1UEAB

Mmp-3/timp-1 complex
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
181
structure length
181
Chain Sequence
b'CTCVPPHPQTAFCNSDLVIRAKFVGTPEVAQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHARSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MATRIX METALLOPROTEINASE-3
molecule tags Complex (metalloprotease/inhibitor)
source organism Homo sapiens
publication title Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
pubmed doi rcsb
total genus 42
structure length 181
sequence length 181
chains with identical sequence D
ec nomenclature
pdb deposition date 1997-06-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ueaB02
3.90.370.10 Alpha Beta Alpha-Beta Complex Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 Tissue inhibitor of metalloproteinase-1. Chain B, domain 1 1ueaB01
1GXDC 3CU7A 5JPNC 1UAPA 3CKIB 2J0TD 1BR9A 5FO9B 3MA2B 3L3OC 3T4AC 4FXGC 2A74C 5FO7B 5FOBB 1BUVT 1BQQT 5JPMC 1JB3A 2WIIB 2WINB 4FXKC 2B39A 3HRZC 3I70A 2TMPA 3OHXC 3FRPB 1PXUA 3HS0C 2ICEC 2XWBB 1JC7A 3V96A 1OO9B 2I07B 2XWJB 2A73B 2QKIC 1D2BA 3KLSA 2E2DC 1XWEA 4ILWA 5FO8B 1UEAB 3G6JB
chains in the Genus database with same CATH superfamily
1WD1A 2D0PA 3TDQA 5FO9B 5IGDA 2I5MX 4HCEA 1TXYA 3W5OA 1JB3A 3TS0A 4B3SQ 4YHHQ 1M8AA 4KTAA 4JI2Q 1K8OA 2EYHA 4QJFA 5IGFA 5KNBA 3K58A 1WOCA 2VB3X 3M4QA 1Z9FA 1TKWB 1V9PA 3I73A 3MTSA 2IW3A 1GJXA 1TWHH 4WRDA 4LF6L 5IODA 1VQ7A 2E2DC 4IURA 5IGBA 1VDZA 4OWXB 4JI6L 2L55A 3ITPA 3JC66 4A3KH 2EVBA 3M9BA 4M8AA 2MPMA 2F0OA 3MXNA 4RHSA 3STBD 2B63H 5GAHC 1V1PA 4J15A 3N52A 3SK8A 3CPWA 4QIWE 2PNHA 1LLRD 1E1OA 3UDIA 3MFYA 4YWMA 5M3FB 3T1HQ 1X6OA 3OWEB 4CDEC 4DV1Q 4HCSA 3M4PA 5C5MA 3NWSA 2VQFL 2D2CC 3SR1A 5LMNW 4C3HG 1F2MA 4ZKCB 1WTXA 2B2WC 1HA5A 5BR8Q 1DXMA 1PRTB 4XDXA 4OIKA 3RD4A 3NE5B 3HOZH 2WAQE 3HOUB 2B2TC 2JQOA 3A0JA 2HT1A 1GUNA 1JQYD 2O5IC 5T1GA 5EPLA 4A3MG 1LV9A 1SBBB 1QE6A 2KCMA 1TWAB 2HQLA 3GV6A 1NR4A 2Q2HA 3HOWG 3STBC 1DJRD 2NVTB 2RVLA 1DM0B 2EXDA 1VQJA 3PIOA 1XX8A 3OHXC 4DPGA 3MEHA 2IWHA 1LABA 5E4WC 1K0RA 1QVGA 3ERQA 3S2HB 1V1PB 2OQ0A 1EQVA 4RAUC 1SNPA 3VYRA 1B50A 2R93G 3BYYB 4AYBB 2HD3A 3KLWA 4JI5Q 2E2IB 1YNJD 1I94L 1U5KA 1LT3D 1J9OA 2A74C 5E4XA 4B9XA 1CHQD 2F4VL 1SE2A 4DU9A 3GTQB 3H94A 4RWSC 4IUUA 4DV0Q 5HGTA 4B3SL 1YJNA 2YTXA 3TP7A 1N33L 4AQYQ 3K5MA 3PIO3 2QDLA 2R61A 3F2DA 4DR1Q 1CFMA 4DR4Q 1X3QA 3E5SA 1FNVA 4KY6A 5IGCA 4JBWA 2ALYB 2HHHL 4KV6A 3H6MA 2PZTA 2PNRC 2QCPX 1EYCA 3TBIB 3GTMB 1G6ZA 2MO0A 5M3MH 3MFGA 1GUOA 1MBYA 3GTJH 1PTOD 1JCKB 1G8ZD 1S72A 2N3SA 5FO7B 4IUQA 2NVTH 1B3QA 4BBSG 1VS0A 5D14A 1QVFA 2FHTA 1CI3M 4XT1B 4GOPB 1A3TA 4HSVA 4DNTB 1YIJA 5K36G 1Y1VH 3QR8A 2SNMA 1N32Q 1RTOA 2F1MA 2BA0A 2I07B 1E0BA 4YCVA 3FKIG 1Y1WG 3H09A 4HTHA 1KL9A 1V43A 1FGUA 2H4OA 1L0WA 1AH9A 2K01A 5FLMG 1PH3A 1TWCH 3LWEA 3OSOA 3NPPA 2DY8A 1HUNA 4A3BB 5CMDA 3ULLA 3GTKB 5LL6X 4B3TQ 3H3VC 2WACA 3NTKA 2NB0A 3EA6A 5IYDG 2JXMB 1S4ZA 3I91A 1VQGA 1EWIA 1ZYRC 1EOVA 4OELB 4JI3L 4Y7NB 1PH6A 4LF6Q 2EDGA 2E2HH 3CD6A 5J1ZA 3MA2B 1YHBA 2B8FA 1I4PA 2NZOA 4LFCQ 1W6JA 2EY2A 3TSSA 4FXKC 3KF6A 1X54A 2Y0SG 1PXUA 2QDBA 3NQTA 1K28A 4GOPC 2G9HD 3HG9A 1CSPA 3S16B 1G51A 2GA4B 1EYAA 2XRQD 3DEPA 1ZEQX 3UE0A 3H0GH 5KNCA 5EKLA 1NMGA 2E5LL 1STGA 3HZXA 2HCIA 3PO2G 3AMUA 3I3CA 2OQKA 3A5ZB 1F2LA 4JV5L 2CKZB 3EIVA 3CCQA 2IL8A 1HQMC 3CCLA 3KJPA 3WOFA 3DM1A 1GUTA 5G3LD 3OTOL 4DKAC 5GQOA 1SYDA 5LMUQ 4C2MH 4ILWA 5CGKA 4OGQC 1WCMH 1KAAA 2LKVA 2K33A 1QJOA 4GNXA 1ILPA 1EUJA 4EQOA 3I4NH 3W2DA 2R92G 5NUCA 1A6XA 3KBGA 1R9TH 1DZ1A 3PV0A 4JBKA 3H0GB 1SJHD 4K5XA 1B7YB 4BS9A 1EEID 2Q8TA 1TY2A 1I5FA 1SR3A 1U4MA 2XIWA 5AJ3L 2BA1A 2N88A 4B3MQ 3QIAA 4RMFA 2JA5H 1B2TA 3DWQA 1DOLA 4LFAL 2AHOB 4A3KG 1EFID 2K4KA 1ICFB 4DV4Q 3S17H 1PH8A 1Q82C 1QNUA 4CJ0B 4LW1A 4DR3L 3A5UA 1BQQT 4HIOA 1BXTA 2KJXA 5I4DA 4N9TA 4UP8A 3T53B 3RZDH 5IT9c 3GV3A 4QQBX 1F2YA 4OO1G 3I72A 3FEWX 4DNRB 1N36Q 1PMRA 2UUCQ 1D8LA 1CA5A 4JPBW 1W3SA 3GD7A 1KD1C 4WFN3 2TSSA 3EFXD 1U9RA 2F3IA 4X64L 4GNXB 2OF1A 1R4PB 3E0EA 1VQ6A 1AFPA 3F1ZA 4KK7A 3J80L 3E9IA 5D3DA 4FP5D 1YITA 3KFUA 4BXXG 1VQOA 5BN4A 3EQLC 2VQFQ 4K5WA 5C3WA 3F2UA 3P75A 4JI4L 4A3KB 1D5ZC 1IBLL 4L8JA 3D6WA 1SNDA 2QA4A 3CCVA 3E0JA 4G7ZC 4AQYL 4MTNA 4IPCA 1RODA 3J7YW 3GTKH 5EKKA 1F9PA 4YHHL 1KTKA 5C3EH 1Q1EA 3CQZH 3OIQA 5JPMC 3TMEA 2OTLA 4A3DB 2WAQG 3R2IA 5LMNL 3IFDA 3TN2A 3EROA 3RNUA 4JI2L 1B8AA 1K83B 5BN5A 2CQOA 3TP5A 5M3MG 1L2FA 1B44D 1PZKD 3RLFA 3NBHB 2BH8A 3BVZA 3KUPA 4U673 1IBLQ 5DM73 4L6TB 2E2HB 2EYLA 2EPBA 1CM9A 2B8GA 4DV5L 1SMYC 5JJKA 4XQQA 3LX0A 3M7GA 1GUGA 4K6DA 4LUZA 3Q22A 1GM5A 2C5CA 1II3A 1VQHA 4UAIA 2E2JH 2V1CC 2R7ZG 4YIJA 4C3JB 1MSGA 2F0MA 2JN4A 2F0DA 5ELNA 3NENA 3KLSA 3UDXA 5JVG3 1NNXA 1OXXK 1JB7A 5EBCA 1QZHA 3CCRA 3PIPA 2OXPA 1B4OA 4PMCA 2ZT9C 1G2TA 2Z4IA 4KHPL 1E2WA 1BKBA 2JEBI 1A63A 3I4OA 4DR5Q 2KUMA 3S1MH 3PO3G 5JEAH 4RCNA 1EZ6A 1PFMA 2NVYH 3NP8A 3MHBA 1N8RC 2F0IA 4DK1A 3L2PA 3K6OA 2NYZD 4O42A 3QJYA 4BXXH 4KN7C 2LY7A 2K6AA 2RDHA 3J81E 1Y8NB 3NELA 4XYOA 2UUBL 1QCBD 2NUCA 2RBMA 4JYAL 2HQEA 2B3GA 3AU7A 4HMJA 2DJGC 2L11A 1EY5A 4XIGS 3A7AB 4ME5A 5IGEA 2LSSA 3K5LA 3NTHA 4TRDA 2MNAA 2K75A 4N8X1 3KF8A 2MUYA 3QOLA 4RHRA 3J81j 4TKOB 4BY7B 4XXEA 2F52A 1I3QH 3MC0B 4DV7Q 4QCLA 3SHLA 3W1GA 1SJED 4A3GB 1X3FA 2MJ8A 3DHQA 2QGQA 4MTKA 2PW7A 1U4LA 1VQIA 1PTOB 3CCJA 3KLRA 1A3VA 2KOLA 2Q2UA 1H9JA 3ERSX 5FJ8G 3D4RA 3GTLH 5M5YB 3BDLA 4PG3A 1QG7A 2B2WA 1VQNA 1EZ8A 1J5EL 1WI5A 1YJ9A 4FF1A 4Y52H 1JJCB 4IUPA 1HR0Q 4ZAIA 1SYFA 2J7ZA 1EFWA 5CYUA 1CKNA 3BVGA 4X65L 3P20A 2UUAQ 2KA7A 2E75C 5DM63 1FJGQ 2LS01 2NTTA 4MHEA 4NDXA 5JJLA 4DV4L 4B08A 2Z1CA 1SMXA 3ULJA 1SAPA 4CGYB 4HAEA 4DA2A 3D6CA 2MGSA 2QILA 3KLSX 3FMCA 4G7HC 3NHHA 3I55A 1MIUA 5FLXc 4N9PA 1YZ6A 5DAUA 1XMOQ 1PH7A 4KLKA 1ET6A 1Y8PB 1A15A 3D8GA 3HOVH 4A76A 4IPGA 4C1NI 1DYQA 3H0GG 1X55A 4LNQA 1STEA 5CBAE 3A7LA 2B63G 4LFBQ 4DV2L 1TWCB 4NB3A 1I50H 1BBXC 1HJPA 1B1ZA 3KDFB 4P71A 3K8AA 2YTYA 5JAVA 5LMNQ 2F3VA 1IW7D 3A55A 4GLAC 1A2UA 4KHZA 1KABA 4A3JH 1TS4A 4DV6L 3KBXA 1ICWA 2PO4A 4A3GH 3OOCA 4F88A 3MZ5A 2JA5G 1XPRA 2JA8G 3S15H 2WP8J 1YJWA 3VA7A 3J80i 1IYVA 1HFGA 3GTGH 3CCMA 2K5QA 2EIFA 4FF3A 4DAVA 2VQEL 2RCNA 5GAEC 1DOKA 3CAMA 4IFDI 4DK6C 2K50A 3SE0A 3J81i 4JYAQ 4L5TA 4OO1H 4A3FB 4K14A 2ATWA 1Q8IA 3I4NG 3ONAB 5D65A 2KHSA 3O13A 2NN6H 5C4HA 2UXDQ 1UNSA 1M4VA 1VQPA 2F0FA 1HXYD 2PQAA 4DK3C 1IHZA 2PI2E 1WTQA 2R7ZB 1PRTF 4FXGC 4X65Q 1PH2A 3D0FA 3G4SA 4OIJA 4FF2A 4UHVA 2RA4A 4X66L 1Q7YC 2X6GA 3MXPA 4QGUA 1KNEA 3DWAA 2JA8B 4A4IA 4G57A 2CHBD 4KD4A 2K5VA 3HFZB 4R4CA 5K36H 2RDGA 3K7AH 4DR7Q 1BCPC 5HY6A 1S5CD 4BBSH 5TSSA 3GTPH 1NR2A 4A3MB 2G5DA 4JI8Q 5C3XA 4A3FH 1UE1A 3J80c 1EEFD 3L3OC 3C1EA 3CQZB 3OMCA 3H15A 1Q86C 4A3DG 1SLJA 3CC4A 1O7IA 1XMOL 3K5OA 4RFBA 1SFOH 3S2DB 2EJMA 3S14B 1HNWL 4KHVA 5I2YA 1DGSA 1RHPA 2NZHA 4KY5A 2CW0D 2IX0A 2WKCA 1XPUA 1I6HB 3D31A 4DFAA 3E6ZX 1Q3LA 4ZCKA 3VYTA 3F2BA 1WTHA 4A3IB 3CMEA 1GOZA 2PMZB 3FPUB 3PO2B 3VR5A 3CC2A 1STAA 4LUVA 1LTSD 3HKZB 2BOSA 5M3FG 2K04A 2E2IH 3NEMA 4ALPA 1ESRA 2AWOA 3T51B 3T13A 4DV1L 2F03A 1H9RA 4KI0A 4YCUA 1NCVA 1HZCA 2NVXH 5C0XJ 1OTCA 3DM3A 1FNUA 4HIDA 2BDOA 1N32L 2K28A 1HFNA 1EU4A 4X3UA 2UU9L 2IJ0A 2KBNA 1LTLA 3S1QH 2R7ZH 4LK1C 1PH1A 3N6RA 4BWGB 3U9SA 2L5TA 1CHPD 1P8LA 4AYBE 1XNRQ 4EVOA 1XMQL 5LL6S 3OPOA 1SNMA 3K59A 3C3LA 2IT1A 3HOUH 5C0XH 1WD0A 5ELFA 1L1OC 3TZUA 3DXJC 3V96A 4EQ5A 5KIXA 3K80C 4BBRH 3J7AV 4OEMB 2R6GA 3JAMi 1IYUA 4F7XA 1Y1WB 1EL0A 1TU2B 4LUOA 3T1YL 2NN6G 2AUJD 4DAYB 3MXGA 3VA5A 3K0YA 4IUNA 2F0GA 5C4XB 2K1BA 2Z9HA 2K03A 4PNYA 1I3QB 3RR5A 3Q6SA 1I6VC 3MXNB 1L0YB 4LF9L 1T5EA 2BCOA 3T56B 3WWVA 3JAMc 3CF5A 1VQCA 5I6YA 1Q81C 5IT9L 2F0TA 4K0KL 1XTCD 1L0XB 1LTGD 2KCNA 1LTBD 2FXQA 3Q8DA 4BBRG 1D6EC 3L0OA 4E6IA 3VR3A 5A2QE 3IKJA 1O80A 5C5LA 4V0BA 1JJ2A 2JYOA 1OXVA 5IP7H 2F3WA 3HKSA 1PFBA 2IHFA 3Q0AA 4TQUS 2D9UA 5EJWA 1JJGA 4A3EG 3ULPA 3G7LA 5D3IB 5I9PA 4XTCS 3G6EA 4X62L 1X32A 1GO3E 1HRJA 2HDMA 1G2SA 5M5WB 4X3TA 5A35A 1TWFH 1JOOA 4A93B 3FHWA 4NKLA 4DV3Q 3CXCA 5BN3A 5CV8A 2ENBA 1A0IA 2Z6BA 1QB5D 3GTLB 3I4MB 3MWYW 1RCVD 3D4WA 4DUZQ 