1GHKA

Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from azotobacter vineland ii, nmr, 25 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
79
structure length
79
Chain Sequence
AIDIKAPTFPESIADGTVATWHKKPGEAVKRDELIVDIETDKVVMEVLAEADGVIAEIVKNEGDTVLSGELLGKLTEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acyltransferase
molecule keywords E2, THE DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE COMPONENT OF 2-
publication title Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from Azotobacter vinelandii.
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 6
structure length 79
sequence length 79
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 1996-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ghkA00
3BG3A 1K8OA 1Y8NB 1OXXK 5KNCA 5C0XH 4DK0A 1CI3M 5JEAG 4G7ZC 2K33A 2PPBC 3M85A 1LABA 3D4RA 3I73A 1A6XA 2CW0C 3W3AA 3OPOA 1E2VA 1YNJC 2O5IC 3H94A 3BDOA 4KN4C 1CFMA 3VA7A 1H9RA 4KKSA 2Q8IB 1YNNC 1H9MA 3WDNA 1GUTA 1LACA 1FYCA 2A69C 1H9JA 4IQZA 1Y69U 2DNEA 2E74C 2A6EC 1GUNA 1GUGA 3AB9A 4H13C 4LK1C 1OXUA 2E76C 4XIGS 3NE5B 3VR6A 3L7ZC 3CRLC 3FMCA 3T51B 1ONLA 3OW7A 1IW7C 1Z7TA 4OO1G 3RLFA 3P20A 3HGBA 2EVBA 3QG1A 1FR3A 2KCCA 1EWHA 1VCIA 1TU2B 1GHJA 3T56B 1HTPA 3SE0A 4GZYC 1DCZA 1DD2A 2EJMA 2K32A 5A35A 5C0XG 3M4YA 4LJZC 5BN4A 3M7NA 3DXJC 3PUZA 1E2WA 1OXTA 2AUKA 2AWOA 2NN6H 3D31A 2BDOA 5KNDA 4KI0A 3TZUA 1I6VC 2A69D 2JXMB 2KA7A 3QIAA 4G7HC 2A6ED 4TQUS 2JEAI 1Q12A 5K36H 3PUXA 1BDOA 2D2CC 4KN7C 4IFDH 2A68D 1Q1BA 5BN3A 4G7OC 1K8MA 2BE5C 1OXVA 1VF7A 3A8JE 3CRKC 3T53B 4IFDG 4KMUC 2D5DA 1T5EA 2ZT9C 2A6HC 2B8GA 1Y8PB 3MXUA 4BA2I 2BA0A 1V43A 2YYZA 3EQLC 4DNRB 3FPPA 1B9NA 3N6RA 2E75C 3I4LA 4HR7B 3OOCA 1V8QA 2JE6I 3A8KE 4DK1A 1H9SB 1IYVA 1PMRA 3VR2A 4PV1C 3GQBA 1HCZA 1HQMC 3GD7A 4TKOB 3KLRA 1Q90A 2NN6G 1SMYC 3ND9A 4DNTB 4H0LC 4KKUA 2B8FA 2D62A 2EJGC 2PNRC 2DN8A 2JEBI 3IFTA 4XTCS 2O5JC 3VR3A 4RCNA 1OXSC 1ZKOA 2V4DA 2NN6I 3SDZA 2EJFC 2BE5D 5JEAH 5K36G 1GUOA 3LWUA 1IW7D 4KHZA 2IT1A 1CTMA 4KKTA 1GJXA 3U9SA 1Z6HA 1DXMA 3A7LA 2EDGA 2PCFB 3PUVA 1GUSA 2AUJD 1G291 1Y8OB 2A6HD 1QJOA 3PV0A 2DNCA 3VR5A 1GHKA 1B9MA 1HPCA 4OGQC 4L8JA 1ZYRC 3I72A 4JBWA 3PUWA 3QJYA 3A8IE 2K7VA 1H9KA 3LNNA 1H9SA 3PUYA 1O7LA 1VDZA 3ND8A 2L5TA 3MFYA 3A7AB 1Q1EA 1E2ZA 1TKWB 2A68C 2BA1A 2LMCB 1VF5C 4I7ZC 4OO1H 1O78A 5KNBA 4H44C 5BN5A 4JK1C 4BA1I 2QF7A 1IYUA 3IKJA 2R6GA 2F1MA 3VR4A
chains in the Genus database with same CATH superfamily
1RHPA 3Q8DA 1HR0Q 2KOLA 2EOTA 2WKCA 1Y14B 4LF5Q 1D5XC 2PMZE 4IPHA 4ZCKA 2F52A 2KHJA 4QL5A 2OTLA 3H94A 2K14A 4BBRH 2Q8IB 2PZUA 5DNFA 2IX3A 4BY7G 4IQZA 1X54A 4A3FG 3IAYA 3KDFA 3CU7A 3L9AX 1SMYD 1HJPA 2KHIA 4K5WA 2M9VA 4A3EB 4K8JA 4MTNA 3OIPA 4DAYB 5C3EB 2B2YC 3KOJA 3HOYG 4A3DG 1GHJA 2R93H 1D7QA 2NYZD 2XSCA 1ET6A 2HCIA 1YZ6A 1VQ4A 3GDEA 3AEVA 5KYLA 1KL9A 4UPAA 3KBXA 2SOBA 2A69D 2KBNA 3IFDA 3AYHB 1X55A 2RKSA 2ZXOA 1K0RA 4IN3A 3C3LA 2A68D 1PTOH 4POFA 3MFGA 4X62L 2KVMA 5C3WA 2BOSA 1T5EA 2K5HA 3MEFA 4X3UA 1JWMD 2A6HC 1YHAA 1EIFA 3BDCA 4BA2I 2NVQH 2YYZA 3RLNA 1XNRQ 5M3MH 3TDQA 2EZVA 5IT9E 3A74A 3NBHA 1MKHA 2NZOA 1EWIA 1M8AA 3BVGA 4PV1C 2B63H 3PF4A 3NTHA 4IPCA 1A62A 1IBLL 2A8VA 3A55A 3STBD 4BBSG 1JORA 2OEOA 3LWUA 1IW7D 1JJGA 1CK1A 1O80A 1I4HA 2PW5A 3KF8B 2B2TA 1HR0L 3OIQA 4LF5L 3Q6SA 3DEOA 4OGQC 1STBA 1RCVD 5LHY1 5T1IA 1B4OA 2K28A 2JA7B 2Q2IA 1WCMB 2ATWA 3TP8A 2JA8G 1QVCA 1GD7A 3S1QB 3GO5A 1RJTA 3PIOA 4A3MB 4A3GG 4C3JH 1HZCA 1GXDC 1I3QB 2N88A 3BG3A 2IPKD 4GLVB 3HP3A 1EY6A 3MHBA 5CV6A 2F0PA 5DEHA 2ZJRA 4O2DA 2R7DA 1YVCA 4R9WA 2FFKB 2CWAA 1N8RC 3I73A 2Z0SA 4XXEA 2R7FA 4A93G 4NDXA 5EQ0A 3BYYB 1TR5A 2IX1A 2WV6D 1WTVA 2FJ2A 3M4QA 1W2BA 3PO2H 1IKMA 3M9BA 3HZXA 2CWPA 2VB2X 4V0BA 4GNXB 3JAML 1SYFA 2EXDA 1EEFD 1KDAA 2KENA 3MTSA 5LL6X 1XNRL 2JA6B 5KNDA 4HJ9A 3NEMA 3CF5A 3W1GA 3CP0A 2JXMB 5JJLA 1NY4A 4C2MH 5FO9B 2NVYH 2ALYB 3FP9A 3I56A 5JJIA 1CT1D 3PQIA 1HZBA 2VUMG 4P75A 3GTLH 1YJNA 4P71A 3CCMA 1D6EC 3GTOB 1A3TA 4B08A 3HKZB 1B7YB 4CJ0B 3BS1A 2E5LQ 3CD6A 3MXGA 1D8LA 2NBFA 1H9SB 4Q5VA 1BCPD 1O7YA 5IGFA 1PDQA 2JEBI 1QNUA 4JI0Q 3J7AV 3QO2A 3UE0A 2PQEA 3LX0A 1SNDA 4A75A 1I94Q 1LM0A 4B3RQ 1E3PA 3QOJA 1WTQA 1JJ2A 4JCVE 1HH2P 4BY7H 2B2TC 2Z4HA 4A3FH 5IY0A 4BBRB 5LMUQ 3NSWA 3CCSA 3S1MB 3HOUG 2XVSA 3NHHA 2WAQB 2QF7A 4A3DH 3U58A 1OXXK 4A3KG 1ENFA 3NELA 4LMQD 2K5VA 3JAME 3KFUA 1Y1VB 1PRTF 1YNNC 2F0QA 1EY5A 1LACA 1SYDA 2E74C 4XIGS 4OXPA 4G4KA 5CBAE 4DXGA 1ONLA 3OW7A 4GN3B 1PTOB 5KIXA 1HHVA 1KXLA 2AQ3B 1SYCA 1FR3A 4JI8L 3DHQA 1JE5A 3Q24A 3CPFA 3BDLA 1QZHA 3NTKA 1EFID 4GN5A 4HEDA 4BXXG 1NR4A 2XRSD 5BN4A 5M3MB 3DXJC 1E2WA 2AUKA 2AQ1B 1LO5D 1PYBA 2E5LL 2IJ0A 4BBSH 4P72A 4DR7Q 2B63B 1E1TA 4K14A 4AYBE 1BDOA 4IFDH 1LUZA 1LT3D 4YCVA 4HCSA 2WB1E 1U4MA 4RAUC 5EGTA 4JI0L 4I65A 3E0EA 2EY6A 5JJZA 4LF7Q 1KRSA 3E0JA 4WJ4A 1I94L 4LF4Q 4B3RL 5M9OA 1TY2A 3NBIA 5IYCG 1KTKA 3SK4A 2E75C 3CCUA 1BUVT 2GA4B 4A3JB 1YNJD 3OOCA 2JA8H 5JVG3 3GD7A 5LMUL 4A3GH 2NN6G 3K7AH 5CORA 3OMGA 3J7AF 5AFWA 2X69A 2ZXRA 1LTBD 1VQMA 1C8CA 2HDMA 4A3IB 4C3JB 1JC7A 1JQYD 4NMZA 1XJVA 4X66Q 2FMCA 4A93H 3GV3A 3H6MA 5IODA 1IXRA 1JB3A 1VQ7A 1S5ED 1TWGB 2JSOA 4RA8A 2F0WA 3MFYA 1O78A 3BVMA 2VS1A 5BN5A 1KD1C 2UXCQ 1NTGA 1YI2A 5J22A 5JJKA 1SRUA 4JI6Q 3TEHB 1ML0D 4B3TQ 3GTPB 1CI3M 1HUMA 2KEDA 1EL0A 3M85A 1EWCA 1EEID 4PZ8A 1WD1A 2GVBA 3EA6A 2VUMH 3E9HA 1WTPA 2Z6KA 1M1KC 1RF2D 4DR7L 5ELBA 3HOVG 1SE3A 1KLUD 5DM73 4LUOA 4GOPA 2N49A 3K80C 1SNOA 4OX9Q 2VQFQ 4MN3A 1MGSA 3SE0A 4LF7L 1PRTC 3CKIB 5C0XG 4LF4L 4UY8C 1UNSA 1TS4A 5CGKA 4HJAA 5C44B 4PNYA 4FF4A 4YY3Q 1G91A 4RG1A 3G6JB 1SJED 3KLSX 3CC2A 2DJGC 3W1BA 1FD7D 1SYBA 2UXBQ 2IWHA 1PH2A 2PMZB 2A1AA 1WFQA 4WJ3M 5EPJA 3URYA 3FKIG 4DR1Q 1X65A 1L2FA 1K9MC 1HR0W 4X66L 4F8MA 1CZGA 3F2BA 3J81j 4DV3Q 2FINB 3OW2A 3HOUH 3J81i 2RDHA 2RQXA 5FLXL 3CCJA 2DUDA 4OIKA 2D9UA 2D0PA 1LTRD 1XPOA 2UXCL 4OHJA 1RIPA 1T9HA 4JI6L 2EDGA 1PH5A 3DUZA 2JA5G 4IUTA 4B3TL 5IOCA 4LFAL 2VXWA 1U4LA 1WD0A 2UXDQ 3I8ZA 3A8IE 4K5VA 4C56C 3GTJH 3CCQA 3A5UA 1VDZA 2F0VA 1HNXL 3TREA 2YU9H 3CXCA 3RZDH 4BXXH 2B2VA 4LF9Q 4DK0A 5I6YA 1BKBA 4OX9L 1YJWA 1G2TA 2VQFL 1A6XA 4JI3Q 1S4ZA 4DUZQ 1SROA 2PYKA 4XQQA 5CMDA 1VQKA 4P2CB 1SAPA 2NWGA 4CDDC 2YTVA 1CUKA 1U4RA 2DNEA 3S2DH 2ASBA 4YY3L 3DWQA 4CBVA 4BBSB 2R3ZA 3CRLC 1LYLA 4C3IG 1GKHA 2Z6KC 5F2DA 2UXBL 1Z7TA 3TMEA 2UUBQ 1O7IA 2AKWB 4GOPC 3H3VH 4IJLA 3I91A 5IYCH 2PZTA 1ET9A 2EYFA 1KLGD 5KGUA 1DD2A 4QB4A 1BVSA 1A3VA 2F0MA 4UP9A 1AH9A 1D2BA 3NUCA 1G51A 4DR1L 3M7NA 2NN6H 4C3HB 3GTMB 1Z47A 1R9TH 4WORA 2E2IB 1PFBA 4DV3L 3K7AB 1YBYA 4G7OC 3HG9A 1Q1BA 4G57A 1K8MA 1LT6D 1EYDA 3W5OA 3T53B 4CDFC 5FLXE 1SNQA 2ZXPA 1XXGA 3NP8A 3E5SA 1I50B 2EIFA 2ZT9C 4KY6A 1E0BA 5KEEA 1JB7A 5JVH3 2K52A 3KUPA 3UDFA 3HOXH 3KBGA 2I5LX 2JE6I 2NZ1D 1G6ZA 1HNZL 2UXDL 1AE2A 4GKJQ 3P1HA 1C48A 3ND9A 3PO3G 3TQYA 1V1PA 4CDEC 5D3IB 4CHTB 2A19A 4ZKBB 2X6LA 2BE5D 1GUOA 1NR2A 1UAPA 1I4XA 2F0OA 3F1ZA 1IHZA 3KF6A 3U9SA 1VMPA 4LF9L 1Y8OB 4RKLA 2I07B 4POGA 2ZM6Q 1HPCA 1PHJA 3ERQA 1R4PB 2Z4IA 4JI3L 1NJIC 1EQTA 1HZ9A 4A4IA 4DUZL 4A3LH 1H9KA 2DY7A 1O7LA 2AWNA 3DWPA 3HOVH 3AFQA 3VYUA 2XIWA 4QUFA 2F0JA 4BA1I 4C1NI 1WTOA 5IGDA 3S24A 2R6GA 1L1OB 2ZJPA 4RGMA 1WTRA 1MJEA 3I7FA 1SSOA 2UUBL 2QEJC 4ILWA 5C0XH 2B2VC 2G9DA 5ELNA 5JEAG 3K57A 3UE1A 1NUCA 1S5FD 4Z9CB 2CW0C 4CKEA 4K6LA 2TMPA 1TWAH 4IFDJ 3DM3A 1H9JA 1SEBD 2IL8A 4YCUA 5I2YA 3CMEA 1PV4A 3FDTA 1RKNA 1BBXC 2NVTH 1TWHH 3QWNA 4FF2A 3S1NB 2E76C 5CV8A 2IHFA 3J80i 3R8BA 3FKIH 1EWHA 2ZJQA 3A54A 1VQCA 3IL8A 3K7UC 4BWGB 4IUNA 3S1RH 4LFCQ 4XT1B 5H1SE 1PLFA 2QILA 4K8IA 2MQHA 2KCNA 4TVAB 4ZYSA 4OWXB 2F3VA 3HFZB 4OELB 5E4XA 1A2TA 2OF1A 2K75A 4EQNA 4DXFA 5JPMC 4GKJL 1ENAA 1PH4A 5C4XB 3FVQA 1ILPA 4KMUC 2JA5H 2CQOA 2RDGA 3IRBA 1CQFA 5C4JB 2O4XA 4PMBA 4CJ1B 4APVA 1AE3A 5K5PA 3J81c 1I6HH 2BA0A 1F9SA 1TWCH 2FHTA 4DNRB 1AP0A 1B9NA 4EQOA 1PFSA 4DV4Q 4IUPA 4UP7A 3H0GG 3MXNA 2ZM6L 2OCEA 3H3VI 4JYAQ 1K3BC 1SMYC 3BJUA 3IFTA 2O5JC 4RHSA 3SDZA 2NN6I 4DAPA 1YITA 1AN8A 4BY1B 1STYA 2AUJD 2N55A 2A6HD 2JA9A 1EFWA 3M3YH 4AYBB 4NXMQ 1FGBD 1STEA 3SK8A 4OL7A 4DR4Q 1N33Q 2Y0SG 2F0EA 4IOCA 5CBEE 3J7ZC 3SHLA 2WB1B 4C3IH 3ER0A 2DY8A 2A68C 1QWYA 4NW2A 1UE7A 3ITPA 2F0IA 4A3BG 2F1MA 3KYHC 1B44D 5ELDA 3SVMA 5D3DA 5IYBG 2K04A 1PTOD 1R4QB 3GTKH 1AZPA 2B2UA 2IY5B 4LFCL 3C2PA 1CZWA 1YIJA 3VA7A 1H9RA 3S16H 1L0WA 2K6AA 3U4ZA 4FVMA 4JC0A 3L0OA 4H13C 1R9TB 2WIIB 3STBC 3L3OC 4XT3B 2I0QA 3T1HQ 1IW7C 2WKDA 1MD2D 1NAPA 4YIJA 2PO4A 3GTQB 1YHQA 4DGZA 1K73C 2Q2UA 2EJMA 