4QB4A

Crystal structure of staphylococcal nuclease mutant v23l/l25v/v66l
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTLKVMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMLENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal Structure of Staphylococcal Nuclease mutant V23L/L25V/V66L
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2014-05-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4qb4A00
5HGTA 5JAVA 4N9PA 3P1HA 4J1MA 3SK4A 1U9RA 3C1EA 4ZQ3A 5C3XA 3NUCA 3SHLA 5IGBA 3U9OA 4KTAA 4K5XA 4F8MA 2PZWA 5C4HA 1STHA 3D4DA 4KD3A 5M9OA 5JOBA 1A2TA 3NHHA 3HEJA 3EROA 5HURA 3NP8A 2ENBA 1EYAA 2EY1A 4WRDA 2F0MA 2M00A 2PZUA 4KY6A 5CV5A 4ME5A 5F2DA 4B9XA 5K5PA 3DHQA 3OMGA 4HMIA 4HTHA 3SR1A 2F0SA 4TRDA 5IODA 4KY7A 2F0JA 5KRUA 4KHVA 1EY7A 2LKVA 4NMZA 4K2KA 3TP6A 5I6WA 4IZ8A 2RBMA 4WORA 4RKLA 5CV7A 1JORA 1SNQA 1EZ8A 5I9PA 5KIXA 1A3UA 5EKLA 1TQOA 4K5VA 1KDCA 1KABA 4G57A 4B9WA 2F0DA 4ODGA 2OF1A 1EY9A 4PNYA 4YIJA 3T16A 3SK6A 4EVOA 5KGUA 4R8NA 1SYGA 1ENAA 3TP8A 2F0NA 5KYLA 1TR5A 2SNMA 2WACA 1KAAA 5E1FA 1A3VA 2PW5A 3T13A 3VA5A 3ITPA 5CV4A 4EQNA 1STYA 5CC4A 4ID6A 2F0QA 1SNMA 3D8GA 4ZUIA 4NP5A 4HMJA 5EGTA 1F2MA 3TP5A 3OMCA 2F0IA 1EY5A 2EYOA 3RUZA 4EQPA 2F0EA 5E3FA 2SNSA 5J22A 1RKNA 1KDBA 4DU9A 2KQ3A 4PMCA 5EKKA 1EY6A 4NKLA 5I6YA 2QDBA 4K8IA 4F7XA 3DMUA 3BDCA 1EQVA 3ERQA 5KEEA 4KY5A 1SYCA 3NQTA 5IOCA 5CV6A 3QOLA 3MZ5A 4K14A 4KV6A 2F0UA 1IHZA 4IALA 3QB3A 3TP7A 1EY4A 1JOKA 1ENCA 3OWFA 4K5WA 3P75A 4QF4A 4KJNA 1JOOA 2F0KA 3H6MA 5IGFA 3QOJA 3V2TA 5DEHA 1SNDA 1NUCA 3C1FA 5C5LA 3SK8A 3D6CA 5IGEA 1SYDA 2EYJA 2NUCA 5CV8A 2RKSA 1KDAA 1SYFA 1F2ZA 2O4XA 3MHBA 3NK9A 1EZ6A 3NXWA 4K6DA 4QB4A 2F0GA 3SK5A 1JOQA 5CR3A 4N9TA 3D4WA 4IUNA 4RKBA 2F0TA 3LX0A 3MEHA 5CV9A 1AEXA 2F0VA 2HQEA 2PW7A 4ZUJA 4EQOA 4DF7A 2PYKA 3S9WA 1SNCA 5IGDA 1SNPA 2OEOA 2EYMA 3E5SA 5KYIA 1A2UA 2EY5A 1NSNS 1F2YA 2EYLA 4I65A 2F0PA 3EVQA 5NUCA 1SYBA 2PZTA 4NDXA 4DGZA 2F0LA 1SNOA 2EY6A 4K8JA 4E6IA 3EJIA 5ISRA 5J39A 4OL7A 2RDFA 5C3WA 5CGKA 4PMBA 5IGGA 1TT2A 2EXZA 3HZXA 5I9OA 2EYFA 1A3TA 1EYCA 2F0FA 3BDLA 2F0HA 3MVVA 3PMFA 1STAA 2SOBA 3OSOA 4K2LA 4KD4A 2OXPA 4LAAA 3TMEA 5C4ZA 5IGCA 1II3A 2F3WA 1EYDA 5C6AA 1EY8A 1EY0A 3SXHA 5IIFA 1SYEA 2F0WA 2F0OA 1STBA 1STGA 2KHSA 2PQEA 4H7BA 4QMGA 2EYPA 5C5MA 2F3VA 2EYHA 4KJOA 4DFAA 4J6HA 4MIUA 1STNA 3MXPA 5J1ZA 3R3OA 2EY2A 5DAUA 4S3SA
chains in the Genus database with same CATH superfamily
5HGTA 4JI5L 2WB1G 3CCSA 5CMDA 2ZT9C 3GTGH 1XNQQ 3WOEA 3NHHA 2CW0C 5HURA 4AIMA 4FF4A 4ALPA 3CCLA 2M00A 4KKTA 2KENA 2LMCB 4A93H 4Y52H 3IRBA 2DNEA 1HNZQ 4LFCL 3HKSA 4IZ8A 1Q7YC 2R93H 4R4OA 1S5ED 1EZ8A 1A3UA 3S1QH 2UUCQ 2Q2HA 4V0BA 4OWXB 2GVAA 3D4RA 4L5RC 1B3AA 3A8JE 5E4XA 5KGUA 1SYGA 4LF5Q 1U4LA 5C44B 1G291 1B9NA 2WFWA 1QVCA 4H02A 4DV1Q 1XPUA 4A3JG 4OWTB 1N34L 2XWJB 1UUPA 3VYSA 4FF2A 2HD3A 4GS3A 2Z6KC 4JBKA 1V1PB 1Q8IA 2PCFB 1XX8A 4ZCKA 5IOCA 3MZ5A 2MNAA 2HIXA 4KJNA 2F0KA 1I6VC 1PMRA 3J80c 1I4XA 5IGEA 5IYDG 1SMYD 3KLRA 3NQIA 4GLVB 1EWCA 4KHPQ 1U4MA 1HNWL 4FXDA 4X3UA 3QG1A 2QCPX 3DLLA 2P5ZX 1H9KA 1U5KA 5IYBH 2PYKA 1SMXA 2NVXB 5M5YB 1TWHB 3VR5A 1PZKD 2EYMA 4ABNA 2CH4W 1G2TA 1I50H 2UUAL 4L8JA 4NDXA 4JI2Q 4B3RQ 2EY6A 3FRPB 4PMBA 1TWAB 4H13C 1EIHA 4EGVA 2M9VA 5FLXc 1NNXA 1JICA 3BVGA 1W2BA 2YTYA 3AQQA 4GN3B 4NB3A 1SE3A 3W3AA 2EYPA 4JI0L 4KJOA 2EYHA 5M3MG 3G6EA 1TWFB 5J1ZA 1X3EA 1XMQL 3BYTB 2K5WA 3RMHA 1TWGB 2AQ3B 3T51B 4J8QA 3I91A 3QO2A 2PZWA 2R92H 4IPGA 3PIO3 1O7ZA 1WCMB 3S15H 3EROA 3RLNA 3NP8A 1EYAA 2F0MA 3CPFA 2EIFA 3HOWG 1B44D 3K5OA 1EQTA 2R3ZA 4GZYC 2ZTEA 4JYAL 1WVLA 1I4RA 4A3FB 4C3HG 5KRUA 2ZTCA 4A3IH 5GAGC 3NBHA 5IP9H 3TZUA 1JMCA 5C0XG 5C4XB 2JA6G 2R7FA 3OTOQ 1RCVD 3I4NG 2F52A 2OF1A 3FKIG 4JPBW 4ZRZA 4IJHA 3CCMA 1DM0B 1XJVA 2OWOA 3EQLC 1SROA 3HOUG 3M4PA 1CKNB 2PO4A 3CRLC 2UXDQ 3K0XA 3UDIA 2K01A 5E3FA 1LTSD 4QUCA 1EWHA 1Q1BA 1TXYA 3TREA 1FGUA 4IALA 3H3VH 1YITA 1ASYA 3CD6A 3BJUA 1LYLA 2D2CC 1LTGD 2B2VA 3FMCA 3QOJA 5DEHA 2WAQG 1SYDA 4FVMA 4DR6L 5D14A 2KBNA 5A35A 3FP9A 5D3DA 5GQOA 4JI7Q 1C4QA 2C5CA 1NJIC 2HHHQ 2O4XA 4IPHA 4RG1A 4POGA 1FJGQ 4RMFA 1Z47A 2B2TA 2IPKD 3IKJA 2K5HA 3E6ZX 2VUMH 2F0VA 4DR2Q 1Q90A 3S9WA 5IWAQ 2Y0SG 1BUVT 2QF7A 3I72A 1QCBD 2RHSB 5KYIA 1IBML 1E1OA 1NSNS 2DGYA 2JXMB 2XN9C 3TN2A 2F0PA 1R4QB 4GLXA 2UUBQ 2F1MA 1X56A 3CCQA 1N33L 4X65L 1ICWA 2F0FA 1QVFA 1D7QA 2JE6I 2NZ1D 4DR1L 2F3WA 1EYDA 2MO0A 2XTIA 5LL6X 4KKUA 3DWAA 4BY1H 3DEOA 1HNXQ 1S72A 2B39A 3GTMH 3SDZA 3U58A 1J5EL 4V190 1K8OA 1EU4A 2I07B 4DR5L 4WJ4A 3D4DA 4LFAL 4DPGA 4ILWA 4OO1I 4UP7A 2EY1A 1D5XC 3OIQA 5JJIA 4JI8L 2MUYA 2PI2A 5D3IB 1FVIA 1J6QA 1MHWC 3VR6A 4K5VA 2F0DA 3BVMA 1Q82C 4PNYA 3TBIB 4IOAA 5E1FA 1Y1WH 3ITPA 1SFOB 3S16B 2CHBD 4LF8Q 4P72A 4A3LG 1QVGA 2Z0SA 1EIGA 3GTJH 2M2LA 3KJPA 2C9OA 1VQDA 4CKEA 2KEDA 2ID0A 5EKKA 1EY6A 4R8IA 3L9AX 3ZJYC 4LF6L 1EQVA 4WJWA 4AYBG 3QOLA 4QIWB 3BZDB 1WJJA 2GVBA 3OPOA 4HCEA 2H4OA 1SNDA 3D6CA 3U50C 2NN6H 1EEID 1LTRD 3HFZB 2RKSA 1PDQA 1JC7A 1E24A 5FLMH 4LUVA 3CQZB 1EFID 2KCTA 3MFYA 3SVMA 3ER0A 1VF7A 3P20A 5FO7B 5LMNQ 4JI3L 1J9OA 5BR8Q 2K1BA 4TKOB 1I3QB 1CZWA 3GTKH 1F2YA 4XIGS 1PHJA 4OX9Q 5GAEC 1UE6A 1BKBA 2SEBD 4DV3Q 4YY3Q 4RA8A 5C0XH 4DV7L 1C48A 4C3IH 2LSSA 4PG3A 1G51A 2F4IA 3SXHA 2FINB 5KNDA 1ZYRD 2J4XA 1QUQB 3NPPA 3QJYA 1PTOC 4MIUA 3HOUH 1PFNA 1STNA 1WOCA 3PO3H 2B2VC 3TQYA 4I7ZC 3CCVA 1GHJA 4DNRB 1R9TB 2KA7A 2XWBB 4QGUA 3U9OA 2FFKB 3G7LA 3PQIA 4HJ8A 1FYCA 3F2UA 4KHZA 3CCRA 1GUOA 1K83B 2EE1A 1BO0A 3OIPA 2G9DA 2E74C 5I6WA 1E22A 4CHTB 1PRTD 4XYQA 4X64Q 3K5NA 1S4ZA 3S1MB 3Q8DA 2B63H 1VQMA 2RF4A 4CKBA 3SK6A 5C44G 3CKIB 2F0NA 4RAUC 1P16A 4A3MB 4BY7B 2DN8A 5EGTA 3I4OA 1CI3M 4FO2A 2F0IA 1BOSA 3TDQA 3HOZH 1RKNA 1RHPA 3PUYA 4K8IA 2EXDA 2XVSA 4F7XA 1WD1A 1PFMA 3MEFA 3X3MA 5LMUL 4IOCA 1IW7D 2IJ0A 2LXKA 2WIIB 2F0UA 1EY4A 2L4NA 3NTKA 2K6AA 2IL8A 2RCFA 5DLQE 2QEXA 4X66Q 1L0YB 5C3EG 2K04A 1KXLA 1YI2A 1E3PA 2JEAI 4O0AA 1C7YA 3CXCA 2UXBQ 3NXWA 4K6DA 3BDOA 1G2SA 5I4DA 2E5LL 3J7AF 1VQJA 1AH9A 4IUVA 1BBUA 4H44C 3P7JA 4RFBA 1AEXA 2R7ZB 3KF6A 1PXUA 4DUZQ 1OO9B 4MNOA 1A2UA 2X6LA 5EJWA 3ULPA 4A3KB 2ZM6Q 2E2DC 4IUQA 1Y69U 4B3TL 2AQ1B 3KF8A 1M1KC 3TMEA 5LMNW 2L0CA 2K52A 2PNHA 3DUZA 1EIYB 2NBFA 3I7FA 3J81E 4GNXB 3PUWA 3UDXA 1EU3A 3R3OA 2AWOA 1EFWA 1WCMG 2CFMA 4B3ML 1AZQA 1SN8A 1SBBB 2OCEA 3S17H 4B3SQ 5M3FH 5JEAG 4C2MB 4XQNA 2N88A 4L6TB 2CVRA 3CW2C 4A3FG 4IUTA 2F0SA 5IODA 4KY7A 2F4VQ 5C4XG 2PI2E 1HUNA 1EY7A 2FMMA 2RBMA 3J7AV 1PZJD 2A68C 3RNUA 1EY9A 4YIJA 1BDOA 1K0SA 3B6YA 2WACA 1KAAA 2HCCA 1GD7A 4EQNA 2JA5B 3RZDH 3HOVB 3I8ZA 4JI4Q 4DV5L 2ALYB 5FJ8G 2VQEL 2YYZA 1U4RA 5IP7H 1WTWA 3TS0A 1DZ1A 3Q0AA 2WKDA 1I94L 1K3RA 1TWCB 3E0JA 1X55A 2NVTH 1QUQA 4GKKQ 4K14A 3M4OH 1RIPA 1HTLD 1SRUA 4MN3A 4LF9L 2K5DA 5EBCA 3V2TA 3C1FA 4HJAA 1DXMA 1XNQL 4HJ9A 3I4MB 3DEPA 1JOQA 1N8RC 1G8ZD 1H9JA 1ONLA 3EA6A 4NXML 1ESFA 2VZAA 4O2DA 3U4VA 3OOCA 3JAMc 2K28A 3FEWX 1K8GA 2MHVA 3IAYA 5EKIA 2K03A 1IBKQ 4MHEA 1SYBA 4UP9A 1HR0W 5IYCH 5CBAE 3RN5A 4DV0L 1JB7A 1N32L 3J81j 3SE0A 3M3YH 1A8VA 1A3TA 1B9MA 3BDLA 4K2LA 1DD2A 1VCIA 5LL6S 1LABA 1PRTF 3E9HA 4DR4Q 4JI6Q 5AJ3L 1GUSA 1XMOL 2F0OA 1VQ7A 2EDGA 4LF4L 1MI2A 4IPDA 4J6HA 1N9WA 4UPAA 1IL2A 3FDTA 2I5LX 1B4OA 1L1OB 4TSSA 3SK4A 4JCVE 4BBRH 2JA8B 1SR3A 1Y1VB 5C3XA 3K7AB 5EPLA 1BF4A 2YU9B 1STHA 2YTVA 1CT1D 3HEJA 4GN5A 3JAME 3I4LA 3F8TA 4RGOS 2RCNA 3OMGA 4HTHA 4Q0FA 2E2JB 1X3FA 4GOPB 2R7DA 1D5ZC 1RTOA 2BA0A 4N8X1 4NXNQ 4DK1A 1HZAA 3CC4A 5C3EH 1PH3A 2MQHA 4RKLA 1EOVA 2KOLA 3G4SA 1Y8PB 5JPNC 4X62Q 3K58A 3M9BA 4A3DB 2L12A 1T9HA 4DA2A 1A15A 3H94A 3VA5A 4DK0A 2DNCA 2ATWA 1B1ZA 4ZUIA 3H15A 1SLJA 4L63B 3I55A 2EYOA 4EQPA 1ASZA 4BBSG 2N3SA 3A56A 2A6EC 2QDBA 4JBMA 2JYOA 2F3IA 3BDCA 4OONA 2XIWA 1VQOA 4GNXA 4P73A 4FNFA 1KTKA 3CP0A 3TP7A 4IFDG 2R6GA 1JE5A 2UXCL 1S5CD 1V1OA 3UI2A 1KLUD 4KKSA 5IT9c 2L5TA 3M4YA 3W5OA 2NYZD 5HGQA 2K33A 3MHBA 3KBXA 2F0GA 1WFQA 3PUXA 2VW9A 4A3GB 4ZKBB 4RH6A 4RKBA 3MEHA 3U9SA 5CV9A 3T1YQ 3FPPA 3NENA 2LS01 3T1HL 4DF7A 4TQUS 1E2WA 1ICFB 3K57A 4UHVA 2AUJD 3R93A 3GV6A 1Q1EA 1HA5A 3H3VI 1AFPA 1LUZA 1QJOA 3D6WA 2RDFA 3JC66 1Q8KA 1HZBA 4CJ1B 2A19A 2EYFA 1VQHA 1EYCA 3MVVA 5EQ0A 4EX5A 5K36G 2B8GA 4C3JH 2EJMA 2WB1E 3I2ZA 2CWPA 5C6AA 2UXDL 1YHQA 3H0GB 2Z4IA 4LF7Q 4YWMA 3K8AA 3RLFA 4LFBL 1JE4A 1VF5C 4R1JA 4LMQD 2PPBC 1Y8OB 3R8BA 1CSQA 3J81L 3HGBA 5IT9E 4AQYL 1ENFA 1M90C 5KNBA 4DV2L 2LFNA 4OHJA 1VQFA 3EN2A 4KN7C 1CM9A 2K32A 2K5QA 4M8AA 4IUUA 2FXQA 2K5NA 2VQFL 1GHKA 3N52A 2JK8A 5M5XH 5C0XJ 2BOSA 1ZXTA 1O80A 1F9QA 2RVLA 3GTGB 1UE1A 3ULLA 2A74C 1SNQA 2B2UA 4JI5Q 