5LMNW

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
AKEKDTIRTEGVVTEALPNATFRVKLDSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 12
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5lmnW00
4A3EG 2PQAA 4HJ9A 2CQOA 3CW2C 3K8AA 1VQIA 2PI2A 4JI8Q 1HNXL 1ASZA 2R7DA 4AYBE 3ZJYC 4FDBA 2K52A 4L5SA 2VQFL 1JMCA 5IWAQ 3PO3H 4IFDJ 4LFAQ 3AQQA 4GKJL 4DR6Q 3OTOL 4JI2Q 2RHQB 4DUYQ 4JI5L 4B3TQ 5IYBG 4BBRG 3CC2A 3F8TA 2PQAB 4A3FG 1VQ8A 1HR0Q 3GTLH 4YHHQ 2VZAA 1VQKA 3RZOH 3CMEA 3W1BA 3AYHB 1YI2A 3CD6A 4DR7Q 2A8VA 4NXMQ 1VQ4A 2RF4A 2Y0SE 2ZTEA 1PFSA 3PF5A 2OCEA 1Y1VG 4BY7H 1RIPA 2UUAQ 3UDIA 1AE2A 4LWCA 4YWMA 4Y7NH 1VQDA 3HOVG 1J5EL 2JA5G 2UU9L 3HKZE 5C0XG 2YTXA 2HHHL 3UE0A 2KCMA 1I5FA 4AH6A 4JOIC 3STBC 4X64L 1EYGA 1JJGA 3KJOA 4HIDA 2MNAA 3AFQA 4JI1Q 1PH4A 1TXYA 1S40A 3I56A 3H15A 1WCMG 1OTCA 4PG3A 2WAQG 2VS1A 2XTIA 5LMNQ 4LW1A 4A3GH 2K50A 4C3HH 3M3YH 2ID0A 4HIOA 4A3IG 4X62Q 3J81c 5LMUQ 1WFQA 4P72A 4IOCA 2CWAA 1QVGA 2UUCQ 2WB1G 2MO1A 5M5WH 3PF4A 1KAWA 1VQAA 4DR3Q 4YY3L 1NTGA 2L15A 2NZOA 4A3BG 1N33Q 4IOAA 5K36G 2JQOA 3CP0A 2ASBA 3HOUH 1IBKL 2YV5A 4H02A 2CKZB 3HKSA 5GADC 4LFAL 1X54A 1Q46A 1WI5A 3STBD 1QVFA 3I4NH 5IYDH 5JJLA 2IY5B 2ZTCA 5IYBH 3S14H 4BBSG 3BJUA 4O2DA 1SRUA 3HOWG 4QQBX 1O7IA 2IHFA 1W2BA 2BH2A 2PI2E 3EN2A 4BY1H 1CKNA 4A3CG 2C35B 1YHAA 2CWPA 3K0XA 4LUVA 5H1SE 4DR5Q 2Q2TA 1IL2A 1KQSA 1EFWA 2YTVA 3A0JA 2NVTH 4DV5Q 3IRBA 3HOWH 4JYAL 3S2HH 2JK8A 1YEZA 1Y1VH 3SGIA 2KENA 4JI0Q 3U4ZA 2UXBL 4X66L 4HJAA 1FVIA 3MXNB 4JOIA 3NEMA 5HY6A 3CC7A 3CCQA 4YWLA 3S1NH 1K83H 1GKHA 1YIJA 1IBLQ 3PIOA 5M3FH 1UE6A 5ELOA 4A3GG 1TWCH 4LF7Q 5JJKA 1WCMH 4UP7A 3L7ZC 3H3VI 1S72A 4JI6Q 4L5QA 1SROA 2A19A 3M4PA 4QIWE 1A8VA 2Q2IA 1L2FA 1TWHH 2ES2A 4HJ7A 2K5HA 4NPSA 4BBRH 1XMOQ 4X64Q 4POGA 3G48A 3OW2A 3HOYG 1CKMA 1XNQL 4AQYL 3H0GH 3T1YQ 1OXSC 3A5ZB 1LTLA 3PV0A 4OONA 4YY3Q 5C4JH 3J81j 4GNXC 3T1HL 1MKHA 2Z0SA 1LM0A 3E9HA 2LXJA 4APVA 1HZAA 5IYDG 3KDFB 4A3MH 4NXNQ 1I3QH 2OTJA 4HIMA 4LFBL 1KIXA 4DPGA 4LF6L 4P75A 4PZ7A 1VQ9A 3D31A 1OXVA 4PZ6A 1QZGA 4TQUS 3KJPA 2I0QA 4LF7L 1D7QA 3RLNA 1IBML 1E3PA 2XGTA 4X6AH 2WP8J 1L1OC 1V1QA 3A74A 3PUVA 3E0EA 3PSIA 4QL5A 2V1CC 4NXNL 5IP7H 3CXCA 4DV1Q 4GOPA 4R4CA 3NBHB 4C3JH 4QGUA 4MZ9A 1YNXA 2I5HA 4YCWA 1YHQA 4IFDI 2PMZE 1BBUA 1A0IA 4OX9Q 3K81C 3I4OA 4KLKA 3J80i 4B3ML 2VQFQ 1YJ9A 4NB3A 1W3SA 1VQMA 1Z47A 4R4QA 1UE5A 4LF9Q 3A5UA 4DR2L 1N33L 4A3JH 4A93H 1XPOA 1D8LA 4C2MH 1Q1BA 1SMXA 2R6GA 2AMCB 2QA4A 3NELA 2JA7G 1LYLA 2E5LQ 3CCMA 1UE1A 4BY7G 1VQOA 4DV7L 2Z6KA 1PHJA 4LFBQ 2Q2HA 1SLJA 3EIVA 3EBEA 2CCZA 3M9BA 2ZJRA 1HNWL 2N49A 4DV3Q 4P71A 2UUBL 2F4VQ 1PH8A 4BXXG 2K75A 2FXQA 1PH9A 4DAMA 1Z9FA 2R93H 1Y1WG 3RLOA 1X9NA 1Q81C 3AEVA 2Q2UA 1XNRQ 3HFZB 4GKKL 1BVSA 2YYZA 2E2HH 1BKBA 4AQYQ 4LF8Q 2R92G 4JI2L 2NVQH 4JV5L 1HZBA 2HQLA 2NN6G 2WB1E 4JBJA 4DR1L 1SR3A 3UDGA 1Q12A 4EQ5A 1GD7A 5IP9H 2UU9Q 3KYHC 3PUYA 3Q8DA 1B8AA 1NBWA 3S1RH 4B3MQ 1JJCB 2IT1A 1VQ5A 2GVBA 1XNRL 4GKKQ 4DKAC 1XPUA 1UEBA 4X65Q 1DGSA 2I5LX 2Y0SG 3FP9A 1PH7A 4KI0A 2OQKA 2VW9A 4IFDG 2NVXH 4NXML 1Q86C 5LMUL 5ELNA 1KXLA 1KC8C 3CCLA 2F3IA 4JBKA 1YITA 3CCUA 1K8AC 4WJ3M 1HR0L 1JB7A 3TRZA 2JA8G 5E7NA 4L5RC 1X55A 2ZM6L 5M3FG 2K5NA 1K0RA 1I6HH 5J3BA 1Q82C 1RL2A 1N36L 5GAHC 3TREA 2AWNA 1A62A 3KF6B 1PH2A 4A3LG 4ME3A 2E2IH 3KLWA 2ZM6Q 3T1YL 4A3KG 1NJIC 1CSPA 1E7ZA 4PMWA 3U58A 1HNZL 2RHSB 1BBWA 3J7A5 4JI7L 1N9WA 1YZ6A 4UY8C 5IYCH 5LMNW 4X62L 2B63G 3S24A 1KRTA 3JAMc 2B3GA 1QUQA 4DV5L 1XJVA 1FJGQ 4A3CH 1HH2P 3GTQH 3DLLA 4JYAQ 4GS3A 4UP9A 5C4XH 4L5TA 3FKIG 3J7ZC 3BU2A 3W1GA 3S17H 4P74A 3ULPA 1PH1A 4HIKA 1PVOA 3HOXH 4A3KH 4UPAA 4YHHL 4LF4L 4A75A 5JEAG 1HZCA 4IJHA 1E1OA 1OXXK 4EX5A 3FHWA 1Y1WH 1M1KC 1IBKQ 2K4KA 3G4SA 1N32Q 4B3TL 4JI5Q 1XNQQ 2HT1A 1X3EA 3HOUG 4XTCS 4AYBG 2MQHA 5AJ3Q 2JEAI 1UE7A 4LF4Q 1WYDA 4JBWA 4A3BH 4GNXB 1K3RA 1Y14B 4DR4Q 2F4VL 4DV2L 4A76A 4DV1L 3G6EA 1VCIA 2JA7H 2WAQE 4K0KL 3F1ZA 4LUZA 1JE5A 1V43A 2ZJPA 4C3IH 1QZHA 1FL0A 2JA8H 5JJIA 5EAYA 2YU9H 4MNOA 1KHIA 1TWAH 1QUQB 4LFCL 3CMAA 2B63H 1WJJA 2N3SA 5JEAJ 3I2ZA 5GAEC 3WWVA 3J81i 3HOXG 4GLXA 3RN5A 1XPRA 1E1TA 2Z6KC 3HOZG 5C0XI 1L1OB 1SFOH 3BZCA 3HKZG 5IP9G 1VQ6A 4DR6L 4DV0L 1E24A 2R7FA 4DK3C 3CCSA 2OWOA 4J15A 4DV6L 4TVAB 3I55A 3KF6A 1U5KA 4KHPQ 1X56A 3PUZA 1IZ6A 1X6OA 1K8GA 1HNXQ 3PO2H 5M3MG 4BXXH 3CPFA 2UXDL 2KBNA 3RZDH 1VQNA 2BH8A 3S1MH 3PUXA 3VDYA 3I4MH 3JAMi 1PYSB 1NY4A 3RR5A 5FLMH 3CCVA 4OWWB 4OXPA 2EQSA 1Q7YC 2OTLA 4DUYL 3GTOH 4B3RQ 4A3JG 1HJPA 1I50H 1GM5A 3M7NA 1IYJB 2R7ZH 3HOYH 4LF9L 1HNZQ 3FKIH 1VQ7A 1QVCA 1X65A 3G71A 1NMGA 1YVCA 4KHZA 4OX9L 2JE6I 3BZKA 1SN8A 3B6YA 3PO3G 2UUCL 4JI8L 4IPHA 4DV6Q 5IYCG 4IO9A 4DR1Q 1XMQL 5IWAL 2HIVA 3J80c 5IE8A 3UDFA 5LMNL 1A63A 3CCJA 3MEFA 3GTGH 1N34Q 3L0OA 5GROA 5M3MH 2CFMA 5FLXc 4R4OA 2E2JH 4DK6C 2JA6G 1R9TH 2PNHA 4DV4Q 3PIPA 3CCEA 4BA1I 3I4MG 3KFUA 2LSSA 3JC66 4IJLA 2ZJQA 2R92H 4JI6L 5DLQE 4O0AA 1N34L 4QY7A 2DGYA 5C3EH 1MJEA 1SE8A 2OQ0A 1CUKA 1VQCA 4MTNA 1VQPA 4DR4L 4DV2Q 1C7YA 1EIYB 1I94L 1MJCA 4JBMA 1EQQA 3HOZH 1AE3A 1IBLL 2IHEA 4P73A 1LUZA 1OXUA 3CAMA 4PZ8A 4RMFA 4LF8L 1IXRA 1PYBA 3GTJH 3RNUA 4GKJQ 4JV5Q 1H95A 1B7YB 4JI4L 3ULLA 3U50C 4DAYB 2NVYH 1J5EQ 1L1OA 2JEBI 1G51A 4OWTB 4DR5L 1I94Q 4DUZQ 4LF5Q 3F2DA 2BA1A 2VQEL 1TWGH 4GOPB 1HNWQ 3I4NG 2KHJA 1PH6A 4RG1A 1K9MC 2IX0A 3S2DH 2JA9A 3TS2A 2JJQA 3KF8B 5IY0A 2VY3A 1GO3E 4POFA 3UDXA 2E5LL 3I7FA 1FJGL 1EOVA 1NMFA 4DV7Q 3GD7A 1VQGA 2AHOB 3KDFA 3TEHB 2E8GA 4JI4Q 3M4OH 2UXCL 4GNXA 1PV4A 4ALPA 4JI3Q 1JT8A 3PO2G 2GVAA 1JJ2A 3S15H 4R4IA 1VQFA 4A3DH 3OYYA 1T9HA 3M4QA 5C44G 2MO0A 1CSQA 1UWVA 2UUAL 5FJ8G 1PH5A 3CC4A 4QJFA 3NENA 3T1HQ 1VQBA 3RN2A 3U4VA 4DNIA 3M85A 1L0WA 4B3SQ 4BA2I 1GVPA 4A4IA 4JCVE 3H0GG 3TQYA 5C44H 2VQEQ 4DR7L 1VQHA 4JI1L 2AKWB 2ZTDA 2R7ZG 3D0FA 1EQRA 3K80C 3PUWA 5BR8L 1V9PA 1X3FA 4Y52H 2RCNA 1OXTA 1HZ9A 4B3SL 2IX1A 2QGQA 4IPGA 2HIXA 4HJ5A 3GTMH 3L2PA 2ALYB 2K5VA 2VNUD 1M90C 4GLVB 5FLMG 3F2BA 1YJWA 1WOCA 4DV0Q 5GQOA 3RLFA 1U0LA 3GO5A 4OO1I 2F52A 1VQEA 1XTDA 2KHIA 3E9IA 2N78A 3H3VH 1EIFA 1E22A 3CQZH 4YWKA 4A3IH 4B3RL 3DM3A 3ER0A 3KOJA 1IBMQ 5C4XG 4A93G 1VS0A 1PA6A 4AIMA 4JC0A 2VUMG 1CKNB 4LUOA 4R1JA 4BY1G 4X65L 2EIFA 2N8NA 2WFWA 3ULJA 4JI7Q 2ATWA 4LFCQ 5IT9c 1S3OA 1XMQQ 2H5XA 3UE1A 3LGJA 1Q8KA 3PCOB 5AJ3L 3GDEA 4DR2Q 4KHPL 2HHHQ 4A3LH 1TWFH 5FJ8H 1KD1C 4YCUA 5IP7G 2LXKA 1C0AA 2D62A 4WJ4A 4A3EH 1J6QA 1YBYA 4JI3L 4A3DG 1N8RC 1KRSA 2D0PA 1X3GA 2VUMH 3OTOQ 1N36Q 1C9OA 1XMOL 3GTPH 4BBSH 1CKOA 2BA0A 3HOVH 1EUJA 2UXBQ 4GLAC 1HR0W 3K7AH 2R93G 4A3MG 1P16A 4GN5A 4GN3B 1B70B 2D0OA 2NN6I 3CCRA 4DR3L 1PH3A 3GTKH 2K14A 3PGZA 3ICEA 4GOPC 5GAGC 1AH9A 2DUDA 2EXDA 2KCTA 2A1AA 4XIGS 3CPWA 4DUZL 4A3FH 4LF6Q 5M5YH 3ERSX 2GN5A 2B29A 2VL6A 4IPCA 2QEXA 4OO1G 4UP8A 1G6PA 3F2CA 1NE3A 1K73C 1Q1EA 1KL9A 4HJ8A 1G291 1P8LA 1YHBA 3W5OA 2NZHA 5M5XH 3TS0A 1YJNA 4X66Q 4LF5L 4R4TA 4JG2A 4LNQA 2UXDQ 3CF5A 2JA5H 1VQJA 1MIUA 2UXCQ 1N32L 2I5MX 5C3EG 5BR8Q 3AFPA 3S1QH 4JI0L 1VQLA 1EWIA 4DV3L 2UUBQ 4OWXB 5HGQA 4GN4B 5C0XJ 2AWOA 2YTYA 2JA6H 4IPDA 4K0KQ 1FGUA 2MFIA 3K7UC 4YCVA 3S16H 4DV4L 1ASYA
chains in the Genus database with same CATH superfamily
1CM9A 2O5IC 2CQOA 3CW2C 3K8AA 3KLSX 5ELDA 2K5DA 2L11A 3ZJYC 2A6ED 4FXGC 1JMCA 5IWAQ 3PO3H 1TS5A 3NTHA 4GKJL 3OTOL 4JI2Q 4JI5L 1HR0Q 2QDBA 1VQKA 4PNYA 1Z6HA 1EL0A 4KN7C 3CD6A 3AYHB 4IUVA 3K7AB 1FGBD 2RF4A 3U9SA 5A2QL 2OCEA 2EOTA 1JCKB 1J9OA 4IURA 5TSSA 3S9WA 3HOVG 2G9HD 3K5OA 2JA5G 3G6JB 5I9OA 3UE0A 2KCMA 1HQMC 3STBC 4XQNA 2MNAA 1D1KA 3K0YA 1PH4A 1HRJA 2WAQB 1WD1A 2CH4W 4A3DB 3OHXC 1EWHA 3I3CA 2J4XA 1HFNA 1TY2A 3M3YH 2ID0A 2K32A 4X62Q 3J81c 5LMUQ 2WACA 1QVGA 2MUYA 3WDNA 3PF4A 1MHWC 4YY3L 4A3BG 4RKBA 2AQ2B 1YNNC 2KCCA 2LMCB 3HKSA 3TZDA 5GADC 3EA6A 5IYDH 1QVFA 2A6EC 5E3FA 3BJUA 1SRUA 1FNVA 2QEJC 1B3AA 2PI2E 1CKNA 2Y0SB 3A8JE 4LUVA 2RCFA 5H1SE 2Q2TA 1EZ8A 3HOWB 2R92B 1PTOD 5C4ZA 4JYAL 3IRBA 1YEZA 1Y1VH 1I4RA 2KENA 4JI0Q 2PZUA 3QOJA 4MIUA 4JOIA 1I3QB 1R9TB 3S1NB 2RBMA 5ELOA 5EKKA 1SFOB 1KNEA 3T56B 4F7XA 4A3EB 4JI6Q 1Q3LA 1SROA 4OGQC 2IL8A 4HJ7A 3DM1A 3S1QB 2Q8RE 4NPSA 5KEEA 4X64Q 3OW2A 1NUCA 2F3VA 2NVTB 4FVMA 2RSNA 3H0GH 4BS9A 3J81j 1MKHA 1JR0D 3K57A 2C5CA 4ZAIA 1NR4A 4CJ1B 3LWUA 4QB4A 1RD9D 2IJ0A 4NXNQ 4MHEA 4HIMA 3QWNA 1OXVA 4DNRB 4NW2A 4TQUS 4K5VA 2QW7A 1HHVA 3DUZA 3PSIA 4C1NK 4GOPA 4NXNL 1WTRA 4C3JH 5LHY1 4QGUA 1RHPA 2I5HA 2F0EA 4DAYA 5E1FA 1A0IA 1BBUA 4OX9Q 5JAVA 1HA6A 1Y8NB 1HTPA 1Z47A 3D6WA 4DAPA 3I73A 1A2UA 2M00A 2AMCB 3NELA 2JA7G 1B50A 1LYLA 4QF4A 5JVH3 4BY7G 1VQOA 3H94A 5E4WC 1PFNA 2F3WA 2Q2HA 3EIVA 4GZYC 4P71A 1WTOA 2F4VQ 2K75A 2CVRA 5L37A 4CDCC 3A7LA 2K7VA 3OIPA 3RLOA 1X9NA 1K3BC 1Q81C 3AEVA 2YYZA 3VR6A 1BKBA 4AQYQ 4JI2L 1VMCA 4JV5L 1XMQQ 3GTJB 4WJ3M 1Q12A 2KEEA 3CKIB 2DNCA 1NBWA 2E74C 3WOEA 3I4LA 3NTIA 2AQ1B 5EBCA 4X65Q 4KI0A 5KRUA 4NXML 4NP5A 3CCLA 2F3IA 4HSVA 3R3OA 4KKUA 5CV4A 3SK5A 4I65A 5M3FG 1HCZA 4A3MB 1DOMA 4G7HC 1A62A 1GXDC 1ILPA 2ZXPA 4A3LG 2B2VC 4XXEA 1AFPA 1CSPA 4PMWA 1EEFD 2RHSB 1IL8A 5IYCH 3S24A 2XRQD 1QNKA 1LO5D 4IQZA 3T13A 1B2TA 4JYAQ 4HMIA 4V190 3QJYA 2A5HA 3S17H 4J1MA 3ULPA 1PDQA 5JOBA 4A75A 5IGCA 5JEAG 4IJHA 1E1OA 2X6LA 2H4OA 5JVG3 1N32Q 1X3EA 4AYBG 5AJ3Q 2EY2A 5COYA 3NBIA 1TR5A 3G6EA 2WAQE 4ZLTF 1TS4A 4K6LA 4CDDC 3GTMB 2F0KA 4C3HG 3OOCA 4OHJA 3VYUA 3FRPB 4CKEA 1LTTD 2N3SA 1GJXA 3GTQB 1C4QA 1FYCA 2Z6KC 