3MEHA 5FO8B 3BZDB 3VYTA 3CQZB 1X3PA 3PO3H 1V9PA 3HOXB 4ZLTF 1EQRA 4DV4L 5C0XI 3I4MG 4A76A 4HCEA 4IALA 3BVZA 3HKSA 3UDXA 4JYAL 1MIUA 3S17H 3BYTB 2D2CC 4KN7C 4XQJA 2R7ZG 1D5MC 5DLQE 3OTOQ 2L9HA 4PZ7A 2G5DA 1WI5A 4PZ6A 1V1QA 3F2DA 4L5QA 3RMHA 2Q8RE 1V43A 1SNCA 3T1YQ 2BH2A 1C4QA 1FNWA 4IUVA 3H09A 4NXML 2L4NA 3M4OH 4DV0Q 4DR4L 1N33L 4DV1Q 5CR3A 1SXTA 3HOVB 4GS3A 5IE8A 3NPPA 5LMNW 2AQ2B 4XTCS 4FXDA 4HMJA 1VS0A 4HIOA 2F0GA 1KC8C 4O0AA 5JEAH 1QUQB 5K36G 1E7ZA 1Q8IA 5IYDG 1DXMA 1SLJA 2PCFB 3I70A 2MO0A 2OQKA 3W2DA 4EGVA 1RL2A 2RHQB 1Q7YC 5M3FG 4OONA 2Q2TA 4ZUJA 4CDCC 1ESFA 4NXNQ 2J4XA 5A2QL 1PH6A 3QB3A 3J81L 2GVAA 5KNBA 1VQ8A 2N78A 1VQAA 1N34Q 1DOKA 4DKAC 3OWFA 5HGTA 3UI2A 1X3QA 3T1HL 4MTKA 2NVXH 2M00A 3DWAA 4OEMB 3TZDA 3J7A5 2Z9HA 2CVRA 1JICA 2MHVA 2L55A 2B2UC 1BCPC 3TRZA 2CCZA 2EYHA 2BDNA 1GUTA 3J80c 5ISRA 5HGQA 1VQ9A 2A6EC 1DM0B 1G8ZD 1VQ6A 1XX8A 3HOZG 3FMCA 1VQEA 1A3UA 1EIGA 3HOYH 3KF6B 1XTCD 1K0SA 1JOOA 1BBUA 2F0SA 2NTTA 4ALPA 1Q81C 4LF8Q 3OTOL 2HD3A 1S72A 4XQNA 4GZYC 3H0GH 2Z6BA 1TVXA 2R92G 5FLMG 5A35A 2R93B 3F8TA 1BQQT 1OXTA 1EYGA 3D31A 1EY8A 2PNHA 1ZYRD 4K5XA 3T1YL 1ICWA 5IP7G 2SDFA 2N3SA 3E3XA 1LTGD 2B29A 1W6KA 2PQAA 2E2DC 1JJCB 4TQUS 3PF5A 1Q46A 3K8AA 4LAAA 4DV0L 4DV1L 1JWUD 3CRKC 1WTWA 4DK6C 4A3EG 3MAQA 1L0XB 1VQJA 2XN9C 1F2ZA 4TRDA 3VYRA 2HT1A 1MI2A 2NVQB 2I46A 5M5WH 3KJPA 2SNSA 4NXNL 3L2PA 1HQMC 2F0NA 5EKIA 1EU3A 1SE4A 4C3IB 2QGQA 2JJQA 2EJGC 2DN8A 5A2QE 4R4QA 1OXSC 5IYBH 2QEXA 1WTXA 1N34L 1HUNA 3K5MA 1CTMA 4PQXA 5EJWA 1HZAA 5LL6S 1GJXA 2MGSA 4RGTA 1IL8A 4X3KA 5M5YH 1QB5D 4JBMA 3S9WA 2F4IA 2F0TA 1EYCA 2ZTDA 3QJYA 4DV5Q 1MHWC 1H95A 3KDFB 3GTGH 2LKVA 3S2HH 4DAVA 1VF5C 4FYDA 1SMXA 4J15A 5I9OA 1GM5A 1TWFH 3DM1A 1EOVA 5I9PA 5COYA 5GADC 2HQEA 1Y1WG 3RR5A 3CCRA 4LF8L 2K05A 2K33A 3RZOH 4J8QA 4R8NA 3I4MH 1YNJC 1KHIA 3FPUB 4KKSA 1CKNA 4S3SA 1FYCA 4IUQA 4AQYQ 4KY5A 3AB9A 2R7ZH 1CHPD 3WWVA 2JA7G 4XDXA 5E4WC 1II3A 3S17B 3X3MA 3PGZA 2QDLA 4RFBA 1XPRA 4EQ5A 2K5DA 3EVQA 5BR8Q 4A3MG 4B9XA 3PO2B 1FVIA 4R4CA 1DOLA 1TS3A 4ODGA 3T56B 2FMMA 1HTPA 1DCZA 3KLWA 3NBHB 4NKLA 4R4OA 2RSOA 3MVVA 1Z9FA 1DGSA 5CC4A 5IIFA 1IL2A 2EXZA 5IGCA 3QIAA 1KIXA 5K36H 4C2MB 2NVYB 3R2TA 4GLXA 4RH6A 3GTLB 4DAYA 3K5OA 5M3FH 4JV5Q 2UUAQ 3D6CA 4DV7Q 3V2TA 1GO3E 1LT4D 4E6IA 2NTSA 5EBCA 4FXKC 4EQPA 1EQQA 2KUMA 2JA6G 4RGOS 3S15H 4KKUA 2PNRC 5EPLA 5G3LF 3VDYA 3JAMi 2VNUD 2NVXB 4C1NK 4DNIA 1UEBA 4B3MQ 1HA5A 1QJOA 3MWYW 3HKZG 2C5CA 4AIMA 1GHKA 1PZID 5E1FA 4BY7B 3T4AC 2EY5A 2LY7A 3LGJA 4A3FB 3LNNA 3HOZH 5IGEA 1Q1EA 3MA2B 3FHWA 4AQYL 3WOEA 2RBMA 5J1ZA 5GAEC 1MSGA 2A74C 1IYUA 1B3AA 2KCMA 3VR4A 4A3KH 2F3IA 3HOYB 4A3DB 2R92H 5FLMH 4J6HA 2UU9Q 5BR8L 3R3OA 3G4SA 4G7ZC 3KF8A 5IP7H 4KN4C 1SBBB 3WOFA 2VL6A 2MP1A 1Y69U 1ZEQX 1GUGA 1EQVA 5IT9c 2JK8A 1HQRD 1JWSD 4RMFA 5M5XH 1JCKB 2F4VQ 4FDBA 2WAQG 2ENBA 4N8FA 1CKMA 1G2SA 1PYSB 2HDLA 2K5QA 4FNFA 4DV2Q 4FF3A 1E1OA 1PH9A 1I4RA 2J0TD 4UDUC 5IP9G 4WFN3 4JV5L 1WVLA 2UUAL 4ID6A 2VQEQ 4LJZC 4AH6A 2KHSA 3R93A 4LUVA 4DV7L 4JI1Q 1Y1VG 4F87A 5M5WB 1XWEA 4PMWA 4DN4M 3OHXC 4HJ7A 3CHBD 1K8GA 4DR2Q 2B2WC 2HIVA 4QMGA 1A2UA 4P74A 1KAAA 4F7XA 2N8NA 1VQDA 2L0CA 1SDFA 2Q8TA 2TSSA 1QCBD 4GNXA 2OWOA 1IBKQ 1I4PA 2A73B 4DFAA 1XYIA 3QOLA 3EQLC 3FPPA 3NXWA 2CH4A 4B3ML 5M5YB 3C1FA 3I4LA 4HR7B 3RD4A 1IYJB 4IO9A 1K28A 1IYVA 3VR2A 2RSNA 3GQBA 5J39A 1Q90A 3SR1A 2JA8B 3M7GA 1CA5A 1UEAB 4A3GB 2UUCQ 1VQGA 4ME5A 1Y1WH 3S14H 2QW7A 4GN4B 2XWJB 3R2IA 4KHZA 4WJWA 2M2LA 5EPKA 5FKAC 1DJRD 1BOSA 4K6DA 4I7AA 2FXQA 2UU9L 3NTIA 1KAWA 2O2LD 1EIYB 1B9MA 3EJIA 4X65Q 4A93B 4L8JA 2RVLA 1F9RA 3PUWA 2WACA 1LTSD 1S3OA 2JA7H 2XNAC 4A3JG 1EU4A 1H9SA 3CC7A 3HOWG 3S1QH 1D1IA 4A3MH 2HCCA 3A56A 1G6PA 1I3QH 5EBDA 4PG3A 3EIVA 3K58A 3B6YA 2EQSA 1EYAA 2F4VL 2MPMA 1S40A 1AZQA 3K81C 4A3IG 1BXTA 1PRTB 1A15A 1TS2A 1QVFA 4C3JG 1LTAD 3UDGA 4TSSA 3CMAA 4DV2L 1SE2A 4MIUA 2WP8J 1A63A 2IHEA 2VQEL 3PIP3 4XYOA 3OWEB 4FF1A 4JI1L 1OXUA 3NE5B 4DR2L 3J7YW 2VUMB 3T51B 2PI2A 4OO1G 1J9OA 2RCFA 3TP6A 4HIDA 1NNXA 1RTOA 1VQOA 1ESRA 3G6EA 1NBWA 3I2ZA 2I5MX 1LTTD 2K32A 1BNZA 4LW1A 1X6OA 4EX5A 3M4YA 1UWVA 2CW0D 1IBKL 2CHBD 2JA6H 3OSOA 3G7LA 1BR9A 4R4IA 5CV4A 1U4PA 4KJNA 1K3RA 3TZUA 5ELOA 5I6WA 4DV6Q 1NMGA 2OXPA 1EUJA 3MXPA 5HURA 2JEAI 1BBWA 3DLLA 1IZ6A 1BF4A 5BN3A 4ULLA 1XMOQ 4CKBA 3EBEA 1SFOH 1PZKD 1VF7A 1TXYA 3GTOH 2UUCL 4DPGA 5AJ3Q 1P16A 5KRUA 1KRTA 4LUZA 2K1BA 5C5LA 3HRZC 2B8GA 3DEPA 4Q0FA 4GNXC 1GVPA 4QIWE 1STNA 3FEWX 1MSHA 1QE6A 5EAYA 4O1NA 4X65L 3CCVA 5C44G 3NK9A 4DNTB 3JAMc 4N9TA 5TSSA 3HOUB 4H0LC 3U50C 2EYPA 1TQOA 1PFMA 1W3SA 4H7BA 2H5XA 2D0OA 1MJCA 1QILA 1EZ6A 4A3KB 2HHHQ 3HEJA 4U673 3KLSA 3P7JA 2R92B 3A7LA 4JG2A 2QCPX 1CSQA 2F03A 1TIID 3M4PA 2IX0A 3SXHA 1Q86C 1CM9A 1AEXA 3PUYA 4HTHA 1J8IA 5FJ8G 3S1MH 1XTDA 3GTJB 1LTLA 2BA1A 2JN4A 1XMQQ 1FNVA 1STGA 1F2LA 3UDIA 4JK1C 5CV5A 4F88A 5FOBB 2EPBA 4GOPB 5M5XB 2E2HH 3IKJA 1MBYA 4ZAIA 3V96A 2YU9B 2RF4A 5IP9H 4IURA 1AW7A 1Q3LA 2ZTCA 3RZDB 1PVOA 1QOHA 1Y1VH 2R61A 5JPNC 1B2TA 3BDOA 1VQFA 2MUYA 5IGBA 2A69C 4BS9A 1STAA 1BCPF 4B9WA 4HSPA 4DV6L 2Y0SE 3S2DB 1B8AA 2MJ8A 1STHA 1F9QA 1PYWD 3LWEA 3RUZA 3D4WA 3HGBA 1XMOL 2KCCA 1YNXA 5AJ3L 1Q82C 1HA6A 4N9PA 1UE5A 1EIHA 1CHQD 4X3SA 5GAHC 3NQIA 5JOBA 1VQNA 1I6VC 3K0YA 3BU2A 2PZWA 2RDFA 1Q12A 1WTHA 3C46A 5E7NA 2DGYA 4IFDG 1Y1WB 2D5DA 3S14B 1PTOC 3E9IA 1KQSA 4R4TA 2HHHL 2CKZB 4ZRZA 2AMCB 2BCOA 4A3JH 3N6RA 4MNOA 3HOWH 2YTXA 4KY7A 5HY6A 3I55A 1PA6A 4C3HG 1QG7A 3I4NG 1BO0A 3ZYYX 1K83H 1HTLD 4X6AH 2B8FA 2Q2HA 3VR3A 4K0KQ 3CC4A 1A8VA 1XMQL 4A3IH 3N52A 4IPDA 1HFGA 2KJXA 1OTCA 4KHPQ 3KK7A 4QGUA 3H15A 1KNAA 3PUVA 1XPUA 4DUYQ 1GUSA 1G291 2XGTA 2NZHA 1M4VA 3VR5A 5NUCA 1PH3A 1TWGH 4JBWA 2EE1A 2L5TA 3ICEA 4FP5D 3PIO3 4RWSC 2IW3A 4OO1H 1B70B 4H44C 3CPWA 2F0UA 3D8GA 1ICFB 3BZKA 2K50A 3CAMA 4KD4A 3GTPH 4DR3Q 3T13A 1K8OA 1NMFA 5KNCA 1F9PA 1EZ8A 3SK6A 4KJOA 3TBIB 3TS0A 1SE8A 3KJOA 2ZTEA 1LABA 2K01A 3K5NA 4X3TA 2O5IC 4M8AA 2V1CC 2QKIC 2XTIA 1X3FA 4NP5A 1H9MA 4YWLA 2VB3X 3TN2A 1TWAB 1VMCA 4DK3C 5GAGC 3D3RA 4K2LA 1TWHB 3O13A 3P75A 2NVTB 3MC0B 4JI8Q 5JAVA 1SFOB 4HN7A 1TY0A 2F0LA 3FKIB 4JVZA 4NPSA 4QQBX 3Q22A 4R1JA 3EN2A 2RCNA 2WINB 4KV6A 3S1RB 3EFXD 5C6AA 5C44H 1PZJD 1CA6A 2K5NA 5DAUA 3CW2C 1S5DD 1X56A 2B39A 2XRQD 3K6OA 1K8AC 2OT2A 3F2UA 2A6ED 1V1PB 4ME3A 1ZXTA 1M90C 4L63B 2F0DA 1CQVA 4QJFA 4RGNA 4EVOA 4GLAC 2X6GA 4K0KL 4KLKA 2MO1A 5IGGA 3RNUA 2L1BA 2JA5B 2DJFC 4DA2A 4OIJA 4DR6Q 4KHPL 2H4OA 3GV6A 4DU9A 4DUYL 4JI5Q 1I6HB 5FJ8H 2NUCA 4RCOA 1TWCB 1X3GA 4ABNA 3A8KE 1IBMQ 1EOTA 1NE3A 1PMRA 1W6JA 4WRDA 2LXJA 1J5EQ 1VQIA 1YNND 5KYIA 5I2XA 2QDBA 3V05A 1HNWQ 2D62A 3RN5A 4GKKQ 1T5XD 5C4XG 2F0KA 2E2HB 1NSNS 3T16A 1X3EA 1VQ5A 1SNPA 4CJ2C 4QUCA 2RHSB 1F2YA 5T1GA 4DR3L 5C3EG 4QF4A 3SK5A 1ZYRC 2BH8A 3M3YB 1F77A 4OWTB 4NB3A 1HRJA 2L12A 2YV5A 3A7AB 1IKLA 1PH7A 1AFPA 4A3BH 2SNMA 4R8IA 1LTID 1Q8KA 5C0XJ 4KTAA 1X9NA 3AFPA 1U0LA 3PMFA 1C0AA 3J81E 4Y7NH 1JOKA 4K2KA 1E22A 4BY1G 4HAEA 1EY0A 4YHHQ 2NB0A 5CYUA 5FLXc 1SYGA 3D4RA 3W3AA 3GTKB 1E2VA 4YCWA 1PXUA 3I90A 4YWMA 4AYBG 3HS0C 2VY3A 3G48A 1YEZA 4IZ8A 5C3XA 5C5MA 1VQPA 3S16B 4L6TB 2K5WA 1N9WA 4DR5Q 2VW9A 2WB1G 3VR6A 1B50A 1UUPA 2ID0A 2EVBA 3QG1A 1L1OA 1VCIA 4X64Q 3E6ZX 3ULPA 2ES2A 3ONAB 4OO1I 5IWAQ 1SYEA 1KDCA 2P5ZX 1SN8A 4C3HH 3GTMH 2Z1CA 3MXNB 4DR6L 3I4NH 3QR8A 2KECA 3HOWB 4JI5L 2E2IH 2E2JH 2MNAA 3Q0AA 3PO3B 1IBML 1WOCA 3ULLA 1J5EL 1K83B 1WCMG 4KK7A 3A8JE 1RTNA 1HNWL 1I50H 4GKKL 1JE4A 3TP5A 1EY4A 1LV9A 4CGYB 1LT5D 1KNEA 1Y8PB 3MXUA 5CV9A 1RDPD 1FGUA 1N32Q 3FRPB 4DK1A 4JPBW 1C9OA 4V190 3HOXG 2B2WA 1JMCA 4IPGA 1S5BD 1HCZA 3G71A 4TKOB 3KLRA 4FXGC 3M4OB 5I4DA 1DONA 4CKCA 4RCNA 3U4VA 2CFMA 2ICIA 2V4DA 5IYDH 3J80L 1V1OA 1O7ZA 2IT1A 4LFAQ 1ILQA 3OYYA 1QVGA 1CKOA 3I4OA 1JR0D 4FO2A 1S5CD 1BCPB 5D65A 3PV0A 2DNCA 1B3QA 4YHHL 1SJHD 1PRTD 3K59A 2F0HA 2VZAA 5LMNQ 1UE6A 5ELEA 4L5RC 4XYQA 1HNXQ 1TKWB 4DV5L 1HFNA 2CQAA 4A3LG 4DR5L 4OWWB 4U68A 3JC66 4QIWB 3I3CA 1EY9A 2C35B 4A3CG 2YTYA 1TS5A 3U9OA 4X64L 1F2MA 2LFNA 2C9OA 5ELFA 3OPOA 1KABA 5IWAL 1CFMA 1JOQA 3S1NH 3X3NA 3HKZE 2ICEC 4LK1C 5ELCA 4JI7Q 3PSIA 4LF6Q 2B3GA 1FL0A 1ASYA 4KHVA 4RHRA 3RN2A 3SGIA 3PCOB 5EKKA 3RLFA 3P20A 5GQOA 1KDBA 2H1EA 2Z8LA 1TU2B 1L1OC 2EYJA 1FJGQ 4B3SQ 1D5ZC 1HXYD 1ASZA 4HIKA 1VQHA 3DMUA 3H0GB 5DM63 1ENCA 3PUZA 1SR3A 1N32L 2L15A 4UAIA 2BDOA 3AMUA 4KI0A 4L5SA 4G7HC 4LFBQ 4BBRG 4DF7A 1B1ZA 1E24A 4M1UB 2K4KA 5C4XH 1I4GA 4LWCA 3D4DA 4JW0A 1OXVA 2QA4A 4A3EH 4JOIA 4JBKA 4Y52H 5C3EH 5C4JH 1DYQA 5E3FA 4HJ8A 2WAQE 2PI2E 4IFDI 3J80E 