5LMUQ

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5lmuQ00
4JOIC 1OXTA 4BBSH 4OONA 4OWTB 4IOCA 3T1HQ 3BZKA 4DV5Q 4YWLA 2BH8A 3LGJA 5FJ8H 3W1BA 2CCZA 5GAHC 1FGUA 3KF6B 2K5NA 1E1TA 4DK3C 3NELA 4B3ML 1PH2A 1W2BA 1XNQL 2UXCL 3F2BA 1JB7A 2K5VA 4LF9Q 3M4QA 3CCSA 2K50A 3TQYA 1VQKA 1U5KA 2JA7G 4APVA 2Q2IA 4A75A 3GTJH 1YJ9A 1B8AA 3MXNB 4WJ3M 1E22A 2YTXA 1I94L 2E2HH 2YU9H 2K75A 3FP9A 4DV3L 1P16A 2ALYB 3S1NH 4GKKL 2KCMA 1PH7A 1FL0A 2Z6KC 2VL6A 3I55A 2R6GA 4GKJQ 1K8AC 2ZTEA 5HY6A 2UUAQ 4YY3L 3M9BA 4JCVE 1UWVA 1CSQA 3RZDH 4LF5Q 1CKNA 1TWGH 4B3RQ 1VQBA 4A3CG 4A3FG 1HNXQ 1JE5A 3PIPA 3HOWG 2PQAB 4L5QA 1VQ8A 4BA1I 4DR3Q 4HIOA 1H95A 1XNRL 3RN5A 1SROA 4R1JA 1EQQA 3CPFA 1GM5A 4JI0L 3HOUH 4TQUS 4A3LH 4C3JH 4A3MH 1XMQL 4A3IG 1HZCA 1YIJA 4J15A 2F52A 1ASZA 3FHWA 1VQDA 1XMOQ 1OXXK 3HOXG 5M3MH 1IBLL 4IPHA 2ZJPA 4QQBX 2AWNA 3HOYG 1HZBA 2QGQA 1BBUA 3GO5A 3H0GG 5ELOA 3A0JA 4DAMA 3CXCA 1PFSA 3UDXA 4DR1L 1RL2A 4GN5A 4JI8Q 2UUCL 5IE8A 3OW2A 4A93H 1CKMA 3I4NG 1N33L 3H3VI 1IZ6A 2WB1E 4LUVA 3SGIA 4JBKA 2A1AA 2EIFA 4DKAC 4OO1G 3CMEA 2I5HA 4LF4L 4BY7H 2K14A 2ZJRA 2QA4A 3CAMA 5EAYA 1V9PA 3RR5A 1Q12A 4X62L 3ULPA 3OTOQ 3J80i 5C4JH 2XTIA 1PYBA 2OWOA 5FLMG 1D8LA 1WCMH 1HR0W 1DGSA 3A5ZB 1FJGL 2KCTA 1N32Q 1LUZA 1YHAA 2H5XA 4DV0L 2OQKA 1RIPA 3CCUA 1HZAA 4GLXA 2NN6I 1PH8A 1KQSA 1YZ6A 2K4KA 3S16H 4R4QA 4BBRH 1M1KC 2PI2E 3A74A 4A3BG 2E2IH 4O0AA 1HNZQ 4JYAL 2XGTA 4JV5Q 3PV0A 4DAYB 3KF6A 1EIYB 1PYSB 3L2PA 2MO1A 2OTLA 4GOPB 4YHHQ 4K0KQ 2JA9A 1YBYA 5IYCH 3KOJA 1A0IA 2R93G 1VQ4A 4L5TA 4GLVB 3PO3G 2VQEL 1SN8A 1IL2A 2JEBI 5LMNQ 1HR0L 2R7DA 2NN6G 4RG1A 4DV7Q 3CW2C 3BU2A 4JI2Q 5GADC 1YJNA 4R4IA 2JEAI 2KBNA 4MTNA 4POGA 1X3FA 3S17H 1MKHA 3L0OA 2L15A 4C2MH 1J6QA 4JI3L 1I50H 2GVBA 5C4XH 5C44H 1KAWA 1Q8KA 4AYBG 4JI4L 4LF8L 2E5LQ 2PQAA 4YCVA 4YWKA 2YV5A 2UU9L 1IYJB 3OYYA 4A76A 1GO3E 1BKBA 1C9OA 1XJVA 1D7QA 3HKSA 4IPDA 1KRSA 3UE1A 2JA7H 1J5EL 5JJLA 1TWFH 3STBC 1K73C 4BXXG 5IP7G 1VQIA 2KHJA 4FDBA 1WI5A 3J80c 1JMCA 2ES2A 4LF6L 3GTGH 4LFBQ 3Q8DA 1N34Q 3FKIG 1WJJA 4P71A 2GN5A 5GAEC 4A3EG 1VQEA 1EQRA 5BR8L 2ZM6Q 4A3FH 4DR6Q 5M5WH 4DNIA 3HOWH 5GAGC 5M3FG 1X54A 3CCLA 4JI6L 4A3GG 2DGYA 4GN4B 3DLLA 4AH6A 2JQOA 2JA5G 2MO0A 4DR5L 3CF5A 3DM3A 3K81C 5M5XH 2R7FA 4HJ5A 4PG3A 3TEHB 2IY5B 3M7NA 1I5FA 3JAMi 4DUYQ 1PA6A 1KIXA 1S40A 3K0XA 4JG2A 3GTOH 2MNAA 4DR4Q 1VS0A 5IY0A 4IFDJ 3GTKH 2MQHA 5JEAJ 1YVCA 1NJIC 4X66Q 5C0XI 3HOYH 3H0GH 4IOAA 1YJWA 1NMFA 3F8TA 1N36L 2UXBQ 3BJUA 4DV4Q 4NXMQ 2D62A 3I4NH 1L1OB 1JJ2A 3S15H 2B3GA 3J81i 4LUZA 2D0PA 1E1OA 3CC4A 1VQ6A 4ALPA 3CC2A 2VS1A 2PI2A 4GOPA 4X64L 3PUVA 2I5LX 2AWOA 1E24A 3AFQA 1VQCA 5C0XG 4NXNL 1N9WA 4LF7L 4YCUA 1V43A 2ZTDA 3NBHB 3W1GA 3M85A 2EXDA 2ZTCA 3H3VH 2Y0SG 1B70B 4DV6L 1IBKL 4UP7A 4A3DG 2UXDL 2VZAA 4IJLA 3B6YA 4A3BH 2JJQA 3CCMA 1QZHA 4DR7Q 1LM0A 1O7IA 1SR3A 1KXLA 3T1HL 1A62A 4QJFA 4DV5L 1OXUA 1XTDA 5AJ3Q 1WOCA 1TWCH 1HNWQ 3L7ZC 2ID0A 2B63G 4IPCA 1KC8C 3STBD 2AMCB 3UDGA 3IRBA 2R93H 2UUBQ 3UDFA 2NZHA 4LF9L 2R7ZG 3KDFB 1X6OA 1GVPA 4B3SQ 3M3YH 3HOZG 4IJHA 3EIVA 4HIDA 5C3EG 1PH4A 2N8NA 3F1ZA 3EBEA 3JAMc 1VQGA 3CQZH 4ME3A 1EWIA 2PNHA 4OX9Q 4DV1Q 4GKJL 1Q82C 2F4VQ 2UUAL 4LUOA 2C35B 1SFOH 4IO9A 3CC7A 4LF5L 1PH5A 4B3RL 1HNXL 3U58A 2K5HA 3PF5A 1QVFA 5FJ8G 5IWAQ 2ZJQA 4NPSA 2JE6I 3RZOH 4DR3L 1K9MC 5M5YH 3S14H 4QIWE 2NVXH 3J81c 2JA6H 1TXYA 4AQYQ 1YITA 2HHHQ 2KHIA 5DLQE 4YCWA 5HGQA 4GLAC 4X65Q 4BXXH 4HJ8A 3EN2A 5IP7H 5ELNA 1XMOL 4R4TA 1VQLA 2B29A 1MIUA 1CKOA 1GKHA 3AEVA 1VQ9A 1X65A 4RMFA 5GQOA 2Q2UA 2KENA 4UP9A 1JJGA 4DV2Q 4EQ5A 1KL9A 2CWPA 3G4SA 4JI8L 3ICEA 3T1YQ 1BVSA 1L1OA 1UE1A 3GDEA 5M3FH 1IBMQ 4O2DA 4NB3A 2BH2A 2JA5H 3E0EA 1Q1BA 2WFWA 1KD1C 1KHIA 4PZ8A 3TRZA 4KHPQ 4C3HH 1Y1WH 4B3TQ 2QEXA 4AIMA 3HOUG 1YNXA 3PUWA 2IX1A 4TVAB 3I4MH 1GD7A 3U50C 2ATWA 4KLKA 3J81j 3OTOL 1VQ5A 3KJOA 1SMXA 4R4CA 5LMNW 3PSIA 2VQFQ 4JI7Q 1N32L 4LFAQ 2FXQA 3TS0A 2IT1A 1B7YB 2JK8A 1VQFA 4JI5Q 2CWAA 1UE6A 4LFCQ 2R92G 2EQSA 2Y0SE 5E7NA 1VQMA 1NE3A 3PUXA 1AE2A 2CKZB 3U4VA 5IYDG 1SRUA 3CPWA 1HNZL 4UP8A 4X6AH 4JV5L 4HJ7A 1BBWA 4JI1Q 1NBWA 1X3EA 4OWXB 4LNQA 4H02A 3ULJA 5LMUQ 2LXJA 3M4OH 1AH9A 3WWVA 4DR2Q 4BY7G 4YHHL 2HIXA 2LSSA 2RHQB 2LXKA 4K0KL 1W3SA 1X55A 1M90C 4JBJA 4JOIA 3CCVA 1X3GA 4A3CH 3GD7A 4QGUA 3KDFA 4R4OA 3G48A 5LMNL 2JA8G 1QZGA 1WFQA 1LTLA 3M4PA 2I5MX 4B3MQ 4DV7L 1Q46A 2WP8J 4JI2L 1XNQQ 4A3DH 2UXCQ 1HZ9A 1VQ7A 2AHOB 2D0OA 4A3IH 3HOXH 3ZJYC 5IP9G 1I94Q 3CMAA 2YTVA 4A3JG 4DV3Q 3S1RH 2E5LL 1VQPA 4GKKQ 2B63H 1PH1A 2VUMG 4GNXC 2Z6KA 4HJ9A 1QVGA 2N78A 1EUJA 1TWHH 4LW1A 1QUQB 4YY3Q 2R7ZH 4A3KG 3RLFA 5IT9c 2BA0A 4Y7NH 2RCNA 5C3EH 1L2FA 3A5UA 1YI2A 2ASBA 2NVTH 3JC66 1PHJA 3RN2A 3I56A 1XPOA 4JI0Q 1XNRQ 4A4IA 3RNUA 3W5OA 4LFBL 2E2JH 1PH6A 3PO2G 4MNOA 5IYBG 1N34L 1CSPA 3K80C 4P74A 3U4ZA 1G291 3CP0A 1SE8A 1XMQQ 1L0WA 2CQOA 3UDIA 1AE3A 2ZM6L 1E3PA 4DR6L 1ASYA 5C4XG 5FLMH 5C44G 3CCJA 2OCEA 1K3RA 3HFZB 1G51A 1KRTA 1K83H 3KYHC 4XIGS 2CFMA 3CCRA 1IBLQ 3BZCA 4Y52H 3S2DH 3HOVG 4DR1Q 3PF4A 2UUCQ 5C0XJ 1VQNA 1Q7YC 1MJCA 1VCIA 1E7ZA 1N33Q 1G6PA 4DUYL 1YHQA 4DR4L 4GN3B 1Y1VG 1P8LA 1CUKA 1K0RA 2NVYH 4L5RC 5FLXc 4AYBE 1QVCA 4X66L 4LF4Q 3UE0A 3D31A 4P75A 2UXBL 3KF8B 4X62Q 4DV4L 4NXML 3ERSX 3TREA 3PO3H 5JJIA 1PH9A 3CD6A 3AQQA 3G71A 4IPGA 2MFIA 3PIOA 1FJGQ 4GNXB 3RLNA 2K52A 3VDYA 5H1SE 4PZ6A 4DV0Q 4OWWB 3PUZA 1N8RC 4BY1G 4JBWA 4GOPC 4OO1I 1S3OA 1Q1EA 2NZOA 4DPGA 4OXPA 1Q81C 3GTLH 1EFWA 4BBSG 3F2DA 1PVOA 4JYAQ 1MJEA 1PV4A 3AYHB 2WAQG 3K8AA 2DUDA 2NVQH 3I2ZA 2HIVA 3HKZG 2HT1A 2V1CC 2R92H 3I7FA 3S24A 4DR7L 1VQAA 1OXSC 5JJKA 2VQEQ 5IYDH 1OXVA 2AKWB 1Z9FA 4POFA 1HR0Q 3KFUA 3S1QH 2RHSB 2YTYA 5AJ3L 1EYGA 1XPUA 1R9TH 1T9HA 3FKIH 1HJPA 1HNWL 4MZ9A 1JT8A 2IHFA 4KI0A 2VW9A 4A3EH 1QUQA 1PH3A 2UUBL 4KHZA 3G6EA 4JI3Q 2A8VA 3S1MH 3ER0A 2Z0SA 4B3SL 4JI4Q 2JA8H 1UEBA 3NENA 4LF8Q 4A3GH 2UU9Q 1YHBA 2GVAA 1JJCB 4WJ4A 3KLWA 1IXRA 1Z47A 1YEZA 3KJPA 4DV1L 1OTCA 4OX9L 4A3MG 2F4VL 4A3LG 1C0AA 3GTQH 4XTCS 1J5EQ 2Q2TA 2N49A 4DK6C 3J7ZC 4HIMA 5IP9H 1EOVA 1UE7A 3GTPH 4A3JH 2E8GA 3CCEA 4LF6Q 5IWAL 2HQLA 2VUMH 5M3MG 5J3BA 4DUZQ 1I6HH 1UE5A 4AQYL 4A3KH 2HHHL 4JC0A 4PMWA 4QY7A 1X9NA 1CKNB 2IX0A 4P72A 3RLOA 5BR8Q 4JBMA 4X65L 1V1QA 2OQ0A 1Y14B 4UY8C 4A93G 1EIFA 1C7YA 2PMZE 1WYDA 3MEFA 4JI6Q 4BA2I 3CCQA 5IYBH 3PO2H 4DR5Q 2VY3A 4LWCA 3ULLA 3PCOB 2Q2HA 2N3SA 4DV2L 1X56A 1VQHA 3PGZA 1SLJA 3T1YL 1L1OC 1S72A 1XPRA 2YYZA 1IBML 3J7A5 2IHEA 1WCMG 4HJAA 3F2CA 4GNXA 1FVIA 1TWAH 1N36Q 3HOVH 2F3IA 4KHPL 1NTGA 4B3TL 2JA6G 3I4OA 4P73A 3K7UC 4YWMA 1VQOA 1NMGA 2WB1G 1HH2P 5K36G 4PZ7A 4BBRG 4L5SA 3GTMH 4IFDI 2RF4A 3D0FA 1I3QH 1VQJA 1Y1VH 5GROA 4C3IH 1Q86C 3PUYA 4UPAA 4EX5A 1K8GA 1A8VA 2VQFL 4JI7L 3TS2A 4DUZL 1LYLA 3AFPA 4GS3A 4LFAL 2WAQE 3S2HH 4X64Q 3NEMA 4JI5L 3HKZE 3H15A 4LFCL 2A19A 5IYCG 2I0QA 1A63A 3HOZH 3E9IA 2BA1A 4NXNQ 4HIKA 4LF7Q 2VNUD 2OTJA 1U0LA 4QL5A 4JI1L 3K7AH 5LMUL 4DV6Q 1IBKQ 4BY1H 4IFDG 1NY4A 5JEAG 4DR2L 1Y1WG 2UXDQ 3I4MG 3E9HA
chains in the Genus database with same CATH superfamily
3N6RA 4BS9A 4JOIC 2B2WC 5CV4A 4OONA 2BH8A 3K57A 5GAHC 1EFID 2MGSA 2KEDA 4DK3C 1VF5C 1JB7A 1EU3A 3RZDB 3Q22A 2D5DA 1LTGD 2KVMA 1I94L 2YU9H 2K75A 4DV3L 1V8QA 1FNUA 1FL0A 3I55A 4B9XA 4A3MB 1RF2D 4JCVE 1EOTA 1TWGH 5CYUA 4A3CG 1G2SA 2PQAB 2L1BA 1SROA 4TSSA 3HOUH 4HAEA 1V1OA 1PFBA 3FHWA 3M3YB 3HOXG 4ID6A 5AFWA 4R8NA 3SK4A 2ZJPA 2AWNA 5E4WC 3A0JA 1RL2A 4GN5A 5IE8A 3I4NG 4EQNA 1TR5A 2VB3X 5EKKA 1C4QA 2EE1A 2A1AA 1RHPA 2EIFA 2HD3A 4DKAC 1WCMB 2B2UC 4Q0FA 4MN3A 3SK8A 2JA6B 3PQIA 3RD4A 3RR5A 4X62L 4BBRB 3OTOQ 1GUTA 1IYVA 2XTIA 1HR0W 1DJRD 3A5ZB 1MSGA 1FJGL 2KCTA 2LMCB 1RIPA 3CCUA 1HZAA 1PH8A 1KQSA 3S16H 4EQOA 1H9SB 2BDOA 2E2IH 4O0AA 2XGTA 1EEID 5KYLA 3KF6A 5JVG3 2LFNA 2VB2X 4GOPB 4RGNA 1Y1WB 1YBYA 3I4MB 3KOJA 1A0IA 4L5TA 4GLVB 4EGVA 2VQEL 4N9TA 1SMYC 2R7DA 2BCOA 3CW2C 3BU2A 4JI2Q 2JEAI 1PRTC 1EEFD 1LT4D 1J6QA 4JI3L 2C9OA 3K0YA 2E5LQ 2YV5A 4XDXA 3M4OB 4IN3A 3GTGB 5EKLA 5IGDA 5CC4A 4N9PA 1EYDA 1TWFH 1K73C 1NCVA 1BQQT 4BXXG 1B3QA 3HOWB 4FDBA 1JMCA 2ES2A 2EOTA 5DM63 4NP5A 2Y0SB 1N34Q 2Q8IB 3C46A 1XWEA 5BR8L 2ZM6Q 4DNIA 5C3XA 5M3FG 2XRSD 4TRDA 4HR7B 3A56A 1SBBB 3S1RB 2JA5G 2JQOA 2XIWA 2MO0A 3CF5A 1TWHB 1F2YA 4OIKA 4PG3A 1B50A 4DUYQ 1PA6A 4DR4Q 4JG2A 1VS0A 5C3EB 5DEHA 1YVCA 4FF3A 3P75A 3NTIA 3KUPA 1H9RA 1VMPA 3OWEB 4IOAA 1I4XA 3F8TA 4FVMA 3SHLA 1PMRA 1L1OB 3I4NH 2G9DA 1JJ2A 2F0WA 2RCFA 3J81i 2NTSA 1A15A 3CC4A 2D0PA 3J7YW 3FVQA 1ILQA 2EY6A 2K04A 4X64L 1FYCA 3PUVA 5CORA 3MFGA 4CDCC 4NXNL 4LF7L 1GUSA 3F2UA 2XVSA 2ZTDA 4DNRB 4I7AA 2EXDA 5FO8B 1IBKL 3H3VH 2NYZD 3QO2A 4UP7A 4A3DG 3B6YA 1QZHA 2PCFB 2B2TC 1KXLA 3EVQA 5FKAC 3TDQA 4UHVA 4DN4M 1WOCA 1DONA 4CKEA 2CH4A 4CBVA 2B63G 1KC8C 3STBD 2AMCB 2O5JC 4PV1C 3KDFB 3NWSA 1GVPA 2O4XA 1SYCA 2RBMA 2EJMA 3F1ZA 3OIPA 3Q24A 1EWIA 1LT3D 3S14B 3IKJA 4IZ8A 4GKJL 5M5YB 2K32A 5IGCA 1PH5A 1IL8A 2K5HA 3H09A 3RZOH 1KNAA 4B9WA 1YNND 3FKIB 4XYOA 3J81c 5DLQE 2MUYA 4A3EB 1STGA 4X65Q 4BXXH 5C5LA 4IURA 1H9KA 4QIWB 4A3GB 1GKHA 3BDLA 1X65A 4RMFA 2Q2UA 2KENA 4UP9A 1AW7A 4C3HB 4OGQC 3GTQB 1JCKB 4IUTA 2FFKB 1UE1A 5M3FH 2BH2A 2EYMA 2JA5H 1KHIA 2E75C 5JAVA 2K7VA 3P20A 4H44C 4KLKA 3O13A 2VQFQ 1AN8A 3VR6A 3NBHA 2NBFA 1VQFA 4RAUC 4JI5Q 2CWAA 3HS0C 1C48A 2Y0SE 5E7NA 1AE2A 1EY0A 5IYDG 5CMDA 1SRUA 5DM73 3RMHA 4HJ7A 2F0IA 1NBWA 1X3EA 2AUJD 5LMUQ 2LXJA 1K28A 3J81E 