1LABA

Three-dimensional structure of the lipoyl domain from bacillus stearothermophilus pyruvate dehydrogenase multienzyme complex
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
80
structure length
80
Chain Sequence
AFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGTVATVGQTLITLDAPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the lipoyl domain from Bacillus stearothermophilus pyruvate dehydrogenase multienzyme complex.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase (acyltransferase)
molecule keywords DIHYDROLIPOAMIDE ACETYLTRANSFERASE
total genus 6
structure length 80
sequence length 80
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1labA00
2A6HD 1Y8NB 2B8GA 2EDGA 1IW7C 1E2ZA 3T53B 3BG3A 1G291 5A35A 4HR7B 1I6VC 4L8JA 1OXUA 1HQMC 1H9MA 2JXMB 3CRKC 5BN5A 4OO1H 1CFMA 3CRLC 4KN4C 3PUYA 4JK1C 3GD7A 1HTPA 2A68D 3SE0A 1HPCA 2D5DA 2A69D 1OXSC 4OGQC 4PV1C 2R6GA 2D2CC 3IKJA 3A8IE 2BDOA 3M4YA 5BN3A 1DD2A 3OOCA 1VCIA 2BE5C 1H9KA 3NE5B 1Q12A 2DNCA 3A8KE 2D62A 5C0XH 1Q1EA 1DXMA 2BA0A 4BA2I 2KCCA 1LACA 2A6EC 3H94A 3ND8A 1E2WA 2PNRC 4H0LC 4GZYC 1V43A 4KKSA 4XIGS 4LJZC 1GHKA 3I4LA 1FR3A 3VA7A 2F1MA 3FPPA 2L5TA 3D31A 3QJYA 2E76C 4KKUA 2AWOA 1O78A 1ZYRC 3FMCA 1Y69U 5KNBA 4G7HC 1GHJA 1A6XA 2K32A 3L7ZC 2A68C 3T56B 1VDZA 1SMYC 5KNDA 1BDOA 1OXVA 1IYUA 3EQLC 3A8JE 4RCNA 3VR3A 3PUZA 2QF7A 1ZKOA 1IW7D 2CW0C 2YYZA 2B8FA 2Q8IB 1H9RA 1OXXK 5KNCA 2K7VA 3BDOA 1H9SB 3OW7A 2V4DA 4KI0A 2NN6I 1TKWB 4TKOB 2BA1A 4DNTB 4TQUS 1GJXA 1Q1BA 3PUWA 1IYVA 1Z6HA 2O5JC 3PV0A 1Q90A 2LMCB 2E75C 1CI3M 2AUKA 1K8OA 2JEBI 2NN6G 1FYCA 5K36G 1V8QA 2A6ED 3WDNA 3VR5A 2IT1A 1OXTA 1GUNA 3VR6A 4IFDG 3I72A 3U9SA 4LK1C 3D4RA 2E74C 3IFTA 3PUXA 3AB9A 2EJFC 1GUSA 1YNNC 1LABA 2BE5D 4H13C 1HCZA 1QJOA 3LNNA 1Y8OB 3T51B 1PMRA 1YNJC 2AUJD 2K33A 4I7ZC 3ND9A 2PCFB 4JBWA 4KKTA 4XTCS 5BN4A 2A69C 2DNEA 1GUOA 4G7ZC 4OO1G 2NN6H 1K8MA 1VF5C 4G7OC 4DK1A 1T5EA 3VR4A 2PPBC 1Z7TA 1B9NA 3QG1A 2JEAI 1EWHA 2JE6I 1CTMA 3M7NA 3RLFA 1GUGA 1Y8PB 2O5IC 3LWUA 1O7LA 3A7AB 5JEAH 3MXUA 3VR2A 1ONLA 3QIAA 5C0XG 3MFYA 4DK0A 4KHZA 1H9JA 3PUVA 1TU2B 3I73A 1GUTA 3TZUA 3GQBA 3KLRA 2EJGC 3N6RA 3OPOA 4KN7C 2KA7A 1B9MA 4H44C 1VF7A 3A7LA 2A6HC 3W3AA 2ZT9C 3HGBA 3M85A 4KMUC 4BA1I 2EJMA 1H9SA 4DNRB 1DCZA 2EVBA 2DN8A 5JEAG 3DXJC 5K36H 3P20A 3SDZA 4IQZA 4IFDH 1E2VA
chains in the Genus database with same CATH superfamily
1SMYD 2Z0SA 3ULPA 1Y8NB 2L1BA 4YCUA 2VS1A 1CZWA 1JCKB 3Q8DA 5A35A 4FXKC 4LF7L 4HSVA 4JI8L 3FRPB 5CBAE 4PG3A 4HCSA 4LWCA 2NUCA 3DMUA 3IKJA 4R4CA 1VQNA 1J8IA 1I50B 5IODA 2N55A 3ZJYC 4ZRZA 3MTSA 4H0LC 4DV6L 4A3CG 1PTOB 2MPMA 1I4RA 5BR8Q 1VQ5A 1A3TA 1XPUA 2E76C 3E6ZX 1G2TA 5IT9L 2N88A 1Y69U 1B4OA 4ILWA 3HOUH 3CCLA 1D1KA 4IJHA 2A5HA 1KAWA 2KVMA 4H02A 2Q8IB 4P72A 3Q0AA 2XWJB 4DAYB 4ZYSA 1YNXA 1SYBA 3J7A5 4A3DG 1UE1A 1PH2A 1WTHA 3DM3A 5IP7H 4DV6Q 2JEBI 4X65Q 1YI2A 1LO5D 2PMZB 3C46A 4LFAL 4K2LA 2WIIB 4A3FB 1X3PA 4OO1I 1RDPD 2ZTCA 3S9WA 3PUXA 1YNNC 2EYHA 4R4TA 4BBRB 3LX0A 5EBCA 5ELOA 3HOWG 1SROA 1Y8OB 1EWIA 2Z4IA 2NN6H 1NJIC 2RCNA 3NBHB 3SK6A 4DR7L 5GROA 1NR4A 2CVRA 1EIYB 3CCSA 2PZUA 1UNSA 1TS3A 2NTTA 5J22A 2QDBA 1RKNA 4OWXB 5C0XG 2YTYA 3BDCA 3J81c 3I73A 3GQBA 3H0GG 1JC7A 2QEJC 1SE8A 1B9MA 1HXYD 1WYDA 2IL8A 3S14H 1GUWA 2R7DA 4IUTA 2EJMA 4X66L 4YWLA 2NVXB 3UDIA 2NZOA 3TP5A 4UY8C 1WTXA 3MHBA 2B8GA 4B08A 1SE4A 3EFXD 5IWAL 1HJPA 1PXUA 4BY1G 1W2BA 3KLSX 4B3TQ 3H3VI 2A68D 2D5DA 2K05A 2UUCQ 2WFWA 3N52A 4FF2A 5BN3A 2Q8TA 5M9OA 1KLUD 1MBYA 2FXQA 4LF4Q 5BR8L 3L3OC 1SE3A 1EY7A 5C3EB 1EZ6A 5JJZA 4LF8L 4MTKA 3TP8A 1QVCA 2PZWA 1O7IA 3EN2A 3FKIG 3HFZB 1BCPD 2F0VA 4G7HC 1L1OC 4JI7L 3I56A 1TY2A 1PYBA 3W5OA 3I4MG 4BBRG 1YHQA 1DYQA 1NE3A 4OEMB 1I3QB 4DA2A 5M5XB 1OTCA 4DV5Q 4DR2L 5IYCH 1EIGA 1I4GA 1AZPA 4TQUS 1LT6D 5IGFA 3E3XA 4BXXH 4DV0L 1BCPC 4QMGA 2RKSA 1TWFH 1EOTA 2MQHA 3I2ZA 1QUQA 1QJOA 4XYQA 1I4HA 5M5WB 4V0BA 1K8OA 1IL2A 1LTBD 2X6GA 4DV1Q 2ASBA 2DNEA 1WD1A 1QG7A 4B3MQ 4IALA 1HQRD 3K5MA 2JA5H 2OF1A 1U4RA 5FLXL 1EY5A 3QG1A 3CMEA 2EQSA 4PZ7A 4HMIA 4RHRA 4HJ7A 3A7AB 4ZAIA 2QDLA 5IGEA 1ET6A 1Q8IA 2HUGA 2NVXH 1PRTD 1WCMH 4A3IG 1AH9A 3OPOA 2EOTA 4ZK9B 2EE1A 4XT3B 4QB4A 4FXDA 4JI8Q 1TWCH 1R9TB 1DCZA 4I7AA 1I94L 5C5MA 2BH8A 1B3AA 2B63H 1IYVA 1S5BD 1F2YA 2DY7A 5T1GA 4JI5L 3T53B 3CP0A 4DN4M 4HR7B 1SSOA 5FO7B 5K5PA 5E4XA 1MHWC 4JK1C 4YY3Q 2EY6A 3HOVB 1A15A 2M00A 1VQEA 1PH3A 1PFSA 1VQGA 2DNCA 1WFQA 3BVMA 3CC4A 1DXMA 2HIVA 4P73A 2KCCA 2J0TD 1BBWA 2FMCA 5CYUA 2I5MX 1VQ4A 1NTGA 1GHKA 2CWAA 1E24A 3FPPA 4NPSA 5IYBG 4CHTB 1CSQA 2F0IA 3R8BA 3DWPA 2R61A 1AE2A 3H6MA 3OHXC 3GDEA 3M4PA 4OWWB 4WJ4A 5KNDA 4DR5Q 4DV3Q 1JJGA 2UUCL 4HEDA 4C3HH 1AW7A 4LNQA 3P7JA 1R4PB 4C1NI 4OIJA 2K7VA 4A3JG 1YJWA 2VQEQ 1K83B 1ZYRD 5KYIA 4RCOA 2F0JA 3RUZA 2HHHL 1CZGA 4NXML 3PUWA 1MJEA 1SEBD 3NWSA 2F0PA 1X3EA 1GKHA 1PTOC 1VQ8A 2K4KA 2RF4A 4A3GH 1STEA 3TP6A 2KHSA 1Y14B 3I72A 1ML0D 1FVIA 2EJFC 4L5RC 3NQIA 4A3EB 3I4NB 3LNNA 3I70A 1XWEA 3ND9A 2K14A 2IW3A 1KTKA 3S1NB 1VQMA 4B3TL 1STAA 2PMZE 4EGVA 1SBBB 3PSIA 1HR0W 1DJRD 2F0MA 2RSOA 3NK9A 2L12A 1WTVA 5M5YH 3NUCA 5IT9c 3K5NA 5C4JH 4GN4B 4KHZA 4LF5L 5JVH3 4DUYL 3CCJA 4RA8A 4TRDA 4LFAQ 2PZTA 3S2DH 4EQ5A 1X6OA 4GN5A 3U4ZA 2YU9B 1EYDA 4IQZA 2EY1A 1LT5D 4A93B 1ILPA 1SDFA 3DWQA 5KYLA 2SNMA 2F52A 3PO2H 3CCQA 2WAQE 4IJLA 3TRZA 1SNPA 3GTLH 1M1KC 1AZQA 2OXPA 3KLSA 1MSHA 4LAAA 3GTOH 1CKOA 3RMHA 2EY5A 4PV1C 4JI2Q 4F8MA 4B3SL 2F0NA 4K5VA 3S1QH 4AYBG 2D62A 4ZUJA 2PYKA 3MXPA 1U4PA 2Q2TA 3PIPA 5ELNA 3Q22A 1VQ6A 1W3SA 2R92H 2ID0A 2F1MA 3NQTA 2VZAA 2EIFA 1O78A 1RTOA 3KJOA 1SNCA 4CJ1B 1UAPA 1VQBA 2KEDA 5FO8B 3S1MB 2QW7A 1KXLA 1X32A 3M9BA 2JA7H 3I4MB 1C9OA 3PUZA 4GKJL 1IW7D 2UU9L 1IHZA 3JAML 4DR4Q 1S3OA 1G8ZD 1B3QA 1FGBD 2EYMA 1VQCA 1B1ZA 2LXKA 3RNUA 4HSPA 2DY8A 3TBIB 3CCEA 1D5XC 3HOUG 2HCCA 1GVPA 2VL6A 4DXGA 2LMCB 1QE6A 2A74C 2QKIC 3IRBA 1TWCB 3DLLA 1STNA 2AUKA 1R9TH 5K36G 1BBUA 3VR5A 1KDCA 1GUNA 2B63G 3H09A 4LK1C 4C2MB 1QVGA 3JAME 2PQEA 5IP9H 4P74A 2AKWB 1PMRA 2K33A 4DR6L 1K3RA 1STHA 2CQOA 3PIOA 4A3KG 1YHAA 5C4JB 5M3FB 3HOVH 3HOXH 2IHEA 4EQPA 1Q86C 2Z6KC 1LUZA 3BVZA 1PH7A 4JG2A 4O2DA 3A56A 1E7ZA 2O5IC 1ICWA 2F0FA 1UE7A 3RN2A 3S16B 2JP1A 3MFYA 1C4QA 1H9JA 5D3DA 4A3IB 3BJUA 1AEXA 1N36Q 4PMWA 4KY5A 1D5ZC 2IT1A 1E2VA 4LFBL 3VYRA 4LMQD 3T13A 3RR5A 3J80E 2IPKD 1U0LA 3CRKC 2KECA 4CJ0B 3E5SA 1L0WA 1A62A 3FDTA 1LTSD 1OXSC 2E2IB 1IXRA 2R6GA 2FFKB 4MIUA 1QCBD 1DD2A 1HFGA 5C5LA 2NYZD 1AN8A 2LXJA 2MO0A 1HTLD 1TXYA 2VW9A 4BY1H 2F0QA 5JEAJ 1Q1EA 1XTCD 3AQQA 5GQOA 3GTKB 3I90A 3PQIA 1E2WA 2EZVA 4B3ML 3CHBD 3Q6SA 2ZJRA 4AYBE 2ZM6L 1WTOA 4IUUA 2JA7B 3FEWX 1PYSB 1HNXL 3OIPA 4JBKA 1XTDA 3R93A 5I2YA 4I65A 4L5SA 2KCTA 1QWYA 2KHJA 4OWTB 2TMPA 2KOLA 1PTOF 4FNFA 5ISRA 1A63A 4OONA 1L1OA 5E3FA 3GV6A 1IYJB 5GAHC 2IX0A 4IPHA 1PZKD 4Q5VA 5M5YB 3FKIH 3NBHA 5C6AA 1YVCA 1AP0A 1HA6A 4KI0A 3CCRA 4E6IA 5H1SE 1PH9A 2O5JC 2A19A 3EROA 4RKLA 4JVZA 2I5HA 3K0XA 2FHTA 1I6HB 2F3IA 2VXWA 1JB7A 3NELA 3D4RA 3ONAB 3TN2A 3KFUA 1PFBA 4C1NK 4DR3Q 3VYUA 2A73B 5JAVA 4KKTA 3RZDH 3PO3H 2R7FA 1VQDA 1XMOL 3S16H 1L0XB 1WD0A 4IOAA 4QJFA 4F88A 4G7OC 2Z6KA 1SNOA 4QUFA 1G6PA 5DM63 3RLOA 4OL7A 3DEOA 3OMGA 4BY7H 1EIHA 1O7LA 2Q2UA 1DZ1A 5HGTA 1N33Q 1CA5A 3GTQH 3H0GB 4BS9A 5J1ZA 4FF3A 3K7AB 3W3AA 1B8AA 2F0KA 4OELB 2PI2E 1WCMB 3WWVA 2ATWA 1VMPA 2UUBL 1M4VA 2JA8H 1U4LA 4A3EH 1E2ZA 1N8RC 5HY6A 3ERSX 1V9PA 4MNOA 1VMCA 1EL0A 1FD7D 4RFBA 5CV7A 2NVQH 4ZKBB 4L5QA 3SE0A 5D65A 2MNAA 1SXTA 2HCIA 3CCUA 4QQBX 2JYOA 2ZXPA 2OEOA 3X3NA 1OO9B 3ER0A 1VQIA 2UXDL 2AQ1B 3KJPA 1JWUD 4U673 2QEXA 3OWFA 1SJHD 4RG1A 4OIKA 2L5TA 4QL5A 1ZYRC 1EU4A 2K6AA 4FXGC 4QIWE 2K32A 3HOXB 5IGCA 1SMYC 4NB3A 1CA6A 4YCWA 2XRQD 3VA5A 4A3CH 4L5TA 3EQLC 2NTSA 4DV2L 5IYDG 1UE5A 4IURA 1EWCA 4YHHL 4DR5L 1H9SB 1JQYD 3NEMA 3AU7A 1TKWB 1HNZQ 1X56A 2E5LQ 2PO4A 3I91A 3I7FA 1EYCA 3HOYB 5DAUA 1VQAA 5TSSA 3PO3B 1CHQD 2Y0SB 1T5XD 3HEJA 2CKZB 1EIFA 2L55A 1OXTA 2F0UA 3A0JA 1E3PA 3D0FA 3NWTA 3I55A 1AFPA 2E74C 4JOIC 1J6QA 2BE5D 4F87A 1PA6A 3E0EA 2AUJD 1Q7YC 1SYEA 4JI3Q 2VNUD 4G7ZC 2EYOA 2RDHA 3D3RA 1B2TA 1SAPA 5DM73 5C4HA 1S5CD 5FK9C 4HJ9A 4RGMA 3K7AH 4KY6A 2M9VA 3HOWH 2F3VA 1LTTD 1KRTA 4JI6Q 3D8GA 3WOEA 1XYIA 3E9HA 3BZKA 4WFN3 1HRJA 4DF7A 4GN3B 2EXDA 4CKBA 3JAMc 2PNHA 1HR0Q 2H5XA 1PRTC 2K50A 3U9SA 3P75A 2KHIA 2TSSA 3G71A 1X9NA 1GD7A 1F9RA 1XXGA 3BZCA 3BG3A 1G291 1DOLA 5AJ3Q 2BCOA 3S2DB 2JXMB 4RGNA 4OO1H 5LMNW 5JVG3 2YU9H 4HIMA 2BH2A 3GD7A 1HTPA 2RHSB 1B50A 5M3FH 1HPCA 5C3EH 2L4NA 3J81j 