2UU9L

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
total genus 17
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uu9L00
4JCVE 4X64Q 1TXYA 2E2HH 2HQLA 3BZCA 4R4OA 2B63H 1Y1WG 4GN5A 3D0FA 1K73C 2UUAQ 2NN6G 4OWTB 4P71A 4POGA 4B3RQ 1G291 3FHWA 1TWFH 4DR1Q 2I0QA 4JI7L 3DM3A 1A62A 1YHAA 3M85A 1BKBA 3J81c 1C7YA 3CMEA 5C4JH 4DR7L 1YZ6A 1OXSC 4A3JG 5JEAJ 4GLAC 1TWCH 2UUCQ 1YHBA 2CQOA 5C44G 3PIOA 3KJPA 4LF9L 3I7FA 4WJ3M 1VQ7A 1KHIA 4DR5L 3ULPA 4LF7L 3TS2A 3A5ZB 5AJ3Q 2ZJRA 3CCQA 1VQ5A 2D62A 5C4XH 1SMXA 2ATWA 2VS1A 4A3CH 1HZAA 3CQZH 4A3BG 2VNUD 2WFWA 4AYBG 1PYBA 1V43A 5HGQA 4JI4Q 2QA4A 4AYBE 3AFQA 1PA6A 1OTCA 4DV6L 2JA5G 4DR4L 1LYLA 2PNHA 4IOAA 1K3RA 5DLQE 4LW1A 4X64L 4BBSG 2GVBA 3PGZA 1BBUA 2NZOA 1KRSA 3U4ZA 5C44H 3KJOA 5BR8L 4R4CA 4DK6C 1B8AA 4QQBX 2KBNA 3M3YH 1DGSA 4B3RL 1U5KA 2K5NA 2QGQA 3D31A 1JJ2A 2OQKA 4DV7Q 3STBD 1HJPA 4JG2A 5JEAG 5JJKA 4JBWA 3J7ZC 3T1HQ 3CW2C 4DV0Q 3CC7A 1NY4A 1VQCA 3S24A 5EAYA 5IP9G 1EUJA 4TVAB 1FGUA 1WOCA 3U58A 5M3MH 2UUCL 4WJ4A 1UEBA 1IBKL 1N33Q 3HOWH 2JA9A 5C0XI 2JEAI 4BBSH 1XPOA 5AJ3L 4A3KG 4KHPQ 3TREA 1NJIC 2LSSA 1YJWA 3J81j 3GTMH 4BXXH 4YWMA 2H5XA 5C4XG 1KAWA 1PH3A 2DGYA 4QY7A 4O2DA 4JI5L 1OXTA 3CCRA 1ASYA 2YTVA 2MNAA 4L5SA 4PZ8A 1K8GA 3CF5A 2PI2E 1P8LA 2Z0SA 1HH2P 1NE3A 4J15A 4YCWA 4HIKA 2LXJA 1A0IA 4OX9L 4YY3L 4C3JH 2D0PA 2WP8J 1VQPA 4A3IH 4R1JA 1FJGQ 1Q46A 4BBRH 5LMNQ 1L0WA 1EQRA 2UXDQ 2D0OA 4HJAA 2OWOA 1N36Q 2ALYB 2N78A 1NMFA 3S1NH 1BVSA 4DV0L 1A63A 4LFAL 2NVYH 3EN2A 1VQ9A 1VQGA 4JI2L 4A3LH 3S1QH 3H0GG 3S16H 4A3GH 2PI2A 3BJUA 2B29A 3G71A 4LF5L 4DV4L 1V9PA 5FLMG 5GAEC 3TRZA 1K8AC 4LFBQ 1WCMH 2L15A 1PHJA 2JA8G 1PH6A 3UE1A 4IFDJ 1I6HH 2OCEA 1XMOQ 3GTQH 1G51A 4B3SQ 1HZCA 4JI1L 2K52A 3RN5A 3L0OA 5LMNW 1M1KC 1YVCA 3S1MH 1I50H 1I5FA 3W1GA 4ME3A 1Y1VH 3GD7A 1Q1BA 2I5MX 4LWCA 3IRBA 4YHHQ 1VS0A 2UU9Q 4KLKA 1RIPA 3M9BA 3HFZB 4OWWB 5LMUL 3K81C 3AFPA 1C9OA 4DR3L 3M7NA 5C0XG 2UXBQ 3TEHB 1VQAA 2JEBI 4APVA 2R6GA 1IYJB 3HOVH 2BA0A 2E2JH 1VQKA 3ULLA 3H15A 1Y14B 3TQYA 1JE5A 4GLVB 4UY8C 1S3OA 5FLXc 3J80c 4DR6Q 2PQAA 4MTNA 3GTJH 4LF8Q 4X6AH 5IWAL 2UXCL 3UDGA 4P72A 3G4SA 1N32L 2Y0SE 2E5LQ 2K75A 3GDEA 4JOIC 1PH1A 1W3SA 3PUWA 1VQDA 1E7ZA 2RF4A 1K83H 1TWHH 3OTOL 1SFOH 3ZJYC 4AIMA 4DV1L 5JJIA 4EX5A 4IFDG 2HIXA 4JI0Q 2KCTA 3GO5A 5IYBH 1B70B 4PZ6A 4A3CG 3S15H 2A8VA 3KDFB 4AQYQ 4LUVA 3PO3H 4DUYQ 1OXUA 3CMAA 1VQJA 1XMOL 3GTGH 4YWLA 3CXCA 4B3SL 1X56A 2I5HA 5IE8A 4GKKL 2NZHA 1CKMA 1UE1A 2LXKA 1VQOA 2KHJA 4UP7A 3STBC 1SR3A 1XMQQ 2UU9L 1GD7A 2KHIA 3CPWA 3OW2A 1IBLQ 1CSQA 4B3TQ 1E24A 2N3SA 4JI6Q 2UXBL 1X55A 3ER0A 5GROA 1J6QA 3K8AA 4QIWE 5M3FG 2HHHQ 3KYHC 2F4VQ 1HNXL 1X3GA 3KF8B 3KF6B 5GADC 3GTPH 3CP0A 3MXNB 1HR0Q 4POFA 3I56A 4LUOA 1HNWQ 2Z6KC 1YJNA 1TWGH 2EXDA 4GKJQ 4JYAQ 4X62Q 3PUVA 4DK3C 5M3MG 3HOZH 4OWXB 2ZTDA 3F2DA 2KCMA 4PMWA 3JAMc 2CCZA 3HOUH 2E8GA 4DNIA 2K5VA 3CCEA 2N49A 3B6YA 1XPUA 3HOWG 3I4MH 4JOIA 4DV3Q 1VQBA 4L5TA 1J5EQ 4JI0L 3S2DH 1IXRA 2R7FA 2UUAL 3PO2H 3HOYH 4BXXG 3K0XA 5M3FH 1W2BA 4DR1L 4DUYL 4A3FH 3H3VH 1MJEA 2JK8A 1R9TH 2VL6A 4JI8Q 1M90C 4XTCS 1Q12A 2CFMA 2CKZB 2YTYA 4MNOA 3RLOA 5M5WH 1P16A 2ZM6Q 1Q7YC 1HR0W 4GN4B 3W1BA 1VQMA 4YCVA 3HKSA 1PH5A 1YHQA 5E7NA 1XMQL 1MKHA 2UUBQ 3BU2A 1XNRQ 1B7YB 4RMFA 4A3DH 4TQUS 2IY5B 3CCJA 1QZHA 3PIPA 4LNQA 4A3IG 2HHHL 1CKNB 3UE0A 4BBRG 3CCVA 2AMCB 3S17H 4HJ5A 4GNXB 3A5UA 1YEZA 4HJ8A 1HR0L 2JA6H 1HNWL 1Q8KA 4Y7NH 2ASBA 5IY0A 2VQFQ 1YI2A 4HIMA 4JI4L 4GKJL 3S1RH 4JYAL 4X62L 2Z6KA 2EIFA 4A3LG 4KHZA 5FJ8H 1S72A 3U4VA 1MIUA 4A3GG 4XIGS 3A0JA 4NXMQ 3M4QA 5J3BA 1EIFA 4DV3L 1X65A 1WCMG 4R4IA 2B3GA 3M4PA 3RNUA 4A3EH 3HKZG 1J5EL 3EIVA 4IFDI 2VQEQ 4JBKA 3T1YQ 3RN2A 4IO9A 1GM5A 1CKOA 3HKZE 2IHFA 2GVAA 4A93H 4DV7L 4K0KQ 2BA1A 3NELA 1Y1VG 3T1HL 5M5YH 2C35B 3GTOH 1Z9FA 1UWVA 1N34Q 5IYCG 2ZJQA 1E3PA 4OONA 1X3FA 3E9HA 3CCUA 1YNXA 1N33L 3KOJA 2A1AA 1SE8A 3I4NH 1JJCB 2RHSB 3HOVG 4FDBA 1MJCA 4UPAA 4KHPL 2Q2HA 3GTLH 1U0LA 1NBWA 2WB1E 4DV5Q 2NVQH 2R93H 2ES2A 1VCIA 4EQ5A 4UP9A 1KD1C 4X65Q 1AE3A 1HNZQ 1SRUA 3DLLA 3RLFA 4NB3A 4PG3A 1I94Q 3CD6A 3PCOB 2IX1A 4LF4Q 2FXQA 4A3MH 4NXML 3F2CA 5IYCH 1E1OA 2RHQB 5IYBG 4IOCA 2K4KA 1CKNA 1XPRA 3J81i 3AYHB 3F8TA 3PO3G 3T1YL 1FJGL 4IPCA 2AWOA 5LMNL 3F2BA 3WWVA 2EQSA 5IP7H 2UXDL 2Y0SG 3K80C 4IPHA 1N36L 1T9HA 4LFCQ 5IYDH 1H95A 1AH9A 1K0RA 3KFUA 1E1TA 1UE5A 4P73A 2VUMH 2Q2IA 1CSPA 3CCLA 4JBMA 1PYSB 4DKAC 3HOXH 2JA7H 1JJGA 2F3IA 1PV4A 4LFBL 2VW9A 4DV2Q 4LF9Q 2Q2TA 1K9MC 2MO0A 3BZKA 5IT9c 4GOPB 1XNQQ 2AKWB 2BH8A 2RCNA 1YJ9A 5K36G 4DV5L 3RR5A 2OTLA 4LF7Q 2CWPA 3HOZG 3EBEA 2VZAA 3A74A 3AEVA 3HOUG 3I4MG 2AHOB 3K7AH 1I94L 4DR2Q 4GN3B 2JQOA 4BY1H 1L1OB 4RG1A 4YHHL 2ZJPA 4LF4L 4GS3A 4GOPC 2I5LX 4DV6Q 4DR4Q 2OQ0A 3PO2G 1YBYA 2MQHA 1VQ8A 1PH8A 3HOYG 2F52A 1LTLA 4QJFA 2XGTA 5GQOA 3UDIA 4A3FG 4BY7G 2IHEA 3AQQA 1QVGA 2YTXA 5BR8Q 3I55A 4DR6L 2JJQA 1L1OC 2YYZA 4R4QA 2A19A 4LFCL 4LF8L 4BA2I 1SROA 1G6PA 1C0AA 1E22A 2WAQG 4A76A 1XJVA 4DAMA 1QUQB 2IX0A 2E5LL 3W5OA 3PUXA 4C2MH 3PV0A 4AH6A 2WAQE 4Y52H 4A3DG 4JBJA 2R92H 5C3EH 2ID0A 3RZOH 1EWIA 3FKIG 4GLXA 1D7QA 3L7ZC 3NENA 3GTKH 3JC66 1KRTA 1A8VA 4DV2L 2K50A 4IJLA 1IBKQ 1XNQL 2JA6G 1YIJA 1VQLA 3M4OH 1EOVA 4AQYL 4BY7H 1IBMQ 2PMZE 3Q8DA 1VQHA 2R7ZG 1Y1WH 1UE6A 5FJ8G 3K7UC 1TWAH 2QEXA 4DR2L 4YCUA 3CAMA 1VQNA 1VQ6A 1GO3E 4B3MQ 4JI5Q 3UDFA 4A3EG 1NMGA 1IBLL 1KXLA 1Q1EA 1EQQA 4B3TL 4JI6L 4GOPA 3KDFA 4R4TA 2F4VL 4A93G 3FKIH 4A3JH 2VY3A 4OX9Q 1LM0A 4YY3Q 4HIOA 4A75A 1KQSA 1CUKA 1EIYB 3NBHB 4HIDA 1GKHA 3TS0A 3ERSX 4NXNQ 4X66Q 4YWKA 1L1OA 2R7ZH 4A3BH 4LFAQ 1VQIA 3I4NG 3VDYA 4JI3Q 4GNXC 1PH2A 1GVPA 4JI2Q 1WYDA 3S2HH 1Q86C 1N8RC 1X54A 1JMCA 2JA5H 3RLNA 2OTJA 4H02A 1PVOA 4JC0A 3KF6A 4LUZA 2R93G 4LF5Q 4MZ9A 4DV4Q 4HJ7A 1V1QA 2BH2A 1LUZA 1IBML 1IL2A 3PUZA 4L5RC 4IPGA 2Q2UA 2K14A 1QUQA 4JI8L 5M5XH 1PH4A 2MO1A 2HT1A 4A3MG 2ZM6L 3PF5A 3L2PA 1QVCA 4C3HH 2NVXH 2ZTCA 1KC8C 1KL9A 2PQAB 4O0AA 4JI1Q 4LF6Q 4B3ML 4UP8A 2UUBL 4DUZQ 1XNRL 3J80i 4KI0A 3CCMA 2NVTH 4OO1I 2YV5A 1PH9A 1HZ9A 1L2FA 1WFQA 2V1CC 5IP9H 2WB1G 1VQEA 5LMUQ 3CC4A 4DR3Q 1BBWA 5IP7G 3H3VI 2DUDA 2CWAA 4HJ9A 5GAGC 5IYDG 2NN6I 2K5HA 3S14H 2VQFL 3OYYA 1S40A 5C0XJ 1KIXA 5H1SE 3I2ZA 4NXNL 3U50C 4IJHA 4X66L 4A3KH 3CPFA 3RZDH 3ULJA 2VUMG 2AWNA 1X9NA 5IWAQ 3E0EA 3MEFA 1SLJA 2KENA 1Q82C 1WI5A 3J7A5 1N32Q 2UXCQ 2JA7G 3HOXG 3PUYA 2N8NA 4JI3L 4JV5Q 1OXXK 3NEMA 1UE7A 4C3IH 1PFSA 3OTOQ 4QL5A 2VQEL 1JB7A 2MFIA 4GNXA 4DV1Q 1QZGA 2ZTEA 2XTIA 3PSIA 1SN8A 1D8LA 4P74A 4DAYB 3F1ZA 3CC2A 2GN5A 1EFWA 4K0KL 1EYGA 1PH7A 3I4OA 4NPSA 1N9WA 2E2IH 5ELNA 4BY1G 1HZBA 3FP9A 4JI7Q 1VQFA 4QGUA 1N34L 1FVIA 4LF6L 4GKKQ 4DUZL 1QVFA 4DR7Q 3G48A 3PF4A 3UDXA 1AE2A 4BA1I 4IPDA 2YU9H 1X6OA 2B63G 5JJLA 1NTGA 3SGIA 1O7IA 3H0GH 3JAMi 1FL0A 2IT1A 4A4IA 5HY6A 1OXVA 4ALPA 4DR5Q 3E9IA 5FLMH 1HNXQ 1IZ6A 2JE6I 3G6EA 4DPGA 3LGJA 4L5QA 4X65L 1XTDA 1Z47A 1HNZL 1ASZA 2JA8H 1RL2A 1WJJA 4OXPA 1JT8A 2R92G 5C3EG 1VQ4A 1I3QH 2R7DA 1X3EA 3ICEA 3CCSA 5ELOA 1YITA 1Q81C 4JV5L 5GAHC 4PZ7A 4P75A 4OO1G 3KLWA 2HIVA
chains in the Genus database with same CATH superfamily
3BZCA 1EY5A 4R4OA 3BDLA 4POGA 2UUAQ 2NN6G 1KNAA 4IURA 1G291 3L9AX 1LTID 4JI7L 3DM3A 2Q8TA 3D6CA 1BKBA 1EY6A 2D9UA 1QWYA 2C5CA 1YZ6A 1OXSC 1Q8IA 1SNOA 3HEJA 3Q6SA 3A56A 1TR5A 1U4LA 1FR3A 4DR5L 3ULPA 3TS2A 2D62A 5C4XH 1PXUA 2Z1CA 3E3XA 4A3BG 4DN4M 2RCFA 1PYBA 5HGQA 1YNJC 2F0OA 1LYLA 2EYHA 1LABA 1K3RA 2KHSA 1AW7A 1RHPA 4DNTB 3S16B 4A3GB 3KLSX 1B8AA 3K5NA 2SNMA 1QB5D 1DGSA 5CV9A 4B3RL 4G57A 1U5KA 3D31A 3OIQA 1H9RA 4MN3A 3S24A 1LTAD 4PNYA 4TVAB 1FGUA 2UUCL 3S1MB 1MBYA 1EFID 5ISRA 3OWFA 4HSPA 2B2TC 3HOWH 2JEAI 3P1HA 1B9NA 1XPOA 1FD7D 3R2IA 1Z6HA 5AJ3L 4KHPQ 1NJIC 1J9OA 1YJWA 3J81j 1EEID 1Y69U 2Z8LA 2WB1B 1PH3A 2DGYA 3U9OA 2XVSA 2PZWA 4O2DA 4WRDA 1OXTA 2YTVA 4L5SA 4PZ8A 1CI3M 1LT5D 2PI2E 4MIUA 1ENCA 4M8AA 2BE5D 1A0IA 5COYA 3NPPA 4OX9L 1SFOB 4C3JH 3TN2A 4KV6A 5LMNQ 3MVVA 4HN7A 4RGOS 2OWOA 1N36Q 2ALYB 3S1NH 4F87A 1IYUA 1K28A 2NVYH 1GUSA 3BDOA 1PFBA 2DNEA 1VQGA 4FVMA 2E2DC 1CM9A 4A3LH 1V8QA 2A6HC 3H0GG 1BQQT 3TP8A 3TRZA 1HCZA 1WCMH 2H1EA 2L15A 1PHJA 1EOTA 1PH6A 2B2TA 4V190 3J81L 4NMZA 1XMOQ 1I6HH 2QEJC 4ZYSA 1M1KC 3L0OA 1YVCA 3OMGA 1I5FA 3IKJA 2CH4A 3A54A 5I2YA 2HQEA 4LWCA 4YHHQ 1DM0B 2UU9Q 1EY0A 3HRZC 3M9BA 3HFZB 3AFPA 5LHY1 1WTRA 1VQAA 3MTSA 1IYJB 3HOVH 2E2JH 3ULLA 4UY8C 3TQYA 1ET6A 1JE5A 4GLVB 4DR6Q 3M4OB 4MTNA 1B3AA 4N9TA 3UDGA 1CZGA 1VDZA 2K75A 4JOIC 2G9HD 5M5WB 3DUZA 1HA5A 4J6HA 1STAA 2RF4A 1K83H 3DEPA 3ZJYC 5EPJA 4AIMA 4DV1L 5JJIA 1SYBA 5IYBH 4A3CG 4A3DB 3S15H 1V1PB 2MPMA 5C3XA 4LUVA 3FKIB 3S17B 3GTGH 2RBMA 5DEHA 4Q0FA 1UE1A 2KHJA 1LT6D 1SR3A 3SK8A 3OW2A 1ET9A 1IBLQ 1CSQA 2UXBL 1X55A 2F4VQ 1JICA 2HHHQ 2Z4HA 3CP0A 1HR0Q 2I07B 1YJNA 1TWGH 1UNSA 2XRQD 4KHVA 4CHTB 2EXDA 4GKJQ 4HAEA 3HOZH 1GUGA 2CCZA 4DNIA 2K5VA 4NKLA 2PCFB 4JOIA 4RKLA 4JI0L 2K33A 3BS1A 2QF7A 2R7FA 2UUAL 4EGVA 2BE5C 3H3VH 3DMUA 4DUYL 1HHVA 1D6EC 1MJEA 2JK8A 1R9TH 2NTTA 4XTCS 2F0HA 2NVQB 2ZM6Q 3MWYW 3DM1A 1GUTA 4GN4B 2AQ1B 5E7NA 1XMQL 3SVMA 1MKHA 4G7OC 1CTMA 1EQVA 3TP6A 2B8GA 3MXGA 4OL7A 1EIHA 3KBGA 3I3CA 1YEZA 4I65A 1HNWL 4CJ2C 3BVZA 1BOSA 2VQFQ 3S1RH 4JYAL 1KABA 4DK1A 1RCVD 2VB2X 4XIGS 1CHQD 2M00A 2PW5A 2KJXA 1X3PA 3KF8A 1ESRA 3RMHA 4A93H 3HGBA 5KYIA 4F8MA 3NTHA 4K0KQ 4H13C 1Y1VG 1CT1D 5M5YH 4RFBA 1RKNA 5IYCG 4OONA 3CCUA 3QB3A 1SE8A 