3HRZC 4K0KL 4JBJA 1B1ZA 4QGUA 4ZKCB 2EZVA 3M4PA 1JORA 2WP8J 4A3DH 3E6ZX 1VQ7A 4U68A 3EQLC 4KHVA 1ET6A 1STAA 1I94Q 3CMAA 4DV3Q 5CR3A 2B63H 1PH1A 2EJGC 4LW1A 3RLFA 2SEBD 1H9SA 1GUNA 1JQYD 3W5OA 4HEDA 2CW0D 3D6CA 3K80C 1Y8NB 1SE8A 3J81L 1A3VA 2HDLA 5IOCA 4DR6L 5FLMH 1STNA 5D3DA 3GTJB 1SJED 1KRTA 3KYHC 2CFMA 2JSOA 1MHWC 2K28A 3HOVG 3PF4A 1E2ZA 3T13A 1VCIA 1E7ZA 4ABNA 1G6PA 3FPUB 1P8LA 4L5RC 5FLXc 4X66L 2MHVA 4CDEC 2A6HD 4FO2A 4F7XA 4X62Q 2XNAC 3PO3H 1QOHA 3H91A 3GTLB 1FJGQ 3RLNA 2K52A 2LY7A 3SE0A 4N8FA 1JC7A 3W2DA 2NB0A 1PDQA 2RDFA 4JBWA 5K5PA 3TP6A 4GOPC 1GXDC 5C3WA 4DPGA 4OXPA 1Q81C 4BBSG 1DCZA 1STBA 3G7LA 3S1QB 3AYHB 2WAQG 3D3RA 3A8JE 1UEAB 2DUDA 1CHQD 3IFTA 1SE2A 1QCBD 1VQAA 5JJKA 2VQEQ 1PTOB 2HQEA 5IYDH 1OXVA 2JA8B 2RHSB 2YTYA 5AJ3L 1R9TH 2D9UA 3A8IE 1B2TA 3G6EA 4JI3Q 2AUKA 3FPPA 5TSSA 1BCPF 4KTAA 5KRUA 4A3JB 1T5EA 2NTTA 1YHBA 2GVAA 3OPOA 5JPMC 4WJ4A 1DOMA 3NQIA 1QB5D 4DA2A 1I6HB 4OX9L 1OTCA 1ZEQX 4A3LG 1ONLA 2LKVA 1KLGD 4A3MG 2F4VL 1U4LA 4XTCS 1TVXA 2E8GA 2HQLA 2Z4HA 5M3MG 3HG9A 5A35A 3PO2B 4CJ0B 4AQYL 2HHHL 1XYIA 5BR8Q 4P72A 4JBMA 5I2XA 1V1QA 5E3FA 1I50B 4OL7A 5C44B 5C4XB 3K6OA 3DWAA 3CCQA 3ULLA 2E2DC 5T1IA 1X56A 3T1YL 1L1OC 1XPRA 4C3IB 2EYLA 3J7A5 1WCMG 4GNXA 1R4PB 1F2MA 1TWAH 3HOVH 2F3IA 2HUGA 5FLXL 4ME5A 4B3TL 2JA6G 3I4OA 3S2HB 4YWMA 1VQOA 1S5DD 4PZ7A 4BBRG 4L5SA 5M5WB 1YNJD 1NR4A 4EX5A 4UPAA 1MSHA 2C5CA 4IQZA 2K6AA 4JK1C 4MHEA 2L4NA 1D2BA 4X64Q 3NEMA 3H15A 4LFCL 5IYCG 1A63A 2QCPX 3E9IA 1O7YA 4NXNQ 1BCPD 4LF7Q 1CI3M 4IUUA 3K7AH 1W6JA 1GHJA 1IBKQ 4DK1A 4IFDG 5JEAG 1A3TA 1EU4A 1Y1WG 4O42A 3I4MG 4IUQA 4BBSH 4IOCA 4X3TA 4ZK9B 3W1BA 1FGUA 3KF6B 3M4YA 1MGSA 3OOCA 1PH2A 4PMBA 2K5VA 3M4QA 3SK5A 4CKBA 3TQYA 4J8QA 4RCOA 4APVA 1ZYRD 4G57A 4WJ3M 5FO9B 1E22A 2YTXA 3QWNA 2ALYB 3QG1A 1PH7A 4GKJQ 2VL6A 5DNFA 5D3IB 1DOKA 4C3JB 1UWVA 2WINB 3RZDH 2IL8A 1VQBA 1B3AA 5KNDA 1TKWB 1VDZA 3HOWG 4BA1I 3RN5A 2PQEA 4R1JA 1EQQA 3CPFA 4JI0L 4K8JA 2RDGA 4A3LH 3CHBD 4A3MH 1BXTA 1TS3A 3C1EA 5G3LF 5D65A 4J15A 2F52A 3K5LA 1ASZA 1OXXK 4M8AA 4LAAA 1LLRD 5I2YA 5M3MH 2A6ED 1ET9A 5EBDA 4I65A 2DY8A 2F0VA 2B2VA 3HOYG 1HZBA 1IL2A 5ELOA 3A54A 4G4KA 3OW2A 5EPLA 3PIP3 5C4JB 1SAPA 2WB1E 1STYA 2PO4A 4BY7H 2K14A 1NR2A 2ZJRA 2QA4A 1V9PA 1F2LA 3J80i 1PYBA 3BZDB 3QOLA 1WCMH 3I70A 2H5XA 4DV0L 3NWTA 1YZ6A 3EROA 4BBRH 1M1KC 1CT1D 1HQMC 3A74A 1DD2A 4JYAL 4UDUC 2MO1A 1RJTA 2G9HD 4K0KQ 5IYCH 5CV8A 1VQ4A 2R3ZA 2TMPA 3E0JA 1EQTA 3DWPA 4LJZC 4RFBA 4IFDH 1YJNA 4MTNA 4FNFA 1HA5A 4POGA 3S17H 4C2MH 5G3LD 3QIAA 1KAWA 1TT2A 4JI4L 4L8JA 4LF8L 1BCPB 4YWKA 1DXMA 2NWGA 3BYTB 2PYKA 1BKBA 1XJVA 3HKSA 4PMCA 4IPDA 1Y8PB 2A68D 3UE1A 5JJLA 3STBC 4A3FB 2F1MA 2KHJA 1WI5A 3J80c 4LF6L 3GTGH 3Q8DA 3FKIG 1E2WA 1WJJA 4A3EG 4A3IB 1HFNA 4DR6Q 1IYUA 2F0KA 3HOWH 5GAGC 1K0SA 2EPBA 1LT6D 1X54A 1JE4A 4A3GG 4GN4B 5CGKA 3BDOA 4C3HG 1SSOA 2R7FA 2IWHA 3TEHB 1YNNC 3NBIA 1KIXA 4IFDJ 3GTKH 2NVTB 4I7ZC 5JEAJ 1I4HA 1NJIC 4ILWA 1EZ8A 1HPCA 4X66Q 5C0XI 2BE5D 3HOYH 2E2JB 1NMFA 3SXHA 3R2IA 2J7ZA 3S15H 4KN7C 3KLRA 1K83B 1E1OA 4DAYA 4ALPA 2F0FA 3A55A 1LTTD 1GUGA 2AWOA 2E74C 1E24A 3AFQA 4NW2A 5IIFA 1JWMD 1N9WA 3ERQA 4YCUA 3J80E 3NBHB 3ND8A 1DOLA 1B70B 2KA7A 3KLSA 2KECA 2QDLA 2UXDL 1J8IA 4IJLA 2R93B 1O7IA 2B8GA 5KGUA 3T1HL 4Z9CB 1OXUA 5AJ3Q 2EDGA 1TWCH 1PZID 3IRBA 1KDAA 2R7ZG 1JB3A 4PQXA 4HIDA 3EBEA 1QNKA 5M9OA 2NVQB 4OX9Q 1B4OA 1Q82C 2F4VQ 2R92B 2UUAL 2C35B 1SFOH 4LF5L 3CC7A 4K2LA 4B3RL 1HNXL 5FJ8G 4DR3L 3LX0A 5M5YH 3J80L 3S14H 2NVXH 5I9OA 4AQYQ 4XQQA 3MAQA 2HHHQ 2KHIA 3VR4A 2Z9HA 5A2QE 4L6TB 5CV6A 5ELNA 3V96A 5F2DA 5KIXA 1MIUA 3I91A 2EY5A 5GQOA 2B8FA 3C2PA 3MEHA 2CW0C 3T1YQ 5I4DA 2A69D 1SEBD 2WFWA 3BVZA 4C3HH 3I90A 4B3TQ 2M9VA 2QEXA 4A3KB 3U50C 1SMXA 1D5XC 2EJFC 4YIJA 2J0TD 2JK8A 3I3CA 2K5WA 4LFCQ 2AQ1B 2A6HC 5A2QL 3Q0AA 1NE3A 2K33A 1NNXA 4UP8A 1BBWA 3TSSA 3WWVA 3VA5A 2LSSA 2RHQB 1RD9D 1M90C 4KJNA 2PMZB 1X3GA 3CCVA 4A3CH 3G48A 5LMNL 2PPBC 3IAYA 2B2YA 2JA8G 1STHA 4ZUJA 3FEWX 2QILA 1Q46A 1TQOA 1BUVT 1HZ9A 1WTHA 1SYGA 3HOXH 3HOZB 2YTVA 3EFXD 4A3JG 2Z6KA 1QVGA 2N78A 4CJ1B 3VR5A 1CK1A 2R7ZH 5IT9c 3ITPA 4RGTA 1L2FA 3BS1A 3A5UA 5BN3A 2ASBA 1PHJA 3I56A 4JI0Q 4A4IA 3K58A 3RNUA 3PO2G 5IYBG 1CSPA 3Q23A 3U4ZA 1G291 3G6JB 2EXZA 3UDIA 1AE3A 4OIJA 1E3PA 4N8X1 5C4XG 3MXUA 5C44G 1EY4A 3CCJA 1AFPA 2DN8A 1G51A 1SE4A 2NVYB 4KY7A 1LABA 2OT2A 1Q7YC 1MJCA 1PTOF 2KUMA 1QNUA 2SNMA 2Z4IA 4C3IG 1CUKA 1QVCA 3HOUB 3T53B 4EQPA 3D31A 4DV4L 1PLFA 3AB9A 3ERSX 3TREA 2DNEA 3TMEA 4DNTB 2EYOA 3V05A 3A8KE 3CD6A 4DFAA 3AQQA 2MFIA 4GNXB 3VDYA 5H1SE 4PZ6A 4DV0Q 3PUZA 1EY8A 5IT9E 1G8ZD 3GTLH 1E2VA 4TKOB 4K5WA 4JYAQ 2EYFA 4UAIA 1MJEA 4KJOA 2N55A 1YNJC 3EJIA 3I2ZA 2DJGC 3E3XA 1GUOA 3I7FA 4DR7L 2R61A 1D1KA 4CDFC 3PIO3 3KFUA 3S1QH 1ZKOA 3TN2A 1F9RA 1EYGA 1BCPC 4K6LA 5CV7A 4QMGA 1FR3A 2WKCA 4MZ9A 1I4QA 4B08A 1HNWL 1GHKA 1PH3A 3DMUA 2UUBL 3ER0A 2Z0SA 4JI4Q 2DJFC 2JA8H 1HUNA 2QF7A 3NENA 3R3OA 2AQ3B 3OIQA 4PNYA 4CHTB 4LF8Q 2IJ0A 2KQ3A 3KLWA 4FP5D 1IXRA 2CHBD 4C3JG 1PTOD 2EYJA 2N49A 2Q2TA 3J7ZC 1U9RA 1SNQA 2PZWA 5IT9L 5HURA 4HIMA 3GTPH 4A3JH 3CCEA 3T56B 4LF6Q 5IWAL 1D1IA 1ZYRC 2L11A 1I6HH 3VYSA 1UE5A 1EWHA 2K5QA 3T4AC 4S3SA 3SDZA 1KDCA 5ISRA 4UY8C 1Y14B 4OEMB 1JR0D 1C7YA 2PMZE 1WYDA 1BBXC 2BOSA 4R9WA 3PO2H 5IYBH 2VY3A 5HGTA 1CQVA 4DV2L 3PGZA 1SLJA 3KF8A 1LO5D 1Y1VB 3DWQA 3F2CA 4X3KA 2KOLA 2A6EC 1MI2A 3K7UC 1NMGA 5D14A 5K36G 1I6VC 2RF4A 4C3IH 2JP1A 3PUYA 1K8GA 5FOBB 4JI7L 3SEBA 1LACA 4DUZL 1LYLA 4GS3A 1UUPA 4LFAL 3S2HH 3HKZE 2I0QA 4KD3A 4HIKA 2VNUD 4K5XA 3QOJA 4JI1L 1FD7D 1NY4A 4DR2L 2UXDQ 5BN5A 1HTPA 1OXTA 3T1HQ 4YWLA 1HCZA 3LGJA 3IL8A 2CCZA 3QJYA 2K5NA 1E1TA 4KKSA 2E2HB 1SNPA 3NELA 4B3ML 4WORA 2UXCL 1A2UA 1O7LA 1S5BD 3CCSA 2J4XA 4FYDA 1VQKA 2K05A 1MBYA 2Q2IA 4A75A 3MXNB 2F0MA 3S1NH 4GKKL 2UUAQ 5HY6A 4YY3L 4LF5Q 4B3RQ 4A3FG 1HNXQ 3MFYA 1Q90A 3V2TA 4DR3Q 1VQ8A 1H95A 1XNRL 1GM5A 3K5OA 5E4XA 3I4LA 1U4PA 4C3JH 2F0QA 4A3IG 3U9OA 4QUCA 3SVMA 4A93B 2A68C 2F0EA 4DU9A 5C4HA 1IBLL 4IPHA 2RVLA 5C6AA 3GO5A 2QGQA 3MZ5A 4DAMA 3CXCA 4DR1L 3UDXA 4DXFA 2UUCL 1S5FD 3KK7A 1N33L 1IZ6A 1V1PA 3SGIA 4DAVA 4JBKA 3RZOB 4OO1G 2I5HA 3KBGA 4LF4L 2X6LA 1MD2D 3CAMA 5EAYA 2WB1B 4RCNA 4C56C 2NZ1D 3ULPA 5C4JH 2GA4B 3RUZA 2HCIA 1DGSA 1ENCA 1LUZA 3R93A 5I6WA 3D4RA 2NN6I 2K4KA 5K36H 4R4QA 2BE5C 3L3OC 1TIID 4O1NA 4F8MA 3PV0A 4DAYB 1EIYB 2JA5B 5ELBA 3L2PA 2OTLA 1DYQA 1K3BC 2R93G 1EL0A 2XWBB 1QG7A 2JYOA 4MIUA 5LMNQ 1KLUD 4RG1A 1BNZA 5KYIA 4R4IA 4C1NK 2KBNA 1EIGA 1E0BA 1X3FA 3OHXC 1MKHA 3L0OA 2L15A 1A6XA 2GVBA 2CVRA 3TZDA 2JA7B 3CKIB 1Q8KA 4FF1A 4CGYB 1AEXA 1IYJB 3OYYA 4A76A 1GO3E 2K5DA 1C9OA 1D7QA 2EY2A 4H13C 1KRSA 2DY7A 4MTKA 1J5EL 3NTHA 4XQJA 5LL6S 1KDBA 5IP7G 1PZKD 4RKLA 1LTAD 1SE3A 1RTOA 3S9WA 3GV3A 4P71A 2GN5A 2F0GA 1VQEA 4FXDA 4FXGC 5M5XB 4A3FH 1GUWA 1F2ZA 3CRLC 3ND9A 4JI6L 1JWUD 2DGYA 3DLLA 3H0GB 2OXPA 2VXWA 4HJ5A 2IY5B 4X3SA 3M7NA 3JAMi 2L55A 3K0XA 3GTOH 5FO7B 4KK7A 1YJWA 1N36L 1XXGA 2QEJC 4DV4Q 4RHSA 1F9QA 5ELFA 2LS01 3LNNA 3GV6A 1BO0A 4OO1H 4K8IA 2A69C 1VQ6A 2F0UA 1IW7D 3CC2A 1VMCA 2I5LX 5EKIA 4A3BB 2X69A 5C0XG 1XX8A 3HEJA 3M85A 2ZTCA 2Y0SG 1DZ1A 4DR7Q 1SJHD 2JJQA 3CCMA 3PO3B 1LM0A 1A62A 4ZLTF 4QJFA 4DV5L 1XTDA 1PFNA 3CRKC 1HNWQ 3L7ZC 4V0BA 1BF4A 2ID0A 4FF2A 3CQZB 4IPCA 1D5MC 3UDGA 2R93H 3H94A 2UUBQ 4LF9L 1X6OA 3M3YH 3HOZG 4IJHA 2F0LA 4AYBB 5IGEA 5C3EG 2N8NA 3JAMc 3D4WA 3BYYB 3DM1A 2QW7A 3HP3A 5I9PA 5J1ZA 4LUOA 2AQ2B 3I72A 1WVLA 2F3VA 3U58A 1I4PA 5IWAQ 1XTCD 4NPSA 1NAPA 1R9TB 1HA6A 2JA6H 1TXYA 1FNVA 5JJZA 5HGQA 1ICFB 4GLAC 4WFN3 4FXKC 3WOEA 4HJ8A 3EN2A 2RQXA 5IP7H 1XMOL 3WOFA 4FF4A 3NK9A 4R4TA 1VQLA 2B29A 3KBXA 1KTKA 1CKOA 2RSNA 1Z7TA 2PZTA 2B2VC 4DV2Q 1KL9A 2F0PA 4JI8L 1EYAA 5CBAE 3GDEA 3IFDA 3OMGA 1HXYD 3MXNA 3OW7A 1KD1C 4IUVA 3TRZA 5JEAH 1Y1WH 3HOUG 3TP5A 1YNXA 3I4MH 2IX1A 4TVAB 3EA6A 4K5VA 3NQTA 2XSCA 1VQ5A 3KJOA 4R4CA 5LMNW 3PSIA 4JI7Q 3JAME 1LV9A 1N32L 1CHPD 4LFAQ 5C5MA 2FXQA 4OHJA 2F0SA 3CU7A 2EQSA 3C1FA 3PUXA 2F0JA 5LHY1 3U4VA 1WTPA 1HNZL 4JV5L 4JI1Q 3M4OH 4OWXB 2FJ2A 2L12A 2PW7A 1AH9A 4DR2Q 3ZYYX 4YHHL 2LXKA 1X55A 4JOIA 2B2WA 4H0LC 1WTRA 1GJXA 1LTLA 2QDBA 4B3MQ 2EYPA 4DV7L 5ELCA 2UXCQ 1ESFA 1QILA 5JVH3 4CJ2C 2L5TA 2WACA 4Y7NB 3ZJYC 5JOBA 3MTSA 1CA6A 3S1RH 4GKKQ 3JAML 1F9PA 2FINB 4HJ9A 1EUJA 1SXTA 1QE6A 1TWHH 4YY3Q 3BVGA 5C3EH 5BN4A 1YI2A 4HSPA 2RSOA 2WAQB 3RN2A 1XPOA 1XNRQ 1UAPA 2SDFA 1RDPD 2K03A 3URYA 4LFBL 4MNOA 4NKLA 3S2DB 3BDCA 3T16A 2ICIA 1L0WA 1WD0A 3K5MA 2CQOA 3VYUA 3HFZB 1PTOC 3DEPA 4XIGS 1IBLQ 4Y52H 3BZCA 1EY7A 4DR1Q 2WIIB 5C0XJ 2UUCQ 5EPJA 3TP8A 1G2TA 1N33Q 3NHHA 1Y1VG 4J1MA 4ZQ3A 4GZYC 2B2UA 1OO9B 2NVYH 4AYBE 4LF4Q 1G6ZA 2F3WA 4XYQA 2UXBL 3KF8B 4NXML 5JJIA 1PH9A 4HSVA 4JVZA 4RGMA 5M3MB 2K01A 1SYFA 3NUCA 1S3OA 1Q1EA 2NZOA 1KABA 1PVOA 2F0NA 3F2DA 4F88A 1PV4A 1ICWA 3K8AA 2Q8RE 1PFMA 4ZAIA 2HIVA 4DK0A 4BY7B 2V1CC 1BDOA 1WTXA 1OXSC 1X3QA 2FMMA 4DXGA 2QKIC 3S1MB 1CFMA 1XPUA 3E5SA 1D6EC 3FKIH 1Z6HA 2RA4A 3OMCA 1S5CD 2IHFA 4KI0A 4A3EH 1SNOA 1QUQA 4BWGB 4B3SL 2L9HA 1UEBA 4A3GH 4DAPA 1PZJD 3SK6A 2VUMB 1WTOA 2WV6D 2EVBA 3KJPA 3DXJC 4DV1L 1C0AA 1JICA 2KEEA 1J5EQ 3GTQH 4QB4A 4DK6C 1EOVA 1UE7A 1CA5A 1VF7A 4K6DA 4KY5A 3VA7A 2IX0A 3S17B 5CV9A 3RLOA 2EY1A 1B9NA 4C2MB 2OQ0A 4R8IA 4A93G 1EIFA 2KJXA 4JI6Q 1WTWA 2SNSA 4BA2I 2Q8TA 1FGBD 1R4QB 2ZXPA 1L0YB 3GTMB 1CZGA 2H1EA 1IBML 1I3QB 4WRDA 