2UU9L

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uu9L00
1TWGH 2YTVA 2PNHA 1A8VA 4XTCS 3JC66 4A93G 3K80C 3E0EA 3M3YH 4OX9L 2E5LQ 3HKZE 4YHHL 3M4OH 1K83H 4JYAQ 4LNQA 4O2DA 2VUMH 3RLOA 1UE6A 1CSQA 2ZTCA 1NY4A 2ATWA 2R7ZG 3NENA 2GVBA 1K8AC 4JCVE 2VQEL 3CP0A 1KD1C 1WCMH 4RMFA 2KCMA 3PGZA 1VQ6A 3KOJA 1LUZA 4BY1G 2QEXA 3RZOH 4UY8C 1DGSA 3M7NA 4R4IA 1EYGA 4APVA 1YJNA 4LF9Q 5ELOA 2VUMG 1WOCA 3I7FA 5IP7H 4GKJQ 3T1YQ 2UUAL 1GVPA 5IWAL 2F4VQ 3GTGH 1XMOQ 3GDEA 4JI3L 4OO1I 5FJ8H 3NELA 1YHQA 1WCMG 5IP9H 4GN5A 1GM5A 1JJ2A 3GTOH 5M3FH 4GLVB 4GKKQ 5C4XH 4LFBQ 3JAMi 1VQ7A 4LF4L 3S14H 4NXNQ 5JEAJ 2JA7H 2MNAA 2Q2HA 3DLLA 2OTLA 1G291 1HR0Q 4QGUA 1FGUA 1YHBA 1N33Q 4LUZA 5IP7G 4B3MQ 4MNOA 1IYJB 5LMNQ 2JQOA 2QGQA 3JAMc 1VQBA 2JE6I 4DK3C 3CCEA 1C9OA 5AJ3L 4DAMA 2JJQA 3UDFA 4IFDJ 5FJ8G 1RL2A 5IP9G 4X6AH 1EQQA 1IXRA 3K7UC 4X64Q 3TREA 5M3FG 4LF8L 3GTQH 1L0WA 5C4XG 3CCSA 1VQIA 2XGTA 3FKIH 3KLWA 4BA1I 2KBNA 3AYHB 4IOCA 2B63H 2JA7G 2L15A 1WYDA 4QIWE 1X3EA 1E22A 1E3PA 1K73C 4QL5A 2BA0A 2CKZB 4L5TA 1MKHA 1B7YB 4OX9Q 2JA6H 2E2JH 3L2PA 4A75A 2VS1A 4YHHQ 4JI0Q 4NXMQ 2PQAB 3U58A 2YYZA 1Y1VH 4DR4L 1YIJA 3GTLH 2B63G 2VQEQ 1X3FA 3CAMA 1X6OA 1NE3A 2WFWA 4C3HH 1HZCA 1T9HA 3W5OA 1TWAH 2AMCB 4DR1L 3OTOL 4DR7L 3KDFA 4LWCA 2EXDA 5K36G 5H1SE 2JA6G 2Y0SG 5M3MH 2F52A 2JA8H 3S15H 2NN6G 4YY3L 4FDBA 5M5XH 4DV2L 4B3RL 4JG2A 3UE1A 3PF5A 3PF4A 2UUAQ 5IWAQ 1N34L 5DLQE 1FVIA 3BZCA 2RHSB 4YCVA 2E2HH 3KYHC 2AHOB 1HNXL 4JI3Q 1FJGL 2I0QA 4R4TA 1X9NA 3A5UA 2B3GA 1PYBA 4OXPA 2YTXA 4DR5Q 1E1TA 4LF4Q 3HOUH 4DR3L 4L5QA 1VQOA 1K3RA 3A0JA 3CQZH 5E7NA 5IY0A 5M3MG 4GNXB 2JA8G 3ICEA 4BY7G 4KHPQ 4DAYB 2K14A 4JBKA 1V1QA 1VQLA 4JI4Q 1VQ5A 2A1AA 5GAGC 3GO5A 2JEAI 4GOPA 1SN8A 5AJ3Q 1VQHA 4KHZA 3G71A 1LM0A 1SMXA 1ASYA 3CC4A 1C0AA 1BBUA 1GO3E 2A19A 3K81C 3CCMA 4AQYQ 1UEBA 4LF8Q 1NTGA 5C4JH 5LMUQ 3S17H 4NB3A 1KHIA 1UE7A 3M9BA 1IBML 3HOUG 4A3BH 2OCEA 1N8RC 3TS2A 4C3IH 2VNUD 3K0XA 2ES2A 3STBD 5IYCH 4HIKA 4ALPA 1VQDA 1XMQQ 1SLJA 3CW2C 2EIFA 4DV0Q 1HNZQ 2RHQB 4BY7H 1I50H 1HR0W 4A93H 1HZ9A 1JJGA 2YTYA 4DV4Q 1Q82C 2Q2UA 4A3IH 4K0KQ 4A3LH 3E9HA 3VDYA 5LMNW 1BKBA 1XPRA 3PUWA 4UPAA 2N78A 4JI1L 3EN2A 1W2BA 3BZKA 2WB1E 2ZTDA 1VQFA 4A3BG 4DR4Q 3OW2A 4IOAA 3KF6B 4P75A 1L1OB 2I5HA 4EQ5A 5IYCG 4DUZL 4B3TQ 3CMEA 4HJ9A 2A8VA 3K8AA 2HQLA 2HHHQ 1VQNA 1Q1EA 4R4CA 3J81c 3OTOQ 4DR1Q 4BY1H 4JI6L 3U4VA 3DM3A 5J3BA 4L5SA 1XNRL 4DR7Q 3AFPA 4A3IG 4A3LG 3LGJA 4JOIA 4DK6C 1S40A 4LF5L 5GAEC 4DV1L 1UE5A 2JK8A 3L0OA 3I4NH 1A63A 2Z6KC 1P16A 2YV5A 3BJUA 1N34Q 5IT9c 2CCZA 3HFZB 1FJGQ 1LYLA 3MEFA 4A3KH 1HNXQ 1X55A 4JI8L 1R9TH 4YCUA 3PCOB 2H5XA 2PI2E 2AWNA 3J80i 1KRTA 1OTCA 4GS3A 2NVXH 4A3DH 1Z47A 3SGIA 4DR3Q 2PMZE 4C2MH 4DUYL 3HOZH 1XNQQ 1CKNB 1PH8A 4DR6L 2WP8J 1A62A 3UDIA 2DUDA 2KHJA 1X54A 2MQHA 4P73A 3I4NG 4X65Q 4GN4B 3J80c 1KL9A 1VQCA 4PZ8A 1JB7A 1PFSA 1EFWA 3CC2A 4L5RC 1B70B 1TWHH 4NPSA 4A3KG 1XPOA 4TVAB 1YITA 2R6GA 4A3CH 2BA1A 3CCQA 1EOVA 4IPGA 4X66L 2GN5A 1I3QH 5BR8Q 3I56A 4A3DG 1K8GA 1IBMQ 2MO0A 5C0XG 4KLKA 3HKZG 3HOVH 4ME3A 5IE8A 3T1HL 3PSIA 3HOZG 3GTMH 1HZAA 1D8LA 2VL6A 4UP7A 4HJ7A 1XTDA 1A0IA 2GVAA 4HIDA 3KJOA 2D0PA 3TS0A 3CCLA 2UXCQ 1KXLA 2IT1A 1PH9A 1NBWA 2FXQA 4HIOA 1QZGA 2UUCL 1WFQA 2D0OA 3EIVA 1EUJA 4A3CG 4IPDA 5GROA 2UXBL 1E1OA 4IPCA 4YCWA 3RZDH 2R93H 1L1OC 3I2ZA 4IJLA 1YNXA 4WJ3M 5JJLA 1HJPA 4A4IA 5M5YH 1N32L 1LTLA 3M4PA 4RG1A 4QY7A 1UWVA 1HH2P 4DV6L 4JI6Q 3FP9A 1XNRQ 3A74A 1VQKA 4AYBG 2AWOA 4C3JH 4LF5Q 1K9MC 3J7ZC 1AE3A 2RF4A 2Z0SA 2NVQH 4A76A 2NVYH 1YJWA 2R93G 3UE0A 2UXDL 1PH5A 3GTJH 4JI8Q 3W1BA 1YI2A 2ASBA 3F1ZA 4JV5L 4HJ8A 3PIPA 4BBSH 1CKMA 4A3MG 1JMCA 4POFA 3K7AH 2K5HA 3ULLA 3CXCA 3RR5A 5C0XI 4GLXA 3HOXH 3F2DA 1IBLL 2JA9A 4AIMA 1PH1A 2R92H 5EAYA 3ULJA 1KQSA 2UU9L 1QUQA 2BH8A 2K4KA 3H15A 2NVTH 3AFQA 1J5EL 3HOWG 2HIXA 3F2BA 3M4QA 1CUKA 1PVOA 3D0FA 4BBSG 1Q86C 1YZ6A 4GN3B 1Z9FA 3CPFA 5FLMH 1V9PA 1VQAA 3HOXG 3T1HQ 4IO9A 2OTJA 3S24A 1MJCA 1Q7YC 4A3GH 2R92G 1SR3A 2R7DA 4HJ5A 3D31A 2IX1A 2E5LL 2N8NA 1EWIA 3E9IA 2KHIA 4B3SL 1Q46A 2I5LX 2UUCQ 4DNIA 1TXYA 5HGQA 2QA4A 2ZJRA 2KCTA 1VS0A 3RNUA 2MFIA 3GTPH 2WAQG 4POGA 5FLMG 4PZ7A 4JI7L 4LF6L 1VQMA 2E2IH 3STBC 1ASZA 1I6HH 1VCIA 1N32Q 3KDFB 2ID0A 4A3GG 1Q1BA 2E8GA 4MTNA 1MIUA 4EX5A 4LUVA 4OWTB 1XPUA 3ULPA 4DV3L 4DV7L 4GKJL 3T1YL 1UE1A 1HNWL 1PH6A 3AEVA 4UP9A 2ZM6L 3CCUA 4R1JA 1I94L 1GD7A 2UXDQ 1VQJA 1VQ4A 4OWXB 4PG3A 3NBHB 1OXSC 1PV4A 5M5WH 2ZJQA 1FL0A 1X65A 3HOYH 4GKKL 3ER0A 2CQOA 3PUZA 2ZTEA 4Y52H 3S2DH 4YWMA 3RLFA 1YVCA 5HY6A 5JEAG 1Y1WH 1IBKL 3OYYA 3J81j 1SRUA 1TWCH 1IBLQ 4BA2I 4YY3Q 1QVCA 3I55A 3I4MH 2N49A 4GOPB 3H3VH 2K50A 4JI5L 1SROA 4DV2Q 2UU9Q 2HT1A 4B3RQ 2AKWB 4Y7NH 4R4QA 5IYBH 1XJVA 3UDXA 4P72A 1K0RA 3HOYG 3S1NH 4IFDG 3PO2G 3W1GA 3PO3G 2R7FA 4GNXC 1YHAA 2K75A 3AQQA 1Y1WG 1N9WA 1YEZA 1OXVA 1M90C 4HIMA 4A3FH 3B6YA 3I4MG 1SE8A 4A3JG 2WB1G 4JBJA 1PHJA 2YU9H 3IRBA 4B3SQ 4LUOA 4JI0L 3Q8DA 1Q8KA 2NZOA 1E7ZA 5IYBG 4NXML 2CWAA 1PYSB 3ZJYC 4JBMA 1PH2A 1CKOA 2B29A 2Q2IA 4JI7Q 1O7IA 1QVGA 4LF6Q 4IJHA 3PUYA 3FHWA 1D7QA 4A3FG 2EQSA 4GLAC 1U5KA 3CD6A 3S1MH 3PUXA 1AE2A 1P8LA 2F3IA 4H02A 4IPHA 4LFAL 4DV5L 1EIYB 3TEHB 2UXCL 1TWFH 1B8AA 4DV3Q 4DV7Q 1JE5A 3TQYA 1HZBA 3F2CA 4JI1Q 1X56A 1PH3A 1HNWQ 1AH9A 2JA5H 2ZM6Q 4P74A 2PQAA 4R4OA 1I94Q 4AYBE 4J15A 4IFDI 1EQRA 1YBYA 4DUZQ 4DR5L 3M85A 4HJAA 3KFUA 1GKHA 1KC8C 3F8TA 4LFCL 3A5ZB 4A3MH 1QZHA 1X3GA 2LXJA 2UUBL 4WJ4A 4KHPL 2LXKA 1OXXK 4GOPC 1Y14B 1IBKQ 2IY5B 1G6PA 2CFMA 4JI4L 4UP8A 1V43A 4DV1Q 3WWVA 3H3VI 4DR2L 4JI5Q 2VZAA 2JA5G 1J6QA 1NMGA 2Y0SE 4BXXH 3PIOA 2IX0A 4AQYL 3HOWH 1PH4A 3S16H 2Z6KA 2IHEA 3BU2A 5LMUL 3G4SA 3G48A 1N36L 5GADC 2C35B 1JT8A 3KF8B 2VQFL 3RN2A 2MO1A 4JI2L 3U4ZA 1KIXA 4BBRH 1XMQL 2I5MX 3PV0A 4PMWA 4DUYQ 4DR6Q 2K5VA 4LW1A 4GNXA 1HNZL 4DV0L 5C3EH 3S2HH 3CCRA 2D62A 3EBEA 3HKSA 3RLNA 4DV4L 3S1RH 4K0KL 1QVFA 4P71A 4BXXG 1PA6A 1IL2A 5ELNA 4A3EH 4JBWA 2VW9A 3RN5A 4AH6A 3CCVA 1OXUA 4TQUS 1M1KC 1W3SA 2OQKA 4X66Q 1G51A 3FKIG 5C0XJ 1H95A 4LF7L 4X62L 4YWKA 3HOVG 3H0GH 4QQBX 4KI0A 4BBRG 4B3TL 3TRZA 2ZJPA 2HHHL 4JOIC 5C3EG 1WI5A 2RCNA 1KRSA 2WAQE 1VQPA 4O0AA 3CF5A 1IZ6A 3CMAA 4LFAQ 4JYAL 4DV5Q 1NJIC 5IYDH 3ERSX 4OONA 1CSPA 2IHFA 5GAHC 5C44H 2DGYA 2XTIA 4A3EG 1C7YA 1KAWA 4OWWB 2UXBQ 3L7ZC 1Y1VG 2LSSA 1JJCB 2ALYB 3H0GG 4QJFA 1BVSA 3J7A5 3KF6A 1WJJA 1U0LA 2HIVA 2NZHA 5GQOA 1L1OA 3KJPA 1YJ9A 1VQ9A 2K52A 4DKAC 3U50C 4LFCQ 3GTKH 2CWPA 4XIGS 4DV6Q 2Q2TA 2UUBQ 1XNQL 5IYDG 1RIPA 2K5NA 3PUVA 1I5FA 1L2FA 4LF9L 5C44G 4X65L 3CCJA 3CPWA 4DR2Q 1QUQB 3NEMA 2F4VL 1E24A 1XMOL 3MXNB 1Q81C 3I4OA 2V1CC 4JC0A 5JJIA 1Q12A 1MJEA 5BR8L 3G6EA 3PO2H 1N36Q 4PZ6A 4JV5Q 4LFBL 1SFOH 3PO3H 2VQFQ 4NXNL 1S72A 2OWOA 3S1QH 2BH2A 4JI2Q 1PH7A 2KENA 3UDGA 2OQ0A 1HR0L 2PI2A 5FLXc 1N33L 1CKNA 1VQEA 4B3ML 5LMNL 3GD7A 1BBWA 4A3JH 1NMFA 2VY3A 1VQGA 1VQ8A 4DPGA 1OXTA 4OO1G 2NN6I 1S3OA 3CC7A 1J5EQ 2N3SA 4YWLA 4X64L 5JJKA 2R7ZH 1EIFA 3J81i 4MZ9A 4LF7Q 4X62Q 2JEBI
chains in the Genus database with same CATH superfamily
4G7HC 3M7GA 1A8VA 3E0JA 4RFBA 4XTCS 3QOJA 3M3YH 1Z7TA 3RLOA 1CSQA 2ZTCA 1NY4A 3ND8A 1B3AA 2R7ZG 1LTBD 2HCIA 1G91A 1RTNA 2VQEL 1TWHB 2KCMA 4BY1G 1EFID 1ONLA 1XTCD 2L55A 1DGSA 3M7NA 4R8NA 5ELOA 2XNAC 1U9RA 4F8MA 3I8ZA 2E74C 5FJ8H 3NELA 3BYYB 2MGSA 1JJ2A 4TSSA 4NXNQ 1A3UA 4L8JA 2MNAA 3KLSX 1MSGA 3R2TA 1YHBA 4DK1A 5M5YB 2M9VA 1TU2B 1VQBA 4DK3C 1GHJA 1PTOH 2K5DA 4FF4A 1RL2A 4X64Q 4LF8L 5M3FG 2E75C 1SXTA 3CCSA 2XGTA 3FKIH 2JA7G 4BA1I 1PZKD 2NVYB 2EOTA 1E22A 1E3PA 4IALA 2A69C 1DYQA 4BBSB 4RGMA 2J4XA 2N55A 2E2JH 3FRPB 4K8IA 4K5WA 3VR4A 4EVOA 1DONA 3I91A 4DR4L 2K28A 1YIJA 3GV6A 2R92B 2VQEQ 1H9MA 3R2IA 1SNQA 3CAMA 2XSCA 1NE3A 4IUPA 1WD0A 4RCOA 1QOHA 4EQPA 3DWQA 2F52A 1DJRD 2NN6G 4YY3L 1NR2A 2E2DC 3UE1A 3V2TA 1FVIA 3BZCA 2RHSB 4A3GB 3KYHC 1HNXL 2QDBA 4RKBA 1H9RA 2JN4A 2YTXA 1IKLA 2JYOA 4CBVA 1VQOA 1K3RA 1FGBD 5M3MG 2JA8G 3ICEA 1EY6A 4DAYB 1VQLA 1VQ5A 2AUJD 5GAGC 2RBMA 4E6IA 5I2XA 2A19A 1U4PA 4LF8Q 1ZXTA 2AQ2B 2F0FA 2PO4A 4XQJA 1KHIA 1UE7A 3M9BA 2C5CA 1A2UA 1E2ZA 3HOUG 5I9PA 1BCPB 4RHRA 2QCPX 1YNND 1ET6A 1QJOA 2MP1A 4QUCA 4ALPA 1HNZQ 2ICIA 2RHQB 1SNDA 5M5WB 1HR0W 1HZ9A 3TZDA 5C4HA 1Q82C 4K0KQ 4KN4C 1EYAA 1LT3D 1BKBA 4PNYA 2N78A 4JI1L 2CVRA 4DR4Q 1ET9A 3OW2A 3NHHA 1F2YA 1L1OB 4EQ5A 5IYCG 4B3TQ 4FO2A 3K8AA 2HQLA 3G7LA 1VQNA 3BYTB 5IGDA 3J81c 4JI6L 3U4VA 1GUTA 1TVXA 4A3LG 4I65A 1BDOA 4DK6C 4LF5L 2OF1A 1HA5A 2JK8A 3L0OA 3SK6A 2Z6KC 3BJUA 2ZXOA 3GP7A 2NB0A 4DNTB 1HNXQ 1X55A 2TMPA 1CA6A 2H5XA 1KRTA 5E1FA 1PFNA 3HG9A 2IL8A 5C0XH 2PMZE 1TS3A 2F0PA 3SK5A 3HRZC 1CKNB 2RKSA 3ONAB 1SYCA 5E4WC 3J80c 1F2MA 4GN4B 1ENAA 1KL9A 3J80E 1EFWA 4HN7A 1WD1A 1AFPA 1B44D 1TWHH 4NPSA 4A3KG 4QF4A 2KOLA 2D9UA 3H94A 3H09A 1HPCA 1YITA 2BA1A 1TWFB 4NDXA 1BCPC 1K8GA 4ME3A 3HOZG 5CYUA 1HZAA 3NQTA 1D8LA 3TP8A 3Q0AA 4HJ7A 1G8ZD 1KDAA 1KXLA 3KJOA 1IW7C 1LV9A 2IT1A 2DN8A 3NWTA 2FXQA 1QZGA 2D0OA 3EIVA 4FYDA 1KDBA 1S5CD 1EUJA 1H9JA 4IPDA 2UXBL 4IPCA 4JPBW 1L1OC 4B08A 4IJLA 4RAUC 2F0LA 5M5YH 4QY7A 3HOWB 4U673 1RJTA 5EBCA 4JI6Q 3FP9A 4BWGB 1PLFA 4LF5Q 3VYSA 4BBRB 2Z0SA 2FJ2A 2NVYH 4QCLA 1EOTA 5C3EB 3K5NA 3PMFA 1JWUD 3S1RB 3F1ZA 5IIFA 4BBSH 4K2KA 1JMCA 4POFA 1U4RA 1Y8OB 1QILA 1PH1A 2R92H 3ULJA 4XQQA 1SMYC 3MXNA 1CUKA 3TDQA 3MFGA 4GN3B 5C44B 1FNVA 3CPFA 5E4XA 1K3BC 1MJCA 1Q7YC 2AQ3B 4A3GH 2IX1A 2IWHA 2E5LL 