5LMUQ

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5lmuQ00
5IP9H 5IYCH 2QA4A 1IZ6A 4BBRH 3FKIH 2Z6KC 4EX5A 4UPAA 3KLWA 1XMQL 3KJPA 1GKHA 2VL6A 4KHZA 3K7UC 3CXCA 3CQZH 1ASZA 3PUXA 4JI8Q 3I55A 4DV2L 2K50A 4A76A 3U4VA 4PZ7A 4LFAL 2JA8G 1J5EL 2NN6G 2V1CC 3HOWG 4JBMA 1E1TA 1PH1A 3J81j 4JOIA 1P8LA 3GTOH 4RMFA 1VQHA 2EQSA 4JI1L 2BH8A 5JEAJ 3CCUA 3T1YQ 1Q7YC 5IE8A 3L0OA 1VQ8A 2Q2UA 4LF5L 2R92G 3U50C 4DR5Q 2D62A 2WB1E 2LXJA 2XTIA 5LMUQ 3PV0A 3GDEA 1WCMH 4X66L 4GOPC 3S1RH 1K8GA 2DUDA 1HNZQ 2E5LL 1AE3A 2K75A 2XGTA 2ZTCA 4Y7NH 4NXMQ 2VUMG 1VQKA 1E24A 4JI7L 1UE5A 3J80i 4X62L 1SN8A 2VQFL 2UUCL 4BXXH 4DR7Q 5E7NA 4OWXB 4DV1Q 4HIOA 1VQ5A 4LF6L 5C4XH 4NPSA 2HT1A 3H3VI 1T9HA 2NVYH 3J7A5 1YEZA 1VS0A 3HOXH 2UUAQ 3MEFA 4LUVA 3CMEA 1PV4A 1YHQA 4A3CG 4C2MH 1C7YA 1EWIA 3I56A 4DV5Q 1VQ4A 1XMQQ 4BY1H 3HOVG 2EIFA 1Y1WG 4A3BH 4GKJL 2Q2HA 3BZCA 2JA5H 4P75A 4LFAQ 4DV2Q 3HOUG 2R7ZH 1B70B 1OTCA 1J5EQ 5GROA 1KXLA 4X65L 4L5QA 4LUOA 3RZDH 2E2IH 3FP9A 4KLKA 2OCEA 3G48A 5IY0A 4NB3A 4JI1Q 4DUZL 1X3EA 3H0GG 1YIJA 4LF5Q 4NXNL 4WJ3M 5GADC 2ES2A 4DR4L 3S17H 4DR3L 1PYBA 5C4JH 2JA6H 3GTMH 4X66Q 2E5LQ 5BR8Q 1JMCA 3W5OA 1S40A 4UY8C 2OQ0A 3KYHC 4P71A 5IT9c 1ASYA 2F4VL 1P16A 1A62A 4IO9A 3K0XA 2IX1A 4JI7Q 1VQPA 4X62Q 2VQFQ 3S2HH 1R9TH 2UUCQ 1FGUA 4POGA 3UDFA 4A3DH 4R4QA 4DK6C 1PH3A 4LF6Q 3W1GA 3MXNB 3AYHB 4B3SL 2MQHA 2R6GA 1MJEA 1MKHA 4L5SA 1SRUA 4X6AH 4IPDA 3F2CA 4JBWA 4B3RL 3CCRA 1JJGA 4GKJQ 4GNXB 4POFA 4GNXA 3E9HA 4JI2L 3ULJA 2I0QA 2K4KA 1VQAA 1CKMA 2PNHA 4YY3L 4DUYL 2HHHL 2JEAI 2UXBL 3EBEA 1N34L 2UUBL 1Q1BA 4X65Q 3TS0A 1OXXK 1X3FA 4LNQA 1NY4A 1VQ9A 4QGUA 3W1BA 3GTQH 3M3YH 4BBSG 3G6EA 2Q2IA 3BJUA 3CPWA 4DUZQ 4DV6L 3RNUA 4DR6Q 5FJ8H 4NXNQ 1O7IA 1SFOH 1L1OC 2OWOA 3I4NG 1XNQL 4DR3Q 1BBWA 4DR4Q 1AH9A 2CWPA 4R4TA 4LF8L 1PVOA 4DV3L 4GLXA 1NE3A 2K5VA 3PIOA 1A8VA 4A3IG 2F4VQ 3GTPH 1QZGA 1VQIA 2Q2TA 5FLMG 4GN3B 1QUQB 1QUQA 1B7YB 2JA8H 1BKBA 3CPFA 1IYJB 2ZTEA 3M7NA 5C3EH 3HOWH 1HNWL 1BBUA 3CCSA 4DK3C 4LW1A 2YU9H 4B3SQ 4OWTB 3GD7A 2IT1A 4OXPA 3I7FA 2UXCL 5AJ3L 4LFBL 1NJIC 4A3GG 1AE2A 4B3RQ 4GS3A 4HJAA 3TEHB 4QQBX 2R92H 1TWCH 3HOZH 3STBD 1PH4A 3Q8DA 2F52A 3TRZA 2VQEL 4JI5L 3TQYA 4JI2Q 4XTCS 4YY3Q 2JE6I 5J3BA 3F2BA 4DUYQ 4A3FG 2HHHQ 2UXBQ 1M90C 1JJ2A 1N34Q 2UUBQ 4KHPL 2VUMH 4A4IA 3OTOL 4DV4L 3ZJYC 4APVA 4P72A 1EIYB 4C3HH 3DM3A 2KHJA 1Q1EA 1IXRA 2VY3A 4DV6Q 1YVCA 5IWAL 1LYLA 1HJPA 4JI3Q 4HIMA 1XNQQ 2KBNA 4LF8Q 4IOAA 1X56A 1LUZA 1EYGA 1U5KA 4IFDI 2VNUD 1OXVA 4JOIC 1FL0A 1Y14B 4BY7G 4R4IA 1EFWA 2ZJPA 3HOUH 1I3QH 5HGQA 1VQLA 1K8AC 3HKZG 1HNWQ 4A3JG 2CCZA 4QJFA 1M1KC 4OO1I 2R93G 4P74A 2B63G 2BA0A 2H5XA 2UXCQ 5AJ3Q 4LFBQ 3PF5A 1NBWA 1YHBA 4JC0A 4AIMA 1YZ6A 4X64L 2YTYA 5C44G 5IP7H 3KJOA 4YWKA 1X65A 2VQEQ 5GAEC 4JI5Q 2B3GA 5IYDG 4LFCQ 1SR3A 3PSIA 4KHPQ 2E2JH 1FVIA 2IHFA 2AMCB 4DPGA 3GTKH 2ATWA 3A5ZB 3UDGA 3KF6B 3KF6A 2R7DA 4AQYL 1I94L 4O2DA 5M5YH 1TWFH 4HIKA 1V9PA 5IWAQ 4HJ7A 1N36L 2D0PA 1GVPA 4DNIA 1L2FA 2AHOB 1HNXL 1X9NA 1JE5A 3JAMi 5M3FG 3HOYH 3RLNA 4A3EH 1XMOL 3U4ZA 1VQNA 2QGQA 3L2PA 1XTDA 3CCEA 1WFQA 4A3KH 5C0XJ 3LGJA 2GVBA 2HQLA 3M9BA 3VDYA 1TWGH 1MIUA 4GN5A 4LWCA 2WAQE 3RLOA 1X54A 1S3OA 4OONA 4B3TL 4PMWA 1DGSA 2QEXA 3CCJA 1S72A 1RIPA 2EXDA 5IYBG 1Q82C 4IFDG 3RZOH 4YHHL 1VQBA 4R1JA 4YCWA 2UU9L 4JI0L 2A1AA 4DV0L 1VCIA 2VW9A 5JJLA 3PO3H 1QVGA 1E22A 5IP9G 5IYCG 4OO1G 3D31A 3EN2A 3FKIG 4BBRG 5K36G 2PI2A 1Q81C 3CF5A 1QZHA 4DR1L 3E9IA 1J6QA 3M85A 4AQYQ 1I94Q 1YBYA 2CQOA 4A3LG 2JA7H 1N36Q 4GNXC 1JT8A 3J81i 4A3MG 4ALPA 1VQJA 3PGZA 1HNXQ 1WI5A 1E3PA 4HJ5A 1PH6A 3RN2A 1FJGL 2NVQH 1XMOQ 2I5LX 1VQ6A 1EUJA 3CCVA 4KI0A 4GLVB 4OX9L 2WFWA 1K9MC 1KRSA 2K5HA 3K8AA 1PH5A 4MNOA 4JV5L 2PI2E 4B3TQ 4JG2A 4BXXG 3F1ZA 2L15A 4BA2I 1IBKL 1EQRA 3H15A 3S1NH 4AYBG 4YHHQ 2ALYB 2PMZE 4A93H 4JI0Q 2YTXA 1Q12A 1HZCA 3OYYA 3HOXG 4DV0Q 2NVTH 3PO2G 1I6HH 2B29A 1IBLL 4LF4L 1XPOA 1YNXA 1A0IA 1Q8KA 1Y1VG 3CCMA 1X3GA 5GQOA 4YWLA 3CW2C 5H1SE 4DR1Q 4BY7H 2ZTDA 3EIVA 2JA5G 2AWOA 3UDXA 1I50H 4DAMA 4P73A 1VQDA 5FLXc 3PIPA 2R7ZG 3KOJA 4R4OA 1NMGA 2BA1A 3PUVA 4JCVE 4HIDA 3M4OH 5HY6A 4IJHA 3FHWA 1OXSC 1FJGQ 4L5TA 3KDFB 2RHSB 3KDFA 4UP9A 5M3MG 1N8RC 3F2DA 1YJWA 4OX9Q 2JA6G 4IFDJ 3S16H 2RHQB 3S15H 4AH6A 2WB1G 1NMFA 4XIGS 4QY7A 2RCNA 2JK8A 2GN5A 2C35B 2NZOA 3A0JA 1SLJA 3HKSA 1VQGA 2A8VA 4JV5Q 2N8NA 3BZKA 3CMAA 1HR0W 1IBKQ 1KAWA 4A75A 2JEBI 1PH2A 2HIXA 1HZ9A 2ZJQA 2NZHA 4A3CH 4GKKL 1WOCA 4LF4Q 1UWVA 4DV3Q 1H95A 1B8AA 3S24A 3ERSX 1JB7A 3SGIA 1I5FA 1W3SA 1OXTA 1Z9FA 4DV7L 1Y1WH 3HOVH 4LF7L 1E7ZA 3KF8B 2Y0SE 4LF9L 4IPCA 3PUYA 2MNAA 1X55A 1PYSB 2E2HH 1A63A 4TQUS 2D0OA 3H0GH 3L7ZC 2JA9A 5FJ8G 2VZAA 3PUWA 5GAGC 5LMNW 2N78A 4YCUA 2VS1A 3CAMA 3PCOB 2YTVA 1K73C 3D0FA 4DV5L 3TS2A 3OTOQ 2K5NA 4DV4Q 1PH8A 1L0WA 1PA6A 1D7QA 2ZM6L 1G51A 3DLLA 3S1MH 1VQFA 5ELNA 4A3LH 1CKOA 5GAHC 2Z6KA 1V43A 4PZ6A 5C3EG 1N32L 4OWWB 1VQMA 4A3MH 1KRTA 2AKWB 3K81C 4K0KL 1MJCA 2IHEA 1SMXA 1X6OA 4GKKQ 1G6PA 1K0RA 4HJ8A 2PQAB 2PQAA 3HOZG 1CUKA 1TWAH 1EIFA 4DV7Q 3KFUA 3GTGH 3K7AH 3CC7A 4LF7Q 3H3VH 3S1QH 4C3JH 5BR8L 2KCTA 4LF9Q 3WWVA 3J7ZC 5M5WH 2OTJA 3I4MG 2RF4A 3T1HL 2ASBA 4B3ML 3I4OA 1C9OA 1EOVA 4UP8A 4C3IH 2ZJRA 4BBSH 1HZBA 4GOPB 4GOPA 1WJJA 4X64Q 3AQQA 4ME3A 4EQ5A 2OTLA 2K14A 4A93G 3CP0A 4IJLA 3I4NH 3F8TA 1UE1A 3A74A 1VQOA 4L5RC 3PO2H 3J80c 3U58A 3ICEA 2R7FA 1VQEA 1Y1VH 4MZ9A 1XNRL 4PZ8A 1HR0L 4A3IH 3I2ZA 2MFIA 4QL5A 1KIXA 4O0AA 3M4PA 3UE1A 3HKZE 1CSPA 3K80C 4YWMA 5FLMH 2ZM6Q 3PUZA 1XPRA 1U0LA 4R4CA 1KC8C 1YITA 2ID0A 2YYZA 1XJVA 2KENA 3B6YA 3JAMc 3S2DH 1KL9A 1N32Q 5DLQE 3CC4A 5EAYA 2IY5B 4A3GH 4K0KQ 3JC66 1LM0A 4DR6L 4PG3A 5M3MH 2DGYA 5IP7G 4JBKA 4Y52H 3TREA 2JQOA 1RL2A 2AWNA 3G71A 4A3FH 1WCMG 1CKNB 1CKNA 1G291 2GVAA 3ER0A 3RR5A 1SROA 1KQSA 5JJIA 3ULLA 4JYAL 3T1HQ 1VQCA 4B3MQ 2YV5A 5LMNL 1PFSA 3AFPA 2E8GA 5C0XI 1N33L 3CCLA 2CKZB 5C4XG 3AEVA 2UU9Q 4MTNA 3NENA 1QVFA 2KCMA 2MO1A 4TVAB 4QIWE 1UE7A 1YJ9A 3GO5A 3GTLH 3S14H 2BH2A 3HOYG 1XNRQ 1HR0Q 4A3EG 1TWHH 3GTJH 1JJCB 4BY1G 4JI6L 4A3BG 1VQ7A 1PH7A 4JI4L 1N9WA 3PF4A 3J81c 1Z47A 2CWAA 4H02A 2NVXH 1UEBA 4HJ9A 4GN4B 4A3JH 2UXDL 1HH2P 3CC2A 5M5XH 1E1OA 2Y0SG 4A3KG 2B63H 1XPUA 4J15A 1HZAA 2R93H 5JEAG 3G4SA 3AFQA 1IBML 1GO3E 3NEMA 1Q46A 5JJKA 2CFMA 1WYDA 4RG1A 5C44H 1KHIA 2N3SA 2OQKA 4GLAC 4JI3L 1CSQA 2NN6I 4DR2L 3RN5A 4FDBA 2I5MX 2N49A 4JBJA 5IYDH 3HFZB 1TXYA 4YCVA 5ELOA 3RLFA 3PO3G 4LUZA 2Z0SA 2IX0A 2KHIA 1W2BA 4JYAQ 2LSSA 1L1OB 1L1OA 5LMNQ 1Q86C 3STBC 1C0AA 2MO0A 2WP8J 3A5UA 4A3DG 1OXUA 4JI8L 1N33Q 1BVSA 2LXKA 3IRBA 3ULPA 4DAYB 4IOCA 2FXQA 1V1QA 2K52A 2JA7G 1UE6A 2F3IA 4BA1I 4IPGA 1K3RA 2HIVA 1GD7A 3NBHB 1YI2A 3CCQA 1YHAA 3NELA 1IBLQ 5M3FH 3UE0A 3T1YL 2A19A 4DR5L 4JI6Q 1K83H 5C0XG 4JI4Q 5LMUL 1PH9A 1HNZL 4LFCL 1IL2A 1NTGA 1YJNA 2JJQA 2UXDQ 3E0EA 4NXML 3I4MH 3UDIA 4WJ4A 1KD1C 3M4QA 1SE8A 3OW2A 4DR7L 4DKAC 4AYBE 3BU2A 1EQQA 1IBMQ 3CD6A 5IYBH 4DV1L 1PHJA 2WAQG 4UP7A 1D8LA 1GM5A 4IPHA 4DR2Q 1QVCA 2UUAL 1LTLA 2I5HA
chains in the Genus database with same CATH superfamily
3LWUA 1PZKD 2QA4A 3S2HB 1K3BC 4EX5A 2RCFA 5K36H 3KLWA 1HHVA 1GKHA 3CQZH 2L5TA 3DUZA 4A76A 2NN6G 1G91A 3MVVA 4JBMA 3GTLB 3WDNA 1E1TA 4EVOA 4JI1L 4DXFA 5JEAJ 1Q7YC 1VQ8A 3L0OA 3U50C 4B9XA 2XWJB 4DR5Q 5M5XB 3MTSA 4ZCKA 2XTIA 2E5LL 1RTOA 1BBXC 3GTQB 1WTXA 5JOBA 4HMJA 1E24A 3J80i 1G6ZA 1SN8A 4C3HG 1BCPF 1JQYD 5EKKA 4DV1Q 2A69D 1VQ5A 1TKWB 2IW3A 1T9HA 2NVYH 4KY7A 3FDTA 1YEZA 2UUAQ 2O5JC 1BO0A 4A3CG 4IALA 1C7YA 3NTKA 3HOVG 5C3EB 2Q2HA 3NTIA 2YU9B 3BZCA 4P75A 2R7ZH 3F2UA 5DM63 5T1GA 1KXLA 2D2CC 4X65L 4LMQD 2R92B 5L37A 3HOZB 2BDOA 1G2TA 1ILQA 2OCEA 5IY0A 4ODGA 1KDBA 5GADC 3NE5B 5BR8Q 2RDGA 2BOSA 3D3RA 3K0YA 1MBYA 1VQPA 2EE1A 1R9TH 4POGA 3S1RB 1MD2D 4R4QA 2A5HA 3D6CA 3W1GA 3AYHB 4B3SL 1ENFA 1LTID 4CDEC 4X6AH 4ILWA 1HA6A 3HOUB 2C5CA 2EY6A 2JP1A 4GNXB 1SJED 4RWSC 4JI2L 3ULJA 2I0QA 2K4KA 4YY3L 4DUYL 1WTVA 2PYKA 4U673 1N34L 1A3UA 1X3FA 3D4WA 2XRSD 5COYA 3K5MA 3TMEA 5FJ8H 1O7IA 1SFOH 3TN2A 4DR3Q 1BBWA 4IUVA 1ESFA 1F9SA 4MHEA 4LF8L 4F87A 3VYUA 4DV3L 1SNQA 4GLXA 2F4VQ 5AFWA 1QZGA 1TWFB 4DNRB 1HA5A 1BKBA 1IYJB 2ZTEA 3A56A 5EPJA 5A2QE 4DK3C 4LW1A 3HOYB 4KD3A 2J7ZA 3GD7A 4A3EB 3I7FA 5AJ3L 4O42A 1ZYRC 1E2ZA 3IFTA 4GS3A 1DXMA 1JOKA 1D1KA 3V2TA 4QQBX 2F52A 4A3KB 3TQYA 2CH4W 4XTCS 2HHHQ 3F2BA 4FF2A 2LS01 1IKLA 3MXPA 1M90C 4JW0A 3OTOL 1DOLA 2MGSA 4C3HH 3Q23A 1PRTB 3DM3A 1IXRA 3VYRA 1K8OA 2A6HC 1XNQQ 2FMMA 3QIAA 1KABA 2KBNA 2RQXA 2QCPX 4IOAA 1X56A 2MHVA 2TSSA 1EYGA 3WOFA 1OXVA 2Z4IA 4Q5VA 4KD4A 4JOIC 1EFWA 2A68C 5HGQA 4A3JG 1M1KC 1RF2D 2BA0A 1YHBA 1GOZA 1PTOB 1X65A 2VQEQ 4PQXA 3PSIA 3X3MA 2E2JH 2OEOA 1FVIA 4DPGA 2AMCB 1WTHA 3UDGA 1EWCA 4FO2A 2OT2A 1N36L 3ND8A 1GVPA 1HNXL 1JE5A 2IL8A 5M3FG 1SDFA 1GUWA 1VQNA 4C1NK 2QGQA 3L2PA 4K2LA 1I6VC 1F9QA 2Z8LA 2GVBA 3M9BA 5IT9E 1TWCB 4OONA 1DONA 1DGSA 3HG9A 4K8JA 1RIPA 4IFDG 4TRDA 3S15B 1KNEA 2F0DA 1STGA 3RZOH 1R4QB 5JJLA 3K58A 3J7YW 2J4XA 4O1NA 4OO1G 1FR3A 2TMPA 5EPKA 3N52A 1DJRD 1NNXA 3E9IA 2X69A 4NKLA 1YNNC 3NWTA 1ONLA 2NB0A 1SBBB 2HQEA 1E3PA 5IOCA 4HJ5A 1PH6A 1CZGA 3OWFA 2NVQH 4P2CB 4CKCA 2K1BA 1EUJA 3K6OA 3A7LA 3CCVA 3GV6A 2F0QA 4GLVB 1JOQA 1K9MC 1KRSA 3I3CA 2EJGC 2K5HA 1B53A 3C46A 5D3IB 4JV5L 2PQEA 4B3TQ 4OIJA 4N8X1 2F0GA 4BA2I 1IBKL 3S1NH 4OHJA 1NR2A 2FFKB 4AYBG 4JI0Q 1HZCA 2PPBC 1LTAD 3PO2G 2B29A 1EIHA 1Y1VG 2B2YC 5I2XA 2ZTDA 4KHVA 