4QB4A

Crystal structure of staphylococcal nuclease mutant v23l/l25v/v66l
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTLKVMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal Structure of Staphylococcal Nuclease mutant V23L/L25V/V66L
rcsb
source organism Staphylococcus aureus
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4qb4A00
2EXZA 2EYFA 4F8MA 5KRUA 3D6CA 4EQOA 2EY5A 4TRDA 1KDAA 4R8NA 4I65A 2PW7A 3DHQA 4QF4A 4DU9A 4ZUIA 5J39A 5CR3A 4K2LA 2RKSA 4K6DA 5E3FA 5EKLA 4DF7A 3SK8A 4KJOA 2PYKA 1JOQA 4N9TA 3BDLA 3ITPA 3MXPA 1SNMA 2OEOA 5IIFA 5F2DA 3TP6A 5M9OA 3NP8A 4IZ8A 4S3SA 2F0WA 1RKNA 3E5SA 5JOBA 3MVVA 5KGUA 5EGTA 5DAUA 5I6YA 3LX0A 3QOLA 1SYBA 5CV6A 2F0VA 2F0IA 1F2MA 5E1FA 1SYGA 4KD4A 5IOCA 4ZQ3A 1KAAA 5IGFA 3NQTA 2F0EA 3QOJA 5CV9A 3D8GA 4DFAA 4PNYA 4K14A 2F3WA 4DGZA 2EYJA 2EYPA 1EY9A 4EVOA 2F0HA 1ENCA 2EY2A 3C1EA 3OMCA 5ISRA 3C1FA 1A3VA 5C4ZA 5CV7A 5IGEA 3SK5A 1A3UA 4F7XA 3TP7A 4IUNA 5DEHA 4EQNA 2WACA 4NP5A 5I6WA 5I9OA 5IGDA 2PZUA 5J1ZA 4B9WA 3VA5A 1EY0A 1STYA 2F0MA 5C5MA 5J22A 3TMEA 4KY5A 4J1MA 3RUZA 4NKLA 1A3TA 1STHA 1NSNS 2KQ3A 1AEXA 3EJIA 3V2TA 2RDFA 1TT2A 1SYFA 1A2UA 1EQVA 1STBA 3H6MA 4HTHA 2PZWA 2F0SA 4ID6A 2EYMA 1IHZA 2QDBA 2F0NA 4H7BA 4N9PA 4ZUJA 1II3A 3SXHA 4QMGA 5C5LA 1EYAA 2F3VA 3SK4A 5EKKA 1ENAA 2PW5A 4K8JA 2F0FA 2F0GA 3T16A 1STAA 3OMGA 2OXPA 5NUCA 4HMIA 2PQEA 4QB4A 1JOKA 2SNSA 2F0UA 2F0KA 4ODGA 3D4DA 1EYCA 5C3WA 4PMBA 1SNDA 5JAVA 1SYEA 1EY7A 5IODA 1EZ6A 1NUCA 1STGA 2HQEA 2NUCA 3NK9A 2EY6A 1KDCA 3MHBA 3OWFA 4E6IA 5KYIA 2O4XA 3TP8A 2ENBA 3NXWA 5KIXA 3MZ5A 3MEHA 4K5VA 1EY8A 4MIUA 5IGGA 5CV5A 4WORA 5C3XA 2M00A 5CGKA 3HEJA 4KD3A 3P75A 3D4WA 2F0LA 3QB3A 4K8IA 4KJNA 1F2YA 5CV4A 2RBMA 4YIJA 5CV8A 2SOBA 4WRDA 3HZXA 2LKVA 1SNOA 3P1HA 1U9RA 4K2KA 1EYDA 4NDXA 4EQPA 1SNQA 5IGBA 4KHVA 1TQOA 5KEEA 2PZTA 3SHLA 1SYDA 3SK6A 5CC4A 5KYLA 4HMJA 2EYHA 3R3OA 4K5WA 2SNMA 5C6AA 5K5PA 5HURA 1EY6A 1JORA 1A2TA 1EZ8A 4J6HA 1F2ZA 2F0JA 3SR1A 1EY4A 3TP5A 4B9XA 4KTAA 2F0PA 3OSOA 4LAAA 3U9OA 1TR5A 4RKLA 5HGTA 2KHSA 1JOOA 4G57A 2F0OA 4IALA 3DMUA 4OL7A 5C4HA 3PMFA 2OF1A 2F0QA 3BDCA 4KY7A 4KV6A 2EY1A 1STNA 3T13A 1KDBA 3NHHA 2F0TA 1SNPA 4PMCA 4KY6A 2F0DA 4K5XA 5IGCA 3NUCA 4ME5A 3S9WA 2EYLA 5I9PA 3ERQA 3EVQA 4RKBA 1SYCA 1EY5A 3EROA 4NMZA 1SNCA 2EYOA 1KABA
chains in the Genus database with same CATH superfamily
5KRUA 2CKZB 2EY5A 4O0AA 4RFBA 1P8LA 1VQAA 1PH9A 3KLRA 1VQ8A 3ERSX 3HKZB 2ICEC 4A3MB 3MTSA 4XQJA 3NQIA 1HZBA 4BA1I 1G2TA 1K8AC 1WTVA 2UXBQ 3D0FA 1B8AA 3AYHB 1LTAD 2PPBC 1MJCA 5GAHC 4N8FA 4B08A 1G2SA 3N52A 1WTXA 3PCOB 1O7YA 2K33A 3KBGA 2EY2A 3GTQB 5GAGC 2JA6H 3C1FA 3S1MB 4H13C 2P5ZX 3FKIB 5I9OA 3NWTA 4MZ9A 1RIPA 3G71A 1GM5A 4UDUC 4X64Q 1FGBD 4JI8Q 3D31A 4DUYL 3O13A 1Y69U 1NMGA 4A3GG 3NTKA 3V2TA 4YCUA 1M4VA 3H6MA 3JAML 2K05A 3R2IA 3CCSA 4QMGA 4A3KB 4RCNA 1KRSA 3SK4A 1H9RA 2BDOA 1E0BA 3GTOH 1H9KA 1PRTC 4DAVA 2UUBQ 2EJGC 3M9BA 5FK9C 3WDNA 2ZTCA 3HOUB 4PMBA 3F2BA 1LLRD 1BNZA 1U4LA 3OHXC 4LNQA 5IYDH 5C44B 3OWEB 5EPJA 1U5KA 4JI2L 1B4OA 2HHHQ 3A7LA 3EA6A 4GLAC 1B53A 2R92G 3BG3A 1WYDA 4JBWA 5CV4A 3BU2A 3FPUB 4A3IG 3EIVA 3TRZA 1ICFB 5KEEA 5KYLA 2PZTA 1K8MA 4IFDG 1M1KC 1NAPA 5C6AA 2SNMA 3CCQA 4X62Q 3HOVH 1EY6A 3J7AV 1EL0A 4KTAA 4DV0Q 3I4OA 4A3JG 4X66L 2A6HD 2I5HA 1PTOD 4KY7A 3T1YQ 1UAPA 1TY2A 5I2XA 2XSCA 4A3LG 2H4OA 4PMCA 1HFGA 1CZGA 1S5BD 3J81c 5IP7G 3S16H 4IFDI 4U673 4HJ8A 1N33L 2EXZA 2Q2UA 4EQOA 4JV5Q 1PVOA 2I0QA 1HNXQ 1VQJA 2ZTDA 4K2LA 2JE6I 5ELFA 3PF4A 1WTPA 1D5XC 4IQZA 4A3MG 5M9OA 1XYIA 4A76A 4CKCA 4IPDA 2NTSA 1C7YA 1G6PA 1WI5A 2Z0SA 5JJIA 4BY7B 5IGFA 4DFAA 3BVMA 1YNJD 1PTOB 4XT3B 3C1EA 3F2UA 2DN8A 1A3VA 3STBC 4C2MB 1VF5C 4LF9Q 1QCBD 1HH2P 4NXMQ 1TWAH 4B9WA 1G91A 1STYA 3E0EA 2NVQB 3CAMA 1MGSA 1JR0D 1WJJA 1NSNS 2UXDQ 1MKHA 1CK1A 1FYCA 2E2IB 1CA5A 1EQVA 2PZWA 3PO3H 3R2TA 4FVMA 4FNFA 2VY3A 4B3RL 1CKNB 2L15A 3S1NB 3VYSA 1F9RA 2RSNA 5I4DA 2PW5A 2PMZB 1EFID 3M4PA 4P72A 4P74A 1XTCD 2XVSA 1Q46A 3GTGB 4A93H 4C3JB 4A3EH 4QY7A 4CDDC 2A5HA 2Z6KA 2V1CC 1JQYD 4ZK9B 3I3CA 3S24A 4ULLA 2Z1CA 1K8OA 2LS01 2VS1A 2WAQB 5IGGA 1SLJA 3SGIA 1QUQB 1RDPD 4O2DA 1G8ZD 3FHWA 3L7ZC 1LACA 3P75A 3QR8A 5CBAE 3IAYA 5CV8A 1KHIA 1B9MA 1KC8C 1B2TA 3K5OA 5T1IA 2JN4A 4FP5D 3OPOA 4LUVA 1PZJD 1QE6A 3HFZB 1LYLA 2VNUD 3CCEA 2BE5C 2WB1G 2HD3A 1XPRA 2JA6B 1WTHA 4GOPB 1ILPA 1O78A 1QNKA 3UDGA 1B7YB 4KY6A 5I9PA 2FXQA 1EY5A 5E4WC 1HFNA 1IBKQ 2LMCB 2K32A 1HNZL 2KJXA 4LF5L 2VUMH 4JI7Q 2E2HB 5K36H 1XMQQ 3VR5A 4J15A 3SK8A 4KJOA 1SE2A 1I94L 3PO2H 3N6RA 3TP6A 3S1QH 1DOKA 4V0BA 2EVBA 3ULJA 1B3AA 2F0IA 2NVTH 1X3EA 4DGZA 3A8IE 3ULLA 2EYJA 3K5NA 1MIUA 2ZM6Q 4PQXA 5IGEA 1PV4A 1IKLA 1KIXA 1A3UA 1H9SB 1BCPC 4HJ9A 5LL6X 3S17B 1R4PB 1YZ6A 1X55A 2VQEQ 3L3OC 1Q7YC 2B29A 1STHA 1S3OA 2NVXH 1A2UA 1TWFB 2K52A 4DV5Q 4DAPA 4DPGA 3VYTA 1Y1WB 4XYQA 2IHEA 3PIP3 5LMNQ 2R7DA 1KQSA 1GUSA 5A2QL 2Q8RE 2VQFQ 4LFAQ 5DLQE 3CC2A 3S16B 1STGA 4C3JG 4CKEA 1IBML 2EY6A 3SVMA 5GADC 3J7ZC 4BY1B 5FLXL 2HCIA 4K0KL 1GHKA 2M00A 1SE4A 1B44D 2F4VQ 4K8IA 1VQ4A 3OIPA 1W2BA 2R7ZB 1D5ZC 3I8ZA 1J5EQ 1R9TB 1SNQA 2MQHA 4UPAA 3SDZA 5IWAL 1QOHA 2F0JA 1A8VA 2A69C 1D1IA 1Q1EA 4AH6A 1C4QA 3MXNB 4H02A 4OL7A 2AQ3B 2OF1A 3KLSA 1QJOA 4AYBG 4RGTA 2JA6G 1VQ7A 2E5LL 1I3QH 1WCMB 1TWAB 4A3BB 1MHWC 2SDFA 2F3IA 4RKBA 2RDHA 1SNCA 2EYFA 1H9MA 3ND9A 3S2HH 5JJKA 1UWVA 2ZXPA 2QDLA 2HDMA 2CWAA 2ES2A 3BDLA 1DJRD 2N8NA 4L5SA 3RD4A 4FF2A 4TKOB 2K50A 1E7ZA 1HZ9A 1JWMD 5IT9c 1RKNA 5JOBA 1YIJA 3IFDA 2F3WA 1KTKA 3W5OA 5IYDG 1YI2A 4F7XA 4NXNL 1T9HA 3TP7A 1I4QA 4FDBA 1M8AA 1N9WA 5IGDA 4Y7NH 1HQRD 3K5MA 3HP3A 1QNUA 1OXVA 1LT6D 3TMEA 1X3PA 3TEHB 2G5DA 3NELA 3DUZA 1I4GA 2A1AA 3RR5A 2MO0A 1JC7A 3DWQA 3KF6B 4DNTB 1GHJA 2B2VC 4R4CA 1N8RC 1TVXA 4P71A 4DV2Q 4FF4A 2OTJA 1SSOA 1NBWA 3HOVG 1JMCA 2L5TA 2ZJQA 3AFPA 1VDZA 4JG2A 1EOVA 1K0RA 4ODGA 3PSIA 2CH4A 4PZ7A 2ZXOA 5IT9L 2HQEA 4N8X1 2XGTA 5HGQA 5JPMC 3PIOA 2Y0SG 5HY6A 3CF5A 4RCOA 3CRKC 4HSPA 4K5VA 4P73A 1YBYA 4TVAB 3RLNA 4BY1G 4CBVA 1HR0W 1YJNA 1EOTA 3CMAA 3PO2B 2KOLA 4G7HC 1XXGA 1DYQA 4PMWA 1VMPA 5GROA 4JBMA 2HIXA 2UUCQ 2R7ZG 2HUGA 3H94A 4BWGB 3R3OA 2QEJC 1VQMA 1EZ8A 2KEDA 2NVTB 1EY4A 1CTMA 4KKUA 1K0SA 2A6HC 1PTOC 3GTQH 1HUNA 4DR5L 1B50A 1B9NA 2HCCA 1XTDA 3A5ZB 3LNNA 3OW7A 1ML0D 2BOSA 2Z4IA 5D3IB 2CVRA 1XMOL 3FKIH 4B3ML 3S1MH 1E3PA 2JA7B 3KK7A 4NMZA 3PUWA 1U4MA 2A8VA 2KENA 1HQMC 2Z6BA 4QF4A 1QVCA 5GAEC 1HNWL 5E3FA 5CORA 4LFCQ 3PO3G 2JA5B 4A3KH 1UE5A 2AMCB 2BE5D 2IX3A 4KHPL 4JYAL 3V96A 5IE8A 1EIGA 3TDQA 1YJWA 3GTMB 1J6QA 2AWNA 4JCVE 1TKWB 1ZEQX 1L0XB 1VQ6A 4OO1H 2FFKB 2RVLA 3I73A 3PUZA 3WWVA 3HOUH 1UE7A 2G9HD 1YNJC 4A93G 2EYPA 2XRSD 2H5XA 2MO1A 2RF4A 5ISRA 4JI4Q 1AE2A 4HAEA 5C44H 4A3EG 4JI1L 1I6VC 1GKHA 1WTQA 3D4RA 2ZT9C 2VB3X 3NBHB 2O5JC 2XWJB 3CCRA 5EPLA 1CM9A 1S72A 1XNQQ 1D5MC 5EQ0A 1XJVA 3MFYA 3T1HL 5FLMH 1AEXA 2NN6I 1EUJA 3S1RH 4X65L 1PH5A 4PZ6A 1IHZA 2QDBA 4AIMA 1ET6A 3G6JB 5C4JB 4ALPA 1TS3A 1LTRD 1U0LA 2GVAA 1ENAA 2AHOB 3H0GB 3UDFA 1IBLQ 4A3FH 4GOPC 3BZCA 1XWEA 1ESRA 3BYYB 2F0KA 3X3NA 2R7FA 1BCPD 1ET9A 1HTPA 4ILWA 4M8AA 1EY7A 3H3VI 1Y8OB 3NK9A 1OXXK 4E6IA 2EQSA 1E24A 1E22A 4KLKA 5C4XB 3S2HB 2B8GA 4YY3Q 3J80c 5CYUA 2VUMG 4DUZQ 3I72A 1YHBA 1LT5D 1PFSA 1SJHD 5K36G 2JK8A 4ZKCB 4OELB 4JI6L 1PRTF 1C48A 2QILA 3CCJA 3KJPA 3BZDB 3PO2G 3OYYA 3F2CA 3HOZB 4BY7H 4LFBL 4JI5L 2Z9HA 1VCIA 1PTOH 3U4ZA 4C2MH 4DR3L 2EY1A 1NJIC 3PUXA 4QUFA 4LF4L 4DR6L 1Q8IA 3AEVA 4Y7NB 4GKJL 3U58A 1NY4A 3UE1A 3EROA 3Q6SA 2NVQH 1RCVD 1G51A 2O2LD 1N34Q 1C8CA 4O42A 3NENA 2E2IH 1IXRA 4ZUIA 1X3FA 4JI0Q 5EKLA 3QIAA 4KKSA 2Q2TA 1IKMA 3ITPA 3CPWA 2MJ8A 3MXPA 4DV6Q 2OEOA 1DCZA 4X3SA 1BR9A 1HZCA 3DEPA 1HXYD 5DAUA 1HZAA 5I6YA 3QOLA 3GTGH 4PZ8A 5BN4A 4ZQ3A 2L12A 3QOJA 2F0HA 3OMCA 5T1GA 4APVA 5LMNW 3S2DH 2VZAA 2ZXRA 1VQGA 3W3AA 5M5YB 4M1UB 1I4PA 4NP5A 2IY5B 1A6XA 1VQDA 1OO9B 3FRPB 3AU7A 1EY0A 4WFN3 4OWXB 4KY5A 1RF2D 4U68A 1RL2A 5C3EH 3TBIB 1RHPA 1PH6A 3DLLA 2EZVA 2F03A 4JI8L 2H1EA 1II3A 1UEAB 3SXHA 2ZJPA 4Y52H 1EYAA 1EWCA 2F3VA 1A15A 5EKKA 5ELBA 1CQVA 2IW3A 1L1OB 1Y8NB 4Q0FA 2F0FA 2B2UC 5KNCA 4HIMA 2F0UA 1V43A 2WV6D 2NUCA 2X6LA 2WINB 1K3BC 3I4MB 2K04A 4DR7L 4XIGS 3E9HA 2I5LX 3RLFA 2E2HH 1SROA 5C3XA 4B3SL 4TSSA 1JICA 5C4XG 5DM73 2KA7A 1STEA 4BBRB 1GUOA 1PZKD 3K6OA 2HHHL 4X3KA 4GKKL 1I5FA 4KMUC 5CC4A 1VQKA 1NTGA 4J6HA 2B2WA 4PV1C 1TIID 4G57A 5JVH3 2GVBA 5C4HA 4OGQC 1GJXA 1VQ5A 3G7LA 1IW7C 1QWYA 2N55A 2OTLA 3S17H 4WJ4A 4F87A 3HKSA 1RTNA 4DUYQ 3MZ5A 2K14A 3DXJC 4RMFA 3T1YL 1R4QB 3H3VC 4LF7L 3HGBA 3S1RB 1TWFH 1IL8A 1N36Q 2D0PA 1FJGQ 4JK1C 4UY8C 2K5VA 