1GHKA

Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from azotobacter vineland ii, nmr, 25 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
79
structure length
79
Chain Sequence
b'AIDIKAPTFPESIADGTVATWHKKPGEAVKRDELIVDIETDKVVMEVLAEADGVIAEIVKNEGDTVLSGELLGKLTEGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E2, THE DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE COMPONENT OF 2-
molecule tags Acyltransferase
source organism Azotobacter vinelandii
publication title Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from Azotobacter vinelandii.
pubmed doi rcsb
total genus 6
structure length 79
sequence length 79
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 1996-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ghkA00
2E76C 4KHZA 4KKSA 2L5TA 3GQBA 4RCNA 2A69C 2CW0C 2JEBI 5KNCA 1OXVA 3MXUA 1GUSA 4IQZA 1H9RA 1E2VA 2O5IC 5K36H 3H94A 1O78A 1DXMA 4TKOB 3D4RA 2V4DA 2K33A 3AB9A 4BA1I 1V8QA 2EJGC 3HGBA 2PNRC 4PV1C 2LMCB 4HR7B 4GZYC 3KLRA 4TQUS 2JEAI 3A7LA 4IFDH 1PMRA 3PUVA 2AUKA 1HTPA 1OXUA 1H9KA 4G7HC 2DNCA 1IYVA 4DNRB 1OXSC 4G7OC 1LABA 3IKJA 1OXTA 1FYCA 2KCCA 2PCFB 4H0LC 1K8OA 1B9NA 1ONLA 1QJOA 3ND8A 3VR4A 2DNEA 4KN7C 3CRKC 3GD7A 3VA7A 1H9JA 2BDOA 1HCZA 2K7VA 2A6EC 1E2ZA 3QIAA 4DK0A 3VR3A 5C0XH 3VR2A 2EJMA 2JE6I 1CI3M 3M4YA 1ZYRC 4OGQC 2PPBC 3CRLC 1Y8NB 3PUYA 4IFDG 1CFMA 3VR5A 1BDOA 5KNDA 3BG3A 2EDGA 2A6HD 3PUZA 2NN6H 1K8MA 1SMYC 3I72A 4KMUC 3FPPA 2JXMB 4G7ZC 4JBWA 2IT1A 1IYUA 3I4LA 3ND9A 3SDZA 2A69D 1H9SA 2BE5D 1GHJA 2EJFC 2EVBA 4DK1A 1Y8OB 3T51B 5K36G 1VDZA 3A7AB 5BN5A 5C0XG 1GHKA 2KA7A 1Y69U 3U9SA 1V43A 1H9MA 1I6VC 3PV0A 2ZT9C 3SE0A 1Z6HA 2A6HC 1GUGA 2B8GA 3W3AA 2A68C 1G291 1TKWB 1TU2B 1VF7A 3I73A 4LJZC 1HQMC 3TZUA 2R6GA 1VCIA 1E2WA 3NE5B 5BN3A 5JEAG 3M7NA 1GUNA 3D31A 1YNJC 1Y8PB 1T5EA 3OPOA 3OW7A 1IW7D 2A6ED 3MFYA 4XTCS 3T53B 4JK1C 1Q90A 2B8FA 2AWOA 4H13C 3PUXA 3A8IE 1DCZA 2NN6I 3LNNA 3P20A 4KI0A 5KNBA 1OXXK 4KKUA 4OO1H 2E74C 5BN4A 3BDOA 2YYZA 4DNTB 3IFTA 3L7ZC 1VF5C 3N6RA 3QJYA 1EWHA 3DXJC 1DD2A 1B9MA 2D5DA 2Q8IB 1YNNC 3M85A 1Q12A 3PUWA 4LK1C 3VR6A 3QG1A 5A35A 2O5JC 1GJXA 1LACA 4KN4C 1A6XA 2A68D 5JEAH 1GUOA 1Q1BA 2NN6G 3OOCA 1IW7C 3LWUA 3A8KE 2DN8A 4L8JA 4XIGS 4KKTA 2QF7A 2AUJD 1CTMA 1HPCA 2BE5C 3A8JE 1O7LA 3FMCA 3RLFA 1GUTA 1FR3A 2D62A 2BA1A 4I7ZC 3T56B 1Z7TA 1ZKOA 2K32A 4OO1G 2F1MA 1H9SB 4H44C 3WDNA 4BA2I 2BA0A 2E75C 3EQLC 2D2CC 1Q1EA
chains in the Genus database with same CATH superfamily
4DR6L 2EXZA 4JI6L 1SRUA 2OXPA 1PTOC 4B9XA 4J8QA 5KNCA 3TQYA 4MNOA 1H9RA 5C3EB 2PZWA 1X6OA 3U9OA 1SBBB 5EKIA 2K33A 1SYBA 4AQYQ 4IOAA 4ZK9B 2KEDA 3HGBA 4DR3Q 5IT9c 4JOIC 1PH8A 3GTJH 1EIYB 5IGFA 4JCVE 2RSOA 3AQQA 4IPDA 4A93G 3GTLH 2VNUD 4A3MB 1SNCA 2FMMA 4PMBA 4C3HH 2HQLA 3M3YB 1S5ED 5JOBA 2KUMA 3S1NB 1VQ6A 1DOMA 4IPHA 1PH9A 2V1CC 2RA4A 3BZCA 3VR2A 3NBHB 4AQYL 4GNXA 5IGBA 2FHTA 4DR3L 1X3GA 2JYOA 2F0NA 5C4XG 1KLUD 4U68A 3U4ZA 5M5WH 4DV0Q 3J7YW 4EX5A 1CQFA 3S1NH 4O0AA 3TMEA 4C3JH 4HJ7A 1SAPA 2TSSA 3PSIA 3OIPA 4NP5A 4X3UA 3E0JA 1IYJB 2OQ0A 4OL7A 2X6GA 5FJ8H 1I6VC 4BY7H 2YU9H 1JWUD 1SE8A 3UDIA 4BXXH 2R92B 3NHHA 2R6GA 2E2HH 1CA6A 3V05A 5KEEA 4C3JG 2WAQG 3BDLA 4A93B 4RHSA 4ZQ3A 2ZXRA 3NTKA 3TRZA 2ICIA 2UXCL 3L7ZC 1EU4A 3I90A 2WV6D 1X56A 2KOLA 3M85A 4HIMA 4L5SA 4BXXG 1IL2A 4R4OA 5A35A 1KDAA 4DK3C 3A74A 2NVQH 2EY5A 2EY1A 3M9BA 1X54A 1RTOA 1HNZL 1TWCH 4I7ZC 3L9AX 1SE3A 1KRSA 1SNQA 4RGNA 1II3A 1ZYRD 3NXWA 4FYDA 4A3BG 1ASZA 4KKSA 2L5TA 3DM3A 4TSSA 3A55A 3PQIA 3V2TA 1Y1VB 1WCMB 3BVGA 2K14A 4LUVA 3EA6A 5EPKA 4EGVA 3HOWH 2O5IC 1LTSD 2B2VC 2QW7A 2RBMA 1STAA 1CA5A 4IZ8A 1DXMA 4TKOB 1HNZQ 4N8X1 2D0OA 1AFPA 4CKCA 1D6EC 1Y14B 4HTHA 2ZM6L 2PW5A 1E7ZA 2KHSA 2E5LQ 2DNCA 1OXSC 1NSNS 2EYLA 3S9WA 2PCFB 4QIWE 1F9QA 2B3GA 1YJ9A 3NSWA 5NUCA 2B2TA 1SYFA 4R4TA 3FVQA 1WTQA 4N8FA 5E4XA 1KHIA 1L1OA 2KBNA 4KY5A 2CWAA 1F2ZA 1L0WA 5DAUA 3G71A 3KJOA 4IPCA 1KC8C 1EYGA 3S15H 5IGDA 1VQDA 3PO3G 5FKAC 3T13A 4V190 1J6QA 3URYA 4LFAL 2N78A 2R7DA 2MFIA 2EQSA 2PO4A 3FKIH 2E2HB 1Y8OB 5DNFA 3RZOH 1JE4A 1Q81C 1EFWA 2K01A 2LKVA 1WTRA 2YU9B 3NK9A 2EIFA 2Q2UA 5FOBB 5A2QE 2JA5G 4A3CH 5JEAG 1RJTA 1JJGA 2IJ0A 1JT8A 1U0LA 1QILA 3MXGA 3OPOA 3C46A 4G4KA 1IBLL 5M5WB 1LTAD 1SROA 1Q90A 2G5DA 2Q2HA 1NNXA 1EQVA 1BVSA 1STYA 3DXJC 3DWQA 1TY0A 3I8ZA 3W5OA 2F3VA 1LTBD 5DEHA 3TN2A 1P16A 2XRQD 3OOCA 3BYYB 5CV5A 2Z6KA 3FMCA 3GTLB 2BE5C 3MXNB 1C4QA 1ESFA 4IFDJ 1J8IA 2EPBA 1PTOH 2N55A 3FEWX 2QDBA 4RHRA 4RCNA 3E6ZX 2PYKA 4RKBA 4DAMA 2CVRA 1U4MA 1UE5A 3TP6A 1Z9FA 4CKBA 1RL2A 1TXYA 1IBKQ 2V4DA 4R8IA 5EKLA 2F0GA 4UP8A 1XMQQ 4PV1C 4UP9A 2AKWB 1X65A 3KLRA 4UPAA 4GZYC 1BQQT 3GTOH 2K5NA 4DV6Q 4G7OC 2KENA 3VYSA 2R7ZB 5C44H 2K50A 1FGBD 3SXHA 5G3LD 3CCUA 1B9NA 4Y52H 4DR2Q 1NBWA 3GV3A 2JA6G 1XTDA 3QIAA 1CHPD 2JE6I 4AH6A 2KHJA 5I6WA 3GTPH 2UXCQ 2PW7A 5CMDA 2H1EA 3J80c 4KJNA 1BCPF 2F4VQ 3BG3A 4JI3Q 3DWAA 3PUZA 4KMUC 4DV6L 1N34L 3CF5A 1EIHA 5EJWA 1ET6A 3S16B 1M90C 1EEID 2PI2A 4ID6A 1GHJA 1KAWA 2EJFC 3QOJA 5IT9L 4DK1A 2E2JB 1GHKA 3PO2H 4EVOA 3L3OC 4WFN3 5CBAE 1GM5A 1TS4A 3CC7A 3PV0A 1AZPA 4L63B 1I4HA 1HZ9A 3RN5A 1XTCD 2RVLA 2B8GA 1F9RA 2EYFA 4HMJA 4C2MH 1HQMC 3K0YA 5IOCA 3SHLA 3M7NA 4CGYB 1MBYA 1HR0L 5C4JH 4BBSG 4YY3L 2VQEQ 4FNFA 3MHBA 3D4DA 3NPPA 4RGMA 4A3LH 3PCOB 4C3JB 1YVCA 1UE7A 2NN6I 2FJ2A 3Q22A 5ELFA 3BDOA 1FD7D 4HEDA 4DNTB 4C56C 3BZDB 3K6OA 4B3RL 3WOEA 3E5SA 2RDFA 2UUCQ 1MD2D 1GJXA 5EGTA 4RAUC 2NN6G 4S3SA 4KKTA 2VUMH 1TIID 2B29A 2AQ2B 3G6JB 2LFNA 1MJEA 3S17B 3WDNA 4BA2I 3VYTA 5FO9B 3HOXB 3I4NH 3ZYYX 3SVMA 3GDEA 4POGA 1KABA 4HJAA 1JB3A 1HA6A 2F52A 3DMUA 4L5TA 5C5LA 3STBC 4XQQA 4B9WA 3CCLA 2CFMA 2F0HA 2A74C 2YTVA 3CMEA 4JBKA 2JA8H 4PMCA 4K5WA 5C3EH 3RD4A 1EY4A 2K1BA 1V8QA 2G9HD 2GN5A 1JJ2A 1C9OA 2C5CA 2HD3A 4PZ7A 1Q8KA 4B08A 1ILPA 1H9KA 5C6AA 4LFAQ 1C7YA 2FMCA 2Q8RE 4DU9A 3PF5A 3BS1A 2PZUA 1VQ9A 2Z4IA 3S1QB 1WI5A 2JA8G 2ZJRA 4LF5L 4K5XA 1CI3M 2WIIB 4WJ3M 4GKKQ 2F03A 5KRUA 1Z47A 2NWGA 3CRLC 2UUAQ 3VR5A 1U4RA 3R3OA 4BBRH 2F3WA 4R4CA 3I4MG 3K7UC 1IBMQ 1PH3A 1K0RA 2HIVA 3S1QH 1DM0B 4U673 1IYUA 3ND9A 1JICA 4ZKBB 3Q6SA 5ELNA 4CKEA 3ERQA 2NVXH 1MKHA 2NYZD 3AYHB 1Y69U 2JA7B 1LM0A 1N36Q 3HKZE 2HQEA 2ZT9C 3AU7A 4KD4A 4YWLA 1PV4A 4YCUA 1EY6A 3GTGH 5L37A 3T1YL 2CQAA 2UUAL 1NY4A 2KVMA 3F2BA 3RUZA 2WACA 1TWCB 1PH1A 1CKNA 1JWSD 1A63A 2F0IA 4C3HG 1WYDA 1EY9A 3PIOA 1IBKL 3I4OA 4HIKA 1D1IA 1BCPB 1TS5A 3HEJA 3J7ZC 1UUPA 5CV6A 1STNA 1KL9A 2D5DA 4X6AH 5GQOA 1EL0A 3A5ZB 3PUWA 3T1YQ 3QG1A 1AEXA 5EPJA 5GAHC 5FO7B 5GADC 1BUVT 5J1ZA 2LY7A 4NXML 1FJGL 1QOHA 3I91A 3S1MB 1STHA 4TVAB 4ZKCB 5IP7G 5JVH3 4DV3L 1KQSA 3PIP3 1KNEA 3CD6A 3IL8A 2Z1CA 3BDCA 1LV9A 3NTHA 5LMUQ 2X6LA 1XMQL 1O7ZA 5GAGC 1MI2A 4DV1Q 2BA0A 5FJ8G 3ZJYC 3CCMA 4BY7G 1EY7A 1A8VA 2R7ZG 1YNND 5BR8Q 4A3MH 4IPGA 2PI2E 1QVCA 1UNSA 5E3FA 3MZ5A 4IQZA 3KDFA 2F0QA 1A2UA 1TQOA 3NWSA 2BH2A 3PIO3 1HNXL 4DV2Q 4PNYA 1GD7A 2L55A 4OWXB 3W2DA 5CC4A 1W6JA 2K52A 3D8GA 4MTKA 2HCCA 5IY0A 4LAAA 2JA9A 4DNRB 5KYLA 2J7ZA 1A3VA 3HOYH 3STBD 3WOFA 2Z6KC 2OCEA 3OIQA 4PG3A 2L12A 3FHWA 1HR0Q 1E0BA 5IGGA 3CQZB 2B2VA 3J80E 3S16H 2B63G 2F0OA 3K8AA 2KCMA 3PIPA 4A3IG 2C9OA 4UP7A 3QR8A 3GTPB 3CC4A 3V96A 4JI1L 3I72A 3HOYG 2MO0A 3P1HA 4QIWB 5M5XB 1SFOB 3SDZA 4QUFA 1WTOA 2HT1A 4AYBB 3PO2B 4F7XA 2LSSA 2R61A 3FP9A 3GTOB 1PRTB 1K9MC 3FRPB 1BR9A 1C0AA 2LXKA 4F87A 4DGZA 3GTKH 1WCMH 3I73A 5KYIA 4K0KL 1PDQA 3M4QA 4JV5Q 3D3RA 2IW3A 4OWTB 1Y8PB 1ESRA 2EY2A 3T53B 5IYBG 1S5DD 2EYHA 5FLMH 3FPUB 1DCZA 1F9PA 2ZTDA 3E9HA 4C1NK 2F0KA 1VQIA 4QY7A 3IAYA 1PH2A 3L2PA 3GO5A 1WCMG 3AEVA 1DYQA 4K0KQ 2B2TC 4MIUA 4A3FB 1GO3E 3X3NA 4F8MA 1U4LA 2AQ3B 2RCNA 1FNWA 5FK9C 2UUBL 1PYWD 1UAPA 2F0UA 2D62A 4OELB 2BA1A 4LF5Q 2PMZE 3UDGA 1RODA 5JPNC 3SK8A 2NBFA 4DUYQ 2EZVA 1XPUA 3AMUA 4FXGC 3GQBA 2K75A 1EQRA 1UE1A 4HAEA 1K8GA 4OHJA 1WTXA 2B2WC 3CHBD 1EU3A 1CSQA 2Z6BA 1L0XB 3LWEA 1F2MA 4IO9A 1GKHA 3D4RA 2HHHL 2OF1A 4O1NA 2PMZB 2NTTA 2LS01 3X3MA 1PMRA 4P71A 4A3JH 1EQTA 4A3KH 1LABA 2F4IA 2KCCA 3HOUG 1QJOA 2I07B 1EY8A 1IBLQ 2ZTCA 4DK0A 2KCTA 3J7AV 2A5HA 4Z9CB 1A2TA 4JBMA 2EXDA 1C48A 3MXNA 1BKBA 1Y8NB 5LHY1 5EAYA 1I5FA 1BDOA 4LFBQ 3NQTA 2D9UA 4A3JG 3GTMH 4LF9L 4CBVA 4OX9Q 2RDHA 4JBJA 1HZAA 2OEOA 1KDBA 4G7ZC 1NMFA 3F2CA 1PRTD 1KAAA 1VDZA 4YIJA 1HFNA 2UXBL 4HN7A 2A6HC 3CMAA 1BXTA 2L1BA 2N88A 2X69A 1XMOL 3TZUA 2ES2A 4LF9Q 3FDTA 3CAMA 1N33Q 3A0JA 2JJQA 3BVZA 4NDXA 1T5EA 1IW7D 5I4DA 4QUCA 4HIOA 4QL5A 3BJUA 1KTKA 1E22A 2K5QA 2Z8LA 2IY5B 2JSOA 1Q86C 3CC2A 2UXBQ 4IUNA 4DAYB 5CORA 1HXYD 4BBRB 