1UEAB 1EY9A 1MJCA 4KHPL 3VYSA 3GTLH 1JR0D 1PDQA 4EQ5A 1KD1C 1PTOB 1WD1A 3P75A 1SRUA 4C1NI 1SYFA 1I94Q 3DEOA 4LF4Q 2FXQA 4A3MH 4NXML 1HA6A 5IYCH 1E1OA 5CV8A 1M4VA 5AFWA 2F0FA 3ITPA 3PO3G 4IN3A 3VR6A 1TY2A 4IPCA 5LMNL 2CQAA 2EQSA 5IP7H 2Y0SG 4KD3A 1N36L 4LFCQ 3JAML 1TT2A 3BZDB 1F2MA 1TWAB 4GZYC 1LT3D 5IGCA 4IUPA 3ONAB 1CSPA 2DN8A 2KQ3A 1PYSB 4DV2Q 2Q2TA 3H94A 1EYCA 3BZKA 1K9MC 2AKWB 2FMMA 5K36G 5JVG3 5TSSA 4B9XA 1BXTA 1AZQA 1SEBD 3EBEA 3I4MG 4Q5VA 3K7AH 2FINB 4RG1A 4YHHL 2ZJPA 1SYEA 2I5LX 2NZ1D 1KNEA 3FVQA 2L12A 3HOYG 4QJFA 4A3FG 2IHEA 4FXGC 2F0DA 2F0SA 4DR6L 2YYZA 1TS5A 4R4QA 4BBSB 1BNZA 2ICIA 2WAQG 4N8X1 1HPCA 2IX0A 3W5OA 2L11A 1BCPD 3OMCA 3PV0A 1Y8NB 2WAQE 4JBJA 5C3EH 3RZOH 1EWIA 4CBVA 3GTKH 1KRTA 2JA6G 2K50A 3ERQA 4IJLA 1IBKQ 1XNQL 4DF7A 1F2ZA 2R7ZG 3LWEA 1Y1WH 5FJ8G 2I46A 4CGYB 1KTKA 3CAMA 2IL8A 1VQNA 1GO3E 4MHEA 3UDFA 3WDNA 5ELBA 1IBLL 1Q1EA 4RCNA 1S4ZA 1SJED 1EQQA 1KXLA 5CMDA 1HTPA 4R4TA 2F4VL 4KN7C 4A3JH 1XYIA 1PRTB 4HMIA 1JORA 1E2WA 1LM0A 3NQIA 3NBHB 1LTGD 5KRUA 1O7ZA 3TS0A 4OHJA 2R7ZH 5EKKA 2PZTA 4HTHA 4LFAQ 3I4NG 1H9KA 4C56C 1KDCA 4JI3Q 1U9RA 1QNKA 5CYUA 1GVPA 1KDBA 3KBXA 2OTJA 1X54A 4DV4Q 3MFYA 2PPBC 3PUZA 5FOBB 1A6XA 1QUQA 2HT1A 5M5XH 2MO1A 2ZM6L 4C3HH 1KL9A 1GJXA 2C9OA 4NDXA 5JEAH 3BYYB 1NSNS 1WFQA 5IT9L 1PH9A 2HCCA 1VQEA 1IL8A 1I4HA 3J7YW 5LMUQ 4DR3Q 2DUDA 5HURA 5IYDG 4IZ8A 3DWAA 3PIP3 3S14H 2VQFL 1S40A 1SNQA 5C0XJ 3HS0C 4X66L 2VUMG 4KY5A 4KN4C 3PO3B 5IWAQ 3E0EA 1Q82C 3NE5B 3HOXG 3J81E 4N9PA 3NEMA 2Y0SB 4KTAA 5I9PA 4C3IH 3OTOQ 1PFSA 4QL5A 1LTBD 3PSIA 1SN8A 1D8LA 1EFWA 3HP3A 1X3QA 4I7ZC 4K0KL 2OT2A 4JI7Q 2F0GA 1HFGA 4DA2A 4DUZL 2SNSA 3VYTA 1BCPC 4DXGA 3HZXA 1ZYRC 5KNCA 2B63G 1NTGA 2CVRA 2SDFA 5A2QE 1FL0A 4DR5Q 4CKEA 5FLMH 1IZ6A 4QIWB 3G6EA 4L5QA 1XTDA 1SYDA 2JA8H 3HOYB 1OO9B 2A69D 1RL2A 4OXPA 1VQ4A 1I3QH 1SBBB 5ELOA 4JV5L 4JCVE 2Q8RE 1TXYA 2E2HH 5M3MB 2V4DA 4QMGA 4EVOA 4ZLTF 2B63H 1K73C 4OWTB 5C0XH 1QNUA 1SAPA 5LL6S 1E2VA 4B3RQ 4DR1Q 4Z9CB 3M85A 2X69A 3J81c 3CMEA 1KLUD 4K6DA 5KGUA 2JN4A 4GLAC 2UUCQ 5C3WA 2CQOA 3QWNA 2G5DA 5KIXA 3KJPA 3I7FA 1ILQA 3RUZA 1VMCA 3A5ZB 5AJ3Q 2ZJRA 4IFDH 2M2LA 1SMXA 1EU3A 1HZAA 3CQZH 4B9WA 2WFWA 4AYBG 2O2LD 1V43A 4JI4Q 4BBRB 5C4ZA 4AYBE 2JA5G 1FNUA 3TMEA 2PNHA 2R61A 4IOAA 3GTOB 5DLQE 1M8AA 2GVBA 3K5LA 1KRSA 4R4CA 1LV9A 2KBNA 3M3YH 4DGZA 2R3ZA 3CRKC 1BO0A 1IKMA 2X6GA 4FF4A 2K5DA 4HMJA 1JJ2A 4DV7Q 3HKZB 2Z6BA 2FJ2A 1JOKA 4JBWA 3CW2C 3CC7A 1WVLA 3GTQB 2PQEA 2RVLA 4RGTA 1A3UA 4ULLA 1TIID 3QOJA 1IBKL 5C0XI 2FFKB 4A3KG 1SNMA 2Z4IA 4BXXH 4YWMA 3A8JE 1KAWA 1WTWA 3GTJB 2O5IC 3CCRA 1IYVA 1ASYA 5I9OA 2MNAA 2Z0SA 1ZKOA 1HH2P 5FK9C 1TWHB 1WTPA 4IUUA 2D0PA 4A3IH 1E0BA 3W3AA 3A7AB 1Q46A 2OEOA 2TMPA 4ZAIA 2UXDQ 2D0OA 2ENBA 1NMFA 2WACA 4DV0L 4LFAL 2A69C 5CORA 3S16H 4A3GH 3CKIB 1STHA 4DV4L 4LFBQ 2A68D 2GA4B 1PTOF 2IJ0A 2RDFA 1QG7A 4WFN3 1T5XD 3WOEA 1G51A 3GTPB 4HSVA 1R4QB 4QUCA 2K52A 3RN5A 3S1MH 3EROA 1JCKB 3IRBA 2F0KA 1RIPA 4OWWB 5LMUL 3HOUB 4DR3L 2PNRC 2XRSD 3T53B 2UXBQ 1Q90A 2JEBI 3C3LA 4CKCA 2KUMA 2BA0A 3S2DB 3PO2B 1S3OA 1TS3A 5FLXc 3J80c 3EQLC 5IWAL 1I6VC 2A6HD 4BY7B 3GDEA 5ELDA 5J22A 3ZYYX 1E7ZA 3VR3A 3OTOL 1SFOH 5EPLA 3D4DA 4JI0Q 5D3DA 5C4XG 3GO5A 4PZ6A 1NNXA 2A8VA 3KDFB 4AQYQ 3DWPA 4RAUC 5A35A 4DUYQ 1SJHD 1NAPA 1OXUA 5IGGA 4KJNA 4B3SL 1STYA 5IE8A 2FHTA 1CKMA 1TU2B 1W6JA 1BDOA 2D2CC 5CBAE 1XMQQ 2KHIA 1F9SA 2NUCA 2N3SA 5GROA 5M3FG 1X3GA 3EVQA 3KF8B 3KF6B 3WOFA 4A3EB 1GXDC 2EE1A 1HNWQ 1IHZA 3MHBA 3N52A 2EYFA 4JYAQ 3PUVA 4DK3C 3F2DA 1ICFB 1IW7D 4PMWA 3JAMc 3HOWG 1B44D 3K5OA 3EJIA 1IXRA 1CHPD 4ABNA 2IWHA 4I7AA 5M3FH 1VF5C 4DR1L 1M90C 1J8IA 5M5WH 2CKZB 1Q7YC 2EJMA 1P16A 1PFMA 2J4XA 3W1BA 2JP1A 3M7GA 4DFAA 4YCVA 4QCLA 3HKSA 1PH5A 1YHQA 3BU2A 1PRTF 1XNRQ 3QR8A 4RMFA 2EZVA 1Q3LA 4A3DH 4TQUS 4C3JG 3CCJA 1QZHA 3PIPA 1WTHA 3UE0A 3S17H 2RDHA 3CCVA 3R93A 4HJ5A 3D8GA 3PIO3 4HJ8A 4Y7NH 1T5EA 3TP7A 5IY0A 1AN8A 2A68C 4JI4L 2K32A 3OHXC 4X62L 4ZRZA 3KLSA 4A3LG 3N6RA 3U4VA 1MIUA 4TKOB 2K03A 3A0JA 4NXMQ 4DV3L 1WCMG 1X65A 3NK9A 3R3OA 1DCZA 1J5EL 4JBKA 3MXNA 2A6EC 1G91A 2JA7B 2KEEA 2GVAA 5IT9E 4DV7L 2BA1A 4F88A 3BG3A 2ZT9C 4L6TB 1N34Q 4OGQC 1X3FA 4X3KA 3OIPA 1YNXA 4BY1B 2A1AA 3HOVG 2RHSB 4FDBA 2Q2HA 1U0LA 1SXTA 1Z7TA 2NVQH 2R93H 4UP9A 3A7LA 2DJFC 3RLFA 4NB3A 1RTOA 2IX1A 2BDNA 5IYBG 1MI2A 2R92B 2F0VA 3F8TA 3T1YL 3WWVA 2UXDL 2N55A 2NBFA 3S9WA 1T9HA 4H0LC 3SDZA 5KEEA 5C4XB 1E1TA 5IGEA 3Q0AA 5A2QL 3VA5A 2Q2IA 4JBMA 4DKAC 1IW7C 2F3IA 2K1BA 4LFBL 4LF9Q 1XNQQ 5IT9c 1K0SA 4DV5L 1EWHA 3RR5A 4LF7Q 1LTTD 1B1ZA 2CWPA 3OOCA 3HOZG 5EQ0A 2VZAA 3AEVA 4GN3B 2JQOA 2PYKA 2E76C 1O78A 1HRJA 4GOPC 4DXFA 4DV6Q 1R4PB 3FEWX 4DR4Q 4A3BB 2OQ0A 3SXHA 1YBYA 3MXUA 4LMQD 2F52A 1LTLA 2XGTA 5GQOA 3AQQA 1PTOH 2YTXA 5G3LF 3I55A 2JJQA 5I2XA 2A19A 2L5TA 1DOKA 2XWBB 4DAMA 1QUQB 1FGBD 2ZXOA 1EYAA 1JC7A 4JW0A 1D7QA 1V1OA 3L7ZC 3NENA 4KKUA 4OO1H 1A8VA 1F77A 1STGA 4EQOA 1EOVA 4AQYL 5CBEE 4LJZC 2PMZE 3J7AF 2LMCB 1TWAH 2QEXA 4YCUA 4EQPA 3RZDB 4JI5Q 3QIAA 3S1NB 2NVYB 4GOPA 3KDFA 4A93G 4RKBA 3TZUA 1PFNA 2L9HA 1TS2A 2F0WA 3MAQA 4HIDA 4X66Q 2E2IB 4BWGB 2FMCA 3VDYA 3O13A 4J1MA 4K5VA 3S2HH 1Q86C 1PVOA 3KF6A 4R8NA 2K6AA 4LF5Q 4HJ7A 2YU9B 2BH2A 4K5XA 1LUZA 1WTQA 3H0GB 2KEDA 4IPGA 2K14A 2Q2UA 5IGFA 4IUNA 4A3MG 3HOVB 1QVCA 3QJYA 1QILA 4O0AA 4JI1Q 4B3ML 4UP8A 5DNFA 4DUZQ 1XNRL 2EVBA 2NVTH 4OO1I 2YV5A 3KUPA 3R8BA 5IP9H 5IP7G 3H3VI 3TP5A 2CWAA 5GAGC 1ENFA 1FNVA 3OYYA 1JQYD 1C4QA 1KIXA 3Q23A 5H1SE 3I2ZA 4NXNL 3CPFA 3ULJA 5JOBA 1TWFB 3MEFA 3J7A5 2KENA 1N32Q 2UXCQ 3GTGB 4RGNA 2N8NA 2EJFC 4JV5Q 5NUCA 4ZCKA 1SE2A 1UE7A 5C4JB 2F0EA 2KA7A 3NSWA 2ZTEA 1TWCB 3CC2A 1BCPB 1QOHA 1N9WA 2F0IA 2F0LA 1L0XB 3GP7A 2EYPA 1N34L 1FVIA 4KD4A 4BA1I 1AE2A 3IL8A 1WD0A 1G2SA 5E4WC 4ALPA 1OXVA 1HNXQ 3E9IA 2O4XA 3LGJA 3SR1A 2TSSA 1ASZA 5C3EG 3MXPA 2IPKD 2R7DA 1X3EA 3KLRA 3CCSA 1VMPA 3C1EA 1DXMA 1FYCA 3QO2A 5I4DA 4WORA 3T4AC 1Y1WG 3FRPB 4GN5A 2SEBD 1NUCA 3FHWA 2I0QA 1RJTA 1A62A 1YHAA 2HD3A 1AZPA 1ZYRD 4PMCA 1C7YA 4FYDA 4A3JG 4OELB 5JEAJ 1YHBA 5C44G 4DAYA 4RH6A 3PIOA 4LF9L 2A5HA 4WJ3M 1VQ7A 1KHIA 4LF7L 2B39A 1VQ5A 2OXPA 4MTKA 1EU4A 2VS1A 5JAVA 1ZXTA 4M1UB 5C5MA 1RF2D 3AFQA 1OTCA 4IALA 5CV7A 4DV6L 4DR4L 1AP0A 3PMFA 2RQXA 4X64L 3TSSA 4LW1A 2LY7A 5DM63 1BBUA 2NZOA 3U4ZA 4QQBX 3BVGA 4K5WA 3V96A 5C44H 3KJOA 3A8KE 1PZKD 4C3HG 2QGQA 2OQKA 1HJPA 4JG2A 5JEAG 3J7ZC 3T1HQ 4DV0Q 5EAYA 1EUJA 3TZDA 1WOCA 3U58A 5M3MH 1Y1VB 1SNCA 1UEBA 1N33Q 2JA9A 4RGMA 1F9RA 3K58A 2VXWA 1DYQA 2JYOA 4G7HC 5EBDA 3GTMH 2MGSA 4X3UA 2H5XA 1UUPA 5IODA 3DHQA 4QY7A 4JI5L 4C3IG 1MSHA 3CF5A 1BF4A 1NE3A 4OIJA 4J15A 4YCWA 2BOSA 2WP8J 2M9VA 4R1JA 4BBRH 4F7XA 3TDQA 2N78A 2F0TA 1SSOA 1S5FD 3EN2A 1NR4A 3AB9A 1VQ9A 5CGKA 3K7AB 3S1QH 2E74C 2KVMA 2PI2A 2B29A 4LF5L 5FLMG 2JA8G 3UE1A 2LS01 4IFDJ 1RTNA 3GTQH 4B3SQ 5ELFA 5FO7B 2WIIB 4LK1C 4JI1L 3Q24A 3FPPA 1I50H 4K8JA 3NTIA 4ME3A 3X3MA 3D4RA 3GD7A 1B2TA 2I5MX 1VS0A 4XDXA 1C9OA 3I4MB 5C0XG 4APVA 2R6GA 3RZOB 1XXGA 1VQKA 3Q22A 3BVMA 4R9WA 3MA2B 4KKTA 4XQNA 3GTJH 2B2YC 4TSSA 4A3FB 2UXCL 1N32L 1BBXC 4H44C 1BR9A 1PH1A 1VQDA 2F0QA 2RKSA 1TWHH 2WAQB 4IFDG 2HIXA 3I73A 2KCTA 3BYTB 1B70B 3H3VC 1F9QA 4XYQA 4R8IA 4XQJA 1STBA 3CMAA 4YWLA 1MGSA 4RA8A 3CXCA 4BS9A 2JA6B 3IFDA 4P2CB 2EYJA 3HG9A 1VQOA 2LXKA 2R7ZB 4PQXA 1ILPA 3CPWA 5IGBA 4B3TQ 1E24A 5IOCA 4JI6Q 5K5PA 3K8AA 3KYHC 1HNXL 3GTPH 3I72A 5GADC 2QCPX 3MXNB 4LUOA 1D1KA 2B8FA 2L4NA 4X62Q 3R2TA 5EPKA 2DNCA 3I4LA 2KCMA 3HOUH 2B2YA 2E8GA 3CCEA 4C3HB 3DWQA 5I6YA 1JOQA 4UHVA 4DV3Q 1VQBA 4ZKBB 3K57A 4G7ZC 4L5TA 1J5EQ 4ID6A 3S2DH 4OEMB 2DJGC 3PO2H 1HQRD 3I4NB 4BXXG 3K0XA 4PV1C 1W2BA 3NP8A 5KNDA 2K04A 4JI8Q 1W6KA 2CFMA 4MNOA 1JWMD 1WTVA 4WJWA 1VQMA 4L8JA 4A3IG 2F3WA 2QDLA 4RCOA 4B08A 2ASBA 3K6OA 4C1NK 2EIFA 1S72A 2HUGA 1ZEQX 4A3GG 2EDGA 2K5WA 3M4QA 5J3BA 1NR2A 1EIFA 2PW7A 5D65A 4CKBA 2VUMB 4A3EH 1QCBD 4IFDI 3EIVA 3T1YQ 3HOXB 3RN2A 4IO9A 2F0JA 1CKOA 1GM5A 2IHFA 1H9MA 3GV6A 3NELA 3T1HL 4EQNA 1TQOA 1HTLD 2C35B 1UWVA 1E3PA 3E9HA 2MJ8A 1N33L 3CU7A 3MEHA 3SE0A 4UPAA 3V05A 4ODGA 1CZWA 5CV4A 1S5DD 2WB1E 2XN9C 2HCIA 4DV5Q 4QF4A 2QKIC 2EY5A 2B63B 4K6LA 1RD9D 2WKDA 3DLLA 3CD6A 3IFTA 3PCOB 3C46A 2E75C 4FXKC 3F2CA 4XYOA 2A6ED 4C2MB 4IOCA 1CKNA 3NWTA 1XPRA 1BCPF 1PZJD 3J81i 1PLFA 4KY6A 2K7VA 3F2BA 3C1FA 3T56B 1EL0A 1AH9A 3DXJC 3KFUA 1UE5A 5EKIA 4P73A 1CK1A 2JA7H 3URYA 1JJGA 3MFGA 4GOPB 1G2TA 1YJ9A 2OTLA 3LWUA 1JWSD 2AUJD 3T51B 3A74A 4QUFA 3M3YB 1B3QA 1EZ6A 4BY1H 2A73B 1JWUD 4IQZA 3AU7A 2SOBA 4AYBB 2MQHA 4DU9A 5HGTA 1VQ8A 2QILA 4UAIA 4K8IA 1CA5A 3LX0A 2QDBA 2JA5B 1RODA 2ICEC 5BR8Q 1L1OC 2RSOA 3H09A 1SROA 1G6PA 1E22A 4A76A 1XJVA 2JSOA 3PUXA 1EY4A 5C5LA 4A3DG 2K28A 2K05A 1LLRD 4HCSA 3SK6A 2R92H 2NVXB 3CRLC 4XT1B 3QOLA 1KDAA 3H6MA 3FKIG 1WTOA 1B53A 5CR3A 3JC66 4HCEA 3M4OH 1YIJA 1VQLA 1XWEA 3P20A 3Q8DA 3F2UA 4RWSC 2NN6H 2B2UC 1D5XC 2EPBA 4A3IB 1HXYD 4DR2L 4A3KB 3SK5A 1B4OA 4B3MQ 4B3TL 4JI6L 5L37A 4DK0A 3FKIH 3MZ5A 4ZKCB 4YY3Q 4HIOA 1CUKA 1EIYB 1LTSD 4NXNQ 4RHSA 1L1OA 3OSOA 4A3BH 4FNFA 2EYMA 1VQIA 1L0YB 4JI2Q 1WYDA 1N8RC 1JMCA 4FO2A 3RLNA 4H02A 4JC0A 2R93G 3E0JA 3FPUB 1V1QA 3IAYA 1G8ZD 1IBML 1I4RA 2EYOA 4L5RC 2K5QA 4JI8L 1PH4A 2F1MA 3T13A 2CH4W 3G6JB 3PF5A 1STEA 1KC8C 2F0PA 2PQAB 2B2UA 1K8OA 3K0YA 3J80i 3CCMA 1EY8A 5EGTA 3VR2A 1QJOA 4DAVA 1O7YA 4HJ9A 1G6ZA 2NN6I 2K5HA 4K2KA 2RDGA 4XXEA 3RZDH 4IJHA 