5LMUQ

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
b'PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5lmuQ00
2A19A 3BU2A 2ZTDA 1KRTA 4L5RC 1N9WA 2GN5A 5M3MH 4DR4L 1O7IA 1H95A 3OTOL 1UEBA 2K14A 1VQNA 1GKHA 4IFDG 1VQIA 2LXKA 1PHJA 4AH6A 4P74A 2H5XA 1RL2A 4A3JG 4NPSA 4GKKQ 1CKNA 2N78A 4X65Q 1VQ7A 4NXML 4IPGA 3AFQA 3J80i 2A1AA 4YHHQ 5M3FH 3PCOB 3F1ZA 4A76A 3K7UC 2NZOA 5JEAG 2PNHA 3W5OA 4DUZL 5IY0A 3J81j 2N8NA 1L0WA 2MNAA 4DNIA 4JI8Q 1Y14B 1PV4A 4PZ8A 3OYYA 2A8VA 2VZAA 1NY4A 2B29A 5GAEC 2WFWA 4QJFA 5IYDG 4P71A 2Q2TA 3M3YH 4GN4B 4JI1L 1HNWQ 2VQFQ 1IXRA 3CCJA 3CCMA 1X54A 2KCMA 4UP7A 3KF6B 5HGQA 3CF5A 4BY1H 3KFUA 2DUDA 5K36G 3SGIA 2JEAI 4JBJA 4LFAL 4OX9L 1XNQQ 3TRZA 4YWKA 3FKIH 3HOXG 4OXPA 2GVAA 5LMNL 1K0RA 2JK8A 1X3GA 2BH8A 2BA1A 4GS3A 4A3GG 3S2HH 2KHJA 1NMGA 3NEMA 1X6OA 2HIXA 5DLQE 4DK6C 1KQSA 2VNUD 3UDXA 3GTQH 4OO1G 2R6GA 1YHQA 3TS2A 1UE1A 4A3DG 3KLWA 3BJUA 4QL5A 4A3KG 2B63H 2RHQB 2UU9Q 3H3VH 1QUQB 1SE8A 1YNXA 2EIFA 5JJKA 4X65L 1SR3A 1UE5A 2JA8G 1NBWA 4YHHL 3GDEA 5IYCH 2YTVA 4GNXA 2AMCB 3CMAA 3H0GG 3I2ZA 1IBKQ 3AEVA 1JT8A 4O0AA 1B8AA 4JI8L 3S1RH 4BBRH 3A0JA 1FJGQ 5IT9c 4GLXA 4JI2L 4QY7A 1HZAA 1SLJA 4JBWA 1XPRA 1FVIA 5GAGC 2QEXA 4A3DH 4POFA 1MIUA 2VQFL 3CCLA 1XTDA 4P72A 4B3TL 4LFBQ 2CKZB 1Q7YC 1FGUA 1XNQL 1KRSA 2F3IA 3I4OA 3G6EA 3CPWA 1WCMH 3CP0A 1Q1EA 2E5LQ 3K81C 1SFOH 1HNZL 1KXLA 2IT1A 3LGJA 3I4MH 1WJJA 3K7AH 4BBSH 2XGTA 1GO3E 4MZ9A 3KYHC 3GTJH 2AHOB 4HIMA 2I5MX 2MO0A 3HOWH 4BXXH 4JI5Q 5LMNW 1JJCB 2QGQA 4RG1A 2VQEQ 4JI7Q 1S40A 1PH9A 4GKJQ 4X6AH 2OCEA 2R92H 2NVXH 3RLOA 2UU9L 1K83H 1PH3A 2R93H 3PUXA 1N36Q 4EQ5A 3CC7A 1L1OC 1IBKL 4DR4Q 2VY3A 1BBWA 2N49A 5IE8A 3JAMc 1WFQA 4NXNQ 2IHFA 3RNUA 1GVPA 4JCVE 4Y7NH 3MXNB 1HZBA 4R4IA 2NN6I 1I94L 4H02A 2VUMG 3ICEA 1FL0A 2Y0SG 1W2BA 4A3FH 1N33Q 1EQRA 4DUZQ 2GVBA 4LFBL 2LXJA 4QQBX 4OWXB 3W1BA 3M9BA 5FJ8H 1K9MC 4LUVA 3PO3H 4OONA 1SRUA 4HIDA 2FXQA 5H1SE 1CKOA 1KL9A 1E24A 4TVAB 2UUBQ 2ZTEA 2JE6I 5C0XG 3G71A 4DKAC 1K8GA 3S17H 3HKSA 4OO1I 3ZJYC 3U4VA 2IX0A 1VQDA 3CCVA 3HKZG 4GN5A 4LFCQ 2BH2A 3GTPH 2CFMA 2YV5A 3GTKH 4JI5L 4DAYB 4IPHA 1M90C 2VQEL 4JI7L 2UUAQ 2JA7G 3M85A 1K8AC 4GKJL 1CKNB 3CCEA 1X3FA 2E2HH 4A93G 1NJIC 2UUCQ 2ES2A 1CKMA 1M1KC 1A63A 1RIPA 3CCRA 1E22A 4LF7Q 1Z9FA 4RMFA 4X66Q 1PH1A 3GTOH 1WI5A 2I0QA 2KCTA 4AIMA 5IYBH 4XTCS 1VQLA 1B7YB 4LUZA 4MTNA 4NXNL 3I56A 1UE7A 2JA5G 1CSPA 1V9PA 3PUYA 1EWIA 1UWVA 4C3JH 4YY3Q 1MKHA 1Y1VG 1YJ9A 4JI0Q 2Y0SE 4PZ7A 2WB1E 3GO5A 3RLNA 5M3MG 3I4NH 1C0AA 1N33L 1LM0A 1HJPA 3E9HA 1OTCA 1VQ9A 1K73C 5IP9H 3CMEA 3F2DA 5GAHC 3HOYH 4WJ3M 1VQEA 3AFPA 1ASZA 4DR5L 3J7ZC 4JI2Q 2ASBA 3KJOA 3UDIA 3CD6A 1PYSB 1EIFA 2UUBL 1MJEA 4HIOA 2D0OA 2KBNA 3GTGH 1VQPA 1XPOA 3GTMH 4GLAC 3HKZE 4LFCL 2MFIA 2E8GA 2I5HA 2JQOA 2WP8J 2OQKA 2Q2IA 4GNXC 4B3TQ 4A3BH 1PH2A 4JG2A 4HJ7A 1Z47A 3PF4A 4DR7Q 3NENA 4PZ6A 2UUAL 4DV2Q 4A75A 1PH7A 3T1YQ 2NVYH 2UUCL 4DR3L 1HNZQ 1HZCA 1UE6A 4BY1G 4R4OA 3J81c 3HOZH 2VS1A 4LF7L 4GNXB 4X66L 1TWAH 2K75A 3ERSX 2K5VA 4C2MH 3CXCA 4LF5Q 3WWVA 2ATWA 5GQOA 5J3BA 3FKIG 3UE0A 1VQBA 4DAMA 1LYLA 1V43A 4IJLA 3AYHB 4YY3L 5C3EH 1PYBA 3GTLH 2NVQH 4JI0L 1HR0Q 1AE3A 5HY6A 1YIJA 2XTIA 1PH8A 1I3QH 4DUYQ 1XMQQ 4JI3Q 2LSSA 3M4QA 3U4ZA 3NELA 2ZJPA 4HJ5A 4YWMA 1N34L 3RZOH 1TWFH 4IJHA 3T1HL 1GM5A 3PO2H 2B63G 2CCZA 5E7NA 4A3MH 2JA6H 2EXDA 5C4XH 4Y52H 4UP8A 1T9HA 4IPCA 1XMOQ 1I94Q 1SN8A 3J80c 4APVA 1VQCA 5IYCG 3HOUH 4B3RQ 1P8LA 1Q46A 3L0OA 3UDFA 1BKBA 2N3SA 1QVGA 1EFWA 4BBRG 2D62A 4R4CA 1LTLA 4LNQA 3A5ZB 3ULJA 3GD7A 2ZJQA 1A8VA 1K3RA 4DR7L 2Z6KA 4DV2L 3FHWA 3HFZB 3T1YL 2R7ZH 4OWTB 1VQ4A 4QIWE 1XNRQ 1B70B 4IFDI 2UXDQ 4IFDJ 1L2FA 3TEHB 3BZCA 4DK3C 1G291 2OQ0A 4HJAA 2UXBL 4LF5L 3HOVH 3VDYA 1HH2P 1WCMG 2BA0A 1A62A 3UDGA 5JEAJ 5IWAQ 4DV1Q 4BBSG 3I4MG 4JC0A 4R4QA 4LF4Q 5GADC 1E1OA 1HR0L 1JMCA 3TQYA 2I5LX 1XMQL 4DUYL 4JI3L 1S72A 2K5HA 3HOWG 4BXXG 4A3LH 1PFSA 2HT1A 1YVCA 1JJ2A 5IP7H 1VQFA 1VQGA 2R92G 3G48A 1VQMA 1X3EA 4L5QA 4LW1A 2KHIA 2R93G 4GN3B 1XMOL 3S24A 1KHIA 4B3RL 5M5WH 5C44H 1C7YA 1N32Q 4DPGA 3U58A 4DV6Q 2E2IH 3NBHB 4LUOA 3CC2A 3STBD 3K80C 3PUVA 3Q8DA 4A3IH 4DR5Q 3KF8B 4YWLA 4LF6L 1KAWA 4A3FG 3A5UA 2IX1A 4DR1Q 1LUZA 1XNRL 1E3PA 2UXDL 4R1JA 1E1TA 2UXCL 5JJLA 4X64Q 3PO3G 4X62Q 5FJ8G 2HHHQ 3H15A 3A74A 1BBUA 3CAMA 1X55A 3CCQA 4A3EH 2OWOA 2JEBI 1G6PA 1VQ5A 3M4OH 1IYJB 3CCSA 1Y1WH 1QZHA 4O2DA 1SMXA 5IWAL 4POGA 5LMUQ 2HIVA 3F8TA 4DV1L 4GOPA 1IBLQ 4A3CH 4LF4L 4DR3Q 3H3VI 4IPDA 5FLMH 1YHAA 4JV5Q 2E2JH 3F2CA 2WAQG 4MNOA 3ULLA 1PVOA 4JI6Q 4BY7G 1W3SA 1YI2A 1TWHH 2R7FA 3PF5A 3L2PA 2NZHA 1I5FA 1EIYB 2CWPA 4DR2Q 4IO9A 1NTGA 3IRBA 4JOIA 3KDFA 3M7NA 3PUWA 3K0XA 5IYBG 3S16H 4BY7H 1N32L 2CQOA 4LF9Q 1L1OA 5AJ3Q 3OW2A 4DV6L 4UY8C 2AKWB 3EN2A 1E7ZA 4A4IA 3TREA 1N34Q 1YEZA 1OXUA 3T1HQ 4WJ4A 4DR6Q 1MJCA 5BR8Q 2R7DA 4B3SQ 4A3JH 1U0LA 3I4NG 5M3FG 1VQHA 4DR1L 1QVCA 1VCIA 5IP9G 2F4VQ 1VQ6A 4HIKA 2PI2E 3HOYG 4J15A 2MQHA 3CPFA 4X64L 3F2BA 4X62L 1A0IA 4NB3A 2HHHL 4KHPL 5GROA 1PH6A 2D0PA 2PQAA 1YZ6A 1XJVA 5IYDH 3RN2A 4B3MQ 5LMUL 3G4SA 4UPAA 1EUJA 2QA4A 1IBLL 3J7A5 4A3BG 4DV7Q 1J5EL 4JV5L 2WAQE 1OXVA 2UXBQ 2MO1A 4P75A 4JI6L 2K50A 2Z6KC 4YCWA 2VW9A 1PH5A 1J6QA 1CSQA 4JBMA 1VS0A 3PIOA 3HOXH 4DR2L 3HOZG 3DM3A 3EIVA 3DLLA 2YTXA 2C35B 4A3GH 1VQ8A 2NN6G 3KOJA 4LF9L 5AJ3L 2JA9A 2Q2HA 2YYZA 5C0XI 1NE3A 1D7QA 5C0XJ 3CQZH 4JYAQ 1DGSA 3I7FA 3S2DH 1OXTA 5C3EG 2K52A 2IY5B 1X9NA 2Q2UA 5BR8L 3KJPA 5FLXc 4DV3L 4DV4Q 1YITA 4A3KH 3RN5A 1KD1C 4B3SL 1TWGH 1SROA 3B6YA 2AWOA 3UE1A 1VQOA 4DV0Q 4KLKA 2JA8H 3KF6A 1QVFA 3W1GA 2F4VL 2Z0SA 1IBMQ 1WOCA 1Q81C 3PO2G 3H0GH 4LF8Q 1YJNA 3JAMi 3BZKA 4A3MG 2JA6G 5C4XG 4AQYQ 4GKKL 1EYGA 2JJQA 3MEFA 3HOUG 4LF6Q 1GD7A 1TWCH 2ALYB 1Q8KA 1U5KA 4PG3A 4B3ML 4TQUS 3JC66 4DV7L 1VQAA 1ASYA 5ELNA 3AQQA 2UXCQ 4K0KQ 4EX5A 4AYBG 3CCUA 5M5YH 2VL6A 1YJWA 1IZ6A 1QZGA 4JI4Q 4HJ9A 2R7ZG 4C3IH 3CC4A 4BA1I 4LWCA 1QUQA 1HNWL 2ZTCA 4DR6L 2DGYA 2F52A 4KI0A 1HNXQ 2YU9H 4GLVB 2B3GA 4DV5Q 5EAYA 1JB7A 3HOVG 3E0EA 5ELOA 2K4KA 1X65A 2YTYA 1OXXK 3RR5A 3D31A 2ID0A 4JYAL 2PMZE 1X56A 1KC8C 3M4PA 4UP9A 5M5XH 3PIPA 3I55A 3EBEA 4DV4L 4GOPC 4XIGS 1VQKA 1OXSC 4A3LG 4P73A 4DV0L 4FDBA 4YCVA 1AE2A 1CUKA 4R4TA 4JBKA 3E9IA 5IP7G 1IBML 1YHBA 2CWAA 3D0FA 1R9TH 4LF8L 4KHZA 1AH9A 5C4JH 4AQYL 3CW2C 1I50H 2ZM6Q 1PA6A 1C9OA 4JOIC 4GOPB 5C44G 3U50C 1PH4A 2VUMH 2IHEA 2OTJA 4OWWB 3OTOQ 2RCNA 3RLFA 2RHSB 4QGUA 4AYBE 1NMFA 4A3IG 3RZDH 1FJGL 2NVTH 3S1QH 4K0KL 4KHPQ 2KENA 3S1MH 1EOVA 4IOCA 4JI4L 1I6HH 2PI2A 1IL2A 4NXMQ 2WB1G 3FP9A 3KDFB 4L5TA 2EQSA 2V1CC 3PGZA 1HNXL 3PSIA 1L1OB 4DV5L 1J5EQ 1G51A 1HZ9A 1YBYA 4A3EG 2OTLA 3TS0A 2AWNA 3S14H 4YCUA 2K5NA 1TXYA 1WYDA 1Q1BA 1Y1WG 4A3CG 2E5LL 2JA7H 3S15H 4JI1Q 2ZJRA 3ULPA 1HR0W 4BA2I 5FLMG 4A93H 1BVSA 2L15A 3K8AA 2HQLA 1Q86C 3J81i 1XPUA 1D8LA 4C3HH 1N8RC 3L7ZC 1Q12A 3S1NH 1P16A 1JE5A 4LFAQ 4PMWA 4OX9Q 4IOAA 1Q82C 3PV0A 1EQQA 1JJGA 3STBC 5JJIA 1VQJA 3PUZA 2JA5H 2PQAB 1S3OA 2RF4A 2ZM6L 5LMNQ 4DV3Q 1KIXA 4HJ8A 4ALPA 1V1QA 4L5SA 1N36L 1Y1VH 3ER0A 4ME3A
chains in the Genus database with same CATH superfamily
5EBCA 1N9WA 2GN5A 5M3MH 1O7IA 1EY0A 5EBDA 5EKKA 3K5NA 1L0YB 3GP7A 1GKHA 3NE5B 2H5XA 1UUPA 4HMIA 1DOKA 4CDFC 1VQ7A 3IFDA 4IPGA 3DWPA 5M3FH 4YIJA 2NZOA 4DUZL 2N8NA 3EQLC 4DAPA 4DNIA 4PZ8A 2MP1A 1IW7D 1ML0D 5A2QL 4ZKBB 5C6AA 4GN4B 2K32A 1IXRA 1X54A 3KF6B 3VYUA 1U4LA 2F3VA 2PO4A 1SE3A 2JEAI 2HD3A 3ND9A 1JR0D 3GV6A 3HOXG 2QDBA 3MAQA 2JK8A 1X3GA 3V2TA 2HDMA 4DAVA 4A3GG 1KNEA 1IKMA 1X6OA 5DLQE 1RF2D 3BDCA 2R6GA 1UE1A 2AUKA 1B9NA 2B63H 5CMDA 1BR9A 2EIFA 2NB0A 4LMQD 3C46A 1UEAB 1HPCA 3TZUA 2EY1A 4C56C 4GNXA 2AMCB 1II3A 3I2ZA 3CMAA 1B8AA 1FJGQ 1E2WA 3BG3A 2EZVA 5IT9c 4P2CB 3HOWB 4KN7C 1RD9D 1EY6A 1SLJA 4JBWA 1XPRA 2QEXA 2DY8A 4EQPA 2NVXB 3NBIA 5HURA 4P72A 3J7AV 3A54A 1CT1D 2AQ2B 1DOLA 4NW2A 4Q0FA 1D1IA 4C3IG 1KRSA 5E4WC 3CP0A 5C4ZA 3RZDB 4J6HA 2Z4HA 3TMEA 3I4MH 3K7AH 1G91A 5IGGA 2TMPA 3OIPA 3D6WA 4HIMA 4KHVA 3BDOA 4N8FA 2VQEQ 2LS01 2QGQA 4RG1A 3AMUA 4GKJQ 3I3CA 5KNBA 2Z6BA 1JWMD 2EYFA 1PH3A 1NAPA 3S14B 1DZ1A 4K14A 3H6MA 4HSVA 2K5WA 1WFQA 4G57A 1CA6A 3TP8A 1B3QA 2NN6I 2WAQB 1D5MC 3SEBA 1ENAA 4C3HB 2PPBC 4MIUA 1W2BA 4A3FH 1EQRA 1F2YA 3BVZA 2LXJA 3PO3H 4QB4A 4OONA 4LAAA 4HIDA 2EYMA 1CKOA 1KL9A 5H1SE 5I2XA 1PRTF 2LFNA 3TSSA 4HTHA 3HKSA 1H9JA 5FOBB 1VQDA 3FRPB 2BH2A 1U4PA 1W6JA 3BVMA 4Z9CB 3GTPH 1SNPA 4RWSC 4DAYB 1F2ZA 2VQEL 2UUAQ 2JA7G 3M85A 3Q0AA 4GKJL 1CKNB 4PMCA 2ES2A 1PTOH 1CTMA 3MWYW 2Z4IA 2RDFA 1WTWA 5I9PA 1CSPA 4BY1B 1V9PA 1UWVA 2F0NA 4H13C 2B2VA 3T53B 5M3MG 1LTSD 3FKIB 1K73C 3F2DA 4JK1C 5GAHC 4F87A 1ASZA 4L6TB 1PYSB 1EIFA 4HIOA 2I46A 2D0OA 2WIIB 3GTMH 4GNXC 5CV6A 2WP8J 2Q2IA 1QWYA 2D5DA 1PH2A 3HZXA 4A3BH 1I4QA 4PQXA 2UUAL 1PH7A 3S1RB 3N6RA 1XTCD 1HNZQ 1CHQD 4R4OA 3HOZH 1PRTD 3A7AB 1TWAH 2K75A 2WACA 3ERSX 3NP8A 4C2MH 4CJ2C 3CXCA 1U9RA 3WWVA 3HOUB 3UE0A 4DAMA 1LYLA 1V43A 4IJLA 1PZJD 1O80A 4L8JA 3VR4A 5C3EH 4AYBB 1V1PA 4CDDC 5E4XA 3MVVA 1BXTA 1WTRA 1BOSA 4DUYQ 1M4VA 2ZJPA 4IJHA 3K5MA 3PO2H 2B63G 5E7NA 3SVMA 4A3MH 2EXDA 2JA6H 1EEFD 4Y52H 2EYHA 1T9HA 3NHHA 4IPCA 3NTKA 1I94Q 3H94A 3I72A 4APVA 1P8LA 1EFWA 2D62A 4DK1A 1SAPA 4R4CA 3SK6A 2EJGC 2BOSA 1BDOA 3JAME 4QIWE 1B70B 5LHY1 3OHXC 1ZKOA 4G7ZC 3BZCA 2OQ0A 4HJAA 3RD4A 2L4NA 5F2DA 3UDGA 3R2TA 3SXHA 5JEAJ 3I4MG 3FPUB 2I5LX 4DUYL 1S72A 1VF5C 2QF7A 4NP5A 1PFSA 1LABA 