2IHEA 4JW0A 4ZCKA 3VR2A 4HJAA 1LTRD 3KLSX 1FVIA 1N36Q 4KHPL 1B9MA 2ICEC 4P73A 2WB1G 3OWFA 5L37A 4ZKBB 2F4IA 4IUNA 1V1PB 2K1BA 1Y1VH 1Q86C 3TS2A 3HZXA 2WAQE 1TS5A 4BY1B 4ULLA 2P5ZX 3J7AF 2A19A 2OF1A 3OSOA 3C3LA 1EYCA 3GTKB 1U0LA 1WD1A 2OTJA 4QL5A 3HKZB 3HOYB 3E9HA 1SNDA 1B44D 2B2TA 4OWTB 3BZKA 4DV5Q 5T1GA 3S15B 5FJ8H 3MXPA 2B2YC 4RA8A 2YU9B 1PYWD 3AMUA 1FNWA 1W2BA 1XNQL 3F2BA 4LF9Q 2K50A 1M8AA 1U5KA 2JA7G 1JWSD 3H6MA 1TWGB 1YJ9A 3GTJH 1B8AA 2E2HH 3FP9A 1DM0B 1P16A 2KCMA 1LTID 2Z6KC 1QJOA 2R6GA 5IGBA 4HCSA 2ZTEA 1K8AC 3M9BA 1CSQA 4QF4A 3WDNA 1CKNA 5EQ0A 4ZRZA 1JE5A 3PIPA 4L5QA 4HIOA 1S4ZA 1TWCB 2BDNA 4HTHA 4TQUS 2MPMA 1IHZA 3VYTA 3K59A 1XMQL 1M4VA 1HZCA 3AU7A 1YIJA 2DNCA 5J39A 1VQDA 1XMOQ 1SNMA 1SYEA 4RH6A 4QQBX 3G4SA 1BBUA 3H0GG 1PFSA 4JI8Q 1A3UA 4A93H 1CKMA 1SFOB 1UNSA 3H3VI 3BG3A 4LUVA 4K2KA 3D6WA 4JPBW 3CMEA 1C8CA 2NVXB 3S16B 2IW3A 1RODA 1Q12A 1PTOH 5COYA 2ZT9C 2OWOA 2E2IB 1BOSA 1D8LA 5FLMG 1LT5D 3QB3A 1N32Q 1YHAA 4GLXA 2OQKA 5C4ZA 3MA2B 1F77A 2PI2E 2SOBA 4A3BG 2JXMB 3L9AX 1HNZQ 4JV5Q 1PYSB 2RKSA 4YHHQ 3DEOA 1W6KA 2JA9A 2CQAA 1IW7C 1TY2A 3PO3G 3MXGA 3NTKA 1SN8A 2JEBI 1HTLD 1HR0L 2NN6G 4DV7Q 1JOKA 1HRJA 5GADC 4XT3B 3J7AV 2H4OA 4RWSC 5CV5A 1JOOA 5C4XH 1I50H 5C44H 1WTQA 1TWFB 4AYBG 2PQAA 4YCVA 4ODGA 1B53A 4DGZA 2UU9L 1PRTF 4G7OC 1SYBA 2PW5A 4QCLA 2FHTA 2JA7H 1O80A 2HDMA 1VQIA 3LWEA 4LFBQ 3MHBA 1S5ED 1SNCA 5GAEC 2TSSA 1EQRA 5M5WH 1CTMA 2F0HA 4NMZA 3HOXB 1NSNS 3CCLA 1ML0D 1STEA 3DUZA 4AH6A 3A7AB 4DR5L 3DM3A 3K81C 5M5XH 2EYHA 2R7ZB 5J22A 1I5FA 3FDTA 3I4NB 2D2CC 1KNEA 1S40A 2MNAA 4F87A 5IY0A 2NUCA 2KCCA 2MQHA 2XN9C 3DHQA 4X3UA 3H0GH 3BVMA 2UXBQ 3BJUA 4NXMQ 4NDXA 2D62A 1AP0A 2B3GA 1JOQA 3FRPB 4J6HA 4LUZA 5EBCA 3A7LA 3TP7A 2VS1A 2PI2A 4GOPA 4ZYSA 3NSWA 3ONAB 3M7GA 1SMYD 2ZXOA 4C1NI 1VQCA 3N52A 1V43A 3W1GA 2KHSA 2JN4A 1PRTD 4DV6L 3HGBA 2VZAA 4A3BH 1SR3A 1H9JA 2O2LD 1PXUA 1RKNA 1TS2A 4KKUA 3UDFA 2NZHA 3UI2A 3W3AA 1EIHA 4B3SQ 3NE5B 3D4DA 2NN6H 3EIVA 1PH4A 3VYRA 1VQGA 5ELEA 5JPNC 3CQZH 4ME3A 1J9OA 2PNHA 1K8OA 1HUMA 4DV1Q 2I07B 2F03A 1Q8IA 4IO9A 1IKMA 1QVFA 3PF5A 2ZJQA 2JE6I 1AZQA 1K9MC 4QIWE 4RHRA 5EPKA 1YITA 1QWYA 4YCWA 5CBEE 2V4DA 1KAAA 1CZWA 3LWUA 5M3FB 3AEVA 1VQ9A 1L0XB 1JJGA 4EQ5A 3FMCA 1TU2B 2CWPA 3ICEA 4LK1C 1BVSA 1L1OA 1IKLA 1IBMQ 4O2DA 4NB3A 1K8MA 2KCNA 3GTPB 3E0EA 5FLXE 1Q1BA 4G7HC 4PZ8A 4KHPQ 4AIMA 4WJWA 3PUWA 1U4RA 2FMCA 1GD7A 2MJ8A 2ATWA 1ENFA 1CQFA 3J81j 3OTOL 1TY0A 5EGTA 1ENAA 4KKTA 1TS4A 5KEEA 1HHVA 3TS0A 2IT1A 1B7YB 1X3PA 2IX3A 5ELDA 2X6GA 5EJWA 1UE6A 2R92G 4HN7A 1VQMA 5IODA 1HFGA 1EY6A 2CKZB 1T5XD 3CPWA 2E76C 4X6AH 4IALA 4LNQA 1I4GA 4H02A 3ULJA 4BY7G 2HIXA 5NUCA 4CDDC 4A3DB 1W3SA 2PNRC 2RDHA 1CM9A 1II3A 3GD7A 4V190 3KDFA 4R4OA 1QZGA 1WFQA 1A2TA 1D5ZC 2I5MX 3PMFA 1XNQQ 4JI2L 3R8BA 2B63B 2AHOB 2D0OA 3MWYW 4M1UB 4A3IH 4ZUIA 3X3MA 5IP9G 2A73B 2PZUA 2E5LL 1VQPA 2VUMG 4GNXC 2Z8LA 2ZXRA 3Q6SA 1PRTB 1QUQB 2O5IC 3K5NA 4A3KG 4XQNA 1G91A 5KNCA 1H9MA 2BA0A 3GP7A 4Y7NH 2RCNA 1NUCA 2Z1CA 4RGOS 1Y69U 2HCCA 2NVTH 3JC66 4CKCA 2E2JH 1EY5A 5I6YA 1PH6A 1N34L 4P74A 5DAUA 1XMQQ 3CP0A 2ZM6L 4OELB 1ASYA 2OCEA 1K3RA 4HMJA 1K83H 3CCRA 1EY9A 2MP1A 3S2DH 3S1NB 3P7JA 3QR8A 4KV6A 3GQBA 1VQNA 1U4MA 4DUYL 1YHQA 4DR4L 4GN3B 2N88A 4E6IA 3TZUA 1K0RA 1EWCA 1GOZA 3NPPA 4KY6A 4H7BA 3UE0A 3U9SA 4P75A 1ZXTA 2M2LA 2OEOA 1RCVD 1LTBD 1Y8OB 3VR3A 3G71A 4IPGA 5IGFA 4KN4C 3PIOA 4OWWB 1N8RC 4BY1G 1EQVA 4OO1I 3R2TA 4L63B 2A74C 1EFWA 5IGGA 3MVVA 1X32A 3SR1A 4Q5VA 2NVQH 2HT1A 3HKZG 2R92H 3S24A 4U673 2F0OA 2AKWB 1SDFA 1Z9FA 1Q3LA 2ENBA 4POFA 1WTVA 1HR0Q 1AZPA 1T9HA 1HJPA 2G5DA 1JT8A 2VW9A 1O7ZA 1SYDA 2A8VA 4KHZA 4EVOA 3S1MH 2L0CA 2F0TA 4HCEA 4DF7A 1F9SA 2UU9Q 1JJCB 3I8ZA 3I73A 1Z47A 1YEZA 2I46A 5E1FA 5KNBA 4KMUC 5IP9H 4IUPA 4LMQD 2VUMH 2IPKD 5J3BA 4DUZQ 4G7ZC 1I4RA 4A3KH 4JC0A 4PMWA 4QY7A 1X9NA 1CKNB 2Z6BA 4X65L 2XWJB 3NP8A 1EZ6A 3MEFA 3NXWA 5LL6X 4HMIA 4DR5Q 4P2CB 4LWCA 3PCOB 1TWAB 2N3SA 2Q2HA 5FK9C 3HOVB 1VQHA 1LTSD 1HQRD 1O78A 4XT1B 3X3NA 5C0XH 1S72A 4XXEA 1BR9A 2YYZA 3TBIB 2XRQD 2A5HA 3MC0B 1NTGA 1ESRA 2B39A 3P1HA 2CH4W 1HH2P 3H3VC 2M00A 3GTMH 4IFDI 3D0FA 5GROA 1I3QH 1VQJA 1ILPA 4QUFA 1A8VA 2VQFL 4KD4A 3AFPA 2WKDA 3K7AB 1RTNA 4JI5L 2F0DA 4K14A 3D8GA 4RKBA 3HOZH 2BA1A 4BBSB 3GTOB 3T51B 5LMUL 4DV6Q 4BY1H
chains in the Genus database with same CATH topology
4JOIC 1OXTA 4BBSH 4OONA 4OWTB 4IOCA 3T1HQ 3BZKA 4DV5Q 4YWLA 2BH8A 3LGJA 5FJ8H 3W1BA 2CCZA 5GAHC 1FGUA 3KF6B 2K5NA 1E1TA 4DK3C 3NELA 4B3ML 1PH2A 1W2BA 1XNQL 2UXCL 3F2BA 1JB7A 2K5VA 4LF9Q 3M4QA 3CCSA 2K50A 3TQYA 1VQKA 1U5KA 2JA7G 4APVA 2Q2IA 4A75A 3GTJH 1YJ9A 1B8AA 3MXNB 4WJ3M 1E22A 2YTXA 1I94L 2E2HH 2YU9H 2K75A 3FP9A 4DV3L 1P16A 2ALYB 3S1NH 4GKKL 2KCMA 1PH7A 1FL0A 2Z6KC 2VL6A 3I55A 2R6GA 4GKJQ 1K8AC 2ZTEA 5HY6A 2UUAQ 4YY3L 3M9BA 4JCVE 1UWVA 1CSQA 3RZDH 4LF5Q 1CKNA 1TWGH 4B3RQ 1VQBA 4A3CG 4A3FG 1HNXQ 1JE5A 3PIPA 3HOWG 2PQAB 4L5QA 1VQ8A 4BA1I 4DR3Q 4HIOA 1H95A 1XNRL 3RN5A 1SROA 4R1JA 1EQQA 3CPFA 1GM5A 4JI0L 3HOUH 4TQUS 4A3LH 4C3JH 4A3MH 1XMQL 4A3IG 1HZCA 1YIJA 4J15A 2F52A 1ASZA 3FHWA 1VQDA 1XMOQ 1OXXK 3HOXG 5M3MH 1IBLL 4IPHA 2ZJPA 4QQBX 2AWNA 3HOYG 1HZBA 2QGQA 1BBUA 3GO5A 3H0GG 5ELOA 3A0JA 4DAMA 3CXCA 1PFSA 3UDXA 4DR1L 1RL2A 4GN5A 4JI8Q 2UUCL 5IE8A 3OW2A 4A93H 1CKMA 3I4NG 1N33L 3H3VI 1IZ6A 2WB1E 4LUVA 3SGIA 4JBKA 2A1AA 2EIFA 4DKAC 4OO1G 3CMEA 2I5HA 4LF4L 4BY7H 2K14A 2ZJRA 2QA4A 3CAMA 5EAYA 1V9PA 3RR5A 1Q12A 4X62L 3ULPA 3OTOQ 3J80i 5C4JH 2XTIA 1PYBA 2OWOA 5FLMG 1D8LA 1WCMH 1HR0W 1DGSA 3A5ZB 1FJGL 2KCTA 1N32Q 1LUZA 1YHAA 2H5XA 4DV0L 2OQKA 1RIPA 3CCUA 1HZAA 4GLXA 2NN6I 1PH8A 1KQSA 1YZ6A 2K4KA 3S16H 4R4QA 4BBRH 1M1KC 2PI2E 3A74A 4A3BG 2E2IH 4O0AA 1HNZQ 4JYAL 2XGTA 4JV5Q 3PV0A 4DAYB 3KF6A 1EIYB 1PYSB 3L2PA 2MO1A 2OTLA 4GOPB 4YHHQ 4K0KQ 2JA9A 1YBYA 5IYCH 3KOJA 1A0IA 2R93G 1VQ4A 4L5TA 4GLVB 3PO3G 2VQEL 1SN8A 1IL2A 2JEBI 5LMNQ 1HR0L 2R7DA 2NN6G 4RG1A 4DV7Q 3CW2C 3BU2A 4JI2Q 5GADC 1YJNA 4R4IA 2JEAI 2KBNA 4MTNA 4POGA 1X3FA 3S17H 1MKHA 3L0OA 2L15A 4C2MH 1J6QA 4JI3L 1I50H 2GVBA 5C4XH 5C44H 1KAWA 1Q8KA 4AYBG 4JI4L 4LF8L 2E5LQ 2PQAA 4YCVA 4YWKA 2YV5A 2UU9L 1IYJB 3OYYA 4A76A 1GO3E 1BKBA 1C9OA 1XJVA 1D7QA 3HKSA 4IPDA 1KRSA 3UE1A 2JA7H 1J5EL 5JJLA 1TWFH 3STBC 1K73C 4BXXG 5IP7G 1VQIA 2KHJA 4FDBA 1WI5A 3J80c 1JMCA 2ES2A 4LF6L 3GTGH 4LFBQ 3Q8DA 1N34Q 3FKIG 1WJJA 4P71A 2GN5A 5GAEC 4A3EG 1VQEA 1EQRA 5BR8L 2ZM6Q 4A3FH 4DR6Q 5M5WH 4DNIA 3HOWH 5GAGC 5M3FG 1X54A 3CCLA 4JI6L 4A3GG 2DGYA 4GN4B 3DLLA 4AH6A 2JQOA 2JA5G 2MO0A 4DR5L 3CF5A 3DM3A 3K81C 5M5XH 2R7FA 4HJ5A 4PG3A 3TEHB 2IY5B 3M7NA 1I5FA 3JAMi 4DUYQ 1PA6A 1KIXA 1S40A 3K0XA 4JG2A 3GTOH 2MNAA 4DR4Q 1VS0A 5IY0A 4IFDJ 3GTKH 2MQHA 5JEAJ 1YVCA 1NJIC 4X66Q 5C0XI 3HOYH 3H0GH 4IOAA 1YJWA 1NMFA 3F8TA 1N36L 2UXBQ 3BJUA 4DV4Q 4NXMQ 2D62A 3I4NH 1L1OB 1JJ2A 3S15H 2B3GA 3J81i 4LUZA 2D0PA 1E1OA 3CC4A 1VQ6A 4ALPA 3CC2A 2VS1A 2PI2A 4GOPA 4X64L 3PUVA 2I5LX 2AWOA 1E24A 3AFQA 1VQCA 5C0XG 4NXNL 1N9WA 4LF7L 4YCUA 1V43A 2ZTDA 3NBHB 3W1GA 3M85A 2EXDA 2ZTCA 3H3VH 2Y0SG 1B70B 4DV6L 1IBKL 4UP7A 4A3DG 2UXDL 2VZAA 4IJLA 3B6YA 4A3BH 2JJQA 3CCMA 1QZHA 4DR7Q 1LM0A 1O7IA 1SR3A 1KXLA 3T1HL 1A62A 4QJFA 4DV5L 1OXUA 1XTDA 5AJ3Q 1WOCA 1TWCH 1HNWQ 3L7ZC 2ID0A 2B63G 4IPCA 1KC8C 3STBD 2AMCB 3UDGA 3IRBA 2R93H 2UUBQ 3UDFA 2NZHA 4LF9L 2R7ZG 3KDFB 1X6OA 1GVPA 4B3SQ 3M3YH 3HOZG 4IJHA 3EIVA 4HIDA 5C3EG 1PH4A 2N8NA 3F1ZA 3EBEA 3JAMc 1VQGA 3CQZH 4ME3A 1EWIA 2PNHA 4OX9Q 4DV1Q 4GKJL 1Q82C 2F4VQ 2UUAL 4LUOA 2C35B 1SFOH 4IO9A 3CC7A 4LF5L 1PH5A 4B3RL 1HNXL 3U58A 2K5HA 3PF5A 1QVFA 5FJ8G 5IWAQ 2ZJQA 4NPSA 2JE6I 3RZOH 4DR3L 1K9MC 5M5YH 3S14H 4QIWE 2NVXH 3J81c 2JA6H 1TXYA 4AQYQ 1YITA 2HHHQ 2KHIA 5DLQE 4YCWA 5HGQA 4GLAC 4X65Q 4BXXH 4HJ8A 3EN2A 5IP7H 5ELNA 1XMOL 4R4TA 1VQLA 2B29A 1MIUA 1CKOA 1GKHA 3AEVA 1VQ9A 1X65A 4RMFA 5GQOA 2Q2UA 2KENA 4UP9A 1JJGA 4DV2Q 4EQ5A 1KL9A 2CWPA 3G4SA 4JI8L 3ICEA 3T1YQ 1BVSA 1L1OA 1UE1A 3GDEA 5M3FH 1IBMQ 4O2DA 4NB3A 2BH2A 2JA5H 3E0EA 1Q1BA 2WFWA 1KD1C 1KHIA 4PZ8A 3TRZA 4KHPQ 4C3HH 1Y1WH 4B3TQ 2QEXA 4AIMA 3HOUG 1YNXA 3PUWA 2IX1A 4TVAB 3I4MH 1GD7A 3U50C 2ATWA 4KLKA 3J81j 3OTOL 1VQ5A 3KJOA 1SMXA 4R4CA 5LMNW 3PSIA 2VQFQ 4JI7Q 1N32L 4LFAQ 2FXQA 3TS0A 2IT1A 1B7YB 2JK8A 1VQFA 4JI5Q 2CWAA 1UE6A 4LFCQ 2R92G 2EQSA 2Y0SE 5E7NA 1VQMA 1NE3A 3PUXA 1AE2A 2CKZB 3U4VA 5IYDG 1SRUA 3CPWA 1HNZL 4UP8A 4X6AH 4JV5L 4HJ7A 1BBWA 4JI1Q 1NBWA 1X3EA 4OWXB 4LNQA 4H02A 3ULJA 5LMUQ 2LXJA 3M4OH 1AH9A 3WWVA 4DR2Q 4BY7G 4YHHL 2HIXA 2LSSA 2RHQB 2LXKA 4K0KL 1W3SA 1X55A 1M90C 4JBJA 4JOIA 3CCVA 1X3GA 4A3CH 3GD7A 4QGUA 3KDFA 4R4OA 3G48A 5LMNL 2JA8G 1QZGA 1WFQA 1LTLA 3M4PA 2I5MX 4B3MQ 4DV7L 1Q46A 2WP8J 4JI2L 1XNQQ 4A3DH 2UXCQ 1HZ9A 1VQ7A 2AHOB 2D0OA 4A3IH 3HOXH 3ZJYC 5IP9G 1I94Q 3CMAA 2YTVA 4A3JG 4DV3Q 3S1RH 2E5LL 1VQPA 4GKKQ 2B63H 1PH1A 2VUMG 4GNXC 2Z6KA 4HJ9A 1QVGA 2N78A 1EUJA 1TWHH 4LW1A 1QUQB 4YY3Q 2R7ZH 4A3KG 3RLFA 5IT9c 2BA0A 4Y7NH 2RCNA 5C3EH 1L2FA 3A5UA 1YI2A 2ASBA 2NVTH 3JC66 1PHJA 3RN2A 3I56A 1XPOA 4JI0Q 1XNRQ 4A4IA 3RNUA 3W5OA 4LFBL 2E2JH 1PH6A 3PO2G 4MNOA 5IYBG 1N34L 1CSPA 3K80C 4P74A 3U4ZA 1G291 3CP0A 1SE8A 1XMQQ 1L0WA 2CQOA 3UDIA 1AE3A 2ZM6L 1E3PA 4DR6L 1ASYA 5C4XG 5FLMH 5C44G 3CCJA 2OCEA 1K3RA 3HFZB 1G51A 1KRTA 1K83H 3KYHC 4XIGS 2CFMA 3CCRA 1IBLQ 3BZCA 4Y52H 3S2DH 3HOVG 4DR1Q 3PF4A 2UUCQ 5C0XJ 1VQNA 1Q7YC 1MJCA 1VCIA 1E7ZA 1N33Q 1G6PA 