5LMUQ

Structure of bacterial 30s-if3-mrna-trna translation pre-initiation complex, closed form (state-4)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYESLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Large-Scale Movements of IF3 and tRNA during Bacterial Translation Initiation.
pubmed doi rcsb
source organism Thermus thermophilus hb8
molecule tags Ribosome
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2016-08-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5lmuQ00
1QZGA 1CKMA 3U58A 2JA9A 1GM5A 2ZJQA 2ASBA 4LNQA 5GADC 1A8VA 3HOWH 3CP0A 4GNXB 3FKIG 2HHHL 3RZOH 2B29A 2AWOA 4NPSA 1Q1BA 3CCQA 2VUMG 4LUZA 5M3MH 3J81c 2LXKA 4PZ6A 3GTKH 1I94L 4GLXA 1LYLA 1TWAH 3E9IA 3BJUA 3ER0A 4TVAB 4JI7Q 4GS3A 3OYYA 4IFDG 2PNHA 2FXQA 4NB3A 4UPAA 2JA8G 1G291 4JBKA 2N8NA 1AE3A 2CFMA 2K5VA 4Y7NH 1EOVA 3M4QA 2Z0SA 5GAHC 1Q86C 1HR0Q 3MXNB 1VQBA 5DLQE 1KRTA 3STBD 3G4SA 1PV4A 4BBRH 1QUQB 3NEMA 4X62L 4DV1L 1K73C 1M90C 1N33Q 1RL2A 1Q46A 2UUCL 4DV6L 1HH2P 3GTLH 3CAMA 1S40A 3HOWG 5HY6A 5LMUL 3S2DH 4KHPL 1HR0W 4A3LH 5C0XI 1Y1VG 2QGQA 3F8TA 3HFZB 5M3MG 2OWOA 2JA7H 2QEXA 3T1HL 3PUYA 1IBML 2RHQB 4DV3L 1VCIA 4DAYB 4GLAC 1K9MC 1E7ZA 3U50C 3UDGA 1B7YB 4DR7Q 2GVAA 2WP8J 4YCUA 2OTLA 1C0AA 2K50A 2WB1E 4R4TA 1SRUA 4A3IG 4DUZL 3SGIA 1PH6A 3RLOA 4AYBG 1YBYA 3W1BA 4AQYQ 4B3TL 4JI5L 1HNXQ 4R1JA 4LFAL 4B3RQ 2ZJRA 4BBRG 1XTDA 2VNUD 1K0RA 2VZAA 1KRSA 1CKNB 1GD7A 2Z6KC 1EIFA 2Z6KA 1W2BA 1GKHA 2BA0A 3GTJH 3JAMi 1ASYA 1SROA 4A3LG 2ES2A 4JI3L 4JI6Q 2NN6I 3PUZA 1IZ6A 4LUVA 1HNWQ 1L2FA 1SR3A 1E24A 4DV0Q 4X66Q 2JA7G 4DV4Q 2I0QA 2UUBL 1EFWA 1VQEA 2YTYA 4PZ7A 1Q8KA 4LF7L 4JI0L 1X9NA 1NJIC 1FJGQ 4LFBL 2VL6A 1J6QA 3RR5A 1SLJA 2E8GA 1TWGH 4RG1A 3KLWA 4NXML 2A8VA 1N9WA 3D31A 3DLLA 3H0GH 4JOIC 4JOIA 1JJGA 1Y14B 2JEAI 1N36Q 1OXTA 1A0IA 3TQYA 4DV7L 5IWAL 1Q81C 5J3BA 5IP9H 5E7NA 5C3EH 1Q1EA 4GLVB 3PIPA 1X55A 3AFPA 1I94Q 2JE6I 2D0PA 5JJKA 2HIXA 1WI5A 2RHSB 4P72A 2Q2UA 1XPRA 1X3FA 2MQHA 3BZKA 4EQ5A 1NMFA 3PUXA 5AJ3L 3TS0A 1VQ9A 1XNRL 5LMNW 4DV2L 2YU9H 4GKKL 2ZM6L 1PH5A 4LFCL 2E5LL 4JYAL 3CC4A 2YTVA 3ICEA 3CCVA 1I6HH 1VQDA 1VS0A 2E2HH 2F4VQ 4X62Q 4DV1Q 1KXLA 2D62A 5C4XH 3K0XA 1E22A 2WAQG 2NZOA 2N78A 3KF6B 1I50H 3J81i 2UUCQ 4DV6Q 4BY1H 1SE8A 1OXUA 4DR4L 4OONA 3H0GG 1PH7A 1VQFA 2K5HA 3CPFA 3L0OA 4QGUA 4KHPQ 4HJ7A 3CCUA 2VQEL 3RLFA 4A3KH 4LF5L 2Y0SG 5IP9G 1PVOA 3S24A 5C3EG 4QIWE 1OXSC 2UU9L 2JEBI 3EIVA 3KYHC 3T1HQ 3HKZG 4KHZA 1QVGA 4DR6L 4O2DA 4A3EG 4A3FH 3M9BA 4O0AA 1V9PA 1Z9FA 4DV3Q 3PF5A 1K8GA 2MO1A 2QA4A 4DK3C 1O7IA 1L1OB 2CKZB 4GN5A 3RZDH 1HZ9A 1VQKA 2Y0SE 4POGA 4WJ3M 3K8AA 2BH2A 4LF6L 4IFDJ 1G6PA 2PQAB 3CF5A 4LFAQ 4JI5Q 2UXDQ 1VQ5A 1N32L 3HKZE 4WJ4A 1UE7A 1HJPA 1T9HA 1X3EA 4LF9L 4A75A 1J5EQ 5C4XG 4FDBA 4P74A 2R7FA 4BY1G 3I4MH 4APVA 4OWTB 4JI3Q 4A3KG 3KDFA 3TRZA 1A63A 3J80c 4DR2L 2B63H 1X6OA 4QQBX 2UUAL 4BA2I 2K4KA 4MTNA 1JE5A 1UE6A 4JI0Q 4OX9L 1V43A 4A3FG 4A3CH 3BU2A 4LFBQ 2R7ZH 3UDFA 3F1ZA 1YIJA 2KCMA 1CSQA 1N34L 2NVXH 2RCNA 2JA6G 1BBWA 4LW1A 3RNUA 2CWAA 2I5LX 2IT1A 2A1AA 3WWVA 3HOUG 2EIFA 3CXCA 4JI2L 1M1KC 2L15A 3CCRA 4ME3A 5M3FH 1VQJA 1B8AA 4IPHA 4DV7Q 2VS1A 3NELA 1X54A 3UE1A 5IWAQ 3AYHB 3BZCA 4Y52H 1YHQA 4UP9A 3H3VH 3G71A 4X64L 3CCMA 2ID0A 4JI4Q 2BH8A 2CCZA 3KFUA 1IYJB 4NXNQ 3CC7A 4A3JH 5IY0A 1AE2A 1C9OA 1MKHA 3I4NH 5AJ3Q 1JMCA 4ALPA 3S14H 2DUDA 4B3SL 1XNRQ 3HOXH 2K52A 1HZCA 4JV5L 2B63G 1K83H 3F2CA 2ZM6Q 3PCOB 2PI2E 1C7YA 3W5OA 1IBLL 2E5LQ 4LFCQ 5BR8L 1EQQA 4JBWA 1MJCA 2R7ZG 4IJLA 4BA1I 3J7ZC 4YWMA 3CCEA 1VQOA 1SN8A 5IP7H 1KL9A 1Q7YC 4DR4Q 3OTOL 5C4JH 4J15A 1KC8C 1IBKL 1Q82C 3MEFA 3GTQH 5M3FG 1EQRA 2YV5A 5ELOA 4RMFA 3H15A 1YHAA 5H1SE 2Q2HA 1VQHA 3PUWA 3Q8DA 2UU9Q 4AYBE 4GOPB 2ATWA 4A3JG 4DR6Q 1VQGA 3L2PA 3I4NG 2ZJPA 4LF8Q 2RF4A 3CW2C 4EX5A 3HOXG 3TS2A 2UXBL 4IOAA 4X6AH 4TQUS 1I5FA 4JI1L 1JT8A 1D8LA 2CWPA 1Z47A 1VQ7A 1WOCA 4LF6Q 3GTGH 1PH9A 1TWCH 1VQAA 3DM3A 4GNXC 4PZ8A 4GNXA 2MFIA 1N32Q 1TWHH 2LXJA 3ULPA 4GN3B 4LF9Q 3I56A 1HNZL 2PI2A 1Y1WH 2JK8A 1NBWA 1YJWA 2HHHQ 4B3ML 3EN2A 1GO3E 4X65L 2NVTH 3A74A 1EIYB 2F52A 1YEZA 4JC0A 3UDIA 3W1GA 3J7A5 3HOZH 1YITA 3RN2A 1OXXK 3VDYA 4DPGA 3PV0A 1VQIA 4IFDI 4JI7L 3FHWA 5GROA 2UUAQ 1VQNA 2H5XA 4H02A 3T1YL 4OX9Q 1XJVA 1QUQA 5C44H 2OQ0A 1HR0L 1N34Q 1UEBA 1IL2A 2OQKA 4UP8A 3F2BA 5IYCH 4C3HH 2Q2IA 1XNQL 2JQOA 2HQLA 2ZTCA 4OO1G 1S3OA 2PMZE 3CMAA 4YHHL 3IRBA 3GTPH 3A0JA 4QL5A 4XIGS 1Q12A 2R6GA 1H95A 4PMWA 1CKOA 1X3GA 4R4IA 1Y1WG 5LMUQ 3J80i 2E2IH 4X64Q 1GVPA 1NMGA 1BKBA 4DV5L 1R9TH 1G51A 3TEHB 3UDXA 4KI0A 5HGQA 4B3SQ 3EBEA 3HOYH 1LTLA 2WAQE 1IBMQ 4JV5Q 3RLNA 5JJLA 1JJCB 3OW2A 4R4CA 3G6EA 4P73A 3HOVH 1P8LA 1IBLQ 3K81C 3U4ZA 5BR8Q 2VW9A 3K7AH 1KD1C 1HZBA 1QVCA 2IHFA 2V1CC 2IHEA 4C3JH 4DUZQ 1CKNA 1NY4A 4K0KL 2K5NA 4B3TQ 3OTOQ 3ZJYC 1UE1A 4BBSH 1X65A 1XMQL 1U0LA 2AMCB 3M3YH 3H3VI 1U5KA 1E3PA 1SMXA 4DR3L 1EWIA 1VQ4A 5IT9c 2IY5B 5FLMH 1WJJA 1TWFH 4X66L 2E2JH 3JC66 2Q2TA 2AHOB 2UUBQ 1EUJA 4L5RC 1UE5A 4LF7Q 4QJFA 1TXYA 3I55A 4LWCA 2JA5H 3HOYG 4YWKA 3CMEA 1FJGL 2ZTEA 4JI1Q 1L0WA 3HOVG 4GN4B 3ULLA 4R4OA 4JI8L 3I2ZA 4HIMA 4A76A 3GTMH 4IPDA 1AH9A 4AIMA 2MNAA 1XMOL 4NXMQ 3PGZA 3M4OH 2R93H 5FLXc 1N36L 4KLKA 1KQSA 1HNZQ 4C2MH 3E0EA 1Y1VH 3J81j 5LMNL 3S15H 2N3SA 1K3RA 4YCVA 4X65Q 4B3MQ 4YY3L 2GVBA 4A3DH 5ELNA 2IX0A 3HKSA 3AFQA 4BBSG 2KCTA 2C35B 1VQ6A 3UE0A 1LM0A 2JJQA 2YTXA 1JB7A 4C3IH 1NTGA 3I4MG 2VQFL 4GKJL 3AQQA 3PO2H 1VQCA 5FLMG 4HJ8A 1OTCA 5EAYA 3T1YQ 4JG2A 2IX1A 4UP7A 4JBJA 3NENA 4DV2Q 4A3IH 4GKKQ 3A5ZB 3M4PA 2JA5G 3PO3H 5GQOA 4JYAQ 1PYSB 4A3CG 2F4VL 4DR5L 3KF6A 4LUOA 4OO1I 1MIUA 4YCWA 4DR1L 1XNQQ 2GN5A 1KAWA 1VQPA 3M85A 2D0OA 3F2DA 4UY8C 4YHHQ 1I3QH 4JCVE 4OWXB 3STBC 1PA6A 2R93G 1MJEA 1OXVA 3E9HA 2ZTDA 1UWVA 3KOJA 3CQZH 2WB1G 3KJOA 3S1RH 4MZ9A 4A3DG 1FL0A 5FJ8H 2VQEQ 1LUZA 4LF5Q 4DV5Q 2NZHA 1PH4A 5JJIA 4OXPA 5JEAJ 1IXRA 1A62A 3G48A 3KJPA 1YI2A 2BA1A 3GO5A 1V1QA 3PO2G 3K80C 1L1OC 1L1OA 1WFQA 4HIDA 3K7UC 4LF4L 4QY7A 2KENA 2K75A 1PH1A 4PG3A 4L5QA 2R92H 4A3MH 4A3BH 4BY7H 2PQAA 1PH2A 1P16A 1ASZA 3A5UA 2UXCL 1FVIA 3ULJA 1SFOH 3PO3G 3PUVA 4MNOA 4DUYL 3CCSA 1PH3A 2UXDL 5IYDH 3ERSX 3PF4A 3TREA 3S16H 4K0KQ 1VQLA 5K36G 4DK6C 1J5EL 3CC2A 1CSPA 2N49A 1PHJA 3S1MH 1PFSA 3U4VA 4DAMA 5JEAG 5IP7G 2EQSA 1XMQQ 1N8RC 3S17H 2AKWB 3D0FA 2KBNA 3S1NH 5M5XH 3KF8B 4DR3Q 3PSIA 1E1OA 4JBMA 4P71A 2A19A 2MO0A 1WCMH 5FJ8G 1VQMA 3CCLA 4A3GH 1YNXA 1BVSA 2EXDA 4HJ9A 1DGSA 4DR2Q 3KDFB 5C0XJ 1JJ2A 2WFWA 4HIOA 3M7NA 2R92G 1YZ6A 4BY7G 2YYZA 4A3MG 4A3BG 2LSSA 4JI8Q 5GAEC 2KHIA 1S72A 1KIXA 4HJ5A 2HIVA 3CPWA 3RN5A 1XMOQ 1WYDA 1PYBA 2K14A 5IYDG 1N33L 4BXXH 4JI2Q 3PIOA 1EYGA 4XTCS 5LMNQ 1KHIA 4IPCA 5IYBH 4DNIA 2XGTA 4R4QA 4YY3Q 1YHBA 4YWLA 1YJ9A 4JI4L 3LGJA 4NXNL 1HZAA 2I5HA 1PH8A 4AH6A 1B70B 2OCEA 5C0XG 4IOCA 2VQFQ 4A3EH 4GKJQ 4A93H 3JAMc 2XTIA 3I4OA 1D7QA 1WCMG 4L5SA 2NVQH 1E1TA 3HOZG 4A3GG 1K8AC 1CUKA 1RIPA 1W3SA 4DR7L 2NVYH 3L7ZC 3CD6A 1YVCA 4DR5Q 3AEVA 5IE8A 4IJHA 4DR1Q 2I5MX 5C44G 3GDEA 4AQYL 1HNXL 4B3RL 2OTJA 3FKIH 5M5WH 5IYCG 5M5YH 1QVFA 1XPOA 4POFA 2VUMH 1IBKQ 2HT1A 4BXXG 4A4IA 3NBHB 2AWNA 4P75A 5IYBG 3GTOH 1FGUA 2R7DA 1BBUA 2B3GA 3GD7A 3FP9A 4IO9A 5GAGC 4IPGA 4GOPA 4GOPC 4JI6L 3S2HH 1XPUA 1HNWL 4HIKA 1QZHA 4L5TA 2NN6G 4DKAC 4HJAA 4DV0L 2DGYA 1YJNA 2JA8H 1X56A 4DV4L 4LF8L 4OWWB 2VY3A 4A93G 4LF4Q 2F3IA 3CCJA 1NE3A 3I7FA 3B6YA 2CQOA 2JA6H 2UXBQ 1VQ8A 2ALYB 2UXCQ 2KHJA 3HOUH 3S1QH 4DUYQ
chains in the Genus database with same CATH superfamily
1HTPA 3U58A 3OWFA 3EQLC 2A5HA 4LNQA 2QDLA 2A68C 1DCZA 3HOWH 3CP0A 4FVMA 4ZK9B 1GUSA 2AWOA 4X3UA 4HCEA 3CCQA 2F0MA 2VUMG 4LUZA 5M3MH 3HOWB 3GTKH 3SK4A 3K59A 4J6HA 2PZTA 1SYCA 2J7ZA 5M3MB 3BJUA 3ER0A 3GTKB 4JI7Q 2IL8A 3TSSA 3K6OA 1EOVA 1Q86C 2AQ2B 1VQBA 2K03A 3MXNB 3GV6A 3D6WA 1QUQB 1SJED 5DEHA 3HZXA 1JWUD 3HOWG 3FRPB 1J8IA 4TSSA 3HFZB 5E1FA 2RSOA 5M3MG 2QEXA 2Q8RE 1H9KA 1WTVA 1IBML 2AQ1B 2XN9C 2HQEA 1VCIA 2L55A 1K9MC 4DR7Q 3U50C 4HCSA 2GVAA 2WP8J 4PMCA 2WB1E 3HS0C 2LS01 2HDMA 4A3IG 3SGIA 3RLOA 1YBYA 2EOTA 4B3RQ 1KAAA 1MI2A 2VNUD 1JQYD 2VZAA 1PZJD 1SNQA 2Z6KC 2Z6KA 1GKHA 5KYIA 5EKIA 3JAMi 3GTJH 3M4YA 1EY9A 3URYA 4JI3L 1HNWQ 1SR3A 4F87A 3GTJB 1HA5A 5EBCA 2YTYA 1Q8KA 4FNFA 1X9NA 2JN4A 4LFBL 1BCPF 4M1UB 3RR5A 2M9VA 1JC7A 2E8GA 1TWGH 3W2DA 2CH4W 4JK1C 5BN3A 4QIWB 2KVMA 2HCIA 1GUGA 4IQZA 3TQYA 3SE0A 1TS4A 2EY2A 2FHTA 3AFPA 1I94Q 1RJTA 3I3CA 2HIXA 3BZKA 3TS0A 3PUXA 1XNRL 4GKKL 3D8GA 1Q90A 3P1HA 1D6EC 3ICEA 3CCVA 2E2HH 1A3TA 4N9PA 5C4XH 2N78A 3KF6B 1I50H 4RHSA 2E2HB 3N6RA 5C4XB 1VQFA 2K5HA 4FYDA 1I50B 1QG7A 2Z1CA 2VQEL 3RLFA 4LF5L 1QCBD 3KBGA 3KYHC 1QVGA 4O2DA 1EY5A 3M9BA 3EA6A 4RCOA 2QA4A 3DEOA 1O7IA 1L1OB 3RZDH 1HZ9A 1FYCA 1G6PA 5COYA 4JI5Q 4K8JA 5J1ZA 1VQ5A 3RZDB 4CHTB 1HFGA 4I7ZC 5C4XG 2F4IA 1LLRD 3FEWX 2N88A 1EZ6A 3J80L 3MHBA 1A63A 3NK9A 2B63H 1U4PA 4BA2I 1WTHA 1JE5A 4DXFA 4HMJA 4V0BA 4A3CH 2V4DA 2B63B 3NTIA 4QUFA 4U68A 4TRDA 5CC4A 2IT1A 2EYMA 4JI2L 4Y7NB 3DMUA 5M3FH 1VQJA 1RF2D 3MFYA 2VS1A 3UE1A 5IWAQ 5L37A 3AYHB 3H3VH 5T1GA 5M3FB 4NXNQ 5BN4A 3GV3A 5IY0A 5LHY1 3I4NH 1PTOD 1JMCA 3S14H 2DUDA 1CM9A 2F3WA 1HZCA 2XRSD 2B63G 3I4NB 2OF1A 3F2CA 2DY7A 3SVMA 3S14B 1B44D 2F0EA 1PTOC 4BA1I 3D3RA 4YWMA 3TN2A 3A8IE 2F0UA 4RKLA 4DR4Q 5C4JH 5I2XA 4O42A 3MEFA 1PMRA 5M3FG 1LO5D 4KY7A 3TMEA 5C4JB 4HSPA 2EYOA 3Q8DA 2UU9Q 1PRTD 5D3DA 4AYBE 3VR6A 1D5ZC 2EVBA 3L2PA 3I4NG 3DUZA 2ZJPA 1AEXA 1F77A 1H9RA 4LF8Q 