2A5HA 2XWBB 3ZJYC 1HNZQ 2Y0SB 1D1KA 2R93G 2HIXA 1V8QA 2J7ZA 3K5LA 2F0FA 5LMNL 5JEAJ 2JP1A 4A3BB 2LS01 3Q23A 1DZ1A 2L11A 4BY1H 2F3WA 2RA4A 4JI4Q 4Y7NB 2PW7A 4KKTA 2EY2A 1Z6HA 1XNQQ 1RODA 4IJHA 5C4HA 3TS2A 2K03A 3I72A 1YJ9A 1N36Q 4ZK9B 1YHBA 2K7VA 5M3MG 4ZKCB 4N8X1 5FO7B 1E2ZA 2LMCB 2EY1A 4HIMA 3GTGB 4UHVA 2B63G 3S2HB 1J6QA 4JI7L 4LF6L 4IUUA 3AU7A 4JI2Q 1VQLA 1JT8A 5GROA 1QUQA 1Y8NB 1TWFB 2EYMA 3OMCA 4PMCA 2PPBC 1I5FA 4MZ9A 4QY7A 1FJGL 2WFWA 3NENA 4B3SL 1QZGA 1OO9B 3RZOB 1CSPA 3D0FA 4UP8A 3CCLA 3MZ5A 3I4MB 3I4NB 1LLRD 3WDNA 3GP7A 1L0YB 3NWSA 2PQAB 4L5TA 1GUNA 2E2JB 1WCMH 3PIPA 1P8LA 5G3LD 2EYLA 2R7ZB 3L7ZC 4LFBL 3SEBA 1NCVA 3H91A 3GTQH 3D6WA 2HQLA 1I4QA 2B2YA 2HUGA 4H02A 4ZQ3A 4HSVA 2GN5A 5J3BA 4KD3A 2JYOA 4HMIA 4RKBA 4IOAA 4YWKA 2KQ3A 3H3VC 3CQZH 1A0IA 3C1EA 3TSSA 2AWOA 3A5ZB 1U5KA 1X32A 4QCLA 1UE1A 5C4ZA 2G9HD 2KA7A 2SEBD 3NQTA 2OQ0A 2LSSA 3PUXA 1VQBA 1TT2A 2BE5C 4HJ5A 4JOIC 2I5HA 3PO2G 4JI4L 1FNUA 5EKLA 5M3FB 1PTOF 4O42A 1XNQL 1SNMA 1B53A 5FK9C 4DAMA 1PFNA 3ULJA 3AQQA 3CCEA 3ERSX 1N36L 2KCTA 4J1MA 3VA5A 3NWTA 2MFIA 1GOZA 1EY7A 4X62Q 3S15B 3TP7A 4MHEA 1ZKOA 3RLOA 2EJFC 1QNKA 4A3CH 1RD9D 2OTJA 4JI2L 4ZUIA 1PH1A 5IT9L 4LNQA 5D14A 2EYOA 1WYDA 1WJJA 4JBJA 2AHOB 1PH8A 2LXKA 4P73A 1CKNB 5L37A 2KEEA 3K0XA 5CV7A 2JQOA 2CH4W 3BZCA 3F2CA 1IBLQ 3EROA 3ND8A 2E8GA 1C7YA 4I7ZC 3HOZB 1GUWA 3VYSA 1DOMA 1U9RA 3A0JA
chains in the Genus database with same CATH topology
1RHPA 2KOLA 2EOTA 2WKCA 1D5XC 3H94A 2Q8IB 2PZUA 5DNFA 2IX3A 4IQZA 3IAYA 3CU7A 3L9AX 1SMYD 4K5WA 2M9VA 4A3EB 4K8JA 3OIPA 5C3EB 2B2YC 1GHJA 2NYZD 2XSCA 1ET6A 2HCIA 5KYLA 3KBXA 2SOBA 2A69D 3IFDA 2RKSA 2ZXOA 4IN3A 3C3LA 2A68D 1PTOH 3MFGA 2KVMA 5C3WA 2BOSA 1T5EA 4X3UA 1JWMD 2A6HC 3BDCA 4BA2I 2YYZA 3TDQA 2EZVA 5IT9E 3NBHA 1M8AA 3BVGA 4PV1C 3NTHA 3A55A 1JORA 2OEOA 3LWUA 1IW7D 1CK1A 1O80A 1I4HA 2PW5A 2B2TA 3OIQA 3Q6SA 3DEOA 4OGQC 1STBA 1RCVD 5LHY1 5T1IA 1B4OA 2K28A 2JA7B 1WCMB 3TP8A 3S1QB 3GO5A 1RJTA 4A3MB 1GXDC 1I3QB 2N88A 3BG3A 2IPKD 3HP3A 1EY6A 3MHBA 5CV6A 2F0PA 5DEHA 4R9WA 2FFKB 3I73A 4XXEA 4NDXA 5EQ0A 3BYYB 1TR5A 2IX1A 2WV6D 1WTVA 2FJ2A 1IKMA 3HZXA 2VB2X 4V0BA 3JAML 1SYFA 1EEFD 1KDAA 3MTSA 5LL6X 2JA6B 5KNDA 2JXMB 5FO9B 1CT1D 1D6EC 3GTOB 1A3TA 4B08A 3HKZB 4CJ0B 3BS1A 3MXGA 2NBFA 1H9SB 4Q5VA 1BCPD 1O7YA 5IGFA 1PDQA 2JEBI 1QNUA 3J7AV 3QO2A 2PQEA 3LX0A 1SNDA 3QOJA 1WTQA 2B2TC 2Z4HA 4BBRB 3NSWA 3S1MB 2XVSA 3NHHA 2WAQB 2QF7A 1OXXK 1ENFA 4LMQD 3JAME 1Y1VB 1PRTF 1YNNC 2F0QA 1EY5A 1LACA 1SYDA 2E74C 4XIGS 4G4KA 5CBAE 4DXGA 1ONLA 3OW7A 1PTOB 5KIXA 1HHVA 2AQ3B 1SYCA 1FR3A 3DHQA 3Q24A 3BDLA 3NTKA 1EFID 4HEDA 1NR4A 2XRSD 5BN4A 5M3MB 3DXJC 1E2WA 2AUKA 2AQ1B 1LO5D 2IJ0A 2B63B 4K14A 1BDOA 4IFDH 1LT3D 4HCSA 1U4MA 4RAUC 5EGTA 4I65A 2EY6A 5JJZA 3E0JA 5M9OA 1TY2A 3NBIA 1KTKA 3SK4A 2E75C 1BUVT 2GA4B 4A3JB 1YNJD 3OOCA 5JVG3 3GD7A 2NN6G 5CORA 3OMGA 3J7AF 5AFWA 2X69A 2ZXRA 1LTBD 1C8CA 2HDMA 4A3IB 4C3JB 1JC7A 1JQYD 4NMZA 2FMCA 3GV3A 3H6MA 5IODA 1JB3A 1S5ED 1TWGB 2JSOA 4RA8A 2F0WA 3MFYA 1O78A 3BVMA 5BN5A 5J22A 1ML0D 3GTPB 1CI3M 1HUMA 2KEDA 1EL0A 3M85A 1EWCA 1EEID 1WD1A 3EA6A 1WTPA 1RF2D 5ELBA 1SE3A 1KLUD 5DM73 1SNOA 4MN3A 1MGSA 3SE0A 1PRTC 3CKIB 5C0XG 1UNSA 1TS4A 5CGKA 5C44B 4PNYA 4FF4A 1G91A 3G6JB 1SJED 3KLSX 1FD7D 1SYBA 2IWHA 2PMZB 5EPJA 3URYA 4F8MA 1CZGA 2FINB 2RDHA 2RQXA 5FLXL 4OIKA 2D9UA 1LTRD 4OHJA 2EDGA 3DUZA 4IUTA 5IOCA 2VXWA 1U4LA 1WD0A 3I8ZA 3A8IE 4K5VA 4C56C 1VDZA 2F0VA 2B2VA 4DK0A 5I6YA 1G2TA 1A6XA 1S4ZA 5CMDA 2PYKA 4XQQA 4P2CB 1SAPA 2NWGA 1U4RA 2DNEA 3DWQA 4CBVA 4BBSB 2R3ZA 3CRLC 4C3IG 5F2DA 1Z7TA 3TMEA 3I91A 2PZTA 1ET9A 2EYFA 1KLGD 5KGUA 1DD2A 4QB4A 1A3VA 2F0MA 1D2BA 3NUCA 3M7NA 2NN6H 4C3HB 3GTMB 1Z47A 4WORA 2E2IB 1PFBA 3K7AB 4G7OC 3HG9A 1Q1BA 4G57A 1K8MA 1LT6D 1EYDA 5FLXE 3T53B 1SNQA 2ZXPA 1XXGA 3NP8A 3E5SA 1I50B 2ZT9C 4KY6A 1E0BA 5KEEA 5JVH3 3KUPA 3KBGA 2JE6I 2NZ1D 1G6ZA 3P1HA 1C48A 3ND9A 1V1PA 5D3IB 4CHTB 4ZKBB 2X6LA 2BE5D 1GUOA 1NR2A 1UAPA 1I4XA 2F0OA 1IHZA 3U9SA 1VMPA 1Y8OB 4RKLA 2I07B 1HPCA 3ERQA 1R4PB 2Z4IA 1EQTA 1H9KA 2DY7A 1O7LA 2AWNA 3DWPA 3VYUA 2XIWA 4QUFA 2F0JA 4BA1I 4C1NI 1WTOA 5IGDA 2R6GA 4RGMA 1WTRA 1SSOA 2QEJC 4ILWA 5C0XH 2B2VC 2G9DA 5JEAG 3K57A 1NUCA 1S5FD 4Z9CB 2CW0C 4CKEA 4K6LA 2TMPA 4IFDJ 1H9JA 1SEBD 2IL8A 5I2YA 1BBXC 3FDTA 1RKNA 3S1NB 3QWNA 4FF2A 2E76C 5CV8A 3R8BA 1EWHA 3A54A 3IL8A 4BWGB 4IUNA 4XT1B 1PLFA 2QILA 4K8IA 2KCNA 4ZYSA 2F3VA 5E4XA 1A2TA 2OF1A 4EQNA 4DXFA 5JPMC 1ENAA 5C4XB 3FVQA 1ILPA 4KMUC 2RDGA 1CQFA 5C4JB 2O4XA 4CJ1B 4PMBA 5K5PA 2BA0A 1F9SA 2FHTA 4DNRB 1AP0A 1B9NA 4EQOA 4IUPA 3MXNA 1SMYC 3IFTA 2O5JC 4RHSA 3SDZA 2NN6I 4DAPA 1AN8A 4BY1B 1STYA 2AUJD 2N55A 2A6HD 4AYBB 1FGBD 1STEA 3SK8A 4OL7A 2F0EA 5CBEE 3SHLA 2WB1B 2DY8A 2A68C 1QWYA 4NW2A 3ITPA 2F0IA 2F1MA 1B44D 5ELDA 3SVMA 5D3DA 2K04A 1PTOD 1R4QB 1AZPA 2B2UA 3C2PA 1CZWA 3VA7A 1H9RA 2K6AA 4FVMA 4H13C 1R9TB 2WIIB 3L3OC 4XT3B 1IW7C 2WKDA 1MD2D 1NAPA 4YIJA 2PO4A 3GTQB 4DGZA 2EJMA 3MEHA 5FO8B 3BZDB 3VYTA 3CQZB 1X3PA 3HOXB 4ZLTF 5C0XI 4HCEA 4IALA 3BVZA 3BYTB 2D2CC 4KN7C 4XQJA 1D5MC 2L9HA 3RMHA 2Q8RE 1V43A 1SNCA 1C4QA 1FNWA 4IUVA 3H09A 2L4NA 5CR3A 1SXTA 3HOVB 3NPPA 2AQ2B 4XTCS 4FXDA 4HMJA 2F0GA 5JEAH 5K36G 1Q8IA 1DXMA 2PCFB 3I70A 3W2DA 4EGVA 4ZUJA 1ESFA 2J4XA 5A2QL 3QB3A 3J81L 5KNBA 1DOKA 3OWFA 5HGTA 3UI2A 1X3QA 2M00A 3DWAA 3TZDA 2CVRA 1JICA 2MHVA 2L55A 2B2UC 1BCPC 2EYHA 2BDNA 1GUTA 5ISRA 2A6EC 1DM0B 1G8ZD 1XX8A 3FMCA 1A3UA 1EIGA 1XTCD 1JOOA 2F0SA 2NTTA 4XQNA 4GZYC 1TVXA 5A35A 2R93B 1BQQT 1OXTA 3D31A 1EY8A 1ZYRD 4K5XA 1ICWA 2SDFA 1LTGD 1W6KA 2E2DC 4TQUS 4LAAA 1JWUD 3CRKC 1WTWA 3MAQA 1L0XB 2XN9C 1F2ZA 4TRDA 3VYRA 1MI2A 2NVQB 2I46A 2SNSA 1HQMC 2F0NA 5EKIA 1EU3A 1SE4A 4C3IB 2EJGC 2DN8A 5A2QE 1OXSC 1WTXA 1HUNA 3K5MA 1CTMA 4PQXA 5EJWA 5LL6S 1GJXA 2MGSA 4RGTA 1IL8A 4X3KA 1QB5D 3S9WA 2F4IA 2F0TA 1EYCA 3QJYA 2LKVA 4DAVA 1VF5C 4FYDA 5I9OA 3DM1A 5I9PA 5COYA 2HQEA 2K05A 2K33A 4J8QA 4R8NA 1YNJC 3FPUB 4KKSA 4S3SA 1FYCA 4IUQA 4KY5A 3AB9A 1CHPD 4XDXA 5E4WC 1II3A 3S17B 3X3MA 4RFBA 2K5DA 3EVQA 4B9XA 3PO2B 1DOLA 1TS3A 4ODGA 3T56B 2FMMA 1HTPA 1DCZA 4NKLA 2RSOA 3MVVA 5CC4A 5IIFA 2EXZA 5IGCA 3QIAA 5K36H 4C2MB 2NVYB 3R2TA 4RH6A 3GTLB 4DAYA 3K5OA 3D6CA 3V2TA 1LT4D 4E6IA 2NTSA 5EBCA 4FXKC 4EQPA 2KUMA 4RGOS 4KKUA 2PNRC 5EPLA 5G3LF 2VNUD 2NVXB 4C1NK 1HA5A 1QJOA 3MWYW 2C5CA 1GHKA 1PZID 5E1FA 4BY7B 3T4AC 2EY5A 2LY7A 4A3FB 3LNNA 5IGEA 1Q1EA 3MA2B 3WOEA 2RBMA 5J1ZA 1MSGA 2A74C 1IYUA 1B3AA 3VR4A 3HOYB 4A3DB 4J6HA 3R3OA 4G7ZC 3KF8A 4KN4C 1SBBB 3WOFA 2MP1A 1Y69U 1ZEQX 1GUGA 1EQVA 1HQRD 1JWSD 1JCKB 2ENBA 1G2SA 2HDLA 2K5QA 4FNFA 4FF3A 1I4RA 2J0TD 4UDUC 4WFN3 1WVLA 4ID6A 4LJZC 2KHSA 3R93A 4F87A 5M5WB 1XWEA 4PMWA 4DN4M 3OHXC 3CHBD 2B2WC 4QMGA 1A2UA 1KAAA 4F7XA 2L0CA 1SDFA 2Q8TA 2TSSA 1QCBD 1I4PA 2A73B 4DFAA 1XYIA 3QOLA 3EQLC 3FPPA 3NXWA 5M5YB 3C1FA 3I4LA 4HR7B 3RD4A 1IYVA 3VR2A 2RSNA 3GQBA 5J39A 1Q90A 3SR1A 2JA8B 3M7GA 1CA5A 1UEAB 4A3GB 4ME5A 2XWJB 3R2IA 4KHZA 4WJWA 2M2LA 5EPKA 5FKAC 1DJRD 1BOSA 4K6DA 3NTIA 2O2LD 1B9MA 3EJIA 4A93B 4L8JA 2RVLA 1F9RA 3PUWA 2WACA 1LTSD 2XNAC 1EU4A 1H9SA 1D1IA 2HCCA 3A56A 5EBDA 3K58A 1EYAA 2MPMA 1AZQA 1BXTA 1PRTB 1A15A 1TS2A 4C3JG 1LTAD 4TSSA 1SE2A 4MIUA 2WP8J 3PIP3 4XYOA 3OWEB 4FF1A 1OXUA 3NE5B 3J7YW 2VUMB 3T51B 4OO1G 1J9OA 3TP6A 1RTOA 1ESRA 1BNZA 1LTTD 2K32A 3M4YA 2CW0D 2CHBD 3OSOA 3G7LA 1BR9A 5CV4A 1U4PA 4KJNA 3TZUA 5I6WA 2OXPA 3MXPA 5HURA 2JEAI 1BF4A 5BN3A 4ULLA 4CKBA 1PZKD 1VF7A 5KRUA 2K1BA 5C5LA 3HRZC 2B8GA 3DEPA 4Q0FA 1STNA 3FEWX 1MSHA 1QE6A 4O1NA 3NK9A 4DNTB 4N9TA 5TSSA 3HOUB 4H0LC 2EYPA 1TQOA 1PFMA 4H7BA 1QILA 1EZ6A 4A3KB 3HEJA 4U673 3KLSA 3P7JA 2R92B 3A7LA 2QCPX 2F03A 1TIID 2IX0A 3SXHA 1CM9A 1AEXA 3PUYA 4HTHA 1J8IA 3GTJB 2BA1A 1FNVA 1STGA 1F2LA 4F88A 4JK1C 5CV5A 5FOBB 2EPBA 5M5XB 3IKJA 1MBYA 4ZAIA 3V96A 2YU9B 4IURA 1AW7A 1Q3LA 3RZDB 1QOHA 2R61A 5JPNC 1B2TA 3BDOA 2MUYA 5IGBA 2A69C 4BS9A 1STAA 1BCPF 4B9WA 4HSPA 3S2DB 2MJ8A 1STHA 1F9QA 1PYWD 3LWEA 3RUZA 3D4WA 3HGBA 2KCCA 1HA6A 4N9PA 1EIHA 1CHQD 4X3SA 3NQIA 5JOBA 1I6VC 3K0YA 2PZWA 2RDFA 1Q12A 3C46A 4IFDG 1Y1WB 2D5DA 3S14B 1PTOC 4ZRZA 2BCOA 3N6RA 4KY7A 4C3HG 1QG7A 1BO0A 3ZYYX 1HTLD 2B8FA 3VR3A 3N52A 1HFGA 2KJXA 3KK7A 1KNAA 3PUVA 1GUSA 1G291 1M4VA 3VR5A 5NUCA 4JBWA 2EE1A 2L5TA 4FP5D 3PIO3 4RWSC 2IW3A 4OO1H 4H44C 2F0UA 3D8GA 4KD4A 3T13A 1K8OA 5KNCA 1F9PA 1EZ8A 3SK6A 4KJOA 3TBIB 1LABA 2K01A 3K5NA 4X3TA 2O5IC 4M8AA 2QKIC 4NP5A 1H9MA 2VB3X 3TN2A 1TWAB 1VMCA 3D3RA 4K2LA 1TWHB 3O13A 3P75A 2NVTB 3MC0B 5JAVA 1SFOB 4HN7A 