5EKLA 3J80E 1KABA 4A93B 4F88A 2OQ0A 5KYLA 4Q5VA 1YBYA 3F2CA 5COYA 1DCZA 2HIVA 4BY7G 2J0TD 1BBWA 1E0BA 4RGTA 2R93B 5M5WH 3OMCA 4RGMA 4LFCQ 1UAPA 3S1QB 2VS1A 4XT3B 1KL9A 4RHSA 2BCOA 3A7AB 1LTAD 2G9HD 3ERQA 3MWYW 4FXKC 2E2HH 3MA2B 1CFMA 1YNNC 1EEFD 1ENCA 1X6OA 3UDGA 3HKZB 1L1OA 1WYDA 3WOFA 2UU9L 5FLXE 2JQOA 3S1NH 4FXGC 3HOYH 4HIDA 1N34Q 1F2ZA 4HEDA 1VQ9A 1EQQA 3I90A 3O13A 2SDFA 4GOPA 3GP7A 2R7ZG 2KECA 1G6ZA 2NWGA 2MPMA 4XYOA 3FHWA 2VXWA 2E2IH 1NCVA 4A3KG 4K0KQ 3E5SA 1C9OA 3HOXH 1K9MC 1NAPA 1F9PA 4HIMA 4G7ZC 1KQSA 3J7A5 3EJIA 2NVYH 2BA1A 2IW3A 5J39A 1QWYA 1EUJA 1TT2A 3HZXA 4MTKA 4LF8L 4A75A 1AE2A 2NN6I 3I56A 2SOBA 1HNWQ 2OXPA 2MFIA 2MO1A 1Z7TA 1I50B 4OO1G 2XNAC 1EOTA 4DV6L 2RSOA 4GNXC 5C5MA 4B08A 1OXTA 2QILA 3L3OC 1G91A 4C1NI 1LV9A 1I4GA 4X3KA 2UUAQ 5JJZA 1OXVA 4BBSH 4RWSC 4DUYL 1CA6A 4CGYB 5IGBA 2H1EA 4HSPA 1S5FD 1I6HH 4K5XA 2I5HA 3A74A 5M9OA 1CTMA 1PRTB 5G3LD 3WDNA 2EQSA 1PH9A 1H9SB 2B8FA 3DWPA 4IFDH 4HMIA 5CBEE 1VQEA 1JWSD 4LK1C 4JI0Q 1HXYD 3PV0A 1JCKB 3NSWA 1EIFA 2QEJC 2LKVA 2R92B 1CQVA 1K0RA 2A6HC 4DNTB 1HPCA 3S15B 1V1PA 3CQZH 1KDCA 1C8CA 4A3JH 3MXUA 3KDFB 3ND8A 4YCUA 4CJ2C 1TS5A 2JA5G 2RA4A 4KK7A 3HOVG 1VQIA 4OX9L 3PO2B 1PFSA 4ID6A 4A3IB 1YJ9A 1K8AC 4NP5A 4DR3L 3DWQA 3VYTA 3MXNB 4JYAQ 2V1CC 2WAQE 5GADC 3J81i 1BQQT 3F2BA 2A5HA 1L0XB 2WV6D 2YV5A 5IYDH 4KV6A 4JG2A 1NBWA 1BVSA 2HCIA 2WKCA 2JA9A 2DUDA 3P75A 2A1AA 4ZAIA 1N36L 3QR8A 2F03A 1OTCA 4OWWB 2Y0SE 3NBIA 1YEZA 5CV8A 2KHIA 3AU7A 3SK5A 2Z6BA 3K80C 3A55A 3TRZA 2K4KA 3T56B 3LX0A 1W6KA 2B2UC 4HJ7A 3CC2A 2Q2IA 1DYQA 1XNRL 3NELA 5GROA 2L1BA 3STBC 1Q46A 2OEOA 3Q22A 1B50A 2WINB 2K75A 3KYHC 2PZTA 3W1GA 2ICIA 2NTTA 4P74A 4DR6Q 3NTHA 3HS0C 2VUMB 2VY3A 2B2YA 2KVMA 1KRTA 1SE4A 5M3MH 4YHHL 1EY0A 1U0LA 4KI0A 3K59A 4CDDC 2Q2TA 4BWGB 1JWUD 4HSVA 4DFAA 4HIOA 3GO5A 2EOTA 3EIVA 3G71A 1IBMQ 2JA8G 1L1OC 1Y1VG 3OYYA 1EQRA 4GKJL 4J1MA 2JP1A 1U9RA 3HOWH 3GTPH 3NUCA 2OTLA 2I46A 3K0YA 3V05A 1N33Q 4PMWA 3WWVA 4X65Q 1VDZA 5ELOA 4C3HH 5JVH3 4JV5L 2L55A 4DV4Q 4BY1B 3ND9A 2PZUA 1YNJD 4KY6A 2UXBL 3LGJA 1TKWB 4ME5A 4JI1L 1HR0L 1CKNA 2JA6H 3I4NH 3FKIH 2BDNA 3ZYYX 1T5EA 3MC0B 2KCNA 5CV7A 5I9PA 1J5EQ 4A3DG 4DR5Q 3GTOH 4LFAQ 3FVQA 4AYBE 1S5DD 5CV4A 4CKCA 1QILA 3NWTA 2DY8A 4KMUC 2JN4A 1MIUA 1FGBD 5T1IA 4IQZA 2B2TC 4JI8Q 3TZDA 1A6XA 3PCOB 1VQBA 1KLGD 1PYWD 1GOZA 4JK1C 2ASBA 4HR7B 1Y1WB 1X3PA 1VS0A 1VMCA 4JOIA 5CV6A 3KBGA 3VA7A 1JJGA 2IWHA 4JVZA 3PIPA 1V8QA 4Y7NH 2TSSA 3GTJB 1JJCB 1NMFA 4UDUC 2I5MX 5DNFA 3S2HH 3BU2A 3SK8A 2X69A 3BG3A 2EYJA 2N55A 2NUCA 2PMZE 3AFPA 4OIKA 1E1TA 3URYA 1ESRA 1XWEA 4B3SL 4A3GG 3KJOA 2HT1A 5FLXL 1H9SA 2N78A 2AKWB 3GTQH 4LF6Q 2PW7A 1GUWA 1VQLA 3K5MA 1I4QA 5G3LF 4M1UB 1HCZA 1A62A 1PH5A 3S14H 1ZKOA 2EY5A 2IX1A 3EVQA 4K6LA 2K5VA 2FHTA 3KDFA 2E76C 2AMCB 1F2LA 1BCPD 5ELBA 3C3LA 2F0HA 3PMFA 1CSPA 3H0GG 1CQFA 1YIJA 3RZOH 2JA7B 3GTKB 1EY8A 4R9WA 3S2DH 3MXNA 4A3BB 1STBA 1JT8A 4JI3Q 1FNUA 2NVQH 1HUMA 4DAYB 3MXPA 3CRKC 3BYYB 4X6AH 1O7IA 4C3IB 3CHBD 4N9PA 4LW1A 2IX0A 1UE7A 2BH8A 5T1GA 4R4TA 2KUMA 5JEAJ 4DV7Q 2A69C 1Q3LA 4DR7L 3W1BA 3HOUB 1WTQA 4RCOA 5F2DA 3PO3B 3PIOA 1BBXC 3V96A 1E7ZA 4TRDA 4APVA 5C4JH 1H95A 4KHVA 4P2CB 1UWVA 1HH2P 3HP3A 1TIID 2CW0D 4A3LH 1XTDA 4DNIA 4ODGA 4A76A 2B2YC 1TR5A 2R93G 4P75A 2K05A 1A3VA 3T13A 2A6ED 4CDFC 1HRJA 2J7ZA 4Z9CB 4WJ3M 1JB3A 4R4IA 3TP5A 2B63B 3RUZA 4XQQA 4DU9A 2RSNA 4PZ6A 2ZXOA 1HZCA 2A8VA 3H09A 4ME3A 3HKZG 1GVPA 3N6RA 2Q8RE 5EAYA 3HOZB 1GUNA 4CBVA 1I5FA 2DJGC 4OELB 1TS2A 1HJPA 1VQ4A 3HRZC 4DAVA 3SEBA 1QOHA 3NK9A 5DM73 1G6PA 3CMEA 1L0WA 1KHIA 2KCCA 4N9TA 3GTLB 4G7HC 2ZJPA 4YWKA 3S1RH 3TEHB 1RDPD 5EBDA 1RL2A 4WFN3 5FOBB 5IGDA 1JQYD 3BZKA 1IBLQ 1HZ9A 1X3GA 1C0AA 2HQLA 4PZ7A 1FR3A 4OL7A 5C3WA 3OHXC 5I9OA 1PTOH 2E5LQ 4TVAB 3OSOA 5D65A 3KLSX 3MXGA 3R2TA 5GAHC 4UY8C 1LLRD 4KLKA 1PH4A 4JOIC 1HNZL 5BN4A 3R2IA 2L9HA 1QE6A 3SGIA 3VDYA 1FD7D 1B7YB 3LNNA 4CJ0B 5L37A 3M7GA 2C35B 3P1HA 1NR4A 2UUCL 1YJNA 2O5IC 1PRTC 4B3TQ 1MSGA 3PUZA 1KNAA 1QG7A 1TS4A 1YVCA 5BN3A 4LF5L 4WRDA 4FYDA 3MTSA 2A73B 4DV1L 3AYHB 4BXXG 1PFBA 3KK7A 4OEMB 5C44H 3OW7A 3S17B 1EYGA 1FNWA 3IL8A 4DAMA 4H0LC 5M3FB 4LUOA 5J3BA 3ONAB 4B3MQ 4QY7A 3C46A 3PO2G 4R8NA 2DY7A 1ENAA 4N8FA 4A3IG 2H5XA 4YCWA 3PUVA 3OWEB 1VQ5A 5CC4A 1TVXA 2F0QA 1RODA 2D62A 1S3OA 5ELCA 3KLSA 5ELDA 5J22A 1YNND 4KHPL 1BR9A 2JJQA 3I70A 2CCZA 5I6YA 4F87A 4LF7L 4IFDJ 4PV1C 1WTXA 3I3CA 3RZDB 4JW0A 1JOKA 1BCPF 4DAYA 5DM63 2IT1A 4JBJA 4KN4C 3PSIA 1IKMA 1NUCA 5C5LA 4B3RL 4JI2L 1VQAA 4DV5Q 4CDEC 2NVXH 3A0JA 5M5YH 2NVTB 1TWHH 4J15A 2VQEQ 1RJTA 3M4OB 4LUZA 1I94Q 2OT2A 1ET6A 4FF3A 4A3EB 1IYVA 1D1KA 1DOLA 4HCSA 1TWAH 1HTPA 1NY4A 3KFUA 2CKZB 1XPRA 1XXGA 4DN4M 1O78A 4LF9Q 2CH4A 4L5SA 3DM3A 1WTRA 4BA1I 2VUMG 4DGZA 4K8JA 4XT1B 2PNRC 1TWFH 4NXMQ 1KC8C 4UAIA 4RGNA 1II3A 3GQBA 1TWGH 3OW2A 2VL6A 4ZLTF 1RF2D 1SJED 1SYEA 4A4IA 4FP5D 1EL0A 1WCMH 2HUGA 2F3VA 3FPUB 5ELFA 3M3YB 3CCUA 4S3SA 1PH2A 3VR3A 5JAVA 5JEAH 1V1QA 3OTOL 3ERSX 2CWAA 4A3FH 4DV0Q 4KTAA 5C4HA 4F8MA 5ELNA 4BY1G 4QCLA 2RDGA 4HAEA 1N32Q 3IFTA 3UDFA 5C4XH 4ZYSA 1CUKA 3GD7A 2A6HD 2HDLA 5AJ3Q 3A8IE 5K5PA 1XMOQ 3PIP3 1DJRD 1VQCA 2G5DA 4IN3A 4BBRB 4LF4Q 2RHQB 3AB9A 1SSOA 2XGTA 4K0KL 5FJ8H 4PZ8A 1VQ6A 4QIWE 4ULLA 5C3EB 1SE8A 1Q12A 4JI7L 4XQJA 4MZ9A 2HHHL 4MTNA 1Y1WG 2KQ3A 3I73A 4IFDI 1FJGL 1TY2A 1I4PA 3M85A 2IY5B 2BH2A 3VYRA 2ZJQA 3L7ZC 1SYCA 4DR2L 5IWAL 2B2WA 4K5WA 1KRSA 4QF4A 3S24A 4A3MG 2QW7A 1MJCA 4OIJA 2B3GA 2EZVA 2UUBL 1SYFA 1B53A 2N49A 4QB4A 3STBD 4I7AA 3F1ZA 1Y8NB 4R4QA 2F0TA 2NN6G 3C2PA 3U4ZA 4RHRA 1F77A 2Z4HA 2ES2A 1K3BC 5FLMG 2UXCQ 1SNPA 2XRSD 1HNXL 2B29A 2EYLA 1DGSA 1U4PA 1VQ8A 2F0LA 4BXXH 4CDCC 1A63A 4DXFA 5CGKA 1X54A 2JA7G 3F2DA 4NW2A 1UE5A 2ZXRA 4L5QA 1LTID 5IGCA 4A3BG 3BVZA 5IIFA 3PO2H 2KHSA 1STGA 3T1HQ 4H7BA 1ML0D 4C3IG 2K7VA 3CCEA 1Z6HA 5DAUA 2Q8IB 3L0OA 4C3JB 2L15A 5EPKA 1VQGA 2K50A 1GXDC 3KOJA 2EJFC 1NR2A 3LWEA 4KD3A 1DOKA 2BE5C 2MGSA 3PO3G 3A8KE 3MAQA 1PTOD 2PQAB 5TSSA 2DJFC 4LFBQ 1OXUA 2EVBA 2L11A 1ET9A 1VQPA 1SFOH 3S16H 1IYUA 3TP6A 1AZPA 1QB5D 4EQ5A 1X32A 3K6OA 3NWSA 4AQYQ 4G57A 1PYBA 1GM5A 1WD0A 4DV2Q 4QQBX 1PZID 4IUPA 5M5XB 1DONA 2ZXPA 1STYA 3KLWA 2B63G 3D8GA 3G6JB 5HY6A 2AHOB 2VQFQ 4JBWA 3TS2A 2VNUD 3RD4A 3RLOA 2SNSA 2IHEA 4LJZC 5C0XI 3CC7A 1TY0A 3PF4A 1STEA 3QWNA 5LHY1 3JAML 1AE3A 1K28A 4DK3C 3EBEA 3NQTA 3HOZG 1XMQQ 3QB3A 5LMNL 5M5WB 5BR8L 2D0OA 3IFDA 1W6JA 1GUTA 1JOOA 1UEAB 2D0PA 3A54A 5EPJA 2E75C 1MGSA 4DV3L 4DV4L 3RN2A 4XXEA 4YY3L 1I3QH 1M8AA 2JEBI 2E2HB 5AFWA 5CR3A 2MJ8A 4IUNA 1PA6A 1SMYC 1L2FA 4RCNA 1BCPB 4ZUJA 4EQOA 3GDEA 1PLFA 3S1NB 3HOYB 1SNCA 2RDHA 5FK9C 1Q81C 5K36H 1FL0A 4I65A 2UU9Q 5KNCA 3J7YW 1GUGA 1SNOA 4IURA 5ISRA 1MD2D 3E0EA 5IGGA 3GV3A 3I4MG 1GJXA 2E2IB 4KD4A 1CHPD 4C1NK 1R9TH 3HOXB 4FF1A 3KUPA 2F0WA 2PQEA 3KF6B 2NVYB 3L2PA 3M7NA 1YJWA 2B2WC 2Q2UA 2Z1CA 1BXTA 1IZ6A 4PQXA 1QZGA 2A69D 4A3CG 4X64L 4JC0A 4OXPA 1AP0A 1K83H 4ZQ3A 1H9RA 1XPOA 1B2TA 1GO3E 2WB1B 3S1MH 3KF8B 1F9RA 4ZK9B 1HA6A 3CMAA 1MJEA 5CV5A 1UNSA 1WTVA 4DV6Q 2D5DA 1F9SA 4BBSB 3BS1A 5JJKA 3A5UA 1I6HB 2GA4B 4A3MH 5M3FG 4WORA 4BY7H 1WTHA 3M4QA 1XTCD 5CYUA 4DUYQ 1QNUA 1R4PB 1DOMA 4EVOA 3NE5B 1D6EC 1XYIA 2PW5A 1LTLA 4X66L 2Q8TA 5IT9L 1KD1C 1SNMA 2IX3A 4HMJA 4DR1Q 4YWLA 5E7NA 5IE8A 2F0EA 4GOPC 2LY7A 3GTMB 4A3JB 1ILQA 1V43A 2GN5A 3AFQA 2A68D 1JR0D 3DMUA 5KEEA 4KY5A 4QUFA 1KIXA 2JA7H 1I4HA 1SXTA 5IP7G 4DUZL 4A3BH 2HDMA 3VR4A 5A2QE 3H6MA 2VB2X 5IGFA 4DAPA 2ZM6L 1J8IA 3J80L 1Z9FA 4DR3Q 2R7ZH 1LACA 1D2BA 4BA2I 1PVOA 2Z8LA 1JWMD 4P71A 4A3EG 3CU7A 4A3KH 2ZTDA 2PQAA 3T4AC 1YZ6A 4HJ5A 2CQOA 3G48A 1IXRA 4DKAC 1SDFA 4GN4B 4R4CA 2KEEA 4L5TA 5JVG3 2EJGC 2IHFA 1N36Q 1JJ2A 1SE2A 3VR2A 1PTOF 4OO1H 2ZJRA 1QZHA 2OQKA 4QL5A 1IKLA 2EXZA 4X3SA 4U673 3JAMi 1P8LA 2X6GA 5JPMC 2LXJA 2QDLA 4LAAA 5C4ZA 1O7YA 1S40A 1HFGA 1Y14B 5IYCG 1XNRQ 1RTNA 4IO9A 4QJFA 3NEMA 2F4VL 1VQKA 2NTSA 4C2MH 5M3MB 1HQMC 2EY2A 4HN7A 3C1EA 1TU2B 3UE1A 5JOBA 4UP8A 1B8AA 3LWUA 2Z9HA 2ENBA 1E2ZA 2V4DA 4BBRG 4YHHQ 4JI4L 2TMPA 1QNKA 4B9XA 3DHQA 4HIKA 2NB0A 3CAMA 3PGZA 3HOWB 3GTPB 3AMUA 2F0JA 2JA5H 1E2VA 4NMZA 4K2KA 3HOVH 2KHJA 4C3HB 5KIXA 4GKJQ 1D8LA 1TQOA 3UE0A 4C56C 3J81c 3GTLH 3NTIA 4GKKL 1IBLL 2JA6B 1D5MC 3I4NB 1H9MA 2KJXA 3TP8A 1TWCH 4X3TA 4JV5Q 1YHAA 3FKIB 4DK6C 2E8GA 2QA4A 1CZGA 1F2MA 4JI1Q 1HR0Q 2AWNA 2RQXA 1EY5A 1PH7A 1LM0A 1X65A 1KDBA 1ILPA 2ICEC 1LT4D 3GTOB 2R61A 4NPSA 4IJLA 1EWIA 3X3NA 2QGQA 3K7UC 1PYSB 2FMCA 4A93G 3I4MH 1IHZA 1V9PA 1YNXA 1IBKL 3D3RA 3OWFA 3MFGA 3Q23A 1LTTD 4FDBA 1M4VA 1RD9D 1SAPA 2WAQB 3T53B 1FNVA 1KDAA 1EZ6A 4G7OC 4A3CH 4Y7NB 3ICEA 2CQAA 4DXGA 4DR4L 4JI6L 1NMGA 1SEBD 3S2HB 2JSOA 1MBYA 2HQEA 1GKHA 1HQRD 1NTGA 3H91A 2EPBA 2YTXA 3CF5A 2KCMA 1T5XD 2AUKA 1WI5A 2Y0SB 3VYUA 1D1IA 1IYJB 1MKHA 1YHBA 1CHQD 5I2XA 3GTQB 4E6IA 3J7ZC 3D0FA 2QKIC 1ZEQX 2JA8H 1W3SA 1S5BD 1KNEA 1Y1VH 2BDOA 3K7AH 3S14B 4G4KA 3QIAA 2YU9H 2O5JC 1Q86C 4QMGA 3EFXD 1PH1A 4NXNL 5LMUQ 1YNJC 5E4WC 4C3JG 1VMPA 1B3QA 2Z6KA 3J80i 2OTJA 1LO5D 1LT6D 2E2JH 3K5LA 4X62L 4POFA 1PV4A 1ZYRC 3SHLA 3RZOB 1B70B 3S2DB 1IL8A 3PF5A 2I0QA 1CK1A 4U68A 1A2TA 5IY0A 4OGQC 5IYBG 2N8NA 2XRQD 1BNZA 2NVQB 1CKOA 4A3DH 5JJLA 3SR1A 1KAWA 2O2LD 2VB3X 3W2DA 1JORA 1WTPA 1X3QA 1X9NA 4B9WA 3A7LA 4XTCS 1MSHA 3T16A 5FO8B 2XSCA 4A3EH 3ULJA 1AW7A 1OXXK 2SNMA 4ZKCB 5FO9B 5CORA 5C4JB 2AQ2B 4DR7Q 1AN8A 3HKZE 4XDXA 4LNQA 1A0IA 3A5ZB 1VQNA 3CCJA 4PMCA 2R92G 1OXSC 1UEBA 1K8MA 4NKLA 1WTOA 5FKAC 3T1YL 1CA5A 1HFNA 1LT5D 4IPCA 5H1SE 4AYBB 4A3GH 3Q6SA 2NZHA 1LT3D 3HG9A 5IP9G 3DXJC 1IW7C 3K81C 4AH6A 5A2QL 1O7LA 5BN5A 3D4WA 3BZCA 1BCPC 3NBHB 5I2YA 3HOYG 1HHVA 1K73C 3TSSA 4BS9A 3CPWA 3Q24A 1PH8A 2FJ2A 1TS3A 2MP1A 1LTBD 1SJHD 4YCVA 3H0GH 2PMZB 5NUCA 3DM1A 3E3XA 1CKMA 4O1NA 5ELEA 3S1RB 1PH6A 3E9IA 3AEVA 3RR5A 3HOXG 2WP8J 1STAA 3H3VC 4GLAC 2D9UA 2NZOA 2K14A 1NE3A 4O42A 2BE5D 1PTOB 3D31A 4LWCA
