1GHKA

Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from azotobacter vineland ii, nmr, 25 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
79
structure length
79
Chain Sequence
AIDIKAPTFPESIADGTVATWHKKPGEAVKRDELIVDIETDKVVMEVLAEADGVIAEIVKNEGDTVLSGELLGKLTEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from Azotobacter vinelandii.
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Acyltransferase
molecule keywords E2, THE DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE COMPONENT OF 2-
total genus 6
structure length 79
sequence length 79
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 1996-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ghkA00
1FR3A 1BDOA 1DXMA 2A6EC 3OW7A 1GUNA 3MXUA 1V43A 2E75C 2D5DA 2A69C 4KMUC 3EQLC 4I7ZC 3VR6A 4XTCS 1Y69U 2E74C 4L8JA 1Q1EA 3U9SA 1B9NA 3D4RA 2D62A 2NN6G 3T56B 3IKJA 1H9SA 1VDZA 2IT1A 2PCFB 1PMRA 3L7ZC 4H0LC 4DK1A 2O5IC 3PUVA 1OXXK 2AUJD 2KCCA 3CRLC 3FMCA 1VF5C 3GD7A 2NN6H 3QIAA 1O78A 5JEAH 1IYVA 1EWHA 4G7OC 3HGBA 1OXTA 1V8QA 2AWOA 1H9KA 3M7NA 1GUTA 5KNCA 3QJYA 1FYCA 3AB9A 2O5JC 2KA7A 2PNRC 3A8JE 1YNNC 4LJZC 1Z7TA 3RLFA 2A6HD 4HR7B 3WDNA 1DCZA 4JK1C 1GHJA 1GJXA 1OXUA 2JE6I 1SMYC 4JBWA 3PV0A 3VA7A 2BDOA 2CW0C 3A8KE 1VF7A 4OO1G 1HTPA 2E76C 3I72A 1TKWB 3PUWA 4G7HC 3VR4A 4DNTB 1CTMA 3A7AB 2B8GA 3ND8A 5KNDA 3FPPA 2NN6I 2K33A 4KN4C 3CRKC 2EJMA 3PUXA 1O7LA 3QG1A 5BN5A 1HPCA 1Y8PB 1GHKA 2PPBC 5C0XG 5KNBA 2JEAI 4OO1H 1IW7C 2DNEA 4H44C 1Q90A 2YYZA 2EJFC 1OXVA 2R6GA 3VR5A 1GUSA 1DD2A 5C0XH 1ZYRC 4H13C 2ZT9C 3MFYA 1H9JA 4KKTA 2BA1A 2F1MA 3I4LA 1I6VC 3LNNA 1Q12A 3IFTA 2V4DA 1OXSC 4BA1I 4IQZA 3SE0A 3PUZA 5A35A 3ND9A 4GZYC 1YNJC 4IFDG 4OGQC 3H94A 4KHZA 2A68D 1QJOA 2AUKA 2BE5C 4KKUA 2K32A 1GUOA 4KI0A 4LK1C 2EJGC 3DXJC 1IW7D 2QF7A 5BN4A 4DK0A 1H9SB 5BN3A 4PV1C 1K8OA 1LACA 3M85A 1Q1BA 2A69D 3I73A 1CFMA 1E2VA 1Y8OB 5JEAG 2B8FA 2DNCA 2L5TA 1E2WA 2D2CC 4KN7C 3M4YA 4XIGS 3SDZA 4BA2I 4IFDH 3PUYA 4TQUS 4KKSA 1TU2B 3VR2A 1IYUA 1T5EA 3LWUA 3KLRA 2BA0A 1HQMC 3NE5B 3BG3A 1VCIA 2A6ED 3W3AA 1H9RA 1B9MA 1LABA 4TKOB 4G7ZC 4DNRB 5K36H 1Z6HA 1A6XA 3A7LA 1ONLA 3T53B 3N6RA 1ZKOA 2JEBI 4RCNA 1CI3M 2Q8IB 1Y8NB 2EDGA 3TZUA 2DN8A 1H9MA 2K7VA 1GUGA 2A6HC 1K8MA 3OOCA 3A8IE 3BDOA 1HCZA 2EVBA 3P20A 1G291 2LMCB 3T51B 3VR3A 5K36G 3GQBA 2JXMB 3D31A 3OPOA 2A68C 1E2ZA 2BE5D
chains in the Genus database with same CATH superfamily
1EIGA 4B3ML 1YHAA 3M4OH 4CDDC 5FO7B 4BY1G 1DZ1A 3V05A 5JJKA 1D5XC 5CV4A 4JI8Q 2EIFA 3EQLC 4I7ZC 2K1BA 4XQQA 3TS0A 2OWOA 3U9SA 1EY9A 1UE1A 2D62A 4DV2L 4OXPA 1SMXA 3K5MA 1G2TA 4H7BA 2JP1A 1QZGA 4KY7A 5JEAH 1IBLQ 2NN6H 3BVGA 2R92H 1AFPA 1EWHA 3I4NB 2LSSA 1D8LA 4JI4Q 2NVQB 5EKLA 3ZJYC 3K59A 1EY6A 5M5YH 1IBMQ 3MTSA 4NW2A 4GKKQ 4V190 3AB9A 3J7ZC 3DEPA 1YNNC 3RN5A 4DR4L 2HQLA 4UP7A 3WDNA 1LO5D 4DR3Q 1GJXA 4BY7H 1WCMG 3PV0A 1K28A 1I3QB 4G57A 5CV8A 1K9MC 3A8KE 1B50A 3GTQH 1CZGA 1TKWB 1K0RA 4F8MA 2B8GA 1U9RA 2IY5B 1I50H 3QG1A 4ME3A 1K83B 3HOZB 4OWXB 2ZJRA 1JB3A 2Z4HA 3BDLA 2CH4A 1SYCA 3ERSX 4F88A 1C4QA 2HDMA 1OXSC 5EBDA 4M1UB 3SE0A 1JC7A 5IT9E 3S15H 3M3YH 3A56A 1SRUA 1EQRA 4MTKA 4IALA 5JJZA 4DUZL 1HFNA 1N36L 1PYBA 1YJNA 4JI7Q 1TS3A 2R7FA 1SN8A 1BBWA 4K6DA 4DV3Q 4AQYQ 3GP7A 1TWFB 3M9BA 3TS2A 1X6OA 3C1FA 1WTWA 4XIGS 2UUCQ 1U4LA 3K5LA 2Z6KC 4LUZA 1VQAA 1ILPA 3UDGA 5IGDA 4JI0Q 4JBJA 4DV5Q 1O7IA 1ILQA 2K50A 4DNRB 3HOYH 5M5XB 1CZWA 1WVLA 4JI0L 2JA8G 2B2UC 2F0EA 4CDCC 4AYBB 5LMNW 1K8MA 1U0LA 3I4MG 3HRZC 3SK8A 1I4RA 1B1ZA 5A2QL 5K36G 1JE5A 2NVXH 3L3OC 1YIJA 1L0WA 2R92B 1TWGH 1ENFA 1U4RA 2PNHA 2KHIA 1FJGL 1LV9A 2E75C 3FHWA 4DV0Q 2F0UA 4PZ8A 1PH8A 2KCNA 2R7ZG 4RKBA 4QB4A 1PFNA 2F0LA 3UDIA 2ZTDA 3CRLC 5M5WB 2L4NA 1PH2A 2BOSA 5GAGC 1TS5A 2EYLA 2JSOA 2MJ8A 3CP0A 2DGYA 1ZEQX 3QJYA 1G91A 1LTTD 4DV3L 3HOZH 1TWCH 4FO2A 2ES2A 2JA6G 1L1OC 4R4CA 2FFKB 1MI2A 1PTOH 2AWNA 1HTPA 3I72A 1PRTC 4P73A 2A74C 2F3WA 4JI1Q 3KBXA 3H3VH 1O7LA 3CCUA 3F2DA 1RKNA 3KJPA 4BBSG 5C4XH 5C0XG 4OO1H 1KDAA 2K03A 3GTJH 2HT1A 2WB1E 3ICEA 1KIXA 4LF9Q 2VZAA 1ZYRC 4HJ5A 1SBBB 3JAMi 1WTOA 2F1MA 1N34Q 2Z9HA 1JQYD 4YIJA 4K0KL 4NP5A 2QA4A 2Q2UA 1KAWA 4P71A 3K6OA 3I55A 2A68D 5E4WC 5FO9B 4X3TA 3HOUG 4ZAIA 2CKZB 5TSSA 1N33Q 3S2HH 5JPMC 2YU9B 3S1MH 4QL5A 2K5DA 3KLSX 1KAAA 1XTCD 3CKIB 3S1RB 3RZDH 2RCFA 3CQZH 1Y1VG 1EU3A 4B9XA 4RHRA 1CHQD 4A75A 3KYHC 4XQNA 5CV6A 4C3HG 3PUYA 1VQ8A 1IBKQ 3OMGA 1HNXQ 3GV3A 3NE5B 3CMAA 1JWSD 4O2DA 5ELFA 4BBSH 1QNUA 2VS1A 2RA4A 1D7QA 1S5DD 3T53B 2I5LX 3CQZB 5JVG3 1JJGA 3EBEA 1BBUA 3RZOB 3V2TA 2L9HA 2Z8LA 2ALYB 3CXCA 2HHHL 2Z4IA 4GN4B 4BY1H 2BCOA 1Q82C 1DXMA 2MGSA 4AH6A 4C3HB 1X32A 4LF6Q 3CF5A 3NSWA 2KCTA 4RGTA 1Q1EA 3HOVB 5KYIA 4DK1A 3H91A 1Y1VH 2AQ1B 4K5VA 4G7OC 3KDFB 1NR2A 1QOHA 3JAML 3PO3H 2KHSA 1K8AC 1S5ED 4NXMQ 4A3GH 3NBIA 3H0GH 1PTOB 1D2BA 3MEFA 1OXUA 4NXNQ 1STEA 2F0FA 3AU7A 1OTCA 4H02A 1PLFA 4DV0L 2QCPX 3NWSA 2F3VA 1HZAA 4GLAC 1RJTA 1E1OA 1HJPA 1MGSA 1PRTB 2HDLA 3NTKA 3U4ZA 3PUXA 1MIUA 4C3JB 2KHJA 1WD1A 2JEAI 4A3DG 1Q90A 5LMUQ 1BXTA 3TBIB 3FVQA 3PIOA 4GLVB 1QCBD 4FXGC 3RUZA 3H0GB 1X65A 2I0QA 3PGZA 2EYMA 2QW7A 4JI2L 1Q12A 3H09A 3TP6A 1QUQA 3F2BA 2Y0SB 5DEHA 3ND9A 2X6GA 3DHQA 3E3XA 1WOCA 4TRDA 3FEWX 2K05A 3AEVA 2ENBA 4DK6C 3J81L 2EJGC 4C3IB 1F77A 4DK0A 3H3VI 4IO9A 1EY4A 5HURA 2F0MA 4B08A 2D0PA 1CFMA 4RGOS 2CVRA 3OIQA 2H4OA 5DM63 1HR0W 3MHBA 2JA7G 1JORA 1SE3A 1SAPA 1Q8IA 4RG1A 4ZRZA 3CCSA 3KLSA 4KD3A 3M4YA 1T9HA 3J7AF 4TQUS 4BY1B 4CJ0B 1IYUA 3SK4A 4EGVA 2F0PA 2R93B 2BA0A 3Q24A 3DM1A 3EJIA 2A6ED 4G7ZC 4A76A 2B63H 1XNQQ 3G71A 1ONLA 2EYFA 2M00A 5C3WA 1L1OB 2JEBI 4LMQD 3SVMA 1VQOA 3HOXG 4LF5L 1B70B 1CQFA 2YTYA 2LMCB 3A55A 2JXMB 2UUAQ 4N9PA 4UPAA 5AJ3L 4NXML 4RFBA 5JJIA 4BY7G 3I4MH 3QO2A 2F4VQ 3MXUA 3KBGA 2TSSA 3JAME 1KL9A 4DV7L 5ELCA 3UDFA 1CKNA 1VQMA 3T1YQ 3D8GA 4A93B 1AEXA 1EYGA 1PYWD 1LTID 1K83H 2WP8J 1F9RA 4EQOA 5GAHC 2E2JB 1SJHD 4HEDA 2EXZA 2EYHA 5C4JB 1B8AA 4HMJA 4OWWB 5KIXA 1Z7TA 5M5XH 5C4HA 1BBXC 2N49A 3AFQA 4X62L 4OX9Q 1LTRD 2OQKA 3T16A 3I91A 2BDOA 2F0NA 5C5MA 4NMZA 4DV5L 2MQHA 1PFBA 4OX9L 1TS4A 2NUCA 1XNRL 2NBFA 3FPPA 1NAPA 2RQXA 4KN4C 5EPJA 4DKAC 1V1QA 5KNBA 1I6HB 3U9OA 1HH2P 5IY0A 3E0JA 2Y0SE 1RCVD 1WTXA 1FL0A 2NTTA 3IFTA 1X3FA 1EUJA 1HZ9A 3QWNA 2ZXPA 1N33L 2HQEA 3O13A 1QJOA 1IXRA 1KABA 3C46A 4K14A 1GO3E 5LHY1 1W3SA 2VW9A 2A8VA 2E5LQ 1AN8A 4KD4A 1Q1BA 5GROA 5L37A 1II3A 2D9UA 5NUCA 1AP0A 2EY1A 4A3BB 2ZXOA 4L5TA 3D0FA 4J6HA 5JEAG 3DUZA 3UE0A 4RAUC 2DJGC 1STNA 3GTQB 1D1IA 3H6MA 4JG2A 3BVMA 3NQTA 3J80c 1IKMA 1HUNA 1T5EA 1I3QH 2NVXB 1VQBA 2H1EA 3A5ZB 4J1MA 2UU9L 4P75A 1V9PA 4JYAQ 3T1HL 5IGCA 2KCMA 1PZID 1SNCA 1Q86C 3T1HQ 4A3IG 2JA6H 2F0QA 2K5HA 3URYA 3I4NH 2LY7A 1EZ6A 1GM5A 4L5RC 2VL6A 4CDFC 5JEAJ 1HQRD 2G9HD 1F9QA 4OEMB 5CV9A 3CC7A 4PG3A 4ZQ3A 4XTCS 3TEHB 4JV5Q 1Q3LA 1YJWA 3BYTB 1VDZA 4GKJL 3RZOH 1SNPA 4L5SA 1GKHA 4GNXA 1EQVA 1DOKA 1VMCA 1TWAB 5LMUL 3EN2A 3RMHA 5C44B 1PVOA 4TVAB 4U673 4A3FG 1DCZA 3S16B 3HOYG 1S72A 3HOWG 5A2QE 3FPUB 2UU9Q 1ML0D 3PIP3 5KNDA 1GVPA 5D3DA 3RD4A 3GDEA 1IBLL 1FNUA 1VQNA 4UHVA 4OL7A 2JA5G 3C1EA 2K04A 2IWHA 1FNWA 1LT3D 1GUSA 2ZTCA 3F1ZA 1DOMA 3CPWA 1IHZA 4KKTA 1BVSA 4WFN3 5IT9c 2PI2A 3S1QH 1YNJC 2VUMG 4JV5L 1PRTF 1SR3A 4POFA 3X3NA 3MFGA 1CSPA 1IL8A 1Y1WB 3TP7A 3R8BA 3AFPA 3NXWA 1C48A 2CW0D 1CT1D 4F87A 4JI5Q 3U58A 3KJOA 4HAEA 1VS0A 2JQOA 3LWUA 1PH7A 2WINB 5ELEA 4X3UA 3D4DA 1VCIA 1AH9A 4LFAQ 5ISRA 4AYBE 1SE8A 1KNEA 3N6RA 4GN3B 4R1JA 1GUGA 2A6HC 3N52A 3SR1A 4Q5VA 1CKOA 5IP9H 5COYA 3OPOA 2F4VL 4HCSA 4DA2A 4A3GB 4DFAA 1Y69U 1PTOC 1VQJA 2EYJA 4DV1Q 2PQAA 3H15A 4OO1I 2Z6BA 5DLQE 2XTIA 4GNXB 4ILWA 1E0BA 4KV6A 2KCCA 1IYVA 2Q2IA 3STBD 1TXYA 4LF7Q 2L55A 3CCLA 4IPCA 1OXTA 1V8QA 4MN3A 1GUTA 1CQVA 3Q22A 3ZYYX 3CCRA 2GVAA 1V1PB 2PNRC 2RVLA 4QCLA 4K2KA 1V1PA 1HNZL 4YWKA 5C4JH 1AW7A 4K0KQ 2N8NA 1DGSA 2JE6I 1EIFA 2OT2A 1X3GA 4YWMA 2HIXA 2Q2HA 3P1HA 4R9WA 4CGYB 5C5LA 1NBWA 4A3MG 1CTMA 1A62A 3OHXC 2NN6I 3CRKC 4IFDI 4DAPA 1Y8PB 5HGTA 1A3TA 2WB1B 1YNND 3PCOB 4X66Q 3E5SA 3S15B 2K5WA 1SYGA 3RZDB 2Z0SA 3QB3A 1N9WA 5HY6A 3K5OA 3NTIA 4IQZA 3S1MB 1SROA 4R4OA 4CHTB 3S2HB 2L11A 2BDNA 4JI3L 5J22A 3DWPA 3AQQA 3HOUB 4JYAL 1I4XA 4DR1L 5BN4A 2EPBA 5C4XG 1MSGA 3DLLA 1NSNS 3HKZG 2O2LD 4PV1C 1JMCA 2F0TA 3BDCA 3CAMA 2PI2E 3L9AX 5CMDA 1XMOL 1MJEA 2EOTA 2QILA 2HHHQ 2ZJPA 5DNFA 2RKSA 1EZ8A 4I65A 1ENAA 1XMOQ 1NUCA 1YITA 4KHPQ 1YNXA 1SXTA 3KOJA 3BG3A 4GOPA 3W3AA 1V1OA 1H9RA 1BCPF 1QVFA 1WFQA 1KDCA 5IE8A 4JW0A 5DAUA 5EGTA 2RBMA 1JE4A 5IGFA 1EY8A 5KEEA 1IL2A 2DN8A 