5LMUQ

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5lmuQ00
5IYDG 4EQ5A 4JI4L 1OTCA 3KLWA 4BBSG 2R6GA 1CKNA 3OTOQ 2WB1E 1N36L 3D31A 4TVAB 4X64Q 1K3RA 2A1AA 2IY5B 1VQJA 1XPRA 4IPGA 4AH6A 4X65L 1MIUA 1HNZL 1JE5A 3W1BA 5IP9G 3KYHC 4IPCA 4DV6L 4A3GH 2UXBL 4DV7Q 2JJQA 2Q2TA 2JA6H 3PIOA 4BXXH 4TQUS 1G6PA 4DV1L 2JA6G 1YHQA 1B70B 1NTGA 1VQFA 1WFQA 1NY4A 4A3KG 1JB7A 3I2ZA 2R92H 4GS3A 1M90C 3HOZG 2HHHL 4BY1G 4JI1L 2VW9A 2KHJA 1UE5A 4A3DH 1IBML 1VQMA 1Y1VH 2Q2IA 4DR5Q 4IOAA 4JOIA 1AE3A 2R93G 2E5LQ 4YY3L 2LSSA 5C44H 1NE3A 4L5RC 2ZTEA 1EOVA 4OXPA 5IYBH 5GADC 3TS0A 4LFCL 2PQAA 1PYBA 3H3VH 3PUXA 4GN3B 1NBWA 3PUYA 4MNOA 4BA1I 1QVCA 4LFBQ 1L1OB 1Y14B 4C3HH 3KFUA 5M3MH 2IX1A 4OO1I 2KHIA 5BR8L 3HOVH 4X64L 4PZ7A 4X65Q 1HNZQ 2JA8G 1J5EL 3CCVA 1PH3A 2Z0SA 1XMOL 5C0XI 2OTLA 1OXUA 4NXML 1G51A 1JJ2A 2AWOA 4JI6Q 3A0JA 2UUAQ 1UEBA 1X55A 3HOWG 3KDFA 3PO2H 4DR4L 5DLQE 4LF6Q 2IHFA 1PA6A 2PNHA 1KC8C 1XNQQ 2VNUD 3K81C 4R4TA 2UXCL 1C9OA 3PUZA 4DKAC 3NEMA 3HOXH 3AYHB 1VQOA 3GTJH 1N34Q 1E3PA 4JI7L 4BA2I 1NMFA 5LMNW 1X9NA 1EQQA 1LTLA 2VZAA 4DR5L 4AQYL 2UU9L 2Q2UA 1SN8A 4K0KL 4A3FG 4DR6Q 1VQKA 5FJ8H 3CC7A 2I5LX 2WFWA 3L2PA 2R93H 4POGA 3JC66 4YCVA 4DK6C 1VQ7A 3MXNB 1Y1WG 2CCZA 4KHPQ 3HOZH 4IJHA 1RIPA 3OTOL 2VQFL 4OX9L 3GTQH 4DR3Q 4A3CH 3SGIA 5C4JH 3GTLH 2NZHA 1IBLL 2KENA 3K0XA 3EBEA 1W2BA 1GM5A 2DGYA 3F2BA 3DLLA 1K8GA 3I4NG 4DV7L 2KBNA 4B3MQ 2R7ZG 4OO1G 1YZ6A 1D8LA 2MO1A 2N49A 4QY7A 4NXMQ 4UPAA 2JK8A 2KCMA 1A62A 1KD1C 3ICEA 1JJCB 1UWVA 3H3VI 3CF5A 4JI5Q 2D62A 3S24A 1XMQQ 4OWWB 5LMNL 2UXCQ 2EQSA 3CCJA 3M4PA 3L7ZC 3PSIA 4JI7Q 5IYCH 2MQHA 1C0AA 4A3LH 3KJOA 3HKZE 4YCWA 1X54A 2IT1A 1B7YB 3H15A 3F2CA 2ZJRA 3RNUA 1YJWA 5FLXc 3M3YH 4LUOA 3S1NH 1PH2A 2UUCQ 3PF4A 5JJIA 4DR6L 4JI3L 4JI8Q 2EIFA 1I50H 5IP7H 4DV3Q 1Q81C 1VQ6A 1TXYA 3E9IA 4KI0A 2MFIA 2GN5A 1UE7A 4IFDG 4LF5L 4BXXG 4DAYB 1Q1EA 2WB1G 2RHSB 4IPHA 5IWAQ 3J81c 4HIMA 2KCTA 3BZKA 1HH2P 3RLOA 4JI0Q 4NPSA 1HZBA 2OTJA 1KRSA 1IXRA 1IBLQ 2CQOA 1OXVA 3CQZH 2ZM6L 5LMUL 5HY6A 3MEFA 4JBMA 2ID0A 3CCSA 4DR2Q 1I94Q 2I5HA 3UDIA 1V1QA 4JC0A 1PH6A 4LF7Q 1HNXQ 1HR0L 4DR4Q 1BKBA 4UP7A 1N32Q 3DM3A 5M5WH 1PH1A 1E24A 2BH2A 1QZGA 4A3FH 3I7FA 4A3IG 1ASYA 1KXLA 1EUJA 3UDGA 2VY3A 3HFZB 4DV5Q 4QQBX 1V43A 4DV0Q 1T9HA 4YHHQ 1L2FA 4UP9A 1M1KC 3UDXA 1YITA 3CPFA 4P74A 2RCNA 3I4NH 3TS2A 1YHBA 2XTIA 4DV1Q 2OQKA 4JBKA 4JI3Q 4JI8L 2VQEL 3RZOH 2R7DA 5JJKA 1A63A 5FLMG 4J15A 1RL2A 2MNAA 3E9HA 4KHZA 4JV5Q 1IYJB 4JI1Q 3UE1A 2QEXA 2NVQH 1GD7A 2PQAB 2Y0SE 3CP0A 1IBMQ 3TRZA 1XPOA 3TQYA 1LM0A 1VQCA 1XPUA 1H95A 4B3ML 2ATWA 2NVYH 4YY3Q 2JA5G 5LMUQ 4B3TQ 3ZJYC 2AKWB 2FXQA 2JA9A 1VQ4A 4R4CA 1OXTA 1X65A 3S1MH 1V9PA 2K50A 2B3GA 4GLXA 4YWKA 1TWCH 4GOPB 3PO2G 2K4KA 3BJUA 4Y52H 2JEBI 3NBHB 1E1TA 3CCQA 2K5HA 1KAWA 3PO3G 1Z47A 1JJGA 1ASZA 2R92G 4HJAA 4X66L 3I56A 3RN2A 4BY7G 2I0QA 4BY7H 1I6HH 2ZJQA 4JI2L 1A0IA 1D7QA 4XTCS 4UP8A 2A8VA 1Q12A 3LGJA 3GDEA 4IPDA 2YTYA 4R1JA 2JA7G 3A74A 3T1HL 1XNRL 3S17H 1CSPA 5GROA 5M3MG 3GTPH 1N33L 1EIYB 1JT8A 3FP9A 4NXNL 4DUYQ 2AWNA 4MZ9A 2NVTH 4K0KQ 1X3GA 3KF8B 4QL5A 3GTOH 3M4OH 5IYDH 4B3TL 2HT1A 5C0XG 4OONA 4C2MH 2K5VA 1HNXL 1HR0Q 4LFAL 4GLVB 2F4VL 3U4VA 3S1QH 4KHPL 2PI2E 4WJ4A 2N3SA 1YIJA 1VQ5A 4KLKA 1QVGA 3I4MH 3PGZA 4R4QA 3OW2A 3BZCA 4L5TA 3HOYG 4R4IA 4H02A 2VS1A 1VQIA 2ZJPA 4DV5L 1X6OA 3CXCA 1YBYA 1SR3A 3H0GH 1NMGA 4C3IH 1KIXA 1TWGH 1U0LA 1GKHA 4DNIA 4A3GG 3NENA 2UXBQ 4A3MH 4DPGA 1YEZA 4X66Q 1Q7YC 2VQEQ 1UE6A 1WI5A 4A3JG 3KF6B 5EAYA 4DUZL 3VDYA 4RG1A 1CKMA 1Q1BA 4JI5L 1XMQL 1DGSA 5LMNQ 4B3SQ 3F2DA 2YYZA 4WJ3M 5IP7G 4JG2A 2K75A 4LF8Q 1K83H 4DK3C 1Q86C 1BBWA 2CWPA 1K0RA 1MKHA 4A76A 4NB3A 1VQEA 3AFQA 3K8AA 5M3FG 4FDBA 2VUMG 4GKJQ 2UXDL 2L15A 4DV3L 4O0AA 3ER0A 4PG3A 2E8GA 4LFAQ 4JOIC 5H1SE 4LFCQ 5M5XH 3TEHB 4JI4Q 5IT9c 1BVSA 4A3KH 3EIVA 2CKZB 4A3EG 4A93H 4GKKQ 2B63G 4PZ6A 1N36Q 3S1RH 3F1ZA 3RLNA 1HZCA 1VQNA 3AEVA 4DR7Q 1FGUA 3STBD 4DV6Q 4GNXB 1K8AC 4GN5A 1WOCA 3S14H 4LF4L 3J80c 4GOPA 1QVFA 3I55A 3S15H 1CKNB 2UUBQ 4PZ8A 1CSQA 4IJLA 4RMFA 4LF7L 3PCOB 1E22A 1VQAA 3K80C 1FJGL 1EFWA 4A3CG 4HJ9A 3E0EA 5ELNA 3L0OA 4GN4B 1QZHA 2B29A 4LF6L 1XNQL 1YNXA 1HR0W 1LYLA 2B63H 1HNWL 1S40A 2K52A 3HOUG 4QIWE 1N33Q 3HKZG 4DV0L 4LF4Q 3NELA 3RR5A 3UDFA 3HOUH 1PH4A 2C35B 4JBWA 3EN2A 1SFOH 2E2JH 5K36G 1PHJA 2GVAA 1K73C 2AMCB 4GKJL 3M4QA 3OYYA 2Z6KA 1VQDA 4HIOA 3CPWA 2NN6I 3S16H 4LFBL 1PH9A 2JQOA 2WAQG 4A3MG 4AYBE 4DV4Q 5ELOA 3KOJA 4DR3L 2ES2A 2JA7H 4P71A 3JAMi 3J80i 4HIDA 4MTNA 2DUDA 3U4ZA 1NJIC 3CC4A 3J7A5 2ZTDA 3UE0A 1UE1A 1VCIA 4JYAQ 2UUAL 1AE2A 2BH8A 3GO5A 3I4OA 1PYSB 2F52A 2YV5A 4DUZQ 3HKSA 3CCLA 4LNQA 2OWOA 1EQRA 1FJGQ 3CCUA 3S2HH 2CFMA 5IYCG 4GNXA 1WCMG 1P8LA 1S3OA 2D0PA 5GAHC 2IHEA 1N34L 1JMCA 4B3SL 3PIPA 4LF9L 4LF8L 1W3SA 4L5QA 3CCRA 4IFDI 5GAEC 2HQLA 1PH5A 2UXDQ 1AH9A 2LXJA 2VUMH 2Q2HA 4GNXC 2QA4A 4OWXB 1I5FA 4IFDJ 1QUQA 1PVOA 1B8AA 1VQPA 4A3JH 1O7IA 1E1OA 2GVBA 1LUZA 1U5KA 3G48A 3Q8DA 4AIMA 5AJ3Q 1L1OC 2LXKA 3CMAA 4LF5Q 4GKKL 2VQFQ 1TWFH 4C3JH 3K7AH 2F3IA 1I3QH 3JAMc 4DR7L 5C3EH 1IBKQ 1FVIA 2AHOB 5IP9H 3HOVG 3HOYH 1WYDA 1N8RC 4A3BG 2F4VQ 3K7UC 2A19A 5GQOA 3FKIG 2WAQE 1XNRQ 5M3FH 1N32L 1KHIA 3RLFA 1R9TH 3FKIH 1N9WA 1TWHH 2JA5H 1X56A 1KQSA 3M9BA 2BA1A 2NZOA 4IOCA 5C4XH 2HHHQ 5C44G 4BBRH 3G4SA 4LUVA 3GTKH 3HOWH 3CD6A 4YHHL 4DR1L 5IE8A 4L5SA 4YCUA 5IY0A 1WJJA 1SRUA 4BY1H 2R7ZH 2JEAI 4A3DG 1OXSC 1YHAA 4X62Q 1KL9A 5E7NA 3J7ZC 1S72A 1P16A 2ZTCA 3PV0A 4P72A 4ALPA 2I5MX 2Z6KC 5AJ3L 2V1CC 5C3EG 4LUZA 4A75A 3M7NA 2HIVA 3J81j 1YJ9A 2D0OA 2K14A 3W1GA 1PFSA 2RF4A 3STBC 4BBSH 4DAMA 4Y7NH 5J3BA 5BR8Q 2MO0A 1HZAA 2ZM6Q 3GD7A 3ULPA 1IBKL 1MJCA 3CMEA 4BBRG 4XIGS 1XMOQ 1I94L 4IO9A 2BA0A 4JI6L 1X3FA 5HGQA 1Y1VG 1VQLA 2ALYB 4R4OA 4YWMA 2Y0SG 3KF6A 1E7ZA 4A3BH 1TWAH 2PMZE 1K9MC 2N78A 3F8TA 1PV4A 4LF9Q 2EXDA 4B3RQ 4HJ5A 1EYGA 3PF5A 1GO3E 3U50C 2CWAA 4DV2L 3WWVA 3T1YL 2UUBL 4P73A 4DR1Q 1J6QA 1G291 1VS0A 4O2DA 2QGQA 3A5ZB 4UY8C 2JA8H 1IZ6A 1Q8KA 3CC2A 2RHQB 3J81i 2JE6I 4JCVE 4JI2Q 1GVPA 4YWLA 1PH8A 1XTDA 3CAMA 3ULJA 4POFA 1MJEA 1Q82C 4HJ7A 4AYBG 1Z9FA 3KJPA 2NVXH 4JV5L 1HNWQ 2N8NA 2K5NA 3ERSX 3D0FA 3CCMA 4ME3A 5FLMH 4APVA 3G6EA 4HJ8A 4GOPC 1L1OA 3CW2C 3H0GG 3G71A 2E2IH 1EWIA 3BU2A 1FL0A 3M85A 1Y1WH 5IYBG 4NXNQ 5C0XJ 2H5XA 3RZDH 4A93G 2VL6A 4OWTB 3ULLA 1VQ8A 1VQ9A 1IL2A 3PUWA 3I4MG 3CCEA 1EIFA 1VQBA 2IX0A 1KRTA 1PH7A 2OQ0A 1WCMH 1SROA 4PMWA 4OX9Q 3GTGH 1SMXA 5JEAG 3KDFB 3U58A 2HIXA 4DV4L 4EX5A 1CKOA 4LW1A 4B3RL 2NN6G 1X3EA 3IRBA 4DV2Q 3PUVA 3T1YQ 1HZ9A 1J5EQ 2E2HH 1HJPA 1XJVA 3A5UA 4JYAL 1YJNA 4JBJA 2UUCL 1L0WA 3FHWA 4X62L 1C7YA 4A4IA 2WP8J 1VQGA 2ASBA 1Q46A 5M5YH 2PI2A 4P75A 4A3EH 4LWCA 2YTXA 3GTMH 2R7FA 3W5OA 1QUQB 2OCEA 5IWAL 2XGTA 4QJFA 3T1HQ 4JI0L 1YI2A 1VQHA 3S2DH 4DUYL 5JJLA 5JEAJ 3TREA 3RN5A 3PO3H 4X6AH 1A8VA 1OXXK 4QGUA 4A3IH 4HIKA 2E5LL 4AQYQ 2UU9Q 1SE8A 3B6YA 5GAGC 3HOXG 2YU9H 1BBUA 3AQQA 5FJ8G 1SLJA 4GLAC 2YTVA 5C4XG 4DR2L 1CUKA 4A3LG 1YVCA 3AFPA
chains in the Genus database with same CATH superfamily
4JI4L 4BBSG 2R6GA 2B2WC 3K5MA 2CW0C 1BDOA 3D6WA 1HFGA 2IY5B 1XPRA 1JE5A 3W1BA 5IP9G 2K5QA 4IPCA 3C1FA 5I9PA 2JJQA 2JA6H 4TQUS 3G7LA 1B70B 1NTGA 3GTLB 2F0HA 2VW9A 3LX0A 3S2DB 1IBML 1Y1VH 2Q2IA 4ZKCB 3FPUB 5C44H 4L5RC 4K14A 2ZTEA 2MJ8A 5IYBH 4O42A 4PV1C 3H3VH 2E2DC 2K04A 2E2HB 3GV3A 4MNOA 1QVCA 5L37A 4HCSA 5KYIA 3KFUA 1LV9A 2KHIA 5BR8L 3HOVH 4JW0A 5IGDA 4PZ7A 2R61A 2WINB 1PH3A 5C0XI 1JE4A 5HGTA 3A8JE 4KJNA 2A74C 3P75A 1NR2A 2B39A 4P2CB 2F0SA 3KDFA 3D4DA 5DLQE 1PA6A 2PNHA 4LMQD 4CDFC 1SNDA 1KC8C 3J7AF 2VNUD 5ISRA 1AN8A 3PUZA 1ENCA 1CI3M 4KKSA 1TY0A 2VZAA 4AQYL 2UU9L 3D6CA 1M4VA 2SDFA 2I5LX 3V05A 1WTXA 5CV8A 3JC66 4RA8A 5FO7B 2M9VA 4O1NA 2FJ2A 1RIPA 1MHWC 4A3BB 4A3CH 3EJIA 3I4NG 1PXUA 3BS1A 1SAPA 2EPBA 4B3MQ 1IW7D 1YZ6A 1QOHA 2WKDA 1A62A 5IIFA 3ICEA 2NN6H 1XMQQ 5LMNL 1D6EC 2EQSA 3M4PA 3PSIA 5C3WA 2K28A 5IYCH 2MQHA 4A3LH 1FGBD 4Q0FA 5C4ZA 5JJZA 1PH2A 2UUCQ 3U9OA 5JJIA 4DR6L 1I50H 4DV3Q 1WCMB 3Q22A 3J81L 2MFIA 1UE7A 1NCVA 3J81c 2RHSB 4IPHA 2EYJA 5IWAQ 4F88A 1HH2P 3HEJA 4KK7A 2ZM6L 5LMUL 1SYEA 1UNSA 2R3ZA 1SYCA 1V1QA 1PH6A 2MUYA 1C48A 4UP7A 1KDCA 5M5WH 4WJWA 2BH2A 5ELEA 1KXLA 3Q0AA 3TN2A 3UDGA 1ILQA 2VY3A 1RODA 1EYDA 1V43A 4DV0Q 1T9HA 4YHHQ 4UP9A 1YITA 3GTQB 1YHBA 5K5PA 5JOBA 4JBKA 3RZOH 5I6WA 1NR4A 4KD3A 1A63A 4WORA 1HHVA 1SYDA 4B9WA 2MNAA 5E4XA 3EVQA 4RFBA 1IYJB 2KCCA 2QEXA 3CP0A 1IBMQ 3TRZA 1QE6A 4R8IA 1LM0A 1SMYC 3NHHA 1K0SA 1I4RA 2I07B 2ATWA 1WTVA 4B3TQ 1A2TA 1B3QA 4IALA 4FNFA 2PZUA 4R4CA 1V9PA 1SE2A 4C1NI 3R2TA 1F9RA 2NTTA 1TWCH 4GOPB 3BJUA 2JEBI 1EY9A 3BDLA 5M5XB 2G9DA 4DXGA 4JPBW 4OEMB 5G3LD 2D2CC 1TVXA 4C3JG 5IGCA 4GZYC 2X6LA 1KTKA 1LTID 1SSOA 1D7QA 1G8ZD 2NBFA 3FMCA 4DN4M 5COYA 5BN5A 5DM63 1PTOB 1PLFA 1XNRL 3S17H 5M3MG 3G6JB 3RZOB 3FP9A 4NXNL 4HMIA 2PW7A 3TP5A 2NVTH 1HTLD 2NZ1D 2CH4W 5C0XH 1B9MA 5IYDH 5C0XG 1Y69U 1HR0Q 4LFAL 2PMZB 5FO8B 3I4MH 4KKTA 4KLKA 4OO1G 4R4IA 4HAEA 5EBDA 4DV5L 1X6OA 1LACA 5TSSA 4ODGA 4A3GG 4A3MH 1YEZA 1UE6A 2BOSA 3VDYA 1XX8A 1TKWB 1Z7TA 3T51B 3C46A 3ND9A 3HOUB 1CA6A 1EY7A 4NB3A 3AFQA 1JWMD 2IJ0A 2F0EA 1G2SA 1HXYD 2E8GA 4LFAQ 3TEHB 3N52A 3GQBA 1FNUA 3KK7A 5I2XA 1KNAA 3S1RH 3RLNA 1L0YB 4DR7Q 4OIJA 4GOPA 1QVFA 1CKNB 2EY6A 4LF7L 3PCOB 4A3CG 4HJ9A 3L0OA 4L63B 2B29A 4KD4A 1H9KA 3NBIA 1N33Q 2NTSA 1PH4A 1ET6A 2TMPA 3MXNA 3EN2A 1MGSA 