2UU9L

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a gug-codon in the a-site and paromomycin.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Mechanism for expanding the decoding capacity of transfer RNAs by modification of uridines.
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uu9L00
1KL9A 4DR6Q 2KBNA 4B3RL 3RZDH 1IBLQ 4PZ7A 4B3TQ 4R1JA 4IJHA 2KHJA 1E1OA 3S1RH 4L5RC 2DGYA 2E2HH 2UXCQ 3J80i 2NVQH 2K50A 5JEAG 3STBD 5JJIA 2HQLA 2JJQA 4LUZA 4JI3L 1TWGH 2N3SA 4BBSH 3JAMc 5IYDH 3B6YA 3M3YH 5LMUQ 1BKBA 4X6AH 1NE3A 4A3LH 4A3CH 1I6HH 3ERSX 5C44H 4IFDJ 1VQMA 2UU9L 3M9BA 3BZKA 4AH6A 3AFQA 4A3EG 1AE2A 1S72A 2Z0SA 4GKKQ 1SMXA 2WFWA 4LF9Q 4AQYL 4GKJL 1YHAA 4B3MQ 3CXCA 3HOXG 1GO3E 1KQSA 2GN5A 3S14H 1HNZQ 2ALYB 5GAEC 4WJ3M 4P72A 4KHPL 1Y14B 1IBLL 2VL6A 4YHHQ 3CF5A 1N33Q 2KENA 1KAWA 4AIMA 1OXUA 1GM5A 2UXCL 3TS0A 1O7IA 2RF4A 1CKNB 1VQ6A 3A0JA 2IHFA 2YTYA 3HKSA 2KCMA 4YY3L 3S1QH 4A3IH 4JI0Q 2RHQB 2UUAL 4JV5Q 3I4MG 3RR5A 1K83H 4DUZL 5JJKA 4LFAQ 4PMWA 3UDIA 2UUBL 3PUZA 4JI8L 3DLLA 2VQEQ 2E8GA 5LMNQ 1Q8KA 1S40A 1VQOA 2PNHA 4X62Q 5E7NA 1I94Q 1YJ9A 2PI2E 4JCVE 4DV3Q 4O2DA 1IBMQ 3AFPA 5IY0A 2K5HA 1UEBA 5JJLA 3PV0A 1PH8A 3PIPA 2ATWA 1OXTA 2Z6KA 4DV7Q 1T9HA 1JJCB 5M3MH 1E7ZA 2Q2TA 1Q12A 4JBJA 3CCQA 1Q82C 4LF9L 2UXDQ 4A3JG 1HR0W 1C7YA 3G4SA 4POGA 4DV5L 1HNZL 4X66Q 4OONA 1W3SA 1L1OA 1QUQB 3OYYA 1I3QH 3M4PA 5BR8Q 1EUJA 1NMGA 2YTVA 5H1SE 1P16A 2VUMG 1B7YB 5EAYA 1KRTA 1MIUA 2JEBI 4JBWA 3KLWA 5FJ8G 3CC4A 1CUKA 3UDFA 4QQBX 4C2MH 2E5LQ 4GN4B 1L2FA 5M5XH 4IPDA 4PZ6A 1Y1VH 3FKIH 1HNWQ 3GTMH 4LFAL 3K8AA 5IWAL 3U4ZA 3T1HQ 5M3FG 3ULLA 3MXNB 1V43A 2MO0A 4LUVA 4UP9A 4APVA 2IX0A 5GAGC 3CCMA 4NXML 4BY7G 1I94L 1ASYA 4DV1Q 3STBC 2VW9A 2CWAA 2OQ0A 2PQAB 4DV3L 2HIXA 4GLAC 1IBML 3KFUA 3PO3H 4A3DH 1XNRQ 3AYHB 4B3RQ 1VQJA 4DV7L 1PVOA 1WOCA 5IP9G 3NENA 3HOUH 2WP8J 1Q1EA 3F8TA 4A3BG 4BBRG 3J81i 1G291 1S3OA 1C9OA 3UDXA 1GKHA 3RNUA 4DAMA 3CMAA 2JE6I 1WYDA 1X9NA 4Y7NH 1VQKA 3TS2A 2AMCB 4X66L 3L2PA 4IOCA 2R7FA 1K9MC 2A8VA 1PYBA 4DV4L 1MKHA 4GN3B 3H3VI 2N8NA 2NN6G 1EQQA 2OTJA 3KYHC 5BR8L 1KC8C 4BXXG 2MO1A 2B63H 4OWTB 1N32L 1I50H 4J15A 1N34L 1HNXL 1LTLA 3GTLH 2EXDA 4A3GG 2H5XA 2A19A 2F52A 4ME3A 1NJIC 4C3JH 3I4NH 2JA6H 2F3IA 4IFDG 2IHEA 1QZGA 2WAQE 2E2JH 4GNXC 1J5EL 4LF5Q 4HIOA 1YZ6A 1B70B 3DM3A 4KHZA 1WCMH 4P75A 4JI1Q 1VQBA 3ER0A 4IJLA 1UWVA 1CSPA 4BY1G 3ZJYC 4AQYQ 1YNXA 4QGUA 4LF6Q 2F4VQ 3RZOH 5GQOA 2WAQG 3H15A 1Y1WH 1HZBA 3PF5A 4R4TA 1FGUA 1WI5A 3CCUA 4RMFA 1PA6A 4KHPQ 1XNRL 3D31A 1RL2A 2RCNA 1X6OA 3HOZH 1VQHA 1SRUA 2YTXA 5FLMH 1E22A 3OTOL 1QVGA 4O0AA 1PHJA 2D62A 1Z9FA 2AWNA 2NVXH 3F2BA 1YHBA 2K5NA 2A1AA 3PUWA 4C3HH 4YY3Q 5IYCG 1HR0L 4B3SQ 4OXPA 1Q7YC 2UUAQ 5IP7H 4DUZQ 1HJPA 2UUBQ 2BA1A 4JI8Q 3HOWH 4LF8L 4A3FG 3MEFA 3S24A 1VQEA 3E9IA 3S2DH 2R7DA 2CWPA 2VQFQ 4A3DG 4A75A 1C0AA 1X54A 4HIMA 1IBKQ 1SE8A 3AEVA 3HOVH 1KXLA 4DV2Q 4FDBA 4P74A 4R4QA 3J7ZC 1OXSC 3GO5A 4JI5L 3KJOA 4YWMA 1VQGA 2GVAA 3ICEA 4QL5A 4MZ9A 5C3EH 5IYBH 4LF5L 4JI1L 1OXXK 3WWVA 3GD7A 3HFZB 2F4VL 4LF6L 4BBSG 1HH2P 1JT8A 5IYDG 1A0IA 4DV5Q 4DR4Q 4NB3A 3TQYA 2NN6I 2EQSA 5GAHC 3E9HA 4A3LG 4R4IA 4A3CG 4DK3C 3U4VA 5C44G 3PO2H 4JOIC 1VQPA 2YV5A 1Q86C 2OTLA 4AYBE 4QY7A 4A93H 3EIVA 1G51A 1K0RA 3CP0A 3RLFA 3UDGA 4MTNA 2OCEA 2NZHA 4PZ8A 3CC7A 4B3SL 4A3KH 1A63A 1H95A 2ZTEA 4IFDI 4AYBG 3ULJA 1VQNA 2MFIA 1EIYB 5HGQA 1CKNA 5IWAQ 3I2ZA 1Q81C 3H0GH 1JE5A 2HHHQ 3T1YQ 4NXMQ 3U58A 2MQHA 1PV4A 2JA7H 2VQFL 4GNXB 2L15A 2D0PA 1IBKL 2QGQA 4H02A 2E2IH 4DV2L 1YJWA 3K7UC 3RN5A 1K8GA 1X65A 2IT1A 4L5TA 2K52A 1JJ2A 1N9WA 3HKZE 2ZJQA 4L5SA 2Q2HA 3NELA 4YWLA 4A3IG 4DR4L 4A4IA 1SR3A 1IXRA 3HKZG 2CCZA 1K73C 3GTOH 4DV4Q 3S15H 1OXVA 3PUVA 3G71A 4XIGS 1BVSA 1VQ4A 2N78A 2ASBA 3U50C 3S17H 1UE7A 1GVPA 3D0FA 1KHIA 4DUYQ 3W1GA 1QVFA 1PFSA 3PGZA 1L0WA 3SGIA 3JAMi 4A3MH 3L0OA 1N34Q 1HNXQ 1EFWA 3GTKH 1E3PA 1NY4A 2I5LX 1OTCA 5DLQE 1YBYA 3EN2A 4BA2I 4LF4Q 1PH1A 5M3MG 2R7ZH 5GROA 1VQ8A 2UXBQ 3A5UA 1WFQA 3K80C 4JBMA 3JC66 1PYSB 1J5EQ 4LFCQ 2R93H 1X56A 2D0OA 4GN5A 3KDFB 1XPUA 3KOJA 2HHHL 3T1YL 3W5OA 1I5FA 3J80c 1A62A 4LWCA 3HOYH 3CW2C 4JBKA 1HZ9A 4OWXB 1M1KC 4OO1G 2ZJPA 1UE6A 3OTOQ 5C0XJ 2JEAI 4PG3A 2K4KA 2PQAA 4IPHA 1PH4A 3J7A5 1XMQL 4K0KQ 4HJ8A 4X65L 3T1HL 4GOPB 3PUYA 4X64L 1HR0Q 2CKZB 1Y1VG 3FKIG 4DV6Q 3M7NA 1VQDA 3G6EA 4LFBL 3I55A 4DKAC 3VDYA 1CKMA 1GD7A 1TWCH 1Z47A 4LF8Q 4DUYL 1TWHH 4Y52H 1VS0A 3I4OA 4JI6Q 4JI2Q 5C4XH 3KJPA 2HT1A 1YHQA 2QA4A 2JA5H 4RG1A 4DR5L 3PO3G 3GTPH 4DR1L 1E24A 1VQIA 3ULPA 4LNQA 2R92H 4MNOA 4LF4L 1SROA 1D8LA 2JQOA 3HOUG 2UXBL 4JI5Q 1IL2A 4WJ4A 4HIKA 3S2HH 1NTGA 4LFCL 1NMFA 3OW2A 4ALPA 1KD1C 2OWOA 2MNAA 4LF7Q 3L7ZC 4YCVA 3TEHB 5IT9c 3HOVG 3K7AH 3UE1A 1YI2A 1QZHA 2OQKA 4UP7A 5C4JH 1N32Q 4P71A 3PF4A 4LW1A 1PH6A 3G48A 1W2BA 5FLXc 1Q1BA 4R4OA 1P8LA 4DNIA 3CCVA 2B63G 1K8AC 1AE3A 1PH9A 4K0KL 1M90C 5M5WH 1FJGL 3KF6B 1YIJA 2NVYH 3I4NG 2I5HA 3E0EA 2JA6G 4IPGA 1X3FA 2WB1E 3CQZH 4BA1I 1XPOA 1WCMG 2Y0SE 3LGJA 5AJ3Q 4JI7L 2ZJRA 4JI6L 2EIFA 1Y1WG 4JI2L 1A8VA 2Q2IA 2WB1G 1PH7A 2NZOA 2B3GA 1LM0A 1LYLA 1EQRA 5ELNA 1R9TH 1WJJA 1QVCA 3HOZG 4YCUA 4OO1I 5FLMG 2KHIA 4A3EH 1N36L 1U0LA 1X3GA 2ES2A 2VNUD 4LF7L 1ASZA 3HOXH 3CCRA 2RHSB 4QIWE 2BH8A 2BA0A 4JC0A 4OWWB 1TWFH 2JA9A 5IP7G 3F2CA 4DV0L 1XNQQ 5LMNW 3HOWG 4GOPC 3TREA 2NVTH 4DR2L 1HZCA 3CCEA 2UUCL 3EBEA 1VQAA 1VCIA 2QEXA 5M5YH 2VY3A 1PH3A 2I0QA 1KRSA 3AQQA 1VQFA 3K81C 4DAYB 2ZM6Q 3I4MH 1K3RA 4HIDA 3CCLA 3H3VH 1Q46A 5ELOA 4POFA 5IYBG 5C3EG 1XPRA 1VQLA 2BH2A 4JYAL 1JJGA 5AJ3L 3TRZA 4QJFA 3J81c 4NXNL 3KF8B 1SLJA 2B29A 3A74A 3J81j 4DV6L 4B3ML 1PH5A 4OX9L 3GTQH 2LXJA 4DR6L 2CFMA 4UY8C 1YVCA 1TWAH 5JEAJ 4B3TL 1FVIA 2K14A 4R4CA 3PO2G 3GTGH 2ZTCA 1J6QA 2YU9H 5K36G 2AHOB 3CCJA 4IO9A 4GNXA 3FP9A 3CPFA 2JA8G 4A93G 1XMQQ 3CPWA 1KIXA 1XTDA 4A3JH 4X65Q 1NBWA 1MJEA 4A3KG 4X64Q 5C0XG 5LMUL 2XTIA 4A76A 4EQ5A 4OX9Q 1V1QA 3CMEA 3CC2A 4C3IH 1XNQL 2IX1A 4DK6C 2K75A 1YJNA 4LFBQ 1TXYA 4HJ9A 1G6PA 5IE8A 2CQOA 1BBWA 3H0GG 4KLKA 2VUMH 1B8AA 1E1TA 3PSIA 1QUQA 5FJ8H 2JA7G 1SN8A 3BU2A 4P73A 4TVAB 3I56A 4DR5Q 4DR1Q 4JG2A 4DR3Q 2ZM6L 1L1OB 4KI0A 1PH2A 4GKKL 4XTCS 2JA8H 5M3FH 3IRBA 4HJ5A 4DPGA 4BY7H 2PMZE 3W1BA 3F2DA 3BZCA 2I5MX 3CD6A 1BBUA 1U5KA 1XMOQ 3KDFA 3BJUA 1EOVA 4HJ7A 5IP9H 1X55A 4YHHL 1N33L 1IYJB 4A3BH 4BBRH 3M85A 4A3MG 1N8RC 3CAMA 1AH9A 1VQCA 3NBHB 2N49A 2LXKA 4JI0L 1V9PA 3RN2A 1XJVA 1FJGQ 1HZAA 1VQ9A 4JV5L 3Q8DA 2R7ZG 2DUDA 2VS1A 2JK8A 2VQEL 2R93G 1DGSA 4GS3A 5LMNL 4JI4Q 4DR7Q 4GLXA 2FXQA 3NEMA 3RLNA 4GOPA 4BXXH 4JOIA 4JI7Q 2C35B 2YYZA 5J3BA 4X62L 3HOYG 1MJCA 2V1CC 1LUZA 4A3GH 2KCTA 5GADC 2ID0A 2XGTA 1YEZA 3GTJH 4GLVB 1VQ7A 1IZ6A 4DR3L 3PUXA 1UE1A 1YITA 4IPCA 2K5VA 1CKOA 2ZTDA 3F1ZA 3UE0A 3RLOA 5HY6A 1N36Q 2Q2UA 4BY1H 4JI3Q 2UXDL 1X3EA 3M4QA 5C0XI 2VZAA 4L5QA 3S1MH 2HIVA 1RIPA 4UP8A 3A5ZB 3CCSA 4DV0Q 1XMOL 3M4OH 3PCOB 2GVBA 4EX5A 3K0XA 4HJAA 3PIOA 1UE5A 3GDEA 4DR2Q 2PI2A 5C4XG 1EYGA 4LUOA 2R6GA 2E5LL 2JA5G 1EWIA 4YCWA 2UUCQ 2UU9Q 1SFOH 2R92G 4NPSA 4UPAA 5IYCH 2AWOA 4IOAA 1D7QA 2Z6KC 1HNWL 2AKWB 1JB7A 1VQ5A 4TQUS 3S16H 4JI4L 4DR7L 3KF6A 4YWKA 4JYAQ 3S1NH 4A3FH 4GKJQ 2IY5B 1CSQA 4NXNQ 1EIFA 4DV1L 1FL0A 1L1OC 2LSSA 1JMCA 3I7FA 3FHWA 2Y0SG
chains in the Genus database with same CATH superfamily
4NP5A 3RZDH 4B3TQ 1PDQA 2KHJA 2UXCQ 2DGYA 4ZAIA 5JJIA 2K50A 5JEAG 4G57A 2A69C 1LV9A 5IYDH 1BKBA 5T1GA 1I6HH 2XIWA 5C44H 1DOLA 2WACA 3NTIA 2DY8A 1ESRA 2UU9L 3M9BA 1FD7D 4AH6A 3EVQA 3NXWA 3P1HA 1XWEA 3GQBA 4KY7A 2NBFA 3CXCA 1KQSA 3I4LA 5KNBA 1HNZQ 4DAYA 1PFBA 4ZKCB 5GAEC 4P72A 4DFAA 1S5ED 2D9UA 3RD4A 3KF8A 4YHHQ 2UXCL 2YTYA 3ND8A 3HKSA 3S1QH 4A3IH 4OEMB 3I4MG 1JC7A 1TWHB 2MHVA 1NAPA 3DLLA 2VQEQ 2QKIC 3BVZA 4IUTA 1MBYA 2IW3A 2PI2E 5IODA 1IBMQ 5IY0A 1PTOF 1PH8A 1WCMB 5M3MH 5C4HA 2Q2TA 1Y1WB 2ICEC 3AU7A 1HR0W 3BVGA 1HNZL 1W3SA 1L1OA 3OYYA 3M4PA 5BR8Q 3VR4A 1B7YB 3KLSX 5EAYA 1PLFA 4JBWA 3KLWA 2OEOA 2B2UC 3J7AV 2PZTA 1CUKA 3DEPA 1KDBA 4QIWB 1HNWQ 1HQRD 3K8AA 3M4YA 3QB3A 3CCMA 3MXNB 1V43A 2MO0A 1HPCA 3KLRA 4DV1Q 2CWAA 1IBML 2CW0C 2HIXA 4GLAC 4N9PA 1GUTA 4B3RQ 3CKIB 4HSPA 2KCCA 1S5FD 3HOUH 4I65A 4DNTB 2WP8J 1Q1EA 2E2DC 1HFGA 4BBRG 1A2UA 3P7JA 4A3BG 1S3OA 3ERQA 3RNUA 3CMAA 2JE6I 1X9NA 1TY0A 2AMCB 1PYBA 2L0CA 1MKHA 4DV4L 2N8NA 2NN6G 3MA2B 5CBEE 5BR8L 4KY5A 4M1UB 2MO1A 3CRKC 1WTWA 2B63H 1HNXL 2EXDA 2H5XA 2F52A 2O5IC 3I4NH 1BO0A 4RGOS 2WAQE 1TU2B 4HIOA 1B70B 4DK1A 2JA7B 1WCMH 1F9RA 1CSPA 3FPUB 3ZJYC 3RZOH 1Y1WH 1H9SB 4KHPQ 2RCNA 1BR9A 2YTXA 1B50A 1T5XD 1IYUA 5IOCA 1DD2A 3F2BA 2K5NA 1I4RA 1HR0L 1JB3A 3G7LA 4F8MA 2LKVA 4LF8L 4U673 4A3FG 1SE3A 2Z8LA 3K5MA 1VQEA 3E9IA 4MHEA 3VR3A 3QJYA 2R7DA 4OIKA 1IBKQ 1KXLA 4DV2Q 4FDBA 4HTHA 3NWSA 2JXMB 3J7ZC 1LT3D 4YWMA 4MZ9A 2Q8IB 4EGVA 1FNWA 1OXXK 1CTMA 1RDPD 3WOEA 1HH2P 3OMGA 1JT8A 4DR4Q 4DV5Q 1A3VA 4ZQ3A 3TQYA 2K03A 1V1PB 4A3BB 1BCPC 4A3CG 2RBMA 1SMYC 4DK3C 4NKLA 5KRUA 1JQYD 1LTID 3FPPA 1MGSA 4QY7A 4J6HA 3RLFA 2QEJC 4MTNA 4IFDI 1RTOA 2MFIA 1SYFA 5C4XB 1BOSA 3H3VC 3MFYA 3GTJB 2BDNA 2R92B 2JA7H 3U9SA 4ZRZA 3X3NA 1IBKL 2PZUA 2E2IH 4DV2L 5ISRA 1K3BC 2B39A 3HKZE 4H44C 1F9PA 3S1MB 3NELA 2Z9HA 5EPJA 4YWLA 3M4OB 4DR4L 4RHRA 1K73C 4O1NA 2N78A 1STEA 2LY7A 3RMHA 2A6ED 5EJWA 1EFWA 2NYZD 1NY4A 2I5LX 1B2TA 1DOKA 4BA2I 4RHSA 1PH1A 4K5XA 3S1NB 1EY7A 5GROA 1WFQA 3K80C 5FKAC 4GN5A 1XPUA 3W5OA 1LACA 1A62A 1Y8PB 3Q24A 3CW2C 3BG3A 1DONA 1HZ9A 