2P5ZX 3I4NG 4UDUC 1G291 4IN3A 3T13A 4A3CG 2E2JH 1FGUA 5I6WA 3MA2B 2PYKA 4IOAA 2LS01 2CCZA 1A15A 1SEBD 4YWLA 1E22A 2A69C 5D14A 5CORA 1S5BD 4FXKC 5FLXE 2NN6G 2IX0A 3L7ZC 3ULJA 1CKNB 1Q8KA 5CC4A 5EPKA 3RR5A 1STHA 1HA6A 1E3PA 4IUVA 1ET9A 3HGBA 2ASBA 2JA8H 1ICWA 2OCEA 5KNCA 3K7UC 3VYUA 3D4WA 1JR0D 1VQKA 2FJ2A 3DWQA 5IP9G 5FLMG 1JB7A 1KD1C 2K5NA 2SNSA 2E8GA 4XDXA 4DAYB 1QILA 1NCVA 4JI2Q 1G8ZD 1KLGD 1WCMB 4DNIA 4EX5A 3G4SA 1PH6A 3QR8A 4KHPL 1XWEA 4DK3C 5IIFA 1XJVA 3UI2A 3F2UA 4IJHA 3C2PA 2FMCA 3K57A 1NJIC 1EOTA 3P7JA 4OELB 1EOVA 1LTAD 4GS3A 2DNEA 3S14H 5FJ8G 2N78A 2RDGA 2TMPA 1SFOB 5CGKA 1OXVA 2RSOA 4LWCA 3KF6A 2RSNA 4J8QA 5IODA 4A3KB 1G6PA 1WD0A 3EFXD 1IKLA 3D6WA 1PDQA 2UUBL 1DJRD 1KDBA 3OSOA 3TZDA 2NVTH 3M3YB 4DU9A 1U4PA 2DUDA 2MO1A 2Q8RE 3TDQA 2B3GA 2D0OA 3M4PA 3I4MB 4BBSB 1Y1WG 2KQ3A 1VQ4A 3SGIA 1F9SA 3MWYW 1B7YB 1YNJD 4BA2I 4R4TA 1UE5A 3GTKB 2ID0A 2MFIA 1A3UA 2NWGA 1LABA 4MIUA 4ID6A 1F2ZA 3IFDA 5G3LF 2QDLA 1J9OA 4RCNA 2K7VA 2HIVA 3I70A 3MEHA 5ELBA 1LT4D 4QIWB 1PZJD 3AMUA 1HR0L 2OF1A 5E1FA 4DV4Q 2BE5D 4AIMA 2OQ0A 4A4IA 1J6QA 1CUKA 2CQAA 1UWVA 1R4PB 3D3RA 2UUCL 1EEFD 4KMUC 2G5DA 3IRBA 5C4XB 3VDYA 1B9NA 4CJ1B 3MXPA 4WJ3M 3M4QA 3HOWB 1B3QA 1PFSA 1OXXK 2QEJC 1MKHA 2EZVA 4N8FA 4P72A 4OWTB 5GADC 2PW5A 2VY3A 5J1ZA 2JJQA 3VYSA 3J81c 1VQ5A 3SK5A 2ZM6L 2I07B 2KA7A 3MXNB 3PQIA 1XXGA 5LL6S 4C3JH 4KY5A 3OTOL 1TWCB 2NTSA 2DY7A 2KENA 2XVSA 1JWUD 1I4PA 4HIMA 5C3EG 4OO1G 3PUWA 4PZ6A 4R4IA 4YCUA 4QY7A 1BNZA 3GTMH 1IW7C 2F0JA 3NTHA 1B2TA 1PV4A 5JJLA 2E2HH 1SNMA 4FXDA 1I94Q 4H13C 3CW2C 4KTAA 4A3KH 1RL2A 2J0TD 4HSVA 4XYOA 4A3EH 1SYEA 2YTVA 4IPDA 4KHZA 5E3FA 2NB0A 4JBMA 1GXDC 1HRJA 3E9IA 4KKUA 4KK7A 1GUOA 4LK1C 4ABNA 3GTOH 4JI4L 4FNFA 5FO8B 4FF3A 2DY8A 1EIYB 2CWPA 1ICFB 3A54A 3J7AV 4QJFA 4DN4M 3Q0AA 4KJNA 5FJ8H 2B2TC 3CU7A 2XNAC 1YJ9A 4KKSA 2F0OA 4X64L 2AHOB 2WAQB 1RTNA 3WWVA 2EY5A 2K5QA 1EY5A 2OTJA 3GTPB 3MXNA 3HOVG 1BUVT 4K5XA 4NKLA 4IUPA 3HKZB 1YVCA 3OOCA 3A8IE 2E5LL 3P20A 3T51B 4CDEC 4A3KG 1EIHA 1CM9A 4P74A 5M5WH 1TY0A 4ZUJA 2A6EC 2F0WA 2N55A 3JAMc 3GTGB 2F0HA 1HZCA 1IBKL 2RCNA 1RTOA 2PQAB 3W1GA 1X9NA 1RD9D 5FK9C 1G51A 3TP5A 1BF4A 1PH3A 2UXBQ 2CFMA 1H9SA 3U50C 2NYZD 2AUJD 4JI7L 4ZKBB 5EQ0A 1M1KC 1Q81C 4K6LA 1SE4A 1KHIA 4BY7B 2HUGA 4C1NI 1ESFA 4K8IA 2RDFA 1WTQA 1VQHA 5M5YB 2SEBD 4QUCA 3VA7A 1WTHA 1TY2A 4GOPB 4HTHA 4HSPA 5EBCA 4J15A 2KJXA 2HD3A 3A7AB 4ALPA 2R3ZA 3FKIB 1SNQA 2B39A 1HPCA 4C3IG 1WYDA 2C5CA 1AE3A 2PPBC 2XWBB 3HG9A 3HOUH 3M4OB 2JA7B 2VB3X 4LUVA 1HNXL 3I2ZA 3MFYA 1VQIA 4IUNA 2AQ3B 4ZYSA 2NZOA 3TRZA 1QVGA 3HP3A 2L0CA 4IFDG 4BBRG 4DAMA 1LTBD 2B2UA 2K32A 4KI0A 1JCKB 3LX0A 4LF4Q 5C0XJ 1U4MA 1YI2A 1D6EC 3BZDB 4O1NA 1N32L 3GTPH 3ER0A 3I73A 4RGNA 1QVCA 4XT1B 4JI1L 3KF8B 1YHQA 1YEZA 2Z6KA 4PMCA 2K52A 2KEDA 1E2VA 3UE1A 1Y8OB 1I4HA 3EIVA 1S40A 1E7ZA 4HIOA 1IBML 3EA6A 4CBVA 1X3EA 2D2CC 2PZWA 4LF6L 1D5MC 2Z1CA 2JYOA 4IFDH 4DR3L 1CA6A 2JA6B 2UXBL 3F2CA 3NBHB 2QEXA 1B9MA 4K5WA 4DV6L 1A6XA 1STAA 5M3MG 1KRSA 1CI3M 1HXYD 2A73B 5C3XA 1DYQA 2KECA 3H0GG 5KYLA 4EQ5A 2B63G 3D31A 1E2ZA 4QIWE 4X3KA 4C3IH 2OXPA 4IURA 5I4DA 2UXDQ 1PH4A 3FDTA 1FR3A 1KLUD 1LUZA 2F03A 5BR8Q 1RHPA 1NY4A 3GTMB 4BS9A 4LFAL 3BZCA 1M90C 3ULLA 4C2MH 1PMRA 3PUVA 1AE2A 1TVXA 1N32Q 2Q8TA 2WV6D 2LXJA 2I46A 3G6EA 2ZJQA 5AJ3Q 5ELNA 2IX1A 4XYQA 1UEBA 2IHEA 1T5XD 2BH8A 1FNVA 1F9PA 1S3OA 3MXGA 3EVQA 1YZ6A 1NR4A 1LTSD 4HN7A 4X65L 3ITPA 2CW0C 1D1KA 4LFBQ 2F0IA 3ULPA 2PW7A 4WRDA 1Y1WH 1BR9A 5BN5A 2IJ0A 3J81i 3CC2A 3TQYA 3CD6A 4HJ8A 3K7AB 5LL6X 1GHKA 4S3SA 1EEID 2RF4A 4ZUIA 5E4XA 4A3BG 1GOZA 4RKLA 1KC8C 2NVQH 1EFID 2ZT9C 3S24A 1C9OA 4HJAA 3K8AA 3S1NH 1STYA 1JOOA 3NENA 3DM3A 4C3HH 4OGQC 4M8AA 3J80i 2XRSD 1J5EL 4EQNA 1KQSA 1HNWQ 3KLWA 1HZBA 4OHJA 1QUQB 4A93H 2MUYA 5ELOA 3TSSA 1K73C 3M85A 2B2VA 2VB2X 1G2SA 4BXXH 2ZXRA 4A3GG 1PRTD 5FKAC 2K6AA 4YCVA 3HEJA 1I5FA 4B9WA 1EQQA 4MNOA 4G4KA 5BR8L 2GVBA 3G48A 1A8VA 3VR2A 4PMBA 3KLRA 2N88A 1OO9B 3KDFA 3Q8DA 5IGEA 3KF6B 1HA5A 2WAQE 2YTXA 1D5ZC 3A7LA 4RH6A 5EAYA 4B3RL 3K5NA 4IOCA 2EDGA 2F0DA 1H9MA 4B3SQ 5JOBA 3VR3A 1LT5D 3NUCA 4XXEA 1Y1VB 4DF7A 2L12A 3I7FA 2EQSA 2RHQB 1PA6A 4A3DH 4NPSA 1PTOF 5C3EH 1FD7D 1TIID 1BCPB 5FLXc 1XNRQ 3D4RA 3IKJA 1EYAA 5GAEC 1SMYD 2UXCL 3PF4A 2VQEL 1K3RA 3OIPA 1Q7YC 4DXGA 5LMNL 2VQEQ 1RIPA 3AYHB 5C44G 4ZK9B 4LJZC 1MSHA 4FF4A 4LAAA 1GHJA 2F0SA 3B6YA 1KNAA 4JBWA 4JPBW 2IL8A 2JA8B 1HNWL 4HMIA 1LT6D 3C3LA 4Y7NH 1X54A 3VYTA 4DUZQ 2GA4B 3PIPA 3GTKH 3VR4A 2VUMB 5FOBB 2PZUA 4CKBA 2K33A 2EJMA 4A3EG 1M8AA 5M9OA 4B3SL 4H44C 5IYCH 3T4AC 4AQYL 2EJFC 3L0OA 4C2MB 1RODA 4RGMA 2EYOA 3IL8A 2XWJB 4PQXA 2GN5A 2MNAA 4KHVA 1N36Q 1CK1A 5I2YA 2JA9A 4JVZA 4DV6Q 1I6HH 1QG7A 1JOQA 2E2IB 2QF7A 1BCPD 5BN3A 1CHPD 3HOXB 4A3JG 3UDXA 3TP8A 5FLXL 1HR0Q 4BBRH 5M3FG 3NHHA 1L0XB 4R8NA 4X6AH 5LMNQ 1QB5D 2PMZE 3HOYB 2B8FA 4Y52H 4IPGA 4TSSA 5IYDH 1FJGQ 1Y14B 1R9TH 3CHBD 3NWTA 1BQQT 2MP1A 1EQTA 3TREA 3VA5A 3SEBA 3NP8A 1B4OA 1CA5A 1DOLA 5I9OA 5C6AA 5K36H 1MHWC 4BXXG 1C0AA 1UNSA 4WJWA 2Q8IB 2SDFA 1WJJA 1AZPA 4LW1A 4WORA 4NDXA 4P2CB 5GQOA 1XYIA 4FVMA 1W6JA 1W2BA 3DEOA 2ZM6Q 4NXNL 3EROA 1X3QA 1GUNA 2X69A 5EPLA 1M4VA 1YBYA 3NELA 3S1RH 2EY2A 5CV5A 3RNUA 5EKKA 2E74C 1DONA 5T1IA 1GD7A 5M3FH 4DR1Q 1O7ZA 3M7GA 2CWAA 2O5IC 1SYBA 1XMQQ 2SOBA 2M2LA 3QIAA 5IGBA 4Q0FA 3T1YL 3FKIG 1I50B 2AWOA 1MD2D 5JPNC 3NPPA 2O5JC 3W2DA 1N34L 1O7YA 1GUWA 1LTGD 1EWCA 1NTGA 1G6ZA 4POGA 4LNQA 2C9OA 3Q23A 1ASZA 2VNUD 1JJ2A 1XNQL 1XTDA 4BBRB 3CCMA 5KGUA 2XGTA 1BKBA 4LF7L 2EY6A 2UXCQ 3K80C 4YHHL 1JICA 1STBA 2YYZA 4O42A 3VR5A 5C0XH 1VQLA 3TMEA 3HFZB 4A3BH 1H9JA 4I7AA 4DR7Q 3LNNA 4HIDA 4IUUA 4A93G 1A63A 2H5XA 3GTGH 2AMCB 3H94A 4LUOA 4OIKA 3S17H 4NB3A 3BJUA 3R2TA 4JI3Q 2UUAL 5IOCA 1ESRA 4AYBG 1UUPA 3S2DH 4QQBX 1LACA 2O4XA 4FF1A 1UE7A 4L6TB 3FKIH 1A2TA 5E7NA 3PF5A 1JT8A 3S9WA 5IYBH 2RHSB 3I4OA 1JJCB 3LWEA 4B3RQ 4APVA 4TKOB 2HCIA 4X65Q 1Z6HA 1VQGA 4A3FH 3CCJA 2DJFC 2MO0A 3HOZG 3OWFA 1XPOA 3BDOA 4HJ9A 2F0GA 3S1QB 4IPHA 2NVYB 2AQ2B 3PMFA 1BDOA 1KRTA 4JI5L 2BH2A 4A3DB 3OW7A 2V1CC 4DR7L 5IWAQ 4XT3B 1P8LA 1Z47A 2D5DA 1W6KA 3VR6A 1EU4A 4L8JA 4K8JA 2Q2TA 1AZQA 4C56C 1SNDA 2PCFB 2Y0SG 3G7LA 3F8TA 5M3FB 3PO3G 1EY0A 2IW3A 3FP9A 3HS0C 2SNMA 2LKVA 1FGBD 3E0EA 1F2YA 2VQFL 3M7NA 3CC4A 2K4KA 1ASYA 4A3MH 4KY6A 5D65A 2R93G 3A8JE 2N3SA 1HHVA 4GN5A 3RLFA 4ZKCB 5C44H 2PZTA 4DGZA 1SE2A 2IX3A 1KTKA 3WOFA 1B3AA 1S5FD 5J39A 5IP7G 1IZ6A 3J80E 4DV2Q 1QZHA 2B63B 2A1AA 3ND8A 2WIIB 1PH9A 2YU9H 1FVIA 1E24A 4GOPC 2E2DC 1XMQL 1R9TB 2K14A 1VQDA 3MC0B 1DD2A 2QKIC 4QUFA 3GTOB 1TS2A 1EL0A 1I6VC 4UAIA 1PFMA 5IT9L 4DR5L 1R4QB 2F0KA 3BYYB 4MZ9A 3OMCA 2AUKA 2E2IH 4KJOA 1PTOD 2R61A 3DXJC 1IW7D 1H9SB 1K8GA 5I9PA 2B2YC 4HIKA 4DR2Q 4B3TQ 4PMWA 4CKEA 4YHHQ 4RCOA 3W1BA 5JAVA 3CMEA 2L5TA 3X3MA 3NK9A 3J80L 4DAVA 3ONAB 4B3TL 3HZXA 2I5HA 4KN7C 2PMZB 3STBC 5CBAE 3P75A 2B2YA 2MHVA 5D3IB 4GKJQ 1L2FA 2CH4W 1NE3A 3D6CA 1JWMD 1Z9FA 4LF4L 1QNKA 3K0XA 1ZKOA 1Y8NB 4IFDJ 2PQEA 4L5QA 2VQFQ 3H3VC 2XSCA 1XPRA 3PO2B 2RDHA 1EYCA 4A3MB 2A68C 2NVTB 1L1OA 2F52A 3PIO3 1C8CA 1P16A 2OEOA 1IYJB 2EE1A 4DV4L 4IUTA 4IZ8A 1PZKD 4X62Q 1TWGB 2G9DA 5CV7A 4MHEA 5H1SE 3OWEB 1EYDA 5C0XI 3T56B 1VQ7A 4H0LC 3I3CA 2NZHA 3HOVH 2KEEA 3FMCA 3GD7A 4ULLA 2FXQA 2J4XA 3S14B 5I2XA 1NMGA 2JK8A 2WB1G 4DXFA 1EY7A 2EXDA 4CKCA 2CQOA 2UXDL 2WKDA 5ELDA 1DM0B 1J8IA 4DR5Q 2A6HD 4CJ2C 4HJ7A 3CPFA 3RLNA 4Z9CB 2I5MX 4R4QA 1TWFH 1UE6A 3MVVA 1LYLA 2F0VA 1PYSB 1VF7A 2FINB 2HCCA 4A3JH 3NBHA 3DWAA 4DR2L 4LF5Q 2KUMA 5IYDG 3W5OA 2NZ1D 1LLRD 2JN4A 1CSQA 4QGUA 2R6GA 2C35B 2ATWA 1PH5A 1NNXA 4DUYQ 2K28A 4DPGA 1B53A 1SJED 1WTVA 1I4QA 4IUQA 4JI8L 2MPMA 1O80A 1QE6A 3J81j 3PUZA 5A35A 2JA7H 3CCEA 4XQJA 2K01A 4EVOA 4FF2A 3CCVA 2ICEC 3GV6A 3OYYA 3R3OA 1XX8A 4WJ4A 1X3PA 2ZTEA 3HOWH 3DMUA 1UEAB 3S1NB 2A69D 5FLMH 4LF8Q 4GKKL 1WTRA 3E9HA 1PHJA 4PNYA 2JA5H 4LF9L 1EWIA 4A3CH 3GTJB 4OONA 5IWAL 1TU2B 1HNZQ 1QWYA 1N8RC 4A3FB 1SNOA 2QDBA 3HKSA 2JA5B 1SYDA 3PO2G 3GTLH 2QGQA 1RF2D 4EQPA 2FHTA 2A5HA 3IAYA 3J7YW 3S2DB 1HFGA 1V43A 4UP8A 4A3IH 1YHBA 5F2DA 4X64Q 4GNXC 3J7A5 3S17B 2B29A 5J3BA 2IT1A 3JC66 3NQIA 1C7YA 1VF5C 1X55A 2FMMA 2F3IA 3L2PA 3I8ZA 1TR5A 1NMFA 1K0SA 4QF4A 4UP9A 4V0BA 3G6JB 1H9KA 4JC0A 1I94L 5M3MH 2R92G 1ZXTA 2J7ZA 2AKWB 3WOEA 1FYCA 1EFWA 1BO0A 3OW2A 4A3LG 5IGGA 4JBKA 1PXUA 4HR7B 1LM0A 4JK1C 5DM73 5CYUA 4ME5A 2WKCA 2X6LA 2XN9C 2K75A 4KLKA 1TWHB 4DR4Q 2R93H 1TQOA 1PH1A 4JI6L 2IPKD 2R7DA 4LFCQ 1WTPA 3U4VA 5AFWA 4JI6Q 4JCVE 1TT2A 1TWHH 4HCEA 4YY3L 1I4GA 3HOXH 2KOLA 2BA1A 3I4LA 