1UEAB

Mmp-3/timp-1 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
181
structure length
181
Chain Sequence
b'CTCVPPHPQTAFCNSDLVIRAKFVGTPEVAQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHARSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX METALLOPROTEINASE-3
publication title Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (metalloprotease/inhibitor)
total genus 42
structure length 181
sequence length 181
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ueaB02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 1ueaB01
1BR9A 1BQQT 3MA2B 5FO8B 2I07B 3CU7A 4FXKC 3CKIB 1JC7A 5JPMC 1XWEA 2E2DC 2WIIB 3OHXC 5FO9B 2ICEC 3G6JB 2B39A 5FOBB 5FO7B 3KLSA 2XWBB 3V96A 2WINB 1UEAB 3FRPB 2A74C 3L3OC 3HS0C 1BUVT 2A73B 2TMPA 2QKIC 1JB3A 4ILWA 3HRZC 4FXGC 3I70A 1UAPA 1OO9B 2XWJB 3T4AC 1D2BA 2J0TD 1GXDC 1PXUA 5JPNC
chains in the Genus database with same CATH superfamily
1GUWA 4L5QA 1O80A 4X6AH 1ZYRC 3E3XA 1BDOA 1JWMD 1RF2D 3C3LA 1XWEA 1N33Q 5HY6A 1TWFB 2NVYH 2A19A 4ABNA 2RHQB 1F77A 2IX0A 2ID0A 3L7ZC 5KIXA 3PMFA 1A63A 3UDIA 2F4VQ 2PNRC 4RGNA 1FD7D 1PTOH 3JC66 1TIID 4XT1B 2B2VC 1HR0W 2R93H 4C3JB 2KEEA 4F87A 2VB2X 2O4XA 1HR0Q 3I91A 2JYOA 4NXNL 4A3IB 1X3EA 1SJED 2IWHA 3K5MA 2D2CC 2K28A 4R4IA 3LNNA 1GUGA 4P74A 3STBC 4JC0A 1LT6D 3K0YA 4OONA 4RHRA 1B4OA 1B53A 4GLXA 1GOZA 1EY4A 1N34Q 3S1NB 1HNXQ 1JORA 2F0SA 3W5OA 4OEMB 5C44G 2Y0SB 3GTOH 1SMYD 4PG3A 3NTIA 4CJ0B 4DR3Q 2JA6H 4X3SA 1J5EL 4A3KG 3PIOA 1VDZA 3BZKA 4NMZA 4BXXG 1QVFA 4FXDA 3VYSA 4X3KA 5K5PA 1WTHA 4WJ4A 3T1HQ 2DGYA 2SNMA 3UE1A 1NR4A 1KC8C 1GUTA 2V4DA 2VUMG 1PV4A 1PH4A 3OTOL 1EYDA 2MGSA 5C5LA 4QIWE 5CV4A 5M3MB 3UDXA 3TSSA 1GVPA 1VMPA 4DV5Q 2Q2HA 3QG1A 1J9OA 4DV7L 3QR8A 3Q22A 5M9OA 4JBWA 1NMFA 2RDGA 1OXSC 1PH6A 3TQYA 2K5VA 5FLXE 1E2WA 3T51B 2WACA 1HNZL 2F0FA 3ITPA 5ISRA 1AZPA 1EEFD 1EU4A 3SK6A 2Z4IA 1K8GA 4J15A 1EYAA 3Q6SA 5FLMG 1DZ1A 3EQLC 4AQYQ 4GNXA 4DK3C 3MXPA 4J6HA 5E4XA 1ET9A 1S5DD 3HG9A 2CQOA 2QGQA 1G6ZA 1KHIA 2BA1A 1ZXTA 5C0XI 4ZKCB 3CMEA 1I4QA 2D0OA 1VQ7A 4DK1A 4KTAA 1XJVA 2B2VA 4POGA 1SNQA 3GTLH 3SGIA 4DV4L 5C6AA 2WKCA 1O7IA 3NHHA 2O5JC 4FP5D 5DM73 4N8X1 3SE0A 3A8IE 1Y1WG 4B3RL 2QEJC 1BCPB 2RKSA 4DAYB 2ZTEA 2LS01 4BBRB 4A3FH 2P5ZX 1STAA 1PFNA 1YEZA 3Q8DA 4C3HH 1QOHA 3AB9A 2F1MA 2MO0A 2QF7A 2Y0SE 3NTHA 4JI7Q 3P75A 2R6GA 3QWNA 1E1TA 3MHBA 1WOCA 1SAPA 1K3RA 4ILWA 4RG1A 4DUZL 2UU9Q 2Q2TA 1UAPA 1KNAA 2HIXA 3J81L 4L6TB 1V1QA 1U4LA 1CSPA 2WB1G 4PMCA 1YJ9A 4A93G 4IPHA 2BA0A 4NB3A 4M1UB 5CMDA 2AWOA 2Z0SA 4B3TL 1PTOB 1UE1A 1JB7A 1E2VA 3QO2A 2R93B 4JI5L 4LF4L 2RCNA 1U4PA 3MXNA 4JI0L 5GROA 5BN5A 4KN4C 1U4RA 3TN2A 3GP7A 1D6EC 1K83H 3J7AF 3QIAA 5KYIA 4AYBE 1WCMH 4UPAA 1MIUA 2C9OA 1OXTA 1RJTA 4QF4A 2L0CA 1W6JA 2RDHA 3I4MH 3S1QH 2LFNA 2K5QA 1EY7A 2WAQE 1K0SA 3F8TA 4A3EG 1SXTA 3GTOB 1QZGA 5IP9H 4EX5A 4JBMA 2Q8TA 4JV5Q 4LJZC 2M00A 4GN3B 4J1MA 4LFBQ 1U9RA 1KRSA 4G4KA 2EVBA 1X3QA 3FKIG 3HKZG 1WD0A 3NENA 2Q2UA 3KLSX 3E0JA 3B6YA 4N9PA 5LMNL 4KHVA 1EY6A 3S1MH 3S2DH 1Y8PB 3IL8A 4K0KQ 3I8ZA 4L8JA 5EKLA 2KECA 4OWWB 4K14A 2L12A 5H1SE 2B63G 3BVMA 4CKEA 4H0LC 2DY8A 3G48A 2FINB 2ALYB 2WFWA 4LUZA 1I3QH 3J81i 5C44B 2F0JA 4BY7G 1SEBD 4QGUA 1BR9A 4A3KB 4YY3L 5M5YH 1CA6A 4IFDH 1HTPA 3PO2G 1PVOA 1ENFA 2NTTA 4GKJL 5ELOA 4LWCA 3S15B 4IPDA 3I73A 4OX9Q 2VUMB 3NBHB 1EIYB 4U68A 2I0QA 1D8LA 3PO3G 4L5RC 1QNKA 3T1YL 4JI8L 4HTHA 3GO5A 4NPSA 2RA4A 5NUCA 2JEAI 5GADC 3KYHC 5I6YA 3IFDA 3V2TA 1XPUA 1ONLA 3RN5A 4G7ZC 3P1HA 2VZAA 3CCSA 1GM5A 3OPOA 2EPBA 2OQ0A 2YTXA 5CGKA 2HCCA 4R1JA 3HGBA 3FRPB 5FK9C 3HS0C 4ZRZA 5IT9L 1XNQQ 1SYEA 1B50A 4C3HB 2EY2A 1VQ6A 3GTJB 3M7GA 3A5UA 4A4IA 4IOAA 3I4OA 3TZUA 4MN3A 3RD4A 1Y69U 3RZOB 1A2TA 3R2TA 1SNOA 2NB0A 4GS3A 1BOSA 2IX1A 3M85A 3VA5A 4UP9A 1IKMA 1IW7D 3P7JA 4KV6A 2L11A 2J0TD 3K7AB 3SEBA 3HOZH 4BBSG 3UE0A 3CCQA 1BQQT 1YNXA 1JOKA 1EZ8A 4DV4Q 4X3TA 1HUNA 2RDFA 3MVVA 1SYCA 5JPMC 2MPMA 3D31A 3VR6A 1WCMB 3J81j 2F4IA 1X3FA 3KJPA 3NPPA 1A3UA 1CM9A 3I4MB 3S1QB 1CA5A 1PH2A 2FHTA 4HMJA 2MNAA 1I50H 1STBA 1Z7TA 1EY0A 1N36L 1Q12A 1Z47A 5CV9A 1ESRA 4HJ8A 1XXGA 4NKLA 4JK1C 1YBYA 2E2HH 1IBKL 1K8AC 3VA7A 3K8AA 5IGEA 2F03A 1CFMA 3LX0A 4A3CG 4GN5A 3J80c 1UEAB 1DOKA 1RL2A 1NTGA 3MC0B 1BCPC 3L2PA 4B3TQ 2L15A 1HRJA 2ICIA 1E24A 1JJGA 1ENCA 3OW2A 4KN7C 1X56A 4MTNA 3GTMH 3MXGA 3K80C 2HCIA 4R8IA 2KEDA 1ML0D 1L0YB 4A3BH 1I3QB 5IGDA 1TR5A 3S1RH 4C3IG 4BY1H 1IL8A 2F4VL 1H9KA 4BWGB 2E5LL 2VY3A 5M5YB 4RKLA 1WTRA 3M3YH 3CCMA 3I4LA 1CQVA 2JA7G 1HR0L 3FKIB 3NP8A 4CDDC 4OL7A 1YZ6A 4GLAC 1CZGA 5I4DA 5IGFA 2K5NA 2ASBA 2HIVA 3J81E 2F0VA 2K6AA 4CKBA 1EWIA 1VQDA 1JWUD 5FLXL 5C3EG 3HKSA 3HOVH 4MTKA 2NVTB 1PHJA 4C2MB 1DCZA 1H9MA 2NN6I 2BCOA 4FNFA 2B63B 1N34L 4DV3Q 1HNXL 2OEOA 1I6HH 3CCJA 1R4PB 2KENA 3KDFB 2G5DA 1V1PB 1WTPA 4ODGA 2B29A 4DR3L 1RIPA 4J8QA 5BN3A 1LTAD 4MNOA 3J80i 3D6WA 1Q46A 1AW7A 1IL2A 3C1FA 2KHIA 2RBMA 3ERQA 4DR4Q 3T1HL 2MHVA 5KGUA 4RFBA 3I4NH 1V1OA 4EQPA 1HPCA 4Y52H 2CHBD 3F1ZA 1VMCA 1GO3E 2BH8A 4YY3Q 3RN2A 1D1KA 2CH4W 3N6RA 2L9HA 1IBMQ 2C5CA 1BUVT 4CJ2C 1XYIA 1TS5A 1SRUA 4GKJQ 1JOQA 4DR1Q 3W1BA 3HOYG 1X3PA 4ZKBB 1HHVA 2VQEQ 5EKIA 4AIMA 1AH9A 4DUYQ 2PNHA 2HDMA 3K57A 4UAIA 1SLJA 3D6CA 3LWUA 4DAMA 4DAYA 5IYBG 4C1NK 4Z9CB 4HJ7A 1S72A 4TVAB 1F2YA 1LTTD 4G7OC 3S1NH 3RLOA 3BDLA 3FEWX 1VQBA 2MFIA 4EQ5A 3U4ZA 2UXBQ 4YCWA 5IOCA 4OHJA 2YTVA 3GV6A 4DR6Q 1X54A 1UE5A 2TSSA 1PDQA 1JOOA 3OSOA 1GUOA 1SE4A 2NUCA 2PQAB 1F2ZA 2RCFA 2M9VA 5CBEE 4U673 4XYOA 5BR8L 1I50B 4IPCA 2F0GA 4A3MH 1KD1C 1FNVA 3VYUA 3EFXD 1UNSA 3NK9A 3G71A 4ULLA 5CYUA 4KMUC 2B2WC 1SFOB 4JG2A 1AE2A 4FO2A 3BS1A 1EYGA 2K01A 4GZYC 2EYPA 4IURA 3ICEA 1B44D 4X62Q 1ICWA 4OIJA 3DMUA 3HZXA 1CHPD 1JJ2A 2KCMA 3W1GA 3PUYA 4GLVB 2UU9L 3RR5A 3VR4A 3GTMB 3D8GA 4IUPA 1OXUA 4BY1B 3KK7A 5IT9E 2E76C 1L0XB 4DR2Q 3MA2B 3HOWG 4PQXA 3GTKB 2WV6D 3M3YB 1N36Q 4RA8A 5KNBA 5JEAG 4FF3A 4RAUC 2ZTDA 4WJ3M 3E9IA 4P73A 2CFMA 3S2HH 2SNSA 2EY6A 2PW7A 5IIFA 1IBKQ 2QW7A 3K58A 1S5BD 1EY5A 3LWEA 1M1KC 3CCUA 3H94A 3HOVB 2QEXA 1ILPA 2F3VA 3KLWA 4BBRH 1F2LA 1UWVA 1I6HB 3CF5A 1KDBA 1LT4D 5CBAE 1O7ZA 1VQ5A 2A6HD 2DUDA 3IKJA 4FYDA 2RF4A 1N9WA 4JV5L 4GNXC 4LFBL 4QQBX 1MJCA 3TP5A 4IPGA 3I4NB 1BCPD 3I56A 3GV3A 2JA7B 5D3DA 5E1FA 4B9XA 3QOJA 2K03A 1SE8A 3HOXG 4PMBA 2JJQA 2E5LQ 3DEOA 1UUPA 2JA8G 1GHKA 3A8KE 1EOVA 1HFGA 4K0KL 4UHVA 4IO9A 1JQYD 2ZTCA 4XQNA 5T1IA 2UXCL 1C0AA 2ENBA 2KBNA 4GKKQ 2LXKA 1L0WA 1JE4A 3K5NA 2B2WA 2AQ2B 2K05A 2I5MX 2N55A 1B70B 3R8BA 4KHPQ 3BJUA 2B2YC 4HEDA 3JAMc 3I72A 3S16H 5CORA 1TWHH 1LV9A 1HH2P 4L63B 4N9TA 4HJAA 3U58A 2MUYA 4KD3A 4GOPB 2VNUD 1PTOD 3MEHA 1HZBA 4DK0A 5L37A 5M5XB 1H9JA 4HSPA 1BBUA 2LSSA 4OX9L 1QG7A 4LFAQ 5HURA 1LLRD 1SSOA 2F0PA 2CQAA 1EWHA 1O7LA 1HA6A 4FF2A 3OWEB 1D1IA 2XN9C 1X32A 4KKSA 3PIPA 3HOYB 4A3MB 1PH8A 1HQMC 4FF1A 3A0JA 3M4PA 4DN4M 3H15A 1MSHA 2LXJA 3Q23A 2MO1A 1KLUD 5EGTA 3NXWA 5LMUQ 3A55A 2PZTA 3T53B 3AU7A 1XNQL 2Z1CA 3D0FA 2YYZA 5GAGC 3CC7A 5C44H 1PRTB 5CC4A 2JSOA 4G7HC 1TXYA 2EIFA 4A3KH 4X3UA 1TKWB 4BXXH 1RODA 3S17H 3BVGA 1TWAB 2EXDA 1IW7C 4DNTB 1VS0A 3IFTA 2EYJA 1MKHA 1PH9A 3HP3A 1STGA 5C0XG 3S15H 2HD3A 2VUMH 3NQIA 5D3IB 4IQZA 4LNQA 5IYCG 1VQ8A 1XPOA 1EUJA 4M8AA 3OW7A 1JT8A 2D62A 5GAHC 4LF8Q 4K5XA 1HZ9A 5BR8Q 1QE6A 3W3AA 4DK6C 1IYUA 3TDQA 2D0PA 1YIJA 1EQRA 3H0GG 1I5FA 3S2HB 3T56B 1V9PA 2R7FA 3RZDH 3KBGA 1PMRA 2B2YA 4FXKC 3A8JE 4X65L 4NXMQ 2JK8A 5FLMH 4K8JA 3S14H 5E4WC 2FFKB 1IBLL 3GTJH 5HGTA 5IY0A 1EIFA 4JYAQ 2PZWA 2A5HA 4PMWA 3RZOH 1WYDA 3F2UA 2VW9A 4F7XA 5M3FG 3KF6B 2F0UA 1PH1A 1RKNA 1QUQB 1WTVA 4LF6Q 2KHSA 4X66Q 2KJXA 1VQEA 3DHQA 3L9AX 2GVBA 5EJWA 5IWAQ 2RSNA 3AFPA 3K7AH 5CV6A 2CWPA 1Y1WH 4DF7A 4KJOA 4LMQD 3VYTA 3A56A 1PZJD 2BDOA 2AHOB 1LTID 1ESFA 3K5OA 2ZXOA 3NWTA 1STHA 5IP7G 3DM3A 4CHTB 4WORA 3DWQA 3S16B 1Y14B 1TWHB 3BU2A 4EGVA 3U9OA 2UUBL 1H9SB 4UY8C 4R4TA 1NNXA 1EIHA 3RMHA 1P16A 5EBDA 3D4DA 1VF5C 2HHHQ 5I2YA 3PV0A 1V43A 2F0LA 2ZT9C 1NUCA 2JP1A 3J7A5 1I4PA 4BA1I 4A93H 5EKKA 4EVOA 1DM0B 2HUGA 1Q81C 1VF7A 4ID6A 2FMMA 1B2TA 3O13A 4K5WA 4JPBW 2XGTA 1WJJA 2K5WA 4DV3L 3WOFA 5IYDG 