1TY0A 2F0LA 3FKIB 3Q22A 2WINB 4KV6A 3S1RB 3EFXD 5C6AA 1PZJD 1CA6A 5DAUA 1S5DD 2B39A 2XRQD 3K6OA 2OT2A 3F2UA 2A6ED 1V1PB 1ZXTA 4L63B 2F0DA 1CQVA 4RGNA 4EVOA 2X6GA 5IGGA 2L1BA 2JA5B 4DA2A 4OIJA 2H4OA 3GV6A 4DU9A 1I6HB 2NUCA 4RCOA 1TWCB 4ABNA 3A8KE 1EOTA 1PMRA 4WRDA 1W6JA 1YNND 5KYIA 5I2XA 2QDBA 3V05A 2D62A 1T5XD 2F0KA 2E2HB 1NSNS 3T16A 1SNPA 4CJ2C 4QUCA 1F2YA 5T1GA 4QF4A 3SK5A 1ZYRC 3M3YB 1F77A 1HRJA 2L12A 3A7AB 1AFPA 1IKLA 2SNMA 4R8IA 1LTID 5C0XJ 4KTAA 3PMFA 3J81E 1JOKA 4K2KA 4HAEA 1EY0A 2NB0A 5CYUA 1SYGA 3D4RA 3W3AA 3GTKB 1E2VA 1PXUA 3I90A 3HS0C 4IZ8A 5C3XA 5C5MA 3S16B 4L6TB 2K5WA 3VR6A 1B50A 1UUPA 2ID0A 2EVBA 3QG1A 1VCIA 3E6ZX 3ONAB 4OO1I 1SYEA 1KDCA 2Z1CA 2KECA 3HOWB 3Q0AA 3PO3B 1K83B 4KK7A 3A8JE 1RTNA 1JE4A 3TP5A 1EY4A 1LV9A 4CGYB 1LT5D 1KNEA 1Y8PB 3MXUA 5CV9A 1RDPD 3FRPB 4DK1A 4V190 2B2WA 1S5BD 1HCZA 4TKOB 3KLRA 4FXGC 3M4OB 5I4DA 1DONA 4CKCA 4RCNA 2V4DA 2ICIA 3J80L 1V1OA 1O7ZA 2IT1A 1ILQA 1JR0D 4FO2A 1S5CD 1BCPB 5D65A 3PV0A 2DNCA 1SJHD 1PRTD 3K59A 2F0HA 5ELEA 4XYQA 1TKWB 1HFNA 2CQAA 4U68A 4QIWB 3I3CA 1EY9A 1TS5A 3U9OA 1F2MA 2LFNA 2C9OA 5ELFA 3OPOA 1KABA 1CFMA 1JOQA 3X3NA 2ICEC 4LK1C 5ELCA 4KHVA 4RHRA 5EKKA 3RLFA 3P20A 1KDBA 2H1EA 2Z8LA 1TU2B 2EYJA 1D5ZC 1HXYD 3DMUA 3H0GB 5DM63 1ENCA 3PUZA 4UAIA 2BDOA 3AMUA 4KI0A 4G7HC 4DF7A 1B1ZA 4M1UB 1I4GA 3D4DA 1OXVA 1DYQA 5E3FA 4IFDI 3J80E 2A5HA 2XWBB 2Y0SB 1D1KA 1V8QA 2J7ZA 3K5LA 2F0FA 5JEAJ 2JP1A 4A3BB 2LS01 3Q23A 1DZ1A 2L11A 2F3WA 2RA4A 4Y7NB 2PW7A 4KKTA 2EY2A 1Z6HA 1RODA 5C4HA 2K03A 3I72A 4ZK9B 2K7VA 4ZKCB 5FO7B 1E2ZA 2LMCB 2EY1A 3GTGB 3S2HB 4IUUA 3AU7A 1Y8NB 1TWFB 2EYMA 3OMCA 4PMCA 2PPBC 1OO9B 3RZOB 3MZ5A 3I4MB 3I4NB 1LLRD 3WDNA 3GP7A 1L0YB 3NWSA 1GUNA 2E2JB 5G3LD 2EYLA 2R7ZB 3L7ZC 3SEBA 1NCVA 3H91A 3D6WA 1I4QA 2B2YA 2HUGA 4ZQ3A 4HSVA 4KD3A 2JYOA 4HMIA 4RKBA 2KQ3A 3H3VC 3C1EA 3TSSA 2AWOA 1X32A 4QCLA 5C4ZA 2G9HD 2KA7A 2SEBD 3NQTA 3PUXA 1TT2A 2BE5C 1FNUA 5EKLA 5M3FB 1PTOF 4O42A 1SNMA 1B53A 5FK9C 1PFNA 3VA5A 4J1MA 3NWTA 1GOZA 1EY7A 3S15B 3TP7A 4MHEA 1ZKOA 2EJFC 1QNKA 1RD9D 4ZUIA 5IT9L 5D14A 2EYOA 2KEEA 5CV7A 3EROA 3ND8A 4I7ZC 3HOZB 1GUWA 3VYSA 1DOMA 1U9RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BG3 A;  1K8O A;  1Y8N B;  1OXX K;  5KNC A;  5C0X H;  4DK0 A;  1CI3 M;  5JEA G;  4G7Z C;  2K33 A;  2PPB C;  3M85 A;  1LAB A;  3D4R A;  3I73 A;  1A6X A;  2CW0 C;  3W3A A;  3OPO A;  1E2V A;  1YNJ C;  2O5I C;  3H94 A;  3BDO A;  4KN4 C;  1CFM A;  3VA7 A;  1H9R A;  4KKS A;  2Q8I B;  1YNN C;  1H9M A;  3WDN A;  1GUT A;  1LAC A;  1FYC A;  2A69 C;  1H9J A;  4IQZ A;  1Y69 U;  2DNE A;  2E74 C;  2A6E C;  1GUN A;  1GUG A;  3AB9 A;  4H13 C;  4LK1 C;  1OXU A;  2E76 C;  4XIG S;  3NE5 B;  3VR6 A;  3L7Z C;  3CRL C;  3FMC A;  3T51 B;  1ONL A;  3OW7 A;  1IW7 C;  1Z7T A;  4OO1 G;  3RLF A;  3P20 A;  3HGB A;  2EVB A;  3QG1 A;  1FR3 A;  2KCC A;  1EWH A;  1VCI A;  1TU2 B;  1GHJ A;  3T56 B;  1HTP A;  3SE0 A;  4GZY C;  1DCZ A;  1DD2 A;  2EJM A;  2K32 A;  5A35 A;  5C0X G;  3M4Y A;  4LJZ C;  5BN4 A;  3M7N A;  3DXJ C;  3PUZ A;  1E2W A;  1OXT A;  2AUK A;  2AWO A;  2NN6 H;  3D31 A;  2BDO A;  5KND A;  4KI0 A;  3TZU A;  1I6V C;  2A69 D;  2JXM B;  2KA7 A;  3QIA A;  4G7H C;  2A6E D;  4TQU S;  2JEA I;  1Q12 A;  5K36 H;  3PUX A;  1BDO A;  2D2C C;  4KN7 C;  4IFD H;  2A68 D;  1Q1B A;  5BN3 A;  4G7O C;  1K8M A;  2BE5 C;  1OXV A;  1VF7 A;  3A8J E;  3CRK C;  3T53 B;  4IFD G;  4KMU C;  2D5D A;  1T5E A;  2ZT9 C;  2A6H C;  2B8G A;  1Y8P B;  3MXU A;  4BA2 I;  2BA0 A;  1V43 A;  2YYZ A;  3EQL C;  4DNR B;  3FPP A;  1B9N A;  3N6R A;  2E75 C;  3I4L A;  4HR7 B;  3OOC A;  1V8Q A;  2JE6 I;  3A8K E;  4DK1 A;  1H9S B;  1IYV A;  1PMR A;  3VR2 A;  4PV1 C;  3GQB A;  1HCZ A;  1HQM C;  3GD7 A;  4TKO B;  3KLR A;  1Q90 A;  2NN6 G;  1SMY C;  3ND9 A;  4DNT B;  4H0L C;  4KKU A;  2B8F A;  2D62 A;  2EJG C;  2PNR C;  2DN8 A;  2JEB I;  3IFT A;  4XTC S;  2O5J C;  3VR3 A;  4RCN A;  1OXS C;  1ZKO A;  2V4D A;  2NN6 I;  3SDZ A;  2EJF C;  2BE5 D;  5JEA H;  5K36 G;  1GUO A;  3LWU A;  1IW7 D;  4KHZ A;  2IT1 A;  1CTM A;  4KKT A;  1GJX A;  3U9S A;  1Z6H A;  1DXM A;  3A7L A;  2EDG A;  2PCF B;  3PUV A;  1GUS A;  2AUJ D;  1G29 1;  1Y8O B;  2A6H D;  1QJO A;  3PV0 A;  2DNC A;  3VR5 A;  1GHK A;  1B9M A;  1HPC A;  4OGQ C;  4L8J A;  1ZYR C;  3I72 A;  4JBW A;  3PUW A;  3QJY A;  3A8I E;  2K7V A;  1H9K A;  3LNN A;  1H9S A;  3PUY A;  1O7L A;  1VDZ A;  3ND8 A;  2L5T A;  3MFY A;  3A7A B;  1Q1E A;  1E2Z A;  1TKW B;  2A68 C;  2BA1 A;  2LMC B;  1VF5 C;  4I7Z C;  4OO1 H;  1O78 A;  5KNB A;  4H44 C;  5BN5 A;  4JK1 C;  4BA1 I;  2QF7 A;  1IYU A;  3IKJ A;  2R6G A;  2F1M A;  3VR4 A; 
#chains in the Genus database with same CATH topology
 1RHP A;  3Q8D A;  1HR0 Q;  2KOL A;  2EOT A;  2WKC A;  1Y14 B;  4LF5 Q;  1D5X C;  2PMZ E;  4IPH A;  4ZCK A;  2F52 A;  2KHJ A;  4QL5 A;  2OTL A;  3H94 A;  2K14 A;  4BBR H;  2Q8I B;  2PZU A;  5DNF A;  2IX3 A;  4BY7 G;  4IQZ A;  1X54 A;  4A3F G;  3IAY A;  3KDF A;  3CU7 A;  3L9A X;  1SMY D;  1HJP A;  2KHI A;  4K5W A;  2M9V A;  4A3E B;  4K8J A;  4MTN A;  3OIP A;  4DAY B;  5C3E B;  2B2Y C;  3KOJ A;  3HOY G;  4A3D G;  1GHJ A;  2R93 H;  1D7Q A;  2NYZ D;  2XSC A;  1ET6 A;  2HCI A;  1YZ6 A;  1VQ4 A;  3GDE A;  3AEV A;  5KYL A;  1KL9 A;  4UPA A;  3KBX A;  2SOB A;  2A69 D;  2KBN A;  3IFD A;  3AYH B;  1X55 A;  2RKS A;  2ZXO A;  1K0R A;  4IN3 A;  3C3L A;  2A68 D;  1PTO H;  4POF A;  3MFG A;  4X62 L;  2KVM A;  5C3W A;  2BOS A;  1T5E A;  2K5H A;  3MEF A;  4X3U A;  1JWM D;  2A6H C;  1YHA A;  1EIF A;  3BDC A;  4BA2 I;  2NVQ H;  2YYZ A;  3RLN A;  1XNR Q;  5M3M H;  3TDQ A;  2EZV A;  5IT9 E;  3A74 A;  3NBH A;  1MKH A;  2NZO A;  1EWI A;  1M8A A;  3BVG A;  4PV1 C;  2B63 H;  3PF4 A;  3NTH A;  4IPC A;  1A62 A;  1IBL L;  2A8V A;  3A55 A;  3STB D;  4BBS G;  1JOR A;  2OEO A;  3LWU A;  1IW7 D;  1JJG A;  1CK1 A;  1O80 A;  1I4H A;  2PW5 A;  3KF8 B;  2B2T A;  1HR0 L;  3OIQ A;  4LF5 L;  3Q6S A;  3DEO A;  4OGQ C;  1STB A;  1RCV D;  5LHY 1;  5T1I A;  1B4O A;  2K28 A;  2JA7 B;  2Q2I A;  1WCM B;  2ATW A;  3TP8 A;  2JA8 G;  1QVC A;  1GD7 A;  3S1Q B;  3GO5 A;  1RJT A;  3PIO A;  4A3M B;  4A3G G;  4C3J H;  1HZC A;  1GXD C;  1I3Q B;  2N88 A;  3BG3 A;  2IPK D;  4GLV B;  3HP3 A;  1EY6 A;  3MHB A;  5CV6 A;  2F0P A;  5DEH A;  2ZJR A;  4O2D A;  2R7D A;  1YVC A;  4R9W A;  2FFK B;  2CWA A;  1N8R C;  3I73 A;  2Z0S A;  4XXE A;  2R7F A;  4A93 G;  4NDX A;  5EQ0 A;  3BYY B;  1TR5 A;  2IX1 A;  2WV6 D;  1WTV A;  2FJ2 A;  3M4Q A;  1W2B A;  3PO2 H;  1IKM A;  3M9B A;  3HZX A;  2CWP A;  2VB2 X;  4V0B A;  4GNX B;  3JAM L;  1SYF A;  2EXD A;  1EEF D;  1KDA A;  2KEN A;  3MTS A;  5LL6 X;  1XNR L;  2JA6 B;  5KND A;  4HJ9 A;  3NEM A;  3CF5 A;  3W1G A;  3CP0 A;  2JXM B;  5JJL A;  1NY4 A;  4C2M H;  5FO9 B;  2NVY H;  2ALY B;  3FP9 A;  3I56 A;  5JJI A;  1CT1 D;  3PQI A;  1HZB A;  2VUM G;  4P75 A;  3GTL H;  1YJN A;  4P71 A;  3CCM A;  1D6E C;  3GTO B;  1A3T A;  4B08 A;  3HKZ B;  1B7Y B;  4CJ0 B;  3BS1 A;  2E5L Q;  3CD6 A;  3MXG A;  1D8L A;  2NBF A;  1H9S B;  4Q5V A;  1BCP D;  1O7Y A;  5IGF A;  1PDQ A;  2JEB I;  1QNU A;  4JI0 Q;  3J7A V;  3QO2 A;  3UE0 A;  2PQE A;  3LX0 A;  1SND A;  4A75 A;  1I94 Q;  1LM0 A;  4B3R Q;  1E3P A;  3QOJ A;  1WTQ A;  1JJ2 A;  4JCV E;  1HH2 P;  4BY7 H;  2B2T C;  2Z4H A;  4A3F H;  5IY0 A;  4BBR B;  5LMU Q;  3NSW A;  3CCS A;  3S1M B;  3HOU G;  2XVS A;  3NHH A;  2WAQ B;  2QF7 A;  4A3D H;  3U58 A;  1OXX K;  4A3K G;  1ENF A;  3NEL A;  4LMQ D;  2K5V A;  3JAM E;  3KFU A;  1Y1V B;  1PRT F;  1YNN C;  2F0Q A;  1EY5 A;  1LAC A;  1SYD A;  2E74 C;  4XIG S;  4OXP A;  4G4K A;  5CBA E;  4DXG A;  1ONL A;  3OW7 A;  4GN3 B;  1PTO B;  5KIX A;  1HHV A;  1KXL A;  2AQ3 B;  1SYC A;  1FR3 A;  4JI8 L;  3DHQ A;  1JE5 A;  3Q24 A;  3CPF A;  3BDL A;  1QZH A;  3NTK A;  1EFI D;  4GN5 A;  4HED A;  4BXX G;  1NR4 A;  2XRS D;  5BN4 A;  5M3M B;  3DXJ C;  1E2W A;  2AUK A;  2AQ1 B;  1LO5 D;  1PYB A;  2E5L L;  2IJ0 A;  4BBS H;  4P72 A;  4DR7 Q;  2B63 B;  1E1T A;  4K14 A;  4AYB E;  1BDO A;  4IFD H;  1LUZ A;  1LT3 D;  4YCV A;  4HCS A;  2WB1 E;  1U4M A;  4RAU C;  5EGT A;  4JI0 L;  4I65 A;  3E0E A;  2EY6 A;  5JJZ A;  4LF7 Q;  1KRS A;  3E0J A;  4WJ4 A;  1I94 L;  4LF4 Q;  4B3R L;  5M9O A;  1TY2 A;  3NBI A;  5IYC G;  1KTK A;  3SK4 A;  2E75 C;  3CCU A;  1BUV T;  2GA4 B;  4A3J B;  1YNJ D;  3OOC A;  2JA8 H;  5JVG 3;  3GD7 A;  5LMU L;  4A3G H;  2NN6 G;  3K7A H;  5COR A;  3OMG A;  3J7A F;  5AFW