1HNZL

Structure of the thermus thermophilus 30s ribosomal subunit in complex with hygromycin b
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit.
pubmed doi rcsb
total genus 15
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2000-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1hnzL00
3I4OA 3HOXG 4POFA 3LGJA 4QGUA 1VQ8A 4DR1L 4APVA 4HIKA 4AH6A 4P74A 3KF8B 1L1OC 3I56A 2PI2E 1ASZA 5C0XI 4LF9Q 1CSQA 3B6YA 2I5MX 3JC66 1NJIC 3H3VH 3GO5A 3PUWA 1Q1EA 4GN5A 5C0XJ 1UE6A 3PGZA 3HOYH 3RZOH 4DPGA 4NPSA 1PVOA 3AFPA 1HNWQ 1HNZL 1J5EL 5JJIA 4DV3L 4BY7H 1D7QA 2R7FA 3CW2C 1PA6A 1WI5A 5GAGC 1VQ6A 1Q7YC 1GKHA 1K9MC 1QVCA 3U58A 3K8AA 3M4QA 3MEFA 5E7NA 2RHQB 2EXDA 1A0IA 5C44H 1X65A 3D31A 3CAMA 3RN5A 3I2ZA 4GOPB 2Z6KA 1GD7A 1OXSC 1AE2A 1YHBA 1Q12A 1JB7A 4LF6L 1VQ5A 2UXBL 3AFQA 1EIYB 4L5TA 1HNXQ 2GVAA 1IBKL 3JAMi 4JYAL 4NXML 1GM5A 2BH8A 2YTYA 2R92H 4DR5Q 2Q2HA 2E5LQ 2VQEL 2ZJRA 5FLMH 1AH9A 3U4ZA 4A3MH 3TS0A 1PH6A 2NVQH 1E24A 5IWAL 2UXBQ 4LF7L 4R4IA 1VQ9A 2JA8G 4JI0Q 1MIUA 3J7A5 1K8GA 3T1YQ 2F4VQ 4P73A 2UXCL 4B3TL 4DK6C 1A8VA 1X9NA 2YU9H 1UE5A 1X6OA 2N8NA 1BVSA 2LXKA 3J7ZC 1G291 2FXQA 4A3KH 1WCMH 2PMZE 2IHEA 1BBWA 4IPHA 1JJCB 2ZJPA 1XPOA 4JI7Q 4C2MH 2JK8A 5C0XG 4LUZA 1V9PA 4X66L 1YJNA 2ASBA 4B3RL 2H5XA 4LFCQ 2OCEA 2R7DA 4DR1Q 5LMNQ 4UP8A 4ME3A 2Q2TA 4L5SA 3S1NH 1PFSA 2AMCB 1E22A 2KCTA 3HFZB 1VS0A 4YCVA 2A8VA 3NELA 2JA6G 4A3FH 4L5QA 4K0KQ 1J5EQ 3UE1A 2B29A 1M90C 2E2HH 3PO3G 3HOVG 2Z0SA 4DR3L 2NZHA 4A3DH 1L1OB 1EQRA 3CC4A 3S16H 3K7AH 4NB3A 4LF9L 4AQYL 3S2DH 4A3JG 3J81c 1GVPA 4IPCA 2Q2IA 5M5YH 4DV4L 4A3IG 1KHIA 5JEAJ 1X56A 3CCQA 4A3BH 2E8GA 1VQGA 3CC7A 3CQZH 2BA0A 2I0QA 3S1MH 3PUVA 1Y1VG 4LF6Q 1K8AC 3I4MH 1L2FA 4GN4B 1XNQQ 4JI6L 4YWMA 4A3CG 4YY3Q 3G71A 3S1RH 1PYBA 4JYAQ 4X6AH 1VQ4A 2IHFA 2ALYB 4GKKQ 5BR8Q 5IP7G 4DUZQ 3STBC 4FDBA 2JE6I 2VQEQ 4A75A 5M3FG 4R4OA 2B63G 1LUZA 1N34Q 4LF7Q 5IYBH 4JI3L 4RG1A 4DR2L 2N49A 3U50C 2NVXH 1RL2A 1VQDA 5C3EG 2RF4A 3ZJYC 4B3TQ 1VQ7A 2MNAA 1VQIA 1HNWL 1L0WA 1B8AA 3H3VI 3J81j 4DR5L 1V43A 1Q46A 2A1AA 3F1ZA 4DV7L 4IFDJ 2JEBI 3GD7A 1C9OA 1B7YB 4KLKA 2C35B 4A93G 2MO1A 2UUBL 1HZ9A 4MTNA 4B3RQ 4X66Q 3KJPA 3PUXA 4EQ5A 4PMWA 5C4XH 1Q8KA 4JI0L 2XTIA 3KLWA 3GTMH 2F4VL 2R93H 4QL5A 1KL9A 3ULLA 2VY3A 3KDFA 3OW2A 3K80C 1WFQA 4LUOA 2VQFQ 1K0RA 3G4SA 4DR6Q 3RLFA 4P72A 3U4VA 3K7UC 1XJVA 2K5HA 1NE3A 2ZJQA 4JI7L 1WYDA 1PH1A 1VQEA 2OQ0A 5JEAG 1EUJA 1KC8C 4DR3Q 4LFCL 4DK3C 3HOXH 5LMNL 4J15A 5FLXc 1E1OA 3L7ZC 1KAWA 4B3SQ 4GKJQ 1KXLA 2PI2A 5M3MG 1A63A 3AYHB 4AQYQ 2PQAB 3CCSA 2KCMA 2V1CC 1VQOA 3M3YH 2EQSA 2DGYA 4GLXA 1KD1C 2AWOA 4DV4Q 3DLLA 4GNXB 3VDYA 4A3EG 1GO3E 3E0EA 4XTCS 5GAHC 1I5FA 5J3BA 5LMNW 4BXXG 4BY1G 5FJ8G 4K0KL 1C7YA 2JJQA 2Q2UA 3F2BA 3NEMA 3I7FA 1VQLA 4JI6Q 3HOWG 4WJ4A 2LXJA 3D0FA 3UDXA 4EX5A 1D8LA 2UU9L 3TEHB 5GADC 4HJ8A 4QY7A 4GNXA 2PNHA 1U0LA 1PH2A 4LFAL 1S3OA 1UEBA 3Q8DA 3PF5A 4JI5Q 3TREA 3DM3A 2KENA 4JOIA 4X65Q 2ZM6Q 1UE1A 2QEXA 1XNRQ 4DAMA 2KHJA 2I5LX 3HOYG 4DR2Q 3CCLA 4JI3Q 1JMCA 2NVTH 1XNQL 5K36G 1X3FA 1Y14B 4YY3L 3CMEA 3KF6B 3NBHB 5ELNA 4OX9Q 3CPWA 5IP9H 4TQUS 1G51A 4BY7G 4KHZA 1R9TH 1NY4A 5BR8L 4DUZL 2IX1A 4GKKL 4OO1I 2VUMH 4NXNL 1FGUA 4A3GH 4DV7Q 3UE0A 3CCVA 4GOPA 3HKZE 1FJGL 3ICEA 2UUBQ 3EBEA 4YWLA 1S40A 1TWCH 3W1GA 2N78A 1TWFH 2LSSA 2HQLA 2JA9A 5GROA 1YI2A 1N34L 3I4NG 3S14H 2UUAQ 1HZBA 5IT9c 3PO2G 3CCMA 1PHJA 2JA8H 5IYCG 4A3LH 1IZ6A 4LF4Q 1U5KA 2K14A 1PH9A 2VNUD 1Q81C 2IY5B 1N33Q 3BZKA 1YZ6A 2JA7H 1OXVA 4X62L 1YHQA 4JI2Q 1XMQL 4DV1Q 1FL0A 1NMFA 3CCUA 4HJ7A 2CKZB 2YV5A 3UDIA 4OWTB 3RZDH 1EYGA 4A3MG 4UY8C 4DR4L 3PF4A 1VQAA 1W2BA 2Y0SE 4LW1A 4PZ8A 3JAMc 4Y52H 3K81C 4YHHL 1Y1WG 4DR6L 2VQFL 4UPAA 3KOJA 1UWVA 3M9BA 4JI4L 3GTGH 3A5UA 3A74A 2HIXA 1YHAA 3J80i 4H02A 3M7NA 4JBJA 1I3QH 1E1TA 3FKIG 1IBLQ 3FP9A 2WFWA 3PO3H 4PZ6A 4GKJL 4OWXB 1HR0L 3OTOQ 4B3SL 2UU9Q 1IXRA 1LYLA 1N36L 1QZGA 4IPGA 3HOZG 1EIFA 1QUQB 1CKMA 1TWHH 1YNXA 2VL6A 4LFAQ 5AJ3Q 3RLOA 3UDGA 1T9HA 4BA2I 1NTGA 3BU2A 1HJPA 4PZ7A 3H0GH 4OO1G 1CKNB 3M85A 2OTLA 4A3FG 1L1OA 2ZTEA 1SRUA 4A4IA 1OTCA 1EWIA 2N3SA 2XGTA 4ALPA 1Y1VH 3ULJA 2HHHL 1KRTA 2VW9A 1MKHA 2F52A 1YJ9A 4AIMA 4NXNQ 1KRSA 4LFBL 2R7ZG 1EOVA 4A3DG 2OTJA 4RMFA 3CPFA 1FJGQ 5IYDH 1JT8A 2Z6KC 1FVIA 4JI5L 1OXUA 1VCIA 1SFOH 1TWAH 3TQYA 4X65L 2ZM6L 1XNRL 4BBSG 4C3IH 1V1QA 1N9WA 2B63H 1JJGA 3T1HL 3M4PA 1K3RA 4OX9L 3I4MG 4YWKA 3L0OA 4JI8L 3UDFA 4GOPC 3RN2A 1PH3A 4IFDI 2CWPA 4GLAC 3BJUA 4L5RC 3FHWA 4X62Q 1IYJB 1Q82C 1XMQQ 3S2HH 2JA5H 4Y7NH 3HOUH 1XPRA 3CCJA 4DR4Q 2UUAL 4JBWA 3RLNA 5IE8A 3L2PA 4YHHQ 5GQOA 5IYBG 2CWAA 4YCUA 4LF4L 1MJCA 4OXPA 4R4QA 2UUCL 1N33L 4JI4Q 2HIVA 4A76A 2K5NA 4JV5L 3GTQH 2R6GA 4JI2L 2L15A 3HKZG 1Z47A 4DV1L 4BBRH 4HIDA 2UXDL 5H1SE 2YTXA 1Q86C 2BH2A 5DLQE 2RHSB 2JQOA 1S72A 1PV4A 4O2DA 1HR0Q 2KHIA 5C4XG 4QJFA 4HIOA 1LM0A 1X54A 2WB1E 1N36Q 3W1BA 5M5WH 4MNOA 3RR5A 1VQJA 3CF5A 5ELOA 4DV0L 1IBMQ 3KYHC 3TRZA 5M3MH 4KI0A 4MZ9A 1X3EA 4JI1Q 1VQBA 4DV2Q 2I5HA 3G48A 1IBLL 1SE8A 4HJ9A 3F8TA 4HIMA 4IOAA 2B3GA 4BY1H 2HHHQ 1G6PA 2PQAA 3K0XA 3HOWH 2Y0SG 2VS1A 3OTOL 4LF8L 1YIJA 3PUZA 4LFBQ 1N32L 1I50H 1Z9FA 3G6EA 2MFIA 5AJ3L 2YYZA 2OQKA 1PH7A 4IPDA 4HJAA 4B3MQ 2AHOB 3F2CA 4IFDG 3S17H 4O0AA 3GTPH 2IX0A 3E9IA 2JEAI 3T1HQ 1LTLA 3CMAA 2F3IA 4DV5Q 1AE3A 1NMGA 3BZCA 3IRBA 4JI8Q 1XTDA 4LF5Q 2CFMA 3STBD 4R4CA 4P75A 2DUDA 3CC2A 2NVYH 2HT1A 1J6QA 4X64Q 4IO9A 3E9HA 4OWWB 1M1KC 3KF6A 5C44G 1SR3A 3I4NH 3PO2H 1Q1BA 2MQHA 4DR7L 4HJ5A 4R1JA 5IY0A 1P16A 3HKSA 5IYCH 2UUCQ 3CCEA 5IP9G 3ULPA 1XMOQ 1X55A 4GS3A 2R92G 2K52A 4JV5Q 2VUMG 4A3GG 3EIVA 2KBNA 5FLMG 4QQBX 3EN2A 2UXDQ 1YVCA 1NBWA 4GN3B 1VQFA 3CXCA 3AQQA 4PG3A 1SMXA 1KQSA 5LMUQ 3GDEA 1I94Q 3GTOH 1ASYA 1Y1WH 2QA4A 4DKAC 2CCZA 4DV0Q 2ATWA 4A3LG 2ZTDA 3CCRA 5HY6A 1QVFA 4DUYL 4LUVA 4IOCA 2JA6H 2ES2A 5M5XH 1A62A 2WAQG 3NENA 3OYYA 5GAEC 1WCMG 3CP0A 4JG2A 4A3KG 2JA7G 1UE7A 2GN5A 4DAYB 3FKIH 2E2JH 3J81i 2D62A 4QIWE 3S1QH 3HOVH 1E7ZA 1SN8A 2ID0A 4LF8Q 4KHPL 1BBUA 1EQQA 1IBML 4IJHA 3S15H 2WP8J 3A5ZB 4POGA 4BA1I 2RCNA 4IJLA 1I6HH 1W3SA 1N32Q 2VZAA 2OWOA 4JI1L 2K5VA 4A3JH 2GVBA 4YCWA 3HOZH 4A3IH 4DV2L 1YBYA 1TWGH 2K75A 1HR0W 4JCVE 2NZOA 1PH4A 4UP9A 1QZHA 3M4OH 2D0OA 1H95A 2K4KA 4GNXC 4A3CH 1EFWA 1QUQA 2QGQA 1VQKA 1WOCA 4DV6L 1HNZQ 4JBMA 1IL2A 4JBKA 4DV3Q 3ER0A 4JOIC 4TVAB 2WB1G 5IP7H 1K83H 3J80c 1RIPA 1BKBA 1CKNA 4P71A 4DNIA 4LNQA 3TS2A 2YTVA 2R7ZH 4B3ML 2D0PA 2NN6I 1VQMA 3KJOA 5M3FH 1K73C 1JE5A 1CKOA 3ERSX 1C0AA 4BBSH 2E2IH 3A0JA 5C4JH 4A3BG 4WJ3M 3H0GG 4DV5L 3PIOA 4DR7Q 5JJLA 4AYBG 1TXYA 5C3EH 1SROA 1N8RC 1XPUA 4LF5L 3SGIA 1CUKA 3KFUA 2AKWB 4UP7A 2WAQE 1IBKQ 4NXMQ 4X64L 3PCOB 3I55A 3PUYA 5IYDG 3H15A 4A93H 1HH2P 2AWNA 1CSPA 2IT1A 1PYSB 4OONA 1QVGA 1KIXA 3PSIA 1SLJA 5IWAQ 1WJJA 2MO0A 2ZTCA 1OXXK 3GTKH 4GLVB 5HGQA 4C3HH 1HZCA 1XMOL 5EAYA 4DUYQ 1HNXL 2UXCQ 3F2DA 2BA1A 2K50A 1YEZA 4JC0A 1JJ2A 2E5LL 1X3GA 3GTLH 3GTJH 3KDFB 2JA5G 3HOUG 1OXTA 4R4TA 1YITA 1YJWA 1PH5A 5LMUL 4KHPQ 1DGSA 1P8LA 2EIFA 1I94L 3S24A 1PH8A 1MJEA 2R93G 5JJKA 3T1YL 1B70B 3MXNB 4XIGS 4LWCA 2CQOA 3AEVA 3CD6A 3PIPA 3WWVA 1VQPA 4A3EH 1O7IA 1VQNA 4AYBE 1VQCA 1VQHA 1HZAA 3W5OA 5FJ8H 4BXXH 4BBRG 3PV0A 2NN6G 4C3JH 1E3PA 3RNUA 2A19A 4DV6Q
chains in the Genus database with same CATH superfamily
4POFA 3LGJA 4APVA 1EYAA 4HIKA 2EOTA 4FF2A 5KNBA 1L1OC 2EY5A 5C0XI 1CSQA 2F0TA 3B6YA 5DM63 3R8BA 3GO5A 1Q1EA 3RZOH 3HOYH 2JA5B 2A68C 3HOUB 4NPSA 1HNZL 4NP5A 4DV3L 2R93B 2K1BA 1WI5A 4CJ0B 3K8AA 3M4YA 4DF7A 3M4QA 3MEFA 1A0IA 4PV1C 5LL6X 2EXZA 3D31A 3EJIA 3RN5A 1DONA 1AE2A 4QCLA 3AFQA 4K5VA 2SOBA 1AZPA 1EIYB 1HNXQ 4JYAL 4RCNA 4NXML 2K04A 1IW7C 2BE5C 2YTYA 4V190 2C9OA 2Q2HA 1EY6A 1TR5A 2E5LQ 1AH9A 1W6KA 4XYQA 4PNYA 1EL0A 2F0SA 3U4ZA 4DNTB 1STGA 4B9WA 4CKEA 2PMZB 2RDHA 1VQ9A 1NAPA 1DYQA 3TN2A 2JXMB 2IW3A 2Z9HA 3F2UA 3T1YQ 1K8GA 2F4VQ 4QUCA 4DK6C 3BZDB 2XRQD 3J7ZC 1BVSA 1MGSA 4L63B 4IPHA 1STBA 1XPOA 4FXDA 1JQYD 4B3RL 1ML0D 4LUZA 3PIO3 1IL8A 4DR1Q 1D5ZC 1B9NA 5LMNQ 2F0MA 4ME3A 3S1NH 1PFSA 1EEID 2AMCB 3K5NA 1QJOA 2EPBA 3SE0A 5C3XA 4A3FH 3S17B 4KKUA 3S14B 3IL8A 3EVQA 3UE1A 2B29A 2E2HH 2HCCA 4DR3L 1B9MA 2NZHA 1QOHA 4P2CB 1H9SB 4RAUC 4A3DH 4EGVA 5DEHA 2NBFA 5NUCA 4LF9L 1WTQA 1GVPA 5M5YH 3RD4A 3KLRA 1DD2A 1KHIA 3I72A 3X3MA 4A3BH 3CC7A 2L9HA 1AFPA 1XNQQ 4YWMA 1BOSA 3OMCA 2MP1A 1PRTC 2IHFA 2ALYB 4CJ2C 4DUZQ 2VQEQ 2JA6B 1RKNA 5JAVA 2QDBA 4J8QA 2B63G 3I90A 2KJXA 4LF7Q 4JI3L 5C3EG 3ZJYC 4B3TQ 1VQ7A 5IOCA 3P75A 1QILA 2K6AA 1V43A 4RA8A 4A3JB 3MC0B 1B7YB 1M4VA 5I6YA 4A3IB 1PLFA 3I8ZA 4X66Q 3KJPA 3PUXA 3T13A 5C4XH 3HZXA 1Y1VB 4QL5A 2PW5A 3KDFA 3OW2A 1WFQA 2VQFQ 1K0RA 4KK7A 3G4SA 4IUNA 3U4VA 2K5HA 4JI7L 4C3IB 4KKSA 5FKAC 3O13A 5C4JB 1F9SA 1ICFB 3OPOA 5JEAG 1S5CD 4J15A 1KAWA 3L9AX 4AQYQ 2EJMA 2KCMA 4GLXA 1KD1C 4DV4Q 4GNXB 3TDQA 2XSCA 3E0EA 1I5FA 5J3BA 4BXXG 5FJ8G 1VF7A 1C7YA 4ABNA 4JI6Q 1ZXTA 3OWEB 3UDXA 2UU9L 4DU9A 5JPNC 5KGUA 1CTMA 1PH2A 4LFAL 1SDFA 1IKMA 1PRTF 3X3NA 4JOIA 1UE1A 5DM73 4DAMA 4DR2Q 3CCLA 2NVTH 4YY3L 2F3VA 3NBHB 5EPLA 3CPWA 5IP9H 4BY7G 4KHZA 1R9TH 5BR8L 5M3MB 4A3GH 2R3ZA 1FGUA 4NXNL 1F77A 2PZUA 1FJGL 5C5LA 2JSOA 4YWLA 1S40A 1TWCH 2N78A 1TWFH 3I4NG 1HZBA 5E4XA 3HOWB 3NTHA 2IY5B 1U5KA 2K14A 1PH9A 3KK7A 4HCSA 3BZKA 3SR1A 1YZ6A 3K6OA 1QNUA 2JA7H 1YHQA 4JI2Q 4FVMA 2F3WA 1EYGA 1H9MA 1KDCA 3W2DA 3Q6SA 5IODA 3BYTB 4PZ8A 4YHHL 1HTLD 5IGEA 3A5UA 4ZK9B 2J0TD 2SDFA 