2F0OA 2H4OA 2R92G 2QCPX 4ZUJA 5EPLA 4XT3B 2K04A 3HOUG 1A8VA 5JOBA 4YCVA 2UXCQ 4LUVA 1ZEQX 1ZKOA 3J7AV 3SVMA 3I3CA 4WRDA 4WFN3 4DR4L 1NCVA 4KK7A 4RMFA 3WDNA 1AN8A 4LW1A 4A3EH 3C2PA 1KLGD 1EU3A 4DFAA 2YU9H 2NTSA 3BDCA 3S17B 3CAMA 4JI6Q 5F2DA 5LHY1 1Z9FA 1IBML 3BDOA 1Q3LA 1JR0D 3FKIH 4DR1L 4O42A 1X65A 3NWSA 1R9TH 2VQEL 5JJLA 4DUYL 2JA5G 1R4QB 3U9SA 3T13A 2CW0C 4F8MA 1SYFA 5IGCA 1DGSA 2R7DA 1MI2A 1HFNA 2NVTH 1X3GA 4C2MH 4K2LA 4HIDA 2B63H 4A3DG 4A3GG 4K8IA 1MJEA 4FF4A 3R2IA 2F3IA 2JA9A 1NY4A 4S3SA 3VYRA 4GOPC 2GVAA 2UXBL 3K5LA 2I5LX 1Q90A 3RZDB 4LF5L 5FO7B 4BY7H 1GUSA 5ELEA 3V96A 4DR6L 5E3FA 1KNEA 1XTCD 1NR2A 2WP8J 4R4QA 5IGBA 3ONAB 1JJCB 2AUKA 2EY1A 3PSIA 1LTGD 1NSNS 3DUZA 3PO2H 1MD2D 2E75C 4CJ1B 3S14B 4P75A 2HDLA 2N49A 3TRZA 2NZOA 1HTLD 5K36G 1HA5A 2NBFA 1I4XA 1EZ6A 3PO3H 3M4QA 1XTDA 4H44C 3P20A 1QZHA 1SNMA 1J6QA 1AFPA 1D5XC 3H0GB 4QCLA 4JI1Q 4X62L 1Y8NB 1D7QA 3TBIB 4LFCQ 4DV2L 2EOTA 1Y1WB 1AP0A 2EXZA 3FVQA 3HFZB 2ZJRA 4K5VA 1PRTC 5FJ8G 2JN4A 2HQEA 2UXDQ 1BBWA 2CWAA 1KAWA 4DGZA 1VQIA 4JCVE 4QUCA 5CV8A 4C56C 2K33A 4X65Q 3CCVA 1EEID 4B08A 4DR2L 2IHFA 2GN5A 3EVQA 4V190 1OO9B 2L4NA 3PUVA 1IBLQ 1ASYA 2CKZB 3EROA 3J80L 2EQSA 2WB1B 3CRLC 3ZJYC 2R7ZG 4A93B 5IE8A 4OXPA 1D5MC 5ELNA 1WVLA 2PI2E 4OO1G 4X64Q 3TZDA 5LL6X 1HZAA 1LTBD 1XPRA 2YTYA 4A3LG 1K8MA 4LAAA 2A6HC 2K5DA 1SFOH 2JEBI 4BBSH 1FGBD 2E2JH 4ZUIA 5DAUA 4OO1I 2WINB 3AQQA 1L1OB 1HCZA 4ME5A 4JBKA 2A73B 4UP7A 3FHWA 1LYLA 3TEHB 1Q7YC 4DAVA 4TRDA 4GOPA 1F9RA 2AUJD 3NBIA 2EZVA 2B3GA 2K50A 3BG3A 5TSSA 5T1GA 1Q86C 1QNUA 1IKLA 4A3EB 2E8GA 1CHQD 2YU9B 3BVZA 2A68D 5DEHA 5JAVA 4F88A 2UUBQ 1A3VA 4DNIA 4UP8A 3GTKH 3CMAA 1E1OA 2DNCA 3FPUB 3I70A 4A3JG 1OXVA 1VCIA 3HKZB 4YWKA 5JPNC 5KYLA 4P2CB 1PTOC 4A3CH 4GKKL 1LO5D 1G2SA 4HJ9A 1R9TB 1EFWA 3MAQA 2H5XA 3J7YW 4TSSA 4KHPL 2NN6G 1QJOA 2BE5D 4I7ZC 3G6EA 4PZ6A 2MP1A 5D65A 2XRQD 3MTSA 3HOUB 2EYOA 4LF9Q 3RLNA 3KLSA 2BDNA 3BZDB 1CT1D 5G3LD 1NE3A 2L5TA 4C3IH 1F2MA 4LF7Q 4BY7B 3T4AC 4HCEA 2J7ZA 5C5MA 2F0IA 4LFAL 1S4ZA 2SEBD 3OIPA 4C3JG 1K0RA 1QWYA 2F0QA 1UEBA 1VQLA 1E22A 1VQKA 1RTOA 1AZQA 2PPBC 3PO2B 1Z6HA 4A3IG 1DXMA 3ULJA 3CCRA 3E6ZX 2JA7H 4NDXA 2AQ1B 1CKNB 3MXNB 2IHEA 1KTKA 1C8CA 2UUCQ 4HN7A 3PO3B 1Y1VG 2PYKA 2EYFA 1EWCA 2ZJPA 4XTCS 1XX8A 1S40A 4FXGC 2UUAQ 3T16A 5C3EH 3ND9A 2OTLA 5KNDA 4IZ8A 5LMUL 2AMCB 4OWXB 3KFUA 4ZLTF 2Y0SG 3VR5A 4QJFA 4CKCA 1TWCB 5AFWA 3ER0A 3CW2C 2K1BA 4JI4L 1RTNA 1B9NA 3A5ZB 1WTOA 5M5XH 3X3MA 2A74C 1MHWC 5A35A 1T5EA 3PUZA 4CGYB 2CW0D 4JVZA 2Q8IB 4LF5Q 4Q0FA 5J3BA 5M3MG 1HXYD 4JI3Q 4HIOA 1WD1A 4YCUA 4LF8L 3PUWA 1IYVA 1YVCA 2F0MA 2N8NA 4HSVA 4KKUA 1TY0A 3H3VH 3HOYH 1XNRQ 2RHSB 1BNZA 3CP0A 2B39A 3N52A 3FPPA 1PYBA 1I4GA 4MHEA 4HAEA 4AYBG 2B8FA 3KOJA 3S24A 1NBWA 5C4ZA 2RQXA 5BN4A 5IYBH 2XWJB 2HQLA 4BBSB 2WAQG 3BZCA 2E2JB 1A0IA 4NXML 1FVIA 1BKBA 1FR3A 1UE7A 4HMIA 4DV1Q 4IUVA 4DV2Q 4JOIC 5FO9B 2E2DC 1WTXA 4JYAL 1TWAH 1M4VA 1B9MA 1M90C 2KUMA 1C7YA 3V05A 2JXMB 4IFDJ 3TS0A 1Q8KA 1I4HA 1PH5A 2PW5A 4LF6L 4X66L 2F0TA 1JE5A 1PRTD 5IWAL 1ENAA 1MBYA 2F52A 1QVCA 5D14A 1C9OA 4A76A 1WTQA 1OTCA 2NZHA 1J8IA 4OELB 2A69C 1G51A 1BBXC 3MZ5A 4I7AA 5JJZA 5C4HA 2EE1A 1E0BA 4OGQC 1U0LA 3GTGB 1P8LA 1B3QA 1H95A 2ZJQA 3M9BA 1BCPF 1B1ZA 3W2DA 3SHLA 2HHHL 5JJIA 1LABA 1SR3A 4FVMA 4O2DA 2E2IH 3C46A 1LACA 4PZ7A 4QIWB 4C3IB 1WI5A 1GD7A 3OHXC 1PYWD 1SN8A 2XWBB 3CQZH 4MZ9A 3AMUA 2R93G 2ZM6Q 3HOWH 4LK1C 3URYA 1FNUA 1YNNC 4KY7A 2DJGC 2X6LA 1PFSA 3NBHA 4KHZA 5JEAH 2PI2A 3GTQH 1VQ9A 1C4QA 1NMGA 2F3WA 3JAML 4DXGA 1K8OA 1T9HA 2NVQH 4XQJA 1FL0A 1K28A 1PTOF 3CD6A 1L1OC 3J80E 4XXEA 3I90A 3EA6A 4Y7NH 2H1EA 4B3SQ 5C3EB 1TY2A 3DXJC 4KKTA 3KF8B 1SNPA 2V1CC 2JA6G 2L1BA 1A2UA 3HEJA 1HNWQ 2DNEA 4OIKA 4RGOS 3CC2A 4XDXA 4JOIA 3CPFA 2NZ1D 3ULPA 4IUQA 4JI6L 5DLQE 1WTWA 1I94L 1STEA 4XIGS 4JI2Q 2IY5B 1SYBA 3SK8A 4DR7Q 2K7VA 3HOXH 1YI2A 2WIIB 2JA8H 3DM1A 1Y1VB 3SXHA 2E74C 1G291 2J4XA 1S5CD 2N88A 1KDCA 1QCBD 1Q82C 1E3PA 1SYDA 1HZCA 3GTPH 4CDCC 4YHHQ 1RDPD 1W6KA 3CCLA 5C3XA 2KCNA 4YWMA 3DWAA 1DYQA 3OMGA 2CVRA 2PZUA 1JC7A 3EBEA 5C4XG 2AQ3B 1FNWA 3VR3A 4EQOA 3UDGA 2N78A 4R9WA 5I2XA 3PF4A 3F2DA 4WJWA 4Q5VA 1K73C 2SOBA 5DM63 3WWVA 3ZYYX 3EIVA 4JI4Q 3NSWA 3RNUA 1YNJD 1LTLA 1QVGA 3JAMi 5C4JH 1IYJB 1HUMA 4KLKA 4QL5A 1D5ZC 2N3SA 1QB5D 1I6VC 1LTSD 5FKAC 4B3MQ 2OXPA 1ET6A 1HJPA 5EQ0A 2A6ED 4R4CA 2K32A 3K81C 1STYA 3SK5A 1DOLA 3BYTB 2Z4HA 1YHQA 1VQAA 4AYBB 1LUZA 5FOBB 4JI1L 1G2TA 2FMCA 3PIO3 5M5WH 4LFCL 2RSOA 1LT5D 1L1OA 3E9HA 3PF5A 4K6LA 1CKMA 1PZID 5C4XH 1EYCA 2WAQB 4A3FG 2SDFA 1S5FD 1EFID 2B2TC 2Z9HA 4C3HG 2XVSA 3PIP3 3NEMA 2UXDL 2ATWA 1Q1EA 1PFMA 4DV6L 4K2KA 5AJ3L 4IALA 1XMOL 2VQFL 1SMXA 5J39A 1EIGA 5C0XH 2E2IB 4G57A 1YITA 3RUZA 2OQKA 1AEXA 1LTRD 3K0XA 5IYCH 4DV0Q 2LMCB 4EQNA 3A74A 1TVXA 4X64L 3VDYA 5CV7A 3CQZB 4LUOA 1W2BA 1YHBA 3HOWB 4HR7B 4R8NA 5J22A 1SE2A 1U5KA 5JVH3 1EQQA 2NVXB 2EY5A 4APVA 2D9UA 2CH4A 4TQUS 2XRSD 3H0GH 4AH6A 2QILA 3M4OH 2K4KA 3GTQB 4CDFC 2WKDA 2NVQB 4ALPA 1WCMG 2KCCA 3Q24A 4E6IA 2JQOA 2A68C 2EYMA 3M4YA 3I4MG 4KJNA 4Y7NB 1B3AA 3CRKC 3SR1A 3PUXA 3KDFA 1V1PA 2EYHA 2NVYB 1F9QA 2EYLA 5IP9G 3IAYA 1W3SA 2DJFC 2A69D 3TP6A 1RD9D 2BE5C 2L55A 2KVMA 5CR3A 5I9PA 5M3FH 4YWLA 2Z8LA 4MIUA 1ILQA 3J81c 2FXQA 1CKNA 3GD7A 1N32L 4BA2I 1A62A 3UDFA 1SE3A 3TS2A 3HOXB 2M2LA 4NP5A 2JA8B 4O0AA 3WOEA 4IN3A 4DAPA 2OTJA 1TWGH 2K5HA 5ELFA 4LF9L 1SNDA 5A2QE 1VQPA 4CDEC 3GTPB 2Z6KC 2XSCA 4QMGA 5IP7H 1N8RC 1AE3A 3H91A 4P72A 4B9WA 3SK4A 1L2FA 2B2TA 2JA6B 4IUUA 3A7AB 1YNND 4LF7L 1HQRD 1KXLA 3L0OA 1JCKB 1TS3A 2XTIA 3L3OC 4IFDG 1KAAA 2VB3X 1KL9A 4L5TA 3U50C 1EQTA 2QDLA 2JE6I 4RKBA 3CCEA 3H6MA 1BF4A 3NELA 3D4RA 1ZYRD 4IFDI 4L5SA 2PQAA 1YJNA 3VR2A 2UUCL 1CSQA 2F0KA 4KI0A 1KIXA 3A7LA 2F0DA 5C4JB 5CV5A 2ICEC 1I94Q 2I46A 2IT1A 4NXNQ 4JBJA 2UUAL 2VS1A 1VQJA 3QJYA 3UI2A 4PV1C 2KQ3A 3ERSX 3OYYA 3HRZC 2OT2A 5IYDH 2R92H 2LY7A 5M5WB 1EL0A 3FP9A 3HOUH 4HIMA 3KUPA 2X6GA 4R4OA 3JAME 5C4XB 1NAPA 4ZK9B 3PCOB 1PLFA 3I2ZA 2XNAC 1J5EQ 4IUNA 3STBD 3NE5B 4JI3L 1GHJA 4HIKA 4H13C 3CXCA 2TMPA 3OMCA 5GQOA 2PQEA 2IJ0A 3AFQA 5EPKA 3OTOQ 5KEEA 3KJOA 2KCTA 1XNRL 5IODA 3GTLB 2FJ2A 4RGTA 1M8AA 4H7BA 2JA5H 5JEAJ 3FMCA 3H3VC 1VQHA 1EOTA 4KD4A 3HOZG 4DV7Q 1MGSA 2BOSA 1X9NA 2EJGC 3EN2A 4A3DH 4A3GH 4A3FB 1JMCA 3M4OB 2BH2A 1II3A 1JB3A 1TWCH 1DJRD 2IPKD 1PH7A 1FJGL 3F2CA 1Q8IA 2Z6KA 4DV1L 1HNZQ 1S3OA 4N8FA 3U4VA 1K3BC 5IT9c 2GA4B 2ZXPA 1PA6A 1KDAA 4DR5L 3NTKA 1STNA 2IX3A 4QY7A 4DV6Q 5K36H 2EJMA 4DXFA 5AJ3Q 1PH3A 4DA2A 4QB4A 1XMOQ 2VQFQ 2QA4A 3MXUA 1FYCA 1LM0A 1PYSB 2KHJA 5M3FB 5ELDA 1K9MC 5ELCA 4JW0A 1E2ZA 3EJIA 1KRTA 2HT1A 1OXXK 5FO8B 2I07B 1G91A 2AKWB 4NW2A 1K83B 3S9WA 3CKIB 2D5DA 3G7LA 4ZQ3A 1VQFA 1X6OA 4B3RQ 1CI3M 5J1ZA 2K75A 1CZWA 1TWGB 1CK1A 2C35B 3KF8A 2Z6BA 4PNYA 5FJ8H 1JICA 2VXWA 2OF1A 4ZYSA 4POFA 5EAYA 5JJKA 2K52A 2R61A 4A3BG 4GNXB 4BY1G 1VQNA 1D2BA 1GXDC 4K6DA 4RWSC 1KQSA 5KNCA 2NWGA 5I9OA 1GUNA 1JWSD 4DUZQ 4BS9A 2F0WA 1UE6A 2ZM6L 4V0BA 3C1EA 2G9HD 4XYQA 1XMQL 4DU9A 2R7ZH 1IHZA 4RH6A 1TT2A 1WFQA 3S1MB 3S2DB 3E0EA 5ELBA 4OO1H 1B7YB 1RHPA 1DONA 5E7NA 3D4WA 5G3LF 3ND8A 4JI5Q 4LF4Q 3AEVA 3LGJA 3HOVG 3K7UC 4A3LH 5COYA 4B3SL 4JI0Q 2X69A 1N32Q 1N33L 1CKOA 2MQHA 3CC4A 3PQIA 4PZ8A 3GTGH 1SNCA 2R92B 1VQGA 4H02A 1HNWL 2LKVA 1S5ED 1YHAA 1B8AA 2B2UC 5JVG3 3I4NG 3RLFA 3R93A 4JI2L 4O1NA 1CQFA 4KY6A 2O2LD 4DR7L 1ICFB 3MWYW 4YIJA 4GN4B 5C0XJ 1SMYC 2F0HA 1BXTA 2IW3A 2DY7A 3MEFA 4ME3A 3X3NA 1YJWA 2F0NA 3CPWA 1EY8A 3GDEA 3SDZA 5KRUA 5LMNW 1TS2A 4A3JH 5LMNQ 3K59A 5I6WA 2WB1E 1IZ6A 1A6XA 1T5XD 4IJHA 4YHHL 1GJXA 2XIWA 1V8QA 1IXRA 2JA5B 2NN6H 1TU2B 1GKHA 1PFBA 1SYGA 3AYHB 4RGMA 5IGGA 3ULLA 4RHSA 1O78A 1F9PA 5FLXc 4DPGA 1YNJC 2PMZB 1TS4A 2PO4A 1VQOA 1TWFH 4CBVA 4A3DB 4A3GB 1A3TA 1BO0A 3CU7A 1NJIC 4UDUC 2RVLA 2A6EC 4OWTB 2OCEA 1G8ZD 1CUKA 3A54A 5EPJA 1LT3D 3OIQA 4C3JH 4DV5L 4ZAIA 1RCVD 2EDGA 1PZKD 3BYYB 1O7YA 3TMEA 4A3IH 4A3MG 4B3ML 3K6OA 1E7ZA 2MJ8A 3MFYA 1KABA 4JI8Q 3T1YQ 3H3VI 1VQCA 1Y1VH 2B8GA 3KF6A 3TREA 1ASZA 1QUQA 2IL8A 2EJFC 2KOLA 3G4SA 3DWPA 2PCFB 2NYZD 3HOZB 1C48A 2A1AA 3I7FA 3KLRA 3FDTA 3QB3A 1G6PA 3HKZE 3CHBD 4RCOA 4HCSA 3OWFA 1SROA 4AQYL 2OWOA 1SJHD 1CTMA 1Y8OB 4P71A 4KY5A 3GQBA 1VQ4A 1VQMA 2ZXRA 4A75A 4FDBA 4IUTA 2YV5A 3DLLA 4TKOB 2B2UA 1FJGQ 1PRTF 2R3ZA 1H9SA 4RCNA 4IJLA 4QUFA 5M3MH 3I55A 1EQVA 4IOCA 2K14A 1U4MA 4DKAC 4DV0L 1H9RA 5C3WA 2E2HB 1DD2A 1SBBB 2VL6A 3QOLA 3D3RA 3TP7A 4DR5Q 1DOMA 2O5IC 1Q1BA 5A2QL 4ZCKA 1EY9A 2DN8A 2KA7A 3J7ZC 3M7NA 2R7ZB 3F2BA 1BVSA 2CCZA 4JI7L 3OOCA 3KBXA 3R3OA 5EBCA 2F0EA 1X55A 2QDBA 2PMZE 4BBRG 5HGQA 2ES2A 2A8VA 3PGZA 3Q0AA 4A3BB 2G9DA 3DEPA 3S1RB 4HJ5A 2QKIC 1A15A 2Q8RE 1MSGA 3H09A 1FGUA 3IRBA 1SDFA 3NUCA 4C1NI 2Q2IA 3E5SA 4DNRB 3NQTA 3G6JB 1QILA 5GAEC 5DNFA 2AWNA 3MFGA 1F9SA 4XQQA 5LL6S 2NVXH 1TQOA 3TP8A 1I4RA 4A3JB 2I5HA 1XMQQ 1PXUA 4I65A
