1UEAB

Mmp-3/timp-1 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
181
structure length
181
Chain Sequence
CTCVPPHPQTAFCNSDLVIRAKFVGTPEVAQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHARSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX METALLOPROTEINASE-3
publication title Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Complex (metalloprotease/inhibitor)
total genus 42
structure length 181
sequence length 181
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ueaB02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 1ueaB01
2XWJB 3G6JB 2XWBB 5JPNC 1JB3A 1PXUA 2B39A 3OHXC 4FXKC 2ICEC 2TMPA 3FRPB 3T4AC 1OO9B 1BR9A 2QKIC 4ILWA 2WINB 1UAPA 3HRZC 5JPMC 1JC7A 5FOBB 1UEAB 2I07B 1GXDC 4FXGC 5FO7B 2WIIB 3V96A 3CKIB 1BUVT 3HS0C 2E2DC 2J0TD 2A74C 3L3OC 5FO9B 3CU7A 3MA2B 2A73B 5FO8B 1D2BA 1XWEA 3I70A 3KLSA 1BQQT
chains in the Genus database with same CATH superfamily
4IUPA 3TRZA 1X3EA 3W5OA 2B2YA 4HIMA 2E75C 2KHJA 3OPOA 1IBKQ 1XNRQ 5I9OA 1DOMA 1S3OA 1WTWA 1D1IA 1SYFA 1SYGA 4EGVA 2Q8RE 2Q8TA 4O42A 2B2WC 4F87A 2K5HA 1LTAD 4LJZC 1XTDA 5EBCA 4MIUA 1II3A 4IPHA 4CGYB 2ASBA 2F0OA 3ERSX 1V1QA 4P72A 1RD9D 3HKZG 3D4RA 4HTHA 4IALA 3VYSA 2IPKD 3PIO3 3OOCA 1F2YA 3PF5A 4ULLA 3HGBA 4HN7A 2ICEC 1JJCB 4YWLA 1HHVA 3IRBA 4B3SL 4IJHA 1D6EC 1W6KA 3VYUA 2ENBA 3GO5A 4B3RL 1CI3M 2R61A 4DR4Q 1N33L 4DV5Q 1KDCA 3I72A 1EFWA 1H95A 5IODA 3LWEA 4V190 3A8JE 4A3CH 2EYHA 4XYQA 3GTKB 1J9OA 5GROA 1STGA 2ZT9C 1C9OA 1EOVA 4GN4B 3URYA 4K5WA 2R93B 4H44C 2MP1A 5IYBH 3K5OA 2HHHQ 3T1HQ 1WTHA 2RSOA 1CSPA 1B3AA 4RCOA 3S1RB 4X64L 5IP7H 2E2JH 2NTSA 4A3BG 4FDBA 3U4ZA 1WCMB 1A63A 3PO2G 3DWQA 2RBMA 3PV0A 4JG2A 4A75A 4DUZQ 2Y0SE 4YHHL 1PFNA 3KF6B 3HOVH 3GTJH 1EQRA 3D0FA 2KEEA 4X62L 1LYLA 1SFOB 2DJGC 3BZDB 3A8IE 2HQLA 4GOPC 1PH4A 4EQ5A 3HOZG 2B63H 2I46A 1T5XD 5EAYA 1VQOA 3RR5A 4IURA 3DM3A 4DAVA 1VF5C 1KXLA 2ZXRA 4JVZA 2Q2TA 4GKKL 1JWMD 3HOWG 4UAIA 4F88A 2EYPA 4AQYQ 1JJ2A 2FXQA 4KHPQ 1U0LA 4PV1C 2UUAL 2PQEA 1RTNA 5M3MB 2AUKA 2YU9B 1DYQA 1YNNC 5ELNA 5I9PA 4B3MQ 2G5DA 3GQBA 1VQ8A 4WFN3 1OTCA 2XRSD 3M4QA 4A3GG 3E0JA 3RN2A 3SDZA 3M7NA 4BBSH 1SEBD 4MHEA 3OSOA 4S3SA 2WB1E 1NR2A 1IBKL 1YZ6A 1VQ4A 4KK7A 1XMQQ 4IPGA 5FLXE 2Y0SB 4DV7Q 3S1NH 1YVCA 4ILWA 5L37A 1K0SA 2IX0A 5CBEE 1HNXQ 3HP3A 3IFDA 2CWPA 4H13C 1S5CD 4EQOA 5CGKA 2K5NA 1G6PA 4LMQD 4GLVB 3J81i 3MC0B 4X3UA 3S14B 5E4WC 2HT1A 3I4MB 4QGUA 4JI1Q 2VW9A 1IL8A 2VUMH 1BCPF 3HG9A 1VQIA 4JI2L 5FKAC 4RKBA 3KYHC 1PMRA 1SBBB 1U5KA 1XPOA 3OWFA 1E2VA 4NKLA 1B50A 1I4PA 1LACA 2A6EC 1SMXA 2O5JC 1FYCA 2EDGA 3TS2A 4YWMA 1VQ7A 5JJLA 1AE3A 3A54A 2UXBL 5HY6A 3H09A 2K04A 2HQEA 4LF5Q 3KJPA 2BCOA 1I3QB 3GTGH 2F0DA 1TWFB 1HZBA 1NTGA 4HJ5A 2JA5G 2WB1B 2HHHL 4OO1H 3OIPA 4IUUA 2F0WA 4RGTA 4AYBG 3BS1A 1PH8A 4DV3L 1JQYD 4KY6A 3PUZA 2TSSA 3CKIB 3HOXG 3HOUG 1C8CA 4DXFA 4DUZL 2JA8G 3HZXA 3A5UA 3HOVB 1S40A 3GTJB 1EWIA 3TREA 2IY5B 1EY5A 1Q81C 1B9MA 5JPNC 3NHHA 1ZYRC 2F0LA 1IKMA 1BBXC 3KLSX 3T4AC 5GAGC 2EYMA 2KENA 4A3JG 1R9TH 2B63B 3K59A 1C48A 4R1JA 3K8AA 5A35A 1EIHA 5HURA 2EVBA 1EUJA 2O5IC 3PO3G 4GN5A 5CORA 1ESRA 1XWEA 5CV9A 1BNZA 1QB5D 2L55A 5CV8A 4AQYL 4DGZA 2DN8A 4H7BA 1F2MA 1X65A 3FP9A 1JOKA 3W3AA 5EKKA 5IT9E 4C3IH 5C4XH 2WAQG 4TVAB 2YV5A 4P71A 2L1BA 5C0XI 4BBSB 2AMCB 1V1PA 4RGMA 1EZ6A 3J80i 4EQNA 4JI7L 1LV9A 2K33A 3PF4A 3NENA 2UXCQ 1QZGA 5M5YH 2BDOA 1GOZA 5C5LA 1XMQL 4UP7A 3S1NB 5JOBA 2Z6BA 4FYDA 4ALPA 1IYVA 4DV7L 1YEZA 2K32A 5JAVA 1X9NA 1G291 3CCSA 4X3SA 1BKBA 2F3IA 1DONA 5M3FH 1PLFA 4KN7C 3AYHB 1NNXA 2EY1A 1ILQA 2L4NA 1QG7A 2VUMB 2RHQB 2RSNA 4JI1L 3GTMH 1CM9A 4LF8L 1GUWA 4LK1C 3Q6SA 2GVBA 3WOFA 1EYCA 3P7JA 2F1MA 1CFMA 4IFDH 1STHA 3KBXA 3H0GH 1E1TA 5FJ8H 1PRTF 2OTLA 3MXNA 4A3IH 4DR1L 3JC66 4L5RC 1DCZA 3TP8A 4MZ9A 4L5TA 4M8AA 3D6WA 4ZUIA 1X55A 1J6QA 1PYBA 1DXMA 3H6MA 3GTQB 4DR2Q 1HNZQ 3S9WA 1HR0Q 4K5VA 3GTGB 2L5TA 2HIVA 1D2BA 1SJHD 4BBRB 2DJFC 5FLXc 2LS01 2D9UA 1KTKA 4FXDA 5D3IB 5ELFA 3NUCA 3U50C 3RMHA 4R8IA 2BA0A 1MIUA 1WFQA 4U673 3CCEA 4A3FH 3BZKA 3B6YA 3LNNA 4DV0Q 4JI0Q 3M7GA 1VQAA 1M90C 2VB3X 1J5EL 2CQOA 5AJ3Q 1GO3E 4F7XA 4ZCKA 4CJ2C 1EY8A 1TXYA 2XNAC 5EGTA 3VYTA 4B3TL 3WOEA 1WTVA 2VQFL 3OHXC 1R9TB 2PI2A 4X66Q 4OHJA 1PH7A 4JI5L 5C44G 3BYTB 3J80E 4I7AA 2Z4HA 2F52A 5C3EH 5C0XG 1HTLD 1OXVA 2Q2IA 3MXPA 2R92G 5JEAH 3QO2A 1FVIA 2PQAA 1SMYD 1BCPB 4RKLA 5JEAJ 5A2QE 1QUQA 3KDFB 1NJIC 1SN8A 1BQQT 3SVMA 3DWAA 4C3IB 5C4XB 4IJLA 3ND8A 2KVMA 2GA4B 1LTTD 4QB4A 4ZYSA 3JAMi 4J15A 2QA4A 2Q2UA 4DK6C 5M5YB 4OIKA 3F2BA 4K14A 2A74C 3TQYA 3FPPA 2SNMA 1X3FA 1WVLA 2B2YC 4NDXA 4BA1I 2K5VA 5T1GA 4CKBA 1L1OB 1TU2B 1V1OA 5M3FB 4A3DG 1H9RA 1YNND 2JA7G 2HUGA 1LLRD 3KLRA 3G48A 4DNIA 4KD3A 4IO9A 3GTMB 2K4KA 5FLMG 1XTCD 4CHTB 3FKIH 1K8AC 1GJXA 3V2TA 2F0IA 1L0YB 2L0CA 3K5MA 4PMBA 3VR4A 4A3IB 3J7AV 2KUMA 3ERQA 4NPSA 4A3KG 2ID0A 4CKCA 1JR0D 2F4IA 4LAAA 1SROA 3J81c 1E2ZA 1LT5D 4ABNA 3T53B 3MVVA 2WINB 1CKMA 1M1KC 4FF1A 3VR2A 4DR2L 1EU4A 4WORA 1PTOC 5CBAE 1A6XA 2Z6KA 2K03A 2NN6H 2F0GA 2B2UA 4P75A 4FP5D 2A8VA 5IGEA 4JOIA 1VQ6A 4A3FB 4GLXA 5IGBA 2JP1A 2NZ1D 1RIPA 3ULPA 4JBKA 1CHPD 3DM1A 3F2UA 4JBMA 4OGQC 2NTTA 1BR9A 3SR1A 3UDXA 2DY8A 1PFMA 4BXXG 1S5DD 1PH9A 2PNHA 1LTBD 4BY7H 1Y1VG 4GLAC 4X65Q 1CA5A 4B3SQ 2CFMA 3MXGA 5M5XH 4TSSA 1KL9A 5GAEC 4B3RQ 2B2VA 5JJKA 1N33Q 5EBDA 1H9MA 2KA7A 5C3EB 2UU9L 3JAME 4LFBQ 3DLLA 1UE1A 1PV4A 3PIPA 5IGCA 2ZM6Q 2JEAI 1MJCA 2VQEQ 2NB0A 2BH2A 2K5QA 3I2ZA 1E2WA 4A76A 1HZ9A 3CRLC 1BUVT 4C3HB 2K14A 2EYLA 3GD7A 4ODGA 4POFA 1STEA 4K0KQ 1MJEA 1G51A 1PRTB 3FEWX 3I4NH 1I4QA 1SE4A 2P5ZX 2K1BA 2C35B 1D5ZC 1W6JA 3SE0A 4JI4L 1UWVA 3MEHA 4N9PA 4IOAA 1ENFA 1NMGA 1HNWQ 4X62Q 3Q22A 3WDNA 3S1QB 1EY7A 3L9AX 2VB2X 2JXMB 1TY0A 2C5CA 2R3ZA 4LF6L 4KKUA 2JA6G 2F03A 3J80c 5LMNL 3A55A 2PPBC 1A2UA 5IYDG 5D3DA 3X3MA 1SNMA 4LF7Q 4FXKC 1D5MC 3FKIB 2E5LQ 2NUCA 4GKKQ 2PZUA 4A3EG 2XGTA 3I4LA 3KK7A 3L0OA 2CW0C 3CHBD 1ZXTA 2LSSA 1H9SA 3HKZE 3IAYA 5ELOA 3CCMA 3CC2A 1TR5A 4DV6Q 1NE3A 1G6ZA 3K57A 1BOSA 1KRTA 1F9RA 4N9TA 3MFYA 5IP9G 4O2DA 5DAUA 4RGOS 1JOOA 4DK3C 1HFNA 1EQVA 1I6VC 4ID6A 2VXWA 1TVXA 2K75A 3S2DH 5FO7B 3PIP3 1IBLQ 1V43A 3S17H 1N32L 3U9SA 3IFTA 3K58A 1WTOA 4C56C 2QEXA 4UPAA 1BBUA 1K83H 4CDFC 3QJYA 4J1MA 3N52A 4HIOA 2R7ZB 3S2HH 3PMFA 3BG3A 3NEMA 3S14H 2AQ2B 5G3LD 3CMEA 1X6OA 3I4MH 4DA2A 4BY7B 4JI2Q 4X65L 5D14A 5M5XB 3RLOA 3UDGA 4HJAA 2XIWA 1WOCA 3QWNA 1HA6A 1N36L 1KAWA 3R3OA 3AEVA 2KCMA 1VQ9A 3NTKA 4LFBL 5KEEA 2ZM6L 3T1YL 1HZCA 2HDMA 3HKZB 2NZOA 2VQEL 2UXBQ 1JB3A 5K36G 4EX5A 1O7ZA 4HMJA 1IW7C 1SR3A 1O7IA 2YTYA 1XNQL 4JV5Q 1ENCA 4C2MH 1PA6A 2M2LA 3K0YA 4CBVA 1I3QH 5D65A 1TWFH 2DNCA 4DF7A 5IGGA 1WCMG 3I4NB 4K0KL 1Q8IA 4LUZA 4DV3Q 5EKLA 1U4RA 4WJWA 3LX0A 1KDAA 2A5HA 4RWSC 5EPJA 1SMYC 2F0JA 3SHLA 1DD2A 2KJXA 2ZTEA 5CV5A 3R2IA 4C1NK 1KABA 3KJOA 2JN4A 1PYWD 5K5PA 2TMPA 1Q82C 1HNWL 4KJNA 3CRKC 2CKZB 1N34Q 2RDFA 1RDPD 4A3LG 1MBYA 2NVYH 4HIKA 2QILA 1HA5A 2UXDL 2JA5H 3JAMc 2KBNA 3NBIA 1Y14B 3VDYA 4LF7L 4X6AH 4MTNA 2EJFC 2E5LL 5KRUA 3HOXH 4R4TA 3O13A 5DEHA 3VYRA 1VQGA 1PDQA 1TKWB 3UE1A 5LHY1 1PYSB 1TIID 4RA8A 4B9WA 1RL2A 1U4LA 3OMGA 2ZXPA 2ALYB 1I6HH 1IXRA 3EA6A 1EYDA 3ZJYC 1X56A 4PNYA 4DV6L 4JI7Q 1X3PA 1A2TA 4IUQA 1SSOA 1B2TA 5H1SE 3OTOL 2UUBL 5CC4A 3PGZA 3S2DB 2OQ0A 4DV1L 4HJ8A 4R4CA 2N88A 3HOWB 3S17B 1MI2A 2WFWA 3HRZC 1K8GA 1IBLL 5GADC 3CW2C 1D7QA 1KAAA 3UDFA 1HUMA 4Q0FA 3BVZA 1K83B 3AQQA 3NXWA 1O78A 1LUZA 3J81L 1PZJD 3W1GA 5CMDA 1EYGA 3S2HB 4QL5A 1MGSA 3Q0AA 1STBA 1WTRA 4A3GB 3TZDA 3BZCA 1IKLA 1PH3A 3FHWA 2G9HD 4RCNA 5BN3A 4LF8Q 2NBFA 3RZOH 3D31A 1CT1D 2QGQA 3A7AB 5C6AA 3SK6A 1G2TA 1RF2D 4I65A 4A3CG 1PTOD 1EL0A 1UAPA 4AYBE 3DHQA 4NP5A 2QW7A 4DR1Q 4U68A 2A6HC 3EIVA 2MUYA 4GOPB 2JJQA 3IL8A 3H94A 3OW7A 1EY0A 4JI3L 3A7LA 4G7HC 1U4MA 3M85A 1XMOL 3GTQH 2WB1G 3CP0A 4C2MB 3OW2A 4HAEA 4JV5L 2QDLA 4OEMB 5E1FA 5IP7G 4BBRH 3KF6A 2OXPA 1EEID 4CDEC 1E1OA 4H02A 4I7ZC 1F9SA 1AEXA 1JC7A 1SAPA 1QE6A 4CJ0B 2O4XA 3FMCA 3S1MB 3CXCA 1IYUA 4A4IA 1QOHA 5BN5A 1ICFB 2EYJA 1Q12A 1AZPA 1Q86C 1J5EQ 3PCOB 4OO1I 4IPCA 1LTID 1B70B 5JJZA 2F4VQ 4B3TQ 