1JJ2A 2H1EA 1X3EA 1EY4A 2KHIA 3GTKB 1EY5A 2QW7A 1KHIA 5EPLA 2SNMA 1STYA 2SNSA 5FK9C 3PIO3 3CC2A 3Q8DA 2E2JB 3A55A 4ZYSA 2EY6A 3GTOB 3KF8B 4YWLA 1NNXA 4LF6L 2B2VC 4A3FG 1ICWA 3HS0C 1IL8A 4RGTA 4X64Q 3PO3G 3R3OA 5D14A 2OWOA 3S16B 1ZYRC 5K5PA 1BBXC 2FMMA 2VB2X 1QZHA 4POGA 4A3CH 4IUTA 4GOPA 2H4OA 1IBLQ 1QJOA 4XT3B 2KOLA 5T1GA 4A3JB 1BCPF 2E76C 4MNOA 1PVOA 2LY7A 4N9PA 1TWHH 1JCKB 2LMCB 2SDFA 4K5XA 3PUWA 3K0XA 1I4HA 4BY7H 2VB3X 5AJ3Q 2F0UA 2RBMA 2AKWB 1X3QA 2O5IC 4K8JA 1FD7D 5DM63 1LT4D 5JPNC 4IFDH 1SNOA 3KLSA 3N52A 1U0LA 3URYA 1IHZA 4I7AA 2I07B 1VCIA 4HSPA 2F4VQ 4HIKA 4J15A 5D3IB 2K5QA 4X64L 1J8IA 4RCNA 1STEA 1GUTA 1I3QB 1PH6A 4NDXA 4H44C 3S2DB 3ZYYX 1IBLL 1F9RA 4FXGC 2CVRA 4JVZA 1SJHD 3J7A5 4A3BG 3EVQA 2WAQE 5D3DA 2MO1A 2M2LA 1B50A 2VW9A 1PH5A 2L11A 2X6LA 3HOZG 3C1EA 2C35B 1TS3A 1A3TA 5A35A 5J22A 3I4LA 5AJ3L 5C0XI 4GZYC 3CQZH 3OW7A 1K8MA 2F0OA 5C3EG 2IY5B 1KD1C 4DV4Q 1EZ8A 1EY9A 4MHEA 1SROA 1VF7A 2AWOA 2JA8H 2F4VL 3PO2G 3H0GH 2BDNA 4ILWA 4A3MG 2JA6G 4GKKL 2J0TD 1EYGA 3MEFA 3DEPA 4TQUS 5IT9L 3JC66 1VQAA 2G9HD 1ASYA 2F0VA 4OGQC 4EX5A 3D6CA 3CCUA 1EEID 1QZGA 1IZ6A 3CKIB 1DJRD 4CKEA 2E2IB 4BA1I 1R9TB 1QUQA 2DGYA 4KI0A 1HNXQ 1MI2A 2YU9H 4DV5Q 5EAYA 2HUGA 1JB7A 4RHRA 2A68D 1X65A 2Y0SB 1OXXK 3RR5A 1STBA 3D31A 1BCPC 5M5XH 3I55A 2DY7A 3EBEA 4DV4L 4GOPC 1VQKA 3QB3A 3HRZC 4FDBA 1VDZA 3E9IA 2ENBA 3PMFA 2CWAA 1LLRD 3W3AA 4KN4C 3CRLC 3HKZB 1U4MA 4K6DA 1GHJA 3U50C 4K2LA 4WFN3 4RKBA 3FMCA 4OWWB 2RCNA 2RHSB 4AYBE 3RZDH 1LV9A 2NVTH 3S1QH 5KYIA 1I6HH 3S1NB 1E0BA 3FP9A 1B4OA 1HNXL 3PSIA 1L1OB 1HFGA 4DV5L 1Y1VB 2OTLA 2K28A 3S14H 3VYSA 4EQOA 1WYDA 4JPBW 2A6HC 4A3CG 2E5LL 3ULPA 4A93H 2B39A 1HXYD 3K8AA 3E5SA 3J81i 4G4KA 4C3HH 1N8RC 4IOAA 3Q23A 2EY5A 1ZEQX 3PUZA 4RAUC 1DD2A 4DV3Q 1PTOF 4ALPA 4S3SA 4BY7G 1F9SA 4DR4L 2PZTA 1D2BA 1VQNA 4IFDG 1LT3D 4AH6A 1RL2A 1WTHA 2N78A 2NBFA 2A1AA 4A76A 3K7UC 3W5OA 2F3WA 4JI8Q 2A8VA 1RKNA 3S2HB 3X3MA 3L3OC 4QJFA 3IKJA 4HCEA 4ZLTF 1A2TA 4P71A 2Q2TA 2AUJD 1HNWQ 2VQFQ 3CCJA 2A6ED 5HGQA 5C3XA 3CF5A 4BY1H 4JBJA 3TRZA 4YWKA 3FKIH 4R9WA 1O7LA 5ELFA 5M5YB 2BH8A 4GS3A 1O78A 1GUSA 4OELB 1EQTA 3UDXA 3GTQH 3P75A 4OO1G 1UAPA 1FNUA 1YHQA 3TS2A 1CZGA 5J39A 3BJUA 4IQZA 1JOOA 3H3VH 1YNXA 3BS1A 2CH4A 3C1FA 4KJOA 1LACA 1SR3A 1UE5A 2JA8G 1WCMB 3M7GA 2YTVA 4BS9A 3H0GG 3EFXD 3VYTA 4PNYA 1ZXTA 4JI8L 3S1RH 4BBRH 1TS5A 2XNAC 1F2MA 4GLXA 4JI2L 1RTOA 1LTBD 3Q6SA 2R92B 1MIUA 2VQFL 3K0YA 4B3TL 3I90A 4LFBQ 2FJ2A 2R93B 2VUMB 4ZK9B 1ILPA 1Z6HA 2ZT9C 3T56B 2XGTA 3VA7A 3GTJH 2AHOB 2EYJA 4TKOB 1S40A 2EJMA 4XDXA 5ISRA 3RLOA 1YNND 2A74C 2ICIA 2WINB 4IURA 2J7ZA 1L1OC 2VY3A 1BBWA 2N49A 4CKBA 5IE8A 2IHFA 1F77A 2CW0D 1IYUA 4JCVE 3MXNB 4XQJA 2JN4A 1JOQA 5E1FA 4IZ8A 2E2HB 2JA5B 5JJZA 4DUZQ 2GVBA 4LFBL 1WTVA 4X3KA 4KD3A 4OWXB 1KTKA 3M9BA 1SRUA 1E24A 4TVAB 2UUBQ 2TSSA 4C1NK 1T5EA 1K8GA 3U4VA 2IX0A 4LFCQ 3QR8A 4KD4A 1F9QA 4EGVA 3NBHA 3GTKH 4ZKCB 3VYRA 1PFBA 4A93G 2B2TA 2UUCQ 1T5XD 2F0GA 4ID6A 1RIPA 1SEBD 1Z9FA 4RMFA 3GTOH 1WI5A 4C3HG 1SE2A 2KCTA 2I0QA 3GTGB 1B7YB 5IOCA 1UE7A 1QB5D 2QDLA 3VA5A 3PUYA 4C3JH 2DN8A 2N88A 2Y0SE 1PZID 1LM0A 3E9HA 5IP9H 3HOYH 4WJ3M 4ABNA 3AFPA 3P20A 2UUBL 1CFMA 1HQMC 1VQPA 1XPOA 4MN3A 4GLAC 3HKZE 4LFCL 2NVQB 2OQKA 4JW0A 4HJ7A 4DR7Q 1E2ZA 4PZ6A 1TY2A 1TWFB 2HCIA 1AW7A 2DNCA 2NVYH 2UUCL 1HZCA 4BY1G 3J81c 5IT9E 4GNXB 2K5VA 2NN6H 2F0QA 1RJTA 2OEOA 3FKIG 5J3BA 2ATWA 1AP0A 1SMYD 2QEJC 3VR3A 4KY7A 5I6WA 3FPPA 1HR0Q 3IAYA 5HY6A 5CV9A 1I3QH 1XMQQ 4XT1B 2R7ZB 2NYZD 2Q8IB 3U4ZA 1SFOB 4HJ5A 1N34L 2QKIC 5CC4A 4BBSB 3TBIB 5C4XH 1IW7C 3HOVB 5CORA 5C3WA 1SN8A 3QOLA 5IODA 1CHPD 3UDFA 1BKBA 4BBRG 1UNSA 5CV7A 1LTLA 1Q8IA 3ULJA 4DR7L 2Z6KA 3IL8A 4K5WA 3GQBA 1X32A 3HFZB 2AQ3B 3DWAA 2UXDQ 2RVLA 4Y7NB 1L2FA 4DK3C 2UXBL 3K6OA 1JOKA 3D8GA 1A62A 4CJ1B 5IWAQ 2DNEA 4A3IB 4LF4Q 1K3BC 1HR0L 2B8FA 4A3LH 1XMQL 2K5HA 5KNDA 1PRTB 2HT1A 2WB1B 1YVCA 3M4YA 3G48A 4RGOS 4L5QA 5EPJA 4LW1A 2B2TC 4A3EB 1ENFA 1ESRA 5M5WH 1N32Q 1Y1WB 2CQAA 3VR2A 2E2IH 1SYBA 3STBD 2BE5D 4RCOA 3A5UA 4KKUA 1E3PA 2UXDL 1XX8A 1E1TA 2ZXPA 2UXCL 1WD1A 1H9RA 2HHHQ 3LX0A 3H15A 3A74A 1BBUA 3TP6A 1X55A 3CCQA 2PW7A 1TT2A 1TKWB 4O2DA 5IWAL 1A6XA 1JB3A 4LF4L 4IPDA 2QCPX 5FLMH 4EQNA 1YHAA 4JV5Q 1DYQA 1QOHA 3L2PA 1I5FA 4CKCA 2CWPA 1EIYB 1B1ZA 3KDFA 3HEJA 1J9OA 1N32L 2CQOA 3SK8A 1EL0A 3TREA 1YEZA 4C3JG 1MJCA 5BR8Q 2R7DA 3C2PA 2VXWA 1RODA 5M3FG 1VQHA 3I73A 4QUFA 1F2LA 5IP9G 1BNZA 3ONAB 2ICEC 3HOXB 2PI2E 1VQ6A 3HOYG 3GTLB 2MQHA 4NB3A 2HHHL 2KEEA 5GROA 4A3GB 1D5XC 2L1BA 5CYUA 3NTIA 1YZ6A 5IGCA 4XQNA 3RZOB 3K5LA 1YNJD 3G4SA 4UPAA 1EUJA 4DK0A 2JXMB 1J5EL 2EXZA 4JV5L 3H09A 2JSOA 5K36H 3KLRA 2Z6KC 1VS0A 3C3LA 3EIVA 3DLLA 4K8IA 5ELCA 1I4PA 1VQ8A 2NN6G 2RDGA 3FVQA 1ILQA 1NE3A 2NUCA 1HTLD 3I7FA 2K52A 4A3DH 5BR8L 3I8ZA 5FLXc 4A3KH 3RN5A 2B8GA 3B6YA 4KLKA 4C3IB 4F7XA 1QVFA 5G3LF 3EROA 3W1GA 4XXEA 2XWJB 5C4XG 3T13A 1CQVA 2JJQA 3K5OA 5JPMC 4LF6Q 1GD7A 1U5KA 4FXKC 3L9AX 4DN4M 2IPKD 1PRTC 4K0KQ 3R2IA 5M5YH 2PNRC 5C44B 3MHBA 3CC4A 5COYA 1SYCA 1EZ6A 1I50B 4QF4A 3E0EA 4I7ZC 2K4KA 3RUZA 2RA4A 2ID0A 2M00A 4CJ0B 4A3LG 1TVXA 4P73A 4U673 1CZWA 4O42A 1AE2A 1ZYRD 2KUMA 1B9MA 1HUMA 4OIJA 1AH9A 2GA4B 5C4JH 1BCPB 1PA6A 1JE4A 4GOPB 2EOTA 2VUMH 2JA7B 3S15B 1LTRD 3T51B 5KEEA 2MPMA 3OTOQ 4K0KL 1NMFA 5G3LD 2KENA 1EOVA 4IOCA 2K03A 1LTAD 4FNFA 4DA2A 5C0XH 2KCNA 3WOEA 1QG7A 4WORA 3GV3A 1YBYA 1HZ9A 3IFTA 5BN4A 5M3MB 2K5NA 5M9OA 2O4XA 5JOBA 4BA2I 4JI1Q 5A2QE 2ZJRA 4K5VA 2P5ZX 5FLMG 2JYOA 1DM0B 1K8OA 1Q86C 1XPUA 1H9SA 3L7ZC 4LJZC 4LFAQ 3PV0A 1SYEA 1JJGA 2JA5H 3MXUA 5CBEE 5LMNQ 3A8JE 1CA5A 1HUNA 1V1QA 1FGBD 1N36L 2XIWA 4ME3A 2A19A 2J4XA 1S5CD 2ZTDA 3G6JB 1KRTA 1QCBD 2F0PA 3E3XA 1XYIA 3OTOL 2K14A 1HHVA 3OOCA 1VQIA 2LXKA 3NXWA 1PHJA 4GKKQ 3SK5A 1GXDC 4X65Q 1S5FD 1X3PA 1KLUD 3AFQA 3J80i 3H3VC 3PCOB 3F1ZA 3NQIA 1CK1A 2PNHA 1L0WA 1PV4A 1TWGB 1F9PA 1NY4A 2B29A 5GAEC 2B2WA 2WFWA 2FMCA 1Y8OB 4JI1L 4KK7A 3QWNA 1RCVD 2B63B 3CCMA 1S5BD 2DUDA 5K36G 1TWCB 3J7YW 3SGIA 4FO2A 3J81L 4LFAL 1XNQQ 2MUYA 3DHQA 4OXPA 5LMNL 1FNWA 1PFMA 2A69D 2KHJA 1NMGA 1PZKD 1GUGA 2L5TA 4DK6C 1KQSA 2VNUD 3KLSX 4FVMA 1JC7A 1LO5D 4A3DG 4A3KG 1RHPA 2RHQB 2UU9Q 1QUQB 2FFKB 5JJKA 2PZWA 4X65L 3X3NA 3PQIA 2X69A 3AEVA 1JT8A 1TR5A 3I91A 1VMCA 4QY7A 4CHTB 4X3UA 1FVIA 4F88A 1WTXA 1C4QA 3CCLA 1KDCA 3U9OA 4KY5A 5JAVA 1XNQL 3OSOA 3I4OA 1PYWD 2E5LQ 1FYCA 1D1KA 1SFOH 1KDBA 4BBSH 4MZ9A 3KYHC 1A2UA 3HOWH 4JI5Q 4A3FB 5LMNW 4JI7Q 1SNMA 2F0KA 1PH9A 3OPOA 3P1HA 4DXGA 4KJNA 2NVXH 2D2CC 2UU9L 1FNVA 3PUXA 1EYAA 4EQ5A 2O5JC 1STHA 4DR4Q 4KV6A 4NXNQ 4HAEA 2RSOA 3GTPB 4KTAA 3RNUA 4Y7NH 1BUVT 4R4IA 2R3ZA 2VUMG 1NCVA 1FL0A 1EWCA 2WKCA 3BDLA 4FF3A 4UAIA 1PTOB 3W1BA 4DFAA 5ELDA 5FJ8H 4LUVA 1EY7A 1HCZA 2A68C 2FXQA 4DGZA 2XVSA 5EJWA 1RTNA 2ZTEA 5C0XG 5ELBA 2F0MA 4OO1I 4FXDA 4KKSA 3RMHA 3ZJYC 3U9SA 2JP1A 3T16A 2CFMA 2YV5A 4JI5L 3EJIA 2PYKA 2OT2A 4JI7L 1KNAA 2KECA 1CKMA 4DF7A 1A63A 1ESFA 1E22A 1CM9A 3DMUA 3M3YB 5IYBH 1ICFB 2IL8A 1VQLA 3GTMB 2E75C 4NXNL 3I56A 2JA5G 2PW5A 1DOMA 4YY3Q 1MKHA 1BO0A 1YJ9A 4PZ7A 3GO5A 1HJPA 1OTCA 1VQEA 3UI2A 4DR5L 2ASBA 4JI2Q 3CD6A 3D4RA 2Z9HA 2ZXRA 4QUCA 1MJEA 2KBNA 3SHLA 1V1OA 1QNKA 2E8GA 2PMZB 3ERQA 4B3TQ 2D9UA 1WVLA 4JG2A 3Q22A 1Z47A 3PF4A 5D65A 3OMGA 3NENA 4F8MA 4DV2Q 3WDNA 4CGYB 2KQ3A 1O7YA 3T1YQ 4J1MA 3PO2B 2CH4W 4DR3L 1UE6A 2K7VA 5I4DA 4LF5Q 2Z8LA 5CV4A 5GQOA 1B3AA 1HTPA 1VQBA 3NWTA 4YY3L 1SDFA 3GTLH 4B9WA 1AE3A 1YIJA 1PH8A 4JI3Q 5FO7B 5FLXL 4FF1A 3NELA 3RZOH 2V4DA 3T1HL 1DCZA 4X3TA 2F0SA 4UP8A 2EPBA 4B9XA 1XMOQ 4IUUA 3J80c 3HOUH 4B3RQ 1Q46A 3L0OA 2N3SA 2A6EC 1K83B 2AQ1B 3J7AF 4X3SA 1K0SA 4DXFA 2F0LA 2NTTA 2ZJQA 1K3RA 1EQVA 4DV2L 3A8IE 2EVBA 2HQEA 1B53A 3T1YL 2XWBB 4IFDJ 3F2UA 3TEHB 2SOBA 4ULLA 1H9MA 4LF5L 1GUOA 2Q8RE 4ZAIA 1HH2P 2BA0A 2EE1A 4Q5VA 2RKSA 1JQYD 4BBSG 4JC0A 5GADC 2L0CA 1JMCA 3TQYA 4JI3L 3HOWG 3S17B 1PTOC 3TZDA 4R8IA 1VQFA 1TIID 4NMZA 5KYLA 2IW3A 4DU9A 4GN3B 1XMOL 2XSCA 5DNFA 2PQEA 3S24A 4B3RL 5C44H 1MHWC 4DPGA 5EKLA 3NBHB 2DJGC 3K80C 2G9DA 1TWHB 2IX1A 1LUZA 5JJLA 4X62Q 5FJ8G 5C4HA 3I4NB 2JEBI 1VQ5A 2KHSA 2F0IA 1I6VC 1IYJB 2HDLA 1G6ZA 3SDZA 5LMUQ 2HIVA 3F8TA 3H3VI 1HFNA 1Z7TA 1YNNC 1KDAA 3NQTA 5HGTA 2E2JH 3F2CA 2WAQG 3I70A 3NSWA 4JI6Q 5AFWA 1H9KA 1W3SA 5JVH3 1YI2A 2R7FA 3PF5A 4H0LC 4IO9A 1NTGA 3IRBA 3M7NA 2L12A 5IYBG 3S16H 1HQRD 4UY8C 1N34Q 2F4IA 3J81E 4WJ4A 3KBXA 3QO2A 3D4WA 4XYQA 4B3SQ 4A3JH 5DAUA 1KLGD 3T4AC 5JEAH 3CPFA 3F2BA 4X62L 1A0IA 1ENCA 3DUZA 4ME5A 4QIWB 4KHPL 1SSOA 1WD0A 4M8AA 1MSGA 1S4ZA 2PQAA 3CQZB 1XJVA 2E2DC 5IYDH 3RN2A 4WRDA 4B3MQ 5LMUL 2QA4A 3E6ZX 4CDCC 1OXVA 2UXBQ 2X6GA 4P75A 4FYDA 4JI6L 2JA8B 4OHJA 4YCWA 3VR5A 1CSQA 3H0GB 2K6AA 4JBMA 1NUCA 3R93A 1G8ZD 4DNTB 1W6KA 5CBAE 5DEHA 4IUQA 1DXMA 2JA9A 2Q2HA 5BN3A 1D7QA 4JYAQ 1DGSA 3VR6A 3S2DH 1X9NA 1YITA 1A3UA 3KJPA 4V190 1ET9A 2EYOA 4B3SL 1TWGH 4DV0Q 3BZDB 3KF6A 1PDQA 2B2YA 1IBMQ 4MTKA 2YU9B 4LF8Q 1YJNA 3JAMi 4AQYQ 1EY8A 1SYFA 3HOUG 5EKIA 1TWCH 4B3ML 3Q24A 5M5XB 4R8NA 5ELNA 2UXCQ 4AYBG 2VL6A 1YJWA 1SMYC 5T1IA 2F52A 1EU3A 5KIXA 5ELOA 5JVG3 3MXPA 2RSNA 4JYAL 2PMZE 1X56A 3EA6A 3DXJC 2EDGA 3PIPA 2NVTB 3S1QB 4XIGS 1I6HB 4DV0L 3NUCA 3M4OB 4YCVA 1CUKA 2Q8TA 4JBKA 1QE6A 1IBML 1G2TA 1R9TH 4LF8L 4AQYL 3CRKC 5ELEA 5FKAC 5C44G 2IHEA 3BVGA 4A93B 3RLFA 2QILA 4QGUA 3SR1A 1FJGL 4N9TA 1EU4A 3A8KE 1TS2A 4NXMQ 4L5TA 3G7LA 3KDFB 1I4RA 2V1CC 