2UXCL 4C56C 3NBIA 5IT9E 1WTPA 2JJQA 3T16A 4HJ8A 3O13A 4A3LG 1H9KA 5CC4A 4CGYB 5IE8A 4XQNA 1IBKQ 3OMCA 2M2LA 3A8KE 5T1IA 5KIXA 4JI3L 4ZQ3A 1HH2P 1WTWA 4GKKQ 1IBLQ 1M90C 4JI4L 1PRTF 1WCMG 2Z8LA 3K8AA 3L0OA 5C4ZA 1EZ8A 4PNYA 1L0YB 4X64Q 5LMNL 3H3VH 3A55A 1J9OA 1VQOA 2VUMG 3QJYA 5KRUA 3C1EA 4RWSC 3A5UA 4BBSG 3H91A 3FHWA 2H4OA 1IL8A 2Y0SG 3BYTB 5C4XB 4DV5L 5I6YA 2PQAA 3G7LA 2QF7A 3D4DA 3K5OA 4HIKA 4BY7G 3K7UC 4DFAA 4UAIA 3C2PA 3BDOA 2B2VA 3HZXA 2F0LA 2XN9C 1UE6A 4HIDA 4ABNA 2KUMA 1TS4A 4IPGA 4HAEA 1U5KA 3R3OA 2I46A 2PQAB 3CC2A 1RIPA 3W1BA 1V8QA 2KEEA 3BYYB 1N32L 3HRZC 1B7YB 1K0SA 4JV5Q 1PVOA 4C3JB 2JA8B 4H13C 1YZ6A 2F0DA 1EY9A 4GNXA 3MC0B 1FNVA 1SYDA 2NVQB 1VQFA 3KBXA 5FLMG 2WB1G 5IGGA 3GTJH 5FJ8H 2PPBC 4C2MH 1JOQA 3S15H 4AIMA 1D2BA 4NP5A 3M7NA 1Y8PB 2F0TA 3MVVA 2DGYA 4H7BA 2UUAL 4A3JH 1KDAA 2NB0A 1YITA 2IX1A 3HOVG 3L9AX 4A3MB 1PHJA 4CBVA 4A3DH 1TWAB 4HMJA 4X66Q 3WOFA 3H3VC 2ZT9C 3S17H 2E2HB 2SNSA 1X55A 2K5NA 3G4SA 4CKEA 3U4VA 1FJGL 4G4KA 1HZ9A 4NKLA 4EX5A 4A3IH 4FVMA 2RQXA 4ZCKA 1KD1C 3AFPA 2WB1E 1CFMA 5A2QE 3CMAA 1I4PA 2FMMA 2C35B 1F9SA 3M4YA 4KHPQ 5E4WC 2HT1A 5C0XH 1HFNA 2CFMA 4DV7Q 3CAMA 3ND8A 1TWFB 3F1ZA 3SHLA 4MN3A 2FJ2A 3B6YA 1FR3A 3VA7A 2F0HA 4YCVA 4ODGA 3X3MA 1I50H 3KOJA 4FP5D 2F0GA 5IGDA 1KABA 2ZJQA 2XIWA 5CR3A 1A6XA 2IJ0A 1JT8A 5ELCA 5FO9B 1A2UA 2JA5B 3HOXG 4GS3A 4AQYQ 4MTNA 1IYUA 1EEID 4M8AA 5JJKA 3A8JE 2EY2A 2OQ0A 3SEBA 2Y0SE 2RBMA 5IYBH 1OXXK 4X3SA 3A54A 2I07B 3OW7A 1ENFA 3HOUB 1E22A 1F9PA 1ICFB 1B70B 1EY6A 1TIID 2AHOB 1Z6HA 2KQ3A 1VQLA 4CKCA 1HUMA 3OIQA 2B2YC 3PGZA 2KJXA 5FLXc 1EFID 2B63B 3Q23A 4B3RL 2KENA 1UWVA 3S15B 2AQ3B 4DR7Q 1QUQB 1ET9A 1JE5A 3KYHC 4QIWB 4JBWA 1D8LA 1CK1A 2HDLA 3EBEA 1VF5C 3VDYA 1RTNA 1EQVA 3PIP3 1PLFA 4NMZA 1TR5A 2QILA 3OSOA 1TS2A 1HZBA 3VR2A 1I3QH 2KCMA 4JI0L 3K80C 3A74A 4N9TA 1BO0A 4A93H 1CM9A 5I9OA 4BWGB 1EY0A 2A6HC 4S3SA 1QILA 4Y7NH 5JPMC 1JMCA 4XXEA 2EVBA 2DN8A 5LL6S 4M1UB 4BBSH 4DUYQ 2CH4W 3GTQB 4KTAA 3NPPA 2VB3X 2OQKA 4LUZA 4KY7A 2J4XA 3QOJA 4LF6Q 3RZOB 4L8JA 1JB3A 3STBC 3Q24A 3M3YB 2B2UC 3E0JA 2K03A 2D2CC 2R92G 4X3UA 3EA6A 3OOCA 1VCIA 3F8TA 5F2DA 1KQSA 3PO2G 4WJWA 3RN5A 4NW2A 1XPOA 1BF4A 1C8CA 2G9HD 4R4QA 1CKNB 3MA2B 2A6EC 1YNJD 2PNRC 4JYAL 1LT4D 4GZYC 4KKSA 2N3SA 1VQJA 3D4WA 4XIGS 3OTOQ 3I4LA 1BXTA 2NBFA 1QNUA 4J6HA 1V1OA 5FLXE 3CU7A 4KK7A 1SYGA 2R7ZB 4O0AA 3R2IA 4N8X1 2OCEA 1Q3LA 4GLVB 2E2JH 3CXCA 4RCNA 4DR1L 4FF4A 1Y1WB 5FKAC 3HOZB 4IUQA 3MXGA 1WJJA 1SR3A 4JBJA 2F0WA 3NTHA 3J81L 1DOMA 4JI1Q 2E2DC 5C44H 1Q1BA 2B2TC 4J8QA 2E75C 4FO2A 2E2HH 4JYAQ 1CI3M 1C0AA 3SXHA 3VR6A 1C7YA 3C1FA 4DNIA 3MEHA 2F03A 4IN3A 1A3UA 1ENAA 1GUSA 2B29A 4C3JG 1HCZA 1EEFD 4EVOA 4A3EG 2JA8G 3HOYH 2PCFB 1GUOA 4KD4A 1T9HA 1LLRD 2D0PA 1EFWA 3GTOB 1QNKA 2J7ZA 3HG9A 3G6JB 3MWYW 1GUGA 3GP7A 2E8GA 4RGOS 4HN7A 4PMCA 4ZLTF 5I6WA 1CHPD 1L2FA 1TY0A 1I5FA 3SGIA 4DV2Q 2CW0D 4GOPB 2NZ1D 1DGSA 1YBYA 1H9SA 4DNRB 3TQYA 5EPJA 1KNEA 5I2XA 1X54A 3KF8B 3EVQA 3NP8A 3MAQA 4A3BG 1HQMC 1P16A 2LFNA 4BY1B 4DV4L 3OWEB 4QY7A 4UP8A 1TWHB 2NVYH 5LMUQ 2IHFA 2VB2X 2RVLA 4LF8Q 4IUNA 2RDGA 3AMUA 3G6EA 3M4OB 1PH6A 4DR6Q 1Q12A 3AFQA 3UDXA 4UPAA 1PYWD 3SR1A 1VQKA 1XMQQ 1XNRQ 1BCPB 3J80i 3URYA 2F4VL 1D1IA 4DKAC 1X3GA 1TWAH 5DEHA 4K5WA 3CQZB 1K8AC 4A3LH 4DK6C 3ITPA 1HA5A 5EQ0A 4A75A 1Y1WH 5EKIA 4LF6L 1GHJA 3F2BA 3L7ZC 1FL0A 2DJGC 2K01A 4IZ8A 4Q0FA 2K5QA 1F77A 2SDFA 4K14A 4DR4L 3VR3A 1ZKOA 4HIOA 2F3WA 1L1OB 2G5DA 4IUVA 4GNXC 1H9RA 3S24A 2PI2A 2HD3A 1FNUA 5C4XH 4DV3L 1GM5A 1EQRA 4XDXA 1NMFA 4B9WA 4P2CB 3S1QB 3D6CA 3W2DA 1SNMA 5C3XA 3UDFA 5D3IB 1KLGD 1EQTA 5J39A 2N49A 2XRSD 1LABA 1B53A 1CSPA 1KDBA 3NSWA 4QF4A 4TVAB 3QO2A 3T51B 3CD6A 4I7ZC 2A69C 1LTGD 3K81C 2IWHA 5M3FG 2E2IH 3OTOL 1XNQQ 4OX9L 1Z7TA 2LS01 2MO1A 3I4NH 1S5ED 3RLFA 2O4XA 5EAYA 5EJWA 3LWUA 4DAMA 1ILQA 3TDQA 3MXUA 4GOPA 4LF9L 3DEPA 5IGBA 4JOIA 1GUTA 2LSSA 4X6AH 4KN7C 2KA7A 5M3MH 3A7LA 1QZGA 2RSNA 2VUMH 4BA1I 4K6LA 5K36H 5GADC 1XJVA 3P20A 5J3BA 4P71A 3UE0A 3NXWA 5EKKA 4DUZQ 2MHVA 4POFA 2F4IA 1IW7C 5IP9G 3OYYA 4K0KQ 4A3KH 3NTKA 3F2DA 5GAGC 1E1OA 4XT1B 4DV7L 1JJCB 3A8IE 1STGA 2EXZA 1SYCA 3TP7A 3NE5B 1XMOQ 1I6HH 4TSSA 4U68A 5G3LF 1JORA 1SE2A 4CDEC 4FDBA 3CPWA 3HOYG 1XMQL 2UUBQ 1XNRL 1IBMQ 2JA6H 4Y7NB 3JAMi 4DV0Q 4QCLA 3V2TA 3CF5A 4K6DA 2Z6BA 4FYDA 4RKBA 1VDZA 2ZXOA 2KBNA 1J5EL 1BDOA 3A5ZB 1OXVA 1D6EC 4BY7B 3RZOH 3JC66 5IY0A 3J7YW 2B8FA 1IBML 3HOZG 3CPFA 2V4DA 1S72A 3BVGA 3KDFB 1BQQT 1Q46A 4RGTA 3S1MH 3S14B 3I4OA 5CV8A 1EOVA 2Q2HA 4LF5Q 2ZTEA 2ZTDA 3SK4A 4A3FG 1X65A 1JJ2A 1CKNA 3ULLA 3MXNB 1PTOH 1Z9FA 5DLQE 2QA4A 3FVQA 1PDQA 2YTVA 3T1HL 3PCOB 1NCVA 1YNJC 1RL2A 2ENBA 2KCNA 5GAEC 4IFDI 1WTRA 1VS0A 1K73C 4ULLA 5LL6X 1CKMA 3VR4A 3NHHA 3L2PA 1Y1VG 1DOKA 5M3MB 1EWHA 4LF7Q 2MGSA 3M7GA 2UXBQ 2MFIA 4AH6A 2GN5A 5JEAH 5HGQA 2D9UA 3I3CA 4XQJA 1HUNA 3KLWA 1ASYA 3DM1A 4C3IG 4A3MG 1JICA 3GO5A 2B2WC 2WV6D 4H44C 3S1RH 2UU9Q 4LF9Q 5D14A 1EQQA 1VQ9A 3HGBA 1S4ZA 1HZAA 1JR0D 3AEVA 2QCPX 2A6HD 4A93G 5JPNC 2HDMA 2SOBA 1PRTB 1R4QB 2XGTA 1SN8A 1GXDC 1JWMD 1OXUA 1N36L 3RZDB 3PUYA 2B2UA 4BBSB 4N9PA 4IPCA 1HZCA 4X3KA 5FJ8G 2A69D 1IBLL 4JI4Q 1UEAB 2BDOA 1KRSA 1K28A 5JJLA 3C3LA 1ENCA 4X62Q 2MJ8A 4AYBB 5CV4A 1FGUA 1LACA 1PH4A 1V43A 4LJZC 1IBKL 3T1YL 3EJIA 4C3HB 3CC7A 1LTRD 1NNXA 1X3QA 3ICEA 1M8AA 1K83H 1DONA 1ZXTA 3V96A 5DNFA 1LTAD 2NZHA 4JI1L 1V1PA 1HR0L 3HOWB 2WINB 3CKIB 1CQVA 3K5LA 2R7ZH 4K2KA 2F0SA 2RHQB 4DR1Q 1EYGA 1S5DD 5M3MG 1PH8A 4O42A 5FOBB 3PMFA 1FYCA 2Q2IA 3T1HQ 1Z47A 1WTQA 4IFDG 2R3ZA 4V190 1ESFA 3CCVA 3MFGA 1QB5D 3NTIA 2R93H 3HKSA 4P75A 5EKLA 2P5ZX 1CUKA 2WP8J 4A3DB 1SNDA 3UE1A 1UUPA 5IYDH 4ZKCB 2Z9HA 1G2SA 4XQQA 4K5XA 5FLMH 2LY7A 1JE4A 3TZUA 2F0EA 3N6RA 2G9DA 3J80c 2C9OA 2XVSA 4LUOA 4A76A 1YJNA 2MP1A 5C3WA 5IOCA 4DAPA 5HURA 4KMUC 1JOKA 4GLXA 1QZHA 4JI0Q 2JQOA 1Y1VB 2I5LX 3HS0C 2CHBD 1VQ7A 3CCMA 3AYHB 1AE3A 5NUCA 3CRLC 4KN4C 1YIJA 4GKKL 4A4IA 3GTPB 4C3IB 2UXBL 2V1CC 3ULJA 2UUAQ 4DPGA 2FINB 2GA4B 2K5DA 2AQ2B 1S5FD 4L63B 4PZ8A 2B2VC 4CDFC 5CGKA 3K6OA 3J81i 1KAAA 3H15A 4R8IA 1QVFA 5C0XI 2VUMB 2AWOA 1KNAA 3QOLA 4MZ9A 1WI5A 4DV4Q 1E1TA 4JW0A 4IUPA 4NXMQ 3IFDA 3DUZA 3BS1A 4IFDJ 3TS0A 2JA9A 2IY5B 4R4IA 2CW0C 2WAQB 1TQOA 3ZYYX 1I4XA 5C3EG 4A3JB 1SMXA 4HJAA 3TSSA 3SK8A 3F2CA 4YHHQ 3KF6B 4JC0A 1S40A 3S17B 1V1PB 2IX3A 4X3TA 4L6TB 3T1YQ 5M5XH 3BU2A 5L37A 4UHVA 3WDNA 2D0OA 1JWSD 1YHBA 5CV9A 1PFNA 3I4NG 3S2HH 1D7QA 1KIXA 3RLNA 2ICEC 3G48A 5ELDA 5EPKA 4R1JA 1G51A 2OTLA 5BN4A 4G57A 2C5CA 3W1GA 1K3BC 3QR8A 5IIFA 1C48A 3SK5A 5G3LD 2BDNA 3PIO3 1CTMA 1KHIA 4Z9CB 1F2LA 1N9WA 1PV4A 1TT2A 5M5WH 1YNND 2EYPA 1V1QA 1SRUA 2VQEL 4POGA 1RODA 1ONLA 4DK0A 2UXCQ 2K28A 3KLRA 2EJGC 4HTHA 3TMEA 5C44G 5A2QL 2MUYA 2R92B 1VF7A 4DUZL 4APVA 2F0OA 2RCFA 5IP7G 1NBWA 2CH4A 5LHY1 5AJ3L 4KHVA 3U58A 3I8ZA 3SDZA 4J15A 5KNBA 1K8GA 4YWKA 2XNAC 4C3JH 2EDGA 2XSCA 4A3BB 1I6VC 2OWOA 3DHQA 3J7AF 1CQFA 3K57A 1HNWQ 3TREA 1HHVA 2R7ZG 1BUVT 3TZDA 1STYA 2PW5A 4OGQC 5JJIA 5LMUL 2ICIA 1E0BA 3SVMA 2ZM6Q 3KK7A 2ES2A 2WAQG 4PMBA 4DK3C 2O2LD 4Y52H 3KBGA 4IO9A 2RA4A 1O7YA 4JI5Q 1N34L 4R9WA 2EPBA 3HOZH 3FKIB 2AWNA 4KV6A 2K5HA 4DXFA 1BCPF 5I9PA 3FPUB 4DR3L 2R93B 1LV9A 2JA5G 4CDCC 2YTXA 4N8FA 3HKZB 5JOBA 2A8VA 1X3FA 3PO2B 1EUJA 1MIUA 2L11A 3KUPA 4MHEA 1EU3A 2Z4HA 1ASZA 1H95A 1NMGA 4UP7A 4LFBQ 3J80L 4TKOB 1A8VA 2VQFQ 1A0IA 4DNTB 1LM0A 2JN4A 3S2HB 1IKLA 2PW7A 2XTIA 4PQXA 5LMNQ 2GVAA 2B2YA 2K5VA 5E1FA 3MZ5A 1BBXC 2NN6G 4JBMA 1RJTA 4IOCA 2OTJA 2DUDA 1TWGH 1QOHA 1EY4A 2WKCA 1EY8A 2B39A 3K58A 2Z1CA 4XTCS 4LFCQ 1PH1A 4LF4L 1YEZA 4C3IH 5CV5A 3M3YH 1TS5A 2CQAA 4CDDC 1UEBA 2JK8A 1B9NA 2B2TA 4EQNA 3VYTA 1HNWL 4J1MA 5COYA 5KEEA 1VQPA 4ALPA 1JOOA 1SFOB 3S1NH 4PZ6A 4JCVE 1K9MC 1N32Q 2L15A 1SYFA 4K8IA 4IPDA 1PTOD 2LKVA 2ALYB 3NENA 5EBDA 2JA6G 5JEAG 3DXJC 3KF6A 2BOSA 1MI2A 3LWEA 2HHHQ 2YV5A 4A3MH 2NVTB 1SJED 1BKBA 5E7NA 3S1RB 1J5EQ 5ELFA 3KF8A 2H1EA 4NXNQ 1H9MA 4QGUA 4DGZA 1EYAA 4ME3A 1IKMA 2L9HA 1NR2A 4NDXA 1MJCA 3HKZG 3CQZH 2A1AA 3TEHB 1SLJA 4LFCL 1Q82C 1MKHA 3GTGH 3OW2A 4A3GG 3H94A 1Q81C 4RH6A 3PF4A 4JPBW 3T4AC 2VY3A 1A2TA 3LGJA 4F7XA 4DAYA 4BBRH 4UDUC 2JA7G 2N78A 3D31A 4GOPC 3U50C 2CCZA 4GLAC 3BZDB 3FMCA 4GKJQ 1GOZA 4B3RQ 1GO3E 1I4QA 3MXNA 3J7ZC 5C4XG 4DR2Q 4K0KL 1LTID 4HJ5A 3DWAA 2E5LL 4BXXG 4YY3L 5ELEA 2NWGA 4X65L 1Y1WG 1FNWA 1FJGQ 1RHPA 3K0YA 2Q8RE 3GTPH 3KDFA 4WORA 4JI7Q 1A3VA 4DU9A 2NN6I 1RD9D 2K1BA 2BA1A 5EPLA 3ERQA 1TWGB 3I4MH 3IAYA 1Q90A 4LUVA 2HIXA 1II3A 3GTKH 1IZ6A 1N34Q 4B3SQ 2OT2A 3QWNA 1NAPA 5IYCG 1W6JA 3AB9A 4OX9Q 