1GHKA

Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from azotobacter vineland ii, nmr, 25 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
79
structure length
79
Chain Sequence
AIDIKAPTFPESIADGTVATWHKKPGEAVKRDELIVDIETDKVVMEVLAEADGVIAEIVKNEGDTVLSGELLGKLTEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E2, THE DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE COMPONENT OF 2-
publication title Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from Azotobacter vinelandii.
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Acyltransferase
total genus 6
structure length 79
sequence length 79
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 1996-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ghkA00
2EJFC 2BA1A 2B8FA 3PUZA 3EQLC 3OOCA 2A69C 4KN4C 4LK1C 4BA1I 2F1MA 1V43A 1CI3M 4DNRB 3QG1A 2DNCA 3AB9A 4RCNA 5JEAH 5K36G 3PUYA 3OPOA 3T53B 4H0LC 1Z7TA 4TKOB 2Q8IB 4IFDG 1OXSC 1IW7C 2A6HC 1QJOA 2DNEA 1HCZA 2JEBI 2NN6H 3M4YA 5K36H 3LNNA 2E74C 1B9NA 2KA7A 2AUKA 3PUVA 1E2VA 5C0XG 3D31A 2A69D 3GQBA 3CRLC 1GHJA 3VR6A 5A35A 5BN3A 1HPCA 4JK1C 2B8GA 3I73A 1IYUA 4TQUS 2A68C 2ZT9C 3T51B 1OXXK 1SMYC 1Y8OB 1YNNC 2BE5C 3MFYA 4HR7B 3VA7A 4G7HC 2PCFB 3DXJC 5JEAG 2LMCB 1E2ZA 1G291 1IW7D 2PPBC 2A6HD 1GHKA 1CTMA 1Y69U 3HGBA 3A7AB 1VF5C 3PUXA 3A8IE 3QJYA 2K32A 4DNTB 2BDOA 2NN6G 5KNBA 2EJMA 1VDZA 4IQZA 3KLRA 1DD2A 2A68D 1IYVA 2BE5D 1B9MA 4OO1G 3LWUA 1OXUA 4G7OC 3SDZA 1V8QA 2EVBA 1TU2B 3WDNA 4JBWA 4G7ZC 2R6GA 3PUWA 1ZKOA 1GUOA 1GJXA 1K8MA 3W3AA 4OO1H 3IFTA 1DXMA 2JXMB 4OGQC 4LJZC 1GUNA 4DK1A 3ND8A 3OW7A 3TZUA 3L7ZC 1GUSA 1H9JA 3PV0A 4PV1C 1Q12A 1E2WA 1FR3A 1VF7A 3RLFA 1T5EA 3MXUA 2QF7A 4KKTA 2D5DA 2D2CC 3A7LA 3H94A 3VR4A 3VR2A 4KI0A 2L5TA 1H9SA 2YYZA 3ND9A 3A8KE 4I7ZC 2A6EC 3N6RA 3M7NA 4GZYC 3GD7A 3QIAA 1GUGA 2K33A 3A8JE 3FPPA 1VCIA 1OXTA 1Y8NB 1Z6HA 2JEAI 1PMRA 3D4RA 1H9MA 2O5IC 1Q1BA 2JE6I 5KNDA 1GUTA 2NN6I 3FMCA 3I4LA 4H44C 4KKSA 1HQMC 2IT1A 3VR5A 1Q1EA 2BA0A 2E75C 4KHZA 1O7LA 2PNRC 2V4DA 1LACA 4XTCS 3P20A 2A6ED 2KCCA 1Q90A 2CW0C 1ONLA 2AUJD 3SE0A 3M85A 1TKWB 1HTPA 5BN5A 5BN4A 1DCZA 3IKJA 1YNJC 4KMUC 1A6XA 1H9SB 2D62A 4L8JA 3VR3A 1EWHA 2EDGA 1ZYRC 1K8OA 1BDOA 5KNCA 1H9KA 4H13C 2DN8A 1O78A 2EJGC 3I72A 2E76C 1FYCA 3BG3A 4DK0A 3NE5B 4IFDH 1I6VC 1Y8PB 3BDOA 4XIGS 1LABA 3CRKC 4KN7C 3U9SA 4BA2I 4KKUA 2O5JC 1H9RA 1CFMA 1OXVA 2AWOA 5C0XH 2K7VA 3T56B
chains in the Genus database with same CATH superfamily
2F0QA 4JI6Q 1D1KA 1KLGD 2UXDQ 1E3PA 3HOVH 1VQ9A 4IJLA 5IIFA 4GLXA 2LSSA 2NVQB 1EZ8A 5JAVA 1XNRL 1ASYA 4X62L 2EYJA 5LL6X 1PH4A 1VMPA 1ENCA 3TZDA 4NXNQ 2KA7A 3VYSA 1SBBB 3E0EA 1BKBA 4POGA 1QVFA 1JJGA 1CQVA 3A5UA 1X3PA 1IBKQ 2ICIA 1UAPA 2JA6H 1F9SA 1RKNA 2NTTA 3GTQH 4G7HC 3CPWA 5I9OA 3I91A 2L4NA 1FL0A 1ILPA 1IW7D 3RMHA 1HZ9A 5COYA 1NTGA 2ZTDA 1U9RA 3A8IE 3L0OA 4B9WA 1BNZA 4B3SQ 4BY1H 2N49A 1Y14B 1CM9A 4LF7L 1QVGA 4DAMA 1B44D 3LGJA 1LT3D 5FLXc 1QNKA 3K0YA 2DUDA 4PNYA 5GAEC 2BE5D 2B63B 3NHHA 3CQZB 3VYTA 3F2CA 1EYCA 1K8MA 4FF2A 4FXGC 4LJZC 3DLLA 4HJAA 1HR0Q 3KBGA 1G2SA 2K4KA 1LUZA 4WFN3 2EY1A 2KUMA 3GTPB 4GN4B 4FF3A 4BWGB 2JA9A 4QUCA 4HCEA 2HT1A 2YYZA 2JA7H 1C9OA 3CKIB 4JI1Q 4GZYC 3A74A 5ELOA 1GUGA 2Z8LA 4TVAB 5BR8Q 4RKLA 2XWJB 1CT1D 1HFGA 3OIQA 2V1CC 4C1NI 2E5LQ 5AFWA 1N34L 3SK4A 2IT1A 5C44H 4JC0A 2RHSB 5I6YA 2Z4IA 3PF4A 4OONA 1EIFA 3TQYA 3GTLB 1KQSA 3S15B 1WVLA 1SEBD 1H9SB 3CCQA 1ET6A 2N88A 1XNRQ 3ULJA 2VY3A 4X62Q 5L37A 2HHHL 1EY5A 3BDOA 1WTOA 4X6AH 1EEID 2XRQD 1M90C 2EZVA 2F0UA 2K7VA 1W3SA 1GKHA 4RG1A 1D1IA 2FXQA 1PFBA 5LL6S 3CCJA 2FINB 3QWNA 4IURA 3D8GA 5EQ0A 3S1MB 3HKZG 4DU9A 1E22A 1GD7A 2X69A 1EFWA 3S16H 3RZDH 3JAML 2CFMA 2A6HC 1JB3A 5LMUL 4LF7Q 1XPRA 4UP8A 3HKZB 5DLQE 5C4XB 1TWFH 1LT5D 1UWVA 1GUWA 2CWPA 2A8VA 2N8NA 5IGBA 4QUFA 4DXGA 3CD6A 1OXXK 3NP8A 4DV0L 4BY7G 3PO3G 2G9DA 5G3LF 5DM73 2RA4A 3PSIA 2GA4B 1GVPA 2L1BA 1STHA 3HGBA 2YU9H 2XGTA 5M3FG 1NCVA 3SK8A 2K32A 4BY7B 1CZWA 2NN6G 2KCNA 3PO3B 1C0AA 1P8LA 1VDZA 4IALA 5M3FB 1YNND 5CBAE 1V8QA 3NSWA 4JBWA 3A55A 4J15A 3CCMA 1MD2D 1GJXA 2F0KA 2QEXA 4JBKA 4DK1A 4DK6C 2WB1B 1N34Q 3OW7A 1I94L 3HS0C 1XJVA 2JJQA 5IT9L 4MIUA 2Q8RE 2ZXPA 3R3OA 1SAPA 1TIID 3JAMc 2UUAL 4A3CH 2L5TA 1STAA 2FJ2A 2M00A 2H5XA 3MVVA 1CA6A 4FDBA 3J7YW 3HOWH 4HTHA 3V96A 1L0WA 1JJCB 2HHHQ 1KAWA 3TDQA 2F0GA 2J7ZA 3IL8A 4LFAL 3P20A 1R9TB 1DOLA 1FVIA 4MNOA 2NVYB 4HJ5A 4KMUC 4XYQA 1RJTA 2Y0SE 1K8OA 1H9KA 1RL2A 4H13C 3J81i 4FXDA 4KD3A 4PZ8A 3A0JA 3K5LA 1I50B 3CRKC 5LMUQ 1D7QA 4AYBE 4AH6A 1G8ZD 2QCPX 3BDLA 1NR2A 5IT9c 1DJRD 1YNJD 4LW1A 1S4ZA 1PHJA 4Y7NH 2KCMA 1ZYRD 4NKLA 4FYDA 4JI7L 1CI3M 5K5PA 4QY7A 4HSPA 3OWFA 3STBC 4YWLA 3PUYA 1FGUA 2L0CA 2ZM6Q 3S1RH 1O7YA 1U4MA 5NUCA 4DR5L 3FDTA 4CGYB 3ER0A 3BJUA 4A3GG 3KYHC 3NTIA 1BCPC 3RN5A 4ALPA 4LUZA 4DR6Q 4DGZA 1RODA 2M9VA 3I8ZA 2EXDA 4GN5A 1CTMA 1I94Q 4A3GB 1Y1VB 4FVMA 1LTAD 3T1YL 2UUAQ 2A68D 1EEFD 1ENFA 3GTKH 3FP9A 1TWAB 2WACA 1EYGA 1QG7A 5C0XJ 4A3JG 1FGBD 4C3HH 1SYDA 1S5CD 5GAGC 4R4QA 3ND8A 5JJZA 5JPNC 1J9OA 3NUCA 1K3BC 4QB4A 4LFAQ 2R93H 3RLFA 3BS1A 1A8VA 5E1FA 2F0NA 2JYOA 1U5KA 4CKEA 1K83H 2D2CC 1KRSA 3OHXC 1A2UA 3DWPA 5M5WH 1L1OB 1IBML 4JI0L 1YEZA 3FPPA 1LO5D 3Q22A 3I4NH 1EOTA 2PZWA 1L2FA 2ENBA 4M8AA 1N8RC 3GTJB 3FMCA 2K75A 3NEMA 3W1BA 3H3VH 4DR7L 2PNRC 4XTCS 3FHWA 3S2HB 2NVQH 2EE1A 2F4IA 2XIWA 3HRZC 4JI7Q 4R4IA 3I7FA 5C4JB 1XXGA 1BDOA 1DYQA 1X3FA 2ALYB 2HQLA 3F2BA 5GAHC 1AEXA 5M3MH 4JOIA 4DR5Q 4F7XA 1WTQA 1K73C 4QGUA 2MUYA 1SNOA 3FRPB 2RSOA 4GOPC 2NB0A 4RCNA 1PZID 4HMJA 1Q8IA 1IW7C 1I4XA 3CCEA 1EY9A 1YNXA 1PTOB 4BXXH 4OWTB 4R9WA 3CQZH 4F88A 3M4QA 1GO3E 4APVA 3I73A 1I6HH 5I6WA 3G6JB 4R8NA 2Z1CA 2BE5C 4UHVA 1L0XB 2UUBQ 1Q86C 2PPBC 3GTPH 4LWCA 3H6MA 4DR1L 1JMCA 1YZ6A 2LY7A 2AHOB 3HOXG 3ITPA 4WJWA 1KDAA 1B9MA 1IBMQ 1K3RA 4K14A 3HOXB 1N33L 3RZOB 3F1ZA 3CHBD 1PRTF 4K6LA 1HA5A 4PQXA 4X66L 2Z6BA 3W3AA 5T1GA 3CF5A 4HJ7A 4PV1C 5IGGA 4DR7Q 5JEAJ 1AP0A 2NZHA 3KBXA 1B3AA 1TT2A 3CAMA 2XRSD 1SN8A 5TSSA 3FPUB 2SNMA 1JCKB 5IP9G 1HRJA 4I7ZC 1A3TA 1JE4A 3PO2G 5M5XB 4B3TL 1VQ6A 4QJFA 4HSVA 1B3QA 4HMIA 2F4VL 1ICFB 2NN6I 1V1PA 2WB1E 2JA5G 3PO2B 1CHPD 1VQDA 1HZCA 4P74A 4UAIA 1RHPA 4ZKBB 2F52A 4HIKA 3OSOA 2JA5B 1QILA 3KF8B 2VL6A 4KHPL 5BN5A 1DCZA 5C3XA 3K6OA 4IUQA 4S3SA 2XNAC 5CV9A 2C35B 2DN8A 1FNUA 3TSSA 4YHHQ 1Y8PB 3DWAA 4KN7C 1HTLD 4ZK9B 4A3MG 5G3LD 1S40A 4PG3A 3ZYYX 4A3MB 3PUZA 5CV5A 1CA5A 3PO3H 3U4ZA 1EU4A 4DR1Q 1TS3A 2NVTB 4MN3A 4DV4Q 5CYUA 2NN6H 1BBXC 2JN4A 1E24A 1LLRD 4X65Q 1B9NA 4DAVA 3CMAA 2WP8J 2X6LA 3DM3A 1W6JA 3HKSA 4ZKCB 3D31A 1TVXA 5ELDA 2OEOA 2E2JH 1N33Q 2MNAA 4TSSA 1K28A 1YNNC 3UI2A 1M1KC 3DXJC 4IOCA 2LXKA 1N36L 1EYDA 4HJ8A 2VNUD 1VF5C 4RCOA 3E9IA 2K50A 1S5FD 2PNHA 3TMEA 5LMNL 3GTOH 3NWTA 1LTTD 3WDNA 1Q7YC 3EIVA 1GUOA 1MIUA 4B3TQ 1CHQD 4OO1H 1UNSA 2F4VQ 2A19A 1PRTB 3PV0A 2F0DA 2NVYH 3H3VC 1T5EA 1YI2A 1VQMA 3HOZG 3VR2A 2EXZA 4DF7A 4KHPQ 3TEHB 4CJ0B 3I4MG 3Q24A 1TWCB 2A5HA 2CKZB 2EYFA 3SK6A 3HOZB 4FF1A 5IOCA 3J80E 1NR4A 1BO0A 2C9OA 1KD1C 1DONA 2GVAA 5C3EG 2RDGA 1P16A 1JWMD 1Q1EA 5DAUA 5JVH3 3HOUG 2F0JA 1SLJA 2C5CA 1X54A 2A6ED 1SJHD 1UE5A 3OIPA 4YCWA 5C3EB 4IUTA 1UE1A 1K8AC 1QB5D 2K5NA 3BZCA 2Y0SG 2F0MA 1PTOD 3HOUB 1YNJC 1A6XA 3I2ZA 4N9TA 3D4WA 1ZYRC 2JQOA 3H09A 4L63B 1ASZA 4HEDA 1O78A 4AYBG 5C4HA 1FNWA 2Y0SB 2E76C 3I4OA 4DK0A 3Q0AA 1CK1A 1SNQA 3CMEA 4JI4Q 4YCUA 4K8IA 1EY0A 2MO0A 3M4PA 4GNXB 3S1QB 2CW0D 4LFCL 3K5OA 3K7AH 1VQNA 4AYBB 5JJKA 3TRZA 1JICA 1KHIA 3T1HL 2CWAA 3SVMA 4A3GH 1CKOA 2VQEL 5KRUA 1PH1A 1IXRA 1N36Q 4ZLTF 4YWMA 2E8GA 2K01A 1T5XD 1HJPA 4BBRG 1TWAH 3AFQA 5J3BA 1XMOL 5K36H 1Q46A 1SYGA 4V0BA 1EFID 2ZJPA 5LMNQ 5JJLA 4P75A 1H95A 3M3YB 2A68C 4A3JH 3MFYA 2RHQB 4V190 1PZKD 2FMCA 3GDEA 1F77A 2WAQE 5D3IB 4YY3L 4C3JG 1TY0A 3DWQA 4IQZA 3IAYA 2UXCQ 3SXHA 2KHJA 4AQYL 1NJIC 4C3JB 3GTJH 3LWUA 2E2IB 2R3ZA 2K14A 2R7FA 4EQ5A 1HR0W 1TU2B 1FD7D 1X56A 4MZ9A 3NTKA 2R6GA 1SNCA 3TS2A 2KHSA 4OGQC 3S2HH 3TP8A 2CQAA 2RF4A 3KOJA 4KV6A 5EJWA 2ES2A 2B2WA 2O2LD 2RCFA 4RGOS 5M9OA 1SNDA 2F3IA 1DOKA 5C4JH 4JPBW 4F87A 5E4WC 4XYOA 3VR4A 2B63G 1HHVA 1QOHA 3F2UA 4CDEC 5JPMC 2QDBA 1X3GA 1YVCA 1QUQA 3S17B 3CP0A 2Z9HA 3F2DA 1N9WA 4K8JA 1C8CA 3VR5A 4LFCQ 1B8AA 1O7LA 1T9HA 3BYYB 1JWSD 2ICEC 3T1HQ 3CC7A 3RR5A 2IHFA 4Q5VA 3UE0A 2VQEQ 1KABA 3MTSA 4QF4A 1PTOH 3NQTA 3VDYA 4O2DA 4JI2L 4UDUC 3PQIA 5M5YH 3X3MA 1LTGD 3KLSX 1XMOQ 3BDCA 3ZJYC 1YHBA 4NXML 1WTHA 1G91A 1RD9D 2Z0SA 1RCVD 4XT3B 2B8FA 4BA1I 3QG1A 2RQXA 1XMQL 1STYA 1PA6A 2FMMA 2HDMA 3E9HA 1NUCA 3Q23A 