chains in the Genus database with same CATH topology
1GUWA 1O80A 1ZYRC 1BDOA 1JWMD 1RF2D 3C3LA 1XWEA 1TWFB 4ABNA 1F77A 2IX0A 2ID0A 3L7ZC 5KIXA 3PMFA 2PNRC 4RGNA 1FD7D 1PTOH 4XT1B 1TIID 2B2VC 4C3JB 2KEEA 4F87A 2VB2X 2O4XA 3I91A 2JYOA 4A3IB 1SJED 2IWHA 3K5MA 2D2CC 2K28A 3LNNA 1GUGA 1LT6D 3K0YA 4RHRA 1B4OA 1B53A 1GOZA 1EY4A 3S1NB 1JORA 2F0SA 2Y0SB 1SMYD 4CJ0B 3NTIA 4X3SA 1VDZA 4NMZA 4FXDA 3VYSA 4X3KA 5K5PA 2SNMA 1NR4A 1GUTA 2V4DA 1EYDA 2MGSA 5C5LA 5CV4A 5M3MB 3TSSA 1VMPA 3QG1A 1J9OA 3Q22A 5M9OA 4JBWA 2RDGA 1OXSC 5FLXE 1E2WA 3T51B 2WACA 2F0FA 3ITPA 5ISRA 1AZPA 1EEFD 1EU4A 3SK6A 2Z4IA 1EYAA 3Q6SA 1DZ1A 3EQLC 3MXPA 4J6HA 5E4XA 1ET9A 1S5DD 3HG9A 1G6ZA 2BA1A 1ZXTA 5C0XI 4ZKCB 1I4QA 4DK1A 4KTAA 2B2VA 1SNQA 5C6AA 2WKCA 2O5JC 3NHHA 4FP5D 5DM73 3SE0A 3A8IE 2QEJC 1BCPB 2RKSA 2LS01 4BBRB 1STAA 1PFNA 1QOHA 3AB9A 2F1MA 2QF7A 3NTHA 3P75A 2R6GA 3QWNA 3MHBA 1SAPA 4ILWA 1UAPA 1KNAA 3J81L 4L6TB 1U4LA 4PMCA 2BA0A 4M1UB 5CMDA 2AWOA 1PTOB 1E2VA 3QO2A 2R93B 1U4PA 3MXNA 5BN5A 4KN4C 1U4RA 3TN2A 3GP7A 1D6EC 3J7AF 3QIAA 5KYIA 2C9OA 1OXTA 1RJTA 4QF4A 2L0CA 1W6JA 2RDHA 2LFNA 2K5QA 1EY7A 1SXTA 3GTOB 2Q8TA 4LJZC 2M00A 4J1MA 1U9RA 4G4KA 2EVBA 1X3QA 1WD0A 3KLSX 3E0JA 4N9PA 4KHVA 1EY6A 1Y8PB 3IL8A 3I8ZA 4L8JA 5EKLA 2KECA 4K14A 2L12A 3BVMA 4CKEA 4H0LC 2DY8A 2FINB 5C44B 2F0JA 1SEBD 1BR9A 4A3KB 1CA6A 4IFDH 1HTPA 1ENFA 2NTTA 3S15B 3I73A 2VUMB 4U68A 1QNKA 4HTHA 3GO5A 2RA4A 5NUCA 2JEAI 5I6YA 3IFDA 3V2TA 1ONLA 4G7ZC 3P1HA 3OPOA 2EPBA 5CGKA 2HCCA 3HGBA 3FRPB 5FK9C 3HS0C 4ZRZA 5IT9L 1SYEA 1B50A 4C3HB 2EY2A 3GTJB 3M7GA 3TZUA 4MN3A 3RD4A 1Y69U 3RZOB 1A2TA 3R2TA 1SNOA 2NB0A 1BOSA 2IX1A 3M85A 3VA5A 1IKMA 1IW7D 3P7JA 4KV6A 2L11A 2J0TD 3K7AB 3SEBA 1BQQT 1JOKA 1EZ8A 4X3TA 1HUNA 2RDFA 3MVVA 1SYCA 5JPMC 2MPMA 3D31A 3VR6A 1WCMB 2F4IA 3NPPA 1A3UA 1CM9A 3I4MB 3S1QB 1CA5A 2FHTA 4HMJA 1STBA 1Z7TA 1EY0A 1Q12A 1Z47A 5CV9A 1ESRA 1XXGA 4NKLA 4JK1C 3VA7A 5IGEA 2F03A 1CFMA 3LX0A 1UEAB 1DOKA 3MC0B 1BCPC 1HRJA 2ICIA 1ENCA 4KN7C 3MXGA 2HCIA 4R8IA 2KEDA 1ML0D 1L0YB 1I3QB 5IGDA 1TR5A 4C3IG 1IL8A 1H9KA 4BWGB 5M5YB 4RKLA 1WTRA 3I4LA 1CQVA 3FKIB 3NP8A 4OL7A 1CZGA 5I4DA 5IGFA 3J81E 2F0VA 2K6AA 4CKBA 1JWUD 5FLXL 2NVTB 4C2MB 1DCZA 1H9MA 2NN6I 2BCOA 4FNFA 2B63B 2OEOA 1R4PB 1V1PB 1WTPA 4ODGA 4J8QA 5BN3A 1LTAD 3D6WA 1AW7A 3C1FA 2RBMA 3ERQA 2MHVA 5KGUA 4RFBA 1V1OA 4EQPA 1HPCA 2CHBD 1VMCA 1D1KA 3N6RA 2L9HA 2C5CA 1BUVT 4CJ2C 1XYIA 1TS5A 1JOQA 1X3PA 4ZKBB 1HHVA 5EKIA 2HDMA 3K57A 4UAIA 3D6CA 3LWUA 4DAYA 4C1NK 4Z9CB 1F2YA 1LTTD 4G7OC 3BDLA 3FEWX 5IOCA 4OHJA 3GV6A 2TSSA 1PDQA 1JOOA 3OSOA 1GUOA 1SE4A 2NUCA 1F2ZA 2M9VA 5CBEE 4U673 4XYOA 1I50B 2F0GA 1FNVA 3VYUA 3EFXD 1UNSA 3NK9A 4ULLA 5CYUA 4KMUC 2B2WC 1SFOB 4FO2A 3BS1A 2K01A 4GZYC 2EYPA 4IURA 1B44D 1ICWA 4OIJA 3DMUA 3HZXA 1CHPD 3PUYA 3VR4A 3GTMB 3D8GA 4IUPA 1OXUA 4BY1B 3KK7A 5IT9E 2E76C 1L0XB 3MA2B 3GTKB 4PQXA 2WV6D 3M3YB 4RA8A 5KNBA 5JEAG 4FF3A 4RAUC 2SNSA 2EY6A 2PW7A 5IIFA 3K58A 1S5BD 1EY5A 3LWEA 3H94A 3HOVB 1ILPA 2F3VA 1F2LA 1I6HB 1KDBA 1LT4D 5CBAE 1O7ZA 2A6HD 3IKJA 4FYDA 3TP5A 3I4NB 1BCPD 3GV3A 2JA7B 5D3DA 5E1FA 4B9XA 3QOJA 2K03A 4PMBA 3DEOA 1UUPA 1GHKA 3A8KE 1HFGA 1JQYD 4XQNA 5T1IA 2ENBA 1JE4A 3K5NA 2B2WA 2AQ2B 2K05A 2N55A 3R8BA 4HEDA 2B2YC 3I72A 5CORA 1LV9A 4L63B 4N9TA 2MUYA 4KD3A 2VNUD 1PTOD 3MEHA 4DK0A 5M5XB 1H9JA 4HSPA 1QG7A 5HURA 1LLRD 1SSOA 2F0PA 2CQAA 1EWHA 1O7LA 1HA6A 4FF2A 3OWEB 1D1IA 2XN9C 1X32A 4KKSA 3HOYB 4A3MB 1HQMC 4FF1A 4DN4M 1MSHA 3Q23A 1KLUD 5EGTA 3NXWA 3A55A 2PZTA 3T53B 3AU7A 2Z1CA 2YYZA 1PRTB 5CC4A 2JSOA 4G7HC 4X3UA 1TKWB 1RODA 1TWAB 3BVGA 1IW7C 4DNTB 3IFTA 2EYJA 3HP3A 1STGA 5C0XG 3NQIA 5D3IB 4IQZA 4M8AA 3OW7A 2D62A 4K5XA 1QE6A 3W3AA 1IYUA 3TDQA 3S2HB 3T56B 3KBGA 1PMRA 2B2YA 4FXKC 3A8JE 4K8JA 5E4WC 2FFKB 5HGTA 2PZWA 2A5HA 4PMWA 3F2UA 4F7XA 2F0UA 1RKNA 1WTVA 2KHSA 2KJXA 3DHQA 3L9AX 5EJWA 2RSNA 5CV6A 4DF7A 4KJOA 4LMQD 3VYTA 3A56A 1PZJD 2BDOA 1LTID 1ESFA 3K5OA 2ZXOA 3NWTA 1STHA 4CHTB 4WORA 3DWQA 3S16B 1TWHB 4EGVA 3U9OA 1H9SB 1EIHA 3RMHA 5EBDA 3D4DA 1VF5C 5I2YA 3PV0A 1V43A 2F0LA 2ZT9C 1NUCA 2JP1A 1I4PA 4BA1I 5EKKA 4EVOA 1DM0B 2HUGA 1VF7A 4ID6A 2FMMA 1B2TA 3O13A 4K5WA 2K5WA 3WOFA 2F0OA 2H4OA 2QCPX 4ZUJA 5EPLA 4XT3B 2K04A 5JOBA 1ZEQX 1ZKOA 3J7AV 3SVMA 3I3CA 4WRDA 4WFN3 1NCVA 4KK7A 3WDNA 1AN8A 3C2PA 1KLGD 1EU3A 4DFAA 2NTSA 3BDCA 3S17B 5F2DA 5LHY1 3BDOA 1Q3LA 1JR0D 4O42A 3NWSA 1R4QB 3U9SA 3T13A 2CW0C 4F8MA 1SYFA 5IGCA 1MI2A 1HFNA 4K2LA 4K8IA 4FF4A 3R2IA 4S3SA 3VYRA 3K5LA 1Q90A 3RZDB 5FO7B 1GUSA 5ELEA 3V96A 5E3FA 1KNEA 1XTCD 1NR2A 2WP8J 5IGBA 3ONAB 2AUKA 2EY1A 1LTGD 1NSNS 3DUZA 1MD2D 2E75C 4CJ1B 3S14B 2HDLA 1HTLD 5K36G 1HA5A 2NBFA 1I4XA 1EZ6A 4H44C 3P20A 1SNMA 1AFPA 1D5XC 3H0GB 4QCLA 1Y8NB 3TBIB 2EOTA 1Y1WB 1AP0A 2EXZA 3FVQA 4K5VA 1PRTC 2HQEA 4DGZA 4QUCA 5CV8A 4C56C 2K33A 1EEID 4B08A 3EVQA 4V190 1OO9B 2L4NA 3PUVA 3EROA 3J80L 2WB1B 3CRLC 4A93B 1D5MC 1WVLA 4OO1G 3TZDA 5LL6X 1LTBD 1K8MA 4LAAA 2A6HC 2K5DA 2JEBI 1FGBD 4ZUIA 5DAUA 4OO1I 2WINB 1HCZA 4ME5A 2A73B 4DAVA 4TRDA 1F9RA 2AUJD 3NBIA 2EZVA 3BG3A 5TSSA 5T1GA 1QNUA 1IKLA 4A3EB 1CHQD 2YU9B 3BVZA 2A68D 5DEHA 5JAVA 4F88A 1A3VA 2DNCA 3FPUB 3I70A 1OXVA 1VCIA 3HKZB 5JPNC 5KYLA 4P2CB 1PTOC 1LO5D 1G2SA 1R9TB 3MAQA 3J7YW 4TSSA 2NN6G 1QJOA 2BE5D 4I7ZC 2MP1A 5D65A 2XRQD 3MTSA 3HOUB 2EYOA 3KLSA 2BDNA 3BZDB 1CT1D 5G3LD 2L5TA 1F2MA 4BY7B 3T4AC 4HCEA 2J7ZA 5C5MA 2F0IA 1S4ZA 2SEBD 3OIPA 4C3JG 1QWYA 2F0QA 1RTOA 1AZQA 2PPBC 3PO2B 1Z6HA 1DXMA 3E6ZX 4NDXA 2AQ1B 1KTKA 1C8CA 4HN7A 3PO3B 2PYKA 2EYFA 1EWCA 4XTCS 1XX8A 4FXGC 3T16A 3ND9A 5KNDA 4IZ8A 4ZLTF 3VR5A 4CKCA 1TWCB 5AFWA 2K1BA 1RTNA 1B9NA 1WTOA 3X3MA 2A74C 5A35A 1T5EA 3PUZA 4CGYB 2CW0D 2Q8IB 4Q0FA 1HXYD 1WD1A 3PUWA 1IYVA 2F0MA 4HSVA 4KKUA 1TY0A 1BNZA 2B39A 3N52A 3FPPA 1I4GA 4MHEA 4HAEA 2B8FA 5C4ZA 2RQXA 5BN4A 2XWJB 4BBSB 2E2JB 1FR3A 4HMIA 4IUVA 5FO9B 2E2DC 1WTXA 1M4VA 1B9MA 2KUMA 3V05A 2JXMB 4IFDJ 1I4HA 2PW5A 2F0TA 1PRTD 1ENAA 1MBYA 5D14A 1WTQA 1J8IA 2A69C 1BBXC 3MZ5A 5JJZA 5C4HA 2EE1A 1E0BA 4OGQC 3GTGB 1BCPF 1B1ZA 3W2DA 3SHLA 1LABA 4FVMA 3C46A 1LACA 4QIWB 4C3IB 3OHXC 1PYWD 2XWBB 3AMUA 4LK1C 3URYA 1FNUA 1YNNC 4KY7A 2X6LA 3NBHA 4KHZA 5JEAH 1C4QA 2F3WA 1K8OA 3JAML 4DXGA 4XQJA 1PTOF 3J80E 4XXEA 3I90A 3EA6A 2H1EA 5C3EB 1TY2A 3DXJC 4KKTA 1SNPA 2L1BA 1A2UA 3HEJA 2DNEA 4OIKA 4RGOS 4XDXA 2NZ1D 4IUQA 1WTWA 1STEA 4XIGS 1SYBA 3SK8A 2K7VA 2WIIB 3DM1A 1Y1VB 3SXHA 2E74C 1G291 2J4XA 1S5CD 2N88A 1KDCA 1QCBD 1SYDA 1RDPD 1W6KA 5C3XA 2KCNA 3DWAA 1DYQA 3OMGA 2CVRA 2PZUA 1JC7A 2AQ3B 1FNWA 3VR3A 4EQOA 4R9WA 5I2XA 4WJWA 4Q5VA 2SOBA 5DM63 3ZYYX 3NSWA 1YNJD 1HUMA 1D5ZC 1QB5D 1I6VC 1LTSD 5FKAC 2OXPA 1ET6A 5EQ0A 2A6ED 2K32A 1STYA 3SK5A 1DOLA 3BYTB 2Z4HA 4AYBB 5FOBB 1G2TA 2FMCA 3PIO3 2RSOA 1LT5D 4K6LA 1PZID 1EYCA 2WAQB 2SDFA 1S5FD 1EFID 2B2TC 4C3HG 2XVSA 3PIP3 1Q1EA 1PFMA 4K2KA 4IALA 5J39A 1EIGA 5C0XH 2E2IB 4G57A 3RUZA 1AEXA 1LTRD 2LMCB 4EQNA 1TVXA 5CV7A 3CQZB 3HOWB 4HR7B 4R8NA 5J22A 1SE2A 5JVH3 2NVXB 2EY5A 2D9UA 4TQUS 2XRSD 2QILA 3GTQB 2WKDA 2NVQB 2KCCA 3Q24A 4E6IA 2A68C 2EYMA 3M4YA 4KJNA 4Y7NB 1B3AA 3CRKC 3SR1A 3PUXA 1V1PA 2EYHA 2NVYB 1F9QA 2EYLA 3IAYA 2A69D 3TP6A 1RD9D 2BE5C 2L55A 2KVMA 5CR3A 5I9PA 2Z8LA 4MIUA 1ILQA 3GD7A 4BA2I 1SE3A 3HOXB 2M2LA 4NP5A 2JA8B 3WOEA 4IN3A 4DAPA 5ELFA 1SNDA 5A2QE 3GTPB 4QMGA 2XSCA 3H91A 4B9WA 3SK4A 2B2TA 