5LMNW

Structure of bacterial 30s-if1-if3-mrna translation pre-initiation complex (state-1a)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
AKEKDTIRTEGVVTEALPNATFRVKLDSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVYRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus (strain hb8 / atcc 27634 / dsm 579)
total genus 12
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
W PF01176 eIF-1a Translation initiation factor 1A / IF-1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5lmnW00
2N78A 3NENA 1WJJA 2K75A 1VQPA 2EXDA 2ZTEA 2IT1A 5C4XG 4LWCA 4JOIA 3NBHB 3BJUA 4O0AA 1HNXQ 2UUBL 3I4NH 1N32L 5JJLA 1LTLA 3J80i 3PF5A 4IFDG 3UE0A 1TWAH 1RL2A 1CKMA 1WCMH 2ZM6Q 2ID0A 3L7ZC 1VQCA 3GD7A 4JBJA 4P74A 5FJ8H 2KENA 1N34L 4FDBA 4IPHA 4P75A 2E2JH 1IBKL 2Q2IA 2NN6G 3BZCA 2YTVA 5BR8L 5LMUL 2K5NA 1GVPA 4UP8A 3S24A 1Y14B 1J5EL 3I4OA 3J80c 2OTJA 1PYBA 5C0XJ 3AYHB 4K0KQ 3KJOA 5LMNQ 2GVAA 1V43A 3M7NA 3CP0A 5M3FG 4XIGS 1IYJB 1RIPA 4GN5A 2B63G 1KIXA 4B3RQ 3E9IA 1T9HA 1OXTA 3GTOH 2CWPA 2RHQB 4DR3L 3RZOH 1Q1EA 4DR6Q 4X65L 4GOPA 1HR0Q 4R4OA 4GKKL 2F52A 4JI0L 1FVIA 1D7QA 4HIKA 3HOZH 1Y1WH 2VUMH 4KHZA 2F4VL 1YJNA 3PIOA 1PH2A 1KD1C 2IY5B 1N9WA 2VQEL 3M4OH 4IPGA 1Q7YC 1I6HH 3KJPA 4A3EG 4BY1H 1TWCH 1I3QH 1X3EA 1P16A 5E7NA 3CD6A 2NVTH 4KLKA 4GNXA 1J6QA 4A93G 1UE5A 4DV5L 3AQQA 1VQGA 1A8VA 3KFUA 4DV6Q 3HOVG 1QUQA 1X65A 4PZ8A 5K36G 5GQOA 4B3TQ 4A3GH 2N8NA 1CSQA 2E5LL 1IBLQ 3UDIA 3EBEA 4AQYL 3L2PA 1N36L 5LMNW 4LFAL 1TXYA 2R7ZH 4A3IH 1BKBA 4DR4L 2VNUD 2AWNA 3HKZG 1X56A 3CCQA 3ULJA 2R7DA 4YCVA 1A0IA 4LF6Q 1FL0A 4OX9Q 4BBSH 1JJGA 1A62A 2UUAQ 2ASBA 1XMOQ 3TQYA 4BXXH 3M4PA 5IWAL 3GTGH 1WI5A 1PH7A 4AYBG 2K4KA 5M3MG 3UDXA 3CC4A 1L1OB 2GN5A 3GDEA 4L5QA 1G291 2AWOA 1XNQL 2QEXA 3I56A 3GTJH 1PYSB 2Q2UA 4X64L 1CUKA 3HKZE 2NZHA 3RNUA 4APVA 4JBWA 2NVQH 1MKHA 2UUBQ 1N32Q 1OXUA 2MO1A 3FKIH 1GO3E 3KF6A 2MQHA 4JI1L 4BA1I 1VQ8A 1YHQA 2JA6G 3SGIA 1XTDA 2YV5A 1N34Q 3EIVA 1IBMQ 3H3VI 1UE6A 3I2ZA 4GN3B 4QJFA 3U4VA 4AYBE 4DK6C 3CCMA 1IBKQ 5LMUQ 4QIWE 2YTXA 1J5EQ 1GKHA 4MTNA 4RG1A 3T1YL 4DUYL 1TWHH 4GKJL 4HJ9A 5JEAJ 3PO3G 1SRUA 3U50C 4A3DH 4Y7NH 1LUZA 4PZ6A 5IYBG 3T1HL 4JYAL 3UDGA 1X3FA 4DR3Q 3IRBA 3KF8B 1E1TA 2K52A 2ZTDA 4X65Q 3DLLA 3CCLA 1U0LA 2CCZA 4GKKQ 3L0OA 4JI0Q 3MXNB 3S16H 3UE1A 5IYCH 1S40A 4OXPA 2F4VQ 3PO2H 5C0XI 4EQ5A 1NY4A 2E8GA 4C3IH 2VQEQ 4ALPA 1Q86C 1WYDA 1ASYA 1IBLL 2I0QA 3STBD 1C0AA 1E22A 2CQOA 2DUDA 4YWKA 3I4NG 1SLJA 2NVXH 5J3BA 2BH2A 4A3CG 3CXCA 2R93H 2A19A 1L1OA 4YHHL 4DR2L 3J7ZC 1CSPA 5FJ8G 4LUOA 2E5LQ 1Q46A 1YHBA 4AQYQ 4LFAQ 3PUYA 2WAQG 1QZHA 1N36Q 1N33L 1LYLA 4OWXB 4DKAC 4IPDA 1EQQA 2I5LX 4GNXB 4DR4Q 3HOXG 5GROA 3GTLH 3K8AA 1KRTA 4LF9L 1PA6A 1V9PA 4JBKA 1AE2A 1E24A 1QUQB 4POGA 2DGYA 4DK3C 2L15A 2BA0A 2A1AA 3KOJA 3KDFB 4PG3A 2D0PA 5IWAQ 1X55A 1L0WA 3U4ZA 1SN8A 2C35B 3ER0A 1CKNB 4DNIA 5C3EH 1KL9A 2R6GA 1XNQQ 4R4TA 2WAQE 4A3KG 3K80C 5IT9c 1VQIA 4MNOA 3CCUA 1IBML 4BY7H 1Q8KA 1Y1WG 3HKSA 4X64Q 5C44H 1HZBA 2JA5H 2JA8H 2VUMG 4IFDJ 1PH3A 3A5UA 3K7AH 2JJQA 2WP8J 1I50H 2VL6A 3CCJA 1Q82C 5HGQA 1KHIA 4GLAC 5DLQE 4JI1Q 4IOAA 2Z6KC 1EOVA 3KLWA 4JC0A 4TVAB 1UE1A 1VQDA 3G4SA 4WJ3M 2JE6I 3TEHB 4IO9A 2JEBI 3W1GA 4A3GG 3T1YQ 1W3SA 4OO1G 4LUZA 4DUYQ 3H3VH 4GKJQ 4B3ML 3KF6B 4NB3A 2R7ZG 4GN4B 1VQ4A 2HIXA 3G71A 1UWVA 4POFA 3T1HQ 2OTLA 2KCTA 3W1BA 2MNAA 4JI5Q 4OWWB 2JA7G 4BBSG 4JYAQ 1WFQA 3TRZA 3PUWA 2ZJPA 4OONA 3J81j 4P72A 1P8LA 2IX1A 1EWIA 1XMQL 4H02A 3I4MH 4BXXG 2I5MX 2LXJA 4YWMA 1PV4A 4HJ8A 1XPUA 1SROA 1EIFA 4DV2L 1PH9A 5EAYA 2Z0SA 4JI6L 3HOWG 4Y52H 4WJ4A 4PMWA 1VQ6A 3LGJA 3H0GG 3KDFA 4MZ9A 3CCRA 4LFCL 1EUJA 2JQOA 2UXBL 1SE8A 1Y1VG 4KHPL 4IJLA 1R9TH 1C9OA 1CKNA 3FP9A 5M5XH 4P73A 1OTCA 2HQLA 4YHHQ 4DR2Q 1Q81C 1I94L 3HOYH 3PUVA 1VQ5A 4YWLA 4QY7A 3WWVA 1N33Q 4TQUS 1E1OA 2QA4A 1VQOA 3ERSX 2NZOA 3D31A 3OTOL 3KYHC 2WB1G 3PGZA 4LF9Q 2B63H 1MJCA 1JJCB 4KI0A 4JI7L 1JMCA 2UXDL 2ALYB 3CQZH 2D62A 1X9NA 1YJWA 4A3DG 4DUZL 1YBYA 2ATWA 1KQSA 2PMZE 3F2DA 3CC2A 4QL5A 4A3MH 4ME3A 1NMGA 3ICEA 5IP9G 1JT8A 2D0OA 2PI2A 1EYGA 4L5RC 1K9MC 2CKZB 1KRSA 5IYCG 4A3EH 2OQ0A 3J7A5 2JK8A 1FGUA 2WB1E 3JC66 4PZ7A 4X6AH 1Q1BA 3G6EA 4HJAA 4A3JG 3GTMH 1IXRA 4A93H 1NJIC 2OQKA 2N3SA 2RHSB 4NPSA 1HNZL 3HOVH 4L5SA 1QZGA 4RMFA 4GOPC 2HT1A 1X6OA 3PV0A 1YJ9A 4JI2Q 1NMFA 3M85A 4R1JA 1A63A 4JI5L 3D0FA 4A3LH 4JI3L 4J15A 4DV7L 4B3MQ 1VQJA 1SFOH 4IFDI 1Z9FA 1VQHA 2BA1A 4HIMA 4LF7L 2KCMA 4IJHA 1VQ7A 2VZAA 5JJKA 4DV0L 3S1MH 2PI2E 3J81i 3S1QH 2NN6I 3JAMi 3AFPA 3F1ZA 2Z6KA 5ELOA 3TREA 1XMQQ 4GS3A 2OWOA 2N49A 2Q2TA 2PQAA 4C3JH 4LF8L 1K73C 5HY6A 1AE3A 4DV2Q 1HH2P 2WFWA 4DV4Q 4HIOA 1ASZA 4JI6Q 4LUVA 3J81c 1PH5A 2QGQA 5GAGC 1PFSA 1WCMG 2IHEA 5FLMH 3JAMc 3S17H 2E2IH 4P71A 3RLFA 3BU2A 4BY7G 3RLOA 4LFCQ 5C44G 3PCOB 2HHHL 3CPWA 2JA6H 4KHPQ 2UXBQ 1EIYB 1BVSA 3GO5A 4A3FH 3S14H 1MIUA 3RR5A 1I94Q 3CAMA 1PH4A 5IYDH 2MFIA 4IPCA 4X66L 4JBMA 4X62L 5IP7H 3OYYA 2ES2A 1MJEA 1SMXA 1JB7A 2FXQA 3CW2C 3OTOQ 4AIMA 5FLXc 4DR5L 2B3GA 1X54A 2MO0A 5IYBH 4JI7Q 2UXDQ 3I55A 1NTGA 1PH1A 4NXML 3A74A 1SR3A 5IY0A 4EX5A 4JI8L 4DUZQ 3HOZG 2K50A 2CFMA 4HIDA 1HZAA 1TWGH 4A4IA 4A76A 1O7IA 3S15H 5C4JH 2R92H 3B6YA 4BY1G 1B7YB 2KBNA 4JG2A 3VDYA 4OWTB 3CMAA 4BBRH 1XJVA 2K14A 2PNHA 2UU9L 1EQRA 3PUXA 4LF4L 3NEMA 4AH6A 1UE7A 3CCEA 2JEAI 4JI2L 1OXVA 4YY3L 3HOUH 1K3RA 3AEVA 4DV3L 1IL2A 4A3BH 1L2FA 4A3CH 3RN2A 3CPFA 3FHWA 4NXNL 2R7FA 2AKWB 1HNZQ 3TS2A 3S1NH 3S2DH 4DV1L 4A3IG 4XTCS 1KXLA 5C0XG 2UUCL 1YHAA 4UY8C 4HJ5A 3GTKH 3HOYG 1XPOA 1B70B 3CC7A 3HOXH 3RZDH 1XNRL 2YTYA 4JI3Q 4DV7Q 3RLNA 1D8LA 4QQBX 1B8AA 4YCWA 4LF7Q 1VQMA 1VQFA 4DV4L 1PH6A 2V1CC 3RN5A 1W2BA 1FJGL 4R4QA 4UPAA 4DV0Q 1Z47A 2KHIA 3A5ZB 4C2MH 5C4XH 2H5XA 1VQEA 4DR1L 1EFWA 1HNWL 1L1OC 1C7YA 4C3HH 1QVCA 3PF4A 4R4CA 4JCVE 1E3PA 4A3KH 2VS1A 4LF8Q 4O2DA 4L5TA 4A3MG 1S3OA 1PH8A 2UXCL 1HNWQ 3E0EA 3FKIG 2F3IA 1BBWA 3S2HH 1UEBA 1M90C 1WOCA 1YNXA 4B3SL 2AHOB 2JA9A 5AJ3L 2HHHQ 2PQAB 4LF5L 5M3FH 4DPGA 3CF5A 4JOIC 1GD7A 4HJ7A 3GTQH 4DR7L 2BH8A 1HZ9A 4LFBL 3M9BA 4X66Q 3ZJYC 1BBUA 4X62Q 4YCUA 1KC8C 3F2BA 3K81C 5M5WH 2LXKA 2YU9H 3E9HA 3F2CA 4JV5L 2Y0SG 5H1SE 4JI4L 2ZJRA 4GLXA 1Q12A 2VY3A 1HJPA 3MEFA 4DAYB 5IE8A 4QGUA 2VQFL 4DR5Q 4A3LG 1X3GA 5GAHC 2JA7H 3M3YH 1IZ6A 4NXMQ 2VW9A 4GLVB 3U58A 3A0JA 4JI8Q 1HR0W 3ULLA 3M4QA 3NELA 4DAMA 3S1RH 2A8VA 3PO2G 1VCIA 1NE3A 3HOWH 1HNXL 1CKOA 2K5VA 1JJ2A 2UU9Q 3Q8DA 3W5OA 1XPRA 4LF4Q 2ZM6L 1KAWA 1NBWA 1VQBA 2IHFA 5ELNA 3H0GH 2Y0SE 1QVFA 2ZJQA 2R93G 4YY3Q 3BZKA 1HZCA 2AMCB 1M1KC 2HIVA 1VS0A 1Y1VH 3AFQA 5FLMG 4DV3Q 2E2HH 4NXNQ 1G51A 2KHJA 4K0KL 3ULPA 1H95A 5LMNL 1U5KA 2K5HA 4IOCA 4DV1Q 2EQSA 4R4IA 1VQ9A 1OXSC 2GVBA 1JE5A 5M5YH 4A3FG 2UUCQ 3PUZA 4GNXC 4B3RL 1YVCA 2YYZA 5BR8Q 5JEAG 1V1QA 5IYDG 3CCVA 2Q2HA 1VQLA 1VQKA 1XNRQ 5M3MH 1K83H 2OCEA 4LW1A 4DR6L 1VQAA 5IP7G 3CCSA 3PSIA 1K8GA 2LSSA 2ZTCA 3F8TA 4UP9A 1HR0L 1AH9A 3G48A 1QVGA 1VQNA 2XGTA 4UP7A 3CMEA 5C3EG 1FJGQ 2RF4A 2I5HA 4DR1Q 1YIJA 1PHJA 1N8RC 2CWAA 2JA8G 2EIFA 3K7UC 3TS0A 2JA5G 5IP9H 3H15A 4OO1I 1LM0A 5JJIA 2UXCQ 2R92G 2IX0A 1YI2A 1TWFH 3STBC 1I5FA 3DM3A 4BBRG 4DV6L 3OW2A 4A3JH 1YITA 1K0RA 4B3SQ 2NVYH 1YZ6A 1DGSA 3EN2A 4B3TL 4LNQA 2RCNA 4GOPB 5AJ3Q 2XTIA 3HOUG 2B29A 4LF5Q 3GTPH 3PIPA 3I7FA 3PO3H 5GADC 4A3BG 4DV5Q 3K0XA 1G6PA 1YEZA 5GAEC 1K8AC 4LF6L 4DR7Q 4OX9L 4LFBQ 2UUAL 1XMOL 1OXXK 4JV5Q 1E7ZA 3UDFA 1PVOA 1S72A 4JI4Q 1GM5A 2VQFQ 3I4MG 4A75A 4BA2I 3HFZB
chains in the Genus database with same CATH superfamily
5C3XA 3NENA 4M1UB 1JB3A 1ZEQX 4X3UA 3BJUA 2UUBL 1LTLA 2PZTA 2X6LA 3K5NA 1EQTA 2L1BA 4FDBA 4IPHA 5EKKA 1IBKL 5D14A 4DNTB 3Q0AA 2XRSD 1J5EL 3MXPA 5G3LF 5LL6S 1F77A 1BCPB 4X3SA 5E3FA 3S17B 3CP0A 5M3FG 1A3VA 1A15A 4CKBA 1OXTA 3GTOH 2B2YA 4A3FB 2RHQB 1HR0Q 4R4OA 5DEHA 4GKKL 4KHZA 1KD1C 2VQEL 4IPGA 5C4HA 3KJPA 1SEBD 3OMGA 1I3QH 5E7NA 5I2YA 1QJOA 2NVTH 2KCCA 1J6QA 4A93G 2QW7A 2JA5B 3AQQA 1VQGA 1A8VA 1NSNS 1TWGB 3CKIB 4QF4A 5KIXA 4DV6Q 3S15B 3OWEB 1EIHA 4CKEA 2N8NA 1CSQA 3UDIA 3EBEA 5LMNW 3SK6A 4A3IH 2VNUD 2AWNA 3H6MA 3UI2A 4MIUA 2H4OA 1F9PA 3SE0A 2R7DA 3ULJA 1A0IA 4LF6Q 1FL0A 1JJGA 2QILA 3S1NB 3TQYA 3S2DB 1O7ZA 3K59A 5M3MG 2GN5A 2G5DA 3I56A 3I4MB 3IL8A 4H13C 1RD9D 2TSSA 1CUKA 3R8BA 1SDFA 4KJOA 4NDXA 3HP3A 4JBWA 3W2DA 1BO0A 1MKHA 5C4XB 1OXUA 3FKIH 1GO3E 1KLGD 3EJIA 2MQHA 4BA1I 2JA6G 2YV5A 1N34Q 1IBMQ 4IALA 3CCMA 1CHQD 1H9JA 4A3KB 1GUWA 5LMUQ 1FGBD 4IUVA 4MTNA 1EEFD 4DUYL 2RCFA 1A2UA 5DM73 2XVSA 3PIP3 1BNZA 2RKSA 3PO3G 4A3DH 1I6VC 3TN2A 5BN3A 3T1HL 2G9HD 2A6ED 4QUFA 4DR3Q 3KF8B 1IHZA 2ZTDA 1I4GA 1PFBA 1UAPA 2BE5C 4ZQ3A 3L0OA 4JI0Q 3MXNB 3VR3A 2HCCA 1PTOB 4EQ5A 2F4IA 2L55A 3L9AX 1DJRD 2QKIC 4PQXA 3MFGA 1ESRA 4A3EB 2NVXH 4A3CG 3S1RB 3CXCA 4CJ0B 3NSWA 4YHHL 1TY2A 3A56A 5IGFA 3HOVB 4AQYQ 1DONA 1PLFA 3TP7A 2K5WA 2L4NA 3WDNA 5GROA 3K8AA 5HURA 3MVVA 1EYCA 5JEAH 1Q8IA 1SNDA 5EPKA 2BA0A 2A1AA 1V1PA 3KOJA 1D6EC 4QMGA 5KGUA 5IWAQ 3U4ZA 1SN8A 1CKNB 1PFNA 4V0BA 3U9OA 4DNIA 1PYWD 2R6GA 2PYKA 2WAQE 3KBGA 3CCUA 1VQIA 1IBML 1EQVA 1Q8KA 2F0PA 2JA8H 1XTCD 1PH3A 2WP8J 3TMEA 2FFKB 1Q82C 5DLQE 5EBCA 1EOVA 4XYQA 3VA5A 1U4PA 2N88A 1UE1A 1VQDA 3G4SA 1HHVA 4OO1G 1VF7A 1K8MA 4NB3A 4GN4B 3VYRA 4BBSG 2KCTA 3W1BA 4JYAQ 1WTOA 1ESFA 2ZJPA 4KN4C 1Q90A 1MSGA 4OL7A 3TRZA 4GZYC 3OW7A 1XMQL 4QCLA 4BXXG 3D4DA 4YWMA 1EIFA 4JI6L 1ICWA 4PMWA 3R2IA 3KDFA 5IIFA 1SE8A 1Y1VG 2K28A 5TSSA 4P73A 3I4NB 4DR2Q 1Q81C 4YWLA 4QY7A 3WWVA 