1MJCA 3BVZA 4BA1I 4GZYC 3KF8A 2OTLA 2BE5C 1S4ZA 1LTLA 2B2WC 1WI5A 3SHLA 3K81C 5KRUA 3J81E 3GO5A 3NEMA 5CR3A 1VQ9A 2CHBD 1VQCA 3KFUA 3BU2A 4BWGB 4GLXA 4A3IB 4F7XA 2EYPA 2DNCA 1U5KA 1E2WA 4YCWA 4JOIA 4RA8A 1XPUA 2WAQG 1A0IA 5K5PA 4A3LH 4QMGA 3E6ZX 4LFBL 1ET6A 3K58A 2KBNA 3HKZE 2R7ZB 4ZCKA 3GTLB 1S5CD 3MZ5A 3PSIA 3A0JA 1CKMA 2L15A 4LFCL 3CCQA 1A3VA 1HCZA 3PO3B 3GQBA 4ZLTF 2M9VA 3Q6SA 4FYDA 3A74A 3RLOA 3I90A 5G3LD 4N8X1 2ICIA 1VQFA 1X56A 5HGQA 3QOLA 3KK7A 4OIJA 3SXHA 5IP7H 4R8IA 1SYFA 3RN2A 2KVMA 3MAQA 2L1BA 1J5EQ 1H95A 5C3EB 1JOKA 2UUBQ 2VXWA 2A19A 1F2MA 4RWSC 4O0AA 1O78A 4DAYA 3R2IA 4E6IA 3ERQA 2R7ZH 3OTOQ 3PO2H 4IJLA 4X66L 4DUYL 1SDFA 5I6YA 2B2TA 4N9TA 5EKIA 3V96A 1HUMA 4FP5D 2VUMH 4FDBA 3R93A 1SMYC 1ZYRD 3FRPB 4Y7NB 4U68A 3A5UA 2K5VA 1UAPA 4DV7Q 2E76C 1K3BC 3BS1A 4G7HC 4DNTB 2YV5A 1F2LA 1A2UA 4A3JB 1SLJA 3TN2A 3SK6A 1SSOA 4JOIC 1KXLA 2LFNA 1RDPD 4ODGA 1VQEA 2XRQD 4L63B 1VQ6A 2V4DA 1L0YB 4DV1L 4X3SA 5T1GA 5IYBG 3I56A 1SFOH 3K0YA 5IYCG 2B2WA 4LF8L 2NVYH 4RHSA 4A3EB 4C3JG 3VYRA 1B44D 1HTLD 3BZKA 1K8OA 1VMPA 5EJWA 4C1NK 3K7AH 2IHFA 1MBYA 3QOJA 2E2HB 2XIWA 2F4IA 4YY3Q 1WCMH 4UY8C 4DR6Q 3SDZA 1STGA 2LXKA 2B2VC 4PZ7A 3KUPA 1BOSA 1BCPC 1HQMC 1Q46A 4DR6L 3S16H 4MTNA 1ENCA 5M3MB 2WACA 1VQPA 1E1TA 3TZUA 4K2LA 2EVBA 5JVH3 1TWAH 5C4ZA 4B3MQ 5CBEE 2PO4A 4RMFA 3LGJA 2WFWA
chains in the Genus database with same CATH topology
1EIGA 1DZ1A 5FO7B 3V05A 1D5XC 5CV4A 3EQLC 4I7ZC 2K1BA 4XQQA 3U9SA 1EY9A 2D62A 1G2TA 3K5MA 4H7BA 2JP1A 4KY7A 5JEAH 2NN6H 3BVGA 1AFPA 1EWHA 3I4NB 2NVQB 5EKLA 3K59A 1EY6A 3MTSA 4NW2A 4V190 3AB9A 3DEPA 1YNNC 3WDNA 1LO5D 1GJXA 3PV0A 4G57A 1I3QB 5CV8A 3A8KE 1B50A 1CZGA 1TKWB 4F8MA 2B8GA 1U9RA 3QG1A 1K83B 3HOZB 1JB3A 2Z4HA 3BDLA 1SYCA 4F88A 1C4QA 2HDMA 1OXSC 5EBDA 4M1UB 3SE0A 1JC7A 5IT9E 3A56A 4IALA 5JJZA 1HFNA 1TS3A 4K6DA 3GP7A 1TWFB 3C1FA 1WTWA 4XIGS 1U4LA 3K5LA 1ILPA 5IGDA 1ILQA 4DNRB 5M5XB 1CZWA 1WVLA 2B2UC 2F0EA 4AYBB 1K8MA 3HRZC 3SK8A 1I4RA 1B1ZA 5A2QL 5K36G 3L3OC 2R92B 1ENFA 1U4RA 1LV9A 2E75C 2F0UA 2KCNA 4RKBA 4QB4A 1PFNA 2F0LA 3CRLC 5M5WB 2L4NA 2BOSA 1TS5A 2EYLA 2JSOA 2MJ8A 1ZEQX 3QJYA 1G91A 1LTTD 4FO2A 2FFKB 1MI2A 1PTOH 2AWNA 1HTPA 3I72A 1PRTC 2A74C 2F3WA 3KBXA 1O7LA 1RKNA 5C0XG 4OO1H 1KDAA 2K03A 1ZYRC 1SBBB 1WTOA 2F1MA 1JQYD 4YIJA 4NP5A 3K6OA 2A68D 5E4WC 5FO9B 4X3TA 4ZAIA 5TSSA 5JPMC 2YU9B 2K5DA 3KLSX 1KAAA 1XTCD 3CKIB 3S1RB 1EU3A 4B9XA 4RHRA 1CHQD 4XQNA 5CV6A 4C3HG 3PUYA 3OMGA 3GV3A 3NE5B 1JWSD 5ELFA 1QNUA 2RA4A 1S5DD 3T53B 3CQZB 5JVG3 3RZOB 3V2TA 2L9HA 2Z8LA 2Z4IA 2BCOA 1DXMA 2MGSA 4C3HB 1X32A 3NSWA 4RGTA 1Q1EA 3HOVB 5KYIA 4DK1A 3H91A 2AQ1B 4K5VA 4G7OC 1NR2A 1QOHA 3JAML 2KHSA 1S5ED 3NBIA 1PTOB 1D2BA 1OXUA 1STEA 2F0FA 3AU7A 1PLFA 2QCPX 3NWSA 2F3VA 1RJTA 2HDLA 1MGSA 1PRTB 3NTKA 3PUXA 4C3JB 1WD1A 2JEAI 1Q90A 1BXTA 3TBIB 3FVQA 1QCBD 4FXGC 3RUZA 3H0GB 2EYMA 1Q12A 3H09A 3TP6A 2Y0SB 5DEHA 3ND9A 2X6GA 3DHQA 4TRDA 3FEWX 2K05A 2ENBA 3J81L 2EJGC 4C3IB 1F77A 4DK0A 1EY4A 5HURA 2F0MA 4B08A 1CFMA 4RGOS 2CVRA 3OIQA 2H4OA 5DM63 3MHBA 1JORA 1SE3A 1SAPA 1Q8IA 4ZRZA 3KLSA 4KD3A 3M4YA 3J7AF 4TQUS 4BY1B 4CJ0B 3SK4A 1IYUA 4EGVA 2F0PA 2R93B 2BA0A 3Q24A 3DM1A 3EJIA 2A6ED 4G7ZC 1ONLA 2EYFA 2M00A 5C3WA 2JEBI 4LMQD 3SVMA 1CQFA 2LMCB 3A55A 2JXMB 4N9PA 4RFBA 3QO2A 3MXUA 3KBGA 2TSSA 3JAME 5ELCA 3D8GA 4A93B 1AEXA 1PYWD 1LTID 2WP8J 1F9RA 4EQOA 2E2JB 1SJHD 4HEDA 2EXZA 2EYHA 5C4JB 4HMJA 5KIXA 1Z7TA 5C4HA 1BBXC 1LTRD 3T16A 3I91A 2BDOA 2F0NA 5C5MA 4NMZA 1PFBA 1TS4A 2NUCA 2NBFA 3FPPA 1NAPA 2RQXA 4KN4C 5EPJA 5KNBA 1I6HB 3U9OA 3E0JA 1WTXA 1RCVD 2NTTA 3IFTA 3QWNA 2ZXPA 2HQEA 3O13A 1QJOA 1KABA 3C46A 4K14A 5LHY1 1AN8A 4KD4A 1Q1BA 1II3A 2D9UA 5NUCA 1AP0A 2EY1A 4A3BB 2ZXOA 4J6HA 5JEAG 3DUZA 4RAUC 1STNA 3GTQB 1D1IA 3H6MA 1HUNA 3BVMA 3NQTA 1IKMA 1T5EA 2NVXB 2H1EA 4J1MA 5IGCA 1PZID 1SNCA 2F0QA 3URYA 2LY7A 1EZ6A 5JEAJ 1HQRD 2G9HD 1F9QA 5CV9A 4ZQ3A 4XTCS 1Q3LA 3BYTB 1VDZA 1SNPA 1EQVA 1DOKA 1VMCA 1TWAB 3RMHA 5C44B 4U673 1DCZA 3S16B 5A2QE 3FPUB 1ML0D 3PIP3 5KNDA 5D3DA 3RD4A 1FNUA 4OL7A 3C1EA 2K04A 2IWHA 1FNWA 1LT3D 1GUSA 1DOMA 1IHZA 4KKTA 4WFN3 1YNJC 1PRTF 3X3NA 3MFGA 1IL8A 1Y1WB 3TP7A 3R8BA 3NXWA 1C48A 2CW0D 1CT1D 4F87A 4HAEA 3LWUA 2WINB 5ELEA 4X3UA 3D4DA 1VCIA 5ISRA 1KNEA 3N6RA 1GUGA 2A6HC 3N52A 3SR1A 4Q5VA 5COYA 3OPOA 4HCSA 4DA2A 4A3GB 4DFAA 1Y69U 1PTOC 2EYJA 4OO1I 4ILWA 1E0BA 4KV6A 2KCCA 1IYVA 2L55A 1OXTA 1V8QA 4MN3A 1GUTA 1CQVA 3Q22A 3ZYYX 2RVLA 1V1PB 2PNRC 4QCLA 4K2KA 1V1PA 1AW7A 2JE6I 2OT2A 3P1HA 4R9WA 4CGYB 5C5LA 1CTMA 3OHXC 2NN6I 3CRKC 4IFDI 4DAPA 1Y8PB 5HGTA 1A3TA 2WB1B 1YNND 3S15B 3E5SA 2K5WA 1SYGA 3RZDB 3QB3A 3K5OA 3NTIA 4IQZA 3S1MB 4CHTB 3S2HB 2L11A 2BDNA 5J22A 3DWPA 3HOUB 1I4XA 5BN4A 2EPBA 1MSGA 1NSNS 2O2LD 4PV1C 2F0TA 3BDCA 3L9AX 5CMDA 2EOTA 2QILA 5DNFA 2RKSA 1EZ8A 4I65A 1ENAA 1NUCA 1SXTA 3BG3A 3W3AA 1V1OA 1H9RA 1BCPF 1KDCA 5DAUA 5EGTA 2RBMA 1JE4A 5IGFA 1EY8A 5KEEA 2DN8A 4UDUC 1G291 4IN3A 3T13A 5I6WA 3MA2B 2PYKA 2LS01 1A15A 1SEBD 2A69C 5D14A 5CORA 1S5BD 4FXKC 5FLXE 2NN6G 2IX0A 3L7ZC 5CC4A 5EPKA 1STHA 1HA6A 4IUVA 1ET9A 3HGBA 1ICWA 5KNCA 3VYUA 3D4WA 1JR0D 2FJ2A 3DWQA 2SNSA 4XDXA 1QILA 1NCVA 1G8ZD 1KLGD 1WCMB 1XWEA 5IIFA 3UI2A 3F2UA 3C2PA 2FMCA 3K57A 1EOTA 3P7JA 1LTAD 2DNEA 2RDGA 2TMPA 1SFOB 5CGKA 1OXVA 2RSOA 2RSNA 4J8QA 5IODA 4A3KB 1WD0A 3EFXD 1IKLA 3D6WA 1PDQA 1DJRD 1KDBA 3OSOA 3TZDA 3M3YB 4DU9A 1U4PA 2Q8RE 3TDQA 3I4MB 4BBSB 2KQ3A 1F9SA 3MWYW 1YNJD 4BA2I 3GTKB 2ID0A 1A3UA 2NWGA 1LABA 4MIUA 4ID6A 1F2ZA 3IFDA 5G3LF 1J9OA 4RCNA 2K7VA 3I70A 3MEHA 5ELBA 1LT4D 4QIWB 1PZJD 3AMUA 2OF1A 5E1FA 2BE5D 2CQAA 1R4PB 3D3RA 1EEFD 4KMUC 5C4XB 1B9NA 4CJ1B 3MXPA 3HOWB 1OXXK 2QEJC 2EZVA 2PW5A 5J1ZA 3VYSA 3SK5A 2I07B 2KA7A 1XXGA 5LL6S 4KY5A 1TWCB 2NTSA 2DY7A 2XVSA 1JWUD 1I4PA 4OO1G 3PUWA 1BNZA 1IW7C 2F0JA 3NTHA 1B2TA 1SNMA 4FXDA 4H13C 4KTAA 2J0TD 4HSVA 4XYOA 1SYEA 4KHZA 5E3FA 2NB0A 1HRJA 1GXDC 4KKUA 4KK7A 1GUOA 4LK1C 4ABNA 4FNFA 5FO8B 4FF3A 2DY8A 3A54A 3J7AV 4DN4M 3Q0AA 4KJNA 2B2TC 3CU7A 2XNAC 4KKSA 2F0OA 2WAQB 1RTNA 2EY5A 2K5QA 1EY5A 3GTPB 3MXNA 1BUVT 4K5XA 4NKLA 4IUPA 3HKZB 3OOCA 3A8IE 3P20A 3T51B 1EIHA 1CM9A 1TY0A 4ZUJA 2A6EC 2F0WA 2N55A 3GTGB 2F0HA 1RTOA 1BF4A 1RD9D 5FK9C 3TP5A 1H9SA 2NYZD 2AUJD 4ZKBB 5EQ0A 4K6LA 1SE4A 4BY7B 2HUGA 4C1NI 1ESFA 4K8IA 2RDFA 1WTQA 5M5YB 2SEBD 4QUCA 3VA7A 1TY2A 4HTHA 4HSPA 5EBCA 2KJXA 3A7AB 2R3ZA 3FKIB 1SNQA 2B39A 1HPCA 4C3IG 2C5CA 2PPBC 2XWBB 3HG9A 3M4OB 2JA7B 2VB3X 3MFYA 4IUNA 2AQ3B 4ZYSA 3HP3A 2L0CA 4IFDG 1LTBD 2B2UA 2K32A 4KI0A 1JCKB 3LX0A 5C0XJ 1U4MA 1D6EC 3BZDB 4O1NA 3I73A 4RGNA 4XT1B 4PMCA 2KEDA 1E2VA 1Y8OB 1I4HA 3EA6A 4CBVA 2D2CC 2PZWA 1D5MC 2Z1CA 2JYOA 4IFDH 1CA6A 2JA6B 1B9MA 4K5WA 1A6XA 1STAA 1CI3M 1HXYD 2A73B 5C3XA 1DYQA 2KECA 5KYLA 3D31A 1E2ZA 4X3KA 2OXPA 4IURA 5I4DA 3FDTA 1FR3A 1KLUD 2F03A 1RHPA 3GTMB 4BS9A 1PMRA 3PUVA 1TVXA 2Q8TA 2WV6D 2I46A 2IX1A 4XYQA 1T5XD 1FNVA 1F9PA 3MXGA 3EVQA 1NR4A 1LTSD 4HN7A 3ITPA 2CW0C 1D1KA 2F0IA 2PW7A 4WRDA 1BR9A 5BN5A 2IJ0A 3K7AB 5LL6X 1GHKA 4S3SA 1EEID 4ZUIA 5E4XA 1GOZA 4RKLA 1EFID 2ZT9C 1STYA 1JOOA 4OGQC 4M8AA 2XRSD 4EQNA 4OHJA 2MUYA 3TSSA 3M85A 2B2VA 2VB2X 1G2SA 2ZXRA 1PRTD 5FKAC 2K6AA 3HEJA 4B9WA 4G4KA 3VR2A 4PMBA 3KLRA 2N88A 1OO9B 5IGEA 1HA5A 1D5ZC 3A7LA 4RH6A 3K5NA 2EDGA 2F0DA 1H9MA 5JOBA 3VR3A 1LT5D 3NUCA 4XXEA 1Y1VB 4DF7A 2L12A 1PTOF 1FD7D 1TIID 1BCPB 3D4RA 3IKJA 1EYAA 1SMYD 3OIPA 4DXGA 4ZK9B 4LJZC 1MSHA 4FF4A 4LAAA 1GHJA 2F0SA 1KNAA 4JBWA 2IL8A 2JA8B 4HMIA 1LT6D 3C3LA 3VYTA 2GA4B 3VR4A 2VUMB 5FOBB 2PZUA 4CKBA 2K33A 2EJMA 1M8AA 5M9OA 4H44C 3T4AC 2EJFC 4C2MB 1RODA 4RGMA 2EYOA 3IL8A 2XWJB 4PQXA 4KHVA 1CK1A 5I2YA 1QG7A 1JOQA 2E2IB 2QF7A 1BCPD 5BN3A 1CHPD 3HOXB 3TP8A 5FLXL 3NHHA 1L0XB 4R8NA 1QB5D 3HOYB 2B8FA 4TSSA 3CHBD 3NWTA 1BQQT 2MP1A 1EQTA 3VA5A 3SEBA 3NP8A 1B4OA 1CA5A 1DOLA 5I9OA 5C6AA 5K36H 1UNSA 4WJWA 2Q8IB 2SDFA 1AZPA 4WORA 4NDXA 4P2CB 1XYIA 4FVMA 1W6JA 3DEOA 3EROA 1X3QA 1GUNA 2X69A 5EPLA 1M4VA 2EY2A 5CV5A 5EKKA 2E74C 1DONA 5T1IA 1O7ZA 3M7GA 2O5IC 1SYBA 2SOBA 2M2LA 3QIAA 5IGBA 4Q0FA 1I50B 2AWOA 1MD2D 5JPNC 3NPPA 2O5JC 3W2DA 1O7YA 1GUWA 1LTGD 1EWCA 1G6ZA 2C9OA 3Q23A 2VNUD 4BBRB 5KGUA 2EY6A 1JICA 1STBA 2YYZA 4O42A 3VR5A 5C0XH 3TMEA 1H9JA 3LNNA 4IUUA 3H94A 4OIKA 3R2TA 5IOCA 1ESRA 1UUPA 1LACA 2O4XA 4FF1A 4L6TB 1A2TA 3S9WA 3LWEA 4TKOB 2HCIA 1Z6HA 3OWFA 3BDOA 2F0GA 3S1QB 2NVYB 2AQ2B 3PMFA 1BDOA 4A3DB 3OW7A 4XT3B 1Z47A 2D5DA 1W6KA 3VR6A 1EU4A 4L8JA 4K8JA 1AZQA 4C56C 1SNDA 2PCFB 3G7LA 5M3FB 1EY0A 2IW3A 3HS0C 2SNMA 2LKVA 1FGBD 