2D5DA 3T56B 2B63G 1WYDA 2VQFQ 4JPBW 1A0IA 5LMUQ 2IL8A 2NVYB 4R4QA 5J1ZA 1N34L 1Y8NB 3SK8A 4K6DA 2WAQE 1B4OA 2JA5B 4JI5Q 4XTCS 1G8ZD 2B8FA 1K0RA 4R4OA 2IHFA 2MFIA 2WP8J 2IT1A 3BU2A 3H91A 3TDQA 4QUFA 3I8ZA 3FDTA 2MNAA 1BBWA 2EZVA 3HKSA 1FL0A 2HCCA 3HOXB 5FO8B 1YNXA 1IYJB 1EIFA 5TSSA 3L7ZC 5IIFA 4RGNA 3GTLB 1CK1A 1O7YA 4AH6A 5CV7A 4K6LA 3MFGA 1VQKA 1DM0B 2BDNA 4QJFA 1F9QA 1OXUA 4BBSG 4DPGA 4HJ9A 1I6HB 1I94Q 1SLJA 3BVGA 1YHAA 5E3FA 1L0WA 1QWYA 3UI2A 2EY6A 1KNAA 1Q3LA 2QEJC 4XT3B 2E2HH 3OWEB 1C7YA 1FNVA 2F0NA 1ICWA 4ZKCB 4DUYQ 1H9KA 5BN4A 1SYEA 3BDLA 5IYCH 1SJED 5M5WH 2NVTB 5J3BA 1KLUD 4UY8C 2R92H 4LUOA 3CC4A 1JJGA 2PO4A 3I4OA 1BXTA 3DWPA 1JORA 1GUNA 2Z6KC 4NW2A 4V0BA 2CW0D 4LF4L 1NSNS 2B2UC 1V8QA 1VQMA 2K28A 1JOQA 1D5XC 4JOIC 2WAQB 2M00A 4K5XA 2AQ3B 1CA6A 5BR8Q 4BY1H 1OXXK 2KHIA 3CCVA 3RZOB 4OWTB 2XN9C 3BDCA 2NVXH 4CDCC 1XPUA 2FINB 1TY2A 4TQUS 1JE5A 1OO9B 3Q8DA 2LY7A 3W2DA 5T1IA 1LTGD 2CHBD 2PYKA 1BCPC 2B2VC 1VDZA 4A3MG 3TSSA 4NXML 4IFDI 1Y1WH 1O80A 4FO2A 4OO1G 3D4DA 3PUWA 3NP8A 1EIYB 1UE5A 1PZKD 2CQAA 2F0HA 2H5XA 2BA1A 3SK5A 3EVQA 2KEDA 4C3JH 3ZYYX 1A62A 1N9WA 2MHVA 1M4VA 1EY4A 4DK1A 1UEAB 1P8LA 3TN2A 4L5SA 3RZDH 4KY5A 2ICIA 3M4OH 2L12A 1K73C 2F4VL 1L1OC 1DOLA 3QB3A 3CPWA 1RODA 1S5BD 1IW7D 1LO5D 1SNOA 1Q90A 3UDIA 5LMUL 2MPMA 3C1EA 1OXTA 1I50H 3ICEA 2UU9Q 1RHPA 4FF4A 3KF8B 5JPMC 3L2PA 1LTSD 2Z4IA 4KD4A 4LFCQ 2LMCB 3KLWA 4YCUA 3RD4A 3C46A 3D6CA 1K9MC 4Q5VA 4LWCA 1D1KA 1TWCH 2MO1A 1M8AA 3H3VH 2AUJD 3RN5A 4C3IG 3CCJA 5C4XG 1YJWA 1B1ZA 2BH8A 3I56A 5ELCA 1Z47A 2B29A 2OEOA 4C3HH 3G6EA 2J4XA 1C4QA 2Z0SA 3X3NA 1I94L 3KUPA 2Z8LA 4RHRA 2AKWB 2E2HB 2JQOA 3STBC 1YI2A 1EQQA 1IBMQ 4JI4Q 1W3SA 4DV4Q 4QMGA 4DUYL 4IZ8A 1CZGA 1Q1BA 1WJJA 5M5WB 1B44D 2R92B 1LTLA 5FO9B 3I91A 4CJ1B 1WD0A 1LT4D 3P75A 5M3FG 1RCVD 3PUVA 2Q2HA 3S1QH 1SNDA 2A69C 4QIWE 2VZAA 4LF6Q 1NY4A 2EYFA 5C3XA 5M9OA 5LMNQ 4DAYB 1PZID 1EWHA 1Q46A 2VNUD 1EEFD 4BA2I 1HTPA 2PW5A 4BY1B 3NQTA 4LW1A 3OYYA 5I6YA 5DLQE 5BR8L 1EIGA 2KCTA 4IFDG 3H0GG 3QIAA 5FJ8G 2NVXB 4DR3L 4A3IG 3HEJA 1HR0W 3R8BA 1LT3D 1WTXA 1VQJA 2K5WA 5IWAL 1ASZA 1ET6A 2RDGA 2X69A 1TS3A 5IT9c 4MNOA 2F0FA 2WKCA 1SE3A 1TWAH 2K50A 4A3DB 1S4ZA 2R7DA 1Y1WB 2JA6H 1NBWA 4APVA 5DM63 5COYA 4LF9L 1AH9A 3D4WA 5J22A 4A3FG 1JWUD 1VMPA 3HOYH 2EOTA 4HMIA 3LWUA 3I3CA 2AWNA 2D0OA 4C3JB 1N32Q 4UHVA 3NBHB 1PH2A 3M9BA 4A93H 5IE8A 3FPUB 1C0AA 3CCQA 1YITA 4QIWB 3GV6A 2A6HD 2NN6I 1X32A 1QJOA 3RZDB 2R7ZH 2WV6D 3M4OB 1SYDA 2FFKB 3ULLA 1FD7D 1GHJA 3KF8A 1Z9FA 4HJ7A 1K3BC 1TWHB 3S15H 4XQJA 4LUVA 4YCWA 5CV6A 3CU7A 5C3EG 1AE2A 4FNFA 2VL6A 1ML0D 1N36Q 1I50B 1HPCA 5IGDA 2CH4W 2KCCA 4WRDA 3KDFA 1R4QB 1PH6A 1PXUA 1W2BA 2IWHA 3T1YQ 4PZ6A 4JCVE 4LFCL 4KKTA 5F2DA 4JYAL 1E24A 3G71A 1ENAA 1TWCB 4LNQA 1WI5A 1XNQQ 1EOTA 1SE2A 4ZKBB 3MHBA 5JJIA 5CYUA 4JI8Q 1EFID 3NTIA 5KYIA 4KJOA 3EBEA 1A3TA 3GTPH 2ATWA 2MJ8A 4G7ZC 2FJ2A 2NWGA 4XYOA 3TZUA 2H1EA 1IBML 1YJ9A 1TS5A 1SNPA 4CKEA 3J7A5 1L1OA 4DV4L 4DAMA 2OTJA 4GS3A 3BDOA 4OONA 2K52A 5FOBB 1X54A 1VQHA 2OT2A 3WWVA 4F8MA 4DKAC 2SDFA 2WIIB 1AP0A 1E3PA 1UE7A 4K8JA 4RHSA 1A15A 1HRJA 5HGQA 3MA2B 1QILA 4E6IA 4EVOA 3HFZB 1SRUA 4WJ3M 2UXDQ 4YIJA 1FGBD 1NR4A 4GKJL 2ZJPA 1GHKA 1VQDA 4BS9A 1PHJA 4Y7NB 3I55A 4A3BH 1LM0A 3PO2H 1DJRD 1CKOA 2N78A 1EY6A 2N8NA 1ZKOA 4KV6A 1WTQA 4FXGC 5ELBA 3KFUA 2PZWA 3E6ZX 3W1BA 1DGSA 3GTOH 1QVCA 1OXSC 1ILPA 2F0SA 2D2CC 2F0UA 2KCNA 3ND9A 1JICA 1LABA 1TWAB 2XWJB 4A3LH 1B53A 3RNUA 2ZXOA 4IN3A 2JA6B 1VMCA 2VY3A 3HOZH 2NN6G 3QR8A 1GKHA 2IX3A 3F2DA 3U4VA 4G7OC 1RKNA 3V05A 3OTOQ 2UUBQ 1F2ZA 2OWOA 3HOYB 2VS1A 1YBYA 3T51B 1GXDC 5DNFA 4DV1Q 3NWSA 4A3EB 1B8AA 3HOWH 3PUXA 4X3TA 3SK4A 4A93B 1NCVA 1QVGA 2IW3A 4UDUC 2QCPX 1VQNA 1XXGA 4BY7G 4RFBA 1O7LA 4MTKA 1FJGQ 4HCEA 1SYCA 4A3GH 3PSIA 3A8KE 2XRQD 1BCPD 2R6GA 1Z7TA 3S15B 1F77A 3M3YH 3DXJC 1XJVA 3QOJA 2EY5A 5FLXL 3M4PA 2B3GA 3EQLC 5I4DA 2LXKA 3F8TA 2AQ1B 3K5LA 3A56A 1UEBA 2M9VA 3E9HA 5EQ0A 1T5EA 4JI3Q 1HZAA 3ITPA 4L5QA 2R93G 4HEDA 1AN8A 4DR7L 1XMOQ 4GNXB 1VQEA 4KKSA 2N3SA 3D3RA 3I4NG 4KI0A 1KC8C 4JI8L 1SNCA 5IOCA 4OX9L 1BF4A 3GTPB 2CVRA 4ZQ3A 2EXDA 2PZTA 1F2LA 1I4XA 1RTOA 3TBIB 3L3OC 2B8GA 4RMFA 1U9RA 2A73B 3AB9A 3MEFA 4EQPA 1YJNA 5C3WA 3S1MH 2F0PA 1KQSA 2OF1A 3NWTA 1HXYD 3EROA 1K28A 5KNCA 2LXJA 2B2TA 1KIXA 2JYOA 2XSCA 3SEBA 4JI6L 3J7ZC 4FF3A 4Z9CB 3F2CA 1CQVA 2L9HA 2WACA 3OMCA 2ZTCA 1B3QA 1GUGA 4HCSA 2FMMA 1G2SA 1NAPA 3U9OA 4PZ8A 4DR5L 4A3BB 3G6JB 4R8NA 3STBD 3PO2B 3HOUH 5M3MG 1BDOA 3K81C 3J7YW 1N8RC 3T16A 4G57A 2JA8H 1FNWA 3GTOB 3GTLH 4DN4M 1Y8PB 3DEPA 2E2IH 1I5FA 3P20A 5J39A 2V1CC 2L11A 1ESFA 2BE5C 2N49A 2YYZA 4JBJA 3CQZH 5ELEA 3NPPA 2XVSA 1WD1A 2K05A 2PMZE 4KHVA 5JVG3 1WTPA 4JBWA 3HOZB 1TWGH 4YWKA 2A69D 4CDDC 4A3JH 3K80C 1STYA 4FF2A 2XWBB 4DNRB 2Y0SG 3CCUA 3G7LA 3I7FA 1VS0A 1AFPA 2A1AA 2WKDA 3CD6A 2SNSA 5E4XA 2EJGC 3PO3H 5NUCA 2NVTH 3E5SA 3DUZA 4ZK9B 3VR6A 1GVPA 2I07B 3S24A 4LF4Q 4QUCA 5IT9L 2GVAA 4KMUC 1K8OA 1PH1A 3I4MG 3MXUA 4ZAIA 5GQOA 1FJGL 2XTIA 1XNRL 3M3YB 1SDFA 3CPFA 5HGTA 1Q8KA 3NK9A 1B9NA 1SYBA 4QF4A 3BJUA 4GNXA 1LT6D 4RAUC 1V1PB 1P16A 1PRTD 2K6AA 5IGFA 1EYAA 1K3RA 4Y52H 5KYLA 1E7ZA 5KNDA 3K7AH 2MO0A 3J81j 3E9IA 5G3LF 5IYBG 3KLSA 4NXMQ 1NMFA 2PMZB 4TRDA 2NVQH 1X3GA 4N8X1 2DNEA 2PCFB 1EZ8A 3FRPB 2QKIC 1I4GA 4DR4L 4UP9A 4DV5L 3Q23A 2A68C 2EIFA 1Y8OB 1YNJC 4K2LA 3K5NA 2PI2E 1CKNB 1Q1EA 4P2CB 3HOVG 2B2WA 4K8IA 1TT2A 2UUCQ 1YHQA 1ET9A 1PFBA 3A0JA 4A3MH 3MXNB 2EJMA 1AW7A 4ZUJA 3I73A 4DAPA 1DZ1A 1A8VA 2J7ZA 3SGIA 4PQXA 2F0TA 2E2JB 1FR3A 3T1HL 1SNQA 1D8LA 2NYZD 4PZ7A 1HUNA 1MSGA 4L6TB 4AYBB 1KLGD 4R9WA 2CH4A 1JT8A 4PG3A 2RHSB 3A74A 3HOUB 3TEHB 4C1NI 1FNUA 1I4RA 4DK0A 2JA8B 1Z6HA 4PMCA 3K7UC 3M4YA 1EU3A 3J7AF 4OL7A 2E2IB 4XT1B 1UE6A 3CQZB 1JB7A 1JCKB 2F3VA 3EJIA 2A19A 1I4HA 2N55A 4JW0A 2QF7A 2CWAA 1GM5A 1TWGB 4A3JB 2EPBA 3J80L 3NQIA 5C4HA 1ONLA 2PW7A 4IUVA 4J6HA 4LFAQ 5C44H 1L2FA 2ZJQA 3QG1A 4HSPA 4IQZA 4UP8A 2I5LX 4N8FA 4XXEA 5C0XH 1J8IA 3K0XA 3PO3B 4K2KA 2OCEA 4IUTA 4HR7B 2FHTA 5C0XJ 2C9OA 4KHPL 5KNBA 5A2QL 1STNA 4P74A 3VR3A 2I5MX 4B3ML 2KHSA 2OQKA 3MZ5A 3J81E 3AFQA 2VUMG 5FK9C 2PQAB 3S16H 3F1ZA 2F0KA 2GN5A 1QUQB 4GOPA 2X6LA 3NE5B 4DR3Q 2ES2A 2Z9HA 4XDXA 1DOKA 2Z1CA 2F0EA 2QDBA 5ELDA 5IWAQ 1HNXL 4XQNA 3EN2A 1CTMA 1VQFA 1E22A 3K7AB 5ISRA 1F9PA 3GV3A 4ZLTF 1GUOA 4BBRG 2IJ0A 4A3DH 2NVQB 4KY7A 1BO0A 1CKNA 1MHWC 2JA7H 3CAMA 4LF9Q 5FLMH 2JSOA 1VQPA 2MQHA 1PTOF 1G91A 1HJPA 1VQBA 1HH2P 2RA4A 5LL6X 2I0QA 2IHEA 4IFDJ 2K7VA 2JEBI 1VQCA 2PNRC 1EQTA 3MWYW 4HIDA 1E0BA 5I2XA 2LKVA 1PFSA 2MGSA 3KBGA 2HCIA 4A3KH 3HS0C 2Q8IB 5C5MA 2F3WA 1NUCA 2NZHA 2UUCL 1EY9A 1QCBD 4A3MB 4LF5L 3NTHA 1KRSA 4DR6Q 3CC7A 1TWHH 1QNKA 1VF7A 3AU7A 3CCRA 2RQXA 4L8JA 3N6RA 1A3UA 1ZEQX 4WJ4A 1FGUA 4IOCA 2E74C 1IZ6A 4JYAQ 4OELB 3V96A 3GP7A 3P1HA 3EFXD 4DFAA 1L0XB 1HQMC 3IKJA 2F0MA 3DMUA 1T9HA 4BXXH 1V9PA 1PH5A 1KDBA 3H15A 1Y1VH 5IY0A 5C4JH 2HD3A 4YY3Q 3H3VI 3AFPA 3U58A 5IYCG 3JAML 2F0VA 2CCZA 5C44B 1TQOA 2JA9A 4LFAL 5EKIA 3D8GA 3TS0A 3TP5A 3I90A 4OIJA 4RH6A 2AHOB 1CHQD 4B9XA 2E8GA 1A3VA 1SXTA 1K8MA 1PTOH 1GD7A 2LFNA 2B39A 3S16B 4BY1G 2I5HA 1CSQA 4GKJQ 2R7FA 4KTAA 2RVLA 2EQSA 2BE5D 4M1UB 4O1NA 3QOLA 3NSWA 1GUTA 1IHZA 2UXCL 5EPLA 3VA5A 4Y7NH 1CZWA 2ZTDA 3RLNA 5KGUA 5I6WA 2D62A 4KN4C 1AZQA 3ULJA 4DNTB 1VQLA 1BVSA 5EJWA 3CF5A 1LTRD 5C4ZA 1SE8A 4DU9A 2ZJRA 2RCNA 1U4PA 1JWSD 1Y1WG 3H3VC 3LGJA 4HSVA 4FVMA 2SOBA 3RLFA 4XQQA 3CCLA 4KLKA 2JA7B 2RF4A 5IYDH 4J8QA 4C3JG 2E2DC 3ONAB 1XYIA 1GUSA 1PRTC 4ME5A 3H0GB 4GZYC 4GN3B 4ME3A 1QNUA 1XX8A 5KIXA 4DV2Q 2X6GA 2AWOA 4NXNQ 4A3EH 4NB3A 1JE4A 2D0PA 1MD2D 4OWWB 4A3KB 1CUKA 3RUZA 3AMUA 4JC0A 1HNZL 1KHIA 2KOLA 1YHBA 3C1FA 1HR0L 1H9SB 1HFGA 2K01A 4TKOB 1KNEA 4DR6L 4B08A 5AFWA 2JK8A 3MAQA 3VR5A 1S72A 1QZHA 5CR3A 2YTVA 1MSHA 4IUNA 4L63B 4BWGB 5IP9H 2RKSA 5JVH3 3GDEA 3MTSA 4H0LC 2B2TC 3TMEA 5GAHC 2L15A 5JEAG 2A6ED 4JK1C 4JI0L 4DV0L 2EY2A 4AIMA 2A68D 4OWXB 2EXZA 1KD1C 1YNJD 3K6OA 3G4SA 5AJ3L 4DR7Q 3PQIA 2DY7A 4C3HG 3BYYB 2DGYA 3C3LA 4POGA 1STAA 1X3QA 4OX9Q 1Y1VB 4X66L 5C4JB 1S5FD 4NMZA 1HQRD 4YY3L 5LL6S 1YIJA 1Q7YC 4X3KA 3NELA 3GTKH 2KQ3A 5CV4A 5LMNW 4XIGS 4QCLA 4DAYA 3PUYA 1EWCA 3OIQA 2EYOA 4DXGA 2R93H 1MKHA 5K36H 3PIOA 2E76C 2J0TD 4JI6Q 1PTOB 1ZYRD 1RJTA 4X64Q 2F0QA 2EE1A 3I70A 1PVOA 3S1RH 1ASYA 2BOSA 3FKIG 3FVQA 3R93A 1QVFA 1WCMH 3UE0A 2FMCA 5E7NA 3SXHA 3CMAA 4DR5Q 4P73A 1TS4A 4PMWA 2G9DA 4YHHQ 1VCIA 4QQBX 1S5ED 4QY7A 2DUDA 1UUPA 4G4KA 1XPRA 2IX1A 1SFOH 4MN3A 3VA7A 1TS2A 2O2LD 3BVMA 1R4PB 4RG1A 1B7YB 3E3XA 3TP7A 2HDLA 2RDHA 4OXPA 4GNXC 5DM73 4O0AA 2V4DA 5I2YA 3C2PA 3DEOA 3NBHA 3HOYG 1CQFA 2SEBD 1IL2A 2JE6I 3E0EA 4ZRZA 1Y69U 2UUAQ 4KHZA 4A93G 2KECA 3T13A 1H9JA 4IPDA 3R2TA 3Q24A 4DV2L 3KOJA 4YCVA 3ER0A 4NXNL 5M3MH 2YU9H 1HCZA 1VQ5A 5EPKA 3TP6A 1UNSA 2K5DA 4R4IA 2HIXA 2R7ZG 2RCFA 3A5ZB 2H4OA 2YTXA 1JMCA
