1GHKA

Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from azotobacter vineland ii, nmr, 25 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
79
structure length
79
Chain Sequence
b'AIDIKAPTFPESIADGTVATWHKKPGEAVKRDELIVDIETDKVVMEVLAEADGVIAEIVKNEGDTVLSGELLGKLTEGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E2, THE DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE COMPONENT OF 2-
publication title Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from Azotobacter vinelandii.
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Acyltransferase
total genus 6
structure length 79
sequence length 79
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 1996-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ghkA00
1BDOA 2EJMA 5A35A 4H13C 1E2VA 3QIAA 4G7ZC 2JXMB 2NN6H 1G291 4G7HC 1LABA 1GJXA 4IFDG 1CTMA 4BA1I 3MFYA 4HR7B 1H9MA 1VF7A 2A6HD 1ZKOA 2K7VA 1O7LA 4TQUS 3CRKC 4DNTB 1E2ZA 2EJFC 1GUSA 5KNCA 5BN5A 3QG1A 3FMCA 2JE6I 2AUKA 3I72A 4OO1G 1I6VC 1TU2B 1DXMA 2AWOA 3VA7A 1YNJC 4KN7C 1K8MA 1Q90A 1Y8NB 1H9SB 1ZYRC 1IYUA 1DCZA 3KLRA 3RLFA 3PUYA 4DNRB 2EJGC 2IT1A 1V8QA 3DXJC 3NE5B 3VR5A 3WDNA 3A7AB 3FPPA 3LNNA 2D62A 5C0XH 1Y69U 1H9RA 3D31A 3ND9A 1HPCA 2CW0C 1SMYC 2JEBI 3BDOA 1LACA 3T56B 1GHJA 4KKUA 3LWUA 5BN3A 1QJOA 2A6HC 1K8OA 3OW7A 3M4YA 1PMRA 3N6RA 2A68C 1VF5C 2B8GA 3PUXA 1GHKA 2E75C 4I7ZC 1IW7C 5KNBA 1B9NA 4KHZA 3MXUA 2A68D 3ND8A 3VR2A 1IW7D 2QF7A 2LMCB 3PUZA 4IQZA 4H44C 3GD7A 3OPOA 1Y8OB 4KKSA 2KA7A 2ZT9C 5JEAH 2A69D 3I4LA 1OXTA 2KCCA 4JK1C 1Q1EA 2NN6I 2O5JC 2NN6G 2PNRC 3EQLC 5K36H 3T51B 1Q12A 3U9SA 1GUNA 1VCIA 1GUTA 1YNNC 2DNEA 4LJZC 4PV1C 1TKWB 3SDZA 3VR6A 1A6XA 4XIGS 3BG3A 1Z7TA 1GUGA 4LK1C 1OXXK 4KKTA 1DD2A 1H9KA 2V4DA 2DN8A 3A7LA 1Z6HA 4KI0A 2EDGA 1OXSC 5KNDA 4RCNA 5C0XG 3W3AA 3T53B 4DK0A 5BN4A 1HTPA 3TZUA 4XTCS 1B9MA 2A69C 2K33A 1CI3M 3PUWA 1GUOA 3L7ZC 3IKJA 3A8KE 3H94A 3PV0A 4TKOB 2E74C 2EVBA 3QJYA 3SE0A 4OO1H 3D4RA 3HGBA 1V43A 2JEAI 2BA0A 4KN4C 3AB9A 4G7OC 2R6GA 1T5EA 3A8IE 4GZYC 3P20A 4L8JA 4DK1A 2AUJD 1Q1BA 2YYZA 2PPBC 3A8JE 2A6EC 1IYVA 1OXVA 3M7NA 2A6ED 3IFTA 4KMUC 1ONLA 1FR3A 1H9SA 1H9JA 1HQMC 1O78A 2DNCA 2K32A 2L5TA 2D5DA 3VR4A 3OOCA 1EWHA 1E2WA 2BA1A 5JEAG 3M85A 1CFMA 4H0LC 2PCFB 1VDZA 4IFDH 3GQBA 2BDOA 2BE5C 2O5IC 4JBWA 5K36G 3VR3A 2Q8IB 1HCZA 2BE5D 2E76C 1OXUA 4OGQC 2D2CC 3PUVA 2B8FA 3I73A 4BA2I 3CRLC 1Y8PB 1FYCA 2F1MA
chains in the Genus database with same CATH superfamily
1QZGA 5HGTA 3JAMc 1F9RA 3LWEA 2E8GA 4ZAIA 1UE1A 1HA5A 1Z9FA 3BZKA 2Z1CA 2QKIC 3TMEA 2NWGA 4MNOA 2ICIA 3GTJB 2EJFC 2RHQB 2VQEQ 3NWSA 4X62L 5IYCH 4ZKBB 3S2DH 3UE1A 1JC7A 5IYBG 1Q90A 4A3CG 3EJIA 5J1ZA 4DGZA 2I5LX 4PMBA 4HTHA 5EGTA 4Y52H 2HD3A 5J3BA 2E2HB 2KHJA 4LFCQ 1XX8A 3DEPA 2BH2A 2B63B 2R7ZB 1NAPA 1FJGL 2KOLA 3OHXC 3GTJH 4YY3L 1SN8A 2A6HC 1PH8A 1PYSB 2N49A 3J80i 5M3FG 3PF4A 2UUAQ 1K8GA 4LUZA 1J5EL 4Y7NB 1VMCA 3K7AB 4DR6Q 1Y8OB 3E0EA 4C3JG 5IT9c 1GD7A 3KDFA 3JAMi 2E2HH 2IPKD 2PNRC 5K36H 2B63H 3EN2A 1U4LA 4NB3A 4R4OA 5T1GA 3X3NA 1WTQA 1FNUA 3P1HA 1FNVA 5IP9H 1PRTD 4HCEA 2PW5A 4BY7G 4N8FA 2K5WA 4Y7NH 3KJPA 1QVCA 3K7AH 2KQ3A 2NVTB 1B9MA 4IJLA 3S16H 3OTOQ 1AZQA 3IKJA 1BQQT 1KIXA 1FD7D 1SAPA 4Q5VA 1TS4A 3S24A 4JG2A 5COYA 1G91A 5GAHC 1VQGA 4DXGA 5L37A 2NZ1D 1S4ZA 2EY1A 1RIPA 3AMUA 2OQKA 2IX1A 2JEAI 1F2MA 2JJQA 3CMAA 2NVTH 2JA6B 5DM63 1VQ4A 2Y0SG 2CVRA 3OOCA 3M85A 1K83B 5C4ZA 3ER0A 1BR9A 1IL8A 3GQBA 4CDDC 3URYA 5KYLA 4H02A 4DR3L 3BU2A 1FYCA 2R93G 1NR2A 4JI0Q 1CM9A 1E2VA 3ULJA 2B2VA 2IHFA 4P71A 5AJ3Q 2NTTA 2JA6H 3VYSA 3HFZB 1CTMA 1K83H 4JI4Q 2JA7B 1WTXA 3MZ5A 1FGUA 1HNXL 1VS0A 1PRTB 2V1CC 3PSIA 4A3KB 1TU2B 2HHHL 2AMCB 5FLMG 2MP1A 1A3UA 4DR2L 3KUPA 1K3BC 3ITPA 1VQPA 1AE2A 4DR1Q 2B2TC 4CDEC 1XNRL 3A7AB 1XMOQ 3FPUB 1S3OA 1HNZL 4DUYL 5ELNA 1CA5A 1KDAA 3H3VC 3J7AF 4LF6L 5EJWA 1KRSA 2NTSA 3HS0C 3DM1A 1T5XD 4A3KH 1KAWA 3NTHA 2WFWA 2MNAA 4EQ5A 3CQZH 3MXNA 4YCVA 1EZ8A 1BCPC 1EFID 3E3XA 4LMQD 2I5MX 1D2BA 3NWTA 1X55A 4IUQA 5I9PA 2BH8A 1PFMA 2NVQB 4HJ5A 1PRTC 4XIGS 5DM73 1SNMA 4DV4Q 2V4DA 3HOVB 1C4QA 3HOXG 1VQCA 1HTPA 2XGTA 3PIPA 4POGA 2QW7A 1CI3M 2WB1E 3TSSA 4O0AA 2L4NA 3H94A 2SOBA 3QJYA 2NVQH 2VNUD 5IYDH 2WKDA 2JP1A 3A8IE 1A15A 2CH4A 5JPMC 2F3VA 5M3MG 3A8JE 3KF6A 4LF7L 3MXPA 3R93A 2K03A 4P2CB 2MQHA 1VDZA 1MIUA 1KTKA 3K57A 4DV0Q 1V1PB 1EEID 3FHWA 3HKZG 4O2DA 3BS1A 4BA2I 1Y8PB 4RA8A 1CZGA 2L11A 4RKBA 2RVLA 2Q2UA 3CD6A 2H1EA 3L9AX 2VL6A 1SNOA 3MFYA 2HT1A 4LFBL 3K7UC 4GOPB 5A2QE 1U4RA 1WFQA 5A2QL 3HOWG 4V0BA 4DNIA 1U4MA 2UUBL 4X65L 4A3IG 1K8MA 4GLAC 2ZM6L 1CKNA 3GTQB 1ZYRD 1U4PA 5IOCA 1E1OA 4CGYB 3TRZA 2PQAB 3IFDA 1JCKB 3D8GA 3F2BA 2VY3A 3OWEB 1CQFA 1KDCA 5HY6A 3S1MH 1A63A 1NTGA 2WAQG 4KKUA 2XRQD 3A74A 3F2UA 1NNXA 4NDXA 5FKAC 3OIPA 3SK4A 1GHKA 2MO0A 1SXTA 2LMCB 1XMQL 1QUQA 5KEEA 4AIMA 3CPWA 3B6YA 1EIHA 3PF5A 3GP7A 2X6GA 5E4WC 5KYIA 4GOPC 1XWEA 2DNEA 2Z6BA 3EBEA 2B2UC 1WI5A 3J81j 3K8AA 3AU7A 1MJEA 3P75A 3KF8A 3ZJYC 4LF9L 4C3HB 2F0VA 3RR5A 4DK3C 1LT3D 1ASYA 2ID0A 3AFQA 1BCPF 4C2MB 3PV0A 2D0PA 5IWAL 2EVBA 1O7ZA 3GTOB 4EQNA 2I07B 1EQTA 2Q2IA 1NSNS 2Y0SE 1ICWA 1B7YB 1TS5A 1X3EA 2A6ED 2QEXA 3M7NA 4C3HH 1FR3A 5C4XB 2DNCA 3CU7A 4DPGA 4A3FG 1F77A 1E2WA 2BDNA 3ONAB 1KQSA 3FKIB 1EL0A 4H7BA 4LF5L 1LTSD 4J8QA 3TP8A 4F7XA 1I4RA 4PMCA 2E2DC 3UDFA 3GTOH 2F3IA 2F0DA 2D9UA 4A3DH 5JJLA 5C3XA 3R3OA 5LMUQ 5C4XH 5ELEA 2IHEA 1YITA 4IFDG 1VQDA 3FKIH 5FO7B 2I0QA 1E2ZA 2WB1B 5C3WA 2SDFA 2XWBB 4B3MQ 5ELFA 4RFBA 2HCCA 4JVZA 4OO1I 4JI6Q 2NVYB 1R9TB 1ZYRC 1Y1VG 1I5FA 3NENA 4PG3A 4BXXG 3D31A 2DY7A 4P73A 3RLOA 1VQMA 1Q8KA 4OWWB 4GLVB 1GXDC 1QWYA 3T56B 1LTAD 4OEMB 2Q8TA 4JI1Q 3M4YA 1VQIA 1K0SA 5GROA 3HOYB 2A68D 2NVYH 1R9TH 3CCVA 4XT1B 4DR5Q 2TSSA 2K75A 4KY5A 2IX3A 1VQBA 3DM3A 1Q1EA 2NN6I 4RGOS 3W5OA 1VCIA 3T1YQ 3TS2A 2PMZE 3UDIA 1B8AA 4DR7L 2GVBA 3MEFA 4DV1Q 2UXDL 1NCVA 3BG3A 1ICFB 4TVAB 3SVMA 4DR4Q 4FXGC 5J39A 3GTLB 3WWVA 2NUCA 5C0XG 5EKKA 2NZHA 1DM0B 3C1FA 4N9PA 3X3MA 1KNEA 4R4CA 2AQ1B 5M3FB 1V43A 2A8VA 4RAUC 4A3CH 3HG9A 1YHBA 2YYZA 4C3JB 4GLXA 4ILWA 1STGA 2A6EC 4IOCA 3GTLH 1N34L 2ALYB 2F4VQ 2CWPA 1LO5D 2X6LA 4XXEA 2N88A 4YHHL 1L1OB 5IODA 2F0HA 2R7DA 1WYDA 3S1RH 3H0GB 1VQ8A 1XYIA 5M3FH 3G7LA 2BE5D 1N33Q 5CV4A 4NKLA 4BBSG 1A3VA 4KHPQ 1BDOA 4C3JH 5A35A 4DV3Q 5EQ0A 5FO9B 1A3TA 3EA6A 3PQIA 2CQOA 3EROA 1CK1A 4IPHA 5ELCA 1SR3A 2KEEA 3CC7A 2CKZB 1E7ZA 4C1NI 2PQEA 5M5WB 1STNA 4B3TL 3H0GH 1EQVA 4RG1A 3NXWA 3QG1A 3SK6A 2ZTCA 1PH5A 1JE5A 4JI7Q 4JYAQ 4BY7H 4KN7C 2A19A 3MAQA 3CCSA 2G5DA 1DCZA 2RKSA 2JA5B 1YNJD 3PUYA 2Y0SB 1QNUA 2WAQE 2GN5A 2RA4A 3PIO3 1QE6A 2P5ZX 3TN2A 3H3VI 1L1OC 4OL7A 1KL9A 2K1BA 5DAUA 2CW0D 5M5WH 2GA4B 4WFN3 1QCBD 4CDFC 4IFDI 3P7JA 4PZ8A 3BDCA 2A68C 4F88A 4HCSA 2F4IA 5LMNL 2ZTEA 2JA5H 2F0NA 2IWHA 4DV5Q 3GD7A 5C6AA 3EIVA 3IRBA 3I4LA 4ZQ3A 1OXTA 2KJXA 5DLQE 4AQYL 3K0XA 4QIWE 4KD4A 3V2TA 1BKBA 4LJZC 2CQAA 1AFPA 2DY8A 1MJCA 1UEAB 3KDFB 3GV3A 4QCLA 1SYEA 2JK8A 3K81C 1DD2A 1HA6A 2F0KA 3A7LA 1Z6HA 5ELDA 1OXSC 1SE2A 3NTIA 1I3QB 3W3AA 4IUTA 3QR8A 4X66L 4DK0A 2A74C 2K4KA 5C3EG 1R4PB 1LTRD 2XTIA 3Q23A 4IUPA 2VQEL 5JJKA 1MSGA 1WD1A 2ZJQA 4HJ9A 3DEOA 5FLMH 2J4XA 3I4MB 2R6GA 1T5EA 3TP5A 4XQJA 1IYJB 2ZJPA 2AUJD 5JJZA 1UUPA 1XPOA 2N8NA 1ONLA 2L5TA 4B3SQ 2B2WC 4A93G 2AKWB 5JEAG 3NBIA 1PV4A 5C0XI 1XPUA 1KNAA 5FOBB 2BE5C 4LAAA 2C35B 5G3LD 3K59A 4K6DA 1NMGA 4S3SA 2E76C 4OX9Q 2PMZB 4PMWA 5I2XA 1TVXA 1I94Q 3CHBD 4HIOA 2F1MA 3HOXB 4XT3B 3M7GA 1SMYD 2JXMB 5IGGA 1YNXA 5M5XB 1C9OA 2EXDA 1F9PA 5LMNW 3FDTA 1HR0Q 2IY5B 4DNTB 1IL2A 1PTOH 1GUSA 1LV9A 2CH4W 1LTTD 4F87A 2RCFA 2LXJA 5FLXE 5FLXL 1SNCA 2EIFA 2RDGA 1YNJC 3PO3G 1SRUA 3HOXH 3RLFA 3DUZA 2IT1A 4FF4A 4V190 3OTOL 4ZUIA 3T4AC 2KCMA 1D5XC 3Q6SA 1YJNA 5M5XH 2CW0C 1PH4A 4KJOA 4QF4A 1X6OA 5GADC 4QMGA 1W6JA 3HOZG 1QJOA 1I6HB 4L63B 1Q8IA 2E75C 3BYTB 3SR1A 3L0OA 1BBWA 3C46A 1E3PA 4JW0A 4L6TB 2JYOA 1TIID 2RDFA 1CSPA 4WRDA 2O5JC 2EYFA 1LTID 1JJCB 2IX0A 3T51B 3I70A 3HOWB 1W6KA 3U9SA 1WCMG 2CHBD 1HFGA 3VR6A 2EYLA 4A3IB 1I6HH 4CJ2C 4EX5A 1Z7TA 1EEFD 1PA6A 1MI2A 5EKLA 5IP7G 2PI2A 1TWFB 5IGFA 1SNPA 2L15A 3ERQA 1C8CA 4GKKQ 3MVVA 3AFPA 2WAQB 1N36Q 4B3RQ 2F0OA 3HOWH 2E74C 1D1IA 2JSOA 3MFGA 3SE0A 3S16B 4A3IH 3BZDB 3CPFA 2A1AA 2PZUA 2L1BA 2B2YA 2G9HD 1E1TA 1HZAA 1TWFH 3TBIB 1HNWL 1RCVD 2ZXOA 3T1HQ 3FEWX 3TS0A 4RMFA 4QIWB 2Q8IB 4OIKA 2RF4A 1CHPD 2VS1A 3D6CA 5ELBA 2EY5A 2XRSD 4JI2Q 2QDBA 2EJMA 4E6IA 2E2IH 2UUCQ 3NP8A 5T1IA 3SK5A 2LFNA 4G7HC 3KFUA 4NXML 1RTNA 4JBKA 1B70B 1PLFA 5LL6X 1N32Q 4TQUS 4R4IA 4LF8Q 