4JBJA 1I3QH 3PO2B 3FP9A 2PZWA 3CRKC 2LKVA 4GKJL 1IYVA 4KY5A 1LYLA 1N36L 1QZGA 1QUQB 4M8AA 3UDGA 3A56A 4H0LC 4KD3A 5LL6S 1HJPA 1KABA 1CM9A 5BN3A 1WTRA 3ULJA 1KRTA 1YNJD 5CYUA 1Y1WB 1MKHA 2F52A 3OIQA 4OIJA 1A2TA 2R7ZG 4RMFA 1DM0B 1FVIA 4JI5L 1VCIA 1SFOH 1LTAD 4X65L 1XNRL 2ZM6L 1V1QA 1WD0A 2G9DA 3HS0C 4OX9L 3L0OA 2O2LD 4ODGA 4GOPC 1PH3A 2XVSA 3H91A 3HOZB 2CHBD 2B2VC 1MD2D 2JA5H 1I6VC 3HOUH 3CCJA 5ELFA 4JBWA 5EKIA 4BS9A 5IE8A 2EYHA 3K5LA 3K5OA 2ZT9C 1VMPA 4YCUA 2O5IC 5TSSA 4LF4L 2UUCL 4EQNA 2HIVA 3ND9A 1KNAA 4ME5A 2HDMA 3BVZA 3GV3A 4DV1L 1Z47A 4HIDA 2UXDL 2YTXA 1J8IA 2QCPX 2EJFC 2RHSB 2MJ8A 5C6AA 3MEHA 3CHBD 3FMCA 1S5FD 2WB1E 1Z7TA 3CF5A 1GXDC 1VQJA 2ENBA 5CMDA 4MZ9A 1X3EA 2I5HA 3PQIA 3L3OC 4ZUJA 2B3GA 5IT9E 1HQMC 4BY1H 2PQAA 3Q23A 1K3BC 1G2SA 2PCFB 1Z9FA 1N32L 1STEA 1ESRA 2KQ3A 3F2CA 4IN3A 2D9UA 4JVZA 1AE3A 2RKSA 4JI8Q 3GTMB 2A6ED 4R4CA 1SNPA 4J6HA 4P75A 2DUDA 3CC2A 2I07B 4X64Q 1STAA 3J81L 5IGCA 3NE5B 3KF6A 1ICWA 3ITPA 4OHJA 4C3JB 3GP7A 1P16A 5IYCH 1YNND 2HD3A 2R92G 3N6RA 3EIVA 5FLMG 5I9PA 2QW7A 3RZOB 5C0XH 1STNA 1QG7A 1SMXA 5LMUQ 1SNMA 4QIWB 4DKAC 2CCZA 4DV0Q 2F0HA 3R93A 4KN4C 1SYCA 3MXUA 5EKKA 2JA6H 3TP7A 1IHZA 3OYYA 4UAIA 3WDNA 1UE7A 3FRPB 1JOKA 2CW0D 4KD4A 3HOVH 3R2IA 1E7ZA 1BBUA 1EQQA 1IBML 3NHHA 2WP8J 3A5ZB 4POGA 2RCNA 4IJLA 1W3SA 1DOKA 2OWOA 4JI1L 4A3JH 3SK5A 4G7ZC 1WVLA 4A3IH 2K75A 3DEOA 2VXWA 4OO1H 1PH4A 4ID6A 1QZHA 4A3CH 1B50A 1EFWA 1HNZQ 4DV6L 1IL2A 4JBKA 4DV3Q 5FLXL 3ER0A 4JOIC 3J80c 1RIPA 4DNIA 1EWCA 2NN6I 1VQMA 2RSOA 1K73C 2E2IH 5C4JH 3RZDB 3VYSA 1LTTD 4DR7Q 5JJLA 2BE5D 3WOFA 1XPUA 1CUKA 1NUCA 4IUPA 4NXMQ 3OMGA 5IGFA 3I55A 3PUYA 2IT1A 3MA2B 4LAAA 4OONA 3PIP3 2E2HB 1CI3M 1SLJA 1LTID 2MO0A 1OXXK 2WB1B 3BVGA 4ZRZA 1XMOL 4DUYQ 3ND8A 2Z4IA 2K50A 1YEZA 2CH4A 1LO5D 5M5YB 3GTLH 1TS4A 2QDLA 3E0JA 4A3BB 3H0GB 4R4TA 1YITA 1PH5A 1DGSA 1QNKA 1I94L 2NTSA 1D2BA 1MJEA 1EY5A 1SNCA 4NW2A 3NBIA 3MXNB 3PIPA 1GHJA 1VQPA 1PTOD 3OWFA 1O7IA 4AYBE 1VQCA 1VQHA 3W5OA 5D14A 1S5ED 4RHRA 5CV6A 3PV0A 1FNWA 1SAPA 3JAML 3RNUA 2P5ZX 1ONLA 3HOXG 3OIPA 4OEMB 2FHTA 4QGUA 4AH6A 4P74A 3I56A 2EDGA 1F2YA 4LF9Q 1ET6A 1UNSA 3JC66 2I5MX 4DAVA 1NJIC 3PGZA 4Y7NB 4ILWA 5JJIA 3HG9A 3SK8A 2HDLA 1YNJC 3U58A 2WINB 2DN8A 5E7NA 2NUCA 2C5CA 2EXDA 1SYDA 1X65A 3I2ZA 1GD7A 2Z6KA 1YHBA 1Q12A 1VQ5A 1TS2A 4L5TA 4KTAA 3LX0A 2LMCB 4FO2A 1B3AA 1SE2A 1PH6A 2B8GA 1E24A 2KOLA 2JA8G 1KAAA 5FOBB 2FXQA 2XWBB 1WCMH 2PMZE 2IHEA 1BBWA 1JJCB 4JI7Q 4C2MH 1YJNA 1V9PA 5EKLA 2H5XA 2AQ3B 3DWAA 3HEJA 1R9TB 2Z6BA 4DAYA 4L5SA 2F0OA 2I46A 4YCVA 1NNXA 3HFZB 3NELA 1HCZA 2IWHA 2QEJC 1SE3A 1TWFB 4L5QA 3J7AF 1D5XC 1J5EQ 4XQJA 3PO3G 1CHPD 2ZXPA 3NWTA 1L1OB 1H9RA 3CC4A 4PMCA 3HGBA 3K7AH 4NB3A 3G7LA 2JA7B 3J81c 4IPCA 4RKLA 3T16A 1GUWA 5JEAJ 1X56A 4WORA 1A6XA 4BWGB 2BA0A 2I0QA 4LF6Q 2UXBQ 1K8AC 2Z1CA 1TKWB 4YY3Q 3S1RH 1PYBA 4X6AH 3URYA 1VQ4A 4CDDC 3D6WA 5BR8Q 2A6EC 1DXMA 2MGSA 1I3QB 2XNAC 3IFDA 5M5XB 1STHA 2BOSA 5IYBH 4RG1A 1TS3A 1EQVA 5IGBA 2RF4A 4K2LA 2EYJA 4RCOA 4X3KA 4CDEC 1L0WA 1YNNC 1ET9A 4IFDJ 3SVMA 1C9OA 4KLKA 2C35B 4A93G 2UUBL 3H3VC 1Q8KA 3M4OB 4JI0L 2XTIA 3KLWA 3GTMH 1HRJA 1NR4A 3ULLA 4UHVA 4P72A 2F0JA 2B2TA 3K7UC 1SFOB 1M8AA 5M3FB 4I65A 4X3TA 2OQ0A 3J7AV 3MTSA 4LFCL 4DK3C 2CW0C 5HURA 1X32A 4GKJQ 5FLXc 1BCPD 1E1OA 4Q0FA 2F1MA 1JC7A 1VQOA 1TU2B 2V1CC 2DGYA 4A3EG 1QB5D 4N8FA 4XTCS 5J1ZA 5JVH3 2EY2A 5LMNW 4K0KL 1RHPA 1V1PA 3KF8A 3P1HA 4IZ8A 4JW0A 3NEMA 3I7FA 3F2BA 1E2WA 2DNCA 1Y8OB 3D0FA 2K32A 5EBCA 4EX5A 5GADC 1B2TA 4QY7A 2ICIA 4GNXA 1U0LA 4ZKCB 1S3OA 3Q8DA 4CKBA 4JI5Q 3DM3A 4HAEA 4X65Q 1XNRQ 2ZM6Q 3DUZA 1Q90A 2KHJA 4KY7A 3HOYG 1Y14B 3CMEA 5CV9A 4IUTA 1HNWQ 1PRTB 3QG1A 4OX9Q 4TQUS 4GKKL 1NY4A 4OO1I 4DV7Q 4GOPA 3HKZE 5CGKA 3ICEA 4C1NK 2Q8IB 2JA9A 2WKCA 1N34L 4BY1B 2B2VA 4G4KA 3TZUA 4DK0A 1JWMD 2MHVA 2QKIC 4ZAIA 5M9OA 4LF4Q 4KN7C 5CBAE 1GJXA 1JORA 1OXVA 4X62L 3TBIB 4K8JA 5D65A 1FL0A 1NMFA 3EROA 2F0LA 4DV1Q 2RSNA 1T5XD 4HJ7A 3RZDH 1HHVA 3PF4A 1VQAA 2ZXRA 2M2LA 4LW1A 5EPJA 3JAMc 1W2BA 4Y52H 4X3UA 4RGOS 1U9RA 3BDOA 1UWVA 1D6EC 1TIID 1UEAB 1E1TA 1PTOC 3FKIG 4FF3A 1TT2A 3DXJC 2A6HD 1FD7D 2WFWA 4L8JA 1L0XB 4OWXB 2XRSD 5AFWA 2K28A 1IXRA 5A35A 3D4WA 1BO0A 1EIFA 1CKMA 1MSGA 3RLOA 2EE1A 3H0GH 1CKNB 4ZKBB 3M85A 3OSOA 4TSSA 4A3FG 4A3MB 2HHHL 2F4IA 2ZXOA 1SYBA 3LWEA 4A3DG 1EOVA 1S5BD 2Z6KC 1E0BA 4BBSG 2B2WA 5E4WC 2B63H 3HOVB 3T1HL 5D3IB 2FMCA 1BNZA 4YWKA 2WACA 1NSNS 1Y8NB 3FHWA 1JWUD 1LV9A 1XMQQ 2RVLA 4Y7NH 1V1OA 1XPRA 1C48A 1F9PA 1LTRD 1KDAA 4DR4Q 2UUAL 3RLNA 4N9TA 3P20A 1Q8IA 4JI4Q 3NK9A 1X3PA 5CR3A 4A76A 4JV5L 3GTQH 1CZWA 1EFID 1XTCD 2R6GA 3S2DB 1WTWA 4BBRH 2E2IB 5H1SE 2NN6H 1SYEA 2Q8TA 4LK1C 3QOLA 1HR0Q 1Y8PB 2KHIA 5C4XG 4QJFA 3I4MB 1PTOF 1CQVA 3BS1A 1IBMQ 4R9WA 5ELOA 3J7YW 3KYHC 3LNNA 4KI0A 3CRLC 4JI1Q 3DWQA 1VQBA 4RGMA 5K5PA 1QE6A 5E3FA 1SNQA 4HIMA 4MHEA 4F7XA 3N52A 1GUTA 2Y0SG 3OTOL 4LF8L 2NVXB 1SYGA 3PUZA 3A7AB 4LFBQ 1HTPA 5AJ3L 1PH7A 3VR2A 4HJAA 2FMMA 2AHOB 1C8CA 4IFDG 3HKZB 3GTLB 2OF1A 3C2PA 2B2YA 3GTPH 3E9IA 1LTLA 3CMAA 4M1UB 4RHSA 1TVXA 3J80L 2KVMA 2ICEC 5IIFA 2CFMA 4KJNA 3STBD 2DNEA 4OWWB 4DA2A 3IAYA 5C44G 3KUPA 1SR3A 5KNDA 3I4NH 4HJ5A 3KLSX 1BXTA 3EFXD 3HKSA 1V8QA 5IP9G 1A3UA 1XMOQ 1X55A 2K52A 4A3GG 5ISRA 4EQOA 4Z9CB 3M3YB 2LS01 1YVCA 1IKLA 4U673 5A2QL 3CXCA 2Q8RE 4F87A 2HQEA 2B2TC 1I94Q 2ATWA 5HY6A 4HEDA 1TQOA 2ES2A 5M5XH 3NENA 1A15A 4A3KG 2JA7G 5CV8A 3CP0A 1DJRD 2GN5A 2NWGA 3MFGA 4QIWE 1LLRD 4IURA 1SN8A 2ID0A 4KHPL 2EYFA 1II3A 4BA1I 1SSOA 1BCPC 3EA6A 4YCWA 1PFNA 2VUMB 4DV2L 2A69D 1YBYA 4RWSC 4JCVE 4UP9A 3BVMA 4QF4A 3M4OH 1H95A 4GNXC 3I91A 3IKJA 4UDUC 1WOCA 4JBMA 3FVQA 4OL7A 4TVAB 5IP7H 1K83H 5F2DA 3TS2A 1BKBA 4P71A 4RGNA 1OO9B 2R7ZH 4B3ML 5CV7A 4XT3B 5C4ZA 3KJOA 1B53A 5M3FH 1EIHA 3ERSX 1WCMB 2CQAA 4C2MB 4DV5L 4AYBG 1SROA 4LF5L 3VR3A 3KFUA 4EVOA 4UP7A 2WAQE 2NB0A 2DY8A 4IUQA 3AMUA 1CSPA 1QVGA 1PYSB 2VB2X 2B2UA 5JJZA 3KBGA 1WJJA 2J4XA 2ZTCA 3OW7A 4N8X1 4C3HH 5HGQA 1HNXL 1RD9D 3K7AB 4DXFA 3F2DA 3P7JA 1JJ2A 4JC0A 2E5LL 1I4RA 1X3GA 4JPBW 4CGYB 3GTJH 3KDFB 1WTOA 2JA5G 3HOUG 2EIFA 1LTBD 3GQBA 1PH8A 3S1RB 2R93G 1RCVD 4YIJA 2F0FA 4E6IA 4FXKC 3T1YL 1I4XA 3KBXA 4LWCA 1PXUA 1VQNA 1D1KA 1HZAA 1TWAB 1BCPF 1EYCA 3S9WA 4FXGC 1R4PB 2A6HC 5I9OA 1VQ8A 5KNCA 4DR1L 1MHWC 2WIIB 5G3LD 2PI2E 1ASZA 4XYOA 4TRDA 2JP1A 5EPKA 3PUWA 4GN5A 1UE6A 1PVOA 3AFPA 4RH6A 3RUZA 5K36H 3DHQA 3CW2C 2B2WC 1PA6A 5GAGC 2F0UA 1K9MC 1HQRD 1QVCA 1SBBB 4HN7A 5BN4A 2F0WA 1S5DD 3NXWA 1SEBD 2E2DC 1NCVA 1XX8A 2AQ2B 1TY2A 1RTNA 2GVAA 4KY6A 1IBKL 3OHXC 2R92H 2VQEL 2ZJRA 5FLMH 1XYIA 4A3MH 5D3DA 3TS0A 4LF7L 4R4IA 4JI0Q 1MIUA 3J7A5 3J80E 4P73A 2UXCL 4B3TL 2KCCA 1X9NA 2YU9H 1SMYD 2LXKA 1G291 2ZJPA 5C0XG 2ASBA 4X66L 2G5DA 2WV6D 4LFCQ 2R7DA 2H1EA 1F2LA 3NWSA 4K5XA 3V2TA 1VS0A 2JA6G 4K0KQ 3ERQA 5A2QE 1M90C 1G91A 3HOVG 3E5SA 3I73A 2B2YC 3VR5A 2E76C 1XWEA 3S16H 2LY7A 5EBDA 3Q0AA 2WAQB 2H4OA 4AQYL 3S2DH 4A3JG 3QO2A 2Q2IA 4A3IG 3QWNA 4DV4L 2PYKA 2DY7A 1STYA 1U4RA 2E8GA 3CQZH 3W3AA 3PUVA 1Y1VG 3I4MH 4A3CG 2F0IA 1L2FA 4GN4B 1PZJD 4JI6L 1TY0A 4JYAQ 4GKKQ 2K03A 2SEBD 3STBC 4FDBA 1A3TA 3MZ5A 1TS5A 4R4OA 4C3IG 4R8NA 1N34Q 2E2JB 4DR2L 1WTHA 2N49A 3U50C 2NVXH 1RL2A 1VQDA 1HPCA 2QF7A 2MNAA 1VQIA 1BBXC 1O80A 3S15B 5KEEA 1EY8A 3H3VI 1B8AA 4DR5L 1J9OA 1EOTA 3NPPA 3F1ZA 1EEFD 4KJOA 3GD7A 2MO1A 1HZ9A 4MTNA 4B3RQ 5FO9B 3AU7A 5CV4A 1NR2A 4PMWA 3BDCA 3WOEA 2AUJD 1DCZA 2VY3A 4V0BA 4LUOA 4DN4M 1SNDA 3RLFA 4ZQ3A 3I3CA 1XJVA 1X3QA 3UI2A 1NE3A 2ZJQA 1K0SA 2B63B 3DMUA 4IQZA 4DR3Q 5C3EB 3HOXH 1MSHA 1KXLA 3L7ZC 5M3MG 1A63A 4R8IA 2PQAB 2BDNA 1U4MA 3M3YH 1JCKB 2OXPA 5JOBA 1EY7A 1GO3E 4H7BA 4K8IA 2A69C 1R4QB 4O1NA 2JJQA 4WJ4A 1VQLA 3HOWG 1D8LA 1PFMA 5ELCA 4NKLA 3TEHB 4HJ8A 1G6ZA 2PNHA 2L4NA 3GTQB 1UEBA 2KECA 4BBRB 4I7ZC 2I5LX 3K59A 2K5QA 1CK1A 4JI3Q 4LMQD 1A3VA 1X3FA 3R2TA 3KF6B 4TKOB 2IX1A 1PFBA 2B2UC 4RFBA 2L55A 2VUMH 4OELB 5I2YA 3UE0A 3CCVA 3MXPA 2LSSA 5GROA 2HQLA 1G6PA 3PO2G 2UUAQ 1PHJA 2JA8H 4A3LH 1IZ6A 1Q81C 2Z4HA 1LACA 1I4HA 3J81E 4KV6A 4DGZA 2JN4A 5ELEA 3GTPB 3CCUA 2CKZB 2YV5A 4HR7B 3UDIA 2HUGA 4UY8C 1EIGA 3MHBA 2A5HA 1Y1WG 4QB4A 1C4QA 4BY7B 5EJWA 4DR6L 5COYA 3TP8A 3M9BA 2A73B 3J80i 4H02A 2EJGC 3M7NA 3VR6A 1G2TA 3I4NB 2KCNA 5CORA 2PW7A 2RQXA 3VA7A 3PO3H 1GUOA 4B3SL 3OTOQ 2UU9Q 4CDFC 3HOZG 4LFAQ 5AJ3Q 1TWHH 2E75C 3K5MA 1T9HA 1AEXA 4PZ7A 1H9SA 4HTHA 2MPMA 1SRUA 4A4IA 4G57A 4ALPA 1Q3LA 2VW9A 1YJ9A 2O4XA 4AIMA 4NXNQ 1KRSA 1F2MA 2OTJA 1PZKD 1FJGQ 5IYDH 2SNSA 2IL8A 1TWAH 4GZYC 1HFGA 2X6GA 5FLXE 4JI8L 3NSWA 3UDFA 3HRZC 3RN2A 1EY0A 2CWPA 1KNEA 4GLAC 3BJUA 4HMJA 5EGTA 2EYOA 1HA6A 3K57A 4YHHQ 1O7LA 5IYBG 1K28A 2CWAA 3T56B 2IX3A 2N88A 1K83B 3NQIA 4CKCA 3NTIA 1N33L 2R7ZB 2K5NA 1RF2D 2L15A 2QILA 1SMYC 4K2KA 1CA6A 2BH2A 5DLQE 4XXEA 2JQOA 1S72A 3V05A 1PV4A 3H09A 4HIOA 1LM0A 1X54A 1PZID 1N36Q 5M5WH 4MNOA 3RR5A 3TRZA 4DV0L 5T1IA 3H6MA 1FR3A 2EZVA 1K8OA 2G9HD 4DV2Q 1SNOA 1IBLL 2VB3X 1MI2A 1SE8A 4HJ9A 3F8TA 4C3JG 1O7YA 5G3LF 2VS1A 1YIJA 4C3HB 1EY9A 1O78A 3G6EA 3FEWX 2MFIA 2OQKA 4HSPA 4B3MQ 4O0AA 2EYPA 3GTJB 1FYCA 2IX0A 4QMGA 1EY4A 2TSSA 3JAME 4DV5Q 3BZCA 2DJFC 1Z6HA 4LF5Q 3VYTA 1RJTA 4I7AA 2NVYH 1J6QA 4IO9A 1M1KC 3NBHA 2NYZD 1LT4D 3DEPA 3VR4A 4DR7L 5IGGA 1ENFA 4R1JA 5IY0A 5KRUA 2UUCQ 3CCEA 4GS3A 3BG3A 2TMPA 4QQBX 2UXDQ 1NBWA 1VQFA 5DAUA 2MUYA 4PG3A 1AP0A 4DAPA 3GTOH 1ASYA 3NQTA 2EVBA 1E2ZA 3SXHA 3CCRA 5CC4A 4DUYL 1PYWD 