2JA6B 4IUUA 3A7AB 1YNND 1HQRD 3L3OC 1JCKB 1TS3A 4IFDG 1KAAA 2VB3X 1EQTA 2JE6I 4RKBA 3H6MA 1BF4A 3D4RA 1ZYRD 4IFDI 3VR2A 2F0KA 4KI0A 3A7LA 2F0DA 5C4JB 5CV5A 2ICEC 2I46A 2IT1A 3QJYA 3UI2A 4PV1C 2KQ3A 3HRZC 2OT2A 2LY7A 5M5WB 1EL0A 3KUPA 2X6GA 3JAME 5C4XB 1NAPA 4ZK9B 1PLFA 2XNAC 4IUNA 3NE5B 1GHJA 4H13C 2TMPA 3OMCA 2PQEA 2IJ0A 5EPKA 5KEEA 5IODA 3GTLB 2FJ2A 4RGTA 1M8AA 4H7BA 5JEAJ 3FMCA 3H3VC 1EOTA 4KD4A 1MGSA 2BOSA 2EJGC 4A3FB 3M4OB 1II3A 1JB3A 1DJRD 2IPKD 1Q8IA 2GA4B 2ZXPA 1KDAA 3NTKA 1STNA 2IX3A 5K36H 2EJMA 4DXFA 4DA2A 4QB4A 3MXUA 1FYCA 5M3FB 5ELDA 5ELCA 1E2ZA 3EJIA 1OXXK 5FO8B 2I07B 1G91A 4NW2A 1K83B 3S9WA 3CKIB 2D5DA 3G7LA 4ZQ3A 1CI3M 5J1ZA 1CZWA 1TWGB 1CK1A 3KF8A 4PNYA 1JICA 2VXWA 2OF1A 4ZYSA 2R61A 1D2BA 1GXDC 4K6DA 4RWSC 5KNCA 2NWGA 5I9OA 1GUNA 1JWSD 4BS9A 2F0WA 4V0BA 3C1EA 2G9HD 4XYQA 4DU9A 1IHZA 4RH6A 1TT2A 3S1MB 3S2DB 5ELBA 4OO1H 1RHPA 1DONA 3D4WA 5G3LF 3ND8A 5COYA 2X69A 1SNCA 2R92B 2LKVA 1S5ED 2B2UC 5JVG3 3RLFA 3R93A 4O1NA 1CQFA 4KY6A 2O2LD 3MWYW 4YIJA 5C0XJ 1SMYC 2F0HA 1BXTA 2IW3A 2DY7A 3X3NA 2F0NA 1EY8A 3SDZA 5KRUA 1TS2A 3K59A 5I6WA 1A6XA 1T5XD 1GJXA 2XIWA 1V8QA 2JA5B 2NN6H 1TU2B 1PFBA 1SYGA 4RGMA 5IGGA 4RHSA 1O78A 1F9PA 1YNJC 2PMZB 1TS4A 2PO4A 4CBVA 4A3DB 4A3GB 1A3TA 1BO0A 3CU7A 4UDUC 2RVLA 2A6EC 1G8ZD 3A54A 5EPJA 1LT3D 3OIQA 4ZAIA 1RCVD 2EDGA 1PZKD 3BYYB 1O7YA 3TMEA 3K6OA 2MJ8A 3MFYA 1KABA 2B8GA 2IL8A 2EJFC 2KOLA 3HOZB 3DWPA 2PCFB 2NYZD 1C48A 3KLRA 3FDTA 3QB3A 3CHBD 4RCOA 4HCSA 3OWFA 1SJHD 1CTMA 1Y8OB 4KY5A 3GQBA 2ZXRA 4IUTA 4TKOB 2B2UA 1PRTF 2R3ZA 1H9SA 4RCNA 4QUFA 1EQVA 1U4MA 1H9RA 5C3WA 2E2HB 1DD2A 1SBBB 3QOLA 3D3RA 3TP7A 1DOMA 2O5IC 1Q1BA 5A2QL 1EY9A 2DN8A 2KA7A 3M7NA 2R7ZB 3OOCA 3KBXA 3R3OA 5EBCA 2F0EA 2QDBA 3Q0AA 4A3BB 2G9DA 3DEPA 3S1RB 2QKIC 1A15A 2Q8RE 1MSGA 3H09A 1SDFA 3NUCA 4C1NI 3E5SA 4DNRB 3NQTA 3G6JB 1QILA 5DNFA 2AWNA 3MFGA 1F9SA 4XQQA 5LL6S 1TQOA 3TP8A 1I4RA 4A3JB 1PXUA 4I65A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BR9 A;  1BQQ T;  3MA2 B;  5FO8 B;  2I07 B;  3CU7 A;  4FXK C;  3CKI B;  1JC7 A;  5JPM C;  1XWE A;  2E2D C;  2WII B;  3OHX C;  5FO9 B;  2ICE C;  3G6J B;  2B39 A;  5FOB B;  5FO7 B;  3KLS A;  2XWB B;  3V96 A;  2WIN B;  1UEA B;  3FRP B;  2A74 C;  3L3O C;  3HS0 C;  1BUV T;  2A73 B;  2TMP A;  2QKI C;  1JB3 A;  4ILW A;  3HRZ C;  4FXG C;  3I70 A;  1UAP A;  1OO9 B;  2XWJ B;  3T4A C;  1D2B A;  2J0T D;  1GXD C;  1PXU A;  5JPN C; 
#chains in the Genus database with same CATH topology
 1GUW A;  4L5Q A;  1O80 A;  4X6A H;  1ZYR C;  3E3X A;  1BDO A;  1JWM D;  1RF2 D;  3C3L A;  1XWE A;  1N33 Q;  5HY6 A;  1TWF B;  2NVY H;  2A19 A;  4ABN A;  2RHQ B;  1F77 A;  2IX0 A;  2ID0 A;  3L7Z C;  5KIX A;  3PMF A;  1A63 A;  3UDI A;  2F4V Q;  2PNR C;  4RGN A;  1FD7 D;  1PTO H;  3JC6 6;  1TII D;  4XT1 B;  2B2V C;  1HR0 W;  2R93 H;  4C3J B;  2KEE A;  4F87 A;  2VB2 X;  2O4X A;  1HR0 Q;  3I91 A;  2JYO A;  4NXN L;  4A3I B;  1X3E A;  1SJE D;  2IWH A;  3K5M A;  2D2C C;  2K28 A;  4R4I A;  3LNN A;  1GUG A;  4P74 A;  3STB C;  4JC0 A;  1LT6 D;  3K0Y A;  4OON A;  4RHR A;  1B4O A;  1B53 A;  4GLX A;  1GOZ A;  1EY4 A;  1N34 Q;  3S1N B;  1HNX Q;  1JOR A;  2F0S A;  3W5O A;  4OEM B;  5C44 G;  2Y0S B;  3GTO H;  1SMY D;  4PG3 A;  3NTI A;  4CJ0 B;  4DR3 Q;  2JA6 H;  4X3S A;  1J5E L;  4A3K G;  3PIO A;  1VDZ A;  3BZK A;  4NMZ A;  4BXX G;  1QVF A;  4FXD A;  3VYS A;  4X3K A;  5K5P A;  1WTH A;  4WJ4 A;  3T1H Q;  2DGY A;  2SNM A;  3UE1 A;  1NR4 A;  1KC8 C;  1GUT A;  2V4D A;  2VUM G;  1PV4 A;  1PH4 A;  3OTO L;  1EYD A;  2MGS A;  5C5L A;  4QIW E;  5CV4 A;  5M3M B;  3UDX A;  3TSS A;  1GVP A;  1VMP A;  4DV5 Q;  2Q2H A;  3QG1 A;  1J9O A;  4DV7 L;  3QR8 A;  3Q22 A;  5M9O A;  4JBW A;  1NMF A;  2RDG A;  1OXS C;  1PH6 A;  3TQY A;  2K5V A;  5FLX E;  1E2W A;  3T51 B;  2WAC A;  1HNZ L;  2F0F A;  3ITP A;  5ISR A;  1AZP A;  1EEF D;  1EU4 A;  3SK6 A;  2Z4I A;  1K8G A;  4J15 A;  1EYA A;  3Q6S A;  5FLM G;  1DZ1 A;  3EQL C;  4AQY Q;  4GNX A;  4DK3 C;  3MXP A;  4J6H A;  5E4X A;  1ET9 A;  1S5D D;  3HG9 A;  2CQO A;  2QGQ A;  1G6Z A;  1KHI A;  2BA1 A;  1ZXT A;  5C0X I;  4ZKC B;  3CME A;  1I4Q A;  2D0O A;  1VQ7 A;  4DK1 A;  4KTA A;  1XJV A;  2B2V A;  4POG A;  1SNQ A;  3GTL H;  3SGI A;  4DV4 L;  5C6A A;  2WKC A;  1O7I A;  3NHH A;  2O5J C;  4FP5 D;  5DM7 3;  4N8X 1;  3SE0 A;  3A8I E;  1Y1W G;  4B3R L;  2QEJ C;  1BCP B;  2RKS A;  4DAY B;  2ZTE A;  2LS0 1;  4BBR B;  4A3F H;  2P5Z X;  1STA A;  1PFN A;  1YEZ A;  3Q8D A;  4C3H H;  1QOH A;  3AB9 A;  2F1M A;  2MO0 A;  2QF7 A;  2Y0S E;  3NTH A;  4JI7 Q;  3P75 A;  2R6G A;  3QWN A;  1E1T A;  3MHB A;  1WOC A;  1SAP A;  1K3R A;  4ILW A;  4RG1 A;  4DUZ L;  2UU9 Q;  2Q2T A;  1UAP A;  1KNA A;  2HIX A;  3J81 L;  4L6T B;  1V1Q A;  1U4L A;  1CSP A;  2WB1 G;  4PMC A;  1YJ9 A;  4A93 G;  4IPH A;  2BA0 A;  4NB3 A;  4M1U B;  5CMD A;  2AWO A;  2Z0S A;  4B3T L;  1PTO B;  1UE1 A;  1JB7 A;  1E2V A;  3QO2 A;  2R93 B;  4JI5 L;  4LF4 L;  2RCN A;  1U4P A;  3MXN A;  4JI0 L;  5GRO A;  5BN5 A;  4KN4 C;  1U4R A;  3TN2 A;  3GP7 A;  1D6E C;  1K83 H;  3J7A F;  3QIA A;  5KYI A;  4AYB E;  1WCM H;  4UPA A;  1MIU A;  2C9O A;  1OXT A;  1RJT A;  4QF4 A;  2L0C A;  1W6J A;  2RDH A;  3I4M H;  3S1Q H;  2LFN A;  2K5Q A;  1EY7 A;  2WAQ E;  1K0S A;  3F8T A;  4A3E G;  1SXT A;  3GTO B;  1QZG A;  5IP9 H;  4EX5 A;  4JBM A;  2Q8T A;  4JV5 Q;  4LJZ C;  2M00 A;  4GN3 B;  4J1M A;  4LFB Q;  1U9R A;  1KRS A;  4G4K A;  2EVB A;  1X3Q A;  3FKI G;  3HKZ G;  1WD0 A;  3NEN A;  2Q2U A;  3KLS X;  3E0J A;  3B6Y A;  4N9P A;  5LMN L;  4KHV A;  1EY6 A;  3S1M H;  3S2D H;  1Y8P B;  3IL8 A;  4K0K Q;  3I8Z A;  4L8J A;  5EKL A;  2KEC A;  4OWW B;  4K14 A;  2L12 A;  5H1S E;  2B63 G;  3BVM A;  4CKE A;  4H0L C;  2DY8 A;  3G48 A;  2FIN B;  2ALY B;  2WFW A;  4LUZ A;  1I3Q H;  3J81 i;  5C44 B;  2F0J A;  4BY7 G;  1SEB D;  4QGU A;  1BR9 A;  4A3K B;  4YY3 L;  5M5Y H;  1CA6 A;  4IFD H;  1HTP A;  3PO2 G;  1PVO A;  1ENF A;  2NTT A;  4GKJ L;  5ELO A;  4LWC A;  3S15 B;  4IPD A;  3I73 A;  4OX9 Q;  2VUM B;  3NBH B;  1EIY B;  4U68 A;  2I0Q A;  1D8L A;  3PO3 G;  4L5R C;  1QNK A;  3T1Y L;  4JI8 L;  4HTH A;  3GO5 A;  4NPS A;  2RA4 A;  5NUC A;  2JEA I;  5GAD C;  3KYH C;  5I6Y A;  3IFD A;  3V2T A;  1XPU A;  1ONL A;  3RN5 A;  4G7Z C;  3P1H A;  2VZA A;  3CCS A;  1GM5 A;  3OPO A;  2EPB A;  2OQ0 A;  2YTX A;  5CGK A;  2HCC A;  4R1J A;  3HGB A;  3FRP B;  5FK9 C;  3HS0 C;  4ZRZ A;  5IT9 L;  1XNQ Q;  1SYE A;  1B50 A;  4C3H B;  2EY2 A;  1VQ6 A;  3GTJ B;  3M7G A;  3A5U A;  4A4I A;  4IOA A;  3I4O A;  3TZU A;  4MN3 A;  3RD4 A;  1Y69 U;  3RZO B;  1A2T A;  3R2T A;  1SNO A;  2NB0 A;  4GS3 A;  1BOS A;  2IX1 A;  3M85 A;  3VA5 A;  4UP9 A;  1IKM A;  1IW7 D;  3P7J A;  4KV6 A;  2L11 A;  2J0T D;  3K7A B;  3SEB A;  3HOZ H;  4BBS G;  3UE0 A;  3CCQ A;  1BQQ T;  1YNX A;  1JOK A;  1EZ8 A;  4DV4 Q;  4X3T A;  1HUN A;  2RDF A;  3MVV A;  1SYC A;  5JPM C;  2MPM A;  3D31 A;  3VR6 A;  1WCM B;  3J81 j;  2F4I A;  1X3F A;  3KJP A;  3NPP A;  1A3U A;  1CM9 A;  3I4M B;  3S1Q B;  1CA5 A;  1PH2 A;  2FHT A;  4HMJ A;  2MNA A;  1I50 H;  1STB A;  1Z7T A;  1EY0 A;  1N36 L;  1Q12 A;  1Z47 A;  5CV9 A;  1ESR A;  4HJ8 A;  1XXG A;  4NKL A;  4JK1 C;  1YBY A;  2E2H H;  1IBK L;  1K8A C;  3VA7 A;  3K8A A;  5IGE A;  2F03 A;  1CFM A;  3LX0 A;  4A3C G;  4GN5 A;  3J80 c;  1UEA B;  1DOK A;  1RL2 A;  1NTG A;  3MC0 B;  1BCP C;  3L2P A;  4B3T Q;  2L15 A;  1HRJ A;  2ICI A;  1E24 A;  1JJG A;  1ENC A;  3OW2 A;  4KN7 C;  1X56 A;  4MTN A;  3GTM H;  3MXG A;  3K80 C;  2HCI A;  4R8I A;  2KED A;  1ML0 D;  1L0Y B;  4A3B H;  1I3Q B;  5IGD A;  1TR5 A;  3S1R H;  4C3I G;  4BY1 H;  1IL8 A;  2F4V L;  1H9K A;  4BWG B;  2E5L L;  2VY3 A;  5M5Y B;  4RKL A;  1WTR A;  3M3Y H;  3CCM A;  3I4L A;  1CQV A;  2JA7 G;  1HR0 L;  3FKI B;  3NP8 A;  4CDD C;  4OL7 A;  1YZ6 A;  4GLA C;  1CZG A;  5I4D A;  5IGF A;  2K5N A;  2ASB A;  2HIV A;  3J81 E;  2F0V A;  2K6A A;  4CKB A;  1EWI A;  1VQD A;  1JWU D;  5FLX L;  5C3E G;  3HKS A;  3HOV H;  