5JOBA 1NR4A 2UXBL 1I5FA 1BDOA 4N9TA 4H44C 1Z47A 3OIQA 1WOCA 1PH9A 2L4NA 4OO1H 1N32Q 2MFIA 3SK5A 3BZDB 4LF9Q 3AU7A 1Y1WH 2JK8A 3DEPA 1GXDC 4B3ML 2NVTH 4X65L 1Y1WB 4L63B 4JC0A 3J7A5 3HOZH 3RN2A 2NVTB 1CHQD 2L5TA 4JI7L 1A15A 1QE6A 1WTQA 2H5XA 4LK1C 1BOSA 5KRUA 5C44H 3O13A 1N34Q 1QOHA 4UP8A 4C3HH 2JQOA 4OO1G 1S3OA 3KLSA 3CMAA 1F9PA 2B2YC 2B2YA 4QL5A 4C3HB 1Q12A 2R6GA 4PMWA 3MVVA 1Y1WG 2EY5A 4X64Q 1GVPA 1MSHA 3JAML 1R9TH 3TEHB 1RTNA 4KKSA 3KK7A 3EBEA 1KABA 3DWPA 2WAQE 3OIPA 4DA2A 1R9TB 3HOYH 3DHQA 3RLNA 1STHA 4U673 1JJCB 1P8LA 5BR8Q 3HOYB 1LABA 1FNVA 2IHFA 1G2TA 1RTOA 1HQRD 3OSOA 1KDCA 1CKNA 2GA4B 4OEMB 1PZKD 3T56B 4C3HG 5FO9B 1A3VA 3M3YH 4DFAA 2F0SA 3LWUA 1VQ4A 3BVGA 1ZXTA 2K33A 2P5ZX 4RA8A 1JB3A 3M3YB 1B53A 3I4MB 5EKKA 2AHOB 1YNNC 1T5XD 1Y69U 2UUBQ 1EUJA 3GQBA 3ZYYX 4QJFA 1TXYA 3HOYG 1PTOF 1ESFA 4G4KA 4R4OA 3IKJA 3BYTB 1XMOL 4NXMQ 2G5DA 5CV7A 1Z7TA 4PMBA 5FLXc 1KQSA 4KLKA 1HNZQ 3VYTA 3NQTA 1Y1VH 3J81j 4PNYA 2KHSA 3HKSA 2X6LA 5C4ZA 2KCTA 1VQ6A 2YTXA 3I4MG 4GKJL 1EWHA 1EY4A 3A7AB 1VQCA 4FP5D 1IW7D 4JG2A 4DV2Q 1PRTF 1AZPA 3PO3H 1E2WA 4CJ1B 1WTXA 3BDLA 4ZUIA 2BE5D 3MFGA 1MIUA 2MP1A 4YCWA 1IW7C 1XNQQ 3PO3B 2O5JC 1KAWA 1TY2A 2D0OA 4X3SA 5JEAH 3F2DA 2B2TC 2B2TA 4OWXB 3STBC 1PA6A 2KJXA 1OXVA 3E9HA 5D3IB 2BE5C 4MZ9A 5IGCA 1FL0A 4DV5Q 2NZHA 2RDHA 2C9OA 4OXPA 4K5XA 3KJPA 1YI2A 2HUGA 3GO5A 4QY7A 1PH1A 4PG3A 4BY7H 1Z6HA 1MSGA 3PO3G 3PUVA 4BY7B 2G9HD 3ERSX 4KHVA 3S16H 5K36G 2E75C 1S5BD 2H1EA 2HD3A 4DK6C 1VQLA 5CV6A 4IUVA 3CC2A 1CSPA 2TMPA 2CHBD 1PFSA 4RHRA 5JEAG 3HRZC 3D0FA 5M5XH 1JWMD 4DR3Q 1ENCA 1E1OA 2KEDA 5M5XB 4KD3A 4DR2Q 1SBBB 4HIOA 1ONLA 3MXNA 2B2WC 2B2WA 4BY7G 1FR3A 2KHIA 3CPWA 3RN5A 4FF1A 2K14A 1N33L 1IL8A 2K5WA 2OEOA 2MGSA 4DNIA 4FO2A 5IYBH 2JSOA 2F0IA 2Q8IB 5JPMC 4MHEA 4YY3Q 4M8AA 5KNCA 1YJ9A 2EXZA 2E76C 3LGJA 4NXNL 4G57A 1PH8A 1SYBA 1D7QA 2BOSA 4DNTB 5ISRA 5T1IA 1O7YA 3A7LA 2LKVA 1AFPA 1K0SA 3MXGA 3WOFA 5M5WH 4OIKA 5IYCG 3OOCA 3BVZA 5M5WB 2Z4IA 1O7LA 1S5FD 5IYBG 1BBUA 3D4WA 2K05A 4JI6L 1LT6D 4HIKA 1QZHA 4NKLA 4DV4L 4LF8L 4LF4Q 1HUMA 1NE3A 1GOZA 3I7FA 1AZQA 2JA6H 2FMMA 1LT4D 2UXCQ 1I4XA 1HHVA 3S1QH 1JICA 4DUYQ 1QZGA 2JA6B 2NB0A 5EPKA 1EYCA 5GADC 2EZVA 3S1QB 1DONA 3RZOH 3NSWA 4NPSA 3I91A 2AUJD 2F0DA 1B3AA 2K5DA 3RZOB 1TWAH 2HDLA 3CKIB 4DNRB 1B3QA 4TVAB 1EQTA 4GS3A 2PNHA 2SEBD 4NB3A 4UPAA 1BO0A 1AP0A 1TWAB 4WFN3 2N8NA 1LTRD 2CFMA 1S5DD 2K5VA 1GHJA 1HR0Q 2SOBA 4CDDC 1PV4A 1EZ8A 4IZ8A 1RL2A 2XNAC 5DAUA 2UUCL 4DV6L 2RDGA 1U9RA 3CAMA 2RA4A 4KHPL 5HY6A 4IN3A 5EBDA 3F8TA 1H9JA 1NNXA 4EQPA 4J1MA 3T1HL 3UDGA 3H94A 2OTLA 4YCUA 1C0AA 1PH6A 4AQYQ 1HNXQ 4R1JA 2NUCA 2ZJRA 1XTDA 1CKNB 1EIFA 4Q0FA 3SHLA 3R2IA 4ZKCB 2BA0A 1WTOA 1SROA 3EJIA 2NN6I 4CKEA 1IZ6A 4DAVA 1L2FA 1TT2A 1E24A 4DV0Q 2I0QA 2J4XA 2UUBL 1EFWA 2PMZB 4PZ7A 5IODA 4XYOA 1SLJA 3KLRA 4NXML 2A8VA 5K5PA 1N9WA 4KD4A 4CDCC 4JOIC 4JOIA 1ILQA 3TP6A 4L8JA 5EGTA 1A0IA 3Q0AA 4DV7L 4KV6A 5E7NA 5C3EH 3I73A 3PIPA 1FD7D 2JE6I 1K8MA 3RUZA 2Y0SB 5JJKA 5C3EB 1XPRA 1VQ9A 4UDUC 4DV2L 2NTTA 4A3EB 1LTSD 1PH5A 4LFCL 4XQJA 2E5LL 1OO9B 2K32A 2DJFC 1C48A 2F4VQ 2K28A 4X62Q 4DV1Q 2F0VA 3I72A 2IPKD 1E22A 4C1NK 2NZOA 4XYQA 1PH7A 1ZYRD 1HFNA 4QGUA 1ZKOA 3CCUA 3J81E 2FJ2A 4A3KH 2Y0SG 1PFMA 3DM1A 5C3EG 4QIWE 1OXSC 4A3KB 3VR4A 4DR6L 3BS1A 4A3EG 4DV3Q 3S2HB 1AW7A 1V9PA 2MO1A 4DK3C 3K8AA 2BH2A 1GUTA 4LFAQ 3CF5A 2C5CA 4NP5A 2BDNA 1UE7A 1T9HA 4A75A 4FDBA 4APVA 3OMGA 1M4VA 5I4DA 4A3KG 3SR1A 3TRZA 1BR9A 4DR2L 1X6OA 4CGYB 4MTNA 2WV6D 5CV8A 4CKBA 1V1PA 1Y8NB 4JI0Q 2Z8LA 4OX9L 3BU2A 3SDZA 4ZLTF 1YIJA 2KCMA 2NVXH 5FLXL 2EDGA 3C1EA 2CWAA 2I5LX 3S9WA 3CXCA 2NVXB 3K0YA 2EY6A 2L15A 3EVQA 3QOJA 4IPHA 5G3LD 3NELA 3BZCA 4Y52H 1YHQA 4F88A 5KYLA 1GUOA 3N52A 3CCMA 3ND9A 3KFUA 2BH8A 4QMGA 3CC7A 1AE2A 1C9OA 1MKHA 5AJ3Q 4ALPA 1SXTA 4ME5A 4B3SL 1O78A 2K52A 4HEDA 2F0QA 4K5WA 1I4HA 2ZM6Q 3W5OA 1IBLL 1X3QA 1R4QB 4JBWA 1RKNA 2RQXA 1BBXC 4MIUA 1KC8C 2QEJC 1Q82C 5IGDA 1KLUD 5ELOA 3H15A 1YHAA 5H1SE 2PPBC 1LTBD 2Q2HA 3Q22A 2DJGC 2EYFA 2ATWA 2M00A 4ZRZA 2RBMA 4EX5A 3TS2A 4IOAA 5M9OA 2CWPA 4LF6Q 2NZ1D 2E74C 4PZ8A 1TWHH 2I46A 2RKSA 3Q23A 1QB5D 4N8X1 1TWGB 2HHHQ 1EWCA 1TWHB 1EQVA 1CA6A 2NWGA 3UDIA 3W1GA 1EU4A 3E3XA 3RD4A 1VQIA 4IFDI 1I4RA 2RCFA 2UUAQ 2D9UA 3VYRA 3NWTA 1HR0L 1UEBA 5FK9C 2OQKA 2Q2IA 2HQLA 2ZTCA 2OT2A 4YHHL 1F9QA 3K57A 1X3GA 5LMUQ 4PQXA 1WD1A 1LTLA 4JV5Q 3G6EA 3TP5A 3HOVH 2WINB 3K81C 2VW9A 1HZBA 1QVCA 2EYLA 2V1CC 1SYGA 3HOVB 1MD2D 1VMPA 1EY8A 2LFNA 4KTAA 4K0KL 1O7ZA 3V96A 3OTOQ 3ZJYC 1S4ZA 1XMQL 2AMCB 4XT1B 3H3VI 1U5KA 1K3BC 1EIGA 1SMXA 1UEAB 1EWIA 5IT9c 5G3LF 3R8BA 1WJJA 2E2JH 1TU2B 1UE5A 2JA5H 3NTKA 3IL8A 4JI1Q 1L0WA 4XQNA 3HOVG 4N8FA 2JA5B 4JI8L 4HIMA 3GTMH 4IPDA 1DOMA 5EQ0A 3M4OH 3GTMB 3E0EA 5LMNL 4A3DH 2GVBA 3M4OB 3AFQA 2C35B 4S3SA 1BXTA 2WB1B 3UE0A 1LM0A 1JB7A 5EKLA 3V2TA 4A3DB 2NYZD 3BDCA 2VQFL 1A2TA 5J39A 2A6HC 5EAYA 3T1YQ 3M4PA 4IUQA 2JA5G 4B9WA 5GQOA 4LAAA 3J7YW 1PYSB 4KMUC 4A3CG 2F4VL 4JYAQ 4OO1I 2F0WA 4DR1L 1IYUA 2GN5A 3M85A 2PZWA 1I3QH 1RHPA 1K8OA 5ELEA 3IAYA 1MJEA 2ZTDA 3S1RH 3CQZH 2WB1G 1I3QB 4A3DG 5FJ8H 1LUZA 4I7AA 4KY5A 5C4HA 5KNDA 3S1RB 3CQZB 4G7HC 1BNZA 2F1MA 4R9WA 4CJ0B 3D4DA 2BA1A 3LWEA 3CRKC 1H9SA 1SAPA 3K7UC 5I9PA 2R92H 2KENA 2FINB 2K75A 4A3MH 3OMCA 2PQAA 4OELB 1SFOH 2R92B 1DZ1A 1PH3A 2FFKB 5FO8B 3CCSA 4A3MB 3IFDA 3QOLA 1SFOB 1O80A 3S1MH 1NAPA 2EQSA 1M8AA 3FMCA 5C0XH 3T13A 3S1NH 1QILA 3S1MB 3PSIA 4JBMA 4P71A 5IGGA 3A56A 1VQMA 5FJ8G 2EJFC 4A3GH 3S1NB 1I6VC 1DGSA 2EPBA 4IUPA 3P7JA 3HOZB 1WTRA 4A3GB 3QB3A 1UNSA 1TKWB 2I07B 1JR0D 3M7NA 2R92G 4KY6A 1HPCA 1V1PB 4WRDA 4A3MG 1S72A 4RWSC 1KIXA 5C44B 4BXXH 3I4LA 3SK6A 3PIOA 4XTCS 4IPCA 1Y8OB 1D2BA 3NUCA 2XGTA 5EJWA 3TP7A 4C1NI 5C0XG 1MHWC 2OCEA 4ODGA 1T5EA 2L1BA 5IGBA 3J80E 1E1TA 3Q24A 3HOZG 4A3GG 1K8AC 1C8CA 1RIPA 1W3SA 2CVRA 2Z6BA 2XVSA 4DR7L 2QILA 1B1ZA 2IW3A 3I70A 2DN8A 4DR5Q 5IE8A 5C44G 3GDEA 4B3RL 2OTJA 3FKIH 4K14A 1K28A 1JOKA 3LX0A 4BXXG 1IBKQ 2HT1A 3FKIB 4P75A 3K5MA 1YNND 4MTKA 3GD7A 3RMHA 3FP9A 4GOPA 5GAGC 4GOPC 4OHJA 1XPUA 4KKUA 1HNWL 2KCNA 3FVQA 1SNOA 2X69A 3VA5A 2JA8H 2VY3A 1CFMA 3HEJA 1TY0A 5IOCA 3CCJA 4EGVA 2JA8B 1VQ8A 1G6ZA 2ALYB 2KHJA 3HOUH 3MEHA 1XXGA 3KLSX 1ZEQX 1SEBD 1W6JA 5NUCA 3TZUA 1E2ZA 2JA9A 3HOUB 2DNEA 4LMQD 3FKIG 2HHHL 2B29A 3DWAA 1S5CD 2LXKA 3TDQA 4B08A 1I94L 2KEEA 1Y1VB 4CDEC 5DM73 4IALA 3E9IA 2KUMA 3OYYA 4IURA 3DWQA 2JA8G 2XRQD 1G291 4CKCA 4JBKA 4ULLA 2F0GA 2R3ZA 5A2QL 3M4QA 5GAHC 2Z0SA 5DLQE 3STBD 1KRTA 1LACA 1WTWA 3SK8A 1RDPD 4AYBB 2A6ED 4K2LA 4JVZA 1HH2P 1FNWA 3GTLH 3S2DH 5LMUL 1HR0W 1Y1VG 2NBFA 2QGQA 3DXJC 3K5NA 3GTLB 2A6EC 4DF7A 2JA7H 3R3OA 3T51B 3S2DB 4NDXA 1KTKA 1NCVA 3PUYA 3AB9A 2JA7B 2RHQB 4DAYB 4GLAC 2BCOA 1B7YB 2PCFB 4BS9A 2K50A 4R4TA 1F9SA 5CORA 4AYBG 4DXGA 3W1BA 4JI5L 3H09A 1KRSA 5C5MA 1GD7A 3QG1A 1W2BA 3S16B 1ASYA 2ES2A 1SE2A 4G7OC 2WACA 1EYDA 2JA7G 1DOLA 1VQEA 5DM63 1B2TA 3MWYW 1TIID 2A69C 1NJIC 2L9HA 2VL6A 1KDAA 2QCPX 4Z9CB 3H0GH 1JCKB 1JJGA 1Y14B 4IUUA 2WAQB 1N36Q 5I6YA 5C5LA 1X32A 5IWAL 3H0GB 5IP9H 1Q1EA 3TBIB 1ICWA 2J0TD 2WKCA 5LMNW 3HKZB 5AFWA 3H91A 5E4XA 3I8ZA 1E2VA 4ZYSA 4V190 4XT3B 4JYAL 3CC4A 5HGTA 1I6HH 1VS0A 2HCCA 3MAQA 3K0XA 2WAQG 1QNUA 1UAPA 3T4AC 3BVMA 4BY1H 4DR4L 1I6HB 1OXUA 1CI3M 3H0GG 5BN5A 2D2CC 3CPFA 3Q6SA 1XWEA 1JWSD 1F9RA 4BY1B 3K58A 5IP9G 1TR5A 3S24A 5KGUA 2UU9L 5DNFA 3TP8A 3EIVA 3MXPA 3HKZG 2Z4HA 4O0AA 1K8GA 1Z9FA 2B8GA 3R2TA 4KKTA 1H9SB 1I4QA 4GN5A 2Y0SE 5ELCA 1NR2A 4IFDJ 2PQAB 1CTMA 2UXDQ 2MHVA 1N32L 1VDZA 4WJWA 2CH4A 1HJPA 1LTAD 4LF9L 1J5EQ 3KF8A 5IT9L 2R7FA 4RGOS 4BY1G 1TS5A 3ONAB 2PW5A 2CQAA 5ELFA 4JI3Q 4K6DA 1SSOA 4ZCKA 3P75A 3KDFA 3J7AV 5J22A 3J80c 1PDQA 4QQBX 4RFBA 2K4KA 1CQFA 1V43A 1S5ED 1SNCA 4LFBQ 2R7ZH 3F1ZA 1DXMA 1CSQA 1N34L 2RCNA 2JA6G 1BBWA 2L12A 4LW1A 5F2DA 2R7ZB 2EIFA 4ABNA 3CCRA 4DK0A 4O1NA 5TSSA 1X54A 4WJ4A 2QF7A 4X64L 2ID0A 2CCZA 4A3JH 3VR5A 3OWEB 3F2UA 5JAVA 3HOXH 1XNRQ 4A3JB 1EY0A 2F03A 4RH6A 1K83H 2PI2E 5BR8L 3HOXB 2R7ZG 3BDOA 1K83B 4IJLA 1VQOA 1STAA 4CDFC 1SN8A 1FNUA 5IP7H 3NBHA 3A8JE 4KN7C 1IBKL 3E5SA 3KUPA 3GTQH 2YV5A 2RVLA 1MGSA 2EE1A 3NPPA 3PUWA 3GTQB 4GOPB 4A3JG 1PXUA 2RF4A 3HOXG 1B9NA 3HP3A 4TQUS 1JT8A 3EROA 1D8LA 5C3WA 1C4QA 4IUNA 4GNXC 4GNXA 3ULPA 1G2SA 4GN3B 2QDBA 1HNZL 1NBWA 3A8KE 2B39A 3EN2A 1GO3E 4HSVA 2JXMB 3A74A 1EIYB 4BWGB 3D4RA 2F52A 1YEZA 3NTHA 1OXXK 3NP8A 1LV9A 2AUKA 1HCZA 1VQNA 4H02A 3D6CA 1EU3A 3T16A 1XJVA 1F2MA 3NWSA 1D1IA 1IYVA 3CRLC 3F2BA 1STEA 1XNQL 5CV5A 3IRBA 3GTPH 2OXPA 2ENBA 2LY7A 4J8QA 4XIGS 1WTPA 1CKOA 2ICEC 5IGEA 3J80i 2E2IH 3U9SA 1EEID 2NN6H 1XYIA 1CK1A 1BKBA 4DV5L 1EYAA 1ET6A 2JP1A 2E2IB 5HGQA 2D5DA 2K1BA 1SMYD 2XWBB 5CMDA 4EVOA 3OW2A 4R4CA 1BCPC 3K7AH 3QO2A 2IX3A 3BG3A 4C3JH 4DUZQ 4IUTA 1SMYC 5KIXA 1NY4A 2K5NA 3K7AB 4B3TQ 4C3JB 4BBSH 1X65A 4DR3L 4BBSB 2IY5B 4OL7A 5FLMH 4EQNA 3JC66 4L5RC 2M2LA 5ELBA 1IKLA 4LF7Q 2CW0D 5I2YA 3C2PA 4GN4B 1I4PA 3FDTA 3ULLA 3QWNA 1ICFB 3PGZA 1EIHA 2CW0C 3OW7A 4C3JG 4DN4M 2R93H 1N36L 1V8QA 2L11A 5CV9A 4C2MH 2N3SA 4YCVA 4X65Q 4B3MQ 4YY3L 2R93B 4HR7B 4BBSG 2X6GA 4TKOB 1B9MA 2H4OA 4C2MB 4C3IH 1NTGA 3PO2H 1J9OA 1WVLA 2SDFA 5FLMG 1OTCA 4HJ8A 4C3IB 2IX1A 3NENA 3PO2B 4A3IH 3A5ZB 1V1OA 2VB2X 5JVG3 3H6MA 4A3IB 1GJXA 3PQIA 3A54A 3G6JB 4UY8C 5C3XA 2R93G 1LTID 1LT3D 1KNAA 2VB3X 3KOJA 3KJOA 4CBVA 3X3NA 1PH4A 2K01A 5JJIA 5JEAJ 4GZYC 3HG9A 4C3IG 1V1QA 3PO2G 3K80C 4LF4L 1ENFA 1HRJA 4L5QA 