4IFDG 4YY3Q 3VYUA 3NWSA 3HOXH 1NBWA 4OL7A 3RZOH 5ELNA 1PRTD 1G2TA 4K2LA 4AQYQ 2ZXOA 4JK1C 4DV2L 1N32L 2B8GA 2VQFL 1IYUA 2QW7A 4C3IH 1BBUA 4IN3A 2KVMA 1WD1A 2F3VA 3TBIB 2M2LA 1TWHB 2BDOA 3AU7A 3F8TA 5C4XG 3KLSA 2Q8TA 4ZRZA 1D8LA 4ZCKA 2F0LA 3GTGB 5IP9H 1SMYD 1PH2A 1IYVA 1OXUA 4FO2A 3KJPA 3PO2H 2IX0A 1SR3A 2PO4A 1HH2P 1OO9B 3PIOA 1WYDA 3SHLA 3DM1A 3RD4A 1K0RA 5T1IA 2JA5H 1Q12A 2N55A 1E2WA 2B29A 2B2UC 4XQQA 3MXUA 1M8AA 3E5SA 1V1OA 5KYLA 2L55A 2O4XA 3H94A 4XDXA 2PZTA 5FO9B 1EIGA 3GD7A 2K52A 1QUQB 3AMUA 1VQBA 4ABNA 5DEHA 2WB1G 4JI2Q 4IPHA 2KENA 5IYCG 5FKAC 3J80L 4A3MH 2E75C 3H0GG 3HOYG 1PYWD 4NXMQ 2I5HA 3R2IA 1J8IA 2Z4HA 5C4ZA 1VQ8A 1EY4A 4ULLA 1WD0A 4BBSH 3I70A 4GLAC 3H0GB 5BN4A 3HOYB 3PCOB 3K57A 1XMQQ 2NBFA 4NDXA 1I4HA 1D2BA 1EY8A 2K03A 4F8MA 4LUVA 1EL0A 4XIGS 4C56C 1LT4D 3H91A 3K59A 4MTNA 1Y1WH 1CFMA 1JE5A 1I4QA 1WCMB 4A3BG 2LFNA 1WTRA 4DV2Q 5EGTA 2QEJC 1N32Q 2VQFQ 4N8X1 4ZQ3A 3EQLC 3ERQA 2LS01 4KD4A 1E7ZA 3E6ZX 4A3BB 2NYZD 3E0JA 1MJEA 1SXTA 1XTCD 5I2XA 1YJ9A 1VS0A 1VQPA 3BVZA 1JT8A 2RDHA 1L1OC 3Q6SA 4K6DA 2SOBA 1EOVA 2KECA 1X9NA 1EIHA 1E2VA 3UDFA 2PQAA 2BDNA 2JA8G 3J80c 1SYFA 4B9XA 3EBEA 4CJ1B 3UDXA 3X3NA 2R7DA 2JSOA 5CC4A 1SNMA 4I65A 4LAAA 2XTIA 3VA7A 3HZXA 2RKSA 2JA8B 4IPGA 2DY8A 2H1EA 4IUPA 1S5ED 3U4VA 1NMFA 1Y69U 4DV0Q 4R8IA 1HZBA 4J1MA 1TWCH 1ZXTA 1WTPA 3K58A 3WOEA 3FEWX 1DZ1A 1SMXA 3B6YA 3I4MH 1A3VA 3EVQA 4HCSA 4C2MH 3PUWA 1AW7A 1TWGB 4B3ML 1S5DD 1JOQA 1X55A 1VQ7A 1Y1VG 2P5ZX 1TS4A 4JW0A 1S72A 2R7ZB 4EGVA 1UE7A 5J22A 1EWCA 4XQJA 5CV4A 2L12A 1VQEA 1SE2A 1NNXA 2A6EC 1FJGL 3MAQA 5CR3A 3S1QH 3A8JE 1NY4A 4MTKA 1PTOC 1X3QA 3FVQA 4G4KA 5LHY1 1GUTA 1PV4A 4OX9L 3E3XA 4IPDA 2XVSA 1F9RA 3MXNA 4K5XA 1WTXA 2F0PA 2CW0C 4RMFA 5FO7B 5ELEA 2AUJD 1JB7A 2F0IA 2PW7A 1VQOA 2KBNA 4HAEA 3L3OC 2PZUA 1KDBA 2WKDA 2VXWA 2D0OA 5KNCA 2BH2A 2EJGC 1K0SA 4A93H 2I07B 2AMCB 4BBRH 1LABA 5CBEE 2I5MX 2RDFA 4KKUA 1A3UA 1EUJA 1Q3LA 3TN2A 3T56B 1PYSB 2DJGC 4PZ6A 2PMZE 1PH3A 2HIXA 2RCNA 3MXPA 5E4XA 4CDCC 1EIYB 5ELFA 4EQOA 3WOFA 1MHWC 4H0LC 1EQTA 2IL8A 2EY5A 1E1TA 4C3JH 3Q8DA 2PQAB 3A56A 4L6TB 3J7AV 1UE6A 3OW2A 4RA8A 4KY6A 5E3FA 3VA5A 4MHEA 4DV3L 2ZXRA 4GLVB 4TQUS 4HJ9A 2JA6B 5JJIA 3MXGA 4XT1B 1F2MA 4B3MQ 1BOSA 2NZOA 1KNEA 2WAQG 4GOPA 5C3WA 3GTMB 2MPMA 1EWIA 4N9PA 4RHRA 1E1OA 3PUXA 1U0LA 1WOCA 1KDCA 2WAQB 5C5MA 3NENA 2OTLA 3S1NB 3P1HA 5CV8A 1AE2A 2SEBD 1DGSA 5IGDA 3KJOA 2B63H 1FJGQ 4A3KG 2QILA 3T1YQ 3G6EA 2EVBA 5KIXA 3UDGA 4IFDI 3IFTA 2CQOA 4IOAA 4OX9Q 1F2LA 3L7ZC 4A3KB 4OEMB 1JOKA 1RIPA 1YHAA 2E2DC 3D3RA 4A3IG 3CCRA 2R92G 3MHBA 3QOJA 4ID6A 2HDLA 5HURA 4IJHA 1L0YB 1WTWA 3A8KE 3M9BA 4A3IB 1O80A 3N52A 1BF4A 4A3FG 5IYBG 5D65A 2R92B 2EOTA 4QQBX 1X32A 2EYLA 4JI0Q 5KNDA 1HNZL 3MXNB 1K9MC 1HQMC 4A3FB 4ZUIA 4DFAA 5CV6A 5EPKA 3QO2A 1CSPA 1JQYD 4RWSC 3PF5A 2B39A 3GTLH 1PZJD 3S15H 3G7LA 3UDIA 1TKWB 2Q2IA 4KTAA 5CV7A 3CW2C 4DR3L 1HA6A 4A75A 3J7AF 1A2TA 4KY7A 5ELCA 3NBHA 5EBCA 3CCVA 1VQHA 4KK7A 1STGA 4PMCA 5IY0A 3BG3A 1C7YA 4IFDH 3TP6A 3G48A 2MGSA 4P72A 4JI5L 1ICWA 3NTHA 2CVRA 1PYBA 1AZPA 3NPPA 3R8BA 3UE1A 4DV3Q 2B2VC 3MA2B 3S1MH 1QWYA 4LUOA 2HD3A 4DKAC 2B2YA 4RGTA 4NW2A 1LTBD 2F0SA 4CHTB 3KUPA 1IKLA 1BXTA 4E6IA 1KXLA 2YTYA 2UUCL 1BR9A 4RH6A 5C4XH 5C0XG 1RDPD 1PLFA 1HPCA 1YIJA 4LF6L 1TWFB 1S3OA 1EZ6A 4CKBA 2X6GA 2ZT9C 5FO8B 1UUPA 4ODGA 1SMYC 1S5BD 3D6CA 4ZAIA 1QVCA 2IJ0A 3A7AB 4LNQA 2Z6KC 3U50C 4BY7H 1X65A 4OELB 2B2TC 1U4RA 3K8AA 2K5WA 2WV6D 1RF2D 5M3FH 1QNUA 2YTXA 1JJ2A 4G7OC 2AQ2B 4GNXC 3BYTB 3JAMi 4A3LG 1DXMA 1HNZQ 3EFXD 5IYCH 4WJ3M 1VQ5A 3WWVA 2KOLA 4O42A 4X66Q 3EN2A 1VQLA 3H0GH 3HOYH 1B70B 3DEPA 5C6AA 3ND9A 5AJ3L 4DR3Q 1SROA 2QDLA 1NAPA 1ESFA 4KKSA 1LTSD 1TR5A 4Z9CB 4XQNA 1R9TH 4KY5A 1TQOA 4A3BH 4CDDC 3J80i 3NBHB 3AYHB 4JV5L 1LYLA 2AWNA 4DR2L 1F2ZA 1FYCA 1I50H 1KL9A 1RTOA 1V1QA 3SEBA 4P2CB 1V1PB 1OXVA 2UUCQ 3NELA 2AWOA 5H1SE 3BVMA 3HFZB 2JA8H 1EQVA 4LF6Q 4OWWB 4WORA 1WJJA 3RLOA 1F2YA 4X3UA 4N8FA 4GS3A 2CH4A 3T53B 1OXSC 1IL8A 1QJOA 1KRTA 5LMNW 4DUYL 3PUVA 1SJED 2NVXB 2VZAA 5EBDA 1TWGH 2F0WA 3K7UC 3P7JA 2WINB 2Q2TA 4IPCA 1I3QB 5D3DA 2RSNA 4Q0FA 4H7BA 2PCFB 2CHBD 2AKWB 5JEAG 4B3SL 1E2ZA 1Y1VH 4WJ4A 5HGQA 3QJYA 2Q2UA 4DNTB 3S2DB 2K5QA 2OCEA 2EJMA 4R4OA 1KLUD 3GP7A 3CC2A 1I4GA 3K5NA 1BQQT 1JC7A 1HQRD 2L9HA 3JC66 4JI8L 1KAAA 3GTKB 5D14A 4K5VA 1Z9FA 1YHQA 1B4OA 1XX8A 3ONAB 1GUNA 5GROA 3NK9A 1D6EC 1VQAA 4DUZL 3U58A 4DK3C 2R93B 5DM63 4JCVE 5EAYA 4RHSA 4TRDA 1O7ZA 3RLNA 1K83B 1H9SA 4XXEA 3V05A 1WTVA 3KF6A 4DNIA 1STEA 4JV5Q 1A62A 3CXCA 4DR2Q 2WIIB 2JEAI 3S9WA 1H9MA 2EYPA 2JE6I 4RKBA 4HIOA 1I4PA 3I4NB 3I4LA 4YCVA 1U4LA 2IY5B 2RVLA 1XWEA 1KNAA 3M85A 4CKCA 5IYDG 5A2QL 1LTLA 1B53A 3IKJA 2IX3A 4IO9A 4L8JA 3VR3A 4DXFA 1EWHA 5M3MG 1O7IA 5CGKA 4DUYQ 5KGUA 5M3MB 2MJ8A 1SFOB 2E2HB 1PH6A 1R4QB 3KDFA 4UP9A 5IGCA 3GTMH 3OOCA 2B2WC 2MQHA 1JR0D 4IUNA 4OXPA 4LK1C 4B3RL 2PMZB 2OTJA 2DNCA 3AB9A 5IGEA 4UY8C 4L5QA 4BXXG 3CC4A 3S1NH 5FLMG 1HUMA 1CUKA 3CCLA 3M4YA 3D6WA 4HIMA 4NPSA 4P71A 1K8GA 1MSGA 1ET9A 2A69D 1NSNS 2GVBA 1YITA 1GHJA 4DAYA 4A3DG 1QE6A 4X64L 1PH5A 4JI8Q 4A3KH 4KJOA 4R4CA 1I6HB 3O13A 2ZJRA 4O1NA 1HNWL 2VUMG 2LMCB 4NP5A 1IKMA 4A3DB 2K05A 4DUZQ 3GV6A 4A3IH 3TREA 2VUMB 4K0KL 2PI2E 2ID0A 2R92H 2JP1A 2VB2X 1XTDA 2K04A 1PH8A 4WRDA 4Y52H 4FNFA 4X3SA 3RN2A 1KC8C 1D5XC 1I4RA 4A3FH 1CKMA 5IYBH 4JYAL 3S14B 4LF8L 1XPOA 1U4PA 2OQKA 1GUSA 4K2KA 3IFDA 3SK5A 1XYIA 1PFSA 1GM5A 5C0XI 4QIWB 2OWOA 1A63A 2QF7A 1VQGA 5C5LA 4L5SA 3OMGA 3KF6B 5M5XH 3M7NA 5HY6A 2OQ0A 4DR4L 3OWEB 2G5DA 1VCIA 3CU7A 1OXTA 3J81j 3D4RA 1DOMA 4DV5L 3GO5A 3L2PA 1VQIA 1PFMA 2EQSA 4ZYSA 1ZEQX 2V4DA 4KHZA 4NB3A 5KEEA 2CCZA 1IYJB 2B2UA 1XPUA 2KCCA 4LF9L 1VQFA 4B08A 4EX5A 2IPKD 1J6QA 1HTPA 2NUCA 1GXDC 4B3RQ 5JVG3 3LX0A 2YV5A 3BZKA 5IP7G 4KLKA 4JI3L 1PH9A 3S24A 2ATWA 2FHTA 1BVSA 4U673 1AZQA 2HUGA 5EPLA 4KHVA 1LM0A 4BS9A 3BZDB 1SYEA 3KDFB 5C0XH 3TP5A 4X64Q 2EJFC 3K5MA 1Z47A 4JBMA 2F1MA 3FKIG 2ZM6L 4OHJA 1HNWQ 1ENAA 1SRUA 5IODA 2NVTH 1MSHA 1BUVT 2Q8IB 3M4OB 3FKIB 4LFBL 1LTID 4K0KQ 1WCMG 4OIJA 4DAYB 2J4XA 2YTVA 5J39A 4DR6L 1C4QA 1G6ZA 1YBYA 3T51B 2E2JB 4JYAQ 2HCCA 1A15A 2OT2A 4X3KA 4LF8Q 4UPAA 4A3EG 4YIJA 4A3LH 1HFNA 5KYIA 4X3TA 1GHKA 2G9HD 1EQQA 1ML0D 2MFIA 5GADC 1CQFA 4IUUA 4A3EB 3T13A 2D9UA 5I2YA 1L1OA 2IW3A 3MFGA 4EVOA 4FP5D 4OO1G 1MJCA 3GTOB 3SDZA 4DR4Q 3M7GA 1SYCA 3C46A 4PZ7A 5EPJA 2D0PA 4DV5Q 2JXMB 1ILQA 1MBYA 1VF7A 1UEBA 3HEJA 1VQCA 2B3GA 2PW5A 5IWAL 4HIDA 1NE3A 3OTOL 2D5DA 4LF9Q 4L5RC 4J8QA 5FK9C 3N6RA 1F9PA 3HOZH 1STNA 1SNPA 4JI3Q 2N78A 1Z6HA 3DMUA 4DV1L 2KEEA 1QZGA 1BCPF 3AFPA 2R7ZG 4C1NK 5ELBA 3KFUA 3J81E 3C1FA 1D5MC 5C3EH 4O0AA 1AN8A 2NTSA 3L9AX 1Q90A 1IBLL 1CKNA 1LTRD 3HOUH 1EYAA 3J7ZC 2J0TD 2MP1A 1W2BA 1PH7A 1PTOF 2XWBB 4EQNA 2EY6A 2F3WA 2NVXH 2OXPA 2F0HA 5J1ZA 4LFBQ 1H9RA 4M1UB 1I3QH 4RGNA 4KJNA 3PIO3 3K7AB 1STBA 1EY6A 2PQEA 4RGMA 5FJ8G 4KN4C 2HQEA 1TXYA 3H3VI 1V43A 3AQQA 3S2DH 4QMGA 5JEAH 3P75A 3CCUA 5K36G 2EPBA 3OPOA 1Z7TA 3I3CA 4NMZA 2UXBL 3KK7A 5F2DA 2EIFA 1HCZA 3MZ5A 1SSOA 2AUKA 2ZJQA 1I5FA 3SR1A 1WI5A 2HCIA 1HZAA 4L5TA 5A35A 3VR6A 5BN3A 2UUBL 4GKKL 3M3YH 1KIXA 4GN3B 3A54A 3NQIA 1E0BA 3HOVG 4HR7B 2GN5A 4A3JB 1DM0B 2K5HA 1D5ZC 3HG9A 1AFPA 4GKJL 3QOLA 3HOVB 4QL5A 5IWAQ 3OTOQ 3KLRA 1HNXL 4FF4A 2BCOA 2E2IH 4CJ2C 2F0EA 1MGSA 2JA6G 2PI2A 4LF5L 4YWKA 4DV1Q 3ULLA 3K0XA 2EYMA 2K5DA 2PYKA 3ERSX 3GTQB 3T16A 1FR3A 4BY1G 3D4DA 1LT6D 2F03A 3KF8A 2KEDA 4LF4L 5I4DA 1IBLQ 3A7LA 1FNVA 2NZ1D 4DA2A 4PMWA 3ICEA 4BY1B 5IYDH 3GV3A 4JVZA 1SE4A 1BBWA 4IZ8A 2K33A 4AIMA 3S17H 1J5EL 3LWEA 1Y8NB 1SFOH 2E2HH 1PXUA 2O5IC 1Q1BA 3C1EA 3URYA 1VQ4A 2TMPA 1B7YB 5DNFA 1IL2A 1BCPB 4JOIC 4DV7L 4EQPA 3MEHA 1G6PA 2OF1A 2JK8A 2WFWA 4U68A 4QIWE 1CKNB 2RBMA 3C3LA 5IGFA 2LXJA 1ONLA 4ME3A 2JA7G 2MO1A 1SE3A 4YHHL 2D62A 2SDFA 5FLXE 3KLWA 3I56A 4RFBA 3V2TA 2XSCA 3I72A 5FLMH 3DHQA 1VQJA 2UXBQ 3NE5B 2JA7B 5M5YB 1SYBA 3D0FA 1EQRA 5C44G 2O5JC 1PVOA 3RUZA 3BVGA 1A0IA 2F0OA 4A3DH 4GKKQ 5C44B 1PFNA 2BA1A 4DAPA 5A2QE 2A69C 4DNRB 2KJXA 4DV4L 1ESRA 2VUMH 2EYOA 1XNQL 2F0VA 2K5VA 3PIPA 4P73A 3QB3A 4G57A 4X65L 4OWXB 3K80C 1KTKA 1Q81C 4GKJQ 2DGYA 3HKZE 5E7NA 5EKKA 3I55A 1M4VA 2TSSA 3S14H 5HGTA 1C48A 1AH9A 2AQ1B 2FFKB 3GQBA 1HNXQ 3CRLC 3RNUA 4C3IG 2HIVA 4J6HA 3H15A 4LF5Q 4QCLA 2QKIC 1LV9A 2B2VA 1PRTC 1G291 4C3IB 3CCSA 2BOSA 2A6HD 1TWHH 2UU9L 3BU2A 2ZTCA 2QGQA 2L15A 3IRBA 4R4TA 5FOBB 2H4OA 4LF4Q 3GTGH 3VYRA 2A74C 2BH8A 1HXYD 2VS1A 4R1JA 4FXKC 3S16B 3RZDB 5CORA 3R93A 2DJFC 2LKVA 1YJWA 1B50A 4G7ZC 1J5EQ 2I46A 2ZTEA 3I90A 3TZUA 4A76A 