3A8KE

Crystal structure of etd97n-ehred complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
125
Chain Sequence
NVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transport protein
molecule keywords Aminomethyltransferase
total genus 29
structure length 125
sequence length 126
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3a8kE00
1PMRA 1B9MA 2AWOA 1YNJC 2A69C 2F1MA 3U9SA 3LWUA 1E2ZA 3SE0A 1GHKA 1HCZA 2PNRC 2PPBC 3A8IE 2A6EC 1Q90A 2BDOA 5K36H 2AUJD 2A68D 3A8JE 4OO1H 4KKTA 4DNRB 1YNNC 3N6RA 1Q1EA 2B8FA 1FYCA 1OXTA 5A35A 1Y8PB 1ZYRC 2DN8A 3GQBA 1E2WA 5JEAH 2EVBA 4LK1C 2A6HC 1GUSA 1HPCA 1Y8OB 1CFMA 1LABA 4TQUS 1GUTA 3D31A 3W3AA 5C0XH 4RCNA 2NN6G 1O78A 5BN5A 1A6XA 2IT1A 4KHZA 3RLFA 3L7ZC 3PUZA 1GUNA 1TU2B 3VR2A 3LNNA 2A68C 4G7ZC 1GHJA 3P20A 4IFDG 3M4YA 3A8KE 3VR5A 1DXMA 1DCZA 3CRKC 3PUWA 4JK1C 5KNBA 4OGQC 2A69D 3PUYA 2ZT9C 1B9NA 1Q12A 3MFYA 3OPOA 1H9RA 3HGBA 4H13C 1Z7TA 3TZUA 2EJGC 2R6GA 2A6ED 2AUKA 2K32A 1TKWB 2NN6I 2D5DA 2JEAI 5C0XG 1H9SA 2E75C 3CRLC 2DNEA 3IFTA 2YYZA 2QF7A 3QG1A 2NN6H 4DK1A 1H9SB 1ONLA 2B8GA 4I7ZC 4KN4C 2Q8IB 1Q1BA 2O5IC 3EQLC 1SMYC 3M85A 1IW7C 3GD7A 3VR4A 3H94A 1VCIA 3A7LA 1V8QA 3D4RA 3PV0A 4BA1I 2KA7A 3FMCA 2L5TA 4KKUA 1FR3A 1OXVA 4KN7C 4G7OC 4HR7B 4LJZC 1I6VC 1QJOA 2BA1A 2E76C 3T53B 3OOCA 3VA7A 2JE6I 1H9KA 1GJXA 4PV1C 1G291 1V43A 1CI3M 2EDGA 2K7VA 4XIGS 5K36G 1K8MA 1H9JA 3QJYA 1DD2A 5BN4A 1OXUA 1VDZA 3OW7A 3PUVA 2JEBI 3QIAA 5KNCA 2E74C 3IKJA 1K8OA 1T5EA 2DNCA 2BA0A 2EJMA 3ND8A 2JXMB 4DK0A 1O7LA 4H0LC 2D62A 3I4LA 1IYUA 3A7AB 3NE5B 3SDZA 2V4DA 4GZYC 4H44C 2BE5D 1IYVA 3VR3A 3I73A 4XTCS 2LMCB 3WDNA 1HTPA 4IFDH 1OXSC 2KCCA 3VR6A 1LACA 4JBWA 2D2CC 5KNDA 3T51B 1Y8NB 2PCFB 4KMUC 4TKOB 3KLRA 1GUOA 4BA2I 1HQMC 1CTMA 2CW0C 3FPPA 4IQZA 2A6HD 3ND9A 4DNTB 5JEAG 3PUXA 1EWHA 1BDOA 3DXJC 3M7NA 4KKSA 4G7HC 1VF5C 3T56B 1ZKOA 4KI0A 1Y69U 2BE5C 1OXXK 3AB9A 1VF7A 1GUGA 3MXUA 1IW7D 2O5JC 5BN3A 4L8JA 4OO1G 2K33A 3BDOA 2EJFC 3I72A 1H9MA 1E2VA 1Z6HA 3BG3A
chains in the Genus database with same CATH superfamily