1HFNA 3EQLC 2RQXA 4OO1G 3QG1A 3ND9A 4X3SA 5KEEA 4YIJA 2K5QA 4IPHA 2QCPX 4K0KQ 4FYDA 5G3LF 4NW2A 1R4QB 3FKIG 3M7NA 1YNNC 1VQDA 3I55A 4DKAC 1CKMA 4L6TB 2R61A 3I4OA 4QB4A 4JI6Q 5C4XH 1PTOC 1YHQA 3GTPH 1PZID 3ULPA 4LNQA 1HRJA 2R92H 1SROA 1IL2A 1W6JA 1NTGA 3OPOA 4OL7A 1NMFA 2OWOA 4YCVA 2F0FA 1QJOA 5IT9c 4UP7A 3FRPB 2YU9B 3PF4A 1FR3A 4LW1A 1PH6A 1E2ZA 3MVVA 4ZKBB 3CCVA 4RFBA 4CJ2C 2KCNA 5EKLA 1WTPA 1K8AC 1QB5D 1AE3A 4K0KL 1DYQA 2X6LA 1M90C 3KF6B 4OELB 1BXTA 2O4XA 4IPGA 2QF7A 2L1BA 5JJZA 2WB1E 3CQZH 3SHLA 1EY5A 4BA1I 5AJ3Q 4JI6L 2B2UA 1XTCD 2Q2IA 1STGA 5ELNA 1R9TH 3HOZG 4YCUA 2JA8B 1Q3LA 3NTKA 4CJ0B 1KDCA 4JC0A 4OWWB 1I4XA 3F2CA 3Q22A 1LTBD 4K8IA 3HOWG 2NTSA 3TREA 5F2DA 1HZCA 1FNVA 1EEID 1VQAA 1G8ZD 2QEXA 1X3PA 4M8AA 2XNAC 1KRSA 5EKKA 3T4AC 3CCLA 4POFA 1XPRA 2BH2A 1D2BA 4JYAL 1JJGA 5AJ3L 4I7ZC 3BYYB 3D6WA 4A3GB 2B29A 4OX9L 4DAVA 2CFMA 2F0VA 1NSNS 1YVCA 5IGBA 2K14A 3PO2G 2YU9H 3CCJA 3FP9A 4A93G 5HGTA 2K6AA 1KIXA 4X65Q 2O2LD 1MJEA 4CDDC 4X64Q 1GUWA 2QILA 3CMEA 1LABA 4H7BA 4J8QA 4DK6C 4LFBQ 5IE8A 4KLKA 2SOBA 4ULLA 2VUMH 2FHTA 4X3KA 1SFOB 4ID6A 5FJ8H 1AP0A 3GV3A 2AQ1B 3BU2A 4P73A 2K7VA 5E4XA 3I56A 2CQAA 1PFNA 1A2TA 4LJZC 4RA8A 4KI0A 4GKKL 2OT2A 4XTCS 1SJHD 2JA8H 2K32A 4HJ5A 4BY7H 3SE0A 3HOZB 3C46A 2I5MX 3OMCA 4HJ7A 2NVQB 4NDXA 2DJGC 2NB0A 4A3MG 3M3YB 2OF1A 3CAMA 2IL8A 1AH9A 1EY6A 2N49A 2PZWA 3D4WA 1FJGQ 1F9SA 1HZAA 2FMCA 2L5TA 3HOWB 4JV5L 3Q8DA 4RAUC 2PCFB 2R7ZG 2XRSD 2DUDA 2VS1A 2JK8A 1CFMA 4XDXA 4JI4Q 4BXXH 2FXQA 3RLNA 3E5SA 2C35B 3HOYG 1J8IA 1B44D 3H09A 4A3GH 2KCTA 1YEZA 4GLVB 1VQ7A 1VMPA 1YNJC 2FINB 2B8FA 1CKOA 3KUPA 3V96A 2Q2UA 4JI3Q 2KEDA 2VZAA 4L5QA 3PO2B 2EYFA 3V05A 3K0XA 4A93B 4EQNA 5CGKA 3R2IA 4DR2Q 2PI2A 1Z7TA 4LUOA 2E5LL 1KNAA 1EWIA 1K83B 4YCWA 2UUCQ 1SFOH 5IYCH 1CK1A 1D7QA 1JB7A 4ZLTF 4JI4L 4GKJQ 4NXNQ 4IZ8A 3SXHA 1PZKD 1D5ZC 1FL0A 1L1OC 1SYGA 5ELBA 2Y0SG 2Q8RE 2BOSA 5C3XA 1KL9A 4DR6Q 1GHKA 4KJOA 5D3DA 4R1JA 4IJHA 3J80i 2NVQH 3STBD 4FO2A 2HQLA 4JI3L 4LUZA 1A3TA 2EJGC 2I46A 2PMZB 4LK1C 3M3YH 4X6AH 2F0NA 2FJ2A 4A3LH 5J1ZA 4A3MB 4IN3A 3ERSX 1ZYRD 2NZ1D 4HAEA 1Y1VB 1V1OA 4NMZA 3NK9A 1VQMA 2R7ZB 5L37A 4FXDA 2O5JC 2NWGA 4A3EG 3HOYB 2Z0SA 4N8FA 2WFWA 4AQYL 4RGTA 4GKJL 1SNQA 3HOXG 2GN5A 1B1ZA 3K5NA 3S14H 2ALYB 5NUCA 1LTRD 1LTGD 3A7AB 4K14A 1Y14B 1A3UA 1RJTA 3CF5A 4Y7NB 1OXUA 1GM5A 4UAIA 2CHBD 1CKNB 1VQ6A 3QWNA 2IHFA 3K58A 4YY3L 2JN4A 1I6VC 4KV6A 2UUAL 5JJKA 4DUZL 1K83H 1CHQD 2UUBL 2G9DA 5A35A 4JI8L 4G7OC 3A7LA 5G3LD 1C48A 5LMNQ 2F0DA 5ELDA 4DXFA 4C3JB 4DV3Q 4O2DA 3R93A 5CYUA 2E2JB 5JJLA 2F0KA 3QOJA 2ATWA 4DV7Q 2Z6KA 3HP3A 1JJCB 3I70A 1JORA 5FOBB 2Y0SB 4A3JG 4KY6A 3G4SA 1AEXA 4X66Q 4C3IG 1I3QH 2PW5A 1KLGD 1ZKOA 1CHPD 1DJRD 5CORA 4HN7A 3CC4A 1TS5A 3UDFA 4C2MH 2M2LA 3NTHA 1L2FA 4WRDA 3G6JB 4IPDA 4PZ6A 1Y1VH 5E4WC 3GTMH 5FO8B 5IWAL 1QE6A 5EKIA 2BCOA 3L3OC 3ULLA 4LUVA 5GAGC 2F0PA 4APVA 5DEHA 3I90A 1U4RA 3GV6A 2VW9A 4DV3L 1AFPA 4A3EB 3R8BA 1VQJA 4DV7L 1WOCA 3HOXB 2KUMA 3F8TA 1WTRA 1O78A 1BCPB 1DXMA 1GKHA 4Z9CB 1WYDA 4Y7NH 5KNDA 4X66L 2OTJA 3DEOA 4GN3B 2Z1CA 1IHZA 2MPMA 2J7ZA 3TP5A 4J15A 4A3KB 1BUVT 4KHVA 4ME3A 1NJIC 2XRQD 1DCZA 4C3JH 1QILA 2F3IA 3S9WA 3VA7A 1GUSA 2E2JH 4GNXC 1SJED 4KHZA 4P75A 4BY1G 2F0LA 3ER0A 4IJLA 2D5DA 4LF6Q 1TWAB 2WAQG 3IFTA 3BDCA 1HZBA 3PF5A 4R4TA 1WI5A 1RL2A 3P20A 1X6OA 5JPMC 1VQHA 4A3JB 3OTOL 1QVGA 2NUCA 3OSOA 4CHTB 4IUUA 3LNNA 3E6ZX 3Q6SA 4C3IB 2EYLA 4C3HH 2K1BA 5DM63 2B2TA 5IP7H 2K33A 1O80A 3MEFA 3LX0A 3PQIA 3S2DH 2CWPA 5CV5A 1X54A 4X3UA 5CV7A 2EJMA 2WINB 1Y8NB 1OXSC 4JI5L 2GVAA 3SK4A 3ONAB 1ZEQX 3O13A 2MP1A 4LF6L 4BBSG 1PXUA 3TSSA 1MSHA 2L55A 1PMRA 5KYLA 1I4GA 3BZDB 3E9HA 4C56C 2C5CA 3SDZA 5K36H 3V2TA 1Q86C 3VR6A 4XQJA 1SNCA 4AYBE 1O7ZA 2Z6BA 3J7YW 3CP0A 2OCEA 1HA6A 4A3KH 5C0XH 1H95A 2ZTEA 3ULJA 5BN3A 1VQNA 1EY8A 5JVH3 1Q81C 2HHHQ 3T1YQ 3U58A 1PV4A 2L15A 4Q0FA 3NSWA 2D0PA 2RDGA 2B8GA 1EQVA 1X65A 4BY1B 2IT1A 4L5TA 2RKSA 4KTAA 3OHXC 1U4PA 4IQZA 5ELFA 2EYOA 1VF5C 1M4VA 3HKZG 4DV4Q 3QR8A 5COYA 2CCZA 3G71A 3H91A 1VQ4A 3U50C 4TKOB 1X32A 2EPBA 1A15A 1KHIA 4DUYQ 1QVFA 2JSOA 2NVYB 2F03A 3L0OA 1HNXQ 5J39A 3J81L 3S16B 1VQ8A 3JC66 3N52A 4LFCQ 2HHHL 3Q23A 3BYTB 2HDMA 3T1YL 3J80c 4LWCA 5E1FA 4HSVA 1LTTD 4CDCC 4CKCA 1F2YA 2E2HB 2F0QA 3TDQA 5I2XA 4BBSB 5IGFA 2JEAI 2PQAA 2XWBB 5CV8A 4HJ8A 3HZXA 1HR0Q 3PUYA 2CKZB 2N55A 5LL6X 3G6EA 2NVTB 1GD7A 1Z47A 4LF8Q 1G91A 4DUYL 1TWHH 3C2PA 1VS0A 4JI2Q 3KJPA 3PO3G 4DR5L 3I4MB 2A74C 3FMCA 4DR1L 1E24A 2ZT9C 1D8LA 5CV4A 1SEBD 4LFCL 2E76C 1Z6HA 3L9AX 4JPBW 4ALPA 2MNAA 3GTQB 3HOVG 5BN4A 3UE1A 1YI2A 3GTGB 1EZ8A 1DOMA 5FLXc 4R4OA 3NQTA 3HKZB 5JEAH 5FO7B 3SK5A 1YIJA 1BNZA 2NVYH 3E0EA 2JA6G 4G4KA 3VYTA 2IPKD 1AW7A 5EGTA 4EVOA 1XPOA 2HCCA 3I8ZA 4JI2L 2WB1G 1PH7A 2B3GA 4HMIA 4KD4A 1I4HA 3F2UA 1QVCA 5FLMG 3MTSA 1WTXA 5FK9C 2V4DA 1SDFA 2VB3X 1ASZA 3IKJA 3CCRA 2A6EC 4QIWE 2DN8A 3VYSA 1SNPA 2JA9A 3TP7A 4BBRB 1H9RA 4RWSC 2NVTH 1LO5D 3CCEA 3WDNA 3EBEA 3MC0B 3DUZA 2VY3A 5BN5A 3AQQA 3OOCA 4DAYB 3I4MH 1RF2D 5I4DA 5IYBG 5C3EG 4QF4A 3PO3B 4RCOA 3KF8B 1B9NA 5JAVA 5EPLA 4DV6L 1EOTA 4B3ML 3GTQH 3J80E 4R4CA 3GTGH 1J6QA 2SEBD 4K5VA 4IO9A 4GNXA 3HOVB 3CPWA 3MHBA 1K0SA 1IKMA 5LMUL 4K5WA 1I50B 1TXYA 3H0GG 1E1TA 2NTTA 1JE4A 3MXPA 1ICFB 3EJIA 4XQQA 1NUCA 1PRTB 1GUOA 1HTPA 4A3FB 1L1OB 3IRBA 3I91A 3SVMA 4K2LA 1GUGA 3BZCA 3CD6A 3KBGA 1U5KA 2TMPA 3IAYA 1Q8IA 3KDFA 1S5BD 1RODA 1N33L 1TWGB 4A3BH 4BBRH 5FLXE 3M85A 1C8CA 4KK7A 2IWHA 1CM9A 3HG9A 4JI0L 1XJVA 1E2WA 1VQ9A 2NN6H 1D6EC 2R93G 3LWUA 2F0HA 4GOPA 2YYZA 4X62L 1WD0A 4XT3B 1H9JA 2CH4A 1PRTF 5GADC 2XGTA 5C3EB 3GTJH 2VB2X 1U4MA 3UE0A 2UXDL 3MAQA 3M4QA 5C0XI 1STBA 5I6WA 3S1MH 1WD1A 1KABA 3CCSA 3M4OH 3JAME 2SDFA 2F0IA 4CKBA 5TSSA 4DAPA 5J22A 3K5LA 3GDEA 2JA5G 2R6GA 3FEWX 4ODGA 2GA4B 2AWOA 2Z6KC 3H0GB 2AKWB 3D4RA 2B2YA 4YWKA 4JYAQ 3S1NH 4A3FH 2IY5B 5CR3A 1EIFA 2LSSA 1CZWA 4KN7C 3FHWA 5KYIA 4OX9Q 2F4IA 3C1EA 3MWYW 1JICA 4P2CB 3K57A 4QMGA 1E1OA 3D3RA 5A2QE 2E75C 3S15B 2IX3A 4L63B 1QCBD 1TWGH 2N3SA 4UDUC 3OWEB 3B6YA 3DWQA 3K5OA 1CT1D 1GOZA 1ENCA 5EQ0A 3GTKB 4A3CH 1TR5A 2L11A 1SBBB 5M5XB 3FKIB 3K0YA 4IFDJ 2HCIA 4BS9A 1JWSD 2R93B 2G5DA 3AFQA 4CDEC 1AE2A 1AN8A 3RUZA 1S72A 1WTOA 1SE2A 1SMXA 4GKKQ 4LF9Q 3M7GA 3D8GA 1GO3E 4FXGC 3SK8A 2LMCB 2HUGA 4WJ3M 3BDOA 1EQTA 1NCVA 2VL6A 2A6HD 2KENA 5K5PA 4AIMA 3TS0A 1O7IA 4XXEA 2AQ2B 2AQ3B 1TWCB 4JV5Q 3RR5A 4PMWA 3UDIA 3PUZA 1QOHA 2E8GA 2JA5B 3AMUA 1S40A 1LTSD 2K05A 1O7LA 1VQOA 5E7NA 5DAUA 3DXJC 4JCVE 3SK6A 3AFPA 2K5HA 1UEBA 3PV0A 1OXTA 1T9HA 3DMUA 1TT2A 4UHVA 1Q82C 4LF9L 2F0TA 2RDHA 2P5ZX 4X3TA 4OONA 1HHVA 4ABNA 2B2TC 3TZUA 1EUJA 1NMGA 5H1SE 1P16A 4OO1H 3DWAA 2F1MA 1EIHA 3P75A 4N8X1 4CKEA 2E5LQ 2PPBC 5ELCA 5M5XH 2H1EA 4XQNA 5IGDA 1IYVA 3FKIH 2EY1A 4HMJA 4K6LA 3U4ZA 3NBHA 3T1HQ 5M3FG 2J0TD 2FMMA 2IX0A 2K04A 4NXML 1ASYA 3STBC 2OQ0A 1EFID 4A3DH 1XNRQ 3AYHB 5IP9G 3NENA 3T51B 1EY0A 2BE5D 1G291 3UDXA 1TWFB 4DAMA 1MI2A 1ZYRC 4ZK9B 3L2PA 5IGEA 1PFMA 5I9PA 5M5YB 1N32L 1N34L 1LTLA 2A19A 2RDFA 1JOOA 2I07B 1SYEA 3URYA 4ZUIA 1M8AA 3T56B 2IHEA 1QZGA 4IFDG 1J5EL 4LF5Q 3I72A 2EOTA 3DM3A 3T1HL 1VQBA 4AQYQ 2K28A 1UWVA 4B9XA 2F4VQ 5C4ZA 3IFDA 5GQOA 4DN4M 1UAPA 4L8JA 2F0MA 1FGUA 1R4PB 1PA6A 1XNRL 3D31A 1S4ZA 3HOZH 5ELEA 1PHJA 1O7YA 2D62A 1EY4A 1YHBA 2A1AA 4K6DA 4YY3Q 1JWMD 1Q7YC 2UUAQ 4DUZQ 1HJPA 2UUBQ 2BA1A 4JI8Q 3HOWH 3GTOB 3S24A 4MTKA 4A3DG 1XX8A 1C0AA 5I2YA 4R9WA 1CQVA 2D2CC 4HIMA 1LT6D 4P74A 3CU7A 5IT9L 1VMCA 3GO5A 4J1MA 1VQGA 3ICEA 4QL5A 2ZXRA 4LF5L 4C1NI 3WWVA 1PYWD 2F4VL 1TVXA 5CV9A 5IYDG 4NB3A 1TKWB 2NN6I 5GAHC 2AUKA 3R2TA 4R4IA 4F88A 4WFN3 3U4VA 1F77A 5C44G 3PO2H 4JOIC 1VQPA 1E0BA 2YV5A 2OTLA 4F87A 4A93H 1G51A 1G6ZA 1K0RA 2CH4W 4ZCKA 2RSOA 1A63A 2KA7A 4RH6A 4AYBG 4KKSA 5HGQA 5IWAQ 1BQQT 5I9OA 1D5XC 1EEFD 1JE5A 2K01A 3ZYYX 2MQHA 1RTNA 3S2HB 2QGQA 4H02A 1HTLD 1K8GA 4KN4C 1PRTD 3K7AB 2ZJQA 1KNEA 3NQIA 1EYCA 1IW7D 4FP5D 4A3IG 4LMQD 1SR3A 4A4IA 1Q90A 1RD9D 3PIO3 1OXVA 2N88A 4XIGS 1BVSA 2ASBA 3TZDA 5C5LA 3OIQA 1GVPA 2HQEA 3KBXA 3D0FA 2KJXA 2JYOA 3W1GA 1B3AA 3PGZA 1L0WA 3SGIA 3JAMi 4A3MH 3GTOH 1PVOA 1E3PA 3C3LA 1OTCA 1S5DD 3BDLA 5DLQE 3TP8A 5M9OA 1ESFA 1Y8OB 5KGUA 3U9OA 5IGGA 2F0OA 3VYRA 5M3MG 2R7ZH 2UXBQ 3A5UA 4JBMA 1X56A 4A3DB 3KOJA 1I5FA 2XN9C 3HOYH 4JBKA 4OHJA 1A6XA 2EYPA 1Y69U 1JCKB 4OWXB 1T5EA 3VA5A 3OTOQ 4PG3A 2K4KA 1PH4A 3J7A5 2B2VA 2EY6A 1XMQL 2KQ3A 3D6CA 2Q8TA 1BBXC 1II3A 4FF1A 1SYDA 1I6HB 2RCFA 5C44B 2OXPA 1B53A 3QO2A 4XYQA 1EL0A 2B2WC 4TSSA 1D1IA 3I3CA 4AYBB 4DU9A 3GP7A 4CBVA 1VQIA 4DNRB 1AZPA 4MNOA 4XYOA 5LHY1 4G7ZC 3HOUG 2UXBL 1JOKA 2F0EA 4JI5Q 4HIKA 3S2HH 1KAAA 1STYA 3OW2A 4V190 2QDLA 2WV6D 1L0XB 3K7AH 1SAPA 1QZHA 3NHHA 4P71A 3W3AA 1W2BA 1Q1BA 3S1QB 1BCPF 2F0SA 5I6YA 1P8LA 2B63G 4A3IB 1H9SA 1PH9A 3I4NG 3MXUA 2I5HA 1VF7A 1X3FA 4ME5A 1WCMG 2Y0SE 4ILWA 3LGJA 4Q5VA 4JI7L 1ET6A 3K59A 2EIFA 1Y1WG 1A8VA 3PIP3 5M3MB 1TS2A 1LM0A 1LYLA 5D65A 1EQRA 1WJJA 4OO1I 2KHIA 4A3EH 3FDTA 2ICIA 2F0JA 1N36L 1X3GA 4H13C 2SNSA 5KIXA 3HOXH 2BA0A 3CRLC 4RKLA 4DV0L 3A56A 1XNQQ 5IIFA 2X6GA 4GOPC 2A68D 1V1PA 1J9OA 5DNFA 1EY9A 1VCIA 4OGQC 4RKBA 2EYMA 3K81C 2ZM6Q 1PTOB 1K3RA 2Z4HA 4HIDA 3H3VH 1Q46A 4LAAA 1QNKA 4BWGB 4QJFA 3E3XA 1SLJA 3A74A 3J81j 4XT1B 3HOUB 4PV1C 5T1IA 1NR2A 3OW7A 4UY8C 1TWAH 2QDBA 4B3TL 5AFWA 2AHOB 4KJNA 2WAQB 3CPFA 3MFGA 1TQOA 4IUNA 3X3MA 2FFKB 1S5CD 1ML0D 4A3JH 1NBWA 3MXGA 3HGBA 