1H9JA 4DPGA 3MEFA 4DV7Q 4GOPB 2F0TA 2MHVA 1VQKA 1SE8A 2Z6KA 1AE3A 2B2YC 2B2TA 2F0FA 2EY2A 2YU9B 1VMCA 4KI0A 1B2TA 1R4PB 1TY2A 5IP7H 1PMRA 1PDQA 1NMGA 1QCBD 2NWGA 1OTCA 2WKCA 4DV6L 4GNXA 1GOZA 2I5LX 4H44C 1X6OA 4RAUC 4ME5A 4BBSG 4UP7A 1G51A 4OO1I 4A3CG 3K81C 3DEOA 3J81L 3EA6A 3W5OA 4K5WA 4BBSB 2N3SA 3M4OH 3FKIH 3PGZA 4DN4M 4JI4L 1XNQQ 3HOWG 1Y1WG 3OMCA 1I6VC 3U9SA 5JOBA 1QZHA 4BA2I 2VB3X 3HOWB 1WCMH 1YJNA 4CBVA 1Y1WB 3TS0A 1HUNA 3R2TA 3SGIA 4JI5Q 3C2PA 2VW9A 2K6AA 1EY7A 5EKIA 4A3EH 1Q8KA 1SDFA 3JAME 2R61A 4ILWA 3TP7A 2UU9Q 2I0QA 4TKOB 2XN9C 3EJIA 2JEBI 2DNEA 1CZGA 3G4SA 3EROA 2E74C 3LNNA 3W2DA 3CPFA 1WFQA 2IHEA 2Q2HA 5CMDA 2DY7A 4ZUJA 4JI6L 1JOOA 2UXDL 4JBJA 3T4AC 3STBD 2ASBA 2A73B 4JG2A 1Y8OB 3U9OA 1JWUD 3QR8A 3DUZA 3J81c 1X3EA 2IWHA 4Y7NB 2UXCL 1F9QA 2KHIA 3NBIA 3PIP3 2IX1A 5KNBA 4NXNL 5IE8A 4IFDJ 3PMFA 2KCTA 5GQOA 2KQ3A 3NXWA 4PMBA 3S1RB 1DD2A 1BCPD 1IBKL 1TS5A 3I4MB 3OYYA 1ZKOA 4C2MB 1CSQA 5IT9E 4DV6Q 1MI2A 2L11A 2R7ZH 3ULPA 2SNSA 3A5ZB 4OIKA 2K1BA 5EKLA 5I9PA 5ISRA 3J7A5 4KKTA 1W6KA 4HN7A 3QIAA 4A4IA 4C3HG 1EU3A 5AJ3Q 1Q82C 1MKHA 3MC0B 2QA4A 1B1ZA 1HR0L 1IHZA 1TS2A 1IZ6A 3G71A 2R93G 2BA0A 4C3HB 1LACA 3W1GA 1UEAB 2AQ3B 3HP3A 3MWYW 3AEVA 2K28A 3SE0A 5FJ8H 4LMQD 2CH4W 4JI1L 4A93G 4POFA 2EDGA 5BR8L 1II3A 2A1AA 3I4NG 1RTNA 2E5LL 5M5WB 5FLXL 4A93B 4CDFC 1JORA 1V9PA 4BBRB 2EYHA 4IUVA 4H02A 4I7AA
chains in the Genus database with same CATH topology
2F0QA 1D1KA 1KLGD 5IIFA 2NVQB 1EZ8A 5JAVA 2EYJA 5LL6X 1VMPA 1ENCA 3TZDA 2KA7A 3VYSA 1SBBB 1CQVA 1X3PA 2ICIA 1UAPA 1F9SA 1RKNA 2NTTA 4G7HC 5I9OA 3I91A 2L4NA 1ILPA 1IW7D 3RMHA 5COYA 1U9RA 3A8IE 4B9WA 1BNZA 1CM9A 1B44D 1LT3D 1QNKA 3K0YA 4PNYA 2BE5D 2B63B 3NHHA 3CQZB 3VYTA 1EYCA 1K8MA 4FF2A 4FXGC 4LJZC 3KBGA 1G2SA 4WFN3 2EY1A 2KUMA 3GTPB 4FF3A 4BWGB 4QUCA 4HCEA 2YYZA 3CKIB 4GZYC 1GUGA 2Z8LA 4RKLA 2XWJB 1CT1D 1HFGA 3OIQA 4C1NI 5AFWA 3SK4A 2IT1A 5I6YA 2Z4IA 3GTLB 3S15B 1WVLA 1SEBD 1H9SB 1ET6A 2N88A 1EY5A 3BDOA 1WTOA 1EEID 2XRQD 2EZVA 2F0UA 2K7VA 1D1IA 1PFBA 5LL6S 2FINB 3QWNA 4IURA 3D8GA 5EQ0A 3S1MB 4DU9A 2X69A 3JAML 2A6HC 1JB3A 3HKZB 5C4XB 1LT5D 1GUWA 5IGBA 4QUFA 4DXGA 1OXXK 3NP8A 2G9DA 5G3LF 5DM73 2RA4A 2GA4B 2L1BA 1STHA 3HGBA 1NCVA 3SK8A 2K32A 4BY7B 1CZWA 2NN6G 2KCNA 3PO3B 1VDZA 4IALA 5M3FB 1YNND 5CBAE 1V8QA 3NSWA 4JBWA 3A55A 1MD2D 1GJXA 2F0KA 4DK1A 2WB1B 3OW7A 3HS0C 5IT9L 4MIUA 2Q8RE 2ZXPA 3R3OA 1SAPA 1TIID 2L5TA 1STAA 2FJ2A 2M00A 3MVVA 1CA6A 3J7YW 4HTHA 3V96A 3TDQA 2F0GA 2J7ZA 3IL8A 3P20A 1R9TB 1DOLA 2NVYB 4KMUC 4XYQA 1RJTA 1K8OA 1H9KA 4H13C 4FXDA 4KD3A 3K5LA 1I50B 3CRKC 1G8ZD 2QCPX 3BDLA 1NR2A 1DJRD 1YNJD 1S4ZA 1ZYRD 4NKLA 4FYDA 1CI3M 5K5PA 4HSPA 3OWFA 3PUYA 2L0CA 1O7YA 1U4MA 5NUCA 3FDTA 4CGYB 3NTIA 1BCPC 4DGZA 1RODA 2M9VA 3I8ZA 1CTMA 4A3GB 1Y1VB 4FVMA 1LTAD 2A68D 1EEFD 1ENFA 1TWAB 2WACA 1QG7A 5C0XJ 1FGBD 1SYDA 1S5CD 5JJZA 5JPNC 3ND8A 1J9OA 3NUCA 4QB4A 3RLFA 3BS1A 5E1FA 2F0NA 2JYOA 4CKEA 2D2CC 3OHXC 1A2UA 3DWPA 3FPPA 1LO5D 3Q22A 1EOTA 2PZWA 2ENBA 4M8AA 3GTJB 3FMCA 2PNRC 4XTCS 3S2HB 2EE1A 2F4IA 2XIWA 3HRZC 5C4JB 1XXGA 1BDOA 1DYQA 1AEXA 4F7XA 1WTQA 2MUYA 1SNOA 3FRPB 2RSOA 2NB0A 4RCNA 1PZID 4HMJA 1Q8IA 1IW7C 1I4XA 1EY9A 1PTOB 4R9WA 4F88A 3I73A 5I6WA 3G6JB 4R8NA 2Z1CA 2BE5C 1L0XB 2PPBC 3H6MA 2LY7A 3ITPA 4WJWA 1KDAA 1B9MA 4K14A 3HOXB 3RZOB 4PQXA 3CHBD 1PRTF 4K6LA 1HA5A 3W3AA 5T1GA 4PV1C 5IGGA 5JEAJ 1AP0A 3KBXA 1B3AA 1TT2A 2XRSD 5TSSA 3FPUB 2SNMA 1JCKB 1HRJA 4I7ZC 1A3TA 1JE4A 5M5XB 4HSVA 4HMIA 2NN6I 1V1PA 3PO2B 1CHPD 4UAIA 4ZKBB 1RHPA 3OSOA 2JA5B 1QILA 5BN5A 1DCZA 5C3XA 3K6OA 4IUQA 4S3SA 2XNAC 5CV9A 2DN8A 1FNUA 3TSSA 1Y8PB 3DWAA 4KN7C 1HTLD 4ZK9B 5G3LD 3ZYYX 4A3MB 3PUZA 5CV5A 1CA5A 1EU4A 1TS3A 2NVTB 4MN3A 5CYUA 2NN6H 1BBXC 1LLRD 4DAVA 1B9NA 2WP8J 2X6LA 1W6JA 4ZKCB 3D31A 1TVXA 5ELDA 2OEOA 4TSSA 1YNNC 3UI2A 3DXJC 1EYDA 2VNUD 1VF5C 4RCOA 1S5FD 3TMEA 3NWTA 1LTTD 3WDNA 1GUOA 1CHQD 4OO1H 1UNSA 1PRTB 3PV0A 2F0DA 3H3VC 1T5EA 3VR2A 2EXZA 4DF7A 4CJ0B 3Q24A 1TWCB 2A5HA 2EYFA 3SK6A 3HOZB 4FF1A 5IOCA 3J80E 1NR4A 1BO0A 2C9OA 1DONA 2RDGA 1JWMD 1Q1EA 5DAUA 5JVH3 2F0JA 2C5CA 2A6ED 1SJHD 3OIPA 5C3EB 4IUTA 1QB5D 2F0MA 1PTOD 3HOUB 1YNJC 1A6XA 4N9TA 3D4WA 1ZYRC 3H09A 4L63B 4HEDA 1O78A 5C4HA 1FNWA 2Y0SB 2E76C 4DK0A 3Q0AA 1CK1A 1SNQA 4K8IA 1EY0A 3S1QB 2CW0D 3K5OA 4AYBB 1JICA 3SVMA 5KRUA 4ZLTF 2K01A 1T5XD 5K36H 1SYGA 4V0BA 1EFID 3M3YB 2A68C 3MFYA 4V190 1PZKD 2FMCA 1F77A 5D3IB 4C3JG 1TY0A 3DWQA 4IQZA 3IAYA 3SXHA 4C3JB 3LWUA 2E2IB 2R3ZA 1TU2B 1FD7D 3NTKA 2R6GA 1SNCA 2KHSA 4OGQC 3TP8A 2CQAA 4KV6A 5EJWA 2B2WA 2O2LD 4RGOS 5M9OA 1SNDA 1DOKA 4F87A 5E4WC 4XYOA 3VR4A 1HHVA 1QOHA 3F2UA 5JPMC 2QDBA 3S17B 4K8JA 1C8CA 3VR5A 1O7LA 3BYYB 1JWSD 2ICEC 4Q5VA 1KABA 3MTSA 4QF4A 1PTOH 3NQTA 4UDUC 3X3MA 1LTGD 3KLSX 3BDCA 1G91A 1RD9D 1RCVD 4XT3B 2B8FA 4BA1I 3QG1A 2RQXA 1STYA 2FMMA 2HDMA 1NUCA 3Q23A 4IFDG 3VYUA 3NWSA 4OL7A 1PRTD 1G2TA 4K2LA 2ZXOA 4JK1C 2B8GA 1IYUA 4IN3A 2KVMA 1WD1A 2F3VA 3TBIB 2M2LA 1TWHB 2BDOA 3AU7A 3KLSA 2Q8TA 4ZRZA 2F0LA 3GTGB 1IYVA 1SMYD 1OXUA 4FO2A 2IX0A 2PO4A 1OO9B 3SHLA 3DM1A 3RD4A 5T1IA 1Q12A 2N55A 1E2WA 2B2UC 4XQQA 3MXUA 1M8AA 3E5SA 1V1OA 5KYLA 2L55A 2O4XA 3H94A 4XDXA 2PZTA 5FO9B 1EIGA 3GD7A 3AMUA 4ABNA 5DEHA 5FKAC 3J80L 2E75C 1PYWD 3R2IA 1J8IA 2Z4HA 5C4ZA 1EY4A 4ULLA 1WD0A 3I70A 3H0GB 5BN4A 3HOYB 3K57A 2NBFA 4NDXA 1I4HA 1D2BA 1EY8A 2K03A 4F8MA 1EL0A 4XIGS 4C56C 1LT4D 3H91A 3K59A 1CFMA 1I4QA 1WCMB 2LFNA 1WTRA 5EGTA 2QEJC 4ZQ3A 3EQLC 3ERQA 2LS01 4KD4A 3E6ZX 4A3BB 2NYZD 3E0JA 1SXTA 1XTCD 5I2XA 3BVZA 2RDHA 3Q6SA 4K6DA 2SOBA 2KECA 1EIHA 1E2VA 2BDNA 1SYFA 4B9XA 4CJ1B 3X3NA 5CC4A 2JSOA 1SNMA 4I65A 4LAAA 3VA7A 3HZXA 2RKSA 2JA8B 2DY8A 2H1EA 4IUPA 1S5ED 1Y69U 4R8IA 4J1MA 1ZXTA 1WTPA 3K58A 3WOEA 3FEWX 1DZ1A 1A3VA 3EVQA 4HCSA 3PUWA 1AW7A 1TWGB 1S5DD 1JOQA 1TS4A 2R7ZB 4EGVA 5J22A 1EWCA 4XQJA 5CV4A 2L12A 1SE2A 2A6EC 3MAQA 5CR3A 3A8JE 1PTOC 1X3QA 3FVQA 4G4KA 5LHY1 1GUTA 2XVSA 1F9RA 3MXNA 4K5XA 1WTXA 2F0PA 2CW0C 5FO7B 5ELEA 2AUJD 2F0IA 2PW7A 4HAEA 3L3OC 2PZUA 1KDBA 2WKDA 2VXWA 5KNCA 2EJGC 2I07B 1LABA 5CBEE 2RDFA 4KKUA 1A3UA 1Q3LA 3TN2A 3T56B 3MXPA 5E4XA 5ELFA 4EQOA 3WOFA 4H0LC 1EQTA 2IL8A 2EY5A 3A56A 4L6TB 3J7AV 4RA8A 4KY6A 5E3FA 3VA5A 4MHEA 2ZXRA 4TQUS 2JA6B 3MXGA 4XT1B 1F2MA 1BOSA 1KNEA 5C3WA 3GTMB 2MPMA 4N9PA 4RHRA 3PUXA 1KDCA 2WAQB 5C5MA 3S1NB 3P1HA 5CV8A 2SEBD 5IGDA 2QILA 2EVBA 5KIXA 4IFDI 3IFTA 1F2LA 3L7ZC 4A3KB 1JOKA 2E2DC 3D3RA 3MHBA 3QOJA 4ID6A 2HDLA 5HURA 1L0YB 1WTWA 3A8KE 4A3IB 1BF4A 1O80A 3N52A 5D65A 2R92B 2EOTA 1X32A 2EYLA 5KNDA 1HQMC 4A3FB 4ZUIA 4DFAA 5CV6A 5EPKA 3QO2A 1JQYD 4RWSC 2B39A 1PZJD 3G7LA 1TKWB 4KTAA 5CV7A 1HA6A 3J7AF 1A2TA 4KY7A 5ELCA 3NBHA 5EBCA 4KK7A 1STGA 4PMCA 3BG3A 4IFDH 3TP6A 2MGSA 1ICWA 3NTHA 2CVRA 1AZPA 3NPPA 3R8BA 2B2VC 3MA2B 1QWYA 2B2YA 4RGTA 4NW2A 1LTBD 2F0SA 4CHTB 3KUPA 1IKLA 1BXTA 4E6IA 1BR9A 4RH6A 5C0XG 1RDPD 1PLFA 1HPCA 1TWFB 1EZ6A 4CKBA 2X6GA 2ZT9C 5FO8B 1UUPA 4ODGA 1SMYC 1S5BD 3D6CA 4ZAIA 2IJ0A 3A7AB 2B2TC 1U4RA 2K5WA 2WV6D 1RF2D 1QNUA 4G7OC 2AQ2B 3BYTB 1DXMA 3EFXD 2KOLA 4O42A 3DEPA 5C6AA 3ND9A 1NAPA 1ESFA 4KKSA 1LTSD 1TR5A 4Z9CB 4XQNA 4KY5A 1TQOA 2AWNA 1F2ZA 1FYCA 1RTOA 3SEBA 4P2CB 1V1PB 1OXVA 2AWOA 3BVMA 1EQVA 4WORA 1F2YA 4X3UA 3T53B 1OXSC 1IL8A 1QJOA 3PUVA 1SJED 2NVXB 5EBDA 2F0WA 3P7JA 2WINB 1I3QB 5D3DA 2RSNA 4Q0FA 4H7BA 2PCFB 2CHBD 5JEAG 1E2ZA 3QJYA 4DNTB 3S2DB 2K5QA 2EJMA 1KLUD 3GP7A 1I4GA 3K5NA 1BQQT 1JC7A 1HQRD 2L9HA 1KAAA 3GTKB 5D14A 4K5VA 1B4OA 1XX8A 3ONAB 1GUNA 3NK9A 1D6EC 2R93B 5DM63 4RHSA 4TRDA 1O7ZA 1K83B 1H9SA 4XXEA 3V05A 1WTVA 1STEA 2WIIB 2JEAI 3S9WA 1H9MA 2EYPA 2JE6I 4RKBA 3I4NB 1I4PA 3I4LA 1U4LA 2RVLA 1XWEA 1KNAA 3M85A 4CKCA 5A2QL 1B53A 3IKJA 2IX3A 4L8JA 3VR3A 4DXFA 1EWHA 5CGKA 5KGUA 5M3MB 2MJ8A 1SFOB 2E2HB 1R4QB 5IGCA 4LK1C 2B2WC 3OOCA 1JR0D 4IUNA 2PMZB 2DNCA 3AB9A 5IGEA 1HUMA 3M4YA 3D6WA 1MSGA 1ET9A 2A69D 1NSNS 1GHJA 4DAYA 1QE6A 4KJOA 1I6HB 3O13A 4O1NA 2LMCB 4NP5A 1IKMA 4A3DB 2K05A 3GV6A 2VUMB 2ID0A 2JP1A 2VB2X 2K04A 4WRDA 4FNFA 4X3SA 1D5XC 1I4RA 3S14B 1U4PA 1GUSA 4K2KA 3IFDA 3SK5A 1XYIA 5C0XI 4QIWB 2QF7A 5C5LA 3OMGA 3M7NA 3OWEB 1VCIA 3CU7A 1OXTA 3D4RA 1DOMA 3GO5A 1PFMA 4ZYSA 5KEEA 1ZEQX 2V4DA 4KHZA 2B2UA 2KCCA 4B08A 2IPKD 1HTPA 2NUCA 1GXDC 5JVG3 3LX0A 2FHTA 4U673 1AZQA 2HUGA 5EPLA 4KHVA 4BS9A 3BZDB 1SYEA 5C0XH 3TP5A 2EJFC 3K5MA 1Z47A 2F1MA 4OHJA 1ENAA 5IODA 1MSHA 1BUVT 2Q8IB 3M4OB 3FKIB 1LTID 4OIJA 2J4XA 5J39A 1C4QA 1G6ZA 3T51B 2E2JB 2HCCA 1A15A 2OT2A 4X3KA 1HFNA 4YIJA 5KYIA 4X3TA 1GHKA 2G9HD 1ML0D 1CQFA 