1Y1WH 4KKTA 2JEBI 4JV5L 5FJ8H 4C1NI 1OXSC 4A3FB 1K9MC 3IKJA 3VR3A 2L1BA 1HNXL 3U9SA 4XQQA 1HR0Q 4KK7A 1SYGA 2LSSA 4DV7Q 3FMCA 2DNEA 2F0EA 3QJYA 2HT1A 4R4TA 3CC7A 3DWAA 5M3MB 5DNFA 1I6HB 4BY1H 4DA2A 1F9PA 4QGUA 4NW2A 4DV3L 3T51B 2B2VA 4YHHQ 4ZAIA 3VA5A 1IL2A 2KQ3A 3HKZG 4LF9L 2R7ZH 1R9TH 3H91A 2F0SA 2NZOA 1AN8A 2F0NA 5LMUL 2E76C 4G7ZC 1J8IA 1LTID 4A3DB 1CZWA 2SEBD 2UXCQ 3I56A 4ZCKA 4A3CH 1JT8A 1BCPF 2B3GA 3KLWA 1EYCA 5C3WA 1SNDA 1WCMH 4A3BH 2YTYA 3OTOQ 3FKIG 2F1MA 4GNXB 1JE5A 1N33Q 1DONA 1PHJA 2PNHA 2R93B 4MTKA 2KCNA 1TWHB 2IT1A 2CCZA 1Q90A 1K83H 2N88A 3F2DA 2RBMA 2F4IA 1CHQD 4A3KG 2IPKD 4KHVA 2VXWA 2NN6H 3JAME 3UDXA 3A5UA 3NWSA 2JP1A 2PNRC 1F9QA 4CDFC 3RMHA 3SR1A 4DN4M 1VQBA 4OO1G 1EFWA 2F0OA 3HOUG 2DY7A 3S2DB 1SE8A 3BDCA 3BVZA 2K5WA 3HOXH 4FF1A 2DUDA 2AUJD 2F0TA 3CHBD 4K6LA 5C44G 2F0DA 4LUOA 1X56A 1CKNA 5IYBH 1FR3A 2Z4HA 1KNAA 3TSSA 2BH8A 4F8MA 5C3EB 1YVCA 2J4XA 3H3VH 3G48A 4JC0A 1YITA 5FLMG 1H9JA 2QA4A 4OO1I 2XWBB 1IBKL 1GUTA 1T5EA 1CQFA 3PUYA 3NP8A 4JI7L 1VQIA 2ID0A 1ASYA 1XMQL 3LX0A 4A3FG 4B3TQ 1F2MA 1DD2A 5C0XJ 1QUQA 1PZID 4GLVB 4CJ2C 5AJ3Q 2LY7A 4HR7B 1YHAA 1V9PA 1DZ1A 3SK5A 3AQQA 5I6WA 2WACA 3EN2A 2PZUA 1V1PB 1SN8A 1DXMA 1DOLA 3GTJH 2VB2X 2MHVA 4DNRB 1SMYD 1QVFA 1ONLA 1NR2A 4GOPA 1STBA 2EYMA 4C56C 2DJGC 2K7VA 5FLXc 2WFWA 2E75C 4R8IA 1EIYB 4BY7G 3M3YB 3G4SA 3U4VA 4CGYB 4QB4A 5LMNL 4MNOA 2CW0D 3OIQA 4DK6C 2LXJA 5JAVA 5IODA 2JA7H 4DR4Q 2BA1A 1KDCA 2K5QA 1SBBB 2DNCA 2ENBA 1HNZQ 5EAYA 3ULPA 3BS1A 1TS2A 4I7ZC 2WP8J 1SFOB 3CW2C 4IPHA 4JW0A 1UUPA 3QB3A 1FVIA 1Z7TA 2JA5H 1K3RA 3CP0A 2LKVA 4C3IB 1U9RA 1K28A 3GTMH 3SHLA 1H9SA 2F4VL 3J81E 1F2LA 5HURA 2D9UA 2QCPX 1A2TA 3QO2A 4B9XA 2K6AA 1J5EL 1V8QA 2F0PA 2JSOA 3OSOA 3U9OA 1ZYRD 5FO7B 2B63B 1STNA 2C35B 3MAQA 3QWNA 2IX0A 3ERQA 3T56B 2MP1A 2WAQG 4XYOA 1BBXC 1PFMA 4XQNA 1LO5D 4LF8Q 2UU9L 2C9OA 3GD7A 2J7ZA 1KDAA 4R8NA 4L63B 3M85A 2PW7A 5C3EG 4LJZC 5J39A 5C4JH 1ESFA 2A68C 1I4RA 3GTPB 3R8BA 1NCVA 5IIFA 1L1OC 1PTOF 2KBNA 3H0GH 4S3SA 1CT1D 3DWPA 4JI3Q 3SEBA 1E1TA 5E1FA 1IW7D 5CV9A 3RN5A 2MGSA 5KNDA 4G7OC 1BQQT 2YV5A 4EVOA 3VR4A 3ONAB 2ASBA 2B2WC 4OEMB 2A19A 5C4ZA 5CV7A 4DAYB 5C4XH 1LTLA 4K0KQ 1K73C 1K83B 1NR4A 3NTIA 2D5DA 1A3TA 2A6ED 2XNAC 2JA9A 1GUGA 2NZHA 3I4LA 3MXNA 1VQFA 1DGSA 1HUMA 2B2UA 4HTHA 4ZUJA 4C3HH 1TU2B 4EQ5A 3HOZH 3KF8B 1WVLA 4OHJA 2LFNA 3IL8A 2PQEA 1SEBD 2WB1E 3HOXB 5H1SE 2OWOA 1DM0B 4DV2L 2ICIA 2E5LQ 3A8KE 1LTSD 1EU4A 3I2ZA 4LMQD 1A63A 3NEMA 1KLUD 2JA8H 3BVGA 4WORA 2Q8IB 4HIOA 3W1BA 3VR2A 3C3LA 1Y8PB 2NVYH 1Y1WG 3CCUA 3RZDB 2KVMA 3DM3A 1TQOA 4O1NA 4UP9A 3C46A 4ZYSA 5FJ8G 4HJ5A 4X3TA 1BF4A 4CJ0B 5JEAJ 4YWMA 2PQAB 4OIJA 4QJFA 3L2PA 3G6EA 3A0JA 5LL6S 1M90C 5A2QE 1JOOA 5JPNC 2UUCL 4IALA 1JE4A 2VL6A 5M5YH 2KUMA 5D65A 1PYWD 3KF6A 3K57A 1Q3LA 3NUCA 2EDGA 3EVQA 3CU7A 4GN4B 1SYCA 3GTJB 4JBKA 2PO4A 1O7LA 1KABA 1K8GA 4POGA 1CI3M 5TSSA 1PFNA 2RCNA 4TRDA 3ND8A 3DHQA 4JOIC 5CR3A 1PH1A 1UEBA 1BBWA 2E8GA 2RKSA 2UUAL 1AW7A 4UAIA 1XPUA 1JOQA 1XNRL 1ZXTA 1SNMA 3LWUA 4RG1A 2MNAA 1O7ZA 3KDFB 5EGTA 4IUTA 1SYBA 4A3CG 1Z47A 4XT1B 2PMZE 3NQTA 3CCLA 3E3XA 2QKIC 5C0XH 3GTLB 1IYJB 3P7JA 1ENCA 1ZKOA 2E2JB 5E7NA 1HHVA 4GNXC 2NB0A 1WCMG 1N32Q 4A3BG 3I4MH 4RHSA 1IZ6A 5DEHA 5IYCH 1CA6A 4RH6A 4JI4L 3AB9A 1PH4A 3RUZA 5BR8L 3EJIA 4DK3C 1S5FD 4BBRH 1VQPA 3CC4A 1XNQL 1X3QA 1B3QA 2Q2HA 2JQOA 2YU9B 3GDEA 2KCMA 2NN6G 1NNXA 1JJCB 4OX9L 3VDYA 1PYBA 1EWIA 3HRZC 4AQYQ 2GN5A 2Z8LA 1O7IA 4L5RC 1U4PA 3HOXG 4AYBE 5M5XB 1VQ9A 1J9OA 5IYBG 4FF3A 4DR2L 4MIUA 2A74C 4R4QA 1E2ZA 3HEJA 4HIDA 3MFGA 4YCVA 1SDFA 2F0LA 4YIJA 1EQTA 1SNOA 4IOCA 1EWHA 4YY3L 4DV4Q 3C2PA 1MSHA 3K5LA 3L0OA 3NBHA 4IPGA 2K03A 4GN5A 4J8QA 1Z6HA 2IWHA 2JYOA 2D62A 1YNND 1JB3A 5M3MH 1OTCA 1I6HH 4XXEA 3PMFA 4RGMA 2X6GA 3URYA 5EPKA 4JI1Q 1KDBA 3NHHA 3GQBA 2CHBD 4LF6Q 1TWCH 2MFIA 1EU3A 3S14B 4KI0A 1H95A 3Q0AA 5IT9E 2I07B 3I7FA 4WJWA 3GO5A 2L11A 2DGYA 4H44C 3T1HQ 2CQOA 4KN7C 3JAMi 5GQOA 4IUVA 4A3GB 4C3HB 1D2BA 4DXGA 4IO9A 3E9IA 3HOWH 5BN5A 4A3DH 1YHQA 3FVQA 4QIWE 3IRBA 1PA6A 1CSQA 4DXFA 3MEFA 3K81C 4JI0L 2BCOA 1D8LA 1RTOA 1BKBA 4HN7A 5IOCA 3CXCA 2K01A 3U50C 4CJ1B 4DV6L 2EOTA 2ALYB 2XIWA 2NTTA 4C1NK 2JA7G 1S4ZA 3I70A 3A54A 4I7AA 3WOFA 2JA8B 4RGNA 2IL8A 5D14A 1W3SA 2YYZA 2Y0SE 2R93H 3BZKA 1QVGA 1TWHH 4X3UA 3W1GA 1HTLD 2F0MA 2K4KA 1SMYC 4DR1Q 2A68D 3J7A5 1D1KA 3NE5B 2NVYB 2LXKA 4CDCC 1JWSD 2R92B 4CHTB 1KD1C 2JA5G 2JJQA 1XPOA 4N9PA 1WTOA 1C0AA 4DV1Q 3MC0B 2CWPA 4A3IB 2BA0A 2TSSA 3RNUA 4LFBQ 2VW9A 2UXBL 3M7GA 2GA4B 4HMIA 1JOKA 4L6TB 3K80C 2KECA 4A3JB 4LF4Q 2CW0C 1JCKB 4RGOS 5JVG3 5M5WB 2TMPA 1PH3A 3OWFA 4DK1A 1GVPA 1LM0A 4JVZA 1QB5D 4X64L 3CRLC 3A7AB 1U4RA 2Q8TA 4QQBX 4DKAC 2SOBA 1V1QA 5BN3A 3AMUA 4KHZA 4P2CB 4YCWA 1HA6A 1LTTD 4QL5A 5AFWA 5IGBA 1I4HA 3IFTA 1SYDA 4ABNA 3H0GG 2IX1A 4FYDA 1PH7A 1PDQA 2NYZD 5JEAH 2PI2A 1ZYRC 2UUBL 2I46A 5I2YA 5IGCA 1QZGA 1S5ED 2NWGA 1CKMA 1I4XA 1L1OA 4ME3A 4UHVA 5KNBA 4IPCA 3T53B 1OXUA 3J81i 1Q1BA 3B6YA 4IURA 1F9SA 1SRUA 1MSGA 2ATWA 4C3HG 5F2DA 4IZ8A 3HOZG 1N36L 3M3YH 5KGUA 1FJGL 3K58A 4X62L 1XX8A 4X6AH 3F8TA 4WJ3M 2AQ2B 4KD4A 2R61A 4DV0L 4K14A 5JJLA 3UE0A 1F77A 3TN2A 5CBEE 2G9DA 1JWUD 2ZTEA 5IP9H 5M3FH 1HR0L 3LWEA 4DR7Q 4DV7L 2AQ1B 2AWOA 5FOBB 4B3SQ 2JA8G 1SFOH 1WOCA 1DOMA 3S15B 1TXYA 2A6EC 3D3RA 3K0XA 4C3IH 2JXMB 4ID6A 1G6ZA 3OW2A 4L8JA 4YHHL 4GKKQ 1W6JA 1KL9A 1FNWA 2EIFA 3FP9A 4FO2A 2R3ZA 1D6EC 4A4IA 1PYSB 3T16A 1STAA 4TQUS 1Q81C 3J80E 2WB1B 5EKIA 4JI2Q 2B63H 4DNIA 3D4DA 1TWCB 3KUPA 2UXCL 1B1ZA 4OWWB 1AP0A 4XDXA 1UE1A 1AZQA 1AFPA 5EJWA 1TY0A 2KHIA 3NXWA 1X6OA 4NXML 2DY8A 4LF7Q 5CV5A 3J7YW 3OTOL 3HOWB 5CMDA 2M9VA 4KJNA 1VQEA 3GTPH 2UXDL 3VR6A 1WD1A 3HZXA 2AKWB 2MPMA 3EQLC 1EYDA 3TZDA 1RJTA 4X66Q 1Y14B 2Q2IA 3SK6A 4ZRZA 4FXGC 1L0WA 3RLOA 3EFXD 3BJUA 1SJED 3E6ZX 4BBSH 1TR5A 4RKLA 3EBEA 5C0XG 3T13A 3TZUA 4JOIA 3DEOA 4DV3Q 3I4MG 4HCEA 1T5XD 5EBDA 3ER0A 3K7AB 2RHQB 5IYCG 2K5NA 2IHFA 2I5MX 4BBRG 5LMUQ 4IUUA 5C0XI 4IFDJ 1LV9A 5E4XA 3KLSX 3I91A 4GNXA 2F0WA 3HG9A 2CFMA 3MVVA 3J81L 1I50H 3I4NB 3GV6A 2IJ0A 1BBUA 4LK1C 1KAAA 4MTNA 1Q12A 3PUVA 4IJHA 3A56A 5G3LD 1EIHA 2EJMA 1HCZA 4R9WA 3Q22A 2EXDA 4B3TL 2K5DA 4CDEC 4HJ7A 1KNEA 1VF7A 1X54A 4IUNA 4OONA 1UNSA 2L55A 1PH2A 1VQNA 4RHRA 2K75A 5J22A 5AJ3L 4J1MA 4B3RQ 2EE1A 3M4YA 1YNXA 2RCFA 3CPFA 1SYFA 2V4DA 1Y1VH 2N78A 3RZDH 1JJ2A 1KXLA 2B2YC 4R1JA 1PMRA 1QILA 5C5LA 1PLFA 1FL0A 2HDLA 3HS0C 1X9NA 3PIO3 3A8JE 3VA7A 4GN3B 1VQOA 2B2TA 5NUCA 4F88A 1IYUA 1SAPA 4IUPA 1KLGD 5M3MG 3J81j 1VQHA 2OQ0A 4EGVA 1SYEA 4AYBB 1NUCA 1KAWA 2ZM6L 1WTRA 5KYIA 1CHPD 5KIXA 4DAMA 2JEAI 1GUNA 3ICEA 2VQEL 2YTXA 4DR4L 1CUKA 3TS2A 1BUVT 3HOWG 5EBCA 4WRDA 4A3DG 2CQAA 4DV5L 1BVSA 5IY0A 4Q5VA 4NDXA 1IYVA 2E2DC 3AFQA 5K5PA 1V1PA 1F2ZA 3TP5A 4BXXH 3GTOB 1YNNC 1O80A 2KHSA 3GTLH 2E2JH 2F0QA 5M3FB 1MD2D 4KV6A 2VQFL 4LFAL 2O5IC 4LF5Q 3CCMA 2NBFA 2EPBA 1SNPA 2WIIB 4K5XA 3TQYA 5ELEA 3FEWX 4YWLA 1LTBD 2R93G 4L5TA 1I94Q 1EIFA 1A62A 2OCEA 5JJZA 1OXTA 3P20A 3KOJA 1YJ9A 4IOAA 3HKZE 2XTIA 3MWYW 3PGZA 4IN3A 2PYKA 4BA2I 2PCFB 2YU9H 4LF8L 3GTKH 2AUKA 2PI2E 2CH4W 4QIWB 2KCCA 3NPPA 2RSOA 4OIKA 1C9OA 1ICWA 4MHEA 1LABA 3A74A 2F0VA 1Q86C 1VMCA 3HOVB 2N49A 1E2VA 2L4NA 3I4NG 1WFQA 1EY9A 5M5XH 3HOYH 4JI3L 4GS3A 2DJFC 2E74C 3MXGA 4P75A 3BDOA 2M2LA 2Y0SB 3UI2A 2NZ1D 5C5MA 2L9HA 4JPBW 1SR3A 2RDFA 3MA2B 4QCLA 4XTCS 1FNVA 1TS4A 2K1BA 1PFBA 1MJEA 3D6WA 4BBSB 2HIVA 2OQKA 1LTGD 1PRTD 3OMGA 1IBMQ 4KN4C 1RODA 5JEAG 4UP7A 3L9AX 5A35A 1VS0A 3A55A 3S14H 1P16A 4QUCA 2O4XA 1BOSA 2UU9Q 1EEID 3MEHA 3KYHC 4POFA 4LWCA 4A3GH 1GUWA 1TWGH 3NBIA 1HPCA 5IWAQ 1SMXA 1L2FA 2XRQD 4NB3A 2RA4A 3X3MA 3TREA 3PO3B 4DAYA 1I50B 5LHY1 1W6KA 4GLXA 1E1OA 1PRTB 1CFMA 3CKIB 4OWTB 3VYRA 1FNUA 4A93B 1FGUA 2QGQA 4A3EB 5IP9G 5M3FG 2BH2A 2F52A 3UDIA 4JBJA 1VQCA 4FXDA 1GOZA 1CKOA 3KF8A 1Q82C 3QG1A 3V05A 4OXPA 1Y1VB 3CCVA 1S5DD 2R92H 3CD6A 4I65A 4GZYC 4DU9A 1SE3A 3PV0A 4C3IG 1FD7D 4A3IH 4G4KA 4N9TA 2D2CC 2KEEA 5FO9B 4IFDH 2FINB 3CQZH 1E2WA 1PXUA 1S5CD 2QW7A 2K5HA 2RHSB 5L37A 4A3JH 4NXNQ 1AH9A 5G3LF 4R4IA 1L0YB 3D8GA 2FJ2A 1BO0A 4PNYA 1WD0A 2B63G 3RZOH 5M5WH 4A3LH 3STBD 3M4OH 3K7UC 5IP7H 1D7QA 1EEFD 5FLXE 4EQNA 5J1ZA 3H15A 1GO3E 3ZYYX 2PQAA 1N32L 2VUMB 2B39A 3KBXA 5FO8B 2RQXA 1ILQA 4LFCL 4A3MH 2B8FA 3DM1A 3KJOA 4K8JA 3S1QB 5DM63 5COYA 4BBSG 1NE3A 3WOEA 3PF5A 1BXTA 4RA8A 4NPSA 1HA5A 5ELOA 1MI2A 2XN9C 2WKDA 4CKBA 3M4QA 3FPPA 3MHBA 1LT4D 3H09A 3K0YA 3TP8A 3K59A 1QG7A 4AQYL 1X32A 1YEZA 2WAQE 1EY8A 3KDFA 3VYUA 4EX5A 3ZJYC 5CGKA 3D4WA 2YTVA 5ELNA 2UUAQ 1F2YA 3GTKB 2Z6KC 1XNRQ 2NVXB 2KHJA 1G291 3P1HA 3J80i 4EQPA 1KRTA 3R93A 4A75A 4DR5Q 4HMJA 2J0TD 4K5WA 1ENFA 4LUZA 4B3MQ 1XMOQ 2N3SA 3T4AC 4LAAA 1IBLL 5J3BA 3PIPA 5HGTA 5D3DA 3FDTA 3GV3A 4DV4L 3NTHA 4LW1A 3HOYB 3DMUA 1ASZA 3J7AF 3LGJA 2B2TC 1A0IA 2QF7A 3S9WA 1HRJA 2FMMA 1S40A 1VQLA 3BYTB 1HNWQ 2QEXA 3S15H 2EYOA 5ELDA 2MUYA 4ZKBB 3D6CA 3Q23A 5BR8Q 1RD9D 1BDOA 4LF6L 2EJFC 1LT3D 4KHPQ 4JYAQ 1JB7A 4UP8A 4DUZL 4YWKA 3E0JA 4K6DA 1Y1VG 4DF7A 3GP7A 4V190 1LUZA 3F1ZA 3PQIA 4OX9Q 3E5SA 1QZHA 4HCSA 1EQQA 5CV6A 2D0OA 3W2DA 1CSPA 2HQLA 3RN2A 4PG3A 4IUQA 5ELCA 2B2YA 4IJLA 3I55A 1I3QB 4DR2Q 4X65Q 1Z9FA 1TWGB 3KFUA 1PH8A 1N34L 1UE6A 2X69A 4MN3A 4NKLA 3TS0A 1HJPA 2FMCA 1TT2A 1X65A 4HEDA 4H7BA 1X3GA 4DR1L 1SXTA 4R4OA 2L0CA 2KCTA 1AZPA 2F0GA 4HIKA 4BXXG 3Q8DA 2OXPA 4DV1L 2WKCA 3OOCA 4RAUC 2SNSA 4H0LC 1GD7A 2OT2A 4HJAA 4ZLTF 3K7AH 2RDGA 1EZ6A 4HSVA 4DK0A 3JC66 3CMEA 2K28A 2C5CA 3I90A 4JI6Q 3M7NA 1BCPB 2ZJRA 5FKAC 3MXUA 1NMFA 4KD3A 1WTWA 2FHTA 4RWSC 1V1OA 3CQZB 4K2KA 4JI5Q 1EQRA 3I4NH 2EYHA 4DR3Q 4L5QA 3S1NH 1JORA 3Q24A 4DR6Q 4GKJQ 3K8AA 2A69D 3RZOB 1AE3A 2A73B 2BDNA 3J80L 1Q8KA 3SE0A 3M4OB 1EYGA 3HOYG 1B70B 1TS5A 1GXDC 3NSWA 4C3JH 2R6GA 1MBYA 4ME5A 4FXKC 3JAMc 1JJGA 4BS9A 2EYLA 4Z9CB