4HCEA 3HKZG 1VQ6A 4ZYSA 3KBGA 3CCSA 5IGGA 2JN4A 3KF6A 1U5KA 2JSOA 4KHPQ 1IZ6A 3U9OA 3DEPA 4BXXH 2KBNA 2F1MA 3PUXA 3OWEB 3G7LA 1HUNA 3DMUA 4PQXA 5ELBA 1Q8IA 2VUMB 4BBSB 1HJPA 3M7NA 2SEBD 2LY7A 2HD3A 4LMQD 1VQ7A 4XT3B 1L0XB 3PMFA 4JVZA 2E2DC 4IUUA 2JE6I 3B6YA 2UUCL 4IPHA 4J6HA 4C3JB 5IWAL 4C3IB 3CQZB 5IE8A 3CCJA 3GTGH 4HEDA 5M3MH 2K04A 1B9MA 4KD3A 2E2JB 4R4OA 1CFMA 4BA1I 2LSSA 3JC66 5NUCA 4X3UA 5DLQE 4O0AA 3SE0A 2B2YC 1AZQA 1BR9A 4QY7A 5C3EH 4FF3A 1SE8A 3PQIA 1VQCA 1VQPA 4A3GB 1LT3D 1C7YA 1AE3A 1LUZA 1OXUA 4GKJQ 3GTJH 3RNUA 4JV5Q 1B7YB 2HDMA 3UI2A 4ZKBB 1CQFA 3U50C 2PQEA 1EEID 2JEBI 3OMGA 1I94Q 1A6XA 2VQEL 1MBYA 1SYCA 4C2MB 2EY1A 3Q6SA 3K59A 2L12A 4CBVA 1FJGL 1EOVA 1AN8A 3GD7A 3QG1A 3PO2B 5DEHA 3VYSA 4BY7B 3M4OH 3HOUB 1BBXC 4GNXA 1PV4A 3PO2G 1IYVA 1A15A 2MO0A 2UUAL 4KHVA 1PH5A 1JC7A 3NTKA 1B9NA 5IOCA 3BDOA 1L0WA 1S5ED 1ENCA 4B3SQ 3QR8A 1GVPA 3NHHA 1H9MA 4K5XA 4K14A 3TQYA 2AKWB 2ZTDA 2R7ZG 4KJOA 1EQRA 3K80C 3PUWA 1LT6D 2RCNA 1OXTA 4RHSA 3GTMH 1GOZA 3S14B 1DCZA 1RKNA 5EPKA 4DU9A 1M90C 3MXNA 1CHQD 2G5DA 1G8ZD 3GO5A 2EY5A 3P7JA 5FOBB 4A3JB 4A93B 1M8AA 3KOJA 4CDFC 1IBMQ 5C4XG 4KJNA 1PA6A 1EY9A 1ZKOA 1G2TA 4BY1G 4ME5A 3HOVB 2N8NA 3ULJA 4JI7Q 2ATWA 3MC0B 4LFCQ 4RGOS 2HUGA 3PCOB 3GDEA 4DR2Q 5CV7A 3R93A 4KHPL 2RKSA 1C0AA 5JJZA 4KV6A 4A3EH 1YBYA 4KTAA 2A6HD 2VUMH 3R2TA 1XMOL 3TSSA 4BBSH 3D3RA 4FXDA 3HOVH 2R93G 4A3MG 2D0OA 3TMEA 2NN6I 5I2XA 5KNCA 1AH9A 2EXDA 5I6WA 2FMMA 4LF6Q 4A3FH 5M5YH 2B29A 2A68C 4UP8A 3EJIA 1NE3A 2XWBB 1P8LA 1DONA 1YHBA 4PV1C 3I72A 4R4TA 4LNQA 1V8QA 4EQNA 1UNSA 2UXCQ 1QWYA 2JA8B 3MZ5A 4XYOA 4DV3L 2UUBQ 2YTYA 4IPDA 1S4ZA 5CV8A 4NMZA 3K7UC 3NE5B 4DV4L 4A3EG 2PQAA 2NBFA 4S3SA 1ASZA 4AYBE 5C5MA 2K52A 4N8FA 1IW7C 2QDLA 4JPBW 4ZQ3A 4IFDJ 1PTOH 3TP6A 2QCPX 4BBRB 4DR6Q 3WOFA 3CRKC 2OT2A 4A3FG 1AP0A 2VZAA 1CHPD 1YI2A 4C56C 5K36H 4NXMQ 5FLXL 1VQ4A 1PTOC 1FNWA 3NXWA 2Y0SE 1RIPA 2UUAQ 4LWCA 1MSGA 5A2QE 3HKZE 3J81L 4RFBA 2HHHL 4AH6A 3ITPA 4IZ8A 1CZWA 1HPCA 5T1IA 3AFQA 1BUVT 4OO1H 1H9RA 1MGSA 1WCMG 1II3A 4PG3A 2XTIA 2K50A 4FP5D 3D8GA 3IKJA 4IOCA 2WB1G 5M5WH 1KAWA 3AU7A 4DR3Q 1YNJD 1T5XD 5C4HA 1N33Q 4IOAA 1EIGA 3CP0A 1PRTB 2FHTA 1H9SB 1AW7A 3I90A 3VA7A 3HOUH 3A55A 2EYHA 2DJFC 1EU3A 5IGEA 2ZTCA 1ENAA 2DJGC 2MGSA 2DNEA 1O7IA 4FXKC 4BY1H 2R92H 2CWPA 2L1BA 2FJ2A 4DR5Q 3HOWH 3PO3B 1KQSA 3T16A 2YTVA 4DV5Q 3E0JA 3S2HH 2KECA 5IIFA 3SGIA 2PW5A 3U4ZA 4K2KA 2UXBL 1TWHB 4X66L 1FVIA 3NEMA 3CC7A 3RZDB 1I4QA 4H0LC 5KNDA 1PZJD 4DN4M 3CCQA 3A7AB 1JWSD 2BDOA 5M3FB 4RAUC 4A3KB 3GTLB 4UP7A 4L5QA 3T51B 2A19A 4QIWE 4EGVA 2ES2A 2XN9C 4BBRH 4POGA 4RA8A 3HOYG 5IT9L 1CKMA 1XNQL 3H0GB 4HTHA 3T1YQ 3A5ZB 4YY3Q 1F2LA 2B2UC 3NP8A 2Z0SA 1R4PB 1V1OA 2CW0C 1HZAA 5IYDG 3MFYA 4CJ2C 2EDGA 4A3MH 1I3QH 5DM63 1KIXA 4DPGA 1BO0A 1JOKA 4LF6L 4P75A 4PZ7A 1VQ9A 3D31A 2AQ3B 1KDAA 2I0QA 3KF8A 4ZKCB 2XRSD 2WP8J 4C3HB 1L1OC 2HCIA 3E0EA 4DV1Q 2A69D 3ONAB 2A73B 1S5CD 1WTWA 3K81C 5CBEE 2RVLA 1DOKA 4NB3A 3NWTA 4R4QA 1UE5A 3A5UA 2SDFA 5E4XA 4H13C 2E2IB 1ESRA 1SEBD 1UUPA 1O80A 3K6OA 3SVMA 3DEOA 1MSHA 2QKIC 2Z6KA 1PHJA 5CGKA 1SLJA 3M9BA 1KABA 1EY0A 3DXJC 5CV6A 2ZJRA 4DV3Q 2UUBL 2JYOA 1PH8A 1D5XC 1EYAA 4BXXG 4A3BB 2CH4A 1K83B 3BDLA 1Z9FA 4ODGA 1A3VA 1QE6A 2Q2UA 3HFZB 4LF8Q 2E2HH 1XXGA 4X3SA 1HZBA 1SNPA 2NN6G 2WB1E 4JBJA 4DR1L 3UDGA 5IP9H 2F0WA 3NUCA 4HR7B 4CGYB 2IT1A 1VQ5A 2GVBA 1UEBA 1DGSA 2Y0SG 1J8IA 5IGFA 4KKTA 2OQKA 5LMUL 4JBKA 3CCUA 3VA5A 3TRZA 2JA8G 2B2TA 4C3JG 1I6HH 5J3BA 3S1MB 5GAHC 2AWNA 1SYDA 1PH2A 2L0CA 4DXFA 3KLWA 3KBXA 1NJIC 4N8X1 2WINB 2D2CC 3J7A5 4JI7L 4UY8C 2B63G 1B44D 2K03A 4DV5L 1XJVA 1HH2P 3GTQH 3DLLA 4GS3A 4UP9A 5C4XH 2O2LD 3J7ZC 3W1GA 4P74A 1TU2B 4HIKA 3HOXH 4UPAA 3EFXD 4A3FB 2F0JA 4WORA 1HZCA 1M1KC 2K4KA 1E2ZA 4B3TL 2OEOA 1DYQA 3HOUG 4XTCS 2MQHA 4A3BH 4GNXB 1K3RA 2JP1A 1VCIA 1DJRD 1QILA 1TWCB 3F1ZA 1JE5A 4ZUJA 1ET9A 1FL0A 2JA8H 2YU9H 2AUKA 3HOZB 1SXTA 3LNNA 1ILQA 1RTOA 4LFCL 1I50B 1G6ZA 1STAA 3ND8A 2ZT9C 3HOZG 3RN5A 4GLXA 1E1TA 4IUPA 3C1FA 1RDPD 4DR6L 1E24A 4WJWA 4J15A 3GQBA 1KDBA 1X56A 3PUZA 1X6OA 3J81E 1K8GA 5M3MG 1QJOA 3RZDH 3S1MH 1EYDA 5FKAC 3RR5A 4Z9CB 4OWWB 1TWGB 1JOQA 2EQSA 1QB5D 5FO8B 3GTOH 4B3RQ 1TY0A 4ZUIA 1IYJB 2R7ZH 3HOYH 1HNZQ 1JWUD 3FKIH 1X65A 4KHZA 1NMGA 3K5LA 4XDXA 2F0GA 4QIWB 5IYCG 2A6HC 3UDFA 1A63A 3DWQA 2M2LA 3MEFA 3VR4A 1SNDA 2PZTA 2PMZB 4ZCKA 2CFMA 2ENBA 5FLXc 1NR2A 2JA6G 2PNHA 4DV4Q 3I4MG 1I6VC 3W2DA 3KFUA 2B2WA 3H91A 4JI6L 4PMBA 2DGYA 1MJEA 4DR4L 1CUKA 2KEDA 2LS01 4MTNA 1K8MA 4DV2Q 1WTHA 1O78A 1EQTA 1I94L 1LT5D 4JBMA 4P73A 3BZDB 3CAMA 4LF8L 1ET6A 4QUCA 5CR3A 1LT4D 4DR5L 4LF5Q 4IN3A 2NVQB 2PNRC 5I4DA 3KF8B 4POFA 3UDXA 1TS2A 1EQVA 2AHOB 3TEHB 2K5QA 4JI3Q 1JT8A 2GVAA 4A3DH 5AFWA 5FJ8G 3A54A 3RN2A 4X3TA 4DNIA 2EE1A 2B2WC 3KLRA 1VQHA 1SSOA 2F0HA 4JI1L 3D0FA 5BR8L 1PFMA 5JPNC 1V9PA 2NZ1D 4F8MA 1HZ9A 2QGQA 3TP5A 2K05A 1ONLA 2OXPA 3J80E 2K5VA 4V0BA 2VNUD 3MTSA 1JWMD 5FLMG 3F2BA 3I91A 4DV0Q 3MVVA 1GUNA 2ZXOA 1VQEA 1PRTD 5C4JB 2N78A 3H3VH 5FO9B 4B3RL 3ER0A 3R8BA 4DF7A 1Y1VB 5IGDA 4LUOA 4R1JA 4X65L 1BXTA 5IT9c 1S3OA 1GUGA 2FMCA 3TP7A 1TWFH 5FJ8H 5IODA 4A3IB 1PXUA 2LXKA 5IP7G 2D62A 1KD1C 4QCLA 1KAAA 5G3LF 2D0PA 1H9SA 3J7YW 3C46A 3OTOQ 1C9OA 1RF2D 3GTPH 3R2IA 2BA0A 2KQ3A 1EUJA 3O13A 2NTTA 1HR0W 1EFID 1P16A 4GN5A 4ZK9B 5KYLA 3GTKB 4C1NI 1A3TA 1F2YA 3MXPA 1RJTA 1D1IA 1C48A 1SAPA 4XIGS 3CPWA 3ERSX 5JPMC 1SNQA 3VR2A 1SMYC 1K73C 4HJ8A 1WTPA 3W5OA 1HTLD 2F0TA 5M5XH 2B63B 2UXDQ 5J22A 4Q5VA 2H1EA 2FINB 1MIUA 5M9OA 1JICA 1XTCD 4UAIA 2B2TC 4PMCA 3AFPA 5CBAE 4OWXB 3HGBA 4GN4B 2AWOA 2F0QA 2JA6H 1FGUA 1HUMA 2MFIA 3MEHA 2MP1A 4YCVA 1ASYA 4N9PA 1HNXL 4JI8Q 2R7DA 1FR3A 4FDBA 3GTGB 3C3LA 4L5SA 3BVZA 3SDZA 2VQFL 4I7ZC 3D4DA 3TZUA 2F0PA 2J0TD 4LFAQ 1STEA 3F2UA 4B3TQ 4QUFA 2K6AA 5IYBG 3SK8A 3C1EA 3NWSA 2BE5D 2PQAB 4B9WA 2E2HB 1G91A 3A8IE 3GTLH 2YU9B 2N88A 3RZOH 1LV9A 2NYZD 3W1BA 4DR7Q 3C2PA 2RDGA 1SYFA 2D5DA 4NDXA 1SMYD 2WKDA 5C4XB 3PF5A 4F87A 5CV5A 3UDIA 5J1ZA 1BNZA 1EY5A 1VQDA 1HQRD 2F0UA 1B3QA 1PTOF 3TP8A 1I5FA 4JOIC 2EXZA 4X64L 1LABA 1EYGA 4HIDA 1S5DD 5KIXA 3VYRA 1I4XA 2O4XA 1S40A 3I56A 3H15A 5CC4A 5IT9E 2WAQG 5F2DA 5I2YA 2EVBA 5LMNQ 4LW1A 4A3GH 4C3HH 4EVOA 5M5YB 3N52A 1U9RA 2NB0A 1WFQA 4HN7A 4P72A 3PIP3 2VXWA 1NTGA 2L15A 2NZOA 2JA6B 2JQOA 1IKMA 2A68D 2ASBA 1IBKL 2Z4HA 2CKZB 1Q46A 1WI5A 3S17B 3I4NH 3M3YB 4ABNA 1HA5A 4BBSG 4O2DA 3HOWG 4QQBX 1ML0D 2RSOA 1W2BA 2BH2A 4A3CG 3K0XA 1YHAA 4IUQA 4HAEA 1IL2A 1EFWA 1YNND 3HZXA 3A0JA 1F2MA 3EQLC 5KGUA 4JW0A 4HJAA 3K5NA 4K6DA 3MXNB 1TVXA 5HY6A 1K83H 1GKHA 1XWEA 1YIJA 3VYTA 4NKLA 5CMDA 5M3FH 2RQXA 4K2LA 4A3GG 2EY6A 2B8GA 5JJKA 2SNSA 3Q24A 3L7ZC 3H3VI 2EPBA 2PCFB 2PYKA 1IYUA 1A8VA 2Q2IA 3H3VC 1L2FA 3FEWX 3QB3A 2RDHA 1SNOA 4XQJA 3G48A 4DK1A 2BDNA 4AQYL 5DAUA 1OXSC 2L55A 3PV0A 4GNXC 1LM0A 2B39A 3I8ZA 1STGA 2R61A 5CORA 3MWYW 3BDCA 5BN3A 2OTJA 5C3WA 4LFBL 3IL8A 2BOSA 4PZ6A 1QZGA 3RLNA 1OO9B 1E3PA 1STYA 2XGTA 4X6AH 3S16H 2F0LA 4QL5A 5IP7H 3S2DB 1YHQA 2PMZE 1F2ZA 1QG7A 3J7AV 1LTBD 3J80i 5EJWA 2VQFQ 1SDFA 4LF9Q 5KNBA 1N33L 4A93H 1XPOA 4C2MH 2MHVA 1Q1BA 1SMXA 2VB2X 2WB1B 5I9PA 2QA4A 3DHQA 2NVXB 1LTRD 1D2BA 3CCMA 1UE1A 5ISRA 4IUTA 4LFBQ 2N55A 3FVQA 2MJ8A 3Q0AA 4P2CB 1WTXA 1Y1WG 3J80L 4O42A 4GKKL 1PFBA 1LACA 4B9XA 1ZEQX 2K1BA 5CV9A 4KD4A 1SR3A 4DA2A 2UU9Q 4EQ5A 1GD7A 1E2WA 3S1RH 3HS0C 1JJCB 3D4RA 4GKKQ 1XPUA 1PH7A 3MXUA 2Z4IA 4IFDG 4H7BA 1KC8C 2AUJD 1V1PB 1YITA 3FPUB 2L4NA 4ZRZA 1JB7A 1X55A 2K5NA 1K0RA 4RCNA 5FK9C 1N36L 1U4PA 3TREA 3KF6B 3S16B 2F0VA 2E2IH 1UEAB 4OIKA 1F9RA 4A3KG 2IPKD 4R8NA 1BBWA 1NNXA 2Z1CA 1B4OA 1YZ6A 5FO7B 4X62L 1KRTA 4A3CH 4XYQA 3BU2A 1WTQA 1PH1A 1PVOA 3GP7A 4YHHL 1ZXTA 2IW3A 1D5ZC 1IBKQ 4EX5A 4AYBB 2HCCA 3G4SA 4RGMA 1KDCA 1TKWB 1XNQQ 3RMHA 3RD4A 1F9PA 4I7AA 2HDLA 4DR4Q 3Q22A 4MN3A 2NVYB 2F4VL 4DV2L 3KLSA 4DV1L 4QMGA 4A76A 1VF7A 2JA7H 4K0KL 4LUZA 2XNAC 2ZJPA 3OIQA 5EAYA 4MNOA 4KY6A 1TWAH 3CMAA 3J81i 5JEAJ 3I2ZA 5GAEC 1XPRA 3HOXG 1L1OB 1SFOH 5IP9G 1KLGD 4UHVA 2R7FA 3ZYYX 4DK3C 3HOXB 2OWOA 4OL7A 3T4AC 3BVMA 1HNXQ 1VQNA 4KKSA 2BH8A 3M7GA 1A2TA 3I4MH 4DFAA 1TQOA 3CCVA 1JE4A 4MTKA 1CT1D 1NSNS 1Y8OB 3CRLC 1Q7YC 3N6RA 3S2HB 1I50H 3H09A 2K01A 1QVCA 3GV3A 1EY8A 3MHBA 5ELCA 4L63B 3G71A 1YVCA 4OEMB 1SYBA 2L5TA 4JI8L 4DV6Q 5D65A 4IO9A 2A74C 1XMQL 2B2UA 2HIVA 2EJFC 4M1UB 2G9DA 4TRDA 2WIIB 3E6ZX 2EYJA 1PYWD 4DK6C 1R9TH 1WVLA 1EOTA 3CCEA 4RH6A 5FLXE 3V96A 4TKOB 4HSPA 1I4HA 3DWAA 2OQ0A 5BN5A 5EKLA 1EIYB 1RODA 1EQQA 1IBLL 2MPMA 1JORA 4PZ8A 4RMFA 1IXRA 1PYBA 3FKIB 1H95A 5ELEA 1HFGA 4DAYB 1G51A 1O7ZA 4DUZQ 2IX3A 2BA1A 4GOPB 1TWGH 5C3EB 2KHJA 1PH6A 4RG1A 1LTSD 2IX0A 3MFGA 3TS2A 1SNCA 3S1RB 2F0SA 1CA6A 4Q0FA 3I7FA 1VQGA 5D3DA 5A35A 2RA4A 4JI4Q 2E8GA 4CKBA 4ALPA 1JJ2A 4R4IA 5D3IB 1T9HA 3M4QA 2K5WA 1UWVA 2F0IA 5DM73 3CC4A 3NENA 3V2TA 1VQBA 5M5XB 3MXGA 3U4VA 3M85A 4KN4C 4BA2I 1SNMA 4A4IA 4JCVE 3H0GG 4CJ0B 4G7OC 1X32A 3NPPA 4IPGA 2HIXA 2R7ZB 3GV6A 1RTNA 3L2PA 1DM0B 3CHBD 1QNUA 3SXHA 1U0LA 4OO1I 2KHIA 3E9IA 2I07B 3SK6A 4YWKA 3CU7A 4E6IA 4A93G 1VS0A 3FDTA 1CKNB 3X3MA 2EIFA 2WFWA 4XT1B 3AMUA 1KLUD 5K5PA 1SJHD 1TS3A 1Q8KA 3UE1A 1FD7D 1Y8PB 3DWPA 5AJ3L 2HHHQ 4A3LH 3L9AX 2EYOA 2JXMB 4YCUA 4WJ4A 3D6CA 1J6QA 4JI3L 3IFTA 5EKIA 4A3DG 1KRSA 5HURA 1K28A 1BCPD 1VDZA 3K58A 4GLAC 1RCVD 1ESFA 3BG3A 4GN3B 1B70B 3GTKH 3CCRA 3Q23A 3KK7A 2K14A 3PGZA 2E75C 3I4MB 4RKLA 2KCTA 2A1AA 