4P73A 1HCZA 3KOJA 5DAUA 5HY6A 3GTGB 1SYFA 4L5TA 1GJXA 5F2DA 1WVLA 3JAML 1MHWC 2RDHA 5A35A 1V1PB 3S16H 2Q8TA 2AQ1B 1TS5A 2F0IA 2WB1G 1ZYRD 3NK9A 2JK8A 2NZOA 3A0JA 2A8VA 4G7OC 3BVZA 1TS2A 3BZKA 3CMAA 1HR0W 2ICEC 4Z9CB 5EJWA 5DNFA 1PH2A 3OIPA 2NZHA 4XDXA 4GKKL 1WOCA 1H95A 2F0WA 1JB7A 1Y1WH 3S2DB 1FNWA 5D3DA 4HSPA 4A3GB 2A6HD 1XTCD 1X55A 5C5MA 2WKCA 4TQUS 1ENAA 4RFBA 5LMNW 1S5DD 4YCUA 3KLRA 2VS1A 3UI2A 1JE4A 1MI2A 2VXWA 1I4XA 2YTVA 3D0FA 5IGEA 4HR7B 3PIO3 5IGCA 3T51B 2R3ZA 4HCSA 1TY2A 4PZ6A 2KOLA 5E4XA 2RDFA 4OWWB 1G8ZD 4K0KL 3MFGA 1MJCA 2IHEA 1EIGA 1LT5D 4HJ8A 3HKZB 1JWMD 3KFUA 4V190 3CC7A 3S1QH 4C3JH 2KCTA 4LF9Q 5M5WH 3NXWA 3I4MG 3URYA 1EY8A 3WOEA 1EOVA 1BCPC 1HTLD 4C3IH 4BBSH 4GOPB 1WJJA 5KIXA 3AQQA 4Q0FA 3K5LA 3CP0A 3I4NH 3E6ZX 1DD2A 4EGVA 3PO2H 1BCPB 1I4GA 2ZT9C 1Y1VH 1HR0L 1D5XC 4A3IH 3KBXA 1KIXA 4ZKBB 3HKZE 2Q8RE 2F0TA 4UHVA 4QIWB 4EQPA 2QEJC 3VR5A 5IP7G 2EYLA 4OIKA 1YNND 4A3FH 4CJ0B 1CKNB 4KJOA 4XQJA 1KQSA 3ULLA 3T1HQ 4B3MQ 2YV5A 5LMNL 1BR9A 3I90A 3AFPA 2E8GA 1N33L 2CKZB 5KNDA 1ICFB 3IL8A 5FLXE 3TP7A 2UU9Q 3E3XA 2KCMA 3HS0C 4QIWE 1UE7A 1YJ9A 4KKUA 3CQZB 4DU9A 2FHTA 2FINB 3DEPA 4DA2A 4JI6L 1VQ7A 2CH4A 2UXDL 1XPUA 1E1OA 1HZAA 1DCZA 5IGDA 3ERQA 1GO3E 5CBAE 3NEMA 1Q46A 2IJ0A 2IX3A 4RG1A 1T5XD 1J8IA 2F0JA 4GLAC 3RN5A 4JI3L 2NN6I 1A3VA 2I5MX 1KLGD 1PRTF 1TXYA 3PO3G 1PZJD 1DOMA 3MWYW 5M9OA 4JYAQ 3BDCA 3NBIA 2DJGC 2NVYB 1FNUA 4XT3B 1Q86C 1EY7A 4K6LA 2WP8J 1OXUA 3IRBA 4IOCA 2JA7G 1GD7A 1NSNS 3CCQA 1YHAA 3NELA 1IBLQ 3R8BA 2R7ZB 1K83H 5C0XG 1YJNA 2E76C 2JJQA 4WJWA 1PTOF 3FRPB 3I4MH 4HEDA 1KD1C 3OW2A 4DR7L 3TP5A 3BU2A 3CD6A 1IBMQ 1SNCA 1WD1A 3MC0B 1GM5A 4DR2Q 2HDLA 4I7AA 4A93G 2DN8A 4LK1C 2QILA 5IP9H 1R9TB 2KCNA 4BBRH 2Z6KC 1XMQL 3P75A 1KTKA 1Z7TA 1V1OA 2VL6A 3K7UC 3CXCA 4DV2L 2K04A 2K50A 2RKSA 3U4VA 4PZ7A 3TP8A 2JA8G 2V1CC 3HOWG 3J7AV 1HFGA 4JOIA 1P8LA 3GTOH 3CCUA 2BH8A 3T1YQ 2WKDA 2JN4A 4LF5L 4HAEA 5BN5A 2EY2A 2PW5A 2B2UC 1QILA 4L63B 2D62A 1HQMC 2CQAA 5LMUQ 3PV0A 1HNZQ 2MPMA 1JB3A 5TSSA 2K75A 2ZTCA 2VUMG 1IW7C 1UE5A 3TZUA 4X62L 2UUCL 1SFOB 4BXXH 5E7NA 4DAVA 1VS0A 4NW2A 1A15A 3MEFA 3CMEA 1SMYC 1F77A 2X6GA 1F9RA 1ZXTA 1VQ4A 4GKJL 4K5XA 2B2WC 2JA5H 1KAAA 1HUMA 1AZPA 4L5QA 4LUOA 3RZDH 4KLKA 2EY5A 3R2TA 4NB3A 4JI1Q 3H0GG 4WJ3M 3KLSA 3U9OA 4ME5A 2JA6H 4WFN3 2E5LQ 1JMCA 3W5OA 2EYJA 3KYHC 5IT9c 4IO9A 2IX1A 2EYHA 1Q90A 4ZLTF 1RODA 4DK6C 3J81E 3MXNA 1MJEA 1Q3LA 4L5SA 1SRUA 4IPDA 4B3RL 1SNPA 3CCRA 1B1ZA 2NYZD 2K28A 3QOJA 2UXBL 3VR2A 1Q1BA 4X65Q 3TS0A 1OXXK 1SNOA 1WD0A 2F3WA 1NY4A 1VQ9A 4QGUA 3G6EA 1JWUD 4DR6Q 1QNUA 3RNUA 4ZRZA 2E2JB 4R4TA 1A8VA 5E4WC 4E6IA 5DM73 2F3VA 3RUZA 1LTGD 1QUQB 4K5WA 3J80L 2JA8H 3W2DA 3M7NA 3HOWH 2B2YA 4B3SQ 2IT1A 2B8GA 5DEHA 2D9UA 4IUQA 1EY9A 2KA7A 3Q8DA 3T4AC 2NWGA 4F7XA 1WTRA 4JI2Q 3TSSA 2EJMA 4DUYQ 2DJFC 2JE6I 4YY3Q 3MA2B 1N34Q 4KHPL 3EFXD 2VUMH 4DV4L 1DOKA 4KY5A 5EBCA 3RZOB 4APVA 2RVLA 3LNNA 4P72A 2L11A 2KHJA 1Q1EA 2DNCA 4L8JA 3NTHA 5IWAL 1LYLA 2KUMA 3D4RA 4HIMA 4OGQC 2KQ3A 4LF8Q 4K6DA 3QOLA 4IFDI 2K5WA 5I6YA 3NWSA 2N88A 5JVG3 1FL0A 1SEBD 1Y14B 2ZJPA 1I3QH 1VQLA 1K8AC 2A74C 2A73B 4OO1I 2NVQB 2R93G 2B63G 1JCKB 1STHA 5EPLA 3NPPA 1B3AA 5AJ3Q 1EQTA 1NBWA 4JC0A 4AIMA 3H09A 3EROA 5C44G 4ZUJA 1CA6A 3C1EA 2P5ZX 5GAEC 2B3GA 4LFCQ 4KN4C 3S1NB 3A5ZB 3KF6A 4NP5A 1XWEA 4AQYL 1I94L 1SYCA 4O2DA 1V9PA 2QW7A 4HJ7A 2D0PA 3E0JA 5EGTA 4GZYC 1GUGA 2AHOB 1X9NA 3TP6A 5CORA 3SK4A 4B08A 1XTDA 1ZKOA 3CCEA 1WFQA 1PZID 4DGZA 1F2ZA 3LGJA 1TWGH 1U4PA 4GN5A 1X54A 1S3OA 2QEXA 1S72A 5IYBG 1Q82C 3S16B 2AQ2B 1I4QA 2DNEA 3NQTA 2A1AA 1VCIA 5LL6X 4DN4M 5IYCG 1HTPA 1PFMA 2HD3A 3D31A 3S9WA 3FKIG 4MIUA 4DR1L 1WTOA 1J6QA 3M85A 3DMUA 1RDPD 5KRUA 1YNJC 4ZQ3A 1O7LA 2EYMA 1N36Q 4GNXC 2CHBD 4X3TA 1JT8A 3J81i 1Y1WB 3PGZA 1HNXQ 1FJGL 1VMCA 1QB5D 2WIIB 4KKTA 1T5EA 4CDCC 2KVMA 4CHTB 1LLRD 2F0OA 1PH5A 2PI2E 1O7ZA 3A7AB 1SJHD 3KLSX 1AP0A 3H15A 2ALYB 3X3NA 3D4DA 1WTQA 2JXMB 2YTXA 1Q12A 3HOXG 3QR8A 2NVTH 4LF4L 1A0IA 1Q8KA 4QUCA 4HSVA 3FMCA 2X6LA 2G9HD 3D6WA 1EZ6A 3CW2C 2I46A 1D6EC 4FXGC 2EPBA 2EJFC 5G3LD 3UDXA 5FLXc 1TU2B 2NN6H 4IUTA 4HMIA 3PUVA 4X3UA 4IJHA 1X32A 2K5QA 3S1QB 4UP9A 3KDFB 2RHSB 4C3JB 5M3MG 1ML0D 2C9OA 2L55A 5M5WB 4KV6A 1N8RC 1YJWA 4IFDJ 1PRTC 2QDBA 2RHQB 2KEEA 4AH6A 4C3IB 4BBSB 1NMFA 3DWQA 1K0SA 2RCNA 3DM1A 4AYBB 2GN5A 4JV5Q 3I4NB 2N8NA 4QF4A 1IBKQ 4CDFC 4A75A 1Y1VB 2JEBI 4A3IB 2HIXA 1O80A 1HZ9A 1Y8OB 3NSWA 4A3CH 1L0YB 2E75C 4OELB 1TS4A 3HOVH 1I5FA 4KY6A 1Z9FA 1HXYD 2J0TD 3I4LA 1M4VA 4LF7L 1E7ZA 3KF8B 2LFNA 5C5LA 1AN8A 4R8IA 1PTOC 4IPCA 2MNAA 5IIFA 3M7GA 1IYUA 1A63A 1SYBA 4A3FB 1C4QA 2E74C 3L7ZC 3DXJC 3NUCA 2JA9A 2VZAA 4OEMB 2ZXRA 4G7ZC 1ENCA 2L4NA 1XXGA 1PA6A 1NUCA 4WRDA 5K5PA 1VQFA 5I9OA 5ELNA 3PMFA 3C2PA 1BNZA 3CRKC 2Z6KA 5C3EG 1N32L 1LTTD 4OL7A 3VA5A 3K81C 4GKKQ 1SMXA 1X6OA 2VB3X 4BY7B 5JPMC 1G6PA 1K0RA 5KNCA 2PQAA 3HOZG 2EYOA 1TWAH 3K7AH 5BR8L 5E3FA 4C1NI 3AB9A 3A8JE 3ND9A 3MAQA 3I4OA 2B2UA 3NP8A 4UP8A 1U4LA 3MHBA 3DEOA 4X64Q 4RGOS 5A2QL 4IJLA 1UE1A 2RA4A 2HCIA 1Y69U 3ZYYX 4L5RC 3J80c 3ICEA 1STYA 2R7FA 1VQEA 5CBEE 1PMRA 2MFIA 4O0AA 1BUVT 2K33A 4FVMA 3PUZA 1U0LA 1YITA 1JWSD 5IGFA 2KENA 4QMGA 1X3QA 5LHY1 2M9VA 5DLQE 1A2TA 2NTSA 3FPPA 2B2WA 5EKIA 1K83B 2PZWA 3JC66 4K0KQ 2RSNA 1H9SA 4PG3A 5M3MH 2DGYA 3I4MB 1D5MC 1YNJD 2JQOA 1LTRD 2AWNA 3RR5A 1U4RA 2E2HB 4N8FA 2EY1A 5C0XI 1RJTA 3AEVA 4BBRB 1LT4D 2B2VC 1DZ1A 1GUOA 3SDZA 2MO1A 4TVAB 2A6EC 1K8MA 2K01A 1CHQD 3GTLH 4IUUA 2BH2A 3HOYG 1HR0Q 4A3EG 1TWHH 1JJCB 4BY1G 4H7BA 4A3BG 1N9WA 2F0FA 5KNBA 3J81c 3H3VC 1UEBA 3KBGA 4A3JH 3GTOB 1HH2P 5M5XH 4A3KG 4J15A 2F1MA 2XSCA 4ZUIA 1UAPA 3HGBA 2NBFA 2OQKA 4CJ2C 4PNYA 4YIJA 3GV3A 3N6RA 2Z0SA 2L9HA 4HN7A 1TVXA 2LSSA 1L1OB 1QE6A 5LMNQ 3STBC 3A5UA 4A3DG 2AQ3B 4JI8L 1N33Q 3ULPA 3H94A 1I4HA 4DAYB 2FXQA 2K52A 5IT9L 1PRTD 1UE6A 4RA8A 1LV9A 1K3RA 4IZ8A 3NBHB 5M3FH 2JA5B 1BOSA 3V96A 4JI6Q 3RZDB 1PH9A 1IL2A 1H9KA 3OSOA 2PZUA 3OW7A 2F03A 2UXDQ 3AMUA 4NXML 4WJ4A 1FGBD 1SE8A 4PV1C 4DKAC 1F2YA 3BS1A 3QO2A 2JA6B 4IFDH 2F0UA 3LWEA 4UP7A 5FO7B 5IGGA 1PYWD 3A55A 3MXGA 1VDZA 2A68D 3S1RH 1SXTA 1I4PA 1PTOD 5FOBB 2F4IA 3BDLA 4OO1H 4UPAA 2L0CA 3KJPA 4XXEA 4KHZA 2DY8A 3SEBA 4RKLA 1QOHA 3PUXA 4LFAL 1TQOA 2D5DA 1J5EL 3IAYA 3S14B 1SAPA 3J81j 4RMFA 5IE8A 4FYDA 2F0EA 1K8GA 2JSOA 4X66L 4GOPC 2XGTA 3EVQA 3K57A 4JI7L 2VQFL 4DR7Q 5ELFA 4LF6L 4NPSA 3TZDA 4LUVA 1LT3D 1PV4A 2AUJD 1YHQA 3FPUB 3I72A 1B9NA 4DV5Q 3I56A 1XMQQ 4BY1H 2K6AA 2JA8B 4A3BH 3HOWB 3IFDA 4LJZC 4H0LC 4DV2Q 5GROA 2E2IH 4PMCA 1D5ZC 3G48A 4DUZL 1X3EA 1YIJA 4QCLA 4LF5Q 2WINB 4NXNL 2ES2A 4DR4L 3S17H 1LT6D 2VUMB 1EFID 1S40A 2F0HA 3OMGA 1EU3A 1ASYA 1P16A 1A62A 4FF3A 3K0XA 2SDFA 4R8NA 4X62Q 2UUCQ 1FGUA 4A3DH 3E5SA 3HZXA 4J1MA 4RHRA 1UEAB 4GKJQ 4XYOA 4POFA 4GNXA 3E9HA 1STNA 1VQAA 1CKMA 1TT2A 2JEAI 3EBEA 2UUBL 2F0SA 5CR3A 1Y8NB 2A6ED 3G7LA 5ELDA 5C4ZA 3M3YH 3W1BA 2Q2IA 3BJUA 2SEBD 4DV6L 2XNAC 2OWOA 4DK1A 1MSHA 2CWPA 3NHHA 1SE3A 3PIOA 3GTPH 1GUTA 5FLMG 4GN3B 1B7YB 3CPFA 1HNWL 2UXCL 3P20A 4LFBL 1NJIC 4A3GG 4B3RQ 4HJAA 3TEHB 1TWCH 1IL8A 5E1FA 3SK8A 3STBD 1PH4A 2Y0SB 4JI5L 1TWGB 2XRQD 5J3BA 4LAAA 2UXBQ 5CV6A 5C6AA 5CGKA 1JJ2A 3A54A 3VR3A 2EZVA 4L6TB 2K03A 1S5ED 1TIID 2VY3A 1YVCA 1HJPA 2PO4A 3EQLC 1BF4A 1HRJA 4RGTA 2VNUD 1U5KA 1AZQA 1ICWA 1CTMA 5EKLA 3CRLC 2EDGA 3HKZG 4QJFA 4P74A 2F0MA 5CV8A 3PF5A 3OIQA 1YZ6A 2YTYA 5FLXL 2R61A 5IP7H 4CBVA 5IYDG 4KHPQ 1AW7A 2K05A 2WAQB 3GTKH 2F0NA 2IHFA 2R7DA 2NVTB 5BN3A 5M5YH 5IWAQ 1SNMA 5J39A 5JAVA 1V8QA 1EZ8A 3IKJA 1B50A 2F0VA 3R2IA 3RLNA 4U68A 1XMOL 1BCPD 3A8IE 1SNDA 1O7YA 4N9PA 2HQLA 1LTBD 3VDYA 2M2LA 2CW0C 4LWCA 2WAQE 3RLOA 4PMWA 5ELEA 1BXTA 4YHHL 1VQBA 2UU9L 4DV0L 2VW9A 5J1ZA 3PO3H 1QVGA 1EYDA 4C3HB 3EN2A 5K36G 1Q81C 3CF5A 1GHJA 1QJOA 4AQYQ 1I94Q 2JA7H 3OOCA 4A3MG 3HOVB 1VQJA 3OWEB 3RN2A 3LX0A 2I5LX 1G2SA 4ZAIA 5C0XH 4KI0A 4OX9L 1SYDA 1FNVA 2M00A 2ZXPA 3QWNA 2Z9HA 1AEXA 4IUNA 4JG2A 2KCCA 3OPOA 1EQRA 1QWYA 4A93H 1CZWA 3SK5A 3EA6A 3OYYA 1I6HH 1IBLL 1XPOA 1X3GA 3I70A 2B2VA 5GQOA 5H1SE 4MTKA 4DR1Q 2SOBA 1I50H 1VQDA 4FF1A 4MN3A 2R7ZG 3M4OH 4R4OA 2BA1A 4KN7C 3J7AF 1NCVA 4K2KA 3ITPA 1TWAB 3FHWA 3K7AB 1FJGQ 2H4OA 1F9PA 5EQ0A 2I07B 1PXUA 1V1PA 1F2LA 4G57A 4B9WA 1U4MA 1LACA 1SLJA 4JPBW 4DAYA 4R9WA 1HQRD 1U9RA 3DHQA 3NBHA 5CV5A 4LF4Q 1UWVA 4DV3Q 3S24A 1PLFA 3ERSX 3SGIA 1W3SA 4DV7L 1OXTA 2EYPA 2N55A 4KK7A 3T56B 3PUYA 5ELBA 1KNAA 3J81L 1QNKA 4ABNA 2D0OA 2Z1CA 3H0GH 4ZK9B 1II3A 3P7JA 5FJ8G 3PUWA 5GAGC 5IODA 4G4KA 4WORA 2LMCB 3TS2A 3OTOQ 2K5NA 1PH8A 2ICIA 1S4ZA 2ZM6L 1G51A 3S1MH 3G6JB 4QB4A 5GAHC 2WV6D 1VQMA 4A3MH 1TWHB 1CM9A 1IW7D 3OHXC 1CUKA 1EIFA 4A3JB 2XIWA 4LF7Q 2QKIC 2BCOA 1CA5A 4CKEA 1SMYD 1EYCA 1HZBA 4GOPA 3BYTB 4ME3A 5JJZA 2K14A 1S5BD 3A74A 1VQOA 1S5FD 3U58A 4MZ9A 2CW0D 3EJIA 1XNRL 4PZ8A 3I2ZA 2L1BA 3M4PA 2AUKA 4H13C 4R4CA 1KC8C 3NQIA 2YYZA 3D8GA 5M3FB 1KL9A 1N32Q 3CC4A 1SE2A 1LO5D 2IY5B 1CT1D 5FO8B 1LM0A 4UDUC 2V4DA 4DR6L 4ID6A 5JVH3 1XYIA 1E2VA 1I4RA 1GXDC 4Y52H 1RL2A 1A3TA 1WCMG 1CKNA 1G291 2GVAA 1PDQA 3R3OA 1UNSA 3BYYB 1PFSA 5KGUA 3CCLA 5C4XG 1HPCA 4KKSA 4F8MA 3R93A 2SNSA 4RH6A 5T1IA 1E2WA 1JR0D 5KYIA 5KYLA 3GTJH 3A8KE 1PH7A 4JI4L 1Z47A 2CWAA 4H02A 2NVXH 4GN4B 4J6HA 1CHPD 3CC2A 2R93H 5HURA 4FP5D 2B63H 5JEAG 3G4SA 3AFQA 2K32A 4PMBA 3HEJA 5C4HA 1WYDA 5JJKA 5C44H 3L9AX 2N3SA 3HFZB 5CV4A 4YCVA 2IX0A 2KHIA 