4IUUA 4A3EB 3T13A 2D9UA 5I2YA 2IW3A 3MFGA 4EVOA 4FP5D 4OO1G 3GTOB 3SDZA 3M7GA 1SYCA 3C46A 5EPJA 2JXMB 1ILQA 1MBYA 1VF7A 3HEJA 2PW5A 2D5DA 4J8QA 5FK9C 3N6RA 1F9PA 1STNA 1SNPA 3DMUA 1Z6HA 2KEEA 1BCPF 4C1NK 5ELBA 3J81E 3C1FA 1D5MC 1AN8A 2NTSA 3L9AX 1Q90A 1LTRD 1EYAA 2J0TD 2MP1A 1PTOF 2XWBB 4EQNA 2EY6A 2F3WA 2OXPA 2F0HA 5J1ZA 1H9RA 4M1UB 4RGNA 4KJNA 3PIO3 3K7AB 1STBA 1EY6A 2PQEA 4RGMA 4KN4C 2HQEA 1V43A 4QMGA 5JEAH 3P75A 5K36G 2EPBA 3OPOA 1Z7TA 3I3CA 4NMZA 3KK7A 5F2DA 1HCZA 3MZ5A 1SSOA 2AUKA 3SR1A 2HCIA 5A35A 3VR6A 5BN3A 3A54A 3NQIA 1E0BA 4HR7B 4A3JB 1DM0B 1D5ZC 3HG9A 1AFPA 3QOLA 3HOVB 3KLRA 4FF4A 2BCOA 4CJ2C 2F0EA 1MGSA 2EYMA 2K5DA 2PYKA 3GTQB 3T16A 1FR3A 3D4DA 1LT6D 2F03A 3KF8A 2KEDA 5I4DA 3A7LA 1FNVA 2NZ1D 4DA2A 4PMWA 4BY1B 3GV3A 1SE4A 4IZ8A 2K33A 3LWEA 1Y8NB 1PXUA 2O5IC 1Q1BA 3C1EA 3URYA 2TMPA 5DNFA 1BCPB 4EQPA 3MEHA 2OF1A 4U68A 2RBMA 3C3LA 5IGFA 1ONLA 1SE3A 2D62A 2SDFA 5FLXE 4RFBA 3V2TA 2XSCA 3I72A 3DHQA 2JA7B 5M5YB 3NE5B 1SYBA 2O5JC 3RUZA 3BVGA 2F0OA 5C44B 1PFNA 2BA1A 4DAPA 5A2QE 2A69C 4DNRB 2KJXA 1ESRA 2EYOA 2F0VA 3QB3A 4G57A 1KTKA 5EKKA 1M4VA 2TSSA 5HGTA 1C48A 2AQ1B 2FFKB 3GQBA 3CRLC 4C3IG 4J6HA 4QCLA 2QKIC 1LV9A 2B2VA 4C3IB 1G291 1PRTC 2BOSA 2A6HD 5FOBB 2H4OA 3VYRA 2A74C 1HXYD 4FXKC 3S16B 3RZDB 5CORA 3R93A 1B50A 2LKVA 4G7ZC 2I46A 3I90A 3TZUA 1H9JA 2F0TA 2MHVA 2B2YC 2B2TA 2F0FA 2EY2A 2YU9B 1VMCA 4KI0A 1B2TA 1R4PB 1TY2A 1PMRA 1PDQA 1QCBD 2NWGA 2WKCA 1GOZA 4H44C 4RAUC 4ME5A 4OO1I 3DEOA 3J81L 3EA6A 4K5WA 4BBSB 4DN4M 3OMCA 1I6VC 3U9SA 5JOBA 4BA2I 2VB3X 3HOWB 4CBVA 1Y1WB 1HUNA 3R2TA 3C2PA 2K6AA 1EY7A 5EKIA 1SDFA 3JAME 2R61A 4ILWA 3TP7A 4TKOB 2XN9C 3EJIA 2JEBI 2DNEA 1CZGA 3EROA 2E74C 3LNNA 3W2DA 5CMDA 2DY7A 4ZUJA 1JOOA 3T4AC 2A73B 1Y8OB 3U9OA 1JWUD 3DUZA 2IWHA 4Y7NB 1F9QA 3PIP3 3NBIA 2IX1A 5KNBA 4IFDJ 3PMFA 2KQ3A 3NXWA 4PMBA 3S1RB 1DD2A 1BCPD 1TS5A 3I4MB 1ZKOA 4C2MB 5IT9E 1MI2A 2L11A 2SNSA 4OIKA 2K1BA 5EKLA 5I9PA 5ISRA 4KKTA 1W6KA 4HN7A 3QIAA 4C3HG 1EU3A 3MC0B 1B1ZA 1IHZA 1TS2A 2BA0A 4C3HB 1LACA 1UEAB 2AQ3B 3HP3A 3MWYW 2K28A 3SE0A 4LMQD 2EDGA 1II3A 1RTNA 5M5WB 5FLXL 4A93B 1JORA 4BBRB 2EYHA 4IUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EJF C;  2BA1 A;  2B8F A;  3PUZ A;  3EQL C;  3OOC A;  2A69 C;  4KN4 C;  4LK1 C;  4BA1 I;  2F1M A;  1V43 A;  1CI3 M;  4DNR B;  3QG1 A;  2DNC A;  3AB9 A;  4RCN A;  5JEA H;  5K36 G;  3PUY A;  3OPO A;  3T53 B;  4H0L C;  1Z7T A;  4TKO B;  2Q8I B;  4IFD G;  1OXS C;  1IW7 C;  2A6H C;  1QJO A;  2DNE A;  1HCZ A;  2JEB I;  2NN6 H;  3M4Y A;  5K36 H;  3LNN A;  2E74 C;  1B9N A;  2KA7 A;  2AUK A;  3PUV A;  1E2V A;  5C0X G;  3D31 A;  2A69 D;  3GQB A;  3CRL C;  1GHJ A;  3VR6 A;  5A35 A;  5BN3 A;  1HPC A;  4JK1 C;  2B8G A;  3I73 A;  1IYU A;  4TQU S;  2A68 C;  2ZT9 C;  3T51 B;  1OXX K;  1SMY C;  1Y8O B;  1YNN C;  2BE5 C;  3MFY A;  4HR7 B;  3VA7 A;  4G7H C;  2PCF B;  3DXJ C;  5JEA G;  2LMC B;  1E2Z A;  1G29 1;  1IW7 D;  2PPB C;  2A6H D;  1GHK A;  1CTM A;  1Y69 U;  3HGB A;  3A7A B;  1VF5 C;  3PUX A;  3A8I E;  3QJY A;  2K32 A;  4DNT B;  2BDO A;  2NN6 G;  5KNB A;  2EJM A;  1VDZ A;  4IQZ A;  3KLR A;  1DD2 A;  2A68 D;  1IYV A;  2BE5 D;  1B9M A;  4OO1 G;  3LWU A;  1OXU A;  4G7O C;  3SDZ A;  1V8Q A;  2EVB A;  1TU2 B;  3WDN A;  4JBW A;  4G7Z C;  2R6G A;  3PUW A;  1ZKO A;  1GUO A;  1GJX A;  1K8M A;  3W3A A;  4OO1 H;  3IFT A;  1DXM A;  2JXM B;  4OGQ C;  4LJZ C;  1GUN A;  4DK1 A;  3ND8 A;  3OW7 A;  3TZU A;  3L7Z C;  1GUS A;  1H9J A;  3PV0 A;  4PV1 C;  1Q12 A;  1E2W A;  1FR3 A;  1VF7 A;  3RLF A;  1T5E A;  3MXU A;  2QF7 A;  4KKT A;  2D5D A;  2D2C C;  3A7L A;  3H94 A;  3VR4 A;  3VR2 A;  4KI0 A;  2L5T A;  1H9S A;  2YYZ A;  3ND9 A;  3A8K E;  4I7Z C;  2A6E C;  3N6R A;  3M7N A;  4GZY C;  3GD7 A;  3QIA A;  1GUG A;  2K33 A;  3A8J E;  3FPP A;  1VCI A;  1OXT A;  1Y8N B;  1Z6H A;  2JEA I;  1PMR A;  3D4R A;  1H9M A;  2O5I C;  1Q1B A;  2JE6 I;  5KND A;  1GUT A;  2NN6 I;  3FMC A;  3I4L A;  4H44 C;  4KKS A;  1HQM C;  2IT1 A;  3VR5 A;  1Q1E A;  2BA0 A;  2E75 C;  4KHZ A;  1O7L A;  2PNR C;  2V4D A;  1LAC A;  4XTC S;  3P20 A;  2A6E D;  2KCC A;  1Q90 A;  2CW0 C;  1ONL A;  2AUJ D;  3SE0 A;  3M85 A;  1TKW B;  1HTP A;  5BN5 A;  5BN4 A;  1DCZ A;  3IKJ A;  1YNJ C;  4KMU C;  1A6X A;  1H9S B;  2D62 A;  4L8J A;  3VR3 A;  1EWH A;  2EDG A;  1ZYR C;  1K8O A;  1BDO A;  5KNC A;  1H9K A;  4H13 C;  2DN8 A;  1O78 A;  2EJG C;  3I72 A;  2E76 C;  1FYC A;  3BG3 A;  4DK0 A;  3NE5 B;  4IFD H;  1I6V C;  1Y8P B;  3BDO A;  4XIG S;  1LAB A;  3CRK C;  4KN7 C;  3U9S A;  4BA2 I;  4KKU A;  2O5J C;  1H9R A;  1CFM A;  1OXV A;  2AWO A;  5C0X H;  2K7V A;  3T56 B; 
#chains in the Genus database with same CATH topology
 2F0Q A;  4JI6 Q;  1D1K A;  1KLG D;  2UXD Q;  1E3P A;  3HOV H;  1VQ9 A;  4IJL A;  5IIF A;  4GLX A;  2LSS A;  2NVQ B;  1EZ8 A;  5JAV A;  1XNR L;  1ASY A;  4X62 L;  2EYJ A;  5LL6 X;  1PH4 A;  1VMP A;  1ENC A;  3TZD A;  4NXN Q;  2KA7 A;  3VYS A;  1SBB B;  3E0E A;  1BKB A;  4POG A;  1QVF A;  1JJG A;  1CQV A;  3A5U A;  1X3P A;  1IBK Q;  2ICI A;  1UAP A;  2JA6 H;  1F9S A;  1RKN A;  2NTT A;  3GTQ H;  4G7H C;  3CPW A;  5I9O A;  3I91 A;  2L4N A;  1FL0 A;  1ILP A;  1IW7 D;  3RMH A;  1HZ9 A;  5COY A;  1NTG A;  2ZTD A;  1U9R A;  3A8I E;  3L0O A;  4B9W A;  1BNZ A;  4B3S Q;  4BY1 H;  2N49 A;  1Y14 B;  1CM9 A;  4LF7 L;  1QVG A;  4DAM A;  1B44 D;  3LGJ A;  1LT3 D;  5FLX c;  1QNK A;  3K0Y A;  2DUD A;  4PNY A;  5GAE C;  2BE5 D;  2B63 B;  3NHH A;  3CQZ B;  3VYT A;  3F2C A;  1EYC A;  1K8M A;  4FF2 A;  4FXG C;  4LJZ C;  3DLL A;  4HJA A;  1HR0 Q;  3KBG A;  1G2S A;  2K4K A;  1LUZ A;  4WFN 3;  2EY1 A;  2KUM A;  3GTP B;  4GN4 B;  4FF3 A;  4BWG B;  2JA9 A;  4QUC A;  4HCE A;  2HT1 A;  2YYZ A;  2JA7 H;  1C9O A;  3CKI B;  4JI1 Q;  4GZY C;  3A74 A;  5ELO A;  1GUG A;  2Z8L A;  4TVA B;  5BR8 Q;  4RKL A;  2XWJ B;  1CT1 D;  1HFG A;  3OIQ A;  2V1C C;  4C1N I;  2E5L Q;  5AFW A;  1N34 L;  3SK4 A;  2IT1 A;  5C44 H;  4JC0 A;  2RHS B;  5I6Y A;  2Z4I A;  3PF4 A;  4OON A;  1EIF A;  3TQY A;  3GTL B;  1KQS A;  3S15 B;  1WVL A;  1SEB D;  1H9S B;  3CCQ A;  1ET6 A;  2N88 A;  1XNR Q;  3ULJ A;  2VY3 A;  4X62 Q;  5L37 A;  2HHH L;  1EY5 A;  3BDO A;  1WTO A;  4X6A H;  1EEI D;  2XRQ D;  1M90 C;  2EZV A;  2F0U A;  2K7V A;  1W3S A;  1GKH A;  4RG1 A;  1D1I A;  2FXQ A;  1PFB A;  5LL6 S;  3CCJ A;  2FIN B;  3QWN A;  4IUR A;  3D8G A;  5EQ0 A;  3S1M B;  3HKZ G;  4DU9 A;  1E22 A;  1GD7 A;  2X69 A;  1EFW A;  3S16 H;  3RZD H;  3JAM L;  2CFM A;  2A6H C;  1JB3 A;  5LMU L;  4LF7 Q;  1XPR A;  4UP8 A;  3HKZ B;  5DLQ E;  5C4X B;  1TWF H;  1LT5 D;  1UWV A;  1GUW A;  2CWP A;  2A8V A;  2N8N A;  5IGB A;  4QUF A;  4DXG A;  3CD6 A;  1OXX K;  3NP8 A;  4DV0 L;  4BY7 G;  3PO3 G;  2G9D A;  5G3L F;  5DM7 3;  2RA4 A;  3PSI A;  2GA4 B;  1GVP A;  2L1B A;  1STH A;  3HGB A;  2YU9 H;  2XGT A;  5M3F G;  1NCV A;  3SK8 A;  2K32 A;  4BY7 B;  1CZW A;  2NN6 G;  2KCN A;  3PO3 B;  1C0A A;  1P8L A;  1VDZ A;  4IAL A;  5M3F B;  1YNN D;  5CBA E;  1V8Q A;  3NSW A;  4JBW A;  3A55 A;  4J15 A;  3CCM A;  1MD2 D;  1GJX A;  2F0K A;  2QEX A;  4JBK A;  4DK1 A;  4DK6 C;  2WB1 B;  1N34 Q;  3OW7 A;  1I94 L;  3HS0 C;  1XJV A;  2JJQ A;  5IT9 L;  4MIU A;  2Q8R E;  2ZXP A;  3R3O A;  1SAP A;  1TII D;  3JAM c;  2UUA L;  4A3C H;  2L5T A;  1STA A;  2FJ2 A;  2M00 A;  2H5X A;  3MVV A;  1CA6 A;  4FDB A;  3J7Y W;  3HOW H;  4HTH A;  3V96 A;  1L0W A;  1JJC B;  2HHH Q;  1KAW A;  3TDQ A;  2F0G A;  2J7Z A;  3IL8 A;  4LFA L;  3P20 A;  1R9T B;  1DOL A;  1FVI A;  4MNO A;  2NVY B;  4HJ5 A;  4KMU C;  4XYQ A;  1RJT A;  2Y0S E;  1K8O A;  1H9K A;  1RL2 A;  4H13 C;  3J81 i;  4FXD A;  4KD3 A;  4PZ8 A;  3A0J A;  3K5L A;  1I50 B;  3CRK C;  5LMU Q;  1D7Q A;  4AYB E;  4AH6 A;  1G8Z D;  2QCP X;  3BDL A;  1NR2 A;  5IT9 c;  1DJR D;  1YNJ D;  4LW1 A;  1S4Z A;  1PHJ A;  4Y7N H;  2KCM A;  1ZYR D;  4NKL A;  4FYD A;  4JI7 L;  1CI3 M;  5K5P A;  4QY7 A;  4HSP A;  3OWF A;  3STB C;  4YWL A;  3PUY A;  1FGU A;  2L0C A;  2ZM6 Q;  3S1R H;  1O7Y A;  1U4M A;  5NUC A;  4DR5 L;  3FDT A;  4CGY B;  3ER0 A;  3BJU A;  4A3G G;  3KYH C;  3NTI A;  1BCP C;  3RN5 A;  4ALP A;  4LUZ A;  4DR6 Q;  4DGZ A;  1ROD A;  2M9V A;  3I8Z A;  2EXD A;  4GN5 A;  1CTM A;  1I94 Q;  4A3G B;  1Y1V B;  4FVM A;  1LTA D;  3T1Y L;  2UUA Q;  2A68 D;  1EEF D;  1ENF A;  3GTK H;  3FP9 A;  1TWA B;  2WAC A;  1EYG A;  1QG7 A;  5C0X J;  4A3J G;  1FGB D;  4C3H H;  1SYD A;  1S5C D;  5GAG C;  4R4Q