chains in the Genus database with same CATH topology
4IUPA 2B2YA 2E75C 3OPOA 5I9OA 1DOMA 1WTWA 1D1IA 1SYFA 1SYGA 4EGVA 2Q8RE 2Q8TA 4O42A 2B2WC 4F87A 1LTAD 4LJZC 5EBCA 4MIUA 1II3A 4CGYB 2F0OA 1RD9D 3D4RA 4HTHA 4IALA 3VYSA 2IPKD 3PIO3 3OOCA 1F2YA 4ULLA 3HGBA 4HN7A 2ICEC 1HHVA 1D6EC 1W6KA 3VYUA 2ENBA 3GO5A 1CI3M 2R61A 1KDCA 3I72A 5IODA 3LWEA 4V190 3A8JE 2EYHA 4XYQA 3GTKB 1J9OA 1STGA 2ZT9C 3URYA 4K5WA 2R93B 4H44C 2MP1A 3K5OA 3S1RB 2RSOA 4RCOA 1B3AA 2NTSA 1WCMB 3DWQA 2RBMA 3PV0A 1PFNA 2KEEA 1SFOB 3BZDB 3A8IE 2I46A 1T5XD 4IURA 4DAVA 1VF5C 2ZXRA 1JWMD 4UAIA 4F88A 2EYPA 4PV1C 2PQEA 1RTNA 5M3MB 2AUKA 2YU9B 1DYQA 1YNNC 5I9PA 3GQBA 4WFN3 2XRSD 3E0JA 3SDZA 3M7NA 1SEBD 4MHEA 3OSOA 4S3SA 1NR2A 4KK7A 5FLXE 2Y0SB 4ILWA 2IX0A 5CBEE 3HP3A 3IFDA 4H13C 1S5CD 4EQOA 5CGKA 4LMQD 3S14B 3MC0B 4X3UA 5E4WC 3I4MB 1IL8A 1BCPF 3HG9A 5FKAC 4RKBA 1PMRA 1SBBB 3OWFA 1E2VA 4NKLA 1B50A 1I4PA 1LACA 2A6EC 2O5JC 1FYCA 2EDGA 3A54A 3H09A 2K04A 2HQEA 2BCOA 1I3QB 2F0DA 1TWFB 2WB1B 4OO1H 3OIPA 4IUUA 2F0WA 4RGTA 3BS1A 1JQYD 4KY6A 3PUZA 2TSSA 3CKIB 1C8CA 4DXFA 3HZXA 3HOVB 3GTJB 1EY5A 1B9MA 5JPNC 3NHHA 1ZYRC 2F0LA 1IKMA 1BBXC 3KLSX 3T4AC 2EYMA 2B63B 3K59A 1C48A 5A35A 1EIHA 5HURA 2EVBA 2O5IC 5CORA 1ESRA 1XWEA 5CV9A 1BNZA 1QB5D 2L55A 5CV8A 4DGZA 2DN8A 4H7BA 1F2MA 1JOKA 3W3AA 5EKKA 5IT9E 2L1BA 5C0XI 4BBSB 1V1PA 4RGMA 1EZ6A 4EQNA 1LV9A 2K33A 2BDOA 1GOZA 5C5LA 3S1NB 5JOBA 4FYDA 1IYVA 2K32A 5JAVA 1G291 4X3SA 1DONA 1PLFA 4KN7C 2EY1A 1ILQA 2L4NA 1QG7A 2VUMB 2RSNA 1CM9A 1GUWA 4LK1C 3Q6SA 3WOFA 1EYCA 3P7JA 2F1MA 1CFMA 4IFDH 1STHA 3KBXA 1PRTF 3MXNA 1DCZA 3TP8A 4M8AA 3D6WA 4ZUIA 1DXMA 3H6MA 3GTQB 3S9WA 4K5VA 3GTGB 2L5TA 1D2BA 1SJHD 4BBRB 2LS01 2D9UA 1KTKA 4FXDA 5D3IB 5ELFA 3NUCA 3RMHA 4R8IA 2BA0A 4U673 3LNNA 3M7GA 2VB3X 4F7XA 4CJ2C 1EY8A 2XNAC 5EGTA 3VYTA 3WOEA 1WTVA 3OHXC 1R9TB 4OHJA 3BYTB 3J80E 2Z4HA 5C0XG 1HTLD 1OXVA 3MXPA 5JEAH 3QO2A 1SMYD 1BCPB 4RKLA 5JEAJ 5A2QE 1BQQT 3SVMA 3DWAA 4C3IB 5C4XB 3ND8A 2KVMA 2GA4B 1LTTD 4QB4A 4ZYSA 5M5YB 4OIKA 4K14A 2A74C 3FPPA 2SNMA 1WVLA 2B2YC 4NDXA 4BA1I 5T1GA 4CKBA 1TU2B 1V1OA 5M3FB 1H9RA 1YNND 2HUGA 1LLRD 3KLRA 3GTMB 4KD3A 1XTCD 4CHTB 1GJXA 3V2TA 2F0IA 1L0YB 2L0CA 3K5MA 4PMBA 3VR4A 4A3IB 3J7AV 2KUMA 3ERQA 2ID0A 4CKCA 1JR0D 2F4IA 4LAAA 1E2ZA 1LT5D 4ABNA 3T53B 3MVVA 2WINB 4FF1A 3VR2A 1EU4A 4WORA 1PTOC 5CBAE 1A6XA 2K03A 2NN6H 2F0GA 2B2UA 4FP5D 5IGEA 4A3FB 5IGBA 2JP1A 2NZ1D 1CHPD 3DM1A 3F2UA 4OGQC 2NTTA 1BR9A 3SR1A 2DY8A 1PFMA 1S5DD 1LTBD 1CA5A 3MXGA 4TSSA 2B2VA 5EBDA 1H9MA 2KA7A 5C3EB 3JAME 5IGCA 2JEAI 2NB0A 2K5QA 1E2WA 3CRLC 1BUVT 4C3HB 3GD7A 2EYLA 4ODGA 1STEA 1PRTB 3FEWX 1I4QA 1SE4A 2K1BA 1D5ZC 1W6JA 3SE0A 4N9PA 3MEHA 1ENFA 3Q22A 3WDNA 3S1QB 1EY7A 3L9AX 2VB2X 2JXMB 1TY0A 2C5CA 2R3ZA 4KKUA 2F03A 3A55A 2PPBC 1A2UA 5D3DA 3X3MA 1SNMA 4FXKC 1D5MC 3FKIB 2NUCA 2PZUA 3I4LA 3KK7A 2CW0C 3CHBD 1ZXTA 1H9SA 3IAYA 1TR5A 1G6ZA 3K57A 1BOSA 1F9RA 4N9TA 3MFYA 5DAUA 4RGOS 1JOOA 1HFNA 1EQVA 1I6VC 4ID6A 2VXWA 1TVXA 5FO7B 3PIP3 1V43A 3U9SA 3IFTA 3K58A 1WTOA 4C56C 3QJYA 4J1MA 3N52A 2R7ZB 3PMFA 3BG3A 2AQ2B 5G3LD 4BY7B 4DA2A 5M5XB 5D14A 2XIWA 3QWNA 1HA6A 3R3OA 3NTKA 5KEEA 2HDMA 3HKZB 1JB3A 5K36G 1O7ZA 4HMJA 1IW7C 1ENCA 2M2LA 3K0YA 4CBVA 5D65A 2DNCA 4DF7A 5IGGA 3I4NB 1Q8IA 5EKLA 1U4RA 4WJWA 3LX0A 1KDAA 2A5HA 4RWSC 5EPJA 1SMYC 2F0JA 3SHLA 1DD2A 2KJXA 5CV5A 3R2IA 4C1NK 1KABA 1PYWD 5K5PA 2TMPA 4KJNA 3CRKC 2RDFA 1RDPD 1MBYA 2QILA 1HA5A 3NBIA 2EJFC 5KRUA 3O13A 5DEHA 3VYRA 1PDQA 1TKWB 5LHY1 1TIID 4RA8A 4B9WA 1U4LA 3OMGA 2ZXPA 3EA6A 1EYDA 4PNYA 1X3PA 1A2TA 4IUQA 1SSOA 1B2TA 5CC4A 3S2DB 2N88A 3HOWB 3S17B 1MI2A 3HRZC 1KAAA 1HUMA 4Q0FA 3BVZA 1K83B 3NXWA 1O78A 3J81L 1PZJD 5CMDA 3S2HB 1MGSA 3Q0AA 1STBA 1WTRA 4A3GB 3TZDA 1IKLA 2G9HD 4RCNA 5BN3A 2NBFA 3D31A 1CT1D 3A7AB 5C6AA 3SK6A 1G2TA 1RF2D 4I65A 1PTOD 1EL0A 1UAPA 3DHQA 4NP5A 4U68A 2A6HC 2MUYA 3IL8A 3H94A 3OW7A 1EY0A 3A7LA 4G7HC 1U4MA 3M85A 4C2MB 4HAEA 5E1FA 2OXPA 1EEID 4I7ZC 1F9SA 1AEXA 1JC7A 1SAPA 1QE6A 4CJ0B 2O4XA 3FMCA 3S1MB 1IYUA 1QOHA 5BN5A 2EYJA 1Q12A 1AZPA 4OO1I 1LTID 5JJZA 2D5DA 3T56B 2IL8A 2NVYB 5J1ZA 1Y8NB 3SK8A 4K6DA 1B4OA 2JA5B 4XTCS 1G8ZD 2B8FA 3H91A 2WP8J 2IT1A 3TDQA 4QUFA 3I8ZA 3FDTA 2EZVA 2HCCA 3HOXB 5FO8B 5TSSA 3L7ZC 5IIFA 4RGNA 3GTLB 1CK1A 1O7YA 5CV7A 4K6LA 3MFGA 1DM0B 2BDNA 1F9QA 1OXUA 1I6HB 3BVGA 3UI2A 5E3FA 1QWYA 2EY6A 1KNAA 1Q3LA 2QEJC 4XT3B 3OWEB 1FNVA 2F0NA 1ICWA 4ZKCB 1H9KA 5BN4A 1SYEA 3BDLA 2NVTB 1SJED 1KLUD 2PO4A 1BXTA 3DWPA 1JORA 1GUNA 4NW2A 4V0BA 2CW0D 1NSNS 2B2UC 1V8QA 2K28A 1JOQA 1D5XC 2WAQB 2M00A 4K5XA 2AQ3B 1CA6A 1OXXK 3RZOB 2XN9C 3BDCA 2FINB 1TY2A 4TQUS 1OO9B 2LY7A 3W2DA 5T1IA 1LTGD 2CHBD 2PYKA 1BCPC 2B2VC 1VDZA 3TSSA 4IFDI 1O80A 4FO2A 4OO1G 3D4DA 3PUWA 3NP8A 1PZKD 2CQAA 2F0HA 2BA1A 3SK5A 3EVQA 2KEDA 3ZYYX 2MHVA 1M4VA 1EY4A 4DK1A 1UEAB 3TN2A 4KY5A 2ICIA 2L12A 1DOLA 3QB3A 1RODA 1S5BD 1IW7D 1LO5D 1SNOA 1Q90A 2MPMA 3C1EA 1OXTA 1RHPA 4FF4A 5JPMC 1LTSD 2Z4IA 4KD4A 2LMCB 3RD4A 3C46A 3D6CA 4Q5VA 1D1KA 1M8AA 2AUJD 4C3IG 1B1ZA 5ELCA 1Z47A 2OEOA 2J4XA 1C4QA 3X3NA 3KUPA 2Z8LA 4RHRA 2E2HB 4QMGA 4IZ8A 1CZGA 1Q1BA 5M5WB 1B44D 2R92B 5FO9B 3I91A 4CJ1B 1WD0A 1LT4D 3P75A 1RCVD 3PUVA 1SNDA 2A69C 5C3XA 2EYFA 5M9OA 1PZID 1EWHA 2VNUD 1EEFD 4BA2I 1HTPA 2PW5A 4BY1B 3NQTA 5I6YA 1EIGA 4IFDG 3QIAA 2NVXB 3HEJA 3R8BA 1LT3D 1WTXA 2K5WA 1ET6A 2RDGA 2X69A 1TS3A 2F0FA 2WKCA 1SE3A 4A3DB 1S4ZA 1Y1WB 5DM63 5COYA 3D4WA 5J22A 1JWUD 1VMPA 2EOTA 4HMIA 3LWUA 3I3CA 2AWNA 4C3JB 3FPUB 4QIWB 3GV6A 2A6HD 2NN6I 1X32A 1QJOA 3RZDB 3M4OB 2WV6D 1SYDA 2FFKB 1FD7D 1GHJA 3KF8A 1TWHB 4XQJA 5CV6A 3CU7A 4FNFA 1ML0D 1I50B 1HPCA 5IGDA 2KCCA 4WRDA 1R4QB 1PXUA 2IWHA 4KKTA 5F2DA 1ENAA 1TWCB 1EOTA 1SE2A 4ZKBB 3MHBA 5CYUA 1EFID 3NTIA 5KYIA 4KJOA 1A3TA 2MJ8A 4G7ZC 2FJ2A 2NWGA 4XYOA 3TZUA 2H1EA 1TS5A 1SNPA 4CKEA 3BDOA 5FOBB 2OT2A 4F8MA 2SDFA 2WIIB 1AP0A 4K8JA 4RHSA 1A15A 1HRJA 3MA2B 1QILA 4E6IA 4EVOA 4YIJA 1FGBD 1NR4A 1GHKA 4BS9A 4Y7NB 1DJRD 4KV6A 1EY6A 1WTQA 1ZKOA 4FXGC 5ELBA 2PZWA 3E6ZX 1ILPA 2F0SA 2D2CC 2F0UA 2KCNA 3ND9A 1JICA 1LABA 1TWAB 2XWJB 1B53A 2ZXOA 4IN3A 2JA6B 1VMCA 2NN6G 2IX3A 4G7OC 1RKNA 3V05A 1F2ZA 3HOYB 3T51B 1GXDC 5DNFA 3NWSA 4A3EB 3PUXA 4X3TA 3SK4A 4A93B 1NCVA 2IW3A 4UDUC 2QCPX 1XXGA 4RFBA 1O7LA 4HCEA 1SYCA 3A8KE 2XRQD 1BCPD 2R6GA 1Z7TA 3S15B 1F77A 3DXJC 3QOJA 2EY5A 5FLXL 3EQLC 5I4DA 2AQ1B 3K5LA 3A56A 2M9VA 5EQ0A 1T5EA 3ITPA 4HEDA 1AN8A 4KKSA 3D3RA 4KI0A 1SNCA 5IOCA 1BF4A 3GTPB 2CVRA 4ZQ3A 2PZTA 1F2LA 1I4XA 1RTOA 3TBIB 3L3OC 2B8GA 1U9RA 2A73B 3AB9A 4EQPA 5C3WA 2F0PA 2OF1A 3NWTA 1HXYD 3EROA 5KNCA 2B2TA 2JYOA 2XSCA 3SEBA 4FF3A 4Z9CB 1CQVA 2L9HA 2WACA 3OMCA 1GUGA 4HCSA 2FMMA 1G2SA 1NAPA 3U9OA 4A3BB 3G6JB 4R8NA 3PO2B 1BDOA 3J7YW 3T16A 4G57A 1FNWA 3GTOB 4DN4M 1Y8PB 3DEPA 3P20A 5J39A 2L11A 1ESFA 2BE5C 2YYZA 5ELEA 3NPPA 2XVSA 1WD1A 2K05A 4KHVA 5JVG3 1WTPA 4JBWA 3HOZB 2A69D 1STYA 4FF2A 2XWBB 4DNRB 3G7LA 1AFPA 2WKDA 2SNSA 5E4XA 2EJGC 5NUCA 3E5SA 3DUZA 4ZK9B 3VR6A 2I07B 4QUCA 5IT9L 4KMUC 1K8OA 3MXUA 4ZAIA 3M3YB 1SDFA 5HGTA 3NK9A 1B9NA 1SYBA 4QF4A 1LT6D 4RAUC 1V1PB 1PRTD 2K6AA 5IGFA 1EYAA 5KYLA 5KNDA 5G3LF 3KLSA 2PMZB 4TRDA 2DNEA 2PCFB 1EZ8A 3FRPB 2QKIC 1I4GA 3Q23A 2A68C 1Y8OB 1YNJC 4K2LA 3K5NA 1Q1EA 4P2CB 2B2WA 4K8IA 1TT2A 1ET9A 1PFBA 2EJMA 1AW7A 4ZUJA 3I73A 4DAPA 1DZ1A 2J7ZA 4PQXA 2F0TA 2E2JB 