1PH2A 2UXCL 3A5UA 4DUYL 5IYDH 2UXDL 1CZWA 3PF4A 1G91A 1J5EL 4DAMA 3S17H 4B9XA 4FF2A 1STNA 2EJGC 2KBNA 3KF8B 3S17B 2EYJA 1CHPD 1II3A 2A19A 3OHXC 2SNSA 1BVSA 4HTHA 3EFXD 3KDFB 3SXHA 1HTLD 2A74C 1PYWD 2LSSA 2O4XA 4HJ5A 2HIVA 1XMOQ 1XTCD 1STYA 1WYDA 5IYDG 4C56C 3A55A 2PQEA 4R4QA 4YWLA 1STGA 1D5MC 4LJZC 4AH6A 1B70B 3PMFA 4GKJQ 1E0BA 2NVQH 4DAYA 2F0TA 2NVQB 1QJOA 3L7ZC 1X3PA 1TS2A 3R93A 3AEVA 2I5MX 4AQYL 1D5XC 2K7VA 1HNXL 5FLXE 2N55A 1QVFA 1XPOA 4POFA 3KBXA 4A4IA 3NBHB 2AWNA 1DYQA 1FGUA 3MXUA 2QW7A 4IPGA 1RD9D 4IFDH 2O2LD 2PW7A 4L5TA 4DV0L 2DGYA 1YJNA 3QIAA 1X56A 4PV1C 4OWWB 1HXYD 3U9OA 3B6YA 4KJOA 2E2JB 5JJZA 1QNKA 1STBA 3C1FA 1CKMA 1NSNS 1GM5A 2ZJQA 2ASBA 3OPOA 4FF3A 1A8VA 2AQ3B 3QJYA 4GNXB 1TQOA 1Q3LA 1Q1BA 4FXKC 4K5VA 3J81c 4PZ6A 2A6HD 2O5IC 1PLFA 1ML0D 3VA7A 4GLXA 1LYLA 5JPNC 4OIJA 3LNNA 4IFDG 4CJ2C 2FXQA 4EQOA 3VR3A 1AE3A 2F3VA 4QB4A 4Y7NH 3G4SA 4BBRH 3NEMA 1K73C 5CBAE 4X62L 4DV1L 2MUYA 2ZT9C 4RGNA 1M90C 1N33Q 1Q46A 4BBRB 1S40A 1ESRA 4A3LH 5C0XI 3WOEA 2BDOA 1LT5D 2OWOA 3G7LA 3PIP3 4DV3L 3BYYB 1E7ZA 3MZ5A 1Q8IA 3K5OA 1IKMA 1SRUA 4RAUC 4DUZL 4H13C 1BCPB 1SE4A 1TVXA 1A6XA 4B3TL 4LFAL 4R8IA 4BBRG 4R8NA 1K0RA 4RGTA 2G9DA 1VF7A 1HUNA 4JW0A 3ND8A 5KNBA 4A3LG 3K5LA 4JI6Q 4K6LA 3PUZA 4LUVA 4X66Q 4DV4Q 1JOOA 3NBIA 4LF7L 3V05A 2EYPA 2LMCB 4JI0L 1PRTC 1FJGQ 1J6QA 3MC0B 4RG1A 3KLWA 1DM0B 3D31A 3DLLA 1A3UA 2JEAI 1OXTA 4ZQ3A 1EY7A 1L0XB 1Q81C 5J3BA 2MJ8A 1SDFA 4GLVB 1B4OA 3SEBA 4G7ZC 1X55A 2D0PA 4L6TB 2RHSB 1WI5A 4P72A 2Q2UA 2KCCA 1X3FA 2MQHA 4EQ5A 5AJ3L 1NMFA 4DU9A 2YU9H 1FGBD 2IWHA 2NTSA 4ZKBB 3T53B 2ZM6L 2B2VC 2B2VA 1SNDA 4OGQC 3NXWA 2YU9B 2F0JA 2YTVA 1VQDA 1F2YA 1KXLA 2D62A 3MA2B 3FPUB 4F8MA 3J81i 2UUCQ 4DV6Q 1SE8A 4OONA 1TS3A 4XXEA 4RKBA 2IJ0A 3L0OA 5HURA 4KHPQ 4HJ7A 1RODA 5CR3A 1LTGD 1PVOA 5E4WC 1PFNA 2JEBI 3T1HQ 3VYUA 4KHZA 1U4MA 4A3FH 2SNMA 1JORA 1SYEA 3PF5A 3ERQA 3C3LA 1WD0A 2CKZB 4A3FB 1VQKA 4POGA 4WJ3M 2F0KA 1D1KA 4LF6L 2F0LA 4RCNA 3TZDA 2ZXPA 3HKZE 3CHBD 3WDNA 1X3EA 2R61A 2KQ3A 4P74A 3I4MH 4XQQA 4OWTB 1VMCA 1I4GA 4H7BA 4X3TA 2MPMA 2UUAL 1UE6A 4A3FG 2TSSA 1CT1D 1EOTA 3UDFA 3I90A 5D65A 3RNUA 5E3FA 2PO4A 3WWVA 2A1AA 3HOUG 4P2CB 1M1KC 1DD2A 2K04A 1SJHD 4K8IA 4ME3A 1B8AA 4DV7Q 5FO7B 4UP9A 3G71A 4JI4Q 2WIIB 3GP7A 1IYJB 5A35A 1GUNA 4NMZA 4FF4A 1SE3A 4KN4C 4H0LC 1B50A 4JV5L 2K6AA 5EPJA 2XIWA 2XWJB 1EL0A 1CZGA 3PCOB 4LFCQ 1C7YA 2E5LQ 3L3OC 1EQQA 5K36H 1MJCA 3J7ZC 3CCEA 1W6KA 4FXGC 1KL9A 1Q7YC 3OTOL 3CU7A 4J15A 2KA7A 1EQRA 4RMFA 1VQHA 2A69D 2VXWA 4HMIA 3ITPA 2KOLA 3X3MA 4DR6Q 1VQGA 3JAME 2Z9HA 1MBYA 3CW2C 4XDXA 2XSCA 4FXDA 4X6AH 1EFID 2F0HA 4JI1L 2ZXRA 1U4LA 2RDFA 1DOKA 3GTGH 2DY8A 4QCLA 1TWCH 1VQAA 3DM3A 4F7XA 2LXJA 4RGMA 5CV4A 3I56A 3GTGB 2PI2A 1IHZA 1TWCB 1YJWA 1G8ZD 3C46A 1HA6A 4ZAIA 1YITA 4I65A 4DPGA 3PV0A 3VDYA 4HAEA 1VF5C 3FHWA 3QR8A 5GROA 4UAIA 3HGBA 1KNEA 3T1YL 4OX9Q 1F2ZA 1QUQA 2OQ0A 1IL2A 3VR2A 1L0YB 5IYCH 1SYDA 2F0PA 2PMZE 5KEEA 2B2UC 2B2UA 2JYOA 3A0JA 1H95A 4R4IA 3P20A 2ZXOA 1JE4A 3W3AA 1NMGA 1G51A 3MTSA 1PFBA 3UDXA 4DAPA 1YNJD 4KI0A 1LTTD 2QKIC 4B3SQ 1IBMQ 1DJRD 5JJLA 1PTOH 4P73A 3NHHA 1IBLQ 3U4ZA 1YNJC 3NQIA 4ID6A 1KD1C 1PTOB 2IHEA 4HN7A 5FOBB 5IIFA 5A2QE 3IFTA 4ILWA 1UE1A 2E2DC 5I6WA 1U0LA 4QUCA 1PZID 1E3PA 4DK1A 1TWFH 4X66L 2Q2TA 1JOQA 3I55A 4LWCA 1TWFB 1KDBA 1U4RA 4YWKA 3CMEA 1FJGL 2ZTEA 2Q8TA 1CA5A 1PRTB 3I2ZA 4A76A 1AH9A 4AIMA 2MNAA 3J81L 5I9OA 3S15H 2A73B 1K3RA 5LL6S 5ELNA 2IX0A 1KLGD 2L0CA 4Q5VA 3NE5B 2JJQA 3S15B 1EEFD 4DGZA 3AQQA 2PYKA 5EPLA 2DNCA 2PZUA 4UP7A 4JBJA 5IGFA 3L9AX 4GKKQ 1AN8A 1R4PB 5JVH3 3UI2A 4DR5L 1A2UA 3KF6A 4LUOA 5CBEE 1VQPA 4YHHQ 4JCVE 1ENAA 1CQVA 3PIO3 1UWVA 2VQEQ 4WORA 4LF5Q 1IXRA 1A62A 3G48A 1L1OC 1L1OA 1WFQA 2KECA 2PNRC 5ELDA 4HIDA 4A3BH 5CGKA 1SYFA 1UUPA 1P16A 2B8FA 1ASZA 1FVIA 3ULJA 2EJMA 4MNOA 4A3BB 2FMCA 4K0KQ 3TREA 1GUWA 3VYSA 5D14A 4QF4A 3AMUA 4UHVA 2N49A 1PHJA 3U4VA 5IP7G 1XMQQ 1N8RC 2AKWB 1H9MA 1ILPA 2MO0A 1WCMH 3CCLA 2F0OA 1YNXA 2EXDA 4HJ9A 1SNPA 2RSNA 1WCMB 2WKDA 5C0XJ 1JJ2A 2F0FA 2WFWA 1YZ6A 5CYUA 2YYZA 4A3BG 4JI8Q 5GAEC 2EYHA 5FKAC 1BUVT 1PYBA 1QWYA 4KJNA 4JI2Q 2F0NA 1EYGA 5LMNQ 1KHIA 1Y8PB 4ZUJA 4KK7A 1YHBA 4JI4L 4JPBW 3H3VC 1HZAA 2I5HA 1XX8A 3M7GA 5IT9E 4IOCA 4A3EH 1NUCA 3GTPB 2VQFQ 4A93H 3JAMc 2XTIA 3I4OA 1BCPD 1WCMG 4L5SA 1CUKA 4A93B 2NVYH 3CD6A 4X3KA 4E6IA 1YVCA 1SNMA 5LL6X 3FPPA 2EY1A 2K5QA 4YIJA 4IJHA 4DR1Q 2NVYB 5M5YH 3J7AF 5C6AA 3E6ZX 2VUMH 4NW2A 2ICIA 3GTOH 4MN3A 2R7DA 5M5YB 2B3GA 4IO9A 3S2HH 2VUMB 1RCVD 1GHKA 3E0JA 1BQQT 1ZYRC 3GTOB 2NN6G 4K2KA 4DKAC 4HJAA 4A93G 1BF4A 2F3IA 1F2LA 2CQOA 2UXBQ 1EY6A 1HQMC 2A68D 1ET9A 1VQ7A
chains in the Genus database with same CATH topology
1QZGA 1CKMA 3U58A 2JA9A 1GM5A 2ZJQA 2ASBA 4LNQA 5GADC 1A8VA 3HOWH 3CP0A 4GNXB 3FKIG 2HHHL 3RZOH 2B29A 2AWOA 4NPSA 1Q1BA 3CCQA 2VUMG 4LUZA 5M3MH 3J81c 2LXKA 4PZ6A 3GTKH 1I94L 4GLXA 1LYLA 1TWAH 3E9IA 3BJUA 3ER0A 4TVAB 4JI7Q 4GS3A 3OYYA 4IFDG 2PNHA 2FXQA 4NB3A 4UPAA 2JA8G 1G291 4JBKA 2N8NA 1AE3A 2CFMA 2K5VA 4Y7NH 1EOVA 3M4QA 2Z0SA 5GAHC 1Q86C 1HR0Q 3MXNB 1VQBA 5DLQE 1KRTA 3STBD 3G4SA 1PV4A 4BBRH 1QUQB 3NEMA 4X62L 4DV1L 1K73C 1M90C 1N33Q 1RL2A 1Q46A 2UUCL 4DV6L 1HH2P 3GTLH 3CAMA 1S40A 3HOWG 5HY6A 5LMUL 3S2DH 4KHPL 1HR0W 4A3LH 5C0XI 1Y1VG 2QGQA 3F8TA 3HFZB 5M3MG 2OWOA 2JA7H 2QEXA 3T1HL 3PUYA 1IBML 2RHQB 4DV3L 1VCIA 4DAYB 4GLAC 1K9MC 1E7ZA 3U50C 3UDGA 1B7YB 4DR7Q 2GVAA 2WP8J 4YCUA 2OTLA 1C0AA 2K50A 2WB1E 4R4TA 1SRUA 4A3IG 4DUZL 3SGIA 1PH6A 3RLOA 4AYBG 1YBYA 3W1BA 4AQYQ 4B3TL 4JI5L 1HNXQ 4R1JA 4LFAL 4B3RQ 2ZJRA 4BBRG 1XTDA 2VNUD 1K0RA 2VZAA 1KRSA 1CKNB 1GD7A 2Z6KC 1EIFA 2Z6KA 1W2BA 1GKHA 2BA0A 3GTJH 3JAMi 1ASYA 1SROA 4A3LG 2ES2A 4JI3L 4JI6Q 2NN6I 3PUZA 1IZ6A 4LUVA 1HNWQ 1L2FA 1SR3A 1E24A 4DV0Q 4X66Q 2JA7G 4DV4Q 2I0QA 2UUBL 1EFWA 1VQEA 2YTYA 4PZ7A 1Q8KA 4LF7L 4JI0L 1X9NA 1NJIC 1FJGQ 4LFBL 2VL6A 1J6QA 3RR5A 1SLJA 2E8GA 1TWGH 4RG1A 3KLWA 4NXML 2A8VA 1N9WA 3D31A 3DLLA 3H0GH 4JOIC 4JOIA 1JJGA 1Y14B 2JEAI 1N36Q 1OXTA 1A0IA 3TQYA 4DV7L 5IWAL 1Q81C 5J3BA 5IP9H 5E7NA 5C3EH 1Q1EA 4GLVB 3PIPA 1X55A 3AFPA 1I94Q 2JE6I 2D0PA 5JJKA 2HIXA 1WI5A 2RHSB 4P72A 2Q2UA 1XPRA 1X3FA 2MQHA 3BZKA 4EQ5A 1NMFA 3PUXA 5AJ3L 3TS0A 1VQ9A 1XNRL 5LMNW 4DV2L 2YU9H 4GKKL 2ZM6L 1PH5A 4LFCL 2E5LL 4JYAL 3CC4A 2YTVA 3ICEA 3CCVA 1I6HH 1VQDA 1VS0A 2E2HH 2F4VQ 4X62Q 4DV1Q 1KXLA 2D62A 5C4XH 3K0XA 1E22A 2WAQG 2NZOA 2N78A 3KF6B 1I50H 3J81i 2UUCQ 4DV6Q 4BY1H 1SE8A 1OXUA 4DR4L 4OONA 3H0GG 1PH7A 1VQFA 2K5HA 3CPFA 3L0OA 4QGUA 4KHPQ 4HJ7A 3CCUA 2VQEL 3RLFA 4A3KH 4LF5L 2Y0SG 5IP9G 1PVOA 3S24A 5C3EG 4QIWE 1OXSC 2UU9L 2JEBI 3EIVA 3KYHC 3T1HQ 3HKZG 4KHZA 1QVGA 4DR6L 4O2DA 4A3EG 4A3FH 3M9BA 4O0AA 1V9PA 1Z9FA 4DV3Q 3PF5A 1K8GA 2MO1A 2QA4A 4DK3C 1O7IA 1L1OB 2CKZB 4GN5A 3RZDH 1HZ9A 1VQKA 2Y0SE 4POGA 4WJ3M 3K8AA 2BH2A 4LF6L 4IFDJ 1G6PA 2PQAB 3CF5A 4LFAQ 4JI5Q 2UXDQ 1VQ5A 1N32L 3HKZE 4WJ4A 1UE7A 1HJPA 1T9HA 1X3EA 4LF9L 4A75A 1J5EQ 5C4XG 4FDBA 4P74A 2R7FA 4BY1G 3I4MH 4APVA 4OWTB 4JI3Q 4A3KG 3KDFA 3TRZA 1A63A 3J80c 4DR2L 2B63H 1X6OA 4QQBX 2UUAL 4BA2I 2K4KA 4MTNA 1JE5A 1UE6A 4JI0Q 4OX9L 1V43A 4A3FG 4A3CH 3BU2A 4LFBQ 2R7ZH 3UDFA 3F1ZA 1YIJA 2KCMA 1CSQA 1N34L 2NVXH 2RCNA 2JA6G 1BBWA 4LW1A 3RNUA 2CWAA 2I5LX 2IT1A 2A1AA 3WWVA 3HOUG 2EIFA 3CXCA 4JI2L 1M1KC 2L15A 3CCRA 4ME3A 5M3FH 1VQJA 1B8AA 4IPHA 4DV7Q 2VS1A 3NELA 1X54A 3UE1A 5IWAQ 3AYHB 3BZCA 4Y52H 1YHQA 4UP9A 3H3VH 3G71A 4X64L 3CCMA 2ID0A 4JI4Q 2BH8A 2CCZA 3KFUA 1IYJB 4NXNQ 3CC7A 4A3JH 5IY0A 1AE2A 1C9OA 1MKHA 3I4NH 5AJ3Q 1JMCA 4ALPA 3S14H 2DUDA 4B3SL 1XNRQ 3HOXH 2K52A 1HZCA 4JV5L 2B63G 1K83H 3F2CA 2ZM6Q 3PCOB 2PI2E 1C7YA 3W5OA 1IBLL 2E5LQ 4LFCQ 5BR8L 1EQQA 4JBWA 1MJCA 2R7ZG 4IJLA 4BA1I 3J7ZC 4YWMA 3CCEA 1VQOA 1SN8A 5IP7H 1KL9A 1Q7YC 4DR4Q 3OTOL 5C4JH 4J15A 1KC8C 1IBKL 1Q82C 3MEFA 3GTQH 5M3FG 1EQRA 2YV5A 5ELOA 4RMFA 3H15A 1YHAA 5H1SE 2Q2HA 1VQHA 3PUWA 3Q8DA 2UU9Q 4AYBE 4GOPB 2ATWA 4A3JG 4DR6Q 1VQGA 3L2PA 3I4NG 2ZJPA 4LF8Q 2RF4A 3CW2C 4EX5A 3HOXG 3TS2A 2UXBL 4IOAA 4X6AH 4TQUS 1I5FA 4JI1L 1JT8A 1D8LA 2CWPA 1Z47A 1VQ7A 1WOCA 4LF6Q 3GTGH 1PH9A 1TWCH 1VQAA 3DM3A 4GNXC 4PZ8A 4GNXA 2MFIA 1N32Q 1TWHH 2LXJA 3ULPA 4GN3B 4LF9Q 3I56A 1HNZL 2PI2A 1Y1WH 2JK8A 1NBWA 1YJWA 2HHHQ 4B3ML 3EN2A 1GO3E 4X65L 2NVTH 3A74A 1EIYB 2F52A 1YEZA 4JC0A 3UDIA 3W1GA 3J7A5 3HOZH 1YITA 3RN2A 1OXXK 3VDYA 4DPGA 3PV0A 1VQIA 4IFDI 4JI7L 3FHWA 5GROA 2UUAQ 1VQNA 2H5XA 4H02A 3T1YL 4OX9Q 1XJVA 1QUQA 5C44H 2OQ0A 1HR0L 1N34Q 1UEBA 1IL2A 2OQKA 4UP8A 3F2BA 5IYCH 4C3HH 2Q2IA 1XNQL 2JQOA 2HQLA 2ZTCA 4OO1G 1S3OA 2PMZE 3CMAA 4YHHL 3IRBA 3GTPH 3A0JA 4QL5A 4XIGS 1Q12A 2R6GA 1H95A 4PMWA 1CKOA 1X3GA 4R4IA 1Y1WG 5LMUQ 3J80i 2E2IH 4X64Q 1GVPA 1NMGA 1BKBA 4DV5L 1R9TH 1G51A 3TEHB 3UDXA 4KI0A 5HGQA 4B3SQ 3EBEA 3HOYH 1LTLA 2WAQE 1IBMQ 4JV5Q 3RLNA 5JJLA 1JJCB 3OW2A 4R4CA 3G6EA 4P73A 3HOVH 1P8LA 1IBLQ 3K81C 3U4ZA 5BR8Q 2VW9A 3K7AH 1KD1C 1HZBA 1QVCA 2IHFA 2V1CC 2IHEA 4C3JH 4DUZQ 1CKNA 1NY4A 4K0KL 2K5NA 4B3TQ 3OTOQ 3ZJYC 1UE1A 4BBSH 1X65A 1XMQL 1U0LA 2AMCB 3M3YH 3H3VI 1U5KA 1E3PA 1SMXA 4DR3L 1EWIA 1VQ4A 5IT9c 2IY5B 5FLMH 1WJJA 1TWFH 4X66L 2E2JH 3JC66 2Q2TA 2AHOB 2UUBQ 1EUJA 4L5RC 1UE5A 4LF7Q 4QJFA 1TXYA 3I55A 4LWCA 2JA5H 3HOYG 4YWKA 3CMEA 1FJGL 2ZTEA 4JI1Q 1L0WA 3HOVG 4GN4B 3ULLA 4R4OA 4JI8L 3I2ZA 4HIMA 4A76A 3GTMH 4IPDA 1AH9A 4AIMA 2MNAA 1XMOL 4NXMQ 3PGZA 3M4OH 2R93H 5FLXc 1N36L 4KLKA 1KQSA 1HNZQ 4C2MH 3E0EA 1Y1VH 3J81j 5LMNL 