3S1NB 3S9WA 4NW2A 4JBMA 2F0EA 1IBKL 3NBHB 1PZID 3W2DA 3M4PA 1RODA 4FF1A 2H4OA 3KLRA 2EJGC 4A3FB 2PZWA 4JPBW 3K5NA 2C9OA 4NPSA 5HURA 4K5XA 2SNMA 4ULLA 4C56C 3RNUA 2FJ2A 5IIFA 1CHQD 3S1NH 1ENCA 1VQ5A 4A3GB 4X62Q 4X6AH 2RCNA 1R4QB 5C5MA 4JI8Q 3L2PA 3PUXA 2F0PA 4X64L 1HHVA 1QG7A 2EYJA 1WJJA 4IJHA 1EIYB 1IW7D 3GTGB 2XN9C 4A3FH 3TEHB 3TDQA 3CQZB 4A3EB 1FJGQ 2AWNA 3OMGA 4DV0L 1Q12A 3R2IA 4DUZL 4PV1C 1GO3E 2A73B 2D0OA 4QJFA 4TSSA 1QUQB 4UY8C 4A3GH 4B08A 3CF5A 1OXXK 1Y1VB 5GAEC 2DN8A 4RHSA 3HP3A 4AYBG 1YJ9A 1TWAB 1L0XB 2O4XA 3GTGH 1GVPA 5I2YA 4UDUC 1IKLA 2EYHA 2RQXA 4A3EH 4GNXB 2F0GA 2CCZA 2WINB 1YIJA 4MIUA 1BF4A 1RJTA 2JA8G 5C44B 3I4OA 3VA5A 5BR8Q 3TQYA 2LS01 1Y1VH 1SE4A 5DNFA 3D0FA 3EFXD 1JR0D 3HRZC 1I4HA 4X3SA 4BXXH 1TWAH 1HJPA 4EVOA 1T9HA 1Y14B 2K32A 3GTPB 4K5WA 4IURA 2K04A 3NELA 2BDOA 2QCPX 5JOBA 5FJ8G 2SNSA 2NYZD 4FXDA 5C44H 3F2CA 4HSPA 4TRDA 5EPJA 2Z4IA 1JJGA 1XXGA 1NBWA 4KY6A 1PH3A 1TQOA 1EY0A 4QY7A 5CV9A 1A2UA 2RSOA 3GTPH 4GNXC 4IALA 5CGKA 1DOKA 4BA1I 2KEDA 2VUMG 1O7LA 1UEBA 4DR3Q 4OO1G 3MWYW 4ABNA 4PZ7A 4HEDA 4XYQA 1TWCB 3M9BA 1Y8NB 2KBNA 4DNRB 5C0XH 2ZXRA 2JA9A 1TWHB 3J81E 3J81L 5CORA 1ESRA 3UE0A 1KLUD 3W1GA 2IJ0A 3I8ZA 3F1ZA 2VZAA 4LNQA 4FYDA 4HJAA 2ICEC 4CKBA 3I7FA 3PIP3 1YJWA 4JI3L 2RDHA 5CV7A 1F2YA 2OF1A 1AH9A 2HHHQ 4BBSB 4K0KL 1NR4A 2QGQA 3S1MB 5FO8B 2B8GA 1VF5C 4DR2Q 1IW7C 2KCNA 4KHZA 4WORA 1S40A 1TWCH 2QF7A 2JQOA 1EIGA 1XNRQ 1TWHH 1SROA 2Z9HA 1HNZQ 2OQ0A 2B2TA 2M9VA 2NN6G 1KLGD 2KCTA 1VQKA 1JWSD 4LF6Q 3G6JB 2Z8LA 2FINB 1EYDA 1P8LA 1IKMA 4BBSH 1HZCA 5E7NA 1STEA 5JPNC 2E5LL 3KLSA 5LMUL 2M00A 3PGZA 3F8TA 4GN4B 1ILQA 2XSCA 2K14A 1NMFA 5HGQA 2Z6KC 4BBRG 2R7ZG 4B3ML 2K33A 4CDCC 2O2LD 2EPBA 2F03A 3QB3A 1YI2A 4JI6L 1IBMQ 2ZXPA 4WJWA 3KBXA 5C4HA 3KLWA 5AFWA 1G2TA 1I4GA 5D3DA 4OHJA 2F0IA 3NQIA 3MC0B 1IBLL 1A8VA 1CA6A 1L2FA 1NUCA 4APVA 1SYFA 1AEXA 4JC0A 4EGVA 2O5IC 2CWAA 3CW2C 4DXFA 3BDLA 3BVZA 1HCZA 3PMFA 5IY0A 2I5HA 2F0MA 5EBDA 3A54A 1JT8A 3HEJA 3SHLA 2K5DA 3R2TA 4J6HA 3CRLC 4LF7Q 4DV2L 1RHPA 5C3EB 4A3DB 4HJ7A 2UU9Q 1PRTF 1ET6A 2FHTA 1XTDA 3T1YL 4KK7A 2OTLA 4DAYA 1J6QA 4JBJA 1ZKOA 3IAYA 3CRKC 2HCIA 5I4DA 1EYGA 2RSNA 4M1UB 5KRUA 4IPCA 2XNAC 3CCLA 2UXCQ 1DXMA 1U0LA 1PYWD 1MD2D 5LHY1 2K52A 1VQHA 3T13A 1SJED 5C3EH 1B2TA 3HKSA 4ZK9B 2BOSA 3S15H 4MZ9A 3RD4A 2PI2E 4DV7L 2XVSA 4OELB 2UXBL 2XWJB 1QZHA 1GHJA 3PCOB 5BN3A 2NVXB 1LT4D 1E24A 3Q22A 2UUBQ 3OW7A 5JVG3 1VQNA 4I7ZC 2ZM6Q 3K5MA 1FNWA 3UDGA 3ND8A 2F0WA 2EOTA 1VQ7A 4CJ0B 2M2LA 3OPOA 4JI5L 2ASBA 4A93H 1Q7YC 5JEAH 1C0AA 4WJ4A 2B39A 4IPDA 2LKVA 1SYBA 2JA7G 4UP7A 3VDYA 4IN3A 2NBFA 2NVXH 4KD3A 3PO3B 3J80E 3FRPB 3J80L 4YWKA 1XNQQ 1V1PA 1XMQQ 4HMIA 4FF2A 2EDGA 4QB4A 1I4QA 2OEOA 4C3IG 4KJNA 4RH6A 3TZUA 3JAME 3NEMA 3JAML 5F2DA 1S72A 4CJ1B 4JYAL 5E1FA 3NQTA 2VQFQ 4GOPA 3PO3H 1X3QA 2PW7A 2B2UA 1B44D 1JICA 2QILA 4CHTB 2NZOA 1STYA 1H9JA 4F8MA 1WCMB 2YU9H 3M4QA 3HOZH 4ID6A 1YHQA 1TY2A 3H15A 5K5PA 3S1RB 2MO1A 4K2LA 3HOVG 4DV5L 1CSQA 1UAPA 1G6PA 1Q81C 1HTLD 2EE1A 5IYBH 4DU9A 2HQEA 2N78A 1LM0A 1SEBD 1B50A 1WCMH 2PYKA 1PVOA 5BN5A 2K6AA 3KLSX 5CV8A 3I72A 3HKZE 5IP7H 3VA7A 4FNFA 2WACA 1VQOA 1H9SB 3VYTA 5KNBA 4BY7B 4OXPA 3FPPA 2D62A 4DN4M 2E2JB 3DWPA 4JOIC 3E5SA 4LF4L 3S2HB 4R8NA 1HUMA 1MHWC 5IE8A 1YVCA 3AYHB 1AN8A 1LUZA 2TMPA 1WTPA 3A55A 1ET9A 1CZWA 1B3QA 3VR2A 4IQZA 4H44C 4ZCKA 1LTBD 2KA7A 2A69D 4JCVE 2E2JH 3C2PA 2FXQA 3WOEA 3S2HH 4GKJQ 3EQLC 5D3IB 2ZJRA 4LUOA 1KRTA 2J0TD 1I94L 3E9HA 1AE3A 1GUGA 1JQYD 2N55A 4FO2A 4KY7A 4P74A 1H95A 3A56A 1E22A 1PTOD 2VW9A 2R93B 5CV6A 4NXNL 1WTVA 1HR0L 3S14B 1XPRA 1X65A 2UXDQ 5IGEA 1EUJA 3EVQA 4X3KA 3I55A 1PYBA 3CCRA 3P20A 1D5MC 4J1MA 4L8JA 1Q1BA 3RUZA 1B1ZA 2R93H 1SE3A 4A75A 4KMUC 3E9IA 3S14H 1O7YA 1S5CD 1ZXTA 3I3CA 2F0TA 3OIQA 4YCWA 4RHRA 3SEBA 1A0IA 2QA4A 3E0JA 3G6EA 2K28A 3TZDA 5KIXA 4QL5A 5D14A 1VMPA 1PH9A 4OONA 4R4QA 3KYHC 1EU3A 3NTKA 4A3LG 1PFBA 4BY1G 1LABA 4YHHQ 2AHOB 4LFCL 4FVMA 2A6HD 2JA8B 3OMCA 1X32A 4K14A 1DOLA 5GQOA 2EZVA 1G51A 3F2DA 4DV6Q 1GUWA 1TS3A 2QEJC 1I6VC 4LW1A 1VQLA 4I65A 1PTOB 4GN5A 1WTWA 1J9OA 2UUAL 4DA2A 1PFSA 4XDXA 2MJ8A 1CT1D 2X69A 3DXJC 3VR5A 3H6MA 1IZ6A 3LNNA 1Y69U 4DR6L 5JVH3 3ND9A 5CC4A 1KAAA 4B3TQ 2JA8H 1IHZA 3V05A 1HR0W 2VB2X 2K5VA 4Z9CB 4UHVA 4A3MG 2MGSA 1RDPD 4MTNA 1CKMA 2OXPA 4C1NK 1Q82C 1B9NA 3CCJA 2KHIA 5M3MB 3FVQA 4O42A 1L0YB 1GOZA 2VUMB 3V96A 5FJ8H 1D1KA 2WB1G 1TS2A 1GUNA 5C4JB 1A6XA 4A3BG 1TKWB 1L1OA 2AQ3B 1YNND 1PTOC 1HUNA 1DGSA 3QOJA 2IW3A 3A5ZB 3HKZB 1ENAA 5IGBA 2F0UA 4KLKA 4XYOA 5KNDA 3A0JA 5M3MH 3J80c 1UE6A 5J22A 2KHSA 4XTCS 4AQYQ 2VUMH 4LFAQ 2EQSA 1UWVA 3A8KE 1PDQA 4HN7A 5C4JH 1Q46A 4OO1H 4KN4C 3AB9A 4G7OC 4ZYSA 3MXNB 3HOYG 3Q24A 1LLRD 1S5DD 2PPBC 2B2VC 1EY5A 2EY6A 2RBMA 4X66Q 4JI0L 1BOSA 4L5QA 1N8RC 1HQMC 1LTGD 4PNYA 5AJ3L 2DJFC 3RMHA 3I4NG 4JI4L 1M4VA 3BZCA 4JI8L 1QNKA 4RKLA 4DKAC 1LT6D 2D2CC 5C0XJ 1F9QA 1LTLA 4QQBX 1G8ZD 1TR5A 4ODGA 4BBRB 2N3SA 3VYRA 4DR1L 2J7ZA 2NN6H 4JV5Q 1XMOL 1P16A 2E2IB 3QO2A 2B2WA 2K5QA 1HZBA 1Y1WG 3NSWA 4UPAA 2EYOA 1KHIA 2KUMA 4A76A 3Q0AA 4R8IA 1G2SA 3KF6B 2FMMA 2B29A 4N9TA 4RGNA 3DMUA 3LX0A 2JN4A 1BCPD 2EYMA 3C1EA 2PZTA 2R92G 4BBRH 2L0CA 2R7ZH 1I4PA 1OO9B 1SMYC 3H0GG 1LACA 4IUUA 3CCQA 5BR8L 1B53A 1EU4A 1MGSA 2K5NA 4PZ6A 1D5ZC 4DV4L 3L3OC 3HOUG 5TSSA 2YV5A 1EY6A 4KKSA 2Z0SA 3SGIA 1EIFA 4RCOA 1EQQA 2KCCA 3J7YW 1S5FD 1JWMD 1AP0A 1KXLA 4XQNA 1EWIA 1YNNC 2KECA 4BWGB 1QVFA 4B9XA 1CKNB 3U9OA 1EFWA 5H1SE 2JA5G 1K0RA 2F0QA 4KI0A 4HIKA 1ESFA 4P75A 2PO4A 1XTCD 1SFOB 1EZ6A 5EBCA 1JORA 5BN4A 1S5BD 1K8AC 3AEVA 4A3JG 3L7ZC 3BVMA 2YTVA 2BA0A 1F2LA 1JJ2A 4YY3Q 1BCPB 1IXRA 2FFKB 2SEBD 4KTAA 4GZYC 3QWNA 1EOTA 1SFOH 1FGBD 1PTOF 3IFTA 1J5EQ 1K73C 4J15A 3H3VH 3OYYA 5E4XA 3VR4A 4FF3A 2D5DA 2QDLA 3S1QB 2BA1A 1JOKA 1A2TA 4ALPA 1ZEQX 4IFDH 4L5RC 1QOHA 3VR3A 3Q8DA 1LT5D 1KD1C 1L0WA 3KF8B 2EXZA 2B8FA 3H91A 3STBD 2I46A 4C3IB 1SNDA 4G7ZC 3ZYYX 2JA7H 1HNWQ 3PO2G 3S1QH 1RD9D 1KC8C 1F9SA 4GS3A 4MN3A 5KNCA 3I4MG 3FMCA 4I7AA 1PHJA 3CCEA 4DAYB 5JEAJ 1MSHA 5JAVA 1HH2P 4C3IH 3NPPA 1V8QA 2ENBA 3WDNA 4IUVA 1V1OA 2MHVA 4ZUJA 4R9WA 2RHSB 1LYLA 4UP8A 1H9RA 4NXMQ 1EY4A 1XJVA 1QILA 1IBML 1TY0A 1EYCA 1SJHD 4OWXB 2CFMA 3BYYB 2IL8A 1UE7A 1JWUD 2L55A 3CCUA 1IBKQ 2H5XA 1ML0D 3TP6A 5IGDA 1PZJD 2LSSA 3PUZA 2VXWA 5G3LF 2K01A 3CCMA 3CMEA 3CKIB 1CQVA 4L5TA 1BBXC 1BBUA 1UE5A 5M9OA 5FLXc 3C3LA 1PXUA 5LL6S 3SDZA 3KOJA 3HOVH 3ULLA 4X64Q 1BUVT 1RTOA 2ATWA 4OWTB 4POFA 1H9KA 1HNXQ 5DEHA 5IYCG 2R61A 3TP7A 2UU9L 4RCNA 1GM5A 3BJUA 3D3RA 5CMDA 4FDBA 2EY2A 2K50A 3I90A 1PH7A 4NMZA 1JE4A 2YTYA 1SSOA 4DUZQ 1DYQA 3G71A 1X3PA 2UXCL 1PH6A 1MBYA 4DUYQ 4GN3B 5CYUA 4A4IA 3U58A 4MTKA 3AQQA 1VQAA 3GO5A 3ERSX 1YZ6A 3R8BA 3NBHA 1F2ZA 1SMXA 1NJIC 1JMCA 1ILPA 3RN2A 3OWFA 1EWHA 1I50B 4YWLA 1CFMA 3CP0A 4H0LC 5E3FA 1MKHA 5CBEE 4U673 5K36G 2B63G 3E6ZX 4Q0FA 2KVMA 1OXUA 2MPMA 3K5OA 3PUVA 1D6EC 1KABA 3STBC 1IYVA 5IP9G 1HQRD 1NE3A 1AW7A 5ISRA 2F0SA 1JOOA 4H13C 3G4SA 1SYCA 3DWQA 2DJGC 1I50H 4HR7B 1VF7A 2K7VA 4KV6A 1JOQA 2JE6I 4DAVA 1XNQL 1QB5D 3J7A5 3GTQH 4G4KA 5ELOA 2F3WA 4JI1L 1ASZA 4HJ8A 1IYUA 3DHQA 4DR5L 3U4VA 2VQFL 4DK6C 3BVGA 3S15B 3U50C 4GNXA 3LWUA 2R7FA 1C7YA 5GAGC 1PMRA 3N6RA 4IZ8A 4DV1L 1VQ6A 1J8IA 3SK8A 2LXKA 4LWCA 3MXUA 1WVLA 4BY1B 5C5LA 1DOMA 5EPLA 4DR4L 1YBYA 1E0BA 1X56A 1X3FA 1HFNA 2ZT9C 4M8AA 1EYAA 3RLNA 1VQ9A 2MFIA 3K0YA 4CKCA 2HDLA 3KK7A 1Q86C 2JA6G 4A93B 4BS9A 3GV6A 4QUCA 1DZ1A 1HZ9A 4ME3A 4JI3Q 4XQQA 3NHHA 1RKNA 4OIJA 4K0KQ 3CC2A 1SYGA 2GVAA 4LFBQ 2HQLA 2XIWA 4KKTA 3FP9A 5JJIA 4A3LH 4BY1H 3RZDB 3KJOA 4X65Q 2F0JA 3K6OA 3MA2B 1CKOA 3T53B 4C2MH 1WTHA 1JB3A 2F4VL 1B4OA 1EWCA 1SNQA 3CAMA 1STHA 2ES2A 4A3GG 4UP9A 2WP8J 4TKOB 4A3MB 3CC4A 4X3UA 3N52A 2E5LQ 2K5HA 4R4TA 1N33L 3S17B 2VB3X 1Z47A 1SLJA 1GKHA 4A3KG 4AYBE 3RZDH 4ZRZA 5KGUA 1W2BA 4KHPL 4YWMA 4DV3L 4A3EG 2K05A 1O78A 2MUYA 3I2ZA 2F0LA 1STAA 1U9RA 2Z4HA 2PCFB 4A3BB 2Z6KA 4A3MH 1K9MC 4HIDA 2YU9B 3HOZB 2PNHA 4RGTA 2WKCA 1NY4A 3S17H 3UI2A 3K80C 3A5UA 4JI7L 3I73A 2DUDA 4G57A 1S5ED 3DWAA 4GKJL 3QIAA 4X3TA 4IUNA 1IBLQ 4LF9Q 1VQJA 1O80A 3TREA 1D7QA 1HXYD 4FXKC 4L5SA 3RN5A 4A3BH 5C44G 4O1NA 3M4OB 1OTCA 2PQAA 5IYDG 5IWAQ 2AWOA 1YHAA 5FK9C 1W3SA 1BO0A 2LY7A 1SDFA 2HIVA 4DV2Q 1KDBA 1K28A 4WJ3M 1FL0A 3NE5B 3HZXA 2WIIB 1VQFA 3K5LA 1JB7A 1HRJA 3I4NB 1ENFA 1HPCA 3J7AV 3BDOA 5EPKA 2NB0A 2OWOA 2HDMA 4IPGA 3HOYH 3GTKB 3M4OH 3QOLA 4QGUA 4LF5Q 1AZPA 5IT9E 5I9OA 3IL8A 1YEZA 5IT9L 4DAPA 1K3RA 4K2KA 5I6YA 1TWGB 3M3YB 1STBA 5D65A 1Q3LA 2AQ2B 1PH2A 3I56A 4JK1C 3I4NH 4DV7Q 4CKEA 