2UU9L

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 17
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uu9L00
4B3MQ 1KC8C 3F2BA 3KOJA 4Y7NH 2VL6A 3PGZA 1I3QH 2B3GA 2A1AA 3S1QH 5M5WH 2I5LX 1JMCA 3RLOA 3KFUA 3OYYA 1HR0L 1NE3A 3Q8DA 4MZ9A 1XNRL 2E2HH 1JJCB 2DUDA 2R6GA 1N9WA 4IPDA 4QIWE 4EQ5A 1QZHA 3TS0A 1K9MC 4GKJL 2VNUD 3PIOA 2PQAB 5M3MH 4HJ5A 3BU2A 4LFCL 5M5XH 4Y52H 3PUZA 1GO3E 5C0XG 2KHIA 3PCOB 2GVBA 5IP7H 1N32Q 3HKSA 5JEAJ 5IWAL 4X65Q 4IOCA 4B3TQ 4LUZA 1VQEA 1PV4A 1IBML 3ULPA 3TRZA 4B3RQ 2UXDQ 4QQBX 4IPCA 4A3CH 3F1ZA 4LUVA 2NZHA 4DR7L 1K73C 1CSPA 4H02A 3GO5A 4UP9A 3I56A 1J6QA 1UE5A 1V43A 3HOXG 1GM5A 3EIVA 1BVSA 2IY5B 5IP7G 3CCSA 4DV6L 4AH6A 3T1HQ 4HJ8A 4DR3L 4XIGS 4DV5L 3TQYA 4BXXH 4A3LG 3GTPH 3PV0A 2XGTA 2ZJRA 4DV6Q 3RZDH 2N3SA 1SR3A 4DR4L 4A75A 4PZ7A 4AQYQ 4DV7L 1HH2P 2RCNA 3MXNB 3M4QA 4C3IH 1HNXQ 1EWIA 1QVFA 2R7ZG 5JJIA 2IHFA 1XNRQ 1Q1BA 4YCUA 3A5UA 2WAQE 3PUWA 3K8AA 4DV4Q 1PYSB 3KF6A 4DV7Q 3VDYA 5AJ3L 1NJIC 2IHEA 1IL2A 2R7FA 3UDIA 3S15H 3U4VA 1VQIA 2CKZB 1Y1VH 1Z9FA 5C44H 4IO9A 4IFDG 2AMCB 1PH2A 2K52A 5GAEC 2N78A 4NXMQ 4OWWB 1PH3A 4APVA 1AE3A 1IYJB 4DK6C 3CMEA 2UU9Q 2JA6G 5IYDH 3E9IA 4JCVE 1WOCA 4A3FH 4BBSH 2K5NA 2NZOA 4A3DG 1OXUA 4WJ3M 3CCUA 1PVOA 3RLNA 3GTJH 2ZTDA 1S72A 3STBC 1N33L 4X6AH 3CMAA 1WFQA 2RHQB 3KLWA 2VQFQ 4JBJA 1CKOA 1NY4A 4DR5L 1R9TH 3EBEA 5IE8A 1X65A 5IP9G 4A3GH 4ME3A 2OCEA 4DUYQ 5IYBG 1PH8A 4JI8L 1YJ9A 3KF6B 1YHQA 4DR1L 1E22A 2CQOA 3G4SA 1HNZL 3H3VH 3D31A 1X3FA 1HR0W 4GNXB 1L1OA 4JI6Q 2ZTEA 3RR5A 2HHHQ 4P75A 3ZJYC 4POFA 3CCRA 4GNXC 1XMQQ 2ZJPA 4JBMA 4OX9L 3FKIG 3CD6A 2L15A 1ASZA 3UDFA 3RN5A 2MNAA 1AE2A 4BA2I 2D0PA 4KHPL 4R4TA 3CCVA 4LFAQ 4JI2Q 2YV5A 4IFDI 4P74A 1Q46A 1PH7A 2KCTA 4YHHQ 4DPGA 1JJGA 1J5EQ 1IBKQ 2VQEL 3I4MH 1G51A 3UDXA 1EOVA 4AIMA 3RNUA 4A3KG 4JI7L 3GDEA 3NEMA 1XPRA 1WCMG 1P16A 5H1SE 1YI2A 1YIJA 1P8LA 2HQLA 1J5EL 1IBKL 1CUKA 2BA1A 3CC2A 2RHSB 4JI4Q 2GVAA 1XNQQ 1PFSA 1VQDA 2VUMH 2ZTCA 4DAYB 3UE1A 4X62Q 1PH4A 1HR0Q 3GTLH 1E3PA 5C3EG 3I4NH 3J81c 2HT1A 2OQKA 3G6EA 1X3EA 1Q12A 1SFOH 4A93H 1YHAA 1L2FA 5DLQE 1IZ6A 2F4VL 2ZJQA 2JK8A 2UXCL 3TREA 4A3KH 3ULLA 1N32L 4JG2A 3HOWH 4X65L 1TWHH 1VQBA 4BY1G 4B3TL 2ATWA 1VQKA 2JA5G 1EYGA 4B3SL 1PH5A 4JOIC 4P73A 4X66L 1D8LA 4HJ7A 4FDBA 1N34Q 4LF6L 1BBUA 4LF7L 4A3IH 4A3JH 3OW2A 2QA4A 3F2CA 1SROA 2K75A 2FXQA 5C44G 3CCQA 2Z6KA 4LF6Q 2B29A 4QY7A 1K8AC 3AFQA 5C0XI 3CC4A 2Q2HA 1YJWA 1SMXA 4PMWA 1UEBA 2PMZE 2Q2IA 2KBNA 3J80i 2VQEQ 4GNXA 4DR3Q 1FJGQ 5JJLA 2I5HA 4A3BH 2YU9H 4JI0L 2MQHA 4YY3L 1JJ2A 2AKWB 2F52A 3DLLA 3RN2A 4DR6L 3S14H 4GS3A 1C9OA 4A3MH 1VQAA 3K7AH 1PYBA 4L5TA 5GADC 4LF5L 1MIUA 3STBD 1PH6A 2YTXA 5GAGC 4DR6Q 4GKKL 3L0OA 3S17H 1WYDA 1LYLA 1JE5A 4GN4B 4C3JH 4JI3L 5HGQA 4GOPC 2R92H 1X54A 2IT1A 1A63A 4DV2L 1AH9A 3CPWA 1HZCA 2UUAL 1X56A 3CW2C 1MJEA 4KLKA 5BR8L 1E1OA 3AYHB 5C0XJ 1U5KA 4DV1L 5LMNL 2MO1A 4DV2Q 3FKIH 4YWKA 1KAWA 1YHBA 4C2MH 3CCJA 2UUBL 3NENA 1KHIA 2VS1A 1YZ6A 2LXJA 4GOPA 2I0QA 4B3RL 1BBWA 5C4XG 3HOYG 2JEBI 2JJQA 4JC0A 3HKZE 4DV3L 1HJPA 5C3EH 4LFCQ 2R92G 1Y1VG 3CF5A 1A0IA 3J7ZC 4NXNQ 2B63H 2R7ZH 1W3SA 1EIYB 2LSSA 3HOUH 2EQSA 2Y0SG 1EQQA 3KJPA 1Q8KA 4HJAA 4POGA 3I4MG 1VQHA 3PSIA 1OXVA 4XTCS 4AYBE 2QEXA 4A3FG 1XTDA 4P72A 2Y0SE 4QGUA 4R1JA 4O2DA 4R4OA 5HY6A 2UU9L 4ALPA 3ERSX 4DV4L 3PIPA 1Q86C 3GTGH 4AYBG 5ELNA 4BBRG 2OTLA 3M85A 4NB3A 4L5SA 3S1NH 3NELA 2VY3A 4IJHA 4JOIA 3JAMi 4DV1Q 4BA1I 4AQYL 1PH1A 1FVIA 1H95A 4LW1A 4KHZA 2NVQH 2WB1E 1Q1EA 1E24A 4DV5Q 2EXDA 4DV3Q 1VQGA 1M90C 1S3OA 4GLVB 4UP8A 1EUJA 1QUQB 3HOZG 4MTNA 4GKJQ 4A3MG 4PG3A 4A93G 2K50A 2IX0A 3FP9A 3W1GA 2WFWA 4X62L 1C7YA 2CFMA 2JA8H 2HIXA 1G6PA 1BKBA 1IBLL 3PF5A 1KXLA 4A3BG 2A19A 2JA9A 1WCMH 1OXTA 1Z47A 2BA0A 4LFAL 4IPGA 4YWMA 5IYDG 3CCMA 2JA6H 3GTQH 5C4XH 2C35B 5E7NA 1LUZA 3I55A 4BBSG 1VQLA 4DR2L 3S24A 3LGJA 1WJJA 5K36G 5C4JH 1KQSA 4LFBQ 3CAMA 1QVCA 3CXCA 3PO2H 1QVGA 1I94Q 2HIVA 2D62A 1O7IA 1YVCA 1X55A 1L1OC 2CCZA 5M3FH 2NVXH 3HOUG 1SLJA 3RLFA 2VUMG 1I6HH 3IRBA 2AWNA 4HJ9A 3ULJA 1Q81C 2V1CC 3BZKA 4YCVA 1K0RA 4HIDA 1HZAA 3HOYH 4JI7Q 1DGSA 5FJ8G 2E5LL 4JBKA 3M7NA 4B3SQ 1VQJA 1B8AA 1SRUA 2HHHL 2K14A 2Q2UA 3AFPA 4BXXG 2OWOA 4A4IA 5LMNW 2UUCQ 4YHHL 1IXRA 2R7DA 3CCLA 4JI5Q 1K8GA 4KI0A 3GD7A 1B7YB 1K3RA 2RF4A 1CSQA 3B6YA 4RMFA 3HOXH 2EIFA 4DR7Q 5M5YH 5BR8Q 4JI5L 4DV0Q 5LMUL 5GROA 4J15A 1L0WA 4A3IG 2N8NA 3PUXA 3U58A 1VQFA 4A3JG 5FLMG 4A3CG 1XPUA 4JV5Q 1VQCA 3KDFB 4DV0L 5ELOA 4HIOA 3AQQA 3PUYA 1OTCA 2ALYB 4OXPA 2JEAI 4OO1I 4EX5A 4O0AA 3CPFA 1XNQL 4JI8Q 4NXNL 1VQPA 4R4CA 1HNXL 1VCIA 4LF8Q 4LF9L 2A8VA 3HOVG 3J7A5 1TWFH 1W2BA 1YJNA 3K0XA 2NVYH 4JI3Q 1MJCA 3CP0A 4DKAC 3K7UC 1YEZA 2VW9A 1CKMA 1G291 2PI2E 1XMQL 4X64Q 4JI0Q 1VQ6A 3OTOL 4DUZL 3H3VI 3GTOH 1WI5A 4JBWA 2UXCQ 2F4VQ 2IX1A 4GN5A 5GAHC 2MFIA 4B3ML 4A3LH 4X64L 5JJKA 3PO3G 3A74A 1X9NA 1N36L 4X66Q 2E2JH 4JI2L 3PO2G 2WP8J 3KF8B 3HOWG 4QL5A 2ZM6Q 4YY3Q 1EQRA 1N36Q 1VQMA 1GD7A 3I2ZA 1A8VA 2VZAA 4OWTB 1N8RC 4LUOA 5IYCH 3BZCA 3J81j 1NBWA 4R4IA 2E2IH 4PZ6A 1HZBA 2ES2A 3W5OA 4JV5L 2YTYA 5FLXc 1OXSC 5LMNQ 3HFZB 4GKKQ 4LF5Q 2PNHA 2UUBQ 2B63G 4LF4L 2N49A 3I4OA 3KJOA 3L2PA 3S2HH 1QUQA 1UE1A 1U0LA 2OTJA 1KRSA 2PQAA 3S1RH 3M4PA 2UXDL 3F8TA 5IYBH 1VQ4A 2GN5A 1A62A 4IFDJ 4R4QA 4DR4Q 1FL0A 1GKHA 4JI6L 1IBLQ 3NBHB 2K5VA 2D0OA 4OWXB 3T1HL 3AEVA 1D7QA 5J3BA 3S2DH 4YWLA 4LF7Q 2R93H 1GVPA 1B70B 5FLMH 3PO3H 1VQ5A 1TWGH 4A3DH 2CWPA 2BH8A 3H0GH 4UP7A 1YBYA 3J80c 3FHWA 3PUVA 2ID0A 1VQ8A 4HIMA 2NN6G 4BY7G 4IOAA 3M3YH 1FJGL 2JA8G 2Z0SA 2F3IA 1XJVA 1TWCH 1JT8A 4BY1H 4WJ4A 5AJ3Q 3S16H 3S1MH 4PZ8A 1YNXA 1NMFA 3BJUA 1KIXA 1HNWQ 3T1YL 1SE8A 2I5MX 5M3MG 4TVAB 3ICEA 2JQOA 3M4OH 4K0KQ 3K81C 4JYAL 1V1QA 2KENA 2WB1G 4LNQA 1N33Q 3JAMc 4NXML 2JA7H 5EAYA 4UPAA 1NTGA 4DR5Q 1I50H 4BY7H 3J81i 3E9HA 1IBMQ 2E5LQ 1C0AA 3SGIA 2QGQA 2JE6I 4DK3C 4GLAC 2Z6KC 1HNZQ 3D0FA 4HIKA 1TWAH 1OXXK 4KHPQ 4IJLA 4TQUS 5GQOA 3RZOH 2AWOA 3H15A 1Y1WH 2VQFL 5IT9c 1PA6A 1L1OB 1E1TA 4GOPB 2MO0A 1LTLA 5FJ8H 3EN2A 3KYHC 1T9HA 3U50C 2NVTH 4RG1A 1NMGA 3L7ZC 3F2DA 1Q7YC 1VQ9A 1JB7A 1EFWA 2K4KA 4A3EH 4LFBL 1SN8A 2UXBQ 2KCMA 3MEFA 4IPHA 1RIPA 1XMOQ 1QZGA 2DGYA 1HNWL 1E7ZA 3T1YQ 2UXBL 5JEAG 2AHOB 1PH9A 4GN3B 4DAMA 4L5RC 3HOVH 1X6OA 3GTKH 1RL2A 3K80C 2LXKA 3KDFA 1PHJA 1X3GA 4JYAQ 4NPSA 3TEHB 3U4ZA 4JI1L 1K83H 3DM3A 3UE0A 3W1BA 4C3HH 3OTOQ 4DUZQ 2K5HA 4DR1Q 3H0GG 2BH2A 4LWCA 3CCEA 1XPOA 4OX9Q 3A0JA 1UE7A 1Q82C 2Q2TA 1ASYA 3HKZG 2UUAQ 4DR2Q 1VQ7A 4DNIA 1EIFA 4UY8C 1TXYA 4JI4L 4YCWA 1UE6A 1KD1C 2R93G 1I5FA 3UDGA 1I94L 3G71A 4K0KL 2JA5H 3E0EA 1S40A 2ASBA 2YYZA 1UWVA 4LF8L 1LM0A 4LF9Q 2PI2A 4DUYL 5LMUQ 5IP9H 4A3GG 2WAQG 2OQ0A 3G48A 1XMOL 4A3EG 2JA7G 4LF4Q 3I4NG 3JC66 5M3FG 2UUCL 3CQZH 2NN6I 1KL9A 1Y14B 2H5XA 3I7FA 1V9PA 3M9BA 1M1KC 1MKHA 2YTVA 4QJFA 5IY0A 5IWAQ 5IYCG 3GTMH 4MNOA 1YITA 2XTIA 3PF4A 3HOZH 1VQNA 4JI1Q 1Y1WG 3ER0A 1HZ9A 2E8GA 1KRTA 4OO1G 2KHJA 4BBRH 3A5ZB 2ZM6L 4A76A 1VQOA 1VS0A 2CWAA 1CKNB 4P71A 4L5QA 3CC7A 4GLXA 1FGUA 1CKNA 4OONA 1N34L 3TS2A 3WWVA
chains in the Genus database with same CATH superfamily
1XYIA 3F2BA 4QIWB 4KK7A 4KD3A 5CC4A 2B3GA 3S2DB 5M5WH 2K04A 2P5ZX 3RLOA 1NUCA 4X3SA 5C3XA 3H91A 1HR0L 1NE3A 1PMRA 2DUDA 1N9WA 4IPDA 2VNUD 4GKJL 2PQAB 5M5XH 1JICA 1F2ZA 2SDFA 4F88A 1SYBA 3SVMA 3HKSA 4IOCA 5IGDA 4HEDA 4LUZA 4OELB 3BVMA 1I4XA 2UXDQ 3F1ZA 3ND9A 1EY4A 3VYSA 1T5XD 3GO5A 4H02A 3I56A 1BOSA 1UE5A 2EPBA 1GM5A 3HOXG 1GHKA 2N55A 4RAUC 4XYQA 1BVSA 4A93B 2IY5B 1A2TA 3CCSA 3K5MA 3T1HQ 3Q22A 4HJ8A 4DR3L 3L9AX 3S1QB 3TQYA 4A3LG 3UI2A 3GTPH 1G8ZD 3M4YA 2N3SA 2NZ1D 4IQZA 3HOZG 4A93G 2SNSA 4C3IH 4XT1B 2K01A 5JJIA 2AQ2B 1EYDA 4DN4M 4DV4Q 2WAQE 1PYSB 3KF6A 4FXDA 5AJ3L 3U4VA 2CKZB 1Y8OB 2K03A 4IFDG 1F9RA 2N88A 4DAVA 2N78A 4NXMQ 1X32A 4APVA 1GJXA 3MC0B 2JA6G 2B63B 4JCVE 4MHEA 2K5NA 3RLNA 3GTJH 2ZTDA 1TY0A 1N33L 1AW7A 4N8X1 2VQFQ 1CKOA 4DR5L 3QOJA 5IE8A 1DOKA 2KHSA 4DUYQ 5EKLA 1PH8A 2AUJD 4KY6A 2CQOA 3H3VH 1IYUA 3D31A 3RR5A 3E0JA 2HHHQ 4POFA 4CDCC 5DAUA 2L15A 4F87A 1ASZA 3NE5B 5IGCA 1PRTC 4JI2Q 4H7BA 4P74A 5KNCA 1AEXA 2CVRA 4DPGA 1IBKQ 1JJGA 5JEAH 3S1MB 2EY1A 3GDEA 1IBKL 1P16A 1P8LA 4JI4Q 1CUKA 2VUMH 3CC2A 2RHSB 2GVAA 1PFSA 1VQDA 3I90A 3PIP3 2ZTCA 3GTQB 4X62Q 1PH4A 3GTLH 1A3UA 3J81c 3DEPA 3SDZA 1C48A 1ZEQX 2O2LD 1RJTA 2ZJQA 3ULLA 5C4XB 3Q24A 2X6GA 4BY1G 3WOFA 1VQKA 3H3VC 1D8LA 2MP1A 1T5EA 4LF7L 3N6RA 3F2CA 1SROA 3SXHA 3CCQA 4LF6Q 2B29A 1F2YA 1TS5A 1XTCD 3I4MB 4GNXA 3J80i 5JJLA 1Y69U 2HDMA 2I5HA 1SMYD 2YU9H 4A3BH 4JI0L 1ENCA 1G2SA 3RN2A 4WORA 2MUYA 3S14H 4GS3A 1TWGB 1VQAA 3TSSA 1STYA 5GADC 1MIUA 3STBD 4LF5L 2YTXA 5GAGC 1XX8A 4DR6Q 4GZYC 1WYDA 1HFGA 3HEJA 1O80A 1VMPA 3EVQA 2OEOA 1DYQA 4X3KA 1AH9A 1GUNA 1WTVA 2WV6D 1E1OA 3AYHB 1U5KA 2F4IA 2NVYB 3TZDA 1EWHA 1KAWA 4C2MH 3BVGA 1KHIA 2I0QA 2LXJA 1HUMA 4B3RL 2ZXPA 3TBIB 2QDBA 1Y1VG 4NXNQ 2B63H 3OSOA 1W3SA 1EIYB 1PRTF 3MXGA 2Y0SG 1SYFA 1J8IA 3PSIA 4XTCS 3OWEB 4A3KB 2E2DC 1XTDA 3FVQA 2Y0SE 4P72A 2EXZA 3ERSX 1F9PA 3S9WA 2OTLA 3S1NH 4C3IB 5F2DA 3MHBA 4IJHA 5K5PA 4L63B 4KJNA 3TP7A 4FYDA 4KHZA 3VYTA 4FNFA 1OO9B 1JR0D 1ILPA 2EXDA 4RHSA 1F9QA 1NCVA 1S3OA 3HOWB 2CW0C 1SNQA 3DWAA 1WTWA 4A3MG 3VYRA 4PG3A 1CK1A 4X62L 2D9UA 1BKBA 2FMMA 1TY2A 4RGTA 1CHPD 1DOMA 4A3BG 2ZXRA 1WCMH 1E0BA 2OXPA 4IPGA 4HMJA 5IYDG 3X3NA 1Z7TA 2SEBD 1B53A 3GTQH 2RBMA 1LABA 4DNTB 5E7NA 1LUZA 3NQIA 4DR2L 