1FR3A 1SNQA 2NYZD 1HUNA 1MSGA 4L6TB 4AYBB 1KLGD 4R9WA 3HOUB 4C1NI 1FNUA 1I4RA 4DK0A 2JA8B 1Z6HA 4PMCA 3M4YA 1EU3A 3J7AF 4OL7A 2E2IB 4XT1B 3CQZB 1JCKB 2F3VA 3EJIA 1I4HA 2N55A 2QF7A 1TWGB 4A3JB 2EPBA 3J80L 3NQIA 5C4HA 1ONLA 2PW7A 4IUVA 4J6HA 3QG1A 4HSPA 4IQZA 4XXEA 5C0XH 1J8IA 3PO3B 4K2KA 4IUTA 4HR7B 2FHTA 5C0XJ 2C9OA 5KNBA 5A2QL 1STNA 3VR3A 2KHSA 3MZ5A 3J81E 5FK9C 2F0KA 2X6LA 3NE5B 4XDXA 1DOKA 2Z1CA 2F0EA 2QDBA 5ELDA 4XQNA 1CTMA 3K7AB 5ISRA 1F9PA 3GV3A 4ZLTF 1GUOA 2IJ0A 2NVQB 4KY7A 1BO0A 2JSOA 1PTOF 1G91A 2RA4A 5LL6X 4IFDJ 2K7VA 2JEBI 2PNRC 1EQTA 3MWYW 1E0BA 5I2XA 2LKVA 2MGSA 3KBGA 2HCIA 3HS0C 2Q8IB 5C5MA 2F3WA 1NUCA 1EY9A 1QCBD 4A3MB 3NTHA 1QNKA 1VF7A 3AU7A 2RQXA 4L8JA 3N6RA 1A3UA 1ZEQX 2E74C 3V96A 3GP7A 3P1HA 3EFXD 4DFAA 1L0XB 1HQMC 3IKJA 2F0MA 3DMUA 1KDBA 3JAML 2F0VA 5C44B 1TQOA 5EKIA 3D8GA 3TP5A 3I90A 4OIJA 4RH6A 1CHQD 4B9XA 1A3VA 1SXTA 1K8MA 1PTOH 2LFNA 2B39A 3S16B 4KTAA 2RVLA 4O1NA 2BE5D 4M1UB 3QOLA 3NSWA 1GUTA 1IHZA 5EPLA 3VA5A 1CZWA 5KGUA 5I6WA 2D62A 4KN4C 1AZQA 4DNTB 5EJWA 1LTRD 5C4ZA 4DU9A 1U4PA 1JWSD 3H3VC 4HSVA 4FVMA 2SOBA 3RLFA 4XQQA 2JA7B 4J8QA 4C3JG 2E2DC 3ONAB 1XYIA 1GUSA 1PRTC 4ME5A 3H0GB 4GZYC 1QNUA 1XX8A 5KIXA 2X6GA 2AWOA 1JE4A 1MD2D 4A3KB 3RUZA 3AMUA 2KOLA 3C1FA 1H9SB 1HFGA 2K01A 4TKOB 1KNEA 4B08A 5AFWA 3MAQA 3VR5A 5CR3A 4L63B 1MSHA 4IUNA 4BWGB 2RKSA 5JVH3 3MTSA 4H0LC 2B2TC 3TMEA 5JEAG 2A6ED 4JK1C 2EY2A 2A68D 2EXZA 1YNJD 3K6OA 2DY7A 4C3HG 3BYYB 3C3LA 1STAA 1X3QA 1Y1VB 5C4JB 1S5FD 4NMZA 1HQRD 5LL6S 4X3KA 2KQ3A 5CV4A 4XIGS 4QCLA 4DAYA 3PUYA 1EWCA 3OIQA 2EYOA 4DXGA 5K36H 2E76C 2J0TD 1PTOB 1ZYRD 1RJTA 2F0QA 2EE1A 3I70A 2BOSA 3FVQA 3R93A 2FMCA 3SXHA 4PMWA 1TS4A 2G9DA 1VCIA 1S5ED 1UUPA 4G4KA 2IX1A 4MN3A 3VA7A 1TS2A 2O2LD 3BVMA 1R4PB 3TP7A 2HDLA 2RDHA 5DM73 2V4DA 5I2YA 3C2PA 3DEOA 3NBHA 1CQFA 2SEBD 2JE6I 4ZRZA 1Y69U 4KHZA 2KECA 3T13A 1H9JA 3R2TA 3Q24A 1HCZA 5EPKA 3TP6A 1UNSA 2K5DA 1OXSC 2H4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XWJ B;  3G6J B;  2XWB B;  5JPN C;  1JB3 A;  1PXU A;  2B39 A;  3OHX C;  4FXK C;  2ICE C;  2TMP A;  3FRP B;  3T4A C;  1OO9 B;  1BR9 A;  2QKI C;  4ILW A;  2WIN B;  1UAP A;  3HRZ C;  5JPM C;  1JC7 A;  5FOB B;  1UEA B;  2I07 B;  1GXD C;  4FXG C;  5FO7 B;  2WII B;  3V96 A;  3CKI B;  1BUV T;  3HS0 C;  2E2D C;  2J0T D;  2A74 C;  3L3O C;  5FO9 B;  3CU7 A;  3MA2 B;  2A73 B;  5FO8 B;  1D2B A;  1XWE A;  3I70 A;  3KLS A;  1BQQ T; 
#chains in the Genus database with same CATH topology
 4IUP A;  3TRZ A;  1X3E A;  3W5O A;  2B2Y A;  4HIM A;  2E75 C;  2KHJ A;  3OPO A;  1IBK Q;  1XNR Q;  5I9O A;  1DOM A;  1S3O A;  1WTW A;  1D1I A;  1SYF A;  1SYG A;  4EGV A;  2Q8R E;  2Q8T A;  4O42 A;  2B2W C;  4F87 A;  2K5H A;  1LTA D;  4LJZ C;  1XTD A;  5EBC A;  4MIU A;  1II3 A;  4IPH A;  4CGY B;  2ASB A;  2F0O A;  3ERS X;  1V1Q A;  4P72 A;  1RD9 D;  3HKZ G;  3D4R A;  4HTH A;  4IAL A;  3VYS A;  2IPK D;  3PIO 3;  3OOC A;  1F2Y A;  3PF5 A;  4ULL A;  3HGB A;  4HN7 A;  2ICE C;  1JJC B;  4YWL A;  1HHV A;  3IRB A;  4B3S L;  4IJH A;  1D6E C;  1W6K A;  3VYU A;  2ENB A;  3GO5 A;  4B3R L;  1CI3 M;  2R61 A;  4DR4 Q;  1N33 L;  4DV5 Q;  1KDC A;  3I72 A;  1EFW A;  1H95 A;  5IOD A;  3LWE A;  4V19 0;  3A8J E;  4A3C H;  2EYH A;  4XYQ A;  3GTK B;  1J9O A;  5GRO A;  1STG A;  2ZT9 C;  1C9O A;  1EOV A;  4GN4 B;  3URY A;  4K5W A;  2R93 B;  4H44 C;  2MP1 A;  5IYB H;  3K5O A;  2HHH Q;  3T1H Q;  1WTH A;  2RSO A;  1CSP A;  1B3A A;  4RCO A;  3S1R B;  4X64 L;  5IP7 H;  2E2J H;  2NTS A;  4A3B G;  4FDB A;  3U4Z A;  1WCM B;  1A63 A;  3PO2 G;  3DWQ A;  2RBM A;  3PV0 A;  4JG2 A;  4A75 A;  4DUZ Q;  2Y0S E;  4YHH L;  1PFN A;  3KF6 B;  3HOV H;  3GTJ H;  1EQR A;  3D0F A;  2KEE A;  4X62 L;  1LYL A;  1SFO B;  2DJG C;  3BZD B;  3A8I E;  2HQL A;  4GOP C;  1PH4 A;  4EQ5 A;  3HOZ G;  2B63 H;  2I46 A;  1T5X D;  5EAY A;  1VQO A;  3RR5 A;  4IUR A;  3DM3 A;  4DAV A;  1VF5 C;  1KXL A;  2ZXR A;  4JVZ A;  2Q2T A;  4GKK L;  1JWM D;  3HOW G;  4UAI A;  4F88 A;  2EYP A;  4AQY Q;  1JJ2 A;  2FXQ A;  4KHP Q;  1U0L A;  4PV1 C;  2UUA L;  2PQE A;  1RTN A;  5M3M B;  2AUK A;  2YU9 B;  1DYQ A;  1YNN C;  5ELN A;  5I9P A;  4B3M Q;  2G5D A;  3GQB A;  1VQ8 A;  4WFN 3;  1OTC A;  2XRS D;  3M4Q A;  4A3G G;  3E0J A;  3RN2 A;  3SDZ A;  3M7N A;  4BBS H;  1SEB D;  4MHE A;  3OSO A;  4S3S A;  2WB1 E;  1NR2 A;  1IBK L;  1YZ6 A;  1VQ4 A;  4KK7 A;  1XMQ Q;  4IPG A;  5FLX E;  2Y0S B;  4DV7 Q;  3S1N H;  1YVC A;  4ILW A;  5L37 A;  1K0S A;  2IX0 A;  5CBE E;  1HNX Q;  3HP3 A;  3IFD A;  2CWP A;  4H13 C;  1S5C D;  4EQO A;  5CGK A;  2K5N A;  1G6P A;  4LMQ D;  4GLV B;  3J81 i;  3MC0 B;  4X3U A;  3S14 B;  5E4W C;  2HT1 A;  3I4M B;  4QGU A;  4JI1 Q;  2VW9 A;  1IL8 A;  2VUM H;  1BCP F;  3HG9 A;  1VQI A;  4JI2 L;  5FKA C;  4RKB A;  3KYH C;  1PMR A;  1SBB B;  1U5K A;  1XPO A;  3OWF A;  1E2V A;  4NKL A;  1B50 A;  1I4P A;  1LAC A;  2A6E C;  1SMX A;  2O5J C;  1FYC A;  2EDG A;  3TS2 A;  4YWM A;  1VQ7 A;  5JJL A;  1AE3 A;  3A54 A;  2UXB L;  5HY6 A;  3H09 A;  2K04 A;  2HQE A;  4LF5 Q;  3KJP A;  2BCO A;  1I3Q B;  3GTG H;  2F0D A;  1TWF B;  1HZB A;  1NTG A;  4HJ5 A;  2JA5 G;  2WB1 B;  2HHH L;  4OO1 H;  3OIP A;  4IUU A;  2F0W A;  4RGT A;  4AYB G;  3BS1 A;  1PH8 A;  4DV3 L;  1JQY D;  4KY6 A;  3PUZ A;  2TSS A;  3CKI B;  3HOX G;  3HOU G;  1C8C A;  4DXF A;  4DUZ L;  2JA8 G;  3HZX A;  3A5U A;  3HOV B;  1S40 A;  3GTJ B;  1EWI A;  3TRE A;  2IY5 B;  1EY5 A;  1Q81 C;  1B9M A;  5JPN C;  3NHH A;  1ZYR C;  2F0L A;  1IKM A;  1BBX C;  3KLS X;  3T4A C;  5GAG C;  2EYM A;  2KEN A;  4A3J G;  1R9T H;  2B63 B;  3K59 A;  1C48 A;  4R1J A;  3K8A A;  5A35 A;  1EIH A;  5HUR A;  2EVB A;  1EUJ A;  2O5I C;  3PO3 G;  4GN5 A;  5COR A;  1ESR A;  1XWE A;  5CV9 A;  1BNZ A;  1QB5 D;  2L55 A;  5CV8 A;  4AQY L;  4DGZ A;  2DN8 A;  4H7B A;  1F2M A;  1X65 A;  3FP9 A;  1JOK A;  3W3A A;  5EKK A;  5IT9 E;  4C3I H;  5C4X H;  2WAQ G;  4TVA B;  2YV5 A;  4P71 A;  2L1B A;  5C0X I;  4BBS B;  2AMC B;  1V1P A;  4RGM A;  1EZ6 A;  3J80 i;  4EQN A;  4JI7 L;  1LV9 A;  2K33 A;  3PF4 A;  3NEN A;  2UXC Q;  1QZG A;  5M5Y H;  2BDO A;  1GOZ A;  5C5L A;  1XMQ L;  4UP7 A;  3S1N B;  5JOB A;  2Z6B A;  4FYD A;  4ALP A;  1IYV A;  4DV7 L;  1YEZ A;  2K32 A;  5JAV A;  1X9N A;  1G29 1;  3CCS A;  4X3S A;  1BKB A;  2F3I A;  1DON A;  5M3F H;  1PLF A;  4KN7 C;  3AYH B;  1NNX A;  2EY1 A;  1ILQ A;  2L4N A;  1QG7 A;  2VUM B;  2RHQ B;  2RSN A;  4JI1 L;  3GTM H;  1CM9 A;  4LF8 L;  1GUW A;  4LK1 C;  3Q6S A;  2GVB A;  3WOF A;  1EYC A;  3P7J A;  2F1M A;  1CFM A;  4IFD H;  1STH A;  3KBX A;  3H0G H;  1E1T A;  5FJ8 H;  1PRT F;  2OTL A;  3MXN A;  4A3I H;  4DR1 L;  3JC6 6;  4L5R C;  1DCZ A;  3TP8 A;  4MZ9 A;  4L5T A;  4M8A A;  3D6W A;  4ZUI A;  1X55 A;  1J6Q A;  1PYB A;  1DXM A;  3H6M A;  3GTQ B;  4DR2 Q;  1HNZ Q;  3S9W A;  1HR0 Q;  4K5V A;  3GTG B;  2L5T A;  2HIV A;  1D2B A;  1SJH D;  4BBR B;  2DJF C;  5FLX c;  2LS0 1;  2D9U A;  1KTK A;  4FXD A;  5D3I B;  5ELF A;  3NUC A;  3U50 C;  3RMH A;  4R8I A;  2BA0 A;  1MIU A;  1WFQ A;  4U67 3;  3CCE A;  4A3F H;  3BZK A;  3B6Y A;  3LNN A;  4DV0 Q;  4JI0 Q;  3M7G A;  1VQA A;  1M90 C;  2VB3 X;  1J5E L;  2CQO A;  5AJ3 Q;  1GO3 E;  4F7X A;  4ZCK A;  4CJ2 C;  1EY8 A;  1TXY A;  2XNA C;  5EGT A;  3VYT A;  4B3T L;  3WOE A;  1WTV A;  2VQF L;  3OHX C;  1R9T B;  2PI2 A;  4X66 Q;  4OHJ A;  1PH7 A;  4JI5 L;  5C44 G;  3BYT B;  3J80 E;  4I7A A;  2Z4H A;  2F52 A;  5C3E H;  5C0X G;  1HTL D;  1OXV A;  2Q2I A;  3MXP A;  2R92 G;  5JEA H;  3QO2 A;  1FVI A;  2PQA A;  1SMY D;  1BCP B;  4RKL A;  5JEA J;  5A2Q E;  1QUQ A;  3KDF B;  1NJI C;  1SN8 A;  1BQQ T;  3SVM A;  3DWA A;  4C3I B;  5C4X B;  4IJL A;  3ND8 A;  2KVM A;  2GA4 B;  1LTT D;  4QB4 A;  4ZYS A;  3JAM i;  4J15 A;  2QA4 A;  2Q2U A;  4DK6 C;  5M5Y B;  4OIK A;  3F2B A;  4K14 A;  2A74 C;  3TQY A;  3FPP A;  2SNM A;  1X3F A;  1WVL A;  2B2Y C;  4NDX A;  4BA1 I;  2K5V A;  5T1G A;  4CKB A;  1L1O B;  1TU2 B;  1V1O A;  5M3F B;  4A3D G;  1H9R A;  1YNN D;  2JA7 