chains in the Genus database with same CATH topology
5HGTA 5CMDA 2ZT9C 3WOEA 3NHHA 2CW0C 5HURA 4FF4A 2M00A 4KKTA 2LMCB 2DNEA 4IZ8A 1S5ED 1EZ8A 1A3UA 4V0BA 3D4RA 1B3AA 3A8JE 5E4XA 5KGUA 1SYGA 1U4LA 5C44B 1G291 1B9NA 2XWJB 1UUPA 3VYSA 4FF2A 1V1PB 1Q8IA 2PCFB 1XX8A 5IOCA 3MZ5A 4KJNA 2F0KA 1I6VC 1PMRA 1I4XA 5IGEA 1SMYD 3KLRA 3NQIA 1EWCA 1U4MA 4FXDA 4X3UA 3QG1A 2QCPX 1H9KA 2PYKA 2NVXB 5M5YB 1TWHB 3VR5A 1PZKD 2EYMA 4ABNA 1G2TA 4L8JA 4NDXA 2EY6A 3FRPB 4PMBA 1TWAB 4H13C 1EIHA 4EGVA 2M9VA 1JICA 3BVGA 1SE3A 3W3AA 2EYPA 4KJOA 2EYHA 1TWFB 5J1ZA 3BYTB 2K5WA 3RMHA 1TWGB 2AQ3B 3T51B 4J8QA 3I91A 3QO2A 2PZWA 3PIO3 1O7ZA 1WCMB 3EROA 3NP8A 1EYAA 2F0MA 1B44D 3K5OA 1EQTA 2R3ZA 4GZYC 1WVLA 1I4RA 4A3FB 4C3HG 5KRUA 3NBHA 3TZUA 5C0XG 5C4XB 1RCVD 2OF1A 4ZRZA 1DM0B 3EQLC 2PO4A 3CRLC 2K01A 5E3FA 1LTSD 4QUCA 1EWHA 1Q1BA 4IALA 2D2CC 1LTGD 2B2VA 3FMCA 3QOJA 5DEHA 1SYDA 4FVMA 5D14A 5A35A 5D3DA 1C4QA 2C5CA 2O4XA 1Z47A 2B2TA 2IPKD 3IKJA 3E6ZX 2F0VA 1Q90A 3S9WA 1BUVT 2QF7A 3I72A 1QCBD 5KYIA 1NSNS 2JXMB 2XN9C 3TN2A 2F0PA 1R4QB 2F1MA 1ICWA 2F0FA 2JE6I 2NZ1D 2F3WA 1EYDA 5LL6X 4KKUA 3DWAA 3DEOA 2B39A 3SDZA 4V190 1K8OA 1EU4A 2I07B 3D4DA 4ILWA 4OO1I 2EY1A 1D5XC 3OIQA 2MUYA 5D3IB 3VR6A 4K5VA 2F0DA 3BVMA 4PNYA 3TBIB 5E1FA 3ITPA 1SFOB 3S16B 2CHBD 1EIGA 2M2LA 2C9OA 4CKEA 2KEDA 2ID0A 5EKKA 1EY6A 4R8IA 3L9AX 1EQVA 4WJWA 3QOLA 4QIWB 3BZDB 3OPOA 4HCEA 2H4OA 1SNDA 3D6CA 2NN6H 1EEID 1LTRD 2RKSA 1PDQA 1JC7A 3CQZB 1EFID 3MFYA 3SVMA 1VF7A 3P20A 5FO7B 1J9OA 2K1BA 4TKOB 1I3QB 1CZWA 1F2YA 4XIGS 2SEBD 4RA8A 5C0XH 1C48A 2F4IA 3SXHA 2FINB 5KNDA 1ZYRD 2J4XA 3NPPA 3QJYA 1PTOC 4MIUA 1PFNA 1STNA 2B2VC 4I7ZC 1GHJA 4DNRB 1R9TB 2KA7A 2XWBB 3U9OA 2FFKB 3G7LA 1FYCA 3F2UA 4KHZA 1GUOA 1K83B 2EE1A 1BO0A 3OIPA 2G9DA 2E74C 5I6WA 4CHTB 1PRTD 4XYQA 3K5NA 1S4ZA 3S1MB 4CKBA 3SK6A 3CKIB 2F0NA 4RAUC 4A3MB 4BY7B 2DN8A 5EGTA 4FO2A 1CI3M 2F0IA 1BOSA 3TDQA 1RKNA 1RHPA 3PUYA 4K8IA 2XVSA 4F7XA 1WD1A 1PFMA 3X3MA 1IW7D 2IJ0A 2WIIB 2F0UA 1EY4A 2L4NA 3NTKA 2K6AA 2IL8A 1L0YB 2K04A 2JEAI 3NXWA 4K6DA 3BDOA 1G2SA 5I4DA 3J7AF 4IUVA 4H44C 3P7JA 4RFBA 1AEXA 2R7ZB 1PXUA 1OO9B 1A2UA 2X6LA 5EJWA 4A3KB 2E2DC 4IUQA 1Y69U 2AQ1B 3KF8A 3TMEA 2L0CA 3DUZA 2NBFA 3J81E 3PUWA 1EU3A 3R3OA 2AWOA 1AZQA 1SBBB 5JEAG 4C2MB 4XQNA 2N88A 4L6TB 2CVRA 4IUTA 2F0SA 5IODA 4KY7A 1HUNA 1EY7A 2FMMA 2RBMA 3J7AV 1PZJD 2A68C 1EY9A 4YIJA 1BDOA 2WACA 1KAAA 2HCCA 4EQNA 2JA5B 3HOVB 3I8ZA 2YYZA 1U4RA 1WTWA 1DZ1A 3Q0AA 2WKDA 1TWCB 3E0JA 4K14A 1HTLD 4MN3A 2K5DA 5EBCA 3V2TA 3C1FA 1DXMA 3I4MB 3DEPA 1JOQA 1G8ZD 1H9JA 1ONLA 3EA6A 1ESFA 3OOCA 2K28A 3FEWX 2MHVA 3IAYA 5EKIA 2K03A 4MHEA 1SYBA 5CBAE 3SE0A 1A3TA 1B9MA 3BDLA 4K2LA 1DD2A 1VCIA 5LL6S 1LABA 1PRTF 1GUSA 2F0OA 2EDGA 1MI2A 4J6HA 3FDTA 1B4OA 4TSSA 3SK4A 2JA8B 1Y1VB 5C3XA 3K7AB 5EPLA 1BF4A 2YU9B 1STHA 1CT1D 3HEJA 3JAME 3I4LA 4RGOS 3OMGA 4HTHA 4Q0FA 2E2JB 1D5ZC 1RTOA 2BA0A 4DK1A 4RKLA 2KOLA 1Y8PB 5JPNC 3K58A 4A3DB 2L12A 4DA2A 1A15A 3H94A 3VA5A 4DK0A 2DNCA 1B1ZA 4ZUIA 4L63B 2EYOA 4EQPA 3A56A 2A6EC 2QDBA 2JYOA 3BDCA 2XIWA 4FNFA 1KTKA 3TP7A 4IFDG 2R6GA 1S5CD 1V1OA 3UI2A 1KLUD 4KKSA 2L5TA 3M4YA 2NYZD 2K33A 3MHBA 3KBXA 2F0GA 3PUXA 4A3GB 4ZKBB 4RH6A 4RKBA 3MEHA 3U9SA 5CV9A 3FPPA 2LS01 4DF7A 4TQUS 1E2WA 3K57A 2AUJD 3R93A 3GV6A 1Q1EA 1HA5A 1AFPA 1QJOA 3D6WA 2RDFA 4CJ1B 2EYFA 5K36G 1EYCA 3MVVA 5EQ0A 2B8GA 2EJMA 5C6AA 3H0GB 2Z4IA 3RLFA 1JE4A 1VF5C 4LMQD 2PPBC 1Y8OB 3R8BA 3J81L 3HGBA 5IT9E 1ENFA 5KNBA 2LFNA 4OHJA 4KN7C 1CM9A 2K32A 2K5QA 4M8AA 4IUUA 1GHKA 3N52A 5C0XJ 2BOSA 1ZXTA 1O80A 1F9QA 2RVLA 3GTGB 2A74C 1SNQA 2B2UA 5EKLA 3J80E 1KABA 4A93B 4F88A 5KYLA 4Q5VA 5COYA 1DCZA 2J0TD 1E0BA 4RGTA 2R93B 3OMCA 4RGMA 1UAPA 3S1QB 4XT3B 4RHSA 2BCOA 3A7AB 1LTAD 2G9HD 3ERQA 3MWYW 4FXKC 3MA2B 1CFMA 1YNNC 1EEFD 1ENCA 3HKZB 3WOFA 5FLXE 4FXGC 1F2ZA 4HEDA 3I90A 3O13A 2SDFA 3GP7A 2KECA 1G6ZA 2NWGA 2MPMA 4XYOA 2VXWA 1NCVA 3E5SA 1NAPA 1F9PA 4G7ZC 3EJIA 2BA1A 2IW3A 5J39A 1QWYA 1TT2A 3HZXA 2NN6I 2SOBA 2OXPA 1Z7TA 1I50B 4OO1G 2XNAC 1EOTA 2RSOA 5C5MA 4B08A 1OXTA 2QILA 3L3OC 1G91A 4C1NI 1LV9A 1I4GA 4X3KA 5JJZA 1OXVA 4RWSC 1CA6A 4CGYB 5IGBA 2H1EA 4HSPA 1S5FD 4K5XA 5M9OA 1CTMA 1PRTB 5G3LD 3WDNA 1H9SB 2B8FA 3DWPA 4IFDH 4HMIA 5CBEE 1JWSD 4LK1C 1HXYD 3PV0A 1JCKB 3NSWA 2QEJC 2LKVA 2R92B 1CQVA 2A6HC 4DNTB 1HPCA 3S15B 1V1PA 1KDCA 1C8CA 3MXUA 4CJ2C 3ND8A 1TS5A 2RA4A 4KK7A 3PO2B 4ID6A 4A3IB 4NP5A 3DWQA 3VYTA 1BQQT 2A5HA 1L0XB 2WV6D 4KV6A 2HCIA 2WKCA 3P75A 4ZAIA 2F03A 3NBIA 5CV8A 3AU7A 3SK5A 3A55A 3T56B 3LX0A 1W6KA 2B2UC 1DYQA 2L1BA 2OEOA 3Q22A 1B50A 2WINB 2PZTA 2ICIA 2NTTA 3NTHA 3HS0C 2VUMB 2B2YA 2KVMA 1SE4A 1EY0A 4KI0A 3K59A 4BWGB 1JWUD 4HSVA 4DFAA 3GO5A 2EOTA 4J1MA 2JP1A 1U9RA 3NUCA 2I46A 3K0YA 3V05A 4PMWA 1VDZA 5JVH3 2L55A 4BY1B 3ND9A 2PZUA 1YNJD 4KY6A 4ME5A 1TKWB 2BDNA 3ZYYX 1T5EA 3MC0B 2KCNA 5CV7A 5I9PA 3FVQA 1S5DD 5CV4A 4CKCA 1QILA 3NWTA 2DY8A 4KMUC 1FGBD 5T1IA 4IQZA 2B2TC 3TZDA 1A6XA 1KLGD 1PYWD 1GOZA 4JK1C 4HR7B 1Y1WB 1X3PA 1VMCA 5CV6A 3KBGA 3VA7A 2IWHA 1V8QA 2TSSA 3GTJB 4UDUC 5DNFA 3SK8A 2X69A 2EYJA 2N55A 2NUCA 3BG3A 4OIKA 3URYA 1ESRA 1XWEA 5FLXL 1H9SA 2PW7A 1GUWA 3K5MA 1I4QA 5G3LF 4M1UB 1HCZA 1ZKOA 2EY5A 2IX1A 3EVQA 4K6LA 2FHTA 2E76C 1F2LA 1BCPD 5ELBA 3C3LA 2F0HA 3PMFA 1CQFA 2JA7B 3GTKB 1EY8A 4R9WA 3MXNA 4A3BB 1STBA 1FNUA 1HUMA 3MXPA 3CRKC 3BYYB 4C3IB 3CHBD 4N9PA 2IX0A 5T1GA 2KUMA 5JEAJ 2A69C 1Q3LA 3HOUB 1WTQA 4RCOA 5F2DA 3PO3B 1BBXC 3V96A 4TRDA 4KHVA 4P2CB 3HP3A 1TIID 2CW0D 4ODGA 2B2YC 1TR5A 2K05A 1A3VA 3T13A 2A6ED 1HRJA 2J7ZA 4Z9CB 1JB3A 3TP5A 2B63B 3RUZA 4XQQA 4DU9A 2RSNA 2ZXOA 3H09A 3N6RA 2Q8RE 3HOZB 1GUNA 4CBVA 1TS2A 3HRZC 4DAVA 3SEBA 1QOHA 3NK9A 5DM73 2KCCA 4N9TA 3GTLB 4G7HC 1RDPD 5EBDA 4WFN3 5FOBB 5IGDA 1JQYD 1FR3A 4OL7A 5C3WA 3OHXC 5I9OA 1PTOH 3OSOA 5D65A 3KLSX 3MXGA 3R2TA 1LLRD 5BN4A 3R2IA 2L9HA 1QE6A 1FD7D 3LNNA 4CJ0B 3M7GA 3P1HA 1NR4A 2O5IC 1PRTC 1MSGA 3PUZA 1KNAA 1QG7A 1TS4A 5BN3A 4WRDA 4FYDA 3MTSA 2A73B 1PFBA 3KK7A 3OW7A 3S17B 1FNWA 3IL8A 4H0LC 5M3FB 3ONAB 3C46A 4R8NA 2DY7A 1ENAA 3PUVA 3OWEB 5CC4A 1TVXA 2F0QA 1RODA 2D62A 5ELCA 3KLSA 5ELDA 5J22A 1YNND 1BR9A 3I70A 5I6YA 4F87A 4IFDJ 4PV1C 1WTXA 3I3CA 3RZDB 1JOKA 1BCPF 4DAYA 5DM63 2IT1A 4KN4C 1IKMA 1NUCA 5C5LA 2NVTB 3M4OB 1RJTA 4FF3A 2OT2A 1ET6A 4A3EB 1IYVA 1D1KA 1DOLA 4HCSA 1HTPA 1XXGA 4DN4M 1O78A 1WTRA 4BA1I 4DGZA 4K8JA 4XT1B 2PNRC 4UAIA 4RGNA 1II3A 3GQBA 4ZLTF 1RF2D 1SJED 1SYEA 4FP5D 1EL0A 2HUGA 2F3VA 3FPUB 5ELFA 3M3YB 4S3SA 3VR3A 5JAVA 5JEAH 4KTAA 5C4HA 4F8MA 4QCLA 2RDGA 4HAEA 3IFTA 4ZYSA 3GD7A 2A6HD 2HDLA 3A8IE 5K5PA 3PIP3 1DJRD 4BBRB 4IN3A 3AB9A 1SSOA 4ULLA 5C3EB 1Q12A 4XQJA 2KQ3A 3I73A 4IFDI 1TY2A 1I4PA 3M85A 3VYRA 3L7ZC 1SYCA 2B2WA 4K5WA 4QF4A 4OIJA 2EZVA 1SYFA 1B53A 4QB4A 1Y8NB 2F0TA 2NN6G 3C2PA 4RHRA 1F77A 2Z4HA 1SNPA 2XRSD 2EYLA 1U4PA 2F0LA 4DXFA 5CGKA 4NW2A 2ZXRA 1LTID 5IGCA 3BVZA 5IIFA 2KHSA 1STGA 4H7BA 1ML0D 4C3IG 2K7VA 1Z6HA 5DAUA 2Q8IB 4C3JB 5EPKA 1GXDC 2EJFC 1NR2A 3LWEA 4KD3A 1DOKA 2BE5C 2MGSA 3A8KE 3MAQA 1PTOD 5TSSA 1OXUA 2EVBA 2L11A 1ET9A 1IYUA 3TP6A 1AZPA 1QB5D 1X32A 3K6OA 3NWSA 4G57A 1WD0A 1PZID 4IUPA 5M5XB 1DONA 2ZXPA 1STYA 3D8GA 3G6JB 4JBWA 2VNUD 3RD4A 2SNSA 4LJZC 5C0XI 1TY0A 1STEA 3QWNA 5LHY1 3JAML 3NQTA 3QB3A 5M5WB 3IFDA 1W6JA 1GUTA 1JOOA 1UEAB 5EPJA 3A54A 2E75C 1MGSA 4XXEA 1M8AA 2JEBI 2E2HB 