3CHBD 2XTIA 2ENBA 3CC2A 2B63B 4C3IH 1XNQL 1HXYD 1YJNA 1EU3A 2B2YC 1BBWA 4H0LC 3PSIA 2A69D 1QUQA 2JA7G 3UI2A 1SN8A 3ITPA 3I4NB 1HUNA 4TVAB 3SEBA 4DR5Q 5CC4A 4DR1Q 4HEDA 1MHWC 2F0GA 2ZM6L 2XWJB 1WTHA 3RZOB 2LS01 1PH2A 2TSSA 4EQPA 3TMEA 1HA5A 2EZVA 2F0UA 3S1RB 1ENAA 3EFXD 3NE5B 2Z4IA 1X55A 4YHHL 4KD3A 3EA6A 1VQCA 1G2SA 4RCNA 2LXKA 1V9PA 2LFNA 3DHQA 4DA2A 2VQEL 1LT4D 1JOQA 1ONLA 1STNA 4B08A 4DR7Q 4GLXA 3NEMA 1PTOH 4JOIA 4PMBA 4FF3A 1MJCA 2V1CC 3HEJA 5EPKA 1I4QA 2ID0A 1U9RA 5FO9B 2K5VA 2RVLA 2ZTDA 3F1ZA 1ZXTA 5HY6A 3RLOA 4BY1H 4IALA 1X3EA 4WORA 3FVQA 2F3VA 1SYBA 1KTKA 1RIPA 2HIVA 4UP8A 5D3IB 3PCOB 1LLRD 2QW7A 4EX5A 4FVMA 3PIOA 1EWHA 1UE5A 2F0WA 5C4XG 1JR0D 3NPPA 3A54A 2R92G 2C9OA 4NPSA 4UPAA 4MN3A 1WTQA 1HNWL 1NR4A 1VQ5A 3S16H 4DR7L 3DWPA 3KF6A 4GZYC 1EU4A 2E2IB 4DV1L 1LTAD 1RCVD 4DV6Q 3I7FA 4B3MQ 4B3RL 2KBNA 1G2TA 4S3SA 2DNEA 4PZ7A 1IBLQ 3S1RH 5C3WA 4L5RC 2E2HH 2HD3A 2PQEA 1EWCA 2CW0D 2JJQA 4BBSH 3JAMc 2JP1A 5DM73 5LMUQ 1SYCA 1NE3A 2MUYA 4QUCA 4QCLA 2KOLA 4O42A 1KLUD 3BZKA 3HRZC 1GJXA 2A73B 2EXZA 3NWTA 1OO9B 4FXKC 1YHAA 4PMCA 3D4DA 2B2WA 4IURA 5KNCA 4KHPL 1IBLL 1N33Q 1KAWA 2RF4A 3A0JA 2KCMA 1WVLA 3A8IE 3TBIB 2WKDA 1K8MA 4JI0Q 2RHQB 3TP6A 4LFAQ 1Q8KA 1C4QA 3GTLB 3GTPB 2PNHA 4CGYB 4X62Q 1I94Q 1YJ9A 2JA6B 2MGSA 3PIPA 3VR5A 1WTVA 1E7ZA 4MIUA 1Q12A 4JBJA 3CCQA 2SNMA 1QNUA 2WB1B 2UXDQ 1UNSA 1C7YA 4POGA 4DV5L 1QUQB 3NP8A 2KHSA 1JWUD 2NVXB 2YTVA 2VUMG 1SXTA 1KRTA 1IL8A 1MIUA 2JEBI 4R8NA 5FJ8G 1RHPA 4ZUJA 1GHJA 3VR2A 3J7AF 5CBAE 4QQBX 4GN4B 1E2VA 1SNDA 1BCPD 3CQZB 5EBCA 1SMYD 5D14A 3OIPA 3A55A 4LFAL 4KKUA 3A8JE 3C1FA 2JA8G 2J4XA 1SNMA 4UP9A 2KEEA 4BY7G 3VYUA 4B9WA 1R9TB 1I94L 3PO3H 2PQAB 3KFUA 1TS4A 1D1KA 1EYDA 4RGMA 3J81i 1CA5A 1C9OA 3NUCA 1SSOA 2F3WA 3T16A 1F9QA 1L0YB 3TS2A 1VQKA 2WKCA 3HOVH 1K9MC 4IOCA 2R7FA 2A8VA 2WIIB 3H3VI 1EQQA 4FF2A 3KLSA 3KYHC 1KC8C 4BXXG 2RSNA 1SE4A 2EY5A 4OWTB 1I50H 2RA4A 3GTLH 3IL8A 4A3GG 2L12A 3J80L 2JA6H 1TIID 3R3OA 5JPNC 1DZ1A 1IKLA 1YZ6A 4JI1Q 2A6HC 1YNXA 4QGUA 3H15A 2X69A 3CCUA 4RMFA 3SR1A 1HUMA 1SRUA 2L4NA 4PNYA 1E22A 5FLMH 4O0AA 1Z9FA 2AWNA 2EVBA 3HS0C 2NVXH 3PUWA 2EDGA 5IYCG 4B3SQ 4OXPA 3S17B 2VUMB 1NNXA 4N9TA 1STHA 3T53B 1ILQA 2VQFQ 4A75A 2CVRA 1YNND 4DF7A 1SE8A 4DK0A 3AEVA 4IUPA 4R4QA 4FF4A 3KJOA 4BY7B 4QUFA 5C3EH 5IYBH 1RKNA 1UEAB 1PTOD 2B2VC 2BDOA 4JI1L 5FLXL 3GD7A 3HFZB 1ILPA 1A0IA 3EROA 2EQSA 4A3LG 4K8JA 2E74C 1AZQA 5CV6A 1U4LA 2PNRC 3EIVA 3MEHA 3UDGA 2NZHA 4PZ8A 3CC7A 4B3SL 2VXWA 3LWEA 1EIYB 1CKNA 5CMDA 3I2ZA 3H0GH 2BE5C 4I7AA 4NXMQ 2VQFL 4GNXB 4E6IA 3TN2A 1YJWA 3JAML 1B4OA 3K7UC 3RN5A 2K52A 1JJ2A 1N9WA 4L5SA 2DNCA 2Q2HA 5C4JB 1GXDC 2MJ8A 2XSCA 1IXRA 4CDFC 3S15H 1D5MC 3PUVA 4ZYSA 1LT5D 4FNFA 3S17H 1UE7A 3QOLA 4DGZA 5M5WB 4DXGA 1PFSA 1N32Q 4V0BA 1N34Q 3GTKH 5E3FA 1YBYA 3EN2A 2K5WA 4LF4Q 3T13A 1PYSB 5A2QL 1J5EQ 2R93H 2D0OA 4F7XA 3KDFB 1FGBD 2PO4A 1SNOA 5IT9E 2KECA 1M1KC 2ZJPA 1UE6A 5C0XJ 5C5MA 4X65L 4GOPB 3W2DA 4X64L 1Y1VG 4LFBL 2ZXPA 3VDYA 5JOBA 1EIGA 1TWCH 4Y52H 1CQFA 2HT1A 4C1NK 3N6RA 4WJWA 2QA4A 2JA5H 4RG1A 1UUPA 3BVMA 4LF4L 1EYAA 2JQOA 2M9VA 1PZJD 4WJ4A 3K6OA 4PQXA 2L9HA 3S14B 1KD1C 4LF7Q 1CI3M 3L7ZC 3TEHB 2OQKA 5C4JH 3G48A 4R8IA 2KVMA 4KKTA 3H94A 4EQOA 4DNIA 3KK7A 5M5WH 1FJGL 2EYHA 4C3JG 5LL6S 1TS3A 3BS1A 4G7HC 4JVZA 2ZJRA 3AB9A 1PRTC 1F2MA 2NZOA 1IW7C 3I73A 5M3FB 3Q0AA 1ET9A 1HCZA 1TY2A 1U0LA 2ES2A 2VNUD 4LF7L 1F2LA 4C3HG 1I3QB 1X3QA 2RHSB 1B3QA 2BH8A 2M00A 4U68A 1QG7A 1TWFH 1YNJD 5IP7G 5LMNW 4OIJA 3PMFA 4C2MB 1B9MA 1VDZA 1K28A 4DR2L 1QWYA 2UUCL 1BF4A 3GTMB 1ENFA 5M5YH 1PH3A 2I0QA 1VQFA 2HDLA 5ELOA 2XVSA 1VQLA 4JK1C 3TRZA 3J81c 2DY7A 4NXNL 1CA6A 1XYIA 3OWFA 2EE1A 1PH5A 4DR6L 2LXJA 1MD2D 2DJFC 5JEAJ 1FVIA 2ZTCA 5K36G 4RGNA 1HQMC 4K2KA 1XMQQ 1XTDA 3A8KE 2A5HA 1K8OA 4A3KG 5C0XG 4A76A 4EQ5A 1V1QA 2IX1A 2K75A 4HJ9A 1G6PA 2CQOA 1EZ6A 2EY2A 1B8AA 3E0JA 2EJFC 1I4PA 5EBDA 4JG2A 4DR3Q 1CZGA 5M3FH 4DPGA 2PMZE 3DM1A 4TRDA 3W1BA 3F2DA 4HCSA 3RZDB 1BBUA 3QIAA 1XMOQ 1F2ZA 3WOFA 3MXNA 3BJUA 1EOVA 5IP9H 1IYJB 1W6KA 2AUJD 4C3HB 2IJ0A 1N8RC 3NBHB 2EYJA 3RN2A 5JVG3 2R3ZA 1FNUA 3S2DB 4HR7B 1DGSA 4GS3A 5LMNL 1FYCA 4IUVA 5IGCA 4JI7Q 5J3BA 4IUQA 1LUZA 4JW0A 1H9MA 1XXGA 1IZ6A 2PYKA 3PUXA 4HCEA 4DR3L 1UE1A 1YITA 4IPCA 3H6MA 4IFDH 4KMUC 1N36Q 2A68C 1V8QA 5HURA 3NBIA 1MSGA 3A5ZB 1XMOL 4DV0Q 2GVBA 1KDAA 4HJAA 1ICWA 1H9KA 1EYGA 1DM0B 2ZXOA 1GUNA 2UU9Q 1BDOA 4IOAA 4TQUS 2PW7A 4CJ1B 2K5DA 1CSQA 3MZ5A 1STAA 2G9HD 2H4OA 5C6AA 1JMCA 3J81E
chains in the Genus database with same CATH topology
1KL9A 4DR6Q 2KBNA 4B3RL 3RZDH 1IBLQ 4PZ7A 4B3TQ 4R1JA 4IJHA 2KHJA 1E1OA 3S1RH 4L5RC 2DGYA 2E2HH 2UXCQ 3J80i 2NVQH 2K50A 5JEAG 3STBD 5JJIA 2HQLA 2JJQA 4LUZA 4JI3L 1TWGH 2N3SA 4BBSH 3JAMc 5IYDH 3B6YA 3M3YH 5LMUQ 1BKBA 4X6AH 1NE3A 4A3LH 4A3CH 1I6HH 3ERSX 5C44H 4IFDJ 1VQMA 2UU9L 3M9BA 3BZKA 4AH6A 3AFQA 4A3EG 1AE2A 1S72A 2Z0SA 4GKKQ 1SMXA 2WFWA 4LF9Q 4AQYL 4GKJL 1YHAA 4B3MQ 3CXCA 3HOXG 1GO3E 1KQSA 2GN5A 3S14H 1HNZQ 2ALYB 5GAEC 4WJ3M 4P72A 4KHPL 1Y14B 1IBLL 2VL6A 4YHHQ 3CF5A 1N33Q 2KENA 1KAWA 4AIMA 1OXUA 1GM5A 2UXCL 3TS0A 1O7IA 2RF4A 1CKNB 1VQ6A 3A0JA 2IHFA 2YTYA 3HKSA 2KCMA 4YY3L 3S1QH 4A3IH 4JI0Q 2RHQB 2UUAL 4JV5Q 3I4MG 3RR5A 1K83H 4DUZL 5JJKA 4LFAQ 4PMWA 3UDIA 2UUBL 3PUZA 4JI8L 3DLLA 2VQEQ 2E8GA 5LMNQ 1Q8KA 1S40A 1VQOA 2PNHA 4X62Q 5E7NA 1I94Q 1YJ9A 2PI2E 4JCVE 4DV3Q 4O2DA 1IBMQ 3AFPA 5IY0A 2K5HA 1UEBA 5JJLA 3PV0A 1PH8A 3PIPA 2ATWA 1OXTA 2Z6KA 4DV7Q 1T9HA 1JJCB 5M3MH 1E7ZA 2Q2TA 1Q12A 4JBJA 3CCQA 1Q82C 4LF9L 2UXDQ 4A3JG 1HR0W 1C7YA 3G4SA 4POGA 4DV5L 1HNZL 4X66Q 4OONA 1W3SA 1L1OA 1QUQB 3OYYA 1I3QH 3M4PA 5BR8Q 1EUJA 1NMGA 2YTVA 5H1SE 1P16A 2VUMG 1B7YB 5EAYA 1KRTA 1MIUA 2JEBI 4JBWA 3KLWA 5FJ8G 3CC4A 1CUKA 3UDFA 4QQBX 4C2MH 2E5LQ 4GN4B 1L2FA 5M5XH 4IPDA 4PZ6A 1Y1VH 3FKIH 1HNWQ 3GTMH 4LFAL 3K8AA 5IWAL 3U4ZA 3T1HQ 5M3FG 3ULLA 3MXNB 1V43A 2MO0A 4LUVA 4UP9A 4APVA 2IX0A 5GAGC 3CCMA 4NXML 4BY7G 1I94L 1ASYA 4DV1Q 3STBC 2VW9A 2CWAA 2OQ0A 2PQAB 4DV3L 2HIXA 4GLAC 1IBML 3KFUA 3PO3H 4A3DH 1XNRQ 3AYHB 4B3RQ 1VQJA 4DV7L 1PVOA 1WOCA 5IP9G 3NENA 3HOUH 2WP8J 1Q1EA 3F8TA 4A3BG 4BBRG 3J81i 1G291 1S3OA 1C9OA 3UDXA 1GKHA 3RNUA 4DAMA 3CMAA 2JE6I 1WYDA 1X9NA 4Y7NH 1VQKA 3TS2A 2AMCB 4X66L 3L2PA 4IOCA 2R7FA 1K9MC 2A8VA 1PYBA 4DV4L 1MKHA 4GN3B 3H3VI 2N8NA 2NN6G 1EQQA 2OTJA 3KYHC 5BR8L 1KC8C 4BXXG 2MO1A 2B63H 4OWTB 1N32L 1I50H 4J15A 1N34L 1HNXL 1LTLA 3GTLH 2EXDA 4A3GG 2H5XA 2A19A 2F52A 4ME3A 1NJIC 4C3JH 3I4NH 2JA6H 2F3IA 4IFDG 2IHEA 1QZGA 2WAQE 2E2JH 4GNXC 1J5EL 4LF5Q 4HIOA 1YZ6A 1B70B 3DM3A 4KHZA 1WCMH 4P75A 4JI1Q 1VQBA 3ER0A 4IJLA 1UWVA 1CSPA 4BY1G 3ZJYC 4AQYQ 1YNXA 4QGUA 4LF6Q 2F4VQ 3RZOH 5GQOA 2WAQG 3H15A 1Y1WH 1HZBA 3PF5A 4R4TA 1FGUA 1WI5A 3CCUA 4RMFA 1PA6A 4KHPQ 1XNRL 3D31A 1RL2A 2RCNA 1X6OA 3HOZH 1VQHA 1SRUA 2YTXA 5FLMH 1E22A 3OTOL 1QVGA 4O0AA 1PHJA 2D62A 1Z9FA 2AWNA 2NVXH 3F2BA 1YHBA 2K5NA 2A1AA 3PUWA 4C3HH 4YY3Q 5IYCG 1HR0L 4B3SQ 4OXPA 1Q7YC 2UUAQ 5IP7H 4DUZQ 1HJPA 2UUBQ 2BA1A 4JI8Q 3HOWH 4LF8L 4A3FG 3MEFA 3S24A 1VQEA 3E9IA 3S2DH 2R7DA 2CWPA 2VQFQ 4A3DG 4A75A 1C0AA 1X54A 4HIMA 1IBKQ 1SE8A 3AEVA 3HOVH 1KXLA 4DV2Q 4FDBA 4P74A 4R4QA 3J7ZC 1OXSC 3GO5A 4JI5L 3KJOA 4YWMA 1VQGA 2GVAA 3ICEA 4QL5A 4MZ9A 5C3EH 5IYBH 4LF5L 4JI1L 1OXXK 3WWVA 3GD7A 3HFZB 2F4VL 4LF6L 4BBSG 1HH2P 1JT8A 5IYDG 1A0IA 4DV5Q 4DR4Q 4NB3A 3TQYA 2NN6I 2EQSA 5GAHC 3E9HA 4A3LG 4R4IA 4A3CG 4DK3C 3U4VA 5C44G 3PO2H 4JOIC 1VQPA 2YV5A 1Q86C 2OTLA 4AYBE 4QY7A 4A93H 3EIVA 1G51A 1K0RA 3CP0A 3RLFA 3UDGA 4MTNA 2OCEA 2NZHA 4PZ8A 3CC7A 4B3SL 4A3KH 1A63A 1H95A 2ZTEA 4IFDI 4AYBG 3ULJA 1VQNA 2MFIA 1EIYB 5HGQA 1CKNA 5IWAQ 3I2ZA 1Q81C 3H0GH 1JE5A 2HHHQ 3T1YQ 4NXMQ 3U58A 2MQHA 1PV4A 2JA7H 2VQFL 4GNXB 2L15A 2D0PA 1IBKL 2QGQA 4H02A 2E2IH 4DV2L 1YJWA 3K7UC 3RN5A 1K8GA 1X65A 2IT1A 4L5TA 2K52A 1JJ2A 1N9WA 3HKZE 2ZJQA 4L5SA 2Q2HA 3NELA 4YWLA 4A3IG 4DR4L 4A4IA 1SR3A 1IXRA 3HKZG 2CCZA 1K73C 3GTOH 4DV4Q 3S15H 1OXVA 3PUVA 3G71A 4XIGS 1BVSA 1VQ4A 2N78A 2ASBA 3U50C 3S17H 1UE7A 1GVPA 3D0FA 1KHIA 4DUYQ 3W1GA 1QVFA 1PFSA 3PGZA 1L0WA 3SGIA 3JAMi 4A3MH 3L0OA 1N34Q 1HNXQ 1EFWA 3GTKH 1E3PA 1NY4A 2I5LX 1OTCA 5DLQE 1YBYA 3EN2A 4BA2I 4LF4Q 1PH1A 5M3MG 2R7ZH 5GROA 1VQ8A 2UXBQ 3A5UA 1WFQA 3K80C 4JBMA 3JC66 1PYSB 1J5EQ 4LFCQ 2R93H 1X56A 2D0OA 4GN5A 3KDFB 1XPUA 3KOJA 2HHHL 3T1YL 3W5OA 1I5FA 3J80c 1A62A 4LWCA 3HOYH 3CW2C 4JBKA 1HZ9A 4OWXB 1M1KC 4OO1G 2ZJPA 1UE6A 3OTOQ 5C0XJ 2JEAI 4PG3A 2K4KA 2PQAA 4IPHA 1PH4A 3J7A5 1XMQL 4K0KQ 4HJ8A 4X65L 3T1HL 4GOPB 3PUYA 4X64L 1HR0Q 2CKZB 1Y1VG 3FKIG 4DV6Q 3M7NA 1VQDA 3G6EA 4LFBL 3I55A 4DKAC 3VDYA 1CKMA 1GD7A 1TWCH 1Z47A 4LF8Q 4DUYL 1TWHH 4Y52H 1VS0A 3I4OA 4JI6Q 4JI2Q 5C4XH 3KJPA 2HT1A 1YHQA 2QA4A 2JA5H 4RG1A 4DR5L 3PO3G 3GTPH 4DR1L 1E24A 1VQIA 3ULPA 4LNQA 2R92H 4MNOA 4LF4L 1SROA 1D8LA 2JQOA 3HOUG 2UXBL 4JI5Q 1IL2A 4WJ4A 4HIKA 3S2HH 1NTGA 4LFCL 1NMFA 3OW2A 4ALPA 1KD1C 2OWOA 2MNAA 4LF7Q 3L7ZC 4YCVA 3TEHB 5IT9c 3HOVG 3K7AH 3UE1A 1YI2A 1QZHA 2OQKA 4UP7A 5C4JH 1N32Q 4P71A 3PF4A 4LW1A 1PH6A 3G48A 1W2BA 5FLXc 1Q1BA 4R4OA 1P8LA 4DNIA 3CCVA 2B63G 1K8AC 1AE3A 1PH9A 4K0KL 1M90C 5M5WH 1FJGL 3KF6B 1YIJA 2NVYH 3I4NG 2I5HA 3E0EA 2JA6G 4IPGA 1X3FA 2WB1E 3CQZH 4BA1I 1XPOA 1WCMG 2Y0SE 3LGJA 5AJ3Q 4JI7L 2ZJRA 4JI6L 2EIFA 1Y1WG 4JI2L 1A8VA 2Q2IA 2WB1G 1PH7A 2NZOA 2B3GA 1LM0A 1LYLA 1EQRA 5ELNA 1R9TH 1WJJA 1QVCA 3HOZG 4YCUA 4OO1I 5FLMG 2KHIA 4A3EH 1N36L 