2I5LX 2B8GA 2SEBD 2KCTA 1VS0A 2V4DA 1GXDC 2MFIA 2WAQG 3RD4A 1LO5D 2VXWA 3Q24A 1VCIA 3KDFB 4XXEA 2ID0A 3NSWA 4ZUIA 1EQTA 2F0WA 4OWTB 3OIPA 1XPUA 1CZWA 3T1YL 1HNWL 1PH6A 4HMIA 3TP5A 1KTKA 1VQJA 1DOLA 4IUVA 1D6EC 1PRTD 3CKIB 5M5WH 1NSNS 4CKBA 2L0CA 1SYFA 1Z6HA 3RLFA 2R3ZA 4YIJA 1U4MA 1TWCH 2ZXRA 5FLXE 4ZLTF 1QVCA 4RGTA 4JI5L 1SROA 4J1MA 3LWUA 1IYUA 2KVMA 4CDDC 3K5OA 1SNOA 5IOCA 1PRTF 5I4DA 2VUMB 5ELCA 1L0YB 5FLXL 1I4GA 1LABA 3T56B 4HIMA 5FOBB 2WIIB 1O7LA 1WCMB 4A3JG 3IRBA 2ZT9C 4LUOA 4JI0L 3Q8DA 2Z4HA 1Q8KA 2NZOA 4IUNA 5IGCA 3Q22A 1O7IA 4XYOA 3QR8A 3GTGB 1K28A 3FHWA 1G6ZA 5CV6A 4A3FG 3K5MA 1STGA 1G2SA 2B2TC 3PUXA 1I6VC 1AE2A 3GTOB 4H02A 5C4XB 4H13C 2I07B 4DV5L 1SDFA 1TWFH 1PH3A 1HNWQ 2Z9HA 4FNFA 1Q90A 4B9XA 4DK0A 5C3XA 4J15A 4CDFC 1CFMA 4KD4A 1Q3LA 4EGVA 3F8TA 5DM73 3GTQB 2UUBL 1OXXK 4JI4L 1FNWA 4ULLA 2DNEA 2BCOA 4JI5Q 2JA5G 1NMGA 2Y0SE 4BXXH 3HOWH 1PH4A 1IKMA 4FP5D 1FYCA 3N52A 3G4SA 1N36L 4MHEA 2VQFL 3RN2A 4JI2L 1BR9A 4BBRH 1Y1VB 1YNJC 4GNXA 4DV0L 5C3EH 1D5XC 3NXWA 4Q0FA 4C3HB 3FPPA 3S1RH 3BDCA 1UEAB 1GJXA 1TWAB 3MHBA 1IL2A 4KHVA 2L5TA 1A15A 4JBWA 4X66Q 3FKIG 1H95A 5M5XB 4X62L 4QQBX 5CGKA 3CRKC 3TRZA 2HHHL 2E2HB 4JOIC 2LKVA 1WI5A 1VQPA 3CMAA 4DV5Q 2IHFA 5C44H 2DGYA 1GUNA 3MWYW 1KAWA 2F0QA 3L7ZC 5JPMC 3R8BA 2P5ZX 4QJFA 1QWYA 1WTHA 1RHPA 3KF6A 2HIVA 1R4QB 2XIWA 5GQOA 3KJPA 2K52A 5IGBA 4DV6Q 3QJYA 5FK9C 2UUBQ 1RIPA 1I5FA 3BS1A 4A3BB 2G9HD 1EWCA 3SK8A 1A2TA 2F4VL 1LT5D 4OO1H 4BY7B 1I50B 4A93B 2V1CC 4A3IB 1MJEA 5BR8L 1N36Q 3MVVA 1QNKA 4K14A 2VQFQ 1D5ZC 1JWMD 3OSOA 4JI2Q 4K5XA 4M8AA 4B3ML 5LMNL 1BBWA 1NMFA 1VQ8A 1VQGA 5DM63 1OXTA 2HUGA 3CC7A 1J5EQ 2ICEC 5JJKA 5CV9A 4MZ9A 2KEEA 1M8AA 3RMHA 4X62Q 3I4NB 1EY0A 2F4IA 2K6AA 3J7YW 4ID6A 3A8JE 1JOKA 2JSOA 4G4KA 1R9TB 3JC66 3K80C 2H4OA 5EKLA 2IW3A 4A3DB 4U68A 2VUMH 2B8FA 1EZ6A 1UE6A 3HKZB 4C2MB 2ATWA 1TS4A 1K8AC 4JCVE 3CP0A 1WCMH 4FXKC 1VQ6A 1TR5A 1J9OA 5ELBA 3H6MA 4R4IA 1YJNA 3I90A 3HOVB 5TSSA 3I7FA 5IT9L 1CA5A 4DA2A 2F4VQ 1GVPA 5IWAL 3GTGH 4ODGA 1STYA 1F2ZA 3GDEA 1DOMA 5IP9H 1EWHA 1GM5A 4ME5A 4AYBB 3GTOH 4GLVB 4GKKQ 1SE3A 5C4XH 3OPOA 4LF4L 4KY6A 5JEAJ 4XT3B 2OTLA 1G291 3BDLA 1FGUA 1QB5D 4B3MQ 5IP7G 1IYJB 4F88A 5LMNQ 4J8QA 4XT1B 3OW7A 4DAMA 2JP1A 2FINB 4CJ1B 3GTQH 3TREA 1L0WA 4FF3A 1BBXC 3AYHB 2L15A 1A3TA 4HMJA 1CM9A 3GTJB 4QL5A 1KAAA 2CKZB 4L5TA 1MKHA 4DU9A 2RDFA 4A75A 2VS1A 5KYLA 4NXMQ 1WVLA 5CORA 1AP0A 1XX8A 4V0BA 3DUZA 3U58A 1Y1VH 1JOQA 1ICFB 2B63G 3MEHA 1C48A 4C3HH 2NVTB 1T9HA 1PFMA 1TWAH 3W5OA 5K36G 1ML0D 3VA5A 4DR7L 5FKAC 2JA6G 2Y0SG 3MAQA 3ERQA 5M5XH 4DV2L 4B3RL 3PF5A 2HDLA 5IWAQ 1N34L 2E2HH 2AHOB 3AMUA 1X9NA 5EPJA 2B3GA 3SEBA 4DR5Q 4K8JA 1SE2A 2B2YC 5JPNC 4LF4Q 3A0JA 2D2CC 3FPUB 4KHPQ 5KNBA 4JBKA 3P20A 1I4RA 1HFNA 3IFTA 2A5HA 5FO9B 2FHTA 3GO5A 2KJXA 4GOPA 4QMGA 3A8IE 1VQHA 1C0AA 2EPBA 1GUWA 2EY5A 4AQYQ 1NTGA 4HTHA 3QWNA 4A3BH 3K0XA 3STBD 1XMQQ 4KKTA 4HIKA 4NP5A 3CW2C 2EIFA 5DEHA 4BY7H 1I50H 4A93H 1SEBD 4DV4Q 2B2WC 2Q2UA 4A3IH 1GHKA 1C4QA 3TBIB 3C46A 4FXDA 4XQNA 4UPAA 2PCFB 1W2BA 1Y1WB 3Q6SA 1S4ZA 3I4MB 1VQFA 1T5EA 4IOAA 4X3TA 2I5HA 5K5PA 3FMCA 3U9SA 2A8VA 4KJNA 1Q1EA 4DR7Q 3AFPA 1UE5A 3I4NH 2YV5A 2CCZA 1N34Q 3ND9A 3MEFA 1R9TH 2H1EA 1JC7A 1D1KA 1VF7A 2AWNA 3J80i 4A3DH 1Z47A 4R8IA 4C2MH 4UDUC 4DUYL 1XNQQ 4DR6L 1QG7A 5CMDA 3OOCA 4X65Q 3CC2A 1F9SA 4PZ8A 1PFSA 3UI2A 1JB7A 4L5RC 2O4XA 1SNPA 1B70B 3S1MB 1XPOA 4A3CH 3L9AX 1ICWA 3RUZA 2GN5A 4KY5A 3I56A 2MO0A 2F0OA 3HOVH 5NUCA 4KY7A 5CR3A 1A0IA 2GVAA 4HIDA 2D0PA 1PH9A 1NBWA 1SBBB 2UUCL 1WFQA 3H3VC 1E1OA 4OGQC 2XRSD 2OT2A 5JJLA 1RD9D 1Y8PB 1N32L 1IL8A 3P7JA 5L37A 5G3LD 3S16B 2FMMA 3A74A 5T1IA 4N8X1 2AWOA 3A55A 2C9OA 1TT2A 1ENCA 3H91A 2R93G 1YJWA 3S2HB 3GTJH 1YI2A 4JV5L 1EQVA 1IHZA 2EYOA 5G3LF 2R61A 1S5FD 1RTOA 3F2DA 2A68D 4C3JG 4AIMA 3H0GB 4OHJA 2PW5A 5EKIA 3A7LA 3G6JB 3KBXA 5CBEE 4OELB 1QUQA 2SOBA 3HOWG 3H15A 2NVTH 3AFQA 1PVOA 1MSHA 3M4QA 2BDOA 3DM1A 2L4NA 1Z9FA 4KTAA 3HOXG 4IO9A 2OTJA 4KK7A 1H9SA 3D31A 1EWIA 2UUCQ 1DOKA 4DNIA 3GTKB 4XDXA 2ZJRA 3RNUA 2EY6A 5FLMG 1VQMA 1JCKB 1N32Q 5IODA 2X69A 4MTNA 1MIUA 1CHQD 2GA4B 3PO2B 2PZUA 1EIHA 3PO3B 3S1QB 1MI2A 3K0YA 2K01A 4DV7L 4GKJL 1UE1A 4MIUA 4ZYSA 3AEVA 2EYJA 2ZM6L 1TWCB 5CV7A 1SYEA 3M4YA 3TP7A 1VQ4A 4PG3A 1PV4A 1OXSC 2ZJQA 4IFDH 1X65A 3ER0A 4EQNA 5JEAG 1Y1WH 1IBKL 2R7ZB 3J81j 1AW7A 4FF2A 4YY3Q 3I55A 3I4MH 2N49A 3H3VH 2K50A 1NUCA 1LLRD 5IYBH 1XJVA 3HOYG 4P72A 1KABA 3M4OB 1K83B 5KGUA 4IZ8A 1A3VA 1YHAA 3CU7A 3AQQA 5D65A 1AZQA 1M90C 4WJWA 5BN4A 1EY8A 4KN7C 3B6YA 1PMRA 5D3DA 4RA8A 4JBJA 1JB3A 1PHJA 2F0TA 1MHWC 2F0NA 3ZYYX 5C3WA 1PYSB 1STBA 2BOSA 3ZJYC 2RQXA 4N9PA 3R3OA 5C4ZA 4PQXA 3R93A 5KYIA 2B29A 1QVGA 2F03A 3FEWX 1B4OA 4IJHA 1D7QA 1FNUA 1NCVA 1W6JA 1U5KA 4GLAC 3S1MH 4FXGC 4CJ0B 2F3IA 4IPHA 5M3FB 2QEJC 1EIYB 1V1OA 3TEHB 2JA7B 4DV7Q 3TQYA 3L3OC 4JI1Q 1RKNA 2ZM6Q 2PQAA 4H7BA 5JVH3 4AYBE 4BS9A 1EIGA 3M85A 4HJAA 3KFUA 2K7VA 1X3GA 2LXKA 1BXTA 1PYWD 1IBKQ 2IY5B 1G6PA 1V43A 3OWEB 1TS2A 4DR2L 1DM0B 2WINB 2K33A 3S16H 4QUFA 5LMUL 3BU2A 1SSOA 5AFWA 5GADC 1E2WA 2CH4A 3U4ZA 3HGBA 4RGOS 4PMWA 3S2HH 5BN5A 3GTLB 3CCRA 4DXFA 2A69D 4H44C 1B3QA 3HKSA 2PQEA 2KQ3A 2B2VA 2K05A 3RN5A 5M3MB 3CCVA 2JA8B 4TQUS 1G51A 5C0XJ 3H0GH 4I7ZC 3A54A 4C1NI 3T4AC 4ZKBB 4IUTA 4A3EG 3HOUB 3CQZB 4OWWB 1EY5A 2UXBQ 1STNA 1Y1VG 2XWBB 1JJCB 3J7A5 4C3HG 2OEOA 1XXGA 5A35A 1YJ9A 2NZHA 1VQ9A 3GTKH 3W3AA 2K03A 4XIGS 2Q2TA 3IKJA 2OXPA 5IYDG 4RGNA 1WTXA 2RDGA 4PMCA 2SNMA 4DR2Q 4X3KA 1XMOL 3MXNB 2G9DA 3PO2H 1Q8IA 5EQ0A 4LFBL 2L12A 3PO3H 3S1QH 1C8CA 1RCVD 2KEDA 2OQ0A 1STEA 3UDGA 1HR0L 5FLXc 2K5WA 2PYKA 1VQEA 2EY2A 1S5DD 3C3LA 5CV5A 2NTSA 1S3OA 1F9QA 1JQYD 3P75A 2R7ZH 2NTTA 1HUNA 1V1PA 4TKOB 4A3KB 1X32A 5LHY1 4A93G 1EEFD 2AQ1B 1L0XB 4OX9L 2E5LQ 4YHHL 3M4OH 1K83H 5I2YA 2NVXB 3LNNA 4O2DA 3SDZA 3HOZB 1Y8NB 1SYDA 2LY7A 2SDFA 1HA6A 3NENA 2GVBA 2K32A 2QDLA 2RSOA 2B2UA 1EU4A 3K5LA 1IYVA 4RMFA 5ISRA 1LTRD 2X6LA 1LUZA 4XYQA 3MZ5A 5A2QE 3J7AF 1I3QB 3T1YQ 3BDOA 2F1MA 4IN3A 1WTOA 2UUAL 1XMOQ 1M4VA 3K6OA 4CKCA 4GN5A 4ZCKA 5A2QL 5M3FH 1LACA 2LS01 4LFBQ 1BCPD 3TN2A 2JA7H 2Q2HA 3RZDB 3DLLA 4HSPA 1HR0Q 4QGUA 4MNOA 1IW7D 3JAMc 3JAME 1DXMA 2JE6I 2XN9C 3K57A 5AJ3L 2RVLA 2JJQA 5FJ8G 4X6AH 1EQQA 3K7UC 4KKSA 3URYA 4IOCA 3KLWA 3HOVG 2KBNA 1BCPF 3MA2B 4CGYB 1K73C 3JAML 2BA0A 3VYRA 4IUQA 2ENBA 2RSNA 4OX9Q 3L2PA 4YHHQ 4JI0Q 2NN6H 2B39A 3QB3A 2YYZA 3GTLH 1X3FA 4ILWA 2WFWA 4DXGA 4EQOA 2F0EA 1O7ZA 4DR1L 3OTOL 2EXDA 5H1SE 5HGTA 2PZTA 5M3MH 3I3CA 2JA8H 2WAQB 2FMCA 5CBAE 1VDZA 3OMGA 4JG2A 2UUAQ 2O2LD 3K59A 1SMYD 1FD7D 4R4TA 1T5XD 3NBHA 3NTKA 4DN4M 4DF7A 1UNSA 3HOUH 1PFBA 4L5QA 3CQZH 5T1GA 4GNXB 2K14A 1CQFA 1V1QA 4JI4Q 1TY2A 2E2IB 4JK1C 1I6HB 4F7XA 5AJ3Q 4KHZA 3G71A 1LM0A 1SMXA 1BBUA 1GO3E 2CH4W 2F0SA 2HDMA 2OCEA 2Z8LA 1N8RC 1LTAD 3TS2A 5IYCH 1E2VA 1VQDA 4DV0Q 1JJGA 4QB4A 4A3LH 2PZWA 1SAPA 1KNAA 3PUWA 1XPRA 1HHVA 3BZKA 2K5QA 3KF6B 4P75A 4DUZL 4Y7NB 3CMEA 4HJ9A 2HHHQ 4DR1Q 3DWPA 3OTOQ 3DM3A 3LGJA 1S40A 5GAEC 5EPKA 4DV1L 1FR3A 1P16A 4A3FB 5IT9c 1LYLA 4A3KH 5IT9E 4X3SA 3PCOB 2PI2E 3WDNA 4ABNA 2NVXH 4GS3A 2X6GA 2AUKA 1SYGA 3TMEA 3HOZH 1TKWB 1RDPD 2PMZB 2WP8J 3UDIA 2DJGC 2DUDA 3NTIA 1X54A 3MTSA 4P73A 4RH6A 3NBIA 2WKDA 2I46A 3NK9A 5JAVA 3E6ZX 4TVAB 2R6GA 4IPGA 5IGGA 1I3QH 5BR8Q 1STHA 2NZ1D 5C0XG 4KLKA 3KF8A 3T1HL 2JA5B 1B53A 2IJ0A 2VL6A 1EL0A 3TS0A 5I9OA 1JR0D 3FDTA 3I72A 4A3MB 1ZEQX 4YCWA 3RZDH 1PDQA 3I2ZA 1YNXA 5JOBA 1CTMA 1WTQA 4A4IA 2KUMA 4RG1A 4QIWB 1HH2P 5C5LA 3W2DA 1TIID 1XWEA 1AE3A 1CHPD 2L1BA 1EZ8A 3UE0A 3W1BA 5J22A 3C1FA 1HFGA 4HJ8A 1CKMA 4MTKA 2KHSA 2K5HA 3EVQA 3ULLA 1DCZA 5C0XI 5EJWA 1KLGD 3DMUA 1HCZA 3VR3A 1IBLL 2JA9A 1CI3M 2MUYA 5EAYA 1SJED 2M2LA 2A6ED 3PQIA 4MN3A 3F2BA 3D0FA 4BBSG 5LL6S 1Q86C 1V9PA 1VQAA 4K6LA 3NPPA 3T1HQ 3V05A 3S24A 3DXJC 3F2UA 2R92G 5I6WA 2R7DA 4HJ5A 2N8NA 1Q46A 4ZK9B 5HGQA 2QA4A 5IGEA 1JE4A 1H9KA 4FVMA 4PZ7A 4JI7L 2FFKB 1QE6A 4IUUA 2E2IH 5J1ZA 1ASZA 1YNNC 2LMCB 1HXYD 1I6HH 4M1UB 4A3GG 4K5VA 4EX5A 3KBGA 4LUVA 3Q23A 2SNSA 3D4RA 5LL6X 4DV3L 2L11A 1KNEA 4O1NA 1I94L 1GD7A 4Q5VA 1V8QA 4OWXB 2WB1B 1AZPA 4GZYC 1O78A 2KCNA 4Y52H 4YWMA 1YVCA 1EEID 3C2PA 4OIKA 3AB9A 1IBLQ 4PMBA 4GOPB 4DV2Q 2HT1A 4ZQ3A 4B3RQ 2AKWB 4Y7NH 4R4QA 3GQBA 3UDXA 3PO2G 3W1GA 1B1ZA 3PO3G 2R7FA 3LX0A 1OXVA 3OWFA 3I73A 4R9WA 4HCSA 4A3FH 5ELEA 1PZID 1EYCA 2EYPA 2F0MA 2XVSA 3RZOB 3CHBD 1EY4A 2CWAA 4JBMA 4B9WA 1ZYRD 4JI7Q 1X3QA 1B9MA 1Y69U 3PUYA 1S5ED 3D4WA 3A7AB 4WORA 4LFAL 3EFXD 4DNRB 3S14B 4DV3Q 1JE5A 3F2CA 1SYBA 1X56A 2BE5D 2JA5H 4P74A 1I94Q 1LTID 1YBYA 4LK1C 1GKHA 3N6RA 4LFCL 4A3MH 3KLSA 1QZHA 4GOPC 3S9WA 2MPMA 2CFMA 2B63B 2VB2X 2VZAA 3BVGA 1TS5A 3IL8A 1BNZA 2RA4A 3PIOA 2IX0A 2F0UA 2JA6B 2Y0SB 2Z6KA 3G48A 1PRTB 5FO8B 1EY7A 3QG1A 1KIXA 2F3VA 4DUYQ 3PV0A 4DR6Q 4LW1A 1HNZL 1GOZA 4DAYA 2D62A 3EBEA 4K0KL 1G2TA 4P71A 2E76C 4BXXG 5ELNA 3S15B 1OXUA 1M1KC 1W3SA 4LF7L 3VYUA 4BBRG 4B3TL 5EPLA 2ZJPA 5C3EG 3C1EA 1HQRD 2RCNA 2WAQE 4O0AA 3D3RA 3CF5A 2EVBA 4LFAQ 3T51B 4JYAL 3ERSX 3HEJA 4OONA 5GAHC 1C7YA 2QILA 1DD2A 1WTRA 2HCCA 2LSSA 4HEDA 2K04A 2ALYB 1BVSA 1PTOD 1WJJA 1L1OA 1BOSA 4DKAC 3U50C 4LFCQ 1K8OA 2CWPA 4WRDA 3X3MA 5C4JB 3S17B 2EZVA 2K5NA 1L2FA 4LF9L 5C44G 3CCJA 4C3IB 1GUOA 1QUQB 3A56A 1Q81C 5JVG3 3I4OA 4ZUJA 2CW0D 1PRTC 2CHBD 1GUSA 4JC0A 1Q12A 1PTOF 2F0VA 2F0HA 2RDHA 2O5IC 4JV5Q 2A6HD 1PH7A 