G;  2HUG A;  1LLR D;  3KLR A;  3G48 A;  4DNI A;  4KD3 A;  4IO9 A;  3GTM B;  2K4K A;  5FLM G;  1XTC D;  4CHT B;  3FKI H;  1K8A C;  1GJX A;  3V2T A;  2F0I A;  1L0Y B;  2L0C A;  3K5M A;  4PMB A;  3VR4 A;  4A3I B;  3J7A V;  2KUM A;  3ERQ A;  4NPS A;  4A3K G;  2ID0 A;  4CKC A;  1JR0 D;  2F4I A;  4LAA A;  1SRO A;  3J81 c;  1E2Z A;  1LT5 D;  4ABN A;  3T53 B;  3MVV A;  2WIN B;  1CKM A;  1M1K C;  4FF1 A;  3VR2 A;  4DR2 L;  1EU4 A;  4WOR A;  1PTO C;  5CBA E;  1A6X A;  2Z6K A;  2K03 A;  2NN6 H;  2F0G A;  2B2U A;  4P75 A;  4FP5 D;  2A8V A;  5IGE A;  4JOI A;  1VQ6 A;  4A3F B;  4GLX A;  5IGB A;  2JP1 A;  2NZ1 D;  1RIP A;  3ULP A;  4JBK A;  1CHP D;  3DM1 A;  3F2U A;  4JBM A;  4OGQ C;  2NTT A;  1BR9 A;  3SR1 A;  3UDX A;  2DY8 A;  1PFM A;  4BXX G;  1S5D D;  1PH9 A;  2PNH A;  1LTB D;  4BY7 H;  1Y1V G;  4GLA C;  4X65 Q;  1CA5 A;  4B3S Q;  2CFM A;  3MXG A;  5M5X H;  4TSS A;  1KL9 A;  5GAE C;  4B3R Q;  2B2V A;  5JJK A;  1N33 Q;  5EBD A;  1H9M A;  2KA7 A;  5C3E B;  2UU9 L;  3JAM E;  4LFB Q;  3DLL A;  1UE1 A;  1PV4 A;  3PIP A;  5IGC A;  2ZM6 Q;  2JEA I;  1MJC A;  2VQE Q;  2NB0 A;  2BH2 A;  2K5Q A;  3I2Z A;  1E2W A;  4A76 A;  1HZ9 A;  3CRL C;  1BUV T;  4C3H B;  2K14 A;  2EYL A;  3GD7 A;  4ODG A;  4POF A;  1STE A;  4K0K Q;  1MJE A;  1G51 A;  1PRT B;  3FEW X;  3I4N H;  1I4Q A;  1SE4 A;  2P5Z X;  2K1B A;  2C35 B;  1D5Z C;  1W6J A;  3SE0 A;  4JI4 L;  1UWV A;  3MEH A;  4N9P A;  4IOA A;  1ENF A;  1NMG A;  1HNW Q;  4X62 Q;  3Q22 A;  3WDN A;  3S1Q B;  1EY7 A;  3L9A X;  2VB2 X;  2JXM B;  1TY0 A;  2C5C A;  2R3Z A;  4LF6 L;  4KKU A;  2JA6 G;  2F03 A;  3J80 c;  5LMN L;  3A55 A;  2PPB C;  1A2U A;  5IYD G;  5D3D A;  3X3M A;  1SNM A;  4LF7 Q;  4FXK C;  1D5M C;  3FKI B;  2E5L Q;  2NUC A;  4GKK Q;  2PZU A;  4A3E G;  2XGT A;  3I4L A;  3KK7 A;  3L0O A;  2CW0 C;  3CHB D;  1ZXT A;  2LSS A;  1H9S A;  3HKZ E;  3IAY A;  5ELO A;  3CCM A;  3CC2 A;  1TR5 A;  4DV6 Q;  1NE3 A;  1G6Z A;  3K57 A;  1BOS A;  1KRT A;  1F9R A;  4N9T A;  3MFY A;  5IP9 G;  4O2D A;  5DAU A;  4RGO S;  1JOO A;  4DK3 C;  1HFN A;  1EQV A;  1I6V C;  4ID6 A;  2VXW A;  1TVX A;  2K75 A;  3S2D H;  5FO7 B;  3PIP 3;  1IBL Q;  1V43 A;  3S17 H;  1N32 L;  3U9S A;  3IFT A;  3K58 A;  1WTO A;  4C56 C;  2QEX A;  4UPA A;  1BBU A;  1K83 H;  4CDF C;  3QJY A;  4J1M A;  3N52 A;  4HIO A;  2R7Z B;  3S2H H;  3PMF A;  3BG3 A;  3NEM A;  3S14 H;  2AQ2 B;  5G3L D;  3CME A;  1X6O A;  3I4M H;  4DA2 A;  4BY7 B;  4JI2 Q;  4X65 L;  5D14 A;  5M5X B;  3RLO A;  3UDG A;  4HJA A;  2XIW A;  1WOC A;  3QWN A;  1HA6 A;  1N36 L;  1KAW A;  3R3O A;  3AEV A;  2KCM A;  1VQ9 A;  3NTK A;  4LFB L;  5KEE A;  2ZM6 L;  3T1Y L;  1HZC A;  2HDM A;  3HKZ B;  2NZO A;  2VQE L;  2UXB Q;  1JB3 A;  5K36 G;  4EX5 A;  1O7Z A;  4HMJ A;  1IW7 C;  1SR3 A;  1O7I A;  2YTY A;  1XNQ L;  4JV5 Q;  1ENC A;  4C2M H;  1PA6 A;  2M2L A;  3K0Y A;  4CBV A;  1I3Q H;  5D65 A;  1TWF H;  2DNC A;  4DF7 A;  5IGG A;  1WCM G;  3I4N B;  4K0K L;  1Q8I A;  4LUZ A;  4DV3 Q;  5EKL A;  1U4R A;  4WJW A;  3LX0 A;  1KDA A;  2A5H A;  4RWS C;  5EPJ A;  1SMY C;  2F0J A;  3SHL A;  1DD2 A;  2KJX A;  2ZTE A;  5CV5 A;  3R2I A;  4C1N K;  1KAB A;  3KJO A;  2JN4 A;  1PYW D;  5K5P A;  2TMP A;  1Q82 C;  1HNW L;  4KJN A;  3CRK C;  2CKZ B;  1N34 Q;  2RDF A;  1RDP D;  4A3L G;  1MBY A;  2NVY H;  4HIK A;  2QIL A;  1HA5 A;  2UXD L;  2JA5 H;  3JAM c;  2KBN A;  3NBI A;  1Y14 B;  3VDY A;  4LF7 L;  4X6A H;  4MTN A;  2EJF C;  2E5L L;  5KRU A;  3HOX H;  4R4T A;  3O13 A;  5DEH A;  3VYR A;  1VQG A;  1PDQ A;  1TKW B;  3UE1 A;  5LHY 1;  1PYS B;  1TII D;  4RA8 A;  4B9W A;  1RL2 A;  1U4L A;  3OMG A;  2ZXP A;  2ALY B;  1I6H H;  1IXR A;  3EA6 A;  1EYD A;  3ZJY C;  1X56 A;  4PNY A;  4DV6 L;  4JI7 Q;  1X3P A;  1A2T A;  4IUQ A;  1SSO A;  1B2T A;  5H1S E;  3OTO L;  2UUB L;  5CC4 A;  3PGZ A;  3S2D B;  2OQ0 A;  4DV1 L;  4HJ8 A;  4R4C A;  2N88 A;  3HOW B;  3S17 B;  1MI2 A;  2WFW A;  3HRZ C;  1K8G A;  1IBL L;  5GAD C;  3CW2 C;  1D7Q A;  1KAA A;  3UDF A;  1HUM A;  4Q0F A;  3BVZ A;  1K83 B;  3AQQ A;  3NXW A;  1O78 A;  1LUZ A;  3J81 L;  1PZJ D;  3W1G A;  5CMD A;  1EYG A;  3S2H B;  4QL5 A;  1MGS A;  3Q0A A;  1STB A;  1WTR A;  4A3G B;  3TZD A;  3BZC A;  1IKL A;  1PH3 A;  3FHW A;  2G9H D;  4RCN A;  5BN3 A;  4LF8 Q;  2NBF A;  3RZO H;  3D31 A;  1CT1 D;  2QGQ A;  3A7A B;  5C6A A;  3SK6 A;  1G2T A;  1RF2 D;  4I65 A;  4A3C G;  1PTO D;  1EL0 A;  1UAP A;  4AYB E;  3DHQ A;  4NP5 A;  2QW7 A;  4DR1 Q;  4U68 A;  2A6H C;  3EIV A;  2MUY A;  4GOP B;  2JJQ A;  3IL8 A;  3H94 A;  3OW7 A;  1EY0 A;  4JI3 L;  3A7L A;  4G7H C;  1U4M A;  3M85 A;  1XMO L;  3GTQ H;  2WB1 G;  3CP0 A;  4C2M B;  3OW2 A;  4HAE A;  4JV5 L;  2QDL A;  4OEM B;  5E1F A;  5IP7 G;  4BBR H;  3KF6 A;  2OXP A;  1EEI D;  4CDE C;  1E1O A;  4H02 A;  4I7Z C;  1F9S A;  1AEX A;  1JC7 A;  1SAP A;  1QE6 A;  4CJ0 B;  2O4X A;  3FMC A;  3S1M B;  3CXC A;  1IYU A;  4A4I A;  1QOH A;  5BN5 A;  1ICF B;  2EYJ A;  1Q12 A;  1AZP A;  1Q86 C;  1J5E Q;  3PCO B;  4OO1 I;  4IPC A;  1LTI D;  1B70 B;  5JJZ A;  2F4V Q;  4B3T Q;  2D5D A;  3T56 B;  2B63 G;  1WYD A;  2VQF Q;  4JPB W;  1A0I A;  5LMU Q;  2IL8 A;  2NVY B;  4R4Q A;  5J1Z A;  1N34 L;  1Y8N B;  3SK8 A;  4K6D A;  2WAQ E;  1B4O A;  2JA5 B;  4JI5 Q;  4XTC S;  1G8Z D;  2B8F A;  1K0R A;  4R4O A;  2IHF A;  2MFI A;  2WP8 J;  2IT1 A;  3BU2 A;  3H91 A;  3TDQ A;  4QUF A;  3I8Z A;  3FDT A;  2MNA A;  1BBW A;  2EZV A;  3HKS A;  1FL0 A;  2HCC A;  3HOX B;  5FO8 B;  1YNX A;  1IYJ B;  1EIF A;  5TSS A;  3L7Z C;  5IIF A;  4RGN A;  3GTL B;  1CK1 A;  1O7Y A;  4AH6 A;  5CV7 A;  4K6L A;  3MFG A;  1VQK A;  1DM0 B;  2BDN A;  4QJF A;  1F9Q A;  1OXU A;  4BBS G;  4DPG A;  4HJ9 A;  1I6H B;  1I94 Q;  1SLJ A;  3BVG A;  1YHA A;  5E3F A;  1L0W A;  1QWY A;  3UI2 A;  2EY6 A;  1KNA A;  1Q3L A;  2QEJ C;  4XT3 B;  2E2H H;  3OWE B;  1C7Y A;  1FNV A;  2F0N A;  1ICW A;  4ZKC B;  4DUY Q;  1H9K A;  5BN4 A;  1SYE A;  3BDL A;  5IYC H;  1SJE D;  5M5W H;  2NVT B;  5J3B A;  1KLU D;  4UY8 C;  2R92 H;  4LUO A;  3CC4 A;  1JJG A;  2PO4 A;  3I4O A;  1BXT A;  3DWP A;  1JOR A;  1GUN A;  2Z6K C;  4NW2 A;  4V0B A;  2CW0 D;  4LF4 L;  1NSN S;  2B2U C;  1V8Q A;  1VQM A;  2K28 A;  1JOQ A;  1D5X C;  4JOI C;  2WAQ B;  2M00 A;  4K5X A;  2AQ3 B;  1CA6 A;  5BR8 Q;  4BY1 H;  1OXX K;  2KHI A;  3CCV A;  3RZO B;  4OWT B;  2XN9 C;  3BDC A;  2NVX H;  4CDC C;  1XPU A;  2FIN B;  1TY2 A;  4TQU S;  1JE5 A;  1OO9 B;  3Q8D A;  2LY7 A;  3W2D A;  5T1I A;  1LTG D;  2CHB D;  2PYK A;  1BCP C;  2B2V C;  1VDZ A;  4A3M G;  3TSS A;  4NXM L;  4IFD I;  1Y1W H;  1O80 A;  4FO2 A;  4OO1 G;  3D4D A;  3PUW A;  3NP8 A;  1EIY B;  1UE5 A;  1PZK D;  2CQA A;  2F0H A;  2H5X A;  2BA1 A;  3SK5 A;  3EVQ A;  2KED A;  4C3J H;  3ZYY X;  1A62 A;  1N9W A;  2MHV A;  1M4V A;  1EY4 A;  4DK1 A;  1UEA B;  1P8L A;  3TN2 A;  4L5S A;  3RZD H;  4KY5 A;  2ICI A;  3M4O H;  2L12 A;  1K73 C;  2F4V L;  1L1O C;  1DOL A;  3QB3 A;  3CPW A;  1ROD A;  1S5B D;  1IW7 D;  1LO5 D;  1SNO A;  1Q90 A;  3UDI A;  5LMU L;  2MPM A;  3C1E A;  1OXT A;  1I50 H;  3ICE A;  2UU9 Q;  1RHP A;  4FF4 A;  3KF8 B;  5JPM C;  3L2P A;  1LTS D;  2Z4I A;  4KD4 A;  4LFC Q;  2LMC B;  3KLW A;  4YCU A;  3RD4 A;  3C46 A;  3D6C A;  1K9M C;  4Q5V A;  4LWC A;  1D1K A;  1TWC H;  2MO1 A;  1M8A A;  3H3V H;  2AUJ D;  3RN5 A;  4C3I G;  3CCJ A;  5C4X G;  1YJW A;  1B1Z A;  2BH8 A;  3I56 A;  5ELC A;  1Z47 A;  2B29 A;  2OEO A;  4C3H H;  3G6E A;  2J4X A;  1C4Q A;  2Z0S A;  3X3N A;  1I94 L;  3KUP A;  2Z8L A;  4RHR A;  2AKW B;  2E2H B;  2JQO A;  3STB C;  1YI2 A;  1EQQ A;  1IBM Q;  4JI4 Q;  1W3S A;  4DV4 Q;  4QMG A;  4DUY L;  4IZ8 A;  1CZG A;  1Q1B A;  1WJJ A;  5M5W B;  1B44 D;  2R92 B;  1LTL A;  5FO9 B;  3I91 A;  4CJ1 B;  1WD0 A;  1LT4 D;  3P75 A;  5M3F G;  1RCV D;  3PUV A;  2Q2H A;  3S1Q H;  1SND A;  2A69 C;  4QIW E;  2VZA A;  4LF6 Q;  1NY4 A;  2EYF A;  5C3X A;  5M9O A;  5LMN Q;  4DAY B;  1PZI D;  1EWH A;  1Q46 A;  2VNU D;  1EEF D;  4BA2 I;  1HTP A;  2PW5 A;  4BY1 B;  