A;  2X69 A;  2ZXR A;  1LTB D;  1VQM A;  1C8C A;  2HDM A;  4A3I B;  4C3J B;  1JC7 A;  1JQY D;  4NMZ A;  1XJV A;  4X66 Q;  2FMC A;  4A93 H;  3GV3 A;  3H6M A;  5IOD A;  1IXR A;  1JB3 A;  1VQ7 A;  1S5E D;  1TWG B;  2JSO A;  4RA8 A;  2F0W A;  3MFY A;  1O78 A;  3BVM A;  2VS1 A;  5BN5 A;  1KD1 C;  2UXC Q;  1NTG A;  1YI2 A;  5J22 A;  5JJK A;  1SRU A;  4JI6 Q;  3TEH B;  1ML0 D;  4B3T Q;  3GTP B;  1CI3 M;  1HUM A;  2KED A;  1EL0 A;  3M85 A;  1EWC A;  1EEI D;  4PZ8 A;  1WD1 A;  2GVB A;  3EA6 A;  2VUM H;  3E9H A;  1WTP A;  2Z6K A;  1M1K C;  1RF2 D;  4DR7 L;  5ELB A;  3HOV G;  1SE3 A;  1KLU D;  5DM7 3;  4LUO A;  4GOP A;  2N49 A;  3K80 C;  1SNO A;  4OX9 Q;  2VQF Q;  4MN3 A;  1MGS A;  3SE0 A;  4LF7 L;  1PRT C;  3CKI B;  5C0X G;  4LF4 L;  4UY8 C;  1UNS A;  1TS4 A;  5CGK A;  4HJA A;  5C44 B;  4PNY A;  4FF4 A;  4YY3 Q;  1G91 A;  4RG1 A;  3G6J B;  1SJE D;  3KLS X;  3CC2 A;  2DJG C;  3W1B A;  1FD7 D;  1SYB A;  2UXB Q;  2IWH A;  1PH2 A;  2PMZ B;  2A1A A;  1WFQ A;  4WJ3 M;  5EPJ A;  3URY A;  3FKI G;  4DR1 Q;  1X65 A;  1L2F A;  1K9M C;  1HR0 W;  4X66 L;  4F8M A;  1CZG A;  3F2B A;  3J81 j;  4DV3 Q;  2FIN B;  3OW2 A;  3HOU H;  3J81 i;  2RDH A;  2RQX A;  5FLX L;  3CCJ A;  2DUD A;  4OIK A;  2D9U A;  2D0P A;  1LTR D;  1XPO A;  2UXC L;  4OHJ A;  1RIP A;  1T9H A;  4JI6 L;  2EDG A;  1PH5 A;  3DUZ A;  2JA5 G;  4IUT A;  4B3T L;  5IOC A;  4LFA L;  2VXW A;  1U4L A;  1WD0 A;  2UXD Q;  3I8Z A;  3A8I E;  4K5V A;  4C56 C;  3GTJ H;  3CCQ A;  3A5U A;  1VDZ A;  2F0V A;  1HNX L;  3TRE A;  2YU9 H;  3CXC A;  3RZD H;  4BXX H;  2B2V A;  4LF9 Q;  4DK0 A;  5I6Y A;  1BKB A;  4OX9 L;  1YJW A;  1G2T A;  2VQF L;  1A6X A;  4JI3 Q;  1S4Z A;  4DUZ Q;  1SRO A;  2PYK A;  4XQQ A;  5CMD A;  1VQK A;  4P2C B;  1SAP A;  2NWG A;  4CDD C;  2YTV A;  1CUK A;  1U4R A;  2DNE A;  3S2D H;  2ASB A;  4YY3 L;  3DWQ A;  4CBV A;  4BBS B;  2R3Z A;  3CRL C;  1LYL A;  4C3I G;  1GKH A;  2Z6K C;  5F2D A;  2UXB L;  1Z7T A;  3TME A;  2UUB Q;  1O7I A;  2AKW B;  4GOP C;  3H3V H;  4IJL A;  3I91 A;  5IYC H;  2PZT A;  1ET9 A;  2EYF A;  1KLG D;  5KGU A;  1DD2 A;  4QB4 A;  1BVS A;  1A3V A;  2F0M A;  4UP9 A;  1AH9 A;  1D2B A;  3NUC A;  1G51 A;  4DR1 L;  3M7N A;  2NN6 H;  4C3H B;  3GTM B;  1Z47 A;  1R9T H;  4WOR A;  2E2I B;  1PFB A;  4DV3 L;  3K7A B;  1YBY A;  4G7O C;  3HG9 A;  1Q1B A;  4G57 A;  1K8M A;  1LT6 D;  1EYD A;  3W5O A;  3T53 B;  4CDF C;  5FLX E;  1SNQ A;  2ZXP A;  1XXG A;  3NP8 A;  3E5S A;  1I50 B;  2EIF A;  2ZT9 C;  4KY6 A;  1E0B A;  5KEE A;  1JB7 A;  5JVH 3;  2K52 A;  3KUP A;  3UDF A;  3HOX H;  3KBG A;  2I5L X;  2JE6 I;  2NZ1 D;  1G6Z A;  1HNZ L;  2UXD L;  1AE2 A;  4GKJ Q;  3P1H A;  1C48 A;  3ND9 A;  3PO3 G;  3TQY A;  1V1P A;  4CDE C;  5D3I B;  4CHT B;  2A19 A;  4ZKB B;  2X6L A;  2BE5 D;  1GUO A;  1NR2 A;  1UAP A;  1I4X A;  2F0O A;  3F1Z A;  1IHZ A;  3KF6 A;  3U9S A;  1VMP A;  4LF9 L;  1Y8O B;  4RKL A;  2I07 B;  4POG A;  2ZM6 Q;  1HPC A;  1PHJ A;  3ERQ A;  1R4P B;  2Z4I A;  4JI3 L;  1NJI C;  1EQT A;  1HZ9 A;  4A4I A;  4DUZ L;  4A3L H;  1H9K A;  2DY7 A;  1O7L A;  2AWN A;  3DWP A;  3HOV H;  3AFQ A;  3VYU A;  2XIW A;  4QUF A;  2F0J A;  4BA1 I;  4C1N I;  1WTO A;  5IGD A;  3S24 A;  2R6G A;  1L1O B;  2ZJP A;  4RGM A;  1WTR A;  1MJE A;  3I7F A;  1SSO A;  2UUB L;  2QEJ C;  4ILW A;  5C0X H;  2B2V C;  2G9D A;  5ELN A;  5JEA G;  3K57 A;  3UE1 A;  1NUC A;  1S5F D;  4Z9C B;  2CW0 C;  4CKE A;  4K6L A;  2TMP A;  1TWA H;  4IFD J;  3DM3 A;  1H9J A;  1SEB D;  2IL8 A;  4YCU A;  5I2Y A;  3CME A;  1PV4 A;  3FDT A;  1RKN A;  1BBX C;  2NVT H;  1TWH H;  3QWN A;  4FF2 A;  3S1N B;  2E76 C;  5CV8 A;  2IHF A;  3J80 i;  3R8B A;  3FKI H;  1EWH A;  2ZJQ A;  3A54 A;  1VQC A;  3IL8 A;  3K7U C;  4BWG B;  4IUN A;  3S1R H;  4LFC Q;  4XT1 B;  5H1S E;  1PLF A;  2QIL A;  4K8I A;  2MQH A;  2KCN A;  4TVA B;  4ZYS A;  4OWX B;  2F3V A;  3HFZ B;  4OEL B;  5E4X A;  1A2T A;  2OF1 A;  2K75 A;  4EQN A;  4DXF A;  5JPM C;  4GKJ L;  1ENA A;  1PH4 A;  5C4X B;  3FVQ A;  1ILP A;  4KMU C;  2JA5 H;  2CQO A;  2RDG A;  3IRB A;  1CQF A;  5C4J B;  2O4X A;  4PMB A;  4CJ1 B;  4APV A;  1AE3 A;  5K5P A;  3J81 c;  1I6H H;  2BA0 A;  1F9S A;  1TWC H;  2FHT A;  4DNR B;  1AP0 A;  1B9N A;  4EQO A;  1PFS A;  4DV4 Q;  4IUP A;  4UP7 A;  3H0G G;  3MXN A;  2ZM6 L;  2OCE A;  3H3V I;  4JYA Q;  1K3B C;  1SMY C;  3BJU A;  3IFT A;  2O5J C;  4RHS A;  3SDZ A;  2NN6 I;  4DAP A;  1YIT A;  1AN8 A;  4BY1 B;  1STY A;  2AUJ D;  2N55 A;  2A6H D;  2JA9 A;  1EFW A;  3M3Y H;  4AYB B;  4NXM Q;  1FGB D;  1STE A;  3SK8 A;  4OL7 A;  4DR4 Q;  1N33 Q;  2Y0S G;  2F0E A;  4IOC A;  5CBE E;  3J7Z C;  3SHL A;  2WB1 B;  4C3I H;  3ER0 A;  2DY8 A;  2A68 C;  1QWY A;  4NW2 A;  1UE7 A;  3ITP A;  2F0I A;  4A3B G;  2F1M A;  3KYH C;  1B44 D;  5ELD A;  3SVM A;  5D3D A;  5IYB G;  2K04 A;  1PTO D;  1R4Q B;  3GTK H;  1AZP A;  2B2U A;  2IY5 B;  4LFC L;  3C2P A;  1CZW A;  1YIJ A;  3VA7 A;  1H9R A;  3S16 H;  1L0W A;  2K6A A;  3U4Z A;  4FVM A;  4JC0 A;  3L0O A;  4H13 C;  1R9T B;  2WII B;  3STB C;  3L3O C;  4XT3 B;  2I0Q A;  3T1H Q;  1IW7 C;  2WKD A;  1MD2 D;  1NAP A;  4YIJ A;  2PO4 A;  3GTQ B;  1YHQ A;  4DGZ A;  1K73 C;  2Q2U A;  2EJM A;  3MEH A;  5FO8 B;  3BZD B;  3VYT A;  3CQZ B;  1X3P A;  3PO3 H;  1V9P A;  3HOX B;  4ZLT F;  1EQR A;  4DV4 L;  5C0X I;  3I4M G;  4A76 A;  4HCE A;  4IAL A;  3BVZ A;  3HKS A;  3UDX A;  4JYA L;  1MIU A;  3S17 H;  3BYT B;  2D2C C;  4KN7 C;  4XQJ A;  2R7Z G;  1D5M C;  5DLQ E;  3OTO Q;  2L9H A;  4PZ7 A;  2G5D A;  1WI5 A;  4PZ6 A;  1V1Q A;  3F2D A;  4L5Q A;  3RMH A;  2Q8R E;  1V43 A;  1SNC A;  3T1Y Q;  2BH2 A;  1C4Q A;  1FNW A;  4IUV A;  3H09 A;  4NXM L;  2L4N A;  3M4O H;  4DV0 Q;  4DR4 L;  1N33 L;  4DV1 Q;  5CR3 A;  1SXT A;  3HOV B;  4GS3 A;  5IE8 A;  3NPP A;  5LMN W;  2AQ2 B;  4XTC S;  4FXD A;  4HMJ A;  1VS0 A;  4HIO A;  2F0G A;  1KC8 C;  4O0A A;  5JEA H;  1QUQ B;  5K36 G;  1E7Z A;  1Q8I A;  5IYD G;  1DXM A;  1SLJ A;  2PCF B;  3I70 A;  2MO0 A;  2OQK A;  3W2D A;  4EGV A;  1RL2 A;  2RHQ B;  1Q7Y C;  5M3F G;  4OON A;  2Q2T A;  4ZUJ A;  4CDC C;  1ESF A;  4NXN Q;  2J4X A;  5A2Q L;  1PH6 A;  3QB3 A;  3J81 L;  2GVA A;  5KNB A;  1VQ8 A;  2N78 A;  1VQA A;  1N34 Q;  1DOK A;  4DKA C;  3OWF A;  5HGT A;  3UI2 A;  1X3Q A;  3T1H L;  4MTK A;  2NVX H;  2M00 A;  3DWA A;  4OEM B;  3TZD A;  3J7A 5;  2Z9H A;  2CVR A;  1JIC A;  2MHV A;  2L55 A;  2B2U C;  1BCP C;  3TRZ A;  2CCZ A;  2EYH A;  2BDN A;  1GUT A;  3J80 c;  5ISR A;  5HGQ A;  1VQ9 A;  2A6E C;  1DM0 B;  1G8Z D;  1VQ6 A;  1XX8 A;  3HOZ G;  3FMC A;  1VQE A;  1A3U A;  1EIG A;  3HOY H;  3KF6 B;  1XTC D;  1K0S A;  1JOO A;  1BBU A;  2F0S A;  2NTT A;  4ALP A;  1Q81 C;  4LF8 Q;  3OTO L;  2HD3 A;  1S72 A;  4XQN A;  4GZY C;  3H0G H;  2Z6B A;  1TVX A;  2R92 G;  5FLM G;  5A35 A;  2R93 B;  3F8T A;  1BQQ T;  1OXT A;  1EYG A;  3D31 A;  1EY8 A;  2PNH A;  1ZYR D;  4K5X A;  3T1Y L;  1ICW A;  5IP7 G;  2SDF A;  2N3S A;  3E3X A;  1LTG D;  2B29 A;  1W6K A;  2PQA A;  2E2D C;  1JJC B;  4TQU S;  3PF5 A;  1Q46 A;  3K8A A;  4LAA A;  4DV0 L;  4DV1 L;  1JWU D;  3CRK C;  1WTW A;  4DK6 C;  4A3E G;  3MAQ A;  1L0X B;  1VQJ A;  2XN9 C;  1F2Z A;  4TRD A;  3VYR A;  2HT1 A;  1MI2 A;  2NVQ B;  2I46 A;  5M5W H;  3KJP A;  2SNS A;  4NXN L;  3L2P A;  1HQM C;  2F0N A;  5EKI A;  1EU3 A;  1SE4 A;  4C3I B;  2QGQ A;  2JJQ A;  2EJG C;  2DN8 A;  5A2Q E;  4R4Q A;  1OXS C;  5IYB H;  2QEX A;  1WTX A;  1N34 L;  1HUN A;  3K5M A;  1CTM A;  4PQX A;  5EJW A;  1HZA A;  5LL6 S;  1GJX A;  2MGS A;  4RGT A;  1IL8 A;  4X3K A;  5M5Y H;  1QB5 D;  4JBM A;  3S9W A;  2F4I A;  2F0T A;  1EYC A;  2ZTD A;  3QJY A;  4DV5 Q;  1MHW C;  1H95 A;  3KDF B;  3GTG H;  2LKV A;  3S2H H;  4DAV A;  1VF5 C;  4FYD A;  1SMX A;  4J15 A;  5I9O A;  1GM5 A;  1TWF H;  3DM1 A;  1EOV A;  5I9P A;  5COY A;  5GAD C;  2HQE A;  1Y1W G;  3RR5 A;  3CCR A;  4LF8 L;  2K05 A;  2K33 A;  3RZO H;  4J8Q A;  4R8N A;  3I4M H;  1YNJ C;  1KHI A;  3FPU B;  4KKS A;  1CKN A;  4S3S A;  1FYC A;  4IUQ A;  4AQY Q;  4KY5 A;  3AB9 A;  2R7Z H;  1CHP D;  3WWV A;  2JA7 G;  4XDX A;  5E4W C;  1II3 A;  3S17 B;  3X3M A;  3PGZ A;  2QDL A;  4RFB A;  1XPR A;  4EQ5 A;  2K5D A;  3EVQ A;  5BR8 Q;  4A3M G;  4B9X A;  3PO2 B;  1FVI A;  4R4C A;  1DOL A;  1TS3 A;  4ODG A;  3T56 B;  2FMM A;  1HTP A;  1DCZ A;  3KLW A;  3NBH B;  4NKL A;  4R4O A;  2RSO A;  3MVV A;  1Z9F A;  1DGS A;  5CC4 A;  5IIF A;  1IL2 A;  2EXZ A;  5IGC A;  3QIA A;  