2UU9L

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 17
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uu9L00
4OXPA 1TXYA 4JI4L 1ASYA 2WP8J 3A74A 2K5NA 1B8AA 1A8VA 2Z0SA 4DV1L 3EN2A 1L2FA 3WWVA 4A3CH 2HT1A 4B3SL 4BY7G 5GROA 3LGJA 4DV2Q 3HOUG 5IT9c 2D62A 4TQUS 2VNUD 3RLFA 5IE8A 2IHFA 4UY8C 4YY3Q 4GKKL 4DUZL 2VL6A 2UXDQ 1Y1VG 3RLNA 1K83H 4TVAB 1FVIA 1JB7A 1KQSA 5LMUL 1A62A 2NVXH 4C3IH 3K80C 2R93H 3UDFA 4B3SQ 4A3EH 1HNXQ 1UEBA 3RN5A 1V9PA 1J5EL 1K3RA 1PHJA 4LFBL 1OXVA 3H0GG 3M4PA 2FXQA 1TWFH 3W1BA 4DAMA 5GAGC 1IBLL 3DM3A 5FJ8G 3ICEA 1PH8A 4GKJL 1C9OA 2KHJA 2VUMG 3HOZH 4DR6L 1CUKA 2NZOA 2YTYA 4P73A 4DV3L 4DR1Q 1I94L 1A0IA 1PVOA 1Z9FA 3CMAA 1HR0Q 5M5WH 5C0XG 4DK3C 4JI2Q 5M3FH 4O0AA 5LMUQ 2GVBA 2ZTCA 4PMWA 4DKAC 5GQOA 1N8RC 1EOVA 1PYBA 3I55A 1IBKL 2NVQH 1HNZQ 1QZHA 4RG1A 4DR7L 4DV5Q 2UUBQ 3PIPA 5IP7H 2JK8A 1CSPA 4UPAA 3A5UA 4LUZA 2B63G 4X66Q 1N33L 1J6QA 1G6PA 3PSIA 3G71A 2DGYA 4DV0Q 1YHBA 4DR3Q 1VQ9A 3GTOH 4A3LG 3JAMc 4A3DH 5M5YH 4OWWB 1YVCA 2D0PA 4WJ4A 1VQPA 4GLVB 2K75A 1KHIA 4NXMQ 3T1YL 3J81i 3ZJYC 3S2DH 4JC0A 4A93G 4HIOA 1KXLA 1WCMG 3GTQH 3JAMi 3TS2A 4GOPB 2KBNA 3CCEA 3HOVG 2HHHQ 2VZAA 3PUYA 3HOZG 3S15H 2EQSA 3S14H 1XTDA 4BBRH 2MO0A 2CCZA 4YWMA 1HJPA 1NTGA 1JT8A 2UUAQ 1I6HH 1X6OA 4NXML 2N78A 2R7ZG 2Y0SG 4JI1Q 3HOXG 1JJGA 5IYDH 2YV5A 1PH2A 2PQAB 4PZ8A 5C0XI 4DR4L 3OTOL 2EIFA 4JG2A 2N8NA 1PH3A 1OXXK 3GTJH 4JI7L 4KLKA 3BZKA 3UDGA 4UP8A 2ZM6L 2JA5G 4IFDJ 3D31A 1EQRA 1XMQQ 1NBWA 1TWGH 2JA6G 3PGZA 2UUAL 2ALYB 4A3DG 2IHEA 4L5SA 3K7UC 4AQYQ 3DLLA 2ATWA 4R4CA 4LFAL 1IBKQ 2KENA 4A3LH 1KRSA 4DR5Q 1E1TA 3HOWG 4LFCL 2F3IA 4GNXB 4K0KQ 2UXBQ 4MTNA 1FGUA 2AHOB 2KCMA 2WB1E 1EIFA 2PMZE 2OTLA 2LSSA 3GTMH 1VCIA 1WYDA 4X66L 1U0LA 1VQAA 2JJQA 3GD7A 2I5HA 1SN8A 4GS3A 1K8GA 1N33Q 4DV4Q 1HZBA 4R4TA 3AQQA 4R4OA 1BKBA 2JA5H 4GN5A 1IBLQ 3PO3H 4DAYB 3CMEA 2L15A 4IPGA 1MJCA 1E1OA 1EQQA 2ASBA 3I4MG 1A63A 1N36L 1E24A 4AQYL 1UE7A 5BR8L 4JBWA 2QGQA 4WJ3M 1K73C 5IWAQ 3CCQA 4ME3A 1VQMA 2R7DA 1YHQA 1GO3E 1YEZA 2MFIA 2OQ0A 3HOWH 3PF4A 1YJ9A 4QL5A 4DK6C 2ZJQA 4A3BH 3S1MH 1PFSA 4GNXA 3OW2A 3TQYA 2K5VA 4YWLA 4LF7Q 1H95A 4JI6L 1B7YB 4HIDA 3BZCA 2V1CC 1YHAA 2NN6G 4JI1L 3HOVH 4P74A 3CC2A 2LXKA 1TWCH 3G48A 3U58A 4LF6L 2WB1G 1PH6A 3S16H 1CSQA 4H02A 5J3BA 1FL0A 1N32Q 1EUJA 2OWOA 1L1OB 3NENA 4JI0Q 3KLWA 1NE3A 5C4XG 3M7NA 4JOIC 3ULLA 1HNWQ 4LUVA 2VQFQ 3MXNB 3F2DA 2JEAI 1UE5A 3GO5A 1BBWA 4DV0L 2PI2E 4DR3L 4A3EG 1MJEA 3NEMA 3KF6A 4A3KH 1EIYB 1HH2P 1E3PA 1G291 4BBRG 1YJNA 1KC8C 4IFDI 3MEFA 4LF8Q 4BY1G 4LFCQ 3RZDH 5ELOA 3J80c 4LF5L 3EBEA 3OYYA 2ZTDA 4DV1Q 1XMOL 2DUDA 5LMNQ 3CPFA 2C35B 4EX5A 5AJ3Q 4DV6L 4YCWA 4MNOA 4PG3A 3HKSA 4NXNL 1CKNB 4DV7L 2OCEA 1K8AC 1PH7A 1VQOA 2NZHA 4BY7H 3H15A 5GAHC 2E2HH 1KIXA 1XNQQ 1NMGA 4JOIA 2UU9Q 1TWAH 1WFQA 3K7AH 3S24A 1NMFA 1HZCA 3KYHC 1I50H 2BH8A 3RR5A 4GOPC 1RL2A 2XGTA 3PUWA 1LUZA 3CP0A 3F8TA 3PUZA 5IP9G 3GTKH 2R92G 3NBHB 1JJCB 3VDYA 3I7FA 5E7NA 1XPOA 3CCUA 3PO2H 4HJ8A 4LFAQ 2R6GA 1Q46A 4KHPQ 4LF4Q 1GVPA 4XIGS 1C7YA 1BVSA 1Y1VH 4A3IG 1S40A 2B3GA 2IX0A 4X64Q 1CKMA 3JC66 4LWCA 4JI2L 5JJKA 3CC7A 1VQ7A 1VQHA 1Y14B 3RN2A 1VQBA 5M3MG 1YNXA 2ZJPA 2LXJA 4LUOA 5JJLA 1SMXA 4A3CG 2UXCL 1KD1C 1SR3A 1VQCA 2AWOA 4GOPA 4KHPL 1HNZL 3S1QH 1GKHA 1D7QA 1B70B 1X9NA 4IPHA 4OONA 1JJ2A 1Q8KA 4YWKA 4DV5L 3PIOA 2I5LX 5GADC 1MIUA 2VW9A 3I4NG 1TWHH 3TS0A 4GLAC 4LF7L 2OQKA 1L1OC 5FLMG 3KDFA 5C44H 2CWPA 3CW2C 3J81c 1HNXL 2F4VQ 2R7FA 3SGIA 5IYCG 1N32L 4GNXC 1UWVA 2OTJA 1PH4A 3KOJA 3TREA 5DLQE 1Q81C 1IL2A 1VQ6A 2MNAA 1VQEA 1YZ6A 1EWIA 4OWTB 1I5FA 5IYCH 4B3MQ 3KF6B 4Y52H 1KL9A 5IYBG 1K9MC 2MQHA 4DV2L 1L0WA 4BA2I 4GKKQ 5C0XJ 3I4NH 3TRZA 1Q1BA 3PV0A 5FLXc 1QZGA 3UE1A 1PYSB 3BJUA 4AYBE 1N36Q 3CC4A 1SROA 2CQOA 4B3TQ 2KCTA 3M4OH 2AMCB 1Q1EA 3CQZH 1D8LA 3E9IA 4LF4L 1RIPA 1V1QA 3HOYH 4HJ5A 3EIVA 4C2MH 1Q82C 3L7ZC 3UDIA 3AFPA 4JYAL 1AH9A 3W5OA 3HKZG 2NN6I 1VQIA 3BU2A 2IX1A 4QJFA 2E8GA 2N49A 3T1HQ 4R4IA 3W1GA 2CWAA 4DR5L 2Z6KC 4A3FG 4GKJQ 4GN3B 4JI5L 1CKNA 4BXXH 4O2DA 1LTLA 2Q2TA 4A3GG 3CCRA 4FDBA 1BBUA 1LM0A 4B3RL 3RLOA 3NELA 1QUQA 1X56A 2E2JH 3I4MH 3AFQA 3PO3G 4HJ9A 1HZAA 4A3MG 4R1JA 3PO2G 2JA7H 2UXBL 1Q86C 3J81j 3U50C 1FJGL 1G51A 1M1KC 1DGSA 4IO9A 3S1RH 4DR7Q 3GDEA 1Y1WH 4A4IA 4DUZQ 4YY3L 2UXDL 4A3BG 4BY1H 2PNHA 4DR4Q 3FKIG 2NVTH 2A19A 4DUYL 4QGUA 3E9HA 2Y0SE 5BR8Q 4XTCS 4DV6Q 2ZJRA 4B3RQ 4NB3A 3CCVA 1YIJA 2JA8G 2UXCQ 2I5MX 2JA6H 3Q8DA 1YBYA 4AH6A 1VQ5A 4JV5Q 4DR2L 4UP9A 2EXDA 1XNRL 5C3EH 1LYLA 4ALPA 1XNQL 4POGA 5GAEC 1KAWA 2WAQE 2BH2A 4JBMA 3K8AA 3KDFB 1VQ4A 1JE5A 3F2CA 4DUYQ 2WAQG 2GN5A 4LF9L 1W3SA 2K52A 2R7ZH 2YYZA 4JI3L 1M90C 1HZ9A 2AKWB 4A3KG 2HHHL 1Q12A 4UP7A 1IBMQ 2RF4A 1SFOH 3A5ZB 1P8LA 1U5KA 4OX9L 3H3VI 1X65A 1OTCA 3ULPA 4P75A 4QY7A 5C4XH 1XPUA 1O7IA 4IPDA 2K14A 2WFWA 3KF8B 3J80i 3CCSA 5LMNW 1AE2A 2QA4A 3I2ZA 5LMNL 4BBSG 4JV5L 3CF5A 5IY0A 1C0AA 2JQOA 1PA6A 3L2PA 1VQGA 1W2BA 5JEAG 3FP9A 4LF8L 3E0EA 1SE8A 3J7ZC 4C3HH 2VQEL 1J5EQ 4LFBQ 2GVAA 4IJLA 1FJGQ 4OWXB 2D0OA 1XJVA 3ER0A 4NXNQ 2ZTEA 5HY6A 5H1SE 3G6EA 4B3ML 3RZOH 3T1YQ 3UDXA 3AEVA 3S2HH 3H3VH 1VQKA 4OO1I 1PV4A 4R4QA 3M3YH 1S3OA 1QVCA 2HQLA 2PI2A 3HFZB 2UU9L 4IPCA 1E7ZA 4B3TL 1WCMH 4AIMA 2HIVA 1Y1WG 4DV3Q 1XPRA 1N9WA 5C3EG 5HGQA 4X6AH 2CFMA 3M9BA 4Y7NH 4A3MH 3U4ZA 3KJOA 1S72A 3CCJA 1ASZA 4JCVE 5M5XH 1T9HA 3T1HL 1OXTA 5JEAJ 4HJ7A 3HOYG 4MZ9A 4JI7Q 3OTOQ 4BBSH 1N34L 5IWAL 5IYDG 4JBJA 4AYBG 4KHZA 3ULJA 3H0GH 2JEBI 3J7A5 3FKIH 5C4JH 3S1NH 3B6YA 2VY3A 2CKZB 5ELNA 3GTGH 4JI6Q 3GTLH 2YU9H 2R93G 2AWNA 1QUQB 2K4KA 1VQNA 1VQDA 4JI8Q 4LW1A 5M3FG 3K0XA 1WI5A 4J15A 4DPGA 1IZ6A 4KI0A 2IT1A 4K0KL 1I3QH 2RCNA 1VQ8A 1HNWL 1OXUA 4L5TA 3D0FA 2K5HA 1MKHA 3HOXH 1VQLA 2BA0A 1JMCA 4DV4L 2IY5B 2XTIA 3CCMA 1NJIC 1SLJA 4RMFA 1IXRA 4X65Q 1GM5A 2E5LL 2A1AA 4DR2Q 5IP7G 2ZM6Q 4HIKA 1QVFA 3CD6A 1NY4A 4YHHQ 2Q2UA 4DNIA 4LNQA 4QIWE 4L5QA 1Z47A 4P71A 2JA9A 5AJ3L 3CCLA 4A93H 1UE6A 4JI3Q 3S17H 3STBC 5K36G 1XMOQ 4P72A 4YCVA 2A8VA 2F52A 4A76A 2B29A 1PH9A 2JA7G 3HKZE 1K0RA 2PQAA 3ERSX 1X54A 3I4OA 3CPWA 4X65L 1XMQL 2ES2A 3FHWA 3TEHB 4OX9Q 2JA8H 3GTPH 2Q2IA 3F2BA 2YTVA 3M4QA 2VUMH 4DR6Q 3CAMA 1VQFA 5EAYA 2B63H 3PCOB 4YHHL 1SRUA 4YCUA 1QVGA 1R9TH 1WOCA 4APVA 4IFDG 2JE6I 4JI0L 2RHSB 1HR0L 1WJJA 4A3JH 4GLXA 1I94Q 1VS0A 3AYHB 2BA1A 2F4VL 5FLMH 3PUVA 5C44G 2VQEQ 3M85A 1CKOA 1YJWA 2UUBL 1XNRQ 4JI5Q 4X62Q 2NVYH 1VQJA 3I56A 2YTXA 2KHIA 3KFUA 4LF9Q 4LF5Q 1V43A 4QQBX 2HIXA 2MO1A 5FJ8H 4IOAA 4A3GH 3PF5A 1X3EA 4BXXG 4GN4B 4A3FH 5JJIA 1IYJB 1KRTA 4X64L 3U4VA 4JBKA 5IYBH 4DV7Q 2RHQB 4C3JH 1AE3A 3KJPA 1YITA 1IBML 4POFA 3A0JA 2H5XA 3CXCA 4A3JG 3F1ZA 1X55A 4X62L 3RNUA 5M3MH 4A75A 1YI2A 3K81C 1EYGA 1PH1A 2E2IH 1EFWA 2VS1A 4PZ6A 1Q7YC 2UUCQ 4DR1L 1N34Q 1OXSC 2E5LQ 2I0QA 1X3GA 2Z6KA 2ID0A 2QEXA 1X3FA 4A3IH 4LF6Q 2VQFL 3STBD 4HJAA 4JYAQ 1GD7A 4BA1I 4JI4Q 4OO1G 4L5RC 2Q2HA 4IJHA 3L0OA 3G4SA 4IOCA 1HR0W 3HOUH 3UE0A 2R92H 4HIMA 5IP9H 1UE1A 2N3SA 4NPSA 1P16A 3IRBA 4EQ5A 1L1OA 2K50A 3PUXA 1E22A 2UUCL 4JI8L 1PH5A 4PZ7A
chains in the Genus database with same CATH superfamily
4JI4L 2WP8J 2F0UA 1A8VA 1L2FA 2HT1A 3MTSA 3KF8A 4B3SL 3I4NB 5GROA 5E3FA 1WVLA 3S1NB 1H9KA 2VNUD 4IUTA 4GKKL 2XSCA 2VL6A 5NUCA 1K83H 1TS5A 4IN3A 1HTLD 4Y7NB 4A3MB 2R93H 2SEBD 1A3VA 1HNXQ 2NVTB 1J5EL 1PHJA 1OXVA 5C4HA 4G57A 1TWFH 3ICEA 1PH8A 2VUMG 1CUKA 4DV3L 2YTYA 3KBXA 1I94L 1GUSA 2MGSA 2JA7B 5M5WH 3MVVA 5LMUQ 2F0GA 1EY8A 5LL6S 2QEJC 1IHZA 1D1KA 3KBGA 3PIPA 5IP7H 1EWCA 4K5VA 1M8AA 4DR3Q 3G71A 3GTOH 1NUCA 5M5YH 4OWWB 2ICEC 2F0MA 4DNTB 2BDOA 2EYPA 1KHIA 3TS2A 3VR6A 3HOVG 4KKTA 5M9OA 3HOZG 5JJZA 2EQSA 4K8IA 3S14H 3A54A 4JVZA 2MO0A 2NBFA 3VR3A 3A55A 1CQFA 5T1IA 1NTGA 2N78A 2Y0SG 5IYDH 2YV5A 1KABA 2KVMA 4DR4L 4JG2A 3BDOA 2N8NA 3BZKA 2C5CA 3NUCA 2XWJB 1TY0A 1S4ZA 2JA5G 3IKJA 1XMQQ 2ALYB 2CVRA 3GQBA 3DWQA 1IBKQ 1I6HB 1HCZA 1KRSA 4DR5Q 1E1TA 2KHSA 4LFCL 3HOWG 2KA7A 2F0WA 1X3PA 2KCMA 2AHOB 4MTNA 2WB1E 4HEDA 1VQAA 5EQ0A 1K0SA 4GN5A 1IBLQ 4DAYB 5M3FB 1N36L 1JICA 5BR8L 4JBWA 5M3MB 1VQMA 4ME3A 1YEZA 4A3LG 1UEAB 4QL5A 4A3BH 4RHRA 3DEPA 4BWGB 4GNXA 4XDXA 2K5VA 4YWLA 2YU9B 2EYOA 2Z6BA 4HIDA 3BZCA 2V1CC 2Z8LA 1TR5A 4JI1L 4P74A 2B2TC 3G48A 3R93A 4MIUA 4LF6L 4OEMB 2L1BA 4H02A 5J3BA 3VYUA 1CZWA 1L1OB 2EY5A 1LT6D 5TSSA 1CHPD 1NE3A 2PNRC 4JOIC 1SYGA 1HNWQ 3F2DA 3CRLC 3JAME 1BBWA 4DV0L 2PI2E 4A3EG 2R92B 1QJOA 4IFDI 4BBRG 1YJNA 5L37A 3NE5B 2EJFC 1TKWB 5EPKA 4LF8Q 4LFCQ 1SMYD 3EBEA 3OYYA 4WFN3 4DV1Q 2DUDA 5AJ3Q 2JXMB 4ZKCB 4DV7L 4CKEA 1UNSA 1K8AC 4OELB 5KYLA 4BY7H 2AUJD 5G3LF 2M2LA 2E2HH 1JR0D 4RHSA 1CFMA 2FHTA 3SK6A 5I4DA 3E6ZX 2UU9Q 3MXNA 3NWSA 5KIXA 1C8CA 3S24A 1NMFA 4Z9CB 3KYHC 4A3BB 3RR5A 5ELBA 2PO4A 1EOTA 1FYCA 1NSNS 1ET6A 3P1HA 4C2MB 2A74C 3PUZA 2BE5D 3QIAA 2IX3A 3HOXB 2R92G 3I7FA 4KY5A 3OWFA 4K6LA 4LFAQ 4HJ8A 1B3QA 3ONAB 1S5BD 1SE2A 4DF7A 1AW7A 1Y1VH 1S40A 5EJWA 1EFID 2NYZD 3PQIA 2M00A 4JI2L 4NKLA 2PZTA 2K01A 3MC0B 3HGBA 1WTRA 3C1FA 5JJLA 5IGDA 1VQCA 2NVXB 4C3IG 4IPHA 4OONA 3S14B 3J80L 2KCCA 1JCKB 5FO9B 1I4GA 1MIUA 3NTKA 1KDBA 1L1OC 3KDFA 5IT9E 4UDUC 4JK1C 3S1QB 4B9XA 2NZ1D 1H9SB 5IGGA 2B2VC 4HCSA 5DLQE 2MNAA 1EWIA 3A8IE 4TKOB 4C3JG 5A35A 1ESRA 3PO3B 1K9MC 4XQQA 5KNCA 4Y52H 5COYA 2MQHA 4DK1A 4BA2I 2C9OA 4GKKQ 2VUMB 2B2VA 1X3QA 2L11A 3PV0A 3UE1A 4AYBE 3BJUA 1N36Q 2KCTA 3M4OH 3S17B 1D8LA 4N8FA 1RIPA 3P20A 1O7ZA 5EBCA 4JYAL 