3QIAA 4IPCA 2BCOA 3ERQA 1G291 4ULLA 2NZHA 1JB3A 1YJNA 4X66Q 4LF5L 2EYPA 1CZGA 2JA5H 1N32L 3I4NB 3NBHA 3URYA 4JI0L 1F77A 1SYEA 1EWIA 1SE3A 2XVSA 2DN8A 3EROA 4LJZC 4HJ9A 1VQIA 2PI2A 4FF2A 1KNAA 1EYCA 2Z8LA 4O1NA 4LAAA 3AQQA 2RHQB 4DUYQ 1CI3M 4HMJA 4BBRG 3CC2A 3F8TA 1VQ8A 4DK0A 1SBBB 2TMPA 4HCSA 4YHHQ 2GA4B 1Z7TA 3CMEA 1PZID 2CQAA 4EQOA 2ZTEA 1PFSA 4BY7H 1Y1VG 2X69A 1X3PA 1AE2A 5BN4A 4YWMA 4Y7NH 2J7ZA 2X6GA 1J5EL 2CHBD 2FFKB 2UU9L 5C0XG 2YTXA 2ZXRA 1D5MC 3SHLA 1CTMA 4BWGB 4RGNA 1T5EA 1SJED 2K33A 3EVQA 3P75A 3KJOA 1YNJC 4ID6A 1JJGA 4JI1Q 1TXYA 1O7LA 3X3NA 5C6AA 5HGTA 4DNTB 1GHJA 5C0XH 1OTCA 2D9UA 2VS1A 1ICFB 4C3IG 4HIOA 1TWAB 4A3IG 1U4RA 2CWAA 5M3MB 2UUCQ 2MO1A 1VQAA 5K36G 2KUMA 2F0OA 2YV5A 4L6TB 1IKLA 2XWJB 1NAPA 4H02A 4LFAL 1X54A 4DXGA 3STBD 5JJLA 2IY5B 5IYBH 3S14H 1XYIA 1H9JA 2SNMA 1Y1WB 2IHFA 1R4QB 2F0NA 2CW0D 3EN2A 1BCPF 2C35B 2SOBA 3FMCA 1QOHA 1PMRA 2V4DA 4G4KA 2KCNA 2NVTH 2JK8A 3BYTB 1ZYRC 2Q8TA 1ENFA 4RWSC 4U68A 1Q90A 5LL6S 4YWLA 3S1NH 4YIJA 2NWGA 3H6MA 3PIOA 1IBLQ 4WFN3 1I4GA 1UE6A 2K28A 1TWCH 4LF7Q 1WCMH 1CK1A 1S72A 3M4PA 1Y69U 4RGTA 1TWHH 4ILWA 3HOYB 4R8IA 4IFDH 1SE2A 2K5HA 2EJMA 3A8KE 1XMOQ 4KMUC 4U673 2A8VA 1LTLA 1AEXA 4OONA 5C4JH 3OW7A 3T1HL 2Z6BA 4RCOA 3E9HA 4N9TA 2LXJA 3TN2A 4APVA 2TSSA 2XIWA 1FNUA 2KOLA 5LL6X 3KDFB 1S5BD 2JA5B 2DY8A 1U4LA 3KJPA 2ICIA 4LF7L 1D7QA 1IBML 1DZ1A 5EPJA 1V1QA 3A74A 3MA2B 3PUVA 2V1CC 3CXCA 4DGZA 4R4CA 2ICEC 3NBHB 3JAME 4MZ9A 1YNXA 2KVMA 3BYYB 3OWFA 4YCWA 1ICWA 3J7AF 4IFDI 3SK4A 4BY1B 3I4OA 4KLKA 4B3ML 1YJ9A 1VQMA 1W3SA 1H9KA 4DR2L 4A3JH 1EIHA 4LK1C 1D8LA 2R6GA 2E5LQ 5D14A 3OMCA 1EWCA 4KK7A 4DV7L 1NCVA 2QF7A 3EBEA 2CCZA 1HNWL 2N49A 2FXQA 1QCBD 1PH9A 4DAMA 4KY7A 1M4VA 3HG9A 4FYDA 2R93H 2NTSA 2KHSA 5EGTA 4R9WA 3RUZA 1K8OA 1B1ZA 1XNRQ 1BVSA 1TT2A 2R92G 2NVQH 2B2VA 2HQLA 4JI4L 4B3MQ 5KYIA 3KYHC 3Q8DA 3PUYA 1B8AA 3OSOA 1XNRL 4DKAC 1JQYD 3FP9A 2I5LX 2PPBC 1U4MA 2VW9A 1WTVA 2NVXH 3BS1A 1Q86C 4UDUC 5ELNA 1KXLA 1K8AC 1HR0L 5E7NA 4L5RC 3QO2A 2ZM6L 3L3OC 4G57A 1Q82C 1RL2A 1STNA 3S15B 2RDFA 1BF4A 2EYLA 4ME3A 1DXMA 4F88A 2ZM6Q 3T1YL 1E7ZA 3U58A 1HNZL 1WD0A 1EY4A 3RZOB 1N9WA 5LMNW 3JAMc 1MD2D 2B3GA 1QUQA 1FJGQ 1I4PA 4XQQA 4J8QA 1BDOA 3E3XA 3FKIG 4L5TA 1HXYD 2Z9HA 4A3KH 4LF4L 1IHZA 3IAYA 1Y1WH 1OXXK 3QOLA 3FHWA 3MAQA 4JI5Q 2HT1A 3E5SA 3V05A 2JEAI 1UE7A 4LF4Q 2O5JC 1WYDA 4JBWA 1Y14B 2LFNA 5I6YA 1C8CA 1BCPB 1V43A 1QZHA 4C3IH 1W6JA 3A56A 5JJIA 1CQVA 1EU4A 4B08A 1KHIA 1PRTF 1QUQB 4K5WA 3JAML 2B63H 1WJJA 3W3AA 3WWVA 5C0XI 1E2VA 3BZCA 4DV0L 2M9VA 1WCMB 2HQEA 4Y7NB 3PIO3 2F03A 4FF1A 4DV6L 2OF1A 1BOSA 4TVAB 1GUSA 1PLFA 2WV6D 3I55A 1IW7D 3P20A 3PO2H 3CPFA 1JOOA 2UXDL 3M4OB 2IWHA 3VDYA 3JAMi 1PYSB 1NY4A 4CDEC 5FLMH 1DD2A 4OXPA 3TBIB 2OTLA 1VMPA 1D6EC 3I70A 4EQPA 4DUYL 1GUWA 4A3JG 3GTPB 1GM5A 4LF9L 2E76C 4OX9L 3PO3G 1SN8A 3BZKA 2VB3X 5C5LA 1A3UA 5T1GA 4DR1Q 1GUTA 3IFDA 1S5FD 3J80c 2B8FA 5LMNL 1CA5A 1DOLA 1N34Q 3L0OA 5GROA 1STHA 1L0YB 4X3KA 2EYMA 5ELFA 2WKCA 4K8IA 1LLRD 2E2JH 4FO2A 1ZYRD 4KY5A 1B53A 3PIPA 1K0SA 3LX0A 4IJLA 2ZJQA 3BVGA 3T53B 1AZPA 1SE4A 1N34L 2DY7A 2R93B 2C9OA 1MJCA 3HOZH 1X3QA 2IHEA 3AB9A 2PO4A 2F4IA 3ULLA 1J5EQ 2NVYH 1VF5C 1L1OA 3NSWA 4OWTB 5EPLA 4G7ZC 2KA7A 4OELB 3F2DA 1HNWQ 3LWEA 3I4NG 1K9MC 3S2DH 2JA9A 2JJQA 2BE5C 1KTKA 1GO3E 2VY3A 5IY0A 2I46A 2E5LL 1LTGD 1NMFA 5DNFA 4DV7Q 3KDFA 3NQIA 3HRZC 1I6HB 3M4YA 1UAPA 4CHTB 2UXCL 5C44B 5IGBA 3NK9A 2A69C 5EQ0A 3S15H 5C3XA 1VQFA 3OYYA 5C44G 1F9SA 1CSQA 4OIJA 3TDQA 4QJFA 3T1HQ 5JEAH 1F9QA 3HKZB 1BQQT 4IUNA 1EY7A 1GUOA 2NUCA 1EY6A 2LKVA 4L8JA 1W6KA 2XSCA 2VQEQ 5C44H 4DR7L 4WRDA 2EYFA 5CYUA 1X3FA 4Y52H 2F0DA 4B3SL 4JK1C 2IX1A 4HJ5A 1EZ6A 4TSSA 2ALYB 3NQTA 4GLVB 5EBDA 1YJWA 1WOCA 1LTID 5GQOA 3RLFA 4FNFA 2F52A 1XTDA 2PZWA 2L9HA 1EIFA 1E22A 1TWFB 3CQZH 4IALA 4A3IH 3DM3A 2F0MA 3VR5A 4CKCA 1LTAD 4AIMA 1V1PA 4JC0A 2VUMG 1G2SA 2Q8IB 3D4WA 2NN6H 3HP3A 2H5XA 3VR3A 3LGJA 1PRTC 4H44C 3HEJA 2JA7B 1N8RC 1O7YA 2KJXA 1X3GA 3GTOB 1N36Q 1PZKD 3K5MA 1CKOA 4FF4A 2UXBQ 3K7AH 3ND9A 4DR3L 1XX8A 1PH3A 3KUPA 2B2YA 3ICEA 2EJGC 4GOPC 3SEBA 5GAGC 2EZVA 1GHKA 2DUDA 4K8JA 2F0FA 4DUZL 3SR1A 1G6PA 2GN5A 2VL6A 2QEXA 4OO1G 1E0BA 2R3ZA 3F2CA 1Q1EA 1KL9A 4DAVA 1SYGA 3TS0A 1TIID 1PTOB 4JG2A 3P1HA 2QILA 2P5ZX 3CF5A 1VQJA 2I5MX 2PW7A 4M8AA 5BR8Q 5C3EG 1BCPC 5M5WB 3S1QH 1VQLA 3OPOA 1MI2A 5HGQA 5G3LD 5C0XJ 4RHRA 4K0KQ 1STBA 5J39A 3FPPA
chains in the Genus database with same CATH topology
4A3EG 2PQAA 4HJ9A 2CQOA 3CW2C 3K8AA 1VQIA 2PI2A 4JI8Q 1HNXL 1ASZA 2R7DA 4AYBE 3ZJYC 4FDBA 2K52A 4L5SA 2VQFL 1JMCA 5IWAQ 3PO3H 4IFDJ 4LFAQ 3AQQA 4GKJL 4DR6Q 3OTOL 4JI2Q 2RHQB 4DUYQ 4JI5L 4B3TQ 5IYBG 4BBRG 3CC2A 3F8TA 2PQAB 4A3FG 1VQ8A 1HR0Q 3GTLH 4YHHQ 2VZAA 1VQKA 3RZOH 3CMEA 3W1BA 3AYHB 1YI2A 3CD6A 4DR7Q 2A8VA 4NXMQ 1VQ4A 2RF4A 2Y0SE 2ZTEA 1PFSA 3PF5A 2OCEA 1Y1VG 4BY7H 1RIPA 2UUAQ 3UDIA 1AE2A 4LWCA 4YWMA 4Y7NH 1VQDA 3HOVG 1J5EL 2JA5G 2UU9L 3HKZE 5C0XG 2YTXA 2HHHL 3UE0A 2KCMA 1I5FA 4AH6A 4JOIC 3STBC 4X64L 1EYGA 1JJGA 3KJOA 4HIDA 2MNAA 3AFQA 4JI1Q 1PH4A 1TXYA 1S40A 3I56A 3H15A 1WCMG 1OTCA 4PG3A 2WAQG 2VS1A 2XTIA 5LMNQ 4LW1A 4A3GH 2K50A 4C3HH 3M3YH 2ID0A 4HIOA 4A3IG 4X62Q 3J81c 5LMUQ 1WFQA 4P72A 4IOCA 2CWAA 1QVGA 2UUCQ 2WB1G 2MO1A 5M5WH 3PF4A 1KAWA 1VQAA 4DR3Q 4YY3L 1NTGA 2L15A 2NZOA 4A3BG 1N33Q 4IOAA 5K36G 2JQOA 3CP0A 2ASBA 3HOUH 1IBKL 2YV5A 4H02A 2CKZB 3HKSA 5GADC 4LFAL 1X54A 1Q46A 1WI5A 3STBD 1QVFA 3I4NH 5IYDH 5JJLA 2IY5B 2ZTCA 5IYBH 3S14H 4BBSG 3BJUA 4O2DA 1SRUA 3HOWG 4QQBX 1O7IA 2IHFA 1W2BA 2BH2A 2PI2E 3EN2A 4BY1H 1CKNA 4A3CG 2C35B 1YHAA 2CWPA 3K0XA 4LUVA 5H1SE 4DR5Q 2Q2TA 1IL2A 1KQSA 1EFWA 2YTVA 3A0JA 2NVTH 4DV5Q 3IRBA 3HOWH 4JYAL 3S2HH 2JK8A 1YEZA 1Y1VH 3SGIA 2KENA 4JI0Q 3U4ZA 2UXBL 4X66L 4HJAA 1FVIA 3MXNB 4JOIA 3NEMA 5HY6A 3CC7A 3CCQA 4YWLA 3S1NH 1K83H 1GKHA 1YIJA 1IBLQ 3PIOA 5M3FH 1UE6A 5ELOA 4A3GG 1TWCH 4LF7Q 5JJKA 1WCMH 4UP7A 3L7ZC 3H3VI 1S72A 4JI6Q 4L5QA 1SROA 2A19A 3M4PA 4QIWE 1A8VA 2Q2IA 1L2FA 1TWHH 2ES2A 4HJ7A 2K5HA 4NPSA 4BBRH 1XMOQ 4X64Q 4POGA 3G48A 3OW2A 3HOYG 1CKMA 1XNQL 4AQYL 3H0GH 3T1YQ 1OXSC 3A5ZB 1LTLA 3PV0A 4OONA 4YY3Q 5C4JH 3J81j 4GNXC 3T1HL 1MKHA 2Z0SA 1LM0A 3E9HA 2LXJA 4APVA 1HZAA 5IYDG 3KDFB 4A3MH 4NXNQ 1I3QH 2OTJA 4HIMA 4LFBL 1KIXA 4DPGA 4LF6L 4P75A 4PZ7A 1VQ9A 3D31A 1OXVA 4PZ6A 1QZGA 4TQUS 3KJPA 2I0QA 4LF7L 1D7QA 3RLNA 1IBML 1E3PA 2XGTA 4X6AH 2WP8J 1L1OC 1V1QA 3A74A 3PUVA 3E0EA 3PSIA 4QL5A 2V1CC 4NXNL 5IP7H 3CXCA 4DV1Q 4GOPA 4R4CA 3NBHB 4C3JH 4QGUA 4MZ9A 1YNXA 2I5HA 4YCWA 1YHQA 4IFDI 2PMZE 1BBUA 1A0IA 4OX9Q 3K81C 3I4OA 4KLKA 3J80i 4B3ML 2VQFQ 1YJ9A 4NB3A 1W3SA 1VQMA 1Z47A 4R4QA 1UE5A 4LF9Q 3A5UA 4DR2L 1N33L 4A3JH 4A93H 1XPOA 1D8LA 4C2MH 1Q1BA 1SMXA 2R6GA 2AMCB 2QA4A 3NELA 2JA7G 1LYLA 2E5LQ 3CCMA 1UE1A 4BY7G 1VQOA 4DV7L 2Z6KA 1PHJA 4LFBQ 2Q2HA 1SLJA 3EIVA 3EBEA 2CCZA 3M9BA 2ZJRA 1HNWL 2N49A 4DV3Q 4P71A 2UUBL 2F4VQ 1PH8A 4BXXG 2K75A 2FXQA 1PH9A 4DAMA 1Z9FA 2R93H 1Y1WG 3RLOA 1X9NA 1Q81C 3AEVA 2Q2UA 1XNRQ 3HFZB 4GKKL 1BVSA 2YYZA 2E2HH 1BKBA 4AQYQ 4LF8Q 2R92G 4JI2L 2NVQH 4JV5L 1HZBA 2HQLA 2NN6G 2WB1E 4JBJA 4DR1L 1SR3A 3UDGA 1Q12A 4EQ5A 1GD7A 5IP9H 2UU9Q 3KYHC 3PUYA 3Q8DA 1B8AA 1NBWA 3S1RH 4B3MQ 1JJCB 2IT1A 1VQ5A 2GVBA 1XNRL 4GKKQ 4DKAC 1XPUA 1UEBA 4X65Q 1DGSA 2I5LX 2Y0SG 3FP9A 1PH7A 4KI0A 2OQKA 2VW9A 4IFDG 2NVXH 4NXML 1Q86C 5LMUL 5ELNA 1KXLA 1KC8C 3CCLA 2F3IA 4JBKA 1YITA 3CCUA 1K8AC 4WJ3M 1HR0L 1JB7A 3TRZA 2JA8G 5E7NA 4L5RC 1X55A 2ZM6L 5M3FG 2K5NA 1K0RA 1I6HH 5J3BA 1Q82C 1RL2A 1N36L 5GAHC 3TREA 2AWNA 1A62A 3KF6B 1PH2A 4A3LG 4ME3A 2E2IH 3KLWA 2ZM6Q 3T1YL 4A3KG 1NJIC 1CSPA 1E7ZA 4PMWA 3U58A 1HNZL 2RHSB 1BBWA 3J7A5 4JI7L 1N9WA 1YZ6A 4UY8C 5IYCH 5LMNW 4X62L 2B63G 3S24A 1KRTA 3JAMc 2B3GA 1QUQA 4DV5L 1XJVA 1FJGQ 4A3CH 1HH2P 3GTQH 3DLLA 4JYAQ 4GS3A 4UP9A 5C4XH 4L5TA 3FKIG 3J7ZC 3BU2A 3W1GA 3S17H 4P74A 3ULPA 1PH1A 4HIKA 1PVOA 3HOXH 4A3KH 4UPAA 4YHHL 4LF4L 4A75A 5JEAG 1HZCA 4IJHA 1E1OA 1OXXK 4EX5A 3FHWA 1Y1WH 1M1KC 1IBKQ 2K4KA 3G4SA 1N32Q 4B3TL 4JI5Q 1XNQQ 2HT1A 1X3EA 3HOUG 4XTCS 4AYBG 2MQHA 5AJ3Q 2JEAI 1UE7A 4LF4Q 1WYDA 4JBWA 4A3BH 4GNXB 1K3RA 1Y14B 4DR4Q 2F4VL 4DV2L 4A76A 4DV1L 3G6EA 1VCIA 2JA7H 2WAQE 4K0KL 3F1ZA 4LUZA 1JE5A 1V43A 2ZJPA 4C3IH 1QZHA 1FL0A 2JA8H 5JJIA 5EAYA 2YU9H 4MNOA 1KHIA 1TWAH 1QUQB 4LFCL 3CMAA 2B63H 1WJJA 2N3SA 5JEAJ 3I2ZA 5GAEC 3WWVA 3J81i 3HOXG 4GLXA 3RN5A 1XPRA 1E1TA 2Z6KC 3HOZG 5C0XI 1L1OB 1SFOH 3BZCA 3HKZG 5IP9G 1VQ6A 4DR6L 4DV0L 1E24A 2R7FA 4DK3C 3CCSA 2OWOA 4J15A 4DV6L 4TVAB 3I55A 3KF6A 1U5KA 4KHPQ 1X56A 3PUZA 1IZ6A 1X6OA 1K8GA 1HNXQ 3PO2H 5M3MG 4BXXH 3CPFA 2UXDL 2KBNA 3RZDH 1VQNA 2BH8A 3S1MH 3PUXA 3VDYA 3I4MH 3JAMi 1PYSB 1NY4A 3RR5A 5FLMH 3CCVA 4OWWB 4OXPA 2EQSA 1Q7YC 2OTLA 4DUYL 3GTOH 4B3RQ 4A3JG 1HJPA 1I50H 1GM5A 3M7NA 1IYJB 2R7ZH 3HOYH 4LF9L 1HNZQ 3FKIH 1VQ7A 1QVCA 1X65A 3G71A 1NMGA 1YVCA 4KHZA 4OX9L 2JE6I 3BZKA 1SN8A 3B6YA 3PO3G 2UUCL 4JI8L 4IPHA 4DV6Q 5IYCG 4IO9A 4DR1Q 1XMQL 5IWAL 2HIVA 3J80c 5IE8A 3UDFA 5LMNL 1A63A 3CCJA 3MEFA 3GTGH 1N34Q 3L0OA 5GROA 5M3MH 2CFMA 5FLXc 4R4OA 2E2JH 4DK6C 2JA6G 1R9TH 2PNHA 4DV4Q 3PIPA 3CCEA 4BA1I 3I4MG 3KFUA 2LSSA 3JC66 4IJLA 2ZJQA 2R92H 4JI6L 5DLQE 4O0AA 1N34L 4QY7A 2DGYA 5C3EH 1MJEA 1SE8A 2OQ0A 1CUKA 1VQCA 4MTNA 1VQPA 4DR4L 4DV2Q 1C7YA 1EIYB 1I94L 1MJCA 4JBMA 1EQQA 3HOZH 1AE3A 1IBLL 2IHEA 4P73A 1LUZA 1OXUA 3CAMA 4PZ8A 4RMFA 4LF8L 1IXRA 