1LABA

Three-dimensional structure of the lipoyl domain from bacillus stearothermophilus pyruvate dehydrogenase multienzyme complex
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
80
structure length
80
Chain Sequence
AFEFKLPDIGEGIHEGEIVKWFVKPGDEVNEDDVLCEVQNDKAVVEIPSPVKGKVLEILVPEGTVATVGQTLITLDAPGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the lipoyl domain from Bacillus stearothermophilus pyruvate dehydrogenase multienzyme complex.
pubmed doi rcsb
source organism Geobacillus stearothermophilus
molecule tags Transferase (acyltransferase)
molecule keywords DIHYDROLIPOAMIDE ACETYLTRANSFERASE
total genus 6
structure length 80
sequence length 80
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1992-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1labA00
4TKOB 3PUZA 2A68D 1HCZA 3OW7A 1O7LA 1SMYC 1IW7D 2A68C 1Y8NB 2DN8A 3T53B 2D5DA 1EWHA 3A7AB 1GJXA 3M85A 3FPPA 4KKSA 1FYCA 3A8JE 1Y69U 1OXVA 2L5TA 2PCFB 1H9RA 4H0LC 2NN6G 2E76C 1LABA 1B9MA 1Z7TA 1VCIA 3BG3A 1H9SB 2AUJD 2KCCA 3NE5B 3GQBA 3PUVA 1GUNA 3BDOA 4JBWA 4XTCS 3RLFA 3VR5A 2A6HC 3VR3A 4G7HC 1IYUA 3A8KE 1B9NA 2BE5D 1VF7A 2EDGA 2YYZA 3ND8A 4DK1A 5KNBA 4IQZA 2A69C 3FMCA 3U9SA 4H44C 2JXMB 1K8MA 3N6RA 4G7ZC 3PUYA 2BE5C 2JE6I 1OXUA 2EVBA 4DK0A 3H94A 3OPOA 1ZYRC 3M4YA 2BDOA 2JEAI 1YNNC 2EJGC 3ND9A 4H13C 1HQMC 5JEAH 4DNTB 1HTPA 4KKTA 5BN3A 4OO1G 4KN4C 1Q1BA 1Z6HA 2AUKA 4KKUA 1H9SA 2E75C 4I7ZC 1GUOA 3VR6A 5KNCA 1ONLA 4IFDH 1QJOA 1A6XA 2A6EC 1H9KA 3SDZA 1T5EA 3A8IE 3PUXA 2PNRC 2KA7A 3D4RA 4JK1C 3T51B 3WDNA 2QF7A 1YNJC 2K32A 3TZUA 4BA1I 2O5IC 3M7NA 5JEAG 1DXMA 2K7VA 4HR7B 5K36G 3I73A 1H9MA 2V4DA 3VR4A 1FR3A 4KI0A 4LK1C 2JEBI 3QIAA 1GHJA 1CFMA 2A6HD 1O78A 1Y8OB 3DXJC 1GUSA 2D2CC 4KHZA 3HGBA 2E74C 5BN4A 3A7LA 1V8QA 4G7OC 1V43A 1I6VC 1OXTA 3P20A 1GUTA 2AWOA 3OOCA 1GHKA 1DD2A 4PV1C 1H9JA 1ZKOA 2R6GA 1Q90A 5C0XG 1CI3M 1K8OA 3KLRA 3IFTA 3VR2A 1OXXK 1PMRA 1Y8PB 2A69D 2A6ED 1LACA 3W3AA 3PV0A 4OGQC 3SE0A 4KN7C 2EJMA 2NN6I 4RCNA 2DNCA 3PUWA 1IYVA 1HPCA 4OO1H 1E2ZA 2D62A 1CTMA 2Q8IB 1TKWB 3I4LA 3CRLC 2BA0A 4IFDG 5C0XH 3VA7A 2NN6H 2LMCB 2BA1A 3IKJA 4LJZC 1GUGA 4TQUS 2IT1A 5BN5A 3CRKC 3MFYA 2O5JC 5KNDA 2F1MA 5K36H 2ZT9C 4XIGS 2DNEA 3LWUA 1Q1EA 1OXSC 1DCZA 3D31A 3MXUA 1IW7C 3QG1A 3T56B 1TU2B 3I72A 1VF5C 2B8GA 1E2WA 1G291 3GD7A 1BDOA 1Q12A 1VDZA 3L7ZC 3LNNA 4GZYC 4DNRB 2CW0C 3QJYA 5A35A 4BA2I 2K33A 4KMUC 2EJFC 3EQLC 3AB9A 2PPBC 1E2VA 2B8FA 4L8JA
chains in the Genus database with same CATH superfamily
1ZEQX 3URYA 1O7IA 4DV1L 1JWMD 1HCZA 2NZ1D 2IWHA 1A62A 1SJHD 3T1YQ 4WJ3M 1TY0A 4RG1A 5CMDA 5LHY1 4FDBA 1JJCB 1SNMA 1WOCA 2B2TA 2VQFL 4QQBX 3DWAA 4P73A 5EBCA 1EY0A 3K57A 4PG3A 3TMEA 1HZBA 2B29A 1NMGA 3N52A 1KXLA 2JA7G 4WJ4A 2OTJA 2CWPA 1G51A 4OWTB 3NUCA 3S15B 5KGUA 1SR3A 2IX1A 2WV6D 1J5EQ 4RA8A 3A55A 1NMFA 4IFDI 3AFQA 3QOJA 1U4PA 1EFWA 1K3BC 1YBYA 5E1FA 5IYCG 1C4QA 3R3OA 2BH2A 1LT5D 2A6EC 2HCIA 4EVOA 3BVMA 5DEHA 3PO2G 3FRPB 2RDGA 1PH2A 4BA1I 4A3IG 2VW9A 2B63G 1PRTC 4DA2A 3Q23A 1GHJA 2B2YC 3G4SA 1O78A 1I4XA 1K28A 2CW0D 1TIID 2NVXH 4UY8C 2GN5A 1VQJA 1W6JA 4K0KL 4DV4L 3WOEA 3NPPA 1ENCA 2F03A 2FMMA 2J4XA 5IYDH 3HOVB 3KFUA 2WFWA 3TP8A 4C3HB 1VQKA 4P74A 4A3GH 1VQ5A 4JYAL 1YITA 3HOUH 1F2ZA 2NZOA 1I6HB 4LF6L 3KLRA 2XIWA 1UUPA 1HR0W 2JJQA 3HOXH 3W2DA 2HIVA 1PYBA 1FNVA 2UUBQ 1C48A 1ESFA 1HPCA 3HOZH 2E5LL 1QB5D 1KD1C 4N8X1 4NMZA 2C5CA 2R3ZA 4QIWB 4DKAC 3S1MH 4UAIA 2E2JH 1ENFA 3R2TA 2F1MA 4X66L 4A76A 3S2HH 1OXSC 2MPMA 3T56B 1B8AA 1RCVD 3GD7A 2B2WC 3T1HQ 4XT3B 3CCLA 1FJGL 3H09A 3AB9A 2JA6B 2B8FA 4KD4A 4OL7A 2JA6H 1T9HA 1D1IA 3Q22A 1XNRQ 3KJPA 1PFNA 3E0JA 1XTDA 2PZTA 2MNAA 2D5DA 2YU9B 1FYCA 2ZJPA 2O2LD 3J7A5 3DMUA 4DR5Q 1MJCA 3MWYW 3MAQA 4H0LC 1A2UA 1UNSA 3GTQB 4BWGB 4DUYQ 4LUVA 3S2HB 3HZXA 2KBNA 1PTOF 3GQBA 2RBMA 5IWAQ 3BDOA 1RD9D 2FHTA 1EYAA 1N32L 2MO1A 1UE7A 1U0LA 3IRBA 1KTKA 5KEEA 1J6QA 4N9PA 3J80i 4E6IA 1HA5A 5I2YA 1XPOA 1IL2A 2A19A 4UP7A 3SK5A 4JG2A 4DN4M 1OXUA 4DV3L 3HOYH 2EPBA 2EYPA 3QR8A 4XQNA 1PZJD 4HCSA 2KOLA 5KYLA 5IYBH 4A3GB 3ONAB 3K80C 4KV6A 3J81i 3EBEA 4JI1L 4DV2L 1XMOL 4A3BG 4A3JG 2L1BA 4HR7B 2NVXB 2CCZA 4KY6A 3H3VH 3S1QH 4GOPA 3QIAA 2IX0A 2PQAA 2XSCA 3BDLA 5FJ8H 3TP7A 2Y0SG 3BDCA 1HTLD 2ZXOA 5FLXE 4IURA 2B2UC 2F0FA 5GAGC 5L37A 1GUTA 4NB3A 1UE6A 3UDIA 3CMAA 1N33Q 4KD3A 3CXCA 1O80A 1RKNA 1K0SA 1L1OB 2IHEA 3W3AA 2ZM6L 2HHHQ 1X3PA 2ZJQA 1ILQA 1EOTA 3VDYA 4HMIA 2IW3A 1HNXL 4R8IA 1VMPA 3DHQA 4IFDG 1S40A 4A3FB 1X3FA 1YEZA 3IKJA 1VQ8A 1QG7A 2K5VA 1FGBD 4GN3B 4FXKC 5K36H 1K83H 4DAVA 1MD2D 3OWEB 2EQSA 1Q1EA 2F0MA 3PQIA 2L55A 4L5TA 4EQPA 1XPUA 3E0EA 1BDOA 1SXTA 2F0WA 3CCEA 4LF6Q 1JB3A 3E3XA 1B1ZA 4JPBW 1STEA 4QY7A 1KRSA 2ES2A 4N8FA 3GTJH 3W5OA 3TS2A 3HOYG 3TS0A 4ME3A 4LF8L 4JC0A 1XYIA 3H0GH 2KENA 1Y69U 3HOYB 1BCPC 2ATWA 1AH9A 5EKLA 4POFA 4CKEA 2ZXPA 2X6LA 3BG3A 1HNZQ 3NHHA 3M4OB 2WB1G 5LL6S 1RODA 4JI5Q 4DAMA 1MIUA 1BCPB 1RTOA 3M3YB 2SNSA 2QA4A 3U9SA 2UU9Q 2ASBA 5ISRA 4EQNA 4G7ZC 4WJWA 2JE6I 3EROA 1SYFA 3GV6A 4DK0A 1OTCA 3T4AC 2A73B 3M4YA 4ILWA 4JYAQ 5DLQE 2HIXA 3OTOQ 4LF5L 1KIXA 4UP8A 4EQ5A 1N8RC 1SFOH 3I4MH 3D8GA 5LMNL 2SOBA 2GA4B 5J3BA 3TREA 2UXBL 1T5EA 4WORA 1SNOA 4QGUA 2M2LA 1FD7D 4JI4Q 4P2CB 1NSNS 5FLMG 4GNXB 5J39A 3T13A 2IX3A 1YNXA 4X6AH 1E22A 5FO8B 4FXGC 2H4OA 4RHRA 1C9OA 3FPUB 1K73C 1LTTD 1RIPA 5FJ8G 3KK7A 5C4XG 5IGDA 3H15A 1Q8KA 1I6VC 2RHSB 2E2JB 3P20A 2VY3A 3SHLA 4AYBB 4CJ1B 2Y0SB 4B3TL 2MHVA 1CSPA 3HOWB 1NAPA 2A69D 1RDPD 3X3MA 4F87A 1LTAD 4B3MQ 3MA2B 4RCNA 4A3DG 3IAYA 3TBIB 2F3VA 1VQ7A 1GVPA 4NDXA 1QILA 4IN3A 1I6HH 3PO2H 4C3HH 4LJZC 4IUVA 3S2DB 1HUMA 4TQUS 4IO9A 5BN5A 3HS0C 5DM63 1M8AA 1YJNA 3I4NG 2KHIA 2F4VL 3HRZC 1L0XB 4X3KA 3BVZA 4IUTA 1ASYA 4A3GG 2KQ3A 4PMWA 1SROA 2HHHL 4UDUC 4DF7A 1KAWA 4DV3Q 5C4HA 1MBYA 2MGSA 4XXEA 1HZCA 1HNXQ 2N88A 3LGJA 1BKBA 4IUPA 2B2TC 4NXNL 3FPPA 3TN2A 2F0LA 4HIKA 3G7LA 1A0IA 1U4MA 2K14A 2E76C 5IIFA 3WOFA 2QEJC 4RH6A 3RLFA 2LFNA 1LT4D 2Q2IA 3A8KE 4DPGA 1B9NA 2CQAA 2EYJA 3CCUA 2DJFC 1TS5A 1NY4A 3M4QA 4OXPA 1Y1WH 3I7FA 2QDLA 1I3QH 4X3TA 1N33L 4NPSA 2Z4HA 3ITPA 4DV4Q 1G2TA 1W2BA 4KN4C 1AW7A 4DUZL 1ONLA 5M3MB 1VQDA 4ULLA 3UDGA 5EQ0A 4RKBA 2Q8RE 2LXKA 2O5IC 1GO3E 3KF8A 1LTGD 5KRUA 4POGA 3PF4A 4F7XA 4KI0A 4JI5L 4HJ7A 3TDQA 2L15A 2F0JA 2XNAC 2JN4A 5E7NA 4UP9A 1PH9A 5C3EG 1V1QA 5I9OA 4A3EH 1Q46A 5JJKA 1FL0A 1K3RA 1G6PA 4C2MB 2AWOA 5M5XH 2VNUD 4OONA 2Z0SA 2Z6KA 1WTOA 4FYDA 4EQOA 2LS01 5M9OA 1OXXK 5EBDA 4TSSA 1D5XC 3PO3B 4OGQC 2IPKD 3J80E 3L9AX 5LMNQ 4FF2A 4DXGA 2DNCA 2N8NA 4DK3C 2GVAA 1TWFH 3CRLC 4ZKBB 3PF5A 1HH2P 4LFCQ 2C35B 4DR4Q 4MTNA 2OQ0A 4GKJL 2F0HA 3RD4A 2ZT9C 1CM9A 4XYQA 4J1MA 4O0AA 2B2UA 1GUWA 1SNDA 1CKMA 2PZWA 1M4VA 4DV5Q 4CKCA 4A3KH 3GTKH 4B3TQ 5IT9L 1CKNA 2E5LQ 3NELA 2CW0C 3CKIB 3QO2A 1F77A 1S5ED 5IWAL 4NW2A 1D8LA 2A1AA 1PFMA 4DR7Q 2UUCQ 3S14B 1JJ2A 2OXPA 1D2BA 2A8VA 2N55A 4YHHL 3ER0A 3A7AB 5FKAC 3NP8A 1EL0A 3BZKA 1H9RA 4HIMA 4Y52H 1CUKA 1DJRD 2R7FA 1Z7TA 3K58A 1VCIA 4JBWA 4PZ6A 2CQOA 5J22A 4G4KA 2E2HB 4AYBE 3UDFA 2L4NA 2UXDQ 1TWFB 4LF9L 5KYIA 3GV3A 3CU7A 3NWSA 3OPOA 1IBMQ 3VYTA 5JEAH 4O42A 1EY4A 5CV5A 3Q24A 4DUYL 1Q1BA 1Z6HA 5IOCA 1X3EA 1CSQA 4WRDA 2UUAQ 4DV6Q 2K04A 1S72A 1U4RA 3J7ZC 3J81c 1EY8A 4UPAA 4X64Q 4A3CG 2WAQE 1KDAA 4PZ8A 2K7VA 2KUMA 1UEBA 1HZAA 5IYCH 2RKSA 2IY5B 4L6TB 4NXMQ 1A3TA 4ODGA 1B4OA 3OSOA 5I6YA 1BNZA 3TZDA 1X55A 3NXWA 1F2MA 3PSIA 3CCSA 4DV7L 3NWTA 1QCBD 5M3MH 4GKKQ 3E9IA 2Q2TA 2XVSA 3CHBD 2B39A 3VR2A 3I56A 1Y8PB 4DAYA 3DWPA 3PV0A 4GNXA 4AH6A 2RSOA 4QCLA 4MZ9A 3HG9A 1Y1WB 2B2WA 1PTOH 1VQMA 2KHJA 4JBJA 5A2QE 3STBD 3NTHA 3W1GA 1WTXA 3A5UA 4U68A 1KLUD 2PNHA 1DCZA 2HUGA 4YIJA 5CV6A 1EUJA 1BBWA 1LUZA 2KCTA 1Q82C 2EY6A 2HD3A 4DNRB 1STGA 5LMNW 5IP7G 1PH5A 4BY1H 3EQLC 3OW2A 5IODA 4RGOS 1YI2A 3K7UC 2K28A 2VZAA 5C3XA 2A68C 1WTRA 3J81E 5HGQA 4DR4L 1OXVA 4V190 2I0QA 1LABA 3PIO3 1WTWA 1TWCB 4A3LH 1VQFA 2NBFA 5I4DA 2F0NA 3RZDH 3SR1A 1SBBB 2BE5D 3AU7A 3S2DH 2K05A 2RF4A 3K81C 3GTMB 1TWHH 1PH6A 5J1ZA 2EVBA 1STNA 1PTOC 4LMQD 2L12A 4H13C 4A3JH 1TR5A 2AQ2B 1EQTA 2X69A 3IFDA 4BBRG 1SDFA 4FF4A 4ZYSA 3GTPH 2B3GA 4BBSH 1YNJC 1STHA 2K32A 4Q5VA 3A54A 3EJIA 2DJGC 4B3ML 3CCMA 3I73A 4LK1C 4A3FG 5DNFA 1GUSA 5EPKA 2UXDL 3EA6A 3U50C 3E9HA 4DV5L 1YNND 1NR4A 1Y14B 1M1KC 2OT2A 1K0RA 3ZYYX 5ELEA 1F9PA 4R4CA 5M3MG 2L9HA 1EEFD 3OMGA 2QKIC 1N34Q 3CCJA 2F0IA 2R92G 1UE1A 3UE0A 5C3EB 1SSOA 3SK4A 1WTQA 1B50A 1NNXA 4XYOA 2RCFA 1Q3LA 4YCUA 5EPJA 2K50A 4DR5L 3LX0A 1B3AA 4DV0L 3MXPA 1I94Q 4AQYL 2R7ZB 1J8IA 4IJHA 3M4OH 1LV9A 