3P75A 2NN6I 2IX1A 5FO8B 3VYSA 1MD2D 4BY1B 3MWYW 2Q8IB 3LWUA 3K5OA 2J0TD 2WKCA 4B3RL 1DXMA 1X56A 5CBAE 4R1JA 4P2CB 2JA7H 2UXBL 1FJGL 1M1KC 1DGSA 2LS01 3S16B 4OIKA 4OGQC 5ELCA 4L6TB 4RGTA 2M9VA 4DUZQ 2B2UC 4A3BG 3S15B 2BDNA 4QCLA 1TS2A 1PDQA 2DNEA 2PNHA 3EA6A 3FKIG 2NVTH 4QB4A 2A19A 4IUQA 2RCFA 4QGUA 2IPKD 1JWMD 4NB3A 4KV6A 1YIJA 5C4ZA 2JA8G 2UXCQ 2V4DA 2JA6H 5CV6A 1YBYA 5C3EH 2WAQE 5DEHA 5FKAC 2BH2A 3NWTA 4LF9L 2BOSA 3BYTB 2K52A 4A3KG 3R2TA 1X65A 3FRPB 2EDGA 2WFWA 2QA4A 3I2ZA 5LMNL 4A93B 1E2WA 2IJ0A 2JQOA 1VQGA 2ZT9C 3BG3A 3E0EA 1SE8A 3J7ZC 4C3HH 1J5EQ 2GVAA 4IJLA 1I4HA 2F1MA 2K5WA 1FJGQ 2E2DC 4KN4C 4J1MA 5HY6A 5H1SE 3G6EA 4B3ML 4LMQD 1SFOB 3S2HH 1CK1A 5IOCA 3A7LA 5D65A 4CDDC 1PRTF 4R4QA 3M3YH 1S3OA 2PI2A 3HFZB 3M4OB 3CHBD 4B3TL 1LV9A 3QR8A 1KDAA 3J7YW 1Y1WG 4DV3Q 1EYAA 1ZYRC 4X3KA 3SK5A 4X6AH 1S5FD 1BCPC 2GA4B 5M5XH 3T1HL 3HOYG 4MZ9A 2WACA 5ISRA 3FKIH 1XTCD 2LKVA 2AWNA 1QUQB 2K4KA 1VQNA 2F0EA 4LW1A 3VR5A 3LNNA 3M4YA 4QUCA 4J15A 2Q8TA 2A5HA 4DPGA 2IT1A 1VQ8A 1HNWL 1OXUA 4WJWA 2K5HA 2XNAC 1MKHA 2E74C 1U9RA 3T13A 4UAIA 4CJ1B 1T5XD 1IXRA 2RDGA 1KDCA 2E5LL 4DR2Q 5FK9C 1NY4A 3HOZB 1A3UA 4LNQA 4QIWE 4QMGA 3NP8A 2F3WA 4A76A 2B29A 5T1GA 2D9UA 1AN8A 1K0RA 3GTOB 2ES2A 2JA8H 4FF2A 3F2BA 3M4QA 4DR6Q 3CAMA 1VQFA 1E0BA 4PNYA 4YHHL 1K8OA 4YCUA 1QVGA 1GOZA 4JI0L 4LJZC 1Y1WB 3KUPA 4GLXA 1TU2B 3W2DA 2HCIA 1RTOA 1CKOA 1DM0B 4BBSB 3URYA 2QKIC 2F0JA 2NVYH 2X69A 3F2UA 2KHIA 3Q0AA 3DHQA 1Y69U 4IUPA 1PRTD 1IYJB 4ID6A 3K5LA 1CHQD 1JE4A 3G6JB 2CHBD 1EIGA 2H5XA 3ND9A 5CGKA 4KY7A 3RNUA 4A75A 1EYGA 3V96A 1EFWA 2B2WC 4RH6A 4DR1L 2Y0SB 2E5LQ 1LLRD 1X3GA 4LF6Q 2EYHA 1PTOC 4X3TA 5HURA 1GD7A 4L5RC 1RODA 4IJHA 2BE5C 1D6EC 3HOUH 1O7YA 2R92H 2N3SA 4H44C 3IRBA 4EQ5A 5K5PA 3K5MA 3GTKB 3PUXA 1Z7TA 4JI8L 1QCBD 2B39A 4KHVA 3A74A 2K5NA 1B8AA 3BVGA 4RGNA 3EN2A 4A3CH 3AB9A 4BY7G 3HOUG 4TQUS 2F0VA 4CJ2C 4YIJA 1CA5A 4RCNA 4DN4M 1PZID 1F77A 1SJED 1PRTC 3MXUA 1EQVA 4J8QA 3RN5A 4IFDH 3EFXD 3WDNA 1LTSD 3FKIB 1PFNA 2XWBB 2JP1A 2KHJA 4P73A 4KKUA 4DR1Q 2PCFB 1EL0A 1PVOA 3CMAA 1HR0Q 2R3ZA 1A2TA 4DAYA 4O0AA 2GVBA 4OHJA 2ZTCA 5LHY1 5LL6X 5GQOA 1N8RC 2NVQH 3CKIB 1HNZQ 3OW7A 4RG1A 4DV5Q 3FMCA 2JK8A 4LUZA 3PSIA 1KTKA 3SR1A 1BQQT 2L55A 4A3DH 1CM9A 3UI2A 3K5NA 4HMIA 1V1PA 4NXMQ 1SYBA 1WCMG 1O80A 3MEHA 1QE6A 3CCEA 2NN6H 1D5XC 2Z4HA 3PIO3 1XTDA 3M3YB 3E0JA 1FGBD 1H9SA 1CTMA 1X6OA 4JI1Q 2PQAB 4H13C 4PZ8A 4JI7L 1OXXK 1R4QB 1EU4A 3GTJH 4O42A 1KLUD 3GTQB 4UP8A 5DAUA 3D31A 3SE0A 1NNXA 1TWGH 3PGZA 3OMCA 5IT9L 2IHEA 4L5SA 4AQYQ 4R4CA 2KENA 4K2LA 4A3LH 2VB2X 4HAEA 1CT1D 5IODA 3VA7A 4K0KQ 4O1NA 2LSSA 4GS3A 3KLSA 4NDXA 4K8JA 4G7OC 3S2DB 2ASBA 1MJCA 4FF3A 4CDCC 4MHEA 1LACA 1BCPF 3T16A 3R3OA 4RCOA 1K73C 3HOWH 2R7DA 5I9PA 5E1FA 4LAAA 3NXWA 2F0NA 4C3IB 1JB3A 1LTRD 3M7GA 1CSQA 1SNPA 1N32Q 2OWOA 3NENA 1GHKA 3KLWA 5DM63 4FVMA 3OHXC 1B53A 4DR3L 1MJEA 3H6MA 4ZAIA 1FNUA 2A6HC 2RSOA 1BBXC 3NEMA 3KF6A 4A3KH 1EIYB 1E3PA 1S5ED 4R9WA 1E2ZA 1PZKD 5ELOA 3J80c 4LF5L 2MP1A 3GV3A 3A56A 1VMCA 2ZTDA 5J1ZA 1LT3D 5LMNQ 1FD7D 2C35B 2B2WA 3CPFA 1PYWD 4DV6L 4YCWA 5CV5A 3U9SA 1Y8OB 1SJHD 2QILA 3FPPA 4PG3A 1CKNB 3WOFA 2B2UA 1PH7A 1VQOA 2NZHA 5IGFA 1TVXA 1XNQQ 1JC7A 4JW0A 2N88A 4JOIA 1WFQA 3C2PA 4CHTB 1RL2A 3S1MB 3W3AA 4IUUA 5M5YB 2KUMA 2NVQB 4UHVA 5A2QL 5IP9G 3VDYA 1KNAA 4BBRB 2DJGC 2G9HD 2Q8RE 2RDHA 3CCUA 3I72A 1GVPA 1HQMC 1LTTD 1RHPA 5D14A 1KLGD 2F0PA 1EIHA 5FLXE 1Y14B 3A7AB 5EKKA 4BS9A 1YNXA 2ZJPA 2RVLA 1SMXA 3DXJC 1YNND 4XYOA 2UXCL 2RA4A 1SR3A 2AWOA 1ET9A 1HNZL 3S1QH 1B70B 1LT5D 1Q8KA 3FDTA 2B2YA 5C3XA 1JWSD 1TWCB 5DNFA 4DAVA 3TS0A 1HUNA 4LF7L 2OQKA 2SNMA 5FLMG 1HNXL 2R7FA 3J80E 2CW0D 4H7BA 4KN7C 1ZKOA 2RSNA 1PH4A 1SDFA 3KOJA 1QG7A 3TREA 1Q81C 1IL2A 1VQ6A 4CKCA 1ILQA 4F87A 1Q1BA 2OF1A 1XYIA 1SROA 2L9HA 1STBA 4G7ZC 2AMCB 1D1IA 3CQZH 1V1QA 3EIVA 4C2MH 3UDIA 4CBVA 1V1OA 3C46A 3BU2A 2TMPA 2ZXOA 4QJFA 2D5DA 3DMUA 5KEEA 4R4IA 1HXYD 3X3MA 1BCPB 2Z6KC 4A3FG 4JI5L 4A3GG 4WORA 1BBUA 2EPBA 1LM0A 3FEWX 4Q0FA 1Z6HA 2E2JH 3I4MH 3AFQA 1HZAA 4A3MG 3U50C 4DGZA 1IKLA 1BR9A 5C6AA 4A4IA 4ZCKA 4IALA 4YY3L 2UXDL 4BY1H 1EY4A 4DR4Q 3HG9A 4DUYL 3R2IA 3E9HA 2Y0SE 3N6RA 2R93B 1HA5A 3GTJB 4DV6Q 5DM73 3OPOA 4B3RQ 4KMUC 1HRJA 2I5MX 4QUFA 4NW2A 1TWGB 4UP9A 1XNRL 4WRDA 3I91A 4ALPA 3K7AB 4POGA 2F0HA 5GAEC 2HCCA 3K8AA 2EJGC 3OOCA 1JE5A 2GN5A 4I7AA 2R7ZH 5CV9A 4N8X1 1Y8NB 1Q12A 4UP7A 3SDZA 3GTPB 1PMRA 3T4AC 4ZYSA 4OX9L 3H3VI 1OTCA 1XPUA 4FNFA 2SDFA 4P75A 4QY7A 3HOZH 1F2YA 3KF8B 5EPJA 1GUWA 1AE2A 2F4IA 5JEAH 4FF4A 2F0TA 5BN5A 3L2PA 5JEAG 3FP9A 1J8IA 2VQEL 2DY7A 1EY7A 1ZEQX 2OT2A 1XJVA 3ER0A 4DXGA 2RQXA 3T1YQ 2EY6A 3HP3A 3D4WA 3E3XA 2JN4A 2PZWA 4OO1I 2LY7A 1PTOB 3S9WA 1WCMH 4N9TA 4MN3A 1XPRA 3IL8A 3TN2A 2EJMA 1II3A 2CFMA 4Y7NH 4A3MH 3Q24A 3Q22A 3OTOQ 4F7XA 1U4RA 4JBJA 4KHZA 3H0GH 1HFNA 2XRSD 3S1NH 2VY3A 2CKZB 2ICIA 3GTLH 1VQDA 3L3OC 4B08A 4J6HA 3OMGA 1DOLA 1DZ1A 5KYIA 4KI0A 5CV4A 3VR2A 4PV1C 4IQZA 2RCNA 2RDFA 4EQPA 3D0FA 2TSSA 2Z4IA 1TWFB 4IURA 4DV4L 3PIP3 2IY5B 1SLJA 4X65Q 5IP7G 4B9WA 3CD6A 5JVH3 4DNIA 2X6LA 1H9JA 4L5QA 2JA9A 5AJ3L 2F03A 3CCLA 4A93H 1O78A 4P72A 5C5MA 1PH9A 2JA7G 3NK9A 1C48A 1LTBD 1RKNA 1X54A 2PQAA 3ERSX 3I4OA 1XMQL 3GTPH 1AFPA 5EAYA 1B44D 4FF1A 3MZ5A 3BVZA 4A3KB 4QF4A 3NTHA 1HR0L 1B50A 1WJJA 4A3JH 2L5TA 1HUMA 3VR4A 5C44G 3PUVA 1G2SA 4QIWB 4JI5Q 1VQJA 1MGSA 2LFNA 4LF9Q 1AP0A 1V43A 4QQBX 4IOAA 3QO2A 3PF5A 1X3EA 1QOHA 4A3FH 3C3LA 4JBKA 3KJPA 4C3JH 1AE3A 3H94A 1X55A 4X62L 5M3MH 2HQEA 1RJTA 4S3SA 1VF5C 3CQZB 2E2IH 1QB5D 4PZ6A 2RKSA 1N34Q 2Z6KA 1SYEA 1ZXTA 4HJAA 4JYAQ 4BA1I 4OO1G 1LTGD 2Q2HA 3UE0A 4HIMA 1UE1A 4A3DB 3SK4A 1EZ8A 1LO5D 2H4OA 1PH5A 1SSOA 3NHHA 4X3SA 1PXUA 2Z0SA 4DV1L 3WWVA 4IUNA 3QOJA 1WTVA 4ABNA 2CH4A 4DV2Q 2L0CA 5C5LA 5IT9c 3RLFA 2IHFA 4UY8C 3K58A 4DUZL 1Y1VG 1DJRD 1X32A 3IAYA 1RTNA 1FVIA 4F88A 1JB7A 1KQSA 4RFBA 5FOBB 2PPBC 3K80C 1MSHA 1O7LA 3UDFA 4B3SQ 1EY6A 1UEBA 4LFBL 2PQEA 3NTIA 3H0GG 5GAGC 4DAMA 2AQ2B 5FJ8G 3TMEA 4Q5VA 3D6WA 4IZ8A 4DR6L 2NZOA 3SXHA 2WINB 1A0IA 4HSVA 5C0XG 4DK3C 3E5SA 4JI2Q 3ERQA 1ENCA 5I9OA 4PMWA 2PZUA 5E4WC 4ULLA 1I4RA 1S5DD 4EQOA 1Y1VB 2UUBQ 2F0FA 2HDLA 4X66Q 1N33L 1VQ9A 1I3QB 3JAMc 5BN4A 4WJ4A 2K04A 5ELDA 1VQPA 1G6ZA 2K75A 3T1YL 4HTHA 3J81i 4A93G 3GTQH 3JAMi 5I2XA 2HHHQ 1BDOA 1HFGA 3PUYA 2F0OA 1C4QA 2MUYA 4YWMA 1R4PB 1A3TA 1HJPA 1L0XB 2KCNA 1JT8A 2UUAQ 1BNZA 1EY0A 4NXML 2R7ZG 3EQLC 4C3HG 3J7AV 5C0XI 1LTAD 1PH3A 1QWYA 1F9PA 4R8NA 2XRQD 4C56C 3UDGA 1GUOA 2ZM6L 3I3CA 1JORA 3TZDA 1EQRA 1NBWA 2UUAL 4A3DG 5CORA 1DONA 3DLLA 2ATWA 4R8IA 4LFAL 1F2ZA 1NAPA 2F3IA 2E2JB 2WV6D 1K83B 2UXBQ 1FGUA 2PMZE 1TS4A 3DWAA 4X3UA 5CYUA 3GTMH 3J7A5 1WYDA 4X66L 2JJQA 1N33Q 2I5HA 4DV4Q 2F3VA 4IUVA 3AQQA 2JA5H 3N52A 1CI3M 2L15A 1STYA 4IPGA 3I4MG 3VYTA 1E24A 4AQYL 3X3NA 5IWAQ 3CCQA 1YHQA 5JJKA 3PF4A 2OQ0A 1WD1A 2ZJQA 5CV7A 1PFSA 1STAA 3IFDA 3OW2A 1BF4A 2NTSA 1H95A 3GV6A 3NPPA 3TDQA 1YHAA 3HOVH 1TWCH 3U58A 3S16H 1PH6A 1LABA 1EUJA 4FXKC 5C4XG 1DD2A 2A69C 2O2LD 4OL7A 2WKDA 3ULLA 4LUVA 4AYBB 1UE5A 3GO5A 3G7LA 5CR3A 3SEBA 1G291 1KC8C 2HUGA 1RDPD 3MEFA 4BY1G 4C1NK 3RZDH 2K03A 2ZXRA 1EEFD 2B2YC 4XYQA 2K5QA 4MNOA 3HKSA 2OCEA 3KK7A 1GUGA 2ENBA 2FFKB 3R8BA 1B9MA 5GAHC 1NMGA 1TWAH 3K7AH 4GOPC 2XGTA 3PUWA 1LUZA 1I6VC 4XQJA 3CP0A 1L0YB 3TSSA 3NBHB 5E7NA 2F0QA 5CV8A 2R6GA 2XVSA 1Q46A 4KHPQ 4LF4Q 1C7YA 4EGVA 4A3IG 1D5MC 2IX0A 1CKMA 3CC7A 1VQ7A 1VQHA 2N55A 2WAQB 3TP6A 2A69D 3RN2A 1VQBA 4LUOA 4PMCA 4XXEA 1EQTA 1ZYRD 1GUNA 2HD3A 2KOLA 5C3WA 3QJYA 5IGEA 1GKHA 2WIIB 5ELFA 3I73A 1K8MA 1JJ2A 4KY6A 1NR2A 2EY1A 3TBIB 3RZOB 5JOBA 2NUCA 4ZUIA 4U68A 1WTQA 1MSGA 4KD4A 5KRUA 4BY7B 1TWHH 3MAQA 2F4VQ 3CW2C 3P7JA 1NCVA 5IYCG 3HKZB 1N32L 1STEA 3RUZA 4GNXC 4A3JB 3GP7A 1WTPA 2K6AA 2I46A 1EYCA 1VQEA 3KF6B 3BZDB 2DJFC 3IFTA 4I65A 4ZQ3A 4K14A 1I4QA 3MHBA 5I6WA 5C0XJ 3I4NH 3TRZA 2KQ3A 2CQOA 4XT3B 4B3TQ 4LF4L 1Q1EA 2CH4W 3E9IA 2K33A 1H9RA 2L4NA 1AH9A 1Q82C 3OIQA 1VQIA 1I50B 1OO9B 2E8GA 2N49A 4FXGC 3T1HQ 1K3BC 3HOUB 3W1GA 2CWAA 4DR5L 2RBMA 4GN3B 4DXFA 4BXXH 4O2DA 2Z1CA 2Q2TA 1Y8PB 4FDBA 3VA5A 1J9OA 3RLOA 3NELA 1QUQA 3PO3G 4K5XA 2EE1A 3PO2G 1Q86C 3J81j 1G51A 1IW7C 1PTOF 1JOKA 1EYDA 3S1RH 3BYYB 1BO0A 1Y1WH 3ND8A 5KNDA 5D3DA 1WTXA 1B1ZA 3MA2B 3Q23A 3MFYA 4KK7A 2EYFA 1T5EA 1UUPA 3CCVA 4K2KA 1SNCA 2XIWA 2FJ2A 4RAUC 4DR2L 3I90A 1AZQA 1XNQL 2QCPX 5K36H 1KAWA 5IGCA 3KLRA 2WAQG 1CQVA 1E2VA 2NWGA 1W3SA 4ME5A 2CQAA 3SK8A 1M90C 1HZ9A 1XWEA 2PYKA 2HHHL 3FVQA 1MI2A 3TP7A 1IBMQ 2RF4A 3A5ZB 1U5KA 3TP5A 4C3JB 1UAPA 2EZVA 3H09A 3ULPA 1O7IA 3CCSA 2K14A 3J80i 4BBSG 3EVQA 5IY0A 1QILA 2FMMA 1W2BA 3S1RB 4LFBQ 2D0OA 4NXNQ 2VXWA 4EVOA 3UDXA 4K5WA 2K32A 1VQKA 1SMYC 2HQLA 2UU9L 2EY2A 4AIMA 2HIVA 4CDEC 1Q90A 5C3EG 3M9BA 4ILWA 3CCJA 4JCVE 1T9HA 4DAPA 1OXTA 1EEID 1QNKA 5JEAJ 1Q8IA 4AYBG 1RCVD 4ODGA 3TP8A 4CGYB 1U4PA 3B6YA 1DCZA 5ELNA 3GTGH 4JI6Q 4RGOS 4K6DA 4ZK9B 2A68C 3T56B 3LX0A 1HA6A 1IZ6A 4XT1B 3PO2B 5I2YA 2Z9HA 4K0KL 1IKMA 1BOSA 4RGMA 4NMZA 3HOXH 1VQLA 2BA0A 1GUTA 1JOQA 2XTIA 2H1EA 4RKLA 1SEBD 3CCMA 5C44B 4DFAA 4FXDA 4RMFA 2A1AA 3BDCA 4HIKA 2WB1B 4YHHQ 1Z47A 1UE6A 4JI3Q 3RMHA 3S17H 5K36G 1XMOQ 4YCVA 2IWHA 2A8VA 2F52A 4JPBW 1W6JA 3HKZE 3CPWA 1VMPA 2IW3A 4X65L 3ITPA 4FO2A 2YTVA 1SE4A 5KNBA 1EY5A 2B63H 3PCOB 1SRUA 4A3GB 2KJXA 2K28A 5HGTA 1TWAB 4IFDG 2JE6I 2RHSB 1BXTA 1DOMA 1I94Q 5JPNC 2IL8A 1F9SA 