3OPOA 2IW3A 1SLJA 1WI5A 1Y8OB 2EXZA 3D3RA 1EYDA 2B2VC 2BDOA 1C48A 1VF7A 2XTIA 4DAYB 3EA6A 4P74A 3F1ZA 2GN5A 2J0TD 1LT4D 1PH7A 3I4OA 4NPSA 2E2IH 1HZBA 4LF6L 4GKKQ 1QVFA 3PF4A 1DZ1A 1QE6A 3UDXA 4X3TA 4IPDA 3J7AV 2YU9H 1X6OA 5JJLA 4ZQ3A 2VB3X 3H0GH 3JAMi 1TS4A 2IT1A 4A4IA 2JE6I 4DPGA 4KY7A 5M3FB 4ZUIA 1SYCA 1UAPA 5FO8B 2H4OA 1YITA 1Q81C 5GAHC 4PZ7A 4OO1G 3KLWA 2HIVA 4X3SA 4X64Q 1I4PA 3NXWA 4UDUC 2HQLA 5KYLA 2KCCA 3D0FA 2B2VA 4P71A 3HOWB 3UI2A 1SE4A 1TWFH 4V0BA 2DY8A 2LKVA 4Y7NB 1DD2A 1PZID 3OWEB 4XT3B 4NP5A 5C4JH 4DR7L 1TWCH 3I90A 1MSGA 1SMYD 1H9SA 3KK7A 4XQQA 2L55A 4HR7B 3CCQA 2ATWA 1D5MC 4A3CH 2VNUD 4C3JB 2QA4A 1PYWD 1PA6A 1ENAA 2XIWA 3D4WA 3VR4A 2N88A 5KNBA 1U4MA 5CC4A 2HDLA 4BBSG 3PGZA 1YNND 2HDMA 4N8FA 5BR8L 4DK6C 1WTXA 1TVXA 2K5NA 1WCMB 3NHHA 2O5JC 3STBD 5JJKA 2R93B 1I6HB 1NY4A 1VQCA 1AEXA 5IP9G 1II3A 1ML0D 2B2WC 4WJ4A 2NWGA 2EYLA 3MC0B 4BBSH 5DM73 4IUQA 3TREA 2LSSA 4ZUJA 2E2JB 4H7BA 1PMRA 2K01A 5EJWA 1ONLA 1K8GA 1P8LA 4HIKA 2LXJA 4E6IA 5I6WA 1K83B 5E1FA 4YY3L 4ZK9B 5FLXL 3J80L 1VQPA 1FJGQ 2F0MA 1L0WA 1EQRA 3S15B 4HJAA 2IX3A 2NB0A 1BVSA 2OF1A 2CHBD 4CDCC 5J1ZA 3NTKA 4JI2L 2F0UA 2A74C 1F2YA 5DAUA 3BJUA 3G71A 5LL6X 1V9PA 5GAEC 2B2WA 1S5CD 1K8AC 1D5ZC 1GHKA 2NYZD 2OCEA 1GHJA 3E6ZX 3FMCA 3NWSA 1HZCA 1TWGB 5LMNW 3W1GA 3LNNA 1Y1VH 1Q1BA 3HOZB 4KLKA 3V2TA 1DOMA 1K3BC 1XTCD 3K81C 3L3OC 1SYGA 4NW2A 2WKCA 3M7NA 5T1IA 1I4GA 3TEHB 3H15A 1Y14B 1O7LA 1SMYC 5E4XA 1F2LA 2PQAA 5BN4A 4LF8Q 5T1GA 4X6AH 5E3FA 4U673 4P72A 3G4SA 2AUKA 2Y0SE 1BUVT 5IGDA 2E5LQ 1R9TB 1I4XA 1Y8PB 3K5MA 1W3SA 3PUWA 5EBCA 1A2UA 2MP1A 4K2LA 3H91A 1A3VA 2X6LA 1MD2D 2G9DA 2JXMB 4EX5A 3D6WA 2P5ZX 1LTRD 1SDFA 2ZXRA 2F03A 2AQ2B 3M4YA 2L0CA 3PO3H 1YNNC 5C6AA 1XMOL 1VQJA 5D14A 1X56A 2I5HA 4ME5A 4GKKL 2PMZB 2NZHA 4UP7A 1ESFA 1PTOD 3ND9A 3STBC 3S1RB 1GUWA 4CJ1B 2UU9L 1GD7A 2QW7A 1CQVA 3ER0A 1J6QA 4HEDA 3E5SA 4QIWE 3SK4A 3S2HB 4FF3A 4POFA 3I56A 2Z6KC 2RA4A 4PMBA 5K36H 4A93B 2WINB 5M3MG 1S5BD 2BCOA 2ZTDA 4OWXB 5JPMC 3I4MH 5M5YB 1XPUA 2N49A 3B6YA 3GV3A 3A8IE 2NVTB 3HOYH 1EIGA 3W2DA 4G4KA 4A3FH 3RD4A 3GTLB 1GUNA 2VL6A 2PO4A 5D3IB 2F4IA 1Q12A 3VYUA 2YTYA 3QG1A 3RLOA 1HR0W 1HQMC 5J39A 2WV6D 3NBIA 2L1BA 2UUBQ 1B7YB 4A3MB 2IY5B 3I70A 2MHVA 1V1PA 4IUVA 3SHLA 4LNQA 3ND8A 4DAPA 2HHHL 1CKNB 4BBRG 2AMCB 5BN5A 1HFNA 1SNDA 4GNXB 3A5UA 1HR0L 2JA6H 1Q8KA 1YI2A 4HIMA 2EOTA 4TRDA 4GKJL 3TBIB 3K59A 2Z6KA 5BN3A 4KHZA 4FP5D 5FJ8H 1TY0A 1TKWB 2MUYA 2EJGC 4R4IA 1KLGD 1A2TA 2B3GA 3M4PA 3RNUA 3HKZG 2VQEQ 3HKZE 4RHRA 2F0NA 4J8QA 1B9MA 2F3VA 1DOLA 4OIKA 3I8ZA 3GTOH 3OW7A 1Z9FA 3NQTA 2ZJQA 4L63B 5CV6A 3KOJA 3I4NH 2D5DA 1JJCB 1C8CA 1NBWA 3T16A 2AQ3B 2ES2A 1VCIA 1JOOA 5F2DA 4U68A 1PRTD 3BDCA 1AE3A 4X65Q 4CDFC 1HNZQ 3VYRA 4PG3A 5JJZA 1MHWC 5C4HA 2KOLA 5IIFA 2RHQB 1JE4A 2K4KA 5C3EB 1O80A 1PTOC 2NTSA 1CFMA 3AYHB 1I4QA 1D2BA 2XWJB 2CW0D 1FJGL 3GTKB 2AWOA 1HUMA 5FKAC 1LACA 1NCVA 3K80C 4IPHA 1H95A 5IYDH 1EZ8A 1XX8A 1K0RA 1Y1WB 2VUMH 3CCLA 3HOXH 3G7LA 4JK1C 1PV4A 2VW9A 4DNRB 2MO0A 1CA6A 2BH8A 2RCNA 1B50A 1LO5D 5ELEA 4O1NA 4A3JB 4ILWA 4K14A 1CQFA 5C44B 3U9SA 1GUOA 3HOUG 2RSNA 4CJ0B 2AHOB 1I94L 4O42A 4DR2Q 4LF4L 2XSCA 4JVZA 1L1OB 5FO9B 4GS3A 3A55A 3PO2G 2XNAC 1ICWA 1PH8A 4JPBW 3UDIA 3AMUA 4BY7G 1HUNA 1QVGA 2PZUA 4LF8L 4LFCL 4BA2I 1JB3A 1C0AA 3X3NA 2E5LL 4C2MH 5M5XB 4AH6A 4Y52H 1S5ED 3GTMB 2EY6A 3I91A 2ID0A 4KK7A 1DJRD 4GLXA 3SEBA 4DV2L 3NUCA 3VA7A 1SNPA 4BY7H 2Z9HA 1IBMQ 1VQHA 1UE6A 1EWCA 3K7UC 2DY7A 3S14B 5M9OA 1X32A 1K8MA 1VQ6A 3GQBA 1RDPD 1A15A 4A3EG 1NMGA 4FXDA 2KCNA 2EY1A 1EY7A 2VY3A 3S1QB 4C3IB 4OX9Q 4KKSA 4A75A 1KQSA 5EKLA 1GKHA 3ERSX 4YWKA 1F9PA 1U4RA 4CDDC 1PRTC 4GNXC 1PH2A 5G3LD 1I50B 2JA5H 1A63A 1A3TA 4LUZA 4MZ9A 5JPNC 4KJOA 1IL2A 2ZXPA 1YNJD 1FNWA 4QB4A 3PQIA 1AFPA 1D1IA 2CW0C 5JVH3 1H9JA 3L2PA 2NVXH 2ZTCA 5FLXE 3J80E 2JA8B 4LF6Q 1KAAA 3CHBD 2UUBL 1SE3A 4KI0A 1I3QB 1HZ9A 1L2FA 2V1CC 2WB1G 4FF1A 3CC4A 1BBWA 2E2HB 4LAAA 1EEFD 4A3KH 1EYGA 3U50C 2AWNA 1X9NA 2JA7G 3PUYA 4JI3L 3VR5A 3C2PA 1OXXK 1JB7A 2VQEL 2MFIA 4GNXA 3P7JA 3EFXD 4DV1Q 1QZGA 1GOZA 3NBHA 1U4PA 1H9SB 5ELNA 4KMUC 4BY1G 3FP9A 2KECA 1VQFA 4QGUA 1EQTA 3CQZB 1STNA 5ELCA 1E2ZA 2Q8IB 4S3SA 4DR7Q 3G48A 3JAME 1IKLA 3FDTA 3SGIA 1O7IA 5HY6A 4CDEC 4FF2A 2EY2A 4X65L 2J7ZA 1Z47A 1HNZL 1WJJA 1JT8A 2R92G 5CV5A 3ICEA 1DONA 2LFNA 4YIJA 4P75A 4IUTA
chains in the Genus database with same CATH topology
4JCVE 4X64Q 1TXYA 2E2HH 2HQLA 3BZCA 4R4OA 2B63H 1Y1WG 4GN5A 3D0FA 1K73C 2UUAQ 2NN6G 4OWTB 4P71A 4POGA 4B3RQ 1G291 3FHWA 1TWFH 4DR1Q 2I0QA 4JI7L 3DM3A 1A62A 1YHAA 3M85A 1BKBA 3J81c 1C7YA 3CMEA 5C4JH 4DR7L 1YZ6A 1OXSC 4A3JG 5JEAJ 4GLAC 1TWCH 2UUCQ 1YHBA 2CQOA 5C44G 3PIOA 3KJPA 4LF9L 3I7FA 4WJ3M 1VQ7A 1KHIA 4DR5L 3ULPA 4LF7L 3TS2A 3A5ZB 5AJ3Q 2ZJRA 3CCQA 1VQ5A 2D62A 5C4XH 1SMXA 2ATWA 2VS1A 4A3CH 1HZAA 3CQZH 4A3BG 2VNUD 2WFWA 4AYBG 1PYBA 1V43A 5HGQA 4JI4Q 2QA4A 4AYBE 3AFQA 1PA6A 1OTCA 4DV6L 2JA5G 4DR4L 1LYLA 2PNHA 4IOAA 1K3RA 5DLQE 4LW1A 4X64L 4BBSG 2GVBA 3PGZA 1BBUA 2NZOA 1KRSA 3U4ZA 5C44H 3KJOA 5BR8L 4R4CA 4DK6C 1B8AA 4QQBX 2KBNA 3M3YH 1DGSA 4B3RL 1U5KA 2K5NA 2QGQA 3D31A 1JJ2A 2OQKA 4DV7Q 3STBD 1HJPA 4JG2A 5JEAG 5JJKA 4JBWA 3J7ZC 3T1HQ 3CW2C 4DV0Q 3CC7A 1NY4A 1VQCA 3S24A 5EAYA 5IP9G 1EUJA 4TVAB 1FGUA 1WOCA 3U58A 5M3MH 2UUCL 4WJ4A 1UEBA 1IBKL 1N33Q 3HOWH 2JA9A 5C0XI 2JEAI 4BBSH 1XPOA 5AJ3L 4A3KG 4KHPQ 3TREA 1NJIC 2LSSA 1YJWA 3J81j 3GTMH 4BXXH 4YWMA 2H5XA 5C4XG 1KAWA 1PH3A 2DGYA 4QY7A 4O2DA 4JI5L 1OXTA 3CCRA 1ASYA 2YTVA 2MNAA 4L5SA 4PZ8A 1K8GA 3CF5A 2PI2E 1P8LA 2Z0SA 1HH2P 1NE3A 4J15A 4YCWA 4HIKA 2LXJA 1A0IA 4OX9L 4YY3L 4C3JH 2D0PA 2WP8J 1VQPA 4A3IH 4R1JA 1FJGQ 1Q46A 4BBRH 5LMNQ 1L0WA 1EQRA 2UXDQ 2D0OA 4HJAA 2OWOA 1N36Q 2ALYB 2N78A 1NMFA 3S1NH 1BVSA 4DV0L 1A63A 4LFAL 2NVYH 3EN2A 1VQ9A 1VQGA 4JI2L 4A3LH 3S1QH 3H0GG 3S16H 4A3GH 2PI2A 3BJUA 2B29A 3G71A 4LF5L 4DV4L 1V9PA 5FLMG 5GAEC 3TRZA 1K8AC 4LFBQ 1WCMH 2L15A 1PHJA 2JA8G 1PH6A 3UE1A 4IFDJ 1I6HH 2OCEA 1XMOQ 3GTQH 1G51A 4B3SQ 1HZCA 4JI1L 2K52A 3RN5A 3L0OA 5LMNW 1M1KC 1YVCA 3S1MH 1I50H 1I5FA 3W1GA 4ME3A 1Y1VH 3GD7A 1Q1BA 2I5MX 4LWCA 3IRBA 4YHHQ 1VS0A 2UU9Q 4KLKA 1RIPA 3M9BA 3HFZB 4OWWB 5LMUL 3K81C 3AFPA 1C9OA 4DR3L 3M7NA 5C0XG 2UXBQ 3TEHB 1VQAA 2JEBI 4APVA 2R6GA 1IYJB 3HOVH 2BA0A 2E2JH 1VQKA 3ULLA 3H15A 1Y14B 3TQYA 1JE5A 4GLVB 4UY8C 1S3OA 5FLXc 3J80c 4DR6Q 2PQAA 4MTNA 3GTJH 4LF8Q 4X6AH 5IWAL 2UXCL 3UDGA 4P72A 3G4SA 1N32L 2Y0SE 2E5LQ 2K75A 3GDEA 4JOIC 1PH1A 1W3SA 3PUWA 1VQDA 1E7ZA 2RF4A 1K83H 1TWHH 3OTOL 1SFOH 3ZJYC 4AIMA 4DV1L 5JJIA 4EX5A 4IFDG 2HIXA 4JI0Q 2KCTA 3GO5A 5IYBH 1B70B 4PZ6A 4A3CG 3S15H 2A8VA 3KDFB 4AQYQ 4LUVA 3PO3H 4DUYQ 1OXUA 3CMAA 1VQJA 1XMOL 3GTGH 4YWLA 3CXCA 4B3SL 1X56A 2I5HA 5IE8A 4GKKL 2NZHA 1CKMA 1UE1A 2LXKA 1VQOA 2KHJA 4UP7A 3STBC 1SR3A 1XMQQ 2UU9L 1GD7A 2KHIA 3CPWA 3OW2A 1IBLQ 1CSQA 4B3TQ 1E24A 2N3SA 4JI6Q 2UXBL 1X55A 3ER0A 5GROA 1J6QA 3K8AA 4QIWE 5M3FG 2HHHQ 3KYHC 2F4VQ 1HNXL 1X3GA 3KF8B 3KF6B 5GADC 3GTPH 3CP0A 3MXNB 1HR0Q 4POFA 3I56A 4LUOA 1HNWQ 2Z6KC 1YJNA 1TWGH 2EXDA 4GKJQ 4JYAQ 4X62Q 3PUVA 4DK3C 5M3MG 3HOZH 4OWXB 2ZTDA 3F2DA 2KCMA 4PMWA 3JAMc 2CCZA 3HOUH 2E8GA 4DNIA 2K5VA 3CCEA 2N49A 3B6YA 1XPUA 3HOWG 3I4MH 4JOIA 4DV3Q 1VQBA 4L5TA 1J5EQ 4JI0L 3S2DH 1IXRA 2R7FA 2UUAL 3PO2H 3HOYH 4BXXG 3K0XA 5M3FH 1W2BA 4DR1L 4DUYL 4A3FH 3H3VH 1MJEA 2JK8A 1R9TH 2VL6A 4JI8Q 1M90C 4XTCS 1Q12A 2CFMA 2CKZB 2YTYA 4MNOA 3RLOA 5M5WH 1P16A 2ZM6Q 1Q7YC 1HR0W 4GN4B 3W1BA 1VQMA 4YCVA 3HKSA 1PH5A 1YHQA 5E7NA 1XMQL 1MKHA 2UUBQ 3BU2A 1XNRQ 1B7YB 4RMFA 4A3DH 4TQUS 2IY5B 3CCJA 1QZHA 3PIPA 4LNQA 4A3IG 2HHHL 1CKNB 3UE0A 4BBRG 3CCVA 2AMCB 3S17H 4HJ5A 4GNXB 3A5UA 1YEZA 4HJ8A 1HR0L 2JA6H 1HNWL 1Q8KA 4Y7NH 2ASBA 5IY0A 2VQFQ 1YI2A 4HIMA 4JI4L 4GKJL 3S1RH 4JYAL 4X62L 2Z6KA 2EIFA 4A3LG 4KHZA 5FJ8H 1S72A 3U4VA 1MIUA 4A3GG 4XIGS 3A0JA 4NXMQ 3M4QA 5J3BA 1EIFA 4DV3L 1X65A 1WCMG 4R4IA 2B3GA 3M4PA 3RNUA 4A3EH 3HKZG 1J5EL 3EIVA 4IFDI 2VQEQ 4JBKA 3T1YQ 3RN2A 4IO9A 1GM5A 1CKOA 3HKZE 2IHFA 2GVAA 4A93H 4DV7L 4K0KQ 2BA1A 3NELA 1Y1VG 3T1HL 5M5YH 2C35B 3GTOH 1Z9FA 1UWVA 1N34Q 5IYCG 2ZJQA 1E3PA 4OONA 1X3FA 3E9HA 3CCUA 1YNXA 1N33L 3KOJA 2A1AA 1SE8A 3I4NH 1JJCB 2RHSB 3HOVG 4FDBA 1MJCA 4UPAA 4KHPL 2Q2HA 3GTLH 1U0LA 1NBWA 2WB1E 4DV5Q 2NVQH 2R93H 2ES2A 1VCIA 4EQ5A 4UP9A 1KD1C 4X65Q 1AE3A 1HNZQ 1SRUA 3DLLA 3RLFA 4NB3A 4PG3A 1I94Q 3CD6A 3PCOB 2IX1A 4LF4Q 2FXQA 4A3MH 4NXML 3F2CA 5IYCH 1E1OA 2RHQB 5IYBG 4IOCA 2K4KA 1CKNA 1XPRA 3J81i 3AYHB 3F8TA 3PO3G 3T1YL 1FJGL 4IPCA 2AWOA 5LMNL 3F2BA 3WWVA 2EQSA 5IP7H 2UXDL 2Y0SG 3K80C 4IPHA 1N36L 1T9HA 4LFCQ 5IYDH 1H95A 1AH9A 1K0RA 3KFUA 1E1TA 1UE5A 4P73A 2VUMH 2Q2IA 1CSPA 3CCLA 4JBMA 1PYSB 4DKAC 3HOXH 2JA7H 1JJGA 2F3IA 1PV4A 4LFBL 2VW9A 4DV2Q 4LF9Q 2Q2TA 1K9MC 2MO0A 3BZKA 5IT9c 4GOPB 1XNQQ 2AKWB 2BH8A 2RCNA 1YJ9A 5K36G 4DV5L 3RR5A 2OTLA 4LF7Q 2CWPA 3HOZG 3EBEA 2VZAA 3A74A 3AEVA 3HOUG 3I4MG 2AHOB 3K7AH 1I94L 4DR2Q 4GN3B 2JQOA 4BY1H 1L1OB 4RG1A 4YHHL 2ZJPA 4LF4L 4GS3A 4GOPC 2I5LX 4DV6Q 4DR4Q 2OQ0A 3PO2G 1YBYA 2MQHA 1VQ8A 1PH8A 3HOYG 2F52A 1LTLA 4QJFA 2XGTA 5GQOA 3UDIA 4A3FG 4BY7G 2IHEA 3AQQA 1QVGA 2YTXA 5BR8Q 3I55A 4DR6L 2JJQA 1L1OC 2YYZA 4R4QA 2A19A 4LFCL 4LF8L 4BA2I 1SROA 1G6PA 1C0AA 1E22A 2WAQG 4A76A 1XJVA 4DAMA 1QUQB 2IX0A 2E5LL 3W5OA 3PUXA 4C2MH 3PV0A 4AH6A 2WAQE 4Y52H 4A3DG 4JBJA 2R92H 5C3EH 2ID0A 3RZOH 1EWIA 3FKIG 4GLXA 