3EIVA 1XNQL 3GTMB 1P8LA 1RF2D 2EYJA 2UXDQ 2WB1B 1K8MA 1XX8A 3TS2A 1U9RA 4DK1A 1T5EA 1ESRA 1TVXA 2K52A 2EYLA 2HQEA 3V05A 2B3GA 4ZUIA 2X69A 2K75A 1F2ZA 1PZJD 2HQLA 5CV6A 1RCVD 1PH5A 2SEBD 2ZXRA 1TU2B 4O1NA 1YJ9A 5C44B 1WOCA 1F9QA 4JI6L 1CT1D 4A3KB 5KGUA 4DAVA 1HNZL 2WKDA 3UDGA 2I0QA 3CW2C 4B9XA 1MD2D 2X6LA 1BVSA 5EGTA 3VYSA 5BN5A 4WJ3M 1G6ZA 2JSOA 3J81E 3MEFA 3GTGB 5CMDA 4KHPL 3GV3A 3PF5A 1Y1VH 2DJFC 2BE5C 4RMFA 4X64L 2B2WA 5CORA 3HP3A 4JI2L 2JA6B 4R4OA 1NUCA 4RHSA 2F4VQ 1O7ZA 2BA0A 4BA2I 3RD4A 1F2MA 2CWPA 3F2UA 3H0GH 1XPRA 1MGSA 4KD3A 4C3HG 4OHJA 3P1HA 4KKUA 5CBEE 4ME5A 1BOSA 1O80A 4JV5L 1G91A 4NXNL 2VQFL 1VQHA 2A68C 4HCEA 3T56B 2R93G 1STBA 4WRDA 4A3BH 4YIJA 4UP9A 4XYOA 2YYZA 1NSNS 4A3GB 1TWHH 2NVYB 5KNCA 1SFOH 3FP9A 1PFMA 2ZJPA 1LT3D 2E2JB 1U4MA 1GJXA 4AQYL 1LTLA 3M4OH 3R2TA 3UI2A 3PV0A 4KJNA 3GTMH 4KLKA 3PO3G 3IL8A 5AFWA 2K04A 2A6ED 1N33L 1HNXQ 3GTJB 4KJOA 2NVTH 3HKZE 3IFTA 4R8NA 1KL9A 4ID6A 4DV1L 2WACA 1DM0B 4K8JA 3U9OA 4X62L 4OO1G 3J7AV 1BR9A 1PZID 3STBD 4A3FH 4EQOA 2RDFA 4GNXB 5IWAQ 1Q8KA 2JEAI 2JE6I 3BDLA 1K0RA 4OXPA 1WVLA 4YWMA 1MSGA 1I94Q 1B44D 3M4QA 2K5WA 5C0XJ 4QUCA 2EYFA 1ZEQX 3QIAA 2L0CA 4CJ2C 2XWBB 1D5MC 3PUVA 4RAUC 2QGQA 4FF1A 1KC8C 3K59A 2AMCB 1LYLA 4LW1A 1BNZA 2GVBA 5ELBA 5I4DA 3QB3A 3M85A 3GTLB 1NY4A 2N8NA 3D6WA 1SNQA 1W6KA 3E9IA 4IFDH
chains in the Genus database with same CATH topology
1SMYD 1Y8NB 2L1BA 1CZWA 1JCKB 5A35A 4FXKC 4HSVA 3FRPB 5CBAE 4HCSA 2NUCA 3DMUA 3IKJA 1J8IA 1I50B 5IODA 2N55A 4ZRZA 3MTSA 4H0LC 1PTOB 2MPMA 1I4RA 1A3TA 2E76C 3E6ZX 1G2TA 5IT9L 2N88A 1Y69U 1B4OA 4ILWA 1D1KA 2A5HA 2KVMA 2Q8IB 3Q0AA 2XWJB 4ZYSA 1SYBA 2JEBI 3C46A 1LO5D 2PMZB 4K2LA 2WIIB 4A3FB 1X3PA 4OO1I 1RDPD 3S9WA 3PUXA 1YNNC 2EYHA 4BBRB 3LX0A 5EBCA 1Y8OB 2Z4IA 2NN6H 3SK6A 1NR4A 2CVRA 2PZUA 1UNSA 1TS3A 2NTTA 5J22A 2QDBA 1RKNA 5C0XG 3BDCA 3I73A 3GQBA 1JC7A 2QEJC 1B9MA 1HXYD 2IL8A 1GUWA 4IUTA 2EJMA 2NVXB 3TP5A 1WTXA 3MHBA 2B8GA 4B08A 1SE4A 3EFXD 1PXUA 3KLSX 2A68D 2D5DA 2K05A 3N52A 4FF2A 5BN3A 2Q8TA 5M9OA 1KLUD 1MBYA 3L3OC 1SE3A 1EY7A 5C3EB 1EZ6A 5JJZA 3TP8A 2PZWA 1BCPD 2F0VA 4G7HC 1TY2A 1DYQA 1I3QB 4DA2A 5M5XB 1EIGA 1I4GA 1AZPA 4TQUS 1LT6D 5IGFA 1BCPC 4QMGA 2RKSA 1EOTA 1QJOA 4XYQA 1I4HA 5M5WB 4V0BA 1K8OA 1LTBD 2X6GA 2DNEA 1WD1A 1QG7A 4IALA 1HQRD 3K5MA 2OF1A 5FLXL 1U4RA 1EY5A 3QG1A 4HMIA 4RHRA 3A7AB 4ZAIA 5IGEA 1ET6A 1Q8IA 2HUGA 1PRTD 3OPOA 2EOTA 4ZK9B 2EE1A 4XT3B 4QB4A 4FXDA 1R9TB 1DCZA 5C5MA 1B3AA 1IYVA 1S5BD 1F2YA 2DY7A 5T1GA 3T53B 4DN4M 4HR7B 1SSOA 5FO7B 5K5PA 5E4XA 4JK1C 2EY6A 3HOVB 1A15A 2M00A 2DNCA 3BVMA 1DXMA 2KCCA 2J0TD 2FMCA 5CYUA 1GHKA 3FPPA 4CHTB 2F0IA 3R8BA 3DWPA 2R61A 3H6MA 3OHXC 5KNDA 4HEDA 1AW7A 3P7JA 1R4PB 4C1NI 4OIJA 2K7VA 1K83B 1ZYRD 5KYIA 4RCOA 2F0JA 3RUZA 1CZGA 3PUWA 1SEBD 3NWSA 2F0PA 1PTOC 1STEA 3TP6A 2KHSA 3I72A 1ML0D 2EJFC 3NQIA 4A3EB 3I4NB 3LNNA 3I70A 1XWEA 3ND9A 2IW3A 1KTKA 3S1NB 1STAA 4EGVA 1SBBB 1DJRD 2F0MA 2RSOA 3NK9A 2L12A 1WTVA 3NUCA 3K5NA 4KHZA 5JVH3 4RA8A 4TRDA 2PZTA 2YU9B 1EYDA 4IQZA 2EY1A 1LT5D 4A93B 1ILPA 1SDFA 3DWQA 5KYLA 2SNMA 1SNPA 1AZQA 2OXPA 3KLSA 1MSHA 4LAAA 3RMHA 2EY5A 4PV1C 4F8MA 2F0NA 4K5VA 2D62A 4ZUJA 2PYKA 3MXPA 1U4PA 3Q22A 2ID0A 2F1MA 3NQTA 1O78A 1RTOA 1SNCA 4CJ1B 1UAPA 2KEDA 5FO8B 3S1MB 1X32A 3I4MB 3PUZA 1IW7D 1IHZA 3JAML 1G8ZD 1FGBD 2EYMA 1B1ZA 4HSPA 2DY8A 3TBIB 1D5XC 2HCCA 4DXGA 2LMCB 1QE6A 2A74C 2QKIC 1TWCB 1STNA 2AUKA 5K36G 3VR5A 1KDCA 1GUNA 3H09A 4LK1C 4C2MB 3JAME 2PQEA 1PMRA 2K33A 1STHA 5C4JB 5M3FB 4EQPA 3BVZA 3A56A 2O5IC 1ICWA 2F0FA 3S16B 2JP1A 3MFYA 1C4QA 1H9JA 5D3DA 4A3IB 1AEXA 4PMWA 4KY5A 1D5ZC 2IT1A 1E2VA 3VYRA 4LMQD 3T13A 3J80E 2IPKD 3CRKC 2KECA 4CJ0B 3E5SA 3FDTA 1LTSD 1OXSC 2E2IB 2R6GA 4MIUA 2FFKB 1QCBD 1DD2A 1HFGA 5C5LA 2NYZD 1AN8A 1HTLD 2F0QA 5JEAJ 1Q1EA 1XTCD 3GTKB 3I90A 1E2WA 2EZVA 3CHBD 3Q6SA 1WTOA 4IUUA 2JA7B 3FEWX 3OIPA 3R93A 5I2YA 4I65A 1QWYA 2TMPA 2KOLA 1PTOF 4FNFA 5ISRA 5E3FA 3GV6A 4Q5VA 2IX0A 1PZKD 5M5YB 3NBHA 5C6AA 1AP0A 1HA6A 4KI0A 4E6IA 2O5JC 3EROA 4RKLA 2FHTA 1I6HB 2VXWA 3D4RA 3ONAB 3TN2A 1PFBA 4C1NK 3VYUA 2A73B 5JAVA 4KKTA 1L0XB 1WD0A 4F88A 4G7OC 1SNOA 4QUFA 5DM63 4OL7A 3DEOA 3OMGA 1EIHA 1O7LA 1DZ1A 5HGTA 1CA5A 3H0GB 4BS9A 5J1ZA 4FF3A 3K7AB 3W3AA 2F0KA 1WCMB 1VMPA 1M4VA 1U4LA 1E2ZA 1VMCA 1EL0A 1FD7D 4RFBA 5CV7A 4ZKBB 3SE0A 5D65A 1SXTA 2HCIA 2JYOA 2ZXPA 2OEOA 3X3NA 1OO9B 2AQ1B 1JWUD 4U673 3OWFA 1SJHD 4OIKA 2L5TA 1ZYRC 1EU4A 2K6AA 4FXGC 2K32A 3HOXB 5IGCA 1SMYC 1CA6A 2XRQD 3VA5A 3EQLC 2NTSA 4IURA 1EWCA 1H9SB 1JQYD 3AU7A 1TKWB 2PO4A 3I91A 1EYCA 3HOYB 5DAUA 5TSSA 3PO3B 1CHQD 2Y0SB 1T5XD 3HEJA 2L55A 1OXTA 2F0UA 3NWTA 1AFPA 2E74C 2BE5D 4F87A 2AUJD 1SYEA 2VNUD 4G7ZC 2EYOA 2RDHA 3D3RA 1B2TA 1SAPA 5DM73 5C4HA 1S5CD 5FK9C 4RGMA 4KY6A 2M9VA 2F3VA 1LTTD 3D8GA 3WOEA 1XYIA 4WFN3 1HRJA 4DF7A 4CKBA 1PRTC 3U9SA 3P75A 2TSSA 1F9RA 1XXGA 3BG3A 1G291 1DOLA 2BCOA 3S2DB 2JXMB 4RGNA 4OO1H 5JVG3 3GD7A 1HTPA 1B50A 1HPCA 2L4NA 4C56C 3NBIA 5IT9E 1WTPA 3T16A 3O13A 1H9KA 5CC4A 4CGYB 4XQNA 3OMCA 2M2LA 3A8KE 5T1IA 5KIXA 4ZQ3A 1WTWA 1PRTF 5C4ZA 2Z8LA 1EZ8A 4PNYA 1L0YB 3A55A 1J9OA 3QJYA 5KRUA 3C1EA 4RWSC 3H91A 2H4OA 1IL8A 3BYTB 5C4XB 5I6YA 3G7LA 2QF7A 3D4DA 3K5OA 4DFAA 4UAIA 3C2PA 3BDOA 2B2VA 3HZXA 2F0LA 2XN9C 4ABNA 2KUMA 1TS4A 4HAEA 3R3OA 2I46A 1V8QA 2KEEA 3BYYB 3HRZC 4C3JB 2JA8B 4H13C 2F0DA 1EY9A 3MC0B 1FNVA 1SYDA 2NVQB 3KBXA 5IGGA 2PPBC 1JOQA 1D2BA 4NP5A 3M7NA 1Y8PB 2F0TA 3MVVA 4H7BA 1KDAA 2NB0A 2IX1A 3L9AX 4A3MB 4CBVA 1TWAB 4HMJA 3WOFA 3H3VC 2ZT9C 2E2HB 2SNSA 4CKEA 4G4KA 4NKLA 4FVMA 2RQXA 1CFMA 5A2QE 1I4PA 2FMMA 1F9SA 3M4YA 5E4WC 5C0XH 1HFNA 3ND8A 1TWFB 3SHLA 4MN3A 2FJ2A 1FR3A 3VA7A 2F0HA 4ODGA 3X3MA 4FP5D 2F0GA 5IGDA 1KABA 2XIWA 5CR3A 1A6XA 2IJ0A 5FO9B 5ELCA 1A2UA 2JA5B 1IYUA 1EEID 4M8AA 3A8JE 2EY2A 3SEBA 2RBMA 1OXXK 4X3SA 3A54A 2I07B 3OW7A 1ENFA 3HOUB 1F9PA 1EY6A 1TIID 1Z6HA 2KQ3A 4CKCA 1HUMA 3OIQA 2B2YC 2KJXA 2B63B 1EFID 3Q23A 3S15B 2AQ3B 1ET9A 4QIWB 4JBWA 1CK1A 2HDLA 1VF5C 1RTNA 1EQVA 3PIP3 1PLFA 4NMZA 1TR5A 2QILA 3OSOA 1TS2A 3VR2A 4N9TA 1BO0A 1CM9A 5I9OA 4BWGB 1EY0A 2A6HC 4S3SA 1QILA 5JPMC 4XXEA 2EVBA 2DN8A 5LL6S 4M1UB 3GTQB 4KTAA 3NPPA 2VB3X 4KY7A 2J4XA 3QOJA 3RZOB 4L8JA 1JB3A 3Q24A 3M3YB 2B2UC 3E0JA 2K03A 2D2CC 4X3UA 3EA6A 3OOCA 1VCIA 5F2DA 4WJWA 4NW2A 1BF4A 1C8CA 2G9HD 3MA2B 2A6EC 1YNJD 2PNRC 1LT4D 4GZYC 4KKSA 3D4WA 4XIGS 3I4LA 1BXTA 2NBFA 1QNUA 4J6HA 1V1OA 5FLXE 3CU7A 4KK7A 1SYGA 2R7ZB 3R2IA 1Q3LA 4RCNA 4FF4A 1Y1WB 5FKAC 3HOZB 4IUQA 3MXGA 2F0WA 3NTHA 3J81L 1DOMA 2E2DC 1Q1BA 2B2TC 4J8QA 2E75C 4FO2A 1CI3M 3SXHA 3VR6A 3C1FA 3MEHA 2F03A 4IN3A 4C3JG 1A3UA 1ENAA 1GUSA 1HCZA 1EEFD 4EVOA 2PCFB 1GUOA 4KD4A 1LLRD 3GTOB 1QNKA 2J7ZA 3HG9A 3G6JB 3MWYW 1GUGA 3GP7A 4RGOS 4HN7A 4PMCA 4ZLTF 5I6WA 1CHPD 1TY0A 2CW0D 2NZ1D 1H9SA 4DNRB 5EPJA 1KNEA 5I2XA 3EVQA 3NP8A 3MAQA 1HQMC 2LFNA 4BY1B 3OWEB 1TWHB 2VB2X 2RVLA 4IUNA 2RDGA 3AMUA 3M4OB 1Q12A 1PYWD 3SR1A 1BCPB 3URYA 1D1IA 5DEHA 4K5WA 3CQZB 3ITPA 1HA5A 5EQ0A 5EKIA 1GHJA 3L7ZC 2K01A 4IZ8A 4Q0FA 2K5QA 1F77A 2SDFA 4K14A 3VR3A 1ZKOA 2F3WA 4IUVA 1H9RA 1FNUA 4XDXA 4B9WA 4P2CB 3S1QB 3D6CA 3W2DA 1SNMA 5C3XA 5D3IB 1KLGD 1EQTA 5J39A 2XRSD 1LABA 1B53A 1KDBA 3NSWA 4QF4A 3QO2A 3T51B 4I7ZC 2A69C 1LTGD 2IWHA 1Z7TA 2LS01 1S5ED 3RLFA 2O4XA 5EJWA 3LWUA 1ILQA 3TDQA 3MXUA 3DEPA 5IGBA 1GUTA 4KN7C 2KA7A 3A7LA 2RSNA 4BA1I 4K6LA 5K36H 3P20A 3NXWA 5EKKA 2MHVA 2F4IA 1IW7C 3NTKA 4XT1B 3A8IE 1STGA 2EXZA 1SYCA 3TP7A 3NE5B 4TSSA 4U68A 5G3LF 1JORA 1SE2A 4Y7NB 4QCLA 3V2TA 4K6DA 4FYDA 4RKBA 1VDZA 2ZXOA 1BDOA 1OXVA 1D6EC 4BY7B 3J7YW 2B8FA 2V4DA 3BVGA 1BQQT 4RGTA 3S14B 5CV8A 3SK4A 1PTOH 3FVQA 1PDQA 1NCVA 1YNJC 2ENBA 2KCNA 4IFDI 1WTRA 4ULLA 5LL6X 3VR4A 3NHHA 1DOKA 5M3MB 1EWHA 2MGSA 3M7GA 5JEAH 2D9UA 3I3CA 4XQJA 1HUNA 3DM1A 4C3IG 1JICA 3GO5A 2B2WC 2WV6D 4H44C 5D14A 3HGBA 1S4ZA 1JR0D 2QCPX 2A6HD 5JPNC 2HDMA 2SOBA 1PRTB 1R4QB 1GXDC 1JWMD 1OXUA 3RZDB 3PUYA 2B2UA 4BBSB 4N9PA 4X3KA 2A69D 1UEAB 2BDOA 3C3LA 1ENCA 2MJ8A 4AYBB 5CV4A 1LACA 1V43A 4LJZC 3EJIA 4C3HB 1LTRD 1X3QA 1M8AA 1DONA 1ZXTA 3V96A 5DNFA 1LTAD 1V1PA 3HOWB 2WINB 3CKIB 1CQVA 3K5LA 4K2KA 2F0SA 1S5DD 4O42A 5FOBB 3PMFA 1FYCA 1Z47A 1WTQA 4IFDG 2R3ZA 4V190 1ESFA 3MFGA 1QB5D 3NTIA 5EKLA 2WP8J 4A3DB 1SNDA 1UUPA 4ZKCB 1G2SA 4XQQA 4K5XA 2LY7A 1JE4A 3TZUA 2F0EA 3N6RA 2G9DA 2C9OA 2XVSA 2MP1A 5C3WA 5IOCA 4DAPA 5HURA 4KMUC 1JOKA 1Y1VB 3HS0C 2CHBD 5NUCA 3CRLC 4KN4C 3GTPB 4C3IB 2FINB 2GA4B 2K5DA 2AQ2B 1S5FD 4L63B 2B2VC 5CGKA 3K6OA 1KAAA 4R8IA 5C0XI 2VUMB 2AWOA 1KNAA 3QOLA 4IUPA 