1KIX A;  5K36 H;  4C2M B;  2NVY B;  3R2T A;  4GLX A;  4RH6 A;  3GTL B;  4DAY A;  3K5O A;  5M3F H;  4JV5 Q;  2UUA Q;  3D6C A;  4DV7 Q;  3V2T A;  1GO3 E;  1LT4 D;  4E6I A;  2NTS A;  5EBC A;  4FXK C;  4EQP A;  1EQQ A;  2KUM A;  2JA6 G;  4RGO S;  3S15 H;  4KKU A;  2PNR C;  5EPL A;  5G3L F;  3VDY A;  3JAM i;  2VNU D;  2NVX B;  4C1N K;  4DNI A;  1UEB A;  4B3M Q;  1HA5 A;  1QJO A;  3MWY W;  3HKZ G;  2C5C A;  4AIM A;  1GHK A;  1PZI D;  5E1F A;  4BY7 B;  3T4A C;  2EY5 A;  2LY7 A;  3LGJ A;  4A3F B;  3LNN A;  3HOZ H;  5IGE A;  1Q1E A;  3MA2 B;  3FHW A;  4AQY L;  3WOE A;  2RBM A;  5J1Z A;  5GAE C;  1MSG A;  2A74 C;  1IYU A;  1B3A A;  2KCM A;  3VR4 A;  4A3K H;  2F3I A;  3HOY B;  4A3D B;  2R92 H;  5FLM H;  4J6H A;  2UU9 Q;  5BR8 L;  3R3O A;  3G4S A;  4G7Z C;  3KF8 A;  5IP7 H;  4KN4 C;  1SBB B;  3WOF A;  2VL6 A;  2MP1 A;  1Y69 U;  1ZEQ X;  1GUG A;  1EQV A;  5IT9 c;  2JK8 A;  1HQR D;  1JWS D;  4RMF A;  5M5X H;  1JCK B;  2F4V Q;  4FDB A;  2WAQ G;  2ENB A;  4N8F A;  1CKM A;  1G2S A;  1PYS B;  2HDL A;  2K5Q A;  4FNF A;  4DV2 Q;  4FF3 A;  1E1O A;  1PH9 A;  1I4R A;  2J0T D;  4UDU C;  5IP9 G;  4WFN 3;  4JV5 L;  1WVL A;  2UUA L;  4ID6 A;  2VQE Q;  4LJZ C;  4AH6 A;  2KHS A;  3R93 A;  4LUV A;  4DV7 L;  4JI1 Q;  1Y1V G;  4F87 A;  5M5W B;  1XWE A;  4PMW A;  4DN4 M;  3OHX C;  4HJ7 A;  3CHB D;  1K8G A;  4DR2 Q;  2B2W C;  2HIV A;  4QMG A;  1A2U A;  4P74 A;  1KAA A;  4F7X A;  2N8N A;  1VQD A;  2L0C A;  1SDF A;  2Q8T A;  2TSS A;  1QCB D;  4GNX A;  2OWO A;  1IBK Q;  1I4P A;  2A73 B;  4DFA A;  1XYI A;  3QOL A;  3EQL C;  3FPP A;  3NXW A;  2CH4 A;  4B3M L;  5M5Y B;  3C1F A;  3I4L A;  4HR7 B;  3RD4 A;  1IYJ B;  4IO9 A;  1K28 A;  1IYV A;  3VR2 A;  2RSN A;  3GQB A;  5J39 A;  1Q90 A;  3SR1 A;  2JA8 B;  3M7G A;  1CA5 A;  1UEA B;  4A3G B;  2UUC Q;  1VQG A;  4ME5 A;  1Y1W H;  3S14 H;  2QW7 A;  4GN4 B;  2XWJ B;  3R2I A;  4KHZ A;  4WJW A;  2M2L A;  5EPK A;  5FKA C;  1DJR D;  1BOS A;  4K6D A;  4I7A A;  2FXQ A;  2UU9 L;  3NTI A;  1KAW A;  2O2L D;  1EIY B;  1B9M A;  3EJI A;  4X65 Q;  4A93 B;  4L8J A;  2RVL A;  1F9R A;  3PUW A;  2WAC A;  1LTS D;  1S3O A;  2JA7 H;  2XNA C;  4A3J G;  1EU4 A;  1H9S A;  3CC7 A;  3HOW G;  3S1Q H;  1D1I A;  4A3M H;  2HCC A;  3A56 A;  1G6P A;  1I3Q H;  5EBD A;  4PG3 A;  3EIV A;  3K58 A;  3B6Y A;  2EQS A;  1EYA A;  2F4V L;  2MPM A;  1S40 A;  1AZQ A;  3K81 C;  4A3I G;  1BXT A;  1PRT B;  1A15 A;  1TS2 A;  1QVF A;  4C3J G;  1LTA D;  3UDG A;  4TSS A;  3CMA A;  4DV2 L;  1SE2 A;  4MIU A;  2WP8 J;  1A63 A;  2IHE A;  2VQE L;  3PIP 3;  4XYO A;  3OWE B;  4FF1 A;  4JI1 L;  1OXU A;  3NE5 B;  4DR2 L;  3J7Y W;  2VUM B;  3T51 B;  2PI2 A;  4OO1 G;  1J9O A;  2RCF A;  3TP6 A;  4HID A;  1NNX A;  1RTO A;  1VQO A;  1ESR A;  3G6E A;  1NBW A;  3I2Z A;  2I5M X;  1LTT D;  2K32 A;  1BNZ A;  4LW1 A;  1X6O A;  4EX5 A;  3M4Y A;  1UWV A;  2CW0 D;  1IBK L;  2CHB D;  2JA6 H;  3OSO A;  3G7L A;  1BR9 A;  4R4I A;  5CV4 A;  1U4P A;  4KJN A;  1K3R A;  3TZU A;  5ELO A;  5I6W A;  4DV6 Q;  1NMG A;  2OXP A;  1EUJ A;  3MXP A;  5HUR A;  2JEA I;  1BBW A;  3DLL A;  1IZ6 A;  1BF4 A;  5BN3 A;  4ULL A;  1XMO Q;  4CKB A;  3EBE A;  1SFO H;  1PZK D;  1VF7 A;  1TXY A;  3GTO H;  2UUC L;  4DPG A;  5AJ3 Q;  1P16 A;  5KRU A;  1KRT A;  4LUZ A;  2K1B A;  5C5L A;  3HRZ C;  2B8G A;  3DEP A;  4Q0F A;  4GNX C;  1GVP A;  4QIW E;  1STN A;  3FEW X;  1MSH A;  1QE6 A;  5EAY A;  4O1N A;  4X65 L;  3CCV A;  5C44 G;  3NK9 A;  4DNT B;  3JAM c;  4N9T A;  5TSS A;  3HOU B;  4H0L C;  3U50 C;  2EYP A;  1TQO A;  1PFM A;  1W3S A;  4H7B A;  2H5X A;  2D0O A;  1MJC A;  1QIL A;  1EZ6 A;  4A3K B;  2HHH Q;  3HEJ A;  4U67 3;  3KLS A;  3P7J A;  2R92 B;  3A7L A;  4JG2 A;  2QCP X;  1CSQ A;  2F03 A;  1TII D;  3M4P A;  2IX0 A;  3SXH A;  1Q86 C;  1CM9 A;  1AEX A;  3PUY A;  4HTH A;  1J8I A;  5FJ8 G;  3S1M H;  1XTD A;  3GTJ B;  1LTL A;  2BA1 A;  2JN4 A;  1XMQ Q;  1FNV A;  1STG A;  1F2L A;  3UDI A;  4JK1 C;  5CV5 A;  4F88 A;  5FOB B;  2EPB A;  4GOP B;  5M5X B;  2E2H H;  3IKJ A;  1MBY A;  4ZAI A;  3V96 A;  2YU9 B;  2RF4 A;  5IP9 H;  4IUR A;  1AW7 A;  1Q3L A;  2ZTC A;  3RZD B;  1PVO A;  1QOH A;  1Y1V H;  2R61 A;  5JPN C;  1B2T A;  3BDO A;  1VQF A;  2MUY A;  5IGB A;  2A69 C;  4BS9 A;  1STA A;  1BCP F;  4B9W A;  4HSP A;  4DV6 L;  2Y0S E;  3S2D B;  1B8A A;  2MJ8 A;  1STH A;  1F9Q A;  1PYW D;  3LWE A;  3RUZ A;  3D4W A;  3HGB A;  1XMO L;  2KCC A;  1YNX A;  5AJ3 L;  1Q82 C;  1HA6 A;  4N9P A;  1UE5 A;  1EIH A;  1CHQ D;  4X3S A;  5GAH C;  3NQI A;  5JOB A;  1VQN A;  1I6V C;  3K0Y A;  3BU2 A;  2PZW A;  2RDF A;  1Q12 A;  1WTH A;  3C46 A;  5E7N A;  2DGY A;  4IFD G;  1Y1W B;  2D5D A;  3S14 B;  1PTO C;  3E9I A;  1KQS A;  4R4T A;  2HHH L;  2CKZ B;  4ZRZ A;  2AMC B;  2BCO A;  4A3J H;  3N6R A;  4MNO A;  3HOW H;  2YTX A;  4KY7 A;  5HY6 A;  3I55 A;  1PA6 A;  4C3H G;  1QG7 A;  3I4N G;  1BO0 A;  3ZYY X;  1K83 H;  1HTL D;  4X6A H;  2B8F A;  2Q2H A;  3VR3 A;  4K0K Q;  3CC4 A;  1A8V A;  1XMQ L;  4A3I H;  3N52 A;  4IPD A;  1HFG A;  2KJX A;  1OTC A;  4KHP Q;  3KK7 A;  4QGU A;  3H15 A;  1KNA A;  3PUV A;  1XPU A;  4DUY Q;  1GUS A;  1G29 1;  2XGT A;  2NZH A;  1M4V A;  3VR5 A;  5NUC A;  1PH3 A;  1TWG H;  4JBW A;  2EE1 A;  2L5T A;  3ICE A;  4FP5 D;  3PIO 3;  4RWS C;  2IW3 A;  4OO1 H;  1B70 B;  4H44 C;  3CPW A;  2F0U A;  3D8G A;  1ICF B;  3BZK A;  2K50 A;  3CAM A;  4KD4 A;  3GTP H;  4DR3 Q;  3T13 A;  1K8O A;  1NMF A;  5KNC A;  1F9P A;  1EZ8 A;  3SK6 A;  4KJO A;  3TBI B;  3TS0 A;  1SE8 A;  3KJO A;  2ZTE A;  1LAB A;  2K01 A;  3K5N A;  4X3T A;  2O5I C;  4M8A A;  2V1C C;  2QKI C;  2XTI A;  1X3F A;  4NP5 A;  1H9M A;  4YWL A;  2VB3 X;  3TN2 A;  1TWA B;  1VMC A;  4DK3 C;  5GAG C;  3D3R A;  4K2L A;  1TWH B;  3O13 A;  3P75 A;  2NVT B;  3MC0 B;  4JI8 Q;  5JAV A;  1SFO B;  4HN7 A;  1TY0 A;  2F0L A;  3FKI B;  4JVZ A;  4NPS A;  4QQB X;  3Q22 A;  4R1J A;  3EN2 A;  2RCN A;  2WIN B;  4KV6 A;  3S1R B;  3EFX D;  5C6A A;  5C44 H;  1PZJ D;  1CA6 A;  2K5N A;  5DAU A;  3CW2 C;  1S5D D;  1X56 A;  2B39 A;  2XRQ D;  3K6O A;  1K8A C;  2OT2 A;  3F2U A;  2A6E D;  1V1P B;  4ME3 A;  1ZXT A;  1M90 C;  4L63 B;  2F0D A;  1CQV A;  4QJF A;  4RGN A;  4EVO A;  4GLA C;  2X6G A;  4K0K L;  4KLK A;  2MO1 A;  5IGG A;  3RNU A;  2L1B A;  2JA5 B;  2DJF C;  4DA2 A;  4OIJ A;  4DR6 Q;  4KHP L;  2H4O A;  3GV6 A;  4DU9 A;  4DUY L;  4JI5 Q;  1I6H B;  5FJ8 H;  2NUC A;  4RCO A;  1TWC B;  1X3G A;  4ABN A;  3A8K E;  1IBM Q;  1EOT A;  1NE3 A;  1PMR A;  1W6J A;  4WRD A;  2LXJ A;  1J5E Q;  1VQI A;  1YNN D;  5KYI A;  5I2X A;  2QDB A;  3V05 A;  1HNW Q;  2D62 A;  3RN5 A;  4GKK Q;  1T5X D;  5C4X G;  2F0K A;  2E2H B;  1NSN S;  3T16 A;  1X3E A;  1VQ5 A;  1SNP A;  4CJ2 C;  4QUC A;  2RHS B;  1F2Y A;  5T1G A;  4DR3 L;  5C3E G;  4QF4 A;  3SK5 A;  1ZYR C;  2BH8 A;  3M3Y B;  1F77 A;  4OWT B;  4NB3 A;  1HRJ A;  2L12 A;  2YV5 A;  3A7A B;  1IKL A;  1PH7 A;  1AFP A;  4A3B H;  2SNM A;  4R8I A;  1LTI D;  1Q8K A;  5C0X J;  4KTA A;  1X9N A;  3AFP A;  1U0L A;  3PMF A;  1C0A A;  3J81 E;  4Y7N H;  1JOK A;  4K2K A;  1E22 A;  4BY1 G;  4HAE A;  1EY0 A;  4YHH Q;  2NB0 A;  5CYU A;  5FLX c;  1SYG A;  3D4R A;  3W3A A;  3GTK B;  1E2V A;  4YCW A;  1PXU A;  3I90 A;  4YWM A;  4AYB G;  3HS0 C;  2VY3 A;  3G48 A;  1YEZ A;  4IZ8 A;  5C3X A;  5C5M A;  1VQP A;  3S16 B;  4L6T B;  2K5W A;  1N9W A;  4DR5 Q;  2VW9 A;  2WB1 G;  3VR6 A;  1B50 A;  1UUP A;  2ID0 A;  2EVB A;  3QG1 A;  1L1O A;  1VCI A;  4X64 Q;  3E6Z X;  3ULP A;  2ES2 A;  3ONA B;  4OO1 I;  5IWA Q;  1SYE A;  1KDC A;  2P5Z X;  1SN8 A;  4C3H H;  3GTM H;  2Z1C A;  3MXN B;  4DR6 L;  3I4N H;  3QR8 A;  2KEC A;  3HOW B;  4JI5 L;  2E2I H;  2E2J H;  2MNA A;  3Q0A A;  3PO3 B;  1IBM L;  1WOC A;  3ULL A;  1J5E L;  1K83 B;  1WCM G;  4KK7 A;  3A8J E;  1RTN A;  1HNW L;  1I50 H;  4GKK L;  1JE4 A;  3TP5 A;  1EY4 A;  1LV9 A;  4CGY B;  1LT5 D;  1KNE A;  1Y8P B;  3MXU A;  5CV9 A;  1RDP D;  1FGU A;  1N32 Q;  3FRP B;  4DK1 A;  4JPB W;  1C9O A;  4V19 0;  3HOX G;  2B2W A;  1JMC A;  4IPG A;  1S5B D;  1HCZ A;  3G71 A;  4TKO B;  3KLR A;  4FXG C;  3M4O B;  5I4D A;  1DON A;  4CKC A;  4RCN A;  3U4V A;  2CFM A;  2ICI A;  2V4D A;  5IYD H;  3J80 L;  1V1O A;  1O7Z A;  2IT1 A;  4LFA Q;  1ILQ A;  3OYY A;  1QVG A;  1CKO A;  3I4O A;  1JR0 D;  4FO2 A;  1S5C D;  1BCP B;  5D65 A;  3PV0 A;  2DNC A;  1B3Q A;  4YHH L;  1SJH D;  1PRT D;  3K59 A;  2F0H A;  2VZA A;  5LMN Q;  1UE6 A;  5ELE A;  4L5R C;  