1UEAB

Mmp-3/timp-1 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
181
structure length
181
Chain Sequence
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVAQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHARSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (metalloprotease/inhibitor)
molecule keywords MATRIX METALLOPROTEINASE-3
publication title Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
pubmed doi rcsb
source organism Homo sapiens
total genus 42
structure length 181
sequence length 181
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ueaB02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 1ueaB01
5FOBB 1JB3A 3CKIB 1UAPA 1BR9A 1XWEA 2ICEC 4FXGC 4ILWA 2WIIB 1BUVT 1JC7A 1D2BA 2A73B 5FO8B 2A74C 3L3OC 5JPNC 4FXKC 3HRZC 2WINB 2QKIC 3I70A 3FRPB 3OHXC 5FO9B 3G6JB 3HS0C 3MA2B 1GXDC 3CU7A 3KLSA 5JPMC 2XWJB 1UEAB 2XWBB 1PXUA 2I07B 2J0TD 3V96A 2E2DC 2B39A 1OO9B 3T4AC 5FO7B 1BQQT 2TMPA
chains in the Genus database with same CATH superfamily
4BBSH 3U9OA 4DV1Q 3GTMB 1CZGA 2FMCA 1WCMB 2F0TA 2UUAQ 5M3FG 1HNWL 2KHIA 4R8NA 4R4IA 4IUNA 4A93B 1SN8A 4L5RC 3WOEA 3AFQA 2EY2A 1ZYRD 3SR1A 5J3BA 2NUCA 2F0IA 4GN4B 3K7AB 3WOFA 3KLSA 3ER0A 3NEMA 4XDXA 3ZYYX 3T56B 1K8GA 1I94L 5JJLA 2UXDL 1CUKA 2GN5A 2E2IB 1TR5A 1DOMA 3MEHA 1TU2B 4DR1Q 1AZPA 3U9SA 3NP8A 5IT9c 3HOWB 2BE5D 2F0GA 3VYRA 5NUCA 3S2HB 4JI8Q 1TWFH 1NNXA 2CQAA 3GTOB 1ENCA 4B3SL 4FXKC 4WORA 2NZOA 4DNTB 4HTHA 1E2VA 3U50C 2NTSA 2QEXA 1WTRA 2X6GA 5IYCG 4CGYB 2FINB 2RDGA 2Z9HA 4JI6L 4IURA 4ME3A 4KN7C 5EBDA 5BN5A 3SGIA 4L63B 4IPDA 1NMFA 2A73B 1BCPC 3CMEA 1A15A 2G5DA 2ES2A 2K7VA 4K2LA 3Q24A 2MFIA 1BOSA 2IJ0A 5ELOA 4JI0L 4HMIA 2F0KA 3JC66 3W3AA 4ZUJA 2E2JB 4K5WA 2XWJB 3I7FA 3MAQA 4IOCA 5ELBA 4RA8A 4UP9A 4DUYL 1AW7A 3R3OA 3C1FA 2B2UA 2VNUD 2ZJRA 4RWSC 3VDYA 1NAPA 3HG9A 2BA1A 1UE6A 4CHTB 2LXKA 4KV6A 2V1CC 1LUZA 3DEPA 5JPNC 2B2VA 1SE3A 3T13A 4A3MG 3HOYB 1K8OA 1E7ZA 2K14A 4KKUA 5K5PA 4O42A 4YHHL 1AE3A 1UE1A 2O5IC 2JA6B 3BVMA 1SNOA 2NTTA 4Z9CB 4BY1B 3IL8A 5EJWA 1BCPB 2H5XA 2WACA 3RN5A 3UDXA 4YCUA 2E2DC 2ZTCA 1G6ZA 1XMOQ 5LMNQ 1VQ4A 2B2WA 1KD1C 3PO2H 3SK6A 1YI2A 2XVSA 1GO3E 2EQSA 4JI4L 4A3BH 4DR4Q 2H1EA 3HOUH 4FXDA 2L15A 2EXZA 1Y1WH 3J7ZC 2PI2E 3BVZA 4HN7A 4A3EH 3A8JE 4MIUA 4DPGA 2CKZB 1FNVA 5FLMG 2D9UA 1SFOB 1K3RA 4NDXA 5M5XH 1FNWA 4JI3L 1MSHA 3E0EA 3S14B 2A6EC 1S40A 2TMPA 2RVLA 1HR0L 1S5CD 4O0AA 1JWUD 3T1YQ 1VF7A 3BDLA 1OXSC 4OL7A 1DJRD 3GTPH 1E2ZA 1E22A 2DN8A 3E9HA 1B3AA 3VR2A 4UAIA 2UXBQ 1YHQA 2F0EA 2J7ZA 3D4DA 3QG1A 2C35B 1W6KA 1OXTA 5I2XA 1HXYD 3PF5A 1JB7A 2L0CA 4H13C 4LNQA 1PH4A 3AYHB 4HSPA 4K8JA 3GTGH 4F87A 1FJGQ 4C56C 1EIFA 1TS5A 4LFCL 3TSSA 2PNRC 4MZ9A 3R2TA 4OWWB 2EZVA 1F2ZA 1G91A 4LF6L 1QILA 3M4YA 1EU3A 1MHWC 1QVGA 1RDPD 1PA6A 4FYDA 1DCZA 4B9XA 4B3ML 2A68C 2XRQD 1Z47A 4WJ4A 1IYUA 1Q1BA 1Q86C 1KDBA 1Y8PB 1DOLA 2MO1A 4XIGS 1I50B 3VR5A 4RH6A 3E0JA 5FOBB 3GTKH 1X3EA 2R61A 1XTCD 2QEJC 4DR6Q 2JYOA 1TWFB 3HOYG 2EDGA 4JK1C 2EXDA 3SK8A 1E1TA 1SSOA 2SOBA 5BN3A 4A4IA 1J9OA 4FNFA 3S17H 1AEXA 2JA6G 2ZT9C 5AFWA 5IODA 1N34L 1ICFB 2K5HA 4PV1C 1BKBA 1VQ9A 4OIJA 2D2CC 5M9OA 4X64Q 1JORA 3MXPA 2EJGC 4RGNA 1P16A 3PIOA 3T53B 4NPSA 4HAEA 2N8NA 5IP9H 4HJ8A 3OYYA 4ZRZA 2JA8G 1B50A 1SMYD 4APVA 4DV1L 2ALYB 3A7LA 2BCOA 5ELCA 4TQUS 1KRSA 3GD7A 1T9HA 1VQAA 4R4TA 5EKLA 4HIMA 1RD9D 3IFTA 3CCMA 4KHPQ 4DUZQ 3P7JA 2Z0SA 4A3KH 4KKTA 1XMQQ 2UU9L 5EPKA 1IKMA 3ERSX 5ISRA 5KEEA 2AUKA 2K04A 1V8QA 1PRTC 2HIXA 1I4RA 3EQLC 3I4MH 5KYIA 3RD4A 2F0FA 2I0QA 2C5CA 4DK0A 1YITA 3IFDA 1O7ZA 1UNSA 1Y8OB 2B8GA 4JI8L 1PTOC 5HURA 4AH6A 1IKLA 2AWOA 1ZYRC 2RDHA 1RTNA 5C4XH 1YNJC 5JEAH 4UY8C 4BY7B 3KF8A 5HGQA 4OEMB 2BOSA 4BBSG 3PO2B 1JQYD 3CCRA 3PO3H 3Q23A 1D5XC 1B4OA 1LTGD 1XNQQ 3HOUB 2VQFL 2OTJA 4DV7L 1PZID 4GZYC 2BE5C 5AJ3Q 2LFNA 1VQFA 3M4PA 2O5JC 1JICA 1S5DD 5KGUA 1F2LA 2K4KA 2OQKA 3TQYA 5M5XB 1PRTB 2PCFB 1G8ZD 2DNEA 5EKIA 2DY8A 2EYMA 4LJZC 3CCQA 4BA2I 3S16H 2N49A 1HFNA 4DAYB 2N3SA 3FHWA 3NBIA 1DYQA 4KJOA 3H15A 2BA0A 3GTPB 5G3LF 2JA7B 4LFAL 3OW2A 1EYAA 3WDNA 1LACA 3NXWA 3QIAA 3I4NB 3SVMA 4A3GH 4WJWA 5C3EH 2MQHA 1TIID 5IWAQ 4LK1C 4P73A 2NWGA 4DGZA 2VUMB 5L37A 4IUUA 2R93H 2VB2X 4B3TQ 2EYFA 1STAA 3F2CA 1IBLL 2EY1A 2X6LA 3HGBA 1KXLA 2HDMA 5C44B 1L2FA 2K28A 1TS2A 2XN9C 3HZXA 4PNYA 2O2LD 3W1BA 1Y69U 1NJIC 2VS1A 3BS1A 1IXRA 3KBXA 3HRZC 2QILA 4POGA 4WJ3M 1Q1EA 2QKIC 3I70A 3KLWA 3GTLB 4DK1A 5LMNL 2K32A 5LL6S 2F1MA 4R4OA 4KTAA 5I4DA 2J0TD 3TMEA 3K7UC 2F52A 3H0GH 4JBMA 4PZ6A 3TZUA 4OX9L 4L6TB 4IFDH 4CKEA 3GTKB 3MXUA 3QJYA 1B53A 1ZXTA 1KLUD 4WRDA 3AU7A 4O2DA 1OTCA 3CC4A 4HIKA 1Y1VB 3TP8A 2RSOA 2NVXH 2MUYA 4FVMA 1GUTA 3S17B 4JV5L 1CKOA 3NQTA 4KLKA 2DY7A 4ZYSA 1SYDA 3NENA 3MXNB 2CCZA 4LMQD 1SYGA 1JWSD 2DGYA 3U58A 1U4RA 3G71A 4X6AH 3PO2G 2B8FA 1F9PA 4A3BG 1H9JA 1FJGL 4M1UB 1LT5D 2SEBD 5IP7H 1KAAA 5IYDH 1Y1WG 1F2MA 3QWNA 2B2VC 1SYEA 4A3EG 1TY0A 3VR6A 3K81C 5GAGC 4E6IA 4QGUA 1E2WA 3A5ZB 4U673 2F0VA 1BR9A 3PCOB 4QIWB 1N36L 1MJCA 4YY3Q 1FGUA 2LSSA 3MEFA 1G51A 4HJ7A 2RBMA 3I4MB 4QUFA 4FP5D 2L55A 4ZAIA 3MTSA 1YBYA 1SJHD 2CQOA 1YJWA 3SDZA 1JE4A 4JI2Q 1EQVA 5KIXA 4DR6L 1SNMA 1XYIA 2NVQH 1PFSA 2QA4A 4KD4A 1VQJA 4PG3A 3PIO3 3I56A 1EIYB 3DEOA 1SE4A 3LX0A 1VQHA 1FNUA 3CXCA 1STYA 3LNNA 3S2HH 2WIIB 1X54A 1M90C 3GTOH 2QGQA 3PO3B 2KJXA 1NTGA 4DR5Q 1RKNA 3NTKA 1HA5A 1LM0A 1LTID 3QO2A 3UDIA 1STHA 2A6ED 4QJFA 1BNZA 4DAMA 1HZCA 4GKKQ 3B6YA 4POFA 4EQNA 4L8JA 4HSVA 1QNUA 4EVOA 2SNSA 3S16B 4XXEA 1H95A 3F2DA 5CV9A 5LMNW 5CBAE 2F3WA 3RLNA 4KJNA 3OW7A 3TRZA 1SLJA 3BU2A 5IGDA 4XQJA 2Z4HA 2AUJD 4FO2A 1K0RA 2GVBA 3HKZB 4IJLA 4IFDI 3X3MA 3CC7A 4LF7Q 4FF4A 4PZ8A 1A2UA 1HQMC 1HPCA 2UXCQ 1A2TA 1YNXA 5JPMC 4A3GB 4IJHA 4NW2A 1EYCA 2WB1G 2CWPA 3TBIB 3X3NA 5C3EB 1LO5D 1SMYC 4H44C 1KRTA 3A8KE 2R93B 3I2ZA 1LTSD 1E24A 1G291 2AWNA 1VDZA 2GA4B 1Q46A 2H4OA 2RKSA 2Z6BA 3RZOB 1IYVA 3Q6SA 2A68D 4IPCA 1I6VC 3NHHA 1EY8A 1ML0D 5IP9G 3CF5A 3PF4A 4RG1A 3F8TA 2Q8IB 2BDNA 4DV0L 2XIWA 4LWCA 4BXXH 4BY1H 2ZM6Q 3CQZH 3BZDB 5DAUA 1A3TA 2EYJA 1QE6A 1IBMQ 4CDFC 4QF4A 4A3KG 4DV3Q 3GTQH 3DMUA 3CRKC 3PMFA 1QZHA 1BBWA 1RHPA 2F03A 4IOAA 2BH2A 2D5DA 1WTQA 2IX0A 5FLXE 4B9WA 1O7YA 3RMHA 5J39A 2LY7A 3A8IE 4LF5L 4A3IB 1PH9A 2NVXB 1K83H 4MNOA 1IYJB 2I5HA 3I73A 1JT8A 3G48A 2WB1E 1PFBA 3M3YH 1I4XA 1JCKB 1ESFA 1BBXC 1LTRD 3S14H 2QDBA 3FKIG 4JOIC 1TWCH 1NBWA 1HUNA 4FDBA 4NP5A 5C4XG 2KHJA 5JEAG 1PH1A 5I9PA 3ITPA 2I5MX 2FFKB 1Z7TA 1PVOA 2F0PA 1K8MA 1XNRL 1LT4D 1PYSB 1N33L 3PUVA 3FEWX 2K5QA 1J5EQ 5E4WC 5JAVA 4EQPA 1PMRA 1VQ5A 1K0SA 4N9TA 1K3BC 4R8IA 2JJQA 4CJ2C 2I46A 4AYBE 3J7AV 4LFBL 3CPFA 2EVBA 3NBHB 4OWTB 5C0XH 5EGTA 3OIPA 1TWGH 4PQXA 5EKKA 3P1HA 2CHBD 1PTOD 1ENFA 1N8RC 3EN2A 2EJFC 2F4VQ 1R4QB 4TKOB 2L12A 1L0XB 1YNJD 5CV7A 3GDEA 3URYA 2E76C 4CDCC 2NVQB 5T1IA 3V96A 1I50H 1DM0B 4AIMA 1N32Q 1CSQA 2K5WA 3SHLA 1LTBD 2KCCA 4R9WA 1X56A 4NB3A 3MXNA 2R93G 4GKJQ 1PFMA 4C3HG 1R4PB 1VQIA 1HZAA 3IRBA 4LF8Q 1SYFA 3HOZG 3IKJA 1BDOA 1I4HA 3S1NH 4NMZA 4KK7A 3A55A 3NWSA 1V1PA 1PLFA 3M4OB 3TREA 1RJTA 3FMCA 3ERQA 2ZXPA 1BBUA 3T1HQ 4LF4Q 2Z6KC 2XWBB 2A69C 4F8MA 1H9KA 1CKMA 4ZKBB 2EY6A 5M3MH 1HHVA 4J15A 3KF8B 3H0GG 3HOXH 2PQAB 2A8VA 1MGSA 4ILWA 4IFDG 4QCLA 4JI5Q 4JPBW 3MZ5A 5GROA 1EZ6A 5BN4A 1CZWA 2JA5B 2K03A 4PMBA 2LMCB 2FMMA 4OONA 4YY3L 1WVLA 3K5LA 2A19A 1O7IA 1MD2D 2MJ8A 3A7AB 2FJ2A 4JYAQ 1E1OA 4BBRH 1GD7A 4JI2L 1MSGA 4JBWA 2HHHQ 2HT1A 4P2CB 4G7HC 3QOLA 1PH6A 4FXGC 4N8X1 2IT1A 3RLFA 4DR7Q 3NE5B 3OTOL 2Q8RE 1Z9FA 1D8LA 3U4VA 2M00A 3SEBA 4UHVA 2K5VA 5IP7G 4A3LG 5IYDG 4IPHA 1QJOA 3AB9A 3CQZB 3L9AX 2VQEQ 3DHQA 2UUBL 3CC2A 3NTHA 4ZUIA 5HY6A 4LF9Q 4BY7H 4GKKL 3GTQB 3PUXA 2KA7A 4X62Q 1WCMG 1U4PA 2EIFA 1SJED 4OO1H 1DZ1A 2D0OA 4ME5A 4V190 2R7ZH 3M7NA 3D31A 1IBKQ 4A93G 1NR2A 3JAME 5M5WH 5C0XI 3JAMi 1K83B 2IX1A 1SEBD 1QVFA 3M3YB 1ZEQX 1OXUA 2K01A 2AMCB 2KCTA 3H3VH 2MGSA 3T4AC 1TWCB 1EY6A 3W2DA 3D6CA 5H1SE 2UXCL 3HOWG 1HRJA 4OIKA 2Y0SB 1PTOH 1ESRA 4TRDA 5C4ZA 4L5TA 1WD0A 2JA7H 1AN8A 4L5QA 1PV4A 2KEDA 1JOQA 1ET6A 1JOOA 4RKLA 5C6AA 3I4NH 5BR8Q 3PIPA 2BH8A 5C3XA 1A3VA 2VUMH 