3UDFA 1LACA 4K6DA 2A68D 3QO2A 3CXCA 2P5ZX 4I65A 1BCPC 2ATWA 1EYCA 4L8JA 1A62A 5DM63 3RR5A 4XYQA 2QKIC 2GVAA 3VYUA 1Q3LA 1X3PA 2VB3X 4YCVA 2UU9L 5E7NA 4JW0A 2XSCA 4NXNL 3HOWB 2D2CC 1Q1EA 5ELDA 4XQJA 2FXQA 4A93H 2VY3A 3DHQA 3DEPA 1C8CA 1EZ8A 5IWAQ 5LMNL 5K36H 3CPFA 5I2YA 5I6YA 3F2DA 4CJ1B 5AJ3Q 3I56A 2NVYB 3EFXD 1I94Q 1G6ZA 2JA7H 2EJGC 5JAVA 1I4RA 3MAQA 1EY5A 3N52A 3A7LA 1I4GA 4BY7B 3C1EA 1GOZA 5C4XH 2F0DA 2JQOA 4P2CB 4Q0FA 4H0LC 5IYDG 4DFAA 2VQEL 4B3MQ 4AIMA 1HTLD 3CRKC 4A3GG 1IL8A 3HOZH 1S72A 3PF4A 1XX8A 3CCRA 5M3MH 1UEAB 1FL0A 4UY8C 4ME5A 3H6MA 4K5VA 1HZBA 3GV6A 1SNMA 2RHSB 1YHAA 2IT1A 5IIFA 3TEHB 2XWBB 3U4VA 1RTNA 3MC0B 4HJ8A 3A7AB 1JR0D 2PQAB 3H0GH 4X62L 1VQAA 3PGZA 1G8ZD 2MHVA 4X66L 3KDFB 4KHVA 3CW2C 1BO0A 1TWGB 1DZ1A 4UHVA 1OTCA 2WKDA 1KRTA 4DR2L 4IJLA 5EQ0A 1ET9A 3R2IA 1K83H 1CQVA 2BDNA 2M9VA 3I2ZA 2K04A 4YCWA 1K3RA 2RDGA 4H7BA 4JI0Q 2VUMB 4A3BH 4X66Q 1VQ4A 4BBRG 1R4PB 1Q1BA 3NBIA 2G9DA 4O42A 1I3QB 4XIGS 1CTMA 4KV6A 1CK1A 3HZXA 4FXKC 1Z7TA 4YWKA 4IUVA 4YHHQ 4CHTB 2WB1G 5C4JB 3TP8A 4DUZQ 3OW2A 3BYTB 3RN2A 1FGUA 4WJ4A 2N3SA 1GUSA 1X32A 5T1IA 4DPGA 3HOVG 1VS0A 1TWFB 4EQ5A 1GUWA 3EN2A 3I70A 4LF6L 1CKNB 4RGTA 2QEJC 1LTGD 1SFOH 2XTIA 4NKLA 3PO3H 4BBSB 1S40A 3KOJA 3MXPA 4DUZL 3RLOA 4POFA 4B3TQ 1SNPA 3LX0A 4KY7A 4RMFA 3S2DH 2J4XA 3HKSA 2DNEA 3E0EA 1EEFD 3HOVH 3OHXC 3MEFA 3VA7A 4H02A 4OWWB 3A54A 3JAMi 1BBXC 4JC0A 1K28A 3GTQB 1IKMA 4Y7NH 1BBWA 4JI2L 1I4QA 3K80C 3HP3A 1XNRL 2MUYA 5LL6S 4ZYSA 2MJ8A 3SK5A 4EQOA 5JJKA 2Z0SA 2JA5H 4A3CG 3FPPA 1PA6A 4JBWA 1CSPA 4XT1B 4A3MG 1VMPA 1YJWA 3TS2A 4JYAL 2PQEA 5JJIA 4DV3Q 1JC7A 1YHBA 4APVA 1JQYD 1EYAA 2XVSA 1NMGA 1QNKA 1K83B 4FVMA 1XWEA 1GUGA 1YZ6A 5JJZA 1WFQA 3NE5B 2EE1A 1GUNA 4HJ5A 5M5XH 4X65Q 3F2UA 1BF4A 1G2TA 3B6YA 1FNUA 2UU9Q 2ENBA 5BN4A 2M00A 2PZTA 3QJYA 3IRBA 4J6HA 3J81j 3VA5A 1PH7A 1Q12A 3OTOL 3JAML 3H3VI 2OTLA 1GUOA 2WP8J 2VS1A 2H4OA 2LXJA 1K0SA 2J0TD 2QF7A 4JI7L 1W3SA 2N49A 5AJ3L 1B3AA 1SNOA 5ISRA 1SYCA 1LUZA 1ZKOA 2FFKB 1T5XD 3S1RB 2JEAI 2MP1A 2YTXA 4QF4A 4BY1B 3SR1A 1XJVA 2CW0C 3OTOQ 1X3FA 3SK6A 5C4ZA 1PYBA 5C44G 1OXVA 1VQFA 1E2VA 3RLNA 2WFWA 2M2LA 3H94A 4JI7Q 1IKLA 3EBEA 1R9TB 1YNJD 2EYJA 1RIPA 1MSHA 3KLSA 4BA1I 1MSGA 4BS9A 2NVXB 4FF2A 2LMCB 4HR7B 4NPSA 3RZOB 1SSOA 1TWHB 5IYCH 3EIVA 4LWCA 1LT6D 4JI6Q 1O7YA 5A2QL 2NUCA 5TSSA 1M1KC 3T4AC 1BBUA 1Q82C 4LMQD 4ODGA 2NVQB 5LMUL 2OWOA 2K5VA 4OEMB 1A3TA 2E8GA 1PHJA 1ILQA 1HZCA 3M7GA 4GLVB 1B7YB 4LF4L 5IYCG 4QCLA 1K8MA 4M1UB 4OONA 2K5HA 3CP0A 3I4LA 2WB1B 4BBSH 4GS3A 5IT9E 1PXUA 4A3LG 1QZHA 1M8AA 5C0XG 1YEZA 3U9SA 2CCZA 3HFZB 4ULLA 1VQLA 2JA6B 2R92H 5FLXL 2DGYA 4QMGA 3H09A 1G91A 4K14A 4LF4Q 3KF6B 3MFGA 3SK4A 4JI3L 3SEBA 4JI5Q 1V9PA 2K5DA 2KHIA 4DR1L 1AN8A 1MIUA 4L5RC 4JK1C 3NBHA 1EUJA 5DM73 3PUXA 3CCSA 4R1JA 4K2KA 4KKUA 1VQGA 3S1RH 4KLKA 2OQKA 1I3QH 2CW0D 1B1ZA 2HDLA 5C3WA 1A6XA 4FDBA 4R8NA 1JORA 3J81L 4GKJL 2I5LX 4JI5L 2QA4A 1AP0A 3NELA 1HPCA 2HUGA 3A8JE 4YY3Q 2JN4A 1YJNA 4LF6Q 2RCFA 5M3FG 4F88A 2F1MA 1AZQA 1B70B 4OIJA 3KBGA 3ERSX 1XNRQ 2JP1A 4LFBL 2QILA 2JA8B 2SDFA 1STGA 3I3CA 5LMNW 1PH4A 1TWGH 2L11A 1X9NA 4CDDC 4DNIA 5FLXc 2B2WA 4P73A 5C5MA 4PMWA 3TP5A 2K6AA 1QUQB 4WJWA 1SYDA 5DLQE 5M3FH 1EWCA 1I6HH 1CM9A 1QUQA 2K4KA 1HNWQ 4LUZA 4LF8L 1XMOQ 2N8NA 2B39A 4G7HC 1TS2A 4DV5Q 5FO8B 1CHQD 1XPOA 1HHVA 3O13A 3I4MH 2AQ1B 1ONLA 2WB1E 5JJLA 2Y0SE 3D4WA 2RQXA 3K7AB 3A56A 3K57A 2QCPX 3ULPA 3OWEB 5EKKA 1E2ZA 2F0FA 2YTYA 2EJMA 3DWPA 1PFMA 2SEBD 2XWJB 3PUYA 4A3JB 3NTIA 4DR4Q 2CQOA 2RF4A 1JCKB 4RH6A 4QJFA 1ENAA 2A6HD 4E6IA 1EFID 3JAME 2K05A 1S5CD 4X65L 1H9SA 2FINB 3K5MA 1SJED 3S2HH 3LGJA 2O4XA 2NVYH 1H9MA 5H1SE 2ZJPA 3S14H 1RDPD 2E2IB 1Z6HA 4J1MA 1K8AC 4C1NI 3D6CA 4DR4L 2NZOA 2E2IH 1E2WA 4X64Q 1YNJC 5IWAL 4KJOA 5LMNQ 2TMPA 4FO2A 4P75A 2ALYB 1BCPD 4DV4L 1L1OB 4NB3A 1NR2A 5KIXA 4A75A 4IUUA 3HOZG 4RG1A 1SXTA 3IFTA 1WJJA 1B9MA 3KF8A 5M3MG 3RZDB 5ELEA 2DJGC 3VR6A 5C3XA 1GVPA 4PQXA 1IW7C 2UXDL 4X64L 1L2FA 3KF8B 1TY2A 1MJCA 4B3ML 4IUPA 3RLFA 1GXDC 1FR3A 2XN9C 5M5YB 3K7AH 4DXFA 1BOSA 5IGEA 3H0GG 1EQQA 1VQ8A 4RA8A 2EY6A 2Q8IB 1BNZA 2A69C 1R9TH 1E1OA 3KF6A 3OYYA 3T16A 4ZUJA 3R8BA 1DOLA 2I0QA 1W6KA 4JI8Q 2K03A 4DAPA 3C3LA 1F77A 1KLGD 1I50H 1PZKD 3G6EA 1LTID 2NB0A 2B2UC 1M4VA 4DF7A 1B50A 1AE3A 1IYVA 4BY1G 4CDEC 3HOUB 2KEEA 4C3IG 3RNUA 4DR7Q 3K59A 2O2LD 3VR4A 3A5UA 5COYA 1NUCA 2IHFA 5I9OA 4A3EH 3JC66 4LFCL 1NR4A 1I4XA 1KDCA 1HJPA 4DV1L 2CH4W 3VDYA 4JI0L 5M5YH 1RCVD 1PH5A 2I5MX 1RD9D 3NENA 4A3KB 3BU2A 1NCVA 2WAQB 2BOSA 2A69D 3OMGA 3T51B 3P7JA 3P75A 3J80L 1EOTA 4O2DA 4LFCQ 1S3OA 1FVIA 4YHHL 3SE0A 3T1HL 1D5XC 2WINB 3R93A 4R9WA 4FF3A 1EIFA 2DY7A 3U50C 3UI2A 1LLRD 1N34Q 1QVFA 5JVG3 4GKJQ 1DONA 1PLFA 3C2PA 1G2SA 1XPRA 1JMCA 4JI4Q 2A6ED 3U58A 4AYBE 5EBDA 4DAVA 3A8IE 3S14B 3P20A 2WKCA 1SLJA 5CV7A 3BVMA 1PZID 2RKSA 5ELBA 1SEBD 4LF8Q 5CR3A 1HUMA 4GOPA 4HIDA 1PVOA 2O5JC 4KN4C 1WOCA 4XDXA 3J81E 2XIWA 4JV5L 4GOPB 4TRDA 1WTVA 4R4IA 2Z4HA 2F0WA 5ELOA 3S24A 3PO3B 1YIJA 1CKOA 4XXEA 1WTHA 4JI2Q 2EOTA 2ZM6Q 1JJCB 4JVZA 4RCOA 3E3XA 1V1OA 3EQLC 1IHZA 5IGCA 5GROA 4MTNA 2ZTEA 1F9SA 1VQOA 5IP9G 1TVXA 3GP7A 2B2YA 2YV5A 1RKNA 4IFDI 2CKZB 4ME3A 3WWVA 3AFPA 1I6HB 4QGUA 5M3FB 3H15A 4DUYL 1YI2A 3PUVA 2AUKA 1HTPA 1OXUA 1HR0W 3TZDA 5C4HA 4J15A 1IBML 1LT4D 5IP9H 2R3ZA 2ZXOA 2F0PA 3HOWG 4A4IA 1B2TA 1QE6A 2BDOA 2A6EC 5F2DA 2JK8A 3VR3A 1N36L 3KLSX 3EROA 4NMZA 1B8AA 3H91A 1QWYA 1N8RC 5E1FA 3CQZH 2Q8TA 1L0YB 1STBA 3KFUA 4P72A 3RMHA 1ASYA 1U4PA 2NTSA 4X3TA 3CCQA 2Y0SB 4DV4Q 3SGIA 5T1GA 1WD0A 1V43A 1YITA 1ENCA 4OO1I 5CV9A 3UE1A 4DR5L 4FXDA 1DOKA 1PRTF 4DR6Q 2MQHA 5I2XA 1VQBA 4OX9L 5BN3A 2HCIA 4NXMQ 3KYHC 1FJGQ 3D31A 1HA5A 2C35B 3OW7A 3MFYA 4PZ8A 1Q8IA 2JA6H 4YWMA 1KNAA 5KNBA 1OXXK 4MN3A 2E74C 1SE4A 5M3MB 2R7FA 1G6PA 3Q8DA 4IN3A 5KGUA 3J81c 4EQPA 4A3DG 1F2LA 5JEAH 3Q0AA 3M3YH 3LWUA 3A8KE 1XYIA 1UEBA 4P74A 4A3FH 2A19A 3CCVA 3T56B 3GTJB 2B2UA 4IJHA 1B4OA 1QZGA 3M4OB 1SMYD 1B53A 2KQ3A 3CPWA 2F4VL 4C3IB 5J39A 4XT3B 3OMCA 2F0SA 4DR7L 4KTAA 1N33L 4FF1A 2F3IA 3ICEA 5IYDH 2EYOA 3GTGB 4KY6A 1HRJA 4ILWA 3H3VH 3BZKA 4A3FG 1IXRA 1ICFB 1JB7A 5HGTA 2DUDA 3NEMA 1LTRD 4OXPA 2ICEC 4IUQA 1VQNA 1V1QA 2A8VA 4GLXA 4CDCC 2L15A 1LT5D 4JI1Q 2SNSA 2Q2TA 1ZXTA 1B44D 2AWNA 4L6TB 1QCBD 2VQFL 4KN7C 3GD7A 1Y1VG 1DGSA 2DJFC 2VUMG 1PTOB 4JPBW 2L0CA 1YNXA 3CKIB 3M4YA 3T1HQ 4LUOA 1PH6A 4RKLA 2F0VA 1TWHH 3DM1A 4HCSA 4GOPC 4ZRZA 4LF7L 2EDGA 1SMYC 4A3EB 3MEHA 4UDUC 1TR5A 2BE5D 4GN3B 4WORA 3IFDA 1TWAH 2AMCB 1S4ZA 1SMXA 1VQ5A 1N9WA 5C3EG 4RGOS 4WRDA 4K8IA 2A1AA 2BCOA 1AW7A 1T9HA 4L5QA 2UUCL 1CKMA 1VQ7A 4B3SQ 1TU2B 3MWYW 3HS0C 1D5MC 3NWTA 4I7AA 1JWMD 1SN8A 5ELCA 1WVLA 3DEOA 3PO2G 1CZWA 2VZAA 4OO1H 1K3BC 3MVVA 1EWHA 1VQJA 2H5XA 4IURA 1R4QB 1HNWL 3VYRA 1L1OC 1YNNC 1STEA 4ZAIA 5HY6A 4DV5L 4FF4A 1SR3A 3FKIB 4B3SL 1S5FD 1WTWA 2SNMA 4HJ9A 1D2BA 1JOOA 3ONAB 4A3GH 5D3DA 2B2YC 2PQAA 1PZJD 5C0XJ 2HDMA 3Q24A 1O7LA 3CU7A 4XYOA 2CHBD 2IPKD 2IWHA 1QVGA 4OO1G 2F0LA 1YHQA 4Y7NB 1RHPA 1H9SB 4X62Q 3J81i 1Y1WG 3KJPA 2VL6A 3KUPA 1S5BD 2E76C 4MZ9A 1Q46A 3C1FA 3S2DB 5J22A 2JEBI 4X3KA 1X3QA 3MXUA 5C0XI 1TT2A 4NW2A 4XQNA 3TDQA 2OTJA 4DR1Q 4FP5D 4KHPL 3W1GA 5HGQA 1EYDA 3S1MH 1Y1WH 2K28A 3I4NG 4IFDH 1TWFH 5CBEE 2E2JH 4JOIA 3S15B 3M4OH 1EIGA 2HIXA 2IX3A 1OXTA 1FYCA 3ER0A 3H3VC 4BWGB 5JEAJ 4ZUIA 2NVTB 1HCZA 2K7VA 3HOVB 5CV8A 4K2LA 2HHHQ 3HKZB 3NUCA 1PFBA 4DV7Q 2IX0A 4IFDG 1CFMA 2QEXA 4RFBA 2ASBA 4ABNA 1ML0D 1A0IA 5D14A 3Q23A 2R7ZH 4B3TL 2UXDQ 1HFGA 1PRTC 1H95A 4HCEA 3OWFA 2EVBA 4QQBX 3S2HB 2Y0SG 1U9RA 2MO1A 1LYLA 2KCNA 4A76A 3AFQA 1A3UA 4DV7L 5D3IB 5CGKA 5FLXE 1F2YA 1XNQL 3W3AA 4IUTA 4PZ6A 2E5LL 1SYGA 1VQHA 1TKWB 2Q2IA 4LJZC 5HURA 1VCIA 4BY1H 4C3IH 1AE2A 2WAQE 3ULJA 4JYAQ 2SOBA 4XTCS 3K0XA 2R93G 2IL8A 2E2DC 3MTSA 3UE0A 4AYBG 4H13C 4A3EG 4DV2L 4DXGA 3LNNA 2R93B 2QDLA 3H0GB 2IX1A 2YYZA 4A3IH 4LNQA 1D7QA 1DD2A 4GNXC 2RSNA 4LW1A 4GLAC 3HKZG 1XNQQ 5BR8L 2L4NA 2CWPA 2DN8A 4V0BA 5K5PA 2K5WA 1AH9A 4A3IB 1HH2P 3ITPA 3DLLA 2R93H 1HNXQ 1O80A 3NQIA 3QB3A 1RF2D 1I94L 1W2BA 5AFWA 2I5HA 4H44C 4GN4B 2RHQB 4KHZA 4DK6C 1PTOD 1P8LA 3EVQA 3FKIG 3KBXA 3TREA 1UWVA 1WTPA 1X3EA 2KECA 2DY8A 1IZ6A 1QNUA 2VW9A 3S17H 1D1KA 5IP7H 3HG9A 4N9TA 1UE6A 1NAPA 2PNRC 3G48A 3KLWA 1VQMA 1SE2A 5IE8A 2F0MA 3R2TA 4NXNQ 4LF7Q 4DKAC 2VB2X 3IKJA 5CYUA 1NJIC 3HOZB 1KXLA 5I9PA 3GTQH 1LO5D 3F1ZA 5C0XH 1O7IA 1HUNA 4ZLTF 1ZYRC 4OGQC 2PPBC 3TSSA 5C4XB 4B3RQ 2XRSD 2Z9HA 4C2MB 4GN5A 1D8LA 2ZXPA 2JXMB 5G3LF 1ZEQX 3F8TA 3JAMc 1N32Q 4ALPA 1Y1WB 5C44B 3ULLA 4CJ0B 2B63H 