1B53A 1KLUD 2QA4A 3ERSX 1WTVA 2WB1G 4LF9Q 2B63H 1QNUA 1MJCA 3RZDB 2AQ1B 1C8CA 4JI7L 2UXDL 1K28A 1STAA 1GUGA 1X9NA 1RHPA 2BOSA 4ILWA 4DUZL 3IFTA 2ATWA 4ZKCB 4A3MH 1MBYA 1NMGA 2KEEA 5IP9G 1JT8A 1KNAA 1CM9A 2B2VC 4L5RC 1EU3A 2CKZB 1Q1BA 3G6EA 4C3IG 1Y1WB 2VUMB 1FNWA 4L5SA 3C2PA 5K36H 1IW7D 4RMFA 2HT1A 4WRDA 4B9XA 2C5CA 2NTTA 3DEOA 4X3TA 2F0OA 1PZID 3D0FA 4ABNA 2EZVA 4JI3L 1QE6A 1VQJA 1QWYA 2BA1A 1WTWA 2VZAA 4DV0L 2PI2E 2EJGC 3T16A 3JAMi 3AFPA 3F1ZA 2Z6KA 3DXJC 4FNFA 5ELOA 2JA7B 3J80E 1MI2A 5HY6A 1AE3A 1ASZA 1HQMC 2M9VA 1TS5A 1PH5A 2QGQA 2L0CA 1WCMG 2EY5A 3S17H 2ZXRA 3HRZC 3BU2A 3RLOA 5HGTA 2M2LA 4LFCQ 3PCOB 4RHRA 2Z9HA 1M4VA 3DHQA 4A3FH 2Z4HA 2O4XA 2B2UC 1LTGD 2E2HB 1Y8PB 4JBMA 3QJYA 3OYYA 2KOLA 1MJEA 2I07B 1EY9A 2EJMA 1S5FD 3TZDA 2B3GA 5IYBH 1K83B 2NB0A 1PH1A 1TWHB 5IY0A 1NNXA 4R8IA 1J9OA 4EX5A 5CORA 1BCPF 1HZAA 2TMPA 1TWGH 3S15H 3NWTA 2KBNA 2UU9L 3CMAA 2PNHA 4AH6A 2JEAI 1EWCA 2O5JC 4M8AA 1LTTD 4EQPA 3BDLA 2E76C 3FHWA 2OEOA 4A3JB 2O5IC 3S1NH 1HA5A 2F0JA 3S2DH 2DY7A 1CI3M 5C0XG 5KNBA 1QNKA 1HA6A 3QG1A 3P1HA 1XNRL 4DV7Q 1D8LA 1B8AA 2B8FA 3W3AA 4KD4A 4IUQA 2V1CC 2K7VA 1FJGL 1Z47A 5C4XH 3BYTB 2F0DA 2DN8A 1WTRA 4K5XA 4A3KH 4O2DA 1UUPA 4G4KA 4WORA 1MGSA 4TSSA 5C3EB 1QG7A 2L11A 1CFMA 2LKVA 4KY5A 4BY7B 4DPGA 3CRLC 3M9BA 5J39A 3F2CA 2CHBD 2Y0SG 5H1SE 1EYAA 3NBHA 1Q12A 5COYA 2K6AA 1H9RA 3KLSX 4DXFA 1IZ6A 2MP1A 3OPOA 4NXMQ 2D2CC 4JI8Q 1X3PA 3S1RH 4DAMA 1K8OA 4CBVA 2B2YC 3R93A 4O42A 1SJED 2LS01 5ELNA 2R93G 1EZ8A 2NVTB 1M1KC 1IYUA 3DM1A 1VS0A 3AFQA 4DV3Q 5FO9B 3P75A 1H95A 2E75C 1PTOF 4R4IA 2GVBA 5EPLA 2A73B 4A3IB 1YVCA 4B3RL 5IT9E 3OIQA 4PNYA 3HOYB 5FK9C 3R2TA 3NWSA 1JOKA 4UP9A 1AH9A 4FXKC 2NYZD 2XGTA 2A6EC 4UP7A 4U673 2RF4A 1T5XD 1RKNA 1YIJA 5CMDA 1UNSA 5C5LA 5JVG3 4IUTA 4OO1I 1Z6HA 2XWBB 4DAYA 5T1GA 4ID6A 2IX0A 4C1NI 3KBXA 2XSCA 1YI2A 1I5FA 4BBRG 1K0RA 1YZ6A 4B3TL 1CTMA 2VB2X 2PCFB 5CBEE 1W6JA 2HCIA 4OIKA 4TKOB 5GAEC 2B8GA 4DAVA 1GUNA 4OX9L 1LT4D 2UUAL 1SYBA 2F0HA 1OXXK 4JV5Q 3UDFA 1XWEA 2F0UA 5NUCA 2VQFQ 4A75A 2N78A 3K6OA 2EYMA 1DOKA 1SYEA 4HCEA 2IT1A 4LWCA 3I4NH 4QUCA 2WV6D 3S1QB 4IFDG 4B9WA 2Q8RE 1RL2A 2ZM6Q 2EYJA 2ID0A 4P75A 1D5MC 2KECA 1I4XA 2NN6G 3BZCA 2K5NA 4UP8A 3S24A 1Y14B 3J80c 5C0XJ 2B2VA 3AYHB 2XNAC 5LMNQ 1SNQA 3JAML 2GVAA 3E3XA 1V43A 4KD3A 4RGNA 2SEBD 3OOCA 4GN5A 4XIGS 1KIXA 2JA6B 4HMJA 1LO5D 2CWPA 3S14B 4S3SA 3RZOH 1Q1EA 4X65L 3MEHA 3K5OA 4ZK9B 3SK5A 2QDBA 1CK1A 4JW0A 4HIKA 1Y1WH 2VUMH 2F3VA 2F4VL 1U9RA 1PH2A 3PIOA 4FF1A 2AQ3B 3M4OH 5FLXL 1Q7YC 1I6HH 1U4MA 4RA8A 2EOTA 1UE5A 4PZ8A 5BN5A 4P2CB 3MHBA 2R92B 1I4QA 4LFAL 1IYVA 3HKZG 1X56A 4YCVA 2DY8A 4RGMA 3DWAA 5IGBA 3J81E 1STYA 3M4PA 1DOLA 1B4OA 1EFID 4AYBG 3UDXA 3CC4A 1SNPA 4RGOS 3GDEA 2WIIB 2AWOA 1XNQL 1LTSD 2Q2UA 4X64L 2A68C 2NZHA 3A7LA 3WOFA 1TY0A 2E74C 2UUBQ 1PRTC 1CA5A 2HDMA 2LFNA 1SAPA 1VQ8A 3H3VI 1V1PB 3EIVA 4QJFA 1IBKQ 1IKLA 1QCBD 2Z8LA 1J5EQ 1GKHA 5L37A 3T1YL 1IW7C 3BVMA 1TWHH 4TRDA 1GJXA 3KLSA 2MPMA 4ULLA 4XT1B 3U50C 1S5DD 4Y7NH 1LUZA 5E4XA 2B63B 1X3FA 3IRBA 3OWFA 1XYIA 1E1TA 4GKKQ 4I7ZC 1LT6D 5C4ZA 5M5WB 5IYCH 3PO2H 5C0XI 2J7ZA 1D1KA 2E8GA 2NZ1D 3SHLA 2VQEQ 2WKCA 2I0QA 3M3YB 4ZLTF 4MHEA 5A2QL 2QDLA 4YWKA 2A5HA 1ZYRD 2BH2A 1DCZA 2A19A 3N52A 1CSPA 4LUOA 1I4RA 1N33L 3PUYA 1EQQA 4IPDA 4GNXB 3HOXG 1KRTA 5FKAC 4CJ2C 1QUQB 4DK3C 2L15A 1BXTA 1SJHD 4XYOA 3KDFB 4PG3A 1X55A 1L0WA 1VDZA 1L0YB 4C3HG 3CHBD 5C3EH 1F2MA 2PW5A 4R4TA 2EE1A 5IT9c 4BY7H 3HKSA 4FXDA 1HZBA 3DEPA 2G9DA 3WOEA 4IFDJ 3A5UA 2F1MA 2XN9C 2R61A 1D5XC 5HGQA 4GLAC 2Z6KC 3VYTA 3NXWA 3TEHB 2RSNA 1A2TA 3RD4A 2AQ2B 4L6TB 3K5MA 4DUYQ 4B3ML 2F0EA 2NVYB 3KF6B 5FOBB 3SVMA 1WD1A 1AZQA 2BDNA 3GQBA 1UEAB 3G71A 3GTPB 3T1HQ 5KNDA 4OONA 2RVLA 4P72A 3J81j 2IX1A 1EWIA 2KQ3A 4H02A 1SE4A 3MZ5A 3H3VC 3G6JB 2KEDA 2Z1CA 1LACA 1PV4A 3HOWG 4DV2L 2Z0SA 2K5DA 1VQ6A 3LX0A 4KKSA 3LGJA 2JN4A 3H0GG 4MZ9A 1KAAA 1HUNA 1R9TH 1F9QA 3MWYW 1OTCA 4YHHQ 3HOYH 4HCSA 3AMUA 1QILA 1JWSD 1CZWA 3A8JE 2NZOA 3D31A 4RCNA 2WAQB 1NR2A 3PGZA 4ZKBB 1EZ6A 1JJCB 4KI0A 5J22A 1JMCA 3BVGA 2D62A 3LWUA 1YJWA 4I7AA 4A3DG 2RBMA 3MAQA 1KQSA 3CC2A 1KRSA 2OQ0A 3MXUA 2WB1E 3JC66 3D4WA 3Q23A 4A93H 4FP5D 1NJIC 4G7ZC 4N8FA 3VR6A 2PZWA 2RHSB 4DFAA 1CQVA 4GOPC 1X6OA 3PV0A 1YJ9A 3I90A 4R1JA 4A3GB 1JWUD 2VB3X 4DK0A 5C3WA 4IFDI 3TZUA 1VQHA 4LF7L 2J4XA 2KCMA 1LV9A 4UHVA 1ML0D 4CJ1B 2R7ZB 3S1QH 4FXGC 4JPBW 2NN6I 1XMQQ 4GS3A 1PDQA 2N49A 3T4AC 2NUCA 1HNWL 4HIOA 1LABA 3I3CA 4JI6Q 4K2LA 4DXGA 3J81c 1JOOA 1PFSA 2ZT9C 1AW7A 2IHEA 5FLMH 2CH4W 3RMHA 1A6XA 1HXYD 4WJWA 3V05A 3J7AV 2HHHL 2JA6H 1EIYB 3S14H 2NVQB 3CAMA 1PH4A 4ZUIA 5IYDH 4H0LC 2Q8IB 4X62L 5IP7H 4CDEC 1O7LA 4AIMA 4DR5L 2MJ8A 1ONLA 3NP8A 3FDTA 5IODA 4JI7Q 2UXDQ 2NTSA 3A74A 4DUZQ 2JSOA 3HOZG 1SSOA 2CFMA 2HUGA 4HIDA 2R92H 5I4DA 1Z7TA 4BY1G 4JG2A 1GUOA 3PUXA 5FO8B 3CCEA 4KY6A 1OXVA 1CHPD 4YY3L 1BQQT 3S16B 4A3CH 5FO7B 4NXNL 2R7FA 3FMCA 1R4PB 4DV1L 1GXDC 1ILQA 3MTSA 1G2SA 2UUCL 1YHAA 4UY8C 1SYCA 4G7HC 1EY4A 1B70B 1BDOA 1CT1D 3AB9A 1XPOA 2EPBA 5IOCA 4JI3Q 3NTIA 4QQBX 4YCWA 5I9OA 1B9MA 1PH6A 3RN5A 1W2BA 1JICA 4DV0Q 4FF4A 2KHIA 4C2MH 3GTLB 4DR1L 1VQEA 4HN7A 1FYCA 1L1OC 1C7YA 1LLRD 3VYSA 4L5TA 1SNOA 3LWEA 4A3MG 2UXCL 1I4HA 1NUCA 4C1NK 2EY2A 2F3IA 3NBIA 2RDHA 4NW2A 4J1MA 2JA9A 1STEA 5CV9A 1QB5D 2PQAB 4LF5L 5CYUA 2EYLA 4F87A 5C44B 2XRQD 3K7AB 1B50A 5ELCA 1BOSA 4DR7L 2BH8A 1HZ9A 4OO1H 2GA4B 4YCUA 1C48A 5M5WH 2YU9H 3E9HA 4JI4L 4R9WA 1H9SA 2VY3A 4DAYB 1HJPA 4KY7A 2A68D 4WFN3 4EQOA 3RZOB 3M3YH 1E2WA 1PRTD 1B3AA 4X3KA 2VW9A 3NK9A 1HR0W 3M4QA 3NELA 1NE3A 4F88A 1HPCA 3PMFA 2RSOA 1HNXL 3BDOA 2K5VA 2FMMA 1JJ2A 2UU9Q 3Q8DA 1S5CD 3M4OB 1DZ1A 1I6HB 3PQIA 3RUZA 2Y0SE 4HMIA 3BZKA 4IUPA 4DNRB 2HIVA 1Y1VH 3I4LA 2Z4IA 1ENFA 4K5VA 3QIAA 3X3NA 4K0KL 1KDBA 4IOCA 3IAYA 2EQSA 1JE5A 4A3FG 4BWGB 3GP7A 3CCVA 5BR8Q 1NAPA 5M5XB 2C9OA 1VQKA 1XNRQ 4FYDA 4XDXA 3FRPB 1VQAA 3CCSA 1K8GA 3PSIA 4RAUC 4DR6L 1AFPA 2F0QA 1QVGA 5KEEA 4N9TA 1LTAD 3CMEA 1FJGQ 1PHJA 2CWAA 3H94A 2JA5G 5IP9H 3CU7A 4F8MA 3NE5B 1ZXTA 3SK8A 1KDAA 3FVQA 3OW2A 1WTXA 2NVYH 4LNQA 1HFNA 2RCNA 1ZYRC 4Q0FA 3GTPH 4DV5Q 1G6PA 3GTMB 2F0GA 1X3QA 1K8AC 1EIGA 3QR8A 1XMOL 1S72A 1ICFB 1CZGA 4Y7NB 2N55A 3I4MG 3HFZB 1STNA 3TSSA 1SE2A 2K75A 3NQTA 5CV4A 5EQ0A 1VQPA 2EXDA 2ZTEA 4RKLA 1F2YA 4U68A 5C4XG 2KVMA 4O0AA 3PO2B 1N32L 3J80i 3UE0A 2SNMA 1TWAH 4AYBB 1CKMA 1WCMH 5FJ8H 1VQCA 3GD7A 4P74A 5CGKA 2E2JH 2Q2IA 2YTVA 5BR8L 5I6YA 2EXZA 5JVH3 2K1BA 4ZCKA 3F2UA 3M7NA 4EQNA 2PW7A 4B3RQ 1LT3D 1T9HA 1E0BA 1CA6A 4GOPA 3LNNA 2F0WA 1NCVA 4XT3B 1FD7D 1FVIA 1ET9A 4RFBA 1YJNA 5DNFA 5T1IA 3VA7A 1WTQA 3K5LA 4PV1C 4A3EG 3CD6A 1P16A 4KLKA 1EY8A 4DV5L 3C3LA 1W6KA 3KFUA 1BBXC 1JR0D 3NUCA 2K03A 1X65A 3P20A 5C4JB 5GQOA 4IURA 3HOVG 4B3TQ 2IJ0A 4A3GH 2E5LL 1WTPA 1IBLQ 4B08A 5IGGA 3L2PA 1N36L 2R7ZH 4DR4L 5C0XH 4XQQA 3HOUB 4A3BB 4OX9Q 1A62A 1TKWB 2L9HA 2UUAQ 3J7AF 3T56B 2E2DC 2F3WA 1WI5A 2LMCB 5EKIA 2K4KA 3GTKB 5LHY1 1C4QA 1G291 3HOXB 2CW0D 4C3JG 1PTOD 1PYSB 3ONAB 4BS9A 2SOBA 3HKZE 1EY0A 4APVA 2NVQH 4IN3A 2OXPA 4JI1L 4G57A 4C3HB 1XTDA 1LTBD 1TS3A 1UE6A 4GN3B 4G7OC 4AYBE 1R9TB 3S2HB 4IQZA 4GKJL 4HJ9A 1DXMA 2OF1A 1AP0A 1SRUA 4E6IA 4PZ6A 5M3FB 1FNVA 1O80A 3UDGA 3I70A 3VR4A 2K52A 4X65Q 3K0YA 4N9PA 4L63B 1U0LA 2XIWA 3CCLA 1SNCA 3S16H 3HG9A 1TU2B 3HGBA 4OXPA 2F4VQ 1LTRD 1QOHA 4HTHA 1NY4A 1EYDA 3J7YW 4KHVA 3V96A 1IBLL 1ASYA 3STBD 3T51B 1WTHA 1C0AA 1F2ZA 2DUDA 4FF3A 1M8AA 3I4NG 5J3BA 2PZUA 2R93H 3QOJA 2F0KA 1L1OA 1DYQA 2VXWA 4A93B 3M4YA 3MC0B 1YHBA 4LFAQ 4IZ8A 1LYLA 4OWXB 3H0GB 4DKAC 2I5LX 3GTLH 1V9PA 1YNNC 3D4RA 1AE2A 4HR7B 3ZYYX 2DGYA 2PMZB 1G8ZD 5M5YB 5JOBA 2F0VA 3ER0A 4DF7A 1B3QA 1S5ED 1KL9A 1XNQQ 1JOQA 5M3MB 4Z9CB 1EY5A 1EL0A 2CQAA 1Y1WG 4X64Q 5C44H 3PIO3 2VUMG 5EGTA 3K7AH 2JJQA 1I50H 1B44D 3MXGA 3EA6A 1KHIA 5BN4A 4QB4A 1LTID 3NPPA 4JC0A 3KLWA 4TVAB 1AEXA 1RTOA 3T1YQ 1TWFB 3QO2A 4LUZA 2K01A 4LMQD 3BDCA 2CH4A 2HIXA 4MN3A 1UWVA 3PO3B 2K04A 4OWWB 2EDGA 4JI5Q 2JA7G 1WFQA 1L0XB 2I5MX 2LXJA 3HS0C 5JPNC 1F9SA 1SROA 4Y52H 4ME5A 4KTAA 4WJ4A 1TQOA 1F2LA 4IFDH 1EUJA 2F0MA 2UXBL 3E0JA 2K33A 4KHPL 4IJLA 1C9OA 5M5XH 1TR5A 2A6HD 1I94L 1MSHA 3URYA 1U4RA 1N33Q 4TQUS 4PMCA 3OTOL 3KYHC 1X32A 3OSOA 4CDCC 3J80L 2F0NA 4NMZA 3QWNA 3VR2A 2PMZE 3F2DA 1G2TA 4QL5A 2B2WA 1B1ZA 5CC4A 4ME3A 4C2MB 1DM0B 3ICEA 2BDOA 1A3TA 2D0OA 4HSPA 1K9MC 5IYCG 2JK8A 1FGUA 4A3JG 2PPBC 3IFDA 3GTMH 1IXRA 2OQKA 4DU9A 4NPSA 1HNZL 3BYYB 1E2VA 1TWCB 2A69D 4JI2Q 4JI5L 1HCZA 4A3LH 1EU4A 3A8KE 4J15A 4B3MQ 1SFOH 4J8QA 4HIMA 1ET6A 2YU9B 1JORA 3EROA 1VQ7A 3J81i 2XWJB 4HEDA 1OO9B 4BBSB 3A7AB 2Q2TA 4LF8L 4DV2Q 3GTGB 4DN4M 1PRTB 4XQNA 1SYGA 2EYFA 3DUZA 4BY7G 4H44C 1ILPA 4OIJA 3GTJB 3CPWA 4EVOA 1MIUA 3RR5A 1Y1VB 4LJZC 4IPCA 5DM63 1BCPC 4X66L 2ES2A 1SMXA 1JB7A 2FXQA 3CW2C 5G3LD 2WB1B 2H1EA 3NHHA 3I55A 1NTGA 1AN8A 1TIID 3Q22A 1GUTA 3Q24A 5LL6X 4A4IA 1O7IA 5C4JH 3E5SA 3B6YA 1B7YB 2QCPX 4LF4L 1EQRA 1UE7A 4JI2L 3L3OC 3HOUH 1K3RA 3AEVA 1IL2A 1H9SB 4A3BH 1L2FA 2AUJD 3RN2A 4C3IB 4A3IG 1KXLA 3TP6A 1PZKD 1Y8OB 3GTKH 2EYOA 3HOYG 3CC7A 3HOXH 2MUYA 2IWHA 3RLNA 4LF7Q 1VQFA 4I65A 4UPAA 2H5XA 2D5DA 1HFGA 4C3HH 1XXGA 4JCVE 1E3PA 1TS4A 1HNWQ 4KKUA 2Z6BA 4DAPA 1D2BA 3E0EA 3FKIG 1BBWA 5I2XA 1UEBA 3S2HH 3C1FA 1YNXA 4B3SL 1TWAB 1WCMB 5AJ3L 2B2TA 2HHHQ 4K14A 3FPUB 5IT9L 5M3FH 2E2JB 1WVLA 3CF5A 4RHSA 1GOZA 2DNCA 4OHJA 3GTQH 4LFBL 3ZJYC 4X62Q 4CDDC 2V4DA 5J1ZA 1KC8C 3F2BA 2LXKA 1YNJD 