1Y1WB 2UXBQ 1GUTA 4CBVA 3OW2A 3GTKH 2KENA 1I4XA 3J81c 4LK1C 2HUGA 2R92B 2Q8RE 1TWGH 4YCUA 3VYUA 4ZKCB 3CXCA 3DLLA 4JI5Q 3M3YH 3PIOA 1M8AA 2OCEA 1A62A 4B3SL 4DV6L 1Y1WH 2YTXA 3MXGA 1TXYA 1VQEA 3U4ZA 1X3GA 3D4RA 3GTMB 3W1BA 4FP5D 3HOUB 3JC66 2OT2A 4OX9L 4DK1A 2R92H 4DAMA 4P72A 1EY8A 1PFNA 4RWSC 1WTRA 3PUWA 4DF7A 1EQRA 4LUVA 5CV5A 2EYPA 2B3GA 4ME5A 4JBWA 3GTMH 1DONA 3RZOB 3HOUH 5CR3A 3T16A 4DR7Q 4NP5A 1N9WA 4QUFA 4ZLTF 3LGJA 2Q2TA 3J81i 3KBGA 3SXHA 4K8IA 4HMJA 1D8LA 4A3JB 1G291 1UNSA 4IO9A 2DGYA 1GJXA 1BNZA 3G48A 1DJRD 1H9MA 2OTJA 2R3ZA 2C5CA 1M90C 1RF2D 1M1KC 2AUKA 3WOFA 4RGMA 1RL2A 1PH1A 3RZOH 1SE8A 2BCOA 4EQPA 1O7IA 3MTSA 2HIXA 4AYBB 3ULPA 4LFAL 1SBBB 4A3JH 4C3HG 5NUCA 1WTOA 1N34Q 2JEBI 3D4WA 1PZKD 2Q2HA 4HAEA 1V9PA 4PQXA 5EKIA 3OSOA 5M5YB 1WD0A 1K8OA 1CUKA 3UDXA 1B3AA 2F52A 3D4DA 4DFAA 1G6ZA 3MHBA 4A3DG 3PO2B 3K58A 4LF4Q 4KHVA 2L12A 1C48A 3GDEA 4HIMA 5C4XG 2A5HA 4GKKL 1V1QA 4HSVA 1N36L 4B3RL 4JOIA 3NK9A 2B2YC 3FKIG 5M5YH 3J7ZC 3D6WA 1BVSA 1I3QH 4K6LA 4EQOA 1FVIA 4R1JA 1II3A 2F0FA 4N8X1 4MHEA 3H09A 4JV5L 3PO2H 1X54A 4K5VA 4B9WA 1TT2A 4IFDJ 2G9DA 3NUCA 5IGCA 2A69C 1GUOA 3MEHA 2ZTDA 3I4MH 4AH6A 1X9NA 3T1HL 3HGBA 2L9HA 3ICEA 1EY9A 1BXTA 3O13A 1EOVA 3I91A 1QVGA 4JI2L 4NXNQ 1OXVA 5EAYA 2UUCL 1H9SA 2FMCA 5LMNQ 1SYDA 4U68A 5CBAE 1EY7A 2WV6D 5I6WA 1N32L 4LF8L 1WOCA 4IOAA 4K8JA 4OGQC 1U5KA 3S2DB 4YIJA 4UAIA
chains in the Genus database with same CATH topology
5HGTA 1F9RA 3LWEA 4ZAIA 1HA5A 2Z1CA 2QKIC 3TMEA 2NWGA 2ICIA 3GTJB 2EJFC 3NWSA 4ZKBB 1JC7A 1Q90A 3EJIA 5J1ZA 4DGZA 4PMBA 4HTHA 5EGTA 2E2HB 1XX8A 3DEPA 2B63B 2R7ZB 1NAPA 2KOLA 3OHXC 2A6HC 4Y7NB 1VMCA 3K7AB 1Y8OB 4C3JG 2IPKD 2PNRC 5K36H 1U4LA 5T1GA 3X3NA 1WTQA 1FNUA 3P1HA 1FNVA 1PRTD 4HCEA 2PW5A 2K5WA 2KQ3A 2NVTB 1B9MA 1AZQA 3IKJA 1BQQT 1FD7D 1SAPA 4Q5VA 1TS4A 5COYA 1G91A 4DXGA 2NZ1D 1S4ZA 2EY1A 3AMUA 2IX1A 2JEAI 1F2MA 2JA6B 5DM63 2CVRA 3OOCA 3M85A 1K83B 5C4ZA 1BR9A 1IL8A 3GQBA 3URYA 5KYLA 1FYCA 1NR2A 1CM9A 1E2VA 2B2VA 2NTTA 3VYSA 1CTMA 2JA7B 1WTXA 3MZ5A 1PRTB 4A3KB 1TU2B 2MP1A 1A3UA 3KUPA 3ITPA 2B2TC 3A7AB 3FPUB 1CA5A 1KDAA 3H3VC 3J7AF 5EJWA 2NTSA 3HS0C 3DM1A 1T5XD 3NTHA 3MXNA 1EZ8A 1BCPC 1EFID 4LMQD 1D2BA 3NWTA 4IUQA 5I9PA 1PFMA 2NVQB 1PRTC 4XIGS 5DM73 1SNMA 2V4DA 3HOVB 1C4QA 1HTPA 1CI3M 3TSSA 2L4NA 3H94A 2SOBA 3QJYA 2VNUD 2WKDA 2JP1A 3A8IE 1A15A 5JPMC 2F3VA 3A8JE 3MXPA 3R93A 2K03A 4P2CB 1VDZA 1KTKA 3K57A 1V1PB 1EEID 3BS1A 4BA2I 1Y8PB 4RA8A 1CZGA 2L11A 4RKBA 2RVLA 2H1EA 3L9AX 1SNOA 3MFYA 5A2QE 1U4RA 5A2QL 4V0BA 1U4MA 1K8MA 3GTQB 1ZYRD 1U4PA 5IOCA 4CGYB 3IFDA 1JCKB 3D8GA 3OWEB 1CQFA 1KDCA 4KKUA 2XRQD 3F2UA 4NDXA 5FKAC 3OIPA 3SK4A 1GHKA 1SXTA 2LMCB 5KEEA 1EIHA 3GP7A 2X6GA 5E4WC 5KYIA 1XWEA 2DNEA 2B2UC 3AU7A 3P75A 3KF8A 4C3HB 2F0VA 1LT3D 2ID0A 1BCPF 4C2MB 3PV0A 2EVBA 1O7ZA 3GTOB 4EQNA 2I07B 1EQTA 1NSNS 1ICWA 1TS5A 3M7NA 2A6ED 5C4XB 1FR3A 2DNCA 3CU7A 1F77A 1E2WA 2BDNA 3ONAB 3FKIB 1EL0A 4H7BA 1LTSD 4J8QA 3TP8A 4F7XA 1I4RA 4PMCA 2E2DC 2F0DA 2D9UA 5C3XA 3R3OA 5ELEA 4IFDG 5FO7B 1E2ZA 5C3WA 2WB1B 2SDFA 2XWBB 5ELFA 4RFBA 2HCCA 4OO1I 2NVYB 1R9TB 1ZYRC 3D31A 2DY7A 1GXDC 1QWYA 3T56B 1LTAD 2Q8TA 3M4YA 3HOYB 2A68D 4XT1B 2TSSA 4KY5A 2IX3A 1Q1EA 2NN6I 4RGOS 1VCIA 1NCVA 3BG3A 3SVMA 4FXGC 5J39A 3GTLB 5C0XG 2NUCA 5EKKA 1DM0B 3C1FA 4N9PA 3X3MA 1KNEA 2AQ1B 5M3FB 1V43A 4RAUC 3HG9A 2YYZA 4C3JB 4ILWA 1STGA 2A6EC 1LO5D 2X6LA 4XXEA 2N88A 5IODA 2F0HA 3H0GB 1XYIA 3G7LA 2BE5D 5CV4A 4NKLA 1A3VA 1BDOA 5A35A 5EQ0A 5FO9B 1A3TA 3EA6A 3EROA 1CK1A 5ELCA 2KEEA 4C1NI 2PQEA 5M5WB 1STNA 1EQVA 3NXWA 3QG1A 3SK6A 4KN7C 3MAQA 1DCZA 2RKSA 2JA5B 1YNJD 3PUYA 2Y0SB 1QNUA 2RA4A 3PIO3 1QE6A 3TN2A 4OL7A 5DAUA 2K1BA 2CW0D 2GA4B 4WFN3 1QCBD 4IFDI 3P7JA 3BDCA 2A68C 4F88A 4HCSA 2F4IA 2F0NA 2IWHA 3GD7A 5C6AA 3I4LA 4ZQ3A 1OXTA 2KJXA 4KD4A 3V2TA 4LJZC 2CQAA 1AFPA 2DY8A 1UEAB 3GV3A 4QCLA 1SYEA 1DD2A 1HA6A 2F0KA 3A7LA 1Z6HA 5ELDA 1OXSC 1SE2A 3NTIA 1I3QB 3W3AA 4IUTA 4DK0A 2A74C 1R4PB 1LTRD 3Q23A 4IUPA 1MSGA 1WD1A 3DEOA 2J4XA 3I4MB 2R6GA 1T5EA 3TP5A 4XQJA 2AUJD 5JJZA 1UUPA 1ONLA 2L5TA 2B2WC 5JEAG 3NBIA 5C0XI 1KNAA 5FOBB 2BE5C 4LAAA 5G3LD 3K59A 4K6DA 4S3SA 2E76C 2PMZB 4PMWA 5I2XA 1TVXA 3CHBD 2F1MA 3HOXB 4XT3B 3M7GA 1SMYD 2JXMB 5IGGA 5M5XB 1F9PA 3FDTA 4DNTB 1PTOH 1GUSA 1LV9A 1LTTD 4F87A 5FLXE 5FLXL 1SNCA 2RDGA 1YNJC 3RLFA 3DUZA 2IT1A 4FF4A 4V190 4ZUIA 3T4AC 3Q6SA 1D5XC 2CW0C 4KJOA 4QF4A 4QMGA 1W6JA 1QJOA 1I6HB 4L63B 1Q8IA 2E75C 3BYTB 3SR1A 3C46A 4L6TB 2JYOA 1TIID 2RDFA 4WRDA 2O5JC 2EYFA 1LTID 2IX0A 3T51B 3I70A 3HOWB 1W6KA 3U9SA 2CHBD 1HFGA 3VR6A 2EYLA 4A3IB 4CJ2C 1Z7TA 1EEFD 1MI2A 5EKLA 1TWFB 5IGFA 1SNPA 3ERQA 1C8CA 3MVVA 2WAQB 2F0OA 2E74C 1D1IA 2JSOA 3MFGA 3SE0A 3S16B 3BZDB 2PZUA 2L1BA 2B2YA 2G9HD 3TBIB 1RCVD 2ZXOA 3FEWX 4QIWB 2Q8IB 4OIKA 1CHPD 3D6CA 5ELBA 2EY5A 2XRSD 2QDBA 2EJMA 4E6IA 3NP8A 5T1IA 3SK5A 2LFNA 4G7HC 1RTNA 1PLFA 5LL6X 4TQUS 3S1NB 3S9WA 4NW2A 2F0EA 1PZID 3W2DA 1RODA 4FF1A 2H4OA 3KLRA 2EJGC 4A3FB 2PZWA 3K5NA 2C9OA 5HURA 4K5XA 2SNMA 4ULLA 4C56C 2FJ2A 5IIFA 1CHQD 1ENCA 4A3GB 1R4QB 5C5MA 1HHVA 2F0PA 3PUXA 1QG7A 2EYJA 1IW7D 3GTGB 2XN9C 3TDQA 3CQZB 4A3EB 2AWNA 3OMGA 1Q12A 3R2IA 4PV1C 2A73B 4TSSA 4B08A 1OXXK 1Y1VB 2DN8A 4RHSA 3HP3A 1TWAB 1L0XB 2O4XA 5I2YA 4UDUC 1IKLA 2EYHA 2RQXA 2F0GA 2WINB 4MIUA 1BF4A 1RJTA 5C44B 3VA5A 2LS01 1SE4A 5DNFA 1JR0D 3EFXD 3HRZC 1I4HA 4X3SA 4EVOA 2K32A 3GTPB 4K5WA 4IURA 2K04A 2BDOA 2QCPX 5JOBA 2SNSA 2NYZD 4FXDA 4HSPA 4TRDA 5EPJA 2Z4IA 1XXGA 4KY6A 1TQOA 1EY0A 5CV9A 1A2UA 2RSOA 4IALA 5CGKA 1DOKA 4BA1I 2KEDA 1O7LA 4OO1G 3MWYW 4ABNA 4HEDA 4XYQA 1TWCB 1Y8NB 4DNRB 5C0XH 2ZXRA 3J81E 1TWHB 3J81L 5CORA 1ESRA 1KLUD 2IJ0A 3I8ZA 4FYDA 2ICEC 4CKBA 3PIP3 2RDHA 5CV7A 1F2YA 2OF1A 4BBSB 1NR4A 3S1MB 5FO8B 2B8GA 1VF5C 1IW7C 2KCNA 4KHZA 4WORA 2QF7A 1EIGA 2B2TA 2M9VA 2NN6G 1KLGD 1JWSD 3G6JB 2Z8LA 2FINB 1EYDA 1IKMA 1STEA 5JPNC 3KLSA 2M00A 1ILQA 2XSCA 2K33A 2O2LD 2EPBA 2F03A 3QB3A 2ZXPA 4WJWA 3KBXA 5C4HA 5AFWA 1G2TA 1I4GA 5D3DA 4OHJA 2F0IA 3NQIA 3MC0B 1CA6A 1NUCA 1SYFA 1AEXA 4EGVA 2O5IC 4DXFA 3BDLA 3BVZA 1HCZA 3PMFA 2F0MA 5EBDA 3A54A 3HEJA 3SHLA 2K5DA 3R2TA 4J6HA 3CRLC 1RHPA 5C3EB 4A3DB 1PRTF 1ET6A 2FHTA 4KK7A 4DAYA 1ZKOA 3IAYA 3CRKC 2HCIA 5I4DA 2RSNA 4M1UB 5KRUA 2XNAC 1DXMA 1PYWD 1MD2D 5LHY1 3T13A 1SJED 1B2TA 4ZK9B 2BOSA 3RD4A 2XVSA 2XWJB 1GHJA 5BN3A 2NVXB 1LT4D 3Q22A 3OW7A 5JVG3 4I7ZC 3K5MA 1FNWA 3ND8A 2F0WA 2EOTA 4CJ0B 2M2LA 3OPOA 5JEAH 2B39A 2LKVA 1SYBA 4IN3A 2NBFA 4KD3A 3PO3B 3J80E 3FRPB 3J80L 1V1PA 4HMIA 4FF2A 2EDGA 4QB4A 1I4QA 2OEOA 4C3IG 4KJNA 4RH6A 3TZUA 3JAME 3JAML 5F2DA 4CJ1B 5E1FA 3NQTA 1X3QA 2PW7A 2B2UA 1B44D 1JICA 2QILA 4CHTB 1STYA 1H9JA 4F8MA 1WCMB 4ID6A 1TY2A 5K5PA 3S1RB 4K2LA 1UAPA 1HTLD 2EE1A 4DU9A 2HQEA 1B50A 1SEBD 2PYKA 5BN5A 2K6AA 3KLSX 5CV8A 3I72A 3VA7A 4FNFA 2WACA 1H9SB 3VYTA 5KNBA 4BY7B 3FPPA 2D62A 4DN4M 2E2JB 3DWPA 3E5SA 3S2HB 4R8NA 1HUMA 1AN8A 2TMPA 1WTPA 3A55A 1ET9A 1CZWA 3VR2A 4IQZA 4H44C 1LTBD 2KA7A 2A69D 3C2PA 3WOEA 3EQLC 5D3IB 2J0TD 1GUGA 1JQYD 2N55A 4FO2A 4KY7A 3A56A 1PTOD 2R93B 5CV6A 1WTVA 3S14B 5IGEA 3EVQA 4X3KA 3P20A 1D5MC 4J1MA 4L8JA 1Q1BA 3RUZA 1B1ZA 1SE3A 4KMUC 1O7YA 1S5CD 1ZXTA 2F0TA 3I3CA 3OIQA 4RHRA 3SEBA 3E0JA 2K28A 3TZDA 5KIXA 5D14A 1VMPA 1EU3A 3NTKA 1PFBA 1LABA 4FVMA 2A6HD 2JA8B 3OMCA 1X32A 4K14A 1DOLA 2EZVA 1GUWA 1TS3A 2QEJC 1I6VC 4I65A 1PTOB 1WTWA 1J9OA 4DA2A 4XDXA 2MJ8A 1CT1D 2X69A 3DXJC 3VR5A 3H6MA 3LNNA 1Y69U 5JVH3 3ND9A 5CC4A 1KAAA 1IHZA 3V05A 2VB2X 4Z9CB 2MGSA 1RDPD 2OXPA 4C1NK 1B9NA 5M3MB 3FVQA 4O42A 1L0YB 1GOZA 2VUMB 3V96A 1D1KA 1TS2A 1GUNA 5C4JB 1A6XA 1TKWB 2AQ3B 1YNND 1PTOC 1HUNA 3QOJA 2IW3A 3HKZB 1ENAA 5IGBA 2F0UA 4XYOA 5KNDA 5J22A 2KHSA 4XTCS 3A8KE 1PDQA 4HN7A 4OO1H 4KN4C 3AB9A 4G7OC 4ZYSA 3Q24A 1LLRD 1S5DD 2PPBC 2B2VC 1EY5A 2EY6A 2RBMA 1BOSA 1HQMC 1LTGD 4PNYA 3RMHA 1M4VA 1QNKA 4RKLA 1LT6D 2D2CC 5C0XJ 1F9QA 1G8ZD 1TR5A 4ODGA 4BBRB 3VYRA 2J7ZA 2NN6H 2E2IB 3QO2A 2B2WA 2K5QA 3NSWA 2EYOA 2KUMA 3Q0AA 4R8IA 1G2SA 2FMMA 4N9TA 4RGNA 3DMUA 3LX0A 1BCPD 2EYMA 3C1EA 2PZTA 2L0CA 1I4PA 1OO9B 1SMYC 1LACA 4IUUA 1B53A 1EU4A 1MGSA 1D5ZC 3L3OC 5TSSA 1EY6A 4KKSA 4RCOA 2KCCA 3J7YW 1S5FD 1JWMD 1AP0A 4XQNA 1YNNC 2KECA 4BWGB 4B9XA 3U9OA 2F0QA 4KI0A 1ESFA 2PO4A 1XTCD 1SFOB 1EZ6A 5EBCA 1JORA 5BN4A 1S5BD 3L7ZC 3BVMA 2BA0A 1F2LA 1BCPB 4GZYC 2FFKB 2SEBD 4KTAA 3QWNA 1EOTA 1FGBD 1PTOF 3IFTA 5E4XA 3VR4A 4FF3A 2D5DA 3S1QB 2BA1A 1JOKA 1A2TA 1ZEQX 4IFDH 1QOHA 3VR3A 1LT5D 2EXZA 2B8FA 3H91A 2I46A 4C3IB 1SNDA 4G7ZC 3ZYYX 1RD9D 1F9SA 4MN3A 5KNCA 3FMCA 