1JJGA 4KY5A 2ICEC 2AQ1B 1T5EA 5C44H 2ZM6L 1TWGB 3UDFA 5CV5A 2K5NA 2SDFA 1Q8IA 2R3ZA 1JE5A 2RCFA 4JI1Q 1IBML 3GTLH 1ICWA 2PNHA 2HQEA 4DV3L 1STNA 1K28A 4DR3Q 3CCUA 3U4ZA 4RHRA 1G2SA 4ZK9B 1PZJD 1RCVD 2C9OA 1U4LA 1U9RA 1LT6D 4IQZA 4UPAA 5EAYA 3AMUA 1I5FA 3G4SA 5IYBH 3D6WA 4XTCS 1Y1VH 4BWGB 4HMJA 5I9OA 1A0IA 4K6LA 2KCNA 2PW7A 3S1NB 3HKSA 2PI2A 1HNXQ 1EU4A 4Q5VA 2K50A 2YYZA 1X55A 4BXXG 1HCZA 4BY1G 1Q12A 1Q3LA 2EE1A 4XQNA 1AFPA 2Q8TA 3NBHA 3K5NA 4G7OC 5M3MB 4A3DH 4N9PA 5ELDA 4EQOA 1G2TA 1NR4A 3HOXB 3EROA 3MHBA 5FO8B 1QZGA 1B44D 5D65A 5CORA 5FLXL 4LUZA 1EY9A 1SRUA 1W3SA 4JOIA 4RAUC 5T1GA 1FR3A 2UUAL 1ILPA 1I3QB 1EYGA 1NMGA 1Q8KA 5E4XA 4OO1I 4RCNA 2YU9B 2NVYH 4QL5A 1BQQT 1TS4A 5EQ0A 4K8IA 4BBRB 1YNND 2HD3A 1V1OA 2LXJA 2VY3A 5I6WA 3S1QH 1VQDA 4JBJA 3H3VC 1CSPA 5IGBA 2B2YC 4A76A 2B29A 4DR1L 1D1KA 2EPBA 4EQ5A 3K0XA 3ZJYC 1NY4A 3K6OA 4JVZA 1SYBA 5C4JH 3GTJB 1V9PA 1EFWA 5CV6A 4X65Q 1VQKA 1EQQA 2PZTA 5C0XG 4LF4L 4DV2Q 2PQAA 1KDAA 1MIUA 1D5ZC 1XTDA 2R7ZB 2MPMA 4G7ZC 3CW2C 1B1ZA 4KKSA 5M5WB 4RKBA 4RGOS 5FK9C 3QOJA 3G7LA 3AQQA 3O13A 2AKWB 1TWAH 2PQEA 3MXGA 1RIPA 5TSSA 3AEVA 1HNZQ 3FPPA 2HDLA 4EX5A 4K0KQ 1VQ6A 3A5UA 1JC7A 2Z8LA 4DAPA 1BCPF 3HOVH 1TT2A 2HCCA 1PTOB 1M1KC 2ZXRA 3CMAA 2VZAA 1P8LA 4DKAC 4OHJA 2Z6KA 4FF3A 2PYKA 1AE2A 2DJGC 3L2PA 2RQXA 4OXPA 2IL8A 3VYTA 1PH5A 4DR7L 1CT1D 5JVH3 4CBVA 3FKIH 1X65A 5CC4A 3ND8A 2GVAA 2I07B 2QF7A 2RDFA 1YHAA 1SNCA 1HA6A 2FHTA 5M3MG 5A35A 4HR7B 4QY7A 2OTLA 3RZOH 1S5FD 2WP8J 2VQEL 1E3PA 1I4QA 1CK1A 1TVXA 2IWHA 4LF9L 5CV4A 1EY7A 1TY2A 1NSNS 1DGSA 1XMOL 3D3RA 1HUMA 5E1FA 4X62L 2F0HA 2AQ2B 2UUCQ 3SE0A 4DR4L 5FKAC 2ZTEA 4Q0FA 4ZQ3A 2L1BA 2RSNA 1GM5A 2ASBA 4A3JB 4R4CA 2F0DA 4DK6C 5KNCA 3I4OA 2ICIA 3RLOA 1X6OA 4DV5Q 1F9QA 2MP1A 4A3IH 2A69D 1A63A 1YZ6A 3GV6A 4NKLA 3FDTA 3Q0AA 3T1YL 2CFMA 1VMPA 2OQ0A 1HNWQ 2B3GA 3EA6A 2WAQB 3E6ZX 3A56A 3VYUA 3K57A 3GQBA 4JBKA 1F9RA 2UXBL 1H9SB 3BDOA 4LAAA 1PZKD 5K36H 5IOCA 4BY7G 1D2BA 1BUVT 4A3DB 3IAYA 2R92H 1SAPA 1YJ9A 1UE5A 2UXDQ 4OO1G 1QWYA 3S2DH 2WKDA 5ELFA 3HOUG 1HTLD 3JAML 1V1PB 1A62A 1LYLA 1UEBA 1EOTA 3D0FA 3I91A 3KOJA 4K2KA 3R8BA 3FP9A 3NK9A 5G3LD 3STBC 2J4XA 3I72A 4ZKCB 2NVYB 5CV8A 3EIVA 4DR3L 4P75A 3CHBD 4IZ8A 4A3MH 2NZ1D 4TSSA 2A74C 1STEA 1H9RA 2EYHA 2K75A 3S1QB 4C3IH 4JI6Q 4DR2Q 1II3A 2R6GA 4ZCKA 2JA7G 2IY5B 4R1JA 5LL6X 3I4NG 2XGTA 2WKCA 4GLVB 3TS0A 3DXJC 1L0YB 2VUMG 1IL8A 5A2QL 1HNXL 5C4JB 4JI0Q 2TSSA 1Y8NB 1B8AA 4F88A 4DXGA 1CTMA 2NN6H 3VA7A 1KTKA 1UE7A 1CKNA 5C44G 2B63B 2F0WA 3C1EA 2EYLA 3KBGA 4YWLA 2HUGA 4KHZA 4DUYQ 4M8AA 4X64L 1IZ6A 3M4OH 1SYCA 2D0PA 2HCIA 3OIQA 2NZHA 3M4QA 1PH2A 1MKHA 1VQEA 3K5MA 1TWAB 1EL0A 1EFID 2B39A 4DN4M 3E9IA 4YHHQ 4WFN3 1TKWB 1PFNA 1PH8A 1JWMD 4H0LC 2IPKD 4KHPL 1B9MA 1WYDA 4DUZL 1A3UA 1QVCA 1YIJA 3HOVB 4HJ9A 1XMQL 2JA5H 5FJ8H 1Y1VG 5DEHA 2OXPA 3A54A 5JJIA 5CGKA 1VQPA 4JI4Q 1QNKA 2KUMA 1EOVA 3PGZA 3OPOA 4GNXC 3FKIB 1GJXA 1TWHH 2B2TC 1SBBB 4K14A 1AH9A 2F3VA 3ULPA 3TS2A 5JJKA 1VQGA 2A6HC 2KOLA 1PRTF 3J80E 2V4DA 2JN4A 3I3CA 1OXVA 2VW9A 4JI3Q 2ATWA 4A3DG 3J80i 1JOKA 3PSIA 1YJNA 2L5TA 2AHOB 3KDFA 4XYQA 5FO9B 3S1RH 1PH3A 1HR0Q 1YNNC 1EZ8A 3UE0A 1I6HH 2RHSB 3NELA 3RR5A 2L4NA 1PHJA 2WV6D 3Q22A 1TQOA 1YEZA 1XNQL 4QUCA 3E5SA 3GV3A 5AJ3L 5KNBA 2B2YA 4KY7A 4Y7NH 2K6AA 1CHQD 4GNXB 3I4MG 1GHJA 4JW0A 2CWAA 5FLXc 1VQLA 4LFCQ 3MA2B 2G9HD 3H94A 3N52A 5IGFA 3I90A 3BDCA 1E0BA 1ILQA 2KEEA 3CD6A 1EEID 3R2IA 4O1NA 2IHFA 4LF6Q 4C1NI 1YVCA 4ULLA 2Z4IA 1DOKA 3K8AA 2JA8H 3T51B 4B3MQ 5IWAL 5D14A 3K58A 3C3LA 4GOPC 1S3OA 2HQLA 1IW7C 1SE8A 1KHIA 4YWMA 2R92B 2VL6A 1D5MC 3VR4A 4B3TL 3PO3G 2E2HB 1C9OA 4XQQA 2N78A 4J1MA 3S2DB 3MFGA 3EJIA 2NN6I 1CFMA 1Z6HA 1FD7D 1UEAB 1KIXA 3D4RA 3S24A 3J81E 1GUSA 1HTPA 1X32A 5EPJA 3M85A 5ELEA 3J81i 4MN3A 3MC0B 2A5HA 3CKIB 3W1GA 1V1QA 4QIWE 1EWCA 3FVQA 2PO4A 4A3MB 1WTPA 3DWPA 3KF6B 3R93A 1N34Q 1A8VA 3L7ZC 4B08A 2KQ3A 3H09A 2Q2UA 4C3IB 4JI7Q 2JA9A 3SXHA 3HKZG 2XNAC 2PZUA 1XJVA 1VQOA 4A3GG 5C3EG 5CR3A 1B3QA 1EUJA 2Q2IA 4H7BA 4NXMQ 5IGGA 1S72A 1H9SA 4KY6A 1J8IA 3DWAA 5LMUQ 3BZCA 1SNPA 3NTIA 1W6JA 3T16A 1EIHA 2UU9Q 3UE1A 4V0BA 3S9WA 3NSWA 3CU7A 5IT9E 1C7YA 1SNQA 3D8GA 5JVG3 3NPPA 2CH4A 1IL2A 2WFWA 1N9WA 3K80C 2PMZE 2NB0A 1JB3A 4DAVA 1HFGA 4ZLTF 3J81j 3DWQA 1ASYA 2ZJQA 1HQRD 3Q8DA 1GKHA 4IUPA 1PYBA 3HKZE 3KJOA 3ICEA 2ZTDA 4HIOA 1O78A 4A3IG 1I3QH 4KN4C 1R9TH 1EWHA 1PXUA 2YU9H 2IW3A 2VQFQ 4DR2L 3BYTB 3EVQA 1TWHB 3KFUA 4DV7Q 1GUGA 4C2MB 4S3SA 5K36G 1X3QA 3AFPA 3KLRA 4OELB 3F2BA 1H9MA 1RODA 4HEDA 2R92G 2OF1A 3DUZA 4DXFA 4IO9A 1LTTD 3S1RB 2K1BA 3RZDB 1JJ2A 3BZKA 1QUQB 1I6HB 2PPBC 4DR5L 2RCNA 3GTJH 2AQ3B 4LFAQ 1FVIA 2CW0C 3KUPA 1VQMA 2KBNA 5CMDA 1M8AA 2E5LQ 1RF2D 4Y7NB 1O80A 1MJEA 1U4MA 1WOCA 3OWFA 2OT2A 4C3IG 2E74C 1IBLQ 1STBA 1WFQA 1CM9A 3JAMc 4C3JH 4DV6Q 1SXTA 4GLAC 5CBEE 2F0NA 1WTOA 4PMWA 4LF7L 4LUOA 3G6EA 1FYCA 2JA8B 3NQIA 5I2YA 2NN6G 4DV4Q 4BA1I 2K5DA 4I7ZC 2M2LA 4OX9Q 3STBD 4ABNA 3CRLC 1O7LA 3CCJA 1B70B 4QB4A 2YTVA 2YTXA 3FPUB 2Q2TA 1XXGA 3ONAB 1NUCA 1L1OC 1Q82C 1MBYA 5FO7B 5A2QE 4B3RQ 3CAMA 4RMFA 3BYYB 3PUYA 4LUVA 1D6EC 5M5YH 4KI0A 4JV5Q 2R7DA 3K59A 5JEAJ 1SR3A 1C48A 1A6XA 4GNXA 1LTLA 2JA5G 2B2TA 5FJ8G 4C1NK 3V05A 4CDDC 1OXXK 1C0AA 1XX8A 2L11A 1STGA 5GQOA 1LLRD 4A3JH 2KHSA 4BBSB 4IN3A 4X3KA 5J1ZA 4L5SA 1DXMA 5D3IB 3J80L 4LW1A 1VQ8A 4CKBA 3KK7A 1L1OB 1LV9A 2DJFC 5DLQE 1GOZA 4IALA 5DNFA 4JG2A 3VYSA 1SNDA 3TEHB 1VMCA 1N36Q 1CA6A 4U68A 4A3CH 1QCBD 2NBFA 4DNRB 2OCEA 1KDCA 1OO9B 3RUZA 2F4IA 2O4XA 2XRSD 3S15H 1V43A 1J5EL 3KJPA 4R4QA 1CKNB 3HEJA 2JP1A 4P72A 3KF6A 4GN3B 3I8ZA 1LTAD 1UWVA 3P75A 2X69A 5COYA 2A1AA 4P71A 4X3SA 2NYZD 3QB3A 2NVTH 2A6HD 2PZWA 3RN2A 4OWXB 2QW7A 1IHZA 2RHQB 2KVMA 1R9TB 3EFXD 1EEFD 4MHEA 1DD2A 3L0OA 2JSOA 4JI7L 4GOPA 2F4VL 3TDQA 1CI3M 1BF4A 1HZBA 5DM73 4Y52H 4X3TA 4TVAB 1F9SA 2Y0SG 4IFDJ 1N32L 4NXML 3H3VI 2F3IA 4GKJL 1Y14B 2HIVA 4NXNQ 4LF8L 1WI5A 1KNEA 4A3FH 5LMUL 1WD1A 2LKVA 4AQYQ 5KRUA 4IPGA 3J81L 5C5LA 2JEAI 3NUCA 2EOTA 3BJUA 2F0UA 3SK5A 3T1HL 3K5OA 4X3UA 1NE3A 2B63H 4HCEA 3UI2A 3OMGA 4H02A 1ENAA 3LGJA 3KDFB 1PDQA 4N8FA 1TXYA 2PW5A 4RFBA 5KYLA 2F0JA 3WWVA 1HR0W 1B9NA 4JI5L 2FXQA 2Z1CA 4C3JB 2JEBI 3EBEA 4QQBX 1IW7D 5JOBA 3TP6A 1X3FA 2F0SA 1YHBA 2Y0SE 4DV0Q 2EYPA 4A3BB 5IGCA 4JYAL 4JC0A 4XT1B 4MTNA 1Y1WB 1UUPA 1X3GA 2HHHL 1CQVA 3HFZB 3A74A 4K5XA 4A3EB 2IHEA 4EGVA 1KABA 4IUQA 4RHSA 1LABA 1I4PA 3M9BA 1QUQA 5IT9L 4LF5Q 5EPLA 4CKCA 4DNIA 5M3FH 5E3FA 1S5BD 1VCIA 3LWEA 2EJMA 3M7GA 4X66Q 1Q81C 5M5YB 3HOXG 2E75C 3CCSA 5I6YA 3MWYW 1BXTA 3OHXC 1EY5A 5KNDA 3I4LA 2VXWA 3CP0A 3SK4A 2BDOA 2M9VA 4HIDA 5DM63 2E5LL 1M4VA 3TP7A 1U5KA 1IBKL 3VR3A 4UDUC 1XNRQ 4C3HH 3OMCA 3GTGB 4OGQC 1LT3D 1K9MC 3HOZH 3H6MA 1ASZA 2XSCA 1N33Q 4BBRG 3ND9A 4FF2A 3ULJA 3PQIA 4DV6L 3UDGA 4FF1A 3C46A 2KCMA 2VB3X 2DUDA 3PUZA 3C2PA 2RA4A 3K0YA 4LFBQ 1B2TA 3S1MH 3FRPB 1GUWA 5IGEA 1CHPD 5IYCH 1SMXA 3PIP3 1KL9A 4K6DA 1WTXA 4PZ7A 5JJZA 4DV4L 1QOHA 2CVRA 2Q2HA 4UP8A 5HGTA 1D1IA 4JCVE 1X3PA 1UAPA 5C4HA 3OSOA 3S15B 1FL0A 5C3WA 5BR8L 2MNAA 3HP3A 5GAEC 1I94Q 2L9HA 5GAHC 2E2HH 3CPWA 3GO5A 2IX3A 4B3RL 2OWOA 2CH4W 4HJ5A 2R7ZG 1S5ED 2ENBA 1QG7A 1XPUA 2WB1B 2JE6I 2NVTB 1HZ9A 1XPOA 2JK8A 1DONA 1BCPD 4JI1L 4RGTA 1JJCB 1QB5D 4C3JG 1VF5C 4B3SQ 4UP7A 4CJ1B 4MTKA 1EQTA 3V2TA 1GVPA 4J6HA 1B7YB 1K73C 4PMCA 1BO0A 2I5LX 2QDLA 4YWKA 1VQBA 1SROA 2B2UC 3DM1A 4A75A 4A3LH 1I4GA 3VA5A 1L1OA 3LWUA 1TS3A 4P74A 2CW0D 1AZQA 2EYOA 3PUWA 1EQRA 4GS3A 1Q7YC 4A3FB 4AYBB 4A3KB 5C5MA 3GTMH 3GP7A 4QMGA 3J7A5 1WCMH 1MI2A 4I65A 1Q90A 1NCVA 1U0LA 2YV5A 4A93H 5ELNA 1XPRA 1HJPA 3MVVA 2JQOA 2MHVA 1C4QA 2B2WC 1EY4A 5FLMH 3K7AH 4HJAA 3TN2A 1GXDC 3KLSX 3DLLA 2K05A 2RF4A 4CDEC 3OTOQ 1FGBD 5IIFA 2E2IH 3HOWH 4DFAA 4DA2A 5C4XB 1J6QA 3PV0A 1GHKA 3H91A 2JXMB 5IE8A 4A3JG 1X9NA 1D7QA 1EWIA 1CA5A 1ONLA 3BG3A 3F2UA 5C0XJ 4ALPA 5IYBG 3I55A 2UUBQ 3RNUA 3J7AF 2SNMA 2KENA 4J8QA 2WAQG 3A0JA 1JMCA 4A3CG 2PMZB 4DK3C 2ID0A 4DU9A 4C2MH 1XWEA 5M3FB 4NXNL 3ULLA 2KECA 1RTOA 4IUVA 4CJ0B 4AQYL 1HH2P 5GADC 1SDFA 1BVSA 1KLGD 3OWEB 3J80c 4X65L 3RZDH 2E2JH 4KD3A 2N55A 4KMUC 5E7NA 4DV2L 2P5ZX 1PTOF 3OOCA 2DNCA 4GLXA 1KAWA 1KQSA 3J7YW 2K33A 3E3XA 1EYDA 2MO0A 5IY0A 5CYUA 4C3HB 1PYWD 3HOZB 1ET9A 4RGMA 1WTHA 4IUTA 4G57A 3L3OC 3HOYH 1W2BA 4YIJA 1SE2A 2LS01 1WJJA 3F1ZA 1HNZL 1ZKOA 4G4KA 2E8GA 1GUNA 4RCOA 3S1MB 2D62A 2K52A 2N88A 3W5OA 4XYOA 2JA6H 3BVGA 4K0KL 3KYHC 1C8CA 1K8AC 3NWTA 5J22A 2WAQE 4YCVA 2XTIA 1WTWA 1CQFA 1F77A 3P20A 4HCSA 4AYBG 4A3FG 2F0LA 1L0WA 3H0GB 4YCWA 1AP0A 3CCEA 5LHY1 4DAYA 2EY5A 2YTYA 3D4WA 4ODGA 4XT3B 3CCVA 4BS9A 3DM3A 1KNAA 2B63G 2WINB 3QR8A 2F0QA 1WTVA 2F0MA 3G6JB 1SFOH 4GN5A 1KC8C 4X66L 1S4ZA 1VQ7A 4K5VA 5D3DA 2R7FA 1JR0D 2F0OA 4F7XA 1F2YA 5F2DA 4I7AA 4KHVA 3J81c 2UUCL 1EIGA 1RL2A 2ZJPA 1VQCA 1VQNA 1T5XD 3N6RA 3TZDA 3HOVG 2ZXOA 1GUOA 2G9DA 2OEOA 3HS0C 3CCLA 1EY0A 4DF7A 1PRTD 4ID6A 5EBCA 4DV5L 1PH7A 1VS0A 4GOPB 3MFYA 1G6PA 2QCPX 3TP5A