4DUYL 1YHQA 4DR4L 4GN3B 1Y1VG 1P8LA 1CUKA 1K0RA 2NVYH 4L5RC 5FLXc 4AYBE 1QVCA 4X66L 4LF4Q 3UE0A 3D31A 4P75A 2UXBL 3KF8B 4X62Q 4DV4L 4NXML 3ERSX 3TREA 3PO3H 5JJIA 1PH9A 3CD6A 3AQQA 3G71A 4IPGA 2MFIA 3PIOA 1FJGQ 4GNXB 3RLNA 2K52A 3VDYA 5H1SE 4PZ6A 4DV0Q 4OWWB 3PUZA 1N8RC 4BY1G 4JBWA 4GOPC 4OO1I 1S3OA 1Q1EA 2NZOA 4DPGA 4OXPA 1Q81C 3GTLH 1EFWA 4BBSG 3F2DA 1PVOA 4JYAQ 1MJEA 1PV4A 3AYHB 2WAQG 3K8AA 2DUDA 2NVQH 3I2ZA 2HIVA 3HKZG 2HT1A 2V1CC 2R92H 3I7FA 3S24A 4DR7L 1VQAA 1OXSC 5JJKA 2VQEQ 5IYDH 1OXVA 2AKWB 1Z9FA 4POFA 1HR0Q 3KFUA 3S1QH 2RHSB 2YTYA 5AJ3L 1EYGA 1XPUA 1R9TH 1T9HA 3FKIH 1HJPA 1HNWL 4MZ9A 1JT8A 2IHFA 4KI0A 2VW9A 4A3EH 1QUQA 1PH3A 2UUBL 4KHZA 3G6EA 4JI3Q 2A8VA 3S1MH 3ER0A 2Z0SA 4B3SL 4JI4Q 2JA8H 1UEBA 3NENA 4LF8Q 4A3GH 2UU9Q 1YHBA 2GVAA 1JJCB 4WJ4A 3KLWA 1IXRA 1Z47A 1YEZA 3KJPA 4DV1L 1OTCA 4OX9L 4A3MG 2F4VL 4A3LG 1C0AA 3GTQH 4XTCS 1J5EQ 2Q2TA 2N49A 4DK6C 3J7ZC 4HIMA 5IP9H 1EOVA 1UE7A 3GTPH 4A3JH 2E8GA 3CCEA 4LF6Q 5IWAL 2HQLA 2VUMH 5M3MG 5J3BA 4DUZQ 1I6HH 1UE5A 4AQYL 4A3KH 2HHHL 4JC0A 4PMWA 4QY7A 1X9NA 1CKNB 2IX0A 4P72A 3RLOA 5BR8Q 4JBMA 4X65L 1V1QA 2OQ0A 1Y14B 4UY8C 4A93G 1EIFA 1C7YA 2PMZE 1WYDA 3MEFA 4JI6Q 4BA2I 3CCQA 5IYBH 3PO2H 4DR5Q 2VY3A 4LWCA 3ULLA 3PCOB 2Q2HA 2N3SA 4DV2L 1X56A 1VQHA 3PGZA 1SLJA 3T1YL 1L1OC 1S72A 1XPRA 2YYZA 1IBML 3J7A5 2IHEA 1WCMG 4HJAA 3F2CA 4GNXA 1FVIA 1TWAH 1N36Q 3HOVH 2F3IA 4KHPL 1NTGA 4B3TL 2JA6G 3I4OA 4P73A 3K7UC 4YWMA 1VQOA 1NMGA 2WB1G 1HH2P 5K36G 4PZ7A 4BBRG 4L5SA 3GTMH 4IFDI 2RF4A 3D0FA 1I3QH 1VQJA 1Y1VH 5GROA 4C3IH 1Q86C 3PUYA 4UPAA 4EX5A 1K8GA 1A8VA 2VQFL 4JI7L 3TS2A 4DUZL 1LYLA 3AFPA 4GS3A 4LFAL 2WAQE 3S2HH 4X64Q 3NEMA 4JI5L 3HKZE 3H15A 4LFCL 2A19A 5IYCG 2I0QA 1A63A 3HOZH 3E9IA 2BA1A 4NXNQ 4HIKA 4LF7Q 2VNUD 2OTJA 1U0LA 4QL5A 4JI1L 3K7AH 5LMUL 4DV6Q 1IBKQ 4BY1H 4IFDG 1NY4A 5JEAG 4DR2L 1Y1WG 2UXDQ 3I4MG 3E9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JOI C;  1OXT A;  4BBS H;  4OON A;  4OWT B;  4IOC A;  3T1H Q;  3BZK A;  4DV5 Q;  4YWL A;  2BH8 A;  3LGJ A;  5FJ8 H;  3W1B A;  2CCZ A;  5GAH C;  1FGU A;  3KF6 B;  2K5N A;  1E1T A;  4DK3 C;  3NEL A;  4B3M L;  1PH2 A;  1W2B A;  1XNQ L;  2UXC L;  3F2B A;  1JB7 A;  2K5V A;  4LF9 Q;  3M4Q A;  3CCS A;  2K50 A;  3TQY A;  1VQK A;  1U5K A;  2JA7 G;  4APV A;  2Q2I A;  4A75 A;  3GTJ H;  1YJ9 A;  1B8A A;  3MXN B;  4WJ3 M;  1E22 A;  2YTX A;  1I94 L;  2E2H H;  2YU9 H;  2K75 A;  3FP9 A;  4DV3 L;  1P16 A;  2ALY B;  3S1N H;  4GKK L;  2KCM A;  1PH7 A;  1FL0 A;  2Z6K C;  2VL6 A;  3I55 A;  2R6G A;  4GKJ Q;  1K8A C;  2ZTE A;  5HY6 A;  2UUA Q;  4YY3 L;  3M9B A;  4JCV E;  1UWV A;  1CSQ A;  3RZD H;  4LF5 Q;  1CKN A;  1TWG H;  4B3R Q;  1VQB A;  4A3C G;  4A3F G;  1HNX Q;  1JE5 A;  3PIP A;  3HOW G;  2PQA B;  4L5Q A;  1VQ8 A;  4BA1 I;  4DR3 Q;  4HIO A;  1H95 A;  1XNR L;  3RN5 A;  1SRO A;  4R1J A;  1EQQ A;  3CPF A;  1GM5 A;  4JI0 L;  3HOU H;  4TQU S;  4A3L H;  4C3J H;  4A3M H;  1XMQ L;  4A3I G;  1HZC A;  1YIJ A;  4J15 A;  2F52 A;  1ASZ A;  3FHW A;  1VQD A;  1XMO Q;  1OXX K;  3HOX G;  5M3M H;  1IBL L;  4IPH A;  2ZJP A;  4QQB X;  2AWN A;  3HOY G;  1HZB A;  2QGQ A;  1BBU A;  3GO5 A;  3H0G G;  5ELO A;  3A0J A;  4DAM A;  3CXC A;  1PFS A;  3UDX A;  4DR1 L;  1RL2 A;  4GN5 A;  4JI8 Q;  2UUC L;  5IE8 A;  3OW2 A;  4A93 H;  1CKM A;  3I4N G;  1N33 L;  3H3V I;  1IZ6 A;  2WB1 E;  4LUV A;  3SGI A;  4JBK A;  2A1A A;  2EIF A;  4DKA C;  4OO1 G;  3CME A;  2I5H A;  4LF4 L;  4BY7 H;  2K14 A;  2ZJR A;  2QA4 A;  3CAM A;  5EAY A;  1V9P A;  3RR5 A;  1Q12 A;  4X62 L;  3ULP A;  3OTO Q;  3J80 i;  5C4J H;  2XTI A;  1PYB A;  2OWO A;  5FLM G;  1D8L A;  1WCM H;  1HR0 W;  1DGS A;  3A5Z B;  1FJG L;  2KCT A;  1N32 Q;  1LUZ A;  1YHA A;  2H5X A;  4DV0 L;  2OQK A;  1RIP A;  3CCU A;  1HZA A;  4GLX A;  2NN6 I;  1PH8 A;  1KQS A;  1YZ6 A;  2K4K A;  3S16 H;  4R4Q A;  4BBR H;  1M1K C;  2PI2 E;  3A74 A;  4A3B G;  2E2I H;  4O0A A;  1HNZ Q;  4JYA L;  2XGT A;  4JV5 Q;  3PV0 A;  4DAY B;  3KF6 A;  1EIY B;  1PYS B;  3L2P A;  2MO1 A;  2OTL A;  4GOP B;  4YHH Q;  4K0K Q;  2JA9 A;  1YBY A;  5IYC H;  3KOJ A;  1A0I A;  2R93 G;  1VQ4 A;  4L5T A;  4GLV B;  3PO3 G;  2VQE L;  1SN8 A;  1IL2 A;  2JEB I;  5LMN Q;  1HR0 L;  2R7D A;  2NN6 G;  4RG1 A;  4DV7 Q;  3CW2 C;  3BU2 A;  4JI2 Q;  5GAD C;  1YJN A;  4R4I A;  2JEA I;  2KBN A;  4MTN A;  4POG A;  1X3F A;  3S17 H;  1MKH A;  3L0O A;  2L15 A;  4C2M H;  1J6Q A;  4JI3 L;  1I50 H;  2GVB A;  5C4X H;  5C44 H;  1KAW A;  1Q8K A;  4AYB G;  4JI4 L;  4LF8 L;  2E5L Q;  2PQA A;  4YCV A;  4YWK A;  2YV5 A;  2UU9 L;  1IYJ B;  3OYY A;  4A76 A;  1GO3 E;  1BKB A;  1C9O A;  1XJV A;  1D7Q A;  3HKS A;  4IPD A;  1KRS A;  3UE1 A;  2JA7 H;  1J5E L;  5JJL A;  1TWF H;  3STB C;  1K73 C;  4BXX G;  5IP7 G;  1VQI A;  2KHJ A;  4FDB A;  1WI5 A;  3J80 c;  1JMC A;  2ES2 A;  4LF6 L;  3GTG H;  4LFB Q;  3Q8D A;  1N34 Q;  3FKI G;  1WJJ A;  4P71 A;  2GN5 A;  5GAE C;  4A3E G;  1VQE A;  1EQR A;  5BR8 L;  2ZM6 Q;  4A3F H;  4DR6 Q;  5M5W H;  4DNI A;  3HOW H;  5GAG C;  5M3F G;  1X54 A;  3CCL A;  4JI6 L;  4A3G G;  2DGY A;  4GN4 B;  3DLL A;  4AH6 A;  2JQO A;  2JA5 G;  2MO0 A;  4DR5 L;  3CF5 A;  3DM3 A;  3K81 C;  5M5X H;  2R7F A;  4HJ5 A;  4PG3 A;  3TEH B;  2IY5 B;  3M7N A;  1I5F A;  3JAM i;  4DUY Q;  1PA6 A;  1KIX A;  1S40 A;  3K0X A;  4JG2 A;  3GTO H;  2MNA A;  4DR4 Q;  1VS0 A;  5IY0 A;  4IFD J;  3GTK H;  2MQH A;  5JEA J;  1YVC A;  1NJI C;  4X66 Q;  5C0X I;  3HOY H;  3H0G H;  4IOA A;  1YJW A;  1NMF A;  3F8T A;  1N36 L;  2UXB Q;  3BJU A;  4DV4 Q;  4NXM Q;  2D62 A;  3I4N H;  1L1O B;  1JJ2 A;  3S15 H;  2B3G A;  3J81 i;  4LUZ A;  2D0P A;  1E1O A;  3CC4 A;  1VQ6 A;  4ALP A;  3CC2 A;  2VS1 A;  2PI2 A;  4GOP A;  4X64 L;  3PUV A;  2I5L X;  2AWO A;  1E24 A;  3AFQ A;  1VQC A;  5C0X G;  4NXN L;  1N9W A;  4LF7 L;  4YCU A;  1V43 A;  2ZTD A;  3NBH B;  3W1G A;  3M85 A;  2EXD A;  2ZTC A;  3H3V H;  2Y0S G;  1B70 B;  4DV6 L;  1IBK L;  4UP7 A;  4A3D G;  2UXD L;  2VZA A;  4IJL A;  3B6Y A;  4A3B H;  2JJQ A;  3CCM A;  1QZH A;  4DR7 Q;  1LM0 A;  1O7I A;  1SR3 A;  1KXL A;  3T1H L;  1A62 A;  4QJF A;  4DV5 L;  1OXU A;  1XTD A;  5AJ3 Q;  1WOC A;  1TWC H;  1HNW Q;  3L7Z C;  2ID0 A;  2B63 G;  4IPC A;  1KC8 C;  3STB D;  2AMC B;  3UDG A;  3IRB A;  2R93 H;  2UUB Q;  3UDF A;  2NZH A;  4LF9 L;  2R7Z G;  3KDF B;  1X6O A;  1GVP A;  4B3S Q;  3M3Y H;  3HOZ G;  4IJH A;  3EIV A;  4HID A;  5C3E G;  1PH4 A;  2N8N A;  3F1Z A;  3EBE A;  3JAM c;  1VQG A;  3CQZ H;  4ME3 A;  1EWI A;  2PNH A;  4OX9 Q;  4DV1 Q;  4GKJ L;  1Q82 C;  2F4V Q;  2UUA L;  4LUO A;  2C35 B;  1SFO H;  4IO9 A;  3CC7 A;  4LF5 L;  1PH5 A;  4B3R L;  1HNX L;  3U58 A;  2K5H A;  3PF5 A;  1QVF A;  5FJ8 G;  5IWA Q;  2ZJQ A;  4NPS A;  2JE6 I;  3RZO H;  4DR3 L;  1K9M C;  5M5Y H;  3S14 H;  4QIW E;  2NVX H;  3J81 c;  2JA6 H;  1TXY A;  4AQY Q;  1YIT A;  2HHH Q;  2KHI A;  5DLQ E;  4YCW A;  5HGQ A;  4GLA C;  4X65 Q;  4BXX H;  4HJ8 A;  3EN2 A;  5IP7 H;  5ELN A;  1XMO L;  4R4T A;  1VQL A;  2B29 A;  1MIU A;  1CKO A;  1GKH A;  3AEV A;  1VQ9 A;  1X65 A;  4RMF A;  5GQO A;  2Q2U A;  2KEN A;  4UP9 A;  1JJG A;  4DV2 Q;  4EQ5 A;  1KL9 A;  2CWP A;  3G4S A;  4JI8 L;  3ICE A;  3T1Y Q;  1BVS A;  1L1O A;  1UE1 A;  3GDE A;  5M3F H;  1IBM Q;  4O2D A;  4NB3 A;  2BH2 A;  2JA5 H;  3E0E A;  1Q1B A;  2WFW A;  1KD1 C;  1KHI A;  4PZ8 A;  3TRZ A;  4KHP Q;  4C3H H;  1Y1W H;  4B3T Q;  2QEX A;  4AIM A;  3HOU G;  1YNX A;  3PUW A;  2IX1 A;  4TVA B;  3I4M H;  1GD7 A;  3U50 C;  2ATW A;  4KLK A;  3J81 j;  3OTO L;  1VQ5 A;  3KJO A;  1SMX A;  4R4C A;  5LMN W;  3PSI A;  2VQF Q;  4JI7 Q;  1N32 L;  4LFA Q;  2FXQ A;  3TS0 A;  2IT1 A;  1B7Y B;  2JK8 A;  1VQF A;  4JI5 Q;  2CWA A;  1UE6 A;  4LFC Q;  2R92 G;  2EQS A;  2Y0S E;  5E7N A;  1VQM A;  1NE3 A;  3PUX A;  1AE2 A;  2CKZ B;  3U4V A;  5IYD G;  1SRU A;  3CPW A;  1HNZ L;  4UP8 A;  4X6A H;  4JV5 L;  4HJ7 A;  1BBW A;  4JI1 Q;  1NBW A;  1X3E A;  4OWX B;  4LNQ A;  4H02 A;  3ULJ A;  5LMU Q;  2LXJ A;  3M4O H;  1AH9 A;  3WWV A;  4DR2 Q;  4BY7 G;  4YHH L;  2HIX A;  2LSS A;  2RHQ B;  2LXK A;  4K0K L;  1W3S A;  1X55 A;  1M90 C;  4JBJ A;  4JOI A;  3CCV A;  1X3G A;  4A3C H;  3GD7 A;  4QGU A;  3KDF A;  4R4O A;  3G48 A;  5LMN L;  2JA8 G;  1QZG A;  1WFQ A;  1LTL A;  3M4P A;  2I5M X;  4B3M Q;  4DV7 L;  1Q46 A;  2WP8 J;  4JI2 L;  1XNQ Q;  4A3D H;  2UXC Q;  1HZ9 A;  1VQ7 A;  2AHO B;  2D0O A;  4A3I H;  3HOX H;  3ZJY C;  5IP9 G;  1I94 Q;  3CMA A;  2YTV A;  4A3J G;  4DV3 Q;  3S1R H;  2E5L L;  1VQP A;  4GKK Q;  2B63 H;  1PH1 A;  2VUM G;  4GNX C;  2Z6K A;  4HJ9 A;  1QVG A;  2N78 A;  1EUJ A;  1TWH H;  4LW1 A;  1QUQ B;  4YY3 Q;  2R7Z H;  4A3K G;  3RLF A;  5IT9 c;  2BA0 A;  4Y7N H;  2RCN A;  5C3E H;  1L2F A;  3A5U A;  1YI2 A;  2ASB A;  2NVT H;  3JC6 6;  1PHJ A;  3RN2 A;  3I56 A;  1XPO A;  4JI0 Q;  1XNR Q;  4A4I A;  3RNU A;  3W5O A;  4LFB L;  2E2J H;  1PH6 A;  3PO2 G;  4MNO A;  5IYB G;  1N34 L;  1CSP A;  3K80 C;  4P74 A;  3U4Z A;  1G29 1;  3CP0 A;  1SE8 A;  1XMQ Q;  1L0W A;  2CQO A;  3UDI A;  1AE3 A;  2ZM6 L;  1E3P A;  4DR6 L;  1ASY A;  5C4X G;  5FLM H;  5C44 G;  3CCJ A;  2OCE A;  1K3R A;  3HFZ B;  1G51 A;  1KRT A;  1K83 H;  3KYH C;  4XIG S;  2CFM A;  3CCR A;  1IBL Q;  3BZC A;  4Y52 H;  3S2D H;  3HOV G;  4DR1 Q;  3PF4 