1D7QA 3L7ZC 3NENA 3GTKH 3JC66 1KRTA 1A8VA 4DV2L 2K50A 4IJLA 1IBKQ 1XNQL 2JA6G 1YIJA 1VQLA 3M4OH 1EOVA 4AQYL 4BY7H 1IBMQ 2PMZE 3Q8DA 1VQHA 2R7ZG 1Y1WH 1UE6A 5FJ8G 3K7UC 1TWAH 2QEXA 4DR2L 4YCUA 3CAMA 1VQNA 1VQ6A 1GO3E 4B3MQ 4JI5Q 3UDFA 4A3EG 1NMGA 1IBLL 1KXLA 1Q1EA 1EQQA 4B3TL 4JI6L 4GOPA 3KDFA 4R4TA 2F4VL 4A93G 3FKIH 4A3JH 2VY3A 4OX9Q 1LM0A 4YY3Q 4HIOA 4A75A 1KQSA 1CUKA 1EIYB 3NBHB 4HIDA 1GKHA 3TS0A 3ERSX 4NXNQ 4X66Q 4YWKA 1L1OA 2R7ZH 4A3BH 4LFAQ 1VQIA 3I4NG 3VDYA 4JI3Q 4GNXC 1PH2A 1GVPA 4JI2Q 1WYDA 3S2HH 1Q86C 1N8RC 1X54A 1JMCA 2JA5H 3RLNA 2OTJA 4H02A 1PVOA 4JC0A 3KF6A 4LUZA 2R93G 4LF5Q 4MZ9A 4DV4Q 4HJ7A 1V1QA 2BH2A 1LUZA 1IBML 1IL2A 3PUZA 4L5RC 4IPGA 2Q2UA 2K14A 1QUQA 4JI8L 5M5XH 1PH4A 2MO1A 2HT1A 4A3MG 2ZM6L 3PF5A 3L2PA 1QVCA 4C3HH 2NVXH 2ZTCA 1KC8C 1KL9A 2PQAB 4O0AA 4JI1Q 4LF6Q 4B3ML 4UP8A 2UUBL 4DUZQ 1XNRL 3J80i 4KI0A 3CCMA 2NVTH 4OO1I 2YV5A 1PH9A 1HZ9A 1L2FA 1WFQA 2V1CC 5IP9H 2WB1G 1VQEA 5LMUQ 3CC4A 4DR3Q 1BBWA 5IP7G 3H3VI 2DUDA 2CWAA 4HJ9A 5GAGC 5IYDG 2NN6I 2K5HA 3S14H 2VQFL 3OYYA 1S40A 5C0XJ 1KIXA 5H1SE 3I2ZA 4NXNL 3U50C 4IJHA 4X66L 4A3KH 3CPFA 3RZDH 3ULJA 2VUMG 2AWNA 1X9NA 5IWAQ 3E0EA 3MEFA 1SLJA 2KENA 1Q82C 1WI5A 3J7A5 1N32Q 2UXCQ 2JA7G 3HOXG 3PUYA 2N8NA 4JI3L 4JV5Q 1OXXK 3NEMA 1UE7A 4C3IH 1PFSA 3OTOQ 4QL5A 2VQEL 1JB7A 2MFIA 4GNXA 4DV1Q 1QZGA 2ZTEA 2XTIA 3PSIA 1SN8A 1D8LA 4P74A 4DAYB 3F1ZA 3CC2A 2GN5A 1EFWA 4K0KL 1EYGA 1PH7A 3I4OA 4NPSA 1N9WA 2E2IH 5ELNA 4BY1G 1HZBA 3FP9A 4JI7Q 1VQFA 4QGUA 1N34L 1FVIA 4LF6L 4GKKQ 4DUZL 1QVFA 4DR7Q 3G48A 3PF4A 3UDXA 1AE2A 4BA1I 4IPDA 2YU9H 1X6OA 2B63G 5JJLA 1NTGA 3SGIA 1O7IA 3H0GH 3JAMi 1FL0A 2IT1A 4A4IA 5HY6A 1OXVA 4ALPA 4DR5Q 3E9IA 5FLMH 1HNXQ 1IZ6A 2JE6I 3G6EA 4DPGA 3LGJA 4L5QA 4X65L 1XTDA 1Z47A 1HNZL 1ASZA 2JA8H 1RL2A 1WJJA 4OXPA 1JT8A 2R92G 5C3EG 1VQ4A 1I3QH 2R7DA 1X3EA 3ICEA 3CCSA 5ELOA 1YITA 1Q81C 4JV5L 5GAHC 4PZ7A 4P75A 4OO1G 3KLWA 2HIVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JCV E;  4X64 Q;  1TXY A;  2E2H H;  2HQL A;  3BZC A;  4R4O A;  2B63 H;  1Y1W G;  4GN5 A;  3D0F A;  1K73 C;  2UUA Q;  2NN6 G;  4OWT B;  4P71 A;  4POG A;  4B3R Q;  1G29 1;  3FHW A;  1TWF H;  4DR1 Q;  2I0Q A;  4JI7 L;  3DM3 A;  1A62 A;  1YHA A;  3M85 A;  1BKB A;  3J81 c;  1C7Y A;  3CME A;  5C4J H;  4DR7 L;  1YZ6 A;  1OXS C;  4A3J G;  5JEA J;  4GLA C;  1TWC H;  2UUC Q;  1YHB A;  2CQO A;  5C44 G;  3PIO A;  3KJP A;  4LF9 L;  3I7F A;  4WJ3 M;  1VQ7 A;  1KHI A;  4DR5 L;  3ULP A;  4LF7 L;  3TS2 A;  3A5Z B;  5AJ3 Q;  2ZJR A;  3CCQ A;  1VQ5 A;  2D62 A;  5C4X H;  1SMX A;  2ATW A;  2VS1 A;  4A3C H;  1HZA A;  3CQZ H;  4A3B G;  2VNU D;  2WFW A;  4AYB G;  1PYB A;  1V43 A;  5HGQ A;  4JI4 Q;  2QA4 A;  4AYB E;  3AFQ A;  1PA6 A;  1OTC A;  4DV6 L;  2JA5 G;  4DR4 L;  1LYL A;  2PNH A;  4IOA A;  1K3R A;  5DLQ E;  4LW1 A;  4X64 L;  4BBS G;  2GVB A;  3PGZ A;  1BBU A;  2NZO A;  1KRS A;  3U4Z A;  5C44 H;  3KJO A;  5BR8 L;  4R4C A;  4DK6 C;  1B8A A;  4QQB X;  2KBN A;  3M3Y H;  1DGS A;  4B3R L;  1U5K A;  2K5N A;  2QGQ A;  3D31 A;  1JJ2 A;  2OQK A;  4DV7 Q;  3STB D;  1HJP A;  4JG2 A;  5JEA G;  5JJK A;  4JBW A;  3J7Z C;  3T1H Q;  3CW2 C;  4DV0 Q;  3CC7 A;  1NY4 A;  1VQC A;  3S24 A;  5EAY A;  5IP9 G;  1EUJ A;  4TVA B;  1FGU A;  1WOC A;  3U58 A;  5M3M H;  2UUC L;  4WJ4 A;  1UEB A;  1IBK L;  1N33 Q;  3HOW H;  2JA9 A;  5C0X I;  2JEA I;  4BBS H;  1XPO A;  5AJ3 L;  4A3K G;  4KHP Q;  3TRE A;  1NJI C;  2LSS A;  1YJW A;  3J81 j;  3GTM H;  4BXX H;  4YWM A;  2H5X A;  5C4X G;  1KAW A;  1PH3 A;  2DGY A;  4QY7 A;  4O2D A;  4JI5 L;  1OXT A;  3CCR A;  1ASY A;  2YTV A;  2MNA A;  4L5S A;  4PZ8 A;  1K8G A;  3CF5 A;  2PI2 E;  1P8L A;  2Z0S A;  1HH2 P;  1NE3 A;  4J15 A;  4YCW A;  4HIK A;  2LXJ A;  1A0I A;  4OX9 L;  4YY3 L;  4C3J H;  2D0P A;  2WP8 J;  1VQP A;  4A3I H;  4R1J A;  1FJG Q;  1Q46 A;  4BBR H;  5LMN Q;  1L0W A;  1EQR A;  2UXD Q;  2D0O A;  4HJA A;  2OWO A;  1N36 Q;  2ALY B;  2N78 A;  1NMF A;  3S1N H;  1BVS A;  4DV0 L;  1A63 A;  4LFA L;  2NVY H;  3EN2 A;  1VQ9 A;  1VQG A;  4JI2 L;  4A3L H;  3S1Q H;  3H0G G;  3S16 H;  4A3G H;  2PI2 A;  3BJU A;  2B29 A;  3G71 A;  4LF5 L;  4DV4 L;  1V9P A;  5FLM G;  5GAE C;  3TRZ A;  1K8A C;  4LFB Q;  1WCM H;  2L15 A;  1PHJ A;  2JA8 G;  1PH6 A;  3UE1 A;  4IFD J;  1I6H H;  2OCE A;  1XMO Q;  3GTQ H;  1G51 A;  4B3S Q;  1HZC A;  4JI1 L;  2K52 A;  3RN5 A;  3L0O A;  5LMN W;  1M1K C;  1YVC A;  3S1M H;  1I50 H;  1I5F A;  3W1G A;  4ME3 A;  1Y1V H;  3GD7 A;  1Q1B A;  2I5M X;  4LWC A;  3IRB A;  4YHH Q;  1VS0 A;  2UU9 Q;  4KLK A;  1RIP A;  3M9B A;  3HFZ B;  4OWW B;  5LMU L;  3K81 C;  3AFP A;  1C9O A;  4DR3 L;  3M7N A;  5C0X G;  2UXB Q;  3TEH B;  1VQA A;  2JEB I;  4APV A;  2R6G A;  1IYJ B;  3HOV H;  2BA0 A;  2E2J H;  1VQK A;  3ULL A;  3H15 A;  1Y14 B;  3TQY A;  1JE5 A;  4GLV B;  4UY8 C;  1S3O A;  5FLX c;  3J80 c;  4DR6 Q;  2PQA A;  4MTN A;  3GTJ H;  4LF8 Q;  4X6A H;  5IWA L;  2UXC L;  3UDG A;  4P72 A;  3G4S A;  1N32 L;  2Y0S E;  2E5L Q;  2K75 A;  3GDE A;  4JOI C;  1PH1 A;  1W3S A;  3PUW A;  1VQD A;  1E7Z A;  2RF4 A;  1K83 H;  1TWH H;  3OTO L;  1SFO H;  3ZJY C;  4AIM A;  4DV1 L;  5JJI A;  4EX5 A;  4IFD G;  2HIX A;  4JI0 Q;  2KCT A;  3GO5 A;  5IYB H;  1B70 B;  4PZ6 A;  4A3C G;  3S15 H;  2A8V A;  3KDF B;  4AQY Q;  4LUV A;  3PO3 H;  4DUY Q;  1OXU A;  3CMA A;  1VQJ A;  1XMO L;  3GTG H;  4YWL A;  3CXC A;  4B3S L;  1X56 A;  2I5H A;  5IE8 A;  4GKK L;  2NZH A;  1CKM A;  1UE1 A;  2LXK A;  1VQO A;  2KHJ A;  4UP7 A;  3STB C;  1SR3 A;  1XMQ Q;  2UU9 L;  1GD7 A;  2KHI A;  3CPW A;  3OW2 A;  1IBL Q;  1CSQ A;  4B3T Q;  1E24 A;  2N3S A;  4JI6 Q;  2UXB L;  1X55 A;  3ER0 A;  5GRO A;  1J6Q A;  3K8A A;  4QIW E;  5M3F G;  2HHH Q;  3KYH C;  2F4V Q;  1HNX L;  1X3G A;  3KF8 B;  3KF6 B;  5GAD C;  3GTP H;  3CP0 A;  3MXN B;  1HR0 Q;  4POF A;  3I56 A;  4LUO A;  1HNW Q;  2Z6K C;  1YJN A;  1TWG H;  2EXD A;  4GKJ Q;  4JYA Q;  4X62 Q;  3PUV A;  4DK3 C;  5M3M G;  3HOZ H;  4OWX B;  2ZTD A;  3F2D A;  2KCM A;  4PMW A;  3JAM c;  2CCZ A;  3HOU H;  2E8G A;  4DNI A;  2K5V A;  3CCE A;  2N49 A;  3B6Y A;  1XPU A;  3HOW G;  3I4M H;  4JOI A;  4DV3 Q;  1VQB A;  4L5T A;  1J5E Q;  4JI0 L;  3S2D H;  1IXR A;  2R7F A;  2UUA L;  3PO2 H;  3HOY H;  4BXX G;  3K0X A;  5M3F H;  1W2B A;  4DR1 L;  4DUY L;  4A3F H;  3H3V H;  1MJE A;  2JK8 A;  1R9T H;  2VL6 A;  4JI8 Q;  1M90 C;  4XTC S;  1Q12 A;  2CFM A;  2CKZ B;  2YTY A;  4MNO A;  3RLO A;  5M5W H;  1P16 A;  2ZM6 Q;  1Q7Y C;  1HR0 W;  4GN4 B;  3W1B A;  1VQM A;  4YCV A;  3HKS A;  1PH5 A;  1YHQ A;  5E7N A;  1XMQ L;  1MKH A;  2UUB Q;  3BU2 A;  1XNR Q;  1B7Y B;  4RMF A;  4A3D H;  4TQU S;  2IY5 B;  3CCJ A;  1QZH A;  3PIP A;  4LNQ A;  4A3I G;  2HHH L;  1CKN B;  3UE0 A;  4BBR G;  3CCV A;  2AMC B;  3S17 H;  4HJ5 A;  4GNX B;  3A5U A;  1YEZ A;  4HJ8 A;  1HR0 L;  2JA6 H;  1HNW L;  1Q8K A;  4Y7N H;  2ASB A;  5IY0 A;  2VQF Q;  1YI2 A;  4HIM A;  4JI4 L;  4GKJ L;  3S1R H;  4JYA L;  4X62 L;  2Z6K A;  2EIF A;  4A3L G;  4KHZ A;  5FJ8 H;  1S72 A;  3U4V A;  1MIU A;  4A3G G;  4XIG S;  3A0J A;  4NXM Q;  3M4Q A;  5J3B A;  1EIF A;  4DV3 L;  1X65 A;  1WCM G;  4R4I A;  2B3G A;  3M4P A;  3RNU A;  4A3E H;  3HKZ G;  1J5E L;  3EIV A;  4IFD I;  2VQE Q;  4JBK A;  3T1Y Q;  3RN2 A;  4IO9 A;  1GM5 A;  1CKO A;  3HKZ E;  2IHF A;  2GVA A;  4A93 H;  4DV7 L;  4K0K Q;  2BA1 A;  3NEL A;  1Y1V G;  3T1H L;  5M5Y H;  2C35 B;  3GTO H;  1Z9F A;  1UWV A;  1N34 Q;  5IYC G;  2ZJQ A;  1E3P A;  4OON A;  1X3F A;  3E9H A;  3CCU A;  1YNX A;  1N33 L;  3KOJ A;  2A1A A;  1SE8 A;  3I4N H;  1JJC B;  2RHS B;  3HOV G;  4FDB A;  1MJC A;  4UPA A;  4KHP L;  2Q2H A;  3GTL H;  1U0L A;  1NBW A;  2WB1 E;  4DV5 Q;  2NVQ H;  2R93 H;  2ES2 A;  1VCI A;  4EQ5 A;  4UP9 A;  1KD1 C;  4X65 Q;  1AE3 A;  1HNZ Q;  1SRU A;  3DLL A;  3RLF A;  4NB3 A;  4PG3 A;  1I94 Q;  3CD6 A;  3PCO B;  2IX1 A;  4LF4 Q;  2FXQ A;  4A3M H;  4NXM L;  3F2C A;  5IYC H;  1E1O A;  2RHQ B;  5IYB G;  4IOC A;  2K4K A;  1CKN A;  1XPR A;  3J81 i;  3AYH B;  3F8T A;  3PO3 G;  3T1Y L;  1FJG L;  4IPC A;  2AWO A;  5LMN L;  3F2B A;  3WWV A;  2EQS A;  5IP7 H;  2UXD L;  2Y0S G;  3K80 C;  4IPH A;  1N36 L;  1T9H A;  4LFC Q;  5IYD H;  1H95 A;  1AH9 A;  1K0R A;  3KFU A;  1E1T A;  1UE5 A;  4P73 A;  2VUM H;  2Q2I A;  1CSP A;  3CCL A;  4JBM A;  1PYS B;  4DKA C;  3HOX H;  2JA7 H;  1JJG A;  2F3I A;  1PV4 A;  4LFB L;  2VW9 A;  4DV2 Q;  4LF9 Q;  2Q2T A;  1K9M C;  2MO0 A;  3BZK A;  5IT9 c;  4GOP B;  1XNQ Q;  2AKW B;  2BH8 A;  2RCN A;  1YJ9 A;  5K36 G;  4DV5 L;  3RR5 A;  2OTL A;  4LF7 Q;  2CWP A;  3HOZ G;  3EBE A;  2VZA A;  3A74 A;  3AEV A;  3HOU G;  3I4M G;  2AHO B;  3K7A H;  1I94 L;  4DR2 Q;  4GN3 B;  2JQO A;  4BY1 H;  1L1O B;  4RG1 A;  4YHH L;  2ZJP A;  4LF4 L;  4GS3 A;  4GOP C;  2I5L X;  4DV6 Q;  4DR4 Q;  2OQ0 A;  3PO2 G;  1YBY A;  2MQH A;  1VQ8 A;  1PH8 A;  3HOY G;  2F52 A;  1LTL A;  4QJF A;  2XGT A;  5GQO A;  3UDI A;  4A3F G;  4BY7 G;  2IHE A;  3AQQ A;  1QVG A;  2YTX A;  5BR8 Q;  3I55 A;  4DR6 L;  2JJQ A;  1L1O C;  2YYZ A;  4R4Q A;  2A19 A;  4LFC L;  4LF8 L;  4BA2 I;  1SRO A;  1G6P A;  1C0A A;  1E22 A;  2WAQ G;  4A76 A;  1XJV A;  4DAM A;  1QUQ B;  2IX0 A;  2E5L L;  3W5O A;  3PUX A;  4C2M H;  3PV0 A;  4AH6 A;  2WAQ E;  4Y52 H;  4A3D G;  4JBJ A;  2R92 