4UP9A 4G4KA 2NVQH 5C44B 3BZDB 4EGVA 2EXZA 3CPFA 4GN4B 5J39A 3J7A5 4A3CH 1AE3A 4DK0A 1DCZA 4JI0L 5C4XH 3PUXA 5AJ3Q 1FYCA 2KENA 2Y0SB 3AEVA 3HOWH 3OWFA 4B9WA 5IP9G 2GVAA 2B2YA 1FR3A 4R1JA 4GKJL 4X3SA 1MI2A 4DUYQ 4NXMQ 1JWMD 1YHAA 4HR7B 2NVXB 1UE5A 3OYYA 1B53A 4YCWA 1TQOA 4ME3A 1ESFA 2K5HA 2D62A 3MVVA 4BBSB 1TVXA 2MHVA 3I4MG 4P2CB 4YWKA 3HOXB 1SMYD 1YBYA 2AUKA 5E3FA 4DR5L 1KC8C 3KDFA 4IUTA 4NPSA 2F0JA 2EJGC 1YVCA 4B3RL 1F2ZA 2V4DA 1PTOC 1TY0A 4KY7A 4CDDC 4A3EH 3GTQH 4KD3A 3CC7A 1NUCA 2QEXA 1SN8A 4XQJA 2X69A 5KYLA 1EY0A 4BY1G 1PFNA 3H91A 2J4XA 1BUVT 4ZRZA 1Q1BA 3F2CA 3QG1A 3FP9A 3M3YB 5M3MB 4IOCA 3S2DH 4PV1C 4A3BG 2VS1A 3G48A 5A2QL 2MP1A 4GLVB 2EY1A 3P1HA 2GVBA 2WB1B 2PZWA 3BVMA 1UE6A 2LXKA 4RCOA 5EBDA 4HIMA 2VUMG 4A3GG 2B2UA 2G9DA 1RKNA 1F9SA 2WFWA 1FD7D 5KEEA 2DNCA 5AFWA 4A3CG 1PLFA 3VR2A 2CCZA 3BJUA 1XTDA 3GP7A 1I4XA 1SNOA 4IQZA 1VQBA 4IFDH 1JWUD 3M4YA 2MO1A 1H9MA 3S14H 4IFDJ 4HJ8A 2ZJRA 4LF7Q 3L9AX 4GN3B 4LFBL 2F0WA 4DR6Q 4PMBA 3DMUA 2L9HA 4AH6A 3R93A 4EQNA 5C4XG 1U4PA 1EIYB 1JMCA 4JV5Q 2ZTCA 4ODGA 4DV7L 3PSIA 3A74A 3B6YA 3DWPA 2UXBQ 1E3PA 3PO3B 3I4MH 1UUPA 3M3YH 1YEZA 4Z9CB 3BG3A 5LHY1 1ENCA 3R3OA 3Q24A 1O7ZA 1EY6A 1N36L 1ONLA 2CFMA 5FLXL 4UDUC 2ES2A 1Z6HA 4BA1I 3RLOA 4R4OA 2QKIC 2Z6KA 3UDFA 2F0SA 3HOZB 2F4IA 5FO8B 4B3RQ 3M4OB 3DEOA 1M1KC 2B2TA 3EJIA 5KYIA 5M3FH 5IWAQ 1JE5A 4B3ML 2KQ3A 3SK4A 3MAQA 2I5LX 1TWFB 4A3LH 1K3RA 1WTWA 4LF4Q 4DAYA 5M5WH 1A2TA 4K6LA 1XPOA 1CKMA 1JOQA 4IOAA 3S15B 3NUCA 4NMZA 1IBKQ 1LTID 4A93G 1GHKA 4JI8L 4C2MB 4LWCA 1VQAA 4JW0A 4C3IB 1H9SA 2EQSA 1EY7A 1PTOF 1OXSC 2CQAA 4CDCC 2DY7A 3VYUA 2IX1A 4O0AA 1I4QA 4DV3L 4V190 4JI1L 1LT4D 4DV5Q 3I56A 1VQKA 1E2VA 4OX9Q 5G3LF 4R8IA 5DNFA 3TS2A 5T1IA 4LF9Q 3PUZA 1BOSA 1LO5D 2B29A 5HURA 2N49A 2A69C 3FDTA 1C9OA 4ZYSA 4A3BH 4BBRB 2D5DA 5GROA 2N78A 1FGBD 2F0EA 1B3AA 1FNWA 1GVPA 5FLMH 3DLLA 4POFA 5C3EG 3S17B 3S1RH 3A56A 1F9RA 1WVLA 5C6AA 5FK9C 1B9MA 3ICEA 4J1MA 4R4IA 2K5NA 3CKIB 5CV4A 3GQBA 1LM0A 5IGGA 2NZ1D 3VR4A 1PZJD 3T1HL 4X66Q 1ZXTA 1MJEA 1VMPA 3PQIA 4RG1A 1N9WA 2ZJPA 1R9TB 3HKZE 1BNZA 1NTGA 1VQFA 3BYTB 3JAME 5COYA 1CK1A 3Q23A 1HA6A 1EWCA 2OEOA 2PQEA 1QUQA 4M1UB 3K7AB 1D2BA 1SE3A 1KAWA 3C46A 4JOIC 2D0OA 4JI7L 1KXLA 2PW5A 3T1YQ 1MD2D 3BDCA 4IZ8A 4HN7A 2Q2IA 1NE3A 2EYJA 4WORA 2R92B 1MJCA 3UI2A 2XWBB 5IYCG 1X65A 5C44G 2SEBD 1IBML 1G291 2BE5C 3NTIA 4HEDA 1C0AA 3I4LA 5C4JH 3TEHB 2EYOA 4YY3Q 2ZM6Q 3HP3A 3BU2A 2PZUA 2KHIA 3S9WA 2KVMA 3PF5A 3PUVA 1NY4A 1IBKL 1NSNS 3VDYA 1F9QA 1NMFA 3HOXG 3RZOB 2QW7A 2L0CA 1RF2D 2R92H 1QNKA 3KF8B 1TS5A 1ASZA 2VNUD 2E74C 4R4QA 1PRTC 3EVQA 1QOHA 5M5XB 2A73B 3RUZA 1QILA 2L1BA 1QVCA 2IHEA 2AWNA 2DJFC 4BY1H 3CU7A 3I7FA 1WTOA 1WTPA 2JA6G 1JE4A 3K5NA 2HHHQ 3KOJA 3E9HA 3TP8A 2JK8A 3HOVB 2ZM6L 1CQVA 1TIID 5JJIA 4CBVA 4Q0FA 2NWGA 1VQ4A 1GUWA 4APVA 1AW7A 5FJ8H 4DR2L 4LF5L 4K2KA 4H7BA 2XVSA 4DR3Q 1WYDA 1Y1VG 2PQAB 4A75A 2WIIB 3OMGA 1PH5A 2DUDA 2IY5B 3QWNA 4LF8L 1RL2A 2N55A 2PMZE 4JI0Q 5CV9A 3W1BA 2DGYA 3KF6B 4RKBA 5C4JB 1E22A 3RZDB 4WJ3M 3GDEA 4C3IG 1Y14B 1SROA 4PZ6A 4JI1Q 1STYA 1D1KA 1STHA 4DR2Q 4LF5Q 1MHWC 3BZCA 4P73A 5F2DA 1I94Q 1JWSD 3JAML 2HUGA 4R9WA 2VY3A 3S1RB 5KRUA 3FVQA 3CW2C 2JSOA 1OXTA 5BR8L 2JA7H 2K05A 2F0LA 4XYQA 1XNQL 2Z0SA 3L7ZC 2R93H 3SK6A 5ELBA 4GS3A 2B63B 1K8MA 4P75A 4QUFA 2R7FA 3SK5A 3G71A 5EPJA 4F8MA 2E8GA 1BCPF 3C2PA 2F0HA 2A6EC 1Y1WH 1TWHB 2KCTA 1IXRA 2A69D 4IJLA 3FRPB 4WJWA 1CUKA 2WB1G 1AP0A 4DV6Q 1SEBD 2MFIA 3X3MA 4DGZA 5ISRA 5FLXE 2JA7B 1H9KA 1D5XC 3PGZA 2GN5A 4QB4A 4A3IG 3G6JB 2M9VA 1PH9A 4QUCA 3OIPA 1WFQA 3PMFA 4PZ8A 1ENFA 2PCFB 2KCCA 2WKDA 2F0NA 4A3FG 3GTOB 1V1QA 3C1FA 2UUBQ 1RTNA 2A19A 3PO3H 2OCEA 1SNQA 4XT3B 1RJTA 1S5ED 4K8JA 4C3HH 2EY5A 3QOJA 5EKIA 4JCVE 4HMIA 5CV5A 3V05A 2Y0SE 1AEXA 2XTIA 1TT2A 2NVYB 2WINB 2EYFA 4FNFA 1U4RA 4OWWB 4GKKQ 1J8IA 3HEJA 2VUMB 2RSNA 2RQXA 3KJOA 1C8CA 3I8ZA 3J80E 1L1OA 1KDBA 1KLUD 4XQNA 2MQHA 4IPDA 4DF7A 2FINB 1UEAB 2BDNA 2RCFA 1JOKA 4HSPA 5JEAG 1PVOA 4P72A 1HNXL 2K52A 5EAYA 3AYHB 3RMHA 1XMQQ 2DN8A 3NBHA 4PMWA 2A6ED 5IWAL 4KN4C 2AKWB 4A3MH 4IJHA 1EIHA 2EYMA 5EGTA 1ZYRD 1X9NA 3PO2H 4C3JH 5IY0A 2YU9B 3TP6A 3M4OH 1S40A 4KJNA 3X3NA 2FMMA 1Z47A 2Q8IB 4MIUA 3I90A 4LF7L 1X3GA 1N34L 3DUZA 1VQDA 1XWEA 2A5HA 2RHSB 4JI6Q 1S3OA 1JICA 4FXDA 1IKMA 1EIFA 1EY9A 4K0KQ 1F77A 1O7LA 2YYZA 5JPNC 4NXNL 1DONA 2B2VA 2XRSD 1S5FD 5CC4A 4KMUC 1K8AC 4DNIA 5GADC 1RD9D 2VZAA 3FKIH 1SYGA 3RZOH 1KDCA 3AFPA 4AYBG 2ZTEA 3J81c 3CCEA 3U9OA 3P7JA 2XGTA 2JEAI 4KKSA 4NP5A 2CWPA 1GKHA 1HQRD 4B3TL 1GD7A 4TSSA 3HOYG 2JJQA 5J22A 1A62A 2SDFA 2RSOA 5ELEA 1HNZQ 3S24A 1E2ZA 4DR4L 4WJ4A 1EQRA 5IYBH 4BY1B 1IBMQ 5C0XG 1VQLA 4DAMA 1M90C 4X62Q 1KRTA 3GTGB 3A8IE 2ASBA 1TWGB 4QIWB 3SXHA 4L5RC 4NXNQ 3IL8A 5JEAJ 2UXBL 1G6PA 1HUMA 1FVIA 2VUMH 1D5MC 2YU9H 1DD2A 3HOXH 1KLGD 1HHVA 4DAPA 1V8QA 2I0QA 2F0VA 2VL6A 5C4ZA 4MZ9A 4K5VA 3BDOA 3SVMA 2OT2A 3EBEA 4RGMA 2QF7A 3IRBA 2ID0A 1WTRA 2UXCL 5C44H 3K7UC 1SNCA 4CDFC 2OWOA 1AZQA 3NQIA 1S5BD 5HGQA 3I2ZA 1VF5C 1HNXQ 3VR6A 3D4DA 1HNWQ 5JOBA 3FKIB 2ICIA 3AB9A 5E7NA 1B70B 1LTAD 3HS0C 5IYBG 4X6AH 3SGIA 1QZGA 1SDFA 4A3JB 2C35B 3LGJA 2B2UC 2H1EA 4FF4A 2R93B 1BCPD 4HJAA 1JR0D 1UEBA 1NAPA 3URYA 3IAYA 2AMCB 3A8JE 1AN8A 1HPCA 2F0QA 2EJFC 3CRKC 2O2LD 3SEBA 1BDOA 3BS1A 4NXML 3QO2A 2SOBA 4A3DH 1EYDA 3HRZC 1O7YA 3R8BA 1KDAA 5CR3A 4LFCL 1HR0W 1A3UA 4GZYC 1L1OB 1Y8OB 1AZPA 5C0XI 3A8KE 2PI2A 2ZXOA 4EQPA 2XNAC 1I4RA 1BVSA 2Z8LA 1VQ8A 1X56A 5CORA 1YHQA 4OO1I 2WAQB 1GXDC 4H0LC 1BBWA 1XNRL 4LFAQ 1JT8A 1PTOH 4DXFA 4YY3L 1EOTA 1SE4A 4OWTB 1SYEA 1X3EA 1XXGA 4AIMA 2XN9C 4A3LG 2VQEQ 1CA6A 4MNOA 4S3SA 2JP1A 1LTTD 4YWLA 4DN4M 4RA8A 5E1FA 5KGUA 3CP0A 1YNND 1PYSB 3WOEA 4LMQD 3RN2A 1CQFA 1OXUA 2YTVA 4LF4L 2NN6I 4R4TA 2H5XA 2A6HC 1WTVA 2UUCL 3HOZG 1IW7C 4KKUA 2UXCQ 4JOIA 4ID6A 3H3VH 3H3VI 1LT6D 3LWUA 2KEEA 1J6QA 3HOYB 5GAGC 1QUQB 1FJGL 3KYHC 1ASYA 1PDQA 2BH2A 1HTPA 2AQ3B 4CJ2C 4GKJQ 1H9SB 1LTRD 4CJ1B 2A1AA 4JK1C 2XWJB 1CTMA 3PUYA 4FYDA 5ELOA 4FVMA 4DUYL 3S1MB 1I6HH 4J8QA 3D3RA 1Y1VB 3FPPA 1Q90A 3MXUA 2RKSA 5FOBB 4ZUIA 4QMGA 4DV0L 2E76C 1BCPB 3U58A 2WB1E 3PF4A 2HIVA 5IYCH 3I70A 2Q8RE 1QWYA 2BE5D 4GOPA 1PYBA 2KEDA 1A8VA 4I7ZC 4CKCA 1O78A 3E3XA 4N8FA 4OONA 2JA6B 1PA6A 2Z6KC 3SDZA 5CBEE 5LMUL 1UWVA 4FO2A 1CKNB 4C3JG 3CCSA 4DV2Q 5ELDA 1G91A 5DLQE 4OL7A 4A3JG 4A3IH 1NJIC 4PZ7A 3T16A 3LNNA 4BY7G 4LAAA 4C1NK 2R7DA 4I7AA 4CKEA 2N8NA 1I4GA 1WJJA 5CV6A 1HH2P 4IN3A 4KKTA 1TWGH 1EY4A 3HOUG 4I65A 2Z4HA 1C4QA 2K14A 1ML0D 2A8VA 3IFTA 5CV7A 1VQ9A 1GUSA 2F0PA 1XYIA 2XSCA 2CWAA 5KNDA 2EZVA 3QB3A 2M2LA 2K5WA 2IX3A 1ZKOA 5M9OA 3MEFA 3ZYYX 4IALA 4U68A 4A3EB 3HOVG 5ELCA 4C56C 1VQEA 3S1QB 4ZKBB 1IL2A 1CKOA 4K2LA 1IZ6A 1K73C 4LJZC 5J3BA 5IE8A 2O4XA 2LXJA 4UY8C 1JORA 2EYPA 2CW0C 2J0TD 4JI3Q 2M00A 1E7ZA 1EWHA 1MGSA 2X6LA 1YNXA 3ND8A 4ULLA 3KK7A 5IT9E 1LUZA 2K5DA 1EYGA 1Q12A 1NBWA 4RGTA 3U50C 1N33Q 1T5XD 2JA8H 4DR7L 3NBIA 4EX5A 4HJ7A 4DUZL 4IO9A 1T9HA 4ZK9B 5C3EB 3GTOH 3R2TA 1LACA 1SYBA 1B9NA 4H13C 2KHJA 1W6KA 4OX9L 2CH4W 5EQ0A 3BZKA 1HZBA 3AQQA 4JBMA 4ZLTF 4TVAB 2RDFA 1W2BA 2KECA 2FFKB 3OW7A 2NBFA 3HGBA 1IKLA 2JE6I 3OTOQ 2VXWA 2I5HA 3NWTA 3GTJB 4Q5VA 3TQYA 4RH6A 1EIGA 1VQMA 1OO9B 1TR5A 3NSWA 1I4HA 2L12A 5I6WA 3AFQA 4QF4A 2NTSA 1STNA 2F4VQ 3J7ZC 2EE1A 4OXPA 4RKLA 2WV6D 1VCIA 3I4NB 4L5QA 1VQ5A 1Y69U 4J6HA 3TREA 4JI7Q 1KQSA 1C7YA 2DNEA 3CMAA 1PH4A 1S5DD 1SYCA 4L5SA 5EPKA 1XJVA 3PCOB 3ER0A 4C3IH 3NXWA 2K32A 1ILQA 4BY7H 4KJOA 5JJZA 5FKAC 2L15A 3W3AA 4ZUJA 5K5PA 4UP7A 4O1NA 4JVZA 2LFNA 1EY8A 1RIPA 5DEHA 1BF4A 4JBJA 4HIKA 2EOTA 2FMCA 2B39A 1ENAA 4HJ5A 1HZ9A 1WCMB 1PZID 2A6HD 3CCUA 2I46A 2IPKD 2R3ZA 1GHJA 5M5YH 2HCCA 2O5JC 4JG2A 1CZWA 2B2YC 3PUWA 1K3BC 4H02A 1K8GA 3U4VA 1TS3A 2CH4A 1EQQA 1UAPA 2K7VA 3T4AC 1I50B 1D7QA 2JA9A 1PYWD 1KHIA 4R8NA 2UUAL 2EY6A 5IIFA 2A68D 1SRUA 3RN5A 5IOCA 1PV4A 4KHPQ 3TZDA 2LMCB 2OTJA 1LT5D 4FDBA 3S1NH 1STBA 1VMCA 2YV5A 1E24A 1KNAA 2RHQB 2UXDL 4IFDG 3A54A 2C9OA 4LF8Q 4CHTB 1Z7TA 4G7OC 3EN2A 1IL8A 1LYLA 5JVH3 4DR1L 3V2TA 5H1SE 1K0SA 4DR6L 1YNJC 2PPBC 1TS2A 2A68C 1ET9A 2ZTDA 4F87A 1HTLD 3K0XA 1H95A 4GN5A 4Y7NH 4RGOS 2QEJC 1YI2A 3M7NA 4JI4Q 1IYJB 4GLXA 3S16H 1J5EQ 1UE7A 2CVRA 2L4NA 2ZXPA 4PQXA 3GTPB 3ND9A 2E2JB 1CZGA 2F0KA 1CT1D 4O2DA 1BBUA 2PYKA 3K57A 1EQTA 2F0UA 4QY7A 1DOMA 2AQ1B 1HR0L 3J81L 1SSOA 3UE1A 1R4QB 1E1TA 1SFOB 2ZJQA 1KIXA 5IYDH 1MSHA 4GNXC 4POGA 1MKHA 1SE8A 1C48A 4ABNA 4GKKL 4H44C 4X3KA 4RGNA 1X3PA 3GTMH 2HDLA 3RLNA 3ZJYC 1N34Q 1K83H 1XNQQ 2P5ZX 4C3HB 3J7AF 1Q8KA 3GO5A 4QL5A 3S1NB 2JA7G 2FJ2A 1BR9A 1WCMG 2ZXRA 5M5XH 3UDGA 4MN3A 1V1OA 2UU9Q 5IP7G 4K8IA 5I9OA 1HCZA 1TWAH 2TMPA 3HOWB 2RF4A 2JA6H 5IP9H 2ICEC 3M85A 4BA2I 3K81C 2VW9A 1HNZL 4JC0A 1JC7A 2E5LQ 1EU3A 4UPAA 5I2XA 1YNNC 4DXGA 1P16A 3TRZA 1CSQA 4IPHA 1KRSA 3VYSA 2JA5B 1BO0A 1RDPD 4X64Q 1AE2A 3CHBD 2VB2X 3CRLC 3F8TA 4L63B 3HOYH 1PFSA 4OHJA 1PRTD 2B2VC 4ZQ3A 1D1IA 1SXTA 2SNSA 1HZAA 2HIXA 2NVQB 3NK9A 2AQ2B 3U4ZA 1Q46A 3S2HH 1PHJA 1U0LA 1VF7A 4HJ9A 1K9MC 4A93H 3HKZG 4NW2A 3WDNA 4IUVA 3OW2A 4JI5L 5L37A 3PIP3 1FL0A 2Q2TA 4CKBA 4P74A