4IPDA 4A3KG 1SNQA 4HJ8A 2Z6KC 2F4IA 2WAQB 4L5RC 1MKHA 4LF4L 4ZK9B 1XX8A 3QWNA 4CGYB 4KJNA 5F2DA 2TSSA 1SJED 1VQNA 3HEJA 3NQIA 1IW7D 3F8TA 5M5WB 4YCWA 5NUCA 4C3IG 2PCFB 1IL8A 2AQ3B 1YJ9A 2JP1A 2QDBA 3LWEA 4FP5D 2AUJD 4LF4Q 4OELB 4YY3Q 1K83B 1JICA 3C2PA 2A6HC 2ALYB 1WJJA 1EY7A 4A3EG 1F2YA 3S24A 2R61A 1SE2A 4DK1A 5KNBA 4A3FH 3S1RB 4C3JH 2EZVA 2A74C 2BE5C 3AQQA 1SYGA 4LWCA 1NE3A 3U58A 4B3RQ 1QOHA 2EY1A 1I4QA 4HSVA 5JAVA 2ZM6Q 2F3IA 2NVQH 4BBRH 1SYBA 1EYDA 1H9KA 1CK1A 2WAQG 3STBC 2AHOB 5M3FB 1KQSA 1JB7A 5FO7B 2WB1E 3MXNB 5FLXc 5CV4A 4LFCL 3X3NA 1V43A 4IPHA 3K5LA 3S16H 1EQRA 4HTHA 2F0QA 2NVYH 2RA4A 3F2BA 4DR1L 4ZAIA 1TS3A 2J7ZA 2M00A 2WKCA 1K8OA 2H1EA 1A3UA 4KTAA 2EY5A 4C3HG 4JCVE 1ILPA 2EJMA 1HR0L 1CQFA 4A3CH 1D5ZC 1PH8A 2D62A 1VQBA 5CORA 3J7YW 3GDEA 2ID0A 5C44H 2K75A 1GUGA 1JQYD 4RGNA 1WTPA 2JA5H 4C3IH 2O5JC 5I6WA 1FGUA 2MQHA 3ULJA 3GTQH 3F1ZA 3K7AH 1Q12A 4TRDA 3L7ZC 1XJVA 3NTKA 3AEVA 3U9OA 4O2DA 1S5DD 5G3LD 2PPBC 4FF1A 2FFKB 2RDFA 3AFPA 3RUZA 1O7ZA 2KEEA 1RHPA 4APVA 4DFAA 1VQGA 3RLNA 1CA5A 4PMCA 4BS9A 3CAMA 3KJOA 5CC4A 4A3BH 1QUQB 3KLSX 3C1FA 1CA6A 1CKNB 3IL8A 1DGSA 5CBEE 3ICEA 2KCCA 2K4KA 4A4IA 3NE5B 3PUVA 2QILA 1FJGQ 4DV6L 4DNIA 3S1MB 1C0AA 4LUZA 2H5XA 1CQVA 4X64L 4CBVA 2A5HA 4IQZA 4H44C 4YHHQ 3HOZB 1L1OC 3HP3A 1B70B 2E8GA 3SVMA 4OX9Q 3K0YA 5M5WH 3I90A 4DNTB 2KEDA 1X56A 3HOUB 1V1PB 1ML0D 4ZUIA 4GKKL 1EOVA 2JA9A 3MEFA 3CQZB 4QF4A 1J9OA 4PNYA 5IT9c 3HOVG 4PMBA 5ELFA 4A93G 1S5CD 1HNWQ 3S17B 5CYUA 1H9MA 2YTYA 4Y7NB 1Y8OB 2F0VA 5C3WA 4DXFA 3I8ZA 1SN8A 4A3DB 3SK8A 1E0BA 5IYDG 3A7LA 1V8QA 2NTSA 3L2PA 4QMGA 2B63B 1JE4A 1W3SA 3GTLH 3CPWA 4B9WA 1F2LA 1VQIA 4PV1C 4IPCA 2VL6A 1ESRA 1KLGD 4H7BA 3R8BA 3HOXG 1SYDA 4A3MB 4JI3Q 1JJGA 2Z8LA 1F9RA 3SE0A 3NBIA 3GTOH 1TS4A 5CV8A 4A3MG 1IBLQ 3C46A 4NXML 3S15H 2RDHA 1JOOA 2NN6H 3CCQA 4RWSC 4X3SA 4S3SA 5D3DA 2G5DA 3CC2A 1X54A 2Q2UA 1PRTB 4JI3L 4YWMA 2KVMA 4KHPQ 2BCOA 4DAYB 1QUQA 1SE4A 1E2WA 4GN4B 4DR6L 5ELDA 2NVTB 4QL5A 4NP5A 2AQ1B 2L0CA 1R9TH 5D65A 2Q2HA 1SEBD 5A35A 4JI8L 1HR0Q 1VQOA 1CT1D 3SEBA 4ABNA 4BXXG 1YJWA 5BR8L 4HJ9A 2VUMB 5C5MA 1FNUA 1TT2A 1I50H 2UXCL 3M85A 3F2DA 1LT3D 2BOSA 2X6GA 1TWHB 1B9MA 1VQ4A 4JI6Q 4IJLA 3K5MA 1S5FD 1RF2D 3TP6A 1UE5A 1VF7A 1Z47A 5C4XH 3RZDB 3DWQA 3Q0AA 1TWCH 1AE3A 1UWVA 2E2DC 4LF8Q 1D6EC 2EYMA 1UEAB 2K5HA 3G48A 3H94A 2NTTA 4R8NA 3F2UA 1YNNC 2Z4IA 4I65A 1M90C 2FJ2A 1TVXA 5BN3A 4OO1G 2AUKA 3FKIG 4JVZA 4I7ZC 1GUOA 4IUNA 3VR6A 1TS2A 3SDZA 3NBHB 3QOLA 4DU9A 1IKMA 2EE1A 1PZKD 3CF5A 3ULLA 1X32A 5JEAG 3PCOB 2JK8A 3NEMA 1B2TA 2TMPA 3CC7A 1ET6A 3EIVA 1STAA 4JI0Q 1KABA 3J7AF 3NSWA 4JI7Q 4A93B 1LTID 3EFXD 2RVLA 4PZ7A 3CC4A 1WD0A 3W1BA 4OX9L 2K1BA 4OWXB 1ZXTA 4AQYQ 1KNAA 4ZQ3A 1PMRA 2F0UA 2NN6I 2HQLA 1U9RA 2D0OA 1JT8A 1SYEA 5JVH3 3HKZE 2F0TA 5AJ3L 2PMZE 3FKIB 1PYWD 1K9MC 5H1SE 1AEXA 5GROA 3DLLA 5GAEC 3PIOA 2IT1A 4A3IB 1QWYA 4R4OA 4F88A 2PI2E 3LWUA 4R4IA 4GS3A 2L11A 3CPFA 1DZ1A 3DUZA 2JA7B 5CV7A 3QJYA 1LT6D 4LF7L 3JAMc 3G71A 1JR0D 3I2ZA 4DV0Q 1N9WA 4TKOB 2I07B 2FMCA 2HDLA 4ZUJA 3I91A 2Z6BA 1BOSA 1VQCA 5EKKA 5C5LA 3BVGA 3A8JE 2WIIB 3D4WA 1PV4A 2YTXA 4BY7G 4X66Q 2ZJRA 4H02A 2O4XA 3VR3A 3VR5A 3G6JB 3KBGA 4A3IH 2LSSA 4DR6Q 2YYZA 2XTIA 2VUMG 1RL2A 5EPLA 1Q81C 4BY7B 4C56C 3TP5A 4RCOA 1YVCA 4JI8Q 1EQQA 4ZLTF 4OIKA 5FK9C 5DAUA 1AP0A 2PZUA 3P7JA 3C3LA 4XDXA 4J6HA 3RN5A 4IOAA 5EJWA 1DOMA 2WP8J 2B2VA 4YY3L 3OMCA 1B44D 1I4HA 1A6XA 1NBWA 1EWCA 2JQOA 4IFDJ 1Q8IA 4ID6A 2CH4A 1Y1VB 4A93H 4JV5Q 2N78A 4OEMB 4JK1C 1VQHA 3WDNA 2QF7A 2R7ZG 1V9PA 3MVVA 2V4DA 3GTKB 4A3KB 2KCNA 2EYLA 4J8QA 1TWGB 2AMCB 2G9DA 4B3RL 5BN4A 4RMFA 4IUQA 2Y0SE 4KHPL 1OXTA 3OOCA 2K52A 1GHKA 2K03A 3PGZA 2RSNA 3HKSA 1H9JA 2R6GA 4JV5L 1GKHA 1AZQA 3KDFB 4LFBL 1DOKA 4XT1B 4KHVA 4IALA 3SXHA 2Q8IB 4B08A 1EYGA 3L3OC 1N36L 4GN5A 2LMCB 1JCKB 2BA1A 5M5XB 4OO1I 5JVG3 2NZHA 5C4XB 1MSHA 3CRKC 3MFYA 1E24A 1S5BD 1PTOD 1QVCA 3GO5A 4A3EB 1HQRD 2DNEA 3HOZG 2EYOA 1TWGH 1HNZL 2YV5A 4ME5A 3QG1A 3GP7A 1EIYB 5LMUL 1BVSA 5C4ZA 1PH1A 1I50B 3MTSA 5C0XJ 1QZHA 5JJIA 1Y1VH 1PXUA 2VUMH 3WWVA 4QB4A 1EY6A 1BUVT 2K5DA 3BJUA 2HCCA 3SGIA 3DEOA 4DR2L 4RHSA 5IE8A 1EZ6A 1L0YB 1HHVA 3H91A 1EWIA 3BYYB 3M9BA 5IP9G 4JBMA 2LXJA 1HRJA 1A3VA 1CZWA 2UXBQ 4GLAC 1I5FA 1ICWA 4ZKCB 2JA6G 4YCVA 4BY7H 1SE8A 1HFNA 4G7HC 3HKZB 4DR7L 1VMCA 4RGTA 1NUCA 3AMUA 3N6RA 1HNWL 1RTNA 3U4VA 5C0XI 5IP7H 4DK6C 5M5YB 2VXWA 4YWKA 3A56A 5D14A 4EX5A 3CD6A 1I4RA 4A3MH 1IHZA 5T1IA 1N34L 4UHVA 4CDDC 4X65L 1O7YA 2B63H 3H3VC 3K8AA 1E1TA 5AJ3Q 3RR5A 3TZUA 3RLOA 1C8CA 1HXYD 4AIMA 2JA7H 3P1HA 2UUBL 4Y7NH 1G2SA 1IBML 3S17H 2EYHA 3D0FA 3HGBA 4WFN3 2F0PA 2PQAB 5I9PA 3U4ZA 3CP0A 2WKDA 1WTVA 1BO0A 2F3WA 2IL8A 3MZ5A 2I5HA 1PH7A 1DD2A 3KF6B 3PO2B 1Q90A 3FKIH 1CI3M 1ASZA 2E2IB 1SNCA 2ZTEA 1LACA 1E1OA 1IZ6A 3K5OA 1PVOA 2OQKA 4OO1H 2PYKA 1TQOA 4K8IA 1TKWB 2D0PA 3I4LA 3NK9A 3BZDB 4OHJA 5C0XH 3VA7A 2NWGA 3PIPA 4R4QA 4K2KA 1WI5A 1IYJB 1WCMH 4O1NA 1GM5A 1JORA 1SLJA 1A8VA 1EU4A 3J81L 2DY7A 2KECA 1KC8C 2IHFA 2R93H 4A3BB 2B8GA 1STBA 1WYDA 1BCPF 3BS1A 4JI6L 1AN8A 1F9QA 2HDMA 5C4JB 4XQJA 5JOBA 1YIJA 5EAYA 4GNXC 4GLXA 4CHTB 1YHBA 4KJOA 1I4GA 2SDFA 3I4MB 2ICIA 3RZOB 3PUZA 5G3LF 1VQ6A 3F2CA 3SK6A 4A75A 2DN8A 1JC7A 1EWHA 1GJXA 4DGZA 3FDTA 3KBXA 1VQLA 1C7YA 3K7AB 3I4NB 4IPGA 1H9SB 4XTCS 5K5PA 1LTSD 5GQOA 4C3IB 3H0GG 3H6MA 4JI1Q 4DV2Q 1XMOQ 1FNWA 3GTGB 1GD7A 2MO0A 4K6DA 2JXMB 1UAPA 4B9XA 1PFSA 3PUYA 4YWLA 1QZGA 3EVQA 2HQEA 4X62Q 1JWSD 5FLXL 2JEAI 4JOIA 4FXDA 2I5LX 2WINB 2Q8TA 4JI2L 4JI7L 2RHQB 4KY7A 3I55A 1G91A 3GTJB 2K5WA 5KNCA 4LFBQ 1LTBD 3OIQA 1IBKL 2C9OA 1R9TB 4BBSG 4FF3A 5E4WC 2NVTH 3HOWG 2D9UA 1ENAA 2PO4A 1CFMA 3OIPA 2D2CC 3M7GA 2KCMA 2E74C 1V1OA 3S1NH 1STYA 3ERSX 1HJPA 1KAAA 1I4PA 2SNMA 4OIJA 5JEAJ 2DUDA 5LMUQ 2NVQB 5CBAE 1DM0B 5CGKA 5IGGA 2FINB 3NBHA 4B3SQ 4C1NK 5IT9E 1IBKQ 3AYHB 3A74A 2A6ED 3TSSA 4DUZQ 3OYYA 3BZCA 4X65Q 1LTRD 1BBUA 3GTOB 1MSGA 1U4LA 1E2ZA 1JWUD 4C3JB 2BA0A 3S1RH 2F0GA 4LF7Q 1WTHA 1MGSA 3GTLB 3Q6SA 1WCMG 2ZTCA 3CW2C 1LM0A 4XIGS 2YTVA 4A3DH 4MHEA 1KNEA 1KDBA 4CDFC 1PZID 1VF5C 3S1QB 4K5XA 1TWAB 4HIOA 4K5VA 4JW0A 3CQZH 2WB1B 3ULPA 4KMUC 4HSPA 4RGMA 3RMHA 4CDCC 1KL9A 1IXRA 1Q7YC 1HFGA 3M4PA 3Q8DA 4HJAA 2K5NA 1O7LA 2UU9L 3T53B 3TQYA 1TWAH 1EIFA 2ZTDA 3E5SA 3KYHC 1PH4A 4GKJQ 5ELOA 1NR2A 3FVQA 4GOPC 1HZ9A 4V0BA 3OTOL 2XRSD 3RN2A 1EQVA 1AZPA 2I5MX 3UDXA 4CDEC 2CKZB 2F0DA 2QCPX 1VQ9A 5HY6A 4JI4L 4I7AA 3K0XA 1LYLA 5C3EH 4DV7Q 2UUCL 3FHWA 3I4OA 3D6CA 3E6ZX 4L5QA 2YU9H 3ND9A 4M1UB 2CFMA 3L0OA 4KKTA 1EIGA 1Y1WG 3ERQA 2BDNA 1A15A 2CH4W 1IBLL 2MUYA 3S1NB 2QEXA 4C1NI 2I46A 5K36G 1N32Q 2DY8A 1XXGA 2JSOA 4IZ8A 3V2TA 5A2QL 1R4PB 3A5ZB 3OHXC 1PRTF 4BBSB 4HCEA 2JA5B 1DONA 1B3QA 2EIFA 2KJXA 1JMCA 5C44B 1PA6A 4HAEA 2MFIA 3R2IA 1BBXC 4DR3Q 4JI2Q 4A3JB 5C6AA 2B2YA 2MJ8A 1L2FA 1X65A 4GOPB 3HOXB 2F4VQ 3MXNA 1NJIC 1CTMA 5IP9H 5BR8Q 3GTMH 1EYCA 4FVMA 1A63A 2F0OA 3GTGH 3R93A 2NVYB 4R4TA 3KOJA 4MTKA 3HOVH 4RAUC 5FLMH 1PLFA 5EKIA 4DR1Q 3S16B 2VQEQ 3KF6A 5GADC 4DV1Q 3T1YL 1MJEA 1EY9A 4DR3L 3I4NH 3D31A 5DM73 3I3CA 3I72A 5M3FH 5HURA 1X3QA 1G8ZD 2K5QA 1N36Q 1XWEA 1VQAA 1Q86C 1B7YB 1E7ZA 2K33A 2NB0A 2EJFC 3RZOH 1SAPA 4X62L 4PQXA 4BBRB 1D7QA 2XWBB 3HFZB 1JOQA 3TRZA 4BY1B 2MP1A 3J7AV 2G9HD 1WVLA 5C4JH 4K14A 1A2TA 4QUCA 2OCEA 4K5WA 1XTCD 2EOTA 1X6OA 2NN6G 2R93B 5I2XA 5LL6X 2CWAA 3DEPA 3HKZG 5JJZA 3PIP3 3G6EA 1AE2A 1IYUA 4ALPA 2EDGA 1WCMB 2K6AA 2XN9C 4DR2Q 2R93G 1PTOB 1K8MA 4K6LA 5IGFA 1H95A 3VYSA 3V05A 5TSSA 3J81j 5FO9B 1L0WA 2EJGC 4R9WA 1EU3A 4EGVA 1BCPD 2E2IH 1H9SA 2QW7A 1EZ8A 2F0EA 2DGYA 1VS0A 1B53A 2OWOA 1BQQT 4AYBG 1GOZA 2P5ZX 1FR3A 4FO2A 1XMQQ 1LLRD 1I94L 2JYOA 1FVIA 2F52A 4KHZA 3O13A 3FEWX 2RQXA 2R7ZH 4RKLA 4HIDA 1CHQD 4JOIC 5ELCA 1ZKOA 2F0SA 3IFTA 3NTIA 5C44G 3CCRA 5M3FG 2XWJB 3NENA 3BU2A 5EGTA 5M5YH 4OWWB 2JA5G 2GVBA 1P16A 1QVFA 2OEOA 1E3PA 4ZCKA 4L63B 4K0KQ 4DAPA 3KLSA 5ELNA 3JAML 2IJ0A 2JA8H 1MI2A 2M9VA 1F9SA 1KDCA 4Z9CB 2Z9HA 5KNDA 4QIWE 4QUFA 3VA5A 1CZGA 3V96A 2K01A 4MIUA 2SEBD 2PQEA 2XGTA 1VDZA 3LNNA 3D6WA 1X9NA 4GZYC 1VQEA 2V1CC 1R4QB 1HUNA 4BA2I 3GTPB 5CV9A 1PFBA 1YHAA 1AFPA 1CKOA 1YNJD 1SMYD 4HEDA 3OW7A 1SMYC 1Y8NB 4LF9Q 2L5TA 1YZ6A 4BY1G 1QE6A 3D4DA 2VQEL 2FXQA 4J15A 3A0JA 2VS1A 1YHQA 2WACA 1PH3A 3MXGA 4HJ5A 4Q0FA 1ZYRD 3DM1A 3CCVA 3RNUA 4LNQA 3I4MG 3KLWA 4HMJA 2UXCQ 2J0TD 1W6KA 2BDOA 4NKLA 1TXYA 5IGCA 3J80c 1HQMC 1X3GA 1HTPA 3FP9A 2EXZA 2N49A 5IY0A 2NUCA 1QJOA 5E4XA 1K8GA 1IKLA 5HGTA 3PUXA 4P75A 2PW5A 4C2MH 4KY5A 2PNRC 1D1KA 1TY2A 3MFGA 2OTLA 2AWNA 3S9WA 4QJFA 4LFAL 5IGEA 