3S15H 2N3SA 1K3RA 4YCVA 4X65Q 4B3MQ 4YY3L 2GVBA 4A3DH 5ELNA 2IX0A 3HKSA 3AFQA 4BBSG 2KCTA 2C35B 1VQ6A 3UE0A 1LM0A 2JJQA 2YTXA 1JB7A 4C3IH 1NTGA 3I4MG 2VQFL 4GKJL 3AQQA 3PO2H 1VQCA 5FLMG 4HJ8A 1OTCA 5EAYA 3T1YQ 4JG2A 2IX1A 4UP7A 4JBJA 3NENA 4DV2Q 4A3IH 4GKKQ 3A5ZB 3M4PA 2JA5G 3PO3H 5GQOA 4JYAQ 1PYSB 4A3CG 2F4VL 4DR5L 3KF6A 4LUOA 4OO1I 1MIUA 4YCWA 4DR1L 1XNQQ 2GN5A 1KAWA 1VQPA 3M85A 2D0OA 3F2DA 4UY8C 4YHHQ 1I3QH 4JCVE 4OWXB 3STBC 1PA6A 2R93G 1MJEA 1OXVA 3E9HA 2ZTDA 1UWVA 3KOJA 3CQZH 2WB1G 3KJOA 3S1RH 4MZ9A 4A3DG 1FL0A 5FJ8H 2VQEQ 1LUZA 4LF5Q 4DV5Q 2NZHA 1PH4A 5JJIA 4OXPA 5JEAJ 1IXRA 1A62A 3G48A 3KJPA 1YI2A 2BA1A 3GO5A 1V1QA 3PO2G 3K80C 1L1OC 1L1OA 1WFQA 4HIDA 3K7UC 4LF4L 4QY7A 2KENA 2K75A 1PH1A 4PG3A 4L5QA 2R92H 4A3MH 4A3BH 4BY7H 2PQAA 1PH2A 1P16A 1ASZA 3A5UA 2UXCL 1FVIA 3ULJA 1SFOH 3PO3G 3PUVA 4MNOA 4DUYL 3CCSA 1PH3A 2UXDL 5IYDH 3ERSX 3PF4A 3TREA 3S16H 4K0KQ 1VQLA 5K36G 4DK6C 1J5EL 3CC2A 1CSPA 2N49A 1PHJA 3S1MH 1PFSA 3U4VA 4DAMA 5JEAG 5IP7G 2EQSA 1XMQQ 1N8RC 3S17H 2AKWB 3D0FA 2KBNA 3S1NH 5M5XH 3KF8B 4DR3Q 3PSIA 1E1OA 4JBMA 4P71A 2A19A 2MO0A 1WCMH 5FJ8G 1VQMA 3CCLA 4A3GH 1YNXA 1BVSA 2EXDA 4HJ9A 1DGSA 4DR2Q 3KDFB 5C0XJ 1JJ2A 2WFWA 4HIOA 3M7NA 2R92G 1YZ6A 4BY7G 2YYZA 4A3MG 4A3BG 2LSSA 4JI8Q 5GAEC 2KHIA 1S72A 1KIXA 4HJ5A 2HIVA 3CPWA 3RN5A 1XMOQ 1WYDA 1PYBA 2K14A 5IYDG 1N33L 4BXXH 4JI2Q 3PIOA 1EYGA 4XTCS 5LMNQ 1KHIA 4IPCA 5IYBH 4DNIA 2XGTA 4R4QA 4YY3Q 1YHBA 4YWLA 1YJ9A 4JI4L 3LGJA 4NXNL 1HZAA 2I5HA 1PH8A 4AH6A 1B70B 2OCEA 5C0XG 4IOCA 2VQFQ 4A3EH 4GKJQ 4A93H 3JAMc 2XTIA 3I4OA 1D7QA 1WCMG 4L5SA 2NVQH 1E1TA 3HOZG 4A3GG 1K8AC 1CUKA 1RIPA 1W3SA 4DR7L 2NVYH 3L7ZC 3CD6A 1YVCA 4DR5Q 3AEVA 5IE8A 4IJHA 4DR1Q 2I5MX 5C44G 3GDEA 4AQYL 1HNXL 4B3RL 2OTJA 3FKIH 5M5WH 5IYCG 5M5YH 1QVFA 1XPOA 4POFA 2VUMH 1IBKQ 2HT1A 4BXXG 4A4IA 3NBHB 2AWNA 4P75A 5IYBG 3GTOH 1FGUA 2R7DA 1BBUA 2B3GA 3GD7A 3FP9A 4IO9A 5GAGC 4IPGA 4GOPA 4GOPC 4JI6L 3S2HH 1XPUA 1HNWL 4HIKA 1QZHA 4L5TA 2NN6G 4DKAC 4HJAA 4DV0L 2DGYA 1YJNA 2JA8H 1X56A 4DV4L 4LF8L 4OWWB 2VY3A 4A93G 4LF4Q 2F3IA 3CCJA 1NE3A 3I7FA 3B6YA 2CQOA 2JA6H 2UXBQ 1VQ8A 2ALYB 2UXCQ 2KHJA 3HOUH 3S1QH 4DUYQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZG A;  1CKM A;  3U58 A;  2JA9 A;  1GM5 A;  2ZJQ A;  2ASB A;  4LNQ A;  5GAD C;  1A8V A;  3HOW H;  3CP0 A;  4GNX B;  3FKI G;  2HHH L;  3RZO H;  2B29 A;  2AWO A;  4NPS A;  1Q1B A;  3CCQ A;  2VUM G;  4LUZ A;  5M3M H;  3J81 c;  2LXK A;  4PZ6 A;  3GTK H;  1I94 L;  4GLX A;  1LYL A;  1TWA H;  3E9I A;  3BJU A;  3ER0 A;  4TVA B;  4JI7 Q;  4GS3 A;  3OYY A;  4IFD G;  2PNH A;  2FXQ A;  4NB3 A;  4UPA A;  2JA8 G;  1G29 1;  4JBK A;  2N8N A;  1AE3 A;  2CFM A;  2K5V A;  4Y7N H;  1EOV A;  3M4Q A;  2Z0S A;  5GAH C;  1Q86 C;  1HR0 Q;  3MXN B;  1VQB A;  5DLQ E;  1KRT A;  3STB D;  3G4S A;  1PV4 A;  4BBR H;  1QUQ B;  3NEM A;  4X62 L;  4DV1 L;  1K73 C;  1M90 C;  1N33 Q;  1RL2 A;  1Q46 A;  2UUC L;  4DV6 L;  1HH2 P;  3GTL H;  3CAM A;  1S40 A;  3HOW G;  5HY6 A;  5LMU L;  3S2D H;  4KHP L;  1HR0 W;  4A3L H;  5C0X I;  1Y1V G;  2QGQ A;  3F8T A;  3HFZ B;  5M3M G;  2OWO A;  2JA7 H;  2QEX A;  3T1H L;  3PUY A;  1IBM L;  2RHQ B;  4DV3 L;  1VCI A;  4DAY B;  4GLA C;  1K9M C;  1E7Z A;  3U50 C;  3UDG A;  1B7Y B;  4DR7 Q;  2GVA A;  2WP8 J;  4YCU A;  2OTL A;  1C0A A;  2K50 A;  2WB1 E;  4R4T A;  1SRU A;  4A3I G;  4DUZ L;  3SGI A;  1PH6 A;  3RLO A;  4AYB G;  1YBY A;  3W1B A;  4AQY Q;  4B3T L;  4JI5 L;  1HNX Q;  4R1J A;  4LFA L;  4B3R Q;  2ZJR A;  4BBR G;  1XTD A;  2VNU D;  1K0R A;  2VZA A;  1KRS A;  1CKN B;  1GD7 A;  2Z6K C;  1EIF A;  2Z6K A;  1W2B A;  1GKH A;  2BA0 A;  3GTJ H;  3JAM i;  1ASY A;  1SRO A;  4A3L G;  2ES2 A;  4JI3 L;  4JI6 Q;  2NN6 I;  3PUZ A;  1IZ6 A;  4LUV A;  1HNW Q;  1L2F A;  1SR3 A;  1E24 A;  4DV0 Q;  4X66 Q;  2JA7 G;  4DV4 Q;  2I0Q A;  2UUB L;  1EFW A;  1VQE A;  2YTY A;  4PZ7 A;  1Q8K A;  4LF7 L;  4JI0 L;  1X9N A;  1NJI C;  1FJG Q;  4LFB L;  2VL6 A;  1J6Q A;  3RR5 A;  1SLJ A;  2E8G A;  1TWG H;  4RG1 A;  3KLW A;  4NXM L;  2A8V A;  1N9W A;  3D31 A;  3DLL A;  3H0G H;  4JOI C;  4JOI A;  1JJG A;  1Y14 B;  2JEA I;  1N36 Q;  1OXT A;  1A0I A;  3TQY A;  4DV7 L;  5IWA L;  1Q81 C;  5J3B A;  5IP9 H;  5E7N A;  5C3E H;  1Q1E A;  4GLV B;  3PIP A;  1X55 A;  3AFP A;  1I94 Q;  2JE6 I;  2D0P A;  5JJK A;  2HIX A;  1WI5 A;  2RHS B;  4P72 A;  2Q2U A;  1XPR A;  1X3F A;  2MQH A;  3BZK A;  4EQ5 A;  1NMF A;  3PUX A;  5AJ3 L;  3TS0 A;  1VQ9 A;  1XNR L;  5LMN W;  4DV2 L;  2YU9 H;  4GKK L;  2ZM6 L;  1PH5 A;  4LFC L;  2E5L L;  4JYA L;  3CC4 A;  2YTV A;  3ICE A;  3CCV A;  1I6H H;  1VQD A;  1VS0 A;  2E2H H;  2F4V Q;  4X62 Q;  4DV1 Q;  1KXL A;  2D62 A;  5C4X H;  3K0X A;  1E22 A;  2WAQ G;  2NZO A;  2N78 A;  3KF6 B;  1I50 H;  3J81 i;  2UUC Q;  4DV6 Q;  4BY1 H;  1SE8 A;  1OXU A;  4DR4 L;  4OON A;  3H0G G;  1PH7 A;  1VQF A;  2K5H A;  3CPF A;  3L0O A;  4QGU A;  4KHP Q;  4HJ7 A;  3CCU A;  2VQE L;  3RLF A;  4A3K H;  4LF5 L;  2Y0S G;  5IP9 G;  1PVO A;  3S24 A;  5C3E G;  4QIW E;  1OXS C;  2UU9 L;  2JEB I;  3EIV A;  3KYH C;  3T1H Q;  3HKZ G;  4KHZ A;  1QVG A;  4DR6 L;  4O2D A;  4A3E G;  4A3F H;  3M9B A;  4O0A A;  1V9P A;  1Z9F A;  4DV3 Q;  3PF5 A;  1K8G A;  2MO1 A;  2QA4 A;  4DK3 C;  1O7I A;  1L1O B;  2CKZ B;  4GN5 A;  3RZD H;  1HZ9 A;  1VQK A;  2Y0S E;  4POG A;  4WJ3 M;  3K8A A;  2BH2 A;  4LF6 L;  4IFD J;  1G6P A;  2PQA B;  3CF5 A;  4LFA Q;  4JI5 Q;  2UXD Q;  1VQ5 A;  1N32 L;  3HKZ E;  4WJ4 A;  1UE7 A;  1HJP A;  1T9H A;  1X3E A;  4LF9 L;  4A75 A;  1J5E Q;  5C4X G;  4FDB A;  4P74 A;  2R7F A;  4BY1 G;  3I4M H;  4APV A;  4OWT B;  4JI3 Q;  4A3K G;  3KDF A;  3TRZ A;  1A63 A;  3J80 c;  4DR2 L;  2B63 H;  1X6O A;  4QQB X;  2UUA L;  4BA2 I;  2K4K A;  4MTN A;  1JE5 A;  1UE6 A;  4JI0 Q;  4OX9 L;  1V43 A;  4A3F G;  4A3C H;  3BU2 A;  4LFB Q;  2R7Z H;  3UDF A;  3F1Z A;  1YIJ A;  2KCM A;  1CSQ A;  1N34 L;  2NVX H;  2RCN A;  2JA6 G;  1BBW A;  4LW1 A;  3RNU A;  2CWA A;  2I5L X;  2IT1 A;  2A1A A;  3WWV A;  3HOU G;  2EIF A;  3CXC A;  4JI2 L;  1M1K C;  2L15 A;  3CCR A;  4ME3 A;  5M3F H;  1VQJ A;  1B8A A;  4IPH A;  4DV7 Q;  2VS1 A;  3NEL A;  1X54 A;  3UE1 A;  5IWA Q;  3AYH B;  3BZC A;  4Y52 H;  1YHQ A;  4UP9 A;  3H3V H;  3G71 A;  4X64 L;  3CCM A;  2ID0 A;  4JI4 Q;  2BH8 A;  2CCZ A;  3KFU A;  1IYJ B;  4NXN Q;  3CC7 A;  4A3J H;  5IY0 A;  1AE2 A;  1C9O A;  1MKH A;  3I4N H;  5AJ3 Q;  1JMC A;  4ALP A;  3S14 H;  2DUD A;  4B3S L;  1XNR Q;  3HOX H;  2K52 A;  1HZC A;  4JV5 L;  2B63 G;  1K83 H;  3F2C A;  2ZM6 Q;  3PCO B;  2PI2 E;  1C7Y A;  3W5O A;  1IBL L;  2E5L Q;  4LFC Q;  5BR8 L;  1EQQ A;  4JBW A;  1MJC A;  2R7Z G;  4IJL A;  4BA1 I;  3J7Z C;  4YWM A;  3CCE A;  1VQO A;  1SN8 A;  5IP7 H;  1KL9 A;  1Q7Y C;  4DR4 Q;  3OTO L;  5C4J H;  4J15 A;  1KC8 C;  1IBK L;  1Q82 C;  3MEF A;  3GTQ H;  5M3F G;  1EQR A;  2YV5 A;  5ELO A;  4RMF A;  3H15 A;  1YHA A;  5H1S E;  2Q2H A;  1VQH A;  3PUW A;  3Q8D A;  2UU9 Q;  4AYB E;  4GOP B;  2ATW A;  4A3J G;  4DR6 Q;  1VQG A;  3L2P A;  3I4N G;  2ZJP A;  4LF8 Q;  2RF4 A;  3CW2 C;  4EX5 A;  3HOX G;  3TS2 A;  2UXB L;  4IOA A;  4X6A H;  4TQU S;  1I5F A;  4JI1 L;  1JT8 A;  1D8L A;  2CWP A;  1Z47 A;  1VQ7 A;  1WOC A;  4LF6 Q;  3GTG H;  1PH9 A;  1TWC H;  1VQA A;  3DM3 A;  4GNX C;  4PZ8 A;  4GNX A;  2MFI A;  1N32 Q;  1TWH H;  2LXJ A;  3ULP A;  4GN3 B;  4LF9 Q;  3I56 A;  1HNZ L;  2PI2 A;  1Y1W H;  2JK8 A;  1NBW A;  1YJW A;  2HHH Q;  4B3M L;  3EN2 A;  1GO3 E;  4X65 L;  2NVT H;  3A74 A;  1EIY B;  2F52 A;  1YEZ A;  4JC0 A;  3UDI A;  3W1G A;  3J7A 5;  3HOZ H;  1YIT A;  3RN2 A;  1OXX K;  3VDY A;  4DPG A;  3PV0 A;  1VQI A;  4IFD I;  4JI7 L;  3FHW A;  5GRO A;  2UUA Q;  1VQN A;  2H5X A;  4H02 A;  3T1Y L;  4OX9 Q;  1XJV A;  1QUQ A;  5C44 H;  2OQ0 A;  1HR0 L;  1N34 Q;  1UEB A;  1IL2 A;  2OQK A;  4UP8 A;  3F2B A;  5IYC H;  4C3H H;  2Q2I A;  1XNQ L;  2JQO A;  2HQL A;  2ZTC A;  4OO1 G;  1S3O A;  2PMZ E;  3CMA A;  4YHH L;  3IRB A;  3GTP H;  3A0J A;  4QL5 A;  4XIG S;  1Q12 A;  2R6G A;  1H95 A;  4PMW A;  1CKO A;  1X3G A;  4R4I A;  1Y1W G;  5LMU Q;  3J80 i;  2E2I H;  4X64 Q;  1GVP A;  1NMG A;  1BKB A;  4DV5 L;  1R9T H;  1G51 A;  3TEH B;  3UDX A;  4KI0 A;  5HGQ A;  4B3S Q;  3EBE A;  3HOY H;  1LTL A;  2WAQ E;  1IBM Q;  4JV5 Q;  3RLN A;  5JJL A;  1JJC B;  3OW2 A;  4R4C A;  3G6E A;  4P73 A;  3HOV H;  1P8L A;  1IBL Q;  3K81 C;  3U4Z A;  5BR8 Q;  2VW9 A;  3K7A H;  1KD1 C;  1HZB A;  1QVC A;  2IHF A;  2V1C C;  2IHE A;  4C3J H;  4DUZ Q;  1CKN A;  1NY4 A;  4K0K L;  2K5N A;  4B3T Q;  3OTO Q;  3ZJY C;  1UE1 A;  4BBS H;  1X65 A;  1XMQ L;  1U0L A;  2AMC B;  3M3Y H;  3H3V I;  1U5K A;  1E3P A;  1SMX A;  4DR3 L;  1EWI A;  1VQ4 A;  5IT9 c;  2IY5 B;  5FLM H;  1WJJ A;  1TWF H;  4X66 L;  2E2J H;  3JC6 6;  2Q2T A;  2AHO B;  2UUB Q;  1EUJ A;  4L5R C;  1UE5 A;  4LF7 Q;  4QJF A;  1TXY A;  3I55 A;  4LWC A;  2JA5 H;  3HOY G;  4YWK A;  3CME A;  1FJG L;  2ZTE A;  4JI1 Q;  1L0W A;  3HOV G;  4GN4 B;  3ULL A;  4R4O A;  4JI8 L;  3I2Z A;  4HIM A;  4A76 A;  3GTM H;  4IPD A;  1AH9 A;  4AIM A;  2MNA A;  1XMO L;  4NXM Q;  3PGZ A;  3M4O H;  2R93 H;  5FLX c;  1N36 L;  4KLK A;  1KQS A;  1HNZ Q;  4C2M H;  3E0E A;  1Y1V H;  3J81 j;  5LMN L;  3S15 H;  2N3S A;  1K3R A;  4YCV A;  4X65 Q;  4B3M Q;  4YY3 L;  2GVB A;  4A3D H;  5ELN A;  2IX0 A;  3HKS