5LMNW

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
AKEKDTIRTEGVVTEALPNATFRVKLDSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
molecule tags Ribosome
total genus 12
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5lmnW00
3HKZE 3KDFA 2ZJPA 4DV2L 5GAEC 5M3FH 3GTLH 2ATWA 2R6GA 1RIPA 4NPSA 4JBMA 3J81j 1XMOL 2HHHL 1BVSA 1A62A 4QL5A 4H02A 3PCOB 1Q1BA 4OXPA 1D7QA 3CXCA 4JOIA 2OQ0A 4DR2L 3PF5A 1HZCA 3ULJA 1GVPA 1I94L 4LF9Q 3E0EA 1EQRA 1Y1VH 1SLJA 3J81c 1NE3A 4A3BG 4A3JG 2GVBA 1NY4A 2Q2TA 5C4XH 1X54A 3D31A 5C0XG 2F3IA 3ERSX 3MEFA 1PH1A 1JB7A 2HHHQ 4AH6A 4BXXG 3J80i 1YZ6A 5C3EG 3S2HH 2PNHA 2QGQA 2ES2A 4IJLA 2DUDA 1S3OA 2I5MX 5C0XJ 1N32L 3GTGH 2MQHA 4GOPA 2K50A 2UUBQ 3I4MG 1C0AA 1K0RA 3E9IA 1OXXK 3CAMA 4C3JH 1XPRA 2NVTH 1KHIA 3K8AA 3HKZG 2LSSA 5LMNL 2VQFQ 1UE7A 2V1CC 3MXNB 4DR5Q 4B3MQ 1VQAA 1Z9FA 2K75A 3FKIH 3PUVA 4DV5L 4DR4L 3KFUA 1AE3A 4NXNL 4C3HH 4YWKA 1X6OA 2KHIA 4DR1L 1PH9A 2UXDL 4PZ8A 3BZKA 3GO5A 4TQUS 5H1SE 1IBMQ 4BA2I 5FLMG 3RLFA 4R4QA 3STBD 3NELA 4XTCS 3I56A 1YNXA 1E22A 5BR8Q 1K73C 1K9MC 3U58A 4JBKA 4K0KL 1YVCA 1PH8A 4NXNQ 4UPAA 3H0GG 3TEHB 2AWOA 4EX5A 2UXDQ 1PH6A 5AJ3L 4LF6L 2K52A 4B3SQ 3S2DH 3G6EA 3Q8DA 1I3QH 1NMFA 3JAMi 1MKHA 1TWHH 2Z6KC 2I0QA 4JI7L 5K36G 3H3VI 4HIKA 4K0KQ 4AQYL 3TS0A 1VQPA 1KC8C 3KYHC 4DV0L 1X55A 3AYHB 4GKKQ 2AMCB 3RN2A 1Z47A 4J15A 1E1TA 4NB3A 1S72A 4PZ7A 1X56A 2N3SA 1WI5A 3PUWA 3TREA 4POFA 1GD7A 4YY3Q 2VW9A 4DR7L 2ZTCA 1IBLL 4ALPA 2C35B 4R4CA 4KHZA 5IP9H 1N36Q 4JI7Q 2F4VQ 2R92H 1VQ6A 3HOWH 3F8TA 4MNOA 3J81i 3KF8B 4HJ9A 2KHJA 4A76A 4EQ5A 3OW2A 1I6HH 3RLOA 5GAHC 2JA5H 2WB1E 5M5XH 4DV0Q 2E2HH 4Y52H 2CFMA 5IT9c 2UXCL 3KF6B 4A3GG 1VQ7A 1V1QA 1HNXL 1OXVA 4BY7G 2NZOA 2VUMG 4DR7Q 3AFQA 2PQAB 1FGUA 1L1OC 3I4NG 2GN5A 4LF5Q 5J3BA 4AYBE 1TWAH 3CC2A 4LNQA 1XNRL 4OWTB 4APVA 4JBWA 3M4OH 2LXKA 4HIDA 2R7DA 1LTLA 1PYSB 3ULPA 2NVXH 1Q46A 4LF7Q 2ZTEA 5M5YH 1WCMH 3HKSA 3IRBA 5LMUQ 2WAQE 3HOUH 4X65Q 1BBWA 2XGTA 1K8GA 1HNXQ 3KF6A 4GKJL 1N9WA 3WWVA 4OWXB 3HFZB 2JA8H 5IYCG 2Q2HA 1SRUA 1KIXA 3FKIG 3TS2A 4DV7Q 4A3IG 4JI5L 4A3FG 4LF4L 3CCSA 4X64Q 1BKBA 1VQ9A 3S1RH 4FDBA 5ELOA 1NMGA 1IYJB 3TRZA 3HOYH 2JEAI 4GN5A 4GKJQ 3KOJA 1SROA 1M90C 1YJNA 4C2MH 2WB1G 3PIPA 3T1YL 1DGSA 3T1HL 5M5WH 4X66L 4JI3L 2MO0A 1B7YB 1UE5A 3ER0A 2I5HA 2YTXA 4B3RQ 4LF4Q 2ZTDA 1JJGA 4A3CH 2AKWB 4BBRH 1JE5A 2K5HA 1Y14B 1WYDA 2Z0SA 3ZJYC 2KENA 1YHQA 4A93G 5FJ8H 4GNXB 1A0IA 1CKNB 1V9PA 1VQJA 4OO1G 1N33L 4DV1L 1PYBA 1QVFA 3J7ZC 5IYBH 3D0FA 1Q7YC 4IOAA 1OXTA 1UE6A 3UDGA 4DKAC 2JA6H 2IX0A 4JI3Q 4JV5Q 4Y7NH 2N78A 3RZOH 4GS3A 1XNQQ 5C0XI 1Q81C 3CCLA 4GLVB 1PH3A 1IBKQ 1HNWQ 3BU2A 1S40A 1J6QA 5JEAG 4IPDA 1VQOA 4JOIC 4YCUA 4A3DH 2DGYA 1EIYB 3PO2G 4DV1Q 1HR0L 1CKNA 4RMFA 1OXUA 4DR3Q 1D8LA 3A74A 3CCJA 4DV2Q 4JI0L 3GTPH 1MJCA 5JEAJ 5E7NA 4A3MG 2CWAA 3PGZA 4L5TA 3RN5A 1XMOQ 2K5NA 3GTQH 1J5EL 1X3FA 3CCUA 4YHHL 3B6YA 3OYYA 3U4ZA 3GTJH 4DR2Q 1HR0Q 1N8RC 1I94Q 2R93H 4GOPC 2FXQA 4BBSG 3GTKH 5ELNA 3H15A 4A3EG 1NTGA 3JC66 4DV4L 3M85A 1UE1A 3HOVG 1E24A 1VQIA 2MFIA 2XTIA 2JEBI 2YTYA 1Q1EA 4JBJA 1VQBA 1FVIA 3FHWA 1T9HA 1CKOA 4XIGS 5IYDG 3HOXH 1XPOA 2UUAL 2KCTA 3UE0A 4KHPL 4JI6L 3PUYA 4LF8L 2B3GA 5DLQE 2IX1A 1MIUA 1QVGA 1N32Q 4IPHA 1ASZA 4DNIA 3PF4A 1KRTA 4DK3C 2R7FA 3GTMH 3UDIA 3F2CA 1VQ8A 3BJUA 1Q8KA 4DR6L 4LFBL 5C4JH 5LMNQ 4X6AH 1LM0A 2VL6A 3M9BA 4BY1H 4LUOA 3CPFA 4IO9A 3DM3A 1TWCH 1G51A 5M3MH 5C44G 4DV5Q 4L5SA 4DR4Q 2E2JH 1Q12A 1KD1C 1PVOA 1I5FA 3CF5A 3NBHB 2D62A 1VQEA 4JI2L 4DR1Q 3H3VH 2NN6I 2R7ZH 4BBRG 3NENA 2RHSB 3M4PA 2RHQB 4YWLA 2IHEA 4O2DA 3PSIA 1SE8A 3RLNA 1YHBA 5IP7H 2IY5B 2E2IH 3HOZH 2B63G 1HZ9A 1VCIA 4IFDG 1QUQB 5M3FG 1OTCA 3STBC 3PO3H 1UEBA 2K14A 4JI2Q 4AIMA 2JJQA 2RF4A 3PUZA 3I55A 2NN6G 5GAGC 5AJ3Q 4A3KH 4LF6Q 2YYZA 5IE8A 1W3SA 4DAYB 1LYLA 3PIOA 4JI4L 4UP9A 4DK6C 4A75A 4R4IA 4IPCA 4LFCL 2ZJRA 1XJVA 1EQQA 1B8AA 4AQYQ 1Y1WH 1HR0W 1EFWA 1VQLA 1VQKA 1VQNA 3S15H 4A3LH 1Y1VG 1JT8A 1PFSA 4GLAC 4WJ3M 4YCWA 5IWAL 1TXYA 2JK8A 2A19A 2GVAA 4HJ5A 1QZHA 4JG2A 4QQBX 5C4XG 2N49A 3CCRA 2KBNA 1RL2A 2RCNA 1PH7A 4A3BH 4HJ8A 4R4OA 4LFAL 1KXLA 4JI4Q 2YTVA 1YJ9A 4X62L 1IBLQ 4JI8L 2CKZB 2JA9A 4LFCQ 3CCQA 3CMEA 1HNZL 4O0AA 1W2BA 5EAYA 3S1MH 1KRSA 1V43A 1PA6A 1YEZA 1Q86C 4JC0A 5IWAQ 3NEMA 2UXCQ 1XTDA 4TVAB 1GKHA 3K0XA 4A3JH 4LWCA 2JA7H 4LFAQ 5LMNW 1I50H 4P72A 3G71A 2EXDA 2F52A 2E8GA 4KLKA 1EOVA 2PQAA 2D0PA 4JI8Q 4BXXH 3CCVA 3RZDH 4DAMA 2E5LL 3SGIA 1XNRQ 5C3EH 3S14H 4KI0A 1YITA 1YBYA 5GROA 4OO1I 3PUXA 3F2DA 4JYAL 4DUZL 1SN8A 4OX9L 2BH2A 1JJ2A 3K81C 4L5RC 4HIOA 2ASBA 4YWMA 3GD7A 1Q82C 4JI5Q 3K7UC 2UUCL 1U0LA 2QA4A 3OTOL 2H5XA 4PMWA 2Y0SE 1A8VA 4IJHA 4JCVE 3PV0A 4DUYL 4AYBG 3CPWA 1HJPA 1KAWA 2AHOB 1XMQL 1P16A 3AFPA 5IY0A 3T1YQ 1GM5A 1E3PA 3T1HQ 4X66Q 1IZ6A 4B3TL 2WAQG 5FLMH 1O7IA 4P73A 2UUCQ 2PI2A 1C7YA 3U4VA 3OTOQ 5JJKA 3KDFB 3M3YH 1AH9A 2YV5A 3L0OA 3UE1A 1YHAA 4IPGA 4GNXC 4BA1I 1P8LA 5HY6A 3H0GH 1N33Q 4GNXA 1VQ5A 2ALYB 1M1KC 1TWFH 1SFOH 1K83H 5IP9G 2YU9H 5JJIA 2R92G 2L15A 1L2FA 4B3TQ 3HOWG 1IL2A 4PG3A 3KLWA 4QGUA 2B29A 3I7FA 3CC4A 2JA5G 3CC7A 1AE2A 4LF9L 3I4OA 3LGJA 3CP0A 3S17H 1TWGH 1VQHA 2A8VA 3RNUA 1X3EA 2Y0SG 4HIMA 2Q2IA 3I4MH 3GDEA 4JI0Q 2D0OA 4UP8A 1G6PA 1B70B 4GLXA 2N8NA 3EIVA 2VY3A 3U50C 3CMAA 1J5EQ 1WCMG 3W5OA 4GOPB 2UXBL 5JJLA 3HOUG 1VQCA 2EQSA 4QJFA 1E7ZA 4YHHQ 1PH4A 2UUBL 2JA7G 2A1AA 4A3GH 2JA8G 1IXRA 4BY7H 2VUMH 3EN2A 2VQFL 1JMCA 4DR5L 1EIFA 4DV4Q 1PV4A 4B3ML 3I4NH 1HH2P 4R1JA 4MTNA 1BBUA 3HOYG 4WJ4A 1G291 2ZJQA 1FL0A 2UXBQ 4QY7A 4POGA 2UUAQ 1EYGA 4KHPQ 2UU9L 2PI2E 4JI6Q 4IFDI 1PH5A 4LF8Q 1SMXA 2VS1A 3FP9A 3A5UA 1IBML 3M4QA 3M7NA 1L0WA 1UWVA 1VS0A 1VQMA 2OTLA 2MNAA 4A3CG 1H95A 5IYCH 1QVCA 5BR8L 3AQQA 4A3IH 2WP8J 4A3FH 1PH2A 1R9TH 4HJAA 4LFBQ 5FJ8G 4DR6Q 4LUZA 3RR5A 3A5ZB 3AEVA 1CKMA 5IYBG 2UU9Q 2AWNA 3EBEA 1N34L 1ASYA 2JA6G 3F2BA 3CCMA 4C3IH 4B3SL 2NVYH 4DV3L 2ZM6L 3S16H 4GN4B 2OCEA 3TQYA 3KJOA 3UDFA 1QZGA 2HT1A 4A3DG 4IFDJ 3K7AH 1EWIA 4UP7A 1YI2A 2JE6I 5FLXc 1XPUA 1N34Q 4A93H 4GKKL 2IHFA 4P75A 1HZBA 1U5KA 2Q2UA 2HIVA 1E1OA 3CQZH 5GADC 1SR3A 4GN3B 4YY3L 1QUQA 1WFQA 4DV3Q 2F4VL 2ZM6Q 2IT1A 1N36L 2I5LX 2Z6KA 3UDXA 1PHJA 1X3GA 2CCZA 4P74A 4R4TA 3K80C 1EUJA 1X9NA 2R93G 4JI1L 4DPGA 3ICEA 3PO2H 2MO1A 2KCMA 1L1OB 1GO3E 1VQGA 3I2ZA 2K4KA 4LF5L 1X65A 3HOXG 4A3MH 3G4SA 4LUVA 1JJCB 2JQOA 1A63A 4X62Q 4A4IA 3E9HA 3G48A 4LF7L 1K8AC 1KQSA 5LMUL 1HNZQ 2OWOA 2OTJA 4X65L 3J80c 1YIJA 1NBWA 4JI1Q 2VNUD 1LUZA 2LXJA 2HQLA 1NJIC 4MZ9A 4UY8C 4DV7L 4BBSH 3GTOH 1L1OA 4RG1A 1CSPA 4X64L 4A3EH 4IOCA 3S1QH 4OONA 4BY1G 2VQEL 4QIWE 3HOVH 2EIFA 3BZCA 4LW1A 3KJPA 3W1BA 2QEXA 1MJEA 2CQOA 4OWWB 2NVQH 5M3MG 2PMZE 3J7A5 5IYDH 2E5LQ 4ME3A 3CD6A 1FJGL 1VQDA 2BA1A 3DLLA 4DV6L 1OXSC 2BA0A 3CW2C 2R7ZG 3ULLA 4L5QA 4B3RL 4PZ6A 4JYAQ 4DUZQ 4NXML 1CUKA 5IP7G 4OX9Q 1HZAA 2VQEQ 3L2PA 3HOZG 2HIXA 3CCEA 2WFWA 3F1ZA 2K5VA 1FJGQ 1K3RA 3PO3G 1VQ4A 4HJ7A 2VZAA 4DV6Q 5C44H 1C9OA 1WJJA 5HGQA 4DUYQ 4JV5L 3S24A 4A3KG 3L7ZC 1XMQQ 2ID0A 4YCVA 1XNQL 3S1NH 1HNWL 5GQOA 1IBKL 4NXMQ 1CSQA 3W1GA 2NZHA 1Y1WG 1VQFA 1YJWA 1KL9A 2OQKA 4A3LG 2CWPA 3VDYA 3JAMc 2BH8A 4P71A 1WOCA 2B63H 4DR3L 3A0JA
chains in the Genus database with same CATH superfamily
1LACA 2Q8TA 4DV2L 5M3FH 3GTLH 2DNCA 2R6GA 4KJNA 1F9SA 4NPSA 2E2JB 1U4PA 3J81j 1WVLA 1XMOL 2HHHL 2F3VA 4UDUC 1A62A 3ND8A 5JOBA 4OEMB 4A3IB 4OXPA 4A3FB 1R9TB 4JOIA 2F0WA 1GVPA 3QOLA 4L8JA 3E0EA 1Y1VH 4HEDA 3MFGA 1JOKA 1U4RA 2EPBA 2GVBA 1NY4A 2Q2TA 4RWSC 1X54A 2HHHQ 1U4LA 4BXXG 2KVMA 4NW2A 3DEPA 3VR3A 3K7AB 2J4XA 1PRTF 3FMCA 2DUDA 3HZXA 1PTOD 5C6AA 2MQHA 2K50A 3CQZB 1K0RA 2VB3X 4MHEA 2PZTA 3NE5B 4OIJA 1ZEQX 2V1CC 4DR5Q 4NDXA 3OWEB 4L63B 5TSSA 5CBEE 3KFUA 1AE3A 1X6OA 2K04A 2KHIA 3PO2B 1QJOA 2HUGA 3RLFA 1S5ED 1HA5A 1YNXA 2PW7A 5BR8Q 1Z7TA 1K73C 1YVCA 2L0CA 1AW7A 3TEHB 4CDCC 1B3QA 5KGUA 1PZID 2K52A 2PZUA 1EY7A 2Z4HA 3A56A 3Q8DA 5J1ZA 1NMFA 2F4IA 1TWHH 2N55A 4JI7L 3H3VI 4AQYL 1VF5C 1VQPA 3DHQA 5A35A 4DV0L 4ZUIA 4ZCKA 1KDCA 4J15A 4X3KA 1S72A 1XYIA 4POFA 4DNTB 1WI5A 2VW9A 3TREA 4DR7L 3MAQA 2JP1A 3I72A 1IBLL 4ZKBB 2C35B 4JI7Q 4KHZA 5IP9H 1VQ6A 5CV4A 1O7LA 3J81i 3SXHA 2K5DA 4F8MA 4HMJA 1DOLA 4DV0Q 4Y52H 4N8FA 2CFMA 3KF6B 4BS9A 1OXVA 4EQPA 4DR7Q 3AFQA 2PPBC 3I4NG 3NTIA 2GN5A 4LF5Q 4AYBE 1SFOB 1TWAH 3CC2A 3M4OH 4HIDA 2R7DA 3WDNA 2NVXH 4LF7Q 2WAQE 3GV6A 4X65Q 1BBWA 2XGTA 3KF6A 2QEJC 3WWVA 3T51B 3LWEA 5EBDA 3TS2A 4LF4L 4U673 5K5PA 3CCSA 2F0IA 4FDBA 5ELOA 1NMGA 3NP8A 3TRZA 3HOYH 3G7LA 1E0BA 3KOJA 1JR0D 3NXWA 1M90C 4CGYB 1OO9B 3PIPA 3T1HL 5M5WH 4PNYA 2YTXA 4LF4Q 3SEBA 4A3CH 2AKWB 4BBRH 3ZJYC 3NK9A 4GNXB 2MP1A 1VQJA 1QVFA 5IOCA 1OXTA 1UE6A 3UDGA 2IX0A 2HDMA 4G7ZC 2DN8A 2NVTB 2F0PA 1XNQQ 3CCLA 1HNWQ 1PH3A 1AZPA 1J6QA 1VQOA 2H1EA 1HQMC 2DGYA 4N9PA 1IYUA 1OXUA 4C3HB 4JI0L 2WACA 5JEAJ 3I8ZA 5EKIA 3RN5A 3VR2A 2QCPX 5IIFA 1X3FA 3MWYW 2LMCB 2FJ2A 4DR2Q 1I94Q 4GOPC 4BBSG 4NMZA 2KEEA 3TZUA 4AYBB 2FHTA 4A3EG 1NTGA 4DV4L 5BN3A 3HOVG 1VQIA 4GZYC 2MFIA 2JEBI 2IW3A 1ML0D 2KCTA 2WAQB 1A3TA 1GHKA 5DLQE 4FVMA 5IGCA 5DNFA 1MIUA 4CDEC 3FPUB 1BF4A 2D5DA 1SYEA 3D4DA 3GTMH 4KKTA 1VQ8A 4LFBL 4DR6L 1EY6A 2DY8A 2R92B 1WTXA 3HOWB 1K3BC 3CPFA 1S5CD 3DM3A 4IO9A 4CJ1B 4DV5Q 2E2JH 3OIPA 1I5FA 4DR1Q 1X3QA 1W6KA 4BBRG 4BWGB 1CQFA 3M4PA 5FOBB 4YWLA 3PSIA 3RLNA 4IN3A 1YHBA 5IP7H 3V05A 1OTCA 1WCMB 4AIMA 3HOUB 1F2ZA 1RDPD 2JJQA 3PUZA 3HG9A 2NN6G 1LYLA 