2KENA 5D3IB 4RWSC 2PI2A 4HCEA 1H9SB 1CKNA 1S5BD 1N33L 3SHLA 3FVQA 3QOLA 1MBYA 4OO1G 2NN6I 4BY1B 1PXUA 1DZ1A 3P1HA 4YWLA 3KK7A 2XWJB 1B50A 4LF7Q 2JEBI 1TWGH 3SR1A 4LJZC 2YTVA 2PNHA 1HTPA 3J81E 3E0EA 4F87A 3HKZE 4J6HA 4JYAQ 4LNQA 1JICA 3LWEA 3MFYA 5EKKA 1KD1C 4ZRZA 3J81L 3PGZA 3KOJA 2F0JA 2QEXA 3RZOH 4UY8C 3SE0A 1R4PB 5I6YA 1EYGA 4APVA 4LF9Q 2VUMG 1WOCA 5IP7H 4GKJQ 3GTMB 2EE1A 4JI3L 2WKCA 4OO1I 1YHQA 1WCMG 1D1IA 1I4HA 3TZUA 2G5DA 3JAMi 1VQ7A 3S14H 3OMCA 4Z9CB 1KDCA 2R93B 3J80L 1N33Q 4LUZA 5M9OA 1K0SA 4DAVA 4OL7A 3U9OA 2JQOA 2QGQA 3CCEA 1C9OA 3VR6A 3UDFA 1BQQT 4IFDJ 5FO7B 5F2DA 5IP9G 1IXRA 3KLRA 2NUCA 4OIJA 3EQLC 4C3JB 5C4XG 1VQIA 4PV1C 5JJZA 5COYA 2B63H 4QIWE 1WYDA 4L63B 2NVQB 1X3EA 4CDEC 4TRDA 2VB3X 4HSVA 2IPKD 2Q8TA 5K36H 1K8MA 2Q8RE 1B7YB 2JA6H 2PNRC 4RKLA 3K7AB 4UAIA 1I4QA 4CJ2C 1HRJA 3HOXB 2PQAB 1NNXA 2JXMB 4KJOA 1X6OA 1RODA 3O13A 1HZCA 1XYIA 1NR4A 2AMCB 3KDFA 4LWCA 2N88A 3CRLC 3S15H 2EJMA 4FDBA 2B2TA 5KIXA 3BVZA 3PF4A 4CKEA 5DLQE 3X3NA 4YCVA 2F0DA 1FJGL 4JI3Q 3NE5B 1A6XA 2I0QA 3A5UA 1PYBA 3OHXC 4OXPA 1E1TA 3PIO3 1KLUD 1MD2D 4DR3L 4X3UA 3GTPB 3HZXA 5E7NA 5IY0A 5KRUA 2DNCA 1LTTD 3DEPA 2A1AA 4N8FA 2EJGC 1LTSD 2JEAI 4C1NK 1SN8A 2EYFA 1ASYA 3CC4A 3K81C 3MXUA 3CCMA 1UEBA 4KD3A 5C4JH 5LMUQ 3S17H 2WV6D 4NB3A 1IBML 3QO2A 2QKIC 4C3IH 2VNUD 2ES2A 1F77A 1UAPA 5EBDA 1SLJA 3HOYB 1EY9A 2KECA 2YTYA 2MJ8A 3SXHA 3E9HA 3VDYA 3DEOA 1I4XA 1NAPA 5LMNW 3S2DB 4G7OC 3EN2A 2NWGA 3NQIA 2WB1E 2ZTDA 1HQMC 4A3BG 4LMQD 1O80A 5D14A 2WACA 3NUCA 1ESFA 4R4CA 4BY7G 4BY1H 1XNRL 3S1NB 4L5SA 5J3BA 4NMZA 4A3IG 4KMUC 4JOIA 4IURA 4CHTB 4H0LC 3ITPA 1A63A 3HFZB 1FJGQ 1JWSD 4JI8L 2YU9B 4IQZA 4YCUA 2XRQD 2CQAA 2F0GA 1OTCA 3SGIA 4DR3Q 1PH8A 1A62A 2KHJA 2MQHA 2B2VC 4N9TA 3I4NG 1VQCA 1ZKOA 2QF7A 3TSSA 1I4PA 4JVZA 1EOVA 1U4LA 3CCQA 4X66L 3KUPA 1V1PB 4A3DG 1BO0A 1IBMQ 3OIQA 2A74C 3HKZG 1D5MC 3E3XA 3PSIA 5IE8A 3GTMH 4UP7A 1XTDA 4OEMB 3CCLA 1VMCA 3MC0B 4DGZA 1BUVT 1HUMA 1W6KA 4HIOA 2NYZD 1JOOA 4A3CG 1ENFA 1QCBD 2F3WA 5GROA 2R93H 4WJ3M 5C6AA 1PZJD 1HJPA 4ZKCB 3VR5A 1D2BA 1II3A 1LTLA 3M4PA 1UWVA 4DAPA 4DV6L 3VA7A 4JW0A 1XNRQ 2NBFA 4KV6A 1VQKA 4AYBG 4C3JH 4LAAA 1K9MC 3J7ZC 2RF4A 1WTWA 2NVQH 4A76A 2EYHA 3IFDA 4P2CB 2UXDL 1EU3A 1PH5A 4ZAIA 4JI8Q 2ASBA 3SK4A 3PIPA 4A3EB 4A3MG 1CZGA 3K7AH 3CXCA 3RR5A 4GLXA 2F0IA 3HOXH 3NP8A 3I4LA 4NW2A 1GUGA 3QIAA 2HD3A 1KQSA 3NTHA 2UU9L 2HQEA 3TP6A 1RF2D 2A6EC 2BH8A 2K4KA 1J5EL 2HIXA 3EROA 2J7ZA 3AU7A 1YZ6A 3I70A 5FLMH 2Z4IA 4NKLA 1J8IA 3BZDB 2MHVA 1SR3A 3WOEA 1B2TA 3E9IA 2KHIA 4B3SL 1TXYA 2B2UC 4UHVA 1E0BA 4WFN3 3GTPH 2L9HA 1MGSA 4POGA 4LF6L 4G57A 3STBC 2KA7A 1Q1BA 2E8GA 1VMPA 1LT4D 1EYDA 5ELDA 5JEAH 2EXZA 3EJIA 1SFOB 3ULPA 2D5DA 4UP9A 3T13A 3CCUA 4R1JA 2UXDQ 5EGTA 3DHQA 3NBHB 3WOFA 4A3JB 3HOYH 1FL0A 4GKKL 2CQOA 1VF5C 3PUZA 3D6WA 2ZTEA 3S2DH 5HY6A 3OYYA 5CV4A 1SRUA 1WTVA 4BA2I 1ILQA 3EA6A 1X3PA 3V96A 2DJFC 1SE4A 1CT1D 2UU9Q 1LTGD 4CDCC 1SNMA 4HR7B 1K0RA 4IFDG 3S1NH 3M3YB 4I7AA 3BG3A 4GNXC 2EJFC 2EYMA 4V190 2K75A 1Y1WG 1N9WA 1YEZA 3I4MG 3T16A 2B2YA 1SE8A 2Z1CA 1BF4A 2WB1G 2YU9H 4B3SQ 1OO9B 3E5SA 5IYBG 1E7ZA 4NXML 4RCNA 3D8GA 1B9NA 3VYTA 1ZYRC 4S3SA 1PH2A 1SNCA 1CKOA 3J7AV 2Q2IA 3BVMA 4LF6Q 3IAYA 1ILPA 3D4DA 1CQVA 2RCFA 2EQSA 5KNCA 4O42A 3CD6A 1AEXA 2IX3A 4HAEA 2O5JC 1P8LA 1TQOA 2Z6BA 2Q8IB 2UXCL 1B8AA 3HP3A 1HZBA 2BE5C 2QW7A 1AH9A 2B2WA 5KNDA 2TSSA 4R4OA 2ZXPA 4IFDI 2EY1A 1EQRA 5C5MA 4DUZQ 4DR5L 1PTOB 1UUPA 1KC8C 3A5ZB 2LXJA 4WJ4A 4KHPL 1STAA 5KEEA 1Y14B 2EDGA 3FKIB 4UP8A 4DV1Q 3WWVA 3H3VI 3D6CA 3T53B 5IGFA 1J6QA 4C56C 4AQYL 2E2JB 2IHEA 1ESRA 2C35B 1JT8A 3KF8B 4G7ZC 2MO1A 2M00A 1XMQL 2A68C 2I5MX 3HS0C 2BDNA 2K5VA 1YNJD 3MXPA 1F2LA 3RLNA 4DV4L 2PW7A 1QVFA 2KCCA 1CK1A 1O7YA 1PA6A 4A3EH 2VW9A 4AH6A 2EYLA 2OQKA 5ELFA 5BN3A 2K1BA 4YWKA 3NWSA 4KI0A 2LFNA 1WTPA 1JORA 5E3FA 5DAUA 5CC4A 1KRSA 2A73B 2PPBC 1SJHD 1IZ6A 4K2LA 5IYDH 5HURA 1NJIC 1QNUA 2UXCQ 1CSPA 1HTLD 2XTIA 4DFAA 3MXGA 5CV8A 3A8KE 3H0GG 1PTOC 2DY8A 2F0KA 1U0LA 3GV3A 3PIP3 1XNQL 3PUVA 5J39A 4X65L 1TY0A 3CPWA 1F9PA 3NEMA 1E24A 3K58A 2CW0C 4K6DA 3DWAA 4RHSA 5JJIA 3G6EA 4PZ6A 2J0TD 2A6HC 1SFOH 2OWOA 4NXNL 1S72A 2BH2A 2DY7A 5DNFA 1F9RA 3GD7A 4L6TB 1TWGB 4A3JH 2VY3A 1AN8A 3SVMA 4DPGA 4FF1A 2N3SA 4X64L 1EIFA 3J81i 1LT6D 3VR2A 4C3IG 4KKUA
chains in the Genus database with same CATH topology
1TWGH 2YTVA 2PNHA 1A8VA 4XTCS 3JC66 4A93G 3K80C 3E0EA 3M3YH 4OX9L 2E5LQ 3HKZE 4YHHL 3M4OH 1K83H 4JYAQ 4LNQA 4O2DA 2VUMH 3RLOA 1UE6A 1CSQA 2ZTCA 1NY4A 2ATWA 2R7ZG 3NENA 2GVBA 1K8AC 4JCVE 2VQEL 3CP0A 1KD1C 1WCMH 4RMFA 2KCMA 3PGZA 1VQ6A 3KOJA 1LUZA 4BY1G 2QEXA 3RZOH 4UY8C 1DGSA 3M7NA 4R4IA 1EYGA 4APVA 1YJNA 4LF9Q 5ELOA 2VUMG 1WOCA 3I7FA 5IP7H 4GKJQ 3T1YQ 2UUAL 1GVPA 5IWAL 2F4VQ 3GTGH 1XMOQ 3GDEA 4JI3L 4OO1I 5FJ8H 3NELA 1YHQA 1WCMG 5IP9H 4GN5A 1GM5A 1JJ2A 3GTOH 5M3FH 4GLVB 4GKKQ 5C4XH 4LFBQ 3JAMi 1VQ7A 4LF4L 3S14H 4NXNQ 5JEAJ 2JA7H 2MNAA 2Q2HA 3DLLA 2OTLA 1G291 1HR0Q 4QGUA 1FGUA 1YHBA 1N33Q 4LUZA 5IP7G 4B3MQ 4MNOA 1IYJB 5LMNQ 2JQOA 2QGQA 3JAMc 1VQBA 2JE6I 4DK3C 3CCEA 1C9OA 5AJ3L 4DAMA 2JJQA 3UDFA 4IFDJ 5FJ8G 1RL2A 5IP9G 4X6AH 1EQQA 1IXRA 3K7UC 4X64Q 3TREA 5M3FG 4LF8L 3GTQH 1L0WA 5C4XG 3CCSA 1VQIA 2XGTA 3FKIH 3KLWA 4BA1I 2KBNA 3AYHB 4IOCA 2B63H 2JA7G 2L15A 1WYDA 4QIWE 1X3EA 1E22A 1E3PA 1K73C 4QL5A 2BA0A 2CKZB 4L5TA 1MKHA 1B7YB 4OX9Q 2JA6H 2E2JH 3L2PA 4A75A 2VS1A 4YHHQ 4JI0Q 4NXMQ 2PQAB 3U58A 2YYZA 1Y1VH 4DR4L 1YIJA 3GTLH 2B63G 2VQEQ 1X3FA 3CAMA 1X6OA 1NE3A 2WFWA 4C3HH 1HZCA 1T9HA 3W5OA 1TWAH 2AMCB 4DR1L 3OTOL 4DR7L 3KDFA 4LWCA 2EXDA 5K36G 5H1SE 2JA6G 2Y0SG 5M3MH 2F52A 2JA8H 3S15H 2NN6G 4YY3L 4FDBA 5M5XH 4DV2L 4B3RL 4JG2A 3UE1A 3PF5A 3PF4A 2UUAQ 5IWAQ 1N34L 5DLQE 1FVIA 3BZCA 2RHSB 4YCVA 2E2HH 3KYHC 2AHOB 1HNXL 4JI3Q 1FJGL 2I0QA 4R4TA 1X9NA 3A5UA 2B3GA 1PYBA 4OXPA 2YTXA 4DR5Q 1E1TA 4LF4Q 3HOUH 4DR3L 4L5QA 1VQOA 1K3RA 3A0JA 3CQZH 5E7NA 5IY0A 5M3MG 4GNXB 2JA8G 3ICEA 4BY7G 4KHPQ 4DAYB 2K14A 4JBKA 1V1QA 1VQLA 4JI4Q 1VQ5A 2A1AA 5GAGC 3GO5A 2JEAI 4GOPA 1SN8A 5AJ3Q 1VQHA 4KHZA 3G71A 1LM0A 1SMXA 1ASYA 3CC4A 1C0AA 1BBUA 1GO3E 2A19A 3K81C 3CCMA 4AQYQ 1UEBA 4LF8Q 1NTGA 5C4JH 5LMUQ 3S17H 4NB3A 1KHIA 1UE7A 3M9BA 1IBML 3HOUG 4A3BH 2OCEA 1N8RC 3TS2A 4C3IH 2VNUD 3K0XA 2ES2A 3STBD 5IYCH 4HIKA 4ALPA 1VQDA 1XMQQ 1SLJA 3CW2C 2EIFA 4DV0Q 1HNZQ 2RHQB 4BY7H 1I50H 1HR0W 4A93H 1HZ9A 1JJGA 2YTYA 4DV4Q 1Q82C 2Q2UA 4A3IH 4K0KQ 4A3LH 3E9HA 3VDYA 5LMNW 1BKBA 1XPRA 3PUWA 4UPAA 2N78A 4JI1L 3EN2A 1W2BA 3BZKA 2WB1E 2ZTDA 1VQFA 4A3BG 4DR4Q 3OW2A 4IOAA 3KF6B 4P75A 1L1OB 2I5HA 4EQ5A 5IYCG 4DUZL 4B3TQ 3CMEA 4HJ9A 2A8VA 3K8AA 2HQLA 2HHHQ 1VQNA 1Q1EA 4R4CA 3J81c 3OTOQ 4DR1Q 4BY1H 4JI6L 3U4VA 3DM3A 5J3BA 4L5SA 1XNRL 4DR7Q 3AFPA 4A3IG 4A3LG 3LGJA 4JOIA 4DK6C 1S40A 4LF5L 5GAEC 4DV1L 1UE5A 2JK8A 3L0OA 3I4NH 1A63A 2Z6KC 1P16A 2YV5A 3BJUA 1N34Q 5IT9c 2CCZA 3HFZB 1FJGQ 1LYLA 3MEFA 4A3KH 1HNXQ 1X55A 4JI8L 1R9TH 4YCUA 3PCOB 2H5XA 2PI2E 2AWNA 3J80i 1KRTA 1OTCA 4GS3A 2NVXH 4A3DH 1Z47A 3SGIA 4DR3Q 2PMZE 4C2MH 4DUYL 3HOZH 1XNQQ 1CKNB 1PH8A 4DR6L 2WP8J 1A62A 3UDIA 2DUDA 2KHJA 1X54A 2MQHA 4P73A 3I4NG 4X65Q 4GN4B 3J80c 1KL9A 1VQCA 4PZ8A 1JB7A 1PFSA 1EFWA 3CC2A 4L5RC 1B70B 1TWHH 4NPSA 4A3KG 1XPOA 4TVAB 1YITA 2R6GA 4A3CH 2BA1A 3CCQA 1EOVA 4IPGA 4X66L 2GN5A 1I3QH 5BR8Q 3I56A 4A3DG 1K8GA 1IBMQ 2MO0A 5C0XG 4KLKA 3HKZG 3HOVH 4ME3A 5IE8A 3T1HL 3PSIA 3HOZG 3GTMH 1HZAA 1D8LA 2VL6A 4UP7A 4HJ7A 1XTDA 1A0IA 2GVAA 4HIDA 3KJOA 2D0PA 3TS0A 3CCLA 2UXCQ 1KXLA 2IT1A 1PH9A 1NBWA 2FXQA 4HIOA 1QZGA 2UUCL 1WFQA 2D0OA 3EIVA 1EUJA 4A3CG 4IPDA 5GROA 2UXBL 1E1OA 4IPCA 4YCWA 3RZDH 2R93H 1L1OC 3I2ZA 4IJLA 1YNXA 4WJ3M 5JJLA 1HJPA 4A4IA 5M5YH 1N32L 1LTLA 3M4PA 4RG1A 4QY7A 1UWVA 1HH2P 4DV6L 4JI6Q 3FP9A 1XNRQ 3A74A 1VQKA 4AYBG 2AWOA 4C3JH 4LF5Q 1K9MC 3J7ZC 1AE3A 2RF4A 2Z0SA 2NVQH 4A76A 2NVYH 1YJWA 2R93G 3UE0A 2UXDL 1PH5A 3GTJH 4JI8Q 3W1BA 1YI2A 2ASBA 3F1ZA 4JV5L 4HJ8A 3PIPA 4BBSH 1CKMA 4A3MG 1JMCA 4POFA 3K7AH 2K5HA 3ULLA 3CXCA 3RR5A 5C0XI 4GLXA 3HOXH 3F2DA 1IBLL 2JA9A 4AIMA 1PH1A 2R92H 5EAYA 3ULJA 1KQSA 2UU9L 1QUQA 2BH8A 2K4KA 3H15A 2NVTH 3AFQA 1J5EL 3HOWG 2HIXA 3F2BA 3M4QA 1CUKA 1PVOA 3D0FA 4BBSG 1Q86C 1YZ6A 4GN3B 1Z9FA 3CPFA 5FLMH 1V9PA 1VQAA 3HOXG 3T1HQ 4IO9A 2OTJA 3S24A 1MJCA 1Q7YC 4A3GH 2R92G 1SR3A 2R7DA 4HJ5A 3D31A 2IX1A 2E5LL 2N8NA 1EWIA 3E9IA 2KHIA 4B3SL 1Q46A 2I5LX 2UUCQ 4DNIA 1TXYA 5HGQA 2QA4A 2ZJRA 2KCTA 1VS0A 3RNUA 2MFIA 3GTPH 2WAQG 4POGA 5FLMG 4PZ7A 4JI7L 4LF6L 1VQMA 2E2IH 3STBC 1ASZA 1I6HH 1VCIA 1N32Q 3KDFB 2ID0A 4A3GG 1Q1BA 2E8GA 4MTNA 1MIUA 4EX5A 4LUVA 4OWTB 1XPUA 3ULPA 4DV3L 4DV7L 4GKJL 3T1YL 1UE1A 1HNWL 1PH6A 3AEVA 4UP9A 2ZM6L 3CCUA 4R1JA 1I94L 1GD7A 2UXDQ 1VQJA 1VQ4A 4OWXB 4PG3A 3NBHB 1OXSC 1PV4A 5M5WH 2ZJQA 1FL0A 1X65A 3HOYH 4GKKL 3ER0A 2CQOA 3PUZA 2ZTEA 4Y52H 3S2DH 4YWMA 3RLFA 1YVCA 5HY6A 5JEAG 1Y1WH 1IBKL 3OYYA 3J81j 1SRUA 1TWCH 1IBLQ 4BA2I 4YY3Q 1QVCA 3I55A 3I4MH 2N49A 4GOPB 3H3VH 2K50A 4JI5L 1SROA 4DV2Q 2UU9Q 2HT1A 4B3RQ 2AKWB 4Y7NH 4R4QA 5IYBH 1XJVA 3UDXA 4P72A 1K0RA 3HOYG 3S1NH 4IFDG 3PO2G 3W1GA 3PO3G 2R7FA 4GNXC 1YHAA 2K75A 3AQQA 1Y1WG 1N9WA 1YEZA 1OXVA 1M90C 4HIMA 4A3FH 3B6YA 3I4MG 1SE8A 4A3JG 2WB1G 4JBJA 1PHJA 2YU9H 3IRBA 4B3SQ 4LUOA 4JI0L 3Q8DA 1Q8KA 2NZOA 1E7ZA 5IYBG 4NXML 2CWAA 1PYSB 3ZJYC 4JBMA 1PH2A 1CKOA 2B29A 2Q2IA 4JI7Q 1O7IA 1QVGA 4LF6Q 4IJHA 3PUYA 3FHWA 1D7QA 