2KEDA 2WAQG 5GAEC 4JG2A 1ZYRC 3CKIB 1WTXA 4DAYB 3FKIH 2E2JH 3QJYA 2D62A 1K8MA 3J81i 1HUMA 3S1QH 3A54A 4LJZC 4PQXA 5DNFA 4IJHA 1H9KA 3S15H 1N32Q 1I6HH 2K5VA 2R92B 3DM1A 1U4LA 1HR0W 3TP6A 2D0OA 3FPUB 1F9RA 1QUQA 2QGQA 2R61A 2WB1G 3K58A 1WD1A 4LNQA 1CA5A 2YU9B 2YTVA 1HUNA 2D0PA 4K5WA 4BBSH 3ZYYX 3A0JA 4A3BG 4WJ3M 3H0GG 3PIOA 5C3EH 3SGIA 1F9QA 1B1ZA 4G7OC 1IBKQ 1ILPA 1SXTA 1CFMA 3H94A 3H15A 3GTGB 2BDOA 1KIXA 5FK9C 2F0DA 3PSIA 2RDFA 3TSSA 3GTKH 4GLVB 3S16B 2UXCQ 5IGDA 1D5MC 1EU3A 3NTKA 1ZKOA 5JEAH 1YJWA 3CQZB 5IT9L 3MWYW 3S24A 1QCBD 3CD6A 1EQTA 1DOLA 2CQOA 3AEVA 1DOMA 4BXXH 5FJ8H 4BBRG 2NN6G 2A19A 4DV6Q 2V4DA 3I4OA 4IUVA 3SEBA 1BF4A 1VF5C 1V1PB 1BCPB 3KF8B 1BUVT 2L0CA 3H3VH 4IFDH 4CBVA 5C0XJ 4L6TB 3S2HB 1I4QA 4DPGA 4ZUIA 4ZLTF 2KA7A 3TZDA 1J5EL 2M9VA 4BY7H 1D7QA 2R7FA 1E2VA 1VQ6A 2PZTA 1GKHA 1Q7YC 2PPBC 5C4HA 2RHQB 4NMZA 2O5JC 2SNMA 5C44H 4FP5D 3CAMA 1SJED 4GOPB 1OXSC 1JB7A 4LF6L 3HOXB 2UXBL 1Y69U 3E3XA 5EQ0A 5FO7B 3JAMi 1GM5A 1FNVA 2BH8A 1JWSD 2B8FA 4DR5Q 3AB9A 1I4PA 3D4DA 1L0YB 4NDXA 4HCEA 2NVQH 5IWAL 3C1FA 1A8VA 1I50B 1RTOA 1UE5A 1X6OA 1XXGA 2J7ZA 2N8NA 4A3KH 2JK8A 4FYDA 1ENCA 4PMBA 2OCEA 1PDQA 3RMHA 4DFAA 5LHY1 4UP8A 2Q2TA 1JOOA 5FO8B 2KCTA 1E22A 2X69A 2A8VA 3LWUA 5C3WA 1S4ZA 4WRDA 3QR8A 2E74C 2Z0SA 2BCOA 1EYDA 3C1EA 2JA8B 2EYMA 5C5MA 3Q22A 1EQRA 2N55A 3CCQA 1VQGA 3I4LA 3S1MH 3MAQA 5I4DA 3G71A 1DZ1A 1W6JA 2L12A 3SK6A 5IP7G 2JE6I 4RKBA 1PTOH 4A75A 5M3FG 1LUZA 4U68A 3PO3B 1CQFA 1ESFA 1GUGA 1HNWL 4ZCKA 3J81j 1TWHB 1Q46A 2A1AA 4DV7L 2JEBI 1KLUD 1TWGB 4EQ5A 1JE4A 1FGBD 2F4VL 2R93H 1JICA 4ZYSA 4EQPA 1KL9A 2F0PA 2L11A 3CU7A 3PMFA 4B08A 3K80C 4S3SA 4C3HG 4DR6Q 4O42A 1H9JA 2K5DA 1LT3D 3D3RA 3R3OA 4KMUC 1WYDA 3MFYA 1PH1A 3VYRA 1VQEA 4Q5VA 1LABA 3MXNA 1UAPA 1EUJA 1KC8C 2EY1A 5LMNL 4B3SQ 2NZ1D 1LT6D 1SYFA 1EZ6A 2PI2A 4X3SA 3AYHB 5CBEE 2X6LA 3CCSA 2EQSA 2AWOA 3DLLA 3VDYA 4A93B 5GAHC 1GOZA 4BY1G 2Q2UA 3V96A 1SE4A 5I2XA 5JPMC 2LXJA 4HMIA 5KYIA 2RDGA 3VYUA 1WTPA 2HCIA 3NUCA 3A8JE 3PF5A 3BYYB 3C46A 3TREA 5BN5A 2F0QA 2KENA 4XT1B 3A8KE 2EYLA 2QEXA 4KHVA 4WFN3 2Z8LA 1GUSA 1JMCA 1XNQL 5K36G 1HA5A 4DK1A 5ELNA 5M5WB 1KDBA 1G51A 1KTKA 4DUZL 3QOJA 2FINB 5KIXA 3FPPA 5E1FA 2AQ1B 2K7VA 4G7HC 3MVVA 4A3EB 3EBEA 2UUBQ 3W1GA 3S17H 1YI2A 2FJ2A 2M00A 3K0YA 3T4AC 5IT9c 3S14H 3CCMA 1WTVA 5IYCG 3KLSA 5J22A 2VNUD 2IPKD 3D6CA 1RODA 2L5TA 1N33Q 1ILQA 1XMQL 1I4GA 5ELBA 4OWTB 3HOYB 4A3MG 4DR4L 2RA4A 2Y0SE 5I6WA 3K81C 2F03A 3DWPA 2VQFL 2NVYB 4UPAA 1AZQA 3KOJA 4JI4L 4MN3A 3GTGH 3A74A 2HIXA 1YHAA 4OIKA 2D5DA 1IBLQ 2K5WA 3A7LA 4CDCC 1VMCA 4PZ6A 1HR0L 4WJWA 4IPGA 1YNXA 2VL6A 1BQQT 2A68D 4BA2I 1NTGA 3BU2A 4K6DA 2D2CC 4OO1G 2OTLA 4K6LA 2AUKA 1L1OA 2ZTEA 1OTCA 1EWIA 2N3SA 2XGTA 1Y1VH 4F88A 3GTOB 1B44D 1JB3A 3U9OA 4LFBL 4MIUA 1JT8A 3CPFA 1BR9A 1OXUA 3TQYA 2RBMA 2F0VA 3FKIB 2OEOA 4C3IH 1N9WA 3S1QB 1JJGA 3M4PA 1K3RA 1VDZA 1IW7D 3I4MG 4IFDI 1I6HB 4L5RC 1HXYD 4X62Q 1IYJB 4C56C 3S1NB 2K01A 1Q82C 3S2HH 4FNFA 4A3FB 3L2PA 1CZGA 3QIAA 5GQOA 1UUPA 4FF1A 2PO4A 1MJCA 4OXPA 4K14A 4R4QA 1B4OA 1ZYRD 4A3DB 2XIWA 3T53B 3TMEA 4JI2L 3HKZG 4BBSB 2LFNA 2NTTA 1Q86C 3FDTA 2XN9C 4O2DA 1PMRA 4ULLA 3W1BA 4CJ1B 3I70A 5M3MH 2CVRA 3OOCA 3G48A 1RDPD 1O7ZA 4IOAA 3HP3A 2HHHQ 3K0XA 2F0GA 3HOWH 4H13C 3GTKB 1BDOA 3QB3A 1I50H 3SHLA 2YYZA 2FFKB 4IPDA 1GHKA 1F2ZA 2JEAI 2PQEA 3T1HQ 1JOQA 1D1IA 2F3IA 1NMGA 1PRTD 5C4XB 3IRBA 1XTDA 5CV5A 3VA5A 2DJGC 3D8GA 2HT1A 3SK4A 5HGTA 1AW7A 3E9HA 5J39A 1U4PA 2KEEA 3ONAB 3PO2H 1Q1BA 2MQHA 2F0EA 2KHSA 2RCFA 2Y0SB 4KKTA 4XDXA 1HFNA 1LTGD 1EWHA 1KLGD 4J1MA 3E6ZX 3ULPA 4JV5Q 2VUMG 2B39A 2KBNA 3GV6A 3EN2A 4GN3B 3AQQA 4DNRB 1KQSA 5T1GA 3GDEA 1Y1WH 2QA4A 4A3LG 2ZTDA 1QVFA 4LUVA 4IOCA 4N9PA 1A62A 1ZEQX 3Q24A 1WCMG 5C44B 3M7GA 3IFTA 3T51B 2F0NA 4LF8Q 2NVTB 4H44C 4OGQC 3EQLC 2VZAA 4C1NI 4DXGA 2GVBA 1CT1D 1MBYA 3HOZH 4A3GB 2PNRC 4XQQA 1TWGH 1LTSD 2JYOA 1IYUA 1SJHD 2NZOA 2NVQB 1TWCB 2K4KA 3SDZA 2IJ0A 1VQKA 1T5EA 1ENAA 4RGTA 3BDLA 1B3QA 1CKNA 3A55A 2K33A 4A3KB 1JE5A 1CKOA 1C0AA 1A2UA 1EU4A 4XQNA 1TXYA 1N8RC 4FF4A 4IALA 5JVG3 4F8MA 2AKWB 4CHTB 4X64L 1CHQD 3PCOB 5IYDG 4A93H 3D4RA 1HH2P 2AWNA 3G6JB 5KYLA 4JK1C 1AN8A 1G8ZD 5IWAQ 2A74C 4MTKA 2GA4B 1HZCA 2KUMA 5EAYA 2CH4W 4B9XA 2BA1A 5ELDA 1LT5D 1FNUA 4IUUA 2EY6A 1OXTA 1QWYA 1EZ8A 2F0KA 1GUNA 1JR0D 3S1MB 3NP8A 4AYBB 5LMUL 4KHPQ 1P8LA 2OT2A 3C3LA 2XWJB 3U9SA 3MXGA 5JJKA 1B70B 3A8IE 4XIGS 2K05A 3TP5A 3WWVA 1PTOB 4A3EH 2L1BA 5L37A 2WKDA 4QUFA 4HSVA 4C3JH 1E3PA
chains in the Genus database with same CATH topology
3I4OA 3HOXG 4POFA 3LGJA 4QGUA 1VQ8A 4DR1L 4APVA 4HIKA 4AH6A 4P74A 3KF8B 1L1OC 3I56A 2PI2E 1ASZA 5C0XI 4LF9Q 1CSQA 3B6YA 2I5MX 3JC66 1NJIC 3H3VH 3GO5A 3PUWA 1Q1EA 4GN5A 5C0XJ 1UE6A 3PGZA 3HOYH 3RZOH 4DPGA 4NPSA 1PVOA 3AFPA 1HNWQ 1HNZL 1J5EL 5JJIA 4DV3L 4BY7H 1D7QA 2R7FA 3CW2C 1PA6A 1WI5A 5GAGC 1VQ6A 1Q7YC 1GKHA 1K9MC 1QVCA 3U58A 3K8AA 3M4QA 3MEFA 5E7NA 2RHQB 2EXDA 1A0IA 5C44H 1X65A 3D31A 3CAMA 3RN5A 3I2ZA 4GOPB 2Z6KA 1GD7A 1OXSC 1AE2A 1YHBA 1Q12A 1JB7A 4LF6L 1VQ5A 2UXBL 3AFQA 1EIYB 4L5TA 1HNXQ 2GVAA 1IBKL 3JAMi 4JYAL 4NXML 1GM5A 2BH8A 2YTYA 2R92H 4DR5Q 2Q2HA 2E5LQ 2VQEL 2ZJRA 5FLMH 1AH9A 3U4ZA 4A3MH 3TS0A 1PH6A 2NVQH 1E24A 5IWAL 2UXBQ 4LF7L 4R4IA 1VQ9A 2JA8G 4JI0Q 1MIUA 3J7A5 1K8GA 3T1YQ 2F4VQ 4P73A 2UXCL 4B3TL 4DK6C 1A8VA 1X9NA 2YU9H 1UE5A 1X6OA 2N8NA 1BVSA 2LXKA 3J7ZC 1G291 2FXQA 4A3KH 1WCMH 2PMZE 2IHEA 1BBWA 4IPHA 1JJCB 2ZJPA 1XPOA 4JI7Q 4C2MH 2JK8A 5C0XG 4LUZA 1V9PA 4X66L 1YJNA 2ASBA 4B3RL 2H5XA 4LFCQ 2OCEA 2R7DA 4DR1Q 5LMNQ 4UP8A 4ME3A 2Q2TA 4L5SA 3S1NH 1PFSA 2AMCB 1E22A 2KCTA 3HFZB 1VS0A 4YCVA 2A8VA 3NELA 2JA6G 4A3FH 4L5QA 4K0KQ 1J5EQ 3UE1A 2B29A 1M90C 2E2HH 3PO3G 3HOVG 2Z0SA 4DR3L 2NZHA 4A3DH 1L1OB 1EQRA 3CC4A 3S16H 3K7AH 4NB3A 4LF9L 4AQYL 3S2DH 4A3JG 3J81c 1GVPA 4IPCA 2Q2IA 5M5YH 4DV4L 4A3IG 1KHIA 5JEAJ 1X56A 3CCQA 4A3BH 2E8GA 1VQGA 3CC7A 3CQZH 2BA0A 2I0QA 3S1MH 3PUVA 1Y1VG 4LF6Q 1K8AC 3I4MH 1L2FA 4GN4B 1XNQQ 4JI6L 4YWMA 4A3CG 4YY3Q 3G71A 3S1RH 1PYBA 4JYAQ 4X6AH 1VQ4A 2IHFA 2ALYB 4GKKQ 5BR8Q 5IP7G 4DUZQ 3STBC 4FDBA 2JE6I 2VQEQ 4A75A 5M3FG 4R4OA 2B63G 1LUZA 1N34Q 4LF7Q 5IYBH 4JI3L 4RG1A 4DR2L 2N49A 3U50C 2NVXH 1RL2A 1VQDA 5C3EG 2RF4A 3ZJYC 4B3TQ 1VQ7A 2MNAA 1VQIA 1HNWL 1L0WA 1B8AA 3H3VI 3J81j 4DR5L 1V43A 1Q46A 2A1AA 3F1ZA 4DV7L 4IFDJ 2JEBI 3GD7A 1C9OA 1B7YB 4KLKA 2C35B 4A93G 2MO1A 2UUBL 1HZ9A 4MTNA 4B3RQ 4X66Q 3KJPA 3PUXA 4EQ5A 4PMWA 5C4XH 1Q8KA 4JI0L 2XTIA 3KLWA 3GTMH 2F4VL 2R93H 4QL5A 1KL9A 3ULLA 2VY3A 3KDFA 3OW2A 3K80C 1WFQA 4LUOA 2VQFQ 1K0RA 3G4SA 4DR6Q 3RLFA 4P72A 3U4VA 3K7UC 1XJVA 2K5HA 1NE3A 2ZJQA 4JI7L 1WYDA 1PH1A 1VQEA 2OQ0A 5JEAG 1EUJA 1KC8C 4DR3Q 4LFCL 4DK3C 3HOXH 5LMNL 4J15A 5FLXc 1E1OA 3L7ZC 1KAWA 4B3SQ 4GKJQ 1KXLA 2PI2A 5M3MG 1A63A 3AYHB 4AQYQ 2PQAB 3CCSA 2KCMA 2V1CC 1VQOA 3M3YH 2EQSA 2DGYA 4GLXA 1KD1C 2AWOA 4DV4Q 3DLLA 4GNXB 3VDYA 4A3EG 1GO3E 3E0EA 4XTCS 5GAHC 1I5FA 5J3BA 5LMNW 4BXXG 4BY1G 5FJ8G 4K0KL 1C7YA 2JJQA 2Q2UA 3F2BA 3NEMA 3I7FA 1VQLA 4JI6Q 3HOWG 4WJ4A 2LXJA 3D0FA 3UDXA 4EX5A 1D8LA 2UU9L 3TEHB 5GADC 4HJ8A 4QY7A 4GNXA 2PNHA 1U0LA 1PH2A 4LFAL 1S3OA 1UEBA 3Q8DA 3PF5A 4JI5Q 3TREA 3DM3A 2KENA 4JOIA 4X65Q 2ZM6Q 1UE1A 2QEXA 1XNRQ 4DAMA 2KHJA 2I5LX 3HOYG 4DR2Q 3CCLA 4JI3Q 1JMCA 2NVTH 1XNQL 5K36G 1X3FA 1Y14B 4YY3L 3CMEA 3KF6B 3NBHB 5ELNA 4OX9Q 3CPWA 5IP9H 4TQUS 1G51A 4BY7G 4KHZA 1R9TH 1NY4A 5BR8L 4DUZL 2IX1A 4GKKL 4OO1I 2VUMH 4NXNL 1FGUA 4A3GH 4DV7Q 3UE0A 3CCVA 4GOPA 3HKZE 1FJGL 3ICEA 2UUBQ 3EBEA 4YWLA 1S40A 1TWCH 3W1GA 2N78A 1TWFH 2LSSA 2HQLA 2JA9A 5GROA 1YI2A 1N34L 3I4NG 3S14H 2UUAQ 1HZBA 5IT9c 3PO2G 3CCMA 1PHJA 2JA8H 5IYCG 4A3LH 1IZ6A 4LF4Q 1U5KA 2K14A 1PH9A 2VNUD 1Q81C 2IY5B 1N33Q 3BZKA 1YZ6A 2JA7H 1OXVA 4X62L 1YHQA 4JI2Q 1XMQL 4DV1Q 1FL0A 1NMFA 3CCUA 4HJ7A 2CKZB 2YV5A 3UDIA 4OWTB 3RZDH 1EYGA 4A3MG 4UY8C 4DR4L 3PF4A 1VQAA 1W2BA 2Y0SE 4LW1A 4PZ8A 3JAMc 4Y52H 3K81C 4YHHL 1Y1WG 4DR6L 2VQFL 4UPAA 3KOJA 1UWVA 3M9BA 4JI4L 3GTGH 3A5UA 3A74A 2HIXA 1YHAA 3J80i 4H02A 3M7NA 4JBJA 1I3QH 1E1TA 3FKIG 1IBLQ 3FP9A 2WFWA 3PO3H 4PZ6A 4GKJL 4OWXB 1HR0L 3OTOQ 4B3SL 2UU9Q 1IXRA 1LYLA 1N36L 1QZGA 4IPGA 3HOZG 1EIFA 1QUQB 1CKMA 1TWHH 1YNXA 2VL6A 4LFAQ 5AJ3Q 3RLOA 3UDGA 1T9HA 4BA2I 1NTGA 3BU2A 1HJPA 4PZ7A 3H0GH 4OO1G 1CKNB 3M85A 2OTLA 4A3FG 1L1OA 2ZTEA 1SRUA 4A4IA 1OTCA 1EWIA 2N3SA 2XGTA 4ALPA 1Y1VH 3ULJA 2HHHL 1KRTA 2VW9A 1MKHA 2F52A 1YJ9A 4AIMA 4NXNQ 1KRSA 4LFBL 2R7ZG 1EOVA 4A3DG 2OTJA 4RMFA 3CPFA 1FJGQ 5IYDH 1JT8A 2Z6KC 1FVIA 4JI5L 1OXUA 1VCIA 1SFOH 1TWAH 3TQYA 4X65L 2ZM6L 1XNRL 4BBSG 4C3IH 1V1QA 1N9WA 2B63H 1JJGA 3T1HL 3M4PA 1K3RA 4OX9L 3I4MG 4YWKA 3L0OA 4JI8L 3UDFA 4GOPC 3RN2A 1PH3A 4IFDI 2CWPA 4GLAC 3BJUA 4L5RC 3FHWA 4X62Q 1IYJB 1Q82C 1XMQQ 3S2HH 2JA5H 4Y7NH 3HOUH 1XPRA 3CCJA 4DR4Q 2UUAL 4JBWA 3RLNA 5IE8A 3L2PA 4YHHQ 5GQOA 5IYBG 2CWAA 4YCUA 4LF4L 1MJCA 4OXPA 4R4QA 2UUCL 1N33L 4JI4Q 2HIVA 4A76A 2K5NA 4JV5L 3GTQH 2R6GA 4JI2L 2L15A 3HKZG 1Z47A 4DV1L 4BBRH 4HIDA 2UXDL 5H1SE 2YTXA 1Q86C 2BH2A 5DLQE 2RHSB 2JQOA 1S72A 1PV4A 4O2DA 1HR0Q 2KHIA 5C4XG 4QJFA 4HIOA 1LM0A 1X54A 2WB1E 1N36Q 3W1BA 5M5WH 4MNOA 3RR5A 1VQJA 3CF5A 5ELOA 4DV0L 1IBMQ 3KYHC 3TRZA 5M3MH 4KI0A 4MZ9A 1X3EA 4JI1Q 1VQBA 4DV2Q 2I5HA 3G48A 1IBLL 1SE8A 4HJ9A 3F8TA 4HIMA 4IOAA 2B3GA 4BY1H 2HHHQ 1G6PA 2PQAA 3K0XA 3HOWH 2Y0SG 2VS1A 3OTOL 4LF8L 1YIJA 3PUZA 4LFBQ 1N32L 1I50H 1Z9FA 3G6EA 2MFIA 5AJ3L 2YYZA 