4LAAA 3VR4A 1DOLA 2JEBI 3QB3A 4RFBA 2A6HD 2N3SA 3DXJC 5JPNC 3K59A 2JA8G 1NCVA 2LKVA 2Z1CA 2R92B 3EN2A 1U5KA 3MHBA 3PO3G 5COYA 1XNQQ 5C0XG 2VB2X 2VB3X 4IUUA 3HOUG 1S4ZA 4LFAQ 2QGQA 3KF8B 1JOKA 1SE3A 4KN7C 2ZXRA 2R7DA 1ICFB 2LY7A 1I3QB 1Z9FA 3UE1A 3JC66 4JI0L 1EFID 1SNPA 4F8MA 3OWFA 3D3RA 3JAME 1XMQL 1MHWC 3DM3A 1OO9B 2NYZD 2R92H 4B3SL 2VQFQ 4CJ0B 5GAHC 1SRUA 1KRTA 3I70A 4CJ2C 1TU2B 3ZJYC 4L5SA 2PI2A 2EXDA 3VYUA 3BYTB 4TVAB 4BXXH 1PRTD 4X3UA 1J5EL 5AFWA 2EYFA 4L8JA 1QNUA 4XQQA 2A68D 4ZRZA 4MN3A 4KK7A 5IGBA 4FNFA 4KKSA 5ELBA 1KHIA 1JE5A 3P75A 3TEHB 2PW7A 2HT1A 1XPRA 4LF5Q 4HN7A 2E2HH 3CMEA 1GUNA 3H3VI 1QVGA 1NTGA 2ENBA 3ND8A 4U673 1PYSB 1GXDC 2A69C 3FMCA 1WD1A 3PMFA 1QNKA 4LW1A 1ZYRC 5KIXA 1EIHA 4K8JA 3JAMi 4GLVB 1V1PA 1T5XD 3S14H 4KKUA 2XRQD 3HOWH 2E75C 4C3JG 4K2LA 4IOCA 4IFDH 1EY5A 3A8IE 4JBKA 3J80L 5IYBG 2KA7A 3D4RA 1L1OA 3T51B 3KDFA 3KUPA 3MEHA 5E3FA 3M7NA 1HA6A 2OF1A 1DXMA 4MNOA 3MC0B 4P71A 4CKBA 3K6OA 1LO5D 5JJLA 3C1EA 4M8AA 2KHSA 4KLKA 3B6YA 4G7OC 2F0KA 1DYQA 3VYRA 4P72A 1Y1VG 1K8AC 2JA8B 3T1HL 1S3OA 1LTLA 1SFOB 1ET9A 1P8LA 2B2VC 5FOBB 2UUAL 4LUOA 3T16A 3NQTA 5JPMC 3PUWA 1IYVA 2PMZB 4G57A 4R1JA 3PO3H 1XNRL 1PHJA 1BF4A 1CHPD 2RCNA 1VQPA 2EY2A 5T1GA 2BH8A 3M3YH 1SYCA 5D3IB 4A3LG 5CR3A 3K5NA 2CVRA 1RJTA 2AKWB 1BXTA 1WFQA 1PDQA 3MXUA 4NXNQ 1IW7C 2CHBD 3UI2A 1XNQL 1G6ZA 1G291 4N9TA 1II3A 1BR9A 3H0GB 1EEID 1SMXA 1D5MC 1E2VA 2ICEC
chains in the Genus database with same CATH topology
1ZEQX 3URYA 1JWMD 1HCZA 2NZ1D 2IWHA 1SJHD 1TY0A 5CMDA 5LHY1 1SNMA 2B2TA 3DWAA 5EBCA 1EY0A 3K57A 3TMEA 3N52A 3NUCA 3S15B 5KGUA 2IX1A 2WV6D 4RA8A 3A55A 4IFDI 3QOJA 1U4PA 5E1FA 1C4QA 3R3OA 1LT5D 2A6EC 2HCIA 4EVOA 3BVMA 5DEHA 3FRPB 2RDGA 4BA1I 1PRTC 4DA2A 3Q23A 1GHJA 2B2YC 1O78A 1I4XA 2CW0D 1TIID 1W6JA 3WOEA 3NPPA 1ENCA 2F03A 2FMMA 2J4XA 3HOVB 3TP8A 4C3HB 1F2ZA 1I6HB 3KLRA 2XIWA 1UUPA 3W2DA 1FNVA 1C48A 1ESFA 1HPCA 1QB5D 4NMZA 2C5CA 2R3ZA 4QIWB 4UAIA 1ENFA 3R2TA 2F1MA 1OXSC 2MPMA 3T56B 1RCVD 3GD7A 2B2WC 4XT3B 3H09A 3AB9A 2JA6B 2B8FA 4KD4A 4OL7A 1D1IA 3Q22A 1PFNA 3E0JA 2PZTA 2D5DA 2YU9B 1FYCA 2O2LD 3DMUA 3MWYW 3MAQA 4H0LC 1A2UA 1UNSA 3GTQB 4BWGB 3S2HB 3HZXA 1PTOF 3GQBA 2RBMA 3BDOA 1RD9D 2FHTA 1EYAA 1KTKA 5KEEA 4E6IA 4N9PA 1HA5A 5I2YA 3SK5A 4DN4M 1OXUA 2EPBA 2EYPA 4XQNA 1PZJD 4HCSA 2KOLA 5KYLA 4A3GB 3ONAB 4KV6A 2L1BA 4HR7B 2NVXB 4KY6A 3QIAA 2IX0A 2XSCA 3BDLA 3TP7A 3BDCA 1HTLD 2ZXOA 5FLXE 4IURA 2B2UC 2F0FA 1GUTA 4KD3A 1O80A 1RKNA 3W3AA 1X3PA 1ILQA 1EOTA 4HMIA 2IW3A 4R8IA 1VMPA 3DHQA 4IFDG 4A3FB 3IKJA 1QG7A 1FGBD 4FXKC 5K36H 4DAVA 1MD2D 3OWEB 1Q1EA 2F0MA 2L55A 4EQPA 1BDOA 1SXTA 2F0WA 1JB3A 1B1ZA 1STEA 1XYIA 1Y69U 3HOYB 1BCPC 5EKLA 4CKEA 2ZXPA 2X6LA 3BG3A 3NHHA 3M4OB 5LL6S 1RODA 1BCPB 1RTOA 3M3YB 2SNSA 3U9SA 5ISRA 4EQNA 4G7ZC 4WJWA 2JE6I 3EROA 1SYFA 3GV6A 4DK0A 3T4AC 2A73B 3M4YA 4ILWA 3D8GA 2SOBA 2GA4B 1T5EA 4WORA 1SNOA 2M2LA 1FD7D 4P2CB 1NSNS 5J39A 3T13A 2IX3A 5FO8B 4FXGC 2H4OA 4RHRA 3FPUB 1LTTD 3KK7A 5IGDA 1I6VC 2E2JB 3P20A 4AYBB 3SHLA 4CJ1B 2Y0SB 2MHVA 3HOWB 1NAPA 2A69D 1RDPD 3X3MA 4F87A 1LTAD 3MA2B 4RCNA 3IAYA 3TBIB 2F3VA 4NDXA 1QILA 4IN3A 4LJZC 4IUVA 3S2DB 1HUMA 4TQUS 5BN5A 3HS0C 5DM63 1M8AA 3HRZC 1L0XB 4X3KA 3BVZA 4IUTA 2KQ3A 4PMWA 4UDUC 4DF7A 5C4HA 1MBYA 4XXEA 2MGSA 2N88A 4IUPA 2B2TC 3FPPA 3TN2A 2F0LA 3G7LA 1U4MA 2E76C 5IIFA 3WOFA 2QEJC 4RH6A 3RLFA 2LFNA 1LT4D 3A8KE 1B9NA 2CQAA 2EYJA 1TS5A 4X3TA 2Z4HA 3ITPA 1G2TA 4KN4C 1AW7A 1ONLA 5M3MB 4ULLA 5EQ0A 4RKBA 2Q8RE 2O5IC 3KF8A 1LTGD 5KRUA 4F7XA 4KI0A 3TDQA 2F0JA 2XNAC 5I9OA 4C2MB 2AWOA 2VNUD 1WTOA 4FYDA 4EQOA 2LS01 5M9OA 1OXXK 5EBDA 4TSSA 1D5XC 3PO3B 4OGQC 2IPKD 3J80E 3L9AX 4FF2A 4DXGA 2DNCA 3CRLC 4ZKBB 2F0HA 3RD4A 2ZT9C 1CM9A 4XYQA 4J1MA 2B2UA 1GUWA 1SNDA 2PZWA 1M4VA 4CKCA 5IT9L 2CW0C 3CKIB 3QO2A 1F77A 1S5ED 4NW2A 1PFMA 3S14B 2OXPA 1D2BA 2N55A 3A7AB 5FKAC 3NP8A 1EL0A 1H9RA 1DJRD 1Z7TA 3K58A 1VCIA 4JBWA 5J22A 4G4KA 2E2HB 2L4NA 1TWFB 5KYIA 3GV3A 3CU7A 3NWSA 3OPOA 3VYTA 5JEAH 4O42A 1EY4A 5CV5A 3Q24A 1Q1BA 1Z6HA 5IOCA 4WRDA 2K04A 1U4RA 1EY8A 1KDAA 2K7VA 2KUMA 2RKSA 4L6TB 1A3TA 4ODGA 1B4OA 3OSOA 5I6YA 1BNZA 3TZDA 3NXWA 1F2MA 3NWTA 1QCBD 2XVSA 3CHBD 2B39A 3VR2A 1Y8PB 4DAYA 3DWPA 3PV0A 2RSOA 4QCLA 3HG9A 1Y1WB 2B2WA 1PTOH 5A2QE 3NTHA 1WTXA 4U68A 1KLUD 1DCZA 2HUGA 4YIJA 5CV6A 2EY6A 4DNRB 1STGA 3EQLC 5IODA 4RGOS 2K28A 5C3XA 2A68C 1WTRA 3J81E 1OXVA 4V190 1LABA 3PIO3 1WTWA 1TWCB 2NBFA 5I4DA 2F0NA 3SR1A 1SBBB 2BE5D 3AU7A 2K05A 3GTMB 5J1ZA 2EVBA 1STNA 1PTOC 4LMQD 2L12A 4H13C 1TR5A 2AQ2B 1EQTA 2X69A 3IFDA 1SDFA 4FF4A 4ZYSA 1YNJC 1STHA 2K32A 4Q5VA 3A54A 3EJIA 3I73A 4LK1C 5DNFA 1GUSA 5EPKA 3EA6A 1YNND 1NR4A 2OT2A 3ZYYX 5ELEA 1F9PA 2L9HA 1EEFD 3OMGA 2QKIC 2F0IA 5C3EB 1SSOA 3SK4A 1WTQA 1B50A 4XYOA 1Q3LA 5EPJA 3LX0A 1B3AA 3MXPA 2R7ZB 1J8IA 1LV9A 1SNQA 2F4IA 2WAQB 4ZK9B 1XX8A 3QWNA 4CGYB 4KJNA 5F2DA 2TSSA 1SJED 3HEJA 3NQIA 1IW7D 5M5WB 5NUCA 4C3IG 2PCFB 1IL8A 2AQ3B 2JP1A 2QDBA 3LWEA 4FP5D 2AUJD 1K83B 1JICA 3C2PA 2A6HC 1EY7A 1F2YA 2R61A 1SE2A 4DK1A 5KNBA 3S1RB 2EZVA 2A74C 2BE5C 1SYGA 1QOHA 2EY1A 1I4QA 4HSVA 5JAVA 1SYBA 1EYDA 1H9KA 1CK1A 5M3FB 5FO7B 5CV4A 3X3NA 1V43A 3K5LA 4HTHA 2F0QA 2RA4A 4ZAIA 1TS3A 2J7ZA 2M00A 2WKCA 1K8OA 2H1EA 1A3UA 4KTAA 2EY5A 4C3HG 1ILPA 2EJMA 1CQFA 1D5ZC 2D62A 5CORA 3J7YW 2ID0A 1GUGA 1JQYD 4RGNA 1WTPA 2O5JC 5I6WA 1Q12A 4TRDA 3L7ZC 3NTKA 3U9OA 1S5DD 5G3LD 2PPBC 4FF1A 2FFKB 2RDFA 3RUZA 1O7ZA 2KEEA 1RHPA 4DFAA 1CA5A 4PMCA 4BS9A 5CC4A 3KLSX 3C1FA 1CA6A 3IL8A 5CBEE 2KCCA 3NE5B 3PUVA 2QILA 3S1MB 1CQVA 4CBVA 2A5HA 4IQZA 4H44C 3HOZB 3HP3A 3SVMA 3K0YA 3I90A 4DNTB 2KEDA 3HOUB 1V1PB 1ML0D 4ZUIA 3CQZB 4QF4A 1J9OA 4PNYA 4PMBA 5ELFA 1S5CD 3S17B 5CYUA 1H9MA 4Y7NB 5C3WA 1Y8OB 2F0VA 4DXFA 3I8ZA 4A3DB 3SK8A 1E0BA 3A7LA 1V8QA 2NTSA 4QMGA 2B63B 1JE4A 4B9WA 1F2LA 4PV1C 1ESRA 1KLGD 4H7BA 3R8BA 1SYDA 4A3MB 2Z8LA 1F9RA 3SE0A 3NBIA 1TS4A 5CV8A 3C46A 2RDHA 1JOOA 2NN6H 4RWSC 4X3SA 4S3SA 5D3DA 1PRTB 2KVMA 2BCOA 1SE4A 1E2WA 2NVTB 5ELDA 4NP5A 2AQ1B 2L0CA 5D65A 1SEBD 5A35A 1CT1D 3SEBA 4ABNA 2VUMB 5C5MA 1FNUA 1TT2A 3M85A 1LT3D 2BOSA 2X6GA 1TWHB 1B9MA 3K5MA 1S5FD 1RF2D 3TP6A 1VF7A 1Z47A 3RZDB 3DWQA 3Q0AA 2E2DC 1D6EC 2EYMA 1UEAB 3H94A 2NTTA 4R8NA 3F2UA 1YNNC 2Z4IA 4I65A 2FJ2A 1TVXA 5BN3A 4OO1G 2AUKA 4I7ZC 1GUOA 4IUNA 3VR6A 1TS2A 3SDZA 3QOLA 4DU9A 1IKMA 2EE1A 1PZKD 1X32A 5JEAG 1B2TA 2TMPA 1ET6A 1STAA 1KABA 3J7AF 3NSWA 4A93B 1LTID 3EFXD 2RVLA 1WD0A 2K1BA 1ZXTA 1KNAA 4ZQ3A 1PMRA 2F0UA 2NN6I 1U9RA 1SYEA 5JVH3 2F0TA 3FKIB 1PYWD 1AEXA 2IT1A 4A3IB 1QWYA 4F88A 3LWUA 2L11A 1DZ1A 3DUZA 2JA7B 5CV7A 3QJYA 1LT6D 1JR0D 4TKOB 2I07B 2FMCA 2HDLA 4ZUJA 3I91A 1BOSA 5EKKA 5C5LA 3BVGA 3A8JE 2WIIB 3D4WA 2O4XA 3VR3A 3VR5A 3G6JB 3KBGA 2YYZA 5EPLA 4BY7B 4C56C 3TP5A 4RCOA 4ZLTF 4OIKA 5FK9C 5DAUA 1AP0A 2PZUA 3P7JA 3C3LA 4XDXA 4J6HA 5EJWA 1DOMA 2WP8J 2B2VA 3OMCA 1B44D 1I4HA 1A6XA 1EWCA 4IFDJ 1Q8IA 4ID6A 1Y1VB 4JK1C 3WDNA 2QF7A 3MVVA 2V4DA 3GTKB 4A3KB 2KCNA 2EYLA 4J8QA 1TWGB 2G9DA 5BN4A 4IUQA 1OXTA 3OOCA 1GHKA 2K03A 2RSNA 1H9JA 2R6GA 1AZQA 1DOKA 4XT1B 4KHVA 4IALA 3SXHA 2Q8IB 4B08A 3L3OC 2LMCB 1JCKB 2BA1A 5M5XB 4OO1I 5JVG3 5C4XB 1MSHA 3CRKC 3MFYA 1S5BD 1PTOD 4A3EB 3GO5A 1HQRD 2DNEA 2EYOA 4ME5A 3QG1A 3GP7A 5C4ZA 1I50B 3MTSA 5C0XJ 1PXUA 4QB4A 1EY6A 1BUVT 2K5DA 2HCCA 3DEOA 4RHSA 1EZ6A 1L0YB 1HHVA 3H91A 3BYYB 1HRJA 1A3VA 1CZWA 1ICWA 4ZKCB 1HFNA 4G7HC 3HKZB 1VMCA 4RGTA 1NUCA 3AMUA 3N6RA 1RTNA 5C0XI 5M5YB 2VXWA 3A56A 5D14A 1I4RA 1IHZA 5T1IA 1O7YA 3H3VC 3TZUA 1C8CA 1HXYD 3P1HA 1G2SA 2EYHA 3HGBA 4WFN3 2F0PA 5I9PA 2WKDA 1WTVA 1BO0A 2F3WA 2IL8A 3MZ5A 1DD2A 3PO2B 1Q90A 1CI3M 2E2IB 1SNCA 1LACA 3K5OA 4OO1H 2PYKA 1TQOA 4K8IA 1TKWB 3I4LA 3NK9A 3BZDB 4OHJA 5C0XH 3VA7A 2NWGA 4K2KA 4O1NA 1JORA 1EU4A 3J81L 2DY7A 2KECA 4A3BB 2B8GA 1STBA 1BCPF 3BS1A 1AN8A 1F9QA 2HDMA 5C4JB 4XQJA 5JOBA 4CHTB 4KJOA 1I4GA 3I4MB 2SDFA 2ICIA 3RZOB 3PUZA 5G3LF 3SK6A 2DN8A 1JC7A 1EWHA 1GJXA 4DGZA 3FDTA 3KBXA 3K7AB 3I4NB 1H9SB 4XTCS 5K5PA 1LTSD 4C3IB 3H6MA 1FNWA 3GTGB 4K6DA 2JXMB 1UAPA 4B9XA 3PUYA 3EVQA 2HQEA 1JWSD 5FLXL 2JEAI 4FXDA 2WINB 2Q8TA 4KY7A 1G91A 3GTJB 2K5WA 5KNCA 1LTBD 3OIQA 2C9OA 1R9TB 4FF3A 5E4WC 2D9UA 1ENAA 2PO4A 1CFMA 3OIPA 2D2CC 3M7GA 2E74C 1V1OA 1STYA 1KAAA 1I4PA 2SNMA 4OIJA 5JEAJ 2NVQB 5CBAE 5IGGA 1DM0B 5CGKA 2FINB 3NBHA 4C1NK 5IT9E 2A6ED 3TSSA 1LTRD 3GTOB 1MSGA 1U4LA 1E2ZA 1JWUD 4C3JB 2BA0A 2F0GA 1MGSA 3GTLB 3Q6SA 4XIGS 4MHEA 1KNEA 1KDBA 1PZID 1VF5C 3S1QB 4K5XA 1TWAB 4K5VA 2WB1B 4KMUC 4HSPA 4RGMA 3RMHA 1HFGA 1O7LA 3T53B 3E5SA 1NR2A 3FVQA 