4JI8L 5J3BA 4EQNA 2KA7A 2GVBA 3D6WA 3G7LA 4KD3A 1LT3D 4Q5VA 1CZGA 1Q7YC 1J5EL 1JOKA 1A15A 3OSOA 2A68C 1G291 3K5NA 1VF7A 4CJ2C 5M9OA 2UUBQ 1NE3A 5E4WC 4DN4M 1PYSB 1N32L 4K8JA 3MA2B 1EWIA 1LTLA 3W1BA 3K81C 2AWOA 2CH4A 1DJRD 3TP7A 1CT1D 1J9OA 3N6RA 4OIKA 2F0EA 4IOCA 1J5EQ 2QGQA 4DV0L 2NVTH 3K5OA 4UAIA 1SDFA 3D0FA 2D0PA 4HSPA 2F0TA 5IYBH 5JPMC 4KHPQ 3J80i 5FLMG 1VQPA 2K32A 4GKKL 5EBCA 3HOXG 3HOYB 2KJXA 2E75C 3G4SA 3K58A 1OO9B 3KK7A 4K6LA 4QB4A 1E3PA 1LTTD 4A3DB 1SJHD 1B3QA 1U5KA 4G57A 4JI4L 1SYEA 1VQEA 1PFNA 1O78A 4ZCKA 3AB9A 1QB5D 3HOXH 2R92G 3I4NB 2F0JA 1VQCA 5EPLA 4TQUS 1EOVA 2A73B 1E1TA 3GTMB 1YBYA 2ZJQA 1HQRD 1CUKA 4N9PA 5GAEC 1KIXA 1PTOF 2GA4B 4A3DH 1K8OA 2VXWA 4A3GB 3ND8A 3UDXA 1EZ6A 3HRZC 2AHOB 1G51A 1H9JA 3PMFA 3E9IA 4GNXB 3M4PA 1ICWA 1MGSA 3QWNA 1JE5A 3I55A 1E24A 4HSVA 1VQKA 2BH8A 3RZDH 5KNDA 4C3HB 1V1PA 2L9HA 5D65A 2NN6H 3TS0A 4A3KG 3K5LA 1XXGA 3HOUH 1MHWC 4MHEA 1EY0A 1V1PB 3DUZA 1I50B 5K36G 2MGSA 1NTGA 2OT2A 5BN5A 2IHEA 4IALA 2MPMA 2EYPA 1I4PA 2JA7G 1K73C 3NP8A 1SNDA 2JA5B 1TWAB 1D5ZC 2XNAC 4RWSC 1FNVA 2XGTA 2I46A 5CV4A 4DAYA 3TBIB 1VMCA 4DA2A 3CCJA 1KD1C 2B8FA 1Y1VH 2EYMA 2PNHA 4KI0A 2MNAA 3J7A5 4R4QA 4CDFC 1VF5C 1X55A 3I7FA 2B63B 3J7AF 4LK1C 4HMIA 3L0OA 5LL6X 1ENFA 1QG7A 4M8AA 1TS3A 2VQFQ 2ID0A 2AUJD 1JOQA 3QOLA 1GUTA 2NZ1D 2NZHA 3EJIA 4JG2A 1WD1A 3CCEA 5IODA 4A3BB 4KK7A 3I4MB 4X3SA 3GTKB 1PFSA 4DR5Q
chains in the Genus database with same CATH topology
2EXZA 2OXPA 1PTOC 4B9XA 4J8QA 5KNCA 1H9RA 5C3EB 2PZWA 3U9OA 1SBBB 5EKIA 2K33A 1SYBA 4ZK9B 2KEDA 3HGBA 5IGFA 2RSOA 2VNUD 4A3MB 1SNCA 2FMMA 4PMBA 3M3YB 1S5ED 5JOBA 2KUMA 3S1NB 1DOMA 2RA4A 3VR2A 5IGBA 2FHTA 2JYOA 2F0NA 1KLUD 4U68A 3J7YW 1CQFA 3TMEA 1SAPA 2TSSA 3OIPA 4NP5A 4X3UA 3E0JA 4OL7A 2X6GA 1I6VC 1JWUD 2R92B 3NHHA 2R6GA 1CA6A 3V05A 5KEEA 4C3JG 3BDLA 4A93B 4RHSA 4ZQ3A 2ZXRA 3NTKA 2ICIA 3L7ZC 1EU4A 3I90A 2WV6D 2KOLA 3M85A 5A35A 1KDAA 2EY5A 2EY1A 1RTOA 4I7ZC 3L9AX 1SE3A 1SNQA 4RGNA 1II3A 1ZYRD 3NXWA 4FYDA 4KKSA 2L5TA 3V2TA 4TSSA 3A55A 1Y1VB 1WCMB 3BVGA 3EA6A 5EPKA 4EGVA 2O5IC 1LTSD 2B2VC 2RBMA 1STAA 1CA5A 4IZ8A 1DXMA 4TKOB 1AFPA 4CKCA 1D6EC 4HTHA 2PW5A 2KHSA 2DNCA 1OXSC 1NSNS 2EYLA 3S9WA 2PCFB 1F9QA 3NSWA 5NUCA 2B2TA 1SYFA 3FVQA 1WTQA 5E4XA 4KY5A 1F2ZA 5DAUA 5IGDA 5FKAC 3T13A 4V190 3URYA 2PO4A 2E2HB 1Y8OB 5DNFA 1JE4A 2K01A 2LKVA 1WTRA 2YU9B 3NK9A 5FOBB 5A2QE 5JEAG 1RJTA 2IJ0A 1QILA 3MXGA 3OPOA 3C46A 4G4KA 5M5WB 1LTAD 1Q90A 1EQVA 1STYA 3DXJC 3DWQA 1TY0A 3I8ZA 2F3VA 1LTBD 5DEHA 3TN2A 2XRQD 3OOCA 3BYYB 5CV5A 3GTLB 3FMCA 2BE5C 1C4QA 1ESFA 4IFDJ 1J8IA 2EPBA 1PTOH 2N55A 3FEWX 2QDBA 4RHRA 4RCNA 3E6ZX 2PYKA 4RKBA 2CVRA 1U4MA 3TP6A 4CKBA 2V4DA 4R8IA 5EKLA 2F0GA 4PV1C 4GZYC 3KLRA 1BQQT 4G7OC 3VYSA 2R7ZB 1FGBD 3SXHA 5G3LD 1B9NA 3GV3A 3QIAA 1CHPD 2JE6I 5I6WA 2PW7A 5CMDA 2H1EA 4KJNA 1BCPF 3BG3A 3DWAA 3PUZA 4KMUC 1EIHA 5EJWA 1ET6A 3S16B 1EEID 4ID6A 1GHJA 5IT9L 2EJFC 3QOJA 4DK1A 2E2JB 1GHKA 4EVOA 3L3OC 4WFN3 5CBAE 1TS4A 1AZPA 3PV0A 4L63B 1I4HA 1XTCD 2RVLA 2B8GA 1F9RA 2EYFA 4HMJA 1HQMC 3K0YA 5IOCA 3SHLA 3M7NA 4CGYB 1MBYA 4FNFA 3MHBA 3D4DA 3NPPA 4RGMA 4C3JB 2NN6I 2FJ2A 3Q22A 5ELFA 3BDOA 1FD7D 4HEDA 4DNTB 4C56C 3BZDB 3K6OA 3WOEA 3E5SA 2RDFA 1MD2D 1GJXA 5EGTA 4RAUC 2NN6G 4S3SA 4KKTA 1TIID 2AQ2B 3G6JB 2LFNA 3S17B 3WDNA 4BA2I 3VYTA 5FO9B 3HOXB 3ZYYX 3SVMA 1KABA 1HA6A 1JB3A 3DMUA 5C5LA 4XQQA 4B9WA 2F0HA 2A74C 4PMCA 4K5WA 3RD4A 1EY4A 2K1BA 1V8QA 2G9HD 2C5CA 4B08A 1ILPA 1H9KA 5C6AA 2FMCA 2Q8RE 4DU9A 3BS1A 2PZUA 2Z4IA 3S1QB 4K5XA 1CI3M 2WIIB 2F03A 5KRUA 1Z47A 2NWGA 3CRLC 3VR5A 1U4RA 3R3OA 2F3WA 1DM0B 4U673 1IYUA 3ND9A 1JICA 4ZKBB 3Q6SA 4CKEA 3ERQA 2NYZD 1Y69U 2JA7B 2HQEA 2ZT9C 3AU7A 4KD4A 1EY6A 2CQAA 2KVMA 3RUZA 2WACA 1TWCB 1JWSD 2F0IA 4C3HG 1EY9A 1D1IA 1BCPB 1TS5A 3HEJA 1UUPA 5CV6A 1STNA 2D5DA 1EL0A 3PUWA 3QG1A 1AEXA 5EPJA 5FO7B 1BUVT 5J1ZA 2LY7A 1QOHA 3I91A 3S1MB 1STHA 4ZKCB 5JVH3 3PIP3 1KNEA 3IL8A 2Z1CA 3BDCA 1LV9A 3NTHA 2X6LA 1O7ZA 1MI2A 2BA0A 1EY7A 1YNND 1UNSA 5E3FA 3MZ5A 4IQZA 2F0QA 1A2UA 1TQOA 3NWSA 3PIO3 4PNYA 2L55A 3W2DA 5CC4A 1W6JA 3D8GA 2HCCA 4LAAA 4DNRB 5KYLA 2J7ZA 1A3VA 3WOFA 3OIQA 2L12A 1E0BA 5IGGA 3CQZB 2B2VA 3J80E 2F0OA 2C9OA 3GTPB 3V96A 3I72A 3P1HA 4QIWB 5M5XB 1SFOB 3SDZA 4QUFA 1WTOA 4AYBB 3PO2B 4F7XA 2R61A 3GTOB 1PRTB 3FRPB 1BR9A 4F87A 4DGZA 3I73A 5KYIA 1PDQA 3D3RA 2IW3A 1Y8PB 1ESRA 2EY2A 3T53B 1S5DD 2EYHA 3FPUB 1DCZA 1F9PA 4C1NK 2F0KA 3IAYA 3GO5A 1DYQA 2B2TC 4MIUA 4A3FB 3X3NA 4F8MA 1U4LA 2AQ3B 1FNWA 5FK9C 1PYWD 1UAPA 2F0UA 2D62A 2BA1A 1RODA 5JPNC 3SK8A 2NBFA 2EZVA 3AMUA 4FXGC 3GQBA 4HAEA 4OHJA 1WTXA 2B2WC 3CHBD 1EU3A 3LWEA 1L0XB 1F2MA 3D4RA 2OF1A 4O1NA 2PMZB 2NTTA 2LS01 3X3MA 1PMRA 1EQTA 1LABA 2F4IA 2KCCA 1QJOA 2I07B 1EY8A 4DK0A 3J7AV 2A5HA 4Z9CB 1A2TA 1C48A 3MXNA 1Y8NB 5LHY1 1BDOA 3NQTA 2D9UA 4CBVA 2RDHA 2OEOA 1KDBA 4G7ZC 1PRTD 1KAAA 1VDZA 4YIJA 1HFNA 4HN7A 2A6HC 1BXTA 2L1BA 2N88A 2X69A 3TZUA 3FDTA 3BVZA 4NDXA 1T5EA 1IW7D 5I4DA 4QUCA 1KTKA 2K5QA 2Z8LA 2JSOA 4IUNA 5CORA 1HXYD 4BBRB 1LACA 4K6DA 2A68D 3QO2A 4I65A 1BCPC 1EYCA 4L8JA 5DM63 4XYQA 2QKIC 3VYUA 1Q3LA 1X3PA 2VB3X 2XSCA 3HOWB 2D2CC 1Q1EA 5ELDA 4XQJA 3DHQA 3DEPA 1C8CA 1EZ8A 5K36H 5I2YA 5I6YA 4CJ1B 2NVYB 3EFXD 1G6ZA 2EJGC 5JAVA 1I4RA 3MAQA 1EY5A 3N52A 3A7LA 1I4GA 4BY7B 3C1EA 1GOZA 2F0DA 4P2CB 4Q0FA 4H0LC 4DFAA 1HTLD 3CRKC 1IL8A 1XX8A 1UEAB 4ME5A 3H6MA 4K5VA 3GV6A 1SNMA 2IT1A 5IIFA 2XWBB 1RTNA 3MC0B 3A7AB 1JR0D 1G8ZD 2MHVA 4KHVA 1BO0A 1TWGB 1DZ1A 2WKDA 5EQ0A 1ET9A 3R2IA 1CQVA 2BDNA 2M9VA 2K04A 2RDGA 4H7BA 2VUMB 1R4PB 1Q1BA 3NBIA 2G9DA 4O42A 1I3QB 4XIGS 1CTMA 4KV6A 1CK1A 3HZXA 4FXKC 1Z7TA 4IUVA 4CHTB 5C4JB 3TP8A 3BYTB 1GUSA 1X32A 5T1IA 1TWFB 1GUWA 3I70A 4RGTA 2QEJC 1LTGD 4NKLA 4BBSB 3MXPA 1SNPA 3LX0A 4KY7A 2J4XA 2DNEA 1EEFD 3OHXC 3VA7A 3A54A 1BBXC 3GTQB 1IKMA 1I4QA 3HP3A 2MUYA 5LL6S 4ZYSA 2MJ8A 3SK5A 4EQOA 3FPPA 4JBWA 4XT1B 1VMPA 2PQEA 1JC7A 1JQYD 1EYAA 2XVSA 1QNKA 1K83B 4FVMA 1XWEA 1GUGA 5JJZA 3NE5B 2EE1A 1GUNA 3F2UA 1BF4A 1G2TA 1FNUA 2ENBA 5BN4A 2M00A 2PZTA 3QJYA 4J6HA 3VA5A 1Q12A 3JAML 1GUOA 2WP8J 2H4OA 2J0TD 2QF7A 1B3AA 1SNOA 5ISRA 1SYCA 1ZKOA 2FFKB 1T5XD 3S1RB 2JEAI 2MP1A 4QF4A 4BY1B 3SR1A 2CW0C 3SK6A 5C4ZA 1OXVA 1E2VA 2M2LA 3H94A 1IKLA 1R9TB 1YNJD 2EYJA 3KLSA 1MSHA 4BA1I 1MSGA 4BS9A 2NVXB 4FF2A 2LMCB 4HR7B 3RZOB 1SSOA 1TWHB 1LT6D 1O7YA 5A2QL 2NUCA 5TSSA 3T4AC 4LMQD 4ODGA 2NVQB 1A3TA 1ILQA 3M7GA 4QCLA 1K8MA 4M1UB 3I4LA 2WB1B 5IT9E 1PXUA 1M8AA 5C0XG 3U9SA 4ULLA 2JA6B 5FLXL 4QMGA 3H09A 1G91A 4K14A 3MFGA 3SK4A 3SEBA 2K5DA 1AN8A 4JK1C 3NBHA 5DM73 3PUXA 4K2KA 4KKUA 2CW0D 1B1ZA 2HDLA 5C3WA 1A6XA 4R8NA 1JORA 3J81L 1AP0A 1HPCA 2HUGA 3A8JE 4F88A 2F1MA 1AZQA 4OIJA 3KBGA 2JP1A 2QILA 2JA8B 2SDFA 1STGA 3I3CA 2L11A 2B2WA 5C5MA 4PMWA 3TP5A 2K6AA 4WJWA 1SYDA 1EWCA 1CM9A 2B39A 4G7HC 1TS2A 5FO8B 1CHQD 1HHVA 3O13A 2AQ1B 1ONLA 3D4WA 3K7AB 2RQXA 3K57A 3A56A 2QCPX 3OWEB 5EKKA 1E2ZA 2F0FA 2EJMA 3DWPA 1PFMA 2SEBD 2XWJB 3PUYA 4A3JB 3NTIA 1JCKB 4RH6A 1ENAA 2A6HD 4E6IA 1EFID 3JAME 2K05A 1S5CD 1H9SA 2FINB 3K5MA 1SJED 2O4XA 1H9MA 1RDPD 2E2IB 1Z6HA 4J1MA 4C1NI 3D6CA 1E2WA 1YNJC 4KJOA 2TMPA 4FO2A 1BCPD 1NR2A 5KIXA 4IUUA 1SXTA 3IFTA 1B9MA 3KF8A 3RZDB 5ELEA 3VR6A 5C3XA 4PQXA 1IW7C 1TY2A 4IUPA 3RLFA 1GXDC 1FR3A 2XN9C 5M5YB 4DXFA 1BOSA 5IGEA 4RA8A 2EY6A 2Q8IB 1BNZA 2A69C 3T16A 4ZUJA 3R8BA 1DOLA 1W6KA 2K03A 4DAPA 3C3LA 1F77A 1KLGD 1PZKD 1LTID 2NB0A 2B2UC 1M4VA 4DF7A 1B50A 1IYVA 3HOUB 2KEEA 4C3IG 3K59A 2O2LD 3VR4A 5COYA 1NUCA 5I9OA 1NR4A 1I4XA 1KDCA 1RCVD 1RD9D 4A3KB 1NCVA 2WAQB 2BOSA 2A69D 3OMGA 3T51B 3P7JA 3P75A 3J80L 1EOTA 3SE0A 1D5XC 2WINB 3R93A 4R9WA 4FF3A 2DY7A 3UI2A 1LLRD 5JVG3 1DONA 1PLFA 3C2PA 1G2SA 2A6ED 5EBDA 4DAVA 3A8IE 3S14B 3P20A 2WKCA 5CV7A 3BVMA 1PZID 2RKSA 5ELBA 1SEBD 5CR3A 1HUMA 2O5JC 4KN4C 4XDXA 3J81E 2XIWA 4TRDA 1WTVA 2Z4HA 2F0WA 3PO3B 4XXEA 2EOTA 4RCOA 1V1OA 3EQLC 1IHZA 5IGCA 1F9SA 1TVXA 3GP7A 2B2YA 1RKNA 4IFDI 1I6HB 5M3FB 3PUVA 2AUKA 1HTPA 1OXUA 3TZDA 5C4HA 1LT4D 2R3ZA 2ZXOA 2F0PA 1B2TA 1QE6A 2BDOA 2A6EC 5F2DA 3VR3A 3KLSX 3EROA 4NMZA 3H91A 1QWYA 5E1FA 2Q8TA 1L0YB 1STBA 3RMHA 1U4PA 2NTSA 4X3TA 2Y0SB 5T1GA 1WD0A 1V43A 1ENCA 4OO1I 5CV9A 4FXDA 1DOKA 1PRTF 5I2XA 5BN3A 2HCIA 3D31A 1HA5A 3OW7A 3MFYA 1Q8IA 1KNAA 5KNBA 1OXXK 4MN3A 2E74C 1SE4A 5M3MB 4IN3A 5KGUA 4EQPA 1F2LA 5JEAH 3Q0AA 3LWUA 3A8KE 1XYIA 3T56B 3GTJB 2B2UA 1B4OA 3M4OB 1SMYD 1B53A 2KQ3A 4C3IB 5J39A 4XT3B 3OMCA 2F0SA 4KTAA 4FF1A 2EYOA 3GTGB 4KY6A 1HRJA 4ILWA 5HGTA 1LTRD 2ICEC 4IUQA 1LT5D 2SNSA 1ZXTA 1B44D 2AWNA 4L6TB 1QCBD 