2KECA 2Z1CA 3D6CA 2EYMA 4UP9A 4DK6C 2ZJRA 1XJVA 4PMCA 5C4HA 5I9PA 3NTHA 5BN5A 1NR4A 2Z8LA 3D6WA 2KBNA 2YTVA 4FF2A 4JI8L 1JWMD 2CKZB 5CMDA 5A2QE 1YEZA 1Q86C 4C3JG 1SNMA 2A6HD 2JYOA 4DAVA 2F0GA 2JA7H 3M7GA 2F52A 1ENCA 4KLKA 4JI8Q 3K5NA 4DAMA 1XNRQ 5C3EH 1UNSA 1ZYRD 5I4DA 1YBYA 4JYAL 3K57A 4XQJA 3WOEA 4OX9L 3K81C 4ZK9B 4HIOA 4JPBW 4L5RC 4YWMA 1Q82C 3OSOA 4JI5Q 3K7UC 3GTQB 3OTOL 3SR1A 1ICWA 1A2TA 3QG1A 4JCVE 4DUYL 2L4NA 3GTJB 1KAWA 1YNJC 1XMQL 3AFPA 5IY0A 1F9PA 3DEOA 3T1YQ 4X66Q 3BVZA 4HMIA 4HSVA 4P73A 3EJIA 4DK0A 3OTOQ 5JJKA 3M3YH 5D3DA 3TP8A 3I91A 2NYZD 1YHAA 2KHSA 4IPGA 5HY6A 3H0GH 1N33Q 3J7YW 1A15A 3A54A 1SFOH 1K83H 2YU9H 4XXEA 3I7FA 3SVMA 2JA5G 3I90A 3QR8A 1AE2A 3CC7A 1JB3A 1EQTA 1TWGH 5DAUA 1X3EA 3QO2A 1QG7A 1B2TA 2Q2IA 3I4MH 4UP8A 3M4YA 1HTPA 1J5EQ 4GOPB 2F0NA 1B3AA 4HTHA 4YHHQ 1PH4A 2JA7G 1IXRA 1ILPA 2WV6D 5CORA 4B3ML 1HH2P 2EY1A 5E3FA 1Y1WB 3S15B 4KHPQ 2PI2E 4IFDI 3J80E 5IT9L 4LF8Q 5D65A 3FP9A 2LY7A 2XWJB 3MEHA 5IYCH 2J7ZA 2K33A 4OELB 4G57A 3TSSA 3A5ZB 1CKMA 1B44D 2AWNA 3EBEA 2JA6G 2NVYH 2FMMA 5J39A 4DV3L 3C46A 1LTID 1Y8OB 1CFMA 1QZGA 2AUKA 4IFDJ 2KEDA 1T5EA 2SEBD 1HZBA 1U5KA 4QMGA 5ELFA 2Q2UA 4OO1H 4QCLA 2QDBA 4GN3B 4DV3Q 1ICFB 2EDGA 1WTPA 1PFMA 2Z6KA 3FRPB 4L6TB 1HRJA 2CCZA 3K80C 5JEAH 3JAME 1EUJA 4JI1L 1KABA 3I2ZA 2CW0D 4FXGC 1X65A 3HOXG 4A3MH 3C3LA 4Y7NB 4X62Q 4A4IA 3G48A 1HNZQ 1A3UA 1XX8A 4RCNA 3SK4A 2CHBD 3J80c 4JI1Q 1LUZA 2MGSA 3SHLA 2WKDA 1EIHA 3KLSX 3OPOA 2NZ1D 4RG1A 4K5XA 4IOCA 4DNRB 1BOSA 3S1QH 4OONA 4BY1G 2VQEL 3BZCA 1JWUD 3KJPA 2QEXA 4GKJL 5IYDH 2A6HC 2E5LQ 2B2WC 1VQDA 3PMFA 4Z9CB 1SXTA 2BA1A 4RHSA 3S17B 2B2TC 4PZ6A 5JVG3 2R93B 4RGOS 5KYIA 1PZJD 2VQEQ 3HOZG 2HIXA 4CDFC 2K01A 3F1ZA 1R4QB 1DD2A 2C9OA 3PO3G 1FR3A 2RVLA 2VZAA 5L37A 5LHY1 2B2UC 2B2VC 2K1BA 4JK1C 1HFGA 2G9DA 4A3KG 1CHQD 4YCVA 1B50A 4V190 5E4WC 3QOJA 3S1NH 2TMPA 3A7LA 3W1GA 4YIJA 1VQFA 1PFNA 3A7AB 1YJWA 1KL9A 3I4NB 4KMUC 2JXMB 2VXWA 3JAMc 2B63H 1HA6A 2EJGC 3A0JA 1XPOA 3HKZE 4A3BG 5GAEC 1JQYD 4IUVA 2ATWA 1BCPD 5IGFA 3TN2A 1MGSA 2EVBA 5KIXA 3TDQA 4H02A 3PCOB 4RHRA 3CXCA 2OQ0A 1HZCA 5HURA 4P2CB 1EQRA 1SLJA 4A3JG 5C4XH 2PNRC 4PMBA 3D31A 1PH1A 1F9QA 1NCVA 2F3IA 3MEFA 1JB7A 4AH6A 2OF1A 1KNEA 4E6IA 1H9SB 4RKLA 3S2HH 3Q23A 4XQQA 2EY2A 4F88A 2PW5A 5C0XJ 1S3OA 3A8JE 1N32L 3T13A 1Y8NB 2IPKD 3OW7A 2XN9C 1LTGD 2UUBQ 1XPRA 3E9IA 1D2BA 3K8AA 1F2LA 5C5MA 5LMNL 2MJ8A 2VQFQ 1UE7A 4HCSA 2K75A 3FKIH 3PUVA 2E2DC 3IFTA 1IKLA 4DR4L 4YWKA 2PQEA 2UXDL 3MTSA 5G3LF 3BZKA 3GO5A 4TQUS 5H1SE 5FLMG 3OOCA 1KLGD 4DXGA 3U9OA 1D1KA 2XVSA 4JBKA 1TR5A 4MTKA 4DU9A 1AEXA 4UPAA 4DK1A 2A68D 1GUNA 3BVMA 2UXDQ 4KK7A 4QUCA 4DA2A 1PH6A 4B3SQ 3S2DH 5LL6S 5K36G 1U9RA 4HIKA 4A3EB 2K7VA 5J22A 1WTRA 3R93A 2NVQB 1X55A 4GKKQ 3RN2A 4NB3A 4K5WA 1X56A 2N3SA 2I07B 3PUWA 3NPPA 1GD7A 1I6HH 2ZXRA 3NUCA 4ALPA 4R4CA 1N36Q 4FYDA 4ZAIA 3KF8B 4A76A 2KQ3A 2E2HH 2EYOA 2BDNA 4A3GG 1HNXL 1F9RA 4BY7G 2NZOA 2V4DA 3I70A 3PQIA 5I6YA 2XNAC 4OWTB 4JBWA 2LXKA 1PYSB 3KF8A 5FO7B 1SMYD 4ZKCB 3ULPA 1D1IA 2ZTEA 2CW0C 1PYWD 1HNXQ 3OHXC 1ILQA 2JA8H 2IJ0A 3K58A 3FKIG 4DV7Q 1G8ZD 3K5LA 5ELDA 4X64Q 2RCFA 1BKBA 1VQ9A 3S1RH 3C1EA 1IYJB 4GN5A 4C3IG 2RKSA 2X6GA 3N6RA 2WB1G 1SYCA 1HHVA 1B7YB 3ER0A 1JJGA 2NTTA 4IUUA 4RKBA 2VUMB 1JE5A 2K5HA 3SK5A 2KENA 1YHQA 4A93G 5FJ8H 1V9PA 3DXJC 3EQLC 3H3VC 3A55A 3J7ZC 5IYBH 3GTGB 1C8CA 4JV5Q 4Y7NH 4C3JB 3C2PA 1CHPD 3RZOH 4N8X1 1IBKQ 1ET6A 4XDXA 2XSCA 1YNND 1S40A 1DOKA 4IPDA 2O4XA 4YCUA 1K28A 1HR0L 3DWPA 5C5LA 4DR3Q 4DV2Q 3V96A 5I9OA 3GTPH 3TZDA 3PGZA 1C4QA 2AQ1B 1XMOQ 1RTNA 2EYFA 2IWHA 3CCUA 3CRKC 1BCPC 1XXGA 3OYYA 5E1FA 3U4ZA 1HR0Q 1MSGA 2HDLA 2R93H 2EJMA 1TT2A 4DFAA 3H15A 2XWBB 1GUSA 5ISRA 2R3ZA 1I3QB 1E24A 2OWOA 3PIO3 1Q1EA 3FHWA 1FVIA 1CKOA 5I6WA 2UUAL 4F87A 2A5HA 5JVH3 4JI6L 2XIWA 2BDOA 4G4KA 1M4VA 4U68A 4DK3C 2R7FA 3F2CA 3BJUA 3Q0AA 4X6AH 4IUNA 5C4JH 1BDOA 1KAAA 1LM0A 3BS1A 1TWCH 2MHVA 5CBAE 5IGDA 2JA5B 5M3MH 1STEA 4ILWA 1PVOA 3CF5A 3NBHB 1FNVA 1VQEA 3DM1A 2M00A 2R7ZH 1V1PB 1DYQA 2RHSB 2L11A 1LTSD 3BVGA 1SE8A 4X3SA 3BG3A 1L0YB 1EYDA 1HZ9A 4LMQD 4IFDG 1QUQB 5M3FG 4UHVA 2EY5A 3GV3A 3NBHA 5IODA 5IE8A 1EEFD 1PRTD 4DAYB 1V1PA 3OMCA 2A68C 1AN8A 4R4IA 4RGNA 4AQYQ 3Q6SA 1VQNA 5KNCA 1Y1VG 1JT8A 3A8KE 3LX0A 4YCWA 5IWAL 2OXPA 1QZHA 2F0DA 4HJ5A 2KCNA 4QQBX 3CU7A 1FYCA 3NSWA 4C2MB 2N49A 3GQBA 1ENFA 2RCNA 5C44B 1EU3A 4LFAL 1IBLQ 2A74C 4MIUA 3CMEA 2GA4B 4JC0A 5IWAQ 3BDOA 3NEMA 3URYA 1G91A 1LTRD 4TVAB 3K0XA 2EXZA 2JA6B 4LWCA 2RSOA 4LFAQ 4P72A 3G71A 3IAYA 5C0XH 1EOVA 4PQXA 3RZDH 3SGIA 1SDFA 3VYRA 3X3NA 4KJOA 4OO1I 1LV9A 5F2DA 4DUZL 1SMYC 1Q90A 3GD7A 1SNOA 1U0LA 2QA4A 1EL0A 1E2ZA 1MI2A 1A8VA 4I7AA 2K28A 1LT3D 2AHOB 1AFPA 1EY9A 1E3PA 3T1HQ 4NKLA 5T1IA 1VDZA 1GUWA 4RA8A 4OGQC 5EBCA 3U4VA 1TU2B 3KDFB 1I4RA 1AH9A 5FKAC 2YV5A 3UE1A 1P8LA 3BDLA 1L0XB 4GNXA 2F0EA 1TS2A 5E4XA 3BYYB 5IP9G 4K14A 1IL2A 4PG3A 1STAA 4K6DA 1IYVA 4LF9L 4BY1B 2QKIC 2A8VA 2Y0SG 1B1ZA 1I6VC 3GDEA 3CKIB 4V0BA 4JI0Q 2D0OA 1G6PA 1EYAA 2VY3A 2FMCA 5FO8B 3W5OA 3HOZB 1VQCA 1CZWA 3ND9A 3KUPA 4ZRZA 2FINB 1I4HA 3PO3B 2EJFC 2VUMH 1II3A 1R4PB 4A3KB 2KOLA 2EYHA 2PCFB 4DV4Q 3KBXA 2IL8A 4R1JA 1B4OA 1BBUA 3HOYG 1WTWA 2ZJQA 1EOTA 1PTOC 3MHBA 1EYGA 1KLUD 3HEJA 4ZQ3A 3A5UA 4QIWB 3M4QA 1IBML 1L0WA 2F0QA 1VQMA 2I46A 2PMZB 4A3BB 1LT6D 4A3CG 1H95A 1HUNA 3AQQA 4A3IH 2H4OA 4A3FH 1PH2A 1LLRD 5EPLA 1R9TH 4DR6Q 2DNEA 4LFBQ 3RR5A 3AEVA 3R2IA 1GHJA 4B9XA 1I4GA 5M5YB 3H91A 2ZM6L 2Z4IA 4A3JB 1TS4A 1I50B 2RBMA 3K7AH 3OMGA 4UP7A 2JE6I 1MHWC 1XPUA 2WKCA 4P75A 2FFKB 4I65A 1S5BD 3CQZH 4YY3L 2F4VL 2ZM6Q 2IT1A 2I5LX 2Z6BA 5CC4A 2K05A 1V8QA 3QB3A 3SK8A 3T4AC 1PRTC 3PO2H 3QWNA 3NWTA 3GP7A 2KCMA 3FPPA 2K4KA 5EPKA 3G4SA 4LUVA 3E6ZX 1B9MA 5EKKA 5I2XA 1EQVA 2D9UA 5LMUL 1YIJA 1B53A 4A3DB 3J81E 1E2VA 1NJIC 3IFDA 3LNNA 1JC7A 4LAAA 4UY8C 5KNDA 1TWFB 4CJ2C 1X32A 4FXKC 2EIFA 4LW1A 1D6EC 3J7A5 5EPJA 3K5MA 3CD6A 1FJGL 4ID6A 4B3RL 4JYAQ 5JAVA 3GTKB 1FD7D 4NXML 1J8IA 5IP7G 4OX9Q 5D3IB 3L2PA 2ICIA 2L12A 3CHBD 2K5VA 2VB2X 1FJGQ 1K3RA 1VQ4A 4HJ7A 5C44H 1C9OA 4DUYQ 1RJTA 4A3GB 3L7ZC 1XMQQ 2QW7A 2G9HD 1GUGA 4NXMQ 1MSHA 2OQKA 1SNDA 2CWPA 2F0KA 2PO4A 3R3OA 4P71A 4XT3B 3H94A 1QE6A 3UI2A 1W6JA 1JWSD 1HXYD 2ZJPA 1DZ1A 3VYSA 1CK1A 1DJRD 1RIPA 4JBMA 2MPMA 3MXPA 5BN4A 3RUZA 1XWEA 2M9VA 1Q1BA 1D7QA 1B9NA 3PF5A 3ULJA 3D4WA 2EOTA 4IALA 3EA6A 2E2IB 3J81c 1I4PA 4C3IB 2WB1B 3ERSX 1SYGA 4WRDA 3S16B 3FEWX 1YZ6A 5C3EG 2D2CC 2PNHA 4IJLA 3S9WA 1RHPA 4A93B 4GOPA 3ZYYX 1OXXK 3CAMA 2NVTH 1SE2A 2B39A 1PTOB 1RCVD 3MXNB 4B3MQ 1Z9FA 1D5ZC 4OL7A 1MBYA 1JICA 4NXNL 4C3HH 5EKLA 4TKOB 3TP6A 4PZ8A 1SYDA 1EY0A 1HUMA 4R4QA 3STBD 3NBIA 3NELA 3I56A 1K9MC 1E22A 3U58A 1HPCA 1PH8A 3MXNA 2RSNA 1RF2D 4NXNQ 3BDCA 3H0GG 1WTHA 4KN4C 3S14B 5AJ3L 4LF6L 1O80A 3VR5A 2Q8IB 1PFBA 1MKHA 3GTOB 2I0QA 1LABA 2B2YC 1KC8C 4K2LA 3KYHC 3RD4A 3AYHB 3AMUA 1Z47A 4FF1A 1E1TA 3I4MG 5T1GA 3Q24A 2R92H 3HOWH 3F8TA 4F7XA 4EQ5A 3OW2A 1U4MA 2UXCL 3J7AF 1V1QA 4X3UA 1DXMA 1QNUA 1IHZA 2PQAB 4WJWA 1L1OC 4JW0A 1HFNA 3IL8A 1FNUA 4APVA 1LTLA 2F0OA 4FF4A 5A2QL 3F2UA 1Q46A 5M5YH 1WCMH 3HKSA 4FP5D 3HOUH 1K8GA 1TKWB 4CKBA 1N9WA 5M3FB 3HFZB 3GTLB 5IYCG 1SRUA 1UAPA 2Q2HA 1QNKA 1BCPF 1ZYRC 4FNFA 1QCBD 2L5TA 1SAPA 4GKJQ 4RCOA 1YJNA 1AP0A 1DGSA 1UEAB 1BNZA 4KD4A 1STYA 1UE5A 5EGTA 4O1NA 1HQRD 2ZTDA 1Y14B 1WYDA 1EWHA 1GJXA 5IGGA 4OO1G 4DV1L 2NBFA 4QF4A 3T53B 1Q7YC 3K6OA 4DKAC 4H7BA 1EFID 3I73A 1SNQA 3T56B 1TY2A 4G7HC 1ENAA 5C0XI 4GLVB 3BU2A 5JEAG 4A3DH 4JOIC 4DV1Q 4RMFA 3K59A 2KJXA 1D8LA 3A74A 1I4QA 5E7NA 4A3MG 4L5TA 5KNBA 2DY7A 3GTQH 1PZKD 3GTJH 2G5DA 3NQIA 3OWFA 3TP5A 1LTTD 3NTKA 2K5WA 1F2MA 1Q3LA 1UUPA 1KDBA 3GTKH 5ELNA 1K0SA 1UE1A 1BR9A 2XTIA 4JBJA 2YTYA 1CA6A 5IYDG 1T9HA 4XIGS 1H9SA 3PUYA 4KD3A 2DJGC 2IX1A 1N32Q 1QVGA 4IPHA 1ASZA 1JORA 3PF4A 2ENBA 3UDIA 4ZYSA 5LMNQ 1T5XD 3M9BA 4LUOA 2LKVA 4L5SA 5I2YA 4DR4Q 1Q12A 3J80L 3IKJA 2D62A 3D8GA 3MXUA 4HN7A 1CTMA 2NN6I 2ZXOA 1MD2D 2Y0SB 4CJ0B 2RHQB 2A6ED 2IHEA 1CQVA 4BBSB 1G2TA 4WORA 1TWAB 2E2IH 3M4OB 2B63G 3HOVB 2NVXB 1LTBD 5M9OA 3KBGA 3STBC 5KEEA 4XYOA 1SSOA 3I55A 1W3SA 3PIOA 1WTVA 4LK1C 5KYLA 3OIQA 4IPCA 1EQQA 1HR0W 1EFWA 1B8AA 2RDHA 3NQTA 1Y1WH 1VQKA 3S15H 4A3LH 4GLAC 1JCKB 4WJ3M 1TXYA 2A19A 2GVAA 4XYQA 5C4XG 5COYA 3CCRA 1RL2A 5M5WB 2NUCA 3H09A 5G3LD 4BBRB 5EAYA 3AU7A 5D14A 3JAML 1AZQA 1EY5A 1GKHA 2EE1A 4ABNA 3FDTA 2EYPA 2A73B 2E8GA 4BXXH 3CCVA 3S14H 4KI0A 1YITA 1GXDC 3F2DA 1SNCA 4R8IA 1SN8A 1STHA 1RODA 2UUCL 1O7YA 2H5XA 4PMWA 3K5OA 4EQNA 2AQ3B 1PMRA 1K8MA 2CQAA 3ONAB 2B2TA 1HCZA 1GM5A 1C48A 2E75C 1CI3M 2F0VA 1PTOF 2UUCQ 5IGEA 2DJFC 4GNXC 1STNA 2B2UA 3R2TA 2ALYB 4J6HA 2R61A 1FGBD 5JJIA 1L2FA 2B29A 3GTMB 4XT1B 1VF7A 3LGJA 5FLXE 3S17H 1VQHA 5CV7A 1PDQA 2SOBA 4GLXA 2N8NA 3U50C 2K5QA 5JJLA 3HRZC 1IKMA 2EY6A 2BCOA 2A1AA 2JA8G 4DN4M 2Q8RE 4H44C 4I7ZC 2L1BA 4DR5L 1PV4A 3I4NH 2F0FA 4WJ4A 1FL0A 4POGA 4R8NA 2UUAQ 1SEBD 3T16A 4JI6Q 1ESFA 1TS3A 4R9WA 1EY4A 1PH5A 1SMXA 4CKEA 5M5XB 2O5JC 3HGBA 3P7JA 2KUMA 3TMEA 3DWAA 4KKUA 5BR8L 1VMCA 2O2LD 2X6LA 4HJAA 5FJ8G 1Q8IA 4LUZA 3ERQA 5IYBG 1N34L 1ASYA 4S3SA 2L55A 3QJYA 1EWCA 2LFNA 3DMUA 1JE4A 2P5ZX 1SYBA 1BQQT 2JA7B 3TQYA 3KJOA 1GUTA 3UDFA 2Z9HA 5FLXc 5C3EB 1N34Q 2IHFA 1E1OA 1F77A 2A6EC 5GADC 1SR3A 4HAEA 1QUQA 2B8FA 3EROA 1PHJA 1X3GA 4DAYA 4P74A 1CZGA 4CHTB 2R93G 1J9OA 1A3VA 5CYUA 1H9RA 2MO1A 1VMPA 2L9HA 1VQGA 4LF5L 4HSPA 