2OQKA 1PH7A 4IPDA 4HJAA 4B3MQ 2AHOB 3F2CA 4IFDG 3S17H 4O0AA 3GTPH 2IX0A 3E9IA 2JEAI 3T1HQ 1LTLA 3CMAA 2F3IA 4DV5Q 1AE3A 1NMGA 3BZCA 3IRBA 4JI8Q 1XTDA 4LF5Q 2CFMA 3STBD 4R4CA 4P75A 2DUDA 3CC2A 2NVYH 2HT1A 1J6QA 4X64Q 4IO9A 3E9HA 4OWWB 1M1KC 3KF6A 5C44G 1SR3A 3I4NH 3PO2H 1Q1BA 2MQHA 4DR7L 4HJ5A 4R1JA 5IY0A 1P16A 3HKSA 5IYCH 2UUCQ 3CCEA 5IP9G 3ULPA 1XMOQ 1X55A 4GS3A 2R92G 2K52A 4JV5Q 2VUMG 4A3GG 3EIVA 2KBNA 5FLMG 4QQBX 3EN2A 2UXDQ 1YVCA 1NBWA 4GN3B 1VQFA 3CXCA 3AQQA 4PG3A 1SMXA 1KQSA 5LMUQ 3GDEA 1I94Q 3GTOH 1ASYA 1Y1WH 2QA4A 4DKAC 2CCZA 4DV0Q 2ATWA 4A3LG 2ZTDA 3CCRA 5HY6A 1QVFA 4DUYL 4LUVA 4IOCA 2JA6H 2ES2A 5M5XH 1A62A 2WAQG 3NENA 3OYYA 5GAEC 1WCMG 3CP0A 4JG2A 4A3KG 2JA7G 1UE7A 2GN5A 4DAYB 3FKIH 2E2JH 3J81i 2D62A 4QIWE 3S1QH 3HOVH 1E7ZA 1SN8A 2ID0A 4LF8Q 4KHPL 1BBUA 1EQQA 1IBML 4IJHA 3S15H 2WP8J 3A5ZB 4POGA 4BA1I 2RCNA 4IJLA 1I6HH 1W3SA 1N32Q 2VZAA 2OWOA 4JI1L 2K5VA 4A3JH 2GVBA 4YCWA 3HOZH 4A3IH 4DV2L 1YBYA 1TWGH 2K75A 1HR0W 4JCVE 2NZOA 1PH4A 4UP9A 1QZHA 3M4OH 2D0OA 1H95A 2K4KA 4GNXC 4A3CH 1EFWA 1QUQA 2QGQA 1VQKA 1WOCA 4DV6L 1HNZQ 4JBMA 1IL2A 4JBKA 4DV3Q 3ER0A 4JOIC 4TVAB 2WB1G 5IP7H 1K83H 3J80c 1RIPA 1BKBA 1CKNA 4P71A 4DNIA 4LNQA 3TS2A 2YTVA 2R7ZH 4B3ML 2D0PA 2NN6I 1VQMA 3KJOA 5M3FH 1K73C 1JE5A 1CKOA 3ERSX 1C0AA 4BBSH 2E2IH 3A0JA 5C4JH 4A3BG 4WJ3M 3H0GG 4DV5L 3PIOA 4DR7Q 5JJLA 4AYBG 1TXYA 5C3EH 1SROA 1N8RC 1XPUA 4LF5L 3SGIA 1CUKA 3KFUA 2AKWB 4UP7A 2WAQE 1IBKQ 4NXMQ 4X64L 3PCOB 3I55A 3PUYA 5IYDG 3H15A 4A93H 1HH2P 2AWNA 1CSPA 2IT1A 1PYSB 4OONA 1QVGA 1KIXA 3PSIA 1SLJA 5IWAQ 1WJJA 2MO0A 2ZTCA 1OXXK 3GTKH 4GLVB 5HGQA 4C3HH 1HZCA 1XMOL 5EAYA 4DUYQ 1HNXL 2UXCQ 3F2DA 2BA1A 2K50A 1YEZA 4JC0A 1JJ2A 2E5LL 1X3GA 3GTLH 3GTJH 3KDFB 2JA5G 3HOUG 1OXTA 4R4TA 1YITA 1YJWA 1PH5A 5LMUL 4KHPQ 1DGSA 1P8LA 2EIFA 1I94L 3S24A 1PH8A 1MJEA 2R93G 5JJKA 3T1YL 1B70B 3MXNB 4XIGS 4LWCA 2CQOA 3AEVA 3CD6A 3PIPA 3WWVA 1VQPA 4A3EH 1O7IA 1VQNA 4AYBE 1VQCA 1VQHA 1HZAA 3W5OA 5FJ8H 4BXXH 4BBRG 3PV0A 2NN6G 4C3JH 1E3PA 3RNUA 2A19A 4DV6Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4O A;  3HOX G;  4POF A;  3LGJ A;  4QGU A;  1VQ8 A;  4DR1 L;  4APV A;  4HIK A;  4AH6 A;  4P74 A;  3KF8 B;  1L1O C;  3I56 A;  2PI2 E;  1ASZ A;  5C0X I;  4LF9 Q;  1CSQ A;  3B6Y A;  2I5M X;  3JC6 6;  1NJI C;  3H3V H;  3GO5 A;  3PUW A;  1Q1E A;  4GN5 A;  5C0X J;  1UE6 A;  3PGZ A;  3HOY H;  3RZO H;  4DPG A;  4NPS A;  1PVO A;  3AFP A;  1HNW Q;  1HNZ L;  1J5E L;  5JJI A;  4DV3 L;  4BY7 H;  1D7Q A;  2R7F A;  3CW2 C;  1PA6 A;  1WI5 A;  5GAG C;  1VQ6 A;  1Q7Y C;  1GKH A;  1K9M C;  1QVC A;  3U58 A;  3K8A A;  3M4Q A;  3MEF A;  5E7N A;  2RHQ B;  2EXD A;  1A0I A;  5C44 H;  1X65 A;  3D31 A;  3CAM A;  3RN5 A;  3I2Z A;  4GOP B;  2Z6K A;  1GD7 A;  1OXS C;  1AE2 A;  1YHB A;  1Q12 A;  1JB7 A;  4LF6 L;  1VQ5 A;  2UXB L;  3AFQ A;  1EIY B;  4L5T A;  1HNX Q;  2GVA A;  1IBK L;  3JAM i;  4JYA L;  4NXM L;  1GM5 A;  2BH8 A;  2YTY A;  2R92 H;  4DR5 Q;  2Q2H A;  2E5L Q;  2VQE L;  2ZJR A;  5FLM H;  1AH9 A;  3U4Z A;  4A3M H;  3TS0 A;  1PH6 A;  2NVQ H;  1E24 A;  5IWA L;  2UXB Q;  4LF7 L;  4R4I A;  1VQ9 A;  2JA8 G;  4JI0 Q;  1MIU A;  3J7A 5;  1K8G A;  3T1Y Q;  2F4V Q;  4P73 A;  2UXC L;  4B3T L;  4DK6 C;  1A8V A;  1X9N A;  2YU9 H;  1UE5 A;  1X6O A;  2N8N A;  1BVS A;  2LXK A;  3J7Z C;  1G29 1;  2FXQ A;  4A3K H;  1WCM H;  2PMZ E;  2IHE A;  1BBW A;  4IPH A;  1JJC B;  2ZJP A;  1XPO A;  4JI7 Q;  4C2M H;  2JK8 A;  5C0X G;  4LUZ A;  1V9P A;  4X66 L;  1YJN A;  2ASB A;  4B3R L;  2H5X A;  4LFC Q;  2OCE A;  2R7D A;  4DR1 Q;  5LMN Q;  4UP8 A;  4ME3 A;  2Q2T A;  4L5S A;  3S1N H;  1PFS A;  2AMC B;  1E22 A;  2KCT A;  3HFZ B;  1VS0 A;  4YCV A;  2A8V A;  3NEL A;  2JA6 G;  4A3F H;  4L5Q A;  4K0K Q;  1J5E Q;  3UE1 A;  2B29 A;  1M90 C;  2E2H H;  3PO3 G;  3HOV G;  2Z0S A;  4DR3 L;  2NZH A;  4A3D H;  1L1O B;  1EQR A;  3CC4 A;  3S16 H;  3K7A H;  4NB3 A;  4LF9 L;  4AQY L;  3S2D H;  4A3J G;  3J81 c;  1GVP A;  4IPC A;  2Q2I A;  5M5Y H;  4DV4 L;  4A3I G;  1KHI A;  5JEA J;  1X56 A;  3CCQ A;  4A3B H;  2E8G A;  1VQG A;  3CC7 A;  3CQZ H;  2BA0 A;  2I0Q A;  3S1M H;  3PUV A;  1Y1V G;  4LF6 Q;  1K8A C;  3I4M H;  1L2F A;  4GN4 B;  1XNQ Q;  4JI6 L;  4YWM A;  4A3C G;  4YY3 Q;  3G71 A;  3S1R H;  1PYB A;  4JYA Q;  4X6A H;  1VQ4 A;  2IHF A;  2ALY B;  4GKK Q;  5BR8 Q;  5IP7 G;  4DUZ Q;  3STB C;  4FDB A;  2JE6 I;  2VQE Q;  4A75 A;  5M3F G;  4R4O A;  2B63 G;  1LUZ A;  1N34 Q;  4LF7 Q;  5IYB H;  4JI3 L;  4RG1 A;  4DR2 L;  2N49 A;  3U50 C;  2NVX H;  1RL2 A;  1VQD A;  5C3E G;  2RF4 A;  3ZJY C;  4B3T Q;  1VQ7 A;  2MNA A;  1VQI A;  1HNW L;  1L0W A;  1B8A A;  3H3V I;  3J81 j;  4DR5 L;  1V43 A;  1Q46 A;  2A1A A;  3F1Z A;  4DV7 L;  4IFD J;  2JEB I;  3GD7 A;  1C9O A;  1B7Y B;  4KLK A;  2C35 B;  4A93 G;  2MO1 A;  2UUB L;  1HZ9 A;  4MTN A;  4B3R Q;  4X66 Q;  3KJP A;  3PUX A;  4EQ5 A;  4PMW A;  5C4X H;  1Q8K A;  4JI0 L;  2XTI A;  3KLW A;  3GTM H;  2F4V L;  2R93 H;  4QL5 A;  1KL9 A;  3ULL A;  2VY3 A;  3KDF A;  3OW2 A;  3K80 C;  1WFQ A;  4LUO A;  2VQF Q;  1K0R A;  3G4S A;  4DR6 Q;  3RLF A;  4P72 A;  3U4V A;  3K7U C;  1XJV A;  2K5H A;  1NE3 A;  2ZJQ A;  4JI7 L;  1WYD A;  1PH1 A;  1VQE A;  2OQ0 A;  5JEA G;  1EUJ A;  1KC8 C;  4DR3 Q;  4LFC L;  4DK3 C;  3HOX H;  5LMN L;  4J15 A;  5FLX c;  1E1O A;  3L7Z C;  1KAW A;  4B3S Q;  4GKJ Q;  1KXL A;  2PI2 A;  5M3M G;  1A63 A;  3AYH B;  4AQY Q;  2PQA B;  3CCS A;  2KCM A;  2V1C C;  1VQO A;  3M3Y H;  2EQS A;  2DGY A;  4GLX A;  1KD1 C;  2AWO A;  4DV4 Q;  3DLL A;  4GNX B;  3VDY A;  4A3E G;  1GO3 E;  3E0E A;  4XTC S;  5GAH C;  1I5F A;  5J3B A;  5LMN W;  4BXX G;  4BY1 G;  5FJ8 G;  4K0K L;  1C7Y A;  2JJQ A;  2Q2U A;  3F2B A;  3NEM A;  3I7F A;  1VQL A;  4JI6 Q;  3HOW G;  4WJ4 A;  2LXJ A;  3D0F A;  3UDX A;  4EX5 A;  1D8L A;  2UU9 L;  3TEH B;  5GAD C;  4HJ8 A;  4QY7 A;  4GNX A;  2PNH A;  1U0L A;  1PH2 A;  4LFA L;  1S3O A;  1UEB A;  3Q8D A;  3PF5 A;  4JI5 Q;  3TRE A;  3DM3 A;  2KEN A;  4JOI A;  4X65 Q;  2ZM6 Q;  1UE1 A;  2QEX A;  1XNR Q;  4DAM A;  2KHJ A;  2I5L X;  3HOY G;  4DR2 Q;  3CCL A;  4JI3 Q;  1JMC A;  2NVT H;  1XNQ L;  5K36 G;  1X3F A;  1Y14 B;  4YY3 L;  3CME A;  3KF6 B;  3NBH B;  5ELN A;  4OX9 Q;  3CPW A;  5IP9 H;  4TQU S;  1G51 A;  4BY7 G;  4KHZ A;  1R9T H;  1NY4 A;  5BR8 L;  4DUZ L;  2IX1 A;  4GKK L;  4OO1 I;  2VUM H;  4NXN L;  1FGU A;  4A3G H;  4DV7 Q;  3UE0 A;  3CCV A;  4GOP A;  3HKZ E;  1FJG L;  3ICE A;  2UUB Q;  3EBE A;  4YWL A;  1S40 A;  1TWC H;  3W1G A;  2N78 A;  1TWF H;  2LSS A;  2HQL A;  2JA9 A;  5GRO A;  1YI2 A;  1N34 L;  3I4N G;  3S14 H;  2UUA Q;  1HZB A;  5IT9 c;  3PO2 G;  3CCM A;  1PHJ A;  2JA8 H;  5IYC G;  4A3L H;  1IZ6 A;  4LF4 Q;  1U5K A;  2K14 A;  1PH9 A;  2VNU D;  1Q81 C;  2IY5 B;  1N33 Q;  3BZK A;  1YZ6 A;  2JA7 H;  1OXV A;  4X62 L;  1YHQ A;  4JI2 Q;  1XMQ L;  4DV1 Q;  1FL0 A;  1NMF A;  3CCU A;  4HJ7 A;  2CKZ B;  2YV5 A;  3UDI A;  4OWT B;  3RZD H;  1EYG A;  4A3M G;  4UY8 C;  4DR4 L;  3PF4 A;  1VQA A;  1W2B A;  2Y0S E;  4LW1 A;  4PZ8 A;  3JAM c;  4Y52 H;  3K81 C;  4YHH L;  1Y1W G;  4DR6 L;  2VQF L;  4UPA A;  3KOJ A;  1UWV A;  3M9B A;  4JI4 L;  3GTG H;  3A5U A;  3A74 A;  2HIX A;  1YHA A;  3J80 i;  4H02 A;  3M7N A;  4JBJ A;  1I3Q H;  1E1T A;  3FKI G;  1IBL Q;  3FP9 A;  2WFW A;  3PO3 H;  4PZ6 A;  4GKJ L;  4OWX B;  1HR0 L;  3OTO Q;  4B3S L;  2UU9 Q;  1IXR A;  1LYL A;  1N36 L;  1QZG A;  4IPG A;  3HOZ G;  1EIF A;  1QUQ B;  1CKM A;  1TWH H;  1YNX A;  2VL6 A;  4LFA Q;  5AJ3 Q;  3RLO A;  3UDG A;  1T9H A;  4BA2 I;  1NTG A;  3BU2 A;  1HJP A;  4PZ7 A;  3H0G H;  4OO1 G;  1CKN B;  3M85 A;  2OTL A;  4A3F G;  1L1O A;  2ZTE A;  1SRU A;  4A4I A;  1OTC A;  1EWI A;  2N3S A;  2XGT A;  4ALP A;  1Y1V H;  3ULJ A;  2HHH L;  1KRT A;  2VW9 A;  1MKH A;  2F52 A;  1YJ9 A;  4AIM A;  4NXN Q;  1KRS A;  4LFB L;  2R7Z G;  1EOV A;  4A3D G;  2OTJ A;  4RMF A;  3CPF A;  1FJG Q;  5IYD H;  1JT8 A;  2Z6K C;  1FVI A;  4JI5 L;  1OXU A;  1VCI A;  1SFO H;  1TWA H;  3TQY A;  4X65 L;  2ZM6 L;  1XNR L;  4BBS G;  4C3I H;  1V1Q A;  1N9W A;  2B63 H;  1JJG A;  3T1H L;  3M4P A;  1K3R A;  4OX9 L;  3I4M G;  4YWK A;  3L0O A;  4JI8 L;  3UDF A;  4GOP C;  3RN2 A;  1PH3 A;  4IFD I;  2CWP A;  4GLA C;  3BJU A;  4L5R C;  3FHW A;  4X62 Q;  1IYJ B;  1Q82 C;  1XMQ Q;  3S2H H;  2JA5 H;  4Y7N H;  3HOU H;  1XPR A;  3CCJ A;  4DR4 Q;  2UUA L;  4JBW A;  3RLN A;  5IE8 A;  3L2P A;  4YHH Q;  5GQO A;  5IYB G;  2CWA A;  4YCU A;  4LF4 L;  1MJC A;  4OXP A;  4R4Q A;  2UUC L;  1N33 L;  4JI4 Q;  2HIV A;  4A76 A;  2K5N A;  4JV5 L;  3GTQ H;  2R6G A;  4JI2 L;  2L15 A;  3HKZ G;  1Z47 A;  4DV1 L;  4BBR H;  4HID A;  2UXD L;  5H1S E;  2YTX A;  1Q86 C;  2BH2 A;  5DLQ E;  2RHS B;  2JQO A;  1S72 A;  1PV4 A;  4O2D A;  1HR0 Q;  2KHI A;  5C4X G;  4QJF A;  4HIO A;  1LM0 A;  1X54 A;  2WB1 E;  1N36 Q;  3W1B A;  5M5W H;  4MNO A;  3RR5 A;  1VQJ A;  3CF5 A;  5ELO A;  4DV0 L;  1IBM Q;  3KYH C;  3TRZ A;  5M3M H;  4KI0 A;  4MZ9 A;  1X3E A;  4JI1 Q;  1VQB A;  4DV2 Q;  2I5H A;  3G48 A;  1IBL L;  1SE8 A;  4HJ9 A;  3F8T A;  4HIM A;  4IOA A;  2B3G A;  4BY1 H;  2HHH Q;  1G6P A;  2PQA A;  3K0X A;  3HOW H;  2Y0S G;  2VS1 A;  3OTO L;  4LF8 L;  1YIJ A;  3PUZ A;  4LFB Q;  1N32 L;  1I50 H;  1Z9F A;  3G6E A;  2MFI A;  5AJ3 L;  2YYZ A;  2OQK A;  1PH7 A;  4IPD