5AFWA 5CR3A 2MJ8A 4IUNA 1SMYC 4RCNA 1BCPB 4ZUJA 4EQOA 3S1NB 1PLFA 3HOYB 1SNCA 2RDHA 5FK9C 5K36H 4I65A 5KNCA 3J7YW 1GUGA 1SNOA 4IURA 5ISRA 1MD2D 5IGGA 3GV3A 1GJXA 2E2IB 4KD4A 1CHPD 4C1NK 3HOXB 4FF1A 3KUPA 2F0WA 2PQEA 2NVYB 3M7NA 2B2WC 2Z1CA 1BXTA 4PQXA 2A69D 1AP0A 4ZQ3A 1H9RA 1B2TA 2WB1B 1F9RA 4ZK9B 1HA6A 5CV5A 1UNSA 1WTVA 2D5DA 1F9SA 4BBSB 3BS1A 1I6HB 2GA4B 4WORA 1XTCD 5CYUA 1QNUA 1R4PB 1DOMA 4EVOA 3NE5B 1D6EC 1XYIA 2PW5A 2Q8TA 5IT9L 1SNMA 2IX3A 4HMJA 2F0EA 3GTMB 2LY7A 4A3JB 1ILQA 1V43A 2A68D 1JR0D 3DMUA 5KEEA 4KY5A 4QUFA 1I4HA 1SXTA 2HDMA 3VR4A 5A2QE 3H6MA 2VB2X 5IGFA 4DAPA 1J8IA 3J80L 1LACA 1D2BA 4BA2I 2Z8LA 1JWMD 3CU7A 3T4AC 1SDFA 2KEEA 5JVG3 2EJGC 1SE2A 3VR2A 1PTOF 4OO1H 1IKLA 2EXZA 4X3SA 4U673 2X6GA 5JPMC 4LAAA 5C4ZA 1O7YA 1HFGA 1RTNA 2NTSA 5M3MB 1HQMC 2EY2A 4HN7A 3C1EA 1TU2B 5JOBA 3LWUA 2ENBA 1E2ZA 2V4DA 2TMPA 1QNKA 4B9XA 3DHQA 2NB0A 3HOWB 3GTPB 3AMUA 2F0JA 1E2VA 4NMZA 4K2KA 4C3HB 5KIXA 1TQOA 4C56C 3NTIA 2JA6B 1D5MC 3I4NB 1H9MA 2KJXA 3TP8A 4X3TA 3FKIB 1CZGA 1F2MA 2AWNA 2RQXA 1EY5A 1KDBA 1ILPA 2ICEC 1LT4D 3GTOB 2R61A 3X3NA 2FMCA 1IHZA 3D3RA 3OWFA 3MFGA 3Q23A 1LTTD 1M4VA 1RD9D 1SAPA 2WAQB 3T53B 1FNVA 1KDAA 1EZ6A 4G7OC 4Y7NB 2CQAA 4DXGA 1SEBD 3S2HB 2JSOA 1MBYA 2HQEA 1HQRD 3H91A 2EPBA 1T5XD 2AUKA 2Y0SB 3VYUA 1D1IA 1CHQD 5I2XA 3GTQB 4E6IA 2QKIC 1ZEQX 1S5BD 1KNEA 2BDOA 3S14B 4G4KA 3QIAA 2O5JC 4QMGA 3EFXD 1YNJC 5E4WC 4C3JG 1VMPA 1LO5D 1LT6D 3K5LA 1ZYRC 3SHLA 3RZOB 3S2DB 1IL8A 1CK1A 4U68A 1A2TA 4OGQC 2XRQD 1BNZA 2NVQB 3SR1A 2O2LD 2VB3X 3W2DA 1JORA 1WTPA 1X3QA 4B9WA 3A7LA 4XTCS 1MSHA 3T16A 5FO8B 2XSCA 1AW7A 1OXXK 2SNMA 4ZKCB 5FO9B 5CORA 5C4JB 2AQ2B 1AN8A 4XDXA 4PMCA 1OXSC 4NKLA 1K8MA 1WTOA 5FKAC 1CA5A 1HFNA 1LT5D 4AYBB 3Q6SA 1LT3D 3HG9A 3DXJC 1IW7C 5A2QL 1O7LA 5BN5A 3D4WA 1BCPC 5I2YA 1HHVA 3TSSA 4BS9A 3Q24A 2FJ2A 1TS3A 2MP1A 1LTBD 1SJHD 2PMZB 5NUCA 3DM1A 4O1NA 5ELEA 3S1RB 2WP8J 1STAA 3H3VC 2D9UA 4O42A 2BE5D 1PTOB 3D31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGT A;  5JAV A;  4N9P A;  3P1H A;  4J1M A;  3SK4 A;  1U9R A;  3C1E A;  4ZQ3 A;  5C3X A;  3NUC A;  3SHL A;  5IGB A;  3U9O A;  4KTA A;  4K5X A;  4F8M A;  2PZW A;  5C4H A;  1STH A;  3D4D A;  4KD3 A;  5M9O A;  5JOB A;  1A2T A;  3NHH A;  3HEJ A;  3ERO A;  5HUR A;  3NP8 A;  2ENB A;  1EYA A;  2EY1 A;  4WRD A;  2F0M A;  2M00 A;  2PZU A;  4KY6 A;  5CV5 A;  4ME5 A;  5F2D A;  4B9X A;  5K5P A;  3DHQ A;  3OMG A;  4HMI A;  4HTH A;  3SR1 A;  2F0S A;  4TRD A;  5IOD A;  4KY7 A;  2F0J A;  5KRU A;  4KHV A;  1EY7 A;  2LKV A;  4NMZ A;  4K2K A;  3TP6 A;  5I6W A;  4IZ8 A;  2RBM A;  4WOR A;  4RKL A;  5CV7 A;  1JOR A;  1SNQ A;  1EZ8 A;  5I9P A;  5KIX A;  1A3U A;  5EKL A;  1TQO A;  4K5V A;  1KDC A;  1KAB A;  4G57 A;  4B9W A;  2F0D A;  4ODG A;  2OF1 A;  1EY9 A;  4PNY A;  4YIJ A;  3T16 A;  3SK6 A;  4EVO A;  5KGU A;  4R8N A;  1SYG A;  1ENA A;  3TP8 A;  2F0N A;  5KYL A;  1TR5 A;  2SNM A;  2WAC A;  1KAA A;  5E1F A;  1A3V A;  2PW5 A;  3T13 A;  3VA5 A;  3ITP A;  5CV4 A;  4EQN A;  1STY A;  5CC4 A;  4ID6 A;  2F0Q A;  1SNM A;  3D8G A;  4ZUI A;  4NP5 A;  4HMJ A;  5EGT A;  1F2M A;  3TP5 A;  3OMC A;  2F0I A;  1EY5 A;  2EYO A;  3RUZ A;  4EQP A;  2F0E A;  5E3F A;  2SNS A;  5J22 A;  1RKN A;  1KDB A;  4DU9 A;  2KQ3 A;  4PMC A;  5EKK A;  1EY6 A;  4NKL A;  5I6Y A;  2QDB A;  4K8I A;  4F7X A;  3DMU A;  3BDC A;  1EQV A;  3ERQ A;  5KEE A;  4KY5 A;  1SYC A;  3NQT A;  5IOC A;  5CV6 A;  3QOL A;  3MZ5 A;  4K14 A;  4KV6 A;  2F0U A;  1IHZ A;  4IAL A;  3QB3 A;  3TP7 A;  1EY4 A;  1JOK A;  1ENC A;  3OWF A;  4K5W A;  3P75 A;  4QF4 A;  4KJN A;  1JOO A;  2F0K A;  3H6M A;  5IGF A;  3QOJ A;  3V2T A;  5DEH A;  1SND A;  1NUC A;  3C1F A;  5C5L A;  3SK8 A;  3D6C A;  5IGE A;  1SYD A;  2EYJ A;  2NUC A;  5CV8 A;  2RKS A;  1KDA A;  1SYF A;  1F2Z A;  2O4X A;  3MHB A;  3NK9 A;  1EZ6 A;  3NXW A;  4K6D A;  4QB4 A;  2F0G A;  3SK5 A;  1JOQ A;  5CR3 A;  4N9T A;  3D4W A;  4IUN A;  4RKB A;  2F0T A;  3LX0 A;  3MEH A;  5CV9 A;  1AEX A;  2F0V A;  2HQE A;  2PW7 A;  4ZUJ A;  4EQO A;  4DF7 A;  2PYK A;  3S9W A;  1SNC A;  5IGD A;  1SNP A;  2OEO A;  2EYM A;  3E5S A;  5KYI A;  1A2U A;  2EY5 A;  1NSN S;  1F2Y A;  2EYL A;  4I65 A;  2F0P A;  3EVQ A;  5NUC A;  1SYB A;  2PZT A;  4NDX A;  4DGZ A;  2F0L A;  1SNO A;  2EY6 A;  4K8J A;  4E6I A;  3EJI A;  5ISR A;  5J39 A;  4OL7 A;  2RDF A;  5C3W A;  5CGK A;  4PMB A;  5IGG A;  1TT2 A;  2EXZ A;  3HZX A;  5I9O A;  2EYF A;  1A3T A;  1EYC A;  2F0F A;  3BDL A;  2F0H A;  3MVV A;  3PMF A;  1STA A;  2SOB A;  3OSO A;  4K2L A;  4KD4 A;  2OXP A;  4LAA A;  3TME A;  5C4Z A;  5IGC A;  1II3 A;  2F3W A;  1EYD A;  5C6A A;  1EY8 A;  1EY0 A;  3SXH A;  5IIF A;  1SYE A;  2F0W A;  2F0O A;  1STB A;  1STG A;  2KHS A;  2PQE A;  4H7B A;  4QMG A;  2EYP A;  5C5M A;  2F3V A;  2EYH A;  4KJO A;  4DFA A;  4J6H A;  4MIU A;  1STN A;  3MXP A;  5J1Z A;  3R3O A;  2EY2 A;  5DAU A;  4S3S A; 
#chains in the Genus database with same CATH topology
 5HGT A;  4JI5 L;  2WB1 G;  3CCS A;  5CMD A;  2ZT9 C;  3GTG H;  1XNQ Q;  3WOE A;  3NHH A;  2CW0 C;  5HUR A;  4AIM A;  4FF4 A;  4ALP A;  3CCL A;  2M00 A;  4KKT A;  2KEN A;  2LMC B;  4A93 H;  4Y52 H;  3IRB A;  2DNE A;  1HNZ Q;  4LFC L;  3HKS A;  4IZ8 A;  1Q7Y C;  2R93 H;  4R4O A;  1S5E D;  1EZ8 A;  1A3U A;  3S1Q H;  2UUC Q;  2Q2H A;  4V0B A;  4OWX B;  2GVA A;  3D4R A;  4L5R C;  1B3A A;  3A8J E;  5E4X A;  5KGU A;  1SYG A;  4LF5 Q;  1U4L A;  5C44 B;  1G29 1;  1B9N A;  2WFW A;  1QVC A;  4H02 A;  4DV1 Q;  1XPU A;  4A3J G;  4OWT B;  1N34 L;  2XWJ B;  1UUP A;  3VYS A;  4FF2 A;  2HD3 A;  4GS3 A;  2Z6K C;  4JBK A;  1V1P B;  1Q8I A;  2PCF B;  1XX8 A;  4ZCK A;  5IOC A;  3MZ5 A;  2MNA A;  2HIX A;  4KJN A;  2F0K A;  1I6V C;  1PMR A;  3J80 c;  1I4X A;  5IGE A;  5IYD G;  1SMY D;  3KLR A;  3NQI A;  4GLV B;  1EWC A;  4KHP Q;  1U4M A;  1HNW L;  4FXD A;  4X3U A;  3QG1 A;  2QCP X;  3DLL A;  2P5Z X;  1H9K A;  1U5K A;  5IYB H;  2PYK A;  1SMX A;  2NVX B;  5M5Y B;  1TWH B;  3VR5 A;  1PZK D;  2EYM A;  4ABN A;  2CH4 W;  1G2T A;  1I50 H;  2UUA L;  4L8J A;  4NDX A;  4JI2 Q;  4B3R Q;  2EY6 A;  3FRP B;  4PMB A;  1TWA B;  4H13 C;  1EIH A;  4EGV A;  2M9V A;  5FLX c;  1NNX A;  1JIC A;  3BVG A;  1W2B A;  2YTY A;  3AQQ A;  4GN3 B;  4NB3 A;  1SE3 A;  3W3A A;  2EYP A;  4JI0 L;  4KJO A;  2EYH A;  5M3M G;  3G6E A;  1TWF B;  5J1Z A;  1X3E A;  1XMQ L;  3BYT B;  2K5W A;  3RMH A;  1TWG B;  2AQ3 B;  3T51 B;  4J8Q A;  3I91 A;  3QO2 A;  2PZW A;  2R92 H;  4IPG A;  3PIO 3;  1O7Z A;  1WCM B;  3S15 H;  3ERO A;  3RLN A;  3NP8 A;  1EYA A;  2F0M A;  3CPF A;  2EIF A;  3HOW G;  1B44 D;  3K5O A;  1EQT A;  2R3Z A;  4GZY C;  2ZTE A;  4JYA L;  1WVL A;  1I4R A;  4A3F B;  4C3H G;  5KRU A;  2ZTC A;  4A3I H;  5GAG C;  3NBH A;  5IP9 H;  3TZU A;  1JMC A;  5C0X G;  5C4X B;  2JA6 G;  2R7F A;  3OTO Q;  1RCV D;  3I4N G;  2F52 A;  2OF1 A;  3FKI G;  4JPB W;  4ZRZ A;  4IJH A;  3CCM A;  1DM0 B;  1XJV A;  2OWO A;  3EQL C;  1SRO A;  3HOU G;  3M4P A;  1CKN B;  2PO4 A;  3CRL C;  2UXD Q;  3K0X A;  3UDI A;  2K01 A;  5E3F A;  1LTS D;  4QUC A;  1EWH A;  1Q1B A;  1TXY A;  3TRE A;  1FGU A;  4IAL A;  3H3V H;  1YIT A;  1ASY A;  3CD6 A;  3BJU A;  1LYL A;  2D2C C;  1LTG D;  2B2V A;  3FMC A;  3QOJ A;  5DEH A;  2WAQ G;  1SYD A;  4FVM A;  4DR6 L;  5D14 A;  2KBN A;  5A35 A;  3FP9 A;  5D3D A;  5GQO A;  4JI7 Q;  1C4Q A;  2C5C A;  1NJI C;  2HHH Q;  2O4X A;  4IPH A;  4RG1 A;  4POG A;  1FJG Q;  4RMF A;  1Z47 A;  2B2T A;  2IPK D;  3IKJ A;  2K5H A;  3E6Z X;  2VUM H;  2F0V A;  4DR2 Q;  1Q90 A;  3S9W A;  5IWA Q;  2Y0S G;  1BUV T;  2QF7 A;  3I72 A;  1QCB D;  2RHS B;  5KYI A;  1IBM L;  1E1O A;  1NSN S;  2DGY A;  2JXM B;  2XN9 C;  3TN2 A;  2F0P A;  1R4Q B;  4GLX A;  2UUB Q;  2F1M A;  1X56 A;  3CCQ A;  1N33 L;  4X65 L;  1ICW A;  2F0F A;  1QVF A;  1D7Q A;  2JE6 I;  2NZ1 D;  4DR1 L;  2F3W A;  1EYD A;  2MO0 A;  2XTI A;  5LL6 X;  4KKU A;  3DWA A;  4BY1 H;  3DEO A;  1HNX Q;  1S72 A;  2B39 A;  3GTM H;  3SDZ A;  3U58 A;  1J5E L;  4V19 0;  1K8O A;  1EU4 A;  2I07 B;  4DR5 L;  4WJ4 A;  3D4D A;  4LFA L;  4DPG A;  4ILW A;  4OO1 I;  4UP7 A;  2EY1 A;  1D5X C;  3OIQ A;  5JJI A;  4JI8 L;  2MUY A;  2PI2 A;  5D3I B;  1FVI A;  1J6Q A;  1MHW C;  3VR6 A;  4K5V A;  2F0D A;  3BVM A;  1Q82 C;  4PNY A;  3TBI B;  4IOA A;  5E1F A;  1Y1W H;  3ITP A;  1SFO B;  3S16 B;  2CHB D;  4LF8 Q;  4P72 A;  4A3L G;  1QVG A;  2Z0S A;  1EIG A;  3GTJ H;  2M2L A;  3KJP A;  2C9O A;  1VQD A;  4CKE A;  2KED A;  2ID0 A;  5EKK A;  1EY6 A;  4R8I A;  