4XYQ A;  1HNX Q;  1TKW B;  4DV5 L;  1HFN A;  2CQA A;  4A3L G;  4DR5 L;  4OWW B;  4U68 A;  3JC6 6;  4QIW B;  3I3C A;  1EY9 A;  2C35 B;  4A3C G;  2YTY A;  1TS5 A;  3U9O A;  4X64 L;  1F2M A;  2LFN A;  2C9O A;  5ELF A;  3OPO A;  1KAB A;  5IWA L;  1CFM A;  1JOQ A;  3S1N H;  3X3N A;  3HKZ E;  2ICE C;  4LK1 C;  5ELC A;  4JI7 Q;  3PSI A;  4LF6 Q;  2B3G A;  1FL0 A;  1ASY A;  4KHV A;  4RHR A;  3RN2 A;  3SGI A;  3PCO B;  5EKK A;  3RLF A;  3P20 A;  5GQO A;  1KDB A;  2H1E A;  2Z8L A;  1TU2 B;  1L1O C;  2EYJ A;  1FJG Q;  4B3S Q;  1D5Z C;  1HXY D;  1ASZ A;  4HIK A;  1VQH A;  3DMU A;  3H0G B;  5DM6 3;  1ENC A;  3PUZ A;  1SR3 A;  1N32 L;  2L15 A;  4UAI A;  2BDO A;  3AMU A;  4KI0 A;  4L5S A;  4G7H C;  4LFB Q;  4BBR G;  4DF7 A;  1B1Z A;  1E24 A;  4M1U B;  2K4K A;  5C4X H;  1I4G A;  4LWC A;  3D4D A;  4JW0 A;  1OXV A;  2QA4 A;  4A3E H;  4JOI A;  4JBK A;  4Y52 H;  5C3E H;  5C4J H;  1DYQ A;  5E3F A;  4HJ8 A;  2WAQ E;  2PI2 E;  4IFD I;  3J80 E;  2A5H A;  2XWB B;  3ZJY C;  1HNZ Q;  2Y0S B;  1D1K A;  2R93 G;  2HIX A;  1V8Q A;  2J7Z A;  3K5L A;  2F0F A;  5LMN L;  5JEA J;  2JP1 A;  4A3B B;  2LS0 1;  3Q23 A;  1DZ1 A;  2L11 A;  4BY1 H;  2F3W A;  2RA4 A;  4JI4 Q;  4Y7N B;  2PW7 A;  4KKT A;  2EY2 A;  1Z6H A;  1XNQ Q;  1ROD A;  4IJH A;  5C4H A;  3TS2 A;  2K03 A;  3I72 A;  1YJ9 A;  1N36 Q;  4ZK9 B;  1YHB A;  2K7V A;  5M3M G;  4ZKC B;  4N8X 1;  5FO7 B;  1E2Z A;  2LMC B;  2EY1 A;  4HIM A;  3GTG B;  4UHV A;  2B63 G;  3S2H B;  1J6Q A;  4JI7 L;  4LF6 L;  4IUU A;  3AU7 A;  4JI2 Q;  1VQL A;  1JT8 A;  5GRO A;  1QUQ A;  1Y8N B;  1TWF B;  2EYM A;  3OMC A;  4PMC A;  2PPB C;  1I5F A;  4MZ9 A;  4QY7 A;  1FJG L;  2WFW A;  3NEN A;  4B3S L;  1QZG A;  1OO9 B;  3RZO B;  1CSP A;  3D0F A;  4UP8 A;  3CCL A;  3MZ5 A;  3I4M B;  3I4N B;  1LLR D;  3WDN A;  3GP7 A;  1L0Y B;  3NWS A;  2PQA B;  4L5T A;  1GUN A;  2E2J B;  1WCM H;  3PIP A;  1P8L A;  5G3L D;  2EYL A;  2R7Z B;  3L7Z C;  4LFB L;  3SEB A;  1NCV A;  3H91 A;  3GTQ H;  3D6W A;  2HQL A;  1I4Q A;  2B2Y A;  2HUG A;  4H02 A;  4ZQ3 A;  4HSV A;  2GN5 A;  5J3B A;  4KD3 A;  2JYO A;  4HMI A;  4RKB A;  4IOA A;  4YWK A;  2KQ3 A;  3H3V C;  3CQZ H;  1A0I A;  3C1E A;  3TSS A;  2AWO A;  3A5Z B;  1U5K A;  1X32 A;  4QCL A;  1UE1 A;  5C4Z A;  2G9H D;  2KA7 A;  2SEB D;  3NQT A;  2OQ0 A;  2LSS A;  3PUX A;  1VQB A;  1TT2 A;  2BE5 C;  4HJ5 A;  4JOI C;  2I5H A;  3PO2 G;  4JI4 L;  1FNU A;  5EKL A;  5M3F B;  1PTO F;  4O42 A;  1XNQ L;  1SNM A;  1B53 A;  5FK9 C;  4DAM A;  1PFN A;  3ULJ A;  3AQQ A;  3CCE A;  3ERS X;  1N36 L;  2KCT A;  4J1M A;  3VA5 A;  3NWT A;  2MFI A;  1GOZ A;  1EY7 A;  4X62 Q;  3S15 B;  3TP7 A;  4MHE A;  1ZKO A;  3RLO A;  2EJF C;  1QNK A;  4A3C H;  1RD9 D;  2OTJ A;  4JI2 L;  4ZUI A;  1PH1 A;  5IT9 L;  4LNQ A;  5D14 A;  2EYO A;  1WYD A;  1WJJ A;  4JBJ A;  2AHO B;  1PH8 A;  2LXK A;  4P73 A;  1CKN B;  5L37 A;  2KEE A;  3K0X A;  5CV7 A;  2JQO A;  2CH4 W;  3BZC A;  3F2C A;  1IBL Q;  3ERO A;  3ND8 A;  2E8G A;  1C7Y A;  4I7Z C;  3HOZ B;  1GUW A;  3VYS A;  1DOM A;  1U9R A;  3A0J A; 
#chains in the Genus database with same CATH homology
 1RHP A;  2KOL A;  2EOT A;  2WKC A;  1D5X C;  3H94 A;  2Q8I B;  2PZU A;  5DNF A;  2IX3 A;  4IQZ A;  3IAY A;  3CU7 A;  3L9A X;  1SMY D;  4K5W A;  2M9V A;  4A3E B;  4K8J A;  3OIP A;  5C3E B;  2B2Y C;  1GHJ A;  2NYZ D;  2XSC A;  1ET6 A;  2HCI A;  5KYL A;  3KBX A;  2SOB A;  2A69 D;  3IFD A;  2RKS A;  2ZXO A;  4IN3 A;  3C3L A;  2A68 D;  1PTO H;  3MFG A;  2KVM A;  5C3W A;  2BOS A;  1T5E A;  4X3U A;  1JWM D;  2A6H C;  3BDC A;  4BA2 I;  2YYZ A;  3TDQ A;  2EZV A;  5IT9 E;  3NBH A;  1M8A A;  3BVG A;  4PV1 C;  3NTH A;  3A55 A;  1JOR A;  2OEO A;  3LWU A;  1IW7 D;  1CK1 A;  1O80 A;  1I4H A;  2PW5 A;  2B2T A;  3OIQ A;  3Q6S A;  3DEO A;  4OGQ C;  1STB A;  1RCV D;  5LHY 1;  5T1I A;  1B4O A;  2K28 A;  2JA7 B;  1WCM B;  3TP8 A;  3S1Q B;  3GO5 A;  1RJT A;  4A3M B;  1GXD C;  1I3Q B;  2N88 A;  3BG3 A;  2IPK D;  3HP3 A;  1EY6 A;  3MHB A;  5CV6 A;  2F0P A;  5DEH A;  4R9W A;  2FFK B;  3I73 A;  4XXE A;  4NDX A;  5EQ0 A;  3BYY B;  1TR5 A;  2IX1 A;  2WV6 D;  1WTV A;  2FJ2 A;  1IKM A;  3HZX A;  2VB2 X;  4V0B A;  3JAM L;  1SYF A;  1EEF D;  1KDA A;  3MTS A;  5LL6 X;  2JA6 B;  5KND A;  2JXM B;  5FO9 B;  1CT1 D;  1D6E C;  3GTO B;  1A3T A;  4B08 A;  3HKZ B;  4CJ0 B;  3BS1 A;  3MXG A;  2NBF A;  1H9S B;  4Q5V A;  1BCP D;  1O7Y A;  5IGF A;  1PDQ A;  2JEB I;  1QNU A;  3J7A V;  3QO2 A;  2PQE A;  3LX0 A;  1SND A;  3QOJ A;  1WTQ A;  2B2T C;  2Z4H A;  4BBR B;  3NSW A;  3S1M B;  2XVS A;  3NHH A;  2WAQ B;  2QF7 A;  1OXX K;  1ENF A;  4LMQ D;  3JAM E;  1Y1V B;  1PRT F;  1YNN C;  2F0Q A;  1EY5 A;  1LAC A;  1SYD A;  2E74 C;  4XIG S;  4G4K A;  5CBA E;  4DXG A;  1ONL A;  3OW7 A;  1PTO B;  5KIX A;  1HHV A;  2AQ3 B;  1SYC A;  1FR3 A;  3DHQ A;  3Q24 A;  3BDL A;  3NTK A;  1EFI D;  4HED A;  1NR4 A;  2XRS D;  5BN4 A;  5M3M B;  3DXJ C;  1E2W A;  2AUK A;  2AQ1 B;  1LO5 D;  2IJ0 A;  2B63 B;  4K14 A;  1BDO A;  4IFD H;  1LT3 D;  4HCS A;  1U4M A;  4RAU C;  5EGT A;  4I65 A;  2EY6 A;  5JJZ A;  3E0J A;  5M9O A;  1TY2 A;  3NBI A;  1KTK A;  3SK4 A;  2E75 C;  1BUV T;  2GA4 B;  4A3J B;  1YNJ D;  3OOC A;  5JVG 3;  3GD7 A;  2NN6 G;  5COR A;  3OMG A;  3J7A F;  5AFW A;  2X69 A;  2ZXR A;  1LTB D;  1C8C A;  2HDM A;  4A3I B;  4C3J B;  1JC7 A;  1JQY D;  4NMZ A;  2FMC A;  3GV3 A;  3H6M A;  5IOD A;  1JB3 A;  1S5E D;  1TWG B;  2JSO A;  4RA8 A;  2F0W A;  3MFY A;  1O78 A;  3BVM A;  5BN5 A;  5J22 A;  1ML0 D;  3GTP B;  1CI3 M;  1HUM A;  2KED A;  1EL0 A;  3M85 A;  1EWC A;  1EEI D;  1WD1 A;  3EA6 A;  1WTP A;  1RF2 D;  5ELB A;  1SE3 A;  1KLU D;  5DM7 3;  1SNO A;  4MN3 A;  1MGS A;  3SE0 A;  1PRT C;  3CKI B;  5C0X G;  1UNS A;  1TS4 A;  5CGK A;  5C44 B;  4PNY A;  4FF4 A;  1G91 A;  3G6J B;  1SJE D;  3KLS X;  1FD7 D;  1SYB A;  2IWH A;  2PMZ B;  5EPJ A;  3URY A;  4F8M A;  1CZG A;  2FIN B;  2RDH A;  2RQX A;  5FLX L;  4OIK A;  2D9U A;  1LTR D;  4OHJ A;  2EDG A;  3DUZ A;  4IUT A;  5IOC A;  2VXW A;  1U4L A;  1WD0 A;  3I8Z A;  3A8I E;  4K5V A;  4C56 C;  1VDZ A;  2F0V A;  2B2V A;  4DK0 A;  5I6Y A;  1G2T A;  1A6X A;  1S4Z A;  5CMD A;  2PYK A;  4XQQ A;  4P2C B;  1SAP A;  2NWG A;  1U4R A;  2DNE A;  3DWQ A;  4CBV A;  4BBS B;  2R3Z A;  3CRL C;  4C3I G;  5F2D A;  1Z7T A;  3TME A;  3I91 A;  2PZT A;  1ET9 A;  2EYF A;  1KLG D;  5KGU A;  1DD2 A;  4QB4 A;  1A3V A;  2F0M A;  1D2B A;  3NUC A;  3M7N A;  2NN6 H;  4C3H B;  3GTM B;  1Z47 A;  4WOR A;  2E2I B;  1PFB A;  3K7A B;  4G7O C;  3HG9 A;  1Q1B A;  4G57 A;  1K8M A;  1LT6 D;  1EYD A;  5FLX E;  3T53 B;  1SNQ A;  2ZXP A;  1XXG A;  3NP8 A;  3E5S A;  1I50 B;  2ZT9 C;  4KY6 A;  1E0B A;  5KEE A;  5JVH 3;  3KUP A;  3KBG A;  2JE6 I;  2NZ1 D;  1G6Z A;  3P1H A;  1C48 A;  3ND9 A;  1V1P A;  5D3I B;  4CHT B;  4ZKB B;  2X6L A;  2BE5 D;  1GUO A;  1NR2 A;  1UAP A;  1I4X A;  2F0O A;  1IHZ A;  3U9S A;  1VMP A;  1Y8O B;  4RKL A;  2I07 B;  1HPC A;  3ERQ A;  1R4P B;  2Z4I A;  1EQT A;  1H9K A;  2DY7 A;  1O7L A;  2AWN A;  3DWP A;  3VYU A;  2XIW A;  4QUF A;  2F0J A;  4BA1 I;  4C1N I;  1WTO A;  5IGD A;  2R6G A;  4RGM A;  1WTR A;  1SSO A;  2QEJ C;  4ILW A;  5C0X H;  2B2V C;  2G9D A;  5JEA G;  3K57 A;  1NUC A;  1S5F D;  4Z9C B;  2CW0 C;  4CKE A;  4K6L A;  2TMP A;  4IFD J;  1H9J A;  1SEB D;  2IL8 A;  5I2Y A;  1BBX C;  3FDT A;  1RKN A;  3S1N B;  3QWN A;  4FF2 A;  2E76 C;  5CV8 A;  3R8B A;  1EWH A;  3A54 A;  3IL8 A;  4BWG B;  4IUN A;  4XT1 B;  1PLF A;  2QIL A;  4K8I A;  2KCN A;  4ZYS A;  2F3V A;  5E4X A;  1A2T A;  2OF1 A;  4EQN A;  4DXF A;  5JPM C;  1ENA A;  5C4X B;  3FVQ A;  1ILP A;  4KMU C;  2RDG A;  1CQF A;  5C4J B;  2O4X A;  4CJ1 B;  4PMB A;  5K5P A;  2BA0 A;  1F9S A;  2FHT A;  4DNR B;  1AP0 A;  1B9N A;  4EQO A;  4IUP A;  3MXN A;  1SMY C;  3IFT A;  2O5J C;  4RHS A;  3SDZ A;  2NN6 I;  4DAP A;  1AN8 A;  4BY1 B;  1STY A;  2AUJ D;  2N55 A;  2A6H D;  4AYB B;  1FGB D;  1STE A;  3SK8 A;  4OL7 A;  2F0E A;  5CBE E;  3SHL A;  2WB1 B;  2DY8 A;  2A68 C;  1QWY A;  4NW2 A;  3ITP A;  2F0I A;  2F1M A;  1B44 D;  5ELD A;  3SVM A;  5D3D A;  2K04 A;  1PTO D;  1R4Q B;  1AZP A;  2B2U A;  3C2P A;  1CZW A;  3VA7 A;  1H9R A;  2K6A A;  4FVM A;  4H13 C;  1R9T B;  2WII B;  3L3O C;  4XT3 B;  1IW7 C;  2WKD A;  1MD2 D;  1NAP A;  4YIJ A;  2PO4 A;  3GTQ B;  4DGZ A;  2EJM A;  3MEH A;  5FO8 B;  3BZD B;  3VYT A;  3CQZ B;  1X3P A;  3HOX B;  4ZLT F;  5C0X I;  4HCE A;  4IAL A;  