A;  2UUC Q;  5C0X J;  1VQN A;  1Q7Y C;  1MJC A;  1VCI A;  1E7Z A;  1N33 Q;  1G6P A;  4DUY L;  1YHQ A;  4DR4 L;  4GN3 B;  1Y1V G;  1P8L A;  1CUK A;  1K0R A;  2NVY H;  4L5R C;  5FLX c;  4AYB E;  1QVC A;  4X66 L;  4LF4 Q;  3UE0 A;  3D31 A;  4P75 A;  2UXB L;  3KF8 B;  4X62 Q;  4DV4 L;  4NXM L;  3ERS X;  3TRE A;  3PO3 H;  5JJI A;  1PH9 A;  3CD6 A;  3AQQ A;  3G71 A;  4IPG A;  2MFI A;  3PIO A;  1FJG Q;  4GNX B;  3RLN A;  2K52 A;  3VDY A;  5H1S E;  4PZ6 A;  4DV0 Q;  4OWW B;  3PUZ A;  1N8R C;  4BY1 G;  4JBW A;  4GOP C;  4OO1 I;  1S3O A;  1Q1E A;  2NZO A;  4DPG A;  4OXP A;  1Q81 C;  3GTL H;  1EFW A;  4BBS G;  3F2D A;  1PVO A;  4JYA Q;  1MJE A;  1PV4 A;  3AYH B;  2WAQ G;  3K8A A;  2DUD A;  2NVQ H;  3I2Z A;  2HIV A;  3HKZ G;  2HT1 A;  2V1C C;  2R92 H;  3I7F A;  3S24 A;  4DR7 L;  1VQA A;  1OXS C;  5JJK A;  2VQE Q;  5IYD H;  1OXV A;  2AKW B;  1Z9F A;  4POF A;  1HR0 Q;  3KFU A;  3S1Q H;  2RHS B;  2YTY A;  5AJ3 L;  1EYG A;  1XPU A;  1R9T H;  1T9H A;  3FKI H;  1HJP A;  1HNW L;  4MZ9 A;  1JT8 A;  2IHF A;  4KI0 A;  2VW9 A;  4A3E H;  1QUQ A;  1PH3 A;  2UUB L;  4KHZ A;  3G6E A;  4JI3 Q;  2A8V A;  3S1M H;  3ER0 A;  2Z0S A;  4B3S L;  4JI4 Q;  2JA8 H;  1UEB A;  3NEN A;  4LF8 Q;  4A3G H;  2UU9 Q;  1YHB A;  2GVA A;  1JJC B;  4WJ4 A;  3KLW A;  1IXR A;  1Z47 A;  1YEZ A;  3KJP A;  4DV1 L;  1OTC A;  4OX9 L;  4A3M G;  2F4V L;  4A3L G;  1C0A A;  3GTQ H;  4XTC S;  1J5E Q;  2Q2T A;  2N49 A;  4DK6 C;  3J7Z C;  4HIM A;  5IP9 H;  1EOV A;  1UE7 A;  3GTP H;  4A3J H;  2E8G A;  3CCE A;  4LF6 Q;  5IWA L;  2HQL A;  2VUM H;  5M3M G;  5J3B A;  4DUZ Q;  1I6H H;  1UE5 A;  4AQY L;  4A3K H;  2HHH L;  4JC0 A;  4PMW A;  4QY7 A;  1X9N A;  1CKN B;  2IX0 A;  4P72 A;  3RLO A;  5BR8 Q;  4JBM A;  4X65 L;  1V1Q A;  2OQ0 A;  1Y14 B;  4UY8 C;  4A93 G;  1EIF A;  1C7Y A;  2PMZ E;  1WYD A;  3MEF A;  4JI6 Q;  4BA2 I;  3CCQ A;  5IYB H;  3PO2 H;  4DR5 Q;  2VY3 A;  4LWC A;  3ULL A;  3PCO B;  2Q2H A;  2N3S A;  4DV2 L;  1X56 A;  1VQH A;  3PGZ A;  1SLJ A;  3T1Y L;  1L1O C;  1S72 A;  1XPR A;  2YYZ A;  1IBM L;  3J7A 5;  2IHE A;  1WCM G;  4HJA A;  3F2C A;  4GNX A;  1FVI A;  1TWA H;  1N36 Q;  3HOV H;  2F3I A;  4KHP L;  1NTG A;  4B3T L;  2JA6 G;  3I4O A;  4P73 A;  3K7U C;  4YWM A;  1VQO A;  1NMG A;  2WB1 G;  1HH2 P;  5K36 G;  4PZ7 A;  4BBR G;  4L5S A;  3GTM H;  4IFD I;  2RF4 A;  3D0F A;  1I3Q H;  1VQJ A;  1Y1V H;  5GRO A;  4C3I H;  1Q86 C;  3PUY A;  4UPA A;  4EX5 A;  1K8G A;  1A8V A;  2VQF L;  4JI7 L;  3TS2 A;  4DUZ L;  1LYL A;  3AFP A;  4GS3 A;  4LFA L;  2WAQ E;  3S2H H;  4X64 Q;  3NEM A;  4JI5 L;  3HKZ E;  3H15 A;  4LFC L;  2A19 A;  5IYC G;  2I0Q A;  1A63 A;  3HOZ H;  3E9I A;  2BA1 A;  4NXN Q;  4HIK A;  4LF7 Q;  2VNU D;  2OTJ A;  1U0L A;  4QL5 A;  4JI1 L;  3K7A H;  5LMU L;  4DV6 Q;  1IBK Q;  4BY1 H;  4IFD G;  1NY4 A;  5JEA G;  4DR2 L;  1Y1W G;  2UXD Q;  3I4M G;  3E9H A; 
#chains in the Genus database with same CATH topology
 3N6R A;  4BS9 A;  4JOI C;  2B2W C;  5CV4 A;  4OON A;  2BH8 A;  3K57 A;  5GAH C;  1EFI D;  2MGS A;  2KED A;  4DK3 C;  1VF5 C;  1JB7 A;  1EU3 A;  3RZD B;  3Q22 A;  2D5D A;  1LTG D;  2KVM A;  1I94 L;  2YU9 H;  2K75 A;  4DV3 L;  1V8Q A;  1FNU A;  1FL0 A;  3I55 A;  4B9X A;  4A3M B;  1RF2 D;  4JCV E;  1EOT A;  1TWG H;  5CYU A;  4A3C G;  1G2S A;  2PQA B;  2L1B A;  1SRO A;  4TSS A;  3HOU H;  4HAE A;  1V1O A;  1PFB A;  3FHW A;  3M3Y B;  3HOX G;  4ID6 A;  5AFW A;  4R8N A;  3SK4 A;  2ZJP A;  2AWN A;  5E4W C;  3A0J A;  1RL2 A;  4GN5 A;  5IE8 A;  3I4N G;  4EQN A;  1TR5 A;  2VB3 X;  5EKK A;  1C4Q A;  2EE1 A;  2A1A A;  1RHP A;  2EIF A;  2HD3 A;  4DKA C;  1WCM B;  2B2U C;  4Q0F A;  4MN3 A;  3SK8 A;  2JA6 B;  3PQI A;  3RD4 A;  3RR5 A;  4X62 L;  4BBR B;  3OTO Q;  1GUT A;  1IYV A;  2XTI A;  1HR0 W;  1DJR D;  3A5Z B;  1MSG A;  1FJG L;  2KCT A;  2LMC B;  1RIP A;  3CCU A;  1HZA A;  1PH8 A;  1KQS A;  3S16 H;  4EQO A;  1H9S B;  2BDO A;  2E2I H;  4O0A A;  2XGT A;  1EEI D;  5KYL A;  3KF6 A;  5JVG 3;  2LFN A;  2VB2 X;  4GOP B;  4RGN A;  1Y1W B;  1YBY A;  3I4M B;  3KOJ A;  1A0I A;  4L5T A;  4GLV B;  4EGV A;  2VQE L;  4N9T A;  1SMY C;  2R7D A;  2BCO A;  3CW2 C;  3BU2 A;  4JI2 Q;  2JEA I;  1PRT C;  1EEF D;  1LT4 D;  1J6Q A;  4JI3 L;  2C9O A;  3K0Y A;  2E5L Q;  2YV5 A;  4XDX A;  3M4O B;  4IN3 A;  3GTG B;  5EKL A;  5IGD A;  5CC4 A;  4N9P A;  1EYD A;  1TWF H;  1K73 C;  1NCV A;  1BQQ T;  4BXX G;  1B3Q A;  3HOW B;  4FDB A;  1JMC A;  2ES2 A;  2EOT A;  5DM6 3;  4NP5 A;  2Y0S B;  1N34 Q;  2Q8I B;  3C46 A;  1XWE A;  5BR8 L;  2ZM6 Q;  4DNI A;  5C3X A;  5M3F G;  2XRS D;  4TRD A;  4HR7 B;  3A56 A;  1SBB B;  3S1R B;  2JA5 G;  2JQO A;  2XIW A;  2MO0 A;  3CF5 A;  1TWH B;  1F2Y A;  4OIK A;  4PG3 A;  1B50 A;  4DUY Q;  1PA6 A;  4DR4 Q;  4JG2 A;  1VS0 A;  5C3E B;  5DEH A;  1YVC A;  4FF3 A;  3P75 A;  3NTI A;  3KUP A;  1H9R A;  1VMP A;  3OWE B;  4IOA A;  1I4X A;  3F8T A;  4FVM A;  3SHL A;  1PMR A;  1L1O B;  3I4N H;  2G9D A;  1JJ2 A;  2F0W A;  2RCF A;  3J81 i;  2NTS A;  1A15 A;  3CC4 A;  2D0P A;  3J7Y W;  3FVQ A;  1ILQ A;  2EY6 A;  2K04 A;  4X64 L;  1FYC A;  3PUV A;  5COR A;  3MFG A;  4CDC C;  4NXN L;  4LF7 L;  1GUS A;  3F2U A;  2XVS A;  2ZTD A;  4DNR B;  4I7A A;  2EXD A;  5FO8 B;  1IBK L;  3H3V H;  2NYZ D;  3QO2 A;  4UP7 A;  4A3D G;  3B6Y A;  1QZH A;  2PCF B;  2B2T C;  1KXL A;  3EVQ A;  5FKA C;  3TDQ A;  4UHV A;  4DN4 M;  1WOC A;  1DON A;  4CKE A;  2CH4 A;  4CBV A;  2B63 G;  1KC8 C;  3STB D;  2AMC B;  2O5J C;  4PV1 C;  3KDF B;  3NWS A;  1GVP A;  2O4X A;  1SYC A;  2RBM A;  2EJM A;  3F1Z A;  3OIP A;  3Q24 A;  1EWI A;  1LT3 D;  3S14 B;  3IKJ A;  4IZ8 A;  4GKJ L;  5M5Y B;  2K32 A;  5IGC A;  1PH5 A;  1IL8 A;  2K5H A;  3H09 A;  3RZO H;  1KNA A;  4B9W A;  1YNN D;  3FKI B;  4XYO A;  3J81 c;  5DLQ E;  2MUY A;  4A3E B;  1STG A;  4X65 Q;  4BXX H;  5C5L A;  4IUR A;  1H9K A;  4QIW B;  4A3G B;  1GKH A;  3BDL A;  1X65 A;  4RMF A;  2Q2U A;  2KEN A;  4UP9 A;  1AW7 A;  4C3H B;  4OGQ C;  3GTQ B;  1JCK B;  4IUT A;  2FFK B;  1UE1 A;  5M3F H;  2BH2 A;  2EYM A;  2JA5 H;  1KHI A;  2E75 C;  5JAV A;  2K7V A;  3P20 A;  4H44 C;  4KLK A;  3O13 A;  2VQF Q;  1AN8 A;  3VR6 A;  3NBH A;  2NBF A;  1VQF A;  4RAU C;  4JI5 Q;  2CWA A;  3HS0 C;  1C48 A;  2Y0S E;  5E7N A;  1AE2 A;  1EY0 A;  5IYD G;  5CMD A;  1SRU A;  5DM7 3;  3RMH A;  4HJ7 A;  2F0I A;  1NBW A;  1X3E A;  2AUJ D;  5LMU Q;  2LXJ A;  1K28 A;  3J81 E;  3HRZ C;  4K0K L;  4JBJ A;  1B1Z A;  4QGU A;  4ZKC B;  2EZV A;  3M4P A;  1JOR A;  2WP8 J;  4A3D H;  3E6Z X;  1VQ7 A;  4U68 A;  3EQL C;  4KHV A;  1ET6 A;  1STA A;  1I94 Q;  3CMA A;  4DV3 Q;  5CR3 A;  2B63 H;  1PH1 A;  2EJG C;  4LW1 A;  3RLF A;  2SEB D;  1H9S A;  1GUN A;  1JQY D;  3W5O A;  4HED A;  2CW0 D;  3D6C A;  3K80 C;  1Y8N B;  1SE8 A;  3J81 L;  1A3V A;  2HDL A;  5IOC A;  4DR6 L;  5FLM H;  1STN A;  5D3D A;  3GTJ B;  1SJE D;  1KRT A;  3KYH C;  2CFM A;  2JSO A;  1MHW C;  2K28 A;  3HOV G;  3PF4 A;  1E2Z A;  3T13 A;  1VCI A;  1E7Z A;  4ABN A;  1G6P A;  3FPU B;  1P8L A;  4L5R C;  5FLX c;  4X66 L;  2MHV A;  4CDE C;  2A6H D;  4FO2 A;  4F7X A;  4X62 Q;  2XNA C;  3PO3 H;  1QOH A;  3H91 A;  3GTL B;  1FJG Q;  3RLN A;  2K52 A;  2LY7 A;  3SE0 A;  4N8F A;  1JC7 A;  3W2D A;  2NB0 A;  1PDQ A;  2RDF A;  4JBW A;  5K5P A;  3TP6 A;  4GOP C;  1GXD C;  5C3W A;  4DPG A;  4OXP A;  1Q81 C;  4BBS G;  1DCZ A;  1STB A;  3G7L A;  3S1Q B;  3AYH B;  2WAQ G;  3D3R A;  3A8J E;  1UEA B;  2DUD A;  1CHQ D;  3IFT A;  1SE2 A;  1QCB D;  1VQA A;  5JJK A;  2VQE Q;  1PTO B;  2HQE A;  5IYD H;  1OXV A;  2JA8 B;  2RHS B;  2YTY A;  5AJ3 L;  1R9T H;  2D9U A;  3A8I E;  1B2T A;  3G6E A;  4JI3 Q;  2AUK A;  3FPP A;  5TSS A;  1BCP F;  4KTA A;  5KRU A;  4A3J B;  1T5E A;  2NTT A;  1YHB A;  2GVA A;  3OPO A;  5JPM C;  4WJ4 A;  1DOM A;  3NQI A;  1QB5 D;  4DA2 A;  1I6H B;  4OX9 L;  1OTC A;  1ZEQ X;  4A3L G;  1ONL A;  2LKV A;  1KLG D;  4A3M G;  2F4V L;  1U4L A;  4XTC S;  1TVX A;  2E8G A;  2HQL A;  2Z4H A;  5M3M G;  3HG9 A;  5A35 A;  3PO2 B;  4CJ0 B;  4AQY L;  2HHH L;  1XYI A;  5BR8 Q;  4P72 A;  4JBM A;  5I2X A;  1V1Q A;  5E3F A;  1I50 B;  4OL7 A;  5C44 B;  5C4X B;  3K6O A;  3DWA A;  3CCQ A;  3ULL A;  2E2D C;  5T1I A;  1X56 A;  3T1Y L;  1L1O C;  1XPR A;  4C3I B;  2EYL A;  3J7A 5;  1WCM G;  4GNX A;  1R4P B;  1F2M A;  1TWA H;  3HOV H;  2F3I A;  2HUG A;  5FLX L;  4ME5 A;  4B3T L;  2JA6 G;  3I4O A;  3S2H B;  4YWM A;  1VQO A;  1S5D D;  4PZ7 A;  4BBR G;  4L5S A;  5M5W B;  1YNJ D;  1NR4 A;  4EX5 A;  4UPA A;  1MSH A;  2C5C A;  4IQZ A;  2K6A A;  4JK1 C;  4MHE A;  2L4N A;  1D2B A;  4X64 Q;  3NEM A;  3H15 A;  4LFC L;  5IYC G;  1A63 A;  2QCP X;  3E9I A;  1O7Y A;  4NXN Q;  1BCP D;  4LF7 Q;  1CI3 M;  4IUU A;  3K7A H;  1W6J A;  1GHJ A;  1IBK Q;  4DK1 A;  4IFD G;  5JEA G;  1A3T A;  1EU4 A;  1Y1W G;  4O42 A;  3I4M G;  4IUQ A;  4BBS H;  4IOC A;  4X3T A;  4ZK9 B;  3W1B A;  1FGU A;  3KF6 B;  3M4Y A;  1MGS A;  3OOC A;  1PH2 A;  4PMB A;  2K5V A;  3M4Q A;  3SK5 A;  4CKB A;  3TQY A;  4J8Q A;  4RCO A;  4APV A;  1ZYR D;  4G57 A;  4WJ3 M;  5FO9 B;  1E22 A;  2YTX A;  3QWN A;  2ALY B;  3QG1 A;  1PH7 A;  4GKJ Q;  2VL6 A;  5DNF A;  5D3I B;  1DOK A;  4C3J B;  1UWV A;  2WIN B;  3RZD H;  2IL8 A;  1VQB A;  1B3A A;  5KND A;  1TKW B;  