1I4XA 2NVYB 3AYHB 2VB3X 1XNRQ 3I56A 5JPMC 2MO1A 5CC4A 4H0LC 1F2MA 3NSWA 4BXXG 4GN4B 2A6ED 5JJIA 1KRTA 4X64L 5IYBH 4DV7Q 1IBML 1YITA 4POFA 2NB0A 3A0JA 3JAML 2A6HD 4L63B 3A8JE 3K81C 2MPMA 5ELEA 3TZUA 1PH1A 1Q7YC 2UUCQ 1JWUD 2G9DA 5M5XB 3AMUA 4FYDA 4A3IH 1X3FA 4DU9A 2QDLA 1I4PA 1V1PB 4JI4Q 2K7VA 4TSSA 4DNRB 4A3IB 2E2HB 3L0OA 4IOCA 1ML0D 4NPSA 1P16A 4XQNA 2KEDA 2K50A 1E22A 1SXTA 4ZUJA 1HTPA 4OXPA 1LTID 1TXYA 1ASYA 3HRZC 5JVG3 2QW7A 1HQRD 5A2QE 4U673 4G7HC 3LGJA 3J81E 2D62A 3D4RA 5I6YA 5IE8A 3SVMA 4V190 4YY3Q 2UXDQ 3RLNA 3I4MB 4TVAB 4KD3A 5C4JB 1WTWA 1PZJD 5LMUL 1SNQA 3MXGA 1A62A 2A6EC 3QG1A 2NVXH 4C3IH 2I07B 1BCPD 4A3EH 1V9PA 1K3RA 2B8FA 3M4PA 5FLXL 2FXQA 3W1BA 2QF7A 2F0IA 1IBLL 4GKJL 3DM3A 3HS0C 3QB3A 4C1NI 1TIID 1C9OA 3HOWB 1G6PA 1AZPA 1Z9FA 3NBHA 2EVBA 5M3FH 2MJ8A 2OEOA 2FMCA 2JYOA 3I8ZA 4DKAC 1YNJD 1EOVA 1PYBA 3I55A 4RA8A 1IBKL 1QZHA 4DR7L 2R7ZB 1CSPA 4UPAA 3A5UA 1STHA 2B63G 2B8GA 1J6QA 4DV0Q 2DGYA 1YHBA 1DOKA 1IYVA 1YVCA 2D0PA 1SYCA 4GLVB 3J81L 1ONLA 2E75C 3ZJYC 4JC0A 3S2DH 2D2CC 2XN9C 4HIOA 1KXLA 4HMJA 3D4DA 4GOPB 2KBNA 1STNA 2R61A 2VZAA 3S15H 4BBRH 1ESFA 4V0BA 1YNNC 2CCZA 1A2UA 1MBYA 2EOTA 1I6HH 3RZDB 1YNJC 1GXDC 4RWSC 3HOXG 1JJGA 1PH2A 3OTOL 2EIFA 3HOYH 1CA6A 4KLKA 1K28A 2F0KA 4IFDJ 2JA6G 1PLFA 4HCEA 3GTGB 3K7UC 4CDFC 4DK0A 1G91A 1MHWC 3I70A 3H0GB 5BN3A 4GNXB 3U9OA 1WTHA 2OTLA 4KTAA 1EIFA 1VCIA 4KJOA 1U0LA 3GD7A 1K8GA 1SN8A 2BCOA 1JQYD 1HZBA 4OIJA 4R4TA 4R4OA 1BKBA 3PO3H 1EQQA 3CMEA 1E1OA 4A3EB 5G3LD 1A63A 2F0LA 3HEJA 2CW0C 1UE7A 5JAVA 2NTTA 5AFWA 1TQOA 2L12A 2LMCB 2QGQA 4WJ3M 1GO3E 2MFIA 1VF7A 1YJ9A 4DK6C 3S1MH 1AEXA 3GTMB 3TQYA 4EQNA 4M8AA 4LF7Q 2FINB 4JI6L 1B7YB 1SE3A 2SNSA 4KKSA 4DA2A 5KGUA 2NN6G 3MXPA 3CC2A 2LXKA 2WB1G 1WCMB 1HHVA 1FL0A 3O13A 4JI0Q 4HSPA 1W6KA 3M7NA 2JEAI 2VQFQ 3MXNB 2G5DA 1R9TB 1HH2P 3CU7A 3QWNA 1IYUA 3SHLA 3NQTA 3HZXA 3ZYYX 1XMOL 5FO7B 1SNDA 4EX5A 1S5CD 3K59A 4NXNL 3MFGA 4OO1H 1EWHA 1IL8A 3WOEA 2K1BA 3H15A 1KIXA 4CJ0B 4MTKA 1F2LA 2O4XA 1HZCA 2F0SA 1I50H 2BH8A 5E4XA 1F9RA 4PQXA 3F8TA 3D3RA 3GTKH 1XPOA 1JJCB 3VYRA 1EY9A 3PO2H 2SOBA 1B9NA 4XIGS 1BVSA 2B3GA 2EYJA 4X64Q 1RF2D 3DM1A 1BUVT 3JC66 4LWCA 2B63B 5M3MG 1XXGA 2LXJA 4A3CG 2AUKA 1KD1C 4GOPA 4KHPL 1D7QA 1X9NA 4PMBA 1STGA 4YWKA 2HDMA 4DV5L 3PIOA 2I5LX 4ZRZA 5GADC 2VW9A 3I4NG 3J7AF 4GLAC 1HPCA 5C44H 2CWPA 3J81c 2O5IC 5C4XB 3NQIA 3SGIA 1UWVA 2OTJA 5EKIA 2JSOA 2MHVA 4CKBA 1RD9D 2E76C 1PFBA 1YZ6A 2B2TA 4OWTB 5IYCH 1I5FA 4B3MQ 1KL9A 3EJIA 1GHJA 5IYBG 1M4VA 4DV2L 1L0WA 1PFMA 2PMZB 3V05A 3LWEA 5FLXc 1QZGA 4E6IA 1PYSB 3CC4A 1GJXA 1WD0A 3PMFA 1XX8A 1ICWA 3BVMA 1G2TA 4HJ5A 3L7ZC 3AFPA 3W5OA 1V8QA 2AQ1B 3HKZG 1B3AA 1Q3LA 5F2DA 2DNCA 2KECA 4HR7B 4GKJQ 1ENAA 1CKNA 1FNWA 1LTLA 2ZXPA 1SNOA 3C1EA 4RKBA 3CCRA 1ICFB 3OWEB 3S2HB 4G4KA 2OXPA 5M5WB 1NR4A 4HJ9A 3KLSX 3Q6SA 4IO9A 1SAPA 4DR7Q 3GDEA 4N9PA 3DUZA 3NBIA 3T51B 1F9QA 1PTOD 2EXZA 3FPUB 4ZLTF 5BR8Q 4XTCS 1LT4D 2ZJRA 4TRDA 3Q8DA 4AH6A 4JV5Q 1VQ5A 4A3FB 1VDZA 2EXDA 4L8JA 1TWHB 1LYLA 3D8GA 1D2BA 1B4OA 1CZGA 1SNMA 4JBMA 3KDFB 2P5ZX 1VQ4A 3H3VC 3F2CA 2JA5B 4DUYQ 1TT2A 4KJNA 2YYZA 4JI3L 2AKWB 3CRKC 1D5ZC 1SFOH 1SYFA 1P8LA 4HN7A 5C4XH 5LMNW 4IPDA 2F0DA 4JV5L 3H91A 3T53B 3CF5A 1C0AA 1PA6A 3HOVB 4LF8L 2JA8B 1KNEA 1IW7D 4OWXB 3OIPA 1ENFA 1H9MA 2ZTEA 1TY2A 4FP5D 3RZOH 3AEVA 1FNVA 3H3VH 2X6GA 3BDLA 1PV4A 1B2TA 1QVCA 4IPCA 1E7ZA 2QDBA 3OSOA 1FR3A 1N9WA 3D6CA 5HGQA 3AU7A 3U4ZA 5C0XH 1QNUA 3KJOA 1S72A 1ASZA 4GZYC 1G8ZD 1EU3A 4HJ7A 4JI7Q 4BBSH 5CMDA 1N34L 5IWAL 5IYDG 2A73B 3ULJA 2JEBI 3DWPA 3K57A 1ILPA 5C4JH 1A6XA 2EYMA 5IGBA 1EZ6A 2YU9H 2R93G 5EKLA 1SYDA 4JI8Q 5M3FG 5CBEE 3K0XA 1WI5A 5C3EB 1WTOA 2J7ZA 3L9AX 1I3QH 4I7ZC 4L5TA 3QOLA 2O5JC 1JMCA 1SBBB 3I4LA 1JOOA 1NJIC 3HOYB 1GM5A 1PTOH 2ZM6Q 1QVFA 4LK1C 2Q2UA 4NP5A 4P71A 4F8MA 1DYQA 3STBC 2PW7A 2DN8A 5EBDA 4OX9Q 3FHWA 3TEHB 2Q2IA 2DY8A 2AQ3B 1U4MA 3BS1A 2VUMH 5J22A 4ZKBB 1R9TH 1WOCA 4APVA 3GTLB 3RD4A 1U4LA 1VS0A 4M1UB 2BA1A 2K05A 5EPLA 2F4VL 5FLMH 1YJWA 3A8KE 2VQEQ 3M85A 2UUBL 4X62Q 3V2TA 2YTXA 5EGTA 3KFUA 4LF5Q 3DEOA 1A15A 2J4XA 2HIXA 5FJ8H 1KAAA 4A3GH 3U4VA 2A68D 2RHQB 3EROA 4A3JG 3CXCA 2E2IB 3F1ZA 2PW5A 2KEEA 1YI2A 2VS1A 2I0QA 1OXSC 2K5DA 2QEXA 2EYLA 2ID0A 4C3HB 2VQFL 3STBD 1PRTB 3K0YA 5J39A 3G4SA 1HR0W 1TS3A 5IP9H 2JA6B 5IIFA 1L1OA 5D3IB 2UUCL 3K6OA 4PZ7A
chains in the Genus database with same CATH topology
4OXPA 1TXYA 4JI4L 1ASYA 2WP8J 3A74A 2K5NA 1B8AA 1A8VA 2Z0SA 4DV1L 3EN2A 1L2FA 3WWVA 4A3CH 2HT1A 4B3SL 4BY7G 5GROA 3LGJA 4DV2Q 3HOUG 5IT9c 2D62A 4TQUS 2VNUD 3RLFA 5IE8A 2IHFA 4UY8C 4YY3Q 4GKKL 4DUZL 2VL6A 2UXDQ 1Y1VG 3RLNA 1K83H 4TVAB 1FVIA 1JB7A 1KQSA 5LMUL 1A62A 2NVXH 4C3IH 3K80C 2R93H 3UDFA 4B3SQ 4A3EH 1HNXQ 1UEBA 3RN5A 1V9PA 1J5EL 1K3RA 1PHJA 4LFBL 1OXVA 3H0GG 3M4PA 2FXQA 1TWFH 3W1BA 4DAMA 5GAGC 1IBLL 3DM3A 5FJ8G 3ICEA 1PH8A 4GKJL 1C9OA 2KHJA 2VUMG 3HOZH 4DR6L 1CUKA 2NZOA 2YTYA 4P73A 4DV3L 4DR1Q 1I94L 1A0IA 1PVOA 1Z9FA 3CMAA 1HR0Q 5M5WH 5C0XG 4DK3C 4JI2Q 5M3FH 4O0AA 5LMUQ 2GVBA 2ZTCA 4PMWA 4DKAC 5GQOA 1N8RC 1EOVA 1PYBA 3I55A 1IBKL 2NVQH 1HNZQ 1QZHA 4RG1A 4DR7L 4DV5Q 2UUBQ 3PIPA 5IP7H 2JK8A 1CSPA 4UPAA 3A5UA 4LUZA 2B63G 4X66Q 1N33L 1J6QA 1G6PA 3PSIA 3G71A 2DGYA 4DV0Q 1YHBA 4DR3Q 1VQ9A 3GTOH 4A3LG 3JAMc 4A3DH 5M5YH 4OWWB 1YVCA 2D0PA 4WJ4A 1VQPA 4GLVB 2K75A 1KHIA 4NXMQ 3T1YL 3J81i 3ZJYC 3S2DH 4JC0A 4A93G 4HIOA 1KXLA 1WCMG 3GTQH 3JAMi 3TS2A 4GOPB 2KBNA 3CCEA 3HOVG 2HHHQ 2VZAA 3PUYA 3HOZG 3S15H 2EQSA 3S14H 1XTDA 4BBRH 2MO0A 2CCZA 4YWMA 1HJPA 1NTGA 1JT8A 2UUAQ 1I6HH 1X6OA 4NXML 2N78A 2R7ZG 2Y0SG 4JI1Q 3HOXG 1JJGA 5IYDH 2YV5A 1PH2A 2PQAB 4PZ8A 5C0XI 4DR4L 3OTOL 2EIFA 4JG2A 2N8NA 1PH3A 1OXXK 3GTJH 4JI7L 4KLKA 3BZKA 3UDGA 4UP8A 2ZM6L 2JA5G 4IFDJ 3D31A 1EQRA 1XMQQ 1NBWA 1TWGH 2JA6G 3PGZA 2UUAL 2ALYB 4A3DG 2IHEA 4L5SA 3K7UC 4AQYQ 3DLLA 2ATWA 4R4CA 4LFAL 1IBKQ 2KENA 4A3LH 1KRSA 4DR5Q 1E1TA 3HOWG 4LFCL 2F3IA 4GNXB 4K0KQ 2UXBQ 4MTNA 1FGUA 2AHOB 2KCMA 2WB1E 1EIFA 2PMZE 2OTLA 2LSSA 3GTMH 1VCIA 1WYDA 4X66L 1U0LA 1VQAA 2JJQA 3GD7A 2I5HA 1SN8A 4GS3A 1K8GA 1N33Q 4DV4Q 1HZBA 4R4TA 3AQQA 4R4OA 1BKBA 2JA5H 4GN5A 1IBLQ 3PO3H 4DAYB 3CMEA 2L15A 4IPGA 1MJCA 1E1OA 1EQQA 2ASBA 3I4MG 1A63A 1N36L 1E24A 4AQYL 1UE7A 5BR8L 4JBWA 2QGQA 4WJ3M 1K73C 5IWAQ 3CCQA 4ME3A 1VQMA 2R7DA 1YHQA 1GO3E 1YEZA 2MFIA 2OQ0A 3HOWH 3PF4A 1YJ9A 4QL5A 4DK6C 2ZJQA 4A3BH 3S1MH 1PFSA 4GNXA 3OW2A 3TQYA 2K5VA 4YWLA 4LF7Q 1H95A 4JI6L 1B7YB 4HIDA 3BZCA 2V1CC 1YHAA 2NN6G 4JI1L 3HOVH 4P74A 3CC2A 2LXKA 1TWCH 3G48A 3U58A 4LF6L 2WB1G 1PH6A 3S16H 1CSQA 4H02A 5J3BA 1FL0A 1N32Q 1EUJA 2OWOA 1L1OB 3NENA 4JI0Q 3KLWA 1NE3A 5C4XG 3M7NA 4JOIC 3ULLA 1HNWQ 4LUVA 2VQFQ 3MXNB 3F2DA 2JEAI 1UE5A 3GO5A 1BBWA 4DV0L 2PI2E 4DR3L 4A3EG 1MJEA 3NEMA 3KF6A 4A3KH 1EIYB 1HH2P 1E3PA 1G291 4BBRG 1YJNA 1KC8C 4IFDI 3MEFA 4LF8Q 4BY1G 4LFCQ 3RZDH 5ELOA 3J80c 4LF5L 3EBEA 3OYYA 2ZTDA 4DV1Q 1XMOL 2DUDA 5LMNQ 3CPFA 2C35B 4EX5A 5AJ3Q 4DV6L 4YCWA 4MNOA 4PG3A 3HKSA 4NXNL 1CKNB 4DV7L 2OCEA 1K8AC 1PH7A 1VQOA 2NZHA 4BY7H 3H15A 5GAHC 2E2HH 1KIXA 1XNQQ 1NMGA 4JOIA 2UU9Q 1TWAH 1WFQA 3K7AH 3S24A 1NMFA 1HZCA 3KYHC 1I50H 2BH8A 3RR5A 4GOPC 1RL2A 2XGTA 3PUWA 1LUZA 3CP0A 3F8TA 3PUZA 5IP9G 3GTKH 2R92G 3NBHB 1JJCB 3VDYA 3I7FA 5E7NA 1XPOA 3CCUA 3PO2H 4HJ8A 4LFAQ 2R6GA 1Q46A 4KHPQ 4LF4Q 1GVPA 4XIGS 1C7YA 1BVSA 1Y1VH 4A3IG 1S40A 2B3GA 2IX0A 4X64Q 1CKMA 3JC66 4LWCA 4JI2L 5JJKA 3CC7A 1VQ7A 1VQHA 1Y14B 3RN2A 1VQBA 5M3MG 1YNXA 2ZJPA 2LXJA 4LUOA 5JJLA 1SMXA 4A3CG 2UXCL 1KD1C 1SR3A 1VQCA 2AWOA 4GOPA 4KHPL 1HNZL 3S1QH 1GKHA 1D7QA 1B70B 1X9NA 4IPHA 4OONA 1JJ2A 1Q8KA 4YWKA 4DV5L 3PIOA 2I5LX 5GADC 1MIUA 2VW9A 3I4NG 1TWHH 3TS0A 4GLAC 4LF7L 2OQKA 1L1OC 5FLMG 3KDFA 5C44H 2CWPA 3CW2C 3J81c 1HNXL 2F4VQ 2R7FA 3SGIA 5IYCG 1N32L 4GNXC 1UWVA 2OTJA 1PH4A 3KOJA 3TREA 5DLQE 1Q81C 1IL2A 1VQ6A 2MNAA 1VQEA 1YZ6A 1EWIA 4OWTB 1I5FA 5IYCH 4B3MQ 3KF6B 4Y52H 1KL9A 5IYBG 1K9MC 2MQHA 4DV2L 1L0WA 4BA2I 4GKKQ 5C0XJ 3I4NH 3TRZA 1Q1BA 3PV0A 5FLXc 1QZGA 3UE1A 1PYSB 3BJUA 4AYBE 1N36Q 3CC4A 1SROA 2CQOA 4B3TQ 2KCTA 3M4OH 2AMCB 1Q1EA 3CQZH 1D8LA 3E9IA 4LF4L 1RIPA 1V1QA 3HOYH 4HJ5A 3EIVA 4C2MH 1Q82C 3L7ZC 3UDIA 3AFPA 4JYAL 1AH9A 3W5OA 3HKZG 2NN6I 1VQIA 3BU2A 2IX1A 4QJFA 2E8GA 2N49A 3T1HQ 4R4IA 3W1GA 2CWAA 4DR5L 2Z6KC 4A3FG 4GKJQ 4GN3B 4JI5L 1CKNA 4BXXH 4O2DA 1LTLA 2Q2TA 4A3GG 3CCRA 4FDBA 1BBUA 1LM0A 4B3RL 3RLOA 3NELA 1QUQA 1X56A 2E2JH 3I4MH 3AFQA 3PO3G 4HJ9A 1HZAA 4A3MG 4R1JA 3PO2G 2JA7H 2UXBL 1Q86C 3J81j 3U50C 1FJGL 1G51A 1M1KC 1DGSA 4IO9A 3S1RH 4DR7Q 3GDEA 1Y1WH 4A4IA 4DUZQ 4YY3L 2UXDL 4A3BG 4BY1H 2PNHA 4DR4Q 3FKIG 2NVTH 2A19A 4DUYL 4QGUA 3E9HA 2Y0SE 5BR8Q 4XTCS 4DV6Q 2ZJRA 4B3RQ 4NB3A 3CCVA 1YIJA 2JA8G 2UXCQ 2I5MX 2JA6H 3Q8DA 1YBYA 4AH6A 1VQ5A 4JV5Q 4DR2L 4UP9A 2EXDA 1XNRL 5C3EH 1LYLA 4ALPA 1XNQL 4POGA 5GAEC 1KAWA 2WAQE 2BH2A 4JBMA 3K8AA 3KDFB 1VQ4A 1JE5A 3F2CA 4DUYQ 2WAQG 2GN5A 4LF9L 1W3SA 2K52A 2R7ZH 2YYZA 4JI3L 1M90C 1HZ9A 2AKWB 4A3KG 2HHHL 1Q12A 4UP7A 1IBMQ 2RF4A 1SFOH 3A5ZB 1P8LA 1U5KA 4OX9L 3H3VI 1X65A 1OTCA 3ULPA 4P75A 4QY7A 5C4XH 1XPUA 1O7IA 4IPDA 2K14A 2WFWA 3KF8B 3J80i 3CCSA 5LMNW 1AE2A 2QA4A 3I2ZA 5LMNL 4BBSG 4JV5L 3CF5A 5IY0A 1C0AA 2JQOA 1PA6A 3L2PA 1VQGA 1W2BA 5JEAG 3FP9A 4LF8L 3E0EA 1SE8A 3J7ZC 4C3HH 2VQEL 1J5EQ 4LFBQ 2GVAA 4IJLA 1FJGQ 4OWXB 2D0OA 1XJVA 3ER0A 4NXNQ 2ZTEA 5HY6A 5H1SE 3G6EA 4B3ML 3RZOH 3T1YQ 3UDXA 