1F2YA 3M7NA 4KY6A 5D65A 3A8JE 1HHVA 3RLFA 4ZKCB 2PZTA 4DGZA 1SE2A 2IX3A 1KTKA 3WOFA 1B3AA 1S5FD 5J39A 3J80E 2B63B 3ND8A 2WIIB 2E2DC 1R9TB 3MC0B 1DD2A 2QKIC 4QUFA 3GTOB 1TS2A 1EL0A 1I6VC 4UAIA 1PFMA 5IT9L 1R4QB 2F0KA 3BYYB 3OMCA 2AUKA 4KJOA 1PTOD 2R61A 3DXJC 1IW7D 1H9SB 5I9PA 2B2YC 4PMWA 4CKEA 4RCOA 5JAVA 2L5TA 3J80L 3NK9A 3X3MA 4DAVA 3ONAB 3HZXA 4KN7C 2PMZB 5CBAE 3P75A 2B2YA 2MHVA 5D3IB 3D6CA 1JWMD 1QNKA 1ZKOA 1Y8NB 4IFDJ 2PQEA 3H3VC 2XSCA 3PO2B 2RDHA 1EYCA 4A3MB 2A68C 2NVTB 3PIO3 1C8CA 2OEOA 2EE1A 4IUTA 4IZ8A 1PZKD 1TWGB 2G9DA 5CV7A 4MHEA 3OWEB 1EYDA 5C0XI 3T56B 4H0LC 3I3CA 2KEEA 3FMCA 3GD7A 4ULLA 2J4XA 3S14B 5I2XA 4DXFA 1EY7A 4CKCA 2WKDA 5ELDA 1DM0B 1J8IA 2A6HD 4CJ2C 4Z9CB 3MVVA 2F0VA 1VF7A 2FINB 2HCCA 3NBHA 3DWAA 2KUMA 2NZ1D 1LLRD 2R6GA 2K28A 1B53A 1SJED 1WTVA 1I4QA 4IUQA 2MPMA 1O80A 1QE6A 3PUZA 5A35A 4XQJA 2K01A 4EVOA 4FF2A 2ICEC 3GV6A 3R3OA 1XX8A 1X3PA 3DMUA 1UEAB 3S1NB 2A69D 1WTRA 4PNYA 3GTJB 1TU2B 1QWYA 4A3FB 1SNOA 2QDBA 2JA5B 1SYDA 1RF2D 4EQPA 2FHTA 2A5HA 3IAYA 3J7YW 3S2DB 1HFGA 1V43A 5F2DA 3S17B 2IT1A 3NQIA 1VF5C 2FMMA 3I8ZA 1TR5A 4QF4A 4V0BA 3G6JB 1H9KA 1ZXTA 2J7ZA 3WOEA 1FYCA 1BO0A 5IGGA 1PXUA 4HR7B 5DM73 4JK1C 5CYUA 4ME5A 2WKCA 2X6LA 2XN9C 1TWHB 1TQOA 2IPKD 1WTPA 5AFWA 1TT2A 4HCEA 1I4GA 2KOLA 2BA1A 3I4LA 3BVZA 4BA1I 4GZYC 3KF8A 2BE5C 1S4ZA 2B2WC 3SHLA 5KRUA 3J81E 3GO5A 5CR3A 2CHBD 4BWGB 4A3IB 4F7XA 2EYPA 2DNCA 1E2WA 4RA8A 5K5PA 4QMGA 3E6ZX 1ET6A 3K58A 2R7ZB 3GTLB 1S5CD 3MZ5A 1A3VA 1HCZA 3PO3B 3GQBA 4ZLTF 2M9VA 3Q6SA 4FYDA 3I90A 5G3LD 2ICIA 3QOLA 3KK7A 4OIJA 3SXHA 4R8IA 1SYFA 2KVMA 3MAQA 2L1BA 5C3EB 1JOKA 2VXWA 1F2MA 4RWSC 1O78A 4DAYA 3R2IA 4E6IA 3ERQA 1SDFA 5I6YA 2B2TA 4N9TA 5EKIA 3V96A 1HUMA 4FP5D 3R93A 1SMYC 1ZYRD 3FRPB 4Y7NB 4U68A 1UAPA 2E76C 3BS1A 4G7HC 4DNTB 1F2LA 1A2UA 4A3JB 3TN2A 3SK6A 1SSOA 2LFNA 1RDPD 4ODGA 2XRQD 4L63B 2V4DA 1L0YB 4X3SA 5T1GA 3K0YA 2B2WA 4RHSA 4A3EB 4C3JG 3VYRA 1B44D 1HTLD 1K8OA 1VMPA 5EJWA 4C1NK 1MBYA 3QOJA 2E2HB 2XIWA 2F4IA 3SDZA 1STGA 2B2VC 1BOSA 1BCPC 1HQMC 3KUPA 1ENCA 5M3MB 2WACA 3TZUA 4K2LA 2EVBA 5JVH3 5C4ZA 5CBEE 2PO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FR3 A;  1BDO A;  1DXM A;  2A6E C;  3OW7 A;  1GUN A;  3MXU A;  1V43 A;  2E75 C;  2D5D A;  2A69 C;  4KMU C;  3EQL C;  4I7Z C;  3VR6 A;  4XTC S;  1Y69 U;  2E74 C;  4L8J A;  1Q1E A;  3U9S A;  1B9N A;  3D4R A;  2D62 A;  2NN6 G;  3T56 B;  3IKJ A;  1H9S A;  1VDZ A;  2IT1 A;  2PCF B;  1PMR A;  3L7Z C;  4H0L C;  4DK1 A;  2O5I C;  3PUV A;  1OXX K;  2AUJ D;  2KCC A;  3CRL C;  3FMC A;  1VF5 C;  3GD7 A;  2NN6 H;  3QIA A;  1O78 A;  5JEA H;  1IYV A;  1EWH A;  4G7O C;  3HGB A;  1OXT A;  1V8Q A;  2AWO A;  1H9K A;  3M7N A;  1GUT A;  5KNC A;  3QJY A;  1FYC A;  3AB9 A;  2O5J C;  2KA7 A;  2PNR C;  3A8J E;  1YNN C;  4LJZ C;  1Z7T A;  3RLF A;  2A6H D;  4HR7 B;  3WDN A;  1DCZ A;  4JK1 C;  1GHJ A;  1GJX A;  1OXU A;  2JE6 I;  1SMY C;  4JBW A;  3PV0 A;  3VA7 A;  2BDO A;  2CW0 C;  3A8K E;  1VF7 A;  4OO1 G;  1HTP A;  2E76 C;  3I72 A;  1TKW B;  3PUW A;  4G7H C;  3VR4 A;  4DNT B;  1CTM A;  3A7A B;  2B8G A;  3ND8 A;  5KND A;  3FPP A;  2NN6 I;  2K33 A;  4KN4 C;  3CRK C;  2EJM A;  3PUX A;  1O7L A;  3QG1 A;  5BN5 A;  1HPC A;  1Y8P B;  1GHK A;  2PPB C;  5C0X G;  5KNB A;  2JEA I;  4OO1 H;  1IW7 C;  2DNE A;  4H44 C;  1Q90 A;  2YYZ A;  2EJF C;  1OXV A;  2R6G A;  3VR5 A;  1GUS A;  1DD2 A;  5C0X H;  1ZYR C;  4H13 C;  2ZT9 C;  3MFY A;  1H9J A;  4KKT A;  2BA1 A;  2F1M A;  3I4L A;  1I6V C;  3LNN A;  1Q12 A;  3IFT A;  2V4D A;  1OXS C;  4BA1 I;  4IQZ A;  3SE0 A;  3PUZ A;  5A35 A;  3ND9 A;  4GZY C;  1YNJ C;  4IFD G;  4OGQ C;  3H94 A;  4KHZ A;  2A68 D;  1QJO A;  2AUK A;  2BE5 C;  4KKU A;  2K32 A;  1GUO A;  4KI0 A;  4LK1 C;  2EJG C;  3DXJ C;  1IW7 D;  2QF7 A;  5BN4 A;  4DK0 A;  1H9S B;  5BN3 A;  4PV1 C;  1K8O A;  1LAC A;  3M85 A;  1Q1B A;  2A69 D;  3I73 A;  1CFM A;  1E2V A;  1Y8O B;  5JEA G;  2B8F A;  2DNC A;  2L5T A;  1E2W A;  2D2C C;  4KN7 C;  3M4Y A;  4XIG S;  3SDZ A;  4BA2 I;  4IFD H;  3PUY A;  4TQU S;  4KKS A;  1TU2 B;  3VR2 A;  1IYU A;  1T5E A;  3LWU A;  3KLR A;  2BA0 A;  1HQM C;  3NE5 B;  3BG3 A;  1VCI A;  2A6E D;  3W3A A;  1H9R A;  1B9M A;  1LAB A;  4TKO B;  4G7Z C;  4DNR B;  5K36 H;  1Z6H A;  1A6X A;  3A7L A;  1ONL A;  3T53 B;  3N6R A;  1ZKO A;  2JEB I;  4RCN A;  1CI3 M;  2Q8I B;  1Y8N B;  2EDG A;  3TZU A;  2DN8 A;  1H9M A;  2K7V A;  1GUG A;  2A6H C;  1K8M A;  3OOC A;  3A8I E;  3BDO A;  1HCZ A;  2EVB A;  3P20 A;  1G29 1;  2LMC B;  3T51 B;  3VR3 A;  5K36 G;  3GQB A;  2JXM B;  3D31 A;  3OPO A;  2A68 C;  1E2Z A;  2BE5 D; 
#chains in the Genus database with same CATH topology
 1EIG A;  4B3M L;  1YHA A;  3M4O H;  4CDD C;  5FO7 B;  4BY1 G;  1DZ1 A;  3V05 A;  5JJK A;  1D5X C;  5CV4 A;  4JI8 Q;  2EIF A;  3EQL C;  4I7Z C;  2K1B A;  4XQQ A;  3TS0 A;  2OWO A;  3U9S A;  1EY9 A;  1UE1 A;  2D62 A;  4DV2 L;  4OXP A;  1SMX A;  3K5M A;  1G2T A;  4H7B A;  2JP1 A;  1QZG A;  4KY7 A;  5JEA H;  1IBL Q;  2NN6 H;  3BVG A;  2R92 H;  1AFP A;  1EWH A;  3I4N B;  2LSS A;  1D8L A;  4JI4 Q;  2NVQ B;  5EKL A;  3ZJY C;  3K59 A;  1EY6 A;  5M5Y H;  1IBM Q;  3MTS A;  4NW2 A;  4GKK Q;  4V19 0;  3AB9 A;  3J7Z C;  3DEP A;  1YNN C;  3RN5 A;  4DR4 L;  2HQL A;  4UP7 A;  3WDN A;  1LO5 D;  4DR3 Q;  1GJX A;  4BY7 H;  1WCM G;  3PV0 A;  1K28 A;  1I3Q B;  4G57 A;  5CV8 A;  1K9M C;  3A8K E;  1B50 A;  3GTQ H;  1CZG A;  1TKW B;  1K0R A;  4F8M A;  2B8G A;  1U9R A;  2IY5 B;  1I50 H;  3QG1 A;  4ME3 A;  1K83 B;  3HOZ B;  4OWX B;  2ZJR A;  1JB3 A;  2Z4H A;  3BDL A;  2CH4 A;  1SYC A;  3ERS X;  4F88 A;  1C4Q A;  2HDM A;  1OXS C;  5EBD A;  4M1U B;  3SE0 A;  1JC7 A;  5IT9 E;  3S15 H;  3M3Y H;  3A56 A;  1SRU A;  1EQR A;  4MTK A;  4IAL A;  5JJZ A;  4DUZ L;  1HFN A;  1N36 L;  1PYB A;  1YJN A;  4JI7 Q;  1TS3 A;  2R7F A;  1SN8 A;  1BBW A;  4K6D A;  4DV3 Q;  4AQY Q;  3GP7 A;  1TWF B;  3M9B A;  3TS2 A;  1X6O A;  3C1F A;  1WTW A;  4XIG S;  2UUC Q;  1U4L A;  3K5L A;  2Z6K C;  4LUZ A;  1VQA A;  1ILP A;  3UDG A;  5IGD A;  4JI0 Q;  4JBJ A;  4DV5 Q;  1O7I A;  1ILQ A;  2K50 A;  4DNR B;  3HOY H;  5M5X B;  1CZW A;  1WVL A;  4JI0 L;  2JA8 G;  2B2U C;  2F0E A;  4CDC C;  4AYB B;  5LMN W;  1K8M A;  1U0L A;  3I4M G;  3HRZ C;  3SK8 A;  1I4R A;  1B1Z A;  5A2Q L;  5K36 G;  1JE5 A;  2NVX H;  3L3O C;  1YIJ A;  1L0W A;  2R92 B;  1TWG H;  1ENF A;  1U4R A;  2PNH A;  2KHI A;  1FJG L;  1LV9 A;  2E75 C;  3FHW A;  4DV0 Q;  2F0U A;  4PZ8 A;  1PH8 A;  2KCN A;  2R7Z G;  4RKB A;  4QB4 A;  1PFN A;  2F0L A;  3UDI A;  2ZTD A;  3CRL C;  5M5W B;  2L4N A;  1PH2 A;  2BOS A;  5GAG C;  1TS5 A;  2EYL A;  2JSO A;  2MJ8 A;  3CP0 A;  2DGY A;  1ZEQ X;  3QJY A;  1G91 A;  1LTT D;  4DV3 L;  3HOZ H;  1TWC H;  4FO2 A;  2ES2 A;  2JA6 G;  1L1O C;  4R4C A;  2FFK B;  1MI2 A;  1PTO H;  2AWN A;  1HTP A;  3I72 A;  1PRT C;  4P73 A;  2A74 C;  2F3W A;  4JI1 Q;  3KBX A;  3H3V H;  1O7L A;  3CCU A;  3F2D A;  1RKN A;  3KJP A;  4BBS G;  5C4X H;  5C0X G;  4OO1 H;  1KDA A;  2K03 A;  3GTJ H;  2HT1 A;  2WB1 E;  3ICE A;  1KIX A;  4LF9 Q;  2VZA A;  1ZYR C;  4HJ5 A;  1SBB B;  3JAM i;  1WTO A;  2F1M A;  1N34 Q;  2Z9H A;  1JQY D;  4YIJ A;  4K0K L;  4NP5 A;  2QA4 A;  2Q2U A;  1KAW A;  4P71 A;  3K6O A;  3I55 A;  2A68 D;  5E4W C;  5FO9 B;  4X3T A;  3HOU G;  4ZAI A;  2CKZ B;  5TSS A;  1N33 Q;  3S2H H;  5JPM C;  2YU9 B;  3S1M H;  4QL5 A;  2K5D A;  3KLS X;  1KAA A;  1XTC D;  3CKI B;  3S1R B;  3RZD H;  2RCF A;  3CQZ H;  1Y1V G;  1EU3 A;  4B9X A;  4RHR A;  1CHQ D;  4A75 A;  3KYH C;  4XQN A;  5CV6 A;  4C3H G;  3PUY A;  1VQ8 A;  1IBK Q;  3OMG A;  1HNX Q;  3GV3 A;  3NE5 B;  3CMA A;  1JWS D;  4O2D A;  5ELF A;  4BBS H;  1QNU A;  2VS1 A;  2RA4 A;  1D7Q A;  1S5D D;  3T53 B;  2I5L X;  3CQZ B;  5JVG 3;  1JJG A;  3EBE A;  1BBU A;  3RZO B;  3V2T A;  2L9H A;  2Z8L A;  2ALY B;  3CXC A;  2HHH L;  2Z4I A;  4GN4 B;  4BY1 H;  2BCO A;  1Q82 C;  1DXM A;  2MGS A;  4AH6 A;  4C3H B;  1X32 A;  4LF6 Q;  3CF5 A;  3NSW A;  2KCT A;  4RGT A;  1Q1E A;  3HOV B;  5KYI A;  4DK1 A;  3H91 A;  1Y1V H;  2AQ1 B;  4K5V A;  4G7O C;  3KDF B;  1NR2 A;  1QOH A;  3JAM L;  3PO3 H;  2KHS A;  1K8A C;  1S5E D;  4NXM Q;  4A3G H;  3NBI A;  3H0G H;  1PTO B;  1D2B A;  3MEF A;  1OXU A;  4NXN Q;  1STE A;  2F0F A;  3AU7 A;  1OTC A;  4H02 A;  1PLF A;  4DV0 L;  2QCP X;  3NWS A;  2F3V A;  1HZA A;  4GLA C;  1RJT A;  1E1O A;  1HJP A;  1MGS A;  1PRT B;  2HDL A;  3NTK A;  3U4Z A;  3PUX A;  1MIU