1PYBA 3GTJH 3RNUA 4GKJQ 4JV5Q 1H95A 1B7YB 4JI4L 3ULLA 3U50C 4DAYB 2NVYH 1J5EQ 1L1OA 2JEBI 1G51A 4OWTB 4DR5L 1I94Q 4DUZQ 4LF5Q 3F2DA 2BA1A 2VQEL 1TWGH 4GOPB 1HNWQ 3I4NG 2KHJA 1PH6A 4RG1A 1K9MC 2IX0A 3S2DH 2JA9A 3TS2A 2JJQA 3KF8B 5IY0A 2VY3A 1GO3E 4POFA 3UDXA 2E5LL 3I7FA 1FJGL 1EOVA 1NMFA 4DV7Q 3GD7A 1VQGA 2AHOB 3KDFA 3TEHB 2E8GA 4JI4Q 3M4OH 2UXCL 4GNXA 1PV4A 4ALPA 4JI3Q 1JT8A 3PO2G 2GVAA 1JJ2A 3S15H 4R4IA 1VQFA 4A3DH 3OYYA 1T9HA 3M4QA 5C44G 2MO0A 1CSQA 1UWVA 2UUAL 5FJ8G 1PH5A 3CC4A 4QJFA 3NENA 3T1HQ 1VQBA 3RN2A 3U4VA 4DNIA 3M85A 1L0WA 4B3SQ 4BA2I 1GVPA 4A4IA 4JCVE 3H0GG 3TQYA 5C44H 2VQEQ 4DR7L 1VQHA 4JI1L 2AKWB 2ZTDA 2R7ZG 3D0FA 1EQRA 3K80C 3PUWA 5BR8L 1V9PA 1X3FA 4Y52H 2RCNA 1OXTA 1HZ9A 4B3SL 2IX1A 2QGQA 4IPGA 2HIXA 4HJ5A 3GTMH 3L2PA 2ALYB 2K5VA 2VNUD 1M90C 4GLVB 5FLMG 3F2BA 1YJWA 1WOCA 4DV0Q 5GQOA 3RLFA 1U0LA 3GO5A 4OO1I 2F52A 1VQEA 1XTDA 2KHIA 3E9IA 2N78A 3H3VH 1EIFA 1E22A 3CQZH 4YWKA 4A3IH 4B3RL 3DM3A 3ER0A 3KOJA 1IBMQ 5C4XG 4A93G 1VS0A 1PA6A 4AIMA 4JC0A 2VUMG 1CKNB 4LUOA 4R1JA 4BY1G 4X65L 2EIFA 2N8NA 2WFWA 3ULJA 4JI7Q 2ATWA 4LFCQ 5IT9c 1S3OA 1XMQQ 2H5XA 3UE1A 3LGJA 1Q8KA 3PCOB 5AJ3L 3GDEA 4DR2Q 4KHPL 2HHHQ 4A3LH 1TWFH 5FJ8H 1KD1C 4YCUA 5IP7G 2LXKA 1C0AA 2D62A 4WJ4A 4A3EH 1J6QA 1YBYA 4JI3L 4A3DG 1N8RC 1KRSA 2D0PA 1X3GA 2VUMH 3OTOQ 1N36Q 1C9OA 1XMOL 3GTPH 4BBSH 1CKOA 2BA0A 3HOVH 1EUJA 2UXBQ 4GLAC 1HR0W 3K7AH 2R93G 4A3MG 1P16A 4GN5A 4GN3B 1B70B 2D0OA 2NN6I 3CCRA 4DR3L 1PH3A 3GTKH 2K14A 3PGZA 3ICEA 4GOPC 5GAGC 1AH9A 2DUDA 2EXDA 2KCTA 2A1AA 4XIGS 3CPWA 4DUZL 4A3FH 4LF6Q 5M5YH 3ERSX 2GN5A 2B29A 2VL6A 4IPCA 2QEXA 4OO1G 4UP8A 1G6PA 3F2CA 1NE3A 1K73C 1Q1EA 1KL9A 4HJ8A 1G291 1P8LA 1YHBA 3W5OA 2NZHA 5M5XH 3TS0A 1YJNA 4X66Q 4LF5L 4R4TA 4JG2A 4LNQA 2UXDQ 3CF5A 2JA5H 1VQJA 1MIUA 2UXCQ 1N32L 2I5MX 5C3EG 5BR8Q 3AFPA 3S1QH 4JI0L 1VQLA 1EWIA 4DV3L 2UUBQ 4OWXB 5HGQA 4GN4B 5C0XJ 2AWOA 2YTYA 2JA6H 4IPDA 4K0KQ 1FGUA 2MFIA 3K7UC 4YCVA 3S16H 4DV4L 1ASYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3E G;  2PQA A;  4HJ9 A;  2CQO A;  3CW2 C;  3K8A A;  1VQI A;  2PI2 A;  4JI8 Q;  1HNX L;  1ASZ A;  2R7D A;  4AYB E;  3ZJY C;  4FDB A;  2K52 A;  4L5S A;  2VQF L;  1JMC A;  5IWA Q;  3PO3 H;  4IFD J;  4LFA Q;  3AQQ A;  4GKJ L;  4DR6 Q;  3OTO L;  4JI2 Q;  2RHQ B;  4DUY Q;  4JI5 L;  4B3T Q;  5IYB G;  4BBR G;  3CC2 A;  3F8T A;  2PQA B;  4A3F G;  1VQ8 A;  1HR0 Q;  3GTL H;  4YHH Q;  2VZA A;  1VQK A;  3RZO H;  3CME A;  3W1B A;  3AYH B;  1YI2 A;  3CD6 A;  4DR7 Q;  2A8V A;  4NXM Q;  1VQ4 A;  2RF4 A;  2Y0S E;  2ZTE A;  1PFS A;  3PF5 A;  2OCE A;  1Y1V G;  4BY7 H;  1RIP A;  2UUA Q;  3UDI A;  1AE2 A;  4LWC A;  4YWM A;  4Y7N H;  1VQD A;  3HOV G;  1J5E L;  2JA5 G;  2UU9 L;  3HKZ E;  5C0X G;  2YTX A;  2HHH L;  3UE0 A;  2KCM A;  1I5F A;  4AH6 A;  4JOI C;  3STB C;  4X64 L;  1EYG A;  1JJG A;  3KJO A;  4HID A;  2MNA A;  3AFQ A;  4JI1 Q;  1PH4 A;  1TXY A;  1S40 A;  3I56 A;  3H15 A;  1WCM G;  1OTC A;  4PG3 A;  2WAQ G;  2VS1 A;  2XTI A;  5LMN Q;  4LW1 A;  4A3G H;  2K50 A;  4C3H H;  3M3Y H;  2ID0 A;  4HIO A;  4A3I G;  4X62 Q;  3J81 c;  5LMU Q;  1WFQ A;  4P72 A;  4IOC A;  2CWA A;  1QVG A;  2UUC Q;  2WB1 G;  2MO1 A;  5M5W H;  3PF4 A;  1KAW A;  1VQA A;  4DR3 Q;  4YY3 L;  1NTG A;  2L15 A;  2NZO A;  4A3B G;  1N33 Q;  4IOA A;  5K36 G;  2JQO A;  3CP0 A;  2ASB A;  3HOU H;  1IBK L;  2YV5 A;  4H02 A;  2CKZ B;  3HKS A;  5GAD C;  4LFA L;  1X54 A;  1Q46 A;  1WI5 A;  3STB D;  1QVF A;  3I4N H;  5IYD H;  5JJL A;  2IY5 B;  2ZTC A;  5IYB H;  3S14 H;  4BBS G;  3BJU A;  4O2D A;  1SRU A;  3HOW G;  4QQB X;  1O7I A;  2IHF A;  1W2B A;  2BH2 A;  2PI2 E;  3EN2 A;  4BY1 H;  1CKN A;  4A3C G;  2C35 B;  1YHA A;  2CWP A;  3K0X A;  4LUV A;  5H1S E;  4DR5 Q;  2Q2T A;  1IL2 A;  1KQS A;  1EFW A;  2YTV A;  3A0J A;  2NVT H;  4DV5 Q;  3IRB A;  3HOW H;  4JYA L;  3S2H H;  2JK8 A;  1YEZ A;  1Y1V H;  3SGI A;  2KEN A;  4JI0 Q;  3U4Z A;  2UXB L;  4X66 L;  4HJA A;  1FVI A;  3MXN B;  4JOI A;  3NEM A;  5HY6 A;  3CC7 A;  3CCQ A;  4YWL A;  3S1N H;  1K83 H;  1GKH A;  1YIJ A;  1IBL Q;  3PIO A;  5M3F H;  1UE6 A;  5ELO A;  4A3G G;  1TWC H;  4LF7 Q;  5JJK A;  1WCM H;  4UP7 A;  3L7Z C;  3H3V I;  1S72 A;  4JI6 Q;  4L5Q A;  1SRO A;  2A19 A;  3M4P A;  4QIW E;  1A8V A;  2Q2I A;  1L2F A;  1TWH H;  2ES2 A;  4HJ7 A;  2K5H A;  4NPS A;  4BBR H;  1XMO Q;  4X64 Q;  4POG A;  3G48 A;  3OW2 A;  3HOY G;  1CKM A;  1XNQ L;  4AQY L;  3H0G H;  3T1Y Q;  1OXS C;  3A5Z B;  1LTL A;  3PV0 A;  4OON A;  4YY3 Q;  5C4J H;  3J81 j;  4GNX C;  3T1H L;  1MKH A;  2Z0S A;  1LM0 A;  3E9H A;  2LXJ A;  4APV A;  1HZA A;  5IYD G;  3KDF B;  4A3M H;  4NXN Q;  1I3Q H;  2OTJ A;  4HIM A;  4LFB L;  1KIX A;  4DPG A;  4LF6 L;  4P75 A;  4PZ7 A;  1VQ9 A;  3D31 A;  1OXV A;  4PZ6 A;  1QZG A;  4TQU S;  3KJP A;  2I0Q A;  4LF7 L;  1D7Q A;  3RLN A;  1IBM L;  1E3P A;  2XGT A;  4X6A H;  2WP8 J;  1L1O C;  1V1Q A;  3A74 A;  3PUV A;  3E0E A;  3PSI A;  4QL5 A;  2V1C C;  4NXN L;  5IP7 H;  3CXC A;  4DV1 Q;  4GOP A;  4R4C A;  3NBH B;  4C3J H;  4QGU A;  4MZ9 A;  1YNX A;  2I5H A;  4YCW A;  1YHQ A;  4IFD I;  2PMZ E;  1BBU A;  1A0I A;  4OX9 Q;  3K81 C;  3I4O A;  4KLK A;  3J80 i;  4B3M L;  2VQF Q;  1YJ9 A;  4NB3 A;  1W3S A;  1VQM A;  1Z47 A;  4R4Q A;  1UE5 A;  4LF9 Q;  3A5U A;  4DR2 L;  1N33 L;  4A3J H;  4A93 H;  1XPO A;  1D8L A;  4C2M H;  1Q1B A;  1SMX A;  2R6G A;  2AMC B;  2QA4 A;  3NEL A;  2JA7 G;  1LYL A;  2E5L Q;  3CCM A;  1UE1 A;  4BY7 G;  1VQO A;  4DV7 L;  2Z6K A;  1PHJ A;  4LFB Q;  2Q2H A;  1SLJ A;  3EIV A;  3EBE A;  2CCZ A;  3M9B A;  2ZJR A;  1HNW L;  2N49 A;  4DV3 Q;  4P71 A;  2UUB L;  2F4V Q;  1PH8 A;  4BXX G;  2K75 A;  2FXQ A;  1PH9 A;  4DAM A;  1Z9F A;  2R93 H;  1Y1W G;  3RLO A;  1X9N A;  1Q81 C;  3AEV A;  2Q2U A;  1XNR Q;  3HFZ B;  4GKK L;  1BVS A;  2YYZ A;  2E2H H;  1BKB A;  4AQY Q;  4LF8 Q;  2R92 G;  4JI2 L;  2NVQ H;  4JV5 L;  1HZB A;  2HQL A;  2NN6 G;  2WB1 E;  4JBJ A;  4DR1 L;  1SR3 A;  3UDG A;  1Q12 A;  4EQ5 A;  1GD7 A;  5IP9 H;  2UU9 Q;  3KYH C;  3PUY A;  3Q8D A;  1B8A A;  1NBW A;  3S1R H;  4B3M Q;  1JJC B;  2IT1 A;  1VQ5 A;  2GVB A;  1XNR L;  4GKK Q;  4DKA C;  1XPU A;  1UEB A;  4X65 Q;  1DGS A;  2I5L X;  2Y0S G;  3FP9 A;  1PH7 A;  4KI0 A;  2OQK A;  2VW9 A;  4IFD G;  2NVX H;  4NXM L;  1Q86 C;  5LMU L;  5ELN A;  1KXL A;  1KC8 C;  3CCL A;  2F3I A;  4JBK A;  1YIT A;  3CCU A;  1K8A C;  4WJ3 M;  1HR0 L;  1JB7 A;  3TRZ A;  2JA8 G;  5E7N A;  4L5R C;  1X55 A;  2ZM6 L;  5M3F G;  2K5N A;  1K0R A;  1I6H H;  5J3B A;  1Q82 C;  1RL2 A;  1N36 L;  5GAH C;  3TRE A;  2AWN A;  1A62 A;  3KF6 B;  1PH2 A;  4A3L G;  4ME3 A;  2E2I H;  3KLW A;  2ZM6 Q;  3T1Y L;  4A3K G;  1NJI C;  1CSP A;  1E7Z A;  4PMW A;  3U58 A;  1HNZ L;  2RHS B;  1BBW A;  3J7A 5;  4JI7 L;  1N9W A;  1YZ6 A;  4UY8 C;  5IYC H;  5LMN W;  4X62 L;  2B63 G;  3S24 A;  1KRT A;  3JAM c;  2B3G A;  1QUQ A;  4DV5 L;  1XJV A;  1FJG Q;  4A3C H;  1HH2 P;  3GTQ H;  3DLL A;  4JYA Q;  4GS3 A;  4UP9 A;  5C4X H;  4L5T A;  3FKI G;  3J7Z C;  3BU2 A;  3W1G A;  3S17 H;  4P74 A;  3ULP A;  1PH1 A;  4HIK A;  1PVO A;  3HOX H;  4A3K H;  4UPA A;  4YHH L;  4LF4 L;  4A75 A;  5JEA G;  1HZC A;  4IJH A;  1E1O A;  1OXX K;  4EX5 A;  3FHW A;  1Y1W H;  1M1K C;  1IBK Q;  2K4K A;  3G4S A;  1N32 Q;  4B3T L;  4JI5 Q;  1XNQ Q;  2HT1 A;  1X3E A;  3HOU G;  4XTC S;  4AYB G;  2MQH A;  5AJ3 Q;  2JEA I;  1UE7 A;  4LF4 Q;  1WYD A;  4JBW A;  4A3B H;  4GNX B;  1K3R A;  1Y14 B;  4DR4 Q;  2F4V L;  4DV2 L;  4A76 A;  4DV1 L;  3G6E A;  1VCI A;  2JA7 H;  2WAQ E;  4K0K L;  3F1Z A;  4LUZ A;  1JE5 A;  1V43 A;  2ZJP A;  4C3I H;  1QZH A;  1FL0 A;  2JA8 H;  5JJI A;  5EAY A;  2YU9 H;  4MNO A;  1KHI A;  1TWA H;  1QUQ B;  4LFC L;  3CMA A;  2B63 H;  1WJJ A;  2N3S A;  5JEA J;  3I2Z A;  5GAE C;  3WWV A;  3J81 i;  3HOX G;  4GLX A;  3RN5 A;  1XPR A;  1E1T A;  2Z6K C;  3HOZ G;  5C0X I;  1L1O B;  1SFO H;  3BZC A;  3HKZ G;  5IP9 G;  1VQ6 A;  4DR6 L;  4DV0 L;  1E24 A;  2R7F A;  4DK3 C;  3CCS A;  2OWO A;  4J15 A;  4DV6 L;  4TVA B;  3I55 A;  3KF6 A;  1U5K A;  4KHP Q;  1X56 A;  3PUZ A;  1IZ6 A;  1X6O A;  1K8G A;  1HNX Q;  3PO2 H;  5M3M G;  4BXX H;  3CPF A;  2UXD L;  2KBN A;  3RZD H;  1VQN A;  2BH8 A;  3S1M H;  3PUX A;  3VDY A;  3I4M H;  3JAM i;  1PYS B;  1NY4 A;  3RR5 A;  5FLM H;  3CCV A;  4OWW B;  4OXP A;  2EQS A;  1Q7Y C;  2OTL A;  4DUY L;  3GTO H;  4B3R Q;  4A3J G;  1HJP A;  1I50 H;  1GM5 A;  3M7N A;  1IYJ B;  2R7Z H;  3HOY H;  4LF9 L;  1HNZ Q;  3FKI H;  1VQ7 A;  1QVC A;  1X65 A;  3G71 A;  1NMG A;  1YVC A;  4KHZ A;  4OX9 L;  2JE6 I;  3BZK A;  1SN8 A;  3B6Y A;  3PO3 G;  2UUC L;  4JI8 L;  4IPH A;  4DV6 Q;  5IYC G;  4IO9 A;  4DR1 Q;  1XMQ L;  5IWA L;  2HIV A;  3J80 c;  5IE8 A;  3UDF A;  5LMN L;  1A63 A;  3CCJ A;  3MEF A;  3GTG H;  1N34 Q;  3L0O A;  5GRO A;  5M3M H;  2CFM A;  5FLX c;  4R4O A;  2E2J H;  4DK6 C;  2JA6 G;  1R9T H;  2PNH A;  4DV4 Q;  3PIP A;  3CCE A;  4BA1 I;  3I4M G;  3KFU A;  2LSS A;  3JC6 6;  4IJL A;  2ZJQ A;  2R92 H;  4JI6 L;  5DLQ E;  4O0A A;  1N34 L;  4QY7 A;  2DGY A;  5C3E H;  1MJE A;  1SE8 A;  2OQ0 A;  1CUK A;  1VQC A;  4MTN A;  1VQP A;  4DR4 L;  4DV2 Q;  1C7Y A;  1EIY B;  1I94 L;  1MJC A;  4JBM A;  1EQQ A;  3HOZ H;  1AE3 A;  1IBL L;  2IHE A;  4P73 A;  1LUZ A;  1OXU A;  3CAM A;  4PZ8 A;  4RMF A;  