4V0BA 2XRSD 1AZPA 1EQVA 2F0DA 2QCPX 3D6CA 3E6ZX 3ND9A 4M1UB 4KKTA 1EIGA 3ERQA 2BDNA 1A15A 2MUYA 3S1NB 4C1NI 2I46A 5K36G 2DY8A 1XXGA 2JSOA 4IZ8A 5A2QL 3V2TA 1R4PB 3OHXC 1PRTF 4BBSB 4HCEA 2JA5B 1DONA 2KJXA 5C44B 4HAEA 1BBXC 3R2IA 4A3JB 5C6AA 2B2YA 2MJ8A 3HOXB 3MXNA 1CTMA 1EYCA 4FVMA 2F0OA 3R93A 2NVYB 4RAUC 1PLFA 5EKIA 3S16B 1EY9A 3D31A 5DM73 3I3CA 3I72A 5HURA 1X3QA 1G8ZD 2K5QA 1XWEA 2K33A 2NB0A 2EJFC 1SAPA 4PQXA 4BBRB 2XWBB 1JOQA 4BY1B 2MP1A 3J7AV 2G9HD 1WVLA 4K14A 1A2TA 4QUCA 4K5WA 1XTCD 2EOTA 2NN6G 2R93B 5I2XA 5LL6X 3DEPA 5JJZA 3PIP3 1IYUA 2EDGA 1WCMB 2K6AA 2XN9C 1PTOB 1K8MA 4K6LA 5IGFA 3VYSA 3V05A 5TSSA 5FO9B 2EJGC 4R9WA 1EU3A 4EGVA 1BCPD 1H9SA 1EZ8A 2F0EA 1B53A 1BQQT 1GOZA 1FR3A 4FO2A 1LLRD 2JYOA 4KHZA 3O13A 3FEWX 2RQXA 4RKLA 1CHQD 5ELCA 1ZKOA 2F0SA 3IFTA 3NTIA 2XWJB 5EGTA 2OEOA 4L63B 4DAPA 3KLSA 3JAML 2IJ0A 1MI2A 2M9VA 1F9SA 1KDCA 4Z9CB 5KNDA 4QUFA 3VA5A 1CZGA 3V96A 2K01A 4MIUA 2SEBD 2PQEA 1VDZA 3LNNA 3D6WA 4GZYC 1R4QB 1HUNA 4BA2I 3GTPB 5CV9A 1PFBA 1AFPA 1YNJD 1SMYD 4HEDA 3OW7A 1SMYC 1Y8NB 2L5TA 1QE6A 3D4DA 2WACA 3MXGA 4Q0FA 1ZYRD 3DM1A 4HMJA 2J0TD 1W6KA 2BDOA 4NKLA 5IGCA 1HQMC 1HTPA 2EXZA 2NUCA 1QJOA 5E4XA 1IKLA 5HGTA 3PUXA 2PW5A 2PNRC 1D1KA 1TY2A 3MFGA 4KY5A 2AWNA 3S9WA 5IGEA 4LAAA 3VR4A 1DOLA 2JEBI 3QB3A 4RFBA 2A6HD 3DXJC 5JPNC 3K59A 1NCVA 2LKVA 2Z1CA 2R92B 3MHBA 5COYA 5C0XG 2VB2X 2VB3X 4IUUA 1S4ZA 1JOKA 1SE3A 4KN7C 2ZXRA 2LY7A 1I3QB 1EFID 1SNPA 4F8MA 3OWFA 3D3RA 3JAME 1OO9B 2NYZD 4CJ0B 3I70A 4CJ2C 1TU2B 3VYUA 3BYTB 1PRTD 4X3UA 5AFWA 2EYFA 4L8JA 1QNUA 4XQQA 2A68D 4ZRZA 4MN3A 4KK7A 5IGBA 4FNFA 4KKSA 5ELBA 3P75A 2PW7A 4HN7A 1GUNA 2ENBA 3ND8A 4U673 1GXDC 2A69C 3FMCA 1WD1A 3PMFA 1QNKA 1ZYRC 5KIXA 1EIHA 4K8JA 1V1PA 1T5XD 4KKUA 2XRQD 2E75C 4C3JG 4K2LA 4IFDH 1EY5A 3A8IE 3J80L 2KA7A 3D4RA 3T51B 3KUPA 3MEHA 5E3FA 3M7NA 1HA6A 2OF1A 1DXMA 3MC0B 4CKBA 3K6OA 1LO5D 3C1EA 4M8AA 2KHSA 4G7OC 2F0KA 1DYQA 3VYRA 2JA8B 1SFOB 1ET9A 2B2VC 5FOBB 3T16A 3NQTA 5JPMC 3PUWA 1IYVA 2PMZB 4G57A 1BF4A 1CHPD 2EY2A 5T1GA 1SYCA 5D3IB 5CR3A 3K5NA 2CVRA 1RJTA 1BXTA 1PDQA 3MXUA 1IW7C 2CHBD 3UI2A 1G6ZA 1G291 4N9TA 1II3A 1BR9A 3H0GB 1EEID 1D5MC 1E2VA 2ICEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TKO B;  3PUZ A;  2A68 D;  1HCZ A;  3OW7 A;  1O7L A;  1SMY C;  1IW7 D;  2A68 C;  1Y8N B;  2DN8 A;  3T53 B;  2D5D A;  1EWH A;  3A7A B;  1GJX A;  3M85 A;  3FPP A;  4KKS A;  1FYC A;  3A8J E;  1Y69 U;  1OXV A;  2L5T A;  2PCF B;  1H9R A;  4H0L C;  2NN6 G;  2E76 C;  1LAB A;  1B9M A;  1Z7T A;  1VCI A;  3BG3 A;  1H9S B;  2AUJ D;  2KCC A;  3NE5 B;  3GQB A;  3PUV A;  1GUN A;  3BDO A;  4JBW A;  4XTC S;  3RLF A;  3VR5 A;  2A6H C;  3VR3 A;  4G7H C;  1IYU A;  3A8K E;  1B9N A;  2BE5 D;  1VF7 A;  2EDG A;  2YYZ A;  3ND8 A;  4DK1 A;  5KNB A;  4IQZ A;  2A69 C;  3FMC A;  3U9S A;  4H44 C;  2JXM B;  1K8M A;  3N6R A;  4G7Z C;  3PUY A;  2BE5 C;  2JE6 I;  1OXU A;  2EVB A;  4DK0 A;  3H94 A;  3OPO A;  1ZYR C;  3M4Y A;  2BDO A;  2JEA I;  1YNN C;  2EJG C;  3ND9 A;  4H13 C;  1HQM C;  5JEA H;  4DNT B;  1HTP A;  4KKT A;  5BN3 A;  4OO1 G;  4KN4 C;  1Q1B A;  1Z6H A;  2AUK A;  4KKU A;  1H9S A;  2E75 C;  4I7Z C;  1GUO A;  3VR6 A;  5KNC A;  1ONL A;  4IFD H;  1QJO A;  1A6X A;  2A6E C;  1H9K A;  3SDZ A;  1T5E A;  3A8I E;  3PUX A;  2PNR C;  2KA7 A;  3D4R A;  4JK1 C;  3T51 B;  3WDN A;  2QF7 A;  1YNJ C;  2K32 A;  3TZU A;  4BA1 I;  2O5I C;  3M7N A;  5JEA G;  1DXM A;  2K7V A;  4HR7 B;  5K36 G;  3I73 A;  1H9M A;  2V4D A;  3VR4 A;  1FR3 A;  4KI0 A;  4LK1 C;  2JEB I;  3QIA A;  1GHJ A;  1CFM A;  2A6H D;  1O78 A;  1Y8O B;  3DXJ C;  1GUS A;  2D2C C;  4KHZ A;  3HGB A;  2E74 C;  5BN4 A;  3A7L A;  1V8Q A;  4G7O C;  1V43 A;  1I6V C;  1OXT A;  3P20 A;  1GUT A;  2AWO A;  3OOC A;  1GHK A;  1DD2 A;  4PV1 C;  1H9J A;  1ZKO A;  2R6G A;  1Q90 A;  5C0X G;  1CI3 M;  1K8O A;  3KLR A;  3IFT A;  3VR2 A;  1OXX K;  1PMR A;  1Y8P B;  2A69 D;  2A6E D;  1LAC A;  3W3A A;  3PV0 A;  4OGQ C;  3SE0 A;  4KN7 C;  2EJM A;  2NN6 I;  4RCN A;  2DNC A;  3PUW A;  1IYV A;  1HPC A;  4OO1 H;  1E2Z A;  2D62 A;  1CTM A;  2Q8I B;  1TKW B;  3I4L A;  3CRL C;  2BA0 A;  4IFD G;  5C0X H;  3VA7 A;  2NN6 H;  2LMC B;  2BA1 A;  3IKJ A;  4LJZ C;  1GUG A;  4TQU S;  2IT1 A;  5BN5 A;  3CRK C;  3MFY A;  2O5J C;  5KND A;  2F1M A;  5K36 H;  2ZT9 C;  4XIG S;  2DNE A;  3LWU A;  1Q1E A;  1OXS C;  1DCZ A;  3D31 A;  3MXU A;  1IW7 C;  3QG1 A;  3T56 B;  1TU2 B;  3I72 A;  1VF5 C;  2B8G A;  1E2W A;  1G29 1;  3GD7 A;  1BDO A;  1Q12 A;  1VDZ A;  3L7Z C;  3LNN A;  4GZY C;  4DNR B;  2CW0 C;  3QJY A;  5A35 A;  4BA2 I;  2K33 A;  4KMU C;  2EJF C;  3EQL C;  3AB9 A;  2PPB C;  1E2V A;  2B8F A;  4L8J A; 
#chains in the Genus database with same CATH topology
 1ZEQ X;  3URY A;  1O7I A;  4DV1 L;  1JWM D;  1HCZ A;  2NZ1 D;  2IWH A;  1A62 A;  1SJH D;  3T1Y Q;  4WJ3 M;  1TY0 A;  4RG1 A;  5CMD A;  5LHY 1;  4FDB A;  1JJC B;  1SNM A;  1WOC A;  2B2T A;  2VQF L;  4QQB X;  3DWA A;  4P73 A;  5EBC A;  1EY0 A;  3K57 A;  4PG3 A;  3TME A;  1HZB A;  2B29 A;  1NMG A;  3N52 A;  1KXL A;  2JA7 G;  4WJ4 A;  2OTJ A;  2CWP A;  1G51 A;  4OWT B;  3NUC A;  3S15 B;  5KGU A;  1SR3 A;  2IX1 A;  2WV6 D;  1J5E Q;  4RA8 A;  3A55 A;  1NMF A;  4IFD I;  3AFQ A;  3QOJ A;  1U4P A;  1EFW A;  1K3B C;  1YBY A;  5E1F A;  5IYC G;  1C4Q A;  3R3O A;  2BH2 A;  1LT5 D;  2A6E C;  2HCI A;  4EVO A;  3BVM A;  5DEH A;  3PO2 G;  3FRP B;  2RDG A;  1PH2 A;  4BA1 I;  4A3I G;  2VW9 A;  2B63 G;  1PRT C;  4DA2 A;  3Q23 A;  1GHJ A;  2B2Y C;  3G4S A;  1O78 A;  1I4X A;  1K28 A;  2CW0 D;  1TII D;  2NVX H;  4UY8 C;  2GN5 A;  1VQJ A;  1W6J A;  4K0K L;  4DV4 L;  3WOE A;  3NPP A;  1ENC A;  2F03 A;  2FMM A;  2J4X A;  5IYD H;  3HOV B;  3KFU A;  2WFW A;  3TP8 A;  4C3H B;  1VQK A;  4P74 A;  4A3G H;  1VQ5 A;  4JYA L;  1YIT A;  3HOU H;  1F2Z A;  2NZO A;  1I6H B;  4LF6 L;  3KLR A;  2XIW A;  1UUP A;  1HR0 W;  2JJQ A;  3HOX H;  3W2D A;  2HIV A;  1PYB A;  1FNV A;  2UUB Q;  1C48 A;  1ESF A;  1HPC A;  3HOZ H;  2E5L L;  1QB5 D;  1KD1 C;  4N8X 1;  4NMZ A;  2C5C A;  2R3Z A;  4QIW B;  4DKA C;  3S1M H;  4UAI A;  2E2J H;  1ENF A;  3R2T A;  2F1M A;  4X66 L;  4A76 A;  3S2H H;  1OXS C;  2MPM A;  3T56 B;  1B8A A;  1RCV D;  3GD7 A;  2B2W C;  3T1H Q;  4XT3 B;  3CCL A;  1FJG L;  3H09 A;  3AB9 A;  2JA6 B;  2B8F A;  4KD4 A;  4OL7 A;  2JA6 H;  1T9H A;  1D1I A;  3Q22 A;  1XNR Q;  3KJP A;  1PFN A;  3E0J A;  1XTD A;  2PZT A;  2MNA A;  2D5D A;  2YU9 B;  1FYC A;  2ZJP A;  2O2L D;  3J7A 5;  3DMU A;  4DR5 Q;  1MJC A;  3MWY W;  3MAQ A;  4H0L C;  1A2U A;  1UNS A;  3GTQ B;  4BWG B;  4DUY Q;  4LUV A;  3S2H B;  3HZX A;  2KBN A;  1PTO F;  3GQB A;  2RBM A;  5IWA Q;  3BDO A;  1RD9 D;  2FHT A;  1EYA A;  1N32 L;  2MO1 A;  1UE7 A;  1U0L A;  3IRB A;  1KTK A;  5KEE A;  1J6Q A;  4N9P A;  3J80 i;  4E6I A;  1HA5 A;  5I2Y A;  1XPO A;  1IL2 A;  2A19 A;  4UP7 A;  3SK5 A;  4JG2 A;  4DN4 M;  1OXU A;  4DV3 L;  3HOY H;  2EPB A;  2EYP A;  3QR8 A;  4XQN A;  1PZJ D;  4HCS A;  2KOL A;  5KYL A;  5IYB H;  4A3G B;  3ONA B;  3K80 C;  4KV6 A;  3J81 i;  3EBE A;  4JI1 L;  4DV2 L;  1XMO L;  4A3B G;  4A3J G;  2L1B A;  4HR7 B;  2NVX B;  2CCZ A;  4KY6 A;  3H3V H;  3S1Q H;  4GOP A;  3QIA A;  2IX0 A;  2PQA A;  2XSC A;  3BDL A;  5FJ8 H;  3TP7 A;  2Y0S G;  3BDC A;  1HTL D;  2ZXO A;  5FLX E;  4IUR A;  2B2U C;  2F0F A;  5GAG C;  5L37 A;  1GUT A;  4NB3 A;  1UE6 A;  3UDI A;  3CMA A;  1N33 Q;  4KD3 A;  3CXC A;  1O80 A;  1RKN A;  1K0S A;  1L1O B;  2IHE A;  3W3A A;  2ZM6 L;  2HHH Q;  1X3P A;  2ZJQ A;  1ILQ A;  1EOT A;  3VDY A;  4HMI A;  2IW3 A;  1HNX L;  4R8I A;  1VMP A;  3DHQ A;  4IFD G;  1S40 A;  4A3F B;  1X3F A;  1YEZ A;  3IKJ A;  1VQ8 A;  1QG7 A;  2K5V A;  1FGB D;  4GN3 B;  4FXK C;  5K36 H;  1K83 H;  4DAV A;  1MD2 D;  3OWE B;  2EQS A;  1Q1E A;  2F0M A;  3PQI A;  2L55 A;  4L5T A;  4EQP A;  1XPU A;  3E0E A;  1BDO A;  1SXT A;  2F0W A;  3CCE A;  4LF6 Q;  1JB3 A;  3E3X A;  1B1Z A;  4JPB W;  1STE A;  4QY7 A;  1KRS A;  2ES2 A;  4N8F A;  3GTJ H;  3W5O A;  3TS2 A;  3HOY G;  3TS0 A;  4ME3 A;  4LF8 L;  4JC0 A;  1XYI A;  3H0G H;  2KEN A;  1Y69 U;  3HOY B;  1BCP C;  2ATW A;  1AH9 A;  5EKL A;  4POF A;  4CKE A;  2ZXP A;  2X6L A;  3BG3 A;  1HNZ Q;  3NHH A;  3M4O B;  2WB1 G;  5LL6 S;  1ROD A;  4JI5 Q;  4DAM A;  1MIU A;  1BCP B;  1RTO A;  3M3Y B;  2SNS A;  2QA4 A;  3U9S A;  2UU9 Q;  2ASB A;  5ISR A;  4EQN A;  4G7Z C;  4WJW A;  2JE6 I;  3ERO A;  1SYF A;  3GV6 A;  4DK0 A;  1OTC A;  3T4A C;  2A73 