1BQQT 1WJJA 1GUTA 5C4JH 4BWGB 4G7ZC 3PO2H 1QVGA 2HIVA 2B2UA 2B8FA 1YVCA 2F0QA 1L1OC 2BDOA 5M3FH 3HOUG 3PO3B 2E76C 3SK5A 2ICIA 3CRKC 1SNMA 2AWNA 1Y1WB 4YCVA 4FF4A 5D14A 1Q3LA 1S5ED 4JI7Q 1V8QA 5FJ8G 4C1NI 1SRUA 2Q2UA 2OWOA 4A4IA 3R2IA 3KBGA 2RF4A 2VUMB 4RMFA 4DR7Q 1SSOA 3S1RB 3C1FA 4A3FB 4J15A 4A3JG 3TMEA 1XPUA 4ZLTF 4OXPA 1FR3A 2BE5D 5LHY1 4NXNL 1SYDA 4LF9L 1ET6A 1BDOA 1TWFH 3ZYYX 2KA7A 2L4NA 1EY9A 5T1GA 1VQ6A 4DUZL 4DAPA 3PIO3 1WI5A 4JBWA 3GTOH 4QCLA 2F4VQ 2UXCQ 5GAHC 2F0NA 2R61A 3GV3A 4B3ML 5JJKA 4X64L 3EROA 1CTMA 4CJ0B 1A6XA 4JI2L 1ONLA 4WFN3 1VQMA 1NR2A 1N8RC 4LUOA 3BZCA 3T53B 2E2IH 1TS2A 1HZBA 5D3DA 1OXSC 1K3BC 3RMHA 2PNHA 2RQXA 3TDQA 2N49A 1C4QA 4PMBA 1U0LA 5E4XA 2M00A 3S1RH 2UXDL 1SXTA 1B44D 2F3VA 1VQ4A 5FOBB 1TQOA 1WD1A 2CH4A 3C46A 2ZXOA 1AN8A 2EVBA 3EJIA 1IBLQ 2D0OA 3T13A 3T1HL 4LF7Q 1TR5A 1GVPA 1B70B 4UHVA 1LTSD 2Y0SB 3H0GH 2RDFA 3BYTB 1BBXC 2ID0A 3I73A 1PTOF 3ND8A 2HUGA 1CFMA 3DWPA 4JPBW 1TWCH 4KD4A 1DD2A 4HR7B 3RUZA 3I91A 5C4JB 3R8BA 5M3MG 3URYA 3PO2B 3ERQA 3K0YA 4FVMA 2EYFA 1KLUD 2JA7H 4P2CB 2JN4A 4BY7H 1IBMQ 1C0AA 3D4DA 2R7ZB 1EQVA 2G9HD 3D0FA 4H0LC 4TKOB 3A54A 4YIJA 4HCSA 2AWOA 2IX3A 3BDCA 3CQZB 1LLRD 5M5YB 2EYPA 1SJED 1BCPF 1NMGA 1Q7YC 3F2DA 1STGA 5KEEA 1SN8A 2KCMA 3MEFA 1EZ6A 4ILWA 2F0IA 2DGYA 3S1NB 1YNJD 3I3CA 4L5RC 1PH9A 4GN3B 5FLXL 1RODA 5ELFA 3KDFA 1MI2A 4JYAQ 4NPSA 4XQJA 2DY8A 3UE0A 4C3JB 2R92B 1GUOA 1XPOA 5M3FB 3D6CA 3A0JA 5ELEA 5BN3A 1ASYA 2UUAQ 1WTOA 4DR2Q 1VQ7A 1S5FD 2B2WC 5FKAC 1LV9A 1I5FA 5IOCA 2YYZA 2PI2A 4DUYL 2PCFB 4K6DA 1EY0A 1QILA 3G48A 1XWEA 1KDCA 5TSSA 4CKCA 3HP3A 5M3FG 3CQZH 2NN6I 2EY6A 3NTIA 1Y14B 3M9BA 2JA8B 1M1KC 5IY0A 1TT2A 4QJFA 5IYCG 1YNJC 3PF4A 2K5QA 1YITA 2B2UC 5EKKA 3KK7A 4BBRH 2IJ0A 2ZM6L 1VQOA 2A68C 2RSNA 2WB1B 2EYHA 4L5QA 3CC7A 4GLXA 3Q23A 1CT1D 2M9VA 1STHA 1FNWA 2RDGA 4Y7NH 1I3QH 3G7LA 5NUCA 5A35A 1GUWA 5C5MA 3KFUA 3I72A 3H0GB 3OYYA 1XNRL 2HCCA 2E2HH 2R6GA 4QIWE 1S4ZA 1K9MC 4EQ5A 3TS0A 2Q8IB 3PIOA 5M3MH 2H4OA 3M7GA 3PUZA 1G91A 2WACA 5G3LD 2GVBA 5IP7H 2QEJC 1SNDA 2RA4A 3KBXA 3ULPA 3TRZA 4B3RQ 4IPCA 4LUVA 4O1NA 2NZHA 1CSPA 2JYOA 4H13C 3SK6A 3EIVA 4ZUIA 2O5IC 1YNNC 2K7VA 4XDXA 4XIGS 4DV5L 4BXXH 1NR4A 1M8AA 1SR3A 1H9RA 5I4DA 4DR4L 4PZ7A 1QVFA 1HNXQ 3M4QA 3T4AC 1XNRQ 3A5UA 4PV1C 1EY5A 3VDYA 4DV7Q 1GXDC 1M4VA 1W6KA 5DNFA 4OL7A 3S15H 1VQIA 1S5CD 1Y1VH 4QUCA 1EZ8A 1EIGA 2K52A 5GAEC 4OWWB 1MSGA 2D2CC 3E9IA 3FEWX 3T56B 4BBSH 3A56A 2EJFC 2EE1A 2EDGA 3STBC 2RHQB 3KLWA 4RKLA 4K2KA 1X65A 4ME3A 4A3IB 3T51B 1X3FA 1HR0W 4JI6Q 4GNXC 4JBMA 4X3TA 3CD6A 2XVSA 1JCKB 3UDFA 3RN5A 4ZQ3A 2D0PA 2Z1CA 4R4TA 3SEBA 2TSSA 4LJZC 3QO2A 2LFNA 4RGNA 4HTHA 1SNCA 2KCTA 2KEEA 2OF1A 3GTPB 1G51A 1EOVA 4AIMA 1J5EL 1YI2A 5H1SE 3FMCA 1YIJA 4KN7C 5EGTA 1RF2D 1MD2D 4ID6A 2XN9C 3I4NH 3G6EA 4C56C 4L8JA 1QNKA 2EJMA 1SFOH 1L2FA 5DLQE 2F0EA 1IZ6A 4KKUA 3S17B 3W3AA 2JSOA 3NHHA 3HOWH 4X65L 1TWHH 4B3TL 2JA5G 2B2YA 4JOIC 4P73A 1HXYD 4X66L 1N34Q 4FDBA 1SE3A 4A3IH 3IKJA 3OW2A 5C44G 1QNUA 2DNEA 3GP7A 2A69C 2B8GA 2B2YC 2KECA 1YJWA 5JPNC 2FMCA 2KQ3A 2IW3A 3K57A 1F77A 1PTOC 2MQHA 2F52A 3IFDA 4G7HC 3J7AV 4RH6A 1PH6A 4IZ8A 4KJOA 4GOPC 2IT1A 1A63A 5IODA 1F9SA 2MHVA 3CPWA 3CW2C 5C0XJ 5KRUA 2MO1A 2F0MA 3TP8A 5DM73 1YHBA 3A8IE 2XIWA 3SHLA 4S3SA 2VS1A 4GOPA 1SE2A 1BBWA 2JJQA 4DV3L 4LAAA 4NW2A 4LFCQ 1TWAB 4C3IG 4TSSA 2EQSA 3MVVA 2F0KA 4POGA 4CKBA 1OXVA 5EJWA 3NQTA 1B3QA 2UU9L 1B9MA 2JXMB 3PIPA 1Q86C 3OIQA 3GTGH 2X6LA 4L5SA 4NB3A 1KNAA 1TWFB 3NELA 1CI3M 4JOIA 2KEDA 4AQYL 5E4WC 4G4KA 5CR3A 2NVQH 5HURA 3QR8A 1ET9A 1VQGA 1M90C 2EYOA 2A5HA 4UP8A 1EUJA 1QUQB 2A6ED 2VB3X 4GKJQ 3MZ5A 3FP9A 2IX0A 1UNSA 2PW5A 1EY7A 4ME5A 2CFMA 4NMZA 5JVH3 1ZYRC 5I9OA 1KXLA 2A19A 1JORA 2QW7A 5IT9L 2PZUA 2C35B 4N9PA 1NAPA 4CBVA 4FO2A 3I4NB 5BN4A 1B4OA 1HTLD 3BG3A 4J8QA 1CA6A 4K8JA 3CAMA 3G6JB 3CXCA 4IFDH 1PRTD 1V1PB 1WTHA 2PQEA 1LTTD 2MJ8A 1O7IA 3GTJB 2DY7A 1BCPB 3AMUA 4BS9A 3RLFA 2VUMG 3IRBA 4HJ9A 1FNVA 3ULJA 2V1CC 4IUNA 2EJGC 3BZKA 3RZOB 3MXPA 1I4PA 4HIDA 2FHTA 5EPLA 1VQJA 4B3SQ 2HHHL 2K14A 4HCEA 1Q90A 4U673 4BXXG 4RWSC 5LMNW 2UUCQ 2EOTA 4YHHL 1E2WA 3CCLA 4JI5Q 4CHTB 3GD7A 1JWUD 1CSQA 2EIFA 2MPMA 2IL8A 4JI5L 4DV0Q 5GROA 1MBYA 1VQFA 2LMCB 1VQCA 1Y8NB 4DV0L 2A6HD 5LL6X 3PUYA 1TKWB 2JA5B 1O7YA 2J0TD 2L11A 4O0AA 2F0HA 3CPFA 3JAME 5D65A 1XNQL 1IW7D 4JI8Q 3MAQA 1HNXL 2PMZB 4LF8Q 2JEAI 1YJNA 3K7UC 1YEZA 2VW9A 3NPPA 1XMQL 1G291 4JI0Q 3VR3A 1I4HA 4K8IA 2MFIA 4IURA 3E3XA 1PRTB 2F03A 1X9NA 3PO2G 2WP8J 3HOWG 4QL5A 2ZM6Q 1GD7A 1A8VA 4NDXA 4PNYA 4R4IA 2ES2A 1BUVT 1TVXA 2NVTB 2NB0A 2F3WA 5IIFA 4LF5Q 3A8KE 3EQLC 2B63G 2JA6B 3NTKA 3I4OA 1LT6D 1UE1A 1FD7D 3M4PA 3F8TA 5FO8B 1A62A 2DN8A 4R4QA 5I6YA 1FL0A 1GKHA 2PNRC 4RA8A 4JI6L 1SJHD 2F0UA 2RCFA 2EY5A 1BXTA 1SBBB 4ZRZA 3AEVA 4KTAA 4YWLA 2E2HB 2HCIA 1TWGH 1VQ5A 2CWPA 3J80c 3FHWA 1VQ8A 2NN6G 4C3HG 2C5CA 1PTOH 4UAIA 4IOAA 4G7OC 3M3YH 5M5WB 4HSPA 1JT8A 1XJVA 3NWTA 4BBRB 5CMDA 3LNNA 4A3BB 3MXNA 1RD9D 1X3QA 2AQ3B 4OHJA 3M4OH 4DXFA 1YNND 3D4RA 2DJFC 5EAYA 4UPAA 1NTGA 4DR5Q 1I50H 5EBCA 4K5XA 3J81i 3E9HA 4DFAA 2QGQA 2B2WA 1B1ZA 4GLAC 1TWAH 1OXXK 5C4ZA 4KHPQ 4IJLA 3RZOH 3H15A 4DF7A 2VQFL 4M1UB 3DHQA 1L1OB 1E1TA 2MO0A 3HS0C 1F2MA 4NKLA 1G2TA 5C44B 3HZXA 1PYWD 4IPHA 1XMOQ 4ZK9B 1LT4D 1S5DD 2AHOB 4DAMA 3WOEA 3GTKH 3K80C 3K7AB 1WTQA 4KY7A 1PHJA 4IUUA 3S15B 1QB5D 4JI1L 2NN6H 3DM3A 4C3HH 4RGOS 1GOZA 2K5HA 2K28A 1STEA 2ICEC 1EEFD 1QCBD 3H0GG 4LWCA 4FF3A 1UE7A 4OIJA 2AUKA 1ICWA 2Z6BA 4DNIA 3VR2A 2D5DA 1UE6A 2L0CA 3OHXC 3UDGA 1I94L 3G71A 1RKNA 2ASBA 2PYKA 1WTRA 5LMUQ 1L0YB 2F0GA 2JA7G 1XMOL 1I4GA 5L37A 4A3DB 4PQXA 4BBSB 2UUCL 2L5TA 2WIIB 2RVLA 1MKHA 3MFGA 5CGKA 3GTMH 2XTIA 1VQNA 3VA7A 4JI1Q 1PFMA 1BCPD 1KRTA 3A5ZB 3R2TA 3AU7A 4P71A 5CV5A 4K5WA 1ILQA 4KY5A 4K14A 1CKNA 4OONA 4B3MQ 2Q8RE 1AZPA 1KC8C 2F1MA 4K5VA 1DZ1A 1ZYRD 1ENFA 3S1QH 1EFID 4KHVA 2AQ1B 4FXKC 4MZ9A 3FKIB 1PXUA 4CDDC 2F0SA 4Y52H 2A6HC 4HJ5A 3BU2A 2EYLA 4DNRB 5JEAJ 5IWAL 1SMYC 4X65Q 4B3TQ 1EIHA 1VQEA 1PV4A 4QQBX 2B2VC 4DR7L 4UP9A 3OMCA 4FXGC 1V43A 1EU3A 5IP7G 4DV6L 3A7AB 2XGTA 2ZJRA 4DV6Q 3RZDH 1CQVA 1FYCA 2CQAA 4A75A 4DV7L 4AQYQ 2R7ZG 2IHFA 1LTRD 3PUWA 5IT9E 2J4XA 1NJIC 3LX0A 2IHEA 1WTXA 5EPKA 1IL2A 1EL0A 4QUFA 2V4DA 1EY6A 3K5NA 1Z9FA 3KLSX 5C44H 4IO9A 3C2PA 1K83B 1JOKA 1PH3A 1H9JA 5IYDH 2EYMA 1WOCA 1H9SA 2NZOA 2E2IB 4WJ3M 1S72A 1H9MA 3CMAA 4RHRA 3BDLA 4JBJA 1NY4A 1R9TH 3AB9A 4A3GH 2OCEA 4JW0A 2K32A 4A3JB 3SK4A 1YJ9A 1YHQA 4FF2A 3G4SA 3MFYA 1O7LA 4N8FA 4GNXB 1L1OA 2ZTEA 2PPBC 2NTTA 4P75A 4A3CH 4UDUC 2KOLA 2ZJPA 4V190 2K5WA 3IL8A 4C1NK 4EGVA 1HFNA 1AE2A 3GTGB 2KVMA 5ISRA 1UUPA 2Z4IA 2JA7B 1HA5A 4IFDI 2YV5A 5J39A 1Q46A 1E2VA 5FO9B 1D5ZC 1V1OA 2VQEL 3I4MH 3UDXA 5EQ0A 2NYZD 4A3KG 1WCMG 3DUZA 2YU9B 2HQLA 2JP1A 2BA1A 1U9RA 1XNQQ 4KKSA 1A3VA 3LWUA 1E3PA 2QDLA 1X3PA 2BCOA 1K8OA 1BO0A 3CHBD 1ICFB 4BY7B 1YHAA 5M5XB 2F4VL 1SEBD 1XXGA 2WAQB 1VQBA 4B3SL 3NXWA 4LF6L 4HJ7A 1BBUA 3E5SA 4A3JH 2QA4A 2K75A 2FXQA 2A69D 2Z6KA 2DJGC 3AFQA 4LMQD 2Q2HA 3OW7A 3J81L 4PMWA 2PMZE 2VQEQ 2K6AA 2KBNA 1FJGQ 4DR3Q 3S1MH 5FO7B 2LS01 5J1ZA 4JVZA 3VR5A 3KLRA 2AKWB 4ZKBB 3DM1A 1PYBA 4GKKL 4JYAL 5CV9A 2A74C 5C4HA 1LYLA 4ODGA 1JE5A 4GN4B 4C3JH 2R92H 4IN3A 1SFOB 1IYVA 1X54A 1PLFA 3ONAB 2UUAL 1X56A 2FINB 4KLKA 4DV1L 3NTHA 3QG1A 3A8JE 2B2VA 3FKIH 3BZDB 4YWKA 2MGSA 4CJ2C 3J80E 2UUBL 3NENA 3MXUA 3U9SA 1KLGD 5C4XG 3HOYG 2JEBI 3D8GA 3DMUA 5CV8A 4Y7NB 3RD4A 2A73B 3CF5A 3J7ZC 2KCCA 1JWSD 2LSSA 1EQQA 3I4MG 3C1EA 1DONA 2F0TA 1KTKA 1NNXA 2QEXA 4A3FG 4QGUA 4R1JA 4R4OA 1VF7A 1RHPA 4ALPA 3BS1A 3SR1A 4HMIA 4BBRG 4O42A 3M85A 3KF8A 5I2YA 4DV1Q 4BA1I 1EOTA 2VXWA 1PH1A 3HRZC 5EPJA 4LW1A 3HOVB 2WB1E 5AFWA 4DV5Q 4DV3Q 2PO4A 2CW0D 3W1GA 2WFWA 1C7YA 1U4LA 2HQEA 1G6PA 1U4RA 3PF5A 1CA5A 1J9OA 2JA9A 2BDNA 1OXTA 1Z47A 4IUTA 4LFAL 4EQPA 3CCMA 2JA6H 5C4XH 1I6HB 3I55A 3M4OB 5K36G 2K5DA 1BR9A 1CHQD 3V05A 2D62A 2G9DA 2M2LA 4U68A 5E1FA 2CCZA 2NVXH 5IGFA 1CQFA 1KABA 5E3FA 1SLJA 3W2DA 3HKZB 3M3YB 1HZAA 3HOYH 1Y1VB 4V0BA 1B8AA 3J80L 3AFPA 1IXRA 1K8GA 4KI0A 1B7YB 4A3GB 3B6YA 4F8MA 1RDPD 3HOXH 5M5YH 5BR8Q 1KDBA 1JMCA 5LMUL 1SYGA 4R8NA 3U58A 3H09A 2L12A 5FLMG 2F0OA 1A15A 5ELOA 3AQQA 3IFTA 4NP5A 4B08A 4EX5A 1WVLA 1PDQA 5KGUA 1B2TA 1EU4A 4F7XA 4B9WA 3K0XA 1IHZA 4XQQA 4JI3Q 3CP0A 3GTKB 2PI2E 2GA4B 3TZUA 4X64Q 2NWGA 3H3VI 4DXGA 5CBEE 4GN5A 4DA2A 2IX1A 4HAEA 4A3LH 1D2BA 3TP5A 3V96A 2O5JC 2PZTA 3A74A 1N36L 4X66Q 2E2JH 5I2XA 3KF8B 1N36Q 4K0KQ 4OWTB 5IYCH 4PZ6A 4JV5L 2YTYA 5FLXc 2L1BA 5LMNQ 1U4MA 2UUBQ 3NK9A 4QB4A 4FF1A 3KJOA 3S2HH 1QUQA 3J81E 2PQAA 5A2QL 5IYBH 3SK8A 4G57A 1H9SB 5CV6A 4ZAIA 3DXJC 4RFBA 4HN7A 1DOLA 4HSVA 1EEID 1TWHB 1K28A 3NBHB 2K5VA 2Q8TA 5J3BA 1DM0B 4PMCA 5FLMH 4A3DH 4UP7A 3T16A 2A68D 3PUVA 4OIKA 4HIMA 2F0WA 3X3MA 2ENBA 4QF4A 4JK1C 2NBFA 1FJGL 2Z0SA 2F3IA 2F0FA 3VR4A 2JA8G 3C3LA 4IUQA 4TRDA 1FNUA 4N9TA 1ESFA 4PZ8A 1IKMA 1YNXA 3BJUA 3FPPA 2C9OA 2QILA 1KIXA 1VDZA 1SE8A 2I5MX 3KUPA 3K81C 1I4RA 1VF5C 1V1QA 2KENA 2WB1G 3L3OC 4LNQA 4NXML 1PTOB 1PZID 3I70A 4CGYB 4KV6A 2E5LQ 1K0SA 3HOZB 2JE6I 4I7ZC 4DK3C 5I9PA 1O78A 3P20A 3OPOA 5FLXE 5KYLA 3A55A 1PA6A 1IL8A 1R4QB 2EZVA 1LTLA 5FJ8H 4OO1H 1L0XB 2NVTH 3L7ZC 2CH4W 1EFWA 4A3EH 4LFBL 1RCVD 2XSCA 1HNWL 1E7ZA 3T1YQ 4KN4C 2UXBL 5JEAG 1X6OA 3KLSA 2LXKA 2G5DA 1SYEA 4FP5D 2SNMA 1QG7A 4DR1Q 2NUCA 2Z8LA 3W1BA 4DUZQ 1HCZA 4OX9Q 2NVXB 