3L9A X;  3ZJY C;  4LF6 L;  1EQV A;  4WJW A;  4AYB G;  3QOL A;  4QIW B;  3BZD B;  1WJJ A;  2GVB A;  3OPO A;  4HCE A;  2H4O A;  1SND A;  3D6C A;  3U50 C;  2NN6 H;  1EEI D;  1LTR D;  3HFZ B;  2RKS A;  1PDQ A;  1JC7 A;  1E24 A;  5FLM H;  4LUV A;  3CQZ B;  1EFI D;  2KCT A;  3MFY A;  3SVM A;  3ER0 A;  1VF7 A;  3P20 A;  5FO7 B;  5LMN Q;  4JI3 L;  1J9O A;  5BR8 Q;  2K1B A;  4TKO B;  1I3Q B;  1CZW A;  3GTK H;  1F2Y A;  4XIG S;  1PHJ A;  4OX9 Q;  5GAE C;  1UE6 A;  1BKB A;  2SEB D;  4DV3 Q;  4YY3 Q;  4RA8 A;  5C0X H;  4DV7 L;  1C48 A;  4C3I H;  2LSS A;  4PG3 A;  1G51 A;  2F4I A;  3SXH A;  2FIN B;  5KND A;  1ZYR D;  2J4X A;  1QUQ B;  3NPP A;  3QJY A;  1PTO C;  4MIU A;  3HOU H;  1PFN A;  1STN A;  1WOC A;  3PO3 H;  2B2V C;  3TQY A;  4I7Z C;  3CCV A;  1GHJ A;  4DNR B;  1R9T B;  2KA7 A;  2XWB B;  4QGU A;  3U9O A;  2FFK B;  3G7L A;  3PQI A;  4HJ8 A;  1FYC A;  3F2U A;  4KHZ A;  3CCR A;  1GUO A;  1K83 B;  2EE1 A;  1BO0 A;  3OIP A;  2G9D A;  2E74 C;  5I6W A;  1E22 A;  4CHT B;  1PRT D;  4XYQ A;  4X64 Q;  3K5N A;  1S4Z A;  3S1M B;  3Q8D A;  2B63 H;  1VQM A;  2RF4 A;  4CKB A;  3SK6 A;  5C44 G;  3CKI B;  2F0N A;  4RAU C;  1P16 A;  4A3M B;  4BY7 B;  2DN8 A;  5EGT A;  3I4O A;  1CI3 M;  4FO2 A;  2F0I A;  1BOS A;  3TDQ A;  3HOZ H;  1RKN A;  1RHP A;  3PUY A;  4K8I A;  2EXD A;  2XVS A;  4F7X A;  1WD1 A;  1PFM A;  3MEF A;  3X3M A;  5LMU L;  4IOC A;  1IW7 D;  2IJ0 A;  2LXK A;  2WII B;  2F0U A;  1EY4 A;  2L4N A;  3NTK A;  2K6A A;  2IL8 A;  2RCF A;  5DLQ E;  2QEX A;  4X66 Q;  1L0Y B;  5C3E G;  2K04 A;  1KXL A;  1YI2 A;  1E3P A;  2JEA I;  4O0A A;  1C7Y A;  3CXC A;  2UXB Q;  3NXW A;  4K6D A;  3BDO A;  1G2S A;  5I4D A;  2E5L L;  3J7A F;  1VQJ A;  1AH9 A;  4IUV A;  1BBU A;  4H44 C;  3P7J A;  4RFB A;  1AEX A;  2R7Z B;  3KF6 A;  1PXU A;  4DUZ Q;  1OO9 B;  4MNO A;  1A2U A;  2X6L A;  5EJW A;  3ULP A;  4A3K B;  2ZM6 Q;  2E2D C;  4IUQ A;  1Y69 U;  4B3T L;  2AQ1 B;  3KF8 A;  1M1K C;  3TME A;  5LMN W;  2L0C A;  2K52 A;  2PNH A;  3DUZ A;  1EIY B;  2NBF A;  3I7F A;  3J81 E;  4GNX B;  3PUW A;  3UDX A;  1EU3 A;  3R3O A;  2AWO A;  1EFW A;  1WCM G;  2CFM A;  4B3M L;  1AZQ A;  1SN8 A;  1SBB B;  2OCE A;  3S17 H;  4B3S Q;  5M3F H;  5JEA G;  4C2M B;  4XQN A;  2N88 A;  4L6T B;  2CVR A;  3CW2 C;  4A3F G;  4IUT A;  2F0S A;  5IOD A;  4KY7 A;  2F4V Q;  5C4X G;  2PI2 E;  1HUN A;  1EY7 A;  2FMM A;  2RBM A;  3J7A V;  1PZJ D;  2A68 C;  3RNU A;  1EY9 A;  4YIJ A;  1BDO A;  1K0S A;  3B6Y A;  2WAC A;  1KAA A;  2HCC A;  1GD7 A;  4EQN A;  2JA5 B;  3RZD H;  3HOV B;  3I8Z A;  4JI4 Q;  4DV5 L;  2ALY B;  5FJ8 G;  2VQE L;  2YYZ A;  1U4R A;  5IP7 H;  1WTW A;  3TS0 A;  1DZ1 A;  3Q0A A;  2WKD A;  1I94 L;  1K3R A;  1TWC B;  3E0J A;  1X55 A;  2NVT H;  1QUQ A;  4GKK Q;  4K14 A;  3M4O H;  1RIP A;  1HTL D;  1SRU A;  4MN3 A;  4LF9 L;  2K5D A;  5EBC A;  3V2T A;  3C1F A;  4HJA A;  1DXM A;  1XNQ L;  4HJ9 A;  3I4M B;  3DEP A;  1JOQ A;  1N8R C;  1G8Z D;  1H9J A;  1ONL A;  3EA6 A;  4NXM L;  1ESF A;  2VZA A;  4O2D A;  3U4V A;  3OOC A;  3JAM c;  2K28 A;  3FEW X;  1K8G A;  2MHV A;  3IAY A;  5EKI A;  2K03 A;  1IBK Q;  4MHE A;  1SYB A;  4UP9 A;  1HR0 W;  5IYC H;  5CBA E;  3RN5 A;  4DV0 L;  1JB7 A;  1N32 L;  3J81 j;  3SE0 A;  3M3Y H;  1A8V A;  1A3T A;  1B9M A;  3BDL A;  4K2L A;  1DD2 A;  1VCI A;  5LL6 S;  1LAB A;  1PRT F;  3E9H A;  4DR4 Q;  4JI6 Q;  5AJ3 L;  1GUS A;  1XMO L;  2F0O A;  1VQ7 A;  2EDG A;  4LF4 L;  1MI2 A;  4IPD A;  4J6H A;  1N9W A;  4UPA A;  1IL2 A;  3FDT A;  2I5L X;  1B4O A;  1L1O B;  4TSS A;  3SK4 A;  4JCV E;  4BBR H;  2JA8 B;  1SR3 A;  1Y1V B;  5C3X A;  3K7A B;  5EPL A;  1BF4 A;  2YU9 B;  1STH A;  2YTV A;  1CT1 D;  3HEJ A;  4GN5 A;  3JAM E;  3I4L A;  3F8T A;  4RGO S;  2RCN A;  3OMG A;  4HTH A;  4Q0F A;  2E2J B;  1X3F A;  4GOP B;  2R7D A;  1D5Z C;  1RTO A;  2BA0 A;  4N8X 1;  4NXN Q;  4DK1 A;  1HZA A;  3CC4 A;  5C3E H;  1PH3 A;  2MQH A;  4RKL A;  1EOV A;  2KOL A;  3G4S A;  1Y8P B;  5JPN C;  4X62 Q;  3K58 A;  3M9B A;  4A3D B;  2L12 A;  1T9H A;  4DA2 A;  1A15 A;  3H94 A;  3VA5 A;  4DK0 A;  2DNC A;  2ATW A;  1B1Z A;  4ZUI A;  3H15 A;  1SLJ A;  4L63 B;  3I55 A;  2EYO A;  4EQP A;  1ASZ A;  4BBS G;  2N3S A;  3A56 A;  2A6E C;  2QDB A;  4JBM A;  2JYO A;  2F3I A;  3BDC A;  4OON A;  2XIW A;  1VQO A;  4GNX A;  4P73 A;  4FNF A;  1KTK A;  3CP0 A;  3TP7 A;  4IFD G;  2R6G A;  1JE5 A;  2UXC L;  1S5C D;  1V1O A;  3UI2 A;  1KLU D;  4KKS A;  5IT9 c;  2L5T A;  3M4Y A;  3W5O A;  2NYZ D;  5HGQ A;  2K33 A;  3MHB A;  3KBX A;  2F0G A;  1WFQ A;  3PUX A;  2VW9 A;  4A3G B;  4ZKB B;  4RH6 A;  4RKB A;  3MEH A;  3U9S A;  5CV9 A;  3T1Y Q;  3FPP A;  3NEN A;  2LS0 1;  3T1H L;  4DF7 A;  4TQU S;  1E2W A;  1ICF B;  3K57 A;  4UHV A;  2AUJ D;  3R93 A;  3GV6 A;  1Q1E A;  1HA5 A;  3H3V I;  1AFP A;  1LUZ A;  1QJO A;  3D6W A;  2RDF A;  3JC6 6;  1Q8K A;  1HZB A;  4CJ1 B;  2A19 A;  2EYF A;  1VQH A;  1EYC A;  3MVV A;  5EQ0 A;  4EX5 A;  5K36 G;  2B8G A;  4C3J H;  2EJM A;  2WB1 E;  3I2Z A;  2CWP A;  5C6A A;  2UXD L;  1YHQ A;  3H0G B;  2Z4I A;  4LF7 Q;  4YWM A;  3K8A A;  3RLF A;  4LFB L;  1JE4 A;  1VF5 C;  4R1J A;  4LMQ D;  2PPB C;  1Y8O B;  3R8B A;  1CSQ A;  3J81 L;  3HGB A;  5IT9 E;  4AQY L;  1ENF A;  1M90 C;  5KNB A;  4DV2 L;  2LFN A;  4OHJ A;  1VQF A;  3EN2 A;  4KN7 C;  1CM9 A;  2K32 A;  2K5Q A;  4M8A A;  4IUU A;  2FXQ A;  2K5N A;  2VQF L;  1GHK A;  3N52 A;  2JK8 A;  5M5X H;  5C0X J;  2BOS A;  1ZXT A;  1O80 A;  1F9Q A;  2RVL A;  3GTG B;  1UE1 A;  3ULL A;  2A74 C;  1SNQ A;  2B2U A;  4JI5 Q;  5EKL A;  3J80 E;  1KAB A;  4A93 B;  4F88 A;  2OQ0 A;  5KYL A;  4Q5V A;  1YBY A;  3F2C A;  5COY A;  1DCZ A;  2HIV A;  4BY7 G;  2J0T D;  1BBW A;  1E0B A;  4RGT A;  2R93 B;  5M5W H;  3OMC A;  4RGM A;  4LFC Q;  1UAP A;  3S1Q B;  2VS1 A;  4XT3 B;  1KL9 A;  4RHS A;  2BCO A;  3A7A B;  1LTA D;  2G9H D;  3ERQ A;  3MWY W;  4FXK C;  2E2H H;  3MA2 B;  1CFM A;  1YNN C;  1EEF D;  1ENC A;  1X6O A;  3UDG A;  3HKZ B;  1L1O A;  1WYD A;  3WOF A;  2UU9 L;  5FLX E;  2JQO A;  3S1N H;  4FXG C;  3HOY H;  4HID A;  1N34 Q;  1F2Z A;  4HED A;  1VQ9 A;  1EQQ A;  3I90 A;  3O13 A;  2SDF A;  4GOP A;  3GP7 A;  2R7Z G;  2KEC A;  1G6Z A;  2NWG A;  2MPM A;  4XYO A;  3FHW A;  2VXW A;  2E2I H;  1NCV A;  4A3K G;  4K0K Q;  3E5S A;  1C9O A;  3HOX H;  1K9M C;  1NAP A;  1F9P A;  4HIM A;  4G7Z C;  1KQS A;  3J7A 5;  3EJI A;  2NVY H;  2BA1 A;  2IW3 A;  5J39 A;  1QWY A;  1EUJ A;  1TT2 A;  3HZX A;  4MTK A;  4LF8 L;  4A75 A;  1AE2 A;  2NN6 I;  3I56 A;  2SOB A;  1HNW Q;  2OXP A;  2MFI A;  2MO1 A;  1Z7T A;  1I50 B;  4OO1 G;  2XNA C;  1EOT A;  4DV6 L;  2RSO A;  4GNX C;  5C5M A;  4B08 A;  1OXT A;  2QIL A;  3L3O C;  1G91 A;  4C1N I;  1LV9 A;  1I4G A;  4X3K A;  2UUA Q;  5JJZ A;  1OXV A;  4BBS H;  4RWS C;  4DUY L;  1CA6 A;  4CGY B;  5IGB A;  2H1E A;  4HSP A;  1S5F D;  1I6H H;  4K5X A;  2I5H A;  3A74 A;  5M9O A;  1CTM A;  1PRT B;  5G3L D;  3WDN A;  2EQS A;  1PH9 A;  1H9S B;  2B8F A;  3DWP A;  4IFD H;  4HMI A;  5CBE E;  1VQE A;  1JWS D;  4LK1 C;  4JI0 Q;  1HXY D;  3PV0 A;  1JCK B;  3NSW A;  1EIF A;  2QEJ C;  2LKV A;  2R92 B;  1CQV A;  1K0R A;  2A6H C;  4DNT B;  1HPC A;  3S15 B;  1V1P A;  3CQZ H;  1KDC A;  1C8C A;  4A3J H;  3MXU A;  3KDF B;  3ND8 A;  4YCU A;  4CJ2 C;  1TS5 A;  2JA5 G;  2RA4 A;  4KK7 A;  3HOV G;  1VQI A;  4OX9 L;  3PO2 B;  1PFS A;  4ID6 A;  4A3I B;  1YJ9 A;  1K8A C;  4NP5 A;  4DR3 L;  3DWQ A;  3VYT A;  3MXN B;  4JYA Q;  2V1C C;  2WAQ E;  5GAD C;  3J81 i;  1BQQ T;  3F2B A;  2A5H A;  1L0X B;  2WV6 D;  2YV5 A;  5IYD H;  4KV6 A;  4JG2 A;  1NBW A;  1BVS A;  2HCI A;  2WKC A;  2JA9 A;  2DUD A;  3P75 A;  2A1A A;  4ZAI A;  1N36 L;  3QR8 A;  2F03 A;  1OTC A;  4OWW B;  2Y0S E;  3NBI A;  1YEZ A;  5CV8 A;  2KHI A;  3AU7 A;  3SK5 A;  2Z6B A;  3K80 C;  3A55 A;  3TRZ A;  2K4K A;  3T56 B;  3LX0 A;  1W6K A;  2B2U C;  4HJ7 A;  3CC2 A;  2Q2I A;  1DYQ A;  1XNR L;  3NEL A;  5GRO A;  2L1B A;  3STB C;  1Q46 A;  2OEO A;  3Q22 A;  1B50 A;  2WIN B;  2K75 A;  3KYH C;  2PZT A;  3W1G A;  2ICI A;  2NTT A;  4P74 A;  4DR6 Q;  3NTH A;  3HS0 C;  2VUM B;  2VY3 A;  2B2Y A;  2KVM A;  1KRT A;  1SE4 A;  5M3M H;  4YHH L;  1EY0 A;  1U0L A;  4KI0 A;  3K59 A;  4CDD C;  2Q2T A;  4BWG B;  1JWU D;  4HSV A;  4DFA A;  4HIO A;  3GO5 A;  2EOT A;  3EIV A;  3G71 A;  1IBM Q;  2JA8 G;  1L1O C;  1Y1V G;  3OYY A;  1EQR A;  4GKJ L;  4J1M A;  2JP1 A;  1U9R A;  3HOW H;  3GTP H;  3NUC A;  2OTL A;  2I46 A;  3K0Y A;  3V05 A;  1N33 Q;  4PMW A;  3WWV A;  4X65 