A;  3ND8 A;  5JJZ A;  5JPN C;  1J9O A;  3NUC A;  1K3B C;  4QB4 A;  4LFA Q;  2R93 H;  3RLF A;  3BS1 A;  1A8V A;  5E1F A;  2F0N A;  2JYO A;  1U5K A;  4CKE A;  1K83 H;  2D2C C;  1KRS A;  3OHX C;  1A2U A;  3DWP A;  5M5W H;  1L1O B;  1IBM L;  4JI0 L;  1YEZ A;  3FPP A;  1LO5 D;  3Q22 A;  3I4N H;  1EOT A;  2PZW A;  1L2F A;  2ENB A;  4M8A A;  1N8R C;  3GTJ B;  3FMC A;  2K75 A;  3NEM A;  3W1B A;  3H3V H;  4DR7 L;  2PNR C;  4XTC S;  3FHW A;  3S2H B;  2NVQ H;  2EE1 A;  2F4I A;  2XIW A;  3HRZ C;  4JI7 Q;  4R4I A;  3I7F A;  5C4J B;  1XXG A;  1BDO A;  1DYQ A;  1X3F A;  2ALY B;  2HQL A;  3F2B A;  5GAH C;  1AEX A;  5M3M H;  4JOI A;  4DR5 Q;  4F7X A;  1WTQ A;  1K73 C;  4QGU A;  2MUY A;  1SNO A;  3FRP B;  2RSO A;  4GOP C;  2NB0 A;  4RCN A;  1PZI D;  4HMJ A;  1Q8I A;  1IW7 C;  1I4X A;  3CCE A;  1EY9 A;  1YNX A;  1PTO B;  4BXX H;  4OWT B;  4R9W A;  3CQZ H;  4F88 A;  3M4Q A;  1GO3 E;  4APV A;  3I73 A;  1I6H H;  5I6W A;  3G6J B;  4R8N A;  2Z1C A;  2BE5 C;  4UHV A;  1L0X B;  2UUB Q;  1Q86 C;  2PPB C;  3GTP H;  4LWC A;  3H6M A;  4DR1 L;  1JMC A;  1YZ6 A;  2LY7 A;  2AHO B;  3HOX G;  3ITP A;  4WJW A;  1KDA A;  1B9M A;  1IBM Q;  1K3R A;  4K14 A;  3HOX B;  1N33 L;  3RZO B;  3F1Z A;  3CHB D;  1PRT F;  4K6L A;  1HA5 A;  4PQX A;  4X66 L;  2Z6B A;  3W3A A;  5T1G A;  3CF5 A;  4HJ7 A;  4PV1 C;  5IGG A;  4DR7 Q;  5JEA J;  1AP0 A;  2NZH A;  3KBX A;  1B3A A;  1TT2 A;  3CAM A;  2XRS D;  1SN8 A;  5TSS A;  3FPU B;  2SNM A;  1JCK B;  5IP9 G;  1HRJ A;  4I7Z C;  1A3T A;  1JE4 A;  3PO2 G;  5M5X B;  4B3T L;  1VQ6 A;  4QJF A;  4HSV A;  1B3Q A;  4HMI A;  2F4V L;  1ICF B;  2NN6 I;  1V1P A;  2WB1 E;  2JA5 G;  3PO2 B;  1CHP D;  1VQD A;  1HZC A;  4P74 A;  4UAI A;  1RHP A;  4ZKB B;  2F52 A;  4HIK A;  3OSO A;  2JA5 B;  1QIL A;  3KF8 B;  2VL6 A;  4KHP L;  5BN5 A;  1DCZ A;  5C3X A;  3K6O A;  4IUQ A;  4S3S A;  2XNA C;  5CV9 A;  2C35 B;  2DN8 A;  1FNU A;  3TSS A;  4YHH Q;  1Y8P B;  3DWA A;  4KN7 C;  1HTL D;  4ZK9 B;  4A3M G;  5G3L D;  1S40 A;  4PG3 A;  3ZYY X;  4A3M B;  3PUZ A;  5CV5 A;  1CA5 A;  3PO3 H;  3U4Z A;  1EU4 A;  4DR1 Q;  1TS3 A;  2NVT B;  4MN3 A;  4DV4 Q;  5CYU A;  2NN6 H;  1BBX C;  2JN4 A;  1E24 A;  1LLR D;  4X65 Q;  1B9N A;  4DAV A;  3CMA A;  2WP8 J;  2X6L A;  3DM3 A;  1W6J A;  3HKS A;  4ZKC B;  3D31 A;  1TVX A;  5ELD A;  2OEO A;  2E2J H;  1N33 Q;  2MNA A;  4TSS A;  1K28 A;  1YNN C;  3UI2 A;  1M1K C;  3DXJ C;  4IOC A;  2LXK A;  1N36 L;  1EYD A;  4HJ8 A;  2VNU D;  1VF5 C;  4RCO A;  3E9I A;  2K50 A;  1S5F D;  2PNH A;  3TME A;  5LMN L;  3GTO H;  3NWT A;  1LTT D;  3WDN A;  1Q7Y C;  3EIV A;  1GUO A;  1MIU A;  4B3T Q;  1CHQ D;  4OO1 H;  1UNS A;  2F4V Q;  2A19 A;  1PRT B;  3PV0 A;  2F0D A;  2NVY H;  3H3V C;  1T5E A;  1YI2 A;  1VQM A;  3HOZ G;  3VR2 A;  2EXZ A;  4DF7 A;  4KHP Q;  3TEH B;  4CJ0 B;  3I4M G;  3Q24 A;  1TWC B;  2A5H A;  2CKZ B;  2EYF A;  3SK6 A;  3HOZ B;  4FF1 A;  5IOC A;  3J80 E;  1NR4 A;  1BO0 A;  2C9O A;  1KD1 C;  1DON A;  2GVA A;  5C3E G;  2RDG A;  1P16 A;  1JWM D;  1Q1E A;  5DAU A;  5JVH 3;  3HOU G;  2F0J A;  1SLJ A;  2C5C A;  1X54 A;  2A6E D;  1SJH D;  1UE5 A;  3OIP A;  4YCW A;  5C3E B;  4IUT A;  1UE1 A;  1K8A C;  1QB5 D;  2K5N A;  3BZC A;  2Y0S G;  2F0M A;  1PTO D;  3HOU B;  1YNJ C;  1A6X A;  3I2Z A;  4N9T A;  3D4W A;  1ZYR C;  2JQO A;  3H09 A;  4L63 B;  1ASZ A;  4HED A;  1O78 A;  4AYB G;  5C4H A;  1FNW A;  2Y0S B;  2E76 C;  3I4O A;  4DK0 A;  3Q0A A;  1CK1 A;  1SNQ A;  3CME A;  4JI4 Q;  4YCU A;  4K8I A;  1EY0 A;  2MO0 A;  3M4P A;  4GNX B;  3S1Q B;  2CW0 D;  4LFC L;  3K5O A;  3K7A H;  1VQN A;  4AYB B;  5JJK A;  3TRZ A;  1JIC A;  1KHI A;  3T1H L;  2CWA A;  3SVM A;  4A3G H;  1CKO A;  2VQE L;  5KRU A;  1PH1 A;  1IXR A;  1N36 Q;  4ZLT F;  4YWM A;  2E8G A;  2K01 A;  1T5X D;  1HJP A;  4BBR G;  1TWA H;  3AFQ A;  5J3B A;  1XMO L;  5K36 H;  1Q46 A;  1SYG A;  4V0B A;  1EFI D;  2ZJP A;  5LMN Q;  5JJL A;  4P75 A;  1H95 A;  3M3Y B;  2A68 C;  4A3J H;  3MFY A;  2RHQ B;  4V19 0;  1PZK D;  2FMC A;  3GDE A;  1F77 A;  2WAQ E;  5D3I B;  4YY3 L;  4C3J G;  1TY0 A;  3DWQ A;  4IQZ A;  3IAY A;  2UXC Q;  3SXH A;  2KHJ A;  4AQY L;  1NJI C;  4C3J B;  3GTJ H;  3LWU A;  2E2I B;  2R3Z A;  2K14 A;  2R7F A;  4EQ5 A;  1HR0 W;  1TU2 B;  1FD7 D;  1X56 A;  4MZ9 A;  3NTK A;  2R6G A;  1SNC A;  3TS2 A;  2KHS A;  4OGQ C;  3S2H H;  3TP8 A;  2CQA A;  2RF4 A;  3KOJ A;  4KV6 A;  5EJW A;  2ES2 A;  2B2W A;  2O2L D;  2RCF A;  4RGO S;  5M9O A;  1SND A;  2F3I A;  1DOK A;  5C4J H;  4JPB W;  4F87 A;  5E4W C;  4XYO A;  3VR4 A;  2B63 G;  1HHV A;  1QOH A;  3F2U A;  4CDE C;  5JPM C;  2QDB A;  1X3G A;  1YVC A;  1QUQ A;  3S17 B;  3CP0 A;  2Z9H A;  3F2D A;  1N9W A;  4K8J A;  1C8C A;  3VR5 A;  4LFC Q;  1B8A A;  1O7L A;  1T9H A;  3BYY B;  1JWS D;  2ICE C;  3T1H Q;  3CC7 A;  3RR5 A;  2IHF A;  4Q5V A;  3UE0 A;  2VQE Q;  1KAB A;  3MTS A;  4QF4 A;  1PTO H;  3NQT A;  3VDY A;  4O2D A;  4JI2 L;  4UDU C;  3PQI A;  5M5Y H;  3X3M A;  1LTG D;  3KLS X;  1XMO Q;  3BDC A;  3ZJY C;  1YHB A;  4NXM L;  1WTH A;  1G91 A;  1RD9 D;  2Z0S A;  1RCV D;  4XT3 B;  2B8F A;  4BA1 I;  3QG1 A;  2RQX A;  1XMQ L;  1STY A;  1PA6 A;  2FMM A;  2HDM A;  3E9H A;  1NUC A;  3Q23 A;  4IFD G;  4YY3 Q;  3VYU A;  3NWS A;  3HOX H;  1NBW A;  4OL7 A;  3RZO H;  5ELN A;  1PRT D;  1G2T A;  4K2L A;  4AQY Q;  2ZXO A;  4JK1 C;  4DV2 L;  1N32 L;  2B8G A;  2VQF L;  1IYU A;  2QW7 A;  4C3I H;  1BBU A;  4IN3 A;  2KVM A;  1WD1 A;  2F3V A;  3TBI B;  2M2L A;  1TWH B;  2BDO A;  3AU7 A;  3F8T A;  5C4X G;  3KLS A;  2Q8T A;  4ZRZ A;  1D8L A;  4ZCK A;  2F0L A;  3GTG B;  5IP9 H;  1SMY D;  1PH2 A;  1IYV A;  1OXU A;  4FO2 A;  3KJP A;  3PO2 H;  2IX0 A;  1SR3 A;  2PO4 A;  1HH2 P;  1OO9 B;  3PIO A;  1WYD A;  3SHL A;  3DM1 A;  3RD4 A;  1K0R A;  5T1I A;  2JA5 H;  1Q12 A;  2N55 A;  1E2W A;  2B29 A;  2B2U C;  4XQQ A;  3MXU A;  1M8A A;  3E5S A;  1V1O A;  5KYL A;  2L55 A;  2O4X A;  3H94 A;  4XDX A;  2PZT A;  5FO9 B;  1EIG A;  3GD7 A;  2K52 A;  1QUQ B;  3AMU A;  1VQB A;  4ABN A;  5DEH A;  2WB1 G;  4JI2 Q;  4IPH A;  2KEN A;  5IYC G;  5FKA C;  3J80 L;  4A3M H;  2E75 C;  3H0G G;  3HOY G;  1PYW D;  4NXM Q;  2I5H A;  3R2I A;  1J8I A;  2Z4H A;  5C4Z A;  1VQ8 A;  1EY4 A;  4ULL A;  1WD0 A;  4BBS H;  3I70 A;  4GLA C;  3H0G B;  5BN4 A;  3HOY B;  3PCO B;  3K57 A;  1XMQ Q;  2NBF A;  4NDX A;  1I4H A;  1D2B A;  1EY8 A;  2K03 A;  4F8M A;  4LUV A;  1EL0 A;  4XIG S;  4C56 C;  1LT4 D;  3H91 A;  3K59 A;  4MTN A;  1Y1W H;  1CFM A;  1JE5 A;  1I4Q A;  1WCM B;  4A3B G;  2LFN A;  1WTR A;  4DV2 Q;  5EGT A;  2QEJ C;  1N32 Q;  2VQF Q;  4N8X 1;  4ZQ3 A;  3EQL C;  3ERQ A;  2LS0 1;  4KD4 A;  1E7Z A;  3E6Z X;  4A3B B;  2NYZ D;  3E0J A;  1MJE A;  1SXT A;  1XTC D;  5I2X A;  1YJ9 A;  1VS0 A;  1VQP A;  3BVZ A;  1JT8 A;  2RDH A;  1L1O C;  3Q6S A;  4K6D A;  2SOB A;  1EOV A;  2KEC A;  1X9N A;  1EIH A;  1E2V A;  3UDF A;  2PQA A;  2BDN A;  2JA8 G;  3J80 c;  1SYF A;  4B9X A;  3EBE A;  4CJ1 B;  3UDX A;  3X3N A;  2R7D A;  2JSO A;  5CC4 A;  1SNM A;  4I65 A;  4LAA A;  2XTI A;  3VA7 A;  3HZX A;  2RKS A;  2JA8 B;  4IPG A;  2DY8 A;  2H1E A;  4IUP A;  1S5E D;  3U4V A;  1NMF A;  1Y69 U;  4DV0 Q;  4R8I A;  1HZB A;  4J1M A;  1TWC H;  1ZXT A;  1WTP A;  3K58 A;  3WOE A;  3FEW X;  1DZ1 A;  1SMX A;  3B6Y A;  3I4M H;  1A3V A;  3EVQ A;  4HCS A;  4C2M H;  3PUW A;  1AW7 A;  1TWG B;  4B3M L;  1S5D D;  1JOQ A;  1X55 A;  1VQ7 A;  1Y1V G;  2P5Z X;  1TS4 A;  4JW0 A;  1S72 A;  2R7Z B;  4EGV A;  1UE7 A;  5J22 A;  1EWC A;  4XQJ A;  5CV4 A;  2L12 A;  1VQE A;  1SE2 A;  1NNX A;  2A6E C;  1FJG L;  3MAQ A;  5CR3 A;  3S1Q H;  3A8J E;  1NY4 A;  4MTK A;  1PTO C;  1X3Q A;  3FVQ A;  4G4K A;  5LHY 1;  1GUT A;  1PV4 A;  4OX9 L;  3E3X A;  4IPD A;  2XVS A;  1F9R A;  3MXN A;  4K5X A;  1WTX A;  2F0P A;  2CW0 C;  4RMF A;  5FO7 B;  5ELE A;  2AUJ D;  1JB7 A;  2F0I A;  2PW7 A;  1VQO A;  2KBN A;  4HAE A;  3L3O C;  2PZU A;  1KDB A;  2WKD A;  2VXW A;  2D0O A;  5KNC A;  2BH2 A;  2EJG C;  1K0S A;  4A93 H;  2I07 B;  2AMC B;  4BBR H;  1LAB A;  5CBE E;  2I5M X;  2RDF A;  4KKU A;  1A3U A;  1EUJ A;  1Q3L A;  3TN2 A;  3T56 B;  1PYS B;  2DJG C;  4PZ6 A;  2PMZ E;  1PH3 A;  2HIX A;  2RCN A;  3MXP A;  5E4X A;  4CDC C;  1EIY B;  5ELF A;  4EQO A;  3WOF A;  1MHW C;  4H0L C;  1EQT A;  2IL8 A;  2EY5 A;  1E1T A;  4C3J H;  3Q8D A;  2PQA B;  3A56 A;  4L6T B;  3J7A V;  1UE6 A;  3OW2 A;  4RA8 A;  4KY6 A;  5E3F A;  3VA5 A;  4MHE A;  4DV3 L;  2ZXR