3NQT A;  4LW1 A;  3OYY A;  5I6Y A;  5DLQ E;  5BR8 L;  1EIG A;  2KCT A;  4IFD G;  3H0G G;  3QIA A;  5FJ8 G;  2NVX B;  4DR3 L;  4A3I G;  3HEJ A;  1HR0 W;  3R8B A;  1LT3 D;  1WTX A;  1VQJ A;  2K5W A;  5IWA L;  1ASZ A;  1ET6 A;  2RDG A;  2X69 A;  1TS3 A;  5IT9 c;  4MNO A;  2F0F A;  2WKC A;  1SE3 A;  1TWA H;  2K50 A;  4A3D B;  1S4Z A;  2R7D A;  1Y1W B;  2JA6 H;  1NBW A;  4APV A;  5DM6 3;  5COY A;  4LF9 L;  1AH9 A;  3D4W A;  5J22 A;  4A3F G;  1JWU D;  1VMP A;  3HOY H;  2EOT A;  4HMI A;  3LWU A;  3I3C A;  2AWN A;  2D0O A;  4C3J B;  1N32 Q;  4UHV A;  3NBH B;  1PH2 A;  3M9B A;  4A93 H;  5IE8 A;  3FPU B;  1C0A A;  3CCQ A;  1YIT A;  4QIW B;  3GV6 A;  2A6H D;  2NN6 I;  1X32 A;  1QJO A;  3RZD B;  2R7Z H;  2WV6 D;  3M4O B;  1SYD A;  2FFK B;  3ULL A;  1FD7 D;  1GHJ A;  3KF8 A;  1Z9F A;  4HJ7 A;  1K3B C;  1TWH B;  3S15 H;  4XQJ A;  4LUV A;  4YCW A;  5CV6 A;  3CU7 A;  5C3E G;  1AE2 A;  4FNF A;  2VL6 A;  1ML0 D;  1N36 Q;  1I50 B;  1HPC A;  5IGD A;  2CH4 W;  2KCC A;  4WRD A;  3KDF A;  1R4Q B;  1PH6 A;  1PXU A;  1W2B A;  2IWH A;  3T1Y Q;  4PZ6 A;  4JCV E;  4LFC L;  4KKT A;  5F2D A;  4JYA L;  1E24 A;  3G71 A;  1ENA A;  1TWC B;  4LNQ A;  1WI5 A;  1XNQ Q;  1EOT A;  1SE2 A;  4ZKB B;  3MHB A;  5JJI A;  5CYU A;  4JI8 Q;  1EFI D;  3NTI A;  5KYI A;  4KJO A;  3EBE A;  1A3T A;  3GTP H;  2ATW A;  2MJ8 A;  4G7Z C;  2FJ2 A;  2NWG A;  4XYO A;  3TZU A;  2H1E A;  1IBM L;  1YJ9 A;  1TS5 A;  1SNP A;  4CKE A;  3J7A 5;  1L1O A;  4DV4 L;  4DAM A;  2OTJ A;  4GS3 A;  3BDO A;  4OON A;  2K52 A;  5FOB B;  1X54 A;  1VQH A;  2OT2 A;  3WWV A;  4F8M A;  4DKA C;  2SDF A;  2WII B;  1AP0 A;  1E3P A;  1UE7 A;  4K8J A;  4RHS A;  1A15 A;  1HRJ A;  5HGQ A;  3MA2 B;  1QIL A;  4E6I A;  4EVO A;  3HFZ B;  1SRU A;  4WJ3 M;  2UXD Q;  4YIJ A;  1FGB D;  1NR4 A;  4GKJ L;  2ZJP A;  1GHK A;  1VQD A;  4BS9 A;  1PHJ A;  4Y7N B;  3I55 A;  4A3B H;  1LM0 A;  3PO2 H;  1DJR D;  1CKO A;  2N78 A;  1EY6 A;  2N8N A;  1ZKO A;  4KV6 A;  1WTQ A;  4FXG C;  5ELB A;  3KFU A;  2PZW A;  3E6Z X;  3W1B A;  1DGS A;  3GTO H;  1QVC A;  1OXS C;  1ILP A;  2F0S A;  2D2C C;  2F0U A;  2KCN A;  3ND9 A;  1JIC A;  1LAB A;  1TWA B;  2XWJ B;  4A3L H;  1B53 A;  3RNU A;  2ZXO A;  4IN3 A;  2JA6 B;  1VMC A;  2VY3 A;  3HOZ H;  2NN6 G;  3QR8 A;  1GKH A;  2IX3 A;  3F2D A;  3U4V A;  4G7O C;  1RKN A;  3V05 A;  3OTO Q;  2UUB Q;  1F2Z A;  2OWO A;  3HOY B;  2VS1 A;  1YBY A;  3T51 B;  1GXD C;  5DNF A;  4DV1 Q;  3NWS A;  4A3E B;  1B8A A;  3HOW H;  3PUX A;  4X3T A;  3SK4 A;  4A93 B;  1NCV A;  1QVG A;  2IW3 A;  4UDU C;  2QCP X;  1VQN A;  1XXG A;  4BY7 G;  4RFB A;  1O7L A;  4MTK A;  1FJG Q;  4HCE A;  1SYC A;  4A3G H;  3PSI A;  3A8K E;  2XRQ D;  1BCP D;  2R6G A;  1Z7T A;  3S15 B;  1F77 A;  3M3Y H;  3DXJ C;  1XJV A;  3QOJ A;  2EY5 A;  5FLX L;  3M4P A;  2B3G A;  3EQL C;  5I4D A;  2LXK A;  3F8T A;  2AQ1 B;  3K5L A;  3A56 A;  1UEB A;  2M9V A;  3E9H A;  5EQ0 A;  1T5E A;  4JI3 Q;  1HZA A;  3ITP A;  4L5Q A;  2R93 G;  4HED A;  1AN8 A;  4DR7 L;  1XMO Q;  4GNX B;  1VQE A;  4KKS A;  2N3S A;  3D3R A;  3I4N G;  4KI0 A;  1KC8 C;  4JI8 L;  1SNC A;  5IOC A;  4OX9 L;  1BF4 A;  3GTP B;  2CVR A;  4ZQ3 A;  2EXD A;  2PZT A;  1F2L A;  1I4X A;  1RTO A;  3TBI B;  3L3O C;  2B8G A;  4RMF A;  1U9R A;  2A73 B;  3AB9 A;  3MEF A;  4EQP A;  1YJN A;  5C3W A;  3S1M H;  2F0P A;  1KQS A;  2OF1 A;  3NWT A;  1HXY D;  3ERO A;  1K28 A;  5KNC A;  2LXJ A;  2B2T A;  1KIX A;  2JYO A;  2XSC A;  3SEB A;  4JI6 L;  3J7Z C;  4FF3 A;  4Z9C B;  3F2C A;  1CQV A;  2L9H A;  2WAC A;  3OMC A;  2ZTC A;  1B3Q A;  1GUG A;  4HCS A;  2FMM A;  1G2S A;  1NAP A;  3U9O A;  4PZ8 A;  4DR5 L;  4A3B B;  3G6J B;  4R8N A;  3STB D;  3PO2 B;  3HOU H;  5M3M G;  1BDO A;  3K81 C;  3J7Y W;  1N8R C;  3T16 A;  4G57 A;  2JA8 H;  1FNW A;  3GTO B;  3GTL H;  4DN4 M;  1Y8P B;  3DEP A;  2E2I H;  1I5F A;  3P20 A;  5J39 A;  2V1C C;  2L11 A;  1ESF A;  2BE5 C;  2N49 A;  2YYZ A;  4JBJ A;  3CQZ H;  5ELE A;  3NPP A;  2XVS A;  1WD1 A;  2K05 A;  2PMZ E;  4KHV A;  5JVG 3;  1WTP A;  4JBW A;  3HOZ B;  1TWG H;  4YWK A;  2A69 D;  4CDD C;  4A3J H;  3K80 C;  1STY A;  4FF2 A;  2XWB B;  4DNR B;  2Y0S G;  3CCU A;  3G7L A;  3I7F A;  1VS0 A;  1AFP A;  2A1A A;  2WKD A;  3CD6 A;  2SNS A;  5E4X A;  2EJG C;  3PO3 H;  5NUC A;  2NVT H;  3E5S A;  3DUZ A;  4ZK9 B;  3VR6 A;  1GVP A;  2I07 B;  3S24 A;  4LF4 Q;  4QUC A;  5IT9 L;  2GVA A;  4KMU C;  1K8O A;  1PH1 A;  3I4M G;  3MXU A;  4ZAI A;  5GQO A;  1FJG L;  2XTI A;  1XNR L;  3M3Y B;  1SDF A;  3CPF A;  5HGT A;  1Q8K A;  3NK9 A;  1B9N A;  1SYB A;  4QF4 A;  3BJU A;  4GNX A;  1LT6 D;  4RAU C;  1V1P B;  1P16 A;  1PRT D;  2K6A A;  5IGF A;  1EYA A;  1K3R A;  4Y52 H;  5KYL A;  1E7Z A;  5KND A;  3K7A H;  2MO0 A;  3J81 j;  3E9I A;  5G3L F;  5IYB G;  3KLS A;  4NXM Q;  1NMF A;  2PMZ B;  4TRD A;  2NVQ H;  1X3G A;  4N8X 1;  2DNE A;  2PCF B;  1EZ8 A;  3FRP B;  2QKI C;  1I4G A;  4DR4 L;  4UP9 A;  4DV5 L;  3Q23 A;  2A68 C;  2EIF A;  1Y8O B;  1YNJ C;  4K2L A;  3K5N A;  2PI2 E;  1CKN B;  1Q1E A;  4P2C B;  3HOV G;  2B2W A;  4K8I A;  1TT2 A;  2UUC Q;  1YHQ A;  1ET9 A;  1PFB A;  3A0J A;  4A3M H;  3MXN B;  2EJM A;  1AW7 A;  4ZUJ A;  3I73 A;  4DAP A;  1DZ1 A;  1A8V A;  2J7Z A;  3SGI A;  4PQX A;  2F0T A;  2E2J B;  1FR3 A;  3T1H L;  1SNQ A;  1D8L A;  2NYZ D;  4PZ7 A;  1HUN A;  1MSG A;  4L6T B;  4AYB B;  1KLG D;  4R9W A;  2CH4 A;  1JT8 A;  4PG3 A;  2RHS B;  3A74 A;  3HOU B;  3TEH B;  4C1N I;  1FNU A;  1I4R A;  4DK0 A;  2JA8 B;  1Z6H A;  4PMC A;  3K7U C;  3M4Y A;  1EU3 A;  3J7A F;  4OL7 A;  2E2I B;  4XT1 B;  1UE6 A;  3CQZ B;  1JB7 A;  1JCK B;  2F3V A;  3EJI A;  2A19 A;  1I4H A;  2N55 A;  4JW0 A;  2QF7 A;  2CWA A;  1GM5 A;  1TWG B;  4A3J B;  2EPB A;  3J80 L;  3NQI A;  5C4H A;  1ONL A;  2PW7 A;  4IUV A;  4J6H A;  4LFA Q;  5C44 H;  1L2F A;  2ZJQ A;  3QG1 A;  4HSP A;  4IQZ A;  4UP8 A;  2I5L X;  4N8F A;  4XXE A;  5C0X H;  1J8I A;  3K0X A;  3PO3 B;  4K2K A;  2OCE A;  4IUT A;  4HR7 B;  2FHT A;  5C0X J;  2C9O A;  4KHP L;  5KNB A;  5A2Q L;  1STN A;  4P74 A;  3VR3 A;  2I5M X;  4B3M L;  2KHS A;  2OQK A;  3MZ5 A;  3J81 E;  3AFQ A;  2VUM G;  5FK9 C;  2PQA B;  3S16 H;  3F1Z A;  2F0K A;  2GN5 A;  1QUQ B;  4GOP A;  2X6L A;  3NE5 B;  4DR3 Q;  2ES2 A;  2Z9H A;  4XDX A;  1DOK A;  2Z1C A;  2F0E A;  2QDB A;  5ELD A;  5IWA Q;  1HNX L;  4XQN A;  3EN2 A;  1CTM A;  1VQF A;  1E22 A;  3K7A B;  5ISR A;  1F9P A;  3GV3 A;  4ZLT F;  1GUO A;  4BBR G;  2IJ0 A;  4A3D H;  2NVQ B;  4KY7 A;  1BO0 A;  1CKN A;  1MHW C;  2JA7 H;  3CAM A;  4LF9 Q;  5FLM H;  2JSO A;  1VQP A;  2MQH A;  1PTO F;  1G91 A;  1HJP A;  1VQB A;  1HH2 P;  2RA4 A;  5LL6 X;  2I0Q A;  2IHE A;  4IFD J;  2K7V A;  2JEB I;  1VQC A;  2PNR C;  1EQT A;  3MWY W;  4HID A;  1E0B A;  5I2X A;  2LKV A;  1PFS A;  2MGS A;  3KBG A;  2HCI A;  4A3K H;  3HS0 C;  2Q8I B;  5C5M A;  2F3W A;  1NUC A;  2NZH A;  2UUC L;  1EY9 A;  1QCB D;  4A3M B;  4LF5 L;  3NTH A;  1KRS A;  4DR6 Q;  3CC7 A;  1TWH H;  1QNK A;  1VF7 A;  3AU7 A;  3CCR A;  2RQX A;  4L8J A;  3N6R A;  1A3U A;  1ZEQ X;  4WJ4 A;  1FGU A;  4IOC A;  2E74 C;  1IZ6 A;  4JYA Q;  4OEL B;  3V96 A;  3GP7 A;  3P1H A;  3EFX D;  4DFA A;  1L0X B;  1HQM C;  3IKJ A;  2F0M A;  3DMU A;  1T9H A;  4BXX H;  1V9P A;  1PH5 A;  1KDB A;  3H15 A;  1Y1V H;  5IY0 A;  5C4J H;  2HD3 A;  4YY3 Q;  3H3V I;  3AFP A;  3U58 A;  5IYC G;  3JAM L;  2F0V A;  2CCZ A;  5C44 B;  1TQO A;  2JA9 A;  4LFA L;  5EKI A;  3D8G A;  3TS0 A;  3TP5 A;  3I90 A;  4OIJ A;  4RH6 A;  2AHO B;  1CHQ D;  4B9X A;  2E8G A;  1A3V A;  1SXT A;  1K8M A;  1PTO H;  1GD7 A;  2LFN A;  2B39 A;  3S16 B;  4BY1 G;  2I5H A;  1CSQ A;  4GKJ Q;  2R7F A;  4KTA A;  2RVL A;  2EQS A;  2BE5 D;  4M1U B;  4O1N A;  3QOL A;  3NSW A;  1GUT A;  1IHZ A;  2UXC L;  5EPL A;  3VA5 A;  4Y7N H;  1CZW A;  2ZTD A;  3RLN A;  5KGU A;  5I6W A;  2D62 A;  4KN4 C;  1AZQ A;  3ULJ A;  4DNT B;  1VQL A;  1BVS A;  5EJW A;  3CF5 A;  1LTR D;  5C4Z A;  1SE8 A;  4DU9 A;  2ZJR A;  2RCN A;  1U4P A;  1JWS D;  