4KN7C 3GD7A 1PTOB 2L0CA 3CKIB 3M4YA 4RKLA 2F0VA 3DM1A 4HCSA 4ZRZA 2EDGA 1SMYC 4A3EB 3MEHA 4UDUC 1TR5A 2BE5D 4WORA 3IFDA 1S4ZA 4RGOS 4WRDA 4K8IA 2BCOA 1AW7A 1TU2B 3MWYW 3HS0C 1D5MC 3NWTA 1JWMD 5ELCA 1WVLA 3DEOA 1CZWA 4OO1H 3MVVA 1EWHA 4IURA 1R4QB 3VYRA 1YNNC 1STEA 4ZAIA 4FF4A 3FKIB 1S5FD 1WTWA 2SNMA 1D2BA 1JOOA 3ONAB 5D3DA 2B2YC 5C0XJ 1PZJD 2HDMA 3Q24A 1O7LA 3CU7A 4XYOA 2CHBD 2IPKD 2IWHA 4OO1G 2F0LA 4Y7NB 1RHPA 1H9SB 3KUPA 1S5BD 2E76C 3C1FA 3S2DB 5J22A 2JEBI 4X3KA 1X3QA 3MXUA 5C0XI 1TT2A 4NW2A 4XQNA 3TDQA 4FP5D 1EYDA 2K28A 4IFDH 5CBEE 3S15B 1EIGA 2IX3A 1OXTA 1FYCA 3H3VC 4BWGB 5JEAJ 4ZUIA 2NVTB 3HOVB 1HCZA 2K7VA 5CV8A 4K2LA 3HKZB 3NUCA 1PFBA 2IX0A 4IFDG 1CFMA 4RFBA 4ABNA 1ML0D 5D14A 3Q23A 1HFGA 1PRTC 4HCEA 3OWFA 2EVBA 3S2HB 1U9RA 2KCNA 1A3UA 5D3IB 5CGKA 5FLXE 1F2YA 3W3AA 4IUTA 1SYGA 1TKWB 4LJZC 5HURA 1VCIA 2SOBA 4XTCS 2IL8A 2E2DC 3MTSA 4H13C 4DXGA 3LNNA 2R93B 3H0GB 2IX1A 2YYZA 1DD2A 2RSNA 2L4NA 2DN8A 4V0BA 5K5PA 2K5WA 4A3IB 3ITPA 1O80A 3NQIA 3QB3A 1RF2D 5AFWA 4H44C 4KHZA 1PTOD 3EVQA 3KBXA 1WTPA 2KECA 2DY8A 1QNUA 1D1KA 3HG9A 4N9TA 1NAPA 2PNRC 1SE2A 2F0MA 3R2TA 2VB2X 3IKJA 5CYUA 3HOZB 5I9PA 1LO5D 5C0XH 1HUNA 4ZLTF 1ZYRC 4OGQC 2PPBC 3TSSA 5C4XB 2XRSD 4C2MB 2ZXPA 2JXMB 5G3LF 1ZEQX 1Y1WB 5C44B 4CJ0B 4EQNA 2KA7A 3D6WA 3G7LA 4KD3A 1LT3D 4Q5VA 1CZGA 1JOKA 1A15A 3OSOA 2A68C 1G291 3K5NA 1VF7A 4CJ2C 5M9OA 5E4WC 4DN4M 4K8JA 3MA2B 2AWOA 1DJRD 3TP7A 1CT1D 1J9OA 3N6RA 4OIKA 2F0EA 3K5OA 4UAIA 1SDFA 4HSPA 2F0TA 5JPMC 2K32A 5EBCA 3HOYB 2KJXA 2E75C 3K58A 1OO9B 3KK7A 4K6LA 4QB4A 1LTTD 4A3DB 1SJHD 4G57A 1SYEA 1PFNA 1O78A 3AB9A 1QB5D 3I4NB 2F0JA 5EPLA 4TQUS 3GTMB 2A73B 1HQRD 4N9PA 1PTOF 2GA4B 1K8OA 2VXWA 4A3GB 3ND8A 1EZ6A 3HRZC 1H9JA 3PMFA 1ICWA 1MGSA 3QWNA 4HSVA 5KNDA 4C3HB 1V1PA 2L9HA 5D65A 2NN6H 3K5LA 1XXGA 4MHEA 1EY0A 1V1PB 3DUZA 1I50B 5K36G 2MGSA 2OT2A 5BN5A 4IALA 2MPMA 2EYPA 1I4PA 3NP8A 1SNDA 2JA5B 1TWAB 1D5ZC 2XNAC 4RWSC 1FNVA 2I46A 5CV4A 4DAYA 3TBIB 1VMCA 4DA2A 2B8FA 2EYMA 4KI0A 1VF5C 2B63B 3J7AF 4LK1C 4HMIA 5LL6X 1ENFA 1QG7A 4M8AA 1TS3A 2ID0A 2AUJD 1JOQA 3QOLA 1GUTA 2NZ1D 3EJIA 1WD1A 5IODA 4A3BB 4KK7A 3I4MB 4X3SA 3GTKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E76 C;  4KHZ A;  4KKS A;  2L5T A;  3GQB A;  4RCN A;  2A69 C;  2CW0 C;  2JEB I;  5KNC A;  1OXV A;  3MXU A;  1GUS A;  4IQZ A;  1H9R A;  1E2V A;  2O5I C;  5K36 H;  3H94 A;  1O78 A;  1DXM A;  4TKO B;  3D4R A;  2V4D A;  2K33 A;  3AB9 A;  4BA1 I;  1V8Q A;  2EJG C;  3HGB A;  2PNR C;  4PV1 C;  2LMC B;  4HR7 B;  4GZY C;  3KLR A;  4TQU S;  2JEA I;  3A7L A;  4IFD H;  1PMR A;  3PUV A;  2AUK A;  1HTP A;  1OXU A;  1H9K A;  4G7H C;  2DNC A;  1IYV A;  4DNR B;  1OXS C;  4G7O C;  1LAB A;  3IKJ A;  1OXT A;  1FYC A;  2KCC A;  2PCF B;  4H0L C;  1K8O A;  1B9N A;  1ONL A;  1QJO A;  3ND8 A;  3VR4 A;  2DNE A;  4KN7 C;  3CRK C;  3GD7 A;  3VA7 A;  1H9J A;  2BDO A;  1HCZ A;  2K7V A;  2A6E C;  1E2Z A;  3QIA A;  4DK0 A;  3VR3 A;  5C0X H;  3VR2 A;  2EJM A;  2JE6 I;  1CI3 M;  3M4Y A;  1ZYR C;  4OGQ C;  2PPB C;  3CRL C;  1Y8N B;  3PUY A;  4IFD G;  1CFM A;  3VR5 A;  1BDO A;  5KND A;  3BG3 A;  2EDG A;  2A6H D;  3PUZ A;  2NN6 H;  1K8M A;  1SMY C;  3I72 A;  4KMU C;  3FPP A;  2JXM B;  4G7Z C;  4JBW A;  2IT1 A;  1IYU A;  3I4L A;  3ND9 A;  3SDZ A;  2A69 D;  1H9S A;  2BE5 D;  1GHJ A;  2EJF C;  2EVB A;  4DK1 A;  1Y8O B;  3T51 B;  5K36 G;  1VDZ A;  3A7A B;  5BN5 A;  5C0X G;  1GHK A;  2KA7 A;  1Y69 U;  3U9S A;  1V43 A;  1H9M A;  1I6V C;  3PV0 A;  2ZT9 C;  3SE0 A;  1Z6H A;  2A6H C;  1GUG A;  2B8G A;  3W3A A;  2A68 C;  1G29 1;  1TKW B;  1TU2 B;  1VF7 A;  3I73 A;  4LJZ C;  1HQM C;  3TZU A;  2R6G A;  1VCI A;  1E2W A;  3NE5 B;  5BN3 A;  5JEA G;  3M7N A;  1GUN A;  3D31 A;  1YNJ C;  1Y8P B;  1T5E A;  3OPO A;  3OW7 A;  1IW7 D;  2A6E D;  3MFY A;  4XTC S;  3T53 B;  4JK1 C;  1Q90 A;  2B8F A;  2AWO A;  4H13 C;  3PUX A;  3A8I E;  1DCZ A;  2NN6 I;  3LNN A;  3P20 A;  4KI0 A;  5KNB A;  1OXX K;  4KKU A;  4OO1 H;  2E74 C;  5BN4 A;  3BDO A;  2YYZ A;  4DNT B;  3IFT A;  3L7Z C;  1VF5 C;  3N6R A;  3QJY A;  1EWH A;  3DXJ C;  1DD2 A;  1B9M A;  2D5D A;  2Q8I B;  1YNN C;  3M85 A;  1Q12 A;  3PUW A;  4LK1 C;  3VR6 A;  3QG1 A;  5A35 A;  2O5J C;  1GJX A;  1LAC A;  4KN4 C;  1A6X A;  2A68 D;  5JEA H;  1GUO A;  1Q1B A;  2NN6 G;  3OOC A;  1IW7 C;  3LWU A;  3A8K E;  2DN8 A;  4L8J A;  4XIG S;  4KKT A;  2QF7 A;  2AUJ D;  1CTM A;  1HPC A;  2BE5 C;  3A8J E;  1O7L A;  3FMC A;  3RLF A;  1GUT A;  1FR3 A;  2D62 A;  2BA1 A;  4I7Z C;  3T56 B;  1Z7T A;  1ZKO A;  2K32 A;  4OO1 G;  2F1M A;  1H9S B;  4H44 C;  3WDN A;  4BA2 I;  2BA0 A;  2E75 C;  3EQL C;  2D2C C;  1Q1E A; 
#chains in the Genus database with same CATH topology
 4DR6 L;  2EXZ A;  4JI6 L;  1SRU A;  2OXP A;  1PTO C;  4B9X A;  4J8Q A;  5KNC A;  3TQY A;  4MNO A;  1H9R A;  5C3E B;  2PZW A;  1X6O A;  3U9O A;  1SBB B;  5EKI A;  2K33 A;  1SYB A;  4AQY Q;  4IOA A;  4ZK9 B;  2KED A;  3HGB A;  4DR3 Q;  5IT9 c;  4JOI C;  1PH8 A;  3GTJ H;  1EIY B;  5IGF A;  4JCV E;  2RSO A;  3AQQ A;  4IPD A;  4A93 G;  3GTL H;  2VNU D;  4A3M B;  1SNC A;  2FMM A;  4PMB A;  4C3H H;  2HQL A;  3M3Y B;  1S5E D;  5JOB A;  2KUM A;  3S1N B;  1VQ6 A;  1DOM A;  4IPH A;  1PH9 A;  2V1C C;  2RA4 A;  3BZC A;  3VR2 A;  3NBH B;  4AQY L;  4GNX A;  5IGB A;  2FHT A;  4DR3 L;  1X3G A;  2JYO A;  2F0N A;  5C4X G;  1KLU D;  4U68 A;  3U4Z A;  5M5W H;  4DV0 Q;  3J7Y W;  4EX5 A;  1CQF A;  3S1N H;  4O0A A;  3TME A;  4C3J H;  4HJ7 A;  1SAP A;  2TSS A;  3PSI A;  3OIP A;  4NP5 A;  4X3U A;  3E0J A;  1IYJ B;  2OQ0 A;  4OL7 A;  2X6G A;  5FJ8 H;  1I6V C;  4BY7 H;  2YU9 H;  1JWU D;  1SE8 A;  3UDI A;  4BXX H;  2R92 B;  3NHH A;  2R6G A;  2E2H H;  1CA6 A;  3V05 A;  5KEE A;  4C3J G;  2WAQ G;  3BDL A;  4A93 B;  4RHS A;  4ZQ3 A;  2ZXR A;  3NTK A;  3TRZ A;  2ICI A;  2UXC L;  3L7Z C;  1EU4 A;  3I90 A;  2WV6 D;  1X56 A;  2KOL A;  3M85 A;  4HIM A;  4L5S A;  4BXX G;  1IL2 A;  4R4O A;  5A35 A;  1KDA A;  4DK3 C;  3A74 A;  2NVQ H;  2EY5 A;  2EY1 A;  3M9B A;  1X54 A;  1RTO A;  1HNZ L;  1TWC H;  4I7Z C;  3L9A X;  1SE3 A;  1KRS A;  1SNQ A;  4RGN A;  1II3 A;  1ZYR D;  3NXW A;  4FYD A;  4A3B G;  1ASZ A;  4KKS A;  2L5T A;  3DM3 A;  4TSS A;  3A55 A;  3PQI A;  3V2T A;  1Y1V B;  1WCM B;  3BVG A;  2K14 A;  4LUV A;  3EA6 A;  5EPK A;  4EGV A;  3HOW H;  2O5I C;  1LTS D;  2B2V C;  2QW7 A;  2RBM A;  1STA A;  1CA5 A;  4IZ8 A;  1DXM A;  4TKO B;  1HNZ Q;  4N8X 1;  2D0O A;  1AFP A;  4CKC A;  1D6E C;  1Y14 B;  4HTH A;  2ZM6 L;  2PW5 A;  1E7Z A;  2KHS A;  2E5L Q;  2DNC A;  1OXS C;  1NSN S;  2EYL A;  3S9W A;  2PCF B;  4QIW E;  1F9Q A;  2B3G A;  1YJ9 A;  3NSW A;  5NUC A;  2B2T A;  1SYF A;  4R4T A;  3FVQ A;  1WTQ A;  4N8F A;  5E4X A;  1KHI A;  1L1O A;  2KBN A;  4KY5 A;  2CWA A;  1F2Z A;  1L0W A;  5DAU A;  3G71 A;  3KJO A;  4IPC A;  1KC8 C;  1EYG A;  3S15 H;  5IGD A;  1VQD A;  3PO3 G;  5FKA C;  3T13 A;  4V19 0;  1J6Q A;  3URY A;  4LFA L;  2N78 A;  2R7D A;  2MFI A;  2EQS A;  2PO4 A;  3FKI H;  2E2H B;  1Y8O B;  5DNF A;  3RZO H;  1JE4 A;  1Q81 C;  1EFW A;  2K01 A;  2LKV A;  1WTR A;  2YU9 B;  3NK9 A;  2EIF A;  2Q2U A;  5FOB B;  5A2Q E;  2JA5 G;  4A3C H;  5JEA G;  1RJT A;  1JJG A;  2IJ0 A;  1JT8 A;  1U0L A;  1QIL A;  3MXG A;  3OPO A;  3C46 A;  4G4K A;  1IBL L;  5M5W B;  1LTA D;  1SRO A;  1Q90 A;  2G5D A;  2Q2H A;  1NNX A;  1EQV A;  1BVS A;  1STY A;  3DXJ C;  3DWQ A;  1TY0 A;  3I8Z A;  3W5O A;  2F3V A;  1LTB D;  5DEH A;  3TN2 A;  1P16 A;  2XRQ D;  3OOC A;  3BYY B;  5CV5 A;  2Z6K A;  3FMC A;  3GTL B;  2BE5 C;  3MXN B;  1C4Q A;  1ESF A;  4IFD J;  1J8I A;  2EPB A;  1PTO H;  2N55 A;  3FEW X;  2QDB A;  4RHR A;  4RCN A;  3E6Z X;  2PYK A;  4RKB A;  4DAM A;  2CVR A;  1U4M A;  1UE5 A;  3TP6 A;  1Z9F A;  4CKB A;  1RL2 A;  1TXY A;  1IBK Q;  2V4D A;  4R8I A;  5EKL A;  2F0G A;  4UP8 A;  1XMQ Q;  4PV1 C;  4UP9 A;  2AKW B;  1X65 A;  3KLR A;  4UPA A;  4GZY C;  1BQQ T;  3GTO H;  2K5N A;  4DV6 Q;  4G7O C;  2KEN A;  3VYS A;  2R7Z B;  5C44 H;  2K50 A;  1FGB D;  3SXH A;  5G3L D;  3CCU A;  1B9N A;  4Y52 H;  4DR2 Q;  1NBW A;  3GV3 A;  2JA6 G;  1XTD A;  3QIA A;  1CHP D;  2JE6 I;  4AH6 A;  2KHJ A;  5I6W A;  3GTP H;  2UXC Q;  2PW7 A;  5CMD A;  2H1E A;  3J80 c;  4KJN A;  1BCP F;  2F4V Q;  3BG3 A;  4JI3 Q;  3DWA A;  3PUZ A;  4KMU C;  4DV6 L;  1N34 L;  3CF5 A;  1EIH A;  5EJW A;  1ET6 A;  3S16 B;  1M90 C;  1EEI D;  2PI2 A;  4ID6 A;  1GHJ A;  1KAW A;  2EJF C;  3QOJ A;  5IT9 L;  4DK1 