chains in the Genus database with same CATH topology
3U9OA 3GTMB 1CZGA 2FMCA 1WCMB 2F0TA 4R8NA 4IUNA 4A93B 3WOEA 2EY2A 1ZYRD 3SR1A 2NUCA 2F0IA 3K7AB 3WOFA 3KLSA 4XDXA 3ZYYX 3T56B 2E2IB 1TR5A 1DOMA 3MEHA 1TU2B 1AZPA 3HOWB 3U9SA 3NP8A 2BE5D 2F0GA 3VYRA 5NUCA 3S2HB 2CQAA 3GTOB 1ENCA 4FXKC 4WORA 4DNTB 4HTHA 1E2VA 2NTSA 1WTRA 2X6GA 4CGYB 2FINB 2RDGA 4IURA 4KN7C 5EBDA 5BN5A 4L63B 2A73B 1BCPC 1A15A 2K7VA 4K2LA 3Q24A 1BOSA 2IJ0A 4HMIA 2F0KA 3W3AA 4ZUJA 2E2JB 4K5WA 2XWJB 3MAQA 5ELBA 4RA8A 1AW7A 3R3OA 3C1FA 2B2UA 2VNUD 4RWSC 1NAPA 3HG9A 2BA1A 4CHTB 4KV6A 3DEPA 5JPNC 2B2VA 1SE3A 3T13A 3HOYB 1K8OA 5K5PA 4KKUA 4O42A 2O5IC 2JA6B 3BVMA 1SNOA 2NTTA 4Z9CB 4BY1B 3IL8A 5EJWA 1BCPB 2WACA 2E2DC 1G6ZA 2B2WA 3SK6A 2XVSA 2H1EA 4FXDA 2EXZA 3BVZA 4HN7A 3A8JE 4MIUA 1FNVA 2D9UA 1SFOB 4NDXA 1FNWA 1MSHA 3S14B 2A6EC 2TMPA 2RVLA 1S5CD 1JWUD 1VF7A 3BDLA 1OXSC 4OL7A 1DJRD 1E2ZA 2DN8A 1B3AA 3VR2A 4UAIA 2F0EA 2J7ZA 3D4DA 3QG1A 1W6KA 1OXTA 5I2XA 1HXYD 2L0CA 4H13C 4HSPA 4K8JA 4F87A 4C56C 1TS5A 3TSSA 2PNRC 3R2TA 2EZVA 1F2ZA 1G91A 1QILA 3M4YA 1EU3A 1RDPD 4FYDA 1DCZA 4B9XA 2A68C 2XRQD 1Z47A 1IYUA 1Q1BA 1KDBA 1Y8PB 1DOLA 4XIGS 1I50B 3VR5A 4RH6A 3E0JA 5FOBB 2R61A 1XTCD 2QEJC 2JYOA 1TWFB 2EDGA 4JK1C 3SK8A 1SSOA 2SOBA 5BN3A 1J9OA 4FNFA 1AEXA 2ZT9C 5AFWA 5IODA 4PV1C 4OIJA 2D2CC 5M9OA 1JORA 3MXPA 2EJGC 4RGNA 3T53B 4HAEA 4ZRZA 1B50A 1SMYD 3A7LA 2BCOA 5ELCA 4TQUS 3GD7A 5EKLA 1RD9D 3IFTA 3P7JA 4KKTA 5EPKA 1IKMA 5ISRA 5KEEA 2AUKA 2K04A 1V8QA 1PRTC 1I4RA 3EQLC 5KYIA 3RD4A 2F0FA 2C5CA 4DK0A 3IFDA 1O7ZA 1UNSA 1Y8OB 2B8GA 1PTOC 5HURA 1IKLA 2AWOA 1ZYRC 2RDHA 1RTNA 1YNJC 5JEAH 4BY7B 3KF8A 2BOSA 3PO2B 1JQYD 3Q23A 1D5XC 1B4OA 1LTGD 3HOUB 1PZID 4GZYC 2BE5C 2LFNA 2O5JC 1JICA 1S5DD 5KGUA 1F2LA 5M5XB 1PRTB 2PCFB 1G8ZD 2DNEA 5EKIA 2DY8A 2EYMA 4LJZC 4BA2I 1HFNA 3NBIA 1DYQA 4KJOA 2BA0A 3GTPB 5G3LF 2JA7B 1EYAA 3WDNA 1LACA 3NXWA 3QIAA 3I4NB 3SVMA 4WJWA 1TIID 4LK1C 2NWGA 4DGZA 2VUMB 4IUUA 2VB2X 2EYFA 1STAA 2EY1A 2X6LA 3HGBA 2HDMA 5C44B 2K28A 1TS2A 2XN9C 3HZXA 4PNYA 2O2LD 1Y69U 3BS1A 3KBXA 3HRZC 2QILA 1Q1EA 2QKIC 3I70A 3GTLB 4DK1A 2K32A 5LL6S 2F1MA 4KTAA 5I4DA 2J0TD 3TMEA 3TZUA 4L6TB 4IFDH 4CKEA 3GTKB 3MXUA 3QJYA 1B53A 1ZXTA 1KLUD 4WRDA 3AU7A 1Y1VB 3TP8A 2RSOA 2MUYA 4FVMA 1GUTA 3S17B 3NQTA 2DY7A 4ZYSA 1SYDA 4LMQD 1SYGA 1JWSD 1U4RA 2B8FA 1F9PA 1H9JA 4M1UB 1LT5D 2SEBD 1KAAA 1F2MA 3QWNA 2B2VC 1SYEA 1TY0A 3VR6A 4E6IA 1E2WA 4U673 2F0VA 1BR9A 4QIWB 2RBMA 3I4MB 4QUFA 4FP5D 2L55A 4ZAIA 3MTSA 1SJHD 3SDZA 1JE4A 5KIXA 1EQVA 1SNMA 1XYIA 4KD4A 3PIO3 3DEOA 1SE4A 3LX0A 1FNUA 1STYA 3LNNA 2WIIB 3PO3B 2KJXA 1RKNA 3NTKA 1HA5A 1LTID 3QO2A 1STHA 2A6ED 1BNZA 4EQNA 4L8JA 4HSVA 1QNUA 4EVOA 2SNSA 3S16B 4XXEA 5CV9A 5CBAE 2F3WA 4KJNA 3OW7A 5IGDA 4XQJA 2Z4HA 2AUJD 4FO2A 3HKZB 4IFDI 3X3MA 4FF4A 1A2UA 1HQMC 1HPCA 1A2TA 5JPMC 4A3GB 3TBIB 4NW2A 1EYCA 3X3NA 5C3EB 1LO5D 1SMYC 4H44C 3A8KE 2R93B 1LTSD 1G291 2AWNA 1VDZA 2GA4B 2H4OA 2RKSA 3RZOB 1IYVA 3Q6SA 2A68D 1I6VC 3NHHA 1EY8A 1ML0D 2Q8IB 2BDNA 2XIWA 3BZDB 5DAUA 1A3TA 2EYJA 1QE6A 4QF4A 3DMUA 3CRKC 3PMFA 1RHPA 2F03A 2D5DA 1WTQA 2IX0A 5FLXE 4B9WA 1O7YA 3RMHA 5J39A 2LY7A 3A8IE 4A3IB 2NVXB 3I73A 1PFBA 1I4XA 1JCKB 1ESFA 1BBXC 1LTRD 2QDBA 1HUNA 4NP5A 5JEAG 5I9PA 3ITPA 2FFKB 1Z7TA 2F0PA 1K8MA 1LT4D 3PUVA 3FEWX 2K5QA 5E4WC 5JAVA 4EQPA 1PMRA 4N9TA 4R8IA 4CJ2C 2I46A 3J7AV 2EVBA 5C0XH 5EGTA 3OIPA 4PQXA 5EKKA 3P1HA 2CHBD 1PTOD 1ENFA 2EJFC 1R4QB 4TKOB 2L12A 1L0XB 1YNJD 5CV7A 3URYA 2E76C 2NVQB 5T1IA 3V96A 1DM0B 2K5WA 3SHLA 1LTBD 2KCCA 4R9WA 3MXNA 1PFMA 4C3HG 1R4PB 1SYFA 3IKJA 1BDOA 1I4HA 4NMZA 4KK7A 3A55A 3NWSA 1V1PA 1PLFA 3M4OB 1RJTA 3FMCA 3ERQA 2ZXPA 2XWBB 2A69C 4F8MA 1H9KA 4ZKBB 2EY6A 1HHVA 1MGSA 4ILWA 4IFDG 4QCLA 3MZ5A 1EZ6A 5BN4A 1CZWA 2JA5B 2K03A 4PMBA 2LMCB 2FMMA 1WVLA 3K5LA 1MD2D 2MJ8A 3A7AB 2FJ2A 1MSGA 4JBWA 4P2CB 4G7HC 3QOLA 4FXGC 2IT1A 3RLFA 3NE5B 2Q8RE 2M00A 3SEBA 1QJOA 3AB9A 3CQZB 3L9AX 3DHQA 3NTHA 4ZUIA 3GTQB 3PUXA 2KA7A 1U4PA 1SJED 4OO1H 1DZ1A 4ME5A 4V190 3M7NA 3D31A 1NR2A 3JAME 5C0XI 1K83B 2IX1A 1SEBD 3M3YB 1ZEQX 1OXUA 2K01A 2MGSA 3T4AC 1TWCB 1EY6A 3W2DA 3D6CA 1HRJA 4OIKA 2Y0SB 1PTOH 1ESRA 4TRDA 5C4ZA 1WD0A 1AN8A 2KEDA 1JOQA 1ET6A 1JOOA 4RKLA 5C6AA 5C3XA 1A3VA 4KY5A 2ICEC 2AQ1B 1T5EA 1TWGB 5CV5A 2SDFA 1Q8IA 2R3ZA 1ICWA 2HQEA 1STNA 4RHRA 1G2SA 4ZK9B 1PZJD 1RCVD 2C9OA 1U4LA 1U9RA 1LT6D 4IQZA 3AMUA 3D6WA 4XTCS 4BWGB 4HMJA 5I9OA 4K6LA 2KCNA 2PW7A 3S1NB 1EU4A 4Q5VA 2YYZA 1HCZA 1Q12A 1Q3LA 2EE1A 4XQNA 1AFPA 2Q8TA 3NBHA 3K5NA 4G7OC 5M3MB 4N9PA 5ELDA 4EQOA 1G2TA 1NR4A 3HOXB 5FO8B 3EROA 3MHBA 1B44D 5D65A 5CORA 5FLXL 1EY9A 4RAUC 5T1GA 1FR3A 1ILPA 1I3QB 5E4XA 4OO1I 4RCNA 2YU9B 1BQQT 1TS4A 5EQ0A 4K8IA 4BBRB 1YNND 1V1OA 5I6WA 3H3VC 5IGBA 2B2YC 1D1KA 2EPBA 3K6OA 1SYBA 3GTJB 5CV6A 2PZTA 5C0XG 1KDAA 1D5ZC 2R7ZB 2MPMA 4G7ZC 1B1ZA 4KKSA 5M5WB 4RKBA 4RGOS 5FK9C 3QOJA 3G7LA 3O13A 2PQEA 3MXGA 5TSSA 3FPPA 2HDLA 1JC7A 2Z8LA 4DAPA 1BCPF 1TT2A 2HCCA 1PTOB 2ZXRA 4OHJA 4FF3A 2PYKA 2RQXA 2IL8A 3VYTA 1CT1D 5JVH3 4CBVA 5CC4A 3ND8A 2I07B 2QF7A 2RDFA 1SNCA 1HA6A 2FHTA 5A35A 4HR7B 1S5FD 2WP8J 1I4QA 1CK1A 1TVXA 2IWHA 5CV4A 1EY7A 1TY2A 1NSNS 3D3RA 1HUMA 5E1FA 2F0HA 2AQ2B 3SE0A 5FKAC 4Q0FA 4ZQ3A 2L1BA 2RSNA 4A3JB 2F0DA 5KNCA 2ICIA 1F9QA 2MP1A 2A69D 3GV6A 4NKLA 3FDTA 3Q0AA 1VMPA 3EA6A 2WAQB 3E6ZX 3A56A 3VYUA 3K57A 3GQBA 1F9RA 1H9SB 3BDOA 4LAAA 1PZKD 5K36H 5IOCA 1D2BA 1BUVT 4A3DB 3IAYA 1SAPA 4OO1G 1QWYA 2WKDA 5ELFA 1HTLD 3JAML 1V1PB 1EOTA 3I91A 4K2KA 3R8BA 3NK9A 5G3LD 4ZKCB 2J4XA 3I72A 2NVYB 5CV8A 3CHBD 4IZ8A 2NZ1D 4TSSA 2A74C 1STEA 1H9RA 2EYHA 3S1QB 1II3A 2R6GA 5LL6X 2WKCA 3DXJC 1L0YB 1IL8A 5A2QL 5C4JB 2TSSA 1Y8NB 4F88A 4DXGA 1CTMA 2NN6H 3VA7A 1KTKA 2B63B 2F0WA 3C1EA 2EYLA 3KBGA 2HUGA 4KHZA 4M8AA 1SYCA 2HCIA 3OIQA 3K5MA 1TWAB 1EL0A 1EFID 2B39A 4DN4M 4WFN3 1TKWB 1PFNA 1JWMD 4H0LC 2IPKD 1B9MA 1A3UA 3HOVB 5DEHA 2OXPA 3A54A 5CGKA 1QNKA 2KUMA 3OPOA 3FKIB 1GJXA 2B2TC 1SBBB 4K14A 2F3VA 2A6HC 2KOLA 1PRTF 3J80E 2V4DA 3I3CA 1OXVA 1JOKA 2L5TA 4XYQA 5FO9B 1YNNC 1EZ8A 2L4NA 2WV6D 3Q22A 1TQOA 4QUCA 3E5SA 3GV3A 5KNBA 2B2YA 4KY7A 2K6AA 1CHQD 1GHJA 3MA2B 2G9HD 3H94A 3N52A 5IGFA 3I90A 3BDCA 1E0BA 1ILQA 2KEEA 1EEID 3R2IA 4O1NA 4C1NI 4ULLA 2Z4IA 1DOKA 3T51B 5D14A 3K58A 3C3LA 1IW7C 2R92B 1D5MC 3VR4A 2E2HB 4XQQA 4J1MA 3S2DB 3MFGA 3EJIA 2NN6I 1CFMA 1Z6HA 1FD7D 1UEAB 3D4RA 3J81E 1GUSA 1HTPA 1X32A 5EPJA 3M85A 5ELEA 4MN3A 3MC0B 2A5HA 3CKIB 1EWCA 3FVQA 2PO4A 4A3MB 1WTPA 3DWPA 3R93A 3L7ZC 4B08A 2KQ3A 3H09A 4C3IB 3SXHA 2XNAC 2PZUA 5CR3A 4H7BA 5IGGA 1H9SA 4KY6A 1J8IA 3DWAA 1SNPA 3NTIA 1W6JA 3T16A 1EIHA 4V0BA 3S9WA 3NSWA 3CU7A 5IT9E 1SNQA 3D8GA 5JVG3 3NPPA 2NB0A 1JB3A 4DAVA 1HFGA 4ZLTF 3DWQA 1HQRD 4IUPA 1O78A 4KN4C 1EWHA 1PXUA 2IW3A 3BYTB 3EVQA 1TWHB 1GUGA 4C2MB 4S3SA 5K36G 1X3QA 3KLRA 1H9MA 1RODA 4HEDA 2OF1A 3DUZA 4DXFA 1LTTD 3S1RB 2K1BA 3RZDB 1I6HB 2PPBC 2AQ3B 2CW0C 3KUPA 5CMDA 1M8AA 1RF2D 4Y7NB 1O80A 1U4MA 3OWFA 2OT2A 4C3IG 2E74C 1STBA 1CM9A 1SXTA 5CBEE 2F0NA 1WTOA 4PMWA 1FYCA 2JA8B 3NQIA 5I2YA 2NN6G 4BA1I 2K5DA 4I7ZC 2M2LA 4ABNA 3CRLC 1O7LA 4QB4A 3FPUB 1XXGA 3ONAB 1NUCA 1MBYA 5FO7B 5A2QE 3BYYB 3PUYA 1D6EC 4KI0A 3K59A 5JEAJ 1C48A 1A6XA 2B2TA 4C1NK 3V05A 1OXXK 1XX8A 2L11A 1STGA 1LLRD 2KHSA 4BBSB 4IN3A 4X3KA 5J1ZA 1DXMA 5D3IB 