1VDZ A;  3HOW G;  4BA1 I;  3RN5 A;  2PQE A;  4R1J A;  1EQQ A;  3CPF A;  4JI0 L;  4K8J A;  2RDG A;  4A3L H;  3CHB D;  4A3M H;  1BXT A;  1TS3 A;  3C1E A;  5G3L F;  5D65 A;  4J15 A;  2F52 A;  3K5L A;  1ASZ A;  1OXX K;  4M8A A;  4LAA A;  1LLR D;  5I2Y A;  5M3M H;  2A6E D;  1ET9 A;  5EBD A;  4I65 A;  2DY8 A;  2F0V A;  2B2V A;  3HOY G;  1HZB A;  1IL2 A;  5ELO A;  3A54 A;  4G4K A;  3OW2 A;  5EPL A;  3PIP 3;  5C4J B;  1SAP A;  2WB1 E;  1STY A;  2PO4 A;  4BY7 H;  2K14 A;  1NR2 A;  2ZJR A;  2QA4 A;  1V9P A;  1F2L A;  3J80 i;  1PYB A;  3BZD B;  3QOL A;  1WCM H;  3I70 A;  2H5X A;  4DV0 L;  3NWT A;  1YZ6 A;  3ERO A;  4BBR H;  1M1K C;  1CT1 D;  1HQM C;  3A74 A;  1DD2 A;  4JYA L;  4UDU C;  2MO1 A;  1RJT A;  2G9H D;  4K0K Q;  5IYC H;  5CV8 A;  1VQ4 A;  2R3Z A;  2TMP A;  3E0J A;  1EQT A;  3DWP A;  4LJZ C;  4RFB A;  4IFD H;  1YJN A;  4MTN A;  4FNF A;  1HA5 A;  4POG A;  3S17 H;  4C2M H;  5G3L D;  3QIA A;  1KAW A;  1TT2 A;  4JI4 L;  4L8J A;  4LF8 L;  1BCP B;  4YWK A;  1DXM A;  2NWG A;  3BYT B;  2PYK A;  1BKB A;  1XJV A;  3HKS A;  4PMC A;  4IPD A;  1Y8P B;  2A68 D;  3UE1 A;  5JJL A;  3STB C;  4A3F B;  2F1M A;  2KHJ A;  1WI5 A;  3J80 c;  4LF6 L;  3GTG H;  3Q8D A;  3FKI G;  1E2W A;  1WJJ A;  4A3E G;  4A3I B;  1HFN A;  4DR6 Q;  1IYU A;  2F0K A;  3HOW H;  5GAG C;  1K0S A;  2EPB A;  1LT6 D;  1X54 A;  1JE4 A;  4A3G G;  4GN4 B;  5CGK A;  3BDO A;  4C3H G;  1SSO A;  2R7F A;  2IWH A;  3TEH B;  1YNN C;  3NBI A;  1KIX A;  4IFD J;  3GTK H;  2NVT B;  4I7Z C;  5JEA J;  1I4H A;  1NJI C;  4ILW A;  1EZ8 A;  1HPC A;  4X66 Q;  5C0X I;  2BE5 D;  3HOY H;  2E2J B;  1NMF A;  3SXH A;  3R2I A;  2J7Z A;  3S15 H;  4KN7 C;  3KLR A;  1K83 B;  1E1O A;  4DAY A;  4ALP A;  2F0F A;  3A55 A;  1LTT D;  1GUG A;  2AWO A;  2E74 C;  1E24 A;  3AFQ A;  4NW2 A;  5IIF A;  1JWM D;  1N9W A;  3ERQ A;  4YCU A;  3J80 E;  3NBH B;  3ND8 A;  1DOL A;  1B70 B;  2KA7 A;  3KLS A;  2KEC A;  2QDL A;  2UXD L;  1J8I A;  4IJL A;  2R93 B;  1O7I A;  2B8G A;  5KGU A;  3T1H L;  4Z9C B;  1OXU A;  5AJ3 Q;  2EDG A;  1TWC H;  1PZI D;  3IRB A;  1KDA A;  2R7Z G;  1JB3 A;  4PQX A;  4HID A;  3EBE A;  1QNK A;  5M9O A;  2NVQ B;  4OX9 Q;  1B4O A;  1Q82 C;  2F4V Q;  2R92 B;  2UUA L;  2C35 B;  1SFO H;  4LF5 L;  3CC7 A;  4K2L A;  4B3R L;  1HNX L;  5FJ8 G;  4DR3 L;  3LX0 A;  5M5Y H;  3J80 L;  3S14 H;  2NVX H;  5I9O A;  4AQY Q;  4XQQ A;  3MAQ A;  2HHH Q;  2KHI A;  3VR4 A;  2Z9H A;  5A2Q E;  4L6T B;  5CV6 A;  5ELN A;  3V96 A;  5F2D A;  5KIX A;  1MIU A;  3I91 A;  2EY5 A;  5GQO A;  2B8F A;  3C2P A;  3MEH A;  2CW0 C;  3T1Y Q;  5I4D A;  2A69 D;  1SEB D;  2WFW A;  3BVZ A;  4C3H H;  3I90 A;  4B3T Q;  2M9V A;  2QEX A;  4A3K B;  3U50 C;  1SMX A;  1D5X C;  2EJF C;  4YIJ A;  2J0T D;  2JK8 A;  3I3C A;  2K5W A;  4LFC Q;  2AQ1 B;  2A6H C;  5A2Q L;  3Q0A A;  1NE3 A;  2K33 A;  1NNX A;  4UP8 A;  1BBW A;  3TSS A;  3WWV A;  3VA5 A;  2LSS A;  2RHQ B;  1RD9 D;  1M90 C;  4KJN A;  2PMZ B;  1X3G A;  3CCV A;  4A3C H;  3G48 A;  5LMN L;  2PPB C;  3IAY A;  2B2Y A;  2JA8 G;  1STH A;  4ZUJ A;  3FEW X;  2QIL A;  1Q46 A;  1TQO A;  1BUV T;  1HZ9 A;  1WTH A;  1SYG A;  3HOX H;  3HOZ B;  2YTV A;  3EFX D;  4A3J G;  2Z6K A;  1QVG A;  2N78 A;  4CJ1 B;  3VR5 A;  1CK1 A;  2R7Z H;  5IT9 c;  3ITP A;  4RGT A;  1L2F A;  3BS1 A;  3A5U A;  5BN3 A;  2ASB A;  1PHJ A;  3I56 A;  4JI0 Q;  4A4I A;  3K58 A;  3RNU A;  3PO2 G;  5IYB G;  1CSP A;  3Q23 A;  3U4Z A;  1G29 1;  3G6J B;  2EXZ A;  3UDI A;  1AE3 A;  4OIJ A;  1E3P A;  4N8X 1;  5C4X G;  3MXU A;  5C44 G;  1EY4 A;  3CCJ A;  1AFP A;  2DN8 A;  1G51 A;  1SE4 A;  2NVY B;  4KY7 A;  1LAB A;  2OT2 A;  1Q7Y C;  1MJC A;  1PTO F;  2KUM A;  1QNU A;  2SNM A;  2Z4I A;  4C3I G;  1CUK A;  1QVC A;  3HOU B;  3T53 B;  4EQP A;  3D31 A;  4DV4 L;  1PLF A;  3AB9 A;  3ERS X;  3TRE A;  2DNE A;  3TME A;  4DNT B;  2EYO A;  3V05 A;  3A8K E;  3CD6 A;  4DFA A;  3AQQ A;  2MFI A;  4GNX B;  3VDY A;  5H1S E;  4PZ6 A;  4DV0 Q;  3PUZ A;  1EY8 A;  5IT9 E;  1G8Z D;  3GTL H;  1E2V A;  4TKO B;  4K5W A;  4JYA Q;  2EYF A;  4UAI A;  1MJE A;  4KJO A;  2N55 A;  1YNJ C;  3EJI A;  3I2Z A;  2DJG C;  3E3X A;  1GUO A;  3I7F A;  4DR7 L;  2R61 A;  1D1K A;  4CDF C;  3PIO 3;  3KFU A;  3S1Q H;  1ZKO A;  3TN2 A;  1F9R A;  1EYG A;  1BCP C;  4K6L A;  5CV7 A;  4QMG A;  1FR3 A;  2WKC A;  4MZ9 A;  1I4Q A;  4B08 A;  1HNW L;  1GHK A;  1PH3 A;  3DMU A;  2UUB L;  3ER0 A;  2Z0S A;  4JI4 Q;  2DJF C;  2JA8 H;  1HUN A;  2QF7 A;  3NEN A;  3R3O A;  2AQ3 B;  3OIQ A;  4PNY A;  4CHT B;  4LF8 Q;  2IJ0 A;  2KQ3 A;  3KLW A;  4FP5 D;  1IXR A;  2CHB D;  4C3J G;  1PTO D;  2EYJ A;  2N49 A;  2Q2T A;  3J7Z C;  1U9R A;  1SNQ A;  2PZW A;  5IT9 L;  5HUR A;  4HIM A;  3GTP H;  4A3J H;  3CCE A;  3T56 B;  4LF6 Q;  5IWA L;  1D1I A;  1ZYR C;  2L11 A;  1I6H H;  3VYS A;  1UE5 A;  1EWH A;  2K5Q A;  3T4A C;  4S3S A;  3SDZ A;  1KDC A;  5ISR A;  4UY8 C;  1Y14 B;  4OEM B;  1JR0 D;  1C7Y A;  2PMZ E;  1WYD A;  1BBX C;  2BOS A;  4R9W A;  3PO2 H;  5IYB H;  2VY3 A;  5HGT A;  1CQV A;  4DV2 L;  3PGZ A;  1SLJ A;  3KF8 A;  1LO5 D;  1Y1V B;  3DWQ A;  3F2C A;  4X3K A;  2KOL A;  2A6E C;  1MI2 A;  3K7U C;  1NMG A;  5D14 A;  5K36 G;  1I6V C;  2RF4 A;  4C3I H;  2JP1 A;  3PUY A;  1K8G A;  5FOB B;  4JI7 L;  3SEB A;  1LAC A;  4DUZ L;  1LYL A;  4GS3 A;  1UUP A;  4LFA L;  3S2H H;  3HKZ E;  2I0Q A;  4KD3 A;  4HIK A;  2VNU D;  4K5X A;  3QOJ A;  4JI1 L;  1FD7 D;  1NY4 A;  4DR2 L;  2UXD Q;  5BN5 A;  1HTP A;  1OXT A;  3T1H Q;  4YWL A;  1HCZ A;  3LGJ A;  3IL8 A;  2CCZ A;  3QJY A;  2K5N A;  1E1T A;  4KKS A;  2E2H B;  1SNP A;  3NEL A;  4B3M L;  4WOR A;  2UXC L;  1A2U A;  1O7L A;  1S5B D;  3CCS A;  2J4X A;  4FYD A;  1VQK A;  2K05 A;  1MBY A;  2Q2I A;  4A75 A;  3MXN B;  2F0M A;  3S1N H;  4GKK L;  2UUA Q;  5HY6 A;  4YY3 L;  4LF5 Q;  4B3R Q;  4A3F G;  1HNX Q;  3MFY A;  1Q90 A;  3V2T A;  4DR3 Q;  1VQ8 A;  1H95 A;  1XNR L;  1GM5 A;  3K5O A;  5E4X A;  3I4L A;  1U4P A;  4C3J H;  2F0Q A;  4A3I G;  3U9O A;  4QUC A;  3SVM A;  4A93 B;  2A68 C;  2F0E A;  4DU9 A;  5C4H A;  1IBL L;  4IPH A;  2RVL A;  5C6A A;  3GO5 A;  2QGQ A;  3MZ5 A;  4DAM A;  3CXC A;  4DR1 L;  3UDX A;  4DXF A;  2UUC L;  1S5F D;  3KK7 A;  1N33 L;  1IZ6 A;  1V1P A;  3SGI A;  4DAV A;  4JBK A;  3RZO B;  4OO1 G;  2I5H A;  3KBG A;  4LF4 L;  2X6L A;  1MD2 D;  3CAM A;  5EAY A;  2WB1 B;  4RCN A;  4C56 C;  2NZ1 D;  3ULP A;  5C4J H;  2GA4 B;  3RUZ A;  2HCI A;  1DGS A;  1ENC A;  1LUZ A;  3R93 A;  5I6W A;  3D4R A;  2NN6 I;  2K4K A;  5K36 H;  4R4Q A;  2BE5 C;  3L3O C;  1TII D;  4O1N A;  4F8M A;  3PV0 A;  4DAY B;  1EIY B;  2JA5 B;  5ELB A;  3L2P A;  2OTL A;  1DYQ A;  1K3B C;  2R93 G;  1EL0 A;  2XWB B;  1QG7 A;  2JYO A;  4MIU A;  5LMN Q;  1KLU D;  4RG1 A;  1BNZ A;  5KYI A;  4R4I A;  4C1N K;  2KBN A;  1EIG A;  1E0B A;  1X3F A;  3OHX C;  1MKH A;  3L0O A;  2L15 A;  1A6X A;  2GVB A;  2CVR A;  3TZD A;  2JA7 B;  3CKI B;  1Q8K A;  4FF1 A;  4CGY B;  1AEX A;  1IYJ B;  3OYY A;  4A76 A;  1GO3 E;  2K5D A;  1C9O A;  1D7Q A;  2EY2 A;  4H13 C;  1KRS A;  2DY7 A;  4MTK A;  1J5E L;  3NTH A;  4XQJ A;  5LL6 S;  1KDB A;  5IP7 G;  1PZK D;  4RKL A;  1LTA D;  1SE3 A;  1RTO A;  3S9W A;  3GV3 A;  4P71 A;  2GN5 A;  2F0G A;  1VQE A;  4FXD A;  4FXG C;  5M5X B;  4A3F H;  1GUW A;  1F2Z A;  3CRL C;  3ND9 A;  4JI6 L;  1JWU D;  2DGY A;  3DLL A;  3H0G B;  2OXP A;  2VXW A;  4HJ5 A;  2IY5 B;  4X3S A;  3M7N A;  3JAM i;  2L55 A;  3K0X A;  3GTO H;  5FO7 B;  4KK7 A;  1YJW A;  1N36 L;  1XXG A;  2QEJ C;  4DV4 Q;  4RHS A;  1F9Q A;  5ELF A;  2LS0 1;  3LNN A;  3GV6 A;  1BO0 A;  4OO1 H;  4K8I A;  2A69 C;  1VQ6 A;  2F0U A;  1IW7 D;  3CC2 A;  1VMC A;  2I5L X;  5EKI A;  4A3B B;  2X69 A;  5C0X G;  1XX8 A;  3HEJ A;  3M85 A;  2ZTC A;  2Y0S G;  1DZ1 A;  4DR7 Q;  1SJH D;  2JJQ A;  3CCM A;  3PO3 B;  1LM0 A;  1A62 A;  4ZLT F;  4QJF A;  4DV5 L;  1XTD A;  1PFN A;  3CRK C;  1HNW Q;  3L7Z C;  4V0B A;  1BF4 A;  2ID0 A;  4FF2 A;  3CQZ B;  4IPC A;  1D5M C;  3UDG A;  2R93 H;  3H94 A;  2UUB Q;  4LF9 L;  1X6O A;  3M3Y H;  3HOZ G;  4IJH A;  2F0L A;  4AYB B;  5IGE A;  5C3E G;  2N8N A;  3JAM c;  3D4W A;  3BYY B;  3DM1 A;  2QW7 A;  3HP3 A;  5I9P A;  5J1Z A;  4LUO A;  2AQ2 B;  3I72 A;  1WVL A;  2F3V A;  3U58 A;  1I4P A;  5IWA Q;  1XTC D;  4NPS A;  1NAP A;  1R9T B;  1HA6 A;  2JA6 H;  1TXY A;  1FNV A;  5JJZ A;  5HGQ A;  1ICF B;  4GLA C;  4WFN 3;  4FXK C;  3WOE A;  4HJ8 A;  3EN2 A;  2RQX A;  5IP7 H;  1XMO L;  3WOF A;  4FF4 A;  3NK9 A;  4R4T A;  1VQL A;  2B29 A;  3KBX A;  1KTK A;  1CKO A;  2RSN A;  1Z7T A;  2PZT A;  2B2V C;  4DV2 Q;  1KL9 A;  2F0P A;  4JI8 L;  1EYA A;  5CBA E;  3GDE A;  3IFD A;  3OMG A;  1HXY D;  3MXN A;  3OW7 A;  1KD1 C;  4IUV A;  3TRZ A;  5JEA H;  1Y1W H;  3HOU G;  3TP5 A;  1YNX A;  3I4M H;  2IX1 A;  4TVA B;  3EA6 A;  4K5V A;  3NQT A;  2XSC A;  1VQ5 A;  3KJO A;  4R4C A;  5LMN W;  3PSI A;  4JI7 Q;  3JAM E;  1LV9 A;  1N32 L;  1CHP D;  4LFA Q;  5C5M A;  2FXQ A;  4OHJ A;  2F0S A;  3CU7 A;  2EQS A;  3C1F A;  3PUX A;  2F0J A;  5LHY 1;  3U4V A;  1WTP A;  1HNZ L;  4JV5 L;  4JI1 Q;  3M4O H;  4OWX B;  2FJ2 A;  2L12 A;  2PW7 A;  1AH9 A;  4DR2 Q;  3ZYY X;  4YHH L;  2LXK A;  1X55 A;  4JOI A;  2B2W A;  4H0L C;  1WTR A;  1GJX A;  1LTL A;  2QDB A;  4B3M Q;  2EYP A;  4DV7 