A;  2E2J B;  1GHK A;  3PO2 H;  4EVO A;  3L3O C;  4WFN 3;  5CBA E;  1GM5 A;  1TS4 A;  3CC7 A;  3PV0 A;  1AZP A;  4L63 B;  1I4H A;  1HZ9 A;  3RN5 A;  1XTC D;  2RVL A;  2B8G A;  1F9R A;  2EYF A;  4HMJ A;  4C2M H;  1HQM C;  3K0Y A;  5IOC A;  3SHL A;  3M7N A;  4CGY B;  1MBY A;  1HR0 L;  5C4J H;  4BBS G;  4YY3 L;  2VQE Q;  4FNF A;  3MHB A;  3D4D A;  3NPP A;  4RGM A;  4A3L H;  3PCO B;  4C3J B;  1YVC A;  1UE7 A;  2NN6 I;  2FJ2 A;  3Q22 A;  5ELF A;  3BDO A;  1FD7 D;  4HED A;  4DNT B;  4C56 C;  3BZD B;  3K6O A;  4B3R L;  3WOE A;  3E5S A;  2RDF A;  2UUC Q;  1MD2 D;  1GJX A;  5EGT A;  4RAU C;  2NN6 G;  4S3S A;  4KKT A;  2VUM H;  1TII D;  2B29 A;  2AQ2 B;  3G6J B;  2LFN A;  1MJE A;  3S17 B;  3WDN A;  4BA2 I;  3VYT A;  5FO9 B;  3HOX B;  3I4N H;  3ZYY X;  3SVM A;  3GDE A;  4POG A;  1KAB A;  4HJA A;  1JB3 A;  1HA6 A;  2F52 A;  3DMU A;  4L5T A;  5C5L A;  3STB C;  4XQQ A;  4B9W A;  3CCL A;  2CFM A;  2F0H A;  2A74 C;  2YTV A;  3CME A;  4JBK A;  2JA8 H;  4PMC A;  4K5W A;  5C3E H;  3RD4 A;  1EY4 A;  2K1B A;  1V8Q A;  2G9H D;  2GN5 A;  1JJ2 A;  1C9O A;  2C5C A;  2HD3 A;  4PZ7 A;  1Q8K A;  4B08 A;  1ILP A;  1H9K A;  5C6A A;  4LFA Q;  1C7Y A;  2FMC A;  2Q8R E;  4DU9 A;  3PF5 A;  3BS1 A;  2PZU A;  1VQ9 A;  2Z4I A;  3S1Q B;  1WI5 A;  2JA8 G;  2ZJR A;  4LF5 L;  4K5X A;  1CI3 M;  2WII B;  4WJ3 M;  4GKK Q;  2F03 A;  5KRU A;  1Z47 A;  2NWG A;  3CRL C;  2UUA Q;  3VR5 A;  1U4R A;  3R3O A;  4BBR H;  2F3W A;  4R4C A;  3I4M G;  3K7U C;  1IBM Q;  1PH3 A;  1K0R A;  2HIV A;  3S1Q H;  1DM0 B;  4U67 3;  1IYU A;  3ND9 A;  1JIC A;  4ZKB B;  3Q6S A;  5ELN A;  4CKE A;  3ERQ A;  2NVX H;  1MKH A;  2NYZ D;  3AYH B;  1Y69 U;  2JA7 B;  1LM0 A;  1N36 Q;  3HKZ E;  2HQE A;  2ZT9 C;  3AU7 A;  4KD4 A;  4YWL A;  1PV4 A;  4YCU A;  1EY6 A;  3GTG H;  5L37 A;  3T1Y L;  2CQA A;  2UUA L;  1NY4 A;  2KVM A;  3F2B A;  3RUZ A;  2WAC A;  1TWC B;  1PH1 A;  1CKN A;  1JWS D;  1A63 A;  2F0I A;  4C3H G;  1WYD A;  1EY9 A;  3PIO A;  1IBK L;  3I4O A;  4HIK A;  1D1I A;  1BCP B;  1TS5 A;  3HEJ A;  3J7Z C;  1UUP A;  5CV6 A;  1STN A;  1KL9 A;  2D5D A;  4X6A H;  5GQO A;  1EL0 A;  3A5Z B;  3PUW A;  3T1Y Q;  3QG1 A;  1AEX A;  5EPJ A;  5GAH C;  5FO7 B;  5GAD C;  1BUV T;  5J1Z A;  2LY7 A;  4NXM L;  1FJG L;  1QOH A;  3I91 A;  3S1M B;  1STH A;  4TVA B;  4ZKC B;  5IP7 G;  5JVH 3;  4DV3 L;  1KQS A;  3PIP 3;  1KNE A;  3CD6 A;  3IL8 A;  2Z1C A;  3BDC A;  1LV9 A;  3NTH A;  5LMU Q;  2X6L A;  1XMQ L;  1O7Z A;  5GAG C;  1MI2 A;  4DV1 Q;  2BA0 A;  5FJ8 G;  3ZJY C;  3CCM A;  4BY7 G;  1EY7 A;  1A8V A;  2R7Z G;  1YNN D;  5BR8 Q;  4A3M H;  4IPG A;  2PI2 E;  1QVC A;  1UNS A;  5E3F A;  3MZ5 A;  4IQZ A;  3KDF A;  2F0Q A;  1A2U A;  1TQO A;  3NWS A;  2BH2 A;  3PIO 3;  1HNX L;  4DV2 Q;  4PNY A;  1GD7 A;  2L55 A;  4OWX B;  3W2D A;  5CC4 A;  1W6J A;  2K52 A;  3D8G A;  4MTK A;  2HCC A;  5IY0 A;  4LAA A;  2JA9 A;  4DNR B;  5KYL A;  2J7Z A;  1A3V A;  3HOY H;  3STB D;  3WOF A;  2Z6K C;  2OCE A;  3OIQ A;  4PG3 A;  2L12 A;  3FHW A;  1HR0 Q;  1E0B A;  5IGG A;  3CQZ B;  2B2V A;  3J80 E;  3S16 H;  2B63 G;  2F0O A;  3K8A A;  2KCM A;  3PIP A;  4A3I G;  2C9O A;  4UP7 A;  3QR8 A;  3GTP B;  3CC4 A;  3V96 A;  4JI1 L;  3I72 A;  3HOY G;  2MO0 A;  3P1H A;  4QIW B;  5M5X B;  1SFO B;  3SDZ A;  4QUF A;  1WTO A;  2HT1 A;  4AYB B;  3PO2 B;  4F7X A;  2LSS A;  2R61 A;  3FP9 A;  3GTO B;  1PRT B;  1K9M C;  3FRP B;  1BR9 A;  1C0A A;  2LXK A;  4F87 A;  4DGZ A;  3GTK H;  1WCM H;  3I73 A;  5KYI A;  4K0K L;  1PDQ A;  3M4Q A;  4JV5 Q;  3D3R A;  2IW3 A;  4OWT B;  1Y8P B;  1ESR A;  2EY2 A;  3T53 B;  5IYB G;  1S5D D;  2EYH A;  5FLM H;  3FPU B;  1DCZ A;  1F9P A;  2ZTD A;  3E9H A;  4C1N K;  2F0K A;  1VQI A;  4QY7 A;  3IAY A;  1PH2 A;  3L2P A;  3GO5 A;  1WCM G;  3AEV A;  1DYQ A;  4K0K Q;  2B2T C;  4MIU A;  4A3F B;  1GO3 E;  3X3N A;  4F8M A;  1U4L A;  2AQ3 B;  2RCN A;  1FNW A;  5FK9 C;  2UUB L;  1PYW D;  1UAP A;  2F0U A;  2D62 A;  4OEL B;  2BA1 A;  4LF5 Q;  2PMZ E;  3UDG A;  1ROD A;  5JPN C;  3SK8 A;  2NBF A;  4DUY Q;  2EZV A;  1XPU A;  3AMU A;  4FXG C;  3GQB A;  2K75 A;  1EQR A;  1UE1 A;  4HAE A;  1K8G A;  4OHJ A;  1WTX A;  2B2W C;  3CHB D;  1EU3 A;  1CSQ A;  2Z6B A;  1L0X B;  3LWE A;  1F2M A;  4IO9 A;  1GKH A;  3D4R A;  2HHH L;  2OF1 A;  4O1N A;  2PMZ B;  2NTT A;  2LS0 1;  3X3M A;  1PMR A;  4P71 A;  4A3J H;  1EQT A;  4A3K H;  1LAB A;  2F4I A;  2KCC A;  3HOU G;  1QJO A;  2I07 B;  1EY8 A;  1IBL Q;  2ZTC A;  4DK0 A;  2KCT A;  3J7A V;  2A5H A;  4Z9C B;  1A2T A;  4JBM A;  2EXD A;  1C48 A;  3MXN A;  1BKB A;  1Y8N B;  5LHY 1;  5EAY A;  1I5F A;  1BDO A;  4LFB Q;  3NQT A;  2D9U A;  4A3J G;  3GTM H;  4LF9 L;  4CBV A;  4OX9 Q;  2RDH A;  4JBJ A;  1HZA A;  2OEO A;  1KDB A;  4G7Z C;  1NMF A;  3F2C A;  1PRT D;  1KAA A;  1VDZ A;  4YIJ A;  1HFN A;  2UXB L;  4HN7 A;  2A6H C;  3CMA A;  1BXT A;  2L1B A;  2N88 A;  2X69 A;  1XMO L;  3TZU A;  2ES2 A;  4LF9 Q;  3FDT A;  3CAM A;  1N33 Q;  3A0J A;  2JJQ A;  3BVZ A;  4NDX A;  1T5E A;  1IW7 D;  5I4D A;  4QUC A;  4HIO A;  4QL5 A;  3BJU A;  1KTK A;  1E22 A;  2K5Q A;  2Z8L A;  2IY5 B;  2JSO A;  1Q86 C;  3CC2 A;  2UXB Q;  4IUN A;  4DAY B;  5COR A;  1HXY D;  4BBR B;  3UDF A;  1LAC A;  4K6D A;  2A68 D;  3QO2 A;  3CXC A;  2P5Z X;  4I65 A;  1BCP C;  2ATW A;  1EYC A;  4L8J A;  1A62 A;  5DM6 3;  3RR5 A;  4XYQ A;  2QKI C;  2GVA A;  3VYU A;  1Q3L A;  1X3P A;  2VB3 X;  4YCV A;  2UU9 L;  5E7N A;  4JW0 A;  2XSC A;  4NXN L;  3HOW B;  2D2C C;  1Q1E A;  5ELD A;  4XQJ A;  2FXQ A;  4A93 H;  2VY3 A;  3DHQ A;  3DEP A;  1C8C A;  1EZ8 A;  5IWA Q;  5LMN L;  5K36 H;  3CPF A;  5I2Y A;  5I6Y A;  3F2D A;  4CJ1 B;  5AJ3 Q;  3I56 A;  2NVY B;  3EFX D;  1I94 Q;  1G6Z A;  2JA7 H;  2EJG C;  5JAV A;  1I4R A;  3MAQ A;  1EY5 A;  3N52 A;  3A7L A;  1I4G A;  4BY7 B;  3C1E A;  1GOZ A;  5C4X H;  2F0D A;  2JQO A;  4P2C B;  4Q0F A;  4H0L C;  5IYD G;  4DFA A;  2VQE L;  4B3M Q;  4AIM A;  1HTL D;  3CRK C;  4A3G G;  1IL8 A;  3HOZ H;  1S72 A;  3PF4 A;  1XX8 A;  3CCR A;  5M3M H;  1UEA B;  1FL0 A;  4UY8 C;  4ME5 A;  3H6M A;  4K5V A;  1HZB A;  3GV6 A;  1SNM A;  2RHS B;  1YHA A;  2IT1 A;  5IIF A;  3TEH B;  2XWB B;  3U4V A;  1RTN A;  3MC0 B;  4HJ8 A;  3A7A B;  1JR0 D;  2PQA B;  3H0G H;  4X62 L;  1VQA A;  3PGZ A;  1G8Z D;  2MHV A;  4X66 L;  3KDF B;  4KHV A;  3CW2 C;  1BO0 A;  1TWG B;  1DZ1 A;  4UHV A;  1OTC A;  2WKD A;  1KRT A;  4DR2 L;  4IJL A;  5EQ0 A;  1ET9 A;  3R2I A;  1K83 H;  1CQV A;  2BDN A;  2M9V A;  3I2Z A;  2K04 A;  4YCW A;  1K3R A;  2RDG A;  4H7B A;  4JI0 Q;  2VUM B;  4A3B H;  4X66 Q;  1VQ4 A;  4BBR G;  1R4P B;  1Q1B A;  3NBI A;  2G9D A;  4O42 A;  1I3Q B;  4XIG S;  1CTM A;  4KV6 A;  1CK1 A;  3HZX A;  4FXK C;  1Z7T A;  4YWK A;  4IUV A;  4YHH Q;  4CHT B;  2WB1 G;  5C4J B;  3TP8 A;  4DUZ Q;  3OW2 A;  3BYT B;  3RN2 A;  1FGU A;  4WJ4 A;  2N3S A;  1GUS A;  1X32 A;  5T1I A;  4DPG A;  3HOV G;  1VS0 A;  1TWF B;  4EQ5 A;  1GUW A;  3EN2 A;  3I70 A;  4LF6 L;  1CKN B;  4RGT A;  2QEJ C;  1LTG D;  1SFO H;  2XTI A;  4NKL A;  3PO3 H;  4BBS B;  1S40 A;  3KOJ A;  3MXP A;  4DUZ L;  3RLO A;  4POF A;  4B3T Q;  1SNP A;  3LX0 A;  4KY7 A;  4RMF A;  3S2D H;  2J4X A;  3HKS A;  2DNE A;  3E0E A;  1EEF D;  3HOV H;  3OHX C;  3MEF A;  3VA7 A;  4H02 A;  4OWW B;  3A54 A;  3JAM i;  1BBX C;  4JC0 A;  1K28 A;  3GTQ B;  1IKM A;  4Y7N H;  1BBW A;  4JI2 L;  1I4Q A;  3K80 C;  3HP3 A;  1XNR L;  2MUY A;  5LL6 S;  4ZYS A;  2MJ8 A;  3SK5 A;  4EQO A;  5JJK A;  2Z0S A;  2JA5 H;  4A3C G;  3FPP A;  1PA6 A;  4JBW A;  1CSP A;  4XT1 B;  4A3M G;  1VMP A;  1YJW A;  3TS2 A;  4JYA L;  2PQE A;  5JJI A;  4DV3 Q;  1JC7 A;  1YHB A;  4APV A;  1JQY D;  1EYA A;  2XVS A;  1NMG A;  1QNK A;  1K83 B;  4FVM A;  1XWE A;  1GUG A;  1YZ6 A;  5JJZ A;  1WFQ A;  3NE5 B;  2EE1 A;  1GUN A;  4HJ5 A;  5M5X H;  4X65 Q;  3F2U A;  1BF4 A;  1G2T A;  3B6Y A;  1FNU A;  2UU9 Q;  2ENB A;  5BN4 A;  2M00 A;  2PZT A;  3QJY A;  3IRB A;  4J6H A;  3J81 j;  3VA5 A;  1PH7 A;  1Q12 A;  3OTO L;  3JAM L;  3H3V I;  2OTL A;  1GUO A;  2WP8 J;  2VS1 A;  2H4O A;  2LXJ A;  1K0S A;  2J0T D;  2QF7 A;  4JI7 L;  1W3S A;  2N49 A;  5AJ3 L;  1B3A A;  1SNO A;  5ISR A;  1SYC A;  1LUZ A;  1ZKO A;  2FFK B;  1T5X D;  3S1R B;  2JEA I;  2MP1 A;  2YTX A;  4QF4 A;  4BY1 B;  3SR1 A;  1XJV A;  2CW0 C;  3OTO Q;  1X3F A;  3SK6 A;  5C4Z A;  1PYB A;  5C44 G;  1OXV A;  1VQF A;  1E2V A;  3RLN A;  2WFW A;  2M2L A;  3H94 A;  4JI7 Q;  1IKL A;  3EBE A;  1R9T