B;  3M4Y A;  4ILW A;  4JYA Q;  5DLQ E;  2HIX A;  3OTO Q;  4LF5 L;  1KIX A;  4UP8 A;  4EQ5 A;  1N8R C;  1SFO H;  3I4M H;  3D8G A;  5LMN L;  2SOB A;  2GA4 B;  5J3B A;  3TRE A;  2UXB L;  1T5E A;  4WOR A;  1SNO A;  4QGU A;  2M2L A;  1FD7 D;  4JI4 Q;  4P2C B;  1NSN S;  5FLM G;  4GNX B;  5J39 A;  3T13 A;  2IX3 A;  1YNX A;  4X6A H;  1E22 A;  5FO8 B;  4FXG C;  2H4O A;  4RHR A;  1C9O A;  3FPU B;  1K73 C;  1LTT D;  1RIP A;  5FJ8 G;  3KK7 A;  5C4X G;  5IGD A;  3H15 A;  1Q8K A;  1I6V C;  2RHS B;  2E2J B;  3P20 A;  2VY3 A;  3SHL A;  4AYB B;  4CJ1 B;  2Y0S B;  4B3T L;  2MHV A;  1CSP A;  3HOW B;  1NAP A;  2A69 D;  1RDP D;  3X3M A;  4F87 A;  1LTA D;  4B3M Q;  3MA2 B;  4RCN A;  4A3D G;  3IAY A;  3TBI B;  2F3V A;  1VQ7 A;  1GVP A;  4NDX A;  1QIL A;  4IN3 A;  1I6H H;  3PO2 H;  4C3H H;  4LJZ C;  4IUV A;  3S2D B;  1HUM A;  4TQU S;  4IO9 A;  5BN5 A;  3HS0 C;  5DM6 3;  1M8A A;  1YJN A;  3I4N G;  2KHI A;  2F4V L;  3HRZ C;  1L0X B;  4X3K A;  3BVZ A;  4IUT A;  1ASY A;  4A3G G;  2KQ3 A;  4PMW A;  1SRO A;  2HHH L;  4UDU C;  4DF7 A;  1KAW A;  4DV3 Q;  5C4H A;  1MBY A;  2MGS A;  4XXE A;  1HZC A;  1HNX Q;  2N88 A;  3LGJ A;  1BKB A;  4IUP A;  2B2T C;  4NXN L;  3FPP A;  3TN2 A;  2F0L A;  4HIK A;  3G7L A;  1A0I A;  1U4M A;  2K14 A;  2E76 C;  5IIF A;  3WOF A;  2QEJ C;  4RH6 A;  3RLF A;  2LFN A;  1LT4 D;  2Q2I A;  3A8K E;  4DPG A;  1B9N A;  2CQA A;  2EYJ A;  3CCU A;  2DJF C;  1TS5 A;  1NY4 A;  3M4Q A;  4OXP A;  1Y1W H;  3I7F A;  2QDL A;  1I3Q H;  4X3T A;  1N33 L;  4NPS A;  2Z4H A;  3ITP A;  4DV4 Q;  1G2T A;  1W2B A;  4KN4 C;  1AW7 A;  4DUZ L;  1ONL A;  5M3M B;  1VQD A;  4ULL A;  3UDG A;  5EQ0 A;  4RKB A;  2Q8R E;  2LXK A;  2O5I C;  1GO3 E;  3KF8 A;  1LTG D;  5KRU A;  4POG A;  3PF4 A;  4F7X A;  4KI0 A;  4JI5 L;  4HJ7 A;  3TDQ A;  2L15 A;  2F0J A;  2XNA C;  2JN4 A;  5E7N A;  4UP9 A;  1PH9 A;  5C3E G;  1V1Q A;  5I9O A;  4A3E H;  1Q46 A;  5JJK A;  1FL0 A;  1K3R A;  1G6P A;  4C2M B;  2AWO A;  5M5X H;  2VNU D;  4OON A;  2Z0S A;  2Z6K A;  1WTO A;  4FYD A;  4EQO A;  2LS0 1;  5M9O A;  1OXX K;  5EBD A;  4TSS A;  1D5X C;  3PO3 B;  4OGQ C;  2IPK D;  3J80 E;  3L9A X;  5LMN Q;  4FF2 A;  4DXG A;  2DNC A;  2N8N A;  4DK3 C;  2GVA A;  1TWF H;  3CRL C;  4ZKB B;  3PF5 A;  1HH2 P;  4LFC Q;  2C35 B;  4DR4 Q;  4MTN A;  2OQ0 A;  4GKJ L;  2F0H A;  3RD4 A;  2ZT9 C;  1CM9 A;  4XYQ A;  4J1M A;  4O0A A;  2B2U A;  1GUW A;  1SND A;  1CKM A;  2PZW A;  1M4V A;  4DV5 Q;  4CKC A;  4A3K H;  3GTK H;  4B3T Q;  5IT9 L;  1CKN A;  2E5L Q;  3NEL A;  2CW0 C;  3CKI B;  3QO2 A;  1F77 A;  1S5E D;  5IWA L;  4NW2 A;  1D8L A;  2A1A A;  1PFM A;  4DR7 Q;  2UUC Q;  3S14 B;  1JJ2 A;  2OXP A;  1D2B A;  2A8V A;  2N55 A;  4YHH L;  3ER0 A;  3A7A B;  5FKA C;  3NP8 A;  1EL0 A;  3BZK A;  1H9R A;  4HIM A;  4Y52 H;  1CUK A;  1DJR D;  2R7F A;  1Z7T A;  3K58 A;  1VCI A;  4JBW A;  4PZ6 A;  2CQO A;  5J22 A;  4G4K A;  2E2H B;  4AYB E;  3UDF A;  2L4N A;  2UXD Q;  1TWF B;  4LF9 L;  5KYI A;  3GV3 A;  3CU7 A;  3NWS A;  3OPO A;  1IBM Q;  3VYT A;  5JEA H;  4O42 A;  1EY4 A;  5CV5 A;  3Q24 A;  4DUY L;  1Q1B A;  1Z6H A;  5IOC A;  1X3E A;  1CSQ A;  4WRD A;  2UUA Q;  4DV6 Q;  2K04 A;  1S72 A;  1U4R A;  3J7Z C;  3J81 c;  1EY8 A;  4UPA A;  4X64 Q;  4A3C G;  2WAQ E;  1KDA A;  4PZ8 A;  2K7V A;  2KUM A;  1UEB A;  1HZA A;  5IYC H;  2RKS A;  2IY5 B;  4L6T B;  4NXM Q;  1A3T A;  4ODG A;  1B4O A;  3OSO A;  5I6Y A;  1BNZ A;  3TZD A;  1X55 A;  3NXW A;  1F2M A;  3PSI A;  3CCS A;  4DV7 L;  3NWT A;  1QCB D;  5M3M H;  4GKK Q;  3E9I A;  2Q2T A;  2XVS A;  3CHB D;  2B39 A;  3VR2 A;  3I56 A;  1Y8P B;  4DAY A;  3DWP A;  3PV0 A;  4GNX A;  4AH6 A;  2RSO A;  4QCL A;  4MZ9 A;  3HG9 A;  1Y1W B;  2B2W A;  1PTO H;  1VQM A;  2KHJ A;  4JBJ A;  5A2Q E;  3STB D;  3NTH A;  3W1G A;  1WTX A;  3A5U A;  4U68 A;  1KLU D;  2PNH A;  1DCZ A;  2HUG A;  4YIJ A;  5CV6 A;  1EUJ A;  1BBW A;  1LUZ A;  2KCT A;  1Q82 C;  2EY6 A;  2HD3 A;  4DNR B;  1STG A;  5LMN W;  5IP7 G;  1PH5 A;  4BY1 H;  3EQL C;  3OW2 A;  5IOD A;  4RGO S;  1YI2 A;  3K7U C;  2K28 A;  2VZA A;  5C3X A;  2A68 C;  1WTR A;  3J81 E;  5HGQ A;  4DR4 L;  1OXV A;  4V19 0;  2I0Q A;  1LAB A;  3PIO 3;  1WTW A;  1TWC B;  4A3L H;  1VQF A;  2NBF A;  5I4D A;  2F0N A;  3RZD H;  3SR1 A;  1SBB B;  2BE5 D;  3AU7 A;  3S2D H;  2K05 A;  2RF4 A;  3K81 C;  3GTM B;  1TWH H;  1PH6 A;  5J1Z A;  2EVB A;  1STN A;  1PTO C;  4LMQ D;  2L12 A;  4H13 C;  4A3J H;  1TR5 A;  2AQ2 B;  1EQT A;  2X69 A;  3IFD A;  4BBR G;  1SDF A;  4FF4 A;  4ZYS A;  3GTP H;  2B3G A;  4BBS H;  1YNJ C;  1STH A;  2K32 A;  4Q5V A;  3A54 A;  3EJI A;  2DJG C;  4B3M L;  3CCM A;  3I73 A;  4LK1 C;  4A3F G;  5DNF A;  1GUS A;  5EPK A;  2UXD L;  3EA6 A;  3U50 C;  3E9H A;  4DV5 L;  1YNN D;  1NR4 A;  1Y14 B;  1M1K C;  2OT2 A;  1K0R A;  3ZYY X;  5ELE A;  1F9P A;  4R4C A;  5M3M G;  2L9H A;  1EEF D;  3OMG A;  2QKI C;  1N34 Q;  3CCJ A;  2F0I A;  2R92 G;  1UE1 A;  3UE0 A;  5C3E B;  1SSO A;  3SK4 A;  1WTQ A;  1B50 A;  1NNX A;  4XYO A;  2RCF A;  1Q3L A;  4YCU A;  5EPJ A;  2K50 A;  4DR5 L;  3LX0 A;  1B3A A;  4DV0 L;  3MXP A;  1I94 Q;  4AQY L;  2R7Z B;  1J8I A;  4IJH A;  3M4O H;  1LV9 A;  4IPD A;  4A3K G;  1SNQ A;  4HJ8 A;  2Z6K C;  2F4I A;  2WAQ B;  4L5R C;  1MKH A;  4LF4 L;  4ZK9 B;  1XX8 A;  3QWN A;  4CGY B;  4KJN A;  5F2D A;  2TSS A;  1SJE D;  1VQN A;  3HEJ A;  3NQI A;  1IW7 D;  3F8T A;  5M5W B;  4YCW A;  5NUC A;  4C3I G;  2PCF B;  1IL8 A;  2AQ3 B;  1YJ9 A;  2JP1 A;  2QDB A;  3LWE A;  4FP5 D;  2AUJ D;  4LF4 Q;  4OEL B;  4YY3 Q;  1K83 B;  1JIC A;  3C2P A;  2A6H C;  2ALY B;  1WJJ A;  1EY7 A;  4A3E G;  1F2Y A;  3S24 A;  2R61 A;  1SE2 A;  4DK1 A;  5KNB A;  4A3F H;  3S1R B;  4C3J H;  2EZV A;  2A74 C;  2BE5 C;  3AQQ A;  1SYG A;  4LWC A;  1NE3 A;  3U58 A;  4B3R Q;  1QOH A;  2EY1 A;  1I4Q A;  4HSV A;  5JAV A;  2ZM6 Q;  2F3I A;  2NVQ H;  4BBR H;  1SYB A;  1EYD A;  1H9K A;  1CK1 A;  2WAQ G;  3STB C;  2AHO B;  5M3F B;  1KQS A;  1JB7 A;  5FO7 B;  2WB1 E;  3MXN B;  5FLX c;  5CV4 A;  4LFC L;  3X3N A;  1V43 A;  4IPH A;  3K5L A;  3S16 H;  1EQR A;  4HTH A;  2F0Q A;  2NVY H;  2RA4 A;  3F2B A;  4DR1 L;  4ZAI A;  1TS3 A;  2J7Z A;  2M00 A;  2WKC A;  1K8O A;  2H1E A;  1A3U A;  4KTA A;  2EY5 A;  4C3H G;  4JCV E;  1ILP A;  2EJM A;  1HR0 L;  1CQF A;  4A3C H;  1D5Z C;  1PH8 A;  2D62 A;  1VQB A;  5COR A;  3J7Y W;  3GDE A;  2ID0 A;  5C44 H;  2K75 A;  1GUG A;  1JQY D;  4RGN A;  1WTP A;  2JA5 H;  4C3I H;  2O5J C;  5I6W A;  1FGU A;  2MQH A;  3ULJ A;  3GTQ H;  3F1Z A;  3K7A H;  1Q12 A;  4TRD A;  3L7Z C;  1XJV A;  3NTK A;  3AEV A;  3U9O A;  4O2D A;  1S5D D;  5G3L D;  2PPB C;  4FF1 A;  2FFK B;  2RDF A;  3AFP A;  3RUZ A;  1O7Z A;  2KEE A;  1RHP A;  4APV A;  4DFA A;  1VQG A;  3RLN A;  1CA5 A;  4PMC A;  4BS9 A;  3CAM A;  3KJO A;  5CC4 A;  4A3B H;  1QUQ B;  3KLS X;  3C1F A;  1CA6 A;  1CKN B;  3IL8 A;  1DGS A;  5CBE E;  3ICE A;  2KCC A;  2K4K A;  4A4I A;  3NE5 B;  3PUV A;  2QIL A;  1FJG Q;  4DV6 L;  4DNI A;  3S1M B;  1C0A A;  4LUZ A;  2H5X A;  1CQV A;  4X64 L;  4CBV A;  2A5H A;  4IQZ A;  4H44 C;  4YHH Q;  3HOZ B;  1L1O C;  3HP3 A;  1B70 B;  2E8G A;  3SVM A;  4OX9 Q;  3K0Y A;  5M5W H;  3I90 A;  4DNT B;  2KED A;  1X56 A;  3HOU B;  1V1P B;  1ML0 D;  4ZUI A;  4GKK L;  1EOV A;  2JA9 A;  3MEF A;  3CQZ B;  4QF4 A;  1J9O A;  4PNY A;  5IT9 c;  3HOV G;  4PMB A;  5ELF A;  4A93 G;  1S5C D;  1HNW Q;  3S17 B;  5CYU A;  1H9M A;  2YTY A;  4Y7N B;  1Y8O B;  2F0V A;  5C3W A;  4DXF A;  3I8Z A;  1SN8 A;  4A3D B;  3SK8 A;  1E0B A;  5IYD G;  3A7L A;  1V8Q A;  2NTS A;  3L2P A;  4QMG A;  2B63 B;  1JE4 A;  1W3S A;  3GTL H;  3CPW A;  4B9W A;  1F2L A;  1VQI A;  4PV1 C;  4IPC A;  2VL6 A;  1ESR A;  1KLG D;  4H7B A;  3R8B A;  3HOX G;  1SYD A;  4A3M B;  4JI3 Q;  1JJG A;  2Z8L A;  1F9R A;  3SE0 A;  3NBI A;  3GTO H;  1TS4 A;  5CV8 A;  4A3M G;  1IBL Q;  3C46 A;  4NXM L;  3S15 H;  2RDH A;  1JOO A;  2NN6 H;  3CCQ A;  4RWS C;  4X3S A;  4S3S A;  5D3D A;  2G5D A;  3CC2 A;  1X54 A;  2Q2U A;  1PRT B;  4JI3 L;  4YWM A;  2KVM A;  4KHP Q;  2BCO A;  4DAY B;  1QUQ A;  1SE4 A;  1E2W A;  4GN4 B;  4DR6 L;  5ELD A;  2NVT B;  4QL5 A;  4NP5 A;  2AQ1 B;  2L0C A;  1R9T H;  5D65 A;  2Q2H A;  1SEB D;  5A35 A;  4JI8 L;  1HR0 Q;  1VQO A;  1CT1 D;  3SEB A;  4ABN A;  4BXX G;  1YJW A;  5BR8 L;  4HJ9 A;  2VUM B;  5C5M A;  1FNU A;  1TT2 A;  1I50 H;  2UXC L;  3M85 A;  3F2D A;  1LT3 D;  2BOS A;  2X6G A;  1TWH B;  1B9M A;  1VQ4 A;  4JI6 