2ZJRA 4FO2A 4GLXA 1ENCA 5CV8A 4DR5Q 3MEFA 1D1IA 3H09A 3CRKC 1X3GA 4C56C 5GAHC 2QEJC 3TDQA 1B9NA 4FF2A 4GLVB 3U58A 3KK7A 3A0JA 2HD3A 4MTKA 3I91A 3ULLA 4L8JA 2A8VA 4NP5A 3HOWH 2CW0C 4LK1C 1PTOC 3W5OA 2FMCA 1KAWA 2IHFA 1VQBA 1TT2A 1SYFA 3H0GH 3ND8A 1SBBB 4YY3Q 1DD2A 2AMCB 1SMYC 5FLMG 2EY6A 4NXNQ 1O7YA 2K5HA 1I4PA 4DV1Q 3HEJA 1OXSC 5M5YH 3A8IE 4O1NA 2UUCQ 3EVQA 2YYZA 5JEAG 5IYDG 4ZRZA 1VQLA 5M3MH 4LW1A 5IP7G 1STHA 1HR0L 1RCVD 4IUNA 2ZTCA 1HTPA 3D6CA 1VQNA 4K6LA 5D3DA 2PQEA 2I5HA 4DR1Q 1WD0A 1N8RC 2JA8G 2EIFA 3K7UC 3CQZB 5EBDA 1O78A 1TS2A 1LM0A 3H15A 5E1FA 3SR1A 4K8IA 2UXCQ 2R92G 2WACA 1FNUA 1TVXA 1TWFH 3STBC 4DV6L 5CV5A 5KRUA 3EN2A 1DGSA 1YNND 1SE3A 2JXMB 2X69A 4GOPB 2XTIA 5CV7A 1U4LA 2B29A 4LF5Q 3PO3H 3PIPA 3I7FA 3DWPA 5GADC 3TP5A 1YEZA 5I9PA 1SXTA 4LF6L 4DR7Q 1E7ZA 4JI4Q 1H9MA 3G7LA 2Y0SB 4BA2I 1VMCA 3M7GA 1WJJA 2J0TD 2EYHA 4JOIA 3NBHB 1HNXQ 3S1MB 5JJLA 3PF5A 4V190 1ZKOA 3L7ZC 4JBJA 4QIWB 1N34L 2KENA 1STGA 5KNCA 4C3JB 4JK1C 5LMUL 1GVPA 2KJXA 2OTJA 2R93B 5D3IB 3I4OA 4DK1A 1PYBA 3J81L 4HSVA 4K0KQ 3KJOA 2E2IB 1MHWC 1IYJB 1RIPA 2B63G 2F03A 3E9IA 4IUUA 2MGSA 4DR3L 2A74C 2K32A 4DR6Q 2ICIA 2ICEC 2F52A 4JI0L 1D7QA 3HOZH 1E2ZA 1KNEA 1V1OA 2IY5B 1N9WA 3NTHA 3OIPA 4BY1H 1TWCH 4UDUC 3D6WA 1X3EA 2P5ZX 4GNXA 3D8GA 4K5WA 1JE4A 1I50B 1QUQA 5F2DA 5K36G 5ELBA 1GHJA 4BBRB 4AQYL 3T53B 2A6HC 1TXYA 1HRJA 1BKBA 2FINB 3CCQA 4BBSH 3QB3A 2ASBA 1XMOQ 4BXXH 5A35A 3JAME 5IWAL 3GTGH 4OEMB 1PH7A 3NQIA 1BUVT 1L1OB 4L5QA 4RCOA 1VMPA 2QEXA 4RWSC 3GTJH 3IKJA 3SK4A 1S4ZA 4CDFC 2F0FA 3RNUA 2Q8TA 1N32Q 2MO1A 2NBFA 1SYDA 4ZUJA 3KF6A 5FLXE 1YHQA 1JCKB 4OGQC 3SGIA 4RKBA 4H7BA 3I2ZA 3U4VA 4DK6C 5JPMC 1V8QA 2IX3A 4QIWE 2YTXA 4RG1A 2A69C 3DMUA 2I46A 1RDPD 1PRTF 5JEAJ 2WINB 3N6RA 2R3ZA 5IYBG 4JYAL 2SDFA 3DLLA 3A55A 1IKMA 1B2TA 5DAUA 2CCZA 5ISRA 3UE1A 5JJZA 1S40A 3OMCA 4C3IH 4ALPA 1Q86C 1WYDA 2RQXA 1F9RA 1BCPD 1E22A 2CQOA 1SLJA 4KK7A 1JC7A 4DR2L 2B2WC 2RA4A 3J7ZC 5FJ8G 3OHXC 2E5LQ 1Q46A 1KTKA 5I6WA 1N36Q 1PXUA 2WAQG 1QZHA 2PO4A 4DR4Q 3ITPA 1PA6A 4LF9L 4JBKA 1PFMA 2X6GA 1E24A 4POGA 3HKZB 5EPJA 2LY7A 2D0PA 1PZJD 1SFOB 2WKDA 2C35B 3K57A 2D9UA 3GV3A 4A3KG 3K80C 3KUPA 4HAEA 4MNOA 5CV6A 2JA5H 5K5PA 1XX8A 3KF8A 2VL6A 3CCJA 3BVZA 4JI1Q 2JYOA 4IOAA 1EWHA 3MXNA 4WJ3M 5A2QE 3EQLC 2JE6I 4IO9A 2JEBI 3Q6SA 3W1GA 4A3GG 1W3SA 4KV6A 3H3VH 4GKJQ 3VYUA 2R7ZG 1IL8A 1VQ4A 3K58A 4POFA 2OTLA 3V2TA 2MNAA 3PUWA 2KCNA 1P8LA 3FEWX 3I4MH 2JP1A 1BR9A 4HJ8A 1XPUA 1PH9A 5EAYA 3O13A 1EOTA 4EGVA 3CCRA 4LFCL 2JQOA 1S5BD 2CVRA 1CKNA 3ERQA 2DNEA 3FP9A 1VF5C 2HQLA 3PUVA 1J8IA 1VQ5A 2RDFA 3TP8A 1K3BC 1RJTA 1E1OA 1VQOA 3E6ZX 1HUMA 2HQEA 2L12A 3CQZH 2ALYB 1YNJC 3I72A 1YBYA 2SNSA 1LT5D 1PTOH 5ELEA 3GTOB 1SMYD 2PI2A 1Q3LA 4OELB 5KYLA 1JQYD 1MD2D 1EY6A 2F0LA 4A3EH 3J7A5 4PZ7A 4X6AH 4HJAA 3TBIB 2N3SA 3GV6A 2EYPA 5D65A 3HOVH 1QZGA 2KUMA 1I3QB 2AUKA 1NMFA 3M85A 2DJGC 1A63A 4DV7L 3GTQB 4ZAIA 1RTNA 1Z9FA 2B2TC 2QF7A 3BS1A 4IJHA 2BE5D 2MHVA 5JJKA 3S1MH 5M9OA 3TREA 3X3MA 1EY7A 2OWOA 2ZXOA 2PQAA 4C3JH 5IGCA 1K73C 4DV4Q 1HH2P 2WFWA 3QOLA 3D3RA 1SNMA 2KHSA 4LUVA 1EEID 5GAGC 3HOWB 4FVMA 2BCOA 3JAMc 2E2IH 4P71A 3RLFA 1RODA 5C44G 2IL8A 2UXBQ 1G6ZA 4KHPQ 2DJFC 1BVSA 3GO5A 4DA2A 3SEBA 1I94Q 2MFIA 5EKLA 3FKIB 1PMRA 4PMBA 3OTOQ 3A54A 5FLXc 2MO0A 1X54A 1Y69U 4R8NA 4NXML 1D5ZC 1H9KA 1SR3A 4KN7C 4JI8L 4CHTB 4KMUC 2K50A 5JAVA 4A3DB 4A76A 4K6DA 2EVBA 2IPKD 1EYGA 3VDYA 1XJVA 4NKLA 4OWTB 4BBRH 2K14A 4N8X1 2PNRC 3NEMA 4DGZA 4KJNA 1JWMD 4RH6A 4RGTA 4DV3L 3CPFA 3KLRA 1KDCA 2AKWB 2M00A 1HNZQ 3TS2A 5IGEA 3I8ZA 5CR3A 4XTCS 2B39A 2ZXPA 3T13A 4KKTA 3EFXD 4HJ5A 1Y8NB 5ELFA 2NVXB 3MA2B 3RZDH 5C6AA 2YTYA 4JVZA 3SDZA 5EJWA 4Q5VA 4CKCA 1VQMA 2RDGA 4DV4L 1HQRD 2EJFC 2F0SA 3HZXA 4R4QA 5KYIA 3AU7A 3A5ZB 4XXEA 1EFWA 1QVCA 3PF4A 4R4CA 1G91A 4YIJA 5IGDA 2VS1A 4LF8Q 2OT2A 1S3OA 1PH8A 1FR3A 2NN6H 1M90C 1WOCA 3VR5A 5CBAE 2AHOB 1CQFA 1GUSA 3C46A 5E4WC 2K05A 2JA8B 1STBA 4JOIC 1GD7A 4HJ7A 4X66Q 2HDLA 1BBUA 4ODGA 4JV5L 3K81C 3BZDB 3FPPA 1A3UA 5IE8A 4A3LG 2VQFL 4QGUA 1DOMA 2L5TA 4XQJA 2JA7H 3R3OA 3PO2G 4K8JA 1VCIA 1KABA 2B2UA 3HOZB 4LAAA 1CKOA 1XPRA 4LF4Q 3U9SA 2ZM6L 1NBWA 3SXHA 4F7XA 4BY1B 1QVFA 1BF4A 1K0SA 2ZJQA 1HZCA 3P7JA 1ENAA 3I73A 5C5MA 3BG3A 2E2HH 1G51A 2KHJA 3ULPA 5LMNL 1U5KA 1VQ9A 3PUZA 4GNXC 5AFWA 3H91A 2O2LD 2FJ2A 1V1QA 3NTKA 2Q2HA 1HTLD 2IW3A 1K83H 2KA7A 3C1EA 2OCEA 2LSSA 3F8TA 1RF2D 2EY1A 3G48A 4ZYSA 5C3EG 1AZPA 3DWQA 3TS0A 4CGYB 5JJIA 3S9WA 1NR4A 1II3A 4A3MB 3DM3A 2F0TA 4A3JH 4K2KA 1YITA 4B3SQ 5AJ3Q 3HOUG 2NWGA 2ENBA 4A3BG 3K0XA 3ND9A 3MFYA 2F0IA 5ELDA 4LFBQ 1T5EA 2FHTA 1PVOA 1R4QB 1GHKA 2K5QA 1GM5A 4J6HA 4UAIA
chains in the Genus database with same CATH topology
2N78A 3NENA 1WJJA 2K75A 1VQPA 2EXDA 2ZTEA 2IT1A 5C4XG 4LWCA 4JOIA 3NBHB 3BJUA 4O0AA 1HNXQ 2UUBL 3I4NH 1N32L 5JJLA 1LTLA 3J80i 3PF5A 4IFDG 3UE0A 1TWAH 1RL2A 1CKMA 1WCMH 2ZM6Q 2ID0A 3L7ZC 1VQCA 3GD7A 4JBJA 4P74A 5FJ8H 2KENA 1N34L 4FDBA 4IPHA 4P75A 2E2JH 1IBKL 2Q2IA 2NN6G 3BZCA 2YTVA 5BR8L 5LMUL 2K5NA 1GVPA 4UP8A 3S24A 1Y14B 1J5EL 3I4OA 3J80c 2OTJA 1PYBA 5C0XJ 3AYHB 4K0KQ 3KJOA 5LMNQ 2GVAA 1V43A 3M7NA 3CP0A 5M3FG 4XIGS 1IYJB 1RIPA 4GN5A 2B63G 1KIXA 4B3RQ 3E9IA 1T9HA 1OXTA 3GTOH 2CWPA 2RHQB 4DR3L 3RZOH 1Q1EA 4DR6Q 4X65L 4GOPA 1HR0Q 4R4OA 4GKKL 2F52A 4JI0L 1FVIA 1D7QA 4HIKA 3HOZH 1Y1WH 2VUMH 4KHZA 2F4VL 1YJNA 3PIOA 1PH2A 1KD1C 2IY5B 1N9WA 2VQEL 3M4OH 4IPGA 1Q7YC 1I6HH 3KJPA 4A3EG 4BY1H 1TWCH 1I3QH 1X3EA 1P16A 5E7NA 3CD6A 2NVTH 4KLKA 4GNXA 1J6QA 4A93G 1UE5A 4DV5L 3AQQA 1VQGA 1A8VA 3KFUA 4DV6Q 3HOVG 1QUQA 1X65A 4PZ8A 5K36G 5GQOA 4B3TQ 4A3GH 2N8NA 1CSQA 2E5LL 1IBLQ 3UDIA 3EBEA 4AQYL 3L2PA 1N36L 5LMNW 4LFAL 1TXYA 2R7ZH 4A3IH 1BKBA 4DR4L 2VNUD 2AWNA 3HKZG 1X56A 3CCQA 3ULJA 2R7DA 4YCVA 1A0IA 4LF6Q 1FL0A 4OX9Q 4BBSH 1JJGA 1A62A 2UUAQ 2ASBA 1XMOQ 3TQYA 4BXXH 3M4PA 5IWAL 3GTGH 1WI5A 1PH7A 4AYBG 2K4KA 5M3MG 3UDXA 3CC4A 1L1OB 2GN5A 3GDEA 4L5QA 1G291 2AWOA 1XNQL 2QEXA 3I56A 3GTJH 1PYSB 2Q2UA 4X64L 1CUKA 3HKZE 2NZHA 3RNUA 4APVA 4JBWA 2NVQH 1MKHA 2UUBQ 1N32Q 1OXUA 2MO1A 3FKIH 1GO3E 3KF6A 2MQHA 4JI1L 4BA1I 1VQ8A 1YHQA 2JA6G 3SGIA 1XTDA 2YV5A 1N34Q 3EIVA 1IBMQ 3H3VI 1UE6A 3I2ZA 4GN3B 4QJFA 3U4VA 4AYBE 4DK6C 3CCMA 1IBKQ 5LMUQ 4QIWE 2YTXA 1J5EQ 1GKHA 4MTNA 4RG1A 3T1YL 4DUYL 1TWHH 4GKJL 4HJ9A 5JEAJ 3PO3G 1SRUA 3U50C 4A3DH 4Y7NH 1LUZA 4PZ6A 5IYBG 3T1HL 4JYAL 3UDGA 1X3FA 4DR3Q 3IRBA 3KF8B 1E1TA 2K52A 2ZTDA 4X65Q 3DLLA 3CCLA 1U0LA 2CCZA 4GKKQ 3L0OA 4JI0Q 3MXNB 3S16H 3UE1A 5IYCH 1S40A 4OXPA 2F4VQ 3PO2H 5C0XI 4EQ5A 1NY4A 2E8GA 4C3IH 2VQEQ 4ALPA 1Q86C 1WYDA 1ASYA 1IBLL 2I0QA 3STBD 1C0AA 1E22A 2CQOA 2DUDA 4YWKA 3I4NG 1SLJA 2NVXH 5J3BA 2BH2A 4A3CG 3CXCA 2R93H 2A19A 1L1OA 4YHHL 4DR2L 3J7ZC 1CSPA 5FJ8G 4LUOA 2E5LQ 1Q46A 1YHBA 4AQYQ 4LFAQ 3PUYA 2WAQG 1QZHA 1N36Q 1N33L 1LYLA 4OWXB 4DKAC 4IPDA 1EQQA 2I5LX 4GNXB 4DR4Q 3HOXG 5GROA 3GTLH 3K8AA 1KRTA 4LF9L 1PA6A 1V9PA 4JBKA 1AE2A 1E24A 1QUQB 4POGA 2DGYA 4DK3C 2L15A 2BA0A 2A1AA 3KOJA 3KDFB 4PG3A 2D0PA 5IWAQ 1X55A 1L0WA 3U4ZA 1SN8A 2C35B 3ER0A 1CKNB 4DNIA 5C3EH 1KL9A 2R6GA 1XNQQ 4R4TA 2WAQE 4A3KG 3K80C 5IT9c 1VQIA 4MNOA 3CCUA 1IBML 4BY7H 1Q8KA 1Y1WG 3HKSA 4X64Q 5C44H 1HZBA 2JA5H 2JA8H 2VUMG 4IFDJ 1PH3A 3A5UA 3K7AH 2JJQA 2WP8J 1I50H 2VL6A 3CCJA 1Q82C 5HGQA 1KHIA 4GLAC 5DLQE 4JI1Q 4IOAA 2Z6KC 1EOVA 3KLWA 4JC0A 4TVAB 1UE1A 1VQDA 3G4SA 4WJ3M 2JE6I 3TEHB 4IO9A 2JEBI 3W1GA 4A3GG 3T1YQ 1W3SA 4OO1G 4LUZA 4DUYQ 3H3VH 4GKJQ 4B3ML 3KF6B 4NB3A 2R7ZG 4GN4B 1VQ4A 2HIXA 3G71A 1UWVA 4POFA 3T1HQ 2OTLA 2KCTA 3W1BA 2MNAA 4JI5Q 4OWWB 2JA7G 4BBSG 4JYAQ 1WFQA 3TRZA 3PUWA 2ZJPA 4OONA 3J81j 4P72A 1P8LA 2IX1A 1EWIA 1XMQL 4H02A 3I4MH 4BXXG 2I5MX 2LXJA 4YWMA 1PV4A 4HJ8A 1XPUA 1SROA 1EIFA 4DV2L 1PH9A 5EAYA 2Z0SA 4JI6L 3HOWG 4Y52H 4WJ4A 4PMWA 1VQ6A 3LGJA 3H0GG 3KDFA 4MZ9A 3CCRA 4LFCL 1EUJA 2JQOA 2UXBL 1SE8A 1Y1VG 4KHPL 4IJLA 1R9TH 1C9OA 1CKNA 3FP9A 5M5XH 4P73A 1OTCA 2HQLA 4YHHQ 4DR2Q 1Q81C 1I94L 3HOYH 3PUVA 1VQ5A 4YWLA 4QY7A 3WWVA 1N33Q 4TQUS 1E1OA 2QA4A 1VQOA 3ERSX 2NZOA 3D31A 3OTOL 3KYHC 2WB1G 3PGZA 4LF9Q 2B63H 1MJCA 1JJCB 4KI0A 4JI7L 1JMCA 2UXDL 2ALYB 3CQZH 2D62A 1X9NA 1YJWA 4A3DG 4DUZL 1YBYA 2ATWA 1KQSA 2PMZE 3F2DA 3CC2A 4QL5A 4A3MH 4ME3A 1NMGA 3ICEA 5IP9G 1JT8A 2D0OA 2PI2A 1EYGA 4L5RC 1K9MC 2CKZB 1KRSA 5IYCG 4A3EH 2OQ0A 3J7A5 2JK8A 1FGUA 2WB1E 3JC66 4PZ7A 4X6AH 1Q1BA 3G6EA 4HJAA 4A3JG 3GTMH 1IXRA 4A93H 1NJIC 2OQKA 2N3SA 2RHSB 4NPSA 1HNZL 3HOVH 4L5SA 1QZGA 4RMFA 4GOPC 2HT1A 1X6OA 3PV0A 1YJ9A 4JI2Q 1NMFA 3M85A 4R1JA 1A63A 4JI5L 3D0FA 4A3LH 4JI3L 4J15A 4DV7L 4B3MQ 1VQJA 1SFOH 4IFDI 1Z9FA 1VQHA 2BA1A 4HIMA 4LF7L 2KCMA 4IJHA 1VQ7A 2VZAA 5JJKA 4DV0L 3S1MH 2PI2E 3J81i 3S1QH 2NN6I 3JAMi 3AFPA 3F1ZA 2Z6KA 5ELOA 3TREA 1XMQQ 4GS3A 2OWOA 2N49A 2Q2TA 2PQAA 4C3JH 4LF8L 1K73C 5HY6A 1AE3A 4DV2Q 1HH2P 2WFWA 4DV4Q 4HIOA 1ASZA 4JI6Q 4LUVA 3J81c 1PH5A 2QGQA 5GAGC 1PFSA 1WCMG 2IHEA 5FLMH 3JAMc 3S17H 2E2IH 4P71A 3RLFA 3BU2A 4BY7G 3RLOA 4LFCQ 5C44G 3PCOB 2HHHL 3CPWA 2JA6H 4KHPQ 2UXBQ 1EIYB 1BVSA 3GO5A 4A3FH 3S14H 1MIUA 3RR5A 1I94Q 3CAMA 1PH4A 5IYDH 2MFIA 4IPCA 4X66L 4JBMA 4X62L 5IP7H 3OYYA 2ES2A 1MJEA 1SMXA 1JB7A 2FXQA 3CW2C 3OTOQ 4AIMA 5FLXc 4DR5L 2B3GA 1X54A 2MO0A 5IYBH 4JI7Q 2UXDQ 3I55A 1NTGA 1PH1A 4NXML 3A74A 1SR3A 5IY0A 4EX5A 4JI8L 4DUZQ 3HOZG 2K50A 2CFMA 4HIDA 1HZAA 1TWGH 4A4IA 4A76A 1O7IA 3S15H 5C4JH 2R92H 3B6YA 4BY1G 1B7YB 2KBNA 4JG2A 3VDYA 4OWTB 3CMAA 4BBRH 1XJVA 