3AEVA 3S2HH 3H3VH 1VQKA 4OO1I 1PV4A 4R4QA 3M3YH 1S3OA 1QVCA 2HQLA 2PI2A 3HFZB 2UU9L 4IPCA 1E7ZA 4B3TL 1WCMH 4AIMA 2HIVA 1Y1WG 4DV3Q 1XPRA 1N9WA 5C3EG 5HGQA 4X6AH 2CFMA 3M9BA 4Y7NH 4A3MH 3U4ZA 3KJOA 1S72A 3CCJA 1ASZA 4JCVE 5M5XH 1T9HA 3T1HL 1OXTA 5JEAJ 4HJ7A 3HOYG 4MZ9A 4JI7Q 3OTOQ 4BBSH 1N34L 5IWAL 5IYDG 4JBJA 4AYBG 4KHZA 3ULJA 3H0GH 2JEBI 3J7A5 3FKIH 5C4JH 3S1NH 3B6YA 2VY3A 2CKZB 5ELNA 3GTGH 4JI6Q 3GTLH 2YU9H 2R93G 2AWNA 1QUQB 2K4KA 1VQNA 1VQDA 4JI8Q 4LW1A 5M3FG 3K0XA 1WI5A 4J15A 4DPGA 1IZ6A 4KI0A 2IT1A 4K0KL 1I3QH 2RCNA 1VQ8A 1HNWL 1OXUA 4L5TA 3D0FA 2K5HA 1MKHA 3HOXH 1VQLA 2BA0A 1JMCA 4DV4L 2IY5B 2XTIA 3CCMA 1NJIC 1SLJA 4RMFA 1IXRA 4X65Q 1GM5A 2E5LL 2A1AA 4DR2Q 5IP7G 2ZM6Q 4HIKA 1QVFA 3CD6A 1NY4A 4YHHQ 2Q2UA 4DNIA 4LNQA 4QIWE 4L5QA 1Z47A 4P71A 2JA9A 5AJ3L 3CCLA 4A93H 1UE6A 4JI3Q 3S17H 3STBC 5K36G 1XMOQ 4P72A 4YCVA 2A8VA 2F52A 4A76A 2B29A 1PH9A 2JA7G 3HKZE 1K0RA 2PQAA 3ERSX 1X54A 3I4OA 3CPWA 4X65L 1XMQL 2ES2A 3FHWA 3TEHB 4OX9Q 2JA8H 3GTPH 2Q2IA 3F2BA 2YTVA 3M4QA 2VUMH 4DR6Q 3CAMA 1VQFA 5EAYA 2B63H 3PCOB 4YHHL 1SRUA 4YCUA 1QVGA 1R9TH 1WOCA 4APVA 4IFDG 2JE6I 4JI0L 2RHSB 1HR0L 1WJJA 4A3JH 4GLXA 1I94Q 1VS0A 3AYHB 2BA1A 2F4VL 5FLMH 3PUVA 5C44G 2VQEQ 3M85A 1CKOA 1YJWA 2UUBL 1XNRQ 4JI5Q 4X62Q 2NVYH 1VQJA 3I56A 2YTXA 2KHIA 3KFUA 4LF9Q 4LF5Q 1V43A 4QQBX 2HIXA 2MO1A 5FJ8H 4IOAA 4A3GH 3PF5A 1X3EA 4BXXG 4GN4B 4A3FH 5JJIA 1IYJB 1KRTA 4X64L 3U4VA 4JBKA 5IYBH 4DV7Q 2RHQB 4C3JH 1AE3A 3KJPA 1YITA 1IBML 4POFA 3A0JA 2H5XA 3CXCA 4A3JG 3F1ZA 1X55A 4X62L 3RNUA 5M3MH 4A75A 1YI2A 3K81C 1EYGA 1PH1A 2E2IH 1EFWA 2VS1A 4PZ6A 1Q7YC 2UUCQ 4DR1L 1N34Q 1OXSC 2E5LQ 2I0QA 1X3GA 2Z6KA 2ID0A 2QEXA 1X3FA 4A3IH 4LF6Q 2VQFL 3STBD 4HJAA 4JYAQ 1GD7A 4BA1I 4JI4Q 4OO1G 4L5RC 2Q2HA 4IJHA 3L0OA 3G4SA 4IOCA 1HR0W 3HOUH 3UE0A 2R92H 4HIMA 5IP9H 1UE1A 2N3SA 4NPSA 1P16A 3IRBA 4EQ5A 1L1OA 2K50A 3PUXA 1E22A 2UUCL 4JI8L 1PH5A 4PZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OXP A;  1TXY A;  4JI4 L;  1ASY A;  2WP8 J;  3A74 A;  2K5N A;  1B8A A;  1A8V A;  2Z0S A;  4DV1 L;  3EN2 A;  1L2F A;  3WWV A;  4A3C H;  2HT1 A;  4B3S L;  4BY7 G;  5GRO A;  3LGJ A;  4DV2 Q;  3HOU G;  5IT9 c;  2D62 A;  4TQU S;  2VNU D;  3RLF A;  5IE8 A;  2IHF A;  4UY8 C;  4YY3 Q;  4GKK L;  4DUZ L;  2VL6 A;  2UXD Q;  1Y1V G;  3RLN A;  1K83 H;  4TVA B;  1FVI A;  1JB7 A;  1KQS A;  5LMU L;  1A62 A;  2NVX H;  4C3I H;  3K80 C;  2R93 H;  3UDF A;  4B3S Q;  4A3E H;  1HNX Q;  1UEB A;  3RN5 A;  1V9P A;  1J5E L;  1K3R A;  1PHJ A;  4LFB L;  1OXV A;  3H0G G;  3M4P A;  2FXQ A;  1TWF H;  3W1B A;  4DAM A;  5GAG C;  1IBL L;  3DM3 A;  5FJ8 G;  3ICE A;  1PH8 A;  4GKJ L;  1C9O A;  2KHJ A;  2VUM G;  3HOZ H;  4DR6 L;  1CUK A;  2NZO A;  2YTY A;  4P73 A;  4DV3 L;  4DR1 Q;  1I94 L;  1A0I A;  1PVO A;  1Z9F A;  3CMA A;  1HR0 Q;  5M5W H;  5C0X G;  4DK3 C;  4JI2 Q;  5M3F H;  4O0A A;  5LMU Q;  2GVB A;  2ZTC A;  4PMW A;  4DKA C;  5GQO A;  1N8R C;  1EOV A;  1PYB A;  3I55 A;  1IBK L;  2NVQ H;  1HNZ Q;  1QZH A;  4RG1 A;  4DR7 L;  4DV5 Q;  2UUB Q;  3PIP A;  5IP7 H;  2JK8 A;  1CSP A;  4UPA A;  3A5U A;  4LUZ A;  2B63 G;  4X66 Q;  1N33 L;  1J6Q A;  1G6P A;  3PSI A;  3G71 A;  2DGY A;  4DV0 Q;  1YHB A;  4DR3 Q;  1VQ9 A;  3GTO H;  4A3L G;  3JAM c;  4A3D H;  5M5Y H;  4OWW B;  1YVC A;  2D0P A;  4WJ4 A;  1VQP A;  4GLV B;  2K75 A;  1KHI A;  4NXM Q;  3T1Y L;  3J81 i;  3ZJY C;  3S2D H;  4JC0 A;  4A93 G;  4HIO A;  1KXL A;  1WCM G;  3GTQ H;  3JAM i;  3TS2 A;  4GOP B;  2KBN A;  3CCE A;  3HOV G;  2HHH Q;  2VZA A;  3PUY A;  3HOZ G;  3S15 H;  2EQS A;  3S14 H;  1XTD A;  4BBR H;  2MO0 A;  2CCZ A;  4YWM A;  1HJP A;  1NTG A;  1JT8 A;  2UUA Q;  1I6H H;  1X6O A;  4NXM L;  2N78 A;  2R7Z G;  2Y0S G;  4JI1 Q;  3HOX G;  1JJG A;  5IYD H;  2YV5 A;  1PH2 A;  2PQA B;  4PZ8 A;  5C0X I;  4DR4 L;  3OTO L;  2EIF A;  4JG2 A;  2N8N A;  1PH3 A;  1OXX K;  3GTJ H;  4JI7 L;  4KLK A;  3BZK A;  3UDG A;  4UP8 A;  2ZM6 L;  2JA5 G;  4IFD J;  3D31 A;  1EQR A;  1XMQ Q;  1NBW A;  1TWG H;  2JA6 G;  3PGZ A;  2UUA L;  2ALY B;  4A3D G;  2IHE A;  4L5S A;  3K7U C;  4AQY Q;  3DLL A;  2ATW A;  4R4C A;  4LFA L;  1IBK Q;  2KEN A;  4A3L H;  1KRS A;  4DR5 Q;  1E1T A;  3HOW G;  4LFC L;  2F3I A;  4GNX B;  4K0K Q;  2UXB Q;  4MTN A;  1FGU A;  2AHO B;  2KCM A;  2WB1 E;  1EIF A;  2PMZ E;  2OTL A;  2LSS A;  3GTM H;  1VCI A;  1WYD A;  4X66 L;  1U0L A;  1VQA A;  2JJQ A;  3GD7 A;  2I5H A;  1SN8 A;  4GS3 A;  1K8G A;  1N33 Q;  4DV4 Q;  1HZB A;  4R4T A;  3AQQ A;  4R4O A;  1BKB A;  2JA5 H;  4GN5 A;  1IBL Q;  3PO3 H;  4DAY B;  3CME A;  2L15 A;  4IPG A;  1MJC A;  1E1O A;  1EQQ A;  2ASB A;  3I4M G;  1A63 A;  1N36 L;  1E24 A;  4AQY L;  1UE7 A;  5BR8 L;  4JBW A;  2QGQ A;  4WJ3 M;  1K73 C;  5IWA Q;  3CCQ A;  4ME3 A;  1VQM A;  2R7D A;  1YHQ A;  1GO3 E;  1YEZ A;  2MFI A;  2OQ0 A;  3HOW H;  3PF4 A;  1YJ9 A;  4QL5 A;  4DK6 C;  2ZJQ A;  4A3B H;  3S1M H;  1PFS A;  4GNX A;  3OW2 A;  3TQY A;  2K5V A;  4YWL A;  4LF7 Q;  1H95 A;  4JI6 L;  1B7Y B;  4HID A;  3BZC A;  2V1C C;  1YHA A;  2NN6 G;  4JI1 L;  3HOV H;  4P74 A;  3CC2 A;  2LXK A;  1TWC H;  3G48 A;  3U58 A;  4LF6 L;  2WB1 G;  1PH6 A;  3S16 H;  1CSQ A;  4H02 A;  5J3B A;  1FL0 A;  1N32 Q;  1EUJ A;  2OWO A;  1L1O B;  3NEN A;  4JI0 Q;  3KLW A;  1NE3 A;  5C4X G;  3M7N A;  4JOI C;  3ULL A;  1HNW Q;  4LUV A;  2VQF Q;  3MXN B;  3F2D A;  2JEA I;  1UE5 A;  3GO5 A;  1BBW A;  4DV0 L;  2PI2 E;  4DR3 L;  4A3E G;  1MJE A;  3NEM A;  3KF6 A;  4A3K H;  1EIY B;  1HH2 P;  1E3P A;  1G29 1;  4BBR G;  1YJN A;  1KC8 C;  4IFD I;  3MEF A;  4LF8 Q;  4BY1 G;  4LFC Q;  3RZD H;  5ELO A;  3J80 c;  4LF5 L;  3EBE A;  3OYY A;  2ZTD A;  4DV1 Q;  1XMO L;  2DUD A;  5LMN Q;  3CPF A;  2C35 B;  4EX5 A;  5AJ3 Q;  4DV6 L;  4YCW A;  4MNO A;  4PG3 A;  3HKS A;  4NXN L;  1CKN B;  4DV7 L;  2OCE A;  1K8A C;  1PH7 A;  1VQO A;  2NZH A;  4BY7 H;  3H15 A;  5GAH C;  2E2H H;  1KIX A;  1XNQ Q;  1NMG A;  4JOI A;  2UU9 Q;  1TWA H;  1WFQ A;  3K7A H;  3S24 A;  1NMF A;  1HZC A;  3KYH C;  1I50 H;  2BH8 A;  3RR5 A;  4GOP C;  1RL2 A;  2XGT A;  3PUW A;  1LUZ A;  3CP0 A;  3F8T A;  3PUZ A;  5IP9 G;  3GTK H;  2R92 G;  3NBH B;  1JJC B;  3VDY A;  3I7F A;  5E7N A;  1XPO A;  3CCU A;  3PO2 H;  4HJ8 A;  4LFA Q;  2R6G A;  1Q46 A;  4KHP Q;  4LF4 Q;  1GVP A;  4XIG S;  1C7Y A;  1BVS A;  1Y1V H;  4A3I G;  1S40 A;  2B3G A;  2IX0 A;  4X64 Q;  1CKM A;  3JC6 6;  4LWC A;  4JI2 L;  5JJK A;  3CC7 A;  1VQ7 A;  1VQH A;  1Y14 B;  3RN2 A;  1VQB A;  5M3M G;  1YNX A;  2ZJP A;  2LXJ A;  4LUO A;  5JJL A;  1SMX A;  4A3C G;  2UXC L;  1KD1 C;  1SR3 A;  1VQC A;  2AWO A;  4GOP A;  4KHP L;  1HNZ L;  3S1Q H;  1GKH A;  1D7Q A;  1B70 B;  1X9N A;  4IPH A;  4OON A;  1JJ2 A;  1Q8K A;  4YWK A;  4DV5 L;  3PIO A;  2I5L X;  5GAD C;  1MIU A;  2VW9 A;  3I4N G;  1TWH H;  3TS0 A;  4GLA C;  4LF7 L;  2OQK A;  1L1O C;  5FLM G;  3KDF A;  5C44 H;  2CWP A;  3CW2 C;  3J81 c;  1HNX L;  2F4V Q;  2R7F A;  3SGI A;  5IYC G;  1N32 L;  4GNX C;  1UWV A;  2OTJ A;  1PH4 A;  3KOJ A;  3TRE A;  5DLQ E;  1Q81 C;  1IL2 A;  1VQ6 A;  2MNA A;  1VQE A;  1YZ6 A;  1EWI A;  4OWT B;  1I5F A;  5IYC H;  4B3M Q;  3KF6 B;  4Y52 H;  1KL9 A;  5IYB G;  1K9M C;  2MQH A;  4DV2 L;  1L0W A;  4BA2 I;  4GKK Q;  5C0X J;  3I4N H;  3TRZ A;  1Q1B A;  3PV0 A;  5FLX c;  1QZG A;  3UE1 A;  1PYS B;  3BJU A;  4AYB E;  1N36 Q;  3CC4 A;  1SRO A;  2CQO A;  4B3T Q;  2KCT A;  3M4O H;  2AMC B;  1Q1E A;  3CQZ H;  1D8L A;  3E9I A;  4LF4 L;  1RIP A;  1V1Q A;  3HOY H;  4HJ5 A;  3EIV A;  4C2M H;  1Q82 C;  3L7Z C;  3UDI A;  3AFP A;  4JYA L;  1AH9 A;  3W5O A;  3HKZ G;  2NN6 I;  1VQI A;  3BU2 A;  2IX1 A;  4QJF A;  2E8G A;  2N49 A;  3T1H Q;  4R4I A;  3W1G A;  2CWA A;  4DR5 L;  2Z6K C;  4A3F G;  4GKJ Q;  4GN3 B;  4JI5 L;  1CKN A;  4BXX H;  4O2D A;  1LTL A;  2Q2T A;  4A3G G;  3CCR A;  4FDB A;  1BBU A;  1LM0 A;  4B3R L;  3RLO A;  3NEL A;  1QUQ A;  1X56 A;  2E2J H;  3I4M H;  3AFQ A;  3PO3 G;  4HJ9 A;  1HZA A;  4A3M G;  4R1J A;  3PO2 G;  2JA7 H;  2UXB L;  1Q86 C;  3J81 j;  3U50 C;  1FJG L;  1G51 A;  1M1K C;  1DGS A;  4IO9 A;  3S1R H;  4DR7 Q;  3GDE A;  1Y1W H;  4A4I A;  4DUZ Q;  4YY3 L;  2UXD L;  4A3B G;  4BY1 H;  2PNH A;  4DR4 Q;  3FKI G;  2NVT H;  2A19 A;  4DUY L;  4QGU A;  3E9H A;  2Y0S E;  5BR8 Q;  4XTC S;  4DV6 Q;  2ZJR A;  4B3R Q;  4NB3 A;  3CCV A;  1YIJ A;  2JA8 G;  2UXC Q;  2I5M X;  2JA6 H;  3Q8D A;  1YBY A;  4AH6 A;  1VQ5 A;  4JV5 Q;  4DR2 L;  4UP9 A;  2EXD A;  1XNR L;  5C3E H;  1LYL A;  4ALP A;  1XNQ L;  4POG A;  5GAE C;  1KAW A;  2WAQ E;  2BH2 A;  4JBM A;  3K8A A;  3KDF B;  1VQ4 A;  1JE5 A;  3F2C A;  4DUY Q;  2WAQ G;  2GN5 A;  4LF9 L;  1W3S A;  2K52 A;  2R7Z H;  2YYZ A;  4JI3 L;  1M90 C;  1HZ9 A;  2AKW B;  4A3K G;  2HHH L;  1Q12 A;  4UP7 A;  1IBM Q;  2RF4 A;  1SFO H;  3A5Z B;  1P8L A;  1U5K A;  4OX9 L;  3H3V I;  1X65 A;  1OTC A;  3ULP A;  4P75 A;  4QY7 A;  5C4X H;  1XPU A;  1O7I A;  4IPD A;  2K14 A;  2WFW A;  3KF8 B;  3J80 i;  3CCS A;  5LMN W;  1AE2 A;  2QA4 A;  3I2Z A;  5LMN L;  4BBS G;  4JV5 L;  3CF5 A;  5IY0 A;  1C0A A;  2JQO A;  1PA6 A;  3L2P A;  1VQG A;  1W2B A;  5JEA G;  3FP9 A;  4LF8 L;  3E0E A;  1SE8 A;  3J7Z C;  4C3H H;  2VQE L;  1J5E Q;  4LFB Q;  2GVA A;  4IJL A;  1FJG Q;  4OWX B;  2D0O A;  1XJV A;  3ER0 A;  4NXN Q;  2ZTE A;  5HY6 