3PGZA 1SE4A 1MSHA 2F0EA 1J5EQ 1G51A 2KCCA 3TS0A 2AWNA 3ITPA 1TXYA 1Q1BA 1OO9B 2MGSA 1HR0W 2L55A 1BVSA 1LTGD 2HQLA 1V8QA 5FO8B 1FR3A 2RCFA 3S1NH 1Q12A 1P16A 1JE5A 4OX9Q 5KRUA 1Q82C 1EQQA 3STBC 2PCFB 2BE5C 4KKTA 4HJ8A 1O7ZA 4ZCKA 1Y1VH 4L63B 3BU2A 4L5RC 1H95A 1SXTA 1UEBA 2RQXA 4DAYA 2MJ8A 4P74A 4A3JG 4NPSA 1CKNA 2F03A 4NXML 2K05A 1V1PB 4YHHQ 5JEAG 2B2YC 5IY0A 3J81j 5FLXE 2MNAA 1Y14B 3OYYA 2VZAA 3DEOA 2A73B 3MFGA 5IYDG 3GTQB 3M3YH 1QNUA 4UP7A 2KCMA 3KFUA 1SBBB 4B08A 2XN9C 5CR3A 5IGDA 4OX9L 2GVAA 4BBRB 2O2LD 1K0RA 3QJYA 1Y69U 2BA1A 4EVOA 3LWUA 3S2HH 3NEMA 2HIXA 2MHVA 3KLWA 3TP5A 4QL5A 1SNCA 1SE8A 1JWSD 1NBWA 4YHHL 1ET6A 1YNJC 3GDEA 5IYCH 2NTSA 1IBKQ 1U4RA 3HGBA 4O0AA 3J80L 2K04A 3A0JA 4ZQ3A 3GTJB 2ZXOA 2L9HA 1DONA 4RFBA 1TQOA 1HZAA 3KUPA 1PMRA 1SYDA 5GAGC 4POFA 1XTDA 4E6IA 3K58A 2CKZB 3TP7A 1Q7YC 4J8QA 3OWFA 1FGUA 4N8X1 1D6EC 2F3IA 3G6EA 3CPWA 1WCMH 1Q1EA 5FO9B 3K81C 4K6LA 1HNZL 1KXLA 2IT1A 1R4QB 3S1MB 3LGJA 1WJJA 5CV5A 3P7JA 1GO3E 1I4XA 4BXXH 1CQFA 2I5MX 2MO0A 1RDPD 1PLFA 5NUCA 1JJCB 3QOJA 3A56A 3QG1A 4X6AH 2OCEA 2R92H 2SEBD 2RDHA 2B2UA 1K83H 2F0TA 2R93H 1N36Q 4TRDA 4HN7A 3A7LA 3CC7A 4C1NI 1IBKL 1JICA 5LL6S 1A15A 3JAMc 5KGUA 3DWQA 3O13A 1GVPA 1Q3LA 1HZBA 1I94L 1SNQA 4UDUC 4H02A 3ICEA 1Q90A 4UHVA 2Y0SG 2A5HA 4IALA 1N33Q 3D4DA 1H9SB 5KNCA 4QQBX 3AU7A 1AZQA 3HP3A 1K9MC 3MZ5A 4NKLA 1NSNS 1KABA 2JE6I 3G71A 3S17H 4DKAC 1G2SA 2M9VA 1PFNA 4C3JB 3CCVA 3HKZG 4GN5A 3NWSA 4IPHA 1R4PB 5M3FB 1HRJA 1M90C 1NR2A 1K8AC 3KF8A 3HOYB 3CCEA 1X3FA 2E2HH 2HCCA 1NJIC 5I2YA 1M1KC 3CCRA 4LF7Q 1PH1A 1CI3M 4X66Q 2EYPA 3V96A 4AIMA 5EPKA 4XTCS 5CGKA 4LUZA 4MTNA 2LKVA 5IIFA 5I9OA 2K5DA 5BN5A 1EWIA 4IUPA 1Y1VG 3LNNA 4JI0Q 1JWUD 1STAA 2WB1E 3RLNA 1GUWA 3I4NH 1C0AA 1IYVA 1N33L 4HMJA 2NVYB 1VQ9A 3CMEA 2G5DA 1PXUA 3J7ZC 3KJOA 3QIAA 3UDIA 3GTGH 1C8CA 3WOFA 2MFIA 2I5HA 2JQOA 4DNRB 3CU7A 2KEDA 4A75A 1LT6D 3KBGA 1EFID 2R61A 1JORA 1IKLA 3CHBD 5C4XB 4OL7A 1LTTD 2VS1A 4LF7L 1S5DD 4X66L 2F0DA 1EYCA 3AYHB 1PYBA 1TS4A 2NVQH 1EYDA 4JI0L 4ZUJA 2XTIA 5TSSA 2LSSA 3NTHA 5C5LA 3M4QA 4YWMA 1BCPD 1TWFH 1GM5A 2KA7A 3I4MB 3K7AB 1NR4A 4OO1H 2CCZA 1STGA 2B2UC 4WJWA 2FHTA 1TY0A 1VQCA 2XRQD 4RHSA 3V05A 5IYCG 1QVGA 4LNQA 3A5ZB 3GD7A 1EWHA 1A8VA 3FHWA 1AN8A 1I4GA 2WV6D 2R7ZH 4OWTB 1VQ4A 3R8BA 1XNRQ 2A69C 4V0BA 4IFDI 1XXGA 1G291 2EYLA 1SNDA 5M5WB 3HOVH 3VDYA 1WCMG 3OWEB 4DV1Q 2KVMA 3PO3B 4R4QA 1E1OA 4BXXG 1XWEA 2A6HD 5IP7H 1VQGA 2R92G 1VQMA 2R93G 1A3VA 1GOZA 1C7YA 3HG9A 3U58A 1D5ZC 4DV6Q 4LUOA 4RA8A 3MXGA 3PUVA 4A3IH 4DR5Q 4OIKA 1EOTA 1KAWA 5IGFA 4U68A 4OEMB 4DR1Q 3ND8A 3D3RA 1XNRL 2NZ1D 4R1JA 3CAMA 4A3EH 4ZUIA 2NWGA 1G6PA 2B2WC 3M4OH 2F0WA 2WKDA 2KJXA 3CCSA 1GJXA 1Y1WH 1SMXA 1M8AA 4DV1L 4DR3Q 3LWEA 3AB9A 1MD2D 4I65A 5EGTA 5DM73 4RGMA 3ULLA 2F0JA 4IUVA 2NZHA 2IJ0A 4A3BB 4DR2Q 1S5ED 1EIGA 4KY6A 4JOIA 4RGNA 2IX3A 4QCLA 1HA6A 3MFYA 4LF9Q 1L1OA 4H7BA 2PZUA 3OW2A 4DV6L 2K01A 1MBYA 4RKLA 1TU2B 3EN2A 1E7ZA 4HEDA 4A4IA 1OXUA 3T1HQ 3OMCA 3HOZB 4DR6Q 1TWAB 4C2MB 1WTQA 4FP5D 3I4NG 4IN3A 3MEHA 3W2DA 1EIHA 4DR1L 1B44D 1QVCA 5C3EB 1QILA 3MA2B 2BCOA 3PIP3 1Y8PB 4BWGB 5IGEA 3OIQA 1GUNA 4ZRZA 4K2KA 3K59A 2D0PA 2C9OA 3TN2A 1C48A 1SJED 4PV1C 4XQQA 4A3DB 4A3MB 2JA6B 4DV7Q 4A3KB 4XYOA 4CDEC 3J80E 2K50A 1J6QA 4O1NA 4QMGA 3PIOA 3HOXH 4DR2L 3DM3A 2YTXA 5J1ZA 4A3GH 4LF9L 3KOJA 1AFPA 4KMUC 2YYZA 5C0XJ 3K57A 3NK9A 1OXTA 4DR6L 2Q2UA 4DV3L 3FDTA 1MGSA 4G7OC 3KK7A 1STNA 3UE1A 1VQOA 1AZPA 4M1UB 5I6YA 1GHKA 2Z0SA 4RH6A 1WOCA 1Q81C 1WTPA 3BZKA 5C5MA 1SYGA 3MTSA 3S9WA 1BF4A 3DM1A 2ALYB 5E3FA 5IGBA 1Q8KA 4PG3A 1PTOD 2C5CA 4DV7L 3AQQA 2EY2A 2IWHA 2DJFC 2F1MA 1VMPA 4JI4Q 4HJ9A 2R7ZG 4C3IH 2FINB 4LWCA 2BDOA 1HNWL 2ZTCA 5C4JB 4GLVB 2B3GA 1WTOA 3HOVG 3BYTB 3E0JA 3TDQA 2YTYA 1B2TA 4ODGA 1KC8C 3M4PA 4UP9A 1Y8NB 1OXSC 2E74C 4HR7B 1ONLA 2K1BA 2Z1CA 4R4TA 5IP7G 1YHBA 3D0FA 2K33A 3FEWX 4KHZA 5LL6X 2OF1A 3CW2C 4G7HC 1I50H 1K28A 2ZM6Q 3NPPA 4HCSA 1C9OA 4JOIC 3JAML 5L37A 1AEXA 1PH4A 2N55A 2OTJA 1KAAA 5EQ0A 1HA5A 1BQQT 3MC0B 4A3IG 4FF4A 4KHPQ 3S1MH 4BY7B 5CV8A 4LK1C 4JI4L 2PI2A 1IL2A 2WB1G 4PMBA 2EQSA 4TSSA 1L0XB 4A3EG 2F0FA 4YCUA 3H91A 1LT5D 3SE0A 1Y1WG 2JA7H 3S15H 3MXNA 4IUNA 2CW0C 4CBVA 2L15A 1E2VA 2EJFC 2F0HA 1D8LA 4PMWA 2OXPA 5JJIA 1VQJA 2XRSD 2PQAB 1S3OA 2RF4A 1LTID 3SK4A 2ZM6L 1KIXA 4L5SA 2CHBD 3BYYB 4FF2A 3ER0A
chains in the Genus database with same CATH topology
2A19A 3BU2A 2ZTDA 1KRTA 4L5RC 1N9WA 2GN5A 5M3MH 4DR4L 1O7IA 1H95A 3OTOL 1UEBA 2K14A 1VQNA 1GKHA 4IFDG 1VQIA 2LXKA 1PHJA 4AH6A 4P74A 2H5XA 1RL2A 4A3JG 4NPSA 4GKKQ 1CKNA 2N78A 4X65Q 1VQ7A 4NXML 4IPGA 3AFQA 3J80i 2A1AA 4YHHQ 5M3FH 3PCOB 3F1ZA 4A76A 3K7UC 2NZOA 5JEAG 2PNHA 3W5OA 4DUZL 5IY0A 3J81j 2N8NA 1L0WA 2MNAA 4DNIA 4JI8Q 1Y14B 1PV4A 4PZ8A 3OYYA 2A8VA 2VZAA 1NY4A 2B29A 5GAEC 2WFWA 4QJFA 5IYDG 4P71A 2Q2TA 3M3YH 4GN4B 4JI1L 1HNWQ 2VQFQ 1IXRA 3CCJA 3CCMA 1X54A 2KCMA 4UP7A 3KF6B 5HGQA 3CF5A 4BY1H 3KFUA 2DUDA 5K36G 3SGIA 2JEAI 4JBJA 4LFAL 4OX9L 1XNQQ 3TRZA 4YWKA 3FKIH 3HOXG 4OXPA 2GVAA 5LMNL 1K0RA 2JK8A 1X3GA 2BH8A 2BA1A 4GS3A 4A3GG 3S2HH 2KHJA 1NMGA 3NEMA 1X6OA 2HIXA 5DLQE 4DK6C 1KQSA 2VNUD 3UDXA 3GTQH 4OO1G 2R6GA 1YHQA 3TS2A 1UE1A 4A3DG 3KLWA 3BJUA 4QL5A 4A3KG 2B63H 2RHQB 2UU9Q 3H3VH 1QUQB 1SE8A 1YNXA 2EIFA 5JJKA 4X65L 1SR3A 1UE5A 2JA8G 1NBWA 4YHHL 3GDEA 5IYCH 2YTVA 4GNXA 2AMCB 3CMAA 3H0GG 3I2ZA 1IBKQ 3AEVA 1JT8A 4O0AA 1B8AA 4JI8L 3S1RH 4BBRH 3A0JA 1FJGQ 5IT9c 4GLXA 4JI2L 4QY7A 1HZAA 1SLJA 4JBWA 1XPRA 1FVIA 5GAGC 2QEXA 4A3DH 4POFA 1MIUA 2VQFL 3CCLA 1XTDA 4P72A 4B3TL 4LFBQ 2CKZB 1Q7YC 1FGUA 1XNQL 1KRSA 2F3IA 3I4OA 3G6EA 3CPWA 1WCMH 3CP0A 1Q1EA 2E5LQ 3K81C 1SFOH 1HNZL 1KXLA 2IT1A 3LGJA 3I4MH 1WJJA 3K7AH 4BBSH 2XGTA 1GO3E 4MZ9A 3KYHC 3GTJH 2AHOB 4HIMA 2I5MX 2MO0A 3HOWH 4BXXH 4JI5Q 5LMNW 1JJCB 2QGQA 4RG1A 2VQEQ 4JI7Q 1S40A 1PH9A 4GKJQ 4X6AH 2OCEA 2R92H 2NVXH 3RLOA 2UU9L 1K83H 1PH3A 2R93H 3PUXA 1N36Q 4EQ5A 3CC7A 1L1OC 1IBKL 4DR4Q 2VY3A 1BBWA 2N49A 5IE8A 3JAMc 1WFQA 4NXNQ 2IHFA 3RNUA 1GVPA 4JCVE 4Y7NH 3MXNB 1HZBA 4R4IA 2NN6I 1I94L 4H02A 2VUMG 3ICEA 1FL0A 2Y0SG 1W2BA 4A3FH 1N33Q 1EQRA 4DUZQ 2GVBA 4LFBL 2LXJA 4QQBX 4OWXB 3W1BA 3M9BA 5FJ8H 1K9MC 4LUVA 3PO3H 4OONA 1SRUA 4HIDA 2FXQA 5H1SE 1CKOA 1KL9A 1E24A 4TVAB 2UUBQ 2ZTEA 2JE6I 5C0XG 3G71A 4DKAC 1K8GA 3S17H 3HKSA 4OO1I 3ZJYC 3U4VA 2IX0A 1VQDA 3CCVA 3HKZG 4GN5A 4LFCQ 2BH2A 3GTPH 2CFMA 2YV5A 3GTKH 4JI5L 4DAYB 4IPHA 1M90C 2VQEL 4JI7L 2UUAQ 2JA7G 3M85A 1K8AC 4GKJL 1CKNB 3CCEA 1X3FA 2E2HH 4A93G 1NJIC 2UUCQ 2ES2A 1CKMA 1M1KC 1A63A 1RIPA 3CCRA 1E22A 4LF7Q 1Z9FA 4RMFA 4X66Q 1PH1A 3GTOH 1WI5A 2I0QA 2KCTA 4AIMA 5IYBH 4XTCS 1VQLA 1B7YB 4LUZA 4MTNA 4NXNL 3I56A 1UE7A 2JA5G 1CSPA 1V9PA 3PUYA 1EWIA 1UWVA 4C3JH 4YY3Q 1MKHA 1Y1VG 1YJ9A 4JI0Q 2Y0SE 4PZ7A 2WB1E 3GO5A 3RLNA 5M3MG 3I4NH 1C0AA 1N33L 1LM0A 1HJPA 3E9HA 1OTCA 1VQ9A 1K73C 5IP9H 3CMEA 3F2DA 5GAHC 3HOYH 4WJ3M 1VQEA 3AFPA 1ASZA 4DR5L 3J7ZC 4JI2Q 2ASBA 3KJOA 3UDIA 3CD6A 1PYSB 1EIFA 2UUBL 1MJEA 4HIOA 2D0OA 2KBNA 3GTGH 1VQPA 1XPOA 3GTMH 4GLAC 3HKZE 4LFCL 2MFIA 2E8GA 2I5HA 2JQOA 2WP8J 2OQKA 2Q2IA 4GNXC 4B3TQ 4A3BH 1PH2A 4JG2A 4HJ7A 1Z47A 3PF4A 4DR7Q 3NENA 4PZ6A 2UUAL 4DV2Q 4A75A 1PH7A 3T1YQ 2NVYH 2UUCL 4DR3L 1HNZQ 1HZCA 1UE6A 4BY1G 4R4OA 3J81c 3HOZH 2VS1A 4LF7L 4GNXB 4X66L 1TWAH 2K75A 3ERSX 2K5VA 4C2MH 3CXCA 4LF5Q 3WWVA 2ATWA 5GQOA 5J3BA 3FKIG 3UE0A 1VQBA 4DAMA 1LYLA 1V43A 4IJLA 3AYHB 4YY3L 5C3EH 1PYBA 3GTLH 2NVQH 4JI0L 1HR0Q 1AE3A 5HY6A 1YIJA 2XTIA 1PH8A 1I3QH 4DUYQ 1XMQQ 4JI3Q 2LSSA 3M4QA 3U4ZA 3NELA 2ZJPA 4HJ5A 4YWMA 1N34L 3RZOH 1TWFH 4IJHA 3T1HL 1GM5A 3PO2H 2B63G 2CCZA 5E7NA 4A3MH 2JA6H 2EXDA 5C4XH 4Y52H 4UP8A 1T9HA 4IPCA 1XMOQ 1I94Q 1SN8A 3J80c 4APVA 1VQCA 5IYCG 3HOUH 4B3RQ 1P8LA 1Q46A 3L0OA 3UDFA 1BKBA 2N3SA 1QVGA 1EFWA 4BBRG 2D62A 4R4CA 1LTLA 4LNQA 3A5ZB 3ULJA 3GD7A 2ZJQA 1A8VA 1K3RA 4DR7L 2Z6KA 4DV2L 3FHWA 3HFZB 3T1YL 2R7ZH 4OWTB 1VQ4A 4QIWE 1XNRQ 1B70B 4IFDI 2UXDQ 4IFDJ 1L2FA 3TEHB 3BZCA 4DK3C 1G291 2OQ0A 4HJAA 2UXBL 4LF5L 3HOVH 3VDYA 1HH2P 1WCMG 2BA0A 1A62A 3UDGA 5JEAJ 5IWAQ 4DV1Q 4BBSG 3I4MG 4JC0A 4R4QA 4LF4Q 5GADC 1E1OA 1HR0L 1JMCA 3TQYA 2I5LX 1XMQL 4DUYL 4JI3L 1S72A 2K5HA 3HOWG 4BXXG 4A3LH 1PFSA 2HT1A 1YVCA 1JJ2A 5IP7H 1VQFA 1VQGA 2R92G 3G48A 1VQMA 1X3EA 4L5QA 4LW1A 2KHIA 2R93G 4GN3B 1XMOL 3S24A 1KHIA 4B3RL 5M5WH 5C44H 1C7YA 1N32Q 4DPGA 3U58A 4DV6Q 2E2IH 3NBHB 4LUOA 3CC2A 3STBD 3K80C 3PUVA 3Q8DA 4A3IH 4DR5Q 3KF8B 4YWLA 4LF6L 1KAWA 4A3FG 3A5UA 2IX1A 4DR1Q 1LUZA 1XNRL 1E3PA 2UXDL 4R1JA 1E1TA 2UXCL 5JJLA 4X64Q 3PO3G 4X62Q 5FJ8G 2HHHQ 3H15A 3A74A 1BBUA 3CAMA 1X55A 3CCQA 4A3EH 2OWOA 2JEBI 1G6PA 1VQ5A 3M4OH 1IYJB 3CCSA 1Y1WH 1QZHA 4O2DA 1SMXA 5IWAL 4POGA 5LMUQ 2HIVA 3F8TA 4DV1L 4GOPA 1IBLQ 4A3CH 4LF4L 4DR3Q 3H3VI 4IPDA 5FLMH 1YHAA 4JV5Q 2E2JH 3F2CA 2WAQG 4MNOA 3ULLA 1PVOA 4JI6Q 4BY7G 1W3SA 1YI2A 1TWHH 2R7FA 3PF5A 3L2PA 2NZHA 1I5FA 1EIYB 2CWPA 4DR2Q 4IO9A 1NTGA 3IRBA 4JOIA 3KDFA 3M7NA 3PUWA 3K0XA 5IYBG 3S16H 4BY7H 1N32L 2CQOA 4LF9Q 1L1OA 5AJ3Q 3OW2A 4DV6L 4UY8C 2AKWB 3EN2A 1E7ZA 4A4IA 3TREA 1N34Q 1YEZA 1OXUA 3T1HQ 4WJ4A 4DR6Q 1MJCA 5BR8Q 2R7DA 4B3SQ 4A3JH 1U0LA 3I4NG 5M3FG 1VQHA 4DR1L 1QVCA 1VCIA 5IP9G 2F4VQ 1VQ6A 4HIKA 2PI2E 3HOYG 4J15A 2MQHA 3CPFA 4X64L 3F2BA 4X62L 1A0IA 4NB3A 2HHHL 4KHPL 5GROA 1PH6A 2D0PA 2PQAA 1YZ6A 1XJVA 5IYDH 3RN2A 4B3MQ 5LMUL 3G4SA 4UPAA 1EUJA 2QA4A 1IBLL 3J7A5 4A3BG 