chains in the Genus database with same CATH topology
1WD1A 3TDQA 5FO9B 5IGDA 4HCEA 1JB3A 1M8AA 4KTAA 1K8OA 2EYHA 5IGFA 5KNBA 3K58A 2VB3X 1TKWB 3I73A 3MTSA 2IW3A 1GJXA 4WRDA 5IODA 2E2DC 4IURA 5IGBA 1VDZA 2L55A 3ITPA 2EVBA 4M8AA 4RHSA 2MPMA 2F0OA 3MXNA 1V1PA 3N52A 3SK8A 1LLRD 3MFYA 5M3FB 3OWEB 4HCSA 5C5MA 3NWSA 2D2CC 3SR1A 4C3HG 1F2MA 4ZKCB 1WTXA 2B2WC 1HA5A 1DXMA 1PRTB 4XDXA 4OIKA 3RD4A 3NE5B 3HOUB 2B2TC 1GUNA 1JQYD 2O5IC 5T1GA 5EPLA 1LV9A 1SBBB 1QE6A 1TWAB 3GV6A 1NR4A 1DJRD 2NVTB 2RVLA 1DM0B 1XX8A 3OHXC 3MEHA 2IWHA 1LABA 5E4WC 3ERQA 3S2HB 1V1PB 1EQVA 4RAUC 1SNPA 3VYRA 1B50A 3BYYB 4AYBB 2E2IB 1YNJD 1LT3D 1J9OA 2A74C 5E4XA 4B9XA 1CHQD 1SE2A 4DU9A 3GTQB 3H94A 4RWSC 4IUUA 5HGTA 3TP7A 3K5MA 3PIO3 2R61A 1CFMA 1X3QA 3E5SA 1FNVA 4KY6A 5IGCA 4JBWA 4KV6A 3H6MA 2PZTA 2PNRC 2QCPX 1EYCA 3TBIB 3GTMB 1G6ZA 1GUOA 3MFGA 1MBYA 1PTOD 1JCKB 1G8ZD 5FO7B 4IUQA 5D14A 2FHTA 1CI3M 4XT1B 1A3TA 4HSVA 4DNTB 5K36G 2SNMA 1RTOA 2F1MA 2BA0A 2I07B 1E0BA 3H09A 4HTHA 1V43A 2H4OA 2K01A 3LWEA 3OSOA 3NPPA 2DY8A 1HUNA 4A3BB 5CMDA 3GTKB 5LL6X 3H3VC 2WACA 3NTKA 2NB0A 3EA6A 2JXMB 1S4ZA 3I91A 1ZYRC 4Y7NB 2EDGA 5J1ZA 3MA2B 2B8FA 1I4PA 1W6JA 2EY2A 3TSSA 4FXKC 1PXUA 2QDBA 3NQTA 2G9HD 3HG9A 3S16B 2GA4B 1EYAA 2XRQD 3DEPA 1ZEQX 5KNCA 5EKLA 1STGA 3HZXA 2HCIA 3AMUA 3I3CA 1F2LA 2IL8A 1HQMC 3WOFA 3DM1A 1GUTA 5G3LD 1SYDA 4ILWA 5CGKA 4OGQC 1KAAA 2LKVA 2K33A 1QJOA 1ILPA 4EQOA 3W2DA 5NUCA 1A6XA 3KBGA 1DZ1A 3PV0A 3H0GB 1SJHD 4K5XA 4BS9A 1EEID 2Q8TA 1TY2A 1U4MA 2XIWA 2BA1A 2N88A 3QIAA 1B2TA 3DWQA 1DOLA 1EFID 1QNUA 4CJ0B 1BQQT 1BXTA 2KJXA 5I4DA 4N9TA 3T53B 3GV3A 1F2YA 4OO1G 3I72A 3FEWX 4DNRB 1PMRA 1CA5A 3GD7A 4WFN3 2TSSA 3EFXD 1U9RA 2OF1A 1R4PB 1AFPA 4KK7A 3J80L 5D3DA 4FP5D 5BN4A 3EQLC 4K5WA 5C3WA 3F2UA 3P75A 4A3KB 1D5ZC 4L8JA 3D6WA 1SNDA 3E0JA 4G7ZC 1RODA 3J7YW 5EKKA 1F9PA 1KTKA 1Q1EA 3OIQA 5JPMC 3TMEA 4A3DB 3R2IA 3IFDA 3TN2A 3EROA 1K83B 5BN5A 3TP5A 1B44D 1PZKD 3RLFA 3BVZA 4U673 3KUPA 5DM73 4L6TB 2E2HB 2EYLA 2EPBA 1CM9A 2B8GA 1SMYC 4XQQA 3LX0A 3M7GA 1GUGA 4K6DA 3Q22A 2C5CA 1II3A 4UAIA 4YIJA 4C3JB 1MSGA 2F0MA 2F0DA 3KLSA 5JVG3 1OXXK 5EBCA 2OXPA 1B4OA 4PMCA 2ZT9C 1G2TA 2Z4IA 1E2WA 2JEBI 2KUMA 5JEAH 4RCNA 1EZ6A 1PFMA 3NP8A 3MHBA 2F0IA 4DK1A 3K6OA 2NYZD 3QJYA 4O42A 4KN7C 2LY7A 2K6AA 2RDHA 3J81E 1Y8NB 4XYOA 1QCBD 2NUCA 2RBMA 2HQEA 3AU7A 4HMJA 2L11A 1EY5A 4XIGS 3A7AB 4ME5A 5IGEA 3K5LA 3NTHA 4TRDA 3KF8A 2MUYA 3QOLA 4RHRA 4TKOB 4BY7B 4XXEA 3MC0B 4QCLA 3SHLA 1SJED 4A3GB 2MJ8A 3DHQA 2PW7A 1U4LA 1PTOB 3KLRA 1A3VA 2KOLA 1H9JA 3D4RA 5M5YB 3BDLA 1QG7A 2B2WA 1EZ8A 4FF1A 4IUPA 4ZAIA 1SYFA 2J7ZA 5CYUA 3BVGA 3P20A 2KA7A 2E75C 5DM63 2LS01 2NTTA 4MHEA 4NDXA 4B08A 2Z1CA 1SAPA 4CGYB 4HAEA 4DA2A 3D6CA 2MGSA 2QILA 3KLSX 3FMCA 4G7HC 3NHHA 4N9PA 5DAUA 1ET6A 1Y8PB 1A15A 3D8GA 4C1NI 1DYQA 1STEA 5CBAE 3A7LA 1TWCB 1BBXC 1B1ZA 5JAVA 2F3VA 1IW7D 3A55A 1A2UA 4KHZA 1KABA 1TS4A 3KBXA 1ICWA 2PO4A 3OOCA 4F88A 3MZ5A 2WP8J 3VA7A 1IYVA 1HFGA 2K5QA 4FF3A 4DAVA 1DOKA 4IFDI 3SE0A 4OO1H 4A3FB 4K14A 1Q8IA 3ONAB 5D65A 2KHSA 3O13A 2NN6H 5C4HA 1UNSA 1M4VA 2F0FA 1HXYD 1IHZA 1WTQA 2R7ZB 1PRTF 4FXGC 4OIJA 4FF2A 2RA4A 2X6GA 3MXPA 1KNEA 3DWAA 2JA8B 4G57A 2CHBD 4KD4A 5K36H 2RDGA 1BCPC 1S5CD 5TSSA 1NR2A 4A3MB 5C3XA 1EEFD 3L3OC 3C1EA 3CQZB 3OMCA 3K5OA 4RFBA 3S2DB 2EJMA 3S14B 4KHVA 5I2YA 1RHPA 2CW0D 2IX0A 2WKCA 4KY5A 1I6HB 3D31A 4DFAA 3E6ZX 1Q3LA 3VYTA 4A3IB 1GOZA 2PMZB 3FPUB 3PO2B 3VR5A 1STAA 1LTSD 3HKZB 2BOSA 2K04A 3T51B 1ESRA 2AWOA 3T13A 2F03A 1H9RA 4KI0A 1NCVA 5C0XJ 1FNUA 2BDOA 1HFNA 2K28A 1EU4A 4X3UA 2IJ0A 4LK1C 3N6RA 4BWGB 3U9SA 2L5TA 1CHPD 4EVOA 5LL6S 3C3LA 1SNMA 3OPOA 3K59A 2IT1A 5C0XH 1WD0A 5ELFA 3TZUA 3DXJC 3V96A 5KIXA 3J7AV 2R6GA 1IYUA 4F7XA 1Y1WB 1EL0A 1TU2B 2NN6G 2AUJD 3MXGA 3VA5A 3K0YA 4IUNA 2F0GA 5C4XB 2K1BA 2K03A 4PNYA 1I3QB 3Q6SA 1I6VC 1L0YB 1T5EA 2BCOA 3T56B 5I6YA 5IT9L 2F0TA 1XTCD 1L0XB 1LTGD 2KCNA 1LTBD 1D6EC 5A2QE 4E6IA 3VR3A 3IKJA 1O80A 5C5LA 4V0BA 2JYOA 1OXVA 2F3WA 1PFBA 3Q0AA 4TQUS 2D9UA 5EJWA 3G7LA 5D3IB 5I9PA 4XTCS 1X32A 1HRJA 2HDMA 1G2SA 5M5WB 4X3TA 5A35A 1JOOA 4A93B 4NKLA 5BN3A 5CV8A 2ENBA 1QB5D 3GTLB 3I4MB 3MWYW 1RCVD 3D4WA 4G4KA 5C44B 3BZDB 4EGVA 2EXZA 5J39A 4DK0A 1DCZA 3PUXA 1FYCA 2Y0SB 3OWFA 4B9WA 2B2YA 1FR3A 4X3SA 1MI2A 1JWMD 4HR7B 2NVXB 1B53A 1TQOA 1ESFA 3MVVA 2D62A 4BBSB 1TVXA 2MHVA 4P2CB 3HOXB 1SMYD 2AUKA 5E3FA 4IUTA 2F0JA 2EJGC 1F2ZA 2V4DA 1PTOC 1TY0A 4KY7A 4KD3A 1NUCA 4XQJA 2X69A 5KYLA 1EY0A 1PFNA 3H91A 2J4XA 1BUVT 4ZRZA 1Q1BA 3QG1A 3M3YB 5M3MB 4PV1C 5A2QL 2MP1A 2EY1A 3P1HA 2WB1B 2PZWA 3BVMA 4RCOA 5EBDA 2B2UA 2G9DA 1RKNA 1F9SA 1FD7D 5KEEA 2DNCA 5AFWA 1PLFA 3VR2A 3GP7A 1I4XA 1SNOA 4IQZA 4IFDH 1JWUD 3M4YA 4IFDJ 1H9MA 3L9AX 2F0WA 4PMBA 3DMUA 2L9HA 3R93A 4EQNA 1U4PA 4ODGA 3DWPA 3PO3B 1UUPA 4Z9CB 3BG3A 5LHY1 1ENCA 3R3OA 3Q24A 1O7ZA 1EY6A 1ONLA 5FLXL 4UDUC 1Z6HA 4BA1I 2QKIC 2F0SA 3HOZB 2F4IA 5FO8B 3M4OB 3DEOA 2B2TA 3EJIA 5KYIA 2KQ3A 3SK4A 3MAQA 1TWFB 1WTWA 4DAYA 1A2TA 4K6LA 1JOQA 3S15B 3NUCA 4NMZA 1LTID 1GHKA 4C2MB 4C3IB 1H9SA 1EY7A 1PTOF 1OXSC 2CQAA 2DY7A 3VYUA 2IX1A 1I4QA 4V190 1LT4D 1E2VA 5G3LF 4R8IA 5DNFA 5T1IA 3PUZA 1BOSA 1LO5D 5HURA 2A69C 3FDTA 4ZYSA 4BBRB 2D5DA 1FGBD 2F0EA 1B3AA 1FNWA 3S17B 3A56A 1F9RA 1WVLA 5C6AA 5FK9C 1B9MA 4J1MA 3CKIB 5CV4A 3GQBA 5IGGA 2NZ1D 3VR4A 1PZJD 1ZXTA 1VMPA 1R9TB 1BNZA 3BYTB 3JAME 5COYA 1CK1A 3Q23A 1HA6A 1EWCA 2OEOA 2PQEA 4M1UB 3K7AB 1D2BA 1SE3A 3C46A 2PW5A 1MD2D 3BDCA 4IZ8A 4HN7A 2EYJA 2R92B 4WORA 3UI2A 2XWBB 2SEBD 1G291 2BE5C 3NTIA 4HEDA 3I4LA 2EYOA 3HP3A 2PZUA 3S9WA 2KVMA 3PUVA 1NSNS 1F9QA 3RZOB 2L0CA 1RF2D 1QNKA 1TS5A 2VNUD 2E74C 1PRTC 3EVQA 5M5XB 1QOHA 2A73B 3RUZA 1QILA 2L1BA 2AWNA 3CU7A 1WTOA 1WTPA 1JE4A 3K5NA 3TP8A 3HOVB 1CQVA 1TIID 4CBVA 4Q0FA 2NWGA 1GUWA 1AW7A 4K2KA 4H7BA 2XVSA 2WIIB 3OMGA 3QWNA 2N55A 5CV9A 4RKBA 5C4JB 3RZDB 4C3IG 1STYA 1D1KA 1STHA 5F2DA 1JWSD 3JAML 2HUGA 4R9WA 3S1RB 5KRUA 3FVQA 2JSOA 1OXTA 2K05A 2F0LA 4XYQA 3L7ZC 3SK6A 5ELBA 2B63B 1K8MA 4QUFA 3SK5A 5EPJA 4F8MA 1BCPF 3C2PA 2F0HA 2A6EC 1TWHB 2A69D 3FRPB 4WJWA 1AP0A 1SEBD 4DGZA 5ISRA 3X3MA 5FLXE 2JA7B 1H9KA 1D5XC 4QB4A 3G6JB 2M9VA 4QUCA 3OIPA 3PMFA 1ENFA 2PCFB 2KCCA 2WKDA 2F0NA 3GTOB 3C1FA 1RTNA 1SNQA 4XT3B 1RJTA 1S5ED 4K8JA 2EY5A 3QOJA 5EKIA 4HMIA 5CV5A 3V05A 1AEXA 1TT2A 2NVYB 2WINB 2EYFA 4FNFA 1U4RA 1J8IA 3HEJA 2VUMB 2RSNA 2RQXA 1C8CA 3I8ZA 3J80E 1KDBA 1KLUD 4XQNA 4DF7A 2FINB 1UEAB 2BDNA 1JOKA 4HSPA 5JEAG 3RMHA 2DN8A 3NBHA 4PMWA 2A6ED 4KN4C 1EIHA 2EYMA 5EGTA 1ZYRD 2YU9B 3TP6A 4KJNA 3X3NA 2FMMA 1Z47A 2Q8IB 4MIUA 3I90A 3DUZA 1XWEA 2A5HA 4FXDA 1JICA 1IKMA 1EY9A 1F77A 1O7LA 2YYZA 5JPNC 1DONA 2B2VA 2XRSD 1S5FD 5CC4A 4KMUC 1RD9D 1SYGA 1KDCA 3U9OA 3P7JA 2JEAI 4KKSA 4NP5A 1HQRD 4TSSA 5J22A 2SDFA 2RSOA 5ELEA 1E2ZA 4BY1B 5C0XG 3GTGB 3A8IE 1TWGB 4QIWB 3SXHA 3IL8A 5JEAJ 1HUMA 1D5MC 1DD2A 1KLGD 1HHVA 4DAPA 1V8QA 2F0VA 5C4ZA 4K5VA 3BDOA 3SVMA 4RGMA 2OT2A 2QF7A 2ID0A 1WTRA 1SNCA 1AZQA 3NQIA 1S5BD 1VF5C 3VR6A 3D4DA 5JOBA 3FKIB 2ICIA 3AB9A 1LTAD 3HS0C 1SDFA 4A3JB 2B2UC 2H1EA 4FF4A 2R93B 1BCPD 1JR0D 1NAPA 3URYA 3IAYA 3A8JE 1AN8A 1HPCA 2F0QA 2EJFC 3CRKC 2O2LD 3SEBA 1BDOA 3BS1A 3QO2A 2SOBA 1EYDA 