3IFDA 3DUZA 3BS1A 4IFDJ 2CW0C 2WAQB 1TQOA 3ZYYX 1I4XA 4A3JB 3TSSA 3SK8A 3S17B 1V1PB 2IX3A 4X3TA 4L6TB 3WDNA 1JWSD 5CV9A 1PFNA 2ICEC 5ELDA 5EPKA 5BN4A 4G57A 2C5CA 5IIFA 1C48A 3SK5A 5G3LD 2BDNA 3PIO3 1CTMA 4Z9CB 1F2LA 1TT2A 1YNND 2EYPA 1RODA 1ONLA 4DK0A 2K28A 3KLRA 2EJGC 4HTHA 3TMEA 5A2QL 2MUYA 2R92B 1VF7A 2F0OA 5LHY1 4KHVA 3I8ZA 3SDZA 5KNBA 2XNAC 2EDGA 2XSCA 4A3BB 1I6VC 3DHQA 3J7AF 1CQFA 3K57A 1HHVA 1BUVT 3TZDA 1STYA 2PW5A 4OGQC 2ICIA 1E0BA 3SVMA 3KK7A 4PMBA 2O2LD 3KBGA 2RA4A 1O7YA 4R9WA 2EPBA 3FKIB 2AWNA 4KV6A 4DXFA 1BCPF 5I9PA 3FPUB 2R93B 1LV9A 3HKZB 5JOBA 3PO2B 2L11A 3KUPA 4MHEA 1EU3A 2Z4HA 3J80L 4TKOB 4DNTB 3S2HB 1IKLA 2PW7A 4PQXA 2B2YA 5E1FA 3MZ5A 1BBXC 2NN6G 1RJTA 1QOHA 1EY4A 2WKCA 1EY8A 2B39A 3K58A 2Z1CA 4XTCS 5CV5A 1TS5A 2CQAA 1B9NA 2B2TA 4EQNA 3VYTA 4J1MA 5COYA 5KEEA 1JOOA 1SFOB 1SYFA 4K8IA 1PTOD 2LKVA 5EBDA 5JEAG 3DXJC 2BOSA 1MI2A 3LWEA 2NVTB 1SJED 3S1RB 5ELFA 3KF8A 2H1EA 1H9MA 4DGZA 1EYAA 1IKMA 2L9HA 1NR2A 4NDXA 3H94A 4RH6A 3T4AC 1A2TA 4F7XA 4DAYA 4UDUC 3D31A 3BZDB 3FMCA 1GOZA 1I4QA 3MXNA 1LTID 3DWAA 5ELEA 2NWGA 1FNWA 1RHPA 3K0YA 2Q8RE 4WORA 1A3VA 4DU9A 2NN6I 1RD9D 2K1BA 2BA1A 5EPLA 3ERQA 1TWGB 3IAYA 1Q90A 1II3A 2OT2A 3QWNA 1NAPA 1W6JA 3AB9A 3GTMB 1RF2D 2EYJA 2WB1B 1K8MA 1XX8A 1U9RA 4DK1A 1T5EA 1ESRA 1TVXA 2EYLA 2HQEA 3V05A 4ZUIA 2X69A 1F2ZA 1PZJD 5CV6A 1RCVD 2SEBD 2ZXRA 1TU2B 4O1NA 5C44B 1F9QA 1CT1D 4A3KB 5KGUA 4DAVA 2WKDA 4B9XA 1MD2D 2X6LA 5EGTA 3VYSA 5BN5A 1G6ZA 2JSOA 3J81E 3GTGB 5CMDA 3GV3A 2BE5C 2B2WA 5CORA 3HP3A 2JA6B 1NUCA 4RHSA 1O7ZA 2BA0A 4BA2I 3RD4A 1F2MA 3F2UA 1MGSA 4KD3A 4C3HG 4OHJA 3P1HA 4KKUA 5CBEE 4ME5A 1BOSA 1O80A 1G91A 4HCEA 2A68C 3T56B 1STBA 4WRDA 4YIJA 4XYOA 2YYZA 1NSNS 4A3GB 2NVYB 5KNCA 1PFMA 1LT3D 2E2JB 1U4MA 1GJXA 3R2TA 3UI2A 3PV0A 4KJNA 3IL8A 5AFWA 2K04A 2A6ED 3GTJB 4KJOA 3IFTA 4R8NA 4ID6A 2WACA 1DM0B 4K8JA 3U9OA 4OO1G 3J7AV 1BR9A 1PZID 4EQOA 2RDFA 2JEAI 2JE6I 3BDLA 1WVLA 1MSGA 1B44D 5C0XJ 2K5WA 4QUCA 2EYFA 1ZEQX 3QIAA 2L0CA 4CJ2C 2XWBB 1D5MC 3PUVA 4RAUC 4FF1A 3K59A 1BNZA 5ELBA 5I4DA 3QB3A 3M85A 3GTLB 3D6WA 1SNQA 1W6KA 4IFDH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A6H D;  1Y8N B;  2B8G A;  2EDG A;  1IW7 C;  1E2Z A;  3T53 B;  3BG3 A;  1G29 1;  5A35 A;  4HR7 B;  1I6V C;  4L8J A;  1OXU A;  1HQM C;  1H9M A;  2JXM B;  3CRK C;  5BN5 A;  4OO1 H;  1CFM A;  3CRL C;  4KN4 C;  3PUY A;  4JK1 C;  3GD7 A;  1HTP A;  2A68 D;  3SE0 A;  1HPC A;  2D5D A;  2A69 D;  1OXS C;  4OGQ C;  4PV1 C;  2R6G A;  2D2C C;  3IKJ A;  3A8I E;  2BDO A;  3M4Y A;  5BN3 A;  1DD2 A;  3OOC A;  1VCI A;  2BE5 C;  1H9K A;  3NE5 B;  1Q12 A;  2DNC A;  3A8K E;  2D62 A;  5C0X H;  1Q1E A;  1DXM A;  2BA0 A;  4BA2 I;  2KCC A;  1LAC A;  2A6E C;  3H94 A;  3ND8 A;  1E2W A;  2PNR C;  4H0L C;  4GZY C;  1V43 A;  4KKS A;  4XIG S;  4LJZ C;  1GHK A;  3I4L A;  1FR3 A;  3VA7 A;  2F1M A;  3FPP A;  2L5T A;  3D31 A;  3QJY A;  2E76 C;  4KKU A;  2AWO A;  1O78 A;  1ZYR C;  3FMC A;  1Y69 U;  5KNB A;  4G7H C;  1GHJ A;  1A6X A;  2K32 A;  3L7Z C;  2A68 C;  3T56 B;  1VDZ A;  1SMY C;  5KND A;  1BDO A;  1OXV A;  1IYU A;  3EQL C;  3A8J E;  4RCN A;  3VR3 A;  3PUZ A;  2QF7 A;  1ZKO A;  1IW7 D;  2CW0 C;  2YYZ A;  2B8F A;  2Q8I B;  1H9R A;  1OXX K;  5KNC A;  2K7V A;  3BDO A;  1H9S B;  3OW7 A;  2V4D A;  4KI0 A;  2NN6 I;  1TKW B;  4TKO B;  2BA1 A;  4DNT B;  4TQU S;  1GJX A;  1Q1B A;  3PUW A;  1IYV A;  1Z6H A;  2O5J C;  3PV0 A;  1Q90 A;  2LMC B;  2E75 C;  1CI3 M;  2AUK A;  1K8O A;  2JEB I;  2NN6 G;  1FYC A;  5K36 G;  1V8Q A;  2A6E D;  3WDN A;  3VR5 A;  2IT1 A;  1OXT A;  1GUN A;  3VR6 A;  4IFD G;  3I72 A;  3U9S A;  4LK1 C;  3D4R A;  2E74 C;  3IFT A;  3PUX A;  3AB9 A;  2EJF C;  1GUS A;  1YNN C;  1LAB A;  2BE5 D;  4H13 C;  1HCZ A;  1QJO A;  3LNN A;  1Y8O B;  3T51 B;  1PMR A;  1YNJ C;  2AUJ D;  2K33 A;  4I7Z C;  3ND9 A;  2PCF B;  4JBW A;  4KKT A;  4XTC S;  5BN4 A;  2A69 C;  2DNE A;  1GUO A;  4G7Z C;  4OO1 G;  2NN6 H;  1K8M A;  1VF5 C;  4G7O C;  4DK1 A;  1T5E A;  3VR4 A;  2PPB C;  1Z7T A;  1B9N A;  3QG1 A;  2JEA I;  1EWH A;  2JE6 I;  1CTM A;  3M7N A;  3RLF A;  1GUG A;  1Y8P B;  2O5I C;  3LWU A;  1O7L A;  3A7A B;  5JEA H;  3MXU A;  3VR2 A;  1ONL A;  3QIA A;  5C0X G;  3MFY A;  4DK0 A;  4KHZ A;  1H9J A;  3PUV A;  1TU2 B;  3I73 A;  1GUT A;  3TZU A;  3GQB A;  3KLR A;  2EJG C;  3N6R A;  3OPO A;  4KN7 C;  2KA7 A;  1B9M A;  4H44 C;  1VF7 A;  3A7L A;  2A6H C;  3W3A A;  2ZT9 C;  3HGB A;  3M85 A;  4KMU C;  4BA1 I;  2EJM A;  1H9S A;  4DNR B;  1DCZ A;  2EVB A;  2DN8 A;  5JEA G;  3DXJ C;  5K36 H;  3P20 A;  3SDZ A;  4IQZ A;  4IFD H;  1E2V A; 
#chains in the Genus database with same CATH topology
 1SMY D;  2Z0S A;  3ULP A;  1Y8N B;  2L1B A;  4YCU A;  2VS1 A;  1CZW A;  1JCK B;  3Q8D A;  5A35 A;  4FXK C;  4LF7 L;  4HSV A;  4JI8 L;  3FRP B;  5CBA E;  4PG3 A;  4HCS A;  4LWC A;  2NUC A;  3DMU A;  3IKJ A;  4R4C A;  1VQN A;  1J8I A;  1I50 B;  5IOD A;  2N55 A;  3ZJY C;  4ZRZ A;  3MTS A;  4H0L C;  4DV6 L;  4A3C G;  1PTO B;  2MPM A;  1I4R A;  5BR8 Q;  1VQ5 A;  1A3T A;  1XPU A;  2E76 C;  3E6Z X;  1G2T A;  5IT9 L;  2N88 A;  1Y69 U;  1B4O A;  4ILW A;  3HOU H;  3CCL A;  1D1K A;  4IJH A;  2A5H A;  1KAW A;  2KVM A;  4H02 A;  2Q8I B;  4P72 A;  3Q0A A;  2XWJ B;  4DAY B;  4ZYS A;  1YNX A;  1SYB A;  3J7A 5;  4A3D G;  1UE1 A;  1PH2 A;  1WTH A;  3DM3 A;  5IP7 H;  4DV6 Q;  2JEB I;  4X65 Q;  1YI2 A;  1LO5 D;  2PMZ B;  3C46 A;  4LFA L;  4K2L A;  2WII B;  4A3F B;  1X3P A;  4OO1 I;  1RDP D;  2ZTC A;  3S9W A;  3PUX A;  1YNN C;  2EYH A;  4R4T A;  4BBR B;  3LX0 A;  5EBC A;  5ELO A;  3HOW G;  1SRO A;  1Y8O B;  1EWI A;  2Z4I A;  2NN6 H;  1NJI C;  2RCN A;  3NBH B;  3SK6 A;  4DR7 L;  5GRO A;  1NR4 A;  2CVR A;  1EIY B;  3CCS A;  2PZU A;  1UNS A;  1TS3 A;  2NTT A;  5J22 A;  2QDB A;  1RKN A;  4OWX B;  5C0X G;  2YTY A;  3BDC A;  3J81 c;  3I73 A;  3GQB A;  3H0G G;  1JC7 A;  2QEJ C;  1SE8 A;  1B9M A;  1HXY D;  1WYD A;  2IL8 A;  3S14 H;  1GUW A;  2R7D A;  4IUT A;  2EJM A;  4X66 L;  4YWL A;  2NVX B;  3UDI A;  2NZO A;  3TP5 A;  4UY8 C;  1WTX A;  3MHB A;  2B8G A;  4B08 A;  1SE4 A;  3EFX D;  5IWA L;  1HJP A;  1PXU A;  4BY1 G;  1W2B A;  3KLS X;  4B3T Q;  3H3V I;  2A68 D;  2D5D A;  2K05 A;  2UUC Q;  2WFW A;  3N52 A;  4FF2 A;  5BN3 A;  2Q8T A;  5M9O A;  1KLU D;  1MBY A;  2FXQ A;  4LF4 Q;  5BR8 L;  3L3O C;  1SE3 A;  1EY7 A;  5C3E B;  1EZ6 A;  5JJZ A;  4LF8 L;  4MTK A;  3TP8 A;  1QVC A;  2PZW A;  1O7I A;  3EN2 A;  3FKI G;  3HFZ B;  1BCP D;  2F0V A;  4G7H C;  1L1O C;  4JI7 L;  3I56 A;  1TY2 A;  1PYB A;  3W5O A;  3I4M G;  4BBR G;  1YHQ A;  1DYQ A;  1NE3 A;  4OEM B;  1I3Q B;  4DA2 A;  5M5X B;  1OTC A;  4DV5 Q;  4DR2 L;  5IYC H;  1EIG A;  1I4G A;  1AZP A;  4TQU S;  1LT6 D;  5IGF A;  3E3X A;  4BXX H;  4DV0 L;  1BCP C;  4QMG A;  2RKS A;  1TWF H;  1EOT A;  2MQH A;  3I2Z A;  1QUQ A;  1QJO A;  4XYQ A;  1I4H A;  5M5W B;  4V0B A;  1K8O A;  1IL2 A;  1LTB D;  2X6G A;  4DV1 Q;  2ASB A;  2DNE A;  1WD1 A;  1QG7 A;  4B3M Q;  4IAL A;  1HQR D;  3K5M A;  2JA5 H;  2OF1 A;  1U4R A;  5FLX L;  1EY5 A;  3QG1 A;  3CME A;  2EQS A;  4PZ7 A;  4HMI A;  4RHR A;  4HJ7 A;  3A7A B;  4ZAI A;  2QDL A;  5IGE A;  1ET6 A;  1Q8I A;  2HUG A;  2NVX H;  1PRT D;  1WCM H;  4A3I G;  1AH9 A;  3OPO A;  2EOT A;  4ZK9 B;  2EE1 A;  4XT3 B;  4QB4 A;  4FXD A;  4JI8 Q;  1TWC H;  1R9T B;  1DCZ A;  4I7A A;  1I94 L;  5C5M A;  2BH8 A;  1B3A A;  2B63 H;  1IYV A;  1S5B D;  1F2Y A;  2DY7 A;  5T1G A;  4JI5 L;  3T53 B;  3CP0 A;  4DN4 M;  4HR7 B;  1SSO A;  5FO7 B;  5K5P A;  5E4X A;  1MHW C;  4JK1 C;  4YY3 Q;  2EY6 A;  3HOV B;  1A15 A;  2M00 A;  1VQE A;  1PH3 A;  1PFS A;  1VQG A;  2DNC A;  1WFQ A;  3BVM A;  3CC4 A;  1DXM A;  2HIV A;  4P73 A;  2KCC A;  2J0T D;  1BBW A;  2FMC A;  5CYU A;  2I5M X;  1VQ4 A;  1NTG A;  1GHK A;  2CWA A;  1E24 A;  3FPP A;  4NPS A;  5IYB G;  4CHT B;  1CSQ A;  2F0I A;  3R8B A;  3DWP A;  2R61 A;  1AE2 A;  3H6M A;  3OHX C;  3GDE A;  3M4P A;  4OWW B;  4WJ4 A;  5KND A;  4DR5 Q;  4DV3 Q;  1JJG A;  2UUC L;  4HED A;  4C3H H;  1AW7 A;  4LNQ A;  3P7J A;  1R4P B;  4C1N I;  4OIJ A;  2K7V A;  4A3J G;  1YJW A;  2VQE Q;  1K83 B;  1ZYR D;  5KYI A;  4RCO A;  2F0J A;  3RUZ A;  2HHH L;  1CZG A;  4NXM L;  3PUW A;  1MJE A;  1SEB D;  3NWS A;  2F0P A;  1X3E A;  1GKH A;  1PTO C;  1VQ8 A;  2K4K A;  2RF4 A;  4A3G H;  1STE A;  3TP6 A;  2KHS A;  1Y14 B;  3I72 A;  1ML0 D;  1FVI A;  2EJF C;  4L5R C;  3NQI A;  4A3E B;  3I4N B;  3LNN A;  