1U0LA 1X3GA 2ES2A 2VNUD 4LF7L 1ASZA 3HOXH 3CCRA 2RHSB 4QIWE 2BH8A 2BA0A 4JC0A 4OWWB 1TWFH 2JA9A 5IP7G 3F2CA 4DV0L 1XNQQ 5LMNW 3HOWG 4GOPC 3TREA 2NVTH 4DR2L 1HZCA 3CCEA 2UUCL 3EBEA 1VQAA 1VCIA 2QEXA 5M5YH 2VY3A 1PH3A 2I0QA 1KRSA 3AQQA 1VQFA 3K81C 4DAYB 2ZM6Q 3I4MH 1K3RA 4HIDA 3CCLA 3H3VH 1Q46A 5ELOA 4POFA 5IYBG 5C3EG 1XPRA 1VQLA 2BH2A 4JYAL 1JJGA 5AJ3L 3TRZA 4QJFA 3J81c 4NXNL 3KF8B 1SLJA 2B29A 3A74A 3J81j 4DV6L 4B3ML 1PH5A 4OX9L 3GTQH 2LXJA 4DR6L 2CFMA 4UY8C 1YVCA 1TWAH 5JEAJ 4B3TL 1FVIA 2K14A 4R4CA 3PO2G 3GTGH 2ZTCA 1J6QA 2YU9H 5K36G 2AHOB 3CCJA 4IO9A 4GNXA 3FP9A 3CPFA 2JA8G 4A93G 1XMQQ 3CPWA 1KIXA 1XTDA 4A3JH 4X65Q 1NBWA 1MJEA 4A3KG 4X64Q 5C0XG 5LMUL 2XTIA 4A76A 4EQ5A 4OX9Q 1V1QA 3CMEA 3CC2A 4C3IH 1XNQL 2IX1A 4DK6C 2K75A 1YJNA 4LFBQ 1TXYA 4HJ9A 1G6PA 5IE8A 2CQOA 1BBWA 3H0GG 4KLKA 2VUMH 1B8AA 1E1TA 3PSIA 1QUQA 5FJ8H 2JA7G 1SN8A 3BU2A 4P73A 4TVAB 3I56A 4DR5Q 4DR1Q 4JG2A 4DR3Q 2ZM6L 1L1OB 4KI0A 1PH2A 4GKKL 4XTCS 2JA8H 5M3FH 3IRBA 4HJ5A 4DPGA 4BY7H 2PMZE 3W1BA 3F2DA 3BZCA 2I5MX 3CD6A 1BBUA 1U5KA 1XMOQ 3KDFA 3BJUA 1EOVA 4HJ7A 5IP9H 1X55A 4YHHL 1N33L 1IYJB 4A3BH 4BBRH 3M85A 4A3MG 1N8RC 3CAMA 1AH9A 1VQCA 3NBHB 2N49A 2LXKA 4JI0L 1V9PA 3RN2A 1XJVA 1FJGQ 1HZAA 1VQ9A 4JV5L 3Q8DA 2R7ZG 2DUDA 2VS1A 2JK8A 2VQEL 2R93G 1DGSA 4GS3A 5LMNL 4JI4Q 4DR7Q 4GLXA 2FXQA 3NEMA 3RLNA 4GOPA 4BXXH 4JOIA 4JI7Q 2C35B 2YYZA 5J3BA 4X62L 3HOYG 1MJCA 2V1CC 1LUZA 4A3GH 2KCTA 5GADC 2ID0A 2XGTA 1YEZA 3GTJH 4GLVB 1VQ7A 1IZ6A 4DR3L 3PUXA 1UE1A 1YITA 4IPCA 2K5VA 1CKOA 2ZTDA 3F1ZA 3UE0A 3RLOA 5HY6A 1N36Q 2Q2UA 4BY1H 4JI3Q 2UXDL 1X3EA 3M4QA 5C0XI 2VZAA 4L5QA 3S1MH 2HIVA 1RIPA 4UP8A 3A5ZB 3CCSA 4DV0Q 1XMOL 3M4OH 3PCOB 2GVBA 4EX5A 3K0XA 4HJAA 3PIOA 1UE5A 3GDEA 4DR2Q 2PI2A 5C4XG 1EYGA 4LUOA 2R6GA 2E5LL 2JA5G 1EWIA 4YCWA 2UUCQ 2UU9Q 1SFOH 2R92G 4NPSA 4UPAA 5IYCH 2AWOA 4IOAA 1D7QA 2Z6KC 1HNWL 2AKWB 1JB7A 1VQ5A 4TQUS 3S16H 4JI4L 4DR7L 3KF6A 4YWKA 4JYAQ 3S1NH 4A3FH 4GKJQ 2IY5B 1CSQA 4NXNQ 1EIFA 4DV1L 1FL0A 1L1OC 2LSSA 1JMCA 3I7FA 3FHWA 2Y0SG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KL9 A;  4DR6 Q;  2KBN A;  4B3R L;  3RZD H;  1IBL Q;  4PZ7 A;  4B3T Q;  4R1J A;  4IJH A;  2KHJ A;  1E1O A;  3S1R H;  4L5R C;  2DGY A;  2E2H H;  2UXC Q;  3J80 i;  2NVQ H;  2K50 A;  5JEA G;  3STB D;  5JJI A;  2HQL A;  2JJQ A;  4LUZ A;  4JI3 L;  1TWG H;  2N3S A;  4BBS H;  3JAM c;  5IYD H;  3B6Y A;  3M3Y H;  5LMU Q;  1BKB A;  4X6A H;  1NE3 A;  4A3L H;  4A3C H;  1I6H H;  3ERS X;  5C44 H;  4IFD J;  1VQM A;  2UU9 L;  3M9B A;  3BZK A;  4AH6 A;  3AFQ A;  4A3E G;  1AE2 A;  1S72 A;  2Z0S A;  4GKK Q;  1SMX A;  2WFW A;  4LF9 Q;  4AQY L;  4GKJ L;  1YHA A;  4B3M Q;  3CXC A;  3HOX G;  1GO3 E;  1KQS A;  2GN5 A;  3S14 H;  1HNZ Q;  2ALY B;  5GAE C;  4WJ3 M;  4P72 A;  4KHP L;  1Y14 B;  1IBL L;  2VL6 A;  4YHH Q;  3CF5 A;  1N33 Q;  2KEN A;  1KAW A;  4AIM A;  1OXU A;  1GM5 A;  2UXC L;  3TS0 A;  1O7I A;  2RF4 A;  1CKN B;  1VQ6 A;  3A0J A;  2IHF A;  2YTY A;  3HKS A;  2KCM A;  4YY3 L;  3S1Q H;  4A3I H;  4JI0 Q;  2RHQ B;  2UUA L;  4JV5 Q;  3I4M G;  3RR5 A;  1K83 H;  4DUZ L;  5JJK A;  4LFA Q;  4PMW A;  3UDI A;  2UUB L;  3PUZ A;  4JI8 L;  3DLL A;  2VQE Q;  2E8G A;  5LMN Q;  1Q8K A;  1S40 A;  1VQO A;  2PNH A;  4X62 Q;  5E7N A;  1I94 Q;  1YJ9 A;  2PI2 E;  4JCV E;  4DV3 Q;  4O2D A;  1IBM Q;  3AFP A;  5IY0 A;  2K5H A;  1UEB A;  5JJL A;  3PV0 A;  1PH8 A;  3PIP A;  2ATW A;  1OXT A;  2Z6K A;  4DV7 Q;  1T9H A;  1JJC B;  5M3M H;  1E7Z A;  2Q2T A;  1Q12 A;  4JBJ A;  3CCQ A;  1Q82 C;  4LF9 L;  2UXD Q;  4A3J G;  1HR0 W;  1C7Y A;  3G4S A;  4POG A;  4DV5 L;  1HNZ L;  4X66 Q;  4OON A;  1W3S A;  1L1O A;  1QUQ B;  3OYY A;  1I3Q H;  3M4P A;  5BR8 Q;  1EUJ A;  1NMG A;  2YTV A;  5H1S E;  1P16 A;  2VUM G;  1B7Y B;  5EAY A;  1KRT A;  1MIU A;  2JEB I;  4JBW A;  3KLW A;  5FJ8 G;  3CC4 A;  1CUK A;  3UDF A;  4QQB X;  4C2M H;  2E5L Q;  4GN4 B;  1L2F A;  5M5X H;  4IPD A;  4PZ6 A;  1Y1V H;  3FKI H;  1HNW Q;  3GTM H;  4LFA L;  3K8A A;  5IWA L;  3U4Z A;  3T1H Q;  5M3F G;  3ULL A;  3MXN B;  1V43 A;  2MO0 A;  4LUV A;  4UP9 A;  4APV A;  2IX0 A;  5GAG C;  3CCM A;  4NXM L;  4BY7 G;  1I94 L;  1ASY A;  4DV1 Q;  3STB C;  2VW9 A;  2CWA A;  2OQ0 A;  2PQA B;  4DV3 L;  2HIX A;  4GLA C;  1IBM L;  3KFU A;  3PO3 H;  4A3D H;  1XNR Q;  3AYH B;  4B3R Q;  1VQJ A;  4DV7 L;  1PVO A;  1WOC A;  5IP9 G;  3NEN A;  3HOU H;  2WP8 J;  1Q1E A;  3F8T A;  4A3B G;  4BBR G;  3J81 i;  1G29 1;  1S3O A;  1C9O A;  3UDX A;  1GKH A;  3RNU A;  4DAM A;  3CMA A;  2JE6 I;  1WYD A;  1X9N A;  4Y7N H;  1VQK A;  3TS2 A;  2AMC B;  4X66 L;  3L2P A;  4IOC A;  2R7F A;  1K9M C;  2A8V A;  1PYB A;  4DV4 L;  1MKH A;  4GN3 B;  3H3V I;  2N8N A;  2NN6 G;  1EQQ A;  2OTJ A;  3KYH C;  5BR8 L;  1KC8 C;  4BXX G;  2MO1 A;  2B63 H;  4OWT B;  1N32 L;  1I50 H;  4J15 A;  1N34 L;  1HNX L;  1LTL A;  3GTL H;  2EXD A;  4A3G G;  2H5X A;  2A19 A;  2F52 A;  4ME3 A;  1NJI C;  4C3J H;  3I4N H;  2JA6 H;  2F3I A;  4IFD G;  2IHE A;  1QZG A;  2WAQ E;  2E2J H;  4GNX C;  1J5E L;  4LF5 Q;  4HIO A;  1YZ6 A;  1B70 B;  3DM3 A;  4KHZ A;  1WCM H;  4P75 A;  4JI1 Q;  1VQB A;  3ER0 A;  4IJL A;  1UWV A;  1CSP A;  4BY1 G;  3ZJY C;  4AQY Q;  1YNX A;  4QGU A;  4LF6 Q;  2F4V Q;  3RZO H;  5GQO A;  2WAQ G;  3H15 A;  1Y1W H;  1HZB A;  3PF5 A;  4R4T A;  1FGU A;  1WI5 A;  3CCU A;  4RMF A;  1PA6 A;  4KHP Q;  1XNR L;  3D31 A;  1RL2 A;  2RCN A;  1X6O A;  3HOZ H;  1VQH A;  1SRU A;  2YTX A;  5FLM H;  1E22 A;  3OTO L;  1QVG A;  4O0A A;  1PHJ A;  2D62 A;  1Z9F A;  2AWN A;  2NVX H;  3F2B A;  1YHB A;  2K5N A;  2A1A A;  3PUW A;  4C3H H;  4YY3 Q;  5IYC G;  1HR0 L;  4B3S Q;  4OXP A;  1Q7Y C;  2UUA Q;  5IP7 H;  4DUZ Q;  1HJP A;  2UUB Q;  2BA1 A;  4JI8 Q;  3HOW H;  4LF8 L;  4A3F G;  3MEF A;  3S24 A;  1VQE A;  3E9I A;  3S2D H;  2R7D A;  2CWP A;  2VQF Q;  4A3D G;  4A75 A;  1C0A A;  1X54 A;  4HIM A;  1IBK Q;  1SE8 A;  3AEV A;  3HOV H;  1KXL A;  4DV2 Q;  4FDB A;  4P74 A;  4R4Q A;  3J7Z C;  1OXS C;  3GO5 A;  4JI5 L;  3KJO A;  4YWM A;  1VQG A;  2GVA A;  3ICE A;  4QL5 A;  4MZ9 A;  5C3E H;  5IYB H;  4LF5 L;  4JI1 L;  1OXX K;  3WWV A;  3GD7 A;  3HFZ B;  2F4V L;  4LF6 L;  4BBS G;  1HH2 P;  1JT8 A;  5IYD G;  1A0I A;  4DV5 Q;  4DR4 Q;  4NB3 A;  3TQY A;  2NN6 I;  2EQS A;  5GAH C;  3E9H A;  4A3L G;  4R4I A;  4A3C G;  4DK3 C;  3U4V A;  5C44 G;  3PO2 H;  4JOI C;  1VQP A;  2YV5 A;  1Q86 C;  2OTL A;  4AYB E;  4QY7 A;  4A93 H;  3EIV A;  1G51 A;  1K0R A;  3CP0 A;  3RLF A;  3UDG A;  4MTN A;  2OCE A;  2NZH A;  4PZ8 A;  3CC7 A;  4B3S L;  4A3K H;  1A63 A;  1H95 A;  2ZTE A;  4IFD I;  4AYB G;  3ULJ A;  1VQN A;  2MFI A;  1EIY B;  5HGQ A;  1CKN A;  5IWA Q;  3I2Z A;  1Q81 C;  3H0G H;  1JE5 A;  2HHH Q;  3T1Y Q;  4NXM Q;  3U58 A;  2MQH A;  1PV4 A;  2JA7 H;  2VQF L;  4GNX B;  2L15 A;  2D0P A;  1IBK L;  2QGQ A;  4H02 A;  2E2I H;  4DV2 L;  1YJW A;  3K7U C;  3RN5 A;  1K8G A;  1X65 A;  2IT1 A;  4L5T A;  2K52 A;  1JJ2 A;  1N9W A;  3HKZ E;  2ZJQ A;  4L5S A;  2Q2H A;  3NEL A;  4YWL A;  4A3I G;  4DR4 L;  4A4I A;  1SR3 A;  1IXR A;  3HKZ G;  2CCZ A;  1K73 C;  3GTO H;  4DV4 Q;  3S15 H;  1OXV A;  3PUV A;  3G71 A;  4XIG S;  1BVS A;  1VQ4 A;  2N78 A;  2ASB A;  3U50 C;  3S17 H;  1UE7 A;  1GVP A;  3D0F A;  1KHI A;  4DUY Q;  3W1G A;  1QVF A;  1PFS A;  3PGZ A;  1L0W A;  3SGI A;  3JAM i;  4A3M H;  3L0O A;  1N34 Q;  1HNX Q;  1EFW A;  3GTK H;  1E3P A;  1NY4 A;  2I5L X;  1OTC A;  5DLQ E;  1YBY A;  3EN2 A;  4BA2 I;  4LF4 Q;  1PH1 A;  5M3M G;  2R7Z H;  5GRO A;  1VQ8 A;  2UXB Q;  3A5U A;  1WFQ A;  3K80 C;  4JBM A;  3JC6 6;  1PYS B;  1J5E Q;  4LFC Q;  2R93 H;  1X56 A;  2D0O A;  4GN5 A;  3KDF B;  1XPU A;  3KOJ A;  2HHH L;  3T1Y L;  3W5O A;  1I5F A;  3J80 c;  1A62 A;  4LWC A;  3HOY H;  3CW2 C;  4JBK A;  1HZ9 A;  4OWX B;  1M1K C;  4OO1 G;  2ZJP A;  1UE6 A;  3OTO Q;  5C0X J;  2JEA I;  4PG3 A;  2K4K A;  2PQA A;  4IPH A;  1PH4 A;  3J7A 5;  1XMQ L;  4K0K Q;  4HJ8 A;  4X65 L;  3T1H L;  4GOP B;  3PUY A;  4X64 L;  1HR0 Q;  2CKZ B;  1Y1V G;  3FKI G;  4DV6 Q;  3M7N A;  1VQD A;  3G6E A;  4LFB L;  3I55 A;  4DKA C;  3VDY A;  1CKM A;  1GD7 A;  1TWC H;  1Z47 A;  4LF8 Q;  4DUY L;  1TWH H;  4Y52 H;  1VS0 A;  3I4O A;  4JI6 Q;  4JI2 Q;  5C4X H;  3KJP A;  2HT1 A;  1YHQ A;  2QA4 A;  2JA5 H;  4RG1 A;  4DR5 L;  3PO3 G;  3GTP H;  4DR1 L;  1E24 A;  1VQI A;  3ULP A;  4LNQ A;  2R92 H;  4MNO A;  4LF4 L;  1SRO A;  1D8L A;  2JQO A;  3HOU G;  2UXB L;  4JI5 Q;  1IL2 A;  4WJ4 A;  4HIK A;  3S2H H;  1NTG A;  4LFC L;  1NMF A;  3OW2 A;  4ALP A;  1KD1 C;  2OWO A;  2MNA A;  4LF7 Q;  3L7Z C;  4YCV A;  3TEH B;  5IT9 c;  3HOV G;  3K7A H;  3UE1 A;  1YI2 A;  1QZH A;  2OQK A;  4UP7 A;  5C4J H;  1N32 Q;  4P71 A;  3PF4 A;  4LW1 A;  1PH6 A;  3G48 A;  1W2B A;  5FLX c;  1Q1B A;  4R4O A;  1P8L A;  4DNI A;  3CCV A;  2B63 G;  1K8A C;  1AE3 A;  1PH9 A;  4K0K L;  1M90 C;  5M5W H;  1FJG L;  3KF6 B;  1YIJ A;  2NVY H;  3I4N G;  2I5H A;  3E0E A;  2JA6 G;  4IPG A;  1X3F A;  2WB1 E;  3CQZ H;  4BA1 I;  1XPO A;  1WCM G;  2Y0S E;  3LGJ A;  5AJ3 Q;  4JI7 L;  2ZJR A;  4JI6 L;  2EIF A;  1Y1W G;  4JI2 L;  1A8V A;  2Q2I A;  2WB1 G;  1PH7 A;  2NZO A;  2B3G A;  1LM0 A;  1LYL A;  1EQR A;  5ELN A;  1R9T H;  1WJJ A;  1QVC A;  3HOZ G;  4YCU A;  4OO1 I;  5FLM G;  2KHI A;  4A3E H;  1N36 L;  1U0L A;  1X3G A;  