Q;  4IJL A;  3K5M A;  1S5F D;  1RF2 D;  3TP6 A;  1UE5 A;  1VF7 A;  1Z47 A;  5C4X H;  3RZD B;  3DWQ A;  3Q0A A;  1TWC H;  1AE3 A;  1UWV A;  2E2D C;  4LF8 Q;  1D6E C;  2EYM A;  1UEA B;  2K5H A;  3G48 A;  3H94 A;  2NTT A;  4R8N A;  3F2U A;  1YNN C;  2Z4I A;  4I65 A;  1M90 C;  2FJ2 A;  1TVX A;  5BN3 A;  4OO1 G;  2AUK A;  3FKI G;  4JVZ A;  4I7Z C;  1GUO A;  4IUN A;  3VR6 A;  1TS2 A;  3SDZ A;  3NBH B;  3QOL A;  4DU9 A;  1IKM A;  2EE1 A;  1PZK D;  3CF5 A;  3ULL A;  1X32 A;  5JEA G;  3PCO B;  2JK8 A;  3NEM A;  1B2T A;  2TMP A;  3CC7 A;  1ET6 A;  3EIV A;  1STA A;  4JI0 Q;  1KAB A;  3J7A F;  3NSW A;  4JI7 Q;  4A93 B;  1LTI D;  3EFX D;  2RVL A;  4PZ7 A;  3CC4 A;  1WD0 A;  3W1B A;  4OX9 L;  2K1B A;  4OWX B;  1ZXT A;  4AQY Q;  1KNA A;  4ZQ3 A;  1PMR A;  2F0U A;  2NN6 I;  2HQL A;  1U9R A;  2D0O A;  1JT8 A;  1SYE A;  5JVH 3;  3HKZ E;  2F0T A;  5AJ3 L;  2PMZ E;  3FKI B;  1PYW D;  1K9M C;  5H1S E;  1AEX A;  5GRO A;  3DLL A;  5GAE C;  3PIO A;  2IT1 A;  4A3I B;  1QWY A;  4R4O A;  4F88 A;  2PI2 E;  3LWU A;  4R4I A;  4GS3 A;  2L11 A;  3CPF A;  1DZ1 A;  3DUZ A;  2JA7 B;  5CV7 A;  3QJY A;  1LT6 D;  4LF7 L;  3JAM c;  3G71 A;  1JR0 D;  3I2Z A;  4DV0 Q;  1N9W A;  4TKO B;  2I07 B;  2FMC A;  2HDL A;  4ZUJ A;  3I91 A;  2Z6B A;  1BOS A;  1VQC A;  5EKK A;  5C5L A;  3BVG A;  3A8J E;  2WII B;  3D4W A;  1PV4 A;  2YTX A;  4BY7 G;  4X66 Q;  2ZJR A;  4H02 A;  2O4X A;  3VR3 A;  3VR5 A;  3G6J B;  3KBG A;  4A3I H;  2LSS A;  4DR6 Q;  2YYZ A;  2XTI A;  2VUM G;  1RL2 A;  5EPL A;  1Q81 C;  4BY7 B;  4C56 C;  3TP5 A;  4RCO A;  1YVC A;  4JI8 Q;  1EQQ A;  4ZLT F;  4OIK A;  5FK9 C;  5DAU A;  1AP0 A;  2PZU A;  3P7J A;  3C3L A;  4XDX A;  4J6H A;  3RN5 A;  4IOA A;  5EJW A;  1DOM A;  2WP8 J;  2B2V A;  4YY3 L;  3OMC A;  1B44 D;  1I4H A;  1A6X A;  1NBW A;  1EWC A;  2JQO A;  4IFD J;  1Q8I A;  4ID6 A;  2CH4 A;  1Y1V B;  4A93 H;  4JV5 Q;  2N78 A;  4OEM B;  4JK1 C;  1VQH A;  3WDN A;  2QF7 A;  2R7Z G;  1V9P A;  3MVV A;  2V4D A;  3GTK B;  4A3K B;  2KCN A;  2EYL A;  4J8Q A;  1TWG B;  2AMC B;  2G9D A;  4B3R L;  5BN4 A;  4RMF A;  4IUQ A;  2Y0S E;  4KHP L;  1OXT A;  3OOC A;  2K52 A;  1GHK A;  2K03 A;  3PGZ A;  2RSN A;  3HKS A;  1H9J A;  2R6G A;  4JV5 L;  1GKH A;  1AZQ A;  3KDF B;  4LFB L;  1DOK A;  4XT1 B;  4KHV A;  4IAL A;  3SXH A;  2Q8I B;  4B08 A;  1EYG A;  3L3O C;  1N36 L;  4GN5 A;  2LMC B;  1JCK B;  2BA1 A;  5M5X B;  4OO1 I;  5JVG 3;  2NZH A;  5C4X B;  1MSH A;  3CRK C;  3MFY A;  1E24 A;  1S5B D;  1PTO D;  1QVC A;  3GO5 A;  4A3E B;  1HQR D;  2DNE A;  3HOZ G;  2EYO A;  1TWG H;  1HNZ L;  2YV5 A;  4ME5 A;  3QG1 A;  3GP7 A;  1EIY B;  5LMU L;  1BVS A;  5C4Z A;  1PH1 A;  1I50 B;  3MTS A;  5C0X J;  1QZH A;  5JJI A;  1Y1V H;  1PXU A;  2VUM H;  3WWV A;  4QB4 A;  1EY6 A;  1BUV T;  2K5D A;  3BJU A;  2HCC A;  3SGI A;  3DEO A;  4DR2 L;  4RHS A;  5IE8 A;  1EZ6 A;  1L0Y B;  1HHV A;  3H91 A;  1EWI A;  3BYY B;  3M9B A;  5IP9 G;  4JBM A;  2LXJ A;  1HRJ A;  1A3V A;  1CZW A;  2UXB Q;  4GLA C;  1I5F A;  1ICW A;  4ZKC B;  2JA6 G;  4YCV A;  4BY7 H;  1SE8 A;  1HFN A;  4G7H C;  3HKZ B;  4DR7 L;  1VMC A;  4RGT A;  1NUC A;  3AMU A;  3N6R A;  1HNW L;  1RTN A;  3U4V A;  5C0X I;  5IP7 H;  4DK6 C;  5M5Y B;  2VXW A;  4YWK A;  3A56 A;  5D14 A;  4EX5 A;  3CD6 A;  1I4R A;  4A3M H;  1IHZ A;  5T1I A;  1N34 L;  4UHV A;  4CDD C;  4X65 L;  1O7Y A;  2B63 H;  3H3V C;  3K8A A;  1E1T A;  5AJ3 Q;  3RR5 A;  3TZU A;  3RLO A;  1C8C A;  1HXY D;  4AIM A;  2JA7 H;  3P1H A;  2UUB L;  4Y7N H;  1G2S A;  1IBM L;  3S17 H;  2EYH A;  3D0F A;  3HGB A;  4WFN 3;  2F0P A;  2PQA B;  5I9P A;  3U4Z A;  3CP0 A;  2WKD A;  1WTV A;  1BO0 A;  2F3W A;  2IL8 A;  3MZ5 A;  2I5H A;  1PH7 A;  1DD2 A;  3KF6 B;  3PO2 B;  1Q90 A;  3FKI H;  1CI3 M;  1ASZ A;  2E2I B;  1SNC A;  2ZTE A;  1LAC A;  1E1O A;  1IZ6 A;  3K5O A;  1PVO A;  2OQK A;  4OO1 H;  2PYK A;  1TQO A;  4K8I A;  1TKW B;  2D0P A;  3I4L A;  3NK9 A;  3BZD B;  4OHJ A;  5C0X H;  3VA7 A;  2NWG A;  3PIP A;  4R4Q A;  4K2K A;  1WI5 A;  1IYJ B;  1WCM H;  4O1N A;  1GM5 A;  1JOR A;  1SLJ A;  1A8V A;  1EU4 A;  3J81 L;  2DY7 A;  2KEC A;  1KC8 C;  2IHF A;  2R93 H;  4A3B B;  2B8G A;  1STB A;  1WYD A;  1BCP F;  3BS1 A;  4JI6 L;  1AN8 A;  1F9Q A;  2HDM A;  5C4J B;  4XQJ A;  5JOB A;  1YIJ A;  5EAY A;  4GNX C;  4GLX A;  4CHT B;  1YHB A;  4KJO A;  1I4G A;  2SDF A;  3I4M B;  2ICI A;  3RZO B;  3PUZ A;  5G3L F;  1VQ6 A;  3F2C A;  3SK6 A;  4A75 A;  2DN8 A;  1JC7 A;  1EWH A;  1GJX A;  4DGZ A;  3FDT A;  3KBX A;  1VQL A;  1C7Y A;  3K7A B;  3I4N B;  4IPG A;  1H9S B;  4XTC S;  5K5P A;  1LTS D;  5GQO A;  4C3I B;  3H0G G;  3H6M A;  4JI1 Q;  4DV2 Q;  1XMO Q;  1FNW A;  3GTG B;  1GD7 A;  2MO0 A;  4K6D A;  2JXM B;  1UAP A;  4B9X A;  1PFS A;  3PUY A;  4YWL A;  1QZG A;  3EVQ A;  2HQE A;  4X62 Q;  1JWS D;  5FLX L;  2JEA I;  4JOI A;  4FXD A;  2I5L X;  2WIN B;  2Q8T A;  4JI2 L;  4JI7 L;  2RHQ B;  4KY7 A;  3I55 A;  1G91 A;  3GTJ B;  2K5W A;  5KNC A;  4LFB Q;  1LTB D;  3OIQ A;  1IBK L;  2C9O A;  1R9T B;  4BBS G;  4FF3 A;  5E4W C;  2NVT H;  3HOW G;  2D9U A;  1ENA A;  2PO4 A;  1CFM A;  3OIP A;  2D2C C;  3M7G A;  2KCM A;  2E74 C;  1V1O A;  3S1N H;  1STY A;  3ERS X;  1HJP A;  1KAA A;  1I4P A;  2SNM A;  4OIJ A;  5JEA J;  2DUD A;  5LMU Q;  2NVQ B;  5CBA E;  1DM0 B;  5CGK A;  5IGG A;  2FIN B;  3NBH A;  4B3S Q;  4C1N K;  5IT9 E;  1IBK Q;  3AYH B;  3A74 A;  2A6E D;  3TSS A;  4DUZ Q;  3OYY A;  3BZC A;  4X65 Q;  1LTR D;  1BBU A;  3GTO B;  1MSG A;  1U4L A;  1E2Z A;  1JWU D;  4C3J B;  2BA0 A;  3S1R H;  2F0G A;  4LF7 Q;  1WTH A;  1MGS A;  3GTL B;  3Q6S A;  1WCM G;  2ZTC A;  3CW2 C;  1LM0 A;  4XIG S;  2YTV A;  4A3D H;  4MHE A;  1KNE A;  1KDB A;  4CDF C;  1PZI D;  1VF5 C;  3S1Q B;  4K5X A;  1TWA B;  4HIO A;  4K5V A;  4JW0 A;  3CQZ H;  2WB1 B;  3ULP A;  4KMU C;  4HSP A;  4RGM A;  3RMH A;  4CDC C;  1KL9 A;  1IXR A;  1Q7Y C;  1HFG A;  3M4P A;  3Q8D A;  4HJA A;  2K5N A;  1O7L A;  2UU9 L;  3T53 B;  3TQY A;  1TWA H;  1EIF A;  2ZTD A;  3E5S A;  3KYH C;  1PH4 A;  4GKJ Q;  5ELO A;  1NR2 A;  3FVQ A;  4GOP C;  1HZ9 A;  4V0B A;  3OTO L;  2XRS D;  3RN2 A;  1EQV A;  1AZP A;  2I5M X;  3UDX A;  4CDE C;  2CKZ B;  2F0D A;  2QCP X;  1VQ9 A;  5HY6 A;  4JI4 L;  4I7A A;  3K0X A;  1LYL A;  5C3E H;  4DV7 Q;  2UUC L;  3FHW A;  3I4O A;  3D6C A;  3E6Z X;  4L5Q A;  2YU9 H;  3ND9 A;  4M1U B;  2CFM A;  3L0O A;  4KKT A;  1EIG A;  1Y1W G;  3ERQ A;  2BDN A;  1A15 A;  2CH4 W;  1IBL L;  2MUY A;  3S1N B;  2QEX A;  4C1N I;  2I46 A;  5K36 G;  1N32 Q;  2DY8 A;  1XXG A;  2JSO A;  4IZ8 A;  3V2T A;  5A2Q L;  1R4P B;  3A5Z B;  3OHX C;  1PRT F;  4BBS B;  4HCE A;  2JA5 B;  1DON A;  1B3Q A;  2EIF A;  2KJX A;  1JMC A;  5C44 B;  1PA6 A;  4HAE A;  2MFI A;  3R2I A;  1BBX C;  4DR3 Q;  4JI2 Q;  4A3J B;  5C6A A;  2B2Y A;  2MJ8 A;  1L2F A;  1X65 A;  4GOP B;  3HOX B;  2F4V Q;  3MXN A;  1NJI C;  1CTM A;  5IP9 H;  5BR8 Q;  3GTM H;  1EYC A;  4FVM A;  1A63 A;  2F0O A;  3GTG H;  3R93 A;  2NVY B;  4R4T A;  3KOJ A;  4MTK A;  3HOV H;  4RAU C;  5FLM H;  1PLF A;  5EKI A;  4DR1 Q;  3S16 B;  2VQE Q;  3KF6 A;  5GAD C;  4DV1 Q;  3T1Y L;  1MJE A;  1EY9 A;  4DR3 L;  3I4N H;  3D31 A;  5DM7 3;  3I3C A;  3I72 A;  5M3F H;  5HUR A;  1X3Q A;  1G8Z D;  2K5Q A;  1N36 Q;  1XWE A;  1VQA A;  1Q86 C;  1B7Y B;  1E7Z A;  2K33 A;  2NB0 A;  2EJF C;  3RZO H;  1SAP A;  4X62 L;  4PQX A;  4BBR B;  1D7Q A;  2XWB B;  3HFZ B;  1JOQ A;  3TRZ A;  4BY1 B;  2MP1 A;  3J7A V;  2G9H D;  1WVL A;  5C4J H;  4K14 A;  1A2T A;  4QUC A;  2OCE A;  4K5W A;  1XTC D;  2EOT A;  1X6O A;  2NN6 G;  2R93 B;  5I2X A;  5LL6 X;  2CWA A;  3DEP A;  3HKZ G;  5JJZ A;  3PIP 3;  3G6E A;  1AE2 A;  1IYU A;  4ALP A;  2EDG A;  1WCM B;  2K6A A;  2XN9 C;  4DR2 Q;  2R93 G;  1PTO B;  1K8M A;  4K6L A;  5IGF A;  1H95 A;  3VYS A;  3V05 A;  5TSS A;  3J81 j;  5FO9 B;  1L0W A;  2EJG C;  4R9W A;  1EU3 A;  4EGV A;  1BCP D;  2E2I H;  1H9S A;  2QW7 A;  1EZ8 A;  2F0E A;  2DGY A;  1VS0 A;  1B53 A;  2OWO A;  1BQQ T;  4AYB G;  1GOZ A;  2P5Z X;  1FR3 A;  4FO2 A;  1XMQ Q;  1LLR D;  1I94 L;  2JYO A;  1FVI A;  2F52 A;  4KHZ A;  3O13 A;  3FEW X;  2RQX A;  2R7Z H;  4RKL A;  4HID A;  1CHQ D;  4JOI C;  5ELC A;  1ZKO A;  2F0S A;  3IFT A;  3NTI A;  5C44 G;  3CCR A;  5M3F G;  2XWJ B;  3NEN A;  3BU2 A;  5EGT A;  5M5Y H;  4OWW B;  2JA5 G;  2GVB A;  1P16 A;  1QVF A;  2OEO A;  1E3P A;  4ZCK A;  4L63 B;  4K0K Q;  4DAP A;  3KLS A;  5ELN A;  3JAM L;  2IJ0 A;  2JA8 H;  