3I70 A;  1XWE A;  3ND9 A;  2K14 A;  2IW3 A;  1KTK A;  3S1N B;  1VQM A;  4B3T L;  1STA A;  2PMZ E;  4EGV A;  1SBB B;  3PSI A;  1HR0 W;  1DJR D;  2F0M A;  2RSO A;  3NK9 A;  2L12 A;  1WTV A;  5M5Y H;  3NUC A;  5IT9 c;  3K5N A;  5C4J H;  4GN4 B;  4KHZ A;  4LF5 L;  5JVH 3;  4DUY L;  3CCJ A;  4RA8 A;  4TRD A;  4LFA Q;  2PZT A;  3S2D H;  4EQ5 A;  1X6O A;  4GN5 A;  3U4Z A;  2YU9 B;  1EYD A;  4IQZ A;  2EY1 A;  1LT5 D;  4A93 B;  1ILP A;  1SDF A;  3DWQ A;  5KYL A;  2SNM A;  2F52 A;  3PO2 H;  3CCQ A;  2WAQ E;  4IJL A;  3TRZ A;  1SNP A;  3GTL H;  1M1K C;  1AZQ A;  2OXP A;  3KLS A;  1MSH A;  4LAA A;  3GTO H;  1CKO A;  3RMH A;  2EY5 A;  4PV1 C;  4JI2 Q;  4F8M A;  4B3S L;  2F0N A;  4K5V A;  3S1Q H;  4AYB G;  2D62 A;  4ZUJ A;  2PYK A;  3MXP A;  1U4P A;  2Q2T A;  3PIP A;  5ELN A;  3Q22 A;  1VQ6 A;  1W3S A;  2R92 H;  2ID0 A;  2F1M A;  3NQT A;  2VZA A;  2EIF A;  1O78 A;  1RTO A;  3KJO A;  1SNC A;  4CJ1 B;  1UAP A;  1VQB A;  2KED A;  5FO8 B;  3S1M B;  2QW7 A;  1KXL A;  1X32 A;  3M9B A;  2JA7 H;  3I4M B;  1C9O A;  3PUZ A;  4GKJ L;  1IW7 D;  2UU9 L;  1IHZ A;  3JAM L;  4DR4 Q;  1S3O A;  1G8Z D;  1B3Q A;  1FGB D;  2EYM A;  1VQC A;  1B1Z A;  2LXK A;  3RNU A;  4HSP A;  2DY8 A;  3TBI B;  3CCE A;  1D5X C;  3HOU G;  2HCC A;  1GVP A;  2VL6 A;  4DXG A;  2LMC B;  1QE6 A;  2A74 C;  2QKI C;  3IRB A;  1TWC B;  3DLL A;  1STN A;  2AUK A;  1R9T H;  5K36 G;  1BBU A;  3VR5 A;  1KDC A;  1GUN A;  2B63 G;  3H09 A;  4LK1 C;  4C2M B;  1QVG A;  3JAM E;  2PQE A;  5IP9 H;  4P74 A;  2AKW B;  1PMR A;  2K33 A;  4DR6 L;  1K3R A;  1STH A;  2CQO A;  3PIO A;  4A3K G;  1YHA A;  5C4J B;  5M3F B;  3HOV H;  3HOX H;  2IHE A;  4EQP A;  1Q86 C;  2Z6K C;  1LUZ A;  3BVZ A;  1PH7 A;  4JG2 A;  4O2D A;  3A56 A;  1E7Z A;  2O5I C;  1ICW A;  2F0F A;  1UE7 A;  3RN2 A;  3S16 B;  2JP1 A;  3MFY A;  1C4Q A;  1H9J A;  5D3D A;  4A3I B;  3BJU A;  1AEX A;  1N36 Q;  4PMW A;  4KY5 A;  1D5Z C;  2IT1 A;  1E2V A;  4LFB L;  3VYR A;  4LMQ D;  3T13 A;  3RR5 A;  3J80 E;  2IPK D;  1U0L A;  3CRK C;  2KEC A;  4CJ0 B;  3E5S A;  1L0W A;  1A62 A;  3FDT A;  1LTS D;  1OXS C;  2E2I B;  1IXR A;  2R6G A;  2FFK B;  4MIU A;  1QCB D;  1DD2 A;  1HFG A;  5C5L A;  2NYZ D;  1AN8 A;  2LXJ A;  2MO0 A;  1HTL D;  1TXY A;  2VW9 A;  4BY1 H;  2F0Q A;  5JEA J;  1Q1E A;  1XTC D;  3AQQ A;  5GQO A;  3GTK B;  3I90 A;  3PQI A;  1E2W A;  2EZV A;  4B3M L;  3CHB D;  3Q6S A;  2ZJR A;  4AYB E;  2ZM6 L;  1WTO A;  4IUU A;  2JA7 B;  3FEW X;  1PYS B;  1HNX L;  3OIP A;  4JBK A;  1XTD A;  3R93 A;  5I2Y A;  4I65 A;  4L5S A;  2KCT A;  1QWY A;  2KHJ A;  4OWT B;  2TMP A;  2KOL A;  1PTO F;  4FNF A;  5ISR A;  1A63 A;  4OON A;  1L1O A;  5E3F A;  3GV6 A;  1IYJ B;  5GAH C;  2IX0 A;  4IPH A;  1PZK D;  4Q5V A;  5M5Y B;  3FKI H;  3NBH A;  5C6A A;  1YVC A;  1AP0 A;  1HA6 A;  4KI0 A;  3CCR A;  4E6I A;  5H1S E;  1PH9 A;  2O5J C;  2A19 A;  3ERO A;  4RKL A;  4JVZ A;  2I5H A;  3K0X A;  2FHT A;  1I6H B;  2F3I A;  2VXW A;  1JB7 A;  3NEL A;  3D4R A;  3ONA B;  3TN2 A;  3KFU A;  1PFB A;  4C1N K;  4DR3 Q;  3VYU A;  2A73 B;  5JAV A;  4KKT A;  3RZD H;  3PO3 H;  2R7F A;  1VQD A;  1XMO L;  3S16 H;  1L0X B;  1WD0 A;  4IOA A;  4QJF A;  4F88 A;  4G7O C;  2Z6K A;  1SNO A;  4QUF A;  1G6P A;  5DM6 3;  3RLO A;  4OL7 A;  3DEO A;  3OMG A;  4BY7 H;  1EIH A;  1O7L A;  2Q2U A;  1DZ1 A;  5HGT A;  1N33 Q;  1CA5 A;  3GTQ H;  3H0G B;  4BS9 A;  5J1Z A;  4FF3 A;  3K7A B;  3W3A A;  1B8A A;  2F0K A;  4OEL B;  2PI2 E;  1WCM B;  3WWV A;  2ATW A;  1VMP A;  2UUB L;  1M4V A;  2JA8 H;  1U4L A;  4A3E H;  1E2Z A;  1N8R C;  5HY6 A;  3ERS X;  1V9P A;  4MNO A;  1VMC A;  1EL0 A;  1FD7 D;  4RFB A;  5CV7 A;  2NVQ H;  4ZKB B;  4L5Q A;  3SE0 A;  5D65 A;  2MNA A;  1SXT A;  2HCI A;  3CCU A;  4QQB X;  2JYO A;  2ZXP A;  2OEO A;  3X3N A;  1OO9 B;  3ER0 A;  1VQI A;  2UXD L;  2AQ1 B;  3KJP A;  1JWU D;  4U67 3;  2QEX A;  3OWF A;  1SJH D;  4RG1 A;  4OIK A;  2L5T A;  4QL5 A;  1ZYR C;  1EU4 A;  2K6A A;  4FXG C;  4QIW E;  2K32 A;  3HOX B;  5IGC A;  1SMY C;  4NB3 A;  1CA6 A;  4YCW A;  2XRQ D;  3VA5 A;  4A3C H;  4L5T A;  3EQL C;  2NTS A;  4DV2 L;  5IYD G;  1UE5 A;  4IUR A;  1EWC A;  4YHH L;  4DR5 L;  1H9S B;  1JQY D;  3NEM A;  3AU7 A;  1TKW B;  1HNZ Q;  1X56 A;  2E5L Q;  2PO4 A;  3I91 A;  3I7F A;  1EYC A;  3HOY B;  5DAU A;  1VQA A;  5TSS A;  3PO3 B;  1CHQ D;  2Y0S B;  1T5X D;  3HEJ A;  2CKZ B;  1EIF A;  2L55 A;  1OXT A;  2F0U A;  3A0J A;  1E3P A;  3D0F A;  3NWT A;  3I55 A;  1AFP A;  2E74 C;  4JOI C;  1J6Q A;  2BE5 D;  4F87 A;  1PA6 A;  3E0E A;  2AUJ D;  1Q7Y C;  1SYE A;  4JI3 Q;  2VNU D;  4G7Z C;  2EYO A;  2RDH A;  3D3R A;  1B2T A;  1SAP A;  5DM7 3;  5C4H A;  1S5C D;  5FK9 C;  4HJ9 A;  4RGM A;  3K7A H;  4KY6 A;  2M9V A;  3HOW H;  2F3V A;  1LTT D;  1KRT A;  4JI6 Q;  3D8G A;  3WOE A;  1XYI A;  3E9H A;  3BZK A;  4WFN 3;  1HRJ A;  4DF7 A;  4GN3 B;  2EXD A;  4CKB A;  3JAM c;  2PNH A;  1HR0 Q;  2H5X A;  1PRT C;  2K50 A;  3U9S A;  3P75 A;  2KHI A;  2TSS A;  3G71 A;  1X9N A;  1GD7 A;  1F9R A;  1XXG A;  3BZC A;  3BG3 A;  1G29 1;  1DOL A;  5AJ3 Q;  2BCO A;  3S2D B;  2JXM B;  4RGN A;  4OO1 H;  5LMN W;  5JVG 3;  2YU9 H;  4HIM A;  2BH2 A;  3GD7 A;  1HTP A;  2RHS B;  1B50 A;  5M3F H;  1HPC A;  5C3E H;  2L4N A;  3J81 j;  2UXC L;  4C56 C;  3NBI A;  5IT9 E;  1WTP A;  2JJQ A;  3T16 A;  4HJ8 A;  3O13 A;  4A3L G;  1H9K A;  5CC4 A;  4CGY B;  5IE8 A;  4XQN A;  1IBK Q;  3OMC A;  2M2L A;  3A8K E;  5T1I A;  5KIX A;  4JI3 L;  4ZQ3 A;  1HH2 P;  1WTW A;  4GKK Q;  1IBL Q;  1M90 C;  4JI4 L;  1PRT F;  1WCM G;  2Z8L A;  3K8A A;  3L0O A;  5C4Z A;  1EZ8 A;  4PNY A;  1L0Y B;  4X64 Q;  5LMN L;  3H3V H;  3A55 A;  1J9O A;  1VQO A;  2VUM G;  3QJY A;  5KRU A;  3C1E A;  4RWS C;  3A5U A;  4BBS G;  3H91 A;  3FHW A;  2H4O A;  1IL8 A;  2Y0S G;  3BYT B;  5C4X B;  4DV5 L;  5I6Y A;  2PQA A;  3G7L A;  2QF7 A;  3D4D A;  3K5O A;  4HIK A;  4BY7 G;  3K7U C;  4DFA A;  4UAI A;  3C2P A;  3BDO A;  2B2V A;  3HZX A;  2F0L A;  2XN9 C;  1UE6 A;  4HID A;  4ABN A;  2KUM A;  1TS4 A;  4IPG A;  4HAE A;  1U5K A;  3R3O A;  2I46 A;  2PQA B;  3CC2 A;  1RIP A;  3W1B A;  1V8Q A;  2KEE A;  3BYY B;  1N32 L;  3HRZ C;  1B7Y B;  1K0S A;  4JV5 Q;  1PVO A;  4C3J B;  2JA8 B;  4H13 C;  1YZ6 A;  2F0D A;  1EY9 A;  4GNX A;  3MC0 B;  1FNV A;  1SYD A;  2NVQ B;  1VQF A;  3KBX A;  5FLM G;  2WB1 G;  5IGG A;  3GTJ H;  5FJ8 H;  2PPB C;  4C2M H;  1JOQ A;  3S15 H;  4AIM A;  1D2B A;  4NP5 A;  3M7N A;  1Y8P B;  2F0T A;  3MVV A;  2DGY A;  4H7B A;  2UUA L;  4A3J H;  1KDA A;  2NB0 A;  1YIT A;  2IX1 A;  3HOV G;  3L9A X;  4A3M B;  1PHJ A;  4CBV A;  4A3D H;  1TWA B;  4HMJ A;  4X66 Q;  3WOF A;  3H3V C;  2ZT9 C;  3S17 H;  2E2H B;  2SNS A;  1X55 A;  2K5N A;  3G4S A;  4CKE A;  3U4V A;  1FJG L;  4G4K A;  1HZ9 A;  4NKL A;  4EX5 A;  4A3I H;  4FVM A;  2RQX A;  4ZCK A;  1KD1 C;  3AFP A;  2WB1 E;  1CFM A;  5A2Q E;  3CMA A;  1I4P A;  2FMM A;  2C35 B;  1F9S A;  3M4Y A;  4KHP Q;  5E4W C;  2HT1 A;  5C0X H;  1HFN A;  2CFM A;  4DV7 Q;  3CAM A;  3ND8 A;  1TWF B;  3F1Z A;  3SHL A;  4MN3 A;  2FJ2 A;  3B6Y A;  1FR3 A;  3VA7 A;  2F0H A;  4YCV A;  4ODG A;  3X3M A;  1I50 H;  3KOJ A;  4FP5 D;  2F0G A;  5IGD A;  1KAB A;  2ZJQ A;  2XIW A;  5CR3 A;  1A6X A;  2IJ0 A;  1JT8 A;  5ELC A;  5FO9 B;  1A2U A;  2JA5 B;  3HOX G;  4GS3 A;  4AQY Q;  4MTN A;  1IYU A;  1EEI D;  4M8A A;  5JJK A;  3A8J E;  2EY2 A;  2OQ0 A;  3SEB A;  2Y0S E;  2RBM A;  5IYB H;  1OXX K;  4X3S A;  3A54 A;  2I07 B;  3OW7 A;  1ENF A;  3HOU B;  1E22 A;  1F9P A;  1ICF B;  1B70 B;  1EY6 A;  1TII D;  2AHO B;  1Z6H A;  2KQ3 A;  1VQL A;  4CKC A;  1HUM A;  3OIQ A;  2B2Y C;  3PGZ A;  2KJX A;  5FLX c;  1EFI D;  2B63 B;  3Q23 A;  4B3R L;  2KEN A;  1UWV A;  3S15 B;  2AQ3 B;  4DR7 Q;  1QUQ B;  1ET9 A;  1JE5 A;  3KYH C;  4QIW B;  4JBW A;  1D8L A;  1CK1 A;  2HDL A;  3EBE A;  1VF5 C;  3VDY A;  1RTN A;  1EQV A;  3PIP 3;  1PLF A;  4NMZ A;  1TR5 A;  2QIL A;  3OSO A;  1TS2 A;  1HZB A;  3VR2 A;  1I3Q H;  2KCM A;  4JI0 L;  3K80 C;  3A74 A;  4N9T A;  1BO0 A;  4A93 H;  1CM9 A;  5I9O A;  4BWG B;  1EY0 A;  2A6H C;  4S3S A;  1QIL A;  4Y7N H;  5JPM C;  1JMC A;  4XXE A;  2EVB A;  2DN8 A;  5LL6 S;  4M1U B;  4BBS H;  4DUY Q;  2CH4 W;  3GTQ B;  4KTA A;  3NPP A;  2VB3 X;  2OQK A;  4LUZ A;  4KY7 A;  2J4X A;  3QOJ A;  4LF6 Q;  3RZO B;  4L8J A;  1JB3 A;  3STB C;  3Q24 A;  3M3Y B;  2B2U C;  3E0J A;  2K03 A;  2D2C C;  2R92 G;  4X3U A;  3EA6 A;  3OOC A;  1VCI A;  