2K14A 2PNHA 2UU9L 1EQRA 3PUXA 4LF4L 3NEMA 4AH6A 1UE7A 3CCEA 2JEAI 4JI2L 1OXVA 4YY3L 3HOUH 1K3RA 3AEVA 4DV3L 1IL2A 4A3BH 1L2FA 4A3CH 3RN2A 3CPFA 3FHWA 4NXNL 2R7FA 2AKWB 1HNZQ 3TS2A 3S1NH 3S2DH 4DV1L 4A3IG 4XTCS 1KXLA 5C0XG 2UUCL 1YHAA 4UY8C 4HJ5A 3GTKH 3HOYG 1XPOA 1B70B 3CC7A 3HOXH 3RZDH 1XNRL 2YTYA 4JI3Q 4DV7Q 3RLNA 1D8LA 4QQBX 1B8AA 4YCWA 4LF7Q 1VQMA 1VQFA 4DV4L 1PH6A 2V1CC 3RN5A 1W2BA 1FJGL 4R4QA 4UPAA 4DV0Q 1Z47A 2KHIA 3A5ZB 4C2MH 5C4XH 2H5XA 1VQEA 4DR1L 1EFWA 1HNWL 1L1OC 1C7YA 4C3HH 1QVCA 3PF4A 4R4CA 4JCVE 1E3PA 4A3KH 2VS1A 4LF8Q 4O2DA 4L5TA 4A3MG 1S3OA 1PH8A 2UXCL 1HNWQ 3E0EA 3FKIG 2F3IA 1BBWA 3S2HH 1UEBA 1M90C 1WOCA 1YNXA 4B3SL 2AHOB 2JA9A 5AJ3L 2HHHQ 2PQAB 4LF5L 5M3FH 4DPGA 3CF5A 4JOIC 1GD7A 4HJ7A 3GTQH 4DR7L 2BH8A 1HZ9A 4LFBL 3M9BA 4X66Q 3ZJYC 1BBUA 4X62Q 4YCUA 1KC8C 3F2BA 3K81C 5M5WH 2LXKA 2YU9H 3E9HA 3F2CA 4JV5L 2Y0SG 5H1SE 4JI4L 2ZJRA 4GLXA 1Q12A 2VY3A 1HJPA 3MEFA 4DAYB 5IE8A 4QGUA 2VQFL 4DR5Q 4A3LG 1X3GA 5GAHC 2JA7H 3M3YH 1IZ6A 4NXMQ 2VW9A 4GLVB 3U58A 3A0JA 4JI8Q 1HR0W 3ULLA 3M4QA 3NELA 4DAMA 3S1RH 2A8VA 3PO2G 1VCIA 1NE3A 3HOWH 1HNXL 1CKOA 2K5VA 1JJ2A 2UU9Q 3Q8DA 3W5OA 1XPRA 4LF4Q 2ZM6L 1KAWA 1NBWA 1VQBA 2IHFA 5ELNA 3H0GH 2Y0SE 1QVFA 2ZJQA 2R93G 4YY3Q 3BZKA 1HZCA 2AMCB 1M1KC 2HIVA 1VS0A 1Y1VH 3AFQA 5FLMG 4DV3Q 2E2HH 4NXNQ 1G51A 2KHJA 4K0KL 3ULPA 1H95A 5LMNL 1U5KA 2K5HA 4IOCA 4DV1Q 2EQSA 4R4IA 1VQ9A 1OXSC 2GVBA 1JE5A 5M5YH 4A3FG 2UUCQ 3PUZA 4GNXC 4B3RL 1YVCA 2YYZA 5BR8Q 5JEAG 1V1QA 5IYDG 3CCVA 2Q2HA 1VQLA 1VQKA 1XNRQ 5M3MH 1K83H 2OCEA 4LW1A 4DR6L 1VQAA 5IP7G 3CCSA 3PSIA 1K8GA 2LSSA 2ZTCA 3F8TA 4UP9A 1HR0L 1AH9A 3G48A 1QVGA 1VQNA 2XGTA 4UP7A 3CMEA 5C3EG 1FJGQ 2RF4A 2I5HA 4DR1Q 1YIJA 1PHJA 1N8RC 2CWAA 2JA8G 2EIFA 3K7UC 3TS0A 2JA5G 5IP9H 3H15A 4OO1I 1LM0A 5JJIA 2UXCQ 2R92G 2IX0A 1YI2A 1TWFH 3STBC 1I5FA 3DM3A 4BBRG 4DV6L 3OW2A 4A3JH 1YITA 1K0RA 4B3SQ 2NVYH 1YZ6A 1DGSA 3EN2A 4B3TL 4LNQA 2RCNA 4GOPB 5AJ3Q 2XTIA 3HOUG 2B29A 4LF5Q 3GTPH 3PIPA 3I7FA 3PO3H 5GADC 4A3BG 4DV5Q 3K0XA 1G6PA 1YEZA 5GAEC 1K8AC 4LF6L 4DR7Q 4OX9L 4LFBQ 2UUAL 1XMOL 1OXXK 4JV5Q 1E7ZA 3UDFA 1PVOA 1S72A 4JI4Q 1GM5A 2VQFQ 3I4MG 4A75A 4BA2I 3HFZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N78 A;  3NEN A;  1WJJ A;  2K75 A;  1VQP A;  2EXD A;  2ZTE A;  2IT1 A;  5C4X G;  4LWC A;  4JOI A;  3NBH B;  3BJU A;  4O0A A;  1HNX Q;  2UUB L;  3I4N H;  1N32 L;  5JJL A;  1LTL A;  3J80 i;  3PF5 A;  4IFD G;  3UE0 A;  1TWA H;  1RL2 A;  1CKM A;  1WCM H;  2ZM6 Q;  2ID0 A;  3L7Z C;  1VQC A;  3GD7 A;  4JBJ A;  4P74 A;  5FJ8 H;  2KEN A;  1N34 L;  4FDB A;  4IPH A;  4P75 A;  2E2J H;  1IBK L;  2Q2I A;  2NN6 G;  3BZC A;  2YTV A;  5BR8 L;  5LMU L;  2K5N A;  1GVP A;  4UP8 A;  3S24 A;  1Y14 B;  1J5E L;  3I4O A;  3J80 c;  2OTJ A;  1PYB A;  5C0X J;  3AYH B;  4K0K Q;  3KJO A;  5LMN Q;  2GVA A;  1V43 A;  3M7N A;  3CP0 A;  5M3F G;  4XIG S;  1IYJ B;  1RIP A;  4GN5 A;  2B63 G;  1KIX A;  4B3R Q;  3E9I A;  1T9H A;  1OXT A;  3GTO H;  2CWP A;  2RHQ B;  4DR3 L;  3RZO H;  1Q1E A;  4DR6 Q;  4X65 L;  4GOP A;  1HR0 Q;  4R4O A;  4GKK L;  2F52 A;  4JI0 L;  1FVI A;  1D7Q A;  4HIK A;  3HOZ H;  1Y1W H;  2VUM H;  4KHZ A;  2F4V L;  1YJN A;  3PIO A;  1PH2 A;  1KD1 C;  2IY5 B;  1N9W A;  2VQE L;  3M4O H;  4IPG A;  1Q7Y C;  1I6H H;  3KJP A;  4A3E G;  4BY1 H;  1TWC H;  1I3Q H;  1X3E A;  1P16 A;  5E7N A;  3CD6 A;  2NVT H;  4KLK A;  4GNX A;  1J6Q A;  4A93 G;  1UE5 A;  4DV5 L;  3AQQ A;  1VQG A;  1A8V A;  3KFU A;  4DV6 Q;  3HOV G;  1QUQ A;  1X65 A;  4PZ8 A;  5K36 G;  5GQO A;  4B3T Q;  4A3G H;  2N8N A;  1CSQ A;  2E5L L;  1IBL Q;  3UDI A;  3EBE A;  4AQY L;  3L2P A;  1N36 L;  5LMN W;  4LFA L;  1TXY A;  2R7Z H;  4A3I H;  1BKB A;  4DR4 L;  2VNU D;  2AWN A;  3HKZ G;  1X56 A;  3CCQ A;  3ULJ A;  2R7D A;  4YCV A;  1A0I A;  4LF6 Q;  1FL0 A;  4OX9 Q;  4BBS H;  1JJG A;  1A62 A;  2UUA Q;  2ASB A;  1XMO Q;  3TQY A;  4BXX H;  3M4P A;  5IWA L;  3GTG H;  1WI5 A;  1PH7 A;  4AYB G;  2K4K A;  5M3M G;  3UDX A;  3CC4 A;  1L1O B;  2GN5 A;  3GDE A;  4L5Q A;  1G29 1;  2AWO A;  1XNQ L;  2QEX A;  3I56 A;  3GTJ H;  1PYS B;  2Q2U A;  4X64 L;  1CUK A;  3HKZ E;  2NZH A;  3RNU A;  4APV A;  4JBW A;  2NVQ H;  1MKH A;  2UUB Q;  1N32 Q;  1OXU A;  2MO1 A;  3FKI H;  1GO3 E;  3KF6 A;  2MQH A;  4JI1 L;  4BA1 I;  1VQ8 A;  1YHQ A;  2JA6 G;  3SGI A;  1XTD A;  2YV5 A;  1N34 Q;  3EIV A;  1IBM Q;  3H3V I;  1UE6 A;  3I2Z A;  4GN3 B;  4QJF A;  3U4V A;  4AYB E;  4DK6 C;  3CCM A;  1IBK Q;  5LMU Q;  4QIW E;  2YTX A;  1J5E Q;  1GKH A;  4MTN A;  4RG1 A;  3T1Y L;  4DUY L;  1TWH H;  4GKJ L;  4HJ9 A;  5JEA J;  3PO3 G;  1SRU A;  3U50 C;  4A3D H;  4Y7N H;  1LUZ A;  4PZ6 A;  5IYB G;  3T1H L;  4JYA L;  3UDG A;  1X3F A;  4DR3 Q;  3IRB A;  3KF8 B;  1E1T A;  2K52 A;  2ZTD A;  4X65 Q;  3DLL A;  3CCL A;  1U0L A;  2CCZ A;  4GKK Q;  3L0O A;  4JI0 Q;  3MXN B;  3S16 H;  3UE1 A;  5IYC H;  1S40 A;  4OXP A;  2F4V Q;  3PO2 H;  5C0X I;  4EQ5 A;  1NY4 A;  2E8G A;  4C3I H;  2VQE Q;  4ALP A;  1Q86 C;  1WYD A;  1ASY A;  1IBL L;  2I0Q A;  3STB D;  1C0A A;  1E22 A;  2CQO A;  2DUD A;  4YWK A;  3I4N G;  1SLJ A;  2NVX H;  5J3B A;  2BH2 A;  4A3C G;  3CXC A;  2R93 H;  2A19 A;  1L1O A;  4YHH L;  4DR2 L;  3J7Z C;  1CSP A;  5FJ8 G;  4LUO A;  2E5L Q;  1Q46 A;  1YHB A;  4AQY Q;  4LFA Q;  3PUY A;  2WAQ G;  1QZH A;  1N36 Q;  1N33 L;  1LYL A;  4OWX B;  4DKA C;  4IPD A;  1EQQ A;  2I5L X;  4GNX B;  4DR4 Q;  3HOX G;  5GRO A;  3GTL H;  3K8A A;  1KRT A;  4LF9 L;  1PA6 A;  1V9P A;  4JBK A;  1AE2 A;  1E24 A;  1QUQ B;  4POG A;  2DGY A;  4DK3 C;  2L15 A;  2BA0 A;  2A1A A;  3KOJ A;  3KDF B;  4PG3 A;  2D0P A;  5IWA Q;  1X55 A;  1L0W A;  3U4Z A;  1SN8 A;  2C35 B;  3ER0 A;  1CKN B;  4DNI A;  5C3E H;  1KL9 A;  2R6G A;  1XNQ Q;  4R4T A;  2WAQ E;  4A3K G;  3K80 C;  5IT9 c;  1VQI A;  4MNO A;  3CCU A;  1IBM L;  4BY7 H;  1Q8K A;  1Y1W G;  3HKS A;  4X64 Q;  5C44 H;  1HZB A;  2JA5 H;  2JA8 H;  2VUM G;  4IFD J;  1PH3 A;  3A5U A;  3K7A H;  2JJQ A;  2WP8 J;  1I50 H;  2VL6 A;  3CCJ A;  1Q82 C;  5HGQ A;  1KHI A;  4GLA C;  5DLQ E;  4JI1 Q;  4IOA A;  2Z6K C;  1EOV A;  3KLW A;  4JC0 A;  4TVA B;  1UE1 A;  1VQD A;  3G4S A;  4WJ3 M;  2JE6 I;  3TEH B;  4IO9 A;  2JEB I;  3W1G A;  4A3G G;  3T1Y Q;  1W3S A;  4OO1 G;  4LUZ A;  4DUY Q;  3H3V H;  4GKJ Q;  4B3M L;  3KF6 B;  4NB3 A;  2R7Z G;  4GN4 B;  1VQ4 A;  2HIX A;  3G71 A;  1UWV A;  4POF A;  3T1H Q;  2OTL A;  2KCT A;  3W1B A;  2MNA A;  4JI5 Q;  4OWW B;  2JA7 G;  4BBS G;  4JYA Q;  1WFQ A;  3TRZ A;  3PUW A;  2ZJP A;  4OON A;  3J81 j;  4P72 A;  1P8L A;  2IX1 A;  1EWI A;  1XMQ L;  4H02 A;  3I4M H;  4BXX G;  2I5M X;  2LXJ A;  4YWM A;  1PV4 A;  4HJ8 A;  1XPU A;  1SRO A;  1EIF A;  4DV2 L;  1PH9 A;  5EAY A;  2Z0S A;  4JI6 L;  3HOW G;  4Y52 H;  4WJ4 A;  4PMW A;  1VQ6 A;  3LGJ A;  3H0G G;  3KDF A;  4MZ9 A;  3CCR A;  4LFC L;  1EUJ A;  2JQO A;  2UXB L;  1SE8 A;  1Y1V G;  4KHP L;  4IJL A;  1R9T H;  1C9O A;  1CKN A;  3FP9 A;  5M5X H;  4P73 A;  1OTC A;  2HQL A;  4YHH Q;  4DR2 Q;  1Q81 C;  1I94 L;  3HOY H;  3PUV A;  1VQ5 A;  4YWL A;  4QY7 A;  3WWV A;  1N33 Q;  4TQU S;  1E1O A;  2QA4 A;  1VQO A;  3ERS X;  2NZO A;  3D31 A;  3OTO L;  3KYH C;  2WB1 G;  3PGZ A;  4LF9 Q;  2B63 H;  1MJC A;  1JJC B;  4KI0 A;  4JI7 L;  1JMC A;  2UXD L;  2ALY B;  3CQZ H;  2D62 A;  1X9N A;  1YJW A;  4A3D G;  4DUZ L;  1YBY A;  2ATW A;  1KQS A;  2PMZ E;  3F2D A;  3CC2 A;  4QL5 A;  4A3M H;  4ME3 A;  1NMG A;  3ICE A;  5IP9 G;  1JT8 A;  2D0O A;  2PI2 A;  1EYG A;  4L5R C;  1K9M C;  2CKZ B;  1KRS A;  5IYC G;  4A3E H;  2OQ0 A;  3J7A 5;  2JK8 A;  1FGU A;  2WB1 E;  3JC6 6;  4PZ7 A;  4X6A H;  1Q1B A;  3G6E A;  4HJA A;  4A3J G;  3GTM H;  1IXR A;  4A93 H;  1NJI C;  2OQK A;  2N3S A;  2RHS B;  4NPS A;  1HNZ L;  3HOV H;  4L5S A;  1QZG A;  4RMF A;  4GOP C;  2HT1 A;  1X6O A;  3PV0 A;  1YJ9 A;  4JI2 Q;  1NMF A;  3M85 A;  4R1J A;  1A63 A;  4JI5 L;  3D0F A;  4A3L H;  4JI3 L;  4J15 A;  4DV7 L;  4B3M Q;  1VQJ A;  1SFO H;  4IFD I;  1Z9F A;  1VQH A;  2BA1 A;  4HIM A;  4LF7 L;  2KCM A;  4IJH A;  1VQ7 A;  2VZA A;  5JJK A;  4DV0 L;  3S1M H;  2PI2 E;  3J81 i;  3S1Q H;  2NN6 I;  3JAM i;  3AFP A;  3F1Z A;  2Z6K A;  5ELO A;  3TRE A;  1XMQ Q;  4GS3 A;  2OWO A;  2N49 A;  2Q2T A;  2PQA A;  4C3J H;  4LF8 L;  1K73 C;  5HY6 A;  1AE3 A;  4DV2 Q;  1HH2 P;  2WFW A;  4DV4 Q;  4HIO A;  1ASZ A;  4JI6 Q;  4LUV A;  3J81 c;  1PH5 A;  2QGQ A;  5GAG C;  1PFS A;  1WCM G;  2IHE A;  5FLM H;  3JAM c;  3S17 H;  2E2I H;  4P71 A;  3RLF A;  3BU2 A;  4BY7 G;  3RLO A;  4LFC Q;  5C44 G;  3PCO B;  2HHH L;  3CPW A;  2JA6 H;  4KHP Q;  2UXB Q;  1EIY B;  1BVS A;  3GO5 A;  4A3F H;  3S14 H;  1MIU A;  3RR5 A;  1I94 Q;  3CAM A;  1PH4 A;  5IYD H;  2MFI A;  4IPC A;  4X66 L;  4JBM A;  4X62 L;  5IP7 H;  3OYY A;  2ES2 A;  1MJE A;  1SMX A;  1JB7 A;  2FXQ A;  3CW2 C;  3OTO Q;  4AIM A;  5FLX c;  4DR5 L;  2B3G A;  1X54 A;  2MO0 A;  5IYB H;  4JI7 Q;  2UXD Q;  3I55 A;  1NTG A;  1PH1 A;  4NXM L;  3A74 A;  1SR3 A;  5IY0 A;  4EX5 A;  4JI8 L;  4DUZ Q;  3HOZ G;  2K50 A;  2CFM A;  4HID A;  1HZA A;  1TWG H;  4A4I A;  4A76 A;  1O7I A;  3S15 H;  5C4J H;  2R92 H;  3B6Y A;  4BY1 G;  1B7Y B;  2KBN A;  4JG2 A;  3VDY A;  4OWT B;  3CMA A;  4BBR H;  1XJV A;  2K14 A;  2PNH A;  2UU9 L;  1EQR A;  3PUX A;  4LF4 L;  3NEM A;  4AH6 A;  1UE7 A;  3CCE A;  2JEA I;  4JI2 L;  