1Y1W G;  3H3V C;  3LGJ A;  4HSV A;  4FVM A;  2SOB A;  3RLF A;  4XQQ A;  3CCL A;  4KLK A;  2JA7 B;  2RF4 A;  5IYD H;  4J8Q A;  4C3J G;  2E2D C;  3ONA B;  1XYI A;  1GUS A;  1PRT C;  4ME5 A;  3H0G B;  4GZY C;  4GN3 B;  4ME3 A;  1QNU A;  1XX8 A;  5KIX A;  4DV2 Q;  2X6G A;  2AWO A;  4NXN Q;  4A3E H;  4NB3 A;  1JE4 A;  2D0P A;  1MD2 D;  4OWW B;  4A3K B;  1CUK A;  3RUZ A;  3AMU A;  4JC0 A;  1HNZ L;  1KHI A;  2KOL A;  1YHB A;  3C1F A;  1HR0 L;  1H9S B;  1HFG A;  2K01 A;  4TKO B;  1KNE A;  4DR6 L;  4B08 A;  5AFW A;  2JK8 A;  3MAQ A;  3VR5 A;  1S72 A;  1QZH A;  5CR3 A;  2YTV A;  1MSH A;  4IUN A;  4L63 B;  4BWG B;  5IP9 H;  2RKS A;  5JVH 3;  3GDE A;  3MTS A;  4H0L C;  2B2T C;  3TME A;  5GAH C;  2L15 A;  5JEA G;  2A6E D;  4JK1 C;  4JI0 L;  4DV0 L;  2EY2 A;  4AIM A;  2A68 D;  4OWX B;  2EXZ A;  1KD1 C;  1YNJ D;  3K6O A;  3G4S A;  5AJ3 L;  4DR7 Q;  3PQI A;  2DY7 A;  4C3H G;  3BYY B;  2DGY A;  3C3L A;  4POG A;  1STA A;  1X3Q A;  4OX9 Q;  1Y1V B;  4X66 L;  5C4J B;  1S5F D;  4NMZ A;  1HQR D;  4YY3 L;  5LL6 S;  1YIJ A;  1Q7Y C;  4X3K A;  3NEL A;  3GTK H;  2KQ3 A;  5CV4 A;  5LMN W;  4XIG S;  4QCL A;  4DAY A;  3PUY A;  1EWC A;  3OIQ A;  2EYO A;  4DXG A;  2R93 H;  1MKH A;  5K36 H;  3PIO A;  2E76 C;  2J0T D;  4JI6 Q;  1PTO B;  1ZYR D;  1RJT A;  4X64 Q;  2F0Q A;  2EE1 A;  3I70 A;  1PVO A;  3S1R H;  1ASY A;  2BOS A;  3FKI G;  3FVQ A;  3R93 A;  1QVF A;  1WCM H;  3UE0 A;  2FMC A;  5E7N A;  3SXH A;  3CMA A;  4DR5 Q;  4P73 A;  1TS4 A;  4PMW A;  2G9D A;  4YHH Q;  1VCI A;  4QQB X;  1S5E D;  4QY7 A;  2DUD A;  1UUP A;  4G4K A;  1XPR A;  2IX1 A;  1SFO H;  4MN3 A;  3VA7 A;  1TS2 A;  2O2L D;  3BVM A;  1R4P B;  4RG1 A;  1B7Y B;  3E3X A;  3TP7 A;  2HDL A;  2RDH A;  4OXP A;  4GNX C;  5DM7 3;  4O0A A;  2V4D A;  5I2Y A;  3C2P A;  3DEO A;  3NBH A;  3HOY G;  1CQF A;  2SEB D;  1IL2 A;  2JE6 I;  3E0E A;  4ZRZ A;  1Y69 U;  2UUA Q;  4KHZ A;  4A93 G;  2KEC A;  3T13 A;  1H9J A;  4IPD A;  3R2T A;  3Q24 A;  4DV2 L;  3KOJ A;  4YCV A;  3ER0 A;  4NXN L;  5M3M H;  2YU9 H;  1HCZ A;  1VQ5 A;  5EPK A;  3TP6 A;  1UNS A;  2K5D A;  4R4I A;  2HIX A;  2R7Z G;  2RCF A;  3A5Z B;  2H4O A;  2YTX A;  1JMC A; 
#chains in the Genus database with same CATH homology
 4IUP A;  2B2Y A;  2E75 C;  3OPO A;  5I9O A;  1DOM A;  1WTW A;  1D1I A;  1SYF A;  1SYG A;  4EGV A;  2Q8R E;  2Q8T A;  4O42 A;  2B2W C;  4F87 A;  1LTA D;  4LJZ C;  5EBC A;  4MIU A;  1II3 A;  4CGY B;  2F0O A;  1RD9 D;  3D4R A;  4HTH A;  4IAL A;  3VYS A;  2IPK D;  3PIO 3;  3OOC A;  1F2Y A;  4ULL A;  3HGB A;  4HN7 A;  2ICE C;  1HHV A;  1D6E C;  1W6K A;  3VYU A;  2ENB A;  3GO5 A;  1CI3 M;  2R61 A;  1KDC A;  3I72 A;  5IOD A;  3LWE A;  4V19 0;  3A8J E;  2EYH A;  4XYQ A;  3GTK B;  1J9O A;  1STG A;  2ZT9 C;  3URY A;  4K5W A;  2R93 B;  4H44 C;  2MP1 A;  3K5O A;  3S1R B;  2RSO A;  4RCO A;  1B3A A;  2NTS A;  1WCM B;  3DWQ A;  2RBM A;  3PV0 A;  1PFN A;  2KEE A;  1SFO B;  3BZD B;  3A8I E;  2I46 A;  1T5X D;  4IUR A;  4DAV A;  1VF5 C;  2ZXR A;  1JWM D;  4UAI A;  4F88 A;  2EYP A;  4PV1 C;  2PQE A;  1RTN A;  5M3M B;  2AUK A;  2YU9 B;  1DYQ A;  1YNN C;  5I9P A;  3GQB A;  4WFN 3;  2XRS D;  3E0J A;  3SDZ A;  3M7N A;  1SEB D;  4MHE A;  3OSO A;  4S3S A;  1NR2 A;  4KK7 A;  5FLX E;  2Y0S B;  4ILW A;  2IX0 A;  5CBE E;  3HP3 A;  3IFD A;  4H13 C;  1S5C D;  4EQO A;  5CGK A;  4LMQ D;  3S14 B;  3MC0 B;  4X3U A;  5E4W C;  3I4M B;  1IL8 A;  1BCP F;  3HG9 A;  5FKA C;  4RKB A;  1PMR A;  1SBB B;  3OWF A;  1E2V A;  4NKL A;  1B50 A;  1I4P A;  1LAC A;  2A6E C;  2O5J C;  1FYC A;  2EDG A;  3A54 A;  3H09 A;  2K04 A;  2HQE A;  2BCO A;  1I3Q B;  2F0D A;  1TWF B;  2WB1 B;  4OO1 H;  3OIP A;  4IUU A;  2F0W A;  4RGT A;  3BS1 A;  1JQY D;  4KY6 A;  3PUZ A;  2TSS A;  3CKI B;  1C8C A;  4DXF A;  3HZX A;  3HOV B;  3GTJ B;  1EY5 A;  1B9M A;  5JPN C;  3NHH A;  1ZYR C;  2F0L A;  1IKM A;  1BBX C;  3KLS X;  3T4A C;  2EYM A;  2B63 B;  3K59 A;  1C48 A;  5A35 A;  1EIH A;  5HUR A;  2EVB A;  2O5I C;  5COR A;  1ESR A;  1XWE A;  5CV9 A;  1BNZ A;  1QB5 D;  2L55 A;  5CV8 A;  4DGZ A;  2DN8 A;  4H7B A;  1F2M A;  1JOK A;  3W3A A;  5EKK A;  5IT9 E;  2L1B A;  5C0X I;  4BBS B;  1V1P A;  4RGM A;  1EZ6 A;  4EQN A;  1LV9 A;  2K33 A;  2BDO A;  1GOZ A;  5C5L A;  3S1N B;  5JOB A;  4FYD A;  1IYV A;  2K32 A;  5JAV A;  1G29 1;  4X3S A;  1DON A;  1PLF A;  4KN7 C;  2EY1 A;  1ILQ A;  2L4N A;  1QG7 A;  2VUM B;  2RSN A;  1CM9 A;  1GUW A;  4LK1 C;  3Q6S A;  3WOF A;  1EYC A;  3P7J A;  2F1M A;  1CFM A;  4IFD H;  1STH A;  3KBX A;  1PRT F;  3MXN A;  1DCZ A;  3TP8 A;  4M8A A;  3D6W A;  4ZUI A;  1DXM A;  3H6M A;  3GTQ B;  3S9W A;  4K5V A;  3GTG B;  2L5T A;  1D2B A;  1SJH D;  4BBR B;  2LS0 1;  2D9U A;  1KTK A;  4FXD A;  5D3I B;  5ELF A;  3NUC A;  3RMH A;  4R8I A;  2BA0 A;  4U67 3;  3LNN A;  3M7G A;  2VB3 X;  4F7X A;  4CJ2 C;  1EY8 A;  2XNA C;  5EGT A;  3VYT A;  3WOE A;  1WTV A;  3OHX C;  1R9T B;  4OHJ A;  3BYT B;  3J80 E;  2Z4H A;  5C0X G;  1HTL D;  1OXV A;  3MXP A;  5JEA H;  3QO2 A;  1SMY D;  1BCP B;  4RKL A;  5JEA J;  5A2Q E;  1BQQ T;  3SVM A;  3DWA A;  4C3I B;  5C4X B;  3ND8 A;  2KVM A;  2GA4 B;  1LTT D;  4QB4 A;  4ZYS A;  5M5Y B;  4OIK A;  4K14 A;  2A74 C;  3FPP A;  2SNM A;  1WVL A;  2B2Y C;  4NDX A;  4BA1 I;  5T1G A;  4CKB A;  1TU2 B;  1V1O A;  5M3F B;  1H9R A;  1YNN D;  2HUG A;  1LLR D;  3KLR A;  3GTM B;  4KD3 A;  1XTC D;  4CHT B;  1GJX A;  3V2T A;  2F0I A;  1L0Y B;  2L0C A;  3K5M A;  4PMB A;  3VR4 A;  4A3I B;  3J7A V;  2KUM A;  3ERQ A;  2ID0 A;  4CKC A;  1JR0 D;  2F4I A;  4LAA A;  1E2Z A;  1LT5 D;  4ABN A;  3T53 B;  3MVV A;  2WIN B;  4FF1 A;  3VR2 A;  1EU4 A;  4WOR A;  1PTO C;  5CBA E;  1A6X A;  2K03 A;  2NN6 H;  2F0G A;  2B2U A;  4FP5 D;  5IGE A;  4A3F B;  5IGB A;  2JP1 A;  2NZ1 D;  1CHP D;  3DM1 A;  3F2U A;  4OGQ C;  2NTT A;  1BR9 A;  3SR1 A;  2DY8 A;  1PFM A;  1S5D D;  1LTB D;  1CA5 A;  3MXG A;  4TSS A;  2B2V A;  5EBD A;  1H9M A;  2KA7 A;  5C3E B;  3JAM E;  5IGC A;  2JEA I;  2NB0 A;  2K5Q A;  1E2W A;  3CRL C;  1BUV T;  4C3H B;  3GD7 A;  2EYL A;  4ODG A;  1STE A;  1PRT B;  3FEW X;  1I4Q A;  1SE4 A;  2K1B A;  1D5Z C;  1W6J A;  3SE0 A;  4N9P A;  3MEH A;  1ENF A;  3Q22 A;  3WDN A;  3S1Q B;  1EY7 A;  3L9A X;  2VB2 X;  2JXM B;  1TY0 A;  2C5C A;  2R3Z A;  4KKU A;  2F03 A;  3A55 A;  2PPB C;  1A2U A;  5D3D A;  3X3M A;  1SNM A;  4FXK C;  1D5M C;  3FKI B;  2NUC A;  2PZU A;  3I4L A;  3KK7 A;  2CW0 C;  3CHB D;  1ZXT A;  1H9S A;  3IAY A;  1TR5 A;  1G6Z A;  3K57 A;  1BOS A;  1F9R A;  4N9T A;  3MFY A;  5DAU A;  4RGO S;  1JOO A;  1HFN A;  1EQV A;  1I6V C;  4ID6 A;  2VXW A;  1TVX A;  5FO7 B;  3PIP 3;  1V43 A;  3U9S A;  3IFT A;  3K58 A;  1WTO A;  4C56 C;  3QJY A;  4J1M A;  3N52 A;  2R7Z B;  3PMF A;  3BG3 A;  2AQ2 B;  5G3L D;  4BY7 B;  4DA2 A;  5M5X B;  5D14 A;  2XIW A;  3QWN A;  1HA6 A;  3R3O A;  3NTK A;  5KEE A;  2HDM A;  3HKZ B;  1JB3 A;  5K36 G;  1O7Z A;  4HMJ A;  1IW7 C;  1ENC A;  2M2L A;  3K0Y A;  4CBV A;  5D65 A;  2DNC A;  4DF7 A;  5IGG A;  3I4N B;  1Q8I A;  5EKL A;  1U4R A;  4WJW A;  3LX0 A;  1KDA A;  2A5H A;  4RWS C;  5EPJ A;  1SMY C;  2F0J A;  3SHL A;  1DD2 A;  2KJX A;  5CV5 A;  3R2I A;  4C1N K;  1KAB A;  1PYW D;  5K5P A;  2TMP A;  4KJN A;  3CRK C;  2RDF A;  1RDP D;  1MBY A;  2QIL A;  1HA5 A;  3NBI A;  2EJF C;  5KRU A;  3O13 A;  5DEH A;  3VYR A;  1PDQ A;  1TKW B;  5LHY 1;  1TII D;  4RA8 A;  4B9W A;  1U4L A;  3OMG A;  2ZXP A;  3EA6 A;  1EYD A;  4PNY A;  1X3P A;  1A2T A;  4IUQ A;  1SSO A;  1B2T A;  5CC4 A;  3S2D B;  2N88 A;  3HOW B;  3S17 B;  1MI2 A;  3HRZ C;  1KAA A;  1HUM A;  4Q0F A;  3BVZ A;  1K83 B;  3NXW A;  1O78 A;  3J81 L;  1PZJ D;  5CMD A;  3S2H B;  1MGS A;  3Q0A A;  1STB A;  1WTR A;  4A3G B;  3TZD A;  1IKL A;  2G9H D;  4RCN A;  5BN3 A;  2NBF A;  3D31 A;  1CT1 D;  3A7A B;  5C6A A;  3SK6 A;  1G2T A;  1RF2 D;  4I65 A;  1PTO D;  1EL0 A;  1UAP A;  3DHQ A;  4NP5 A;  4U68 A;  2A6H C;  2MUY A;  3IL8 A;  3H94 A;  3OW7 A;  1EY0 A;  3A7L A;  4G7H C;  1U4M A;  