Q;  1VDZ A;  5ELO A;  4C3H H;  5JVH 3;  4JV5 L;  2L55 A;  4DV4 Q;  4BY1 B;  3ND9 A;  2PZU A;  1YNJ D;  4KY6 A;  2UXB L;  3LGJ A;  1TKW B;  4ME5 A;  4JI1 L;  1HR0 L;  1CKN A;  2JA6 H;  3I4N H;  3FKI H;  2BDN A;  3ZYY X;  1T5E A;  3MC0 B;  2KCN A;  5CV7 A;  5I9P A;  1J5E Q;  4A3D G;  4DR5 Q;  3GTO H;  4LFA Q;  3FVQ A;  4AYB E;  1S5D D;  5CV4 A;  4CKC A;  1QIL A;  3NWT A;  2DY8 A;  4KMU C;  2JN4 A;  1MIU A;  1FGB D;  5T1I A;  4IQZ A;  2B2T C;  4JI8 Q;  3TZD A;  1A6X A;  3PCO B;  1VQB A;  1KLG D;  1PYW D;  1GOZ A;  4JK1 C;  2ASB A;  4HR7 B;  1Y1W B;  1X3P A;  1VS0 A;  1VMC A;  4JOI A;  5CV6 A;  3KBG A;  3VA7 A;  1JJG A;  2IWH A;  4JVZ A;  3PIP A;  1V8Q A;  4Y7N H;  2TSS A;  3GTJ B;  1JJC B;  1NMF A;  4UDU C;  2I5M X;  5DNF A;  3S2H H;  3BU2 A;  3SK8 A;  2X69 A;  3BG3 A;  2EYJ A;  2N55 A;  2NUC A;  2PMZ E;  3AFP A;  4OIK A;  1E1T A;  3URY A;  1ESR A;  1XWE A;  4B3S L;  4A3G G;  3KJO A;  2HT1 A;  5FLX L;  1H9S A;  2N78 A;  2AKW B;  3GTQ H;  4LF6 Q;  2PW7 A;  1GUW A;  1VQL A;  3K5M A;  1I4Q A;  5G3L F;  4M1U B;  1HCZ A;  1A62 A;  1PH5 A;  3S14 H;  1ZKO A;  2EY5 A;  2IX1 A;  3EVQ A;  4K6L A;  2K5V A;  2FHT A;  3KDF A;  2E76 C;  2AMC B;  1F2L A;  1BCP D;  5ELB A;  3C3L A;  2F0H A;  3PMF A;  1CSP A;  3H0G G;  1CQF A;  1YIJ A;  3RZO H;  2JA7 B;  3GTK B;  1EY8 A;  4R9W A;  3S2D H;  3MXN A;  4A3B B;  1STB A;  1JT8 A;  4JI3 Q;  1FNU A;  2NVQ H;  1HUM A;  4DAY B;  3MXP A;  3CRK C;  3BYY B;  4X6A H;  1O7I A;  4C3I B;  3CHB D;  4N9P A;  4LW1 A;  2IX0 A;  1UE7 A;  2BH8 A;  5T1G A;  4R4T A;  2KUM A;  5JEA J;  4DV7 Q;  2A69 C;  1Q3L A;  4DR7 L;  3W1B A;  3HOU B;  1WTQ A;  4RCO A;  5F2D A;  3PO3 B;  3PIO A;  1BBX C;  3V96 A;  1E7Z A;  4TRD A;  4APV A;  5C4J H;  1H95 A;  4KHV A;  4P2C B;  1UWV A;  1HH2 P;  3HP3 A;  1TII D;  2CW0 D;  4A3L H;  1XTD A;  4DNI A;  4ODG A;  4A76 A;  2B2Y C;  1TR5 A;  2R93 G;  4P75 A;  2K05 A;  1A3V A;  3T13 A;  2A6E D;  4CDF C;  1HRJ A;  2J7Z A;  4Z9C B;  4WJ3 M;  1JB3 A;  4R4I A;  3TP5 A;  2B63 B;  3RUZ A;  4XQQ A;  4DU9 A;  2RSN A;  4PZ6 A;  2ZXO A;  1HZC A;  2A8V A;  3H09 A;  4ME3 A;  3HKZ G;  1GVP A;  3N6R A;  2Q8R E;  5EAY A;  3HOZ B;  1GUN A;  4CBV A;  1I5F A;  2DJG C;  4OEL B;  1TS2 A;  1HJP A;  1VQ4 A;  3HRZ C;  4DAV A;  3SEB A;  1QOH A;  3NK9 A;  5DM7 3;  1G6P A;  3CME A;  1L0W A;  1KHI A;  2KCC A;  4N9T A;  3GTL B;  4G7H C;  2ZJP A;  4YWK A;  3S1R H;  3TEH B;  1RDP D;  5EBD A;  1RL2 A;  4WFN 3;  5FOB B;  5IGD A;  1JQY D;  3BZK A;  1IBL Q;  1HZ9 A;  1X3G A;  1C0A A;  2HQL A;  4PZ7 A;  1FR3 A;  4OL7 A;  5C3W A;  3OHX C;  5I9O A;  1PTO H;  2E5L Q;  4TVA B;  3OSO A;  5D65 A;  3KLS X;  3MXG A;  3R2T A;  5GAH C;  4UY8 C;  1LLR D;  4KLK A;  1PH4 A;  4JOI C;  1HNZ L;  5BN4 A;  3R2I A;  2L9H A;  1QE6 A;  3SGI A;  3VDY A;  1FD7 D;  1B7Y B;  3LNN A;  4CJ0 B;  5L37 A;  3M7G A;  2C35 B;  3P1H A;  1NR4 A;  2UUC L;  1YJN A;  2O5I C;  1PRT C;  4B3T Q;  1MSG A;  3PUZ A;  1KNA A;  1QG7 A;  1TS4 A;  1YVC A;  5BN3 A;  4LF5 L;  4WRD A;  4FYD A;  3MTS A;  2A73 B;  4DV1 L;  3AYH B;  4BXX G;  1PFB A;  3KK7 A;  4OEM B;  5C44 H;  3OW7 A;  3S17 B;  1EYG A;  1FNW A;  3IL8 A;  4DAM A;  4H0L C;  5M3F B;  4LUO A;  5J3B A;  3ONA B;  4B3M Q;  4QY7 A;  3C46 A;  3PO2 G;  4R8N A;  2DY7 A;  1ENA A;  4N8F A;  4A3I G;  2H5X A;  4YCW A;  3PUV A;  3OWE B;  1VQ5 A;  5CC4 A;  1TVX A;  2F0Q A;  1ROD A;  2D62 A;  1S3O A;  5ELC A;  3KLS A;  5ELD A;  5J22 A;  1YNN D;  4KHP L;  1BR9 A;  2JJQ A;  3I70 A;  2CCZ A;  5I6Y A;  4F87 A;  4LF7 L;  4IFD J;  4PV1 C;  1WTX A;  3I3C A;  3RZD B;  4JW0 A;  1JOK A;  1BCP F;  4DAY A;  5DM6 3;  2IT1 A;  4JBJ A;  4KN4 C;  3PSI A;  1IKM A;  1NUC A;  5C5L A;  4B3R L;  4JI2 L;  1VQA A;  4DV5 Q;  4CDE C;  2NVX H;  3A0J A;  5M5Y H;  2NVT B;  1TWH H;  4J15 A;  2VQE Q;  1RJT A;  3M4O B;  4LUZ A;  1I94 Q;  2OT2 A;  1ET6 A;  4FF3 A;  4A3E B;  1IYV A;  1D1K A;  1DOL A;  4HCS A;  1TWA H;  1HTP A;  1NY4 A;  3KFU A;  2CKZ B;  1XPR A;  1XXG A;  4DN4 M;  1O78 A;  4LF9 Q;  2CH4 A;  4L5S A;  3DM3 A;  1WTR A;  4BA1 I;  2VUM G;  4DGZ A;  4K8J A;  4XT1 B;  2PNR C;  1TWF H;  4NXM Q;  1KC8 C;  4UAI A;  4RGN A;  1II3 A;  3GQB A;  1TWG H;  3OW2 A;  2VL6 A;  4ZLT F;  1RF2 D;  1SJE D;  1SYE A;  4A4I A;  4FP5 D;  1EL0 A;  1WCM H;  2HUG A;  2F3V A;  3FPU B;  5ELF A;  3M3Y B;  3CCU A;  4S3S A;  1PH2 A;  3VR3 A;  5JAV A;  5JEA H;  1V1Q A;  3OTO L;  3ERS X;  2CWA A;  4A3F H;  4DV0 Q;  4KTA A;  5C4H A;  4F8M A;  5ELN A;  4BY1 G;  4QCL A;  2RDG A;  4HAE A;  1N32 Q;  3IFT A;  3UDF A;  5C4X H;  4ZYS A;  1CUK A;  3GD7 A;  2A6H D;  2HDL A;  5AJ3 Q;  3A8I E;  5K5P A;  1XMO Q;  3PIP 3;  1DJR D;  1VQC A;  2G5D A;  4IN3 A;  4BBR B;  4LF4 Q;  2RHQ B;  3AB9 A;  1SSO A;  2XGT A;  4K0K L;  5FJ8 H;  4PZ8 A;  1VQ6 A;  4QIW E;  4ULL A;  5C3E B;  1SE8 A;  1Q12 A;  4JI7 L;  4XQJ A;  4MZ9 A;  2HHH L;  4MTN A;  1Y1W G;  2KQ3 A;  3I73 A;  4IFD I;  1FJG L;  1TY2 A;  1I4P A;  3M85 A;  2IY5 B;  2BH2 A;  3VYR A;  2ZJQ A;  3L7Z C;  1SYC A;  4DR2 L;  5IWA L;  2B2W A;  4K5W A;  1KRS A;  4QF4 A;  3S24 A;  4A3M G;  2QW7 A;  1MJC A;  4OIJ A;  2B3G A;  2EZV A;  2UUB L;  1SYF A;  1B53 A;  2N49 A;  4QB4 A;  3STB D;  4I7A A;  3F1Z A;  1Y8N B;  4R4Q A;  2F0T A;  2NN6 G;  3C2P A;  3U4Z A;  4RHR A;  1F77 A;  2Z4H A;  2ES2 A;  1K3B C;  5FLM G;  2UXC Q;  1SNP A;  2XRS D;  1HNX L;  2B29 A;  2EYL A;  1DGS A;  1U4P A;  1VQ8 A;  2F0L A;  4BXX H;  4CDC C;  1A63 A;  4DXF A;  5CGK A;  1X54 A;  2JA7 G;  3F2D A;  4NW2 A;  1UE5 A;  2ZXR A;  4L5Q A;  1LTI D;  5IGC A;  4A3B G;  3BVZ A;  5IIF A;  3PO2 H;  2KHS A;  1STG A;  3T1H Q;  4H7B A;  1ML0 D;  4C3I G;  2K7V A;  3CCE A;  1Z6H A;  5DAU A;  2Q8I B;  3L0O A;  4C3J B;  2L15 A;  5EPK A;  1VQG A;  2K50 A;  1GXD C;  3KOJ A;  2EJF C;  1NR2 A;  3LWE A;  4KD3 A;  1DOK A;  2BE5 C;  2MGS A;  3PO3 G;  3A8K E;  3MAQ A;  1PTO D;  2PQA B;  5TSS A;  2DJF C;  4LFB Q;  1OXU A;  2EVB A;  2L11 A;  1ET9 A;  1VQP A;  1SFO H;  3S16 H;  1IYU A;  3TP6 A;  1AZP A;  1QB5 D;  4EQ5 A;  1X32 A;  3K6O A;  3NWS A;  4AQY Q;  4G57 A;  1PYB A;  1GM5 A;  1WD0 A;  4DV2 Q;  4QQB X;  1PZI D;  4IUP A;  5M5X B;  1DON A;  2ZXP A;  1STY A;  3KLW A;  2B63 G;  3D8G A;  3G6J B;  5HY6 A;  2AHO B;  2VQF Q;  4JBW A;  3TS2 A;  2VNU D;  3RD4 A;  3RLO A;  2SNS A;  2IHE A;  4LJZ C;  5C0X I;  3CC7 A;  1TY0 A;  3PF4 A;  1STE A;  3QWN A;  5LHY 1;  3JAM L;  1AE3 A;  1K28 A;  4DK3 C;  3EBE A;  3NQT A;  3HOZ G;  1XMQ Q;  3QB3 A;  5LMN L;  5M5W B;  5BR8 L;  2D0O A;  3IFD A;  1W6J A;  1GUT A;  1JOO A;  1UEA B;  2D0P A;  3A54 A;  5EPJ A;  2E75 C;  1MGS A;  4DV3 L;  4DV4 L;  3RN2 A;  4XXE A;  4YY3 L;  1I3Q H;  1M8A A;  2JEB I;  2E2H B;  5AFW A;  5CR3 A;  2MJ8 A;  4IUN A;  1PA6 A;  1SMY C;  1L2F A;  4RCN A;  1BCP B;  4ZUJ A;  4EQO A;  3GDE A;  1PLF A;  3S1N B;  3HOY B;  1SNC A;  2RDH A;  5FK9 C;  1Q81 C;  5K36 H;  1FL0 A;  4I65 A;  2UU9 Q;  5KNC A;  3J7Y W;  1GUG A;  1SNO A;  4IUR A;  5ISR A;  1MD2 D;  3E0E A;  5IGG A;  3GV3 A;  3I4M G;  1GJX A;  2E2I B;  4KD4 A;  1CHP D;  4C1N K;  1R9T H;  3HOX B;  4FF1 A;  3KUP A;  2F0W A;  2PQE A;  3KF6 B;  2NVY B;  3L2P A;  3M7N A;  1YJW A;  2B2W C;  2Q2U A;  2Z1C A;  1BXT A;  1IZ6 A;  4PQX A;  1QZG A;  2A69 D;  4A3C G;  4X64 L;  4JC0 A;  4OXP A;  1AP0 A;  1K83 H;  4ZQ3 A;  1H9R A;  1XPO A;  1B2T A;  1GO3 E;  2WB1 B;  3S1M H;  3KF8 B;  1F9R A;  4ZK9 B;  1HA6 A;  3CMA A;  1MJE A;  5CV5 A;  1UNS A;  1WTV A;  4DV6 Q;  2D5D A;  1F9S A;  4BBS B;  3BS1 A;  5JJK A;  3A5U A;  1I6H B;  2GA4 B;  4A3M H;  5M3F G;  4WOR A;  4BY7 H;  1WTH A;  3M4Q A;  1XTC D;  5CYU A;  4DUY Q;  1QNU A;  1R4P B;  1DOM A;  4EVO A;  3NE5 B;  1D6E C;  1XYI A;  2PW5 A;  1LTL A;  4X66 L;  2Q8T A;  5IT9 L;  1KD1 C;  1SNM A;  2IX3 A;  4HMJ A;  4DR1 Q;  4YWL A;  5E7N A;  5IE8 A;  2F0E A;  4GOP C;  2LY7 A;  3GTM B;  4A3J B;  1ILQ A;  1V43 A;  2GN5 A;  3AFQ A;  2A68 D;  1JR0 D;  3DMU A;  5KEE A;  4KY5 A;  4QUF A;  1KIX A;  2JA7 H;  1I4H A;  1SXT A;  5IP7 G;  4DUZ L;  4A3B H;  2HDM A;  3VR4 A;  5A2Q E;  3H6M A;  2VB2 X;  5IGF A;  4DAP A;  2ZM6 L;  1J8I A;  3J80 L;  1Z9F A;  4DR3 Q;  2R7Z H;  1LAC A;  1D2B A;  4BA2 I;  1PVO A;  2Z8L A;  1JWM D;  4P71 A;  4A3E G;  3CU7 A;  4A3K H;  2ZTD A;  2PQA A;  3T4A C;  1YZ6 A;  4HJ5 A;  2CQO A;  3G48 A;  1IXR A;  4DKA C;  1SDF A;  4GN4 B;  4R4C A;  2KEE A;  4L5T A;  5JVG 3;  2EJG C;  2IHF A;  1N36 Q;  1JJ2 A;  1SE2 A;  3VR2 A;  1PTO F;  4OO1 H;  2ZJR A;  1QZH A;  2OQK A;  