1OXV A;  4YY3 L;  3HOU H;  1K3R A;  3AEV A;  4DV3 L;  1IL2 A;  4A3B H;  1L2F A;  4A3C H;  3RN2 A;  3CPF A;  3FHW A;  4NXN L;  2R7F A;  2AKW B;  1HNZ Q;  3TS2 A;  3S1N H;  3S2D H;  4DV1 L;  4A3I G;  4XTC S;  1KXL A;  5C0X G;  2UUC L;  1YHA A;  4UY8 C;  4HJ5 A;  3GTK H;  3HOY G;  1XPO A;  1B70 B;  3CC7 A;  3HOX H;  3RZD H;  1XNR L;  2YTY A;  4JI3 Q;  4DV7 Q;  3RLN A;  1D8L A;  4QQB X;  1B8A A;  4YCW A;  4LF7 Q;  1VQM A;  1VQF A;  4DV4 L;  1PH6 A;  2V1C C;  3RN5 A;  1W2B A;  1FJG L;  4R4Q A;  4UPA A;  4DV0 Q;  1Z47 A;  2KHI A;  3A5Z B;  4C2M H;  5C4X H;  2H5X A;  1VQE A;  4DR1 L;  1EFW A;  1HNW L;  1L1O C;  1C7Y A;  4C3H H;  1QVC A;  3PF4 A;  4R4C A;  4JCV E;  1E3P A;  4A3K H;  2VS1 A;  4LF8 Q;  4O2D A;  4L5T A;  4A3M G;  1S3O A;  1PH8 A;  2UXC L;  1HNW Q;  3E0E A;  3FKI G;  2F3I A;  1BBW A;  3S2H H;  1UEB A;  1M90 C;  1WOC A;  1YNX A;  4B3S L;  2AHO B;  2JA9 A;  5AJ3 L;  2HHH Q;  2PQA B;  4LF5 L;  5M3F H;  4DPG A;  3CF5 A;  4JOI C;  1GD7 A;  4HJ7 A;  3GTQ H;  4DR7 L;  2BH8 A;  1HZ9 A;  4LFB L;  3M9B A;  4X66 Q;  3ZJY C;  1BBU A;  4X62 Q;  4YCU A;  1KC8 C;  3F2B A;  3K81 C;  5M5W H;  2LXK A;  2YU9 H;  3E9H A;  3F2C A;  4JV5 L;  2Y0S G;  5H1S E;  4JI4 L;  2ZJR A;  4GLX A;  1Q12 A;  2VY3 A;  1HJP A;  3MEF A;  4DAY B;  5IE8 A;  4QGU A;  2VQF L;  4DR5 Q;  4A3L G;  1X3G A;  5GAH C;  2JA7 H;  3M3Y H;  1IZ6 A;  4NXM Q;  2VW9 A;  4GLV B;  3U58 A;  3A0J A;  4JI8 Q;  1HR0 W;  3ULL A;  3M4Q A;  3NEL A;  4DAM A;  3S1R H;  2A8V A;  3PO2 G;  1VCI A;  1NE3 A;  3HOW H;  1HNX L;  1CKO A;  2K5V A;  1JJ2 A;  2UU9 Q;  3Q8D A;  3W5O A;  1XPR A;  4LF4 Q;  2ZM6 L;  1KAW A;  1NBW A;  1VQB A;  2IHF A;  5ELN A;  3H0G H;  2Y0S E;  1QVF A;  2ZJQ A;  2R93 G;  4YY3 Q;  3BZK A;  1HZC A;  2AMC B;  1M1K C;  2HIV A;  1VS0 A;  1Y1V H;  3AFQ A;  5FLM G;  4DV3 Q;  2E2H H;  4NXN Q;  1G51 A;  2KHJ A;  4K0K L;  3ULP A;  1H95 A;  5LMN L;  1U5K A;  2K5H A;  4IOC A;  4DV1 Q;  2EQS A;  4R4I A;  1VQ9 A;  1OXS C;  2GVB A;  1JE5 A;  5M5Y H;  4A3F G;  2UUC Q;  3PUZ A;  4GNX C;  4B3R L;  1YVC A;  2YYZ A;  5BR8 Q;  5JEA G;  1V1Q A;  5IYD G;  3CCV A;  2Q2H A;  1VQL A;  1VQK A;  1XNR Q;  5M3M H;  1K83 H;  2OCE A;  4LW1 A;  4DR6 L;  1VQA A;  5IP7 G;  3CCS A;  3PSI A;  1K8G A;  2LSS A;  2ZTC A;  3F8T A;  4UP9 A;  1HR0 L;  1AH9 A;  3G48 A;  1QVG A;  1VQN A;  2XGT A;  4UP7 A;  3CME A;  5C3E G;  1FJG Q;  2RF4 A;  2I5H A;  4DR1 Q;  1YIJ A;  1PHJ A;  1N8R C;  2CWA A;  2JA8 G;  2EIF A;  3K7U C;  3TS0 A;  2JA5 G;  5IP9 H;  3H15 A;  4OO1 I;  1LM0 A;  5JJI A;  2UXC Q;  2R92 G;  2IX0 A;  1YI2 A;  1TWF H;  3STB C;  1I5F A;  3DM3 A;  4BBR G;  4DV6 L;  3OW2 A;  4A3J H;  1YIT A;  1K0R A;  4B3S Q;  2NVY H;  1YZ6 A;  1DGS A;  3EN2 A;  4B3T L;  4LNQ A;  2RCN A;  4GOP B;  5AJ3 Q;  2XTI A;  3HOU G;  2B29 A;  4LF5 Q;  3GTP H;  3PIP A;  3I7F A;  3PO3 H;  5GAD C;  4A3B G;  4DV5 Q;  3K0X A;  1G6P A;  1YEZ A;  5GAE C;  1K8A C;  4LF6 L;  4DR7 Q;  4OX9 L;  4LFB Q;  2UUA L;  1XMO L;  1OXX K;  4JV5 Q;  1E7Z A;  3UDF A;  1PVO A;  1S72 A;  4JI4 Q;  1GM5 A;  2VQF Q;  3I4M G;  4A75 A;  4BA2 I;  3HFZ B; 
#chains in the Genus database with same CATH topology
 5C3X A;  3NEN A;  4M1U B;  1JB3 A;  1ZEQ X;  4X3U A;  3BJU A;  2UUB L;  1LTL A;  2PZT A;  2X6L A;  3K5N A;  1EQT A;  2L1B A;  4FDB A;  4IPH A;  5EKK A;  1IBK L;  5D14 A;  4DNT B;  3Q0A A;  2XRS D;  1J5E L;  3MXP A;  5G3L F;  5LL6 S;  1F77 A;  1BCP B;  4X3S A;  5E3F A;  3S17 B;  3CP0 A;  5M3F G;  1A3V A;  1A15 A;  4CKB A;  1OXT A;  3GTO H;  2B2Y A;  4A3F B;  2RHQ B;  1HR0 Q;  4R4O A;  5DEH A;  4GKK L;  4KHZ A;  1KD1 C;  2VQE L;  4IPG A;  5C4H A;  3KJP A;  1SEB D;  3OMG A;  1I3Q H;  5E7N A;  5I2Y A;  1QJO A;  2NVT H;  2KCC A;  1J6Q A;  4A93 G;  2QW7 A;  2JA5 B;  3AQQ A;  1VQG A;  1A8V A;  1NSN S;  1TWG B;  3CKI B;  4QF4 A;  5KIX A;  4DV6 Q;  3S15 B;  3OWE B;  1EIH A;  4CKE A;  2N8N A;  1CSQ A;  3UDI A;  3EBE A;  5LMN W;  3SK6 A;  4A3I H;  2VNU D;  2AWN A;  3H6M A;  3UI2 A;  4MIU A;  2H4O A;  1F9P A;  3SE0 A;  2R7D A;  3ULJ A;  1A0I A;  4LF6 Q;  1FL0 A;  1JJG A;  2QIL A;  3S1N B;  3TQY A;  3S2D B;  1O7Z A;  3K59 A;  5M3M G;  2GN5 A;  2G5D A;  3I56 A;  3I4M B;  3IL8 A;  4H13 C;  1RD9 D;  2TSS A;  1CUK A;  3R8B A;  1SDF A;  4KJO A;  4NDX A;  3HP3 A;  4JBW A;  3W2D A;  1BO0 A;  1MKH A;  5C4X B;  1OXU A;  3FKI H;  1GO3 E;  1KLG D;  3EJI A;  2MQH A;  4BA1 I;  2JA6 G;  2YV5 A;  1N34 Q;  1IBM Q;  4IAL A;  3CCM A;  1CHQ D;  1H9J A;  4A3K B;  1GUW A;  5LMU Q;  1FGB D;  4IUV A;  4MTN A;  1EEF D;  4DUY L;  2RCF A;  1A2U A;  5DM7 3;  2XVS A;  3PIP 3;  1BNZ A;  2RKS A;  3PO3 G;  4A3D H;  1I6V C;  3TN2 A;  5BN3 A;  3T1H L;  2G9H D;  2A6E D;  4QUF A;  4DR3 Q;  3KF8 B;  1IHZ A;  2ZTD A;  1I4G A;  1PFB A;  1UAP A;  2BE5 C;  4ZQ3 A;  3L0O A;  4JI0 Q;  3MXN B;  3VR3 A;  2HCC A;  1PTO B;  4EQ5 A;  2F4I A;  2L55 A;  3L9A X;  1DJR D;  2QKI C;  4PQX A;  3MFG A;  1ESR A;  4A3E B;  2NVX H;  4A3C G;  3S1R B;  3CXC A;  4CJ0 B;  3NSW A;  4YHH L;  1TY2 A;  3A56 A;  5IGF A;  3HOV B;  4AQY Q;  1DON A;  1PLF A;  3TP7 A;  2K5W A;  2L4N A;  3WDN A;  5GRO A;  3K8A A;  5HUR A;  3MVV A;  1EYC A;  5JEA H;  1Q8I A;  1SND A;  5EPK A;  2BA0 A;  2A1A A;  1V1P A;  3KOJ A;  1D6E C;  4QMG A;  5KGU A;  5IWA Q;  3U4Z A;  1SN8 A;  1CKN B;  1PFN A;  4V0B A;  3U9O A;  4DNI A;  1PYW D;  2R6G A;  2PYK A;  2WAQ E;  3KBG A;  3CCU A;  1VQI A;  1IBM L;  1EQV A;  1Q8K A;  2F0P A;  2JA8 H;  1XTC D;  1PH3 A;  2WP8 J;  3TME A;  2FFK B;  1Q82 C;  5DLQ E;  5EBC A;  1EOV A;  4XYQ A;  3VA5 A;  1U4P A;  2N88 A;  1UE1 A;  1VQD A;  3G4S A;  1HHV A;  4OO1 G;  1VF7 A;  1K8M A;  4NB3 A;  4GN4 B;  3VYR A;  4BBS G;  2KCT A;  3W1B A;  4JYA Q;  1WTO A;  1ESF A;  2ZJP A;  4KN4 C;  1Q90 A;  1MSG A;  4OL7 A;  3TRZ A;  4GZY C;  3OW7 A;  1XMQ L;  4QCL A;  4BXX G;  3D4D A;  4YWM A;  1EIF A;  4JI6 L;  1ICW A;  4PMW A;  3R2I A;  3KDF A;  5IIF A;  1SE8 A;  1Y1V G;  2K28 A;  5TSS A;  4P73 A;  3I4N B;  4DR2 Q;  1Q81 C;  4YWL A;  4QY7 A;  3WWV A;  1B53 A;  1KLU D;  2QA4 A;  3ERS X;  1WTV A;  2WB1 G;  4LF9 Q;  2B63 H;  1QNU A;  1MJC A;  3RZD B;  2AQ1 B;  1C8C A;  4JI7 L;  2UXD L;  1K28 A;  1STA A;  1GUG A;  1X9N A;  1RHP A;  2BOS A;  4ILW A;  4DUZ L;  3IFT A;  2ATW A;  4ZKC B;  4A3M H;  1MBY A;  1NMG A;  2KEE A;  5IP9 G;  1JT8 A;  1KNA A;  1CM9 A;  2B2V C;  4L5R C;  1EU3 A;  2CKZ B;  1Q1B A;  3G6E A;  4C3I G;  1Y1W B;  2VUM B;  1FNW A;  4L5S A;  3C2P A;  5K36 H;  1IW7 D;  4RMF A;  2HT1 A;  4WRD A;  4B9X A;  2C5C A;  2NTT A;  3DEO A;  4X3T A;  2F0O A;  1PZI D;  3D0F A;  4ABN A;  2EZV A;  4JI3 L;  1QE6 A;  1VQJ A;  1QWY A;  2BA1 A;  1WTW A;  2VZA A;  4DV0 L;  2PI2 E;  2EJG C;  3T16 A;  3JAM i;  3AFP A;  3F1Z A;  2Z6K A;  3DXJ C;  4FNF A;  5ELO A;  2JA7 B;  3J80 E;  1MI2 A;  5HY6 A;  1AE3 A;  1ASZ A;  1HQM C;  2M9V A;  1TS5 A;  1PH5 A;  2QGQ A;  2L0C A;  1WCM G;  2EY5 A;  3S17 H;  2ZXR A;  3HRZ C;  3BU2 A;  3RLO A;  5HGT A;  2M2L A;  4LFC Q;  3PCO B;  4RHR A;  2Z9H A;  1M4V A;  3DHQ A;  4A3F H;  2Z4H A;  2O4X A;  2B2U C;  1LTG D;  2E2H B;  1Y8P B;  4JBM A;  3QJY A;  3OYY A;  2KOL A;  1MJE A;  2I07 B;  1EY9 A;  2EJM A;  1S5F D;  3TZD A;  2B3G A;  5IYB H;  1K83 B;  2NB0 A;  1PH1 A;  1TWH B;  5IY0 A;  1NNX A;  4R8I A;  1J9O A;  4EX5 A;  5COR A;  1BCP F;  1HZA A;  2TMP A;  1TWG H;  3S15 H;  3NWT A;  2KBN A;  2UU9 L;  3CMA A;  2PNH A;  4AH6 A;  2JEA I;  1EWC A;  2O5J C;  4M8A A;  1LTT D;  4EQP A;  3BDL A;  2E76 C;  3FHW A;  2OEO A;  4A3J B;  2O5I C;  3S1N H;  1HA5 A;  2F0J A;  3S2D H;  2DY7 A;  1CI3 M;  5C0X G;  5KNB A;  1QNK A;  1HA6 A;  3QG1 A;  3P1H A;  1XNR L;  4DV7 Q;  1D8L A;  1B8A A;  2B8F A;  3W3A A;  4KD4 A;  4IUQ A;  2V1C C;  2K7V A;  1FJG L;  1Z47 A;  5C4X H;  3BYT B;  2F0D A;  2DN8 A;  1WTR A;  4K5X A;  4A3K H;  4O2D A;  1UUP A;  4G4K A;  4WOR A;  1MGS A;  4TSS A;  5C3E B;  1QG7 A;  2L11 A;  1CFM A;  2LKV A;  4KY5 A;  4BY7 B;  4DPG A;  3CRL C;  3M9B A;  5J39 A;  3F2C A;  2CHB D;  2Y0S G;  5H1S E;  1EYA A;  3NBH A;  1Q12 A;  5COY A;  2K6A A;  1H9R A;  3KLS X;  4DXF A;  1IZ6 A;  2MP1 A;  3OPO A;  4NXM Q;  2D2C C;  4JI8 Q;  1X3P A;  3S1R H;  4DAM A;  1K8O A;  4CBV A;  2B2Y C;  3R93 A;  4O42 A;  1SJE D;  2LS0 1;  5ELN A;  2R93 G;  1EZ8 A;  2NVT B;  1M1K C;  1IYU A;  3DM1 A;  1VS0 A;  3AFQ A;  4DV3 Q;  5FO9 B;  3P75 A;  1H95 A;  2E75 C;  1PTO F;  4R4I A;  2GVB A;  5EPL A;  2A73 B;  4A3I B;  1YVC A;  4B3R L;  5IT9 E;  3OIQ A;  4PNY A;  3HOY B;  5FK9 C;  3R2T A;  3NWS A;  1JOK A;  4UP9 A;  1AH9 A;  4FXK C;  2NYZ D;  2XGT A;  2A6E C;  4UP7 A;  4U67 3;  2RF4 A;  1T5X D;  1RKN A;  1YIJ A;  5CMD A;  1UNS A;  5C5L A;  5JVG 3;  4IUT A;  4OO1 I;  1Z6H A;  2XWB B;  4DAY A;  5T1G A;  4ID6 A;  2IX0 A;  4C1N I;  3KBX A;  2XSC A;  1YI2 A;  1I5F A;  4BBR G;  1K0R A;  1YZ6 A;  4B3T L;  1CTM A;  2VB2 X;  2PCF B;  5CBE E;  1W6J A;  2HCI A;  4OIK A;  4TKO B;  5GAE C;  2B8G A;  4DAV A;  1GUN A;  4OX9 L;  1LT4 D;  2UUA L;  1SYB A;  2F0H A;  1OXX K;  4JV5 Q;  3UDF A;  1XWE A;  2F0U A;  5NUC A;  2VQF Q;  4A75 A;  2N78 A;  3K6O A;  2EYM A;  1DOK A;  1SYE A;  4HCE A;  2IT1 A;  4LWC A;  3I4N H;  4QUC A;  2WV6 D;  3S1Q B;  4IFD G;  4B9W A;  2Q8R E;  1RL2 A;  2ZM6 Q;  2EYJ A;  2ID0 A;  4P75 A;  1D5M C;  2KEC A;  1I4X