A;  4GLV B;  4TQU S;  4HJ9 A;  2JA6 B;  5JJI A;  3MXG A;  4XT1 B;  1F2M A;  4B3M Q;  1BOS A;  2NZO A;  1KNE A;  2WAQ G;  4GOP A;  5C3W A;  3GTM B;  2MPM A;  1EWI A;  4N9P A;  4RHR A;  1E1O A;  3PUX A;  1U0L A;  1WOC A;  1KDC A;  2WAQ B;  5C5M A;  3NEN A;  2OTL A;  3S1N B;  3P1H A;  5CV8 A;  1AE2 A;  2SEB D;  1DGS A;  5IGD A;  3KJO A;  2B63 H;  1FJG Q;  4A3K G;  2QIL A;  3T1Y Q;  3G6E A;  2EVB A;  5KIX A;  3UDG A;  4IFD I;  3IFT A;  2CQO A;  4IOA A;  4OX9 Q;  1F2L A;  3L7Z C;  4A3K B;  4OEM B;  1JOK A;  1RIP A;  1YHA A;  2E2D C;  3D3R A;  4A3I G;  3CCR A;  2R92 G;  3MHB A;  3QOJ A;  4ID6 A;  2HDL A;  5HUR A;  4IJH A;  1L0Y B;  1WTW A;  3A8K E;  3M9B A;  4A3I B;  1O80 A;  3N52 A;  1BF4 A;  4A3F G;  5IYB G;  5D65 A;  2R92 B;  2EOT A;  4QQB X;  1X32 A;  2EYL A;  4JI0 Q;  5KND A;  1HNZ L;  3MXN B;  1K9M C;  1HQM C;  4A3F B;  4ZUI A;  4DFA A;  5CV6 A;  5EPK A;  3QO2 A;  1CSP A;  1JQY D;  4RWS C;  3PF5 A;  2B39 A;  3GTL H;  1PZJ D;  3S15 H;  3G7L A;  3UDI A;  1TKW B;  2Q2I A;  4KTA A;  5CV7 A;  3CW2 C;  4DR3 L;  1HA6 A;  4A75 A;  3J7A F;  1A2T A;  4KY7 A;  5ELC A;  3NBH A;  5EBC A;  3CCV A;  1VQH A;  4KK7 A;  1STG A;  4PMC A;  5IY0 A;  3BG3 A;  1C7Y A;  4IFD H;  3TP6 A;  3G48 A;  2MGS A;  4P72 A;  4JI5 L;  1ICW A;  3NTH A;  2CVR A;  1PYB A;  1AZP A;  3NPP A;  3R8B A;  3UE1 A;  4DV3 Q;  2B2V C;  3MA2 B;  3S1M H;  1QWY A;  4LUO A;  2HD3 A;  4DKA C;  2B2Y A;  4RGT A;  4NW2 A;  1LTB D;  2F0S A;  4CHT B;  3KUP A;  1IKL A;  1BXT A;  4E6I A;  1KXL A;  2YTY A;  2UUC L;  1BR9 A;  4RH6 A;  5C4X H;  5C0X G;  1RDP D;  1PLF A;  1HPC A;  1YIJ A;  4LF6 L;  1TWF B;  1S3O A;  1EZ6 A;  4CKB A;  2X6G A;  2ZT9 C;  5FO8 B;  1UUP A;  4ODG A;  1SMY C;  1S5B D;  3D6C A;  4ZAI A;  1QVC A;  2IJ0 A;  3A7A B;  4LNQ A;  2Z6K C;  3U50 C;  4BY7 H;  1X65 A;  4OEL B;  2B2T C;  1U4R A;  3K8A A;  2K5W A;  2WV6 D;  1RF2 D;  5M3F H;  1QNU A;  2YTX A;  1JJ2 A;  4G7O C;  2AQ2 B;  4GNX C;  3BYT B;  3JAM i;  4A3L G;  1DXM A;  1HNZ Q;  3EFX D;  5IYC H;  4WJ3 M;  1VQ5 A;  3WWV A;  2KOL A;  4O42 A;  4X66 Q;  3EN2 A;  1VQL A;  3H0G H;  3HOY H;  1B70 B;  3DEP A;  5C6A A;  3ND9 A;  5AJ3 L;  4DR3 Q;  1SRO A;  2QDL A;  1NAP A;  1ESF A;  4KKS A;  1LTS D;  1TR5 A;  4Z9C B;  4XQN A;  1R9T H;  4KY5 A;  1TQO A;  4A3B H;  4CDD C;  3J80 i;  3NBH B;  3AYH B;  4JV5 L;  1LYL A;  2AWN A;  4DR2 L;  1F2Z A;  1FYC A;  1I50 H;  1KL9 A;  1RTO A;  1V1Q A;  3SEB A;  4P2C B;  1V1P B;  1OXV A;  2UUC Q;  3NEL A;  2AWO A;  5H1S E;  3BVM A;  3HFZ B;  2JA8 H;  1EQV A;  4LF6 Q;  4OWW B;  4WOR A;  1WJJ A;  3RLO A;  1F2Y A;  4X3U A;  4N8F A;  4GS3 A;  2CH4 A;  3T53 B;  1OXS C;  1IL8 A;  1QJO A;  1KRT A;  5LMN W;  4DUY L;  3PUV A;  1SJE D;  2NVX B;  2VZA A;  5EBD A;  1TWG H;  2F0W A;  3K7U C;  3P7J A;  2WIN B;  2Q2T A;  4IPC A;  1I3Q B;  5D3D A;  2RSN A;  4Q0F A;  4H7B A;  2PCF B;  2CHB D;  2AKW B;  5JEA G;  4B3S L;  1E2Z A;  1Y1V H;  4WJ4 A;  5HGQ A;  3QJY A;  2Q2U A;  4DNT B;  3S2D B;  2K5Q A;  2OCE A;  2EJM A;  4R4O A;  1KLU D;  3GP7 A;  3CC2 A;  1I4G A;  3K5N A;  1BQQ T;  1JC7 A;  1HQR D;  2L9H A;  3JC6 6;  4JI8 L;  1KAA A;  3GTK B;  5D14 A;  4K5V A;  1Z9F A;  1YHQ A;  1B4O A;  1XX8 A;  3ONA B;  1GUN A;  5GRO A;  3NK9 A;  1D6E C;  1VQA A;  4DUZ L;  3U58 A;  4DK3 C;  2R93 B;  5DM6 3;  4JCV E;  5EAY A;  4RHS A;  4TRD A;  1O7Z A;  3RLN A;  1K83 B;  1H9S A;  4XXE A;  3V05 A;  1WTV A;  3KF6 A;  4DNI A;  1STE A;  4JV5 Q;  1A62 A;  3CXC A;  4DR2 Q;  2WII B;  2JEA I;  3S9W A;  1H9M A;  2EYP A;  2JE6 I;  4RKB A;  4HIO A;  1I4P A;  3I4N B;  3I4L A;  4YCV A;  1U4L A;  2IY5 B;  2RVL A;  1XWE A;  1KNA A;  3M85 A;  4CKC A;  5IYD G;  5A2Q L;  1LTL A;  1B53 A;  3IKJ A;  2IX3 A;  4IO9 A;  4L8J A;  3VR3 A;  4DXF A;  1EWH A;  5M3M G;  1O7I A;  5CGK A;  4DUY Q;  5KGU A;  5M3M B;  2MJ8 A;  1SFO B;  2E2H B;  1PH6 A;  1R4Q B;  3KDF A;  4UP9 A;  5IGC A;  3GTM H;  3OOC A;  2B2W C;  2MQH A;  1JR0 D;  4IUN A;  4OXP A;  4LK1 C;  4B3R L;  2PMZ B;  2OTJ A;  2DNC A;  3AB9 A;  5IGE A;  4UY8 C;  4L5Q A;  4BXX G;  3CC4 A;  3S1N H;  5FLM G;  1HUM A;  1CUK A;  3CCL A;  3M4Y A;  3D6W A;  4HIM A;  4NPS A;  4P71 A;  1K8G A;  1MSG A;  1ET9 A;  2A69 D;  1NSN S;  2GVB A;  1YIT A;  1GHJ A;  4DAY A;  4A3D G;  1QE6 A;  4X64 L;  1PH5 A;  4JI8 Q;  4A3K H;  4KJO A;  4R4C A;  1I6H B;  3O13 A;  2ZJR A;  4O1N A;  1HNW L;  2VUM G;  2LMC B;  4NP5 A;  1IKM A;  4A3D B;  2K05 A;  4DUZ Q;  3GV6 A;  4A3I H;  3TRE A;  2VUM B;  4K0K L;  2PI2 E;  2ID0 A;  2R92 H;  2JP1 A;  2VB2 X;  1XTD A;  2K04 A;  1PH8 A;  4WRD A;  4Y52 H;  4FNF A;  4X3S A;  3RN2 A;  1KC8 C;  1D5X C;  1I4R A;  4A3F H;  1CKM A;  5IYB H;  4JYA L;  3S14 B;  4LF8 L;  1XPO A;  1U4P A;  2OQK A;  1GUS A;  4K2K A;  3IFD A;  3SK5 A;  1XYI A;  1PFS A;  1GM5 A;  5C0X I;  4QIW B;  2OWO A;  1A63 A;  2QF7 A;  1VQG A;  5C5L A;  4L5S A;  3OMG A;  3KF6 B;  5M5X H;  3M7N A;  5HY6 A;  2OQ0 A;  4DR4 L;  3OWE B;  2G5D A;  1VCI A;  3CU7 A;  1OXT A;  3J81 j;  3D4R A;  1DOM A;  4DV5 L;  3GO5 A;  3L2P A;  1VQI A;  1PFM A;  2EQS A;  4ZYS A;  1ZEQ X;  2V4D A;  4KHZ A;  4NB3 A;  5KEE A;  2CCZ A;  1IYJ B;  2B2U A;  1XPU A;  2KCC A;  4LF9 L;  1VQF A;  4B08 A;  4EX5 A;  2IPK D;  1J6Q A;  1HTP A;  2NUC A;  1GXD C;  4B3R Q;  5JVG 3;  3LX0 A;  2YV5 A;  3BZK A;  5IP7 G;  4KLK A;  4JI3 L;  1PH9 A;  3S24 A;  2ATW A;  2FHT A;  1BVS A;  4U67 3;  1AZQ A;  2HUG A;  5EPL A;  4KHV A;  1LM0 A;  4BS9 A;  3BZD B;  1SYE A;  3KDF B;  5C0X H;  3TP5 A;  4X64 Q;  2EJF C;  3K5M A;  1Z47 A;  4JBM A;  2F1M A;  3FKI G;  2ZM6 L;  4OHJ A;  1HNW Q;  1ENA A;  1SRU A;  5IOD A;  2NVT H;  1MSH A;  1BUV T;  2Q8I B;  3M4O B;  3FKI B;  4LFB L;  1LTI D;  4K0K Q;  1WCM G;  4OIJ A;  4DAY B;  2J4X A;  2YTV A;  5J39 A;  4DR6 L;  1C4Q A;  1G6Z A;  1YBY A;  3T51 B;  2E2J B;  4JYA Q;  2HCC A;  1A15 A;  2OT2 A;  4X3K A;  4LF8 Q;  4UPA A;  4A3E G;  4YIJ A;  4A3L H;  1HFN A;  5KYI A;  4X3T A;  1GHK A;  2G9H D;  1EQQ A;  1ML0 D;  2MFI A;  5GAD C;  1CQF A;  4IUU A;  4A3E B;  3T13 A;  2D9U A;  5I2Y A;  1L1O A;  2IW3 A;  3MFG A;  4EVO A;  4FP5 D;  4OO1 G;  1MJC A;  3GTO B;  3SDZ A;  4DR4 Q;  3M7G A;  1SYC A;  3C46 A;  4PZ7 A;  5EPJ A;  2D0P A;  4DV5 Q;  2JXM B;  1ILQ A;  1MBY A;  1VF7 A;  1UEB A;  3HEJ A;  1VQC A;  2B3G A;  2PW5 A;  5IWA L;  4HID A;  1NE3 A;  3OTO L;  2D5D A;  4LF9 Q;  4L5R C;  4J8Q A;  5FK9 C;  3N6R A;  1F9P A;  3HOZ H;  1STN A;  1SNP A;  4JI3 Q;  2N78 A;  1Z6H A;  3DMU A;  4DV1 L;  2KEE A;  1QZG A;  1BCP F;  3AFP A;  2R7Z G;  4C1N K;  5ELB A;  3KFU A;  3J81 E;  3C1F A;  1D5M C;  5C3E H;  4O0A A;  1AN8 A;  2NTS A;  3L9A X;  1Q90 A;  1IBL L;  1CKN A;  1LTR D;  3HOU H;  1EYA A;  3J7Z C;  2J0T D;  2MP1 A;  1W2B A;  1PH7 A;  1PTO F;  2XWB B;  4EQN A;  2EY6 A;  2F3W A;  2NVX H;  2OXP A;  2F0H A;  5J1Z A;  4LFB Q;  1H9R A;  4M1U B;  1I3Q H;  4RGN A;  4KJN A;  3PIO 3;  3K7A B;  1STB A;  1EY6 A;  2PQE A;  4RGM A;  5FJ8 G;  4KN4 C;  2HQE A;  1TXY A;  3H3V I;  1V43 A;  3AQQ A;  3S2D H;  4QMG A;  5JEA H;  3P75 A;  3CCU A;  5K36 G;  2EPB A;  3OPO A;  1Z7T A;  3I3C A;  4NMZ A;  2UXB L;  3KK7 A;  5F2D A;  2EIF A;  1HCZ A;  3MZ5 A;  1SSO A;  2AUK A;  2ZJQ A;  1I5F A;  3SR1 A;  1WI5 A;  2HCI A;  1HZA A;  4L5T A;  5A35 A;  3VR6 A;  5BN3 A;  2UUB L;  4GKK L;  3M3Y H;  1KIX A;  4GN3 B;  3A54 A;  3NQI A;  1E0B A;  3HOV G;  4HR7 B;  2GN5 A;  4A3J B;  1DM0 B;  2K5H A;  1D5Z C;  3HG9 A;  1AFP A;  4GKJ L;  3QOL A;  3HOV B;  4QL5 A;  5IWA Q;  3OTO Q;  3KLR A;  1HNX L;  4FF4 A;  2BCO A;  2E2I H;  4CJ2 C;  2F0E A;  1MGS A;  2JA6 G;  2PI2 A;  4LF5 L;  4YWK A;  4DV1 Q;  3ULL A;  3K0X A;  2EYM A;  2K5D A;  2PYK A;  3ERS X;  3GTQ B;  3T16 A;  1FR3 A;  4BY1 G;  3D4D A;  1LT6 D;  2F03 A;  3KF8 A;  2KED A;  4LF4 L;  5I4D A;  1IBL Q;  3A7L A;  1FNV A;  2NZ1 D;  4DA2 A;  4PMW A;  3ICE A;  4BY1 B;  5IYD H;  3GV3 A;  4JVZ A;  1SE4 A;  1BBW A;  4IZ8 A;  2K33 A;  4AIM A;  3S17 H;  1J5E L;  3LWE A;  1Y8N B;  1SFO H;  2E2H H;  1PXU A;  2O5I C;  1Q1B A;  3C1E A;  3URY A;  1VQ4 A;  2TMP A;  1B7Y B;  5DNF A;  1IL2 A;  1BCP B;  4JOI C;  4DV7 L;  4EQP A;  3MEH A;  1G6P A;  2OF1 A;  2JK8 A;  2WFW A;  4U68 A;  4QIW E;  1CKN B;  2RBM A;  3C3L A;  5IGF A;  2LXJ A;  1ONL A;  4ME3 A;  2JA7 G;  2MO1 A;  1SE3 A;  4YHH L;  2D62 A;  2SDF A;  5FLX E;  3KLW A;  3I56 A;  4RFB A;  3V2T A;  2XSC A;  3I72 A;  5FLM H;  3DHQ A;  1VQJ A;  2UXB Q;  3NE5 B;  