4DV7Q 1J5EL 4JV5L 2WAQE 1OXVA 2UXBQ 2MO1A 4P75A 4JI6L 2K50A 2Z6KC 4YCWA 2VW9A 1PH5A 1J6QA 1CSQA 4JBMA 1VS0A 3PIOA 3HOXH 4DR2L 3HOZG 3DM3A 3EIVA 3DLLA 2YTXA 2C35B 4A3GH 1VQ8A 2NN6G 3KOJA 4LF9L 5AJ3L 2JA9A 2Q2HA 2YYZA 5C0XI 1NE3A 1D7QA 5C0XJ 3CQZH 4JYAQ 1DGSA 3I7FA 3S2DH 1OXTA 5C3EG 2K52A 2IY5B 1X9NA 2Q2UA 5BR8L 3KJPA 5FLXc 4DV3L 4DV4Q 1YITA 4A3KH 3RN5A 1KD1C 4B3SL 1TWGH 1SROA 3B6YA 2AWOA 3UE1A 1VQOA 4DV0Q 4KLKA 2JA8H 3KF6A 1QVFA 3W1GA 2F4VL 2Z0SA 1IBMQ 1WOCA 1Q81C 3PO2G 3H0GH 4LF8Q 1YJNA 3JAMi 3BZKA 4A3MG 2JA6G 5C4XG 4AQYQ 4GKKL 1EYGA 2JJQA 3MEFA 3HOUG 4LF6Q 1GD7A 1TWCH 2ALYB 1Q8KA 1U5KA 4PG3A 4B3ML 4TQUS 3JC66 4DV7L 1VQAA 1ASYA 5ELNA 3AQQA 2UXCQ 4K0KQ 4EX5A 4AYBG 3CCUA 5M5YH 2VL6A 1YJWA 1IZ6A 1QZGA 4JI4Q 4HJ9A 2R7ZG 4C3IH 3CC4A 4BA1I 4LWCA 1QUQA 1HNWL 2ZTCA 4DR6L 2DGYA 2F52A 4KI0A 1HNXQ 2YU9H 4GLVB 2B3GA 4DV5Q 5EAYA 1JB7A 3HOVG 3E0EA 5ELOA 2K4KA 1X65A 2YTYA 1OXXK 3RR5A 3D31A 2ID0A 4JYAL 2PMZE 1X56A 1KC8C 3M4PA 4UP9A 5M5XH 3PIPA 3I55A 3EBEA 4DV4L 4GOPC 4XIGS 1VQKA 1OXSC 4A3LG 4P73A 4DV0L 4FDBA 4YCVA 1AE2A 1CUKA 4R4TA 4JBKA 3E9IA 5IP7G 1IBML 1YHBA 2CWAA 3D0FA 1R9TH 4LF8L 4KHZA 1AH9A 5C4JH 4AQYL 3CW2C 1I50H 2ZM6Q 1PA6A 1C9OA 4JOIC 4GOPB 5C44G 3U50C 1PH4A 2VUMH 2IHEA 2OTJA 4OWWB 3OTOQ 2RCNA 3RLFA 2RHSB 4QGUA 4AYBE 1NMFA 4A3IG 3RZDH 1FJGL 2NVTH 3S1QH 4K0KL 4KHPQ 2KENA 3S1MH 1EOVA 4IOCA 4JI4L 1I6HH 2PI2A 1IL2A 4NXMQ 2WB1G 3FP9A 3KDFB 4L5TA 2EQSA 2V1CC 3PGZA 1HNXL 3PSIA 1L1OB 4DV5L 1J5EQ 1G51A 1HZ9A 1YBYA 4A3EG 2OTLA 3TS0A 2AWNA 3S14H 4YCUA 2K5NA 1TXYA 1WYDA 1Q1BA 1Y1WG 4A3CG 2E5LL 2JA7H 3S15H 4JI1Q 2ZJRA 3ULPA 1HR0W 4BA2I 5FLMG 4A93H 1BVSA 2L15A 3K8AA 2HQLA 1Q86C 3J81i 1XPUA 1D8LA 4C3HH 1N8RC 3L7ZC 1Q12A 3S1NH 1P16A 1JE5A 4LFAQ 4PMWA 4OX9Q 4IOAA 1Q82C 3PV0A 1EQQA 1JJGA 3STBC 5JJIA 1VQJA 3PUZA 2JA5H 2PQAB 1S3OA 2RF4A 2ZM6L 5LMNQ 4DV3Q 1KIXA 4HJ8A 4ALPA 1V1QA 4L5SA 1N36L 1Y1VH 3ER0A 4ME3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A19 A;  3BU2 A;  2ZTD A;  1KRT A;  4L5R C;  1N9W A;  2GN5 A;  5M3M H;  4DR4 L;  1O7I A;  1H95 A;  3OTO L;  1UEB A;  2K14 A;  1VQN A;  1GKH A;  4IFD G;  1VQI A;  2LXK A;  1PHJ A;  4AH6 A;  4P74 A;  2H5X A;  1RL2 A;  4A3J G;  4NPS A;  4GKK Q;  1CKN A;  2N78 A;  4X65 Q;  1VQ7 A;  4NXM L;  4IPG A;  3AFQ A;  3J80 i;  2A1A A;  4YHH Q;  5M3F H;  3PCO B;  3F1Z A;  4A76 A;  3K7U C;  2NZO A;  5JEA G;  2PNH A;  3W5O A;  4DUZ L;  5IY0 A;  3J81 j;  2N8N A;  1L0W A;  2MNA A;  4DNI A;  4JI8 Q;  1Y14 B;  1PV4 A;  4PZ8 A;  3OYY A;  2A8V A;  2VZA A;  1NY4 A;  2B29 A;  5GAE C;  2WFW A;  4QJF A;  5IYD G;  4P71 A;  2Q2T A;  3M3Y H;  4GN4 B;  4JI1 L;  1HNW Q;  2VQF Q;  1IXR A;  3CCJ A;  3CCM A;  1X54 A;  2KCM A;  4UP7 A;  3KF6 B;  5HGQ A;  3CF5 A;  4BY1 H;  3KFU A;  2DUD A;  5K36 G;  3SGI A;  2JEA I;  4JBJ A;  4LFA L;  4OX9 L;  1XNQ Q;  3TRZ A;  4YWK A;  3FKI H;  3HOX G;  4OXP A;  2GVA A;  5LMN L;  1K0R A;  2JK8 A;  1X3G A;  2BH8 A;  2BA1 A;  4GS3 A;  4A3G G;  3S2H H;  2KHJ A;  1NMG A;  3NEM A;  1X6O A;  2HIX A;  5DLQ E;  4DK6 C;  1KQS A;  2VNU D;  3UDX A;  3GTQ H;  4OO1 G;  2R6G A;  1YHQ A;  3TS2 A;  1UE1 A;  4A3D G;  3KLW A;  3BJU A;  4QL5 A;  4A3K G;  2B63 H;  2RHQ B;  2UU9 Q;  3H3V H;  1QUQ B;  1SE8 A;  1YNX A;  2EIF A;  5JJK A;  4X65 L;  1SR3 A;  1UE5 A;  2JA8 G;  1NBW A;  4YHH L;  3GDE A;  5IYC H;  2YTV A;  4GNX A;  2AMC B;  3CMA A;  3H0G G;  3I2Z A;  1IBK Q;  3AEV A;  1JT8 A;  4O0A A;  1B8A A;  4JI8 L;  3S1R H;  4BBR H;  3A0J A;  1FJG Q;  5IT9 c;  4GLX A;  4JI2 L;  4QY7 A;  1HZA A;  1SLJ A;  4JBW A;  1XPR A;  1FVI A;  5GAG C;  2QEX A;  4A3D H;  4POF A;  1MIU A;  2VQF L;  3CCL A;  1XTD A;  4P72 A;  4B3T L;  4LFB Q;  2CKZ B;  1Q7Y C;  1FGU A;  1XNQ L;  1KRS A;  2F3I A;  3I4O A;  3G6E A;  3CPW A;  1WCM H;  3CP0 A;  1Q1E A;  2E5L Q;  3K81 C;  1SFO H;  1HNZ L;  1KXL A;  2IT1 A;  3LGJ A;  3I4M H;  1WJJ A;  3K7A H;  4BBS H;  2XGT A;  1GO3 E;  4MZ9 A;  3KYH C;  3GTJ H;  2AHO B;  4HIM A;  2I5M X;  2MO0 A;  3HOW H;  4BXX H;  4JI5 Q;  5LMN W;  1JJC B;  2QGQ A;  4RG1 A;  2VQE Q;  4JI7 Q;  1S40 A;  1PH9 A;  4GKJ Q;  4X6A H;  2OCE A;  2R92 H;  2NVX H;  3RLO A;  2UU9 L;  1K83 H;  1PH3 A;  2R93 H;  3PUX A;  1N36 Q;  4EQ5 A;  3CC7 A;  1L1O C;  1IBK L;  4DR4 Q;  2VY3 A;  1BBW A;  2N49 A;  5IE8 A;  3JAM c;  1WFQ A;  4NXN Q;  2IHF A;  3RNU A;  1GVP A;  4JCV E;  4Y7N H;  3MXN B;  1HZB A;  4R4I A;  2NN6 I;  1I94 L;  4H02 A;  2VUM G;  3ICE A;  1FL0 A;  2Y0S G;  1W2B A;  4A3F H;  1N33 Q;  1EQR A;  4DUZ Q;  2GVB A;  4LFB L;  2LXJ A;  4QQB X;  4OWX B;  3W1B A;  3M9B A;  5FJ8 H;  1K9M C;  4LUV A;  3PO3 H;  4OON A;  1SRU A;  4HID A;  2FXQ A;  5H1S E;  1CKO A;  1KL9 A;  1E24 A;  4TVA B;  2UUB Q;  2ZTE A;  2JE6 I;  5C0X G;  3G71 A;  4DKA C;  1K8G A;  3S17 H;  3HKS A;  4OO1 I;  3ZJY C;  3U4V A;  2IX0 A;  1VQD A;  3CCV A;  3HKZ G;  4GN5 A;  4LFC Q;  2BH2 A;  3GTP H;  2CFM A;  2YV5 A;  3GTK H;  4JI5 L;  4DAY B;  4IPH A;  1M90 C;  2VQE L;  4JI7 L;  2UUA Q;  2JA7 G;  3M85 A;  1K8A C;  4GKJ L;  1CKN B;  3CCE A;  1X3F A;  2E2H H;  4A93 G;  1NJI C;  2UUC Q;  2ES2 A;  1CKM A;  1M1K C;  1A63 A;  1RIP A;  3CCR A;  1E22 A;  4LF7 Q;  1Z9F A;  4RMF A;  4X66 Q;  1PH1 A;  3GTO H;  1WI5 A;  2I0Q A;  2KCT A;  4AIM A;  5IYB H;  4XTC S;  1VQL A;  1B7Y B;  4LUZ A;  4MTN A;  4NXN L;  3I56 A;  1UE7 A;  2JA5 G;  1CSP A;  1V9P A;  3PUY A;  1EWI A;  1UWV A;  4C3J H;  4YY3 Q;  1MKH A;  1Y1V G;  1YJ9 A;  4JI0 Q;  2Y0S E;  4PZ7 A;  2WB1 E;  3GO5 A;  3RLN A;  5M3M G;  3I4N H;  1C0A A;  1N33 L;  1LM0 A;  1HJP A;  3E9H A;  1OTC A;  1VQ9 A;  1K73 C;  5IP9 H;  3CME A;  3F2D A;  5GAH C;  3HOY H;  4WJ3 M;  1VQE A;  3AFP A;  1ASZ A;  4DR5 L;  3J7Z C;  4JI2 Q;  2ASB A;  3KJO A;  3UDI A;  3CD6 A;  1PYS B;  1EIF A;  2UUB L;  1MJE A;  4HIO A;  2D0O A;  2KBN A;  3GTG H;  1VQP A;  1XPO A;  3GTM H;  4GLA C;  3HKZ E;  4LFC L;  2MFI A;  2E8G A;  2I5H A;  2JQO A;  2WP8 J;  2OQK A;  2Q2I A;  4GNX C;  4B3T Q;  4A3B H;  1PH2 A;  4JG2 A;  4HJ7 A;  1Z47 A;  3PF4 A;  4DR7 Q;  3NEN A;  4PZ6 A;  2UUA L;  4DV2 Q;  4A75 A;  1PH7 A;  3T1Y Q;  2NVY H;  2UUC L;  4DR3 L;  1HNZ Q;  1HZC A;  1UE6 A;  4BY1 G;  4R4O A;  3J81 c;  3HOZ H;  2VS1 A;  4LF7 L;  4GNX B;  4X66 L;  1TWA H;  2K75 A;  3ERS X;  2K5V A;  4C2M H;  3CXC A;  4LF5 Q;  3WWV A;  2ATW A;  5GQO A;  5J3B A;  3FKI G;  3UE0 A;  1VQB A;  4DAM A;  1LYL A;  1V43 A;  4IJL A;  3AYH B;  4YY3 L;  5C3E H;  1PYB A;  3GTL H;  2NVQ H;  4JI0 L;  1HR0 Q;  1AE3 A;  5HY6 A;  1YIJ A;  2XTI A;  1PH8 A;  1I3Q H;  4DUY Q;  1XMQ Q;  4JI3 Q;  2LSS A;  3M4Q A;  3U4Z A;  3NEL A;  2ZJP A;  4HJ5 A;  4YWM A;  1N34 L;  3RZO H;  1TWF H;  4IJH A;  3T1H L;  1GM5 A;  3PO2 H;  2B63 G;  2CCZ A;  5E7N A;  4A3M H;  2JA6 H;  2EXD A;  5C4X H;  4Y52 H;  4UP8 A;  1T9H A;  4IPC A;  1XMO Q;  1I94 Q;  1SN8 A;  3J80 c;  4APV A;  1VQC A;  5IYC G;  3HOU H;  4B3R Q;  1P8L A;  1Q46 A;  3L0O A;  3UDF A;  1BKB A;  2N3S A;  1QVG A;  1EFW A;  4BBR G;  2D62 A;  4R4C A;  1LTL A;  4LNQ A;  3A5Z B;  3ULJ A;  3GD7 A;  2ZJQ A;  1A8V A;  1K3R A;  4DR7 L;  2Z6K A;  4DV2 L;  3FHW A;  3HFZ B;  3T1Y L;  2R7Z H;  4OWT B;  1VQ4 A;  4QIW E;  1XNR Q;  1B70 B;  4IFD I;  2UXD Q;  4IFD J;  1L2F A;  3TEH B;  3BZC A;  4DK3 C;  1G29 1;  2OQ0 A;  4HJA A;  2UXB L;  4LF5 L;  3HOV H;  3VDY A;  1HH2 P;  1WCM G;  2BA0 A;  1A62 A;  3UDG A;  5JEA J;  5IWA Q;  4DV1 Q;  4BBS G;  3I4M G;  4JC0 A;  4R4Q A;  4LF4 Q;  5GAD C;  1E1O A;  1HR0 L;  1JMC A;  3TQY A;  2I5L X;  1XMQ L;  4DUY L;  4JI3 L;  1S72 A;  2K5H A;  3HOW G;  4BXX G;  4A3L H;  1PFS A;  2HT1 A;  1YVC A;  1JJ2 A;  5IP7 H;  1VQF A;  1VQG A;  2R92 G;  3G48 A;  1VQM A;  1X3E A;  4L5Q A;  4LW1 A;  2KHI A;  2R93 G;  4GN3 B;  1XMO L;  3S24 A;  1KHI A;  4B3R L;  5M5W H;  5C44 H;  1C7Y A;  1N32 Q;  4DPG A;  3U58 A;  4DV6 Q;  2E2I H;  3NBH B;  4LUO A;  3CC2 A;  3STB D;  3K80 C;  3PUV A;  3Q8D A;  4A3I H;  4DR5 Q;  3KF8 B;  4YWL A;  4LF6 L;  1KAW A;  4A3F G;  3A5U A;  2IX1 A;  4DR1 Q;  1LUZ A;  1XNR L;  1E3P A;  2UXD L;  4R1J A;  1E1T A;  2UXC L;  5JJL A;  4X64 Q;  3PO3 G;  4X62 Q;  5FJ8 G;  2HHH Q;  3H15 A;  3A74 A;  1BBU A;  3CAM A;  1X55 A;  3CCQ A;  4A3E H;  2OWO A;  2JEB I;  1G6P A;  1VQ5 A;  3M4O H;  1IYJ B;  3CCS A;  1Y1W H;  1QZH A;  4O2D A;  1SMX A;  5IWA L;  4POG A;  5LMU Q;  2HIV A;  3F8T A;  4DV1 L;  4GOP A;  1IBL Q;  4A3C H;  4LF4 L;  4DR3 Q;  3H3V I;  4IPD A;  5FLM H;  1YHA A;  4JV5 Q;  2E2J H;  3F2C A;  2WAQ G;  4MNO A;  3ULL A;  1PVO A;  4JI6 Q;  4BY7 G;  1W3S A;  1YI2 A;  1TWH H;  2R7F A;  3PF5 A;  3L2P A;  2NZH A;  1I5F A;  1EIY B;  2CWP A;  4DR2 Q;  4IO9 A;  1NTG A;  3IRB A;  4JOI A;  3KDF A;  3M7N A;  3PUW A;  3K0X A;  5IYB G;  3S16 H;  4BY7 H;  1N32 L;  2CQO A;  4LF9 Q;  1L1O A;  5AJ3 Q;  3OW2 A;  4DV6 L;  4UY8 C;  2AKW B;  3EN2 A;  1E7Z A;  4A4I A;  3TRE A;  1N34 Q;  1YEZ A;  1OXU A;  3T1H Q;  4WJ4 A;  4DR6 Q;  1MJC A;  5BR8 Q;  2R7D A;  4B3S Q;  4A3J H;  1U0L A;  3I4N G;  5M3F G;  1VQH A;  4DR1 L;  1QVC A;  1VCI A;  5IP9 G;  2F4V Q;  1VQ6 A;  4HIK A;  2PI2 E;  3HOY G;  4J15 A;  2MQH A;  3CPF A;  4X64 L;  3F2B A;  4X62 L;  1A0I A;  4NB3 A;  2HHH L;  4KHP L;  5GRO A;  1PH6 A;  2D0P A;  2PQA A;  1YZ6 A;  1XJV A;  5IYD H;  3RN2 A;  4B3M Q;  5LMU L;  3G4S