1W2BA 1C0AA 2ENBA 1RCVD 3PO2B 5I9PA 1V1QA 2B2TC 4BA1I 4BY1B 4A3BB 1KDCA 2PNRC 1NR4A 3UE0A 3K5OA 4DR5L 1LABA 2E2IB 4LFCL 1GUSA 3E0EA 2MP1A 3UDIA 2BDNA 3AU7A 4NDXA 1C8CA 4AYBE 3S17B 5IYBH 2G5DA 4DV1L 1PHJA 2JYOA 1ZEQX 4DF7A 4IPHA 3SHLA 2WB1B 3U9SA 2UUAL 1H9JA 1CI3M 5IYCH 3CU7A 1IZ6A 4A3DB 3FKIH 4DAPA 4QUFA 3Q6SA 3H6MA 2EXZA 1ASZA 3I55A 1KLUD 4JI8Q 1HFNA 1PH1A 1EYAA 3BVMA 1VQHA 2EQSA 1TR5A 2Q2UA 2R92G 3GQBA 1XX8A 2WB1E 2LXJA 3GDEA 1WCMH 3M3YB 2DUDA 3VYTA 2H1EA 1AE3A 3C1FA 4NXMQ 4Y7NH 1IKMA 4J8QA 1VQKA 5FO9B 4OWXB 4X3SA 4HIOA 2HT1A 3H3VI 5C4XH 2HCCA 5FKAC 5HGTA 3J7A5 2EYFA 3HOXH 3JAME 1B3QA 3GTPB 4KTAA 1JICA 4C2MH 1EWIA 2L12A 2EIFA 1Y1WG 4LFAQ 3HOUG 4C56C 1B70B 1OTCA 1J5EQ 1STEA 1B2TA 5JEAH 4X3KA 3FP9A 1EQVA 4S3SA 1D1IA 4M8AA 2G9DA 4DR3L 1PYBA 2QDLA 5C4JH 3GTMH 4X66Q 4UY8C 4RGNA 1TS3A 2OQ0A 4P71A 4ULLA 2F4VL 2SNMA 4JI7Q 2VQFQ 4FF4A 3S2HH 2WACA 3UDFA 2DY7A 1PH3A 4IUPA 4LF6Q 1CFMA 3MXNB 2MQHA 2R6GA 3MXUA 1MKHA 3KUPA 3CHBD 4XQNA 3F2CA 4JBWA 4H44C 1JJGA 2OXPA 1S5CD 1X3PA 3Q22A 2HHHL 2PNHA 4V0BA 4C3JG 5D65A 2IPKD 4RHSA 4LNQA 3GTQH 5I6WA 5LL6S 2Z6BA 4C3IG 4BBSG 3HRZC 3CPWA 5JPNC 1L0XB 4DUZQ 4NXNQ 5G3LF 5BN4A 1L1OC 1H9MA 4K5VA 1XNQL 5CMDA 3I4NG 2KEDA 3GTKB 4DR4Q 1AH9A 3P1HA 1PVOA 2FMCA 1JOOA 1NE3A 2K5VA 1QG7A 4A3IG 5M5YB 1VQIA 2F0LA 2Q2TA 1QCBD 1W6JA 1QUQA 5C3EH 1W6KA 1BBUA 3CCSA 2YU9H 4OWTB 4OXPA 4HCEA 3O13A 2K7VA 4BWGB 1AE2A 3MFYA 3TDQA 2R92H 1MGSA 3HOZH 1ESRA 4CJ1B 3TRZA 2VQEL 1M8AA 4A3FG 5ISRA 2Z4HA 3MZ5A 3SVMA 4F88A 4RAUC 2UUBQ 2NTTA 4A4IA 2IWHA 3ZJYC 1EIYB 3PO3B 4BS9A 4DV6Q 3SR1A 4M1UB 4JI3Q 4ZKCB 1GUNA 3BZDB 1LUZA 2JA7B 5FK9C 4BY7G 4R4IA 3M4YA 3HOUH 2MJ8A 1RTNA 3HP3A 2EOTA 3PIP3 2CCZA 1HNWQ 2H5XA 2UXCQ 4LFBQ 4XYQA 1FD7D 1EL0A 4X64L 4K14A 1JORA 3BVGA 3KJOA 4YWKA 2LY7A 4RGMA 5ELCA 4TKOB 4JI5Q 1LTSD 1SR3A 3QB3A 2ATWA 4I65A 4A93B 3KF6B 1I6HB 1TWFH 4HIKA 3VR4A 4DNIA 1L2FA 1VMPA 5I2YA 1Q8IA 3GP7A 3JAMi 3HOYH 1CQVA 1Y8PB 4A3EH 1I50B 3U4ZA 2LKVA 5CC4A 3M4OB 1C48A 3Q24A 1ILPA 3OMCA 4A3KH 5C0XJ 2O2LD 1A6XA 1MIUA 2BE5C 4B3TL 4XQQA 3CCJA 2KHSA 2EXDA 3SE0A 4R1JA 4YCWA 4JI0L 1RHPA 4DXGA 2B39A 1E22A 5IP9G 4BBRG 1F2MA 1UUPA 2PI2A 1QZHA 2PZTA 4CGYB 1YBYA 2PMZB 2CQOA 4A3LG 1GHKA 4ALPA 2HUGA 1WI5A 2MUYA 1I3QB 1XMOQ 1VQ6A 1DYQA 4IURA 2XVSA 2WFWA 2ZXOA 4N9TA 1PTOH 3VYSA 2O5IC 1SSOA 4UAIA 1WTPA 3K8AA 3H0GB 1EOTA 4MNOA 5C3WA 3K5NA 1NAPA 4BXXG 3DWPA 3F1ZA 2L15A 1SYEA 4YHHQ 2PMZE 2XWBB 4DV0Q 3L3OC 2F0KA 3SK6A 3BDOA 1YNXA 3CCMA 3S1MB 1D2BA 4TSSA 2E2DC 3T13A 2O4XA 4YWLA 4BY7H 3EIVA 4A3MB 2JA5G 2AWOA 1IYVA 4DAMA 2B8FA 3QJYA 3PIPA 1AFPA 1NMGA 4HIDA 4JCVE 2Q8IB 5EBDA 1OXSC 3KDFA 4CDDC 3I73A 3F2DA 1EEID 4DK0A 4OX9Q 2JA6G 4KJNA 3S15H 4I7ZC 4XIGS 4K8IA 4FNFA 4QY7A 1BQQT 2C35B 3HKSA 4FXDA 1VQGA 3W3AA 4RCOA 1KAWA 1ET9A 1B4OA 1DM0B 2ZJQA 2CVRA 5CV9A 1B8AA 2NZ1D 2B2TA 5CV7A 3Q0AA 2VB2X 2Y0SE 3KF8A 4LF9L 1J9OA 5KEEA 1PYSB 2E2HH 1STAA 1R4PB 4KMUC 2N78A 2PCFB 2NUCA 1IHZA 1K28A 3CAMA 1STBA 1PFNA 2KJXA 3PCOB 1K73C 4DV5L 4DV4Q 1CQFA 1L0WA 1D7QA 3DLLA 1CK1A 3QG1A 2XN9C 4A3LH 1VF5C 1CKOA 1V43A 3FEWX 2HDMA 4IN3A 1KRTA 3GTJB 1FYCA 1B9MA 1EY5A 2AKWB 2NVXB 2PQAB 1Z6HA 2A69C 4DV7Q 1TY0A 3GTGH 2RSOA 2B63B 2R93B 3H3VH 3J80E 3WWVA 3J7ZC 4ZYSA 2OTJA 5CYUA 3MEHA 2RF4A 3T1HL 1EY4A 5C44B 3I8ZA 4B3ML 3I91A 2ASBA 1C9OA 1RD9D 2ZJRA 4EQ5A 3PQIA 3SXHA 2OTLA 2K5DA 5D14A 5IGBA 3F8TA 3T53B 3FVQA 2BE5D 4QL5A 3UE1A 4EQNA 4YWMA 1CSPA 3K80C 5FLMH 2ZM6Q 1XPRA 1A2UA 4EQOA 2ID0A 1XJVA 3B6YA 1PFBA 3JAMc 3S2DH 3RD4A 2OF1A 5EAYA 3V05A 4A3GH 5J22A 1ET6A 1B44D 1H9SB 4NMZA 1SYGA 4JK1C 4G7HC 4RKBA 4JBKA 4FXKC 1EWHA 3TREA 3G71A 5JJIA 3ER0A 1SROA 1SE4A 4JYAL 1MSGA 1VQCA 1H9RA 2PW7A 3BG3A 3FKIB 4MTNA 3NENA 1QVFA 1BDOA 3GO5A 3S14H 1VF7A 1XNRQ 3KK7A 3H91A 3PF4A 4DFAA 1HUNA 4HJ9A 4HTHA 3T16A 2Y0SG 3K59A 1IBML 2CFMA 4IQZA 1WCMB 1KHIA 1EY6A 4DR2L 1CSQA 4FDBA 4Y7NB 2EVBA 2N49A 4JBJA 5IYDH 2KECA 3RLFA 5ELOA 4LUZA 3C3LA 5C4XB 2RBMA 1EY0A 1L1OA 3HOXB 2MO0A 4CKBA 1O78A 3VR6A 1BVSA 2F0PA 2LXKA 4JVZA 4C2MB 2F3IA 4IPGA 2HIVA 1YI2A 1EEFD 1EU4A 3T1YL 1OO9B 1WTWA 2A19A 5I4DA 4JI4Q 5LMUL 1HNZL 1RKNA 5NUCA 1NTGA 2FJ2A 5M3MB 3M4QA 2GA4B 3VA7A 4DNTB 1JC7A 1E0BA 1EQQA 3DWAA 4RCNA 5C4JB 3GTMB 2WAQG 1KDAA 1D8LA 4XT1B 2QF7A 3TBIB 5C3XA 3ONAB 3RMHA 1QVCA 3CKIB 1LTLA 2I5HA
chains in the Genus database with same CATH topology
5IP9H 5IYCH 2QA4A 1IZ6A 4BBRH 3FKIH 2Z6KC 4EX5A 4UPAA 3KLWA 1XMQL 3KJPA 1GKHA 2VL6A 4KHZA 3K7UC 3CXCA 3CQZH 1ASZA 3PUXA 4JI8Q 3I55A 4DV2L 2K50A 4A76A 3U4VA 4PZ7A 4LFAL 2JA8G 1J5EL 2NN6G 2V1CC 3HOWG 4JBMA 1E1TA 1PH1A 3J81j 4JOIA 1P8LA 3GTOH 4RMFA 1VQHA 2EQSA 4JI1L 2BH8A 5JEAJ 3CCUA 3T1YQ 1Q7YC 5IE8A 3L0OA 1VQ8A 2Q2UA 4LF5L 2R92G 3U50C 4DR5Q 2D62A 2WB1E 2LXJA 2XTIA 5LMUQ 3PV0A 3GDEA 1WCMH 4X66L 4GOPC 3S1RH 1K8GA 2DUDA 1HNZQ 2E5LL 1AE3A 2K75A 2XGTA 2ZTCA 4Y7NH 4NXMQ 2VUMG 1VQKA 1E24A 4JI7L 1UE5A 3J80i 4X62L 1SN8A 2VQFL 2UUCL 4BXXH 4DR7Q 5E7NA 4OWXB 4DV1Q 4HIOA 1VQ5A 4LF6L 5C4XH 4NPSA 2HT1A 3H3VI 1T9HA 2NVYH 3J7A5 1YEZA 1VS0A 3HOXH 2UUAQ 3MEFA 4LUVA 3CMEA 1PV4A 1YHQA 4A3CG 4C2MH 1C7YA 1EWIA 3I56A 4DV5Q 1VQ4A 1XMQQ 4BY1H 3HOVG 2EIFA 1Y1WG 4A3BH 4GKJL 2Q2HA 3BZCA 2JA5H 4P75A 4LFAQ 4DV2Q 3HOUG 2R7ZH 1B70B 1OTCA 1J5EQ 5GROA 1KXLA 4X65L 4L5QA 4LUOA 3RZDH 2E2IH 3FP9A 4KLKA 2OCEA 3G48A 5IY0A 4NB3A 4JI1Q 4DUZL 1X3EA 3H0GG 1YIJA 4LF5Q 4NXNL 4WJ3M 5GADC 2ES2A 4DR4L 3S17H 4DR3L 1PYBA 5C4JH 2JA6H 3GTMH 4X66Q 2E5LQ 5BR8Q 1JMCA 3W5OA 1S40A 4UY8C 2OQ0A 3KYHC 4P71A 5IT9c 1ASYA 2F4VL 1P16A 1A62A 4IO9A 3K0XA 2IX1A 4JI7Q 1VQPA 4X62Q 2VQFQ 3S2HH 1R9TH 2UUCQ 1FGUA 4POGA 3UDFA 4A3DH 4R4QA 4DK6C 1PH3A 4LF6Q 3W1GA 3MXNB 3AYHB 4B3SL 2MQHA 2R6GA 1MJEA 1MKHA 4L5SA 1SRUA 4X6AH 4IPDA 3F2CA 4JBWA 4B3RL 3CCRA 1JJGA 4GKJQ 4GNXB 4POFA 4GNXA 3E9HA 4JI2L 3ULJA 2I0QA 2K4KA 1VQAA 1CKMA 2PNHA 4YY3L 4DUYL 2HHHL 2JEAI 2UXBL 3EBEA 1N34L 2UUBL 1Q1BA 4X65Q 3TS0A 1OXXK 1X3FA 4LNQA 1NY4A 1VQ9A 4QGUA 3W1BA 3GTQH 3M3YH 4BBSG 3G6EA 2Q2IA 3BJUA 3CPWA 4DUZQ 4DV6L 3RNUA 4DR6Q 5FJ8H 4NXNQ 1O7IA 1SFOH 1L1OC 2OWOA 3I4NG 1XNQL 4DR3Q 1BBWA 4DR4Q 1AH9A 2CWPA 4R4TA 4LF8L 1PVOA 4DV3L 4GLXA 1NE3A 2K5VA 3PIOA 1A8VA 4A3IG 2F4VQ 3GTPH 1QZGA 1VQIA 2Q2TA 5FLMG 4GN3B 1QUQB 1QUQA 1B7YB 2JA8H 1BKBA 3CPFA 1IYJB 2ZTEA 3M7NA 5C3EH 3HOWH 1HNWL 1BBUA 3CCSA 4DK3C 4LW1A 2YU9H 4B3SQ 4OWTB 3GD7A 2IT1A 4OXPA 3I7FA 2UXCL 5AJ3L 4LFBL 1NJIC 4A3GG 1AE2A 4B3RQ 4GS3A 4HJAA 3TEHB 4QQBX 2R92H 1TWCH 3HOZH 3STBD 1PH4A 3Q8DA 2F52A 3TRZA 2VQEL 4JI5L 3TQYA 4JI2Q 4XTCS 4YY3Q 2JE6I 5J3BA 3F2BA 4DUYQ 4A3FG 2HHHQ 2UXBQ 1M90C 1JJ2A 1N34Q 2UUBQ 4KHPL 2VUMH 4A4IA 3OTOL 4DV4L 3ZJYC 4APVA 4P72A 1EIYB 4C3HH 3DM3A 2KHJA 1Q1EA 1IXRA 2VY3A 4DV6Q 1YVCA 5IWAL 1LYLA 1HJPA 4JI3Q 4HIMA 1XNQQ 2KBNA 4LF8Q 4IOAA 1X56A 1LUZA 1EYGA 1U5KA 4IFDI 2VNUD 1OXVA 4JOIC 1FL0A 1Y14B 4BY7G 4R4IA 1EFWA 2ZJPA 3HOUH 1I3QH 5HGQA 1VQLA 1K8AC 3HKZG 1HNWQ 4A3JG 2CCZA 4QJFA 1M1KC 4OO1I 2R93G 4P74A 2B63G 2BA0A 2H5XA 2UXCQ 5AJ3Q 4LFBQ 3PF5A 1NBWA 1YHBA 4JC0A 4AIMA 1YZ6A 4X64L 2YTYA 5C44G 5IP7H 3KJOA 4YWKA 1X65A 2VQEQ 5GAEC 4JI5Q 2B3GA 5IYDG 4LFCQ 1SR3A 3PSIA 4KHPQ 2E2JH 1FVIA 2IHFA 2AMCB 4DPGA 3GTKH 2ATWA 3A5ZB 3UDGA 3KF6B 3KF6A 2R7DA 4AQYL 1I94L 4O2DA 5M5YH 1TWFH 4HIKA 1V9PA 5IWAQ 4HJ7A 1N36L 2D0PA 1GVPA 4DNIA 1L2FA 2AHOB 1HNXL 1X9NA 1JE5A 3JAMi 5M3FG 3HOYH 3RLNA 4A3EH 1XMOL 3U4ZA 1VQNA 2QGQA 3L2PA 1XTDA 3CCEA 1WFQA 4A3KH 5C0XJ 3LGJA 2GVBA 2HQLA 3M9BA 3VDYA 1TWGH 1MIUA 4GN5A 4LWCA 2WAQE 3RLOA 1X54A 1S3OA 4OONA 4B3TL 4PMWA 1DGSA 2QEXA 3CCJA 1S72A 1RIPA 2EXDA 5IYBG 1Q82C 4IFDG 3RZOH 4YHHL 1VQBA 4R1JA 4YCWA 2UU9L 4JI0L 2A1AA 4DV0L 1VCIA 2VW9A 5JJLA 3PO3H 1QVGA 1E22A 5IP9G 5IYCG 4OO1G 3D31A 3EN2A 3FKIG 4BBRG 5K36G 2PI2A 1Q81C 3CF5A 1QZHA 4DR1L 3E9IA 1J6QA 3M85A 4AQYQ 1I94Q 1YBYA 2CQOA 4A3LG 2JA7H 1N36Q 4GNXC 1JT8A 3J81i 4A3MG 4ALPA 1VQJA 3PGZA 1HNXQ 1WI5A 1E3PA 4HJ5A 1PH6A 3RN2A 1FJGL 2NVQH 1XMOQ 2I5LX 1VQ6A 1EUJA 3CCVA 4KI0A 4GLVB 4OX9L 2WFWA 1K9MC 1KRSA 2K5HA 3K8AA 1PH5A 4MNOA 4JV5L 2PI2E 4B3TQ 4JG2A 4BXXG 3F1ZA 2L15A 4BA2I 1IBKL 1EQRA 3H15A 3S1NH 4AYBG 4YHHQ 2ALYB 2PMZE 4A93H 4JI0Q 2YTXA 1Q12A 1HZCA 3OYYA 3HOXG 4DV0Q 2NVTH 3PO2G 1I6HH 2B29A 1IBLL 4LF4L 1XPOA 1YNXA 1A0IA 1Q8KA 1Y1VG 3CCMA 1X3GA 5GQOA 4YWLA 3CW2C 5H1SE 4DR1Q 4BY7H 2ZTDA 3EIVA 2JA5G 2AWOA 3UDXA 1I50H 4DAMA 4P73A 1VQDA 5FLXc 3PIPA 2R7ZG 3KOJA 4R4OA 1NMGA 2BA1A 3PUVA 4JCVE 4HIDA 3M4OH 5HY6A 4IJHA 3FHWA 1OXSC 1FJGQ 4L5TA 3KDFB 2RHSB 3KDFA 4UP9A 5M3MG 1N8RC 3F2DA 1YJWA 4OX9Q 2JA6G 4IFDJ 3S16H 2RHQB 3S15H 4AH6A 2WB1G 1NMFA 4XIGS 4QY7A 2RCNA 2JK8A 2GN5A 2C35B 2NZOA 3A0JA 1SLJA 3HKSA 1VQGA 2A8VA 4JV5Q 2N8NA 3BZKA 3CMAA 1HR0W 1IBKQ 1KAWA 4A75A 2JEBI 1PH2A 2HIXA 1HZ9A 2ZJQA 2NZHA 4A3CH 4GKKL 1WOCA 4LF4Q 1UWVA 4DV3Q 1H95A 1B8AA 3S24A 3ERSX 1JB7A 3SGIA 1I5FA 1W3SA 1OXTA 1Z9FA 4DV7L 1Y1WH 3HOVH 4LF7L 1E7ZA 3KF8B 2Y0SE 4LF9L 4IPCA 3PUYA 2MNAA 1X55A 1PYSB 2E2HH 1A63A 4TQUS 2D0OA 3H0GH 3L7ZC 2JA9A 5FJ8G 2VZAA 3PUWA 5GAGC 5LMNW 2N78A 4YCUA 2VS1A 3CAMA 3PCOB 2YTVA 1K73C 3D0FA 4DV5L 3TS2A 3OTOQ 2K5NA 4DV4Q 1PH8A 1L0WA 1PA6A 1D7QA 2ZM6L 1G51A 3DLLA 3S1MH 1VQFA 5ELNA 4A3LH 1CKOA 5GAHC 2Z6KA 1V43A 4PZ6A 5C3EG 1N32L 4OWWB 1VQMA 4A3MH 1KRTA 2AKWB 3K81C 4K0KL 1MJCA 2IHEA 1SMXA 1X6OA 4GKKQ 1G6PA 1K0RA 4HJ8A 2PQAB 2PQAA 3HOZG 1CUKA 1TWAH 1EIFA 4DV7Q 3KFUA 3GTGH 3K7AH 3CC7A 4LF7Q 3H3VH 3S1QH 4C3JH 5BR8L 