3HP3A 4I65A 1K73C 1TWHB 2AMCB 3JAME 3EFXD 5C4XB 4HIOA 5C3EB 3GTKB 3HZXA 3CPWA 3S16H 5LL6S 1QCBD 2HCCA 4M1UB 4DV4Q 3DUZA 5AFWA 3J80i 4NP5A 3CC4A 3SEBA 3J7A5 3O13A 3UE0A 3S1RB 4ZLTF 1F9PA 3HKSA 4LNQA 1U4PA 1GOZA 2WACA 4V190 2QILA 2B63B 3FKIB 2Z8LA 3I70A 1V1PB 2K01A 3CCRA 2EXZA 4E6IA 2F3VA 3T16A 5GAEC 3A55A 2UXDQ 2C9OA 3MXPA 1TQOA 1VQPA 4S3SA 5AJ3Q 5CGKA 1A3VA 3JAMc 1O7ZA 4DR7L 3MXUA 5C3EH 1FVIA 1STNA 1JOKA 2J4XA 3LWEA 1BXTA 4CDCC 1N32L 1KHIA 2JA5H 1Q3LA 2DJFC 1KQSA 1PTOD 2NZOA 1HTPA 4FF4A 4LJZC 3GTGB 5LL6X 4F87A 5I4DA 1CQVA 4A3DG 2JEAI 2B2YA 1SE3A 2JSOA 1BCPF 5KNBA 5E7NA 2PO4A 3R2IA 1B4OA 4P72A 2Z6KC 1NSNS 2V1CC 4ZUIA 3M7NA 2HIVA 1D2BA 1PFSA 4Y7NH 5J3BA 2MO0A 1Q8IA 1IBKL 4BBRG 4XIGS 1I94L 3E0JA 3OWEB 2Z4HA 1Y1VG 3ND8A 1VQLA 3PO3B 4KN4C 5T1GA 1H9SB 4LF9Q 3F8TA 3H3VC 4B3RQ 4K2LA 2KECA 5CV5A 4HJ5A 1GO3E 3U50C 2CWAA 1U9RA 3WWVA 4P73A 4DR1Q 1VS0A 1G291 3J80E 3A5ZB 1V1PA 2C5CA 2RHQB 2OEOA 3J81i 4JCVE 4YWLA 2V4DA 3ULJA 1Q82C 1SJHD 1HNWQ 4JV5L 4K6DA 2N8NA 3ERSX 2JA6B 4MN3A 4ME3A 3H0GG 3G71A 3M85A 1FL0A 2M2LA 3RZDH 4QUCA 4OWTB 4KV6A 4IUTA 1KRTA 4KKUA 1J8IA 1ZEQX 1SMXA 2RQXA 3TP6A 3U58A 1XTCD 4B3RL 3PUVA 1HZ9A 2E2HH 1XJVA 1YJNA 2UUCL 1L0WA 4ZKBB 3FHWA 2A73B 2ASBA 1VQGA 3D4WA 1Q46A 3K5OA 3MC0B 3TZUA 2R7FA 3A8KE 1PDQA 4OIKA 5E4WC 2EVBA 1BO0A 1HFNA 1CK1A 4MIUA 2YU9H 1BBUA 1LT5D 4G7OC 1SLJA 2K5WA 4DR2L 4A3LG 3Q23A 4ME5A 3S2HB 4EQ5A 3CRKC 3P7JA 2WB1E 3X3MA 4X64Q 2A1AA 1VQJA 4IPGA 4X65L 1HNZL 3Q24A 3DWAA 2OT2A 4DV7Q 2O2LD 2FMCA 3MEHA 4EQPA 1WFQA 5M5YB 1LO5D 3I2ZA 2R92H 4GS3A 1C8CA 2KHJA 5J1ZA 1VQMA 1STYA 4IOAA 3EA6A 2Q8TA 1NE3A 1EOVA 1WVLA 4OXPA 1YNJC 4ZUJA 3TS0A 4LFCL 2PQAA 3PUXA 2A69D 4F7XA 3PUYA 3FEWX 3OW7A 4LFBQ 1L1OB 1BCPB 5M3MH 3LNNA 2IX1A 4X64L 1J5EL 1H9SA 2Z0SA 3F2UA 4WRDA 1XMOL 2R7ZB 2OTLA 1G51A 4RH6A 1JJ2A 4FYDA 4IUPA 1UEBA 2IPKD 3HOWG 3TDQA 4LF6Q 1XNQQ 1DOLA 3K81C 2DY8A 3BDOA 1C9OA 4DKAC 2KVMA 3HOXH 4BA2I 1EQQA 1LTLA 2CHBD 4DR5L 2LFNA 2B2UA 4K0KL 5KRUA 3K6OA 4CBVA 2BE5D 1F9SA 3CC7A 1VQKA 2R93H 4POGA 4YCVA 3VA7A 1ESFA 3MXNB 2E76C 3HOZH 4IJHA 2EYHA 2HUGA 3NXWA 3GTQH 5D65A 5C4JH 2NZHA 4Z9CB 2B2VC 1IBLL 3EBEA 2L0CA 1W2BA 1AW7A 1PYWD 4DV7L 3EQLC 2MO1A 2N49A 4QY7A 4UPAA 1DYQA 2KCMA 3MTSA 4RWSC 1RTOA 1JJCB 1UWVA 2OF1A 4IUQA 1BOSA 1XYIA 4OWWB 1CFMA 2HQEA 3L7ZC 4RGNA 3CRLC 4ABNA 3D3RA 4YCWA 2IT1A 3F2CA 1YJWA 3TP7A 4LUOA 3M3YH 1BF4A 2HD3A 1EEID 1SDFA 3HOXB 3I4NB 5IP7H 4KI0A 4XYOA 2F0NA 2KHSA 4HIMA 3BZKA 4NPSA 4FVMA 2PNRC 2OTJA 4JK1C 2K1BA 3I4LA 1IXRA 4KHVA 2DY7A 2CQOA 5D3IB 3PMFA 1IKMA 5IGFA 2I5HA 5C4JB 4XQNA 5C5MA 1N32Q 1E24A 4A3FH 3I7FA 1QNUA 5EKKA 3S1NB 5EQ0A 3CPFA 3TS2A 1STEA 3OOCA 2OQKA 4JI3Q 2VQEL 4N9TA 5C3XA 5FLMG 2J7ZA 3SK6A 3W2DA 4JI1Q 2ZT9C 2NVQH 1GD7A 2Y0SE 2VB3X 3S1QB 1HUMA 1XPUA 1H95A 4B3ML 4J1MA 2JA5G 1I4PA 3WDNA 1Y8PB 2AKWB 3GTOB 2F3WA 3OHXC 1STHA 2E74C 3S1MH 4YWKA 1EIGA 2K4KA 1CM9A 4Y52H 1K8OA 3R8BA 3NBHB 1E1TA 1PFMA 3BVZA 5F2DA 1Y1VB 3PO3G 1Z47A 3K57A 2K6AA 1ASZA 1TWGB 2R92G 1OO9B 1H9MA 1JQYD 4BY7H 1I6HH 1EIHA 2ZJQA 2TSSA 1AP0A 5CORA 3LGJA 4DK0A 2Q8RE 3T1HL 1CT1D 2SOBA 4RKBA 1EIYB 1JT8A 3ERQA 1PZJD 2AWNA 1QNKA 1X3GA 3DXJC 4QL5A 3M4OH 1V1OA 2CVRA 1TT2A 1HNXL 4GLVB 5JVH3 3U4VA 3S1QH 4WJ4A 3E6ZX 1M8AA 5ELBA 4U673 4R4QA 3BZCA 2VS1A 2A68D 2ZJPA 4XT3B 4DFAA 3CXCA 1SR3A 2K5DA 1NMGA 3AU7A 2DNEA 1GKHA 4FF1A 4DPGA 2H1EA 1WI5A 5EAYA 4CJ2C 4DUZL 1CKMA 2F0JA 4RAUC 5LMNQ 4QMGA 4TSSA 2A69C 5IP7G 3FRPB 1Q86C 1STBA 3NPPA 1DOMA 4A76A 2UXDL 4FDBA 2PCFB 4UDUC 4DA2A 1S5DD 4DV3L 1STGA 3ER0A 4PG3A 3WOFA 5KIXA 3QG1A 4JOIC 1BBXC 1EY6A 4EVOA 5IGGA 5IT9c 4PQXA 2CKZB 4GKKQ 4OHJA 2B63G 1N36Q 2GA4B 4ZRZA 1I4HA 4DNTB 1DXMA 1HZCA 3AEVA 3STBD 1K8AC 3U9SA 4C3IB 4GN5A 3S15H 1MBYA 2L55A 2RDGA 3SK4A 2AQ1B 4RMFA 4CHTB 1LTSD 1PFNA 3NQTA 3E0EA 4GN4B 3NSWA 4LF6L 1NUCA 1YNXA 1HR0W 1S40A 1PZID 1EZ6A 3NELA 3UDFA 3MA2B 3MWYW 1ICWA 1SFOH 2E2JH 2ZXOA 5JEAH 1EFID 3M4QA 1PZKD 2Z6KA 1LTBD 1GUWA 1S5BD 4HCEA 1F9QA 2A6HC 2JQOA 4A3MG 4HN7A 2JA7H 5ELOA 3KOJA 2ES2A 4MTNA 3U4ZA 1NJIC 2PZTA 2BH8A 3NWTA 4RCOA 1FJGQ 2F52A 1KABA 1E2ZA 4FO2A 1EQRA 2NWGA 1KAAA 2CFMA 5JPMC 4GNXA 4XYQA 1WCMG 1SEBD 1S3OA 4B3SL 1N34L 4BY1B 3Q6SA 4IFDI 1PH5A 2VUMH 2Q2HA 4GNXC 2QA4A 4IFDJ 1QUQA 4A3JH 1E1OA 1SNCA 1GUOA 5LHY1 4LF5Q 1T5EA 1PFBA 2XRQD 3MVVA 1F2LA 3I73A 1V8QA 3K7AH 2F3IA 4ZYSA 3JAML 2K33A 3TP8A 2AHOB 3OWFA 3HOVG 3QOLA 1AFPA 1G91A 1X3QA 3K7UC 2PZWA 5GQOA 2RSOA 5FO9B 5M3FH 3RLFA 1R9TH 1B53A 3J7AV 1SNPA 1X56A 3S17B 3M9BA 2SEBD 2HHHQ 4BBRH 2RBMA 5EJWA 3A56A 3HOWH 1O78A 3CD6A 4DR1L 1JR0D 1H9JA 1K28A 5EPKA 1WJJA 2WB1B 4BY1H 1OXSC 4X62Q 3PV0A 2ZTCA 4QF4A 4ALPA 2I5MX 2EY5A 5AJ3L 1TWFB 2KQ3A 4A75A 1JORA 3W1GA 5IGEA 4HEDA 3STBC 4BBSH 1BCPD 4DAMA 1HRJA 4A3JB 1HZAA 2ZM6Q 3ULPA 1MJCA 3MFYA 1PRTD 4OL7A 3SXHA 4IO9A 1LTGD 2XWJB 3MAQA 2VXWA 2IL8A 3TMEA 1PTOC 4YWMA 3KF6A 4LAAA 2Y0SG 3KBGA 2EJFC 2PMZE 2N78A 1K9MC 3SHLA 4C56C 2F0QA 4DV2L 4N8FA 2KUMA 3GTMB 4O2DA 4JVZA 4IUNA 1IZ6A 3CC2A 4RGTA 1JWSD 2L5TA 1XTDA 1X32A 1MJEA 2FMMA 4KY7A 3DEPA 3SR1A 2EZVA 3D0FA 3CCMA 5FLMH 4APVA 1XNRQ 1L1OA 3CW2C 5IYBG 2A6ED 2H5XA 4A93G 2VL6A 2R92B 5C5LA 1IL2A 1B44D 3CCEA 2AUJD 4KN7C 4OX9Q 5EKLA 1TY2A 3CHBD 5JEAG 2Q8IB 3NQIA 4UAIA 2HIXA 3IL8A 4LW1A 2NN6G 1X3EA 1IL8A 4DV2Q 2LY7A 1WTPA 3T1YQ 3IFTA 1J5EQ 1CHQD 5CV7A 3A5UA 4H44C 4JBJA 4XQJA 4X62L 5EBCA 1C7YA 1GUNA 1CQFA 5CV6A 4A3EH 2DJGC 4P75A 4LWCA 2YTXA 3VA5A 3GTMH 2OCEA 1DOKA 2XGTA 2D9UA 1YI2A 3S2DH 4YIJA 4X6AH 1RF2D 3DMUA 3SDZA 1LABA 1SE8A 5GAGC 4RGOS 3AQQA 4F8MA 1TR5A 1YVCA 4OX9L 2F0KA 2B2TA 5CMDA 1IYVA 5IYDG 2BDNA 1OTCA 2XNAC 1CKNA 2F1MA 3OTOQ 2JA8B 1N36L 3D31A 5A35A 2N55A 4TVAB 4EQNA 2E75C 4AH6A 1I4GA 3AB9A 4BXXH 3PIOA 1D1KA 4DV1L 1YHQA 1NY4A 3H91A 1M90C 3HOZG 1SNQA 4BY1G 1UE5A 2RCFA 4JOIA 2NYZD 2R93G 4YY3L 2B2TC 2A6EC 2HDLA 1GJXA 2MP1A 1PRTF 4DAPA 1NBWA 1SYBA 4BA1I 3M3YB 4EQOA 4C3HH 1EY0A 3KF8A 4X65Q 1HNZQ 3CCVA 1R4QB 4NXML 1OXUA 2A6HD 3K59A 4JI6Q 3A0JA 4IUVA 1X55A 2X6GA 3PO2H 1HQRD 4G57A 3C1EA 2UXCL 2QDBA 3NEMA 1N34Q 3GTJH 4X3UA 1E3PA 4HMJA 3BZDB 5IT9E 1NMFA 4Y7NB 2CQAA 1ET9A 5JAVA 1SN8A 4DR6Q 4CKCA 5FJ8H 4A3FB 2WFWA 3L2PA 4AYBB 3LWUA 1XXGA 5M9OA 1A6XA 4CGYB 1VQ7A 5BN4A 4B08A 2VQFL 2RA4A 4DR3Q 2LMCB 3SGIA 1E2WA 3HOVB 3K0XA 4CKEA 1QG7A 2DGYA 3DLLA 4DF7A 1A15A 2KBNA 2R7ZG 2EYLA 1B3AA 1D8LA 1ENFA 3DEOA 2NVQB 2JK8A 1KD1C 4MHEA 2KJXA 4U68A 3H3VI 5M5WB 3OPOA 4JI5Q 2D62A 1SYFA 2UXCQ 4WFN3 4JI7Q 1C0AA 1EYAA 5IOCA 3PO2B 3K0YA 3RNUA 1X54A 1B7YB 2ZJRA 2F0WA 4JI3L 5IGBA 2EIFA 4DXFA 4PNYA 1Q81C 3RMHA 2GN5A 4BXXG 1Q1EA 2WB1G 5KNCA 1GXDC 5DNFA 3RLOA 2ICIA 4PMBA 1KRSA 2MPMA 1OXVA 2ID0A 3CCSA 4JC0A 1HNXQ 1BKBA 3GV6A 1PH1A 1ASYA 4QB4A 4A3IG 3DWQA 1EUJA 1AZPA 4DV5Q 4QQBX 1JWUD 2SNMA 5T1IA 4P74A 2RCNA 2XTIA 1I50B 5CBEE 4L6TB 2R7DA 5JJKA 3RUZA 3NUCA 3QWNA 2EJGC 4XQQA 1PTOH 4RKLA 4JV5Q 3T13A 1XPOA 3TQYA 3C3LA 1EU3A 4FXGC 2P5ZX 1VQCA 1RCVD 2B2YC 4C3HG 2CW0D 2K03A 3I91A 1VF7A 2PW5A 5LMUQ 2ZXRA 3ZJYC 4R9WA 3TSSA 2FXQA 5IODA 2XSCA 3M4YA 4RGMA 1X65A 1BUVT 1GHKA 2K50A 4GLXA 2XN9C 5HURA 3NTIA 1CHPD 3PQIA 3ZYYX 2MHVA 3CCQA 2K5HA 1KAWA 1U4LA 3KLSA 5BN3A 2RDFA 1KLUD 4HTHA 3K5NA 1IW7C 1AEXA 5KEEA 4X66L 3I56A 4BY7G 4A3MB 2K7VA 4JI2L 1A0IA 3TZDA 2A8VA 2EDGA 1Q12A 2YTYA 1KNEA 3KLRA 2O5JC 2FHTA 3GTPH 4DUYQ 2KEDA 4MZ9A 3AMUA 4K0KQ 4I7ZC 3KF8B 4OONA 2K5VA 4IQZA 4KHPL 2PI2E 1ONLA 1YIJA 1QVGA 1TWCB 5D3DA 4L5TA 3HOYG 5J39A 2F0LA 4KJOA 1YBYA 3H0GH 3ONAB 3VR4A 2UXBQ 4DNIA 4X66Q 4OGQC 2JA7B 1A3TA 1TS4A 3A54A 4RG1A 1XWEA 1Q1BA 4JI5L 1DGSA 1S5CD 4C1NK 2IX3A 1J9OA 3VR5A 3QIAA 4N9PA 1EWCA 2YYZA 3BVGA 4DK3C 2NVTB 2CWPA 1K0RA 1MKHA 1RHPA 1VQEA 5M3FG 2H4OA 2L15A 3GTPB 5H1SE 4LFCQ 1KDAA 1D5XC 3S16B 3VYTA 1BVSA 3EIVA 1DJRD 4A93H 2NVXB 4PZ6A 3F1ZA 4H7BA 2E2IB 2IW3A 3S14H 1Y1WB 1UEAB 2AUKA 3J80c 1EWHA 2NB0A 2UUBQ 3T53B 1VQAA 3K80C 3K7AB 1EFWA 5ELNA 1CA5A 3X3NA 1XNQL 1LYLA 1L0XB 2B63H 1HNWL 2K52A 1LTAD 3HOUG 3HKZG 1IYUA 3HOUH 4KY6A 2Z1CA 4QCLA 1PHJA 4NDXA 1R9TB 4GKJL 2QCPX 3OYYA 1H9RA 1SMYD 2WAQG 4AYBE 1ENAA 4IN3A 4DR3L 1S5ED 4FP5D 5KGUA 4ZCKA 1JB3A 3JAMi 4K2KA 2DUDA 3R93A 1K8MA 4JYAQ 1AE2A 1TS2A 3GO5A 1PYSB 4C3IG 1F2ZA 2YV5A 4DUZQ 3S14B 5IYCG 2XIWA 1P8LA 1JMCA 2IHEA 2JA5B 4N8X1 1W3SA 2HQLA 4A3KB 2LXJA 3DHQA 4OWXB 1I5FA 4XXEA 1PVOA 1LT4D 1LT6D 1TS5A 4LK1C 2ICEC 1O7IA 2GVBA 1Q90A 5DEHA 4AIMA 2F0DA 5CBAE 1L1OC 2VQFQ 3PIO3 4DGZA 1B50A 2PQEA 1Z6HA 5KNDA 1IBKQ 2D5DA 5IP9H 3HOYH 1TU2B 1WYDA 4OO1H 1N8RC 3IKJA 2A19A 3FKIG 2WAQE 2MGSA 1EU4A 3FKIH 1N9WA 2G9HD 2BA1A 4IOCA 4TRDA 1ZKOA 4CDEC 1FR3A 1EYCA 4L5SA 5IE8A 1DM0B 4YCUA 2DNCA 3I90A 1YHAA 1II3A 1KL9A 2J0TD 1LTRD 2QEJC 1P16A 4ZK9B 3HS0C 5EGTA 1DZ1A 4IUUA 1U4RA 3VR6A 5C3EG 1YJ9A 3I3CA 2K14A 4G4KA 3KBXA 2RF4A 3MHBA 1JOOA 3GD7A 3NWSA 3RZDB 3CMEA 1XMOQ 2EYMA 2BA0A 1EL0A 3NTKA 1SJED 4JI6L 2B2UC 2JN4A 3BYTB 4R4OA 2LKVA 3I8ZA 3HOYB 4A3BH 1TWAH 1NAPA 1PV4A 2EXDA 3A8IE 2KA7A 3PF5A 5EKIA 1LT3D 2F4IA 3QO2A 2UUBL 1J6QA 2QGQA 2JA8H 1I3QB 4IFDH 4JI2Q 1GVPA 3A7LA 1PH8A 3CAMA 3OIPA 3VR2A 1Z9FA 3KJPA 2K5NA 4HJ8A 3G6EA 4GOPC 4ILWA 1EWIA 3BU2A 1SNMA 2XWBB 5C0XJ 3S15B 3J81E 4G7ZC 3ULLA 1VQ9A 3W3AA 4K8IA 3I4MG 1VQBA 2IX0A 3UI2A 2IWHA 1WCMH 1SROA 2WIIB 3R3OA 3NK9A 3KDFB 2B8FA 5I2YA 4ZAIA 3HG9A 1O80A 5E3FA 4DV4L 2EYFA 1BCPC 1HJPA 1ESRA 4JYAL 1LTTD 5ELCA 5CV9A 4A3DB 4C3HB 5KYLA 2WP8J 1I6VC 1HCZA 5M5YH 1HA6A 