A;  4UPA A;  1EUJ A;  2QA4 A;  1IBL L;  3J7A 5;  4A3B G;  4DV7 Q;  1J5E L;  4JV5 L;  2WAQ E;  1OXV A;  2UXB Q;  2MO1 A;  4P75 A;  4JI6 L;  2K50 A;  2Z6K C;  4YCW A;  2VW9 A;  1PH5 A;  1J6Q A;  1CSQ A;  4JBM A;  1VS0 A;  3PIO A;  3HOX H;  4DR2 L;  3HOZ G;  3DM3 A;  3EIV A;  3DLL A;  2YTX A;  2C35 B;  4A3G H;  1VQ8 A;  2NN6 G;  3KOJ A;  4LF9 L;  5AJ3 L;  2JA9 A;  2Q2H A;  2YYZ A;  5C0X I;  1NE3 A;  1D7Q A;  5C0X J;  3CQZ H;  4JYA Q;  1DGS A;  3I7F A;  3S2D H;  1OXT A;  5C3E G;  2K52 A;  2IY5 B;  1X9N A;  2Q2U A;  5BR8 L;  3KJP A;  5FLX c;  4DV3 L;  4DV4 Q;  1YIT A;  4A3K H;  3RN5 A;  1KD1 C;  4B3S L;  1TWG H;  1SRO A;  3B6Y A;  2AWO A;  3UE1 A;  1VQO A;  4DV0 Q;  4KLK A;  2JA8 H;  3KF6 A;  1QVF A;  3W1G A;  2F4V L;  2Z0S A;  1IBM Q;  1WOC A;  1Q81 C;  3PO2 G;  3H0G H;  4LF8 Q;  1YJN A;  3JAM i;  3BZK A;  4A3M G;  2JA6 G;  5C4X G;  4AQY Q;  4GKK L;  1EYG A;  2JJQ A;  3MEF A;  3HOU G;  4LF6 Q;  1GD7 A;  1TWC H;  2ALY B;  1Q8K A;  1U5K A;  4PG3 A;  4B3M L;  4TQU S;  3JC6 6;  4DV7 L;  1VQA A;  1ASY A;  5ELN A;  3AQQ A;  2UXC Q;  4K0K Q;  4EX5 A;  4AYB G;  3CCU A;  5M5Y H;  2VL6 A;  1YJW A;  1IZ6 A;  1QZG A;  4JI4 Q;  4HJ9 A;  2R7Z G;  4C3I H;  3CC4 A;  4BA1 I;  4LWC A;  1QUQ A;  1HNW L;  2ZTC A;  4DR6 L;  2DGY A;  2F52 A;  4KI0 A;  1HNX Q;  2YU9 H;  4GLV B;  2B3G A;  4DV5 Q;  5EAY A;  1JB7 A;  3HOV G;  3E0E A;  5ELO A;  2K4K A;  1X65 A;  2YTY A;  1OXX K;  3RR5 A;  3D31 A;  2ID0 A;  4JYA L;  2PMZ E;  1X56 A;  1KC8 C;  3M4P A;  4UP9 A;  5M5X H;  3PIP A;  3I55 A;  3EBE A;  4DV4 L;  4GOP C;  4XIG S;  1VQK A;  1OXS C;  4A3L G;  4P73 A;  4DV0 L;  4FDB A;  4YCV A;  1AE2 A;  1CUK A;  4R4T A;  4JBK A;  3E9I A;  5IP7 G;  1IBM L;  1YHB A;  2CWA A;  3D0F A;  1R9T H;  4LF8 L;  4KHZ A;  1AH9 A;  5C4J H;  4AQY L;  3CW2 C;  1I50 H;  2ZM6 Q;  1PA6 A;  1C9O A;  4JOI C;  4GOP B;  5C44 G;  3U50 C;  1PH4 A;  2VUM H;  2IHE A;  2OTJ A;  4OWW B;  3OTO Q;  2RCN A;  3RLF A;  2RHS B;  4QGU A;  4AYB E;  1NMF A;  4A3I G;  3RZD H;  1FJG L;  2NVT H;  3S1Q H;  4K0K L;  4KHP Q;  2KEN A;  3S1M H;  1EOV A;  4IOC A;  4JI4 L;  1I6H H;  2PI2 A;  1IL2 A;  4NXM Q;  2WB1 G;  3FP9 A;  3KDF B;  4L5T A;  2EQS A;  2V1C C;  3PGZ A;  1HNX L;  3PSI A;  1L1O B;  4DV5 L;  1J5E Q;  1G51 A;  1HZ9 A;  1YBY A;  4A3E G;  2OTL A;  3TS0 A;  2AWN A;  3S14 H;  4YCU A;  2K5N A;  1TXY A;  1WYD A;  1Q1B A;  1Y1W G;  4A3C G;  2E5L L;  2JA7 H;  3S15 H;  4JI1 Q;  2ZJR A;  3ULP A;  1HR0 W;  4BA2 I;  5FLM G;  4A93 H;  1BVS A;  2L15 A;  3K8A A;  2HQL A;  1Q86 C;  3J81 i;  1XPU A;  1D8L A;  4C3H H;  1N8R C;  3L7Z C;  1Q12 A;  3S1N H;  1P16 A;  1JE5 A;  4LFA Q;  4PMW A;  4OX9 Q;  4IOA A;  1Q82 C;  3PV0 A;  1EQQ A;  1JJG A;  3STB C;  5JJI A;  1VQJ A;  3PUZ A;  2JA5 H;  2PQA B;  1S3O A;  2RF4 A;  2ZM6 L;  5LMN Q;  4DV3 Q;  1KIX A;  4HJ8 A;  4ALP A;  1V1Q A;  4L5S A;  1N36 L;  1Y1V H;  3ER0 A;  4ME3 A; 
#chains in the Genus database with same CATH topology
 5EBC A;  1N9W A;  2GN5 A;  5M3M H;  1O7I A;  1EY0 A;  5EBD A;  5EKK A;  3K5N A;  1L0Y B;  3GP7 A;  1GKH A;  3NE5 B;  2H5X A;  1UUP A;  4HMI A;  1DOK A;  4CDF C;  1VQ7 A;  3IFD A;  4IPG A;  3DWP A;  5M3F H;  4YIJ A;  2NZO A;  4DUZ L;  2N8N A;  3EQL C;  4DAP A;  4DNI A;  4PZ8 A;  2MP1 A;  1IW7 D;  1ML0 D;  5A2Q L;  4ZKB B;  5C6A A;  4GN4 B;  2K32 A;  1IXR A;  1X54 A;  3KF6 B;  3VYU A;  1U4L A;  2F3V A;  2PO4 A;  1SE3 A;  2JEA I;  2HD3 A;  3ND9 A;  1JR0 D;  3GV6 A;  3HOX G;  2QDB A;  3MAQ A;  2JK8 A;  1X3G A;  3V2T A;  2HDM A;  4DAV A;  4A3G G;  1KNE A;  1IKM A;  1X6O A;  5DLQ E;  1RF2 D;  3BDC A;  2R6G A;  1UE1 A;  2AUK A;  1B9N A;  2B63 H;  5CMD A;  1BR9 A;  2EIF A;  2NB0 A;  4LMQ D;  3C46 A;  1UEA B;  1HPC A;  3TZU A;  2EY1 A;  4C56 C;  4GNX A;  2AMC B;  1II3 A;  3I2Z A;  3CMA A;  1B8A A;  1FJG Q;  1E2W A;  3BG3 A;  2EZV A;  5IT9 c;  4P2C B;  3HOW B;  4KN7 C;  1RD9 D;  1EY6 A;  1SLJ A;  4JBW A;  1XPR A;  2QEX A;  2DY8 A;  4EQP A;  2NVX B;  3NBI A;  5HUR A;  4P72 A;  3J7A V;  3A54 A;  1CT1 D;  2AQ2 B;  1DOL A;  4NW2 A;  4Q0F A;  1D1I A;  4C3I G;  1KRS A;  5E4W C;  3CP0 A;  5C4Z A;  3RZD B;  4J6H A;  2Z4H A;  3TME A;  3I4M H;  3K7A H;  1G91 A;  5IGG A;  2TMP A;  3OIP A;  3D6W A;  4HIM A;  4KHV A;  3BDO A;  4N8F A;  2VQE Q;  2LS0 1;  2QGQ A;  4RG1 A;  3AMU A;  4GKJ Q;  3I3C A;  5KNB A;  2Z6B A;  1JWM D;  2EYF A;  1PH3 A;  1NAP A;  3S14 B;  1DZ1 A;  4K14 A;  3H6M A;  4HSV A;  2K5W A;  1WFQ A;  4G57 A;  1CA6 A;  3TP8 A;  1B3Q A;  2NN6 I;  2WAQ B;  1D5M C;  3SEB A;  1ENA A;  4C3H B;  2PPB C;  4MIU A;  1W2B A;  4A3F H;  1EQR A;  1F2Y A;  3BVZ A;  2LXJ A;  3PO3 H;  4QB4 A;  4OON A;  4LAA A;  4HID A;  2EYM A;  1CKO A;  1KL9 A;  5H1S E;  5I2X A;  1PRT F;  2LFN A;  3TSS A;  4HTH A;  3HKS A;  1H9J A;  5FOB B;  1VQD A;  3FRP B;  2BH2 A;  1U4P A;  1W6J A;  3BVM A;  4Z9C B;  3GTP H;  1SNP A;  4RWS C;  4DAY B;  1F2Z A;  2VQE L;  2UUA Q;  2JA7 G;  3M85 A;  3Q0A A;  4GKJ L;  1CKN B;  4PMC A;  2ES2 A;  1PTO H;  1CTM A;  3MWY W;  2Z4I A;  2RDF A;  1WTW A;  5I9P A;  1CSP A;  4BY1 B;  1V9P A;  1UWV A;  2F0N A;  4H13 C;  2B2V A;  3T53 B;  5M3M G;  1LTS D;  3FKI B;  1K73 C;  3F2D A;  4JK1 C;  5GAH C;  4F87 A;  1ASZ A;  4L6T B;  1PYS B;  1EIF A;  4HIO A;  2I46 A;  2D0O A;  2WII B;  3GTM H;  4GNX C;  5CV6 A;  2WP8 J;  2Q2I A;  1QWY A;  2D5D A;  1PH2 A;  3HZX A;  4A3B H;  1I4Q A;  4PQX A;  2UUA L;  1PH7 A;  3S1R B;  3N6R A;  1XTC D;  1HNZ Q;  1CHQ D;  4R4O A;  3HOZ H;  1PRT D;  3A7A B;  1TWA H;  2K75 A;  2WAC A;  3ERS X;  3NP8 A;  4C2M H;  4CJ2 C;  3CXC A;  1U9R A;  3WWV A;  3HOU B;  3UE0 A;  4DAM A;  1LYL A;  1V43 A;  4IJL A;  1PZJ D;  1O80 A;  4L8J A;  3VR4 A;  5C3E H;  4AYB B;  1V1P A;  4CDD C;  5E4X A;  3MVV A;  1BXT A;  1WTR A;  1BOS A;  4DUY Q;  1M4V A;  2ZJP A;  4IJH A;  3K5M A;  3PO2 H;  2B63 G;  5E7N A;  3SVM A;  4A3M H;  2EXD A;  2JA6 H;  1EEF D;  4Y52 H;  2EYH A;  1T9H A;  3NHH A;  4IPC A;  3NTK A;  1I94 Q;  3H94 A;  3I72 A;  4APV A;  1P8L A;  1EFW A;  2D62 A;  4DK1 A;  1SAP A;  4R4C A;  3SK6 A;  2EJG C;  2BOS A;  1BDO A;  3JAM E;  4QIW E;  1B70 B;  5LHY 1;  3OHX C;  1ZKO A;  4G7Z C;  3BZC A;  2OQ0 A;  4HJA A;  3RD4 A;  2L4N A;  5F2D A;  3UDG A;  3R2T A;  3SXH A;  5JEA J;  3I4M G;  3FPU B;  2I5L X;  4DUY L;  1S72 A;  1VF5 C;  2QF7 A;  4NP5 A;  1PFS A;  1LAB A;  1JJ2 A;  2H1E A;  1X3E A;  1EY4 A;  2KHI A;  3GTK B;  1EY5 A;  2QW7 A;  1KHI A;  5EPL A;  2SNM A;  1STY A;  2SNS A;  5FK9 C;  3PIO 3;  3CC2 A;  3Q8D A;  2E2J B;  3A55 A;  4ZYS A;  2EY6 A;  3GTO B;  3KF8 B;  4YWL A;  1NNX A;  4LF6 L;  2B2V C;  4A3F G;  1ICW A;  3HS0 C;  1IL8 A;  4RGT A;  4X64 Q;  3PO3 G;  3R3O A;  5D14 A;  2OWO A;  3S16 B;  1ZYR C;  5K5P A;  1BBX C;  2FMM A;  2VB2 X;  1QZH A;  4POG A;  4A3C H;  4IUT A;  4GOP A;  2H4O A;  1IBL Q;  1QJO A;  4XT3 B;  2KOL A;  5T1G A;  4A3J B;  1BCP F;  2E76 C;  4MNO A;  1PVO A;  2LY7 A;  4N9P A;  1TWH H;  1JCK B;  2LMC B;  2SDF A;  4K5X A;  3PUW A;  3K0X A;  1I4H A;  4BY7 H;  2VB3 X;  5AJ3 Q;  2F0U A;  2RBM A;  2AKW B;  1X3Q A;  2O5I C;  4K8J A;  1FD7 D;  5DM6 3;  1LT4 D;  5JPN C;  4IFD H;  1SNO A;  3KLS A;  3N52 A;  1U0L A;  3URY A;  1IHZ A;  4I7A A;  2I07 B;  1VCI A;  4HSP A;  2F4V Q;  4HIK A;  4J15 A;  5D3I B;  2K5Q A;  4X64 L;  1J8I A;  4RCN A;  1STE A;  1GUT A;  1I3Q B;  1PH6 A;  4NDX A;  4H44 C;  3S2D B;  3ZYY X;  1IBL L;  1F9R A;  4FXG C;  2CVR A;  4JVZ A;  1SJH D;  3J7A 5;  4A3B G;  3EVQ A;  2WAQ E;  5D3D A;  2MO1 A;  2M2L A;  1B50 A;  2VW9 A;  1PH5 A;  2L11 A;  2X6L A;  3HOZ G;  3C1E A;  2C35 B;  1TS3 A;  1A3T A;  5A35 A;  5J22 A;  3I4L A;  5AJ3 L;  5C0X I;  4GZY C;  3CQZ H;  3OW7 A;  1K8M A;  2F0O A;  5C3E G;  2IY5 B;  1KD1 C;  4DV4 Q;  1EZ8 A;  1EY9 A;  4MHE A;  1SRO A;  1VF7 A;  2AWO A;  2JA8 H;  2F4V L;  3PO2 G;  3H0G H;  2BDN A;  4ILW A;  4A3M G;  2JA6 G;  4GKK L;  2J0T D;  1EYG A;  3MEF A;  3DEP A;  4TQU S;  5IT9 L;  3JC6 6;  1VQA A;  2G9H D;  1ASY A;  2F0V A;  4OGQ C;  4EX5 A;  3D6C A;  3CCU A;  1EEI D;  1QZG A;  1IZ6 A;  3CKI B;  1DJR D;  4CKE A;  2E2I B;  4BA1 I;  1R9T B;  1QUQ A;  2DGY A;  4KI0 A;  1HNX Q;  1MI2 A;  2YU9 H;  4DV5 Q;  5EAY A;  2HUG A;  1JB7 A;  4RHR A;  2A68 D;  1X65 A;  2Y0S B;  1OXX K;  3RR5 A;  1STB A;  3D31 A;  1BCP C;  5M5X H;  3I55 A;  2DY7 A;  3EBE A;  4DV4 L;  4GOP C;  1VQK A;  3QB3 A;  3HRZ C;  4FDB A;  1VDZ A;  3E9I A;  2ENB A;  3PMF A;  2CWA A;  1LLR D;  3W3A A;  4KN4 C;  3CRL C;  3HKZ B;  1U4M A;  4K6D A;  1GHJ A;  3U50 C;  4K2L A;  4WFN 3;  4RKB A;  3FMC A;  4OWW B;  2RCN A;  2RHS B;  4AYB E;  3RZD H;  1LV9 A;  2NVT H;  3S1Q H;  5KYI A;  1I6H H;  3S1N B;  1E0B A;  3FP9 A;  1B4O A;  1HNX L;  3PSI A;  1L1O B;  1HFG A;  4DV5 L;  1Y1V B;  2OTL A;  2K28 A;  3S14 H;  3VYS A;  4EQO A;  1WYD A;  4JPB W;  2A6H C;  4A3C G;  2E5L L;  3ULP A;  4A93 H;  2B39 A;  1HXY D;  3K8A A;  3E5S A;  3J81 i;  4G4K A;  4C3H H;  1N8R C;  4IOA A;  3Q23 A;  2EY5 A;  1ZEQ X;  3PUZ A;  4RAU C;  1DD2 A;  4DV3 Q;  1PTO F;  4ALP A;  4S3S A;  4BY7 G;  1F9S A;  4DR4 L;  2PZT A;  1D2B A;  1VQN A;  4IFD G;  1LT3 D;  4AH6 A;  1RL2 A;  1WTH A;  2N78 A;  2NBF A;  2A1A A;  4A76 A;  3K7U C;  3W5O A;  2F3W A;  4JI8 Q;  2A8V A;  1RKN A;  3S2H B;  3X3M