A;  5H1S E;  3G6E A;  4B3M L;  3RZO H;  3T1Y Q;  3UDX A;  3AEV A;  3S2H H;  3H3V H;  1VQK A;  4OO1 I;  1PV4 A;  4R4Q A;  3M3Y H;  1S3O A;  1QVC A;  2HQL A;  2PI2 A;  3HFZ B;  2UU9 L;  4IPC A;  1E7Z A;  4B3T L;  1WCM H;  4AIM A;  2HIV A;  1Y1W G;  4DV3 Q;  1XPR A;  1N9W A;  5C3E G;  5HGQ A;  4X6A H;  2CFM A;  3M9B A;  4Y7N H;  4A3M H;  3U4Z A;  3KJO A;  1S72 A;  3CCJ A;  1ASZ A;  4JCV E;  5M5X H;  1T9H A;  3T1H L;  1OXT A;  5JEA J;  4HJ7 A;  3HOY G;  4MZ9 A;  4JI7 Q;  3OTO Q;  4BBS H;  1N34 L;  5IWA L;  5IYD G;  4JBJ A;  4AYB G;  4KHZ A;  3ULJ A;  3H0G H;  2JEB I;  3J7A 5;  3FKI H;  5C4J H;  3S1N H;  3B6Y A;  2VY3 A;  2CKZ B;  5ELN A;  3GTG H;  4JI6 Q;  3GTL H;  2YU9 H;  2R93 G;  2AWN A;  1QUQ B;  2K4K A;  1VQN A;  1VQD A;  4JI8 Q;  4LW1 A;  5M3F G;  3K0X A;  1WI5 A;  4J15 A;  4DPG A;  1IZ6 A;  4KI0 A;  2IT1 A;  4K0K L;  1I3Q H;  2RCN A;  1VQ8 A;  1HNW L;  1OXU A;  4L5T A;  3D0F A;  2K5H A;  1MKH A;  3HOX H;  1VQL A;  2BA0 A;  1JMC A;  4DV4 L;  2IY5 B;  2XTI A;  3CCM A;  1NJI C;  1SLJ A;  4RMF A;  1IXR A;  4X65 Q;  1GM5 A;  2E5L L;  2A1A A;  4DR2 Q;  5IP7 G;  2ZM6 Q;  4HIK A;  1QVF A;  3CD6 A;  1NY4 A;  4YHH Q;  2Q2U A;  4DNI A;  4LNQ A;  4QIW E;  4L5Q A;  1Z47 A;  4P71 A;  2JA9 A;  5AJ3 L;  3CCL A;  4A93 H;  1UE6 A;  4JI3 Q;  3S17 H;  3STB C;  5K36 G;  1XMO Q;  4P72 A;  4YCV A;  2A8V A;  2F52 A;  4A76 A;  2B29 A;  1PH9 A;  2JA7 G;  3HKZ E;  1K0R A;  2PQA A;  3ERS X;  1X54 A;  3I4O A;  3CPW A;  4X65 L;  1XMQ L;  2ES2 A;  3FHW A;  3TEH B;  4OX9 Q;  2JA8 H;  3GTP H;  2Q2I A;  3F2B A;  2YTV A;  3M4Q A;  2VUM H;  4DR6 Q;  3CAM A;  1VQF A;  5EAY A;  2B63 H;  3PCO B;  4YHH L;  1SRU A;  4YCU A;  1QVG A;  1R9T H;  1WOC A;  4APV A;  4IFD G;  2JE6 I;  4JI0 L;  2RHS B;  1HR0 L;  1WJJ A;  4A3J H;  4GLX A;  1I94 Q;  1VS0 A;  3AYH B;  2BA1 A;  2F4V L;  5FLM H;  3PUV A;  5C44 G;  2VQE Q;  3M85 A;  1CKO A;  1YJW A;  2UUB L;  1XNR Q;  4JI5 Q;  4X62 Q;  2NVY H;  1VQJ A;  3I56 A;  2YTX A;  2KHI A;  3KFU A;  4LF9 Q;  4LF5 Q;  1V43 A;  4QQB X;  2HIX A;  2MO1 A;  5FJ8 H;  4IOA A;  4A3G H;  3PF5 A;  1X3E A;  4BXX G;  4GN4 B;  4A3F H;  5JJI A;  1IYJ B;  1KRT A;  4X64 L;  3U4V A;  4JBK A;  5IYB H;  4DV7 Q;  2RHQ B;  4C3J H;  1AE3 A;  3KJP A;  1YIT A;  1IBM L;  4POF A;  3A0J A;  2H5X A;  3CXC A;  4A3J G;  3F1Z A;  1X55 A;  4X62 L;  3RNU A;  5M3M H;  4A75 A;  1YI2 A;  3K81 C;  1EYG A;  1PH1 A;  2E2I H;  1EFW A;  2VS1 A;  4PZ6 A;  1Q7Y C;  2UUC Q;  4DR1 L;  1N34 Q;  1OXS C;  2E5L Q;  2I0Q A;  1X3G A;  2Z6K A;  2ID0 A;  2QEX A;  1X3F A;  4A3I H;  4LF6 Q;  2VQF L;  3STB D;  4HJA A;  4JYA Q;  1GD7 A;  4BA1 I;  4JI4 Q;  4OO1 G;  4L5R C;  2Q2H A;  4IJH A;  3L0O A;  3G4S A;  4IOC A;  1HR0 W;  3HOU H;  3UE0 A;  2R92 H;  4HIM A;  5IP9 H;  1UE1 A;  2N3S A;  4NPS A;  1P16 A;  3IRB A;  4EQ5 A;  1L1O A;  2K50 A;  3PUX A;  1E22 A;  2UUC L;  4JI8 L;  1PH5 A;  4PZ7 A; 
#chains in the Genus database with same CATH topology
 4JI4 L;  2WP8 J;  2F0U A;  1A8V A;  1L2F A;  2HT1 A;  3MTS A;  3KF8 A;  4B3S L;  3I4N B;  5GRO A;  5E3F A;  1WVL A;  3S1N B;  1H9K A;  2VNU D;  4IUT A;  4GKK L;  2XSC A;  2VL6 A;  5NUC A;  1K83 H;  1TS5 A;  4IN3 A;  1HTL D;  4Y7N B;  4A3M B;  2R93 H;  2SEB D;  1A3V A;  1HNX Q;  2NVT B;  1J5E L;  1PHJ A;  1OXV A;  5C4H A;  4G57 A;  1TWF H;  3ICE A;  1PH8 A;  2VUM G;  1CUK A;  4DV3 L;  2YTY A;  3KBX A;  1I94 L;  1GUS A;  2MGS A;  2JA7 B;  5M5W H;  3MVV A;  5LMU Q;  2F0G A;  1EY8 A;  5LL6 S;  2QEJ C;  1IHZ A;  1D1K A;  3KBG A;  3PIP A;  5IP7 H;  1EWC A;  4K5V A;  1M8A A;  4DR3 Q;  3G71 A;  3GTO H;  1NUC A;  5M5Y H;  4OWW B;  2ICE C;  2F0M A;  4DNT B;  2BDO A;  2EYP A;  1KHI A;  3TS2 A;  3VR6 A;  3HOV G;  4KKT A;  5M9O A;  3HOZ G;  5JJZ A;  2EQS A;  4K8I A;  3S14 H;  3A54 A;  4JVZ A;  2MO0 A;  2NBF A;  3VR3 A;  3A55 A;  1CQF A;  5T1I A;  1NTG A;  2N78 A;  2Y0S G;  5IYD H;  2YV5 A;  1KAB A;  2KVM A;  4DR4 L;  4JG2 A;  3BDO A;  2N8N A;  3BZK A;  2C5C A;  3NUC A;  2XWJ B;  1TY0 A;  1S4Z A;  2JA5 G;  3IKJ A;  1XMQ Q;  2ALY B;  2CVR A;  3GQB A;  3DWQ A;  1IBK Q;  1I6H B;  1HCZ A;  1KRS A;  4DR5 Q;  1E1T A;  2KHS A;  4LFC L;  3HOW G;  2KA7 A;  2F0W A;  1X3P A;  2KCM A;  2AHO B;  4MTN A;  2WB1 E;  4HED A;  1VQA A;  5EQ0 A;  1K0S A;  4GN5 A;  1IBL Q;  4DAY B;  5M3F B;  1N36 L;  1JIC A;  5BR8 L;  4JBW A;  5M3M B;  1VQM A;  4ME3 A;  1YEZ A;  4A3L G;  1UEA B;  4QL5 A;  4A3B H;  4RHR A;  3DEP A;  4BWG B;  4GNX A;  4XDX A;  2K5V A;  4YWL A;  2YU9 B;  2EYO A;  2Z6B A;  4HID A;  3BZC A;  2V1C C;  2Z8L A;  1TR5 A;  4JI1 L;  4P74 A;  2B2T C;  3G48 A;  3R93 A;  4MIU A;  4LF6 L;  4OEM B;  2L1B A;  4H02 A;  5J3B A;  3VYU A;  1CZW A;  1L1O B;  2EY5 A;  1LT6 D;  5TSS A;  1CHP D;  1NE3 A;  2PNR C;  4JOI C;  1SYG A;  1HNW Q;  3F2D A;  3CRL C;  3JAM E;  1BBW A;  4DV0 L;  2PI2 E;  4A3E G;  2R92 B;  1QJO A;  4IFD I;  4BBR G;  1YJN A;  5L37 A;  3NE5 B;  2EJF C;  1TKW B;  5EPK A;  4LF8 Q;  4LFC Q;  1SMY D;  3EBE A;  3OYY A;  4WFN 3;  4DV1 Q;  2DUD A;  5AJ3 Q;  2JXM B;  4ZKC B;  4DV7 L;  4CKE A;  1UNS A;  1K8A C;  4OEL B;  5KYL A;  4BY7 H;  2AUJ D;  5G3L F;  2M2L A;  2E2H H;  1JR0 D;  4RHS A;  1CFM A;  2FHT A;  3SK6 A;  5I4D A;  3E6Z X;  2UU9 Q;  3MXN A;  3NWS A;  5KIX A;  1C8C A;  3S24 A;  1NMF A;  4Z9C B;  3KYH C;  4A3B B;  3RR5 A;  5ELB A;  2PO4 A;  1EOT A;  1FYC A;  1NSN S;  1ET6 A;  3P1H A;  4C2M B;  2A74 C;  3PUZ A;  2BE5 D;  3QIA A;  2IX3 A;  3HOX B;  2R92 G;  3I7F A;  4KY5 A;  3OWF A;  4K6L A;  4LFA Q;  4HJ8 A;  1B3Q A;  3ONA B;  1S5B D;  1SE2 A;  4DF7 A;  1AW7 A;  1Y1V H;  1S40 A;  5EJW A;  1EFI D;  2NYZ D;  3PQI A;  2M00 A;  4JI2 L;  4NKL A;  2PZT A;  2K01 A;  3MC0 B;  3HGB A;  1WTR A;  3C1F A;  5JJL A;  5IGD A;  1VQC A;  2NVX B;  4C3I G;  4IPH A;  4OON A;  3S14 B;  3J80 L;  2KCC A;  1JCK B;  5FO9 B;  1I4G A;  1MIU A;  3NTK A;  1KDB A;  1L1O C;  3KDF A;  5IT9 E;  4UDU C;  4JK1 C;  3S1Q B;  4B9X A;  2NZ1 D;  1H9S B;  5IGG A;  2B2V C;  4HCS A;  5DLQ E;  2MNA A;  1EWI A;  3A8I E;  4TKO B;  4C3J G;  5A35 A;  1ESR A;  3PO3 B;  1K9M C;  4XQQ A;  5KNC A;  4Y52 H;  5COY A;  2MQH A;  4DK1 A;  4BA2 I;  2C9O A;  4GKK Q;  2VUM B;  2B2V A;  1X3Q A;  2L11 A;  3PV0 A;  3UE1 A;  4AYB E;  3BJU A;  1N36 Q;  2KCT A;  3M4O H;  3S17 B;  1D8L A;  4N8F A;  1RIP A;  3P20 A;  1O7Z A;  5EBC A;  4JYA L;  3P75 A;  2NN6 I;  2IX1 A;  5FO8 B;  3VYS A;  1MD2 D;  4BY1 B;  3MWY W;  2Q8I B;  3LWU A;  3K5O A;  2J0T D;  2WKC A;  4B3R L;  1DXM A;  1X56 A;  5CBA E;  4R1J A;  4P2C B;  2JA7 H;  2UXB L;  1FJG L;  1M1K C;  1DGS A;  2LS0 1;  3S16 B;  4OIK A;  4OGQ C;  5ELC A;  4L6T B;  4RGT A;  2M9V A;  4DUZ Q;  2B2U C;  4A3B G;  3S15 B;  2BDN A;  4QCL A;  1TS2 A;  1PDQ A;  2DNE A;  2PNH A;  3EA6 A;  3FKI G;  2NVT H;  4QB4 A;  2A19 A;  4IUQ A;  2RCF A;  4QGU A;  2IPK D;  1JWM D;  4NB3 A;  4KV6 A;  1YIJ A;  5C4Z A;  2JA8 G;  2UXC Q;  2V4D A;  2JA6 H;  5CV6 A;  1YBY A;  5C3E H;  2WAQ E;  5DEH A;  5FKA C;  2BH2 A;  3NWT A;  4LF9 L;  2BOS A;  3BYT B;  2K52 A;  4A3K G;  3R2T A;  1X65 A;  3FRP B;  2EDG A;  2WFW A;  2QA4 A;  3I2Z A;  5LMN L;  4A93 B;  1E2W A;  2IJ0 A;  2JQO A;  1VQG A;  2ZT9 C;  3BG3 A;  3E0E A;  1SE8 A;  3J7Z C;  4C3H H;  1J5E Q;  2GVA A;  4IJL A;  1I4H A;  2F1M A;  2K5W A;  1FJG Q;  2E2D C;  4KN4 C;  4J1M A;  5HY6 A;  5H1S E;  3G6E A;  4B3M L;  4LMQ D;  1SFO B;  3S2H H;  1CK1 A;  5IOC A;  3A7L A;  5D65 A;  4CDD C;  1PRT F;  4R4Q A;  3M3Y H;  1S3O A;  2PI2 A;  3HFZ B;  3M4O B;  3CHB D;  4B3T L;  1LV9 A;  3QR8 A;  1KDA A;  3J7Y W;  1Y1W G;  4DV3 Q;  1EYA A;  1ZYR C;  4X3K A;  3SK5 A;  4X6A H;  1S5F D;  1BCP C;  2GA4 B;  5M5X H;  3T1H L;  3HOY G;  4MZ9 A;  2WAC A;  5ISR A;  3FKI H;  1XTC D;  2LKV A;  2AWN A;  1QUQ B;  2K4K A;  1VQN A;  2F0E A;  4LW1 A;  3VR5 A;  3LNN A;  3M4Y A;  4QUC A;  4J15 A;  2Q8T A;  2A5H A;  4DPG A;  2IT1 A;  1VQ8 A;  1HNW L;  1OXU A;  4WJW A;  2K5H A;  2XNA C;  1MKH A;  2E74 C;  1U9R A;  3T13 A;  4UAI A;  4CJ1 B;  1T5X D;  1IXR A;  2RDG A;  1KDC A;  2E5L L;  4DR2 Q;  5FK9 C;  1NY4 A;  3HOZ B;  1A3U A;  4LNQ A;  4QIW E;  4QMG A;  3NP8 A;  2F3W A;  4A76 A;  2B29 A;  5T1G A;  2D9U A;  1AN8 A;  1K0R A;  3GTO B;  2ES2 A;  2JA8 H;  4FF2 A;  3F2B A;  3M4Q A;  4DR6 Q;  3CAM A;  1VQF A;  1E0B A;  4PNY A;  4YHH L;  1K8O A;  4YCU A;  1QVG A;  1GOZ A;  4JI0 L;  4LJZ C;  1Y1W B;  3KUP A;  4GLX A;  1TU2 B;  3W2D A;  2HCI A;  1RTO A;  1CKO A;  1DM0 B;  4BBS B;  3URY A;  2QKI C;  2F0J A;  2NVY H;  2X69 A;  3F2U A;  2KHI A;  3Q0A A;  3DHQ A;  1Y69 U;  4IUP A;  1PRT D;  1IYJ B;  4ID6 A;  3K5L A;  1CHQ D;  1JE4 A;  3G6J B;  2CHB D;  1EIG A;  2H5X A;  3ND9 A;  5CGK A;  4KY7 A;  3RNU A;  4A75 A;  1EYG A;  3V96 A;  1EFW A;  2B2W C;  4RH6 A;  4DR1 L;  2Y0S B;  2E5L Q;  1LLR D;  1X3G A;  4LF6 Q;  2EYH A;  1PTO C;  4X3T A;  5HUR A;  1GD7 A;  4L5R C;  1ROD A;  4IJH A;  2BE5 C;  1D6E C;  3HOU H;  1O7Y A;  2R92 H;  2N3S A;  4H44 C;  3IRB A;  4EQ5 A;  5K5P A;  3K5M A;  3GTK B;  3PUX A;  1Z7T A;  4JI8 L;  1QCB D;  2B39 A;  4KHV A;  3A74 A;  2K5N A;  1B8A A;  3BVG A;  4RGN A;  3EN2 A;  4A3C H;  3AB9 A;  4BY7 G;  3HOU G;  4TQU S;  2F0V A;  4CJ2 C;  4YIJ A;  1CA5 A;  4RCN A;  4DN4 M;  1PZI D;  1F77 A;  1SJE