3HRZC 1O7YA 3R8BA 1KDAA 5CR3A 1A3UA 4GZYC 1Y8OB 1AZPA 5C0XI 3A8KE 2ZXOA 4EQPA 2XNAC 1I4RA 2Z8LA 5CORA 4OO1I 2WAQB 1GXDC 4H0LC 1PTOH 4DXFA 1EOTA 1SE4A 1SYEA 1XXGA 2XN9C 1CA6A 4S3SA 2JP1A 1LTTD 4DN4M 5KGUA 4RA8A 5E1FA 1YNND 3WOEA 4LMQD 1CQFA 1OXUA 2NN6I 2A6HC 1WTVA 1IW7C 4KKUA 4ID6A 1LT6D 3LWUA 2KEEA 3HOYB 1PDQA 1HTPA 2AQ3B 4CJ2C 1H9SB 1LTRD 4CJ1B 4JK1C 2XWJB 1CTMA 3PUYA 4FYDA 4FVMA 3S1MB 4J8QA 3D3RA 1Y1VB 3FPPA 1Q90A 3MXUA 2RKSA 5FOBB 4ZUIA 4QMGA 2E76C 1BCPB 3I70A 2Q8RE 1QWYA 2BE5D 2KEDA 4I7ZC 4CKCA 1O78A 2JA6B 3SDZA 5CBEE 4FO2A 4C3JG 5ELDA 1G91A 4OL7A 3T16A 3LNNA 4LAAA 4C1NK 4CKEA 1I4GA 5CV6A 4IN3A 4KKTA 1EY4A 4I65A 2Z4HA 1C4QA 1ML0D 3IFTA 5CV7A 1GUSA 2F0PA 1XYIA 2XSCA 5KNDA 2EZVA 3QB3A 2M2LA 2K5WA 2IX3A 1ZKOA 5M9OA 3ZYYX 4IALA 4U68A 4A3EB 5ELCA 4C56C 3S1QB 4ZKBB 4K2LA 4LJZC 2O4XA 1JORA 2EYPA 2CW0C 2J0TD 2M00A 1EWHA 1MGSA 2X6LA 4ULLA 3ND8A 3KK7A 5IT9E 2K5DA 1Q12A 4RGTA 1T5XD 3NBIA 4ZK9B 5C3EB 3R2TA 1LACA 1SYBA 1B9NA 4H13C 1W6KA 5EQ0A 4ZLTF 2RDFA 2KECA 2FFKB 3OW7A 2NBFA 3HGBA 1IKLA 2JE6I 2VXWA 3NWTA 3GTJB 4Q5VA 4RH6A 1EIGA 1OO9B 1TR5A 3NSWA 1I4HA 2L12A 5I6WA 4QF4A 2NTSA 1STNA 2EE1A 4RKLA 2WV6D 1VCIA 3I4NB 1Y69U 4J6HA 2DNEA 1S5DD 1SYCA 5EPKA 3NXWA 2K32A 1ILQA 4KJOA 5JJZA 5FKAC 3W3AA 4ZUJA 5K5PA 4O1NA 2LFNA 1EY8A 5DEHA 1BF4A 2EOTA 2FMCA 2B39A 1ENAA 1WCMB 1PZID 2A6HD 2I46A 2IPKD 2R3ZA 1GHJA 2HCCA 2O5JC 1CZWA 2B2YC 3PUWA 1TS3A 1UAPA 2K7VA 3T4AC 1I50B 1PYWD 4R8NA 2EY6A 5IIFA 2A68D 5IOCA 3TZDA 2LMCB 1LT5D 1STBA 1VMCA 1KNAA 4IFDG 3A54A 2C9OA 4CHTB 1Z7TA 4G7OC 1IL8A 5JVH3 3V2TA 1YNJC 2PPBC 1TS2A 2A68C 1ET9A 4F87A 1HTLD 4RGOS 2QEJC 3M7NA 2CVRA 2L4NA 2ZXPA 4PQXA 3GTPB 3ND9A 2E2JB 1CZGA 2F0KA 1CT1D 3K57A 2PYKA 1EQTA 2F0UA 1DOMA 2AQ1B 3J81L 1SSOA 1R4QB 1SFOB 1MSHA 1C48A 4ABNA 4H44C 4X3KA 4RGNA 1X3PA 2HDLA 4C3HB 3J7AF 3GO5A 3S1NB 2FJ2A 1BR9A 2ZXRA 4MN3A 1V1OA 4K8IA 5I9OA 1HCZA 2TMPA 3HOWB 2ICEC 3M85A 4BA2I 1JC7A 1EU3A 5I2XA 1YNNC 4DXGA 3VYSA 2JA5B 1BO0A 1RDPD 3CHBD 2VB2X 3CRLC 4L63B 4OHJA 1PRTD 2B2VC 4ZQ3A 1D1IA 1SXTA 2SNSA 2NVQB 3NK9A 2AQ2B 1VF7A 4NW2A 3WDNA 4IUVA 3PIP3 4CKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GXD C;  3CU7 A;  5JPN C;  1UAP A;  3CKI B;  2J0T D;  1BR9 A;  5FO9 B;  3MA2 B;  3L3O C;  3T4A C;  4FXG C;  2A74 C;  5FO7 B;  5FOB B;  1BUV T;  1BQQ T;  5JPM C;  1JB3 A;  2WII B;  2WIN B;  4FXK C;  2B39 A;  3HRZ C;  3I70 A;  2TMP A;  3OHX C;  3FRP B;  1PXU A;  3HS0 C;  2ICE C;  2XWB B;  1JC7 A;  3V96 A;  1OO9 B;  2I07 B;  2XWJ B;  2A73 B;  2QKI C;  1D2B A;  3KLS A;  2E2D C;  1XWE A;  4ILW A;  5FO8 B;  1UEA B;  3G6J B; 
#chains in the Genus database with same CATH topology
 1WD1 A;  2D0P A;  3TDQ A;  5FO9 B;  5IGD A;  2I5M X;  4HCE A;  1TXY A;  3W5O A;  1JB3 A;  3TS0 A;  4B3S Q;  4YHH Q;  1M8A A;  4KTA A;  4JI2 Q;  1K8O A;  2EYH A;  4QJF A;  5IGF A;  5KNB A;  3K58 A;  1WOC A;  2VB3 X;  3M4Q A;  1Z9F A;  1TKW B;  1V9P A;  3I73 A;  3MTS A;  2IW3 A;  1GJX A;  1TWH H;  4WRD A;  4LF6 L;  5IOD A;  1VQ7 A;  2E2D C;  4IUR A;  5IGB A;  1VDZ A;  4OWX B;  4JI6 L;  2L55 A;  3ITP A;  3JC6 6;  4A3K H;  2EVB A;  3M9B A;  4M8A A;  2MPM A;  2F0O A;  3MXN A;  4RHS A;  3STB D;  2B63 H;  5GAH C;  1V1P A;  4J15 A;  3N52 A;  3SK8 A;  3CPW A;  4QIW E;  2PNH A;  1LLR D;  1E1O A;  3UDI A;  3MFY A;  4YWM A;  5M3F B;  3T1H Q;  1X6O A;  3OWE B;  4CDE C;  4DV1 Q;  4HCS A;  3M4P A;  5C5M A;  3NWS A;  2VQF L;  2D2C C;  3SR1 A;  5LMN W;  4C3H G;  1F2M A;  4ZKC B;  1WTX A;  2B2W C;  1HA5 A;  5BR8 Q;  1DXM A;  1PRT B;  4XDX A;  4OIK A;  3RD4 A;  3NE5 B;  3HOZ H;  2WAQ E;  3HOU B;  2B2T C;  2JQO A;  3A0J A;  2HT1 A;  1GUN A;  1JQY D;  2O5I C;  5T1G A;  5EPL A;  4A3M G;  1LV9 A;  1SBB B;  1QE6 A;  2KCM A;  1TWA B;  2HQL A;  3GV6 A;  1NR4 A;  2Q2H A;  3HOW G;  3STB C;  1DJR D;  2NVT B;  2RVL A;  1DM0 B;  2EXD A;  1VQJ A;  3PIO A;  1XX8 A;  3OHX C;  4DPG A;  3MEH A;  2IWH A;  1LAB A;  5E4W C;  1K0R A;  1QVG A;  3ERQ A;  3S2H B;  1V1P B;  2OQ0 A;  1EQV A;  4RAU C;  1SNP A;  3VYR A;  1B50 A;  2R93 G;  3BYY B;  4AYB B;  2HD3 A;  3KLW A;  4JI5 Q;  2E2I B;  1YNJ D;  1I94 L;  1U5K A;  1LT3 D;  1J9O A;  2A74 C;  5E4X A;  4B9X A;  1CHQ D;  2F4V L;  1SE2 A;  4DU9 A;  3GTQ B;  3H94 A;  4RWS C;  4IUU A;  4DV0 Q;  5HGT A;  4B3S L;  1YJN A;  2YTX A;  3TP7 A;  1N33 L;  4AQY Q;  3K5M A;  3PIO 3;  2QDL A;  2R61 A;  3F2D A;  4DR1 Q;  1CFM A;  4DR4 Q;  1X3Q A;  3E5S A;  1FNV A;  4KY6 A;  5IGC A;  4JBW A;  2ALY B;  2HHH L;  4KV6 A;  3H6M A;  2PZT A;  2PNR C;  2QCP X;  1EYC A;  3TBI B;  3GTM B;  1G6Z A;  2MO0 A;  5M3M H;  3MFG A;  1GUO A;  1MBY A;  3GTJ H;  1PTO D;  1JCK B;  1G8Z D;  1S72 A;  2N3S A;  5FO7 B;  4IUQ A;  2NVT H;  1B3Q A;  4BBS G;  1VS0 A;  5D14 A;  1QVF A;  2FHT A;  1CI3 M;  4XT1 B;  4GOP B;  1A3T A;  4HSV A;  4DNT B;  1YIJ A;  5K36 G;  1Y1V H;  3QR8 A;  2SNM A;  1N32 Q;  1RTO A;  2F1M A;  2BA0 A;  2I07 B;  1E0B A;  4YCV A;  3FKI G;  1Y1W G;  3H09 A;  4HTH A;  1KL9 A;  1V43 A;  1FGU A;  2H4O A;  1L0W A;  1AH9 A;  2K01 A;  5FLM G;  1PH3 A;  1TWC H;  3LWE A;  3OSO A;  3NPP A;  2DY8 A;  1HUN A;  4A3B B;  5CMD A;  3ULL A;  3GTK B;  5LL6 X;  4B3T Q;  3H3V C;  2WAC A;  3NTK A;  2NB0 A;  3EA6 A;  5IYD G;  2JXM B;  1S4Z A;  3I91 A;  1VQG A;  1EWI A;  1ZYR C;  1EOV A;  4OEL B;  4JI3 L;  4Y7N B;  1PH6 A;  4LF6 Q;  2EDG A;  2E2H H;  3CD6 A;  5J1Z A;  3MA2 B;  1YHB A;  2B8F A;  1I4P A;  2NZO A;  4LFC Q;  1W6J A;  2EY2 A;  3TSS A;  4FXK C;  3KF6 A;  1X54 A;  2Y0S G;  1PXU A;  2QDB A;  3NQT A;  1K28 A;  4GOP C;  2G9H D;  3HG9 A;  1CSP A;  3S16 B;  1G51 A;  2GA4 B;  1EYA A;  2XRQ D;  3DEP A;  1ZEQ X;  3UE0 A;  3H0G H;  5KNC A;  5EKL A;  1NMG A;  2E5L L;  1STG A;  3HZX A;  2HCI A;  3PO2 G;  3AMU A;  3I3C A;  2OQK A;  3A5Z B;  1F2L A;  4JV5 L;  2CKZ B;  3EIV A;  3CCQ A;  2IL8 A;  1HQM C;  3CCL A;  3KJP A;  3WOF A;  3DM1 A;  1GUT A;  5G3L D;  3OTO L;  4DKA C;  5GQO A;  1SYD A;  5LMU Q;  4C2M H;  4ILW A;  5CGK A;  4OGQ C;  1WCM H;  1KAA A;  2LKV A;  2K33 A;  1QJO A;  4GNX A;  1ILP A;  1EUJ A;  4EQO A;  3I4N H;  3W2D A;  2R92 G;  5NUC A;  1A6X A;  3KBG A;  1R9T H;  1DZ1 A;  3PV0 A;  4JBK A;  3H0G B;  1SJH D;  4K5X A;  1B7Y B;  4BS9 A;  1EEI D;  2Q8T A;  1TY2 A;  1I5F A;  1SR3 A;  1U4M A;  2XIW A;  5AJ3 L;  2BA1 A;  2N88 A;  4B3M Q;  3QIA A;  4RMF A;  2JA5 H;  1B2T A;  3DWQ A;  1DOL A;  4LFA L;  2AHO B;  4A3K G;  1EFI D;  2K4K A;  1ICF B;  4DV4 Q;  3S17 H;  1PH8 A;  1Q82 C;  1QNU A;  4CJ0 B;  4LW1 A;  4DR3 L;  3A5U A;  1BQQ T;  4HIO A;  1BXT A;  2KJX A;  5I4D A;  4N9T A;  4UP8 A;  3T53 B;  3RZD H;  5IT9 c;  3GV3 A;  4QQB X;  1F2Y A;  4OO1 G;  3I72 A;  3FEW X;  4DNR B;  1N36 Q;  1PMR A;  2UUC Q;  1D8L A;  1CA5 A;  4JPB W;  1W3S A;  3GD7 A;  1KD1 C;  4WFN 3;  2TSS A;  3EFX D;  1U9R A;  2F3I A;  4X64 L;  4GNX B;  2OF1 A;  1R4P B;  3E0E A;  1VQ6 A;  1AFP A;  3F1Z A;  4KK7 A;  3J80 L;  3E9I A;  5D3D A;  4FP5 D;  1YIT A;  3KFU A;  4BXX G;  1VQO A;  5BN4 A;  3EQL C;  2VQF Q;  4K5W A;  5C3W A;  3F2U A;  3P75 A;  4JI4 L;  4A3K B;  1D5Z C;  1IBL L;  4L8J A;  3D6W A;  1SND A;  2QA4 A;  3CCV A;  3E0J A;  4G7Z C;  4AQY L;  4MTN A;  4IPC A;  1ROD A;  3J7Y W;  3GTK H;  5EKK A;  1F9P A;  4YHH L;  1KTK A;  5C3E H;  1Q1E A;  3CQZ H;  3OIQ A;  5JPM C;  3TME A;  2OTL A;  4A3D B;  2WAQ G;  3R2I A;  5LMN L;  3IFD A;  3TN2 A;  3ERO A;  3RNU A;  4JI2 L;  1B8A A;  1K83 B;  5BN5 A;  2CQO A;  3TP5 A;  5M3M G;  1L2F A;  1B44 D;  1PZK D;  3RLF A;  3NBH B;  2BH8 A;  3BVZ A;  3KUP A;  4U67 3;  1IBL Q;  5DM7 3;  4L6T B;  2E2H B;  2EYL A;  2EPB A;  1CM9 A;  2B8G A;  4DV5 L;  1SMY C;  5JJK A;  4XQQ A;  3LX0 A;  3M7G A;  1GUG A;  4K6D A;  4LUZ A;  3Q22 A;  1GM5 A;  2C5C A;  1II3 A;  1VQH A;  4UAI A;  2E2J H;  2V1C C;  2R7Z G;  4YIJ A;  4C3J B;  1MSG A;  2F0M A;  2JN4 A;  2F0D A;  5ELN A;  3NEN A;  3KLS A;  3UDX A;  5JVG 3;  1NNX A;  1OXX K;  1JB7 A;  5EBC A;  1QZH A;  3CCR A;  3PIP A;  2OXP A;  1B4O A;  4PMC A;  2ZT9 C;  1G2T A;  2Z4I A;  4KHP L;  1E2W A;  1BKB A;  2JEB I;  1A63 