4A3FG 2EQSA 4GLAC 1U5KA 3CD6A 3S1MH 3PUXA 1AE2A 1P8LA 2F3IA 4H02A 4IPHA 4LFAL 4DV5L 1EIYB 3TEHB 2UXCL 1TWFH 1B8AA 4DV3Q 4DV7Q 1JE5A 3TQYA 1HZBA 3F2CA 4JI1Q 1X56A 1PH3A 1HNWQ 1AH9A 2JA5H 2ZM6Q 4P74A 2PQAA 4R4OA 1I94Q 4AYBE 4J15A 4IFDI 1EQRA 1YBYA 4DUZQ 4DR5L 3M85A 4HJAA 3KFUA 1GKHA 1KC8C 3F8TA 4LFCL 3A5ZB 4A3MH 1QZHA 1X3GA 2LXJA 2UUBL 4WJ4A 4KHPL 2LXKA 1OXXK 4GOPC 1Y14B 1IBKQ 2IY5B 1G6PA 2CFMA 4JI4L 4UP8A 1V43A 4DV1Q 3WWVA 3H3VI 4DR2L 4JI5Q 2VZAA 2JA5G 1J6QA 1NMGA 2Y0SE 4BXXH 3PIOA 2IX0A 4AQYL 3HOWH 1PH4A 3S16H 2Z6KA 2IHEA 3BU2A 5LMUL 3G4SA 3G48A 1N36L 5GADC 2C35B 1JT8A 3KF8B 2VQFL 3RN2A 2MO1A 4JI2L 3U4ZA 1KIXA 4BBRH 1XMQL 2I5MX 3PV0A 4PMWA 4DUYQ 4DR6Q 2K5VA 4LW1A 4GNXA 1HNZL 4DV0L 5C3EH 3S2HH 3CCRA 2D62A 3EBEA 3HKSA 3RLNA 4DV4L 3S1RH 4K0KL 1QVFA 4P71A 4BXXG 1PA6A 1IL2A 5ELNA 4A3EH 4JBWA 2VW9A 3RN5A 4AH6A 3CCVA 1OXUA 4TQUS 1M1KC 1W3SA 2OQKA 4X66Q 1G51A 3FKIG 5C0XJ 1H95A 4LF7L 4X62L 4YWKA 3HOVG 3H0GH 4QQBX 4KI0A 4BBRG 4B3TL 3TRZA 2ZJPA 2HHHL 4JOIC 5C3EG 1WI5A 2RCNA 1KRSA 2WAQE 1VQPA 4O0AA 3CF5A 1IZ6A 3CMAA 4LFAQ 4JYAL 4DV5Q 1NJIC 5IYDH 3ERSX 4OONA 1CSPA 2IHFA 5GAHC 5C44H 2DGYA 2XTIA 4A3EG 1C7YA 1KAWA 4OWWB 2UXBQ 3L7ZC 1Y1VG 2LSSA 1JJCB 2ALYB 3H0GG 4QJFA 1BVSA 3J7A5 3KF6A 1WJJA 1U0LA 2HIVA 2NZHA 5GQOA 1L1OA 3KJPA 1YJ9A 1VQ9A 2K52A 4DKAC 3U50C 4LFCQ 3GTKH 2CWPA 4XIGS 4DV6Q 2Q2TA 2UUBQ 1XNQL 5IYDG 1RIPA 2K5NA 3PUVA 1I5FA 1L2FA 4LF9L 5C44G 4X65L 3CCJA 3CPWA 4DR2Q 1QUQB 3NEMA 2F4VL 1E24A 1XMOL 3MXNB 1Q81C 3I4OA 2V1CC 4JC0A 5JJIA 1Q12A 1MJEA 5BR8L 3G6EA 3PO2H 1N36Q 4PZ6A 4JV5Q 4LFBL 1SFOH 3PO3H 2VQFQ 4NXNL 1S72A 2OWOA 3S1QH 2BH2A 4JI2Q 1PH7A 2KENA 3UDGA 2OQ0A 1HR0L 2PI2A 5FLXc 1N33L 1CKNA 1VQEA 4B3ML 5LMNL 3GD7A 1BBWA 4A3JH 1NMFA 2VY3A 1VQGA 1VQ8A 4DPGA 1OXTA 4OO1G 2NN6I 1S3OA 3CC7A 1J5EQ 2N3SA 4YWLA 4X64L 5JJKA 2R7ZH 1EIFA 3J81i 4MZ9A 4LF7Q 4X62Q 2JEBI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWG H;  2YTV A;  2PNH A;  1A8V A;  4XTC S;  3JC6 6;  4A93 G;  3K80 C;  3E0E A;  3M3Y H;  4OX9 L;  2E5L Q;  3HKZ E;  4YHH L;  3M4O H;  1K83 H;  4JYA Q;  4LNQ A;  4O2D A;  2VUM H;  3RLO A;  1UE6 A;  1CSQ A;  2ZTC A;  1NY4 A;  2ATW A;  2R7Z G;  3NEN A;  2GVB A;  1K8A C;  4JCV E;  2VQE L;  3CP0 A;  1KD1 C;  1WCM H;  4RMF A;  2KCM A;  3PGZ A;  1VQ6 A;  3KOJ A;  1LUZ A;  4BY1 G;  2QEX A;  3RZO H;  4UY8 C;  1DGS A;  3M7N A;  4R4I A;  1EYG A;  4APV A;  1YJN A;  4LF9 Q;  5ELO A;  2VUM G;  1WOC A;  3I7F A;  5IP7 H;  4GKJ Q;  3T1Y Q;  2UUA L;  1GVP A;  5IWA L;  2F4V Q;  3GTG H;  1XMO Q;  3GDE A;  4JI3 L;  4OO1 I;  5FJ8 H;  3NEL A;  1YHQ A;  1WCM G;  5IP9 H;  4GN5 A;  1GM5 A;  1JJ2 A;  3GTO H;  5M3F H;  4GLV B;  4GKK Q;  5C4X H;  4LFB Q;  3JAM i;  1VQ7 A;  4LF4 L;  3S14 H;  4NXN Q;  5JEA J;  2JA7 H;  2MNA A;  2Q2H A;  3DLL A;  2OTL A;  1G29 1;  1HR0 Q;  4QGU A;  1FGU A;  1YHB A;  1N33 Q;  4LUZ A;  5IP7 G;  4B3M Q;  4MNO A;  1IYJ B;  5LMN Q;  2JQO A;  2QGQ A;  3JAM c;  1VQB A;  2JE6 I;  4DK3 C;  3CCE A;  1C9O A;  5AJ3 L;  4DAM A;  2JJQ A;  3UDF A;  4IFD J;  5FJ8 G;  1RL2 A;  5IP9 G;  4X6A H;  1EQQ A;  1IXR A;  3K7U C;  4X64 Q;  3TRE A;  5M3F G;  4LF8 L;  3GTQ H;  1L0W A;  5C4X G;  3CCS A;  1VQI A;  2XGT A;  3FKI H;  3KLW A;  4BA1 I;  2KBN A;  3AYH B;  4IOC A;  2B63 H;  2JA7 G;  2L15 A;  1WYD A;  4QIW E;  1X3E A;  1E22 A;  1E3P A;  1K73 C;  4QL5 A;  2BA0 A;  2CKZ B;  4L5T A;  1MKH A;  1B7Y B;  4OX9 Q;  2JA6 H;  2E2J H;  3L2P A;  4A75 A;  2VS1 A;  4YHH Q;  4JI0 Q;  4NXM Q;  2PQA B;  3U58 A;  2YYZ A;  1Y1V H;  4DR4 L;  1YIJ A;  3GTL H;  2B63 G;  2VQE Q;  1X3F A;  3CAM A;  1X6O A;  1NE3 A;  2WFW A;  4C3H H;  1HZC A;  1T9H A;  3W5O A;  1TWA H;  2AMC B;  4DR1 L;  3OTO L;  4DR7 L;  3KDF A;  4LWC A;  2EXD A;  5K36 G;  5H1S E;  2JA6 G;  2Y0S G;  5M3M H;  2F52 A;  2JA8 H;  3S15 H;  2NN6 G;  4YY3 L;  4FDB A;  5M5X H;  4DV2 L;  4B3R L;  4JG2 A;  3UE1 A;  3PF5 A;  3PF4 A;  2UUA Q;  5IWA Q;  1N34 L;  5DLQ E;  1FVI A;  3BZC A;  2RHS B;  4YCV A;  2E2H H;  3KYH C;  2AHO B;  1HNX L;  4JI3 Q;  1FJG L;  2I0Q A;  4R4T A;  1X9N A;  3A5U A;  2B3G A;  1PYB A;  4OXP A;  2YTX A;  4DR5 Q;  1E1T A;  4LF4 Q;  3HOU H;  4DR3 L;  4L5Q A;  1VQO A;  1K3R A;  3A0J A;  3CQZ H;  5E7N A;  5IY0 A;  5M3M G;  4GNX B;  2JA8 G;  3ICE A;  4BY7 G;  4KHP Q;  4DAY B;  2K14 A;  4JBK A;  1V1Q A;  1VQL A;  4JI4 Q;  1VQ5 A;  2A1A A;  5GAG C;  3GO5 A;  2JEA I;  4GOP A;  1SN8 A;  5AJ3 Q;  1VQH A;  4KHZ A;  3G71 A;  1LM0 A;  1SMX A;  1ASY A;  3CC4 A;  1C0A A;  1BBU A;  1GO3 E;  2A19 A;  3K81 C;  3CCM A;  4AQY Q;  1UEB A;  4LF8 Q;  1NTG A;  5C4J H;  5LMU Q;  3S17 H;  4NB3 A;  1KHI A;  1UE7 A;  3M9B A;  1IBM L;  3HOU G;  4A3B H;  2OCE A;  1N8R C;  3TS2 A;  4C3I H;  2VNU D;  3K0X A;  2ES2 A;  3STB D;  5IYC H;  4HIK A;  4ALP A;  1VQD A;  1XMQ Q;  1SLJ A;  3CW2 C;  2EIF A;  4DV0 Q;  1HNZ Q;  2RHQ B;  4BY7 H;  1I50 H;  1HR0 W;  4A93 H;  1HZ9 A;  1JJG A;  2YTY A;  4DV4 Q;  1Q82 C;  2Q2U A;  4A3I H;  4K0K Q;  4A3L H;  3E9H A;  3VDY A;  5LMN W;  1BKB A;  1XPR A;  3PUW A;  4UPA A;  2N78 A;  4JI1 L;  3EN2 A;  1W2B A;  3BZK A;  2WB1 E;  2ZTD A;  1VQF A;  4A3B G;  4DR4 Q;  3OW2 A;  4IOA A;  3KF6 B;  4P75 A;  1L1O B;  2I5H A;  4EQ5 A;  5IYC G;  4DUZ L;  4B3T Q;  3CME A;  4HJ9 A;  2A8V A;  3K8A A;  2HQL A;  2HHH Q;  1VQN A;  1Q1E A;  4R4C A;  3J81 c;  3OTO Q;  4DR1 Q;  4BY1 H;  4JI6 L;  3U4V A;  3DM3 A;  5J3B A;  4L5S A;  1XNR L;  4DR7 Q;  3AFP A;  4A3I G;  4A3L G;  3LGJ A;  4JOI A;  4DK6 C;  1S40 A;  4LF5 L;  5GAE C;  4DV1 L;  1UE5 A;  2JK8 A;  3L0O A;  3I4N H;  1A63 A;  2Z6K C;  1P16 A;  2YV5 A;  3BJU A;  1N34 Q;  5IT9 c;  2CCZ A;  3HFZ B;  1FJG Q;  1LYL A;  3MEF A;  4A3K H;  1HNX Q;  1X55 A;  4JI8 L;  1R9T H;  4YCU A;  3PCO B;  2H5X A;  2PI2 E;  2AWN A;  3J80 i;  1KRT A;  1OTC A;  4GS3 A;  2NVX H;  4A3D H;  1Z47 A;  3SGI A;  4DR3 Q;  2PMZ E;  4C2M H;  4DUY L;  3HOZ H;  1XNQ Q;  1CKN B;  1PH8 A;  4DR6 L;  2WP8 J;  1A62 A;  3UDI A;  2DUD A;  2KHJ A;  1X54 A;  2MQH A;  4P73 A;  3I4N G;  4X65 Q;  4GN4 B;  3J80 c;  1KL9 A;  1VQC A;  4PZ8 A;  1JB7 A;  1PFS A;  1EFW A;  3CC2 A;  4L5R C;  1B70 B;  1TWH H;  4NPS A;  4A3K G;  1XPO A;  4TVA B;  1YIT A;  2R6G A;  4A3C H;  2BA1 A;  3CCQ A;  1EOV A;  4IPG A;  4X66 L;  2GN5 A;  1I3Q H;  5BR8 Q;  3I56 A;  4A3D G;  1K8G A;  1IBM Q;  2MO0 A;  5C0X G;  4KLK A;  3HKZ G;  3HOV H;  4ME3 A;  5IE8 A;  3T1H L;  3PSI A;  3HOZ G;  3GTM H;  1HZA A;  1D8L A;  2VL6 A;  4UP7 A;  4HJ7 A;  1XTD A;  1A0I A;  2GVA A;  4HID A;  3KJO A;  2D0P A;  3TS0 A;  3CCL A;  2UXC Q;  1KXL A;  2IT1 A;  1PH9 A;  1NBW A;  2FXQ A;  4HIO A;  1QZG A;  2UUC L;  1WFQ A;  2D0O A;  3EIV A;  1EUJ A;  4A3C G;  4IPD A;  5GRO A;  2UXB L;  1E1O A;  4IPC A;  4YCW A;  3RZD H;  2R93 H;  1L1O C;  3I2Z A;  4IJL A;  1YNX A;  4WJ3 M;  5JJL A;  1HJP A;  4A4I A;  5M5Y H;  1N32 L;  1LTL A;  3M4P A;  4RG1 A;  4QY7 A;  1UWV A;  1HH2 P;  4DV6 L;  4JI6 Q;  3FP9 A;  1XNR Q;  3A74 A;  1VQK A;  4AYB G;  2AWO A;  4C3J H;  4LF5 Q;  1K9M C;  3J7Z C;  1AE3 A;  2RF4 A;  2Z0S A;  2NVQ H;  4A76 A;  2NVY H;  1YJW A;  2R93 G;  3UE0 A;  2UXD L;  1PH5 A;  3GTJ H;  4JI8 Q;  3W1B A;  1YI2 A;  2ASB A;  3F1Z A;  4JV5 L;  4HJ8 A;  3PIP A;  4BBS H;  1CKM A;  4A3M G;  1JMC A;  4POF A;  3K7A H;  2K5H A;  3ULL A;  3CXC A;  3RR5 A;  5C0X I;  4GLX A;  3HOX H;  3F2D A;  1IBL L;  2JA9 A;  4AIM A;  1PH1 A;  2R92 H;  5EAY A;  3ULJ A;  1KQS A;  2UU9 L;  1QUQ A;  2BH8 A;  2K4K A;  3H15 A;  2NVT H;  3AFQ A;  1J5E L;  3HOW G;  2HIX A;  3F2B A;  3M4Q A;  1CUK A;  1PVO A;  3D0F A;  4BBS G;  1Q86 C;  1YZ6 A;  4GN3 B;  1Z9F A;  3CPF A;  5FLM H;  1V9P A;  1VQA A;  3HOX G;  3T1H Q;  4IO9 A;  2OTJ A;  3S24 A;  1MJC A;  1Q7Y C;  4A3G H;  2R92 G;  1SR3 A;  2R7D A;  4HJ5 A;  3D31 A;  2IX1 A;  2E5L L;  2N8N A;  1EWI A;  3E9I A;  2KHI A;  4B3S L;  1Q46 A;  2I5L X;  2UUC Q;  4DNI A;  1TXY A;  5HGQ A;  2QA4 A;  2ZJR A;  2KCT A;  1VS0 A;  3RNU A;  2MFI A;  3GTP H;  2WAQ G;  4POG A;  5FLM G;  4PZ7 A;  4JI7 L;  4LF6 L;  1VQM A;  2E2I H;  3STB C;  1ASZ A;  1I6H H;  1VCI A;  1N32 Q;  3KDF B;  2ID0 A;  4A3G G;  1Q1B A;  2E8G A;  4MTN A;  1MIU A;  4EX5 A;  4LUV A;  4OWT B;  1XPU A;  3ULP A;  4DV3 L;  4DV7 L;  4GKJ L;  3T1Y L;  1UE1 A;  1HNW L;  1PH6 A;  3AEV A;  4UP9 A;  2ZM6 L;  3CCU A;  4R1J A;  1I94 L;  1GD7 A;  2UXD Q;  1VQJ A;  1VQ4 A;  4OWX B;  4PG3 A;  3NBH B;  1OXS C;  1PV4 A;  5M5W H;  2ZJQ A;  1FL0 A;  1X65 A;  3HOY H;  4GKK L;  3ER0 A;  2CQO A;  3PUZ A;  2ZTE A;  4Y52 H;  3S2D H;  4YWM A;  3RLF A;  1YVC A;  5HY6 A;  5JEA G;  1Y1W H;  1IBK L;  3OYY A;  3J81 j;  1SRU A;  1TWC H;  1IBL Q;  4BA2 I;  4YY3 Q;  1QVC A;  3I55 A;  3I4M H;  2N49 A;  4GOP B;  3H3V H;  2K50 A;  4JI5 L;  1SRO A;  4DV2 Q;  2UU9 Q;  2HT1 A;  4B3R Q;  2AKW B;  4Y7N H;  4R4Q A;  5IYB H;  1XJV A;  3UDX A;  4P72 A;  1K0R A;  3HOY G;  3S1N H;  4IFD G;  3PO2 G;  3W1G A;  3PO3 G;  2R7F A;  4GNX C;  1YHA A;  2K75 A;  3AQQ A;  1Y1W G;  1N9W A;  1YEZ A;  1OXV A;  1M90 C;  4HIM A;  4A3F H;  3B6Y A;  3I4M G;  1SE8 A;  4A3J G;  2WB1 G;  4JBJ A;  1PHJ A;  2YU9 H;  3IRB A;  4B3S Q;  4LUO A;  4JI0 L;  3Q8D A;  1Q8K A;  2NZO A;  1E7Z A;  5IYB G;  4NXM L;  2CWA A;  1PYS B;  3ZJY C;  4JBM A;  1PH2 A;  1CKO A;  2B29 