2KCTA 4LF9Q 3WWVA 3J7ZC 5M5WH 2OTJA 3I4MG 2RF4A 3T1HL 2ASBA 4B3ML 3I4OA 1C9OA 1EOVA 4UP8A 4C3IH 2ZJRA 4BBSH 1HZBA 4GOPB 4GOPA 1WJJA 4X64Q 3AQQA 4ME3A 4EQ5A 2OTLA 2K14A 4A93G 3CP0A 4IJLA 3I4NH 3F8TA 1UE1A 3A74A 1VQOA 4L5RC 3PO2H 3J80c 3U58A 3ICEA 2R7FA 1VQEA 1Y1VH 4MZ9A 1XNRL 4PZ8A 1HR0L 4A3IH 3I2ZA 2MFIA 4QL5A 1KIXA 4O0AA 3M4PA 3UE1A 3HKZE 1CSPA 3K80C 4YWMA 5FLMH 2ZM6Q 3PUZA 1XPRA 1U0LA 4R4CA 1KC8C 1YITA 2ID0A 2YYZA 1XJVA 2KENA 3B6YA 3JAMc 3S2DH 1KL9A 1N32Q 5DLQE 3CC4A 5EAYA 2IY5B 4A3GH 4K0KQ 3JC66 1LM0A 4DR6L 4PG3A 5M3MH 2DGYA 5IP7G 4JBKA 4Y52H 3TREA 2JQOA 1RL2A 2AWNA 3G71A 4A3FH 1WCMG 1CKNB 1CKNA 1G291 2GVAA 3ER0A 3RR5A 1SROA 1KQSA 5JJIA 3ULLA 4JYAL 3T1HQ 1VQCA 4B3MQ 2YV5A 5LMNL 1PFSA 3AFPA 2E8GA 5C0XI 1N33L 3CCLA 2CKZB 5C4XG 3AEVA 2UU9Q 4MTNA 3NENA 1QVFA 2KCMA 2MO1A 4TVAB 4QIWE 1UE7A 1YJ9A 3GO5A 3GTLH 3S14H 2BH2A 3HOYG 1XNRQ 1HR0Q 4A3EG 1TWHH 3GTJH 1JJCB 4BY1G 4JI6L 4A3BG 1VQ7A 1PH7A 4JI4L 1N9WA 3PF4A 3J81c 1Z47A 2CWAA 4H02A 2NVXH 1UEBA 4HJ9A 4GN4B 4A3JH 2UXDL 1HH2P 3CC2A 5M5XH 1E1OA 2Y0SG 4A3KG 2B63H 1XPUA 4J15A 1HZAA 2R93H 5JEAG 3G4SA 3AFQA 1IBML 1GO3E 3NEMA 1Q46A 5JJKA 2CFMA 1WYDA 4RG1A 5C44H 1KHIA 2N3SA 2OQKA 4GLAC 4JI3L 1CSQA 2NN6I 4DR2L 3RN5A 4FDBA 2I5MX 2N49A 4JBJA 5IYDH 3HFZB 1TXYA 4YCVA 5ELOA 3RLFA 3PO3G 4LUZA 2Z0SA 2IX0A 2KHIA 1W2BA 4JYAQ 2LSSA 1L1OB 1L1OA 5LMNQ 1Q86C 3STBC 1C0AA 2MO0A 2WP8J 3A5UA 4A3DG 1OXUA 4JI8L 1N33Q 1BVSA 2LXKA 3IRBA 3ULPA 4DAYB 4IOCA 2FXQA 1V1QA 2K52A 2JA7G 1UE6A 2F3IA 4BA1I 4IPGA 1K3RA 2HIVA 1GD7A 3NBHB 1YI2A 3CCQA 1YHAA 3NELA 1IBLQ 5M3FH 3UE0A 3T1YL 2A19A 4DR5L 4JI6Q 1K83H 5C0XG 4JI4Q 5LMUL 1PH9A 1HNZL 4LFCL 1IL2A 1NTGA 1YJNA 2JJQA 2UXDQ 3E0EA 4NXML 3I4MH 3UDIA 4WJ4A 1KD1C 3M4QA 1SE8A 3OW2A 4DR7L 4DKAC 4AYBE 3BU2A 1EQQA 1IBMQ 3CD6A 5IYBH 4DV1L 1PHJA 2WAQG 4UP7A 1D8LA 1GM5A 4IPHA 4DR2Q 1QVCA 2UUAL 1LTLA 2I5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IP9 H;  5IYC H;  2QA4 A;  1IZ6 A;  4BBR H;  3FKI H;  2Z6K C;  4EX5 A;  4UPA A;  3KLW A;  1XMQ L;  3KJP A;  1GKH A;  2VL6 A;  4KHZ A;  3K7U C;  3CXC A;  3CQZ H;  1ASZ A;  3PUX A;  4JI8 Q;  3I55 A;  4DV2 L;  2K50 A;  4A76 A;  3U4V A;  4PZ7 A;  4LFA L;  2JA8 G;  1J5E L;  2NN6 G;  2V1C C;  3HOW G;  4JBM A;  1E1T A;  1PH1 A;  3J81 j;  4JOI A;  1P8L A;  3GTO H;  4RMF A;  1VQH A;  2EQS A;  4JI1 L;  2BH8 A;  5JEA J;  3CCU A;  3T1Y Q;  1Q7Y C;  5IE8 A;  3L0O A;  1VQ8 A;  2Q2U A;  4LF5 L;  2R92 G;  3U50 C;  4DR5 Q;  2D62 A;  2WB1 E;  2LXJ A;  2XTI A;  5LMU Q;  3PV0 A;  3GDE A;  1WCM H;  4X66 L;  4GOP C;  3S1R H;  1K8G A;  2DUD A;  1HNZ Q;  2E5L L;  1AE3 A;  2K75 A;  2XGT A;  2ZTC A;  4Y7N H;  4NXM Q;  2VUM G;  1VQK A;  1E24 A;  4JI7 L;  1UE5 A;  3J80 i;  4X62 L;  1SN8 A;  2VQF L;  2UUC L;  4BXX H;  4DR7 Q;  5E7N A;  4OWX B;  4DV1 Q;  4HIO A;  1VQ5 A;  4LF6 L;  5C4X H;  4NPS A;  2HT1 A;  3H3V I;  1T9H A;  2NVY H;  3J7A 5;  1YEZ A;  1VS0 A;  3HOX H;  2UUA Q;  3MEF A;  4LUV A;  3CME A;  1PV4 A;  1YHQ A;  4A3C G;  4C2M H;  1C7Y A;  1EWI A;  3I56 A;  4DV5 Q;  1VQ4 A;  1XMQ Q;  4BY1 H;  3HOV G;  2EIF A;  1Y1W G;  4A3B H;  4GKJ L;  2Q2H A;  3BZC A;  2JA5 H;  4P75 A;  4LFA Q;  4DV2 Q;  3HOU G;  2R7Z H;  1B70 B;  1OTC A;  1J5E Q;  5GRO A;  1KXL A;  4X65 L;  4L5Q A;  4LUO A;  3RZD H;  2E2I H;  3FP9 A;  4KLK A;  2OCE A;  3G48 A;  5IY0 A;  4NB3 A;  4JI1 Q;  4DUZ L;  1X3E A;  3H0G G;  1YIJ A;  4LF5 Q;  4NXN L;  4WJ3 M;  5GAD C;  2ES2 A;  4DR4 L;  3S17 H;  4DR3 L;  1PYB A;  5C4J H;  2JA6 H;  3GTM H;  4X66 Q;  2E5L Q;  5BR8 Q;  1JMC A;  3W5O A;  1S40 A;  4UY8 C;  2OQ0 A;  3KYH C;  4P71 A;  5IT9 c;  1ASY A;  2F4V L;  1P16 A;  1A62 A;  4IO9 A;  3K0X A;  2IX1 A;  4JI7 Q;  1VQP A;  4X62 Q;  2VQF Q;  3S2H H;  1R9T H;  2UUC Q;  1FGU A;  4POG A;  3UDF A;  4A3D H;  4R4Q A;  4DK6 C;  1PH3 A;  4LF6 Q;  3W1G A;  3MXN B;  3AYH B;  4B3S L;  2MQH A;  2R6G A;  1MJE A;  1MKH A;  4L5S A;  1SRU A;  4X6A H;  4IPD A;  3F2C A;  4JBW A;  4B3R L;  3CCR A;  1JJG A;  4GKJ Q;  4GNX B;  4POF A;  4GNX A;  3E9H A;  4JI2 L;  3ULJ A;  2I0Q A;  2K4K A;  1VQA A;  1CKM A;  2PNH A;  4YY3 L;  4DUY L;  2HHH L;  2JEA I;  2UXB L;  3EBE A;  1N34 L;  2UUB L;  1Q1B A;  4X65 Q;  3TS0 A;  1OXX K;  1X3F A;  4LNQ A;  1NY4 A;  1VQ9 A;  4QGU A;  3W1B A;  3GTQ H;  3M3Y H;  4BBS G;  3G6E A;  2Q2I A;  3BJU A;  3CPW A;  4DUZ Q;  4DV6 L;  3RNU A;  4DR6 Q;  5FJ8 H;  4NXN Q;  1O7I A;  1SFO H;  1L1O C;  2OWO A;  3I4N G;  1XNQ L;  4DR3 Q;  1BBW A;  4DR4 Q;  1AH9 A;  2CWP A;  4R4T A;  4LF8 L;  1PVO A;  4DV3 L;  4GLX A;  1NE3 A;  2K5V A;  3PIO A;  1A8V A;  4A3I G;  2F4V Q;  3GTP H;  1QZG A;  1VQI A;  2Q2T A;  5FLM G;  4GN3 B;  1QUQ B;  1QUQ A;  1B7Y B;  2JA8 H;  1BKB A;  3CPF A;  1IYJ B;  2ZTE A;  3M7N A;  5C3E H;  3HOW H;  1HNW L;  1BBU A;  3CCS A;  4DK3 C;  4LW1 A;  2YU9 H;  4B3S Q;  4OWT B;  3GD7 A;  2IT1 A;  4OXP A;  3I7F A;  2UXC L;  5AJ3 L;  4LFB L;  1NJI C;  4A3G G;  1AE2 A;  4B3R Q;  4GS3 A;  4HJA A;  3TEH B;  4QQB X;  2R92 H;  1TWC H;  3HOZ H;  3STB D;  1PH4 A;  3Q8D A;  2F52 A;  3TRZ A;  2VQE L;  4JI5 L;  3TQY A;  4JI2 Q;  4XTC S;  4YY3 Q;  2JE6 I;  5J3B A;  3F2B A;  4DUY Q;  4A3F G;  2HHH Q;  2UXB Q;  1M90 C;  1JJ2 A;  1N34 Q;  2UUB Q;  4KHP L;  2VUM H;  4A4I A;  3OTO L;  4DV4 L;  3ZJY C;  4APV A;  4P72 A;  1EIY B;  4C3H H;  3DM3 A;  2KHJ A;  1Q1E A;  1IXR A;  2VY3 A;  4DV6 Q;  1YVC A;  5IWA L;  1LYL A;  1HJP A;  4JI3 Q;  4HIM A;  1XNQ Q;  2KBN A;  4LF8 Q;  4IOA A;  1X56 A;  1LUZ A;  1EYG A;  1U5K A;  4IFD I;  2VNU D;  1OXV A;  4JOI C;  1FL0 A;  1Y14 B;  4BY7 G;  4R4I A;  1EFW A;  2ZJP A;  3HOU H;  1I3Q H;  5HGQ A;  1VQL A;  1K8A C;  3HKZ G;  1HNW Q;  4A3J G;  2CCZ A;  4QJF A;  1M1K C;  4OO1 I;  2R93 G;  4P74 A;  2B63 G;  2BA0 A;  2H5X A;  2UXC Q;  5AJ3 Q;  4LFB Q;  3PF5 A;  1NBW A;  1YHB A;  4JC0 A;  4AIM A;  1YZ6 A;  4X64 L;  2YTY A;  5C44 G;  5IP7 H;  3KJO A;  4YWK A;  1X65 A;  2VQE Q;  5GAE C;  4JI5 Q;  2B3G A;  5IYD G;  4LFC Q;  1SR3 A;  3PSI A;  4KHP Q;  2E2J H;  1FVI A;  2IHF A;  2AMC B;  4DPG A;  3GTK H;  2ATW A;  3A5Z B;  3UDG A;  3KF6 B;  3KF6 A;  2R7D A;  4AQY L;  1I94 L;  4O2D A;  5M5Y H;  1TWF H;  4HIK A;  1V9P A;  5IWA Q;  4HJ7 A;  1N36 L;  2D0P A;  1GVP A;  4DNI A;  1L2F A;  2AHO B;  1HNX L;  1X9N A;  1JE5 A;  3JAM i;  5M3F G;  3HOY H;  3RLN A;  4A3E H;  1XMO L;  3U4Z A;  1VQN A;  2QGQ A;  3L2P A;  1XTD A;  3CCE A;  1WFQ A;  4A3K H;  5C0X J;  3LGJ A;  2GVB A;  2HQL A;  3M9B A;  3VDY A;  1TWG H;  1MIU A;  4GN5 A;  4LWC A;  2WAQ E;  3RLO A;  1X54 A;  1S3O A;  4OON A;  4B3T L;  4PMW A;  1DGS A;  2QEX A;  3CCJ A;  1S72 A;  1RIP A;  2EXD A;  5IYB G;  1Q82 C;  4IFD G;  3RZO H;  4YHH L;  1VQB A;  4R1J A;  4YCW A;  2UU9 L;  4JI0 L;  2A1A A;  4DV0 L;  1VCI A;  2VW9 A;  5JJL A;  3PO3 H;  1QVG A;  1E22 A;  5IP9 G;  5IYC G;  4OO1 G;  3D31 A;  3EN2 A;  3FKI G;  4BBR G;  5K36 G;  2PI2 A;  1Q81 C;  3CF5 A;  1QZH A;  4DR1 L;  3E9I A;  1J6Q A;  3M85 A;  4AQY Q;  1I94 Q;  1YBY A;  2CQO A;  4A3L G;  2JA7 H;  1N36 Q;  4GNX C;  1JT8 A;  3J81 i;  4A3M G;  4ALP A;  1VQJ A;  3PGZ A;  1HNX Q;  1WI5 A;  1E3P A;  4HJ5 A;  1PH6 A;  3RN2 A;  1FJG L;  2NVQ H;  1XMO Q;  2I5L X;  1VQ6 A;  1EUJ A;  3CCV A;  4KI0 A;  4GLV B;  4OX9 L;  2WFW A;  1K9M C;  1KRS A;  2K5H A;  3K8A A;  1PH5 A;  4MNO A;  4JV5 L;  2PI2 E;  4B3T Q;  4JG2 A;  4BXX G;  3F1Z A;  2L15 A;  4BA2 I;  1IBK L;  1EQR A;  3H15 A;  3S1N H;  4AYB G;  4YHH Q;  2ALY B;  2PMZ E;  4A93 H;  4JI0 Q;  2YTX A;  1Q12 A;  1HZC A;  3OYY A;  3HOX G;  4DV0 Q;  2NVT H;  3PO2 G;  1I6H H;  2B29 A;  1IBL L;  4LF4 L;  1XPO A;  1YNX A;  1A0I A;  1Q8K A;  1Y1V G;  3CCM A;  1X3G A;  5GQO A;  4YWL A;  3CW2 C;  5H1S E;  4DR1 Q;  4BY7 H;  2ZTD A;  3EIV A;  2JA5 G;  2AWO A;  3UDX A;  1I50 H;  4DAM A;  4P73 A;  1VQD A;  5FLX c;  3PIP A;  2R7Z G;  3KOJ A;  4R4O A;  1NMG A;  2BA1 A;  3PUV A;  4JCV E;  4HID A;  3M4O H;  5HY6 A;  4IJH A;  3FHW A;  1OXS C;  1FJG Q;  4L5T A;  3KDF B;  2RHS B;  3KDF A;  4UP9 A;  5M3M G;  1N8R C;  3F2D A;  1YJW A;  4OX9 Q;  2JA6 G;  4IFD J;  3S16 H;  2RHQ B;  3S15 H;  4AH6 A;  2WB1 G;  1NMF A;  4XIG S;  4QY7 A;  2RCN A;  2JK8 A;  2GN5 A;  2C35 B;  2NZO A;  3A0J A;  1SLJ A;  3HKS A;  1VQG A;  2A8V A;  4JV5 Q;  2N8N A;  3BZK A;  3CMA A;  1HR0 W;  1IBK Q;  1KAW A;  4A75 A;  2JEB I;  1PH2 A;  2HIX A;  1HZ9 A;  2ZJQ A;  2NZH A;  4A3C H;  4GKK L;  1WOC A;  4LF4 Q;  1UWV A;  4DV3 Q;  1H95 A;  1B8A A;  3S24 A;  3ERS X;  1JB7 A;  3SGI A;  1I5F A;  1W3S A;  1OXT A;  1Z9F A;  4DV7 L;  1Y1W H;  3HOV H;  4LF7 L;  1E7Z A;  3KF8 B;  2Y0S E;  4LF9 L;  4IPC A;  3PUY A;  2MNA A;  1X55 A;  1PYS B;  2E2H H;  1A63 A;  4TQU S;  2D0O A;  3H0G H;  3L7Z C;  2JA9 A;  5FJ8 G;  2VZA A;  3PUW A;  5GAG C;  5LMN W;  2N78 A;  4YCU A;  2VS1 A;  3CAM A;  3PCO B;  2YTV A;  1K73 C;  3D0F A;  4DV5 L;  3TS2 A;  3OTO Q;  2K5N A;  4DV4 Q;  1PH8 A;  1L0W A;  1PA6 A;  1D7Q A;  2ZM6 L;  1G51 A;  3DLL A;  3S1M H;  1VQF A;  5ELN A;  4A3L H;  1CKO A;  5GAH C;  2Z6K A;  1V43 A;  4PZ6 A;  5C3E G;  1N32 L;  4OWW B;  1VQM A;  4A3M H;  1KRT A;  2AKW B;  3K81 C;  4K0K L;  1MJC A;  2IHE A;  1SMX A;  1X6O A;  4GKK Q;  1G6P A;  1K0R A;  4HJ8 A;  2PQA B;  2PQA A;  3HOZ G;  1CUK A;  1TWA H;  1EIF A;  4DV7 