3BVZ A;  3BYT B;  2D2C C;  4KN7 C;  4XQJ A;  1D5M C;  2L9H A;  3RMH A;  2Q8R E;  1V43 A;  1SNC A;  1C4Q A;  1FNW A;  4IUV A;  3H09 A;  2L4N A;  5CR3 A;  1SXT A;  3HOV B;  3NPP A;  2AQ2 B;  4XTC S;  4FXD A;  4HMJ A;  2F0G A;  5JEA H;  5K36 G;  1Q8I A;  1DXM A;  2PCF B;  3I70 A;  3W2D A;  4EGV A;  4ZUJ A;  1ESF A;  2J4X A;  5A2Q L;  3QB3 A;  3J81 L;  5KNB A;  1DOK A;  3OWF A;  5HGT A;  3UI2 A;  1X3Q A;  2M00 A;  3DWA A;  3TZD A;  2CVR A;  1JIC A;  2MHV A;  2L55 A;  2B2U C;  1BCP C;  2EYH A;  2BDN A;  1GUT A;  5ISR A;  2A6E C;  1DM0 B;  1G8Z D;  1XX8 A;  3FMC A;  1A3U A;  1EIG A;  1XTC D;  1JOO A;  2F0S A;  2NTT A;  4XQN A;  4GZY C;  1TVX A;  5A35 A;  2R93 B;  1BQQ T;  1OXT A;  3D31 A;  1EY8 A;  1ZYR D;  4K5X A;  1ICW A;  2SDF A;  1LTG D;  1W6K A;  2E2D C;  4TQU S;  4LAA A;  1JWU D;  3CRK C;  1WTW A;  3MAQ A;  1L0X B;  2XN9 C;  1F2Z A;  4TRD A;  3VYR A;  1MI2 A;  2NVQ B;  2I46 A;  2SNS A;  1HQM C;  2F0N A;  5EKI A;  1EU3 A;  1SE4 A;  4C3I B;  2EJG C;  2DN8 A;  5A2Q E;  1OXS C;  1WTX A;  1HUN A;  3K5M A;  1CTM A;  4PQX A;  5EJW A;  5LL6 S;  1GJX A;  2MGS A;  4RGT A;  1IL8 A;  4X3K A;  1QB5 D;  3S9W A;  2F4I A;  2F0T A;  1EYC A;  3QJY A;  2LKV A;  4DAV A;  1VF5 C;  4FYD A;  5I9O A;  3DM1 A;  5I9P A;  5COY A;  2HQE A;  2K05 A;  2K33 A;  4J8Q A;  4R8N A;  1YNJ C;  3FPU B;  4KKS A;  4S3S A;  1FYC A;  4IUQ A;  4KY5 A;  3AB9 A;  1CHP D;  4XDX A;  5E4W C;  1II3 A;  3S17 B;  3X3M A;  4RFB A;  2K5D A;  3EVQ A;  4B9X A;  3PO2 B;  1DOL A;  1TS3 A;  4ODG A;  3T56 B;  2FMM A;  1HTP A;  1DCZ A;  4NKL A;  2RSO A;  3MVV A;  5CC4 A;  5IIF A;  2EXZ A;  5IGC A;  3QIA A;  5K36 H;  4C2M B;  2NVY B;  3R2T A;  4RH6 A;  3GTL B;  4DAY A;  3K5O A;  3D6C A;  3V2T A;  1LT4 D;  4E6I A;  2NTS A;  5EBC A;  4FXK C;  4EQP A;  2KUM A;  4RGO S;  4KKU A;  2PNR C;  5EPL A;  5G3L F;  2VNU D;  2NVX B;  4C1N K;  1HA5 A;  1QJO A;  3MWY W;  2C5C A;  1GHK A;  1PZI D;  5E1F A;  4BY7 B;  3T4A C;  2EY5 A;  2LY7 A;  4A3F B;  3LNN A;  5IGE A;  1Q1E A;  3MA2 B;  3WOE A;  2RBM A;  5J1Z A;  1MSG A;  2A74 C;  1IYU A;  1B3A A;  3VR4 A;  3HOY B;  4A3D B;  4J6H A;  3R3O A;  4G7Z C;  3KF8 A;  4KN4 C;  1SBB B;  3WOF A;  2MP1 A;  1Y69 U;  1ZEQ X;  1GUG A;  1EQV A;  1HQR D;  1JWS D;  1JCK B;  2ENB A;  1G2S A;  2HDL A;  2K5Q A;  4FNF A;  4FF3 A;  1I4R A;  2J0T D;  4UDU C;  4WFN 3;  1WVL A;  4ID6 A;  4LJZ C;  2KHS A;  3R93 A;  4F87 A;  5M5W B;  1XWE A;  4PMW A;  4DN4 M;  3OHX C;  3CHB D;  2B2W C;  4QMG A;  1A2U A;  1KAA A;  4F7X A;  2L0C A;  1SDF A;  2Q8T A;  2TSS A;  1QCB D;  1I4P A;  2A73 B;  4DFA A;  1XYI A;  3QOL A;  3EQL C;  3FPP A;  3NXW A;  5M5Y B;  3C1F A;  3I4L A;  4HR7 B;  3RD4 A;  1IYV A;  3VR2 A;  2RSN A;  3GQB A;  5J39 A;  1Q90 A;  3SR1 A;  2JA8 B;  3M7G A;  1CA5 A;  1UEA B;  4A3G B;  4ME5 A;  2XWJ B;  3R2I A;  4KHZ A;  4WJW A;  2M2L A;  5EPK A;  5FKA C;  1DJR D;  1BOS A;  4K6D A;  3NTI A;  2O2L D;  1B9M A;  3EJI A;  4A93 B;  4L8J A;  2RVL A;  1F9R A;  3PUW A;  2WAC A;  1LTS D;  2XNA C;  1EU4 A;  1H9S A;  1D1I A;  2HCC A;  3A56 A;  5EBD A;  3K58 A;  1EYA A;  2MPM A;  1AZQ A;  1BXT A;  1PRT B;  1A15 A;  1TS2 A;  4C3J G;  1LTA D;  4TSS A;  1SE2 A;  4MIU A;  2WP8 J;  3PIP 3;  4XYO A;  3OWE B;  4FF1 A;  1OXU A;  3NE5 B;  3J7Y W;  2VUM B;  3T51 B;  4OO1 G;  1J9O A;  3TP6 A;  1RTO A;  1ESR A;  1BNZ A;  1LTT D;  2K32 A;  3M4Y A;  2CW0 D;  2CHB D;  3OSO A;  3G7L A;  1BR9 A;  5CV4 A;  1U4P A;  4KJN A;  3TZU A;  5I6W A;  2OXP A;  3MXP A;  5HUR A;  2JEA I;  1BF4 A;  5BN3 A;  4ULL A;  4CKB A;  1PZK D;  1VF7 A;  5KRU A;  2K1B A;  5C5L A;  3HRZ C;  2B8G A;  3DEP A;  4Q0F A;  1STN A;  3FEW X;  1MSH A;  1QE6 A;  4O1N A;  3NK9 A;  4DNT B;  4N9T A;  5TSS A;  3HOU B;  4H0L C;  2EYP A;  1TQO A;  1PFM A;  4H7B A;  1QIL A;  1EZ6 A;  4A3K B;  3HEJ A;  4U67 3;  3KLS A;  3P7J A;  2R92 B;  3A7L A;  2QCP X;  2F03 A;  1TII D;  2IX0 A;  3SXH A;  1CM9 A;  1AEX A;  3PUY A;  4HTH A;  1J8I A;  3GTJ B;  2BA1 A;  1FNV A;  1STG A;  1F2L A;  4F88 A;  4JK1 C;  5CV5 A;  5FOB B;  2EPB A;  5M5X B;  3IKJ A;  1MBY A;  4ZAI A;  3V96 A;  2YU9 B;  4IUR A;  1AW7 A;  1Q3L A;  3RZD B;  1QOH A;  2R61 A;  5JPN C;  1B2T A;  3BDO A;  2MUY A;  5IGB A;  2A69 C;  4BS9 A;  1STA A;  1BCP F;  4B9W A;  4HSP A;  3S2D B;  2MJ8 A;  1STH A;  1F9Q A;  1PYW D;  3LWE A;  3RUZ A;  3D4W A;  3HGB A;  2KCC A;  1HA6 A;  4N9P A;  1EIH A;  1CHQ D;  4X3S A;  3NQI A;  5JOB A;  1I6V C;  3K0Y A;  2PZW A;  2RDF A;  1Q12 A;  3C46 A;  4IFD G;  1Y1W B;  2D5D A;  3S14 B;  1PTO C;  4ZRZ A;  2BCO A;  3N6R A;  4KY7 A;  4C3H G;  1QG7 A;  1BO0 A;  3ZYY X;  1HTL D;  2B8F A;  3VR3 A;  3N52 A;  1HFG A;  2KJX A;  3KK7 A;  1KNA A;  3PUV A;  1GUS A;  1G29 1;  1M4V A;  3VR5 A;  5NUC A;  4JBW A;  2EE1 A;  2L5T A;  4FP5 D;  3PIO 3;  4RWS C;  2IW3 A;  4OO1 H;  4H44 C;  2F0U A;  3D8G A;  4KD4 A;  3T13 A;  1K8O A;  5KNC A;  1F9P A;  1EZ8 A;  3SK6 A;  4KJO A;  3TBI B;  1LAB A;  2K01 A;  3K5N A;  4X3T A;  2O5I C;  4M8A A;  2QKI C;  4NP5 A;  1H9M A;  2VB3 X;  3TN2 A;  1TWA B;  1VMC A;  3D3R A;  4K2L A;  1TWH B;  3O13 A;  3P75 A;  2NVT B;  3MC0 B;  5JAV A;  1SFO B;  4HN7 A;  1TY0 A;  2F0L A;  3FKI B;  3Q22 A;  2WIN B;  4KV6 A;  3S1R B;  3EFX D;  5C6A A;  1PZJ D;  1CA6 A;  5DAU A;  1S5D D;  2B39 A;  2XRQ D;  3K6O A;  2OT2 A;  3F2U A;  2A6E D;  1V1P B;  1ZXT A;  4L63 B;  2F0D A;  1CQV A;  4RGN A;  4EVO A;  2X6G A;  5IGG A;  2L1B A;  2JA5 B;  4DA2 A;  4OIJ A;  2H4O A;  3GV6 A;  4DU9 A;  1I6H B;  2NUC A;  4RCO A;  1TWC B;  4ABN A;  3A8K E;  1EOT A;  1PMR A;  4WRD A;  1W6J A;  1YNN D;  5KYI A;  5I2X A;  2QDB A;  3V05 A;  2D62 A;  1T5X D;  2F0K A;  2E2H B;  1NSN S;  3T16 A;  1SNP A;  4CJ2 C;  4QUC A;  1F2Y A;  5T1G A;  4QF4 A;  3SK5 A;  1ZYR C;  3M3Y B;  1F77 A;  1HRJ A;  2L12 A;  3A7A B;  1AFP A;  1IKL A;  2SNM A;  4R8I A;  1LTI D;  5C0X J;  4KTA A;  3PMF A;  3J81 E;  1JOK A;  4K2K A;  4HAE A;  1EY0 A;  2NB0 A;  5CYU A;  1SYG A;  3D4R A;  3W3A A;  3GTK B;  1E2V A;  1PXU A;  3I90 A;  3HS0 C;  4IZ8 A;  5C3X A;  5C5M A;  3S16 B;  4L6T B;  2K5W A;  3VR6 A;  1B50 A;  1UUP A;  2ID0 A;  2EVB A;  3QG1 A;  1VCI A;  3E6Z X;  3ONA B;  4OO1 I;  1SYE A;  1KDC A;  2Z1C A;  2KEC A;  3HOW B;  3Q0A A;  3PO3 B;  1K83 B;  4KK7 A;  3A8J E;  1RTN A;  1JE4 A;  3TP5 A;  1EY4 A;  1LV9 A;  4CGY B;  1LT5 D;  1KNE A;  1Y8P B;  3MXU A;  5CV9 A;  1RDP D;  3FRP B;  4DK1 A;  4V19 0;  2B2W A;  1S5B D;  1HCZ A;  4TKO B;  3KLR A;  4FXG C;  3M4O B;  5I4D A;  1DON A;  4CKC A;  4RCN A;  2V4D A;  2ICI A;  3J80 L;  1V1O A;  1O7Z A;  2IT1 A;  1ILQ A;  1JR0 D;  4FO2 A;  1S5C D;  1BCP B;  5D65 A;  3PV0 A;  2DNC A;  1SJH D;  1PRT D;  3K59 A;  2F0H A;  5ELE A;  4XYQ A;  1TKW B;  1HFN A;  2CQA A;  4U68 A;  4QIW B;  3I3C A;  1EY9 A;  1TS5 A;  3U9O A;  1F2M A;  2LFN A;  2C9O A;  5ELF A;  3OPO A;  1KAB A;  1CFM A;  1JOQ A;  3X3N A;  2ICE C;  4LK1 C;  5ELC A;  4KHV A;  4RHR A;  5EKK A;  3RLF A;  3P20 A;  1KDB A;  2H1E A;  2Z8L A;  1TU2 B;  2EYJ A;  1D5Z C;  1HXY D;  3DMU A;  3H0G B;  5DM6 3;  1ENC A;  3PUZ A;  4UAI A;  2BDO A;  3AMU A;  4KI0 A;  4G7H C;  4DF7 A;  1B1Z A;  4M1U B;  1I4G A;  3D4D A;  1OXV A;  1DYQ A;  5E3F A;  4IFD I;  3J80 E;  2A5H A;  2XWB B;  2Y0S B;  1D1K A;  1V8Q A;  2J7Z A;  3K5L A;  2F0F A;  5JEA J;  2JP1 A;  4A3B B;  2LS0 1;  3Q23 A;  1DZ1 A;  2L11 A;  2F3W A;  2RA4 A;  4Y7N B;  2PW7 A;  4KKT A;  2EY2 A;  1Z6H A;  1ROD A;  5C4H A;  2K03 A;  3I72 A;  4ZK9 B;  2K7V A;  4ZKC B;  5FO7 B;  1E2Z A;  2LMC B;  2EY1 A;  3GTG B;  3S2H B;  4IUU A;  3AU7 A;  1Y8N B;  1TWF B;  2EYM A;  3OMC A;  4PMC A;  2PPB C;  1OO9 B;  3RZO B;  3MZ5 A;  3I4M B;  3I4N B;  1LLR D;  3WDN A;  3GP7 A;  1L0Y B;  3NWS A;  1GUN A;  2E2J B;  5G3L D;  2EYL A;  2R7Z B;  3L7Z C;  3SEB A;  1NCV A;  3H91 A;  3D6W A;  1I4Q A;  2B2Y A;  2HUG A;  4ZQ3 A;  4HSV A;  4KD3 A;  2JYO A;  4HMI A;  4RKB A;  2KQ3 A;  3H3V C;  3C1E A;  3TSS A;  2AWO A;  1X32 A;  4QCL A;  5C4Z A;  2G9H D;  2KA7 A;  2SEB D;  3NQT A;  3PUX A;  1TT2 A;  2BE5 C;  1FNU A;  5EKL A;  5M3F B;  1PTO F;  4O42 A;  1SNM A;  1B53 A;  5FK9 C;  1PFN A;  3VA5 A;  4J1M A;  3NWT A;  1GOZ A;  1EY7 A;  3S15 B;  3TP7 A;  4MHE A;  1ZKO A;  2EJF C;  1QNK A;  1RD9 D;  4ZUI A;  5IT9 L;  5D14 A;  2EYO A;  2KEE A;  5CV7 A;  3ERO A;  3ND8 A;  4I7Z C;  3HOZ B;  1GUW A;  3VYS A;  1DOM A;  1U9R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...