A;  4HJA A;  4B3M Q;  2AHO B;  3F2C A;  4IFD G;  3S17 H;  4O0A A;  3GTP H;  2IX0 A;  3E9I A;  2JEA I;  3T1H Q;  1LTL A;  3CMA A;  2F3I A;  4DV5 Q;  1AE3 A;  1NMG A;  3BZC A;  3IRB A;  4JI8 Q;  1XTD A;  4LF5 Q;  2CFM A;  3STB D;  4R4C A;  4P75 A;  2DUD A;  3CC2 A;  2NVY H;  2HT1 A;  1J6Q A;  4X64 Q;  4IO9 A;  3E9H A;  4OWW B;  1M1K C;  3KF6 A;  5C44 G;  1SR3 A;  3I4N H;  3PO2 H;  1Q1B A;  2MQH A;  4DR7 L;  4HJ5 A;  4R1J A;  5IY0 A;  1P16 A;  3HKS A;  5IYC H;  2UUC Q;  3CCE A;  5IP9 G;  3ULP A;  1XMO Q;  1X55 A;  4GS3 A;  2R92 G;  2K52 A;  4JV5 Q;  2VUM G;  4A3G G;  3EIV A;  2KBN A;  5FLM G;  4QQB X;  3EN2 A;  2UXD Q;  1YVC A;  1NBW A;  4GN3 B;  1VQF A;  3CXC A;  3AQQ A;  4PG3 A;  1SMX A;  1KQS A;  5LMU Q;  3GDE A;  1I94 Q;  3GTO H;  1ASY A;  1Y1W H;  2QA4 A;  4DKA C;  2CCZ A;  4DV0 Q;  2ATW A;  4A3L G;  2ZTD A;  3CCR A;  5HY6 A;  1QVF A;  4DUY L;  4LUV A;  4IOC A;  2JA6 H;  2ES2 A;  5M5X H;  1A62 A;  2WAQ G;  3NEN A;  3OYY A;  5GAE C;  1WCM G;  3CP0 A;  4JG2 A;  4A3K G;  2JA7 G;  1UE7 A;  2GN5 A;  4DAY B;  3FKI H;  2E2J H;  3J81 i;  2D62 A;  4QIW E;  3S1Q H;  3HOV H;  1E7Z A;  1SN8 A;  2ID0 A;  4LF8 Q;  4KHP L;  1BBU A;  1EQQ A;  1IBM L;  4IJH A;  3S15 H;  2WP8 J;  3A5Z B;  4POG A;  4BA1 I;  2RCN A;  4IJL A;  1I6H H;  1W3S A;  1N32 Q;  2VZA A;  2OWO A;  4JI1 L;  2K5V A;  4A3J H;  2GVB A;  4YCW A;  3HOZ H;  4A3I H;  4DV2 L;  1YBY A;  1TWG H;  2K75 A;  1HR0 W;  4JCV E;  2NZO A;  1PH4 A;  4UP9 A;  1QZH A;  3M4O H;  2D0O A;  1H95 A;  2K4K A;  4GNX C;  4A3C H;  1EFW A;  1QUQ A;  2QGQ A;  1VQK A;  1WOC A;  4DV6 L;  1HNZ Q;  4JBM A;  1IL2 A;  4JBK A;  4DV3 Q;  3ER0 A;  4JOI C;  4TVA B;  2WB1 G;  5IP7 H;  1K83 H;  3J80 c;  1RIP A;  1BKB A;  1CKN A;  4P71 A;  4DNI A;  4LNQ A;  3TS2 A;  2YTV A;  2R7Z H;  4B3M L;  2D0P A;  2NN6 I;  1VQM A;  3KJO A;  5M3F H;  1K73 C;  1JE5 A;  1CKO A;  3ERS X;  1C0A A;  4BBS H;  2E2I H;  3A0J A;  5C4J H;  4A3B G;  4WJ3 M;  3H0G G;  4DV5 L;  3PIO A;  4DR7 Q;  5JJL A;  4AYB G;  1TXY A;  5C3E H;  1SRO A;  1N8R C;  1XPU A;  4LF5 L;  3SGI A;  1CUK A;  3KFU A;  2AKW B;  4UP7 A;  2WAQ E;  1IBK Q;  4NXM Q;  4X64 L;  3PCO B;  3I55 A;  3PUY A;  5IYD G;  3H15 A;  4A93 H;  1HH2 P;  2AWN A;  1CSP A;  2IT1 A;  1PYS B;  4OON A;  1QVG A;  1KIX A;  3PSI A;  1SLJ A;  5IWA Q;  1WJJ A;  2MO0 A;  2ZTC A;  1OXX K;  3GTK H;  4GLV B;  5HGQ A;  4C3H H;  1HZC A;  1XMO L;  5EAY A;  4DUY Q;  1HNX L;  2UXC Q;  3F2D A;  2BA1 A;  2K50 A;  1YEZ A;  4JC0 A;  1JJ2 A;  2E5L L;  1X3G A;  3GTL H;  3GTJ H;  3KDF B;  2JA5 G;  3HOU G;  1OXT A;  4R4T A;  1YIT A;  1YJW A;  1PH5 A;  5LMU L;  4KHP Q;  1DGS A;  1P8L A;  2EIF A;  1I94 L;  3S24 A;  1PH8 A;  1MJE A;  2R93 G;  5JJK A;  3T1Y L;  1B70 B;  3MXN B;  4XIG S;  4LWC A;  2CQO A;  3AEV A;  3CD6 A;  3PIP A;  3WWV A;  1VQP A;  4A3E H;  1O7I A;  1VQN A;  4AYB E;  1VQC A;  1VQH A;  1HZA A;  3W5O A;  5FJ8 H;  4BXX H;  4BBR G;  3PV0 A;  2NN6 G;  4C3J H;  1E3P A;  3RNU A;  2A19 A;  4DV6 Q; 
#chains in the Genus database with same CATH topology
 4POF A;  3LGJ A;  4APV A;  1EYA A;  4HIK A;  2EOT A;  4FF2 A;  5KNB A;  1L1O C;  2EY5 A;  5C0X I;  1CSQ A;  2F0T A;  3B6Y A;  5DM6 3;  3R8B A;  3GO5 A;  1Q1E A;  3RZO H;  3HOY H;  2JA5 B;  2A68 C;  3HOU B;  4NPS A;  1HNZ L;  4NP5 A;  4DV3 L;  2R93 B;  2K1B A;  1WI5 A;  4CJ0 B;  3K8A A;  3M4Y A;  4DF7 A;  3M4Q A;  3MEF A;  1A0I A;  4PV1 C;  5LL6 X;  2EXZ A;  3D31 A;  3EJI A;  3RN5 A;  1DON A;  1AE2 A;  4QCL A;  3AFQ A;  4K5V A;  2SOB A;  1AZP A;  1EIY B;  1HNX Q;  4JYA L;  4RCN A;  4NXM L;  2K04 A;  1IW7 C;  2BE5 C;  2YTY A;  4V19 0;  2C9O A;  2Q2H A;  1EY6 A;  1TR5 A;  2E5L Q;  1AH9 A;  1W6K A;  4XYQ A;  4PNY A;  1EL0 A;  2F0S A;  3U4Z A;  4DNT B;  1STG A;  4B9W A;  4CKE A;  2PMZ B;  2RDH A;  1VQ9 A;  1NAP A;  1DYQ A;  3TN2 A;  2JXM B;  2IW3 A;  2Z9H A;  3F2U A;  3T1Y Q;  1K8G A;  2F4V Q;  4QUC A;  4DK6 C;  3BZD B;  2XRQ D;  3J7Z C;  1BVS A;  1MGS A;  4L63 B;  4IPH A;  1STB A;  1XPO A;  4FXD A;  1JQY D;  4B3R L;  1ML0 D;  4LUZ A;  3PIO 3;  1IL8 A;  4DR1 Q;  1D5Z C;  1B9N A;  5LMN Q;  2F0M A;  4ME3 A;  3S1N H;  1PFS A;  1EEI D;  2AMC B;  3K5N A;  1QJO A;  2EPB A;  3SE0 A;  5C3X A;  4A3F H;  3S17 B;  4KKU A;  3S14 B;  3IL8 A;  3EVQ A;  3UE1 A;  2B29 A;  2E2H H;  2HCC A;  4DR3 L;  1B9M A;  2NZH A;  1QOH A;  4P2C B;  1H9S B;  4RAU C;  4A3D H;  4EGV A;  5DEH A;  2NBF A;  5NUC A;  4LF9 L;  1WTQ A;  1GVP A;  5M5Y H;  3RD4 A;  3KLR A;  1DD2 A;  1KHI A;  3I72 A;  3X3M A;  4A3B H;  3CC7 A;  2L9H A;  1AFP A;  1XNQ Q;  4YWM A;  1BOS A;  3OMC A;  2MP1 A;  1PRT C;  2IHF A;  2ALY B;  4CJ2 C;  4DUZ Q;  2VQE Q;  2JA6 B;  1RKN A;  5JAV A;  2QDB A;  4J8Q A;  2B63 G;  3I90 A;  2KJX A;  4LF7 Q;  4JI3 L;  5C3E G;  3ZJY C;  4B3T Q;  1VQ7 A;  5IOC A;  3P75 A;  1QIL A;  2K6A A;  1V43 A;  4RA8 A;  4A3J B;  3MC0 B;  1B7Y B;  1M4V A;  5I6Y A;  4A3I B;  1PLF A;  3I8Z A;  4X66 Q;  3KJP A;  3PUX A;  3T13 A;  5C4X H;  3HZX A;  1Y1V B;  4QL5 A;  2PW5 A;  3KDF A;  3OW2 A;  1WFQ A;  2VQF Q;  1K0R A;  4KK7 A;  3G4S A;  4IUN A;  3U4V A;  2K5H A;  4JI7 L;  4C3I B;  4KKS A;  5FKA C;  3O13 A;  5C4J B;  1F9S A;  1ICF B;  3OPO A;  5JEA G;  1S5C D;  4J15 A;  1KAW A;  3L9A X;  4AQY Q;  2EJM A;  2KCM A;  4GLX A;  1KD1 C;  4DV4 Q;  4GNX B;  3TDQ A;  2XSC A;  3E0E A;  1I5F A;  5J3B A;  4BXX G;  5FJ8 G;  1VF7 A;  1C7Y A;  4ABN A;  4JI6 Q;  1ZXT A;  3OWE B;  3UDX A;  2UU9 L;  4DU9 A;  5JPN C;  5KGU A;  1CTM A;  1PH2 A;  4LFA L;  1SDF A;  1IKM A;  1PRT F;  3X3N A;  4JOI A;  1UE1 A;  5DM7 3;  4DAM A;  4DR2 Q;  3CCL A;  2NVT H;  4YY3 L;  2F3V A;  3NBH B;  5EPL A;  3CPW A;  5IP9 H;  4BY7 G;  4KHZ A;  1R9T H;  5BR8 L;  5M3M B;  4A3G H;  2R3Z A;  1FGU A;  4NXN L;  1F77 A;  2PZU A;  1FJG L;  5C5L A;  2JSO A;  4YWL A;  1S40 A;  1TWC H;  2N78 A;  1TWF H;  3I4N G;  1HZB A;  5E4X A;  3HOW B;  3NTH A;  2IY5 B;  1U5K A;  2K14 A;  1PH9 A;  3KK7 A;  4HCS A;  3BZK A;  3SR1 A;  1YZ6 A;  3K6O A;  1QNU A;  2JA7 H;  1YHQ A;  4JI2 Q;  4FVM A;  2F3W A;  1EYG A;  1H9M A;  1KDC A;  3W2D A;  3Q6S A;  5IOD A;  3BYT B;  4PZ8 A;  4YHH L;  1HTL D;  5IGE A;  3A5U A;  4ZK9 B;  2J0T D;  2SDF A;  4JBJ A;  1I3Q H;  3PO2 B;  3FP9 A;  2PZW A;  3CRK C;  2LKV A;  4GKJ L;  1IYV A;  4KY5 A;  1LYL A;  1N36 L;  1QZG A;  1QUQ B;  4M8A A;  3UDG A;  3A56 A;  4H0L C;  4KD3 A;  5LL6 S;  1HJP A;  1KAB A;  1CM9 A;  5BN3 A;  1WTR A;  3ULJ A;  1KRT A;  1YNJ D;  5CYU A;  1Y1W B;  1MKH A;  2F52 A;  3OIQ A;  4OIJ A;  1A2T A;  2R7Z G;  4RMF A;  1DM0 B;  1FVI A;  4JI5 L;  1VCI A;  1SFO H;  1LTA D;  4X65 L;  1XNR L;  2ZM6 L;  1V1Q A;  1WD0 A;  2G9D A;  3HS0 C;  4OX9 L;  3L0O A;  2O2L D;  4ODG A;  4GOP C;  1PH3 A;  2XVS A;  3H91 A;  3HOZ B;  2CHB D;  2B2V C;  1MD2 D;  2JA5 H;  1I6V C;  3HOU H;  3CCJ A;  5ELF A;  4JBW A;  5EKI A;  4BS9 A;  5IE8 A;  2EYH A;  3K5L A;  3K5O A;  2ZT9 C;  1VMP A;  4YCU A;  2O5I C;  5TSS A;  4LF4 L;  2UUC L;  4EQN A;  2HIV A;  3ND9 A;  1KNA A;  4ME5 A;  2HDM A;  3BVZ A;  3GV3 A;  4DV1 L;  1Z47 A;  4HID A;  2UXD L;  2YTX A;  1J8I A;  2QCP X;  2EJF C;  2RHS B;  2MJ8 A;  5C6A A;  3MEH A;  3CHB D;  3FMC A;  1S5F D;  2WB1 E;  1Z7T A;  3CF5 A;  1GXD C;  1VQJ A;  2ENB A;  5CMD A;  4MZ9 A;  1X3E A;  2I5H A;  3PQI A;  3L3O C;  4ZUJ A;  2B3G A;  5IT9 E;  1HQM C;  4BY1 H;  2PQA A;  3Q23 A;  1K3B C;  1G2S A;  2PCF B;  1Z9F A;  1N32 L;  1STE A;  1ESR A;  2KQ3 A;  3F2C A;  4IN3 A;  2D9U A;  4JVZ A;  1AE3 A;  2RKS A;  4JI8 Q;  3GTM B;  2A6E D;  4R4C A;  1SNP A;  4J6H A;  4P75 A;  2DUD A;  3CC2 A;  2I07 B;  4X64 Q;  1STA A;  3J81 L;  5IGC A;  3NE5 B;  3KF6 A;  1ICW A;  3ITP A;  4OHJ A;  4C3J B;  3GP7 A;  1P16 A;  5IYC H;  1YNN D;  2HD3 A;  2R92 G;  3N6R A;  3EIV A;  5FLM G;  5I9P A;  2QW7 A;  3RZO B;  5C0X H;  1STN A;  1QG7 A;  1SMX A;  5LMU Q;  1SNM A;  4QIW B;  4DKA C;  2CCZ A;  4DV0 Q;  2F0H A;  3R93 A;  4KN4 C;  1SYC A;  3MXU A;  5EKK A;  2JA6 H;  3TP7 A;  1IHZ A;  3OYY A;  4UAI A;  3WDN A;  1UE7 A;  3FRP B;  1JOK A;  2CW0 D;  4KD4 A;  3HOV H;  3R2I A;  1E7Z A;  1BBU A;  1EQQ A;  1IBM L;  3NHH A;  2WP8 J;  3A5Z B;  4POG A;  2RCN A;  4IJL A;  1W3S A;  1DOK A;  2OWO A;  4JI1 L;  4A3J H;  3SK5 A;  4G7Z C;  1WVL A;  4A3I H;  2K75 A;  3DEO A;  2VXW A;  4OO1 H;  1PH4 A;  4ID6 A;  1QZH A;  4A3C H;  1B50 A;  1EFW A;  1HNZ Q;  4DV6 L;  1IL2 A;  4JBK A;  4DV3 Q;  5FLX L;  3ER0 A;  4JOI C;  3J80 c;  1RIP A;  4DNI A;  1EWC A;  2NN6 I;  1VQM A;  2RSO A;  1K73 C;  2E2I H;  5C4J H;  3RZD B;  3VYS A;  1LTT D;  4DR7 Q;  5JJL A;  2BE5 D;  3WOF A;  1XPU A;  1CUK A;  1NUC A;  4IUP A;  4NXM Q;  3OMG A;  5IGF A;  3I55 A;  3PUY A;  2IT1 A;  3MA2 B;  4LAA A;  4OON A;  3PIP 3;  2E2H B;  1CI3 M;  1SLJ A;  1LTI D;  2MO0 A;  1OXX K;  2WB1 B;  3BVG A;  4ZRZ A;  1XMO L;  4DUY Q;  3ND8 A;  2Z4I A;  2K50 A;  1YEZ A;  2CH4 A;  1LO5 D;  5M5Y B;  3GTL H;  1TS4 A;  2QDL A;  3E0J A;  4A3B B;  3H0G B;  4R4T A;  1YIT A;  1PH5 A;  1DGS A;  1QNK A;  1I94 L;  2NTS A;  1D2B A;  1MJE A;  1EY5 A;  1SNC A;  4NW2 A;  3NBI A;  3MXN B;  3PIP A;  1GHJ A;  1VQP A;  1PTO D;  3OWF A;  1O7I A;  4AYB E;  1VQC A;  1VQH A;  3W5O A;  5D14 A;  1S5E D;  4RHR A;  5CV6 A;  3PV0 A;  1FNW A;  1SAP A;  3JAM L;  3RNU A;  2P5Z X;  1ONL