3F8T A;  5F2D A;  1KQS A;  3PO2 G;  4WJW A;  3RN5 A;  4NW2 A;  1XPO A;  1BF4 A;  1C8C A;  2G9H D;  4R4Q A;  1CKN B;  3MA2 B;  2A6E C;  1YNJ D;  2PNR C;  4JYA L;  1LT4 D;  4GZY C;  4KKS A;  2N3S A;  1VQJ A;  3D4W A;  4XIG S;  3OTO Q;  3I4L A;  1BXT A;  2NBF A;  1QNU A;  4J6H A;  1V1O A;  5FLX E;  3CU7 A;  4KK7 A;  1SYG A;  2R7Z B;  4O0A A;  3R2I A;  4N8X 1;  2OCE A;  1Q3L A;  4GLV B;  2E2J H;  3CXC A;  4RCN A;  4DR1 L;  4FF4 A;  1Y1W B;  5FKA C;  3HOZ B;  4IUQ A;  3MXG A;  1WJJ A;  1SR3 A;  4JBJ A;  2F0W A;  3NTH A;  3J81 L;  1DOM A;  4JI1 Q;  2E2D C;  5C44 H;  1Q1B A;  2B2T C;  4J8Q A;  2E75 C;  4FO2 A;  2E2H H;  4JYA Q;  1CI3 M;  1C0A A;  3SXH A;  3VR6 A;  1C7Y A;  3C1F A;  4DNI A;  3MEH A;  2F03 A;  4IN3 A;  1A3U A;  1ENA A;  1GUS A;  2B29 A;  4C3J G;  1HCZ A;  1EEF D;  4EVO A;  4A3E G;  2JA8 G;  3HOY H;  2PCF B;  1GUO A;  4KD4 A;  1T9H A;  1LLR D;  2D0P A;  1EFW A;  3GTO B;  1QNK A;  2J7Z A;  3HG9 A;  3G6J B;  3MWY W;  1GUG A;  3GP7 A;  2E8G A;  4RGO S;  4HN7 A;  4PMC A;  4ZLT F;  5I6W A;  1CHP D;  1L2F A;  1TY0 A;  1I5F A;  3SGI A;  4DV2 Q;  2CW0 D;  4GOP B;  2NZ1 D;  1DGS A;  1YBY A;  1H9S A;  4DNR B;  3TQY A;  5EPJ A;  1KNE A;  5I2X A;  1X54 A;  3KF8 B;  3EVQ A;  3NP8 A;  3MAQ A;  4A3B G;  1HQM C;  1P16 A;  2LFN A;  4BY1 B;  4DV4 L;  3OWE B;  4QY7 A;  4UP8 A;  1TWH B;  2NVY H;  5LMU Q;  2IHF A;  2VB2 X;  2RVL A;  4LF8 Q;  4IUN A;  2RDG A;  3AMU A;  3G6E A;  3M4O B;  1PH6 A;  4DR6 Q;  1Q12 A;  3AFQ A;  3UDX A;  4UPA A;  1PYW D;  3SR1 A;  1VQK A;  1XMQ Q;  1XNR Q;  1BCP B;  3J80 i;  3URY A;  2F4V L;  1D1I A;  4DKA C;  1X3G A;  1TWA H;  5DEH A;  4K5W A;  3CQZ B;  1K8A C;  4A3L H;  4DK6 C;  3ITP A;  1HA5 A;  5EQ0 A;  4A75 A;  1Y1W H;  5EKI A;  4LF6 L;  1GHJ A;  3F2B A;  3L7Z C;  1FL0 A;  2DJG C;  2K01 A;  4IZ8 A;  4Q0F A;  2K5Q A;  1F77 A;  2SDF A;  4K14 A;  4DR4 L;  3VR3 A;  1ZKO A;  4HIO A;  2F3W A;  1L1O B;  2G5D A;  4IUV A;  4GNX C;  1H9R A;  3S24 A;  2PI2 A;  2HD3 A;  1FNU A;  5C4X H;  4DV3 L;  1GM5 A;  1EQR A;  4XDX A;  1NMF A;  4B9W A;  4P2C B;  3S1Q B;  3D6C A;  3W2D A;  1SNM A;  5C3X A;  3UDF A;  5D3I B;  1KLG D;  1EQT A;  5J39 A;  2N49 A;  2XRS D;  1LAB A;  1B53 A;  1CSP A;  1KDB A;  3NSW A;  4QF4 A;  4TVA B;  3QO2 A;  3T51 B;  3CD6 A;  4I7Z C;  2A69 C;  1LTG D;  3K81 C;  2IWH A;  5M3F G;  2E2I H;  3OTO L;  1XNQ Q;  4OX9 L;  1Z7T A;  2LS0 1;  2MO1 A;  3I4N H;  1S5E D;  3RLF A;  2O4X A;  5EAY A;  5EJW A;  3LWU A;  4DAM A;  1ILQ A;  3TDQ A;  3MXU A;  4GOP A;  4LF9 L;  3DEP A;  5IGB A;  4JOI A;  1GUT A;  2LSS A;  4X6A H;  4KN7 C;  2KA7 A;  5M3M H;  3A7L A;  1QZG A;  2RSN A;  2VUM H;  4BA1 I;  4K6L A;  5K36 H;  5GAD C;  1XJV A;  3P20 A;  5J3B A;  4P71 A;  3UE0 A;  3NXW A;  5EKK A;  4DUZ Q;  2MHV A;  4POF A;  2F4I A;  1IW7 C;  5IP9 G;  3OYY A;  4K0K Q;  4A3K H;  3NTK A;  3F2D A;  5GAG C;  1E1O A;  4XT1 B;  4DV7 L;  1JJC B;  3A8I E;  1STG A;  2EXZ A;  1SYC A;  3TP7 A;  3NE5 B;  1XMO Q;  1I6H H;  4TSS A;  4U68 A;  5G3L F;  1JOR A;  1SE2 A;  4CDE C;  4FDB A;  3CPW A;  3HOY G;  1XMQ L;  2UUB Q;  1XNR L;  1IBM Q;  2JA6 H;  4Y7N B;  3JAM i;  4DV0 Q;  4QCL A;  3V2T A;  3CF5 A;  4K6D A;  2Z6B A;  4FYD A;  4RKB A;  1VDZ A;  2ZXO A;  2KBN A;  1J5E L;  1BDO A;  3A5Z B;  1OXV A;  1D6E C;  4BY7 B;  3RZO H;  3JC6 6;  5IY0 A;  3J7Y W;  2B8F A;  1IBM L;  3HOZ G;  3CPF A;  2V4D A;  1S72 A;  3BVG A;  3KDF B;  1BQQ T;  1Q46 A;  4RGT A;  3S1M H;  3S14 B;  3I4O A;  5CV8 A;  1EOV A;  2Q2H A;  4LF5 Q;  2ZTE A;  2ZTD A;  3SK4 A;  4A3F G;  1X65 A;  1JJ2 A;  1CKN A;  3ULL A;  3MXN B;  1PTO H;  1Z9F A;  5DLQ E;  2QA4 A;  3FVQ A;  1PDQ A;  2YTV A;  3T1H L;  3PCO B;  1NCV A;  1YNJ C;  1RL2 A;  2ENB A;  2KCN A;  5GAE C;  4IFD I;  1WTR A;  1VS0 A;  1K73 C;  4ULL A;  5LL6 X;  1CKM A;  3VR4 A;  3NHH A;  3L2P A;  1Y1V G;  1DOK A;  5M3M B;  1EWH A;  4LF7 Q;  2MGS A;  3M7G A;  2UXB Q;  2MFI A;  4AH6 A;  2GN5 A;  5JEA H;  5HGQ A;  2D9U A;  3I3C A;  4XQJ A;  1HUN A;  3KLW A;  1ASY A;  3DM1 A;  4C3I G;  4A3M G;  1JIC A;  3GO5 A;  2B2W C;  2WV6 D;  4H44 C;  3S1R H;  2UU9 Q;  4LF9 Q;  5D14 A;  1EQQ A;  1VQ9 A;  3HGB A;  1S4Z A;  1HZA A;  1JR0 D;  3AEV A;  2QCP X;  2A6H D;  4A93 G;  5JPN C;  2HDM A;  2SOB A;  1PRT B;  1R4Q B;  2XGT A;  1SN8 A;  1GXD C;  1JWM D;  1OXU A;  1N36 L;  3RZD B;  3PUY A;  2B2U A;  4BBS B;  4N9P A;  4IPC A;  1HZC A;  4X3K A;  5FJ8 G;  2A69 D;  1IBL L;  4JI4 Q;  1UEA B;  2BDO A;  1KRS A;  1K28 A;  5JJL A;  3C3L A;  1ENC A;  4X62 Q;  2MJ8 A;  4AYB B;  5CV4 A;  1FGU A;  1LAC A;  1PH4 A;  1V43 A;  4LJZ C;  1IBK L;  3T1Y L;  3EJI A;  4C3H B;  3CC7 A;  1LTR D;  1NNX A;  1X3Q A;  3ICE A;  1M8A A;  1K83 H;  1DON A;  1ZXT A;  3V96 A;  5DNF A;  1LTA D;  2NZH A;  4JI1 L;  1V1P A;  1HR0 L;  3HOW B;  2WIN B;  3CKI B;  1CQV A;  3K5L A;  2R7Z H;  4K2K A;  2F0S A;  2RHQ B;  4DR1 Q;  1EYG A;  1S5D D;  5M3M G;  1PH8 A;  4O42 A;  5FOB B;  3PMF A;  1FYC A;  2Q2I A;  3T1H Q;  1Z47 A;  1WTQ A;  4IFD G;  2R3Z A;  4V19 0;  1ESF A;  3CCV A;  3MFG A;  1QB5 D;  3NTI A;  2R93 H;  3HKS A;  4P75 A;  5EKL A;  2P5Z X;  1CUK A;  2WP8 J;  4A3D B;  1SND A;  3UE1 A;  1UUP A;  5IYD H;  4ZKC B;  2Z9H A;  1G2S A;  4XQQ A;  4K5X A;  5FLM H;  2LY7 A;  1JE4 A;  3TZU A;  2F0E A;  3N6R A;  2G9D A;  3J80 c;  2C9O A;  2XVS A;  4LUO A;  4A76 A;  1YJN A;  2MP1 A;  5C3W A;  5IOC A;  4DAP A;  5HUR A;  4KMU C;  1JOK A;  4GLX A;  1QZH A;  4JI0 Q;  2JQO A;  1Y1V B;  2I5L X;  3HS0 C;  2CHB D;  1VQ7 A;  3CCM A;  3AYH B;  1AE3 A;  5NUC A;  3CRL C;  4KN4 C;  1YIJ A;  4GKK L;  4A4I A;  3GTP B;  4C3I B;  2UXB L;  2V1C C;  3ULJ A;  2UUA Q;  4DPG A;  2FIN B;  2GA4 B;  2K5D A;  2AQ2 B;  1S5F D;  4L63 B;  4PZ8 A;  2B2V C;  4CDF C;  5CGK A;  3K6O A;  3J81 i;  1KAA A;  3H15 A;  4R8I A;  1QVF A;  5C0X I;  2VUM B;  2AWO A;  1KNA A;  3QOL A;  4MZ9 A;  1WI5 A;  4DV4 Q;  1E1T A;  4JW0 A;  4IUP A;  4NXM Q;  3IFD A;  3DUZ A;  3BS1 A;  4IFD J;  3TS0 A;  2JA9 A;  2IY5 B;  4R4I A;  2CW0 C;  2WAQ B;  1TQO A;  3ZYY X;  1I4X A;  5C3E G;  4A3J B;  1SMX A;  4HJA A;  3TSS A;  3SK8 A;  3F2C A;  4YHH Q;  3KF6 B;  4JC0 A;  1S40 A;  3S17 B;  1V1P B;  2IX3 A;  4X3T A;  4L6T B;  3T1Y Q;  5M5X H;  3BU2 A;  5L37 A;  4UHV A;  3WDN A;  2D0O A;  1JWS D;  1YHB A;  5CV9 A;  1PFN A;  3I4N G;  3S2H H;  1D7Q A;  1KIX A;  3RLN A;  2ICE C;  3G48 A;  5ELD A;  5EPK A;  4R1J A;  1G51 A;  2OTL A;  5BN4 A;  4G57 A;  2C5C A;  3W1G A;  1K3B C;  3QR8 A;  5IIF A;  1C48 A;  3SK5 A;  5G3L D;  2BDN A;  3PIO 3;  1CTM A;  1KHI A;  4Z9C B;  1F2L A;  1N9W A;  1PV4 A;  1TT2 A;  5M5W H;  1YNN D;  2EYP A;  1V1Q A;  1SRU A;  2VQE L;  4POG A;  1ROD A;  1ONL A;  4DK0 A;  2UXC Q;  2K28 A;  3KLR A;  2EJG C;  4HTH A;  3TME A;  5C44 G;  5A2Q L;  2MUY A;  2R92 B;  1VF7 A;  4DUZ L;  4APV A;  2F0O A;  2RCF A;  5IP7 G;  1NBW A;  2CH4 A;  5LHY 1;  5AJ3 L;  4KHV A;  3U58 A;  3I8Z A;  3SDZ A;  4J15 A;  5KNB A;  1K8G A;  4YWK A;  2XNA C;  4C3J H;  2EDG A;  2XSC A;  4A3B B;  1I6V C;  2OWO A;  3DHQ A;  3J7A F;  1CQF A;  3K57 A;  1HNW Q;  3TRE A;  1HHV A;  2R7Z G;  1BUV T;  3TZD A;  1STY A;  2PW5 A;  4OGQ C;  5JJI A;  5LMU L;  2ICI A;  1E0B A;  3SVM A;  2ZM6 Q;  3KK7 A;  2ES2 A;  2WAQ G;  4PMB A;  4DK3 C;  2O2L D;  4Y52 H;  3KBG A;  4IO9 A;  2RA4 A;  1O7Y A;  4JI5 Q;  1N34 L;  4R9W A;  2EPB A;  3HOZ H;  3FKI B;  2AWN A;  4KV6 A;  2K5H A;  4DXF A;  1BCP F;  5I9P A;  3FPU B;  4DR3 L;  2R93 B;  1LV9 A;  2JA5 G;  4CDC C;  2YTX A;  4N8F A;  3HKZ B;  5JOB A;  2A8V A;  1X3F A;  3PO2 B;  1EUJ A;  1MIU A;  2L11 A;  3KUP A;  4MHE A;  1EU3 A;  2Z4H A;  1ASZ A;  1H95 A;  1NMG A;  4UP7 A;  4LFB Q;  3J80 L;  4TKO B;  1A8V A;  2VQF Q;  1A0I A;  4DNT B;  1LM0 A;  2JN4 A;  3S2H B;  1IKL A;  2PW7 A;  2XTI A;  4PQX A;  5LMN Q;  2GVA A;  2B2Y A;  2K5V A;  5E1F A;  3MZ5 A;  1BBX C;  2NN6 G;  4JBM A;  1RJT A;  4IOC A;  2OTJ A;  2DUD A;  1TWG H;  1QOH A;  1EY4 A;  2WKC A;  1EY8 A;  2B39 A;  3K58 A;  2Z1C A;  4XTC S;  4LFC Q;  1PH1 A;  4LF4 L;  1YEZ A;  4C3I H;  5CV5 A;  3M3Y H;  1TS5 A;  2CQA A;  4CDD C;  1UEB A;  2JK8 A;  1B9N A;  2B2T A;  4EQN A;  3VYT A;  1HNW L;  4J1M A;  5COY A;  5KEE A;  1VQP A;  4ALP A;  1JOO A;  1SFO B;  3S1N H;  4PZ6 A;  4JCV E;  1K9M C;  1N32 Q;  2L15 A;  1SYF A;  4K8I A;  4IPD A;  1PTO D;  2LKV A;  2ALY B;  3NEN A;  5EBD A;  2JA6 G;  5JEA G;  3DXJ C;  3KF6 A;  2BOS A;  1MI2 A;  3LWE A;  2HHH Q;  