chains in the Genus database with same CATH topology
5KRUA 2EY5A 4RFBA 3KLRA 3HKZB 4A3MB 2ICEC 3MTSA 4XQJA 3NQIA 4BA1I 1G2TA 1WTVA 1LTAD 2PPBC 4B08A 1G2SA 3N52A 1WTXA 1O7YA 2K33A 3KBGA 2EY2A 3GTQB 3C1FA 3S1MB 4H13C 3FKIB 5I9OA 3NWTA 4UDUC 1FGBD 3D31A 3O13A 1Y69U 3NTKA 3V2TA 1M4VA 3H6MA 3JAML 2K05A 3R2IA 4QMGA 4A3KB 4RCNA 3SK4A 1H9RA 2BDOA 1E0BA 1H9KA 1PRTC 4DAVA 2EJGC 5FK9C 3WDNA 3HOUB 4PMBA 1LLRD 1BNZA 1U4LA 3OHXC 5C44B 3OWEB 5EPJA 1B4OA 3A7LA 3EA6A 1B53A 3BG3A 4JBWA 5CV4A 3FPUB 5KEEA 5KYLA 2PZTA 1K8MA 4IFDG 1NAPA 5C6AA 2SNMA 1EY6A 3J7AV 1EL0A 4KTAA 2A6HD 1PTOD 4KY7A 1UAPA 1TY2A 5I2XA 2XSCA 2H4OA 4PMCA 1HFGA 1CZGA 1S5BD 4IFDI 4U673 2EXZA 4EQOA 4K2LA 2JE6I 5ELFA 1WTPA 1D5XC 4IQZA 5M9OA 1XYIA 4CKCA 2NTSA 4BY7B 5IGFA 4DFAA 3BVMA 1YNJD 1PTOB 4XT3B 3C1EA 3F2UA 2DN8A 1A3VA 4C2MB 1VF5C 1QCBD 4B9WA 1G91A 1STYA 2NVQB 1MGSA 1JR0D 1NSNS 1CK1A 1FYCA 2E2IB 1CA5A 1EQVA 2PZWA 3R2TA 4FVMA 4FNFA 3S1NB 3VYSA 1F9RA 2RSNA 5I4DA 2PW5A 2PMZB 1EFID 1XTCD 2XVSA 3GTGB 4C3JB 2A5HA 1JQYD 4ZK9B 3I3CA 4ULLA 2Z1CA 1K8OA 2LS01 2WAQB 5IGGA 1RDPD 1G8ZD 3L7ZC 1LACA 3P75A 5CBAE 3IAYA 5CV8A 1B9MA 1B2TA 3K5OA 5T1IA 4FP5D 3OPOA 1PZJD 1QE6A 2VNUD 2BE5C 2JA6B 1ILPA 1O78A 1QNKA 4KY6A 5I9PA 1EY5A 5E4WC 1HFNA 2LMCB 2K32A 2KJXA 2E2HB 5K36H 3VR5A 3SK8A 4KJOA 1SE2A 3N6RA 3TP6A 1DOKA 4V0BA 2EVBA 1B3AA 2F0IA 4DGZA 3A8IE 3K5NA 2EYJA 4PQXA 5IGEA 1IKLA 1A3UA 1H9SB 1BCPC 5LL6X 3S17B 1R4PB 3L3OC 1STHA 1A2UA 1TWFB 4DAPA 3VYTA 1Y1WB 4XYQA 3PIP3 1GUSA 5A2QL 2Q8RE 3S16B 1STGA 4C3JG 4CKEA 2EY6A 3SVMA 4BY1B 5FLXL 2HCIA 1GHKA 2M00A 1SE4A 1B44D 4K8IA 3OIPA 2R7ZB 1D5ZC 3I8ZA 1R9TB 1SNQA 3SDZA 1QOHA 2F0JA 2A69C 1D1IA 1Q1EA 1C4QA 4OL7A 2AQ3B 2OF1A 3KLSA 1QJOA 4RGTA 1WCMB 1TWAB 4A3BB 2SDFA 4RKBA 2RDHA 1SNCA 2EYFA 1H9MA 3ND9A 2ZXPA 2HDMA 3BDLA 1DJRD 3RD4A 4FF2A 4TKOB 1JWMD 1RKNA 5JOBA 3IFDA 2F3WA 1KTKA 4F7XA 3TP7A 1I4QA 1M8AA 5IGDA 1HQRD 3K5MA 3HP3A 3TMEA 1QNUA 1OXVA 1LT6D 1X3PA 3DUZA 1I4GA 1JC7A 3DWQA 4DNTB 1GHJA 2B2VC 1TVXA 4FF4A 1SSOA 2L5TA 1VDZA 4ODGA 2ZXOA 5IT9L 2HQEA 5JPMC 4RCOA 3CRKC 4HSPA 4K5VA 4CBVA 1EOTA 3PO2B 2KOLA 4G7HC 1XXGA 1DYQA 4PMWA 1VMPA 2HUGA 3H94A 4BWGB 3R3OA 2QEJC 1EZ8A 2KEDA 2NVTB 1EY4A 1CTMA 4KKUA 2A6HC 1PTOC 1HUNA 1B50A 1B9NA 2HCCA 3LNNA 3OW7A 1ML0D 2BOSA 2Z4IA 5D3IB 2CVRA 2JA7B 3KK7A 4NMZA 3PUWA 1U4MA 1HQMC 4QF4A 5E3FA 5CORA 2JA5B 2BE5D 2IX3A 3V96A 1EIGA 3TDQA 3GTMB 2AWNA 1TKWB 1ZEQX 1L0XB 4OO1H 2FFKB 2RVLA 3I73A 3PUZA 2G9HD 1YNJC 2EYPA 2XRSD 5ISRA 4HAEA 1I6VC 1WTQA 3D4RA 2ZT9C 2VB3X 2O5JC 2XWJB 5EPLA 1CM9A 1D5MC 5EQ0A 3MFYA 1AEXA 2NN6I 1IHZA 2QDBA 1ET6A 3G6JB 5C4JB 1TS3A 1LTRD 1ENAA 3H0GB 1XWEA 1ESRA 3BYYB 2F0KA 3X3NA 1BCPD 1ET9A 1HTPA 4ILWA 4M8AA 1EY7A 1Y8OB 3NK9A 1OXXK 4E6IA 5C4XB 3S2HB 2B8GA 5CYUA 3I72A 1LT5D 1SJHD 5K36G 4ZKCB 1PRTF 1C48A 2QILA 3BZDB 3HOZB 1VCIA 1PTOH 2EY1A 3PUXA 4QUFA 1Q8IA 4Y7NB 3EROA 3Q6SA 1RCVD 2O2LD 1C8CA 4O42A 4ZUIA 5EKLA 3QIAA 4KKSA 1IKMA 3ITPA 2MJ8A 3MXPA 2OEOA 1DCZA 4X3SA 1BR9A 3DEPA 1HXYD 5DAUA 5I6YA 3QOLA 5BN4A 4ZQ3A 2L12A 3QOJA 2F0HA 3OMCA 5T1GA 2ZXRA 3W3AA 5M5YB 4M1UB 1I4PA 4NP5A 1A6XA 1OO9B 3FRPB 3AU7A 1EY0A 4WFN3 4KY5A 1RF2D 4U68A 3TBIB 1RHPA 2EZVA 2F03A 2H1EA 1II3A 1UEAB 3SXHA 1EYAA 1EWCA 2F3VA 1A15A 5EKKA 5ELBA 1CQVA 2IW3A 1Y8NB 4Q0FA 2F0FA 2B2UC 5KNCA 2F0UA 1V43A 2WV6D 2NUCA 2X6LA 2WINB 3I4MB 2K04A 4XIGS 3RLFA 5C3XA 4TSSA 1JICA 5DM73 2KA7A 1STEA 4BBRB 1GUOA 1PZKD 3K6OA 4X3KA 4KMUC 5CC4A 4J6HA 2B2WA 4PV1C 1TIID 4G57A 5JVH3 5C4HA 4OGQC 1GJXA 3G7LA 1IW7C 1QWYA 2N55A 4F87A 1RTNA 3MZ5A 3DXJC 1R4QB 3H3VC 3HGBA 3S1RB 1IL8A 4JK1C 4KKTA 2JEBI 4C1NI 1OXSC 4A3FB 3IKJA 3VR3A 2L1BA 3U9SA 4XQQA 4KK7A 1SYGA 3FMCA 2DNEA 2F0EA 3QJYA 3DWAA 5M3MB 5DNFA 1I6HB 4DA2A 1F9PA 4NW2A 3T51B 2B2VA 4ZAIA 3VA5A 2KQ3A 3H91A 2F0SA 1AN8A 2F0NA 2E76C 4G7ZC 1J8IA 1LTID 4A3DB 1CZWA 2SEBD 1BCPF 1EYCA 5C3WA 1SNDA 2F1MA 1DONA 2R93B 2KCNA 1TWHB 2IT1A 1Q90A 2N88A 2RBMA 2F4IA 1CHQD 2IPKD 4KHVA 2VXWA 2NN6H 3JAME 3NWSA 2JP1A 2PNRC 1F9QA 4DN4M 3RMHA 3SR1A 4OO1G 2F0OA 3S2DB 2DY7A 3BDCA 3BVZA 2K5WA 4FF1A 2AUJD 2F0TA 3CHBD 4K6LA 2F0DA 1FR3A 2Z4HA 1KNAA 3TSSA 4F8MA 5C3EB 2J4XA 4OO1I 1H9JA 2XWBB 1GUTA 1T5EA 1CQFA 3PUYA 3NP8A 2ID0A 3LX0A 1F2MA 1DD2A 5C0XJ 1PZID 4CJ2C 2LY7A 4HR7B 1DZ1A 3SK5A 5I6WA 2WACA 2PZUA 1V1PB 1DXMA 1DOLA 4DNRB 2MHVA 2VB2X 1SMYD 1ONLA 1NR2A 1STBA 2EYMA 4C56C 2K7VA 2E75C 4R8IA 3M3YB 4CGYB 4QB4A 2CW0D 3OIQA 5JAVA 5IODA 2BA1A 1KDCA 2K5QA 1SBBB 2DNCA 2ENBA 3BS1A 1TS2A 4I7ZC 2WP8J 1SFOB 1UUPA 3QB3A 1Z7TA 2LKVA 4C3IB 1U9RA 3SHLA 1H9SA 3J81E 1F2LA 5HURA 2D9UA 2QCPX 1A2TA 3QO2A 4B9XA 2K6AA 1V8QA 2F0PA 2JSOA 3OSOA 3U9OA 1ZYRD 5FO7B 2B63B 1STNA 3MAQA 3QWNA 2IX0A 3ERQA 3T56B 2MP1A 4XYOA 1BBXC 1PFMA 4XQNA 1LO5D 2C9OA 3GD7A 2J7ZA 1KDAA 4R8NA 4L63B 3M85A 2PW7A 4LJZC 5J39A 1ESFA 2A68C 1I4RA 3GTPB 3R8BA 1NCVA 5IIFA 1PTOF 4S3SA 1CT1D 3DWPA 3SEBA 5E1FA 1IW7D 5CV9A 2MGSA 5KNDA 4G7OC 1BQQT 4EVOA 3VR4A 3ONAB 2B2WC 5C4ZA 5CV7A 1K83B 1NR4A 3NTIA 2D5DA 1A3TA 2A6ED 2XNAC 1GUGA 3I4LA 3MXNA 1HUMA 4HTHA 2B2UA 4ZUJA 1TU2B 1WVLA 4OHJA 2LFNA 3IL8A 2PQEA 1SEBD 3HOXB 1DM0B 2ICIA 3A8KE 1LTSD 1EU4A 4LMQD 1KLUD 3BVGA 4WORA 2Q8IB 3VR2A 3C3LA 1Y8PB 3RZDB 2KVMA 1TQOA 4O1NA 3C46A 4ZYSA 4X3TA 1BF4A 4CJ0B 5JEAJ 4OIJA 5LL6S 5A2QE 1JOOA 5JPNC 4IALA 1JE4A 2KUMA 5D65A 1PYWD 3K57A 1Q3LA 3NUCA 2EDGA 3EVQA 3CU7A 1SYCA 3GTJB 2PO4A 1O7LA 1KABA 1CI3M 5TSSA 1PFNA 4TRDA 3ND8A 3DHQA 5CR3A 2RKSA 1AW7A 4UAIA 1JOQA 1ZXTA 1SNMA 3LWUA 1O7ZA 5EGTA 4IUTA 1SYBA 1Z47A 4XT1B 3NQTA 2QKIC 5C0XH 3GTLB 3P7JA 1ENCA 1ZKOA 2E2JB 1HHVA 2NB0A 4RHSA 5DEHA 1CA6A 4RH6A 3AB9A 3RUZA 3EJIA 1S5FD 1X3QA 2YU9B 2NN6G 3HRZC 2Z8LA 1U4PA 5M5XB 1J9OA 4FF3A 4MIUA 2A74C 1E2ZA 3HEJA 3MFGA 1SDFA 2F0LA 4YIJA 1EQTA 1SNOA 1EWHA 3C2PA 1MSHA 3K5LA 3NBHA 2K03A 4J8QA 1Z6HA 2IWHA 2JYOA 2D62A 1YNND 1JB3A 4XXEA 3PMFA 4RGMA 2X6GA 3URYA 5EPKA 1KDBA 3NHHA 3GQBA 2CHBD 1EU3A 3S14B 4KI0A 3Q0AA 5IT9E 2I07B 4WJWA 3GO5A 2L11A 4H44C 4KN7C 4IUVA 4A3GB 4C3HB 1D2BA 4DXGA 5BN5A 3FVQA 4DXFA 2BCOA 1RTOA 4HN7A 5IOCA 2K01A 4CJ1B 2EOTA 2XIWA 2NTTA 4C1NK 1S4ZA 3I70A 3A54A 3WOFA 2JA8B 4RGNA 2IL8A 5D14A 2YYZA 4X3UA 1HTLD 2F0MA 1SMYC 2A68D 1D1KA 3NE5B 2NVYB 1JWSD 2R92B 4CHTB 4N9PA 1WTOA 3MC0B 4A3IB 2BA0A 2TSSA 3M7GA 2GA4B 4HMIA 1JOKA 4L6TB 2KECA 4A3JB 2CW0C 1JCKB 4RGOS 5JVG3 5M5WB 2TMPA 3OWFA 4DK1A 1QB5D 3CRLC 3A7AB 1U4RA 2Q8TA 2SOBA 3AMUA 5BN3A 4KHZA 4P2CB 1HA6A 1LTTD 5AFWA 5IGBA 1I4HA 3IFTA 1SYDA 4ABNA 2IX1A 4FYDA 1PDQA 2NYZD 5JEAH 1ZYRC 2I46A 5I2YA 5IGCA 1S5ED 2NWGA 1I4XA 5KNBA 3T53B 1OXUA 1Q1BA 4IURA 1F9SA 1MSGA 4C3HG 5F2DA 4IZ8A 5KGUA 3K58A 1XX8A 2AQ2B 4KD4A 2R61A 4K14A 1F77A 3TN2A 5CBEE 2G9DA 1JWUD 3LWEA 2AQ1B 2AWOA 5FOBB 1DOMA 3S15B 2A6EC 3D3RA 2JXMB 4ID6A 1G6ZA 4L8JA 1W6JA 1FNWA 4FO2A 2R3ZA 1D6EC 3T16A 1STAA 4TQUS 3J80E 2WB1B 5EKIA 3D4DA 1TWCB 3KUPA 1B1ZA 1AP0A 4XDXA 1AZQA 1AFPA 5EJWA 1TY0A 3NXWA 2DY8A 5CV5A 3J7YW 3HOWB 5CMDA 2M9VA 4KJNA 3VR6A 1WD1A 3HZXA 2MPMA 3EQLC 1EYDA 3TZDA 1RJTA 3SK6A 4ZRZA 4FXGC 3EFXD 1SJED 3E6ZX 1TR5A 4RKLA 5C0XG 3T13A 3TZUA 3DEOA 4HCEA 1T5XD 5EBDA 3K7AB 4IUUA 5C0XI 4IFDJ 1LV9A 5E4XA 3KLSX 3I91A 2F0WA 3HG9A 3MVVA 3J81L 3I4NB 3GV6A 2IJ0A 4LK1C 1KAAA 1Q12A 3PUVA 3A56A 5G3LD 1EIHA 2EJMA 1HCZA 4R9WA 3Q22A 2K5DA 1KNEA 1VF7A 4IUNA 1UNSA 2L55A 4RHRA 5J22A 4J1MA 2EE1A 3M4YA 1SYFA 2V4DA 2B2YC 1PMRA 1QILA 5C5LA 1PLFA 2HDLA 