B;  1YNJ D;  2EYJ A;  1RIP A;  1MSH A;  3KLS A;  4BA1 I;  1MSG A;  4BS9 A;  2NVX B;  4FF2 A;  2LMC B;  4HR7 B;  4NPS A;  3RZO B;  1SSO A;  1TWH B;  5IYC H;  3EIV A;  4LWC A;  1LT6 D;  4JI6 Q;  1O7Y A;  5A2Q L;  2NUC A;  5TSS A;  1M1K C;  3T4A C;  1BBU A;  1Q82 C;  4LMQ D;  4ODG A;  2NVQ B;  5LMU L;  2OWO A;  2K5V A;  4OEM B;  1A3T A;  2E8G A;  1PHJ A;  1ILQ A;  1HZC A;  3M7G A;  4GLV B;  1B7Y B;  4LF4 L;  5IYC G;  4QCL A;  1K8M A;  4M1U B;  4OON A;  2K5H A;  3CP0 A;  3I4L A;  2WB1 B;  4BBS H;  4GS3 A;  5IT9 E;  1PXU A;  4A3L G;  1QZH A;  1M8A A;  5C0X G;  1YEZ A;  3U9S A;  2CCZ A;  3HFZ B;  4ULL A;  1VQL A;  2JA6 B;  2R92 H;  5FLX L;  2DGY A;  4QMG A;  3H09 A;  1G91 A;  4K14 A;  4LF4 Q;  3KF6 B;  3MFG A;  3SK4 A;  4JI3 L;  3SEB A;  4JI5 Q;  1V9P A;  2K5D A;  2KHI A;  4DR1 L;  1AN8 A;  1MIU A;  4L5R C;  4JK1 C;  3NBH A;  1EUJ A;  5DM7 3;  3PUX A;  3CCS A;  4R1J A;  4K2K A;  4KKU A;  1VQG A;  3S1R H;  4KLK A;  2OQK A;  1I3Q H;  2CW0 D;  1B1Z A;  2HDL A;  5C3W A;  1A6X A;  4FDB A;  4R8N A;  1JOR A;  3J81 L;  4GKJ L;  2I5L X;  4JI5 L;  2QA4 A;  1AP0 A;  3NEL A;  1HPC A;  2HUG A;  3A8J E;  4YY3 Q;  2JN4 A;  1YJN A;  4LF6 Q;  2RCF A;  5M3F G;  4F88 A;  2F1M A;  1AZQ A;  1B70 B;  4OIJ A;  3KBG A;  3ERS X;  1XNR Q;  2JP1 A;  4LFB L;  2QIL A;  2JA8 B;  2SDF A;  1STG A;  3I3C A;  5LMN W;  1PH4 A;  1TWG H;  2L11 A;  1X9N A;  4CDD C;  4DNI A;  5FLX c;  2B2W A;  4P73 A;  5C5M A;  4PMW A;  3TP5 A;  2K6A A;  1QUQ B;  4WJW A;  1SYD A;  5DLQ E;  5M3F H;  1EWC A;  1I6H H;  1CM9 A;  1QUQ A;  2K4K A;  1HNW Q;  4LUZ A;  4LF8 L;  1XMO Q;  2N8N A;  2B39 A;  4G7H C;  1TS2 A;  4DV5 Q;  5FO8 B;  1CHQ D;  1XPO A;  1HHV A;  3O13 A;  3I4M H;  2AQ1 B;  1ONL A;  2WB1 E;  5JJL A;  2Y0S E;  3D4W A;  2RQX A;  3K7A B;  3A56 A;  3K57 A;  2QCP X;  3ULP A;  3OWE B;  5EKK A;  1E2Z A;  2F0F A;  2YTY A;  2EJM A;  3DWP A;  1PFM A;  2SEB D;  2XWJ B;  3PUY A;  4A3J B;  3NTI A;  4DR4 Q;  2CQO A;  2RF4 A;  1JCK B;  4RH6 A;  4QJF A;  1ENA A;  2A6H D;  4E6I A;  1EFI D;  3JAM E;  2K05 A;  1S5C D;  4X65 L;  1H9S A;  2FIN B;  3K5M A;  1SJE D;  3S2H H;  3LGJ A;  2O4X A;  2NVY H;  1H9M A;  5H1S E;  2ZJP A;  3S14 H;  1RDP D;  2E2I B;  1Z6H A;  4J1M A;  1K8A C;  4C1N I;  3D6C A;  4DR4 L;  2NZO A;  2E2I H;  1E2W A;  4X64 Q;  1YNJ C;  5IWA L;  4KJO A;  5LMN Q;  2TMP A;  4FO2 A;  4P75 A;  2ALY B;  1BCP D;  4DV4 L;  1L1O B;  4NB3 A;  1NR2 A;  5KIX A;  4A75 A;  4IUU A;  3HOZ G;  4RG1 A;  1SXT A;  3IFT A;  1WJJ A;  1B9M A;  3KF8 A;  5M3M G;  3RZD B;  5ELE A;  2DJG C;  3VR6 A;  5C3X A;  1GVP A;  4PQX A;  1IW7 C;  2UXD L;  4X64 L;  1L2F A;  3KF8 B;  1TY2 A;  1MJC A;  4B3M L;  4IUP A;  3RLF A;  1GXD C;  1FR3 A;  2XN9 C;  5M5Y B;  3K7A H;  4DXF A;  1BOS A;  5IGE A;  3H0G G;  1EQQ A;  1VQ8 A;  4RA8 A;  2EY6 A;  2Q8I B;  1BNZ A;  2A69 C;  1R9T H;  1E1O A;  3KF6 A;  3OYY A;  3T16 A;  4ZUJ A;  3R8B A;  1DOL A;  2I0Q A;  1W6K A;  4JI8 Q;  2K03 A;  4DAP A;  3C3L A;  1F77 A;  1KLG D;  1I50 H;  1PZK D;  3G6E A;  1LTI D;  2NB0 A;  2B2U C;  1M4V A;  4DF7 A;  1B50 A;  1AE3 A;  1IYV A;  4BY1 G;  4CDE C;  3HOU B;  2KEE A;  4C3I G;  3RNU A;  4DR7 Q;  3K59 A;  2O2L D;  3VR4 A;  3A5U A;  5COY A;  1NUC A;  2IHF A;  5I9O A;  4A3E H;  3JC6 6;  4LFC L;  1NR4 A;  1I4X A;  1KDC A;  1HJP A;  4DV1 L;  2CH4 W;  3VDY A;  4JI0 L;  5M5Y H;  1RCV D;  1PH5 A;  2I5M X;  1RD9 D;  3NEN A;  4A3K B;  3BU2 A;  1NCV A;  2WAQ B;  2BOS A;  2A69 D;  3OMG A;  3T51 B;  3P7J A;  3P75 A;  3J80 L;  1EOT A;  4O2D A;  4LFC Q;  1S3O A;  1FVI A;  4YHH L;  3SE0 A;  3T1H L;  1D5X C;  2WIN B;  3R93 A;  4R9W A;  4FF3 A;  1EIF A;  2DY7 A;  3U50 C;  3UI2 A;  1LLR D;  1N34 Q;  1QVF A;  5JVG 3;  4GKJ Q;  1DON A;  1PLF A;  3C2P A;  1G2S A;  1XPR A;  1JMC A;  4JI4 Q;  2A6E D;  3U58 A;  4AYB E;  5EBD A;  4DAV A;  3A8I E;  3S14 B;  3P20 A;  2WKC A;  1SLJ A;  5CV7 A;  3BVM A;  1PZI D;  2RKS A;  5ELB A;  1SEB D;  4LF8 Q;  5CR3 A;  1HUM A;  4GOP A;  4HID A;  1PVO A;  2O5J C;  4KN4 C;  1WOC A;  4XDX A;  3J81 E;  2XIW A;  4JV5 L;  4GOP B;  4TRD A;  1WTV A;  4R4I A;  2Z4H A;  2F0W A;  5ELO A;  3S24 A;  3PO3 B;  1YIJ A;  1CKO A;  4XXE A;  1WTH A;  4JI2 Q;  2EOT A;  2ZM6 Q;  1JJC B;  4JVZ A;  4RCO A;  3E3X A;  1V1O A;  3EQL C;  1IHZ A;  5IGC A;  5GRO A;  4MTN A;  2ZTE A;  1F9S A;  1VQO A;  5IP9 G;  1TVX A;  3GP7 A;  2B2Y A;  2YV5 A;  1RKN A;  4IFD I;  2CKZ B;  4ME3 A;  3WWV A;  3AFP A;  1I6H B;  4QGU A;  5M3F B;  3H15 A;  4DUY L;  1YI2 A;  3PUV A;  2AUK A;  1HTP A;  1OXU A;  1HR0 W;  3TZD A;  5C4H A;  4J15 A;  1IBM L;  1LT4 D;  5IP9 H;  2R3Z A;  2ZXO A;  2F0P A;  3HOW G;  4A4I A;  1B2T A;  1QE6 A;  2BDO A;  2A6E C;  5F2D A;  2JK8 A;  3VR3 A;  1N36 L;  3KLS X;  3ERO A;  4NMZ A;  1B8A A;  3H91 A;  1QWY A;  1N8R C;  5E1F A;  3CQZ H;  2Q8T A;  1L0Y B;  1STB A;  3KFU A;  4P72 A;  3RMH A;  1ASY A;  1U4P A;  2NTS A;  4X3T A;  3CCQ A;  2Y0S B;  4DV4 Q;  3SGI A;  5T1G A;  1WD0 A;  1V43 A;  1YIT A;  1ENC A;  4OO1 I;  5CV9 A;  3UE1 A;  4DR5 L;  4FXD A;  1DOK A;  1PRT F;  4DR6 Q;  2MQH A;  5I2X A;  1VQB A;  4OX9 L;  5BN3 A;  2HCI A;  4NXM Q;  3KYH C;  1FJG Q;  3D31 A;  1HA5 A;  2C35 B;  3OW7 A;  3MFY A;  4PZ8 A;  1Q8I A;  2JA6 H;  4YWM A;  1KNA A;  5KNB A;  1OXX K;  4MN3 A;  2E74 C;  1SE4 A;  5M3M B;  2R7F A;  1G6P A;  3Q8D A;  4IN3 A;  5KGU A;  3J81 c;  4EQP A;  4A3D G;  1F2L A;  5JEA H;  3Q0A A;  3M3Y H;  3LWU A;  3A8K E;  1XYI A;  1UEB A;  4P74 A;  4A3F H;  2A19 A;  3CCV A;  3T56 B;  3GTJ B;  2B2U A;  4IJH A;  1B4O A;  1QZG A;  3M4O B;  1SMY D;  1B53 A;  2KQ3 A;  3CPW A;  2F4V L;  4C3I B;  5J39 A;  4XT3 B;  3OMC A;  2F0S A;  4DR7 L;  4KTA A;  1N33 L;  4FF1 A;  2F3I A;  3ICE A;  5IYD H;  2EYO A;  3GTG B;  4KY6 A;  1HRJ A;  4ILW A;  3H3V H;  3BZK A;  4A3F G;  1IXR A;  1ICF B;  1JB7 A;  5HGT A;  2DUD A;  3NEM A;  1LTR D;  4OXP A;  2ICE C;  4IUQ A;  1VQN A;  1V1Q A;  2A8V A;  4GLX A;  4CDC C;  2L15 A;  1LT5 D;  4JI1 Q;  2SNS A;  2Q2T A;  1ZXT A;  1B44 D;  2AWN A;  4L6T B;  1QCB D;  2VQF L;  4KN7 C;  3GD7 A;  1Y1V G;  1DGS A;  2DJF C;  2VUM G;  1PTO B;  4JPB W;  2L0C A;  1YNX A;  3CKI B;  3M4Y A;  3T1H Q;  4LUO A;  1PH6 A;  4RKL A;  2F0V A;  1TWH H;  3DM1 A;  4HCS A;  4GOP C;  4ZRZ A;  4LF7 L;  2EDG A;  1SMY C;  4A3E B;  3MEH A;  4UDU C;  1TR5 A;  2BE5 D;  4GN3 B;  4WOR A;  3IFD A;  1TWA H;  2AMC B;  1S4Z A;  1SMX A;  1VQ5 A;  1N9W A;  5C3E G;  4RGO S;  4WRD A;  4K8I A;  2A1A A;  2BCO A;  1AW7 A;  1T9H A;  4L5Q A;  2UUC L;  1CKM A;  1VQ7 A;  4B3S Q;  1TU2 B;  3MWY W;  3HS0 C;  1D5M C;  3NWT A;  4I7A A;  1JWM D;  1SN8 A;  5ELC A;  1WVL A;  3DEO A;  3PO2 G;  1CZW A;  2VZA A;  4OO1 H;  1K3B C;  3MVV A;  1EWH A;  1VQJ A;  2H5X A;  4IUR A;  1R4Q B;  1HNW L;  3VYR A;  1L1O C;  1YNN C;  1STE A;  4ZAI A;  5HY6 A;  4DV5 L;  4FF4 A;  1SR3 A;  3FKI B;  4B3S L;  1S5F D;  1WTW A;  2SNM A;  4HJ9 A;  1D2B A;  1JOO A;  3ONA B;  4A3G H;  5D3D A;  2B2Y C;  2PQA A;  1PZJ D;  5C0X J;  2HDM A;  3Q24 A;  1O7L A;  3CU7 A;  4XYO A;  2CHB D;  2IPK D;  2IWH A;  1QVG A;  4OO1 G;  2F0L A;  1YHQ A;  4Y7N B;  1RHP A;  1H9S B;  4X62 Q;  3J81 i;  1Y1W G;  3KJP A;  2VL6 A;  3KUP A;  1S5B D;  2E76 C;  4MZ9 A;  1Q46 A;  3C1F A;  3S2D B;  5J22 A;  2JEB I;  4X3K A;  1X3Q A;  3MXU A;  5C0X I;  1TT2 A;  4NW2 A;  4XQN A;  3TDQ A;  2OTJ A;  4DR1 Q;  4FP5 D;  4KHP L;  3W1G A;  5HGQ A;  1EYD A;  3S1M H;  1Y1W H;  2K28 A;  3I4N G;  4IFD H;  1TWF H;  5CBE E;  2E2J H;  4JOI A;  3S15 B;  3M4O H;  1EIG A;  2HIX A;  2IX3 A;  1OXT A;  1FYC A;  3ER0 A;  3H3V C;  4BWG B;  5JEA J;  4ZUI A;  2NVT B;  1HCZ A;  2K7V A;  3HOV B;  5CV8 A;  4K2L A;  2HHH Q;  3HKZ B;  3NUC A;  1PFB A;  4DV7 Q;  2IX0 A;  4IFD G;  1CFM A;  2QEX A;  4RFB A;  2ASB A;  4ABN A;  1ML0 D;  1A0I A;  5D14 A;  3Q23 A;  2R7Z H;  4B3T L;  2UXD Q;  1HFG A;  1PRT C;  1H95 A;  4HCE A;  3OWF A;  2EVB A;  4QQB X;  3S2H B;  2Y0S G;  1U9R A;  2MO1 A;  1LYL A;  2KCN A;  4A76 A;  3AFQ A;  1A3U A;  4DV7 L;  5D3I B;  5CGK A;  5FLX E;  1F2Y A;  1XNQ L;  3W3A A;  4IUT A;  4PZ6 A;  2E5L L;  1SYG A;  1VQH A;  1TKW B;  2Q2I A;  4LJZ C;  5HUR A;  1VCI A;  4BY1 H;  4C3I H;  1AE2 A;  2WAQ E;  3ULJ A;  4JYA Q;  2SOB A;  4XTC S;  3K0X A;  2R93 G;  2IL8 A;  2E2D C;  3MTS A;  3UE0 A;  4AYB G;  4H13 C;  4A3E G;  4DV2 L;  4DXG A;  3LNN A;  2R93 B;  2QDL A;  3H0G B;  2IX1 A;  2YYZ A;  4A3I H;  4LNQ A;  1D7Q A;  1DD2 A;  4GNX