A;  3I4O A;  4DR5 Q;  2KUM A;  3S1M H;  3PO3 G;  5JEA H;  4RCN A;  1EZ6 A;  1PFM A;  2NVY H;  3NP8 A;  3MHB A;  1N8R C;  2F0I A;  4DK1 A;  3L2P A;  3K6O A;  2NYZ D;  4O42 A;  3QJY A;  4BXX H;  4KN7 C;  2LY7 A;  2K6A A;  2RDH A;  3J81 E;  1Y8N B;  3NEL A;  4XYO A;  2UUB L;  1QCB D;  2NUC A;  2RBM A;  4JYA L;  2HQE A;  2B3G A;  3AU7 A;  4HMJ A;  2DJG C;  2L11 A;  1EY5 A;  4XIG S;  3A7A B;  4ME5 A;  5IGE A;  2LSS A;  3K5L A;  3NTH A;  4TRD A;  2MNA A;  2K75 A;  4N8X 1;  3KF8 A;  2MUY A;  3QOL A;  4RHR A;  3J81 j;  4TKO B;  4BY7 B;  4XXE A;  2F52 A;  1I3Q H;  3MC0 B;  4DV7 Q;  4QCL A;  3SHL A;  3W1G A;  1SJE D;  4A3G B;  1X3F A;  2MJ8 A;  3DHQ A;  2QGQ A;  4MTK A;  2PW7 A;  1U4L A;  1VQI A;  1PTO B;  3CCJ A;  3KLR A;  1A3V A;  2KOL A;  2Q2U A;  1H9J A;  3ERS X;  5FJ8 G;  3D4R A;  3GTL H;  5M5Y B;  3BDL A;  4PG3 A;  1QG7 A;  2B2W A;  1VQN A;  1EZ8 A;  1J5E L;  1WI5 A;  1YJ9 A;  4FF1 A;  4Y52 H;  1JJC B;  4IUP A;  1HR0 Q;  4ZAI A;  1SYF A;  2J7Z A;  1EFW A;  5CYU A;  1CKN A;  3BVG A;  4X65 L;  3P20 A;  2UUA Q;  2KA7 A;  2E75 C;  5DM6 3;  1FJG Q;  2LS0 1;  2NTT A;  4MHE A;  4NDX A;  5JJL A;  4DV4 L;  4B08 A;  2Z1C A;  1SMX A;  3ULJ A;  1SAP A;  4CGY B;  4HAE A;  4DA2 A;  3D6C A;  2MGS A;  2QIL A;  3KLS X;  3FMC A;  4G7H C;  3NHH A;  3I55 A;  1MIU A;  5FLX c;  4N9P A;  1YZ6 A;  5DAU A;  1XMO Q;  1PH7 A;  4KLK A;  1ET6 A;  1Y8P B;  1A15 A;  3D8G A;  3HOV H;  4A76 A;  4IPG A;  4C1N I;  1DYQ A;  3H0G G;  1X55 A;  4LNQ A;  1STE A;  5CBA E;  3A7L A;  2B63 G;  4LFB Q;  4DV2 L;  1TWC B;  4NB3 A;  1I50 H;  1BBX C;  1HJP A;  1B1Z A;  3KDF B;  4P71 A;  3K8A A;  2YTY A;  5JAV A;  5LMN Q;  2F3V A;  1IW7 D;  3A55 A;  4GLA C;  1A2U A;  4KHZ A;  1KAB A;  4A3J H;  1TS4 A;  4DV6 L;  3KBX A;  1ICW A;  2PO4 A;  4A3G H;  3OOC A;  4F88 A;  3MZ5 A;  2JA5 G;  1XPR A;  2JA8 G;  3S15 H;  2WP8 J;  1YJW A;  3VA7 A;  3J80 i;  1IYV A;  1HFG A;  3GTG H;  3CCM A;  2K5Q A;  2EIF A;  4FF3 A;  4DAV A;  2VQE L;  2RCN A;  5GAE C;  1DOK A;  3CAM A;  4IFD I;  4DK6 C;  2K50 A;  3SE0 A;  3J81 i;  4JYA Q;  4L5T A;  4OO1 H;  4A3F B;  4K14 A;  2ATW A;  1Q8I A;  3I4N G;  3ONA B;  5D65 A;  2KHS A;  3O13 A;  2NN6 H;  5C4H A;  2UXD Q;  1UNS A;  1M4V A;  1VQP A;  2F0F A;  1HXY D;  2PQA A;  4DK3 C;  1IHZ A;  2PI2 E;  1WTQ A;  2R7Z B;  1PRT F;  4FXG C;  4X65 Q;  1PH2 A;  3D0F A;  3G4S A;  4OIJ A;  4FF2 A;  4UHV A;  2RA4 A;  4X66 L;  1Q7Y C;  2X6G A;  3MXP A;  4QGU A;  1KNE A;  3DWA A;  2JA8 B;  4A4I A;  4G57 A;  2CHB D;  4KD4 A;  2K5V A;  3HFZ B;  4R4C A;  5K36 H;  2RDG A;  3K7A H;  4DR7 Q;  1BCP C;  5HY6 A;  1S5C D;  4BBS H;  5TSS A;  3GTP H;  1NR2 A;  4A3M B;  2G5D A;  4JI8 Q;  5C3X A;  4A3F H;  1UE1 A;  3J80 c;  1EEF D;  3L3O C;  3C1E A;  3CQZ B;  3OMC A;  3H15 A;  1Q86 C;  4A3D G;  1SLJ A;  3CC4 A;  1O7I A;  1XMO L;  3K5O A;  4RFB A;  1SFO H;  3S2D B;  2EJM A;  3S14 B;  1HNW L;  4KHV A;  5I2Y A;  1DGS A;  1RHP A;  2NZH A;  4KY5 A;  2CW0 D;  2IX0 A;  2WKC A;  1XPU A;  1I6H B;  3D31 A;  4DFA A;  3E6Z X;  1Q3L A;  4ZCK A;  3VYT A;  3F2B A;  1WTH A;  4A3I B;  3CME A;  1GOZ A;  2PMZ B;  3FPU B;  3PO2 B;  3VR5 A;  3CC2 A;  1STA A;  4LUV A;  1LTS D;  3HKZ B;  2BOS A;  5M3F G;  2K04 A;  2E2I H;  3NEM A;  4ALP A;  1ESR A;  2AWO A;  3T51 B;  3T13 A;  4DV1 L;  2F03 A;  1H9R A;  4KI0 A;  4YCU A;  1NCV A;  1HZC A;  2NVX H;  5C0X J;  1OTC A;  3DM3 A;  1FNU A;  4HID A;  2BDO A;  1N32 L;  2K28 A;  1HFN A;  1EU4 A;  4X3U A;  2UU9 L;  2IJ0 A;  2KBN A;  1LTL A;  3S1Q H;  2R7Z H;  4LK1 C;  1PH1 A;  3N6R A;  4BWG B;  3U9S A;  2L5T A;  1CHP D;  1P8L A;  4AYB E;  1XNR Q;  4EVO A;  1XMQ L;  5LL6 S;  3OPO A;  1SNM A;  3K59 A;  3C3L A;  2IT1 A;  3HOU H;  5C0X H;  1WD0 A;  5ELF A;  1L1O C;  3TZU A;  3DXJ C;  3V96 A;  4EQ5 A;  5KIX A;  3K80 C;  4BBR H;  3J7A V;  4OEM B;  2R6G A;  3JAM i;  1IYU A;  4F7X A;  1Y1W B;  1EL0 A;  1TU2 B;  4LUO A;  3T1Y L;  2NN6 G;  2AUJ D;  4DAY B;  3MXG A;  3VA5 A;  3K0Y A;  4IUN A;  2F0G A;  5C4X B;  2K1B A;  2Z9H A;  2K03 A;  4PNY A;  1I3Q B;  3RR5 A;  3Q6S A;  1I6V C;  3MXN B;  1L0Y B;  4LF9 L;  1T5E A;  2BCO A;  3T56 B;  3WWV A;  3JAM c;  3CF5 A;  1VQC A;  5I6Y A;  1Q81 C;  5IT9 L;  2F0T A;  4K0K L;  1XTC D;  1L0X B;  1LTG D;  2KCN A;  1LTB D;  2FXQ A;  3Q8D A;  4BBR G;  1D6E C;  3L0O A;  4E6I A;  3VR3 A;  5A2Q E;  3IKJ A;  1O80 A;  5C5L A;  4V0B A;  1JJ2 A;  2JYO A;  1OXV A;  5IP7 H;  2F3W A;  3HKS A;  1PFB A;  2IHF A;  3Q0A A;  4TQU S;  2D9U A;  5EJW A;  1JJG A;  4A3E G;  3ULP A;  3G7L A;  5D3I B;  5I9P A;  4XTC S;  3G6E A;  4X62 L;  1X32 A;  1GO3 E;  1HRJ A;  2HDM A;  1G2S A;  5M5W B;  4X3T A;  5A35 A;  1TWF H;  1JOO A;  4A93 B;  3FHW A;  4NKL A;  4DV3 Q;  3CXC A;  5BN3 A;  5CV8 A;  2ENB A;  1A0I A;  2Z6B A;  1QB5 D;  3GTL B;  3I4M B;  3MWY W;  1RCV D;  3D4W A;  4DUZ Q;  4UP9 A;  4G4K A;  2NVQ H;  5C44 B;  3BZD B;  4EGV A;  2EXZ A;  3CPF A;  4GN4 B;  5J39 A;  3J7A 5;  4A3C H;  1AE3 A;  4DK0 A;  1DCZ A;  4JI0 L;  5C4X H;  3PUX A;  5AJ3 Q;  1FYC A;  2KEN A;  2Y0S B;  3AEV A;  3HOW H;  3OWF A;  4B9W A;  5IP9 G;  2GVA A;  2B2Y A;  1FR3 A;  4R1J A;  4GKJ L;  4X3S A;  1MI2 A;  4DUY Q;  4NXM Q;  1JWM D;  1YHA A;  4HR7 B;  2NVX B;  1UE5 A;  3OYY A;  1B53 A;  4YCW A;  1TQO A;  4ME3 A;  1ESF A;  2K5H A;  2D62 A;  3MVV A;  4BBS B;  1TVX A;  2MHV A;  3I4M G;  4P2C B;  4YWK A;  3HOX B;  1SMY D;  1YBY A;  2AUK A;  5E3F A;  4DR5 L;  1KC8 C;  3KDF A;  4IUT A;  4NPS A;  2F0J A;  2EJG C;  1YVC A;  4B3R L;  1F2Z A;  2V4D A;  1PTO C;  1TY0 A;  4KY7 A;  4CDD C;  4A3E H;  3GTQ H;  4KD3 A;  3CC7 A;  1NUC A;  2QEX A;  1SN8 A;  4XQJ A;  2X69 A;  5KYL A;  1EY0 A;  4BY1 G;  1PFN A;  3H91 A;  2J4X A;  1BUV T;  4ZRZ A;  1Q1B A;  3F2C A;  3QG1 A;  3FP9 A;  3M3Y B;  5M3M B;  4IOC A;  3S2D H;  4PV1 C;  4A3B G;  2VS1 A;  3G48 A;  5A2Q L;  2MP1 A;  4GLV B;  2EY1 A;  3P1H A;  2GVB A;  2WB1 B;  2PZW A;  3BVM A;  1UE6 A;  2LXK A;  4RCO A;  5EBD A;  4HIM A;  2VUM G;  4A3G G;  2B2U A;  2G9D A;  1RKN A;  1F9S A;  2WFW A;  1FD7 D;  5KEE A;  2DNC A;  5AFW A;  4A3C G;  1PLF A;  3VR2 A;  2CCZ A;  3BJU A;  1XTD A;  3GP7 A;  1I4X A;  1SNO A;  4IQZ A;  1VQB A;  4IFD H;  1JWU D;  3M4Y A;  2MO1 A;  1H9M A;  3S14 H;  4IFD J;  4HJ8 A;  2ZJR A;  4LF7 Q;  3L9A X;  4GN3 B;  4LFB L;  2F0W A;  4DR6 Q;  4PMB A;  3DMU A;  2L9H A;  4AH6 A;  3R93 A;  4EQN A;  5C4X G;  1U4P A;  1EIY B;  1JMC A;  4JV5 Q;  2ZTC A;  4ODG A;  4DV7 L;  3PSI A;  3A74 A;  3B6Y A;  3DWP A;  2UXB Q;  1E3P A;  3PO3 B;  3I4M H;  1UUP A;  3M3Y H;  1YEZ A;  4Z9C B;  3BG3 A;  5LHY 1;  1ENC A;  3R3O A;  3Q24 A;  1O7Z A;  1EY6 A;  1N36 L;  1ONL A;  2CFM A;  5FLX L;  4UDU C;  2ES2 A;  1Z6H A;  4BA1 I;  3RLO A;  4R4O A;  2QKI C;  2Z6K A;  3UDF A;  2F0S A;  3HOZ B;  2F4I A;  5FO8 B;  4B3R Q;  3M4O B;  3DEO A;  1M1K C;  2B2T A;  3EJI A;  5KYI A;  5M3F H;  5IWA Q;  1JE5 A;  4B3M L;  2KQ3 A;  3SK4 A;  3MAQ A;  2I5L X;  1TWF B;  4A3L H;  1K3R A;  1WTW A;  4LF4 Q;  4DAY A;  5M5W H;  1A2T A;  4K6L A;  1XPO A;  1CKM A;  1JOQ A;  4IOA A;  3S15 B;  3NUC A;  4NMZ A;  1IBK Q;  1LTI D;  4A93 G;  1GHK A;  4JI8 L;  4C2M B;  4LWC A;  1VQA A;  4JW0 A;  4C3I B;  1H9S A;  2EQS A;  1EY7 A;  1PTO F;  1OXS C;  2CQA A;  4CDC C;  2DY7 A;  3VYU A;  2IX1 A;  4O0A A;  1I4Q A;  4DV3 L;  4V19 0;  4JI1 L;  1LT4 D;  4DV5 Q;  3I56 A;  1VQK A;  1E2V A;  4OX9 Q;  5G3L F;  4R8I A;  5DNF A;  3TS2 A;  5T1I A;  4LF9 Q;  3PUZ A;  1BOS A;  1LO5 D;  2B29 A;  5HUR A;  2N49 A;  2A69 C;  3FDT A;  1C9O A;  4ZYS A;  4A3B H;  4BBR B;  2D5D A;  5GRO A;  2N78 A;  1FGB D;  2F0E A;  1B3A A;  1FNW A;  1GVP A;  5FLM H;  3DLL A;  4POF A;  5C3E G;  3S17 B;  3S1R H;  3A56 A;  1F9R A;  1WVL A;  5C6A A;  5FK9 C;  1B9M A;  3ICE A;  4J1M A;  4R4I A;  2K5N A;  3CKI B;  5CV4 A;  3GQB A;  1LM0 A;  5IGG A;  2NZ1 D;  3VR4 A;  1PZJ D;  3T1H L;  4X66 Q;  1ZXT A;  1MJE A;  1VMP A;  3PQI A;  4RG1 A;  1N9W A;  2ZJP A;  1R9T B;  3HKZ E;  1BNZ A;  1NTG A;  1VQF A;  3BYT B;  3JAM E;  5COY A;  1CK1 