2PI2A 3URYA 4FXDA 1SBBB 2HDMA 4QJFA 5IWAL 3T1HQ 2HCIA 5JEAJ 3N6RA 3RN5A 1A8VA 1OXXK 2WAQB 4DAYA 4NKLA 3HOXG 3E3XA 4GLAC 2YTVA 3D4RA 5C4XG 3FDTA 4DAVA 3AFPA 3VR3A 3KLWA 5EPJA 4OELB 4BS9A 1RDPD 4HSVA 2PYKA 1K3RA 1W6KA 1MIUA 2UXBL 4DV6L 3KYHC 4A3GH 2RKSA 2L4NA 2Q2TA 2F03A 1W6JA 1G6PA 2JA6G 1VQFA 1WD0A 4A3KG 1JB7A 2EYOA 5DM73 4V0BA 2F0VA 4K5XA 4JI1L 5IT9L 3VYSA 2HHHL 4A3DH 4MTKA 4DR5Q 2EYPA 1AE3A 5ELDA 2E5LQ 2CH4A 2LSSA 4K8JA 1HPCA 2FFKB 5GADC 3HGBA 1PYBA 1JCKB 4GN3B 5M3FB 1B9NA 1Y14B 3QOJA 3QJYA 4OO1I 4BBRB 3MXGA 3HOWB 2JA8G 3D8GA 1D5MC 1U4MA 2KOLA 1CZGA 2AWOA 2UUAQ 4DR4L 1ZYRC 4A3IB 2A68C 2IHFA 1E2VA 4A3GB 3I4MB 4R4TA 1VQOA 3AYHB 4JI7L 5LMNW 1X9NA 2QKIC 1SYGA 2Z4IA 2Q2UA 1T5XD 4A3FG 1YNNC 2RSNA 4DK6C 1GUGA 1Y1WG 2CCZA 4KHPQ 2A5HA 3OTOL 5FK9C 1O7LA 5M3MB 3GTLH 2KENA 1GM5A 4PMCA 3F2BA 1K8GA 1FNVA 4NXMQ 4KY5A 5D14A 1GUTA 2B2VA 3CF5A 5NUCA 2Z9HA 3S24A 3CCJA 2F0TA 2XRSD 3OSOA 3KJOA 3K5LA 3HKZE 3H15A 3S1NH 4KMUC 5FLXc 2N88A 3PF4A 2R93B 4JI8Q 3SK8A 4RCNA 4M8AA 3BYYB 2WKCA 1VQ6A 1TXYA 1F77A 3E9IA 4B9XA 4DU9A 4IFDG 3DWPA 3P1HA 4LF5L 3HOZB 2NVYB 4DAYB 4L8JA 4H0LC 5C4HA 4FXKC 4JI0Q 3QR8A 2KCTA 1B2TA 1HZBA 4CKBA 2F0OA 1IBLQ 5FLXE 2AQ3B 3CQZH 1CTMA 4JBMA 5HY6A 3MEFA 4XDXA 1I94Q 4DR2Q 4LF7Q 3UDIA 3H6MA 1HR0L 4DR4Q 4UHVA 3HRZC 3DM3A 1PRTB 3S1MB 1QZGA 1NNXA 4J8QA 5FKAC 1C4QA 3HFZB 2F0UA 1CZWA 1M1KC 1L2FA 3UDXA 5I9OA 2QW7A 3HKZB 3I4NH 2ZXPA 5A2QE 1S5FD 2B8GA 4DV1Q 4X3SA 3FPPA 3NE5B 4JI8L 1VDZA 1I6HB 4BY7B 3OMCA 3H0GB 4J15A 1RL2A 1LLRD 3VYRA 3E9HA 4KHZA 3UE1A 2PQAB 2F0GA 5EPLA 1JOQA 1FD7D 2VB2X 4HR7B 2NVYH 4YY3Q 2AQ2B 1EOTA 5CR3A 3M4OB 2JA9A 3PIP3 1VQ4A 2K05A 1OXTA 2B3GA 3CQZB 1VF5C 3PO2G 3L3OC 4IURA 1G2TA 4NW2A 1JJGA 1UAPA 1B1ZA 4HJAA 3RN2A 4A93B 1FYCA 1DONA 1I4XA 2I0QA 1K83B 1UUPA 1ZXTA 4XTCS 4UP8A 3GDEA 3CU7A 4IPDA 4R1JA 4CJ1B 2JA7G 3P20A 3A74A 4BWGB 1CSPA 5GROA 1N33L 1S4ZA 1D5ZC 4J6HA 2BE5C 1BR9A 3V2TA 1ILPA 3GTOH 4B3TL 2HT1A 4C2MH 2F4VL 1IKLA 1RKNA 2N3SA 3A7AB 1VQ5A 1Y8OB 3PGZA 3OW2A 2EY1A 1EY8A 2BCOA 2WV6D 4H02A 1WTHA 3KLSX 3GTJB 1STAA 1VQIA 4K5WA 2F0IA 1HQMC 1KIXA 1QJOA 4C3IH 1TWGH 1U0LA 3J80L 3NENA 5A2QL 4HSPA 1DCZA 1Q7YC 3SK5A 2VQEQ 3J7YW 4G7HC 4A3JG 2QDLA 3KF6B 2F0FA 1MI2A 3S9WA 4XT1B 2EOTA 1XMQL 4B3SQ 3F2DA 4WJ3M 4JG2A 2K75A 4LF8Q 1K83H 3SE0A 3WOEA 1BBWA 1SFOB 2E2JB 3K8AA 2VUMG 4GKJQ 4FF2A 3L9AX 4O0AA 4NMZA 3CKIB 2L12A 2G5DA 5M5XH 1G6ZA 4JI4Q 4A3KH 4A3EG 3EROA 1PRTC 2M00A 4RHRA 1PMRA 1FNWA 4C2MB 1QWYA 1VQNA 3E5SA 1FGUA 4DV6Q 4GNXB 1WOCA 2L11A 3I55A 2X69A 2SNSA 4PZ8A 2PPBC 1CSQA 4IJLA 4DK1A 5I6YA 1E22A 1KLGD 1FJGL 3V96A 5C6AA 1QZHA 4K5VA 4H13C 1YNND 1WTRA 1EQTA 2KCNA 4QIWE 4ID6A 3K58A 4DV0L 4LF4Q 3RR5A 2F0PA 1ICFB 4CJ0B 2C35B 4JBWA 2ENBA 3GP7A 5K36G 1BNZA 1I4QA 2GVAA 4X3KA 3C2PA 1EEFD 3NP8A 4CDDC 5DAUA 1VQDA 4QUFA 1IHZA 1BQQT 3FVQA 4FF3A 1TIID 2NN6I 4LFBL 1PH9A 4Q5VA 2I46A 2FINB 1JC7A 1K3BC 1MSGA 1X3PA 4P71A 4HIDA 1VMPA 5JPNC 2ZTDA 1AZQA 3KUPA 3NTHA 1UE1A 3IAYA 2YU9B 1VCIA 2UUAL 1MD2D 3CCLA 3I4OA 2NUCA 2OWOA 1SE4A 3CCUA 1ML0D 1QB5D 4IZ8A 3S2HH 2D0PA 1HA5A 5GAHC 3PIPA 1WTWA 5CV4A 2F0MA 4LF8L 4LF9L 3BG3A 4L5QA 2B2WA 1AH9A 2K32A 4K6LA 1TWAB 1B8AA 3QB3A 5E1FA 2LS01 1JICA 1LUZA 1U5KA 3G48A 3Q8DA 4GKKL 2LXKA 3CMAA 1TWFH 1EY4A 4C3JH 3BDCA 1I3QH 1SNOA 2QF7A 4BBSB 1A2UA 1SXTA 3OMGA 4A3BG 2F4VQ 5JVG3 4ULLA 4RHSA 1TS3A 1QILA 1TWHH 5CC4A 1RD9D 5C4XH 2L9HA 5C44G 3G4SA 4LUVA 3GTKH 4YHHL 1E0BA 2VUMB 5IY0A 2R7ZH 1SRUA 3T4AC 1HUNA 1S72A 3J7ZC 3RD4A 1VMCA 4TKOB 1PTOF 5J22A 3MZ5A 5ELFA 4LUZA 2BDOA 2EJMA 3J81j 2D0OA 2RDHA 2KEEA 2JXMB 2O5IC 4DNRB 5BR8Q 5CYUA 2RVLA 4R8NA 2XVSA 1Y8NB 2L1BA 4C3JB 4QIWB 1EQVA 1X3FA 3OIQA 5HGQA 4I7AA 2ALYB 1MSHA 4X3TA 1E7ZA 1EY5A 2JP1A 3H09A 5G3LF 1ZYRD 1EYGA 3T1YL 3M7GA 3SVMA 4UY8C 1Q8KA 2JE6I 3TBIB 3H94A 1GHJA 4POFA 1EZ8A 4A3EB 1A3UA 4HJ7A 4AYBG 1RTNA 2NVXH 1RJTA 1WTOA 1KDBA 2Y0SB 4LF4L 2E2IH 1WD1A 4KTAA 1YNJD 4ZQ3A 1Y1WH 4NXNQ 5K36H 3BVMA 3T56B 1VQ8A 1WTQA 1F2MA 3PUWA 1EIFA 5FLXL 1PH7A 2OQ0A 4PMWA 3GTGH 3IFDA 1O7YA 2O4XA 3MFGA 4EX5A 1CKOA 5FOBB 3I72A 3IRBA 2EY2A 1D1IA 2JYOA 1GUSA 3NBHA 4A4IA 2OXPA 1F2YA 1R4PB 3W5OA 5C44B 1QUQB 4JI0L 2EE1A 3ITPA 3DM1A 5JJLA 1VQHA 4DUYL 3TREA 3PO3H 4QGUA 4A3IH 4HIKA 2E5LL 2Z6BA 4AQYQ 2DN8A 3B6YA 4EGVA 2UU9Q 5FJ8G 3VYUA 1CUKA 1DD2A
chains in the Genus database with same CATH topology
5IYDG 4EQ5A 4JI4L 1OTCA 3KLWA 4BBSG 2R6GA 1CKNA 3OTOQ 2WB1E 1N36L 3D31A 4TVAB 4X64Q 1K3RA 2A1AA 2IY5B 1VQJA 1XPRA 4IPGA 4AH6A 4X65L 1MIUA 1HNZL 1JE5A 3W1BA 5IP9G 3KYHC 4IPCA 4DV6L 4A3GH 2UXBL 4DV7Q 2JJQA 2Q2TA 2JA6H 3PIOA 4BXXH 4TQUS 1G6PA 4DV1L 2JA6G 1YHQA 1B70B 1NTGA 1VQFA 1WFQA 1NY4A 4A3KG 1JB7A 3I2ZA 2R92H 4GS3A 1M90C 3HOZG 2HHHL 4BY1G 4JI1L 2VW9A 2KHJA 1UE5A 4A3DH 1IBML 1VQMA 1Y1VH 2Q2IA 4DR5Q 4IOAA 4JOIA 1AE3A 2R93G 2E5LQ 4YY3L 2LSSA 5C44H 1NE3A 4L5RC 2ZTEA 1EOVA 4OXPA 5IYBH 5GADC 3TS0A 4LFCL 2PQAA 1PYBA 3H3VH 3PUXA 4GN3B 1NBWA 3PUYA 4MNOA 4BA1I 1QVCA 4LFBQ 1L1OB 1Y14B 4C3HH 3KFUA 5M3MH 2IX1A 4OO1I 2KHIA 5BR8L 3HOVH 4X64L 4PZ7A 4X65Q 1HNZQ 2JA8G 1J5EL 3CCVA 1PH3A 2Z0SA 1XMOL 5C0XI 2OTLA 1OXUA 4NXML 1G51A 1JJ2A 2AWOA 4JI6Q 3A0JA 2UUAQ 1UEBA 1X55A 3HOWG 3KDFA 3PO2H 4DR4L 5DLQE 4LF6Q 2IHFA 1PA6A 2PNHA 1KC8C 1XNQQ 2VNUD 3K81C 4R4TA 2UXCL 1C9OA 3PUZA 4DKAC 3NEMA 3HOXH 3AYHB 1VQOA 3GTJH 1N34Q 1E3PA 4JI7L 4BA2I 1NMFA 5LMNW 1X9NA 1EQQA 1LTLA 2VZAA 4DR5L 4AQYL 2UU9L 2Q2UA 1SN8A 4K0KL 4A3FG 4DR6Q 1VQKA 5FJ8H 3CC7A 2I5LX 2WFWA 3L2PA 2R93H 4POGA 3JC66 4YCVA 4DK6C 1VQ7A 3MXNB 1Y1WG 2CCZA 4KHPQ 3HOZH 4IJHA 1RIPA 3OTOL 2VQFL 4OX9L 3GTQH 4DR3Q 4A3CH 3SGIA 5C4JH 3GTLH 2NZHA 1IBLL 2KENA 3K0XA 3EBEA 1W2BA 1GM5A 2DGYA 3F2BA 3DLLA 1K8GA 3I4NG 4DV7L 2KBNA 4B3MQ 2R7ZG 4OO1G 1YZ6A 1D8LA 2MO1A 2N49A 4QY7A 4NXMQ 4UPAA 2JK8A 2KCMA 1A62A 1KD1C 3ICEA 1JJCB 1UWVA 3H3VI 3CF5A 4JI5Q 2D62A 3S24A 1XMQQ 4OWWB 5LMNL 2UXCQ 2EQSA 3CCJA 3M4PA 3L7ZC 3PSIA 4JI7Q 5IYCH 2MQHA 1C0AA 4A3LH 3KJOA 3HKZE 4YCWA 1X54A 2IT1A 1B7YB 3H15A 3F2CA 2ZJRA 3RNUA 1YJWA 5FLXc 3M3YH 4LUOA 3S1NH 1PH2A 2UUCQ 3PF4A 5JJIA 4DR6L 4JI3L 4JI8Q 2EIFA 1I50H 5IP7H 4DV3Q 1Q81C 1VQ6A 1TXYA 3E9IA 4KI0A 2MFIA 2GN5A 1UE7A 4IFDG 4LF5L 4BXXG 4DAYB 1Q1EA 2WB1G 2RHSB 4IPHA 5IWAQ 3J81c 4HIMA 2KCTA 3BZKA 1HH2P 3RLOA 4JI0Q 4NPSA 1HZBA 2OTJA 1KRSA 1IXRA 1IBLQ 2CQOA 1OXVA 3CQZH 2ZM6L 5LMUL 5HY6A 3MEFA 4JBMA 2ID0A 3CCSA 4DR2Q 1I94Q 2I5HA 3UDIA 1V1QA 4JC0A 1PH6A 4LF7Q 1HNXQ 1HR0L 4DR4Q 1BKBA 4UP7A 1N32Q 3DM3A 5M5WH 1PH1A 1E24A 2BH2A 1QZGA 4A3FH 3I7FA 4A3IG 1ASYA 1KXLA 1EUJA 3UDGA 2VY3A 3HFZB 4DV5Q 4QQBX 1V43A 4DV0Q 1T9HA 4YHHQ 1L2FA 4UP9A 1M1KC 3UDXA 1YITA 3CPFA 4P74A 2RCNA 3I4NH 3TS2A 1YHBA 2XTIA 4DV1Q 2OQKA 4JBKA 4JI3Q 4JI8L 2VQEL 3RZOH 2R7DA 5JJKA 1A63A 5FLMG 4J15A 1RL2A 2MNAA 3E9HA 4KHZA 4JV5Q 1IYJB 4JI1Q 3UE1A 2QEXA 2NVQH 1GD7A 2PQAB 2Y0SE 3CP0A 1IBMQ 3TRZA 1XPOA 3TQYA 1LM0A 1VQCA 1XPUA 1H95A 4B3ML 2ATWA 2NVYH 4YY3Q 2JA5G 5LMUQ 4B3TQ 3ZJYC 2AKWB 2FXQA 2JA9A 1VQ4A 4R4CA 1OXTA 1X65A 3S1MH 1V9PA 2K50A 2B3GA 4GLXA 4YWKA 1TWCH 4GOPB 3PO2G 2K4KA 3BJUA 4Y52H 2JEBI 3NBHB 1E1TA 3CCQA 2K5HA 1KAWA 3PO3G 1Z47A 1JJGA 1ASZA 2R92G 4HJAA 4X66L 3I56A 3RN2A 4BY7G 2I0QA 4BY7H 1I6HH 2ZJQA 4JI2L 1A0IA 1D7QA 4XTCS 4UP8A 2A8VA 1Q12A 3LGJA 3GDEA 4IPDA 2YTYA 4R1JA 2JA7G 3A74A 3T1HL 1XNRL 3S17H 1CSPA 5GROA 5M3MG 3GTPH 1N33L 1EIYB 1JT8A 3FP9A 4NXNL 4DUYQ 2AWNA 4MZ9A 2NVTH 4K0KQ 1X3GA 3KF8B 4QL5A 3GTOH 3M4OH 5IYDH 4B3TL 2HT1A 5C0XG 4OONA 4C2MH 2K5VA 1HNXL 1HR0Q 4LFAL 4GLVB 2F4VL 3U4VA 3S1QH 4KHPL 2PI2E 4WJ4A 2N3SA 1YIJA 1VQ5A 4KLKA 1QVGA 3I4MH 3PGZA 4R4QA 3OW2A 3BZCA 4L5TA 3HOYG 4R4IA 4H02A 2VS1A 1VQIA 2ZJPA 4DV5L 1X6OA 3CXCA 1YBYA 1SR3A 3H0GH 1NMGA 4C3IH 1KIXA 1TWGH 1U0LA 1GKHA 4DNIA 4A3GG 3NENA 2UXBQ 4A3MH 4DPGA 1YEZA 4X66Q 1Q7YC 2VQEQ 1UE6A 1WI5A 4A3JG 3KF6B 5EAYA 4DUZL 3VDYA 4RG1A 1CKMA 1Q1BA 4JI5L 1XMQL 1DGSA 5LMNQ 4B3SQ 3F2DA 2YYZA 4WJ3M 5IP7G 4JG2A 2K75A 4LF8Q 1K83H 4DK3C 1Q86C 1BBWA 2CWPA 1K0RA 1MKHA 4A76A 4NB3A 1VQEA 3AFQA 3K8AA 5M3FG 4FDBA 2VUMG 4GKJQ 2UXDL 2L15A 4DV3L 4O0AA 3ER0A 4PG3A 2E8GA 4LFAQ 4JOIC 5H1SE 4LFCQ 5M5XH 3TEHB 4JI4Q 5IT9c 1BVSA 4A3KH 3EIVA 2CKZB 4A3EG 4A93H 4GKKQ 2B63G 4PZ6A 1N36Q 3S1RH 3F1ZA 3RLNA 1HZCA 1VQNA 3AEVA 4DR7Q 1FGUA 3STBD 4DV6Q 4GNXB 1K8AC 4GN5A 1WOCA 3S14H 4LF4L 3J80c 4GOPA 1QVFA 3I55A 3S15H 1CKNB 2UUBQ 4PZ8A 1CSQA 4IJLA 4RMFA 4LF7L 3PCOB 1E22A 1VQAA 3K80C 1FJGL 1EFWA 4A3CG 4HJ9A 3E0EA 5ELNA 3L0OA 4GN4B 1QZHA 2B29A 4LF6L 1XNQL 1YNXA 1HR0W 1LYLA 2B63H 1HNWL 1S40A 2K52A 3HOUG 4QIWE 1N33Q 3HKZG 4DV0L 4LF4Q 3NELA 3RR5A 3UDFA 3HOUH 1PH4A 2C35B 4JBWA 3EN2A 1SFOH 2E2JH 5K36G 1PHJA 2GVAA 1K73C 2AMCB 4GKJL 3M4QA 3OYYA 2Z6KA 1VQDA 4HIOA 3CPWA 2NN6I 3S16H 4LFBL 1PH9A 2JQOA 2WAQG 4A3MG 4AYBE 4DV4Q 5ELOA 3KOJA 4DR3L 2ES2A 2JA7H 4P71A 3JAMi 3J80i 4HIDA 4MTNA 2DUDA 3U4ZA 1NJIC 3CC4A 3J7A5 2ZTDA 3UE0A 1UE1A 1VCIA 4JYAQ 2UUAL 1AE2A 2BH8A 3GO5A 3I4OA 1PYSB 2F52A 2YV5A 4DUZQ 3HKSA 3CCLA 4LNQA 2OWOA 1EQRA 1FJGQ 3CCUA 3S2HH 2CFMA 5IYCG 4GNXA 1WCMG 1P8LA 1S3OA 2D0PA 5GAHC 2IHEA 1N34L 1JMCA 4B3SL 3PIPA 4LF9L 4LF8L 1W3SA 4L5QA 3CCRA 4IFDI 5GAEC 2HQLA 1PH5A 2UXDQ 1AH9A 2LXJA 2VUMH 2Q2HA 4GNXC 2QA4A 4OWXB 1I5FA 4IFDJ 1QUQA 1PVOA 1B8AA 1VQPA 4A3JH 1O7IA 1E1OA 2GVBA 1LUZA 1U5KA 3G48A 3Q8DA 4AIMA 5AJ3Q 1L1OC 2LXKA 3CMAA 4LF5Q 4GKKL 2VQFQ 1TWFH 4C3JH 3K7AH 2F3IA 1I3QH 3JAMc 4DR7L 5C3EH 1IBKQ 1FVIA 