3J80L 4CKBA 3KK7A 1LV9A 1GOZA 4IALA 5DNFA 3VYSA 1SNDA 1VMCA 1CA6A 4U68A 1QCBD 2NBFA 4DNRB 1KDCA 1OO9B 3RUZA 2F4IA 2O4XA 2XRSD 1V43A 3HEJA 2JP1A 3I8ZA 1LTAD 3P75A 2X69A 5COYA 4X3SA 2NYZD 3QB3A 2A6HD 2PZWA 1IHZA 2KVMA 1R9TB 3EFXD 1EEFD 4MHEA 1DD2A 2JSOA 3TDQA 1CI3M 1BF4A 5DM73 4X3TA 1F9SA 4IFDJ 1KNEA 1WD1A 2LKVA 5KRUA 3J81L 5C5LA 2JEAI 3NUCA 2EOTA 2F0UA 3SK5A 3K5OA 4X3UA 4HCEA 3UI2A 3OMGA 1ENAA 1PDQA 4RFBA 2PW5A 5KYLA 2F0JA 1B9NA 2Z1CA 4C3JB 2JEBI 1IW7D 5JOBA 3TP6A 2F0SA 2EYPA 4A3BB 5IGCA 4XT1B 1Y1WB 1UUPA 1CQVA 4K5XA 4A3EB 4EGVA 1KABA 4IUQA 4RHSA 1LABA 1I4PA 5IT9L 5EPLA 4CKCA 5E3FA 1S5BD 1VCIA 3LWEA 2EJMA 3M7GA 5M5YB 2E75C 5I6YA 3MWYW 1BXTA 3OHXC 1EY5A 5KNDA 3I4LA 2VXWA 3SK4A 2BDOA 2M9VA 5DM63 1M4VA 3TP7A 3VR3A 4UDUC 3GTGB 3OMCA 4OGQC 1LT3D 3H6MA 2XSCA 3ND9A 4FF2A 4FF1A 3C46A 2VB3X 3PUZA 3C2PA 2RA4A 3K0YA 1B2TA 3FRPB 1GUWA 5IGEA 1CHPD 3PIP3 4K6DA 1WTXA 5JJZA 1QOHA 2CVRA 5HGTA 1D1IA 1X3PA 1UAPA 5C4HA 3OSOA 3S15B 5C3WA 3HP3A 2L9HA 3GO5A 2IX3A 1S5ED 2ENBA 1QG7A 2WB1B 2JE6I 2NVTB 1DONA 1BCPD 4RGTA 1QB5D 4C3JG 1VF5C 4CJ1B 1EQTA 3V2TA 4J6HA 4PMCA 1BO0A 2B2UC 3DM1A 1I4GA 3VA5A 3LWUA 1TS3A 2CW0D 1AZQA 2EYOA 3PUWA 4A3FB 4AYBB 4A3KB 5C5MA 3GP7A 4QMGA 1MI2A 4I65A 1Q90A 1NCVA 3MVVA 2MHVA 1C4QA 2B2WC 1EY4A 3TN2A 1GXDC 3KLSX 2K05A 1FGBD 5IIFA 4DFAA 4DA2A 5C4XB 3PV0A 1GHKA 3H91A 2JXMB 1CA5A 1ONLA 3BG3A 3F2UA 5C0XJ 3J7AF 2SNMA 4J8QA 2PMZB 2ID0A 4DU9A 1XWEA 5M3FB 2KECA 1RTOA 4IUVA 4CJ0B 1SDFA 1KLGD 3OWEB 4KD3A 2N55A 4KMUC 1PTOF 3OOCA 2DNCA 3J7YW 2K33A 1EYDA 5CYUA 4C3HB 1PYWD 3HOZB 1ET9A 4RGMA 4IUTA 4G57A 3L3OC 4YIJA 1SE2A 2LS01 1ZKOA 4G4KA 4RCOA 1GUNA 3S1MB 2D62A 2N88A 4XYOA 3BVGA 1C8CA 3NWTA 5J22A 1WTWA 1CQFA 1F77A 3P20A 4HCSA 2F0LA 3H0GB 1AP0A 5LHY1 4DAYA 2EY5A 3D4WA 4ODGA 4XT3B 4BS9A 1KNAA 2WINB 2F0QA 1WTVA 2F0MA 3G6JB 1S4ZA 4K5VA 5D3DA 1JR0D 2F0OA 4F7XA 1F2YA 5F2DA 4KHVA 1EIGA 1T5XD 3N6RA 3TZDA 2ZXOA 1GUOA 2G9DA 2OEOA 3HS0C 1EY0A 4DF7A 1PRTD 4ID6A 5EBCA 3MFYA 2QCPX 3TP5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FOB B;  1JB3 A;  3CKI B;  1UAP A;  1BR9 A;  1XWE A;  2ICE C;  4FXG C;  4ILW A;  2WII B;  1BUV T;  1JC7 A;  1D2B A;  2A73 B;  5FO8 B;  2A74 C;  3L3O C;  5JPN C;  4FXK C;  3HRZ C;  2WIN B;  2QKI C;  3I70 A;  3FRP B;  3OHX C;  5FO9 B;  3G6J B;  3HS0 C;  3MA2 B;  1GXD C;  3CU7 A;  3KLS A;  5JPM C;  2XWJ B;  1UEA B;  2XWB B;  1PXU A;  2I07 B;  2J0T D;  3V96 A;  2E2D C;  2B39 A;  1OO9 B;  3T4A C;  5FO7 B;  1BQQ T;  2TMP A; 
#chains in the Genus database with same CATH topology
 4BBS H;  3U9O A;  4DV1 Q;  3GTM B;  1CZG A;  2FMC A;  1WCM B;  2F0T A;  2UUA Q;  5M3F G;  1HNW L;  2KHI A;  4R8N A;  4R4I A;  4IUN A;  4A93 B;  1SN8 A;  4L5R C;  3WOE A;  3AFQ A;  2EY2 A;  1ZYR D;  3SR1 A;  5J3B A;  2NUC A;  2F0I A;  4GN4 B;  3K7A B;  3WOF A;  3KLS A;  3ER0 A;  3NEM A;  4XDX A;  3ZYY X;  3T56 B;  1K8G A;  1I94 L;  5JJL A;  2UXD L;  1CUK A;  2GN5 A;  2E2I B;  1TR5 A;  1DOM A;  3MEH A;  1TU2 B;  4DR1 Q;  1AZP A;  3U9S A;  3NP8 A;  5IT9 c;  3HOW B;  2BE5 D;  2F0G A;  3VYR A;  5NUC A;  3S2H B;  4JI8 Q;  1TWF H;  1NNX A;  2CQA A;  3GTO B;  1ENC A;  4B3S L;  4FXK C;  4WOR A;  2NZO A;  4DNT B;  4HTH A;  1E2V A;  3U50 C;  2NTS A;  2QEX A;  1WTR A;  2X6G A;  5IYC G;  4CGY B;  2FIN B;  2RDG A;  2Z9H A;  4JI6 L;  4IUR A;  4ME3 A;  4KN7 C;  5EBD A;  5BN5 A;  3SGI A;  4L63 B;  4IPD A;  1NMF A;  2A73 B;  1BCP C;  3CME A;  1A15 A;  2G5D A;  2ES2 A;  2K7V A;  4K2L A;  3Q24 A;  2MFI A;  1BOS A;  2IJ0 A;  5ELO A;  4JI0 L;  4HMI A;  2F0K A;  3JC6 6;  3W3A A;  4ZUJ A;  2E2J B;  4K5W A;  2XWJ B;  3I7F A;  3MAQ A;  4IOC A;  5ELB A;  4RA8 A;  4UP9 A;  4DUY L;  1AW7 A;  3R3O A;  3C1F A;  2B2U A;  2VNU D;  2ZJR A;  4RWS C;  3VDY A;  1NAP A;  3HG9 A;  2BA1 A;  1UE6 A;  4CHT B;  2LXK A;  4KV6 A;  2V1C C;  1LUZ A;  3DEP A;  5JPN C;  2B2V A;  1SE3 A;  3T13 A;  4A3M G;  3HOY B;  1K8O A;  1E7Z A;  2K14 A;  4KKU A;  5K5P A;  4O42 A;  4YHH L;  1AE3 A;  1UE1 A;  2O5I C;  2JA6 B;  3BVM A;  1SNO A;  2NTT A;  4Z9C B;  4BY1 B;  3IL8 A;  5EJW A;  1BCP B;  2H5X A;  2WAC A;  3RN5 A;  3UDX A;  4YCU A;  2E2D C;  2ZTC A;  1G6Z A;  1XMO Q;  5LMN Q;  1VQ4 A;  2B2W A;  1KD1 C;  3PO2 H;  3SK6 A;  1YI2 A;  2XVS A;  1GO3 E;  2EQS A;  4JI4 L;  4A3B H;  4DR4 Q;  2H1E A;  3HOU H;  4FXD A;  2L15 A;  2EXZ A;  1Y1W H;  3J7Z C;  2PI2 E;  3BVZ A;  4HN7 A;  4A3E H;  3A8J E;  4MIU A;  4DPG A;  2CKZ B;  1FNV A;  5FLM G;  2D9U A;  1SFO B;  1K3R A;  4NDX A;  5M5X H;  1FNW A;  4JI3 L;  1MSH A;  3E0E A;  3S14 B;  2A6E C;  1S40 A;  2TMP A;  2RVL A;  1HR0 L;  1S5C D;  4O0A A;  1JWU D;  3T1Y Q;  1VF7 A;  3BDL A;  1OXS C;  4OL7 A;  1DJR D;  3GTP H;  1E2Z A;  1E22 A;  2DN8 A;  3E9H A;  1B3A A;  3VR2 A;  4UAI A;  2UXB Q;  1YHQ A;  2F0E A;  2J7Z A;  3D4D A;  3QG1 A;  2C35 B;  1W6K A;  1OXT A;  5I2X A;  1HXY D;  3PF5 A;  1JB7 A;  2L0C A;  4H13 C;  4LNQ A;  1PH4 A;  3AYH B;  4HSP A;  4K8J A;  3GTG H;  4F87 A;  1FJG Q;  4C56 C;  1EIF A;  1TS5 A;  4LFC L;  3TSS A;  2PNR C;  4MZ9 A;  3R2T A;  4OWW B;  2EZV A;  1F2Z A;  1G91 A;  4LF6 L;  1QIL A;  3M4Y A;  1EU3 A;  1MHW C;  1QVG A;  1RDP D;  1PA6 A;  4FYD A;  1DCZ A;  4B9X A;  4B3M L;  2A68 C;  2XRQ D;  1Z47 A;  4WJ4 A;  1IYU A;  1Q1B A;  1Q86 C;  1KDB A;  1Y8P B;  1DOL A;  2MO1 A;  4XIG S;  1I50 B;  3VR5 A;  4RH6 A;  3E0J A;  5FOB B;  3GTK H;  1X3E A;  2R61 A;  1XTC D;  2QEJ C;  4DR6 Q;  2JYO A;  1TWF B;  3HOY G;  2EDG A;  4JK1 C;  2EXD A;  3SK8 A;  1E1T A;  1SSO A;  2SOB A;  5BN3 A;  4A4I A;  1J9O A;  4FNF A;  3S17 H;  1AEX A;  2JA6 G;  2ZT9 C;  5AFW A;  5IOD A;  1N34 L;  1ICF B;  2K5H A;  4PV1 C;  1BKB A;  1VQ9 A;  4OIJ A;  2D2C C;  5M9O A;  4X64 Q;  1JOR A;  3MXP A;  2EJG C;  4RGN A;  1P16 A;  3PIO A;  3T53 B;  4NPS A;  4HAE A;  2N8N A;  5IP9 H;  4HJ8 A;  3OYY A;  4ZRZ A;  2JA8 G;  1B50 A;  1SMY D;  4APV A;  4DV1 L;  2ALY B;  3A7L A;  2BCO A;  5ELC A;  4TQU S;  1KRS A;  3GD7 A;  1T9H A;  1VQA A;  4R4T A;  5EKL A;  4HIM A;  1RD9 D;  3IFT A;  3CCM A;  4KHP Q;  4DUZ Q;  3P7J A;  2Z0S A;  4A3K H;  4KKT A;  1XMQ Q;  2UU9 L;  5EPK A;  1IKM A;  3ERS X;  5ISR A;  5KEE A;  2AUK A;  2K04 A;  1V8Q A;  1PRT C;  2HIX A;  1I4R A;  3EQL C;  3I4M H;  5KYI A;  3RD4 A;  2F0F A;  2I0Q A;  2C5C A;  4DK0 A;  1YIT A;  3IFD A;  1O7Z A;  1UNS A;  1Y8O B;  2B8G A;  4JI8 L;  1PTO C;  5HUR A;  4AH6 A;  1IKL A;  2AWO A;  1ZYR C;  2RDH A;  1RTN A;  5C4X H;  1YNJ C;  5JEA H;  4UY8 C;  4BY7 B;  3KF8 A;  5HGQ A;  4OEM B;  2BOS A;  4BBS G;  3PO2 B;  1JQY D;  3CCR A;  3PO3 H;  3Q23 A;  1D5X C;  1B4O A;  1LTG D;  1XNQ Q;  3HOU B;  2VQF L;  2OTJ A;  4DV7 L;  1PZI D;  4GZY C;  2BE5 C;  5AJ3 Q;  2LFN A;  1VQF A;  3M4P A;  2O5J C;  1JIC A;  1S5D D;  5KGU A;  1F2L A;  2K4K A;  2OQK A;  3TQY A;  5M5X B;  1PRT B;  2PCF B;  1G8Z D;  2DNE A;  5EKI A;  2DY8 A;  2EYM A;  4LJZ C;  3CCQ A;  4BA2 I;  3S16 H;  2N49 A;  1HFN A;  4DAY B;  2N3S A;  3FHW A;  3NBI A;  1DYQ A;  4KJO A;  3H15 A;  2BA0 A;  3GTP B;  5G3L F;  2JA7 B;  4LFA L;  3OW2 A;  1EYA A;  3WDN A;  1LAC A;  3NXW A;  3QIA A;  3I4N B;  3SVM A;  4A3G H;  4WJW A;  5C3E H;  2MQH A;  1TII D;  5IWA Q;  4LK1 C;  4P73 A;  2NWG A;  4DGZ A;  2VUM B;  5L37 A;  4IUU A;  2R93 H;  2VB2 X;  4B3T Q;  2EYF A;  1STA A;  3F2C A;  1IBL L;  2EY1 A;  2X6L A;  3HGB A;  1KXL A;  2HDM A;  5C44 B;  1L2F A;  2K28 A;  1TS2 A;  2XN9 C;  3HZX A;  4PNY A;  2O2L D;  3W1B A;  1Y69 U;  1NJI C;  2VS1 A;  3BS1 A;  1IXR A;  3KBX A;  3HRZ C;  2QIL A;  4POG A;  4WJ3 M;  1Q1E A;  2QKI C;  3I70 A;  3KLW A;  3GTL B;  4DK1 A;  5LMN L;  2K32 A;  5LL6 S;  2F1M A;  4R4O A;  4KTA A;  5I4D A;  2J0T D;  3TME A;  3K7U C;  2F52 A;  3H0G H;  4JBM A;  4PZ6 A;  3TZU A;  4OX9 L;  4L6T B;  4IFD H;  4CKE A;  3GTK B;  3MXU A;  3QJY A;  1B53 A;  1ZXT A;  1KLU D;  4WRD A;  3AU7 A;  4O2D A;  1OTC A;  3CC4 A;  4HIK A;  1Y1V B;  3TP8 A;  2RSO A;  2NVX H;  2MUY A;  4FVM A;  1GUT A;  3S17 B;  4JV5 L;  1CKO A;  3NQT A;  4KLK A;  2DY7 A;  4ZYS A;  1SYD