A;  3Q23 A;  1HA6 A;  1EWC A;  2OEO A;  2PQE A;  1QUQ A;  4M1U B;  3K7A B;  1D2B A;  1SE3 A;  1KAW A;  3C46 A;  4JOI C;  2D0O A;  4JI7 L;  1KXL A;  2PW5 A;  3T1Y Q;  1MD2 D;  3BDC A;  4IZ8 A;  4HN7 A;  2Q2I A;  1NE3 A;  2EYJ A;  4WOR A;  2R92 B;  1MJC A;  3UI2 A;  2XWB B;  5IYC G;  1X65 A;  5C44 G;  2SEB D;  1IBM L;  1G29 1;  2BE5 C;  3NTI A;  4HED A;  1C0A A;  3I4L A;  5C4J H;  3TEH B;  2EYO A;  4YY3 Q;  2ZM6 Q;  3HP3 A;  3BU2 A;  2PZU A;  2KHI A;  3S9W A;  2KVM A;  3PF5 A;  3PUV A;  1NY4 A;  1IBK L;  1NSN S;  3VDY A;  1F9Q A;  1NMF A;  3HOX G;  3RZO B;  2QW7 A;  2L0C A;  1RF2 D;  2R92 H;  1QNK A;  3KF8 B;  1TS5 A;  1ASZ A;  2VNU D;  2E74 C;  4R4Q A;  1PRT C;  3EVQ A;  1QOH A;  5M5X B;  2A73 B;  3RUZ A;  1QIL A;  2L1B A;  1QVC A;  2IHE A;  2AWN A;  2DJF C;  4BY1 H;  3CU7 A;  3I7F A;  1WTO A;  1WTP A;  2JA6 G;  1JE4 A;  3K5N A;  2HHH Q;  3KOJ A;  3E9H A;  3TP8 A;  2JK8 A;  3HOV B;  2ZM6 L;  1CQV A;  1TII D;  5JJI A;  4CBV A;  4Q0F A;  2NWG A;  1VQ4 A;  1GUW A;  4APV A;  1AW7 A;  5FJ8 H;  4DR2 L;  4LF5 L;  4K2K A;  4H7B A;  2XVS A;  4DR3 Q;  1WYD A;  1Y1V G;  2PQA B;  4A75 A;  2WII B;  3OMG A;  1PH5 A;  2DUD A;  2IY5 B;  3QWN A;  4LF8 L;  1RL2 A;  2N55 A;  2PMZ E;  4JI0 Q;  5CV9 A;  3W1B A;  2DGY A;  3KF6 B;  4RKB A;  5C4J B;  1E22 A;  3RZD B;  4WJ3 M;  3GDE A;  4C3I G;  1Y14 B;  1SRO A;  4PZ6 A;  4JI1 Q;  1STY A;  1D1K A;  1STH A;  4DR2 Q;  4LF5 Q;  1MHW C;  3BZC A;  4P73 A;  5F2D A;  1I94 Q;  1JWS D;  3JAM L;  2HUG A;  4R9W A;  2VY3 A;  3S1R B;  5KRU A;  3FVQ A;  3CW2 C;  2JSO A;  1OXT A;  5BR8 L;  2JA7 H;  2K05 A;  2F0L A;  4XYQ A;  1XNQ L;  2Z0S A;  3L7Z C;  2R93 H;  3SK6 A;  5ELB A;  4GS3 A;  2B63 B;  1K8M A;  4P75 A;  4QUF A;  2R7F A;  3SK5 A;  3G71 A;  5EPJ A;  4F8M A;  2E8G A;  1BCP F;  3C2P A;  2F0H A;  2A6E C;  1Y1W H;  1TWH B;  2KCT A;  1IXR A;  2A69 D;  4IJL A;  3FRP B;  4WJW A;  1CUK A;  2WB1 G;  1AP0 A;  4DV6 Q;  1SEB D;  2MFI A;  3X3M A;  4DGZ A;  5ISR A;  5FLX E;  2JA7 B;  1H9K A;  1D5X C;  3PGZ A;  2GN5 A;  4QB4 A;  4A3I G;  3G6J B;  2M9V A;  1PH9 A;  4QUC A;  3OIP A;  1WFQ A;  3PMF A;  4PZ8 A;  1ENF A;  2PCF B;  2KCC A;  2WKD A;  2F0N A;  4A3F G;  3GTO B;  1V1Q A;  3C1F A;  2UUB Q;  1RTN A;  2A19 A;  3PO3 H;  2OCE A;  1SNQ A;  4XT3 B;  1RJT A;  1S5E D;  4K8J A;  4C3H H;  2EY5 A;  3QOJ A;  5EKI A;  4JCV E;  4HMI A;  5CV5 A;  3V05 A;  2Y0S E;  1AEX A;  2XTI A;  1TT2 A;  2NVY B;  2WIN B;  2EYF A;  4FNF A;  1U4R A;  4OWW B;  4GKK Q;  1J8I A;  3HEJ A;  2VUM B;  2RSN A;  2RQX A;  3KJO A;  1C8C A;  3I8Z A;  3J80 E;  1L1O A;  1KDB A;  1KLU D;  4XQN A;  2MQH A;  4IPD A;  4DF7 A;  2FIN B;  1UEA B;  2BDN A;  2RCF A;  1JOK A;  4HSP A;  5JEA G;  1PVO A;  4P72 A;  1HNX L;  2K52 A;  5EAY A;  3AYH B;  3RMH A;  1XMQ Q;  2DN8 A;  3NBH A;  4PMW A;  2A6E D;  5IWA L;  4KN4 C;  2AKW B;  4A3M H;  4IJH A;  1EIH A;  2EYM A;  5EGT A;  1ZYR D;  1X9N A;  3PO2 H;  4C3J H;  5IY0 A;  2YU9 B;  3TP6 A;  3M4O H;  1S40 A;  4KJN A;  3X3N A;  2FMM A;  1Z47 A;  2Q8I B;  4MIU A;  3I90 A;  4LF7 L;  1X3G A;  1N34 L;  3DUZ A;  1VQD A;  1XWE A;  2A5H A;  2RHS B;  4JI6 Q;  1S3O A;  1JIC A;  4FXD A;  1IKM A;  1EIF A;  1EY9 A;  4K0K Q;  1F77 A;  1O7L A;  2YYZ A;  5JPN C;  4NXN L;  1DON A;  2B2V A;  2XRS D;  1S5F D;  5CC4 A;  4KMU C;  1K8A C;  4DNI A;  5GAD C;  1RD9 D;  2VZA A;  3FKI H;  1SYG A;  3RZO H;  1KDC A;  3AFP A;  4AYB G;  2ZTE A;  3J81 c;  3CCE A;  3U9O A;  3P7J A;  2XGT A;  2JEA I;  4KKS A;  4NP5 A;  2CWP A;  1GKH A;  1HQR D;  4B3T L;  1GD7 A;  4TSS A;  3HOY G;  2JJQ A;  5J22 A;  1A62 A;  2SDF A;  2RSO A;  5ELE A;  1HNZ Q;  3S24 A;  1E2Z A;  4DR4 L;  4WJ4 A;  1EQR A;  5IYB H;  4BY1 B;  1IBM Q;  5C0X G;  1VQL A;  4DAM A;  1M90 C;  4X62 Q;  1KRT A;  3GTG B;  3A8I E;  2ASB A;  1TWG B;  4QIW B;  3SXH A;  4L5R C;  4NXN Q;  3IL8 A;  5JEA J;  2UXB L;  1G6P A;  1HUM A;  1FVI A;  2VUM H;  1D5M C;  2YU9 H;  1DD2 A;  3HOX H;  1KLG D;  1HHV A;  4DAP A;  1V8Q A;  2I0Q A;  2F0V A;  2VL6 A;  5C4Z A;  4MZ9 A;  4K5V A;  3BDO A;  3SVM A;  2OT2 A;  3EBE A;  4RGM A;  2QF7 A;  3IRB A;  2ID0 A;  1WTR A;  2UXC L;  5C44 H;  3K7U C;  1SNC A;  4CDF C;  2OWO A;  1AZQ A;  3NQI A;  1S5B D;  5HGQ A;  3I2Z A;  1VF5 C;  1HNX Q;  3VR6 A;  3D4D A;  1HNW Q;  5JOB A;  3FKI B;  2ICI A;  3AB9 A;  5E7N A;  1B70 B;  1LTA D;  3HS0 C;  5IYB G;  4X6A H;  3SGI A;  1QZG A;  1SDF A;  4A3J B;  2C35 B;  3LGJ A;  2B2U C;  2H1E A;  4FF4 A;  2R93 B;  1BCP D;  4HJA A;  1JR0 D;  1UEB A;  1NAP A;  3URY A;  3IAY A;  2AMC B;  3A8J E;  1AN8 A;  1HPC A;  2F0Q A;  2EJF C;  3CRK C;  2O2L D;  3SEB A;  1BDO A;  3BS1 A;  4NXM L;  3QO2 A;  2SOB A;  4A3D H;  1EYD A;  3HRZ C;  1O7Y A;  3R8B A;  1KDA A;  5CR3 A;  4LFC L;  1HR0 W;  1A3U A;  4GZY C;  1L1O B;  1Y8O B;  1AZP A;  5C0X I;  3A8K E;  2PI2 A;  2ZXO A;  4EQP A;  2XNA C;  1I4R A;  1BVS A;  2Z8L A;  1VQ8 A;  1X56 A;  5COR A;  1YHQ A;  4OO1 I;  2WAQ B;  1GXD C;  4H0L C;  1BBW A;  1XNR L;  4LFA Q;  1JT8 A;  1PTO H;  4DXF A;  4YY3 L;  1EOT A;  1SE4 A;  4OWT B;  1SYE A;  1X3E A;  1XXG A;  4AIM A;  2XN9 C;  4A3L G;  2VQE Q;  1CA6 A;  4MNO A;  4S3S A;  2JP1 A;  1LTT D;  4YWL A;  4DN4 M;  4RA8 A;  5E1F A;  5KGU A;  3CP0 A;  1YNN D;  1PYS B;  3WOE A;  4LMQ D;  3RN2 A;  1CQF A;  1OXU A;  2YTV A;  4LF4 L;  2NN6 I;  4R4T A;  2H5X A;  2A6H C;  1WTV A;  2UUC L;  3HOZ G;  1IW7 C;  4KKU A;  2UXC Q;  4JOI A;  4ID6 A;  3H3V H;  3H3V I;  1LT6 D;  3LWU A;  2KEE A;  1J6Q A;  3HOY B;  5GAG C;  1QUQ B;  1FJG L;  3KYH C;  1ASY A;  1PDQ A;  2BH2 A;  1HTP A;  2AQ3 B;  4CJ2 C;  4GKJ Q;  1H9S B;  1LTR D;  4CJ1 B;  2A1A A;  4JK1 C;  2XWJ B;  1CTM A;  3PUY A;  4FYD A;  5ELO A;  4FVM A;  4DUY L;  3S1M B;  1I6H H;  4J8Q A;  3D3R A;  1Y1V B;  3FPP A;  1Q90 A;  3MXU A;  2RKS A;  5FOB B;  4ZUI A;  4QMG A;  4DV0 L;  2E76 C;  1BCP B;  3U58 A;  2WB1 E;  3PF4 A;  2HIV A;  5IYC H;  3I70 A;  2Q8R E;  1QWY A;  2BE5 D;  4GOP A;  1PYB A;  2KED A;  1A8V A;  4I7Z C;  4CKC A;  1O78 A;  3E3X A;  4N8F A;  4OON A;  2JA6 B;  1PA6 A;  2Z6K C;  3SDZ A;  5CBE E;  5LMU L;  1UWV A;  4FO2 A;  1CKN B;  4C3J G;  3CCS A;  4DV2 Q;  5ELD A;  1G91 A;  5DLQ E;  4OL7 A;  4A3J G;  4A3I H;  1NJI C;  4PZ7 A;  3T16 A;  3LNN A;  4BY7 G;  4LAA A;  4C1N K;  2R7D A;  4I7A A;  4CKE A;  2N8N A;  1I4G A;  1WJJ A;  5CV6 A;  1HH2 P;  4IN3 A;  4KKT A;  1TWG H;  1EY4 A;  3HOU G;  4I65 A;  2Z4H A;  1C4Q A;  2K14 A;  1ML0 D;  2A8V A;  3IFT A;  5CV7 A;  1VQ9 A;  1GUS A;  2F0P A;  1XYI A;  2XSC A;  2CWA A;  5KND A;  2EZV A;  3QB3 A;  2M2L A;  2K5W A;  2IX3 A;  1ZKO A;  5M9O A;  3MEF A;  3ZYY X;  4IAL A;  4U68 A;  4A3E B;  3HOV G;  5ELC A;  4C56 C;  1VQE A;  3S1Q B;  4ZKB B;  1IL2 A;  1CKO A;  4K2L A;  1IZ6 A;  1K73 C;  4LJZ C;  5J3B A;  5IE8 A;  2O4X A;  2LXJ A;  4UY8 C;  1JOR A;  2EYP A;  2CW0 C;  2J0T D;  4JI3 Q;  2M00 A;  1E7Z A;  1EWH A;  1MGS A;  2X6L A;  1YNX A;  3ND8 A;  4ULL A;  3KK7 A;  5IT9 E;  1LUZ A;  2K5D A;  1EYG A;  1Q12 A;  1NBW A;  4RGT A;  3U50 C;  1N33 Q;  1T5X D;  2JA8 H;  4DR7 L;  3NBI A;  4EX5 A;  4HJ7 A;  4DUZ L;  4IO9 A;  1T9H A;  4ZK9 B;  5C3E B;  3GTO H;  3R2T A;  1LAC A;  1SYB A;  1B9N A;  4H13 C;  2KHJ A;  1W6K A;  4OX9 L;  2CH4 W;  5EQ0 A;  3BZK A;  1HZB A;  3AQQ A;  4JBM A;  4ZLT F;  4TVA B;  2RDF A;  1W2B A;  2KEC A;  2FFK B;  3OW7 A;  2NBF A;  3HGB A;  1IKL A;  2JE6 I;  3OTO Q;  2VXW A;  2I5H A;  3NWT A;  3GTJ B;  4Q5V A;  3TQY A;  4RH6 A;  1EIG A;  1VQM A;  1OO9 B;  1TR5 A;  3NSW A;  1I4H A;  2L12 A;  5I6W A;  3AFQ A;  4QF4 A;  2NTS A;  1STN A;  2F4V Q;  3J7Z C;  2EE1 A;  4OXP A;  4RKL A;  2WV6 D;  1VCI A;  3I4N B;  4L5Q A;  1VQ5 A;  1Y69 U;  4J6H A;  3TRE A;  4JI7 Q;  1KQS A;  1C7Y A;  2DNE A;  3CMA A;  1PH4 A;  1S5D D;  1SYC A;  4L5S A;  5EPK A;  1XJV A;  3PCO B;  3ER0 A;  4C3I H;  3NXW A;  2K32 A;  1ILQ A;  4BY7 H;  4KJO A;  5JJZ A;  5FKA C;  2L15 A;  3W3A A;  4ZUJ A;  5K5P A;  4UP7 A;  4O1N A;  4JVZ A;  2LFN A;  1EY8 A;  1RIP A;  5DEH A;  1BF4 A;  4JBJ A;  