2AHOB 5IP9H 3HOVG 3HOYH 1WYDA 1N8RC 4A3BG 2F4VQ 3K7UC 2A19A 5GQOA 3FKIG 2WAQE 1XNRQ 5M3FH 1N32L 1KHIA 3RLFA 1R9TH 3FKIH 1N9WA 1TWHH 2JA5H 1X56A 1KQSA 3M9BA 2BA1A 2NZOA 4IOCA 5C4XH 2HHHQ 5C44G 4BBRH 3G4SA 4LUVA 3GTKH 3HOWH 3CD6A 4YHHL 4DR1L 5IE8A 4L5SA 4YCUA 5IY0A 1WJJA 1SRUA 4BY1H 2R7ZH 2JEAI 4A3DG 1OXSC 1YHAA 4X62Q 1KL9A 5E7NA 3J7ZC 1S72A 1P16A 2ZTCA 3PV0A 4P72A 4ALPA 2I5MX 2Z6KC 5AJ3L 2V1CC 5C3EG 4LUZA 4A75A 3M7NA 2HIVA 3J81j 1YJ9A 2D0OA 2K14A 3W1GA 1PFSA 2RF4A 3STBC 4BBSH 4DAMA 4Y7NH 5J3BA 5BR8Q 2MO0A 1HZAA 2ZM6Q 3GD7A 3ULPA 1IBKL 1MJCA 3CMEA 4BBRG 4XIGS 1XMOQ 1I94L 4IO9A 2BA0A 4JI6L 1X3FA 5HGQA 1Y1VG 1VQLA 2ALYB 4R4OA 4YWMA 2Y0SG 3KF6A 1E7ZA 4A3BH 1TWAH 2PMZE 1K9MC 2N78A 3F8TA 1PV4A 4LF9Q 2EXDA 4B3RQ 4HJ5A 1EYGA 3PF5A 1GO3E 3U50C 2CWAA 4DV2L 3WWVA 3T1YL 2UUBL 4P73A 4DR1Q 1J6QA 1G291 1VS0A 4O2DA 2QGQA 3A5ZB 4UY8C 2JA8H 1IZ6A 1Q8KA 3CC2A 2RHQB 3J81i 2JE6I 4JCVE 4JI2Q 1GVPA 4YWLA 1PH8A 1XTDA 3CAMA 3ULJA 4POFA 1MJEA 1Q82C 4HJ7A 4AYBG 1Z9FA 3KJPA 2NVXH 4JV5L 1HNWQ 2N8NA 2K5NA 3ERSX 3D0FA 3CCMA 4ME3A 5FLMH 4APVA 3G6EA 4HJ8A 4GOPC 1L1OA 3CW2C 3H0GG 3G71A 2E2IH 1EWIA 3BU2A 1FL0A 3M85A 1Y1WH 5IYBG 4NXNQ 5C0XJ 2H5XA 3RZDH 4A93G 2VL6A 4OWTB 3ULLA 1VQ8A 1VQ9A 1IL2A 3PUWA 3I4MG 3CCEA 1EIFA 1VQBA 2IX0A 1KRTA 1PH7A 2OQ0A 1WCMH 1SROA 4PMWA 4OX9Q 3GTGH 1SMXA 5JEAG 3KDFB 3U58A 2HIXA 4DV4L 4EX5A 1CKOA 4LW1A 4B3RL 2NN6G 1X3EA 3IRBA 4DV2Q 3PUVA 3T1YQ 1HZ9A 1J5EQ 2E2HH 1HJPA 1XJVA 3A5UA 4JYAL 1YJNA 4JBJA 2UUCL 1L0WA 3FHWA 4X62L 1C7YA 4A4IA 2WP8J 1VQGA 2ASBA 1Q46A 5M5YH 2PI2A 4P75A 4A3EH 4LWCA 2YTXA 3GTMH 2R7FA 3W5OA 1QUQB 2OCEA 5IWAL 2XGTA 4QJFA 3T1HQ 4JI0L 1YI2A 1VQHA 3S2DH 4DUYL 5JJLA 5JEAJ 3TREA 3RN5A 3PO3H 4X6AH 1A8VA 1OXXK 4QGUA 4A3IH 4HIKA 2E5LL 4AQYQ 2UU9Q 1SE8A 3B6YA 5GAGC 3HOXG 2YU9H 1BBUA 3AQQA 5FJ8G 1SLJA 4GLAC 2YTVA 5C4XG 4DR2L 1CUKA 4A3LG 1YVCA 3AFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IYD G;  4EQ5 A;  4JI4 L;  1OTC A;  3KLW A;  4BBS G;  2R6G A;  1CKN A;  3OTO Q;  2WB1 E;  1N36 L;  3D31 A;  4TVA B;  4X64 Q;  1K3R A;  2A1A A;  2IY5 B;  1VQJ A;  1XPR A;  4IPG A;  4AH6 A;  4X65 L;  1MIU A;  1HNZ L;  1JE5 A;  3W1B A;  5IP9 G;  3KYH C;  4IPC A;  4DV6 L;  4A3G H;  2UXB L;  4DV7 Q;  2JJQ A;  2Q2T A;  2JA6 H;  3PIO A;  4BXX H;  4TQU S;  1G6P A;  4DV1 L;  2JA6 G;  1YHQ A;  1B70 B;  1NTG A;  1VQF A;  1WFQ A;  1NY4 A;  4A3K G;  1JB7 A;  3I2Z A;  2R92 H;  4GS3 A;  1M90 C;  3HOZ G;  2HHH L;  4BY1 G;  4JI1 L;  2VW9 A;  2KHJ A;  1UE5 A;  4A3D H;  1IBM L;  1VQM A;  1Y1V H;  2Q2I A;  4DR5 Q;  4IOA A;  4JOI A;  1AE3 A;  2R93 G;  2E5L Q;  4YY3 L;  2LSS A;  5C44 H;  1NE3 A;  4L5R C;  2ZTE A;  1EOV A;  4OXP A;  5IYB H;  5GAD C;  3TS0 A;  4LFC L;  2PQA A;  1PYB A;  3H3V H;  3PUX A;  4GN3 B;  1NBW A;  3PUY A;  4MNO A;  4BA1 I;  1QVC A;  4LFB Q;  1L1O B;  1Y14 B;  4C3H H;  3KFU A;  5M3M H;  2IX1 A;  4OO1 I;  2KHI A;  5BR8 L;  3HOV H;  4X64 L;  4PZ7 A;  4X65 Q;  1HNZ Q;  2JA8 G;  1J5E L;  3CCV A;  1PH3 A;  2Z0S A;  1XMO L;  5C0X I;  2OTL A;  1OXU A;  4NXM L;  1G51 A;  1JJ2 A;  2AWO A;  4JI6 Q;  3A0J A;  2UUA Q;  1UEB A;  1X55 A;  3HOW G;  3KDF A;  3PO2 H;  4DR4 L;  5DLQ E;  4LF6 Q;  2IHF A;  1PA6 A;  2PNH A;  1KC8 C;  1XNQ Q;  2VNU D;  3K81 C;  4R4T A;  2UXC L;  1C9O A;  3PUZ A;  4DKA C;  3NEM A;  3HOX H;  3AYH B;  1VQO A;  3GTJ H;  1N34 Q;  1E3P A;  4JI7 L;  4BA2 I;  1NMF A;  5LMN W;  1X9N A;  1EQQ A;  1LTL A;  2VZA A;  4DR5 L;  4AQY L;  2UU9 L;  2Q2U A;  1SN8 A;  4K0K L;  4A3F G;  4DR6 Q;  1VQK A;  5FJ8 H;  3CC7 A;  2I5L X;  2WFW A;  3L2P A;  2R93 H;  4POG A;  3JC6 6;  4YCV A;  4DK6 C;  1VQ7 A;  3MXN B;  1Y1W G;  2CCZ A;  4KHP Q;  3HOZ H;  4IJH A;  1RIP A;  3OTO L;  2VQF L;  4OX9 L;  3GTQ H;  4DR3 Q;  4A3C H;  3SGI A;  5C4J H;  3GTL H;  2NZH A;  1IBL L;  2KEN A;  3K0X A;  3EBE A;  1W2B A;  1GM5 A;  2DGY A;  3F2B A;  3DLL A;  1K8G A;  3I4N G;  4DV7 L;  2KBN A;  4B3M Q;  2R7Z G;  4OO1 G;  1YZ6 A;  1D8L A;  2MO1 A;  2N49 A;  4QY7 A;  4NXM Q;  4UPA A;  2JK8 A;  2KCM A;  1A62 A;  1KD1 C;  3ICE A;  1JJC B;  1UWV A;  3H3V I;  3CF5 A;  4JI5 Q;  2D62 A;  3S24 A;  1XMQ Q;  4OWW B;  5LMN L;  2UXC Q;  2EQS A;  3CCJ A;  3M4P A;  3L7Z C;  3PSI A;  4JI7 Q;  5IYC H;  2MQH A;  1C0A A;  4A3L H;  3KJO A;  3HKZ E;  4YCW A;  1X54 A;  2IT1 A;  1B7Y B;  3H15 A;  3F2C A;  2ZJR A;  3RNU A;  1YJW A;  5FLX c;  3M3Y H;  4LUO A;  3S1N H;  1PH2 A;  2UUC Q;  3PF4 A;  5JJI A;  4DR6 L;  4JI3 L;  4JI8 Q;  2EIF A;  1I50 H;  5IP7 H;  4DV3 Q;  1Q81 C;  1VQ6 A;  1TXY A;  3E9I A;  4KI0 A;  2MFI A;  2GN5 A;  1UE7 A;  4IFD G;  4LF5 L;  4BXX G;  4DAY B;  1Q1E A;  2WB1 G;  2RHS B;  4IPH A;  5IWA Q;  3J81 c;  4HIM A;  2KCT A;  3BZK A;  1HH2 P;  3RLO A;  4JI0 Q;  4NPS A;  1HZB A;  2OTJ A;  1KRS A;  1IXR A;  1IBL Q;  2CQO A;  1OXV A;  3CQZ H;  2ZM6 L;  5LMU L;  5HY6 A;  3MEF A;  4JBM A;  2ID0 A;  3CCS A;  4DR2 Q;  1I94 Q;  2I5H A;  3UDI A;  1V1Q A;  4JC0 A;  1PH6 A;  4LF7 Q;  1HNX Q;  1HR0 L;  4DR4 Q;  1BKB A;  4UP7 A;  1N32 Q;  3DM3 A;  5M5W H;  1PH1 A;  1E24 A;  2BH2 A;  1QZG A;  4A3F H;  3I7F A;  4A3I G;  1ASY A;  1KXL A;  1EUJ A;  3UDG A;  2VY3 A;  3HFZ B;  4DV5 Q;  4QQB X;  1V43 A;  4DV0 Q;  1T9H A;  4YHH Q;  1L2F A;  4UP9 A;  1M1K C;  3UDX A;  1YIT A;  3CPF A;  4P74 A;  2RCN A;  3I4N H;  3TS2 A;  1YHB A;  2XTI A;  4DV1 Q;  2OQK A;  4JBK A;  4JI3 Q;  4JI8 L;  2VQE L;  3RZO H;  2R7D A;  5JJK A;  1A63 A;  5FLM G;  4J15 A;  1RL2 A;  2MNA A;  3E9H A;  4KHZ A;  4JV5 Q;  1IYJ B;  4JI1 Q;  3UE1 A;  2QEX A;  2NVQ H;  1GD7 A;  2PQA B;  2Y0S E;  3CP0 A;  1IBM Q;  3TRZ A;  1XPO A;  3TQY A;  1LM0 A;  1VQC A;  1XPU A;  1H95 A;  4B3M L;  2ATW A;  2NVY H;  4YY3 Q;  2JA5 G;  5LMU Q;  4B3T Q;  3ZJY C;  2AKW B;  2FXQ A;  2JA9 A;  1VQ4 A;  4R4C A;  1OXT A;  1X65 A;  3S1M H;  1V9P A;  2K50 A;  2B3G A;  4GLX A;  4YWK A;  1TWC H;  4GOP B;  3PO2 G;  2K4K A;  3BJU A;  4Y52 H;  2JEB I;  3NBH B;  1E1T A;  3CCQ A;  2K5H A;  1KAW A;  3PO3 G;  1Z47 A;  1JJG A;  1ASZ A;  2R92 G;  4HJA A;  4X66 L;  3I56 A;  3RN2 A;  4BY7 G;  2I0Q A;  4BY7 H;  1I6H H;  2ZJQ A;  4JI2 L;  1A0I A;  1D7Q A;  4XTC S;  4UP8 A;  2A8V A;  1Q12 A;  3LGJ A;  3GDE A;  4IPD A;  2YTY A;  4R1J A;  2JA7 G;  3A74 A;  3T1H L;  1XNR L;  3S17 H;  1CSP A;  5GRO A;  5M3M G;  3GTP H;  1N33 L;  1EIY B;  1JT8 A;  3FP9 A;  4NXN L;  4DUY Q;  2AWN A;  4MZ9 A;  2NVT H;  4K0K Q;  1X3G A;  3KF8 B;  4QL5 A;  3GTO H;  3M4O H;  5IYD H;  4B3T L;  2HT1 A;  5C0X G;  4OON A;  4C2M H;  2K5V A;  1HNX L;  1HR0 Q;  4LFA L;  4GLV B;  2F4V L;  3U4V A;  3S1Q H;  4KHP L;  2PI2 E;  4WJ4 A;  2N3S A;  1YIJ A;  1VQ5 A;  4KLK A;  1QVG A;  3I4M H;  3PGZ A;  4R4Q A;  3OW2 A;  3BZC A;  4L5T A;  3HOY G;  4R4I A;  4H02 A;  2VS1 A;  1VQI A;  2ZJP A;  4DV5 L;  1X6O A;  3CXC A;  1YBY A;  1SR3 A;  3H0G H;  1NMG A;  4C3I H;  1KIX A;  1TWG H;  1U0L A;  1GKH A;  4DNI A;  4A3G G;  3NEN A;  2UXB Q;  4A3M H;  4DPG A;  1YEZ A;  4X66 Q;  1Q7Y C;  2VQE Q;  1UE6 A;  1WI5 A;  4A3J G;  3KF6 B;  5EAY A;  4DUZ L;  3VDY A;  4RG1 A;  1CKM A;  1Q1B A;  4JI5 L;  1XMQ L;  1DGS A;  5LMN Q;  4B3S Q;  3F2D A;  2YYZ A;  4WJ3 M;  5IP7 G;  4JG2 A;  2K75 A;  4LF8 Q;  1K83 H;  4DK3 C;  1Q86 C;  1BBW A;  2CWP A;  1K0R A;  1MKH A;  4A76 A;  4NB3 A;  1VQE A;  3AFQ A;  3K8A A;  5M3F G;  4FDB A;  2VUM G;  4GKJ Q;  2UXD L;  2L15 A;  4DV3 L;  4O0A A;  3ER0 A;  4PG3 A;  2E8G A;  4LFA Q;  4JOI C;  5H1S E;  4LFC Q;  5M5X H;  3TEH B;  4JI4 Q;  5IT9 c;  1BVS A;  4A3K H;  3EIV A;  2CKZ B;  4A3E G;  4A93 H;  4GKK Q;  2B63 G;  4PZ6 A;  1N36 Q;  3S1R H;  3F1Z A;  3RLN A;  1HZC A;  1VQN A;  3AEV A;  4DR7 Q;  1FGU A;  3STB D;  4DV6 Q;  4GNX B;  1K8A C;  4GN5 A;  1WOC A;  3S14 H;  4LF4 L;  3J80 c;  4GOP A;  1QVF A;  3I55 A;  3S15 H;  1CKN B;  2UUB Q;  4PZ8 A;  1CSQ A;  4IJL A;  4RMF A;  4LF7 L;  3PCO B;  1E22 A;  1VQA A;  3K80 C;  1FJG L;  1EFW A;  4A3C G;  4HJ9 A;  3E0E A;  5ELN A;  3L0O A;  4GN4 B;  1QZH A;  2B29 A;  4LF6 L;  1XNQ L;  1YNX A;  1HR0 W;  1LYL A;  2B63 H;  1HNW L;  1S40 A;  2K52 A;  3HOU G;  4QIW E;  1N33 Q;  3HKZ G;  4DV0 L;  4LF4 Q;  3NEL A;  3RR5 A;  3UDF A;  3HOU H;  1PH4 A;  2C35 B;  4JBW A;  3EN2 A;  1SFO H;  2E2J H;  5K36 G;  1PHJ A;  2GVA A;  1K73 C;  2AMC B;  4GKJ L;  3M4Q A;  3OYY A;  2Z6K A;  1VQD A;  4HIO A;  3CPW A;  2NN6 I;  3S16 H;  4LFB L;  1PH9 A;  2JQO A;  2WAQ G;  4A3M G;  4AYB E;  4DV4 Q;  5ELO A;  3KOJ A;  4DR3 L;  2ES2 A;  2JA7 H;  4P71 A;  3JAM i;  3J80 i;  4HID A;  4MTN A;  2DUD A;  3U4Z A;  1NJI C;  3CC4 A;  3J7A 5;  2ZTD A;  3UE0 A;  1UE1 A;  1VCI A;  4JYA Q;  2UUA L;  1AE2 A;  2BH8 A;  3GO5 A;  3I4O A;  1PYS B;  2F52 A;  2YV5 A;  4DUZ Q;  3HKS A;  3CCL A;  4LNQ A;  2OWO A;  1EQR A;  1FJG Q;  3CCU A;  3S2H H;  2CFM A;  5IYC G;  4GNX A;  1WCM G;  1P8L A;  1S3O A;  2D0P A;  5GAH C;  2IHE A;  1N34 L;  1JMC A;  4B3S L;  3PIP A;  4LF9 L;  4LF8 L;  1W3S A;  4L5Q A;  3CCR A;  4IFD I;  5GAE C;  2HQL A;  1PH5 A;  2UXD Q;  1AH9 A;  2LXJ A;  2VUM H;  2Q2H A;  4GNX C;  2QA4 A;  4OWX B;  1I5F A;  4IFD J;  1QUQ A;  1PVO A;  1B8A A;  1VQP A;  4A3J H;  1O7I A;  1E1O A;  2GVB A;  1LUZ A;  1U5K A;  3G48 A;  3Q8D A;  4AIM A;  5AJ3 Q;  1L1O C;  2LXK A;  3CMA A;  4LF5 Q;  4GKK L;  2VQF Q;  1TWF