A;  4C3J B;  2KHJ A;  1WD1 A;  2JEA I;  4A3D G;  1Q90 A;  5LMU Q;  1BXT A;  3TBI B;  3FVQ A;  3PIO A;  4GLV B;  1QCB D;  4FXG C;  3RUZ A;  3H0G B;  1X65 A;  2I0Q A;  3PGZ A;  2EYM A;  2QW7 A;  4JI2 L;  1Q12 A;  3H09 A;  3TP6 A;  1QUQ A;  3F2B A;  2Y0S B;  5DEH A;  3ND9 A;  2X6G A;  3DHQ A;  3E3X A;  1WOC A;  4TRD A;  3FEW X;  2K05 A;  3AEV A;  2ENB A;  4DK6 C;  3J81 L;  2EJG C;  4C3I B;  1F77 A;  4DK0 A;  3H3V I;  4IO9 A;  1EY4 A;  5HUR A;  2F0M A;  4B08 A;  2D0P A;  1CFM A;  4RGO S;  2CVR A;  3OIQ A;  2H4O A;  5DM6 3;  1HR0 W;  3MHB A;  2JA7 G;  1JOR A;  1SE3 A;  1SAP A;  1Q8I A;  4RG1 A;  4ZRZ A;  3CCS A;  3KLS A;  4KD3 A;  3M4Y A;  1T9H A;  3J7A F;  4TQU S;  4BY1 B;  4CJ0 B;  1IYU A;  3SK4 A;  4EGV A;  2F0P A;  2R93 B;  2BA0 A;  3Q24 A;  3DM1 A;  3EJI A;  2A6E D;  4G7Z C;  4A76 A;  2B63 H;  1XNQ Q;  3G71 A;  1ONL A;  2EYF A;  2M00 A;  5C3W A;  1L1O B;  2JEB I;  4LMQ D;  3SVM A;  1VQO A;  3HOX G;  4LF5 L;  1B70 B;  1CQF A;  2YTY A;  2LMC B;  3A55 A;  2JXM B;  2UUA Q;  4N9P A;  4UPA A;  5AJ3 L;  4NXM L;  4RFB A;  5JJI A;  4BY7 G;  3I4M H;  3QO2 A;  2F4V Q;  3MXU A;  3KBG A;  2TSS A;  3JAM E;  1KL9 A;  4DV7 L;  5ELC A;  3UDF A;  1CKN A;  1VQM A;  3T1Y Q;  3D8G A;  4A93 B;  1AEX A;  1EYG A;  1PYW D;  1LTI D;  1K83 H;  2WP8 J;  1F9R A;  4EQO A;  5GAH C;  2E2J B;  1SJH D;  4HED A;  2EXZ A;  2EYH A;  5C4J B;  1B8A A;  4HMJ A;  4OWW B;  5KIX A;  1Z7T A;  5M5X H;  5C4H A;  1BBX C;  2N49 A;  3AFQ A;  4X62 L;  4OX9 Q;  1LTR D;  2OQK A;  3T16 A;  3I91 A;  2BDO A;  2F0N A;  5C5M A;  4NMZ A;  4DV5 L;  2MQH A;  1PFB A;  4OX9 L;  1TS4 A;  2NUC A;  1XNR L;  2NBF A;  3FPP A;  1NAP A;  2RQX A;  4KN4 C;  5EPJ A;  4DKA C;  1V1Q A;  5KNB A;  1I6H B;  3U9O A;  1HH2 P;  5IY0 A;  3E0J A;  2Y0S E;  1RCV D;  1WTX A;  1FL0 A;  2NTT A;  3IFT A;  1X3F A;  1EUJ A;  1HZ9 A;  3QWN A;  2ZXP A;  1N33 L;  2HQE A;  3O13 A;  1QJO A;  1IXR A;  1KAB A;  3C46 A;  4K14 A;  1GO3 E;  5LHY 1;  1W3S A;  2VW9 A;  2A8V A;  2E5L Q;  1AN8 A;  4KD4 A;  1Q1B A;  5GRO A;  5L37 A;  1II3 A;  2D9U A;  5NUC A;  1AP0 A;  2EY1 A;  4A3B B;  2ZXO A;  4L5T A;  3D0F A;  4J6H A;  5JEA G;  3DUZ A;  3UE0 A;  4RAU C;  2DJG C;  1STN A;  3GTQ B;  1D1I A;  3H6M A;  4JG2 A;  3BVM A;  3NQT A;  3J80 c;  1IKM A;  1HUN A;  1T5E A;  1I3Q H;  2NVX B;  1VQB A;  2H1E A;  3A5Z B;  4J1M A;  2UU9 L;  4P75 A;  1V9P A;  4JYA Q;  3T1H L;  5IGC A;  2KCM A;  1PZI D;  1SNC A;  1Q86 C;  3T1H Q;  4A3I G;  2JA6 H;  2F0Q A;  2K5H A;  3URY A;  3I4N H;  2LY7 A;  1EZ6 A;  1GM5 A;  4L5R C;  2VL6 A;  4CDF C;  5JEA J;  1HQR D;  2G9H D;  1F9Q A;  4OEM B;  5CV9 A;  3CC7 A;  4PG3 A;  4ZQ3 A;  4XTC S;  3TEH B;  4JV5 Q;  1Q3L A;  1YJW A;  3BYT B;  1VDZ A;  4GKJ L;  3RZO H;  1SNP A;  4L5S A;  1GKH A;  4GNX A;  1EQV A;  1DOK A;  1VMC A;  1TWA B;  5LMU L;  3EN2 A;  3RMH A;  5C44 B;  1PVO A;  4TVA B;  4U67 3;  4A3F G;  1DCZ A;  3S16 B;  3HOY G;  1S72 A;  3HOW G;  5A2Q E;  3FPU B;  2UU9 Q;  1ML0 D;  3PIP 3;  5KND A;  1GVP A;  5D3D A;  3RD4 A;  3GDE A;  1IBL L;  1FNU A;  1VQN A;  4UHV A;  4OL7 A;  2JA5 G;  3C1E A;  2K04 A;  2IWH A;  1FNW A;  1LT3 D;  1GUS A;  2ZTC A;  3F1Z A;  1DOM A;  3CPW A;  1IHZ A;  4KKT A;  1BVS A;  4WFN 3;  5IT9 c;  2PI2 A;  3S1Q H;  1YNJ C;  2VUM G;  4JV5 L;  1PRT F;  1SR3 A;  4POF A;  3X3N A;  3MFG A;  1CSP A;  1IL8 A;  1Y1W B;  3TP7 A;  3R8B A;  3AFP A;  3NXW A;  1C48 A;  2CW0 D;  1CT1 D;  4F87 A;  4JI5 Q;  3U58 A;  3KJO A;  4HAE A;  1VS0 A;  2JQO A;  3LWU A;  1PH7 A;  2WIN B;  5ELE A;  4X3U A;  3D4D A;  1VCI A;  1AH9 A;  4LFA Q;  5ISR A;  4AYB E;  1SE8 A;  1KNE A;  3N6R A;  4GN3 B;  4R1J A;  1GUG A;  2A6H C;  3N52 A;  3SR1 A;  4Q5V A;  1CKO A;  5IP9 H;  5COY A;  3OPO A;  2F4V L;  4HCS A;  4DA2 A;  4A3G B;  4DFA A;  1Y69 U;  1PTO C;  1VQJ A;  2EYJ A;  4DV1 Q;  2PQA A;  3H15 A;  4OO1 I;  2Z6B A;  5DLQ E;  2XTI A;  4GNX B;  4ILW A;  1E0B A;  4KV6 A;  2KCC A;  1IYV A;  2Q2I A;  3STB D;  1TXY A;  4LF7 Q;  2L55 A;  3CCL A;  4IPC A;  1OXT A;  1V8Q A;  4MN3 A;  1GUT A;  1CQV A;  3Q22 A;  3ZYY X;  3CCR A;  2GVA A;  1V1P B;  2PNR C;  2RVL A;  4QCL A;  4K2K A;  1V1P A;  1HNZ L;  4YWK A;  5C4J H;  1AW7 A;  4K0K Q;  2N8N A;  1DGS A;  2JE6 I;  1EIF A;  2OT2 A;  1X3G A;  4YWM A;  2HIX A;  2Q2H A;  3P1H A;  4R9W A;  4CGY B;  5C5L A;  1NBW A;  4A3M G;  1CTM A;  1A62 A;  3OHX C;  2NN6 I;  3CRK C;  4IFD I;  4DAP A;  1Y8P B;  5HGT A;  1A3T A;  2WB1 B;  1YNN D;  3PCO B;  4X66 Q;  3E5S A;  3S15 B;  2K5W A;  1SYG A;  3RZD B;  2Z0S A;  3QB3 A;  1N9W A;  5HY6 A;  3K5O A;  3NTI A;  4IQZ A;  3S1M B;  1SRO A;  4R4O A;  4CHT B;  3S2H B;  2L11 A;  2BDN A;  4JI3 L;  5J22 A;  3DWP A;  3AQQ A;  3HOU B;  4JYA L;  1I4X A;  4DR1 L;  5BN4 A;  2EPB A;  5C4X G;  1MSG A;  3DLL A;  1NSN S;  3HKZ G;  2O2L D;  4PV1 C;  1JMC A;  2F0T A;  3BDC A;  3CAM A;  2PI2 E;  3L9A X;  5CMD A;  1XMO L;  1MJE A;  2EOT A;  2QIL A;  2HHH Q;  2ZJP A;  5DNF A;  2RKS A;  1EZ8 A;  4I65 A;  1ENA A;  1XMO Q;  1NUC A;  1YIT A;  4KHP Q;  1YNX A;  1SXT A;  3KOJ A;  3BG3 A;  4GOP A;  3W3A A;  1V1O A;  1H9R A;  1BCP F;  1QVF A;  1WFQ A;  1KDC A;  5IE8 A;  4JW0 A;  5DAU A;  5EGT A;  2RBM A;  1JE4 A;  5IGF A;  1EY8 A;  5KEE A;  1IL2 A;  2DN8 A;  2P5Z X;  3I4N G;  4UDU C;  1G29 1;  4IN3 A;  3T13 A;  4A3C G;  2E2J H;  1FGU A;  5I6W A;  3MA2 B;  2PYK A;  4IOA A;  2LS0 1;  2CCZ A;  1A15 A;  1SEB D;  4YWL A;  1E22 A;  2A69 C;  5D14 A;  5COR A;  1S5B D;  4FXK C;  5FLX E;  2NN6 G;  2IX0 A;  3L7Z C;  3ULJ A;  1CKN B;  1Q8K A;  5CC4 A;  5EPK A;  3RR5 A;  1STH A;  1HA6 A;  1E3P A;  4IUV A;  1ET9 A;  3HGB A;  2ASB A;  2JA8 H;  1ICW A;  2OCE A;  5KNC A;  3K7U C;  3VYU A;  3D4W A;  1JR0 D;  1VQK A;  2FJ2 A;  3DWQ A;  5IP9 G;  5FLM G;  1JB7 A;  1KD1 C;  2K5N A;  2SNS A;  2E8G A;  4XDX A;  4DAY B;  1QIL A;  1NCV A;  4JI2 Q;  1G8Z D;  1KLG D;  1WCM B;  4DNI A;  4EX5 A;  3G4S A;  1PH6 A;  3QR8 A;  4KHP L;  1XWE A;  4DK3 C;  5IIF A;  1XJV A;  3UI2 A;  3F2U A;  4IJH A;  3C2P A;  2FMC A;  3K57 A;  1NJI C;  1EOT A;  3P7J A;  4OEL B;  1EOV A;  1LTA D;  4GS3 A;  2DNE A;  3S14 H;  5FJ8 G;  2N78 A;  2RDG A;  2TMP A;  1SFO B;  5CGK A;  1OXV A;  2RSO A;  4LWC A;  3KF6 A;  2RSN A;  4J8Q A;  5IOD A;  4A3K B;  1G6P A;  1WD0 A;  3EFX D;  1IKL A;  3D6W A;  1PDQ A;  2UUB L;  1DJR D;  1KDB A;  3OSO A;  3TZD A;  2NVT H;  3M3Y B;  4DU9 A;  1U4P A;  2DUD A;  2MO1 A;  2Q8R E;  3TDQ A;  2B3G A;  2D0O A;  3M4P A;  3I4M B;  4BBS B;  1Y1W G;  2KQ3 A;  1VQ4 A;  3SGI A;  1F9S A;  3MWY W;  1B7Y B;  1YNJ D;  4BA2 I;  4R4T A;  1UE5 A;  3GTK B;  2ID0 A;  2MFI A;  1A3U A;  2NWG A;  1LAB A;  4MIU A;  4ID6 A;  1F2Z A;  3IFD A;  5G3L F;  2QDL A;  1J9O A;  4RCN A;  2K7V A;  2HIV A;  3I70 A;  3MEH A;  5ELB A;  1LT4 D;  4QIW B;  1PZJ D;  3AMU A;  1HR0 L;  2OF1 A;  5E1F A;  4DV4 Q;  2BE5 D;  4AIM A;  2OQ0 A;  4A4I A;  1J6Q A;  1CUK A;  2CQA A;  1UWV A;  1R4P B;  3D3R A;  2UUC L;  1EEF D;  4KMU C;  2G5D A;  3IRB A;  5C4X B;  3VDY A;  1B9N A;  4CJ1 B;  3MXP A;  4WJ3 M;  3M4Q A;  3HOW B;  1B3Q A;  1PFS A;  1OXX K;  2QEJ C;  1MKH A;  2EZV A;  4N8F A;  4P72 A;  4OWT B;  5GAD C;  2PW5 A;  2VY3 A;  5J1Z A;  2JJQ A;  3VYS A;  3J81 c;  1VQ5 A;  3SK5 A;  2ZM6 L;  2I07 B;  2KA7 A;  3MXN B;  3PQI A;  1XXG A;  5LL6 S;  4C3J H;  4KY5 A;  3OTO L;  1TWC B;  2NTS A;  2DY7 A;  2KEN A;  2XVS A;  1JWU D;  1I4P A;  4HIM A;  5C3E G;  4OO1 G;  3PUW A;  4PZ6 A;  4R4I A;  4YCU A;  4QY7 A;  1BNZ A;  3GTM H;  1IW7 C;  2F0J A;  3NTH A;  1B2T A;  1PV4 A;  5JJL A;  2E2H H;  1SNM A;  4FXD A;  1I94 Q;  4H13 C;  3CW2 C;  4KTA A;  4A3K H;  1RL2 A;  2J0T D;  4HSV A;  4XYO A;  4A3E H;  1SYE A;  2YTV A;  4IPD A;  4KHZ A;  5E3F A;  2NB0 A;  4JBM A;  1GXD C;  1HRJ A;  3E9I A;  4KKU A;  4KK7 A;  1GUO A;  4LK1 C;  4ABN A;  3GTO H;  4JI4 L;  4FNF A;  5FO8 B;  4FF3 A;  2DY8 A;  1EIY B;  2CWP A;  1ICF B;  3A54 A;  3J7A V;  4QJF A;  4DN4 M;  3Q0A A;  4KJN A;  5FJ8 H;  2B2T C;  3CU7 A;  2XNA C;  1YJ9 A;  4KKS A;  2F0O A;  4X64 L;  2AHO B;  2WAQ B;  1RTN A;  3WWV A;  2EY5 A;  2K5Q A;  1EY5 A;  2OTJ A;  3GTP B;  3MXN A;  3HOV G;  1BUV T;  4K5X A;  4NKL A;  4IUP A;  3HKZ B;  1YVC A;  3OOC A;  3A8I E;  2E5L L;  3P20 A;  3T51 B;  4CDE C;  4A3K G;  1EIH A;  1CM9 A;  4P74 A;  5M5W H;  1TY0 A;  4ZUJ A;  2A6E C;  2F0W A;  2N55 A;  3JAM c;  3GTG B;  2F0H A;  1HZC A;  1IBK L;  2RCN A;  1RTO A;  2PQA B;  3W1G A;  1X9N