Q;  3KFU A;  3GTG H;  3K7A H;  3CC7 A;  4LF7 Q;  3H3V H;  3S1Q H;  4C3J H;  5BR8 L;  2KCT A;  4LF9 Q;  3WWV A;  3J7Z C;  5M5W H;  2OTJ A;  3I4M G;  2RF4 A;  3T1H L;  2ASB A;  4B3M L;  3I4O A;  1C9O A;  1EOV A;  4UP8 A;  4C3I H;  2ZJR A;  4BBS H;  1HZB A;  4GOP B;  4GOP A;  1WJJ A;  4X64 Q;  3AQQ A;  4ME3 A;  4EQ5 A;  2OTL A;  2K14 A;  4A93 G;  3CP0 A;  4IJL A;  3I4N H;  3F8T A;  1UE1 A;  3A74 A;  1VQO A;  4L5R C;  3PO2 H;  3J80 c;  3U58 A;  3ICE A;  2R7F A;  1VQE A;  1Y1V H;  4MZ9 A;  1XNR L;  4PZ8 A;  1HR0 L;  4A3I H;  3I2Z A;  2MFI A;  4QL5 A;  1KIX A;  4O0A A;  3M4P A;  3UE1 A;  3HKZ E;  1CSP A;  3K80 C;  4YWM A;  5FLM H;  2ZM6 Q;  3PUZ A;  1XPR A;  1U0L A;  4R4C A;  1KC8 C;  1YIT A;  2ID0 A;  2YYZ A;  1XJV A;  2KEN A;  3B6Y A;  3JAM c;  3S2D H;  1KL9 A;  1N32 Q;  5DLQ E;  3CC4 A;  5EAY A;  2IY5 B;  4A3G H;  4K0K Q;  3JC6 6;  1LM0 A;  4DR6 L;  4PG3 A;  5M3M H;  2DGY A;  5IP7 G;  4JBK A;  4Y52 H;  3TRE A;  2JQO A;  1RL2 A;  2AWN A;  3G71 A;  4A3F H;  1WCM G;  1CKN B;  1CKN A;  1G29 1;  2GVA A;  3ER0 A;  3RR5 A;  1SRO A;  1KQS A;  5JJI A;  3ULL A;  4JYA L;  3T1H Q;  1VQC A;  4B3M Q;  2YV5 A;  5LMN L;  1PFS A;  3AFP A;  2E8G A;  5C0X I;  1N33 L;  3CCL A;  2CKZ B;  5C4X G;  3AEV A;  2UU9 Q;  4MTN A;  3NEN A;  1QVF A;  2KCM A;  2MO1 A;  4TVA B;  4QIW E;  1UE7 A;  1YJ9 A;  3GO5 A;  3GTL H;  3S14 H;  2BH2 A;  3HOY G;  1XNR Q;  1HR0 Q;  4A3E G;  1TWH H;  3GTJ H;  1JJC B;  4BY1 G;  4JI6 L;  4A3B G;  1VQ7 A;  1PH7 A;  4JI4 L;  1N9W A;  3PF4 A;  3J81 c;  1Z47 A;  2CWA A;  4H02 A;  2NVX H;  1UEB A;  4HJ9 A;  4GN4 B;  4A3J H;  2UXD L;  1HH2 P;  3CC2 A;  5M5X H;  1E1O A;  2Y0S G;  4A3K G;  2B63 H;  1XPU A;  4J15 A;  1HZA A;  2R93 H;  5JEA G;  3G4S A;  3AFQ A;  1IBM L;  1GO3 E;  3NEM A;  1Q46 A;  5JJK A;  2CFM A;  1WYD A;  4RG1 A;  5C44 H;  1KHI A;  2N3S A;  2OQK A;  4GLA C;  4JI3 L;  1CSQ A;  2NN6 I;  4DR2 L;  3RN5 A;  4FDB A;  2I5M X;  2N49 A;  4JBJ A;  5IYD H;  3HFZ B;  1TXY A;  4YCV A;  5ELO A;  3RLF A;  3PO3 G;  4LUZ A;  2Z0S A;  2IX0 A;  2KHI A;  1W2B A;  4JYA Q;  2LSS A;  1L1O B;  1L1O A;  5LMN Q;  1Q86 C;  3STB C;  1C0A A;  2MO0 A;  2WP8 J;  3A5U A;  4A3D G;  1OXU A;  4JI8 L;  1N33 Q;  1BVS A;  2LXK A;  3IRB A;  3ULP A;  4DAY B;  4IOC A;  2FXQ A;  1V1Q A;  2K52 A;  2JA7 G;  1UE6 A;  2F3I A;  4BA1 I;  4IPG A;  1K3R A;  2HIV A;  1GD7 A;  3NBH B;  1YI2 A;  3CCQ A;  1YHA A;  3NEL A;  1IBL Q;  5M3F H;  3UE0 A;  3T1Y L;  2A19 A;  4DR5 L;  4JI6 Q;  1K83 H;  5C0X G;  4JI4 Q;  5LMU L;  1PH9 A;  1HNZ L;  4LFC L;  1IL2 A;  1NTG A;  1YJN A;  2JJQ A;  2UXD Q;  3E0E A;  4NXM L;  3I4M H;  3UDI A;  4WJ4 A;  1KD1 C;  3M4Q A;  1SE8 A;  3OW2 A;  4DR7 L;  4DKA C;  4AYB E;  3BU2 A;  1EQQ A;  1IBM Q;  3CD6 A;  5IYB H;  4DV1 L;  1PHJ A;  2WAQ G;  4UP7 A;  1D8L A;  1GM5 A;  4IPH A;  4DR2 Q;  1QVC A;  2UUA L;  1LTL A;  2I5H A; 
#chains in the Genus database with same CATH topology
 3LWU A;  1PZK D;  2QA4 A;  3S2H B;  1K3B C;  4EX5 A;  2RCF A;  5K36 H;  3KLW A;  1HHV A;  1GKH A;  3CQZ H;  2L5T A;  3DUZ A;  4A76 A;  2NN6 G;  1G91 A;  3MVV A;  4JBM A;  3GTL B;  3WDN A;  1E1T A;  4EVO A;  4JI1 L;  4DXF A;  5JEA J;  1Q7Y C;  1VQ8 A;  3L0O A;  3U50 C;  4B9X A;  2XWJ B;  4DR5 Q;  5M5X B;  3MTS A;  4ZCK A;  2XTI A;  2E5L L;  1RTO A;  1BBX C;  3GTQ B;  1WTX A;  5JOB A;  4HMJ A;  1E24 A;  3J80 i;  1G6Z A;  1SN8 A;  4C3H G;  1BCP F;  1JQY D;  5EKK A;  4DV1 Q;  2A69 D;  1VQ5 A;  1TKW B;  2IW3 A;  1T9H A;  2NVY H;  4KY7 A;  3FDT A;  1YEZ A;  2UUA Q;  2O5J C;  1BO0 A;  4A3C G;  4IAL A;  1C7Y A;  3NTK A;  3HOV G;  5C3E B;  2Q2H A;  3NTI A;  2YU9 B;  3BZC A;  4P75 A;  2R7Z H;  3F2U A;  5DM6 3;  5T1G A;  1KXL A;  2D2C C;  4X65 L;  4LMQ D;  2R92 B;  5L37 A;  3HOZ B;  2BDO A;  1G2T A;  1ILQ A;  2OCE A;  5IY0 A;  4ODG A;  1KDB A;  5GAD C;  3NE5 B;  5BR8 Q;  2RDG A;  2BOS A;  3D3R A;  3K0Y A;  1MBY A;  1VQP A;  2EE1 A;  1R9T H;  4POG A;  3S1R B;  1MD2 D;  4R4Q A;  2A5H A;  3D6C A;  3W1G A;  3AYH B;  4B3S L;  1ENF A;  1LTI D;  4CDE C;  4X6A H;  4ILW A;  1HA6 A;  3HOU B;  2C5C A;  2EY6 A;  2JP1 A;  4GNX B;  1SJE D;  4RWS C;  4JI2 L;  3ULJ A;  2I0Q A;  2K4K A;  4YY3 L;  4DUY L;  1WTV A;  2PYK A;  4U67 3;  1N34 L;  1A3U A;  1X3F A;  3D4W A;  2XRS D;  5COY A;  3K5M A;  3TME A;  5FJ8 H;  1O7I A;  1SFO H;  3TN2 A;  4DR3 Q;  1BBW A;  4IUV A;  1ESF A;  1F9S A;  4MHE A;  4LF8 L;  4F87 A;  3VYU A;  4DV3 L;  1SNQ A;  4GLX A;  2F4V Q;  5AFW A;  1QZG A;  1TWF B;  4DNR B;  1HA5 A;  1BKB A;  1IYJ B;  2ZTE A;  3A56 A;  5EPJ A;  5A2Q E;  4DK3 C;  4LW1 A;  3HOY B;  4KD3 A;  2J7Z A;  3GD7 A;  4A3E B;  3I7F A;  5AJ3 L;  4O42 A;  1ZYR C;  1E2Z A;  3IFT A;  4GS3 A;  1DXM A;  1JOK A;  1D1K A;  3V2T A;  4QQB X;  2F52 A;  4A3K B;  3TQY A;  2CH4 W;  4XTC S;  2HHH Q;  3F2B A;  4FF2 A;  2LS0 1;  1IKL A;  3MXP A;  1M90 C;  4JW0 A;  3OTO L;  1DOL A;  2MGS A;  4C3H H;  3Q23 A;  1PRT B;  3DM3 A;  1IXR A;  3VYR A;  1K8O A;  2A6H C;  1XNQ Q;  2FMM A;  3QIA A;  1KAB A;  2KBN A;  2RQX A;  2QCP X;  4IOA A;  1X56 A;  2MHV A;  2TSS A;  1EYG A;  3WOF A;  1OXV A;  2Z4I A;  4Q5V A;  4KD4 A;  4JOI C;  1EFW A;  2A68 C;  5HGQ A;  4A3J G;  1M1K C;  1RF2 D;  2BA0 A;  1YHB A;  1GOZ A;  1PTO B;  1X65 A;  2VQE Q;  4PQX A;  3PSI A;  3X3M A;  2E2J H;  2OEO A;  1FVI A;  4DPG A;  2AMC B;  1WTH A;  3UDG A;  1EWC A;  4FO2 A;  2OT2 A;  1N36 L;  3ND8 A;  1GVP A;  1HNX L;  1JE5 A;  2IL8 A;  5M3F G;  1SDF A;  1GUW A;  1VQN A;  4C1N K;  2QGQ A;  3L2P A;  4K2L A;  1I6V C;  1F9Q A;  2Z8L A;  2GVB A;  3M9B A;  5IT9 E;  1TWC B;  4OON A;  1DON A;  1DGS A;  3HG9 A;  4K8J A;  1RIP A;  4IFD G;  4TRD A;  3S15 B;  1KNE A;  2F0D A;  1STG A;  3RZO H;  1R4Q B;  5JJL A;  3K58 A;  3J7Y W;  2J4X A;  4O1N A;  4OO1 G;  1FR3 A;  2TMP A;  5EPK A;  3N52 A;  1DJR D;  1NNX A;  3E9I A;  2X69 A;  4NKL A;  1YNN C;  3NWT A;  1ONL A;  2NB0 A;  1SBB B;  2HQE A;  1E3P A;  5IOC A;  4HJ5 A;  1PH6 A;  1CZG A;  3OWF A;  2NVQ H;  4P2C B;  4CKC A;  2K1B A;  1EUJ A;  3K6O A;  3A7L A;  3CCV A;  3GV6 A;  2F0Q A;  4GLV B;  1JOQ A;  1K9M C;  1KRS A;  3I3C A;  2EJG C;  2K5H A;  1B53 A;  3C46 A;  5D3I B;  4JV5 L;  2PQE A;  4B3T Q;  4OIJ A;  4N8X 1;  2F0G A;  4BA2 I;  1IBK L;  3S1N H;  4OHJ A;  1NR2 A;  2FFK B;  4AYB G;  4JI0 Q;  1HZC A;  2PPB C;  1LTA D;  3PO2 G;  2B29 A;  1EIH A;  1Y1V G;  2B2Y C;  5I2X A;  2ZTD A;  4KHV A;  4P73 A;  1HCZ A;  3KOJ A;  5DAU A;  5HY6 A;  3GTG B;  1SYF A;  4L5T A;  1GJX A;  5F2D A;  1WVL A;  3JAM L;  1MHW C;  2RDH A;  5A35 A;  1V1P B;  3S16 H;  2Q8T A;  2AQ1 B;  1TS5 A;  2F0I A;  2WB1 G;  1ZYR D;  3NK9 A;  2JK8 A;  2NZO A;  3A0J A;  2A8V A;  4G7O C;  3BVZ A;  1TS2 A;  3BZK A;  3CMA A;  1HR0 W;  2ICE C;  4Z9C B;  5EJW A;  5DNF A;  1PH2 A;  3OIP A;  2NZH A;  4XDX A;  4GKK L;  1WOC A;  1H95 A;  2F0W A;  1JB7 A;  1Y1W H;  3S2D B;  1FNW A;  5D3D A;  4HSP A;  4A3G B;  2A6H D;  1XTC D;  1X55 A;  5C5M A;  2WKC A;  4TQU S;  1ENA A;  4RFB A;  5LMN W;  1S5D D;  4YCU A;  3KLR A;  2VS1 A;  3UI2 A;  1JE4 A;  1MI2 A;  2VXW A;  1I4X A;  2YTV A;  3D0F A;  5IGE A;  4HR7 B;  3PIO 3;  5IGC A;  3T51 B;  2R3Z A;  4HCS A;  1TY2 A;  4PZ6 A;  2KOL A;  5E4X A;  2RDF A;  4OWW B;  1G8Z D;  4K0K L;  3MFG A;  1MJC A;  2IHE A;  1EIG A;  1LT5 D;  4HJ8 A;  3HKZ B;  1JWM D;  3KFU A;  4V19 0;  3CC7 A;  3S1Q H;  4C3J H;  2KCT A;  4LF9 Q;  5M5W H;  3NXW A;  3I4M G;  3URY A;  1EY8 A;  3WOE A;  1EOV A;  1BCP C;  1HTL D;  4C3I H;  4BBS H;  4GOP B;  1WJJ A;  5KIX A;  3AQQ A;  4Q0F A;  3K5L A;  3CP0 A;  3I4N H;  3E6Z X;  1DD2 A;  4EGV A;  3PO2 H;  1BCP B;  1I4G A;  2ZT9 C;  1Y1V H;  1HR0 L;  1D5X C;  4A3I H;  3KBX A;  1KIX A;  4ZKB B;  3HKZ E;  2Q8R E;  2F0T A;  4UHV A;  4QIW B;  4EQP A;  2QEJ C;  3VR5 A;  5IP7 G;  2EYL A;  4OIK A;  1YNN D;  4A3F H;  4CJ0 B;  1CKN B;  4KJO A;  4XQJ A;  1KQS A;  3ULL A;  3T1H Q;  4B3M Q;  2YV5 A;  5LMN L;  1BR9 A;  3I90 A;  3AFP A;  2E8G A;  1N33 L;  2CKZ B;  5KND A;  1ICF B;  3IL8 A;  5FLX E;  3TP7 A;  2UU9 Q;  3E3X A;  2KCM A;  3HS0 C;  4QIW E;  1UE7 A;  1YJ9 A;  4KKU A;  3CQZ B;  4DU9 A;  2FHT A;  2FIN B;  3DEP A;  4DA2 A;  4JI6 L;  1VQ7 A;  2CH4 A;  2UXD L;  1XPU A;  1E1O A;  1HZA A;  1DCZ A;  5IGD A;  3ERQ A;  1GO3 E;  5CBA E;  3NEM A;  1Q46 A;  2IJ0 A;  2IX3 A;  4RG1 A;  1T5X D;  1J8I A;  2F0J A;  4GLA C;  3RN5 A;  4JI3 L;  2NN6 I;  1A3V A;  2I5M X;  1KLG D;  1PRT F;  1TXY A;  3PO3 G;  1PZJ D;  1DOM A;  3MWY W;  5M9O A;  4JYA Q;  3BDC A;  3NBI A;  2DJG C;  2NVY B;  1FNU A;  4XT3 B;  1Q86 C;  1EY7 A;  4K6L A;  2WP8 J;  1OXU A;  3IRB A;  4IOC A;  2JA7 G;  1GD7 A;  1NSN S;  3CCQ A;  1YHA A;  3NEL A;  1IBL Q;  3R8B A;  2R7Z B;  1K83 H;  5C0X G;  1YJN A;  2E76 C;  2JJQ A;  4WJW A;  1PTO F;  3FRP B;  3I4M H;  4HED A;  1KD1 C;  3OW2 A;  4DR7 L;  3TP5 A;  3BU2 A;  3CD6 A;  1IBM Q;  1SNC A;  1WD1 A;  3MC0 B;  1GM5 A;  4DR2 Q;  2HDL A;  4I7A A;  4A93 G;  2DN8 A;  4LK1 C;  2QIL A;  5IP9 H;  1R9T B;  2KCN A;  4BBR H;  2Z6K C;  1XMQ L;  3P75 A;  1KTK A;  1Z7T A;  1V1O A;  2VL6 A;  3K7U C;  3CXC A;  4DV2 L;  2K04 A;  2K50 A;  2RKS A;  3U4V A;  4PZ7 A;  3TP8 A;  2JA8 G;  2V1C C;  3HOW G;  3J7A V;  1HFG A;  4JOI A;  1P8L A;  3GTO H;  3CCU A;  2BH8 A;  