4LF8 L;  1IXR A;  1PYB A;  3GTJ H;  3RNU A;  4GKJ Q;  4JV5 Q;  1H95 A;  1B7Y B;  4JI4 L;  3ULL A;  3U50 C;  4DAY B;  2NVY H;  1J5E Q;  1L1O A;  2JEB I;  1G51 A;  4OWT B;  4DR5 L;  1I94 Q;  4DUZ Q;  4LF5 Q;  3F2D A;  2BA1 A;  2VQE L;  1TWG H;  4GOP B;  1HNW Q;  3I4N G;  2KHJ A;  1PH6 A;  4RG1 A;  1K9M C;  2IX0 A;  3S2D H;  2JA9 A;  3TS2 A;  2JJQ A;  3KF8 B;  5IY0 A;  2VY3 A;  1GO3 E;  4POF A;  3UDX A;  2E5L L;  3I7F A;  1FJG L;  1EOV A;  1NMF A;  4DV7 Q;  3GD7 A;  1VQG A;  2AHO B;  3KDF A;  3TEH B;  2E8G A;  4JI4 Q;  3M4O H;  2UXC L;  4GNX A;  1PV4 A;  4ALP A;  4JI3 Q;  1JT8 A;  3PO2 G;  2GVA A;  1JJ2 A;  3S15 H;  4R4I A;  1VQF A;  4A3D H;  3OYY A;  1T9H A;  3M4Q A;  5C44 G;  2MO0 A;  1CSQ A;  1UWV A;  2UUA L;  5FJ8 G;  1PH5 A;  3CC4 A;  4QJF A;  3NEN A;  3T1H Q;  1VQB A;  3RN2 A;  3U4V A;  4DNI A;  3M85 A;  1L0W A;  4B3S Q;  4BA2 I;  1GVP A;  4A4I A;  4JCV E;  3H0G G;  3TQY A;  5C44 H;  2VQE Q;  4DR7 L;  1VQH A;  4JI1 L;  2AKW B;  2ZTD A;  2R7Z G;  3D0F A;  1EQR A;  3K80 C;  3PUW A;  5BR8 L;  1V9P A;  1X3F A;  4Y52 H;  2RCN A;  1OXT A;  1HZ9 A;  4B3S L;  2IX1 A;  2QGQ A;  4IPG A;  2HIX A;  4HJ5 A;  3GTM H;  3L2P A;  2ALY B;  2K5V A;  2VNU D;  1M90 C;  4GLV B;  5FLM G;  3F2B A;  1YJW A;  1WOC A;  4DV0 Q;  5GQO A;  3RLF A;  1U0L A;  3GO5 A;  4OO1 I;  2F52 A;  1VQE A;  1XTD A;  2KHI A;  3E9I A;  2N78 A;  3H3V H;  1EIF A;  1E22 A;  3CQZ H;  4YWK A;  4A3I H;  4B3R L;  3DM3 A;  3ER0 A;  3KOJ A;  1IBM Q;  5C4X G;  4A93 G;  1VS0 A;  1PA6 A;  4AIM A;  4JC0 A;  2VUM G;  1CKN B;  4LUO A;  4R1J A;  4BY1 G;  4X65 L;  2EIF A;  2N8N A;  2WFW A;  3ULJ A;  4JI7 Q;  2ATW A;  4LFC Q;  5IT9 c;  1S3O A;  1XMQ Q;  2H5X A;  3UE1 A;  3LGJ A;  1Q8K A;  3PCO B;  5AJ3 L;  3GDE A;  4DR2 Q;  4KHP L;  2HHH Q;  4A3L H;  1TWF H;  5FJ8 H;  1KD1 C;  4YCU A;  5IP7 G;  2LXK A;  1C0A A;  2D62 A;  4WJ4 A;  4A3E H;  1J6Q A;  1YBY A;  4JI3 L;  4A3D G;  1N8R C;  1KRS A;  2D0P A;  1X3G A;  2VUM H;  3OTO Q;  1N36 Q;  1C9O A;  1XMO L;  3GTP H;  4BBS H;  1CKO A;  2BA0 A;  3HOV H;  1EUJ A;  2UXB Q;  4GLA C;  1HR0 W;  3K7A H;  2R93 G;  4A3M G;  1P16 A;  4GN5 A;  4GN3 B;  1B70 B;  2D0O A;  2NN6 I;  3CCR A;  4DR3 L;  1PH3 A;  3GTK H;  2K14 A;  3PGZ A;  3ICE A;  4GOP C;  5GAG C;  1AH9 A;  2DUD A;  2EXD A;  2KCT A;  2A1A A;  4XIG S;  3CPW A;  4DUZ L;  4A3F H;  4LF6 Q;  5M5Y H;  3ERS X;  2GN5 A;  2B29 A;  2VL6 A;  4IPC A;  2QEX A;  4OO1 G;  4UP8 A;  1G6P A;  3F2C A;  1NE3 A;  1K73 C;  1Q1E A;  1KL9 A;  4HJ8 A;  1G29 1;  1P8L A;  1YHB A;  3W5O A;  2NZH A;  5M5X H;  3TS0 A;  1YJN A;  4X66 Q;  4LF5 L;  4R4T A;  4JG2 A;  4LNQ A;  2UXD Q;  3CF5 A;  2JA5 H;  1VQJ A;  1MIU A;  2UXC Q;  1N32 L;  2I5M X;  5C3E G;  5BR8 Q;  3AFP A;  3S1Q H;  4JI0 L;  1VQL A;  1EWI A;  4DV3 L;  2UUB Q;  4OWX B;  5HGQ A;  4GN4 B;  5C0X J;  2AWO A;  2YTY A;  2JA6 H;  4IPD A;  4K0K Q;  1FGU A;  2MFI A;  3K7U C;  4YCV A;  3S16 H;  4DV4 L;  1ASY A; 
#chains in the Genus database with same CATH topology
 1CM9 A;  2O5I C;  2CQO A;  3CW2 C;  3K8A A;  3KLS X;  5ELD A;  2K5D A;  2L11 A;  3ZJY C;  2A6E D;  4FXG C;  1JMC A;  5IWA Q;  3PO3 H;  1TS5 A;  3NTH A;  4GKJ L;  3OTO L;  4JI2 Q;  4JI5 L;  1HR0 Q;  2QDB A;  1VQK A;  4PNY A;  1Z6H A;  1EL0 A;  4KN7 C;  3CD6 A;  3AYH B;  4IUV A;  3K7A B;  1FGB D;  2RF4 A;  3U9S A;  5A2Q L;  2OCE A;  2EOT A;  1JCK B;  1J9O A;  4IUR A;  5TSS A;  3S9W A;  3HOV G;  2G9H D;  3K5O A;  2JA5 G;  3G6J B;  5I9O A;  3UE0 A;  2KCM A;  1HQM C;  3STB C;  4XQN A;  2MNA A;  1D1K A;  3K0Y A;  1PH4 A;  1HRJ A;  2WAQ B;  1WD1 A;  2CH4 W;  4A3D B;  3OHX C;  1EWH A;  3I3C A;  2J4X A;  1HFN A;  1TY2 A;  3M3Y H;  2ID0 A;  2K32 A;  4X62 Q;  3J81 c;  5LMU Q;  2WAC A;  1QVG A;  2MUY A;  3WDN A;  3PF4 A;  1MHW C;  4YY3 L;  4A3B G;  4RKB A;  2AQ2 B;  1YNN C;  2KCC A;  2LMC B;  3HKS A;  3TZD A;  5GAD C;  3EA6 A;  5IYD H;  1QVF A;  2A6E C;  5E3F A;  3BJU A;  1SRU A;  1FNV A;  2QEJ C;  1B3A A;  2PI2 E;  1CKN A;  2Y0S B;  3A8J E;  4LUV A;  2RCF A;  5H1S E;  2Q2T A;  1EZ8 A;  3HOW B;  2R92 B;  1PTO D;  5C4Z A;  4JYA L;  3IRB A;  1YEZ A;  1Y1V H;  1I4R A;  2KEN A;  4JI0 Q;  2PZU A;  3QOJ A;  4MIU A;  4JOI A;  1I3Q B;  1R9T B;  3S1N B;  2RBM A;  5ELO A;  5EKK A;  1SFO B;  1KNE A;  3T56 B;  4F7X A;  4A3E B;  4JI6 Q;  1Q3L A;  1SRO A;  4OGQ C;  2IL8 A;  4HJ7 A;  3DM1 A;  3S1Q B;  2Q8R E;  4NPS A;  5KEE A;  4X64 Q;  3OW2 A;  1NUC A;  2F3V A;  2NVT B;  4FVM A;  2RSN A;  3H0G H;  4BS9 A;  3J81 j;  1MKH A;  1JR0 D;  3K57 A;  2C5C A;  4ZAI A;  1NR4 A;  4CJ1 B;  3LWU A;  4QB4 A;  1RD9 D;  2IJ0 A;  4NXN Q;  4MHE A;  4HIM A;  3QWN A;  1OXV A;  4DNR B;  4NW2 A;  4TQU S;  4K5V A;  2QW7 A;  1HHV A;  3DUZ A;  3PSI A;  4C1N K;  4GOP A;  4NXN L;  1WTR A;  4C3J H;  5LHY 1;  4QGU A;  1RHP A;  2I5H A;  2F0E A;  4DAY A;  5E1F A;  1A0I A;  1BBU A;  4OX9 Q;  5JAV A;  1HA6 A;  1Y8N B;  1HTP A;  1Z47 A;  3D6W A;  4DAP A;  3I73 A;  1A2U A;  2M00 A;  2AMC B;  3NEL A;  2JA7 G;  1B50 A;  1LYL A;  4QF4 A;  5JVH 3;  4BY7 G;  1VQO A;  3H94 A;  5E4W C;  1PFN A;  2F3W A;  2Q2H A;  3EIV A;  4GZY C;  4P71 A;  1WTO A;  2F4V Q;  2K75 A;  2CVR A;  5L37 A;  4CDC C;  3A7L A;  2K7V A;  3OIP A;  3RLO A;  1X9N A;  1K3B C;  1Q81 C;  3AEV A;  2YYZ A;  3VR6 A;  1BKB A;  4AQY Q;  4JI2 L;  1VMC A;  4JV5 L;  1XMQ Q;  3GTJ B;  4WJ3 M;  1Q12 A;  2KEE A;  3CKI B;  2DNC A;  1NBW A;  2E74 C;  3WOE A;  3I4L A;  3NTI A;  2AQ1 B;  5EBC A;  4X65 Q;  4KI0 A;  5KRU A;  4NXM L;  4NP5 A;  3CCL A;  2F3I A;  4HSV A;  3R3O A;  4KKU A;  5CV4 A;  3SK5 A;  4I65 A;  5M3F G;  1HCZ A;  4A3M B;  1DOM A;  4G7H C;  1A62 A;  1GXD C;  1ILP A;  2ZXP A;  4A3L G;  2B2V C;  4XXE A;  1AFP A;  1CSP A;  4PMW A;  1EEF D;  2RHS B;  1IL8 A;  5IYC H;  3S24 A;  2XRQ D;  1QNK A;  1LO5 D;  4IQZ A;  3T13 A;  1B2T A;  4JYA Q;  4HMI A;  4V19 0;  3QJY A;  2A5H A;  3S17 H;  4J1M A;  3ULP A;  1PDQ A;  5JOB A;  4A75 A;  5IGC A;  5JEA G;  4IJH A;  1E1O A;  2X6L A;  2H4O A;  5JVG 3;  1N32 Q;  1X3E A;  4AYB G;  5AJ3 Q;  2EY2 A;  5COY A;  3NBI A;  1TR5 A;  3G6E A;  2WAQ E;  4ZLT F;  1TS4 A;  4K6L A;  4CDD C;  3GTM B;  2F0K A;  4C3H G;  3OOC A;  4OHJ A;  3VYU A;  3FRP B;  4CKE A;  1LTT D;  2N3S A;  1GJX A;  3GTQ B;  1C4Q A;  1FYC A;  2Z6K C;  4HCE A;  3HKZ G;  1VQ6 A;  4ZYS A;  3KBG A;  3CCS A;  5IGG A;  2JN4 A;  3KF6 A;  1U5K A;  2JSO A;  4KHP Q;  1IZ6 A;  3U9O A;  3DEP A;  4BXX H;  2KBN A;  2F1M A;  3PUX A;  3OWE B;  3G7L A;  1HUN A;  3DMU A;  4PQX A;  5ELB A;  1Q8I A;  2VUM B;  4BBS B;  1HJP A;  3M7N A;  2SEB D;  2LY7 A;  2HD3 A;  4LMQ D;  1VQ7 A;  4XT3 B;  1L0X B;  3PMF A;  4JVZ A;  2E2D C;  4IUU A;  2JE6 I;  3B6Y A;  2UUC L;  4IPH A;  4J6H A;  4C3J B;  5IWA L;  4C3I B;  3CQZ B;  5IE8 A;  3CCJ A;  3GTG H;  4HED A;  5M3M H;  2K04 A;  1B9M A;  4KD3 A;  2E2J B;  4R4O A;  1CFM A;  4BA1 I;  2LSS A;  3JC6 6;  5NUC A;  4X3U A;  5DLQ E;  4O0A A;  3SE0 A;  2B2Y C;  1AZQ A;  1BR9 A;  4QY7 A;  5C3E H;  4FF3 A;  1SE8 A;  3PQI A;  1VQC A;  1VQP A;  4A3G B;  1LT3 D;  1C7Y A;  1AE3 A;  1LUZ A;  1OXU A;  4GKJ Q;  3GTJ H;  3RNU A;  4JV5 Q;  1B7Y B;  2HDM A;  3UI2 A;  4ZKB B;  1CQF A;  3U50 C;  2PQE A;  1EEI D;  2JEB I;  3OMG A;  1I94 Q;  1A6X A;  2VQE L;  1MBY A;  1SYC A;  4C2M B;  2EY1 A;  3Q6S A;  3K59 A;  2L12 A;  4CBV A;  1FJG L;  1EOV A;  1AN8 A;  3GD7 A;  3QG1 A;  3PO2 B;  5DEH A;  3VYS A;  4BY7 B;  3M4O H;  3HOU B;  1BBX C;  4GNX A;  1PV4 A;  3PO2 G;  1IYV A;  1A15 A;  2MO0 A;  2UUA L;  4KHV A;  1PH5 A;  1JC7 A;  3NTK A;  1B9N A;  5IOC A;  3BDO A;  1L0W A;  1S5E D;  1ENC A;  4B3S Q;  3QR8 A;  1GVP A;  3NHH A;  1H9M A;  4K5X A;  4K14 A;  3TQY A;  2AKW B;  2ZTD A;  2R7Z G;  4KJO A;  1EQR A;  3K80 C;  3PUW A;  1LT6 D;  2RCN A;  1OXT A;  4RHS A;  3GTM H;  1GOZ A;  3S14 B;  1DCZ A;  1RKN A;  5EPK A;  4DU9 A;  1M90 C;  3MXN A;  1CHQ D;  2G5D A;  1G8Z D;  3GO5 A;  2EY5 A;  3P7J A;  5FOB B;  4A3J B;  4A93 B;  1M8A A;  3KOJ A;  4CDF C;  1IBM Q;  5C4X G;  4KJN A;  1PA6 A;  1EY9 A;  1ZKO A;  1G2T A;  4BY1 G;  4ME5 A;  3HOV B;  2N8N A;  3ULJ A;  4JI7 Q;  2ATW A;  3MC0 B;  4LFC Q;  4RGO S;  2HUG A;  3PCO B;  3GDE A;  4DR2 Q;  5CV7 A;  3R93 A;  4KHP L;  2RKS A;  1C0A A;  5JJZ A;  4KV6 A;  4A3E H;  1YBY A;  4KTA A;  2A6H D;  2VUM H;  3R2T A;  1XMO L;  3TSS A;  4BBS H;  3D3R A;  4FXD A;  3HOV H;  2R93 G;  4A3M G;  2D0O A;  3TME A;  2NN6 I;  5I2X A;  5KNC A;  1AH9 A;  2EXD A;  5I6W A;  2FMM A;  4LF6 Q;  4A3F H;  5M5Y H;  2B29 A;  2A68 C;  4UP8 A;  3EJI A;  1NE3 A;  2XWB B;  1P8L A;  1DON A;  1YHB A;  4PV1 C;  3I72 A;  4R4T A;  4LNQ A;  1V8Q A;  4EQN A;  1UNS A;  2UXC Q;  1QWY A;  2JA8 B;  3MZ5 A;  4XYO A;  4DV3 L;  2UUB Q;  2YTY A;  4IPD A;  1S4Z A;  5CV8 A;  4NMZ A;  3K7U C;  3NE5 B;  4DV4 L;  4A3E G;  2PQA A;  2NBF A;  4S3S A;  1ASZ A;  4AYB E;  5C5M A;  2K52 A;  4N8F A;  1IW7 C;  2QDL A;  4JPB W;  4ZQ3 A;  4IFD J;  1PTO H;  3TP6 A;  2QCP X;  4BBR B;  4DR6 Q;  3WOF A;  3CRK C;  2OT2 A;  4A3F G;  1AP0 A;  2VZA A;  1CHP D;  1YI2 A;  4C56 C;  5K36 H;  4NXM Q;  5FLX L;  1VQ4 A;  1PTO C;  1FNW A;  3NXW A;  2Y0S E;  1RIP A;  2UUA Q;  4LWC A;  1MSG A;  5A2Q E;  3HKZ E;  3J81 L;  4RFB A;  2HHH L;  4AH6 A;  3ITP A;  4IZ8 A;  1CZW A;  1HPC A;  