3HS0C 3PIO3 3A8JE 3VA7A 2B2TA 5NUCA 4F88A 1IYUA 1SAPA 4IUPA 1KLGD 4EGVA 1SYEA 4AYBB 1NUCA 1WTRA 5KYIA 1CHPD 5KIXA 2JEAI 1GUNA 1BUVT 5EBCA 4WRDA 2CQAA 4Q5VA 4NDXA 1IYVA 2E2DC 5K5PA 1V1PA 1F2ZA 3TP5A 3GTOB 1YNNC 1O80A 2KHSA 2F0QA 5M3FB 1MD2D 4KV6A 2O5IC 2NBFA 2EPBA 1SNPA 2WIIB 4K5XA 5ELEA 3FEWX 1LTBD 5JJZA 1OXTA 3P20A 3MWYW 4IN3A 2PYKA 4BA2I 2PCFB 2AUKA 4QIWB 2KCCA 3NPPA 2RSOA 4OIKA 1ICWA 4MHEA 1LABA 2F0VA 3HOVB 1VMCA 1E2VA 2L4NA 1EY9A 2E74C 3MXGA 3BDOA 2M2LA 2Y0SB 3UI2A 2NZ1D 5C5MA 2L9HA 2RDFA 3MA2B 4QCLA 4XTCS 1FNVA 1TS4A 2K1BA 1PFBA 3D6WA 4BBSB 1LTGD 1PRTD 3OMGA 4KN4C 1RODA 5JEAG 3L9AX 5A35A 3A55A 4QUCA 2O4XA 1BOSA 1EEID 3MEHA 1GUWA 1HPCA 3NBIA 2XRQD 2RA4A 3X3MA 3PO3B 4DAYA 1I50B 5LHY1 1W6KA 1PRTB 1CFMA 3CKIB 3VYRA 1FNUA 4A93B 4A3EB 4FXDA 1GOZA 3KF8A 3QG1A 3V05A 1Y1VB 1S5DD 4I65A 4GZYC 4DU9A 1SE3A 3PV0A 4C3IG 1FD7D 4G4KA 4N9TA 2D2CC 2KEEA 5FO9B 4IFDH 2FINB 1E2WA 1PXUA 1S5CD 5G3LF 1L0YB 3D8GA 2FJ2A 1BO0A 4PNYA 1WD0A 1EEFD 5FLXE 4EQNA 5J1ZA 3ZYYX 2VUMB 2B39A 3KBXA 5FO8B 2RQXA 1ILQA 2B8FA 3DM1A 4K8JA 3S1QB 5DM63 5COYA 3WOEA 1BXTA 4RA8A 1HA5A 1MI2A 2XN9C 2WKDA 4CKBA 3FPPA 3MHBA 1LT4D 3H09A 3K0YA 3TP8A 3K59A 1QG7A 1X32A 1EY8A 3VYUA 5CGKA 3D4WA 3GTKB 1F2YA 2NVXB 1G291 3P1HA 4EQPA 3R93A 4HMJA 2J0TD 4K5WA 1ENFA 3T4AC 4LAAA 5HGTA 5D3DA 3FDTA 3GV3A 3NTHA 3HOYB 3DMUA 3J7AF 2B2TC 2QF7A 3S9WA 1HRJA 2FMMA 3BYTB 2EYOA 5ELDA 2MUYA 4ZKBB 3D6CA 3Q23A 1RD9D 1BDOA 2EJFC 1LT3D 3E0JA 4K6DA 4DF7A 4V190 3GP7A 3E5SA 4HCSA 5CV6A 3W2DA 4IUQA 5ELCA 2B2YA 1I3QB 1TWGB 2X69A 4MN3A 4NKLA 2FMCA 1TT2A 4HEDA 4H7BA 1SXTA 2L0CA 1AZPA 2F0GA 2OXPA 2WKCA 3OOCA 4RAUC 2SNSA 4H0LC 2OT2A 4ZLTF 2RDGA 1EZ6A 4HSVA 4DK0A 2K28A 2C5CA 3I90A 3M7NA 1BCPB 5FKAC 3MXUA 4KD3A 1WTWA 2FHTA 4RWSC 1V1OA 3CQZB 4K2KA 2EYHA 1JORA 3Q24A 2A69D 3RZOB 2A73B 2BDNA 3J80L 3SE0A 3M4OB 3NSWA 1TS5A 1GXDC 2R6GA 1MBYA 4ME5A 4FXKC 4BS9A 2EYLA 4Z9CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EXZ A;  2EYF A;  4F8M A;  5KRU A;  3D6C A;  4EQO A;  2EY5 A;  4TRD A;  1KDA A;  4R8N A;  4I65 A;  2PW7 A;  3DHQ A;  4QF4 A;  4DU9 A;  4ZUI A;  5J39 A;  5CR3 A;  4K2L A;  2RKS A;  4K6D A;  5E3F A;  5EKL A;  4DF7 A;  3SK8 A;  4KJO A;  2PYK A;  1JOQ A;  4N9T A;  3BDL A;  3ITP A;  3MXP A;  1SNM A;  2OEO A;  5IIF A;  5F2D A;  3TP6 A;  5M9O A;  3NP8 A;  4IZ8 A;  4S3S A;  2F0W A;  1RKN A;  3E5S A;  5JOB A;  3MVV A;  5KGU A;  5EGT A;  5DAU A;  5I6Y A;  3LX0 A;  3QOL A;  1SYB A;  5CV6 A;  2F0V A;  2F0I A;  1F2M A;  5E1F A;  1SYG A;  4KD4 A;  5IOC A;  4ZQ3 A;  1KAA A;  5IGF A;  3NQT A;  2F0E A;  3QOJ A;  5CV9 A;  3D8G A;  4DFA A;  4PNY A;  4K14 A;  2F3W A;  4DGZ A;  2EYJ A;  2EYP A;  1EY9 A;  4EVO A;  2F0H A;  1ENC A;  2EY2 A;  3C1E A;  3OMC A;  5ISR A;  3C1F A;  1A3V A;  5C4Z A;  5CV7 A;  5IGE A;  3SK5 A;  1A3U A;  4F7X A;  3TP7 A;  4IUN A;  5DEH A;  4EQN A;  2WAC A;  4NP5 A;  5I6W A;  5I9O A;  5IGD A;  2PZU A;  5J1Z A;  4B9W A;  3VA5 A;  1EY0 A;  1STY A;  2F0M A;  5C5M A;  5J22 A;  3TME A;  4KY5 A;  4J1M A;  3RUZ A;  4NKL A;  1A3T A;  1STH A;  1NSN S;  2KQ3 A;  1AEX A;  3EJI A;  3V2T A;  2RDF A;  1TT2 A;  1SYF A;  1A2U A;  1EQV A;  1STB A;  3H6M A;  4HTH A;  2PZW A;  2F0S A;  4ID6 A;  2EYM A;  1IHZ A;  2QDB A;  2F0N A;  4H7B A;  4N9P A;  4ZUJ A;  1II3 A;  3SXH A;  4QMG A;  5C5L A;  1EYA A;  2F3V A;  3SK4 A;  5EKK A;  1ENA A;  2PW5 A;  4K8J A;  2F0F A;  2F0G A;  3T16 A;  1STA A;  3OMG A;  2OXP A;  5NUC A;  4HMI A;  2PQE A;  4QB4 A;  1JOK A;  2SNS A;  2F0U A;  2F0K A;  4ODG A;  3D4D A;  1EYC A;  5C3W A;  4PMB A;  1SND A;  5JAV A;  1SYE A;  1EY7 A;  5IOD A;  1EZ6 A;  1NUC A;  1STG A;  2HQE A;  2NUC A;  3NK9 A;  2EY6 A;  1KDC A;  3MHB A;  3OWF A;  4E6I A;  5KYI A;  2O4X A;  3TP8 A;  2ENB A;  3NXW A;  5KIX A;  3MZ5 A;  3MEH A;  4K5V A;  1EY8 A;  4MIU A;  5IGG A;  5CV5 A;  4WOR A;  5C3X A;  2M00 A;  5CGK A;  3HEJ A;  4KD3 A;  3P75 A;  3D4W A;  2F0L A;  3QB3 A;  4K8I A;  4KJN A;  1F2Y A;  5CV4 A;  2RBM A;  4YIJ A;  5CV8 A;  2SOB A;  4WRD A;  3HZX A;  2LKV A;  1SNO A;  3P1H A;  1U9R A;  4K2K A;  1EYD A;  4NDX A;  4EQP A;  1SNQ A;  5IGB A;  4KHV A;  1TQO A;  5KEE A;  2PZT A;  3SHL A;  1SYD A;  3SK6 A;  5CC4 A;  5KYL A;  4HMJ A;  2EYH A;  3R3O A;  4K5W A;  2SNM A;  5C6A A;  5K5P A;  5HUR A;  1EY6 A;  1JOR A;  1A2T A;  1EZ8 A;  4J6H A;  1F2Z A;  2F0J A;  3SR1 A;  1EY4 A;  3TP5 A;  4B9X A;  4KTA A;  2F0P A;  3OSO A;  4LAA A;  3U9O A;  1TR5 A;  4RKL A;  5HGT A;  2KHS A;  1JOO A;  4G57 A;  2F0O A;  4IAL A;  3DMU A;  4OL7 A;  5C4H A;  3PMF A;  2OF1 A;  2F0Q A;  3BDC A;  4KY7 A;  4KV6 A;  2EY1 A;  1STN A;  3T13 A;  1KDB A;  3NHH A;  2F0T A;  1SNP A;  4PMC A;  4KY6 A;  2F0D A;  4K5X A;  5IGC A;  3NUC A;  4ME5 A;  3S9W A;  2EYL A;  5I9P A;  3ERQ A;  3EVQ A;  4RKB A;  1SYC A;  1EY5 A;  3ERO A;  4NMZ A;  1SNC A;  2EYO A;  1KAB A; 
#chains in the Genus database with same CATH topology
 5KRU A;  2CKZ B;  2EY5 A;  4O0A A;  4RFB A;  1P8L A;  1VQA A;  1PH9 A;  3KLR A;  1VQ8 A;  3ERS X;  3HKZ B;  2ICE C;  4A3M B;  3MTS A;  4XQJ A;  3NQI A;  1HZB A;  4BA1 I;  1G2T A;  1K8A C;  1WTV A;  2UXB Q;  3D0F A;  1B8A A;  3AYH B;  1LTA D;  2PPB C;  1MJC A;  5GAH C;  4N8F A;  4B08 A;  1G2S A;  3N52 A;  1WTX A;  3PCO B;  1O7Y A;  2K33 A;  3KBG A;  2EY2 A;  3GTQ B;  5GAG C;  2JA6 H;  3C1F A;  3S1M B;  4H13 C;  2P5Z X;  3FKI B;  5I9O A;  3NWT A;  4MZ9 A;  1RIP A;  3G71 A;  1GM5 A;  4UDU C;  4X64 Q;  1FGB D;  4JI8 Q;  3D31 A;  4DUY L;  3O13 A;  1Y69 U;  1NMG A;  4A3G G;  3NTK A;  3V2T A;  4YCU A;  1M4V A;  3H6M A;  3JAM L;  2K05 A;  3R2I A;  3CCS A;  4QMG A;  4A3K B;  4RCN A;  1KRS A;  3SK4 A;  1H9R A;  2BDO A;  1E0B A;  3GTO H;  1H9K A;  1PRT C;  4DAV A;  2UUB Q;  2EJG C;  3M9B A;  5FK9 C;  3WDN A;  2ZTC A;  3HOU B;  4PMB A;  3F2B A;  1LLR D;  1BNZ A;  1U4L A;  3OHX C;  4LNQ A;  5IYD H;  5C44 B;  3OWE B;  5EPJ A;  1U5K A;  4JI2 L;  1B4O A;  2HHH Q;  3A7L A;  3EA6 A;  4GLA C;  1B53 A;  2R92 G;  3BG3 A;  1WYD A;  4JBW A;  5CV4 A;  3BU2 A;  3FPU B;  4A3I G;  3EIV A;  3TRZ A;  1ICF B;  5KEE A;  5KYL A;  2PZT A;  1K8M A;  4IFD G;  1M1K C;  1NAP A;  5C6A A;  2SNM A;  3CCQ A;  4X62 Q;  3HOV H;  1EY6 A;  3J7A V;  1EL0 A;  4KTA A;  4DV0 Q;  3I4O A;  4A3J G;  4X66 L;  2A6H D;  2I5H A;  1PTO D;  4KY7 A;  3T1Y Q;  1UAP A;  1TY2 A;  5I2X A;  2XSC A;  4A3L G;  2H4O A;  4PMC A;  1HFG A;  1CZG A;  1S5B D;  3J81 c;  5IP7 G;  3S16 H;  4IFD I;  4U67 3;  4HJ8 A;  1N33 L;  2EXZ A;  2Q2U A;  4EQO A;  4JV5 Q;  1PVO A;  2I0Q A;  1HNX Q;  1VQJ A;  2ZTD A;  4K2L A;  2JE6 I;  5ELF A;  3PF4 A;  1WTP A;  1D5X C;  4IQZ A;  4A3M G;  5M9O A;  1XYI A;  4A76 A;  4CKC A;  4IPD A;  2NTS A;  1C7Y A;  1G6P A;  1WI5 A;  2Z0S A;  5JJI A;  4BY7 B;  5IGF A;  4DFA A;  3BVM A;  1YNJ D;  1PTO B;  4XT3 B;  3C1E A;  3F2U A;  2DN8 A;  1A3V A;  3STB C;  4C2M B;  1VF5 C;  4LF9 Q;  1QCB D;  1HH2 P;  4NXM Q;  1TWA H;  4B9W A;  1G91 A;  1STY A;  3E0E A;  2NVQ B;  3CAM A;  1MGS A;  1JR0 D;  1WJJ A;  1NSN S;  2UXD Q;  1MKH A;  1CK1 A;  1FYC A;  2E2I B;  1CA5 A;  1EQV A;  2PZW A;  3PO3 H;  3R2T A;  4FVM A;  4FNF A;  2VY3 A;  4B3R L;  1CKN B;  2L15 A;  3S1N B;  3VYS A;  1F9R A;  2RSN A;  5I4D A;  2PW5 A;  2PMZ B;  1EFI D;  3M4P A;  4P72 A;  4P74 A;  1XTC D;  2XVS A;  1Q46 A;  3GTG B;  4A93 H;  4C3J B;  4A3E H;  4QY7 A;  4CDD C;  2A5H A;  2Z6K A;  2V1C C;  1JQY D;  4ZK9 B;  3I3C A;  3S24 A;  4ULL A;  2Z1C A;  1K8O A;  2LS0 1;  2VS1 A;  2WAQ B;  5IGG A;  1SLJ A;  3SGI A;  1QUQ B;  1RDP D;  4O2D A;  1G8Z D;  3FHW A;  3L7Z C;  1LAC A;  3P75 A;  3QR8 A;  5CBA E;  3IAY A;  5CV8 A;  1KHI A;  1B9M A;  1KC8 C;  1B2T A;  3K5O A;  5T1I A;  2JN4 A;  4FP5 D;  3OPO A;  4LUV A;  1PZJ D;  1QE6 A;  3HFZ B;  1LYL A;  2VNU D;  3CCE A;  2BE5 C;  2WB1 G;  2HD3 A;  1XPR A;  2JA6 B;  1WTH A;  4GOP B;  1ILP A;  1O78 A;  1QNK A;  3UDG A;  1B7Y B;  4KY6 A;  5I9P A;  2FXQ A;  1EY5 A;  5E4W C;  1HFN A;  1IBK Q;  2LMC B;  2K32 A;  1HNZ L;  2KJX A;  4LF5 L;  2VUM H;  4JI7 Q;  2E2H B;  5K36 H;  1XMQ Q;  3VR5 A;  4J15 A;  3SK8 A;  4KJO A;  1SE2 A;  1I94 L;  3PO2 H;  3N6R A;  3TP6 A;  3S1Q H;  1DOK A;  4V0B A;  2EVB A;  3ULJ A;  1B3A A;  2F0I A;  2NVT H;  1X3E A;  4DGZ A;  3A8I E;  3ULL A;  2EYJ A;  3K5N A;  1MIU A;  2ZM6 Q;  4PQX A;  5IGE A;  1PV4 A;  1IKL A;  1KIX A;  1A3U A;  1H9S B;  1BCP C;  4HJ9 A;  5LL6 X;  3S17 B;  1R4P B;  1YZ6 A;  1X55 A;  2VQE Q;  3L3O C;  1Q7Y C;  2B29 A;  1STH A;  1S3O A;  2NVX H;  1A2U A;  1TWF