A;  2Q2I A;  4JI7 Q;  1O7I A;  1QVG A;  4LF6 Q;  4IJH A;  3PUY A;  3FHW A;  1D7Q A;  4A3F G;  2EQS A;  4GLA C;  1U5K A;  3CD6 A;  3S1M H;  3PUX A;  1AE2 A;  1P8L A;  2F3I A;  4H02 A;  4IPH A;  4LFA L;  4DV5 L;  1EIY B;  3TEH B;  2UXC L;  1TWF H;  1B8A A;  4DV3 Q;  4DV7 Q;  1JE5 A;  3TQY A;  1HZB A;  3F2C A;  4JI1 Q;  1X56 A;  1PH3 A;  1HNW Q;  1AH9 A;  2JA5 H;  2ZM6 Q;  4P74 A;  2PQA A;  4R4O A;  1I94 Q;  4AYB E;  4J15 A;  4IFD I;  1EQR A;  1YBY A;  4DUZ Q;  4DR5 L;  3M85 A;  4HJA A;  3KFU A;  1GKH A;  1KC8 C;  3F8T A;  4LFC L;  3A5Z B;  4A3M H;  1QZH A;  1X3G A;  2LXJ A;  2UUB L;  4WJ4 A;  4KHP L;  2LXK A;  1OXX K;  4GOP C;  1Y14 B;  1IBK Q;  2IY5 B;  1G6P A;  2CFM A;  4JI4 L;  4UP8 A;  1V43 A;  4DV1 Q;  3WWV A;  3H3V I;  4DR2 L;  4JI5 Q;  2VZA A;  2JA5 G;  1J6Q A;  1NMG A;  2Y0S E;  4BXX H;  3PIO A;  2IX0 A;  4AQY L;  3HOW H;  1PH4 A;  3S16 H;  2Z6K A;  2IHE A;  3BU2 A;  5LMU L;  3G4S A;  3G48 A;  1N36 L;  5GAD C;  2C35 B;  1JT8 A;  3KF8 B;  2VQF L;  3RN2 A;  2MO1 A;  4JI2 L;  3U4Z A;  1KIX A;  4BBR H;  1XMQ L;  2I5M X;  3PV0 A;  4PMW A;  4DUY Q;  4DR6 Q;  2K5V A;  4LW1 A;  4GNX A;  1HNZ L;  4DV0 L;  5C3E H;  3S2H H;  3CCR A;  2D62 A;  3EBE A;  3HKS A;  3RLN A;  4DV4 L;  3S1R H;  4K0K L;  1QVF A;  4P71 A;  4BXX G;  1PA6 A;  1IL2 A;  5ELN A;  4A3E H;  4JBW A;  2VW9 A;  3RN5 A;  4AH6 A;  3CCV A;  1OXU A;  4TQU S;  1M1K C;  1W3S A;  2OQK A;  4X66 Q;  1G51 A;  3FKI G;  5C0X J;  1H95 A;  4LF7 L;  4X62 L;  4YWK A;  3HOV G;  3H0G H;  4QQB X;  4KI0 A;  4BBR G;  4B3T L;  3TRZ A;  2ZJP A;  2HHH L;  4JOI C;  5C3E G;  1WI5 A;  2RCN A;  1KRS A;  2WAQ E;  1VQP A;  4O0A A;  3CF5 A;  1IZ6 A;  3CMA A;  4LFA Q;  4JYA L;  4DV5 Q;  1NJI C;  5IYD H;  3ERS X;  4OON A;  1CSP A;  2IHF A;  5GAH C;  5C44 H;  2DGY A;  2XTI A;  4A3E G;  1C7Y A;  1KAW A;  4OWW B;  2UXB Q;  3L7Z C;  1Y1V G;  2LSS A;  1JJC B;  2ALY B;  3H0G G;  4QJF A;  1BVS A;  3J7A 5;  3KF6 A;  1WJJ A;  1U0L A;  2HIV A;  2NZH A;  5GQO A;  1L1O A;  3KJP A;  1YJ9 A;  1VQ9 A;  2K52 A;  4DKA C;  3U50 C;  4LFC Q;  3GTK H;  2CWP A;  4XIG S;  4DV6 Q;  2Q2T A;  2UUB Q;  1XNQ L;  5IYD G;  1RIP A;  2K5N A;  3PUV A;  1I5F A;  1L2F A;  4LF9 L;  5C44 G;  4X65 L;  3CCJ A;  3CPW A;  4DR2 Q;  1QUQ B;  3NEM A;  2F4V L;  1E24 A;  1XMO L;  3MXN B;  1Q81 C;  3I4O A;  2V1C C;  4JC0 A;  5JJI A;  1Q12 A;  1MJE A;  5BR8 L;  3G6E A;  3PO2 H;  1N36 Q;  4PZ6 A;  4JV5 Q;  4LFB L;  1SFO H;  3PO3 H;  2VQF Q;  4NXN L;  1S72 A;  2OWO A;  3S1Q H;  2BH2 A;  4JI2 Q;  1PH7 A;  2KEN A;  3UDG A;  2OQ0 A;  1HR0 L;  2PI2 A;  5FLX c;  1N33 L;  1CKN A;  1VQE A;  4B3M L;  5LMN L;  3GD7 A;  1BBW A;  4A3J H;  1NMF A;  2VY3 A;  1VQG A;  1VQ8 A;  4DPG A;  1OXT A;  4OO1 G;  2NN6 I;  1S3O A;  3CC7 A;  1J5E Q;  2N3S A;  4YWL A;  4X64 L;  5JJK A;  2R7Z H;  1EIF A;  3J81 i;  4MZ9 A;  4LF7 Q;  4X62 Q;  2JEB I; 
#chains in the Genus database with same CATH topology
 4G7H C;  3M7G A;  1A8V A;  3E0J A;  4RFB A;  4XTC S;  3QOJ A;  3M3Y H;  1Z7T A;  3RLO A;  1CSQ A;  2ZTC A;  1NY4 A;  3ND8 A;  1B3A A;  2R7Z G;  1LTB D;  2HCI A;  1G91 A;  1RTN A;  2VQE L;  1TWH B;  2KCM A;  4BY1 G;  1EFI D;  1ONL A;  1XTC D;  2L55 A;  1DGS A;  3M7N A;  4R8N A;  5ELO A;  2XNA C;  1U9R A;  4F8M A;  3I8Z A;  2E74 C;  5FJ8 H;  3NEL A;  3BYY B;  2MGS A;  1JJ2 A;  4TSS A;  4NXN Q;  1A3U A;  4L8J A;  2MNA A;  3KLS X;  1MSG A;  3R2T A;  1YHB A;  4DK1 A;  5M5Y B;  2M9V A;  1TU2 B;  1VQB A;  4DK3 C;  1GHJ A;  1PTO H;  2K5D A;  4FF4 A;  1RL2 A;  4X64 Q;  4LF8 L;  5M3F G;  2E75 C;  1SXT A;  3CCS A;  2XGT A;  3FKI H;  2JA7 G;  4BA1 I;  1PZK D;  2NVY B;  2EOT A;  1E22 A;  1E3P A;  4IAL A;  2A69 C;  1DYQ A;  4BBS B;  4RGM A;  2J4X A;  2N55 A;  2E2J H;  3FRP B;  4K8I A;  4K5W A;  3VR4 A;  4EVO A;  1DON A;  3I91 A;  4DR4 L;  2K28 A;  1YIJ A;  3GV6 A;  2R92 B;  2VQE Q;  1H9M A;  3R2I A;  1SNQ A;  3CAM A;  2XSC A;  1NE3 A;  4IUP A;  1WD0 A;  4RCO A;  1QOH A;  4EQP A;  3DWQ A;  2F52 A;  1DJR D;  2NN6 G;  4YY3 L;  1NR2 A;  2E2D C;  3UE1 A;  3V2T A;  1FVI A;  3BZC A;  2RHS B;  4A3G B;  3KYH C;  1HNX L;  2QDB A;  4RKB A;  1H9R A;  2JN4 A;  2YTX A;  1IKL A;  2JYO A;  4CBV A;  1VQO A;  1K3R A;  1FGB D;  5M3M G;  2JA8 G;  3ICE A;  1EY6 A;  4DAY B;  1VQL A;  1VQ5 A;  2AUJ D;  5GAG C;  2RBM A;  4E6I A;  5I2X A;  2A19 A;  1U4P A;  4LF8 Q;  1ZXT A;  2AQ2 B;  2F0F A;  2PO4 A;  4XQJ A;  1KHI A;  1UE7 A;  3M9B A;  2C5C A;  1A2U A;  1E2Z A;  3HOU G;  5I9P A;  1BCP B;  4RHR A;  2QCP X;  1YNN D;  1ET6 A;  1QJO A;  2MP1 A;  4QUC A;  4ALP A;  1HNZ Q;  2ICI A;  2RHQ B;  1SND A;  5M5W B;  1HR0 W;  1HZ9 A;  3TZD A;  5C4H A;  1Q82 C;  4K0K Q;  4KN4 C;  1EYA A;  1LT3 D;  1BKB A;  4PNY A;  2N78 A;  4JI1 L;  2CVR A;  4DR4 Q;  1ET9 A;  3OW2 A;  3NHH A;  1F2Y A;  1L1O B;  4EQ5 A;  5IYC G;  4B3T Q;  4FO2 A;  3K8A A;  2HQL A;  3G7L A;  1VQN A;  3BYT B;  5IGD A;  3J81 c;  4JI6 L;  3U4V A;  1GUT A;  1TVX A;  4A3L G;  4I65 A;  1BDO A;  4DK6 C;  4LF5 L;  2OF1 A;  1HA5 A;  2JK8 A;  3L0O A;  3SK6 A;  2Z6K C;  3BJU A;  2ZXO A;  3GP7 A;  2NB0 A;  4DNT B;  1HNX Q;  1X55 A;  2TMP A;  1CA6 A;  2H5X A;  1KRT A;  5E1F A;  1PFN A;  3HG9 A;  2IL8 A;  5C0X H;  2PMZ E;  1TS3 A;  2F0P A;  3SK5 A;  3HRZ C;  1CKN B;  2RKS A;  3ONA B;  1SYC A;  5E4W C;  3J80 c;  1F2M A;  4GN4 B;  1ENA A;  1KL9 A;  3J80 E;  1EFW A;  4HN7 A;  1WD1 A;  1AFP A;  1B44 D;  1TWH H;  4NPS A;  4A3K G;  4QF4 A;  2KOL A;  2D9U A;  3H94 A;  3H09 A;  1HPC A;  1YIT A;  2BA1 A;  1TWF B;  4NDX A;  1BCP C;  1K8G A;  4ME3 A;  3HOZ G;  5CYU A;  1HZA A;  3NQT A;  1D8L A;  3TP8 A;  3Q0A A;  4HJ7 A;  1G8Z D;  1KDA A;  1KXL A;  3KJO A;  1IW7 C;  1LV9 A;  2IT1 A;  2DN8 A;  3NWT A;  2FXQ A;  1QZG A;  2D0O A;  3EIV A;  4FYD A;  1KDB A;  1S5C D;  1EUJ A;  1H9J A;  4IPD A;  2UXB L;  4IPC A;  4JPB W;  1L1O C;  4B08 A;  4IJL A;  4RAU C;  2F0L A;  5M5Y H;  4QY7 A;  3HOW B;  4U67 3;  1RJT A;  5EBC A;  4JI6 Q;  3FP9 A;  4BWG B;  1PLF A;  4LF5 Q;  3VYS A;  4BBR B;  2Z0S A;  2FJ2 A;  2NVY H;  4QCL A;  1EOT A;  5C3E B;  3K5N A;  3PMF A;  1JWU D;  3S1R B;  3F1Z A;  5IIF A;  4BBS H;  4K2K A;  1JMC A;  4POF A;  1U4R A;  1Y8O B;  1QIL A;  1PH1 A;  2R92 H;  3ULJ A;  4XQQ A;  1SMY C;  3MXN A;  1CUK A;  3TDQ A;  3MFG A;  4GN3 B;  5C44 B;  1FNV A;  3CPF A;  5E4X A;  1K3B C;  1MJC A;  1Q7Y C;  2AQ3 B;  4A3G H;  2IX1 A;  2IWH A;  2E5L L;  2I5L X;  2B8G A;  2SEB D;  2KCT A;  1VS0 A;  2V4D A;  1GXD C;  2MFI A;  2WAQ G;  3RD4 A;  1LO5 D;  2VXW A;  3Q24 A;  1VCI A;  3KDF B;  4XXE A;  2ID0 A;  3NSW A;  4ZUI A;  1EQT A;  2F0W A;  4OWT B;  3OIP A;  1XPU A;  1CZW A;  3T1Y L;  1HNW L;  1PH6 A;  4HMI A;  3TP5 A;  1KTK A;  1VQJ A;  1DOL A;  4IUV A;  1D6E C;  1PRT D;  3CKI B;  5M5W H;  1NSN S;  4CKB A;  2L0C A;  1SYF A;  1Z6H A;  3RLF A;  2R3Z A;  4YIJ A;  1U4M A;  1TWC H;  2ZXR A;  5FLX E;  4ZLT F;  1QVC A;  4RGT A;  4JI5 L;  1SRO A;  4J1M A;  3LWU A;  1IYU A;  2KVM A;  4CDD C;  3K5O A;  1SNO A;  5IOC A;  1PRT F;  5I4D A;  2VUM B;  5ELC A;  1L0Y B;  5FLX L;  1I4G A;  1LAB A;  3T56 B;  4HIM A;  5FOB B;  2WII B;  1O7L A;  1WCM B;  4A3J G;  3IRB A;  2ZT9 C;  4LUO A;  4JI0 L;  3Q8D A;  2Z4H A;  1Q8K A;  2NZO A;  4IUN A;  5IGC A;  3Q22 A;  1O7I A;  4XYO A;  3QR8 A;  3GTG B;  1K28 A;  3FHW A;  1G6Z A;  5CV6 A;  4A3F G;  3K5M A;  1STG A;  1G2S A;  2B2T C;  3PUX A;  1I6V C;  1AE2 A;  3GTO B;  4H02 A;  5C4X B;  4H13 C;  2I07 B;  4DV5 L;  1SDF A;  1TWF H;  1PH3 A;  1HNW Q;  2Z9H A;  4FNF A;  1Q90 A;  4B9X A;  4DK0 A;  5C3X A;  4J15 A;  4CDF C;  1CFM A;  4KD4 A;  1Q3L A;  4EGV A;  3F8T A;  5DM7 3;  3GTQ B;  2UUB L;  1OXX K;  4JI4 L;  1FNW A;  4ULL A;  2DNE A;  2BCO A;  4JI5 Q;  2JA5 G;  1NMG A;  2Y0S E;  4BXX H;  3HOW H;  1PH4 A;  1IKM A;  4FP5 D;  1FYC A;  3N52 A;  3G4S A;  1N36 L;  4MHE A;  2VQF L;  3RN2 A;  4JI2 L;  1BR9 A;  4BBR H;  1Y1V B;  1YNJ C;  4GNX A;  4DV0 L;  5C3E H;  1D5X C;  3NXW A;  4Q0F A;  4C3H B;  3FPP A;  3S1R H;  3BDC A;  1UEA B;  1GJX A;  1TWA B;  3MHB A;  1IL2 A;  4KHV A;  2L5T A;  1A15 A;  4JBW A;  4X66 Q;  3FKI G;  1H95 A;  5M5X B;  4X62 L;  4QQB X;  5CGK A;  3CRK C;  3TRZ A;  2HHH L;  2E2H B;  4JOI C;  2LKV A;  1WI5 A;  1VQP A;  3CMA A;  4DV5 Q;  2IHF A;  5C44 H;  2DGY A;  1GUN A;  3MWY W;  1KAW A;  2F0Q A;  3L7Z C;  5JPM C;  3R8B A;  2P5Z X;  4QJF A;  1QWY A;  1WTH A;  1RHP A;  3KF6 A;  2HIV A;  1R4Q B;  2XIW A;  5GQO A;  3KJP A;  2K52 A;  5IGB A;  4DV6 Q;  3QJY A;  5FK9 C;  2UUB Q;  1RIP A;  1I5F A;  3BS1 A;  4A3B B;  2G9H D;  1EWC A;  3SK8 A;  1A2T A;  2F4V L;  1LT5 D;  4OO1 H;  4BY7 B;  1I50 B;  4A93 B;  2V1C C;  4A3I B;  1MJE A;  5BR8 L;  1N36 Q;  3MVV A;  1QNK A;  4K14 A;  2VQF Q;  1D5Z C;  1JWM D;  3OSO A;  4JI2 Q;  4K5X A;  4M8A A;  4B3M L;  5LMN L;  1BBW A;  1NMF A;  1VQ8 A;  1VQG A;  5DM6 3;  1OXT A;  2HUG A;  3CC7 A;  1J5E Q;  2ICE C;  5JJK A;  5CV9 A;  4MZ9 A;  2KEE A;  1M8A A;  3RMH A;  4X62 Q;  3I4N B;  1EY0 A;  2F4I A;  2K6A A;  3J7Y W;  4ID6 A;  3A8J E;  1JOK A;  2JSO A;  4G4K A;  1R9T B;  3JC6 6;  3K80 C;  2H4O A;  5EKL A;  2IW3 A;  4A3D B;  4U68 A;  2VUM H;  2B8F A;  1EZ6 A;  1UE6 A;  3HKZ B;  4C2M B;  2ATW A;  1TS4 A;  1K8A C;  4JCV E;  3CP0 A;  1WCM H;  