H;  4C3J H;  3K7A H;  2F3I A;  1I3Q H;  3JAM c;  4DR7 L;  5C3E H;  1IBK Q;  1FVI A;  2AHO B;  5IP9 H;  3HOV G;  3HOY H;  1WYD A;  1N8R C;  4A3B G;  2F4V Q;  3K7U C;  2A19 A;  5GQO A;  3FKI G;  2WAQ E;  1XNR Q;  5M3F H;  1N32 L;  1KHI A;  3RLF A;  1R9T H;  3FKI H;  1N9W A;  1TWH H;  2JA5 H;  1X56 A;  1KQS A;  3M9B A;  2BA1 A;  2NZO A;  4IOC A;  5C4X H;  2HHH Q;  5C44 G;  4BBR H;  3G4S A;  4LUV A;  3GTK H;  3HOW H;  3CD6 A;  4YHH L;  4DR1 L;  5IE8 A;  4L5S A;  4YCU A;  5IY0 A;  1WJJ A;  1SRU A;  4BY1 H;  2R7Z H;  2JEA I;  4A3D G;  1OXS C;  1YHA A;  4X62 Q;  1KL9 A;  5E7N A;  3J7Z C;  1S72 A;  1P16 A;  2ZTC A;  3PV0 A;  4P72 A;  4ALP A;  2I5M X;  2Z6K C;  5AJ3 L;  2V1C C;  5C3E G;  4LUZ A;  4A75 A;  3M7N A;  2HIV A;  3J81 j;  1YJ9 A;  2D0O A;  2K14 A;  3W1G A;  1PFS A;  2RF4 A;  3STB C;  4BBS H;  4DAM A;  4Y7N H;  5J3B A;  5BR8 Q;  2MO0 A;  1HZA A;  2ZM6 Q;  3GD7 A;  3ULP A;  1IBK L;  1MJC A;  3CME A;  4BBR G;  4XIG S;  1XMO Q;  1I94 L;  4IO9 A;  2BA0 A;  4JI6 L;  1X3F A;  5HGQ A;  1Y1V G;  1VQL A;  2ALY B;  4R4O A;  4YWM A;  2Y0S G;  3KF6 A;  1E7Z A;  4A3B H;  1TWA H;  2PMZ E;  1K9M C;  2N78 A;  3F8T A;  1PV4 A;  4LF9 Q;  2EXD A;  4B3R Q;  4HJ5 A;  1EYG A;  3PF5 A;  1GO3 E;  3U50 C;  2CWA A;  4DV2 L;  3WWV A;  3T1Y L;  2UUB L;  4P73 A;  4DR1 Q;  1J6Q A;  1G29 1;  1VS0 A;  4O2D A;  2QGQ A;  3A5Z B;  4UY8 C;  2JA8 H;  1IZ6 A;  1Q8K A;  3CC2 A;  2RHQ B;  3J81 i;  2JE6 I;  4JCV E;  4JI2 Q;  1GVP A;  4YWL A;  1PH8 A;  1XTD A;  3CAM A;  3ULJ A;  4POF A;  1MJE A;  1Q82 C;  4HJ7 A;  4AYB G;  1Z9F A;  3KJP A;  2NVX H;  4JV5 L;  1HNW Q;  2N8N A;  2K5N A;  3ERS X;  3D0F A;  3CCM A;  4ME3 A;  5FLM H;  4APV A;  3G6E A;  4HJ8 A;  4GOP C;  1L1O A;  3CW2 C;  3H0G G;  3G71 A;  2E2I H;  1EWI A;  3BU2 A;  1FL0 A;  3M85 A;  1Y1W H;  5IYB G;  4NXN Q;  5C0X J;  2H5X A;  3RZD H;  4A93 G;  2VL6 A;  4OWT B;  3ULL A;  1VQ8 A;  1VQ9 A;  1IL2 A;  3PUW A;  3I4M G;  3CCE A;  1EIF A;  1VQB A;  2IX0 A;  1KRT A;  1PH7 A;  2OQ0 A;  1WCM H;  1SRO A;  4PMW A;  4OX9 Q;  3GTG H;  1SMX A;  5JEA G;  3KDF B;  3U58 A;  2HIX A;  4DV4 L;  4EX5 A;  1CKO A;  4LW1 A;  4B3R L;  2NN6 G;  1X3E A;  3IRB A;  4DV2 Q;  3PUV A;  3T1Y Q;  1HZ9 A;  1J5E Q;  2E2H H;  1HJP A;  1XJV A;  3A5U A;  4JYA L;  1YJN A;  4JBJ A;  2UUC L;  1L0W A;  3FHW A;  4X62 L;  1C7Y A;  4A4I A;  2WP8 J;  1VQG A;  2ASB A;  1Q46 A;  5M5Y H;  2PI2 A;  4P75 A;  4A3E H;  4LWC A;  2YTX A;  3GTM H;  2R7F A;  3W5O A;  1QUQ B;  2OCE A;  5IWA L;  2XGT A;  4QJF A;  3T1H Q;  4JI0 L;  1YI2 A;  1VQH A;  3S2D H;  4DUY L;  5JJL A;  5JEA J;  3TRE A;  3RN5 A;  3PO3 H;  4X6A H;  1A8V A;  1OXX K;  4QGU A;  4A3I H;  4HIK A;  2E5L L;  4AQY Q;  2UU9 Q;  1SE8 A;  3B6Y A;  5GAG C;  3HOX G;  2YU9 H;  1BBU A;  3AQQ A;  5FJ8 G;  1SLJ A;  4GLA C;  2YTV A;  5C4X G;  4DR2 L;  1CUK A;  4A3L G;  1YVC A;  3AFP A; 
#chains in the Genus database with same CATH topology
 4JI4 L;  4BBS G;  2R6G A;  2B2W C;  3K5M A;  2CW0 C;  1BDO A;  3D6W A;  1HFG A;  2IY5 B;  1XPR A;  1JE5 A;  3W1B A;  5IP9 G;  2K5Q A;  4IPC A;  3C1F A;  5I9P A;  2JJQ A;  2JA6 H;  4TQU S;  3G7L A;  1B70 B;  1NTG A;  3GTL B;  2F0H A;  2VW9 A;  3LX0 A;  3S2D B;  1IBM L;  1Y1V H;  2Q2I A;  4ZKC B;  3FPU B;  5C44 H;  4L5R C;  4K14 A;  2ZTE A;  2MJ8 A;  5IYB H;  4O42 A;  4PV1 C;  3H3V H;  2E2D C;  2K04 A;  2E2H B;  3GV3 A;  4MNO A;  1QVC A;  5L37 A;  4HCS A;  5KYI A;  3KFU A;  1LV9 A;  2KHI A;  5BR8 L;  3HOV H;  4JW0 A;  5IGD A;  4PZ7 A;  2R61 A;  2WIN B;  1PH3 A;  5C0X I;  1JE4 A;  5HGT A;  3A8J E;  4KJN A;  2A74 C;  3P75 A;  1NR2 A;  2B39 A;  4P2C B;  2F0S A;  3KDF A;  3D4D A;  5DLQ E;  1PA6 A;  2PNH A;  4LMQ D;  4CDF C;  1SND A;  1KC8 C;  3J7A F;  2VNU D;  5ISR A;  1AN8 A;  3PUZ A;  1ENC A;  1CI3 M;  4KKS A;  1TY0 A;  2VZA A;  4AQY L;  2UU9 L;  3D6C A;  1M4V A;  2SDF A;  2I5L X;  3V05 A;  1WTX A;  5CV8 A;  3JC6 6;  4RA8 A;  5FO7 B;  2M9V A;  4O1N A;  2FJ2 A;  1RIP A;  1MHW C;  4A3B B;  4A3C H;  3EJI A;  3I4N G;  1PXU A;  3BS1 A;  1SAP A;  2EPB A;  4B3M Q;  1IW7 D;  1YZ6 A;  1QOH A;  2WKD A;  1A62 A;  5IIF A;  3ICE A;  2NN6 H;  1XMQ Q;  5LMN L;  1D6E C;  2EQS A;  3M4P A;  3PSI A;  5C3W A;  2K28 A;  5IYC H;  2MQH A;  4A3L H;  1FGB D;  4Q0F A;  5C4Z A;  5JJZ A;  1PH2 A;  2UUC Q;  3U9O A;  5JJI A;  4DR6 L;  1I50 H;  4DV3 Q;  1WCM B;  3Q22 A;  3J81 L;  2MFI A;  1UE7 A;  1NCV A;  3J81 c;  2RHS B;  4IPH A;  2EYJ A;  5IWA Q;  4F88 A;  1HH2 P;  3HEJ A;  4KK7 A;  2ZM6 L;  5LMU L;  1SYE A;  1UNS A;  2R3Z A;  1SYC A;  1V1Q A;  1PH6 A;  2MUY A;  1C48 A;  4UP7 A;  1KDC A;  5M5W H;  4WJW A;  2BH2 A;  5ELE A;  1KXL A;  3Q0A A;  3TN2 A;  3UDG A;  1ILQ A;  2VY3 A;  1ROD A;  1EYD A;  1V43 A;  4DV0 Q;  1T9H A;  4YHH Q;  4UP9 A;  1YIT A;  3GTQ B;  1YHB A;  5K5P A;  5JOB A;  4JBK A;  3RZO H;  5I6W A;  1NR4 A;  4KD3 A;  1A63 A;  4WOR A;  1HHV A;  1SYD A;  4B9W A;  2MNA A;  5E4X A;  3EVQ A;  4RFB A;  1IYJ B;  2KCC A;  2QEX A;  3CP0 A;  1IBM Q;  3TRZ A;  1QE6 A;  4R8I A;  1LM0 A;  1SMY C;  3NHH A;  1K0S A;  1I4R A;  2I07 B;  2ATW A;  1WTV A;  4B3T Q;  1A2T A;  1B3Q A;  4IAL A;  4FNF A;  2PZU A;  4R4C A;  1V9P A;  1SE2 A;  4C1N I;  3R2T A;  1F9R A;  2NTT A;  1TWC H;  4GOP B;  3BJU A;  2JEB I;  1EY9 A;  3BDL A;  5M5X B;  2G9D A;  4DXG A;  4JPB W;  4OEM B;  5G3L D;  2D2C C;  1TVX A;  4C3J G;  5IGC A;  4GZY C;  2X6L A;  1KTK A;  1LTI D;  1SSO A;  1D7Q A;  1G8Z D;  2NBF A;  3FMC A;  4DN4 M;  5COY A;  5BN5 A;  5DM6 3;  1PTO B;  1PLF A;  1XNR L;  3S17 H;  5M3M G;  3G6J B;  3RZO B;  3FP9 A;  4NXN L;  4HMI A;  2PW7 A;  3TP5 A;  2NVT H;  1HTL D;  2NZ1 D;  2CH4 W;  5C0X H;  1B9M A;  5IYD H;  5C0X G;  1Y69 U;  1HR0 Q;  4LFA L;  2PMZ B;  5FO8 B;  3I4M H;  4KKT A;  4KLK A;  4OO1 G;  4R4I A;  4HAE A;  5EBD A;  4DV5 L;  1X6O A;  1LAC A;  5TSS A;  4ODG A;  4A3G G;  4A3M H;  1YEZ A;  1UE6 A;  2BOS A;  3VDY A;  1XX8 A;  1TKW B;  1Z7T A;  3T51 B;  3C46 A;  3ND9 A;  3HOU B;  1CA6 A;  1EY7 A;  4NB3 A;  3AFQ A;  1JWM D;  2IJ0 A;  2F0E A;  1G2S A;  1HXY D;  2E8G A;  4LFA Q;  3TEH B;  3N52 A;  3GQB A;  1FNU A;  3KK7 A;  5I2X A;  1KNA A;  3S1R H;  3RLN A;  1L0Y B;  4DR7 Q;  4OIJ A;  4GOP A;  1QVF A;  1CKN B;  2EY6 A;  4LF7 L;  3PCO B;  4A3C G;  4HJ9 A;  3L0O A;  4L63 B;  2B29 A;  4KD4 A;  1H9K A;  3NBI A;  1N33 Q;  2NTS A;  1PH4 A;  1ET6 A;  2TMP A;  3MXN A;  3EN2 A;  1MGS A;  3HP3 A;  4I65 A;  1K73 C;  1TWH B;  2AMC B;  3JAM E;  3EFX D;  5C4X B;  4HIO A;  5C3E B;  3GTK B;  3HZX A;  3CPW A;  3S16 H;  5LL6 S;  1QCB D;  2HCC A;  4M1U B;  4DV4 Q;  3DUZ A;  5AFW A;  3J80 i;  4NP5 A;  3CC4 A;  3SEB A;  3J7A 5;  3O13 A;  3UE0 A;  3S1R B;  4ZLT F;  1F9P A;  3HKS A;  4LNQ A;  1U4P A;  1GOZ A;  2WAC A;  4V19 0;  2QIL A;  2B63 B;  3FKI B;  2Z8L A;  3I70 A;  1V1P B;  2K01 A;  3CCR A;  2EXZ A;  4E6I A;  2F3V A;  3T16 A;  5GAE C;  3A55 A;  2UXD Q;  2C9O A;  3MXP A;  1TQO A;  1VQP A;  4S3S A;  5AJ3 Q;  5CGK A;  1A3V A;  3JAM c;  1O7Z A;  4DR7 L;  3MXU A;  5C3E H;  1FVI A;  1STN A;  1JOK A;  2J4X A;  3LWE A;  1BXT A;  4CDC C;  1N32 L;  1KHI A;  2JA5 H;  1Q3L A;  2DJF C;  1KQS A;  1PTO D;  2NZO A;  1HTP A;  4FF4 A;  4LJZ C;  3GTG B;  5LL6 X;  4F87 A;  5I4D A;  1CQV A;  4A3D G;  2JEA I;  2B2Y A;  1SE3 A;  2JSO A;  1BCP F;  5KNB A;  5E7N A;  2PO4 A;  3R2I A;  1B4O A;  4P72 A;  2Z6K C;  1NSN S;  2V1C C;  4ZUI A;  3M7N A;  2HIV A;  1D2B A;  1PFS A;  4Y7N H;  5J3B A;  2MO0 A;  1Q8I A;  1IBK L;  4BBR G;  4XIG S;  1I94 L;  3E0J A;  3OWE B;  2Z4H A;  1Y1V G;  3ND8 A;  1VQL A;  3PO3 B;  4KN4 C;  5T1G A;  1H9S B;  4LF9 Q;  3F8T A;  3H3V C;  4B3R Q;  4K2L A;  2KEC A;  5CV5 A;  4HJ5 A;  1GO3 E;  3U50 C;  2CWA A;  1U9R A;  3WWV A;  4P73 A;  4DR1 Q;  1VS0 A;  1G29 1;  3J80 E;  3A5Z B;  1V1P A;  2C5C A;  2RHQ B;  2OEO A;  3J81 i;  4JCV E;  4YWL A;  2V4D A;  3ULJ A;  1Q82 C;  1SJH D;  1HNW Q;  4JV5 L;  4K6D A;  2N8N A;  3ERS X;  2JA6 B;  4MN3 A;  4ME3 A;  3H0G G;  3G71 A;  3M85 A;  1FL0 A;  2M2L A;  3RZD H;  4QUC A;  4OWT B;  4KV6 A;  4IUT A;  1KRT A;  4KKU A;  1J8I A;  1ZEQ X;  1SMX A;  2RQX A;  3TP6 A;  3U58 A;  1XTC D;  4B3R L;  3PUV A;  1HZ9 A;  2E2H H;  1XJV A;  1YJN A;  2UUC L;  1L0W A;  4ZKB B;  3FHW A;  2A73 B;  2ASB A;  1VQG A;  3D4W A;  1Q46 A;  3K5O A;  3MC0 B;  3TZU A;  2R7F A;  3A8K E;  1PDQ A;  4OIK A;  5E4W C;  2EVB A;  1BO0 A;  1HFN A;  1CK1 A;  4MIU A;  2YU9 H;  1BBU A;  1LT5 D;  4G7O C;  1SLJ A;  2K5W A;  4DR2 L;  4A3L G;  3Q23 A;  4ME5 A;  3S2H B;  4EQ5 A;  3CRK C;  3P7J A;  2WB1 E;  3X3M A;  4X64 Q;  2A1A A;  1VQJ A;  4IPG A;  4X65 L;  1HNZ L;  3Q24 A;  3DWA A;  2OT2 A;  4DV7 Q;  2O2L D;  2FMC A;  3MEH A;  4EQP A;  1WFQ A;  5M5Y B;  1LO5 D;  3I2Z A;  2R92 H;  4GS3 A;  1C8C A;  2KHJ A;  5J1Z A;  1VQM A;  1STY A;  4IOA A;  3EA6 A;  2Q8T A;  1NE3 A;  1EOV A;  1WVL A;  4OXP A;  1YNJ C;  4ZUJ A;  3TS0 A;  4LFC L;  2PQA A;  3PUX A;  2A69 D;  4F7X A;  3PUY A;  3FEW X;  3OW7 A;  4LFB Q;  1L1O B;  1BCP B;  5M3M H;  3LNN A;  2IX1 A;  4X64 L;  1J5E L;  1H9S A;  2Z0S A;  3F2U A;  4WRD A;  1XMO L;  2R7Z B;  2OTL A;  1G51 A;  4RH6 A;  1JJ2 A;  4FYD A;  4IUP A;  1UEB A;  2IPK D;  3HOW G;  3TDQ A;  4LF6 Q;  1XNQ Q;  1DOL A;  3K81 C;  2DY8 A;  