2F0HA 1EIGA 4DGZA 3P1HA 1A63A 4LF7L 1K8AC 1KQSA 5EJWA 2JN4A 4KY7A 4X65L 3M3YB 2LXJA 4WFN3 2HQLA 3H0GB 1QB5D 4MZ9A 2E74C 4BBSH 1STBA 4J1MA 1K83B 4A3EH 2YU9B 2QDLA 3A8IE 4QIWE 3HOVH 1MJEA 2NVQH 2CQOA 1TIID 4H0LC 5M3MG 2PMZE 4QUFA 4OWWB 1TQOA 4C1NI 3DLLA 4DV6L 1OXSC 1TWGB 2BA0A 2R7ZG 3VR4A 1IW7D 1SE4A 1YNJD 2A69D 4DUZQ 3I4MB 1CUKA 2CVRA 2K03A 3MXGA 4K8IA 4NP5A 3W2DA 3KLSA 1XTCD 3HOXB 4DV6Q 5HGQA 1SBBB 2SDFA 1ZXTA 1XNQL 1HNWL 5GQOA 1SNPA 3ITPA 4Q5VA 3VYTA 3VDYA 3DUZA 3KK7A 1H9KA 4IUQA 3KDFA 3SDZA 1EZ6A 1FNWA 2NN6H 1YNNC 1BVSA 4QL5A 1BCPB 4IUPA 4DR2L 3DWQA 1I94L 4LF9Q 3FVQA 1NE3A 4DAPA 3QIAA 2NVYB 1Z6HA 5FK9C 5C0XG 1JOQA 4RH6A 4KV6A 3J80i 2NWGA 3E0JA 2AQ2B 5FLXL 2QGQA 2ES2A 2I5MX 5IT9E 1SJHD 1D5MC 3AB9A 3GTGH 1C0AA 4C3JH 4HCEA 2RQXA 4PV1C 1KHIA 3HKZG 1M8AA 2LSSA 3HS0C 1VQAA 4OHJA 4DV5L 2PZWA 2N88A 3S1MB 1NNXA 4DR1L 1PH9A 1IBMQ 4BA2I 1DOMA 1EYCA 4XTCS 4K0KL 4A3MB 4CDDC 1ONLA 1S5FD 4JVZA 2AWOA 4EX5A 3C1FA 1WTOA 3HP3A 1BXTA 4ZUJA 3G6EA 5CGKA 1I3QH 3JAMi 2F1MA 2Z6KC 4CKCA 4K0KQ 3S1QB 4TRDA 3TS0A 3H6MA 2AMCB 4PZ7A 3NWSA 3PIP3 5CV8A 4YY3Q 3V2TA 2ZTCA 2F4VQ 4MNOA 4HJ9A 2KHJA 1Y69U 1KDAA 3RLOA 2EYLA 3RMHA 5GAHC 2WB1E 5M5XH 2JA5H 3P75A 5IT9c 2CH4W 1VQ7A 2VUMG 4CBVA 2B8GA 3SE0A 1FGUA 1EEID 3SK6A 1RTOA 5J3BA 3S1NB 4LNQA 1XNRL 5KRUA 3MC0B 2CH4A 4EGVA 3VA7A 3IRBA 5LMUQ 2HCIA 3I3CA 2B63B 2F0TA 5CR3A 4OWXB 1KIXA 4A3IG 3Q22A 4JI5L 4A3FG 5DM63 1LO5D 2C5CA 2JEAI 2RDGA 1SROA 1GOZA 4C2MH 3LWUA 3T1YL 1QWYA 1S5DD 1SYFA 5NUCA 4X66L 4JI3L 2MO0A 2I5HA 5DM73 3TP7A 4B3RQ 5C4XB 1QILA 4BY7B 3VR6A 4IUTA 2Z0SA 3S2HB 1IW7C 1A0IA 1CKNB 2A69C 1N33L 1ESRA 1PYBA 3D0FA 1H9MA 1NAPA 4IOAA 2JA6H 4JI3Q 4H13C 2N78A 4GS3A 1Q81C 4C1NK 2SNSA 4EVOA 1STGA 3FKIB 1LT5D 3WOFA 1EIYB 3PO2G 1CKNA 3CCJA 1MJCA 2CWAA 2HCCA 3EVQA 2MUYA 2K5NA 1J5EL 3L3OC 3L9AX 1LTAD 4YHHL 3B6YA 1N8RC 2FXQA 1H9JA 4KN7C 3EFXD 3JC66 3S2DB 3M85A 2F0MA 4O42A 3H3VH 2XRSD 1VQBA 3HOXH 2SNMA 1NSNS 4IQZA 3UE0A 4KHPL 4LF8L 2B3GA 4DXFA 3I4LA 3CRLC 4K2KA 2F0JA 2BOSA 4DNIA 1KTKA 1KRTA 1I6HB 1LT4D 2F0SA 2RA4A 1Q8KA 2VL6A 4BY1H 1G51A 2O5IC 5C44G 4RGMA 3J7AV 2E2HB 1KD1C 2WIIB 4KY5A 4JI2L 3NENA 4KHVA 1G6ZA 1TS5A 4O2DA 1RD9D 1ZKOA 1RKNA 2HD3A 4Q0FA 2IY5B 4K8JA 3HOZH 1PXUA 1VCIA 1A6XA 1WD1A 3PO3H 1UEBA 4FF3A 2K14A 4JI2Q 2RF4A 5GAGC 5AJ3Q 4A3KH 4LF6Q 2YYZA 2JA8B 3O13A 4JI4L 5CV9A 1ET9A 4A75A 3MVVA 1X3PA 3E3XA 4LFCL 1VQLA 3S1RB 3X3MA 1IL8A 1PRTB 5JPNC 1PFSA 1WD0A 2JK8A 4JG2A 3E5SA 4A3BH 1PH7A 4HJ8A 4R4OA 1KNAA 1KXLA 4JI4Q 1YJ9A 4X62L 2JA9A 4LFCQ 3CCQA 4QB4A 1HNZL 2NTSA 4O0AA 1W2BA 2F03A 3S1MH 1KRSA 1V43A 1PA6A 2OEOA 4M1UB 2UXCQ 2BE5D 1XTDA 2EZVA 4ZLTF 4DF7A 2F0UA 4A3JH 5LMNW 1I50H 2EYJA 2EXDA 3RZOB 2PQAA 5ELCA 2D0PA 2E5LL 4C3HG 5ELEA 4EQOA 2LS01 5GROA 4XQNA 3PUXA 3J81L 1Y1VB 2OT2A 2BH2A 3GTPB 1JJ2A 5HGTA 2ASBA 2ZXPA 2Y0SE 4IJHA 3PV0A 4AYBG 3CPWA 1HJPA 3K0YA 1P16A 3KLRA 3NHHA 1SE3A 4M8AA 1O7ZA 3MA2B 5DEHA 1IZ6A 2QF7A 2WAQG 5FLMH 4J8QA 4B3TL 1O7IA 2ZT9C 3P20A 4RAUC 5C3XA 2PI2A 1C7YA 3L0OA 2X69A 4BA1I 1VQ5A 1BUVT 1M1KC 1TWFH 2J0TD 2R92G 2KA7A 2L15A 4B3TQ 5JJZA 3HOWG 3KLWA 4B08A 4QGUA 4RFBA 5K36H 3CC4A 1QOHA 5FO9B 5C4JB 2KCCA 3I4OA 5ELBA 1DONA 1TWCB 3CP0A 4TSSA 4FXDA 5M3MB 4MN3A 3RNUA 1CA5A 1K8OA 4HIMA 1G2SA 2R7ZB 1B70B 3EIVA 2WINB 2PYKA 2JSOA 1TWHB 2QILA 3CMAA 1WCMG 2UXBL 1BO0A 3HOUG 2EQSA 4QJFA 1E7ZA 2UUBL 4A3GH 2RDFA 4BY7H 1E2WA 3EN2A 2VQFL 1GUOA 1JMCA 1EIFA 3D3RA 3N52A 4MTNA 1CM9A 4IZ8A 1G291 2UXBQ 4QY7A 2UU9L 4HR7B 2VS1A 1V1OA 1PLFA 1CT1D 3M7NA 4ME5A 3G6JB 1UWVA 1VS0A 2OTLA 2MNAA 4FO2A 1QVCA 3BZDB 4N9TA 3D4RA 5CV6A 2WP8J 2F0LA 3R8BA 2UU9Q 3TBIB 3F2BA 3CCMA 4C3IH 4B3SL 2E76C 2IX3A 4K5VA 3S16H 4GN4B 2OCEA 3MFYA 2HQEA 2HT1A 4A3DG 1EWIA 1YI2A 3RZDB 5CV5A 4KY6A 4A93H 4GKKL 3VA5A 1A2UA 2HIVA 3HOYB 4KKSA 1WFQA 3BYTB 1N36L 1PTOH 3UDXA 4ULLA 1F2YA 4K6LA 3HKZB 2B2YA 1I4XA 4R4TA 1Y8PB 1EZ8A 1X9NA 1EU4A 2M2LA 4DPGA 3ICEA 1JOOA 2TSSA 4OIKA 1O78A 1L1OB 1GO3E 5C3WA 1JJCB 1SJED 2JQOA 5AFWA 1TY0A 3E9HA 1EY8A 2OTJA 1DCZA 2K6AA 1NBWA 2VNUD 4RGTA 5LL6X 4DV7L 3GTOH 1L1OA 2XRQD 4LJZC 1CSPA 4X64L 2NB0A 4C56C 2ICEC 4X3TA 3W1BA 1D5XC 2BE5C 4B9WA 3W3AA 2F3WA 1NUCA 4ME3A 1NR2A 2B2WA 1BBXC 4KTAA 3CW2C 3ULLA 5JPMC 4L5QA 1HTLD 5C4ZA 1HZAA 3U9SA 1WTQA 3VYUA 3CCEA 2WFWA 1TVXA 5EQ0A 2K32A 3MZ5A 4JV5L 1WJJA 4UAIA 3S24A 2AUJD 2B2VA 2ID0A 1DM0B 5IGBA 1IBKL 1S4ZA 1CSQA 2NZHA 4IURA 1Y1WG 4A3LG 4G7OC 2BH8A 4ODGA 1WOCA 4DR3L 4IFDH
chains in the Genus database with same CATH topology
3HKZE 3KDFA 2ZJPA 4DV2L 5GAEC 5M3FH 3GTLH 2ATWA 2R6GA 1RIPA 4NPSA 4JBMA 3J81j 1XMOL 2HHHL 1BVSA 1A62A 4QL5A 4H02A 3PCOB 1Q1BA 4OXPA 1D7QA 3CXCA 4JOIA 2OQ0A 4DR2L 3PF5A 1HZCA 3ULJA 1GVPA 1I94L 4LF9Q 3E0EA 1EQRA 1Y1VH 1SLJA 3J81c 1NE3A 4A3BG 4A3JG 2GVBA 1NY4A 2Q2TA 5C4XH 1X54A 3D31A 5C0XG 2F3IA 3ERSX 3MEFA 1PH1A 1JB7A 2HHHQ 4AH6A 4BXXG 3J80i 1YZ6A 5C3EG 3S2HH 2PNHA 2QGQA 2ES2A 4IJLA 2DUDA 1S3OA 2I5MX 5C0XJ 1N32L 3GTGH 2MQHA 4GOPA 2K50A 2UUBQ 3I4MG 1C0AA 1K0RA 3E9IA 1OXXK 3CAMA 4C3JH 1XPRA 2NVTH 1KHIA 3K8AA 3HKZG 2LSSA 5LMNL 2VQFQ 1UE7A 2V1CC 3MXNB 4DR5Q 4B3MQ 1VQAA 1Z9FA 2K75A 3FKIH 3PUVA 4DV5L 4DR4L 3KFUA 1AE3A 4NXNL 4C3HH 4YWKA 1X6OA 2KHIA 4DR1L 1PH9A 2UXDL 4PZ8A 3BZKA 3GO5A 4TQUS 5H1SE 1IBMQ 4BA2I 5FLMG 3RLFA 4R4QA 3STBD 3NELA 4XTCS 3I56A 1YNXA 1E22A 5BR8Q 1K73C 1K9MC 3U58A 4JBKA 4K0KL 1YVCA 1PH8A 4NXNQ 4UPAA 3H0GG 3TEHB 2AWOA 4EX5A 2UXDQ 1PH6A 5AJ3L 4LF6L 2K52A 4B3SQ 3S2DH 3G6EA 3Q8DA 1I3QH 1NMFA 3JAMi 1MKHA 1TWHH 2Z6KC 2I0QA 4JI7L 5K36G 3H3VI 4HIKA 4K0KQ 4AQYL 3TS0A 1VQPA 1KC8C 3KYHC 4DV0L 1X55A 3AYHB 4GKKQ 2AMCB 3RN2A 1Z47A 4J15A 1E1TA 4NB3A 1S72A 4PZ7A 1X56A 2N3SA 1WI5A 3PUWA 3TREA 4POFA 1GD7A 4YY3Q 2VW9A 4DR7L 2ZTCA 1IBLL 4ALPA 2C35B 4R4CA 4KHZA 5IP9H 1N36Q 4JI7Q 2F4VQ 2R92H 1VQ6A 3HOWH 3F8TA 4MNOA 3J81i 3KF8B 4HJ9A 2KHJA 4A76A 4EQ5A 3OW2A 1I6HH 3RLOA 5GAHC 2JA5H 2WB1E 5M5XH 4DV0Q 2E2HH 4Y52H 2CFMA 5IT9c 2UXCL 3KF6B 4A3GG 1VQ7A 1V1QA 1HNXL 1OXVA 4BY7G 2NZOA 2VUMG 4DR7Q 3AFQA 2PQAB 1FGUA 1L1OC 3I4NG 2GN5A 4LF5Q 5J3BA 4AYBE 1TWAH 3CC2A 4LNQA 1XNRL 4OWTB 4APVA 4JBWA 3M4OH 2LXKA 4HIDA 2R7DA 1LTLA 1PYSB 3ULPA 2NVXH 1Q46A 4LF7Q 2ZTEA 5M5YH 1WCMH 3HKSA 3IRBA 5LMUQ 2WAQE 3HOUH 4X65Q 1BBWA 2XGTA 1K8GA 1HNXQ 3KF6A 4GKJL 1N9WA 3WWVA 4OWXB 3HFZB 2JA8H 5IYCG 2Q2HA 1SRUA 1KIXA 3FKIG 3TS2A 4DV7Q 4A3IG 4JI5L 4A3FG 4LF4L 3CCSA 4X64Q 1BKBA 1VQ9A 3S1RH 4FDBA 5ELOA 1NMGA 1IYJB 3TRZA 3HOYH 2JEAI 4GN5A 4GKJQ 3KOJA 1SROA 1M90C 1YJNA 4C2MH 2WB1G 3PIPA 3T1YL 1DGSA 3T1HL 5M5WH 4X66L 4JI3L 2MO0A 1B7YB 1UE5A 3ER0A 2I5HA 2YTXA 4B3RQ 4LF4Q 2ZTDA 1JJGA 4A3CH 2AKWB 4BBRH 1JE5A 2K5HA 1Y14B 1WYDA 2Z0SA 3ZJYC 2KENA 1YHQA 4A93G 5FJ8H 4GNXB 1A0IA 1CKNB 1V9PA 1VQJA 4OO1G 1N33L 4DV1L 1PYBA 1QVFA 3J7ZC 5IYBH 3D0FA 1Q7YC 4IOAA 1OXTA 1UE6A 3UDGA 4DKAC 2JA6H 2IX0A 4JI3Q 4JV5Q 4Y7NH 2N78A 3RZOH 4GS3A 1XNQQ 5C0XI 1Q81C 3CCLA 4GLVB 1PH3A 1IBKQ 1HNWQ 3BU2A 1S40A 1J6QA 5JEAG 4IPDA 1VQOA 4JOIC 4YCUA 4A3DH 2DGYA 1EIYB 3PO2G 4DV1Q 1HR0L 1CKNA 4RMFA 1OXUA 4DR3Q 1D8LA 3A74A 3CCJA 4DV2Q 4JI0L 3GTPH 1MJCA 5JEAJ 5E7NA 4A3MG 2CWAA 3PGZA 4L5TA 3RN5A 1XMOQ 2K5NA 3GTQH 1J5EL 1X3FA 3CCUA 4YHHL 3B6YA 3OYYA 3U4ZA 3GTJH 4DR2Q 1HR0Q 1N8RC 1I94Q 2R93H 4GOPC 2FXQA 4BBSG 3GTKH 5ELNA 3H15A 4A3EG 1NTGA 3JC66 4DV4L 3M85A 1UE1A 3HOVG 1E24A 1VQIA 2MFIA 2XTIA 2JEBI 2YTYA 1Q1EA 4JBJA 1VQBA 1FVIA 3FHWA 1T9HA 1CKOA 4XIGS 5IYDG 3HOXH 1XPOA 2UUAL 2KCTA 3UE0A 4KHPL 4JI6L 3PUYA 4LF8L 2B3GA 5DLQE 2IX1A 1MIUA 1QVGA 1N32Q 4IPHA 1ASZA 4DNIA 3PF4A 1KRTA 4DK3C 2R7FA 3GTMH 3UDIA 3F2CA 1VQ8A 3BJUA 1Q8KA 4DR6L 4LFBL 5C4JH 5LMNQ 4X6AH 1LM0A 2VL6A 3M9BA 4BY1H 4LUOA 3CPFA 4IO9A 3DM3A 1TWCH 1G51A 5M3MH 5C44G 4DV5Q 4L5SA 4DR4Q 2E2JH 1Q12A 1KD1C 1PVOA 1I5FA 3CF5A 3NBHB 2D62A 1VQEA 4JI2L 4DR1Q 3H3VH 2NN6I 2R7ZH 4BBRG 3NENA 2RHSB 3M4PA 2RHQB 4YWLA 2IHEA 4O2DA 3PSIA 1SE8A 3RLNA 1YHBA 5IP7H 2IY5B 2E2IH 3HOZH 2B63G 1HZ9A 1VCIA 4IFDG 1QUQB 5M3FG 1OTCA 3STBC 3PO3H 1UEBA 2K14A 4JI2Q 4AIMA 2JJQA 2RF4A 3PUZA 3I55A 2NN6G 5GAGC 5AJ3Q 4A3KH 4LF6Q 2YYZA 5IE8A 1W3SA 4DAYB 1LYLA 3PIOA 4JI4L 4UP9A 4DK6C 4A75A 4R4IA 4IPCA 4LFCL 2ZJRA 1XJVA 1EQQA 1B8AA 4AQYQ 1Y1WH 1HR0W 1EFWA 1VQLA 1VQKA 1VQNA 3S15H 4A3LH 1Y1VG 1JT8A 1PFSA 4GLAC 4WJ3M 4YCWA 5IWAL 1TXYA 2JK8A 2A19A 2GVAA 4HJ5A 1QZHA 4JG2A 4QQBX 5C4XG 2N49A 3CCRA 2KBNA 1RL2A 2RCNA 1PH7A 4A3BH 4HJ8A 4R4OA 4LFAL 1KXLA 4JI4Q 2YTVA 1YJ9A 4X62L 1IBLQ 4JI8L 2CKZB 2JA9A 4LFCQ 3CCQA 3CMEA 1HNZL 4O0AA 1W2BA 5EAYA 3S1MH 1KRSA 1V43A 1PA6A 1YEZA 1Q86C 4JC0A 5IWAQ 3NEMA 2UXCQ 1XTDA 4TVAB 1GKHA 3K0XA 4A3JH 4LWCA 2JA7H 4LFAQ 5LMNW 1I50H 4P72A 3G71A 2EXDA 2F52A 2E8GA 4KLKA 1EOVA 2PQAA 2D0PA 4JI8Q 4BXXH 3CCVA 3RZDH 4DAMA 2E5LL 3SGIA 1XNRQ 5C3EH 3S14H 4KI0A 1YITA 1YBYA 5GROA 4OO1I 3PUXA 3F2DA 4JYAL 4DUZL 1SN8A 4OX9L 2BH2A 1JJ2A 3K81C 4L5RC 4HIOA 2ASBA 4YWMA 3GD7A 1Q82C 4JI5Q 3K7UC 2UUCL 1U0LA 2QA4A 3OTOL 2H5XA 4PMWA 2Y0SE 1A8VA 4IJHA 4JCVE 3PV0A 4DUYL 4AYBG 3CPWA 1HJPA 1KAWA 2AHOB 1XMQL 1P16A 3AFPA 5IY0A 3T1YQ 1GM5A 1E3PA 3T1HQ 4X66Q 1IZ6A 4B3TL 2WAQG 5FLMH 1O7IA 4P73A 2UUCQ 2PI2A 1C7YA 3U4VA 3OTOQ 5JJKA 3KDFB 3M3YH 1AH9A 2YV5A 3L0OA 3UE1A 1YHAA 4IPGA 4GNXC 4BA1I 1P8LA 5HY6A 3H0GH 1N33Q 4GNXA 1VQ5A 2ALYB 1M1KC 1TWFH 1SFOH 1K83H 5IP9G 2YU9H 5JJIA 2R92G 2L15A 1L2FA 4B3TQ 3HOWG 1IL2A 4PG3A 3KLWA 4QGUA 2B29A 3I7FA 3CC4A 2JA5G 3CC7A 1AE2A 4LF9L 3I4OA 3LGJA 3CP0A 3S17H 1TWGH 