A;  3AFQ A;  4BBS G;  2KCT A;  2C35 B;  1VQ6 A;  3UE0 A;  1LM0 A;  2JJQ A;  2YTX A;  1JB7 A;  4C3I H;  1NTG A;  3I4M G;  2VQF L;  4GKJ L;  3AQQ A;  3PO2 H;  1VQC A;  5FLM G;  4HJ8 A;  1OTC A;  5EAY A;  3T1Y Q;  4JG2 A;  2IX1 A;  4UP7 A;  4JBJ A;  3NEN A;  4DV2 Q;  4A3I H;  4GKK Q;  3A5Z B;  3M4P A;  2JA5 G;  3PO3 H;  5GQO A;  4JYA Q;  1PYS B;  4A3C G;  2F4V L;  4DR5 L;  3KF6 A;  4LUO A;  4OO1 I;  1MIU A;  4YCW A;  4DR1 L;  1XNQ Q;  2GN5 A;  1KAW A;  1VQP A;  3M85 A;  2D0O A;  3F2D A;  4UY8 C;  4YHH Q;  1I3Q H;  4JCV E;  4OWX B;  3STB C;  1PA6 A;  2R93 G;  1MJE A;  1OXV A;  3E9H A;  2ZTD A;  1UWV A;  3KOJ A;  3CQZ H;  2WB1 G;  3KJO A;  3S1R H;  4MZ9 A;  4A3D G;  1FL0 A;  5FJ8 H;  2VQE Q;  1LUZ A;  4LF5 Q;  4DV5 Q;  2NZH A;  1PH4 A;  5JJI A;  4OXP A;  5JEA J;  1IXR A;  1A62 A;  3G48 A;  3KJP A;  1YI2 A;  2BA1 A;  3GO5 A;  1V1Q A;  3PO2 G;  3K80 C;  1L1O C;  1L1O A;  1WFQ A;  4HID A;  3K7U C;  4LF4 L;  4QY7 A;  2KEN A;  2K75 A;  1PH1 A;  4PG3 A;  4L5Q A;  2R92 H;  4A3M H;  4A3B H;  4BY7 H;  2PQA A;  1PH2 A;  1P16 A;  1ASZ A;  3A5U A;  2UXC L;  1FVI A;  3ULJ A;  1SFO H;  3PO3 G;  3PUV A;  4MNO A;  4DUY L;  3CCS A;  1PH3 A;  2UXD L;  5IYD H;  3ERS X;  3PF4 A;  3TRE A;  3S16 H;  4K0K Q;  1VQL A;  5K36 G;  4DK6 C;  1J5E L;  3CC2 A;  1CSP A;  2N49 A;  1PHJ A;  3S1M H;  1PFS A;  3U4V A;  4DAM A;  5JEA G;  5IP7 G;  2EQS A;  1XMQ Q;  1N8R C;  3S17 H;  2AKW B;  3D0F A;  2KBN A;  3S1N H;  5M5X H;  3KF8 B;  4DR3 Q;  3PSI A;  1E1O A;  4JBM A;  4P71 A;  2A19 A;  2MO0 A;  1WCM H;  5FJ8 G;  1VQM A;  3CCL A;  4A3G H;  1YNX A;  1BVS A;  2EXD A;  4HJ9 A;  1DGS A;  4DR2 Q;  3KDF B;  5C0X J;  1JJ2 A;  2WFW A;  4HIO A;  3M7N A;  2R92 G;  1YZ6 A;  4BY7 G;  2YYZ A;  4A3M G;  4A3B G;  2LSS A;  4JI8 Q;  5GAE C;  2KHI A;  1S72 A;  1KIX A;  4HJ5 A;  2HIV A;  3CPW A;  3RN5 A;  1XMO Q;  1WYD A;  1PYB A;  2K14 A;  5IYD G;  1N33 L;  4BXX H;  4JI2 Q;  3PIO A;  1EYG A;  4XTC S;  5LMN Q;  1KHI A;  4IPC A;  5IYB H;  4DNI A;  2XGT A;  4R4Q A;  4YY3 Q;  1YHB A;  4YWL A;  1YJ9 A;  4JI4 L;  3LGJ A;  4NXN L;  1HZA A;  2I5H A;  1PH8 A;  4AH6 A;  1B70 B;  2OCE A;  5C0X G;  4IOC A;  2VQF Q;  4A3E H;  4GKJ Q;  4A93 H;  3JAM c;  2XTI A;  3I4O A;  1D7Q A;  1WCM G;  4L5S A;  2NVQ H;  1E1T A;  3HOZ G;  4A3G G;  1K8A C;  1CUK A;  1RIP A;  1W3S A;  4DR7 L;  2NVY H;  3L7Z C;  3CD6 A;  1YVC A;  4DR5 Q;  3AEV A;  5IE8 A;  4IJH A;  4DR1 Q;  2I5M X;  5C44 G;  3GDE A;  4AQY L;  1HNX L;  4B3R L;  2OTJ A;  3FKI H;  5M5W H;  5IYC G;  5M5Y H;  1QVF A;  1XPO A;  4POF A;  2VUM H;  1IBK Q;  2HT1 A;  4BXX G;  4A4I A;  3NBH B;  2AWN A;  4P75 A;  5IYB G;  3GTO H;  1FGU A;  2R7D A;  1BBU A;  2B3G A;  3GD7 A;  3FP9 A;  4IO9 A;  5GAG C;  4IPG A;  4GOP A;  4GOP C;  4JI6 L;  3S2H H;  1XPU A;  1HNW L;  4HIK A;  1QZH A;  4L5T A;  2NN6 G;  4DKA C;  4HJA A;  4DV0 L;  2DGY A;  1YJN A;  2JA8 H;  1X56 A;  4DV4 L;  4LF8 L;  4OWW B;  2VY3 A;  4A93 G;  4LF4 Q;  2F3I A;  3CCJ A;  1NE3 A;  3I7F A;  3B6Y A;  2CQO A;  2JA6 H;  2UXB Q;  1VQ8 A;  2ALY B;  2UXC Q;  2KHJ A;  3HOU H;  3S1Q H;  4DUY Q; 
#chains in the Genus database with same CATH topology
 1HTP A;  3U58 A;  3OWF A;  3EQL C;  2A5H A;  4LNQ A;  2QDL A;  2A68 C;  1DCZ A;  3HOW H;  3CP0 A;  4FVM A;  4ZK9 B;  1GUS A;  2AWO A;  4X3U A;  4HCE A;  3CCQ A;  2F0M A;  2VUM G;  4LUZ A;  5M3M H;  3HOW B;  3GTK H;  3SK4 A;  3K59 A;  4J6H A;  2PZT A;  1SYC A;  2J7Z A;  5M3M B;  3BJU A;  3ER0 A;  3GTK B;  4JI7 Q;  2IL8 A;  3TSS A;  3K6O A;  1EOV A;  1Q86 C;  2AQ2 B;  1VQB A;  2K03 A;  3MXN B;  3GV6 A;  3D6W A;  1QUQ B;  1SJE D;  5DEH A;  3HZX A;  1JWU D;  3HOW G;  3FRP B;  1J8I A;  4TSS A;  3HFZ B;  5E1F A;  2RSO A;  5M3M G;  2QEX A;  2Q8R E;  1H9K A;  1WTV A;  1IBM L;  2AQ1 B;  2XN9 C;  2HQE A;  1VCI A;  2L55 A;  1K9M C;  4DR7 Q;  3U50 C;  4HCS A;  2GVA A;  2WP8 J;  4PMC A;  2WB1 E;  3HS0 C;  2LS0 1;  2HDM A;  4A3I G;  3SGI A;  3RLO A;  1YBY A;  2EOT A;  4B3R Q;  1KAA A;  1MI2 A;  2VNU D;  1JQY D;  2VZA A;  1PZJ D;  1SNQ A;  2Z6K C;  2Z6K A;  1GKH A;  5KYI A;  5EKI A;  3JAM i;  3GTJ H;  3M4Y A;  1EY9 A;  3URY A;  4JI3 L;  1HNW Q;  1SR3 A;  4F87 A;  3GTJ B;  1HA5 A;  5EBC A;  2YTY A;  1Q8K A;  4FNF A;  1X9N A;  2JN4 A;  4LFB L;  1BCP F;  4M1U B;  3RR5 A;  2M9V A;  1JC7 A;  2E8G A;  1TWG H;  3W2D A;  2CH4 W;  4JK1 C;  5BN3 A;  4QIW B;  2KVM A;  2HCI A;  1GUG A;  4IQZ A;  3TQY A;  3SE0 A;  1TS4 A;  2EY2 A;  2FHT A;  3AFP A;  1I94 Q;  1RJT A;  3I3C A;  2HIX A;  3BZK A;  3TS0 A;  3PUX A;  1XNR L;  4GKK L;  3D8G A;  1Q90 A;  3P1H A;  1D6E C;  3ICE A;  3CCV A;  2E2H H;  1A3T A;  4N9P A;  5C4X H;  2N78 A;  3KF6 B;  1I50 H;  4RHS A;  2E2H B;  3N6R A;  5C4X B;  1VQF A;  2K5H A;  4FYD A;  1I50 B;  1QG7 A;  2Z1C A;  2VQE L;  3RLF A;  4LF5 L;  1QCB D;  3KBG A;  3KYH C;  1QVG A;  4O2D A;  1EY5 A;  3M9B A;  3EA6 A;  4RCO A;  2QA4 A;  3DEO A;  1O7I A;  1L1O B;  3RZD H;  1HZ9 A;  1FYC A;  1G6P A;  5COY A;  4JI5 Q;  4K8J A;  5J1Z A;  1VQ5 A;  3RZD B;  4CHT B;  1HFG A;  4I7Z C;  5C4X G;  2F4I A;  1LLR D;  3FEW X;  2N88 A;  1EZ6 A;  3J80 L;  3MHB A;  1A63 A;  3NK9 A;  2B63 H;  1U4P A;  4BA2 I;  1WTH A;  1JE5 A;  4DXF A;  4HMJ A;  4V0B A;  4A3C H;  2V4D A;  2B63 B;  3NTI A;  4QUF A;  4U68 A;  4TRD A;  5CC4 A;  2IT1 A;  2EYM A;  4JI2 L;  4Y7N B;  3DMU A;  5M3F H;  1VQJ A;  1RF2 D;  3MFY A;  2VS1 A;  3UE1 A;  5IWA Q;  5L37 A;  3AYH B;  3H3V H;  5T1G A;  5M3F B;  4NXN Q;  5BN4 A;  3GV3 A;  5IY0 A;  5LHY 1;  3I4N H;  1PTO D;  1JMC A;  3S14 H;  2DUD A;  1CM9 A;  2F3W A;  1HZC A;  2XRS D;  2B63 G;  3I4N B;  2OF1 A;  3F2C A;  2DY7 A;  3SVM A;  3S14 B;  1B44 D;  2F0E A;  1PTO C;  4BA1 I;  3D3R A;  4YWM A;  3TN2 A;  3A8I E;  2F0U A;  4RKL A;  4DR4 Q;  5C4J H;  5I2X A;  4O42 A;  3MEF A;  1PMR A;  5M3F G;  1LO5 D;  4KY7 A;  3TME A;  5C4J B;  4HSP A;  2EYO A;  3Q8D A;  2UU9 Q;  1PRT D;  5D3D A;  4AYB E;  3VR6 A;  1D5Z C;  2EVB A;  3L2P A;  3I4N G;  3DUZ A;  2ZJP A;  1AEX A;  1F77 A;  1H9R A;  4LF8 Q;  5JOB A;  1NR4 A;  2UXB L;  1I5F A;  1BDO A;  4N9T A;  4H44 C;  1Z47 A;  3OIQ A;  1WOC A;  1PH9 A;  2L4N A;  4OO1 H;  1N32 Q;  2MFI A;  3SK5 A;  3BZD B;  4LF9 Q;  3AU7 A;  1Y1W H;  2JK8 A;  3DEP A;  1GXD C;  4B3M L;  2NVT H;  4X65 L;  1Y1W B;  4L63 B;  4JC0 A;  3J7A 5;  3HOZ H;  3RN2 A;  2NVT B;  1CHQ D;  2L5T A;  4JI7 L;  1A15 A;  1QE6 A;  1WTQ A;  2H5X A;  4LK1 C;  1BOS A;  5KRU A;  5C44 H;  3O13 A;  1N34 Q;  1QOH A;  4UP8 A;  4C3H H;  2JQO A;  4OO1 G;  1S3O A;  3KLS A;  3CMA A;  1F9P A;  2B2Y C;  2B2Y A;  4QL5 A;  4C3H B;  1Q12 A;  2R6G A;  4PMW A;  3MVV A;  1Y1W G;  2EY5 A;  4X64 Q;  1GVP A;  1MSH A;  3JAM L;  1R9T H;  3TEH B;  1RTN A;  4KKS A;  3KK7 A;  3EBE A;  1KAB A;  3DWP A;  2WAQ E;  3OIP A;  4DA2 A;  1R9T B;  3HOY H;  3DHQ A;  3RLN A;  1STH A;  4U67 3;  1JJC B;  1P8L A;  5BR8 Q;  3HOY B;  1LAB A;  1FNV A;  2IHF A;  1G2T A;  1RTO A;  1HQR D;  3OSO A;  1KDC A;  1CKN A;  2GA4 B;  4OEM B;  1PZK D;  3T56 B;  4C3H G;  5FO9 B;  1A3V A;  3M3Y H;  4DFA A;  2F0S A;  3LWU A;  1VQ4 A;  3BVG A;  1ZXT A;  2K33 A;  2P5Z X;  4RA8 A;  1JB3 A;  3M3Y B;  1B53 A;  3I4M B;  5EKK A;  2AHO B;  1YNN C;  1T5X D;  1Y69 U;  2UUB Q;  1EUJ A;  3GQB A;  3ZYY X;  4QJF A;  1TXY A;  3HOY G;  1PTO F;  1ESF A;  4G4K A;  4R4O A;  3IKJ A;  3BYT B;  1XMO L;  4NXM Q;  2G5D A;  5CV7 A;  1Z7T A;  4PMB A;  5FLX c;  1KQS A;  4KLK A;  1HNZ Q;  3VYT A;  3NQT A;  1Y1V H;  3J81 j;  4PNY A;  2KHS A;  3HKS A;  2X6L A;  5C4Z A;  2KCT A;  1VQ6 A;  2YTX A;  3I4M G;  4GKJ L;  1EWH A;  1EY4 A;  3A7A B;  1VQC A;  4FP5 D;  1IW7 D;  4JG2 A;  4DV2 Q;  1PRT F;  1AZP A;  3PO3 H;  1E2W A;  4CJ1 B;  1WTX A;  3BDL A;  4ZUI A;  2BE5 D;  3MFG A;  1MIU A;  2MP1 A;  4YCW A;  1IW7 C;  1XNQ Q;  3PO3 B;  2O5J C;  1KAW A;  1TY2 A;  2D0O A;  4X3S A;  5JEA H;  3F2D A;  2B2T C;  2B2T A;  4OWX B;  3STB C;  1PA6 A;  2KJX A;  1OXV A;  3E9H A;  5D3I B;  2BE5 C;  4MZ9 A;  5IGC A;  1FL0 A;  4DV5 Q;  2NZH A;  2RDH A;  2C9O A;  4OXP A;  4K5X A;  3KJP A;  1YI2 A;  2HUG A;  3GO5 A;  4QY7 A;  1PH1 A;  4PG3 A;  4BY7 H;  1Z6H A;  1MSG A;  3PO3 G;  3PUV A;  4BY7 B;  2G9H D;  3ERS X;  4KHV A;  3S16 H;  5K36 G;  2E75 C;  1S5B D;  2H1E A;  2HD3 A;  4DK6 C;  1VQL A;  5CV6 A;  4IUV A;  3CC2 A;  1CSP A;  2TMP A;  2CHB D;  1PFS A;  4RHR A;  5JEA G;  3HRZ C;  3D0F A;  5M5X H;  1JWM D;  4DR3 Q;  1ENC A;  1E1O A;  2KED A;  5M5X B;  4KD3 A;  4DR2 Q;  1SBB B;  4HIO A;  1ONL A;  3MXN A;  2B2W C;  2B2W A;  4BY7 G;  1FR3 A;  2KHI A;  3CPW A;  3RN5 A;  4FF1 A;  2K14 A;  1N33 L;  1IL8 A;  2K5W A;  2OEO A;  2MGS A;  4DNI A;  4FO2 A;  5IYB H;  2JSO A;  2F0I A;  2Q8I B;  5JPM C;  4MHE A;  4YY3 Q;  4M8A A;  5KNC A;  1YJ9 A;  2EXZ A;  2E76 C;  3LGJ A;  4NXN L;  4G57 A;  1PH8 A;  1SYB A;  1D7Q A;  2BOS A;  4DNT B;  5ISR A;  5T1I A;  1O7Y A;  3A7L A;  2LKV A;  1AFP A;  1K0S A;  3MXG A;  3WOF A;  5M5W H;  4OIK A;  5IYC G;  3OOC A;  3BVZ A;  5M5W B;  2Z4I A;  1O7L A;  1S5F D;  5IYB G;  1BBU A;  3D4W A;  2K05 A;  4JI6 L;  1LT6 D;  4HIK A;  1QZH A;  4NKL A;  4DV4 L;  4LF8 L;  4LF4 Q;  1HUM A;  1NE3 A;  1GOZ A;  3I7F A;  1AZQ A;  2JA6 H;  2FMM A;  1LT4 D;  2UXC Q;  1I4X A;  1HHV A;  3S1Q H;  1JIC A;  4DUY Q;  1QZG A;  2JA6 B;  2NB0 A;  5EPK A;  