A;  3L3O C;  4QJF A;  3IKJ A;  4HCE A;  4ZLT F;  1A2T A;  4P71 A;  2Q2T A;  2AUJ D;  1HNW Q;  2VQF Q;  3CCJ A;  2A6E D;  5HGQ A;  5C3X A;  3CF5 A;  4BY1 H;  4JBJ A;  3TRZ A;  4YWK A;  3FKI H;  4R9W A;  1O7L A;  5ELF A;  5M5Y B;  2BH8 A;  4GS3 A;  1O78 A;  1GUS A;  4OEL B;  1EQT A;  3UDX A;  3GTQ H;  3P75 A;  4OO1 G;  1UAP A;  1FNU A;  1YHQ A;  3TS2 A;  1CZG A;  5J39 A;  3BJU A;  4IQZ A;  1JOO A;  3H3V H;  1YNX A;  3BS1 A;  2CH4 A;  3C1F A;  4KJO A;  1LAC A;  1SR3 A;  1UE5 A;  2JA8 G;  1WCM B;  3M7G A;  2YTV A;  4BS9 A;  3H0G G;  3EFX D;  3VYT A;  4PNY A;  1ZXT A;  4JI8 L;  3S1R H;  4BBR H;  1TS5 A;  2XNA C;  1F2M A;  4GLX A;  4JI2 L;  1RTO A;  1LTB D;  3Q6S A;  2R92 B;  1MIU A;  2VQF L;  3K0Y A;  4B3T L;  3I90 A;  4LFB Q;  2FJ2 A;  2R93 B;  2VUM B;  4ZK9 B;  1ILP A;  1Z6H A;  2ZT9 C;  3T56 B;  2XGT A;  3VA7 A;  3GTJ H;  2AHO B;  2EYJ A;  4TKO B;  1S40 A;  2EJM A;  4XDX A;  5ISR A;  3RLO A;  1YNN D;  2A74 C;  2ICI A;  2WIN B;  4IUR A;  2J7Z A;  1L1O C;  2VY3 A;  1BBW A;  2N49 A;  4CKB A;  5IE8 A;  2IHF A;  1F77 A;  2CW0 D;  1IYU A;  4JCV E;  3MXN B;  4XQJ A;  2JN4 A;  1JOQ A;  5E1F A;  4IZ8 A;  2E2H B;  2JA5 B;  5JJZ A;  4DUZ Q;  2GVB A;  4LFB L;  1WTV A;  4X3K A;  4KD3 A;  4OWX B;  1KTK A;  3M9B A;  1SRU A;  1E24 A;  4TVA B;  2UUB Q;  2TSS A;  4C1N K;  1T5E A;  1K8G A;  3U4V A;  2IX0 A;  4LFC Q;  3QR8 A;  4KD4 A;  1F9Q A;  4EGV A;  3NBH A;  3GTK H;  4ZKC B;  3VYR A;  1PFB A;  4A93 G;  2B2T A;  2UUC Q;  1T5X D;  2F0G A;  4ID6 A;  1RIP A;  1SEB D;  1Z9F A;  4RMF A;  3GTO H;  1WI5 A;  4C3H G;  1SE2 A;  2KCT A;  2I0Q A;  3GTG B;  1B7Y B;  5IOC A;  1UE7 A;  1QB5 D;  2QDL A;  3VA5 A;  3PUY A;  4C3J H;  2DN8 A;  2N88 A;  2Y0S E;  1PZI D;  1LM0 A;  3E9H A;  5IP9 H;  3HOY H;  4WJ3 M;  4ABN A;  3AFP A;  3P20 A;  2UUB L;  1CFM A;  1HQM C;  1VQP A;  1XPO A;  4MN3 A;  4GLA C;  3HKZ E;  4LFC L;  2NVQ B;  2OQK A;  4JW0 A;  4HJ7 A;  4DR7 Q;  1E2Z A;  4PZ6 A;  1TY2 A;  1TWF B;  2HCI A;  1AW7 A;  2DNC A;  2NVY H;  2UUC L;  1HZC A;  4BY1 G;  3J81 c;  5IT9 E;  4GNX B;  2K5V A;  2NN6 H;  2F0Q A;  1RJT A;  2OEO A;  3FKI G;  5J3B A;  2ATW A;  1AP0 A;  1SMY D;  2QEJ C;  3VR3 A;  4KY7 A;  5I6W A;  3FPP A;  1HR0 Q;  3IAY A;  5HY6 A;  5CV9 A;  1I3Q H;  1XMQ Q;  4XT1 B;  2R7Z B;  2NYZ D;  2Q8I B;  3U4Z A;  1SFO B;  4HJ5 A;  1N34 L;  2QKI C;  5CC4 A;  4BBS B;  3TBI B;  5C4X H;  1IW7 C;  3HOV B;  5COR A;  5C3W A;  1SN8 A;  3QOL A;  5IOD A;  1CHP D;  3UDF A;  1BKB A;  4BBR G;  1UNS A;  5CV7 A;  1LTL A;  1Q8I A;  3ULJ A;  4DR7 L;  2Z6K A;  3IL8 A;  4K5W A;  3GQB A;  1X32 A;  3HFZ B;  2AQ3 B;  3DWA A;  2UXD Q;  2RVL A;  4Y7N B;  1L2F A;  4DK3 C;  2UXB L;  3K6O A;  1JOK A;  3D8G A;  1A62 A;  4CJ1 B;  5IWA Q;  2DNE A;  4A3I B;  4LF4 Q;  1K3B C;  1HR0 L;  2B8F A;  4A3L H;  1XMQ L;  2K5H A;  5KND A;  1PRT B;  2HT1 A;  2WB1 B;  1YVC A;  3M4Y A;  3G48 A;  4RGO S;  4L5Q A;  5EPJ A;  4LW1 A;  2B2T C;  4A3E B;  1ENF A;  1ESR A;  5M5W H;  1N32 Q;  1Y1W B;  2CQA A;  3VR2 A;  2E2I H;  1SYB A;  3STB D;  2BE5 D;  4RCO A;  3A5U A;  4KKU A;  1E3P A;  2UXD L;  1XX8 A;  1E1T A;  2ZXP A;  2UXC L;  1WD1 A;  1H9R A;  2HHH Q;  3LX0 A;  3H15 A;  3A74 A;  1BBU A;  3TP6 A;  1X55 A;  3CCQ A;  2PW7 A;  1TT2 A;  1TKW B;  4O2D A;  5IWA L;  1A6X A;  1JB3 A;  4LF4 L;  4IPD A;  2QCP X;  5FLM H;  4EQN A;  1YHA A;  4JV5 Q;  1DYQ A;  1QOH A;  3L2P A;  1I5F A;  4CKC A;  2CWP A;  1EIY B;  1B1Z A;  3KDF A;  3HEJ A;  1J9O A;  1N32 L;  2CQO A;  3SK8 A;  1EL0 A;  3TRE A;  1YEZ A;  4C3J G;  1MJC A;  5BR8 Q;  2R7D A;  3C2P A;  2VXW A;  1ROD A;  5M3F G;  1VQH A;  3I73 A;  4QUF A;  1F2L A;  5IP9 G;  1BNZ A;  3ONA B;  2ICE C;  3HOX B;  2PI2 E;  1VQ6 A;  3HOY G;  3GTL B;  2MQH A;  4NB3 A;  2HHH L;  2KEE A;  5GRO A;  4A3G B;  1D5X C;  2L1B A;  5CYU A;  3NTI A;  1YZ6 A;  5IGC A;  4XQN A;  3RZO B;  3K5L A;  1YNJ D;  3G4S A;  4UPA A;  1EUJ A;  4DK0 A;  2JXM B;  1J5E L;  2EXZ A;  4JV5 L;  3H09 A;  2JSO A;  5K36 H;  3KLR A;  2Z6K C;  1VS0 A;  3C3L A;  3EIV A;  3DLL A;  4K8I A;  5ELC A;  1I4P A;  1VQ8 A;  2NN6 G;  2RDG A;  3FVQ A;  1ILQ A;  1NE3 A;  2NUC A;  1HTL D;  3I7F A;  2K52 A;  4A3D H;  5BR8 L;  3I8Z A;  5FLX c;  4A3K H;  3RN5 A;  2B8G A;  3B6Y A;  4KLK A;  4C3I B;  4F7X A;  1QVF A;  5G3L F;  3ERO A;  3W1G A;  4XXE A;  2XWJ B;  5C4X G;  3T13 A;  1CQV A;  2JJQ A;  3K5O A;  5JPM C;  4LF6 Q;  1GD7 A;  1U5K A;  4FXK C;  3L9A X;  4DN4 M;  2IPK D;  1PRT C;  4K0K Q;  3R2I A;  5M5Y H;  2PNR C;  5C44 B;  3MHB A;  3CC4 A;  5COY A;  1SYC A;  1EZ6 A;  1I50 B;  4QF4 A;  3E0E A;  4I7Z C;  2K4K A;  3RUZ A;  2RA4 A;  2ID0 A;  2M00 A;  4CJ0 B;  4A3L G;  1TVX A;  4P73 A;  4U67 3;  1CZW A;  4O42 A;  1AE2 A;  1ZYR D;  2KUM A;  1B9M A;  1HUM A;  4OIJ A;  1AH9 A;  2GA4 B;  5C4J H;  1BCP B;  1PA6 A;  1JE4 A;  4GOP B;  2EOT A;  2VUM H;  2JA7 B;  3S15 B;  1LTR D;  3T51 B;  5KEE A;  2MPM A;  3OTO Q;  4K0K L;  1NMF A;  5G3L D;  2KEN A;  1EOV A;  4IOC A;  2K03 A;  1LTA D;  4FNF A;  4DA2 A;  5C0X H;  2KCN A;  3WOE A;  1QG7 A;  4WOR A;  3GV3 A;  1YBY A;  1HZ9 A;  3IFT A;  5BN4 A;  5M3M B;  2K5N A;  5M9O A;  2O4X A;  5JOB A;  4BA2 I;  4JI1 Q;  5A2Q E;  2ZJR A;  4K5V A;  2P5Z X;  5FLM G;  2JYO A;  1DM0 B;  1K8O A;  1Q86 C;  1XPU A;  1H9S A;  3L7Z C;  4LJZ C;  4LFA Q;  3PV0 A;  1SYE A;  1JJG A;  2JA5 H;  3MXU A;  5CBE E;  5LMN Q;  3A8J E;  1CA5 A;  1HUN A;  1V1Q A;  1FGB D;  1N36 L;  2XIW A;  4ME3 A;  2A19 A;  2J4X A;  1S5C D;  2ZTD A;  3G6J B;  1KRT A;  1QCB D;  2F0P A;  3E3X A;  1XYI A;  3OTO L;  2K14 A;  1HHV A;  3OOC A;  1VQI A;  2LXK A;  3NXW A;  1PHJ A;  4GKK Q;  3SK5 A;  1GXD C;  4X65 Q;  1S5F D;  1X3P A;  1KLU D;  3AFQ A;  3J80 i;  3H3V C;  3PCO B;  3F1Z A;  3NQI A;  1CK1 A;  2PNH A;  1L0W A;  1PV4 A;  1TWG B;  1F9P A;  1NY4 A;  2B29 A;  5GAE C;  2B2W A;  2WFW A;  2FMC A;  1Y8O B;  4JI1 L;  4KK7 A;  3QWN A;  1RCV D;  2B63 B;  3CCM A;  1S5B D;  2DUD A;  5K36 G;  1TWC B;  3J7Y W;  3SGI A;  4FO2 A;  3J81 L;  4LFA L;  1XNQ Q;  2MUY A;  3DHQ A;  4OXP A;  5LMN L;  1FNW A;  1PFM A;  2A69 D;  2KHJ A;  1NMG A;  1PZK D;  1GUG A;  2L5T A;  4DK6 C;  1KQS A;  2VNU D;  3KLS X;  4FVM A;  1JC7 A;  1LO5 D;  4A3D G;  4A3K G;  1RHP A;  2RHQ B;  2UU9 Q;  1QUQ B;  2FFK B;  5JJK A;  2PZW A;  4X65 L;  3X3N A;  3PQI A;  2X69 A;  3AEV A;  1JT8 A;  1TR5 A;  3I91 A;  1VMC A;  4QY7 A;  4CHT B;  4X3U A;  1FVI A;  4F88 A;  1WTX A;  1C4Q A;  3CCL A;  1KDC A;  3U9O A;  4KY5 A;  5JAV A;  1XNQ L;  3OSO A;  3I4O A;  1PYW D;  2E5L Q;  1FYC A;  1D1K A;  1SFO H;  1KDB A;  4BBS H;  4MZ9 A;  3KYH C;  1A2U A;  3HOW H;  4JI5 Q;  4A3F B;  5LMN W;  4JI7 Q;  1SNM A;  2F0K A;  1PH9 A;  3OPO A;  3P1H A;  4DXG A;  4KJN A;  2NVX H;  2D2C C;  2UU9 L;  1FNV A;  3PUX A;  1EYA A;  4EQ5 A;  2O5J C;  1STH A;  4DR4 Q;  4KV6 A;  4NXN Q;  4HAE A;  2RSO A;  3GTP B;  4KTA A;  3RNU A;  4Y7N H;  1BUV T;  4R4I A;  2R3Z A;  2VUM G;  1NCV A;  1FL0 A;  1EWC A;  2WKC A;  3BDL A;  4FF3 A;  4UAI A;  1PTO B;  3W1B A;  4DFA A;  5ELD A;  5FJ8 H;  4LUV A;  1EY7 A;  1HCZ A;  2A68 C;  2FXQ A;  4DGZ A;  2XVS A;  5EJW A;  1RTN A;  2ZTE A;  5C0X G;  5ELB A;  2F0M A;  4OO1 I;  4FXD A;  4KKS A;  3RMH A;  3ZJY C;  3U9S A;  2JP1 A;  3T16 A;  2CFM A;  2YV5 A;  4JI5 L;  3EJI A;  2PYK A;  2OT2 A;  4JI7 L;  1KNA A;  2KEC A;  1CKM A;  4DF7 A;  1A63 A;  1ESF A;  1E22 A;  1CM9 A;  3DMU A;  3M3Y B;  5IYB H;  1ICF B;  2IL8 A;  1VQL A;  3GTM B;  2E75 C;  4NXN L;  3I56 A;  2JA5 G;  2PW5 A;  1DOM A;  4YY3 Q;  1MKH A;  1BO0 A;  1YJ9 A;  4PZ7 A;  3GO5 A;  1HJP A;  1OTC A;  1VQE A;  3UI2 A;  4DR5 L;  2ASB A;  4JI2 Q;  3CD6 A;  3D4R A;  2Z9H A;  2ZXR A;  4QUC A;  1MJE A;  2KBN A;  3SHL A;  1V1O A;  1QNK A;  2E8G A;  2PMZ B;  3ERQ A;  4B3T Q;  2D9U A;  1WVL A;  4JG2 A;  3Q22 A;  1Z47 A;  3PF4 A;  5D65 A;  3OMG A;  3NEN A;  4F8M A;  4DV2 Q;  3WDN A;  4CGY B;  2KQ3 A;  1O7Y A;  3T1Y Q;  4J1M A;  3PO2 B;  2CH4 W;  4DR3 L;  1UE6 A;  2K7V A;  5I4D A;  4LF5 Q;  2Z8L A;  5CV4 A;  5GQO A;  1B3A A;  1HTP A;  1VQB A;  3NWT A;  4YY3 L;  1SDF A;  3GTL H;  4B9W A;  1AE3 A;  1YIJ A;  1PH8 A;  4JI3 Q;  5FO7 B;  5FLX L;  4FF1 A;  3NEL A;  3RZO H;  2V4D A;  3T1H L;  1DCZ A;  4X3T A;  2F0S A;  4UP8 A;  2EPB A;  4B9X A;  1XMO Q;  4IUU A;  3J80 c;  3HOU H;  4B3R Q;  1Q46 A;  3L0O A;  2N3S A;  2A6E C;  1K83 B;  2AQ1 B;  3J7A F;  4X3S A;  1K0S A;  4DXF A;  2F0L A;  2NTT A;  2ZJQ A;  1K3R A;  1EQV A;  4DV2 L;  3A8I E;  2EVB A;  2HQE A;  1B53 A;  3T1Y L;  2XWB B;  4IFD J;  3F2U A;  3TEH B;  2SOB A;  4ULL A;  1H9M A;  4LF5 L;  1GUO A;  2Q8R E;  4ZAI A;  1HH2 P;  2BA0 A;  2EE1 A;  4Q5V A;  2RKS A;  1JQY D;  4BBS G;  4JC0 A;  5GAD C;  2L0C A;  1JMC A;  3TQY A;  4JI3 L;  3HOW G;  3S17 B;  1PTO C;  3TZD A;  4R8I A;  1VQF A;  1TII D;  4NMZ A;  5KYL A;  2IW3 A;  4DU9 A;  4GN3 B;  1XMO L;  2XSC A;  5DNF A;  2PQE A;  3S24 A;  4B3R L;  5C44 H;  1MHW C;  4DPG A;  5EKL A;  3NBH B;  2DJG C;  3K80 C;  2G9D A;  1TWH B;  2IX1 A;  1LUZ A;  5JJL A;  4X62 Q;  5FJ8 G;  5C4H A;  3I4N B;  2JEB I;  1VQ5 A;  2KHS A;  2F0I A;  1I6V C;  1IYJ B;  2HDL A;  1G6Z A;  3SDZ A;  5LMU Q;  2HIV A;  3F8T A;  3H3V I;  1HFN A;  1Z7T A;  1YNN C;  1KDA A;  3NQT A;  5HGT A;  2E2J H;  