D;  1PRT C;  3MXU A;  1EQV A;  4J8Q A;  3RN5 A;  4IFD H;  3EFX D;  3WDN A;  1LTS D;  3FKI B;  1PFN A;  2XWB B;  2JP1 A;  2KHJ A;  4P73 A;  4KKU A;  4DR1 Q;  2PCF B;  1EL0 A;  1PVO A;  3CMA A;  1HR0 Q;  2R3Z A;  1A2T A;  4DAY A;  4O0A A;  2GVB A;  4OHJ A;  2ZTC A;  5LHY 1;  5LL6 X;  5GQO A;  1N8R C;  2NVQ H;  3CKI B;  1HNZ Q;  3OW7 A;  4RG1 A;  4DV5 Q;  3FMC A;  2JK8 A;  4LUZ A;  3PSI A;  1KTK A;  3SR1 A;  1BQQ T;  2L55 A;  4A3D H;  1CM9 A;  3UI2 A;  3K5N A;  4HMI A;  1V1P A;  4NXM Q;  1SYB A;  1WCM G;  1O80 A;  3MEH A;  1QE6 A;  3CCE A;  2NN6 H;  1D5X C;  2Z4H A;  3PIO 3;  1XTD A;  3M3Y B;  3E0J A;  1FGB D;  1H9S A;  1CTM A;  1X6O A;  4JI1 Q;  2PQA B;  4H13 C;  4PZ8 A;  4JI7 L;  1OXX K;  1R4Q B;  1EU4 A;  3GTJ H;  4O42 A;  1KLU D;  3GTQ B;  4UP8 A;  5DAU A;  3D31 A;  3SE0 A;  1NNX A;  1TWG H;  3PGZ A;  3OMC A;  5IT9 L;  2IHE A;  4L5S A;  4AQY Q;  4R4C A;  2KEN A;  4K2L A;  4A3L H;  2VB2 X;  4HAE A;  1CT1 D;  5IOD A;  3VA7 A;  4K0K Q;  4O1N A;  2LSS A;  4GS3 A;  3KLS A;  4NDX A;  4K8J A;  4G7O C;  3S2D B;  2ASB A;  1MJC A;  4FF3 A;  4CDC C;  4MHE A;  1LAC A;  1BCP F;  3T16 A;  3R3O A;  4RCO A;  1K73 C;  3HOW H;  2R7D A;  5I9P A;  5E1F A;  4LAA A;  3NXW A;  2F0N A;  4C3I B;  1JB3 A;  1LTR D;  3M7G A;  1CSQ A;  1SNP A;  1N32 Q;  2OWO A;  3NEN A;  1GHK A;  3KLW A;  5DM6 3;  4FVM A;  3OHX C;  1B53 A;  4DR3 L;  1MJE A;  3H6M A;  4ZAI A;  1FNU A;  2A6H C;  2RSO A;  1BBX C;  3NEM A;  3KF6 A;  4A3K H;  1EIY B;  1E3P A;  1S5E D;  4R9W A;  1E2Z A;  1PZK D;  5ELO A;  3J80 c;  4LF5 L;  2MP1 A;  3GV3 A;  3A56 A;  1VMC A;  2ZTD A;  5J1Z A;  1LT3 D;  5LMN Q;  1FD7 D;  2C35 B;  2B2W A;  3CPF A;  1PYW D;  4DV6 L;  4YCW A;  5CV5 A;  3U9S A;  1Y8O B;  1SJH D;  2QIL A;  3FPP A;  4PG3 A;  1CKN B;  3WOF A;  2B2U A;  1PH7 A;  1VQO A;  2NZH A;  5IGF A;  1TVX A;  1XNQ Q;  1JC7 A;  4JW0 A;  2N88 A;  4JOI A;  1WFQ A;  3C2P A;  4CHT B;  1RL2 A;  3S1M B;  3W3A A;  4IUU A;  5M5Y B;  2KUM A;  2NVQ B;  4UHV A;  5A2Q L;  5IP9 G;  3VDY A;  1KNA A;  4BBR B;  2DJG C;  2G9H D;  2Q8R E;  2RDH A;  3CCU A;  3I72 A;  1GVP A;  1HQM C;  1LTT D;  1RHP A;  5D14 A;  1KLG D;  2F0P A;  1EIH A;  5FLX E;  1Y14 B;  3A7A B;  5EKK A;  4BS9 A;  1YNX A;  2ZJP A;  2RVL A;  1SMX A;  3DXJ C;  1YNN D;  4XYO A;  2UXC L;  2RA4 A;  1SR3 A;  2AWO A;  1ET9 A;  1HNZ L;  3S1Q H;  1B70 B;  1LT5 D;  1Q8K A;  3FDT A;  2B2Y A;  5C3X A;  1JWS D;  1TWC B;  5DNF A;  4DAV A;  3TS0 A;  1HUN A;  4LF7 L;  2OQK A;  2SNM A;  5FLM G;  1HNX L;  2R7F A;  3J80 E;  2CW0 D;  4H7B A;  4KN7 C;  1ZKO A;  2RSN A;  1PH4 A;  1SDF A;  3KOJ A;  1QG7 A;  3TRE A;  1Q81 C;  1IL2 A;  1VQ6 A;  4CKC A;  1ILQ A;  4F87 A;  1Q1B A;  2OF1 A;  1XYI A;  1SRO A;  2L9H A;  1STB A;  4G7Z C;  2AMC B;  1D1I A;  3CQZ H;  1V1Q A;  3EIV A;  4C2M H;  3UDI A;  4CBV A;  1V1O A;  3C46 A;  3BU2 A;  2TMP A;  2ZXO A;  4QJF A;  2D5D A;  3DMU A;  5KEE A;  4R4I A;  1HXY D;  3X3M A;  1BCP B;  2Z6K C;  4A3F G;  4JI5 L;  4A3G G;  4WOR A;  1BBU A;  2EPB A;  1LM0 A;  3FEW X;  4Q0F A;  1Z6H A;  2E2J H;  3I4M H;  3AFQ A;  1HZA A;  4A3M G;  3U50 C;  4DGZ A;  1IKL A;  1BR9 A;  5C6A A;  4A4I A;  4ZCK A;  4IAL A;  4YY3 L;  2UXD L;  4BY1 H;  1EY4 A;  4DR4 Q;  3HG9 A;  4DUY L;  3R2I A;  3E9H A;  2Y0S E;  3N6R A;  2R93 B;  1HA5 A;  3GTJ B;  4DV6 Q;  5DM7 3;  3OPO A;  4B3R Q;  4KMU C;  1HRJ A;  2I5M X;  4QUF A;  4NW2 A;  1TWG B;  4UP9 A;  1XNR L;  4WRD A;  3I91 A;  4ALP A;  3K7A B;  4POG A;  2F0H A;  5GAE C;  2HCC A;  3K8A A;  2EJG C;  3OOC A;  1JE5 A;  2GN5 A;  4I7A A;  2R7Z H;  5CV9 A;  4N8X 1;  1Y8N B;  1Q12 A;  4UP7 A;  3SDZ A;  3GTP B;  1PMR A;  3T4A C;  4ZYS A;  4OX9 L;  3H3V I;  1OTC A;  1XPU A;  4FNF A;  2SDF A;  4P75 A;  4QY7 A;  3HOZ H;  1F2Y A;  3KF8 B;  5EPJ A;  1GUW A;  1AE2 A;  2F4I A;  5JEA H;  4FF4 A;  2F0T A;  5BN5 A;  3L2P A;  5JEA G;  3FP9 A;  1J8I A;  2VQE L;  2DY7 A;  1EY7 A;  1ZEQ X;  2OT2 A;  1XJV A;  3ER0 A;  4DXG A;  2RQX A;  3T1Y Q;  2EY6 A;  3HP3 A;  3D4W A;  3E3X A;  2JN4 A;  2PZW A;  4OO1 I;  2LY7 A;  1PTO B;  3S9W A;  1WCM H;  4N9T A;  4MN3 A;  1XPR A;  3IL8 A;  3TN2 A;  2EJM A;  1II3 A;  2CFM A;  4Y7N H;  4A3M H;  3Q24 A;  3Q22 A;  3OTO Q;  4F7X A;  1U4R A;  4JBJ A;  4KHZ A;  3H0G H;  1HFN A;  2XRS D;  3S1N H;  2VY3 A;  2CKZ B;  2ICI A;  3GTL H;  1VQD A;  3L3O C;  4B08 A;  4J6H A;  3OMG A;  1DOL A;  1DZ1 A;  5KYI A;  4KI0 A;  5CV4 A;  3VR2 A;  4PV1 C;  4IQZ A;  2RCN A;  2RDF A;  4EQP A;  3D0F A;  2TSS A;  2Z4I A;  1TWF B;  4IUR A;  4DV4 L;  3PIP 3;  2IY5 B;  1SLJ A;  4X65 Q;  5IP7 G;  4B9W A;  3CD6 A;  5JVH 3;  4DNI A;  2X6L A;  1H9J A;  4L5Q A;  2JA9 A;  5AJ3 L;  2F03 A;  3CCL A;  4A93 H;  1O78 A;  4P72 A;  5C5M A;  1PH9 A;  2JA7 G;  3NK9 A;  1C48 A;  1LTB D;  1RKN A;  1X54 A;  2PQA A;  3ERS X;  3I4O A;  1XMQ L;  3GTP H;  1AFP A;  5EAY A;  1B44 D;  4FF1 A;  3MZ5 A;  3BVZ A;  4A3K B;  4QF4 A;  3NTH A;  1HR0 L;  1B50 A;  1WJJ A;  4A3J H;  2L5T A;  1HUM A;  3VR4 A;  5C44 G;  3PUV A;  1G2S A;  4QIW B;  4JI5 Q;  1VQJ A;  1MGS A;  2LFN A;  4LF9 Q;  1AP0 A;  1V43 A;  4QQB X;  4IOA A;  3QO2 A;  3PF5 A;  1X3E A;  1QOH A;  4A3F H;  3C3L A;  4JBK A;  3KJP A;  4C3J H;  1AE3 A;  3H94 A;  1X55 A;  4X62 L;  5M3M H;  2HQE A;  1RJT A;  4S3S A;  1VF5 C;  3CQZ B;  2E2I H;  1QB5 D;  4PZ6 A;  2RKS A;  1N34 Q;  2Z6K A;  1SYE A;  1ZXT A;  4HJA A;  4JYA Q;  4BA1 I;  4OO1 G;  1LTG D;  2Q2H A;  3UE0 A;  4HIM A;  1UE1 A;  4A3D B;  3SK4 A;  1EZ8 A;  1LO5 D;  2H4O A;  1PH5 A;  1SSO A;  3NHH A;  4X3S A;  1PXU A;  2Z0S A;  4DV1 L;  3WWV A;  4IUN A;  3QOJ A;  1WTV A;  4ABN A;  2CH4 A;  4DV2 Q;  2L0C A;  5C5L A;  5IT9 c;  3RLF A;  2IHF A;  4UY8 C;  3K58 A;  4DUZ L;  1Y1V G;  1DJR D;  1X32 A;  3IAY A;  1RTN A;  1FVI A;  4F88 A;  1JB7 A;  1KQS A;  4RFB A;  5FOB B;  2PPB C;  3K80 C;  1MSH A;  1O7L A;  3UDF A;  4B3S Q;  1EY6 A;  1UEB A;  4LFB L;  2PQE A;  3NTI A;  3H0G G;  5GAG C;  4DAM A;  2AQ2 B;  5FJ8 G;  3TME A;  4Q5V A;  3D6W A;  4IZ8 A;  4DR6 L;  2NZO A;  3SXH A;  2WIN B;  1A0I A;  4HSV A;  5C0X G;  4DK3 C;  3E5S A;  4JI2 Q;  3ERQ A;  1ENC A;  5I9O A;  4PMW A;  2PZU A;  5E4W C;  4ULL A;  1I4R A;  1S5D D;  4EQO A;  1Y1V B;  2UUB Q;  2F0F A;  2HDL A;  4X66 Q;  1N33 L;  1VQ9 A;  1I3Q B;  3JAM c;  5BN4 A;  4WJ4 A;  2K04 A;  5ELD A;  1VQP A;  1G6Z A;  2K75 A;  3T1Y L;  4HTH A;  3J81 i;  4A93 G;  3GTQ H;  3JAM i;  5I2X A;  2HHH Q;  1BDO A;  1HFG A;  3PUY A;  2F0O A;  1C4Q A;  2MUY A;  4YWM A;  1R4P B;  1A3T A;  1HJP A;  1L0X B;  2KCN A;  1JT8 A;  2UUA Q;  1BNZ A;  1EY0 A;  4NXM L;  2R7Z G;  3EQL C;  4C3H G;  3J7A V;  5C0X I;  1LTA D;  1PH3 A;  1QWY A;  1F9P A;  4R8N A;  2XRQ D;  4C56 C;  3UDG A;  1GUO A;  2ZM6 L;  3I3C A;  1JOR A;  3TZD A;  1EQR A;  1NBW A;  2UUA L;  4A3D G;  5COR A;  1DON A;  3DLL A;  2ATW A;  4R8I A;  4LFA L;  1F2Z A;  1NAP A;  2F3I A;  2E2J B;  2WV6 D;  1K83 B;  2UXB Q;  1FGU A;  2PMZ E;  1TS4 A;  3DWA A;  4X3U A;  5CYU A;  3GTM H;  3J7A 5;  1WYD A;  4X66 L;  2JJQ A;  1N33 Q;  2I5H A;  4DV4 Q;  2F3V A;  4IUV A;  3AQQ A;  2JA5 H;  3N52 A;  1CI3 M;  2L15 A;  1STY A;  4IPG A;  3I4M G;  3VYT A;  1E24 A;  4AQY L;  3X3N A;  5IWA Q;  3CCQ A;  1YHQ A;  5JJK A;  3PF4 A;  2OQ0 A;  1WD1 A;  2ZJQ A;  5CV7 A;  1PFS A;  1STA A;  3IFD A;  3OW2 A;  1BF4 A;  2NTS A;  1H95 A;  3GV6 A;  3NPP A;  3TDQ A;  1YHA A;  3HOV H;  1TWC H;  3U58 A;  3S16 H;  1PH6 A;  1LAB A;  1EUJ A;  4FXK C;  5C4X G;  1DD2 A;  2A69 C;  2O2L D;  4OL7 A;  2WKD A;  3ULL A;  4LUV A;  4AYB B;  1UE5 A;  3GO5 A;  3G7L A;  5CR3 A;  3SEB A;  1G29 1;  1KC8 C;  2HUG A;  1RDP D;  3MEF A;  4BY1 G;  4C1N K;  3RZD H;  2K03 A;  2ZXR A;  1EEF D;  2B2Y C;  4XYQ A;  2K5Q A;  4MNO A;  3HKS A;  2OCE A;  3KK7 A;  1GUG A;  2ENB A;  2FFK B;  3R8B A;  1B9M A;  5GAH C;  1NMG A;  1TWA H;  3K7A H;  4GOP C;  2XGT A;  3PUW A;  1LUZ A;  1I6V C;  4XQJ A;  3CP0 A;  1L0Y B;  3TSS A;  3NBH B;  5E7N A;  2F0Q A;  5CV8 A;  2R6G A;  2XVS A;  1Q46 A;  4KHP Q;  4LF4 Q;  1C7Y A;  4EGV A;  4A3I G;  1D5M C;  2IX0 A;  1CKM A;  3CC7 A;  1VQ7 A;  1VQH A;  2N55 A;  2WAQ B;  3TP6 A;  2A69 D;  3RN2 A;  1VQB A;  4LUO A;  4PMC A;  4XXE A;  1EQT A;  1ZYR D;  1GUN A;  2HD3 A;  2KOL A;  5C3W A;  3QJY A;  5IGE A;  1GKH A;  2WII B;  5ELF A;  3I73 A;  1K8M A;  1JJ2 A;  4KY6 A;  1NR2 A;  2EY1 A;  3TBI B;  3RZO B;  5JOB A;  2NUC A;  4ZUI A;  4U68 A;  1WTQ A;  1MSG A;  4KD4 A;  5KRU A;  4BY7 B;  1TWH H;  3MAQ A;  2F4V Q;  3CW2 C;  3P7J A;  1NCV A;  5IYC G;  3HKZ B;  1N32 L;  1STE A;  3RUZ A;  4GNX C;  4A3J B;  3GP7 A;  1WTP A;  2K6A A;  2I46 A;  1EYC A;  1VQE A;  3KF6 B;  3BZD B;  2DJF C;  3IFT A;  4I65 A;  4ZQ3 A;  4K14 A;  1I4Q A;  3MHB A;  5I6W A;  5C0X J;  3I4N H;  3TRZ A;  2KQ3 A;  2CQO A;  4XT3 B;  4B3T Q;  4LF4 L;  1Q1E A;  2CH4 W;  3E9I A;  2K33 A;  1H9R A;  2L4N A;  1AH9 A;  1Q82 C;  3OIQ A;  1VQI A;  1I50 B;  1OO9 B;  2E8G A;  2N49 A;  4FXG C;  3T1H Q;  1K3B C;  3HOU B;  3W1G A;  2CWA A;  4DR5 L;  2RBM A;  4GN3 B;  4DXF A;  4BXX H;  4O2D A;  2Z1C A;  2Q2T A;  1Y8P B;  4FDB A;  3VA5 A;  1J9O A;  3RLO A;  3NEL A;  1QUQ A;  3PO3 G;  4K5X A;  2EE1 A;  3PO2 G;  1Q86 C;  3J81 j;  1G51 A;  1IW7 C;  1PTO F;  1JOK A;  1EYD A;  3S1R H;  3BYY B;  