1VQHA 2A8VA 3RNUA 1X3EA 2Y0SG 4HIMA 2Q2IA 3I4MH 3GDEA 4JI0Q 2D0OA 4UP8A 1G6PA 1B70B 4GLXA 2N8NA 3EIVA 2VY3A 3U50C 3CMAA 1J5EQ 1WCMG 3W5OA 4GOPB 2UXBL 5JJLA 3HOUG 1VQCA 2EQSA 4QJFA 1E7ZA 4YHHQ 1PH4A 2UUBL 2JA7G 2A1AA 4A3GH 2JA8G 1IXRA 4BY7H 2VUMH 3EN2A 2VQFL 1JMCA 4DR5L 1EIFA 4DV4Q 1PV4A 4B3ML 3I4NH 1HH2P 4R1JA 4MTNA 1BBUA 3HOYG 4WJ4A 1G291 2ZJQA 1FL0A 2UXBQ 4QY7A 4POGA 2UUAQ 1EYGA 4KHPQ 2UU9L 2PI2E 4JI6Q 4IFDI 1PH5A 4LF8Q 1SMXA 2VS1A 3FP9A 3A5UA 1IBML 3M4QA 3M7NA 1L0WA 1UWVA 1VS0A 1VQMA 2OTLA 2MNAA 4A3CG 1H95A 5IYCH 1QVCA 5BR8L 3AQQA 4A3IH 2WP8J 4A3FH 1PH2A 1R9TH 4HJAA 4LFBQ 5FJ8G 4DR6Q 4LUZA 3RR5A 3A5ZB 3AEVA 1CKMA 5IYBG 2UU9Q 2AWNA 3EBEA 1N34L 1ASYA 2JA6G 3F2BA 3CCMA 4C3IH 4B3SL 2NVYH 4DV3L 2ZM6L 3S16H 4GN4B 2OCEA 3TQYA 3KJOA 3UDFA 1QZGA 2HT1A 4A3DG 4IFDJ 3K7AH 1EWIA 4UP7A 1YI2A 2JE6I 5FLXc 1XPUA 1N34Q 4A93H 4GKKL 2IHFA 4P75A 1HZBA 1U5KA 2Q2UA 2HIVA 1E1OA 3CQZH 5GADC 1SR3A 4GN3B 4YY3L 1QUQA 1WFQA 4DV3Q 2F4VL 2ZM6Q 2IT1A 1N36L 2I5LX 2Z6KA 3UDXA 1PHJA 1X3GA 2CCZA 4P74A 4R4TA 3K80C 1EUJA 1X9NA 2R93G 4JI1L 4DPGA 3ICEA 3PO2H 2MO1A 2KCMA 1L1OB 1GO3E 1VQGA 3I2ZA 2K4KA 4LF5L 1X65A 3HOXG 4A3MH 3G4SA 4LUVA 1JJCB 2JQOA 1A63A 4X62Q 4A4IA 3E9HA 3G48A 4LF7L 1K8AC 1KQSA 5LMUL 1HNZQ 2OWOA 2OTJA 4X65L 3J80c 1YIJA 1NBWA 4JI1Q 2VNUD 1LUZA 2LXJA 2HQLA 1NJIC 4MZ9A 4UY8C 4DV7L 4BBSH 3GTOH 1L1OA 4RG1A 1CSPA 4X64L 4A3EH 4IOCA 3S1QH 4OONA 4BY1G 2VQEL 4QIWE 3HOVH 2EIFA 3BZCA 4LW1A 3KJPA 3W1BA 2QEXA 1MJEA 2CQOA 4OWWB 2NVQH 5M3MG 2PMZE 3J7A5 5IYDH 2E5LQ 4ME3A 3CD6A 1FJGL 1VQDA 2BA1A 3DLLA 4DV6L 1OXSC 2BA0A 3CW2C 2R7ZG 3ULLA 4L5QA 4B3RL 4PZ6A 4JYAQ 4DUZQ 4NXML 1CUKA 5IP7G 4OX9Q 1HZAA 2VQEQ 3L2PA 3HOZG 2HIXA 3CCEA 2WFWA 3F1ZA 2K5VA 1FJGQ 1K3RA 3PO3G 1VQ4A 4HJ7A 2VZAA 4DV6Q 5C44H 1C9OA 1WJJA 5HGQA 4DUYQ 4JV5L 3S24A 4A3KG 3L7ZC 1XMQQ 2ID0A 4YCVA 1XNQL 3S1NH 1HNWL 5GQOA 1IBKL 4NXMQ 1CSQA 3W1GA 2NZHA 1Y1WG 1VQFA 1YJWA 1KL9A 2OQKA 4A3LG 2CWPA 3VDYA 3JAMc 2BH8A 4P71A 1WOCA 2B63H 4DR3L 3A0JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ E;  3KDF A;  2ZJP A;  4DV2 L;  5GAE C;  5M3F H;  3GTL H;  2ATW A;  2R6G A;  1RIP A;  4NPS A;  4JBM A;  3J81 j;  1XMO L;  2HHH L;  1BVS A;  1A62 A;  4QL5 A;  4H02 A;  3PCO B;  1Q1B A;  4OXP A;  1D7Q A;  3CXC A;  4JOI A;  2OQ0 A;  4DR2 L;  3PF5 A;  1HZC A;  3ULJ A;  1GVP A;  1I94 L;  4LF9 Q;  3E0E A;  1EQR A;  1Y1V H;  1SLJ A;  3J81 c;  1NE3 A;  4A3B G;  4A3J G;  2GVB A;  1NY4 A;  2Q2T A;  5C4X H;  1X54 A;  3D31 A;  5C0X G;  2F3I A;  3ERS X;  3MEF A;  1PH1 A;  1JB7 A;  2HHH Q;  4AH6 A;  4BXX G;  3J80 i;  1YZ6 A;  5C3E G;  3S2H H;  2PNH A;  2QGQ A;  2ES2 A;  4IJL A;  2DUD A;  1S3O A;  2I5M X;  5C0X J;  1N32 L;  3GTG H;  2MQH A;  4GOP A;  2K50 A;  2UUB Q;  3I4M G;  1C0A A;  1K0R A;  3E9I A;  1OXX K;  3CAM A;  4C3J H;  1XPR A;  2NVT H;  1KHI A;  3K8A A;  3HKZ G;  2LSS A;  5LMN L;  2VQF Q;  1UE7 A;  2V1C C;  3MXN B;  4DR5 Q;  4B3M Q;  1VQA A;  1Z9F A;  2K75 A;  3FKI H;  3PUV A;  4DV5 L;  4DR4 L;  3KFU A;  1AE3 A;  4NXN L;  4C3H H;  4YWK A;  1X6O A;  2KHI A;  4DR1 L;  1PH9 A;  2UXD L;  4PZ8 A;  3BZK A;  3GO5 A;  4TQU S;  5H1S E;  1IBM Q;  4BA2 I;  5FLM G;  3RLF A;  4R4Q A;  3STB D;  3NEL A;  4XTC S;  3I56 A;  1YNX A;  1E22 A;  5BR8 Q;  1K73 C;  1K9M C;  3U58 A;  4JBK A;  4K0K L;  1YVC A;  1PH8 A;  4NXN Q;  4UPA A;  3H0G G;  3TEH B;  2AWO A;  4EX5 A;  2UXD Q;  1PH6 A;  5AJ3 L;  4LF6 L;  2K52 A;  4B3S Q;  3S2D H;  3G6E A;  3Q8D A;  1I3Q H;  1NMF A;  3JAM i;  1MKH A;  1TWH H;  2Z6K C;  2I0Q A;  4JI7 L;  5K36 G;  3H3V I;  4HIK A;  4K0K Q;  4AQY L;  3TS0 A;  1VQP A;  1KC8 C;  3KYH C;  4DV0 L;  1X55 A;  3AYH B;  4GKK Q;  2AMC B;  3RN2 A;  1Z47 A;  4J15 A;  1E1T A;  4NB3 A;  1S72 A;  4PZ7 A;  1X56 A;  2N3S A;  1WI5 A;  3PUW A;  3TRE A;  4POF A;  1GD7 A;  4YY3 Q;  2VW9 A;  4DR7 L;  2ZTC A;  1IBL L;  4ALP A;  2C35 B;  4R4C A;  4KHZ A;  5IP9 H;  1N36 Q;  4JI7 Q;  2F4V Q;  2R92 H;  1VQ6 A;  3HOW H;  3F8T A;  4MNO A;  3J81 i;  3KF8 B;  4HJ9 A;  2KHJ A;  4A76 A;  4EQ5 A;  3OW2 A;  1I6H H;  3RLO A;  5GAH C;  2JA5 H;  2WB1 E;  5M5X H;  4DV0 Q;  2E2H H;  4Y52 H;  2CFM A;  5IT9 c;  2UXC L;  3KF6 B;  4A3G G;  1VQ7 A;  1V1Q A;  1HNX L;  1OXV A;  4BY7 G;  2NZO A;  2VUM G;  4DR7 Q;  3AFQ A;  2PQA B;  1FGU A;  1L1O C;  3I4N G;  2GN5 A;  4LF5 Q;  5J3B A;  4AYB E;  1TWA H;  3CC2 A;  4LNQ A;  1XNR L;  4OWT B;  4APV A;  4JBW A;  3M4O H;  2LXK A;  4HID A;  2R7D A;  1LTL A;  1PYS B;  3ULP A;  2NVX H;  1Q46 A;  4LF7 Q;  2ZTE A;  5M5Y H;  1WCM H;  3HKS A;  3IRB A;  5LMU Q;  2WAQ E;  3HOU H;  4X65 Q;  1BBW A;  2XGT A;  1K8G A;  1HNX Q;  3KF6 A;  4GKJ L;  1N9W A;  3WWV A;  4OWX B;  3HFZ B;  2JA8 H;  5IYC G;  2Q2H A;  1SRU A;  1KIX A;  3FKI G;  3TS2 A;  4DV7 Q;  4A3I G;  4JI5 L;  4A3F G;  4LF4 L;  3CCS A;  4X64 Q;  1BKB A;  1VQ9 A;  3S1R H;  4FDB A;  5ELO A;  1NMG A;  1IYJ B;  3TRZ A;  3HOY H;  2JEA I;  4GN5 A;  4GKJ Q;  3KOJ A;  1SRO A;  1M90 C;  1YJN A;  4C2M H;  2WB1 G;  3PIP A;  3T1Y L;  1DGS A;  3T1H L;  5M5W H;  4X66 L;  4JI3 L;  2MO0 A;  1B7Y B;  1UE5 A;  3ER0 A;  2I5H A;  2YTX A;  4B3R Q;  4LF4 Q;  2ZTD A;  1JJG A;  4A3C H;  2AKW B;  4BBR H;  1JE5 A;  2K5H A;  1Y14 B;  1WYD A;  2Z0S A;  3ZJY C;  2KEN A;  1YHQ A;  4A93 G;  5FJ8 H;  4GNX B;  1A0I A;  1CKN B;  1V9P A;  1VQJ A;  4OO1 G;  1N33 L;  4DV1 L;  1PYB A;  1QVF A;  3J7Z C;  5IYB H;  3D0F A;  1Q7Y C;  4IOA A;  1OXT A;  1UE6 A;  3UDG A;  4DKA C;  2JA6 H;  2IX0 A;  4JI3 Q;  4JV5 Q;  4Y7N H;  2N78 A;  3RZO H;  4GS3 A;  1XNQ Q;  5C0X I;  1Q81 C;  3CCL A;  4GLV B;  1PH3 A;  1IBK Q;  1HNW Q;  3BU2 A;  1S40 A;  1J6Q A;  5JEA G;  4IPD A;  1VQO A;  4JOI C;  4YCU A;  4A3D H;  2DGY A;  1EIY B;  3PO2 G;  4DV1 Q;  1HR0 L;  1CKN A;  4RMF A;  1OXU A;  4DR3 Q;  1D8L A;  3A74 A;  3CCJ A;  4DV2 Q;  4JI0 L;  3GTP H;  1MJC A;  5JEA J;  5E7N A;  4A3M G;  2CWA A;  3PGZ A;  4L5T A;  3RN5 A;  1XMO Q;  2K5N A;  3GTQ H;  1J5E L;  1X3F A;  3CCU A;  4YHH L;  3B6Y A;  3OYY A;  3U4Z A;  3GTJ H;  4DR2 Q;  1HR0 Q;  1N8R C;  1I94 Q;  2R93 H;  4GOP C;  2FXQ A;  4BBS G;  3GTK H;  5ELN A;  3H15 A;  4A3E G;  1NTG A;  3JC6 6;  4DV4 L;  3M85 A;  1UE1 A;  3HOV G;  1E24 A;  1VQI A;  2MFI A;  2XTI A;  2JEB I;  2YTY A;  1Q1E A;  4JBJ A;  1VQB A;  1FVI A;  3FHW A;  1T9H A;  1CKO A;  4XIG S;  5IYD G;  3HOX H;  1XPO A;  2UUA L;  2KCT A;  3UE0 A;  4KHP L;  4JI6 L;  3PUY A;  4LF8 L;  2B3G A;  5DLQ E;  2IX1 A;  1MIU A;  1QVG A;  1N32 Q;  4IPH A;  1ASZ A;  4DNI A;  3PF4 A;  1KRT A;  4DK3 C;  2R7F A;  3GTM H;  3UDI A;  3F2C A;  1VQ8 A;  3BJU A;  1Q8K A;  4DR6 L;  4LFB L;  5C4J H;  5LMN Q;  4X6A H;  1LM0 A;  2VL6 A;  3M9B A;  4BY1 H;  4LUO A;  3CPF A;  4IO9 A;  3DM3 A;  1TWC H;  1G51 A;  5M3M H;  5C44 G;  4DV5 Q;  4L5S A;  4DR4 Q;  2E2J H;  1Q12 A;  1KD1 C;  1PVO A;  1I5F A;  3CF5 A;  3NBH B;  2D62 A;  1VQE A;  4JI2 L;  4DR1 Q;  3H3V H;  2NN6 I;  2R7Z H;  4BBR G;  3NEN A;  2RHS B;  3M4P A;  2RHQ B;  4YWL A;  2IHE A;  4O2D A;  3PSI A;  1SE8 A;  3RLN A;  1YHB A;  5IP7 H;  2IY5 B;  2E2I H;  3HOZ H;  2B63 G;  1HZ9 A;  1VCI A;  4IFD G;  1QUQ B;  5M3F G;  1OTC A;  3STB C;  3PO3 H;  1UEB A;  2K14 A;  4JI2 Q;  4AIM A;  2JJQ A;  2RF4 A;  3PUZ A;  3I55 A;  2NN6 G;  5GAG C;  5AJ3 Q;  4A3K H;  4LF6 Q;  2YYZ A;  5IE8 A;  1W3S A;  4DAY B;  1LYL A;  3PIO A;  4JI4 L;  4UP9 A;  4DK6 C;  4A75 A;  4R4I A;  4IPC A;  4LFC L;  2ZJR A;  1XJV A;  1EQQ A;  1B8A A;  4AQY Q;  1Y1W H;  1HR0 W;  1EFW A;  1VQL A;  1VQK A;  1VQN A;  3S15 H;  4A3L H;  1Y1V G;  1JT8 A;  1PFS A;  4GLA C;  4WJ3 M;  4YCW A;  5IWA L;  1TXY A;  2JK8 A;  2A19 A;  2GVA A;  4HJ5 A;  1QZH A;  4JG2 A;  4QQB X;  5C4X G;  2N49 A;  3CCR A;  2KBN A;  1RL2 A;  2RCN A;  1PH7 A;  4A3B H;  4HJ8 A;  4R4O A;  4LFA L;  1KXL A;  4JI4 Q;  2YTV A;  1YJ9 A;  4X62 L;  1IBL Q;  4JI8 L;  2CKZ B;  2JA9 A;  4LFC Q;  3CCQ A;  3CME A;  1HNZ L;  4O0A A;  1W2B A;  5EAY A;  3S1M H;  1KRS A;  1V43 A;  1PA6 A;  1YEZ A;  1Q86 C;  4JC0 A;  5IWA Q;  3NEM A;  2UXC Q;  1XTD A;  4TVA B;  1GKH A;  3K0X A;  4A3J H;  4LWC A;  2JA7 H;  4LFA Q;  5LMN W;  1I50 H;  4P72 A;  3G71 A;  2EXD A;  2F52 A;  2E8G A;  4KLK A;  1EOV A;  2PQA A;  2D0P A;  4JI8 Q;  4BXX H;  3CCV A;  3RZD H;  4DAM A;  2E5L L;  3SGI A;  1XNR Q;  5C3E H;  3S14 H;  4KI0 A;  1YIT A;  1YBY A;  5GRO A;  4OO1 I;  3PUX A;  3F2D A;  4JYA L;  4DUZ L;  1SN8 A;  4OX9 L;  2BH2 A;  1JJ2 A;  3K81 C;  4L5R C;  4HIO A;  2ASB A;  4YWM A;  3GD7 A;  1Q82 C;  4JI5 Q;  3K7U C;  2UUC L;  1U0L A;  2QA4 A;  3OTO L;  2H5X A;  4PMW A;  2Y0S E;  1A8V A;  4IJH A;  4JCV E;  3PV0 A;  4DUY L;  4AYB G;  3CPW A;  1HJP A;  1KAW A;  2AHO B;  1XMQ L;  1P16 A;  3AFP A;  5IY0 A;  3T1Y Q;  1GM5 A;  1E3P A;  3T1H Q;  4X66 Q;  1IZ6 A;  4B3T L;  2WAQ G;  5FLM H;  1O7I A;  4P73 A;  2UUC Q;  2PI2 A;  1C7Y A;  3U4V A;  3OTO Q;  5JJK A;  3KDF B;  3M3Y H;  1AH9 A;  2YV5 A;  3L0O A;  3UE1 A;  1YHA A;  4IPG A;  4GNX C;  4BA1 I;  1P8L A;  5HY6 A;  3H0G H;  1N33 Q;  4GNX A;  1VQ5 A;  2ALY B;  1M1K C;  1TWF H;  1SFO H;  1K83 H;  5IP9 G;  2YU9 H;  5JJI A;  2R92 G;  2L15 A;  1L2F A;  4B3T Q;  3HOW G;  1IL2 A;  4PG3 A;  3KLW A;  4QGU A;  2B29 A;  3I7F A;  3CC4 A;  2JA5 G;  3CC7 A;  1AE2 A;  4LF9 L;  3I4O A;  3LGJ A;  3CP0 A;  3S17 H;  1TWG H;  