A;  3HOX G;  3OIP A;  4OEM B;  2FHT A;  4QGU A;  4AH6 A;  4P74 A;  3I56 A;  2EDG A;  1F2Y A;  4LF9 Q;  1ET6 A;  1UNS A;  3JC6 6;  2I5M X;  4DAV A;  1NJI C;  3PGZ A;  4Y7N B;  4ILW A;  5JJI A;  3HG9 A;  3SK8 A;  2HDL A;  1YNJ C;  3U58 A;  2WIN B;  2DN8 A;  5E7N A;  2NUC A;  2C5C A;  2EXD A;  1SYD A;  1X65 A;  3I2Z A;  1GD7 A;  2Z6K A;  1YHB A;  1Q12 A;  1VQ5 A;  1TS2 A;  4L5T A;  4KTA A;  3LX0 A;  2LMC B;  4FO2 A;  1B3A A;  1SE2 A;  1PH6 A;  2B8G A;  1E24 A;  2KOL A;  2JA8 G;  1KAA A;  5FOB B;  2FXQ A;  2XWB B;  1WCM H;  2PMZ E;  2IHE A;  1BBW A;  1JJC B;  4JI7 Q;  4C2M H;  1YJN A;  1V9P A;  5EKL A;  2H5X A;  2AQ3 B;  3DWA A;  3HEJ A;  1R9T B;  2Z6B A;  4DAY A;  4L5S A;  2F0O A;  2I46 A;  4YCV A;  1NNX A;  3HFZ B;  3NEL A;  1HCZ A;  2IWH A;  2QEJ C;  1SE3 A;  1TWF B;  4L5Q A;  3J7A F;  1D5X C;  1J5E Q;  4XQJ A;  3PO3 G;  1CHP D;  2ZXP A;  3NWT A;  1L1O B;  1H9R A;  3CC4 A;  4PMC A;  3HGB A;  3K7A H;  4NB3 A;  3G7L A;  2JA7 B;  3J81 c;  4IPC A;  4RKL A;  3T16 A;  1GUW A;  5JEA J;  1X56 A;  4WOR A;  1A6X A;  4BWG B;  2BA0 A;  2I0Q A;  4LF6 Q;  2UXB Q;  1K8A C;  2Z1C A;  1TKW B;  4YY3 Q;  3S1R H;  1PYB A;  4X6A H;  3URY A;  1VQ4 A;  4CDD C;  3D6W A;  5BR8 Q;  2A6E C;  1DXM A;  2MGS A;  1I3Q B;  2XNA C;  3IFD A;  5M5X B;  1STH A;  2BOS A;  5IYB H;  4RG1 A;  1TS3 A;  1EQV A;  5IGB A;  2RF4 A;  4K2L A;  2EYJ A;  4RCO A;  4X3K A;  4CDE C;  1L0W A;  1YNN C;  1ET9 A;  4IFD J;  3SVM A;  1C9O A;  4KLK A;  2C35 B;  4A93 G;  2UUB L;  3H3V C;  1Q8K A;  3M4O B;  4JI0 L;  2XTI A;  3KLW A;  3GTM H;  1HRJ A;  1NR4 A;  3ULL A;  4UHV A;  4P72 A;  2F0J A;  2B2T A;  3K7U C;  1SFO B;  1M8A A;  5M3F B;  4I65 A;  4X3T A;  2OQ0 A;  3J7A V;  3MTS A;  4LFC L;  4DK3 C;  2CW0 C;  5HUR A;  1X32 A;  4GKJ Q;  5FLX c;  1BCP D;  1E1O A;  4Q0F A;  2F1M A;  1JC7 A;  1VQO A;  1TU2 B;  2V1C C;  2DGY A;  4A3E G;  1QB5 D;  4N8F A;  4XTC S;  5J1Z A;  5JVH 3;  2EY2 A;  5LMN W;  4K0K L;  1RHP A;  1V1P A;  3KF8 A;  3P1H A;  4IZ8 A;  4JW0 A;  3NEM A;  3I7F A;  3F2B A;  1E2W A;  2DNC A;  1Y8O B;  3D0F A;  2K32 A;  5EBC A;  4EX5 A;  5GAD C;  1B2T A;  4QY7 A;  2ICI A;  4GNX A;  1U0L A;  4ZKC B;  1S3O A;  3Q8D A;  4CKB A;  4JI5 Q;  3DM3 A;  4HAE A;  4X65 Q;  1XNR Q;  2ZM6 Q;  3DUZ A;  1Q90 A;  2KHJ A;  4KY7 A;  3HOY G;  1Y14 B;  3CME A;  5CV9 A;  4IUT A;  1HNW Q;  1PRT B;  3QG1 A;  4OX9 Q;  4TQU S;  4GKK L;  1NY4 A;  4OO1 I;  4DV7 Q;  4GOP A;  3HKZ E;  5CGK A;  3ICE A;  4C1N K;  2Q8I B;  2JA9 A;  2WKC A;  1N34 L;  4BY1 B;  2B2V A;  4G4K A;  3TZU A;  4DK0 A;  1JWM D;  2MHV A;  2QKI C;  4ZAI A;  5M9O A;  4LF4 Q;  4KN7 C;  5CBA E;  1GJX A;  1JOR A;  1OXV A;  4X62 L;  3TBI B;  4K8J A;  5D65 A;  1FL0 A;  1NMF A;  3ERO A;  2F0L A;  4DV1 Q;  2RSN A;  1T5X D;  4HJ7 A;  3RZD H;  1HHV A;  3PF4 A;  1VQA A;  2ZXR A;  2M2L A;  4LW1 A;  5EPJ A;  3JAM c;  1W2B A;  4Y52 H;  4X3U A;  4RGO S;  1U9R A;  3BDO A;  1UWV A;  1D6E C;  1TII D;  1UEA B;  1E1T A;  1PTO C;  3FKI G;  4FF3 A;  1TT2 A;  3DXJ C;  2A6H D;  1FD7 D;  2WFW A;  4L8J A;  1L0X B;  4OWX B;  2XRS D;  5AFW A;  2K28 A;  1IXR A;  5A35 A;  3D4W A;  1BO0 A;  1EIF A;  1CKM A;  1MSG A;  3RLO A;  2EE1 A;  3H0G H;  1CKN B;  4ZKB B;  3M85 A;  3OSO A;  4TSS A;  4A3F G;  4A3M B;  2HHH L;  2F4I A;  2ZXO A;  1SYB A;  3LWE A;  4A3D G;  1EOV A;  1S5B D;  2Z6K C;  1E0B A;  4BBS G;  2B2W A;  5E4W C;  2B63 H;  3HOV B;  3T1H L;  5D3I B;  2FMC A;  1BNZ A;  4YWK A;  2WAC A;  1NSN S;  1Y8N B;  3FHW A;  1JWU D;  1LV9 A;  1XMQ Q;  2RVL A;  4Y7N H;  1V1O A;  1XPR A;  1C48 A;  1F9P A;  1LTR D;  1KDA A;  4DR4 Q;  2UUA L;  3RLN A;  4N9T A;  3P20 A;  1Q8I A;  4JI4 Q;  3NK9 A;  1X3P A;  5CR3 A;  4A76 A;  4JV5 L;  3GTQ H;  1CZW A;  1EFI D;  1XTC D;  2R6G A;  3S2D B;  1WTW A;  4BBR H;  2E2I B;  5H1S E;  2NN6 H;  1SYE A;  2Q8T A;  4LK1 C;  3QOL A;  1HR0 Q;  1Y8P B;  2KHI A;  5C4X G;  4QJF A;  3I4M B;  1PTO F;  1CQV A;  3BS1 A;  1IBM Q;  4R9W A;  5ELO A;  3J7Y W;  3KYH C;  3LNN A;  4KI0 A;  3CRL C;  4JI1 Q;  3DWQ A;  1VQB A;  4RGM A;  5K5P A;  1QE6 A;  5E3F A;  1SNQ A;  4HIM A;  4MHE A;  4F7X A;  3N52 A;  1GUT A;  2Y0S G;  3OTO L;  4LF8 L;  2NVX B;  1SYG A;  3PUZ A;  3A7A B;  4LFB Q;  1HTP A;  5AJ3 L;  1PH7 A;  3VR2 A;  4HJA A;  2FMM A;  2AHO B;  1C8C A;  4IFD G;  3HKZ B;  3GTL B;  2OF1 A;  3C2P A;  2B2Y A;  3GTP H;  3E9I A;  1LTL A;  3CMA A;  4M1U B;  4RHS A;  1TVX A;  3J80 L;  2KVM A;  2ICE C;  5IIF A;  2CFM A;  4KJN A;  3STB D;  2DNE A;  4OWW B;  4DA2 A;  3IAY A;  5C44 G;  3KUP A;  1SR3 A;  5KND A;  3I4N H;  4HJ5 A;  3KLS X;  1BXT A;  3EFX D;  3HKS A;  1V8Q A;  5IP9 G;  1A3U A;  1XMO Q;  1X55 A;  2K52 A;  4A3G G;  5ISR A;  4EQO A;  4Z9C B;  3M3Y B;  2LS0 1;  1YVC A;  1IKL A;  4U67 3;  5A2Q L;  3CXC A;  2Q8R E;  4F87 A;  2HQE A;  2B2T C;  1I94 Q;  2ATW A;  5HY6 A;  4HED A;  1TQO A;  2ES2 A;  5M5X H;  3NEN A;  1A15 A;  4A3K G;  2JA7 G;  5CV8 A;  3CP0 A;  1DJR D;  2GN5 A;  2NWG A;  3MFG A;  4QIW E;  1LLR D;  4IUR A;  1SN8 A;  2ID0 A;  4KHP L;  2EYF A;  1II3 A;  4BA1 I;  1SSO A;  1BCP C;  3EA6 A;  4YCW A;  1PFN A;  2VUM B;  4DV2 L;  2A69 D;  1YBY A;  4RWS C;  4JCV E;  4UP9 A;  3BVM A;  4QF4 A;  3M4O H;  1H95 A;  4GNX C;  3I91 A;  3IKJ A;  4UDU C;  1WOC A;  4JBM A;  3FVQ A;  4OL7 A;  4TVA B;  5IP7 H;  1K83 H;  5F2D A;  3TS2 A;  1BKB A;  4P71 A;  4RGN A;  1OO9 B;  2R7Z H;  4B3M L;  5CV7 A;  4XT3 B;  5C4Z A;  3KJO A;  1B53 A;  5M3F H;  1EIH A;  3ERS X;  1WCM B;  2CQA A;  4C2M B;  4DV5 L;  4AYB G;  1SRO A;  4LF5 L;  3VR3 A;  3KFU A;  4EVO A;  4UP7 A;  2WAQ E;  2NB0 A;  2DY8 A;  4IUQ A;  3AMU A;  1CSP A;  1QVG A;  1PYS B;  2VB2 X;  2B2U A;  5JJZ A;  3KBG A;  1WJJ A;  2J4X A;  2ZTC A;  3OW7 A;  4N8X 1;  4C3H H;  5HGQ A;  1HNX L;  1RD9 D;  3K7A B;  4DXF A;  3F2D A;  3P7J A;  1JJ2 A;  4JC0 A;  2E5L L;  1I4R A;  1X3G A;  4JPB W;  4CGY B;  3GTJ H;  3KDF B;  1WTO A;  2JA5 G;  3HOU G;  2EIF A;  1LTB D;  3GQB A;  1PH8 A;  3S1R B;  2R93 G;  1RCV D;  4YIJ A;  2F0F A;  4E6I A;  4FXK C;  3T1Y L;  1I4X A;  3KBX A;  4LWC A;  1PXU A;  1VQN A;  1D1K A;  1HZA A;  1TWA B;  1BCP F;  1EYC A;  3S9W A;  4FXG C;  1R4P B;  2A6H C;  5I9O A;  1VQ8 A;  5KNC A;  4DR1 L;  1MHW C;  2WII B;  5G3L D;  2PI2 E;  1ASZ A;  4XYO A;  4TRD A;  2JP1 A;  5EPK A;  3PUW A;  4GN5 A;  1UE6 A;  1PVO A;  3AFP A;  4RH6 A;  3RUZ A;  5K36 H;  3DHQ A;  3CW2 C;  2B2W C;  1PA6 A;  5GAG C;  2F0U A;  1K9M C;  1HQR D;  1QVC A;  1SBB B;  4HN7 A;  5BN4 A;  2F0W A;  1S5D D;  3NXW A;  1SEB D;  2E2D C;  1NCV A;  1XX8 A;  2AQ2 B;  1TY2 A;  1RTN A;  2GVA A;  4KY6 A;  1IBK L;  3OHX C;  2R92 H;  2VQE L;  2ZJR A;  5FLM H;  1XYI A;  4A3M H;  5D3D A;  3TS0 A;  4LF7 L;  4R4I A;  4JI0 Q;  1MIU A;  3J7A 5;  3J80 E;  4P73 A;  2UXC L;  4B3T L;  2KCC A;  1X9N A;  2YU9 H;  1SMY D;  2LXK A;  1G29 1;  2ZJP A;  5C0X G;  2ASB A;  4X66 L;  2G5D A;  2WV6 D;  4LFC Q;  2R7D A;  2H1E A;  1F2L A;  3NWS A;  4K5X A;  3V2T A;  1VS0 A;  2JA6 G;  4K0K Q;  3ERQ A;  5A2Q E;  1M90 C;  1G91 A;  3HOV G;  3E5S A;  3I73 A;  2B2Y C;  3VR5 A;  2E76 C;  1XWE A;  3S16 H;  2LY7 A;  5EBD A;  3Q0A A;  2WAQ B;  2H4O A;  4AQY L;  3S2D H;  4A3J G;  3QO2 A;  2Q2I A;  4A3I G;  3QWN A;  4DV4 L;  2PYK A;  2DY7 A;  1STY A;  1U4R A;  2E8G A;  3CQZ H;  3W3A A;  3PUV A;  1Y1V G;  3I4M H;  4A3C G;  2F0I A;  1L2F A;  4GN4 B;  1PZJ D;  4JI6 L;  1TY0 A;  4JYA Q;  4GKK Q;  2K03 A;  2SEB D;  3STB C;  4FDB A;  1A3T A;  3MZ5 A;  1TS5 A;  4R4O A;  4C3I G;  4R8N A;  1N34 Q;  2E2J B;  4DR2 L;  1WTH A;  2N49 A;  3U50 C;  2NVX H;  1RL2 A;  1VQD A;  1HPC A;  2QF7 A;  2MNA A;  1VQI A;  1BBX C;  1O80 A;  3S15 B;  5KEE A;  1EY8 A;  3H3V I;  1B8A A;  4DR5 L;  1J9O A;  1EOT A;  3NPP A;  3F1Z A;  1EEF D;  4KJO A;  3GD7 A;  2MO1 A;  1HZ9 A;  4MTN A;  4B3R Q;  5FO9 B;  3AU7 A;  5CV4 A;  1NR2 A;  4PMW A;  3BDC A;  3WOE A;  2AUJ D;  1DCZ A;  2VY3 A;  4V0B A;  4LUO A;  4DN4 M;  1SND A;  3RLF A;  4ZQ3 A;  3I3C A;  1XJV A;  1X3Q A;  3UI2 A;  1NE3 A;  2ZJQ A;  1K0S A;  2B63 B;  3DMU A;  4IQZ A;  4DR3 Q;  5C3E B;  3HOX H;  1MSH A;  1KXL A;  3L7Z C;  5M3M G;  1A63 A;  4R8I A;  2PQA B;  2BDN A;  1U4M A;  3M3Y H;  1JCK B;  2OXP A;  5JOB A;  1EY7 A;  1GO3 E;  4H7B A;  4K8I A;  2A69 C;  1R4Q B;  4O1N A;  2JJQ A;  4WJ4 A;  1VQL A;  3HOW G;  1D8L A;  1PFM A;  5ELC A;  4NKL A;  3TEH B;  4HJ8 A;  1G6Z A;  2PNH A;  2L4N A;  3GTQ B;  1UEB A;  2KEC A;  4BBR B;  4I7Z C;  2I5L X;  3K59 A;  2K5Q A;  1CK1 A;  4JI3 Q;  4LMQ D;  1A3V A;  1X3F A;  3R2T A;  3KF6 B;  4TKO B;  2IX1 A;  1PFB A;  2B2U C;  4RFB A;  2L55 A;  2VUM H;  4OEL B;  5I2Y A;  3UE0 A;  3CCV A;  3MXP A;  2LSS A;  5GRO A;  2HQL A;  1G6P A;  3PO2 G;  2UUA Q;  1PHJ A;  2JA8 H;  4A3L H;  1IZ6 A;  1Q81 C;  2Z4H A;  1LAC A;  1I4H A;  3J81 E;  4KV6 A;  4DGZ A;  2JN4 A;  5ELE A;  3GTP B;  3CCU A;  2CKZ B;  2YV5 A;  4HR7 B;  3UDI A;  2HUG A;  4UY8 C;  1EIG A;  3MHB A;  2A5H A;  1Y1W G;  4QB4 A;  1C4Q A;  4BY7 B;  5EJW A;  4DR6 L;  5COY A;  3TP8 A;  3M9B A;  2A73 B;  3J80 i;  4H02 A;  2EJG C;  3M7N A;  3VR6 A;  1G2T A;  3I4N B;  2KCN A;  5COR A;  2PW7 A;  2RQX A;  3VA7 A;  3PO3 H;  1GUO A;  4B3S L;  3OTO Q;  2UU9 Q;  4CDF C;  3HOZ G;  4LFA Q;  5AJ3 Q;  1TWH H;  2E75 C;  3K5M A;  1T9H A;  