4FXK C;  1VQ6 A;  1TR5 A;  1J9O A;  5ELB A;  3H6M A;  4R4I A;  1YJN A;  3I90 A;  3HOV B;  5TSS A;  3I7F A;  5IT9 L;  1CA5 A;  4DA2 A;  2F4V Q;  1GVP A;  5IWA L;  3GTG H;  4ODG A;  1STY A;  1F2Z A;  3GDE A;  1DOM A;  5IP9 H;  1EWH A;  1GM5 A;  4ME5 A;  4AYB B;  3GTO H;  4GLV B;  4GKK Q;  1SE3 A;  5C4X H;  3OPO A;  4LF4 L;  4KY6 A;  5JEA J;  4XT3 B;  2OTL A;  1G29 1;  3BDL A;  1FGU A;  1QB5 D;  4B3M Q;  5IP7 G;  1IYJ B;  4F88 A;  5LMN Q;  4J8Q A;  4XT1 B;  3OW7 A;  4DAM A;  2JP1 A;  2FIN B;  4CJ1 B;  3GTQ H;  3TRE A;  1L0W A;  4FF3 A;  1BBX C;  3AYH B;  2L15 A;  1A3T A;  4HMJ A;  1CM9 A;  3GTJ B;  4QL5 A;  1KAA A;  2CKZ B;  4L5T A;  1MKH A;  4DU9 A;  2RDF A;  4A75 A;  2VS1 A;  5KYL A;  4NXM Q;  1WVL A;  5COR A;  1AP0 A;  1XX8 A;  4V0B A;  3DUZ A;  3U58 A;  1Y1V H;  1JOQ A;  1ICF B;  2B63 G;  3MEH A;  1C48 A;  4C3H H;  2NVT B;  1T9H A;  1PFM A;  1TWA H;  3W5O A;  5K36 G;  1ML0 D;  3VA5 A;  4DR7 L;  5FKA C;  2JA6 G;  2Y0S G;  3MAQ A;  3ERQ A;  5M5X H;  4DV2 L;  4B3R L;  3PF5 A;  2HDL A;  5IWA Q;  1N34 L;  2E2H H;  2AHO B;  3AMU A;  1X9N A;  5EPJ A;  2B3G A;  3SEB A;  4DR5 Q;  4K8J A;  1SE2 A;  2B2Y C;  5JPN C;  4LF4 Q;  3A0J A;  2D2C C;  3FPU B;  4KHP Q;  5KNB A;  4JBK A;  3P20 A;  1I4R A;  1HFN A;  3IFT A;  2A5H A;  5FO9 B;  2FHT A;  3GO5 A;  2KJX A;  4GOP A;  4QMG A;  3A8I E;  1VQH A;  1C0A A;  2EPB A;  1GUW A;  2EY5 A;  4AQY Q;  1NTG A;  4HTH A;  3QWN A;  4A3B H;  3K0X A;  3STB D;  1XMQ Q;  4KKT A;  4HIK A;  4NP5 A;  3CW2 C;  2EIF A;  5DEH A;  4BY7 H;  1I50 H;  4A93 H;  1SEB D;  4DV4 Q;  2B2W C;  2Q2U A;  4A3I H;  1GHK A;  1C4Q A;  3TBI B;  3C46 A;  4FXD A;  4XQN A;  4UPA A;  2PCF B;  1W2B A;  1Y1W B;  3Q6S A;  1S4Z A;  3I4M B;  1VQF A;  1T5E A;  4IOA A;  4X3T A;  2I5H A;  5K5P A;  3FMC A;  3U9S A;  2A8V A;  4KJN A;  1Q1E A;  4DR7 Q;  3AFP A;  1UE5 A;  3I4N H;  2YV5 A;  2CCZ A;  1N34 Q;  3ND9 A;  3MEF A;  1R9T H;  2H1E A;  1JC7 A;  1D1K A;  1VF7 A;  2AWN A;  3J80 i;  4A3D H;  1Z47 A;  4R8I A;  4C2M H;  4UDU C;  4DUY L;  1XNQ Q;  4DR6 L;  1QG7 A;  5CMD A;  3OOC A;  4X65 Q;  3CC2 A;  1F9S A;  4PZ8 A;  1PFS A;  3UI2 A;  1JB7 A;  4L5R C;  2O4X A;  1SNP A;  1B70 B;  3S1M B;  1XPO A;  4A3C H;  3L9A X;  1ICW A;  3RUZ A;  2GN5 A;  4KY5 A;  3I56 A;  2MO0 A;  2F0O A;  3HOV H;  5NUC A;  4KY7 A;  5CR3 A;  1A0I A;  2GVA A;  4HID A;  2D0P A;  1PH9 A;  1NBW A;  1SBB B;  2UUC L;  1WFQ A;  3H3V C;  1E1O A;  4OGQ C;  2XRS D;  2OT2 A;  5JJL A;  1RD9 D;  1Y8P B;  1N32 L;  1IL8 A;  3P7J A;  5L37 A;  5G3L D;  3S16 B;  2FMM A;  3A74 A;  5T1I A;  4N8X 1;  2AWO A;  3A55 A;  2C9O A;  1TT2 A;  1ENC A;  3H91 A;  2R93 G;  1YJW A;  3S2H B;  3GTJ H;  1YI2 A;  4JV5 L;  1EQV A;  1IHZ A;  2EYO A;  5G3L F;  2R61 A;  1S5F D;  1RTO A;  3F2D A;  2A68 D;  4C3J G;  4AIM A;  3H0G B;  4OHJ A;  2PW5 A;  5EKI A;  3A7L A;  3G6J B;  3KBX A;  5CBE E;  4OEL B;  1QUQ A;  2SOB A;  3HOW G;  3H15 A;  2NVT H;  3AFQ A;  1PVO A;  1MSH A;  3M4Q A;  2BDO A;  3DM1 A;  2L4N A;  1Z9F A;  4KTA A;  3HOX G;  4IO9 A;  2OTJ A;  4KK7 A;  1H9S A;  3D31 A;  1EWI A;  2UUC Q;  1DOK A;  4DNI A;  3GTK B;  4XDX A;  2ZJR A;  3RNU A;  2EY6 A;  5FLM G;  1VQM A;  1JCK B;  1N32 Q;  5IOD A;  2X69 A;  4MTN A;  1MIU A;  1CHQ D;  2GA4 B;  3PO2 B;  2PZU A;  1EIH A;  3PO3 B;  3S1Q B;  1MI2 A;  3K0Y A;  2K01 A;  4DV7 L;  4GKJ L;  1UE1 A;  4MIU A;  4ZYS A;  3AEV A;  2EYJ A;  2ZM6 L;  1TWC B;  5CV7 A;  1SYE A;  3M4Y A;  3TP7 A;  1VQ4 A;  4PG3 A;  1PV4 A;  1OXS C;  2ZJQ A;  4IFD H;  1X65 A;  3ER0 A;  4EQN A;  5JEA G;  1Y1W H;  1IBK L;  2R7Z B;  3J81 j;  1AW7 A;  4FF2 A;  4YY3 Q;  3I55 A;  3I4M H;  2N49 A;  3H3V H;  2K50 A;  1NUC A;  1LLR D;  5IYB H;  1XJV A;  3HOY G;  4P72 A;  1KAB A;  3M4O B;  1K83 B;  5KGU A;  4IZ8 A;  1A3V A;  1YHA A;  3CU7 A;  3AQQ A;  5D65 A;  1AZQ A;  1M90 C;  4WJW A;  5BN4 A;  1EY8 A;  4KN7 C;  3B6Y A;  1PMR A;  5D3D A;  4RA8 A;  4JBJ A;  1JB3 A;  1PHJ A;  2F0T A;  1MHW C;  2F0N A;  3ZYY X;  5C3W A;  1PYS B;  1STB A;  2BOS A;  3ZJY C;  2RQX A;  4N9P A;  3R3O A;  5C4Z A;  4PQX A;  3R93 A;  5KYI A;  2B29 A;  1QVG A;  2F03 A;  3FEW X;  1B4O A;  4IJH A;  1D7Q A;  1FNU A;  1NCV A;  1W6J A;  1U5K A;  4GLA C;  3S1M H;  4FXG C;  4CJ0 B;  2F3I A;  4IPH A;  5M3F B;  2QEJ C;  1EIY B;  1V1O A;  3TEH B;  2JA7 B;  4DV7 Q;  3TQY A;  3L3O C;  4JI1 Q;  1RKN A;  2ZM6 Q;  2PQA A;  4H7B A;  5JVH 3;  4AYB E;  4BS9 A;  1EIG A;  3M85 A;  4HJA A;  3KFU A;  2K7V A;  1X3G A;  2LXK A;  1BXT A;  1PYW D;  1IBK Q;  2IY5 B;  1G6P A;  1V43 A;  3OWE B;  1TS2 A;  4DR2 L;  1DM0 B;  2WIN B;  2K33 A;  3S16 H;  4QUF A;  5LMU L;  3BU2 A;  1SSO A;  5AFW A;  5GAD C;  1E2W A;  2CH4 A;  3U4Z A;  3HGB A;  4RGO S;  4PMW A;  3S2H H;  5BN5 A;  3GTL B;  3CCR A;  4DXF A;  2A69 D;  4H44 C;  1B3Q A;  3HKS A;  2PQE A;  2KQ3 A;  2B2V A;  2K05 A;  3RN5 A;  5M3M B;  3CCV A;  2JA8 B;  4TQU S;  1G51 A;  5C0X J;  3H0G H;  4I7Z C;  3A54 A;  4C1N I;  3T4A C;  4ZKB B;  4IUT A;  4A3E G;  3HOU B;  3CQZ B;  4OWW B;  1EY5 A;  2UXB Q;  1STN A;  1Y1V G;  2XWB B;  1JJC B;  3J7A 5;  4C3H G;  2OEO A;  1XXG A;  5A35 A;  1YJ9 A;  2NZH A;  1VQ9 A;  3GTK H;  3W3A A;  2K03 A;  4XIG S;  2Q2T A;  3IKJ A;  2OXP A;  5IYD G;  4RGN A;  1WTX A;  2RDG A;  4PMC A;  2SNM A;  4DR2 Q;  4X3K A;  1XMO L;  3MXN B;  2G9D A;  3PO2 H;  1Q8I A;  5EQ0 A;  4LFB L;  2L12 A;  3PO3 H;  3S1Q H;  1C8C A;  1RCV D;  2KED A;  2OQ0 A;  1STE A;  3UDG A;  1HR0 L;  5FLX c;  2K5W A;  2PYK A;  1VQE A;  2EY2 A;  1S5D D;  3C3L A;  5CV5 A;  2NTS A;  1S3O A;  1F9Q A;  1JQY D;  3P75 A;  2R7Z H;  2NTT A;  1HUN A;  1V1P A;  4TKO B;  4A3K B;  1X32 A;  5LHY 1;  4A93 G;  1EEF D;  2AQ1 B;  1L0X B;  4OX9 L;  2E5L Q;  4YHH L;  3M4O H;  1K83 H;  5I2Y A;  2NVX B;  3LNN A;  4O2D A;  3SDZ A;  3HOZ B;  1Y8N B;  1SYD A;  2LY7 A;  2SDF A;  1HA6 A;  3NEN A;  2GVB A;  2K32 A;  2QDL A;  2RSO A;  2B2U A;  1EU4 A;  3K5L A;  1IYV A;  4RMF A;  5ISR A;  1LTR D;  2X6L A;  1LUZ A;  4XYQ A;  3MZ5 A;  5A2Q E;  3J7A F;  1I3Q B;  3T1Y Q;  3BDO A;  2F1M A;  4IN3 A;  1WTO A;  2UUA L;  1XMO Q;  1M4V A;  3K6O A;  4CKC A;  4GN5 A;  4ZCK A;  5A2Q L;  5M3F H;  1LAC A;  2LS0 1;  4LFB Q;  1BCP D;  3TN2 A;  2JA7 H;  2Q2H A;  3RZD B;  3DLL A;  4HSP A;  1HR0 Q;  4QGU A;  4MNO A;  1IW7 D;  3JAM c;  3JAM E;  1DXM A;  2JE6 I;  2XN9 C;  3K57 A;  5AJ3 L;  2RVL A;  2JJQ A;  5FJ8 G;  4X6A H;  1EQQ A;  3K7U C;  4KKS A;  3URY A;  4IOC A;  3KLW A;  3HOV G;  2KBN A;  1BCP F;  3MA2 B;  4CGY B;  1K73 C;  3JAM L;  2BA0 A;  3VYR A;  4IUQ A;  2ENB A;  2RSN A;  4OX9 Q;  3L2P A;  4YHH Q;  4JI0 Q;  2NN6 H;  2B39 A;  3QB3 A;  2YYZ A;  3GTL H;  1X3F A;  4ILW A;  2WFW A;  4DXG A;  4EQO A;  2F0E A;  1O7Z A;  4DR1 L;  3OTO L;  2EXD A;  5H1S E;  5HGT A;  2PZT A;  5M3M H;  3I3C A;  2JA8 H;  2WAQ B;  2FMC A;  5CBA E;  1VDZ A;  3OMG A;  4JG2 A;  2UUA Q;  2O2L D;  3K59 A;  1SMY D;  1FD7 D;  4R4T A;  1T5X D;  3NBH A;  3NTK A;  4DN4 M;  4DF7 A;  1UNS A;  3HOU H;  1PFB A;  4L5Q A;  3CQZ H;  5T1G A;  4GNX B;  2K14 A;  1CQF A;  1V1Q A;  4JI4 Q;  1TY2 A;  2E2I B;  4JK1 C;  1I6H B;  4F7X A;  5AJ3 Q;  4KHZ A;  3G71 A;  1LM0 A;  1SMX A;  1BBU A;  1GO3 E;  2CH4 W;  2F0S A;  2HDM A;  2OCE A;  2Z8L A;  1N8R C;  1LTA D;  3TS2 A;  5IYC H;  1E2V A;  1VQD A;  4DV0 Q;  1JJG A;  4QB4 A;  4A3L H;  2PZW A;  1SAP A;  1KNA A;  3PUW A;  1XPR A;  1HHV A;  3BZK A;  2K5Q A;  3KF6 B;  4P75 A;  4DUZ L;  4Y7N B;  3CME A;  4HJ9 A;  2HHH Q;  4DR1 Q;  3DWP A;  3OTO Q;  3DM3 A;  3LGJ A;  1S40 A;  5GAE C;  5EPK A;  4DV1 L;  1FR3 A;  1P16 A;  4A3F B;  5IT9 c;  1LYL A;  4A3K H;  5IT9 E;  4X3S A;  3PCO B;  2PI2 E;  3WDN A;  4ABN A;  2NVX H;  4GS3 A;  2X6G A;  2AUK A;  1SYG A;  3TME A;  3HOZ H;  1TKW B;  1RDP D;  2PMZ B;  2WP8 J;  3UDI A;  2DJG C;  2DUD A;  3NTI A;  1X54 A;  3MTS A;  4P73 A;  4RH6 A;  3NBI A;  2WKD A;  2I46 A;  3NK9 A;  5JAV A;  3E6Z X;  4TVA B;  2R6G A;  4IPG A;  5IGG A;  1I3Q H;  5BR8 Q;  1STH A;  2NZ1 D;  5C0X G;  4KLK A;  3KF8 A;  3T1H L;  2JA5 B;  1B53 A;  2IJ0 A;  2VL6 A;  1EL0 A;  3TS0 A;  5I9O A;  1JR0 D;  3FDT A;  3I72 A;  4A3M B;  1ZEQ X;  4YCW A;  3RZD H;  1PDQ A;  3I2Z A;  1YNX A;  5JOB A;  1CTM A;  1WTQ A;  4A4I A;  2KUM A;  4RG1 A;  4QIW B;  1HH2 P;  5C5L A;  3W2D A;  1TII D;  1XWE A;  1AE3 A;  1CHP D;  2L1B A;  1EZ8 A;  3UE0 A;  3W1B A;  5J22 A;  3C1F A;  1HFG A;  4HJ8 A;  1CKM A;  4MTK A;  2KHS A;  2K5H A;  3EVQ A;  3ULL A;  1DCZ A;  5C0X I;  5EJW A;  1KLG D;  3DMU A;  1HCZ A;  3VR3 A;  1IBL L;  2JA9 A;  1CI3 M;  2MUY A;  5EAY A;  1SJE D;  2M2L A;  2A6E D;  3PQI A;  4MN3 A;  3F2B A;  3D0F A;  4BBS G;  5LL6 S;  1Q86 C;  1V9P A;  1VQA A;  4K6L A;  3NPP A;  3T1H Q;  3V05 A;  3S24 A;  3DXJ C;  3F2U A;  2R92 G;  5I6W A;  2R7D A;  4HJ5 A;  2N8N A;  1Q46 A;  4ZK9 B;  5HGQ A;  2QA4 A;  5IGE A;  1JE4 A;  1H9K A;  4FVM A;  4PZ7 A;  4JI7 L;  2FFK B;  1QE6 A;  4IUU A;  2E2I H;  5J1Z A;  1ASZ A;  1YNN C;  2LMC B;  1HXY D;  1I6H H;  4M1U B;  4A3G G;  4K5V A;  4EX5 A;  3KBG A;  4LUV A;  3Q23 A;  2SNS A;  3D4R A;  5LL6 X;  4DV3 L;  2L11 A;  1KNE A;  4O1N A;  1I94 L;  1GD7 A;  4Q5V A;  1V8Q A;  4OWX B;  2WB1 B;  1AZP A;  4GZY C;  1O78 A;  2KCN A;  4Y52 H;  4YWM A;  1YVC A;  1EEI