2B2TA 2Q2TA 3HKZG 4LK1C 5C6AA 5G3LF 1EIFA 4UY8C 1TXYA 3FPUB 3MEHA 4YCWA 2XWJB 3N52A 1O7ZA 1KNEA 2R93G 1R4PB 1PFBA 5A2QE 3E0EA 3U9OA 2IWHA 1AFPA 4LF8L 4Q5VA 2RDHA 1LT5D 3D6WA 2RKSA 4A3GG 2WAQG 4DK1A 3J7YW 4LF4Q 1I4QA 2CHBD 1V9PA 3MA2B 4ZUJA 4C2MB 5KNBA 1LTAD 3ER0A 2WKDA 3P1HA 3P75A 4IUVA 2X69A 4OO1G 4A76A 3S16B 3JAML 2CWAA 1CKNB 3CRLC 3Q6SA 4A3MB 2HD3A 1FGUA 4XXEA 1N34L 3TS2A 1UEAB 3KOJA 4BY1B 2QKIC 2VL6A 3PGZA 4J1MA 2A1AA 2I5LX 3FRPB 5CORA 3Q8DA 5IGBA 4J6HA 1JJCB 1QZHA 2FFKB 3P7JA 4LFCL 1LTGD 1GO3E 5C0XG 2KHIA 3PCOB 1N32Q 2WKCA 1IBML 1K73C 1AZQA 1B9NA 1J6QA 1HUNA 3EFXD 1STBA 1PZJD 1FGBD 1TWCB 4AH6A 3PV0A 1MHWC 2XNAC 5DM63 4EQNA 4K2LA 1HH2P 2RCNA 3MXNB 4AYBB 1EWIA 2ZT9C 1Q1BA 4ZCKA 4YCUA 1F2LA 1GUGA 1LT3D 3K8AA 3OOCA 1ML0D 2R7FA 3UDIA 1WTPA 2I07B 4B9XA 2AMCB 1NSNS 1EY8A 4CDFC 1PH2A 3R93A 1D1IA 4RKBA 1PFNA 2WINB 3I4LA 1HTPA 3A7LA 1AE3A 1IYJB 4DK6C 3CMEA 2UU9Q 5IGEA 4A3FH 3J7AF 4MTKA 4A3DG 1OXUA 1EQTA 3CCUA 1PVOA 3V2TA 2NVQB 5JVG3 4X6AH 1WFQA 5DEHA 4MIUA 3EBEA 5IP9G 2XWBB 5C0XH 5IYBG 1JE4A 4JI8L 3KF6B 4DR1L 1E22A 1HNZL 2KCNA 1B3AA 3LWEA 3K6OA 1SNOA 1SDFA 4OX9L 3ZJYC 3CCRA 1XMQQ 3NUCA 2XRSD 3FKIG 4EVOA 2MNAA 2F0JA 2B39A 4BA2I 5KYIA 1S5BD 2LY7A 3HG9A 4KHPL 3CCVA 3GTLB 4LFAQ 1DXMA 1QWYA 3BDOA 2KJXA 1PH7A 4YHHQ 2F0VA 5ELDA 4MN3A 4X3UA 5T1IA 1J5EQ 4IALA 2K1BA 3RNUA 4JI7L 3NEMA 1XPRA 2NTSA 4M8AA 1I6VC 4DAYB 3UE1A 1HR0Q 5C3EG 1Y8PB 2HT1A 2OQKA 4DGZA 4OGQC 1X3EA 1Q12A 2DNCA 2PZWA 1I50B 4A93H 2UXCL 2JK8A 3TREA 4A3KH 1N32L 4JG2A 2OT2A 2ATWA 5C3EB 1EYGA 1PH5A 1RTOA 5ELCA 5COYA 3IAYA 1EYCA 4KMUC 4Q0FA 1QE6A 4QY7A 1K8MA 1K8AC 5C0XI 3CC4A 1SMXA 1G6ZA 1UEBA 2Q2IA 4I65A 5LL6S 1IW7C 4YY3L 4KKTA 1JJ2A 5IGGA 2Z4HA 3DLLA 1TIID 2VB2X 1C9OA 4A3MH 3K7AH 4L5TA 2PW7A 1JOQA 3L0OA 3S17H 3H94A 5D3IB 3QB3A 5HGQA 4JI3L 4E6IA 4DV2L 4R8IA 1HZCA 1RTNA 1ZKOA 3WDNA 1MJEA 1QJOA 2QF7A 5BR8L 1Q8IA 5M9OA 1MGSA 5LMNL 4DV2Q 3CCJA 1YZ6A 2L55A 2XRQD 4JC0A 4ABNA 5C3WA 3HKZE 1D5MC 1HJPA 5JJZA 5C3EH 4C3JG 2R92G 1JC7A 1A0IA 2E2JB 4Z9CB 3HOXB 2R7ZH 4CJ1B 3HOUH 1WD0A 1V1PA 3KJPA 1Q8KA 3DWQA 1Z6HA 1E2ZA 4HJAA 1VQHA 1WCMB 4AYBE 1U4PA 5CBAE 1W6JA 4O2DA 3R3OA 5HY6A 3Q0AA 4DV4L 4AYBG 5ELNA 1STAA 3DEOA 1HQMC 2VY3A 3JAMi 3VR6A 1UAPA 1FVIA 1H95A 1A3TA 5FK9C 1Q1EA 1E24A 1CM9A 4OEMB 1EYAA 4RCNA 3QIAA 4GLVB 3MWYW 4MTNA 2R93B 2K50A 5J22A 4XQNA 4EQOA 1JOOA 2JA8H 3NP8A 1HPCA 2HIXA 1IBLL 1TS3A 5KNDA 2BA0A 4YWMA 3E6ZX 3S2HB 4WJWA 4BBSG 4ZKCB 1VQLA 1AP0A 3D4WA 3LGJA 3S24A 2H1EA 1KQSA 4LFBQ 3D3RA 1QVCA 1LACA 1I94Q 1MSHA 3PMFA 2O4XA 1X55A 3F2UA 1LO5D 1I3QB 1TS4A 4XT3B 3QOLA 1I6HH 1ZXTA 1Q81C 4DAYA 4IUPA 3CU7A 4R9WA 1K0RA 1EWCA 3GTOB 1DGSA 2F0DA 2E5LL 4JBKA 2HDLA 3M7NA 1B50A 3CKIB 3BYYB 2FJ2A 1JWMD 3NBIA 1GUSA 3OWFA 2R7DA 3K5LA 1K3RA 1ESRA 3VYUA 3ICEA 1L0WA 4A3IG 2N8NA 3PUXA 2TMPA 4A3CG 5M3MB 4JV5Q 3KDFB 4HIOA 1H9KA 1OTCA 2ALYB 2F0LA 4OO1I 3ITPA 1PTOD 1VQPA 2A8VA 4R4CA 3HOVG 1VCIA 4XYOA 1ENAA 3J7A5 1W2BA 1KDAA 2NVYH 1D6EC 1MJCA 4DKAC 1BF4A 1CKMA 2RSOA 3OIPA 1D5XC 4C3HB 3OTOL 1SNPA 4RGMA 3PO3G 3HOUB 2KUMA 3H6MA 5BN5A 1D1KA 4YY3Q 1EQRA 3I2ZA 2VZAA 3J81j 1NBWA 2E75C 2SOBA 1BCPC 3W5OA 1VMCA 3NBHA 3HFZB 4GKKQ 3VA5A 4LF4L 1CZWA 5C5LA 3L2PA 1PZKD 2OTJA 1KRSA 2GN5A 2L9HA 4IFDJ 4DR4Q 3BVZA 2R3ZA 3O13A 5CV4A 4OWXB 1D7QA 2EYJA 2R93H 3S2DH 1BNZA 4CKEA 5CYUA 3PO3H 2BH8A 1YBYA 1SE4A 1II3A 2Z9HA 4BY7G 2K05A 2EY2A 1KAAA 4BY1H 4WJ4A 5AJ3Q 3TP6A 3S16H 5JPMC 4DU9A 1NMFA 3RZDB 1QOHA 1HNWQ 3T1YL 4I7AA 4TVAB 2JQOA 5CV7A 1CZGA 2A6EC 1N33Q 3JAMc 2QCPX 1JQYD 2BOSA 3EA6A 2BE5C 3NSWA 3SGIA 5I6WA 1C8CA 2Z6KC 1HNZQ 4HIKA 4TQUS 5GQOA 5HGTA 2B2TC 2IPKD 1Y1WH 3QJYA 5K36H 2K33A 3OMGA 2J7ZA 5IT9c 1DJRD 1TU2B 4GOPB 1LTBD 5EBDA 3EN2A 3KYHC 1T9HA 4K6LA 3U50C 1HA6A 4H44C 4RG1A 1VQ9A 3GV6A 4QMGA 1SYCA 1JB7A 2K4KA 3K5OA 2UXBQ 1RIPA 1QZGA 1IKLA 1DCZA 3MTSA 4DK0A 4ULLA 3HOVH 1RL2A 5EKIA 3I8ZA 1X3GA 1STNA 5ELBA 3TEHB 3GTMB 3U4ZA 4DR6L 1K83H 2E74C 5JOBA 3OTOQ 4A3EB 4CDEC 3PQIA 2BH2A 3CCEA 4ZYSA 1Q82C 3K58A 3SE0A 4JI4L 1KD1C 2I46A 4K0KL 2JA5H 1HRJA 1S40A 2LKVA 1R9TB 4L6TB 1HHVA 1UWVA 4LF9Q 1LM0A 1HQRD 1JB3A 1LTID 5IP9H 3K59A 2OQ0A 4A3EG 2F0PA 3I4NG 3JC66 1A2UA 1KL9A 3I7FA 2H5XA 3HOYB 2YTVA 5JAVA 5IWAQ 4MNOA 3HOZH 3NWSA 3GQBA 4RCOA 1Y1WG 1HZ9A 2E8GA 4WRDA 2KHJA 1GHJA 1SAPA 1VS0A 3FDTA 5KIXA 3TN2A 3S14B 3HGBA 3WWVA 3QWNA
chains in the Genus database with same CATH topology
4B3MQ 1KC8C 3F2BA 3KOJA 4Y7NH 2VL6A 3PGZA 1I3QH 2B3GA 2A1AA 3S1QH 5M5WH 2I5LX 1JMCA 3RLOA 3KFUA 3OYYA 1HR0L 1NE3A 3Q8DA 4MZ9A 1XNRL 2E2HH 1JJCB 2DUDA 2R6GA 1N9WA 4IPDA 4QIWE 4EQ5A 1QZHA 3TS0A 1K9MC 4GKJL 2VNUD 3PIOA 2PQAB 5M3MH 4HJ5A 3BU2A 4LFCL 5M5XH 4Y52H 3PUZA 1GO3E 5C0XG 2KHIA 3PCOB 2GVBA 5IP7H 1N32Q 3HKSA 5JEAJ 5IWAL 4X65Q 4IOCA 4B3TQ 4LUZA 1VQEA 1PV4A 1IBML 3ULPA 3TRZA 4B3RQ 2UXDQ 4QQBX 4IPCA 4A3CH 3F1ZA 4LUVA 2NZHA 4DR7L 1K73C 1CSPA 4H02A 3GO5A 4UP9A 3I56A 1J6QA 1UE5A 1V43A 3HOXG 1GM5A 3EIVA 1BVSA 2IY5B 5IP7G 3CCSA 4DV6L 4AH6A 3T1HQ 4HJ8A 4DR3L 4XIGS 4DV5L 3TQYA 4BXXH 4A3LG 3GTPH 3PV0A 2XGTA 2ZJRA 4DV6Q 3RZDH 2N3SA 1SR3A 4DR4L 4A75A 4PZ7A 4AQYQ 4DV7L 1HH2P 2RCNA 3MXNB 3M4QA 4C3IH 1HNXQ 1EWIA 1QVFA 2R7ZG 5JJIA 2IHFA 1XNRQ 1Q1BA 4YCUA 3A5UA 2WAQE 3PUWA 3K8AA 4DV4Q 1PYSB 3KF6A 4DV7Q 3VDYA 5AJ3L 1NJIC 2IHEA 1IL2A 2R7FA 3UDIA 3S15H 3U4VA 1VQIA 2CKZB 1Y1VH 1Z9FA 5C44H 4IO9A 4IFDG 2AMCB 1PH2A 2K52A 5GAEC 2N78A 4NXMQ 4OWWB 1PH3A 4APVA 1AE3A 1IYJB 4DK6C 3CMEA 2UU9Q 2JA6G 5IYDH 3E9IA 4JCVE 1WOCA 4A3FH 4BBSH 2K5NA 2NZOA 4A3DG 1OXUA 4WJ3M 3CCUA 1PVOA 3RLNA 3GTJH 2ZTDA 1S72A 3STBC 1N33L 4X6AH 3CMAA 1WFQA 2RHQB 3KLWA 2VQFQ 4JBJA 1CKOA 1NY4A 4DR5L 1R9TH 3EBEA 5IE8A 1X65A 5IP9G 4A3GH 4ME3A 2OCEA 4DUYQ 5IYBG 1PH8A 4JI8L 1YJ9A 3KF6B 1YHQA 4DR1L 1E22A 2CQOA 3G4SA 1HNZL 3H3VH 3D31A 1X3FA 1HR0W 4GNXB 1L1OA 4JI6Q 2ZTEA 3RR5A 2HHHQ 4P75A 3ZJYC 4POFA 3CCRA 4GNXC 1XMQQ 2ZJPA 4JBMA 4OX9L 3FKIG 3CD6A 2L15A 1ASZA 3UDFA 3RN5A 2MNAA 1AE2A 4BA2I 2D0PA 4KHPL 4R4TA 3CCVA 4LFAQ 4JI2Q 2YV5A 4IFDI 4P74A 1Q46A 1PH7A 2KCTA 4YHHQ 4DPGA 1JJGA 1J5EQ 1IBKQ 2VQEL 3I4MH 1G51A 3UDXA 1EOVA 4AIMA 3RNUA 4A3KG 4JI7L 3GDEA 3NEMA 1XPRA 1WCMG 1P16A 5H1SE 1YI2A 1YIJA 1P8LA 2HQLA 1J5EL 1IBKL 1CUKA 2BA1A 3CC2A 2RHSB 4JI4Q 2GVAA 1XNQQ 1PFSA 1VQDA 2VUMH 2ZTCA 4DAYB 3UE1A 4X62Q 1PH4A 1HR0Q 3GTLH 1E3PA 5C3EG 3I4NH 3J81c 2HT1A 2OQKA 3G6EA 1X3EA 1Q12A 1SFOH 4A93H 1YHAA 1L2FA 5DLQE 1IZ6A 2F4VL 2ZJQA 2JK8A 2UXCL 3TREA 4A3KH 3ULLA 1N32L 4JG2A 3HOWH 4X65L 1TWHH 1VQBA 4BY1G 4B3TL 2ATWA 1VQKA 2JA5G 1EYGA 4B3SL 1PH5A 4JOIC 4P73A 4X66L 1D8LA 4HJ7A 4FDBA 1N34Q 4LF6L 1BBUA 4LF7L 4A3IH 4A3JH 3OW2A 2QA4A 3F2CA 1SROA 2K75A 2FXQA 5C44G 3CCQA 2Z6KA 4LF6Q 2B29A 4QY7A 1K8AC 3AFQA 5C0XI 3CC4A 2Q2HA 1YJWA 1SMXA 4PMWA 1UEBA 2PMZE 2Q2IA 2KBNA 3J80i 2VQEQ 4GNXA 4DR3Q 1FJGQ 5JJLA 2I5HA 4A3BH 2YU9H 4JI0L 2MQHA 4YY3L 1JJ2A 2AKWB 2F52A 3DLLA 3RN2A 4DR6L 3S14H 4GS3A 1C9OA 4A3MH 1VQAA 3K7AH 1PYBA 4L5TA 5GADC 4LF5L 1MIUA 3STBD 1PH6A 2YTXA 5GAGC 4DR6Q 4GKKL 3L0OA 3S17H 1WYDA 1LYLA 1JE5A 4GN4B 4C3JH 4JI3L 5HGQA 4GOPC 2R92H 1X54A 2IT1A 1A63A 4DV2L 1AH9A 3CPWA 1HZCA 2UUAL 1X56A 3CW2C 1MJEA 4KLKA 5BR8L 1E1OA 3AYHB 5C0XJ 1U5KA 4DV1L 5LMNL 2MO1A 4DV2Q 3FKIH 4YWKA 1KAWA 1YHBA 4C2MH 3CCJA 2UUBL 3NENA 1KHIA 2VS1A 1YZ6A 2LXJA 4GOPA 2I0QA 4B3RL 1BBWA 5C4XG 3HOYG 2JEBI 2JJQA 4JC0A 3HKZE 4DV3L 1HJPA 5C3EH 4LFCQ 2R92G 1Y1VG 3CF5A 1A0IA 3J7ZC 4NXNQ 2B63H 2R7ZH 1W3SA 1EIYB 2LSSA 3HOUH 2EQSA 2Y0SG 1EQQA 3KJPA 1Q8KA 4HJAA 4POGA 3I4MG 1VQHA 3PSIA 1OXVA 4XTCS 4AYBE 2QEXA 4A3FG 1XTDA 4P72A 2Y0SE 4QGUA 4R1JA 4O2DA 4R4OA 5HY6A 2UU9L 4ALPA 3ERSX 4DV4L 3PIPA 1Q86C 3GTGH 4AYBG 5ELNA 4BBRG 2OTLA 3M85A 4NB3A 4L5SA 3S1NH 3NELA 2VY3A 4IJHA 4JOIA 3JAMi 4DV1Q 4BA1I 4AQYL 1PH1A 1FVIA 1H95A 4LW1A 4KHZA 2NVQH 2WB1E 1Q1EA 1E24A 4DV5Q 2EXDA 4DV3Q 1VQGA 1M90C 1S3OA 4GLVB 4UP8A 1EUJA 1QUQB 3HOZG 4MTNA 4GKJQ 4A3MG 4PG3A 4A93G 2K50A 2IX0A 3FP9A 3W1GA 2WFWA 4X62L 1C7YA 2CFMA 2JA8H 2HIXA 1G6PA 1BKBA 1IBLL 3PF5A 1KXLA 4A3BG 2A19A 2JA9A 1WCMH 1OXTA 1Z47A 2BA0A 4LFAL 4IPGA 4YWMA 5IYDG 3CCMA 2JA6H 3GTQH 5C4XH 2C35B 5E7NA 1LUZA 3I55A 4BBSG 1VQLA 4DR2L 3S24A 3LGJA 1WJJA 5K36G 5C4JH 1KQSA 4LFBQ 3CAMA 1QVCA 3CXCA 3PO2H 1QVGA 1I94Q 2HIVA 2D62A 1O7IA 1YVCA 1X55A 1L1OC 2CCZA 5M3FH 2NVXH 3HOUG 1SLJA 3RLFA 2VUMG 1I6HH 3IRBA 2AWNA 4HJ9A 3ULJA 1Q81C 2V1CC 3BZKA 4YCVA 1K0RA 4HIDA 1HZAA 3HOYH 4JI7Q 1DGSA 5FJ8G 2E5LL 4JBKA 3M7NA 4B3SQ 1VQJA 1B8AA 1SRUA 2HHHL 2K14A 2Q2UA 3AFPA 4BXXG 2OWOA 4A4IA 5LMNW 2UUCQ 4YHHL 1IXRA 2R7DA 3CCLA 4JI5Q 1K8GA 4KI0A 3GD7A 1B7YB 1K3RA 2RF4A 1CSQA 3B6YA 4RMFA 3HOXH 2EIFA 4DR7Q 5M5YH 5BR8Q 4JI5L 4DV0Q 5LMUL 5GROA 4J15A 1L0WA 4A3IG 2N8NA 3PUXA 3U58A 1VQFA 4A3JG 5FLMG 4A3CG 1XPUA 4JV5Q 1VQCA 3KDFB 4DV0L 5ELOA 4HIOA 3AQQA 3PUYA 1OTCA 2ALYB 4OXPA 2JEAI 4OO1I 4EX5A 4O0AA 3CPFA 1XNQL 4JI8Q 4NXNL 1VQPA 4R4CA 1HNXL 1VCIA 4LF8Q 4LF9L 2A8VA 3HOVG 3J7A5 1TWFH 1W2BA 1YJNA 3K0XA 2NVYH 4JI3Q 1MJCA 3CP0A 4DKAC 3K7UC 1YEZA 2VW9A 1CKMA 1G291 2PI2E 1XMQL 4X64Q 4JI0Q 1VQ6A 3OTOL 4DUZL 3H3VI 3GTOH 1WI5A 4JBWA 2UXCQ 2F4VQ 2IX1A 4GN5A 5GAHC 2MFIA 4B3ML 4A3LH 4X64L 5JJKA 3PO3G 3A74A 1X9NA 1N36L 4X66Q 2E2JH 4JI2L 3PO2G 2WP8J 3KF8B 3HOWG 4QL5A 2ZM6Q 4YY3Q 1EQRA 1N36Q 1VQMA 1GD7A 3I2ZA 1A8VA 2VZAA 4OWTB 1N8RC 4LUOA 5IYCH 3BZCA 3J81j 1NBWA 4R4IA 2E2IH 4PZ6A 1HZBA 2ES2A 3W5OA 4JV5L 2YTYA 5FLXc 1OXSC 5LMNQ 3HFZB 