1MI2 A;  2M9V A;  1F9S A;  1KDC A;  4Z9C B;  2Z9H A;  5KND A;  4QIW E;  4QUF A;  3VA5 A;  1CZG A;  3V96 A;  2K01 A;  4MIU A;  2SEB D;  2PQE A;  2XGT A;  1VDZ A;  3LNN A;  3D6W A;  1X9N A;  4GZY C;  1VQE A;  2V1C C;  1R4Q B;  1HUN A;  4BA2 I;  3GTP B;  5CV9 A;  1PFB A;  1YHA A;  1AFP A;  1CKO A;  1YNJ D;  1SMY D;  4HED A;  3OW7 A;  1SMY C;  1Y8N B;  4LF9 Q;  2L5T A;  1YZ6 A;  4BY1 G;  1QE6 A;  3D4D A;  2VQE L;  2FXQ A;  4J15 A;  3A0J A;  2VS1 A;  1YHQ A;  2WAC A;  1PH3 A;  3MXG A;  4HJ5 A;  4Q0F A;  1ZYR D;  3DM1 A;  3CCV A;  3RNU A;  4LNQ A;  3I4M G;  3KLW A;  4HMJ A;  2UXC Q;  2J0T D;  1W6K A;  2BDO A;  4NKL A;  1TXY A;  5IGC A;  3J80 c;  1HQM C;  1X3G A;  1HTP A;  3FP9 A;  2EXZ A;  2N49 A;  5IY0 A;  2NUC A;  1QJO A;  5E4X A;  1K8G A;  1IKL A;  5HGT A;  3PUX A;  4P75 A;  2PW5 A;  4C2M H;  4KY5 A;  2PNR C;  1D1K A;  1TY2 A;  3MFG A;  2OTL A;  2AWN A;  3S9W A;  4QJF A;  4LFA L;  5IGE A;  4LAA A;  3VR4 A;  1DOL A;  2JEB I;  3QB3 A;  4RFB A;  2A6H D;  2N3S A;  3DXJ C;  5JPN C;  3K59 A;  2JA8 G;  1NCV A;  2LKV A;  2Z1C A;  2R92 B;  3EN2 A;  1U5K A;  3MHB A;  3PO3 G;  5COY A;  1XNQ Q;  5C0X G;  2VB2 X;  2VB3 X;  4IUU A;  3HOU G;  1S4Z A;  4LFA Q;  2QGQ A;  3KF8 B;  1JOK A;  1SE3 A;  4KN7 C;  2ZXR A;  2R7D A;  1ICF B;  2LY7 A;  1I3Q B;  1Z9F A;  3UE1 A;  3JC6 6;  4JI0 L;  1EFI D;  1SNP A;  4F8M A;  3OWF A;  3D3R A;  3JAM E;  1XMQ L;  1MHW C;  3DM3 A;  1OO9 B;  2NYZ D;  2R92 H;  4B3S L;  2VQF Q;  4CJ0 B;  5GAH C;  1SRU A;  1KRT A;  3I70 A;  4CJ2 C;  1TU2 B;  3ZJY C;  4L5S A;  2PI2 A;  2EXD A;  3VYU A;  3BYT B;  4TVA B;  4BXX H;  1PRT D;  4X3U A;  1J5E L;  5AFW A;  2EYF A;  4L8J A;  1QNU A;  4XQQ A;  2A68 D;  4ZRZ A;  4MN3 A;  4KK7 A;  5IGB A;  4FNF A;  4KKS A;  5ELB A;  1KHI A;  1JE5 A;  3P75 A;  3TEH B;  2PW7 A;  2HT1 A;  1XPR A;  4LF5 Q;  4HN7 A;  2E2H H;  3CME A;  1GUN A;  3H3V I;  1QVG A;  1NTG A;  2ENB A;  3ND8 A;  4U67 3;  1PYS B;  1GXD C;  2A69 C;  3FMC A;  1WD1 A;  3PMF A;  1QNK A;  4LW1 A;  1ZYR C;  5KIX A;  1EIH A;  4K8J A;  3JAM i;  4GLV B;  1V1P A;  1T5X D;  3S14 H;  4KKU A;  2XRQ D;  3HOW H;  2E75 C;  4C3J G;  4K2L A;  4IOC A;  4IFD H;  1EY5 A;  3A8I E;  4JBK A;  3J80 L;  5IYB G;  2KA7 A;  3D4R A;  1L1O A;  3T51 B;  3KDF A;  3KUP A;  3MEH A;  5E3F A;  3M7N A;  1HA6 A;  2OF1 A;  1DXM A;  4MNO A;  3MC0 B;  4P71 A;  4CKB A;  3K6O A;  1LO5 D;  5JJL A;  3C1E A;  4M8A A;  2KHS A;  4KLK A;  3B6Y A;  4G7O C;  2F0K A;  1DYQ A;  3VYR A;  4P72 A;  1Y1V G;  1K8A C;  2JA8 B;  3T1H L;  1S3O A;  1LTL A;  1SFO B;  1ET9 A;  1P8L A;  2B2V C;  5FOB B;  2UUA L;  4LUO A;  3T16 A;  3NQT A;  5JPM C;  3PUW A;  1IYV A;  2PMZ B;  4G57 A;  4R1J A;  3PO3 H;  1XNR L;  1PHJ A;  1BF4 A;  1CHP D;  2RCN A;  1VQP A;  2EY2 A;  5T1G A;  2BH8 A;  3M3Y H;  1SYC A;  5D3I B;  4A3L G;  5CR3 A;  3K5N A;  2CVR A;  1RJT A;  2AKW B;  1BXT A;  1WFQ A;  1PDQ A;  3MXU A;  4NXN Q;  1IW7 C;  2CHB D;  3UI2 A;  1XNQ L;  1G6Z A;  1G29 1;  4N9T A;  1II3 A;  1BR9 A;  3H0G B;  1EEI D;  1SMX A;  1D5M C;  1E2V A;  2ICE C; 
#chains in the Genus database with same CATH homology
 1ZEQ X;  3URY A;  1JWM D;  1HCZ A;  2NZ1 D;  2IWH A;  1SJH D;  1TY0 A;  5CMD A;  5LHY 1;  1SNM A;  2B2T A;  3DWA A;  5EBC A;  1EY0 A;  3K57 A;  3TME A;  3N52 A;  3NUC A;  3S15 B;  5KGU A;  2IX1 A;  2WV6 D;  4RA8 A;  3A55 A;  4IFD I;  3QOJ A;  1U4P A;  5E1F A;  1C4Q A;  3R3O A;  1LT5 D;  2A6E C;  2HCI A;  4EVO A;  3BVM A;  5DEH A;  3FRP B;  2RDG A;  4BA1 I;  1PRT C;  4DA2 A;  3Q23 A;  1GHJ A;  2B2Y C;  1O78 A;  1I4X A;  2CW0 D;  1TII D;  1W6J A;  3WOE A;  3NPP A;  1ENC A;  2F03 A;  2FMM A;  2J4X A;  3HOV B;  3TP8 A;  4C3H B;  1F2Z A;  1I6H B;  3KLR A;  2XIW A;  1UUP A;  3W2D A;  1FNV A;  1C48 A;  1ESF A;  1HPC A;  1QB5 D;  4NMZ A;  2C5C A;  2R3Z A;  4QIW B;  4UAI A;  1ENF A;  3R2T A;  2F1M A;  1OXS C;  2MPM A;  3T56 B;  1RCV D;  3GD7 A;  2B2W C;  4XT3 B;  3H09 A;  3AB9 A;  2JA6 B;  2B8F A;  4KD4 A;  4OL7 A;  1D1I A;  3Q22 A;  1PFN A;  3E0J A;  2PZT A;  2D5D A;  2YU9 B;  1FYC A;  2O2L D;  3DMU A;  3MWY W;  3MAQ A;  4H0L C;  1A2U A;  1UNS A;  3GTQ B;  4BWG B;  3S2H B;  3HZX A;  1PTO F;  3GQB A;  2RBM A;  3BDO A;  1RD9 D;  2FHT A;  1EYA A;  1KTK A;  5KEE A;  4E6I A;  4N9P A;  1HA5 A;  5I2Y A;  3SK5 A;  4DN4 M;  1OXU A;  2EPB A;  2EYP A;  4XQN A;  1PZJ D;  4HCS A;  2KOL A;  5KYL A;  4A3G B;  3ONA B;  4KV6 A;  2L1B A;  4HR7 B;  2NVX B;  4KY6 A;  3QIA A;  2IX0 A;  2XSC A;  3BDL A;  3TP7 A;  3BDC A;  1HTL D;  2ZXO A;  5FLX E;  4IUR A;  2B2U C;  2F0F A;  1GUT A;  4KD3 A;  1O80 A;  1RKN A;  3W3A A;  1X3P A;  1ILQ A;  1EOT A;  4HMI A;  2IW3 A;  4R8I A;  1VMP A;  3DHQ A;  4IFD G;  4A3F B;  3IKJ A;  1QG7 A;  1FGB D;  4FXK C;  5K36 H;  4DAV A;  1MD2 D;  3OWE B;  1Q1E A;  2F0M A;  2L55 A;  4EQP A;  1BDO A;  1SXT A;  2F0W A;  1JB3 A;  1B1Z A;  1STE A;  1XYI A;  1Y69 U;  3HOY B;  1BCP C;  5EKL A;  4CKE A;  2ZXP A;  2X6L A;  3BG3 A;  3NHH A;  3M4O B;  5LL6 S;  1ROD A;  1BCP B;  1RTO A;  3M3Y B;  2SNS A;  3U9S A;  5ISR A;  4EQN A;  4G7Z C;  4WJW A;  2JE6 I;  3ERO A;  1SYF A;  3GV6 A;  4DK0 A;  3T4A C;  2A73 B;  3M4Y A;  4ILW A;  3D8G A;  2SOB A;  2GA4 B;  1T5E A;  4WOR A;  1SNO A;  2M2L A;  1FD7 D;  4P2C B;  1NSN S;  5J39 A;  3T13 A;  2IX3 A;  5FO8 B;  4FXG C;  2H4O A;  4RHR A;  3FPU B;  1LTT D;  3KK7 A;  5IGD A;  1I6V C;  2E2J B;  3P20 A;  4AYB B;  3SHL A;  4CJ1 B;  2Y0S B;  2MHV A;  3HOW B;  1NAP A;  2A69 D;  1RDP D;  3X3M A;  4F87 A;  1LTA D;  3MA2 B;  4RCN A;  3IAY A;  3TBI B;  2F3V A;  4NDX A;  1QIL A;  4IN3 A;  4LJZ C;  4IUV A;  3S2D B;  1HUM A;  4TQU S;  5BN5 A;  3HS0 C;  5DM6 3;  1M8A A;  3HRZ C;  1L0X B;  4X3K A;  3BVZ A;  4IUT A;  2KQ3 A;  4PMW A;  4UDU C;  4DF7 A;  5C4H A;  1MBY A;  4XXE A;  2MGS A;  2N88 A;  4IUP A;  2B2T C;  3FPP A;  3TN2 A;  2F0L A;  3G7L A;  1U4M A;  2E76 C;  5IIF A;  3WOF A;  2QEJ C;  4RH6 A;  3RLF A;  2LFN A;  1LT4 D;  3A8K E;  1B9N A;  2CQA A;  2EYJ A;  1TS5 A;  4X3T A;  2Z4H A;  3ITP A;  1G2T A;  4KN4 C;  1AW7 A;  1ONL A;  5M3M B;  4ULL A;  5EQ0 A;  4RKB A;  2Q8R E;  2O5I C;  3KF8 A;  1LTG D;  5KRU A;  4F7X A;  4KI0 A;  3TDQ A;  2F0J A;  2XNA C;  5I9O A;  4C2M B;  2AWO A;  2VNU D;  1WTO A;  4FYD A;  4EQO A;  2LS0 1;  5M9O A;  1OXX K;  5EBD A;  4TSS A;  1D5X C;  3PO3 B;  4OGQ C;  2IPK D;  3J80 E;  3L9A X;  4FF2 A;  4DXG A;  2DNC A;  3CRL C;  4ZKB B;  2F0H A;  3RD4 A;  2ZT9 C;  1CM9 A;  4XYQ A;  4J1M A;  2B2U A;  1GUW A;  1SND A;  2PZW A;  1M4V A;  4CKC A;  5IT9 L;  2CW0 C;  3CKI B;  3QO2 A;  1F77 A;  1S5E D;  4NW2 A;  1PFM A;  3S14 B;  2OXP A;  1D2B A;  2N55 A;  3A7A B;  5FKA C;  3NP8 A;  1EL0 A;  1H9R A;  1DJR D;  1Z7T A;  3K58 A;  1VCI A;  4JBW A;  5J22 A;  4G4K A;  2E2H B;  2L4N A;  1TWF B;  5KYI A;  3GV3 A;  3CU7 A;  3NWS A;  3OPO A;  3VYT A;  5JEA H;  4O42 A;  1EY4 A;  5CV5 A;  3Q24 A;  1Q1B A;  1Z6H A;  5IOC A;  4WRD A;  2K04 A;  1U4R A;  1EY8 A;  1KDA A;  2K7V A;  2KUM A;  2RKS A;  4L6T B;  1A3T A;  4ODG A;  1B4O A;  3OSO A;  5I6Y A;  1BNZ A;  3TZD A;  3NXW A;  1F2M A;  3NWT A;  1QCB D;  2XVS A;  3CHB D;  2B39 A;  3VR2 A;  1Y8P B;  4DAY A;  3DWP A;  3PV0 A;  2RSO A;  4QCL A;  3HG9 A;  1Y1W B;  2B2W A;  1PTO H;  5A2Q E;  3NTH A;  1WTX A;  4U68 A;  1KLU D;  1DCZ A;  2HUG A;  4YIJ A;  5CV6 A;  2EY6 A;  4DNR B;  1STG A;  3EQL C;  5IOD A;  4RGO S;  2K28 A;  5C3X A;  2A68 C;  1WTR A;  3J81 E;  1OXV A;  4V19 0;  1LAB A;  3PIO 3;  1WTW A;  1TWC B;  2NBF A;  5I4D A;  2F0N A;  3SR1 A;  1SBB B;  2BE5 D;  3AU7 A;  2K05 A;  3GTM B;  5J1Z A;  2EVB A;  1STN A;  1PTO C;  4LMQ D;  2L12 A;  4H13 C;  1TR5 A;  2AQ2 B;  1EQT A;  2X69 A;  3IFD A;  1SDF A;  4FF4 A;  4ZYS A;  1YNJ C;  1STH A;  2K32 A;  4Q5V A;  3A54 A;  3EJI A;  3I73 A;  4LK1 C;  5DNF A;  1GUS A;  5EPK A;  3EA6 A;  1YNN D;  1NR4 A;  2OT2 A;  3ZYY X;  5ELE A;  1F9P A;  2L9H A;  1EEF D;  3OMG A;  2QKI C;  2F0I A;  5C3E B;  1SSO A;  3SK4 A;  1WTQ A;  1B50 A;  4XYO A;  1Q3L A;  5EPJ A;  3LX0 A;  1B3A A;  3MXP A;  2R7Z B;  1J8I A;  1LV9 A;  1SNQ A;  2F4I A;  2WAQ B;  4ZK9 B;  1XX8 A;  3QWN A;  4CGY B;  4KJN A;  5F2D A;  2TSS A;  1SJE D;  3HEJ A;  3NQI A;  1IW7 D;  5M5W B;  5NUC A;  4C3I G;  2PCF B;  1IL8 A;  2AQ3 B;  2JP1 A;  2QDB A;  3LWE A;  4FP5 D;  2AUJ D;  1K83 B;  1JIC A;  3C2P A;  2A6H C;  1EY7 A;  1F2Y A;  2R61 A;  1SE2 A;  4DK1 A;  5KNB A;  3S1R B;  2EZV A;  2A74 C;  2BE5 C;  1SYG