A;  3NEN A;  3MXN B;  2CCZ A;  4LMQ D;  1SYG A;  1JWS D;  2DGY A;  3U58 A;  1U4R A;  3G71 A;  4X6A H;  3PO2 G;  2B8F A;  1F9P A;  4A3B G;  1H9J A;  1FJG L;  4M1U B;  1LT5 D;  2SEB D;  5IP7 H;  1KAA A;  5IYD H;  1Y1W G;  1F2M A;  3QWN A;  2B2V C;  1SYE A;  4A3E G;  1TY0 A;  3VR6 A;  3K81 C;  5GAG C;  4E6I A;  4QGU A;  1E2W A;  3A5Z B;  4U67 3;  2F0V A;  1BR9 A;  3PCO B;  4QIW B;  1N36 L;  1MJC A;  4YY3 Q;  1FGU A;  2LSS A;  3MEF A;  1G51 A;  4HJ7 A;  2RBM A;  3I4M B;  4QUF A;  4FP5 D;  2L55 A;  4ZAI A;  3MTS A;  1YBY A;  1SJH D;  2CQO A;  1YJW A;  3SDZ A;  1JE4 A;  4JI2 Q;  1EQV A;  5KIX A;  4DR6 L;  1SNM A;  1XYI A;  2NVQ H;  1PFS A;  2QA4 A;  4KD4 A;  1VQJ A;  4PG3 A;  3PIO 3;  3I56 A;  1EIY B;  3DEO A;  1SE4 A;  3LX0 A;  1VQH A;  1FNU A;  3CXC A;  1STY A;  3LNN A;  3S2H H;  2WII B;  1X54 A;  1M90 C;  3GTO H;  2QGQ A;  3PO3 B;  2KJX A;  1NTG A;  4DR5 Q;  1RKN A;  3NTK A;  1HA5 A;  1LM0 A;  1LTI D;  3QO2 A;  3UDI A;  1STH A;  2A6E D;  4QJF A;  1BNZ A;  4DAM A;  1HZC A;  4GKK Q;  3B6Y A;  4POF A;  4EQN A;  4L8J A;  4HSV A;  1QNU A;  4EVO A;  2SNS A;  3S16 B;  4XXE A;  1H95 A;  3F2D A;  5CV9 A;  5LMN W;  5CBA E;  2F3W A;  3RLN A;  4KJN A;  3OW7 A;  3TRZ A;  1SLJ A;  3BU2 A;  5IGD A;  4XQJ A;  2Z4H A;  2AUJ D;  4FO2 A;  1K0R A;  2GVB A;  3HKZ B;  4IJL A;  4IFD I;  3X3M A;  3CC7 A;  4LF7 Q;  4FF4 A;  4PZ8 A;  1A2U A;  1HQM C;  1HPC A;  2UXC Q;  1A2T A;  1YNX A;  5JPM C;  4A3G B;  4IJH A;  4NW2 A;  1EYC A;  2WB1 G;  2CWP A;  3TBI B;  3X3N A;  5C3E B;  1LO5 D;  1SMY C;  4H44 C;  1KRT A;  3A8K E;  2R93 B;  3I2Z A;  1LTS D;  1E24 A;  1G29 1;  2AWN A;  1VDZ A;  2GA4 B;  1Q46 A;  2H4O A;  2RKS A;  2Z6B A;  3RZO B;  1IYV A;  3Q6S A;  2A68 D;  4IPC A;  1I6V C;  3NHH A;  1EY8 A;  1ML0 D;  5IP9 G;  3CF5 A;  3PF4 A;  4RG1 A;  3F8T A;  2Q8I B;  2BDN A;  4DV0 L;  2XIW A;  4LWC A;  4BXX H;  4BY1 H;  2ZM6 Q;  3CQZ H;  3BZD B;  5DAU A;  1A3T A;  2EYJ A;  1QE6 A;  1IBM Q;  4CDF C;  4QF4 A;  4A3K G;  4DV3 Q;  3GTQ H;  3DMU A;  3CRK C;  3PMF A;  1QZH A;  1BBW A;  1RHP A;  2F03 A;  4IOA A;  2BH2 A;  2D5D A;  1WTQ A;  2IX0 A;  5FLX E;  4B9W A;  1O7Y A;  3RMH A;  5J39 A;  2LY7 A;  3A8I E;  4LF5 L;  4A3I B;  1PH9 A;  2NVX B;  1K83 H;  4MNO A;  1IYJ B;  2I5H A;  3I73 A;  1JT8 A;  3G48 A;  2WB1 E;  1PFB A;  3M3Y H;  1I4X A;  1JCK B;  1ESF A;  1BBX C;  1LTR D;  3S14 H;  2QDB A;  3FKI G;  4JOI C;  1TWC H;  1NBW A;  1HUN A;  4FDB A;  4NP5 A;  5C4X G;  2KHJ A;  5JEA G;  1PH1 A;  5I9P A;  3ITP A;  2I5M X;  2FFK B;  1Z7T A;  1PVO A;  2F0P A;  1K8M A;  1XNR L;  1LT4 D;  1PYS B;  1N33 L;  3PUV A;  3FEW X;  2K5Q A;  1J5E Q;  5E4W C;  5JAV A;  4EQP A;  1PMR A;  1VQ5 A;  1K0S A;  4N9T A;  1K3B C;  4R8I A;  2JJQ A;  4CJ2 C;  2I46 A;  4AYB E;  3J7A V;  4LFB L;  3CPF A;  2EVB A;  3NBH B;  4OWT B;  5C0X H;  5EGT A;  3OIP A;  1TWG H;  4PQX A;  5EKK A;  3P1H A;  2CHB D;  1PTO D;  1ENF A;  1N8R C;  3EN2 A;  2EJF C;  2F4V Q;  1R4Q B;  4TKO B;  2L12 A;  1L0X B;  1YNJ D;  5CV7 A;  3GDE A;  3URY A;  2E76 C;  4CDC C;  2NVQ B;  5T1I A;  3V96 A;  1I50 H;  1DM0 B;  4AIM A;  1N32 Q;  1CSQ A;  2K5W A;  3SHL A;  1LTB D;  2KCC A;  4R9W A;  1X56 A;  4NB3 A;  3MXN A;  2R93 G;  4GKJ Q;  1PFM A;  4C3H G;  1R4P B;  1VQI A;  1HZA A;  3IRB A;  4LF8 Q;  1SYF A;  3HOZ G;  3IKJ A;  1BDO A;  1I4H A;  3S1N H;  4NMZ A;  4KK7 A;  3A55 A;  3NWS A;  1V1P A;  1PLF A;  3M4O B;  3TRE A;  1RJT A;  3FMC A;  3ERQ A;  2ZXP A;  1BBU A;  3T1H Q;  4LF4 Q;  2Z6K C;  2XWB B;  2A69 C;  4F8M A;  1H9K A;  1CKM A;  4ZKB B;  2EY6 A;  5M3M H;  1HHV A;  4J15 A;  3KF8 B;  3H0G G;  3HOX H;  2PQA B;  2A8V A;  1MGS A;  4ILW A;  4IFD G;  4QCL A;  4JI5 Q;  4JPB W;  3MZ5 A;  5GRO A;  1EZ6 A;  5BN4 A;  1CZW A;  2JA5 B;  2K03 A;  4PMB A;  2LMC B;  2FMM A;  4OON A;  4YY3 L;  1WVL A;  3K5L A;  2A19 A;  1O7I A;  1MD2 D;  2MJ8 A;  3A7A B;  2FJ2 A;  4JYA Q;  1E1O A;  4BBR H;  1GD7 A;  4JI2 L;  1MSG A;  4JBW A;  2HHH Q;  2HT1 A;  4P2C B;  4G7H C;  3QOL A;  1PH6 A;  4FXG C;  4N8X 1;  2IT1 A;  3RLF A;  4DR7 Q;  3NE5 B;  3OTO L;  2Q8R E;  1Z9F A;  1D8L A;  3U4V A;  2M00 A;  3SEB A;  4UHV A;  2K5V A;  5IP7 G;  4A3L G;  5IYD G;  4IPH A;  1QJO A;  3AB9 A;  3CQZ B;  3L9A X;  2VQE Q;  3DHQ A;  2UUB L;  3CC2 A;  3NTH A;  4ZUI A;  5HY6 A;  4LF9 Q;  4BY7 H;  4GKK L;  3GTQ B;  3PUX A;  2KA7 A;  4X62 Q;  1WCM G;  1U4P A;  2EIF A;  1SJE D;  4OO1 H;  1DZ1 A;  2D0O A;  4ME5 A;  4V19 0;  2R7Z H;  3M7N A;  3D31 A;  1IBK Q;  4A93 G;  1NR2 A;  3JAM E;  5M5W H;  5C0X I;  3JAM i;  1K83 B;  2IX1 A;  1SEB D;  1QVF A;  3M3Y B;  1ZEQ X;  1OXU A;  2K01 A;  2AMC B;  2KCT A;  3H3V H;  2MGS A;  3T4A C;  1TWC B;  1EY6 A;  3W2D A;  3D6C A;  5H1S E;  2UXC L;  3HOW G;  1HRJ A;  4OIK A;  2Y0S B;  1PTO H;  1ESR A;  4TRD A;  5C4Z A;  4L5T A;  1WD0 A;  2JA7 H;  1AN8 A;  4L5Q A;  1PV4 A;  2KED A;  1JOQ A;  1ET6 A;  1JOO A;  4RKL A;  5C6A A;  3I4N H;  5BR8 Q;  3PIP A;  2BH8 A;  5C3X A;  1A3V A;  2VUM H;  1JJG A;  4KY5 A;  2ICE C;  2AQ1 B;  1T5E A;  5C44 H;  2ZM6 L;  1TWG B;  3UDF A;  5CV5 A;  2K5N A;  2SDF A;  1Q8I A;  2R3Z A;  1JE5 A;  2RCF A;  4JI1 Q;  1IBM L;  3GTL H;  1ICW A;  2PNH A;  2HQE A;  4DV3 L;  1STN A;  1K28 A;  4DR3 Q;  3CCU A;  3U4Z A;  4RHR A;  1G2S A;  4ZK9 B;  1PZJ D;  1RCV D;  2C9O A;  1U4L A;  1U9R A;  1LT6 D;  4IQZ A;  4UPA A;  5EAY A;  3AMU A;  1I5F A;  3G4S A;  5IYB H;  3D6W A;  4XTC S;  1Y1V H;  4BWG B;  4HMJ A;  5I9O A;  1A0I A;  4K6L A;  2KCN A;  2PW7 A;  3S1N B;  3HKS A;  2PI2 A;  1HNX Q;  1EU4 A;  4Q5V A;  2K50 A;  2YYZ A;  1X55 A;  4BXX G;  1HCZ A;  4BY1 G;  1Q12 A;  1Q3L A;  2EE1 A;  4XQN A;  1AFP A;  2Q8T A;  3NBH A;  3K5N A;  4G7O C;  5M3M B;  4A3D H;  4N9P A;  5ELD A;  4EQO A;  1G2T A;  1NR4 A;  3HOX B;  3ERO A;  3MHB A;  5FO8 B;  1QZG A;  1B44 D;  5D65 A;  5COR A;  5FLX L;  4LUZ A;  1EY9 A;  1SRU A;  1W3S A;  4JOI A;  4RAU C;  5T1G A;  1FR3 A;  2UUA L;  1ILP A;  1I3Q B;  1EYG A;  1NMG A;  1Q8K A;  5E4X A;  4OO1 I;  4RCN A;  2YU9 B;  2NVY H;  4QL5 A;  1BQQ T;  1TS4 A;  5EQ0 A;  4K8I A;  4BBR B;  1YNN D;  2HD3 A;  1V1O A;  2LXJ A;  2VY3 A;  5I6W A;  3S1Q H;  1VQD A;  4JBJ A;  3H3V C;  1CSP A;  5IGB A;  2B2Y C;  4A76 A;  2B29 A;  4DR1 L;  1D1K A;  2EPB A;  4EQ5 A;  3K0X A;  3ZJY C;  1NY4 A;  3K6O A;  4JVZ A;  1SYB A;  5C4J H;  3GTJ B;  1V9P A;  1EFW A;  5CV6 A;  4X65 Q;  1VQK A;  1EQQ A;  2PZT A;  5C0X G;  4LF4 L;  4DV2 Q;  2PQA A;  1KDA A;  1MIU A;  1D5Z C;  1XTD A;  2R7Z B;  2MPM A;  4G7Z C;  3CW2 C;  1B1Z A;  4KKS A;  5M5W B;  4RKB A;  4RGO S;  5FK9 C;  3QOJ A;  3G7L A;  3AQQ A;  3O13 A;  2AKW B;  1TWA H;  2PQE A;  3MXG A;  1RIP A;  5TSS A;  3AEV A;  1HNZ Q;  3FPP A;  2HDL A;  4EX5 A;  4K0K Q;  1VQ6 A;  3A5U A;  1JC7 A;  2Z8L A;  4DAP A;  1BCP F;  3HOV H;  1TT2 A;  2HCC A;  1PTO B;  1M1K C;  2ZXR A;  3CMA A;  2VZA A;  1P8L A;  4DKA C;  4OHJ A;  2Z6K A;  4FF3 A;  2PYK A;  1AE2 A;  2DJG C;  3L2P A;  2RQX A;  4OXP A;  2IL8 A;  3VYT A;  1PH5 A;  4DR7 L;  1CT1 D;  5JVH 3;  4CBV A;  3FKI H;  1X65 A;  5CC4 A;  3ND8 A;  2GVA A;  2I07 B;  2QF7 A;  2RDF A;  1YHA A;  1SNC A;  1HA6 A;  2FHT A;  5M3M G;  5A35 A;  4HR7 B;  4QY7 A;  2OTL A;  3RZO H;  1S5F D;  2WP8 J;  2VQE L;  1E3P A;  1I4Q A;  1CK1 A;  1TVX A;  2IWH A;  4LF9 L;  5CV4 A;  1EY7 A;  1TY2 A;  1NSN S;  1DGS A;  1XMO L;  3D3R A;  1HUM A;  5E1F A;  4X62 L;  2F0H A;  2AQ2 B;  2UUC Q;  3SE0 A;  4DR4 L;  5FKA C;  2ZTE A;  4Q0F A;  4ZQ3 A;  2L1B A;  2RSN A;  1GM5 A;  2ASB A;  4A3J B;  4R4C A;  2F0D A;  4DK6 C;  5KNC A;  3I4O A;  2ICI A;  3RLO A;  1X6O A;  4DV5 Q;  1F9Q A;  2MP1 A;  4A3I H;  2A69 D;  1A63 A;  1YZ6 A;  3GV6 A;  4NKL A;  3FDT A;  3Q0A A;  3T1Y L;  2CFM A;  1VMP A;  2OQ0 A;  1HNW Q;  2B3G A;  3EA6 A;  2WAQ B;  3E6Z X;  3A56 A;  3VYU A;  3K57 A;  3GQB A;  4JBK A;  1F9R A;  2UXB L;  1H9S B;  3BDO A;  4LAA A;  1PZK D;  5K36 H;  5IOC A;  4BY7 G;  1D2B A;  1BUV T;  4A3D B;  3IAY A;  2R92 H;  1SAP A;  1YJ9 A;  1UE5 A;  2UXD Q;  