1EYC A;  5GAD C;  2EZV A;  3S1Q B;  1DON A;  3RZO H;  3NSW A;  4NPS A;  3I91 A;  2AUJ D;  2F0D A;  1B3A A;  2K5D A;  3RZO B;  1TWA H;  2HDL A;  3CKI B;  4DNR B;  1B3Q A;  4TVA B;  1EQT A;  4GS3 A;  2PNH A;  2SEB D;  4NB3 A;  4UPA A;  1BO0 A;  1AP0 A;  1TWA B;  4WFN 3;  2N8N A;  1LTR D;  2CFM A;  1S5D D;  2K5V A;  1GHJ A;  1HR0 Q;  2SOB A;  4CDD C;  1PV4 A;  1EZ8 A;  4IZ8 A;  1RL2 A;  2XNA C;  5DAU A;  2UUC L;  4DV6 L;  2RDG A;  1U9R A;  3CAM A;  2RA4 A;  4KHP L;  5HY6 A;  4IN3 A;  5EBD A;  3F8T A;  1H9J A;  1NNX A;  4EQP A;  4J1M A;  3T1H L;  3UDG A;  3H94 A;  2OTL A;  4YCU A;  1C0A A;  1PH6 A;  4AQY Q;  1HNX Q;  4R1J A;  2NUC A;  2ZJR A;  1XTD A;  1CKN B;  1EIF A;  4Q0F A;  3SHL A;  3R2I A;  4ZKC B;  2BA0 A;  1WTO A;  1SRO A;  3EJI A;  2NN6 I;  4CKE A;  1IZ6 A;  4DAV A;  1L2F A;  1TT2 A;  1E24 A;  4DV0 Q;  2I0Q A;  2J4X A;  2UUB L;  1EFW A;  2PMZ B;  4PZ7 A;  5IOD A;  4XYO A;  1SLJ A;  3KLR A;  4NXM L;  2A8V A;  5K5P A;  1N9W A;  4KD4 A;  4CDC C;  4JOI C;  4JOI A;  1ILQ A;  3TP6 A;  4L8J A;  5EGT A;  1A0I A;  3Q0A A;  4DV7 L;  4KV6 A;  5E7N A;  5C3E H;  3I73 A;  3PIP A;  1FD7 D;  2JE6 I;  1K8M A;  3RUZ A;  2Y0S B;  5JJK A;  5C3E B;  1XPR A;  1VQ9 A;  4UDU C;  4DV2 L;  2NTT A;  4A3E B;  1LTS D;  1PH5 A;  4LFC L;  4XQJ A;  2E5L L;  1OO9 B;  2K32 A;  2DJF C;  1C48 A;  2F4V Q;  2K28 A;  4X62 Q;  4DV1 Q;  2F0V A;  3I72 A;  2IPK D;  1E22 A;  4C1N K;  2NZO A;  4XYQ A;  1PH7 A;  1ZYR D;  1HFN A;  4QGU A;  1ZKO A;  3CCU A;  3J81 E;  2FJ2 A;  4A3K H;  2Y0S G;  1PFM A;  3DM1 A;  5C3E G;  4QIW E;  1OXS C;  4A3K B;  3VR4 A;  4DR6 L;  3BS1 A;  4A3E G;  4DV3 Q;  3S2H B;  1AW7 A;  1V9P A;  2MO1 A;  4DK3 C;  3K8A A;  2BH2 A;  1GUT A;  4LFA Q;  3CF5 A;  2C5C A;  4NP5 A;  2BDN A;  1UE7 A;  1T9H A;  4A75 A;  4FDB A;  4APV A;  3OMG A;  1M4V A;  5I4D A;  4A3K G;  3SR1 A;  3TRZ A;  1BR9 A;  4DR2 L;  1X6O A;  4CGY B;  4MTN A;  2WV6 D;  5CV8 A;  4CKB A;  1V1P A;  1Y8N B;  4JI0 Q;  2Z8L A;  4OX9 L;  3BU2 A;  3SDZ A;  4ZLT F;  1YIJ A;  2KCM A;  2NVX H;  5FLX L;  2EDG A;  3C1E A;  2CWA A;  2I5L X;  3S9W A;  3CXC A;  2NVX B;  3K0Y A;  2EY6 A;  2L15 A;  3EVQ A;  3QOJ A;  4IPH A;  5G3L D;  3NEL A;  3BZC A;  4Y52 H;  1YHQ A;  4F88 A;  5KYL A;  1GUO A;  3N52 A;  3CCM A;  3ND9 A;  3KFU A;  2BH8 A;  4QMG A;  3CC7 A;  1AE2 A;  1C9O A;  1MKH A;  5AJ3 Q;  4ALP A;  1SXT A;  4ME5 A;  4B3S L;  1O78 A;  2K52 A;  4HED A;  2F0Q A;  4K5W A;  1I4H A;  2ZM6 Q;  3W5O A;  1IBL L;  1X3Q A;  1R4Q B;  4JBW A;  1RKN A;  2RQX A;  1BBX C;  4MIU A;  1KC8 C;  2QEJ C;  1Q82 C;  5IGD A;  1KLU D;  5ELO A;  3H15 A;  1YHA A;  5H1S E;  2PPB C;  1LTB D;  2Q2H A;  3Q22 A;  2DJG C;  2EYF A;  2ATW A;  2M00 A;  4ZRZ A;  2RBM A;  4EX5 A;  3TS2 A;  4IOA A;  5M9O A;  2CWP A;  4LF6 Q;  2NZ1 D;  2E74 C;  4PZ8 A;  1TWH H;  2I46 A;  2RKS A;  3Q23 A;  1QB5 D;  4N8X 1;  1TWG B;  2HHH Q;  1EWC A;  1TWH B;  1EQV A;  1CA6 A;  2NWG A;  3UDI A;  3W1G A;  1EU4 A;  3E3X A;  3RD4 A;  1VQI A;  4IFD I;  1I4R A;  2RCF A;  2UUA Q;  2D9U A;  3VYR A;  3NWT A;  1HR0 L;  1UEB A;  5FK9 C;  2OQK A;  2Q2I A;  2HQL A;  2ZTC A;  2OT2 A;  4YHH L;  1F9Q A;  3K57 A;  1X3G A;  5LMU Q;  4PQX A;  1WD1 A;  1LTL A;  4JV5 Q;  3G6E A;  3TP5 A;  3HOV H;  2WIN B;  3K81 C;  2VW9 A;  1HZB A;  1QVC A;  2EYL A;  2V1C C;  1SYG A;  3HOV B;  1MD2 D;  1VMP A;  1EY8 A;  2LFN A;  4KTA A;  4K0K L;  1O7Z A;  3V96 A;  3OTO Q;  3ZJY C;  1S4Z A;  1XMQ L;  2AMC B;  4XT1 B;  3H3V I;  1U5K A;  1K3B C;  1EIG A;  1SMX A;  1UEA B;  1EWI A;  5IT9 c;  5G3L F;  3R8B A;  1WJJ A;  2E2J H;  1TU2 B;  1UE5 A;  2JA5 H;  3NTK A;  3IL8 A;  4JI1 Q;  1L0W A;  4XQN A;  3HOV G;  4N8F A;  2JA5 B;  4JI8 L;  4HIM A;  3GTM H;  4IPD A;  1DOM A;  5EQ0 A;  3M4O H;  3GTM B;  3E0E A;  5LMN L;  4A3D H;  2GVB A;  3M4O B;  3AFQ A;  2C35 B;  4S3S A;  1BXT A;  2WB1 B;  3UE0 A;  1LM0 A;  1JB7 A;  5EKL A;  3V2T A;  4A3D B;  2NYZ D;  3BDC A;  2VQF L;  1A2T A;  5J39 A;  2A6H C;  5EAY A;  3T1Y Q;  3M4P A;  4IUQ A;  2JA5 G;  4B9W A;  5GQO A;  4LAA A;  3J7Y W;  1PYS B;  4KMU C;  4A3C G;  2F4V L;  4JYA Q;  4OO1 I;  2F0W A;  4DR1 L;  1IYU A;  2GN5 A;  3M85 A;  2PZW A;  1I3Q H;  1RHP A;  1K8O A;  5ELE A;  3IAY A;  1MJE A;  2ZTD A;  3S1R H;  3CQZ H;  2WB1 G;  1I3Q B;  4A3D G;  5FJ8 H;  1LUZ A;  4I7A A;  4KY5 A;  5C4H A;  5KND A;  3S1R B;  3CQZ B;  4G7H C;  1BNZ A;  2F1M A;  4R9W A;  4CJ0 B;  3D4D A;  2BA1 A;  3LWE A;  3CRK C;  1H9S A;  1SAP A;  3K7U C;  5I9P A;  2R92 H;  2KEN A;  2FIN B;  2K75 A;  4A3M H;  3OMC A;  2PQA A;  4OEL B;  1SFO H;  2R92 B;  1DZ1 A;  1PH3 A;  2FFK B;  5FO8 B;  3CCS A;  4A3M B;  3IFD A;  3QOL A;  1SFO B;  1O80 A;  3S1M H;  1NAP A;  2EQS A;  1M8A A;  3FMC A;  5C0X H;  3T13 A;  3S1N H;  1QIL A;  3S1M B;  3PSI A;  4JBM A;  4P71 A;  5IGG A;  3A56 A;  1VQM A;  5FJ8 G;  2EJF C;  4A3G H;  3S1N B;  1I6V C;  1DGS A;  2EPB A;  4IUP A;  3P7J A;  3HOZ B;  1WTR A;  4A3G B;  3QB3 A;  1UNS A;  1TKW B;  2I07 B;  1JR0 D;  3M7N A;  2R92 G;  4KY6 A;  1HPC A;  1V1P B;  4WRD A;  4A3M G;  1S72 A;  4RWS C;  1KIX A;  5C44 B;  4BXX H;  3I4L A;  3SK6 A;  3PIO A;  4XTC S;  4IPC A;  1Y8O B;  1D2B A;  3NUC A;  2XGT A;  5EJW A;  3TP7 A;  4C1N I;  5C0X G;  1MHW C;  2OCE A;  4ODG A;  1T5E A;  2L1B A;  5IGB A;  3J80 E;  1E1T A;  3Q24 A;  3HOZ G;  4A3G G;  1K8A C;  1C8C A;  1RIP A;  1W3S A;  2CVR A;  2Z6B A;  2XVS A;  4DR7 L;  2QIL A;  1B1Z A;  2IW3 A;  3I70 A;  2DN8 A;  4DR5 Q;  5IE8 A;  5C44 G;  3GDE A;  4B3R L;  2OTJ A;  3FKI H;  4K14 A;  1K28 A;  1JOK A;  3LX0 A;  4BXX G;  1IBK Q;  2HT1 A;  3FKI B;  4P75 A;  3K5M A;  1YNN D;  4MTK A;  3GD7 A;  3RMH A;  3FP9 A;  4GOP A;  5GAG C;  4GOP C;  4OHJ A;  1XPU A;  4KKU A;  1HNW L;  2KCN A;  3FVQ A;  1SNO A;  2X69 A;  3VA5 A;  2JA8 H;  2VY3 A;  1CFM A;  3HEJ A;  1TY0 A;  5IOC A;  3CCJ A;  4EGV A;  2JA8 B;  1VQ8 A;  1G6Z A;  2ALY B;  2KHJ A;  3HOU H;  3MEH A;  1XXG A;  3KLS X;  1ZEQ X;  1SEB D;  1W6J A;  5NUC A;  3TZU A;  1E2Z A;  2JA9 A;  3HOU B;  2DNE A;  4LMQ D;  3FKI G;  2HHH L;  2B29 A;  3DWA A;  1S5C D;  2LXK A;  3TDQ A;  4B08 A;  1I94 L;  2KEE A;  1Y1V B;  4CDE C;  5DM7 3;  4IAL A;  3E9I A;  2KUM A;  3OYY A;  4IUR A;  3DWQ A;  2JA8 G;  2XRQ D;  1G29 1;  4CKC A;  4JBK A;  4ULL A;  2F0G A;  2R3Z A;  5A2Q L;  3M4Q A;  5GAH C;  2Z0S A;  5DLQ E;  3STB D;  1KRT A;  1LAC A;  1WTW A;  3SK8 A;  1RDP D;  4AYB B;  2A6E D;  4K2L A;  4JVZ A;  1HH2 P;  1FNW A;  3GTL H;  3S2D H;  5LMU L;  1HR0 W;  1Y1V G;  2NBF A;  2QGQ A;  3DXJ C;  3K5N A;  3GTL B;  2A6E C;  4DF7 A;  2JA7 H;  3R3O A;  3T51 B;  3S2D B;  4NDX A;  1KTK A;  1NCV A;  3PUY A;  3AB9 A;  2JA7 B;  2RHQ B;  4DAY B;  4GLA C;  2BCO A;  1B7Y B;  2PCF B;  4BS9 A;  2K50 A;  4R4T A;  1F9S A;  5COR A;  4AYB G;  4DXG A;  3W1B A;  4JI5 L;  3H09 A;  1KRS A;  5C5M A;  1GD7 A;  3QG1 A;  1W2B A;  3S16 B;  1ASY A;  2ES2 A;  1SE2 A;  4G7O C;  2WAC A;  1EYD A;  2JA7 G;  1DOL A;  1VQE A;  5DM6 3;  1B2T A;  3MWY W;  1TII D;  2A69 C;  1NJI C;  2L9H A;  2VL6 A;  1KDA A;  2QCP X;  4Z9C B;  3H0G H;  1JCK B;  1JJG A;  1Y14 B;  4IUU A;  2WAQ B;  1N36 Q;  5I6Y A;  5C5L A;  1X32 A;  5IWA L;  3H0G B;  5IP9 H;  1Q1E A;  3TBI B;  1ICW A;  2J0T D;  2WKC A;  5LMN W;  3HKZ B;  5AFW A;  3H91 A;  5E4X A;  3I8Z A;  1E2V A;  4ZYS A;  4V19 0;  4XT3 B;  4JYA L;  3CC4 A;  5HGT A;  1I6H H;  1VS0 A;  2HCC A;  3MAQ A;  3K0X A;  2WAQ G;  1QNU A;  1UAP A;  3T4A C;  3BVM A;  4BY1 H;  4DR4 L;  1I6H B;  1OXU A;  1CI3 M;  3H0G G;  5BN5 A;  2D2C C;  3CPF A;  3Q6S A;  1XWE A;  1JWS D;  1F9R A;  4BY1 B;  3K58 A;  5IP9 G;  1TR5 A;  3S24 A;  5KGU A;  2UU9 L;  5DNF A;  3TP8 A;  3EIV A;  3MXP A;  3HKZ G;  2Z4H A;  4O0A A;  1K8G A;  1Z9F A;  2B8G A;  3R2T A;  4KKT A;  1H9S B;  1I4Q A;  4GN5 A;  2Y0S E;  5ELC A;  1NR2 A;  4IFD J;  2PQA B;  1CTM A;  2UXD Q;  2MHV A;  1N32 L;  1VDZ A;  4WJW A;  2CH4 A;  1HJP A;  1LTA D;  4LF9 L;  1J5E Q;  3KF8 A;  5IT9 L;  2R7F A;  4RGO S;  4BY1 G;  1TS5 A;  3ONA B;  2PW5 A;  2CQA A;  5ELF A;  4JI3 Q;  4K6D A;  1SSO A;  4ZCK A;  3P75 A;  3KDF A;  3J7A V;  5J22 A;  3J80 c;  1PDQ A;  4QQB X;  4RFB A;  2K4K A;  1CQF A;  1V43 A;  1S5E D;  1SNC A;  4LFB Q;  2R7Z H;  3F1Z A;  1DXM A;  1CSQ A;  1N34 L;  2RCN A;  2JA6 G;  1BBW A;  2L12 A;  4LW1 A;  5F2D A;  2R7Z B;  2EIF A;  4ABN A;  3CCR A;  4DK0 A;  4O1N A;  5TSS A;  1X54 A;  4WJ4 A;  2QF7 A;  4X64 L;  2ID0 A;  2CCZ A;  4A3J H;  3VR5 A;  3OWE B;  3F2U A;  5JAV A;  3HOX H;  1XNR Q;  4A3J B;  1EY0 A;  2F03 A;  4RH6 A;  1K83 H;  2PI2 E;  5BR8 L;  3HOX B;  2R7Z G;  3BDO A;  1K83 B;  4IJL A;  1VQO A;  1STA A;  4CDF C;  1SN8 A;  1FNU A;  5IP7 H;  3NBH A;  3A8J E;  4KN7 C;  1IBK L;  3E5S A;  3KUP A;  3GTQ H;  2YV5 A;  2RVL A;  1MGS A;  2EE1 A;  3NPP A;  3PUW A;  3GTQ B;  4GOP B;  4A3J G;  1PXU A;  2RF4 A;  3HOX G;  1B9N A;  3HP3 A;  4TQU S;  1JT8 A;  3ERO A;  1D8L A;  5C3W A;  1C4Q A;  4IUN A;  4GNX C;  4GNX A;  3ULP A;  1G2S A;  4GN3 B;  2QDB A;  1HNZ L;  1NBW A;  3A8K E;  2B39 A;  3EN2 A;  1GO3 E;  4HSV A;  2JXM B;  3A74 A;  1EIY B;  4BWG B;  3D4R A;  2F52 A;  1YEZ A;  3NTH A;  1OXX K;  3NP8 A;  1LV9 A;  2AUK A;  1HCZ A;  1VQN A;  4H02 A;  3D6C A;  1EU3 A;  3T16 A;  1XJV A;  1F2M A;  3NWS A;  1D1I A;  1IYV A;  3CRL C;  3F2B A;  1STE