4MTK A;  2NVT B;  1PHJ A;  4C2M B;  1DCZ A;  1H9M A;  2NN6 I;  2BCO A;  4FNF A;  2B63 B;  1N34 L;  4DV3 Q;  1HNX L;  2OEO A;  1I6H H;  3CCJ A;  1R4P B;  2KEN A;  3KDF B;  2G5D A;  1V1P B;  1WTP A;  4ODG A;  2B29 A;  4DR3 L;  1RIP A;  4J8Q A;  5BN3 A;  1LTA D;  4MNO A;  3J80 i;  3D6W A;  1Q46 A;  1AW7 A;  1IL2 A;  3C1F A;  2KHI A;  2RBM A;  3ERQ A;  4DR4 Q;  3T1H L;  2MHV A;  5KGU A;  4RFB A;  3I4N H;  1V1O A;  4EQP A;  1HPC A;  4Y52 H;  2CHB D;  3F1Z A;  1VMC A;  1GO3 E;  2BH8 A;  4YY3 Q;  3RN2 A;  1D1K A;  2CH4 W;  3N6R A;  2L9H A;  1IBM Q;  2C5C A;  1BUV T;  4CJ2 C;  1XYI A;  1TS5 A;  1SRU A;  4GKJ Q;  1JOQ A;  4DR1 Q;  3W1B A;  3HOY G;  1X3P A;  4ZKB B;  1HHV A;  2VQE Q;  5EKI A;  4AIM A;  1AH9 A;  4DUY Q;  2PNH A;  2HDM A;  3K57 A;  4UAI A;  1SLJ A;  3D6C A;  3LWU A;  4DAM A;  4DAY A;  5IYB G;  4C1N K;  4Z9C B;  4HJ7 A;  1S72 A;  4TVA B;  1F2Y A;  1LTT D;  4G7O C;  3S1N H;  3RLO A;  3BDL A;  3FEW X;  1VQB A;  2MFI A;  4EQ5 A;  3U4Z A;  2UXB Q;  4YCW A;  5IOC A;  4OHJ A;  2YTV A;  3GV6 A;  4DR6 Q;  1X54 A;  1UE5 A;  2TSS A;  1PDQ A;  1JOO A;  3OSO A;  1GUO A;  1SE4 A;  2NUC A;  2PQA B;  1F2Z A;  2RCF A;  2M9V A;  5CBE E;  4U67 3;  4XYO A;  5BR8 L;  1I50 B;  4IPC A;  2F0G A;  4A3M H;  1KD1 C;  1FNV A;  3VYU A;  3EFX D;  1UNS A;  3NK9 A;  3G71 A;  4ULL A;  5CYU A;  4KMU C;  2B2W C;  1SFO B;  4JG2 A;  1AE2 A;  4FO2 A;  3BS1 A;  1EYG A;  2K01 A;  4GZY C;  2EYP A;  4IUR A;  3ICE A;  1B44 D;  4X62 Q;  1ICW A;  4OIJ A;  3DMU A;  3HZX A;  1CHP D;  1JJ2 A;  2KCM A;  3W1G A;  3PUY A;  4GLV B;  2UU9 L;  3RR5 A;  3VR4 A;  3GTM B;  3D8G A;  4IUP A;  1OXU A;  4BY1 B;  3KK7 A;  5IT9 E;  2E76 C;  1L0X B;  4DR2 Q;  3MA2 B;  3HOW G;  4PQX A;  3GTK B;  2WV6 D;  3M3Y B;  1N36 Q;  4RA8 A;  5KNB A;  5JEA G;  4FF3 A;  4RAU C;  2ZTD A;  4WJ3 M;  3E9I A;  4P73 A;  2CFM A;  3S2H H;  2SNS A;  2EY6 A;  2PW7 A;  5IIF A;  1IBK Q;  2QW7 A;  3K58 A;  1S5B D;  1EY5 A;  3LWE A;  1M1K C;  3CCU A;  3H94 A;  3HOV B;  2QEX A;  1ILP A;  2F3V A;  3KLW A;  4BBR H;  1F2L A;  1UWV A;  1I6H B;  3CF5 A;  1KDB A;  1LT4 D;  5CBA E;  1O7Z A;  1VQ5 A;  2A6H D;  2DUD A;  3IKJ A;  4FYD A;  2RF4 A;  1N9W A;  4JV5 L;  4GNX C;  4LFB L;  4QQB X;  1MJC A;  3TP5 A;  4IPG A;  3I4N B;  1BCP D;  3I56 A;  3GV3 A;  2JA7 B;  5D3D A;  5E1F A;  4B9X A;  3QOJ A;  2K03 A;  1SE8 A;  3HOX G;  4PMB A;  2JJQ A;  2E5L Q;  3DEO A;  1UUP A;  2JA8 G;  1GHK A;  3A8K E;  1EOV A;  1HFG A;  4K0K L;  4UHV A;  4IO9 A;  1JQY D;  2ZTC A;  4XQN A;  5T1I A;  2UXC L;  1C0A A;  2ENB A;  2KBN A;  4GKK Q;  2LXK A;  1L0W A;  1JE4 A;  3K5N A;  2B2W A;  2AQ2 B;  2K05 A;  2I5M X;  2N55 A;  1B70 B;  3R8B A;  4KHP Q;  3BJU A;  2B2Y C;  4HED A;  3JAM c;  3I72 A;  3S16 H;  5COR A;  1TWH H;  1LV9 A;  1HH2 P;  4L63 B;  4N9T A;  4HJA A;  3U58 A;  2MUY A;  4KD3 A;  4GOP B;  2VNU D;  1PTO D;  3MEH A;  1HZB A;  4DK0 A;  5L37 A;  5M5X B;  1H9J A;  4HSP A;  1BBU A;  2LSS A;  4OX9 L;  1QG7 A;  4LFA Q;  5HUR A;  1LLR D;  1SSO A;  2F0P A;  2CQA A;  1EWH A;  1O7L A;  1HA6 A;  4FF2 A;  3OWE B;  1D1I A;  2XN9 C;  1X32 A;  4KKS A;  3PIP A;  3HOY B;  4A3M B;  1PH8 A;  1HQM C;  4FF1 A;  3A0J A;  3M4P A;  4DN4 M;  3H15 A;  1MSH A;  2LXJ A;  3Q23 A;  2MO1 A;  1KLU D;  5EGT A;  3NXW A;  5LMU Q;  3A55 A;  2PZT A;  3T53 B;  3AU7 A;  1XNQ L;  2Z1C A;  3D0F A;  2YYZ A;  5GAG C;  3CC7 A;  5C44 H;  1PRT B;  5CC4 A;  2JSO A;  4G7H C;  1TXY A;  2EIF A;  4A3K H;  4X3U A;  1TKW B;  4BXX H;  1ROD A;  3S17 H;  3BVG A;  1TWA B;  2EXD A;  1IW7 C;  4DNT B;  1VS0 A;  3IFT A;  2EYJ A;  1MKH A;  1PH9 A;  3HP3 A;  1STG A;  5C0X G;  3S15 H;  2HD3 A;  2VUM H;  3NQI A;  5D3I B;  4IQZ A;  4LNQ A;  5IYC G;  1VQ8 A;  1XPO A;  1EUJ A;  4M8A A;  3OW7 A;  1JT8 A;  2D62 A;  5GAH C;  4LF8 Q;  4K5X A;  1HZ9 A;  5BR8 Q;  1QE6 A;  3W3A A;  4DK6 C;  1IYU A;  3TDQ A;  2D0P A;  1YIJ A;  1EQR A;  3H0G G;  1I5F A;  3S2H B;  3T56 B;  1V9P A;  2R7F A;  3RZD H;  3KBG A;  1PMR A;  2B2Y A;  4FXK C;  3A8J E;  4X65 L;  4NXM Q;  2JK8 A;  5FLM H;  4K8J A;  3S14 H;  5E4W C;  2FFK B;  1IBL L;  3GTJ H;  5HGT A;  5IY0 A;  1EIF A;  4JYA Q;  2PZW A;  2A5H A;  4PMW A;  3RZO H;  1WYD A;  3F2U A;  2VW9 A;  4F7X A;  5M3F G;  3KF6 B;  2F0U A;  1PH1 A;  1RKN A;  1QUQ B;  1WTV A;  4LF6 Q;  2KHS A;  4X66 Q;  2KJX A;  1VQE A;  3DHQ A;  3L9A X;  2GVB A;  5EJW A;  5IWA Q;  2RSN A;  3AFP A;  3K7A H;  5CV6 A;  2CWP A;  1Y1W H;  4DF7 A;  4KJO A;  4LMQ D;  3VYT A;  3A56 A;  1PZJ D;  2BDO A;  2AHO B;  1LTI D;  1ESF A;  3K5O A;  2ZXO A;  3NWT A;  1STH A;  5IP7 G;  3DM3 A;  4CHT B;  4WOR A;  3DWQ A;  3S16 B;  1Y14 B;  1TWH B;  3BU2 A;  4EGV A;  3U9O A;  2UUB L;  1H9S B;  4UY8 C;  4R4T A;  1NNX A;  1EIH A;  3RMH A;  1P16 A;  5EBD A;  3D4D A;  1VF5 C;  2HHH Q;  5I2Y A;  3PV0 A;  1V43 A;  2F0L A;  2ZT9 C;  1NUC A;  2JP1 A;  3J7A 5;  1I4P A;  4BA1 I;  4A93 H;  5EKK A;  4EVO A;  1DM0 B;  2HUG A;  1Q81 C;  1VF7 A;  4ID6 A;  2FMM A;  1B2T A;  3O13 A;  4K5W A;  4JPB W;  2XGT A;  1WJJ A;  2K5W A;  4DV3 L;  3WOF A;  5IYD G;  2F0O A;  2H4O A;  2R92 G;  2QCP X;  4ZUJ A;  5EPL A;  4XT3 B;  2K04 A;  3HOU G;  1A8V A;  5JOB A;  4YCV A;  2UXC Q;  4LUV A;  1ZEQ X;  1ZKO A;  3J7A V;  3SVM A;  3I3C A;  4WRD A;  4WFN 3;  4DR4 L;  1NCV A;  4KK7 A;  4RMF A;  3WDN A;  1AN8 A;  4LW1 A;  4A3E H;  3C2P A;  1KLG D;  1EU3 A;  4DFA A;  2YU9 H;  2NTS A;  3BDC A;  3S17 B;  3CAM A;  4JI6 Q;  5F2D A;  5LHY 1;  1Z9F A;  1IBM L;  3BDO A;  1Q3L A;  1JR0 D;  3FKI H;  4DR1 L;  4O42 A;  1X65 A;  3NWS A;  1R9T H;  2VQE L;  5JJL A;  4DUY L;  2JA5 G;  1R4Q B;  3U9S A;  3T13 A;  2CW0 C;  4F8M A;  1SYF A;  5IGC A;  1DGS A;  2R7D A;  1MI2 A;  1HFN A;  2NVT H;  1X3G A;  4C2M H;  4K2L A;  4HID A;  2B63 H;  4A3D G;  4A3G G;  4K8I A;  1MJE A;  4FF4 A;  3R2I A;  2F3I A;  2JA9 A;  1NY4 A;  4S3S A;  3VYR A;  4GOP C;  2GVA A;  2UXB L;  3K5L A;  2I5L X;  1Q90 A;  3RZD B;  4LF5 L;  5FO7 B;  4BY7 H;  1GUS A;  5ELE A;  3V96 A;  4DR6 L;  5E3F A;  1KNE A;  1XTC D;  1NR2 A;  2WP8 J;  4R4Q A;  5IGB A;  3ONA B;  1JJC B;  2AUK A;  2EY1 A;  3PSI A;  1LTG D;  1NSN S;  3DUZ A;  3PO2 H;  1MD2 D;  2E75 C;  4CJ1 B;  3S14 B;  4P75 A;  2HDL A;  2N49 A;  3TRZ A;  2NZO A;  1HTL D;  5K36 G;  1HA5 A;  2NBF A;  1I4X A;  1EZ6 A;  3PO3 H;  3M4Q A;  1XTD A;  4H44 C;  3P20 A;  1QZH A;  1SNM A;  1J6Q A;  1AFP A;  1D5X C;  3H0G B;  4QCL A;  4JI1 Q;  4X62 L;  1Y8N B;  1D7Q A;  3TBI B;  4LFC Q;  4DV2 L;  2EOT A;  1Y1W B;  1AP0 A;  2EXZ A;  3FVQ A;  3HFZ B;  2ZJR A;  4K5V A;  1PRT C;  5FJ8 G;  2JN4 A;  2HQE A;  2UXD Q;  1BBW A;  2CWA A;  1KAW A;  4DGZ A;  1VQI A;  4JCV E;  4QUC A;  5CV8 A;  4C56 C;  2K33 A;  4X65 Q;  3CCV A;  1EEI D;  4B08 A;  4DR2 L;  2IHF A;  2GN5 A;  3EVQ A;  4V19 0;  1OO9 B;  2L4N A;  3PUV A;  1IBL Q;  1ASY A;  2CKZ B;  3ERO A;  3J80 L;  2EQS A;  2WB1 B;  3CRL C;  3ZJY C;  2R7Z G;  4A93 B;  5IE8 A;  4OXP A;  1D5M C;  5ELN A;  1WVL A;  2PI2 E;  4OO1 G;  4X64 Q;  3TZD A;  5LL6 X;  1HZA A;  1LTB D;  1XPR A;  2YTY A;  4A3L G;  1K8M A;  4LAA A;  2A6H C;  2K5D A;  1SFO H;  2JEB I;  4BBS H;  1FGB D;  2E2J H;  4ZUI A;  5DAU A;  4OO1 I;  2WIN B;  3AQQ A;  1L1O B;  1HCZ A;  4ME5 A;  4JBK A;  2A73 B;  4UP7 A;  3FHW A;  1LYL A;  3TEH B;  1Q7Y C;  4DAV A;  4TRD A;  4GOP A;  1F9R A;  2AUJ D;  3NBI A;  2EZV A;  2B3G A;  2K50 A;  3BG3 A;  5TSS A;  5T1G A;  1Q86 C;  1QNU A;  1IKL A;  4A3E B;  2E8G A;  1CHQ D;  2YU9 B;  3BVZ A;  2A68 D;  5DEH A;  5JAV A;  4F88 A;  2UUB Q;  1A3V A;  4DNI A;  4UP8 A;  3GTK H;  3CMA A;  1E1O A;  2DNC A;  3FPU B;  3I70 A;  4A3J G;  1OXV A;  1VCI A;  3HKZ B;  4YWK A;  5JPN C;  5KYL A;  4P2C B;  1PTO C;  4A3C H;  4GKK L;  1LO5 D;  1G2S A;  4HJ9 A;  1R9T B;  1EFW A;  3MAQ A;  2H5X A;  3J7Y W;  4TSS A;  4KHP L;  2NN6 G;  1QJO A;  2BE5 D;  4I7Z C;  3G6E A;  4PZ6 A;  2MP1 A;  5D65 A;  2XRQ D;  3MTS A;  3HOU B;  2EYO A;  4LF9 Q;  3RLN A;  3KLS A;  2BDN A;  3BZD B;  1CT1 D;  5G3L D;  1NE3 A;  