D;  3C2P A;  4OIK A;  3AB9 A;  1IBL Q;  4PMB A;  4GOP B;  4DV2 Q;  2HT1 A;  4ZQ3 A;  4B3R Q;  2AKW B;  4Y7N H;  4R4Q A;  3GQB A;  3UDX A;  3PO2 G;  3W1G A;  1B1Z A;  3PO3 G;  2R7F A;  3LX0 A;  1OXV A;  3OWF A;  3I73 A;  4R9W A;  4HCS A;  4A3F H;  5ELE A;  1PZI D;  1EYC A;  2EYP A;  2F0M A;  2XVS A;  3RZO B;  3CHB D;  1EY4 A;  2CWA A;  4JBM A;  4B9W A;  1ZYR D;  4JI7 Q;  1X3Q A;  1B9M A;  1Y69 U;  3PUY A;  1S5E D;  3D4W A;  3A7A B;  4WOR A;  4LFA L;  3EFX D;  4DNR B;  3S14 B;  4DV3 Q;  1JE5 A;  3F2C A;  1SYB A;  1X56 A;  2BE5 D;  2JA5 H;  4P74 A;  1I94 Q;  1LTI D;  1YBY A;  4LK1 C;  1GKH A;  3N6R A;  4LFC L;  4A3M H;  3KLS A;  1QZH A;  4GOP C;  3S9W A;  2MPM A;  2CFM A;  2B63 B;  2VB2 X;  2VZA A;  3BVG A;  1TS5 A;  3IL8 A;  1BNZ A;  2RA4 A;  3PIO A;  2IX0 A;  2F0U A;  2JA6 B;  2Y0S B;  2Z6K A;  3G48 A;  1PRT B;  5FO8 B;  1EY7 A;  3QG1 A;  1KIX A;  2F3V A;  4DUY Q;  3PV0 A;  4DR6 Q;  4LW1 A;  1HNZ L;  1GOZ A;  4DAY A;  2D62 A;  3EBE A;  4K0K L;  1G2T A;  4P71 A;  2E76 C;  4BXX G;  5ELN A;  3S15 B;  1OXU A;  1M1K C;  1W3S A;  4LF7 L;  3VYU A;  4BBR G;  4B3T L;  5EPL A;  2ZJP A;  5C3E G;  3C1E A;  1HQR D;  2RCN A;  2WAQ E;  4O0A A;  3D3R A;  3CF5 A;  2EVB A;  4LFA Q;  3T51 B;  4JYA L;  3ERS X;  3HEJ A;  4OON A;  5GAH C;  1C7Y A;  2QIL A;  1DD2 A;  1WTR A;  2HCC A;  2LSS A;  4HED A;  2K04 A;  2ALY B;  1BVS A;  1PTO D;  1WJJ A;  1L1O A;  1BOS A;  4DKA C;  3U50 C;  4LFC Q;  1K8O A;  2CWP A;  4WRD A;  3X3M A;  5C4J B;  3S17 B;  2EZV A;  2K5N A;  1L2F A;  4LF9 L;  5C44 G;  3CCJ A;  4C3I B;  1GUO A;  1QUQ B;  3A56 A;  1Q81 C;  5JVG 3;  3I4O A;  4ZUJ A;  2CW0 D;  1PRT C;  2CHB D;  1GUS A;  4JC0 A;  1Q12 A;  1PTO F;  2F0V A;  2F0H A;  2RDH A;  2O5I C;  4JV5 Q;  2A6H D;  1PH7 A;  2KEN A;  5D3I B;  4RWS C;  2PI2 A;  4HCE A;  1H9S B;  1CKN A;  1S5B D;  1N33 L;  3SHL A;  3FVQ A;  3QOL A;  1MBY A;  4OO1 G;  2NN6 I;  4BY1 B;  1PXU A;  1DZ1 A;  3P1H A;  4YWL A;  3KK7 A;  2XWJ B;  1B50 A;  4LF7 Q;  2JEB I;  1TWG H;  3SR1 A;  4LJZ C;  2YTV A;  2PNH A;  1HTP A;  3J81 E;  3E0E A;  4F87 A;  3HKZ E;  4J6H A;  4JYA Q;  4LNQ A;  1JIC A;  3LWE A;  3MFY A;  5EKK A;  1KD1 C;  4ZRZ A;  3J81 L;  3PGZ A;  3KOJ A;  2F0J A;  2QEX A;  3RZO H;  4UY8 C;  3SE0 A;  1R4P B;  5I6Y A;  1EYG A;  4APV A;  4LF9 Q;  2VUM G;  1WOC A;  5IP7 H;  4GKJ Q;  3GTM B;  2EE1 A;  4JI3 L;  2WKC A;  4OO1 I;  1YHQ A;  1WCM G;  1D1I A;  1I4H A;  3TZU A;  2G5D A;  3JAM i;  1VQ7 A;  3S14 H;  3OMC A;  4Z9C B;  1KDC A;  2R93 B;  3J80 L;  1N33 Q;  4LUZ A;  5M9O A;  1K0S A;  4DAV A;  4OL7 A;  3U9O A;  2JQO A;  2QGQ A;  3CCE A;  1C9O A;  3VR6 A;  3UDF A;  1BQQ T;  4IFD J;  5FO7 B;  5F2D A;  5IP9 G;  1IXR A;  3KLR A;  2NUC A;  4OIJ A;  3EQL C;  4C3J B;  5C4X G;  1VQI A;  4PV1 C;  5JJZ A;  5COY A;  2B63 H;  4QIW E;  1WYD A;  4L63 B;  2NVQ B;  1X3E A;  4CDE C;  4TRD A;  2VB3 X;  4HSV A;  2IPK D;  2Q8T A;  5K36 H;  1K8M A;  2Q8R E;  1B7Y B;  2JA6 H;  2PNR C;  4RKL A;  3K7A B;  4UAI A;  1I4Q A;  4CJ2 C;  1HRJ A;  3HOX B;  2PQA B;  1NNX A;  2JXM B;  4KJO A;  1X6O A;  1ROD A;  3O13 A;  1HZC A;  1XYI A;  1NR4 A;  2AMC B;  3KDF A;  4LWC A;  2N88 A;  3CRL C;  3S15 H;  2EJM A;  4FDB A;  2B2T A;  5KIX A;  3BVZ A;  3PF4 A;  4CKE A;  5DLQ E;  3X3N A;  4YCV A;  2F0D A;  1FJG L;  4JI3 Q;  3NE5 B;  1A6X A;  2I0Q A;  3A5U A;  1PYB A;  3OHX C;  4OXP A;  1E1T A;  3PIO 3;  1KLU D;  1MD2 D;  4DR3 L;  4X3U A;  3GTP B;  3HZX A;  5E7N A;  5IY0 A;  5KRU A;  2DNC A;  1LTT D;  3DEP A;  2A1A A;  4N8F A;  2EJG C;  1LTS D;  2JEA I;  4C1N K;  1SN8 A;  2EYF A;  1ASY A;  3CC4 A;  3K81 C;  3MXU A;  3CCM A;  1UEB A;  4KD3 A;  5C4J H;  5LMU Q;  3S17 H;  2WV6 D;  4NB3 A;  1IBM L;  3QO2 A;  2QKI C;  4C3I H;  2VNU D;  2ES2 A;  1F77 A;  1UAP A;  5EBD A;  1SLJ A;  3HOY B;  1EY9 A;  2KEC A;  2YTY A;  2MJ8 A;  3SXH A;  3E9H A;  3VDY A;  3DEO A;  1I4X A;  1NAP A;  5LMN W;  3S2D B;  4G7O C;  3EN2 A;  2NWG A;  3NQI A;  2WB1 E;  2ZTD A;  1HQM C;  4A3B G;  4LMQ D;  1O80 A;  5D14 A;  2WAC A;  3NUC A;  1ESF A;  4R4C A;  4BY7 G;  4BY1 H;  1XNR L;  3S1N B;  4L5S A;  5J3B A;  4NMZ A;  4A3I G;  4KMU C;  4JOI A;  4IUR A;  4CHT B;  4H0L C;  3ITP A;  1A63 A;  3HFZ B;  1FJG Q;  1JWS D;  4JI8 L;  2YU9 B;  4IQZ A;  4YCU A;  2XRQ D;  2CQA A;  2F0G A;  1OTC A;  3SGI A;  4DR3 Q;  1PH8 A;  1A62 A;  2KHJ A;  2MQH A;  2B2V C;  4N9T A;  3I4N G;  1VQC A;  1ZKO A;  2QF7 A;  3TSS A;  1I4P A;  4JVZ A;  1EOV A;  1U4L A;  3CCQ A;  4X66 L;  3KUP A;  1V1P B;  4A3D G;  1BO0 A;  1IBM Q;  3OIQ A;  2A74 C;  3HKZ G;  1D5M C;  3E3X A;  3PSI A;  5IE8 A;  3GTM H;  4UP7 A;  1XTD A;  4OEM B;  3CCL A;  1VMC A;  3MC0 B;  4DGZ A;  1BUV T;  1HUM A;  1W6K A;  4HIO A;  2NYZ D;  1JOO A;  4A3C G;  1ENF A;  1QCB D;  2F3W A;  5GRO A;  2R93 H;  4WJ3 M;  5C6A A;  1PZJ D;  1HJP A;  4ZKC B;  3VR5 A;  1D2B A;  1II3 A;  1LTL A;  3M4P A;  1UWV A;  4DAP A;  4DV6 L;  3VA7 A;  4JW0 A;  1XNR Q;  2NBF A;  4KV6 A;  1VQK A;  4AYB G;  4C3J H;  4LAA A;  1K9M C;  3J7Z C;  2RF4 A;  1WTW A;  2NVQ H;  4A76 A;  2EYH A;  3IFD A;  4P2C B;  2UXD L;  1EU3 A;  1PH5 A;  4ZAI A;  4JI8 Q;  2ASB A;  3SK4 A;  3PIP A;  4A3E B;  4A3M G;  1CZG A;  3K7A H;  3CXC A;  3RR5 A;  4GLX A;  2F0I A;  3HOX H;  3NP8 A;  3I4L A;  4NW2 A;  1GUG A;  3QIA A;  2HD3 A;  1KQS A;  3NTH A;  2UU9 L;  2HQE A;  3TP6 A;  1RF2 D;  2A6E C;  2BH8 A;  2K4K A;  1J5E L;  2HIX A;  3ERO A;  2J7Z A;  3AU7 A;  1YZ6 A;  3I70 A;  5FLM H;  2Z4I A;  4NKL A;  1J8I A;  3BZD B;  2MHV A;  1SR3 A;  3WOE A;  1B2T A;  3E9I A;  2KHI A;  4B3S L;  1TXY A;  2B2U C;  4UHV A;  1E0B A;  4WFN 3;  3GTP H;  2L9H A;  1MGS A;  4POG A;  4LF6 L;  4G57 A;  3STB C;  2KA7 A;  1Q1B A;  2E8G A;  1VMP A;  1LT4 D;  1EYD A;  5ELD A;  5JEA H;  2EXZ A;  3EJI A;  1SFO B;  3ULP A;  2D5D A;  4UP9 A;  3T13 A;  3CCU A;  4R1J A;  2UXD Q;  5EGT A;  3DHQ A;  3NBH B;  3WOF A;  4A3J B;  3HOY H;  1FL0 A;  4GKK L;  2CQO A;  1VF5 C;  3PUZ A;  3D6W A;  2ZTE A;  3S2D H;  5HY6 A;  3OYY A;  5CV4 A;  1SRU A;  1WTV A;  4BA2 I;  1ILQ A;  3EA6 A;  1X3P A;  3V96 A;  2DJF C;  1SE4 A;  1CT1 D;  2UU9 Q;  1LTG D;  4CDC C;  1SNM A;  4HR7 B;  1K0R A;  4IFD G;  3S1N H;  3M3Y B;  4I7A A;  3BG3 A;  4GNX C;  2EJF C;  2EYM A;  4V19 0;  2K75 A;  1Y1W G;  1N9W A;  1YEZ A;  3I4M G;  3T16 A;  2B2Y A;  1SE8 A;  2Z1C A;  1BF4 A;  2WB1 G;  2YU9 H;  4B3S Q;  1OO9 B;  3E5S A;  5IYB G;  1E7Z A;  4NXM L;  4RCN A;  3D8G A;  1B9N A;  3VYT A;  1ZYR C;  4S3S A;  1PH2 A;  1SNC A;  1CKO A;  3J7A V;  2Q2I A;  3BVM A;  4LF6 Q;  3IAY A;  1ILP A;  3D4D A;  1CQV A;  2RCF A;  2EQS A;  5KNC A;  4O42 A;  3CD6 A;  1AEX A;  2IX3 A;  4HAE A;  2O5J C;  1P8L A;  1TQO A;  2Z6B A;  2Q8I B;  2UXC L;  1B8A A;  3HP3 A;  1HZB A;  2BE5 C;  2QW7 A;  1AH9 A;  2B2W A;  5KND A;  2TSS A;  4R4O A;  2ZXP A;  4IFD I;  2EY1 A;  1EQR A;  5C5M A;  4DUZ Q;  4DR5 L;  1PTO B;  1UUP A;  1KC8 C;  3A5Z B;  2LXJ A;  4WJ4 A;  4KHP L;  1STA A;  5KEE A;  1Y14 B;  2EDG A;  3FKI B;  4UP8 A;  4DV1 Q;  3WWV A;  3H3V I;  3D6C A;  3T53 B;  5IGF A;  1J6Q A;  4C56 C;  4AQY L;  2E2J B;  2IHE A;  1ESR A;  2C35 B;  1JT8 A;  3KF8 B;  4G7Z C;  2MO1 A;  2M00 A;  1XMQ L;  2A68 C;  2I5M X;  3HS0 C;  2BDN A;  2K5V A;  1YNJ D;  3MXP A;  1F2L A;  3RLN A;  4DV4 L;  2PW7 A;  1QVF A;  2KCC A;  1CK1 A;  1O7Y A;  1PA6 A;  4A3E H;  2VW9 A;  4AH6 A;  2EYL A;  2OQK A;  5ELF A;  5BN3 A;  2K1B A;  4YWK A;  3NWS A;  4KI0 A;  2LFN A;  1WTP A;  1JOR A;  5E3F A;  5DAU A;  5CC4 A;  1KRS A;  2A73 B;  2PPB C;  1SJH D;  1IZ6 A;  4K2L A;  5IYD H;  5HUR A;  1NJI C;  1QNU A;  2UXC Q;  1CSP A;  1HTL D;  2XTI A;  4DFA A;  3MXG A;  5CV8 A;  3A8K E;  3H0G G;  1PTO C;  2DY8 A;  2F0K A;  1U0L A;  3GV3 A;  3PIP 3;  1XNQ L;  3PUV A;  5J39 A;  4X65 L;  1TY0 A;  3CPW A;  1F9P A;  3NEM A;  1E24 A;  3K58 A;  2CW0 C;  4K6D A;  3DWA A;  4RHS A;  5JJI A;  3G6E A;  4PZ6 A;  2J0T D;  2A6H C;  1SFO H;  2OWO A;  4NXN L;  1S72 A;  2BH2 A;  2DY7 A;  5DNF A;  1F9R A;  3GD7 A;  4L6T B;  1TWG B;  4A3J H;  2VY3 A;  1AN8 A;  3SVM A;  4DPG A;  4FF1 A;  2N3S A;  4X64 L;  1EIF A;  3J81 i;  1LT6 D;  3VR2 A;  4C3I G;  4KKU A; 
#chains in the Genus database with same CATH homology