3F2C A;  2WAQ G;  3I70 A;  3NSW A;  4JI6 Q;  5AFW A;  1H9K A;  1W3S A;  5JVH 3;  1YI2 A;  2R7F A;  3PF5 A;  4H0L C;  4IO9 A;  1NTG A;  3IRB A;  3M7N A;  2L12 A;  5IYB G;  3S16 H;  1HQR D;  4UY8 C;  1N34 Q;  2F4I A;  3J81 E;  4WJ4 A;  3KBX A;  3QO2 A;  3D4W A;  4XYQ A;  4B3S Q;  4A3J H;  5DAU A;  1KLG D;  3T4A C;  5JEA H;  3CPF A;  3F2B A;  4X62 L;  1A0I A;  1ENC A;  3DUZ A;  4ME5 A;  4QIW B;  4KHP L;  1SSO A;  1WD0 A;  4M8A A;  1MSG A;  1S4Z A;  2PQA A;  3CQZ B;  1XJV A;  2E2D C;  5IYD H;  3RN2 A;  4WRD A;  4B3M Q;  5LMU L;  2QA4 A;  3E6Z X;  4CDC C;  1OXV A;  2UXB Q;  2X6G A;  4P75 A;  4FYD A;  4JI6 L;  2JA8 B;  4OHJ A;  4YCW A;  3VR5 A;  1CSQ A;  3H0G B;  2K6A A;  4JBM A;  1NUC A;  3R93 A;  1G8Z D;  4DNT B;  1W6K A;  5CBA E;  5DEH A;  4IUQ A;  1DXM A;  2JA9 A;  2Q2H A;  5BN3 A;  1D7Q A;  4JYA Q;  1DGS A;  3VR6 A;  3S2D H;  1X9N A;  1YIT A;  1A3U A;  3KJP A;  4V19 0;  1ET9 A;  2EYO A;  4B3S L;  1TWG H;  4DV0 Q;  3BZD B;  3KF6 A;  1PDQ A;  2B2Y A;  1IBM Q;  4MTK A;  2YU9 B;  4LF8 Q;  1YJN A;  3JAM i;  4AQY Q;  1EY8 A;  1SYF A;  3HOU G;  5EKI A;  1TWC H;  4B3M L;  3Q24 A;  5M5X B;  4R8N A;  5ELN A;  2UXC Q;  4AYB G;  2VL6 A;  1YJW A;  1SMY C;  5T1I A;  2F52 A;  1EU3 A;  5KIX A;  5ELO A;  5JVG 3;  3MXP A;  2RSN A;  4JYA L;  2PMZ E;  1X56 A;  3EA6 A;  3DXJ C;  2EDG A;  3PIP A;  2NVT B;  3S1Q B;  4XIG S;  1I6H B;  4DV0 L;  3NUC A;  3M4O B;  4YCV A;  1CUK A;  2Q8T A;  4JBK A;  1QE6 A;  1IBM L;  1G2T A;  1R9T H;  4LF8 L;  4AQY L;  3CRK C;  5ELE A;  5FKA C;  5C44 G;  2IHE A;  3BVG A;  4A93 B;  3RLF A;  2QIL A;  4QGU A;  3SR1 A;  1FJG L;  4N9T A;  1EU4 A;  3A8K E;  1TS2 A;  4NXM Q;  4L5T A;  3G7L A;  3KDF B;  1I4R A;  2V1C C;  3PGZ A;  1SE4 A;  1MSH A;  2F0E A;  1J5E Q;  1G51 A;  2KCC A;  3TS0 A;  2AWN A;  3ITP A;  1TXY A;  1Q1B A;  1OO9 B;  2MGS A;  1HR0 W;  2L55 A;  1BVS A;  1LTG D;  2HQL A;  1V8Q A;  5FO8 B;  1FR3 A;  2RCF A;  3S1N H;  1Q12 A;  1P16 A;  1JE5 A;  4OX9 Q;  5KRU A;  1Q82 C;  1EQQ A;  3STB C;  2PCF B;  2BE5 C;  4KKT A;  4HJ8 A;  1O7Z A;  4ZCK A;  1Y1V H;  4L63 B;  3BU2 A;  4L5R C;  1H95 A;  1SXT A;  1UEB A;  2RQX A;  4DAY A;  2MJ8 A;  4P74 A;  4A3J G;  4NPS A;  1CKN A;  2F03 A;  4NXM L;  2K05 A;  1V1P B;  4YHH Q;  5JEA G;  2B2Y C;  5IY0 A;  3J81 j;  5FLX E;  2MNA A;  1Y14 B;  3OYY A;  2VZA A;  3DEO A;  2A73 B;  3MFG A;  5IYD G;  3GTQ B;  3M3Y H;  1QNU A;  4UP7 A;  2KCM A;  3KFU A;  1SBB B;  4B08 A;  2XN9 C;  5CR3 A;  5IGD A;  4OX9 L;  2GVA A;  4BBR B;  2O2L D;  1K0R A;  3QJY A;  1Y69 U;  2BA1 A;  4EVO A;  3LWU A;  3S2H H;  3NEM A;  2HIX A;  2MHV A;  3KLW A;  3TP5 A;  4QL5 A;  1SNC A;  1SE8 A;  1JWS D;  1NBW A;  4YHH L;  1ET6 A;  1YNJ C;  3GDE A;  5IYC H;  2NTS A;  1IBK Q;  1U4R A;  3HGB A;  4O0A A;  3J80 L;  2K04 A;  3A0J A;  4ZQ3 A;  3GTJ B;  2ZXO A;  2L9H A;  1DON A;  4RFB A;  1TQO A;  1HZA A;  3KUP A;  1PMR A;  1SYD A;  5GAG C;  4POF A;  1XTD A;  4E6I A;  3K58 A;  2CKZ B;  3TP7 A;  1Q7Y C;  4J8Q A;  3OWF A;  1FGU A;  4N8X 1;  1D6E C;  2F3I A;  3G6E A;  3CPW A;  1WCM H;  1Q1E A;  5FO9 B;  3K81 C;  4K6L A;  1HNZ L;  1KXL A;  2IT1 A;  1R4Q B;  3S1M B;  3LGJ A;  1WJJ A;  5CV5 A;  3P7J A;  1GO3 E;  1I4X A;  4BXX H;  1CQF A;  2I5M X;  2MO0 A;  1RDP D;  1PLF A;  5NUC A;  1JJC B;  3QOJ A;  3A56 A;  3QG1 A;  4X6A H;  2OCE A;  2R92 H;  2SEB D;  2RDH A;  2B2U A;  1K83 H;  2F0T A;  2R93 H;  1N36 Q;  4TRD A;  4HN7 A;  3A7L A;  3CC7 A;  4C1N I;  1IBK L;  1JIC A;  5LL6 S;  1A15 A;  3JAM c;  5KGU A;  3DWQ A;  3O13 A;  1GVP A;  1Q3L A;  1HZB A;  1I94 L;  1SNQ A;  4UDU C;  4H02 A;  3ICE A;  1Q90 A;  4UHV A;  2Y0S G;  2A5H A;  4IAL A;  1N33 Q;  3D4D A;  1H9S B;  5KNC A;  4QQB X;  3AU7 A;  1AZQ A;  3HP3 A;  1K9M C;  3MZ5 A;  4NKL A;  1NSN S;  1KAB A;  2JE6 I;  3G71 A;  3S17 H;  4DKA C;  1G2S A;  2M9V A;  1PFN A;  4C3J B;  3CCV A;  3HKZ G;  4GN5 A;  3NWS A;  4IPH A;  1R4P B;  5M3F B;  1HRJ A;  1M90 C;  1NR2 A;  1K8A C;  3KF8 A;  3HOY B;  3CCE A;  1X3F A;  2E2H H;  2HCC A;  1NJI C;  5I2Y A;  1M1K C;  3CCR A;  4LF7 Q;  1PH1 A;  1CI3 M;  4X66 Q;  2EYP A;  3V96 A;  4AIM A;  5EPK A;  4XTC S;  5CGK A;  4LUZ A;  4MTN A;  2LKV A;  5IIF A;  5I9O A;  2K5D A;  5BN5 A;  1EWI A;  4IUP A;  1Y1V G;  3LNN A;  4JI0 Q;  1JWU D;  1STA A;  2WB1 E;  3RLN A;  1GUW A;  3I4N H;  1C0A A;  1IYV A;  1N33 L;  4HMJ A;  2NVY B;  1VQ9 A;  3CME A;  2G5D A;  1PXU A;  3J7Z C;  3KJO A;  3QIA A;  3UDI A;  3GTG H;  1C8C A;  3WOF A;  2MFI A;  2I5H A;  2JQO A;  4DNR B;  3CU7 A;  2KED A;  4A75 A;  1LT6 D;  3KBG A;  1EFI D;  2R61 A;  1JOR A;  1IKL A;  3CHB D;  5C4X B;  4OL7 A;  1LTT D;  2VS1 A;  4LF7 L;  1S5D D;  4X66 L;  2F0D A;  1EYC A;  3AYH B;  1PYB A;  1TS4 A;  2NVQ H;  1EYD A;  4JI0 L;  4ZUJ A;  2XTI A;  5TSS A;  2LSS A;  3NTH A;  5C5L A;  3M4Q A;  4YWM A;  1BCP D;  1TWF H;  1GM5 A;  2KA7 A;  3I4M B;  3K7A B;  1NR4 A;  4OO1 H;  2CCZ A;  1STG A;  2B2U C;  4WJW A;  2FHT A;  1TY0 A;  1VQC A;  2XRQ D;  4RHS A;  3V05 A;  5IYC G;  1QVG A;  4LNQ A;  3A5Z B;  3GD7 A;  1EWH A;  1A8V A;  3FHW A;  1AN8 A;  1I4G A;  2WV6 D;  2R7Z H;  4OWT B;  1VQ4 A;  3R8B A;  1XNR Q;  2A69 C;  4V0B A;  4IFD I;  1XXG A;  1G29 1;  2EYL A;  1SND A;  5M5W B;  3HOV H;  3VDY A;  1WCM G;  3OWE B;  4DV1 Q;  2KVM A;  3PO3 B;  4R4Q A;  1E1O A;  4BXX G;  1XWE A;  2A6H D;  5IP7 H;  1VQG A;  2R92 G;  1VQM A;  2R93 G;  1A3V A;  1GOZ A;  1C7Y A;  3HG9 A;  3U58 A;  1D5Z C;  4DV6 Q;  4LUO A;  4RA8 A;  3MXG A;  3PUV A;  4A3I H;  4DR5 Q;  4OIK A;  1EOT A;  1KAW A;  5IGF A;  4U68 A;  4OEM B;  4DR1 Q;  3ND8 A;  3D3R A;  1XNR L;  2NZ1 D;  4R1J A;  3CAM A;  4A3E H;  4ZUI A;  2NWG A;  1G6P A;  2B2W C;  3M4O H;  2F0W A;  2WKD A;  2KJX A;  3CCS A;  1GJX A;  1Y1W H;  1SMX A;  1M8A A;  4DV1 L;  4DR3 Q;  3LWE A;  3AB9 A;  1MD2 D;  4I65 A;  5EGT A;  5DM7 3;  4RGM A;  3ULL A;  2F0J A;  4IUV A;  2NZH A;  2IJ0 A;  4A3B B;  4DR2 Q;  1S5E D;  1EIG A;  4KY6 A;  4JOI A;  4RGN A;  2IX3 A;  4QCL A;  1HA6 A;  3MFY A;  4LF9 Q;  1L1O A;  4H7B A;  2PZU A;  3OW2 A;  4DV6 L;  2K01 A;  1MBY A;  4RKL A;  1TU2 B;  3EN2 A;  1E7Z A;  4HED A;  4A4I A;  1OXU A;  3T1H Q;  3OMC A;  3HOZ B;  4DR6 Q;  1TWA B;  4C2M B;  1WTQ A;  4FP5 D;  3I4N G;  4IN3 A;  3MEH A;  3W2D A;  1EIH A;  4DR1 L;  1B44 D;  1QVC A;  5C3E B;  1QIL A;  3MA2 B;  2BCO A;  3PIP 3;  1Y8P B;  4BWG B;  5IGE A;  3OIQ A;  1GUN A;  4ZRZ A;  4K2K A;  3K59 A;  2D0P A;  2C9O A;  3TN2 A;  1C48 A;  1SJE D;  4PV1 C;  4XQQ A;  4A3D B;  4A3M B;  2JA6 B;  4DV7 Q;  4A3K B;  4XYO A;  4CDE C;  3J80 E;  2K50 A;  1J6Q A;  4O1N A;  4QMG A;  3PIO A;  3HOX H;  4DR2 L;  3DM3 A;  2YTX A;  5J1Z A;  4A3G H;  4LF9 L;  3KOJ A;  1AFP A;  4KMU C;  2YYZ A;  5C0X J;  3K57 A;  3NK9 A;  1OXT A;  4DR6 L;  2Q2U A;  4DV3 L;  3FDT A;  1MGS A;  4G7O C;  3KK7 A;  1STN A;  3UE1 A;  1VQO A;  1AZP A;  4M1U B;  5I6Y A;  1GHK A;  2Z0S A;  4RH6 A;  1WOC A;  1Q81 C;  1WTP A;  3BZK A;  5C5M A;  1SYG A;  3MTS A;  3S9W A;  1BF4 A;  3DM1 A;  2ALY B;  5E3F A;  5IGB A;  1Q8K A;  4PG3 A;  1PTO D;  2C5C A;  4DV7 L;  3AQQ A;  2EY2 A;  2IWH A;  2DJF C;  2F1M A;  1VMP A;  4JI4 Q;  4HJ9 A;  2R7Z G;  4C3I H;  2FIN B;  4LWC A;  2BDO A;  1HNW L;  2ZTC A;  5C4J B;  4GLV B;  2B3G A;  1WTO A;  3HOV G;  3BYT B;  3E0J A;  3TDQ A;  2YTY A;  1B2T A;  4ODG A;  1KC8 C;  3M4P A;  4UP9 A;  1Y8N B;  1OXS C;  2E74 C;  4HR7 B;  1ONL A;  2K1B A;  2Z1C A;  4R4T A;  5IP7 G;  1YHB A;  3D0F A;  2K33 A;  3FEW X;  4KHZ A;  5LL6 X;  2OF1 A;  3CW2 C;  4G7H C;  1I50 H;  1K28 A;  2ZM6 Q;  3NPP A;  4HCS A;  1C9O A;  4JOI C;  3JAM L;  5L37 A;  1AEX A;  1PH4 A;  2N55 A;  2OTJ A;  1KAA A;  5EQ0 A;  1HA5 A;  1BQQ T;  3MC0 B;  4A3I G;  4FF4 A;  4KHP Q;  3S1M H;  4BY7 B;  5CV8 A;  4LK1 C;  4JI4 L;  2PI2 A;  1IL2 A;  2WB1 G;  4PMB A;  2EQS A;  4TSS A;  1L0X B;  4A3E G;  2F0F A;  4YCU A;  3H91 A;  1LT5 D;  3SE0 A;  1Y1W G;  2JA7 H;  3S15 H;  3MXN A;  4IUN A;  2CW0 C;  4CBV A;  2L15 A;  1E2V A;  2EJF C;  2F0H A;  1D8L A;  4PMW A;  2OXP A;  5JJI A;  1VQJ A;  2XRS D;  2PQA B;  1S3O A;  2RF4 A;  1LTI D;  3SK4 A;  2ZM6 L;  1KIX A;  4L5S A;  2CHB D;  3BYY B;  4FF2 A;  3ER0 A; 
#chains in the Genus database with same CATH homology