A;  1RD9 D;  5FK9 C;  1G51 A;  3TP5 A;  1BF4 A;  1PH3 A;  2UXB Q;  2CFM A;  1H9S A;  3U50 C;  2NYZ D;  2AUJ D;  4JI7 L;  4ZKB B;  5EQ0 A;  1M1K C;  1Q81 C;  4K6L A;  1SE4 A;  1KHI A;  4BY7 B;  2HUG A;  4C1N I;  1ESF A;  4K8I A;  2RDF A;  1WTQ A;  1VQH A;  5M5Y B;  2SEB D;  4QUC A;  3VA7 A;  1WTH A;  1TY2 A;  4GOP B;  4HTH A;  4HSP A;  5EBC A;  4J15 A;  2KJX A;  2HD3 A;  3A7A B;  4ALP A;  2R3Z A;  3FKI B;  1SNQ A;  2B39 A;  1HPC A;  4C3I G;  1WYD A;  2C5C A;  1AE3 A;  2PPB C;  2XWB B;  3HG9 A;  3HOU H;  3M4O B;  2JA7 B;  2VB3 X;  4LUV A;  1HNX L;  3I2Z A;  3MFY A;  1VQI A;  4IUN A;  2AQ3 B;  4ZYS A;  2NZO A;  3TRZ A;  1QVG A;  3HP3 A;  2L0C A;  4IFD G;  4BBR G;  4DAM A;  1LTB D;  2B2U A;  2K32 A;  4KI0 A;  1JCK B;  3LX0 A;  4LF4 Q;  5C0X J;  1U4M A;  1YI2 A;  1D6E C;  3BZD B;  4O1N A;  1N32 L;  3GTP H;  3ER0 A;  3I73 A;  4RGN A;  1QVC A;  4XT1 B;  4JI1 L;  3KF8 B;  1YHQ A;  1YEZ A;  2Z6K A;  4PMC A;  2K52 A;  2KED A;  1E2V A;  3UE1 A;  1Y8O B;  1I4H A;  3EIV A;  1S40 A;  1E7Z A;  4HIO A;  1IBM L;  3EA6 A;  4CBV A;  1X3E A;  2D2C C;  2PZW A;  4LF6 L;  1D5M C;  2Z1C A;  2JYO A;  4IFD H;  4DR3 L;  1CA6 A;  2JA6 B;  2UXB L;  3F2C A;  3NBH B;  2QEX A;  1B9M A;  4K5W A;  4DV6 L;  1A6X A;  1STA A;  5M3M G;  1KRS A;  1CI3 M;  1HXY D;  2A73 B;  5C3X A;  1DYQ A;  2KEC A;  3H0G G;  5KYL A;  4EQ5 A;  2B63 G;  3D31 A;  1E2Z A;  4QIW E;  4X3K A;  4C3I H;  2OXP A;  4IUR A;  5I4D A;  2UXD Q;  1PH4 A;  3FDT A;  1FR3 A;  1KLU D;  1LUZ A;  2F03 A;  5BR8 Q;  1RHP A;  1NY4 A;  3GTM B;  4BS9 A;  4LFA L;  3BZC A;  1M90 C;  3ULL A;  4C2M H;  1PMR A;  3PUV A;  1AE2 A;  1TVX A;  1N32 Q;  2Q8T A;  2WV6 D;  2LXJ A;  2I46 A;  3G6E A;  2ZJQ A;  5AJ3 Q;  5ELN A;  2IX1 A;  4XYQ A;  1UEB A;  2IHE A;  1T5X D;  2BH8 A;  1FNV A;  1F9P A;  1S3O A;  3MXG A;  3EVQ A;  1YZ6 A;  1NR4 A;  1LTS D;  4HN7 A;  4X65 L;  3ITP A;  2CW0 C;  1D1K A;  4LFB Q;  2F0I A;  3ULP A;  2PW7 A;  4WRD A;  1Y1W H;  1BR9 A;  5BN5 A;  2IJ0 A;  3J81 i;  3CC2 A;  3TQY A;  3CD6 A;  4HJ8 A;  3K7A B;  5LL6 X;  1GHK A;  4S3S A;  1EEI D;  2RF4 A;  4ZUI A;  5E4X A;  4A3B G;  1GOZ A;  4RKL A;  1KC8 C;  2NVQ H;  1EFI D;  2ZT9 C;  3S24 A;  1C9O A;  4HJA A;  3K8A A;  3S1N H;  1STY A;  1JOO A;  3NEN A;  3DM3 A;  4C3H H;  4OGQ C;  4M8A A;  3J80 i;  2XRS D;  1J5E L;  4EQN A;  1KQS A;  1HNW Q;  3KLW A;  1HZB A;  4OHJ A;  1QUQ B;  4A93 H;  2MUY A;  5ELO A;  3TSS A;  1K73 C;  3M85 A;  2B2V A;  2VB2 X;  1G2S A;  4BXX H;  2ZXR A;  4A3G G;  1PRT D;  5FKA C;  2K6A A;  4YCV A;  3HEJ A;  1I5F A;  4B9W A;  1EQQ A;  4MNO A;  4G4K A;  5BR8 L;  2GVB A;  3G48 A;  1A8V A;  3VR2 A;  4PMB A;  3KLR A;  2N88 A;  1OO9 B;  3KDF A;  3Q8D A;  5IGE A;  3KF6 B;  1HA5 A;  2WAQ E;  2YTX A;  1D5Z C;  3A7L A;  4RH6 A;  5EAY A;  4B3R L;  3K5N A;  4IOC A;  2EDG A;  2F0D A;  1H9M A;  4B3S Q;  5JOB A;  3VR3 A;  1LT5 D;  3NUC A;  4XXE A;  1Y1V B;  4DF7 A;  2L12 A;  3I7F A;  2EQS A;  2RHQ B;  1PA6 A;  4A3D H;  4NPS A;  1PTO F;  5C3E H;  1FD7 D;  1TII D;  1BCP B;  5FLX c;  1XNR Q;  3D4R A;  3IKJ A;  1EYA A;  5GAE C;  1SMY D;  2UXC L;  3PF4 A;  2VQE L;  1K3R A;  3OIP A;  1Q7Y C;  4DXG A;  5LMN L;  2VQE Q;  1RIP A;  3AYH B;  5C44 G;  4ZK9 B;  4LJZ C;  1MSH A;  4FF4 A;  4LAA A;  1GHJ A;  2F0S A;  3B6Y A;  1KNA A;  4JBW A;  4JPB W;  2IL8 A;  2JA8 B;  1HNW L;  4HMI A;  1LT6 D;  3C3L A;  4Y7N H;  1X54 A;  3VYT A;  4DUZ Q;  2GA4 B;  3PIP A;  3GTK H;  3VR4 A;  2VUM B;  5FOB B;  2PZU A;  4CKB A;  2K33 A;  2EJM A;  4A3E G;  1M8A A;  5M9O A;  4B3S L;  4H44 C;  5IYC H;  3T4A C;  4AQY L;  2EJF C;  3L0O A;  4C2M B;  1ROD A;  4RGM A;  2EYO A;  3IL8 A;  2XWJ B;  4PQX A;  2GN5 A;  2MNA A;  4KHV A;  1N36 Q;  1CK1 A;  5I2Y A;  2JA9 A;  4JVZ A;  4DV6 Q;  1I6H H;  1QG7 A;  1JOQ A;  2E2I B;  2QF7 A;  1BCP D;  5BN3 A;  1CHP D;  3HOX B;  4A3J G;  3UDX A;  3TP8 A;  5FLX L;  1HR0 Q;  4BBR H;  5M3F G;  3NHH A;  1L0X B;  4R8N A;  4X6A H;  5LMN Q;  1QB5 D;  2PMZ E;  3HOY B;  2B8F A;  4Y52 H;  4IPG A;  4TSS A;  5IYD H;  1FJG Q;  1Y14 B;  1R9T H;  3CHB D;  3NWT A;  1BQQ T;  2MP1 A;  1EQT A;  3TRE A;  3VA5 A;  3SEB A;  3NP8 A;  1B4O A;  1CA5 A;  1DOL A;  5I9O A;  5C6A A;  5K36 H;  1MHW C;  4BXX G;  1C0A A;  1UNS A;  4WJW A;  2Q8I B;  2SDF A;  1WJJ A;  1AZP A;  4LW1 A;  4WOR A;  4NDX A;  4P2C B;  5GQO A;  1XYI A;  4FVM A;  1W6J A;  1W2B A;  3DEO A;  2ZM6 Q;  4NXN L;  3ERO A;  1X3Q A;  1GUN A;  2X69 A;  5EPL A;  1M4V A;  1YBY A;  3NEL A;  3S1R H;  2EY2 A;  5CV5 A;  3RNU A;  5EKK A;  2E74 C;  1DON A;  5T1I A;  1GD7 A;  5M3F H;  4DR1 Q;  1O7Z A;  3M7G A;  2CWA A;  2O5I C;  1SYB A;  1XMQ Q;  2SOB A;  2M2L A;  3QIA A;  5IGB A;  4Q0F A;  3T1Y L;  3FKI G;  1I50 B;  2AWO A;  1MD2 D;  5JPN C;  3NPP A;  2O5J C;  3W2D A;  1N34 L;  1O7Y A;  1GUW A;  1LTG D;  1EWC A;  1NTG A;  1G6Z A;  4POG A;  4LNQ A;  2C9O A;  3Q23 A;  1ASZ A;  2VNU D;  1JJ2 A;  1XNQ L;  1XTD A;  4BBR B;  3CCM A;  5KGU A;  2XGT A;  1BKB A;  4LF7 L;  2EY6 A;  2UXC Q;  3K80 C;  4YHH L;  1JIC A;  1STB A;  2YYZ A;  4O42 A;  3VR5 A;  5C0X H;  1VQL A;  3TME A;  3HFZ B;  4A3B H;  1H9J A;  4I7A A;  4DR7 Q;  3LNN A;  4HID A;  4IUU A;  4A93 G;  1A63 A;  2H5X A;  3GTG H;  2AMC B;  3H94 A;  4LUO A;  4OIK A;  3S17 H;  4NB3 A;  3BJU A;  3R2T A;  4JI3 Q;  2UUA L;  5IOC A;  1ESR A;  4AYB G;  1UUP A;  3S2D H;  4QQB X;  1LAC A;  2O4X A;  4FF1 A;  1UE7 A;  4L6T B;  3FKI H;  1A2T A;  5E7N A;  3PF5 A;  1JT8 A;  3S9W A;  5IYB H;  2RHS B;  3I4O A;  1JJC B;  3LWE A;  4B3R Q;  4APV A;  4TKO B;  2HCI A;  4X65 Q;  1Z6H A;  1VQG A;  4A3F H;  3CCJ A;  2DJF C;  2MO0 A;  3HOZ G;  3OWF A;  1XPO A;  3BDO A;  4HJ9 A;  2F0G A;  3S1Q B;  4IPH A;  2NVY B;  2AQ2 B;  3PMF A;  1BDO A;  1KRT A;  4JI5 L;  2BH2 A;  4A3D B;  3OW7 A;  2V1C C;  4DR7 L;  5IWA Q;  4XT3 B;  1P8L A;  1Z47 A;  2D5D A;  1W6K A;  3VR6 A;  1EU4 A;  4L8J A;  4K8J A;  2Q2T A;  1AZQ A;  4C56 C;  1SND A;  2PCF B;  2Y0S G;  3G7L A;  3F8T A;  5M3F B;  3PO3 G;  1EY0 A;  2IW3 A;  3FP9 A;  3HS0 C;  2SNM A;  2LKV A;  1FGB D;  3E0E A;  1F2Y A;  2VQF L;  3M7N A;  3CC4 A;  2K4K A;  1ASY A;  4A3M H;  4KY6 A;  5D65 A;  2R93 G;  3A8J E;  2N3S A;  1HHV A;  4GN5 A;  3RLF A;  4ZKC B;  5C44 H;  2PZT A;  4DGZ A;  1SE2 A;  2IX3 A;  1KTK A;  3WOF A;  1B3A A;  1S5F D;  5J39 A;  5IP7 G;  1IZ6 A;  3J80 E;  4DV2 Q;  1QZH A;  2B63 B;  2A1A A;  3ND8 A;  2WII B;  1PH9 A;  2YU9 H;  1FVI A;  1E24 A;  4GOP C;  2E2D C;  1XMQ L;  1R9T B;  2K14 A;  1VQD A;  3MC0 B;  1DD2 A;  2QKI C;  4QUF A;  3GTO B;  1TS2 A;  1EL0 A;  1I6V C;  4UAI A;  1PFM A;  5IT9 L;  4DR5 L;  1R4Q B;  2F0K A;  3BYY B;  4MZ9 A;  3OMC A;  2AUK A;  2E2I H;  4KJO A;  1PTO D;  2R61 A;  3DXJ C;  1IW7 D;  1H9S B;  1K8G A;  5I9P A;  2B2Y C;  4HIK A;  4DR2 Q;  4B3T Q;  4PMW A;  4CKE A;  4YHH Q;  4RCO A;  3W1B A;  5JAV A;  3CME A;  2L5T A;  3X3M A;  3NK9 A;  3J80 L;  4DAV A;  3ONA B;  4B3T L;  3HZX A;  2I5H A;  4KN7 C;  2PMZ B;  3STB C;  5CBA E;  3P75 A;  2B2Y A;  2MHV A;  5D3I B;  4GKJ Q;  1L2F A;  2CH4 W;  1NE3 A;  3D6C A;  1JWM D;  1Z9F A;  4LF4 L;  1QNK A;  3K0X A;  1ZKO A;  1Y8N B;  4IFD J;  2PQE A;  4L5Q A;  2VQF Q;  3H3V C;  2XSC A;  1XPR A;  3PO2 B;  2RDH A;  1EYC A;  4A3M B;  2A68 C;  2NVT B;  1L1O A;  2F52 A;  3PIO 3;  1C8C A;  1P16 A;  2OEO A;  1IYJ B;  2EE1 A;  4DV4 L;  4IUT A;  4IZ8 A;  1PZK D;  4X62 Q;  1TWG B;  2G9D A;  5CV7 A;  4MHE A;  5H1S E;  3OWE B;  1EYD A;  5C0X I;  3T56 B;  1VQ7 A;  4H0L C;  3I3C A;  2NZH A;  3HOV H;  2KEE A;  3FMC A;  3GD7 A;  4ULL A;  2FXQ A;  2J4X A;  3S14 B;  5I2X A;  1NMG A;  2JK8 A;  2WB1 G;  4DXF A;  1EY7 A;  2EXD A;  4CKC A;  2CQO A;  2UXD L;  2WKD A;  5ELD A;  1DM0 B;  1J8I A;  4DR5 Q;  2A6H D;  4CJ2 C;  4HJ7 A;  3CPF A;  3RLN A;  4Z9C B;  2I5M X;  4R4Q A;  1TWF H;  1UE6 A;  3MVV A;  1LYL A;  2F0V A;  1PYS B;  1VF7 A;  2FIN B;  2HCC A;  4A3J H;  3NBH A;  3DWA A;  4DR2 L;  4LF5 Q;  2KUM A;  5IYD G;  3W5O A;  2NZ1 D;  1LLR D;  2JN4 A;  1CSQ A;  4QGU A;  2R6G A;  2C35 B;  2ATW A;  1PH5 A;  1NNX A;  4DUY Q;  2K28 A;  4DPG A;  1B53 A;  1SJE D;  1WTV A;  1I4Q A;  4IUQ A;  4JI8 L;  2MPM A;  1O80 A;  1QE6 A;  3J81 j;  3PUZ A;  5A35 A;  2JA7 H;  3CCE A;  4XQJ A;  2K01 A;  4EVO A;  4FF2 A;  3CCV A;  2ICE C;  3GV6 A;  3OYY A;  3R3O A;  1XX8 A;  4WJ4 A;  1X3P A;  2ZTE A;  3HOW H;  3DMU A;  1UEA B;  3S1N B;  2A69 D;  5FLM H;  4LF8 Q;  4GKK L;  1WTR A;  3E9H