2ES2 A;  2VNU D;  4LF7 L;  1ASZ A;  3HOX H;  3CCR A;  2RHS B;  4QIW E;  2BH8 A;  2BA0 A;  4JC0 A;  4OWW B;  1TWF H;  2JA9 A;  5IP7 G;  3F2C A;  4DV0 L;  1XNQ Q;  5LMN W;  3HOW G;  4GOP C;  3TRE A;  2NVT H;  4DR2 L;  1HZC A;  3CCE A;  2UUC L;  3EBE A;  1VQA A;  1VCI A;  2QEX A;  5M5Y H;  2VY3 A;  1PH3 A;  2I0Q A;  1KRS A;  3AQQ A;  1VQF A;  3K81 C;  4DAY B;  2ZM6 Q;  3I4M H;  1K3R A;  4HID A;  3CCL A;  3H3V H;  1Q46 A;  5ELO A;  4POF A;  5IYB G;  5C3E G;  1XPR A;  1VQL A;  2BH2 A;  4JYA L;  1JJG A;  5AJ3 L;  3TRZ A;  4QJF A;  3J81 c;  4NXN L;  3KF8 B;  1SLJ A;  2B29 A;  3A74 A;  3J81 j;  4DV6 L;  4B3M L;  1PH5 A;  4OX9 L;  3GTQ H;  2LXJ A;  4DR6 L;  2CFM A;  4UY8 C;  1YVC A;  1TWA H;  5JEA J;  4B3T L;  1FVI A;  2K14 A;  4R4C A;  3PO2 G;  3GTG H;  2ZTC A;  1J6Q A;  2YU9 H;  5K36 G;  2AHO B;  3CCJ A;  4IO9 A;  4GNX A;  3FP9 A;  3CPF A;  2JA8 G;  4A93 G;  1XMQ Q;  3CPW A;  1KIX A;  1XTD A;  4A3J H;  4X65 Q;  1NBW A;  1MJE A;  4A3K G;  4X64 Q;  5C0X G;  5LMU L;  2XTI A;  4A76 A;  4EQ5 A;  4OX9 Q;  1V1Q A;  3CME A;  3CC2 A;  4C3I H;  1XNQ L;  2IX1 A;  4DK6 C;  2K75 A;  1YJN A;  4LFB Q;  1TXY A;  4HJ9 A;  1G6P A;  5IE8 A;  2CQO A;  1BBW A;  3H0G G;  4KLK A;  2VUM H;  1B8A A;  1E1T A;  3PSI A;  1QUQ A;  5FJ8 H;  2JA7 G;  1SN8 A;  3BU2 A;  4P73 A;  4TVA B;  3I56 A;  4DR5 Q;  4DR1 Q;  4JG2 A;  4DR3 Q;  2ZM6 L;  1L1O B;  4KI0 A;  1PH2 A;  4GKK L;  4XTC S;  2JA8 H;  5M3F H;  3IRB A;  4HJ5 A;  4DPG A;  4BY7 H;  2PMZ E;  3W1B A;  3F2D A;  3BZC A;  2I5M X;  3CD6 A;  1BBU A;  1U5K A;  1XMO Q;  3KDF A;  3BJU A;  1EOV A;  4HJ7 A;  5IP9 H;  1X55 A;  4YHH L;  1N33 L;  1IYJ B;  4A3B H;  4BBR H;  3M85 A;  4A3M G;  1N8R C;  3CAM A;  1AH9 A;  1VQC A;  3NBH B;  2N49 A;  2LXK A;  4JI0 L;  1V9P A;  3RN2 A;  1XJV A;  1FJG Q;  1HZA A;  1VQ9 A;  4JV5 L;  3Q8D A;  2R7Z G;  2DUD A;  2VS1 A;  2JK8 A;  2VQE L;  2R93 G;  1DGS A;  4GS3 A;  5LMN L;  4JI4 Q;  4DR7 Q;  4GLX A;  2FXQ A;  3NEM A;  3RLN A;  4GOP A;  4BXX H;  4JOI A;  4JI7 Q;  2C35 B;  2YYZ A;  5J3B A;  4X62 L;  3HOY G;  1MJC A;  2V1C C;  1LUZ A;  4A3G H;  2KCT A;  5GAD C;  2ID0 A;  2XGT A;  1YEZ A;  3GTJ H;  4GLV B;  1VQ7 A;  1IZ6 A;  4DR3 L;  3PUX A;  1UE1 A;  1YIT A;  4IPC A;  2K5V A;  1CKO A;  2ZTD A;  3F1Z A;  3UE0 A;  3RLO A;  5HY6 A;  1N36 Q;  2Q2U A;  4BY1 H;  4JI3 Q;  2UXD L;  1X3E A;  3M4Q A;  5C0X I;  2VZA A;  4L5Q A;  3S1M H;  2HIV A;  1RIP A;  4UP8 A;  3A5Z B;  3CCS A;  4DV0 Q;  1XMO L;  3M4O H;  3PCO B;  2GVB A;  4EX5 A;  3K0X A;  4HJA A;  3PIO A;  1UE5 A;  3GDE A;  4DR2 Q;  2PI2 A;  5C4X G;  1EYG A;  4LUO A;  2R6G A;  2E5L L;  2JA5 G;  1EWI A;  4YCW A;  2UUC Q;  2UU9 Q;  1SFO H;  2R92 G;  4NPS A;  4UPA A;  5IYC H;  2AWO A;  4IOA A;  1D7Q A;  2Z6K C;  1HNW L;  2AKW B;  1JB7 A;  1VQ5 A;  4TQU S;  3S16 H;  4JI4 L;  4DR7 L;  3KF6 A;  4YWK A;  4JYA Q;  3S1N H;  4A3F H;  4GKJ Q;  2IY5 B;  1CSQ A;  4NXN Q;  1EIF A;  4DV1 L;  1FL0 A;  1L1O C;  2LSS A;  1JMC A;  3I7F A;  3FHW A;  2Y0S G; 
#chains in the Genus database with same CATH topology
 4NP5 A;  3RZD H;  4B3T Q;  1PDQ A;  2KHJ A;  2UXC Q;  2DGY A;  4ZAI A;  5JJI A;  2K50 A;  5JEA G;  4G57 A;  2A69 C;  1LV9 A;  5IYD H;  1BKB A;  5T1G A;  1I6H H;  2XIW A;  5C44 H;  1DOL A;  2WAC A;  3NTI A;  2DY8 A;  1ESR A;  2UU9 L;  3M9B A;  1FD7 D;  4AH6 A;  3EVQ A;  3NXW A;  3P1H A;  1XWE A;  3GQB A;  4KY7 A;  2NBF A;  3CXC A;  1KQS A;  3I4L A;  5KNB A;  1HNZ Q;  4DAY A;  1PFB A;  4ZKC B;  5GAE C;  4P72 A;  4DFA A;  1S5E D;  2D9U A;  3RD4 A;  3KF8 A;  4YHH Q;  2UXC L;  2YTY A;  3ND8 A;  3HKS A;  3S1Q H;  4A3I H;  4OEM B;  3I4M G;  1JC7 A;  1TWH B;  2MHV A;  1NAP A;  3DLL A;  2VQE Q;  2QKI C;  3BVZ A;  4IUT A;  1MBY A;  2IW3 A;  2PI2 E;  5IOD A;  1IBM Q;  5IY0 A;  1PTO F;  1PH8 A;  1WCM B;  5M3M H;  5C4H A;  2Q2T A;  1Y1W B;  2ICE C;  3AU7 A;  1HR0 W;  3BVG A;  1HNZ L;  1W3S A;  1L1O A;  3OYY A;  3M4P A;  5BR8 Q;  3VR4 A;  1B7Y B;  3KLS X;  5EAY A;  1PLF A;  4JBW A;  3KLW A;  2OEO A;  2B2U C;  3J7A V;  2PZT A;  1CUK A;  3DEP A;  1KDB A;  4QIW B;  1HNW Q;  1HQR D;  3K8A A;  3M4Y A;  3QB3 A;  3CCM A;  3MXN B;  1V43 A;  2MO0 A;  1HPC A;  3KLR A;  4DV1 Q;  2CWA A;  1IBM L;  2CW0 C;  2HIX A;  4GLA C;  4N9P A;  1GUT A;  4B3R Q;  3CKI B;  4HSP A;  2KCC A;  1S5F D;  3HOU H;  4I65 A;  4DNT B;  2WP8 J;  1Q1E A;  2E2D C;  1HFG A;  4BBR G;  1A2U A;  3P7J A;  4A3B G;  1S3O A;  3ERQ A;  3RNU A;  3CMA A;  2JE6 I;  1X9N A;  1TY0 A;  2AMC B;  1PYB A;  2L0C A;  1MKH A;  4DV4 L;  2N8N A;  2NN6 G;  3MA2 B;  5CBE E;  5BR8 L;  4KY5 A;  4M1U B;  2MO1 A;  3CRK C;  1WTW A;  2B63 H;  1HNX L;  2EXD A;  2H5X A;  2F52 A;  2O5I C;  3I4N H;  1BO0 A;  4RGO S;  2WAQ E;  1TU2 B;  4HIO A;  1B70 B;  4DK1 A;  2JA7 B;  1WCM H;  1F9R A;  1CSP A;  3FPU B;  3ZJY C;  3RZO H;  1Y1W H;  1H9S B;  4KHP Q;  2RCN A;  1BR9 A;  2YTX A;  1B50 A;  1T5X D;  1IYU A;  5IOC A;  1DD2 A;  3F2B A;  2K5N A;  1I4R A;  1HR0 L;  1JB3 A;  3G7L A;  4F8M A;  2LKV A;  4LF8 L;  4U67 3;  4A3F G;  1SE3 A;  2Z8L A;  3K5M A;  1VQE A;  3E9I A;  4MHE A;  3VR3 A;  3QJY A;  2R7D A;  4OIK A;  1IBK Q;  1KXL A;  4DV2 Q;  4FDB A;  4HTH A;  3NWS A;  2JXM B;  3J7Z C;  1LT3 D;  4YWM A;  4MZ9 A;  2Q8I B;  4EGV A;  1FNW A;  1OXX K;  1CTM A;  1RDP D;  3WOE A;  1HH2 P;  3OMG A;  1JT8 A;  4DR4 Q;  4DV5 Q;  1A3V A;  4ZQ3 A;  3TQY A;  2K03 A;  1V1P B;  4A3B B;  1BCP C;  4A3C G;  2RBM A;  1SMY C;  4DK3 C;  4NKL A;  5KRU A;  1JQY D;  1LTI D;  3FPP A;  1MGS A;  4QY7 A;  4J6H A;  3RLF A;  2QEJ C;  4MTN A;  4IFD I;  1RTO A;  2MFI A;  1SYF A;  5C4X B;  1BOS A;  3H3V C;  3MFY A;  3GTJ B;  2BDN A;  2R92 B;  2JA7 H;  3U9S A;  4ZRZ A;  3X3N A;  1IBK L;  2PZU A;  2E2I H;  4DV2 L;  5ISR A;  1K3B C;  2B39 A;  3HKZ E;  4H44 C;  1F9P A;  3S1M B;  3NEL A;  2Z9H A;  5EPJ A;  4YWL A;  3M4O B;  4DR4 L;  4RHR A;  1K73 C;  4O1N A;  2N78 A;  1STE A;  2LY7 A;  3RMH A;  2A6E D;  5EJW A;  1EFW A;  2NYZ D;  1NY4 A;  2I5L X;  1B2T A;  1DOK A;  4BA2 I;  4RHS A;  1PH1 A;  4K5X A;  3S1N B;  1EY7 A;  5GRO A;  1WFQ A;  3K80 C;  5FKA C;  4GN5 A;  1XPU A;  3W5O A;  1LAC A;  1A62 A;  1Y8P B;  3Q24 A;  3CW2 C;  3BG3 A;  1DON A;  1HZ9 A;  1HFN A;  3EQL C;  2RQX A;  4OO1 G;  3QG1 A;  3ND9 A;  4X3S A;  5KEE A;  4YIJ A;  2K5Q A;  4IPH A;  2QCP X;  4K0K Q;  4FYD A;  5G3L F;  4NW2 A;  1R4Q B;  3FKI G;  3M7N A;  1YNN C;  1VQD A;  3I55 A;  4DKA C;  1CKM A;  4L6T B;  2R61 A;  3I4O A;  4QB4 A;  4JI6 Q;  5C4X H;  1PTO C;  1YHQ A;  3GTP H;  1PZI D;  3ULP A;  4LNQ A;  1HRJ A;  2R92 H;  1SRO A;  1IL2 A;  1W6J A;  1NTG A;  3OPO A;  4OL7 A;  1NMF A;  2OWO A;  4YCV A;  2F0F A;  1QJO A;  5IT9 c;  4UP7 A;  3FRP B;  2YU9 B;  3PF4 A;  1FR3 A;  4LW1 A;  1PH6 A;  1E2Z A;  3MVV A;  4ZKB B;  3CCV A;  4RFB A;  4CJ2 C;  2KCN A;  5EKL A;  1WTP A;  1K8A C;  1QB5 D;  1AE3 A;  4K0K L;  1DYQ A;  2X6L A;  1M90 C;  3KF6 B;  4OEL B;  1BXT A;  2O4X A;  4IPG A;  2QF7 A;  2L1B A;  5JJZ A;  2WB1 E;  3CQZ H;  3SHL A;  1EY5 A;  4BA1 I;  5AJ3 Q;  4JI6 L;  2B2U A;  1XTC D;  2Q2I A;  1STG A;  5ELN A;  1R9T H;  3HOZ G;  4YCU A;  2JA8 B;  1Q3L A;  3NTK A;  4CJ0 B;  1KDC A;  4JC0 A;  4OWW B;  1I4X A;  3F2C A;  3Q22 A;  1LTB D;  4K8I A;  3HOW G;  2NTS A;  3TRE A;  5F2D A;  1HZC A;  1FNV A;  1EEI D;  1VQA A;  1G8Z D;  2QEX A;  1X3P A;  4M8A A;  2XNA C;  1KRS A;  5EKK A;  3T4A C;  3CCL A;  4POF A;  1XPR A;  2BH2 A;  1D2B A;  4JYA L;  1JJG A;  5AJ3 L;  4I7Z C;  3BYY B;  3D6W A;  4A3G B;  2B29 A;  4OX9 L;  4DAV A;  2CFM A;  2F0V A;  1NSN S;  1YVC A;  5IGB A;  2K14 A;  3PO2 G;  2YU9 H;  3CCJ A;  3FP9 A;  4A93 G;  5HGT A;  2K6A A;  1KIX A;  4X65 Q;  2O2L D;  1MJE A;  4CDD C;  4X64 Q;  1GUW A;  2QIL A;  3CME A;  1LAB A;  4H7B A;  4J8Q A;  4DK6 C;  4LFB Q;  5IE8 A;  4KLK A;  2SOB A;  4ULL A;  2VUM H;  2FHT A;  4X3K A;  1SFO B;  4ID6 A;  5FJ8 H;  1AP0 A;  3GV3 A;  2AQ1 B;  3BU2 A;  4P73 A;  2K7V A;  5E4X A;  3I56 A;  2CQA A;  1PFN A;  1A2T A;  4LJZ C;  4RA8 A;  4KI0 A;  4GKK L;  2OT2 A;  4XTC S;  1SJH D;  2JA8 H;  2K32 A;  4HJ5 A;  4BY7 H;  3SE0 A;  3HOZ B;  3C46 A;  2I5M X;  3OMC A;  4HJ7 A;  2NVQ B;  4NDX A;  2DJG C;  2NB0 A;  4A3M G;  3M3Y B;  2OF1 A;  3CAM A;  2IL8 A;  1AH9 A;  1EY6 A;  2N49 A;  2PZW A;  3D4W A;  1FJG Q;  1F9S A;  1HZA A;  2FMC A;  2L5T A;  3HOW B;  4JV5 L;  3Q8D A;  4RAU C;  2PCF B;  2R7Z G;  2XRS D;  2DUD A;  2VS1 A;  2JK8 A;  1CFM A;  4XDX A;  4JI4 Q;  4BXX H;  2FXQ A;  3RLN A;  3E5S A;  2C35 B;  3HOY G;  1J8I A;  1B44 D;  3H09 A;  4A3G H;  2KCT A;  1YEZ A;  4GLV B;  1VQ7 A;  1VMP A;  1YNJ C;  2FIN B;  2B8F A;  1CKO A;  3KUP A;  3V96 A;  2Q2U A;  4JI3 Q;  2KED A;  2VZA A;  4L5Q A;  3PO2 B;  2EYF A;  3V05 A;  3K0X A;  4A93 B;  4EQN A;  5CGK A;  3R2I A;  4DR2 Q;  2PI2 A;  1Z7T A;  4LUO A;  2E5L L;  1KNA A;  1EWI A;  1K83 B;  4YCW A;  2UUC Q;  1SFO H;  5IYC H;  1CK1 A;  1D7Q A;  1JB7 A;  4ZLT F;  4JI4 L;  4GKJ Q;  4NXN Q;  4IZ8 A;  3SXH A;  1PZK D;  1D5Z C;  1FL0 A;  1L1O C;  1SYG A;  5ELB A;  2Y0S G;  2Q8R E;  2BOS A;  5C3X A;  1KL9 A;  4DR6 Q;  1GHK A;  4KJO A;  5D3D A;  4R1J A;  4IJH A;  3J80 i;  2NVQ H;  3STB D;  4FO2 A;  2HQL A;  4JI3 L;  4LUZ A;  1A3T A;  2EJG C;  2I46 A;  2PMZ B;  4LK1 C;  3M3Y H;  4X6A H;  2F0N A;  2FJ2 A;  