H;  5C3E H;  2ID0 A;  3RZO H;  1EWI A;  3FKI G;  4GLX A;  1D7Q A;  3L7Z C;  3NEN A;  3GTK H;  3JC6 6;  1KRT A;  1A8V A;  4DV2 L;  2K50 A;  4IJL A;  1IBK Q;  1XNQ L;  2JA6 G;  1YIJ A;  1VQL A;  3M4O H;  1EOV A;  4AQY L;  4BY7 H;  1IBM Q;  2PMZ E;  3Q8D A;  1VQH A;  2R7Z G;  1Y1W H;  1UE6 A;  5FJ8 G;  3K7U C;  1TWA H;  2QEX A;  4DR2 L;  4YCU A;  3CAM A;  1VQN A;  1VQ6 A;  1GO3 E;  4B3M Q;  4JI5 Q;  3UDF A;  4A3E G;  1NMG A;  1IBL L;  1KXL A;  1Q1E A;  1EQQ A;  4B3T L;  4JI6 L;  4GOP A;  3KDF A;  4R4T A;  2F4V L;  4A93 G;  3FKI H;  4A3J H;  2VY3 A;  4OX9 Q;  1LM0 A;  4YY3 Q;  4HIO A;  4A75 A;  1KQS A;  1CUK A;  1EIY B;  3NBH B;  4HID A;  1GKH A;  3TS0 A;  3ERS X;  4NXN Q;  4X66 Q;  4YWK A;  1L1O A;  2R7Z H;  4A3B H;  4LFA Q;  1VQI A;  3I4N G;  3VDY A;  4JI3 Q;  4GNX C;  1PH2 A;  1GVP A;  4JI2 Q;  1WYD A;  3S2H H;  1Q86 C;  1N8R C;  1X54 A;  1JMC A;  2JA5 H;  3RLN A;  2OTJ A;  4H02 A;  1PVO A;  4JC0 A;  3KF6 A;  4LUZ A;  2R93 G;  4LF5 Q;  4MZ9 A;  4DV4 Q;  4HJ7 A;  1V1Q A;  2BH2 A;  1LUZ A;  1IBM L;  1IL2 A;  3PUZ A;  4L5R C;  4IPG A;  2Q2U A;  2K14 A;  1QUQ A;  4JI8 L;  5M5X H;  1PH4 A;  2MO1 A;  2HT1 A;  4A3M G;  2ZM6 L;  3PF5 A;  3L2P A;  1QVC A;  4C3H H;  2NVX H;  2ZTC A;  1KC8 C;  1KL9 A;  2PQA B;  4O0A A;  4JI1 Q;  4LF6 Q;  4B3M L;  4UP8 A;  2UUB L;  4DUZ Q;  1XNR L;  3J80 i;  4KI0 A;  3CCM A;  2NVT H;  4OO1 I;  2YV5 A;  1PH9 A;  1HZ9 A;  1L2F A;  1WFQ A;  2V1C C;  5IP9 H;  2WB1 G;  1VQE A;  5LMU Q;  3CC4 A;  4DR3 Q;  1BBW A;  5IP7 G;  3H3V I;  2DUD A;  2CWA A;  4HJ9 A;  5GAG C;  5IYD G;  2NN6 I;  2K5H A;  3S14 H;  2VQF L;  3OYY A;  1S40 A;  5C0X J;  1KIX A;  5H1S E;  3I2Z A;  4NXN L;  3U50 C;  4IJH A;  4X66 L;  4A3K H;  3CPF A;  3RZD H;  3ULJ A;  2VUM G;  2AWN A;  1X9N A;  5IWA Q;  3E0E A;  3MEF A;  1SLJ A;  2KEN A;  1Q82 C;  1WI5 A;  3J7A 5;  1N32 Q;  2UXC Q;  2JA7 G;  3HOX G;  3PUY A;  2N8N A;  4JI3 L;  4JV5 Q;  1OXX K;  3NEM A;  1UE7 A;  4C3I H;  1PFS A;  3OTO Q;  4QL5 A;  2VQE L;  1JB7 A;  2MFI A;  4GNX A;  4DV1 Q;  1QZG A;  2ZTE A;  2XTI A;  3PSI A;  1SN8 A;  1D8L A;  4P74 A;  4DAY B;  3F1Z A;  3CC2 A;  2GN5 A;  1EFW A;  4K0K L;  1EYG A;  1PH7 A;  3I4O A;  4NPS A;  1N9W A;  2E2I H;  5ELN A;  4BY1 G;  1HZB A;  3FP9 A;  4JI7 Q;  1VQF A;  4QGU A;  1N34 L;  1FVI A;  4LF6 L;  4GKK Q;  4DUZ L;  1QVF A;  4DR7 Q;  3G48 A;  3PF4 A;  3UDX A;  1AE2 A;  4BA1 I;  4IPD A;  2YU9 H;  1X6O A;  2B63 G;  5JJL A;  1NTG A;  3SGI A;  1O7I A;  3H0G H;  3JAM i;  1FL0 A;  2IT1 A;  4A4I A;  5HY6 A;  1OXV A;  4ALP A;  4DR5 Q;  3E9I A;  5FLM H;  1HNX Q;  1IZ6 A;  2JE6 I;  3G6E A;  4DPG A;  3LGJ A;  4L5Q A;  4X65 L;  1XTD A;  1Z47 A;  1HNZ L;  1ASZ A;  2JA8 H;  1RL2 A;  1WJJ A;  4OXP A;  1JT8 A;  2R92 G;  5C3E G;  1VQ4 A;  1I3Q H;  2R7D A;  1X3E A;  3ICE A;  3CCS A;  5ELO A;  1YIT A;  1Q81 C;  4JV5 L;  5GAH C;  4PZ7 A;  4P75 A;  4OO1 G;  3KLW A;  2HIV A; 
#chains in the Genus database with same CATH topology
 3BZC A;  1EY5 A;  4R4O A;  3BDL A;  4POG A;  2UUA Q;  2NN6 G;  1KNA A;  4IUR A;  1G29 1;  3L9A X;  1LTI D;  4JI7 L;  3DM3 A;  2Q8T A;  3D6C A;  1BKB A;  1EY6 A;  2D9U A;  1QWY A;  2C5C A;  1YZ6 A;  1OXS C;  1Q8I A;  1SNO A;  3HEJ A;  3Q6S A;  3A56 A;  1TR5 A;  1U4L A;  1FR3 A;  4DR5 L;  3ULP A;  3TS2 A;  2D62 A;  5C4X H;  1PXU A;  2Z1C A;  3E3X A;  4A3B G;  4DN4 M;  2RCF A;  1PYB A;  5HGQ A;  1YNJ C;  2F0O A;  1LYL A;  2EYH A;  1LAB A;  1K3R A;  2KHS A;  1AW7 A;  1RHP A;  4DNT B;  3S16 B;  4A3G B;  3KLS X;  1B8A A;  3K5N A;  2SNM A;  1QB5 D;  1DGS A;  5CV9 A;  4B3R L;  4G57 A;  1U5K A;  3D31 A;  3OIQ A;  1H9R A;  4MN3 A;  3S24 A;  1LTA D;  4PNY A;  4TVA B;  1FGU A;  2UUC L;  3S1M B;  1MBY A;  1EFI D;  5ISR A;  3OWF A;  4HSP A;  2B2T C;  3HOW H;  2JEA I;  3P1H A;  1B9N A;  1XPO A;  1FD7 D;  3R2I A;  1Z6H A;  5AJ3 L;  4KHP Q;  1NJI C;  1J9O A;  1YJW A;  3J81 j;  1EEI D;  1Y69 U;  2Z8L A;  2WB1 B;  1PH3 A;  2DGY A;  3U9O A;  2XVS A;  2PZW A;  4O2D A;  4WRD A;  1OXT A;  2YTV A;  4L5S A;  4PZ8 A;  1CI3 M;  1LT5 D;  2PI2 E;  4MIU A;  1ENC A;  4M8A A;  2BE5 D;  1A0I A;  5COY A;  3NPP A;  4OX9 L;  1SFO B;  4C3J H;  3TN2 A;  4KV6 A;  5LMN Q;  3MVV A;  4HN7 A;  4RGO S;  2OWO A;  1N36 Q;  2ALY B;  3S1N H;  4F87 A;  1IYU A;  1K28 A;  2NVY H;  1GUS A;  3BDO A;  1PFB A;  2DNE A;  1VQG A;  4FVM A;  2E2D C;  1CM9 A;  4A3L H;  1V8Q A;  2A6H C;  3H0G G;  1BQQ T;  3TP8 A;  3TRZ A;  1HCZ A;  1WCM H;  2H1E A;  2L15 A;  1PHJ A;  1EOT A;  1PH6 A;  2B2T A;  4V19 0;  3J81 L;  4NMZ A;  1XMO Q;  1I6H H;  2QEJ C;  4ZYS A;  1M1K C;  3L0O A;  1YVC A;  3OMG A;  1I5F A;  3IKJ A;  2CH4 A;  3A54 A;  5I2Y A;  2HQE A;  4LWC A;  4YHH Q;  1DM0 B;  2UU9 Q;  1EY0 A;  3HRZ C;  3M9B A;  3HFZ B;  3AFP A;  5LHY 1;  1WTR A;  1VQA A;  3MTS A;  1IYJ B;  3HOV H;  2E2J H;  3ULL A;  4UY8 C;  3TQY A;  1ET6 A;  1JE5 A;  4GLV B;  4DR6 Q;  3M4O B;  4MTN A;  1B3A A;  4N9T A;  3UDG A;  1CZG A;  1VDZ A;  2K75 A;  4JOI C;  2G9H D;  5M5W B;  3DUZ A;  1HA5 A;  4J6H A;  1STA A;  2RF4 A;  1K83 H;  3DEP A;  3ZJY C;  5EPJ A;  4AIM A;  4DV1 L;  5JJI A;  1SYB A;  5IYB H;  4A3C G;  4A3D B;  3S15 H;  1V1P B;  2MPM A;  5C3X A;  4LUV A;  3FKI B;  3S17 B;  3GTG H;  2RBM A;  5DEH A;  4Q0F A;  1UE1 A;  2KHJ A;  1LT6 D;  1SR3 A;  3SK8 A;  3OW2 A;  1ET9 A;  1IBL Q;  1CSQ A;  2UXB L;  1X55 A;  2F4V Q;  1JIC A;  2HHH Q;  2Z4H A;  3CP0 A;  1HR0 Q;  2I07 B;  1YJN A;  1TWG H;  1UNS A;  2XRQ D;  4KHV A;  4CHT B;  2EXD A;  4GKJ Q;  4HAE A;  3HOZ H;  1GUG A;  2CCZ A;  4DNI A;  2K5V A;  4NKL A;  2PCF B;  4JOI A;  4RKL A;  4JI0 L;  2K33 A;  3BS1 A;  2QF7 A;  2R7F A;  2UUA L;  4EGV A;  2BE5 C;  3H3V H;  3DMU A;  4DUY L;  1HHV A;  1D6E C;  1MJE A;  2JK8 A;  1R9T H;  2NTT A;  4XTC S;  2F0H A;  2NVQ B;  2ZM6 Q;  3MWY W;  3DM1 A;  1GUT A;  4GN4 B;  2AQ1 B;  5E7N A;  1XMQ L;  3SVM A;  1MKH A;  4G7O C;  1CTM A;  1EQV A;  3TP6 A;  2B8G A;  3MXG A;  4OL7 A;  1EIH A;  3KBG A;  3I3C A;  1YEZ A;  4I65 A;  1HNW L;  4CJ2 C;  3BVZ A;  1BOS A;  2VQF Q;  3S1R H;  4JYA L;  1KAB A;  4DK1 A;  1RCV D;  2VB2 X;  4XIG S;  1CHQ D;  2M00 A;  2PW5 A;  2KJX A;  1X3P A;  3KF8 A;  1ESR A;  3RMH A;  4A93 H;  3HGB A;  5KYI A;  4F8M A;  3NTH A;  4K0K Q;  4H13 C;  1Y1V G;  1CT1 D;  5M5Y H;  4RFB A;  1RKN A;  5IYC G;  4OON A;  3CCU A;  3QB3 A;  1SE8 A;  1UEA B;  1EY9 A;  1MJC A;  4KHP L;  3VYS A;  3GTL H;  1JR0 D;  1PDQ A;  4EQ5 A;  1KD1 C;  1PTO B;  1WD1 A;  3P75 A;  1SRU A;  4C1N I;  1SYF A;  1I94 Q;  3DEO A;  4LF4 Q;  2FXQ A;  4A3M H;  4NXM L;  1HA6 A;  5IYC H;  1E1O A;  5CV8 A;  1M4V A;  5AFW A;  2F0F A;  3ITP A;  3PO3 G;  4IN3 A;  3VR6 A;  1TY2 A;  4IPC A;  5LMN L;  2CQA A;  2EQS A;  5IP7 H;  2Y0S G;  4KD3 A;  1N36 L;  4LFC Q;  3JAM L;  1TT2 A;  3BZD B;  1F2M A;  1TWA B;  4GZY C;  1LT3 D;  5IGC A;  4IUP A;  3ONA B;  1CSP A;  2DN8 A;  2KQ3 A;  1PYS B;  4DV2 Q;  2Q2T A;  3H94 A;  1EYC A;  3BZK A;  1K9M C;  2AKW B;  2FMM A;  5K36 G;  5JVG 3;  5TSS A;  4B9X A;  1BXT A;  1AZQ A;  1SEB D;  3EBE A;  3I4M G;  4Q5V A;  3K7A H;  2FIN B;  4RG1 A;  4YHH L;  2ZJP A;  1SYE A;  2I5L X;  2NZ1 D;  1KNE A;  3FVQ A;  2L12 A;  3HOY G;  4QJF A;  4A3F G;  2IHE A;  4FXG C;  2F0D A;  2F0S A;  4DR6 L;  2YYZ A;  1TS5 A;  4R4Q A;  4BBS B;  1BNZ A;  2ICI A;  2WAQ G;  4N8X 1;  1HPC A;  2IX0 A;  3W5O A;  2L11 A;  1BCP D;  3OMC A;  3PV0 A;  1Y8N B;  2WAQ E;  4JBJ A;  5C3E H;  3RZO H;  1EWI A;  4CBV A;  3GTK H;  1KRT A;  2JA6 G;  2K50 A;  3ERQ A;  4IJL A;  1IBK Q;  1XNQ L;  4DF7 A;  1F2Z A;  2R7Z G;  3LWE A;  1Y1W H;  5FJ8 G;  2I46 A;  4CGY B;  1KTK A;  3CAM A;  2IL8 A;  1VQN A;  1GO3 E;  4MHE A;  3UDF A;  3WDN A;  5ELB A;  1IBL L;  1Q1E A;  4RCN A;  1S4Z A;  1SJE D;  1EQQ A;  1KXL A;  5CMD A;  1HTP A;  4R4T A;  2F4V L;  4KN7 C;  4A3J H;  1XYI A;  1PRT B;  4HMI A;  1JOR A;  1E2W A;  1LM0 A;  3NQI A;  3NBH B;  1LTG D;  5KRU A;  1O7Z A;  3TS0 A;  4OHJ A;  2R7Z H;  5EKK A;  2PZT A;  4HTH A;  4LFA Q;  3I4N G;  1H9K A;  4C56 C;  1KDC A;  4JI3 Q;  1U9R A;  1QNK A;  5CYU A;  1GVP A;  1KDB A;  3KBX A;  2OTJ A;  1X54 A;  4DV4 Q;  3MFY A;  2PPB C;  3PUZ A;  5FOB B;  1A6X A;  1QUQ A;  2HT1 A;  5M5X H;  2MO1 A;  2ZM6 L;  4C3H H;  1KL9 A;  1GJX A;  2C9O A;  4NDX A;  5JEA H;  3BYY B;  1NSN S;  1WFQ A;  5IT9 L;  1PH9 A;  2HCC A;  1VQE A;  1IL8 A;  1I4H A;  3J7Y W;  5LMU Q;  4DR3 Q;  2DUD A;  5HUR A;  5IYD G;  4IZ8 A;  3DWA A;  3PIP 3;  3S14 H;  2VQF L;  1S40 A;  1SNQ A;  5C0X J;  3HS0 C;  4X66 L;  2VUM G;  4KY5 A;  4KN4 C;  3PO3 B;  5IWA Q;  3E0E A;  1Q82 C;  3NE5 B;  3HOX G;  3J81 E;  4N9P A;  3NEM A;  2Y0S B;  4KTA A;  5I9P A;  4C3I H;  3OTO Q;  1PFS A;  4QL5 A;  1LTB D;  3PSI A;  1SN8 A;  1D8L A;  1EFW A;  3HP3 A;  1X3Q A;  4I7Z C;  4K0K L;  2OT2 A;  4JI7 Q;  2F0G A;  1HFG A;  4DA2 A;  4DUZ L;  2SNS A;  3VYT A;  1BCP C;  4DXG A;  3HZX A;  1ZYR C;  5KNC A;  2B63 G;  1NTG A;  2CVR A;  2SDF A;  5A2Q E;  1FL0 A;  4DR5 Q;  4CKE A;  5FLM H;  1IZ6 A;  4QIW B;  3G6E A;  4L5Q A;  1XTD A;  1SYD A;  2JA8 H;  3HOY B;  1OO9 B;  2A69 D;  1RL2 A;  4OXP A;  1VQ4 A;  1I3Q H;  1SBB B;  5ELO A;  4JV5 L;  4JCV E;  2Q8R E;  1TXY A;  2E2H H;  5M3M B;  2V4D A;  4QMG A;  4EVO A;  4ZLT F;  2B63 H;  1K73 C;  4OWT B;  