A;  1PHJ A;  4PNY A;  2JA5 H;  4LF9 L;  1EWI A;  4A3C H;  3GTJ B;  4OON A;  5IWA L;  1TU2 B;  1HNZ Q;  1QWY A;  1N8R C;  4A3F B;  1SNO A;  2QDB A;  3HKS A;  2JA5 B;  1SYD A;  3PO2 G;  3GTL H;  2QGQ A;  1RF2 D;  4EQP A;  2FHT A;  2A5H A;  3IAY A;  3J7Y W;  3S2D B;  1HFG A;  1V43 A;  4UP8 A;  4A3I H;  1YHB A;  5F2D A;  4X64 Q;  4GNX C;  3J7A 5;  3S17 B;  2B29 A;  5J3B A;  2IT1 A;  3JC6 6;  3NQI A;  1C7Y A;  1VF5 C;  1X55 A;  2FMM A;  2F3I A;  3L2P A;  3I8Z A;  1TR5 A;  1NMF A;  1K0S A;  4QF4 A;  4UP9 A;  4V0B A;  3G6J B;  1H9K A;  4JC0 A;  1I94 L;  5M3M H;  2R92 G;  1ZXT A;  2J7Z A;  2AKW B;  3WOE A;  1FYC A;  1EFW A;  1BO0 A;  3OW2 A;  4A3L G;  5IGG A;  4JBK A;  1PXU A;  4HR7 B;  1LM0 A;  4JK1 C;  5DM7 3;  5CYU A;  4ME5 A;  2WKC A;  2X6L A;  2XN9 C;  2K75 A;  4KLK A;  1TWH B;  4DR4 Q;  2R93 H;  1TQO A;  1PH1 A;  4JI6 L;  2IPK D;  2R7D A;  4LFC Q;  1WTP A;  3U4V A;  5AFW A;  4JI6 Q;  4JCV E;  1TT2 A;  1TWH H;  4HCE A;  4YY3 L;  1I4G A;  3HOX H;  2KOL A;  2BA1 A;  3I4L A;  1MJC A;  3BVZ A;  4BA1 I;  4GZY C;  3KF8 A;  2OTL A;  2BE5 C;  1S4Z A;  1LTL A;  2B2W C;  1WI5 A;  3SHL A;  3K81 C;  5KRU A;  3J81 E;  3GO5 A;  3NEM A;  5CR3 A;  1VQ9 A;  2CHB D;  1VQC A;  3KFU A;  3BU2 A;  4BWG B;  4GLX A;  4A3I B;  4F7X A;  2EYP A;  2DNC A;  1U5K A;  1E2W A;  4YCW A;  4JOI A;  4RA8 A;  1XPU A;  2WAQ G;  1A0I A;  5K5P A;  4A3L H;  4QMG A;  3E6Z X;  4LFB L;  1ET6 A;  3K58 A;  2KBN A;  3HKZ E;  2R7Z B;  4ZCK A;  3GTL B;  1S5C D;  3MZ5 A;  3PSI A;  3A0J A;  1CKM A;  2L15 A;  4LFC L;  3CCQ A;  1A3V A;  1HCZ A;  3PO3 B;  3GQB A;  4ZLT F;  2M9V A;  3Q6S A;  4FYD A;  3A74 A;  3RLO A;  3I90 A;  5G3L D;  4N8X 1;  2ICI A;  1VQF A;  1X56 A;  5HGQ A;  3QOL A;  3KK7 A;  4OIJ A;  3SXH A;  5IP7 H;  4R8I A;  1SYF A;  3RN2 A;  2KVM A;  3MAQ A;  2L1B A;  1J5E Q;  1H95 A;  5C3E B;  1JOK A;  2UUB Q;  2VXW A;  2A19 A;  1F2M A;  4RWS C;  4O0A A;  1O78 A;  4DAY A;  3R2I A;  4E6I A;  3ERQ A;  2R7Z H;  3OTO Q;  3PO2 H;  4IJL A;  4X66 L;  4DUY L;  1SDF A;  5I6Y A;  2B2T A;  4N9T A;  5EKI A;  3V96 A;  1HUM A;  4FP5 D;  2VUM H;  4FDB A;  3R93 A;  1SMY C;  1ZYR D;  3FRP B;  4Y7N B;  4U68 A;  3A5U A;  2K5V A;  1UAP A;  4DV7 Q;  2E76 C;  1K3B C;  3BS1 A;  4G7H C;  4DNT B;  2YV5 A;  1F2L A;  1A2U A;  4A3J B;  1SLJ A;  3TN2 A;  3SK6 A;  1SSO A;  4JOI C;  1KXL A;  2LFN A;  1RDP D;  4ODG A;  1VQE A;  2XRQ D;  4L63 B;  1VQ6 A;  2V4D A;  1L0Y B;  4DV1 L;  4X3S A;  5T1G A;  5IYB G;  3I56 A;  1SFO H;  3K0Y A;  5IYC G;  2B2W A;  4LF8 L;  2NVY H;  4RHS A;  4A3E B;  4C3J G;  3VYR A;  1B44 D;  1HTL D;  3BZK A;  1K8O A;  1VMP A;  5EJW A;  4C1N K;  3K7A H;  2IHF A;  1MBY A;  3QOJ A;  2E2H B;  2XIW A;  2F4I A;  4YY3 Q;  1WCM H;  4UY8 C;  4DR6 Q;  3SDZ A;  1STG A;  2LXK A;  2B2V C;  4PZ7 A;  3KUP A;  1BOS A;  1BCP C;  1HQM C;  1Q46 A;  4DR6 L;  3S16 H;  4MTN A;  1ENC A;  5M3M B;  2WAC A;  1VQP A;  1E1T A;  3TZU A;  4K2L A;  2EVB A;  5JVH 3;  1TWA H;  5C4Z A;  4B3M Q;  5CBE E;  2PO4 A;  4RMF A;  3LGJ A;  2WFW A; 
#chains in the Genus database with same CATH homology
 1EIG A;  1DZ1 A;  5FO7 B;  3V05 A;  1D5X C;  5CV4 A;  3EQL C;  4I7Z C;  2K1B A;  4XQQ A;  3U9S A;  1EY9 A;  2D62 A;  1G2T A;  3K5M A;  4H7B A;  2JP1 A;  4KY7 A;  5JEA H;  2NN6 H;  3BVG A;  1AFP A;  1EWH A;  3I4N B;  2NVQ B;  5EKL A;  3K59 A;  1EY6 A;  3MTS A;  4NW2 A;  4V19 0;  3AB9 A;  3DEP A;  1YNN C;  3WDN A;  1LO5 D;  1GJX A;  3PV0 A;  4G57 A;  1I3Q B;  5CV8 A;  3A8K E;  1B50 A;  1CZG A;  1TKW B;  4F8M A;  2B8G A;  1U9R A;  3QG1 A;  1K83 B;  3HOZ B;  1JB3 A;  2Z4H A;  3BDL A;  1SYC A;  4F88 A;  1C4Q A;  2HDM A;  1OXS C;  5EBD A;  4M1U B;  3SE0 A;  1JC7 A;  5IT9 E;  3A56 A;  4IAL A;  5JJZ A;  1HFN A;  1TS3 A;  4K6D A;  3GP7 A;  1TWF B;  3C1F A;  1WTW A;  4XIG S;  1U4L A;  3K5L A;  1ILP A;  5IGD A;  1ILQ A;  4DNR B;  5M5X B;  1CZW A;  1WVL A;  2B2U C;  2F0E A;  4AYB B;  1K8M A;  3HRZ C;  3SK8 A;  1I4R A;  1B1Z A;  5A2Q L;  5K36 G;  3L3O C;  2R92 B;  1ENF A;  1U4R A;  1LV9 A;  2E75 C;  2F0U A;  2KCN A;  4RKB A;  4QB4 A;  1PFN A;  2F0L A;  3CRL C;  5M5W B;  2L4N A;  2BOS A;  1TS5 A;  2EYL A;  2JSO A;  2MJ8 A;  1ZEQ X;  3QJY A;  1G91 A;  1LTT D;  4FO2 A;  2FFK B;  1MI2 A;  1PTO H;  2AWN A;  1HTP A;  3I72 A;  1PRT C;  2A74 C;  2F3W A;  3KBX A;  1O7L A;  1RKN A;  5C0X G;  4OO1 H;  1KDA A;  2K03 A;  1ZYR C;  1SBB B;  1WTO A;  2F1M A;  1JQY D;  4YIJ A;  4NP5 A;  3K6O A;  2A68 D;  5E4W C;  5FO9 B;  4X3T A;  4ZAI A;  5TSS A;  5JPM C;  2YU9 B;  2K5D A;  3KLS X;  1KAA A;  1XTC D;  3CKI B;  3S1R B;  1EU3 A;  4B9X A;  4RHR A;  1CHQ D;  4XQN A;  5CV6 A;  4C3H G;  3PUY A;  3OMG A;  3GV3 A;  3NE5 B;  1JWS D;  5ELF A;  1QNU A;  2RA4 A;  1S5D D;  3T53 B;  3CQZ B;  5JVG 3;  3RZO B;  3V2T A;  2L9H A;  2Z8L A;  2Z4I A;  2BCO A;  1DXM A;  2MGS A;  4C3H B;  1X32 A;  3NSW A;  4RGT A;  1Q1E A;  3HOV B;  5KYI A;  4DK1 A;  3H91 A;  2AQ1 B;  4K5V A;  4G7O C;  1NR2 A;  1QOH A;  3JAM L;  2KHS A;  1S5E D;  3NBI A;  1PTO B;  1D2B A;  1OXU A;  1STE A;  2F0F A;  3AU7 A;  1PLF A;  2QCP X;  3NWS A;  2F3V A;  1RJT A;  2HDL A;  1MGS A;  1PRT B;  3NTK A;  3PUX A;  4C3J B;  1WD1 A;  2JEA I;  1Q90 A;  1BXT A;  3TBI B;  3FVQ A;  1QCB D;  4FXG C;  3RUZ A;  3H0G B;  2EYM A;  1Q12 A;  3H09 A;  3TP6 A;  2Y0S B;  5DEH A;  3ND9 A;  2X6G A;  3DHQ A;  4TRD A;  3FEW X;  2K05 A;  2ENB A;  3J81 L;  2EJG C;  4C3I B;  1F77 A;  4DK0 A;  1EY4 A;  5HUR A;  2F0M A;  4B08 A;  1CFM A;  4RGO S;  2CVR A;  3OIQ A;  2H4O A;  5DM6 3;  3MHB A;  1JOR A;  1SE3 A;  1SAP A;  1Q8I A;  4ZRZ A;  3KLS A;  4KD3 A;  3M4Y A;  3J7A F;  4TQU S;  4BY1 B;  4CJ0 B;  3SK4 A;  1IYU A;  4EGV A;  2F0P A;  2R93 B;  2BA0 A;  3Q24 A;  3DM1 A;  3EJI A;  2A6E D;  4G7Z C;  1ONL A;  2EYF A;  2M00 A;  5C3W A;  2JEB I;  4LMQ D;  3SVM A;  1CQF A;  2LMC B;  3A55 A;  2JXM B;  4N9P A;  4RFB A;  3QO2 A;  3MXU A;  3KBG A;  2TSS A;  3JAM E;  5ELC A;  3D8G A;  4A93 B;  1AEX A;  1PYW D;  1LTI D;  2WP8 J;  1F9R A;  4EQO A;  2E2J B;  1SJH D;  4HED A;  2EXZ A;  2EYH A;  5C4J B;  4HMJ A;  5KIX A;  1Z7T A;  5C4H A;  1BBX C;  1LTR D;  3T16 A;  3I91 A;  2BDO A;  2F0N A;  5C5M A;  4NMZ A;  1PFB A;  1TS4 A;  2NUC A;  2NBF A;  3FPP A;  1NAP A;  2RQX A;  4KN4 C;  5EPJ A;  5KNB A;  1I6H B;  3U9O A;  3E0J A;  1WTX A;  1RCV D;  2NTT A;  3IFT A;  3QWN A;  2ZXP A;  2HQE A;  3O13 A;  1QJO A;  1KAB A;  3C46 A;  4K14 A;  5LHY 1;  1AN8 A;  4KD4 A;  1Q1B A;  1II3 A;  2D9U A;  5NUC A;  1AP0 A;  2EY1 A;  4A3B B;  2ZXO A;  4J6H A;  5JEA G;  3DUZ A;  4RAU C;  1STN A;  3GTQ B;  1D1I A;  3H6M A;  1HUN A;  3BVM A;  3NQT A;  1IKM A;  1T5E A;  2NVX B;  2H1E A;  4J1M A;  5IGC A;  1PZI D;  1SNC A;  2F0Q A;  3URY A;  2LY7 A;  1EZ6 A;  5JEA J;  1HQR D;  2G9H D;  1F9Q A;  5CV9 A;  4ZQ3 A;  4XTC S;  1Q3L A;  3BYT B;  1VDZ A;  1SNP A;  1EQV A;  1DOK A;  1VMC A;  1TWA B;  3RMH A;  5C44 B;  4U67 3;  1DCZ A;  3S16 B;  5A2Q E;  3FPU B;  1ML0 D;  3PIP 3;  5KND A;  5D3D A;  3RD4 A;  1FNU A;  4OL7 A;  3C1E A;  2K04 A;  2IWH A;  1FNW A;  1LT3 D;  1GUS A;  1DOM A;  1IHZ A;  4KKT A;  4WFN 3;  1YNJ C;  1PRT F;  3X3N A;  3MFG A;  1IL8 A;  1Y1W B;  3TP7 A;  3R8B A;  3NXW A;  1C48 A;  2CW0 D;  1CT1 D;  4F87 A;  4HAE A;  3LWU A;  2WIN B;  5ELE A;  4X3U A;  3D4D A;  1VCI A;  5ISR A;  1KNE A;  3N6R A;  1GUG A;  2A6H C;  3N52 A;  3SR1 A;  4Q5V A;  5COY A;  3OPO A;  4HCS A;  4DA2 A;  4A3G B;  4DFA A;  1Y69 U;  1PTO C;  2EYJ A;  4OO1 I;  4ILW A;  1E0B A;  4KV6 A;  2KCC A;  1IYV A;  2L55 A;  1OXT A;  1V8Q A;  4MN3 A;  1GUT A;  1CQV A;  3Q22 A;  3ZYY X;  2RVL A;  1V1P B;  2PNR C;  4QCL A;  4K2K A;  1V1P A;  1AW7 A;  2JE6 I;  2OT2 A;  3P1H A;  4R9W A;  4CGY B;  5C5L A;  1CTM A;  3OHX C;  2NN6 I;  3CRK C;  4IFD I;  4DAP A;  1Y8P B;  5HGT A;  1A3T A;  2WB1 B;  1YNN D;  3S15 B;  3E5S A;  2K5W A;  1SYG A;  3RZD B;  3QB3 A;  3K5O A;  3NTI A;  4IQZ A;  3S1M B;  4CHT B;  3S2H B;  2L11 A;  2BDN A;  5J22 A;  3DWP A;  3HOU B;  1I4X A;  5BN4 A;  2EPB A;  1MSG A;  1NSN S;  2O2L D;  4PV1 C;  2F0T A;  3BDC A;  3L9A X;  5CMD A;  2EOT A;  2QIL A;  5DNF A;  2RKS A;  1EZ8 A;  4I65 A;  1ENA A;  1NUC A;  1SXT A;  3BG3 A;  3W3A A;  1V1O A;  1H9R A;  1BCP F;  1KDC A;  5DAU A;  5EGT A;  2RBM A;  1JE4 A;  5IGF A;  1EY8 A;  5KEE A;  2DN8 A;  4UDU C;  1G29 1;  4IN3 A;  3T13 A;  5I6W A;  3MA2 B;  2PYK A;  2LS0 1;  1A15 A;  1SEB D;  2A69 C;  5D14 