5T1I A;  3AFQ A;  1BUV T;  4OO1 H;  1H9R A;  1MGS A;  1WCM G;  1II3 A;  4PG3 A;  2XTI A;  2K50 A;  4FP5 D;  3D8G A;  3IKJ A;  4IOC A;  2WB1 G;  5M5W H;  1KAW A;  3AU7 A;  4DR3 Q;  1YNJ D;  1T5X D;  5C4H A;  1N33 Q;  4IOA A;  1EIG A;  3CP0 A;  1PRT B;  2FHT A;  1H9S B;  1AW7 A;  3I90 A;  3VA7 A;  3HOU H;  3A55 A;  2EYH A;  2DJF C;  1EU3 A;  5IGE A;  2ZTC A;  1ENA A;  2DJG C;  2MGS A;  2DNE A;  1O7I A;  4FXK C;  4BY1 H;  2R92 H;  2CWP A;  2L1B A;  2FJ2 A;  4DR5 Q;  3HOW H;  3PO3 B;  1KQS A;  3T16 A;  2YTV A;  4DV5 Q;  3E0J A;  3S2H H;  2KEC A;  5IIF A;  3SGI A;  2PW5 A;  3U4Z A;  4K2K A;  2UXB L;  1TWH B;  4X66 L;  1FVI A;  3NEM A;  3CC7 A;  3RZD B;  1I4Q A;  4H0L C;  5KND A;  1PZJ D;  4DN4 M;  3CCQ A;  3A7A B;  1JWS D;  2BDO A;  5M3F B;  4RAU C;  4A3K B;  3GTL B;  4UP7 A;  4L5Q A;  3T51 B;  2A19 A;  4QIW E;  4EGV A;  2ES2 A;  2XN9 C;  4BBR H;  4POG A;  4RA8 A;  3HOY G;  5IT9 L;  1CKM A;  1XNQ L;  3H0G B;  4HTH A;  3T1Y Q;  3A5Z B;  4YY3 Q;  1F2L A;  2B2U C;  3NP8 A;  2Z0S A;  1R4P B;  1V1O A;  2CW0 C;  1HZA A;  5IYD G;  3MFY A;  4CJ2 C;  2EDG A;  4A3M H;  1I3Q H;  5DM6 3;  1KIX A;  4DPG A;  1BO0 A;  1JOK A;  4LF6 L;  4P75 A;  4PZ7 A;  1VQ9 A;  3D31 A;  2AQ3 B;  1KDA A;  2I0Q A;  3KF8 A;  4ZKC B;  2XRS D;  2WP8 J;  4C3H B;  1L1O C;  2HCI A;  3E0E A;  4DV1 Q;  2A69 D;  3ONA B;  2A73 B;  1S5C D;  1WTW A;  3K81 C;  5CBE E;  2RVL A;  1DOK A;  4NB3 A;  3NWT A;  4R4Q A;  1UE5 A;  3A5U A;  2SDF A;  5E4X A;  4H13 C;  2E2I B;  1ESR A;  1SEB D;  1UUP A;  1O80 A;  3K6O A;  3SVM A;  3DEO A;  1MSH A;  2QKI C;  2Z6K A;  1PHJ A;  5CGK A;  1SLJ A;  3M9B A;  1KAB A;  1EY0 A;  3DXJ C;  5CV6 A;  2ZJR A;  4DV3 Q;  2UUB L;  2JYO A;  1PH8 A;  1D5X C;  1EYA A;  4BXX G;  4A3B B;  2CH4 A;  1K83 B;  3BDL A;  1Z9F A;  4ODG A;  1A3V A;  1QE6 A;  2Q2U A;  3HFZ B;  4LF8 Q;  2E2H H;  1XXG A;  4X3S A;  1HZB A;  1SNP A;  2NN6 G;  2WB1 E;  4JBJ A;  4DR1 L;  3UDG A;  5IP9 H;  2F0W A;  3NUC A;  4HR7 B;  4CGY B;  2IT1 A;  1VQ5 A;  2GVB A;  1UEB A;  1DGS A;  2Y0S G;  1J8I A;  5IGF A;  4KKT A;  2OQK A;  5LMU L;  4JBK A;  3CCU A;  3VA5 A;  3TRZ A;  2JA8 G;  2B2T A;  4C3J G;  1I6H H;  5J3B A;  3S1M B;  5GAH C;  2AWN A;  1SYD A;  1PH2 A;  2L0C A;  4DXF A;  3KLW A;  3KBX A;  1NJI C;  4N8X 1;  2WIN B;  2D2C C;  3J7A 5;  4JI7 L;  4UY8 C;  2B63 G;  1B44 D;  2K03 A;  4DV5 L;  1XJV A;  1HH2 P;  3GTQ H;  3DLL A;  4GS3 A;  4UP9 A;  5C4X H;  2O2L D;  3J7Z C;  3W1G A;  4P74 A;  1TU2 B;  4HIK A;  3HOX H;  4UPA A;  3EFX D;  4A3F B;  2F0J A;  4WOR A;  1HZC A;  1M1K C;  2K4K A;  1E2Z A;  4B3T L;  2OEO A;  1DYQ A;  3HOU G;  4XTC S;  2MQH A;  4A3B H;  4GNX B;  1K3R A;  2JP1 A;  1VCI A;  1DJR D;  1QIL A;  1TWC B;  3F1Z A;  1JE5 A;  4ZUJ A;  1ET9 A;  1FL0 A;  2JA8 H;  2YU9 H;  2AUK A;  3HOZ B;  1SXT A;  3LNN A;  1ILQ A;  1RTO A;  4LFC L;  1I50 B;  1G6Z A;  1STA A;  3ND8 A;  2ZT9 C;  3HOZ G;  3RN5 A;  4GLX A;  1E1T A;  4IUP A;  3C1F A;  1RDP D;  4DR6 L;  1E24 A;  4WJW A;  4J15 A;  3GQB A;  1KDB A;  1X56 A;  3PUZ A;  1X6O A;  3J81 E;  1K8G A;  5M3M G;  1QJO A;  3RZD H;  3S1M H;  1EYD A;  5FKA C;  3RR5 A;  4Z9C B;  4OWW B;  1TWG B;  1JOQ A;  2EQS A;  1QB5 D;  5FO8 B;  3GTO H;  4B3R Q;  1TY0 A;  4ZUI A;  1IYJ B;  2R7Z H;  3HOY H;  1HNZ Q;  1JWU D;  3FKI H;  1X65 A;  4KHZ A;  1NMG A;  3K5L A;  4XDX A;  2F0G A;  4QIW B;  5IYC G;  2A6H C;  3UDF A;  1A63 A;  3DWQ A;  2M2L A;  3MEF A;  3VR4 A;  1SND A;  2PZT A;  2PMZ B;  4ZCK A;  2CFM A;  2ENB A;  5FLX c;  1NR2 A;  2JA6 G;  2PNH A;  4DV4 Q;  3I4M G;  1I6V C;  3W2D A;  3KFU A;  2B2W A;  3H91 A;  4JI6 L;  4PMB A;  2DGY A;  1MJE A;  4DR4 L;  1CUK A;  2KED A;  2LS0 1;  4MTN A;  1K8M A;  4DV2 Q;  1WTH A;  1O78 A;  1EQT A;  1I94 L;  1LT5 D;  4JBM A;  4P73 A;  3BZD B;  3CAM A;  4LF8 L;  1ET6 A;  4QUC A;  5CR3 A;  1LT4 D;  4DR5 L;  4LF5 Q;  4IN3 A;  2NVQ B;  2PNR C;  5I4D A;  3KF8 B;  4POF A;  3UDX A;  1TS2 A;  1EQV A;  2AHO B;  3TEH B;  2K5Q A;  4JI3 Q;  1JT8 A;  2GVA A;  4A3D H;  5AFW A;  5FJ8 G;  3A54 A;  3RN2 A;  4X3T A;  4DNI A;  2EE1 A;  2B2W C;  3KLR A;  1VQH A;  1SSO A;  2F0H A;  4JI1 L;  3D0F A;  5BR8 L;  1PFM A;  5JPN C;  1V9P A;  2NZ1 D;  4F8M A;  1HZ9 A;  2QGQ A;  3TP5 A;  2K05 A;  1ONL A;  2OXP A;  3J80 E;  2K5V A;  4V0B A;  2VNU D;  3MTS A;  1JWM D;  5FLM G;  3F2B A;  3I91 A;  4DV0 Q;  3MVV A;  1GUN A;  2ZXO A;  1VQE A;  1PRT D;  5C4J B;  2N78 A;  3H3V H;  5FO9 B;  4B3R L;  3ER0 A;  3R8B A;  4DF7 A;  1Y1V B;  5IGD A;  4LUO A;  4R1J A;  4X65 L;  1BXT A;  5IT9 c;  1S3O A;  1GUG A;  2FMC A;  3TP7 A;  1TWF H;  5FJ8 H;  5IOD A;  4A3I B;  1PXU A;  2LXK A;  5IP7 G;  2D62 A;  1KD1 C;  4QCL A;  1KAA A;  5G3L F;  2D0P A;  1H9S A;  3J7Y W;  3C46 A;  3OTO Q;  1C9O A;  1RF2 D;  3GTP H;  3R2I A;  2BA0 A;  2KQ3 A;  1EUJ A;  3O13 A;  2NTT A;  1HR0 W;  1EFI D;  1P16 A;  4GN5 A;  4ZK9 B;  5KYL A;  3GTK B;  4C1N I;  1A3T A;  1F2Y A;  3MXP A;  1RJT A;  1D1I A;  1C48 A;  1SAP A;  4XIG S;  3CPW A;  3ERS X;  5JPM C;  1SNQ A;  3VR2 A;  1SMY C;  1K73 C;  4HJ8 A;  1WTP A;  3W5O A;  1HTL D;  2F0T A;  5M5X H;  2B63 B;  2UXD Q;  5J22 A;  4Q5V A;  2H1E A;  2FIN B;  1MIU A;  5M9O A;  1JIC A;  1XTC D;  4UAI A;  2B2T C;  4PMC A;  3AFP A;  5CBA E;  4OWX B;  3HGB A;  4GN4 B;  2AWO A;  2F0Q A;  2JA6 H;  1FGU A;  1HUM A;  2MFI A;  3MEH A;  2MP1 A;  4YCV A;  1ASY A;  4N9P A;  1HNX L;  4JI8 Q;  2R7D A;  1FR3 A;  4FDB A;  3GTG B;  3C3L A;  4L5S A;  3BVZ A;  3SDZ A;  2VQF L;  4I7Z C;  3D4D A;  3TZU A;  2F0P A;  2J0T D;  4LFA Q;  1STE A;  3F2U A;  4B3T Q;  4QUF A;  2K6A A;  5IYB G;  3SK8 A;  3C1E A;  3NWS A;  2BE5 D;  2PQA B;  4B9W A;  2E2H B;  1G91 A;  3A8I E;  3GTL H;  2YU9 B;  2N88 A;  3RZO H;  1LV9 A;  2NYZ D;  3W1B A;  4DR7 Q;  3C2P A;  2RDG A;  1SYF A;  2D5D A;  4NDX A;  1SMY D;  2WKD A;  5C4X B;  3PF5 A;  4F87 A;  5CV5 A;  3UDI A;  5J1Z A;  1BNZ A;  1EY5 A;  1VQD A;  1HQR D;  2F0U A;  1B3Q A;  1PTO F;  3TP8 A;  1I5F A;  4JOI C;  2EXZ A;  4X64 L;  1LAB A;  1EYG A;  4HID A;  1S5D D;  5KIX A;  3VYR A;  1I4X A;  2O4X A;  1S40 A;  3I56 A;  3H15 A;  5CC4 A;  5IT9 E;  2WAQ G;  5F2D A;  5I2Y A;  2EVB A;  5LMN Q;  4LW1 A;  4A3G H;  4C3H H;  4EVO A;  5M5Y B;  3N52 A;  1U9R A;  2NB0 A;  1WFQ A;  4HN7 A;  4P72 A;  3PIP 3;  2VXW A;  1NTG A;  2L15 A;  2NZO A;  2JA6 B;  2JQO A;  1IKM A;  2A68 D;  2ASB A;  1IBK L;  2Z4H A;  2CKZ B;  1Q46 A;  1WI5 A;  3S17 B;  3I4N H;  3M3Y B;  4ABN A;  1HA5 A;  4BBS G;  4O2D A;  3HOW G;  4QQB X;  1ML0 D;  2RSO A;  1W2B A;  2BH2 A;  4A3C G;  3K0X A;  1YHA A;  4IUQ A;  4HAE A;  1IL2 A;  1EFW A;  1YNN D;  3HZX A;  3A0J A;  1F2M A;  3EQL C;  5KGU A;  4JW0 A;  4HJA A;  3K5N A;  4K6D A;  3MXN B;  1TVX A;  5HY6 A;  1K83 H;  1GKH A;  1XWE A;  1YIJ A;  3VYT A;  4NKL A;  5CMD A;  5M3F H;  2RQX A;  4K2L A;  4A3G G;  2EY6 A;  2B8G A;  5JJK A;  2SNS A;  3Q24 A;  3L7Z C;  3H3V I;  2EPB A;  2PCF B;  2PYK A;  1IYU A;  1A8V A;  2Q2I A;  3H3V C;  1L2F A;  3FEW X;  3QB3 A;  2RDH A;  1SNO A;  4XQJ A;  3G48 A;  4DK1 A;  2BDN A;  4AQY L;  5DAU A;  1OXS C;  2L55 A;  3PV0 A;  4GNX C;  1LM0 A;  2B39 A;  3I8Z A;  1STG A;  2R61 A;  5COR A;  3MWY W;  3BDC A;  5BN3 A;  2OTJ A;  5C3W A;  4LFB L;  3IL8 A;  2BOS A;  4PZ6 A;  1QZG A;  3RLN A;  1OO9 B;  1E3P A;  1STY A;  2XGT A;  4X6A H;  3S16 H;  2F0L A;  4QL5 A;  5IP7 H;  3S2D B;  1YHQ A;  2PMZ E;  1F2Z A;  1QG7 A;  3J7A V;  1LTB D;  3J80 i;  5EJW A;  2VQF Q;  1SDF A;  4LF9 Q;  5KNB A;  1N33 L;  4A93 H;  1XPO A;  4C2M H;  2MHV A;  1Q1B A;  1SMX A;  2VB2 X;  2WB1 B;  5I9P A;  2QA4 A;  3DHQ A;  2NVX B;  1LTR D;  1D2B A;  3CCM A;  1UE1 A;  5ISR A;  4IUT A;  4LFB Q;  2N55 A;  3FVQ A;  2MJ8 A;  3Q0A A;  4P2C B;  1WTX A;  1Y1W G;  3J80 L;  4O42 A;  4GKK L;  1PFB A;  1LAC A;  4B9X A;  1ZEQ X;  2K1B A;  5CV9 A;  4KD4 A;  1SR3 A;  4DA2 A;  2UU9 Q;  4EQ5 A;  1GD7 A;  1E2W A;  3S1R H;  3HS0 C;  1JJC B;  3D4R A;  4GKK Q;  1XPU A;  1PH7 A;  3MXU A;  2Z4I A;  4IFD G;  4H7B A;  1KC8 C;  2AUJ D;  1V1P B;  1YIT A;  3FPU B;  2L4N A;  4ZRZ A;  1JB7 A;  1X55 A;  2K5N A;  1K0R A;  4RCN A;  5FK9 C;  1N36 L;  1U4P A;  3TRE A;  3KF6 B;  3S16 B;  2F0V A;  2E2I H;  1UEA B;  4OIK A;  1F9R A;  4A3K G;  2IPK D;  4R8N A;  1BBW A;  1NNX A;  2Z1C A;  1B4O A;  1YZ6 A;  5FO7 B;  4X62 L;  1KRT A;  4A3C H;  4XYQ A;  3BU2 A;  1WTQ A;  1PH1 A;  1PVO A;  3GP7 A;  4YHH L;  1ZXT A;  2IW3 A;  1D5Z C;  1IBK Q;  4EX5 A;  4AYB B;  2HCC A;  3G4S A;  4RGM A;  1KDC A;  1TKW B;  1XNQ Q;  3RMH A;  3RD4 A;  1F9P A;  4I7A A;  2HDL A;  4DR4 Q;  3Q22 A;  4MN3 A;  2NVY B;  2F4V L;  4DV2 L;  3KLS A;  4DV1 L;  4QMG A;  4A76 A;  1VF7 A;  2JA7 H;  4K0K L;  4LUZ A;  2XNA C;  2ZJP A;  3OIQ A;  5EAY A;  4MNO A;  4KY6 A;  1TWA H;  3CMA A;  3J81 i;  5JEA J;  3I2Z A;  5GAE C;  1XPR A;  3HOX G;  1L1O B;  1SFO H;  5IP9 G;  1KLG D;  4UHV A;  2R7F A;  3ZYY X;  4DK3 C;  3HOX B;  2OWO A;  4OL7 A;  3T4A C;  3BVM A;  1HNX Q;  1VQN A;  4KKS A;  2BH8 A;  3M7G A;  1A2T A;  3I4M H;  4DFA A;  1TQO A;  3CCV A;  1JE4 A;  4MTK A;  1CT1 D;  1NSN S;  1Y8O B;  3CRL C;  1Q7Y C;  3N6R A;  3S2H B;  1I50 H;  3H09 A;  2K01 A;  1QVC A;  3GV3 A;  1EY8 A;  3MHB A;  5ELC A;  4L63 B;  3G71 A;  1YVC A;  4OEM B;  1SYB A;  2L5T A;  4JI8 