B;  2K52 A;  4DV5 Q;  4DAP A;  4DPG A;  3VYT A;  1Y1W B;  4XYQ A;  2IHE A;  3PIP 3;  5LMN Q;  2R7D A;  1KQS A;  1GUS A;  5A2Q L;  2Q8R E;  2VQF Q;  4LFA Q;  5DLQ E;  3CC2 A;  3S16 B;  1STG A;  4C3J G;  4CKE A;  1IBM L;  2EY6 A;  3SVM A;  5GAD C;  3J7Z C;  4BY1 B;  5FLX L;  2HCI A;  4K0K L;  1GHK A;  2M00 A;  1SE4 A;  1B44 D;  2F4V Q;  4K8I A;  1VQ4 A;  3OIP A;  1W2B A;  2R7Z B;  1D5Z C;  3I8Z A;  1J5E Q;  1R9T B;  1SNQ A;  2MQH A;  4UPA A;  3SDZ A;  5IWA L;  1QOH A;  2F0J A;  1A8V A;  2A69 C;  1D1I A;  1Q1E A;  4AH6 A;  1C4Q A;  3MXN B;  4H02 A;  4OL7 A;  2AQ3 B;  2OF1 A;  3KLS A;  1QJO A;  4AYB G;  4RGT A;  2JA6 G;  1VQ7 A;  2E5L L;  1I3Q H;  1WCM B;  1TWA B;  4A3B B;  1MHW C;  2SDF A;  2F3I A;  4RKB A;  2RDH A;  1SNC A;  2EYF A;  1H9M A;  3ND9 A;  3S2H H;  5JJK A;  1UWV A;  2ZXP A;  2QDL A;  2HDM A;  2CWA A;  2ES2 A;  3BDL A;  1DJR D;  2N8N A;  4L5S A;  3RD4 A;  4FF2 A;  4TKO B;  2K50 A;  1E7Z A;  1HZ9 A;  1JWM D;  5IT9 c;  1RKN A;  5JOB A;  1YIJ A;  3IFD A;  2F3W A;  1KTK A;  3W5O A;  5IYD G;  1YI2 A;  4F7X A;  4NXN L;  1T9H A;  3TP7 A;  1I4Q A;  4FDB A;  1M8A A;  1N9W A;  5IGD A;  4Y7N H;  1HQR D;  3K5M A;  3HP3 A;  1QNU A;  1OXV A;  1LT6 D;  3TME A;  1X3P A;  3TEH B;  2G5D A;  3NEL A;  3DUZ A;  1I4G A;  2A1A A;  3RR5 A;  2MO0 A;  1JC7 A;  3DWQ A;  3KF6 B;  4DNT B;  1GHJ A;  2B2V C;  4R4C A;  1N8R C;  1TVX A;  4P71 A;  4DV2 Q;  4FF4 A;  2OTJ A;  1SSO A;  1NBW A;  3HOV G;  1JMC A;  2L5T A;  2ZJQ A;  3AFP A;  1VDZ A;  4JG2 A;  1EOV A;  1K0R A;  4ODG A;  3PSI A;  2CH4 A;  4PZ7 A;  2ZXO A;  5IT9 L;  2HQE A;  4N8X 1;  2XGT A;  5HGQ A;  5JPM C;  3PIO A;  2Y0S G;  5HY6 A;  3CF5 A;  4RCO A;  3CRK C;  4HSP A;  4K5V A;  4P73 A;  1YBY A;  4TVA B;  3RLN A;  4BY1 G;  4CBV A;  1HR0 W;  1YJN A;  1EOT A;  3CMA A;  3PO2 B;  2KOL A;  4G7H C;  1XXG A;  1DYQ A;  4PMW A;  1VMP A;  5GRO A;  4JBM A;  2HIX A;  2UUC Q;  2R7Z G;  2HUG A;  3H94 A;  4BWG B;  3R3O A;  2QEJ C;  1VQM A;  1EZ8 A;  2KED A;  2NVT B;  1EY4 A;  1CTM A;  4KKU A;  1K0S A;  2A6H C;  1PTO C;  3GTQ H;  1HUN A;  4DR5 L;  1B50 A;  1B9N A;  2HCC A;  1XTD A;  3A5Z B;  3LNN A;  3OW7 A;  1ML0 D;  2BOS A;  2Z4I A;  5D3I B;  2CVR A;  1XMO L;  3FKI H;  4B3M L;  3S1M H;  1E3P A;  2JA7 B;  3KK7 A;  4NMZ A;  3PUW A;  1U4M A;  2A8V A;  2KEN A;  1HQM C;  2Z6B A;  4QF4 A;  1QVC A;  5GAE C;  1HNW L;  5E3F A;  5COR A;  4LFC Q;  3PO3 G;  2JA5 B;  4A3K H;  1UE5 A;  2AMC B;  2BE5 D;  2IX3 A;  4KHP L;  4JYA L;  3V96 A;  5IE8 A;  1EIG A;  3TDQ A;  1YJW A;  3GTM B;  1J6Q A;  2AWN A;  4JCV E;  1TKW B;  1ZEQ X;  1L0X B;  1VQ6 A;  4OO1 H;  2FFK B;  2RVL A;  3I73 A;  3PUZ A;  3WWV A;  3HOU H;  1UE7 A;  2G9H D;  1YNJ C;  4A93 G;  2EYP A;  2XRS D;  2H5X A;  2MO1 A;  2RF4 A;  5ISR A;  4JI4 Q;  1AE2 A;  4HAE A;  5C44 H;  4A3E G;  4JI1 L;  1I6V C;  1GKH A;  1WTQ A;  3D4R A;  2ZT9 C;  2VB3 X;  3NBH B;  2O5J C;  2XWJ B;  3CCR A;  5EPL A;  1CM9 A;  1S72 A;  1XNQ Q;  1D5M C;  5EQ0 A;  1XJV A;  3MFY A;  3T1H L;  5FLM H;  1AEX A;  2NN6 I;  1EUJ A;  3S1R H;  4X65 L;  1PH5 A;  4PZ6 A;  1IHZ A;  2QDB A;  4AIM A;  1ET6 A;  3G6J B;  5C4J B;  4ALP A;  1TS3 A;  1LTR D;  1U0L A;  2GVA A;  1ENA A;  2AHO B;  3H0G B;  3UDF A;  1IBL Q;  4A3F H;  4GOP C;  3BZC A;  1XWE A;  1ESR A;  3BYY B;  2F0K A;  3X3N A;  2R7F A;  1BCP D;  1ET9 A;  1HTP A;  4ILW A;  4M8A A;  1EY7 A;  3H3V I;  1Y8O B;  3NK9 A;  1OXX K;  4E6I A;  2EQS A;  1E24 A;  1E22 A;  4KLK A;  5C4X B;  3S2H B;  2B8G A;  4YY3 Q;  3J80 c;  5CYU A;  2VUM G;  4DUZ Q;  3I72 A;  1YHB A;  1LT5 D;  1PFS A;  1SJH D;  5K36 G;  2JK8 A;  4ZKC B;  4OEL B;  4JI6 L;  1PRT F;  1C48 A;  2QIL A;  3CCJ A;  3KJP A;  3BZD B;  3PO2 G;  3OYY A;  3F2C A;  3HOZ B;  4BY7 H;  4LFB L;  4JI5 L;  2Z9H A;  1VCI A;  1PTO H;  3U4Z A;  4C2M H;  4DR3 L;  2EY1 A;  1NJI C;  3PUX A;  4QUF A;  4LF4 L;  4DR6 L;  1Q8I A;  3AEV A;  4Y7N B;  4GKJ L;  3U58 A;  1NY4 A;  3UE1 A;  3ERO A;  3Q6S A;  2NVQ H;  1RCV D;  1G51 A;  2O2L D;  1N34 Q;  1C8C A;  4O42 A;  3NEN A;  2E2I H;  1IXR A;  4ZUI A;  1X3F A;  4JI0 Q;  5EKL A;  3QIA A;  4KKS A;  2Q2T A;  1IKM A;  3ITP A;  3CPW A;  2MJ8 A;  3MXP A;  4DV6 Q;  2OEO A;  1DCZ A;  4X3S A;  1BR9 A;  1HZC A;  3DEP A;  1HXY D;  5DAU A;  1HZA A;  5I6Y A;  3QOL A;  3GTG H;  4PZ8 A;  5BN4 A;  4ZQ3 A;  2L12 A;  3QOJ A;  2F0H A;  3OMC A;  5T1G A;  4APV A;  5LMN W;  3S2D H;  2VZA A;  2ZXR A;  1VQG A;  3W3A A;  5M5Y B;  4M1U B;  1I4P A;  4NP5 A;  2IY5 B;  1A6X A;  1VQD A;  1OO9 B;  3FRP B;  3AU7 A;  1EY0 A;  4WFN 3;  4OWX B;  4KY5 A;  1RF2 D;  4U68 A;  1RL2 A;  5C3E H;  3TBI B;  1RHP A;  1PH6 A;  3DLL A;  2EZV A;  2F03 A;  4JI8 L;  2H1E A;  1II3 A;  1UEA B;  3SXH A;  2ZJP A;  4Y52 H;  1EYA A;  1EWC A;  2F3V A;  1A15 A;  5EKK A;  5ELB A;  1CQV A;  2IW3 A;  1L1O B;  1Y8N B;  4Q0F A;  2F0F A;  2B2U C;  5KNC A;  4HIM A;  2F0U A;  1V43 A;  2WV6 D;  2NUC A;  2X6L A;  2WIN B;  1K3B C;  3I4M B;  2K04 A;  4DR7 L;  4XIG S;  3E9H A;  2I5L X;  3RLF A;  2E2H H;  1SRO A;  5C3X A;  4B3S L;  4TSS A;  1JIC A;  5C4X G;  5DM7 3;  2KA7 A;  1STE A;  4BBR B;  1GUO A;  1PZK D;  3K6O A;  2HHH L;  4X3K A;  4GKK L;  1I5F A;  4KMU C;  5CC4 A;  1VQK A;  1NTG A;  4J6H A;  2B2W A;  4PV1 C;  1TII D;  4G57 A;  5JVH 3;  2GVB A;  5C4H A;  4OGQ C;  1GJX A;  1VQ5 A;  3G7L A;  1IW7 C;  1QWY A;  2N55 A;  2OTL A;  3S17 H;  4WJ4 A;  4F87 A;  3HKS A;  1RTN A;  4DUY Q;  3MZ5 A;  2K14 A;  3DXJ C;  4RMF A;  3T1Y L;  1R4Q B;  3H3V C;  4LF7 L;  3HGB A;  3S1R B;  1TWF H;  1IL8 A;  1N36 Q;  2D0P A;  1FJG Q;  4JK1 C;  4UY8 C;  2K5V A;  1Y1W H;  4KKT A;  2JEB I;  4JV5 L;  5FJ8 H;  4C1N I;  1OXS C;  4A3F B;  1K9M C;  3IKJ A;  3VR3 A;  2L1B A;  1HNX L;  3U9S A;  4XQQ A;  1HR0 Q;  4KK7 A;  1SYG A;  2LSS A;  4DV7 Q;  3FMC A;  2DNE A;  2F0E A;  3QJY A;  2HT1 A;  4R4T A;  3CC7 A;  3DWA A;  5M3M B;  5DNF A;  1I6H B;  4BY1 H;  4DA2 A;  1F9P A;  4QGU A;  4NW2 A;  4DV3 L;  3T51 B;  2B2V A;  4YHH Q;  4ZAI A;  3VA5 A;  1IL2 A;  2KQ3 A;  3HKZ G;  4LF9 L;  2R7Z H;  1R9T H;  3H91 A;  2F0S A;  2NZO A;  1AN8 A;  2F0N A;  5LMU L;  2E76 C;  4G7Z C;  1J8I A;  1LTI D;  4A3D B;  1CZW A;  2SEB D;  2UXC Q;  3I56 A;  4ZCK A;  4A3C H;  1JT8 A;  1BCP F;  2B3G A;  3KLW A;  1EYC A;  5C3W A;  1SND A;  1WCM H;  4A3B H;  2YTY A;  3OTO Q;  3FKI G;  2F1M A;  4GNX B;  1JE5 A;  1N33 Q;  1DON A;  1PHJ A;  2PNH A;  2R93 B;  4MTK A;  2KCN A;  1TWH B;  2IT1 A;  2CCZ A;  1Q90 A;  1K83 H;  2N88 A;  3F2D A;  2RBM A;  2F4I A;  1CHQ D;  4A3K G;  2IPK D;  4KHV A;  2VXW A;  2NN6 H;  3JAM E;  3UDX A;  3A5U A;  3NWS A;  2JP1 A;  2PNR C;  1F9Q A;  4CDF C;  3RMH A;  3SR1 A;  4DN4 M;  1VQB A;  4OO1 G;  1EFW A;  2F0O A;  3HOU G;  2DY7 A;  3S2D B;  1SE8 A;  3BDC A;  3BVZ A;  2K5W A;  3HOX H;  4FF1 A;  2DUD A;  2AUJ D;  2F0T A;  3CHB D;  4K6L A;  5C44 G;  2F0D A;  4LUO A;  1X56 A;  1CKN A;  5IYB H;  1FR3 A;  2Z4H A;  1KNA A;  3TSS A;  2BH8 A;  4F8M A;  5C3E B;  1YVC A;  2J4X A;  3H3V H;  3G48 A;  4JC0 A;  1YIT A;  5FLM G;  1H9J A;  2QA4 A;  4OO1 I;  2XWB B;  1IBK L;  1GUT A;  1T5E A;  1CQF A;  3PUY A;  3NP8 A;  4JI7 L;  1VQI A;  2ID0 A;  1ASY A;  1XMQ L;  3LX0 A;  4A3F G;  4B3T Q;  1F2M A;  1DD2 A;  5C0X J;  1QUQ A;  1PZI D;  4GLV B;  4CJ2 C;  5AJ3 Q;  2LY7 A;  4HR7 B;  1YHA A;  1V9P A;  1DZ1 A;  3SK5 A;  3AQQ A;  5I6W A;  2WAC A;  3EN2 A;  2PZU A;  1V1P B;  1SN8 A;  1DXM A;  1DOL A;  3GTJ H;  2VB2 X;  2MHV A;  4DNR B;  1SMY D;  1QVF A;  1ONL A;  1NR2 A;  4GOP A;  1STB A;  2EYM A;  4C56 C;  2DJG C;  2K7V A;  5FLX c;  2WFW A;  2E75 C;  4R8I A;  1EIY B;  4BY7 G;  3M3Y B;  3G4S A;  3U4V A;  4CGY B;  4QB4 A;  5LMN L;  4MNO A;  2CW0 D;  3OIQ A;  4DK6 C;  2LXJ A;  5JAV A;  5IOD A;  2JA7 H;  4DR4 Q;  2BA1 A;  1KDC A;  2K5Q A;  1SBB B;  2DNC A;  2ENB A;  1HNZ Q;  5EAY A;  3ULP A;  3BS1 A;  1TS2 A;  4I7Z C;  2WP8 J;  1SFO B;  3CW2 C;  4IPH A;  4JW0 A;  1UUP A;  3QB3 A;  1FVI A;  1Z7T A;  2JA5 H;  1K3R A;  3CP0 A;  2LKV A;  4C3I B;  1U9R A;  1K28 A;  3GTM H;  3SHL A;  1H9S A;  2F4V L;  3J81 E;  1F2L A;  5HUR A;  2D9U A;  2QCP X;  1A2T A;  3QO2 A;  4B9X A;  2K6A A;  1J5E L;  1V8Q A;  2F0P A;  2JSO A;  3OSO A;  3U9O A;  1ZYR D;  5FO7 B;  2B63 B;  1STN A;  2C35 B;  3MAQ A;  3QWN A;  2IX0 A;  3ERQ A;  3T56 B;  2MP1 A;  2WAQ G;  4XYO A;  1BBX C;  1PFM A;  4XQN A;  1LO5 D;  4LF8 Q;  2UU9 L;  2C9O A;  3GD7 A;  2J7Z A;  1KDA A;  4R8N A;  4L63 B;  3M85 A;  2PW7 A;  5C3E G;  4LJZ C;  5J39 