5JEAJ 1MSHA 5JAVA 3NPPA 1V8QA 2ENBA 3WDNA 4IUVA 1V1OA 2MHVA 4ZUJA 4R9WA 1H9RA 1EY4A 1QILA 1TY0A 1EYCA 1SJHD 3BYYB 2IL8A 1JWUD 2L55A 1ML0D 3TP6A 5IGDA 1PZJD 3PUZA 2VXWA 5G3LF 2K01A 3CKIB 1CQVA 1BBXC 5M9OA 3C3LA 1PXUA 5LL6S 3SDZA 1BUVT 1RTOA 1H9KA 5DEHA 2R61A 3TP7A 4RCNA 3D3RA 5CMDA 2EY2A 3I90A 4NMZA 1JE4A 1SSOA 1DYQA 1X3PA 1MBYA 5CYUA 3GO5A 3R8BA 3NBHA 1F2ZA 1ILPA 3OWFA 1EWHA 1I50B 1CFMA 4H0LC 5E3FA 5CBEE 4U673 5K36G 3E6ZX 4Q0FA 2KVMA 1OXUA 2MPMA 3K5OA 3PUVA 1D6EC 1KABA 1IYVA 1HQRD 1AW7A 5ISRA 2F0SA 1JOOA 4H13C 1SYCA 3DWQA 4HR7B 1VF7A 2K7VA 4KV6A 1JOQA 2JE6I 4DAVA 1QB5D 4G4KA 2F3WA 1IYUA 3DHQA 3BVGA 3S15B 3LWUA 1PMRA 3N6RA 4IZ8A 1J8IA 3SK8A 3MXUA 1WVLA 4BY1B 5C5LA 1DOMA 5EPLA 1E0BA 1HFNA 2ZT9C 4M8AA 1EYAA 3K0YA 4CKCA 2HDLA 3KK7A 4A93B 4BS9A 3GV6A 4QUCA 1DZ1A 4XQQA 3NHHA 1RKNA 4OIJA 1SYGA 2XIWA 4KKTA 3RZDB 2F0JA 3K6OA 3MA2B 3T53B 1JB3A 1B4OA 1EWCA 1SNQA 1STHA 2WP8J 4TKOB 4A3MB 4X3UA 3N52A 3S17B 2VB3X 1Z47A 4ZRZA 5KGUA 2K05A 1O78A 2MUYA 2F0LA 1STAA 1U9RA 2Z4HA 2PCFB 4A3BB 2YU9B 3HOZB 4RGTA 2WKCA 3UI2A 3I73A 4G57A 1S5ED 3DWAA 3QIAA 4X3TA 4IUNA 1O80A 1HXYD 4FXKC 4O1NA 3M4OB 2AWOA 5FK9C 1BO0A 2LY7A 1SDFA 1KDBA 3NE5B 2WIIB 3HZXA 3K5LA 1HRJA 3I4NB 1ENFA 1HPCA 3J7AV 3BDOA 5EPKA 2NB0A 2HDMA 3GTKB 3QOLA 1AZPA 5IT9E 5I9OA 3IL8A 4DAPA 5IT9L 4K2KA 5I6YA 1TWGB 3M3YB 1STBA 5D65A 1Q3LA 2AQ2B 4JK1C 4CKEA 1Y1WB 1GUTA 4CBVA 1I4XA 4LK1C 2HUGA 2R92B 2Q8RE 3VYUA 4ZKCB 1M8AA 3MXGA 3D4RA 3GTMB 4FP5D 3HOUB 2OT2A 4DK1A 1EY8A 1PFNA 4RWSC 1WTRA 3PUWA 4DF7A 5CV5A 2EYPA 4ME5A 4JBWA 1DONA 3RZOB 5CR3A 3T16A 4NP5A 4QUFA 4ZLTF 3KBGA 3SXHA 4K8IA 4HMJA 4A3JB 1G291 1UNSA 1GJXA 1BNZA 1DJRD 1H9MA 2R3ZA 2C5CA 1RF2D 2AUKA 3WOFA 4RGMA 2BCOA 4EQPA 3MTSA 4AYBB 1SBBB 4C3HG 5NUCA 1WTOA 2JEBI 3D4WA 1PZKD 4HAEA 4PQXA 5EKIA 3OSOA 5M5YB 1WD0A 1K8OA 1B3AA 3D4DA 4DFAA 1G6ZA 3MHBA 3PO2B 3K58A 4KHVA 2L12A 1C48A 2A5HA 4HSVA 3NK9A 2B2YC 3D6WA 4K6LA 4EQOA 1II3A 2F0FA 4MHEA 3H09A 4K5VA 4B9WA 1TT2A 4IFDJ 2G9DA 3NUCA 5IGCA 2A69C 1GUOA 3MEHA 3HGBA 2L9HA 1EY9A 1BXTA 3O13A 3I91A 1OXVA 1H9SA 2FMCA 1SYDA 4U68A 5CBAE 1EY7A 2WV6D 5I6WA 4K8JA 4OGQC 3S2DB 4YIJA 4UAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDO A;  2EJM A;  5A35 A;  4H13 C;  1E2V A;  3QIA A;  4G7Z C;  2JXM B;  2NN6 H;  1G29 1;  4G7H C;  1LAB A;  1GJX A;  4IFD G;  1CTM A;  4BA1 I;  3MFY A;  4HR7 B;  1H9M A;  1VF7 A;  2A6H D;  1ZKO A;  2K7V A;  1O7L A;  4TQU S;  3CRK C;  4DNT B;  1E2Z A;  2EJF C;  1GUS A;  5KNC A;  5BN5 A;  3QG1 A;  3FMC A;  2JE6 I;  2AUK A;  3I72 A;  4OO1 G;  1I6V C;  1TU2 B;  1DXM A;  2AWO A;  3VA7 A;  1YNJ C;  4KN7 C;  1K8M A;  1Q90 A;  1Y8N B;  1H9S B;  1ZYR C;  1IYU A;  1DCZ A;  3KLR A;  3RLF A;  3PUY A;  4DNR B;  2EJG C;  2IT1 A;  1V8Q A;  3DXJ C;  3NE5 B;  3VR5 A;  3WDN A;  3A7A B;  3FPP A;  3LNN A;  2D62 A;  5C0X H;  1Y69 U;  1H9R A;  3D31 A;  3ND9 A;  1HPC A;  2CW0 C;  1SMY C;  2JEB I;  3BDO A;  1LAC A;  3T56 B;  1GHJ A;  4KKU A;  3LWU A;  5BN3 A;  1QJO A;  2A6H C;  1K8O A;  3OW7 A;  3M4Y A;  1PMR A;  3N6R A;  2A68 C;  1VF5 C;  2B8G A;  3PUX A;  1GHK A;  2E75 C;  4I7Z C;  1IW7 C;  5KNB A;  1B9N A;  4KHZ A;  3MXU A;  2A68 D;  3ND8 A;  3VR2 A;  1IW7 D;  2QF7 A;  2LMC B;  3PUZ A;  4IQZ A;  4H44 C;  3GD7 A;  3OPO A;  1Y8O B;  4KKS A;  2KA7 A;  2ZT9 C;  5JEA H;  2A69 D;  3I4L A;  1OXT A;  2KCC A;  4JK1 C;  1Q1E A;  2NN6 I;  2O5J C;  2NN6 G;  2PNR C;  3EQL C;  5K36 H;  3T51 B;  1Q12 A;  3U9S A;  1GUN A;  1VCI A;  1GUT A;  1YNN C;  2DNE A;  4LJZ C;  4PV1 C;  1TKW B;  3SDZ A;  3VR6 A;  1A6X A;  4XIG S;  3BG3 A;  1Z7T A;  1GUG A;  4LK1 C;  1OXX K;  4KKT A;  1DD2 A;  1H9K A;  2V4D A;  2DN8 A;  3A7L A;  1Z6H A;  4KI0 A;  2EDG A;  1OXS C;  5KND A;  4RCN A;  5C0X G;  3W3A A;  3T53 B;  4DK0 A;  5BN4 A;  1HTP A;  3TZU A;  4XTC S;  1B9M A;  2A69 C;  2K33 A;  1CI3 M;  3PUW A;  1GUO A;  3L7Z C;  3IKJ A;  3A8K E;  3H94 A;  3PV0 A;  4TKO B;  2E74 C;  2EVB A;  3QJY A;  3SE0 A;  4OO1 H;  3D4R A;  3HGB A;  1V43 A;  2JEA I;  2BA0 A;  4KN4 C;  3AB9 A;  4G7O C;  2R6G A;  1T5E A;  3A8I E;  4GZY C;  3P20 A;  4L8J A;  4DK1 A;  2AUJ D;  1Q1B A;  2YYZ A;  2PPB C;  3A8J E;  2A6E C;  1IYV A;  1OXV A;  3M7N A;  2A6E D;  3IFT A;  4KMU C;  1ONL A;  1FR3 A;  1H9S A;  1H9J A;  1HQM C;  1O78 A;  2DNC A;  2K32 A;  2L5T A;  2D5D A;  3VR4 A;  3OOC A;  1EWH A;  1E2W A;  2BA1 A;  5JEA G;  3M85 A;  1CFM A;  4H0L C;  2PCF B;  1VDZ A;  4IFD H;  3GQB A;  2BDO A;  2BE5 C;  2O5I C;  4JBW A;  5K36 G;  3VR3 A;  2Q8I B;  1HCZ A;  2BE5 D;  2E76 C;  1OXU A;  4OGQ C;  2D2C C;  3PUV A;  2B8F A;  3I73 A;  4BA2 I;  3CRL C;  1Y8P B;  1FYC A;  2F1M A; 
#chains in the Genus database with same CATH topology
 1QZG A;  5HGT A;  3JAM c;  1F9R A;  3LWE A;  2E8G A;  4ZAI A;  1UE1 A;  1HA5 A;  1Z9F A;  3BZK A;  2Z1C A;  2QKI C;  3TME A;  2NWG A;  4MNO A;  2ICI A;  3GTJ B;  2EJF C;  2RHQ B;  2VQE Q;  3NWS A;  4X62 L;  5IYC H;  4ZKB B;  3S2D H;  3UE1 A;  1JC7 A;  5IYB G;  1Q90 A;  4A3C G;  3EJI A;  5J1Z A;  4DGZ A;  2I5L X;  4PMB A;  4HTH A;  5EGT A;  4Y52 H;  2HD3 A;  5J3B A;  2E2H B;  2KHJ A;  4LFC Q;  1XX8 A;  3DEP A;  2BH2 A;  2B63 B;  2R7Z B;  1NAP A;  1FJG L;  2KOL A;  3OHX C;  3GTJ H;  4YY3 L;  1SN8 A;  2A6H C;  1PH8 A;  1PYS B;  2N49 A;  3J80 i;  5M3F G;  3PF4 A;  2UUA Q;  1K8G A;  4LUZ A;  1J5E L;  4Y7N B;  1VMC A;  3K7A B;  4DR6 Q;  1Y8O B;  3E0E A;  4C3J G;  5IT9 c;  1GD7 A;  3KDF A;  3JAM i;  2E2H H;  2IPK D;  2PNR C;  5K36 H;  2B63 H;  3EN2 A;  1U4L A;  4NB3 A;  4R4O A;  5T1G A;  3X3N A;  1WTQ A;  1FNU A;  3P1H A;  1FNV A;  5IP9 H;  1PRT D;  4HCE A;  2PW5 A;  4BY7 G;  4N8F A;  2K5W A;  4Y7N H;  3KJP A;  1QVC A;  3K7A H;  2KQ3 A;  2NVT B;  1B9M A;  4IJL A;  3S16 H;  3OTO Q;  1AZQ A;  3IKJ A;  1BQQ T;  1KIX A;  1FD7 D;  1SAP A;  4Q5V A;  1TS4 A;  3S24 A;  4JG2 A;  5COY A;  1G91 A;  5GAH C;  1VQG A;  4DXG A;  5L37 A;  2NZ1 D;  1S4Z A;  2EY1 A;  1RIP A;  3AMU A;  2OQK A;  2IX1 A;  2JEA I;  1F2M A;  2JJQ A;  3CMA A;  2NVT H;  2JA6 B;  5DM6 3;  1VQ4 A;  2Y0S G;  2CVR A;  3OOC A;  3M85 A;  1K83 B;  5C4Z A;  3ER0 A;  1BR9 A;  1IL8 A;  3GQB A;  4CDD C;  3URY A;  5KYL A;  4H02 A;  4DR3 L;  3BU2 A;  1FYC A;  2R93 G;  1NR2 A;  4JI0 Q;  1CM9 A;  1E2V A;  3ULJ A;  2B2V A;  2IHF A;  4P71 A;  5AJ3 Q;  2NTT A;  2JA6 H;  3VYS A;  3HFZ B;  1CTM A;  1K83 H;  4JI4 Q;  2JA7 B;  1WTX A;  3MZ5 A;  1FGU A;  1HNX L;  1VS0 A;  1PRT B;  2V1C C;  3PSI A;  4A3K B;  1TU2 B;  2HHH L;  2AMC B;  5FLM G;  2MP1 A;  1A3U A;  4DR2 L;  3KUP A;  1K3B C;  3ITP A;  1VQP A;  1AE2 A;  4DR1 Q;  2B2T C;  4CDE C;  1XNR L;  3A7A B;  1XMO Q;  3FPU B;  1S3O A;  1HNZ L;  4DUY L;  5ELN A;  1CA5 A;  1KDA A;  3H3V C;  3J7A F;  4LF6 L;  5EJW A;  1KRS A;  2NTS A;  3HS0 C;  3DM1 A;  1T5X D;  4A3K H;  1KAW A;  3NTH A;  2WFW A;  2MNA A;  4EQ5 A;  3CQZ H;  3MXN A;  4YCV A;  1EZ8 A;  1BCP C;  1EFI D;  3E3X A;  4LMQ D;  2I5M X;  1D2B A;  3NWT A;  1X55 A;  4IUQ A;  5I9P A;  2BH8 A;  1PFM A;  2NVQ B;  4HJ5 A;  1PRT C;  4XIG S;  5DM7 3;  1SNM A;  4DV4 Q;  2V4D A;  3HOV B;  1C4Q A;  3HOX G;  1VQC A;  1HTP A;  2XGT A;  3PIP A;  4POG A;  2QW7 A;  1CI3 M;  2WB1 E;  3TSS A;  4O0A A;  2L4N A;  3H94 A;  2SOB A;  3QJY A;  2NVQ H;  2VNU D;  5IYD H;  2WKD A;  2JP1 A;  3A8I E;  1A15 A;  2CH4 A;  5JPM C;  2F3V A;  5M3M G;  3A8J E;  3KF6 A;  4LF7 L;  3MXP A;  3R93 A;  2K03 A;  4P2C B;  2MQH A;  1VDZ A;  1MIU A;  1KTK A;  3K57 A;  4DV0 Q;  1V1P B;  1EEI D;  3FHW A;  3HKZ G;  4O2D A;  3BS1 A;  4BA2 I;  1Y8P B;  4RA8 A;  1CZG A;  2L11 A;  4RKB A;  2RVL A;  2Q2U A;  3CD6 A;  2H1E A;  3L9A X;  2VL6 A;  1SNO A;  3MFY A;  2HT1 A;  4LFB L;  3K7U C;  4GOP B;  5A2Q E;  1U4R A;  1WFQ A;  5A2Q L;  3HOW G;  4V0B A;  4DNI A;  1U4M A;  2UUB L;  4X65 L;  4A3I G;  1K8M A;  4GLA C;  2ZM6 L;  1CKN A;  3GTQ B;  1ZYR D;  1U4P A;  5IOC A;  1E1O A;  4CGY B;  3TRZ A;  2PQA B;  3IFD A;  1JCK B;  3D8G A;  3F2B A;  2VY3 A;  3OWE B;  1CQF A;  1KDC A;  5HY6 A;  3S1M H;  1A63 A;  1NTG A;  2WAQ G;  4KKU A;  2XRQ D;  3A74 A;  3F2U A;  1NNX A;  4NDX A;  5FKA C;  3OIP A;  3SK4 A;  1GHK A;  2MO0 A;  1SXT A;  2LMC B;  1XMQ L;  1QUQ A;  5KEE A;  4AIM A;  3CPW A;  3B6Y A;  1EIH A;  3PF5 A;  3GP7 A;  2X6G A;  5E4W C;  5KYI A;  4GOP C;  1XWE A;  2DNE A;  2Z6B A;  3EBE A;  2B2U C;  1WI5 A;  3J81 j;  3K8A A;  3AU7 A;  1MJE A;  3P75 A;  3KF8 A;  3ZJY C;  4LF9 L;  4C3H B;  2F0V A;  3RR5 A;  4DK3 C;  1LT3 D;  1ASY