4HIK A;  2EOT A;  2FMC A;  2B39 A;  1ENA A;  4HJ5 A;  1HZ9 A;  1WCM B;  1PZI D;  2A6H D;  3CCU A;  2I46 A;  2IPK D;  2R3Z A;  1GHJ A;  5M5Y H;  2HCC A;  2O5J C;  4JG2 A;  1CZW A;  2B2Y C;  3PUW A;  1K3B C;  4H02 A;  1K8G A;  3U4V A;  1TS3 A;  2CH4 A;  1EQQ A;  1UAP A;  2K7V A;  3T4A C;  1I50 B;  1D7Q A;  2JA9 A;  1PYW D;  1KHI A;  4R8N A;  2UUA L;  2EY6 A;  5IIF A;  2A68 D;  1SRU A;  3RN5 A;  5IOC A;  1PV4 A;  4KHP Q;  3TZD A;  2LMC B;  2OTJ A;  1LT5 D;  4FDB A;  3S1N H;  1STB A;  1VMC A;  2YV5 A;  1E24 A;  1KNA A;  2RHQ B;  2UXD L;  4IFD G;  3A54 A;  2C9O A;  4LF8 Q;  4CHT B;  1Z7T A;  4G7O C;  3EN2 A;  1IL8 A;  1LYL A;  5JVH 3;  4DR1 L;  3V2T A;  5H1S E;  1K0S A;  4DR6 L;  1YNJ C;  2PPB C;  1TS2 A;  2A68 C;  1ET9 A;  2ZTD A;  4F87 A;  1HTL D;  3K0X A;  1H95 A;  4GN5 A;  4Y7N H;  4RGO S;  2QEJ C;  1YI2 A;  3M7N A;  4JI4 Q;  1IYJ B;  4GLX A;  3S16 H;  1J5E Q;  1UE7 A;  2CVR A;  2L4N A;  2ZXP A;  4PQX A;  3GTP B;  3ND9 A;  2E2J B;  1CZG A;  2F0K A;  1CT1 D;  4O2D A;  1BBU A;  2PYK A;  3K57 A;  1EQT A;  2F0U A;  4QY7 A;  1DOM A;  2AQ1 B;  1HR0 L;  3J81 L;  1SSO A;  3UE1 A;  1R4Q B;  1E1T A;  1SFO B;  2ZJQ A;  1KIX A;  5IYD H;  1MSH A;  4GNX C;  4POG A;  1MKH A;  1SE8 A;  1C48 A;  4ABN A;  4GKK L;  4H44 C;  4X3K A;  4RGN A;  1X3P A;  3GTM H;  2HDL A;  3RLN A;  3ZJY C;  1N34 Q;  1K83 H;  1XNQ Q;  2P5Z X;  4C3H B;  3J7A F;  1Q8K A;  3GO5 A;  4QL5 A;  3S1N B;  2JA7 G;  2FJ2 A;  1BR9 A;  1WCM G;  2ZXR A;  5M5X H;  3UDG A;  4MN3 A;  1V1O A;  2UU9 Q;  5IP7 G;  4K8I A;  5I9O A;  1HCZ A;  1TWA H;  2TMP A;  3HOW B;  2RF4 A;  2JA6 H;  5IP9 H;  2ICE C;  3M85 A;  4BA2 I;  3K81 C;  2VW9 A;  1HNZ L;  4JC0 A;  1JC7 A;  2E5L Q;  1EU3 A;  4UPA A;  5I2X A;  1YNN C;  4DXG A;  1P16 A;  3TRZ A;  1CSQ A;  4IPH A;  1KRS A;  3VYS A;  2JA5 B;  1BO0 A;  1RDP D;  4X64 Q;  1AE2 A;  3CHB D;  2VB2 X;  3CRL C;  3F8T A;  4L63 B;  3HOY H;  1PFS A;  4OHJ A;  1PRT D;  2B2V C;  4ZQ3 A;  1D1I A;  1SXT A;  2SNS A;  1HZA A;  2HIX A;  2NVQ B;  3NK9 A;  2AQ2 B;  3U4Z A;  1Q46 A;  3S2H H;  1PHJ A;  1U0L A;  1VF7 A;  4HJ9 A;  1K9M C;  4A93 H;  3HKZ G;  4NW2 A;  3WDN A;  4IUV A;  3OW2 A;  4JI5 L;  5L37 A;  3PIP 3;  1FL0 A;  2Q2T A;  4CKB A;  4P74 A; 
#chains in the Genus database with same CATH homology
 1WD1 A;  3TDQ A;  5FO9 B;  5IGD A;  4HCE A;  1JB3 A;  1M8A A;  4KTA A;  1K8O A;  2EYH A;  5IGF A;  5KNB A;  3K58 A;  2VB3 X;  1TKW B;  3I73 A;  3MTS A;  2IW3 A;  1GJX A;  4WRD A;  5IOD A;  2E2D C;  4IUR A;  5IGB A;  1VDZ A;  2L55 A;  3ITP A;  2EVB A;  4M8A A;  4RHS A;  2MPM A;  2F0O A;  3MXN A;  1V1P A;  3N52 A;  3SK8 A;  1LLR D;  3MFY A;  5M3F B;  3OWE B;  4HCS A;  5C5M A;  3NWS A;  2D2C C;  3SR1 A;  4C3H G;  1F2M A;  4ZKC B;  1WTX A;  2B2W C;  1HA5 A;  1DXM A;  1PRT B;  4XDX A;  4OIK A;  3RD4 A;  3NE5 B;  3HOU B;  2B2T C;  1GUN A;  1JQY D;  2O5I C;  5T1G A;  5EPL A;  1LV9 A;  1SBB B;  1QE6 A;  1TWA B;  3GV6 A;  1NR4 A;  1DJR D;  2NVT B;  2RVL A;  1DM0 B;  1XX8 A;  3OHX C;  3MEH A;  2IWH A;  1LAB A;  5E4W C;  3ERQ A;  3S2H B;  1V1P B;  1EQV A;  4RAU C;  1SNP A;  3VYR A;  1B50 A;  3BYY B;  4AYB B;  2E2I B;  1YNJ D;  1LT3 D;  1J9O A;  2A74 C;  5E4X A;  4B9X A;  1CHQ D;  1SE2 A;  4DU9 A;  3GTQ B;  3H94 A;  4RWS C;  4IUU A;  5HGT A;  3TP7 A;  3K5M A;  3PIO 3;  2R61 A;  1CFM A;  1X3Q A;  3E5S A;  1FNV A;  4KY6 A;  5IGC A;  4JBW A;  4KV6 A;  3H6M A;  2PZT A;  2PNR C;  2QCP X;  1EYC A;  3TBI B;  3GTM B;  1G6Z A;  1GUO A;  3MFG A;  1MBY A;  1PTO D;  1JCK B;  1G8Z D;  5FO7 B;  4IUQ A;  5D14 A;  2FHT A;  1CI3 M;  4XT1 B;  1A3T A;  4HSV A;  4DNT B;  5K36 G;  2SNM A;  1RTO A;  2F1M A;  2BA0 A;  2I07 B;  1E0B A;  3H09 A;  4HTH A;  1V43 A;  2H4O A;  2K01 A;  3LWE A;  3OSO A;  3NPP A;  2DY8 A;  1HUN A;  4A3B B;  5CMD A;  3GTK B;  5LL6 X;  3H3V C;  2WAC A;  3NTK A;  2NB0 A;  3EA6 A;  2JXM B;  1S4Z A;  3I91 A;  1ZYR C;  4Y7N B;  2EDG A;  5J1Z A;  3MA2 B;  2B8F A;  1I4P A;  1W6J A;  2EY2 A;  3TSS A;  4FXK C;  1PXU A;  2QDB A;  3NQT A;  2G9H D;  3HG9 A;  3S16 B;  2GA4 B;  1EYA A;  2XRQ D;  3DEP A;  1ZEQ X;  5KNC A;  5EKL A;  1STG A;  3HZX A;  2HCI A;  3AMU A;  3I3C A;  1F2L A;  2IL8 A;  1HQM C;  3WOF A;  3DM1 A;  1GUT A;  5G3L D;  1SYD A;  4ILW A;  5CGK A;  4OGQ C;  1KAA A;  2LKV A;  2K33 A;  1QJO A;  1ILP A;  4EQO A;  3W2D A;  5NUC A;  1A6X A;  3KBG A;  1DZ1 A;  3PV0 A;  3H0G B;  1SJH D;  4K5X A;  4BS9 A;  1EEI D;  2Q8T A;  1TY2 A;  1U4M A;  2XIW A;  2BA1 A;  2N88 A;  3QIA A;  1B2T A;  3DWQ A;  1DOL A;  1EFI D;  1QNU A;  4CJ0 B;  1BQQ T;  1BXT A;  2KJX A;  5I4D A;  4N9T A;  3T53 B;  3GV3 A;  1F2Y A;  4OO1 G;  3I72 A;  3FEW X;  4DNR B;  1PMR A;  1CA5 A;  3GD7 A;  4WFN 3;  2TSS A;  3EFX D;  1U9R A;  2OF1 A;  1R4P B;  1AFP A;  4KK7 A;  3J80 L;  5D3D A;  4FP5 D;  5BN4 A;  3EQL C;  4K5W A;  5C3W A;  3F2U A;  3P75 A;  4A3K B;  1D5Z C;  4L8J A;  3D6W A;  1SND A;  3E0J A;  4G7Z C;  1ROD A;  3J7Y W;  5EKK A;  1F9P A;  1KTK A;  1Q1E A;  3OIQ A;  5JPM C;  3TME A;  4A3D B;  3R2I A;  3IFD A;  3TN2 A;  3ERO A;  1K83 B;  5BN5 A;  3TP5 A;  1B44 D;  1PZK D;  3RLF A;  3BVZ A;  4U67 3;  3KUP A;  5DM7 3;  4L6T B;  2E2H B;  2EYL A;  2EPB A;  1CM9 A;  2B8G A;  1SMY C;  4XQQ A;  3LX0 A;  3M7G A;  1GUG A;  4K6D A;  3Q22 A;  2C5C A;  1II3 A;  4UAI A;  4YIJ A;  4C3J B;  1MSG A;  2F0M A;  2F0D A;  3KLS A;  5JVG 3;  1OXX K;  5EBC A;  2OXP A;  1B4O A;  4PMC A;  2ZT9 C;  1G2T A;  2Z4I A;  1E2W A;  2JEB I;  2KUM A;  5JEA H;  4RCN A;  1EZ6 A;  1PFM A;  3NP8 A;  3MHB A;  2F0I A;  4DK1 A;  3K6O A;  2NYZ D;  3QJY A;  4O42 A;  4KN7 C;  2LY7 A;  2K6A A;  2RDH A;  3J81 E;  1Y8N B;  4XYO A;  1QCB D;  2NUC A;  2RBM A;  2HQE A;  3AU7 A;  4HMJ A;  2L11 A;  1EY5 A;  4XIG S;  3A7A B;  4ME5 A;  5IGE A;  3K5L A;  3NTH A;  4TRD A;  3KF8 A;  2MUY A;  3QOL A;  4RHR A;  4TKO B;  4BY7 B;  4XXE A;  3MC0 B;  4QCL A;  3SHL A;  1SJE D;  4A3G B;  2MJ8 A;  3DHQ A;  2PW7 A;  1U4L A;  1PTO B;  3KLR A;  1A3V A;  2KOL A;  1H9J A;  3D4R A;  5M5Y B;  3BDL A;  1QG7 A;  2B2W A;  1EZ8 A;  4FF1 A;  4IUP A;  4ZAI A;  1SYF A;  2J7Z A;  5CYU A;  3BVG A;  3P20 A;  2KA7 A;  2E75 C;  5DM6 3;  2LS0 1;  2NTT A;  4MHE A;  4NDX A;  4B08 A;  2Z1C A;  1SAP A;  4CGY B;  4HAE A;  4DA2 A;  3D6C A;  2MGS A;  2QIL A;  3KLS X;  3FMC A;  4G7H C;  3NHH A;  4N9P A;  5DAU A;  1ET6 A;  1Y8P B;  1A15 A;  3D8G A;  4C1N I;  1DYQ A;  1STE A;  5CBA E;  3A7L A;  1TWC B;  1BBX C;  1B1Z A;  5JAV A;  2F3V A;  1IW7 D;  3A55 A;  1A2U A;  4KHZ A;  1KAB A;  1TS4 A;  3KBX A;  1ICW A;  2PO4 A;  3OOC A;  4F88 A;  3MZ5 A;  2WP8 J;  3VA7 A;  1IYV A;  1HFG A;  2K5Q A;  4FF3 A;  4DAV A;  1DOK A;  4IFD I;  3SE0 A;  4OO1 H;  4A3F B;  4K14 A;  1Q8I A;  3ONA B;  5D65 A;  2KHS A;  3O13 A;  2NN6 H;  5C4H A;  1UNS A;  1M4V A;  2F0F A;  1HXY D;  1IHZ A;  1WTQ A;  2R7Z B;  1PRT F;  4FXG C;  4OIJ A;  4FF2 A;  2RA4 A;  2X6G A;  3MXP A;  1KNE A;  3DWA A;  2JA8 B;  4G57 A;  2CHB D;  4KD4 A;  5K36 H;  2RDG A;  1BCP C;  1S5C D;  5TSS A;  1NR2 A;  4A3M B;  5C3X A;  1EEF D;  3L3O C;  3C1E A;  3CQZ B;  3OMC A;  3K5O A;  4RFB A;  3S2D B;  2EJM A;  3S14 B;  4KHV A;  5I2Y A;  1RHP A;  2CW0 D;  2IX0 A;  2WKC A;  4KY5 A;  1I6H B;  3D31 A;  4DFA A;  3E6Z X;  1Q3L A;  3VYT A;  4A3I B;  1GOZ A;  2PMZ B;  3FPU B;  3PO2 B;  3VR5 A;  1STA A;  1LTS D;  3HKZ B;  2BOS A;  2K04 A;  3T51 B;  1ESR A;  2AWO A;  3T13 A;  2F03 A;  1H9R A;  4KI0 A;  1NCV A;  5C0X J;  1FNU A;  2BDO A;  1HFN A;  2K28 A;  1EU4 A;  4X3U A;  2IJ0 A;  4LK1 C;  3N6R A;  4BWG B;  3U9S A;  2L5T A;  1CHP D;  4EVO A;  5LL6 S;  3C3L A;  1SNM A;  3OPO A;  3K59 A;  2IT1 A;  5C0X H;  1WD0 A;  5ELF A;  3TZU A;  3DXJ C;  3V96 A;  5KIX A;  3J7A V;  2R6G A;  1IYU A;  4F7X A;  1Y1W B;  1EL0 A;  1TU2 B;  2NN6 G;  2AUJ D;  3MXG A;  3VA5 A;  3K0Y A;  4IUN A;  2F0G A;  5C4X B;  2K1B A;  2K03 A;  4PNY A;  1I3Q B;  3Q6S A;  1I6V C;  1L0Y B;  1T5E A;  2BCO A;  3T56 B;  5I6Y A;  5IT9 L;  2F0T A;  1XTC D;  1L0X B;  1LTG D;  2KCN A;  1LTB