L;  4DV6 Q;  5D65 A;  4IO9 A;  2A74 C;  1XMQ L;  2B2U A;  2HIV A;  2EJF C;  4M1U B;  2G9D A;  4TRD A;  2WII B;  3E6Z X;  2EYJ A;  1PYW D;  4DK6 C;  1R9T H;  1WVL A;  1EOT A;  3CCE A;  4RH6 A;  5FLX E;  3V96 A;  4TKO B;  4HSP A;  1I4H A;  3DWA A;  2OQ0 A;  5BN5 A;  5EKL A;  1EIY B;  1ROD A;  1EQQ A;  1IBL L;  2MPM A;  1JOR A;  4PZ8 A;  4RMF A;  1IXR A;  1PYB A;  3FKI B;  1H95 A;  5ELE A;  1HFG A;  4DAY B;  1G51 A;  1O7Z A;  4DUZ Q;  2IX3 A;  2BA1 A;  4GOP B;  1TWG H;  5C3E B;  2KHJ A;  1PH6 A;  4RG1 A;  1LTS D;  2IX0 A;  3MFG A;  3TS2 A;  1SNC A;  3S1R B;  2F0S A;  1CA6 A;  4Q0F A;  3I7F A;  1VQG A;  5D3D A;  5A35 A;  2RA4 A;  4JI4 Q;  2E8G A;  4CKB A;  4ALP A;  1JJ2 A;  4R4I A;  5D3I B;  1T9H A;  3M4Q A;  2K5W A;  1UWV A;  2F0I A;  5DM7 3;  3CC4 A;  3NEN A;  3V2T A;  1VQB A;  5M5X B;  3MXG A;  3U4V A;  3M85 A;  4KN4 C;  4BA2 I;  1SNM A;  4A4I A;  4JCV E;  3H0G G;  4CJ0 B;  4G7O C;  1X32 A;  3NPP A;  4IPG A;  2HIX A;  2R7Z B;  3GV6 A;  1RTN A;  3L2P A;  1DM0 B;  3CHB D;  1QNU A;  3SXH A;  1U0L A;  4OO1 I;  2KHI A;  3E9I A;  2I07 B;  3SK6 A;  4YWK A;  3CU7 A;  4E6I A;  4A93 G;  1VS0 A;  3FDT A;  1CKN B;  3X3M A;  2EIF A;  2WFW A;  4XT1 B;  3AMU A;  1KLU D;  5K5P A;  1SJH D;  1TS3 A;  1Q8K A;  3UE1 A;  1FD7 D;  1Y8P B;  3DWP A;  5AJ3 L;  2HHH Q;  4A3L H;  3L9A X;  2EYO A;  2JXM B;  4YCU A;  4WJ4 A;  3D6C A;  1J6Q A;  4JI3 L;  3IFT A;  5EKI A;  4A3D G;  1KRS A;  5HUR A;  1K28 A;  1BCP D;  1VDZ A;  3K58 A;  4GLA C;  1RCV D;  1ESF A;  3BG3 A;  4GN3 B;  1B70 B;  3GTK H;  3CCR A;  3Q23 A;  3KK7 A;  2K14 A;  3PGZ A;  2E75 C;  3I4M B;  4RKL A;  2KCT A;  2A1A A;  3QIA A;  4IPC A;  2BCO A;  3ERQ A;  1G29 1;  4ULL A;  2NZH A;  1JB3 A;  1YJN A;  4X66 Q;  4LF5 L;  2EYP A;  1CZG A;  2JA5 H;  1N32 L;  3I4N B;  3NBH A;  3URY A;  4JI0 L;  1F77 A;  1SYE A;  1EWI A;  1SE3 A;  2XVS A;  2DN8 A;  3ERO A;  4LJZ C;  4HJ9 A;  1VQI A;  2PI2 A;  4FF2 A;  1KNA A;  1EYC A;  2Z8L A;  4O1N A;  4LAA A;  3AQQ A;  2RHQ B;  4DUY Q;  1CI3 M;  4HMJ A;  4BBR G;  3CC2 A;  3F8T A;  1VQ8 A;  4DK0 A;  1SBB B;  2TMP A;  4HCS A;  4YHH Q;  2GA4 B;  1Z7T A;  3CME A;  1PZI D;  2CQA A;  4EQO A;  2ZTE A;  1PFS A;  4BY7 H;  1Y1V G;  2X69 A;  1X3P A;  1AE2 A;  5BN4 A;  4YWM A;  4Y7N H;  2J7Z A;  2X6G A;  1J5E L;  2CHB D;  2FFK B;  2UU9 L;  5C0X G;  2YTX A;  2ZXR A;  1D5M C;  3SHL A;  1CTM A;  4BWG B;  4RGN A;  1T5E A;  1SJE D;  2K33 A;  3EVQ A;  3P75 A;  3KJO A;  1YNJ C;  4ID6 A;  1JJG A;  4JI1 Q;  1TXY A;  1O7L A;  3X3N A;  5C6A A;  5HGT A;  4DNT B;  1GHJ A;  5C0X H;  1OTC A;  2D9U A;  2VS1 A;  1ICF B;  4C3I G;  4HIO A;  1TWA B;  4A3I G;  1U4R A;  2CWA A;  5M3M B;  2UUC Q;  2MO1 A;  1VQA A;  5K36 G;  2KUM A;  2F0O A;  2YV5 A;  4L6T B;  1IKL A;  2XWJ B;  1NAP A;  4H02 A;  4LFA L;  1X54 A;  4DXG A;  3STB D;  5JJL A;  2IY5 B;  5IYB H;  3S14 H;  1XYI A;  1H9J A;  2SNM A;  1Y1W B;  2IHF A;  1R4Q B;  2F0N A;  2CW0 D;  3EN2 A;  1BCP F;  2C35 B;  2SOB A;  3FMC A;  1QOH A;  1PMR A;  2V4D A;  4G4K A;  2KCN A;  2NVT H;  2JK8 A;  3BYT B;  1ZYR C;  2Q8T A;  1ENF A;  4RWS C;  4U68 A;  1Q90 A;  5LL6 S;  4YWL A;  3S1N H;  4YIJ A;  2NWG A;  3H6M A;  3PIO A;  1IBL Q;  4WFN 3;  1I4G A;  1UE6 A;  2K28 A;  1TWC H;  4LF7 Q;  1WCM H;  1CK1 A;  1S72 A;  3M4P A;  1Y69 U;  4RGT A;  1TWH H;  4ILW A;  3HOY B;  4R8I A;  4IFD H;  1SE2 A;  2K5H A;  2EJM A;  3A8K E;  1XMO Q;  4KMU C;  4U67 3;  2A8V A;  1LTL A;  1AEX A;  4OON A;  5C4J H;  3OW7 A;  3T1H L;  2Z6B A;  4RCO A;  3E9H A;  4N9T A;  2LXJ A;  3TN2 A;  4APV A;  2TSS A;  2XIW A;  1FNU A;  2KOL A;  5LL6 X;  3KDF B;  1S5B D;  2JA5 B;  2DY8 A;  1U4L A;  3KJP A;  2ICI A;  4LF7 L;  1D7Q A;  1IBM L;  1DZ1 A;  5EPJ A;  1V1Q A;  3A74 A;  3MA2 B;  3PUV A;  2V1C C;  3CXC A;  4DGZ A;  4R4C A;  2ICE C;  3NBH B;  3JAM E;  4MZ9 A;  1YNX A;  2KVM A;  3BYY B;  3OWF A;  4YCW A;  1ICW A;  3J7A F;  4IFD I;  3SK4 A;  4BY1 B;  3I4O A;  4KLK A;  4B3M L;  1YJ9 A;  1VQM A;  1W3S A;  1H9K A;  4DR2 L;  4A3J H;  1EIH A;  4LK1 C;  1D8L A;  2R6G A;  2E5L Q;  5D14 A;  3OMC A;  1EWC A;  4KK7 A;  4DV7 L;  1NCV A;  2QF7 A;  3EBE A;  2CCZ A;  1HNW L;  2N49 A;  2FXQ A;  1QCB D;  1PH9 A;  4DAM A;  4KY7 A;  1M4V A;  3HG9 A;  4FYD A;  2R93 H;  2NTS A;  2KHS A;  5EGT A;  4R9W A;  3RUZ A;  1K8O A;  1B1Z A;  1XNR Q;  1BVS A;  1TT2 A;  2R92 G;  2NVQ H;  2B2V A;  2HQL A;  4JI4 L;  4B3M Q;  5KYI A;  3KYH C;  3Q8D A;  3PUY A;  1B8A A;  3OSO A;  1XNR L;  4DKA C;  1JQY D;  3FP9 A;  2I5L X;  2PPB C;  1U4M A;  2VW9 A;  1WTV A;  2NVX H;  3BS1 A;  1Q86 C;  4UDU C;  5ELN A;  1KXL A;  1K8A C;  1HR0 L;  5E7N A;  4L5R C;  3QO2 A;  2ZM6 L;  3L3O C;  4G57 A;  1Q82 C;  1RL2 A;  1STN A;  3S15 B;  2RDF A;  1BF4 A;  2EYL A;  4ME3 A;  1DXM A;  4F88 A;  2ZM6 Q;  3T1Y L;  1E7Z A;  3U58 A;  1HNZ L;  1WD0 A;  1EY4 A;  3RZO B;  1N9W A;  5LMN W;  3JAM c;  1MD2 D;  2B3G A;  1QUQ A;  1FJG Q;  1I4P A;  4XQQ A;  4J8Q A;  1BDO A;  3E3X A;  3FKI G;  4L5T A;  1HXY D;  2Z9H A;  4A3K H;  4LF4 L;  1IHZ A;  3IAY A;  1Y1W H;  1OXX K;  3QOL A;  3FHW A;  3MAQ A;  4JI5 Q;  2HT1 A;  3E5S A;  3V05 A;  2JEA I;  1UE7 A;  4LF4 Q;  2O5J C;  1WYD A;  4JBW A;  1Y14 B;  2LFN A;  5I6Y A;  1C8C A;  1BCP B;  1V43 A;  1QZH A;  4C3I H;  1W6J A;  3A56 A;  5JJI A;  1CQV A;  1EU4 A;  4B08 A;  1KHI A;  1PRT F;  1QUQ B;  4K5W A;  3JAM L;  2B63 H;  1WJJ A;  3W3A A;  3WWV A;  5C0X I;  1E2V A;  3BZC A;  4DV0 L;  2M9V A;  1WCM B;  2HQE A;  4Y7N B;  3PIO 3;  2F03 A;  4FF1 A;  4DV6 L;  2OF1 A;  1BOS A;  4TVA B;  1GUS A;  1PLF A;  2WV6 D;  3I55 A;  1IW7 D;  3P20 A;  3PO2 H;  3CPF A;  1JOO A;  2UXD L;  3M4O B;  2IWH A;  3VDY A;  3JAM i;  1PYS B;  1NY4 A;  4CDE C;  5FLM H;  1DD2 A;  4OXP A;  3TBI B;  2OTL A;  1VMP A;  1D6E C;  3I70 A;  4EQP A;  4DUY L;  1GUW A;  4A3J G;  3GTP B;  1GM5 A;  4LF9 L;  2E76 C;  4OX9 L;  3PO3 G;  1SN8 A;  3BZK A;  2VB3 X;  5C5L A;  1A3U A;  5T1G A;  4DR1 Q;  1GUT A;  3IFD A;  1S5F D;  3J80 c;  2B8F A;  5LMN L;  1CA5 A;  1DOL A;  1N34 Q;  3L0O A;  5GRO A;  1STH A;  1L0Y B;  4X3K A;  2EYM A;  5ELF A;  2WKC A;  4K8I A;  1LLR D;  2E2J H;  4FO2 A;  1ZYR D;  4KY5 A;  1B53 A;  3PIP A;  1K0S A;  3LX0 A;  4IJL A;  2ZJQ A;  3BVG A;  3T53 B;  1AZP A;  1SE4 A;  1N34 L;  2DY7 A;  2R93 B;  2C9O A;  1MJC A;  3HOZ H;  1X3Q A;  2IHE A;  3AB9 A;  2PO4 A;  2F4I A;  3ULL A;  1J5E Q;  2NVY H;  1VF5 C;  1L1O A;  3NSW A;  4OWT B;  5EPL A;  4G7Z C;  2KA7 A;  4OEL B;  3F2D A;  1HNW Q;  3LWE A;  3I4N G;  1K9M C;  3S2D H;  2JA9 A;  2JJQ A;  2BE5 C;  1KTK A;  1GO3 E;  2VY3 A;  5IY0 A;  2I46 A;  2E5L L;  1LTG D;  1NMF A;  5DNF A;  4DV7 Q;  3KDF A;  3NQI A;  3HRZ C;  1I6H B;  3M4Y A;  1UAP A;  4CHT B;  2UXC L;  5C44 B;  5IGB A;  3NK9 A;  2A69 C;  5EQ0 A;  3S15 H;  5C3X A;  1VQF A;  3OYY A;  5C44 G;  1F9S A;  1CSQ A;  4OIJ A;  3TDQ A;  4QJF A;  3T1H Q;  5JEA H;  1F9Q A;  3HKZ B;  1BQQ T;  4IUN A;  1EY7 A;  1GUO A;  2NUC A;  1EY6 A;  2LKV A;  4L8J A;  1W6K A;  2XSC A;  2VQE Q;  5C44 H;  4DR7 L;  4WRD A;  2EYF A;  5CYU A;  1X3F A;  4Y52 H;  2F0D A;  4B3S L;  4JK1 C;  2IX1 A;  4HJ5 A;  1EZ6 A;  4TSS A;  2ALY B;  3NQT A;  4GLV B;  5EBD A;  1YJW A;  1WOC A;  1LTI D;  5GQO A;  3RLF A;  4FNF A;  2F52 A;  1XTD A;  2PZW A;  2L9H A;  1EIF A;  1E22 A;  1TWF B;  3CQZ H;  4IAL A;  4A3I H;  3DM3 A;  2F0M A;  3VR5 A;  4CKC A;  1LTA D;  4AIM A;  1V1P A;  4JC0 A;  2VUM G;  1G2S A;  2Q8I B;  3D4W A;  2NN6 H;  3HP3 A;  2H5X A;  3VR3 A;  3LGJ A;  1PRT C;  4H44 C;  3HEJ A;  2JA7 B;  1N8R C;  1O7Y A;  2KJX A;  1X3G A;  3GTO B;  1N36 Q;  1PZK D;  3K5M A;  1CKO A;  4FF4 A;  2UXB Q;  3K7A H;  3ND9 A;  4DR3 L;  1XX8 A;  1PH3 A;  3KUP A;  2B2Y A;  3ICE A;  2EJG C;  4GOP C;  3SEB A;  5GAG C;  2EZV A;  1GHK A;  2DUD A;  4K8J A;  2F0F A;  4DUZ L;  3SR1 A;  1G6P A;  2GN5 A;  2VL6 A;  2QEX A;  4OO1 G;  1E0B A;  2R3Z A;  3F2C A;  1Q1E A;  1KL9 A;  4DAV A;  1SYG A;  3TS0 A;  1TII D;  1PTO B;  4JG2 A;  3P1H A;  2QIL A;  2P5Z X;  3CF5 A;  1VQJ A;  2I5M X;  2PW7 A;  4M8A A;  5BR8 Q;  5C3E G;  1BCP C;  5M5W B;  3S1Q H;  1VQL A;  3OPO A;  1MI2 A;  5HGQ A;  5G3L D;  5C0X J;  4RHR A;  4K0K Q;  1STB A;  5J39 A;  3FPP A; 
#chains in the Genus database with same CATH homology