A;  1XNQ L;  5CV5 A;  3IRB A;  3GTP H;  2OXP A;  2ENB A;  2LY7 A;  4J8Q A;  4XIG S;  1WTP A;  1CKO A;  2ICE C;  5IGE A;  3J80 i;  2E2I H;  3U9S A;  1EEI D;  2NN6 H;  1XYI A;  1CK1 A;  1BKB A;  4DV5 L;  1EYA A;  1ET6 A;  2JP1 A;  2E2I B;  5HGQ A;  2D5D A;  2K1B A;  1SMY D;  2XWB B;  5CMD A;  4EVO A;  3OW2 A;  4R4C A;  1BCP C;  3K7A H;  3QO2 A;  2IX3 A;  3BG3 A;  4C3J H;  4DUZ Q;  4IUT A;  1SMY C;  5KIX A;  1NY4 A;  2K5N A;  3K7A B;  4B3T Q;  4C3J B;  4BBS H;  1X65 A;  4DR3 L;  4BBS B;  2IY5 B;  4OL7 A;  5FLM H;  4EQN A;  3JC6 6;  4L5R C;  2M2L A;  5ELB A;  1IKL A;  4LF7 Q;  2CW0 D;  5I2Y A;  3C2P A;  4GN4 B;  1I4P A;  3FDT A;  3ULL A;  3QWN A;  1ICF B;  3PGZ A;  1EIH A;  2CW0 C;  3OW7 A;  4C3J G;  4DN4 M;  2R93 H;  1N36 L;  1V8Q A;  2L11 A;  5CV9 A;  4C2M H;  2N3S A;  4YCV A;  4X65 Q;  4B3M Q;  4YY3 L;  2R93 B;  4HR7 B;  4BBS G;  2X6G A;  4TKO B;  1B9M A;  2H4O A;  4C2M B;  4C3I H;  1NTG A;  3PO2 H;  1J9O A;  1WVL A;  2SDF A;  5FLM G;  1OTC A;  4HJ8 A;  4C3I B;  2IX1 A;  3NEN A;  3PO2 B;  4A3I H;  3A5Z B;  1V1O A;  2VB2 X;  5JVG 3;  3H6M A;  4A3I B;  1GJX A;  3PQI A;  3A54 A;  3G6J B;  4UY8 C;  5C3X A;  2R93 G;  1LTI D;  1LT3 D;  1KNA A;  2VB3 X;  3KOJ A;  3KJO A;  4CBV A;  3X3N A;  1PH4 A;  2K01 A;  5JJI A;  5JEA J;  4GZY C;  3HG9 A;  4C3I G;  1V1Q A;  3PO2 G;  3K80 C;  4LF4 L;  1ENF A;  1HRJ A;  4L5Q A;  1PH2 A;  2UXC L;  3A5U A;  4DUY L;  5IYD H;  2UXD L;  1CZW A;  3PF4 A;  1G91 A;  1J5E L;  4DAM A;  3S17 H;  4B9X A;  4FF2 A;  1STN A;  2EJG C;  2KBN A;  3KF8 B;  3S17 B;  2EYJ A;  1CHP D;  1II3 A;  2A19 A;  3OHX C;  2SNS A;  1BVS A;  4HTH A;  3EFX D;  3KDF B;  3SXH A;  1HTL D;  2A74 C;  1PYW D;  2LSS A;  2O4X A;  4HJ5 A;  2HIV A;  1XMO Q;  1XTC D;  1STY A;  1WYD A;  5IYD G;  4C56 C;  3A55 A;  2PQE A;  4R4Q A;  4YWL A;  1STG A;  1D5M C;  4LJZ C;  4AH6 A;  1B70 B;  3PMF A;  4GKJ Q;  1E0B A;  2NVQ H;  4DAY A;  2F0T A;  2NVQ B;  1QJO A;  3L7Z C;  1X3P A;  1TS2 A;  3R93 A;  3AEV A;  2I5M X;  4AQY L;  1D5X C;  2K7V A;  1HNX L;  5FLX E;  2N55 A;  1QVF A;  1XPO A;  4POF A;  3KBX A;  4A4I A;  3NBH B;  2AWN A;  1DYQ A;  1FGU A;  3MXU A;  2QW7 A;  4IPG A;  1RD9 D;  4IFD H;  2O2L D;  2PW7 A;  4L5T A;  4DV0 L;  2DGY A;  1YJN A;  3QIA A;  1X56 A;  4PV1 C;  4OWW B;  1HXY D;  3U9O A;  3B6Y A;  4KJO A;  2E2J B;  5JJZ A;  1QNK A;  1STB A;  3C1F A;  1CKM A;  1NSN S;  1GM5 A;  2ZJQ A;  2ASB A;  3OPO A;  4FF3 A;  1A8V A;  2AQ3 B;  3QJY A;  4GNX B;  1TQO A;  1Q3L A;  1Q1B A;  4FXK C;  4K5V A;  3J81 c;  4PZ6 A;  2A6H D;  2O5I C;  1PLF A;  1ML0 D;  3VA7 A;  4GLX A;  1LYL A;  5JPN C;  4OIJ A;  3LNN A;  4IFD G;  4CJ2 C;  2FXQ A;  4EQO A;  3VR3 A;  1AE3 A;  2F3V A;  4QB4 A;  4Y7N H;  3G4S A;  4BBR H;  3NEM A;  1K73 C;  5CBA E;  4X62 L;  4DV1 L;  2MUY A;  2ZT9 C;  4RGN A;  1M90 C;  1N33 Q;  1Q46 A;  4BBR B;  1S40 A;  1ESR A;  4A3L H;  5C0X I;  3WOE A;  2BDO A;  1LT5 D;  2OWO A;  3G7L A;  3PIP 3;  4DV3 L;  3BYY B;  1E7Z A;  3MZ5 A;  1Q8I A;  3K5O A;  1IKM A;  1SRU A;  4RAU C;  4DUZ L;  4H13 C;  1BCP B;  1SE4 A;  1TVX A;  1A6X A;  4B3T L;  4LFA L;  4R8I A;  4BBR G;  4R8N A;  1K0R A;  4RGT A;  2G9D A;  1VF7 A;  1HUN A;  4JW0 A;  3ND8 A;  5KNB A;  4A3L G;  3K5L A;  4JI6 Q;  4K6L A;  3PUZ A;  4LUV A;  4X66 Q;  4DV4 Q;  1JOO A;  3NBI A;  4LF7 L;  3V05 A;  2EYP A;  2LMC B;  4JI0 L;  1PRT C;  1FJG Q;  1J6Q A;  3MC0 B;  4RG1 A;  3KLW A;  1DM0 B;  3D31 A;  3DLL A;  1A3U A;  2JEA I;  1OXT A;  4ZQ3 A;  1EY7 A;  1L0X B;  1Q81 C;  5J3B A;  2MJ8 A;  1SDF A;  4GLV B;  1B4O A;  3SEB A;  4G7Z C;  1X55 A;  2D0P A;  4L6T B;  2RHS B;  1WI5 A;  4P72 A;  2Q2U A;  2KCC A;  1X3F A;  2MQH A;  4EQ5 A;  5AJ3 L;  1NMF A;  4DU9 A;  2YU9 H;  1FGB D;  2IWH A;  2NTS A;  4ZKB B;  3T53 B;  2ZM6 L;  2B2V C;  2B2V A;  1SND A;  4OGQ C;  3NXW A;  2YU9 B;  2F0J A;  2YTV A;  1VQD A;  1F2Y A;  1KXL A;  2D62 A;  3MA2 B;  3FPU B;  4F8M A;  3J81 i;  2UUC Q;  4DV6 Q;  1SE8 A;  4OON A;  1TS3 A;  4XXE A;  4RKB A;  2IJ0 A;  3L0O A;  5HUR A;  4KHP Q;  4HJ7 A;  1ROD A;  5CR3 A;  1LTG D;  1PVO A;  5E4W C;  1PFN A;  2JEB I;  3T1H Q;  3VYU A;  4KHZ A;  1U4M A;  4A3F H;  2SNM A;  1JOR A;  1SYE A;  3PF5 A;  3ERQ A;  3C3L A;  1WD0 A;  2CKZ B;  4A3F B;  1VQK A;  4POG A;  4WJ3 M;  2F0K A;  1D1K A;  4LF6 L;  2F0L A;  4RCN A;  3TZD A;  2ZXP A;  3HKZ E;  3CHB D;  3WDN A;  1X3E A;  2R61 A;  2KQ3 A;  4P74 A;  3I4M H;  4XQQ A;  4OWT B;  1VMC A;  1I4G A;  4H7B A;  4X3T A;  2MPM A;  2UUA L;  1UE6 A;  4A3F G;  2TSS A;  1CT1 D;  1EOT A;  3UDF A;  3I90 A;  5D65 A;  3RNU A;  5E3F A;  2PO4 A;  3WWV A;  2A1A A;  3HOU G;  4P2C B;  1M1K C;  1DD2 A;  2K04 A;  1SJH D;  4K8I A;  4ME3 A;  1B8A A;  4DV7 Q;  5FO7 B;  4UP9 A;  3G71 A;  4JI4 Q;  2WII B;  3GP7 A;  1IYJ B;  5A35 A;  1GUN A;  4NMZ A;  4FF4 A;  1SE3 A;  4KN4 C;  4H0L C;  1B50 A;  4JV5 L;  2K6A A;  5EPJ A;  2XIW A;  2XWJ B;  1EL0 A;  1CZG A;  3PCO B;  4LFC Q;  1C7Y A;  2E5L Q;  3L3O C;  1EQQ A;  5K36 H;  1MJC A;  3J7Z C;  3CCE A;  1W6K A;  4FXG C;  1KL9 A;  1Q7Y C;  3OTO L;  3CU7 A;  4J15 A;  2KA7 A;  1EQR A;  4RMF A;  1VQH A;  2A69 D;  2VXW A;  4HMI A;  3ITP A;  2KOL A;  3X3M A;  4DR6 Q;  1VQG A;  3JAM E;  2Z9H A;  1MBY A;  3CW2 C;  4XDX A;  2XSC A;  4FXD A;  4X6A H;  1EFI D;  2F0H A;  4JI1 L;  2ZXR A;  1U4L A;  2RDF A;  1DOK A;  3GTG H;  2DY8 A;  4QCL A;  1TWC H;  1VQA A;  3DM3 A;  4F7X A;  2LXJ A;  4RGM A;  5CV4 A;  3I56 A;  3GTG B;  2PI2 A;  1IHZ A;  1TWC B;  1YJW A;  1G8Z D;  3C46 A;  1HA6 A;  4ZAI A;  1YIT A;  4I65 A;  4DPG A;  3PV0 A;  3VDY A;  4HAE A;  1VF5 C;  3FHW A;  3QR8 A;  5GRO A;  4UAI A;  3HGB A;  1KNE A;  3T1Y L;  4OX9 Q;  1F2Z A;  1QUQ A;  2OQ0 A;  1IL2 A;  3VR2 A;  1L0Y B;  5IYC H;  1SYD A;  2F0P A;  2PMZ E;  5KEE A;  2B2U C;  2B2U A;  2JYO A;  3A0J A;  1H95 A;  4R4I A;  3P20 A;  2ZXO A;  1JE4 A;  3W3A A;  1NMG A;  1G51 A;  3MTS A;  1PFB A;  3UDX A;  4DAP A;  1YNJ D;  4KI0 A;  1LTT D;  2QKI C;  4B3S Q;  1IBM Q;  1DJR D;  5JJL A;  1PTO H;  4P73 A;  3NHH A;  1IBL Q;  3U4Z A;  1YNJ C;  3NQI A;  4ID6 A;  1KD1 C;  1PTO B;  2IHE A;  4HN7 A;  5FOB B;  5IIF A;  5A2Q E;  3IFT A;  4ILW A;  1UE1 A;  2E2D C;  5I6W A;  1U0L A;  4QUC A;  1PZI D;  1E3P A;  4DK1 A;  1TWF H;  4X66 L;  2Q2T A;  1JOQ A;  3I55 A;  4LWC A;  1TWF B;  1KDB A;  1U4R A;  4YWK A;  3CME A;  1FJG L;  2ZTE A;  2Q8T A;  1CA5 A;  1PRT B;  3I2Z A;  4A76 A;  1AH9 A;  4AIM A;  2MNA A;  3J81 L;  5I9O A;  3S15 H;  2A73 B;  1K3R A;  5LL6 S;  5ELN A;  2IX0 A;  1KLG D;  2L0C A;  4Q5V A;  3NE5 B;  2JJQ A;  3S15 B;  1EEF D;  4DGZ A;  3AQQ A;  2PYK A;  5EPL A;  2DNC A;  2PZU A;  4UP7 A;  4JBJ A;  5IGF A;  3L9A X;  4GKK Q;  1AN8 A;  1R4P B;  5JVH 3;  3UI2 A;  4DR5 L;  1A2U A;  3KF6 A;  4LUO A;  5CBE E;  1VQP A;  4YHH Q;  4JCV E;  1ENA A;  1CQV A;  3PIO 3;  1UWV A;  2VQE Q;  4WOR A;  4LF5 Q;  1IXR A;  1A62 A;  3G48 A;  1L1O C;  1L1O A;  1WFQ A;  2KEC A;  2PNR C;  5ELD A;  4HID A;  4A3B H;  5CGK A;  1SYF A;  1UUP A;  1P16 A;  2B8F A;  1ASZ A;  1FVI A;  3ULJ A;  2EJM A;  4MNO A;  4A3B B;  2FMC A;  4K0K Q;  3TRE A;  1GUW A;  3VYS A;  5D14 A;  4QF4 A;  3AMU A;  4UHV A;  2N49 A;  1PHJ A;  3U4V A;  5IP7 G;  1XMQ Q;  1N8R C;  2AKW B;  1H9M A;  1ILP A;  2MO0 A;  1WCM H;  3CCL A;  2F0O A;  1YNX A;  2EXD A;  4HJ9 A;  1SNP A;  2RSN A;  1WCM B;  2WKD A;  5C0X J;  1JJ2 A;  2F0F A;  2WFW A;  1YZ6 A;  5CYU A;  2YYZ A;  4A3B G;  4JI8 Q;  5GAE C;  2EYH A;  5FKA C;  1BUV T;  1PYB A;  1QWY A;  4KJN A;  4JI2 Q;  2F0N A;  1EYG A;  5LMN Q;  1KHI A;  1Y8P B;  4ZUJ A;  4KK7 A;  1YHB A;  4JI4 L;  4JPB W;  3H3V C;  1HZA A;  2I5H A;  1XX8 A;  3M7G A;  5IT9 E;  4IOC A;  4A3E H;  1NUC A;  3GTP B;  2VQF Q;  4A93 H;  3JAM c;  2XTI A;  3I4O A;  1BCP D;  1WCM G;  4L5S A;  1CUK A;  4A93 B;  2NVY H;  3CD6 A;  4X3K A;  4E6I A;  1YVC A;  1SNM A;  5LL6 X;  3FPP A;  2EY1 A;  2K5Q A;  4YIJ A;  4IJH A;  4DR1 Q;  2NVY B;  5M5Y H;  3J7A F;  5C6A A;  3E6Z X;  2VUM H;  4NW2 A;  2ICI A;  3GTO H;  4MN3 A;  2R7D A;  5M5Y B;  2B3G A;  4IO9 A;  3S2H H;  2VUM B;  1RCV D;  1GHK A;  3E0J A;  1BQQ T;  1ZYR C;  3GTO B;  2NN6 G;  4K2K A;  4DKA C;  4HJA A;  4A93 G;  1BF4 A;  2F3I A;  1F2L A;  2CQO A;  2UXB Q;  1EY6 A;  1HQM C;  2A68 D;  1ET9 A;  1VQ7 A; 
#chains in the Genus database with same CATH homology