C;  2RSN A;  4LW1 A;  4GLA C;  3HKZ G;  1XNQ Q;  5BR8 L;  2L4N A;  2CWP A;  2DN8 A;  4V0B A;  5K5P A;  2K5W A;  1AH9 A;  4A3I B;  1HH2 P;  3ITP A;  3DLL A;  2R93 H;  1HNX Q;  1O80 A;  3NQI A;  3QB3 A;  1RF2 D;  1I94 L;  1W2B A;  5AFW A;  2I5H A;  4H44 C;  4GN4 B;  2RHQ B;  4KHZ A;  4DK6 C;  1PTO D;  1P8L A;  3EVQ A;  3FKI G;  3KBX A;  3TRE A;  1UWV A;  1WTP A;  1X3E A;  2KEC A;  2DY8 A;  1IZ6 A;  1QNU A;  2VW9 A;  3S17 H;  1D1K A;  5IP7 H;  3HG9 A;  4N9T A;  1UE6 A;  1NAP A;  2PNR C;  3G48 A;  3KLW A;  1VQM A;  1SE2 A;  5IE8 A;  2F0M A;  3R2T A;  4NXN Q;  4LF7 Q;  4DKA C;  2VB2 X;  3IKJ A;  5CYU A;  1NJI C;  3HOZ B;  1KXL A;  5I9P A;  3GTQ H;  1LO5 D;  3F1Z A;  5C0X H;  1O7I A;  1HUN A;  4ZLT F;  1ZYR C;  4OGQ C;  2PPB C;  3TSS A;  5C4X B;  4B3R Q;  2XRS D;  2Z9H A;  4C2M B;  4GN5 A;  1D8L A;  2ZXP A;  2JXM B;  5G3L F;  1ZEQ X;  3F8T A;  3JAM c;  1N32 Q;  4ALP A;  1Y1W B;  5C44 B;  3ULL A;  4CJ0 B;  2B63 H;  4JI8 L;  5J3B A;  4EQN A;  2KA7 A;  2GVB A;  3D6W A;  3G7L A;  4KD3 A;  1LT3 D;  4Q5V A;  1CZG A;  1Q7Y C;  1J5E L;  1JOK A;  1A15 A;  3OSO A;  2A68 C;  1G29 1;  3K5N A;  1VF7 A;  4CJ2 C;  5M9O A;  2UUB Q;  1NE3 A;  5E4W C;  4DN4 M;  1PYS B;  1N32 L;  4K8J A;  3MA2 B;  1EWI A;  1LTL A;  3W1B A;  3K81 C;  2AWO A;  2CH4 A;  1DJR D;  3TP7 A;  1CT1 D;  1J9O A;  3N6R A;  4OIK A;  2F0E A;  4IOC A;  1J5E Q;  2QGQ A;  4DV0 L;  2NVT H;  3K5O A;  4UAI A;  1SDF A;  3D0F A;  2D0P A;  4HSP A;  2F0T A;  5IYB H;  5JPM C;  4KHP Q;  3J80 i;  5FLM G;  1VQP A;  2K32 A;  4GKK L;  5EBC A;  3HOX G;  3HOY B;  2KJX A;  2E75 C;  3G4S A;  3K58 A;  1OO9 B;  3KK7 A;  4K6L A;  4QB4 A;  1E3P A;  1LTT D;  4A3D B;  1SJH D;  1B3Q A;  1U5K A;  4G57 A;  4JI4 L;  1SYE A;  1VQE A;  1PFN A;  1O78 A;  4ZCK A;  3AB9 A;  1QB5 D;  3HOX H;  2R92 G;  3I4N B;  2F0J A;  1VQC A;  5EPL A;  4TQU S;  1EOV A;  2A73 B;  1E1T A;  3GTM B;  1YBY A;  2ZJQ A;  1HQR D;  1CUK A;  4N9P A;  5GAE C;  1KIX A;  1PTO F;  2GA4 B;  4A3D H;  1K8O A;  2VXW A;  4A3G B;  3ND8 A;  3UDX A;  1EZ6 A;  3HRZ C;  2AHO B;  1G51 A;  1H9J A;  3PMF A;  3E9I A;  4GNX B;  3M4P A;  1ICW A;  1MGS A;  3QWN A;  1JE5 A;  3I55 A;  1E24 A;  4HSV A;  1VQK A;  2BH8 A;  3RZD H;  5KND A;  4C3H B;  1V1P A;  2L9H A;  5D65 A;  2NN6 H;  3TS0 A;  4A3K G;  3K5L A;  1XXG A;  3HOU H;  1MHW C;  4MHE A;  1EY0 A;  1V1P B;  3DUZ A;  1I50 B;  5K36 G;  2MGS A;  1NTG A;  2OT2 A;  5BN5 A;  2IHE A;  4IAL A;  2MPM A;  2EYP A;  1I4P A;  2JA7 G;  1K73 C;  3NP8 A;  1SND A;  2JA5 B;  1TWA B;  1D5Z C;  2XNA C;  4RWS C;  1FNV A;  2XGT A;  2I46 A;  5CV4 A;  4DAY A;  3TBI B;  1VMC A;  4DA2 A;  3CCJ A;  1KD1 C;  2B8F A;  1Y1V H;  2EYM A;  2PNH A;  4KI0 A;  2MNA A;  3J7A 5;  4R4Q A;  4CDF C;  1VF5 C;  1X55 A;  3I7F A;  2B63 B;  3J7A F;  4LK1 C;  4HMI A;  3L0O A;  5LL6 X;  1ENF A;  1QG7 A;  4M8A A;  1TS3 A;  2VQF Q;  2ID0 A;  2AUJ D;  1JOQ A;  3QOL A;  1GUT A;  2NZ1 D;  2NZH A;  3EJI A;  4JG2 A;  1WD1 A;  3CCE A;  5IOD A;  4A3B B;  4KK7 A;  3I4M B;  4X3S A;  3GTK B;  1PFS A;  4DR5 Q; 
#chains in the Genus database with same CATH homology
 2EXZ A;  2OXP A;  1PTO C;  4B9X A;  4J8Q A;  5KNC A;  1H9R A;  5C3E B;  2PZW A;  3U9O A;  1SBB B;  5EKI A;  2K33 A;  1SYB A;  4ZK9 B;  2KED A;  3HGB A;  5IGF A;  2RSO A;  2VNU D;  4A3M B;  1SNC A;  2FMM A;  4PMB A;  3M3Y B;  1S5E D;  5JOB A;  2KUM A;  3S1N B;  1DOM A;  2RA4 A;  3VR2 A;  5IGB A;  2FHT A;  2JYO A;  2F0N A;  1KLU D;  4U68 A;  3J7Y W;  1CQF A;  3TME A;  1SAP A;  2TSS A;  3OIP A;  4NP5 A;  4X3U A;  3E0J A;  4OL7 A;  2X6G A;  1I6V C;  1JWU D;  2R92 B;  3NHH A;  2R6G A;  1CA6 A;  3V05 A;  5KEE A;  4C3J G;  3BDL A;  4A93 B;  4RHS A;  4ZQ3 A;  2ZXR A;  3NTK A;  2ICI A;  3L7Z C;  1EU4 A;  3I90 A;  2WV6 D;  2KOL A;  3M85 A;  5A35 A;  1KDA A;  2EY5 A;  2EY1 A;  1RTO A;  4I7Z C;  3L9A X;  1SE3 A;  1SNQ A;  4RGN A;  1II3 A;  1ZYR D;  3NXW A;  4FYD A;  4KKS A;  2L5T A;  3V2T A;  4TSS A;  3A55 A;  1Y1V B;  1WCM B;  3BVG A;  3EA6 A;  5EPK A;  4EGV A;  2O5I C;  1LTS D;  2B2V C;  2RBM A;  1STA A;  1CA5 A;  4IZ8 A;  1DXM A;  4TKO B;  1AFP A;  4CKC A;  1D6E C;  4HTH A;  2PW5 A;  2KHS A;  2DNC A;  1OXS C;  1NSN S;  2EYL A;  3S9W A;  2PCF B;  1F9Q A;  3NSW A;  5NUC A;  2B2T A;  1SYF A;  3FVQ A;  1WTQ A;  5E4X A;  4KY5 A;  1F2Z A;  5DAU A;  5IGD A;  5FKA C;  3T13 A;  4V19 0;  3URY A;  2PO4 A;  2E2H B;  1Y8O B;  5DNF A;  1JE4 A;  2K01 A;  2LKV A;  1WTR A;  2YU9 B;  3NK9 A;  5FOB B;  5A2Q E;  5JEA G;  1RJT A;  2IJ0 A;  1QIL A;  3MXG A;  3OPO A;  3C46 A;  4G4K A;  5M5W B;  1LTA D;  1Q90 A;  1EQV A;  1STY A;  3DXJ C;  3DWQ A;  1TY0 A;  3I8Z A;  2F3V A;  1LTB D;  5DEH A;  3TN2 A;  2XRQ D;  3OOC A;  3BYY B;  5CV5 A;  3GTL B;  3FMC A;  2BE5 C;  1C4Q A;  1ESF A;  4IFD J;  1J8I A;  2EPB A;  1PTO H;  2N55 A;  3FEW X;  2QDB A;  4RHR A;  4RCN A;  3E6Z X;  2PYK A;  4RKB A;  2CVR A;  1U4M A;  3TP6 A;  4CKB A;  2V4D A;  4R8I A;  5EKL A;  2F0G A;  4PV1 C;  4GZY C;  3KLR A;  1BQQ T;  4G7O C;  3VYS A;  2R7Z B;  1FGB D;  3SXH A;  5G3L D;  1B9N A;  3GV3 A;  3QIA A;  1CHP D;  2JE6 I;  5I6W A;  2PW7 A;  5CMD A;  2H1E A;  4KJN A;  1BCP F;  3BG3 A;  3DWA A;  3PUZ A;  4KMU C;  1EIH A;  5EJW A;  1ET6 A;  3S16 B;  1EEI D;  4ID6 A;  1GHJ A;  5IT9 L;  2EJF C;  3QOJ A;  4DK1 A;  2E2J B;  1GHK A;  4EVO A;  3L3O C;  4WFN 3;  5CBA E;  1TS4 A;  1AZP A;  3PV0 A;  4L63 B;  1I4H A;  1XTC D;  2RVL A;  2B8G A;  1F9R A;  2EYF A;  4HMJ A;  1HQM C;  3K0Y A;  5IOC A;  3SHL A;  3M7N A;  4CGY B;  1MBY A;  4FNF A;  3MHB A;  3D4D A;  3NPP A;  4RGM A;  4C3J B;  2NN6 I;  2FJ2 A;  3Q22 A;  5ELF A;  3BDO A;  1FD7 D;  4HED A;  4DNT B;  4C56 C;  3BZD B;  3K6O A;  3WOE A;  3E5S A;  2RDF A;  1MD2 D;  1GJX A;  5EGT A;  4RAU C;  2NN6 G;  4S3S A;  4KKT A;  1TII D;  2AQ2 B;  3G6J B;  2LFN A;  3S17 B;  3WDN A;  4BA2 I;  3VYT A;  5FO9 B;  3HOX B;  3ZYY X;  3SVM A;  1KAB A;  1HA6 A;  1JB3 A;  3DMU A;  5C5L A;  4XQQ A;  4B9W A;  2F0H A;  2A74 C;  4PMC A;  4K5W A;  3RD4 A;  1EY4 A;  2K1B A;  1V8Q A;  2G9H D;  2C5C A;  4B08 A;  1ILP A;  1H9K A;  5C6A A;  2FMC A;  2Q8R E;  4DU9 A;  3BS1 A;  2PZU A;  2Z4I A;  3S1Q B;  4K5X A;  1CI3 M;  2WII B;  2F03 A;  5KRU A;  1Z47 A;  2NWG A;  3CRL C;  3VR5 A;  1U4R A;  3R3O A;  2F3W A;  1DM0 B;  4U67 3;  1IYU A;  3ND9 A;  1JIC A;  4ZKB B;  3Q6S A;  4CKE A;  3ERQ A;  2NYZ D;  1Y69 U;  2JA7 B;  2HQE A;  2ZT9 C;  3AU7 A;  4KD4 A;  1EY6 A;  2CQA A;  2KVM A;  3RUZ A;  2WAC A;  1TWC B;  1JWS D;  2F0I A;  4C3H G;  1EY9 A;  1D1I A;  1BCP B;  1TS5 A;  3HEJ A;  1UUP A;  5CV6 A;  1STN A;  2D5D A;  1EL0 A;  3PUW A;  3QG1 A;  1AEX A;  5EPJ A;  5FO7 B;  1BUV T;  5J1Z A;  2LY7 A;  1QOH A;  3I91 A;  3S1M B;  1STH A;  4ZKC B;  5JVH 3;  3PIP 3;  1KNE A;  3IL8 A;  2Z1C A;  3BDC A;  1LV9 A;  3NTH A;  2X6L A;  1O7Z A;  1MI2 A;  2BA0 A;  1EY7 A;  1YNN D;  1UNS A;  5E3F A;  3MZ5 A;  4IQZ A;  2F0Q A;  1A2U A;  1TQO A;  3NWS A;  3PIO 3;  4PNY A;  2L55 A;  3W2D A;  5CC4 A;  1W6J A;  3D8G A;  2HCC A;  4LAA A;  4DNR B;  5KYL A;  2J7Z A;  1A3V A;  3WOF A;  3OIQ A;  2L12 A;  1E0B A;  5IGG A;  3CQZ B;  2B2V A;  3J80 E;  2F0O A;  2C9O A;  3GTP B;  3V96 A;  3I72 A;  3P1H A;  4QIW B;  5M5X B;  1SFO B;  3SDZ A;  4QUF A;  1WTO A;  4AYB B;  3PO2 B;  4F7X A;  2R61 A;  3GTO B;  1PRT B;  3FRP B;  1BR9 A;  4F87 A;  4DGZ A;  3I73 A;  5KYI A;  1PDQ A;  3D3R A;  2IW3 A;  1Y8P B;  1ESR A;  2EY2 A;  3T53 B;  1S5D D;  2EYH A;  3FPU B;  1DCZ A;  1F9P A;  4C1N K;  2F0K A;  3IAY A;  3GO5 A;  1DYQ A;  2B2T C;  4MIU A;  4A3F B;  3X3N A;  4F8M A;  1U4L A;  2AQ3 B;  1FNW A;  5FK9 C;  1PYW D;  1UAP A;  2F0U A;  2D62 A;  2BA1 A;  1ROD A;  5JPN C;  3SK8 A;  2NBF A;  2EZV A;  3AMU A;  4FXG C;  3GQB A;  4HAE A;  4OHJ A;  1WTX A;  2B2W C;  3CHB D;  1EU3 A;  3LWE A;  1L0X B;  1F2M A;  3D4R A;  2OF1 A;  4O1N A;  2PMZ B;  2NTT A;  2LS0 1;  3X3M A;  1PMR A;  1EQT A;  1LAB A;  2F4I A;  2KCC A;  1QJO A;  2I07 B;  1EY8 A;  4DK0 A;  3J7A V;  2A5H A;  4Z9C B;  1A2T A;  1C48 A;  3MXN A;  1Y8N B;  5LHY 1;  1BDO A;  3NQT A;  2D9U A;  4CBV A;  2RDH A;  2OEO A;  1KDB A;  4G7Z C;  1PRT D;  1KAA A;  1VDZ A;  4YIJ A;  1HFN A;  4HN7 A;  2A6H C;  1BXT A;  2L1B A;  2N88 A;  2X69 A;  3TZU A;  3FDT A;  3BVZ A;  4NDX A;  1T5E A;  1IW7 D;  5I4D A;  4QUC A;  1KTK A;  2K5Q A;  2Z8L A;  2JSO A;  4IUN A;  5COR A;  1HXY D;  4BBR B;  1LAC A;  4K6D A;  2A68 D;  3QO2 A;  4I65 