4A3L H;  5J1Z A;  4A3M B;  4IN3 A;  3ERS X;  1ZYR D;  2NZ1 D;  4HAE A;  1Y1V B;  1V1O A;  4NMZ A;  3NK9 A;  1VQM A;  2R7Z B;  5L37 A;  4FXD A;  2O5J C;  2NWG A;  4A3E G;  3HOY B;  2Z0S A;  4N8F A;  2WFW A;  4AQY L;  4RGT A;  4GKJ L;  1SNQ A;  3HOX G;  2GN5 A;  1B1Z A;  3K5N A;  3S14 H;  2ALY B;  5NUC A;  1LTR D;  1LTG D;  3A7A B;  4K14 A;  1Y14 B;  1A3U A;  1RJT A;  3CF5 A;  4Y7N B;  1OXU A;  1GM5 A;  4UAI A;  2CHB D;  1CKN B;  1VQ6 A;  3QWN A;  2IHF A;  3K58 A;  4YY3 L;  2JN4 A;  1I6V C;  4KV6 A;  2UUA L;  5JJK A;  4DUZ L;  1K83 H;  1CHQ D;  2UUB L;  2G9D A;  5A35 A;  4JI8 L;  4G7O C;  3A7L A;  5G3L D;  1C48 A;  5LMN Q;  2F0D A;  5ELD A;  4DXF A;  4C3J B;  4DV3 Q;  4O2D A;  3R93 A;  5CYU A;  2E2J B;  5JJL A;  2F0K A;  3QOJ A;  2ATW A;  4DV7 Q;  2Z6K A;  3HP3 A;  1JJC B;  3I70 A;  1JOR A;  5FOB B;  2Y0S B;  4A3J G;  4KY6 A;  3G4S A;  1AEX A;  4X66 Q;  4C3I G;  1I3Q H;  2PW5 A;  1KLG D;  1ZKO A;  1CHP D;  1DJR D;  5COR A;  4HN7 A;  3CC4 A;  1TS5 A;  3UDF A;  4C2M H;  2M2L A;  3NTH A;  1L2F A;  4WRD A;  3G6J B;  4IPD A;  4PZ6 A;  1Y1V H;  5E4W C;  3GTM H;  5FO8 B;  5IWA L;  1QE6 A;  5EKI A;  2BCO A;  3L3O C;  3ULL A;  4LUV A;  5GAG C;  2F0P A;  4APV A;  5DEH A;  3I90 A;  1U4R A;  3GV6 A;  2VW9 A;  4DV3 L;  1AFP A;  4A3E B;  3R8B A;  1VQJ A;  4DV7 L;  1WOC A;  3HOX B;  2KUM A;  3F8T A;  1WTR A;  1O78 A;  1BCP B;  1DXM A;  1GKH A;  4Z9C B;  1WYD A;  4Y7N H;  5KND A;  4X66 L;  2OTJ A;  3DEO A;  4GN3 B;  2Z1C A;  1IHZ A;  2MPM A;  2J7Z A;  3TP5 A;  4J15 A;  4A3K B;  1BUV T;  4KHV A;  4ME3 A;  1NJI C;  2XRQ D;  1DCZ A;  4C3J H;  1QIL A;  2F3I A;  3S9W A;  3VA7 A;  1GUS A;  2E2J H;  4GNX C;  1SJE D;  4KHZ A;  4P75 A;  4BY1 G;  2F0L A;  3ER0 A;  4IJL A;  2D5D A;  4LF6 Q;  1TWA B;  2WAQ G;  3IFT A;  3BDC A;  1HZB A;  3PF5 A;  4R4T A;  1WI5 A;  1RL2 A;  3P20 A;  1X6O A;  5JPM C;  1VQH A;  4A3J B;  3OTO L;  1QVG A;  2NUC A;  3OSO A;  4CHT B;  4IUU A;  3LNN A;  3E6Z X;  3Q6S A;  4C3I B;  2EYL A;  4C3H H;  2K1B A;  5DM6 3;  2B2T A;  5IP7 H;  2K33 A;  1O80 A;  3MEF A;  3LX0 A;  3PQI A;  3S2D H;  2CWP A;  5CV5 A;  1X54 A;  4X3U A;  5CV7 A;  2EJM A;  2WIN B;  1Y8N B;  1OXS C;  4JI5 L;  2GVA A;  3SK4 A;  3ONA B;  1ZEQ X;  3O13 A;  2MP1 A;  4LF6 L;  4BBS G;  1PXU A;  3TSS A;  1MSH A;  2L55 A;  1PMR A;  5KYL A;  1I4G A;  3BZD B;  3E9H A;  4C56 C;  2C5C A;  3SDZ A;  5K36 H;  3V2T A;  1Q86 C;  3VR6 A;  4XQJ A;  1SNC A;  4AYB E;  1O7Z A;  2Z6B A;  3J7Y W;  3CP0 A;  2OCE A;  1HA6 A;  4A3K H;  5C0X H;  1H95 A;  2ZTE A;  3ULJ A;  5BN3 A;  1VQN A;  1EY8 A;  5JVH 3;  1Q81 C;  2HHH Q;  3T1Y Q;  3U58 A;  1PV4 A;  2L15 A;  4Q0F A;  3NSW A;  2D0P A;  2RDG A;  2B8G A;  1EQV A;  1X65 A;  4BY1 B;  2IT1 A;  4L5T A;  2RKS A;  4KTA A;  3OHX C;  1U4P A;  4IQZ A;  5ELF A;  2EYO A;  1VF5 C;  1M4V A;  3HKZ G;  4DV4 Q;  3QR8 A;  5COY A;  2CCZ A;  3G71 A;  3H91 A;  1VQ4 A;  3U50 C;  4TKO B;  1X32 A;  2EPB A;  1A15 A;  1KHI A;  4DUY Q;  1QVF A;  2JSO A;  2NVY B;  2F03 A;  3L0O A;  1HNX Q;  5J39 A;  3J81 L;  3S16 B;  1VQ8 A;  3JC6 6;  3N52 A;  4LFC Q;  2HHH L;  3Q23 A;  3BYT B;  2HDM A;  3T1Y L;  3J80 c;  4LWC A;  5E1F A;  4HSV A;  1LTT D;  4CDC C;  4CKC A;  1F2Y A;  2E2H B;  2F0Q A;  3TDQ A;  5I2X A;  4BBS B;  5IGF A;  2JEA I;  2PQA A;  2XWB B;  5CV8 A;  4HJ8 A;  3HZX A;  1HR0 Q;  3PUY A;  2CKZ B;  2N55 A;  5LL6 X;  3G6E A;  2NVT B;  1GD7 A;  1Z47 A;  4LF8 Q;  1G91 A;  4DUY L;  1TWH H;  3C2P A;  1VS0 A;  4JI2 Q;  3KJP A;  3PO3 G;  4DR5 L;  3I4M B;  2A74 C;  3FMC A;  4DR1 L;  1E24 A;  2ZT9 C;  1D8L A;  5CV4 A;  1SEB D;  4LFC L;  2E76 C;  1Z6H A;  3L9A X;  4JPB W;  4ALP A;  2MNA A;  3GTQ B;  3HOV G;  5BN4 A;  3UE1 A;  1YI2 A;  3GTG B;  1EZ8 A;  1DOM A;  5FLX c;  4R4O A;  3NQT A;  3HKZ B;  5JEA H;  5FO7 B;  3SK5 A;  1YIJ A;  1BNZ A;  2NVY H;  3E0E A;  2JA6 G;  4G4K A;  3VYT A;  2IPK D;  1AW7 A;  5EGT A;  4EVO A;  1XPO A;  2HCC A;  3I8Z A;  4JI2 L;  2WB1 G;  1PH7 A;  2B3G A;  4HMI A;  4KD4 A;  1I4H A;  3F2U A;  1QVC A;  5FLM G;  3MTS A;  1WTX A;  5FK9 C;  2V4D A;  1SDF A;  2VB3 X;  1ASZ A;  3IKJ A;  3CCR A;  2A6E C;  4QIW E;  2DN8 A;  3VYS A;  1SNP A;  2JA9 A;  3TP7 A;  4BBR B;  1H9R A;  4RWS C;  2NVT H;  1LO5 D;  3CCE A;  3WDN A;  3EBE A;  3MC0 B;  3DUZ A;  2VY3 A;  5BN5 A;  3AQQ A;  3OOC A;  4DAY B;  3I4M H;  1RF2 D;  5I4D A;  5IYB G;  5C3E G;  4QF4 A;  3PO3 B;  4RCO A;  3KF8 B;  1B9N A;  5JAV A;  5EPL A;  4DV6 L;  1EOT A;  4B3M L;  3GTQ H;  3J80 E;  4R4C A;  3GTG H;  1J6Q A;  2SEB D;  4K5V A;  4IO9 A;  4GNX A;  3HOV B;  3CPW A;  3MHB A;  1K0S A;  1IKM A;  5LMU L;  4K5W A;  1I50 B;  1TXY A;  3H0G G;  1E1T A;  2NTT A;  1JE4 A;  3MXP A;  1ICF B;  3EJI A;  4XQQ A;  1NUC A;  1PRT B;  1GUO A;  1HTP A;  4A3F B;  1L1O B;  3IRB A;  3I91 A;  3SVM A;  4K2L A;  1GUG A;  3BZC A;  3CD6 A;  3KBG A;  1U5K A;  2TMP A;  3IAY A;  1Q8I A;  3KDF A;  1S5B D;  1ROD A;  1N33 L;  1TWG B;  4A3B H;  4BBR H;  5FLX E;  3M85 A;  1C8C A;  4KK7 A;  2IWH A;  1CM9 A;  3HG9 A;  4JI0 L;  1XJV A;  1E2W A;  1VQ9 A;  2NN6 H;  1D6E C;  2R93 G;  3LWU A;  2F0H A;  4GOP A;  2YYZ A;  4X62 L;  1WD0 A;  4XT3 B;  1H9J A;  2CH4 A;  1PRT F;  5GAD C;  2XGT A;  5C3E B;  3GTJ H;  2VB2 X;  1U4M A;  3UE0 A;  2UXD L;  3MAQ A;  3M4Q A;  5C0X I;  1STB A;  5I6W A;  3S1M H;  1WD1 A;  1KAB A;  3CCS A;  3M4O H;  3JAM E;  2SDF A;  2F0I A;  4CKB A;  5TSS A;  4DAP A;  5J22 A;  3K5L A;  3GDE A;  2JA5 G;  2R6G A;  3FEW X;  4ODG A;  2GA4 B;  2AWO A;  2Z6K C;  3H0G B;  2AKW B;  3D4R A;  2B2Y A;  4YWK A;  4JYA Q;  3S1N H;  4A3F H;  2IY5 B;  5CR3 A;  1EIF A;  2LSS A;  1CZW A;  4KN7 C;  3FHW A;  5KYI A;  4OX9 Q;  2F4I A;  3C1E A;  3MWY W;  1JIC A;  4P2C B;  3K57 A;  4QMG A;  1E1O A;  3D3R A;  5A2Q E;  2E75 C;  3S15 B;  2IX3 A;  4L63 B;  1QCB D;  1TWG H;  2N3S A;  4UDU C;  3OWE B;  3B6Y A;  3DWQ A;  3K5O A;  1CT1 D;  1GOZ A;  1ENC A;  5EQ0 A;  3GTK B;  4A3C H;  1TR5 A;  2L11 A;  1SBB B;  5M5X B;  3FKI B;  3K0Y A;  4IFD J;  2HCI A;  4BS9 A;  1JWS D;  2R93 B;  2G5D A;  3AFQ A;  4CDE C;  1AE2 A;  1AN8 A;  3RUZ A;  1S72 A;  1WTO A;  1SE2 A;  1SMX A;  4GKK Q;  4LF9 Q;  3M7G A;  3D8G A;  1GO3 E;  4FXG C;  3SK8 A;  2LMC B;  2HUG A;  4WJ3 M;  3BDO A;  1EQT A;  1NCV A;  2VL6 A;  2A6H D;  2KEN A;  5K5P A;  4AIM A;  3TS0 A;  1O7I A;  4XXE A;  2AQ2 B;  2AQ3 B;  1TWC B;  4JV5 Q;  3RR5 A;  4PMW A;  3UDI A;  3PUZ A;  1QOH A;  2E8G A;  2JA5 B;  3AMU A;  1S40 A;  1LTS D;  2K05 A;  1O7L A;  1VQO A;  5E7N A;  5DAU A;  3DXJ C;  4JCV E;  3SK6 A;  3AFP A;  2K5H A;  1UEB A;  3PV0 A;  1OXT A;  1T9H A;  3DMU A;  1TT2 A;  4UHV A;  1Q82 C;  4LF9 L;  2F0T A;  2RDH A;  2P5Z X;  4X3T A;  4OON A;  1HHV A;  4ABN A;  2B2T C;  3TZU A;  1EUJ A;  1NMG A;  5H1S E;  1P16 A;  4OO1 H;  3DWA A;  2F1M A;  1EIH A;  3P75 A;  4N8X 1;  4CKE A;  2E5L Q;  2PPB C;  5ELC A;  5M5X H;  2H1E A;  4XQN A;  5IGD A;  1IYV A;  3FKI H;  2EY1 A;  4HMJ A;  4K6L A;  3U4Z A;  3NBH A;  3T1H Q;  5M3F G;  2J0T D;  2FMM A;  2IX0 A;  2K04 A;  4NXM L;  1ASY A;  3STB C;  2OQ0 A;  1EFI D;  4A3D H;  1XNR Q;  3AYH B;  5IP9 G;  3NEN A;  3T51 B;  1EY0 A;  2BE5 D;  1G29 1;  3UDX A;  1TWF B;  4DAM A;  1MI2 A;  1ZYR C;  4ZK9 B;  3L2P A;  5IGE A;  1PFM A;  5I9P A;  5M5Y B;  1N32 L;  1N34 L;  1LTL A;  2A19 A;  2RDF A;  1JOO A;  2I07 B;  1SYE A;  3URY A;  4ZUI A;  1M8A A;  3T56 B;  2IHE A;  1QZG A;  4IFD G;  1J5E L;  4LF5 Q;  3I72 A;  2EOT A;  3DM3 A;  3T1H L;  1VQB A;  4AQY Q;  2K28 A;  1UWV A;  4B9X A;  2F4V Q;  5C4Z A;  3IFD A;  5GQO A;  4DN4 M;  1UAP A;  4L8J A;  2F0M A;  1FGU A;  1R4P B;  1PA6 A;  1XNR L;  3D31 A;  1S4Z A;  3HOZ H;  5ELE A;  1PHJ A;  1O7Y A;  2D62 A;  1EY4 A;  1YHB A;  2A1A A;  4K6D A;  4YY3 Q;  1JWM D;  1Q7Y C;  2UUA Q;  4DUZ Q;  1HJP A;  2UUB Q;  2BA1 A;  4JI8 Q;  3HOW H;  3GTO B;  3S24 A;  4MTK A;  4A3D G;  1XX8 A;  1C0A A;  5I2Y A;  4R9W A;  1CQV A;  2D2C C;  4HIM A;  1LT6 D;  4P74 A;  3CU7 A;  5IT9 L;  1VMC A;  3GO5 A;  4J1M A;  1VQG A;  3ICE A;  4QL5 A;  2ZXR A;  4LF5 L;  4C1N I;  3WWV A;  1PYW D;  2F4V L;  1TVX A;  5CV9 A;  5IYD G;  4NB3 A;  1TKW B;  2NN6 I;  5GAH C;  2AUK A;  3R2T A;  4R4I A;  4F88 A;  4WFN 3;  3U4V A;  1F77 A;  5C44 G;  3PO2 H;  4JOI C;  1VQP A;  1E0B A;  2YV5 A;  2OTL A;  4F87 A;  4A93 H;  1G51 A;  1G6Z A;  1K0R A;  2CH4 W;  4ZCK A;  2RSO A;  1A63 A;  2KA7 A;  4RH6 A;  4AYB G;  4KKS A;  5HGQ A;  5IWA Q;  1BQQ T;  5I9O A;  1D5X C;  1EEF D;  1JE5 A;  2K01 A;  3ZYY X;  2MQH A;  1RTN A;  3S2H B;  2QGQ A;  4H02 A;  1HTL D;  1K8G A;  4KN4 C;  1PRT D;  3K7A B;  2ZJQ A;  1KNE A;  3NQI A;  1EYC A;  1IW7 D;  4FP5 D;  4A3I G;  4LMQ D;  1SR3 A;  4A4I A;  1Q90 A;  1RD9 D;  3PIO 3;  1OXV A;  2N88 A;  4XIG S;  1BVS A;  2ASB A;  3TZD A;  5C5L A;  3OIQ A;  1GVP A;  2HQE A;  3KBX A;  3D0F A;  2KJX A;  2JYO A;  3W1G A;  1B3A A;  3PGZ A;  1L0W A;  3SGI A;  3JAM i;  4A3M H;  3GTO H;  1PVO A;  1E3P A;  3C3L A;  1OTC A;  1S5D D;  3BDL A;  5DLQ E;  3TP8 A;  5M9O A;  1ESF A;  1Y8O B;  5KGU A;  3U9O A;  5IGG A;  2F0O A;  3VYR A;  5M3M G;  2R7Z H;  2UXB Q;  3A5U A;  4JBM A;  1X56 A;  4A3D B;  3KOJ A;  1I5F A;  2XN9 C;  3HOY H;  4JBK A;  4OHJ A;  1A6X A;  2EYP A;  1Y69 U;  1JCK B;  4OWX B;  1T5E A;  3VA5 A;  3OTO Q;  