2L5T A;  4C3I H;  1F2M A;  4LF7 Q;  4BY7 B;  3T4A C;  4HCE A;  2J7Z A;  5C5M A;  2F0I A;  4LFA L;  1S4Z A;  2SEB D;  3OIP A;  4C3J G;  1K0R A;  1QWY A;  2F0Q A;  1UEB A;  1VQL A;  1E22 A;  1VQK A;  1RTO A;  1AZQ A;  2PPB C;  3PO2 B;  1Z6H A;  4A3I G;  1DXM A;  3ULJ A;  3CCR A;  3E6Z X;  2JA7 H;  4NDX A;  2AQ1 B;  1CKN B;  3MXN B;  2IHE A;  1KTK A;  1C8C A;  2UUC Q;  4HN7 A;  3PO3 B;  1Y1V G;  2PYK A;  2EYF A;  1EWC A;  2ZJP A;  4XTC S;  1XX8 A;  1S40 A;  4FXG C;  2UUA Q;  3T16 A;  5C3E H;  3ND9 A;  2OTL A;  5KND A;  4IZ8 A;  5LMU L;  2AMC B;  4OWX B;  3KFU A;  4ZLT F;  2Y0S G;  3VR5 A;  4QJF A;  4CKC A;  1TWC B;  5AFW A;  3ER0 A;  3CW2 C;  2K1B A;  4JI4 L;  1RTN A;  1B9N A;  3A5Z B;  1WTO A;  5M5X H;  3X3M A;  2A74 C;  1MHW C;  5A35 A;  1T5E A;  3PUZ A;  4CGY B;  2CW0 D;  4JVZ A;  2Q8I B;  4LF5 Q;  4Q0F A;  5J3B A;  5M3M G;  1HXY D;  4JI3 Q;  4HIO A;  1WD1 A;  4YCU A;  4LF8 L;  3PUW A;  1IYV A;  1YVC A;  2F0M A;  2N8N A;  4HSV A;  4KKU A;  1TY0 A;  3H3V H;  3HOY H;  1XNR Q;  2RHS B;  1BNZ A;  3CP0 A;  2B39 A;  3N52 A;  3FPP A;  1PYB A;  1I4G A;  4MHE A;  4HAE A;  4AYB G;  2B8F A;  3KOJ A;  3S24 A;  1NBW A;  5C4Z A;  2RQX A;  5BN4 A;  5IYB H;  2XWJ B;  2HQL A;  4BBS B;  2WAQ G;  3BZC A;  2E2J B;  1A0I A;  4NXM L;  1FVI A;  1BKB A;  1FR3 A;  1UE7 A;  4HMI A;  4DV1 Q;  4IUV A;  4DV2 Q;  4JOI C;  5FO9 B;  2E2D C;  1WTX A;  4JYA L;  1TWA H;  1M4V A;  1B9M A;  1M90 C;  2KUM A;  1C7Y A;  3V05 A;  2JXM B;  4IFD J;  3TS0 A;  1Q8K A;  1I4H A;  1PH5 A;  2PW5 A;  4LF6 L;  4X66 L;  2F0T A;  1JE5 A;  1PRT D;  5IWA L;  1ENA A;  1MBY A;  2F52 A;  1QVC A;  5D14 A;  1C9O A;  4A76 A;  1WTQ A;  1OTC A;  2NZH A;  1J8I A;  4OEL B;  2A69 C;  1G51 A;  1BBX C;  3MZ5 A;  4I7A A;  5JJZ A;  5C4H A;  2EE1 A;  1E0B A;  4OGQ C;  1U0L A;  3GTG B;  1P8L A;  1B3Q A;  1H95 A;  2ZJQ A;  3M9B A;  1BCP F;  1B1Z A;  3W2D A;  3SHL A;  2HHH L;  5JJI A;  1LAB A;  1SR3 A;  4FVM A;  4O2D A;  2E2I H;  3C46 A;  1LAC A;  4PZ7 A;  4QIW B;  4C3I B;  1WI5 A;  1GD7 A;  3OHX C;  1PYW D;  1SN8 A;  2XWB B;  3CQZ H;  4MZ9 A;  3AMU A;  2R93 G;  2ZM6 Q;  3HOW H;  4LK1 C;  3URY A;  1FNU A;  1YNN C;  4KY7 A;  2DJG C;  2X6L A;  1PFS A;  3NBH A;  4KHZ A;  5JEA H;  2PI2 A;  3GTQ H;  1VQ9 A;  1C4Q A;  1NMG A;  2F3W A;  3JAM L;  4DXG A;  1K8O A;  1T9H A;  2NVQ H;  4XQJ A;  1FL0 A;  1K28 A;  1PTO F;  3CD6 A;  1L1O C;  3J80 E;  4XXE A;  3I90 A;  3EA6 A;  4Y7N H;  2H1E A;  4B3S Q;  5C3E B;  1TY2 A;  3DXJ C;  4KKT A;  3KF8 B;  1SNP A;  2V1C C;  2JA6 G;  2L1B A;  1A2U A;  3HEJ A;  1HNW Q;  2DNE A;  4OIK A;  4RGO S;  3CC2 A;  4XDX A;  4JOI A;  3CPF A;  2NZ1 D;  3ULP A;  4IUQ A;  4JI6 L;  5DLQ E;  1WTW A;  1I94 L;  1STE A;  4XIG S;  4JI2 Q;  2IY5 B;  1SYB A;  3SK8 A;  4DR7 Q;  2K7V A;  3HOX H;  1YI2 A;  2WII B;  2JA8 H;  3DM1 A;  1Y1V B;  3SXH A;  2E74 C;  1G29 1;  2J4X A;  1S5C D;  2N88 A;  1KDC A;  1QCB D;  1Q82 C;  1E3P A;  1SYD A;  1HZC A;  3GTP H;  4CDC C;  4YHH Q;  1RDP D;  1W6K A;  3CCL A;  5C3X A;  2KCN A;  4YWM A;  3DWA A;  1DYQ A;  3OMG A;  2CVR A;  2PZU A;  1JC7 A;  3EBE A;  5C4X G;  2AQ3 B;  1FNW A;  3VR3 A;  4EQO A;  3UDG A;  2N78 A;  4R9W A;  5I2X A;  3PF4 A;  3F2D A;  4WJW A;  4Q5V A;  1K73 C;  2SOB A;  5DM6 3;  3WWV A;  3ZYY X;  3EIV A;  4JI4 Q;  3NSW A;  3RNU A;  1YNJ D;  1LTL A;  1QVG A;  3JAM i;  5C4J H;  1IYJ B;  1HUM A;  4KLK A;  4QL5 A;  1D5Z C;  2N3S A;  1QB5 D;  1I6V C;  1LTS D;  5FKA C;  4B3M Q;  2OXP A;  1ET6 A;  1HJP A;  5EQ0 A;  2A6E D;  4R4C A;  2K32 A;  3K81 C;  1STY A;  3SK5 A;  1DOL A;  3BYT B;  2Z4H A;  1YHQ A;  1VQA A;  4AYB B;  1LUZ A;  5FOB B;  4JI1 L;  1G2T A;  2FMC A;  3PIO 3;  5M5W H;  4LFC L;  2RSO A;  1LT5 D;  1L1O A;  3E9H A;  3PF5 A;  4K6L A;  1CKM A;  1PZI D;  5C4X H;  1EYC A;  2WAQ B;  4A3F G;  2SDF A;  1S5F D;  1EFI D;  2B2T C;  2Z9H A;  4C3H G;  2XVS A;  3PIP 3;  3NEM A;  2UXD L;  2ATW A;  1Q1E A;  1PFM A;  4DV6 L;  4K2K A;  5AJ3 L;  4IAL A;  1XMO L;  2VQF L;  1SMX A;  5J39 A;  1EIG A;  5C0X H;  2E2I B;  4G57 A;  1YIT A;  3RUZ A;  2OQK A;  1AEX A;  1LTR D;  3K0X A;  5IYC H;  4DV0 Q;  2LMC B;  4EQN A;  3A74 A;  1TVX A;  4X64 L;  3VDY A;  5CV7 A;  3CQZ B;  4LUO A;  1W2B A;  1YHB A;  3HOW B;  4HR7 B;  4R8N A;  5J22 A;  1SE2 A;  1U5K A;  5JVH 3;  1EQQ A;  2NVX B;  2EY5 A;  4APV A;  2D9U A;  2CH4 A;  4TQU S;  2XRS D;  3H0G H;  4AH6 A;  2QIL A;  3M4O H;  2K4K A;  3GTQ B;  4CDF C;  2WKD A;  2NVQ B;  4ALP A;  1WCM G;  2KCC A;  3Q24 A;  4E6I A;  2JQO A;  2A68 C;  2EYM A;  3M4Y A;  3I4M G;  4KJN A;  4Y7N B;  1B3A A;  3CRK C;  3SR1 A;  3PUX A;  3KDF A;  1V1P A;  2EYH A;  2NVY B;  1F9Q A;  2EYL A;  5IP9 G;  3IAY A;  1W3S A;  2DJF C;  2A69 D;  3TP6 A;  1RD9 D;  2BE5 C;  2L55 A;  2KVM A;  5CR3 A;  5I9P A;  5M3F H;  4YWL A;  2Z8L A;  4MIU A;  1ILQ A;  3J81 c;  2FXQ A;  1CKN A;  3GD7 A;  1N32 L;  4BA2 I;  1A62 A;  3UDF A;  1SE3 A;  3TS2 A;  3HOX B;  2M2L A;  4NP5 A;  2JA8 B;  4O0A A;  3WOE A;  4IN3 A;  4DAP A;  2OTJ A;  1TWG H;  2K5H A;  5ELF A;  4LF9 L;  1SND A;  5A2Q E;  1VQP A;  4CDE C;  3GTP B;  2Z6K C;  2XSC A;  4QMG A;  5IP7 H;  1N8R C;  1AE3 A;  3H91 A;  4P72 A;  4B9W A;  3SK4 A;  1L2F A;  2B2T A;  2JA6 B;  4IUU A;  3A7A B;  1YNN D;  4LF7 L;  1HQR D;  1KXL A;  3L0O A;  1JCK B;  1TS3 A;  2XTI A;  3L3O C;  4IFD G;  1KAA A;  2VB3 X;  1KL9 A;  4L5T A;  3U50 C;  1EQT A;  2QDL A;  2JE6 I;  4RKB A;  3CCE A;  3H6M A;  1BF4 A;  3NEL A;  3D4R A;  1ZYR D;  4IFD I;  4L5S A;  2PQA A;  1YJN A;  3VR2 A;  2UUC L;  1CSQ A;  2F0K A;  4KI0 A;  1KIX A;  3A7L A;  2F0D A;  5C4J B;  5CV5 A;  2ICE C;  1I94 Q;  2I46 A;  2IT1 A;  4NXN Q;  4JBJ A;  2UUA L;  2VS1 A;  1VQJ A;  3QJY A;  3UI2 A;  4PV1 C;  2KQ3 A;  3ERS X;  3OYY A;  3HRZ C;  2OT2 A;  5IYD H;  2R92 H;  2LY7 A;  5M5W B;  1EL0 A;  3FP9 A;  3HOU H;  4HIM A;  3KUP A;  2X6G A;  4R4O A;  3JAM E;  5C4X B;  1NAP A;  4ZK9 B;  3PCO B;  1PLF A;  3I2Z A;  2XNA C;  1J5E Q;  4IUN A;  3STB D;  3NE5 B;  4JI3 L;  1GHJ A;  4HIK A;  4H13 C;  3CXC A;  2TMP A;  3OMC A;  5GQO A;  2PQE A;  2IJ0 A;  3AFQ A;  5EPK A;  3OTO Q;  5KEE A;  3KJO A;  2KCT A;  1XNR L;  5IOD A;  3GTL B;  2FJ2 A;  4RGT A;  1M8A A;  4H7B A;  2JA5 H;  5JEA J;  3FMC A;  3H3V C;  1VQH A;  1EOT A;  4KD4 A;  3HOZ G;  4DV7 Q;  1MGS A;  2BOS A;  1X9N A;  2EJG C;  3EN2 A;  4A3D H;  4A3G H;  4A3F B;  1JMC A;  3M4O B;  2BH2 A;  1II3 A;  1JB3 A;  1TWC H;  1DJR D;  2IPK D;  1PH7 A;  1FJG L;  3F2C A;  1Q8I A;  2Z6K A;  4DV1 L;  1HNZ Q;  1S3O A;  4N8F A;  3U4V A;  1K3B C;  5IT9 c;  2GA4 B;  2ZXP A;  1PA6 A;  1KDA A;  4DR5 L;  3NTK A;  1STN A;  2IX3 A;  4QY7 A;  4DV6 Q;  5K36 H;  2EJM A;  4DXF A;  5AJ3 Q;  1PH3 A;  4DA2 A;  4QB4 A;  1XMO Q;  2VQF Q;  2QA4 A;  3MXU A;  1FYC A;  1LM0 A;  1PYS B;  2KHJ A;  5M3F B;  5ELD A;  1K9M C;  5ELC A;  4JW0 A;  1E2Z A;  3EJI A;  1KRT A;  2HT1 A;  1OXX K;  5FO8 B;  2I07 B;  1G91 A;  2AKW B;  4NW2 A;  1K83 B;  3S9W A;  3CKI B;  2D5D A;  3G7L A;  4ZQ3 A;  1VQF A;  1X6O A;  4B3R Q;  1CI3 M;  5J1Z A;  2K75 A;  1CZW A;  1TWG B;  1CK1 A;  2C35 B;  3KF8 A;  2Z6B A;  4PNY A;  5FJ8 H;  1JIC A;  2VXW A;  2OF1 A;  4ZYS A;  4POF A;  5EAY A;  5JJK A;  2K52 A;  2R61 A;  4A3B G;  4GNX B;  4BY1 G;  1VQN A;  1D2B A;  1GXD C;  4K6D A;  4RWS C;  1KQS A;  5KNC A;  2NWG A;  5I9O A;  1GUN A;  1JWS D;  4DUZ Q;  4BS9 A;  2F0W A;  1UE6 A;  2ZM6 L;  4V0B A;  3C1E A;  2G9H D;  4XYQ A;  1XMQ L;  4DU9 A;  2R7Z H;  1IHZ A;  4RH6 A;  1TT2 A;  1WFQ A;  3S1M B;  3S2D B;  3E0E A;  5ELB A;  4OO1 H;  1B7Y B;  1RHP A;  1DON A;  5E7N A;  3D4W A;  5G3L F;  3ND8 A;  4JI5 Q;  4LF4 Q;  3AEV A;  3LGJ A;  3HOV G;  3K7U C;  4A3L H;  5COY A;  4B3S L;  4JI0 Q;  2X69 A;  1N32 Q;  1N33 L;  1CKO A;  2MQH A;  3CC4 A;  3PQI A;  4PZ8 A;  3GTG H;  1SNC A;  2R92 B;  1VQG A;  4H02 A;  1HNW L;  2LKV A;  1S5E D;  1YHA A;  1B8A A;  2B2U C;  5JVG 3;  3I4N G;  3RLF A;  3R93 A;  4JI2 L;  4O1N A;  1CQF A;  4KY6 A;  2O2L D;  4DR7 L;  1ICF B;  3MWY