3T1Y Q;  2WKD A;  2JN4 A;  4LF5 L;  4HAE A;  5BN5 A;  2EY2 A;  2PW5 A;  2B2U C;  1QIL A;  4L63 B;  2D62 A;  1HQM C;  2CQA A;  5LMU Q;  3PV0 A;  1HNZ Q;  2MPM A;  1JB3 A;  5TSS A;  2K75 A;  2ZTC A;  2VUM G;  1IW7 C;  1UE5 A;  3TZU A;  4X62 L;  2UUC L;  1SFO B;  4BXX H;  5E7N A;  4DAV A;  1VS0 A;  4NW2 A;  1A15 A;  3MEF A;  3CME A;  1SMY C;  1F77 A;  2X6G A;  1F9R A;  1ZXT A;  1VQ4 A;  4GKJ L;  4K5X A;  2B2W C;  2JA5 H;  1KAA A;  1HUM A;  1AZP A;  4L5Q A;  4LUO A;  3RZD H;  4KLK A;  2EY5 A;  3R2T A;  4NB3 A;  4JI1 Q;  3H0G G;  4WJ3 M;  3KLS A;  3U9O A;  4ME5 A;  2JA6 H;  4WFN 3;  2E5L Q;  1JMC A;  3W5O A;  2EYJ A;  3KYH C;  5IT9 c;  4IO9 A;  2IX1 A;  2EYH A;  1Q90 A;  4ZLT F;  1ROD A;  4DK6 C;  3J81 E;  3MXN A;  1MJE A;  1Q3L A;  4L5S A;  1SRU A;  4IPD A;  4B3R L;  1SNP A;  3CCR A;  1B1Z A;  2NYZ D;  2K28 A;  3QOJ A;  2UXB L;  3VR2 A;  1Q1B A;  4X65 Q;  3TS0 A;  1OXX K;  1SNO A;  1WD0 A;  2F3W A;  1NY4 A;  1VQ9 A;  4QGU A;  3G6E A;  1JWU D;  4DR6 Q;  1QNU A;  3RNU A;  4ZRZ A;  2E2J B;  4R4T A;  1A8V A;  5E4W C;  4E6I A;  5DM7 3;  2F3V A;  3RUZ A;  1LTG D;  1QUQ B;  4K5W A;  3J80 L;  2JA8 H;  3W2D A;  3M7N A;  3HOW H;  2B2Y A;  4B3S Q;  2IT1 A;  2B8G A;  5DEH A;  2D9U A;  4IUQ A;  1EY9 A;  2KA7 A;  3Q8D A;  3T4A C;  2NWG A;  4F7X A;  1WTR A;  4JI2 Q;  3TSS A;  2EJM A;  4DUY Q;  2DJF C;  2JE6 I;  4YY3 Q;  3MA2 B;  1N34 Q;  4KHP L;  3EFX D;  2VUM H;  4DV4 L;  1DOK A;  4KY5 A;  5EBC A;  3RZO B;  4APV A;  2RVL A;  3LNN A;  4P72 A;  2L11 A;  2KHJ A;  1Q1E A;  2DNC A;  4L8J A;  3NTH A;  5IWA L;  1LYL A;  2KUM A;  3D4R A;  4HIM A;  4OGQ C;  2KQ3 A;  4LF8 Q;  4K6D A;  3QOL A;  4IFD I;  2K5W A;  5I6Y A;  3NWS A;  2N88 A;  5JVG 3;  1FL0 A;  1SEB D;  1Y14 B;  2ZJP A;  1I3Q H;  1VQL A;  1K8A C;  2A74 C;  2A73 B;  4OO1 I;  2NVQ B;  2R93 G;  2B63 G;  1JCK B;  1STH A;  5EPL A;  3NPP A;  1B3A A;  5AJ3 Q;  1EQT A;  1NBW A;  4JC0 A;  4AIM A;  3H09 A;  3ERO A;  5C44 G;  4ZUJ A;  1CA6 A;  3C1E A;  2P5Z X;  5GAE C;  2B3G A;  4LFC Q;  4KN4 C;  3S1N B;  3A5Z B;  3KF6 A;  4NP5 A;  1XWE A;  4AQY L;  1I94 L;  1SYC A;  4O2D A;  1V9P A;  2QW7 A;  4HJ7 A;  2D0P A;  3E0J A;  5EGT A;  4GZY C;  1GUG A;  2AHO B;  1X9N A;  3TP6 A;  5COR A;  3SK4 A;  4B08 A;  1XTD A;  1ZKO A;  3CCE A;  1WFQ A;  1PZI D;  4DGZ A;  1F2Z A;  3LGJ A;  1TWG H;  1U4P A;  4GN5 A;  1X54 A;  1S3O A;  2QEX A;  1S72 A;  5IYB G;  1Q82 C;  3S16 B;  2AQ2 B;  1I4Q A;  2DNE A;  3NQT A;  2A1A A;  1VCI A;  5LL6 X;  4DN4 M;  5IYC G;  1HTP A;  1PFM A;  2HD3 A;  3D31 A;  3S9W A;  3FKI G;  4MIU A;  4DR1 L;  1WTO A;  1J6Q A;  3M85 A;  3DMU A;  1RDP D;  5KRU A;  1YNJ C;  4ZQ3 A;  1O7L A;  2EYM A;  1N36 Q;  4GNX C;  2CHB D;  4X3T A;  1JT8 A;  3J81 i;  1Y1W B;  3PGZ A;  1HNX Q;  1FJG L;  1VMC A;  1QB5 D;  2WII B;  4KKT A;  1T5E A;  4CDC C;  2KVM A;  4CHT B;  1LLR D;  2F0O A;  1PH5 A;  2PI2 E;  1O7Z A;  3A7A B;  1SJH D;  3KLS X;  1AP0 A;  3H15 A;  2ALY B;  3X3N A;  3D4D A;  1WTQ A;  2JXM B;  2YTX A;  1Q12 A;  3HOX G;  3QR8 A;  2NVT H;  4LF4 L;  1A0I A;  1Q8K A;  4QUC A;  4HSV A;  3FMC A;  2X6L A;  2G9H D;  3D6W A;  1EZ6 A;  3CW2 C;  2I46 A;  1D6E C;  4FXG C;  2EPB A;  2EJF C;  5G3L D;  3UDX A;  5FLX c;  1TU2 B;  2NN6 H;  4IUT A;  4HMI A;  3PUV A;  4X3U A;  4IJH A;  1X32 A;  2K5Q A;  3S1Q B;  4UP9 A;  3KDF B;  2RHS B;  4C3J B;  5M3M G;  1ML0 D;  2C9O A;  2L55 A;  5M5W B;  4KV6 A;  1N8R C;  1YJW A;  4IFD J;  1PRT C;  2QDB A;  2RHQ B;  2KEE A;  4AH6 A;  4C3I B;  4BBS B;  1NMF A;  3DWQ A;  1K0S A;  2RCN A;  3DM1 A;  4AYB B;  2GN5 A;  4JV5 Q;  3I4N B;  2N8N A;  4QF4 A;  1IBK Q;  4CDF C;  4A75 A;  1Y1V B;  2JEB I;  4A3I B;  2HIX A;  1O80 A;  1HZ9 A;  1Y8O B;  3NSW A;  4A3C H;  1L0Y B;  2E75 C;  4OEL B;  1TS4 A;  3HOV H;  1I5F A;  4KY6 A;  1Z9F A;  1HXY D;  2J0T D;  3I4L A;  1M4V A;  4LF7 L;  1E7Z A;  3KF8 B;  2LFN A;  5C5L A;  1AN8 A;  4R8I A;  1PTO C;  4IPC A;  2MNA A;  5IIF A;  3M7G A;  1IYU A;  1A63 A;  1SYB A;  4A3F B;  1C4Q A;  2E74 C;  3L7Z C;  3DXJ C;  3NUC A;  2JA9 A;  2VZA A;  4OEM B;  2ZXR A;  4G7Z C;  1ENC A;  2L4N A;  1XXG A;  1PA6 A;  1NUC A;  4WRD A;  5K5P A;  1VQF A;  5I9O A;  5ELN A;  3PMF A;  3C2P A;  1BNZ A;  3CRK C;  2Z6K A;  5C3E G;  1N32 L;  1LTT D;  4OL7 A;  3VA5 A;  3K81 C;  4GKK Q;  1SMX A;  1X6O A;  2VB3 X;  4BY7 B;  5JPM C;  1G6P A;  1K0R A;  5KNC A;  2PQA A;  3HOZ G;  2EYO A;  1TWA H;  3K7A H;  5BR8 L;  5E3F A;  4C1N I;  3AB9 A;  3A8J E;  3ND9 A;  3MAQ A;  3I4O A;  2B2U A;  3NP8 A;  4UP8 A;  1U4L A;  3MHB A;  3DEO A;  4X64 Q;  4RGO S;  5A2Q L;  4IJL A;  1UE1 A;  2RA4 A;  2HCI A;  1Y69 U;  3ZYY X;  4L5R C;  3J80 c;  3ICE A;  1STY A;  2R7F A;  1VQE A;  5CBE E;  1PMR A;  2MFI A;  4O0A A;  1BUV T;  2K33 A;  4FVM A;  3PUZ A;  1U0L A;  1YIT A;  1JWS D;  5IGF A;  2KEN A;  4QMG A;  1X3Q A;  5LHY 1;  2M9V A;  5DLQ E;  1A2T A;  2NTS A;  3FPP A;  2B2W A;  5EKI A;  1K83 B;  2PZW A;  3JC6 6;  4K0K Q;  2RSN A;  1H9S A;  4PG3 A;  5M3M H;  2DGY A;  3I4M B;  1D5M C;  1YNJ D;  2JQO A;  1LTR D;  2AWN A;  3RR5 A;  1U4R A;  2E2H B;  4N8F A;  2EY1 A;  5C0X I;  1RJT A;  3AEV A;  4BBR B;  1LT4 D;  2B2V C;  1DZ1 A;  1GUO A;  3SDZ A;  2MO1 A;  4TVA B;  2A6E C;  1K8M A;  2K01 A;  1CHQ D;  3GTL H;  4IUU A;  2BH2 A;  3HOY G;  1HR0 Q;  4A3E G;  1TWH H;  1JJC B;  4BY1 G;  4H7B A;  4A3B G;  1N9W A;  2F0F A;  5KNB A;  3J81 c;  3H3V C;  1UEB A;  3KBG A;  4A3J H;  3GTO B;  1HH2 P;  5M5X H;  4A3K G;  4J15 A;  2F1M A;  2XSC A;  4ZUI A;  1UAP A;  3HGB A;  2NBF A;  2OQK A;  4CJ2 C;  4PNY A;  4YIJ A;  3GV3 A;  3N6R A;  2Z0S A;  2L9H A;  4HN7 A;  1TVX A;  2LSS A;  1L1O B;  1QE6 A;  5LMN Q;  3STB C;  3A5U A;  4A3D G;  2AQ3 B;  4JI8 L;  1N33 Q;  3ULP A;  3H94 A;  1I4H A;  4DAY B;  2FXQ A;  2K52 A;  5IT9 L;  1PRT D;  1UE6 A;  4RA8 A;  1LV9 A;  1K3R A;  4IZ8 A;  3NBH B;  5M3F H;  2JA5 B;  1BOS A;  3V96 A;  4JI6 Q;  3RZD B;  1PH9 A;  1IL2 A;  1H9K A;  3OSO A;  2PZU A;  3OW7 A;  2F03 A;  2UXD Q;  3AMU A;  4NXM L;  4WJ4 A;  1FGB D;  1SE8 A;  4PV1 C;  4DKA C;  1F2Y A;  3BS1 A;  3QO2 A;  2JA6 B;  4IFD H;  2F0U A;  3LWE A;  4UP7 A;  5FO7 B;  5IGG A;  1PYW D;  3A55 A;  3MXG A;  1VDZ A;  2A68 D;  3S1R H;  1SXT A;  1I4P A;  1PTO D;  5FOB B;  2F4I A;  3BDL A;  4OO1 H;  4UPA A;  2L0C A;  3KJP A;  4XXE A;  4KHZ A;  2DY8 A;  3SEB A;  4RKL A;  1QOH A;  3PUX A;  4LFA L;  1TQO A;  2D5D A;  1J5E L;  3IAY A;  3S14 B;  1SAP A;  3J81 j;  4RMF A;  5IE8 A;  4FYD A;  2F0E A;  1K8G A;  2JSO A;  4X66 L;  4GOP C;  2XGT A;  3EVQ A;  3K57 A;  4JI7 L;  2VQF L;  4DR7 Q;  5ELF A;  4LF6 L;  4NPS A;  3TZD A;  4LUV A;  1LT3 D;  1PV4 A;  2AUJ D;  1YHQ A;  3FPU B;  3I72 A;  1B9N A;  4DV5 Q;  3I56 A;  1XMQ Q;  4BY1 H;  2K6A A;  2JA8 B;  4A3B H;  3HOW B;  3IFD A;  4LJZ C;  4H0L C;  4DV2 Q;  5GRO A;  2E2I H;  4PMC A;  1D5Z C;  3G48 A;  4DUZ L;  1X3E A;  1YIJ A;  4QCL A;  4LF5 Q;  2WIN B;  4NXN L;  2ES2 A;  4DR4 L;  3S17 H;  1LT6 D;  2VUM B;  1EFI D;  1S40 A;  2F0H A;  3OMG A;  1EU3 A;  1ASY A;  1P16 A;  1A62 A;  4FF3 A;  3K0X A;  2SDF A;  4R8N A;  4X62 Q;  2UUC Q;  1FGU A;  4A3D H;  3E5S A;  3HZX A;  4J1M A;  4RHR A;  1UEA B;  4GKJ Q;  4XYO A;  4POF A;  4GNX A;  3E9H A;  1STN A;  1VQA A;  1CKM A;  1TT2 A;  2JEA I;  3EBE A;  2UUB L;  2F0S A;  5CR3 A;  1Y8N B;  2A6E D;  3G7L A;  5ELD A;  5C4Z A;  3M3Y H;  3W1B A;  2Q2I A;  3BJU A;  2SEB D;  4DV6 L;  2XNA C;  2OWO A;  4DK1 A;  1MSH A;  2CWP A;  3NHH A;  1SE3 A;  3PIO A;  3GTP H;  1GUT A;  5FLM G;  4GN3 B;  1B7Y B;  3CPF A;  1HNW L;  2UXC L;  3P20 A;  4LFB L;  1NJI C;  4A3G G;  4B3R Q;  4HJA A;  3TEH B;  1TWC H;  1IL8 A;  5E1F A;  3SK8 A;  3STB D;  1PH4 A;  2Y0S B;  4JI5 L;  1TWG B;  2XRQ D;  5J3B A;  4LAA A;  2UXB Q;  5CV6 A;  5C6A A;  5CGK A;  1JJ2 A;  3A54 A;  3VR3 A;  2EZV A;  4L6T B;  2K03 A;  1S5E D;  1TII D;  2VY3 A;  1YVC A;  1HJP A;  2PO4 A;  3EQL C;  1BF4 A;  1HRJ A;  4RGT A;  2VNU D;  1U5K A;  1AZQ A;  1ICW A;  1CTM A;  5EKL A;  3CRL C;  2EDG A;  3HKZ G;  4QJF A;  4P74 A;  2F0M A;  5CV8 A;  3PF5 A;  3OIQ A;  1YZ6 A;  2YTY A;  5FLX L;  2R61 A;  5IP7 H;  4CBV A;  5IYD G;  4KHP Q;  1AW7 A;  2K05 A;  2WAQ B;  3GTK H;  2F0N A;  2IHF A;  2R7D A;  2NVT B;  5BN3 A;  5M5Y H;  5IWA Q;  1SNM A;  5J39 A;  5JAV A;  1V8Q A;  1EZ8 A;  3IKJ A;  1B50 A;  2F0V A;  3R2I A;  3RLN A;  4U68 A;  1XMO L;  1BCP D;  3A8I E;  1SND A;  1O7Y A;  4N9P A;  2HQL A;  1LTB D;  3VDY A;  2M2L A;  2CW0 C;  4LWC A;  2WAQ E;  3RLO A;  4PMW A;  5ELE A;  1BXT A;  4YHH L;  1VQB A;  2UU9 L;  4DV0 L;  2VW9 A;  5J1Z A;  3PO3 H;  1QVG A;  1EYD A;  4C3H B;  3EN2 A;  5K36 G;  1Q81 C;  3CF5 A;  1GHJ A;  1QJO A;  4AQY Q;  1I94 Q;  2JA7 H;  3OOC A;  4A3M G;  3HOV B;  1VQJ A;  3OWE B;  3RN2 A;  3LX0 A;  2I5L X;  1G2S A;  4ZAI A;  5C0X H;  4KI0 A;  4OX9 L;  1SYD A;  1FNV A;  2M00 A;  2ZXP A;  3QWN A;  2Z9H A;  1AEX A;  4IUN A;  4JG2 A;  2KCC A;  3OPO A;  1EQR A;  1QWY A;  4A93 H;  1CZW A;  3SK5 A;  3EA6 A;  3OYY A;  1I6H H;  1IBL L;  1XPO A;  1X3G A;  3I70 A;  2B2V A;  5GQO A;  5H1S E;  4MTK A;  4DR1 Q;  2SOB A;  1I50 H;  1VQD A;  4FF1 A;  4MN3 A;  2R7Z G;  3M4O H;  4R4O A;  2BA1 A;  4KN7 C;  3J7A F;  1NCV A;  4K2K A;  3ITP A;  1TWA B;  3FHW A;  3K7A