4GKKQ 4LF5Q 2PNHA 2UUBQ 2B63G 4LF4L 2N49A 3I4OA 3KJOA 3L2PA 3S2HH 1QUQA 1UE1A 1U0LA 2OTJA 1KRSA 2PQAA 3S1RH 3M4PA 2UXDL 3F8TA 5IYBH 1VQ4A 2GN5A 1A62A 4IFDJ 4R4QA 4DR4Q 1FL0A 1GKHA 4JI6L 1IBLQ 3NBHB 2K5VA 2D0OA 4OWXB 3T1HL 3AEVA 1D7QA 5J3BA 3S2DH 4YWLA 4LF7Q 2R93H 1GVPA 1B70B 5FLMH 3PO3H 1VQ5A 1TWGH 4A3DH 2CWPA 2BH8A 3H0GH 4UP7A 1YBYA 3J80c 3FHWA 3PUVA 2ID0A 1VQ8A 4HIMA 2NN6G 4BY7G 4IOAA 3M3YH 1FJGL 2JA8G 2Z0SA 2F3IA 1XJVA 1TWCH 1JT8A 4BY1H 4WJ4A 5AJ3Q 3S16H 3S1MH 4PZ8A 1YNXA 1NMFA 3BJUA 1KIXA 1HNWQ 3T1YL 1SE8A 2I5MX 5M3MG 4TVAB 3ICEA 2JQOA 3M4OH 4K0KQ 3K81C 4JYAL 1V1QA 2KENA 2WB1G 4LNQA 1N33Q 3JAMc 4NXML 2JA7H 5EAYA 4UPAA 1NTGA 4DR5Q 1I50H 4BY7H 3J81i 3E9HA 1IBMQ 2E5LQ 1C0AA 3SGIA 2QGQA 2JE6I 4DK3C 4GLAC 2Z6KC 1HNZQ 3D0FA 4HIKA 1TWAH 1OXXK 4KHPQ 4IJLA 4TQUS 5GQOA 3RZOH 2AWOA 3H15A 1Y1WH 2VQFL 5IT9c 1PA6A 1L1OB 1E1TA 4GOPB 2MO0A 1LTLA 5FJ8H 3EN2A 3KYHC 1T9HA 3U50C 2NVTH 4RG1A 1NMGA 3L7ZC 3F2DA 1Q7YC 1VQ9A 1JB7A 1EFWA 2K4KA 4A3EH 4LFBL 1SN8A 2UXBQ 2KCMA 3MEFA 4IPHA 1RIPA 1XMOQ 1QZGA 2DGYA 1HNWL 1E7ZA 3T1YQ 2UXBL 5JEAG 2AHOB 1PH9A 4GN3B 4DAMA 4L5RC 3HOVH 1X6OA 3GTKH 1RL2A 3K80C 2LXKA 3KDFA 1PHJA 1X3GA 4JYAQ 4NPSA 3TEHB 3U4ZA 4JI1L 1K83H 3DM3A 3UE0A 3W1BA 4C3HH 3OTOQ 4DUZQ 2K5HA 4DR1Q 3H0GG 2BH2A 4LWCA 3CCEA 1XPOA 4OX9Q 3A0JA 1UE7A 1Q82C 2Q2TA 1ASYA 3HKZG 2UUAQ 4DR2Q 1VQ7A 4DNIA 1EIFA 4UY8C 1TXYA 4JI4L 4YCWA 1UE6A 1KD1C 2R93G 1I5FA 3UDGA 1I94L 3G71A 4K0KL 2JA5H 3E0EA 1S40A 2ASBA 2YYZA 1UWVA 4LF8L 1LM0A 4LF9Q 2PI2A 4DUYL 5LMUQ 5IP9H 4A3GG 2WAQG 2OQ0A 3G48A 1XMOL 4A3EG 2JA7G 4LF4Q 3I4NG 3JC66 5M3FG 2UUCL 3CQZH 2NN6I 1KL9A 1Y14B 2H5XA 3I7FA 1V9PA 3M9BA 1M1KC 1MKHA 2YTVA 4QJFA 5IY0A 5IWAQ 5IYCG 3GTMH 4MNOA 1YITA 2XTIA 3PF4A 3HOZH 1VQNA 4JI1Q 1Y1WG 3ER0A 1HZ9A 2E8GA 1KRTA 4OO1G 2KHJA 4BBRH 3A5ZB 2ZM6L 4A76A 1VQOA 1VS0A 2CWAA 1CKNB 4P71A 4L5QA 3CC7A 4GLXA 1FGUA 1CKNA 4OONA 1N34L 3TS2A 3WWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M Q;  1KC8 C;  3F2B A;  3KOJ A;  4Y7N H;  2VL6 A;  3PGZ A;  1I3Q H;  2B3G A;  2A1A A;  3S1Q H;  5M5W H;  2I5L X;  1JMC A;  3RLO A;  3KFU A;  3OYY A;  1HR0 L;  1NE3 A;  3Q8D A;  4MZ9 A;  1XNR L;  2E2H H;  1JJC B;  2DUD A;  2R6G A;  1N9W A;  4IPD A;  4QIW E;  4EQ5 A;  1QZH A;  3TS0 A;  1K9M C;  4GKJ L;  2VNU D;  3PIO A;  2PQA B;  5M3M H;  4HJ5 A;  3BU2 A;  4LFC L;  5M5X H;  4Y52 H;  3PUZ A;  1GO3 E;  5C0X G;  2KHI A;  3PCO B;  2GVB A;  5IP7 H;  1N32 Q;  3HKS A;  5JEA J;  5IWA L;  4X65 Q;  4IOC A;  4B3T Q;  4LUZ A;  1VQE A;  1PV4 A;  1IBM L;  3ULP A;  3TRZ A;  4B3R Q;  2UXD Q;  4QQB X;  4IPC A;  4A3C H;  3F1Z A;  4LUV A;  2NZH A;  4DR7 L;  1K73 C;  1CSP A;  4H02 A;  3GO5 A;  4UP9 A;  3I56 A;  1J6Q A;  1UE5 A;  1V43 A;  3HOX G;  1GM5 A;  3EIV A;  1BVS A;  2IY5 B;  5IP7 G;  3CCS A;  4DV6 L;  4AH6 A;  3T1H Q;  4HJ8 A;  4DR3 L;  4XIG S;  4DV5 L;  3TQY A;  4BXX H;  4A3L G;  3GTP H;  3PV0 A;  2XGT A;  2ZJR A;  4DV6 Q;  3RZD H;  2N3S A;  1SR3 A;  4DR4 L;  4A75 A;  4PZ7 A;  4AQY Q;  4DV7 L;  1HH2 P;  2RCN A;  3MXN B;  3M4Q A;  4C3I H;  1HNX Q;  1EWI A;  1QVF A;  2R7Z G;  5JJI A;  2IHF A;  1XNR Q;  1Q1B A;  4YCU A;  3A5U A;  2WAQ E;  3PUW A;  3K8A A;  4DV4 Q;  1PYS B;  3KF6 A;  4DV7 Q;  3VDY A;  5AJ3 L;  1NJI C;  2IHE A;  1IL2 A;  2R7F A;  3UDI A;  3S15 H;  3U4V A;  1VQI A;  2CKZ B;  1Y1V H;  1Z9F A;  5C44 H;  4IO9 A;  4IFD G;  2AMC B;  1PH2 A;  2K52 A;  5GAE C;  2N78 A;  4NXM Q;  4OWW B;  1PH3 A;  4APV A;  1AE3 A;  1IYJ B;  4DK6 C;  3CME A;  2UU9 Q;  2JA6 G;  5IYD H;  3E9I A;  4JCV E;  1WOC A;  4A3F H;  4BBS H;  2K5N A;  2NZO A;  4A3D G;  1OXU A;  4WJ3 M;  3CCU A;  1PVO A;  3RLN A;  3GTJ H;  2ZTD A;  1S72 A;  3STB C;  1N33 L;  4X6A H;  3CMA A;  1WFQ A;  2RHQ B;  3KLW A;  2VQF Q;  4JBJ A;  1CKO A;  1NY4 A;  4DR5 L;  1R9T H;  3EBE A;  5IE8 A;  1X65 A;  5IP9 G;  4A3G H;  4ME3 A;  2OCE A;  4DUY Q;  5IYB G;  1PH8 A;  4JI8 L;  1YJ9 A;  3KF6 B;  1YHQ A;  4DR1 L;  1E22 A;  2CQO A;  3G4S A;  1HNZ L;  3H3V H;  3D31 A;  1X3F A;  1HR0 W;  4GNX B;  1L1O A;  4JI6 Q;  2ZTE A;  3RR5 A;  2HHH Q;  4P75 A;  3ZJY C;  4POF A;  3CCR A;  4GNX C;  1XMQ Q;  2ZJP A;  4JBM A;  4OX9 L;  3FKI G;  3CD6 A;  2L15 A;  1ASZ A;  3UDF A;  3RN5 A;  2MNA A;  1AE2 A;  4BA2 I;  2D0P A;  4KHP L;  4R4T A;  3CCV A;  4LFA Q;  4JI2 Q;  2YV5 A;  4IFD I;  4P74 A;  1Q46 A;  1PH7 A;  2KCT A;  4YHH Q;  4DPG A;  1JJG A;  1J5E Q;  1IBK Q;  2VQE L;  3I4M H;  1G51 A;  3UDX A;  1EOV A;  4AIM A;  3RNU A;  4A3K G;  4JI7 L;  3GDE A;  3NEM A;  1XPR A;  1WCM G;  1P16 A;  5H1S E;  1YI2 A;  1YIJ A;  1P8L A;  2HQL A;  1J5E L;  1IBK L;  1CUK A;  2BA1 A;  3CC2 A;  2RHS B;  4JI4 Q;  2GVA A;  1XNQ Q;  1PFS A;  1VQD A;  2VUM H;  2ZTC A;  4DAY B;  3UE1 A;  4X62 Q;  1PH4 A;  1HR0 Q;  3GTL H;  1E3P A;  5C3E G;  3I4N H;  3J81 c;  2HT1 A;  2OQK A;  3G6E A;  1X3E A;  1Q12 A;  1SFO H;  4A93 H;  1YHA A;  1L2F A;  5DLQ E;  1IZ6 A;  2F4V L;  2ZJQ A;  2JK8 A;  2UXC L;  3TRE A;  4A3K H;  3ULL A;  1N32 L;  4JG2 A;  3HOW H;  4X65 L;  1TWH H;  1VQB A;  4BY1 G;  4B3T L;  2ATW A;  1VQK A;  2JA5 G;  1EYG A;  4B3S L;  1PH5 A;  4JOI C;  4P73 A;  4X66 L;  1D8L A;  4HJ7 A;  4FDB A;  1N34 Q;  4LF6 L;  1BBU A;  4LF7 L;  4A3I H;  4A3J H;  3OW2 A;  2QA4 A;  3F2C A;  1SRO A;  2K75 A;  2FXQ A;  5C44 G;  3CCQ A;  2Z6K A;  4LF6 Q;  2B29 A;  4QY7 A;  1K8A C;  3AFQ A;  5C0X I;  3CC4 A;  2Q2H A;  1YJW A;  1SMX A;  4PMW A;  1UEB A;  2PMZ E;  2Q2I A;  2KBN A;  3J80 i;  2VQE Q;  4GNX A;  4DR3 Q;  1FJG Q;  5JJL A;  2I5H A;  4A3B H;  2YU9 H;  4JI0 L;  2MQH A;  4YY3 L;  1JJ2 A;  2AKW B;  2F52 A;  3DLL A;  3RN2 A;  4DR6 L;  3S14 H;  4GS3 A;  1C9O A;  4A3M H;  1VQA A;  3K7A H;  1PYB A;  4L5T A;  5GAD C;  4LF5 L;  1MIU A;  3STB D;  1PH6 A;  2YTX A;  5GAG C;  4DR6 Q;  4GKK L;  3L0O A;  3S17 H;  1WYD A;  1LYL A;  1JE5 A;  4GN4 B;  4C3J H;  4JI3 L;  5HGQ A;  4GOP C;  2R92 H;  1X54 A;  2IT1 A;  1A63 A;  4DV2 L;  1AH9 A;  3CPW A;  1HZC A;  2UUA L;  1X56 A;  3CW2 C;  1MJE A;  4KLK A;  5BR8 L;  1E1O A;  3AYH B;  5C0X J;  1U5K A;  4DV1 L;  5LMN L;  2MO1 A;  4DV2 Q;  3FKI H;  4YWK A;  1KAW A;  1YHB A;  4C2M H;  3CCJ A;  2UUB L;  3NEN A;  1KHI A;  2VS1 A;  1YZ6 A;  2LXJ A;  4GOP A;  2I0Q A;  4B3R L;  1BBW A;  5C4X G;  3HOY G;  2JEB I;  2JJQ A;  4JC0 A;  3HKZ E;  4DV3 L;  1HJP A;  5C3E H;  4LFC Q;  2R92 G;  1Y1V G;  3CF5 A;  1A0I A;  3J7Z C;  4NXN Q;  2B63 H;  2R7Z H;  1W3S A;  1EIY B;  2LSS A;  3HOU H;  2EQS A;  2Y0S G;  1EQQ A;  3KJP A;  1Q8K A;  4HJA A;  4POG A;  3I4M G;  1VQH A;  3PSI A;  1OXV A;  4XTC S;  4AYB E;  2QEX A;  4A3F G;  1XTD A;  4P72 A;  2Y0S E;  4QGU A;  4R1J A;  4O2D A;  4R4O A;  5HY6 A;  2UU9 L;  4ALP A;  3ERS X;  4DV4 L;  3PIP A;  1Q86 C;  3GTG H;  4AYB G;  5ELN A;  4BBR G;  2OTL A;  3M85 A;  4NB3 A;  4L5S A;  3S1N H;  3NEL A;  2VY3 A;  4IJH A;  4JOI A;  3JAM i;  4DV1 Q;  4BA1 I;  4AQY L;  1PH1 A;  1FVI A;  1H95 A;  4LW1 A;  4KHZ A;  2NVQ H;  2WB1 E;  1Q1E A;  1E24 A;  4DV5 Q;  2EXD A;  4DV3 Q;  1VQG A;  1M90 C;  1S3O A;  4GLV B;  4UP8 A;  1EUJ A;  1QUQ B;  3HOZ G;  4MTN A;  4GKJ Q;  4A3M G;  4PG3 A;  4A93 G;  2K50 A;  2IX0 A;  3FP9 A;  3W1G A;  2WFW A;  4X62 L;  1C7Y A;  2CFM A;  2JA8 H;  2HIX A;  1G6P A;  1BKB A;  1IBL L;  3PF5 A;  1KXL A;  4A3B G;  2A19 A;  2JA9 A;  1WCM H;  1OXT A;  1Z47 A;  2BA0 A;  4LFA L;  4IPG A;  4YWM A;  5IYD G;  3CCM A;  2JA6 H;  3GTQ H;  5C4X H;  2C35 B;  5E7N A;  1LUZ A;  3I55 A;  4BBS G;  1VQL A;  4DR2 L;  3S24 A;  3LGJ A;  1WJJ A;  5K36 G;  5C4J H;  1KQS A;  4LFB Q;  3CAM A;  1QVC A;  3CXC A;  3PO2 H;  1QVG A;  1I94 Q;  2HIV A;  2D62 A;  1O7I A;  1YVC A;  1X55 A;  1L1O C;  2CCZ A;  5M3F H;  2NVX H;  3HOU G;  1SLJ A;  3RLF A;  2VUM G;  1I6H H;  3IRB A;  2AWN A;  4HJ9 A;  3ULJ A;  1Q81 C;  2V1C C;  3BZK A;  4YCV A;  1K0R A;  4HID A;  1HZA A;  3HOY H;  4JI7 Q;  1DGS A;  5FJ8 G;  2E5L L;  4JBK A;  3M7N A;  4B3S Q;  1VQJ A;  1B8A A;  1SRU A;  2HHH L;  2K14 A;  2Q2U A;  3AFP A;  4BXX G;  2OWO A;  4A4I A;  5LMN W;  2UUC Q;  4YHH L;  1IXR A;  2R7D A;  3CCL A;  4JI5 Q;  1K8G A;  4KI0 A;  3GD7 A;  1B7Y B;  1K3R A;  2RF4 A;  1CSQ A;  3B6Y A;  4RMF A;  3HOX H;  2EIF A;  4DR7 Q;  5M5Y H;  5BR8 Q;  4JI5 L;  4DV0 Q;  5LMU L;  5GRO A;  4J15 A;  1L0W A;  4A3I G;  2N8N A;  3PUX A;  3U58 A;  1VQF A;  4A3J G;  5FLM G;  4A3C G;  1XPU A;  4JV5 Q;  1VQC A;  3KDF B;  4DV0 L;  5ELO A;  4HIO A;  3AQQ A;  3PUY A;  1OTC A;  2ALY B;  4OXP A;  2JEA I;  4OO1 I;  4EX5 A;  4O0A A;  3CPF A;  1XNQ L;  4JI8 Q;  4NXN L;  1VQP A;  4R4C A;  1HNX L;  1VCI A;  4LF8 Q;  4LF9 L;  2A8V A;  3HOV G;  3J7A 5;  1TWF H;  1W2B A;  1YJN A;  3K0X A;  2NVY H;  4JI3 Q;  1MJC A;  3CP0 A;  4DKA C;  3K7U C;  1YEZ A;  2VW9 A;  1CKM A;  1G29 1;  2PI2 E;  1XMQ L;  4X64 Q;  4JI0 Q;  1VQ6 A;  3OTO L;  4DUZ L;  3H3V I;  3GTO H;  1WI5 A;  4JBW A;  2UXC Q;  2F4V Q;  2IX1 A;  4GN5 A;  5GAH C;  2MFI A;  4B3M L;  4A3L H;  4X64 L;  5JJK A;  3PO3 G;  3A74 A;  1X9N A;  1N36 L;  4X66 Q;  2E2J H;  4JI2 L;  3PO2 G;  2WP8 J;  3KF8 B;  3HOW G;  4QL5 A;  2ZM6 Q;  4YY3 Q;  1EQR A;  1N36 Q;  1VQM A;  1GD7 A;  3I2Z A;  1A8V A;  2VZA A;  4OWT B;  1N8R C;  4LUO A;  5IYC H;  3BZC A;  3J81 j;  1NBW A;  4R4I A;  2E2I H;  4PZ6 A;  1HZB A;  2ES2 A;  3W5O