W;  4YIJ A;  4GN4 B;  5C0X J;  1SMY C;  2F0H A;  1BXT A;  2IW3 A;  2DY7 A;  3MEF A;  4ME3 A;  3X3N A;  1YJW A;  2F0N A;  3CPW A;  1EY8 A;  3GDE A;  3SDZ A;  5KRU A;  5LMN W;  1TS2 A;  4A3J H;  5LMN Q;  3K59 A;  5I6W A;  2WB1 E;  1IZ6 A;  1A6X A;  1T5X D;  4IJH A;  4YHH L;  1GJX A;  2XIW A;  1V8Q A;  1IXR A;  2JA5 B;  2NN6 H;  1TU2 B;  1GKH A;  1PFB A;  1SYG A;  3AYH B;  4RGM A;  5IGG A;  3ULL A;  4RHS A;  1O78 A;  1F9P A;  5FLX c;  4DPG A;  1YNJ C;  2PMZ B;  1TS4 A;  2PO4 A;  1VQO A;  1TWF H;  4CBV A;  4A3D B;  4A3G B;  1A3T A;  1BO0 A;  3CU7 A;  1NJI C;  4UDU C;  2RVL A;  2A6E C;  4OWT B;  2OCE A;  1G8Z D;  1CUK A;  3A54 A;  5EPJ A;  1LT3 D;  3OIQ A;  4C3J H;  4DV5 L;  4ZAI A;  1RCV D;  2EDG A;  1PZK D;  3BYY B;  1O7Y A;  3TME A;  4A3I H;  4A3M G;  4B3M L;  3K6O A;  1E7Z A;  2MJ8 A;  3MFY A;  1KAB A;  4JI8 Q;  3T1Y Q;  3H3V I;  1VQC A;  1Y1V H;  2B8G A;  3KF6 A;  3TRE A;  1ASZ A;  1QUQ A;  2IL8 A;  2EJF C;  2KOL A;  3G4S A;  3DWP A;  2PCF B;  2NYZ D;  3HOZ B;  1C48 A;  2A1A A;  3I7F A;  3KLR A;  3FDT A;  3QB3 A;  1G6P A;  3HKZ E;  3CHB D;  4RCO A;  4HCS A;  3OWF A;  1SRO A;  4AQY L;  2OWO A;  1SJH D;  1CTM A;  1Y8O B;  4P71 A;  4KY5 A;  3GQB A;  1VQ4 A;  1VQM A;  2ZXR A;  4A75 A;  4FDB A;  4IUT A;  2YV5 A;  3DLL A;  4TKO B;  2B2U A;  1FJG Q;  1PRT F;  2R3Z A;  1H9S A;  4RCN A;  4IJL A;  4QUF A;  5M3M H;  3I55 A;  1EQV A;  4IOC A;  2K14 A;  1U4M A;  4DKA C;  4DV0 L;  1H9R A;  5C3W A;  2E2H B;  1DD2 A;  1SBB B;  2VL6 A;  3QOL A;  3D3R A;  3TP7 A;  4DR5 Q;  1DOM A;  2O5I C;  1Q1B A;  5A2Q L;  4ZCK A;  1EY9 A;  2DN8 A;  2KA7 A;  3J7Z C;  3M7N A;  2R7Z B;  3F2B A;  1BVS A;  2CCZ A;  4JI7 L;  3OOC A;  3KBX A;  3R3O A;  5EBC A;  2F0E A;  1X55 A;  2QDB A;  2PMZ E;  4BBR G;  5HGQ A;  2ES2 A;  2A8V A;  3PGZ A;  3Q0A A;  4A3B B;  2G9D A;  3DEP A;  3S1R B;  4HJ5 A;  2QKI C;  1A15 A;  2Q8R E;  1MSG A;  3H09 A;  1FGU A;  3IRB A;  1SDF A;  3NUC A;  4C1N I;  2Q2I A;  3E5S A;  4DNR B;  3NQT A;  3G6J B;  1QIL A;  5GAE C;  5DNF A;  2AWN A;  3MFG A;  1F9S A;  4XQQ A;  5LL6 S;  2NVX H;  1TQO A;  3TP8 A;  1I4R A;  4A3J B;  2I5H A;  1XMQ Q;  1PXU A;  4I65 A; 
#chains in the Genus database with same CATH homology
 1GUW A;  1O80 A;  1ZYR C;  1BDO A;  1JWM D;  1RF2 D;  3C3L A;  1XWE A;  1TWF B;  4ABN A;  1F77 A;  2IX0 A;  2ID0 A;  3L7Z C;  5KIX A;  3PMF A;  2PNR C;  4RGN A;  1FD7 D;  1PTO H;  4XT1 B;  1TII D;  2B2V C;  4C3J B;  2KEE A;  4F87 A;  2VB2 X;  2O4X A;  3I91 A;  2JYO A;  4A3I B;  1SJE D;  2IWH A;  3K5M A;  2D2C C;  2K28 A;  3LNN A;  1GUG A;  1LT6 D;  3K0Y A;  4RHR A;  1B4O A;  1B53 A;  1GOZ A;  1EY4 A;  3S1N B;  1JOR A;  2F0S A;  2Y0S B;  1SMY D;  4CJ0 B;  3NTI A;  4X3S A;  1VDZ A;  4NMZ A;  4FXD A;  3VYS A;  4X3K A;  5K5P A;  2SNM A;  1NR4 A;  1GUT A;  2V4D A;  1EYD A;  2MGS A;  5C5L A;  5CV4 A;  5M3M B;  3TSS A;  1VMP A;  3QG1 A;  1J9O A;  3Q22 A;  5M9O A;  4JBW A;  2RDG A;  1OXS C;  5FLX E;  1E2W A;  3T51 B;  2WAC A;  2F0F A;  3ITP A;  5ISR A;  1AZP A;  1EEF D;  1EU4 A;  3SK6 A;  2Z4I A;  1EYA A;  3Q6S A;  1DZ1 A;  3EQL C;  3MXP A;  4J6H A;  5E4X A;  1ET9 A;  1S5D D;  3HG9 A;  1G6Z A;  2BA1 A;  1ZXT A;  5C0X I;  4ZKC B;  1I4Q A;  4DK1 A;  4KTA A;  2B2V A;  1SNQ A;  5C6A A;  2WKC A;  2O5J C;  3NHH A;  4FP5 D;  5DM7 3;  3SE0 A;  3A8I E;  2QEJ C;  1BCP B;  2RKS A;  2LS0 1;  4BBR B;  1STA A;  1PFN A;  1QOH A;  3AB9 A;  2F1M A;  2QF7 A;  3NTH A;  3P75 A;  2R6G A;  3QWN A;  3MHB A;  1SAP A;  4ILW A;  1UAP A;  1KNA A;  3J81 L;  4L6T B;  1U4L A;  4PMC A;  2BA0 A;  4M1U B;  5CMD A;  2AWO A;  1PTO B;  1E2V A;  3QO2 A;  2R93 B;  1U4P A;  3MXN A;  5BN5 A;  4KN4 C;  1U4R A;  3TN2 A;  3GP7 A;  1D6E C;  3J7A F;  3QIA A;  5KYI A;  2C9O A;  1OXT A;  1RJT A;  4QF4 A;  2L0C A;  1W6J A;  2RDH A;  2LFN A;  2K5Q A;  1EY7 A;  1SXT A;  3GTO B;  2Q8T A;  4LJZ C;  2M00 A;  4J1M A;  1U9R A;  4G4K A;  2EVB A;  1X3Q A;  1WD0 A;  3KLS X;  3E0J A;  4N9P A;  4KHV A;  1EY6 A;  1Y8P B;  3IL8 A;  3I8Z A;  4L8J A;  5EKL A;  2KEC A;  4K14 A;  2L12 A;  3BVM A;  4CKE A;  4H0L C;  2DY8 A;  2FIN B;  5C44 B;  2F0J A;  1SEB D;  1BR9 A;  4A3K B;  1CA6 A;  4IFD H;  1HTP A;  1ENF A;  2NTT A;  3S15 B;  3I73 A;  2VUM B;  4U68 A;  1QNK A;  4HTH A;  3GO5 A;  2RA4 A;  5NUC A;  2JEA I;  5I6Y A;  3IFD A;  3V2T A;  1ONL A;  4G7Z C;  3P1H A;  3OPO A;  2EPB A;  5CGK A;  2HCC A;  3HGB A;  3FRP B;  5FK9 C;  3HS0 C;  4ZRZ A;  5IT9 L;  1SYE A;  1B50 A;  4C3H B;  2EY2 A;  3GTJ B;  3M7G A;  3TZU A;  4MN3 A;  3RD4 A;  1Y69 U;  3RZO B;  1A2T A;  3R2T A;  1SNO A;  2NB0 A;  1BOS A;  2IX1 A;  3M85 A;  3VA5 A;  1IKM A;  1IW7 D;  3P7J A;  4KV6 A;  2L11 A;  2J0T D;  3K7A B;  3SEB A;  1BQQ T;  1JOK A;  1EZ8 A;  4X3T A;  1HUN A;  2RDF A;  3MVV A;  1SYC A;  5JPM C;  2MPM A;  3D31 A;  3VR6 A;  1WCM B;  2F4I A;  3NPP A;  1A3U A;  1CM9 A;  3I4M B;  3S1Q B;  1CA5 A;  2FHT A;  4HMJ A;  1STB A;  1Z7T A;  1EY0 A;  1Q12 A;  1Z47 A;  5CV9 A;  1ESR A;  1XXG A;  4NKL A;  4JK1 C;  3VA7 A;  5IGE A;  2F03 A;  1CFM A;  3LX0 A;  1UEA B;  1DOK A;  3MC0 B;  1BCP C;  1HRJ A;  2ICI A;  1ENC A;  4KN7 C;  3MXG A;  2HCI A;  4R8I A;  2KED A;  1ML0 D;  1L0Y B;  1I3Q B;  5IGD A;  1TR5 A;  4C3I G;  1IL8 A;  1H9K A;  4BWG B;  5M5Y B;  4RKL A;  1WTR A;  3I4L A;  1CQV A;  3FKI B;  3NP8 A;  4OL7 A;  1CZG A;  5I4D A;  5IGF A;  3J81 E;  2F0V A;  2K6A A;  4CKB A;  1JWU D;  5FLX L;  2NVT B;  4C2M B;  1DCZ A;  1H9M A;  2NN6 I;  2BCO A;  4FNF A;  2B63 B;  2OEO A;  1R4P B;  1V1P B;  1WTP A;  4ODG A;  4J8Q A;  5BN3 A;  1LTA D;  3D6W A;  1AW7 A;  3C1F A;  2RBM A;  3ERQ A;  2MHV A;  5KGU A;  4RFB A;  1V1O A;  4EQP A;  1HPC A;  2CHB D;  1VMC A;  1D1K A;  3N6R A;  2L9H A;  2C5C A;  1BUV T;  4CJ2 C;  1XYI A;  1TS5 A;  1JOQ A;  1X3P A;  4ZKB B;  1HHV A;  5EKI A;  2HDM A;  3K57 A;  4UAI A;  3D6C A;  3LWU A;  4DAY A;  4C1N K;  4Z9C B;  1F2Y A;  1LTT D;  4G7O C;  3BDL A;  3FEW X;  5IOC A;  4OHJ A;  3GV6 A;  2TSS A;  1PDQ A;  1JOO A;  3OSO A;  1GUO A;  1SE4 A;  2NUC A;  1F2Z A;  2M9V A;  5CBE E;  4U67 3;  4XYO A;  1I50 B;  2F0G A;  1FNV A;  3VYU A;  3EFX D;  1UNS A;  3NK9 A;  4ULL A;  5CYU A;  4KMU C;  2B2W C;  1SFO B;  4FO2 A;  3BS1 A;  2K01 A;  4GZY C;  2EYP A;  4IUR A;  1B44 D;  1ICW A;  4OIJ A;  3DMU A;  3HZX A;  1CHP D;  3PUY A;  3VR4 A;  3GTM B;  3D8G A;  4IUP A;  1OXU A;  4BY1 B;  3KK7 A;  5IT9 E;  2E76 C;  1L0X B;  3MA2 B;  3GTK B;  4PQX A;  2WV6 D;  3M3Y B;  4RA8 A;  5KNB A;  5JEA G;  4FF3 A;  4RAU C;  2SNS A;  2EY6 A;  2PW7 A;  5IIF A;  3K58 A;  1S5B D;  1EY5 A;  3LWE A;  3H94 A;  3HOV B;  1ILP A;  2F3V A;  1F2L A;  1I6H B;  1KDB A;  1LT4 D;  5CBA E;  1O7Z A;  2A6H D;  3IKJ A;  4FYD A;  3TP5 A;  3I4N B;  1BCP D;  3GV3 A;  2JA7 B;  5D3D A;  5E1F A;  4B9X A;  3QOJ A;  2K03 A;  4PMB A;  3DEO A;  1UUP A;  1GHK A;  3A8K E;  1HFG A;  1JQY D;  4XQN A;  5T1I A;  2ENB A;  1JE4 A;  3K5N A;  2B2W A;  2AQ2 B;  2K05 A;  2N55 A;  3R8B A;  4HED A;  2B2Y C;  3I72 A;  5COR A;  1LV9 A;  4L63 B;  4N9T A;  2MUY A;  4KD3 A;  2VNU D;  1PTO D;  3MEH A;  4DK0 A;  5M5X B;  1H9J A;  4HSP A;  1QG7 A;  5HUR A;  1LLR D;  1SSO A;  2F0P A;  2CQA A;  1EWH A;  1O7L A;  1HA6 A;  4FF2 A;  3OWE B;  1D1I A;  2XN9 C;  1X32 A;  4KKS A;  3HOY B;  4A3M B;  1HQM C;  4FF1 A;  4DN4 M;  1MSH A;  3Q23 A;  1KLU D;  5EGT A;  3NXW A;  3A55 A;  2PZT A;  3T53 B;  3AU7 A;  2Z1C A;  2YYZ A;  1PRT B;  5CC4 A;  2JSO A;  4G7H C;  4X3U A;  1TKW B;  1ROD A;  1TWA B;  3BVG A;  1IW7 C;  4DNT B;  3IFT A;  2EYJ A;  3HP3 A;  1STG A;  5C0X G;  3NQI A;  5D3I B;  4IQZ A;  4M8A A;  3OW7 A;  2D62 A;  4K5X A;  1QE6 A;  3W3A A;  1IYU A;  3TDQ A;  3S2H B;  3T56 B;  3KBG A;  1PMR A;  2B2Y A;  4FXK C;  3A8J E;  4K8J A;  5E4W C;  2FFK B;  5HGT A;  2PZW A;  2A5H A;  4PMW A;  3F2U A;  4F7X A;  2F0U A;  1RKN A;  1WTV A;  2KHS A;  2KJX A;  3DHQ A;  3L9A X;  5EJW A;  2RSN A;  5CV6 A;  4DF7 A;  4KJO A;  4LMQ D;  3VYT A;  3A56 A;  1PZJ D;  2BDO A;  1LTI