3M85 A;  4C2M B;  4HAE A;  5E1F A;  2OXP A;  1EEI D;  4I7Z C;  1F9S A;  1AEX A;  1JC7 A;  1SAP A;  1QE6 A;  4CJ0 B;  2O4X A;  3FMC A;  3S1M B;  1IYU A;  1QOH A;  5BN5 A;  2EYJ A;  1Q12 A;  1AZP A;  4OO1 I;  1LTI D;  5JJZ A;  2D5D A;  3T56 B;  2IL8 A;  2NVY B;  5J1Z A;  1Y8N B;  3SK8 A;  4K6D A;  1B4O A;  2JA5 B;  4XTC S;  1G8Z D;  2B8F A;  3H91 A;  2WP8 J;  2IT1 A;  3TDQ A;  4QUF A;  3I8Z A;  3FDT A;  2EZV A;  2HCC A;  3HOX B;  5FO8 B;  5TSS A;  3L7Z C;  5IIF A;  4RGN A;  3GTL B;  1CK1 A;  1O7Y A;  5CV7 A;  4K6L A;  3MFG A;  1DM0 B;  2BDN A;  1F9Q A;  1OXU A;  1I6H B;  3BVG A;  3UI2 A;  5E3F A;  1QWY A;  2EY6 A;  1KNA A;  1Q3L A;  2QEJ C;  4XT3 B;  3OWE B;  1FNV A;  2F0N A;  1ICW A;  4ZKC B;  1H9K A;  5BN4 A;  1SYE A;  3BDL A;  2NVT B;  1SJE D;  1KLU D;  2PO4 A;  1BXT A;  3DWP A;  1JOR A;  1GUN A;  4NW2 A;  4V0B A;  2CW0 D;  1NSN S;  2B2U C;  1V8Q A;  2K28 A;  1JOQ A;  1D5X C;  2WAQ B;  2M00 A;  4K5X A;  2AQ3 B;  1CA6 A;  1OXX K;  3RZO B;  2XN9 C;  3BDC A;  2FIN B;  1TY2 A;  4TQU S;  1OO9 B;  2LY7 A;  3W2D A;  5T1I A;  1LTG D;  2CHB D;  2PYK A;  1BCP C;  2B2V C;  1VDZ A;  3TSS A;  4IFD I;  1O80 A;  4FO2 A;  4OO1 G;  3D4D A;  3PUW A;  3NP8 A;  1PZK D;  2CQA A;  2F0H A;  2BA1 A;  3SK5 A;  3EVQ A;  2KED A;  3ZYY X;  2MHV A;  1M4V A;  1EY4 A;  4DK1 A;  1UEA B;  3TN2 A;  4KY5 A;  2ICI A;  2L12 A;  1DOL A;  3QB3 A;  1ROD A;  1S5B D;  1IW7 D;  1LO5 D;  1SNO A;  1Q90 A;  2MPM A;  3C1E A;  1OXT A;  1RHP A;  4FF4 A;  5JPM C;  1LTS D;  2Z4I A;  4KD4 A;  2LMC B;  3RD4 A;  3C46 A;  3D6C A;  4Q5V A;  1D1K A;  1M8A A;  2AUJ D;  4C3I G;  1B1Z A;  5ELC A;  1Z47 A;  2OEO A;  2J4X A;  1C4Q A;  3X3N A;  3KUP A;  2Z8L A;  4RHR A;  2E2H B;  4QMG A;  4IZ8 A;  1CZG A;  1Q1B A;  5M5W B;  1B44 D;  2R92 B;  5FO9 B;  3I91 A;  4CJ1 B;  1WD0 A;  1LT4 D;  3P75 A;  1RCV D;  3PUV A;  1SND A;  2A69 C;  5C3X A;  2EYF A;  5M9O A;  1PZI D;  1EWH A;  2VNU D;  1EEF D;  4BA2 I;  1HTP A;  2PW5 A;  4BY1 B;  3NQT A;  5I6Y A;  1EIG A;  4IFD G;  3QIA A;  2NVX B;  3HEJ A;  3R8B A;  1LT3 D;  1WTX A;  2K5W A;  1ET6 A;  2RDG A;  2X69 A;  1TS3 A;  2F0F A;  2WKC A;  1SE3 A;  4A3D B;  1S4Z A;  1Y1W B;  5DM6 3;  5COY A;  3D4W A;  5J22 A;  1JWU D;  1VMP A;  2EOT A;  4HMI A;  3LWU A;  3I3C A;  2AWN A;  4C3J B;  3FPU B;  4QIW B;  3GV6 A;  2A6H D;  2NN6 I;  1X32 A;  1QJO A;  3RZD B;  3M4O B;  2WV6 D;  1SYD A;  2FFK B;  1FD7 D;  1GHJ A;  3KF8 A;  1TWH B;  4XQJ A;  5CV6 A;  3CU7 A;  4FNF A;  1ML0 D;  1I50 B;  1HPC A;  5IGD A;  2KCC A;  4WRD A;  1R4Q B;  1PXU A;  2IWH A;  4KKT A;  5F2D A;  1ENA A;  1TWC B;  1EOT A;  1SE2 A;  4ZKB B;  3MHB A;  5CYU A;  1EFI D;  3NTI A;  5KYI A;  4KJO A;  1A3T A;  2MJ8 A;  4G7Z C;  2FJ2 A;  2NWG A;  4XYO A;  3TZU A;  2H1E A;  1TS5 A;  1SNP A;  4CKE A;  3BDO A;  5FOB B;  2OT2 A;  4F8M A;  2SDF A;  2WII B;  1AP0 A;  4K8J A;  4RHS A;  1A15 A;  1HRJ A;  3MA2 B;  1QIL A;  4E6I A;  4EVO A;  4YIJ A;  1FGB D;  1NR4 A;  1GHK A;  4BS9 A;  4Y7N B;  1DJR D;  4KV6 A;  1EY6 A;  1WTQ A;  1ZKO A;  4FXG C;  5ELB A;  2PZW A;  3E6Z X;  1ILP A;  2F0S A;  2D2C C;  2F0U A;  2KCN A;  3ND9 A;  1JIC A;  1LAB A;  1TWA B;  2XWJ B;  1B53 A;  2ZXO A;  4IN3 A;  2JA6 B;  1VMC A;  2NN6 G;  2IX3 A;  4G7O C;  1RKN A;  3V05 A;  1F2Z A;  3HOY B;  3T51 B;  1GXD C;  5DNF A;  3NWS A;  4A3E B;  3PUX A;  4X3T A;  3SK4 A;  4A93 B;  1NCV A;  2IW3 A;  4UDU C;  2QCP X;  1XXG A;  4RFB A;  1O7L A;  4HCE A;  1SYC A;  3A8K E;  2XRQ D;  1BCP D;  2R6G A;  1Z7T A;  3S15 B;  1F77 A;  3DXJ C;  3QOJ A;  2EY5 A;  5FLX L;  3EQL C;  5I4D A;  2AQ1 B;  3K5L A;  3A56 A;  2M9V A;  5EQ0 A;  1T5E A;  3ITP A;  4HED A;  1AN8 A;  4KKS A;  3D3R A;  4KI0 A;  1SNC A;  5IOC A;  1BF4 A;  3GTP B;  2CVR A;  4ZQ3 A;  2PZT A;  1F2L A;  1I4X A;  1RTO A;  3TBI B;  3L3O C;  2B8G A;  1U9R A;  2A73 B;  3AB9 A;  4EQP A;  5C3W A;  2F0P A;  2OF1 A;  3NWT A;  1HXY D;  3ERO A;  5KNC A;  2B2T A;  2JYO A;  2XSC A;  3SEB A;  4FF3 A;  4Z9C B;  1CQV A;  2L9H A;  2WAC A;  3OMC A;  1GUG A;  4HCS A;  2FMM A;  1G2S A;  1NAP A;  3U9O A;  4A3B B;  3G6J B;  4R8N A;  3PO2 B;  1BDO A;  3J7Y W;  3T16 A;  4G57 A;  1FNW A;  3GTO B;  4DN4 M;  1Y8P B;  3DEP A;  3P20 A;  5J39 A;  2L11 A;  1ESF A;  2BE5 C;  2YYZ A;  5ELE A;  3NPP A;  2XVS A;  1WD1 A;  2K05 A;  4KHV A;  5JVG 3;  1WTP A;  4JBW A;  3HOZ B;  2A69 D;  1STY A;  4FF2 A;  2XWB B;  4DNR B;  3G7L A;  1AFP A;  2WKD A;  2SNS A;  5E4X A;  2EJG C;  5NUC A;  3E5S A;  3DUZ A;  4ZK9 B;  3VR6 A;  2I07 B;  4QUC A;  5IT9 L;  4KMU C;  1K8O A;  3MXU A;  4ZAI A;  3M3Y B;  1SDF A;  5HGT A;  3NK9 A;  1B9N A;  1SYB A;  4QF4 A;  1LT6 D;  4RAU C;  1V1P B;  1PRT D;  2K6A A;  5IGF A;  1EYA A;  5KYL A;  5KND A;  5G3L F;  3KLS A;  2PMZ B;  4TRD A;  2DNE A;  2PCF B;  1EZ8 A;  3FRP B;  2QKI C;  1I4G A;  3Q23 A;  2A68 C;  1Y8O B;  1YNJ C;  4K2L A;  3K5N A;  1Q1E A;  4P2C B;  2B2W A;  4K8I A;  1TT2 A;  1ET9 A;  1PFB A;  2EJM A;  1AW7 A;  4ZUJ A;  3I73 A;  4DAP A;  1DZ1 A;  2J7Z A;  4PQX A;  2F0T A;  2E2J B;  1FR3 A;  1SNQ A;  2NYZ D;  1HUN A;  1MSG A;  4L6T B;  4AYB B;  1KLG D;  4R9W A;  3HOU B;  4C1N I;  1FNU A;  1I4R A;  4DK0 A;  2JA8 B;  1Z6H A;  4PMC A;  3M4Y A;  1EU3 A;  3J7A F;  4OL7 A;  2E2I B;  4XT1 B;  3CQZ B;  1JCK B;  2F3V A;  3EJI A;  1I4H A;  2N55 A;  2QF7 A;  1TWG B;  4A3J B;  2EPB A;  3J80 L;  3NQI A;  5C4H A;  1ONL A;  2PW7 A;  4IUV A;  4J6H A;  3QG1 A;  4HSP A;  4IQZ A;  4XXE A;  5C0X H;  1J8I A;  3PO3 B;  4K2K A;  4IUT A;  4HR7 B;  2FHT A;  5C0X J;  2C9O A;  5KNB A;  5A2Q L;  1STN A;  3VR3 A;  2KHS A;  3MZ5 A;  3J81 E;  5FK9 C;  2F0K A;  2X6L A;  3NE5 B;  4XDX A;  1DOK A;  2Z1C A;  2F0E A;  2QDB A;  5ELD A;  4XQN A;  1CTM A;  3K7A B;  5ISR A;  1F9P A;  3GV3 A;  4ZLT F;  1GUO A;  2IJ0 A;  2NVQ B;  4KY7 A;  1BO0 A;  2JSO A;  1PTO F;  1G91 A;  2RA4 A;  5LL6 X;  4IFD J;  2K7V A;  2JEB I;  2PNR C;  1EQT A;  3MWY W;  1E0B A;  5I2X A;  2LKV A;  2MGS A;  3KBG A;  2HCI A;  3HS0 C;  2Q8I B;  5C5M A;  2F3W A;  1NUC A;  1EY9 A;  1QCB D;  4A3M B;  3NTH A;  1QNK A;  1VF7 A;  3AU7 A;  2RQX A;  4L8J A;  3N6R A;  1A3U A;  1ZEQ X;  2E74 C;  3V96 A;  3GP7 A;  3P1H A;  3EFX D;  4DFA A;  1L0X B;  1HQM C;  3IKJ A;  2F0M A;  3DMU A;  1KDB A;  3JAM L;  2F0V A;  5C44 B;  1TQO A;  5EKI A;  3D8G A;  3TP5 A;  3I90 A;  4OIJ A;  4RH6 A;  1CHQ D;  4B9X A;  1A3V A;  1SXT A;  1K8M A;  1PTO H;  2LFN A;  2B39 A;  3S16 B;  4KTA A;  2RVL A;  4O1N A;  2BE5 D;  4M1U B;  3QOL A;  3NSW A;  1GUT A;  1IHZ A;  5EPL A;  3VA5 A;  1CZW A;  5KGU A;  5I6W A;  2D62 A;  4KN4 C;  1AZQ A;  4DNT B;  5EJW A;  1LTR D;  5C4Z A;  4DU9 A;  1U4P A;  1JWS D;  3H3V C;  4HSV A;  4FVM A;  2SOB A;  3RLF A;  4XQQ A;  2JA7 B;  4J8Q A;  4C3J G;  2E2D C;  3ONA B;  1XYI A;  1GUS A;  1PRT C;  4ME5 A;  3H0G B;  4GZY C;  1QNU A;  1XX8 A;  5KIX A;  2X6G A;  2AWO A;  1JE4 A;  1MD2 D;  4A3K B;  3RUZ A;  3AMU A;  2KOL A;  3C1F A;  1H9S B;  1HFG A;  2K01 A;  4TKO B;  1KNE A;  4B08 A;  5AFW A;  3MAQ A;  3VR5 A;  5CR3 A;  4L63 B;  1MSH A;  4IUN A;  4BWG B;  2RKS A;  5JVH 3;  3MTS A;  4H0L C;  2B2T C;  3TME A;  5JEA G;  2A6E D;  4JK1 C;  2EY2 A;  2A68 D;  2EXZ A;  1YNJ D;  3K6O A;  2DY7 A;  4C3H G;  3BYY B;  3C3L A;  1STA A;  1X3Q A;  1Y1V B;  5C4J B;  1S5F D;  4NMZ A;  1HQR D;  5LL6 S;  4X3K A;  2KQ3 A;  5CV4 A;  4XIG S;  4QCL A;  4DAY A;  3PUY A;  1EWC A;  3OIQ A;  2EYO A;  4DXG A;  5K36 H;  2E76 C;  2J0T D;  1PTO B;  1ZYR D;  1RJT A;  2F0Q A;  2EE1 A;  3I70 A;  2BOS A;  3FVQ A;  3R93 A;  2FMC A;  3SXH A;  4PMW A;  1TS4 A;  2G9D A;  1VCI A;  1S5E D;  1UUP A;  4G4K A;  2IX1 A;  4MN3 A;  3VA7 A;  1TS2 A;  2O2L D;  3BVM A;  1R4P B;  3TP7 A;  2HDL A;  2RDH A;  5DM7 3;  2V4D A;  5I2Y A;  3C2P A;  3DEO A;  3NBH A;  1CQF A;  2SEB D;  2JE6 I;  4ZRZ A;  1Y69 U;  4KHZ A;  2KEC A;  3T13 A;  1H9J A;  3R2T A;  3Q24 A;  1HCZ A;  5EPK A;  3TP6 A;  1UNS A;  2K5D A;  1OXS C;  2H4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...