1VQH A;  2A8V A;  3RNU A;  1X3E A;  2Y0S G;  4HIM A;  2Q2I A;  3I4M H;  3GDE A;  4JI0 Q;  2D0O A;  4UP8 A;  1G6P A;  1B70 B;  4GLX A;  2N8N A;  3EIV A;  2VY3 A;  3U50 C;  3CMA A;  1J5E Q;  1WCM G;  3W5O A;  4GOP B;  2UXB L;  5JJL A;  3HOU G;  1VQC A;  2EQS A;  4QJF A;  1E7Z A;  4YHH Q;  1PH4 A;  2UUB L;  2JA7 G;  2A1A A;  4A3G H;  2JA8 G;  1IXR A;  4BY7 H;  2VUM H;  3EN2 A;  2VQF L;  1JMC A;  4DR5 L;  1EIF A;  4DV4 Q;  1PV4 A;  4B3M L;  3I4N H;  1HH2 P;  4R1J A;  4MTN A;  1BBU A;  3HOY G;  4WJ4 A;  1G29 1;  2ZJQ A;  1FL0 A;  2UXB Q;  4QY7 A;  4POG A;  2UUA Q;  1EYG A;  4KHP Q;  2UU9 L;  2PI2 E;  4JI6 Q;  4IFD I;  1PH5 A;  4LF8 Q;  1SMX A;  2VS1 A;  3FP9 A;  3A5U A;  1IBM L;  3M4Q A;  3M7N A;  1L0W A;  1UWV A;  1VS0 A;  1VQM A;  2OTL A;  2MNA A;  4A3C G;  1H95 A;  5IYC H;  1QVC A;  5BR8 L;  3AQQ A;  4A3I H;  2WP8 J;  4A3F H;  1PH2 A;  1R9T H;  4HJA A;  4LFB Q;  5FJ8 G;  4DR6 Q;  4LUZ A;  3RR5 A;  3A5Z B;  3AEV A;  1CKM A;  5IYB G;  2UU9 Q;  2AWN A;  3EBE A;  1N34 L;  1ASY A;  2JA6 G;  3F2B A;  3CCM A;  4C3I H;  4B3S L;  2NVY H;  4DV3 L;  2ZM6 L;  3S16 H;  4GN4 B;  2OCE A;  3TQY A;  3KJO A;  3UDF A;  1QZG A;  2HT1 A;  4A3D G;  4IFD J;  3K7A H;  1EWI A;  4UP7 A;  1YI2 A;  2JE6 I;  5FLX c;  1XPU A;  1N34 Q;  4A93 H;  4GKK L;  2IHF A;  4P75 A;  1HZB A;  1U5K A;  2Q2U A;  2HIV A;  1E1O A;  3CQZ H;  5GAD C;  1SR3 A;  4GN3 B;  4YY3 L;  1QUQ A;  1WFQ A;  4DV3 Q;  2F4V L;  2ZM6 Q;  2IT1 A;  1N36 L;  2I5L X;  2Z6K A;  3UDX A;  1PHJ A;  1X3G A;  2CCZ A;  4P74 A;  4R4T A;  3K80 C;  1EUJ A;  1X9N A;  2R93 G;  4JI1 L;  4DPG A;  3ICE A;  3PO2 H;  2MO1 A;  2KCM A;  1L1O B;  1GO3 E;  1VQG A;  3I2Z A;  2K4K A;  4LF5 L;  1X65 A;  3HOX G;  4A3M H;  3G4S A;  4LUV A;  1JJC B;  2JQO A;  1A63 A;  4X62 Q;  4A4I A;  3E9H A;  3G48 A;  4LF7 L;  1K8A C;  1KQS A;  5LMU L;  1HNZ Q;  2OWO A;  2OTJ A;  4X65 L;  3J80 c;  1YIJ A;  1NBW A;  4JI1 Q;  2VNU D;  1LUZ A;  2LXJ A;  2HQL A;  1NJI C;  4MZ9 A;  4UY8 C;  4DV7 L;  4BBS H;  3GTO H;  1L1O A;  4RG1 A;  1CSP A;  4X64 L;  4A3E H;  4IOC A;  3S1Q H;  4OON A;  4BY1 G;  2VQE L;  4QIW E;  3HOV H;  2EIF A;  3BZC A;  4LW1 A;  3KJP A;  3W1B A;  2QEX A;  1MJE A;  2CQO A;  4OWW B;  2NVQ H;  5M3M G;  2PMZ E;  3J7A 5;  5IYD H;  2E5L Q;  4ME3 A;  3CD6 A;  1FJG L;  1VQD A;  2BA1 A;  3DLL A;  4DV6 L;  1OXS C;  2BA0 A;  3CW2 C;  2R7Z G;  3ULL A;  4L5Q A;  4B3R L;  4PZ6 A;  4JYA Q;  4DUZ Q;  4NXM L;  1CUK A;  5IP7 G;  4OX9 Q;  1HZA A;  2VQE Q;  3L2P A;  3HOZ G;  2HIX A;  3CCE A;  2WFW A;  3F1Z A;  2K5V A;  1FJG Q;  1K3R A;  3PO3 G;  1VQ4 A;  4HJ7 A;  2VZA A;  4DV6 Q;  5C44 H;  1C9O A;  1WJJ A;  5HGQ A;  4DUY Q;  4JV5 L;  3S24 A;  4A3K G;  3L7Z C;  1XMQ Q;  2ID0 A;  4YCV A;  1XNQ L;  3S1N H;  1HNW L;  5GQO A;  1IBK L;  4NXM Q;  1CSQ A;  3W1G A;  2NZH A;  1Y1W G;  1VQF A;  1YJW A;  1KL9 A;  2OQK A;  4A3L G;  2CWP A;  3VDY A;  3JAM c;  2BH8 A;  4P71 A;  1WOC A;  2B63 H;  4DR3 L;  3A0J A; 
#chains in the Genus database with same CATH topology
 1LAC A;  2Q8T A;  4DV2 L;  5M3F H;  3GTL H;  2DNC A;  2R6G A;  4KJN A;  1F9S A;  4NPS A;  2E2J B;  1U4P A;  3J81 j;  1WVL A;  1XMO L;  2HHH L;  2F3V A;  4UDU C;  1A62 A;  3ND8 A;  5JOB A;  4OEM B;  4A3I B;  4OXP A;  4A3F B;  1R9T B;  4JOI A;  2F0W A;  1GVP A;  3QOL A;  4L8J A;  3E0E A;  1Y1V H;  4HED A;  3MFG A;  1JOK A;  1U4R A;  2EPB A;  2GVB A;  1NY4 A;  2Q2T A;  4RWS C;  1X54 A;  2HHH Q;  1U4L A;  4BXX G;  2KVM A;  4NW2 A;  3DEP A;  3VR3 A;  3K7A B;  2J4X A;  1PRT F;  3FMC A;  2DUD A;  3HZX A;  1PTO D;  5C6A A;  2MQH A;  2K50 A;  3CQZ B;  1K0R A;  2VB3 X;  4MHE A;  2PZT A;  3NE5 B;  4OIJ A;  1ZEQ X;  2V1C C;  4DR5 Q;  4NDX A;  3OWE B;  4L63 B;  5TSS A;  5CBE E;  3KFU A;  1AE3 A;  1X6O A;  2K04 A;  2KHI A;  3PO2 B;  1QJO A;  2HUG A;  3RLF A;  1S5E D;  1HA5 A;  1YNX A;  2PW7 A;  5BR8 Q;  1Z7T A;  1K73 C;  1YVC A;  2L0C A;  1AW7 A;  3TEH B;  4CDC C;  1B3Q A;  5KGU A;  1PZI D;  2K52 A;  2PZU A;  1EY7 A;  2Z4H A;  3A56 A;  3Q8D A;  5J1Z A;  1NMF A;  2F4I A;  1TWH H;  2N55 A;  4JI7 L;  3H3V I;  4AQY L;  1VF5 C;  1VQP A;  3DHQ A;  5A35 A;  4DV0 L;  4ZUI A;  4ZCK A;  1KDC A;  4J15 A;  4X3K A;  1S72 A;  1XYI A;  4POF A;  4DNT B;  1WI5 A;  2VW9 A;  3TRE A;  4DR7 L;  3MAQ A;  2JP1 A;  3I72 A;  1IBL L;  4ZKB B;  2C35 B;  4JI7 Q;  4KHZ A;  5IP9 H;  1VQ6 A;  5CV4 A;  1O7L A;  3J81 i;  3SXH A;  2K5D A;  4F8M A;  4HMJ A;  1DOL A;  4DV0 Q;  4Y52 H;  4N8F A;  2CFM A;  3KF6 B;  4BS9 A;  1OXV A;  4EQP A;  4DR7 Q;  3AFQ A;  2PPB C;  3I4N G;  3NTI A;  2GN5 A;  4LF5 Q;  4AYB E;  1SFO B;  1TWA H;  3CC2 A;  3M4O H;  4HID A;  2R7D A;  3WDN A;  2NVX H;  4LF7 Q;  2WAQ E;  3GV6 A;  4X65 Q;  1BBW A;  2XGT A;  3KF6 A;  2QEJ C;  3WWV A;  3T51 B;  3LWE A;  5EBD A;  3TS2 A;  4LF4 L;  4U67 3;  5K5P A;  3CCS A;  2F0I A;  4FDB A;  5ELO A;  1NMG A;  3NP8 A;  3TRZ A;  3HOY H;  3G7L A;  1E0B A;  3KOJ A;  1JR0 D;  3NXW A;  1M90 C;  4CGY B;  1OO9 B;  3PIP A;  3T1H L;  5M5W H;  4PNY A;  2YTX A;  4LF4 Q;  3SEB A;  4A3C H;  2AKW B;  4BBR H;  3ZJY C;  3NK9 A;  4GNX B;  2MP1 A;  1VQJ A;  1QVF A;  5IOC A;  1OXT A;  1UE6 A;  3UDG A;  2IX0 A;  2HDM A;  4G7Z C;  2DN8 A;  2NVT B;  2F0P A;  1XNQ Q;  3CCL A;  1HNW Q;  1PH3 A;  1AZP A;  1J6Q A;  1VQO A;  2H1E A;  1HQM C;  2DGY A;  4N9P A;  1IYU A;  1OXU A;  4C3H B;  4JI0 L;  2WAC A;  5JEA J;  3I8Z A;  5EKI A;  3RN5 A;  3VR2 A;  2QCP X;  5IIF A;  1X3F A;  3MWY W;  2LMC B;  2FJ2 A;  4DR2 Q;  1I94 Q;  4GOP C;  4BBS G;  4NMZ A;  2KEE A;  3TZU A;  4AYB B;  2FHT A;  4A3E G;  1NTG A;  4DV4 L;  5BN3 A;  3HOV G;  1VQI A;  4GZY C;  2MFI A;  2JEB I;  2IW3 A;  1ML0 D;  2KCT A;  2WAQ B;  1A3T A;  1GHK A;  5DLQ E;  4FVM A;  5IGC A;  5DNF A;  1MIU A;  4CDE C;  3FPU B;  1BF4 A;  2D5D A;  1SYE A;  3D4D A;  3GTM H;  4KKT A;  1VQ8 A;  4LFB L;  4DR6 L;  1EY6 A;  2DY8 A;  2R92 B;  1WTX A;  3HOW B;  1K3B C;  3CPF A;  1S5C D;  3DM3 A;  4IO9 A;  4CJ1 B;  4DV5 Q;  2E2J H;  3OIP A;  1I5F A;  4DR1 Q;  1X3Q A;  1W6K A;  4BBR G;  4BWG B;  1CQF A;  3M4P A;  5FOB B;  4YWL A;  3PSI A;  3RLN A;  4IN3 A;  1YHB A;  5IP7 H;  3V05 A;  1OTC A;  1WCM B;  4AIM A;  3HOU B;  1F2Z A;  1RDP D;  2JJQ A;  3PUZ A;  3HG9 A;  2NN6 G;  1LYL A;  2KEC A;  2Z1C A;  3D6C A;  2EYM A;  4UP9 A;  4DK6 C;  2ZJR A;  1XJV A;  4PMC A;  5C4H A;  5I9P A;  3NTH A;  5BN5 A;  1NR4 A;  2Z8L A;  3D6W A;  2KBN A;  2YTV A;  4FF2 A;  4JI8 L;  1JWM D;  2CKZ B;  5CMD A;  5A2Q E;  1YEZ A;  1Q86 C;  4C3J G;  1SNM A;  2A6H D;  2JYO A;  4DAV A;  2F0G A;  2JA7 H;  3M7G A;  2F52 A;  1ENC A;  4KLK A;  4JI8 Q;  3K5N A;  4DAM A;  1XNR Q;  5C3E H;  1UNS A;  1ZYR D;  5I4D A;  1YBY A;  4JYA L;  3K57 A;  4XQJ A;  3WOE A;  4OX9 L;  3K81 C;  4ZK9 B;  4HIO A;  4JPB W;  4L5R C;  4YWM A;  1Q82 C;  3OSO A;  4JI5 Q;  3K7U C;  3GTQ B;  3OTO L;  3SR1 A;  1ICW A;  1A2T A;  3QG1 A;  4JCV E;  4DUY L;  2L4N A;  3GTJ B;  1KAW A;  1YNJ C;  1XMQ L;  3AFP A;  5IY0 A;  1F9P A;  3DEO A;  3T1Y Q;  4X66 Q;  3BVZ A;  4HMI A;  4HSV A;  4P73 A;  3EJI A;  4DK0 A;  3OTO Q;  5JJK A;  3M3Y H;  5D3D A;  3TP8 A;  3I91 A;  2NYZ D;  1YHA A;  2KHS A;  4IPG A;  5HY6 A;  3H0G H;  1N33 Q;  3J7Y W;  1A15 A;  3A54 A;  1SFO H;  1K83 H;  2YU9 H;  4XXE A;  3I7F A;  3SVM A;  2JA5 G;  3I90 A;  3QR8 A;  1AE2 A;  3CC7 A;  1JB3 A;  1EQT A;  1TWG H;  5DAU A;  1X3E A;  3QO2 A;  1QG7 A;  1B2T A;  2Q2I A;  3I4M H;  4UP8 A;  3M4Y A;  1HTP A;  1J5E Q;  4GOP B;  2F0N A;  1B3A A;  4HTH A;  4YHH Q;  1PH4 A;  2JA7 G;  1IXR A;  1ILP A;  2WV6 D;  5COR A;  4B3M L;  1HH2 P;  2EY1 A;  5E3F A;  1Y1W B;  3S15 B;  4KHP Q;  2PI2 E;  4IFD I;  3J80 E;  5IT9 L;  4LF8 Q;  5D65 A;  3FP9 A;  2LY7 A;  2XWJ B;  3MEH A;  5IYC H;  2J7Z A;  2K33 A;  4OEL B;  4G57 A;  3TSS A;  3A5Z B;  1CKM A;  1B44 D;  2AWN A;  3EBE A;  2JA6 G;  2NVY H;  2FMM A;  5J39 A;  4DV3 L;  3C46 A;  1LTI D;  1Y8O B;  1CFM A;  1QZG A;  2AUK A;  4IFD J;  2KED A;  1T5E A;  2SEB D;  1HZB A;  1U5K A;  4QMG A;  5ELF A;  2Q2U A;  4OO1 H;  4QCL A;  2QDB A;  4GN3 B;  4DV3 Q;  1ICF B;  2EDG A;  1WTP A;  1PFM A;  2Z6K A;  3FRP B;  4L6T B;  1HRJ A;  2CCZ A;  3K80 C;  5JEA H;  3JAM E;  1EUJ A;  4JI1 L;  1KAB A;  3I2Z A;  2CW0 D;  4FXG C;  1X65 A;  3HOX G;  4A3M H;  3C3L A;  4Y7N B;  4X62 Q;  4A4I A;  3G48 A;  1HNZ Q;  1A3U A;  1XX8 A;  4RCN A;  3SK4 A;  2CHB D;  3J80 c;  4JI1 Q;  1LUZ A;  2MGS A;  3SHL A;  2WKD A;  1EIH A;  3KLS X;  3OPO A;  2NZ1 D;  4RG1 A;  4K5X A;  4IOC A;  4DNR B;  1BOS A;  3S1Q H;  4OON A;  4BY1 G;  2VQE L;  3BZC A;  1JWU D;  3KJP A;  2QEX A;  4GKJ L;  5IYD H;  2A6H C;  2E5L Q;  2B2W C;  1VQD A;  3PMF A;  4Z9C B;  1SXT A;  2BA1 A;  4RHS A;  3S17 B;  2B2T C;  4PZ6 A;  5JVG 3;  2R93 B;  4RGO S;  5KYI A;  1PZJ D;  2VQE Q;  3HOZ G;  2HIX A;  4CDF C;  2K01 A;  3F1Z A;  1R4Q B;  1DD2 A;  2C9O A;  3PO3 G;  1FR3 A;  2RVL A;  2VZA A;  5L37 A;  5LHY 1;  2B2U C;  2B2V C;  2K1B A;  4JK1 C;  1HFG A;  2G9D A;  4A3K G;  1CHQ D;  4YCV A;  1B50 A;  4V19 0;  5E4W C;  3QOJ A;  3S1N H;  2TMP A;  3A7L A;  3W1G A;  4YIJ A;  1VQF A;  1PFN A;  3A7A B;  1YJW A;  1KL9 A;  3I4N B;  4KMU C;  2JXM B;  2VXW A;  3JAM c;  2B63 H;  1HA6 A;  2EJG C;  3A0J A;  1XPO A;  3HKZ E;  4A3B G;  5GAE C;  1JQY D;  4IUV A;  