2YV5 A;  4A3M H;  2NVT B;  1SJE D;  1BKB A;  5E7N A;  3S1R B;  1J5E Q;  5ELF A;  3KF8 A;  2H1E A;  4NXN Q;  1H9M A;  4QGU A;  4DGZ A;  1EYA A;  4ME3 A;  1IKM A;  2L9H A;  1NR2 A;  4NDX A;  1MJC A;  3HKZ G;  3CQZ H;  2A1A A;  3TEH B;  1SLJ A;  4LFC L;  1Q82 C;  1MKH A;  3GTG H;  3OW2 A;  4A3G G;  3H94 A;  1Q81 C;  4RH6 A;  3PF4 A;  4JPB W;  3T4A C;  2VY3 A;  1A2T A;  3LGJ A;  4F7X A;  4DAY A;  4BBR H;  4UDU C;  2JA7 G;  2N78 A;  3D31 A;  4GOP C;  3U50 C;  2CCZ A;  4GLA C;  3BZD B;  3FMC A;  4GKJ Q;  1GOZ A;  4B3R Q;  1GO3 E;  1I4Q A;  3MXN A;  3J7Z C;  5C4X G;  4DR2 Q;  4K0K L;  1LTI D;  4HJ5 A;  3DWA A;  2E5L L;  4BXX G;  4YY3 L;  5ELE A;  2NWG A;  4X65 L;  1Y1W G;  1FNW A;  1FJG Q;  1RHP A;  3K0Y A;  2Q8R E;  3GTP H;  3KDF A;  4WOR A;  4JI7 Q;  1A3V A;  4DU9 A;  2NN6 I;  1RD9 D;  2K1B A;  2BA1 A;  5EPL A;  3ERQ A;  1TWG B;  3I4M H;  3IAY A;  1Q90 A;  4LUV A;  2HIX A;  1II3 A;  3GTK H;  1IZ6 A;  1N34 Q;  4B3S Q;  2OT2 A;  3QWN A;  1NAP A;  5IYC G;  1W6J A;  3AB9 A;  4OX9 Q;  3EIV A;  1XNQ L;  3GTM B;  1P8L A;  1RF2 D;  2EYJ A;  2UXD Q;  2WB1 B;  1K8M A;  1XX8 A;  3TS2 A;  1U9R A;  4DK1 A;  1T5E A;  1ESR A;  1TVX A;  2K52 A;  2EYL A;  2HQE A;  3V05 A;  2B3G A;  4ZUI A;  2X69 A;  2K75 A;  1F2Z A;  1PZJ D;  2HQL A;  5CV6 A;  1RCV D;  1PH5 A;  2SEB D;  2ZXR A;  1TU2 B;  4O1N A;  1YJ9 A;  5C44 B;  1WOC A;  1F9Q A;  4JI6 L;  1CT1 D;  4A3K B;  5KGU A;  4DAV A;  1HNZ L;  2WKD A;  3UDG A;  2I0Q A;  3CW2 C;  4B9X A;  1MD2 D;  2X6L A;  1BVS A;  5EGT A;  3VYS A;  5BN5 A;  4WJ3 M;  1G6Z A;  2JSO A;  3J81 E;  3MEF A;  3GTG B;  5CMD A;  4KHP L;  3GV3 A;  3PF5 A;  1Y1V H;  2DJF C;  2BE5 C;  4RMF A;  4X64 L;  2B2W A;  5COR A;  3HP3 A;  4JI2 L;  2JA6 B;  4R4O A;  1NUC A;  4RHS A;  2F4V Q;  1O7Z A;  2BA0 A;  4BA2 I;  3RD4 A;  1F2M A;  2CWP A;  3F2U A;  3H0G H;  1XPR A;  1MGS A;  4KD3 A;  4C3H G;  4OHJ A;  3P1H A;  4KKU A;  5CBE E;  4ME5 A;  1BOS A;  1O80 A;  4JV5 L;  1G91 A;  4NXN L;  2VQF L;  1VQH A;  2A68 C;  4HCE A;  3T56 B;  2R93 G;  1STB A;  4WRD A;  4A3B H;  4YIJ A;  4UP9 A;  4XYO A;  2YYZ A;  1NSN S;  4A3G B;  1TWH H;  2NVY B;  5KNC A;  1SFO H;  3FP9 A;  1PFM A;  2ZJP A;  1LT3 D;  2E2J B;  1U4M A;  1GJX A;  4AQY L;  1LTL A;  3M4O H;  3R2T A;  3UI2 A;  3PV0 A;  4KJN A;  3GTM H;  4KLK A;  3PO3 G;  3IL8 A;  5AFW A;  2K04 A;  2A6E D;  1N33 L;  1HNX Q;  3GTJ B;  4KJO A;  2NVT H;  3HKZ E;  3IFT A;  4R8N A;  1KL9 A;  4ID6 A;  4DV1 L;  2WAC A;  1DM0 B;  4K8J A;  3U9O A;  4X62 L;  4OO1 G;  3J7A V;  1BR9 A;  1PZI D;  3STB D;  4A3F H;  4EQO A;  2RDF A;  4GNX B;  5IWA Q;  1Q8K A;  2JEA I;  2JE6 I;  3BDL A;  1K0R A;  4OXP A;  1WVL A;  4YWM A;  1MSG A;  1I94 Q;  1B44 D;  3M4Q A;  2K5W A;  5C0X J;  4QUC A;  2EYF A;  1ZEQ X;  3QIA A;  2L0C A;  4CJ2 C;  2XWB B;  1D5M C;  3PUV A;  4RAU C;  2QGQ A;  4FF1 A;  1KC8 C;  3K59 A;  2AMC B;  1LYL A;  4LW1 A;  1BNZ A;  2GVB A;  5ELB A;  5I4D A;  3QB3 A;  3M85 A;  3GTL B;  1NY4 A;  2N8N A;  3D6W A;  1SNQ A;  1W6K A;  3E9I A;  4IFD H; 
#chains in the Genus database with same CATH homology
 1SMY D;  1Y8N B;  2L1B A;  1CZW A;  1JCK B;  5A35 A;  4FXK C;  4HSV A;  3FRP B;  5CBA E;  4HCS A;  2NUC A;  3DMU A;  3IKJ A;  1J8I A;  1I50 B;  5IOD A;  2N55 A;  4ZRZ A;  3MTS A;  4H0L C;  1PTO B;  2MPM A;  1I4R A;  1A3T A;  2E76 C;  3E6Z X;  1G2T A;  5IT9 L;  2N88 A;  1Y69 U;  1B4O A;  4ILW A;  1D1K A;  2A5H A;  2KVM A;  2Q8I B;  3Q0A A;  2XWJ B;  4ZYS A;  1SYB A;  2JEB I;  3C46 A;  1LO5 D;  2PMZ B;  4K2L A;  2WII B;  4A3F B;  1X3P A;  4OO1 I;  1RDP D;  3S9W A;  3PUX A;  1YNN C;  2EYH A;  4BBR B;  3LX0 A;  5EBC A;  1Y8O B;  2Z4I A;  2NN6 H;  3SK6 A;  1NR4 A;  2CVR A;  2PZU A;  1UNS A;  1TS3 A;  2NTT A;  5J22 A;  2QDB A;  1RKN A;  5C0X G;  3BDC A;  3I73 A;  3GQB A;  1JC7 A;  2QEJ C;  1B9M A;  1HXY D;  2IL8 A;  1GUW A;  4IUT A;  2EJM A;  2NVX B;  3TP5 A;  1WTX A;  3MHB A;  2B8G A;  4B08 A;  1SE4 A;  3EFX D;  1PXU A;  3KLS X;  2A68 D;  2D5D A;  2K05 A;  3N52 A;  4FF2 A;  5BN3 A;  2Q8T A;  5M9O A;  1KLU D;  1MBY A;  3L3O C;  1SE3 A;  1EY7 A;  5C3E B;  1EZ6 A;  5JJZ A;  3TP8 A;  2PZW A;  1BCP D;  2F0V A;  4G7H C;  1TY2 A;  1DYQ A;  1I3Q B;  4DA2 A;  5M5X B;  1EIG A;  1I4G A;  1AZP A;  4TQU S;  1LT6 D;  5IGF A;  1BCP C;  4QMG A;  2RKS A;  1EOT A;  1QJO A;  4XYQ A;  1I4H A;  5M5W B;  4V0B A;  1K8O A;  1LTB D;  2X6G A;  2DNE A;  1WD1 A;  1QG7 A;  4IAL A;  1HQR D;  3K5M A;  2OF1 A;  5FLX L;  1U4R A;  1EY5 A;  3QG1 A;  4HMI A;  4RHR A;  3A7A B;  4ZAI A;  5IGE A;  1ET6 A;  1Q8I A;  2HUG A;  1PRT D;  3OPO A;  2EOT A;  4ZK9 B;  2EE1 A;  4XT3 B;  4QB4 A;  4FXD A;  1R9T B;  1DCZ A;  5C5M A;  1B3A A;  1IYV A;  1S5B D;  1F2Y A;  2DY7 A;  5T1G A;  3T53 B;  4DN4 M;  4HR7 B;  1SSO A;  5FO7 B;  5K5P A;  5E4X A;  4JK1 C;  2EY6 A;  3HOV B;  1A15 A;  2M00 A;  2DNC A;  3BVM A;  1DXM A;  2KCC A;  2J0T D;  2FMC A;  5CYU A;  1GHK A;  3FPP A;  4CHT B;  2F0I A;  3R8B A;  3DWP A;  2R61 A;  3H6M A;  3OHX C;  5KND A;  4HED A;  1AW7 A;  3P7J A;  1R4P B;  4C1N I;  4OIJ A;  2K7V A;  1K83 B;  1ZYR D;  5KYI A;  4RCO A;  2F0J A;  3RUZ A;  1CZG A;  3PUW A;  1SEB D;  3NWS A;  2F0P A;  1PTO C;  1STE A;  3TP6 A;  2KHS A;  3I72 A;  1ML0 D;  2EJF C;  3NQI A;  4A3E B;  3I4N B;  3LNN A;  3I70 A;  1XWE A;  3ND9 A;  2IW3 A;  1KTK A;  3S1N B;  1STA A;  4EGV A;  1SBB B;  1DJR D;  2F0M A;  2RSO A;  3NK9 A;  2L12 A;  1WTV A;  3NUC A;  3K5N A;  4KHZ A;  5JVH 3;  4RA8 A;  4TRD A;  2PZT A;  2YU9 B;  1EYD A;  4IQZ A;  2EY1 A;  1LT5 D;  4A93 B;  1ILP A;  1SDF A;  3DWQ A;  5KYL A;  2SNM A;  1SNP A;  1AZQ A;  2OXP A;  3KLS A;  1MSH A;  4LAA A;  3RMH A;  2EY5 A;  4PV1 C;  4F8M A;  2F0N A;  4K5V A;  2D62 A;  4ZUJ A;  2PYK A;  3MXP A;  1U4P A;  3Q22 A;  2ID0 A;  2F1M A;  3NQT A;  1O78 A;  1RTO A;  1SNC A;  4CJ1 B;  1UAP A;  2KED A;  5FO8 B;  3S1M B;  1X32 A;  3I4M B;  3PUZ A;  1IW7 D;  1IHZ A;  3JAM L;  1G8Z D;  1FGB D;  2EYM A;  1B1Z A;  4HSP A;  2DY8 A;  3TBI B;  1D5X C;  2HCC A;  4DXG A;  2LMC B;  1QE6 A;  2A74 C;  2QKI C;  1TWC B;  1STN A;  2AUK A;  5K36 G;  3VR5 A;  1KDC A;  1GUN A;  3H09 A;  4LK1 C;  4C2M B;  3JAM E;  2PQE A;  1PMR A;  2K33 A;  1STH A;  5C4J B;  5M3F B;  4EQP A;  3BVZ A;  3A56 A;  2O5I C;  1ICW A;  2F0F A;  3S16 B;  2JP1 A;  3MFY A;  1C4Q A;  1H9J A;  5D3D A;  4A3I B;  1AEX A;  4PMW A;  4KY5 A;  1D5Z C;  2IT1 A;  1E2V A;  3VYR A;  4LMQ D;  3T13 A;  3J80 E;  2IPK D;  3CRK C;  2KEC A;  4CJ0 B;  3E5S A;  3FDT A;  1LTS D;  1OXS C;  2E2I B;  2R6G A;  4MIU A;  2FFK B;  1QCB D;  1DD2 A;  1HFG A;  5C5L A;  2NYZ D;  1AN8 A;  1HTL D;  2F0Q A;  5JEA J;  1Q1E A;  1XTC D;  3GTK B;  3I90 A;  1E2W A;  2EZV A;  3CHB D;  3Q6S A;  1WTO A;  4IUU A;  2JA7 B;  3FEW X;  3OIP A;  3R93 A;  5I2Y A;  4I65 A;  1QWY A;  2TMP A;  2KOL A;  1PTO F;  4FNF A;  5ISR A;  5E3F A;  3GV6 A;  4Q5V A;  2IX0 A;  1PZK D;  5M5Y B;  3NBH A;  5C6A A;  1AP0 A;  1HA6 A;  4KI0 A;  4E6I A;  2O5J C;  3ERO A;  4RKL A;  2FHT A;  1I6H B;  2VXW A;  3D4R A;  3ONA B;  3TN2 A;  1PFB A;  4C1N K;  3VYU A;  2A73 B;  5JAV A;  4KKT A;  1L0X B;  1WD0 A;  4F88 A;  4G7O C;  1SNO A;  4QUF A;  5DM6 3;  4OL7 A;  3DEO A;  3OMG A;  1EIH A;  1O7L A;  1DZ1 A;  5HGT A;  1CA5 A;  3H0G B;  4BS9 A;  5J1Z A;  4FF3 A;  3K7A B;  3W3A A;  2F0K A;  1WCM B;  1VMP A;  1M4V A;  1U4L A;  1E2Z A;  1VMC A;  1EL0 A;  1FD7 D;  4RFB A;  5CV7 A;  4ZKB B;  3SE0 A;  5D65 A;  1SXT A;  2HCI A;  2JYO A;  2ZXP A;  2OEO A;  3X3N A;  1OO9 B;  2AQ1 B;  1JWU D;  4U67 3;  3OWF A;  1SJH D;  4OIK A;  2L5T A;  1ZYR C;  1EU4 A;  2K6A A;  4FXG C;  2K32 A;  3HOX B;  5IGC A;  1SMY C;  1CA6 A;  2XRQ D;  3VA5 A;  3EQL C;  2NTS A;  4IUR A;  1EWC A;  1H9S B;  1JQY D;  3AU7 A;  1TKW B;  2PO4 A;  3I91 A;  1EYC A;  3HOY B;  5DAU A;  5TSS A;  3PO3 B;  1CHQ D;  2Y0S B;  1T5X D;  3HEJ A;  2L55 A;  1OXT A;  2F0U A;  3NWT A;  1AFP A;  2E74 C;  2BE5 D;  4F87 A;  2AUJ D;  1SYE A;  2VNU D;  4G7Z C;  2EYO A;  2RDH A;  3D3R A;  1B2T A;  1SAP A;  5DM7 3;  5C4H A;  1S5C D;  5FK9 C;  4RGM A;  4KY6 A;  2M9V A;  2F3V A;  1LTT D;  3D8G A;  3WOE A;  1XYI A;  4WFN 3;  1HRJ A;  4DF7 A;  4CKB A;  1PRT C;  3U9S A;  3P75 A;  2TSS A;  1F9R A;  1XXG A;  3BG3 A;  1G29 1;  1DOL A;  2BCO A;  3S2D B;  2JXM B;  4RGN A;  4OO1 H;  5JVG 3;  3GD7 A;  1HTP A;  1B50 A;  1HPC A;  2L4N A;  4C56 C;  3NBI A;  5IT9 E;  1WTP A;  3T16 A;  3O13 A;  1H9K A;  