A;  4JV5 L;  2YTY A;  5FLX c;  1OXS C;  5LMN Q;  3HFZ B;  4GKK Q;  4LF5 Q;  2PNH A;  2UUB Q;  2B63 G;  4LF4 L;  2N49 A;  3I4O A;  3KJO A;  3L2P A;  3S2H H;  1QUQ A;  1UE1 A;  1U0L A;  2OTJ A;  1KRS A;  2PQA A;  3S1R H;  3M4P A;  2UXD L;  3F8T A;  5IYB H;  1VQ4 A;  2GN5 A;  1A62 A;  4IFD J;  4R4Q A;  4DR4 Q;  1FL0 A;  1GKH A;  4JI6 L;  1IBL Q;  3NBH B;  2K5V A;  2D0O A;  4OWX B;  3T1H L;  3AEV A;  1D7Q A;  5J3B A;  3S2D H;  4YWL A;  4LF7 Q;  2R93 H;  1GVP A;  1B70 B;  5FLM H;  3PO3 H;  1VQ5 A;  1TWG H;  4A3D H;  2CWP A;  2BH8 A;  3H0G H;  4UP7 A;  1YBY A;  3J80 c;  3FHW A;  3PUV A;  2ID0 A;  1VQ8 A;  4HIM A;  2NN6 G;  4BY7 G;  4IOA A;  3M3Y H;  1FJG L;  2JA8 G;  2Z0S A;  2F3I A;  1XJV A;  1TWC H;  1JT8 A;  4BY1 H;  4WJ4 A;  5AJ3 Q;  3S16 H;  3S1M H;  4PZ8 A;  1YNX A;  1NMF A;  3BJU A;  1KIX A;  1HNW Q;  3T1Y L;  1SE8 A;  2I5M X;  5M3M G;  4TVA B;  3ICE A;  2JQO A;  3M4O H;  4K0K Q;  3K81 C;  4JYA L;  1V1Q A;  2KEN A;  2WB1 G;  4LNQ A;  1N33 Q;  3JAM c;  4NXM L;  2JA7 H;  5EAY A;  4UPA A;  1NTG A;  4DR5 Q;  1I50 H;  4BY7 H;  3J81 i;  3E9H A;  1IBM Q;  2E5L Q;  1C0A A;  3SGI A;  2QGQ A;  2JE6 I;  4DK3 C;  4GLA C;  2Z6K C;  1HNZ Q;  3D0F A;  4HIK A;  1TWA H;  1OXX K;  4KHP Q;  4IJL A;  4TQU S;  5GQO A;  3RZO H;  2AWO A;  3H15 A;  1Y1W H;  2VQF L;  5IT9 c;  1PA6 A;  1L1O B;  1E1T A;  4GOP B;  2MO0 A;  1LTL A;  5FJ8 H;  3EN2 A;  3KYH C;  1T9H A;  3U50 C;  2NVT H;  4RG1 A;  1NMG A;  3L7Z C;  3F2D A;  1Q7Y C;  1VQ9 A;  1JB7 A;  1EFW A;  2K4K A;  4A3E H;  4LFB L;  1SN8 A;  2UXB Q;  2KCM A;  3MEF A;  4IPH A;  1RIP A;  1XMO Q;  1QZG A;  2DGY A;  1HNW L;  1E7Z A;  3T1Y Q;  2UXB L;  5JEA G;  2AHO B;  1PH9 A;  4GN3 B;  4DAM A;  4L5R C;  3HOV H;  1X6O A;  3GTK H;  1RL2 A;  3K80 C;  2LXK A;  3KDF A;  1PHJ A;  1X3G A;  4JYA Q;  4NPS A;  3TEH B;  3U4Z A;  4JI1 L;  1K83 H;  3DM3 A;  3UE0 A;  3W1B A;  4C3H H;  3OTO Q;  4DUZ Q;  2K5H A;  4DR1 Q;  3H0G G;  2BH2 A;  4LWC A;  3CCE A;  1XPO A;  4OX9 Q;  3A0J A;  1UE7 A;  1Q82 C;  2Q2T A;  1ASY A;  3HKZ G;  2UUA Q;  4DR2 Q;  1VQ7 A;  4DNI A;  1EIF A;  4UY8 C;  1TXY A;  4JI4 L;  4YCW A;  1UE6 A;  1KD1 C;  2R93 G;  1I5F A;  3UDG A;  1I94 L;  3G71 A;  4K0K L;  2JA5 H;  3E0E A;  1S40 A;  2ASB A;  2YYZ A;  1UWV A;  4LF8 L;  1LM0 A;  4LF9 Q;  2PI2 A;  4DUY L;  5LMU Q;  5IP9 H;  4A3G G;  2WAQ G;  2OQ0 A;  3G48 A;  1XMO L;  4A3E G;  2JA7 G;  4LF4 Q;  3I4N G;  3JC6 6;  5M3F G;  2UUC L;  3CQZ H;  2NN6 I;  1KL9 A;  1Y14 B;  2H5X A;  3I7F A;  1V9P A;  3M9B A;  1M1K C;  1MKH A;  2YTV A;  4QJF A;  5IY0 A;  5IWA Q;  5IYC G;  3GTM H;  4MNO A;  1YIT A;  2XTI A;  3PF4 A;  3HOZ H;  1VQN A;  4JI1 Q;  1Y1W G;  3ER0 A;  1HZ9 A;  2E8G A;  1KRT A;  4OO1 G;  2KHJ A;  4BBR H;  3A5Z B;  2ZM6 L;  4A76 A;  1VQO A;  1VS0 A;  2CWA A;  1CKN B;  4P71 A;  4L5Q A;  3CC7 A;  4GLX A;  1FGU A;  1CKN A;  4OON A;  1N34 L;  3TS2 A;  3WWV A; 
#chains in the Genus database with same CATH topology
 1XYI A;  3F2B A;  4QIW B;  4KK7 A;  4KD3 A;  5CC4 A;  2B3G A;  3S2D B;  5M5W H;  2K04 A;  2P5Z X;  3RLO A;  1NUC A;  4X3S A;  5C3X A;  3H91 A;  1HR0 L;  1NE3 A;  1PMR A;  2DUD A;  1N9W A;  4IPD A;  2VNU D;  4GKJ L;  2PQA B;  5M5X H;  1JIC A;  1F2Z A;  2SDF A;  4F88 A;  1SYB A;  3SVM A;  3HKS A;  4IOC A;  5IGD A;  4HED A;  4LUZ A;  4OEL B;  3BVM A;  1I4X A;  2UXD Q;  3F1Z A;  3ND9 A;  1EY4 A;  3VYS A;  1T5X D;  3GO5 A;  4H02 A;  3I56 A;  1BOS A;  1UE5 A;  2EPB A;  1GM5 A;  3HOX G;  1GHK A;  2N55 A;  4RAU C;  4XYQ A;  1BVS A;  4A93 B;  2IY5 B;  1A2T A;  3CCS A;  3K5M A;  3T1H Q;  3Q22 A;  4HJ8 A;  4DR3 L;  3L9A X;  3S1Q B;  3TQY A;  4A3L G;  3UI2 A;  3GTP H;  1G8Z D;  3M4Y A;  2N3S A;  2NZ1 D;  4IQZ A;  3HOZ G;  4A93 G;  2SNS A;  4C3I H;  4XT1 B;  2K01 A;  5JJI A;  2AQ2 B;  1EYD A;  4DN4 M;  4DV4 Q;  2WAQ E;  1PYS B;  3KF6 A;  4FXD A;  5AJ3 L;  3U4V A;  2CKZ B;  1Y8O B;  2K03 A;  4IFD G;  1F9R A;  2N88 A;  4DAV A;  2N78 A;  4NXM Q;  1X32 A;  4APV A;  1GJX A;  3MC0 B;  2JA6 G;  2B63 B;  4JCV E;  4MHE A;  2K5N A;  3RLN A;  3GTJ H;  2ZTD A;  1TY0 A;  1N33 L;  1AW7 A;  4N8X 1;  2VQF Q;  1CKO A;  4DR5 L;  3QOJ A;  5IE8 A;  1DOK A;  2KHS A;  4DUY Q;  5EKL A;  1PH8 A;  2AUJ D;  4KY6 A;  2CQO A;  3H3V H;  1IYU A;  3D31 A;  3RR5 A;  3E0J A;  2HHH Q;  4POF A;  4CDC C;  5DAU A;  2L15 A;  4F87 A;  1ASZ A;  3NE5 B;  5IGC A;  1PRT C;  4JI2 Q;  4H7B A;  4P74 A;  5KNC A;  1AEX A;  2CVR A;  4DPG A;  1IBK Q;  1JJG A;  5JEA H;  3S1M B;  2EY1 A;  3GDE A;  1IBK L;  1P16 A;  1P8L A;  4JI4 Q;  1CUK A;  2VUM H;  3CC2 A;  2RHS B;  2GVA A;  1PFS A;  1VQD A;  3I90 A;  3PIP 3;  2ZTC A;  3GTQ B;  4X62 Q;  1PH4 A;  3GTL H;  1A3U A;  3J81 c;  3DEP A;  3SDZ A;  1C48 A;  1ZEQ X;  2O2L D;  1RJT A;  2ZJQ A;  3ULL A;  5C4X B;  3Q24 A;  2X6G A;  4BY1 G;  3WOF A;  1VQK A;  3H3V C;  1D8L A;  2MP1 A;  1T5E A;  4LF7 L;  3N6R A;  3F2C A;  1SRO A;  3SXH A;  3CCQ A;  4LF6 Q;  2B29 A;  1F2Y A;  1TS5 A;  1XTC D;  3I4M B;  4GNX A;  3J80 i;  5JJL A;  1Y69 U;  2HDM A;  2I5H A;  1SMY D;  2YU9 H;  4A3B H;  4JI0 L;  1ENC A;  1G2S A;  3RN2 A;  4WOR A;  2MUY A;  3S14 H;  4GS3 A;  1TWG B;  1VQA A;  3TSS A;  1STY A;  5GAD C;  1MIU A;  3STB D;  4LF5 L;  2YTX A;  5GAG C;  1XX8 A;  4DR6 Q;  4GZY C;  1WYD A;  1HFG A;  3HEJ A;  1O80 A;  1VMP A;  3EVQ A;  2OEO A;  1DYQ A;  4X3K A;  1AH9 A;  1GUN A;  1WTV A;  2WV6 D;  1E1O A;  3AYH B;  1U5K A;  2F4I A;  2NVY B;  3TZD A;  1EWH A;  1KAW A;  4C2M H;  3BVG A;  1KHI A;  2I0Q A;  2LXJ A;  1HUM A;  4B3R L;  2ZXP A;  3TBI B;  2QDB A;  1Y1V G;  4NXN Q;  2B63 H;  3OSO A;  1W3S A;  1EIY B;  1PRT F;  3MXG A;  2Y0S G;  1SYF A;  1J8I A;  3PSI A;  4XTC S;  3OWE B;  4A3K B;  2E2D C;  1XTD A;  3FVQ A;  2Y0S E;  4P72 A;  2EXZ A;  3ERS X;  1F9P A;  3S9W A;  2OTL A;  3S1N H;  4C3I B;  5F2D A;  3MHB A;  4IJH A;  5K5P A;  4L63 B;  4KJN A;  3TP7 A;  4FYD A;  4KHZ A;  3VYT A;  4FNF A;  1OO9 B;  1JR0 D;  1ILP A;  2EXD A;  4RHS A;  1F9Q A;  1NCV A;  1S3O A;  3HOW B;  2CW0 C;  1SNQ A;  3DWA A;  1WTW A;  4A3M G;  3VYR A;  4PG3 A;  1CK1 A;  4X62 L;  2D9U A;  1BKB A;  2FMM A;  1TY2 A;  4RGT A;  1CHP D;  1DOM A;  4A3B G;  2ZXR A;  1WCM H;  1E0B A;  2OXP A;  4IPG A;  4HMJ A;  5IYD G;  3X3N A;  1Z7T A;  2SEB D;  1B53 A;  3GTQ H;  2RBM A;  1LAB A;  4DNT B;  5E7N A;  1LUZ A;  3NQI A;  4DR2 L;  1BQQ T;  1WJJ A;  1GUT A;  5C4J H;  4BWG B;  4G7Z C;  3PO2 H;  1QVG A;  2HIV A;  2B2U A;  2B8F A;  1YVC A;  2F0Q A;  1L1O C;  2BDO A;  5M3F H;  3HOU G;  3PO3 B;  2E76 C;  3SK5 A;  2ICI A;  3CRK C;  1SNM A;  2AWN A;  1Y1W B;  4YCV A;  4FF4 A;  5D14 A;  1Q3L A;  1S5E D;  4JI7 Q;  1V8Q A;  5FJ8 G;  4C1N I;  1SRU A;  2Q2U A;  2OWO A;  4A4I A;  3R2I A;  3KBG A;  2RF4 A;  2VUM B;  4RMF A;  4DR7 Q;  1SSO A;  3S1R B;  3C1F A;  4A3F B;  4J15 A;  4A3J G;  3TME A;  1XPU A;  4ZLT F;  4OXP A;  1FR3 A;  2BE5 D;  5LHY 1;  4NXN L;  1SYD A;  4LF9 L;  1ET6 A;  1BDO A;  1TWF H;  3ZYY X;  2KA7 A;  2L4N A;  1EY9 A;  5T1G A;  1VQ6 A;  4DUZ L;  4DAP A;  3PIO 3;  1WI5 A;  4JBW A;  3GTO H;  4QCL A;  2F4V Q;  2UXC Q;  5GAH C;  2F0N A;  2R61 A;  3GV3 A;  4B3M L;  5JJK A;  4X64 L;  3ERO A;  1CTM A;  4CJ0 B;  1A6X A;  4JI2 L;  1ONL A;  4WFN 3;  1VQM A;  1NR2 A;  1N8R C;  4LUO A;  3BZC A;  3T53 B;  2E2I H;  1TS2 A;  1HZB A;  5D3D A;  1OXS C;  1K3B C;  3RMH A;  2PNH A;  2RQX A;  3TDQ A;  2N49 A;  1C4Q A;  4PMB A;  1U0L A;  5E4X A;  2M00 A;  3S1R H;  2UXD L;  1SXT A;  1B44 D;  2F3V A;  1VQ4 A;  5FOB B;  1TQO A;  1WD1 A;  2CH4 A;  3C46 A;  2ZXO A;  1AN8 A;  2EVB A;  3EJI A;  1IBL Q;  2D0O A;  3T13 A;  3T1H L;  4LF7 Q;  1TR5 A;  1GVP A;  1B70 B;  4UHV A;  1LTS D;  2Y0S B;  3H0G H;  2RDF A;  3BYT B;  1BBX C;  2ID0 A;  3I73 A;  1PTO F;  3ND8 A;  2HUG A;  1CFM A;  3DWP A;  4JPB W;  1TWC H;  4KD4 A;  1DD2 A;  4HR7 B;  3RUZ A;  3I91 A;  5C4J B;  3R8B A;  5M3M G;  3URY A;  3PO2 B;  3ERQ A;  3K0Y A;  4FVM A;  2EYF A;  1KLU D;  2JA7 H;  4P2C B;  2JN4 A;  4BY7 H;  1IBM Q;  1C0A A;  3D4D A;  2R7Z B;  1EQV A;  2G9H D;  3D0F A;  4H0L C;  4TKO B;  3A54 A;  4YIJ A;  4HCS A;  2AWO A;  2IX3 A;  3BDC A;  3CQZ B;  1LLR D;  5M5Y B;  2EYP A;  1SJE D;  1BCP F;  1NMG A;  1Q7Y C;  3F2D A;  1STG A;  5KEE A;  1SN8 A;  2KCM A;  3MEF A;  1EZ6 A;  4ILW A;  2F0I A;  2DGY A;  3S1N B;  1YNJ D;  3I3C A;  4L5R C;  1PH9 A;  4GN3 B;  5FLX L;  1ROD A;  5ELF A;  3KDF A;  1MI2 A;  4JYA Q;  4NPS A;  4XQJ A;  2DY8 A;  3UE0 A;  4C3J B;  2R92 B;  1GUO A;  1XPO A;  5M3F B;  3D6C A;  3A0J A;  5ELE A;  5BN3 A;  1ASY A;  2UUA Q;  1WTO A;  4DR2 Q;  1VQ7 A;  1S5F D;  2B2W C;  5FKA C;  1LV9 A;  1I5F A;  5IOC A;  2YYZ A;  2PI2 A;  4DUY L;  2PCF B;  4K6D A;  1EY0 A;  1QIL A;  3G48 A;  1XWE A;  1KDC A;  5TSS A;  4CKC A;  3HP3 A;  5M3F G;  3CQZ H;  2NN6 I;  2EY6 A;  3NTI A;  1Y14 B;  3M9B A;  2JA8 B;  1M1K C;  5IY0 A;  1TT2 A;  4QJF A;  5IYC G;  1YNJ C;  3PF4 A;  2K5Q A;  1YIT A;  2B2U C;  5EKK A;  3KK7 A;  4BBR H;  2IJ0 A;  2ZM6 L;  1VQO A;  2A68 C;  2RSN A;  2WB1 B;  2EYH A;  4L5Q A;  3CC7 A;  4GLX A;  3Q23 A;  1CT1 D;  2M9V A;  1STH A;  1FNW A;  2RDG A;  4Y7N H;  1I3Q H;  3G7L A;  5NUC A;  5A35 A;  1GUW A;  5C5M A;  3KFU A;  3I72 A;  3H0G B;  3OYY A;  1XNR L;  2HCC A;  2E2H H;  2R6G