B;  1FJG Q;  2H4O A;  1F9P A;  5EQ0 A;  2I07 B;  1PXU A;  1V1P A;  1F2L A;  4G57 A;  4B9W A;  1U4M A;  1LAC A;  1SLJ A;  4JPB W;  4DAY A;  4R9W A;  1HQR D;  1U9R A;  3DHQ A;  3NBH A;  5CV5 A;  4LF4 Q;  1UWV A;  4DV3 Q;  3S24 A;  1PLF A;  3ERS X;  3SGI A;  1W3S A;  4DV7 L;  1OXT A;  2EYP A;  2N55 A;  4KK7 A;  3T56 B;  3PUY A;  5ELB A;  1KNA A;  3J81 L;  1QNK A;  4ABN A;  2D0O A;  2Z1C A;  3H0G H;  4ZK9 B;  1II3 A;  3P7J A;  5FJ8 G;  3PUW A;  5GAG C;  5IOD A;  4G4K A;  4WOR A;  2LMC B;  3TS2 A;  3OTO Q;  2K5N A;  1PH8 A;  2ICI A;  1S4Z A;  2ZM6 L;  1G51 A;  3S1M H;  3G6J B;  4QB4 A;  5GAH C;  2WV6 D;  1VQM A;  4A3M H;  1TWH B;  1CM9 A;  1IW7 D;  3OHX C;  1CUK A;  1EIF A;  4A3J B;  2XIW A;  4LF7 Q;  2QKI C;  2BCO A;  1CA5 A;  4CKE A;  1SMY D;  1EYC A;  1HZB A;  4GOP A;  3BYT B;  4ME3 A;  5JJZ A;  2K14 A;  1S5B D;  3A74 A;  1VQO A;  1S5F D;  3U58 A;  4MZ9 A;  2CW0 D;  3EJI A;  1XNR L;  4PZ8 A;  3I2Z A;  2L1B A;  3M4P A;  2AUK A;  4H13 C;  4R4C A;  1KC8 C;  3NQI A;  2YYZ A;  3D8G A;  5M3F B;  1KL9 A;  1N32 Q;  3CC4 A;  1SE2 A;  1LO5 D;  2IY5 B;  1CT1 D;  5FO8 B;  1LM0 A;  4UDU C;  2V4D A;  4DR6 L;  4ID6 A;  5JVH 3;  1XYI A;  1E2V A;  1I4R A;  1GXD C;  4Y52 H;  1RL2 A;  1A3T A;  1WCM G;  1CKN A;  1G29 1;  2GVA A;  1PDQ A;  3R3O A;  1UNS A;  3BYY B;  1PFS A;  5KGU A;  3CCL A;  5C4X G;  1HPC A;  4KKS A;  4F8M A;  3R93 A;  2SNS A;  4RH6 A;  5T1I A;  1E2W A;  1JR0 D;  5KYI A;  5KYL A;  3GTJ H;  3A8K E;  1PH7 A;  4JI4 L;  1Z47 A;  2CWA A;  4H02 A;  2NVX H;  4GN4 B;  4J6H A;  1CHP D;  3CC2 A;  2R93 H;  5HUR A;  4FP5 D;  2B63 H;  5JEA G;  3G4S A;  3AFQ A;  2K32 A;  4PMB A;  3HEJ A;  5C4H A;  1WYD A;  5JJK A;  5C44 H;  3L9A X;  2N3S A;  3HFZ B;  5CV4 A;  4YCV A;  2IX0 A;  2KHI A;  1W2B A;  1C0A A;  2ENB A;  1RCV D;  3PO2 B;  5I9P A;  1V1Q A;  2B2T C;  4BA1 I;  4BY1 B;  4A3B B;  1KDC A;  2PNR C;  1NR4 A;  3UE0 A;  3K5O A;  4DR5 L;  1LAB A;  2E2I B;  4LFC L;  1GUS A;  3E0E A;  2MP1 A;  3UDI A;  2BDN A;  3AU7 A;  4NDX A;  1C8C A;  4AYB E;  3S17 B;  5IYB H;  2G5D A;  4DV1 L;  1PHJ A;  2JYO A;  1ZEQ X;  4DF7 A;  4IPH A;  3SHL A;  2WB1 B;  3U9S A;  2UUA L;  1H9J A;  1CI3 M;  5IYC H;  3CU7 A;  1IZ6 A;  4A3D B;  3FKI H;  4DAP A;  4QUF A;  3Q6S A;  3H6M A;  2EXZ A;  1ASZ A;  3I55 A;  1KLU D;  4JI8 Q;  1HFN A;  1PH1 A;  1EYA A;  3BVM A;  1VQH A;  2EQS A;  1TR5 A;  2Q2U A;  2R92 G;  3GQB A;  1XX8 A;  2WB1 E;  2LXJ A;  3GDE A;  1WCM H;  3M3Y B;  2DUD A;  3VYT A;  2H1E A;  1AE3 A;  3C1F A;  4NXM Q;  4Y7N H;  1IKM A;  4J8Q A;  1VQK A;  5FO9 B;  4OWX B;  4X3S A;  4HIO A;  2HT1 A;  3H3V I;  5C4X H;  2HCC A;  5FKA C;  5HGT A;  3J7A 5;  2EYF A;  3HOX H;  3JAM E;  1B3Q A;  3GTP B;  4KTA A;  1JIC A;  4C2M H;  1EWI A;  2L12 A;  2EIF A;  1Y1W G;  4LFA Q;  3HOU G;  4C56 C;  1B70 B;  1OTC A;  1J5E Q;  1STE A;  1B2T A;  5JEA H;  4X3K A;  3FP9 A;  1EQV A;  4S3S A;  1D1I A;  4M8A A;  2G9D A;  4DR3 L;  1PYB A;  2QDL A;  5C4J H;  3GTM H;  4X66 Q;  4UY8 C;  4RGN A;  1TS3 A;  2OQ0 A;  4P71 A;  4ULL A;  2F4V L;  2SNM A;  4JI7 Q;  2VQF Q;  4FF4 A;  3S2H H;  2WAC A;  3UDF A;  2DY7 A;  1PH3 A;  4IUP A;  4LF6 Q;  1CFM A;  3MXN B;  2MQH A;  2R6G A;  3MXU A;  1MKH A;  3KUP A;  3CHB D;  4XQN A;  3F2C A;  4JBW A;  4H44 C;  1JJG A;  2OXP A;  1S5C D;  1X3P A;  3Q22 A;  2HHH L;  2PNH A;  4V0B A;  4C3J G;  5D65 A;  2IPK D;  4RHS A;  4LNQ A;  3GTQ H;  5I6W A;  5LL6 S;  2Z6B A;  4C3I G;  4BBS G;  3HRZ C;  3CPW A;  5JPN C;  1L0X B;  4DUZ Q;  4NXN Q;  5G3L F;  5BN4 A;  1L1O C;  1H9M A;  4K5V A;  1XNQ L;  5CMD A;  3I4N G;  2KED A;  3GTK B;  4DR4 Q;  1AH9 A;  3P1H A;  1PVO A;  2FMC A;  1JOO A;  1NE3 A;  2K5V A;  1QG7 A;  4A3I G;  5M5Y B;  1VQI A;  2F0L A;  2Q2T A;  1QCB D;  1W6J A;  1QUQ A;  5C3E H;  1W6K A;  1BBU A;  3CCS A;  2YU9 H;  4OWT B;  4OXP A;  4HCE A;  3O13 A;  2K7V A;  4BWG B;  1AE2 A;  3MFY A;  3TDQ A;  2R92 H;  1MGS A;  3HOZ H;  1ESR A;  4CJ1 B;  3TRZ A;  2VQE L;  1M8A A;  4A3F G;  5ISR A;  2Z4H A;  3MZ5 A;  3SVM A;  4F88 A;  4RAU C;  2UUB Q;  2NTT A;  4A4I A;  2IWH A;  3ZJY C;  1EIY B;  3PO3 B;  4BS9 A;  4DV6 Q;  3SR1 A;  4M1U B;  4JI3 Q;  4ZKC B;  1GUN A;  3BZD B;  1LUZ A;  2JA7 B;  5FK9 C;  4BY7 G;  4R4I A;  3M4Y A;  3HOU H;  2MJ8 A;  1RTN A;  3HP3 A;  2EOT A;  3PIP 3;  2CCZ A;  1HNW Q;  2H5X A;  2UXC Q;  4LFB Q;  4XYQ A;  1FD7 D;  1EL0 A;  4X64 L;  4K14 A;  1JOR A;  3BVG A;  3KJO A;  4YWK A;  2LY7 A;  4RGM A;  5ELC A;  4TKO B;  4JI5 Q;  1LTS D;  1SR3 A;  3QB3 A;  2ATW A;  4I65 A;  4A93 B;  3KF6 B;  1I6H B;  1TWF H;  4HIK A;  3VR4 A;  4DNI A;  1L2F A;  1VMP A;  5I2Y A;  1Q8I A;  3GP7 A;  3JAM i;  3HOY H;  1CQV A;  1Y8P B;  4A3E H;  1I50 B;  3U4Z A;  2LKV A;  5CC4 A;  3M4O B;  1C48 A;  3Q24 A;  1ILP A;  3OMC A;  4A3K H;  5C0X J;  2O2L D;  1A6X A;  1MIU A;  2BE5 C;  4B3T L;  4XQQ A;  3CCJ A;  2KHS A;  2EXD A;  3SE0 A;  4R1J A;  4YCW A;  4JI0 L;  1RHP A;  4DXG A;  2B39 A;  1E22 A;  5IP9 G;  4BBR G;  1F2M A;  1UUP A;  2PI2 A;  1QZH A;  2PZT A;  4CGY B;  1YBY A;  2PMZ B;  2CQO A;  4A3L G;  1GHK A;  4ALP A;  2HUG A;  1WI5 A;  2MUY A;  1I3Q B;  1XMO Q;  1VQ6 A;  1DYQ A;  4IUR A;  2XVS A;  2WFW A;  2ZXO A;  4N9T A;  1PTO H;  3VYS A;  2O5I C;  1SSO A;  4UAI A;  1WTP A;  3K8A A;  3H0G B;  1EOT A;  4MNO A;  5C3W A;  3K5N A;  1NAP A;  4BXX G;  3DWP A;  3F1Z A;  2L15 A;  1SYE A;  4YHH Q;  2PMZ E;  2XWB B;  4DV0 Q;  3L3O C;  2F0K A;  3SK6 A;  3BDO A;  1YNX A;  3CCM A;  3S1M B;  1D2B A;  4TSS A;  2E2D C;  3T13 A;  2O4X A;  4YWL A;  4BY7 H;  3EIV A;  4A3M B;  2JA5 G;  2AWO A;  1IYV A;  4DAM A;  2B8F A;  3QJY A;  3PIP A;  1AFP A;  1NMG A;  4HID A;  4JCV E;  2Q8I B;  5EBD A;  1OXS C;  3KDF A;  4CDD C;  3I73 A;  3F2D A;  1EEI D;  4DK0 A;  4OX9 Q;  2JA6 G;  4KJN A;  3S15 H;  4I7Z C;  4XIG S;  4K8I A;  4FNF A;  4QY7 A;  1BQQ T;  2C35 B;  3HKS A;  4FXD A;  1VQG A;  3W3A A;  4RCO A;  1KAW A;  1ET9 A;  1B4O A;  1DM0 B;  2ZJQ A;  2CVR A;  5CV9 A;  1B8A A;  2NZ1 D;  2B2T A;  5CV7 A;  3Q0A A;  2VB2 X;  2Y0S E;  3KF8 A;  4LF9 L;  1J9O A;  5KEE A;  1PYS B;  2E2H H;  1STA A;  1R4P B;  4KMU C;  2N78 A;  2PCF B;  2NUC A;  1IHZ A;  1K28 A;  3CAM A;  1STB A;  1PFN A;  2KJX A;  3PCO B;  1K73 C;  4DV5 L;  4DV4 Q;  1CQF A;  1L0W A;  1D7Q A;  3DLL A;  1CK1 A;  3QG1 A;  2XN9 C;  4A3L H;  1VF5 C;  1CKO A;  1V43 A;  3FEW X;  2HDM A;  4IN3 A;  1KRT A;  3GTJ B;  1FYC A;  1B9M A;  1EY5 A;  2AKW B;  2NVX B;  2PQA B;  1Z6H A;  2A69 C;  4DV7 Q;  1TY0 A;  3GTG H;  2RSO A;  2B63 B;  2R93 B;  3H3V H;  3J80 E;  3WWV A;  3J7Z C;  4ZYS A;  2OTJ A;  5CYU A;  3MEH A;  2RF4 A;  3T1H L;  1EY4 A;  5C44 B;  3I8Z A;  4B3M L;  3I91 A;  2ASB A;  1C9O A;  1RD9 D;  2ZJR A;  4EQ5 A;  3PQI A;  3SXH A;  2OTL A;  2K5D A;  5D14 A;  5IGB A;  3F8T A;  3T53 B;  3FVQ A;  2BE5 D;  4QL5 A;  3UE1 A;  4EQN A;  4YWM A;  1CSP A;  3K80 C;  5FLM H;  2ZM6 Q;  1XPR A;  1A2U A;  4EQO A;  2ID0 A;  1XJV A;  3B6Y A;  1PFB A;  3JAM c;  3S2D H;  3RD4 A;  2OF1 A;  5EAY A;  3V05 A;  4A3G H;  5J22 A;  1ET6 A;  1B44 D;  1H9S B;  4NMZ A;  1SYG A;  4JK1 C;  4G7H C;  4RKB A;  4JBK A;  4FXK C;  1EWH A;  3TRE A;  3G71 A;  5JJI A;  3ER0 A;  1SRO A;  1SE4 A;  4JYA L;  1MSG A;  1VQC A;  1H9R A;  2PW7 A;  3BG3 A;  3FKI B;  4MTN A;  3NEN A;  1QVF A;  1BDO A;  3GO5 A;  3S14 H;  1VF7 A;  1XNR Q;  3KK7 A;  3H91 A;  3PF4 A;  4DFA A;  1HUN A;  4HJ9 A;  4HTH A;  3T16 A;  2Y0S G;  3K59 A;  1IBM L;  2CFM A;  4IQZ A;  1WCM B;  1KHI A;  1EY6 A;  4DR2 L;  1CSQ A;  4FDB A;  4Y7N B;  2EVB A;  2N49 A;  4JBJ A;  5IYD H;  2KEC A;  3RLF A;  5ELO A;  4LUZ A;  3C3L A;  5C4X B;  2RBM A;  1EY0 A;  1L1O A;  3HOX B;  2MO0 A;  4CKB A;  1O78 A;  3VR6 A;  1BVS A;  2F0P A;  2LXK A;  4JVZ A;  4C2M B;  2F3I A;  4IPG A;  2HIV A;  1YI2 A;  1EEF D;  1EU4 A;  3T1Y L;  1OO9 B;  1WTW A;  2A19 A;  5I4D A;  4JI4 Q;  5LMU L;  1HNZ L;  1RKN A;  5NUC A;  1NTG A;  2FJ2 A;  5M3M B;  3M4Q A;  2GA4 B;  3VA7 A;  4DNT B;  1JC7 A;  1E0B A;  1EQQ A;  3DWA A;  4RCN A;  5C4J B;  3GTM B;  2WAQ G;  1KDA A;  1D8L A;  4XT1 B;  2QF7 A;  3TBI B;  5C3X A;  3ONA B;  3RMH A;  1QVC A;  3CKI B;  1LTL A;  2I5H A; 
#chains in the Genus database with same CATH homology