A;  2ID0 A;  3AFQ A;  1BCP F;  4C2M B;  3PV0 A;  2D0P A;  5IWA L;  2EVB A;  1O7Z A;  3GTO B;  4EQN A;  2I07 B;  1EQT A;  2Q2I A;  1NSN S;  2Y0S E;  1ICW A;  1B7Y B;  1TS5 A;  1X3E A;  2A6E D;  2QEX A;  3M7N A;  4C3H H;  1FR3 A;  5C4X B;  2DNC A;  3CU7 A;  4DPG A;  4A3F G;  1F77 A;  1E2W A;  2BDN A;  3ONA B;  1KQS A;  3FKI B;  1EL0 A;  4H7B A;  4LF5 L;  1LTS D;  4J8Q A;  3TP8 A;  4F7X A;  1I4R A;  4PMC A;  2E2D C;  3UDF A;  3GTO H;  2F3I A;  2F0D A;  2D9U A;  4A3D H;  5JJL A;  5C3X A;  3R3O A;  5LMU Q;  5C4X H;  5ELE A;  2IHE A;  1YIT A;  4IFD G;  1VQD A;  3FKI H;  5FO7 B;  2I0Q A;  1E2Z A;  2WB1 B;  5C3W A;  2SDF A;  2XWB B;  4B3M Q;  5ELF A;  4RFB A;  2HCC A;  4JVZ A;  4OO1 I;  4JI6 Q;  2NVY B;  1R9T B;  1ZYR C;  1Y1V G;  1I5F A;  3NEN A;  4PG3 A;  4BXX G;  3D31 A;  2DY7 A;  4P73 A;  3RLO A;  1VQM A;  1Q8K A;  4OWW B;  4GLV B;  1GXD C;  1QWY A;  3T56 B;  1LTA D;  4OEM B;  2Q8T A;  4JI1 Q;  3M4Y A;  1VQI A;  1K0S A;  5GRO A;  3HOY B;  2A68 D;  2NVY H;  1R9T H;  3CCV A;  4XT1 B;  4DR5 Q;  2TSS A;  2K75 A;  4KY5 A;  2IX3 A;  1VQB A;  3DM3 A;  1Q1E A;  2NN6 I;  4RGO S;  3W5O A;  1VCI A;  3T1Y Q;  3TS2 A;  2PMZ E;  3UDI A;  1B8A A;  4DR7 L;  2GVB A;  3MEF A;  4DV1 Q;  2UXD L;  1NCV A;  3BG3 A;  1ICF B;  4TVA B;  3SVM A;  4DR4 Q;  4FXG C;  5J39 A;  3GTL B;  3WWV A;  2NUC A;  5C0X G;  5EKK A;  2NZH A;  1DM0 B;  3C1F A;  4N9P A;  3X3M A;  1KNE A;  4R4C A;  2AQ1 B;  5M3F B;  1V43 A;  2A8V A;  4RAU C;  4A3C H;  3HG9 A;  1YHB A;  2YYZ A;  4C3J B;  4GLX A;  4ILW A;  1STG A;  2A6E C;  4IOC A;  3GTL H;  1N34 L;  2ALY B;  2F4V Q;  2CWP A;  1LO5 D;  2X6L A;  4XXE A;  2N88 A;  4YHH L;  1L1O B;  5IOD A;  2F0H A;  2R7D A;  1WYD A;  3S1R H;  3H0G B;  1VQ8 A;  1XYI A;  5M3F H;  3G7L A;  2BE5 D;  1N33 Q;  5CV4 A;  4NKL A;  4BBS G;  1A3V A;  4KHP Q;  1BDO A;  4C3J H;  5A35 A;  4DV3 Q;  5EQ0 A;  5FO9 B;  1A3T A;  3EA6 A;  3PQI A;  2CQO A;  3ERO A;  1CK1 A;  4IPH A;  5ELC A;  1SR3 A;  2KEE A;  3CC7 A;  2CKZ B;  1E7Z A;  4C1N I;  2PQE A;  5M5W B;  1STN A;  4B3T L;  3H0G H;  1EQV A;  4RG1 A;  3NXW A;  3QG1 A;  3SK6 A;  2ZTC A;  1PH5 A;  1JE5 A;  4JI7 Q;  4JYA Q;  4BY7 H;  4KN7 C;  2A19 A;  3MAQ A;  3CCS A;  2G5D A;  1DCZ A;  2RKS A;  2JA5 B;  1YNJ D;  3PUY A;  2Y0S B;  1QNU A;  2WAQ E;  2GN5 A;  2RA4 A;  3PIO 3;  1QE6 A;  2P5Z X;  3TN2 A;  3H3V I;  1L1O C;  4OL7 A;  1KL9 A;  2K1B A;  5DAU A;  2CW0 D;  5M5W H;  2GA4 B;  4WFN 3;  1QCB D;  4CDF C;  4IFD I;  3P7J A;  4PZ8 A;  3BDC A;  2A68 C;  4F88 A;  4HCS A;  2F4I A;  5LMN L;  2ZTE A;  2JA5 H;  2F0N A;  2IWH A;  4DV5 Q;  3GD7 A;  5C6A A;  3EIV A;  3IRB A;  3I4L A;  4ZQ3 A;  1OXT A;  2KJX A;  5DLQ E;  4AQY L;  3K0X A;  4QIW E;  4KD4 A;  3V2T A;  1BKB A;  4LJZ C;  2CQA A;  1AFP A;  2DY8 A;  1MJC A;  1UEA B;  3KDF B;  3GV3 A;  4QCL A;  1SYE A;  2JK8 A;  3K81 C;  1DD2 A;  1HA6 A;  2F0K A;  3A7L A;  1Z6H A;  5ELD A;  1OXS C;  1SE2 A;  3NTI A;  1I3Q B;  3W3A A;  4IUT A;  3QR8 A;  4X66 L;  4DK0 A;  2A74 C;  2K4K A;  5C3E G;  1R4P B;  1LTR D;  2XTI A;  3Q23 A;  4IUP A;  2VQE L;  5JJK A;  1MSG A;  1WD1 A;  2ZJQ A;  4HJ9 A;  3DEO A;  5FLM H;  2J4X A;  3I4M B;  2R6G A;  1T5E A;  3TP5 A;  4XQJ A;  1IYJ B;  2ZJP A;  2AUJ D;  5JJZ A;  1UUP A;  1XPO A;  2N8N A;  1ONL A;  2L5T A;  4B3S Q;  2B2W C;  4A93 G;  2AKW B;  5JEA G;  3NBI A;  1PV4 A;  5C0X I;  1XPU A;  1KNA A;  5FOB B;  2BE5 C;  4LAA A;  2C35 B;  5G3L D;  3K59 A;  4K6D A;  1NMG A;  4S3S A;  2E76 C;  4OX9 Q;  2PMZ B;  4PMW A;  5I2X A;  1TVX A;  1I94 Q;  3CHB D;  4HIO A;  2F1M A;  3HOX B;  4XT3 B;  3M7G A;  1SMY D;  2JXM B;  5IGG A;  1YNX A;  5M5X B;  1C9O A;  2EXD A;  1F9P A;  5LMN W;  3FDT A;  1HR0 Q;  2IY5 B;  4DNT B;  1IL2 A;  1PTO H;  1GUS A;  1LV9 A;  2CH4 W;  1LTT D;  4F87 A;  2RCF A;  2LXJ A;  5FLX E;  5FLX L;  1SNC A;  2EIF A;  2RDG A;  1YNJ C;  3PO3 G;  1SRU A;  3HOX H;  3RLF A;  3DUZ A;  2IT1 A;  4FF4 A;  4V19 0;  3OTO L;  4ZUI A;  3T4A C;  2KCM A;  1D5X C;  3Q6S A;  1YJN A;  5M5X H;  2CW0 C;  1PH4 A;  4KJO A;  4QF4 A;  1X6O A;  5GAD C;  4QMG A;  1W6J A;  3HOZ G;  1QJO A;  1I6H B;  4L63 B;  1Q8I A;  2E75 C;  3BYT B;  3SR1 A;  3L0O A;  1BBW A;  3C46 A;  1E3P A;  4JW0 A;  4L6T B;  2JYO A;  1TII D;  2RDF A;  1CSP A;  4WRD A;  2O5J C;  2EYF A;  1LTI D;  1JJC B;  2IX0 A;  3T51 B;  3I70 A;  3HOW B;  1W6K A;  3U9S A;  1WCM G;  2CHB D;  1HFG A;  3VR6 A;  2EYL A;  4A3I B;  1I6H H;  4CJ2 C;  4EX5 A;  1Z7T A;  1EEF D;  1PA6 A;  1MI2 A;  5EKL A;  5IP7 G;  2PI2 A;  1TWF B;  5IGF A;  1SNP A;  2L15 A;  3ERQ A;  1C8C A;  4GKK Q;  3MVV A;  3AFP A;  2WAQ B;  1N36 Q;  4B3R Q;  2F0O A;  3HOW H;  2E74 C;  1D1I A;  2JSO A;  3MFG A;  3SE0 A;  3S16 B;  4A3I H;  3BZD B;  3CPF A;  2A1A A;  2PZU A;  2L1B A;  2B2Y A;  2G9H D;  1E1T A;  1HZA A;  1TWF H;  3TBI B;  1HNW L;  1RCV D;  2ZXO A;  3T1H Q;  3FEW X;  3TS0 A;  4RMF A;  4QIW B;  2Q8I B;  4OIK A;  2RF4 A;  1CHP D;  2VS1 A;  3D6C A;  5ELB A;  2EY5 A;  2XRS D;  4JI2 Q;  2QDB A;  2EJM A;  4E6I A;  2E2I H;  2UUC Q;  3NP8 A;  5T1I A;  3SK5 A;  2LFN A;  4G7H C;  3KFU A;  4NXM L;  1RTN A;  4JBK A;  1B70 B;  1PLF A;  5LL6 X;  1N32 Q;  4TQU S;  4R4I A;  4LF8 Q;  3S1N B;  3S9W A;  4NW2 A;  4JBM A;  2F0E A;  1IBK L;  3NBH B;  1PZI D;  3W2D A;  3M4P A;  1ROD A;  4FF1 A;  2H4O A;  3KLR A;  2EJG C;  4A3F B;  2PZW A;  4JPB W;  3K5N A;  2C9O A;  4NPS A;  5HUR A;  4K5X A;  2SNM A;  4ULL A;  4C56 C;  3RNU A;  2FJ2 A;  5IIF A;  1CHQ D;  3S1N H;  1ENC A;  1VQ5 A;  4A3G B;  4X62 Q;  4X6A H;  2RCN A;  1R4Q B;  5C5M A;  4JI8 Q;  3L2P A;  3PUX A;  2F0P A;  4X64 L;  1HHV A;  1QG7 A;  2EYJ A;  1WJJ A;  4IJH A;  1EIY B;  1IW7 D;  3GTG B;  2XN9 C;  4A3F H;  3TEH B;  3TDQ A;  3CQZ B;  4A3E B;  1FJG Q;  2AWN A;  3OMG A;  4DV0 L;  1Q12 A;  3R2I A;  4DUZ L;  4PV1 C;  1GO3 E;  2A73 B;  2D0O A;  4QJF A;  4TSS A;  1QUQ B;  4UY8 C;  4A3G H;  4B08 A;  3CF5 A;  1OXX K;  1Y1V B;  5GAE C;  2DN8 A;  4RHS A;  3HP3 A;  4AYB G;  1YJ9 A;  1TWA B;  1L0X B;  2O4X A;  3GTG H;  1GVP A;  5I2Y A;  4UDU C;  1IKL A;  2EYH A;  2RQX A;  4A3E H;  4GNX B;  2F0G A;  2CCZ A;  2WIN B;  1YIJ A;  4MIU A;  1BF4 A;  1RJT A;  2JA8 G;  5C44 B;  3I4O A;  3VA5 A;  5BR8 Q;  3TQY A;  2LS0 1;  1Y1V H;  1SE4 A;  5DNF A;  3D0F A;  3EFX D;  1JR0 D;  3HRZ C;  1I4H A;  4X3S A;  4BXX H;  1TWA H;  1HJP A;  4EVO A;  1T9H A;  1Y14 B;  2K32 A;  3GTP B;  4K5W A;  4IUR A;  2K04 A;  3NEL A;  2BDO A;  2QCP X;  5JOB A;  5FJ8 G;  2SNS A;  2NYZ D;  4FXD A;  5C44 H;  3F2C A;  4HSP A;  4TRD A;  5EPJ A;  2Z4I A;  1JJG A;  1XXG A;  1NBW A;  4KY6 A;  1PH3 A;  1TQO A;  1EY0 A;  4QY7 A;  5CV9 A;  1A2U A;  2RSO A;  3GTP H;  4GNX C;  4IAL A;  5CGK A;  1DOK A;  4BA1 I;  2KED A;  2VUM G;  1O7L A;  1UEB A;  4DR3 Q;  4OO1 G;  3MWY W;  4ABN A;  4PZ7 A;  4HED A;  4XYQ A;  1TWC B;  3M9B A;  1Y8N B;  2KBN A;  4DNR B;  5C0X H;  2ZXR A;  2JA9 A;  1TWH B;  3J81 E;  3J81 L;  5COR A;  1ESR A;  3UE0 A;  1KLU D;  3W1G A;  2IJ0 A;  3I8Z A;  3F1Z A;  2VZA A;  4LNQ A;  4FYD A;  4HJA A;  2ICE C;  4CKB A;  3I7F A;  3PIP 3;  1YJW A;  4JI3 L;  2RDH A;  5CV7 A;  1F2Y A;  2OF1 A;  1AH9 A;  2HHH Q;  4BBS B;  4K0K L;  1NR4 A;  2QGQ A;  3S1M B;  5FO8 B;  2B8G A;  1VF5 C;  4DR2 Q;  1IW7 C;  2KCN A;  4KHZ A;  4WOR A;  1S40 A;  1TWC H;  2QF7 A;  2JQO A;  1EIG A;  1XNR Q;  1TWH H;  1SRO A;  2Z9H A;  1HNZ Q;  2OQ0 A;  2B2T A;  2M9V A;  2NN6 G;  1KLG D;  2KCT A;  1VQK A;  1JWS D;  4LF6 Q;  3G6J B;  2Z8L A;  2FIN B;  1EYD A;  1P8L A;  1IKM A;  4BBS H;  1HZC A;  5E7N A;  1STE A;  5JPN C;  2E5L L;  3KLS A;  5LMU L;  2M00 A;  3PGZ A;  3F8T A;  4GN4 B;  1ILQ A;  2XSC A;  2K14 A;  1NMF A;  5HGQ A;  2Z6K C;  4BBR G;  2R7Z G;  4B3M L;  2K33 A;  4CDC C;  2O2L D;  2EPB A;  2F03 A;  3QB3 A;  1YI2 A;  4JI6 L;  1IBM Q;  2ZXP A;  4WJW A;  3KBX A;  5C4H A;  3KLW A;  5AFW A;  1G2T A;  1I4G A;  5D3D A;  4OHJ A;  2F0I A;  3NQI A;  3MC0 B;  1IBL L;  1A8V A;  1CA6 A;  1L2F A;  1NUC A;  4APV A;  1SYF A;  1AEX A;  4JC0 A;  4EGV A;  2O5I C;  2CWA A;  3CW2 C;  4DXF A;  3BDL A;  3BVZ A;  1HCZ A;  3PMF A;  5IY0 A;  2I5H A;  2F0M A;  5EBD A;  3A54 A;  1JT8 A;  3HEJ A;  3SHL A;  2K5D A;  3R2T A;  4J6H A;  3CRL C;  4LF7 Q;  4DV2 L;  1RHP A;  5C3E B;  4A3D B;  4HJ7 A;  2UU9 Q;  1PRT F;  1ET6 A;  2FHT A;  1XTD A;  3T1Y L;  4KK7 A;  2OTL A;  4DAY A;  1J6Q A;  4JBJ A;  1ZKO A;  3IAY A;  3CRK C;  2HCI A;  5I4D A;  1EYG A;  2RSN