A;  4QIW E;  1S4Z A;  1K9M C;  4EQ5 A;  3TS0 A;  2Q8I B;  3PIO A;  5M3M H;  2H4O A;  3M7G A;  3PUZ A;  1G91 A;  2WAC A;  5G3L D;  2GVB A;  5IP7 H;  2QEJ C;  1SND A;  2RA4 A;  3KBX A;  3ULP A;  3TRZ A;  4B3R Q;  4IPC A;  4LUV A;  4O1N A;  2NZH A;  1CSP A;  2JYO A;  4H13 C;  3SK6 A;  3EIV A;  4ZUI A;  2O5I C;  1YNN C;  2K7V A;  4XDX A;  4XIG S;  4DV5 L;  4BXX H;  1NR4 A;  1M8A A;  1SR3 A;  1H9R A;  5I4D A;  4DR4 L;  4PZ7 A;  1QVF A;  1HNX Q;  3M4Q A;  3T4A C;  1XNR Q;  3A5U A;  4PV1 C;  1EY5 A;  3VDY A;  4DV7 Q;  1GXD C;  1M4V A;  1W6K A;  5DNF A;  4OL7 A;  3S15 H;  1VQI A;  1S5C D;  1Y1V H;  4QUC A;  1EZ8 A;  1EIG A;  2K52 A;  5GAE C;  4OWW B;  1MSG A;  2D2C C;  3E9I A;  3FEW X;  3T56 B;  4BBS H;  3A56 A;  2EJF C;  2EE1 A;  2EDG A;  3STB C;  2RHQ B;  3KLW A;  4RKL A;  4K2K A;  1X65 A;  4ME3 A;  4A3I B;  3T51 B;  1X3F A;  1HR0 W;  4JI6 Q;  4GNX C;  4JBM A;  4X3T A;  3CD6 A;  2XVS A;  1JCK B;  3UDF A;  3RN5 A;  4ZQ3 A;  2D0P A;  2Z1C A;  4R4T A;  3SEB A;  2TSS A;  4LJZ C;  3QO2 A;  2LFN A;  4RGN A;  4HTH A;  1SNC A;  2KCT A;  2KEE A;  2OF1 A;  3GTP B;  1G51 A;  1EOV A;  4AIM A;  1J5E L;  1YI2 A;  5H1S E;  3FMC A;  1YIJ A;  4KN7 C;  5EGT A;  1RF2 D;  1MD2 D;  4ID6 A;  2XN9 C;  3I4N H;  3G6E A;  4C56 C;  4L8J A;  1QNK A;  2EJM A;  1SFO H;  1L2F A;  5DLQ E;  2F0E A;  1IZ6 A;  4KKU A;  3S17 B;  3W3A A;  2JSO A;  3NHH A;  3HOW H;  4X65 L;  1TWH H;  4B3T L;  2JA5 G;  2B2Y A;  4JOI C;  4P73 A;  1HXY D;  4X66 L;  1N34 Q;  4FDB A;  1SE3 A;  4A3I H;  3IKJ A;  3OW2 A;  5C44 G;  1QNU A;  2DNE A;  3GP7 A;  2A69 C;  2B8G A;  2B2Y C;  2KEC A;  1YJW A;  5JPN C;  2FMC A;  2KQ3 A;  2IW3 A;  3K57 A;  1F77 A;  1PTO C;  2MQH A;  2F52 A;  3IFD A;  4G7H C;  3J7A V;  4RH6 A;  1PH6 A;  4IZ8 A;  4KJO A;  4GOP C;  2IT1 A;  1A63 A;  5IOD A;  1F9S A;  2MHV A;  3CPW A;  3CW2 C;  5C0X J;  5KRU A;  2MO1 A;  2F0M A;  3TP8 A;  5DM7 3;  1YHB A;  3A8I E;  2XIW A;  3SHL A;  4S3S A;  2VS1 A;  4GOP A;  1SE2 A;  1BBW A;  2JJQ A;  4DV3 L;  4LAA A;  4NW2 A;  4LFC Q;  1TWA B;  4C3I G;  4TSS A;  2EQS A;  3MVV A;  2F0K A;  4POG A;  4CKB A;  1OXV A;  5EJW A;  3NQT A;  1B3Q A;  2UU9 L;  1B9M A;  2JXM B;  3PIP A;  1Q86 C;  3OIQ A;  3GTG H;  2X6L A;  4L5S A;  4NB3 A;  1KNA A;  1TWF B;  3NEL A;  1CI3 M;  4JOI A;  2KED A;  4AQY L;  5E4W C;  4G4K A;  5CR3 A;  2NVQ H;  5HUR A;  3QR8 A;  1ET9 A;  1VQG A;  1M90 C;  2EYO A;  2A5H A;  4UP8 A;  1EUJ A;  1QUQ B;  2A6E D;  2VB3 X;  4GKJ Q;  3MZ5 A;  3FP9 A;  2IX0 A;  1UNS A;  2PW5 A;  1EY7 A;  4ME5 A;  2CFM A;  4NMZ A;  5JVH 3;  1ZYR C;  5I9O A;  1KXL A;  2A19 A;  1JOR A;  2QW7 A;  5IT9 L;  2PZU A;  2C35 B;  4N9P A;  1NAP A;  4CBV A;  4FO2 A;  3I4N B;  5BN4 A;  1B4O A;  1HTL D;  3BG3 A;  4J8Q A;  1CA6 A;  4K8J A;  3CAM A;  3G6J B;  3CXC A;  4IFD H;  1PRT D;  1V1P B;  1WTH A;  2PQE A;  1LTT D;  2MJ8 A;  1O7I A;  3GTJ B;  2DY7 A;  1BCP B;  3AMU A;  4BS9 A;  3RLF A;  2VUM G;  3IRB A;  4HJ9 A;  1FNV A;  3ULJ A;  2V1C C;  4IUN A;  2EJG C;  3BZK A;  3RZO B;  3MXP A;  1I4P A;  4HID A;  2FHT A;  5EPL A;  1VQJ A;  4B3S Q;  2HHH L;  2K14 A;  4HCE A;  1Q90 A;  4U67 3;  4BXX G;  4RWS C;  5LMN W;  2UUC Q;  2EOT A;  4YHH L;  1E2W A;  3CCL A;  4JI5 Q;  4CHT B;  3GD7 A;  1JWU D;  1CSQ A;  2EIF A;  2MPM A;  2IL8 A;  4JI5 L;  4DV0 Q;  5GRO A;  1MBY A;  1VQF A;  2LMC B;  1VQC A;  1Y8N B;  4DV0 L;  2A6H D;  5LL6 X;  3PUY A;  1TKW B;  2JA5 B;  1O7Y A;  2J0T D;  2L11 A;  4O0A A;  2F0H A;  3CPF A;  3JAM E;  5D65 A;  1XNQ L;  1IW7 D;  4JI8 Q;  3MAQ A;  1HNX L;  2PMZ B;  4LF8 Q;  2JEA I;  1YJN A;  3K7U C;  1YEZ A;  2VW9 A;  3NPP A;  1XMQ L;  1G29 1;  4JI0 Q;  3VR3 A;  1I4H A;  4K8I A;  2MFI A;  4IUR A;  3E3X A;  1PRT B;  2F03 A;  1X9N A;  3PO2 G;  2WP8 J;  3HOW G;  4QL5 A;  2ZM6 Q;  1GD7 A;  1A8V A;  4NDX A;  4PNY A;  4R4I A;  2ES2 A;  1BUV T;  1TVX A;  2NVT B;  2NB0 A;  2F3W A;  5IIF A;  4LF5 Q;  3A8K E;  3EQL C;  2B63 G;  2JA6 B;  3NTK A;  3I4O A;  1LT6 D;  1UE1 A;  1FD7 D;  3M4P A;  3F8T A;  5FO8 B;  1A62 A;  2DN8 A;  4R4Q A;  5I6Y A;  1FL0 A;  1GKH A;  2PNR C;  4RA8 A;  4JI6 L;  1SJH D;  2F0U A;  2RCF A;  2EY5 A;  1BXT A;  1SBB B;  4ZRZ A;  3AEV A;  4KTA A;  4YWL A;  2E2H B;  2HCI A;  1TWG H;  1VQ5 A;  2CWP A;  3J80 c;  3FHW A;  1VQ8 A;  2NN6 G;  4C3H G;  2C5C A;  1PTO H;  4UAI A;  4IOA A;  4G7O C;  3M3Y H;  5M5W B;  4HSP A;  1JT8 A;  1XJV A;  3NWT A;  4BBR B;  5CMD A;  3LNN A;  4A3B B;  3MXN A;  1RD9 D;  1X3Q A;  2AQ3 B;  4OHJ A;  3M4O H;  4DXF A;  1YNN D;  3D4R A;  2DJF C;  5EAY A;  4UPA A;  1NTG A;  4DR5 Q;  1I50 H;  5EBC A;  4K5X A;  3J81 i;  3E9H A;  4DFA A;  2QGQ A;  2B2W A;  1B1Z A;  4GLA C;  1TWA H;  1OXX K;  5C4Z A;  4KHP Q;  4IJL A;  3RZO H;  3H15 A;  4DF7 A;  2VQF L;  4M1U B;  3DHQ A;  1L1O B;  1E1T A;  2MO0 A;  3HS0 C;  1F2M A;  4NKL A;  1G2T A;  5C44 B;  3HZX A;  1PYW D;  4IPH A;  1XMO Q;  4ZK9 B;  1LT4 D;  1S5D D;  2AHO B;  4DAM A;  3WOE A;  3GTK H;  3K80 C;  3K7A B;  1WTQ A;  4KY7 A;  1PHJ A;  4IUU A;  3S15 B;  1QB5 D;  4JI1 L;  2NN6 H;  3DM3 A;  4C3H H;  4RGO S;  1GOZ A;  2K5H A;  2K28 A;  1STE A;  2ICE C;  1EEF D;  1QCB D;  3H0G G;  4LWC A;  4FF3 A;  1UE7 A;  4OIJ A;  2AUK A;  1ICW A;  2Z6B A;  4DNI A;  3VR2 A;  2D5D A;  1UE6 A;  2L0C A;  3OHX C;  3UDG A;  1I94 L;  3G71 A;  1RKN A;  2ASB A;  2PYK A;  1WTR A;  5LMU Q;  1L0Y B;  2F0G A;  2JA7 G;  1XMO L;  1I4G A;  5L37 A;  4A3D B;  4PQX A;  4BBS B;  2UUC L;  2L5T A;  2WII B;  2RVL A;  1MKH A;  3MFG A;  5CGK A;  3GTM H;  2XTI A;  1VQN A;  3VA7 A;  4JI1 Q;  1PFM A;  1BCP D;  1KRT A;  3A5Z B;  3R2T A;  3AU7 A;  4P71 A;  5CV5 A;  4K5W A;  1ILQ A;  4KY5 A;  4K14 A;  1CKN A;  4OON A;  4B3M Q;  2Q8R E;  1AZP A;  1KC8 C;  2F1M A;  4K5V A;  1DZ1 A;  1ZYR D;  1ENF A;  3S1Q H;  1EFI D;  4KHV A;  2AQ1 B;  4FXK C;  4MZ9 A;  3FKI B;  1PXU A;  4CDD C;  2F0S A;  4Y52 H;  2A6H C;  4HJ5 A;  3BU2 A;  2EYL A;  4DNR B;  5JEA J;  5IWA L;  1SMY C;  4X65 Q;  4B3T Q;  1EIH A;  1VQE A;  1PV4 A;  4QQB X;  2B2V C;  4DR7 L;  4UP9 A;  3OMC A;  4FXG C;  1V43 A;  1EU3 A;  5IP7 G;  4DV6 L;  3A7A B;  2XGT A;  2ZJR A;  4DV6 Q;  3RZD H;  1CQV A;  1FYC A;  2CQA A;  4A75 A;  4DV7 L;  4AQY Q;  2R7Z G;  2IHF A;  1LTR D;  3PUW A;  5IT9 E;  2J4X A;  1NJI C;  3LX0 A;  2IHE A;  1WTX A;  5EPK A;  1IL2 A;  1EL0 A;  4QUF A;  2V4D A;  1EY6 A;  3K5N A;  1Z9F A;  3KLS X;  5C44 H;  4IO9 A;  3C2P A;  1K83 B;  1JOK A;  1PH3 A;  1H9J A;  5IYD H;  2EYM A;  1WOC A;  1H9S A;  2NZO A;  2E2I B;  4WJ3 M;  1S72 A;  1H9M A;  3CMA A;  4RHR A;  3BDL A;  4JBJ A;  1NY4 A;  1R9T H;  3AB9 A;  4A3G H;  2OCE A;  4JW0 A;  2K32 A;  4A3J B;  3SK4 A;  1YJ9 A;  1YHQ A;  4FF2 A;  3G4S A;  3MFY A;  1O7L A;  4N8F A;  4GNX B;  1L1O A;  2ZTE A;  2PPB C;  2NTT A;  4P75 A;  4A3C H;  4UDU C;  2KOL A;  2ZJP A;  4V19 0;  2K5W A;  3IL8 A;  4C1N K;  4EGV A;  1HFN A;  1AE2 A;  3GTG B;  2KVM A;  5ISR A;  1UUP A;  2Z4I A;  2JA7 B;  1HA5 A;  4IFD I;  2YV5 A;  5J39 A;  1Q46 A;  1E2V A;  5FO9 B;  1D5Z C;  1V1O A;  2VQE L;  3I4M H;  3UDX A;  5EQ0 A;  2NYZ D;  4A3K G;  1WCM G;  3DUZ A;  2YU9 B;  2HQL A;  2JP1 A;  2BA1 A;  1U9R A;  1XNQ Q;  4KKS A;  1A3V A;  3LWU A;  1E3P A;  2QDL A;  1X3P A;  2BCO A;  1K8O A;  1BO0 A;  3CHB D;  1ICF B;  4BY7 B;  1YHA A;  5M5X B;  2F4V L;  1SEB D;  1XXG A;  2WAQ B;  1VQB A;  4B3S L;  3NXW A;  4LF6 L;  4HJ7 A;  1BBU A;  3E5S A;  4A3J H;  2QA4 A;  2K75 A;  2FXQ A;  2A69 D;  2Z6K A;  2DJG C;  3AFQ A;  4LMQ D;  2Q2H A;  3OW7 A;  3J81 L;  4PMW A;  2PMZ E;  2VQE Q;  2K6A A;  2KBN A;  1FJG Q;  4DR3 Q;  3S1M H;  5FO7 B;  2LS0 1;  5J1Z A;  4JVZ A;  3VR5 A;  3KLR A;  2AKW B;  4ZKB B;  3DM1 A;  1PYB A;  4GKK L;  4JYA L;  5CV9 A;  2A74 C;  5C4H A;  1LYL A;  4ODG A;  1JE5 A;  4GN4 B;  4C3J H;  2R92 H;  4IN3 A;  1SFO B;  1IYV A;  1X54 A;  1PLF A;  3ONA B;  2UUA L;  1X56 A;  2FIN B;  4KLK A;  4DV1 L;  3NTH A;  3QG1 A;  3A8J E;  2B2V A;  3FKI H;  3BZD B;  4YWK A;  2MGS A;  4CJ2 C;  3J80 E;  2UUB L;  3NEN A;  3MXU A;  3U9S A;  1KLG D;  5C4X G;  3HOY G;  2JEB I;  3D8G A;  3DMU A;  5CV8 A;  4Y7N B;  3RD4 A;  2A73 B;  3CF5 A;  3J7Z C;  2KCC A;  1JWS D;  2LSS A;  1EQQ A;  3I4M G;  3C1E A;  1DON A;  2F0T A;  1KTK A;  1NNX A;  2QEX A;  4A3F G;  4QGU A;  4R1J A;  4R4O A;  1VF7 A;  1RHP A;  4ALP A;  3BS1 A;  3SR1 A;  4HMI A;  4BBR G;  4O42 A;  3M85 A;  3KF8 A;  5I2Y A;  4DV1 Q;  4BA1 I;  1EOT A;  2VXW A;  1PH1 A;  3HRZ C;  5EPJ A;  4LW1 A;  3HOV B;  2WB1 E;  5AFW A;  4DV5 Q;  4DV3 Q;  2PO4 A;  2CW0 D;  3W1G A;  2WFW A;  1C7Y A;  1U4L A;  2HQE A;  1G6P A;  1U4R A;  3PF5 A;  1CA5 A;  1J9O A;  2JA9 A;  2BDN A;  1OXT A;  1Z47 A;  4IUT A;  4LFA L;  4EQP A;  3CCM A;  2JA6 H;  5C4X H;  1I6H B;  3I55 A;  3M4O B;  5K36 G;  2K5D A;  1BR9 A;  1CHQ D;  3V05 A;  2D62 A;  2G9D A;  2M2L A;  4U68 A;  5E1F A;  2CCZ A;  2NVX H;  5IGF A;  1CQF A;  1KAB A;  5E3F A;  1SLJ A;  3W2D A;  3HKZ B;  3M3Y B;  1HZA A;  3HOY H;  1Y1V B;  4V0B A;  1B8A A;  3J80 L;  3AFP A;  1IXR A;  1K8G A;  4KI0 A;  1B7Y B;  4A3G B;  3B6Y A;  4F8M A;  1RDP D;  3HOX H;  5M5Y H;  5BR8 Q;  1KDB A;  1JMC A;  5LMU L;  1SYG A;  4R8N A;  3U58 A;  3H09 A;  2L12 A;  5FLM G;  2F0O A;  1A15 A;  5ELO A;  3AQQ A;  3IFT A;  4NP5 A;  