4PG3 A;  2K4K A;  1PH4 A;  3J7A 5;  2B2V A;  2EY6 A;  1XMQ L;  2KQ3 A;  3D6C A;  2Q8T A;  1BBX C;  1II3 A;  4FF1 A;  1SYD A;  1I6H B;  2RCF A;  5C44 B;  2OXP A;  1B53 A;  3QO2 A;  4XYQ A;  1EL0 A;  2B2W C;  4TSS A;  1D1I A;  3I3C A;  4AYB B;  4DU9 A;  3GP7 A;  4CBV A;  1VQI A;  4DNR B;  1AZP A;  4MNO A;  4XYO A;  5LHY 1;  4G7Z C;  3HOU G;  2UXB L;  1JOK A;  2F0E A;  4JI5 Q;  4HIK A;  3S2H H;  1KAA A;  1STY A;  3OW2 A;  4V19 0;  2QDL A;  2WV6 D;  1L0X B;  3K7A H;  1SAP A;  1QZH A;  3NHH A;  4P71 A;  3W3A A;  1W2B A;  1Q1B A;  3S1Q B;  1BCP F;  2F0S A;  5I6Y A;  1P8L A;  2B63 G;  4A3I B;  1H9S A;  1PH9 A;  3I4N G;  3MXU A;  2I5H A;  1VF7 A;  1X3F A;  4ME5 A;  1WCM G;  2Y0S E;  4ILW A;  3LGJ A;  4Q5V A;  4JI7 L;  1ET6 A;  3K59 A;  2EIF A;  1Y1W G;  1A8V A;  3PIP 3;  5M3M B;  1TS2 A;  1LM0 A;  1LYL A;  5D65 A;  1EQR A;  1WJJ A;  4OO1 I;  2KHI A;  4A3E H;  3FDT A;  2ICI A;  2F0J A;  1N36 L;  1X3G A;  4H13 C;  2SNS A;  5KIX A;  3HOX H;  2BA0 A;  3CRL C;  4RKL A;  4DV0 L;  3A56 A;  1XNQ Q;  5IIF A;  2X6G A;  4GOP C;  2A68 D;  1V1P A;  1J9O A;  5DNF A;  1EY9 A;  1VCI A;  4OGQ C;  4RKB A;  2EYM A;  3K81 C;  2ZM6 Q;  1PTO B;  1K3R A;  2Z4H A;  4HID A;  3H3V H;  1Q46 A;  4LAA A;  1QNK A;  4BWG B;  4QJF A;  3E3X A;  1SLJ A;  3A74 A;  3J81 j;  4XT1 B;  3HOU B;  4PV1 C;  5T1I A;  1NR2 A;  3OW7 A;  4UY8 C;  1TWA H;  2QDB A;  4B3T L;  5AFW A;  2AHO B;  4KJN A;  2WAQ B;  3CPF A;  3MFG A;  1TQO A;  4IUN A;  3X3M A;  2FFK B;  1S5C D;  1ML0 D;  4A3J H;  1NBW A;  3MXG A;  3HGB A;  3CHB D;  2XTI A;  2ENB A;  3CC2 A;  2B63 B;  4C3I H;  1XNQ L;  1HXY D;  1YJN A;  1EU3 A;  2B2Y C;  1BBW A;  4H0L C;  3PSI A;  2A69 D;  1QUQ A;  2JA7 G;  3UI2 A;  1SN8 A;  3ITP A;  3I4N B;  1HUN A;  4TVA B;  3SEB A;  4DR5 Q;  5CC4 A;  4DR1 Q;  4HED A;  1MHW C;  2F0G A;  2ZM6 L;  2XWJ B;  1WTH A;  3RZO B;  2LS0 1;  1PH2 A;  2TSS A;  4EQP A;  3TME A;  1HA5 A;  2EZV A;  2F0U A;  3S1R B;  1ENA A;  3EFX D;  3NE5 B;  2Z4I A;  1X55 A;  4YHH L;  4KD3 A;  3EA6 A;  1VQC A;  1G2S A;  4RCN A;  2LXK A;  1V9P A;  2LFN A;  3DHQ A;  4DA2 A;  2VQE L;  1LT4 D;  1JOQ A;  1ONL A;  1STN A;  4B08 A;  4DR7 Q;  4GLX A;  3NEM A;  1PTO H;  4JOI A;  4PMB A;  4FF3 A;  1MJC A;  2V1C C;  3HEJ A;  5EPK A;  1I4Q A;  2ID0 A;  1U9R A;  5FO9 B;  2K5V A;  2RVL A;  2ZTD A;  3F1Z A;  1ZXT A;  5HY6 A;  3RLO A;  4BY1 H;  4IAL A;  1X3E A;  4WOR A;  3FVQ A;  2F3V A;  1SYB A;  1KTK A;  1RIP A;  2HIV A;  4UP8 A;  5D3I B;  3PCO B;  1LLR D;  2QW7 A;  4EX5 A;  4FVM A;  3PIO A;  1EWH A;  1UE5 A;  2F0W A;  5C4X G;  1JR0 D;  3NPP A;  3A54 A;  2R92 G;  2C9O A;  4NPS A;  4UPA A;  4MN3 A;  1WTQ A;  1HNW L;  1NR4 A;  1VQ5 A;  3S16 H;  4DR7 L;  3DWP A;  3KF6 A;  4GZY C;  1EU4 A;  2E2I B;  4DV1 L;  1LTA D;  1RCV D;  4DV6 Q;  3I7F A;  4B3M Q;  4B3R L;  2KBN A;  1G2T A;  4S3S A;  2DNE A;  4PZ7 A;  1IBL Q;  3S1R H;  5C3W A;  4L5R C;  2E2H H;  2HD3 A;  2PQE A;  1EWC A;  2CW0 D;  2JJQ A;  4BBS H;  3JAM c;  2JP1 A;  5DM7 3;  5LMU Q;  1SYC A;  1NE3 A;  2MUY A;  4QUC A;  4QCL A;  2KOL A;  4O42 A;  1KLU D;  3BZK A;  3HRZ C;  1GJX A;  2A73 B;  2EXZ A;  3NWT A;  1OO9 B;  4FXK C;  1YHA A;  4PMC A;  3D4D A;  2B2W A;  4IUR A;  5KNC A;  4KHP L;  1IBL L;  1N33 Q;  1KAW A;  2RF4 A;  3A0J A;  2KCM A;  1WVL A;  3A8I E;  3TBI B;  2WKD A;  1K8M A;  4JI0 Q;  2RHQ B;  3TP6 A;  4LFA Q;  1Q8K A;  1C4Q A;  3GTL B;  3GTP B;  2PNH A;  4CGY B;  4X62 Q;  1I94 Q;  1YJ9 A;  2JA6 B;  2MGS A;  3PIP A;  3VR5 A;  1WTV A;  1E7Z A;  4MIU A;  1Q12 A;  4JBJ A;  3CCQ A;  2SNM A;  1QNU A;  2WB1 B;  2UXD Q;  1UNS A;  1C7Y A;  4POG A;  4DV5 L;  1QUQ B;  3NP8 A;  2KHS A;  1JWU D;  2NVX B;  2YTV A;  2VUM G;  1SXT A;  1KRT A;  1IL8 A;  1MIU A;  2JEB I;  4R8N A;  5FJ8 G;  1RHP A;  4ZUJ A;  1GHJ A;  3VR2 A;  3J7A F;  5CBA E;  4QQB X;  4GN4 B;  1E2V A;  1SND A;  1BCP D;  3CQZ B;  5EBC A;  1SMY D;  5D14 A;  3OIP A;  3A55 A;  4LFA L;  4KKU A;  3A8J E;  3C1F A;  2JA8 G;  2J4X A;  1SNM A;  4UP9 A;  2KEE A;  4BY7 G;  3VYU A;  4B9W A;  1R9T B;  1I94 L;  3PO3 H;  2PQA B;  3KFU A;  1TS4 A;  1D1K A;  1EYD A;  4RGM A;  3J81 i;  1CA5 A;  1C9O A;  3NUC A;  1SSO A;  2F3W A;  3T16 A;  1F9Q A;  1L0Y B;  3TS2 A;  1VQK A;  2WKC A;  3HOV H;  1K9M C;  4IOC A;  2R7F A;  2A8V A;  2WII B;  3H3V I;  1EQQ A;  4FF2 A;  3KLS A;  3KYH C;  1KC8 C;  4BXX G;  2RSN A;  1SE4 A;  2EY5 A;  4OWT B;  1I50 H;  2RA4 A;  3GTL H;  3IL8 A;  4A3G G;  2L12 A;  3J80 L;  2JA6 H;  1TII D;  3R3O A;  5JPN C;  1DZ1 A;  1IKL A;  1YZ6 A;  4JI1 Q;  2A6H C;  1YNX A;  4QGU A;  3H15 A;  2X69 A;  3CCU A;  4RMF A;  3SR1 A;  1HUM A;  1SRU A;  2L4N A;  4PNY A;  1E22 A;  5FLM H;  4O0A A;  1Z9F A;  2AWN A;  2EVB A;  3HS0 C;  2NVX H;  3PUW A;  2EDG A;  5IYC G;  4B3S Q;  4OXP A;  3S17 B;  2VUM B;  1NNX A;  4N9T A;  1STH A;  3T53 B;  1ILQ A;  2VQF Q;  4A75 A;  2CVR A;  1YNN D;  4DF7 A;  1SE8 A;  4DK0 A;  3AEV A;  4IUP A;  4R4Q A;  4FF4 A;  3KJO A;  4BY7 B;  4QUF A;  5C3E H;  5IYB H;  1RKN A;  1UEA B;  1PTO D;  2B2V C;  2BDO A;  4JI1 L;  5FLX L;  3GD7 A;  3HFZ B;  1ILP A;  1A0I A;  3ERO A;  2EQS A;  4A3L G;  4K8J A;  2E74 C;  1AZQ A;  5CV6 A;  1U4L A;  2PNR C;  3EIV A;  3MEH A;  3UDG A;  2NZH A;  4PZ8 A;  3CC7 A;  4B3S L;  2VXW A;  3LWE A;  1EIY B;  1CKN A;  5CMD A;  3I2Z A;  3H0G H;  2BE5 C;  4I7A A;  4NXM Q;  2VQF L;  4GNX B;  4E6I A;  3TN2 A;  1YJW A;  3JAM L;  1B4O A;  3K7U C;  3RN5 A;  2K52 A;  1JJ2 A;  1N9W A;  4L5S A;  2DNC A;  2Q2H A;  5C4J B;  1GXD C;  2MJ8 A;  2XSC A;  1IXR A;  4CDF C;  3S15 H;  1D5M C;  3PUV A;  4ZYS A;  1LT5 D;  4FNF A;  3S17 H;  1UE7 A;  3QOL A;  4DGZ A;  5M5W B;  4DXG A;  1PFS A;  1N32 Q;  4V0B A;  1N34 Q;  3GTK H;  5E3F A;  1YBY A;  3EN2 A;  2K5W A;  4LF4 Q;  3T13 A;  1PYS B;  5A2Q L;  1J5E Q;  2R93 H;  2D0O A;  4F7X A;  3KDF B;  1FGB D;  2PO4 A;  1SNO A;  5IT9 E;  2KEC A;  1M1K C;  2ZJP A;  1UE6 A;  5C0X J;  5C5M A;  4X65 L;  4GOP B;  3W2D A;  4X64 L;  1Y1V G;  4LFB L;  2ZXP A;  3VDY A;  5JOB A;  1EIG A;  1TWC H;  4Y52 H;  1CQF A;  2HT1 A;  4C1N K;  3N6R A;  4WJW A;  2QA4 A;  2JA5 H;  4RG1 A;  1UUP A;  3BVM A;  4LF4 L;  1EYA A;  2JQO A;  2M9V A;  1PZJ D;  4WJ4 A;  3K6O A;  4PQX A;  2L9H A;  3S14 B;  1KD1 C;  4LF7 Q;  1CI3 M;  3L7Z C;  3TEH B;  2OQK A;  5C4J H;  3G48 A;  4R8I A;  2KVM A;  4KKT A;  3H94 A;  4EQO A;  4DNI A;  3KK7 A;  5M5W H;  1FJG L;  2EYH A;  4C3J G;  5LL6 S;  1TS3 A;  3BS1 A;  4G7H C;  4JVZ A;  2ZJR A;  3AB9 A;  1PRT C;  1F2M A;  2NZO A;  1IW7 C;  3I73 A;  5M3F B;  3Q0A A;  1ET9 A;  1HCZ A;  1TY2 A;  1U0L A;  2ES2 A;  2VNU D;  4LF7 L;  1F2L A;  4C3H G;  1I3Q B;  1X3Q A;  2RHS B;  1B3Q A;  2BH8 A;  2M00 A;  4U68 A;  1QG7 A;  1TWF H;  1YNJ D;  5IP7 G;  5LMN W;  4OIJ A;  3PMF A;  4C2M B;  1B9M A;  1VDZ A;  1K28 A;  4DR2 L;  1QWY A;  2UUC L;  1BF4 A;  3GTM B;  1ENF A;  5M5Y H;  1PH3 A;  2I0Q A;  1VQF A;  2HDL A;  5ELO A;  2XVS A;  1VQL A;  4JK1 C;  3TRZ A;  3J81 c;  2DY7 A;  4NXN L;  1CA6 A;  1XYI A;  3OWF A;  2EE1 A;  1PH5 A;  4DR6 L;  2LXJ A;  1MD2 D;  2DJF C;  5JEA J;  1FVI A;  2ZTC A;  5K36 G;  4RGN A;  1HQM C;  4K2K A;  1XMQ Q;  1XTD A;  3A8K E;  2A5H A;  1K8O A;  4A3K G;  5C0X G;  4A76 A;  4EQ5 A;  1V1Q A;  2IX1 A;  2K75 A;  4HJ9 A;  1G6P A;  2CQO A;  1EZ6 A;  2EY2 A;  1B8A A;  3E0J A;  2EJF C;  1I4P A;  5EBD A;  4JG2 A;  4DR3 Q;  1CZG A;  5M3F H;  4DPG A;  2PMZ E;  3DM1 A;  4TRD A;  3W1B A;  3F2D A;  4HCS A;  3RZD B;  1BBU A;  3QIA A;  1XMO Q;  1F2Z A;  3WOF A;  3MXN A;  3BJU A;  1EOV A;  5IP9 H;  1IYJ B;  1W6K A;  2AUJ D;  4C3H B;  2IJ0 A;  1N8R C;  3NBH B;  2EYJ A;  3RN2 A;  5JVG 3;  2R3Z A;  1FNU A;  3S2D B;  4HR7 B;  1DGS A;  4GS3 A;  5LMN L;  1FYC A;  4IUV A;  5IGC A;  4JI7 Q;  5J3B A;  4IUQ A;  1LUZ A;  4JW0 A;  1H9M A;  1XXG A;  1IZ6 A;  2PYK A;  3PUX A;  4HCE A;  4DR3 L;  1UE1 A;  1YIT A;  4IPC A;  3H6M A;  4IFD H;  4KMU C;  1N36 Q;  2A68 C;  1V8Q A;  5HUR A;  3NBI A;  1MSG A;  3A5Z B;  1XMO L;  4DV0 Q;  2GVB A;  1KDA A;  4HJA A;  1ICW A;  1H9K A;  1EYG A;  1DM0 B;  2ZXO A;  1GUN A;  2UU9 Q;  1BDO A;  4IOA A;  4TQU S;  2PW7 A;  4CJ1 B;  2K5D A;  1CSQ A;  3MZ5 A;  1STA A;  2G9H D;  2H4O A;  5C6A A;  1JMC A;  3J81 E; 
#chains in the Genus database with same CATH homology