A;  5C4J H;  1ESF A;  2A68 C;  1I4R A;  3GTP B;  3R8B A;  1NCV A;  5IIF A;  1L1O C;  1PTO F;  2KBN A;  3H0G H;  4S3S A;  1CT1 D;  3DWP A;  4JI3 Q;  3SEB A;  1E1T A;  5E1F A;  1IW7 D;  5CV9 A;  3RN5 A;  2MGS A;  5KND A;  4G7O C;  1BQQ T;  2YV5 A;  4EVO A;  3VR4 A;  3ONA B;  2ASB A;  2B2W C;  4OEM B;  2A19 A;  5C4Z A;  5CV7 A;  4DAY B;  5C4X H;  1LTL A;  4K0K Q;  1K73 C;  1K83 B;  1NR4 A;  3NTI A;  2D5D A;  1A3T A;  2A6E D;  2XNA C;  2JA9 A;  1GUG A;  2NZH A;  3I4L A;  3MXN A;  1VQF A;  1DGS A;  1HUM A;  2B2U A;  4HTH A;  4ZUJ A;  4C3H H;  1TU2 B;  4EQ5 A;  3HOZ H;  3KF8 B;  1WVL A;  4OHJ A;  2LFN A;  3IL8 A;  2PQE A;  1SEB D;  2WB1 E;  3HOX B;  5H1S E;  2OWO A;  1DM0 B;  4DV2 L;  2ICI A;  2E5L Q;  3A8K E;  1LTS D;  1EU4 A;  3I2Z A;  4LMQ D;  1A63 A;  3NEM A;  1KLU D;  2JA8 H;  3BVG A;  4WOR A;  2Q8I B;  4HIO A;  3W1B A;  3VR2 A;  3C3L A;  1Y8P B;  2NVY H;  1Y1W G;  3CCU A;  3RZD B;  2KVM A;  3DM3 A;  1TQO A;  4O1N A;  4UP9 A;  3C46 A;  4ZYS A;  5FJ8 G;  4HJ5 A;  4X3T A;  1BF4 A;  4CJ0 B;  5JEA J;  4YWM A;  2PQA B;  4OIJ A;  4QJF A;  3L2P A;  3G6E A;  3A0J A;  5LL6 S;  1M90 C;  5A2Q E;  1JOO A;  5JPN C;  2UUC L;  4IAL A;  1JE4 A;  2VL6 A;  5M5Y H;  2KUM A;  5D65 A;  1PYW D;  3KF6 A;  3K57 A;  1Q3L A;  3NUC A;  2EDG A;  3EVQ A;  3CU7 A;  4GN4 B;  1SYC A;  3GTJ B;  4JBK A;  2PO4 A;  1O7L A;  1KAB A;  1K8G A;  4POG A;  1CI3 M;  5TSS A;  1PFN A;  2RCN A;  4TRD A;  3ND8 A;  3DHQ A;  4JOI C;  5CR3 A;  1PH1 A;  1UEB A;  1BBW A;  2E8G A;  2RKS A;  2UUA L;  1AW7 A;  4UAI A;  1XPU A;  1JOQ A;  1XNR L;  1ZXT A;  1SNM A;  3LWU A;  4RG1 A;  2MNA A;  1O7Z A;  3KDF B;  5EGT A;  4IUT A;  1SYB A;  4A3C G;  1Z47 A;  4XT1 B;  2PMZ E;  3NQT A;  3CCL A;  3E3X A;  2QKI C;  5C0X H;  3GTL B;  1IYJ B;  3P7J A;  1ENC A;  1ZKO A;  2E2J B;  5E7N A;  1HHV A;  4GNX C;  2NB0 A;  1WCM G;  1N32 Q;  4A3B G;  3I4M H;  4RHS A;  1IZ6 A;  5DEH A;  5IYC H;  1CA6 A;  4RH6 A;  4JI4 L;  3AB9 A;  1PH4 A;  3RUZ A;  5BR8 L;  3EJI A;  4DK3 C;  1S5F D;  4BBR H;  1VQP A;  3CC4 A;  1XNQ L;  1X3Q A;  1B3Q A;  2Q2H A;  2JQO A;  2YU9 B;  3GDE A;  2KCM A;  2NN6 G;  1NNX A;  1JJC B;  4OX9 L;  3VDY A;  1PYB A;  1EWI A;  3HRZ C;  4AQY Q;  2GN5 A;  2Z8L A;  1O7I A;  4L5R C;  1U4P A;  3HOX G;  4AYB E;  5M5X B;  1VQ9 A;  1J9O A;  5IYB G;  4FF3 A;  4DR2 L;  4MIU A;  2A74 C;  4R4Q A;  1E2Z A;  3HEJ A;  4HID A;  3MFG A;  4YCV A;  1SDF A;  2F0L A;  4YIJ A;  1EQT A;  1SNO A;  4IOC A;  1EWH A;  4YY3 L;  4DV4 Q;  3C2P A;  1MSH A;  3K5L A;  3L0O A;  3NBH A;  4IPG A;  2K03 A;  4GN5 A;  4J8Q A;  1Z6H A;  2IWH A;  2JYO A;  2D62 A;  1YNN D;  1JB3 A;  5M3M H;  1OTC A;  1I6H H;  4XXE A;  3PMF A;  4RGM A;  2X6G A;  3URY A;  5EPK A;  4JI1 Q;  1KDB A;  3NHH A;  3GQB A;  2CHB D;  4LF6 Q;  1TWC H;  2MFI A;  1EU3 A;  3S14 B;  4KI0 A;  1H95 A;  3Q0A A;  5IT9 E;  2I07 B;  3I7F A;  4WJW A;  3GO5 A;  2L11 A;  2DGY A;  4H44 C;  3T1H Q;  2CQO A;  4KN7 C;  3JAM i;  5GQO A;  4IUV A;  4A3G B;  4C3H B;  1D2B A;  4DXG A;  4IO9 A;  3E9I A;  3HOW H;  5BN5 A;  4A3D H;  1YHQ A;  3FVQ A;  4QIW E;  3IRB A;  1PA6 A;  1CSQ A;  4DXF A;  3MEF A;  3K81 C;  4JI0 L;  2BCO A;  1D8L A;  1RTO A;  1BKB A;  4HN7 A;  5IOC A;  3CXC A;  2K01 A;  3U50 C;  4CJ1 B;  4DV6 L;  2EOT A;  2ALY B;  2XIW A;  2NTT A;  4C1N K;  2JA7 G;  1S4Z A;  3I70 A;  3A54 A;  4I7A A;  3WOF A;  2JA8 B;  4RGN A;  2IL8 A;  5D14 A;  1W3S A;  2YYZ A;  2Y0S E;  2R93 H;  3BZK A;  1QVG A;  1TWH H;  4X3U A;  3W1G A;  1HTL D;  2F0M A;  2K4K A;  1SMY C;  4DR1 Q;  2A68 D;  3J7A 5;  1D1K A;  3NE5 B;  2NVY B;  2LXK A;  4CDC C;  1JWS D;  2R92 B;  4CHT B;  1KD1 C;  2JA5 G;  2JJQ A;  1XPO A;  4N9P A;  1WTO A;  1C0A A;  4DV1 Q;  3MC0 B;  2CWP A;  4A3I B;  2BA0 A;  2TSS A;  3RNU A;  4LFB Q;  2VW9 A;  2UXB L;  3M7G A;  2GA4 B;  4HMI A;  1JOK A;  4L6T B;  3K80 C;  2KEC A;  4A3J B;  4LF4 Q;  2CW0 C;  1JCK B;  4RGO S;  5JVG 3;  5M5W B;  2TMP A;  1PH3 A;  3OWF A;  4DK1 A;  1GVP A;  1LM0 A;  4JVZ A;  1QB5 D;  4X64 L;  3CRL C;  3A7A B;  1U4R A;  2Q8T A;  4QQB X;  4DKA C;  2SOB A;  1V1Q A;  5BN3 A;  3AMU A;  4KHZ A;  4P2C B;  4YCW A;  1HA6 A;  1LTT D;  4QL5 A;  5AFW A;  5IGB A;  1I4H A;  3IFT A;  1SYD A;  4ABN A;  3H0G G;  2IX1 A;  4FYD A;  1PH7 A;  1PDQ A;  2NYZ D;  5JEA H;  2PI2 A;  1ZYR C;  2UUB L;  2I46 A;  5I2Y A;  5IGC A;  1QZG A;  1S5E D;  2NWG A;  1CKM A;  1I4X A;  1L1O A;  4ME3 A;  4UHV A;  5KNB A;  4IPC A;  3T53 B;  1OXU A;  3J81 i;  1Q1B A;  3B6Y A;  4IUR A;  1F9S A;  1SRU A;  1MSG A;  2ATW A;  4C3H G;  5F2D A;  4IZ8 A;  3HOZ G;  1N36 L;  3M3Y H;  5KGU A;  1FJG L;  3K58 A;  4X62 L;  1XX8 A;  4X6A H;  3F8T A;  4WJ3 M;  2AQ2 B;  4KD4 A;  2R61 A;  4DV0 L;  4K14 A;  5JJL A;  3UE0 A;  1F77 A;  3TN2 A;  5CBE E;  2G9D A;  1JWU D;  2ZTE A;  5IP9 H;  5M3F H;  1HR0 L;  3LWE A;  4DR7 Q;  4DV7 L;  2AQ1 B;  2AWO A;  5FOB B;  4B3S Q;  2JA8 G;  1SFO H;  1WOC A;  1DOM A;  3S15 B;  1TXY A;  2A6E C;  3D3R A;  3K0X A;  4C3I H;  2JXM B;  4ID6 A;  1G6Z A;  3OW2 A;  4L8J A;  4YHH L;  4GKK Q;  1W6J A;  1KL9 A;  1FNW A;  2EIF A;  3FP9 A;  4FO2 A;  2R3Z A;  1D6E C;  4A4I A;  1PYS B;  3T16 A;  1STA A;  4TQU S;  1Q81 C;  3J80 E;  2WB1 B;  5EKI A;  4JI2 Q;  2B63 H;  4DNI A;  3D4D A;  1TWC B;  3KUP A;  2UXC L;  1B1Z A;  4OWW B;  1AP0 A;  4XDX A;  1UE1 A;  1AZQ A;  1AFP A;  5EJW A;  1TY0 A;  2KHI A;  3NXW A;  1X6O A;  4NXM L;  2DY8 A;  4LF7 Q;  5CV5 A;  3J7Y W;  3OTO L;  3HOW B;  5CMD A;  2M9V A;  4KJN A;  1VQE A;  3GTP H;  2UXD L;  3VR6 A;  1WD1 A;  3HZX A;  2AKW B;  2MPM A;  3EQL C;  1EYD A;  3TZD A;  1RJT A;  4X66 Q;  1Y14 B;  2Q2I A;  3SK6 A;  4ZRZ A;  4FXG C;  1L0W A;  3RLO A;  3EFX D;  3BJU A;  1SJE D;  3E6Z X;  4BBS H;  1TR5 A;  4RKL A;  3EBE A;  5C0X G;  3T13 A;  3TZU A;  4JOI A;  3DEO A;  4DV3 Q;  3I4M G;  4HCE A;  1T5X D;  5EBD A;  3ER0 A;  3K7A B;  2RHQ B;  5IYC G;  2K5N A;  2IHF A;  2I5M X;  4BBR G;  5LMU Q;  4IUU A;  5C0X I;  4IFD J;  1LV9 A;  5E4X A;  3KLS X;  3I91 A;  4GNX A;  2F0W A;  3HG9 A;  2CFM A;  3MVV A;  3J81 L;  1I50 H;  3I4N B;  3GV6 A;  2IJ0 A;  1BBU A;  4LK1 C;  1KAA A;  4MTN A;  1Q12 A;  3PUV A;  4IJH A;  3A56 A;  5G3L D;  1EIH A;  2EJM A;  1HCZ A;  4R9W A;  3Q22 A;  2EXD A;  4B3T L;  2K5D A;  4CDE C;  4HJ7 A;  1KNE A;  1VF7 A;  1X54 A;  4IUN A;  4OON A;  1UNS A;  2L55 A;  1PH2 A;  1VQN A;  4RHR A;  2K75 A;  5J22 A;  5AJ3 L;  4J1M A;  4B3R Q;  2EE1 A;  3M4Y A;  1YNX A;  2RCF A;  3CPF A;  1SYF A;  2V4D A;  1Y1V H;  2N78 A;  3RZD H;  1JJ2 A;  1KXL A;  2B2Y C;  4R1J A;  1PMR A;  1QIL A;  5C5L A;  1PLF A;  1FL0 A;  2HDL A;  3HS0 C;  1X9N A;  3PIO 3;  3A8J E;  3VA7 A;  4GN3 B;  1VQO A;  2B2T A;  5NUC A;  4F88 A;  1IYU A;  1SAP A;  4IUP A;  1KLG D;  5M3M G;  3J81 j;  1VQH A;  2OQ0 A;  4EGV A;  1SYE A;  4AYB B;  1NUC A;  1KAW A;  2ZM6 L;  1WTR A;  5KYI A;  1CHP D;  5KIX A;  4DAM A;  2JEA I;  1GUN A;  3ICE A;  2VQE L;  2YTX A;  4DR4 L;  1CUK A;  3TS2 A;  1BUV T;  3HOW G;  5EBC A;  4WRD A;  4A3D G;  2CQA A;  4DV5 L;  1BVS A;  5IY0 A;  4Q5V A;  4NDX A;  1IYV A;  2E2D C;  3AFQ A;  5K5P A;  1V1P A;  1F2Z A;  3TP5 A;  4BXX H;  3GTO B;  1YNN C;  1O80 A;  2KHS A;  3GTL H;  2E2J H;  2F0Q A;  5M3F B;  1MD2 D;  4KV6 A;  2VQF L;  4LFA L;  2O5I C;  4LF5 Q;  3CCM A;  2NBF A;  2EPB A;  1SNP A;  2WII B;  4K5X A;  3TQY A;  5ELE A;  3FEW X;  4YWL A;  1LTB D;  2R93 G;  4L5T A;  1I94 Q;  1EIF A;  1A62 A;  2OCE A;  5JJZ A;  1OXT A;  3P20 A;  3KOJ A;  1YJ9 A;  4IOA A;  3HKZ E;  2XTI A;  3MWY W;  3PGZ A;  4IN3 A;  2PYK A;  4BA2 I;  2PCF B;  2YU9 H;  4LF8 L;  3GTK H;  2AUK A;  2PI2 E;  2CH4 W;  4QIW B;  2KCC A;  3NPP A;  2RSO A;  4OIK A;  1C9O A;  1ICW A;  4MHE A;  1LAB A;  3A74 A;  2F0V A;  1Q86 C;  1VMC A;  3HOV B;  2N49 A;  1E2V A;  2L4N A;  3I4N G;  1WFQ A;  1EY9 A;  5M5X H;  3HOY H;  4JI3 L;  4GS3 A;  2DJF C;  2E74 C;  3MXG A;  4P75 A;  3BDO A;  2M2L A;  2Y0S B;  3UI2 A;  2NZ1 D;  5C5M A;  2L9H A;  4JPB W;  1SR3 A;  2RDF A;  3MA2 B;  4QCL A;  4XTC S;  1FNV A;  1TS4 A;  2K1B A;  1PFB A;  1MJE A;  3D6W A;  4BBS B;  2HIV A;  2OQK A;  1LTG D;  1PRT D;  3OMG A;  1IBM Q;  4KN4 C;  1ROD A;  5JEA G;  4UP7 A;  3L9A X;  5A35 A;  1VS0 A;  3A55 A;  3S14 H;  1P16 A;  4QUC A;  2O4X A;  1BOS A;  2UU9 Q;  1EEI D;  3MEH A;  3KYH C;  4POF A;  4LWC A;  4A3G H;  1GUW A;  1TWG H;  3NBI A;  1HPC A;  5IWA Q;  1SMX A;  1L2F A;  2XRQ D;  4NB3 A;  2RA4 A;  3X3M A;  3TRE A;  3PO3 B;  4DAY A;  1I50 B;  5LHY 1;  