2ATW A;  1BCP D;  5IGF A;  3TN2 A;  1MGS A;  2EVB A;  5KIX A;  3TDQ A;  4H02 A;  3PCO B;  4RHR A;  3CXC A;  2OQ0 A;  1HZC A;  5HUR A;  4P2C B;  1EQR A;  1SLJ A;  4A3J G;  5C4X H;  2PNR C;  4PMB A;  3D31 A;  1PH1 A;  1F9Q A;  1NCV A;  2F3I A;  3MEF A;  1JB7 A;  4AH6 A;  2OF1 A;  1KNE A;  4E6I A;  1H9S B;  4RKL A;  3S2H H;  3Q23 A;  4XQQ A;  2EY2 A;  4F88 A;  2PW5 A;  5C0X J;  1S3O A;  3A8J E;  1N32 L;  3T13 A;  1Y8N B;  2IPK D;  3OW7 A;  2XN9 C;  1LTG D;  2UUB Q;  1XPR A;  3E9I A;  1D2B A;  3K8A A;  1F2L A;  5C5M A;  5LMN L;  2MJ8 A;  2VQF Q;  1UE7 A;  4HCS A;  2K75 A;  3FKI H;  3PUV A;  2E2D C;  3IFT A;  1IKL A;  4DR4 L;  4YWK A;  2PQE A;  2UXD L;  3MTS A;  5G3L F;  3BZK A;  3GO5 A;  4TQU S;  5H1S E;  5FLM G;  3OOC A;  1KLG D;  4DXG A;  3U9O A;  1D1K A;  2XVS A;  4JBK A;  1TR5 A;  4MTK A;  4DU9 A;  1AEX A;  4UPA A;  4DK1 A;  2A68 D;  1GUN A;  3BVM A;  2UXD Q;  4KK7 A;  4QUC A;  4DA2 A;  1PH6 A;  4B3S Q;  3S2D H;  5LL6 S;  5K36 G;  1U9R A;  4HIK A;  4A3E B;  2K7V A;  5J22 A;  1WTR A;  3R93 A;  2NVQ B;  1X55 A;  4GKK Q;  3RN2 A;  4NB3 A;  4K5W A;  1X56 A;  2N3S A;  2I07 B;  3PUW A;  3NPP A;  1GD7 A;  1I6H H;  2ZXR A;  3NUC A;  4ALP A;  4R4C A;  1N36 Q;  4FYD A;  4ZAI A;  3KF8 B;  4A76 A;  2KQ3 A;  2E2H H;  2EYO A;  2BDN A;  4A3G G;  1HNX L;  1F9R A;  4BY7 G;  2NZO A;  2V4D A;  3I70 A;  3PQI A;  5I6Y A;  2XNA C;  4OWT B;  4JBW A;  2LXK A;  1PYS B;  3KF8 A;  5FO7 B;  1SMY D;  4ZKC B;  3ULP A;  1D1I A;  2ZTE A;  2CW0 C;  1PYW D;  1HNX Q;  3OHX C;  1ILQ A;  2JA8 H;  2IJ0 A;  3K58 A;  3FKI G;  4DV7 Q;  1G8Z D;  3K5L A;  5ELD A;  4X64 Q;  2RCF A;  1BKB A;  1VQ9 A;  3S1R H;  3C1E A;  1IYJ B;  4GN5 A;  4C3I G;  2RKS A;  2X6G A;  3N6R A;  2WB1 G;  1SYC A;  1HHV A;  1B7Y B;  3ER0 A;  1JJG A;  2NTT A;  4IUU A;  4RKB A;  2VUM B;  1JE5 A;  2K5H A;  3SK5 A;  2KEN A;  1YHQ A;  4A93 G;  5FJ8 H;  1V9P A;  3DXJ C;  3EQL C;  3H3V C;  3A55 A;  3J7Z C;  5IYB H;  3GTG B;  1C8C A;  4JV5 Q;  4Y7N H;  4C3J B;  3C2P A;  1CHP D;  3RZO H;  4N8X 1;  1IBK Q;  1ET6 A;  4XDX A;  2XSC A;  1YNN D;  1S40 A;  1DOK A;  4IPD A;  2O4X A;  4YCU A;  1K28 A;  1HR0 L;  3DWP A;  5C5L A;  4DR3 Q;  4DV2 Q;  3V96 A;  5I9O A;  3GTP H;  3TZD A;  3PGZ A;  1C4Q A;  2AQ1 B;  1XMO Q;  1RTN A;  2EYF A;  2IWH A;  3CCU A;  3CRK C;  1BCP C;  1XXG A;  3OYY A;  5E1F A;  3U4Z A;  1HR0 Q;  1MSG A;  2HDL A;  2R93 H;  2EJM A;  1TT2 A;  4DFA A;  3H15 A;  2XWB B;  1GUS A;  5ISR A;  2R3Z A;  1I3Q B;  1E24 A;  2OWO A;  3PIO 3;  1Q1E A;  3FHW A;  1FVI A;  1CKO A;  5I6W A;  2UUA L;  4F87 A;  2A5H A;  5JVH 3;  4JI6 L;  2XIW A;  2BDO A;  4G4K A;  1M4V A;  4U68 A;  4DK3 C;  2R7F A;  3F2C A;  3BJU A;  3Q0A A;  4X6A H;  4IUN A;  5C4J H;  1BDO A;  1KAA A;  1LM0 A;  3BS1 A;  1TWC H;  2MHV A;  5CBA E;  5IGD A;  2JA5 B;  5M3M H;  1STE A;  4ILW A;  1PVO A;  3CF5 A;  3NBH B;  1FNV A;  1VQE A;  3DM1 A;  2M00 A;  2R7Z H;  1V1P B;  1DYQ A;  2RHS B;  2L11 A;  1LTS D;  3BVG A;  1SE8 A;  4X3S A;  3BG3 A;  1L0Y B;  1EYD A;  1HZ9 A;  4LMQ D;  4IFD G;  1QUQ B;  5M3F G;  4UHV A;  2EY5 A;  3GV3 A;  3NBH A;  5IOD A;  5IE8 A;  1EEF D;  1PRT D;  4DAY B;  1V1P A;  3OMC A;  2A68 C;  1AN8 A;  4R4I A;  4RGN A;  4AQY Q;  3Q6S A;  1VQN A;  5KNC A;  1Y1V G;  1JT8 A;  3A8K E;  3LX0 A;  4YCW A;  5IWA L;  2OXP A;  1QZH A;  2F0D A;  4HJ5 A;  2KCN A;  4QQB X;  3CU7 A;  1FYC A;  3NSW A;  4C2M B;  2N49 A;  3GQB A;  1ENF A;  2RCN A;  5C44 B;  1EU3 A;  4LFA L;  1IBL Q;  2A74 C;  4MIU A;  3CME A;  2GA4 B;  4JC0 A;  5IWA Q;  3BDO A;  3NEM A;  3URY A;  1G91 A;  1LTR D;  4TVA B;  3K0X A;  2EXZ A;  2JA6 B;  4LWC A;  2RSO A;  4LFA Q;  4P72 A;  3G71 A;  3IAY A;  5C0X H;  1EOV A;  4PQX A;  3RZD H;  3SGI A;  1SDF A;  3VYR A;  3X3N A;  4KJO A;  4OO1 I;  1LV9 A;  5F2D A;  4DUZ L;  1SMY C;  1Q90 A;  3GD7 A;  1SNO A;  1U0L A;  2QA4 A;  1EL0 A;  1E2Z A;  1MI2 A;  1A8V A;  4I7A A;  2K28 A;  1LT3 D;  2AHO B;  1AFP A;  1EY9 A;  1E3P A;  3T1H Q;  4NKL A;  5T1I A;  1VDZ A;  1GUW A;  4RA8 A;  4OGQ C;  5EBC A;  3U4V A;  1TU2 B;  3KDF B;  1I4R A;  1AH9 A;  5FKA C;  2YV5 A;  3UE1 A;  1P8L A;  3BDL A;  1L0X B;  4GNX A;  2F0E A;  1TS2 A;  5E4X A;  3BYY B;  5IP9 G;  4K14 A;  1IL2 A;  4PG3 A;  1STA A;  4K6D A;  1IYV A;  4LF9 L;  4BY1 B;  2QKI C;  2A8V A;  2Y0S G;  1B1Z A;  1I6V C;  3GDE A;  3CKI B;  4V0B A;  4JI0 Q;  2D0O A;  1G6P A;  1EYA A;  2VY3 A;  2FMC A;  5FO8 B;  3W5O A;  3HOZ B;  1VQC A;  1CZW A;  3ND9 A;  3KUP A;  4ZRZ A;  2FIN B;  1I4H A;  3PO3 B;  2EJF C;  2VUM H;  1II3 A;  1R4P B;  4A3K B;  2KOL A;  2EYH A;  2PCF B;  4DV4 Q;  3KBX A;  2IL8 A;  4R1J A;  1B4O A;  1BBU A;  3HOY G;  1WTW A;  2ZJQ A;  1EOT A;  1PTO C;  3MHB A;  1EYG A;  1KLU D;  3HEJ A;  4ZQ3 A;  3A5U A;  4QIW B;  3M4Q A;  1IBM L;  1L0W A;  2F0Q A;  1VQM A;  2I46 A;  2PMZ B;  4A3B B;  1LT6 D;  4A3C G;  1H95 A;  1HUN A;  3AQQ A;  4A3I H;  2H4O A;  4A3F H;  1PH2 A;  1LLR D;  5EPL A;  1R9T H;  4DR6 Q;  2DNE A;  4LFB Q;  3RR5 A;  3AEV A;  3R2I A;  1GHJ A;  4B9X A;  1I4G A;  5M5Y B;  3H91 A;  2ZM6 L;  2Z4I A;  4A3J B;  1TS4 A;  1I50 B;  2RBM A;  3K7A H;  3OMG A;  4UP7 A;  2JE6 I;  1MHW C;  1XPU A;  2WKC A;  4P75 A;  2FFK B;  4I65 A;  1S5B D;  3CQZ H;  4YY3 L;  2F4V L;  2ZM6 Q;  2IT1 A;  2I5L X;  2Z6B A;  5CC4 A;  2K05 A;  1V8Q A;  3QB3 A;  3SK8 A;  3T4A C;  1PRT C;  3PO2 H;  3QWN A;  3NWT A;  3GP7 A;  2KCM A;  3FPP A;  2K4K A;  5EPK A;  3G4S A;  4LUV A;  3E6Z X;  1B9M A;  5EKK A;  5I2X A;  1EQV A;  2D9U A;  5LMU L;  1YIJ A;  1B53 A;  4A3D B;  3J81 E;  1E2V A;  1NJI C;  3IFD A;  3LNN A;  1JC7 A;  4LAA A;  4UY8 C;  5KND A;  1TWF B;  4CJ2 C;  1X32 A;  4FXK C;  2EIF A;  4LW1 A;  1D6E C;  3J7A 5;  5EPJ A;  3K5M A;  3CD6 A;  1FJG L;  4ID6 A;  4B3R L;  4JYA Q;  5JAV A;  3GTK B;  1FD7 D;  4NXM L;  1J8I A;  5IP7 G;  4OX9 Q;  5D3I B;  3L2P A;  2ICI A;  2L12 A;  3CHB D;  2K5V A;  2VB2 X;  1FJG Q;  1K3R A;  1VQ4 A;  4HJ7 A;  5C44 H;  1C9O A;  4DUY Q;  1RJT A;  4A3G B;  3L7Z C;  1XMQ Q;  2QW7 A;  2G9H D;  1GUG A;  4NXM Q;  1MSH A;  2OQK A;  1SND A;  2CWP A;  2F0K A;  2PO4 A;  3R3O A;  4P71 A;  4XT3 B;  3H94 A;  1QE6 A;  3UI2 A;  1W6J A;  1JWS D;  1HXY D;  2ZJP A;  1DZ1 A;  3VYS A;  1CK1 A;  1DJR D;  1RIP A;  4JBM A;  2MPM A;  3MXP A;  5BN4 A;  3RUZ A;  1XWE A;  2M9V A;  1Q1B A;  1D7Q A;  1B9N A;  3PF5 A;  3ULJ A;  3D4W A;  2EOT A;  4IAL A;  3EA6 A;  2E2I B;  3J81 c;  1I4P A;  4C3I B;  2WB1 B;  3ERS X;  1SYG A;  4WRD A;  3S16 B;  3FEW X;  1YZ6 A;  5C3E G;  2D2C C;  2PNH A;  4IJL A;  3S9W A;  1RHP A;  4A93 B;  4GOP A;  3ZYY X;  1OXX K;  3CAM A;  2NVT H;  1SE2 A;  2B39 A;  1PTO B;  1RCV D;  3MXN B;  4B3M Q;  1Z9F A;  1D5Z C;  4OL7 A;  1MBY A;  1JIC A;  4NXN L;  4C3H H;  5EKL A;  4TKO B;  3TP6 A;  4PZ8 A;  1SYD A;  1EY0 A;  1HUM A;  4R4Q A;  3STB D;  3NBI A;  3NEL A;  3I56 A;  1K9M C;  1E22 A;  3U58 A;  1HPC A;  1PH8 A;  3MXN A;  2RSN A;  1RF2 D;  4NXN Q;  3BDC A;  3H0G G;  1WTH A;  4KN4 C;  3S14 B;  5AJ3 L;  4LF6 L;  1O80 A;  3VR5 A;  2Q8I B;  1PFB A;  1MKH A;  3GTO B;  2I0Q A;  1LAB A;  2B2Y C;  1KC8 C;  4K2L A;  3KYH C;  3RD4 A;  3AYH B;  3AMU A;  1Z47 A;  4FF1 A;  1E1T A;  3I4M G;  5T1G A;  3Q24 A;  2R92 H;  3HOW H;  3F8T A;  4F7X A;  4EQ5 A;  3OW2 A;  1U4M A;  2UXC L;  3J7A F;  1V1Q A;  4X3U A;  1DXM A;  1QNU A;  1IHZ A;  2PQA B;  4WJW A;  1L1O C;  4JW0 A;  1HFN A;  3IL8 A;  1FNU A;  4APV A;  1LTL A;  2F0O A;  4FF4 A;  5A2Q L;  3F2U A;  1Q46 A;  5M5Y H;  1WCM H;  3HKS A;  4FP5 D;  3HOU H;  1K8G A;  1TKW B;  4CKB A;  1N9W A;  5M3F B;  3HFZ B;  3GTL B;  5IYC G;  1SRU A;  1UAP A;  2Q2H A;  1QNK A;  1BCP F;  1ZYR C;  4FNF A;  1QCB D;  2L5T A;  1SAP A;  4GKJ Q;  4RCO A;  1YJN A;  1AP0 A;  1DGS A;  1UEA B;  1BNZ A;  4KD4 A;  1STY A;  1UE5 A;  5EGT A;  4O1N A;  1HQR D;  2ZTD A;  1Y14 B;  1WYD A;  1EWH A;  1GJX A;  5IGG A;  4OO1 G;  4DV1 L;  2NBF A;  4QF4 A;  3T53 B;  1Q7Y C;  3K6O A;  4DKA C;  4H7B A;  1EFI D;  3I73 A;  1SNQ A;  3T56 B;  1TY2 A;  4G7H C;  1ENA A;  5C0X I;  4GLV B;  3BU2 A;  5JEA G;  4A3D H;  4JOI C;  4DV1 Q;  4RMF A;  3K59 A;  2KJX A;  1D8L A;  3A74 A;  1I4Q A;  5E7N A;  4A3M G;  4L5T A;  5KNB A;  2DY7 A;  3GTQ H;  1PZK D;  3GTJ H;  2G5D A;  3NQI A;  3OWF A;  3TP5 A;  1LTT D;  3NTK A;  2K5W A;  1F2M A;  1Q3L A;  1UUP A;  1KDB A;  3GTK H;  5ELN A;  1K0S A;  1UE1 A;  1BR9 A;  2XTI A;  4JBJ A;  2YTY A;  1CA6 A;  5IYD G;  1T9H A;  4XIG S;  1H9S A;  3PUY A;  4KD3 A;  2DJG C;  2IX1 A;  1N32 Q;  1QVG A;  4IPH A;  1ASZ A;  1JOR A;  3PF4 A;  2ENB A;  3UDI A;  4ZYS A;  5LMN Q;  1T5X D;  3M9B A;  4LUO A;  2LKV A;  4L5S A;  5I2Y A;  4DR4 Q;  1Q12 A;  3J80 L;  3IKJ A;  2D62 A;  3D8G A;  3MXU A;  4HN7 A;  1CTM A;  2NN6 I;  2ZXO A;  1MD2 D;  2Y0S B;  4CJ0 B;  2RHQ B;  2A6E D;  2IHE A;  1CQV A;  4BBS B;  1G2T A;  4WOR A;  1TWA B;  2E2I H;  3M4O B;  2B63 G;  3HOV B;  2NVX B;  1LTB D;  5M9O A;  3KBG A;  3STB C;  5KEE A;  4XYO A;  1SSO A;  3I55 A;  1W3S A;  3PIO A;  1WTV A;  4LK1 C;  5KYL A;  3OIQ A;  4IPC A;  1EQQ A;  1HR0 W;  1EFW A;  1B8A A;  2RDH A;  3NQT A;  1Y1W H;  1VQK A;  3S15 H;  4A3L H;  4GLA C;  1JCK B;  4WJ3 M;  1TXY A;  2A19 A;  2GVA A;  4XYQ A;  5C4X G;  5COY A;  3CCR A;  1RL2 A;  5M5W B;  2NUC A;  3H09 A;  