3BDO A;  1C9O A;  4DKA C;  2KVM A;  3HOX H;  4BA2 I;  1EQQ A;  1LTL A;  2CHB D;  4DR5 L;  2LFN A;  2B2U A;  4K0K L;  5KRU A;  3K6O A;  4CBV A;  2BE5 D;  1F9S A;  3CC7 A;  1VQK A;  2R93 H;  4POG A;  4YCV A;  3VA7 A;  1ESF A;  3MXN B;  2E76 C;  3HOZ H;  4IJH A;  2EYH A;  2HUG A;  3NXW A;  3GTQ H;  5D65 A;  5C4J H;  2NZH A;  4Z9C B;  2B2V C;  1IBL L;  3EBE A;  2L0C A;  1W2B A;  1AW7 A;  1PYW D;  4DV7 L;  3EQL C;  2MO1 A;  2N49 A;  4QY7 A;  4UPA A;  1DYQ A;  2KCM A;  3MTS A;  4RWS C;  1RTO A;  1JJC B;  1UWV A;  2OF1 A;  4IUQ A;  1BOS A;  1XYI A;  4OWW B;  1CFM A;  2HQE A;  3L7Z C;  4RGN A;  3CRL C;  4ABN A;  3D3R A;  4YCW A;  2IT1 A;  3F2C A;  1YJW A;  3TP7 A;  4LUO A;  3M3Y H;  1BF4 A;  2HD3 A;  1EEI D;  1SDF A;  3HOX B;  3I4N B;  5IP7 H;  4KI0 A;  4XYO A;  2F0N A;  2KHS A;  4HIM A;  3BZK A;  4NPS A;  4FVM A;  2PNR C;  2OTJ A;  4JK1 C;  2K1B A;  3I4L A;  1IXR A;  4KHV A;  2DY7 A;  2CQO A;  5D3I B;  3PMF A;  1IKM A;  5IGF A;  2I5H A;  5C4J B;  4XQN A;  5C5M A;  1N32 Q;  1E24 A;  4A3F H;  3I7F A;  1QNU A;  5EKK A;  3S1N B;  5EQ0 A;  3CPF A;  3TS2 A;  1STE A;  3OOC A;  2OQK A;  4JI3 Q;  2VQE L;  4N9T A;  5C3X A;  5FLM G;  2J7Z A;  3SK6 A;  3W2D A;  4JI1 Q;  2ZT9 C;  2NVQ H;  1GD7 A;  2Y0S E;  2VB3 X;  3S1Q B;  1HUM A;  1XPU A;  1H95 A;  4B3M L;  4J1M A;  2JA5 G;  1I4P A;  3WDN A;  1Y8P B;  2AKW B;  3GTO B;  2F3W A;  3OHX C;  1STH A;  2E74 C;  3S1M H;  4YWK A;  1EIG A;  2K4K A;  1CM9 A;  4Y52 H;  1K8O A;  3R8B A;  3NBH B;  1E1T A;  1PFM A;  3BVZ A;  5F2D A;  1Y1V B;  3PO3 G;  1Z47 A;  3K57 A;  2K6A A;  1ASZ A;  1TWG B;  2R92 G;  1OO9 B;  1H9M A;  1JQY D;  4BY7 H;  1I6H H;  1EIH A;  2ZJQ A;  2TSS A;  1AP0 A;  5COR A;  3LGJ A;  4DK0 A;  2Q8R E;  3T1H L;  1CT1 D;  2SOB A;  4RKB A;  1EIY B;  1JT8 A;  3ERQ A;  1PZJ D;  2AWN A;  1QNK A;  1X3G A;  3DXJ C;  4QL5 A;  3M4O H;  1V1O A;  2CVR A;  1TT2 A;  1HNX L;  4GLV B;  5JVH 3;  3U4V A;  3S1Q H;  4WJ4 A;  3E6Z X;  1M8A A;  5ELB A;  4U67 3;  4R4Q A;  3BZC A;  2VS1 A;  2A68 D;  2ZJP A;  4XT3 B;  4DFA A;  3CXC A;  1SR3 A;  2K5D A;  1NMG A;  3AU7 A;  2DNE A;  1GKH A;  4FF1 A;  4DPG A;  2H1E A;  1WI5 A;  5EAY A;  4CJ2 C;  4DUZ L;  1CKM A;  2F0J A;  4RAU C;  5LMN Q;  4QMG A;  4TSS A;  2A69 C;  5IP7 G;  3FRP B;  1Q86 C;  1STB A;  3NPP A;  1DOM A;  4A76 A;  2UXD L;  4FDB A;  2PCF B;  4UDU C;  4DA2 A;  1S5D D;  4DV3 L;  1STG A;  3ER0 A;  4PG3 A;  3WOF A;  5KIX A;  3QG1 A;  4JOI C;  1BBX C;  1EY6 A;  4EVO A;  5IGG A;  5IT9 c;  4PQX A;  2CKZ B;  4GKK Q;  4OHJ A;  2B63 G;  1N36 Q;  2GA4 B;  4ZRZ A;  1I4H A;  4DNT B;  1DXM A;  1HZC A;  3AEV A;  3STB D;  1K8A C;  3U9S A;  4C3I B;  4GN5 A;  3S15 H;  1MBY A;  2L55 A;  2RDG A;  3SK4 A;  2AQ1 B;  4RMF A;  4CHT B;  1LTS D;  1PFN A;  3NQT A;  3E0E A;  4GN4 B;  3NSW A;  4LF6 L;  1NUC A;  1YNX A;  1HR0 W;  1S40 A;  1PZI D;  1EZ6 A;  3NEL A;  3UDF A;  3MA2 B;  3MWY W;  1ICW A;  1SFO H;  2E2J H;  2ZXO A;  5JEA H;  1EFI D;  3M4Q A;  1PZK D;  2Z6K A;  1LTB D;  1GUW A;  1S5B D;  4HCE A;  1F9Q A;  2A6H C;  2JQO A;  4A3M G;  4HN7 A;  2JA7 H;  5ELO A;  3KOJ A;  2ES2 A;  4MTN A;  3U4Z A;  1NJI C;  2PZT A;  2BH8 A;  3NWT A;  4RCO A;  1FJG Q;  2F52 A;  1KAB A;  1E2Z A;  4FO2 A;  1EQR A;  2NWG A;  1KAA A;  2CFM A;  5JPM C;  4GNX A;  4XYQ A;  1WCM G;  1SEB D;  1S3O A;  4B3S L;  1N34 L;  4BY1 B;  3Q6S A;  4IFD I;  1PH5 A;  2VUM H;  2Q2H A;  4GNX C;  2QA4 A;  4IFD J;  1QUQ A;  4A3J H;  1E1O A;  1SNC A;  1GUO A;  5LHY 1;  4LF5 Q;  1T5E A;  1PFB A;  2XRQ D;  3MVV A;  1F2L A;  3I73 A;  1V8Q A;  3K7A H;  2F3I A;  4ZYS A;  3JAM L;  2K33 A;  3TP8 A;  2AHO B;  3OWF A;  3HOV G;  3QOL A;  1AFP A;  1G91 A;  1X3Q A;  3K7U C;  2PZW A;  5GQO A;  2RSO A;  5FO9 B;  5M3F H;  3RLF A;  1R9T H;  1B53 A;  3J7A V;  1SNP A;  1X56 A;  3S17 B;  3M9B A;  2SEB D;  2HHH Q;  4BBR H;  2RBM A;  5EJW A;  3A56 A;  3HOW H;  1O78 A;  3CD6 A;  4DR1 L;  1JR0 D;  1H9J A;  1K28 A;  5EPK A;  1WJJ A;  2WB1 B;  4BY1 H;  1OXS C;  4X62 Q;  3PV0 A;  2ZTC A;  4QF4 A;  4ALP A;  2I5M X;  2EY5 A;  5AJ3 L;  1TWF B;  2KQ3 A;  4A75 A;  1JOR A;  3W1G A;  5IGE A;  4HED A;  3STB C;  4BBS H;  1BCP D;  4DAM A;  1HRJ A;  4A3J B;  1HZA A;  2ZM6 Q;  3ULP A;  1MJC A;  3MFY A;  1PRT D;  4OL7 A;  3SXH A;  4IO9 A;  1LTG D;  2XWJ B;  3MAQ A;  2VXW A;  2IL8 A;  3TME A;  1PTO C;  4YWM A;  3KF6 A;  4LAA A;  2Y0S G;  3KBG A;  2EJF C;  2PMZ E;  2N78 A;  1K9M C;  3SHL A;  4C56 C;  2F0Q A;  4DV2 L;  4N8F A;  2KUM A;  3GTM B;  4O2D A;  4JVZ A;  4IUN A;  1IZ6 A;  3CC2 A;  4RGT A;  1JWS D;  2L5T A;  1XTD A;  1X32 A;  1MJE A;  2FMM A;  4KY7 A;  3DEP A;  3SR1 A;  2EZV A;  3D0F A;  3CCM A;  5FLM H;  4APV A;  1XNR Q;  1L1O A;  3CW2 C;  5IYB G;  2A6E D;  2H5X A;  4A93 G;  2VL6 A;  2R92 B;  5C5L A;  1IL2 A;  1B44 D;  3CCE A;  2AUJ D;  4KN7 C;  4OX9 Q;  5EKL A;  1TY2 A;  3CHB D;  5JEA G;  2Q8I B;  3NQI A;  4UAI A;  2HIX A;  3IL8 A;  4LW1 A;  2NN6 G;  1X3E A;  1IL8 A;  4DV2 Q;  2LY7 A;  1WTP A;  3T1Y Q;  3IFT A;  1J5E Q;  1CHQ D;  5CV7 A;  3A5U A;  4H44 C;  4JBJ A;  4XQJ A;  4X62 L;  5EBC A;  1C7Y A;  1GUN A;  1CQF A;  5CV6 A;  4A3E H;  2DJG C;  4P75 A;  4LWC A;  2YTX A;  3VA5 A;  3GTM H;  2OCE A;  1DOK A;  2XGT A;  2D9U A;  1YI2 A;  3S2D H;  4YIJ A;  4X6A H;  1RF2 D;  3DMU A;  3SDZ A;  1LAB A;  1SE8 A;  5GAG C;  4RGO S;  3AQQ A;  4F8M A;  1TR5 A;  1YVC A;  4OX9 L;  2F0K A;  2B2T A;  5CMD A;  1IYV A;  5IYD G;  2BDN A;  1OTC A;  2XNA C;  1CKN A;  2F1M A;  3OTO Q;  2JA8 B;  1N36 L;  3D31 A;  5A35 A;  2N55 A;  4TVA B;  4EQN A;  2E75 C;  4AH6 A;  1I4G A;  3AB9 A;  4BXX H;  3PIO A;  1D1K A;  4DV1 L;  1YHQ A;  1NY4 A;  3H91 A;  1M90 C;  3HOZ G;  1SNQ A;  4BY1 G;  1UE5 A;  2RCF A;  4JOI A;  2NYZ D;  2R93 G;  4YY3 L;  2B2T C;  2A6E C;  2HDL A;  1GJX A;  2MP1 A;  1PRT F;  4DAP A;  1NBW A;  1SYB A;  4BA1 I;  3M3Y B;  4EQO A;  4C3H H;  1EY0 A;  3KF8 A;  4X65 Q;  1HNZ Q;  3CCV A;  1R4Q B;  4NXM L;  1OXU A;  2A6H D;  3K59 A;  4JI6 Q;  3A0J A;  4IUV A;  1X55 A;  2X6G A;  3PO2 H;  1HQR D;  4G57 A;  3C1E A;  2UXC L;  2QDB A;  3NEM A;  1N34 Q;  3GTJ H;  4X3U A;  1E3P A;  4HMJ A;  3BZD B;  5IT9 E;  1NMF A;  4Y7N B;  2CQA A;  1ET9 A;  5JAV A;  1SN8 A;  4DR6 Q;  4CKC A;  5FJ8 H;  4A3F B;  2WFW A;  3L2P A;  4AYB B;  3LWU A;  1XXG A;  5M9O A;  1A6X A;  4CGY B;  1VQ7 A;  5BN4 A;  4B08 A;  2VQF L;  2RA4 A;  4DR3 Q;  2LMC B;  3SGI A;  1E2W A;  3HOV B;  3K0X A;  4CKE A;  1QG7 A;  2DGY A;  3DLL A;  4DF7 A;  1A15 A;  2KBN A;  2R7Z G;  2EYL A;  1B3A A;  1D8L A;  1ENF A;  3DEO A;  2NVQ B;  2JK8 A;  1KD1 C;  4MHE A;  2KJX A;  4U68 A;  3H3V I;  5M5W B;  3OPO A;  4JI5 Q;  2D62 A;  1SYF A;  2UXC Q;  4WFN 3;  4JI7 Q;  1C0A A;  1EYA A;  5IOC A;  3PO2 B;  3K0Y A;  3RNU A;  1X54 A;  1B7Y B;  2ZJR A;  2F0W A;  4JI3 L;  5IGB A;  2EIF A;  4DXF A;  4PNY A;  1Q81 C;  3RMH A;  2GN5 A;  4BXX G;  1Q1E A;  2WB1 G;  5KNC A;  1GXD C;  5DNF A;  3RLO A;  2ICI A;  4PMB A;  1KRS A;  2MPM A;  1OXV A;  2ID0 A;  3CCS A;  4JC0 A;  1HNX Q;  1BKB A;  3GV6 A;  1PH1 A;  1ASY A;  4QB4 A;  4A3I G;  3DWQ A;  1EUJ A;  1AZP A;  4DV5 Q;  4QQB X;  1JWU D;  2SNM A;  5T1I A;  4P74 A;  2RCN A;  2XTI A;  1I50 B;  5CBE E;  4L6T B;  2R7D A;  5JJK A;  3RUZ A;  3NUC A;  3QWN A;  2EJG C;  4XQQ A;  1PTO H;  4RKL A;  4JV5 Q;  3T13 A;  1XPO A;  3TQY A;  3C3L A;  1EU3 A;  4FXG C;  2P5Z X;  1VQC A;  1RCV D;  2B2Y C;  4C3H G;  2CW0 D;  2K03 A;  3I91 A;  1VF7 A;  2PW5 A;  5LMU Q;  2ZXR A;  3ZJY C;  4R9W A;  3TSS A;  2FXQ A;  5IOD A;  2XSC A;  3M4Y A;  4RGM A;  1X65 A;  1BUV T;  1GHK A;  2K50 A;  4GLX A;  2XN9 C;  5HUR A;  3NTI A;  1CHP D;  3PQI A;  3ZYY X;  2MHV A;  3CCQ A;  2K5H A;  1KAW A;  1U4L A;  3KLS A;  5BN3 A;  2RDF A;  1KLU D;  4HTH A;  3K5N A;  1IW7 C;  1AEX A;  5KEE A;  4X66 L;  3I56 A;  4BY7 G;  4A3M B;  2K7V A;  4JI2 L;  1A0I A;  3TZD A;  2A8V A;  2EDG A;  1Q12 A;  2YTY A;  1KNE A;  3KLR A;  2O5J C;  2FHT A;  3GTP H;  4DUY Q;  2KED A;  4MZ9 A;  3AMU A;  4K0K Q;  4I7Z C;  3KF8 B;  4OON A;  2K5V A;  4IQZ A;  4KHP L;  2PI2 E;  1ONL A;  1YIJ A;  1QVG A;  1TWC B;  5D3D A;  4L5T A;  3HOY G;  5J39 A;  2F0L A;  4KJO A;  1YBY A;  3H0G H;  3ONA B;  3VR4 A;  2UXB Q;  4DNI A;  4X66 Q;  4OGQ C;  2JA7 B;  1A3T A;  1TS4 A;  3A54 A;  4RG1 A;  1XWE A;  1Q1B A;  4JI5 L;  1DGS A;  1S5C D;  4C1N K;  2IX3 A;  1J9O A;  3VR5 A;  3QIA A;  4N9P A;  1EWC A;  2YYZ A;  3BVG A;  4DK3 C;  2NVT B;  2CWP A;  1K0R A;  1MKH A;  1RHP A;  1VQE A;  5M3F G;  2H4O A;  2L15 A;  3GTP B;  5H1S E;  4LFC Q;  1KDA A;  1D5X C;  3S16 B;  3VYT A;  1BVS A;  3EIV A;  1DJR D;  4A93 H;  2NVX B;  4PZ6 A;  3F1Z A;  4H7B A;  2E2I B;  2IW3 A;  3S14 H;  1Y1W B;  1UEA B;  2AUK A;  3J80 c;  1EWH A;  2NB0 A;  2UUB Q;  3T53 B;  1VQA A;  3K80 C;  3K7A B;  1EFW A;  5ELN A;  1CA5 A;  3X3N A;  1XNQ L;  1LYL A;  1L0X B;  2B63 H;  1HNW L;  2K52 A;  1LTA D;  3HOU G;  3HKZ G;  1IYU A;  3HOU H;  4KY6 A;  2Z1C A;  4QCL A;  1PHJ A;  4NDX A;  1R9T B;  4GKJ L;  2QCP X;  3OYY A;  1H9R A;  1SMY D;  2WAQ G;  4AYB E;  1ENA A;  4IN3 A;  4DR3 L;  1S5E D;  4FP5 D;  5KGU A;  4ZCK A;  1JB3 A;  3JAM i;  4K2K A;  2DUD A;  3R93 A;  1K8M A;  4JYA Q;  1AE2 A;  1TS2 A;  3GO5 A;  1PYS B;  4C3I G;  1F2Z