1W6K A;  4GLX A;  1E1O A;  1PRT B;  1CFM A;  3CKI B;  4OWT B;  3VYR A;  1FNU A;  4A93 B;  1FGU A;  2QGQ A;  4A3E B;  5IP9 G;  5M3F G;  2BH2 A;  2F52 A;  3UDI A;  4JBJ A;  1VQC A;  4FXD A;  1GOZ A;  1CKO A;  3KF8 A;  1Q82 C;  3QG1 A;  3V05 A;  4OXP A;  1Y1V B;  3CCV A;  1S5D D;  2R92 H;  3CD6 A;  4I65 A;  4GZY C;  4DU9 A;  1SE3 A;  3PV0 A;  4C3I G;  1FD7 D;  4A3I H;  4G4K A;  4N9T A;  2D2C C;  2KEE A;  5FO9 B;  4IFD H;  2FIN B;  3CQZ H;  1E2W A;  1PXU A;  1S5C D;  2QW7 A;  2K5H A;  2RHS B;  5L37 A;  4A3J H;  4NXN Q;  1AH9 A;  5G3L F;  4R4I A;  1L0Y B;  3D8G A;  2FJ2 A;  1BO0 A;  4PNY A;  1WD0 A;  2B63 G;  3RZO H;  5M5W H;  4A3L H;  3STB D;  3M4O H;  3K7U C;  5IP7 H;  1D7Q A;  1EEF D;  5FLX E;  4EQN A;  5J1Z A;  3H15 A;  1GO3 E;  3ZYY X;  2PQA A;  1N32 L;  2VUM B;  2B39 A;  3KBX A;  5FO8 B;  2RQX A;  1ILQ A;  4LFC L;  4A3M H;  2B8F A;  3DM1 A;  3KJO A;  4K8J A;  3S1Q B;  5DM6 3;  5COY A;  4BBS G;  1NE3 A;  3WOE A;  3PF5 A;  1BXT A;  4RA8 A;  4NPS A;  1HA5 A;  5ELO A;  1MI2 A;  2XN9 C;  2WKD A;  4CKB A;  3M4Q A;  3FPP A;  3MHB A;  1LT4 D;  3H09 A;  3K0Y A;  3TP8 A;  3K59 A;  1QG7 A;  4AQY L;  1X32 A;  1YEZ A;  2WAQ E;  1EY8 A;  3KDF A;  3VYU A;  4EX5 A;  3ZJY C;  5CGK A;  3D4W A;  2YTV A;  5ELN A;  2UUA Q;  1F2Y A;  3GTK B;  2Z6K C;  1XNR Q;  2NVX B;  2KHJ A;  1G29 1;  3P1H A;  3J80 i;  4EQP A;  1KRT A;  3R93 A;  4A75 A;  4DR5 Q;  4HMJ A;  2J0T D;  4K5W A;  1ENF A;  4LUZ A;  4B3M Q;  1XMO Q;  2N3S A;  3T4A C;  4LAA A;  1IBL L;  5J3B A;  3PIP A;  5HGT A;  5D3D A;  3FDT A;  3GV3 A;  4DV4 L;  3NTH A;  4LW1 A;  3HOY B;  3DMU A;  1ASZ A;  3J7A F;  3LGJ A;  2B2T C;  1A0I A;  2QF7 A;  3S9W A;  1HRJ A;  2FMM A;  1S40 A;  1VQL A;  3BYT B;  1HNW Q;  2QEX A;  3S15 H;  2EYO A;  5ELD A;  2MUY A;  4ZKB B;  3D6C A;  3Q23 A;  5BR8 Q;  1RD9 D;  1BDO A;  4LF6 L;  2EJF C;  1LT3 D;  4KHP Q;  4JYA Q;  1JB7 A;  4UP8 A;  4DUZ L;  4YWK A;  3E0J A;  4K6D A;  1Y1V G;  4DF7 A;  3GP7 A;  4V19 0;  1LUZ A;  3F1Z A;  3PQI A;  4OX9 Q;  3E5S A;  1QZH A;  4HCS A;  1EQQ A;  5CV6 A;  2D0O A;  3W2D A;  1CSP A;  2HQL A;  3RN2 A;  4PG3 A;  4IUQ A;  5ELC A;  2B2Y A;  4IJL A;  3I55 A;  1I3Q B;  4DR2 Q;  4X65 Q;  1Z9F A;  1TWG B;  3KFU A;  1PH8 A;  1N34 L;  1UE6 A;  2X69 A;  4MN3 A;  4NKL A;  3TS0 A;  1HJP A;  2FMC A;  1TT2 A;  1X65 A;  4HED A;  4H7B A;  1X3G A;  4DR1 L;  1SXT A;  4R4O A;  2L0C A;  2KCT A;  1AZP A;  2F0G A;  4HIK A;  4BXX G;  3Q8D A;  2OXP A;  4DV1 L;  2WKC A;  3OOC A;  4RAU C;  2SNS A;  4H0L C;  1GD7 A;  2OT2 A;  4HJA A;  4ZLT F;  3K7A H;  2RDG A;  1EZ6 A;  4HSV A;  4DK0 A;  3JC6 6;  3CME A;  2K28 A;  2C5C A;  3I90 A;  4JI6 Q;  3M7N A;  1BCP B;  2ZJR A;  5FKA C;  3MXU A;  1NMF A;  4KD3 A;  1WTW A;  2FHT A;  4RWS C;  1V1O A;  3CQZ B;  4K2K A;  4JI5 Q;  1EQR A;  3I4N H;  2EYH A;  4DR3 Q;  4L5Q A;  3S1N H;  1JOR A;  3Q24 A;  4DR6 Q;  4GKJ Q;  3K8A A;  2A69 D;  3RZO B;  1AE3 A;  2A73 B;  2BDN A;  3J80 L;  1Q8K A;  3SE0 A;  3M4O B;  1EYG A;  3HOY G;  1B70 B;  1TS5 A;  1GXD C;  3NSW A;  4C3J H;  2R6G A;  1MBY A;  4ME5 A;  4FXK C;  3JAM c;  1JJG A;  4BS9 A;  2EYL A;  4Z9C B; 
#chains in the Genus database with same CATH homology
 5KRU A;  2EY5 A;  4RFB A;  3KLR A;  3HKZ B;  4A3M B;  2ICE C;  3MTS A;  4XQJ A;  3NQI A;  4BA1 I;  1G2T A;  1WTV A;  1LTA D;  2PPB C;  4B08 A;  1G2S A;  3N52 A;  1WTX A;  1O7Y A;  2K33 A;  3KBG A;  2EY2 A;  3GTQ B;  3C1F A;  3S1M B;  4H13 C;  3FKI B;  5I9O A;  3NWT A;  4UDU C;  1FGB D;  3D31 A;  3O13 A;  1Y69 U;  3NTK A;  3V2T A;  1M4V A;  3H6M A;  3JAM L;  2K05 A;  3R2I A;  4QMG A;  4A3K B;  4RCN A;  3SK4 A;  1H9R A;  2BDO A;  1E0B A;  1H9K A;  1PRT C;  4DAV A;  2EJG C;  5FK9 C;  3WDN A;  3HOU B;  4PMB A;  1LLR D;  1BNZ A;  1U4L A;  3OHX C;  5C44 B;  3OWE B;  5EPJ A;  1B4O A;  3A7L A;  3EA6 A;  1B53 A;  3BG3 A;  4JBW A;  5CV4 A;  3FPU B;  5KEE A;  5KYL A;  2PZT A;  1K8M A;  4IFD G;  1NAP A;  5C6A A;  2SNM A;  1EY6 A;  3J7A V;  1EL0 A;  4KTA A;  2A6H D;  1PTO D;  4KY7 A;  1UAP A;  1TY2 A;  5I2X A;  2XSC A;  2H4O A;  4PMC A;  1HFG A;  1CZG A;  1S5B D;  4IFD I;  4U67 3;  2EXZ A;  4EQO A;  4K2L A;  2JE6 I;  5ELF A;  1WTP A;  1D5X C;  4IQZ A;  5M9O A;  1XYI A;  4CKC A;  2NTS A;  4BY7 B;  5IGF A;  4DFA A;  3BVM A;  1YNJ D;  1PTO B;  4XT3 B;  3C1E A;  3F2U A;  2DN8 A;  1A3V A;  4C2M B;  1VF5 C;  1QCB D;  4B9W A;  1G91 A;  1STY A;  2NVQ B;  1MGS A;  1JR0 D;  1NSN S;  1CK1 A;  1FYC A;  2E2I B;  1CA5 A;  1EQV A;  2PZW A;  3R2T A;  4FVM A;  4FNF A;  3S1N B;  3VYS A;  1F9R A;  2RSN A;  5I4D A;  2PW5 A;  2PMZ B;  1EFI D;  1XTC D;  2XVS A;  3GTG B;  4C3J B;  2A5H A;  1JQY D;  4ZK9 B;  3I3C A;  4ULL A;  2Z1C A;  1K8O A;  2LS0 1;  2WAQ B;  5IGG A;  1RDP D;  1G8Z D;  3L7Z C;  1LAC A;  3P75 A;  5CBA E;  3IAY A;  5CV8 A;  1B9M A;  1B2T A;  3K5O A;  5T1I A;  4FP5 D;  3OPO A;  1PZJ D;  1QE6 A;  2VNU D;  2BE5 C;  2JA6 B;  1ILP A;  1O78 A;  1QNK A;  4KY6 A;  5I9P A;  1EY5 A;  5E4W C;  1HFN A;  2LMC B;  2K32 A;  2KJX A;  2E2H B;  5K36 H;  3VR5 A;  3SK8 A;  4KJO A;  1SE2 A;  3N6R A;  3TP6 A;  1DOK A;  4V0B A;  2EVB A;  1B3A A;  2F0I A;  4DGZ A;  3A8I E;  3K5N A;  2EYJ A;  4PQX A;  5IGE A;  1IKL A;  1A3U A;  1H9S B;  1BCP C;  5LL6 X;  3S17 B;  1R4P B;  3L3O C;  1STH A;  1A2U A;  1TWF B;  4DAP A;  3VYT A;  1Y1W B;  4XYQ A;  3PIP 3;  1GUS A;  5A2Q L;  2Q8R E;  3S16 B;  1STG A;  4C3J G;  4CKE A;  2EY6 A;  3SVM A;  4BY1 B;  5FLX L;  2HCI A;  1GHK A;  2M00 A;  1SE4 A;  1B44 D;  4K8I A;  3OIP A;  2R7Z B;  1D5Z C;  3I8Z A;  1R9T B;  1SNQ A;  3SDZ A;  1QOH A;  2F0J A;  2A69 C;  1D1I A;  1Q1E A;  1C4Q A;  4OL7 A;  2AQ3 B;  2OF1 A;  3KLS A;  1QJO A;  4RGT A;  1WCM B;  1TWA B;  4A3B B;  2SDF A;  4RKB A;  2RDH A;  1SNC A;  2EYF A;  1H9M A;  3ND9 A;  2ZXP A;  2HDM A;  3BDL A;  1DJR D;  3RD4 A;  4FF2 A;  4TKO B;  1JWM D;  1RKN A;  5JOB A;  3IFD A;  2F3W A;  1KTK A;  4F7X A;  3TP7 A;  1I4Q A;  1M8A A;  5IGD A;  1HQR D;  3K5M A;  3HP3 A;  3TME A;  1QNU A;  1OXV A;  1LT6 D;  1X3P A;  3DUZ A;  1I4G A;  1JC7 A;  3DWQ A;  4DNT B;  1GHJ A;  2B2V C;  1TVX A;  4FF4 A;  1SSO A;  2L5T A;  1VDZ A;  4ODG A;  2ZXO A;  5IT9 L;  2HQE A;  5JPM C;  4RCO A;  3CRK C;  4HSP A;  4K5V A;  4CBV A;  1EOT A;  3PO2 B;  2KOL A;  4G7H C;  1XXG A;  1DYQ A;  4PMW A;  1VMP A;  2HUG A;  3H94 A;  4BWG B;  3R3O A;  2QEJ C;  1EZ8 A;  2KED A;  2NVT B;  1EY4 A;  1CTM A;  4KKU A;  2A6H C;  1PTO C;  1HUN A;  1B50 A;  1B9N A;  2HCC A;  3LNN A;  3OW7 A;  1ML0 D;  2BOS A;  2Z4I A;  5D3I B;  2CVR A;  2JA7 B;  3KK7 A;  4NMZ A;  3PUW A;  1U4M A;  1HQM C;  4QF4 A;  5E3F A;  5COR A;  2JA5 B;  2BE5 D;  2IX3 A;  3V96 A;  1EIG A;  3TDQ A;  3GTM B;  2AWN A;  1TKW B;  1ZEQ X;  1L0X B;  4OO1 H;  2FFK B;  2RVL A;  3I73 A;  3PUZ A;  2G9H D;  1YNJ C;  2EYP A;  2XRS D;  5ISR A;  4HAE A;  1I6V C;  1WTQ A;  3D4R A;  2ZT9 C;  2VB3 X;  2O5J C;  2XWJ B;  5EPL A;  1CM9 A;  1D5M C;  5EQ0 A;  3MFY A;  1AEX A;  2NN6 I;  1IHZ A;  2QDB A;  1ET6 A;  3G6J B;  5C4J B;  1TS3 A;  1LTR D;  1ENA A;  3H0G B;  1XWE A;  1ESR A;  3BYY B;  2F0K A;  3X3N A;  1BCP D;  1ET9 A;  1HTP A;  4ILW A;  4M8A A;  1EY7 A;  1Y8O B;  3NK9 A;  1OXX K;  4E6I A;  5C4X B;  3S2H B;  2B8G A;  5CYU A;  3I72 A;  1LT5 D;  1SJH D;  5K36 G;  4ZKC B;  1PRT F;  1C48 A;  2QIL A;  3BZD B;  3HOZ B;  1VCI A;  1PTO H;  2EY1 A;  3PUX A;  4QUF A;  1Q8I A;  4Y7N B;  3ERO A;  3Q6S A;  1RCV D;  2O2L D;  1C8C A;  4O42 A;  4ZUI A;  5EKL A;  3QIA A;  4KKS A;  1IKM A;  3ITP A;  2MJ8 A;  3MXP A;  2OEO A;  1DCZ A;  4X3S A;  1BR9 A;  3DEP A;  1HXY D;  5DAU A;  5I6Y A;  3QOL A;  5BN4 A;  4ZQ3 A;  2L12 A;  3QOJ A;  2F0H A;  3OMC A;  5T1G A;  2ZXR A;  3W3A A;  5M5Y B;  4M1U B;  1I4P A;  4NP5 A;  1A6X A;  1OO9 B;  3FRP B;  3AU7 A;  1EY0 A;  4WFN 3;  4KY5 A;  1RF2 D;  4U68 A;  3TBI B;  1RHP A;  2EZV A;  2F03 A;  2H1E A;  1II3 A;  1UEA B;  3SXH A;  1EYA A;  1EWC A;  2F3V A;  1A15 A;  5EKK A;  5ELB A;  1CQV A;  2IW3 A;  1Y8N B;  4Q0F A;  2F0F A;  2B2U C;  5KNC A;  2F0U A;  1V43 A;  2WV6 D;  2NUC A;  2X6L A;  2WIN B;  3I4M B;  2K04 A;  4XIG S;  3RLF A;  5C3X A;  4TSS A;  1JIC A;  5DM7 3;  2KA7 A;  1STE A;  4BBR B;  1GUO A;  1PZK D;  3K6O A;  4X3K A;  4KMU C;  5CC4 A;  4J6H A;  2B2W A;  4PV1 C;  1TII D;  4G57 A;  5JVH 3;  5C4H A;  4OGQ C;  1GJX A;  3G7L A;  1IW7 C;  1QWY A;  2N55 A;  4F87 A;  1RTN A;  3MZ5 A;  3DXJ C;  1R4Q B;  3H3V C;  3HGB A;  3S1R B;  1IL8 A;  4JK1 C;  4KKT A;  2JEB