1AEX A;  4PZ7 A;  1H9S A;  4HTH A;  2MPM A;  1SRU A;  4A4I A;  4G57 A;  4ALP A;  1Q3L A;  2VW9 A;  1YJ9 A;  2O4X A;  4AIM A;  4NXN Q;  1KRS A;  1F2M A;  2OTJ A;  1PZK D;  1FJG Q;  5IYD H;  2SNS A;  2IL8 A;  1TWA H;  4GZY C;  1HFG A;  2X6G A;  5FLX E;  4JI8 L;  3NSW A;  3UDF A;  3HRZ C;  3RN2 A;  1EY0 A;  2CWP A;  1KNE A;  4GLA C;  3BJU A;  4HMJ A;  5EGT A;  2EYO A;  1HA6 A;  3K57 A;  4YHH Q;  1O7L A;  5IYB G;  1K28 A;  2CWA A;  3T56 B;  2IX3 A;  2N88 A;  1K83 B;  3NQI A;  4CKC A;  3NTI A;  1N33 L;  2R7Z B;  2K5N A;  1RF2 D;  2L15 A;  2QIL A;  1SMY C;  4K2K A;  1CA6 A;  2BH2 A;  5DLQ E;  4XXE A;  2JQO A;  1S72 A;  3V05 A;  1PV4 A;  3H09 A;  4HIO A;  1LM0 A;  1X54 A;  1PZI D;  1N36 Q;  5M5W H;  4MNO A;  3RR5 A;  3TRZ A;  4DV0 L;  5T1I A;  3H6M A;  1FR3 A;  2EZV A;  1K8O A;  2G9H D;  4DV2 Q;  1SNO A;  1IBL L;  2VB3 X;  1MI2 A;  1SE8 A;  4HJ9 A;  3F8T A;  4C3J G;  1O7Y A;  5G3L F;  2VS1 A;  1YIJ A;  4C3H B;  1EY9 A;  1O78 A;  3G6E A;  3FEW X;  2MFI A;  2OQK A;  4HSP A;  4B3M Q;  4O0A A;  2EYP A;  3GTJ B;  1FYC A;  2IX0 A;  4QMG A;  1EY4 A;  2TSS A;  3JAM E;  4DV5 Q;  3BZC A;  2DJF C;  1Z6H A;  4LF5 Q;  3VYT A;  1RJT A;  4I7A A;  2NVY H;  1J6Q A;  4IO9 A;  1M1K C;  3NBH A;  2NYZ D;  1LT4 D;  3DEP A;  3VR4 A;  4DR7 L;  5IGG A;  1ENF A;  4R1J A;  5IY0 A;  5KRU A;  2UUC Q;  3CCE A;  4GS3 A;  3BG3 A;  2TMP A;  4QQB X;  2UXD Q;  1NBW A;  1VQF A;  5DAU A;  2MUY A;  4PG3 A;  1AP0 A;  4DAP A;  3GTO H;  1ASY A;  3NQT A;  2EVB A;  1E2Z A;  3SXH A;  3CCR A;  5CC4 A;  4DUY L;  1PYW D;  2KED A;  2WAQ G;  5GAE C;  4JG2 A;  1ZYR C;  3CKI B;  1WTX A;  4DAY B;  3FKI H;  2E2J H;  3QJY A;  2D62 A;  1K8M A;  3J81 i;  1HUM A;  3S1Q H;  3A54 A;  4LJZ C;  4PQX A;  5DNF A;  4IJH A;  1H9K A;  3S15 H;  1N32 Q;  1I6H H;  2K5V A;  2R92 B;  3DM1 A;  1U4L A;  1HR0 W;  3TP6 A;  2D0O A;  3FPU B;  1F9R A;  1QUQ A;  2QGQ A;  2R61 A;  2WB1 G;  3K58 A;  1WD1 A;  4LNQ A;  1CA5 A;  2YU9 B;  2YTV A;  1HUN A;  2D0P A;  4K5W A;  4BBS H;  3ZYY X;  3A0J A;  4A3B G;  4WJ3 M;  3H0G G;  3PIO A;  5C3E H;  3SGI A;  1F9Q A;  1B1Z A;  4G7O C;  1IBK Q;  1ILP A;  1SXT A;  1CFM A;  3H94 A;  3H15 A;  3GTG B;  2BDO A;  1KIX A;  5FK9 C;  2F0D A;  3PSI A;  2RDF A;  3TSS A;  3GTK H;  4GLV B;  3S16 B;  2UXC Q;  5IGD A;  1D5M C;  1EU3 A;  3NTK A;  1ZKO A;  5JEA H;  1YJW A;  3CQZ B;  5IT9 L;  3MWY W;  3S24 A;  1QCB D;  3CD6 A;  1EQT A;  1DOL A;  2CQO A;  3AEV A;  1DOM A;  4BXX H;  5FJ8 H;  4BBR G;  2NN6 G;  2A19 A;  4DV6 Q;  2V4D A;  3I4O A;  4IUV A;  3SEB A;  1BF4 A;  1VF5 C;  1V1P B;  1BCP B;  3KF8 B;  1BUV T;  2L0C A;  3H3V H;  4IFD H;  4CBV A;  5C0X J;  4L6T B;  3S2H B;  1I4Q A;  4DPG A;  4ZUI A;  4ZLT F;  2KA7 A;  3TZD A;  1J5E L;  2M9V A;  4BY7 H;  1D7Q A;  2R7F A;  1E2V A;  1VQ6 A;  2PZT A;  1GKH A;  1Q7Y C;  2PPB C;  5C4H A;  2RHQ B;  4NMZ A;  2O5J C;  2SNM A;  5C44 H;  4FP5 D;  3CAM A;  1SJE D;  4GOP B;  1OXS C;  1JB7 A;  4LF6 L;  3HOX B;  2UXB L;  1Y69 U;  3E3X A;  5EQ0 A;  5FO7 B;  3JAM i;  1GM5 A;  1FNV A;  2BH8 A;  1JWS D;  2B8F A;  4DR5 Q;  3AB9 A;  1I4P A;  3D4D A;  1L0Y B;  4NDX A;  4HCE A;  2NVQ H;  5IWA L;  3C1F A;  1A8V A;  1I50 B;  1RTO A;  1UE5 A;  1X6O A;  1XXG A;  2J7Z A;  2N8N A;  4A3K H;  2JK8 A;  4FYD A;  1ENC A;  4PMB A;  2OCE A;  1PDQ A;  3RMH A;  4DFA A;  5LHY 1;  4UP8 A;  2Q2T A;  1JOO A;  5FO8 B;  2KCT A;  1E22 A;  2X69 A;  2A8V A;  3LWU A;  5C3W A;  1S4Z A;  4WRD A;  3QR8 A;  2E74 C;  2Z0S A;  2BCO A;  1EYD A;  3C1E A;  2JA8 B;  2EYM A;  5C5M A;  3Q22 A;  1EQR A;  2N55 A;  3CCQ A;  1VQG A;  3I4L A;  3S1M H;  3MAQ A;  5I4D A;  3G71 A;  1DZ1 A;  1W6J A;  2L12 A;  3SK6 A;  5IP7 G;  2JE6 I;  4RKB A;  1PTO H;  4A75 A;  5M3F G;  1LUZ A;  4U68 A;  3PO3 B;  1CQF A;  1ESF A;  1GUG A;  1HNW L;  4ZCK A;  3J81 j;  1TWH B;  1Q46 A;  2A1A A;  4DV7 L;  2JEB I;  1KLU D;  1TWG B;  4EQ5 A;  1JE4 A;  1FGB D;  2F4V L;  2R93 H;  1JIC A;  4ZYS A;  4EQP A;  1KL9 A;  2F0P A;  2L11 A;  3CU7 A;  3PMF A;  4B08 A;  3K80 C;  4S3S A;  4C3H G;  4DR6 Q;  4O42 A;  1H9J A;  2K5D A;  1LT3 D;  3D3R A;  3R3O A;  4KMU C;  1WYD A;  3MFY A;  1PH1 A;  3VYR A;  1VQE A;  4Q5V A;  1LAB A;  3MXN A;  1UAP A;  1EUJ A;  1KC8 C;  2EY1 A;  5LMN L;  4B3S Q;  2NZ1 D;  1LT6 D;  1SYF A;  1EZ6 A;  2PI2 A;  4X3S A;  3AYH B;  5CBE E;  2X6L A;  3CCS A;  2EQS A;  2AWO A;  3DLL A;  3VDY A;  4A93 B;  5GAH C;  1GOZ A;  4BY1 G;  2Q2U A;  3V96 A;  1SE4 A;  5I2X A;  5JPM C;  2LXJ A;  4HMI A;  5KYI A;  2RDG A;  3VYU A;  1WTP A;  2HCI A;  3NUC A;  3A8J E;  3PF5 A;  3BYY B;  3C46 A;  3TRE A;  5BN5 A;  2F0Q A;  2KEN A;  4XT1 B;  3A8K E;  2EYL A;  2QEX A;  4KHV A;  4WFN 3;  2Z8L A;  1GUS A;  1JMC A;  1XNQ L;  5K36 G;  1HA5 A;  4DK1 A;  5ELN A;  5M5W B;  1KDB A;  1G51 A;  1KTK A;  4DUZ L;  3QOJ A;  2FIN B;  5KIX A;  3FPP A;  5E1F A;  2AQ1 B;  2K7V A;  4G7H C;  3MVV A;  4A3E B;  3EBE A;  2UUB Q;  3W1G A;  3S17 H;  1YI2 A;  2FJ2 A;  2M00 A;  3K0Y A;  3T4A C;  5IT9 c;  3S14 H;  3CCM A;  1WTV A;  5IYC G;  3KLS A;  5J22 A;  2VNU D;  2IPK D;  3D6C A;  1ROD A;  2L5T A;  1N33 Q;  1ILQ A;  1XMQ L;  1I4G A;  5ELB A;  4OWT B;  3HOY B;  4A3M G;  4DR4 L;  2RA4 A;  2Y0S E;  5I6W A;  3K81 C;  2F03 A;  3DWP A;  2VQF L;  2NVY B;  4UPA A;  1AZQ A;  3KOJ A;  4JI4 L;  4MN3 A;  3GTG H;  3A74 A;  2HIX A;  1YHA A;  4OIK A;  2D5D A;  1IBL Q;  2K5W A;  3A7L A;  4CDC C;  1VMC A;  4PZ6 A;  1HR0 L;  4WJW A;  4IPG A;  1YNX A;  2VL6 A;  1BQQ T;  2A68 D;  4BA2 I;  1NTG A;  3BU2 A;  4K6D A;  2D2C C;  4OO1 G;  2OTL A;  4K6L A;  2AUK A;  1L1O A;  2ZTE A;  1OTC A;  1EWI A;  2N3S A;  2XGT A;  1Y1V H;  4F88 A;  3GTO B;  1B44 D;  1JB3 A;  3U9O A;  4LFB L;  4MIU A;  1JT8 A;  3CPF A;  1BR9 A;  1OXU A;  3TQY A;  2RBM A;  2F0V A;  3FKI B;  2OEO A;  4C3I H;  1N9W A;  3S1Q B;  1JJG A;  3M4P A;  1K3R A;  1VDZ A;  1IW7 D;  3I4M G;  4IFD I;  1I6H B;  4L5R C;  1HXY D;  4X62 Q;  1IYJ B;  4C56 C;  3S1N B;  2K01 A;  1Q82 C;  3S2H H;  4FNF A;  4A3F B;  3L2P A;  1CZG A;  3QIA A;  5GQO A;  1UUP A;  4FF1 A;  2PO4 A;  1MJC A;  4OXP A;  4K14 A;  4R4Q A;  1B4O A;  1ZYR D;  4A3D B;  2XIW A;  3T53 B;  3TME A;  4JI2 L;  3HKZ G;  4BBS B;  2LFN A;  2NTT A;  1Q86 C;  3FDT A;  2XN9 C;  4O2D A;  1PMR A;  4ULL A;  3W1B A;  4CJ1 B;  3I70 A;  5M3M H;  2CVR A;  3OOC A;  3G48 A;  1RDP D;  1O7Z A;  4IOA A;  3HP3 A;  2HHH Q;  3K0X A;  2F0G A;  3HOW H;  4H13 C;  3GTK B;  1BDO A;  3QB3 A;  1I50 H;  3SHL A;  2YYZ A;  2FFK B;  4IPD A;  1GHK A;  1F2Z A;  2JEA I;  2PQE A;  3T1H Q;  1JOQ A;  1D1I A;  2F3I A;  1NMG A;  1PRT D;  5C4X B;  3IRB A;  1XTD A;  5CV5 A;  3VA5 A;  2DJG C;  3D8G A;  2HT1 A;  3SK4 A;  5HGT A;  1AW7 A;  3E9H A;  5J39 A;  1U4P A;  2KEE A;  3ONA B;  3PO2 H;  1Q1B A;  2MQH A;  2F0E A;  2KHS A;  2RCF A;  2Y0S B;  4KKT A;  4XDX A;  1HFN A;  1LTG D;  1EWH A;  1KLG D;  4J1M A;  3E6Z X;  3ULP A;  4JV5 Q;  2VUM G;  2B39 A;  2KBN A;  3GV6 A;  3EN2 A;  4GN3 B;  3AQQ A;  4DNR B;  1KQS A;  5T1G A;  3GDE A;  1Y1W H;  2QA4 A;  4A3L G;  2ZTD A;  1QVF A;  4LUV A;  4IOC A;  4N9P A;  1A62 A;  1ZEQ X;  3Q24 A;  1WCM G;  5C44 B;  3M7G A;  3IFT A;  3T51 B;  2F0N A;  4LF8 Q;  2NVT B;  4H44 C;  4OGQ C;  3EQL C;  2VZA A;  4C1N I;  4DXG A;  2GVB A;  1CT1 D;  1MBY A;  3HOZ H;  4A3G B;  2PNR C;  4XQQ A;  1TWG H;  1LTS D;  2JYO A;  1IYU A;  1SJH D;  2NZO A;  2NVQ B;  1TWC B;  2K4K A;  3SDZ A;  2IJ0 A;  1VQK A;  1T5E A;  1ENA A;  4RGT A;  3BDL A;  1B3Q A;  1CKN A;  3A55 A;  2K33 A;  4A3K B;  1JE5 A;  1CKO A;  1C0A A;  1A2U A;  1EU4 A;  4XQN A;  1TXY A;  1N8R C;  4FF4 A;  4IAL A;  5JVG 3;  4F8M A;  2AKW B;  4CHT B;  4X64 L;  1CHQ D;  3PCO B;  5IYD G;  4A93 H;  3D4R A;  1HH2 P;  2AWN A;  3G6J B;  5KYL A;  4JK1 C;  1AN8 A;  1G8Z D;  5IWA Q;  2A74 C;  4MTK A;  2GA4 B;  1HZC A;  2KUM A;  5EAY A;  2CH4 W;  4B9X A;  2BA1 A;  5ELD A;  1LT5 D;  1FNU A;  4IUU A;  2EY6 A;  1OXT A;  1QWY A;  1EZ8 A;  2F0K A;  1GUN A;  1JR0 D;  3S1M B;  3NP8 A;  4AYB B;  5LMU L;  4KHP Q;  1P8L A;  2OT2 A;  3C3L A;  2XWJ B;  3U9S A;  3MXG A;  5JJK A;  1B70 B;  3A8I E;  4XIG S;  2K05 A;  3TP5 A;  3WWV A;  1PTO B;  4A3E H;  2L1B A;  5L37 A;  2WKD A;  4QUF A;  4HSV A;  4C3J H;  1E3P A; 
#chains in the Genus database with same CATH homology