 2A19 A;  3BU2 A;  2ZTD A;  1KRT A;  4L5R C;  1N9W A;  2GN5 A;  5M3M H;  4DR4 L;  1O7I A;  1H95 A;  3OTO L;  1UEB A;  2K14 A;  1VQN A;  1GKH A;  4IFD G;  1VQI A;  2LXK A;  1PHJ A;  4AH6 A;  4P74 A;  2H5X A;  1RL2 A;  4A3J G;  4NPS A;  4GKK Q;  1CKN A;  2N78 A;  4X65 Q;  1VQ7 A;  4NXM L;  4IPG A;  3AFQ A;  3J80 i;  2A1A A;  4YHH Q;  5M3F H;  3PCO B;  3F1Z A;  4A76 A;  3K7U C;  2NZO A;  5JEA G;  2PNH A;  3W5O A;  4DUZ L;  5IY0 A;  3J81 j;  2N8N A;  1L0W A;  2MNA A;  4DNI A;  4JI8 Q;  1Y14 B;  1PV4 A;  4PZ8 A;  3OYY A;  2A8V A;  2VZA A;  1NY4 A;  2B29 A;  5GAE C;  2WFW A;  4QJF A;  5IYD G;  4P71 A;  2Q2T A;  3M3Y H;  4GN4 B;  4JI1 L;  1HNW Q;  2VQF Q;  1IXR A;  3CCJ A;  3CCM A;  1X54 A;  2KCM A;  4UP7 A;  3KF6 B;  5HGQ A;  3CF5 A;  4BY1 H;  3KFU A;  2DUD A;  5K36 G;  3SGI A;  2JEA I;  4JBJ A;  4LFA L;  4OX9 L;  1XNQ Q;  3TRZ A;  4YWK A;  3FKI H;  3HOX G;  4OXP A;  2GVA A;  5LMN L;  1K0R A;  2JK8 A;  1X3G A;  2BH8 A;  2BA1 A;  4GS3 A;  4A3G G;  3S2H H;  2KHJ A;  1NMG A;  3NEM A;  1X6O A;  2HIX A;  5DLQ E;  4DK6 C;  1KQS A;  2VNU D;  3UDX A;  3GTQ H;  4OO1 G;  2R6G A;  1YHQ A;  3TS2 A;  1UE1 A;  4A3D G;  3KLW A;  3BJU A;  4QL5 A;  4A3K G;  2B63 H;  2RHQ B;  2UU9 Q;  3H3V H;  1QUQ B;  1SE8 A;  1YNX A;  2EIF A;  5JJK A;  4X65 L;  1SR3 A;  1UE5 A;  2JA8 G;  1NBW A;  4YHH L;  3GDE A;  5IYC H;  2YTV A;  4GNX A;  2AMC B;  3CMA A;  3H0G G;  3I2Z A;  1IBK Q;  3AEV A;  1JT8 A;  4O0A A;  1B8A A;  4JI8 L;  3S1R H;  4BBR H;  3A0J A;  1FJG Q;  5IT9 c;  4GLX A;  4JI2 L;  4QY7 A;  1HZA A;  1SLJ A;  4JBW A;  1XPR A;  1FVI A;  5GAG C;  2QEX A;  4A3D H;  4POF A;  1MIU A;  2VQF L;  3CCL A;  1XTD A;  4P72 A;  4B3T L;  4LFB Q;  2CKZ B;  1Q7Y C;  1FGU A;  1XNQ L;  1KRS A;  2F3I A;  3I4O A;  3G6E A;  3CPW A;  1WCM H;  3CP0 A;  1Q1E A;  2E5L Q;  3K81 C;  1SFO H;  1HNZ L;  1KXL A;  2IT1 A;  3LGJ A;  3I4M H;  1WJJ A;  3K7A H;  4BBS H;  2XGT A;  1GO3 E;  4MZ9 A;  3KYH C;  3GTJ H;  2AHO B;  4HIM A;  2I5M X;  2MO0 A;  3HOW H;  4BXX H;  4JI5 Q;  5LMN W;  1JJC B;  2QGQ A;  4RG1 A;  2VQE Q;  4JI7 Q;  1S40 A;  1PH9 A;  4GKJ Q;  4X6A H;  2OCE A;  2R92 H;  2NVX H;  3RLO A;  2UU9 L;  1K83 H;  1PH3 A;  2R93 H;  3PUX A;  1N36 Q;  4EQ5 A;  3CC7 A;  1L1O C;  1IBK L;  4DR4 Q;  2VY3 A;  1BBW A;  2N49 A;  5IE8 A;  3JAM c;  1WFQ A;  4NXN Q;  2IHF A;  3RNU A;  1GVP A;  4JCV E;  4Y7N H;  3MXN B;  1HZB A;  4R4I A;  2NN6 I;  1I94 L;  4H02 A;  2VUM G;  3ICE A;  1FL0 A;  2Y0S G;  1W2B A;  4A3F H;  1N33 Q;  1EQR A;  4DUZ Q;  2GVB A;  4LFB L;  2LXJ A;  4QQB X;  4OWX B;  3W1B A;  3M9B A;  5FJ8 H;  1K9M C;  4LUV A;  3PO3 H;  4OON A;  1SRU A;  4HID A;  2FXQ A;  5H1S E;  1CKO A;  1KL9 A;  1E24 A;  4TVA B;  2UUB Q;  2ZTE A;  2JE6 I;  5C0X G;  3G71 A;  4DKA C;  1K8G A;  3S17 H;  3HKS A;  4OO1 I;  3ZJY C;  3U4V A;  2IX0 A;  1VQD A;  3CCV A;  3HKZ G;  4GN5 A;  4LFC Q;  2BH2 A;  3GTP H;  2CFM A;  2YV5 A;  3GTK H;  4JI5 L;  4DAY B;  4IPH A;  1M90 C;  2VQE L;  4JI7 L;  2UUA Q;  2JA7 G;  3M85 A;  1K8A C;  4GKJ L;  1CKN B;  3CCE A;  1X3F A;  2E2H H;  4A93 G;  1NJI C;  2UUC Q;  2ES2 A;  1CKM A;  1M1K C;  1A63 A;  1RIP A;  3CCR A;  1E22 A;  4LF7 Q;  1Z9F A;  4RMF A;  4X66 Q;  1PH1 A;  3GTO H;  1WI5 A;  2I0Q A;  2KCT A;  4AIM A;  5IYB H;  4XTC S;  1VQL A;  1B7Y B;  4LUZ A;  4MTN A;  4NXN L;  3I56 A;  1UE7 A;  2JA5 G;  1CSP A;  1V9P A;  3PUY A;  1EWI A;  1UWV A;  4C3J H;  4YY3 Q;  1MKH A;  1Y1V G;  1YJ9 A;  4JI0 Q;  2Y0S E;  4PZ7 A;  2WB1 E;  3GO5 A;  3RLN A;  5M3M G;  3I4N H;  1C0A A;  1N33 L;  1LM0 A;  1HJP A;  3E9H A;  1OTC A;  1VQ9 A;  1K73 C;  5IP9 H;  3CME A;  3F2D A;  5GAH C;  3HOY H;  4WJ3 M;  1VQE A;  3AFP A;  1ASZ A;  4DR5 L;  3J7Z C;  4JI2 Q;  2ASB A;  3KJO A;  3UDI A;  3CD6 A;  1PYS B;  1EIF A;  2UUB L;  1MJE A;  4HIO A;  2D0O A;  2KBN A;  3GTG H;  1VQP A;  1XPO A;  3GTM H;  4GLA C;  3HKZ E;  4LFC L;  2MFI A;  2E8G A;  2I5H A;  2JQO A;  2WP8 J;  2OQK A;  2Q2I A;  4GNX C;  4B3T Q;  4A3B H;  1PH2 A;  4JG2 A;  4HJ7 A;  1Z47 A;  3PF4 A;  4DR7 Q;  3NEN A;  4PZ6 A;  2UUA L;  4DV2 Q;  4A75 A;  1PH7 A;  3T1Y Q;  2NVY H;  2UUC L;  4DR3 L;  1HNZ Q;  1HZC A;  1UE6 A;  4BY1 G;  4R4O A;  3J81 c;  3HOZ H;  2VS1 A;  4LF7 L;  4GNX B;  4X66 L;  1TWA H;  2K75 A;  3ERS X;  2K5V A;  4C2M H;  3CXC A;  4LF5 Q;  3WWV A;  2ATW A;  5GQO A;  5J3B A;  3FKI G;  3UE0 A;  1VQB A;  4DAM A;  1LYL A;  1V43 A;  4IJL A;  3AYH B;  4YY3 L;  5C3E H;  1PYB A;  3GTL H;  2NVQ H;  4JI0 L;  1HR0 Q;  1AE3 A;  5HY6 A;  1YIJ A;  2XTI A;  1PH8 A;  1I3Q H;  4DUY Q;  1XMQ Q;  4JI3 Q;  2LSS A;  3M4Q A;  3U4Z A;  3NEL A;  2ZJP A;  4HJ5 A;  4YWM A;  1N34 L;  3RZO H;  1TWF H;  4IJH A;  3T1H L;  1GM5 A;  3PO2 H;  2B63 G;  2CCZ A;  5E7N A;  4A3M H;  2JA6 H;  2EXD A;  5C4X H;  4Y52 H;  4UP8 A;  1T9H A;  4IPC A;  1XMO Q;  1I94 Q;  1SN8 A;  3J80 c;  4APV A;  1VQC A;  5IYC G;  3HOU H;  4B3R Q;  1P8L A;  1Q46 A;  3L0O A;  3UDF A;  1BKB A;  2N3S A;  1QVG A;  1EFW A;  4BBR G;  2D62 A;  4R4C A;  1LTL A;  4LNQ A;  3A5Z B;  3ULJ A;  3GD7 A;  2ZJQ A;  1A8V A;  1K3R A;  4DR7 L;  2Z6K A;  4DV2 L;  3FHW A;  3HFZ B;  3T1Y L;  2R7Z H;  4OWT B;  1VQ4 A;  4QIW E;  1XNR Q;  1B70 B;  4IFD I;  2UXD Q;  4IFD J;  1L2F A;  3TEH B;  3BZC A;  4DK3 C;  1G29 1;  2OQ0 A;  4HJA A;  2UXB L;  4LF5 L;  3HOV H;  3VDY A;  1HH2 P;  1WCM G;  2BA0 A;  1A62 A;  3UDG A;  5JEA J;  5IWA Q;  4DV1 Q;  4BBS G;  3I4M G;  4JC0 A;  4R4Q A;  4LF4 Q;  5GAD C;  1E1O A;  1HR0 L;  1JMC A;  3TQY A;  2I5L X;  1XMQ L;  4DUY L;  4JI3 L;  1S72 A;  2K5H A;  3HOW G;  4BXX G;  4A3L H;  1PFS A;  2HT1 A;  1YVC A;  1JJ2 A;  5IP7 H;  1VQF A;  1VQG A;  2R92 G;  3G48 A;  1VQM A;  1X3E A;  4L5Q A;  4LW1 A;  2KHI A;  2R93 G;  4GN3 B;  1XMO L;  3S24 A;  1KHI A;  4B3R L;  5M5W H;  5C44 H;  1C7Y A;  1N32 Q;  4DPG A;  3U58 A;  4DV6 Q;  2E2I H;  3NBH B;  4LUO A;  3CC2 A;  3STB D;  3K80 C;  3PUV A;  3Q8D A;  4A3I H;  4DR5 Q;  3KF8 B;  4YWL A;  4LF6 L;  1KAW A;  4A3F G;  3A5U A;  2IX1 A;  4DR1 Q;  1LUZ A;  1XNR L;  1E3P A;  2UXD L;  4R1J A;  1E1T A;  2UXC L;  5JJL A;  4X64 Q;  3PO3 G;  4X62 Q;  5FJ8 G;  2HHH Q;  3H15 A;  3A74 A;  1BBU A;  3CAM A;  1X55 A;  3CCQ A;  4A3E H;  2OWO A;  2JEB I;  1G6P A;  1VQ5 A;  3M4O H;  1IYJ B;  3CCS A;  1Y1W H;  1QZH A;  4O2D A;  1SMX A;  5IWA L;  4POG A;  5LMU Q;  2HIV A;  3F8T A;  4DV1 L;  4GOP A;  1IBL Q;  4A3C H;  4LF4 L;  4DR3 Q;  3H3V I;  4IPD A;  5FLM H;  1YHA A;  4JV5 Q;  2E2J H;  3F2C A;  2WAQ G;  4MNO A;  3ULL A;  1PVO A;  4JI6 Q;  4BY7 G;  1W3S A;  1YI2 A;  1TWH H;  2R7F A;  3PF5 A;  3L2P A;  2NZH A;  1I5F A;  1EIY B;  2CWP A;  4DR2 Q;  4IO9 A;  1NTG A;  3IRB A;  4JOI A;  3KDF A;  3M7N A;  3PUW A;  3K0X A;  5IYB G;  3S16 H;  4BY7 H;  1N32 L;  2CQO A;  4LF9 Q;  1L1O A;  5AJ3 Q;  3OW2 A;  4DV6 L;  4UY8 C;  2AKW B;  3EN2 A;  1E7Z A;  4A4I A;  3TRE A;  1N34 Q;  1YEZ A;  1OXU A;  3T1H Q;  4WJ4 A;  4DR6 Q;  1MJC A;  5BR8 Q;  2R7D A;  4B3S Q;  4A3J H;  1U0L A;  3I4N G;  5M3F G;  1VQH A;  4DR1 L;  1QVC A;  1VCI A;  5IP9 G;  2F4V Q;  1VQ6 A;  4HIK A;  2PI2 E;  3HOY G;  4J15 A;  2MQH A;  3CPF A;  4X64 L;  3F2B A;  4X62 L;  1A0I A;  4NB3 A;  2HHH L;  4KHP L;  5GRO A;  1PH6 A;  2D0P A;  2PQA A;  1YZ6 A;  1XJV A;  5IYD H;  3RN2 A;  4B3M Q;  5LMU L;  3G4S A;  4UPA A;  1EUJ A;  2QA4 A;  1IBL L;  3J7A 5;  4A3B G;  4DV7 Q;  1J5E L;  4JV5 L;  2WAQ E;  1OXV A;  2UXB Q;  2MO1 A;  4P75 A;  4JI6 L;  2K50 A;  2Z6K C;  4YCW A;  2VW9 A;  1PH5 A;  1J6Q A;  1CSQ A;  4JBM A;  1VS0 A;  3PIO A;  3HOX H;  4DR2 L;  3HOZ G;  3DM3 A;  3EIV A;  3DLL A;  2YTX A;  2C35 B;  4A3G H;  1VQ8 A;  2NN6 G;  3KOJ A;  4LF9 L;  5AJ3 L;  2JA9 A;  2Q2H A;  2YYZ A;  5C0X I;  1NE3 A;  1D7Q A;  5C0X J;  3CQZ H;  4JYA Q;  1DGS A;  3I7F A;  3S2D H;  1OXT A;  5C3E G;  2K52 A;  2IY5 B;  1X9N A;  2Q2U A;  5BR8 L;  3KJP A;  5FLX c;  4DV3 L;  4DV4 Q;  1YIT A;  4A3K H;  3RN5 A;  1KD1 C;  4B3S L;  1TWG H;  1SRO A;  3B6Y A;  2AWO A;  3UE1 A;  1VQO A;  4DV0 Q;  4KLK A;  2JA8 H;  3KF6 A;  1QVF A;  3W1G A;  2F4V L;  2Z0S A;  1IBM Q;  1WOC A;  1Q81 C;  3PO2 G;  3H0G H;  4LF8 Q;  1YJN A;  3JAM i;  3BZK A;  4A3M G;  2JA6 G;  5C4X G;  4AQY Q;  4GKK L;  1EYG A;  2JJQ A;  3MEF A;  3HOU G;  4LF6 Q;  1GD7 A;  1TWC H;  2ALY B;  1Q8K A;  1U5K A;  4PG3 A;  4B3M L;  4TQU S;  3JC6 6;  4DV7 L;  1VQA A;  1ASY A;  5ELN A;  3AQQ A;  2UXC Q;  4K0K Q;  4EX5 A;  4AYB G;  3CCU A;  5M5Y H;  2VL6 A;  1YJW A;  1IZ6 A;  1QZG A;  4JI4 Q;  4HJ9 A;  2R7Z G;  4C3I H;  3CC4 A;  4BA1 I;  4LWC A;  1QUQ A;  1HNW L;  2ZTC A;  4DR6 L;  2DGY A;  2F52 A;  4KI0 A;  1HNX Q;  2YU9 H;  4GLV B;  2B3G A;  4DV5 Q;  5EAY A;  1JB7 A;  3HOV G;  3E0E A;  5ELO A;  2K4K A;  1X65 A;  2YTY A;  1OXX K;  3RR5 A;  3D31 A;  2ID0 A;  4JYA L;  2PMZ E;  1X56 A;  1KC8 C;  3M4P A;  4UP9 A;  5M5X H;  3PIP A;  3I55 A;  3EBE A;  4DV4 L;  4GOP C;  4XIG S;  1VQK A;  1OXS C;  4A3L G;  4P73 A;  4DV0 L;  4FDB A;  4YCV A;  1AE2 A;  1CUK A;  4R4T A;  4JBK A;  3E9I A;  5IP7 G;  1IBM L;  1YHB A;  2CWA A;  3D0F A;  1R9T H;  4LF8 L;  4KHZ A;  1AH9 A;  5C4J H;  4AQY L;  3CW2 C;  1I50 H;  2ZM6 Q;  1PA6 A;  1C9O A;  4JOI C;  4GOP B;  5C44 G;  3U50 C;  1PH4 A;  2VUM H;  2IHE A;  2OTJ A;  4OWW B;  3OTO Q;  2RCN A;  3RLF A;  2RHS B;  4QGU A;  4AYB E;  1NMF A;  4A3I G;  3RZD H;  1FJG L;  2NVT H;  3S1Q H;  4K0K L;  4KHP Q;  2KEN A;  3S1M H;  1EOV A;  4IOC A;  4JI4 L;  1I6H H;  2PI2 A;  1IL2 A;  4NXM Q;  2WB1 G;  3FP9 A;  3KDF B;  4L5T A;  2EQS A;  2V1C C;  3PGZ A;  1HNX L;  3PSI A;  1L1O B;  4DV5 L;  1J5E Q;  1G51 A;  1HZ9 A;  1YBY A;  4A3E G;  2OTL A;  3TS0 A;  2AWN A;  3S14 H;  4YCU A;  2K5N A;  1TXY A;  1WYD A;  1Q1B A;  1Y1W G;  4A3C G;  2E5L L;  2JA7 H;  3S15 H;  4JI1 Q;  2ZJR A;  3ULP A;  1HR0 W;  4BA2 I;  5FLM G;  4A93 H;  1BVS A;  2L15 A;  3K8A A;  2HQL A;  1Q86 C;  3J81 i;  1XPU A;  1D8L A;  4C3H H;  1N8R C;  3L7Z C;  1Q12 A;  3S1N H;  1P16 A;  1JE5 A;  4LFA Q;  4PMW A;  4OX9 Q;  4IOA A;  1Q82 C;  3PV0 A;  1EQQ A;  1JJG A;  3STB C;  5JJI A;  1VQJ A;  3PUZ A;  2JA5 H;  2PQA B;  1S3O A;  2RF4 A;  2ZM6 L;  5LMN Q;  4DV3 Q;  1KIX A;  4HJ8 A;  4ALP A;  1V1Q A;  4L5S A;  1N36 L;  1Y1V H;  3ER0 A;  4ME3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...