L;  5ELC A;  2UXC Q;  1ESF A;  1QIL A;  5JVH 3;  4CJ2 C;  2L5T A;  2WAC A;  4Y7N B;  3ZJY C;  5JOB A;  3MTS A;  1CA6 A;  3S1R H;  4GKK Q;  3JAM L;  1F9P A;  2FIN B;  4HJ9 A;  1EUJ A;  1SXT A;  1QE6 A;  1TWH H;  4YY3 Q;  3BVG A;  5C3E H;  5BN4 A;  1YI2 A;  4HSP A;  2RSO A;  2WAQ B;  3RN2 A;  1XPO A;  1XNR Q;  1UAP A;  2SDF A;  1RDP D;  2K03 A;  3URY A;  4LFB L;  4MNO A;  4NKL A;  3S2D B;  3BDC A;  3T16 A;  2ICI A;  1L0W A;  1WD0 A;  3K5M A;  2CQO A;  3VYU A;  3HFZ B;  1PTO C;  3DEP A;  4XIG S;  1IBL Q;  4Y52 H;  3BZC A;  1EY7 A;  4DR1 Q;  2WII B;  5C0X J;  2UUC Q;  5EPJ A;  3TP8 A;  1G2T A;  1N33 Q;  3NHH A;  1Y1V G;  4J1M A;  4ZQ3 A;  4GZY C;  2B2U A;  1OO9 B;  2NVY H;  4AYB E;  4LF4 Q;  1G6Z A;  2F3W A;  4XYQ A;  2UXB L;  3KF8 B;  4NXM L;  5JJI A;  1PH9 A;  4HSV A;  4JVZ A;  4RGM A;  5M3M B;  2K01 A;  1SYF A;  3NUC A;  1S3O A;  1Q1E A;  2NZO A;  1KAB A;  1PVO A;  2F0N A;  3F2D A;  4F88 A;  1PV4 A;  1ICW A;  3K8A A;  2Q8R E;  1PFM A;  4ZAI A;  2HIV A;  4DK0 A;  4BY7 B;  2V1C C;  1BDO A;  1WTX A;  1OXS C;  1X3Q A;  2FMM A;  4DXG A;  2QKI C;  3S1M B;  1CFM A;  1XPU A;  3E5S A;  1D6E C;  3FKI H;  1Z6H A;  2RA4 A;  3OMC A;  1S5C D;  2IHF A;  4KI0 A;  4A3E H;  1SNO A;  1QUQ A;  4BWG B;  4B3S L;  2L9H A;  1UEB A;  4A3G H;  4DAP A;  1PZJ D;  3SK6 A;  2VUM B;  1WTO A;  2WV6 D;  2EVB A;  3KJP A;  3DXJ C;  4DV1 L;  1C0A A;  1JIC A;  2KEE A;  1J5E Q;  3GTQ H;  4QB4 A;  4DK6 C;  1EOV A;  1UE7 A;  1CA5 A;  1VF7 A;  4K6D A;  4KY5 A;  3VA7 A;  2IX0 A;  3S17 B;  5CV9 A;  3RLO A;  2EY1 A;  1B9N A;  4C2M B;  2OQ0 A;  4R8I A;  4A93 G;  1EIF A;  2KJX A;  4JI6 Q;  1WTW A;  2SNS A;  4BA2 I;  2Q8T A;  1FGB D;  1R4Q B;  2ZXP A;  1L0Y B;  3GTM B;  1CZG A;  2H1E A;  1IBM L;  1I3Q B;  4WRD A;  2IHE A;  4JW0 A;  4ZCK A;  3VR2 A;  4HJA A;  1LTR D;  3KLS X;  1FVI A;  1N36 Q;  4KHP L;  1B9M A;  2ICE C;  4P73 A;  2WB1 G;  3OWF A;  5L37 A;  4ZKB B;  2F4I A;  4IUN A;  1V1P B;  2K1B A;  1Y1V H;  1Q86 C;  3TS2 A;  3HZX A;  2WAQ E;  1TS5 A;  4BY1 B;  4ULL A;  2P5Z X;  3J7A F;  2A19 A;  2OF1 A;  3OSO A;  3C3L A;  1EYC A;  3GTK B;  1U0L A;  1WD1 A;  2OTJ A;  4QL5 A;  3HKZ B;  3HOY B;  3E9H A;  1SND A;  1B44 D;  2B2T A;  4OWT B;  3BZK A;  4DV5 Q;  5T1G A;  3S15 B;  5FJ8 H;  3MXP A;  2B2Y C;  4RA8 A;  2YU9 B;  1PYW D;  3AMU A;  1FNW A;  1W2B A;  1XNQ L;  3F2B A;  4LF9 Q;  2K50 A;  1M8A A;  1U5K A;  2JA7 G;  1JWS D;  3H6M A;  1TWG B;  1YJ9 A;  3GTJ H;  1B8A A;  2E2H H;  3FP9 A;  1DM0 B;  1P16 A;  2KCM A;  1LTI D;  2Z6K C;  1QJO A;  2R6G A;  5IGB A;  4HCS A;  2ZTE A;  1K8A C;  3M9B A;  1CSQ A;  4QF4 A;  3WDN A;  1CKN A;  5EQ0 A;  4ZRZ A;  1JE5 A;  3PIP A;  4L5Q A;  4HIO A;  1S4Z A;  1TWC B;  2BDN A;  4HTH A;  4TQU S;  2MPM A;  1IHZ A;  3VYT A;  3K59 A;  1XMQ L;  1M4V A;  1HZC A;  3AU7 A;  1YIJ A;  2DNC A;  5J39 A;  1VQD A;  1XMO Q;  1SNM A;  1SYE A;  4RH6 A;  4QQB X;  3G4S A;  1BBU A;  3H0G G;  1PFS A;  4JI8 Q;  1A3U A;  4A93 H;  1CKM A;  1SFO B;  1UNS A;  3H3V I;  3BG3 A;  4LUV A;  4K2K A;  3D6W A;  4JPB W;  3CME A;  1C8C A;  2NVX B;  3S16 B;  2IW3 A;  1ROD A;  1Q12 A;  1PTO H;  5COY A;  2ZT9 C;  2OWO A;  2E2I B;  1BOS A;  1D8L A;  5FLM G;  1LT5 D;  3QB3 A;  1N32 Q;  1YHA A;  4GLX A;  2OQK A;  5C4Z A;  3MA2 B;  1F77 A;  2PI2 E;  2SOB A;  4A3B G;  2JXM B;  3L9A X;  1HNZ Q;  4JV5 Q;  1PYS B;  2RKS A;  4YHH Q;  3DEO A;  1W6K A;  2JA9 A;  2CQA A;  1IW7 C;  1TY2 A;  3PO3 G;  3MXG A;  3NTK A;  1SN8 A;  2JEB I;  1HTL D;  1HR0 L;  2NN6 G;  4DV7 Q;  1JOK A;  1HRJ A;  5GAD C;  4XT3 B;  3J7A V;  2H4O A;  4RWS C;  5CV5 A;  1JOO A;  5C4X H;  1I50 H;  5C44 H;  1WTQ A;  1TWF B;  4AYB G;  2PQA A;  4YCV A;  4ODG A;  1B53 A;  4DGZ A;  2UU9 L;  1PRT F;  4G7O C;  1SYB A;  2PW5 A;  4QCL A;  2FHT A;  2JA7 H;  1O80 A;  2HDM A;  1VQI A;  3LWE A;  4LFB Q;  3MHB A;  1S5E D;  1SNC A;  5GAE C;  2TSS A;  1EQR A;  5M5W H;  1CTM A;  2F0H A;  4NMZ A;  3HOX B;  1NSN S;  3CCL A;  1ML0 D;  1STE A;  3DUZ A;  4AH6 A;  3A7A B;  4DR5 L;  3DM3 A;  3K81 C;  5M5X H;  2EYH A;  2R7Z B;  5J22 A;  1I5F A;  3FDT A;  3I4N B;  2D2C C;  1KNE A;  1S40 A;  2MNA A;  4F87 A;  5IY0 A;  2NUC A;  2KCC A;  2MQH A;  2XN9 C;  3DHQ A;  4X3U A;  3H0G H;  3BVM A;  2UXB Q;  3BJU A;  4NXM Q;  4NDX A;  2D62 A;  1AP0 A;  2B3G A;  1JOQ A;  3FRP B;  4J6H A;  4LUZ A;  5EBC A;  3A7L A;  3TP7 A;  2VS1 A;  2PI2 A;  4GOP A;  4ZYS A;  3NSW A;  3ONA B;  3M7G A;  1SMY D;  2ZXO A;  4C1N I;  1VQC A;  3N52 A;  1V43 A;  3W1G A;  2KHS A;  2JN4 A;  1PRT D;  4DV6 L;  3HGB A;  2VZA A;  4A3B H;  1SR3 A;  1H9J A;  2O2L D;  1PXU A;  1RKN A;  1TS2 A;  4KKU A;  3UDF A;  2NZH A;  3UI2 A;  3W3A A;  1EIH A;  4B3S Q;  3NE5 B;  3D4D A;  2NN6 H;  3EIV A;  1PH4 A;  3VYR A;  1VQG A;  5ELE A;  5JPN C;  3CQZ H;  4ME3 A;  1J9O A;  2PNH A;  1K8O A;  1HUM A;  4DV1 Q;  2I07 B;  2F03 A;  1Q8I A;  4IO9 A;  1IKM A;  1QVF A;  3PF5 A;  2ZJQ A;  2JE6 I;  1AZQ A;  1K9M C;  4QIW E;  4RHR A;  5EPK A;  1YIT A;  1QWY A;  4YCW A;  5CBE E;  2V4D A;  1KAA A;  1CZW A;  3LWU A;  5M3F B;  3AEV A;  1VQ9 A;  1L0X B;  1JJG A;  4EQ5 A;  3FMC A;  1TU2 B;  2CWP A;  3ICE A;  4LK1 C;  1BVS A;  1L1O A;  1IKL A;  1IBM Q;  4O2D A;  4NB3 A;  1K8M A;  2KCN A;  3GTP B;  3E0E A;  5FLX E;  1Q1B A;  4G7H C;  4PZ8 A;  4KHP Q;  4AIM A;  4WJW A;  3PUW A;  1U4R A;  2FMC A;  1GD7 A;  2MJ8 A;  2ATW A;  1ENF A;  1CQF A;  3J81 j;  3OTO L;  1TY0 A;  5EGT A;  1ENA A;  4KKT A;  1TS4 A;  5KEE A;  1HHV A;  3TS0 A;  2IT1 A;  1B7Y B;  1X3P A;  2IX3 A;  5ELD A;  2X6G A;  5EJW A;  1UE6 A;  2R92 G;  4HN7 A;  1VQM A;  5IOD A;  1HFG A;  1EY6 A;  2CKZ B;  1T5X D;  3CPW A;  2E76 C;  4X6A H;  4IAL A;  4LNQ A;  1I4G A;  4H02 A;  3ULJ A;  4BY7 G;  2HIX A;  5NUC A;  4CDD C;  4A3D B;  1W3S A;  2PNR C;  2RDH A;  1CM9 A;  1II3 A;  3GD7 A;  4V19 0;  3KDF A;  4R4O A;  1QZG A;  1WFQ A;  1A2T A;  1D5Z C;  2I5M X;  3PMF A;  1XNQ Q;  4JI2 L;  3R8B A;  2B63 B;  2AHO B;  2D0O A;  3MWY W;  4M1U B;  4A3I H;  4ZUI A;  3X3M A;  5IP9 G;  2A73 B;  2PZU A;  2E5L L;  1VQP A;  2VUM G;  4GNX C;  2Z8L A;  2ZXR A;  3Q6S A;  1PRT B;  1QUQ B;  2O5I C;  3K5N A;  4A3K G;  4XQN A;  1G91 A;  5KNC A;  1H9M A;  2BA0 A;  3GP7 A;  4Y7N H;  2RCN A;  1NUC A;  2Z1C A;  4RGO S;  1Y69 U;  2HCC A;  2NVT H;  3JC6 6;  4CKC A;  2E2J H;  1EY5 A;  5I6Y A;  1PH6 A;  1N34 L;  4P74 A;  5DAU A;  1XMQ Q;  3CP0 A;  2ZM6 L;  4OEL B;  1ASY A;  2OCE A;  1K3R A;  4HMJ A;  1K83 H;  3CCR A;  1EY9 A;  2MP1 A;  3S2D H;  3S1N B;  3P7J A;  3QR8 A;  4KV6 A;  3GQB A;  1VQN A;  1U4M A;  4DUY L;  1YHQ A;  4DR4 L;  4GN3 B;  2N88 A;  4E6I A;  3TZU A;  1K0R A;  1EWC A;  1GOZ A;  3NPP A;  4KY6 A;  4H7B A;  3UE0 A;  3U9S A;  4P75 A;  1ZXT A;  2M2L A;  2OEO A;  1RCV D;  1LTB D;  1Y8O B;  3VR3 A;  3G71 A;  4IPG A;  5IGF A;  4KN4 C;  3PIO A;  4OWW B;  1N8R C;  4BY1 G;  1EQV A;  4OO1 I;  3R2T A;  4L63 B;  2A74 C;  1EFW A;  5IGG A;  3MVV A;  1X32 A;  3SR1 A;  4Q5V A;  2NVQ H;  2HT1 A;  3HKZ G;  2R92 H;  3S24 A;  4U67 3;  2F0O A;  2AKW B;  1SDF A;  1Z9F A;  1Q3L A;  2ENB A;  4POF A;  1WTV A;  1HR0 Q;  1AZP A;  1T9H A;  1HJP A;  2G5D A;  1JT8 A;  2VW9 A;  1O7Z A;  1SYD A;  2A8V A;  4KHZ A;  4EVO A;  3S1M H;  2L0C A;  2F0T A;  4HCE A;  4DF7 A;  1F9S A;  2UU9 Q;  1JJC B;  3I8Z A;  3I73 A;  1Z47 A;  1YEZ A;  2I46 A;  5E1F A;  5KNB A;  4KMU C;  5IP9 H;  4IUP A;  4LMQ D;  2VUM H;  2IPK D;  5J3B A;  4DUZ Q;  4G7Z C;  1I4R A;  4A3K H;  4JC0 A;  4PMW A;  4QY7 A;  1X9N A;  1CKN B;  2Z6B A;  4X65 L;  2XWJ B;  3NP8 A;  1EZ6 A;  3MEF A;  3NXW A;  5LL6 X;  4HMI A;  4DR5 Q;  4P2C B;  4LWC A;  3PCO B;  1TWA B;  2N3S A;  2Q2H A;  5FK9 C;  3HOV B;  1VQH A;  1LTS D;  1HQR D;  1O78 A;  4XT1 B;  3X3N A;  5C0X H;  1S72 A;  4XXE A;  1BR9 A;  2YYZ A;  3TBI B;  2XRQ D;  2A5H A;  3MC0 B;  1NTG A;  1ESR A;  2B39 A;  3P1H A;  2CH4 W;  1HH2 P;  3H3V C;  2M00 A;  3GTM H;  4IFD I;  3D0F A;  5GRO A;  1I3Q H;  1VQJ A;  1ILP A;  4QUF A;  1A8V A;  2VQF L;  4KD4 A;  3AFP A;  2WKD A;  3K7A B;  1RTN A;  4JI5 L;  2F0D A;  4K14 A;  3D8G A;  4RKB A;  3HOZ H;  2BA1 A;  4BBS B;  3GTO B;  3T51 B;  5LMU L;  4DV6 Q;  4BY1 H; 
#chains in the Genus database with same CATH homology