4B08 A;  4EX5 A;  1WVL A;  1PDQ A;  5KGU A;  1B2T A;  1EU4 A;  4F7X A;  4B9W A;  3K0X A;  1IHZ A;  4XQQ A;  4JI3 Q;  3CP0 A;  3GTK B;  2PI2 E;  2GA4 B;  3TZU A;  4X64 Q;  2NWG A;  3H3V I;  4DXG A;  5CBE E;  4GN5 A;  4DA2 A;  2IX1 A;  4HAE A;  4A3L H;  1D2B A;  3TP5 A;  3V96 A;  2O5J C;  2PZT A;  3A74 A;  1N36 L;  4X66 Q;  2E2J H;  5I2X A;  3KF8 B;  1N36 Q;  4K0K Q;  4OWT B;  5IYC H;  4PZ6 A;  4JV5 L;  2YTY A;  5FLX c;  2L1B A;  5LMN Q;  1U4M A;  2UUB Q;  3NK9 A;  4QB4 A;  4FF1 A;  3KJO A;  3S2H H;  1QUQ A;  3J81 E;  2PQA A;  5A2Q L;  5IYB H;  3SK8 A;  4G57 A;  1H9S B;  5CV6 A;  4ZAI A;  3DXJ C;  4RFB A;  4HN7 A;  1DOL A;  4HSV A;  1EEI D;  1TWH B;  1K28 A;  3NBH B;  2K5V A;  2Q8T A;  5J3B A;  1DM0 B;  4PMC A;  5FLM H;  4A3D H;  4UP7 A;  3T16 A;  2A68 D;  3PUV A;  4OIK A;  4HIM A;  2F0W A;  3X3M A;  2ENB A;  4QF4 A;  4JK1 C;  2NBF A;  1FJG L;  2Z0S A;  2F3I A;  2F0F A;  3VR4 A;  2JA8 G;  3C3L A;  4IUQ A;  4TRD A;  1FNU A;  4N9T A;  1ESF A;  4PZ8 A;  1IKM A;  1YNX A;  3BJU A;  3FPP A;  2C9O A;  2QIL A;  1KIX A;  1VDZ A;  1SE8 A;  2I5M X;  3KUP A;  3K81 C;  1I4R A;  1VF5 C;  1V1Q A;  2KEN A;  2WB1 G;  3L3O C;  4LNQ A;  4NXM L;  1PTO B;  1PZI D;  3I70 A;  4CGY B;  4KV6 A;  2E5L Q;  1K0S A;  3HOZ B;  2JE6 I;  4I7Z C;  4DK3 C;  5I9P A;  1O78 A;  3P20 A;  3OPO A;  5FLX E;  5KYL A;  3A55 A;  1PA6 A;  1IL8 A;  1R4Q B;  2EZV A;  1LTL A;  5FJ8 H;  4OO1 H;  1L0X B;  2NVT H;  3L7Z C;  2CH4 W;  1EFW A;  4A3E H;  4LFB L;  1RCV D;  2XSC A;  1HNW L;  1E7Z A;  3T1Y Q;  4KN4 C;  2UXB L;  5JEA G;  1X6O A;  3KLS A;  2LXK A;  2G5D A;  1SYE A;  4FP5 D;  2SNM A;  1QG7 A;  4DR1 Q;  2NUC A;  2Z8L A;  3W1B A;  4DUZ Q;  1HCZ A;  4OX9 Q;  2NVX B;  2B2T A;  2Q2T A;  3HKZ G;  4LK1 C;  5C6A A;  5G3L F;  1EIF A;  4UY8 C;  1TXY A;  3FPU B;  3MEH A;  4YCW A;  2XWJ B;  3N52 A;  1O7Z A;  1KNE A;  2R93 G;  1R4P B;  1PFB A;  5A2Q E;  3E0E A;  3U9O A;  2IWH A;  1AFP A;  4LF8 L;  4Q5V A;  2RDH A;  1LT5 D;  3D6W A;  2RKS A;  4A3G G;  2WAQ G;  4DK1 A;  3J7Y W;  4LF4 Q;  1I4Q A;  2CHB D;  1V9P A;  3MA2 B;  4ZUJ A;  4C2M B;  5KNB A;  1LTA D;  3ER0 A;  2WKD A;  3P1H A;  3P75 A;  4IUV A;  2X69 A;  4OO1 G;  4A76 A;  3S16 B;  3JAM L;  2CWA A;  1CKN B;  3CRL C;  3Q6S A;  4A3M B;  2HD3 A;  1FGU A;  4XXE A;  1N34 L;  3TS2 A;  1UEA B;  3KOJ A;  4BY1 B;  2QKI C;  2VL6 A;  3PGZ A;  4J1M A;  2A1A A;  2I5L X;  3FRP B;  5COR A;  3Q8D A;  5IGB A;  4J6H A;  1JJC B;  1QZH A;  2FFK B;  3P7J A;  4LFC L;  1LTG D;  1GO3 E;  5C0X G;  2KHI A;  3PCO B;  1N32 Q;  2WKC A;  1IBM L;  1K73 C;  1AZQ A;  1B9N A;  1J6Q A;  1HUN A;  3EFX D;  1STB A;  1PZJ D;  1FGB D;  1TWC B;  4AH6 A;  3PV0 A;  1MHW C;  2XNA C;  5DM6 3;  4EQN A;  4K2L A;  1HH2 P;  2RCN A;  3MXN B;  4AYB B;  1EWI A;  2ZT9 C;  1Q1B A;  4ZCK A;  4YCU A;  1F2L A;  1GUG A;  1LT3 D;  3K8A A;  3OOC A;  1ML0 D;  2R7F A;  3UDI A;  1WTP A;  2I07 B;  4B9X A;  2AMC B;  1NSN S;  1EY8 A;  4CDF C;  1PH2 A;  3R93 A;  1D1I A;  4RKB A;  1PFN A;  2WIN B;  3I4L A;  1HTP A;  3A7L A;  1AE3 A;  1IYJ B;  4DK6 C;  3CME A;  2UU9 Q;  5IGE A;  4A3F H;  3J7A F;  4MTK A;  4A3D G;  1OXU A;  1EQT A;  3CCU A;  1PVO A;  3V2T A;  2NVQ B;  5JVG 3;  4X6A H;  1WFQ A;  5DEH A;  4MIU A;  3EBE A;  5IP9 G;  2XWB B;  5C0X H;  5IYB G;  1JE4 A;  4JI8 L;  3KF6 B;  4DR1 L;  1E22 A;  1HNZ L;  2KCN A;  1B3A A;  3LWE A;  3K6O A;  1SNO A;  1SDF A;  4OX9 L;  3ZJY C;  3CCR A;  1XMQ Q;  3NUC A;  2XRS D;  3FKI G;  4EVO A;  2MNA A;  2F0J A;  2B39 A;  4BA2 I;  5KYI A;  1S5B D;  2LY7 A;  3HG9 A;  4KHP L;  3CCV A;  3GTL B;  4LFA Q;  1DXM A;  1QWY A;  3BDO A;  2KJX A;  1PH7 A;  4YHH Q;  2F0V A;  5ELD A;  4MN3 A;  4X3U A;  5T1I A;  1J5E Q;  4IAL A;  2K1B A;  3RNU A;  4JI7 L;  3NEM A;  1XPR A;  2NTS A;  4M8A A;  1I6V C;  4DAY B;  3UE1 A;  1HR0 Q;  5C3E G;  1Y8P B;  2HT1 A;  2OQK A;  4DGZ A;  4OGQ C;  1X3E A;  1Q12 A;  2DNC A;  2PZW A;  1I50 B;  4A93 H;  2UXC L;  2JK8 A;  3TRE A;  4A3K H;  1N32 L;  4JG2 A;  2OT2 A;  2ATW A;  5C3E B;  1EYG A;  1PH5 A;  1RTO A;  5ELC A;  5COY A;  3IAY A;  1EYC A;  4KMU C;  4Q0F A;  1QE6 A;  4QY7 A;  1K8M A;  1K8A C;  5C0X I;  3CC4 A;  1SMX A;  1G6Z A;  1UEB A;  2Q2I A;  4I65 A;  5LL6 S;  1IW7 C;  4YY3 L;  4KKT A;  1JJ2 A;  5IGG A;  2Z4H A;  3DLL A;  1TII D;  2VB2 X;  1C9O A;  4A3M H;  3K7A H;  4L5T A;  2PW7 A;  1JOQ A;  3L0O A;  3S17 H;  3H94 A;  5D3I B;  3QB3 A;  5HGQ A;  4JI3 L;  4E6I A;  4DV2 L;  4R8I A;  1HZC A;  1RTN A;  1ZKO A;  3WDN A;  1MJE A;  1QJO A;  2QF7 A;  5BR8 L;  1Q8I A;  5M9O A;  1MGS A;  5LMN L;  4DV2 Q;  3CCJ A;  1YZ6 A;  2L55 A;  2XRQ D;  4JC0 A;  4ABN A;  5C3W A;  3HKZ E;  1D5M C;  1HJP A;  5JJZ A;  5C3E H;  4C3J G;  2R92 G;  1JC7 A;  1A0I A;  2E2J B;  4Z9C B;  3HOX B;  2R7Z H;  4CJ1 B;  3HOU H;  1WD0 A;  1V1P A;  3KJP A;  1Q8K A;  3DWQ A;  1Z6H A;  1E2Z A;  4HJA A;  1VQH A;  1WCM B;  4AYB E;  1U4P A;  5CBA E;  1W6J A;  4O2D A;  3R3O A;  5HY6 A;  3Q0A A;  4DV4 L;  4AYB G;  5ELN A;  1STA A;  3DEO A;  1HQM C;  2VY3 A;  3JAM i;  3VR6 A;  1UAP A;  1FVI A;  1H95 A;  1A3T A;  5FK9 C;  1Q1E A;  1E24 A;  1CM9 A;  4OEM B;  1EYA A;  4RCN A;  3QIA A;  4GLV B;  3MWY W;  4MTN A;  2R93 B;  2K50 A;  5J22 A;  4XQN A;  4EQO A;  1JOO A;  2JA8 H;  3NP8 A;  1HPC A;  2HIX A;  1IBL L;  1TS3 A;  5KND A;  2BA0 A;  4YWM A;  3E6Z X;  3S2H B;  4WJW A;  4BBS G;  4ZKC B;  1VQL A;  1AP0 A;  3D4W A;  3LGJ A;  3S24 A;  2H1E A;  1KQS A;  4LFB Q;  3D3R A;  1QVC A;  1LAC A;  1I94 Q;  1MSH A;  3PMF A;  2O4X A;  1X55 A;  3F2U A;  1LO5 D;  1I3Q B;  1TS4 A;  4XT3 B;  3QOL A;  1I6H H;  1ZXT A;  1Q81 C;  4DAY A;  4IUP A;  3CU7 A;  4R9W A;  1K0R A;  1EWC A;  3GTO B;  1DGS A;  2F0D A;  2E5L L;  4JBK A;  2HDL A;  3M7N A;  1B50 A;  3CKI B;  3BYY B;  2FJ2 A;  1JWM D;  3NBI A;  1GUS A;  3OWF A;  2R7D A;  3K5L A;  1K3R A;  1ESR A;  3VYU A;  3ICE A;  1L0W A;  4A3I G;  2N8N A;  3PUX A;  2TMP A;  4A3C G;  5M3M B;  4JV5 Q;  3KDF B;  4HIO A;  1H9K A;  1OTC A;  2ALY B;  2F0L A;  4OO1 I;  3ITP A;  1PTO D;  1VQP A;  2A8V A;  4R4C A;  3HOV G;  1VCI A;  4XYO A;  1ENA A;  3J7A 5;  1W2B A;  1KDA A;  2NVY H;  1D6E C;  1MJC A;  4DKA C;  1BF4 A;  1CKM A;  2RSO A;  3OIP A;  1D5X C;  4C3H B;  3OTO L;  1SNP A;  4RGM A;  3PO3 G;  3HOU B;  2KUM A;  3H6M A;  5BN5 A;  1D1K A;  4YY3 Q;  1EQR A;  3I2Z A;  2VZA A;  3J81 j;  1NBW A;  2E75 C;  2SOB A;  1BCP C;  3W5O A;  1VMC A;  3NBH A;  3HFZ B;  4GKK Q;  3VA5 A;  4LF4 L;  1CZW A;  5C5L A;  3L2P A;  1PZK D;  2OTJ A;  1KRS A;  2GN5 A;  2L9H A;  4IFD J;  4DR4 Q;  3BVZ A;  2R3Z A;  3O13 A;  5CV4 A;  4OWX B;  1D7Q A;  2EYJ A;  2R93 H;  3S2D H;  1BNZ A;  4CKE A;  5CYU A;  3PO3 H;  2BH8 A;  1YBY A;  1SE4 A;  1II3 A;  2Z9H A;  4BY7 G;  2K05 A;  2EY2 A;  1KAA A;  4BY1 H;  4WJ4 A;  5AJ3 Q;  3TP6 A;  3S16 H;  5JPM C;  4DU9 A;  1NMF A;  3RZD B;  1QOH A;  1HNW Q;  3T1Y L;  4I7A A;  4TVA B;  2JQO A;  5CV7 A;  1CZG A;  2A6E C;  1N33 Q;  3JAM c;  2QCP X;  1JQY D;  2BOS A;  3EA6 A;  2BE5 C;  3NSW A;  3SGI A;  5I6W A;  1C8C A;  2Z6K C;  1HNZ Q;  4HIK A;  4TQU S;  5GQO A;  5HGT A;  2B2T C;  2IPK D;  1Y1W H;  3QJY A;  5K36 H;  2K33 A;  3OMG A;  2J7Z A;  5IT9 c;  1DJR D;  1TU2 B;  4GOP B;  1LTB D;  5EBD A;  3EN2 A;  3KYH C;  1T9H A;  4K6L A;  3U50 C;  1HA6 A;  4H44 C;  4RG1 A;  1VQ9 A;  3GV6 A;  4QMG A;  1SYC A;  1JB7 A;  2K4K A;  3K5O A;  2UXB Q;  1RIP A;  1QZG A;  1IKL A;  1DCZ A;  3MTS A;  4DK0 A;  4ULL A;  3HOV H;  1RL2 A;  5EKI A;  3I8Z A;  1X3G A;  1STN A;  5ELB A;  3TEH B;  3GTM B;  3U4Z A;  4DR6 L;  1K83 H;  2E74 C;  5JOB A;  3OTO Q;  4A3E B;  4CDE C;  3PQI A;  2BH2 A;  3CCE A;  4ZYS A;  1Q82 C;  3K58 A;  3SE0 A;  4JI4 L;  1KD1 C;  2I46 A;  4K0K L;  2JA5 H;  1HRJ A;  1S40 A;  2LKV A;  1R9T B;  4L6T B;  1HHV A;  1UWV A;  4LF9 Q;  1LM0 A;  1HQR D;  1JB3 A;  1LTI D;  5IP9 H;  3K59 A;  2OQ0 A;  4A3E G;  2F0P A;  3I4N G;  3JC6 6;  1A2U A;  1KL9 A;  3I7F A;  2H5X A;  3HOY B;  2YTV A;  5JAV A;  5IWA Q;  4MNO A;  3HOZ H;  3NWS A;  3GQB A;  4RCO A;  1Y1W G;  1HZ9 A;  2E8G A;  4WRD A;  2KHJ A;  1GHJ A;  1SAP A;  1VS0 A;  3FDT A;  5KIX A;  3TN2 A;  3S14 B;  3HGB A;  3WWV A;  3QWN A; 
#chains in the Genus database with same CATH homology