2JA7 B;  5M5Y B;  1SYB A;  3D0F A;  1EQR A;  5C44 G;  2O5J C;  1PVO A;  3RUZ A;  3BVG A;  1A0I A;  2F0O A;  4A3D H;  4GKK Q;  5C44 B;  1PFN A;  2BA1 A;  4DAP A;  5A2Q E;  2A69 C;  4DNR B;  2KJX A;  4DV4 L;  1ESR A;  2VUM H;  2EYO A;  1XNQ L;  2F0V A;  2K5V A;  3PIP A;  4P73 A;  3QB3 A;  4G57 A;  4X65 L;  4OWX B;  3K80 C;  1KTK A;  1Q81 C;  4GKJ Q;  2DGY A;  3HKZ E;  5E7N A;  5EKK A;  3I55 A;  1M4V A;  2TSS A;  3S14 H;  5HGT A;  1C48 A;  1AH9 A;  2AQ1 B;  2FFK B;  3GQB A;  1HNX Q;  3CRL C;  3RNU A;  4C3I G;  2HIV A;  4J6H A;  3H15 A;  4LF5 Q;  4QCL A;  2QKI C;  1LV9 A;  2B2V A;  1PRT C;  1G29 1;  4C3I B;  3CCS A;  2BOS A;  2A6H D;  1TWH H;  2UU9 L;  3BU2 A;  2ZTC A;  2QGQ A;  2L15 A;  3IRB A;  4R4T A;  5FOB B;  2H4O A;  4LF4 Q;  3GTG H;  3VYR A;  2A74 C;  2BH8 A;  1HXY D;  2VS1 A;  4R1J A;  4FXK C;  3S16 B;  3RZD B;  5COR A;  3R93 A;  2DJF C;  2LKV A;  1YJW A;  1B50 A;  4G7Z C;  1J5E Q;  2I46 A;  2ZTE A;  3I90 A;  3TZU A;  4A76 A;  1H9J A;  4DPG A;  3MEF A;  4DV7 Q;  4GOP B;  2F0T A;  2MHV A;  1VQK A;  1SE8 A;  2Z6K A;  1AE3 A;  2B2Y C;  2B2T A;  2F0F A;  2EY2 A;  2YU9 B;  1VMC A;  4KI0 A;  1B2T A;  1R4P B;  1TY2 A;  5IP7 H;  1PMR A;  1PDQ A;  1NMG A;  1QCB D;  2NWG A;  1OTC A;  2WKC A;  4DV6 L;  4GNX A;  1GOZ A;  2I5L X;  4H44 C;  1X6O A;  4RAU C;  4ME5 A;  4BBS G;  4UP7 A;  1G51 A;  4OO1 I;  4A3C G;  3K81 C;  3DEO A;  3J81 L;  3EA6 A;  3W5O A;  4K5W A;  4BBS B;  2N3S A;  3M4O H;  3FKI H;  3PGZ A;  4DN4 M;  4JI4 L;  1XNQ Q;  3HOW G;  1Y1W G;  3OMC A;  1I6V C;  3U9S A;  5JOB A;  1QZH A;  4BA2 I;  2VB3 X;  3HOW B;  1WCM H;  1YJN A;  4CBV A;  1Y1W B;  3TS0 A;  1HUN A;  3R2T A;  3SGI A;  4JI5 Q;  3C2P A;  2VW9 A;  2K6A A;  1EY7 A;  5EKI A;  4A3E H;  1Q8K A;  1SDF A;  3JAM E;  2R61 A;  4ILW A;  3TP7 A;  2UU9 Q;  2I0Q A;  4TKO B;  2XN9 C;  3EJI A;  2JEB I;  2DNE A;  1CZG A;  3G4S A;  3ERO A;  2E74 C;  3LNN A;  3W2D A;  3CPF A;  1WFQ A;  2IHE A;  2Q2H A;  5CMD A;  2DY7 A;  4ZUJ A;  4JI6 L;  1JOO A;  2UXD L;  4JBJ A;  3T4A C;  3STB D;  2ASB A;  2A73 B;  4JG2 A;  1Y8O B;  3U9O A;  1JWU D;  3QR8 A;  3DUZ A;  3J81 c;  1X3E A;  2IWH A;  4Y7N B;  2UXC L;  1F9Q A;  2KHI A;  3NBI A;  3PIP 3;  2IX1 A;  5KNB A;  4NXN L;  5IE8 A;  4IFD J;  3PMF A;  2KCT A;  5GQO A;  2KQ3 A;  3NXW A;  4PMB A;  3S1R B;  1DD2 A;  1BCP D;  1IBK L;  1TS5 A;  3I4M B;  3OYY A;  1ZKO A;  4C2M B;  1CSQ A;  5IT9 E;  4DV6 Q;  1MI2 A;  2L11 A;  2R7Z H;  3ULP A;  2SNS A;  3A5Z B;  4OIK A;  2K1B A;  5EKL A;  5I9P A;  5ISR A;  3J7A 5;  4KKT A;  1W6K A;  4HN7 A;  3QIA A;  4A4I A;  4C3H G;  1EU3 A;  5AJ3 Q;  1Q82 C;  1MKH A;  3MC0 B;  2QA4 A;  1B1Z A;  1HR0 L;  1IHZ A;  1TS2 A;  1IZ6 A;  3G71 A;  2R93 G;  2BA0 A;  4C3H B;  1LAC A;  3W1G A;  1UEA B;  2AQ3 B;  3HP3 A;  3MWY W;  3AEV A;  2K28 A;  3SE0 A;  5FJ8 H;  4LMQ D;  2CH4 W;  4JI1 L;  4A93 G;  4POF A;  2EDG A;  5BR8 L;  1II3 A;  2A1A A;  3I4N G;  1RTN A;  2E5L L;  5M5W B;  5FLX L;  4A93 B;  4CDF C;  1JOR A;  1V9P A;  4BBR B;  2EYH A;  4IUV A;  4H02 A;  4I7A A; 
#chains in the Genus database with same CATH homology
 2F0Q A;  1D1K A;  1KLG D;  5IIF A;  2NVQ B;  1EZ8 A;  5JAV A;  2EYJ A;  5LL6 X;  1VMP A;  1ENC A;  3TZD A;  2KA7 A;  3VYS A;  1SBB B;  1CQV A;  1X3P A;  2ICI A;  1UAP A;  1F9S A;  1RKN A;  2NTT A;  4G7H C;  5I9O A;  3I91 A;  2L4N A;  1ILP A;  1IW7 D;  3RMH A;  5COY A;  1U9R A;  3A8I E;  4B9W A;  1BNZ A;  1CM9 A;  1B44 D;  1LT3 D;  1QNK A;  3K0Y A;  4PNY A;  2BE5 D;  2B63 B;  3NHH A;  3CQZ B;  3VYT A;  1EYC A;  1K8M A;  4FF2 A;  4FXG C;  4LJZ C;  3KBG A;  1G2S A;  4WFN 3;  2EY1 A;  2KUM A;  3GTP B;  4FF3 A;  4BWG B;  4QUC A;  4HCE A;  2YYZ A;  3CKI B;  4GZY C;  1GUG A;  2Z8L A;  4RKL A;  2XWJ B;  1CT1 D;  1HFG A;  3OIQ A;  4C1N I;  5AFW A;  3SK4 A;  2IT1 A;  5I6Y A;  2Z4I A;  3GTL B;  3S15 B;  1WVL A;  1SEB D;  1H9S B;  1ET6 A;  2N88 A;  1EY5 A;  3BDO A;  1WTO A;  1EEI D;  2XRQ D;  2EZV A;  2F0U A;  2K7V A;  1D1I A;  1PFB A;  5LL6 S;  2FIN B;  3QWN A;  4IUR A;  3D8G A;  5EQ0 A;  3S1M B;  4DU9 A;  2X69 A;  3JAM L;  2A6H C;  1JB3 A;  3HKZ B;  5C4X B;  1LT5 D;  1GUW A;  5IGB A;  4QUF A;  4DXG A;  1OXX K;  3NP8 A;  2G9D A;  5G3L F;  5DM7 3;  2RA4 A;  2GA4 B;  2L1B A;  1STH A;  3HGB A;  1NCV A;  3SK8 A;  2K32 A;  4BY7 B;  1CZW A;  2NN6 G;  2KCN A;  3PO3 B;  1VDZ A;  4IAL A;  5M3F B;  1YNN D;  5CBA E;  1V8Q A;  3NSW A;  4JBW A;  3A55 A;  1MD2 D;  1GJX A;  2F0K A;  4DK1 A;  2WB1 B;  3OW7 A;  3HS0 C;  5IT9 L;  4MIU A;  2Q8R E;  2ZXP A;  3R3O A;  1SAP A;  1TII D;  2L5T A;  1STA A;  2FJ2 A;  2M00 A;  3MVV A;  1CA6 A;  3J7Y W;  4HTH A;  3V96 A;  3TDQ A;  2F0G A;  2J7Z A;  3IL8 A;  3P20 A;  1R9T B;  1DOL A;  2NVY B;  4KMU C;  4XYQ A;  1RJT A;  1K8O A;  1H9K A;  4H13 C;  4FXD A;  4KD3 A;  3K5L A;  1I50 B;  3CRK C;  1G8Z D;  2QCP X;  3BDL A;  1NR2 A;  1DJR D;  1YNJ D;  1S4Z A;  1ZYR D;  4NKL A;  4FYD A;  1CI3 M;  5K5P A;  4HSP A;  3OWF A;  3PUY A;  2L0C A;  1O7Y A;  1U4M A;  5NUC A;  3FDT A;  4CGY B;  3NTI A;  1BCP C;  4DGZ A;  1ROD A;  2M9V A;  3I8Z A;  1CTM A;  4A3G B;  1Y1V B;  4FVM A;  1LTA D;  2A68 D;  1EEF D;  1ENF A;  1TWA B;  2WAC A;  1QG7 A;  5C0X J;  1FGB D;  1SYD A;  1S5C D;  5JJZ A;  5JPN C;  3ND8 A;  1J9O A;  3NUC A;  4QB4 A;  3RLF A;  3BS1 A;  5E1F A;  2F0N A;  2JYO A;  4CKE A;  2D2C C;  3OHX C;  1A2U A;  3DWP A;  3FPP A;  1LO5 D;  3Q22 A;  1EOT A;  2PZW A;  2ENB A;  4M8A A;  3GTJ B;  3FMC A;  2PNR C;  4XTC S;  3S2H B;  2EE1 A;  2F4I A;  2XIW A;  3HRZ C;  5C4J B;  1XXG A;  1BDO A;  1DYQ A;  1AEX A;  4F7X A;  1WTQ A;  2MUY A;  1SNO A;  3FRP B;  2RSO A;  2NB0 A;  4RCN A;  1PZI D;  4HMJ A;  1Q8I A;  1IW7 C;  1I4X A;  1EY9 A;  1PTO B;  4R9W A;  4F88 A;  3I73 A;  5I6W A;  3G6J B;  4R8N A;  2Z1C A;  2BE5 C;  1L0X B;  2PPB C;  3H6M A;  2LY7 A;  3ITP A;  4WJW A;  1KDA A;  1B9M A;  4K14 A;  3HOX B;  3RZO B;  4PQX A;  3CHB D;  1PRT F;  4K6L A;  1HA5 A;  3W3A A;  5T1G A;  4PV1 C;  5IGG A;  5JEA J;  1AP0 A;  3KBX A;  1B3A A;  1TT2 A;  2XRS D;  5TSS A;  3FPU B;  2SNM A;  1JCK B;  1HRJ A;  4I7Z C;  1A3T A;  1JE4 A;  5M5X B;  4HSV A;  4HMI A;  2NN6 I;  1V1P A;  3PO2 B;  1CHP D;  4UAI A;  4ZKB B;  1RHP A;  3OSO A;  2JA5 B;  1QIL A;  5BN5 A;  1DCZ A;  5C3X A;  3K6O A;  4IUQ A;  4S3S A;  2XNA C;  5CV9 A;  2DN8 A;  1FNU A;  3TSS A;  1Y8P B;  3DWA A;  4KN7 C;  1HTL D;  4ZK9 B;  5G3L D;  3ZYY X;  4A3M B;  3PUZ A;  5CV5 A;  1CA5 A;  1EU4 A;  1TS3 A;  2NVT B;  4MN3 A;  5CYU A;  2NN6 H;  1BBX C;  1LLR D;  4DAV A;  1B9N A;  2WP8 J;  2X6L A;  1W6J A;  4ZKC B;  3D31 A;  1TVX A;  5ELD A;  2OEO A;  4TSS A;  1YNN C;  3UI2 A;  3DXJ C;  1EYD A;  2VNU D;  1VF5 C;  4RCO A;  1S5F D;  3TME A;  3NWT A;  1LTT D;  3WDN A;  1GUO A;  1CHQ D;  4OO1 H;  1UNS A;  1PRT B;  3PV0 A;  2F0D A;  3H3V C;  1T5E A;  3VR2 A;  2EXZ A;  4DF7 A;  4CJ0 B;  3Q24 A;  1TWC B;  2A5H A;  2EYF A;  3SK6 A;  3HOZ B;  4FF1 A;  5IOC A;  3J80 E;  1NR4 A;  1BO0 A;  2C9O A;  1DON A;  2RDG A;  1JWM D;  1Q1E A;  5DAU A;  5JVH 3;  2F0J A;  2C5C A;  2A6E D;  1SJH D;  3OIP A;  5C3E B;  4IUT A;  1QB5 D;  2F0M A;  1PTO D;  3HOU B;  1YNJ C;  1A6X A;  4N9T A;  3D4W A;  1ZYR C;  3H09 A;  4L63 B;  4HED A;  1O78 A;  5C4H A;  1FNW A;  2Y0S B;  2E76 C;  4DK0 A;  3Q0A A;  1CK1 A;  1SNQ A;  4K8I A;  1EY0 A;  3S1Q B;  2CW0 D;  3K5O A;  4AYB B;  1JIC A;  3SVM A;  5KRU A;  4ZLT F;  2K01 A;  1T5X D;  5K36 H;  1SYG A;  4V0B A;  1EFI D;  3M3Y B;  2A68 C;  3MFY A;  4V19 0;  1PZK D;  2FMC A;  1F77 A;  5D3I B;  4C3J G;  1TY0 A;  3DWQ A;  4IQZ A;  3IAY A;  3SXH A;  4C3J B;  3LWU A;  2E2I B;  2R3Z A;  1TU2 B;  1FD7 D;  3NTK A;  2R6G A;  1SNC A;  2KHS A;  4OGQ C;  3TP8 A;  2CQA A;  4KV6 A;  5EJW A;  2B2W A;  2O2L D;  4RGO S;  5M9O A;  1SND A;  1DOK A;  4F87 A;  5E4W C;  4XYO A;  3VR4 A;  1HHV A;  1QOH A;  3F2U A;  5JPM C;  2QDB A;  3S17 B;  4K8J A;  1C8C A;  3VR5 A;  1O7L A;  3BYY B;  1JWS D;  2ICE C;  4Q5V A;  1KAB A;  3MTS A;  4QF4 A;  1PTO H;  3NQT A;  4UDU C;  3X3M A;  1LTG D;  3KLS X;  3BDC A;  1G91 A;  1RD9 D;  1RCV D;  4XT3 B;  2B8F A;  4BA1 I;  3QG1 A;  2RQX A;  1STY A;  2FMM A;  2HDM A;  1NUC A;  3Q23 A;  4IFD G;  3VYU A;  3NWS A;  4OL7 A;  1PRT D;  1G2T A;  4K2L A;  2ZXO A;  4JK1 C;  2B8G A;  1IYU A;  4IN3 A;  2KVM A;  1WD1 A;  2F3V A;  3TBI B;  2M2L A;  1TWH B;  2BDO A;  3AU7 A;  3KLS A;  2Q8T A;  4ZRZ A;  2F0L A;  3GTG B;  1IYV A;  1SMY D;  