A;  4M1U B;  5KRU A;  4IPC A;  2XNA C;  3CCL A;  2UXC Q;  1DXM A;  1U0L A;  1PYW D;  1MD2 D;  5LHY 1;  2K52 A;  1VQH A;  3T13 A;  1SJE D;  5C3E H;  1B2T A;  3HKS A;  4ZK9 B;  2BOS A;  3S15 H;  4MZ9 A;  3RD4 A;  2PI2 E;  4DV7 L;  2XVS A;  4OEL B;  2UXB L;  2XWJ B;  1QZH A;  1GHJ A;  3PCO B;  5BN3 A;  2NVX B;  1LT4 D;  1E24 A;  3Q22 A;  2UUB Q;  3OW7 A;  5JVG 3;  1VQN A;  4I7Z C;  2ZM6 Q;  3K5M A;  1FNW A;  3UDG A;  3ND8 A;  2F0W A;  2EOT A;  1VQ7 A;  4CJ0 B;  2M2L A;  3OPO A;  4JI5 L;  2ASB A;  4A93 H;  1Q7Y C;  5JEA H;  1C0A A;  4WJ4 A;  2B39 A;  4IPD A;  2LKV A;  1SYB A;  2JA7 G;  4UP7 A;  3VDY A;  4IN3 A;  2NBF A;  2NVX H;  4KD3 A;  3PO3 B;  3J80 E;  3FRP B;  3J80 L;  4YWK A;  1XNQ Q;  1V1P A;  1XMQ Q;  4HMI A;  4FF2 A;  2EDG A;  4QB4 A;  1I4Q A;  2OEO A;  4C3I G;  4KJN A;  4RH6 A;  3TZU A;  3JAM E;  3NEM A;  3JAM L;  5F2D A;  1S72 A;  4CJ1 B;  4JYA L;  5E1F A;  3NQT A;  2VQF Q;  4GOP A;  3PO3 H;  1X3Q A;  2PW7 A;  2B2U A;  1B44 D;  1JIC A;  2QIL A;  4CHT B;  2NZO A;  1STY A;  1H9J A;  4F8M A;  1WCM B;  2YU9 H;  3M4Q A;  3HOZ H;  4ID6 A;  1YHQ A;  1TY2 A;  3H15 A;  5K5P A;  3S1R B;  2MO1 A;  4K2L A;  3HOV G;  4DV5 L;  1CSQ A;  1UAP A;  1G6P A;  1Q81 C;  1HTL D;  2EE1 A;  5IYB H;  4DU9 A;  2HQE A;  2N78 A;  1LM0 A;  1SEB D;  1B50 A;  1WCM H;  2PYK A;  1PVO A;  5BN5 A;  2K6A A;  3KLS X;  5CV8 A;  3I72 A;  3HKZ E;  5IP7 H;  3VA7 A;  4FNF A;  2WAC A;  1VQO A;  1H9S B;  3VYT A;  5KNB A;  4BY7 B;  4OXP A;  3FPP A;  2D62 A;  4DN4 M;  2E2J B;  3DWP A;  4JOI C;  3E5S A;  4LF4 L;  3S2H B;  4R8N A;  1HUM A;  1MHW C;  5IE8 A;  1YVC A;  3AYH B;  1AN8 A;  1LUZ A;  2TMP A;  1WTP A;  3A55 A;  1ET9 A;  1CZW A;  1B3Q A;  3VR2 A;  4IQZ A;  4H44 C;  4ZCK A;  1LTB D;  2KA7 A;  2A69 D;  4JCV E;  2E2J H;  3C2P A;  2FXQ A;  3WOE A;  3S2H H;  4GKJ Q;  3EQL C;  5D3I B;  2ZJR A;  4LUO A;  1KRT A;  2J0T D;  1I94 L;  3E9H A;  1AE3 A;  1GUG A;  1JQY D;  2N55 A;  4FO2 A;  4KY7 A;  4P74 A;  1H95 A;  3A56 A;  1E22 A;  1PTO D;  2VW9 A;  2R93 B;  5CV6 A;  4NXN L;  1WTV A;  1HR0 L;  3S14 B;  1XPR A;  1X65 A;  2UXD Q;  5IGE A;  1EUJ A;  3EVQ A;  4X3K A;  3I55 A;  1PYB A;  3CCR A;  3P20 A;  1D5M C;  4J1M A;  4L8J A;  1Q1B A;  3RUZ A;  1B1Z A;  2R93 H;  1SE3 A;  4A75 A;  4KMU C;  3E9I A;  3S14 H;  1O7Y A;  1S5C D;  1ZXT A;  3I3C A;  2F0T A;  3OIQ A;  4YCW A;  4RHR A;  3SEB A;  1A0I A;  2QA4 A;  3E0J A;  3G6E A;  2K28 A;  3TZD A;  5KIX A;  4QL5 A;  5D14 A;  1VMP A;  1PH9 A;  4OON A;  4R4Q A;  3KYH C;  1EU3 A;  3NTK A;  4A3L G;  1PFB A;  4BY1 G;  1LAB A;  4YHH Q;  2AHO B;  4LFC L;  4FVM A;  2A6H D;  2JA8 B;  3OMC A;  1X32 A;  4K14 A;  1DOL A;  5GQO A;  2EZV A;  1G51 A;  3F2D A;  4DV6 Q;  1GUW A;  1TS3 A;  2QEJ C;  1I6V C;  4LW1 A;  1VQL A;  4I65 A;  1PTO B;  4GN5 A;  1WTW A;  1J9O A;  2UUA L;  4DA2 A;  1PFS A;  4XDX A;  2MJ8 A;  1CT1 D;  2X69 A;  3DXJ C;  3VR5 A;  3H6M A;  1IZ6 A;  3LNN A;  1Y69 U;  4DR6 L;  5JVH 3;  3ND9 A;  5CC4 A;  1KAA A;  4B3T Q;  2JA8 H;  1IHZ A;  3V05 A;  1HR0 W;  2VB2 X;  2K5V A;  4Z9C B;  4UHV A;  4A3M G;  2MGS A;  1RDP D;  4MTN A;  1CKM A;  2OXP A;  4C1N K;  1Q82 C;  1B9N A;  3CCJ A;  2KHI A;  5M3M B;  3FVQ A;  4O42 A;  1L0Y B;  1GOZ A;  2VUM B;  3V96 A;  5FJ8 H;  1D1K A;  2WB1 G;  1TS2 A;  1GUN A;  5C4J B;  1A6X A;  4A3B G;  1TKW B;  1L1O A;  2AQ3 B;  1YNN D;  1PTO C;  1HUN A;  1DGS A;  3QOJ A;  2IW3 A;  3A5Z B;  3HKZ B;  1ENA A;  5IGB A;  2F0U A;  4KLK A;  4XYO A;  5KND A;  3A0J A;  5M3M H;  3J80 c;  1UE6 A;  5J22 A;  2KHS A;  4XTC S;  4AQY Q;  2VUM H;  4LFA Q;  2EQS A;  1UWV A;  3A8K E;  1PDQ A;  4HN7 A;  5C4J H;  1Q46 A;  4OO1 H;  4KN4 C;  3AB9 A;  4G7O C;  4ZYS A;  3MXN B;  3HOY G;  3Q24 A;  1LLR D;  1S5D D;  2PPB C;  2B2V C;  1EY5 A;  2EY6 A;  2RBM A;  4X66 Q;  4JI0 L;  1BOS A;  4L5Q A;  1N8R C;  1HQM C;  1LTG D;  4PNY A;  5AJ3 L;  2DJF C;  3RMH A;  3I4N G;  4JI4 L;  1M4V A;  3BZC A;  4JI8 L;  1QNK A;  4RKL A;  4DKA C;  1LT6 D;  2D2C C;  5C0X J;  1F9Q A;  1LTL A;  4QQB X;  1G8Z D;  1TR5 A;  4ODG A;  4BBR B;  2N3S A;  3VYR A;  4DR1 L;  2J7Z A;  2NN6 H;  4JV5 Q;  1XMO L;  1P16 A;  2E2I B;  3QO2 A;  2B2W A;  2K5Q A;  1HZB A;  1Y1W G;  3NSW A;  4UPA A;  2EYO A;  1KHI A;  2KUM A;  4A76 A;  3Q0A A;  4R8I A;  1G2S A;  3KF6 B;  2FMM A;  2B29 A;  4N9T A;  4RGN A;  3DMU A;  3LX0 A;  2JN4 A;  1BCP D;  2EYM A;  3C1E A;  2PZT A;  2R92 G;  4BBR H;  2L0C A;  2R7Z H;  1I4P A;  1OO9 B;  1SMY C;  3H0G G;  1LAC A;  4IUU A;  3CCQ A;  5BR8 L;  1B53 A;  1EU4 A;  1MGS A;  2K5N A;  4PZ6 A;  1D5Z C;  4DV4 L;  3L3O C;  3HOU G;  5TSS A;  2YV5 A;  1EY6 A;  4KKS A;  2Z0S A;  3SGI A;  1EIF A;  4RCO A;  1EQQ A;  2KCC A;  3J7Y W;  1S5F D;  1JWM D;  1AP0 A;  1KXL A;  4XQN A;  1EWI A;  1YNN C;  2KEC A;  4BWG B;  1QVF A;  4B9X A;  1CKN B;  3U9O A;  1EFW A;  5H1S E;  2JA5 G;  1K0R A;  2F0Q A;  4KI0 A;  4HIK A;  1ESF A;  4P75 A;  2PO4 A;  1XTC D;  1SFO B;  1EZ6 A;  5EBC A;  1JOR A;  5BN4 A;  1S5B D;  1K8A C;  3AEV A;  4A3J G;  3L7Z C;  3BVM A;  2YTV A;  2BA0 A;  1F2L A;  1JJ2 A;  4YY3 Q;  1BCP B;  1IXR A;  2FFK B;  2SEB D;  4KTA A;  4GZY C;  3QWN A;  1EOT A;  1SFO H;  1FGB D;  1PTO F;  3IFT A;  1J5E Q;  1K73 C;  4J15 A;  3H3V H;  3OYY A;  5E4X A;  3VR4 A;  4FF3 A;  2D5D A;  2QDL A;  3S1Q B;  2BA1 A;  1JOK A;  1A2T A;  4ALP A;  1ZEQ X;  4IFD H;  4L5R C;  1QOH A;  3VR3 A;  3Q8D A;  1LT5 D;  1KD1 C;  1L0W A;  3KF8 B;  2EXZ A;  2B8F A;  3H91 A;  3STB D;  2I46 A;  4C3I B;  1SND A;  4G7Z C;  3ZYY X;  2JA7 H;  1HNW Q;  3PO2 G;  3S1Q H;  1RD9 D;  1KC8 C;  1F9S A;  4GS3 A;  4MN3 A;  5KNC A;  3I4M G;  3FMC A;  4I7A A;  1PHJ A;  3CCE A;  4DAY B;  5JEA J;  1MSH A;  5JAV A;  1HH2 P;  4C3I H;  3NPP A;  1V8Q A;  2ENB A;  3WDN A;  4IUV A;  1V1O A;  2MHV A;  4ZUJ A;  4R9W A;  2RHS B;  1LYL A;  4UP8 A;  1H9R A;  4NXM Q;  1EY4 A;  1XJV A;  1QIL A;  1IBM L;  1TY0 A;  1EYC A;  1SJH D;  4OWX B;  2CFM A;  3BYY B;  2IL8 A;  1UE7 A;  1JWU D;  2L55 A;  3CCU A;  1IBK Q;  2H5X A;  1ML0 D;  3TP6 A;  5IGD A;  1PZJ D;  2LSS A;  3PUZ A;  2VXW A;  5G3L F;  2K01 A;  3CCM A;  3CME A;  3CKI B;  1CQV A;  4L5T A;  1BBX C;  1BBU A;  1UE5 A;  5M9O A;  5FLX c;  3C3L A;  1PXU A;  5LL6 S;  3SDZ A;  3KOJ A;  3HOV H;  3ULL A;  4X64 Q;  1BUV T;  1RTO A;  2ATW A;  4OWT B;  4POF A;  1H9K A;  1HNX Q;  5DEH A;  5IYC G;  2R61 A;  3TP7 A;  2UU9 L;  4RCN A;  1GM5 A;  3BJU A;  3D3R A;  5CMD A;  4FDB A;  2EY2 A;  2K50 A;  3I90 A;  1PH7 A;  4NMZ A;  1JE4 A;  2YTY A;  1SSO A;  4DUZ Q;  1DYQ A;  3G71 A;  1X3P A;  2UXC L;  1PH6 A;  1MBY A;  4DUY Q;  4GN3 B;  5CYU A;  4A4I A;  3U58 A;  4MTK A;  3AQQ A;  1VQA A;  3GO5 A;  3ERS X;  1YZ6 A;  3R8B A;  3NBH A;  1F2Z A;  1SMX A;  1NJI C;  1JMC A;  1ILP A;  3RN2 A;  3OWF A;  1EWH A;  1I50 B;  4YWL A;  1CFM A;  3CP0 A;  4H0L C;  5E3F A;  1MKH A;  5CBE E;  4U67 3;  5K36 G;  2B63 G;  3E6Z X;  4Q0F A;  2KVM A;  1OXU A;  2MPM A;  3K5O A;  3PUV A;  1D6E C;  1KAB A;  3STB C;  1IYV A;  5IP9 G;  1HQR D;  1NE3 A;  1AW7 A;  5ISR A;  2F0S A;  1JOO A;  4H13 C;  3G4S A;  1SYC A;  3DWQ A;  2DJG C;  1I50 H;  4HR7 B;  1VF7 A;  2K7V A;  4KV6 A;  1JOQ A;  2JE6 I;  4DAV A;  1XNQ L;  1QB5 D;  3J7A 5;  3GTQ H;  4G4K A;  5ELO A;  2F3W A;  4JI1 L;  1ASZ A;  4HJ8 A;  1IYU A;  3DHQ A;  4DR5 L;  3U4V A;  2VQF L;  4DK6 C;  3BVG A;  3S15 B;  3U50 C;  4GNX A;  3LWU A;  2R7F A;  1C7Y A;  5GAG C;  1PMR A;  3N6R A;  4IZ8 A;  4DV1 L;  1VQ6 A;  1J8I A;  3SK8 A;  2LXK A;  4LWC A;  3MXU A;  1WVL A;  4BY1 B;  5C5L A;  1DOM A;  5EPL A;  4DR4 L;  1YBY A;  1E0B A;  1X56 A;  1X3F A;  1HFN A;  2ZT9 C;  4M8A A;  1EYA A;  3RLN A;  1VQ9 A;  2MFI A;  3K0Y A;  4CKC A;  2HDL A;  3KK7 A;  1Q86 C;  2JA6 G;  4A93 B;  4BS9 A;  3GV6 A;  4QUC A;  1DZ1 A;  1HZ9 A;  4ME3 A;  4JI3 Q;  4XQQ A;  3NHH A;  1RKN A;  4OIJ A;  4K0K Q;  3CC2 A;  1SYG A;  2GVA A;  4LFB Q;  2HQL A;  2XIW A;  4KKT A;  3FP9 A;  5JJI A;  4A3L H;  4BY1 H;  3RZD B;  3KJO A;  4X65 Q;  2F0J A;  3K6O A;  3MA2 B;  1CKO A;  3T53 B;  4C2M H;  1WTH A;  1JB3 A;  2F4V L;  1B4O A;  1EWC A;  1SNQ A;  3CAM A;  1STH A;  2ES2 A;  4A3G G;  4UP9 A;  2WP8 J;  4TKO B;  4A3M B;  3CC4 A;  4X3U A;  3N52 A;  2E5L Q;  2K5H A;  4R4T A;  1N33 L;  3S17 B;  2VB3 X;  1Z47 A;  1SLJ A;  1GKH A;  4A3K G;  4AYB E;  3RZD H;  4ZRZ A;  5KGU A;  1W2B A;  4KHP L;  4YWM A;  4DV3 L;  4A3E G;  2K05 A;  1O78 A;  2MUY A;  3I2Z A;  2F0L A;  1STA A;  