4OO1 G;  1QWY A;  3S2D H;  2WKD A;  5ELF A;  3HOU G;  1HTL D;  3JAM L;  1V1P B;  1A62 A;  1LYL A;  1UEB A;  1EOT A;  3D0F A;  3I91 A;  3KOJ A;  4K2K A;  3R8B A;  3FP9 A;  3NK9 A;  5G3L D;  3STB C;  2J4X A;  3I72 A;  4ZKC B;  2NVY B;  5CV8 A;  3EIV A;  4DR3 L;  4P75 A;  3CHB D;  4IZ8 A;  4A3M H;  2NZ1 D;  4TSS A;  2A74 C;  1STE A;  1H9R A;  2EYH A;  2K75 A;  3S1Q B;  4C3I H;  4JI6 Q;  4DR2 Q;  1II3 A;  2R6G A;  4ZCK A;  2JA7 G;  2IY5 B;  4R1J A;  5LL6 X;  3I4N G;  2XGT A;  2WKC A;  4GLV B;  3TS0 A;  3DXJ C;  1L0Y B;  2VUM G;  1IL8 A;  5A2Q L;  1HNX L;  5C4J B;  4JI0 Q;  2TSS A;  1Y8N B;  1B8A A;  4F88 A;  4DXG A;  1CTM A;  2NN6 H;  3VA7 A;  1KTK A;  1UE7 A;  1CKN A;  5C44 G;  2B63 B;  2F0W A;  3C1E A;  2EYL A;  3KBG A;  4YWL A;  2HUG A;  4KHZ A;  4DUY Q;  4M8A A;  4X64 L;  1IZ6 A;  3M4O H;  1SYC A;  2D0P A;  2HCI A;  3OIQ A;  2NZH A;  3M4Q A;  1PH2 A;  1MKH A;  1VQE A;  3K5M A;  1TWA B;  1EL0 A;  1EFI D;  2B39 A;  4DN4 M;  3E9I A;  4YHH Q;  4WFN 3;  1TKW B;  1PFN A;  1PH8 A;  1JWM D;  4H0L C;  2IPK D;  4KHP L;  1B9M A;  1WYD A;  4DUZ L;  1A3U A;  1QVC A;  1YIJ A;  3HOV B;  4HJ9 A;  1XMQ L;  2JA5 H;  5FJ8 H;  1Y1V G;  5DEH A;  2OXP A;  3A54 A;  5JJI A;  5CGK A;  1VQP A;  4JI4 Q;  1QNK A;  2KUM A;  1EOV A;  3PGZ A;  3OPO A;  4GNX C;  3FKI B;  1GJX A;  1TWH H;  2B2T C;  1SBB B;  4K14 A;  1AH9 A;  2F3V A;  3ULP A;  3TS2 A;  5JJK A;  1VQG A;  2A6H C;  2KOL A;  1PRT F;  3J80 E;  2V4D A;  2JN4 A;  3I3C A;  1OXV A;  2VW9 A;  4JI3 Q;  2ATW A;  4A3D G;  3J80 i;  1JOK A;  3PSI A;  1YJN A;  2L5T A;  2AHO B;  3KDF A;  4XYQ A;  5FO9 B;  3S1R H;  1PH3 A;  1HR0 Q;  1YNN C;  1EZ8 A;  3UE0 A;  1I6H H;  2RHS B;  3NEL A;  3RR5 A;  2L4N A;  1PHJ A;  2WV6 D;  3Q22 A;  1TQO A;  1YEZ A;  1XNQ L;  4QUC A;  3E5S A;  3GV3 A;  5AJ3 L;  5KNB A;  2B2Y A;  4KY7 A;  4Y7N H;  2K6A A;  1CHQ D;  4GNX B;  3I4M G;  1GHJ A;  4JW0 A;  2CWA A;  5FLX c;  1VQL A;  4LFC Q;  3MA2 B;  2G9H D;  3H94 A;  3N52 A;  5IGF A;  3I90 A;  3BDC A;  1E0B A;  1ILQ A;  2KEE A;  3CD6 A;  1EEI D;  3R2I A;  4O1N A;  2IHF A;  4LF6 Q;  4C1N I;  1YVC A;  4ULL A;  2Z4I A;  1DOK A;  3K8A A;  2JA8 H;  3T51 B;  4B3M Q;  5IWA L;  5D14 A;  3K58 A;  3C3L A;  4GOP C;  1S3O A;  2HQL A;  1IW7 C;  1SE8 A;  1KHI A;  4YWM A;  2R92 B;  2VL6 A;  1D5M C;  3VR4 A;  4B3T L;  3PO3 G;  2E2H B;  1C9O A;  4XQQ A;  2N78 A;  4J1M A;  3S2D B;  3MFG A;  3EJI A;  2NN6 I;  1CFM A;  1Z6H A;  1FD7 D;  1UEA B;  1KIX A;  3D4R A;  3S24 A;  3J81 E;  1GUS A;  1HTP A;  1X32 A;  5EPJ A;  3M85 A;  5ELE A;  3J81 i;  4MN3 A;  3MC0 B;  2A5H A;  3CKI B;  3W1G A;  1V1Q A;  4QIW E;  1EWC A;  3FVQ A;  2PO4 A;  4A3M B;  1WTP A;  3DWP A;  3KF6 B;  3R93 A;  1N34 Q;  1A8V A;  3L7Z C;  4B08 A;  2KQ3 A;  3H09 A;  2Q2U A;  4C3I B;  4JI7 Q;  2JA9 A;  3SXH A;  3HKZ G;  2XNA C;  2PZU A;  1XJV A;  1VQO A;  4A3G G;  5C3E G;  5CR3 A;  1B3Q A;  1EUJ A;  2Q2I A;  4H7B A;  4NXM Q;  5IGG A;  1S72 A;  1H9S A;  4KY6 A;  1J8I A;  3DWA A;  5LMU Q;  3BZC A;  1SNP A;  3NTI A;  1W6J A;  3T16 A;  1EIH A;  2UU9 Q;  3UE1 A;  4V0B A;  3S9W A;  3NSW A;  3CU7 A;  5IT9 E;  1C7Y A;  1SNQ A;  3D8G A;  5JVG 3;  3NPP A;  2CH4 A;  1IL2 A;  2WFW A;  1N9W A;  3K80 C;  2PMZ E;  2NB0 A;  1JB3 A;  4DAV A;  1HFG A;  4ZLT F;  3J81 j;  3DWQ A;  1ASY A;  2ZJQ A;  1HQR D;  3Q8D A;  1GKH A;  4IUP A;  1PYB A;  3HKZ E;  3KJO A;  3ICE A;  2ZTD A;  4HIO A;  1O78 A;  4A3I G;  1I3Q H;  4KN4 C;  1R9T H;  1EWH A;  1PXU A;  2YU9 H;  2IW3 A;  2VQF Q;  4DR2 L;  3BYT B;  3EVQ A;  1TWH B;  3KFU A;  4DV7 Q;  1GUG A;  4C2M B;  4S3S A;  5K36 G;  1X3Q A;  3AFP A;  3KLR A;  4OEL B;  3F2B A;  1H9M A;  1ROD A;  4HED A;  2R92 G;  2OF1 A;  3DUZ A;  4DXF A;  4IO9 A;  1LTT D;  3S1R B;  2K1B A;  3RZD B;  1JJ2 A;  3BZK A;  1QUQ B;  1I6H B;  2PPB C;  4DR5 L;  2RCN A;  3GTJ H;  2AQ3 B;  4LFA Q;  1FVI A;  2CW0 C;  3KUP A;  1VQM A;  2KBN A;  5CMD A;  1M8A A;  2E5L Q;  1RF2 D;  4Y7N B;  1O80 A;  1MJE A;  1U4M A;  1WOC A;  3OWF A;  2OT2 A;  4C3I G;  2E74 C;  1IBL Q;  1STB A;  1WFQ A;  1CM9 A;  3JAM c;  4C3J H;  4DV6 Q;  1SXT A;  4GLA C;  5CBE E;  2F0N A;  1WTO A;  4PMW A;  4LF7 L;  4LUO A;  3G6E A;  1FYC A;  2JA8 B;  3NQI A;  5I2Y A;  2NN6 G;  4DV4 Q;  4BA1 I;  2K5D A;  4I7Z C;  2M2L A;  4OX9 Q;  3STB D;  4ABN A;  3CRL C;  1O7L A;  3CCJ A;  1B70 B;  4QB4 A;  2YTV A;  2YTX A;  3FPU B;  2Q2T A;  1XXG A;  3ONA B;  1NUC A;  1L1O C;  1Q82 C;  1MBY A;  5FO7 B;  5A2Q E;  4B3R Q;  3CAM A;  4RMF A;  3BYY B;  3PUY A;  4LUV A;  1D6E C;  5M5Y H;  4KI0 A;  4JV5 Q;  2R7D A;  3K59 A;  5JEA J;  1SR3 A;  1C48 A;  1A6X A;  4GNX A;  1LTL A;  2JA5 G;  2B2T A;  5FJ8 G;  4C1N K;  3V05 A;  4CDD C;  1OXX K;  1C0A A;  1XX8 A;  2L11 A;  1STG A;  5GQO A;  1LLR D;  4A3J H;  2KHS A;  4BBS B;  4IN3 A;  4X3K A;  5J1Z A;  4L5S A;  1DXM A;  5D3I B;  3J80 L;  4LW1 A;  1VQ8 A;  4CKB A;  3KK7 A;  1L1O B;  1LV9 A;  2DJF C;  5DLQ E;  1GOZ A;  4IAL A;  5DNF A;  4JG2 A;  3VYS A;  1SND A;  3TEH B;  1VMC A;  1N36 Q;  1CA6 A;  4U68 A;  4A3C H;  1QCB D;  2NBF A;  4DNR B;  2OCE A;  1KDC A;  1OO9 B;  3RUZ A;  2F4I A;  2O4X A;  2XRS D;  3S15 H;  1V43 A;  1J5E L;  3KJP A;  4R4Q A;  1CKN B;  3HEJ A;  2JP1 A;  4P72 A;  3KF6 A;  4GN3 B;  3I8Z A;  1LTA D;  1UWV A;  3P75 A;  2X69 A;  5COY A;  2A1A A;  4P71 A;  4X3S A;  2NYZ D;  3QB3 A;  2NVT H;  2A6H D;  2PZW A;  3RN2 A;  4OWX B;  2QW7 A;  1IHZ A;  2RHQ B;  2KVM A;  1R9T B;  3EFX D;  1EEF D;  4MHE A;  1DD2 A;  3L0O A;  2JSO A;  4JI7 L;  4GOP A;  2F4V L;  3TDQ A;  1CI3 M;  1BF4 A;  1HZB A;  5DM7 3;  4Y52 H;  4X3T A;  4TVA B;  1F9S A;  2Y0S G;  4IFD J;  1N32 L;  4NXM L;  3H3V I;  2F3I A;  4GKJ L;  1Y14 B;  2HIV A;  4NXN Q;  4LF8 L;  1WI5 A;  1KNE A;  4A3F H;  5LMU L;  1WD1 A;  2LKV A;  4AQY Q;  5KRU A;  4IPG A;  3J81 L;  5C5L A;  2JEA I;  3NUC A;  2EOT A;  3BJU A;  2F0U A;  3SK5 A;  3T1H L;  3K5O A;  4X3U A;  1NE3 A;  2B63 H;  4HCE A;  3UI2 A;  3OMG A;  4H02 A;  1ENA A;  3LGJ A;  3KDF B;  1PDQ A;  4N8F A;  1TXY A;  2PW5 A;  4RFB A;  5KYL A;  2F0J A;  3WWV A;  1HR0 W;  1B9N A;  4JI5 L;  2FXQ A;  2Z1C A;  4C3J B;  2JEB I;  3EBE A;  4QQB X;  1IW7 D;  5JOB A;  3TP6 A;  1X3F A;  2F0S A;  1YHB A;  2Y0S E;  4DV0 Q;  2EYP A;  4A3B B;  5IGC A;  4JYA L;  4JC0 A;  4XT1 B;  4MTN A;  1Y1W B;  1UUP A;  1X3G A;  2HHH L;  1CQV A;  3HFZ B;  3A74 A;  4K5X A;  4A3E B;  2IHE A;  4EGV A;  1KAB A;  4IUQ A;  4RHS A;  1LAB A;  1I4P A;  3M9B A;  1QUQ A;  5IT9 L;  4LF5 Q;  5EPL A;  4CKC A;  4DNI A;  5M3F H;  5E3F A;  1S5B D;  1VCI A;  3LWE A;  2EJM A;  3M7G A;  4X66 Q;  1Q81 C;  5M5Y B;  3HOX G;  2E75 C;  3CCS A;  5I6Y A;  3MWY W;  1BXT A;  3OHX C;  1EY5 A;  5KND A;  3I4L A;  2VXW A;  3CP0 A;  3SK4 A;  2BDO A;  2M9V A;  4HID A;  5DM6 3;  2E5L L;  1M4V A;  3TP7 A;  1U5K A;  1IBK L;  3VR3 A;  4UDU C;  1XNR Q;  4C3H H;  3OMC A;  3GTG B;  4OGQ C;  1LT3 D;  1K9M C;  3HOZ H;  3H6M A;  1ASZ A;  2XSC A;  1N33 Q;  4BBR G;  3ND9 A;  4FF2 A;  3ULJ A;  3PQI A;  4DV6 L;  3UDG A;  4FF1 A;  3C46 A;  2KCM A;  2VB3 X;  2DUD A;  3PUZ A;  3C2P A;  2RA4 A;  3K0Y A;  4LFB Q;  1B2T A;  3S1M H;  3FRP B;  1GUW A;  5IGE A;  1CHP D;  5IYC H;  1SMX A;  3PIP 3;  1KL9 A;  4K6D A;  1WTX A;  4PZ7 A;  5JJZ A;  4DV4 L;  1QOH A;  2CVR A;  2Q2H A;  4UP8 A;  5HGT A;  1D1I A;  4JCV E;  1X3P A;  1UAP A;  5C4H A;  3OSO A;  3S15 B;  1FL0 A;  5C3W A;  5BR8 L;  2MNA A;  3HP3 A;  5GAE C;  1I94 Q;  2L9H A;  5GAH C;  2E2H H;  3CPW A;  3GO5 A;  2IX3 A;  4B3R L;  2OWO A;  2CH4 W;  4HJ5 A;  2R7Z G;  1S5E D;  2ENB A;  1QG7 A;  1XPU A;  2WB1 B;  2JE6 I;  2NVT B;  1HZ9 A;  1XPO A;  2JK8 A;  1DON A;  1BCP D;  4JI1 L;  4RGT A;  1JJC B;  1QB5 D;  4C3J G;  1VF5 C;  4B3S Q;  4UP7 A;  4CJ1 B;  4MTK A;  1EQT A;  3V2T A;  1GVP A;  4J6H A;  1B7Y B;  1K73 C;  4PMC A;  1BO0 A;  2I5L X;  2QDL A;  4YWK A;  1VQB A;  1SRO A;  2B2U C;  3DM1 A;  4A75 A;  4A3L H;  1I4G A;  3VA5 A;  1L1O A;  3LWU A;  1TS3 A;  4P74 A;  2CW0 D;  1AZQ A;  2EYO A;  3PUW