5C0X H;  1QNU A;  1SAP A;  5LL6 S;  1E2V A;  4B3R Q;  4DR1 Q;  4Z9C B;  3M85 A;  2X69 A;  3J81 c;  3CME A;  1KLU D;  4K6D A;  5KGU A;  2JN4 A;  4GLA C;  2UUC Q;  5C3W A;  2CQO A;  3QWN A;  2G5D A;  5KIX A;  3KJP A;  3I7F A;  1ILQ A;  3RUZ A;  1VMC A;  3A5Z B;  5AJ3 Q;  2ZJR A;  4IFD H;  2M2L A;  1SMX A;  1EU3 A;  1HZA A;  3CQZ H;  4B9W A;  2WFW A;  4AYB G;  2O2L D;  1V43 A;  4JI4 Q;  4BBR B;  5C4Z A;  4AYB E;  2JA5 G;  1FNU A;  3TME A;  2PNH A;  2R61 A;  4IOA A;  3GTO B;  5DLQ E;  1M8A A;  2GVB A;  3K5L A;  1KRS A;  4R4C A;  1LV9 A;  2KBN A;  3M3Y H;  4DGZ A;  2R3Z A;  3CRK C;  1BO0 A;  1IKM A;  2X6G A;  4FF4 A;  2K5D A;  4HMJ A;  1JJ2 A;  4DV7 Q;  3HKZ B;  2Z6B A;  2FJ2 A;  1JOK A;  4JBW A;  3CW2 C;  3CC7 A;  1WVL A;  3GTQ B;  2PQE A;  2RVL A;  4RGT A;  1A3U A;  4ULL A;  1TII D;  3QOJ A;  1IBK L;  5C0X I;  2FFK B;  4A3K G;  1SNM A;  2Z4I A;  4BXX H;  4YWM A;  3A8J E;  1KAW A;  1WTW A;  3GTJ B;  2O5I C;  3CCR A;  1IYV A;  1ASY A;  5I9O A;  2MNA A;  2Z0S A;  1ZKO A;  1HH2 P;  5FK9 C;  1TWH B;  1WTP A;  4IUU A;  2D0P A;  4A3I H;  1E0B A;  3W3A A;  3A7A B;  1Q46 A;  2OEO A;  2TMP A;  4ZAI A;  2UXD Q;  2D0O A;  2ENB A;  1NMF A;  2WAC A;  4DV0 L;  4LFA L;  2A69 C;  5COR A;  3S16 H;  4A3G H;  3CKI B;  1STH A;  4DV4 L;  4LFB Q;  2A68 D;  2GA4 B;  1PTO F;  2IJ0 A;  2RDF A;  1QG7 A;  4WFN 3;  1T5X D;  3WOE A;  1G51 A;  3GTP B;  4HSV A;  1R4Q B;  4QUC A;  2K52 A;  3RN5 A;  3S1M H;  3ERO A;  1JCK B;  3IRB A;  2F0K A;  1RIP A;  4OWW B;  5LMU L;  3HOU B;  4DR3 L;  2PNR C;  2XRS D;  3T53 B;  2UXB Q;  1Q90 A;  2JEB I;  3C3L A;  4CKC A;  2KUM A;  2BA0 A;  3S2D B;  3PO2 B;  1S3O A;  1TS3 A;  5FLX c;  3J80 c;  3EQL C;  5IWA L;  1I6V C;  2A6H D;  4BY7 B;  3GDE A;  5ELD A;  5J22 A;  3ZYY X;  1E7Z A;  3VR3 A;  3OTO L;  1SFO H;  5EPL A;  3D4D A;  4JI0 Q;  5D3D A;  5C4X G;  3GO5 A;  4PZ6 A;  1NNX A;  2A8V A;  3KDF B;  4AQY Q;  3DWP A;  4RAU C;  5A35 A;  4DUY Q;  1SJH D;  1NAP A;  1OXU A;  5IGG A;  4KJN A;  4B3S L;  1STY A;  5IE8 A;  2FHT A;  1CKM A;  1TU2 B;  1W6J A;  1BDO A;  2D2C C;  5CBA E;  1XMQ Q;  2KHI A;  1F9S A;  2NUC A;  2N3S A;  5GRO A;  5M3F G;  1X3G A;  3EVQ A;  3KF8 B;  3KF6 B;  3WOF A;  4A3E B;  1GXD C;  2EE1 A;  1HNW Q;  1IHZ A;  3MHB A;  3N52 A;  2EYF A;  4JYA Q;  3PUV A;  4DK3 C;  3F2D A;  1ICF B;  1IW7 D;  4PMW A;  3JAM c;  3HOW G;  1B44 D;  3K5O A;  3EJI A;  1IXR A;  1CHP D;  4ABN A;  2IWH A;  4I7A A;  5M3F H;  1VF5 C;  4DR1 L;  1M90 C;  1J8I A;  5M5W H;  2CKZ B;  1Q7Y C;  2EJM A;  1P16 A;  1PFM A;  2J4X A;  3W1B A;  2JP1 A;  3M7G A;  4DFA A;  4YCV A;  4QCL A;  3HKS A;  1PH5 A;  1YHQ A;  3BU2 A;  1PRT F;  1XNR Q;  3QR8 A;  4RMF A;  2EZV A;  1Q3L A;  4A3D H;  4TQU S;  4C3J G;  3CCJ A;  1QZH A;  3PIP A;  1WTH A;  3UE0 A;  3S17 H;  2RDH A;  3CCV A;  3R93 A;  4HJ5 A;  3D8G A;  3PIO 3;  4HJ8 A;  4Y7N H;  1T5E A;  3TP7 A;  5IY0 A;  1AN8 A;  2A68 C;  4JI4 L;  2K32 A;  3OHX C;  4X62 L;  4ZRZ A;  3KLS A;  4A3L G;  3N6R A;  3U4V A;  1MIU A;  4TKO B;  2K03 A;  3A0J A;  4NXM Q;  4DV3 L;  1WCM G;  1X65 A;  3NK9 A;  3R3O A;  1DCZ A;  1J5E L;  4JBK A;  3MXN A;  2A6E C;  1G91 A;  2JA7 B;  2KEE A;  2GVA A;  5IT9 E;  4DV7 L;  2BA1 A;  4F88 A;  3BG3 A;  2ZT9 C;  4L6T B;  1N34 Q;  4OGQ C;  1X3F A;  4X3K A;  3OIP A;  1YNX A;  4BY1 B;  2A1A A;  3HOV G;  2RHS B;  4FDB A;  2Q2H A;  1U0L A;  1SXT A;  1Z7T A;  2NVQ H;  2R93 H;  4UP9 A;  3A7L A;  2DJF C;  3RLF A;  4NB3 A;  1RTO A;  2IX1 A;  2BDN A;  5IYB G;  1MI2 A;  2R92 B;  2F0V A;  3F8T A;  3T1Y L;  3WWV A;  2UXD L;  2N55 A;  2NBF A;  3S9W A;  1T9H A;  4H0L C;  3SDZ A;  5KEE A;  5C4X B;  1E1T A;  5IGE A;  3Q0A A;  5A2Q L;  3VA5 A;  2Q2I A;  4JBM A;  4DKA C;  1IW7 C;  2F3I A;  2K1B A;  4LFB L;  4LF9 Q;  1XNQ Q;  5IT9 c;  1K0S A;  4DV5 L;  1EWH A;  3RR5 A;  4LF7 Q;  1LTT D;  1B1Z A;  2CWP A;  3OOC A;  3HOZ G;  5EQ0 A;  2VZA A;  3AEV A;  4GN3 B;  2JQO A;  2PYK A;  2E76 C;  1O78 A;  1HRJ A;  4GOP C;  4DXF A;  4DV6 Q;  1R4P B;  3FEW X;  4DR4 Q;  4A3B B;  2OQ0 A;  3SXH A;  1YBY A;  3MXU A;  4LMQ D;  2F52 A;  1LTL A;  2XGT A;  5GQO A;  3AQQ A;  1PTO H;  2YTX A;  5G3L F;  3I55 A;  2JJQ A;  5I2X A;  2A19 A;  2L5T A;  1DOK A;  2XWB B;  4DAM A;  1QUQ B;  1FGB D;  2ZXO A;  1EYA A;  1JC7 A;  4JW0 A;  1D7Q A;  1V1O A;  3L7Z C;  3NEN A;  4KKU A;  4OO1 H;  1A8V A;  1F77 A;  1STG A;  4EQO A;  1EOV A;  4AQY L;  5CBE E;  4LJZ C;  2PMZ E;  3J7A F;  2LMC B;  1TWA H;  2QEX A;  4YCU A;  4EQP A;  3RZD B;  4JI5 Q;  3QIA A;  3S1N B;  2NVY B;  4GOP A;  3KDF A;  4A93 G;  4RKB A;  3TZU A;  1PFN A;  2L9H A;  1TS2 A;  2F0W A;  3MAQ A;  4HID A;  4X66 Q;  2E2I B;  4BWG B;  2FMC A;  3VDY A;  3O13 A;  4J1M A;  4K5V A;  3S2H H;  1Q86 C;  1PVO A;  3KF6 A;  4R8N A;  2K6A A;  4LF5 Q;  4HJ7 A;  2YU9 B;  2BH2 A;  4K5X A;  1LUZ A;  1WTQ A;  3H0G B;  2KED A;  4IPG A;  2K14 A;  2Q2U A;  5IGF A;  4IUN A;  4A3M G;  3HOV B;  1QVC A;  3QJY A;  1QIL A;  4O0A A;  4JI1 Q;  4B3M L;  4UP8 A;  5DNF A;  4DUZ Q;  1XNR L;  2EVB A;  2NVT H;  4OO1 I;  2YV5 A;  3KUP A;  3R8B A;  5IP9 H;  5IP7 G;  3H3V I;  3TP5 A;  2CWA A;  5GAG C;  1ENF A;  1FNV A;  3OYY A;  1JQY D;  1C4Q A;  1KIX A;  3Q23 A;  5H1S E;  3I2Z A;  4NXN L;  3CPF A;  3ULJ A;  5JOB A;  1TWF B;  3MEF A;  3J7A 5;  2KEN A;  1N32 Q;  2UXC Q;  3GTG B;  4RGN A;  2N8N A;  2EJF C;  4JV5 Q;  5NUC A;  4ZCK A;  1SE2 A;  1UE7 A;  5C4J B;  2F0E A;  2KA7 A;  3NSW A;  2ZTE A;  1TWC B;  3CC2 A;  1BCP B;  1QOH A;  1N9W A;  2F0I A;  2F0L A;  1L0X B;  3GP7 A;  2EYP A;  1N34 L;  1FVI A;  4KD4 A;  4BA1 I;  1AE2 A;  3IL8 A;  1WD0 A;  1G2S A;  5E4W C;  4ALP A;  1OXV A;  1HNX Q;  3E9I A;  2O4X A;  3LGJ A;  3SR1 A;  2TSS A;  1ASZ A;  5C3E G;  3MXP A;  2IPK D;  2R7D A;  1X3E A;  3KLR A;  3CCS A;  1VMP A;  3C1E A;  1DXM A;  1FYC A;  3QO2 A;  5I4D A;  4WOR A;  3T4A C;  1Y1W G;  3FRP B;  4GN5 A;  2SEB D;  1NUC A;  3FHW A;  2I0Q A;  1RJT A;  1A62 A;  1YHA A;  2HD3 A;  1AZP A;  1ZYR D;  4PMC A;  1C7Y A;  4FYD A;  4A3J G;  4OEL B;  5JEA J;  1YHB A;  5C44 G;  4DAY A;  4RH6 A;  3PIO A;  4LF9 L;  2A5H A;  4WJ3 M;  1VQ7 A;  1KHI A;  4LF7 L;  2B39 A;  1VQ5 A;  2OXP A;  4MTK A;  1EU4 A;  2VS1 A;  5JAV A;  1ZXT A;  4M1U B;  5C5M A;  1RF2 D;  3AFQ A;  1OTC A;  4IAL A;  5CV7 A;  4DV6 L;  4DR4 L;  1AP0 A;  3PMF A;  2RQX A;  4X64 L;  3TSS A;  4LW1 A;  2LY7 A;  5DM6 3;  1BBU A;  2NZO A;  3U4Z A;  4QQB X;  3BVG A;  4K5W A;  3V96 A;  5C44 H;  3KJO A;  3A8K E;  1PZK D;  4C3H G;  2QGQ A;  2OQK A;  1HJP A;  4JG2 A;  5JEA G;  3J7Z C;  3T1H Q;  4DV0 Q;  5EAY A;  1EUJ A;  3TZD A;  1WOC A;  3U58 A;  5M3M H;  1Y1V B;  1SNC A;  1UEB A;  1N33 Q;  2JA9 A;  4RGM A;  1F9R A;  3K58 A;  2VXW A;  1DYQ A;  2JYO A;  4G7H C;  5EBD A;  3GTM H;  2MGS A;  4X3U A;  2H5X A;  1UUP A;  5IOD A;  3DHQ A;  4QY7 A;  4JI5 L;  4C3I G;  1MSH A;  3CF5 A;  1BF4 A;  1NE3 A;  4OIJ A;  4J15 A;  4YCW A;  2BOS A;  2WP8 J;  2M9V A;  4R1J A;  4BBR H;  4F7X A;  3TDQ A;  2N78 A;  2F0T A;  1SSO A;  1S5F D;  3EN2 A;  1NR4 A;  3AB9 A;  1VQ9 A;  5CGK A;  3K7A B;  3S1Q H;  2E74 C;  2KVM A;  2PI2 A;  2B29 A;  4LF5 L;  5FLM G;  2JA8 G;  3UE1 A;  2LS0 1;  4IFD J;  1RTN A;  3GTQ H;  4B3S Q;  5ELF A;  5FO7 B;  2WII B;  4LK1 C;  4JI1 L;  3Q24 A;  3FPP A;  1I50 H;  4K8J A;  3NTI A;  4ME3 A;  3X3M A;  3D4R A;  3GD7 A;  1B2T A;  2I5M X;  1VS0 A;  4XDX A;  1C9O A;  3I4M B;  5C0X G;  4APV A;  2R6G A;  3RZO B;  1XXG A;  1VQK A;  3Q22 A;  3BVM A;  4R9W A;  3MA2 B;  4KKT A;  4XQN A;  3GTJ H;  2B2Y C;  4TSS A;  4A3F B;  2UXC L;  1N32 L;  1BBX C;  4H44 C;  1BR9 A;  1PH1 A;  1VQD A;  2F0Q A;  2RKS A;  1TWH H;  2WAQ B;  4IFD G;  2HIX A;  3I73 A;  2KCT A;  3BYT B;  1B70 B;  3H3V C;  1F9Q A;  4XYQ A;  4R8I A;  4XQJ A;  1STB A;  3CMA A;  4YWL A;  1MGS A;  4RA8 A;  3CXC A;  4BS9 A;  2JA6 B;  3IFD A;  4P2C B;  2EYJ A;  3HG9 A;  1VQO A;  2LXK A;  2R7Z B;  4PQX A;  1ILP A;  3CPW A;  5IGB A;  4B3T Q;  1E24 A;  5IOC A;  4JI6 Q;  5K5P A;  3K8A A;  3KYH C;  1HNX L;  3GTP H;  3I72 A;  5GAD C;  2QCP X;  3MXN B;  4LUO A;  1D1K A;  2B8F A;  2L4N A;  4X62 Q;  3R2T A;  5EPK A;  2DNC A;  3I4L A;  2KCM A;  3HOU H;  2B2Y A;  2E8G A;  3CCE A;  4C3H B;  3DWQ A;  5I6Y A;  1JOQ A;  4UHV A;  4DV3 Q;  1VQB A;  4ZKB B;  3K57 A;  4G7Z C;  4L5T A;  1J5E Q;  4ID6 A;  3S2D H;  4OEM B;  2DJG C;  3PO2 H;  1HQR D;  3I4N B;  4BXX G;  3K0X A;  4PV1 C;  1W2B A;  3NP8 A;  5KND A;  2K04 A;  4JI8 Q;  1W6K A;  2CFM A;  4MNO A;  1JWM D;  1WTV A;  4WJW A;  1VQM A;  4L8J A;  4A3I G;  2F3W A;  2QDL A;  4RCO A;  4B08 A;  2ASB A;  3K6O A;  4C1N K;  2EIF A;  1S72 A;  2HUG A;  1ZEQ X;  4A3G G;  2EDG A;  2K5W A;  3M4Q A;  5J3B A;  1NR2 A;  1EIF A;  2PW7 A;  5D65 A;  4CKB A;  2VUM B;  4A3E H;  1QCB D;  4IFD I;  3EIV A;  3T1Y Q;  3HOX B;  3RN2 A;  4IO9 A;  2F0J A;  1CKO A;  1GM5 A;  2IHF A;  1H9M A;  3GV6 A;  3NEL A;  3T1H L;  4EQN A;  1TQO A;  1HTL D;  2C35 B;  1UWV A;  1E3P A;  3E9H A;  2MJ8 A;  1N33 L;  3CU7 A;  3MEH A;  3SE0 A;  4UPA A;  3V05 A;  4ODG A;  1CZW A;  5CV4 A;  1S5D D;  2WB1 E;  2XN9 C;  2HCI A;  4DV5 Q;  4QF4 A;  2QKI C;  2EY5 A;  2B63 B;  4K6L A;  1RD9 D;  2WKD A;  3DLL A;  3CD6 A;  3IFT A;  3PCO B;  3C46 A;  2E75 C;  4FXK C;  3F2C A;  4XYO