 5IP9 H;  5IYC H;  2QA4 A;  1IZ6 A;  4BBR H;  3FKI H;  2Z6K C;  4EX5 A;  4UPA A;  3KLW A;  1XMQ L;  3KJP A;  1GKH A;  2VL6 A;  4KHZ A;  3K7U C;  3CXC A;  3CQZ H;  1ASZ A;  3PUX A;  4JI8 Q;  3I55 A;  4DV2 L;  2K50 A;  4A76 A;  3U4V A;  4PZ7 A;  4LFA L;  2JA8 G;  1J5E L;  2NN6 G;  2V1C C;  3HOW G;  4JBM A;  1E1T A;  1PH1 A;  3J81 j;  4JOI A;  1P8L A;  3GTO H;  4RMF A;  1VQH A;  2EQS A;  4JI1 L;  2BH8 A;  5JEA J;  3CCU A;  3T1Y Q;  1Q7Y C;  5IE8 A;  3L0O A;  1VQ8 A;  2Q2U A;  4LF5 L;  2R92 G;  3U50 C;  4DR5 Q;  2D62 A;  2WB1 E;  2LXJ A;  2XTI A;  5LMU Q;  3PV0 A;  3GDE A;  1WCM H;  4X66 L;  4GOP C;  3S1R H;  1K8G A;  2DUD A;  1HNZ Q;  2E5L L;  1AE3 A;  2K75 A;  2XGT A;  2ZTC A;  4Y7N H;  4NXM Q;  2VUM G;  1VQK A;  1E24 A;  4JI7 L;  1UE5 A;  3J80 i;  4X62 L;  1SN8 A;  2VQF L;  2UUC L;  4BXX H;  4DR7 Q;  5E7N A;  4OWX B;  4DV1 Q;  4HIO A;  1VQ5 A;  4LF6 L;  5C4X H;  4NPS A;  2HT1 A;  3H3V I;  1T9H A;  2NVY H;  3J7A 5;  1YEZ A;  1VS0 A;  3HOX H;  2UUA Q;  3MEF A;  4LUV A;  3CME A;  1PV4 A;  1YHQ A;  4A3C G;  4C2M H;  1C7Y A;  1EWI A;  3I56 A;  4DV5 Q;  1VQ4 A;  1XMQ Q;  4BY1 H;  3HOV G;  2EIF A;  1Y1W G;  4A3B H;  4GKJ L;  2Q2H A;  3BZC A;  2JA5 H;  4P75 A;  4LFA Q;  4DV2 Q;  3HOU G;  2R7Z H;  1B70 B;  1OTC A;  1J5E Q;  5GRO A;  1KXL A;  4X65 L;  4L5Q A;  4LUO A;  3RZD H;  2E2I H;  3FP9 A;  4KLK A;  2OCE A;  3G48 A;  5IY0 A;  4NB3 A;  4JI1 Q;  4DUZ L;  1X3E A;  3H0G G;  1YIJ A;  4LF5 Q;  4NXN L;  4WJ3 M;  5GAD C;  2ES2 A;  4DR4 L;  3S17 H;  4DR3 L;  1PYB A;  5C4J H;  2JA6 H;  3GTM H;  4X66 Q;  2E5L Q;  5BR8 Q;  1JMC A;  3W5O A;  1S40 A;  4UY8 C;  2OQ0 A;  3KYH C;  4P71 A;  5IT9 c;  1ASY A;  2F4V L;  1P16 A;  1A62 A;  4IO9 A;  3K0X A;  2IX1 A;  4JI7 Q;  1VQP A;  4X62 Q;  2VQF Q;  3S2H H;  1R9T H;  2UUC Q;  1FGU A;  4POG A;  3UDF A;  4A3D H;  4R4Q A;  4DK6 C;  1PH3 A;  4LF6 Q;  3W1G A;  3MXN B;  3AYH B;  4B3S L;  2MQH A;  2R6G A;  1MJE A;  1MKH A;  4L5S A;  1SRU A;  4X6A H;  4IPD A;  3F2C A;  4JBW A;  4B3R L;  3CCR A;  1JJG A;  4GKJ Q;  4GNX B;  4POF A;  4GNX A;  3E9H A;  4JI2 L;  3ULJ A;  2I0Q A;  2K4K A;  1VQA A;  1CKM A;  2PNH A;  4YY3 L;  4DUY L;  2HHH L;  2JEA I;  2UXB L;  3EBE A;  1N34 L;  2UUB L;  1Q1B A;  4X65 Q;  3TS0 A;  1OXX K;  1X3F A;  4LNQ A;  1NY4 A;  1VQ9 A;  4QGU A;  3W1B A;  3GTQ H;  3M3Y H;  4BBS G;  3G6E A;  2Q2I A;  3BJU A;  3CPW A;  4DUZ Q;  4DV6 L;  3RNU A;  4DR6 Q;  5FJ8 H;  4NXN Q;  1O7I A;  1SFO H;  1L1O C;  2OWO A;  3I4N G;  1XNQ L;  4DR3 Q;  1BBW A;  4DR4 Q;  1AH9 A;  2CWP A;  4R4T A;  4LF8 L;  1PVO A;  4DV3 L;  4GLX A;  1NE3 A;  2K5V A;  3PIO A;  1A8V A;  4A3I G;  2F4V Q;  3GTP H;  1QZG A;  1VQI A;  2Q2T A;  5FLM G;  4GN3 B;  1QUQ B;  1QUQ A;  1B7Y B;  2JA8 H;  1BKB A;  3CPF A;  1IYJ B;  2ZTE A;  3M7N A;  5C3E H;  3HOW H;  1HNW L;  1BBU A;  3CCS A;  4DK3 C;  4LW1 A;  2YU9 H;  4B3S Q;  4OWT B;  3GD7 A;  2IT1 A;  4OXP A;  3I7F A;  2UXC L;  5AJ3 L;  4LFB L;  1NJI C;  4A3G G;  1AE2 A;  4B3R Q;  4GS3 A;  4HJA A;  3TEH B;  4QQB X;  2R92 H;  1TWC H;  3HOZ H;  3STB D;  1PH4 A;  3Q8D A;  2F52 A;  3TRZ A;  2VQE L;  4JI5 L;  3TQY A;  4JI2 Q;  4XTC S;  4YY3 Q;  2JE6 I;  5J3B A;  3F2B A;  4DUY Q;  4A3F G;  2HHH Q;  2UXB Q;  1M90 C;  1JJ2 A;  1N34 Q;  2UUB Q;  4KHP L;  2VUM H;  4A4I A;  3OTO L;  4DV4 L;  3ZJY C;  4APV A;  4P72 A;  1EIY B;  4C3H H;  3DM3 A;  2KHJ A;  1Q1E A;  1IXR A;  2VY3 A;  4DV6 Q;  1YVC A;  5IWA L;  1LYL A;  1HJP A;  4JI3 Q;  4HIM A;  1XNQ Q;  2KBN A;  4LF8 Q;  4IOA A;  1X56 A;  1LUZ A;  1EYG A;  1U5K A;  4IFD I;  2VNU D;  1OXV A;  4JOI C;  1FL0 A;  1Y14 B;  4BY7 G;  4R4I A;  1EFW A;  2ZJP A;  3HOU H;  1I3Q H;  5HGQ A;  1VQL A;  1K8A C;  3HKZ G;  1HNW Q;  4A3J G;  2CCZ A;  4QJF A;  1M1K C;  4OO1 I;  2R93 G;  4P74 A;  2B63 G;  2BA0 A;  2H5X A;  2UXC Q;  5AJ3 Q;  4LFB Q;  3PF5 A;  1NBW A;  1YHB A;  4JC0 A;  4AIM A;  1YZ6 A;  4X64 L;  2YTY A;  5C44 G;  5IP7 H;  3KJO A;  4YWK A;  1X65 A;  2VQE Q;  5GAE C;  4JI5 Q;  2B3G A;  5IYD G;  4LFC Q;  1SR3 A;  3PSI A;  4KHP Q;  2E2J H;  1FVI A;  2IHF A;  2AMC B;  4DPG A;  3GTK H;  2ATW A;  3A5Z B;  3UDG A;  3KF6 B;  3KF6 A;  2R7D A;  4AQY L;  1I94 L;  4O2D A;  5M5Y H;  1TWF H;  4HIK A;  1V9P A;  5IWA Q;  4HJ7 A;  1N36 L;  2D0P A;  1GVP A;  4DNI A;  1L2F A;  2AHO B;  1HNX L;  1X9N A;  1JE5 A;  3JAM i;  5M3F G;  3HOY H;  3RLN A;  4A3E H;  1XMO L;  3U4Z A;  1VQN A;  2QGQ A;  3L2P A;  1XTD A;  3CCE A;  1WFQ A;  4A3K H;  5C0X J;  3LGJ A;  2GVB A;  2HQL A;  3M9B A;  3VDY A;  1TWG H;  1MIU A;  4GN5 A;  4LWC A;  2WAQ E;  3RLO A;  1X54 A;  1S3O A;  4OON A;  4B3T L;  4PMW A;  1DGS A;  2QEX A;  3CCJ A;  1S72 A;  1RIP A;  2EXD A;  5IYB G;  1Q82 C;  4IFD G;  3RZO H;  4YHH L;  1VQB A;  4R1J A;  4YCW A;  2UU9 L;  4JI0 L;  2A1A A;  4DV0 L;  1VCI A;  2VW9 A;  5JJL A;  3PO3 H;  1QVG A;  1E22 A;  5IP9 G;  5IYC G;  4OO1 G;  3D31 A;  3EN2 A;  3FKI G;  4BBR G;  5K36 G;  2PI2 A;  1Q81 C;  3CF5 A;  1QZH A;  4DR1 L;  3E9I A;  1J6Q A;  3M85 A;  4AQY Q;  1I94 Q;  1YBY A;  2CQO A;  4A3L G;  2JA7 H;  1N36 Q;  4GNX C;  1JT8 A;  3J81 i;  4A3M G;  4ALP A;  1VQJ A;  3PGZ A;  1HNX Q;  1WI5 A;  1E3P A;  4HJ5 A;  1PH6 A;  3RN2 A;  1FJG L;  2NVQ H;  1XMO Q;  2I5L X;  1VQ6 A;  1EUJ A;  3CCV A;  4KI0 A;  4GLV B;  4OX9 L;  2WFW A;  1K9M C;  1KRS A;  2K5H A;  3K8A A;  1PH5 A;  4MNO A;  4JV5 L;  2PI2 E;  4B3T Q;  4JG2 A;  4BXX G;  3F1Z A;  2L15 A;  4BA2 I;  1IBK L;  1EQR A;  3H15 A;  3S1N H;  4AYB G;  4YHH Q;  2ALY B;  2PMZ E;  4A93 H;  4JI0 Q;  2YTX A;  1Q12 A;  1HZC A;  3OYY A;  3HOX G;  4DV0 Q;  2NVT H;  3PO2 G;  1I6H H;  2B29 A;  1IBL L;  4LF4 L;  1XPO A;  1YNX A;  1A0I A;  1Q8K A;  1Y1V G;  3CCM A;  1X3G A;  5GQO A;  4YWL A;  3CW2 C;  5H1S E;  4DR1 Q;  4BY7 H;  2ZTD A;  3EIV A;  2JA5 G;  2AWO A;  3UDX A;  1I50 H;  4DAM A;  4P73 A;  1VQD A;  5FLX c;  3PIP A;  2R7Z G;  3KOJ A;  4R4O A;  1NMG A;  2BA1 A;  3PUV A;  4JCV E;  4HID A;  3M4O H;  5HY6 A;  4IJH A;  3FHW A;  1OXS C;  1FJG Q;  4L5T A;  3KDF B;  2RHS B;  3KDF A;  4UP9 A;  5M3M G;  1N8R C;  3F2D A;  1YJW A;  4OX9 Q;  2JA6 G;  4IFD J;  3S16 H;  2RHQ B;  3S15 H;  4AH6 A;  2WB1 G;  1NMF A;  4XIG S;  4QY7 A;  2RCN A;  2JK8 A;  2GN5 A;  2C35 B;  2NZO A;  3A0J A;  1SLJ A;  3HKS A;  1VQG A;  2A8V A;  4JV5 Q;  2N8N A;  3BZK A;  3CMA A;  1HR0 W;  1IBK Q;  1KAW A;  4A75 A;  2JEB I;  1PH2 A;  2HIX A;  1HZ9 A;  2ZJQ A;  2NZH A;  4A3C H;  4GKK L;  1WOC A;  4LF4 Q;  1UWV A;  4DV3 Q;  1H95 A;  1B8A A;  3S24 A;  3ERS X;  1JB7 A;  3SGI A;  1I5F A;  1W3S A;  1OXT A;  1Z9F A;  4DV7 L;  1Y1W H;  3HOV H;  4LF7 L;  1E7Z A;  3KF8 B;  2Y0S E;  4LF9 L;  4IPC A;  3PUY A;  2MNA A;  1X55 A;  1PYS B;  2E2H H;  1A63 A;  4TQU S;  2D0O A;  3H0G H;  3L7Z C;  2JA9 A;  5FJ8 G;  2VZA A;  3PUW A;  5GAG C;  5LMN W;  2N78 A;  4YCU A;  2VS1 A;  3CAM A;  3PCO B;  2YTV A;  1K73 C;  3D0F A;  4DV5 L;  3TS2 A;  3OTO Q;  2K5N A;  4DV4 Q;  1PH8 A;  1L0W A;  1PA6 A;  1D7Q A;  2ZM6 L;  1G51 A;  3DLL A;  3S1M H;  1VQF A;  5ELN A;  4A3L H;  1CKO A;  5GAH C;  2Z6K A;  1V43 A;  4PZ6 A;  5C3E G;  1N32 L;  4OWW B;  1VQM A;  4A3M H;  1KRT A;  2AKW B;  3K81 C;  4K0K L;  1MJC A;  2IHE A;  1SMX A;  1X6O A;  4GKK Q;  1G6P A;  1K0R A;  4HJ8 A;  2PQA B;  2PQA A;  3HOZ G;  1CUK A;  1TWA H;  1EIF A;  4DV7 Q;  3KFU A;  3GTG H;  3K7A H;  3CC7 A;  4LF7 Q;  3H3V H;  3S1Q H;  4C3J H;  5BR8 L;  2KCT A;  4LF9 Q;  3WWV A;  3J7Z C;  5M5W H;  2OTJ A;  3I4M G;  2RF4 A;  3T1H L;  2ASB A;  4B3M L;  3I4O A;  1C9O A;  1EOV A;  4UP8 A;  4C3I H;  2ZJR A;  4BBS H;  1HZB A;  4GOP B;  4GOP A;  1WJJ A;  4X64 Q;  3AQQ A;  4ME3 A;  4EQ5 A;  2OTL A;  2K14 A;  4A93 G;  3CP0 A;  4IJL A;  3I4N H;  3F8T A;  1UE1 A;  3A74 A;  1VQO A;  4L5R C;  3PO2 H;  3J80 c;  3U58 A;  3ICE A;  2R7F A;  1VQE A;  1Y1V H;  4MZ9 A;  1XNR L;  4PZ8 A;  1HR0 L;  4A3I H;  3I2Z A;  2MFI A;  4QL5 A;  1KIX A;  4O0A A;  3M4P A;  3UE1 A;  3HKZ E;  1CSP A;  3K80 C;  4YWM A;  5FLM H;  2ZM6 Q;  3PUZ A;  1XPR A;  1U0L A;  4R4C A;  1KC8 C;  1YIT A;  2ID0 A;  2YYZ A;  1XJV A;  2KEN A;  3B6Y A;  3JAM c;  3S2D H;  1KL9 A;  1N32 Q;  5DLQ E;  3CC4 A;  5EAY A;  2IY5 B;  4A3G H;  4K0K Q;  3JC6 6;  1LM0 A;  4DR6 L;  4PG3 A;  5M3M H;  2DGY A;  5IP7 G;  4JBK A;  4Y52 H;  3TRE A;  2JQO A;  1RL2 A;  2AWN A;  3G71 A;  4A3F H;  1WCM G;  1CKN B;  1CKN A;  1G29 1;  2GVA A;  3ER0 A;  3RR5 A;  1SRO A;  1KQS A;  5JJI A;  3ULL A;  4JYA L;  3T1H Q;  1VQC A;  4B3M Q;  2YV5 A;  5LMN L;  1PFS A;  3AFP A;  2E8G A;  5C0X I;  1N33 L;  3CCL A;  2CKZ B;  5C4X G;  3AEV A;  2UU9 Q;  4MTN A;  3NEN A;  1QVF A;  2KCM A;  2MO1 A;  4TVA B;  4QIW E;  1UE7 A;  1YJ9 A;  3GO5 A;  3GTL H;  3S14 H;  2BH2 A;  3HOY G;  1XNR Q;  1HR0 Q;  4A3E G;  1TWH H;  3GTJ H;  1JJC B;  4BY1 G;  4JI6 L;  4A3B G;  1VQ7 A;  1PH7 A;  4JI4 L;  1N9W A;  3PF4 A;  3J81 c;  1Z47 A;  2CWA A;  4H02 A;  2NVX H;  1UEB A;  4HJ9 A;  4GN4 B;  4A3J H;  2UXD L;  1HH2 P;  3CC2 A;  5M5X H;  1E1O A;  2Y0S G;  4A3K G;  2B63 H;  1XPU A;  4J15 A;  1HZA A;  2R93 H;  5JEA G;  3G4S A;  3AFQ A;  1IBM L;  1GO3 E;  3NEM A;  1Q46 A;  5JJK A;  2CFM A;  1WYD A;  4RG1 A;  5C44 H;  1KHI A;  2N3S A;  2OQK A;  4GLA C;  4JI3 L;  1CSQ A;  2NN6 I;  4DR2 L;  3RN5 A;  4FDB A;  2I5M X;  2N49 A;  4JBJ A;  5IYD H;  3HFZ B;  1TXY A;  4YCV A;  5ELO A;  3RLF A;  3PO3 G;  4LUZ A;  2Z0S A;  2IX0 A;  2KHI A;  1W2B A;  4JYA Q;  2LSS A;  1L1O B;  1L1O A;  5LMN Q;  1Q86 C;  3STB C;  1C0A A;  2MO0 A;  2WP8 J;  3A5U A;  4A3D G;  1OXU A;  4JI8 L;  1N33 Q;  1BVS A;  2LXK A;  3IRB A;  3ULP A;  4DAY B;  4IOC A;  2FXQ A;  1V1Q A;  2K52 A;  2JA7 G;  1UE6 A;  2F3I A;  4BA1 I;  4IPG A;  1K3R A;  2HIV A;  1GD7 A;  3NBH B;  1YI2 A;  3CCQ A;  1YHA A;  3NEL A;  1IBL Q;  5M3F H;  3UE0 A;  3T1Y L;  2A19 A;  4DR5 L;  4JI6 Q;  1K83 H;  5C0X G;  4JI4 Q;  5LMU L;  1PH9 A;  1HNZ L;  4LFC L;  1IL2 A;  1NTG A;  1YJN A;  2JJQ A;  2UXD Q;  3E0E A;  4NXM L;  3I4M H;  3UDI A;  4WJ4 A;  1KD1 C;  3M4Q A;  1SE8 A;  3OW2 A;  4DR7 L;  4DKA C;  4AYB E;  3BU2 A;  1EQQ A;  1IBM Q;  3CD6 A;  5IYB H;  4DV1 L;  1PHJ A;  2WAQ G;  4UP7 A;  1D8L A;  1GM5 A;  4IPH A;  4DR2 Q;  1QVC A;  2UUA L;  1LTL A;  2I5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...