A;  5COR A;  1S5B D;  4FXK C;  5FLX E;  2NN6 G;  2IX0 A;  3L7Z C;  5CC4 A;  5EPK A;  1STH A;  1HA6 A;  4IUV A;  1ET9 A;  3HGB A;  1ICW A;  5KNC A;  3VYU A;  3D4W A;  1JR0 D;  2FJ2 A;  3DWQ A;  2SNS A;  4XDX A;  1QIL A;  1NCV A;  1G8Z D;  1KLG D;  1WCM B;  1XWE A;  5IIF A;  3UI2 A;  3F2U A;  3C2P A;  2FMC A;  3K57 A;  1EOT A;  3P7J A;  1LTA D;  2DNE A;  2RDG A;  2TMP A;  1SFO B;  5CGK A;  1OXV A;  2RSO A;  2RSN A;  4J8Q A;  5IOD A;  4A3K B;  1WD0 A;  3EFX D;  1IKL A;  3D6W A;  1PDQ A;  1DJR D;  1KDB A;  3OSO A;  3TZD A;  3M3Y B;  4DU9 A;  1U4P A;  2Q8R E;  3TDQ A;  3I4M B;  4BBS B;  2KQ3 A;  1F9S A;  3MWY W;  1YNJ D;  4BA2 I;  3GTK B;  2ID0 A;  1A3U A;  2NWG A;  1LAB A;  4MIU A;  4ID6 A;  1F2Z A;  3IFD A;  5G3L F;  1J9O A;  4RCN A;  2K7V A;  3I70 A;  3MEH A;  5ELB A;  1LT4 D;  4QIW B;  1PZJ D;  3AMU A;  2OF1 A;  5E1F A;  2BE5 D;  2CQA A;  1R4P B;  3D3R A;  1EEF D;  4KMU C;  5C4X B;  1B9N A;  4CJ1 B;  3MXP A;  3HOW B;  1OXX K;  2QEJ C;  2EZV A;  2PW5 A;  5J1Z A;  3VYS A;  3SK5 A;  2I07 B;  2KA7 A;  1XXG A;  5LL6 S;  4KY5 A;  1TWC B;  2NTS A;  2DY7 A;  2XVS A;  1JWU D;  1I4P A;  4OO1 G;  3PUW A;  1BNZ A;  1IW7 C;  2F0J A;  3NTH A;  1B2T A;  1SNM A;  4FXD A;  4H13 C;  4KTA A;  2J0T D;  4HSV A;  4XYO A;  1SYE A;  4KHZ A;  5E3F A;  2NB0 A;  1HRJ A;  1GXD C;  4KKU A;  4KK7 A;  1GUO A;  4LK1 C;  4ABN A;  4FNF A;  5FO8 B;  4FF3 A;  2DY8 A;  3A54 A;  3J7A V;  4DN4 M;  3Q0A A;  4KJN A;  2B2T C;  3CU7 A;  2XNA C;  4KKS A;  2F0O A;  2WAQ B;  1RTN A;  2EY5 A;  2K5Q A;  1EY5 A;  3GTP B;  3MXN A;  1BUV T;  4K5X A;  4NKL A;  4IUP A;  3HKZ B;  3OOC A;  3A8I E;  3P20 A;  3T51 B;  1EIH A;  1CM9 A;  1TY0 A;  4ZUJ A;  2A6E C;  2F0W A;  2N55 A;  3GTG B;  2F0H A;  1RTO A;  1BF4 A;  1RD9 D;  5FK9 C;  3TP5 A;  1H9S A;  2NYZ D;  2AUJ D;  4ZKB B;  5EQ0 A;  4K6L A;  1SE4 A;  4BY7 B;  2HUG A;  4C1N I;  1ESF A;  4K8I A;  2RDF A;  1WTQ A;  5M5Y B;  2SEB D;  4QUC A;  3VA7 A;  1TY2 A;  4HTH A;  4HSP A;  5EBC A;  2KJX A;  3A7A B;  2R3Z A;  3FKI B;  1SNQ A;  2B39 A;  1HPC A;  4C3I G;  2C5C A;  2PPB C;  2XWB B;  3HG9 A;  3M4O B;  2JA7 B;  2VB3 X;  3MFY A;  4IUN A;  2AQ3 B;  4ZYS A;  3HP3 A;  2L0C A;  4IFD G;  1LTB D;  2B2U A;  2K32 A;  4KI0 A;  1JCK B;  3LX0 A;  5C0X J;  1U4M A;  1D6E C;  3BZD B;  4O1N A;  3I73 A;  4RGN A;  4XT1 B;  4PMC A;  2KED A;  1E2V A;  1Y8O B;  1I4H A;  3EA6 A;  4CBV A;  2D2C C;  2PZW A;  1D5M C;  2Z1C A;  2JYO A;  4IFD H;  1CA6 A;  2JA6 B;  1B9M A;  4K5W A;  1A6X A;  1STA A;  1CI3 M;  1HXY D;  2A73 B;  5C3X A;  1DYQ A;  2KEC A;  5KYL A;  3D31 A;  1E2Z A;  4X3K A;  2OXP A;  4IUR A;  5I4D A;  3FDT A;  1FR3 A;  1KLU D;  2F03 A;  1RHP A;  3GTM B;  4BS9 A;  1PMR A;  3PUV A;  1TVX A;  2Q8T A;  2WV6 D;  2I46 A;  2IX1 A;  4XYQ A;  1T5X D;  1FNV A;  1F9P A;  3MXG A;  3EVQ A;  1NR4 A;  1LTS D;  4HN7 A;  3ITP A;  2CW0 C;  1D1K A;  2F0I A;  2PW7 A;  4WRD A;  1BR9 A;  5BN5 A;  2IJ0 A;  3K7A B;  5LL6 X;  1GHK A;  4S3S A;  1EEI D;  4ZUI A;  5E4X A;  1GOZ A;  4RKL A;  1EFI D;  2ZT9 C;  1STY A;  1JOO A;  4OGQ C;  4M8A A;  2XRS D;  4EQN A;  4OHJ A;  2MUY A;  3TSS A;  3M85 A;  2B2V A;  2VB2 X;  1G2S A;  2ZXR A;  1PRT D;  5FKA C;  2K6A A;  3HEJ A;  4B9W A;  4G4K A;  3VR2 A;  4PMB A;  3KLR A;  2N88 A;  1OO9 B;  5IGE A;  1HA5 A;  1D5Z C;  3A7L A;  4RH6 A;  3K5N A;  2EDG A;  2F0D A;  1H9M A;  5JOB A;  3VR3 A;  1LT5 D;  3NUC A;  4XXE A;  1Y1V B;  4DF7 A;  2L12 A;  1PTO F;  1FD7 D;  1TII D;  1BCP B;  3D4R A;  3IKJ A;  1EYA A;  1SMY D;  3OIP A;  4DXG A;  4ZK9 B;  4LJZ C;  1MSH A;  4FF4 A;  4LAA A;  1GHJ A;  2F0S A;  1KNA A;  4JBW A;  2IL8 A;  2JA8 B;  4HMI A;  1LT6 D;  3C3L A;  3VYT A;  2GA4 B;  3VR4 A;  2VUM B;  5FOB B;  2PZU A;  4CKB A;  2K33 A;  2EJM A;  1M8A A;  5M9O A;  4H44 C;  3T4A C;  2EJF C;  4C2M B;  1ROD A;  4RGM A;  2EYO A;  3IL8 A;  2XWJ B;  4PQX A;  4KHV A;  1CK1 A;  5I2Y A;  1QG7 A;  1JOQ A;  2E2I B;  2QF7 A;  1BCP D;  5BN3 A;  1CHP D;  3HOX B;  3TP8 A;  5FLX L;  3NHH A;  1L0X B;  4R8N A;  1QB5 D;  3HOY B;  2B8F A;  4TSS A;  3CHB D;  3NWT A;  1BQQ T;  2MP1 A;  1EQT A;  3VA5 A;  3SEB A;  3NP8 A;  1B4O A;  1CA5 A;  1DOL A;  5I9O A;  5C6A A;  5K36 H;  1UNS A;  4WJW A;  2Q8I B;  2SDF A;  1AZP A;  4WOR A;  4NDX A;  4P2C B;  1XYI A;  4FVM A;  1W6J A;  3DEO A;  3ERO A;  1X3Q A;  1GUN A;  2X69 A;  5EPL A;  1M4V A;  2EY2 A;  5CV5 A;  5EKK A;  2E74 C;  1DON A;  5T1I A;  1O7Z A;  3M7G A;  2O5I C;  1SYB A;  2SOB A;  2M2L A;  3QIA A;  5IGB A;  4Q0F A;  1I50 B;  2AWO A;  1MD2 D;  5JPN C;  3NPP A;  2O5J C;  3W2D A;  1O7Y A;  1GUW A;  1LTG D;  1EWC A;  1G6Z A;  2C9O A;  3Q23 A;  2VNU D;  4BBR B;  5KGU A;  2EY6 A;  1JIC A;  1STB A;  2YYZ A;  4O42 A;  3VR5 A;  5C0X H;  3TME A;  1H9J A;  3LNN A;  4IUU A;  3H94 A;  4OIK A;  3R2T A;  5IOC A;  1ESR A;  1UUP A;  1LAC A;  2O4X A;  4FF1 A;  4L6T B;  1A2T A;  3S9W A;  3LWE A;  4TKO B;  2HCI A;  1Z6H A;  3OWF A;  3BDO A;  2F0G A;  3S1Q B;  2NVY B;  2AQ2 B;  3PMF A;  1BDO A;  4A3D B;  3OW7 A;  4XT3 B;  1Z47 A;  2D5D A;  1W6K A;  3VR6 A;  1EU4 A;  4L8J A;  4K8J A;  1AZQ A;  4C56 C;  1SND A;  2PCF B;  3G7L A;  5M3F B;  1EY0 A;  2IW3 A;  3HS0 C;  2SNM A;  2LKV A;  1FGB D;  1F2Y A;  3M7N A;  4KY6 A;  5D65 A;  3A8J E;  1HHV A;  3RLF A;  4ZKC B;  2PZT A;  4DGZ A;  1SE2 A;  2IX3 A;  1KTK A;  3WOF A;  1B3A A;  1S5F D;  5J39 A;  3J80 E;  2B63 B;  3ND8 A;  2WII B;  2E2D C;  1R9T B;  3MC0 B;  1DD2 A;  2QKI C;  4QUF A;  3GTO B;  1TS2 A;  1EL0 A;  1I6V C;  4UAI A;  1PFM A;  5IT9 L;  1R4Q B;  2F0K A;  3BYY B;  3OMC A;  2AUK A;  4KJO A;  1PTO D;  2R61 A;  3DXJ C;  1IW7 D;  1H9S B;  5I9P A;  2B2Y C;  4PMW A;  4CKE A;  4RCO A;  5JAV A;  2L5T A;  3J80 L;  3NK9 A;  3X3M A;  4DAV A;  3ONA B;  3HZX A;  4KN7 C;  2PMZ B;  5CBA E;  3P75 A;  2B2Y A;  2MHV A;  5D3I B;  3D6C A;  1JWM D;  1QNK A;  1ZKO A;  1Y8N B;  4IFD J;  2PQE A;  3H3V C;  2XSC A;  3PO2 B;  2RDH A;  1EYC A;  4A3M B;  2A68 C;  2NVT B;  3PIO 3;  1C8C A;  2OEO A;  2EE1 A;  4IUT A;  4IZ8 A;  1PZK D;  1TWG B;  2G9D A;  5CV7 A;  4MHE A;  3OWE B;  1EYD A;  5C0X I;  3T56 B;  4H0L C;  3I3C A;  2KEE A;  3FMC A;  3GD7 A;  4ULL A;  2J4X A;  3S14 B;  5I2X A;  4DXF A;  1EY7 A;  4CKC A;  2WKD A;  5ELD A;  1DM0 B;  1J8I A;  2A6H D;  4CJ2 C;  4Z9C B;  3MVV A;  2F0V A;  1VF7 A;  2FIN B;  2HCC A;  3NBH A;  3DWA A;  2KUM A;  2NZ1 D;  1LLR D;  2R6G A;  2K28 A;  1B53 A;  1SJE D;  1WTV A;  1I4Q A;  4IUQ A;  2MPM A;  1O80 A;  1QE6 A;  3PUZ A;  5A35 A;  4XQJ A;  2K01 A;  4EVO A;  4FF2 A;  2ICE C;  3GV6 A;  3R3O A;  1XX8 A;  1X3P A;  3DMU A;  1UEA B;  3S1N B;  2A69 D;  1WTR A;  4PNY A;  3GTJ B;  1TU2 B;  1QWY A;  4A3F B;  1SNO A;  2QDB A;  2JA5 B;  1SYD A;  1RF2 D;  4EQP A;  2FHT A;  2A5H A;  3IAY A;  3J7Y W;  3S2D B;  1HFG A;  1V43 A;  5F2D A;  3S17 B;  2IT1 A;  3NQI A;  1VF5 C;  2FMM A;  3I8Z A;  1TR5 A;  4QF4 A;  4V0B A;  3G6J B;  1H9K A;  1ZXT A;  2J7Z A;  3WOE A;  1FYC A;  1BO0 A;  5IGG A;  1PXU A;  4HR7 B;  5DM7 3;  4JK1 C;  5CYU A;  4ME5 A;  2WKC A;  2X6L A;  2XN9 C;  1TWH B;  1TQO A;  2IPK D;  1WTP A;  5AFW A;  1TT2 A;  4HCE A;  1I4G A;  2KOL A;  2BA1 A;  3I4L A;  3BVZ A;  4BA1 I;  4GZY C;  3KF8 A;  2BE5 C;  1S4Z A;  2B2W C;  3SHL A;  5KRU A;  3J81 E;  3GO5 A;  5CR3 A;  2CHB D;  4BWG B;  4A3I B;  4F7X A;  2EYP A;  2DNC A;  1E2W A;  4RA8 A;  5K5P A;  4QMG A;  3E6Z X;  1ET6 A;  3K58 A;  2R7Z B;  3GTL B;  1S5C D;  3MZ5 A;  1A3V A;  1HCZ A;  3PO3 B;  3GQB A;  4ZLT F;  2M9V A;  3Q6S A;  4FYD A;  3I90 A;  5G3L D;  2ICI A;  3QOL A;  3KK7 A;  4OIJ A;  3SXH A;  4R8I A;  1SYF A;  2KVM A;  3MAQ A;  2L1B A;  5C3E B;  1JOK A;  2VXW A;  1F2M A;  4RWS C;  1O78 A;  4DAY A;  3R2I A;  4E6I A;  3ERQ A;  1SDF A;  5I6Y A;  2B2T A;  4N9T A;  5EKI A;  3V96 A;  1HUM A;  4FP5 D;  3R93 A;  1SMY C;  1ZYR D;  3FRP B;  4Y7N B;  4U68 A;  1UAP A;  2E76 C;  3BS1 A;  4G7H C;  4DNT B;  1F2L A;  1A2U A;  4A3J B;  3TN2 A;  3SK6 A;  1SSO A;  2LFN A;  1RDP D;  4ODG A;  2XRQ D;  4L63 B;  2V4D A;  1L0Y B;  4X3S A;  5T1G A;  3K0Y A;  2B2W A;  4RHS A;  4A3E B;  4C3J G;  3VYR A;  1B44 D;  1HTL D;  1K8O A;  1VMP A;  5EJW A;  4C1N K;  1MBY A;  3QOJ A;  2E2H B;  2XIW A;  2F4I A;  3SDZ A;  1STG A;  2B2V C;  1BOS A;  1BCP C;  1HQM C;  3KUP A;  1ENC A;  5M3M B;  2WAC A;  3TZU A;  4K2L A;  2EVB A;  5JVH 3;  5C4Z A;  5CBE E;  2PO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...