A;  2A6E D;  4C2M B;  4IOC A;  1CKN A;  3NWT A;  1XPR A;  1BCP F;  1PZJ D;  3J81 i;  1PLF A;  4KY6 A;  2K7V A;  3F2B A;  3C1F A;  3T56 B;  1EL0 A;  1AH9 A;  3DXJ C;  3KFU A;  1UE5 A;  5EKI A;  4P73 A;  1CK1 A;  2JA7 H;  3URY A;  1JJG A;  3MFG A;  4GOP B;  1G2T A;  1YJ9 A;  2OTL A;  3LWU A;  1JWS D;  2AUJ D;  3T51 B;  3A74 A;  4QUF A;  3M3Y B;  1B3Q A;  1EZ6 A;  4BY1 H;  2A73 B;  1JWU D;  4IQZ A;  3AU7 A;  2SOB A;  4AYB B;  2MQH A;  4DU9 A;  5HGT A;  1VQ8 A;  2QIL A;  4UAI A;  4K8I A;  1CA5 A;  3LX0 A;  2QDB A;  2JA5 B;  1ROD A;  2ICE C;  5BR8 Q;  1L1O C;  2RSO A;  3H09 A;  1SRO A;  1G6P A;  1E22 A;  4A76 A;  1XJV A;  2JSO A;  3PUX A;  1EY4 A;  5C5L A;  4A3D G;  2K28 A;  2K05 A;  1LLR D;  4HCS A;  3SK6 A;  2R92 H;  2NVX B;  3CRL C;  4XT1 B;  3QOL A;  1KDA A;  3H6M A;  3FKI G;  1WTO A;  1B53 A;  5CR3 A;  3JC6 6;  4HCE A;  3M4O H;  1YIJ A;  1VQL A;  1XWE A;  3P20 A;  3Q8D A;  3F2U A;  4RWS C;  2NN6 H;  2B2U C;  1D5X C;  2EPB A;  4A3I B;  1HXY D;  4DR2 L;  4A3K B;  3SK5 A;  1B4O A;  4B3M Q;  4B3T L;  4JI6 L;  5L37 A;  4DK0 A;  3FKI H;  3MZ5 A;  4ZKC B;  4YY3 Q;  4HIO A;  1CUK A;  1EIY B;  1LTS D;  4NXN Q;  4RHS A;  1L1O A;  3OSO A;  4A3B H;  4FNF A;  2EYM A;  1VQI A;  1L0Y B;  4JI2 Q;  1WYD A;  1N8R C;  1JMC A;  4FO2 A;  3RLN A;  4H02 A;  4JC0 A;  2R93 G;  3E0J A;  3FPU B;  1V1Q A;  3IAY A;  1G8Z D;  1IBM L;  1I4R A;  2EYO A;  4L5R C;  2K5Q A;  4JI8 L;  1PH4 A;  2F1M A;  3T13 A;  2CH4 W;  3G6J B;  3PF5 A;  1STE A;  1KC8 C;  2F0P A;  2PQA B;  2B2U A;  1K8O A;  3K0Y A;  3J80 i;  3CCM A;  1EY8 A;  5EGT A;  3VR2 A;  1QJO A;  4DAV A;  1O7Y A;  4HJ9 A;  1G6Z A;  2NN6 I;  2K5H A;  4K2K A;  2RDG A;  4XXE A;  3RZD H;  4IJH A;  3OPO A;  2IW3 A;  1SLJ A;  1WI5 A;  1Y8O B;  2EXZ A;  3D3R A;  1EYD A;  2B2V C;  2BDO A;  1C48 A;  1VF7 A;  2XTI A;  4DAY B;  3EA6 A;  4P74 A;  3F1Z A;  2GN5 A;  2J0T D;  1LT4 D;  1PH7 A;  3I4O A;  4NPS A;  2E2I H;  1HZB A;  4LF6 L;  4GKK Q;  1QVF A;  3PF4 A;  1DZ1 A;  1QE6 A;  3UDX A;  4X3T A;  4IPD A;  3J7A V;  2YU9 H;  1X6O A;  5JJL A;  4ZQ3 A;  2VB3 X;  3H0G H;  3JAM i;  1TS4 A;  2IT1 A;  4A4I A;  2JE6 I;  4DPG A;  4KY7 A;  5M3F B;  4ZUI A;  1SYC A;  1UAP A;  5FO8 B;  2H4O A;  1YIT A;  1Q81 C;  5GAH C;  4PZ7 A;  4OO1 G;  3KLW A;  2HIV A;  4X3S A;  4X64 Q;  1I4P A;  3NXW A;  4UDU C;  2HQL A;  5KYL A;  2KCC A;  3D0F A;  2B2V A;  4P71 A;  3HOW B;  3UI2 A;  1SE4 A;  1TWF H;  4V0B A;  2DY8 A;  2LKV A;  4Y7N B;  1DD2 A;  1PZI D;  3OWE B;  4XT3 B;  4NP5 A;  5C4J H;  4DR7 L;  1TWC H;  3I90 A;  1MSG A;  1SMY D;  1H9S A;  3KK7 A;  4XQQ A;  2L55 A;  4HR7 B;  3CCQ A;  2ATW A;  1D5M C;  4A3C H;  2VNU D;  4C3J B;  2QA4 A;  1PYW D;  1PA6 A;  1ENA A;  2XIW A;  3D4W A;  3VR4 A;  2N88 A;  5KNB A;  1U4M A;  5CC4 A;  2HDL A;  4BBS G;  3PGZ A;  1YNN D;  2HDM A;  4N8F A;  5BR8 L;  4DK6 C;  1WTX A;  1TVX A;  2K5N A;  1WCM B;  3NHH A;  2O5J C;  3STB D;  5JJK A;  2R93 B;  1I6H B;  1NY4 A;  1VQC A;  1AEX A;  5IP9 G;  1II3 A;  1ML0 D;  2B2W C;  4WJ4 A;  2NWG A;  2EYL A;  3MC0 B;  4BBS H;  5DM7 3;  4IUQ A;  3TRE A;  2LSS A;  4ZUJ A;  2E2J B;  4H7B A;  1PMR A;  2K01 A;  5EJW A;  1ONL A;  1K8G A;  1P8L A;  4HIK A;  2LXJ A;  4E6I A;  5I6W A;  1K83 B;  5E1F A;  4YY3 L;  4ZK9 B;  5FLX L;  3J80 L;  1VQP A;  1FJG Q;  2F0M A;  1L0W A;  1EQR A;  3S15 B;  4HJA A;  2IX3 A;  2NB0 A;  1BVS A;  2OF1 A;  2CHB D;  4CDC C;  5J1Z A;  3NTK A;  4JI2 L;  2F0U A;  2A74 C;  1F2Y A;  5DAU A;  3BJU A;  3G71 A;  5LL6 X;  1V9P A;  5GAE C;  2B2W A;  1S5C D;  1K8A C;  1D5Z C;  1GHK A;  2NYZ D;  2OCE A;  1GHJ A;  3E6Z X;  3FMC A;  3NWS A;  1HZC A;  1TWG B;  5LMN W;  3W1G A;  3LNN A;  1Y1V H;  1Q1B A;  3HOZ B;  4KLK A;  3V2T A;  1DOM A;  1K3B C;  1XTC D;  3K81 C;  3L3O C;  1SYG A;  4NW2 A;  2WKC A;  3M7N A;  5T1I A;  1I4G A;  3TEH B;  3H15 A;  1Y14 B;  1O7L A;  1SMY C;  5E4X A;  1F2L A;  2PQA A;  5BN4 A;  4LF8 Q;  5T1G A;  4X6A H;  5E3F A;  4U67 3;  4P72 A;  3G4S A;  2AUK A;  2Y0S E;  1BUV T;  5IGD A;  2E5L Q;  1R9T B;  1I4X A;  1Y8P B;  3K5M A;  1W3S A;  3PUW A;  5EBC A;  1A2U A;  2MP1 A;  4K2L A;  3H91 A;  1A3V A;  2X6L A;  1MD2 D;  2G9D A;  2JXM B;  4EX5 A;  3D6W A;  2P5Z X;  1LTR D;  1SDF A;  2ZXR A;  2F03 A;  2AQ2 B;  3M4Y A;  2L0C A;  3PO3 H;  1YNN C;  5C6A A;  1XMO L;  1VQJ A;  5D14 A;  1X56 A;  2I5H A;  4ME5 A;  4GKK L;  2PMZ B;  2NZH A;  4UP7 A;  1ESF A;  1PTO D;  3ND9 A;  3STB C;  3S1R B;  1GUW A;  4CJ1 B;  2UU9 L;  1GD7 A;  2QW7 A;  1CQV A;  3ER0 A;  1J6Q A;  4HED A;  3E5S A;  4QIW E;  3SK4 A;  3S2H B;  4FF3 A;  4POF A;  3I56 A;  2Z6K C;  2RA4 A;  4PMB A;  5K36 H;  4A93 B;  2WIN B;  5M3M G;  1S5B D;  2BCO A;  2ZTD A;  4OWX B;  5JPM C;  3I4M H;  5M5Y B;  1XPU A;  2N49 A;  3B6Y A;  3GV3 A;  3A8I E;  2NVT B;  3HOY H;  1EIG A;  3W2D A;  4G4K A;  4A3F H;  3RD4 A;  3GTL B;  1GUN A;  2VL6 A;  2PO4 A;  5D3I B;  2F4I A;  1Q12 A;  3VYU A;  2YTY A;  3QG1 A;  3RLO A;  1HR0 W;  1HQM C;  5J39 A;  2WV6 D;  3NBI A;  2L1B A;  2UUB Q;  1B7Y B;  4A3M B;  2IY5 B;  3I70 A;  2MHV A;  1V1P A;  4IUV A;  3SHL A;  4LNQ A;  3ND8 A;  4DAP A;  2HHH L;  1CKN B;  4BBR G;  2AMC B;  5BN5 A;  1HFN A;  1SND A;  4GNX B;  3A5U A;  1HR0 L;  2JA6 H;  1Q8K A;  1YI2 A;  4HIM A;  2EOT A;  4TRD A;  4GKJ L;  3TBI B;  3K59 A;  2Z6K A;  5BN3 A;  4KHZ A;  4FP5 D;  5FJ8 H;  1TY0 A;  1TKW B;  2MUY A;  2EJG C;  4R4I A;  1KLG D;  1A2T A;  2B3G A;  3M4P A;  3RNU A;  3HKZ G;  2VQE Q;  3HKZ E;  4RHR A;  2F0N A;  4J8Q A;  1B9M A;  2F3V A;  1DOL A;  4OIK A;  3I8Z A;  3GTO H;  3OW7 A;  1Z9F A;  3NQT A;  2ZJQ A;  4L63 B;  5CV6 A;  3KOJ A;  3I4N H;  2D5D A;  1JJC B;  1C8C A;  1NBW A;  3T16 A;  2AQ3 B;  2ES2 A;  1VCI A;  1JOO A;  5F2D A;  4U68 A;  1PRT D;  3BDC A;  1AE3 A;  4X65 Q;  4CDF C;  1HNZ Q;  3VYR A;  4PG3 A;  5JJZ A;  1MHW C;  5C4H A;  2KOL A;  5IIF A;  2RHQ B;  1JE4 A;  2K4K A;  5C3E B;  1O80 A;  1PTO C;  2NTS A;  1CFM A;  3AYH B;  1I4Q A;  1D2B A;  2XWJ B;  2CW0 D;  1FJG L;  3GTK B;  2AWO A;  1HUM A;  5FKA C;  1LAC A;  1NCV A;  3K80 C;  4IPH A;  1H95 A;  5IYD H;  1EZ8 A;  1XX8 A;  1K0R A;  1Y1W B;  2VUM H;  3CCL A;  3HOX H;  3G7L A;  4JK1 C;  1PV4 A;  2VW9 A;  4DNR B;  2MO0 A;  1CA6 A;  2BH8 A;  2RCN A;  1B50 A;  1LO5 D;  5ELE A;  4O1N A;  4A3J B;  4ILW A;  4K14 A;  1CQF A;  5C44 B;  3U9S A;  1GUO A;  3HOU G;  2RSN A;  4CJ0 B;  2AHO B;  1I94 L;  4O42 A;  4DR2 Q;  4LF4 L;  2XSC A;  4JVZ A;  1L1O B;  5FO9 B;  4GS3 A;  3A55 A;  3PO2 G;  2XNA C;  1ICW A;  1PH8 A;  4JPB W;  3UDI A;  3AMU A;  4BY7 G;  1HUN A;  1QVG A;  2PZU A;  4LF8 L;  4LFC L;  4BA2 I;  1JB3 A;  1C0A A;  3X3N A;  2E5L L;  4C2M H;  5M5X B;  4AH6 A;  4Y52 H;  1S5E D;  3GTM B;  2EY6 A;  3I91 A;  2ID0 A;  4KK7 A;  1DJR D;  4GLX A;  3SEB A;  4DV2 L;  3NUC A;  3VA7 A;  1SNP A;  4BY7 H;  2Z9H A;  1IBM Q;  1VQH A;  1UE6 A;  1EWC A;  3K7U C;  2DY7 A;  3S14 B;  5M9O A;  1X32 A;  1K8M A;  1VQ6 A;  3GQB A;  1RDP D;  1A15 A;  4A3E G;  1NMG A;  4FXD A;  2KCN A;  2EY1 A;  1EY7 A;  2VY3 A;  3S1Q B;  4C3I B;  4OX9 Q;  4KKS A;  4A75 A;  1KQS A;  5EKL A;  1GKH A;  3ERS X;  4YWK A;  1F9P A;  1U4R A;  4CDD C;  1PRT C;  4GNX C;  1PH2 A;  5G3L D;  1I50 B;  2JA5 H;  1A63 A;  1A3T A;  4LUZ A;  4MZ9 A;  5JPN C;  4KJO A;  1IL2 A;  2ZXP A;  1YNJ D;  1FNW A;  4QB4 A;  3PQI A;  1AFP A;  1D1I A;  2CW0 C;  5JVH 3;  1H9J A;  3L2P A;  2NVX H;  2ZTC A;  5FLX E;  3J80 E;  2JA8 B;  4LF6 Q;  1KAA A;  3CHB D;  2UUB L;  1SE3 A;  4KI0 A;  1I3Q B;  1HZ9 A;  1L2F A;  2V1C C;  2WB1 G;  4FF1 A;  3CC4 A;  1BBW A;  2E2H B;  4LAA A;  1EEF D;  4A3K H;  1EYG A;  3U50 C;  2AWN A;  1X9N A;  2JA7 G;  3PUY A;  4JI3 L;  3VR5 A;  3C2P A;  1OXX K;  1JB7 A;  2VQE L;  2MFI A;  4GNX A;  3P7J A;  3EFX D;  4DV1 Q;  1QZG A;  1GOZ A;  3NBH A;  1U4P A;  1H9S B;  5ELN A;  4KMU C;  4BY1 G;  3FP9 A;  2KEC A;  1VQF A;  4QGU A;  1EQT A;  3CQZ B;  1STN A;  5ELC A;  1E2Z A;  2Q8I B;  4S3S A;  4DR7 Q;  3G48 A;  3JAM E;  1IKL A;  3FDT A;  3SGI A;  1O7I A;  5HY6 A;  4CDE C;  4FF2 A;  2EY2 A;  4X65 L;  2J7Z A;  1Z47 A;  1HNZ L;  1WJJ A;  1JT8 A;  2R92 G;  5CV5 A;  3ICE A;  1DON A;  2LFN A;  4YIJ A;  4P75 A;  4IUT A; 
#chains in the Genus database with same CATH homology