5CC4 A;  4CGY B;  4XQN A;  3OMC A;  2M2L A;  3A8K E;  5T1I A;  5KIX A;  4ZQ3 A;  1WTW A;  1PRT F;  5C4Z A;  2Z8L A;  1EZ8 A;  4PNY A;  1L0Y B;  3A55 A;  1J9O A;  3QJY A;  5KRU A;  3C1E A;  4RWS C;  3H91 A;  2H4O A;  1IL8 A;  3BYT B;  5C4X B;  5I6Y A;  3G7L A;  2QF7 A;  3D4D A;  3K5O A;  4DFA A;  4UAI A;  3C2P A;  3BDO A;  2B2V A;  3HZX A;  2F0L A;  2XN9 C;  4ABN A;  2KUM A;  1TS4 A;  4HAE A;  3R3O A;  2I46 A;  1V8Q A;  2KEE A;  3BYY B;  3HRZ C;  4C3J B;  2JA8 B;  4H13 C;  2F0D A;  1EY9 A;  3MC0 B;  1FNV A;  1SYD A;  2NVQ B;  3KBX A;  5IGG A;  2PPB C;  1JOQ A;  1D2B A;  4NP5 A;  3M7N A;  1Y8P B;  2F0T A;  3MVV A;  4H7B A;  1KDA A;  2NB0 A;  2IX1 A;  3L9A X;  4A3M B;  4CBV A;  1TWA B;  4HMJ A;  3WOF A;  3H3V C;  2ZT9 C;  2E2H B;  2SNS A;  4CKE A;  4G4K A;  4NKL A;  4FVM A;  2RQX A;  1CFM A;  5A2Q E;  1I4P A;  2FMM A;  1F9S A;  3M4Y A;  5E4W C;  5C0X H;  1HFN A;  3ND8 A;  1TWF B;  3SHL A;  4MN3 A;  2FJ2 A;  1FR3 A;  3VA7 A;  2F0H A;  4ODG A;  3X3M A;  4FP5 D;  2F0G A;  5IGD A;  1KAB A;  2XIW A;  5CR3 A;  1A6X A;  2IJ0 A;  5FO9 B;  5ELC A;  1A2U A;  2JA5 B;  1IYU A;  1EEI D;  4M8A A;  3A8J E;  2EY2 A;  3SEB A;  2RBM A;  1OXX K;  4X3S A;  3A54 A;  2I07 B;  3OW7 A;  1ENF A;  3HOU B;  1F9P A;  1EY6 A;  1TII D;  1Z6H A;  2KQ3 A;  4CKC A;  1HUM A;  3OIQ A;  2B2Y C;  2KJX A;  2B63 B;  1EFI D;  3Q23 A;  3S15 B;  2AQ3 B;  1ET9 A;  4QIW B;  4JBW A;  1CK1 A;  2HDL A;  1VF5 C;  1RTN A;  1EQV A;  3PIP 3;  1PLF A;  4NMZ A;  1TR5 A;  2QIL A;  3OSO A;  1TS2 A;  3VR2 A;  4N9T A;  1BO0 A;  1CM9 A;  5I9O A;  4BWG B;  1EY0 A;  2A6H C;  4S3S A;  1QIL A;  5JPM C;  4XXE A;  2EVB A;  2DN8 A;  5LL6 S;  4M1U B;  3GTQ B;  4KTA A;  3NPP A;  2VB3 X;  4KY7 A;  2J4X A;  3QOJ A;  3RZO B;  4L8J A;  1JB3 A;  3Q24 A;  3M3Y B;  2B2U C;  3E0J A;  2K03 A;  2D2C C;  4X3U A;  3EA6 A;  3OOC A;  1VCI A;  5F2D A;  4WJW A;  4NW2 A;  1BF4 A;  1C8C A;  2G9H D;  3MA2 B;  2A6E C;  1YNJ D;  2PNR C;  1LT4 D;  4GZY C;  4KKS A;  3D4W A;  4XIG S;  3I4L A;  1BXT A;  2NBF A;  1QNU A;  4J6H A;  1V1O A;  5FLX E;  3CU7 A;  4KK7 A;  1SYG A;  2R7Z B;  3R2I A;  1Q3L A;  4RCN A;  4FF4 A;  1Y1W B;  5FKA C;  3HOZ B;  4IUQ A;  3MXG A;  2F0W A;  3NTH A;  3J81 L;  1DOM A;  2E2D C;  1Q1B A;  2B2T C;  4J8Q A;  2E75 C;  4FO2 A;  1CI3 M;  3SXH A;  3VR6 A;  3C1F A;  3MEH A;  2F03 A;  4IN3 A;  4C3J G;  1A3U A;  1ENA A;  1GUS A;  1HCZ A;  1EEF D;  4EVO A;  2PCF B;  1GUO A;  4KD4 A;  1LLR D;  3GTO B;  1QNK A;  2J7Z A;  3HG9 A;  3G6J B;  3MWY W;  1GUG A;  3GP7 A;  4RGO S;  4HN7 A;  4PMC A;  4ZLT F;  5I6W A;  1CHP D;  1TY0 A;  2CW0 D;  2NZ1 D;  1H9S A;  4DNR B;  5EPJ A;  1KNE A;  5I2X A;  3EVQ A;  3NP8 A;  3MAQ A;  1HQM C;  2LFN A;  4BY1 B;  3OWE B;  1TWH B;  2VB2 X;  2RVL A;  4IUN A;  2RDG A;  3AMU A;  3M4O B;  1Q12 A;  1PYW D;  3SR1 A;  1BCP B;  3URY A;  1D1I A;  5DEH A;  4K5W A;  3CQZ B;  3ITP A;  1HA5 A;  5EQ0 A;  5EKI A;  1GHJ A;  3L7Z C;  2K01 A;  4IZ8 A;  4Q0F A;  2K5Q A;  1F77 A;  2SDF A;  4K14 A;  3VR3 A;  1ZKO A;  2F3W A;  4IUV A;  1H9R A;  1FNU A;  4XDX A;  4B9W A;  4P2C B;  3S1Q B;  3D6C A;  3W2D A;  1SNM A;  5C3X A;  5D3I B;  1KLG D;  1EQT A;  5J39 A;  2XRS D;  1LAB A;  1B53 A;  1KDB A;  3NSW A;  4QF4 A;  3QO2 A;  3T51 B;  4I7Z C;  2A69 C;  1LTG D;  2IWH A;  1Z7T A;  2LS0 1;  1S5E D;  3RLF A;  2O4X A;  5EJW A;  3LWU A;  1ILQ A;  3TDQ A;  3MXU A;  3DEP A;  5IGB A;  1GUT A;  4KN7 C;  2KA7 A;  3A7L A;  2RSN A;  4BA1 I;  4K6L A;  5K36 H;  3P20 A;  3NXW A;  5EKK A;  2MHV A;  2F4I A;  1IW7 C;  3NTK A;  4XT1 B;  3A8I E;  1STG A;  2EXZ A;  1SYC A;  3TP7 A;  3NE5 B;  4TSS A;  4U68 A;  5G3L F;  1JOR A;  1SE2 A;  4Y7N B;  4QCL A;  3V2T A;  4K6D A;  4FYD A;  4RKB A;  1VDZ A;  2ZXO A;  1BDO A;  1OXV A;  1D6E C;  4BY7 B;  3J7Y W;  2B8F A;  2V4D A;  3BVG A;  1BQQ T;  4RGT A;  3S14 B;  5CV8 A;  3SK4 A;  1PTO H;  3FVQ A;  1PDQ A;  1NCV A;  1YNJ C;  2ENB A;  2KCN A;  4IFD I;  1WTR A;  4ULL A;  5LL6 X;  3VR4 A;  3NHH A;  1DOK A;  5M3M B;  1EWH A;  2MGS A;  3M7G A;  5JEA H;  2D9U A;  3I3C A;  4XQJ A;  1HUN A;  3DM1 A;  4C3I G;  1JIC A;  3GO5 A;  2B2W C;  2WV6 D;  4H44 C;  5D14 A;  3HGB A;  1S4Z A;  1JR0 D;  2QCP X;  2A6H D;  5JPN C;  2HDM A;  2SOB A;  1PRT B;  1R4Q B;  1GXD C;  1JWM D;  1OXU A;  3RZD B;  3PUY A;  2B2U A;  4BBS B;  4N9P A;  4X3K A;  2A69 D;  1UEA B;  2BDO A;  3C3L A;  1ENC A;  2MJ8 A;  4AYB B;  5CV4 A;  1LAC A;  1V43 A;  4LJZ C;  3EJI A;  4C3H B;  1LTR D;  1X3Q A;  1M8A A;  1DON A;  1ZXT A;  3V96 A;  5DNF A;  1LTA D;  1V1P A;  3HOW B;  2WIN B;  3CKI B;  1CQV A;  3K5L A;  4K2K A;  2F0S A;  1S5D D;  4O42 A;  5FOB B;  3PMF A;  1FYC A;  1Z47 A;  1WTQ A;  4IFD G;  2R3Z A;  4V19 0;  1ESF A;  3MFG A;  1QB5 D;  3NTI A;  5EKL A;  2WP8 J;  4A3D B;  1SND A;  1UUP A;  4ZKC B;  1G2S A;  4XQQ A;  4K5X A;  2LY7 A;  1JE4 A;  3TZU A;  2F0E A;  3N6R A;  2G9D A;  2C9O A;  2XVS A;  2MP1 A;  5C3W A;  5IOC A;  4DAP A;  5HUR A;  4KMU C;  1JOK A;  1Y1V B;  3HS0 C;  2CHB D;  5NUC A;  3CRL C;  4KN4 C;  3GTP B;  4C3I B;  2FIN B;  2GA4 B;  2K5D A;  2AQ2 B;  1S5F D;  4L63 B;  2B2V C;  5CGK A;  3K6O A;  1KAA A;  4R8I A;  5C0X I;  2VUM B;  2AWO A;  1KNA A;  3QOL A;  4IUP A;  3IFD A;  3DUZ A;  3BS1 A;  4IFD J;  2CW0 C;  2WAQ B;  1TQO A;  3ZYY X;  1I4X A;  4A3J B;  3TSS A;  3SK8 A;  3S17 B;  1V1P B;  2IX3 A;  4X3T A;  4L6T B;  3WDN A;  1JWS D;  5CV9 A;  1PFN A;  2ICE C;  5ELD A;  5EPK A;  5BN4 A;  4G57 A;  2C5C A;  5IIF A;  1C48 A;  3SK5 A;  5G3L D;  2BDN A;  3PIO 3;  1CTM A;  4Z9C B;  1F2L A;  1TT2 A;  1YNN D;  2EYP A;  1ROD A;  1ONL A;  4DK0 A;  2K28 A;  3KLR A;  2EJG C;  4HTH A;  3TME A;  5A2Q L;  2MUY A;  2R92 B;  1VF7 A;  2F0O A;  5LHY 1;  4KHV A;  3I8Z A;  3SDZ A;  5KNB A;  2XNA C;  2EDG A;  2XSC A;  4A3B B;  1I6V C;  3DHQ A;  3J7A F;  1CQF A;  3K57 A;  1HHV A;  1BUV T;  3TZD A;  1STY A;  2PW5 A;  4OGQ C;  2ICI A;  1E0B A;  3SVM A;  3KK7 A;  4PMB A;  2O2L D;  3KBG A;  2RA4 A;  1O7Y A;  4R9W A;  2EPB A;  3FKI B;  2AWN A;  4KV6 A;  4DXF A;  1BCP F;  5I9P A;  3FPU B;  2R93 B;  1LV9 A;  3HKZ B;  5JOB A;  3PO2 B;  2L11 A;  3KUP A;  4MHE A;  1EU3 A;  2Z4H A;  3J80 L;  4TKO B;  4DNT B;  3S2H B;  1IKL A;  2PW7 A;  4PQX A;  2B2Y A;  5E1F A;  3MZ5 A;  1BBX C;  2NN6 G;  1RJT A;  1QOH A;  1EY4 A;  2WKC A;  1EY8 A;  2B39 A;  3K58 A;  2Z1C A;  4XTC S;  5CV5 A;  1TS5 A;  2CQA A;  1B9N A;  2B2T A;  4EQN A;  3VYT A;  4J1M A;  5COY A;  5KEE A;  1JOO A;  1SFO B;  1SYF A;  4K8I A;  1PTO D;  2LKV A;  5EBD A;  5JEA G;  3DXJ C;  2BOS A;  1MI2 A;  3LWE A;  2NVT B;  1SJE D;  3S1R B;  5ELF A;  3KF8 A;  2H1E A;  1H9M A;  4DGZ A;  1EYA A;  1IKM A;  2L9H A;  1NR2 A;  4NDX A;  3H94 A;  4RH6 A;  3T4A C;  1A2T A;  4F7X A;  4DAY A;  4UDU C;  3D31 A;  3BZD B;  3FMC A;  1GOZ A;  1I4Q A;  3MXN A;  1LTI D;  3DWA A;  5ELE A;  2NWG A;  1FNW A;  1RHP A;  3K0Y A;  2Q8R E;  4WOR A;  1A3V A;  4DU9 A;  2NN6 I;  1RD9 D;  2K1B A;  2BA1 A;  5EPL A;  3ERQ A;  1TWG B;  3IAY A;  1Q90 A;  1II3 A;  2OT2 A;  3QWN A;  1NAP A;  1W6J A;  3AB9 A;  3GTM B;  1RF2 D;  2EYJ A;  2WB1 B;  1K8M A;  1XX8 A;  1U9R A;  4DK1 A;  1T5E A;  1ESR A;  1TVX A;  2EYL A;  2HQE A;  3V05 A;  4ZUI A;  2X69 A;  1F2Z A;  1PZJ D;  5CV6 A;  1RCV D;  2SEB D;  2ZXR A;  1TU2 B;  4O1N A;  5C44 B;  1F9Q A;  1CT1 D;  4A3K B;  5KGU A;  4DAV A;  2WKD A;  4B9X A;  1MD2 D;  2X6L A;  5EGT A;  3VYS A;  5BN5 A;  1G6Z A;  2JSO A;  3J81 E;  3GTG B;  5CMD A;  3GV3 A;  2BE5 C;  2B2W A;  5COR A;  3HP3 A;  2JA6 B;  1NUC A;  4RHS A;  1O7Z A;  2BA0 A;  4BA2 I;  3RD4 A;  1F2M A;  3F2U A;  1MGS A;  4KD3 A;  4C3H G;  4OHJ A;  3P1H A;  4KKU A;  5CBE E;  4ME5 A;  1BOS A;  1O80 A;  1G91 A;  4HCE A;  2A68 C;  3T56 B;  1STB A;  4WRD A;  4YIJ A;  4XYO A;  2YYZ A;  1NSN S;  4A3G B;  2NVY B;  5KNC A;  1PFM A;  1LT3 D;  2E2J B;  1U4M A;  1GJX A;  3R2T A;  3UI2 A;  3PV0 A;  4KJN A;  3IL8 A;  5AFW A;  2K04 A;  2A6E D;  3GTJ B;  4KJO A;  3IFT A;  4R8N A;  4ID6 A;  2WAC A;  1DM0 B;  4K8J A;  3U9O A;  4OO1 G;  3J7A V;  1BR9 A;  1PZI D;  4EQO A;  2RDF A;  2JEA I;  2JE6 I;  3BDL A;  1WVL A;  1MSG A;  1B44 D;  5C0X J;  2K5W A;  4QUC A;  2EYF A;  1ZEQ X;  3QIA A;  2L0C A;  4CJ2 C;  2XWB B;  1D5M C;  3PUV A;  4RAU C;  4FF1 A;  3K59 A;  1BNZ A;  5ELB A;  5I4D A;  3QB3 A;  3M85 A;  3GTL B;  3D6W A;  1SNQ A;  1W6K A;  4IFD H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...