4QL5 A;  1IKL A;  2EXZ A;  4X3S A;  4U67 3;  3JAM i;  1P8L A;  2X6G A;  5JPM C;  2LXJ A;  2QDL A;  4LAA A;  5C4Z A;  1O7Y A;  1S40 A;  1HFG A;  1Y14 B;  5IYC G;  1XNR Q;  1RTN A;  4IO9 A;  4QJF A;  3NEM A;  2F4V L;  1VQK A;  2NTS A;  4C2M H;  5M3M B;  1HQM C;  2EY2 A;  4HN7 A;  3C1E A;  1TU2 B;  3UE1 A;  5JOB A;  4UP8 A;  1B8A A;  3LWU A;  2Z9H A;  2ENB A;  1E2Z A;  2V4D A;  4BBR G;  4YHH Q;  4JI4 L;  2TMP A;  1QNK A;  4B9X A;  3DHQ A;  4HIK A;  2NB0 A;  3CAM A;  3PGZ A;  3HOW B;  3GTP B;  3AMU A;  2F0J A;  2JA5 H;  1E2V A;  4NMZ A;  4K2K A;  3HOV H;  2KHJ A;  4C3H B;  5KIX A;  4GKJ Q;  1D8L A;  1TQO A;  3UE0 A;  4C56 C;  3J81 c;  3GTL H;  3NTI A;  4GKK L;  1IBL L;  2JA6 B;  1D5M C;  3I4N B;  1H9M A;  2KJX A;  3TP8 A;  1TWC H;  4X3T A;  4JV5 Q;  1YHA A;  3FKI B;  4DK6 C;  2E8G A;  2QA4 A;  1CZG A;  1F2M A;  4JI1 Q;  1HR0 Q;  2AWN A;  2RQX A;  1EY5 A;  1PH7 A;  1LM0 A;  1X65 A;  1KDB A;  1ILP A;  2ICE C;  1LT4 D;  3GTO B;  2R61 A;  4NPS A;  4IJL A;  1EWI A;  3X3N A;  2QGQ A;  3K7U C;  1PYS B;  2FMC A;  4A93 G;  3I4M H;  1IHZ A;  1V9P A;  1YNX A;  1IBK L;  3D3R A;  3OWF A;  3MFG A;  3Q23 A;  1LTT D;  4FDB A;  1M4V A;  1RD9 D;  1SAP A;  2WAQ B;  3T53 B;  1FNV A;  1KDA A;  1EZ6 A;  4G7O C;  4A3C H;  4Y7N B;  3ICE A;  2CQA A;  4DXG A;  4DR4 L;  4JI6 L;  1NMG A;  1SEB D;  3S2H B;  2JSO A;  1MBY A;  2HQE A;  1GKH A;  1HQR D;  1NTG A;  3H91 A;  2EPB A;  2YTX A;  3CF5 A;  2KCM A;  1T5X D;  2AUK A;  1WI5 A;  2Y0S B;  3VYU A;  1D1I A;  1IYJ B;  1MKH A;  1YHB A;  1CHQ D;  5I2X A;  3GTQ B;  4E6I A;  3J7Z C;  3D0F A;  2QKI C;  1ZEQ X;  2JA8 H;  1W3S A;  1S5B D;  1KNE A;  1Y1V H;  2BDO A;  3K7A H;  3S14 B;  4G4K A;  3QIA A;  2YU9 H;  2O5J C;  1Q86 C;  4QMG A;  3EFX D;  1PH1 A;  4NXN L;  5LMU Q;  1YNJ C;  5E4W C;  4C3J G;  1VMP A;  1B3Q A;  2Z6K A;  3J80 i;  2OTJ A;  1LO5 D;  1LT6 D;  2E2J H;  3K5L A;  4X62 L;  4POF A;  1PV4 A;  1ZYR C;  3SHL A;  3RZO B;  1B70 B;  3S2D B;  1IL8 A;  3PF5 A;  2I0Q A;  1CK1 A;  4U68 A;  1A2T A;  5IY0 A;  4OGQ C;  5IYB G;  2N8N A;  2XRQ D;  1BNZ A;  2NVQ B;  1CKO A;  4A3D H;  5JJL A;  3SR1 A;  1KAW A;  2O2L D;  2VB3 X;  3W2D A;  1JOR A;  1WTP A;  1X3Q A;  1X9N A;  4B9W A;  3A7L A;  4XTC S;  1MSH A;  3T16 A;  5FO8 B;  2XSC A;  4A3E H;  3ULJ A;  1AW7 A;  1OXX K;  2SNM A;  4ZKC B;  5FO9 B;  5COR A;  5C4J B;  2AQ2 B;  4DR7 Q;  1AN8 A;  3HKZ E;  4XDX A;  4LNQ A;  1A0I A;  3A5Z B;  1VQN A;  3CCJ A;  4PMC A;  2R92 G;  1OXS C;  1UEB A;  1K8M A;  4NKL A;  1WTO A;  5FKA C;  3T1Y L;  1CA5 A;  1HFN A;  1LT5 D;  4IPC A;  5H1S E;  4AYB B;  4A3G H;  3Q6S A;  2NZH A;  1LT3 D;  3HG9 A;  5IP9 G;  3DXJ C;  1IW7 C;  3K81 C;  4AH6 A;  5A2Q L;  1O7L A;  5BN5 A;  3D4W A;  3BZC A;  1BCP C;  3NBH B;  5I2Y A;  3HOY G;  1HHV A;  1K73 C;  3TSS A;  4BS9 A;  3CPW A;  3Q24 A;  1PH8 A;  2FJ2 A;  1TS3 A;  2MP1 A;  1LTB D;  1SJH D;  4YCV A;  3H0G H;  2PMZ B;  5NUC A;  3DM1 A;  3E3X A;  1CKM A;  4O1N A;  5ELE A;  3S1R B;  1PH6 A;  3E9I A;  3AEV A;  3RR5 A;  3HOX G;  2WP8 J;  1STA A;  3H3V C;  4GLA C;  2D9U A;  2NZO A;  2K14 A;  1NE3 A;  4O42 A;  2BE5 D;  1PTO B;  3D31 A;  4LWC A; 
#chains in the Genus database with same CATH homology
 5HGT A;  5CMD A;  2ZT9 C;  3WOE A;  3NHH A;  2CW0 C;  5HUR A;  4FF4 A;  2M00 A;  4KKT A;  2LMC B;  2DNE A;  4IZ8 A;  1S5E D;  1EZ8 A;  1A3U A;  4V0B A;  3D4R A;  1B3A A;  3A8J E;  5E4X A;  5KGU A;  1SYG A;  1U4L A;  5C44 B;  1G29 1;  1B9N A;  2XWJ B;  1UUP A;  3VYS A;  4FF2 A;  1V1P B;  1Q8I A;  2PCF B;  1XX8 A;  5IOC A;  3MZ5 A;  4KJN A;  2F0K A;  1I6V C;  1PMR A;  1I4X A;  5IGE A;  1SMY D;  3KLR A;  3NQI A;  1EWC A;  1U4M A;  4FXD A;  4X3U A;  3QG1 A;  2QCP X;  1H9K A;  2PYK A;  2NVX B;  5M5Y B;  1TWH B;  3VR5 A;  1PZK D;  2EYM A;  4ABN A;  1G2T A;  4L8J A;  4NDX A;  2EY6 A;  3FRP B;  4PMB A;  1TWA B;  4H13 C;  1EIH A;  4EGV A;  2M9V A;  1JIC A;  3BVG A;  1SE3 A;  3W3A A;  2EYP A;  4KJO A;  2EYH A;  1TWF B;  5J1Z A;  3BYT B;  2K5W A;  3RMH A;  1TWG B;  2AQ3 B;  3T51 B;  4J8Q A;  3I91 A;  3QO2 A;  2PZW A;  3PIO 3;  1O7Z A;  1WCM B;  3ERO A;  3NP8 A;  1EYA A;  2F0M A;  1B44 D;  3K5O A;  1EQT A;  2R3Z A;  4GZY C;  1WVL A;  1I4R A;  4A3F B;  4C3H G;  5KRU A;  3NBH A;  3TZU A;  5C0X G;  5C4X B;  1RCV D;  2OF1 A;  4ZRZ A;  1DM0 B;  3EQL C;  2PO4 A;  3CRL C;  2K01 A;  5E3F A;  1LTS D;  4QUC A;  1EWH A;  1Q1B A;  4IAL A;  2D2C C;  1LTG D;  2B2V A;  3FMC A;  3QOJ A;  5DEH A;  1SYD A;  4FVM A;  5D14 A;  5A35 A;  5D3D A;  1C4Q A;  2C5C A;  2O4X A;  1Z47 A;  2B2T A;  2IPK D;  3IKJ A;  3E6Z X;  2F0V A;  1Q90 A;  3S9W A;  1BUV T;  2QF7 A;  3I72 A;  1QCB D;  5KYI A;  1NSN S;  2JXM B;  2XN9 C;  3TN2 A;  2F0P A;  1R4Q B;  2F1M A;  1ICW A;  2F0F A;  2JE6 I;  2NZ1 D;  2F3W A;  1EYD A;  5LL6 X;  4KKU A;  3DWA A;  3DEO A;  2B39 A;  3SDZ A;  4V19 0;  1K8O A;  1EU4 A;  2I07 B;  3D4D A;  4ILW A;  4OO1 I;  2EY1 A;  1D5X C;  3OIQ A;  2MUY A;  5D3I B;  3VR6 A;  4K5V A;  2F0D A;  3BVM A;  4PNY A;  3TBI B;  5E1F A;  3ITP A;  1SFO B;  3S16 B;  2CHB D;  1EIG A;  2M2L A;  2C9O A;  4CKE A;  2KED A;  2ID0 A;  5EKK A;  1EY6 A;  4R8I A;  3L9A X;  1EQV A;  4WJW A;  3QOL A;  4QIW B;  3BZD B;  3OPO A;  4HCE A;  2H4O A;  1SND A;  3D6C A;  2NN6 H;  1EEI D;  1LTR D;  2RKS A;  1PDQ A;  1JC7 A;  3CQZ B;  1EFI D;  3MFY A;  3SVM A;  1VF7 A;  3P20 A;  5FO7 B;  1J9O A;  2K1B A;  4TKO B;  1I3Q B;  1CZW A;  1F2Y A;  4XIG S;  2SEB D;  4RA8 A;  5C0X H;  1C48 A;  2F4I A;  3SXH A;  2FIN B;  5KND A;  1ZYR D;  2J4X A;  3NPP A;  3QJY A;  1PTO C;  4MIU A;  1PFN A;  1STN A;  2B2V C;  4I7Z C;  1GHJ A;  4DNR B;  1R9T B;  2KA7 A;  2XWB B;  3U9O A;  2FFK B;  3G7L A;  1FYC A;  3F2U A;  4KHZ A;  1GUO A;  1K83 B;  2EE1 A;  1BO0 A;  3OIP A;  2G9D A;  2E74 C;  5I6W A;  4CHT B;  1PRT D;  4XYQ A;  3K5N A;  1S4Z A;  3S1M B;  4CKB A;  3SK6 A;  3CKI B;  2F0N A;  4RAU C;  4A3M B;  4BY7 B;  2DN8 A;  5EGT A;  4FO2 A;  1CI3 M;  2F0I A;  1BOS A;  3TDQ A;  1RKN A;  1RHP A;  3PUY A;  4K8I A;  2XVS A;  4F7X A;  1WD1 A;  1PFM A;  3X3M A;  1IW7 D;  2IJ0 A;  2WII B;  2F0U A;  1EY4 A;  2L4N A;  3NTK A;  2K6A A;  2IL8 A;  1L0Y B;  2K04 A;  2JEA I;  3NXW A;  4K6D A;  3BDO A;  1G2S A;  5I4D A;  3J7A F;  4IUV A;  4H44 C;  3P7J A;  4RFB A;  1AEX A;  2R7Z B;  1PXU A;  1OO9 B;  1A2U A;  2X6L A;  5EJW A;  4A3K B;  2E2D C;  4IUQ A;  1Y69 U;  2AQ1 B;  3KF8 A;  3TME A;  2L0C A;  3DUZ A;  2NBF A;  3J81 E;  3PUW A;  1EU3 A;  3R3O A;  2AWO A;  1AZQ A;  1SBB B;  5JEA G;  4C2M B;  4XQN A;  2N88 A;  4L6T B;  2CVR A;  4IUT A;  2F0S A;  5IOD A;  4KY7 A;  1HUN A;  1EY7 A;  2FMM A;  2RBM A;  3J7A V;  1PZJ D;  2A68 C;  1EY9 A;  4YIJ A;  1BDO A;  2WAC A;  1KAA A;  2HCC A;  4EQN A;  2JA5 B;  3HOV B;  3I8Z A;  2YYZ A;  1U4R A;  1WTW A;  1DZ1 A;  3Q0A A;  2WKD A;  1TWC B;  3E0J A;  4K14 A;  1HTL D;  4MN3 A;  2K5D A;  5EBC A;  3V2T A;  3C1F A;  1DXM A;  3I4M B;  3DEP A;  1JOQ A;  1G8Z D;  1H9J A;  1ONL A;  3EA6 A;  1ESF A;  3OOC A;  2K28 A;  3FEW X;  2MHV A;  3IAY A;  5EKI A;  2K03 A;  4MHE A;  1SYB A;  5CBA E;  3SE0 A;  1A3T A;  1B9M A;  3BDL A;  4K2L A;  1DD2 A;  1VCI A;  5LL6 S;  1LAB A;  1PRT F;  1GUS A;  2F0O A;  2EDG A;  1MI2 A;  4J6H A;  3FDT A;  1B4O A;  4TSS A;  3SK4 A;  2JA8 B;  1Y1V B;  5C3X A;  3K7A B;  5EPL A;  1BF4 A;  2YU9 B;  1STH A;  1CT1 D;  3HEJ A;  3JAM E;  3I4L A;  4RGO S;  3OMG A;  4HTH A;  4Q0F A;  2E2J B;  1D5Z C;  1RTO A;  2BA0 A;  4DK1 A;  4RKL A;  2KOL A;  1Y8P B;  5JPN C;  3K58 A;  4A3D B;  2L12 A;  4DA2 A;  1A15 A;  3H94 A;  3VA5 A;  4DK0 A;  2DNC A;  1B1Z A;  4ZUI A;  4L63 B;  2EYO A;  4EQP A;  3A56 A;  2A6E C;  2QDB A;  2JYO A;  3BDC A;  2XIW A;  4FNF A;  1KTK A;  3TP7 A;  4IFD G;  2R6G A;  1S5C D;  1V1O A;  3UI2 A;  1KLU D;  4KKS A;  2L5T A;  3M4Y A;  2NYZ D;  2K33 A;  3MHB A;  3KBX A;  2F0G A;  3PUX A;  4A3G B;  4ZKB B;  4RH6 A;  4RKB A;  3MEH A;  3U9S A;  5CV9 A;  3FPP A;  2LS0 1;  4DF7 A;  4TQU S;  1E2W A;  3K57 A;  2AUJ D;  3R93 A;  3GV6 A;  1Q1E A;  1HA5 A;  1AFP A;  1QJO A;  3D6W A;  2RDF A;  4CJ1 B;  2EYF A;  5K36 G;  1EYC A;  3MVV A;  5EQ0 A;  2B8G A;  2EJM A;  5C6A A;  3H0G B;  2Z4I A;  3RLF A;  1JE4 A;  1VF5 C;  4LMQ D;  2PPB C;  1Y8O B;  3R8B A;  3J81 L;  3HGB A;  5IT9 E;  1ENF A;  5KNB A;  2LFN A;  4OHJ A;  4KN7 C;  1CM9 A;  2K32 A;  2K5Q A;  4M8A A;  4IUU A;  1GHK A;  3N52 A;  5C0X J;  2BOS A;  1ZXT A;  1O80 A;  1F9Q A;  2RVL A;  3GTG B;  2A74 C;  1SNQ A;  2B2U A;  