A;  2NN6 G;  3BZC A;  2K5N A;  4UP8 A;  3S24 A;  1Y14 B;  3J80 c;  5C0X J;  2B2V A;  3AYH B;  2XNA C;  5LMN Q;  1SNQ A;  3JAM L;  2GVA A;  3E3X A;  1V43 A;  4KD3 A;  4RGN A;  2SEB D;  3OOC A;  4GN5 A;  4XIG S;  1KIX A;  2JA6 B;  4HMJ A;  1LO5 D;  2CWP A;  3S14 B;  4S3S A;  3RZO H;  1Q1E A;  4X65 L;  3MEH A;  3K5O A;  4ZK9 B;  3SK5 A;  2QDB A;  1CK1 A;  4JW0 A;  4HIK A;  1Y1W H;  2VUM H;  2F3V A;  2F4V L;  1U9R A;  1PH2 A;  3PIO A;  4FF1 A;  2AQ3 B;  3M4O H;  5FLX L;  1Q7Y C;  1I6H H;  1U4M A;  4RA8 A;  2EOT A;  1UE5 A;  4PZ8 A;  5BN5 A;  4P2C B;  3MHB A;  2R92 B;  1I4Q A;  4LFA L;  1IYV A;  3HKZ G;  1X56 A;  4YCV A;  2DY8 A;  4RGM A;  3DWA A;  5IGB A;  3J81 E;  1STY A;  3M4P A;  1DOL A;  1B4O A;  1EFI D;  4AYB G;  3UDX A;  3CC4 A;  1SNP A;  4RGO S;  3GDE A;  2WII B;  2AWO A;  1XNQ L;  1LTS D;  2Q2U A;  4X64 L;  2A68 C;  2NZH A;  3A7L A;  3WOF A;  1TY0 A;  2E74 C;  2UUB Q;  1PRT C;  1CA5 A;  2HDM A;  2LFN A;  1SAP A;  1VQ8 A;  3H3V I;  1V1P B;  3EIV A;  4QJF A;  1IBK Q;  1IKL A;  1QCB D;  2Z8L A;  1J5E Q;  1GKH A;  5L37 A;  3T1Y L;  1IW7 C;  3BVM A;  1TWH H;  4TRD A;  1GJX A;  3KLS A;  2MPM A;  4ULL A;  4XT1 B;  3U50 C;  1S5D D;  4Y7N H;  1LUZ A;  5E4X A;  2B63 B;  1X3F A;  3IRB A;  3OWF A;  1XYI A;  1E1T A;  4GKK Q;  4I7Z C;  1LT6 D;  5C4Z A;  5M5W B;  5IYC H;  3PO2 H;  5C0X I;  2J7Z A;  1D1K A;  2E8G A;  2NZ1 D;  3SHL A;  2VQE Q;  2WKC A;  2I0Q A;  3M3Y B;  4ZLT F;  4MHE A;  5A2Q L;  2QDL A;  4YWK A;  2A5H A;  1ZYR D;  2BH2 A;  1DCZ A;  2A19 A;  3N52 A;  1CSP A;  4LUO A;  1I4R A;  1N33 L;  3PUY A;  1EQQ A;  4IPD A;  4GNX B;  3HOX G;  1KRT A;  5FKA C;  4CJ2 C;  1QUQ B;  4DK3 C;  2L15 A;  1BXT A;  1SJH D;  4XYO A;  3KDF B;  4PG3 A;  1X55 A;  1L0W A;  1VDZ A;  1L0Y B;  4C3H G;  3CHB D;  5C3E H;  1F2M A;  2PW5 A;  4R4T A;  2EE1 A;  5IT9 c;  4BY7 H;  3HKS A;  4FXD A;  1HZB A;  3DEP A;  2G9D A;  3WOE A;  4IFD J;  3A5U A;  2F1M A;  2XN9 C;  2R61 A;  1D5X C;  5HGQ A;  4GLA C;  2Z6K C;  3VYT A;  3NXW A;  3TEH B;  2RSN A;  1A2T A;  3RD4 A;  2AQ2 B;  4L6T B;  3K5M A;  4DUY Q;  4B3M L;  2F0E A;  2NVY B;  3KF6 B;  5FOB B;  3SVM A;  1WD1 A;  1AZQ A;  2BDN A;  3GQB A;  1UEA B;  3G71 A;  3GTP B;  3T1H Q;  5KND A;  4OON A;  2RVL A;  4P72 A;  3J81 j;  2IX1 A;  1EWI A;  2KQ3 A;  4H02 A;  1SE4 A;  3MZ5 A;  3H3V C;  3G6J B;  2KED A;  2Z1C A;  1LAC A;  1PV4 A;  3HOW G;  4DV2 L;  2Z0S A;  2K5D A;  1VQ6 A;  3LX0 A;  4KKS A;  3LGJ A;  2JN4 A;  3H0G G;  4MZ9 A;  1KAA A;  1HUN A;  1R9T H;  1F9Q A;  3MWY W;  1OTC A;  4YHH Q;  3HOY H;  4HCS A;  3AMU A;  1QIL A;  1JWS D;  1CZW A;  3A8J E;  2NZO A;  3D31 A;  4RCN A;  2WAQ B;  1NR2 A;  3PGZ A;  4ZKB B;  1EZ6 A;  1JJC B;  4KI0 A;  5J22 A;  1JMC A;  3BVG A;  2D62 A;  3LWU A;  1YJW A;  4I7A A;  4A3D G;  2RBM A;  3MAQ A;  1KQS A;  3CC2 A;  1KRS A;  2OQ0 A;  3MXU A;  2WB1 E;  3JC6 6;  3D4W A;  3Q23 A;  4A93 H;  4FP5 D;  1NJI C;  4G7Z C;  4N8F A;  3VR6 A;  2PZW A;  2RHS B;  4DFA A;  1CQV A;  4GOP C;  1X6O A;  3PV0 A;  1YJ9 A;  3I90 A;  4R1J A;  4A3G B;  1JWU D;  2VB3 X;  4DK0 A;  5C3W A;  4IFD I;  3TZU A;  1VQH A;  4LF7 L;  2J4X A;  2KCM A;  1LV9 A;  4UHV A;  1ML0 D;  4CJ1 B;  2R7Z B;  3S1Q H;  4FXG C;  4JPB W;  2NN6 I;  1XMQ Q;  4GS3 A;  1PDQ A;  2N49 A;  3T4A C;  2NUC A;  1HNW L;  4HIO A;  1LAB A;  3I3C A;  4JI6 Q;  4K2L A;  4DXG A;  3J81 c;  1JOO A;  1PFS A;  2ZT9 C;  1AW7 A;  2IHE A;  5FLM H;  2CH4 W;  3RMH A;  1A6X A;  1HXY D;  4WJW A;  3V05 A;  3J7A V;  2HHH L;  2JA6 H;  1EIY B;  3S14 H;  2NVQ B;  3CAM A;  1PH4 A;  4ZUI A;  5IYD H;  4H0L C;  2Q8I B;  4X62 L;  5IP7 H;  4CDE C;  1O7L A;  4AIM A;  4DR5 L;  2MJ8 A;  1ONL A;  3NP8 A;  3FDT A;  5IOD A;  4JI7 Q;  2UXD Q;  2NTS A;  3A74 A;  4DUZ Q;  2JSO A;  3HOZ G;  1SSO A;  2CFM A;  2HUG A;  4HID A;  2R92 H;  5I4D A;  1Z7T A;  4BY1 G;  4JG2 A;  1GUO A;  3PUX A;  5FO8 B;  3CCE A;  4KY6 A;  1OXV A;  1CHP D;  4YY3 L;  1BQQ T;  3S16 B;  4A3C H;  5FO7 B;  4NXN L;  2R7F A;  3FMC A;  1R4P B;  4DV1 L;  1GXD C;  1ILQ A;  3MTS A;  1G2S A;  2UUC L;  1YHA A;  4UY8 C;  1SYC A;  4G7H C;  1EY4 A;  1B70 B;  1BDO A;  1CT1 D;  3AB9 A;  1XPO A;  2EPB A;  5IOC A;  4JI3 Q;  3NTI A;  4QQB X;  4YCW A;  5I9O A;  1B9M A;  1PH6 A;  3RN5 A;  1W2B A;  1JIC A;  4DV0 Q;  4FF4 A;  2KHI A;  4C2M H;  3GTL B;  4DR1 L;  1VQE A;  4HN7 A;  1FYC A;  1L1O C;  1C7Y A;  1LLR D;  3VYS A;  4L5T A;  1SNO A;  3LWE A;  4A3M G;  2UXC L;  1I4H A;  1NUC A;  4C1N K;  2EY2 A;  2F3I A;  3NBI A;  2RDH A;  4NW2 A;  4J1M A;  2JA9 A;  1STE A;  5CV9 A;  1QB5 D;  2PQA B;  4LF5 L;  5CYU A;  2EYL A;  4F87 A;  5C44 B;  2XRQ D;  3K7A B;  1B50 A;  5ELC A;  1BOS A;  4DR7 L;  2BH8 A;  1HZ9 A;  4OO1 H;  2GA4 B;  4YCU A;  1C48 A;  5M5W H;  2YU9 H;  3E9H A;  4JI4 L;  4R9W A;  1H9S A;  2VY3 A;  4DAY B;  1HJP A;  4KY7 A;  2A68 D;  4WFN 3;  4EQO A;  3RZO B;  3M3Y H;  1E2W A;  1PRT D;  1B3A A;  4X3K A;  2VW9 A;  3NK9 A;  1HR0 W;  3M4Q A;  3NEL A;  1NE3 A;  4F88 A;  1HPC A;  3PMF A;  2RSO A;  1HNX L;  3BDO A;  2K5V A;  2FMM A;  1JJ2 A;  2UU9 Q;  3Q8D A;  1S5C D;  3M4O B;  1DZ1 A;  1I6H B;  3PQI A;  3RUZ A;  2Y0S E;  4HMI A;  3BZK A;  4IUP A;  4DNR B;  2HIV A;  1Y1V H;  3I4L A;  2Z4I A;  1ENF A;  4K5V A;  3QIA A;  3X3N A;  4K0K L;  1KDB A;  4IOC A;  3IAY A;  2EQS A;  1JE5 A;  4A3F G;  4BWG B;  3GP7 A;  3CCV A;  5BR8 Q;  1NAP A;  5M5X B;  2C9O A;  1VQK A;  1XNR Q;  4FYD A;  4XDX A;  3FRP B;  1VQA A;  3CCS A;  1K8G A;  3PSI A;  4RAU C;  4DR6 L;  1AFP A;  2F0Q A;  1QVG A;  5KEE A;  4N9T A;  1LTA D;  3CME A;  1FJG Q;  1PHJ A;  2CWA A;  3H94 A;  2JA5 G;  5IP9 H;  3CU7 A;  4F8M A;  3NE5 B;  1ZXT A;  3SK8 A;  1KDA A;  3FVQ A;  3OW2 A;  1WTX A;  2NVY H;  4LNQ A;  1HFN A;  2RCN A;  1ZYR C;  4Q0F A;  3GTP H;  4DV5 Q;  1G6P A;  3GTM B;  2F0G A;  1X3Q A;  1K8A C;  1EIG A;  3QR8 A;  1XMO L;  1S72 A;  1ICF B;  1CZG A;  4Y7N B;  2N55 A;  3I4M G;  3HFZ B;  1STN A;  3TSS A;  1SE2 A;  2K75 A;  3NQT A;  5CV4 A;  5EQ0 A;  1VQP A;  2EXD A;  2ZTE A;  4RKL A;  1F2Y A;  4U68 A;  5C4X G;  2KVM A;  4O0A A;  3PO2 B;  1N32 L;  3J80 i;  3UE0 A;  2SNM A;  1TWA H;  4AYB B;  1CKM A;  1WCM H;  5FJ8 H;  1VQC A;  3GD7 A;  4P74 A;  5CGK A;  2E2J H;  2Q2I A;  2YTV A;  5BR8 L;  5I6Y A;  2EXZ A;  5JVH 3;  2K1B A;  4ZCK A;  3F2U A;  3M7N A;  4EQN A;  2PW7 A;  4B3R Q;  1LT3 D;  1T9H A;  1E0B A;  1CA6 A;  4GOP A;  3LNN A;  2F0W A;  1NCV A;  4XT3 B;  1FD7 D;  1FVI A;  1ET9 A;  4RFB A;  1YJN A;  5DNF A;  5T1I A;  3VA7 A;  1WTQ A;  3K5L A;  4PV1 C;  4A3E G;  3CD6 A;  1P16 A;  4KLK A;  1EY8 A;  4DV5 L;  3C3L A;  1W6K A;  3KFU A;  1BBX C;  1JR0 D;  3NUC A;  2K03 A;  1X65 A;  3P20 A;  5C4J B;  5GQO A;  4IUR A;  3HOV G;  4B3T Q;  2IJ0 A;  4A3G H;  2E5L L;  1WTP A;  1IBL Q;  4B08 A;  5IGG A;  3L2P A;  1N36 L;  2R7Z H;  4DR4 L;  5C0X H;  4XQQ A;  3HOU B;  4A3B B;  4OX9 Q;  1A62 A;  1TKW B;  2L9H A;  2UUA Q;  3J7A F;  3T56 B;  2E2D C;  2F3W A;  1WI5 A;  2LMC B;  5EKI A;  2K4K A;  3GTK B;  5LHY 1;  1C4Q A;  1G29 1;  3HOX B;  2CW0 D;  4C3J G;  1PTO D;  1PYS B;  3ONA B;  4BS9 A;  2SOB A;  3HKZ E;  1EY0 A;  4APV A;  2NVQ H;  4IN3 A;  2OXP A;  4JI1 L;  4G57 A;  4C3H B;  1XTD A;  1LTB D;  1TS3 A;  1UE6 A;  4GN3 B;  4G7O C;  4AYB E;  1R9T B;  3S2H B;  4IQZ A;  4GKJ L;  4HJ9 A;  1DXM A;  2OF1 A;  1AP0 A;  1SRU A;  4E6I A;  4PZ6 A;  5M3F B;  1FNV A;  1O80 A;  3UDG A;  3I70 A;  3VR4 A;  2K52 A;  4X65 Q;  3K0Y A;  4N9P A;  4L63 B;  1U0L A;  2XIW A;  3CCL A;  1SNC A;  3S16 H;  3HG9 A;  1TU2 B;  3HGB A;  4OXP A;  2F4V Q;  1LTR D;  1QOH A;  4HTH A;  1NY4 A;  1EYD A;  3J7Y W;  4KHV A;  3V96 A;  1IBL L;  1ASY A;  3STB D;  3T51 B;  1WTH A;  1C0A A;  1F2Z A;  2DUD A;  4FF3 A;  1M8A A;  3I4N G;  5J3B A;  2PZU A;  2R93 H;  3QOJ A;  2F0K A;  1L1O A;  1DYQ A;  2VXW A;  4A93 B;  3M4Y A;  3MC0 B;  1YHB A;  4LFA Q;  4IZ8 A;  1LYL A;  4OWX B;  3H0G B;  4DKA C;  2I5L X;  3GTL H;  1V9P A;  1YNN C;  3D4R A;  1AE2 A;  4HR7 B;  3ZYY X;  2DGY A;  2PMZ B;  1G8Z D;  5M5Y B;  5JOB A;  2F0V A;  3ER0 A;  4DF7 A;  1B3Q A;  1S5E D;  1KL9 A;  1XNQ Q;  1JOQ A;  5M3M B;  4Z9C B;  1EY5 A;  1EL0 A;  2CQA A;  1Y1W G;  4X64 Q;  5C44 H;  3PIO 3;  2VUM G;  5EGT A;  3K7A H;  2JJQ A;  1I50 H;  1B44 D;  3MXG A;  3EA6 A;  1KHI A;  5BN4 A;  4QB4 A;  1LTI D;  3NPP A;  4JC0 A;  3KLW A;  4TVA B;  1AEX A;  1RTO A;  3T1Y Q;  1TWF B;  3QO2 A;  4LUZ A;  2K01 A;  4LMQ D;  3BDC A;  2CH4 A;  2HIX A;  4MN3 A;  1UWV A;  3PO3 B;  2K04 A;  4OWW B;  2EDG A;  4JI5 Q;  2JA7 G;  1WFQ A;  1L0X B;  2I5M X;  2LXJ A;  3HS0 C;  5JPN C;  1F9S A;  1SRO A;  4Y52 H;  4ME5 A;  4KTA A;  4WJ4 A;  1TQO A;  1F2L A;  4IFD H;  1EUJ A;  2F0M A;  2UXB L;  3E0J A;  2K33 A;  4KHP L;  4IJL A;  1C9O A;  5M5X H;  1TR5 A;  2A6H D;  1I94 L;  1MSH A;  3URY A;  1U4R A;  1N33 Q;  4TQU S;  4PMC A;  3OTO L;  3KYH C;  1X32 A;  3OSO A;  4CDC C;  3J80 L;  2F0N A;  4NMZ A;  3QWN A;  3VR2 A;  2PMZ E;  3F2D A;  1G2T A;  4QL5 A;  2B2W A;  1B1Z A;  5CC4 A;  4ME3 A;  4C2M B;  1DM0 B;  3ICE A;  2BDO A;  1A3T A;  2D0O A;  4HSP A;  1K9M C;  5IYC G;  2JK8 A;  1FGU A;  4A3J G;  2PPB C;  3IFD A;  3GTM H;  1IXR A;  2OQK A;  4DU9 A;  4NPS A;  1HNZ L;  3BYY B;  1E2V A;  1TWC B;  2A69 D;  4JI2 Q;  4JI5 L;  1HCZ A;  4A3L H;  1EU4 A;  3A8K E;  4J15 