D;  1ESF A;  3K5O A;  2ZXO A;  3NWT A;  1STH A;  4CHT B;  4WOR A;  3DWQ A;  3S16 B;  1TWH B;  4EGV A;  3U9O A;  1H9S B;  1EIH A;  3RMH A;  5EBD A;  3D4D A;  1VF5 C;  5I2Y A;  3PV0 A;  1V43 A;  2F0L A;  2ZT9 C;  1NUC A;  2JP1 A;  1I4P A;  4BA1 I;  5EKK A;  4EVO A;  1DM0 B;  2HUG A;  1VF7 A;  4ID6 A;  2FMM A;  1B2T A;  3O13 A;  4K5W A;  2K5W A;  3WOF A;  2F0O A;  2H4O A;  2QCP X;  4ZUJ A;  5EPL A;  4XT3 B;  2K04 A;  5JOB A;  1ZEQ X;  1ZKO A;  3J7A V;  3SVM A;  3I3C A;  4WRD A;  4WFN 3;  1NCV A;  4KK7 A;  3WDN A;  1AN8 A;  3C2P A;  1KLG D;  1EU3 A;  4DFA A;  2NTS A;  3BDC A;  3S17 B;  5F2D A;  5LHY 1;  3BDO A;  1Q3L A;  1JR0 D;  4O42 A;  3NWS A;  1R4Q B;  3U9S A;  3T13 A;  2CW0 C;  4F8M A;  1SYF A;  5IGC A;  1MI2 A;  1HFN A;  4K2L A;  4K8I A;  4FF4 A;  3R2I A;  4S3S A;  3VYR A;  3K5L A;  1Q90 A;  3RZD B;  5FO7 B;  1GUS A;  5ELE A;  3V96 A;  5E3F A;  1KNE A;  1XTC D;  1NR2 A;  2WP8 J;  5IGB A;  3ONA B;  2AUK A;  2EY1 A;  1LTG D;  1NSN S;  3DUZ A;  1MD2 D;  2E75 C;  4CJ1 B;  3S14 B;  2HDL A;  1HTL D;  5K36 G;  1HA5 A;  2NBF A;  1I4X A;  1EZ6 A;  4H44 C;  3P20 A;  1SNM A;  1AFP A;  1D5X C;  3H0G B;  4QCL A;  1Y8N B;  3TBI B;  2EOT A;  1Y1W B;  1AP0 A;  2EXZ A;  3FVQ A;  4K5V A;  1PRT C;  2HQE A;  4DGZ A;  4QUC A;  5CV8 A;  4C56 C;  2K33 A;  1EEI D;  4B08 A;  3EVQ A;  4V19 0;  1OO9 B;  2L4N A;  3PUV A;  3ERO A;  3J80 L;  2WB1 B;  3CRL C;  4A93 B;  1D5M C;  1WVL A;  4OO1 G;  3TZD A;  5LL6 X;  1LTB D;  1K8M A;  4LAA A;  2A6H C;  2K5D A;  2JEB I;  1FGB D;  4ZUI A;  5DAU A;  4OO1 I;  2WIN B;  1HCZ A;  4ME5 A;  2A73 B;  4DAV A;  4TRD A;  1F9R A;  2AUJ D;  3NBI A;  2EZV A;  3BG3 A;  5TSS A;  5T1G A;  1QNU A;  1IKL A;  4A3E B;  1CHQ D;  2YU9 B;  3BVZ A;  2A68 D;  5DEH A;  5JAV A;  4F88 A;  1A3V A;  2DNC A;  3FPU B;  3I70 A;  1OXV A;  1VCI A;  3HKZ B;  5JPN C;  5KYL A;  4P2C B;  1PTO C;  1LO5 D;  1G2S A;  1R9T B;  3MAQ A;  3J7Y W;  4TSS A;  2NN6 G;  1QJO A;  2BE5 D;  4I7Z C;  2MP1 A;  5D65 A;  2XRQ D;  3MTS A;  3HOU B;  2EYO A;  3KLS A;  2BDN A;  3BZD B;  1CT1 D;  5G3L D;  2L5T A;  1F2M A;  4BY7 B;  3T4A C;  4HCE A;  2J7Z A;  5C5M A;  2F0I A;  1S4Z A;  2SEB D;  3OIP A;  4C3J G;  1QWY A;  2F0Q A;  1RTO A;  1AZQ A;  2PPB C;  3PO2 B;  1Z6H A;  1DXM A;  3E6Z X;  4NDX A;  2AQ1 B;  1KTK A;  1C8C A;  4HN7 A;  3PO3 B;  2PYK A;  2EYF A;  1EWC A;  4XTC S;  1XX8 A;  4FXG C;  3T16 A;  3ND9 A;  5KND A;  4IZ8 A;  4ZLT F;  3VR5 A;  4CKC A;  1TWC B;  5AFW A;  2K1B A;  1RTN A;  1B9N A;  1WTO A;  3X3M A;  2A74 C;  5A35 A;  1T5E A;  3PUZ A;  4CGY B;  2CW0 D;  2Q8I B;  4Q0F A;  1HXY D;  1WD1 A;  3PUW A;  1IYV A;  2F0M A;  4HSV A;  4KKU A;  1TY0 A;  1BNZ A;  2B39 A;  3N52 A;  3FPP A;  1I4G A;  4MHE A;  4HAE A;  2B8F A;  5C4Z A;  2RQX A;  5BN4 A;  2XWJ B;  4BBS B;  2E2J B;  1FR3 A;  4HMI A;  4IUV A;  5FO9 B;  2E2D C;  1WTX A;  1M4V A;  1B9M A;  2KUM A;  3V05 A;  2JXM B;  4IFD J;  1I4H A;  2PW5 A;  2F0T A;  1PRT D;  1ENA A;  1MBY A;  5D14 A;  1WTQ A;  1J8I A;  2A69 C;  1BBX C;  3MZ5 A;  5JJZ A;  5C4H A;  2EE1 A;  1E0B A;  4OGQ C;  3GTG B;  1BCP F;  1B1Z A;  3W2D A;  3SHL A;  1LAB A;  4FVM A;  3C46 A;  1LAC A;  4QIW B;  4C3I B;  3OHX C;  1PYW D;  2XWB B;  3AMU A;  4LK1 C;  3URY A;  1FNU A;  1YNN C;  4KY7 A;  2X6L A;  3NBH A;  4KHZ A;  5JEA H;  1C4Q A;  2F3W A;  1K8O A;  3JAM L;  4DXG A;  4XQJ A;  1PTO F;  3J80 E;  4XXE A;  3I90 A;  3EA6 A;  2H1E A;  5C3E B;  1TY2 A;  3DXJ C;  4KKT A;  1SNP A;  2L1B A;  1A2U A;  3HEJ A;  2DNE A;  4OIK A;  4RGO S;  4XDX A;  2NZ1 D;  4IUQ A;  1WTW A;  1STE A;  4XIG S;  1SYB A;  3SK8 A;  2K7V A;  2WII B;  3DM1 A;  1Y1V B;  3SXH A;  2E74 C;  1G29 1;  2J4X A;  1S5C D;  2N88 A;  1KDC A;  1QCB D;  1SYD A;  1RDP D;  1W6K A;  5C3X A;  2KCN A;  3DWA A;  1DYQ A;  3OMG A;  2CVR A;  2PZU A;  1JC7 A;  2AQ3 B;  1FNW A;  3VR3 A;  4EQO A;  4R9W A;  5I2X A;  4WJW A;  4Q5V A;  2SOB A;  5DM6 3;  3ZYY X;  3NSW A;  1YNJ D;  1HUM A;  1D5Z C;  1QB5 D;  1I6V C;  1LTS D;  5FKA C;  2OXP A;  1ET6 A;  5EQ0 A;  2A6E D;  2K32 A;  1STY A;  3SK5 A;  1DOL A;  3BYT B;  2Z4H A;  4AYB B;  5FOB B;  1G2T A;  2FMC A;  3PIO 3;  2RSO A;  1LT5 D;  4K6L A;  1PZI D;  1EYC A;  2WAQ B;  2SDF A;  1S5F D;  1EFI D;  2B2T C;  4C3H G;  2XVS A;  3PIP 3;  1Q1E A;  1PFM A;  4K2K A;  4IAL A;  5J39 A;  1EIG A;  5C0X H;  2E2I B;  4G57 A;  3RUZ A;  1AEX A;  1LTR D;  2LMC B;  4EQN A;  1TVX A;  5CV7 A;  3CQZ B;  3HOW B;  4HR7 B;  4R8N A;  5J22 A;  1SE2 A;  5JVH 3;  2NVX B;  2EY5 A;  2D9U A;  4TQU S;  2XRS D;  2QIL A;  3GTQ B;  2WKD A;  2NVQ B;  2KCC A;  3Q24 A;  4E6I A;  2A68 C;  2EYM A;  3M4Y A;  4KJN A;  4Y7N B;  1B3A A;  3CRK C;  3SR1 A;  3PUX A;  1V1P A;  2EYH A;  2NVY B;  1F9Q A;  2EYL A;  3IAY A;  2A69 D;  3TP6 A;  1RD9 D;  2BE5 C;  2L55 A;  2KVM A;  5CR3 A;  5I9P A;  2Z8L A;  4MIU A;  1ILQ A;  3GD7 A;  4BA2 I;  1SE3 A;  3HOX B;  2M2L A;  4NP5 A;  2JA8 B;  3WOE A;  4IN3 A;  4DAP A;  5ELF A;  1SND A;  5A2Q E;  3GTP B;  4QMG A;  2XSC A;  3H91 A;  4B9W A;  3SK4 A;  2B2T A;  2JA6 B;  4IUU A;  3A7A B;  1YNN D;  1HQR D;  3L3O C;  1JCK B;  1TS3 A;  4IFD G;  1KAA A;  2VB3 X;  1EQT A;  2JE6 I;  4RKB A;  3H6M A;  1BF4 A;  3D4R A;  1ZYR D;  4IFD I;  3VR2 A;  2F0K A;  4KI0 A;  3A7L A;  2F0D A;  5C4J B;  5CV5 A;  2ICE C;  2I46 A;  2IT1 A;  3QJY A;  3UI2 A;  4PV1 C;  2KQ3 A;  3HRZ C;  2OT2 A;  2LY7 A;  5M5W B;  1EL0 A;  3KUP A;  2X6G A;  3JAM E;  5C4X B;  1NAP A;  4ZK9 B;  1PLF A;  2XNA C;  4IUN A;  3NE5 B;  1GHJ A;  4H13 C;  2TMP A;  3OMC A;  2PQE A;  2IJ0 A;  5EPK A;  5KEE A;  5IOD A;  3GTL B;  2FJ2 A;  4RGT A;  1M8A A;  4H7B A;  5JEA J;  3FMC A;  3H3V C;  1EOT A;  4KD4 A;  1MGS A;  2BOS A;  2EJG C;  4A3F B;  3M4O B;  1II3 A;  1JB3 A;  1DJR D;  2IPK D;  1Q8I A;  2GA4 B;  2ZXP A;  1KDA A;  3NTK A;  1STN A;  2IX3 A;  5K36 H;  2EJM A;  4DXF A;  4DA2 A;  4QB4 A;  3MXU A;  1FYC A;  5M3F B;  5ELD A;  5ELC A;  1E2Z A;  3EJI A;  1OXX K;  5FO8 B;  2I07 B;  1G91 A;  4NW2 A;  1K83 B;  3S9W A;  3CKI B;  2D5D A;  3G7L A;  4ZQ3 A;  1CI3 M;  5J1Z A;  1CZW A;  1TWG B;  1CK1 A;  3KF8 A;  4PNY A;  1JIC A;  2VXW A;  2OF1 A;  4ZYS A;  2R61 A;  1D2B A;  1GXD C;  4K6D A;  4RWS C;  5KNC A;  2NWG A;  5I9O A;  1GUN A;  1JWS D;  4BS9 A;  2F0W A;  4V0B A;  3C1E A;  2G9H D;  4XYQ A;  4DU9 A;  1IHZ A;  4RH6 A;  1TT2 A;  3S1M B;  3S2D B;  5ELB A;  4OO1 H;  1RHP A;  1DON A;  3D4W A;  5G3L F;  3ND8 A;  5COY A;  2X69 A;  1SNC A;  2R92 B;  2LKV A;  1S5E D;  2B2U C;  5JVG 3;  3RLF A;  3R93 A;  4O1N A;  1CQF A;  4KY6 A;  2O2L D;  3MWY W;  4YIJ A;  5C0X J;  1SMY C;  2F0H A;  1BXT A;  2IW3 A;  2DY7 A;  3X3N A;  2F0N A;  1EY8 A;  3SDZ A;  5KRU A;  1TS2 A;  3K59 A;  5I6W A;  1A6X A;  1T5X D;  1GJX A;  2XIW A;  1V8Q A;  2JA5 B;  2NN6 H;  1TU2 B;  1PFB A;  1SYG A;  4RGM A;  5IGG A;  4RHS A;  1O78 A;  1F9P A;  1YNJ C;  2PMZ B;  1TS4 A;  2PO4 A;  4CBV A;  4A3D B;  4A3G B;  1A3T A;  1BO0 A;  3CU7 A;  4UDU C;  2RVL A;  2A6E C;  1G8Z D;  3A54 A;  5EPJ A;  1LT3 D;  3OIQ A;  4ZAI A;  1RCV D;  2EDG A;  1PZK D;  3BYY B;  1O7Y A;  3TME A;  3K6O A;  2MJ8 A;  3MFY A;  1KAB A;  2B8G A;  2IL8 A;  2EJF C;  2KOL A;  3HOZ B;  3DWP A;  2PCF B;  2NYZ D;  1C48 A;  3KLR A;  3FDT A;  3QB3 A;  3CHB D;  4RCO A;  4HCS A;  3OWF A;  1SJH D;  1CTM A;  1Y8O B;  4KY5 A;  3GQB A;  2ZXR A;  4IUT A;  4TKO B;  2B2U A;  1PRT F;  2R3Z A;  1H9S A;  4RCN A;  4QUF A;  1EQV A;  1U4M A;  1H9R A;  5C3W A;  2E2H B;  1DD2 A;  1SBB B;  3QOL A;  3D3R A;  3TP7 A;  1DOM A;  2O5I C;  1Q1B A;  5A2Q L;  1EY9 A;  2DN8 A;  2KA7 A;  3M7N A;  2R7Z B;  3OOC A;  3KBX A;  3R3O A;  5EBC A;  2F0E A;  2QDB A;  3Q0A A;  4A3B B;  2G9D A;  3DEP A;  3S1R B;  2QKI C;  1A15 A;  2Q8R E;  1MSG A;  3H09 A;  1SDF A;  3NUC A;  4C1N I;  3E5S A;  4DNR B;  3NQT A;  3G6J B;  1QIL A;  5DNF A;  2AWN A;  3MFG A;  1F9S A;  4XQQ A;  5LL6 S;  1TQO A;  3TP8 A;  1I4R A;  4A3J B;  1PXU A;  4I65 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...