A;  1EQR A;  4GS3 A;  1Q7Y C;  4A3F B;  4AYB B;  4A3K B;  5C5M A;  3GTM H;  3GP7 A;  4QMG A;  3J7A 5;  1WCM H;  1MI2 A;  4I65 A;  1Q90 A;  1NCV A;  1U0L A;  2YV5 A;  4A93 H;  5ELN A;  1XPR A;  1HJP A;  3MVV A;  2JQO A;  2MHV A;  1C4Q A;  2B2W C;  1EY4 A;  5FLM H;  3K7A H;  4HJA A;  3TN2 A;  1GXD C;  3KLS X;  3DLL A;  2K05 A;  2RF4 A;  4CDE C;  3OTO Q;  1FGB D;  5IIF A;  2E2I H;  3HOW H;  4DFA A;  4DA2 A;  5C4X B;  1J6Q A;  3PV0 A;  1GHK A;  3H91 A;  2JXM B;  5IE8 A;  4A3J G;  1X9N A;  1D7Q A;  1EWI A;  1CA5 A;  1ONL A;  3BG3 A;  3F2U A;  5C0X J;  4ALP A;  5IYB G;  3I55 A;  2UUB Q;  3RNU A;  3J7A F;  2SNM A;  2KEN A;  4J8Q A;  2WAQ G;  3A0J A;  1JMC A;  4A3C G;  2PMZ B;  4DK3 C;  2ID0 A;  4DU9 A;  4C2M H;  1XWE A;  5M3F B;  4NXN L;  3ULL A;  2KEC A;  1RTO A;  4IUV A;  4CJ0 B;  4AQY L;  1HH2 P;  5GAD C;  1SDF A;  1BVS A;  1KLG D;  3OWE B;  3J80 c;  4X65 L;  3RZD H;  2E2J H;  4KD3 A;  2N55 A;  4KMU C;  5E7N A;  4DV2 L;  2P5Z X;  1PTO F;  3OOC A;  2DNC A;  4GLX A;  1KAW A;  1KQS A;  3J7Y W;  2K33 A;  3E3X A;  1EYD A;  2MO0 A;  5IY0 A;  5CYU A;  4C3H B;  1PYW D;  3HOZ B;  1ET9 A;  4RGM A;  1WTH A;  4IUT A;  4G57 A;  3L3O C;  3HOY H;  1W2B A;  4YIJ A;  1SE2 A;  2LS0 1;  1WJJ A;  3F1Z A;  1HNZ L;  1ZKO A;  4G4K A;  2E8G A;  1GUN A;  4RCO A;  3S1M B;  2D62 A;  2K52 A;  2N88 A;  3W5O A;  4XYO A;  2JA6 H;  3BVG A;  4K0K L;  3KYH C;  1C8C A;  1K8A C;  3NWT A;  5J22 A;  2WAQ E;  4YCV A;  2XTI A;  1WTW A;  1CQF A;  1F77 A;  3P20 A;  4HCS A;  4AYB G;  4A3F G;  2F0L A;  1L0W A;  3H0G B;  4YCW A;  1AP0 A;  3CCE A;  5LHY 1;  4DAY A;  2EY5 A;  2YTY A;  3D4W A;  4ODG A;  4XT3 B;  3CCV A;  4BS9 A;  3DM3 A;  1KNA A;  2B63 G;  2WIN B;  3QR8 A;  2F0Q A;  1WTV A;  2F0M A;  3G6J B;  1SFO H;  4GN5 A;  1KC8 C;  4X66 L;  1S4Z A;  1VQ7 A;  4K5V A;  5D3D A;  2R7F A;  1JR0 D;  2F0O A;  4F7X A;  1F2Y A;  5F2D A;  4I7A A;  4KHV A;  3J81 c;  2UUC L;  1EIG A;  1RL2 A;  2ZJP A;  1VQC A;  1VQN A;  1T5X D;  3N6R A;  3TZD A;  3HOV G;  2ZXO A;  1GUO A;  2G9D A;  2OEO A;  3HS0 C;  3CCL A;  1EY0 A;  4DF7 A;  1PRT D;  4ID6 A;  5EBC A;  4DV5 L;  1PH7 A;  1VS0 A;  4GOP B;  3MFY A;  1G6P A;  2QCP X;  3TP5 A; 
#chains in the Genus database with same CATH homology
 3U9O A;  3GTM B;  1CZG A;  2FMC A;  1WCM B;  2F0T A;  4R8N A;  4IUN A;  4A93 B;  3WOE A;  2EY2 A;  1ZYR D;  3SR1 A;  2NUC A;  2F0I A;  3K7A B;  3WOF A;  3KLS A;  4XDX A;  3ZYY X;  3T56 B;  2E2I B;  1TR5 A;  1DOM A;  3MEH A;  1TU2 B;  1AZP A;  3HOW B;  3U9S A;  3NP8 A;  2BE5 D;  2F0G A;  3VYR A;  5NUC A;  3S2H B;  2CQA A;  3GTO B;  1ENC A;  4FXK C;  4WOR A;  4DNT B;  4HTH A;  1E2V A;  2NTS A;  1WTR A;  2X6G A;  4CGY B;  2FIN B;  2RDG A;  4IUR A;  4KN7 C;  5EBD A;  5BN5 A;  4L63 B;  2A73 B;  1BCP C;  1A15 A;  2K7V A;  4K2L A;  3Q24 A;  1BOS A;  2IJ0 A;  4HMI A;  2F0K A;  3W3A A;  4ZUJ A;  2E2J B;  4K5W A;  2XWJ B;  3MAQ A;  5ELB A;  4RA8 A;  1AW7 A;  3R3O A;  3C1F A;  2B2U A;  2VNU D;  4RWS C;  1NAP A;  3HG9 A;  2BA1 A;  4CHT B;  4KV6 A;  3DEP A;  5JPN C;  2B2V A;  1SE3 A;  3T13 A;  3HOY B;  1K8O A;  5K5P A;  4KKU A;  4O42 A;  2O5I C;  2JA6 B;  3BVM A;  1SNO A;  2NTT A;  4Z9C B;  4BY1 B;  3IL8 A;  5EJW A;  1BCP B;  2WAC A;  2E2D C;  1G6Z A;  2B2W A;  3SK6 A;  2XVS A;  2H1E A;  4FXD A;  2EXZ A;  3BVZ A;  4HN7 A;  3A8J E;  4MIU A;  1FNV A;  2D9U A;  1SFO B;  4NDX A;  1FNW A;  1MSH A;  3S14 B;  2A6E C;  2TMP A;  2RVL A;  1S5C D;  1JWU D;  1VF7 A;  3BDL A;  1OXS C;  4OL7 A;  1DJR D;  1E2Z A;  2DN8 A;  1B3A A;  3VR2 A;  4UAI A;  2F0E A;  2J7Z A;  3D4D A;  3QG1 A;  1W6K A;  1OXT A;  5I2X A;  1HXY D;  2L0C A;  4H13 C;  4HSP A;  4K8J A;  4F87 A;  4C56 C;  1TS5 A;  3TSS A;  2PNR C;  3R2T A;  2EZV A;  1F2Z A;  1G91 A;  1QIL A;  3M4Y A;  1EU3 A;  1RDP D;  4FYD A;  1DCZ A;  4B9X A;  2A68 C;  2XRQ D;  1Z47 A;  1IYU A;  1Q1B A;  1KDB A;  1Y8P B;  1DOL A;  4XIG S;  1I50 B;  3VR5 A;  4RH6 A;  3E0J A;  5FOB B;  2R61 A;  1XTC D;  2QEJ C;  2JYO A;  1TWF B;  2EDG A;  4JK1 C;  3SK8 A;  1SSO A;  2SOB A;  5BN3 A;  1J9O A;  4FNF A;  1AEX A;  2ZT9 C;  5AFW A;  5IOD A;  4PV1 C;  4OIJ A;  2D2C C;  5M9O A;  1JOR A;  3MXP A;  2EJG C;  4RGN A;  3T53 B;  4HAE A;  4ZRZ A;  1B50 A;  1SMY D;  3A7L A;  2BCO A;  5ELC A;  4TQU S;  3GD7 A;  5EKL A;  1RD9 D;  3IFT A;  3P7J A;  4KKT A;  5EPK A;  1IKM A;  5ISR A;  5KEE A;  2AUK A;  2K04 A;  1V8Q A;  1PRT C;  1I4R A;  3EQL C;  5KYI A;  3RD4 A;  2F0F A;  2C5C A;  4DK0 A;  3IFD A;  1O7Z A;  1UNS A;  1Y8O B;  2B8G A;  1PTO C;  5HUR A;  1IKL A;  2AWO A;  1ZYR C;  2RDH A;  1RTN A;  1YNJ C;  5JEA H;  4BY7 B;  3KF8 A;  2BOS A;  3PO2 B;  1JQY D;  3Q23 A;  1D5X C;  1B4O A;  1LTG D;  3HOU B;  1PZI D;  4GZY C;  2BE5 C;  2LFN A;  2O5J C;  1JIC A;  1S5D D;  5KGU A;  1F2L A;  5M5X B;  1PRT B;  2PCF B;  1G8Z D;  2DNE A;  5EKI A;  2DY8 A;  2EYM A;  4LJZ C;  4BA2 I;  1HFN A;  3NBI A;  1DYQ A;  4KJO A;  2BA0 A;  3GTP B;  5G3L F;  2JA7 B;  1EYA A;  3WDN A;  1LAC A;  3NXW A;  3QIA A;  3I4N B;  3SVM A;  4WJW A;  1TII D;  4LK1 C;  2NWG A;  4DGZ A;  2VUM B;  4IUU A;  2VB2 X;  2EYF A;  1STA A;  2EY1 A;  2X6L A;  3HGB A;  2HDM A;  5C44 B;  2K28 A;  1TS2 A;  2XN9 C;  3HZX A;  4PNY A;  2O2L D;  1Y69 U;  3BS1 A;  3KBX A;  3HRZ C;  2QIL A;  1Q1E A;  2QKI C;  3I70 A;  3GTL B;  4DK1 A;  2K32 A;  5LL6 S;  2F1M A;  4KTA A;  5I4D A;  2J0T D;  3TME A;  3TZU A;  4L6T B;  4IFD H;  4CKE A;  3GTK B;  3MXU A;  3QJY A;  1B53 A;  1ZXT A;  1KLU D;  4WRD A;  3AU7 A;  1Y1V B;  3TP8 A;  2RSO A;  2MUY A;  4FVM A;  1GUT A;  3S17 B;  3NQT A;  2DY7 A;  4ZYS A;  1SYD A;  4LMQ D;  1SYG A;  1JWS D;  1U4R A;  2B8F A;  1F9P A;  1H9J A;  4M1U B;  1LT5 D;  2SEB D;  1KAA A;  1F2M A;  3QWN A;  2B2V C;  1SYE A;  1TY0 A;  3VR6 A;  4E6I A;  1E2W A;  4U67 3;  2F0V A;  1BR9 A;  4QIW B;  2RBM A;  3I4M B;  4QUF A;  4FP5 D;  2L55 A;  4ZAI A;  3MTS A;  1SJH D;  3SDZ A;  1JE4 A;  5KIX A;  1EQV A;  1SNM A;  1XYI A;  4KD4 A;  3PIO 3;  3DEO A;  1SE4 A;  3LX0 A;  1FNU A;  1STY A;  3LNN A;  2WII B;  3PO3 B;  2KJX A;  1RKN A;  3NTK A;  1HA5 A;  1LTI D;  3QO2 A;  1STH A;  2A6E D;  1BNZ A;  4EQN A;  4L8J A;  4HSV A;  1QNU A;  4EVO A;  2SNS A;  3S16 B;  4XXE A;  5CV9 A;  5CBA E;  2F3W A;  4KJN A;  3OW7 A;  5IGD A;  4XQJ A;  2Z4H A;  2AUJ D;  4FO2 A;  3HKZ B;  4IFD I;  3X3M A;  4FF4 A;  1A2U A;  1HQM C;  1HPC A;  1A2T A;  5JPM C;  4A3G B;  3TBI B;  4NW2 A;  1EYC A;  3X3N A;  5C3E B;  1LO5 D;  1SMY C;  4H44 C;  3A8K E;  2R93 B;  1LTS D;  1G29 1;  2AWN A;  1VDZ A;  2GA4 B;  2H4O A;  2RKS A;  3RZO B;  1IYV A;  3Q6S A;  2A68 D;  1I6V C;  3NHH A;  1EY8 A;  1ML0 D;  2Q8I B;  2BDN A;  2XIW A;  3BZD B;  5DAU A;  1A3T A;  2EYJ A;  1QE6 A;  4QF4 A;  3DMU A;  3CRK C;  3PMF A;  1RHP A;  2F03 A;  2D5D A;  1WTQ A;  2IX0 A;  5FLX E;  4B9W A;  1O7Y A;  3RMH A;  5J39 A;  2LY7 A;  3A8I E;  4A3I B;  2NVX B;  3I73 A;  1PFB A;  1I4X A;  1JCK B;  1ESF A;  1BBX C;  1LTR D;  2QDB A;  1HUN A;  4NP5 A;  5JEA G;  5I9P A;  3ITP A;  2FFK B;  1Z7T A;  2F0P A;  1K8M A;  1LT4 D;  3PUV A;  3FEW X;  2K5Q A;  5E4W C;  5JAV A;  4EQP A;  1PMR A;  4N9T A;  4R8I A;  4CJ2 C;  2I46 A;  3J7A V;  2EVB A;  5C0X H;  5EGT A;  3OIP A;  4PQX A;  5EKK A;  3P1H A;  2CHB D;  1PTO D;  1ENF A;  2EJF C;  1R4Q B;  4TKO B;  2L12 A;  1L0X B;  1YNJ D;  5CV7 A;  3URY A;  2E76 C;  2NVQ B;  5T1I A;  3V96 A;  1DM0 B;  2K5W A;  3SHL A;  1LTB D;  2KCC A;  4R9W A;  3MXN A;  1PFM A;  4C3H G;  1R4P B;  1SYF A;  3IKJ A;  1BDO A;  1I4H A;  4NMZ A;  4KK7 A;  3A55 A;  3NWS A;  1V1P A;  1PLF A;  3M4O B;  1RJT A;  3FMC A;  3ERQ A;  2ZXP A;  2XWB B;  2A69 C;  4F8M A;  1H9K A;  4ZKB B;  2EY6 A;  1HHV A;  1MGS A;  4ILW A;  4IFD G;  4QCL A;  3MZ5 A;  1EZ6 A;  5BN4 A;  1CZW A;  2JA5 B;  2K03 A;  4PMB A;  2LMC B;  2FMM A;  1WVL A;  3K5L A;  1MD2 D;  2MJ8 A;  3A7A B;  2FJ2 A;  1MSG A;  4JBW A;  4P2C B;  4G7H C;  3QOL A;  4FXG C;  2IT1 A;  3RLF A;  3NE5 B;  2Q8R E;  2M00 A;  3SEB A;  1QJO A;  3AB9 A;  