1OXU A;  4FO2 A;  2IX0 A;  2PO4 A;  1OO9 B;  3SHL A;  3DM1 A;  3RD4 A;  5T1I A;  1Q12 A;  2N55 A;  1E2W A;  2B2U C;  4XQQ A;  3MXU A;  1M8A A;  3E5S A;  1V1O A;  5KYL A;  2L55 A;  2O4X A;  3H94 A;  4XDX A;  2PZT A;  5FO9 B;  1EIG A;  3GD7 A;  3AMU A;  4ABN A;  5DEH A;  5FKA C;  3J80 L;  2E75 C;  1PYW D;  3R2I A;  1J8I A;  2Z4H A;  5C4Z A;  1EY4 A;  4ULL A;  1WD0 A;  3I70 A;  3H0G B;  5BN4 A;  3HOY B;  3K57 A;  2NBF A;  4NDX A;  1I4H A;  1D2B A;  1EY8 A;  2K03 A;  4F8M A;  1EL0 A;  4XIG S;  4C56 C;  1LT4 D;  3H91 A;  3K59 A;  1CFM A;  1I4Q A;  1WCM B;  2LFN A;  1WTR A;  5EGT A;  2QEJ C;  4ZQ3 A;  3EQL C;  3ERQ A;  2LS0 1;  4KD4 A;  3E6Z X;  4A3B B;  2NYZ D;  3E0J A;  1SXT A;  1XTC D;  5I2X A;  3BVZ A;  2RDH A;  3Q6S A;  4K6D A;  2SOB A;  2KEC A;  1EIH A;  1E2V A;  2BDN A;  1SYF A;  4B9X A;  4CJ1 B;  3X3N A;  5CC4 A;  2JSO A;  1SNM A;  4I65 A;  4LAA A;  3VA7 A;  3HZX A;  2RKS A;  2JA8 B;  2DY8 A;  2H1E A;  4IUP A;  1S5E D;  1Y69 U;  4R8I A;  4J1M A;  1ZXT A;  1WTP A;  3K58 A;  3WOE A;  3FEW X;  1DZ1 A;  1A3V A;  3EVQ A;  4HCS A;  3PUW A;  1AW7 A;  1TWG B;  1S5D D;  1JOQ A;  1TS4 A;  2R7Z B;  4EGV A;  5J22 A;  1EWC A;  4XQJ A;  5CV4 A;  2L12 A;  1SE2 A;  2A6E C;  3MAQ A;  5CR3 A;  3A8J E;  1PTO C;  1X3Q A;  3FVQ A;  4G4K A;  5LHY 1;  1GUT A;  2XVS A;  1F9R A;  3MXN A;  4K5X A;  1WTX A;  2F0P A;  2CW0 C;  5FO7 B;  5ELE A;  2AUJ D;  2F0I A;  2PW7 A;  4HAE A;  3L3O C;  2PZU A;  1KDB A;  2WKD A;  2VXW A;  5KNC A;  2EJG C;  2I07 B;  1LAB A;  5CBE E;  2RDF A;  4KKU A;  1A3U A;  1Q3L A;  3TN2 A;  3T56 B;  3MXP A;  5E4X A;  5ELF A;  4EQO A;  3WOF A;  4H0L C;  1EQT A;  2IL8 A;  2EY5 A;  3A56 A;  4L6T B;  3J7A V;  4RA8 A;  4KY6 A;  5E3F A;  3VA5 A;  4MHE A;  2ZXR A;  4TQU S;  2JA6 B;  3MXG A;  4XT1 B;  1F2M A;  1BOS A;  1KNE A;  5C3W A;  3GTM B;  2MPM A;  4N9P A;  4RHR A;  3PUX A;  1KDC A;  2WAQ B;  5C5M A;  3S1N B;  3P1H A;  5CV8 A;  2SEB D;  5IGD A;  2QIL A;  2EVB A;  5KIX A;  4IFD I;  3IFT A;  1F2L A;  3L7Z C;  4A3K B;  1JOK A;  2E2D C;  3D3R A;  3MHB A;  3QOJ A;  4ID6 A;  2HDL A;  5HUR A;  1L0Y B;  1WTW A;  3A8K E;  4A3I B;  1BF4 A;  1O80 A;  3N52 A;  5D65 A;  2R92 B;  2EOT A;  1X32 A;  2EYL A;  5KND A;  1HQM C;  4A3F B;  4ZUI A;  4DFA A;  5CV6 A;  5EPK A;  3QO2 A;  1JQY D;  4RWS C;  2B39 A;  1PZJ D;  3G7L A;  1TKW B;  4KTA A;  5CV7 A;  1HA6 A;  3J7A F;  1A2T A;  4KY7 A;  5ELC A;  3NBH A;  5EBC A;  4KK7 A;  1STG A;  4PMC A;  3BG3 A;  4IFD H;  3TP6 A;  2MGS A;  1ICW A;  3NTH A;  2CVR A;  1AZP A;  3NPP A;  3R8B A;  2B2V C;  3MA2 B;  1QWY A;  2B2Y A;  4RGT A;  4NW2 A;  1LTB D;  2F0S A;  4CHT B;  3KUP A;  1IKL A;  1BXT A;  4E6I A;  1BR9 A;  4RH6 A;  5C0X G;  1RDP D;  1PLF A;  1HPC A;  1TWF B;  1EZ6 A;  4CKB A;  2X6G A;  2ZT9 C;  5FO8 B;  1UUP A;  4ODG A;  1SMY C;  1S5B D;  3D6C A;  4ZAI A;  2IJ0 A;  3A7A B;  2B2T C;  1U4R A;  2K5W A;  2WV6 D;  1RF2 D;  1QNU A;  4G7O C;  2AQ2 B;  3BYT B;  1DXM A;  3EFX D;  2KOL A;  4O42 A;  3DEP A;  5C6A A;  3ND9 A;  1NAP A;  1ESF A;  4KKS A;  1LTS D;  1TR5 A;  4Z9C B;  4XQN A;  4KY5 A;  1TQO A;  2AWN A;  1F2Z A;  1FYC A;  1RTO A;  3SEB A;  4P2C B;  1V1P B;  1OXV A;  2AWO A;  3BVM A;  1EQV A;  4WOR A;  1F2Y A;  4X3U A;  3T53 B;  1OXS C;  1IL8 A;  1QJO A;  3PUV A;  1SJE D;  2NVX B;  5EBD A;  2F0W A;  3P7J A;  2WIN B;  1I3Q B;  5D3D A;  2RSN A;  4Q0F A;  4H7B A;  2PCF B;  2CHB D;  5JEA G;  1E2Z A;  3QJY A;  4DNT B;  3S2D B;  2K5Q A;  2EJM A;  1KLU D;  3GP7 A;  1I4G A;  3K5N A;  1BQQ T;  1JC7 A;  1HQR D;  2L9H A;  1KAA A;  3GTK B;  5D14 A;  4K5V A;  1B4O A;  1XX8 A;  3ONA B;  1GUN A;  3NK9 A;  1D6E C;  2R93 B;  5DM6 3;  4RHS A;  4TRD A;  1O7Z A;  1K83 B;  1H9S A;  4XXE A;  3V05 A;  1WTV A;  1STE A;  2WII B;  2JEA I;  3S9W A;  1H9M A;  2EYP A;  2JE6 I;  4RKB A;  3I4N B;  1I4P A;  3I4L A;  1U4L A;  2RVL A;  1XWE A;  1KNA A;  3M85 A;  4CKC A;  5A2Q L;  1B53 A;  3IKJ A;  2IX3 A;  4L8J A;  3VR3 A;  4DXF A;  1EWH A;  5CGK A;  5KGU A;  5M3M B;  2MJ8 A;  1SFO B;  2E2H B;  1R4Q B;  5IGC A;  4LK1 C;  2B2W C;  3OOC A;  1JR0 D;  4IUN A;  2PMZ B;  2DNC A;  3AB9 A;  5IGE A;  1HUM A;  3M4Y A;  3D6W A;  1MSG A;  1ET9 A;  2A69 D;  1NSN S;  1GHJ A;  4DAY A;  1QE6 A;  4KJO A;  1I6H B;  3O13 A;  4O1N A;  2LMC B;  4NP5 A;  1IKM A;  4A3D B;  2K05 A;  3GV6 A;  2VUM B;  2ID0 A;  2JP1 A;  2VB2 X;  2K04 A;  4WRD A;  4FNF A;  4X3S A;  1D5X C;  1I4R A;  3S14 B;  1U4P A;  1GUS A;  4K2K A;  3IFD A;  3SK5 A;  1XYI A;  5C0X I;  4QIW B;  2QF7 A;  5C5L A;  3OMG A;  3M7N A;  3OWE B;  1VCI A;  3CU7 A;  1OXT A;  3D4R A;  1DOM A;  3GO5 A;  1PFM A;  4ZYS A;  5KEE A;  1ZEQ X;  2V4D A;  4KHZ A;  2B2U A;  2KCC A;  4B08 A;  2IPK D;  1HTP A;  2NUC A;  1GXD C;  5JVG 3;  3LX0 A;  2FHT A;  4U67 3;  1AZQ A;  2HUG A;  5EPL A;  4KHV A;  4BS9 A;  3BZD B;  1SYE A;  5C0X H;  3TP5 A;  2EJF C;  3K5M A;  1Z47 A;  2F1M A;  4OHJ A;  1ENA A;  5IOD A;  1MSH A;  1BUV T;  2Q8I B;  3M4O B;  3FKI B;  1LTI D;  4OIJ A;  2J4X A;  5J39 A;  1C4Q A;  1G6Z A;  3T51 B;  2E2J B;  2HCC A;  1A15 A;  2OT2 A;  4X3K A;  1HFN A;  4YIJ A;  5KYI A;  4X3T A;  1GHK A;  2G9H D;  1ML0 D;  1CQF A;  4IUU A;  4A3E B;  3T13 A;  2D9U A;  5I2Y A;  2IW3 A;  3MFG A;  4EVO A;  4FP5 D;  4OO1 G;  3GTO B;  3SDZ A;  3M7G A;  1SYC A;  3C46 A;  5EPJ A;  2JXM B;  1ILQ A;  1MBY A;  1VF7 A;  3HEJ A;  2PW5 A;  2D5D A;  4J8Q A;  5FK9 C;  3N6R A;  1F9P A;  1STN A;  1SNP A;  3DMU A;  1Z6H A;  2KEE A;  1BCP F;  4C1N K;  5ELB A;  3J81 E;  3C1F A;  1D5M C;  1AN8 A;  2NTS A;  3L9A X;  1Q90 A;  1LTR D;  1EYA A;  2J0T D;  2MP1 A;  1PTO F;  2XWB B;  4EQN A;  2EY6 A;  2F3W A;  2OXP A;  2F0H A;  5J1Z A;  1H9R A;  4M1U B;  4RGN A;  4KJN A;  3PIO 3;  3K7A B;  1STB A;  1EY6 A;  2PQE A;  4RGM A;  4KN4 C;  2HQE A;  1V43 A;  4QMG A;  5JEA H;  3P75 A;  5K36 G;  2EPB A;  3OPO A;  1Z7T A;  3I3C A;  4NMZ A;  3KK7 A;  5F2D A;  1HCZ A;  3MZ5 A;  1SSO A;  2AUK A;  3SR1 A;  2HCI A;  5A35 A;  3VR6 A;  5BN3 A;  3A54 A;  3NQI A;  1E0B A;  4HR7 B;  4A3J B;  1DM0 B;  1D5Z C;  3HG9 A;  1AFP A;  3QOL A;  3HOV B;  3KLR A;  4FF4 A;  2BCO A;  4CJ2 C;  2F0E A;  1MGS A;  2EYM A;  2K5D A;  2PYK A;  3GTQ B;  3T16 A;  1FR3 A;  3D4D A;  1LT6 D;  2F03 A;  3KF8 A;  2KED A;  5I4D A;  3A7L A;  1FNV A;  2NZ1 D;  4DA2 A;  4PMW A;  4BY1 B;  3GV3 A;  1SE4 A;  4IZ8 A;  2K33 A;  3LWE A;  1Y8N B;  1PXU A;  2O5I C;  1Q1B A;  3C1E A;  3URY A;  2TMP A;  5DNF A;  1BCP B;  4EQP A;  3MEH A;  2OF1 A;  4U68 A;  2RBM A;  3C3L A;  5IGF A;  1ONL A;  1SE3 A;  2D62 A;  2SDF A;  5FLX E;  4RFB A;  3V2T A;  2XSC A;  3I72 A;  3DHQ A;  2JA7 B;  5M5Y B;  3NE5 B;  1SYB A;  2O5J C;  3RUZ A;  3BVG A;  2F0O A;  5C44 B;  1PFN A;  2BA1 A;  4DAP A;  5A2Q E;  2A69 C;  4DNR B;  2KJX A;  1ESR A;  2EYO A;  2F0V A;  3QB3 A;  4G57 A;  1KTK A;  5EKK A;  1M4V A;  2TSS A;  5HGT A;  1C48 A;  2AQ1 B;  2FFK B;  3GQB A;  3CRL C;  4C3I G;  4J6H A;  4QCL A;  2QKI C;  1LV9 A;  2B2V A;  4C3I B;  1G29 1;  1PRT C;  2BOS A;  2A6H D;  5FOB B;  2H4O A;  3VYR A;  2A74 C;  1HXY D;  4FXK C;  3S16 B;  3RZD B;  5COR A;  3R93 A;  1B50 A;  2LKV A;  4G7Z C;  2I46 A;  3I90 A;  3TZU A;  1H9J A;  2F0T A;  2MHV A;  2B2Y C;  2B2T A;  2F0F A;  2EY2 A;  2YU9 B;  1VMC A;  4KI0 A;  1B2T A;  1R4P B;  1TY2 A;  1PMR A;  1PDQ A;  1QCB D;  2NWG A;  2WKC A;  1GOZ A;  4H44 C;  4RAU C;  4ME5 A;  4OO1 I;  3DEO A;  3J81 L;  3EA6 A;  4K5W A;  4BBS B;  4DN4 M;  3OMC A;  1I6V C;  3U9S A;  5JOB A;  4BA2 I;  2VB3 X;  3HOW B;  4CBV A;  1Y1W B;  1HUN A;  3R2T A;  3C2P A;  2K6A A;  1EY7 A;  5EKI A;  1SDF A;  3JAM E;  2R61 A;  4ILW A;  3TP7 A;  4TKO B;  2XN9 C;  3EJI A;  2JEB I;  2DNE A;  1CZG A;  3ERO A;  2E74 C;  3LNN A;  3W2D A;  5CMD A;  2DY7 A;  4ZUJ A;  1JOO A;  3T4A C;  2A73 B;  1Y8O B;  3U9O A;  1JWU D;  3DUZ A;  2IWH A;  4Y7N B;  1F9Q A;  3PIP 3;  3NBI A;  2IX1 A;  5KNB A;  4IFD J;  3PMF A;  2KQ3 A;  3NXW A;  4PMB A;  3S1R B;  1DD2 A;  1BCP D;  1TS5 A;  3I4M B;  1ZKO A;  4C2M B;  5IT9 E;  1MI2 A;  2L11 A;  2SNS A;  4OIK A;  2K1B A;  5EKL A;  5I9P A;  5ISR A;  4KKT A;  1W6K A;  4HN7 A;  3QIA A;  4C3H G;  1EU3 A;  3MC0 B;  1B1Z A;  1IHZ A;  1TS2 A;  2BA0 A;  4C3H B;  1LAC A;  1UEA B;  2AQ3 B;  3HP3 A;  3MWY W;  2K28 A;  3SE0 A;  4LMQ D;  2EDG A;  1II3 A;  1RTN A;  5M5W B;  5FLX L;  4A93 B;  1JOR A;  4BBR B;  2EYH A;  4IUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...