 4JOI C;  1OXT A;  4BBS H;  4OON A;  4OWT B;  4IOC A;  3T1H Q;  3BZK A;  4DV5 Q;  4YWL A;  2BH8 A;  3LGJ A;  5FJ8 H;  3W1B A;  2CCZ A;  5GAH C;  1FGU A;  3KF6 B;  2K5N A;  1E1T A;  4DK3 C;  3NEL A;  4B3M L;  1PH2 A;  1W2B A;  1XNQ L;  2UXC L;  3F2B A;  1JB7 A;  2K5V A;  4LF9 Q;  3M4Q A;  3CCS A;  2K50 A;  3TQY A;  1VQK A;  1U5K A;  2JA7 G;  4APV A;  2Q2I A;  4A75 A;  3GTJ H;  1YJ9 A;  1B8A A;  3MXN B;  4WJ3 M;  1E22 A;  2YTX A;  1I94 L;  2E2H H;  2YU9 H;  2K75 A;  3FP9 A;  4DV3 L;  1P16 A;  2ALY B;  3S1N H;  4GKK L;  2KCM A;  1PH7 A;  1FL0 A;  2Z6K C;  2VL6 A;  3I55 A;  2R6G A;  4GKJ Q;  1K8A C;  2ZTE A;  5HY6 A;  2UUA Q;  4YY3 L;  3M9B A;  4JCV E;  1UWV A;  1CSQ A;  3RZD H;  4LF5 Q;  1CKN A;  1TWG H;  4B3R Q;  1VQB A;  4A3C G;  4A3F G;  1HNX Q;  1JE5 A;  3PIP A;  3HOW G;  2PQA B;  4L5Q A;  1VQ8 A;  4BA1 I;  4DR3 Q;  4HIO A;  1H95 A;  1XNR L;  3RN5 A;  1SRO A;  4R1J A;  1EQQ A;  3CPF A;  1GM5 A;  4JI0 L;  3HOU H;  4TQU S;  4A3L H;  4C3J H;  4A3M H;  1XMQ L;  4A3I G;  1HZC A;  1YIJ A;  4J15 A;  2F52 A;  1ASZ A;  3FHW A;  1VQD A;  1XMO Q;  1OXX K;  3HOX G;  5M3M H;  1IBL L;  4IPH A;  2ZJP A;  4QQB X;  2AWN A;  3HOY G;  1HZB A;  2QGQ A;  1BBU A;  3GO5 A;  3H0G G;  5ELO A;  3A0J A;  4DAM A;  3CXC A;  1PFS A;  3UDX A;  4DR1 L;  1RL2 A;  4GN5 A;  4JI8 Q;  2UUC L;  5IE8 A;  3OW2 A;  4A93 H;  1CKM A;  3I4N G;  1N33 L;  3H3V I;  1IZ6 A;  2WB1 E;  4LUV A;  3SGI A;  4JBK A;  2A1A A;  2EIF A;  4DKA C;  4OO1 G;  3CME A;  2I5H A;  4LF4 L;  4BY7 H;  2K14 A;  2ZJR A;  2QA4 A;  3CAM A;  5EAY A;  1V9P A;  3RR5 A;  1Q12 A;  4X62 L;  3ULP A;  3OTO Q;  3J80 i;  5C4J H;  2XTI A;  1PYB A;  2OWO A;  5FLM G;  1D8L A;  1WCM H;  1HR0 W;  1DGS A;  3A5Z B;  1FJG L;  2KCT A;  1N32 Q;  1LUZ A;  1YHA A;  2H5X A;  4DV0 L;  2OQK A;  1RIP A;  3CCU A;  1HZA A;  4GLX A;  2NN6 I;  1PH8 A;  1KQS A;  1YZ6 A;  2K4K A;  3S16 H;  4R4Q A;  4BBR H;  1M1K C;  2PI2 E;  3A74 A;  4A3B G;  2E2I H;  4O0A A;  1HNZ Q;  4JYA L;  2XGT A;  4JV5 Q;  3PV0 A;  4DAY B;  3KF6 A;  1EIY B;  1PYS B;  3L2P A;  2MO1 A;  2OTL A;  4GOP B;  4YHH Q;  4K0K Q;  2JA9 A;  1YBY A;  5IYC H;  3KOJ A;  1A0I A;  2R93 G;  1VQ4 A;  4L5T A;  4GLV B;  3PO3 G;  2VQE L;  1SN8 A;  1IL2 A;  2JEB I;  5LMN Q;  1HR0 L;  2R7D A;  2NN6 G;  4RG1 A;  4DV7 Q;  3CW2 C;  3BU2 A;  4JI2 Q;  5GAD C;  1YJN A;  4R4I A;  2JEA I;  2KBN A;  4MTN A;  4POG A;  1X3F A;  3S17 H;  1MKH A;  3L0O A;  2L15 A;  4C2M H;  1J6Q A;  4JI3 L;  1I50 H;  2GVB A;  5C4X H;  5C44 H;  1KAW A;  1Q8K A;  4AYB G;  4JI4 L;  4LF8 L;  2E5L Q;  2PQA A;  4YCV A;  4YWK A;  2YV5 A;  2UU9 L;  1IYJ B;  3OYY A;  4A76 A;  1GO3 E;  1BKB A;  1C9O A;  1XJV A;  1D7Q A;  3HKS A;  4IPD A;  1KRS A;  3UE1 A;  2JA7 H;  1J5E L;  5JJL A;  1TWF H;  3STB C;  1K73 C;  4BXX G;  5IP7 G;  1VQI A;  2KHJ A;  4FDB A;  1WI5 A;  3J80 c;  1JMC A;  2ES2 A;  4LF6 L;  3GTG H;  4LFB Q;  3Q8D A;  1N34 Q;  3FKI G;  1WJJ A;  4P71 A;  2GN5 A;  5GAE C;  4A3E G;  1VQE A;  1EQR A;  5BR8 L;  2ZM6 Q;  4A3F H;  4DR6 Q;  5M5W H;  4DNI A;  3HOW H;  5GAG C;  5M3F G;  1X54 A;  3CCL A;  4JI6 L;  4A3G G;  2DGY A;  4GN4 B;  3DLL A;  4AH6 A;  2JQO A;  2JA5 G;  2MO0 A;  4DR5 L;  3CF5 A;  3DM3 A;  3K81 C;  5M5X H;  2R7F A;  4HJ5 A;  4PG3 A;  3TEH B;  2IY5 B;  3M7N A;  1I5F A;  3JAM i;  4DUY Q;  1PA6 A;  1KIX A;  1S40 A;  3K0X A;  4JG2 A;  3GTO H;  2MNA A;  4DR4 Q;  1VS0 A;  5IY0 A;  4IFD J;  3GTK H;  2MQH A;  5JEA J;  1YVC A;  1NJI C;  4X66 Q;  5C0X I;  3HOY H;  3H0G H;  4IOA A;  1YJW A;  1NMF A;  3F8T A;  1N36 L;  2UXB Q;  3BJU A;  4DV4 Q;  4NXM Q;  2D62 A;  3I4N H;  1L1O B;  1JJ2 A;  3S15 H;  2B3G A;  3J81 i;  4LUZ A;  2D0P A;  1E1O A;  3CC4 A;  1VQ6 A;  4ALP A;  3CC2 A;  2VS1 A;  2PI2 A;  4GOP A;  4X64 L;  3PUV A;  2I5L X;  2AWO A;  1E24 A;  3AFQ A;  1VQC A;  5C0X G;  4NXN L;  1N9W A;  4LF7 L;  4YCU A;  1V43 A;  2ZTD A;  3NBH B;  3W1G A;  3M85 A;  2EXD A;  2ZTC A;  3H3V H;  2Y0S G;  1B70 B;  4DV6 L;  1IBK L;  4UP7 A;  4A3D G;  2UXD L;  2VZA A;  4IJL A;  3B6Y A;  4A3B H;  2JJQ A;  3CCM A;  1QZH A;  4DR7 Q;  1LM0 A;  1O7I A;  1SR3 A;  1KXL A;  3T1H L;  1A62 A;  4QJF A;  4DV5 L;  1OXU A;  1XTD A;  5AJ3 Q;  1WOC A;  1TWC H;  1HNW Q;  3L7Z C;  2ID0 A;  2B63 G;  4IPC A;  1KC8 C;  3STB D;  2AMC B;  3UDG A;  3IRB A;  2R93 H;  2UUB Q;  3UDF A;  2NZH A;  4LF9 L;  2R7Z G;  3KDF B;  1X6O A;  1GVP A;  4B3S Q;  3M3Y H;  3HOZ G;  4IJH A;  3EIV A;  4HID A;  5C3E G;  1PH4 A;  2N8N A;  3F1Z A;  3EBE A;  3JAM c;  1VQG A;  3CQZ H;  4ME3 A;  1EWI A;  2PNH A;  4OX9 Q;  4DV1 Q;  4GKJ L;  1Q82 C;  2F4V Q;  2UUA L;  4LUO A;  2C35 B;  1SFO H;  4IO9 A;  3CC7 A;  4LF5 L;  1PH5 A;  4B3R L;  1HNX L;  3U58 A;  2K5H A;  3PF5 A;  1QVF A;  5FJ8 G;  5IWA Q;  2ZJQ A;  4NPS A;  2JE6 I;  3RZO H;  4DR3 L;  1K9M C;  5M5Y H;  3S14 H;  4QIW E;  2NVX H;  3J81 c;  2JA6 H;  1TXY A;  4AQY Q;  1YIT A;  2HHH Q;  2KHI A;  5DLQ E;  4YCW A;  5HGQ A;  4GLA C;  4X65 Q;  4BXX H;  4HJ8 A;  3EN2 A;  5IP7 H;  5ELN A;  1XMO L;  4R4T A;  1VQL A;  2B29 A;  1MIU A;  1CKO A;  1GKH A;  3AEV A;  1VQ9 A;  1X65 A;  4RMF A;  5GQO A;  2Q2U A;  2KEN A;  4UP9 A;  1JJG A;  4DV2 Q;  4EQ5 A;  1KL9 A;  2CWP A;  3G4S A;  4JI8 L;  3ICE A;  3T1Y Q;  1BVS A;  1L1O A;  1UE1 A;  3GDE A;  5M3F H;  1IBM Q;  4O2D A;  4NB3 A;  2BH2 A;  2JA5 H;  3E0E A;  1Q1B A;  2WFW A;  1KD1 C;  1KHI A;  4PZ8 A;  3TRZ A;  4KHP Q;  4C3H H;  1Y1W H;  4B3T Q;  2QEX A;  4AIM A;  3HOU G;  1YNX A;  3PUW A;  2IX1 A;  4TVA B;  3I4M H;  1GD7 A;  3U50 C;  2ATW A;  4KLK A;  3J81 j;  3OTO L;  1VQ5 A;  3KJO A;  1SMX A;  4R4C A;  5LMN W;  3PSI A;  2VQF Q;  4JI7 Q;  1N32 L;  4LFA Q;  2FXQ A;  3TS0 A;  2IT1 A;  1B7Y B;  2JK8 A;  1VQF A;  4JI5 Q;  2CWA A;  1UE6 A;  4LFC Q;  2R92 G;  2EQS A;  2Y0S E;  5E7N A;  1VQM A;  1NE3 A;  3PUX A;  1AE2 A;  2CKZ B;  3U4V A;  5IYD G;  1SRU A;  3CPW A;  1HNZ L;  4UP8 A;  4X6A H;  4JV5 L;  4HJ7 A;  1BBW A;  4JI1 Q;  1NBW A;  1X3E A;  4OWX B;  4LNQ A;  4H02 A;  3ULJ A;  5LMU Q;  2LXJ A;  3M4O H;  1AH9 A;  3WWV A;  4DR2 Q;  4BY7 G;  4YHH L;  2HIX A;  2LSS A;  2RHQ B;  2LXK A;  4K0K L;  1W3S A;  1X55 A;  1M90 C;  4JBJ A;  4JOI A;  3CCV A;  1X3G A;  4A3C H;  3GD7 A;  4QGU A;  3KDF A;  4R4O A;  3G48 A;  5LMN L;  2JA8 G;  1QZG A;  1WFQ A;  1LTL A;  3M4P A;  2I5M X;  4B3M Q;  4DV7 L;  1Q46 A;  2WP8 J;  4JI2 L;  1XNQ Q;  4A3D H;  2UXC Q;  1HZ9 A;  1VQ7 A;  2AHO B;  2D0O A;  4A3I H;  3HOX H;  3ZJY C;  5IP9 G;  1I94 Q;  3CMA A;  2YTV A;  4A3J G;  4DV3 Q;  3S1R H;  2E5L L;  1VQP A;  4GKK Q;  2B63 H;  1PH1 A;  2VUM G;  4GNX C;  2Z6K A;  4HJ9 A;  1QVG A;  2N78 A;  1EUJ A;  1TWH H;  4LW1 A;  1QUQ B;  4YY3 Q;  2R7Z H;  4A3K G;  3RLF A;  5IT9 c;  2BA0 A;  4Y7N H;  2RCN A;  5C3E H;  1L2F A;  3A5U A;  1YI2 A;  2ASB A;  2NVT H;  3JC6 6;  1PHJ A;  3RN2 A;  3I56 A;  1XPO A;  4JI0 Q;  1XNR Q;  4A4I A;  3RNU A;  3W5O A;  4LFB L;  2E2J H;  1PH6 A;  3PO2 G;  4MNO A;  5IYB G;  1N34 L;  1CSP A;  3K80 C;  4P74 A;  3U4Z A;  1G29 1;  3CP0 A;  1SE8 A;  1XMQ Q;  1L0W A;  2CQO A;  3UDI A;  1AE3 A;  2ZM6 L;  1E3P A;  4DR6 L;  1ASY A;  5C4X G;  5FLM H;  5C44 G;  3CCJ A;  2OCE A;  1K3R A;  3HFZ B;  1G51 A;  1KRT A;  1K83 H;  3KYH C;  4XIG S;  2CFM A;  3CCR A;  1IBL Q;  3BZC A;  4Y52 H;  3S2D H;  3HOV G;  4DR1 Q;  3PF4 A;  2UUC Q;  5C0X J;  1VQN A;  1Q7Y C;  1MJC A;  1VCI A;  1E7Z A;  1N33 Q;  1G6P A;  4DUY L;  1YHQ A;  4DR4 L;  4GN3 B;  1Y1V G;  1P8L A;  1CUK A;  1K0R A;  2NVY H;  4L5R C;  5FLX c;  4AYB E;  1QVC A;  4X66 L;  4LF4 Q;  3UE0 A;  3D31 A;  4P75 A;  2UXB L;  3KF8 B;  4X62 Q;  4DV4 L;  4NXM L;  3ERS X;  3TRE A;  3PO3 H;  5JJI A;  1PH9 A;  3CD6 A;  3AQQ A;  3G71 A;  4IPG A;  2MFI A;  3PIO A;  1FJG Q;  4GNX B;  3RLN A;  2K52 A;  3VDY A;  5H1S E;  4PZ6 A;  4DV0 Q;  4OWW B;  3PUZ A;  1N8R C;  4BY1 G;  4JBW A;  4GOP C;  4OO1 I;  1S3O A;  1Q1E A;  2NZO A;  4DPG A;  4OXP A;  1Q81 C;  3GTL H;  1EFW A;  4BBS G;  3F2D A;  1PVO A;  4JYA Q;  1MJE A;  1PV4 A;  3AYH B;  2WAQ G;  3K8A A;  2DUD A;  2NVQ H;  3I2Z A;  2HIV A;  3HKZ G;  2HT1 A;  2V1C C;  2R92 H;  3I7F A;  3S24 A;  4DR7 L;  1VQA A;  1OXS C;  5JJK A;  2VQE Q;  5IYD H;  1OXV A;  2AKW B;  1Z9F A;  4POF A;  1HR0 Q;  3KFU A;  3S1Q H;  2RHS B;  2YTY A;  5AJ3 L;  1EYG A;  1XPU A;  1R9T H;  1T9H A;  3FKI H;  1HJP A;  1HNW L;  4MZ9 A;  1JT8 A;  2IHF A;  4KI0 A;  2VW9 A;  4A3E H;  1QUQ A;  1PH3 A;  2UUB L;  4KHZ A;  3G6E A;  4JI3 Q;  2A8V A;  3S1M H;  3ER0 A;  2Z0S A;  4B3S L;  4JI4 Q;  2JA8 H;  1UEB A;  3NEN A;  4LF8 Q;  4A3G H;  2UU9 Q;  1YHB A;  2GVA A;  1JJC B;  4WJ4 A;  3KLW A;  1IXR A;  1Z47 A;  1YEZ A;  3KJP A;  4DV1 L;  1OTC A;  4OX9 L;  4A3M G;  2F4V L;  4A3L G;  1C0A A;  3GTQ H;  4XTC S;  1J5E Q;  2Q2T A;  2N49 A;  4DK6 C;  3J7Z C;  4HIM A;  5IP9 H;  1EOV A;  1UE7 A;  3GTP H;  4A3J H;  2E8G A;  3CCE A;  4LF6 Q;  5IWA L;  2HQL A;  2VUM H;  5M3M G;  5J3B A;  4DUZ Q;  1I6H H;  1UE5 A;  4AQY L;  4A3K H;  2HHH L;  4JC0 A;  4PMW A;  4QY7 A;  1X9N A;  1CKN B;  2IX0 A;  4P72 A;  3RLO A;  5BR8 Q;  4JBM A;  4X65 L;  1V1Q A;  2OQ0 A;  1Y14 B;  4UY8 C;  4A93 G;  1EIF A;  1C7Y A;  2PMZ E;  1WYD A;  3MEF A;  4JI6 Q;  4BA2 I;  3CCQ A;  5IYB H;  3PO2 H;  4DR5 Q;  2VY3 A;  4LWC A;  3ULL A;  3PCO B;  2Q2H A;  2N3S A;  4DV2 L;  1X56 A;  1VQH A;  3PGZ A;  1SLJ A;  3T1Y L;  1L1O C;  1S72 A;  1XPR A;  2YYZ A;  1IBM L;  3J7A 5;  2IHE A;  1WCM G;  4HJA A;  3F2C A;  4GNX A;  1FVI A;  1TWA H;  1N36 Q;  3HOV H;  2F3I A;  4KHP L;  1NTG A;  4B3T L;  2JA6 G;  3I4O A;  4P73 A;  3K7U C;  4YWM A;  1VQO A;  1NMG A;  2WB1 G;  1HH2 P;  5K36 G;  4PZ7 A;  4BBR G;  4L5S A;  3GTM H;  4IFD I;  2RF4 A;  3D0F A;  1I3Q H;  1VQJ A;  1Y1V H;  5GRO A;  4C3I H;  1Q86 C;  3PUY A;  4UPA A;  4EX5 A;  1K8G A;  1A8V A;  2VQF L;  4JI7 L;  3TS2 A;  4DUZ L;  1LYL A;  3AFP A;  4GS3 A;  4LFA L;  2WAQ E;  3S2H H;  4X64 Q;  3NEM A;  4JI5 L;  3HKZ E;  3H15 A;  4LFC L;  2A19 A;  5IYC G;  2I0Q A;  1A63 A;  3HOZ H;  3E9I A;  2BA1 A;  4NXN Q;  4HIK A;  4LF7 Q;  2VNU D;  2OTJ A;  1U0L A;  4QL5 A;  4JI1 L;  3K7A H;  5LMU L;  4DV6 Q;  1IBK Q;  4BY1 H;  4IFD G;  1NY4 A;  5JEA G;  4DR2 L;  1Y1W G;  2UXD Q;  3I4M G;  3E9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...