I;  4C1N I;  1OXS C;  4A3F B;  3IKJ A;  3VR3 A;  2L1B A;  3U9S A;  4XQQ A;  4KK7 A;  1SYG A;  3FMC A;  2DNE A;  2F0E A;  3QJY A;  3DWA A;  5M3M B;  5DNF A;  1I6H B;  4DA2 A;  1F9P A;  4NW2 A;  3T51 B;  2B2V A;  4ZAI A;  3VA5 A;  2KQ3 A;  3H91 A;  2F0S A;  1AN8 A;  2F0N A;  2E76 C;  4G7Z C;  1J8I A;  1LTI D;  4A3D B;  1CZW A;  2SEB D;  1BCP F;  1EYC A;  5C3W A;  1SND A;  2F1M A;  1DON A;  2R93 B;  2KCN A;  1TWH B;  2IT1 A;  1Q90 A;  2N88 A;  2RBM A;  2F4I A;  1CHQ D;  2IPK D;  4KHV A;  2VXW A;  2NN6 H;  3JAM E;  3NWS A;  2JP1 A;  2PNR C;  1F9Q A;  4DN4 M;  3RMH A;  3SR1 A;  4OO1 G;  2F0O A;  3S2D B;  2DY7 A;  3BDC A;  3BVZ A;  2K5W A;  4FF1 A;  2AUJ D;  2F0T A;  3CHB D;  4K6L A;  2F0D A;  1FR3 A;  2Z4H A;  1KNA A;  3TSS A;  4F8M A;  5C3E B;  2J4X A;  4OO1 I;  1H9J A;  2XWB B;  1GUT A;  1T5E A;  1CQF A;  3PUY A;  3NP8 A;  2ID0 A;  3LX0 A;  1F2M A;  1DD2 A;  5C0X J;  1PZI D;  4CJ2 C;  2LY7 A;  4HR7 B;  1DZ1 A;  3SK5 A;  5I6W A;  2WAC A;  2PZU A;  1V1P B;  1DXM A;  1DOL A;  4DNR B;  2MHV A;  2VB2 X;  1SMY D;  1ONL A;  1NR2 A;  1STB A;  2EYM A;  4C56 C;  2K7V A;  2E75 C;  4R8I A;  3M3Y B;  4CGY B;  4QB4 A;  2CW0 D;  3OIQ A;  5JAV A;  5IOD A;  2BA1 A;  1KDC A;  2K5Q A;  1SBB B;  2DNC A;  2ENB A;  3BS1 A;  1TS2 A;  4I7Z C;  2WP8 J;  1SFO B;  1UUP A;  3QB3 A;  1Z7T A;  2LKV A;  4C3I B;  1U9R A;  3SHL A;  1H9S A;  3J81 E;  1F2L A;  5HUR A;  2D9U A;  2QCP X;  1A2T A;  3QO2 A;  4B9X A;  2K6A A;  1V8Q A;  2F0P A;  2JSO A;  3OSO A;  3U9O A;  1ZYR D;  5FO7 B;  2B63 B;  1STN A;  3MAQ A;  3QWN A;  2IX0 A;  3ERQ A;  3T56 B;  2MP1 A;  4XYO A;  1BBX C;  1PFM A;  4XQN A;  1LO5 D;  2C9O A;  3GD7 A;  2J7Z A;  1KDA A;  4R8N A;  4L63 B;  3M85 A;  2PW7 A;  4LJZ C;  5J39 A;  1ESF A;  2A68 C;  1I4R A;  3GTP B;  3R8B A;  1NCV A;  5IIF A;  1PTO F;  4S3S A;  1CT1 D;  3DWP A;  3SEB A;  5E1F A;  1IW7 D;  5CV9 A;  2MGS A;  5KND A;  4G7O C;  1BQQ T;  4EVO A;  3VR4 A;  3ONA B;  2B2W C;  5C4Z A;  5CV7 A;  1K83 B;  1NR4 A;  3NTI A;  2D5D A;  1A3T A;  2A6E D;  2XNA C;  1GUG A;  3I4L A;  3MXN A;  1HUM A;  4HTH A;  2B2U A;  4ZUJ A;  1TU2 B;  1WVL A;  4OHJ A;  2LFN A;  3IL8 A;  2PQE A;  1SEB D;  3HOX B;  1DM0 B;  2ICI A;  3A8K E;  1LTS D;  1EU4 A;  4LMQ D;  1KLU D;  3BVG A;  4WOR A;  2Q8I B;  3VR2 A;  3C3L A;  1Y8P B;  3RZD B;  2KVM A;  1TQO A;  4O1N A;  3C46 A;  4ZYS A;  4X3T A;  1BF4 A;  4CJ0 B;  5JEA J;  4OIJ A;  5LL6 S;  5A2Q E;  1JOO A;  5JPN C;  4IAL A;  1JE4 A;  2KUM A;  5D65 A;  1PYW D;  3K57 A;  1Q3L A;  3NUC A;  2EDG A;  3EVQ A;  3CU7 A;  1SYC A;  3GTJ B;  2PO4 A;  1O7L A;  1KAB A;  1CI3 M;  5TSS A;  1PFN A;  4TRD A;  3ND8 A;  3DHQ A;  5CR3 A;  2RKS A;  1AW7 A;  4UAI A;  1JOQ A;  1ZXT A;  1SNM A;  3LWU A;  1O7Z A;  5EGT A;  4IUT A;  1SYB A;  1Z47 A;  4XT1 B;  3NQT A;  2QKI C;  5C0X H;  3GTL B;  3P7J A;  1ENC A;  1ZKO A;  2E2J B;  1HHV A;  2NB0 A;  4RHS A;  5DEH A;  1CA6 A;  4RH6 A;  3AB9 A;  3RUZ A;  3EJI A;  1S5F D;  1X3Q A;  2YU9 B;  2NN6 G;  3HRZ C;  2Z8L A;  1U4P A;  5M5X B;  1J9O A;  4FF3 A;  4MIU A;  2A74 C;  1E2Z A;  3HEJ A;  3MFG A;  1SDF A;  2F0L A;  4YIJ A;  1EQT A;  1SNO A;  1EWH A;  3C2P A;  1MSH A;  3K5L A;  3NBH A;  2K03 A;  4J8Q A;  1Z6H A;  2IWH A;  2JYO A;  2D62 A;  1YNN D;  1JB3 A;  4XXE A;  3PMF A;  4RGM A;  2X6G A;  3URY A;  5EPK A;  1KDB A;  3NHH A;  3GQB A;  2CHB D;  1EU3 A;  3S14 B;  4KI0 A;  3Q0A A;  5IT9 E;  2I07 B;  4WJW A;  3GO5 A;  2L11 A;  4H44 C;  4KN7 C;  4IUV A;  4A3G B;  4C3H B;  1D2B A;  4DXG A;  5BN5 A;  3FVQ A;  4DXF A;  2BCO A;  1RTO A;  4HN7 A;  5IOC A;  2K01 A;  4CJ1 B;  2EOT A;  2XIW A;  2NTT A;  4C1N K;  1S4Z A;  3I70 A;  3A54 A;  3WOF A;  2JA8 B;  4RGN A;  2IL8 A;  5D14 A;  2YYZ A;  4X3U A;  1HTL D;  2F0M A;  1SMY C;  2A68 D;  1D1K A;  3NE5 B;  2NVY B;  1JWS D;  2R92 B;  4CHT B;  4N9P A;  1WTO A;  3MC0 B;  4A3I B;  2BA0 A;  2TSS A;  3M7G A;  2GA4 B;  4HMI A;  1JOK A;  4L6T B;  2KEC A;  4A3J B;  2CW0 C;  1JCK B;  4RGO S;  5JVG 3;  5M5W B;  2TMP A;  3OWF A;  4DK1 A;  1QB5 D;  3CRL C;  3A7A B;  1U4R A;  2Q8T A;  2SOB A;  3AMU A;  5BN3 A;  4KHZ A;  4P2C B;  1HA6 A;  1LTT D;  5AFW A;  5IGB A;  1I4H A;  3IFT A;  1SYD A;  4ABN A;  2IX1 A;  4FYD A;  1PDQ A;  2NYZ D;  5JEA H;  1ZYR C;  2I46 A;  5I2Y A;  5IGC A;  1S5E D;  2NWG A;  1I4X A;  5KNB A;  3T53 B;  1OXU A;  1Q1B A;  4IUR A;  1F9S A;  1MSG A;  4C3H G;  5F2D A;  4IZ8 A;  5KGU A;  3K58 A;  1XX8 A;  2AQ2 B;  4KD4 A;  2R61 A;  4K14 A;  1F77 A;  3TN2 A;  5CBE E;  2G9D A;  1JWU D;  3LWE A;  2AQ1 B;  2AWO A;  5FOB B;  1DOM A;  3S15 B;  2A6E C;  3D3R A;  2JXM B;  4ID6 A;  1G6Z A;  4L8J A;  1W6J A;  1FNW A;  4FO2 A;  2R3Z A;  1D6E C;  3T16 A;  1STA A;  4TQU S;  3J80 E;  2WB1 B;  5EKI A;  3D4D A;  1TWC B;  3KUP A;  1B1Z A;  1AP0 A;  4XDX A;  1AZQ A;  1AFP A;  5EJW A;  1TY0 A;  3NXW A;  2DY8 A;  5CV5 A;  3J7Y W;  3HOW B;  5CMD A;  2M9V A;  4KJN A;  3VR6 A;  1WD1 A;  3HZX A;  2MPM A;  3EQL C;  1EYD A;  3TZD A;  1RJT A;  3SK6 A;  4ZRZ A;  4FXG C;  3EFX D;  1SJE D;  3E6Z X;  1TR5 A;  4RKL A;  5C0X G;  3T13 A;  3TZU A;  3DEO A;  4HCE A;  1T5X D;  5EBD A;  3K7A B;  4IUU A;  5C0X I;  4IFD J;  1LV9 A;  5E4X A;  3KLS X;  3I91 A;  2F0W A;  3HG9 A;  3MVV A;  3J81 L;  3I4N B;  3GV6 A;  2IJ0 A;  4LK1 C;  1KAA A;  1Q12 A;  3PUV A;  3A56 A;  5G3L D;  1EIH A;  2EJM A;  1HCZ A;  4R9W A;  3Q22 A;  2K5D A;  1KNE A;  1VF7 A;  4IUN A;  1UNS A;  2L55 A;  4RHR A;  5J22 A;  4J1M A;  2EE1 A;  3M4Y A;  1SYF A;  2V4D A;  2B2Y C;  1PMR A;  1QIL A;  5C5L A;  1PLF A;  2HDL A;  3HS0 C;  3PIO 3;  3A8J E;  3VA7 A;  2B2T A;  5NUC A;  4F88 A;  1IYU A;  1SAP A;  4IUP A;  1KLG D;  4EGV A;  1SYE A;  4AYB B;  1NUC A;  1WTR A;  5KYI A;  1CHP D;  5KIX A;  2JEA I;  1GUN A;  1BUV T;  5EBC A;  4WRD A;  2CQA A;  4Q5V A;  4NDX A;  1IYV A;  2E2D C;  5K5P A;  1V1P A;  1F2Z A;  3TP5 A;  3GTO B;  1YNN C;  1O80 A;  2KHS A;  2F0Q A;  5M3F B;  1MD2 D;  4KV6 A;  2O5I C;  2NBF A;  2EPB A;  1SNP A;  2WII B;  4K5X A;  5ELE A;  3FEW X;  1LTB D;  5JJZ A;  1OXT A;  3P20 A;  3MWY W;  4IN3 A;  2PYK A;  4BA2 I;  2PCF B;  2AUK A;  4QIW B;  2KCC A;  3NPP A;  2RSO A;  4OIK A;  1ICW A;  4MHE A;  1LAB A;  2F0V A;  3HOV B;  1VMC A;  1E2V A;  2L4N A;  1EY9 A;  2E74 C;  3MXG A;  3BDO A;  2M2L A;  2Y0S B;  3UI2 A;  2NZ1 D;  5C5M A;  2L9H A;  2RDF A;  3MA2 B;  4QCL A;  4XTC S;  1FNV A;  1TS4 A;  2K1B A;  1PFB A;  3D6W A;  4BBS B;  1LTG D;  1PRT D;  3OMG A;  4KN4 C;  1ROD A;  5JEA G;  3L9A X;  5A35 A;  3A55 A;  4QUC A;  2O4X A;  1BOS A;  1EEI D;  3MEH A;  1GUW A;  1HPC A;  3NBI A;  2XRQ D;  2RA4 A;  3X3M A;  3PO3 B;  4DAY A;  1I50 B;  5LHY 1;  1W6K A;  1PRT B;  1CFM A;  3CKI B;  3VYR A;  1FNU A;  4A93 B;  4A3E B;  4FXD A;  1GOZ A;  3KF8 A;  3QG1 A;  3V05 A;  1Y1V B;  1S5D D;  4I65 A;  4GZY C;  4DU9 A;  1SE3 A;  3PV0 A;  4C3I G;  1FD7 D;  4G4K A;  4N9T A;  2D2C C;  2KEE A;  5FO9 B;  4IFD H;  2FIN B;  1E2W A;  1PXU A;  1S5C D;  5G3L F;  1L0Y B;  3D8G A;  2FJ2 A;  1BO0 A;  4PNY A;  1WD0 A;  1EEF D;  5FLX E;  4EQN A;  5J1Z A;  3ZYY X;  2VUM B;  2B39 A;  3KBX A;  5FO8 B;  2RQX A;  1ILQ A;  2B8F A;  3DM1 A;  4K8J A;  3S1Q B;  5DM6 3;  5COY A;  3WOE A;  1BXT A;  4RA8 A;  1HA5 A;  1MI2 A;  2XN9 C;  2WKD A;  4CKB A;  3FPP A;  3MHB A;  1LT4 D;  3H09 A;  3K0Y A;  3TP8 A;  3K59 A;  1QG7 A;  1X32 A;  1EY8 A;  3VYU A;  5CGK A;  3D4W A;  3GTK B;  1F2Y A;  2NVX B;  1G29 1;  3P1H A;  4EQP A;  3R93 A;  4HMJ A;  2J0T D;  4K5W A;  1ENF A;  3T4A C;  4LAA A;  5HGT A;  5D3D A;  3FDT A;  3GV3 A;  3NTH A;  3HOY B;  3DMU A;  3J7A F;  2B2T C;  2QF7 A;  3S9W A;  1HRJ A;  2FMM A;  3BYT B;  2EYO A;  5ELD A;  2MUY A;  4ZKB B;  3D6C A;  3Q23 A;  1RD9 D;  1BDO A;  2EJF C;  1LT3 D;  3E0J A;  4K6D A;  4DF7 A;  4V19 0;  3GP7 A;  3E5S A;  4HCS A;  5CV6 A;  3W2D A;  4IUQ A;  5ELC A;  2B2Y A;  1I3Q B;  1TWG B;  2X69 A;  4MN3 A;  4NKL A;  2FMC A;  1TT2 A;  4HED A;  4H7B A;  1SXT A;  2L0C A;  1AZP A;  2F0G A;  2OXP A;  2WKC A;  3OOC A;  4RAU C;  2SNS A;  4H0L C;  2OT2 A;  4ZLT F;  2RDG A;  1EZ6 A;  4HSV A;  4DK0 A;  2K28 A;  2C5C A;  3I90 A;  3M7N A;  1BCP B;  5FKA C;  3MXU A;  4KD3 A;  1WTW A;  2FHT A;  4RWS C;  1V1O A;  3CQZ B;  4K2K A;  2EYH A;  1JOR A;  3Q24 A;  2A69 D;  3RZO B;  2A73 B;  2BDN A;  3J80 L;  3SE0 A;  3M4O B;  3NSW A;  1TS5 A;  1GXD C;  2R6G A;  1MBY A;  4ME5 A;  4FXK C;  4BS9 A;  2EYL A;  4Z9C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...