 1KL9 A;  4DR6 Q;  2KBN A;  4B3R L;  3RZD H;  1IBL Q;  4PZ7 A;  4B3T Q;  4R1J A;  4IJH A;  2KHJ A;  1E1O A;  3S1R H;  4L5R C;  2DGY A;  2E2H H;  2UXC Q;  3J80 i;  2NVQ H;  2K50 A;  5JEA G;  3STB D;  5JJI A;  2HQL A;  2JJQ A;  4LUZ A;  4JI3 L;  1TWG H;  2N3S A;  4BBS H;  3JAM c;  5IYD H;  3B6Y A;  3M3Y H;  5LMU Q;  1BKB A;  4X6A H;  1NE3 A;  4A3L H;  4A3C H;  1I6H H;  3ERS X;  5C44 H;  4IFD J;  1VQM A;  2UU9 L;  3M9B A;  3BZK A;  4AH6 A;  3AFQ A;  4A3E G;  1AE2 A;  1S72 A;  2Z0S A;  4GKK Q;  1SMX A;  2WFW A;  4LF9 Q;  4AQY L;  4GKJ L;  1YHA A;  4B3M Q;  3CXC A;  3HOX G;  1GO3 E;  1KQS A;  2GN5 A;  3S14 H;  1HNZ Q;  2ALY B;  5GAE C;  4WJ3 M;  4P72 A;  4KHP L;  1Y14 B;  1IBL L;  2VL6 A;  4YHH Q;  3CF5 A;  1N33 Q;  2KEN A;  1KAW A;  4AIM A;  1OXU A;  1GM5 A;  2UXC L;  3TS0 A;  1O7I A;  2RF4 A;  1CKN B;  1VQ6 A;  3A0J A;  2IHF A;  2YTY A;  3HKS A;  2KCM A;  4YY3 L;  3S1Q H;  4A3I H;  4JI0 Q;  2RHQ B;  2UUA L;  4JV5 Q;  3I4M G;  3RR5 A;  1K83 H;  4DUZ L;  5JJK A;  4LFA Q;  4PMW A;  3UDI A;  2UUB L;  3PUZ A;  4JI8 L;  3DLL A;  2VQE Q;  2E8G A;  5LMN Q;  1Q8K A;  1S40 A;  1VQO A;  2PNH A;  4X62 Q;  5E7N A;  1I94 Q;  1YJ9 A;  2PI2 E;  4JCV E;  4DV3 Q;  4O2D A;  1IBM Q;  3AFP A;  5IY0 A;  2K5H A;  1UEB A;  5JJL A;  3PV0 A;  1PH8 A;  3PIP A;  2ATW A;  1OXT A;  2Z6K A;  4DV7 Q;  1T9H A;  1JJC B;  5M3M H;  1E7Z A;  2Q2T A;  1Q12 A;  4JBJ A;  3CCQ A;  1Q82 C;  4LF9 L;  2UXD Q;  4A3J G;  1HR0 W;  1C7Y A;  3G4S A;  4POG A;  4DV5 L;  1HNZ L;  4X66 Q;  4OON A;  1W3S A;  1L1O A;  1QUQ B;  3OYY A;  1I3Q H;  3M4P A;  5BR8 Q;  1EUJ A;  1NMG A;  2YTV A;  5H1S E;  1P16 A;  2VUM G;  1B7Y B;  5EAY A;  1KRT A;  1MIU A;  2JEB I;  4JBW A;  3KLW A;  5FJ8 G;  3CC4 A;  1CUK A;  3UDF A;  4QQB X;  4C2M H;  2E5L Q;  4GN4 B;  1L2F A;  5M5X H;  4IPD A;  4PZ6 A;  1Y1V H;  3FKI H;  1HNW Q;  3GTM H;  4LFA L;  3K8A A;  5IWA L;  3U4Z A;  3T1H Q;  5M3F G;  3ULL A;  3MXN B;  1V43 A;  2MO0 A;  4LUV A;  4UP9 A;  4APV A;  2IX0 A;  5GAG C;  3CCM A;  4NXM L;  4BY7 G;  1I94 L;  1ASY A;  4DV1 Q;  3STB C;  2VW9 A;  2CWA A;  2OQ0 A;  2PQA B;  4DV3 L;  2HIX A;  4GLA C;  1IBM L;  3KFU A;  3PO3 H;  4A3D H;  1XNR Q;  3AYH B;  4B3R Q;  1VQJ A;  4DV7 L;  1PVO A;  1WOC A;  5IP9 G;  3NEN A;  3HOU H;  2WP8 J;  1Q1E A;  3F8T A;  4A3B G;  4BBR G;  3J81 i;  1G29 1;  1S3O A;  1C9O A;  3UDX A;  1GKH A;  3RNU A;  4DAM A;  3CMA A;  2JE6 I;  1WYD A;  1X9N A;  4Y7N H;  1VQK A;  3TS2 A;  2AMC B;  4X66 L;  3L2P A;  4IOC A;  2R7F A;  1K9M C;  2A8V A;  1PYB A;  4DV4 L;  1MKH A;  4GN3 B;  3H3V I;  2N8N A;  2NN6 G;  1EQQ A;  2OTJ A;  3KYH C;  5BR8 L;  1KC8 C;  4BXX G;  2MO1 A;  2B63 H;  4OWT B;  1N32 L;  1I50 H;  4J15 A;  1N34 L;  1HNX L;  1LTL A;  3GTL H;  2EXD A;  4A3G G;  2H5X A;  2A19 A;  2F52 A;  4ME3 A;  1NJI C;  4C3J H;  3I4N H;  2JA6 H;  2F3I A;  4IFD G;  2IHE A;  1QZG A;  2WAQ E;  2E2J H;  4GNX C;  1J5E L;  4LF5 Q;  4HIO A;  1YZ6 A;  1B70 B;  3DM3 A;  4KHZ A;  1WCM H;  4P75 A;  4JI1 Q;  1VQB A;  3ER0 A;  4IJL A;  1UWV A;  1CSP A;  4BY1 G;  3ZJY C;  4AQY Q;  1YNX A;  4QGU A;  4LF6 Q;  2F4V Q;  3RZO H;  5GQO A;  2WAQ G;  3H15 A;  1Y1W H;  1HZB A;  3PF5 A;  4R4T A;  1FGU A;  1WI5 A;  3CCU A;  4RMF A;  1PA6 A;  4KHP Q;  1XNR L;  3D31 A;  1RL2 A;  2RCN A;  1X6O A;  3HOZ H;  1VQH A;  1SRU A;  2YTX A;  5FLM H;  1E22 A;  3OTO L;  1QVG A;  4O0A A;  1PHJ A;  2D62 A;  1Z9F A;  2AWN A;  2NVX H;  3F2B A;  1YHB A;  2K5N A;  2A1A A;  3PUW A;  4C3H H;  4YY3 Q;  5IYC G;  1HR0 L;  4B3S Q;  4OXP A;  1Q7Y C;  2UUA Q;  5IP7 H;  4DUZ Q;  1HJP A;  2UUB Q;  2BA1 A;  4JI8 Q;  3HOW H;  4LF8 L;  4A3F G;  3MEF A;  3S24 A;  1VQE A;  3E9I A;  3S2D H;  2R7D A;  2CWP A;  2VQF Q;  4A3D G;  4A75 A;  1C0A A;  1X54 A;  4HIM A;  1IBK Q;  1SE8 A;  3AEV A;  3HOV H;  1KXL A;  4DV2 Q;  4FDB A;  4P74 A;  4R4Q A;  3J7Z C;  1OXS C;  3GO5 A;  4JI5 L;  3KJO A;  4YWM A;  1VQG A;  2GVA A;  3ICE A;  4QL5 A;  4MZ9 A;  5C3E H;  5IYB H;  4LF5 L;  4JI1 L;  1OXX K;  3WWV A;  3GD7 A;  3HFZ B;  2F4V L;  4LF6 L;  4BBS G;  1HH2 P;  1JT8 A;  5IYD G;  1A0I A;  4DV5 Q;  4DR4 Q;  4NB3 A;  3TQY A;  2NN6 I;  2EQS A;  5GAH C;  3E9H A;  4A3L G;  4R4I A;  4A3C G;  4DK3 C;  3U4V A;  5C44 G;  3PO2 H;  4JOI C;  1VQP A;  2YV5 A;  1Q86 C;  2OTL A;  4AYB E;  4QY7 A;  4A93 H;  3EIV A;  1G51 A;  1K0R A;  3CP0 A;  3RLF A;  3UDG A;  4MTN A;  2OCE A;  2NZH A;  4PZ8 A;  3CC7 A;  4B3S L;  4A3K H;  1A63 A;  1H95 A;  2ZTE A;  4IFD I;  4AYB G;  3ULJ A;  1VQN A;  2MFI A;  1EIY B;  5HGQ A;  1CKN A;  5IWA Q;  3I2Z A;  1Q81 C;  3H0G H;  1JE5 A;  2HHH Q;  3T1Y Q;  4NXM Q;  3U58 A;  2MQH A;  1PV4 A;  2JA7 H;  2VQF L;  4GNX B;  2L15 A;  2D0P A;  1IBK L;  2QGQ A;  4H02 A;  2E2I H;  4DV2 L;  1YJW A;  3K7U C;  3RN5 A;  1K8G A;  1X65 A;  2IT1 A;  4L5T A;  2K52 A;  1JJ2 A;  1N9W A;  3HKZ E;  2ZJQ A;  4L5S A;  2Q2H A;  3NEL A;  4YWL A;  4A3I G;  4DR4 L;  4A4I A;  1SR3 A;  1IXR A;  3HKZ G;  2CCZ A;  1K73 C;  3GTO H;  4DV4 Q;  3S15 H;  1OXV A;  3PUV A;  3G71 A;  4XIG S;  1BVS A;  1VQ4 A;  2N78 A;  2ASB A;  3U50 C;  3S17 H;  1UE7 A;  1GVP A;  3D0F A;  1KHI A;  4DUY Q;  3W1G A;  1QVF A;  1PFS A;  3PGZ A;  1L0W A;  3SGI A;  3JAM i;  4A3M H;  3L0O A;  1N34 Q;  1HNX Q;  1EFW A;  3GTK H;  1E3P A;  1NY4 A;  2I5L X;  1OTC A;  5DLQ E;  1YBY A;  3EN2 A;  4BA2 I;  4LF4 Q;  1PH1 A;  5M3M G;  2R7Z H;  5GRO A;  1VQ8 A;  2UXB Q;  3A5U A;  1WFQ A;  3K80 C;  4JBM A;  3JC6 6;  1PYS B;  1J5E Q;  4LFC Q;  2R93 H;  1X56 A;  2D0O A;  4GN5 A;  3KDF B;  1XPU A;  3KOJ A;  2HHH L;  3T1Y L;  3W5O A;  1I5F A;  3J80 c;  1A62 A;  4LWC A;  3HOY H;  3CW2 C;  4JBK A;  1HZ9 A;  4OWX B;  1M1K C;  4OO1 G;  2ZJP A;  1UE6 A;  3OTO Q;  5C0X J;  2JEA I;  4PG3 A;  2K4K A;  2PQA A;  4IPH A;  1PH4 A;  3J7A 5;  1XMQ L;  4K0K Q;  4HJ8 A;  4X65 L;  3T1H L;  4GOP B;  3PUY A;  4X64 L;  1HR0 Q;  2CKZ B;  1Y1V G;  3FKI G;  4DV6 Q;  3M7N A;  1VQD A;  3G6E A;  4LFB L;  3I55 A;  4DKA C;  3VDY A;  1CKM A;  1GD7 A;  1TWC H;  1Z47 A;  4LF8 Q;  4DUY L;  1TWH H;  4Y52 H;  1VS0 A;  3I4O A;  4JI6 Q;  4JI2 Q;  5C4X H;  3KJP A;  2HT1 A;  1YHQ A;  2QA4 A;  2JA5 H;  4RG1 A;  4DR5 L;  3PO3 G;  3GTP H;  4DR1 L;  1E24 A;  1VQI A;  3ULP A;  4LNQ A;  2R92 H;  4MNO A;  4LF4 L;  1SRO A;  1D8L A;  2JQO A;  3HOU G;  2UXB L;  4JI5 Q;  1IL2 A;  4WJ4 A;  4HIK A;  3S2H H;  1NTG A;  4LFC L;  1NMF A;  3OW2 A;  4ALP A;  1KD1 C;  2OWO A;  2MNA A;  4LF7 Q;  3L7Z C;  4YCV A;  3TEH B;  5IT9 c;  3HOV G;  3K7A H;  3UE1 A;  1YI2 A;  1QZH A;  2OQK A;  4UP7 A;  5C4J H;  1N32 Q;  4P71 A;  3PF4 A;  4LW1 A;  1PH6 A;  3G48 A;  1W2B A;  5FLX c;  1Q1B A;  4R4O A;  1P8L A;  4DNI A;  3CCV A;  2B63 G;  1K8A C;  1AE3 A;  1PH9 A;  4K0K L;  1M90 C;  5M5W H;  1FJG L;  3KF6 B;  1YIJ A;  2NVY H;  3I4N G;  2I5H A;  3E0E A;  2JA6 G;  4IPG A;  1X3F A;  2WB1 E;  3CQZ H;  4BA1 I;  1XPO A;  1WCM G;  2Y0S E;  3LGJ A;  5AJ3 Q;  4JI7 L;  2ZJR A;  4JI6 L;  2EIF A;  1Y1W G;  4JI2 L;  1A8V A;  2Q2I A;  2WB1 G;  1PH7 A;  2NZO A;  2B3G A;  1LM0 A;  1LYL A;  1EQR A;  5ELN A;  1R9T H;  1WJJ A;  1QVC A;  3HOZ G;  4YCU A;  4OO1 I;  5FLM G;  2KHI A;  4A3E H;  1N36 L;  1U0L A;  1X3G A;  2ES2 A;  2VNU D;  4LF7 L;  1ASZ A;  3HOX H;  3CCR A;  2RHS B;  4QIW E;  2BH8 A;  2BA0 A;  4JC0 A;  4OWW B;  1TWF H;  2JA9 A;  5IP7 G;  3F2C A;  4DV0 L;  1XNQ Q;  5LMN W;  3HOW G;  4GOP C;  3TRE A;  2NVT H;  4DR2 L;  1HZC A;  3CCE A;  2UUC L;  3EBE A;  1VQA A;  1VCI A;  2QEX A;  5M5Y H;  2VY3 A;  1PH3 A;  2I0Q A;  1KRS A;  3AQQ A;  1VQF A;  3K81 C;  4DAY B;  2ZM6 Q;  3I4M H;  1K3R A;  4HID A;  3CCL A;  3H3V H;  1Q46 A;  5ELO A;  4POF A;  5IYB G;  5C3E G;  1XPR A;  1VQL A;  2BH2 A;  4JYA L;  1JJG A;  5AJ3 L;  3TRZ A;  4QJF A;  3J81 c;  4NXN L;  3KF8 B;  1SLJ A;  2B29 A;  3A74 A;  3J81 j;  4DV6 L;  4B3M L;  1PH5 A;  4OX9 L;  3GTQ H;  2LXJ A;  4DR6 L;  2CFM A;  4UY8 C;  1YVC A;  1TWA H;  5JEA J;  4B3T L;  1FVI A;  2K14 A;  4R4C A;  3PO2 G;  3GTG H;  2ZTC A;  1J6Q A;  2YU9 H;  5K36 G;  2AHO B;  3CCJ A;  4IO9 A;  4GNX A;  3FP9 A;  3CPF A;  2JA8 G;  4A93 G;  1XMQ Q;  3CPW A;  1KIX A;  1XTD A;  4A3J H;  4X65 Q;  1NBW A;  1MJE A;  4A3K G;  4X64 Q;  5C0X G;  5LMU L;  2XTI A;  4A76 A;  4EQ5 A;  4OX9 Q;  1V1Q A;  3CME A;  3CC2 A;  4C3I H;  1XNQ L;  2IX1 A;  4DK6 C;  2K75 A;  1YJN A;  4LFB Q;  1TXY A;  4HJ9 A;  1G6P A;  5IE8 A;  2CQO A;  1BBW A;  3H0G G;  4KLK A;  2VUM H;  1B8A A;  1E1T A;  3PSI A;  1QUQ A;  5FJ8 H;  2JA7 G;  1SN8 A;  3BU2 A;  4P73 A;  4TVA B;  3I56 A;  4DR5 Q;  4DR1 Q;  4JG2 A;  4DR3 Q;  2ZM6 L;  1L1O B;  4KI0 A;  1PH2 A;  4GKK L;  4XTC S;  2JA8 H;  5M3F H;  3IRB A;  4HJ5 A;  4DPG A;  4BY7 H;  2PMZ E;  3W1B A;  3F2D A;  3BZC A;  2I5M X;  3CD6 A;  1BBU A;  1U5K A;  1XMO Q;  3KDF A;  3BJU A;  1EOV A;  4HJ7 A;  5IP9 H;  1X55 A;  4YHH L;  1N33 L;  1IYJ B;  4A3B H;  4BBR H;  3M85 A;  4A3M G;  1N8R C;  3CAM A;  1AH9 A;  1VQC A;  3NBH B;  2N49 A;  2LXK A;  4JI0 L;  1V9P A;  3RN2 A;  1XJV A;  1FJG Q;  1HZA A;  1VQ9 A;  4JV5 L;  3Q8D A;  2R7Z G;  2DUD A;  2VS1 A;  2JK8 A;  2VQE L;  2R93 G;  1DGS A;  4GS3 A;  5LMN L;  4JI4 Q;  4DR7 Q;  4GLX A;  2FXQ A;  3NEM A;  3RLN A;  4GOP A;  4BXX H;  4JOI A;  4JI7 Q;  2C35 B;  2YYZ A;  5J3B A;  4X62 L;  3HOY G;  1MJC A;  2V1C C;  1LUZ A;  4A3G H;  2KCT A;  5GAD C;  2ID0 A;  2XGT A;  1YEZ A;  3GTJ H;  4GLV B;  1VQ7 A;  1IZ6 A;  4DR3 L;  3PUX A;  1UE1 A;  1YIT A;  4IPC A;  2K5V A;  1CKO A;  2ZTD A;  3F1Z A;  3UE0 A;  3RLO A;  5HY6 A;  1N36 Q;  2Q2U A;  4BY1 H;  4JI3 Q;  2UXD L;  1X3E A;  3M4Q A;  5C0X I;  2VZA A;  4L5Q A;  3S1M H;  2HIV A;  1RIP A;  4UP8 A;  3A5Z B;  3CCS A;  4DV0 Q;  1XMO L;  3M4O H;  3PCO B;  2GVB A;  4EX5 A;  3K0X A;  4HJA A;  3PIO A;  1UE5 A;  3GDE A;  4DR2 Q;  2PI2 A;  5C4X G;  1EYG A;  4LUO A;  2R6G A;  2E5L L;  2JA5 G;  1EWI A;  4YCW A;  2UUC Q;  2UU9 Q;  1SFO H;  2R92 G;  4NPS A;  4UPA A;  5IYC H;  2AWO A;  4IOA A;  1D7Q A;  2Z6K C;  1HNW L;  2AKW B;  1JB7 A;  1VQ5 A;  4TQU S;  3S16 H;  4JI4 L;  4DR7 L;  3KF6 A;  4YWK A;  4JYA Q;  3S1N H;  4A3F H;  4GKJ Q;  2IY5 B;  1CSQ A;  4NXN Q;  1EIF A;  4DV1 L;  1FL0 A;  1L1O C;  2LSS A;  1JMC A;  3I7F A;  3FHW A;  2Y0S G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...