A;  1QOH A;  2EY1 A;  1I4Q A;  4HSV A;  5JAV A;  1SYB A;  1EYD A;  1H9K A;  1CK1 A;  5M3F B;  5FO7 B;  5CV4 A;  3X3N A;  1V43 A;  3K5L A;  4HTH A;  2F0Q A;  2RA4 A;  4ZAI A;  1TS3 A;  2J7Z A;  2M00 A;  2WKC A;  1K8O A;  2H1E A;  1A3U A;  4KTA A;  2EY5 A;  4C3H G;  1ILP A;  2EJM A;  1CQF A;  1D5Z C;  2D62 A;  5COR A;  3J7Y W;  2ID0 A;  1GUG A;  1JQY D;  4RGN A;  1WTP A;  2O5J C;  5I6W A;  1Q12 A;  4TRD A;  3L7Z C;  3NTK A;  3U9O A;  1S5D D;  5G3L D;  2PPB C;  4FF1 A;  2FFK B;  2RDF A;  3RUZ A;  1O7Z A;  2KEE A;  1RHP A;  4DFA A;  1CA5 A;  4PMC A;  4BS9 A;  5CC4 A;  3KLS X;  3C1F A;  1CA6 A;  3IL8 A;  5CBE E;  2KCC A;  3NE5 B;  3PUV A;  2QIL A;  3S1M B;  1CQV A;  4CBV A;  2A5H A;  4IQZ A;  4H44 C;  3HOZ B;  3HP3 A;  3SVM A;  3K0Y A;  3I90 A;  4DNT B;  2KED A;  3HOU B;  1V1P B;  1ML0 D;  4ZUI A;  3CQZ B;  4QF4 A;  1J9O A;  4PNY A;  4PMB A;  5ELF A;  1S5C D;  3S17 B;  5CYU A;  1H9M A;  4Y7N B;  5C3W A;  1Y8O B;  2F0V A;  4DXF A;  3I8Z A;  4A3D B;  3SK8 A;  1E0B A;  3A7L A;  1V8Q A;  2NTS A;  4QMG A;  2B63 B;  1JE4 A;  4B9W A;  1F2L A;  4PV1 C;  1ESR A;  1KLG D;  4H7B A;  3R8B A;  1SYD A;  4A3M B;  2Z8L A;  1F9R A;  3SE0 A;  3NBI A;  1TS4 A;  5CV8 A;  3C46 A;  2RDH A;  1JOO A;  2NN6 H;  4RWS C;  4X3S A;  4S3S A;  5D3D A;  1PRT B;  2KVM A;  2BCO A;  1SE4 A;  1E2W A;  2NVT B;  5ELD A;  4NP5 A;  2AQ1 B;  2L0C A;  5D65 A;  1SEB D;  5A35 A;  1CT1 D;  3SEB A;  4ABN A;  2VUM B;  5C5M A;  1FNU A;  1TT2 A;  3M85 A;  1LT3 D;  2BOS A;  2X6G A;  1TWH B;  1B9M A;  3K5M A;  1S5F D;  1RF2 D;  3TP6 A;  1VF7 A;  1Z47 A;  3RZD B;  3DWQ A;  3Q0A A;  2E2D C;  1D6E C;  2EYM A;  1UEA B;  3H94 A;  2NTT A;  4R8N A;  3F2U A;  1YNN C;  2Z4I A;  4I65 A;  2FJ2 A;  1TVX A;  5BN3 A;  4OO1 G;  2AUK A;  4I7Z C;  1GUO A;  4IUN A;  3VR6 A;  1TS2 A;  3SDZ A;  3QOL A;  4DU9 A;  1IKM A;  2EE1 A;  1PZK D;  1X32 A;  5JEA G;  1B2T A;  2TMP A;  1ET6 A;  1STA A;  1KAB A;  3J7A F;  3NSW A;  4A93 B;  1LTI D;  3EFX D;  2RVL A;  1WD0 A;  2K1B A;  1ZXT A;  1KNA A;  4ZQ3 A;  1PMR A;  2F0U A;  2NN6 I;  1U9R A;  1SYE A;  5JVH 3;  2F0T A;  3FKI B;  1PYW D;  1AEX A;  2IT1 A;  4A3I B;  1QWY A;  4F88 A;  3LWU A;  2L11 A;  1DZ1 A;  3DUZ A;  2JA7 B;  5CV7 A;  3QJY A;  1LT6 D;  1JR0 D;  4TKO B;  2I07 B;  2FMC A;  2HDL A;  4ZUJ A;  3I91 A;  1BOS A;  5EKK A;  5C5L A;  3BVG A;  3A8J E;  2WII B;  3D4W A;  2O4X A;  3VR3 A;  3VR5 A;  3G6J B;  3KBG A;  2YYZ A;  5EPL A;  4BY7 B;  4C56 C;  3TP5 A;  4RCO A;  4ZLT F;  4OIK A;  5FK9 C;  5DAU A;  1AP0 A;  2PZU A;  3P7J A;  3C3L A;  4XDX A;  4J6H A;  5EJW A;  1DOM A;  2WP8 J;  2B2V A;  3OMC A;  1B44 D;  1I4H A;  1A6X A;  1EWC A;  4IFD J;  1Q8I A;  4ID6 A;  1Y1V B;  4JK1 C;  3WDN A;  2QF7 A;  3MVV A;  2V4D A;  3GTK B;  4A3K B;  2KCN A;  2EYL A;  4J8Q A;  1TWG B;  2G9D A;  5BN4 A;  4IUQ A;  1OXT A;  3OOC A;  1GHK A;  2K03 A;  2RSN A;  1H9J A;  2R6G A;  1AZQ A;  1DOK A;  4XT1 B;  4KHV A;  4IAL A;  3SXH A;  2Q8I B;  4B08 A;  3L3O C;  2LMC B;  1JCK B;  2BA1 A;  5M5X B;  4OO1 I;  5JVG 3;  5C4X B;  1MSH A;  3CRK C;  3MFY A;  1S5B D;  1PTO D;  4A3E B;  3GO5 A;  1HQR D;  2DNE A;  2EYO A;  4ME5 A;  3QG1 A;  3GP7 A;  5C4Z A;  1I50 B;  3MTS A;  5C0X J;  1PXU A;  4QB4 A;  1EY6 A;  1BUV T;  2K5D A;  2HCC A;  3DEO A;  4RHS A;  1EZ6 A;  1L0Y B;  1HHV A;  3H91 A;  3BYY B;  1HRJ A;  1A3V A;  1CZW A;  1ICW A;  4ZKC B;  1HFN A;  4G7H C;  3HKZ B;  1VMC A;  4RGT A;  1NUC A;  3AMU A;  3N6R A;  1RTN A;  5C0X I;  5M5Y B;  2VXW A;  3A56 A;  5D14 A;  1I4R A;  1IHZ A;  5T1I A;  1O7Y A;  3H3V C;  3TZU A;  1C8C A;  1HXY D;  3P1H A;  1G2S A;  2EYH A;  3HGB A;  4WFN 3;  2F0P A;  5I9P A;  2WKD A;  1WTV A;  1BO0 A;  2F3W A;  2IL8 A;  3MZ5 A;  1DD2 A;  3PO2 B;  1Q90 A;  1CI3 M;  2E2I B;  1SNC A;  1LAC A;  3K5O A;  4OO1 H;  2PYK A;  1TQO A;  4K8I A;  1TKW B;  3I4L A;  3NK9 A;  3BZD B;  4OHJ A;  5C0X H;  3VA7 A;  2NWG A;  4K2K A;  4O1N A;  1JOR A;  1EU4 A;  3J81 L;  2DY7 A;  2KEC A;  4A3B B;  2B8G A;  1STB A;  1BCP F;  3BS1 A;  1AN8 A;  1F9Q A;  2HDM A;  5C4J B;  4XQJ A;  5JOB A;  4CHT B;  4KJO A;  1I4G A;  3I4M B;  2SDF A;  2ICI A;  3RZO B;  3PUZ A;  5G3L F;  3SK6 A;  2DN8 A;  1JC7 A;  1EWH A;  1GJX A;  4DGZ A;  3FDT A;  3KBX A;  3K7A B;  3I4N B;  1H9S B;  4XTC S;  5K5P A;  1LTS D;  4C3I B;  3H6M A;  1FNW A;  3GTG B;  4K6D A;  2JXM B;  1UAP A;  4B9X A;  3PUY A;  3EVQ A;  2HQE A;  1JWS D;  5FLX L;  2JEA I;  4FXD A;  2WIN B;  2Q8T A;  4KY7 A;  1G91 A;  3GTJ B;  2K5W A;  5KNC A;  1LTB D;  3OIQ A;  2C9O A;  1R9T B;  4FF3 A;  5E4W C;  2D9U A;  1ENA A;  2PO4 A;  1CFM A;  3OIP A;  2D2C C;  3M7G A;  2E74 C;  1V1O A;  1STY A;  1KAA A;  1I4P A;  2SNM A;  4OIJ A;  5JEA J;  2NVQ B;  5CBA E;  5IGG A;  1DM0 B;  5CGK A;  2FIN B;  3NBH A;  4C1N K;  5IT9 E;  2A6E D;  3TSS A;  1LTR D;  3GTO B;  1MSG A;  1U4L A;  1E2Z A;  1JWU D;  4C3J B;  2BA0 A;  2F0G A;  1MGS A;  3GTL B;  3Q6S A;  4XIG S;  4MHE A;  1KNE A;  1KDB A;  1PZI D;  1VF5 C;  3S1Q B;  4K5X A;  1TWA B;  4K5V A;  2WB1 B;  4KMU C;  4HSP A;  4RGM A;  3RMH A;  1HFG A;  1O7L A;  3T53 B;  3E5S A;  1NR2 A;  3FVQ A;  4V0B A;  2XRS D;  1AZP A;  1EQV A;  2F0D A;  2QCP X;  3D6C A;  3E6Z X;  3ND9 A;  4M1U B;  4KKT A;  1EIG A;  3ERQ A;  2BDN A;  1A15 A;  2MUY A;  3S1N B;  4C1N I;  2I46 A;  5K36 G;  2DY8 A;  1XXG A;  2JSO A;  4IZ8 A;  5A2Q L;  3V2T A;  1R4P B;  3OHX C;  1PRT F;  4BBS B;  4HCE A;  2JA5 B;  1DON A;  2KJX A;  5C44 B;  4HAE A;  1BBX C;  3R2I A;  4A3J B;  5C6A A;  2B2Y A;  2MJ8 A;  3HOX B;  3MXN A;  1CTM A;  1EYC A;  4FVM A;  2F0O A;  3R93 A;  2NVY B;  4RAU C;  1PLF A;  5EKI A;  3S16 B;  1EY9 A;  3D31 A;  5DM7 3;  3I3C A;  3I72 A;  5HUR A;  1X3Q A;  1G8Z D;  2K5Q A;  1XWE A;  2K33 A;  2NB0 A;  2EJF C;  1SAP A;  4PQX A;  4BBR B;  2XWB B;  1JOQ A;  4BY1 B;  2MP1 A;  3J7A V;  2G9H D;  1WVL A;  4K14 A;  1A2T A;  4QUC A;  4K5W A;  1XTC D;  2EOT A;  2NN6 G;  2R93 B;  5I2X A;  5LL6 X;  3DEP A;  5JJZ A;  3PIP 3;  1IYU A;  2EDG A;  1WCM B;  2K6A A;  2XN9 C;  1PTO B;  1K8M A;  4K6L A;  5IGF A;  3VYS A;  3V05 A;  5TSS A;  5FO9 B;  2EJG C;  4R9W A;  1EU3 A;  4EGV A;  1BCP D;  1H9S A;  1EZ8 A;  2F0E A;  1B53 A;  1BQQ T;  1GOZ A;  1FR3 A;  4FO2 A;  1LLR D;  2JYO A;  4KHZ A;  3O13 A;  3FEW X;  2RQX A;  4RKL A;  1CHQ D;  5ELC A;  1ZKO A;  2F0S A;  3IFT A;  3NTI A;  2XWJ B;  5EGT A;  2OEO A;  4L63 B;  4DAP A;  3KLS A;  3JAM L;  2IJ0 A;  1MI2 A;  2M9V A;  1F9S A;  1KDC A;  4Z9C B;  5KND A;  4QUF A;  3VA5 A;  1CZG A;  3V96 A;  2K01 A;  4MIU A;  2SEB D;  2PQE A;  1VDZ A;  3LNN A;  3D6W A;  4GZY C;  1R4Q B;  1HUN A;  4BA2 I;  3GTP B;  5CV9 A;  1PFB A;  1AFP A;  1YNJ D;  1SMY D;  4HED A;  3OW7 A;  1SMY C;  1Y8N B;  2L5T A;  1QE6 A;  3D4D A;  2WAC A;  3MXG A;  4Q0F A;  1ZYR D;  3DM1 A;  4HMJ A;  2J0T D;  1W6K A;  2BDO A;  4NKL A;  5IGC A;  1HQM C;  1HTP A;  2EXZ A;  2NUC A;  1QJO A;  5E4X A;  1IKL A;  5HGT A;  3PUX A;  2PW5 A;  2PNR C;  1D1K A;  1TY2 A;  3MFG A;  4KY5 A;  2AWN A;  3S9W A;  5IGE A;  4LAA A;  3VR4 A;  1DOL A;  2JEB I;  3QB3 A;  4RFB A;  2A6H D;  3DXJ C;  5JPN C;  3K59 A;  1NCV A;  2LKV A;  2Z1C A;  2R92 B;  3MHB A;  5COY A;  5C0X G;  2VB2 X;  2VB3 X;  4IUU A;  1S4Z A;  1JOK A;  1SE3 A;  4KN7 C;  2ZXR A;  2LY7 A;  1I3Q B;  1EFI D;  1SNP A;  4F8M A;  3OWF A;  3D3R A;  3JAM E;  1OO9 B;  2NYZ D;  4CJ0 B;  3I70 A;  4CJ2 C;  1TU2 B;  3VYU A;  3BYT B;  1PRT D;  4X3U A;  5AFW A;  2EYF A;  4L8J A;  1QNU A;  4XQQ A;  2A68 D;  4ZRZ A;  4MN3 A;  4KK7 A;  5IGB A;  4FNF A;  4KKS A;  5ELB A;  3P75 A;  2PW7 A;  4HN7 A;  1GUN A;  2ENB A;  3ND8 A;  4U67 3;  1GXD C;  2A69 C;  3FMC A;  1WD1 A;  3PMF A;  1QNK A;  1ZYR C;  5KIX A;  1EIH A;  4K8J A;  1V1P A;  1T5X D;  4KKU A;  2XRQ D;  2E75 C;  4C3J G;  4K2L A;  4IFD H;  1EY5 A;  3A8I E;  3J80 L;  2KA7 A;  3D4R A;  3T51 B;  3KUP A;  3MEH A;  5E3F A;  3M7N A;  1HA6 A;  2OF1 A;  1DXM A;  3MC0 B;  4CKB A;  3K6O A;  1LO5 D;  3C1E A;  4M8A A;  2KHS A;  4G7O C;  2F0K A;  1DYQ A;  3VYR A;  2JA8 B;  1SFO B;  1ET9 A;  2B2V C;  5FOB B;  3T16 A;  3NQT A;  5JPM C;  3PUW A;  1IYV A;  2PMZ B;  4G57 A;  1BF4 A;  1CHP D;  2EY2 A;  5T1G A;  1SYC A;  5D3I B;  5CR3 A;  3K5N A;  2CVR A;  1RJT A;  1BXT A;  1PDQ A;  3MXU A;  1IW7 C;  2CHB D;  3UI2 A;  1G6Z A;  1G29 1;  4N9T A;  1II3 A;  1BR9 A;  3H0G B;  1EEI D;  1D5M C;  1E2V A;  2ICE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...