A;  4B3M Q;  1SFO H;  4J8Q A;  4HIM A;  1ET6 A;  2YU9 B;  1JOR A;  3ERO A;  1VQ7 A;  3J81 i;  2XWJ B;  4HED A;  1OO9 B;  4BBS B;  3A7A B;  2Q2T A;  4LF8 L;  4DV2 Q;  3GTG B;  4DN4 M;  1PRT B;  4XQN A;  1SYG A;  2EYF A;  3DUZ A;  4BY7 G;  4H44 C;  1ILP A;  4OIJ A;  3GTJ B;  3CPW A;  4EVO A;  1MIU A;  3RR5 A;  1Y1V B;  4LJZ C;  4IPC A;  5DM6 3;  1BCP C;  4X66 L;  2ES2 A;  1SMX A;  1JB7 A;  2FXQ A;  3CW2 C;  5G3L D;  2WB1 B;  2H1E A;  3NHH A;  3I55 A;  1NTG A;  1AN8 A;  1TII D;  3Q22 A;  1GUT A;  3Q24 A;  5LL6 X;  4A4I A;  1O7I A;  5C4J H;  3E5S A;  3B6Y A;  1B7Y B;  2QCP X;  4LF4 L;  1EQR A;  1UE7 A;  4JI2 L;  3L3O C;  3HOU H;  1K3R A;  3AEV A;  1IL2 A;  1H9S B;  4A3B H;  1L2F A;  2AUJ D;  3RN2 A;  4C3I B;  4A3I G;  1KXL A;  3TP6 A;  1PZK D;  1Y8O B;  3GTK H;  2EYO A;  3HOY G;  3CC7 A;  3HOX H;  2MUY A;  2IWH A;  3RLN A;  4LF7 Q;  1VQF A;  4I65 A;  4UPA A;  2H5X A;  2D5D A;  1HFG A;  4C3H H;  1XXG A;  4JCV E;  1E3P A;  1TS4 A;  1HNW Q;  4KKU A;  2Z6B A;  4DAP A;  1D2B A;  3E0E A;  3FKI G;  1BBW A;  5I2X A;  1UEB A;  3S2H H;  3C1F A;  1YNX A;  4B3S L;  1TWA B;  1WCM B;  5AJ3 L;  2B2T A;  2HHH Q;  4K14 A;  3FPU B;  5IT9 L;  5M3F H;  2E2J B;  1WVL A;  3CF5 A;  4RHS A;  1GOZ A;  2DNC A;  4OHJ A;  3GTQ H;  4LFB L;  3ZJY C;  4X62 Q;  4CDD C;  2V4D A;  5J1Z A;  1KC8 C;  3F2B A;  2LXK A;  1YNJ D;  2ZJR A;  4FO2 A;  4GLX A;  1ENC A;  5CV8 A;  4DR5 Q;  3MEF A;  1D1I A;  3H09 A;  3CRK C;  1X3G A;  4C56 C;  5GAH C;  2QEJ C;  3TDQ A;  1B9N A;  4FF2 A;  4GLV B;  3U58 A;  3KK7 A;  3A0J A;  2HD3 A;  4MTK A;  3I91 A;  3ULL A;  4L8J A;  2A8V A;  4NP5 A;  3HOW H;  2CW0 C;  4LK1 C;  1PTO C;  3W5O A;  2FMC A;  1KAW A;  2IHF A;  1VQB A;  1TT2 A;  1SYF A;  3H0G H;  3ND8 A;  1SBB B;  4YY3 Q;  1DD2 A;  2AMC B;  1SMY C;  5FLM G;  2EY6 A;  4NXN Q;  1O7Y A;  2K5H A;  1I4P A;  4DV1 Q;  3HEJ A;  1OXS C;  5M5Y H;  3A8I E;  4O1N A;  2UUC Q;  3EVQ A;  2YYZ A;  5JEA G;  5IYD G;  4ZRZ A;  1VQL A;  5M3M H;  4LW1 A;  5IP7 G;  1STH A;  1HR0 L;  1RCV D;  4IUN A;  2ZTC A;  1HTP A;  3D6C A;  1VQN A;  4K6L A;  5D3D A;  2PQE A;  2I5H A;  4DR1 Q;  1WD0 A;  1N8R C;  2JA8 G;  2EIF A;  3K7U C;  3CQZ B;  5EBD A;  1O78 A;  1TS2 A;  1LM0 A;  3H15 A;  5E1F A;  3SR1 A;  4K8I A;  2UXC Q;  2R92 G;  2WAC A;  1FNU A;  1TVX A;  1TWF H;  3STB C;  4DV6 L;  5CV5 A;  5KRU A;  3EN2 A;  1DGS A;  1YNN D;  1SE3 A;  2JXM B;  2X69 A;  4GOP B;  2XTI A;  5CV7 A;  1U4L A;  2B29 A;  4LF5 Q;  3PO3 H;  3PIP A;  3I7F A;  3DWP A;  5GAD C;  3TP5 A;  1YEZ A;  5I9P A;  1SXT A;  4LF6 L;  4DR7 Q;  1E7Z A;  4JI4 Q;  1H9M A;  3G7L A;  2Y0S B;  4BA2 I;  1VMC A;  3M7G A;  1WJJ A;  2J0T D;  2EYH A;  4JOI A;  3NBH B;  1HNX Q;  3S1M B;  5JJL A;  3PF5 A;  4V19 0;  1ZKO A;  3L7Z C;  4JBJ A;  4QIW B;  1N34 L;  2KEN A;  1STG A;  5KNC A;  4C3J B;  4JK1 C;  5LMU L;  1GVP A;  2KJX A;  2OTJ A;  2R93 B;  5D3I B;  3I4O A;  4DK1 A;  1PYB A;  3J81 L;  4HSV A;  4K0K Q;  3KJO A;  2E2I B;  1MHW C;  1IYJ B;  1RIP A;  2B63 G;  2F03 A;  3E9I A;  4IUU A;  2MGS A;  4DR3 L;  2A74 C;  2K32 A;  4DR6 Q;  2ICI A;  2ICE C;  2F52 A;  4JI0 L;  1D7Q A;  3HOZ H;  1E2Z A;  1KNE A;  1V1O A;  2IY5 B;  1N9W A;  3NTH A;  3OIP A;  4BY1 H;  1TWC H;  4UDU C;  3D6W A;  1X3E A;  2P5Z X;  4GNX A;  3D8G A;  4K5W A;  1JE4 A;  1I50 B;  1QUQ A;  5F2D A;  5K36 G;  5ELB A;  1GHJ A;  4BBR B;  4AQY L;  3T53 B;  2A6H C;  1TXY A;  1HRJ A;  1BKB A;  2FIN B;  3CCQ A;  4BBS H;  3QB3 A;  2ASB A;  1XMO Q;  4BXX H;  5A35 A;  3JAM E;  5IWA L;  3GTG H;  4OEM B;  1PH7 A;  3NQI A;  1BUV T;  1L1O B;  4L5Q A;  4RCO A;  1VMP A;  2QEX A;  4RWS C;  3GTJ H;  3IKJ A;  3SK4 A;  1S4Z A;  4CDF C;  2F0F A;  3RNU A;  2Q8T A;  1N32 Q;  2MO1 A;  2NBF A;  1SYD A;  4ZUJ A;  3KF6 A;  5FLX E;  1YHQ A;  1JCK B;  4OGQ C;  3SGI A;  4RKB A;  4H7B A;  3I2Z A;  3U4V A;  4DK6 C;  5JPM C;  1V8Q A;  2IX3 A;  4QIW E;  2YTX A;  4RG1 A;  2A69 C;  3DMU A;  2I46 A;  1RDP D;  1PRT F;  5JEA J;  2WIN B;  3N6R A;  2R3Z A;  5IYB G;  4JYA L;  2SDF A;  3DLL A;  3A55 A;  1IKM A;  1B2T A;  5DAU A;  2CCZ A;  5ISR A;  3UE1 A;  5JJZ A;  1S40 A;  3OMC A;  4C3I H;  4ALP A;  1Q86 C;  1WYD A;  2RQX A;  1F9R A;  1BCP D;  1E22 A;  2CQO A;  1SLJ A;  4KK7 A;  1JC7 A;  4DR2 L;  2B2W C;  2RA4 A;  3J7Z C;  5FJ8 G;  3OHX C;  2E5L Q;  1Q46 A;  1KTK A;  5I6W A;  1N36 Q;  1PXU A;  2WAQ G;  1QZH A;  2PO4 A;  4DR4 Q;  3ITP A;  1PA6 A;  4LF9 L;  4JBK A;  1PFM A;  2X6G A;  1E24 A;  4POG A;  3HKZ B;  5EPJ A;  2LY7 A;  2D0P A;  1PZJ D;  1SFO B;  2WKD A;  2C35 B;  3K57 A;  2D9U A;  3GV3 A;  4A3K G;  3K80 C;  3KUP A;  4HAE A;  4MNO A;  5CV6 A;  2JA5 H;  5K5P A;  1XX8 A;  3KF8 A;  2VL6 A;  3CCJ A;  3BVZ A;  4JI1 Q;  2JYO A;  4IOA A;  1EWH A;  3MXN A;  4WJ3 M;  5A2Q E;  3EQL C;  2JE6 I;  4IO9 A;  2JEB I;  3Q6S A;  3W1G A;  4A3G G;  1W3S A;  4KV6 A;  3H3V H;  4GKJ Q;  3VYU A;  2R7Z G;  1IL8 A;  1VQ4 A;  3K58 A;  4POF A;  2OTL A;  3V2T A;  2MNA A;  3PUW A;  2KCN A;  1P8L A;  3FEW X;  3I4M H;  2JP1 A;  1BR9 A;  4HJ8 A;  1XPU A;  1PH9 A;  5EAY A;  3O13 A;  1EOT A;  4EGV A;  3CCR A;  4LFC L;  2JQO A;  1S5B D;  2CVR A;  1CKN A;  3ERQ A;  2DNE A;  3FP9 A;  1VF5 C;  2HQL A;  3PUV A;  1J8I A;  1VQ5 A;  2RDF A;  3TP8 A;  1K3B C;  1RJT A;  1E1O A;  1VQO A;  3E6Z X;  1HUM A;  2HQE A;  2L12 A;  3CQZ H;  2ALY B;  1YNJ C;  3I72 A;  1YBY A;  2SNS A;  1LT5 D;  1PTO H;  5ELE A;  3GTO B;  1SMY D;  2PI2 A;  1Q3L A;  4OEL B;  5KYL A;  1JQY D;  1MD2 D;  1EY6 A;  2F0L A;  4A3E H;  3J7A 5;  4PZ7 A;  4X6A H;  4HJA A;  3TBI B;  2N3S A;  3GV6 A;  2EYP A;  5D65 A;  3HOV H;  1QZG A;  2KUM A;  1I3Q B;  2AUK A;  1NMF A;  3M85 A;  2DJG C;  1A63 A;  4DV7 L;  3GTQ B;  4ZAI A;  1RTN A;  1Z9F A;  2B2T C;  2QF7 A;  3BS1 A;  4IJH A;  2BE5 D;  2MHV A;  5JJK A;  3S1M H;  5M9O A;  3TRE A;  3X3M A;  1EY7 A;  2OWO A;  2ZXO A;  2PQA A;  4C3J H;  5IGC A;  1K73 C;  4DV4 Q;  1HH2 P;  2WFW A;  3QOL A;  3D3R A;  1SNM A;  2KHS A;  4LUV A;  1EEI D;  5GAG C;  3HOW B;  4FVM A;  2BCO A;  3JAM c;  2E2I H;  4P71 A;  3RLF A;  1ROD A;  5C44 G;  2IL8 A;  2UXB Q;  1G6Z A;  4KHP Q;  2DJF C;  1BVS A;  3GO5 A;  4DA2 A;  3SEB A;  1I94 Q;  2MFI A;  5EKL A;  3FKI B;  1PMR A;  4PMB A;  3OTO Q;  3A54 A;  5FLX c;  2MO0 A;  1X54 A;  1Y69 U;  4R8N A;  4NXM L;  1D5Z C;  1H9K A;  1SR3 A;  4KN7 C;  4JI8 L;  4CHT B;  4KMU C;  2K50 A;  5JAV A;  4A3D B;  4A76 A;  4K6D A;  2EVB A;  2IPK D;  1EYG A;  3VDY A;  1XJV A;  4NKL A;  4OWT B;  4BBR H;  2K14 A;  4N8X 1;  2PNR C;  3NEM A;  4DGZ A;  4KJN A;  1JWM D;  4RH6 A;  4RGT A;  4DV3 L;  3CPF A;  3KLR A;  1KDC A;  2AKW B;  2M00 A;  1HNZ Q;  3TS2 A;  5IGE A;  3I8Z A;  5CR3 A;  4XTC S;  2B39 A;  2ZXP A;  3T13 A;  4KKT A;  3EFX D;  4HJ5 A;  1Y8N B;  5ELF A;  2NVX B;  3MA2 B;  3RZD H;  5C6A A;  2YTY A;  4JVZ A;  3SDZ A;  5EJW A;  4Q5V A;  4CKC A;  1VQM A;  2RDG A;  4DV4 L;  1HQR D;  2EJF C;  2F0S A;  3HZX A;  4R4Q A;  5KYI A;  3AU7 A;  3A5Z B;  4XXE A;  1EFW A;  1QVC A;  3PF4 A;  4R4C A;  1G91 A;  4YIJ A;  5IGD A;  2VS1 A;  4LF8 Q;  2OT2 A;  1S3O A;  1PH8 A;  1FR3 A;  2NN6 H;  1M90 C;  1WOC A;  3VR5 A;  5CBA E;  2AHO B;  1CQF A;  1GUS A;  3C46 A;  5E4W C;  2K05 A;  2JA8 B;  1STB A;  4JOI C;  1GD7 A;  4HJ7 A;  4X66 Q;  2HDL A;  1BBU A;  4ODG A;  4JV5 L;  3K81 C;  3BZD B;  3FPP A;  1A3U A;  5IE8 A;  4A3L G;  2VQF L;  4QGU A;  1DOM A;  2L5T A;  4XQJ A;  2JA7 H;  3R3O A;  3PO2 G;  4K8J A;  1VCI A;  1KAB A;  2B2U A;  3HOZ B;  4LAA A;  1CKO A;  1XPR A;  4LF4 Q;  3U9S A;  2ZM6 L;  1NBW A;  3SXH A;  4F7X A;  4BY1 B;  1QVF A;  1BF4 A;  1K0S A;  2ZJQ A;  1HZC A;  3P7J A;  1ENA A;  3I73 A;  5C5M A;  3BG3 A;  2E2H H;  1G51 A;  2KHJ A;  3ULP A;  5LMN L;  1U5K A;  1VQ9 A;  3PUZ A;  4GNX C;  5AFW A;  3H91 A;  2O2L D;  2FJ2 A;  1V1Q A;  3NTK A;  2Q2H A;  1HTL D;  2IW3 A;  1K83 H;  2KA7 A;  3C1E A;  2OCE A;  2LSS A;  3F8T A;  1RF2 D;  2EY1 A;  3G48 A;  4ZYS A;  5C3E G;  1AZP A;  3DWQ A;  3TS0 A;  4CGY B;  5JJI A;  3S9W A;  1NR4 A;  1II3 A;  4A3M B;  3DM3 A;  2F0T A;  4A3J H;  4K2K A;  1YIT A;  4B3S Q;  5AJ3 Q;  3HOU G;  2NWG A;  2ENB A;  4A3B G;  3K0X A;  3ND9 A;  3MFY A;  2F0I A;  5ELD A;  4LFB Q;  1T5E A;  2FHT A;  1PVO A;  1R4Q B;  1GHK A;  2K5Q A;  1GM5 A;  4J6H A;  4UAI A; 
#chains in the Genus database with same CATH homology