 4JCV E;  4X64 Q;  1TXY A;  2E2H H;  2HQL A;  3BZC A;  4R4O A;  2B63 H;  1Y1W G;  4GN5 A;  3D0F A;  1K73 C;  2UUA Q;  2NN6 G;  4OWT B;  4P71 A;  4POG A;  4B3R Q;  1G29 1;  3FHW A;  1TWF H;  4DR1 Q;  2I0Q A;  4JI7 L;  3DM3 A;  1A62 A;  1YHA A;  3M85 A;  1BKB A;  3J81 c;  1C7Y A;  3CME A;  5C4J H;  4DR7 L;  1YZ6 A;  1OXS C;  4A3J G;  5JEA J;  4GLA C;  1TWC H;  2UUC Q;  1YHB A;  2CQO A;  5C44 G;  3PIO A;  3KJP A;  4LF9 L;  3I7F A;  4WJ3 M;  1VQ7 A;  1KHI A;  4DR5 L;  3ULP A;  4LF7 L;  3TS2 A;  3A5Z B;  5AJ3 Q;  2ZJR A;  3CCQ A;  1VQ5 A;  2D62 A;  5C4X H;  1SMX A;  2ATW A;  2VS1 A;  4A3C H;  1HZA A;  3CQZ H;  4A3B G;  2VNU D;  2WFW A;  4AYB G;  1PYB A;  1V43 A;  5HGQ A;  4JI4 Q;  2QA4 A;  4AYB E;  3AFQ A;  1PA6 A;  1OTC A;  4DV6 L;  2JA5 G;  4DR4 L;  1LYL A;  2PNH A;  4IOA A;  1K3R A;  5DLQ E;  4LW1 A;  4X64 L;  4BBS G;  2GVB A;  3PGZ A;  1BBU A;  2NZO A;  1KRS A;  3U4Z A;  5C44 H;  3KJO A;  5BR8 L;  4R4C A;  4DK6 C;  1B8A A;  4QQB X;  2KBN A;  3M3Y H;  1DGS A;  4B3R L;  1U5K A;  2K5N A;  2QGQ A;  3D31 A;  1JJ2 A;  2OQK A;  4DV7 Q;  3STB D;  1HJP A;  4JG2 A;  5JEA G;  5JJK A;  4JBW A;  3J7Z C;  3T1H Q;  3CW2 C;  4DV0 Q;  3CC7 A;  1NY4 A;  1VQC A;  3S24 A;  5EAY A;  5IP9 G;  1EUJ A;  4TVA B;  1FGU A;  1WOC A;  3U58 A;  5M3M H;  2UUC L;  4WJ4 A;  1UEB A;  1IBK L;  1N33 Q;  3HOW H;  2JA9 A;  5C0X I;  2JEA I;  4BBS H;  1XPO A;  5AJ3 L;  4A3K G;  4KHP Q;  3TRE A;  1NJI C;  2LSS A;  1YJW A;  3J81 j;  3GTM H;  4BXX H;  4YWM A;  2H5X A;  5C4X G;  1KAW A;  1PH3 A;  2DGY A;  4QY7 A;  4O2D A;  4JI5 L;  1OXT A;  3CCR A;  1ASY A;  2YTV A;  2MNA A;  4L5S A;  4PZ8 A;  1K8G A;  3CF5 A;  2PI2 E;  1P8L A;  2Z0S A;  1HH2 P;  1NE3 A;  4J15 A;  4YCW A;  4HIK A;  2LXJ A;  1A0I A;  4OX9 L;  4YY3 L;  4C3J H;  2D0P A;  2WP8 J;  1VQP A;  4A3I H;  4R1J A;  1FJG Q;  1Q46 A;  4BBR H;  5LMN Q;  1L0W A;  1EQR A;  2UXD Q;  2D0O A;  4HJA A;  2OWO A;  1N36 Q;  2ALY B;  2N78 A;  1NMF A;  3S1N H;  1BVS A;  4DV0 L;  1A63 A;  4LFA L;  2NVY H;  3EN2 A;  1VQ9 A;  1VQG A;  4JI2 L;  4A3L H;  3S1Q H;  3H0G G;  3S16 H;  4A3G H;  2PI2 A;  3BJU A;  2B29 A;  3G71 A;  4LF5 L;  4DV4 L;  1V9P A;  5FLM G;  5GAE C;  3TRZ A;  1K8A C;  4LFB Q;  1WCM H;  2L15 A;  1PHJ A;  2JA8 G;  1PH6 A;  3UE1 A;  4IFD J;  1I6H H;  2OCE A;  1XMO Q;  3GTQ H;  1G51 A;  4B3S Q;  1HZC A;  4JI1 L;  2K52 A;  3RN5 A;  3L0O A;  5LMN W;  1M1K C;  1YVC A;  3S1M H;  1I50 H;  1I5F A;  3W1G A;  4ME3 A;  1Y1V H;  3GD7 A;  1Q1B A;  2I5M X;  4LWC A;  3IRB A;  4YHH Q;  1VS0 A;  2UU9 Q;  4KLK A;  1RIP A;  3M9B A;  3HFZ B;  4OWW B;  5LMU L;  3K81 C;  3AFP A;  1C9O A;  4DR3 L;  3M7N A;  5C0X G;  2UXB Q;  3TEH B;  1VQA A;  2JEB I;  4APV A;  2R6G A;  1IYJ B;  3HOV H;  2BA0 A;  2E2J H;  1VQK A;  3ULL A;  3H15 A;  1Y14 B;  3TQY A;  1JE5 A;  4GLV B;  4UY8 C;  1S3O A;  5FLX c;  3J80 c;  4DR6 Q;  2PQA A;  4MTN A;  3GTJ H;  4LF8 Q;  4X6A H;  5IWA L;  2UXC L;  3UDG A;  4P72 A;  3G4S A;  1N32 L;  2Y0S E;  2E5L Q;  2K75 A;  3GDE A;  4JOI C;  1PH1 A;  1W3S A;  3PUW A;  1VQD A;  1E7Z A;  2RF4 A;  1K83 H;  1TWH H;  3OTO L;  1SFO H;  3ZJY C;  4AIM A;  4DV1 L;  5JJI A;  4EX5 A;  4IFD G;  2HIX A;  4JI0 Q;  2KCT A;  3GO5 A;  5IYB H;  1B70 B;  4PZ6 A;  4A3C G;  3S15 H;  2A8V A;  3KDF B;  4AQY Q;  4LUV A;  3PO3 H;  4DUY Q;  1OXU A;  3CMA A;  1VQJ A;  1XMO L;  3GTG H;  4YWL A;  3CXC A;  4B3S L;  1X56 A;  2I5H A;  5IE8 A;  4GKK L;  2NZH A;  1CKM A;  1UE1 A;  2LXK A;  1VQO A;  2KHJ A;  4UP7 A;  3STB C;  1SR3 A;  1XMQ Q;  2UU9 L;  1GD7 A;  2KHI A;  3CPW A;  3OW2 A;  1IBL Q;  1CSQ A;  4B3T Q;  1E24 A;  2N3S A;  4JI6 Q;  2UXB L;  1X55 A;  3ER0 A;  5GRO A;  1J6Q A;  3K8A A;  4QIW E;  5M3F G;  2HHH Q;  3KYH C;  2F4V Q;  1HNX L;  1X3G A;  3KF8 B;  3KF6 B;  5GAD C;  3GTP H;  3CP0 A;  3MXN B;  1HR0 Q;  4POF A;  3I56 A;  4LUO A;  1HNW Q;  2Z6K C;  1YJN A;  1TWG H;  2EXD A;  4GKJ Q;  4JYA Q;  4X62 Q;  3PUV A;  4DK3 C;  5M3M G;  3HOZ H;  4OWX B;  2ZTD A;  3F2D A;  2KCM A;  4PMW A;  3JAM c;  2CCZ A;  3HOU H;  2E8G A;  4DNI A;  2K5V A;  3CCE A;  2N49 A;  3B6Y A;  1XPU A;  3HOW G;  3I4M H;  4JOI A;  4DV3 Q;  1VQB A;  4L5T A;  1J5E Q;  4JI0 L;  3S2D H;  1IXR A;  2R7F A;  2UUA L;  3PO2 H;  3HOY H;  4BXX G;  3K0X A;  5M3F H;  1W2B A;  4DR1 L;  4DUY L;  4A3F H;  3H3V H;  1MJE A;  2JK8 A;  1R9T H;  2VL6 A;  4JI8 Q;  1M90 C;  4XTC S;  1Q12 A;  2CFM A;  2CKZ B;  2YTY A;  4MNO A;  3RLO A;  5M5W H;  1P16 A;  2ZM6 Q;  1Q7Y C;  1HR0 W;  4GN4 B;  3W1B A;  1VQM A;  4YCV A;  3HKS A;  1PH5 A;  1YHQ A;  5E7N A;  1XMQ L;  1MKH A;  2UUB Q;  3BU2 A;  1XNR Q;  1B7Y B;  4RMF A;  4A3D H;  4TQU S;  2IY5 B;  3CCJ A;  1QZH A;  3PIP A;  4LNQ A;  4A3I G;  2HHH L;  1CKN B;  3UE0 A;  4BBR G;  3CCV A;  2AMC B;  3S17 H;  4HJ5 A;  4GNX B;  3A5U A;  1YEZ A;  4HJ8 A;  1HR0 L;  2JA6 H;  1HNW L;  1Q8K A;  4Y7N H;  2ASB A;  5IY0 A;  2VQF Q;  1YI2 A;  4HIM A;  4JI4 L;  4GKJ L;  3S1R H;  4JYA L;  4X62 L;  2Z6K A;  2EIF A;  4A3L G;  4KHZ A;  5FJ8 H;  1S72 A;  3U4V A;  1MIU A;  4A3G G;  4XIG S;  3A0J A;  4NXM Q;  3M4Q A;  5J3B A;  1EIF A;  4DV3 L;  1X65 A;  1WCM G;  4R4I A;  2B3G A;  3M4P A;  3RNU A;  4A3E H;  3HKZ G;  1J5E L;  3EIV A;  4IFD I;  2VQE Q;  4JBK A;  3T1Y Q;  3RN2 A;  4IO9 A;  1GM5 A;  1CKO A;  3HKZ E;  2IHF A;  2GVA A;  4A93 H;  4DV7 L;  4K0K Q;  2BA1 A;  3NEL A;  1Y1V G;  3T1H L;  5M5Y H;  2C35 B;  3GTO H;  1Z9F A;  1UWV A;  1N34 Q;  5IYC G;  2ZJQ A;  1E3P A;  4OON A;  1X3F A;  3E9H A;  3CCU A;  1YNX A;  1N33 L;  3KOJ A;  2A1A A;  1SE8 A;  3I4N H;  1JJC B;  2RHS B;  3HOV G;  4FDB A;  1MJC A;  4UPA A;  4KHP L;  2Q2H A;  3GTL H;  1U0L A;  1NBW A;  2WB1 E;  4DV5 Q;  2NVQ H;  2R93 H;  2ES2 A;  1VCI A;  4EQ5 A;  4UP9 A;  1KD1 C;  4X65 Q;  1AE3 A;  1HNZ Q;  1SRU A;  3DLL A;  3RLF A;  4NB3 A;  4PG3 A;  1I94 Q;  3CD6 A;  3PCO B;  2IX1 A;  4LF4 Q;  2FXQ A;  4A3M H;  4NXM L;  3F2C A;  5IYC H;  1E1O A;  2RHQ B;  5IYB G;  4IOC A;  2K4K A;  1CKN A;  1XPR A;  3J81 i;  3AYH B;  3F8T A;  3PO3 G;  3T1Y L;  1FJG L;  4IPC A;  2AWO A;  5LMN L;  3F2B A;  3WWV A;  2EQS A;  5IP7 H;  2UXD L;  2Y0S G;  3K80 C;  4IPH A;  1N36 L;  1T9H A;  4LFC Q;  5IYD H;  1H95 A;  1AH9 A;  1K0R A;  3KFU A;  1E1T A;  1UE5 A;  4P73 A;  2VUM H;  2Q2I A;  1CSP A;  3CCL A;  4JBM A;  1PYS B;  4DKA C;  3HOX H;  2JA7 H;  1JJG A;  2F3I A;  1PV4 A;  4LFB L;  2VW9 A;  4DV2 Q;  4LF9 Q;  2Q2T A;  1K9M C;  2MO0 A;  3BZK A;  5IT9 c;  4GOP B;  1XNQ Q;  2AKW B;  2BH8 A;  2RCN A;  1YJ9 A;  5K36 G;  4DV5 L;  3RR5 A;  2OTL A;  4LF7 Q;  2CWP A;  3HOZ G;  3EBE A;  2VZA A;  3A74 A;  3AEV A;  3HOU G;  3I4M G;  2AHO B;  3K7A H;  1I94 L;  4DR2 Q;  4GN3 B;  2JQO A;  4BY1 H;  1L1O B;  4RG1 A;  4YHH L;  2ZJP A;  4LF4 L;  4GS3 A;  4GOP C;  2I5L X;  4DV6 Q;  4DR4 Q;  2OQ0 A;  3PO2 G;  1YBY A;  2MQH A;  1VQ8 A;  1PH8 A;  3HOY G;  2F52 A;  1LTL A;  4QJF A;  2XGT A;  5GQO A;  3UDI A;  4A3F G;  4BY7 G;  2IHE A;  3AQQ A;  1QVG A;  2YTX A;  5BR8 Q;  3I55 A;  4DR6 L;  2JJQ A;  1L1O C;  2YYZ A;  4R4Q A;  2A19 A;  4LFC L;  4LF8 L;  4BA2 I;  1SRO A;  1G6P A;  1C0A A;  1E22 A;  2WAQ G;  4A76 A;  1XJV A;  4DAM A;  1QUQ B;  2IX0 A;  2E5L L;  3W5O A;  3PUX A;  4C2M H;  3PV0 A;  4AH6 A;  2WAQ E;  4Y52 H;  4A3D G;  4JBJ A;  2R92 H;  5C3E H;  2ID0 A;  3RZO H;  1EWI A;  3FKI G;  4GLX A;  1D7Q A;  3L7Z C;  3NEN A;  3GTK H;  3JC6 6;  1KRT A;  1A8V A;  4DV2 L;  2K50 A;  4IJL A;  1IBK Q;  1XNQ L;  2JA6 G;  1YIJ A;  1VQL A;  3M4O H;  1EOV A;  4AQY L;  4BY7 H;  1IBM Q;  2PMZ E;  3Q8D A;  1VQH A;  2R7Z G;  1Y1W H;  1UE6 A;  5FJ8 G;  3K7U C;  1TWA H;  2QEX A;  4DR2 L;  4YCU A;  3CAM A;  1VQN A;  1VQ6 A;  1GO3 E;  4B3M Q;  4JI5 Q;  3UDF A;  4A3E G;  1NMG A;  1IBL L;  1KXL A;  1Q1E A;  1EQQ A;  4B3T L;  4JI6 L;  4GOP A;  3KDF A;  4R4T A;  2F4V L;  4A93 G;  3FKI H;  4A3J H;  2VY3 A;  4OX9 Q;  1LM0 A;  4YY3 Q;  4HIO A;  4A75 A;  1KQS A;  1CUK A;  1EIY B;  3NBH B;  4HID A;  1GKH A;  3TS0 A;  3ERS X;  4NXN Q;  4X66 Q;  4YWK A;  1L1O A;  2R7Z H;  4A3B H;  4LFA Q;  1VQI A;  3I4N G;  3VDY A;  4JI3 Q;  4GNX C;  1PH2 A;  1GVP A;  4JI2 Q;  1WYD A;  3S2H H;  1Q86 C;  1N8R C;  1X54 A;  1JMC A;  2JA5 H;  3RLN A;  2OTJ A;  4H02 A;  1PVO A;  4JC0 A;  3KF6 A;  4LUZ A;  2R93 G;  4LF5 Q;  4MZ9 A;  4DV4 Q;  4HJ7 A;  1V1Q A;  2BH2 A;  1LUZ A;  1IBM L;  1IL2 A;  3PUZ A;  4L5R C;  4IPG A;  2Q2U A;  2K14 A;  1QUQ A;  4JI8 L;  5M5X H;  1PH4 A;  2MO1 A;  2HT1 A;  4A3M G;  2ZM6 L;  3PF5 A;  3L2P A;  1QVC A;  4C3H H;  2NVX H;  2ZTC A;  1KC8 C;  1KL9 A;  2PQA B;  4O0A A;  4JI1 Q;  4LF6 Q;  4B3M L;  4UP8 A;  2UUB L;  4DUZ Q;  1XNR L;  3J80 i;  4KI0 A;  3CCM A;  2NVT H;  4OO1 I;  2YV5 A;  1PH9 A;  1HZ9 A;  1L2F A;  1WFQ A;  2V1C C;  5IP9 H;  2WB1 G;  1VQE A;  5LMU Q;  3CC4 A;  4DR3 Q;  1BBW A;  5IP7 G;  3H3V I;  2DUD A;  2CWA A;  4HJ9 A;  5GAG C;  5IYD G;  2NN6 I;  2K5H A;  3S14 H;  2VQF L;  3OYY A;  1S40 A;  5C0X J;  1KIX A;  5H1S E;  3I2Z A;  4NXN L;  3U50 C;  4IJH A;  4X66 L;  4A3K H;  3CPF A;  3RZD H;  3ULJ A;  2VUM G;  2AWN A;  1X9N A;  5IWA Q;  3E0E A;  3MEF A;  1SLJ A;  2KEN A;  1Q82 C;  1WI5 A;  3J7A 5;  1N32 Q;  2UXC Q;  2JA7 G;  3HOX G;  3PUY A;  2N8N A;  4JI3 L;  4JV5 Q;  1OXX K;  3NEM A;  1UE7 A;  4C3I H;  1PFS A;  3OTO Q;  4QL5 A;  2VQE L;  1JB7 A;  2MFI A;  4GNX A;  4DV1 Q;  1QZG A;  2ZTE A;  2XTI A;  3PSI A;  1SN8 A;  1D8L A;  4P74 A;  4DAY B;  3F1Z A;  3CC2 A;  2GN5 A;  1EFW A;  4K0K L;  1EYG A;  1PH7 A;  3I4O A;  4NPS A;  1N9W A;  2E2I H;  5ELN A;  4BY1 G;  1HZB A;  3FP9 A;  4JI7 Q;  1VQF A;  4QGU A;  1N34 L;  1FVI A;  4LF6 L;  4GKK Q;  4DUZ L;  1QVF A;  4DR7 Q;  3G48 A;  3PF4 A;  3UDX A;  1AE2 A;  4BA1 I;  4IPD A;  2YU9 H;  1X6O A;  2B63 G;  5JJL A;  1NTG A;  3SGI A;  1O7I A;  3H0G H;  3JAM i;  1FL0 A;  2IT1 A;  4A4I A;  5HY6 A;  1OXV A;  4ALP A;  4DR5 Q;  3E9I A;  5FLM H;  1HNX Q;  1IZ6 A;  2JE6 I;  3G6E A;  4DPG A;  3LGJ A;  4L5Q A;  4X65 L;  1XTD A;  1Z47 A;  1HNZ L;  1ASZ A;  2JA8 H;  1RL2 A;  1WJJ A;  4OXP A;  1JT8 A;  2R92 G;  5C3E G;  1VQ4 A;  1I3Q H;  2R7D A;  1X3E A;  3ICE A;  3CCS A;  5ELO A;  1YIT A;  1Q81 C;  4JV5 L;  5GAH C;  4PZ7 A;  4P75 A;  4OO1 G;  3KLW A;  2HIV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...