1U9R A;  2Z4H A;  2PCF B;  4A3B B;  2Z6K A;  4A3M H;  1K9M C;  4HID A;  2YU9 B;  3HOZ B;  2PNH A;  4RGT A;  2WKC A;  1NY4 A;  3S17 H;  3UI2 A;  3K80 C;  3A5U A;  4JI7 L;  3I73 A;  2DUD A;  4G57 A;  1S5E D;  3DWA A;  4GKJ L;  3QIA A;  4X3T A;  4IUN A;  1IBL Q;  4LF9 Q;  1VQJ A;  1O80 A;  3TRE A;  1D7Q A;  1HXY D;  4FXK C;  4L5S A;  3RN5 A;  4A3B H;  5C44 G;  4O1N A;  3M4O B;  1OTC A;  2PQA A;  5IYD G;  5IWA Q;  2AWO A;  1YHA A;  5FK9 C;  1W3S A;  1BO0 A;  2LY7 A;  1SDF A;  2HIV A;  4DV2 Q;  1KDB A;  1K28 A;  4WJ3 M;  1FL0 A;  3NE5 B;  3HZX A;  2WII B;  1VQF A;  3K5L A;  1JB7 A;  1HRJ A;  3I4N B;  1ENF A;  1HPC A;  3J7A V;  3BDO A;  5EPK A;  2NB0 A;  2OWO A;  2HDM A;  4IPG A;  3HOY H;  3GTK B;  3M4O H;  3QOL A;  4QGU A;  4LF5 Q;  1AZP A;  5IT9 E;  5I9O A;  3IL8 A;  1YEZ A;  5IT9 L;  4DAP A;  1K3R A;  4K2K A;  5I6Y A;  1TWG B;  3M3Y B;  1STB A;  5D65 A;  1Q3L A;  2AQ2 B;  1PH2 A;  3I56 A;  4JK1 C;  3I4N H;  4DV7 Q;  4CKE A;  1Y1W B;  2UXB Q;  1GUT A;  4CBV A;  3OW2 A;  3GTK H;  2KEN A;  1I4X A;  3J81 c;  4LK1 C;  2HUG A;  2R92 B;  2Q8R E;  1TWG H;  4YCU A;  3VYU A;  4ZKC B;  3CXC A;  3DLL A;  4JI5 Q;  3M3Y H;  3PIO A;  1M8A A;  2OCE A;  1A62 A;  4B3S L;  4DV6 L;  1Y1W H;  2YTX A;  3MXG A;  1TXY A;  1VQE A;  3U4Z A;  1X3G A;  3D4R A;  3GTM B;  3W1B A;  4FP5 D;  3HOU B;  3JC6 6;  2OT2 A;  4OX9 L;  4DK1 A;  2R92 H;  4DAM A;  4P72 A;  1EY8 A;  1PFN A;  4RWS C;  1WTR A;  3PUW A;  4DF7 A;  1EQR A;  4LUV A;  5CV5 A;  2EYP A;  2B3G A;  4ME5 A;  4JBW A;  3GTM H;  1DON A;  3RZO B;  3HOU H;  5CR3 A;  3T16 A;  4DR7 Q;  4NP5 A;  1N9W A;  4QUF A;  4ZLT F;  3LGJ A;  2Q2T A;  3J81 i;  3KBG A;  3SXH A;  4K8I A;  4HMJ A;  1D8L A;  4A3J B;  1G29 1;  1UNS A;  4IO9 A;  2DGY A;  1GJX A;  1BNZ A;  3G48 A;  1DJR D;  1H9M A;  2OTJ A;  2R3Z A;  2C5C A;  1M90 C;  1RF2 D;  1M1K C;  2AUK A;  3WOF A;  4RGM A;  1RL2 A;  1PH1 A;  3RZO H;  1SE8 A;  2BCO A;  4EQP A;  1O7I A;  3MTS A;  2HIX A;  4AYB B;  3ULP A;  4LFA L;  1SBB B;  4A3J H;  4C3H G;  5NUC A;  1WTO A;  1N34 Q;  2JEB I;  3D4W A;  1PZK D;  2Q2H A;  4HAE A;  1V9P A;  4PQX A;  5EKI A;  3OSO A;  5M5Y B;  1WD0 A;  1K8O A;  1CUK A;  3UDX A;  1B3A A;  2F52 A;  3D4D A;  4DFA A;  1G6Z A;  3MHB A;  4A3D G;  3PO2 B;  3K58 A;  4LF4 Q;  4KHV A;  2L12 A;  1C48 A;  3GDE A;  4HIM A;  5C4X G;  2A5H A;  4GKK L;  1V1Q A;  4HSV A;  1N36 L;  4B3R L;  4JOI A;  3NK9 A;  2B2Y C;  3FKI G;  5M5Y H;  3J7Z C;  3D6W A;  1BVS A;  1I3Q H;  4K6L A;  4EQO A;  1FVI A;  4R1J A;  1II3 A;  2F0F A;  4N8X 1;  4MHE A;  3H09 A;  4JV5 L;  3PO2 H;  1X54 A;  4K5V A;  4B9W A;  1TT2 A;  4IFD J;  2G9D A;  3NUC A;  5IGC A;  2A69 C;  1GUO A;  3MEH A;  2ZTD A;  3I4M H;  4AH6 A;  1X9N A;  3T1H L;  3HGB A;  2L9H A;  3ICE A;  1EY9 A;  1BXT A;  3O13 A;  1EOV A;  3I91 A;  1QVG A;  4JI2 L;  4NXN Q;  1OXV A;  5EAY A;  2UUC L;  1H9S A;  2FMC A;  5LMN Q;  1SYD A;  4U68 A;  5CBA E;  1EY7 A;  2WV6 D;  5I6W A;  1N32 L;  4LF8 L;  1WOC A;  4IOA A;  4K8J A;  4OGQ C;  1U5K A;  3S2D B;  4YIJ A;  4UAI A; 
#chains in the Genus database with same CATH homology
 5HGT A;  1F9R A;  3LWE A;  4ZAI A;  1HA5 A;  2Z1C A;  2QKI C;  3TME A;  2NWG A;  2ICI A;  3GTJ B;  2EJF C;  3NWS A;  4ZKB B;  1JC7 A;  1Q90 A;  3EJI A;  5J1Z A;  4DGZ A;  4PMB A;  4HTH A;  5EGT A;  2E2H B;  1XX8 A;  3DEP A;  2B63 B;  2R7Z B;  1NAP A;  2KOL A;  3OHX C;  2A6H C;  4Y7N B;  1VMC A;  3K7A B;  1Y8O B;  4C3J G;  2IPK D;  2PNR C;  5K36 H;  1U4L A;  5T1G A;  3X3N A;  1WTQ A;  1FNU A;  3P1H A;  1FNV A;  1PRT D;  4HCE A;  2PW5 A;  2K5W A;  2KQ3 A;  2NVT B;  1B9M A;  1AZQ A;  3IKJ A;  1BQQ T;  1FD7 D;  1SAP A;  4Q5V A;  1TS4 A;  5COY A;  1G91 A;  4DXG A;  2NZ1 D;  1S4Z A;  2EY1 A;  3AMU A;  2IX1 A;  2JEA I;  1F2M A;  2JA6 B;  5DM6 3;  2CVR A;  3OOC A;  3M85 A;  1K83 B;  5C4Z A;  1BR9 A;  1IL8 A;  3GQB A;  3URY A;  5KYL A;  1FYC A;  1NR2 A;  1CM9 A;  1E2V A;  2B2V A;  2NTT A;  3VYS A;  1CTM A;  2JA7 B;  1WTX A;  3MZ5 A;  1PRT B;  4A3K B;  1TU2 B;  2MP1 A;  1A3U A;  3KUP A;  3ITP A;  2B2T C;  3A7A B;  3FPU B;  1CA5 A;  1KDA A;  3H3V C;  3J7A F;  5EJW A;  2NTS A;  3HS0 C;  3DM1 A;  1T5X D;  3NTH A;  3MXN A;  1EZ8 A;  1BCP C;  1EFI D;  4LMQ D;  1D2B A;  3NWT A;  4IUQ A;  5I9P A;  1PFM A;  2NVQ B;  1PRT C;  4XIG S;  5DM7 3;  1SNM A;  2V4D A;  3HOV B;  1C4Q A;  1HTP A;  1CI3 M;  3TSS A;  2L4N A;  3H94 A;  2SOB A;  3QJY A;  2VNU D;  2WKD A;  2JP1 A;  3A8I E;  1A15 A;  5JPM C;  2F3V A;  3A8J E;  3MXP A;  3R93 A;  2K03 A;  4P2C B;  1VDZ A;  1KTK A;  3K57 A;  1V1P B;  1EEI D;  3BS1 A;  4BA2 I;  1Y8P B;  4RA8 A;  1CZG A;  2L11 A;  4RKB A;  2RVL A;  2H1E A;  3L9A X;  1SNO A;  3MFY A;  5A2Q E;  1U4R A;  5A2Q L;  4V0B A;  1U4M A;  1K8M A;  3GTQ B;  1ZYR D;  1U4P A;  5IOC A;  4CGY B;  3IFD A;  1JCK B;  3D8G A;  3OWE B;  1CQF A;  1KDC A;  4KKU A;  2XRQ D;  3F2U A;  4NDX A;  5FKA C;  3OIP A;  3SK4 A;  1GHK A;  1SXT A;  2LMC B;  5KEE A;  1EIH A;  3GP7 A;  2X6G A;  5E4W C;  5KYI A;  1XWE A;  2DNE A;  2B2U C;  3AU7 A;  3P75 A;  3KF8 A;  4C3H B;  2F0V A;  1LT3 D;  2ID0 A;  1BCP F;  4C2M B;  3PV0 A;  2EVB A;  1O7Z A;  3GTO B;  4EQN A;  2I07 B;  1EQT A;  1NSN S;  1ICW A;  1TS5 A;  3M7N A;  2A6E D;  5C4X B;  1FR3 A;  2DNC A;  3CU7 A;  1F77 A;  1E2W A;  2BDN A;  3ONA B;  3FKI B;  1EL0 A;  4H7B A;  1LTS D;  4J8Q A;  3TP8 A;  4F7X A;  1I4R A;  4PMC A;  2E2D C;  2F0D A;  2D9U A;  5C3X A;  3R3O A;  5ELE A;  4IFD G;  5FO7 B;  1E2Z A;  5C3W A;  2WB1 B;  2SDF A;  2XWB B;  5ELF A;  4RFB A;  2HCC A;  4OO1 I;  2NVY B;  1R9T B;  1ZYR C;  3D31 A;  2DY7 A;  1GXD C;  1QWY A;  3T56 B;  1LTA D;  2Q8T A;  3M4Y A;  3HOY B;  2A68 D;  4XT1 B;  2TSS A;  4KY5 A;  2IX3 A;  1Q1E A;  2NN6 I;  4RGO S;  1VCI A;  1NCV A;  3BG3 A;  3SVM A;  4FXG C;  5J39 A;  3GTL B;  5C0X G;  2NUC A;  5EKK A;  1DM0 B;  3C1F A;  4N9P A;  3X3M A;  1KNE A;  2AQ1 B;  5M3F B;  1V43 A;  4RAU C;  3HG9 A;  2YYZ A;  4C3J B;  4ILW A;  1STG A;  2A6E C;  1LO5 D;  2X6L A;  4XXE A;  2N88 A;  5IOD A;  2F0H A;  3H0G B;  1XYI A;  3G7L A;  2BE5 D;  5CV4 A;  4NKL A;  1A3V A;  1BDO A;  5A35 A;  5EQ0 A;  5FO9 B;  1A3T A;  3EA6 A;  3ERO A;  1CK1 A;  5ELC A;  2KEE A;  4C1N I;  2PQE A;  5M5W B;  1STN A;  1EQV A;  3NXW A;  3QG1 A;  3SK6 A;  4KN7 C;  3MAQ A;  1DCZ A;  2RKS A;  2JA5 B;  1YNJ D;  3PUY A;  2Y0S B;  1QNU A;  2RA4 A;  3PIO 3;  1QE6 A;  3TN2 A;  4OL7 A;  5DAU A;  2K1B A;  2CW0 D;  2GA4 B;  4WFN 3;  1QCB D;  4IFD I;  3P7J A;  3BDC A;  2A68 C;  4F88 A;  4HCS A;  2F4I A;  2F0N A;  2IWH A;  3GD7 A;  5C6A A;  3I4L A;  4ZQ3 A;  1OXT A;  2KJX A;  4KD4 A;  3V2T A;  4LJZ C;  2CQA A;  1AFP A;  2DY8 A;  1UEA B;  3GV3 A;  4QCL A;  1SYE A;  1DD2 A;  1HA6 A;  2F0K A;  3A7L A;  1Z6H A;  5ELD A;  1OXS C;  1SE2 A;  3NTI A;  1I3Q B;  3W3A A;  4IUT A;  4DK0 A;  2A74 C;  1R4P B;  1LTR D;  3Q23 A;  4IUP A;  1MSG A;  1WD1 A;  3DEO A;  2J4X A;  3I4M B;  2R6G A;  1T5E A;  3TP5 A;  4XQJ A;  2AUJ D;  5JJZ A;  1UUP A;  1ONL A;  2L5T A;  2B2W C;  5JEA G;  3NBI A;  5C0X I;  1KNA A;  5FOB B;  2BE5 C;  4LAA A;  5G3L D;  3K59 A;  4K6D A;  4S3S A;  2E76 C;  2PMZ B;  4PMW A;  5I2X A;  1TVX A;  3CHB D;  2F1M A;  3HOX B;  4XT3 B;  3M7G A;  1SMY D;  2JXM B;  5IGG A;  5M5X B;  1F9P A;  3FDT A;  4DNT B;  1PTO H;  1GUS A;  1LV9 A;  1LTT D;  4F87 A;  5FLX E;  5FLX L;  1SNC A;  2RDG A;  1YNJ C;  3RLF A;  3DUZ A;  2IT1 A;  4FF4 A;  4V19 0;  4ZUI A;  3T4A C;  3Q6S A;  1D5X C;  2CW0 C;  4KJO A;  4QF4 A;  4QMG A;  1W6J A;  1QJO A;  1I6H B;  4L63 B;  1Q8I A;  2E75 C;  3BYT B;  3SR1 A;  3C46 A;  4L6T B;  2JYO A;  1TII D;  2RDF A;  4WRD A;  2O5J C;  2EYF A;  1LTI D;  2IX0 A;  3T51 B;  3I70 A;  3HOW B;  1W6K A;  3U9S A;  2CHB D;  1HFG A;  3VR6 A;  2EYL A;  4A3I B;  4CJ2 C;  1Z7T A;  1EEF D;  1MI2 A;  5EKL A;  1TWF B;  5IGF A;  1SNP A;  3ERQ A;  1C8C A;  3MVV A;  2WAQ B;  2F0O A;  2E74 C;  1D1I A;  2JSO A;  3MFG A;  3SE0 A;  3S16 B;  3BZD B;  2PZU A;  2L1B A;  2B2Y A;  2G9H D;  3TBI B;  1RCV D;  2ZXO A;  3FEW X;  4QIW B;  2Q8I B;  4OIK A;  1CHP D;  3D6C A;  5ELB A;  2EY5 A;  2XRS D;  2QDB A;  2EJM A;  4E6I A;  3NP8 A;  5T1I A;  3SK5 A;  2LFN A;  4G7H C;  1RTN A;  1PLF A;  5LL6 X;  4TQU S;  3S1N B;  3S9W A;  4NW2 A;  2F0E A;  1PZI D;  3W2D A;  1ROD A;  4FF1 A;  2H4O A;  3KLR A;  2EJG C;  4A3F B;  2PZW A;  3K5N A;  2C9O A;  5HUR A;  4K5X A;  2SNM A;  4ULL A;  4C56 C;  2FJ2 A;  5IIF A;  