5EKL A;  3J80 E;  1KAB A;  4A93 B;  4F88 A;  5KYL A;  4Q5V A;  5COY A;  1DCZ A;  2J0T D;  1E0B A;  4RGT A;  2R93 B;  3OMC A;  4RGM A;  1UAP A;  3S1Q B;  4XT3 B;  4RHS A;  2BCO A;  3A7A B;  1LTA D;  2G9H D;  3ERQ A;  3MWY W;  4FXK C;  3MA2 B;  1CFM A;  1YNN C;  1EEF D;  1ENC A;  3HKZ B;  3WOF A;  5FLX E;  4FXG C;  1F2Z A;  4HED A;  3I90 A;  3O13 A;  2SDF A;  3GP7 A;  2KEC A;  1G6Z A;  2NWG A;  2MPM A;  4XYO A;  2VXW A;  1NCV A;  3E5S A;  1NAP A;  1F9P A;  4G7Z C;  3EJI A;  2BA1 A;  2IW3 A;  5J39 A;  1QWY A;  1TT2 A;  3HZX A;  2NN6 I;  2SOB A;  2OXP A;  1Z7T A;  1I50 B;  4OO1 G;  2XNA C;  1EOT A;  2RSO A;  5C5M A;  4B08 A;  1OXT A;  2QIL A;  3L3O C;  1G91 A;  4C1N I;  1LV9 A;  1I4G A;  4X3K A;  5JJZ A;  1OXV A;  4RWS C;  1CA6 A;  4CGY B;  5IGB A;  2H1E A;  4HSP A;  1S5F D;  4K5X A;  5M9O A;  1CTM A;  1PRT B;  5G3L D;  3WDN A;  1H9S B;  2B8F A;  3DWP A;  4IFD H;  4HMI A;  5CBE E;  1JWS D;  4LK1 C;  1HXY D;  3PV0 A;  1JCK B;  3NSW A;  2QEJ C;  2LKV A;  2R92 B;  1CQV A;  2A6H C;  4DNT B;  1HPC A;  3S15 B;  1V1P A;  1KDC A;  1C8C A;  3MXU A;  4CJ2 C;  3ND8 A;  1TS5 A;  2RA4 A;  4KK7 A;  3PO2 B;  4ID6 A;  4A3I B;  4NP5 A;  3DWQ A;  3VYT A;  1BQQ T;  2A5H A;  1L0X B;  2WV6 D;  4KV6 A;  2HCI A;  2WKC A;  3P75 A;  4ZAI A;  2F03 A;  3NBI A;  5CV8 A;  3AU7 A;  3SK5 A;  3A55 A;  3T56 B;  3LX0 A;  1W6K A;  2B2U C;  1DYQ A;  2L1B A;  2OEO A;  3Q22 A;  1B50 A;  2WIN B;  2PZT A;  2ICI A;  2NTT A;  3NTH A;  3HS0 C;  2VUM B;  2B2Y A;  2KVM A;  1SE4 A;  1EY0 A;  4KI0 A;  3K59 A;  4BWG B;  1JWU D;  4HSV A;  4DFA A;  3GO5 A;  2EOT A;  4J1M A;  2JP1 A;  1U9R A;  3NUC A;  2I46 A;  3K0Y A;  3V05 A;  4PMW A;  1VDZ A;  5JVH 3;  2L55 A;  4BY1 B;  3ND9 A;  2PZU A;  1YNJ D;  4KY6 A;  4ME5 A;  1TKW B;  2BDN A;  3ZYY X;  1T5E A;  3MC0 B;  2KCN A;  5CV7 A;  5I9P A;  3FVQ A;  1S5D D;  5CV4 A;  4CKC A;  1QIL A;  3NWT A;  2DY8 A;  4KMU C;  1FGB D;  5T1I A;  4IQZ A;  2B2T C;  3TZD A;  1A6X A;  1KLG D;  1PYW D;  1GOZ A;  4JK1 C;  4HR7 B;  1Y1W B;  1X3P A;  1VMC A;  5CV6 A;  3KBG A;  3VA7 A;  2IWH A;  1V8Q A;  2TSS A;  3GTJ B;  4UDU C;  5DNF A;  3SK8 A;  2X69 A;  2EYJ A;  2N55 A;  2NUC A;  3BG3 A;  4OIK A;  3URY A;  1ESR A;  1XWE A;  5FLX L;  1H9S A;  2PW7 A;  1GUW A;  3K5M A;  1I4Q A;  5G3L F;  4M1U B;  1HCZ A;  1ZKO A;  2EY5 A;  2IX1 A;  3EVQ A;  4K6L A;  2FHT A;  2E76 C;  1F2L A;  1BCP D;  5ELB A;  3C3L A;  2F0H A;  3PMF A;  1CQF A;  2JA7 B;  3GTK B;  1EY8 A;  4R9W A;  3MXN A;  4A3B B;  1STB A;  1FNU A;  1HUM A;  3MXP A;  3CRK C;  3BYY B;  4C3I B;  3CHB D;  4N9P A;  2IX0 A;  5T1G A;  2KUM A;  5JEA J;  2A69 C;  1Q3L A;  3HOU B;  1WTQ A;  4RCO A;  5F2D A;  3PO3 B;  1BBX C;  3V96 A;  4TRD A;  4KHV A;  4P2C B;  3HP3 A;  1TII D;  2CW0 D;  4ODG A;  2B2Y C;  1TR5 A;  2K05 A;  1A3V A;  3T13 A;  2A6E D;  1HRJ A;  2J7Z A;  4Z9C B;  1JB3 A;  3TP5 A;  2B63 B;  3RUZ A;  4XQQ A;  4DU9 A;  2RSN A;  2ZXO A;  3H09 A;  3N6R A;  2Q8R E;  3HOZ B;  1GUN A;  4CBV A;  1TS2 A;  3HRZ C;  4DAV A;  3SEB A;  1QOH A;  3NK9 A;  5DM7 3;  2KCC A;  4N9T A;  3GTL B;  4G7H C;  1RDP D;  5EBD A;  4WFN 3;  5FOB B;  5IGD A;  1JQY D;  1FR3 A;  4OL7 A;  5C3W A;  3OHX C;  5I9O A;  1PTO H;  3OSO A;  5D65 A;  3KLS X;  3MXG A;  3R2T A;  1LLR D;  5BN4 A;  3R2I A;  2L9H A;  1QE6 A;  1FD7 D;  3LNN A;  4CJ0 B;  3M7G A;  3P1H A;  1NR4 A;  2O5I C;  1PRT C;  1MSG A;  3PUZ A;  1KNA A;  1QG7 A;  1TS4 A;  5BN3 A;  4WRD A;  4FYD A;  3MTS A;  2A73 B;  1PFB A;  3KK7 A;  3OW7 A;  3S17 B;  1FNW A;  3IL8 A;  4H0L C;  5M3F B;  3ONA B;  3C46 A;  4R8N A;  2DY7 A;  1ENA A;  3PUV A;  3OWE B;  5CC4 A;  1TVX A;  2F0Q A;  1ROD A;  2D62 A;  5ELC A;  3KLS A;  5ELD A;  5J22 A;  1YNN D;  1BR9 A;  3I70 A;  5I6Y A;  4F87 A;  4IFD J;  4PV1 C;  1WTX A;  3I3C A;  3RZD B;  1JOK A;  1BCP F;  4DAY A;  5DM6 3;  2IT1 A;  4KN4 C;  1IKM A;  1NUC A;  5C5L A;  2NVT B;  3M4O B;  1RJT A;  4FF3 A;  2OT2 A;  1ET6 A;  4A3E B;  1IYV A;  1D1K A;  1DOL A;  4HCS A;  1HTP A;  1XXG A;  4DN4 M;  1O78 A;  1WTR A;  4BA1 I;  4DGZ A;  4K8J A;  4XT1 B;  2PNR C;  4UAI A;  4RGN A;  1II3 A;  3GQB A;  4ZLT F;  1RF2 D;  1SJE D;  1SYE A;  4FP5 D;  1EL0 A;  2HUG A;  2F3V A;  3FPU B;  5ELF A;  3M3Y B;  4S3S A;  3VR3 A;  5JAV A;  5JEA H;  4KTA A;  5C4H A;  4F8M A;  4QCL A;  2RDG A;  4HAE A;  3IFT A;  4ZYS A;  3GD7 A;  2A6H D;  2HDL A;  3A8I E;  5K5P A;  3PIP 3;  1DJR D;  4BBR B;  4IN3 A;  3AB9 A;  1SSO A;  4ULL A;  5C3E B;  1Q12 A;  4XQJ A;  2KQ3 A;  3I73 A;  4IFD I;  1TY2 A;  1I4P A;  3M85 A;  3VYR A;  3L7Z C;  1SYC A;  2B2W A;  4K5W A;  4QF4 A;  4OIJ A;  2EZV A;  1SYF A;  1B53 A;  4QB4 A;  1Y8N B;  2F0T A;  2NN6 G;  3C2P A;  4RHR A;  1F77 A;  2Z4H A;  1SNP A;  2XRS D;  2EYL A;  1U4P A;  2F0L A;  4DXF A;  5CGK A;  4NW2 A;  2ZXR A;  1LTI D;  5IGC A;  3BVZ A;  5IIF A;  2KHS A;  1STG A;  4H7B A;  1ML0 D;  4C3I G;  2K7V A;  1Z6H A;  5DAU A;  2Q8I B;  4C3J B;  5EPK A;  1GXD C;  2EJF C;  1NR2 A;  3LWE A;  4KD3 A;  1DOK A;  2BE5 C;  2MGS A;  3A8K E;  3MAQ A;  1PTO D;  5TSS A;  1OXU A;  2EVB A;  2L11 A;  1ET9 A;  1IYU A;  3TP6 A;  1AZP A;  1QB5 D;  1X32 A;  3K6O A;  3NWS A;  4G57 A;  1WD0 A;  1PZI D;  4IUP A;  5M5X B;  1DON A;  2ZXP A;  1STY A;  3D8G A;  3G6J B;  4JBW A;  2VNU D;  3RD4 A;  2SNS A;  4LJZ C;  5C0X I;  1TY0 A;  1STE A;  3QWN A;  5LHY 1;  3JAM L;  3NQT A;  3QB3 A;  5M5W B;  3IFD A;  1W6J A;  1GUT A;  1JOO A;  1UEA B;  5EPJ A;  3A54 A;  2E75 C;  1MGS A;  4XXE A;  1M8A A;  2JEB I;  2E2H B;  5AFW A;  5CR3 A;  2MJ8 A;  4IUN A;  1SMY C;  4RCN A;  1BCP B;  4ZUJ A;  4EQO A;  3S1N B;  1PLF A;  3HOY B;  1SNC A;  2RDH A;  5FK9 C;  5K36 H;  4I65 A;  5KNC A;  3J7Y W;  1GUG A;  1SNO A;  4IUR A;  5ISR A;  1MD2 D;  5IGG A;  3GV3 A;  1GJX A;  2E2I B;  4KD4 A;  1CHP D;  4C1N K;  3HOX B;  4FF1 A;  3KUP A;  2F0W A;  2PQE A;  2NVY B;  3M7N A;  2B2W C;  2Z1C A;  1BXT A;  4PQX A;  2A69 D;  1AP0 A;  4ZQ3 A;  1H9R A;  1B2T A;  2WB1 B;  1F9R A;  4ZK9 B;  1HA6 A;  5CV5 A;  1UNS A;  1WTV A;  2D5D A;  1F9S A;  4BBS B;  3BS1 A;  1I6H B;  2GA4 B;  4WOR A;  1XTC D;  5CYU A;  1QNU A;  1R4P B;  1DOM A;  4EVO A;  3NE5 B;  1D6E C;  1XYI A;  2PW5 A;  2Q8T A;  5IT9 L;  1SNM A;  2IX3 A;  4HMJ A;  2F0E A;  3GTM B;  2LY7 A;  4A3J B;  1ILQ A;  1V43 A;  2A68 D;  1JR0 D;  3DMU A;  5KEE A;  4KY5 A;  4QUF A;  1I4H A;  1SXT A;  2HDM A;  3VR4 A;  5A2Q E;  3H6M A;  2VB2 X;  5IGF A;  4DAP A;  1J8I A;  3J80 L;  1LAC A;  1D2B A;  4BA2 I;  2Z8L A;  1JWM D;  3CU7 A;  3T4A C;  1SDF A;  2KEE A;  5JVG 3;  2EJG C;  1SE2 A;  3VR2 A;  1PTO F;  4OO1 H;  1IKL A;  2EXZ A;  4X3S A;  4U67 3;  2X6G A;  5JPM C;  4LAA A;  5C4Z A;  1O7Y A;  1HFG A;  1RTN A;  2NTS A;  5M3M B;  1HQM C;  2EY2 A;  4HN7 A;  3C1E A;  1TU2 B;  5JOB A;  3LWU A;  2ENB A;  1E2Z A;  2V4D A;  2TMP A;  1QNK A;  4B9X A;  3DHQ A;  2NB0 A;  3HOW B;  3GTP B;  3AMU A;  2F0J A;  1E2V A;  4NMZ A;  4K2K A;  4C3H B;  5KIX A;  1TQO A;  4C56 C;  3NTI A;  2JA6 B;  1D5M C;  3I4N B;  1H9M A;  2KJX A;  3TP8 A;  4X3T A;  3FKI B;  1CZG A;  1F2M A;  2AWN A;  2RQX A;  1EY5 A;  1KDB A;  1ILP A;  2ICE C;  1LT4 D;  3GTO B;  2R61 A;  3X3N A;  2FMC A;  1IHZ A;  3D3R A;  3OWF A;  3MFG A;  3Q23 A;  1LTT D;  1M4V A;  1RD9 D;  1SAP A;  2WAQ B;  3T53 B;  1FNV A;  1KDA A;  1EZ6 A;  4G7O C;  4Y7N B;  2CQA A;  4DXG A;  1SEB D;  3S2H B;  2JSO A;  1MBY A;  2HQE A;  1HQR D;  3H91 A;  2EPB A;  1T5X D;  2AUK A;  2Y0S B;  3VYU A;  1D1I A;  1CHQ D;  5I2X A;  3GTQ B;  4E6I A;  2QKI C;  1ZEQ X;  1S5B D;  1KNE A;  2BDO A;  3S14 B;  4G4K A;  3QIA A;  2O5J C;  4QMG A;  3EFX D;  1YNJ C;  5E4W C;  4C3J G;  1VMP A;  1LO5 D;  1LT6 D;  3K5L A;  1ZYR C;  3SHL A;  3RZO B;  3S2D B;  1IL8 A;  1CK1 A;  4U68 A;  1A2T A;  4OGQ C;  2XRQ D;  1BNZ A;  2NVQ B;  3SR1 A;  2O2L D;  2VB3 X;  3W2D A;  1JOR A;  1WTP A;  1X3Q A;  4B9W A;  3A7L A;  4XTC S;  1MSH A;  3T16 A;  5FO8 B;  2XSC A;  1AW7 A;  1OXX K;  2SNM A;  4ZKC B;  5FO9 B;  5COR A;  5C4J B;  2AQ2 B;  1AN8 A;  4XDX A;  4PMC A;  1OXS C;  4NKL A;  1K8M A;  1WTO A;  5FKA C;  1CA5 A;  1HFN A;  1LT5 D;  4AYB B;  3Q6S A;  1LT3 D;  3HG9 A;  3DXJ C;  1IW7 C;  5A2Q L;  1O7L A;  5BN5 A;  3D4W A;  1BCP C;  5I2Y A;  1HHV A;  3TSS A;  4BS9 A;  3Q24 A;  2FJ2 A;  1TS3 A;  2MP1 A;  1LTB D;  1SJH D;  2PMZ B;  5NUC A;  3DM1 A;  4O1N A;  5ELE A;  3S1R B;  2WP8 J;  1STA A;  3H3V C;  2D9U A;  4O42 A;  2BE5 D;  1PTO B;  3D31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...