 4B3M Q;  1KC8 C;  3F2B A;  3KOJ A;  4Y7N H;  2VL6 A;  3PGZ A;  1I3Q H;  2B3G A;  2A1A A;  3S1Q H;  5M5W H;  2I5L X;  1JMC A;  3RLO A;  3KFU A;  3OYY A;  1HR0 L;  1NE3 A;  3Q8D A;  4MZ9 A;  1XNR L;  2E2H H;  1JJC B;  2DUD A;  2R6G A;  1N9W A;  4IPD A;  4QIW E;  4EQ5 A;  1QZH A;  3TS0 A;  1K9M C;  4GKJ L;  2VNU D;  3PIO A;  2PQA B;  5M3M H;  4HJ5 A;  3BU2 A;  4LFC L;  5M5X H;  4Y52 H;  3PUZ A;  1GO3 E;  5C0X G;  2KHI A;  3PCO B;  2GVB A;  5IP7 H;  1N32 Q;  3HKS A;  5JEA J;  5IWA L;  4X65 Q;  4IOC A;  4B3T Q;  4LUZ A;  1VQE A;  1PV4 A;  1IBM L;  3ULP A;  3TRZ A;  4B3R Q;  2UXD Q;  4QQB X;  4IPC A;  4A3C H;  3F1Z A;  4LUV A;  2NZH A;  4DR7 L;  1K73 C;  1CSP A;  4H02 A;  3GO5 A;  4UP9 A;  3I56 A;  1J6Q A;  1UE5 A;  1V43 A;  3HOX G;  1GM5 A;  3EIV A;  1BVS A;  2IY5 B;  5IP7 G;  3CCS A;  4DV6 L;  4AH6 A;  3T1H Q;  4HJ8 A;  4DR3 L;  4XIG S;  4DV5 L;  3TQY A;  4BXX H;  4A3L G;  3GTP H;  3PV0 A;  2XGT A;  2ZJR A;  4DV6 Q;  3RZD H;  2N3S A;  1SR3 A;  4DR4 L;  4A75 A;  4PZ7 A;  4AQY Q;  4DV7 L;  1HH2 P;  2RCN A;  3MXN B;  3M4Q A;  4C3I H;  1HNX Q;  1EWI A;  1QVF A;  2R7Z G;  5JJI A;  2IHF A;  1XNR Q;  1Q1B A;  4YCU A;  3A5U A;  2WAQ E;  3PUW A;  3K8A A;  4DV4 Q;  1PYS B;  3KF6 A;  4DV7 Q;  3VDY A;  5AJ3 L;  1NJI C;  2IHE A;  1IL2 A;  2R7F A;  3UDI A;  3S15 H;  3U4V A;  1VQI A;  2CKZ B;  1Y1V H;  1Z9F A;  5C44 H;  4IO9 A;  4IFD G;  2AMC B;  1PH2 A;  2K52 A;  5GAE C;  2N78 A;  4NXM Q;  4OWW B;  1PH3 A;  4APV A;  1AE3 A;  1IYJ B;  4DK6 C;  3CME A;  2UU9 Q;  2JA6 G;  5IYD H;  3E9I A;  4JCV E;  1WOC A;  4A3F H;  4BBS H;  2K5N A;  2NZO A;  4A3D G;  1OXU A;  4WJ3 M;  3CCU A;  1PVO A;  3RLN A;  3GTJ H;  2ZTD A;  1S72 A;  3STB C;  1N33 L;  4X6A H;  3CMA A;  1WFQ A;  2RHQ B;  3KLW A;  2VQF Q;  4JBJ A;  1CKO A;  1NY4 A;  4DR5 L;  1R9T H;  3EBE A;  5IE8 A;  1X65 A;  5IP9 G;  4A3G H;  4ME3 A;  2OCE A;  4DUY Q;  5IYB G;  1PH8 A;  4JI8 L;  1YJ9 A;  3KF6 B;  1YHQ A;  4DR1 L;  1E22 A;  2CQO A;  3G4S A;  1HNZ L;  3H3V H;  3D31 A;  1X3F A;  1HR0 W;  4GNX B;  1L1O A;  4JI6 Q;  2ZTE A;  3RR5 A;  2HHH Q;  4P75 A;  3ZJY C;  4POF A;  3CCR A;  4GNX C;  1XMQ Q;  2ZJP A;  4JBM A;  4OX9 L;  3FKI G;  3CD6 A;  2L15 A;  1ASZ A;  3UDF A;  3RN5 A;  2MNA A;  1AE2 A;  4BA2 I;  2D0P A;  4KHP L;  4R4T A;  3CCV A;  4LFA Q;  4JI2 Q;  2YV5 A;  4IFD I;  4P74 A;  1Q46 A;  1PH7 A;  2KCT A;  4YHH Q;  4DPG A;  1JJG A;  1J5E Q;  1IBK Q;  2VQE L;  3I4M H;  1G51 A;  3UDX A;  1EOV A;  4AIM A;  3RNU A;  4A3K G;  4JI7 L;  3GDE A;  3NEM A;  1XPR A;  1WCM G;  1P16 A;  5H1S E;  1YI2 A;  1YIJ A;  1P8L A;  2HQL A;  1J5E L;  1IBK L;  1CUK A;  2BA1 A;  3CC2 A;  2RHS B;  4JI4 Q;  2GVA A;  1XNQ Q;  1PFS A;  1VQD A;  2VUM H;  2ZTC A;  4DAY B;  3UE1 A;  4X62 Q;  1PH4 A;  1HR0 Q;  3GTL H;  1E3P A;  5C3E G;  3I4N H;  3J81 c;  2HT1 A;  2OQK A;  3G6E A;  1X3E A;  1Q12 A;  1SFO H;  4A93 H;  1YHA A;  1L2F A;  5DLQ E;  1IZ6 A;  2F4V L;  2ZJQ A;  2JK8 A;  2UXC L;  3TRE A;  4A3K H;  3ULL A;  1N32 L;  4JG2 A;  3HOW H;  4X65 L;  1TWH H;  1VQB A;  4BY1 G;  4B3T L;  2ATW A;  1VQK A;  2JA5 G;  1EYG A;  4B3S L;  1PH5 A;  4JOI C;  4P73 A;  4X66 L;  1D8L A;  4HJ7 A;  4FDB A;  1N34 Q;  4LF6 L;  1BBU A;  4LF7 L;  4A3I H;  4A3J H;  3OW2 A;  2QA4 A;  3F2C A;  1SRO A;  2K75 A;  2FXQ A;  5C44 G;  3CCQ A;  2Z6K A;  4LF6 Q;  2B29 A;  4QY7 A;  1K8A C;  3AFQ A;  5C0X I;  3CC4 A;  2Q2H A;  1YJW A;  1SMX A;  4PMW A;  1UEB A;  2PMZ E;  2Q2I A;  2KBN A;  3J80 i;  2VQE Q;  4GNX A;  4DR3 Q;  1FJG Q;  5JJL A;  2I5H A;  4A3B H;  2YU9 H;  4JI0 L;  2MQH A;  4YY3 L;  1JJ2 A;  2AKW B;  2F52 A;  3DLL A;  3RN2 A;  4DR6 L;  3S14 H;  4GS3 A;  1C9O A;  4A3M H;  1VQA A;  3K7A H;  1PYB A;  4L5T A;  5GAD C;  4LF5 L;  1MIU A;  3STB D;  1PH6 A;  2YTX A;  5GAG C;  4DR6 Q;  4GKK L;  3L0O A;  3S17 H;  1WYD A;  1LYL A;  1JE5 A;  4GN4 B;  4C3J H;  4JI3 L;  5HGQ A;  4GOP C;  2R92 H;  1X54 A;  2IT1 A;  1A63 A;  4DV2 L;  1AH9 A;  3CPW A;  1HZC A;  2UUA L;  1X56 A;  3CW2 C;  1MJE A;  4KLK A;  5BR8 L;  1E1O A;  3AYH B;  5C0X J;  1U5K A;  4DV1 L;  5LMN L;  2MO1 A;  4DV2 Q;  3FKI H;  4YWK A;  1KAW A;  1YHB A;  4C2M H;  3CCJ A;  2UUB L;  3NEN A;  1KHI A;  2VS1 A;  1YZ6 A;  2LXJ A;  4GOP A;  2I0Q A;  4B3R L;  1BBW A;  5C4X G;  3HOY G;  2JEB I;  2JJQ A;  4JC0 A;  3HKZ E;  4DV3 L;  1HJP A;  5C3E H;  4LFC Q;  2R92 G;  1Y1V G;  3CF5 A;  1A0I A;  3J7Z C;  4NXN Q;  2B63 H;  2R7Z H;  1W3S A;  1EIY B;  2LSS A;  3HOU H;  2EQS A;  2Y0S G;  1EQQ A;  3KJP A;  1Q8K A;  4HJA A;  4POG A;  3I4M G;  1VQH A;  3PSI A;  1OXV A;  4XTC S;  4AYB E;  2QEX A;  4A3F G;  1XTD A;  4P72 A;  2Y0S E;  4QGU A;  4R1J A;  4O2D A;  4R4O A;  5HY6 A;  2UU9 L;  4ALP A;  3ERS X;  4DV4 L;  3PIP A;  1Q86 C;  3GTG H;  4AYB G;  5ELN A;  4BBR G;  2OTL A;  3M85 A;  4NB3 A;  4L5S A;  3S1N H;  3NEL A;  2VY3 A;  4IJH A;  4JOI A;  3JAM i;  4DV1 Q;  4BA1 I;  4AQY L;  1PH1 A;  1FVI A;  1H95 A;  4LW1 A;  4KHZ A;  2NVQ H;  2WB1 E;  1Q1E A;  1E24 A;  4DV5 Q;  2EXD A;  4DV3 Q;  1VQG A;  1M90 C;  1S3O A;  4GLV B;  4UP8 A;  1EUJ A;  1QUQ B;  3HOZ G;  4MTN A;  4GKJ Q;  4A3M G;  4PG3 A;  4A93 G;  2K50 A;  2IX0 A;  3FP9 A;  3W1G A;  2WFW A;  4X62 L;  1C7Y A;  2CFM A;  2JA8 H;  2HIX A;  1G6P A;  1BKB A;  1IBL L;  3PF5 A;  1KXL A;  4A3B G;  2A19 A;  2JA9 A;  1WCM H;  1OXT A;  1Z47 A;  2BA0 A;  4LFA L;  4IPG A;  4YWM A;  5IYD G;  3CCM A;  2JA6 H;  3GTQ H;  5C4X H;  2C35 B;  5E7N A;  1LUZ A;  3I55 A;  4BBS G;  1VQL A;  4DR2 L;  3S24 A;  3LGJ A;  1WJJ A;  5K36 G;  5C4J H;  1KQS A;  4LFB Q;  3CAM A;  1QVC A;  3CXC A;  3PO2 H;  1QVG A;  1I94 Q;  2HIV A;  2D62 A;  1O7I A;  1YVC A;  1X55 A;  1L1O C;  2CCZ A;  5M3F H;  2NVX H;  3HOU G;  1SLJ A;  3RLF A;  2VUM G;  1I6H H;  3IRB A;  2AWN A;  4HJ9 A;  3ULJ A;  1Q81 C;  2V1C C;  3BZK A;  4YCV A;  1K0R A;  4HID A;  1HZA A;  3HOY H;  4JI7 Q;  1DGS A;  5FJ8 G;  2E5L L;  4JBK A;  3M7N A;  4B3S Q;  1VQJ A;  1B8A A;  1SRU A;  2HHH L;  2K14 A;  2Q2U A;  3AFP A;  4BXX G;  2OWO A;  4A4I A;  5LMN W;  2UUC Q;  4YHH L;  1IXR A;  2R7D A;  3CCL A;  4JI5 Q;  1K8G A;  4KI0 A;  3GD7 A;  1B7Y B;  1K3R A;  2RF4 A;  1CSQ A;  3B6Y A;  4RMF A;  3HOX H;  2EIF A;  4DR7 Q;  5M5Y H;  5BR8 Q;  4JI5 L;  4DV0 Q;  5LMU L;  5GRO A;  4J15 A;  1L0W A;  4A3I G;  2N8N A;  3PUX A;  3U58 A;  1VQF A;  4A3J G;  5FLM G;  4A3C G;  1XPU A;  4JV5 Q;  1VQC A;  3KDF B;  4DV0 L;  5ELO A;  4HIO A;  3AQQ A;  3PUY A;  1OTC A;  2ALY B;  4OXP A;  2JEA I;  4OO1 I;  4EX5 A;  4O0A A;  3CPF A;  1XNQ L;  4JI8 Q;  4NXN L;  1VQP A;  4R4C A;  1HNX L;  1VCI A;  4LF8 Q;  4LF9 L;  2A8V A;  3HOV G;  3J7A 5;  1TWF H;  1W2B A;  1YJN A;  3K0X A;  2NVY H;  4JI3 Q;  1MJC A;  3CP0 A;  4DKA C;  3K7U C;  1YEZ A;  2VW9 A;  1CKM A;  1G29 1;  2PI2 E;  1XMQ L;  4X64 Q;  4JI0 Q;  1VQ6 A;  3OTO L;  4DUZ L;  3H3V I;  3GTO H;  1WI5 A;  4JBW A;  2UXC Q;  2F4V Q;  2IX1 A;  4GN5 A;  5GAH C;  2MFI A;  4B3M L;  4A3L H;  4X64 L;  5JJK A;  3PO3 G;  3A74 A;  1X9N A;  1N36 L;  4X66 Q;  2E2J H;  4JI2 L;  3PO2 G;  2WP8 J;  3KF8 B;  3HOW G;  4QL5 A;  2ZM6 Q;  4YY3 Q;  1EQR A;  1N36 Q;  1VQM A;  1GD7 A;  3I2Z A;  1A8V A;  2VZA A;  4OWT B;  1N8R C;  4LUO A;  5IYC H;  3BZC A;  3J81 j;  1NBW A;  4R4I A;  2E2I H;  4PZ6 A;  1HZB A;  2ES2 A;  3W5O A;  4JV5 L;  2YTY A;  5FLX c;  1OXS C;  5LMN Q;  3HFZ B;  4GKK Q;  4LF5 Q;  2PNH A;  2UUB Q;  2B63 G;  4LF4 L;  2N49 A;  3I4O A;  3KJO A;  3L2P A;  3S2H H;  1QUQ A;  1UE1 A;  1U0L A;  2OTJ A;  1KRS A;  2PQA A;  3S1R H;  3M4P A;  2UXD L;  3F8T A;  5IYB H;  1VQ4 A;  2GN5 A;  1A62 A;  4IFD J;  4R4Q A;  4DR4 Q;  1FL0 A;  1GKH A;  4JI6 L;  1IBL Q;  3NBH B;  2K5V A;  2D0O A;  4OWX B;  3T1H L;  3AEV A;  1D7Q A;  5J3B A;  3S2D H;  4YWL A;  4LF7 Q;  2R93 H;  1GVP A;  1B70 B;  5FLM H;  3PO3 H;  1VQ5 A;  1TWG H;  4A3D H;  2CWP A;  2BH8 A;  3H0G H;  4UP7 A;  1YBY A;  3J80 c;  3FHW A;  3PUV A;  2ID0 A;  1VQ8 A;  4HIM A;  2NN6 G;  4BY7 G;  4IOA A;  3M3Y H;  1FJG L;  2JA8 G;  2Z0S A;  2F3I A;  1XJV A;  1TWC H;  1JT8 A;  4BY1 H;  4WJ4 A;  5AJ3 Q;  3S16 H;  3S1M H;  4PZ8 A;  1YNX A;  1NMF A;  3BJU A;  1KIX A;  1HNW Q;  3T1Y L;  1SE8 A;  2I5M X;  5M3M G;  4TVA B;  3ICE A;  2JQO A;  3M4O H;  4K0K Q;  3K81 C;  4JYA L;  1V1Q A;  2KEN A;  2WB1 G;  4LNQ A;  1N33 Q;  3JAM c;  4NXM L;  2JA7 H;  5EAY A;  4UPA A;  1NTG A;  4DR5 Q;  1I50 H;  4BY7 H;  3J81 i;  3E9H A;  1IBM Q;  2E5L Q;  1C0A A;  3SGI A;  2QGQ A;  2JE6 I;  4DK3 C;  4GLA C;  2Z6K C;  1HNZ Q;  3D0F A;  4HIK A;  1TWA H;  1OXX K;  4KHP Q;  4IJL A;  4TQU S;  5GQO A;  3RZO H;  2AWO A;  3H15 A;  1Y1W H;  2VQF L;  5IT9 c;  1PA6 A;  1L1O B;  1E1T A;  4GOP B;  2MO0 A;  1LTL A;  5FJ8 H;  3EN2 A;  3KYH C;  1T9H A;  3U50 C;  2NVT H;  4RG1 A;  1NMG A;  3L7Z C;  3F2D A;  1Q7Y C;  1VQ9 A;  1JB7 A;  1EFW A;  2K4K A;  4A3E H;  4LFB L;  1SN8 A;  2UXB Q;  2KCM A;  3MEF A;  4IPH A;  1RIP A;  1XMO Q;  1QZG A;  2DGY A;  1HNW L;  1E7Z A;  3T1Y Q;  2UXB L;  5JEA G;  2AHO B;  1PH9 A;  4GN3 B;  4DAM A;  4L5R C;  3HOV H;  1X6O A;  3GTK H;  1RL2 A;  3K80 C;  2LXK A;  3KDF A;  1PHJ A;  1X3G A;  4JYA Q;  4NPS A;  3TEH B;  3U4Z A;  4JI1 L;  1K83 H;  3DM3 A;  3UE0 A;  3W1B A;  4C3H H;  3OTO Q;  4DUZ Q;  2K5H A;  4DR1 Q;  3H0G G;  2BH2 A;  4LWC A;  3CCE A;  1XPO A;  4OX9 Q;  3A0J A;  1UE7 A;  1Q82 C;  2Q2T A;  1ASY A;  3HKZ G;  2UUA Q;  4DR2 Q;  1VQ7 A;  4DNI A;  1EIF A;  4UY8 C;  1TXY A;  4JI4 L;  4YCW A;  1UE6 A;  1KD1 C;  2R93 G;  1I5F A;  3UDG A;  1I94 L;  3G71 A;  4K0K L;  2JA5 H;  3E0E A;  1S40 A;  2ASB A;  2YYZ A;  1UWV A;  4LF8 L;  1LM0 A;  4LF9 Q;  2PI2 A;  4DUY L;  5LMU Q;  5IP9 H;  4A3G G;  2WAQ G;  2OQ0 A;  3G48 A;  1XMO L;  4A3E G;  2JA7 G;  4LF4 Q;  3I4N G;  3JC6 6;  5M3F G;  2UUC L;  3CQZ H;  2NN6 I;  1KL9 A;  1Y14 B;  2H5X A;  3I7F A;  1V9P A;  3M9B A;  1M1K C;  1MKH A;  2YTV A;  4QJF A;  5IY0 A;  5IWA Q;  5IYC G;  3GTM H;  4MNO A;  1YIT A;  2XTI A;  3PF4 A;  3HOZ H;  1VQN A;  4JI1 Q;  1Y1W G;  3ER0 A;  1HZ9 A;  2E8G A;  1KRT A;  4OO1 G;  2KHJ A;  4BBR H;  3A5Z B;  2ZM6 L;  4A76 A;  1VQO A;  1VS0 A;  2CWA A;  1CKN B;  4P71 A;  4L5Q A;  3CC7 A;  4GLX A;  1FGU A;  1CKN A;  4OON A;  1N34 L;  3TS2 A;  3WWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...