1CHQ D;  1ENC A;  4A3G B;  1R4Q B;  5C5M A;  1HHV A;  2F0P A;  3PUX A;  1QG7 A;  2EYJ A;  1IW7 D;  3GTG B;  2XN9 C;  3TDQ A;  3CQZ B;  4A3E B;  2AWN A;  3OMG A;  1Q12 A;  3R2I A;  4PV1 C;  2A73 B;  4TSS A;  4B08 A;  1OXX K;  1Y1V B;  2DN8 A;  4RHS A;  3HP3 A;  1TWA B;  1L0X B;  2O4X A;  5I2Y A;  4UDU C;  1IKL A;  2EYH A;  2RQX A;  2F0G A;  2WIN B;  4MIU A;  1BF4 A;  1RJT A;  5C44 B;  3VA5 A;  2LS0 1;  1SE4 A;  5DNF A;  1JR0 D;  3EFX D;  3HRZ C;  1I4H A;  4X3S A;  4EVO A;  2K32 A;  3GTP B;  4K5W A;  4IUR A;  2K04 A;  2BDO A;  2QCP X;  5JOB A;  2SNS A;  2NYZ D;  4FXD A;  4HSP A;  4TRD A;  5EPJ A;  2Z4I A;  1XXG A;  4KY6 A;  1TQO A;  1EY0 A;  5CV9 A;  1A2U A;  2RSO A;  4IAL A;  5CGK A;  1DOK A;  4BA1 I;  2KED A;  1O7L A;  4OO1 G;  3MWY W;  4ABN A;  4HED A;  4XYQ A;  1TWC B;  1Y8N B;  4DNR B;  5C0X H;  2ZXR A;  3J81 E;  1TWH B;  3J81 L;  5COR A;  1ESR A;  1KLU D;  2IJ0 A;  3I8Z A;  4FYD A;  2ICE C;  4CKB A;  3PIP 3;  2RDH A;  5CV7 A;  1F2Y A;  2OF1 A;  4BBS B;  1NR4 A;  3S1M B;  5FO8 B;  2B8G A;  1VF5 C;  1IW7 C;  2KCN A;  4KHZ A;  4WOR A;  2QF7 A;  1EIG A;  2B2T A;  2M9V A;  2NN6 G;  1KLG D;  1JWS D;  3G6J B;  2Z8L A;  2FIN B;  1EYD A;  1IKM A;  1STE A;  5JPN C;  3KLS A;  2M00 A;  1ILQ A;  2XSC A;  2K33 A;  2O2L D;  2EPB A;  2F03 A;  3QB3 A;  2ZXP A;  4WJW A;  3KBX A;  5C4H A;  5AFW A;  1G2T A;  1I4G A;  5D3D A;  4OHJ A;  2F0I A;  3NQI A;  3MC0 B;  1CA6 A;  1NUC A;  1SYF A;  1AEX A;  4EGV A;  2O5I C;  4DXF A;  3BDL A;  3BVZ A;  1HCZ A;  3PMF A;  2F0M A;  5EBD A;  3A54 A;  3HEJ A;  3SHL A;  2K5D A;  3R2T A;  4J6H A;  3CRL C;  1RHP A;  5C3E B;  4A3D B;  1PRT F;  1ET6 A;  2FHT A;  4KK7 A;  4DAY A;  1ZKO A;  3IAY A;  3CRK C;  2HCI A;  5I4D A;  2RSN A;  4M1U B;  5KRU A;  2XNA C;  1DXM A;  1PYW D;  1MD2 D;  5LHY 1;  3T13 A;  1SJE D;  1B2T A;  4ZK9 B;  2BOS A;  3RD4 A;  2XVS A;  2XWJ B;  1GHJ A;  5BN3 A;  2NVX B;  1LT4 D;  3Q22 A;  3OW7 A;  5JVG 3;  4I7Z C;  3K5M A;  1FNW A;  3ND8 A;  2F0W A;  2EOT A;  4CJ0 B;  2M2L A;  3OPO A;  5JEA H;  2B39 A;  2LKV A;  1SYB A;  4IN3 A;  2NBF A;  4KD3 A;  3PO3 B;  3J80 E;  3FRP B;  3J80 L;  1V1P A;  4HMI A;  4FF2 A;  2EDG A;  4QB4 A;  1I4Q A;  2OEO A;  4C3I G;  4KJN A;  4RH6 A;  3TZU A;  3JAM E;  3JAM L;  5F2D A;  4CJ1 B;  5E1F A;  3NQT A;  1X3Q A;  2PW7 A;  2B2U A;  1B44 D;  1JIC A;  2QIL A;  4CHT B;  1STY A;  1H9J A;  4F8M A;  1WCM B;  4ID6 A;  1TY2 A;  5K5P A;  3S1R B;  4K2L A;  1UAP A;  1HTL D;  2EE1 A;  4DU9 A;  2HQE A;  1B50 A;  1SEB D;  2PYK A;  5BN5 A;  2K6A A;  3KLS X;  5CV8 A;  3I72 A;  3VA7 A;  4FNF A;  2WAC A;  1H9S B;  3VYT A;  5KNB A;  4BY7 B;  3FPP A;  2D62 A;  4DN4 M;  2E2J B;  3DWP A;  3E5S A;  3S2H B;  4R8N A;  1HUM A;  1AN8 A;  2TMP A;  1WTP A;  3A55 A;  1ET9 A;  1CZW A;  3VR2 A;  4IQZ A;  4H44 C;  1LTB D;  2KA7 A;  2A69 D;  3C2P A;  3WOE A;  3EQL C;  5D3I B;  2J0T D;  1GUG A;  1JQY D;  2N55 A;  4FO2 A;  4KY7 A;  3A56 A;  1PTO D;  2R93 B;  5CV6 A;  1WTV A;  3S14 B;  5IGE A;  3EVQ A;  4X3K A;  3P20 A;  1D5M C;  4J1M A;  4L8J A;  1Q1B A;  3RUZ A;  1B1Z A;  1SE3 A;  4KMU C;  1O7Y A;  1S5C D;  1ZXT A;  2F0T A;  3I3C A;  3OIQ A;  4RHR A;  3SEB A;  3E0J A;  2K28 A;  3TZD A;  5KIX A;  5D14 A;  1VMP A;  1EU3 A;  3NTK A;  1PFB A;  1LAB A;  4FVM A;  2A6H D;  2JA8 B;  3OMC A;  1X32 A;  4K14 A;  1DOL A;  2EZV A;  1GUW A;  1TS3 A;  2QEJ C;  1I6V C;  4I65 A;  1PTO B;  1WTW A;  1J9O A;  4DA2 A;  4XDX A;  2MJ8 A;  1CT1 D;  2X69 A;  3DXJ C;  3VR5 A;  3H6M A;  3LNN A;  1Y69 U;  5JVH 3;  3ND9 A;  5CC4 A;  1KAA A;  1IHZ A;  3V05 A;  2VB2 X;  4Z9C B;  2MGS A;  1RDP D;  2OXP A;  4C1N K;  1B9N A;  5M3M B;  3FVQ A;  4O42 A;  1L0Y B;  1GOZ A;  2VUM B;  3V96 A;  1D1K A;  1TS2 A;  1GUN A;  5C4J B;  1A6X A;  1TKW B;  2AQ3 B;  1YNN D;  1PTO C;  1HUN A;  3QOJ A;  2IW3 A;  3HKZ B;  1ENA A;  5IGB A;  2F0U A;  4XYO A;  5KND A;  5J22 A;  2KHS A;  4XTC S;  3A8K E;  1PDQ A;  4HN7 A;  4OO1 H;  4KN4 C;  3AB9 A;  4G7O C;  4ZYS A;  3Q24 A;  1LLR D;  1S5D D;  2PPB C;  2B2V C;  1EY5 A;  2EY6 A;  2RBM A;  1BOS A;  1HQM C;  1LTG D;  4PNY A;  3RMH A;  1M4V A;  1QNK A;  4RKL A;  1LT6 D;  2D2C C;  5C0X J;  1F9Q A;  1G8Z D;  1TR5 A;  4ODG A;  4BBR B;  3VYR A;  2J7Z A;  2NN6 H;  2E2I B;  3QO2 A;  2B2W A;  2K5Q A;  3NSW A;  2EYO A;  2KUM A;  3Q0A A;  4R8I A;  1G2S A;  2FMM A;  4N9T A;  4RGN A;  3DMU A;  3LX0 A;  1BCP D;  2EYM A;  3C1E A;  2PZT A;  2L0C A;  1I4P A;  1OO9 B;  1SMY C;  1LAC A;  4IUU A;  1B53 A;  1EU4 A;  1MGS A;  1D5Z C;  3L3O C;  5TSS A;  1EY6 A;  4KKS A;  4RCO A;  2KCC A;  3J7Y W;  1S5F D;  1JWM D;  1AP0 A;  4XQN A;  1YNN C;  2KEC A;  4BWG B;  4B9X A;  3U9O A;  2F0Q A;  4KI0 A;  1ESF A;  2PO4 A;  1XTC D;  1SFO B;  1EZ6 A;  5EBC A;  1JOR A;  5BN4 A;  1S5B D;  3L7Z C;  3BVM A;  2BA0 A;  1F2L A;  1BCP B;  4GZY C;  2FFK B;  2SEB D;  4KTA A;  3QWN A;  1EOT A;  1FGB D;  1PTO F;  3IFT A;  5E4X A;  3VR4 A;  4FF3 A;  2D5D A;  3S1Q B;  2BA1 A;  1JOK A;  1A2T A;  1ZEQ X;  4IFD H;  1QOH A;  3VR3 A;  1LT5 D;  2EXZ A;  2B8F A;  3H91 A;  2I46 A;  4C3I B;  1SND A;  4G7Z C;  3ZYY X;  1RD9 D;  1F9S A;  4MN3 A;  5KNC A;  3FMC A;  5JEA J;  1MSH A;  5JAV A;  3NPP A;  1V8Q A;  2ENB A;  3WDN A;  4IUV A;  1V1O A;  2MHV A;  4ZUJ A;  4R9W A;  1H9R A;  1EY4 A;  1QIL A;  1TY0 A;  1EYC A;  1SJH D;  3BYY B;  2IL8 A;  1JWU D;  2L55 A;  1ML0 D;  3TP6 A;  5IGD A;  1PZJ D;  3PUZ A;  2VXW A;  5G3L F;  2K01 A;  3CKI B;  1CQV A;  1BBX C;  5M9O A;  3C3L A;  1PXU A;  5LL6 S;  3SDZ A;  1BUV T;  1RTO A;  1H9K A;  5DEH A;  2R61 A;  3TP7 A;  4RCN A;  3D3R A;  5CMD A;  2EY2 A;  3I90 A;  4NMZ A;  1JE4 A;  1SSO A;  1DYQ A;  1X3P A;  1MBY A;  5CYU A;  3GO5 A;  3R8B A;  3NBH A;  1F2Z A;  1ILP A;  3OWF A;  1EWH A;  1I50 B;  1CFM A;  4H0L C;  5E3F A;  5CBE E;  4U67 3;  5K36 G;  3E6Z X;  4Q0F A;  2KVM A;  1OXU A;  2MPM A;  3K5O A;  3PUV A;  1D6E C;  1KAB A;  1IYV A;  1HQR D;  1AW7 A;  5ISR A;  2F0S A;  1JOO A;  4H13 C;  1SYC A;  3DWQ A;  4HR7 B;  1VF7 A;  2K7V A;  4KV6 A;  1JOQ A;  2JE6 I;  4DAV A;  1QB5 D;  4G4K A;  2F3W A;  1IYU A;  3DHQ A;  3BVG A;  3S15 B;  3LWU A;  1PMR A;  3N6R A;  4IZ8 A;  1J8I A;  3SK8 A;  3MXU A;  1WVL A;  4BY1 B;  5C5L A;  1DOM A;  5EPL A;  1E0B A;  1HFN A;  2ZT9 C;  4M8A A;  1EYA A;  3K0Y A;  4CKC A;  2HDL A;  3KK7 A;  4A93 B;  4BS9 A;  3GV6 A;  4QUC A;  1DZ1 A;  4XQQ A;  3NHH A;  1RKN A;  4OIJ A;  1SYG A;  2XIW A;  4KKT A;  3RZD B;  2F0J A;  3K6O A;  3MA2 B;  3T53 B;  1JB3 A;  1B4O A;  1EWC A;  1SNQ A;  1STH A;  2WP8 J;  4TKO B;  4A3M B;  4X3U A;  3N52 A;  3S17 B;  2VB3 X;  1Z47 A;  4ZRZ A;  5KGU A;  2K05 A;  1O78 A;  2MUY A;  2F0L A;  1STA A;  1U9R A;  2Z4H A;  2PCF B;  4A3B B;  2YU9 B;  3HOZ B;  4RGT A;  2WKC A;  3UI2 A;  3I73 A;  4G57 A;  1S5E D;  3DWA A;  3QIA A;  4X3T A;  4IUN A;  1O80 A;  1HXY D;  4FXK C;  4O1N A;  3M4O B;  2AWO A;  5FK9 C;  1BO0 A;  2LY7 A;  1SDF A;  1KDB A;  3NE5 B;  2WII B;  3HZX A;  3K5L A;  1HRJ A;  3I4N B;  1ENF A;  1HPC A;  3J7A V;  3BDO A;  5EPK A;  2NB0 A;  2HDM A;  3GTK B;  3QOL A;  1AZP A;  5IT9 E;  5I9O A;  3IL8 A;  4DAP A;  5IT9 L;  4K2K A;  5I6Y A;  1TWG B;  3M3Y B;  1STB A;  5D65 A;  1Q3L A;  2AQ2 B;  4JK1 C;  4CKE A;  1Y1W B;  1GUT A;  4CBV A;  1I4X A;  4LK1 C;  2HUG A;  2R92 B;  2Q8R E;  3VYU A;  4ZKC B;  1M8A A;  3MXG A;  3D4R A;  3GTM B;  4FP5 D;  3HOU B;  2OT2 A;  4DK1 A;  1EY8 A;  1PFN A;  4RWS C;  1WTR A;  3PUW A;  4DF7 A;  5CV5 A;  2EYP A;  4ME5 A;  4JBW A;  1DON A;  3RZO B;  5CR3 A;  3T16 A;  4NP5 A;  4QUF A;  4ZLT F;  3KBG A;  3SXH A;  4K8I A;  4HMJ A;  4A3J B;  1G29 1;  1UNS A;  1GJX A;  1BNZ A;  1DJR D;  1H9M A;  2R3Z A;  2C5C A;  1RF2 D;  2AUK A;  3WOF A;  4RGM A;  2BCO A;  4EQP A;  3MTS A;  4AYB B;  1SBB B;  4C3H G;  5NUC A;  1WTO A;  2JEB I;  3D4W A;  1PZK D;  4HAE A;  4PQX A;  5EKI A;  3OSO A;  5M5Y B;  1WD0 A;  1K8O A;  1B3A A;  3D4D A;  4DFA A;  1G6Z A;  3MHB A;  3PO2 B;  3K58 A;  4KHV A;  2L12 A;  1C48 A;  2A5H A;  4HSV A;  3NK9 A;  2B2Y C;  3D6W A;  4K6L A;  4EQO A;  1II3 A;  2F0F A;  4MHE A;  3H09 A;  4K5V A;  4B9W A;  1TT2 A;  4IFD J;  2G9D A;  3NUC A;  5IGC A;  2A69 C;  1GUO A;  3MEH A;  3HGB A;  2L9H A;  1EY9 A;  1BXT A;  3O13 A;  3I91 A;  1OXV A;  1H9S A;  2FMC A;  1SYD A;  4U68 A;  5CBA E;  1EY7 A;  2WV6 D;  5I6W A;  4K8J A;  4OGQ C;  3S2D B;  4YIJ A;  4UAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...