1BO0 A;  1Y1W H;  3ND8 A;  5KND A;  5D3D A;  1WTX A;  1B1Z A;  3MA2 B;  3Q23 A;  3MFY A;  4KK7 A;  2EYF A;  1T5E A;  1UUP A;  3CCV A;  4K2K A;  1SNC A;  2XIW A;  2FJ2 A;  4RAU C;  4DR2 L;  3I90 A;  1AZQ A;  1XNQ L;  2QCP X;  5K36 H;  1KAW A;  5IGC A;  3KLR A;  2WAQ G;  1CQV A;  1E2V A;  2NWG A;  1W3S A;  4ME5 A;  2CQA A;  3SK8 A;  1M90 C;  1HZ9 A;  1XWE A;  2PYK A;  2HHH L;  3FVQ A;  1MI2 A;  3TP7 A;  1IBM Q;  2RF4 A;  3A5Z B;  1U5K A;  3TP5 A;  4C3J B;  1UAP A;  2EZV A;  3H09 A;  3ULP A;  1O7I A;  3CCS A;  2K14 A;  3J80 i;  4BBS G;  3EVQ A;  5IY0 A;  1QIL A;  2FMM A;  1W2B A;  3S1R B;  4LFB Q;  2D0O A;  4NXN Q;  2VXW A;  4EVO A;  3UDX A;  4K5W A;  2K32 A;  1VQK A;  1SMY C;  2HQL A;  2UU9 L;  2EY2 A;  4AIM A;  2HIV A;  4CDE C;  1Q90 A;  5C3E G;  3M9B A;  4ILW A;  3CCJ A;  4JCV E;  1T9H A;  4DAP A;  1OXT A;  1EEI D;  1QNK A;  5JEA J;  1Q8I A;  4AYB G;  1RCV D;  4ODG A;  3TP8 A;  4CGY B;  1U4P A;  3B6Y A;  1DCZ A;  5ELN A;  3GTG H;  4JI6 Q;  4RGO S;  4K6D A;  4ZK9 B;  2A68 C;  3T56 B;  3LX0 A;  1HA6 A;  1IZ6 A;  4XT1 B;  3PO2 B;  5I2Y A;  2Z9H A;  4K0K L;  1IKM A;  1BOS A;  4RGM A;  4NMZ A;  3HOX H;  1VQL A;  2BA0 A;  1GUT A;  1JOQ A;  2XTI A;  2H1E A;  4RKL A;  1SEB D;  3CCM A;  5C44 B;  4DFA A;  4FXD A;  4RMF A;  2A1A A;  3BDC A;  4HIK A;  2WB1 B;  4YHH Q;  1Z47 A;  1UE6 A;  4JI3 Q;  3RMH A;  3S17 H;  5K36 G;  1XMO Q;  4YCV A;  2IWH A;  2A8V A;  2F52 A;  4JPB W;  1W6J A;  3HKZ E;  3CPW A;  1VMP A;  2IW3 A;  4X65 L;  3ITP A;  4FO2 A;  2YTV A;  1SE4 A;  5KNB A;  1EY5 A;  2B63 H;  3PCO B;  1SRU A;  4A3G B;  2KJX A;  2K28 A;  5HGT A;  1TWA B;  4IFD G;  2JE6 I;  2RHS B;  1BXT A;  1DOM A;  1I94 Q;  5JPN C;  2IL8 A;  1F9S A;  1I4X A;  2NVY B;  3AYH B;  2VB3 X;  1XNR Q;  3I56 A;  5JPM C;  2MO1 A;  5CC4 A;  4H0L C;  1F2M A;  3NSW A;  4BXX G;  4GN4 B;  2A6E D;  5JJI A;  1KRT A;  4X64 L;  5IYB H;  4DV7 Q;  1IBM L;  1YIT A;  4POF A;  2NB0 A;  3A0J A;  3JAM L;  2A6H D;  4L63 B;  3A8J E;  3K81 C;  2MPM A;  5ELE A;  3TZU A;  1PH1 A;  1Q7Y C;  2UUC Q;  1JWU D;  2G9D A;  5M5X B;  3AMU A;  4FYD A;  4A3I H;  1X3F A;  4DU9 A;  2QDL A;  1I4P A;  1V1P B;  4JI4 Q;  2K7V A;  4TSS A;  4DNR B;  4A3I B;  2E2H B;  3L0O A;  4IOC A;  1ML0 D;  4NPS A;  1P16 A;  4XQN A;  2KED A;  2K50 A;  1E22 A;  1SXT A;  4ZUJ A;  1HTP A;  4OXP A;  1LTI D;  1TXY A;  1ASY A;  3HRZ C;  5JVG 3;  2QW7 A;  1HQR D;  5A2Q E;  4U67 3;  4G7H C;  3LGJ A;  3J81 E;  2D62 A;  3D4R A;  5I6Y A;  5IE8 A;  3SVM A;  4V19 0;  4YY3 Q;  2UXD Q;  3RLN A;  3I4M B;  4TVA B;  4KD3 A;  5C4J B;  1WTW A;  1PZJ D;  5LMU L;  1SNQ A;  3MXG A;  1A62 A;  2A6E C;  3QG1 A;  2NVX H;  4C3I H;  2I07 B;  1BCP D;  4A3E H;  1V9P A;  1K3R A;  2B8F A;  3M4P A;  5FLX L;  2FXQ A;  3W1B A;  2QF7 A;  2F0I A;  1IBL L;  4GKJ L;  3DM3 A;  3HS0 C;  3QB3 A;  4C1N I;  1TII D;  1C9O A;  3HOW B;  1G6P A;  1AZP A;  1Z9F A;  3NBH A;  2EVB A;  5M3F H;  2MJ8 A;  2OEO A;  2FMC A;  2JYO A;  3I8Z A;  4DKA C;  1YNJ D;  1EOV A;  1PYB A;  3I55 A;  4RA8 A;  1IBK L;  1QZH A;  4DR7 L;  2R7Z B;  1CSP A;  4UPA A;  3A5U A;  1STH A;  2B63 G;  2B8G A;  1J6Q A;  4DV0 Q;  2DGY A;  1YHB A;  1DOK A;  1IYV A;  1YVC A;  2D0P A;  1SYC A;  4GLV B;  3J81 L;  1ONL A;  2E75 C;  3ZJY C;  4JC0 A;  3S2D H;  2D2C C;  2XN9 C;  4HIO A;  1KXL A;  4HMJ A;  3D4D A;  4GOP B;  2KBN A;  1STN A;  2R61 A;  2VZA A;  3S15 H;  4BBR H;  1ESF A;  4V0B A;  1YNN C;  2CCZ A;  1A2U A;  1MBY A;  2EOT A;  1I6H H;  3RZD B;  1YNJ C;  1GXD C;  4RWS C;  3HOX G;  1JJG A;  1PH2 A;  3OTO L;  2EIF A;  3HOY H;  1CA6 A;  4KLK A;  1K28 A;  2F0K A;  4IFD J;  2JA6 G;  1PLF A;  4HCE A;  3GTG B;  3K7U C;  4CDF C;  4DK0 A;  1G91 A;  1MHW C;  3I70 A;  3H0G B;  5BN3 A;  4GNX B;  3U9O A;  1WTH A;  2OTL A;  4KTA A;  1EIF A;  1VCI A;  4KJO A;  1U0L A;  3GD7 A;  1K8G A;  1SN8 A;  2BCO A;  1JQY D;  1HZB A;  4OIJ A;  4R4T A;  4R4O A;  1BKB A;  3PO3 H;  1EQQ A;  3CME A;  1E1O A;  4A3E B;  5G3L D;  1A63 A;  2F0L A;  3HEJ A;  2CW0 C;  1UE7 A;  5JAV A;  2NTT A;  5AFW A;  1TQO A;  2L12 A;  2LMC B;  2QGQ A;  4WJ3 M;  1GO3 E;  2MFI A;  1VF7 A;  1YJ9 A;  4DK6 C;  3S1M H;  1AEX A;  3GTM B;  3TQY A;  4EQN A;  4M8A A;  4LF7 Q;  2FIN B;  4JI6 L;  1B7Y B;  1SE3 A;  2SNS A;  4KKS A;  4DA2 A;  5KGU A;  2NN6 G;  3MXP A;  3CC2 A;  2LXK A;  2WB1 G;  1WCM B;  1HHV A;  1FL0 A;  3O13 A;  4JI0 Q;  4HSP A;  1W6K A;  3M7N A;  2JEA I;  2VQF Q;  3MXN B;  2G5D A;  1R9T B;  1HH2 P;  3CU7 A;  3QWN A;  1IYU A;  3SHL A;  3NQT A;  3HZX A;  3ZYY X;  1XMO L;  5FO7 B;  1SND A;  4EX5 A;  1S5C D;  3K59 A;  4NXN L;  3MFG A;  4OO1 H;  1EWH A;  1IL8 A;  3WOE A;  2K1B A;  3H15 A;  1KIX A;  4CJ0 B;  4MTK A;  1F2L A;  2O4X A;  1HZC A;  2F0S A;  1I50 H;  2BH8 A;  5E4X A;  1F9R A;  4PQX A;  3F8T A;  3D3R A;  3GTK H;  1XPO A;  1JJC B;  3VYR A;  1EY9 A;  3PO2 H;  2SOB A;  1B9N A;  4XIG S;  1BVS A;  2B3G A;  2EYJ A;  4X64 Q;  1RF2 D;  3DM1 A;  1BUV T;  3JC6 6;  4LWC A;  2B63 B;  5M3M G;  1XXG A;  2LXJ A;  4A3C G;  2AUK A;  1KD1 C;  4GOP A;  4KHP L;  1D7Q A;  1X9N A;  4PMB A;  1STG A;  4YWK A;  2HDM A;  4DV5 L;  3PIO A;  2I5L X;  4ZRZ A;  5GAD C;  2VW9 A;  3I4N G;  3J7A F;  4GLA C;  1HPC A;  5C44 H;  2CWP A;  3J81 c;  2O5I C;  5C4X B;  3NQI A;  3SGI A;  1UWV A;  2OTJ A;  5EKI A;  2JSO A;  2MHV A;  4CKB A;  1RD9 D;  2E76 C;  1PFB A;  1YZ6 A;  2B2T A;  4OWT B;  5IYC H;  1I5F A;  4B3M Q;  1KL9 A;  3EJI A;  1GHJ A;  5IYB G;  1M4V A;  4DV2 L;  1L0W A;  1PFM A;  2PMZ B;  3V05 A;  3LWE A;  5FLX c;  1QZG A;  4E6I A;  1PYS B;  3CC4 A;  1GJX A;  1WD0 A;  3PMF A;  1XX8 A;  1ICW A;  3BVM A;  1G2T A;  4HJ5 A;  3L7Z C;  3AFP A;  3W5O A;  1V8Q A;  2AQ1 B;  3HKZ G;  1B3A A;  1Q3L A;  5F2D A;  2DNC A;  2KEC A;  4HR7 B;  4GKJ Q;  1ENA A;  1CKN A;  1FNW A;  1LTL A;  2ZXP A;  1SNO A;  3C1E A;  4RKB A;  3CCR A;  1ICF B;  3OWE B;  3S2H B;  4G4K A;  2OXP A;  5M5W B;  1NR4 A;  4HJ9 A;  3KLS X;  3Q6S A;  4IO9 A;  1SAP A;  4DR7 Q;  3GDE A;  4N9P A;  3DUZ A;  3NBI A;  3T51 B;  1F9Q A;  1PTO D;  2EXZ A;  3FPU B;  4ZLT F;  5BR8 Q;  4XTC S;  1LT4 D;  2ZJR A;  4TRD A;  3Q8D A;  4AH6 A;  4JV5 Q;  1VQ5 A;  4A3F B;  1VDZ A;  2EXD A;  4L8J A;  1TWH B;  1LYL A;  3D8G A;  1D2B A;  1B4O A;  1CZG A;  1SNM A;  4JBM A;  3KDF B;  2P5Z X;  1VQ4 A;  3H3V C;  3F2C A;  2JA5 B;  4DUY Q;  1TT2 A;  4KJN A;  2YYZ A;  4JI3 L;  2AKW B;  3CRK C;  1D5Z C;  1SFO H;  1SYF A;  1P8L A;  4HN7 A;  5C4X H;  5LMN W;  4IPD A;  2F0D A;  4JV5 L;  3H91 A;  3T53 B;  3CF5 A;  1C0A A;  1PA6 A;  3HOV B;  4LF8 L;  2JA8 B;  1KNE A;  1IW7 D;  4OWX B;  3OIP A;  1ENF A;  1H9M A;  2ZTE A;  1TY2 A;  4FP5 D;  3RZO H;  3AEV A;  1FNV A;  3H3V H;  2X6G A;  3BDL A;  1PV4 A;  1B2T A;  1QVC A;  4IPC A;  1E7Z A;  2QDB A;  3OSO A;  1FR3 A;  1N9W A;  3D6C A;  5HGQ A;  3AU7 A;  3U4Z A;  5C0X H;  1QNU A;  3KJO A;  1S72 A;  1ASZ A;  4GZY C;  1G8Z D;  1EU3 A;  4HJ7 A;  4JI7 Q;  4BBS H;  5CMD A;  1N34 L;  5IWA L;  5IYD G;  2A73 B;  3ULJ A;  2JEB I;  3DWP A;  3K57 A;  1ILP A;  5C4J H;  1A6X A;  2EYM A;  5IGB A;  1EZ6 A;  2YU9 H;  2R93 G;  5EKL A;  1SYD A;  4JI8 Q;  5M3F G;  5CBE E;  3K0X A;  1WI5 A;  5C3E B;  1WTO A;  2J7Z A;  3L9A X;  1I3Q H;  4I7Z C;  4L5T A;  3QOL A;  2O5J C;  1JMC A;  1SBB B;  3I4L A;  1JOO A;  1NJI C;  3HOY B;  1GM5 A;  1PTO H;  2ZM6 Q;  1QVF A;  4LK1 C;  2Q2U A;  4NP5 A;  4P71 A;  4F8M A;  1DYQ A;  3STB C;  2PW7 A;  2DN8 A;  5EBD A;  4OX9 Q;  3FHW A;  3TEH B;  2Q2I A;  2DY8 A;  2AQ3 B;  1U4M A;  3BS1 A;  2VUM H;  5J22 A;  4ZKB B;  1R9T H;  1WOC A;  4APV A;  3GTL B;  3RD4 A;  1U4L A;  1VS0 A;  4M1U B;  2BA1 A;  2K05 A;  5EPL A;  2F4V L;  5FLM H;  1YJW A;  3A8K E;  2VQE Q;  3M85 A;  2UUB L;  4X62 Q;  3V2T A;  2YTX A;  5EGT A;  3KFU A;  4LF5 Q;  3DEO A;  1A15 A;  2J4X A;  2HIX A;  5FJ8 H;  1KAA A;  4A3G H;  3U4V A;  2A68 D;  2RHQ B;  3ERO A;  4A3J G;  3CXC A;  2E2I B;  3F1Z A;  2PW5 A;  2KEE A;  1YI2 A;  2VS1 A;  2I0Q A;  1OXS C;  2K5D A;  2QEX A;  2EYL A;  2ID0 A;  4C3H B;  2VQF L;  3STB D;  1PRT B;  3K0Y A;  5J39 A;  3G4S A;  1HR0 W;  1TS3 A;  5IP9 H;  2JA6 B;  5IIF A;  1L1O A;  5D3I B;  2UUC L;  3K6O A;  4PZ7 A; 
#chains in the Genus database with same CATH homology