D;  1D6E C;  5A2Q E;  4E6I A;  3VR3 A;  3IKJ A;  1O80 A;  5C5L A;  4V0B A;  2JYO A;  1OXV A;  2F3W A;  1PFB A;  3Q0A A;  4TQU S;  2D9U A;  5EJW A;  3G7L A;  5D3I B;  5I9P A;  4XTC S;  1X32 A;  1HRJ A;  2HDM A;  1G2S A;  5M5W B;  4X3T A;  5A35 A;  1JOO A;  4A93 B;  4NKL A;  5BN3 A;  5CV8 A;  2ENB A;  1QB5 D;  3GTL B;  3I4M B;  3MWY W;  1RCV D;  3D4W A;  4G4K A;  5C44 B;  3BZD B;  4EGV A;  2EXZ A;  5J39 A;  4DK0 A;  1DCZ A;  3PUX A;  1FYC A;  2Y0S B;  3OWF A;  4B9W A;  2B2Y A;  1FR3 A;  4X3S A;  1MI2 A;  1JWM D;  4HR7 B;  2NVX B;  1B53 A;  1TQO A;  1ESF A;  3MVV A;  2D62 A;  4BBS B;  1TVX A;  2MHV A;  4P2C B;  3HOX B;  1SMY D;  2AUK A;  5E3F A;  4IUT A;  2F0J A;  2EJG C;  1F2Z A;  2V4D A;  1PTO C;  1TY0 A;  4KY7 A;  4KD3 A;  1NUC A;  4XQJ A;  2X69 A;  5KYL A;  1EY0 A;  1PFN A;  3H91 A;  2J4X A;  1BUV T;  4ZRZ A;  1Q1B A;  3QG1 A;  3M3Y B;  5M3M B;  4PV1 C;  5A2Q L;  2MP1 A;  2EY1 A;  3P1H A;  2WB1 B;  2PZW A;  3BVM A;  4RCO A;  5EBD A;  2B2U A;  2G9D A;  1RKN A;  1F9S A;  1FD7 D;  5KEE A;  2DNC A;  5AFW A;  1PLF A;  3VR2 A;  3GP7 A;  1I4X A;  1SNO A;  4IQZ A;  4IFD H;  1JWU D;  3M4Y A;  4IFD J;  1H9M A;  3L9A X;  2F0W A;  4PMB A;  3DMU A;  2L9H A;  3R93 A;  4EQN A;  1U4P A;  4ODG A;  3DWP A;  3PO3 B;  1UUP A;  4Z9C B;  3BG3 A;  5LHY 1;  1ENC A;  3R3O A;  3Q24 A;  1O7Z A;  1EY6 A;  1ONL A;  5FLX L;  4UDU C;  1Z6H A;  4BA1 I;  2QKI C;  2F0S A;  3HOZ B;  2F4I A;  5FO8 B;  3M4O B;  3DEO A;  2B2T A;  3EJI A;  5KYI A;  2KQ3 A;  3SK4 A;  3MAQ A;  1TWF B;  1WTW A;  4DAY A;  1A2T A;  4K6L A;  1JOQ A;  3S15 B;  3NUC A;  4NMZ A;  1LTI D;  1GHK A;  4C2M B;  4C3I B;  1H9S A;  1EY7 A;  1PTO F;  1OXS C;  2CQA A;  2DY7 A;  3VYU A;  2IX1 A;  1I4Q A;  4V19 0;  1LT4 D;  1E2V A;  5G3L F;  4R8I A;  5DNF A;  5T1I A;  3PUZ A;  1BOS A;  1LO5 D;  5HUR A;  2A69 C;  3FDT A;  4ZYS A;  4BBR B;  2D5D A;  1FGB D;  2F0E A;  1B3A A;  1FNW A;  3S17 B;  3A56 A;  1F9R A;  1WVL A;  5C6A A;  5FK9 C;  1B9M A;  4J1M A;  3CKI B;  5CV4 A;  3GQB A;  5IGG A;  2NZ1 D;  3VR4 A;  1PZJ D;  1ZXT A;  1VMP A;  1R9T B;  1BNZ A;  3BYT B;  3JAM E;  5COY A;  1CK1 A;  3Q23 A;  1HA6 A;  1EWC A;  2OEO A;  2PQE A;  4M1U B;  3K7A B;  1D2B A;  1SE3 A;  3C46 A;  2PW5 A;  1MD2 D;  3BDC A;  4IZ8 A;  4HN7 A;  2EYJ A;  2R92 B;  4WOR A;  3UI2 A;  2XWB B;  2SEB D;  1G29 1;  2BE5 C;  3NTI A;  4HED A;  3I4L A;  2EYO A;  3HP3 A;  2PZU A;  3S9W A;  2KVM A;  3PUV A;  1NSN S;  1F9Q A;  3RZO B;  2L0C A;  1RF2 D;  1QNK A;  1TS5 A;  2VNU D;  2E74 C;  1PRT C;  3EVQ A;  5M5X B;  1QOH A;  2A73 B;  3RUZ A;  1QIL A;  2L1B A;  2AWN A;  3CU7 A;  1WTO A;  1WTP A;  1JE4 A;  3K5N A;  3TP8 A;  3HOV B;  1CQV A;  1TII D;  4CBV A;  4Q0F A;  2NWG A;  1GUW A;  1AW7 A;  4K2K A;  4H7B A;  2XVS A;  2WII B;  3OMG A;  3QWN A;  2N55 A;  5CV9 A;  4RKB A;  5C4J B;  3RZD B;  4C3I G;  1STY A;  1D1K A;  1STH A;  5F2D A;  1JWS D;  3JAM L;  2HUG A;  4R9W A;  3S1R B;  5KRU A;  3FVQ A;  2JSO A;  1OXT A;  2K05 A;  2F0L A;  4XYQ A;  3L7Z C;  3SK6 A;  5ELB A;  2B63 B;  1K8M A;  4QUF A;  3SK5 A;  5EPJ A;  4F8M A;  1BCP F;  3C2P A;  2F0H A;  2A6E C;  1TWH B;  2A69 D;  3FRP B;  4WJW A;  1AP0 A;  1SEB D;  4DGZ A;  5ISR A;  3X3M A;  5FLX E;  2JA7 B;  1H9K A;  1D5X C;  4QB4 A;  3G6J B;  2M9V A;  4QUC A;  3OIP A;  3PMF A;  1ENF A;  2PCF B;  2KCC A;  2WKD A;  2F0N A;  3GTO B;  3C1F A;  1RTN A;  1SNQ A;  4XT3 B;  1RJT A;  1S5E D;  4K8J A;  2EY5 A;  3QOJ A;  5EKI A;  4HMI A;  5CV5 A;  3V05 A;  1AEX A;  1TT2 A;  2NVY B;  2WIN B;  2EYF A;  4FNF A;  1U4R A;  1J8I A;  3HEJ A;  2VUM B;  2RSN A;  2RQX A;  1C8C A;  3I8Z A;  3J80 E;  1KDB A;  1KLU D;  4XQN A;  4DF7 A;  2FIN B;  1UEA B;  2BDN A;  1JOK A;  4HSP A;  5JEA G;  3RMH A;  2DN8 A;  3NBH A;  4PMW A;  2A6E D;  4KN4 C;  1EIH A;  2EYM A;  5EGT A;  1ZYR D;  2YU9 B;  3TP6 A;  4KJN A;  3X3N A;  2FMM A;  1Z47 A;  2Q8I B;  4MIU A;  3I90 A;  3DUZ A;  1XWE A;  2A5H A;  4FXD A;  1JIC A;  1IKM A;  1EY9 A;  1F77 A;  1O7L A;  2YYZ A;  5JPN C;  1DON A;  2B2V A;  2XRS D;  1S5F D;  5CC4 A;  4KMU C;  1RD9 D;  1SYG A;  1KDC A;  3U9O A;  3P7J A;  2JEA I;  4KKS A;  4NP5 A;  1HQR D;  4TSS A;  5J22 A;  2SDF A;  2RSO A;  5ELE A;  1E2Z A;  4BY1 B;  5C0X G;  3GTG B;  3A8I E;  1TWG B;  4QIW B;  3SXH A;  3IL8 A;  5JEA J;  1HUM A;  1D5M C;  1DD2 A;  1KLG D;  1HHV A;  4DAP A;  1V8Q A;  2F0V A;  5C4Z A;  4K5V A;  3BDO A;  3SVM A;  4RGM A;  2OT2 A;  2QF7 A;  2ID0 A;  1WTR A;  1SNC A;  1AZQ A;  3NQI A;  1S5B D;  1VF5 C;  3VR6 A;  3D4D A;  5JOB A;  3FKI B;  2ICI A;  3AB9 A;  1LTA D;  3HS0 C;  1SDF A;  4A3J B;  2B2U C;  2H1E A;  4FF4 A;  2R93 B;  1BCP D;  1JR0 D;  1NAP A;  3URY A;  3IAY A;  3A8J E;  1AN8 A;  1HPC A;  2F0Q A;  2EJF C;  3CRK C;  2O2L D;  3SEB A;  1BDO A;  3BS1 A;  3QO2 A;  2SOB A;  1EYD A;  3HRZ C;  1O7Y A;  3R8B A;  1KDA A;  5CR3 A;  1A3U A;  4GZY C;  1Y8O B;  1AZP A;  5C0X I;  3A8K E;  2ZXO A;  4EQP A;  2XNA C;  1I4R A;  2Z8L A;  5COR A;  4OO1 I;  2WAQ B;  1GXD C;  4H0L C;  1PTO H;  4DXF A;  1EOT A;  1SE4 A;  1SYE A;  1XXG A;  2XN9 C;  1CA6 A;  4S3S A;  2JP1 A;  1LTT D;  4DN4 M;  5KGU A;  4RA8 A;  5E1F A;  1YNN D;  3WOE A;  4LMQ D;  1CQF A;  1OXU A;  2NN6 I;  2A6H C;  1WTV A;  1IW7 C;  4KKU A;  4ID6 A;  1LT6 D;  3LWU A;  2KEE A;  3HOY B;  1PDQ A;  1HTP A;  2AQ3 B;  4CJ2 C;  1H9S B;  1LTR D;  4CJ1 B;  4JK1 C;  2XWJ B;  1CTM A;  3PUY A;  4FYD A;  4FVM A;  3S1M B;  4J8Q A;  3D3R A;  1Y1V B;  3FPP A;  1Q90 A;  3MXU A;  2RKS A;  5FOB B;  4ZUI A;  4QMG A;  2E76 C;  1BCP B;  3I70 A;  2Q8R E;  1QWY A;  2BE5 D;  2KED A;  4I7Z C;  4CKC A;  1O78 A;  2JA6 B;  3SDZ A;  5CBE E;  4FO2 A;  4C3J G;  5ELD A;  1G91 A;  4OL7 A;  3T16 A;  3LNN A;  4LAA A;  4C1N K;  4CKE A;  1I4G A;  5CV6 A;  4IN3 A;  4KKT A;  1EY4 A;  4I65 A;  2Z4H A;  1C4Q A;  1ML0 D;  3IFT A;  5CV7 A;  1GUS A;  2F0P A;  1XYI A;  2XSC A;  5KND A;  2EZV A;  3QB3 A;  2M2L A;  2K5W A;  2IX3 A;  1ZKO A;  5M9O A;  3ZYY X;  4IAL A;  4U68 A;  4A3E B;  5ELC A;  4C56 C;  3S1Q B;  4ZKB B;  4K2L A;  4LJZ C;  2O4X A;  1JOR A;  2EYP A;  2CW0 C;  2J0T D;  2M00 A;  1EWH A;  1MGS A;  2X6L A;  4ULL A;  3ND8 A;  3KK7 A;  5IT9 E;  2K5D A;  1Q12 A;  4RGT A;  1T5X D;  3NBI A;  4ZK9 B;  5C3E B;  3R2T A;  1LAC A;  1SYB A;  1B9N A;  4H13 C;  1W6K A;  5EQ0 A;  4ZLT F;  2RDF A;  2KEC A;  2FFK B;  3OW7 A;  2NBF A;  3HGB A;  1IKL A;  2JE6 I;  2VXW A;  3NWT A;  3GTJ B;  4Q5V A;  4RH6 A;  1EIG A;  1OO9 B;  1TR5 A;  3NSW A;  1I4H A;  2L12 A;  5I6W A;  4QF4 A;  2NTS A;  1STN A;  2EE1 A;  4RKL A;  2WV6 D;  1VCI A;  3I4N B;  1Y69 U;  4J6H A;  2DNE A;  1S5D D;  1SYC A;  5EPK A;  3NXW A;  2K32 A;  1ILQ A;  4KJO A;  5JJZ A;  5FKA C;  3W3A A;  4ZUJ A;  5K5P A;  4O1N A;  2LFN A;  1EY8 A;  5DEH A;  1BF4 A;  2EOT A;  2FMC A;  2B39 A;  1ENA A;  1WCM B;  1PZI D;  2A6H D;  2I46 A;  2IPK D;  2R3Z A;  1GHJ A;  2HCC A;  2O5J C;  1CZW A;  2B2Y C;  3PUW A;  1TS3 A;  1UAP A;  2K7V A;  3T4A C;  1I50 B;  1PYW D;  4R8N A;  2EY6 A;  5IIF A;  2A68 D;  5IOC A;  3TZD A;  2LMC B;  1LT5 D;  1STB A;  1VMC A;  1KNA A;  4IFD G;  3A54 A;  2C9O A;  4CHT B;  1Z7T A;  4G7O C;  1IL8 A;  5JVH 3;  3V2T A;  1YNJ C;  2PPB C;  1TS2 A;  2A68 C;  1ET9 A;  4F87 A;  1HTL D;  4RGO S;  2QEJ C;  3M7N A;  2CVR A;  2L4N A;  2ZXP A;  4PQX A;  3GTP B;  3ND9 A;  2E2J B;  1CZG A;  2F0K A;  1CT1 D;  3K57 A;  2PYK A;  1EQT A;  2F0U A;  1DOM A;  2AQ1 B;  3J81 L;  1SSO A;  1R4Q B;  1SFO B;  1MSH A;  1C48 A;  4ABN A;  4H44 C;  4X3K A;  4RGN A;  1X3P A;  2HDL A;  4C3H B;  3J7A F;  3GO5 A;  3S1N B;  2FJ2 A;  1BR9 A;  2ZXR A;  4MN3 A;  1V1O A;  4K8I A;  5I9O A;  1HCZ A;  2TMP A;  3HOW B;  2ICE C;  3M85 A;  4BA2 I;  1JC7 A;  1EU3 A;  5I2X A;  1YNN C;  4DXG A;  3VYS A;  2JA5 B;  1BO0 A;  1RDP D;  3CHB D;  2VB2 X;  3CRL C;  4L63 B;  4OHJ A;  1PRT D;  2B2V C;  4ZQ3 A;  1D1I A;  1SXT A;  2SNS A;  2NVQ B;  3NK9 A;  2AQ2 B;  1VF7 A;  4NW2 A;  3WDN A;  4IUV A;  3PIP 3;  4CKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...