3CQZ B;  3L9A X;  3DHQ A;  3NTH A;  4ZUI A;  3GTQ B;  3PUX A;  2KA7 A;  1U4P A;  1SJE D;  4OO1 H;  1DZ1 A;  4ME5 A;  4V19 0;  3M7N A;  3D31 A;  1NR2 A;  3JAM E;  5C0X I;  1K83 B;  2IX1 A;  1SEB D;  3M3Y B;  1ZEQ X;  1OXU A;  2K01 A;  2MGS A;  3T4A C;  1TWC B;  1EY6 A;  3W2D A;  3D6C A;  1HRJ A;  4OIK A;  2Y0S B;  1PTO H;  1ESR A;  4TRD A;  5C4Z A;  1WD0 A;  1AN8 A;  2KED A;  1JOQ A;  1ET6 A;  1JOO A;  4RKL A;  5C6A A;  5C3X A;  1A3V A;  4KY5 A;  2ICE C;  2AQ1 B;  1T5E A;  1TWG B;  5CV5 A;  2SDF A;  1Q8I A;  2R3Z A;  1ICW A;  2HQE A;  1STN A;  4RHR A;  1G2S A;  4ZK9 B;  1PZJ D;  1RCV D;  2C9O A;  1U4L A;  1U9R A;  1LT6 D;  4IQZ A;  3AMU A;  3D6W A;  4XTC S;  4BWG B;  4HMJ A;  5I9O A;  4K6L A;  2KCN A;  2PW7 A;  3S1N B;  1EU4 A;  4Q5V A;  2YYZ A;  1HCZ A;  1Q12 A;  1Q3L A;  2EE1 A;  4XQN A;  1AFP A;  2Q8T A;  3NBH A;  3K5N A;  4G7O C;  5M3M B;  4N9P A;  5ELD A;  4EQO A;  1G2T A;  1NR4 A;  3HOX B;  5FO8 B;  3ERO A;  3MHB A;  1B44 D;  5D65 A;  5COR A;  5FLX L;  1EY9 A;  4RAU C;  5T1G A;  1FR3 A;  1ILP A;  1I3Q B;  5E4X A;  4OO1 I;  4RCN A;  2YU9 B;  1BQQ T;  1TS4 A;  5EQ0 A;  4K8I A;  4BBR B;  1YNN D;  1V1O A;  5I6W A;  3H3V C;  5IGB A;  2B2Y C;  1D1K A;  2EPB A;  3K6O A;  1SYB A;  3GTJ B;  5CV6 A;  2PZT A;  5C0X G;  1KDA A;  1D5Z C;  2R7Z B;  2MPM A;  4G7Z C;  1B1Z A;  4KKS A;  5M5W B;  4RKB A;  4RGO S;  5FK9 C;  3QOJ A;  3G7L A;  3O13 A;  2PQE A;  3MXG A;  5TSS A;  3FPP A;  2HDL A;  1JC7 A;  2Z8L A;  4DAP A;  1BCP F;  1TT2 A;  2HCC A;  1PTO B;  2ZXR A;  4OHJ A;  4FF3 A;  2PYK A;  2RQX A;  2IL8 A;  3VYT A;  1CT1 D;  5JVH 3;  4CBV A;  5CC4 A;  3ND8 A;  2I07 B;  2QF7 A;  2RDF A;  1SNC A;  1HA6 A;  2FHT A;  5A35 A;  4HR7 B;  1S5F D;  2WP8 J;  1I4Q A;  1CK1 A;  1TVX A;  2IWH A;  5CV4 A;  1EY7 A;  1TY2 A;  1NSN S;  3D3R A;  1HUM A;  5E1F A;  2F0H A;  2AQ2 B;  3SE0 A;  5FKA C;  4Q0F A;  4ZQ3 A;  2L1B A;  2RSN A;  4A3J B;  2F0D A;  5KNC A;  2ICI A;  1F9Q A;  2MP1 A;  2A69 D;  3GV6 A;  4NKL A;  3FDT A;  3Q0A A;  1VMP A;  3EA6 A;  2WAQ B;  3E6Z X;  3A56 A;  3VYU A;  3K57 A;  3GQB A;  1F9R A;  1H9S B;  3BDO A;  4LAA A;  1PZK D;  5K36 H;  5IOC A;  1D2B A;  1BUV T;  4A3D B;  3IAY A;  1SAP A;  4OO1 G;  1QWY A;  2WKD A;  5ELF A;  1HTL D;  3JAM L;  1V1P B;  1EOT A;  3I91 A;  4K2K A;  3R8B A;  3NK9 A;  5G3L D;  4ZKC B;  2J4X A;  3I72 A;  2NVY B;  5CV8 A;  3CHB D;  4IZ8 A;  2NZ1 D;  4TSS A;  2A74 C;  1STE A;  1H9R A;  2EYH A;  3S1Q B;  1II3 A;  2R6G A;  5LL6 X;  2WKC A;  3DXJ C;  1L0Y B;  1IL8 A;  5A2Q L;  5C4J B;  2TSS A;  1Y8N B;  4F88 A;  4DXG A;  1CTM A;  2NN6 H;  3VA7 A;  1KTK A;  2B63 B;  2F0W A;  3C1E A;  2EYL A;  3KBG A;  2HUG A;  4KHZ A;  4M8A A;  1SYC A;  2HCI A;  3OIQ A;  3K5M A;  1TWA B;  1EL0 A;  1EFI D;  2B39 A;  4DN4 M;  4WFN 3;  1TKW B;  1PFN A;  1JWM D;  4H0L C;  2IPK D;  1B9M A;  1A3U A;  3HOV B;  5DEH A;  2OXP A;  3A54 A;  5CGK A;  1QNK A;  2KUM A;  3OPO A;  3FKI B;  1GJX A;  2B2T C;  1SBB B;  4K14 A;  2F3V A;  2A6H C;  2KOL A;  1PRT F;  3J80 E;  2V4D A;  3I3C A;  1OXV A;  1JOK A;  2L5T A;  4XYQ A;  5FO9 B;  1YNN C;  1EZ8 A;  2L4N A;  2WV6 D;  3Q22 A;  1TQO A;  4QUC A;  3E5S A;  3GV3 A;  5KNB A;  2B2Y A;  4KY7 A;  2K6A A;  1CHQ D;  1GHJ A;  3MA2 B;  2G9H D;  3H94 A;  3N52 A;  5IGF A;  3I90 A;  3BDC A;  1E0B A;  1ILQ A;  2KEE A;  1EEI D;  3R2I A;  4O1N A;  4C1N I;  4ULL A;  2Z4I A;  1DOK A;  3T51 B;  5D14 A;  3K58 A;  3C3L A;  1IW7 C;  2R92 B;  1D5M C;  3VR4 A;  2E2H B;  4XQQ A;  4J1M A;  3S2D B;  3MFG A;  3EJI A;  2NN6 I;  1CFM A;  1Z6H A;  1FD7 D;  1UEA B;  3D4R A;  3J81 E;  1GUS A;  1HTP A;  1X32 A;  5EPJ A;  3M85 A;  5ELE A;  4MN3 A;  3MC0 B;  2A5H A;  3CKI B;  1EWC A;  3FVQ A;  2PO4 A;  4A3M B;  1WTP A;  3DWP A;  3R93 A;  3L7Z C;  4B08 A;  2KQ3 A;  3H09 A;  4C3I B;  3SXH A;  2XNA C;  2PZU A;  5CR3 A;  4H7B A;  5IGG A;  1H9S A;  4KY6 A;  1J8I A;  3DWA A;  1SNP A;  3NTI A;  1W6J A;  3T16 A;  1EIH A;  4V0B A;  3S9W A;  3NSW A;  3CU7 A;  5IT9 E;  1SNQ A;  3D8G A;  5JVG 3;  3NPP A;  2NB0 A;  1JB3 A;  4DAV A;  1HFG A;  4ZLT F;  3DWQ A;  1HQR D;  4IUP A;  1O78 A;  4KN4 C;  1EWH A;  1PXU A;  2IW3 A;  3BYT B;  3EVQ A;  1TWH B;  1GUG A;  4C2M B;  4S3S A;  5K36 G;  1X3Q A;  3KLR A;  1H9M A;  1ROD A;  4HED A;  2OF1 A;  3DUZ A;  4DXF A;  1LTT D;  3S1R B;  2K1B A;  3RZD B;  1I6H B;  2PPB C;  2AQ3 B;  2CW0 C;  3KUP A;  5CMD A;  1M8A A;  1RF2 D;  4Y7N B;  1O80 A;  1U4M A;  3OWF A;  2OT2 A;  4C3I G;  2E74 C;  1STB A;  1CM9 A;  1SXT A;  5CBE E;  2F0N A;  1WTO A;  4PMW A;  1FYC A;  2JA8 B;  3NQI A;  5I2Y A;  2NN6 G;  4BA1 I;  2K5D A;  4I7Z C;  2M2L A;  4ABN A;  3CRL C;  1O7L A;  4QB4 A;  3FPU B;  1XXG A;  3ONA B;  1NUC A;  1MBY A;  5FO7 B;  5A2Q E;  3BYY B;  3PUY A;  1D6E C;  4KI0 A;  3K59 A;  5JEA J;  1C48 A;  1A6X A;  2B2T A;  4C1N K;  3V05 A;  1OXX K;  1XX8 A;  2L11 A;  1STG A;  1LLR D;  2KHS A;  4BBS B;  4IN3 A;  4X3K A;  5J1Z A;  1DXM A;  5D3I B;  3J80 L;  4CKB A;  3KK7 A;  1LV9 A;  1GOZ A;  4IAL A;  5DNF A;  3VYS A;  1SND A;  1VMC A;  1CA6 A;  4U68 A;  1QCB D;  2NBF A;  4DNR B;  1KDC A;  1OO9 B;  3RUZ A;  2F4I A;  2O4X A;  2XRS D;  1V43 A;  3HEJ A;  2JP1 A;  3I8Z A;  1LTA D;  3P75 A;  2X69 A;  5COY A;  4X3S A;  2NYZ D;  3QB3 A;  2A6H D;  2PZW A;  1IHZ A;  2KVM A;  1R9T B;  3EFX D;  1EEF D;  4MHE A;  1DD2 A;  2JSO A;  3TDQ A;  1CI3 M;  1BF4 A;  5DM7 3;  4X3T A;  1F9S A;  4IFD J;  1KNE A;  1WD1 A;  2LKV A;  5KRU A;  3J81 L;  5C5L A;  2JEA I;  3NUC A;  2EOT A;  2F0U A;  3SK5 A;  3K5O A;  4X3U A;  4HCE A;  3UI2 A;  3OMG A;  1ENA A;  1PDQ A;  4RFB A;  2PW5 A;  5KYL A;  2F0J A;  1B9N A;  2Z1C A;  4C3J B;  2JEB I;  1IW7 D;  5JOB A;  3TP6 A;  2F0S A;  2EYP A;  4A3B B;  5IGC A;  4XT1 B;  1Y1W B;  1UUP A;  1CQV A;  4K5X A;  4A3E B;  4EGV A;  1KAB A;  4IUQ A;  4RHS A;  1LAB A;  1I4P A;  5IT9 L;  5EPL A;  4CKC A;  5E3F A;  1S5B D;  1VCI A;  3LWE A;  2EJM A;  3M7G A;  5M5Y B;  2E75 C;  5I6Y A;  3MWY W;  1BXT A;  3OHX C;  1EY5 A;  5KND A;  3I4L A;  2VXW A;  3SK4 A;  2BDO A;  2M9V A;  5DM6 3;  1M4V A;  3TP7 A;  3VR3 A;  4UDU C;  3GTG B;  3OMC A;  4OGQ C;  1LT3 D;  3H6M A;  2XSC A;  3ND9 A;  4FF2 A;  4FF1 A;  3C46 A;  2VB3 X;  3PUZ A;  3C2P A;  2RA4 A;  3K0Y A;  1B2T A;  3FRP B;  1GUW A;  5IGE A;  1CHP D;  3PIP 3;  4K6D A;  1WTX A;  5JJZ A;  1QOH A;  2CVR A;  5HGT A;  1D1I A;  1X3P A;  1UAP A;  5C4H A;  3OSO A;  3S15 B;  5C3W A;  3HP3 A;  2L9H A;  3GO5 A;  2IX3 A;  1S5E D;  2ENB A;  1QG7 A;  2WB1 B;  2JE6 I;  2NVT B;  1DON A;  1BCP D;  4RGT A;  1QB5 D;  4C3J G;  1VF5 C;  4CJ1 B;  1EQT A;  3V2T A;  4J6H A;  4PMC A;  1BO0 A;  2B2U C;  3DM1 A;  1I4G A;  3VA5 A;  3LWU A;  1TS3 A;  2CW0 D;  1AZQ A;  2EYO A;  3PUW A;  4A3F B;  4AYB B;  4A3K B;  5C5M A;  3GP7 A;  4QMG A;  1MI2 A;  4I65 A;  1Q90 A;  1NCV A;  3MVV A;  2MHV A;  1C4Q A;  2B2W C;  1EY4 A;  3TN2 A;  1GXD C;  3KLS X;  2K05 A;  1FGB D;  5IIF A;  4DFA A;  4DA2 A;  5C4X B;  3PV0 A;  1GHK A;  3H91 A;  2JXM B;  1CA5 A;  1ONL A;  3BG3 A;  3F2U A;  5C0X J;  3J7A F;  2SNM A;  4J8Q A;  2PMZ B;  2ID0 A;  4DU9 A;  1XWE A;  5M3F B;  2KEC A;  1RTO A;  4IUV A;  4CJ0 B;  1SDF A;  1KLG D;  3OWE B;  4KD3 A;  2N55 A;  4KMU C;  1PTO F;  3OOC A;  2DNC A;  3J7Y W;  2K33 A;  1EYD A;  5CYU A;  4C3H B;  1PYW D;  3HOZ B;  1ET9 A;  4RGM A;  4IUT A;  4G57 A;  3L3O C;  4YIJ A;  1SE2 A;  2LS0 1;  1ZKO A;  4G4K A;  4RCO A;  1GUN A;  3S1M B;  2D62 A;  2N88 A;  4XYO A;  3BVG A;  1C8C A;  3NWT A;  5J22 A;  1WTW A;  1CQF A;  1F77 A;  3P20 A;  4HCS A;  2F0L A;  3H0G B;  1AP0 A;  5LHY 1;  4DAY A;  2EY5 A;  3D4W A;  4ODG A;  4XT3 B;  4BS9 A;  1KNA A;  2WIN B;  2F0Q A;  1WTV A;  2F0M A;  3G6J B;  1S4Z A;  4K5V A;  5D3D A;  1JR0 D;  2F0O A;  4F7X A;  1F2Y A;  5F2D A;  4KHV A;  1EIG A;  1T5X D;  3N6R A;  3TZD A;  2ZXO A;  1GUO A;  2G9D A;  2OEO A;  3HS0 C;  1EY0 A;  4DF7 A;  1PRT D;  4ID6 A;  5EBC A;  3MFY A;  2QCP X;  3TP5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...