A;  2YV5 A;  4DUZ Q;  3S14 B;  5IYC G;  2XIW A;  1P8L A;  1JMC A;  2IHE A;  2JA5 B;  4N8X 1;  1W3S A;  2HQL A;  4A3K B;  2LXJ A;  3DHQ A;  4OWX B;  1I5F A;  4XXE A;  1PVO A;  1LT4 D;  1LT6 D;  1TS5 A;  4LK1 C;  2ICE C;  1O7I A;  2GVB A;  1Q90 A;  5DEH A;  4AIM A;  2F0D A;  5CBA E;  1L1O C;  2VQF Q;  3PIO 3;  4DGZ A;  1B50 A;  2PQE A;  1Z6H A;  5KND A;  1IBK Q;  2D5D A;  5IP9 H;  3HOY H;  1TU2 B;  1WYD A;  4OO1 H;  1N8R C;  3IKJ A;  2A19 A;  3FKI G;  2WAQ E;  2MGS A;  1EU4 A;  3FKI H;  1N9W A;  2G9H D;  2BA1 A;  4IOC A;  4TRD A;  1ZKO A;  4CDE C;  1FR3 A;  1EYC A;  4L5S A;  5IE8 A;  1DM0 B;  4YCU A;  2DNC A;  3I90 A;  1YHA A;  1II3 A;  1KL9 A;  2J0T D;  1LTR D;  2QEJ C;  1P16 A;  4ZK9 B;  3HS0 C;  5EGT A;  1DZ1 A;  4IUU A;  1U4R A;  3VR6 A;  5C3E G;  1YJ9 A;  3I3C A;  2K14 A;  4G4K A;  3KBX A;  2RF4 A;  3MHB A;  1JOO A;  3GD7 A;  3NWS A;  3RZD B;  3CME A;  1XMO Q;  2EYM A;  2BA0 A;  1EL0 A;  3NTK A;  1SJE D;  4JI6 L;  2B2U C;  2JN4 A;  3BYT B;  4R4O A;  2LKV A;  3I8Z A;  3HOY B;  4A3B H;  1TWA H;  1NAP A;  1PV4 A;  2EXD A;  3A8I E;  2KA7 A;  3PF5 A;  5EKI A;  1LT3 D;  2F4I A;  3QO2 A;  2UUB L;  1J6Q A;  2QGQ A;  2JA8 H;  1I3Q B;  4IFD H;  4JI2 Q;  1GVP A;  3A7L A;  1PH8 A;  3CAM A;  3OIP A;  3VR2 A;  1Z9F A;  3KJP A;  2K5N A;  4HJ8 A;  3G6E A;  4GOP C;  4ILW A;  1EWI A;  3BU2 A;  1SNM A;  2XWB B;  5C0X J;  3S15 B;  3J81 E;  4G7Z C;  3ULL A;  1VQ9 A;  3W3A A;  4K8I A;  3I4M G;  1VQB A;  2IX0 A;  3UI2 A;  2IWH A;  1WCM H;  1SRO A;  2WII B;  3R3O A;  3NK9 A;  3KDF B;  2B8F A;  5I2Y A;  4ZAI A;  3HG9 A;  1O80 A;  5E3F A;  4DV4 L;  2EYF A;  1BCP C;  1HJP A;  1ESR A;  4JYA L;  1LTT D;  5ELC A;  5CV9 A;  4A3D B;  4C3H B;  5KYL A;  2WP8 J;  1I6V C;  1HCZ A;  5M5Y H;  1HA6 A;  2PI2 A;  3URY A;  4FXD A;  1SBB B;  2HDM A;  4QJF A;  5IWA L;  3T1H Q;  2HCI A;  5JEA J;  3N6R A;  3RN5 A;  1A8V A;  1OXX K;  2WAQ B;  4DAY A;  4NKL A;  3HOX G;  3E3X A;  4GLA C;  2YTV A;  3D4R A;  5C4X G;  3FDT A;  4DAV A;  3AFP A;  3VR3 A;  3KLW A;  5EPJ A;  4OEL B;  4BS9 A;  1RDP D;  4HSV A;  2PYK A;  1K3R A;  1W6K A;  1MIU A;  2UXB L;  4DV6 L;  3KYH C;  4A3G H;  2RKS A;  2L4N A;  2Q2T A;  2F03 A;  1W6J A;  1G6P A;  2JA6 G;  1VQF A;  1WD0 A;  4A3K G;  1JB7 A;  2EYO A;  5DM7 3;  4V0B A;  2F0V A;  4K5X A;  4JI1 L;  5IT9 L;  3VYS A;  2HHH L;  4A3D H;  4MTK A;  4DR5 Q;  2EYP A;  1AE3 A;  5ELD A;  2E5L Q;  2CH4 A;  2LSS A;  4K8J A;  1HPC A;  2FFK B;  5GAD C;  3HGB A;  1PYB A;  1JCK B;  4GN3 B;  5M3F B;  1B9N A;  1Y14 B;  3QOJ A;  3QJY A;  4OO1 I;  4BBR B;  3MXG A;  3HOW B;  2JA8 G;  3D8G A;  1D5M C;  1U4M A;  2KOL A;  1CZG A;  2AWO A;  2UUA Q;  4DR4 L;  1ZYR C;  4A3I B;  2A68 C;  2IHF A;  1E2V A;  4A3G B;  3I4M B;  4R4T A;  1VQO A;  3AYH B;  4JI7 L;  5LMN W;  1X9N A;  2QKI C;  1SYG A;  2Z4I A;  2Q2U A;  1T5X D;  4A3F G;  1YNN C;  2RSN A;  4DK6 C;  1GUG A;  1Y1W G;  2CCZ A;  4KHP Q;  2A5H A;  3OTO L;  5FK9 C;  1O7L A;  5M3M B;  3GTL H;  2KEN A;  1GM5 A;  4PMC A;  3F2B A;  1K8G A;  1FNV A;  4NXM Q;  4KY5 A;  5D14 A;  1GUT A;  2B2V A;  3CF5 A;  5NUC A;  2Z9H A;  3S24 A;  3CCJ A;  2F0T A;  2XRS D;  3OSO A;  3KJO A;  3K5L A;  3HKZ E;  3H15 A;  3S1N H;  4KMU C;  5FLX c;  2N88 A;  3PF4 A;  2R93 B;  4JI8 Q;  3SK8 A;  4RCN A;  4M8A A;  3BYY B;  2WKC A;  1VQ6 A;  1TXY A;  1F77 A;  3E9I A;  4B9X A;  4DU9 A;  4IFD G;  3DWP A;  3P1H A;  4LF5 L;  3HOZ B;  2NVY B;  4DAY B;  4L8J A;  4H0L C;  5C4H A;  4FXK C;  4JI0 Q;  3QR8 A;  2KCT A;  1B2T A;  1HZB A;  4CKB A;  2F0O A;  1IBL Q;  5FLX E;  2AQ3 B;  3CQZ H;  1CTM A;  4JBM A;  5HY6 A;  3MEF A;  4XDX A;  1I94 Q;  4DR2 Q;  4LF7 Q;  3UDI A;  3H6M A;  1HR0 L;  4DR4 Q;  4UHV A;  3HRZ C;  3DM3 A;  1PRT B;  3S1M B;  1QZG A;  1NNX A;  4J8Q A;  5FKA C;  1C4Q A;  3HFZ B;  2F0U A;  1CZW A;  1M1K C;  1L2F A;  3UDX A;  5I9O A;  2QW7 A;  3HKZ B;  3I4N H;  2ZXP A;  5A2Q E;  1S5F D;  2B8G A;  4DV1 Q;  4X3S A;  3FPP A;  3NE5 B;  4JI8 L;  1VDZ A;  1I6H B;  4BY7 B;  3OMC A;  3H0G B;  4J15 A;  1RL2 A;  1LLR D;  3VYR A;  3E9H A;  4KHZ A;  3UE1 A;  2PQA B;  2F0G A;  5EPL A;  1JOQ A;  1FD7 D;  2VB2 X;  4HR7 B;  2NVY H;  4YY3 Q;  2AQ2 B;  1EOT A;  5CR3 A;  3M4O B;  2JA9 A;  3PIP 3;  1VQ4 A;  2K05 A;  1OXT A;  2B3G A;  3CQZ B;  1VF5 C;  3PO2 G;  3L3O C;  4IUR A;  1G2T A;  4NW2 A;  1JJG A;  1UAP A;  1B1Z A;  4HJA A;  3RN2 A;  4A93 B;  1FYC A;  1DON A;  1I4X A;  2I0Q A;  1K83 B;  1UUP A;  1ZXT A;  4XTC S;  4UP8 A;  3GDE A;  3CU7 A;  4IPD A;  4R1J A;  4CJ1 B;  2JA7 G;  3P20 A;  3A74 A;  4BWG B;  1CSP A;  5GRO A;  1N33 L;  1S4Z A;  1D5Z C;  4J6H A;  2BE5 C;  1BR9 A;  3V2T A;  1ILP A;  3GTO H;  4B3T L;  2HT1 A;  4C2M H;  2F4V L;  1IKL A;  1RKN A;  2N3S A;  3A7A B;  1VQ5 A;  1Y8O B;  3PGZ A;  3OW2 A;  2EY1 A;  1EY8 A;  2BCO A;  2WV6 D;  4H02 A;  1WTH A;  3KLS X;  3GTJ B;  1STA A;  1VQI A;  4K5W A;  2F0I A;  1HQM C;  1KIX A;  1QJO A;  4C3I H;  1TWG H;  1U0L A;  3J80 L;  3NEN A;  5A2Q L;  4HSP A;  1DCZ A;  1Q7Y C;  3SK5 A;  2VQE Q;  3J7Y W;  4G7H C;  4A3J G;  2QDL A;  3KF6 B;  2F0F A;  1MI2 A;  3S9W A;  4XT1 B;  2EOT A;  1XMQ L;  4B3S Q;  3F2D A;  4WJ3 M;  4JG2 A;  2K75 A;  4LF8 Q;  1K83 H;  3SE0 A;  3WOE A;  1BBW A;  1SFO B;  2E2J B;  3K8A A;  2VUM G;  4GKJ Q;  4FF2 A;  3L9A X;  4O0A A;  4NMZ A;  3CKI B;  2L12 A;  2G5D A;  5M5X H;  1G6Z A;  4JI4 Q;  4A3K H;  4A3E G;  3ERO A;  1PRT C;  2M00 A;  4RHR A;  1PMR A;  1FNW A;  4C2M B;  1QWY A;  1VQN A;  3E5S A;  1FGU A;  4DV6 Q;  4GNX B;  1WOC A;  2L11 A;  3I55 A;  2X69 A;  2SNS A;  4PZ8 A;  2PPB C;  1CSQ A;  4IJL A;  4DK1 A;  5I6Y A;  1E22 A;  1KLG D;  1FJG L;  3V96 A;  5C6A A;  1QZH A;  4K5V A;  4H13 C;  1YNN D;  1WTR A;  1EQT A;  2KCN A;  4QIW E;  4ID6 A;  3K58 A;  4DV0 L;  4LF4 Q;  3RR5 A;  2F0P A;  1ICF B;  4CJ0 B;  2C35 B;  4JBW A;  2ENB A;  3GP7 A;  5K36 G;  1BNZ A;  1I4Q A;  2GVA A;  4X3K A;  3C2P A;  1EEF D;  3NP8 A;  4CDD C;  5DAU A;  1VQD A;  4QUF A;  1IHZ A;  1BQQ T;  3FVQ A;  4FF3 A;  1TII D;  2NN6 I;  4LFB L;  1PH9 A;  4Q5V A;  2I46 A;  2FIN B;  1JC7 A;  1K3B C;  1MSG A;  1X3P A;  4P71 A;  4HID A;  1VMP A;  5JPN C;  2ZTD A;  1AZQ A;  3KUP A;  3NTH A;  1UE1 A;  3IAY A;  2YU9 B;  1VCI A;  2UUA L;  1MD2 D;  3CCL A;  3I4O A;  2NUC A;  2OWO A;  1SE4 A;  3CCU A;  1ML0 D;  1QB5 D;  4IZ8 A;  3S2H H;  2D0P A;  1HA5 A;  5GAH C;  3PIP A;  1WTW A;  5CV4 A;  2F0M A;  4LF8 L;  4LF9 L;  3BG3 A;  4L5Q A;  2B2W A;  1AH9 A;  2K32 A;  4K6L A;  1TWA B;  1B8A A;  3QB3 A;  5E1F A;  2LS0 1;  1JIC A;  1LUZ A;  1U5K A;  3G48 A;  3Q8D A;  4GKK L;  2LXK A;  3CMA A;  1TWF H;  1EY4 A;  4C3J H;  3BDC A;  1I3Q H;  1SNO A;  2QF7 A;  4BBS B;  1A2U A;  1SXT A;  3OMG A;  4A3B G;  2F4V Q;  5JVG 3;  4ULL A;  4RHS A;  1TS3 A;  1QIL A;  1TWH H;  5CC4 A;  1RD9 D;  5C4X H;  2L9H A;  5C44 G;  3G4S A;  4LUV A;  3GTK H;  4YHH L;  1E0B A;  2VUM B;  5IY0 A;  2R7Z H;  1SRU A;  3T4A C;  1HUN A;  1S72 A;  3J7Z C;  3RD4 A;  1VMC A;  4TKO B;  1PTO F;  5J22 A;  3MZ5 A;  5ELF A;  4LUZ A;  2BDO A;  2EJM A;  3J81 j;  2D0O A;  2RDH A;  2KEE A;  2JXM B;  2O5I C;  4DNR B;  5BR8 Q;  5CYU A;  2RVL A;  4R8N A;  2XVS A;  1Y8N B;  2L1B A;  4C3J B;  4QIW B;  1EQV A;  1X3F A;  3OIQ A;  5HGQ A;  4I7A A;  2ALY B;  1MSH A;  4X3T A;  1E7Z A;  1EY5 A;  2JP1 A;  3H09 A;  5G3L F;  1ZYR D;  1EYG A;  3T1Y L;  3M7G A;  3SVM A;  4UY8 C;  1Q8K A;  2JE6 I;  3TBI B;  3H94 A;  1GHJ A;  4POF A;  1EZ8 A;  4A3E B;  1A3U A;  4HJ7 A;  4AYB G;  1RTN A;  2NVX H;  1RJT A;  1WTO A;  1KDB A;  2Y0S B;  4LF4 L;  2E2I H;  1WD1 A;  4KTA A;  1YNJ D;  4ZQ3 A;  1Y1W H;  4NXN Q;  5K36 H;  3BVM A;  3T56 B;  1VQ8 A;  1WTQ A;  1F2M A;  3PUW A;  1EIF A;  5FLX L;  1PH7 A;  2OQ0 A;  4PMW A;  3GTG H;  3IFD A;  1O7Y A;  2O4X A;  3MFG A;  4EX5 A;  1CKO A;  5FOB B;  3I72 A;  3IRB A;  2EY2 A;  1D1I A;  2JYO A;  1GUS A;  3NBH A;  4A4I A;  2OXP A;  1F2Y A;  1R4P B;  3W5O A;  5C44 B;  1QUQ B;  4JI0 L;  2EE1 A;  3ITP A;  3DM1 A;  5JJL A;  1VQH A;  4DUY L;  3TRE A;  3PO3 H;  4QGU A;  4A3I H;  4HIK A;  2E5L L;  2Z6B A;  4AQY Q;  2DN8 A;  3B6Y A;  4EGV A;  2UU9 Q;  5FJ8 G;  3VYU A;  1CUK A;  1DD2 A; 
#chains in the Genus database with same CATH homology