 4A3E G;  2PQA A;  4HJ9 A;  2CQO A;  3CW2 C;  3K8A A;  1VQI A;  2PI2 A;  4JI8 Q;  1HNX L;  1ASZ A;  2R7D A;  4AYB E;  3ZJY C;  4FDB A;  2K52 A;  4L5S A;  2VQF L;  1JMC A;  5IWA Q;  3PO3 H;  4IFD J;  4LFA Q;  3AQQ A;  4GKJ L;  4DR6 Q;  3OTO L;  4JI2 Q;  2RHQ B;  4DUY Q;  4JI5 L;  4B3T Q;  5IYB G;  4BBR G;  3CC2 A;  3F8T A;  2PQA B;  4A3F G;  1VQ8 A;  1HR0 Q;  3GTL H;  4YHH Q;  2VZA A;  1VQK A;  3RZO H;  3CME A;  3W1B A;  3AYH B;  1YI2 A;  3CD6 A;  4DR7 Q;  2A8V A;  4NXM Q;  1VQ4 A;  2RF4 A;  2Y0S E;  2ZTE A;  1PFS A;  3PF5 A;  2OCE A;  1Y1V G;  4BY7 H;  1RIP A;  2UUA Q;  3UDI A;  1AE2 A;  4LWC A;  4YWM A;  4Y7N H;  1VQD A;  3HOV G;  1J5E L;  2JA5 G;  2UU9 L;  3HKZ E;  5C0X G;  2YTX A;  2HHH L;  3UE0 A;  2KCM A;  1I5F A;  4AH6 A;  4JOI C;  3STB C;  4X64 L;  1EYG A;  1JJG A;  3KJO A;  4HID A;  2MNA A;  3AFQ A;  4JI1 Q;  1PH4 A;  1TXY A;  1S40 A;  3I56 A;  3H15 A;  1WCM G;  1OTC A;  4PG3 A;  2WAQ G;  2VS1 A;  2XTI A;  5LMN Q;  4LW1 A;  4A3G H;  2K50 A;  4C3H H;  3M3Y H;  2ID0 A;  4HIO A;  4A3I G;  4X62 Q;  3J81 c;  5LMU Q;  1WFQ A;  4P72 A;  4IOC A;  2CWA A;  1QVG A;  2UUC Q;  2WB1 G;  2MO1 A;  5M5W H;  3PF4 A;  1KAW A;  1VQA A;  4DR3 Q;  4YY3 L;  1NTG A;  2L15 A;  2NZO A;  4A3B G;  1N33 Q;  4IOA A;  5K36 G;  2JQO A;  3CP0 A;  2ASB A;  3HOU H;  1IBK L;  2YV5 A;  4H02 A;  2CKZ B;  3HKS A;  5GAD C;  4LFA L;  1X54 A;  1Q46 A;  1WI5 A;  3STB D;  1QVF A;  3I4N H;  5IYD H;  5JJL A;  2IY5 B;  2ZTC A;  5IYB H;  3S14 H;  4BBS G;  3BJU A;  4O2D A;  1SRU A;  3HOW G;  4QQB X;  1O7I A;  2IHF A;  1W2B A;  2BH2 A;  2PI2 E;  3EN2 A;  4BY1 H;  1CKN A;  4A3C G;  2C35 B;  1YHA A;  2CWP A;  3K0X A;  4LUV A;  5H1S E;  4DR5 Q;  2Q2T A;  1IL2 A;  1KQS A;  1EFW A;  2YTV A;  3A0J A;  2NVT H;  4DV5 Q;  3IRB A;  3HOW H;  4JYA L;  3S2H H;  2JK8 A;  1YEZ A;  1Y1V H;  3SGI A;  2KEN A;  4JI0 Q;  3U4Z A;  2UXB L;  4X66 L;  4HJA A;  1FVI A;  3MXN B;  4JOI A;  3NEM A;  5HY6 A;  3CC7 A;  3CCQ A;  4YWL A;  3S1N H;  1K83 H;  1GKH A;  1YIJ A;  1IBL Q;  3PIO A;  5M3F H;  1UE6 A;  5ELO A;  4A3G G;  1TWC H;  4LF7 Q;  5JJK A;  1WCM H;  4UP7 A;  3L7Z C;  3H3V I;  1S72 A;  4JI6 Q;  4L5Q A;  1SRO A;  2A19 A;  3M4P A;  4QIW E;  1A8V A;  2Q2I A;  1L2F A;  1TWH H;  2ES2 A;  4HJ7 A;  2K5H A;  4NPS A;  4BBR H;  1XMO Q;  4X64 Q;  4POG A;  3G48 A;  3OW2 A;  3HOY G;  1CKM A;  1XNQ L;  4AQY L;  3H0G H;  3T1Y Q;  1OXS C;  3A5Z B;  1LTL A;  3PV0 A;  4OON A;  4YY3 Q;  5C4J H;  3J81 j;  4GNX C;  3T1H L;  1MKH A;  2Z0S A;  1LM0 A;  3E9H A;  2LXJ A;  4APV A;  1HZA A;  5IYD G;  3KDF B;  4A3M H;  4NXN Q;  1I3Q H;  2OTJ A;  4HIM A;  4LFB L;  1KIX A;  4DPG A;  4LF6 L;  4P75 A;  4PZ7 A;  1VQ9 A;  3D31 A;  1OXV A;  4PZ6 A;  1QZG A;  4TQU S;  3KJP A;  2I0Q A;  4LF7 L;  1D7Q A;  3RLN A;  1IBM L;  1E3P A;  2XGT A;  4X6A H;  2WP8 J;  1L1O C;  1V1Q A;  3A74 A;  3PUV A;  3E0E A;  3PSI A;  4QL5 A;  2V1C C;  4NXN L;  5IP7 H;  3CXC A;  4DV1 Q;  4GOP A;  4R4C A;  3NBH B;  4C3J H;  4QGU A;  4MZ9 A;  1YNX A;  2I5H A;  4YCW A;  1YHQ A;  4IFD I;  2PMZ E;  1BBU A;  1A0I A;  4OX9 Q;  3K81 C;  3I4O A;  4KLK A;  3J80 i;  4B3M L;  2VQF Q;  1YJ9 A;  4NB3 A;  1W3S A;  1VQM A;  1Z47 A;  4R4Q A;  1UE5 A;  4LF9 Q;  3A5U A;  4DR2 L;  1N33 L;  4A3J H;  4A93 H;  1XPO A;  1D8L A;  4C2M H;  1Q1B A;  1SMX A;  2R6G A;  2AMC B;  2QA4 A;  3NEL A;  2JA7 G;  1LYL A;  2E5L Q;  3CCM A;  1UE1 A;  4BY7 G;  1VQO A;  4DV7 L;  2Z6K A;  1PHJ A;  4LFB Q;  2Q2H A;  1SLJ A;  3EIV A;  3EBE A;  2CCZ A;  3M9B A;  2ZJR A;  1HNW L;  2N49 A;  4DV3 Q;  4P71 A;  2UUB L;  2F4V Q;  1PH8 A;  4BXX G;  2K75 A;  2FXQ A;  1PH9 A;  4DAM A;  1Z9F A;  2R93 H;  1Y1W G;  3RLO A;  1X9N A;  1Q81 C;  3AEV A;  2Q2U A;  1XNR Q;  3HFZ B;  4GKK L;  1BVS A;  2YYZ A;  2E2H H;  1BKB A;  4AQY Q;  4LF8 Q;  2R92 G;  4JI2 L;  2NVQ H;  4JV5 L;  1HZB A;  2HQL A;  2NN6 G;  2WB1 E;  4JBJ A;  4DR1 L;  1SR3 A;  3UDG A;  1Q12 A;  4EQ5 A;  1GD7 A;  5IP9 H;  2UU9 Q;  3KYH C;  3PUY A;  3Q8D A;  1B8A A;  1NBW A;  3S1R H;  4B3M Q;  1JJC B;  2IT1 A;  1VQ5 A;  2GVB A;  1XNR L;  4GKK Q;  4DKA C;  1XPU A;  1UEB A;  4X65 Q;  1DGS A;  2I5L X;  2Y0S G;  3FP9 A;  1PH7 A;  4KI0 A;  2OQK A;  2VW9 A;  4IFD G;  2NVX H;  4NXM L;  1Q86 C;  5LMU L;  5ELN A;  1KXL A;  1KC8 C;  3CCL A;  2F3I A;  4JBK A;  1YIT A;  3CCU A;  1K8A C;  4WJ3 M;  1HR0 L;  1JB7 A;  3TRZ A;  2JA8 G;  5E7N A;  4L5R C;  1X55 A;  2ZM6 L;  5M3F G;  2K5N A;  1K0R A;  1I6H H;  5J3B A;  1Q82 C;  1RL2 A;  1N36 L;  5GAH C;  3TRE A;  2AWN A;  1A62 A;  3KF6 B;  1PH2 A;  4A3L G;  4ME3 A;  2E2I H;  3KLW A;  2ZM6 Q;  3T1Y L;  4A3K G;  1NJI C;  1CSP A;  1E7Z A;  4PMW A;  3U58 A;  1HNZ L;  2RHS B;  1BBW A;  3J7A 5;  4JI7 L;  1N9W A;  1YZ6 A;  4UY8 C;  5IYC H;  5LMN W;  4X62 L;  2B63 G;  3S24 A;  1KRT A;  3JAM c;  2B3G A;  1QUQ A;  4DV5 L;  1XJV A;  1FJG Q;  4A3C H;  1HH2 P;  3GTQ H;  3DLL A;  4JYA Q;  4GS3 A;  4UP9 A;  5C4X H;  4L5T A;  3FKI G;  3J7Z C;  3BU2 A;  3W1G A;  3S17 H;  4P74 A;  3ULP A;  1PH1 A;  4HIK A;  1PVO A;  3HOX H;  4A3K H;  4UPA A;  4YHH L;  4LF4 L;  4A75 A;  5JEA G;  1HZC A;  4IJH A;  1E1O A;  1OXX K;  4EX5 A;  3FHW A;  1Y1W H;  1M1K C;  1IBK Q;  2K4K A;  3G4S A;  1N32 Q;  4B3T L;  4JI5 Q;  1XNQ Q;  2HT1 A;  1X3E A;  3HOU G;  4XTC S;  4AYB G;  2MQH A;  5AJ3 Q;  2JEA I;  1UE7 A;  4LF4 Q;  1WYD A;  4JBW A;  4A3B H;  4GNX B;  1K3R A;  1Y14 B;  4DR4 Q;  2F4V L;  4DV2 L;  4A76 A;  4DV1 L;  3G6E A;  1VCI A;  2JA7 H;  2WAQ E;  4K0K L;  3F1Z A;  4LUZ A;  1JE5 A;  1V43 A;  2ZJP A;  4C3I H;  1QZH A;  1FL0 A;  2JA8 H;  5JJI A;  5EAY A;  2YU9 H;  4MNO A;  1KHI A;  1TWA H;  1QUQ B;  4LFC L;  3CMA A;  2B63 H;  1WJJ A;  2N3S A;  5JEA J;  3I2Z A;  5GAE C;  3WWV A;  3J81 i;  3HOX G;  4GLX A;  3RN5 A;  1XPR A;  1E1T A;  2Z6K C;  3HOZ G;  5C0X I;  1L1O B;  1SFO H;  3BZC A;  3HKZ G;  5IP9 G;  1VQ6 A;  4DR6 L;  4DV0 L;  1E24 A;  2R7F A;  4DK3 C;  3CCS A;  2OWO A;  4J15 A;  4DV6 L;  4TVA B;  3I55 A;  3KF6 A;  1U5K A;  4KHP Q;  1X56 A;  3PUZ A;  1IZ6 A;  1X6O A;  1K8G A;  1HNX Q;  3PO2 H;  5M3M G;  4BXX H;  3CPF A;  2UXD L;  2KBN A;  3RZD H;  1VQN A;  2BH8 A;  3S1M H;  3PUX A;  3VDY A;  3I4M H;  3JAM i;  1PYS B;  1NY4 A;  3RR5 A;  5FLM H;  3CCV A;  4OWW B;  4OXP A;  2EQS A;  1Q7Y C;  2OTL A;  4DUY L;  3GTO H;  4B3R Q;  4A3J G;  1HJP A;  1I50 H;  1GM5 A;  3M7N A;  1IYJ B;  2R7Z H;  3HOY H;  4LF9 L;  1HNZ Q;  3FKI H;  1VQ7 A;  1QVC A;  1X65 A;  3G71 A;  1NMG A;  1YVC A;  4KHZ A;  4OX9 L;  2JE6 I;  3BZK A;  1SN8 A;  3B6Y A;  3PO3 G;  2UUC L;  4JI8 L;  4IPH A;  4DV6 Q;  5IYC G;  4IO9 A;  4DR1 Q;  1XMQ L;  5IWA L;  2HIV A;  3J80 c;  5IE8 A;  3UDF A;  5LMN L;  1A63 A;  3CCJ A;  3MEF A;  3GTG H;  1N34 Q;  3L0O A;  5GRO A;  5M3M H;  2CFM A;  5FLX c;  4R4O A;  2E2J H;  4DK6 C;  2JA6 G;  1R9T H;  2PNH A;  4DV4 Q;  3PIP A;  3CCE A;  4BA1 I;  3I4M G;  3KFU A;  2LSS A;  3JC6 6;  4IJL A;  2ZJQ A;  2R92 H;  4JI6 L;  5DLQ E;  4O0A A;  1N34 L;  4QY7 A;  2DGY A;  5C3E H;  1MJE A;  1SE8 A;  2OQ0 A;  1CUK A;  1VQC A;  4MTN A;  1VQP A;  4DR4 L;  4DV2 Q;  1C7Y A;  1EIY B;  1I94 L;  1MJC A;  4JBM A;  1EQQ A;  3HOZ H;  1AE3 A;  1IBL L;  2IHE A;  4P73 A;  1LUZ A;  1OXU A;  3CAM A;  4PZ8 A;  4RMF A;  4LF8 L;  1IXR A;  1PYB A;  3GTJ H;  3RNU A;  4GKJ Q;  4JV5 Q;  1H95 A;  1B7Y B;  4JI4 L;  3ULL A;  3U50 C;  4DAY B;  2NVY H;  1J5E Q;  1L1O A;  2JEB I;  1G51 A;  4OWT B;  4DR5 L;  1I94 Q;  4DUZ Q;  4LF5 Q;  3F2D A;  2BA1 A;  2VQE L;  1TWG H;  4GOP B;  1HNW Q;  3I4N G;  2KHJ A;  1PH6 A;  4RG1 A;  1K9M C;  2IX0 A;  3S2D H;  2JA9 A;  3TS2 A;  2JJQ A;  3KF8 B;  5IY0 A;  2VY3 A;  1GO3 E;  4POF A;  3UDX A;  2E5L L;  3I7F A;  1FJG L;  1EOV A;  1NMF A;  4DV7 Q;  3GD7 A;  1VQG A;  2AHO B;  3KDF A;  3TEH B;  2E8G A;  4JI4 Q;  3M4O H;  2UXC L;  4GNX A;  1PV4 A;  4ALP A;  4JI3 Q;  1JT8 A;  3PO2 G;  2GVA A;  1JJ2 A;  3S15 H;  4R4I A;  1VQF A;  4A3D H;  3OYY A;  1T9H A;  3M4Q A;  5C44 G;  2MO0 A;  1CSQ A;  1UWV A;  2UUA L;  5FJ8 G;  1PH5 A;  3CC4 A;  4QJF A;  3NEN A;  3T1H Q;  1VQB A;  3RN2 A;  3U4V A;  4DNI A;  3M85 A;  1L0W A;  4B3S Q;  4BA2 I;  1GVP A;  4A4I A;  4JCV E;  3H0G G;  3TQY A;  5C44 H;  2VQE Q;  4DR7 L;  1VQH A;  4JI1 L;  2AKW B;  2ZTD A;  2R7Z G;  3D0F A;  1EQR A;  3K80 C;  3PUW A;  5BR8 L;  1V9P A;  1X3F A;  4Y52 H;  2RCN A;  1OXT A;  1HZ9 A;  4B3S L;  2IX1 A;  2QGQ A;  4IPG A;  2HIX A;  4HJ5 A;  3GTM H;  3L2P A;  2ALY B;  2K5V A;  2VNU D;  1M90 C;  4GLV B;  5FLM G;  3F2B A;  1YJW A;  1WOC A;  4DV0 Q;  5GQO A;  3RLF A;  1U0L A;  3GO5 A;  4OO1 I;  2F52 A;  1VQE A;  1XTD A;  2KHI A;  3E9I A;  2N78 A;  3H3V H;  1EIF A;  1E22 A;  3CQZ H;  4YWK A;  4A3I H;  4B3R L;  3DM3 A;  3ER0 A;  3KOJ A;  1IBM Q;  5C4X G;  4A93 G;  1VS0 A;  1PA6 A;  4AIM A;  4JC0 A;  2VUM G;  1CKN B;  4LUO A;  4R1J A;  4BY1 G;  4X65 L;  2EIF A;  2N8N A;  2WFW A;  3ULJ A;  4JI7 Q;  2ATW A;  4LFC Q;  5IT9 c;  1S3O A;  1XMQ Q;  2H5X A;  3UE1 A;  3LGJ A;  1Q8K A;  3PCO B;  5AJ3 L;  3GDE A;  4DR2 Q;  4KHP L;  2HHH Q;  4A3L H;  1TWF H;  5FJ8 H;  1KD1 C;  4YCU A;  5IP7 G;  2LXK A;  1C0A A;  2D62 A;  4WJ4 A;  4A3E H;  1J6Q A;  1YBY A;  4JI3 L;  4A3D G;  1N8R C;  1KRS A;  2D0P A;  1X3G A;  2VUM H;  3OTO Q;  1N36 Q;  1C9O A;  1XMO L;  3GTP H;  4BBS H;  1CKO A;  2BA0 A;  3HOV H;  1EUJ A;  2UXB Q;  4GLA C;  1HR0 W;  3K7A H;  2R93 G;  4A3M G;  1P16 A;  4GN5 A;  4GN3 B;  1B70 B;  2D0O A;  2NN6 I;  3CCR A;  4DR3 L;  1PH3 A;  3GTK H;  2K14 A;  3PGZ A;  3ICE A;  4GOP C;  5GAG C;  1AH9 A;  2DUD A;  2EXD A;  2KCT A;  2A1A A;  4XIG S;  3CPW A;  4DUZ L;  4A3F H;  4LF6 Q;  5M5Y H;  3ERS X;  2GN5 A;  2B29 A;  2VL6 A;  4IPC A;  2QEX A;  4OO1 G;  4UP8 A;  1G6P A;  3F2C A;  1NE3 A;  1K73 C;  1Q1E A;  1KL9 A;  4HJ8 A;  1G29 1;  1P8L A;  1YHB A;  3W5O A;  2NZH A;  5M5X H;  3TS0 A;  1YJN A;  4X66 Q;  4LF5 L;  4R4T A;  4JG2 A;  4LNQ A;  2UXD Q;  3CF5 A;  2JA5 H;  1VQJ A;  1MIU A;  2UXC Q;  1N32 L;  2I5M X;  5C3E G;  5BR8 Q;  3AFP A;  3S1Q H;  4JI0 L;  1VQL A;  1EWI A;  4DV3 L;  2UUB Q;  4OWX B;  5HGQ A;  4GN4 B;  5C0X J;  2AWO A;  2YTY A;  2JA6 H;  4IPD A;  4K0K Q;  1FGU A;  2MFI A;  3K7U C;  4YCV A;  3S16 H;  4DV4 L;  1ASY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...