 1TWG H;  2YTV A;  2PNH A;  1A8V A;  4XTC S;  3JC6 6;  4A93 G;  3K80 C;  3E0E A;  3M3Y H;  4OX9 L;  2E5L Q;  3HKZ E;  4YHH L;  3M4O H;  1K83 H;  4JYA Q;  4LNQ A;  4O2D A;  2VUM H;  3RLO A;  1UE6 A;  1CSQ A;  2ZTC A;  1NY4 A;  2ATW A;  2R7Z G;  3NEN A;  2GVB A;  1K8A C;  4JCV E;  2VQE L;  3CP0 A;  1KD1 C;  1WCM H;  4RMF A;  2KCM A;  3PGZ A;  1VQ6 A;  3KOJ A;  1LUZ A;  4BY1 G;  2QEX A;  3RZO H;  4UY8 C;  1DGS A;  3M7N A;  4R4I A;  1EYG A;  4APV A;  1YJN A;  4LF9 Q;  5ELO A;  2VUM G;  1WOC A;  3I7F A;  5IP7 H;  4GKJ Q;  3T1Y Q;  2UUA L;  1GVP A;  5IWA L;  2F4V Q;  3GTG H;  1XMO Q;  3GDE A;  4JI3 L;  4OO1 I;  5FJ8 H;  3NEL A;  1YHQ A;  1WCM G;  5IP9 H;  4GN5 A;  1GM5 A;  1JJ2 A;  3GTO H;  5M3F H;  4GLV B;  4GKK Q;  5C4X H;  4LFB Q;  3JAM i;  1VQ7 A;  4LF4 L;  3S14 H;  4NXN Q;  5JEA J;  2JA7 H;  2MNA A;  2Q2H A;  3DLL A;  2OTL A;  1G29 1;  1HR0 Q;  4QGU A;  1FGU A;  1YHB A;  1N33 Q;  4LUZ A;  5IP7 G;  4B3M Q;  4MNO A;  1IYJ B;  5LMN Q;  2JQO A;  2QGQ A;  3JAM c;  1VQB A;  2JE6 I;  4DK3 C;  3CCE A;  1C9O A;  5AJ3 L;  4DAM A;  2JJQ A;  3UDF A;  4IFD J;  5FJ8 G;  1RL2 A;  5IP9 G;  4X6A H;  1EQQ A;  1IXR A;  3K7U C;  4X64 Q;  3TRE A;  5M3F G;  4LF8 L;  3GTQ H;  1L0W A;  5C4X G;  3CCS A;  1VQI A;  2XGT A;  3FKI H;  3KLW A;  4BA1 I;  2KBN A;  3AYH B;  4IOC A;  2B63 H;  2JA7 G;  2L15 A;  1WYD A;  4QIW E;  1X3E A;  1E22 A;  1E3P A;  1K73 C;  4QL5 A;  2BA0 A;  2CKZ B;  4L5T A;  1MKH A;  1B7Y B;  4OX9 Q;  2JA6 H;  2E2J H;  3L2P A;  4A75 A;  2VS1 A;  4YHH Q;  4JI0 Q;  4NXM Q;  2PQA B;  3U58 A;  2YYZ A;  1Y1V H;  4DR4 L;  1YIJ A;  3GTL H;  2B63 G;  2VQE Q;  1X3F A;  3CAM A;  1X6O A;  1NE3 A;  2WFW A;  4C3H H;  1HZC A;  1T9H A;  3W5O A;  1TWA H;  2AMC B;  4DR1 L;  3OTO L;  4DR7 L;  3KDF A;  4LWC A;  2EXD A;  5K36 G;  5H1S E;  2JA6 G;  2Y0S G;  5M3M H;  2F52 A;  2JA8 H;  3S15 H;  2NN6 G;  4YY3 L;  4FDB A;  5M5X H;  4DV2 L;  4B3R L;  4JG2 A;  3UE1 A;  3PF5 A;  3PF4 A;  2UUA Q;  5IWA Q;  1N34 L;  5DLQ E;  1FVI A;  3BZC A;  2RHS B;  4YCV A;  2E2H H;  3KYH C;  2AHO B;  1HNX L;  4JI3 Q;  1FJG L;  2I0Q A;  4R4T A;  1X9N A;  3A5U A;  2B3G A;  1PYB A;  4OXP A;  2YTX A;  4DR5 Q;  1E1T A;  4LF4 Q;  3HOU H;  4DR3 L;  4L5Q A;  1VQO A;  1K3R A;  3A0J A;  3CQZ H;  5E7N A;  5IY0 A;  5M3M G;  4GNX B;  2JA8 G;  3ICE A;  4BY7 G;  4KHP Q;  4DAY B;  2K14 A;  4JBK A;  1V1Q A;  1VQL A;  4JI4 Q;  1VQ5 A;  2A1A A;  5GAG C;  3GO5 A;  2JEA I;  4GOP A;  1SN8 A;  5AJ3 Q;  1VQH A;  4KHZ A;  3G71 A;  1LM0 A;  1SMX A;  1ASY A;  3CC4 A;  1C0A A;  1BBU A;  1GO3 E;  2A19 A;  3K81 C;  3CCM A;  4AQY Q;  1UEB A;  4LF8 Q;  1NTG A;  5C4J H;  5LMU Q;  3S17 H;  4NB3 A;  1KHI A;  1UE7 A;  3M9B A;  1IBM L;  3HOU G;  4A3B H;  2OCE A;  1N8R C;  3TS2 A;  4C3I H;  2VNU D;  3K0X A;  2ES2 A;  3STB D;  5IYC H;  4HIK A;  4ALP A;  1VQD A;  1XMQ Q;  1SLJ A;  3CW2 C;  2EIF A;  4DV0 Q;  1HNZ Q;  2RHQ B;  4BY7 H;  1I50 H;  1HR0 W;  4A93 H;  1HZ9 A;  1JJG A;  2YTY A;  4DV4 Q;  1Q82 C;  2Q2U A;  4A3I H;  4K0K Q;  4A3L H;  3E9H A;  3VDY A;  5LMN W;  1BKB A;  1XPR A;  3PUW A;  4UPA A;  2N78 A;  4JI1 L;  3EN2 A;  1W2B A;  3BZK A;  2WB1 E;  2ZTD A;  1VQF A;  4A3B G;  4DR4 Q;  3OW2 A;  4IOA A;  3KF6 B;  4P75 A;  1L1O B;  2I5H A;  4EQ5 A;  5IYC G;  4DUZ L;  4B3T Q;  3CME A;  4HJ9 A;  2A8V A;  3K8A A;  2HQL A;  2HHH Q;  1VQN A;  1Q1E A;  4R4C A;  3J81 c;  3OTO Q;  4DR1 Q;  4BY1 H;  4JI6 L;  3U4V A;  3DM3 A;  5J3B A;  4L5S A;  1XNR L;  4DR7 Q;  3AFP A;  4A3I G;  4A3L G;  3LGJ A;  4JOI A;  4DK6 C;  1S40 A;  4LF5 L;  5GAE C;  4DV1 L;  1UE5 A;  2JK8 A;  3L0O A;  3I4N H;  1A63 A;  2Z6K C;  1P16 A;  2YV5 A;  3BJU A;  1N34 Q;  5IT9 c;  2CCZ A;  3HFZ B;  1FJG Q;  1LYL A;  3MEF A;  4A3K H;  1HNX Q;  1X55 A;  4JI8 L;  1R9T H;  4YCU A;  3PCO B;  2H5X A;  2PI2 E;  2AWN A;  3J80 i;  1KRT A;  1OTC A;  4GS3 A;  2NVX H;  4A3D H;  1Z47 A;  3SGI A;  4DR3 Q;  2PMZ E;  4C2M H;  4DUY L;  3HOZ H;  1XNQ Q;  1CKN B;  1PH8 A;  4DR6 L;  2WP8 J;  1A62 A;  3UDI A;  2DUD A;  2KHJ A;  1X54 A;  2MQH A;  4P73 A;  3I4N G;  4X65 Q;  4GN4 B;  3J80 c;  1KL9 A;  1VQC A;  4PZ8 A;  1JB7 A;  1PFS A;  1EFW A;  3CC2 A;  4L5R C;  1B70 B;  1TWH H;  4NPS A;  4A3K G;  1XPO A;  4TVA B;  1YIT A;  2R6G A;  4A3C H;  2BA1 A;  3CCQ A;  1EOV A;  4IPG A;  4X66 L;  2GN5 A;  1I3Q H;  5BR8 Q;  3I56 A;  4A3D G;  1K8G A;  1IBM Q;  2MO0 A;  5C0X G;  4KLK A;  3HKZ G;  3HOV H;  4ME3 A;  5IE8 A;  3T1H L;  3PSI A;  3HOZ G;  3GTM H;  1HZA A;  1D8L A;  2VL6 A;  4UP7 A;  4HJ7 A;  1XTD A;  1A0I A;  2GVA A;  4HID A;  3KJO A;  2D0P A;  3TS0 A;  3CCL A;  2UXC Q;  1KXL A;  2IT1 A;  1PH9 A;  1NBW A;  2FXQ A;  4HIO A;  1QZG A;  2UUC L;  1WFQ A;  2D0O A;  3EIV A;  1EUJ A;  4A3C G;  4IPD A;  5GRO A;  2UXB L;  1E1O A;  4IPC A;  4YCW A;  3RZD H;  2R93 H;  1L1O C;  3I2Z A;  4IJL A;  1YNX A;  4WJ3 M;  5JJL A;  1HJP A;  4A4I A;  5M5Y H;  1N32 L;  1LTL A;  3M4P A;  4RG1 A;  4QY7 A;  1UWV A;  1HH2 P;  4DV6 L;  4JI6 Q;  3FP9 A;  1XNR Q;  3A74 A;  1VQK A;  4AYB G;  2AWO A;  4C3J H;  4LF5 Q;  1K9M C;  3J7Z C;  1AE3 A;  2RF4 A;  2Z0S A;  2NVQ H;  4A76 A;  2NVY H;  1YJW A;  2R93 G;  3UE0 A;  2UXD L;  1PH5 A;  3GTJ H;  4JI8 Q;  3W1B A;  1YI2 A;  2ASB A;  3F1Z A;  4JV5 L;  4HJ8 A;  3PIP A;  4BBS H;  1CKM A;  4A3M G;  1JMC A;  4POF A;  3K7A H;  2K5H A;  3ULL A;  3CXC A;  3RR5 A;  5C0X I;  4GLX A;  3HOX H;  3F2D A;  1IBL L;  2JA9 A;  4AIM A;  1PH1 A;  2R92 H;  5EAY A;  3ULJ A;  1KQS A;  2UU9 L;  1QUQ A;  2BH8 A;  2K4K A;  3H15 A;  2NVT H;  3AFQ A;  1J5E L;  3HOW G;  2HIX A;  3F2B A;  3M4Q A;  1CUK A;  1PVO A;  3D0F A;  4BBS G;  1Q86 C;  1YZ6 A;  4GN3 B;  1Z9F A;  3CPF A;  5FLM H;  1V9P A;  1VQA A;  3HOX G;  3T1H Q;  4IO9 A;  2OTJ A;  3S24 A;  1MJC A;  1Q7Y C;  4A3G H;  2R92 G;  1SR3 A;  2R7D A;  4HJ5 A;  3D31 A;  2IX1 A;  2E5L L;  2N8N A;  1EWI A;  3E9I A;  2KHI A;  4B3S L;  1Q46 A;  2I5L X;  2UUC Q;  4DNI A;  1TXY A;  5HGQ A;  2QA4 A;  2ZJR A;  2KCT A;  1VS0 A;  3RNU A;  2MFI A;  3GTP H;  2WAQ G;  4POG A;  5FLM G;  4PZ7 A;  4JI7 L;  4LF6 L;  1VQM A;  2E2I H;  3STB C;  1ASZ A;  1I6H H;  1VCI A;  1N32 Q;  3KDF B;  2ID0 A;  4A3G G;  1Q1B A;  2E8G A;  4MTN A;  1MIU A;  4EX5 A;  4LUV A;  4OWT B;  1XPU A;  3ULP A;  4DV3 L;  4DV7 L;  4GKJ L;  3T1Y L;  1UE1 A;  1HNW L;  1PH6 A;  3AEV A;  4UP9 A;  2ZM6 L;  3CCU A;  4R1J A;  1I94 L;  1GD7 A;  2UXD Q;  1VQJ A;  1VQ4 A;  4OWX B;  4PG3 A;  3NBH B;  1OXS C;  1PV4 A;  5M5W H;  2ZJQ A;  1FL0 A;  1X65 A;  3HOY H;  4GKK L;  3ER0 A;  2CQO A;  3PUZ A;  2ZTE A;  4Y52 H;  3S2D H;  4YWM A;  3RLF A;  1YVC A;  5HY6 A;  5JEA G;  1Y1W H;  1IBK L;  3OYY A;  3J81 j;  1SRU A;  1TWC H;  1IBL Q;  4BA2 I;  4YY3 Q;  1QVC A;  3I55 A;  3I4M H;  2N49 A;  4GOP B;  3H3V H;  2K50 A;  4JI5 L;  1SRO A;  4DV2 Q;  2UU9 Q;  2HT1 A;  4B3R Q;  2AKW B;  4Y7N H;  4R4Q A;  5IYB H;  1XJV A;  3UDX A;  4P72 A;  1K0R A;  3HOY G;  3S1N H;  4IFD G;  3PO2 G;  3W1G A;  3PO3 G;  2R7F A;  4GNX C;  1YHA A;  2K75 A;  3AQQ A;  1Y1W G;  1N9W A;  1YEZ A;  1OXV A;  1M90 C;  4HIM A;  4A3F H;  3B6Y A;  3I4M G;  1SE8 A;  4A3J G;  2WB1 G;  4JBJ A;  1PHJ A;  2YU9 H;  3IRB A;  4B3S Q;  4LUO A;  4JI0 L;  3Q8D A;  1Q8K A;  2NZO A;  1E7Z A;  5IYB G;  4NXM L;  2CWA A;  1PYS B;  3ZJY C;  4JBM A;  1PH2 A;  1CKO A;  2B29 A;  2Q2I A;  4JI7 Q;  1O7I A;  1QVG A;  4LF6 Q;  4IJH A;  3PUY A;  3FHW A;  1D7Q A;  4A3F G;  2EQS A;  4GLA C;  1U5K A;  3CD6 A;  3S1M H;  3PUX A;  1AE2 A;  1P8L A;  2F3I A;  4H02 A;  4IPH A;  4LFA L;  4DV5 L;  1EIY B;  3TEH B;  2UXC L;  1TWF H;  1B8A A;  4DV3 Q;  4DV7 Q;  1JE5 A;  3TQY A;  1HZB A;  3F2C A;  4JI1 Q;  1X56 A;  1PH3 A;  1HNW Q;  1AH9 A;  2JA5 H;  2ZM6 Q;  4P74 A;  2PQA A;  4R4O A;  1I94 Q;  4AYB E;  4J15 A;  4IFD I;  1EQR A;  1YBY A;  4DUZ Q;  4DR5 L;  3M85 A;  4HJA A;  3KFU A;  1GKH A;  1KC8 C;  3F8T A;  4LFC L;  3A5Z B;  4A3M H;  1QZH A;  1X3G A;  2LXJ A;  2UUB L;  4WJ4 A;  4KHP L;  2LXK A;  1OXX K;  4GOP C;  1Y14 B;  1IBK Q;  2IY5 B;  1G6P A;  2CFM A;  4JI4 L;  4UP8 A;  1V43 A;  4DV1 Q;  3WWV A;  3H3V I;  4DR2 L;  4JI5 Q;  2VZA A;  2JA5 G;  1J6Q A;  1NMG A;  2Y0S E;  4BXX H;  3PIO A;  2IX0 A;  4AQY L;  3HOW H;  1PH4 A;  3S16 H;  2Z6K A;  2IHE A;  3BU2 A;  5LMU L;  3G4S A;  3G48 A;  1N36 L;  5GAD C;  2C35 B;  1JT8 A;  3KF8 B;  2VQF L;  3RN2 A;  2MO1 A;  4JI2 L;  3U4Z A;  1KIX A;  4BBR H;  1XMQ L;  2I5M X;  3PV0 A;  4PMW A;  4DUY Q;  4DR6 Q;  2K5V A;  4LW1 A;  4GNX A;  1HNZ L;  4DV0 L;  5C3E H;  3S2H H;  3CCR A;  2D62 A;  3EBE A;  3HKS A;  3RLN A;  4DV4 L;  3S1R H;  4K0K L;  1QVF A;  4P71 A;  4BXX G;  1PA6 A;  1IL2 A;  5ELN A;  4A3E H;  4JBW A;  2VW9 A;  3RN5 A;  4AH6 A;  3CCV A;  1OXU A;  4TQU S;  1M1K C;  1W3S A;  2OQK A;  4X66 Q;  1G51 A;  3FKI G;  5C0X J;  1H95 A;  4LF7 L;  4X62 L;  4YWK A;  3HOV G;  3H0G H;  4QQB X;  4KI0 A;  4BBR G;  4B3T L;  3TRZ A;  2ZJP A;  2HHH L;  4JOI C;  5C3E G;  1WI5 A;  2RCN A;  1KRS A;  2WAQ E;  1VQP A;  4O0A A;  3CF5 A;  1IZ6 A;  3CMA A;  4LFA Q;  4JYA L;  4DV5 Q;  1NJI C;  5IYD H;  3ERS X;  4OON A;  1CSP A;  2IHF A;  5GAH C;  5C44 H;  2DGY A;  2XTI A;  4A3E G;  1C7Y A;  1KAW A;  4OWW B;  2UXB Q;  3L7Z C;  1Y1V G;  2LSS A;  1JJC B;  2ALY B;  3H0G G;  4QJF A;  1BVS A;  3J7A 5;  3KF6 A;  1WJJ A;  1U0L A;  2HIV A;  2NZH A;  5GQO A;  1L1O A;  3KJP A;  1YJ9 A;  1VQ9 A;  2K52 A;  4DKA C;  3U50 C;  4LFC Q;  3GTK H;  2CWP A;  4XIG S;  4DV6 Q;  2Q2T A;  2UUB Q;  1XNQ L;  5IYD G;  1RIP A;  2K5N A;  3PUV A;  1I5F A;  1L2F A;  4LF9 L;  5C44 G;  4X65 L;  3CCJ A;  3CPW A;  4DR2 Q;  1QUQ B;  3NEM A;  2F4V L;  1E24 A;  1XMO L;  3MXN B;  1Q81 C;  3I4O A;  2V1C C;  4JC0 A;  5JJI A;  1Q12 A;  1MJE A;  5BR8 L;  3G6E A;  3PO2 H;  1N36 Q;  4PZ6 A;  4JV5 Q;  4LFB L;  1SFO H;  3PO3 H;  2VQF Q;  4NXN L;  1S72 A;  2OWO A;  3S1Q H;  2BH2 A;  4JI2 Q;  1PH7 A;  2KEN A;  3UDG A;  2OQ0 A;  1HR0 L;  2PI2 A;  5FLX c;  1N33 L;  1CKN A;  1VQE A;  4B3M L;  5LMN L;  3GD7 A;  1BBW A;  4A3J H;  1NMF A;  2VY3 A;  1VQG A;  1VQ8 A;  4DPG A;  1OXT A;  4OO1 G;  2NN6 I;  1S3O A;  3CC7 A;  1J5E Q;  2N3S A;  4YWL A;  4X64 L;  5JJK A;  2R7Z H;  1EIF A;  3J81 i;  4MZ9 A;  4LF7 Q;  4X62 Q;  2JEB I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...