 2N78 A;  3NEN A;  1WJJ A;  2K75 A;  1VQP A;  2EXD A;  2ZTE A;  2IT1 A;  5C4X G;  4LWC A;  4JOI A;  3NBH B;  3BJU A;  4O0A A;  1HNX Q;  2UUB L;  3I4N H;  1N32 L;  5JJL A;  1LTL A;  3J80 i;  3PF5 A;  4IFD G;  3UE0 A;  1TWA H;  1RL2 A;  1CKM A;  1WCM H;  2ZM6 Q;  2ID0 A;  3L7Z C;  1VQC A;  3GD7 A;  4JBJ A;  4P74 A;  5FJ8 H;  2KEN A;  1N34 L;  4FDB A;  4IPH A;  4P75 A;  2E2J H;  1IBK L;  2Q2I A;  2NN6 G;  3BZC A;  2YTV A;  5BR8 L;  5LMU L;  2K5N A;  1GVP A;  4UP8 A;  3S24 A;  1Y14 B;  1J5E L;  3I4O A;  3J80 c;  2OTJ A;  1PYB A;  5C0X J;  3AYH B;  4K0K Q;  3KJO A;  5LMN Q;  2GVA A;  1V43 A;  3M7N A;  3CP0 A;  5M3F G;  4XIG S;  1IYJ B;  1RIP A;  4GN5 A;  2B63 G;  1KIX A;  4B3R Q;  3E9I A;  1T9H A;  1OXT A;  3GTO H;  2CWP A;  2RHQ B;  4DR3 L;  3RZO H;  1Q1E A;  4DR6 Q;  4X65 L;  4GOP A;  1HR0 Q;  4R4O A;  4GKK L;  2F52 A;  4JI0 L;  1FVI A;  1D7Q A;  4HIK A;  3HOZ H;  1Y1W H;  2VUM H;  4KHZ A;  2F4V L;  1YJN A;  3PIO A;  1PH2 A;  1KD1 C;  2IY5 B;  1N9W A;  2VQE L;  3M4O H;  4IPG A;  1Q7Y C;  1I6H H;  3KJP A;  4A3E G;  4BY1 H;  1TWC H;  1I3Q H;  1X3E A;  1P16 A;  5E7N A;  3CD6 A;  2NVT H;  4KLK A;  4GNX A;  1J6Q A;  4A93 G;  1UE5 A;  4DV5 L;  3AQQ A;  1VQG A;  1A8V A;  3KFU A;  4DV6 Q;  3HOV G;  1QUQ A;  1X65 A;  4PZ8 A;  5K36 G;  5GQO A;  4B3T Q;  4A3G H;  2N8N A;  1CSQ A;  2E5L L;  1IBL Q;  3UDI A;  3EBE A;  4AQY L;  3L2P A;  1N36 L;  5LMN W;  4LFA L;  1TXY A;  2R7Z H;  4A3I H;  1BKB A;  4DR4 L;  2VNU D;  2AWN A;  3HKZ G;  1X56 A;  3CCQ A;  3ULJ A;  2R7D A;  4YCV A;  1A0I A;  4LF6 Q;  1FL0 A;  4OX9 Q;  4BBS H;  1JJG A;  1A62 A;  2UUA Q;  2ASB A;  1XMO Q;  3TQY A;  4BXX H;  3M4P A;  5IWA L;  3GTG H;  1WI5 A;  1PH7 A;  4AYB G;  2K4K A;  5M3M G;  3UDX A;  3CC4 A;  1L1O B;  2GN5 A;  3GDE A;  4L5Q A;  1G29 1;  2AWO A;  1XNQ L;  2QEX A;  3I56 A;  3GTJ H;  1PYS B;  2Q2U A;  4X64 L;  1CUK A;  3HKZ E;  2NZH A;  3RNU A;  4APV A;  4JBW A;  2NVQ H;  1MKH A;  2UUB Q;  1N32 Q;  1OXU A;  2MO1 A;  3FKI H;  1GO3 E;  3KF6 A;  2MQH A;  4JI1 L;  4BA1 I;  1VQ8 A;  1YHQ A;  2JA6 G;  3SGI A;  1XTD A;  2YV5 A;  1N34 Q;  3EIV A;  1IBM Q;  3H3V I;  1UE6 A;  3I2Z A;  4GN3 B;  4QJF A;  3U4V A;  4AYB E;  4DK6 C;  3CCM A;  1IBK Q;  5LMU Q;  4QIW E;  2YTX A;  1J5E Q;  1GKH A;  4MTN A;  4RG1 A;  3T1Y L;  4DUY L;  1TWH H;  4GKJ L;  4HJ9 A;  5JEA J;  3PO3 G;  1SRU A;  3U50 C;  4A3D H;  4Y7N H;  1LUZ A;  4PZ6 A;  5IYB G;  3T1H L;  4JYA L;  3UDG A;  1X3F A;  4DR3 Q;  3IRB A;  3KF8 B;  1E1T A;  2K52 A;  2ZTD A;  4X65 Q;  3DLL A;  3CCL A;  1U0L A;  2CCZ A;  4GKK Q;  3L0O A;  4JI0 Q;  3MXN B;  3S16 H;  3UE1 A;  5IYC H;  1S40 A;  4OXP A;  2F4V Q;  3PO2 H;  5C0X I;  4EQ5 A;  1NY4 A;  2E8G A;  4C3I H;  2VQE Q;  4ALP A;  1Q86 C;  1WYD A;  1ASY A;  1IBL L;  2I0Q A;  3STB D;  1C0A A;  1E22 A;  2CQO A;  2DUD A;  4YWK A;  3I4N G;  1SLJ A;  2NVX H;  5J3B A;  2BH2 A;  4A3C G;  3CXC A;  2R93 H;  2A19 A;  1L1O A;  4YHH L;  4DR2 L;  3J7Z C;  1CSP A;  5FJ8 G;  4LUO A;  2E5L Q;  1Q46 A;  1YHB A;  4AQY Q;  4LFA Q;  3PUY A;  2WAQ G;  1QZH A;  1N36 Q;  1N33 L;  1LYL A;  4OWX B;  4DKA C;  4IPD A;  1EQQ A;  2I5L X;  4GNX B;  4DR4 Q;  3HOX G;  5GRO A;  3GTL H;  3K8A A;  1KRT A;  4LF9 L;  1PA6 A;  1V9P A;  4JBK A;  1AE2 A;  1E24 A;  1QUQ B;  4POG A;  2DGY A;  4DK3 C;  2L15 A;  2BA0 A;  2A1A A;  3KOJ A;  3KDF B;  4PG3 A;  2D0P A;  5IWA Q;  1X55 A;  1L0W A;  3U4Z A;  1SN8 A;  2C35 B;  3ER0 A;  1CKN B;  4DNI A;  5C3E H;  1KL9 A;  2R6G A;  1XNQ Q;  4R4T A;  2WAQ E;  4A3K G;  3K80 C;  5IT9 c;  1VQI A;  4MNO A;  3CCU A;  1IBM L;  4BY7 H;  1Q8K A;  1Y1W G;  3HKS A;  4X64 Q;  5C44 H;  1HZB A;  2JA5 H;  2JA8 H;  2VUM G;  4IFD J;  1PH3 A;  3A5U A;  3K7A H;  2JJQ A;  2WP8 J;  1I50 H;  2VL6 A;  3CCJ A;  1Q82 C;  5HGQ A;  1KHI A;  4GLA C;  5DLQ E;  4JI1 Q;  4IOA A;  2Z6K C;  1EOV A;  3KLW A;  4JC0 A;  4TVA B;  1UE1 A;  1VQD A;  3G4S A;  4WJ3 M;  2JE6 I;  3TEH B;  4IO9 A;  2JEB I;  3W1G A;  4A3G G;  3T1Y Q;  1W3S A;  4OO1 G;  4LUZ A;  4DUY Q;  3H3V H;  4GKJ Q;  4B3M L;  3KF6 B;  4NB3 A;  2R7Z G;  4GN4 B;  1VQ4 A;  2HIX A;  3G71 A;  1UWV A;  4POF A;  3T1H Q;  2OTL A;  2KCT A;  3W1B A;  2MNA A;  4JI5 Q;  4OWW B;  2JA7 G;  4BBS G;  4JYA Q;  1WFQ A;  3TRZ A;  3PUW A;  2ZJP A;  4OON A;  3J81 j;  4P72 A;  1P8L A;  2IX1 A;  1EWI A;  1XMQ L;  4H02 A;  3I4M H;  4BXX G;  2I5M X;  2LXJ A;  4YWM A;  1PV4 A;  4HJ8 A;  1XPU A;  1SRO A;  1EIF A;  4DV2 L;  1PH9 A;  5EAY A;  2Z0S A;  4JI6 L;  3HOW G;  4Y52 H;  4WJ4 A;  4PMW A;  1VQ6 A;  3LGJ A;  3H0G G;  3KDF A;  4MZ9 A;  3CCR A;  4LFC L;  1EUJ A;  2JQO A;  2UXB L;  1SE8 A;  1Y1V G;  4KHP L;  4IJL A;  1R9T H;  1C9O A;  1CKN A;  3FP9 A;  5M5X H;  4P73 A;  1OTC A;  2HQL A;  4YHH Q;  4DR2 Q;  1Q81 C;  1I94 L;  3HOY H;  3PUV A;  1VQ5 A;  4YWL A;  4QY7 A;  3WWV A;  1N33 Q;  4TQU S;  1E1O A;  2QA4 A;  1VQO A;  3ERS X;  2NZO A;  3D31 A;  3OTO L;  3KYH C;  2WB1 G;  3PGZ A;  4LF9 Q;  2B63 H;  1MJC A;  1JJC B;  4KI0 A;  4JI7 L;  1JMC A;  2UXD L;  2ALY B;  3CQZ H;  2D62 A;  1X9N A;  1YJW A;  4A3D G;  4DUZ L;  1YBY A;  2ATW A;  1KQS A;  2PMZ E;  3F2D A;  3CC2 A;  4QL5 A;  4A3M H;  4ME3 A;  1NMG A;  3ICE A;  5IP9 G;  1JT8 A;  2D0O A;  2PI2 A;  1EYG A;  4L5R C;  1K9M C;  2CKZ B;  1KRS A;  5IYC G;  4A3E H;  2OQ0 A;  3J7A 5;  2JK8 A;  1FGU A;  2WB1 E;  3JC6 6;  4PZ7 A;  4X6A H;  1Q1B A;  3G6E A;  4HJA A;  4A3J G;  3GTM H;  1IXR A;  4A93 H;  1NJI C;  2OQK A;  2N3S A;  2RHS B;  4NPS A;  1HNZ L;  3HOV H;  4L5S A;  1QZG A;  4RMF A;  4GOP C;  2HT1 A;  1X6O A;  3PV0 A;  1YJ9 A;  4JI2 Q;  1NMF A;  3M85 A;  4R1J A;  1A63 A;  4JI5 L;  3D0F A;  4A3L H;  4JI3 L;  4J15 A;  4DV7 L;  4B3M Q;  1VQJ A;  1SFO H;  4IFD I;  1Z9F A;  1VQH A;  2BA1 A;  4HIM A;  4LF7 L;  2KCM A;  4IJH A;  1VQ7 A;  2VZA A;  5JJK A;  4DV0 L;  3S1M H;  2PI2 E;  3J81 i;  3S1Q H;  2NN6 I;  3JAM i;  3AFP A;  3F1Z A;  2Z6K A;  5ELO A;  3TRE A;  1XMQ Q;  4GS3 A;  2OWO A;  2N49 A;  2Q2T A;  2PQA A;  4C3J H;  4LF8 L;  1K73 C;  5HY6 A;  1AE3 A;  4DV2 Q;  1HH2 P;  2WFW A;  4DV4 Q;  4HIO A;  1ASZ A;  4JI6 Q;  4LUV A;  3J81 c;  1PH5 A;  2QGQ A;  5GAG C;  1PFS A;  1WCM G;  2IHE A;  5FLM H;  3JAM c;  3S17 H;  2E2I H;  4P71 A;  3RLF A;  3BU2 A;  4BY7 G;  3RLO A;  4LFC Q;  5C44 G;  3PCO B;  2HHH L;  3CPW A;  2JA6 H;  4KHP Q;  2UXB Q;  1EIY B;  1BVS A;  3GO5 A;  4A3F H;  3S14 H;  1MIU A;  3RR5 A;  1I94 Q;  3CAM A;  1PH4 A;  5IYD H;  2MFI A;  4IPC A;  4X66 L;  4JBM A;  4X62 L;  5IP7 H;  3OYY A;  2ES2 A;  1MJE A;  1SMX A;  1JB7 A;  2FXQ A;  3CW2 C;  3OTO Q;  4AIM A;  5FLX c;  4DR5 L;  2B3G A;  1X54 A;  2MO0 A;  5IYB H;  4JI7 Q;  2UXD Q;  3I55 A;  1NTG A;  1PH1 A;  4NXM L;  3A74 A;  1SR3 A;  5IY0 A;  4EX5 A;  4JI8 L;  4DUZ Q;  3HOZ G;  2K50 A;  2CFM A;  4HID A;  1HZA A;  1TWG H;  4A4I A;  4A76 A;  1O7I A;  3S15 H;  5C4J H;  2R92 H;  3B6Y A;  4BY1 G;  1B7Y B;  2KBN A;  4JG2 A;  3VDY A;  4OWT B;  3CMA A;  4BBR H;  1XJV A;  2K14 A;  2PNH A;  2UU9 L;  1EQR A;  3PUX A;  4LF4 L;  3NEM A;  4AH6 A;  1UE7 A;  3CCE A;  2JEA I;  4JI2 L;  1OXV A;  4YY3 L;  3HOU H;  1K3R A;  3AEV A;  4DV3 L;  1IL2 A;  4A3B H;  1L2F A;  4A3C H;  3RN2 A;  3CPF A;  3FHW A;  4NXN L;  2R7F A;  2AKW B;  1HNZ Q;  3TS2 A;  3S1N H;  3S2D H;  4DV1 L;  4A3I G;  4XTC S;  1KXL A;  5C0X G;  2UUC L;  1YHA A;  4UY8 C;  4HJ5 A;  3GTK H;  3HOY G;  1XPO A;  1B70 B;  3CC7 A;  3HOX H;  3RZD H;  1XNR L;  2YTY A;  4JI3 Q;  4DV7 Q;  3RLN A;  1D8L A;  4QQB X;  1B8A A;  4YCW A;  4LF7 Q;  1VQM A;  1VQF A;  4DV4 L;  1PH6 A;  2V1C C;  3RN5 A;  1W2B A;  1FJG L;  4R4Q A;  4UPA A;  4DV0 Q;  1Z47 A;  2KHI A;  3A5Z B;  4C2M H;  5C4X H;  2H5X A;  1VQE A;  4DR1 L;  1EFW A;  1HNW L;  1L1O C;  1C7Y A;  4C3H H;  1QVC A;  3PF4 A;  4R4C A;  4JCV E;  1E3P A;  4A3K H;  2VS1 A;  4LF8 Q;  4O2D A;  4L5T A;  4A3M G;  1S3O A;  1PH8 A;  2UXC L;  1HNW Q;  3E0E A;  3FKI G;  2F3I A;  1BBW A;  3S2H H;  1UEB A;  1M90 C;  1WOC A;  1YNX A;  4B3S L;  2AHO B;  2JA9 A;  5AJ3 L;  2HHH Q;  2PQA B;  4LF5 L;  5M3F H;  4DPG A;  3CF5 A;  4JOI C;  1GD7 A;  4HJ7 A;  3GTQ H;  4DR7 L;  2BH8 A;  1HZ9 A;  4LFB L;  3M9B A;  4X66 Q;  3ZJY C;  1BBU A;  4X62 Q;  4YCU A;  1KC8 C;  3F2B A;  3K81 C;  5M5W H;  2LXK A;  2YU9 H;  3E9H A;  3F2C A;  4JV5 L;  2Y0S G;  5H1S E;  4JI4 L;  2ZJR A;  4GLX A;  1Q12 A;  2VY3 A;  1HJP A;  3MEF A;  4DAY B;  5IE8 A;  4QGU A;  2VQF L;  4DR5 Q;  4A3L G;  1X3G A;  5GAH C;  2JA7 H;  3M3Y H;  1IZ6 A;  4NXM Q;  2VW9 A;  4GLV B;  3U58 A;  3A0J A;  4JI8 Q;  1HR0 W;  3ULL A;  3M4Q A;  3NEL A;  4DAM A;  3S1R H;  2A8V A;  3PO2 G;  1VCI A;  1NE3 A;  3HOW H;  1HNX L;  1CKO A;  2K5V A;  1JJ2 A;  2UU9 Q;  3Q8D A;  3W5O A;  1XPR A;  4LF4 Q;  2ZM6 L;  1KAW A;  1NBW A;  1VQB A;  2IHF A;  5ELN A;  3H0G H;  2Y0S E;  1QVF A;  2ZJQ A;  2R93 G;  4YY3 Q;  3BZK A;  1HZC A;  2AMC B;  1M1K C;  2HIV A;  1VS0 A;  1Y1V H;  3AFQ A;  5FLM G;  4DV3 Q;  2E2H H;  4NXN Q;  1G51 A;  2KHJ A;  4K0K L;  3ULP A;  1H95 A;  5LMN L;  1U5K A;  2K5H A;  4IOC A;  4DV1 Q;  2EQS A;  4R4I A;  1VQ9 A;  1OXS C;  2GVB A;  1JE5 A;  5M5Y H;  4A3F G;  2UUC Q;  3PUZ A;  4GNX C;  4B3R L;  1YVC A;  2YYZ A;  5BR8 Q;  5JEA G;  1V1Q A;  5IYD G;  3CCV A;  2Q2H A;  1VQL A;  1VQK A;  1XNR Q;  5M3M H;  1K83 H;  2OCE A;  4LW1 A;  4DR6 L;  1VQA A;  5IP7 G;  3CCS A;  3PSI A;  1K8G A;  2LSS A;  2ZTC A;  3F8T A;  4UP9 A;  1HR0 L;  1AH9 A;  3G48 A;  1QVG A;  1VQN A;  2XGT A;  4UP7 A;  3CME A;  5C3E G;  1FJG Q;  2RF4 A;  2I5H A;  4DR1 Q;  1YIJ A;  1PHJ A;  1N8R C;  2CWA A;  2JA8 G;  2EIF A;  3K7U C;  3TS0 A;  2JA5 G;  5IP9 H;  3H15 A;  4OO1 I;  1LM0 A;  5JJI A;  2UXC Q;  2R92 G;  2IX0 A;  1YI2 A;  1TWF H;  3STB C;  1I5F A;  3DM3 A;  4BBR G;  4DV6 L;  3OW2 A;  4A3J H;  1YIT A;  1K0R A;  4B3S Q;  2NVY H;  1YZ6 A;  1DGS A;  3EN2 A;  4B3T L;  4LNQ A;  2RCN A;  4GOP B;  5AJ3 Q;  2XTI A;  3HOU G;  2B29 A;  4LF5 Q;  3GTP H;  3PIP A;  3I7F A;  3PO3 H;  5GAD C;  4A3B G;  4DV5 Q;  3K0X A;  1G6P A;  1YEZ A;  5GAE C;  1K8A C;  4LF6 L;  4DR7 Q;  4OX9 L;  4LFB Q;  2UUA L;  1XMO L;  1OXX K;  4JV5 Q;  1E7Z A;  3UDF A;  1PVO A;  1S72 A;  4JI4 Q;  1GM5 A;  2VQF Q;  3I4M G;  4A75 A;  4BA2 I;  3HFZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...