 4OXP A;  1TXY A;  4JI4 L;  1ASY A;  2WP8 J;  3A74 A;  2K5N A;  1B8A A;  1A8V A;  2Z0S A;  4DV1 L;  3EN2 A;  1L2F A;  3WWV A;  4A3C H;  2HT1 A;  4B3S L;  4BY7 G;  5GRO A;  3LGJ A;  4DV2 Q;  3HOU G;  5IT9 c;  2D62 A;  4TQU S;  2VNU D;  3RLF A;  5IE8 A;  2IHF A;  4UY8 C;  4YY3 Q;  4GKK L;  4DUZ L;  2VL6 A;  2UXD Q;  1Y1V G;  3RLN A;  1K83 H;  4TVA B;  1FVI A;  1JB7 A;  1KQS A;  5LMU L;  1A62 A;  2NVX H;  4C3I H;  3K80 C;  2R93 H;  3UDF A;  4B3S Q;  4A3E H;  1HNX Q;  1UEB A;  3RN5 A;  1V9P A;  1J5E L;  1K3R A;  1PHJ A;  4LFB L;  1OXV A;  3H0G G;  3M4P A;  2FXQ A;  1TWF H;  3W1B A;  4DAM A;  5GAG C;  1IBL L;  3DM3 A;  5FJ8 G;  3ICE A;  1PH8 A;  4GKJ L;  1C9O A;  2KHJ A;  2VUM G;  3HOZ H;  4DR6 L;  1CUK A;  2NZO A;  2YTY A;  4P73 A;  4DV3 L;  4DR1 Q;  1I94 L;  1A0I A;  1PVO A;  1Z9F A;  3CMA A;  1HR0 Q;  5M5W H;  5C0X G;  4DK3 C;  4JI2 Q;  5M3F H;  4O0A A;  5LMU Q;  2GVB A;  2ZTC A;  4PMW A;  4DKA C;  5GQO A;  1N8R C;  1EOV A;  1PYB A;  3I55 A;  1IBK L;  2NVQ H;  1HNZ Q;  1QZH A;  4RG1 A;  4DR7 L;  4DV5 Q;  2UUB Q;  3PIP A;  5IP7 H;  2JK8 A;  1CSP A;  4UPA A;  3A5U A;  4LUZ A;  2B63 G;  4X66 Q;  1N33 L;  1J6Q A;  1G6P A;  3PSI A;  3G71 A;  2DGY A;  4DV0 Q;  1YHB A;  4DR3 Q;  1VQ9 A;  3GTO H;  4A3L G;  3JAM c;  4A3D H;  5M5Y H;  4OWW B;  1YVC A;  2D0P A;  4WJ4 A;  1VQP A;  4GLV B;  2K75 A;  1KHI A;  4NXM Q;  3T1Y L;  3J81 i;  3ZJY C;  3S2D H;  4JC0 A;  4A93 G;  4HIO A;  1KXL A;  1WCM G;  3GTQ H;  3JAM i;  3TS2 A;  4GOP B;  2KBN A;  3CCE A;  3HOV G;  2HHH Q;  2VZA A;  3PUY A;  3HOZ G;  3S15 H;  2EQS A;  3S14 H;  1XTD A;  4BBR H;  2MO0 A;  2CCZ A;  4YWM A;  1HJP A;  1NTG A;  1JT8 A;  2UUA Q;  1I6H H;  1X6O A;  4NXM L;  2N78 A;  2R7Z G;  2Y0S G;  4JI1 Q;  3HOX G;  1JJG A;  5IYD H;  2YV5 A;  1PH2 A;  2PQA B;  4PZ8 A;  5C0X I;  4DR4 L;  3OTO L;  2EIF A;  4JG2 A;  2N8N A;  1PH3 A;  1OXX K;  3GTJ H;  4JI7 L;  4KLK A;  3BZK A;  3UDG A;  4UP8 A;  2ZM6 L;  2JA5 G;  4IFD J;  3D31 A;  1EQR A;  1XMQ Q;  1NBW A;  1TWG H;  2JA6 G;  3PGZ A;  2UUA L;  2ALY B;  4A3D G;  2IHE A;  4L5S A;  3K7U C;  4AQY Q;  3DLL A;  2ATW A;  4R4C A;  4LFA L;  1IBK Q;  2KEN A;  4A3L H;  1KRS A;  4DR5 Q;  1E1T A;  3HOW G;  4LFC L;  2F3I A;  4GNX B;  4K0K Q;  2UXB Q;  4MTN A;  1FGU A;  2AHO B;  2KCM A;  2WB1 E;  1EIF A;  2PMZ E;  2OTL A;  2LSS A;  3GTM H;  1VCI A;  1WYD A;  4X66 L;  1U0L A;  1VQA A;  2JJQ A;  3GD7 A;  2I5H A;  1SN8 A;  4GS3 A;  1K8G A;  1N33 Q;  4DV4 Q;  1HZB A;  4R4T A;  3AQQ A;  4R4O A;  1BKB A;  2JA5 H;  4GN5 A;  1IBL Q;  3PO3 H;  4DAY B;  3CME A;  2L15 A;  4IPG A;  1MJC A;  1E1O A;  1EQQ A;  2ASB A;  3I4M G;  1A63 A;  1N36 L;  1E24 A;  4AQY L;  1UE7 A;  5BR8 L;  4JBW A;  2QGQ A;  4WJ3 M;  1K73 C;  5IWA Q;  3CCQ A;  4ME3 A;  1VQM A;  2R7D A;  1YHQ A;  1GO3 E;  1YEZ A;  2MFI A;  2OQ0 A;  3HOW H;  3PF4 A;  1YJ9 A;  4QL5 A;  4DK6 C;  2ZJQ A;  4A3B H;  3S1M H;  1PFS A;  4GNX A;  3OW2 A;  3TQY A;  2K5V A;  4YWL A;  4LF7 Q;  1H95 A;  4JI6 L;  1B7Y B;  4HID A;  3BZC A;  2V1C C;  1YHA A;  2NN6 G;  4JI1 L;  3HOV H;  4P74 A;  3CC2 A;  2LXK A;  1TWC H;  3G48 A;  3U58 A;  4LF6 L;  2WB1 G;  1PH6 A;  3S16 H;  1CSQ A;  4H02 A;  5J3B A;  1FL0 A;  1N32 Q;  1EUJ A;  2OWO A;  1L1O B;  3NEN A;  4JI0 Q;  3KLW A;  1NE3 A;  5C4X G;  3M7N A;  4JOI C;  3ULL A;  1HNW Q;  4LUV A;  2VQF Q;  3MXN B;  3F2D A;  2JEA I;  1UE5 A;  3GO5 A;  1BBW A;  4DV0 L;  2PI2 E;  4DR3 L;  4A3E G;  1MJE A;  3NEM A;  3KF6 A;  4A3K H;  1EIY B;  1HH2 P;  1E3P A;  1G29 1;  4BBR G;  1YJN A;  1KC8 C;  4IFD I;  3MEF A;  4LF8 Q;  4BY1 G;  4LFC Q;  3RZD H;  5ELO A;  3J80 c;  4LF5 L;  3EBE A;  3OYY A;  2ZTD A;  4DV1 Q;  1XMO L;  2DUD A;  5LMN Q;  3CPF A;  2C35 B;  4EX5 A;  5AJ3 Q;  4DV6 L;  4YCW A;  4MNO A;  4PG3 A;  3HKS A;  4NXN L;  1CKN B;  4DV7 L;  2OCE A;  1K8A C;  1PH7 A;  1VQO A;  2NZH A;  4BY7 H;  3H15 A;  5GAH C;  2E2H H;  1KIX A;  1XNQ Q;  1NMG A;  4JOI A;  2UU9 Q;  1TWA H;  1WFQ A;  3K7A H;  3S24 A;  1NMF A;  1HZC A;  3KYH C;  1I50 H;  2BH8 A;  3RR5 A;  4GOP C;  1RL2 A;  2XGT A;  3PUW A;  1LUZ A;  3CP0 A;  3F8T A;  3PUZ A;  5IP9 G;  3GTK H;  2R92 G;  3NBH B;  1JJC B;  3VDY A;  3I7F A;  5E7N A;  1XPO A;  3CCU A;  3PO2 H;  4HJ8 A;  4LFA Q;  2R6G A;  1Q46 A;  4KHP Q;  4LF4 Q;  1GVP A;  4XIG S;  1C7Y A;  1BVS A;  1Y1V H;  4A3I G;  1S40 A;  2B3G A;  2IX0 A;  4X64 Q;  1CKM A;  3JC6 6;  4LWC A;  4JI2 L;  5JJK A;  3CC7 A;  1VQ7 A;  1VQH A;  1Y14 B;  3RN2 A;  1VQB A;  5M3M G;  1YNX A;  2ZJP A;  2LXJ A;  4LUO A;  5JJL A;  1SMX A;  4A3C G;  2UXC L;  1KD1 C;  1SR3 A;  1VQC A;  2AWO A;  4GOP A;  4KHP L;  1HNZ L;  3S1Q H;  1GKH A;  1D7Q A;  1B70 B;  1X9N A;  4IPH A;  4OON A;  1JJ2 A;  1Q8K A;  4YWK A;  4DV5 L;  3PIO A;  2I5L X;  5GAD C;  1MIU A;  2VW9 A;  3I4N G;  1TWH H;  3TS0 A;  4GLA C;  4LF7 L;  2OQK A;  1L1O C;  5FLM G;  3KDF A;  5C44 H;  2CWP A;  3CW2 C;  3J81 c;  1HNX L;  2F4V Q;  2R7F A;  3SGI A;  5IYC G;  1N32 L;  4GNX C;  1UWV A;  2OTJ A;  1PH4 A;  3KOJ A;  3TRE A;  5DLQ E;  1Q81 C;  1IL2 A;  1VQ6 A;  2MNA A;  1VQE A;  1YZ6 A;  1EWI A;  4OWT B;  1I5F A;  5IYC H;  4B3M Q;  3KF6 B;  4Y52 H;  1KL9 A;  5IYB G;  1K9M C;  2MQH A;  4DV2 L;  1L0W A;  4BA2 I;  4GKK Q;  5C0X J;  3I4N H;  3TRZ A;  1Q1B A;  3PV0 A;  5FLX c;  1QZG A;  3UE1 A;  1PYS B;  3BJU A;  4AYB E;  1N36 Q;  3CC4 A;  1SRO A;  2CQO A;  4B3T Q;  2KCT A;  3M4O H;  2AMC B;  1Q1E A;  3CQZ H;  1D8L A;  3E9I A;  4LF4 L;  1RIP A;  1V1Q A;  3HOY H;  4HJ5 A;  3EIV A;  4C2M H;  1Q82 C;  3L7Z C;  3UDI A;  3AFP A;  4JYA L;  1AH9 A;  3W5O A;  3HKZ G;  2NN6 I;  1VQI A;  3BU2 A;  2IX1 A;  4QJF A;  2E8G A;  2N49 A;  3T1H Q;  4R4I A;  3W1G A;  2CWA A;  4DR5 L;  2Z6K C;  4A3F G;  4GKJ Q;  4GN3 B;  4JI5 L;  1CKN A;  4BXX H;  4O2D A;  1LTL A;  2Q2T A;  4A3G G;  3CCR A;  4FDB A;  1BBU A;  1LM0 A;  4B3R L;  3RLO A;  3NEL A;  1QUQ A;  1X56 A;  2E2J H;  3I4M H;  3AFQ A;  3PO3 G;  4HJ9 A;  1HZA A;  4A3M G;  4R1J A;  3PO2 G;  2JA7 H;  2UXB L;  1Q86 C;  3J81 j;  3U50 C;  1FJG L;  1G51 A;  1M1K C;  1DGS A;  4IO9 A;  3S1R H;  4DR7 Q;  3GDE A;  1Y1W H;  4A4I A;  4DUZ Q;  4YY3 L;  2UXD L;  4A3B G;  4BY1 H;  2PNH A;  4DR4 Q;  3FKI G;  2NVT H;  2A19 A;  4DUY L;  4QGU A;  3E9H A;  2Y0S E;  5BR8 Q;  4XTC S;  4DV6 Q;  2ZJR A;  4B3R Q;  4NB3 A;  3CCV A;  1YIJ A;  2JA8 G;  2UXC Q;  2I5M X;  2JA6 H;  3Q8D A;  1YBY A;  4AH6 A;  1VQ5 A;  4JV5 Q;  4DR2 L;  4UP9 A;  2EXD A;  1XNR L;  5C3E H;  1LYL A;  4ALP A;  1XNQ L;  4POG A;  5GAE C;  1KAW A;  2WAQ E;  2BH2 A;  4JBM A;  3K8A A;  3KDF B;  1VQ4 A;  1JE5 A;  3F2C A;  4DUY Q;  2WAQ G;  2GN5 A;  4LF9 L;  1W3S A;  2K52 A;  2R7Z H;  2YYZ A;  4JI3 L;  1M90 C;  1HZ9 A;  2AKW B;  4A3K G;  2HHH L;  1Q12 A;  4UP7 A;  1IBM Q;  2RF4 A;  1SFO H;  3A5Z B;  1P8L A;  1U5K A;  4OX9 L;  3H3V I;  1X65 A;  1OTC A;  3ULP A;  4P75 A;  4QY7 A;  5C4X H;  1XPU A;  1O7I A;  4IPD A;  2K14 A;  2WFW A;  3KF8 B;  3J80 i;  3CCS A;  5LMN W;  1AE2 A;  2QA4 A;  3I2Z A;  5LMN L;  4BBS G;  4JV5 L;  3CF5 A;  5IY0 A;  1C0A A;  2JQO A;  1PA6 A;  3L2P A;  1VQG A;  1W2B A;  5JEA G;  3FP9 A;  4LF8 L;  3E0E A;  1SE8 A;  3J7Z C;  4C3H H;  2VQE L;  1J5E Q;  4LFB Q;  2GVA A;  4IJL A;  1FJG Q;  4OWX B;  2D0O A;  1XJV A;  3ER0 A;  4NXN Q;  2ZTE A;  5HY6 A;  5H1S E;  3G6E A;  4B3M L;  3RZO H;  3T1Y Q;  3UDX A;  3AEV A;  3S2H H;  3H3V H;  1VQK A;  4OO1 I;  1PV4 A;  4R4Q A;  3M3Y H;  1S3O A;  1QVC A;  2HQL A;  2PI2 A;  3HFZ B;  2UU9 L;  4IPC A;  1E7Z A;  4B3T L;  1WCM H;  4AIM A;  2HIV A;  1Y1W G;  4DV3 Q;  1XPR A;  1N9W A;  5C3E G;  5HGQ A;  4X6A H;  2CFM A;  3M9B A;  4Y7N H;  4A3M H;  3U4Z A;  3KJO A;  1S72 A;  3CCJ A;  1ASZ A;  4JCV E;  5M5X H;  1T9H A;  3T1H L;  1OXT A;  5JEA J;  4HJ7 A;  3HOY G;  4MZ9 A;  4JI7 Q;  3OTO Q;  4BBS H;  1N34 L;  5IWA L;  5IYD G;  4JBJ A;  4AYB G;  4KHZ A;  3ULJ A;  3H0G H;  2JEB I;  3J7A 5;  3FKI H;  5C4J H;  3S1N H;  3B6Y A;  2VY3 A;  2CKZ B;  5ELN A;  3GTG H;  4JI6 Q;  3GTL H;  2YU9 H;  2R93 G;  2AWN A;  1QUQ B;  2K4K A;  1VQN A;  1VQD A;  4JI8 Q;  4LW1 A;  5M3F G;  3K0X A;  1WI5 A;  4J15 A;  4DPG A;  1IZ6 A;  4KI0 A;  2IT1 A;  4K0K L;  1I3Q H;  2RCN A;  1VQ8 A;  1HNW L;  1OXU A;  4L5T A;  3D0F A;  2K5H A;  1MKH A;  3HOX H;  1VQL A;  2BA0 A;  1JMC A;  4DV4 L;  2IY5 B;  2XTI A;  3CCM A;  1NJI C;  1SLJ A;  4RMF A;  1IXR A;  4X65 Q;  1GM5 A;  2E5L L;  2A1A A;  4DR2 Q;  5IP7 G;  2ZM6 Q;  4HIK A;  1QVF A;  3CD6 A;  1NY4 A;  4YHH Q;  2Q2U A;  4DNI A;  4LNQ A;  4QIW E;  4L5Q A;  1Z47 A;  4P71 A;  2JA9 A;  5AJ3 L;  3CCL A;  4A93 H;  1UE6 A;  4JI3 Q;  3S17 H;  3STB C;  5K36 G;  1XMO Q;  4P72 A;  4YCV A;  2A8V A;  2F52 A;  4A76 A;  2B29 A;  1PH9 A;  2JA7 G;  3HKZ E;  1K0R A;  2PQA A;  3ERS X;  1X54 A;  3I4O A;  3CPW A;  4X65 L;  1XMQ L;  2ES2 A;  3FHW A;  3TEH B;  4OX9 Q;  2JA8 H;  3GTP H;  2Q2I A;  3F2B A;  2YTV A;  3M4Q A;  2VUM H;  4DR6 Q;  3CAM A;  1VQF A;  5EAY A;  2B63 H;  3PCO B;  4YHH L;  1SRU A;  4YCU A;  1QVG A;  1R9T H;  1WOC A;  4APV A;  4IFD G;  2JE6 I;  4JI0 L;  2RHS B;  1HR0 L;  1WJJ A;  4A3J H;  4GLX A;  1I94 Q;  1VS0 A;  3AYH B;  2BA1 A;  2F4V L;  5FLM H;  3PUV A;  5C44 G;  2VQE Q;  3M85 A;  1CKO A;  1YJW A;  2UUB L;  1XNR Q;  4JI5 Q;  4X62 Q;  2NVY H;  1VQJ A;  3I56 A;  2YTX A;  2KHI A;  3KFU A;  4LF9 Q;  4LF5 Q;  1V43 A;  4QQB X;  2HIX A;  2MO1 A;  5FJ8 H;  4IOA A;  4A3G H;  3PF5 A;  1X3E A;  4BXX G;  4GN4 B;  4A3F H;  5JJI A;  1IYJ B;  1KRT A;  4X64 L;  3U4V A;  4JBK A;  5IYB H;  4DV7 Q;  2RHQ B;  4C3J H;  1AE3 A;  3KJP A;  1YIT A;  1IBM L;  4POF A;  3A0J A;  2H5X A;  3CXC A;  4A3J G;  3F1Z A;  1X55 A;  4X62 L;  3RNU A;  5M3M H;  4A75 A;  1YI2 A;  3K81 C;  1EYG A;  1PH1 A;  2E2I H;  1EFW A;  2VS1 A;  4PZ6 A;  1Q7Y C;  2UUC Q;  4DR1 L;  1N34 Q;  1OXS C;  2E5L Q;  2I0Q A;  1X3G A;  2Z6K A;  2ID0 A;  2QEX A;  1X3F A;  4A3I H;  4LF6 Q;  2VQF L;  3STB D;  4HJA A;  4JYA Q;  1GD7 A;  4BA1 I;  4JI4 Q;  4OO1 G;  4L5R C;  2Q2H A;  4IJH A;  3L0O A;  3G4S A;  4IOC A;  1HR0 W;  3HOU H;  3UE0 A;  2R92 H;  4HIM A;  5IP9 H;  1UE1 A;  2N3S A;  4NPS A;  1P16 A;  3IRB A;  4EQ5 A;  1L1O A;  2K50 A;  3PUX A;  1E22 A;  2UUC L;  4JI8 L;  1PH5 A;  4PZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...