 5IYD G;  4EQ5 A;  4JI4 L;  1OTC A;  3KLW A;  4BBS G;  2R6G A;  1CKN A;  3OTO Q;  2WB1 E;  1N36 L;  3D31 A;  4TVA B;  4X64 Q;  1K3R A;  2A1A A;  2IY5 B;  1VQJ A;  1XPR A;  4IPG A;  4AH6 A;  4X65 L;  1MIU A;  1HNZ L;  1JE5 A;  3W1B A;  5IP9 G;  3KYH C;  4IPC A;  4DV6 L;  4A3G H;  2UXB L;  4DV7 Q;  2JJQ A;  2Q2T A;  2JA6 H;  3PIO A;  4BXX H;  4TQU S;  1G6P A;  4DV1 L;  2JA6 G;  1YHQ A;  1B70 B;  1NTG A;  1VQF A;  1WFQ A;  1NY4 A;  4A3K G;  1JB7 A;  3I2Z A;  2R92 H;  4GS3 A;  1M90 C;  3HOZ G;  2HHH L;  4BY1 G;  4JI1 L;  2VW9 A;  2KHJ A;  1UE5 A;  4A3D H;  1IBM L;  1VQM A;  1Y1V H;  2Q2I A;  4DR5 Q;  4IOA A;  4JOI A;  1AE3 A;  2R93 G;  2E5L Q;  4YY3 L;  2LSS A;  5C44 H;  1NE3 A;  4L5R C;  2ZTE A;  1EOV A;  4OXP A;  5IYB H;  5GAD C;  3TS0 A;  4LFC L;  2PQA A;  1PYB A;  3H3V H;  3PUX A;  4GN3 B;  1NBW A;  3PUY A;  4MNO A;  4BA1 I;  1QVC A;  4LFB Q;  1L1O B;  1Y14 B;  4C3H H;  3KFU A;  5M3M H;  2IX1 A;  4OO1 I;  2KHI A;  5BR8 L;  3HOV H;  4X64 L;  4PZ7 A;  4X65 Q;  1HNZ Q;  2JA8 G;  1J5E L;  3CCV A;  1PH3 A;  2Z0S A;  1XMO L;  5C0X I;  2OTL A;  1OXU A;  4NXM L;  1G51 A;  1JJ2 A;  2AWO A;  4JI6 Q;  3A0J A;  2UUA Q;  1UEB A;  1X55 A;  3HOW G;  3KDF A;  3PO2 H;  4DR4 L;  5DLQ E;  4LF6 Q;  2IHF A;  1PA6 A;  2PNH A;  1KC8 C;  1XNQ Q;  2VNU D;  3K81 C;  4R4T A;  2UXC L;  1C9O A;  3PUZ A;  4DKA C;  3NEM A;  3HOX H;  3AYH B;  1VQO A;  3GTJ H;  1N34 Q;  1E3P A;  4JI7 L;  4BA2 I;  1NMF A;  5LMN W;  1X9N A;  1EQQ A;  1LTL A;  2VZA A;  4DR5 L;  4AQY L;  2UU9 L;  2Q2U A;  1SN8 A;  4K0K L;  4A3F G;  4DR6 Q;  1VQK A;  5FJ8 H;  3CC7 A;  2I5L X;  2WFW A;  3L2P A;  2R93 H;  4POG A;  3JC6 6;  4YCV A;  4DK6 C;  1VQ7 A;  3MXN B;  1Y1W G;  2CCZ A;  4KHP Q;  3HOZ H;  4IJH A;  1RIP A;  3OTO L;  2VQF L;  4OX9 L;  3GTQ H;  4DR3 Q;  4A3C H;  3SGI A;  5C4J H;  3GTL H;  2NZH A;  1IBL L;  2KEN A;  3K0X A;  3EBE A;  1W2B A;  1GM5 A;  2DGY A;  3F2B A;  3DLL A;  1K8G A;  3I4N G;  4DV7 L;  2KBN A;  4B3M Q;  2R7Z G;  4OO1 G;  1YZ6 A;  1D8L A;  2MO1 A;  2N49 A;  4QY7 A;  4NXM Q;  4UPA A;  2JK8 A;  2KCM A;  1A62 A;  1KD1 C;  3ICE A;  1JJC B;  1UWV A;  3H3V I;  3CF5 A;  4JI5 Q;  2D62 A;  3S24 A;  1XMQ Q;  4OWW B;  5LMN L;  2UXC Q;  2EQS A;  3CCJ A;  3M4P A;  3L7Z C;  3PSI A;  4JI7 Q;  5IYC H;  2MQH A;  1C0A A;  4A3L H;  3KJO A;  3HKZ E;  4YCW A;  1X54 A;  2IT1 A;  1B7Y B;  3H15 A;  3F2C A;  2ZJR A;  3RNU A;  1YJW A;  5FLX c;  3M3Y H;  4LUO A;  3S1N H;  1PH2 A;  2UUC Q;  3PF4 A;  5JJI A;  4DR6 L;  4JI3 L;  4JI8 Q;  2EIF A;  1I50 H;  5IP7 H;  4DV3 Q;  1Q81 C;  1VQ6 A;  1TXY A;  3E9I A;  4KI0 A;  2MFI A;  2GN5 A;  1UE7 A;  4IFD G;  4LF5 L;  4BXX G;  4DAY B;  1Q1E A;  2WB1 G;  2RHS B;  4IPH A;  5IWA Q;  3J81 c;  4HIM A;  2KCT A;  3BZK A;  1HH2 P;  3RLO A;  4JI0 Q;  4NPS A;  1HZB A;  2OTJ A;  1KRS A;  1IXR A;  1IBL Q;  2CQO A;  1OXV A;  3CQZ H;  2ZM6 L;  5LMU L;  5HY6 A;  3MEF A;  4JBM A;  2ID0 A;  3CCS A;  4DR2 Q;  1I94 Q;  2I5H A;  3UDI A;  1V1Q A;  4JC0 A;  1PH6 A;  4LF7 Q;  1HNX Q;  1HR0 L;  4DR4 Q;  1BKB A;  4UP7 A;  1N32 Q;  3DM3 A;  5M5W H;  1PH1 A;  1E24 A;  2BH2 A;  1QZG A;  4A3F H;  3I7F A;  4A3I G;  1ASY A;  1KXL A;  1EUJ A;  3UDG A;  2VY3 A;  3HFZ B;  4DV5 Q;  4QQB X;  1V43 A;  4DV0 Q;  1T9H A;  4YHH Q;  1L2F A;  4UP9 A;  1M1K C;  3UDX A;  1YIT A;  3CPF A;  4P74 A;  2RCN A;  3I4N H;  3TS2 A;  1YHB A;  2XTI A;  4DV1 Q;  2OQK A;  4JBK A;  4JI3 Q;  4JI8 L;  2VQE L;  3RZO H;  2R7D A;  5JJK A;  1A63 A;  5FLM G;  4J15 A;  1RL2 A;  2MNA A;  3E9H A;  4KHZ A;  4JV5 Q;  1IYJ B;  4JI1 Q;  3UE1 A;  2QEX A;  2NVQ H;  1GD7 A;  2PQA B;  2Y0S E;  3CP0 A;  1IBM Q;  3TRZ A;  1XPO A;  3TQY A;  1LM0 A;  1VQC A;  1XPU A;  1H95 A;  4B3M L;  2ATW A;  2NVY H;  4YY3 Q;  2JA5 G;  5LMU Q;  4B3T Q;  3ZJY C;  2AKW B;  2FXQ A;  2JA9 A;  1VQ4 A;  4R4C A;  1OXT A;  1X65 A;  3S1M H;  1V9P A;  2K50 A;  2B3G A;  4GLX A;  4YWK A;  1TWC H;  4GOP B;  3PO2 G;  2K4K A;  3BJU A;  4Y52 H;  2JEB I;  3NBH B;  1E1T A;  3CCQ A;  2K5H A;  1KAW A;  3PO3 G;  1Z47 A;  1JJG A;  1ASZ A;  2R92 G;  4HJA A;  4X66 L;  3I56 A;  3RN2 A;  4BY7 G;  2I0Q A;  4BY7 H;  1I6H H;  2ZJQ A;  4JI2 L;  1A0I A;  1D7Q A;  4XTC S;  4UP8 A;  2A8V A;  1Q12 A;  3LGJ A;  3GDE A;  4IPD A;  2YTY A;  4R1J A;  2JA7 G;  3A74 A;  3T1H L;  1XNR L;  3S17 H;  1CSP A;  5GRO A;  5M3M G;  3GTP H;  1N33 L;  1EIY B;  1JT8 A;  3FP9 A;  4NXN L;  4DUY Q;  2AWN A;  4MZ9 A;  2NVT H;  4K0K Q;  1X3G A;  3KF8 B;  4QL5 A;  3GTO H;  3M4O H;  5IYD H;  4B3T L;  2HT1 A;  5C0X G;  4OON A;  4C2M H;  2K5V A;  1HNX L;  1HR0 Q;  4LFA L;  4GLV B;  2F4V L;  3U4V A;  3S1Q H;  4KHP L;  2PI2 E;  4WJ4 A;  2N3S A;  1YIJ A;  1VQ5 A;  4KLK A;  1QVG A;  3I4M H;  3PGZ A;  4R4Q A;  3OW2 A;  3BZC A;  4L5T A;  3HOY G;  4R4I A;  4H02 A;  2VS1 A;  1VQI A;  2ZJP A;  4DV5 L;  1X6O A;  3CXC A;  1YBY A;  1SR3 A;  3H0G H;  1NMG A;  4C3I H;  1KIX A;  1TWG H;  1U0L A;  1GKH A;  4DNI A;  4A3G G;  3NEN A;  2UXB Q;  4A3M H;  4DPG A;  1YEZ A;  4X66 Q;  1Q7Y C;  2VQE Q;  1UE6 A;  1WI5 A;  4A3J G;  3KF6 B;  5EAY A;  4DUZ L;  3VDY A;  4RG1 A;  1CKM A;  1Q1B A;  4JI5 L;  1XMQ L;  1DGS A;  5LMN Q;  4B3S Q;  3F2D A;  2YYZ A;  4WJ3 M;  5IP7 G;  4JG2 A;  2K75 A;  4LF8 Q;  1K83 H;  4DK3 C;  1Q86 C;  1BBW A;  2CWP A;  1K0R A;  1MKH A;  4A76 A;  4NB3 A;  1VQE A;  3AFQ A;  3K8A A;  5M3F G;  4FDB A;  2VUM G;  4GKJ Q;  2UXD L;  2L15 A;  4DV3 L;  4O0A A;  3ER0 A;  4PG3 A;  2E8G A;  4LFA Q;  4JOI C;  5H1S E;  4LFC Q;  5M5X H;  3TEH B;  4JI4 Q;  5IT9 c;  1BVS A;  4A3K H;  3EIV A;  2CKZ B;  4A3E G;  4A93 H;  4GKK Q;  2B63 G;  4PZ6 A;  1N36 Q;  3S1R H;  3F1Z A;  3RLN A;  1HZC A;  1VQN A;  3AEV A;  4DR7 Q;  1FGU A;  3STB D;  4DV6 Q;  4GNX B;  1K8A C;  4GN5 A;  1WOC A;  3S14 H;  4LF4 L;  3J80 c;  4GOP A;  1QVF A;  3I55 A;  3S15 H;  1CKN B;  2UUB Q;  4PZ8 A;  1CSQ A;  4IJL A;  4RMF A;  4LF7 L;  3PCO B;  1E22 A;  1VQA A;  3K80 C;  1FJG L;  1EFW A;  4A3C G;  4HJ9 A;  3E0E A;  5ELN A;  3L0O A;  4GN4 B;  1QZH A;  2B29 A;  4LF6 L;  1XNQ L;  1YNX A;  1HR0 W;  1LYL A;  2B63 H;  1HNW L;  1S40 A;  2K52 A;  3HOU G;  4QIW E;  1N33 Q;  3HKZ G;  4DV0 L;  4LF4 Q;  3NEL A;  3RR5 A;  3UDF A;  3HOU H;  1PH4 A;  2C35 B;  4JBW A;  3EN2 A;  1SFO H;  2E2J H;  5K36 G;  1PHJ A;  2GVA A;  1K73 C;  2AMC B;  4GKJ L;  3M4Q A;  3OYY A;  2Z6K A;  1VQD A;  4HIO A;  3CPW A;  2NN6 I;  3S16 H;  4LFB L;  1PH9 A;  2JQO A;  2WAQ G;  4A3M G;  4AYB E;  4DV4 Q;  5ELO A;  3KOJ A;  4DR3 L;  2ES2 A;  2JA7 H;  4P71 A;  3JAM i;  3J80 i;  4HID A;  4MTN A;  2DUD A;  3U4Z A;  1NJI C;  3CC4 A;  3J7A 5;  2ZTD A;  3UE0 A;  1UE1 A;  1VCI A;  4JYA Q;  2UUA L;  1AE2 A;  2BH8 A;  3GO5 A;  3I4O A;  1PYS B;  2F52 A;  2YV5 A;  4DUZ Q;  3HKS A;  3CCL A;  4LNQ A;  2OWO A;  1EQR A;  1FJG Q;  3CCU A;  3S2H H;  2CFM A;  5IYC G;  4GNX A;  1WCM G;  1P8L A;  1S3O A;  2D0P A;  5GAH C;  2IHE A;  1N34 L;  1JMC A;  4B3S L;  3PIP A;  4LF9 L;  4LF8 L;  1W3S A;  4L5Q A;  3CCR A;  4IFD I;  5GAE C;  2HQL A;  1PH5 A;  2UXD Q;  1AH9 A;  2LXJ A;  2VUM H;  2Q2H A;  4GNX C;  2QA4 A;  4OWX B;  1I5F A;  4IFD J;  1QUQ A;  1PVO A;  1B8A A;  1VQP A;  4A3J H;  1O7I A;  1E1O A;  2GVB A;  1LUZ A;  1U5K A;  3G48 A;  3Q8D A;  4AIM A;  5AJ3 Q;  1L1O C;  2LXK A;  3CMA A;  4LF5 Q;  4GKK L;  2VQF Q;  1TWF H;  4C3J H;  3K7A H;  2F3I A;  1I3Q H;  3JAM c;  4DR7 L;  5C3E H;  1IBK Q;  1FVI A;  2AHO B;  5IP9 H;  3HOV G;  3HOY H;  1WYD A;  1N8R C;  4A3B G;  2F4V Q;  3K7U C;  2A19 A;  5GQO A;  3FKI G;  2WAQ E;  1XNR Q;  5M3F H;  1N32 L;  1KHI A;  3RLF A;  1R9T H;  3FKI H;  1N9W A;  1TWH H;  2JA5 H;  1X56 A;  1KQS A;  3M9B A;  2BA1 A;  2NZO A;  4IOC A;  5C4X H;  2HHH Q;  5C44 G;  4BBR H;  3G4S A;  4LUV A;  3GTK H;  3HOW H;  3CD6 A;  4YHH L;  4DR1 L;  5IE8 A;  4L5S A;  4YCU A;  5IY0 A;  1WJJ A;  1SRU A;  4BY1 H;  2R7Z H;  2JEA I;  4A3D G;  1OXS C;  1YHA A;  4X62 Q;  1KL9 A;  5E7N A;  3J7Z C;  1S72 A;  1P16 A;  2ZTC A;  3PV0 A;  4P72 A;  4ALP A;  2I5M X;  2Z6K C;  5AJ3 L;  2V1C C;  5C3E G;  4LUZ A;  4A75 A;  3M7N A;  2HIV A;  3J81 j;  1YJ9 A;  2D0O A;  2K14 A;  3W1G A;  1PFS A;  2RF4 A;  3STB C;  4BBS H;  4DAM A;  4Y7N H;  5J3B A;  5BR8 Q;  2MO0 A;  1HZA A;  2ZM6 Q;  3GD7 A;  3ULP A;  1IBK L;  1MJC A;  3CME A;  4BBR G;  4XIG S;  1XMO Q;  1I94 L;  4IO9 A;  2BA0 A;  4JI6 L;  1X3F A;  5HGQ A;  1Y1V G;  1VQL A;  2ALY B;  4R4O A;  4YWM A;  2Y0S G;  3KF6 A;  1E7Z A;  4A3B H;  1TWA H;  2PMZ E;  1K9M C;  2N78 A;  3F8T A;  1PV4 A;  4LF9 Q;  2EXD A;  4B3R Q;  4HJ5 A;  1EYG A;  3PF5 A;  1GO3 E;  3U50 C;  2CWA A;  4DV2 L;  3WWV A;  3T1Y L;  2UUB L;  4P73 A;  4DR1 Q;  1J6Q A;  1G29 1;  1VS0 A;  4O2D A;  2QGQ A;  3A5Z B;  4UY8 C;  2JA8 H;  1IZ6 A;  1Q8K A;  3CC2 A;  2RHQ B;  3J81 i;  2JE6 I;  4JCV E;  4JI2 Q;  1GVP A;  4YWL A;  1PH8 A;  1XTD A;  3CAM A;  3ULJ A;  4POF A;  1MJE A;  1Q82 C;  4HJ7 A;  4AYB G;  1Z9F A;  3KJP A;  2NVX H;  4JV5 L;  1HNW Q;  2N8N A;  2K5N A;  3ERS X;  3D0F A;  3CCM A;  4ME3 A;  5FLM H;  4APV A;  3G6E A;  4HJ8 A;  4GOP C;  1L1O A;  3CW2 C;  3H0G G;  3G71 A;  2E2I H;  1EWI A;  3BU2 A;  1FL0 A;  3M85 A;  1Y1W H;  5IYB G;  4NXN Q;  5C0X J;  2H5X A;  3RZD H;  4A93 G;  2VL6 A;  4OWT B;  3ULL A;  1VQ8 A;  1VQ9 A;  1IL2 A;  3PUW A;  3I4M G;  3CCE A;  1EIF A;  1VQB A;  2IX0 A;  1KRT A;  1PH7 A;  2OQ0 A;  1WCM H;  1SRO A;  4PMW A;  4OX9 Q;  3GTG H;  1SMX A;  5JEA G;  3KDF B;  3U58 A;  2HIX A;  4DV4 L;  4EX5 A;  1CKO A;  4LW1 A;  4B3R L;  2NN6 G;  1X3E A;  3IRB A;  4DV2 Q;  3PUV A;  3T1Y Q;  1HZ9 A;  1J5E Q;  2E2H H;  1HJP A;  1XJV A;  3A5U A;  4JYA L;  1YJN A;  4JBJ A;  2UUC L;  1L0W A;  3FHW A;  4X62 L;  1C7Y A;  4A4I A;  2WP8 J;  1VQG A;  2ASB A;  1Q46 A;  5M5Y H;  2PI2 A;  4P75 A;  4A3E H;  4LWC A;  2YTX A;  3GTM H;  2R7F A;  3W5O A;  1QUQ B;  2OCE A;  5IWA L;  2XGT A;  4QJF A;  3T1H Q;  4JI0 L;  1YI2 A;  1VQH A;  3S2D H;  4DUY L;  5JJL A;  5JEA J;  3TRE A;  3RN5 A;  3PO3 H;  4X6A H;  1A8V A;  1OXX K;  4QGU A;  4A3I H;  4HIK A;  2E5L L;  4AQY Q;  2UU9 Q;  1SE8 A;  3B6Y A;  5GAG C;  3HOX G;  2YU9 H;  1BBU A;  3AQQ A;  5FJ8 G;  1SLJ A;  4GLA C;  2YTV A;  5C4X G;  4DR2 L;  1CUK A;  4A3L G;  1YVC A;  3AFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...