 1QZG A;  1CKM A;  3U58 A;  2JA9 A;  1GM5 A;  2ZJQ A;  2ASB A;  4LNQ A;  5GAD C;  1A8V A;  3HOW H;  3CP0 A;  4GNX B;  3FKI G;  2HHH L;  3RZO H;  2B29 A;  2AWO A;  4NPS A;  1Q1B A;  3CCQ A;  2VUM G;  4LUZ A;  5M3M H;  3J81 c;  2LXK A;  4PZ6 A;  3GTK H;  1I94 L;  4GLX A;  1LYL A;  1TWA H;  3E9I A;  3BJU A;  3ER0 A;  4TVA B;  4JI7 Q;  4GS3 A;  3OYY A;  4IFD G;  2PNH A;  2FXQ A;  4NB3 A;  4UPA A;  2JA8 G;  1G29 1;  4JBK A;  2N8N A;  1AE3 A;  2CFM A;  2K5V A;  4Y7N H;  1EOV A;  3M4Q A;  2Z0S A;  5GAH C;  1Q86 C;  1HR0 Q;  3MXN B;  1VQB A;  5DLQ E;  1KRT A;  3STB D;  3G4S A;  1PV4 A;  4BBR H;  1QUQ B;  3NEM A;  4X62 L;  4DV1 L;  1K73 C;  1M90 C;  1N33 Q;  1RL2 A;  1Q46 A;  2UUC L;  4DV6 L;  1HH2 P;  3GTL H;  3CAM A;  1S40 A;  3HOW G;  5HY6 A;  5LMU L;  3S2D H;  4KHP L;  1HR0 W;  4A3L H;  5C0X I;  1Y1V G;  2QGQ A;  3F8T A;  3HFZ B;  5M3M G;  2OWO A;  2JA7 H;  2QEX A;  3T1H L;  3PUY A;  1IBM L;  2RHQ B;  4DV3 L;  1VCI A;  4DAY B;  4GLA C;  1K9M C;  1E7Z A;  3U50 C;  3UDG A;  1B7Y B;  4DR7 Q;  2GVA A;  2WP8 J;  4YCU A;  2OTL A;  1C0A A;  2K50 A;  2WB1 E;  4R4T A;  1SRU A;  4A3I G;  4DUZ L;  3SGI A;  1PH6 A;  3RLO A;  4AYB G;  1YBY A;  3W1B A;  4AQY Q;  4B3T L;  4JI5 L;  1HNX Q;  4R1J A;  4LFA L;  4B3R Q;  2ZJR A;  4BBR G;  1XTD A;  2VNU D;  1K0R A;  2VZA A;  1KRS A;  1CKN B;  1GD7 A;  2Z6K C;  1EIF A;  2Z6K A;  1W2B A;  1GKH A;  2BA0 A;  3GTJ H;  3JAM i;  1ASY A;  1SRO A;  4A3L G;  2ES2 A;  4JI3 L;  4JI6 Q;  2NN6 I;  3PUZ A;  1IZ6 A;  4LUV A;  1HNW Q;  1L2F A;  1SR3 A;  1E24 A;  4DV0 Q;  4X66 Q;  2JA7 G;  4DV4 Q;  2I0Q A;  2UUB L;  1EFW A;  1VQE A;  2YTY A;  4PZ7 A;  1Q8K A;  4LF7 L;  4JI0 L;  1X9N A;  1NJI C;  1FJG Q;  4LFB L;  2VL6 A;  1J6Q A;  3RR5 A;  1SLJ A;  2E8G A;  1TWG H;  4RG1 A;  3KLW A;  4NXM L;  2A8V A;  1N9W A;  3D31 A;  3DLL A;  3H0G H;  4JOI C;  4JOI A;  1JJG A;  1Y14 B;  2JEA I;  1N36 Q;  1OXT A;  1A0I A;  3TQY A;  4DV7 L;  5IWA L;  1Q81 C;  5J3B A;  5IP9 H;  5E7N A;  5C3E H;  1Q1E A;  4GLV B;  3PIP A;  1X55 A;  3AFP A;  1I94 Q;  2JE6 I;  2D0P A;  5JJK A;  2HIX A;  1WI5 A;  2RHS B;  4P72 A;  2Q2U A;  1XPR A;  1X3F A;  2MQH A;  3BZK A;  4EQ5 A;  1NMF A;  3PUX A;  5AJ3 L;  3TS0 A;  1VQ9 A;  1XNR L;  5LMN W;  4DV2 L;  2YU9 H;  4GKK L;  2ZM6 L;  1PH5 A;  4LFC L;  2E5L L;  4JYA L;  3CC4 A;  2YTV A;  3ICE A;  3CCV A;  1I6H H;  1VQD A;  1VS0 A;  2E2H H;  2F4V Q;  4X62 Q;  4DV1 Q;  1KXL A;  2D62 A;  5C4X H;  3K0X A;  1E22 A;  2WAQ G;  2NZO A;  2N78 A;  3KF6 B;  1I50 H;  3J81 i;  2UUC Q;  4DV6 Q;  4BY1 H;  1SE8 A;  1OXU A;  4DR4 L;  4OON A;  3H0G G;  1PH7 A;  1VQF A;  2K5H A;  3CPF A;  3L0O A;  4QGU A;  4KHP Q;  4HJ7 A;  3CCU A;  2VQE L;  3RLF A;  4A3K H;  4LF5 L;  2Y0S G;  5IP9 G;  1PVO A;  3S24 A;  5C3E G;  4QIW E;  1OXS C;  2UU9 L;  2JEB I;  3EIV A;  3KYH C;  3T1H Q;  3HKZ G;  4KHZ A;  1QVG A;  4DR6 L;  4O2D A;  4A3E G;  4A3F H;  3M9B A;  4O0A A;  1V9P A;  1Z9F A;  4DV3 Q;  3PF5 A;  1K8G A;  2MO1 A;  2QA4 A;  4DK3 C;  1O7I A;  1L1O B;  2CKZ B;  4GN5 A;  3RZD H;  1HZ9 A;  1VQK A;  2Y0S E;  4POG A;  4WJ3 M;  3K8A A;  2BH2 A;  4LF6 L;  4IFD J;  1G6P A;  2PQA B;  3CF5 A;  4LFA Q;  4JI5 Q;  2UXD Q;  1VQ5 A;  1N32 L;  3HKZ E;  4WJ4 A;  1UE7 A;  1HJP A;  1T9H A;  1X3E A;  4LF9 L;  4A75 A;  1J5E Q;  5C4X G;  4FDB A;  4P74 A;  2R7F A;  4BY1 G;  3I4M H;  4APV A;  4OWT B;  4JI3 Q;  4A3K G;  3KDF A;  3TRZ A;  1A63 A;  3J80 c;  4DR2 L;  2B63 H;  1X6O A;  4QQB X;  2UUA L;  4BA2 I;  2K4K A;  4MTN A;  1JE5 A;  1UE6 A;  4JI0 Q;  4OX9 L;  1V43 A;  4A3F G;  4A3C H;  3BU2 A;  4LFB Q;  2R7Z H;  3UDF A;  3F1Z A;  1YIJ A;  2KCM A;  1CSQ A;  1N34 L;  2NVX H;  2RCN A;  2JA6 G;  1BBW A;  4LW1 A;  3RNU A;  2CWA A;  2I5L X;  2IT1 A;  2A1A A;  3WWV A;  3HOU G;  2EIF A;  3CXC A;  4JI2 L;  1M1K C;  2L15 A;  3CCR A;  4ME3 A;  5M3F H;  1VQJ A;  1B8A A;  4IPH A;  4DV7 Q;  2VS1 A;  3NEL A;  1X54 A;  3UE1 A;  5IWA Q;  3AYH B;  3BZC A;  4Y52 H;  1YHQ A;  4UP9 A;  3H3V H;  3G71 A;  4X64 L;  3CCM A;  2ID0 A;  4JI4 Q;  2BH8 A;  2CCZ A;  3KFU A;  1IYJ B;  4NXN Q;  3CC7 A;  4A3J H;  5IY0 A;  1AE2 A;  1C9O A;  1MKH A;  3I4N H;  5AJ3 Q;  1JMC A;  4ALP A;  3S14 H;  2DUD A;  4B3S L;  1XNR Q;  3HOX H;  2K52 A;  1HZC A;  4JV5 L;  2B63 G;  1K83 H;  3F2C A;  2ZM6 Q;  3PCO B;  2PI2 E;  1C7Y A;  3W5O A;  1IBL L;  2E5L Q;  4LFC Q;  5BR8 L;  1EQQ A;  4JBW A;  1MJC A;  2R7Z G;  4IJL A;  4BA1 I;  3J7Z C;  4YWM A;  3CCE A;  1VQO A;  1SN8 A;  5IP7 H;  1KL9 A;  1Q7Y C;  4DR4 Q;  3OTO L;  5C4J H;  4J15 A;  1KC8 C;  1IBK L;  1Q82 C;  3MEF A;  3GTQ H;  5M3F G;  1EQR A;  2YV5 A;  5ELO A;  4RMF A;  3H15 A;  1YHA A;  5H1S E;  2Q2H A;  1VQH A;  3PUW A;  3Q8D A;  2UU9 Q;  4AYB E;  4GOP B;  2ATW A;  4A3J G;  4DR6 Q;  1VQG A;  3L2P A;  3I4N G;  2ZJP A;  4LF8 Q;  2RF4 A;  3CW2 C;  4EX5 A;  3HOX G;  3TS2 A;  2UXB L;  4IOA A;  4X6A H;  4TQU S;  1I5F A;  4JI1 L;  1JT8 A;  1D8L A;  2CWP A;  1Z47 A;  1VQ7 A;  1WOC A;  4LF6 Q;  3GTG H;  1PH9 A;  1TWC H;  1VQA A;  3DM3 A;  4GNX C;  4PZ8 A;  4GNX A;  2MFI A;  1N32 Q;  1TWH H;  2LXJ A;  3ULP A;  4GN3 B;  4LF9 Q;  3I56 A;  1HNZ L;  2PI2 A;  1Y1W H;  2JK8 A;  1NBW A;  1YJW A;  2HHH Q;  4B3M L;  3EN2 A;  1GO3 E;  4X65 L;  2NVT H;  3A74 A;  1EIY B;  2F52 A;  1YEZ A;  4JC0 A;  3UDI A;  3W1G A;  3J7A 5;  3HOZ H;  1YIT A;  3RN2 A;  1OXX K;  3VDY A;  4DPG A;  3PV0 A;  1VQI A;  4IFD I;  4JI7 L;  3FHW A;  5GRO A;  2UUA Q;  1VQN A;  2H5X A;  4H02 A;  3T1Y L;  4OX9 Q;  1XJV A;  1QUQ A;  5C44 H;  2OQ0 A;  1HR0 L;  1N34 Q;  1UEB A;  1IL2 A;  2OQK A;  4UP8 A;  3F2B A;  5IYC H;  4C3H H;  2Q2I A;  1XNQ L;  2JQO A;  2HQL A;  2ZTC A;  4OO1 G;  1S3O A;  2PMZ E;  3CMA A;  4YHH L;  3IRB A;  3GTP H;  3A0J A;  4QL5 A;  4XIG S;  1Q12 A;  2R6G A;  1H95 A;  4PMW A;  1CKO A;  1X3G A;  4R4I A;  1Y1W G;  5LMU Q;  3J80 i;  2E2I H;  4X64 Q;  1GVP A;  1NMG A;  1BKB A;  4DV5 L;  1R9T H;  1G51 A;  3TEH B;  3UDX A;  4KI0 A;  5HGQ A;  4B3S Q;  3EBE A;  3HOY H;  1LTL A;  2WAQ E;  1IBM Q;  4JV5 Q;  3RLN A;  5JJL A;  1JJC B;  3OW2 A;  4R4C A;  3G6E A;  4P73 A;  3HOV H;  1P8L A;  1IBL Q;  3K81 C;  3U4Z A;  5BR8 Q;  2VW9 A;  3K7A H;  1KD1 C;  1HZB A;  1QVC A;  2IHF A;  2V1C C;  2IHE A;  4C3J H;  4DUZ Q;  1CKN A;  1NY4 A;  4K0K L;  2K5N A;  4B3T Q;  3OTO Q;  3ZJY C;  1UE1 A;  4BBS H;  1X65 A;  1XMQ L;  1U0L A;  2AMC B;  3M3Y H;  3H3V I;  1U5K A;  1E3P A;  1SMX A;  4DR3 L;  1EWI A;  1VQ4 A;  5IT9 c;  2IY5 B;  5FLM H;  1WJJ A;  1TWF H;  4X66 L;  2E2J H;  3JC6 6;  2Q2T A;  2AHO B;  2UUB Q;  1EUJ A;  4L5R C;  1UE5 A;  4LF7 Q;  4QJF A;  1TXY A;  3I55 A;  4LWC A;  2JA5 H;  3HOY G;  4YWK A;  3CME A;  1FJG L;  2ZTE A;  4JI1 Q;  1L0W A;  3HOV G;  4GN4 B;  3ULL A;  4R4O A;  4JI8 L;  3I2Z A;  4HIM A;  4A76 A;  3GTM H;  4IPD A;  1AH9 A;  4AIM A;  2MNA A;  1XMO L;  4NXM Q;  3PGZ A;  3M4O H;  2R93 H;  5FLX c;  1N36 L;  4KLK A;  1KQS A;  1HNZ Q;  4C2M H;  3E0E A;  1Y1V H;  3J81 j;  5LMN L;  3S15 H;  2N3S A;  1K3R A;  4YCV A;  4X65 Q;  4B3M Q;  4YY3 L;  2GVB A;  4A3D H;  5ELN A;  2IX0 A;  3HKS A;  3AFQ A;  4BBS G;  2KCT A;  2C35 B;  1VQ6 A;  3UE0 A;  1LM0 A;  2JJQ A;  2YTX A;  1JB7 A;  4C3I H;  1NTG A;  3I4M G;  2VQF L;  4GKJ L;  3AQQ A;  3PO2 H;  1VQC A;  5FLM G;  4HJ8 A;  1OTC A;  5EAY A;  3T1Y Q;  4JG2 A;  2IX1 A;  4UP7 A;  4JBJ A;  3NEN A;  4DV2 Q;  4A3I H;  4GKK Q;  3A5Z B;  3M4P A;  2JA5 G;  3PO3 H;  5GQO A;  4JYA Q;  1PYS B;  4A3C G;  2F4V L;  4DR5 L;  3KF6 A;  4LUO A;  4OO1 I;  1MIU A;  4YCW A;  4DR1 L;  1XNQ Q;  2GN5 A;  1KAW A;  1VQP A;  3M85 A;  2D0O A;  3F2D A;  4UY8 C;  4YHH Q;  1I3Q H;  4JCV E;  4OWX B;  3STB C;  1PA6 A;  2R93 G;  1MJE A;  1OXV A;  3E9H A;  2ZTD A;  1UWV A;  3KOJ A;  3CQZ H;  2WB1 G;  3KJO A;  3S1R H;  4MZ9 A;  4A3D G;  1FL0 A;  5FJ8 H;  2VQE Q;  1LUZ A;  4LF5 Q;  4DV5 Q;  2NZH A;  1PH4 A;  5JJI A;  4OXP A;  5JEA J;  1IXR A;  1A62 A;  3G48 A;  3KJP A;  1YI2 A;  2BA1 A;  3GO5 A;  1V1Q A;  3PO2 G;  3K80 C;  1L1O C;  1L1O A;  1WFQ A;  4HID A;  3K7U C;  4LF4 L;  4QY7 A;  2KEN A;  2K75 A;  1PH1 A;  4PG3 A;  4L5Q A;  2R92 H;  4A3M H;  4A3B H;  4BY7 H;  2PQA A;  1PH2 A;  1P16 A;  1ASZ A;  3A5U A;  2UXC L;  1FVI A;  3ULJ A;  1SFO H;  3PO3 G;  3PUV A;  4MNO A;  4DUY L;  3CCS A;  1PH3 A;  2UXD L;  5IYD H;  3ERS X;  3PF4 A;  3TRE A;  3S16 H;  4K0K Q;  1VQL A;  5K36 G;  4DK6 C;  1J5E L;  3CC2 A;  1CSP A;  2N49 A;  1PHJ A;  3S1M H;  1PFS A;  3U4V A;  4DAM A;  5JEA G;  5IP7 G;  2EQS A;  1XMQ Q;  1N8R C;  3S17 H;  2AKW B;  3D0F A;  2KBN A;  3S1N H;  5M5X H;  3KF8 B;  4DR3 Q;  3PSI A;  1E1O A;  4JBM A;  4P71 A;  2A19 A;  2MO0 A;  1WCM H;  5FJ8 G;  1VQM A;  3CCL A;  4A3G H;  1YNX A;  1BVS A;  2EXD A;  4HJ9 A;  1DGS A;  4DR2 Q;  3KDF B;  5C0X J;  1JJ2 A;  2WFW A;  4HIO A;  3M7N A;  2R92 G;  1YZ6 A;  4BY7 G;  2YYZ A;  4A3M G;  4A3B G;  2LSS A;  4JI8 Q;  5GAE C;  2KHI A;  1S72 A;  1KIX A;  4HJ5 A;  2HIV A;  3CPW A;  3RN5 A;  1XMO Q;  1WYD A;  1PYB A;  2K14 A;  5IYD G;  1N33 L;  4BXX H;  4JI2 Q;  3PIO A;  1EYG A;  4XTC S;  5LMN Q;  1KHI A;  4IPC A;  5IYB H;  4DNI A;  2XGT A;  4R4Q A;  4YY3 Q;  1YHB A;  4YWL A;  1YJ9 A;  4JI4 L;  3LGJ A;  4NXN L;  1HZA A;  2I5H A;  1PH8 A;  4AH6 A;  1B70 B;  2OCE A;  5C0X G;  4IOC A;  2VQF Q;  4A3E H;  4GKJ Q;  4A93 H;  3JAM c;  2XTI A;  3I4O A;  1D7Q A;  1WCM G;  4L5S A;  2NVQ H;  1E1T A;  3HOZ G;  4A3G G;  1K8A C;  1CUK A;  1RIP A;  1W3S A;  4DR7 L;  2NVY H;  3L7Z C;  3CD6 A;  1YVC A;  4DR5 Q;  3AEV A;  5IE8 A;  4IJH A;  4DR1 Q;  2I5M X;  5C44 G;  3GDE A;  4AQY L;  1HNX L;  4B3R L;  2OTJ A;  3FKI H;  5M5W H;  5IYC G;  5M5Y H;  1QVF A;  1XPO A;  4POF A;  2VUM H;  1IBK Q;  2HT1 A;  4BXX G;  4A4I A;  3NBH B;  2AWN A;  4P75 A;  5IYB G;  3GTO H;  1FGU A;  2R7D A;  1BBU A;  2B3G A;  3GD7 A;  3FP9 A;  4IO9 A;  5GAG C;  4IPG A;  4GOP A;  4GOP C;  4JI6 L;  3S2H H;  1XPU A;  1HNW L;  4HIK A;  1QZH A;  4L5T A;  2NN6 G;  4DKA C;  4HJA A;  4DV0 L;  2DGY A;  1YJN A;  2JA8 H;  1X56 A;  4DV4 L;  4LF8 L;  4OWW B;  2VY3 A;  4A93 G;  4LF4 Q;  2F3I A;  3CCJ A;  1NE3 A;  3I7F A;  3B6Y A;  2CQO A;  2JA6 H;  2UXB Q;  1VQ8 A;  2ALY B;  2UXC Q;  2KHJ A;  3HOU H;  3S1Q H;  4DUY Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...