5G3L D;  4BBR B;  5EAY A;  3AU7 A;  5D14 A;  3JAM L;  1AZQ A;  1EY5 A;  1GKH A;  2EE1 A;  4ABN A;  3FDT A;  2EYP A;  2A73 B;  2E8G A;  4BXX H;  3CCV A;  3S14 H;  4KI0 A;  1YIT A;  1GXD C;  3F2D A;  1SNC A;  4R8I A;  1SN8 A;  1STH A;  1ROD A;  2UUC L;  1O7Y A;  2H5X A;  4PMW A;  3K5O A;  4EQN A;  2AQ3 B;  1PMR A;  1K8M A;  2CQA A;  3ONA B;  2B2T A;  1HCZ A;  1GM5 A;  1C48 A;  2E75 C;  1CI3 M;  2F0V A;  1PTO F;  2UUC Q;  5IGE A;  2DJF C;  4GNX C;  1STN A;  2B2U A;  3R2T A;  2ALY B;  4J6H A;  2R61 A;  1FGB D;  5JJI A;  1L2F A;  2B29 A;  3GTM B;  4XT1 B;  1VF7 A;  3LGJ A;  5FLX E;  3S17 H;  1VQH A;  5CV7 A;  1PDQ A;  2SOB A;  4GLX A;  2N8N A;  3U50 C;  2K5Q A;  5JJL A;  3HRZ C;  1IKM A;  2EY6 A;  2BCO A;  2A1A A;  2JA8 G;  4DN4 M;  2Q8R E;  4H44 C;  4I7Z C;  2L1B A;  4DR5 L;  1PV4 A;  3I4N H;  2F0F A;  4WJ4 A;  1FL0 A;  4POG A;  4R8N A;  2UUA Q;  1SEB D;  3T16 A;  4JI6 Q;  1ESF A;  1TS3 A;  4R9W A;  1EY4 A;  1PH5 A;  1SMX A;  4CKE A;  5M5X B;  2O5J C;  3HGB A;  3P7J A;  2KUM A;  3TME A;  3DWA A;  4KKU A;  5BR8 L;  1VMC A;  2O2L D;  2X6L A;  4HJA A;  5FJ8 G;  1Q8I A;  4LUZ A;  3ERQ A;  5IYB G;  1N34 L;  1ASY A;  4S3S A;  2L55 A;  3QJY A;  1EWC A;  2LFN A;  3DMU A;  1JE4 A;  2P5Z X;  1SYB A;  1BQQ T;  2JA7 B;  3TQY A;  3KJO A;  1GUT A;  3UDF A;  2Z9H A;  5FLX c;  5C3E B;  1N34 Q;  2IHF A;  1E1O A;  1F77 A;  2A6E C;  5GAD C;  1SR3 A;  4HAE A;  1QUQ A;  2B8F A;  3ERO A;  1PHJ A;  1X3G A;  4DAY A;  4P74 A;  1CZG A;  4CHT B;  2R93 G;  1J9O A;  1A3V A;  5CYU A;  1H9R A;  2MO1 A;  1VMP A;  2L9H A;  1VQG A;  4LF5 L;  4HSP A;  2F0H A;  1EIG A;  4DGZ A;  3P1H A;  1A63 A;  4LF7 L;  1K8A C;  1KQS A;  5EJW A;  2JN4 A;  4KY7 A;  4X65 L;  3M3Y B;  2LXJ A;  4WFN 3;  2HQL A;  3H0G B;  1QB5 D;  4MZ9 A;  2E74 C;  4BBS H;  1STB A;  4J1M A;  1K83 B;  4A3E H;  2YU9 B;  2QDL A;  3A8I E;  4QIW E;  3HOV H;  1MJE A;  2NVQ H;  2CQO A;  1TII D;  4H0L C;  5M3M G;  2PMZ E;  4QUF A;  4OWW B;  1TQO A;  4C1N I;  3DLL A;  4DV6 L;  1OXS C;  1TWG B;  2BA0 A;  2R7Z G;  3VR4 A;  1IW7 D;  1SE4 A;  1YNJ D;  2A69 D;  4DUZ Q;  3I4M B;  1CUK A;  2CVR A;  2K03 A;  3MXG A;  4K8I A;  4NP5 A;  3W2D A;  3KLS A;  1XTC D;  3HOX B;  4DV6 Q;  5HGQ A;  1SBB B;  2SDF A;  1ZXT A;  1XNQ L;  1HNW L;  5GQO A;  1SNP A;  3ITP A;  4Q5V A;  3VYT A;  3VDY A;  3DUZ A;  3KK7 A;  1H9K A;  4IUQ A;  3KDF A;  3SDZ A;  1EZ6 A;  1FNW A;  2NN6 H;  1YNN C;  1BVS A;  4QL5 A;  1BCP B;  4IUP A;  4DR2 L;  3DWQ A;  1I94 L;  4LF9 Q;  3FVQ A;  1NE3 A;  4DAP A;  3QIA A;  2NVY B;  1Z6H A;  5FK9 C;  5C0X G;  1JOQ A;  4RH6 A;  4KV6 A;  3J80 i;  2NWG A;  3E0J A;  2AQ2 B;  5FLX L;  2QGQ A;  2ES2 A;  2I5M X;  5IT9 E;  1SJH D;  1D5M C;  3AB9 A;  3GTG H;  1C0A A;  4C3J H;  4HCE A;  2RQX A;  4PV1 C;  1KHI A;  3HKZ G;  1M8A A;  2LSS A;  3HS0 C;  1VQA A;  4OHJ A;  4DV5 L;  2PZW A;  2N88 A;  3S1M B;  1NNX A;  4DR1 L;  1PH9 A;  1IBM Q;  4BA2 I;  1DOM A;  1EYC A;  4XTC S;  4K0K L;  4A3M B;  4CDD C;  1ONL A;  1S5F D;  4JVZ A;  2AWO A;  4EX5 A;  3C1F A;  1WTO A;  3HP3 A;  1BXT A;  4ZUJ A;  3G6E A;  5CGK A;  1I3Q H;  3JAM i;  2F1M A;  2Z6K C;  4CKC A;  4K0K Q;  3S1Q B;  4TRD A;  3TS0 A;  3H6M A;  2AMC B;  4PZ7 A;  3NWS A;  3PIP 3;  5CV8 A;  4YY3 Q;  3V2T A;  2ZTC A;  2F4V Q;  4MNO A;  4HJ9 A;  2KHJ A;  1Y69 U;  1KDA A;  3RLO A;  2EYL A;  3RMH A;  5GAH C;  2WB1 E;  5M5X H;  2JA5 H;  3P75 A;  5IT9 c;  2CH4 W;  1VQ7 A;  2VUM G;  4CBV A;  2B8G A;  3SE0 A;  1FGU A;  1EEI D;  3SK6 A;  1RTO A;  5J3B A;  3S1N B;  4LNQ A;  1XNR L;  5KRU A;  3MC0 B;  2CH4 A;  4EGV A;  3VA7 A;  3IRB A;  5LMU Q;  2HCI A;  3I3C A;  2B63 B;  2F0T A;  5CR3 A;  4OWX B;  1KIX A;  4A3I G;  3Q22 A;  4JI5 L;  4A3F G;  5DM6 3;  1LO5 D;  2C5C A;  2JEA I;  2RDG A;  1SRO A;  1GOZ A;  4C2M H;  3LWU A;  3T1Y L;  1QWY A;  1S5D D;  1SYF A;  5NUC A;  4X66 L;  4JI3 L;  2MO0 A;  2I5H A;  5DM7 3;  3TP7 A;  4B3R Q;  5C4X B;  1QIL A;  4BY7 B;  3VR6 A;  4IUT A;  2Z0S A;  3S2H B;  1IW7 C;  1A0I A;  1CKN B;  2A69 C;  1N33 L;  1ESR A;  1PYB A;  3D0F A;  1H9M A;  1NAP A;  4IOA A;  2JA6 H;  4JI3 Q;  4H13 C;  2N78 A;  4GS3 A;  1Q81 C;  4C1N K;  2SNS A;  4EVO A;  1STG A;  3FKI B;  1LT5 D;  3WOF A;  1EIY B;  3PO2 G;  1CKN A;  3CCJ A;  1MJC A;  2CWA A;  2HCC A;  3EVQ A;  2MUY A;  2K5N A;  1J5E L;  3L3O C;  3L9A X;  1LTA D;  4YHH L;  3B6Y A;  1N8R C;  2FXQ A;  1H9J A;  4KN7 C;  3EFX D;  3JC6 6;  3S2D B;  3M85 A;  2F0M A;  4O42 A;  3H3V H;  2XRS D;  1VQB A;  3HOX H;  2SNM A;  1NSN S;  4IQZ A;  3UE0 A;  4KHP L;  4LF8 L;  2B3G A;  4DXF A;  3I4L A;  3CRL C;  4K2K A;  2F0J A;  2BOS A;  4DNI A;  1KTK A;  1KRT A;  1I6H B;  1LT4 D;  2F0S A;  2RA4 A;  1Q8K A;  2VL6 A;  4BY1 H;  1G51 A;  2O5I C;  5C44 G;  4RGM A;  3J7A V;  2E2H B;  1KD1 C;  2WII B;  4KY5 A;  4JI2 L;  3NEN A;  4KHV A;  1G6Z A;  1TS5 A;  4O2D A;  1RD9 D;  1ZKO A;  1RKN A;  2HD3 A;  4Q0F A;  2IY5 B;  4K8J A;  3HOZ H;  1PXU A;  1VCI A;  1A6X A;  1WD1 A;  3PO3 H;  1UEB A;  4FF3 A;  2K14 A;  4JI2 Q;  2RF4 A;  5GAG C;  5AJ3 Q;  4A3K H;  4LF6 Q;  2YYZ A;  2JA8 B;  3O13 A;  4JI4 L;  5CV9 A;  1ET9 A;  4A75 A;  3MVV A;  1X3P A;  3E3X A;  4LFC L;  1VQL A;  3S1R B;  3X3M A;  1IL8 A;  1PRT B;  5JPN C;  1PFS A;  1WD0 A;  2JK8 A;  4JG2 A;  3E5S A;  4A3B H;  1PH7 A;  4HJ8 A;  4R4O A;  1KNA A;  1KXL A;  4JI4 Q;  1YJ9 A;  4X62 L;  2JA9 A;  4LFC Q;  3CCQ A;  4QB4 A;  1HNZ L;  2NTS A;  4O0A A;  1W2B A;  2F03 A;  3S1M H;  1KRS A;  1V43 A;  1PA6 A;  2OEO A;  4M1U B;  2UXC Q;  2BE5 D;  1XTD A;  2EZV A;  4ZLT F;  4DF7 A;  2F0U A;  4A3J H;  5LMN W;  1I50 H;  2EYJ A;  2EXD A;  3RZO B;  2PQA A;  5ELC A;  2D0P A;  2E5L L;  4C3H G;  5ELE A;  4EQO A;  2LS0 1;  5GRO A;  4XQN A;  3PUX A;  3J81 L;  1Y1V B;  2OT2 A;  2BH2 A;  3GTP B;  1JJ2 A;  5HGT A;  2ASB A;  2ZXP A;  2Y0S E;  4IJH A;  3PV0 A;  4AYB G;  3CPW A;  1HJP A;  3K0Y A;  1P16 A;  3KLR A;  3NHH A;  1SE3 A;  4M8A A;  1O7Z A;  3MA2 B;  5DEH A;  1IZ6 A;  2QF7 A;  2WAQ G;  5FLM H;  4J8Q A;  4B3T L;  1O7I A;  2ZT9 C;  3P20 A;  4RAU C;  5C3X A;  2PI2 A;  1C7Y A;  3L0O A;  2X69 A;  4BA1 I;  1VQ5 A;  1BUV T;  1M1K C;  1TWF H;  2J0T D;  2R92 G;  2KA7 A;  2L15 A;  4B3T Q;  5JJZ A;  3HOW G;  3KLW A;  4B08 A;  4QGU A;  4RFB A;  5K36 H;  3CC4 A;  1QOH A;  5FO9 B;  5C4J B;  2KCC A;  3I4O A;  5ELB A;  1DON A;  1TWC B;  3CP0 A;  4TSS A;  4FXD A;  5M3M B;  4MN3 A;  3RNU A;  1CA5 A;  1K8O A;  4HIM A;  1G2S A;  2R7Z B;  1B70 B;  3EIV A;  2WIN B;  2PYK A;  2JSO A;  1TWH B;  2QIL A;  3CMA A;  1WCM G;  2UXB L;  1BO0 A;  3HOU G;  2EQS A;  4QJF A;  1E7Z A;  2UUB L;  4A3G H;  2RDF A;  4BY7 H;  1E2W A;  3EN2 A;  2VQF L;  1GUO A;  1JMC A;  1EIF A;  3D3R A;  3N52 A;  4MTN A;  1CM9 A;  4IZ8 A;  1G29 1;  2UXB Q;  4QY7 A;  2UU9 L;  4HR7 B;  2VS1 A;  1V1O A;  1PLF A;  1CT1 D;  3M7N A;  4ME5 A;  3G6J B;  1UWV A;  1VS0 A;  2OTL A;  2MNA A;  4FO2 A;  1QVC A;  3BZD B;  4N9T A;  3D4R A;  5CV6 A;  2WP8 J;  2F0L A;  3R8B A;  2UU9 Q;  3TBI B;  3F2B A;  3CCM A;  4C3I H;  4B3S L;  2E76 C;  2IX3 A;  4K5V A;  3S16 H;  4GN4 B;  2OCE A;  3MFY A;  2HQE A;  2HT1 A;  4A3D G;  1EWI A;  1YI2 A;  3RZD B;  5CV5 A;  4KY6 A;  4A93 H;  4GKK L;  3VA5 A;  1A2U A;  2HIV A;  3HOY B;  4KKS A;  1WFQ A;  3BYT B;  1N36 L;  1PTO H;  3UDX A;  4ULL A;  1F2Y A;  4K6L A;  3HKZ B;  2B2Y A;  1I4X A;  4R4T A;  1Y8P B;  1EZ8 A;  1X9N A;  1EU4 A;  2M2L A;  4DPG A;  3ICE A;  1JOO A;  2TSS A;  4OIK A;  1O78 A;  1L1O B;  1GO3 E;  5C3W A;  1JJC B;  1SJE D;  2JQO A;  5AFW A;  1TY0 A;  3E9H A;  1EY8 A;  2OTJ A;  1DCZ A;  2K6A A;  1NBW A;  2VNU D;  4RGT A;  5LL6 X;  4DV7 L;  3GTO H;  1L1O A;  2XRQ D;  4LJZ C;  1CSP A;  4X64 L;  2NB0 A;  4C56 C;  2ICE C;  4X3T A;  3W1B A;  1D5X C;  2BE5 C;  4B9W A;  3W3A A;  2F3W A;  1NUC A;  4ME3 A;  1NR2 A;  2B2W A;  1BBX C;  4KTA A;  3CW2 C;  3ULL A;  5JPM C;  4L5Q A;  1HTL D;  5C4Z A;  1HZA A;  3U9S A;  1WTQ A;  3VYU A;  3CCE A;  2WFW A;  1TVX A;  5EQ0 A;  2K32 A;  3MZ5 A;  4JV5 L;  1WJJ A;  4UAI A;  3S24 A;  2AUJ D;  2B2V A;  2ID0 A;  1DM0 B;  5IGB A;  1IBK L;  1S4Z A;  1CSQ A;  2NZH A;  4IUR A;  1Y1W G;  4A3L G;  4G7O C;  2BH8 A;  4ODG A;  1WOC A;  4DR3 L;  4IFD H; 
#chains in the Genus database with same CATH homology