 3I4O A;  3HOX G;  4POF A;  3LGJ A;  4QGU A;  1VQ8 A;  4DR1 L;  4APV A;  4HIK A;  4AH6 A;  4P74 A;  3KF8 B;  1L1O C;  3I56 A;  2PI2 E;  1ASZ A;  5C0X I;  4LF9 Q;  1CSQ A;  3B6Y A;  2I5M X;  3JC6 6;  1NJI C;  3H3V H;  3GO5 A;  3PUW A;  1Q1E A;  4GN5 A;  5C0X J;  1UE6 A;  3PGZ A;  3HOY H;  3RZO H;  4DPG A;  4NPS A;  1PVO A;  3AFP A;  1HNW Q;  1HNZ L;  1J5E L;  5JJI A;  4DV3 L;  4BY7 H;  1D7Q A;  2R7F A;  3CW2 C;  1PA6 A;  1WI5 A;  5GAG C;  1VQ6 A;  1Q7Y C;  1GKH A;  1K9M C;  1QVC A;  3U58 A;  3K8A A;  3M4Q A;  3MEF A;  5E7N A;  2RHQ B;  2EXD A;  1A0I A;  5C44 H;  1X65 A;  3D31 A;  3CAM A;  3RN5 A;  3I2Z A;  4GOP B;  2Z6K A;  1GD7 A;  1OXS C;  1AE2 A;  1YHB A;  1Q12 A;  1JB7 A;  4LF6 L;  1VQ5 A;  2UXB L;  3AFQ A;  1EIY B;  4L5T A;  1HNX Q;  2GVA A;  1IBK L;  3JAM i;  4JYA L;  4NXM L;  1GM5 A;  2BH8 A;  2YTY A;  2R92 H;  4DR5 Q;  2Q2H A;  2E5L Q;  2VQE L;  2ZJR A;  5FLM H;  1AH9 A;  3U4Z A;  4A3M H;  3TS0 A;  1PH6 A;  2NVQ H;  1E24 A;  5IWA L;  2UXB Q;  4LF7 L;  4R4I A;  1VQ9 A;  2JA8 G;  4JI0 Q;  1MIU A;  3J7A 5;  1K8G A;  3T1Y Q;  2F4V Q;  4P73 A;  2UXC L;  4B3T L;  4DK6 C;  1A8V A;  1X9N A;  2YU9 H;  1UE5 A;  1X6O A;  2N8N A;  1BVS A;  2LXK A;  3J7Z C;  1G29 1;  2FXQ A;  4A3K H;  1WCM H;  2PMZ E;  2IHE A;  1BBW A;  4IPH A;  1JJC B;  2ZJP A;  1XPO A;  4JI7 Q;  4C2M H;  2JK8 A;  5C0X G;  4LUZ A;  1V9P A;  4X66 L;  1YJN A;  2ASB A;  4B3R L;  2H5X A;  4LFC Q;  2OCE A;  2R7D A;  4DR1 Q;  5LMN Q;  4UP8 A;  4ME3 A;  2Q2T A;  4L5S A;  3S1N H;  1PFS A;  2AMC B;  1E22 A;  2KCT A;  3HFZ B;  1VS0 A;  4YCV A;  2A8V A;  3NEL A;  2JA6 G;  4A3F H;  4L5Q A;  4K0K Q;  1J5E Q;  3UE1 A;  2B29 A;  1M90 C;  2E2H H;  3PO3 G;  3HOV G;  2Z0S A;  4DR3 L;  2NZH A;  4A3D H;  1L1O B;  1EQR A;  3CC4 A;  3S16 H;  3K7A H;  4NB3 A;  4LF9 L;  4AQY L;  3S2D H;  4A3J G;  3J81 c;  1GVP A;  4IPC A;  2Q2I A;  5M5Y H;  4DV4 L;  4A3I G;  1KHI A;  5JEA J;  1X56 A;  3CCQ A;  4A3B H;  2E8G A;  1VQG A;  3CC7 A;  3CQZ H;  2BA0 A;  2I0Q A;  3S1M H;  3PUV A;  1Y1V G;  4LF6 Q;  1K8A C;  3I4M H;  1L2F A;  4GN4 B;  1XNQ Q;  4JI6 L;  4YWM A;  4A3C G;  4YY3 Q;  3G71 A;  3S1R H;  1PYB A;  4JYA Q;  4X6A H;  1VQ4 A;  2IHF A;  2ALY B;  4GKK Q;  5BR8 Q;  5IP7 G;  4DUZ Q;  3STB C;  4FDB A;  2JE6 I;  2VQE Q;  4A75 A;  5M3F G;  4R4O A;  2B63 G;  1LUZ A;  1N34 Q;  4LF7 Q;  5IYB H;  4JI3 L;  4RG1 A;  4DR2 L;  2N49 A;  3U50 C;  2NVX H;  1RL2 A;  1VQD A;  5C3E G;  2RF4 A;  3ZJY C;  4B3T Q;  1VQ7 A;  2MNA A;  1VQI A;  1HNW L;  1L0W A;  1B8A A;  3H3V I;  3J81 j;  4DR5 L;  1V43 A;  1Q46 A;  2A1A A;  3F1Z A;  4DV7 L;  4IFD J;  2JEB I;  3GD7 A;  1C9O A;  1B7Y B;  4KLK A;  2C35 B;  4A93 G;  2MO1 A;  2UUB L;  1HZ9 A;  4MTN A;  4B3R Q;  4X66 Q;  3KJP A;  3PUX A;  4EQ5 A;  4PMW A;  5C4X H;  1Q8K A;  4JI0 L;  2XTI A;  3KLW A;  3GTM H;  2F4V L;  2R93 H;  4QL5 A;  1KL9 A;  3ULL A;  2VY3 A;  3KDF A;  3OW2 A;  3K80 C;  1WFQ A;  4LUO A;  2VQF Q;  1K0R A;  3G4S A;  4DR6 Q;  3RLF A;  4P72 A;  3U4V A;  3K7U C;  1XJV A;  2K5H A;  1NE3 A;  2ZJQ A;  4JI7 L;  1WYD A;  1PH1 A;  1VQE A;  2OQ0 A;  5JEA G;  1EUJ A;  1KC8 C;  4DR3 Q;  4LFC L;  4DK3 C;  3HOX H;  5LMN L;  4J15 A;  5FLX c;  1E1O A;  3L7Z C;  1KAW A;  4B3S Q;  4GKJ Q;  1KXL A;  2PI2 A;  5M3M G;  1A63 A;  3AYH B;  4AQY Q;  2PQA B;  3CCS A;  2KCM A;  2V1C C;  1VQO A;  3M3Y H;  2EQS A;  2DGY A;  4GLX A;  1KD1 C;  2AWO A;  4DV4 Q;  3DLL A;  4GNX B;  3VDY A;  4A3E G;  1GO3 E;  3E0E A;  4XTC S;  5GAH C;  1I5F A;  5J3B A;  5LMN W;  4BXX G;  4BY1 G;  5FJ8 G;  4K0K L;  1C7Y A;  2JJQ A;  2Q2U A;  3F2B A;  3NEM A;  3I7F A;  1VQL A;  4JI6 Q;  3HOW G;  4WJ4 A;  2LXJ A;  3D0F A;  3UDX A;  4EX5 A;  1D8L A;  2UU9 L;  3TEH B;  5GAD C;  4HJ8 A;  4QY7 A;  4GNX A;  2PNH A;  1U0L A;  1PH2 A;  4LFA L;  1S3O A;  1UEB A;  3Q8D A;  3PF5 A;  4JI5 Q;  3TRE A;  3DM3 A;  2KEN A;  4JOI A;  4X65 Q;  2ZM6 Q;  1UE1 A;  2QEX A;  1XNR Q;  4DAM A;  2KHJ A;  2I5L X;  3HOY G;  4DR2 Q;  3CCL A;  4JI3 Q;  1JMC A;  2NVT H;  1XNQ L;  5K36 G;  1X3F A;  1Y14 B;  4YY3 L;  3CME A;  3KF6 B;  3NBH B;  5ELN A;  4OX9 Q;  3CPW A;  5IP9 H;  4TQU S;  1G51 A;  4BY7 G;  4KHZ A;  1R9T H;  1NY4 A;  5BR8 L;  4DUZ L;  2IX1 A;  4GKK L;  4OO1 I;  2VUM H;  4NXN L;  1FGU A;  4A3G H;  4DV7 Q;  3UE0 A;  3CCV A;  4GOP A;  3HKZ E;  1FJG L;  3ICE A;  2UUB Q;  3EBE A;  4YWL A;  1S40 A;  1TWC H;  3W1G A;  2N78 A;  1TWF H;  2LSS A;  2HQL A;  2JA9 A;  5GRO A;  1YI2 A;  1N34 L;  3I4N G;  3S14 H;  2UUA Q;  1HZB A;  5IT9 c;  3PO2 G;  3CCM A;  1PHJ A;  2JA8 H;  5IYC G;  4A3L H;  1IZ6 A;  4LF4 Q;  1U5K A;  2K14 A;  1PH9 A;  2VNU D;  1Q81 C;  2IY5 B;  1N33 Q;  3BZK A;  1YZ6 A;  2JA7 H;  1OXV A;  4X62 L;  1YHQ A;  4JI2 Q;  1XMQ L;  4DV1 Q;  1FL0 A;  1NMF A;  3CCU A;  4HJ7 A;  2CKZ B;  2YV5 A;  3UDI A;  4OWT B;  3RZD H;  1EYG A;  4A3M G;  4UY8 C;  4DR4 L;  3PF4 A;  1VQA A;  1W2B A;  2Y0S E;  4LW1 A;  4PZ8 A;  3JAM c;  4Y52 H;  3K81 C;  4YHH L;  1Y1W G;  4DR6 L;  2VQF L;  4UPA A;  3KOJ A;  1UWV A;  3M9B A;  4JI4 L;  3GTG H;  3A5U A;  3A74 A;  2HIX A;  1YHA A;  3J80 i;  4H02 A;  3M7N A;  4JBJ A;  1I3Q H;  1E1T A;  3FKI G;  1IBL Q;  3FP9 A;  2WFW A;  3PO3 H;  4PZ6 A;  4GKJ L;  4OWX B;  1HR0 L;  3OTO Q;  4B3S L;  2UU9 Q;  1IXR A;  1LYL A;  1N36 L;  1QZG A;  4IPG A;  3HOZ G;  1EIF A;  1QUQ B;  1CKM A;  1TWH H;  1YNX A;  2VL6 A;  4LFA Q;  5AJ3 Q;  3RLO A;  3UDG A;  1T9H A;  4BA2 I;  1NTG A;  3BU2 A;  1HJP A;  4PZ7 A;  3H0G H;  4OO1 G;  1CKN B;  3M85 A;  2OTL A;  4A3F G;  1L1O A;  2ZTE A;  1SRU A;  4A4I A;  1OTC A;  1EWI A;  2N3S A;  2XGT A;  4ALP A;  1Y1V H;  3ULJ A;  2HHH L;  1KRT A;  2VW9 A;  1MKH A;  2F52 A;  1YJ9 A;  4AIM A;  4NXN Q;  1KRS A;  4LFB L;  2R7Z G;  1EOV A;  4A3D G;  2OTJ A;  4RMF A;  3CPF A;  1FJG Q;  5IYD H;  1JT8 A;  2Z6K C;  1FVI A;  4JI5 L;  1OXU A;  1VCI A;  1SFO H;  1TWA H;  3TQY A;  4X65 L;  2ZM6 L;  1XNR L;  4BBS G;  4C3I H;  1V1Q A;  1N9W A;  2B63 H;  1JJG A;  3T1H L;  3M4P A;  1K3R A;  4OX9 L;  3I4M G;  4YWK A;  3L0O A;  4JI8 L;  3UDF A;  4GOP C;  3RN2 A;  1PH3 A;  4IFD I;  2CWP A;  4GLA C;  3BJU A;  4L5R C;  3FHW A;  4X62 Q;  1IYJ B;  1Q82 C;  1XMQ Q;  3S2H H;  2JA5 H;  4Y7N H;  3HOU H;  1XPR A;  3CCJ A;  4DR4 Q;  2UUA L;  4JBW A;  3RLN A;  5IE8 A;  3L2P A;  4YHH Q;  5GQO A;  5IYB G;  2CWA A;  4YCU A;  4LF4 L;  1MJC A;  4OXP A;  4R4Q A;  2UUC L;  1N33 L;  4JI4 Q;  2HIV A;  4A76 A;  2K5N A;  4JV5 L;  3GTQ H;  2R6G A;  4JI2 L;  2L15 A;  3HKZ G;  1Z47 A;  4DV1 L;  4BBR H;  4HID A;  2UXD L;  5H1S E;  2YTX A;  1Q86 C;  2BH2 A;  5DLQ E;  2RHS B;  2JQO A;  1S72 A;  1PV4 A;  4O2D A;  1HR0 Q;  2KHI A;  5C4X G;  4QJF A;  4HIO A;  1LM0 A;  1X54 A;  2WB1 E;  1N36 Q;  3W1B A;  5M5W H;  4MNO A;  3RR5 A;  1VQJ A;  3CF5 A;  5ELO A;  4DV0 L;  1IBM Q;  3KYH C;  3TRZ A;  5M3M H;  4KI0 A;  4MZ9 A;  1X3E A;  4JI1 Q;  1VQB A;  4DV2 Q;  2I5H A;  3G48 A;  1IBL L;  1SE8 A;  4HJ9 A;  3F8T A;  4HIM A;  4IOA A;  2B3G A;  4BY1 H;  2HHH Q;  1G6P A;  2PQA A;  3K0X A;  3HOW H;  2Y0S G;  2VS1 A;  3OTO L;  4LF8 L;  1YIJ A;  3PUZ A;  4LFB Q;  1N32 L;  1I50 H;  1Z9F A;  3G6E A;  2MFI A;  5AJ3 L;  2YYZ A;  2OQK A;  1PH7 A;  4IPD A;  4HJA A;  4B3M Q;  2AHO B;  3F2C A;  4IFD G;  3S17 H;  4O0A A;  3GTP H;  2IX0 A;  3E9I A;  2JEA I;  3T1H Q;  1LTL A;  3CMA A;  2F3I A;  4DV5 Q;  1AE3 A;  1NMG A;  3BZC A;  3IRB A;  4JI8 Q;  1XTD A;  4LF5 Q;  2CFM A;  3STB D;  4R4C A;  4P75 A;  2DUD A;  3CC2 A;  2NVY H;  2HT1 A;  1J6Q A;  4X64 Q;  4IO9 A;  3E9H A;  4OWW B;  1M1K C;  3KF6 A;  5C44 G;  1SR3 A;  3I4N H;  3PO2 H;  1Q1B A;  2MQH A;  4DR7 L;  4HJ5 A;  4R1J A;  5IY0 A;  1P16 A;  3HKS A;  5IYC H;  2UUC Q;  3CCE A;  5IP9 G;  3ULP A;  1XMO Q;  1X55 A;  4GS3 A;  2R92 G;  2K52 A;  4JV5 Q;  2VUM G;  4A3G G;  3EIV A;  2KBN A;  5FLM G;  4QQB X;  3EN2 A;  2UXD Q;  1YVC A;  1NBW A;  4GN3 B;  1VQF A;  3CXC A;  3AQQ A;  4PG3 A;  1SMX A;  1KQS A;  5LMU Q;  3GDE A;  1I94 Q;  3GTO H;  1ASY A;  1Y1W H;  2QA4 A;  4DKA C;  2CCZ A;  4DV0 Q;  2ATW A;  4A3L G;  2ZTD A;  3CCR A;  5HY6 A;  1QVF A;  4DUY L;  4LUV A;  4IOC A;  2JA6 H;  2ES2 A;  5M5X H;  1A62 A;  2WAQ G;  3NEN A;  3OYY A;  5GAE C;  1WCM G;  3CP0 A;  4JG2 A;  4A3K G;  2JA7 G;  1UE7 A;  2GN5 A;  4DAY B;  3FKI H;  2E2J H;  3J81 i;  2D62 A;  4QIW E;  3S1Q H;  3HOV H;  1E7Z A;  1SN8 A;  2ID0 A;  4LF8 Q;  4KHP L;  1BBU A;  1EQQ A;  1IBM L;  4IJH A;  3S15 H;  2WP8 J;  3A5Z B;  4POG A;  4BA1 I;  2RCN A;  4IJL A;  1I6H H;  1W3S A;  1N32 Q;  2VZA A;  2OWO A;  4JI1 L;  2K5V A;  4A3J H;  2GVB A;  4YCW A;  3HOZ H;  4A3I H;  4DV2 L;  1YBY A;  1TWG H;  2K75 A;  1HR0 W;  4JCV E;  2NZO A;  1PH4 A;  4UP9 A;  1QZH A;  3M4O H;  2D0O A;  1H95 A;  2K4K A;  4GNX C;  4A3C H;  1EFW A;  1QUQ A;  2QGQ A;  1VQK A;  1WOC A;  4DV6 L;  1HNZ Q;  4JBM A;  1IL2 A;  4JBK A;  4DV3 Q;  3ER0 A;  4JOI C;  4TVA B;  2WB1 G;  5IP7 H;  1K83 H;  3J80 c;  1RIP A;  1BKB A;  1CKN A;  4P71 A;  4DNI A;  4LNQ A;  3TS2 A;  2YTV A;  2R7Z H;  4B3M L;  2D0P A;  2NN6 I;  1VQM A;  3KJO A;  5M3F H;  1K73 C;  1JE5 A;  1CKO A;  3ERS X;  1C0A A;  4BBS H;  2E2I H;  3A0J A;  5C4J H;  4A3B G;  4WJ3 M;  3H0G G;  4DV5 L;  3PIO A;  4DR7 Q;  5JJL A;  4AYB G;  1TXY A;  5C3E H;  1SRO A;  1N8R C;  1XPU A;  4LF5 L;  3SGI A;  1CUK A;  3KFU A;  2AKW B;  4UP7 A;  2WAQ E;  1IBK Q;  4NXM Q;  4X64 L;  3PCO B;  3I55 A;  3PUY A;  5IYD G;  3H15 A;  4A93 H;  1HH2 P;  2AWN A;  1CSP A;  2IT1 A;  1PYS B;  4OON A;  1QVG A;  1KIX A;  3PSI A;  1SLJ A;  5IWA Q;  1WJJ A;  2MO0 A;  2ZTC A;  1OXX K;  3GTK H;  4GLV B;  5HGQ A;  4C3H H;  1HZC A;  1XMO L;  5EAY A;  4DUY Q;  1HNX L;  2UXC Q;  3F2D A;  2BA1 A;  2K50 A;  1YEZ A;  4JC0 A;  1JJ2 A;  2E5L L;  1X3G A;  3GTL H;  3GTJ H;  3KDF B;  2JA5 G;  3HOU G;  1OXT A;  4R4T A;  1YIT A;  1YJW A;  1PH5 A;  5LMU L;  4KHP Q;  1DGS A;  1P8L A;  2EIF A;  1I94 L;  3S24 A;  1PH8 A;  1MJE A;  2R93 G;  5JJK A;  3T1Y L;  1B70 B;  3MXN B;  4XIG S;  4LWC A;  2CQO A;  3AEV A;  3CD6 A;  3PIP A;  3WWV A;  1VQP A;  4A3E H;  1O7I A;  1VQN A;  4AYB E;  1VQC A;  1VQH A;  1HZA A;  3W5O A;  5FJ8 H;  4BXX H;  4BBR G;  3PV0 A;  2NN6 G;  4C3J H;  1E3P A;  3RNU A;  2A19 A;  4DV6 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...