A;  1BCP C;  1EYC A;  4L8J A;  5DM6 3;  4XYQ A;  2QKI C;  3VYU A;  1Q3L A;  1X3P A;  2VB3 X;  2XSC A;  3HOW B;  2D2C C;  1Q1E A;  5ELD A;  4XQJ A;  3DHQ A;  3DEP A;  1C8C A;  1EZ8 A;  5K36 H;  5I2Y A;  5I6Y A;  4CJ1 B;  2NVY B;  3EFX D;  1G6Z A;  2EJG C;  5JAV A;  1I4R A;  3MAQ A;  1EY5 A;  3N52 A;  3A7L A;  1I4G A;  4BY7 B;  3C1E A;  1GOZ A;  2F0D A;  4P2C B;  4Q0F A;  4H0L C;  4DFA A;  1HTL D;  3CRK C;  1IL8 A;  1XX8 A;  1UEA B;  4ME5 A;  3H6M A;  4K5V A;  3GV6 A;  1SNM A;  2IT1 A;  5IIF A;  2XWB B;  1RTN A;  3MC0 B;  3A7A B;  1JR0 D;  1G8Z D;  2MHV A;  4KHV A;  1BO0 A;  1TWG B;  1DZ1 A;  2WKD A;  5EQ0 A;  1ET9 A;  3R2I A;  1CQV A;  2BDN A;  2M9V A;  2K04 A;  2RDG A;  4H7B A;  2VUM B;  1R4P B;  1Q1B A;  3NBI A;  2G9D A;  4O42 A;  1I3Q B;  4XIG S;  1CTM A;  4KV6 A;  1CK1 A;  3HZX A;  4FXK C;  1Z7T A;  4IUV A;  4CHT B;  5C4J B;  3TP8 A;  3BYT B;  1GUS A;  1X32 A;  5T1I A;  1TWF B;  1GUW A;  3I70 A;  4RGT A;  2QEJ C;  1LTG D;  4NKL A;  4BBS B;  3MXP A;  1SNP A;  3LX0 A;  4KY7 A;  2J4X A;  2DNE A;  1EEF D;  3OHX C;  3VA7 A;  3A54 A;  1BBX C;  3GTQ B;  1IKM A;  1I4Q A;  3HP3 A;  2MUY A;  5LL6 S;  4ZYS A;  2MJ8 A;  3SK5 A;  4EQO A;  3FPP A;  4JBW A;  4XT1 B;  1VMP A;  2PQE A;  1JC7 A;  1JQY D;  1EYA A;  2XVS A;  1QNK A;  1K83 B;  4FVM A;  1XWE A;  1GUG A;  5JJZ A;  3NE5 B;  2EE1 A;  1GUN A;  3F2U A;  1BF4 A;  1G2T A;  1FNU A;  2ENB A;  5BN4 A;  2M00 A;  2PZT A;  3QJY A;  4J6H A;  3VA5 A;  1Q12 A;  3JAM L;  1GUO A;  2WP8 J;  2H4O A;  2J0T D;  2QF7 A;  1B3A A;  1SNO A;  5ISR A;  1SYC A;  1ZKO A;  2FFK B;  1T5X D;  3S1R B;  2JEA I;  2MP1 A;  4QF4 A;  4BY1 B;  3SR1 A;  2CW0 C;  3SK6 A;  5C4Z A;  1OXV A;  1E2V A;  2M2L A;  3H94 A;  1IKL A;  1R9T B;  1YNJ D;  2EYJ A;  3KLS A;  1MSH A;  4BA1 I;  1MSG A;  4BS9 A;  2NVX B;  4FF2 A;  2LMC B;  4HR7 B;  3RZO B;  1SSO A;  1TWH B;  1LT6 D;  1O7Y A;  5A2Q L;  2NUC A;  5TSS A;  3T4A C;  4LMQ D;  4ODG A;  2NVQ B;  1A3T A;  1ILQ A;  3M7G A;  4QCL A;  1K8M A;  4M1U B;  3I4L A;  2WB1 B;  5IT9 E;  1PXU A;  1M8A A;  5C0X G;  3U9S A;  4ULL A;  2JA6 B;  5FLX L;  4QMG A;  3H09 A;  1G91 A;  4K14 A;  3MFG A;  3SK4 A;  3SEB A;  2K5D A;  1AN8 A;  4JK1 C;  3NBH A;  5DM7 3;  3PUX A;  4K2K A;  4KKU A;  2CW0 D;  1B1Z A;  2HDL A;  5C3W A;  1A6X A;  4R8N A;  1JOR A;  3J81 L;  1AP0 A;  1HPC A;  2HUG A;  3A8J E;  4F88 A;  2F1M A;  1AZQ A;  4OIJ A;  3KBG A;  2JP1 A;  2QIL A;  2JA8 B;  2SDF A;  1STG A;  3I3C A;  2L11 A;  2B2W A;  5C5M A;  4PMW A;  3TP5 A;  2K6A A;  4WJW A;  1SYD A;  1EWC A;  1CM9 A;  2B39 A;  4G7H C;  1TS2 A;  5FO8 B;  1CHQ D;  1HHV A;  3O13 A;  2AQ1 B;  1ONL A;  3D4W A;  3K7A B;  2RQX A;  3K57 A;  3A56 A;  2QCP X;  3OWE B;  5EKK A;  1E2Z A;  2F0F A;  2EJM A;  3DWP A;  1PFM A;  2SEB D;  2XWJ B;  3PUY A;  4A3J B;  3NTI A;  1JCK B;  4RH6 A;  1ENA A;  2A6H D;  4E6I A;  1EFI D;  3JAM E;  2K05 A;  1S5C D;  1H9S A;  2FIN B;  3K5M A;  1SJE D;  2O4X A;  1H9M A;  1RDP D;  2E2I B;  1Z6H A;  4J1M A;  4C1N I;  3D6C A;  1E2W A;  1YNJ C;  4KJO A;  2TMP A;  4FO2 A;  1BCP D;  1NR2 A;  5KIX A;  4IUU A;  1SXT A;  3IFT A;  1B9M A;  3KF8 A;  3RZD B;  5ELE A;  3VR6 A;  5C3X A;  4PQX A;  1IW7 C;  1TY2 A;  4IUP A;  3RLF A;  1GXD C;  1FR3 A;  2XN9 C;  5M5Y B;  4DXF A;  1BOS A;  5IGE A;  4RA8 A;  2EY6 A;  2Q8I B;  1BNZ A;  2A69 C;  3T16 A;  4ZUJ A;  3R8B A;  1DOL A;  1W6K A;  2K03 A;  4DAP A;  3C3L A;  1F77 A;  1KLG D;  1PZK D;  1LTI D;  2NB0 A;  2B2U C;  1M4V A;  4DF7 A;  1B50 A;  1IYV A;  3HOU B;  2KEE A;  4C3I G;  3K59 A;  2O2L D;  3VR4 A;  5COY A;  1NUC A;  5I9O A;  1NR4 A;  1I4X A;  1KDC A;  1RCV D;  1RD9 D;  4A3K B;  1NCV A;  2WAQ B;  2BOS A;  2A69 D;  3OMG A;  3T51 B;  3P7J A;  3P75 A;  3J80 L;  1EOT A;  3SE0 A;  1D5X C;  2WIN B;  3R93 A;  4R9W A;  4FF3 A;  2DY7 A;  3UI2 A;  1LLR D;  5JVG 3;  1DON A;  1PLF A;  3C2P A;  1G2S A;  2A6E D;  5EBD A;  4DAV A;  3A8I E;  3S14 B;  3P20 A;  2WKC A;  5CV7 A;  3BVM A;  1PZI D;  2RKS A;  5ELB A;  1SEB D;  5CR3 A;  1HUM A;  2O5J C;  4KN4 C;  4XDX A;  3J81 E;  2XIW A;  4TRD A;  1WTV A;  2Z4H A;  2F0W A;  3PO3 B;  4XXE A;  2EOT A;  4RCO A;  1V1O A;  3EQL C;  1IHZ A;  5IGC A;  1F9S A;  1TVX A;  3GP7 A;  2B2Y A;  1RKN A;  4IFD I;  1I6H B;  5M3F B;  3PUV A;  2AUK A;  1HTP A;  1OXU A;  3TZD A;  5C4H A;  1LT4 D;  2R3Z A;  2ZXO A;  2F0P A;  1B2T A;  1QE6 A;  2BDO A;  2A6E C;  5F2D A;  3VR3 A;  3KLS X;  3ERO A;  4NMZ A;  3H91 A;  1QWY A;  5E1F A;  2Q8T A;  1L0Y B;  1STB A;  3RMH A;  1U4P A;  2NTS A;  4X3T A;  2Y0S B;  5T1G A;  1WD0 A;  1V43 A;  1ENC A;  4OO1 I;  5CV9 A;  4FXD A;  1DOK A;  1PRT F;  5I2X A;  5BN3 A;  2HCI A;  3D31 A;  1HA5 A;  3OW7 A;  3MFY A;  1Q8I A;  1KNA A;  5KNB A;  1OXX K;  4MN3 A;  2E74 C;  1SE4 A;  5M3M B;  4IN3 A;  5KGU A;  4EQP A;  1F2L A;  5JEA H;  3Q0A A;  3LWU A;  3A8K E;  1XYI A;  3T56 B;  3GTJ B;  2B2U A;  1B4O A;  3M4O B;  1SMY D;  1B53 A;  2KQ3 A;  4C3I B;  5J39 A;  4XT3 B;  3OMC A;  2F0S A;  4KTA A;  4FF1 A;  2EYO A;  3GTG B;  4KY6 A;  1HRJ A;  4ILW A;  5HGT A;  1LTR D;  2ICE C;  4IUQ A;  1LT5 D;  2SNS A;  1ZXT A;  1B44 D;  2AWN A;  4L6T B;  1QCB D;  4KN7 C;  3GD7 A;  1PTO B;  2L0C A;  3CKI B;  3M4Y A;  4RKL A;  2F0V A;  3DM1 A;  4HCS A;  4ZRZ A;  2EDG A;  1SMY C;  4A3E B;  3MEH A;  4UDU C;  1TR5 A;  2BE5 D;  4WOR A;  3IFD A;  1S4Z A;  4RGO S;  4WRD A;  4K8I A;  2BCO A;  1AW7 A;  1TU2 B;  3MWY W;  3HS0 C;  1D5M C;  3NWT A;  1JWM D;  5ELC A;  1WVL A;  3DEO A;  1CZW A;  4OO1 H;  3MVV A;  1EWH A;  4IUR A;  1R4Q B;  3VYR A;  1YNN C;  1STE A;  4ZAI A;  4FF4 A;  3FKI B;  1S5F D;  1WTW A;  2SNM A;  1D2B A;  1JOO A;  3ONA B;  5D3D A;  2B2Y C;  5C0X J;  1PZJ D;  2HDM A;  3Q24 A;  1O7L A;  3CU7 A;  4XYO A;  2CHB D;  2IPK D;  2IWH A;  4OO1 G;  2F0L A;  4Y7N B;  1RHP A;  1H9S B;  3KUP A;  1S5B D;  2E76 C;  3C1F A;  3S2D B;  5J22 A;  2JEB I;  4X3K A;  1X3Q A;  3MXU A;  5C0X I;  1TT2 A;  4NW2 A;  4XQN A;  3TDQ A;  4FP5 D;  1EYD A;  2K28 A;  4IFD H;  5CBE E;  3S15 B;  1EIG A;  2IX3 A;  1OXT A;  1FYC A;  3H3V C;  4BWG B;  5JEA J;  4ZUI A;  2NVT B;  3HOV B;  1HCZ A;  2K7V A;  5CV8 A;  4K2L A;  3HKZ B;  3NUC A;  1PFB A;  2IX0 A;  4IFD G;  1CFM A;  4RFB A;  4ABN A;  1ML0 D;  5D14 A;  3Q23 A;  1HFG A;  1PRT C;  4HCE A;  3OWF A;  2EVB A;  3S2H B;  1U9R A;  2KCN A;  1A3U A;  5D3I B;  5CGK A;  5FLX E;  1F2Y A;  3W3A A;  4IUT A;  1SYG A;  1TKW B;  4LJZ C;  5HUR A;  1VCI A;  2SOB A;  4XTC S;  2IL8 A;  2E2D C;  3MTS A;  4H13 C;  4DXG A;  3LNN A;  2R93 B;  3H0G B;  2IX1 A;  2YYZ A;  1DD2 A;  2RSN A;  2L4N A;  2DN8 A;  4V0B A;  5K5P A;  2K5W A;  4A3I B;  3ITP A;  1O80 A;  3NQI A;  3QB3 A;  1RF2 D;  5AFW A;  4H44 C;  4KHZ A;  1PTO D;  3EVQ A;  3KBX A;  1WTP A;  2KEC A;  2DY8 A;  1QNU A;  1D1K A;  3HG9 A;  4N9T A;  1NAP A;  2PNR C;  1SE2 A;  2F0M A;  3R2T A;  2VB2 X;  3IKJ A;  5CYU A;  3HOZ B;  5I9P A;  1LO5 D;  5C0X H;  1HUN A;  4ZLT F;  1ZYR C;  4OGQ C;  2PPB C;  3TSS A;  5C4X B;  2XRS D;  4C2M B;  2ZXP A;  2JXM B;  5G3L F;  1ZEQ X;  1Y1W B;  5C44 B;  4CJ0 B;  4EQN A;  2KA7 A;  3D6W A;  3G7L A;  4KD3 A;  1LT3 D;  4Q5V A;  1CZG A;  1JOK A;  1A15 A;  3OSO A;  2A68 C;  1G29 1;  3K5N A;  1VF7 A;  4CJ2 C;  5M9O A;  5E4W C;  4DN4 M;  4K8J A;  3MA2 B;  2AWO A;  1DJR D;  3TP7 A;  1CT1 D;  1J9O A;  3N6R A;  4OIK A;  2F0E A;  3K5O A;  4UAI A;  1SDF A;  4HSP A;  2F0T A;  5JPM C;  2K32 A;  5EBC A;  3HOY B;  2KJX A;  2E75 C;  3K58 A;  1OO9 B;  3KK7 A;  4K6L A;  4QB4 A;  1LTT D;  4A3D B;  1SJH D;  4G57 A;  1SYE A;  1PFN A;  1O78 A;  3AB9 A;  1QB5 D;  3I4N B;  2F0J A;  5EPL A;  4TQU S;  3GTM B;  2A73 B;  1HQR D;  4N9P A;  1PTO F;  2GA4 B;  1K8O A;  2VXW A;  4A3G B;  3ND8 A;  1EZ6 A;  3HRZ C;  1H9J A;  3PMF A;  1ICW A;  1MGS A;  3QWN A;  4HSV A;  5KND A;  4C3H B;  1V1P A;  2L9H A;  5D65 A;  2NN6 H;  3K5L A;  1XXG A;  4MHE A;  1EY0 A;  1V1P B;  3DUZ A;  1I50 B;  5K36 G;  2MGS A;  2OT2 A;  5BN5 A;  4IAL A;  2MPM A;  2EYP A;  1I4P A;  3NP8 A;  1SND A;  2JA5 B;  1TWA B;  1D5Z C;  2XNA C;  4RWS C;  1FNV A;  2I46 A;  5CV4 A;  4DAY A;  3TBI B;  1VMC A;  4DA2 A;  2B8F A;  2EYM A;  4KI0 A;  1VF5 C;  2B63 B;  3J7A F;  4LK1 C;  4HMI A;  5LL6 X;  1ENF A;  1QG7 A;  4M8A A;  1TS3 A;  2ID0 A;  2AUJ D;  1JOQ A;  3QOL A;  1GUT A;  2NZ1 D;  3EJI A;  1WD1 A;  5IOD A;  4A3B B;  4KK7 A;  3I4M B;  4X3S A;  3GTK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...