 3HKZ E;  3KDF A;  2ZJP A;  4DV2 L;  5GAE C;  5M3F H;  3GTL H;  2ATW A;  2R6G A;  1RIP A;  4NPS A;  4JBM A;  3J81 j;  1XMO L;  2HHH L;  1BVS A;  1A62 A;  4QL5 A;  4H02 A;  3PCO B;  1Q1B A;  4OXP A;  1D7Q A;  3CXC A;  4JOI A;  2OQ0 A;  4DR2 L;  3PF5 A;  1HZC A;  3ULJ A;  1GVP A;  1I94 L;  4LF9 Q;  3E0E A;  1EQR A;  1Y1V H;  1SLJ A;  3J81 c;  1NE3 A;  4A3B G;  4A3J G;  2GVB A;  1NY4 A;  2Q2T A;  5C4X H;  1X54 A;  3D31 A;  5C0X G;  2F3I A;  3ERS X;  3MEF A;  1PH1 A;  1JB7 A;  2HHH Q;  4AH6 A;  4BXX G;  3J80 i;  1YZ6 A;  5C3E G;  3S2H H;  2PNH A;  2QGQ A;  2ES2 A;  4IJL A;  2DUD A;  1S3O A;  2I5M X;  5C0X J;  1N32 L;  3GTG H;  2MQH A;  4GOP A;  2K50 A;  2UUB Q;  3I4M G;  1C0A A;  1K0R A;  3E9I A;  1OXX K;  3CAM A;  4C3J H;  1XPR A;  2NVT H;  1KHI A;  3K8A A;  3HKZ G;  2LSS A;  5LMN L;  2VQF Q;  1UE7 A;  2V1C C;  3MXN B;  4DR5 Q;  4B3M Q;  1VQA A;  1Z9F A;  2K75 A;  3FKI H;  3PUV A;  4DV5 L;  4DR4 L;  3KFU A;  1AE3 A;  4NXN L;  4C3H H;  4YWK A;  1X6O A;  2KHI A;  4DR1 L;  1PH9 A;  2UXD L;  4PZ8 A;  3BZK A;  3GO5 A;  4TQU S;  5H1S E;  1IBM Q;  4BA2 I;  5FLM G;  3RLF A;  4R4Q A;  3STB D;  3NEL A;  4XTC S;  3I56 A;  1YNX A;  1E22 A;  5BR8 Q;  1K73 C;  1K9M C;  3U58 A;  4JBK A;  4K0K L;  1YVC A;  1PH8 A;  4NXN Q;  4UPA A;  3H0G G;  3TEH B;  2AWO A;  4EX5 A;  2UXD Q;  1PH6 A;  5AJ3 L;  4LF6 L;  2K52 A;  4B3S Q;  3S2D H;  3G6E A;  3Q8D A;  1I3Q H;  1NMF A;  3JAM i;  1MKH A;  1TWH H;  2Z6K C;  2I0Q A;  4JI7 L;  5K36 G;  3H3V I;  4HIK A;  4K0K Q;  4AQY L;  3TS0 A;  1VQP A;  1KC8 C;  3KYH C;  4DV0 L;  1X55 A;  3AYH B;  4GKK Q;  2AMC B;  3RN2 A;  1Z47 A;  4J15 A;  1E1T A;  4NB3 A;  1S72 A;  4PZ7 A;  1X56 A;  2N3S A;  1WI5 A;  3PUW A;  3TRE A;  4POF A;  1GD7 A;  4YY3 Q;  2VW9 A;  4DR7 L;  2ZTC A;  1IBL L;  4ALP A;  2C35 B;  4R4C A;  4KHZ A;  5IP9 H;  1N36 Q;  4JI7 Q;  2F4V Q;  2R92 H;  1VQ6 A;  3HOW H;  3F8T A;  4MNO A;  3J81 i;  3KF8 B;  4HJ9 A;  2KHJ A;  4A76 A;  4EQ5 A;  3OW2 A;  1I6H H;  3RLO A;  5GAH C;  2JA5 H;  2WB1 E;  5M5X H;  4DV0 Q;  2E2H H;  4Y52 H;  2CFM A;  5IT9 c;  2UXC L;  3KF6 B;  4A3G G;  1VQ7 A;  1V1Q A;  1HNX L;  1OXV A;  4BY7 G;  2NZO A;  2VUM G;  4DR7 Q;  3AFQ A;  2PQA B;  1FGU A;  1L1O C;  3I4N G;  2GN5 A;  4LF5 Q;  5J3B A;  4AYB E;  1TWA H;  3CC2 A;  4LNQ A;  1XNR L;  4OWT B;  4APV A;  4JBW A;  3M4O H;  2LXK A;  4HID A;  2R7D A;  1LTL A;  1PYS B;  3ULP A;  2NVX H;  1Q46 A;  4LF7 Q;  2ZTE A;  5M5Y H;  1WCM H;  3HKS A;  3IRB A;  5LMU Q;  2WAQ E;  3HOU H;  4X65 Q;  1BBW A;  2XGT A;  1K8G A;  1HNX Q;  3KF6 A;  4GKJ L;  1N9W A;  3WWV A;  4OWX B;  3HFZ B;  2JA8 H;  5IYC G;  2Q2H A;  1SRU A;  1KIX A;  3FKI G;  3TS2 A;  4DV7 Q;  4A3I G;  4JI5 L;  4A3F G;  4LF4 L;  3CCS A;  4X64 Q;  1BKB A;  1VQ9 A;  3S1R H;  4FDB A;  5ELO A;  1NMG A;  1IYJ B;  3TRZ A;  3HOY H;  2JEA I;  4GN5 A;  4GKJ Q;  3KOJ A;  1SRO A;  1M90 C;  1YJN A;  4C2M H;  2WB1 G;  3PIP A;  3T1Y L;  1DGS A;  3T1H L;  5M5W H;  4X66 L;  4JI3 L;  2MO0 A;  1B7Y B;  1UE5 A;  3ER0 A;  2I5H A;  2YTX A;  4B3R Q;  4LF4 Q;  2ZTD A;  1JJG A;  4A3C H;  2AKW B;  4BBR H;  1JE5 A;  2K5H A;  1Y14 B;  1WYD A;  2Z0S A;  3ZJY C;  2KEN A;  1YHQ A;  4A93 G;  5FJ8 H;  4GNX B;  1A0I A;  1CKN B;  1V9P A;  1VQJ A;  4OO1 G;  1N33 L;  4DV1 L;  1PYB A;  1QVF A;  3J7Z C;  5IYB H;  3D0F A;  1Q7Y C;  4IOA A;  1OXT A;  1UE6 A;  3UDG A;  4DKA C;  2JA6 H;  2IX0 A;  4JI3 Q;  4JV5 Q;  4Y7N H;  2N78 A;  3RZO H;  4GS3 A;  1XNQ Q;  5C0X I;  1Q81 C;  3CCL A;  4GLV B;  1PH3 A;  1IBK Q;  1HNW Q;  3BU2 A;  1S40 A;  1J6Q A;  5JEA G;  4IPD A;  1VQO A;  4JOI C;  4YCU A;  4A3D H;  2DGY A;  1EIY B;  3PO2 G;  4DV1 Q;  1HR0 L;  1CKN A;  4RMF A;  1OXU A;  4DR3 Q;  1D8L A;  3A74 A;  3CCJ A;  4DV2 Q;  4JI0 L;  3GTP H;  1MJC A;  5JEA J;  5E7N A;  4A3M G;  2CWA A;  3PGZ A;  4L5T A;  3RN5 A;  1XMO Q;  2K5N A;  3GTQ H;  1J5E L;  1X3F A;  3CCU A;  4YHH L;  3B6Y A;  3OYY A;  3U4Z A;  3GTJ H;  4DR2 Q;  1HR0 Q;  1N8R C;  1I94 Q;  2R93 H;  4GOP C;  2FXQ A;  4BBS G;  3GTK H;  5ELN A;  3H15 A;  4A3E G;  1NTG A;  3JC6 6;  4DV4 L;  3M85 A;  1UE1 A;  3HOV G;  1E24 A;  1VQI A;  2MFI A;  2XTI A;  2JEB I;  2YTY A;  1Q1E A;  4JBJ A;  1VQB A;  1FVI A;  3FHW A;  1T9H A;  1CKO A;  4XIG S;  5IYD G;  3HOX H;  1XPO A;  2UUA L;  2KCT A;  3UE0 A;  4KHP L;  4JI6 L;  3PUY A;  4LF8 L;  2B3G A;  5DLQ E;  2IX1 A;  1MIU A;  1QVG A;  1N32 Q;  4IPH A;  1ASZ A;  4DNI A;  3PF4 A;  1KRT A;  4DK3 C;  2R7F A;  3GTM H;  3UDI A;  3F2C A;  1VQ8 A;  3BJU A;  1Q8K A;  4DR6 L;  4LFB L;  5C4J H;  5LMN Q;  4X6A H;  1LM0 A;  2VL6 A;  3M9B A;  4BY1 H;  4LUO A;  3CPF A;  4IO9 A;  3DM3 A;  1TWC H;  1G51 A;  5M3M H;  5C44 G;  4DV5 Q;  4L5S A;  4DR4 Q;  2E2J H;  1Q12 A;  1KD1 C;  1PVO A;  1I5F A;  3CF5 A;  3NBH B;  2D62 A;  1VQE A;  4JI2 L;  4DR1 Q;  3H3V H;  2NN6 I;  2R7Z H;  4BBR G;  3NEN A;  2RHS B;  3M4P A;  2RHQ B;  4YWL A;  2IHE A;  4O2D A;  3PSI A;  1SE8 A;  3RLN A;  1YHB A;  5IP7 H;  2IY5 B;  2E2I H;  3HOZ H;  2B63 G;  1HZ9 A;  1VCI A;  4IFD G;  1QUQ B;  5M3F G;  1OTC A;  3STB C;  3PO3 H;  1UEB A;  2K14 A;  4JI2 Q;  4AIM A;  2JJQ A;  2RF4 A;  3PUZ A;  3I55 A;  2NN6 G;  5GAG C;  5AJ3 Q;  4A3K H;  4LF6 Q;  2YYZ A;  5IE8 A;  1W3S A;  4DAY B;  1LYL A;  3PIO A;  4JI4 L;  4UP9 A;  4DK6 C;  4A75 A;  4R4I A;  4IPC A;  4LFC L;  2ZJR A;  1XJV A;  1EQQ A;  1B8A A;  4AQY Q;  1Y1W H;  1HR0 W;  1EFW A;  1VQL A;  1VQK A;  1VQN A;  3S15 H;  4A3L H;  1Y1V G;  1JT8 A;  1PFS A;  4GLA C;  4WJ3 M;  4YCW A;  5IWA L;  1TXY A;  2JK8 A;  2A19 A;  2GVA A;  4HJ5 A;  1QZH A;  4JG2 A;  4QQB X;  5C4X G;  2N49 A;  3CCR A;  2KBN A;  1RL2 A;  2RCN A;  1PH7 A;  4A3B H;  4HJ8 A;  4R4O A;  4LFA L;  1KXL A;  4JI4 Q;  2YTV A;  1YJ9 A;  4X62 L;  1IBL Q;  4JI8 L;  2CKZ B;  2JA9 A;  4LFC Q;  3CCQ A;  3CME A;  1HNZ L;  4O0A A;  1W2B A;  5EAY A;  3S1M H;  1KRS A;  1V43 A;  1PA6 A;  1YEZ A;  1Q86 C;  4JC0 A;  5IWA Q;  3NEM A;  2UXC Q;  1XTD A;  4TVA B;  1GKH A;  3K0X A;  4A3J H;  4LWC A;  2JA7 H;  4LFA Q;  5LMN W;  1I50 H;  4P72 A;  3G71 A;  2EXD A;  2F52 A;  2E8G A;  4KLK A;  1EOV A;  2PQA A;  2D0P A;  4JI8 Q;  4BXX H;  3CCV A;  3RZD H;  4DAM A;  2E5L L;  3SGI A;  1XNR Q;  5C3E H;  3S14 H;  4KI0 A;  1YIT A;  1YBY A;  5GRO A;  4OO1 I;  3PUX A;  3F2D A;  4JYA L;  4DUZ L;  1SN8 A;  4OX9 L;  2BH2 A;  1JJ2 A;  3K81 C;  4L5R C;  4HIO A;  2ASB A;  4YWM A;  3GD7 A;  1Q82 C;  4JI5 Q;  3K7U C;  2UUC L;  1U0L A;  2QA4 A;  3OTO L;  2H5X A;  4PMW A;  2Y0S E;  1A8V A;  4IJH A;  4JCV E;  3PV0 A;  4DUY L;  4AYB G;  3CPW A;  1HJP A;  1KAW A;  2AHO B;  1XMQ L;  1P16 A;  3AFP A;  5IY0 A;  3T1Y Q;  1GM5 A;  1E3P A;  3T1H Q;  4X66 Q;  1IZ6 A;  4B3T L;  2WAQ G;  5FLM H;  1O7I A;  4P73 A;  2UUC Q;  2PI2 A;  1C7Y A;  3U4V A;  3OTO Q;  5JJK A;  3KDF B;  3M3Y H;  1AH9 A;  2YV5 A;  3L0O A;  3UE1 A;  1YHA A;  4IPG A;  4GNX C;  4BA1 I;  1P8L A;  5HY6 A;  3H0G H;  1N33 Q;  4GNX A;  1VQ5 A;  2ALY B;  1M1K C;  1TWF H;  1SFO H;  1K83 H;  5IP9 G;  2YU9 H;  5JJI A;  2R92 G;  2L15 A;  1L2F A;  4B3T Q;  3HOW G;  1IL2 A;  4PG3 A;  3KLW A;  4QGU A;  2B29 A;  3I7F A;  3CC4 A;  2JA5 G;  3CC7 A;  1AE2 A;  4LF9 L;  3I4O A;  3LGJ A;  3CP0 A;  3S17 H;  1TWG H;  1VQH A;  2A8V A;  3RNU A;  1X3E A;  2Y0S G;  4HIM A;  2Q2I A;  3I4M H;  3GDE A;  4JI0 Q;  2D0O A;  4UP8 A;  1G6P A;  1B70 B;  4GLX A;  2N8N A;  3EIV A;  2VY3 A;  3U50 C;  3CMA A;  1J5E Q;  1WCM G;  3W5O A;  4GOP B;  2UXB L;  5JJL A;  3HOU G;  1VQC A;  2EQS A;  4QJF A;  1E7Z A;  4YHH Q;  1PH4 A;  2UUB L;  2JA7 G;  2A1A A;  4A3G H;  2JA8 G;  1IXR A;  4BY7 H;  2VUM H;  3EN2 A;  2VQF L;  1JMC A;  4DR5 L;  1EIF A;  4DV4 Q;  1PV4 A;  4B3M L;  3I4N H;  1HH2 P;  4R1J A;  4MTN A;  1BBU A;  3HOY G;  4WJ4 A;  1G29 1;  2ZJQ A;  1FL0 A;  2UXB Q;  4QY7 A;  4POG A;  2UUA Q;  1EYG A;  4KHP Q;  2UU9 L;  2PI2 E;  4JI6 Q;  4IFD I;  1PH5 A;  4LF8 Q;  1SMX A;  2VS1 A;  3FP9 A;  3A5U A;  1IBM L;  3M4Q A;  3M7N A;  1L0W A;  1UWV A;  1VS0 A;  1VQM A;  2OTL A;  2MNA A;  4A3C G;  1H95 A;  5IYC H;  1QVC A;  5BR8 L;  3AQQ A;  4A3I H;  2WP8 J;  4A3F H;  1PH2 A;  1R9T H;  4HJA A;  4LFB Q;  5FJ8 G;  4DR6 Q;  4LUZ A;  3RR5 A;  3A5Z B;  3AEV A;  1CKM A;  5IYB G;  2UU9 Q;  2AWN A;  3EBE A;  1N34 L;  1ASY A;  2JA6 G;  3F2B A;  3CCM A;  4C3I H;  4B3S L;  2NVY H;  4DV3 L;  2ZM6 L;  3S16 H;  4GN4 B;  2OCE A;  3TQY A;  3KJO A;  3UDF A;  1QZG A;  2HT1 A;  4A3D G;  4IFD J;  3K7A H;  1EWI A;  4UP7 A;  1YI2 A;  2JE6 I;  5FLX c;  1XPU A;  1N34 Q;  4A93 H;  4GKK L;  2IHF A;  4P75 A;  1HZB A;  1U5K A;  2Q2U A;  2HIV A;  1E1O A;  3CQZ H;  5GAD C;  1SR3 A;  4GN3 B;  4YY3 L;  1QUQ A;  1WFQ A;  4DV3 Q;  2F4V L;  2ZM6 Q;  2IT1 A;  1N36 L;  2I5L X;  2Z6K A;  3UDX A;  1PHJ A;  1X3G A;  2CCZ A;  4P74 A;  4R4T A;  3K80 C;  1EUJ A;  1X9N A;  2R93 G;  4JI1 L;  4DPG A;  3ICE A;  3PO2 H;  2MO1 A;  2KCM A;  1L1O B;  1GO3 E;  1VQG A;  3I2Z A;  2K4K A;  4LF5 L;  1X65 A;  3HOX G;  4A3M H;  3G4S A;  4LUV A;  1JJC B;  2JQO A;  1A63 A;  4X62 Q;  4A4I A;  3E9H A;  3G48 A;  4LF7 L;  1K8A C;  1KQS A;  5LMU L;  1HNZ Q;  2OWO A;  2OTJ A;  4X65 L;  3J80 c;  1YIJ A;  1NBW A;  4JI1 Q;  2VNU D;  1LUZ A;  2LXJ A;  2HQL A;  1NJI C;  4MZ9 A;  4UY8 C;  4DV7 L;  4BBS H;  3GTO H;  1L1O A;  4RG1 A;  1CSP A;  4X64 L;  4A3E H;  4IOC A;  3S1Q H;  4OON A;  4BY1 G;  2VQE L;  4QIW E;  3HOV H;  2EIF A;  3BZC A;  4LW1 A;  3KJP A;  3W1B A;  2QEX A;  1MJE A;  2CQO A;  4OWW B;  2NVQ H;  5M3M G;  2PMZ E;  3J7A 5;  5IYD H;  2E5L Q;  4ME3 A;  3CD6 A;  1FJG L;  1VQD A;  2BA1 A;  3DLL A;  4DV6 L;  1OXS C;  2BA0 A;  3CW2 C;  2R7Z G;  3ULL A;  4L5Q A;  4B3R L;  4PZ6 A;  4JYA Q;  4DUZ Q;  4NXM L;  1CUK A;  5IP7 G;  4OX9 Q;  1HZA A;  2VQE Q;  3L2P A;  3HOZ G;  2HIX A;  3CCE A;  2WFW A;  3F1Z A;  2K5V A;  1FJG Q;  1K3R A;  3PO3 G;  1VQ4 A;  4HJ7 A;  2VZA A;  4DV6 Q;  5C44 H;  1C9O A;  1WJJ A;  5HGQ A;  4DUY Q;  4JV5 L;  3S24 A;  4A3K G;  3L7Z C;  1XMQ Q;  2ID0 A;  4YCV A;  1XNQ L;  3S1N H;  1HNW L;  5GQO A;  1IBK L;  4NXM Q;  1CSQ A;  3W1G A;  2NZH A;  1Y1W G;  1VQF A;  1YJW A;  1KL9 A;  2OQK A;  4A3L G;  2CWP A;  3VDY A;  3JAM c;  2BH8 A;  4P71 A;  1WOC A;  2B63 H;  4DR3 L;  3A0J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...