5EPKA 1YBYA 2FFKB 1PFMA 1E2ZA 4JBMA 1EYGA 1VQCA 4IOAA 3RUZA 5K36H 1PFSA 2Q2IA 2CW0D 2EYLA 4ZKCB 1TWAB 1KLGD 1E2WA 5JEAH 2XRQD 2UXCL 1CA6A 1HPCA 1TWFH 2K6AA 1B1ZA 1RODA 1WVLA 4K8JA 1XMOQ 1WTVA 3OSOA 1O78A 5I9OA 1LO5D 2E2JB 4DAYA 2CQOA 3L7ZC 4UP7A 5IYCH 5IODA 2XNAC 5IWAL 5T1IA 1KNAA 3MA2B 3A8KE 3VR5A 2K5WA 3KF8A 4B3RQ 4JK1C 2XIWA 2IWHA 3HOXG 1Q12A 3KJPA 4A4IA 5FLXc 1HNXQ 1VQEA 2R3ZA 3SK4A 1VQ9A 4BY1H 1SYFA 1ASZA 4GKJQ 2AUKA 1K0RA 2DUDA 2EOTA 2HDLA 1DM0B 5C44G 4LW1A 3W2DA 2Q8IB 1G2SA 1SROA 2IX3A 1I50H 3I4NG 2KA7A 2MGSA 5IGFA 2Q8RE 4RGOS 2K14A 1A2UA 1N8RC 4LUVA 4ZCKA 3FEWX 4F88A 1HJPA 2B29A 3F2UA 4JBKA 3H6MA 2F0QA 4X65L 2BDNA 1K8MA 3ZYYX 4YWKA 1N33L 1IYJB 3PUVA 3OW7A 5ELCA 4QJFA 3K7AH 4JPBW 1LT6D 2EJMA 4HJAA 3PIPA 3HKZG 2I5MX 2V4DA 3J7ZC 4DUYQ 4L6TB 4K8IA 3NQTA 4J15A 4C56C 2Q2TA 3MAQA 1AZQA 4FDBA 2GVAA 3S17H 2Z6KC 2EY6A 1VQ6A 4FXGC 2RDHA 3CCEA 3CQZB 4RKBA 2CW0C 1Q8KA 3FPPA 1UNSA 3J80i 5GADC 4UDUC 5C4HA 2QA4A 3R8BA 3NEMA 1BF4A 1O7IA 4NPSA 1XPUA 4KY5A 4CKEA 3OIQA 2K5QA 4OWTB 1HNWQ 2MO0A 1DOLA 3CCRA 2ZM6L 4KN7C 3J80c 1PMRA 2K75A 1U0LA 2X6GA 4MHEA 3J81L 3D6CA 2ZXOA 2F03A 4DR7L 4CDFC 3HOWG 4A3KH 3TP7A 5IY0A 4A3CH 1HFGA 1JJ2A 1ENCA 3K7AB 4JOIA 1JOOA 2KUMA 5FO8B 2MJ8A 1PXUA 3M4PA 4ZKBB 1LABA 3I91A 1ZXTA 1XWEA 3MTSA 2R92G 3CPWA 1CKNB 1X3EA 3KUPA 4NW2A 5KYLA 3LNNA 2SEBD 4K6LA 1VQMA 1Q82C 4K14A 5KNBA 2R61A 2E2HB 1SYGA 1HR0W 1SFOB 4ME3A 2VB3X 1CKOA 1VMPA 4IFDI 2SNMA 2E2IH 1VMCA 3CCUA 3T1HL 2E75C 3IFTA 2JA7H 2NN6H 2EYOA 1BCPD 1CKNA 2F3WA 2O5IC 1SMYC 1SXTA 1KXLA 3PQIA 1BCPB 3U4VA 3D4DA 4B3SQ 3CKIB 1CZWA 1EQVA 4GKKL 1PZID 4QB4A 5HGQA 4RHRA 4PZ8A 1H9KA 3I7FA 3U4ZA 4LF7Q 3TEHB 2GN5A 4HIMA 3KF8B 4JC0A 4WJ3M 3STBC 3TDQA 2Y0SB 2OWOA 2VUMG 1UE6A 3ITPA 4R8NA 1I4XA 5C5MA 4DR5Q 3NK9A 4CKCA 1T5XD 1A3VA 4R4QA 3HEJA 1K73C 1IBKQ 3DUZA 3R2TA 2AQ2B 4HMJA 3JAML 1BNZA 1PH6A 4IN3A 1CM9A 3RZDB 1G6PA 2D2CC 3A55A 1ET6A 1K28A 2PCFB 3S14H 1DOMA 2HIXA 2B2WC 1FNWA 4H02A 4WORA 2AQ1B 5GQOA 2JQOA 1HR0L 4JI2Q 2JA7G 1EFID 2CCZA 3HOZH 1ESRA 2RKSA 4DK3C 1RD9D 4CKBA 3Q0AA 3QB3A 3MXUA 1K3RA 4IUPA 1KL9A 4ZQ3A 3AYHB 2XWJB 4DUZL 2RVLA 2XWBB 1BXTA 3T13A 1Y1VB 2AWOA 3PO3G 1G91A 4C2MH 5J22A 1TS5A 2A69C 3PCOB 4LFBL 1F9SA 3A8JE 1VQ7A 4A3EG 1EWCA 2A74C 1X3PA 4DU9A 2B8FA 2KBNA 4A3BH 1Y8PB 1F2MA 5C4XH 3GQBA 4PQXA 1EY5A 1S40A 1KDBA 1G8ZD 1HZBA 4A3MG 3E5SA 5LMNQ 5JOBA 1BBUA 2X69A 5I4DA 1VQ8A 1V1QA 1UE1A 1TWHB 3F2CA 4OWXB 2JN4A 1QNKA 4DV1L 3CD6A 4G7ZC 1ENAA 1D5ZC 5CC4A 4RWSC 1K3BC 2WAQB 2NVYH 1YJNA 1KDCA 3KF6A 4OHJA 2EZVA 3NTKA 3MXGA 2EYFA 3BJUA 5KIXA 2OQ0A 5IYDG 4DV4Q 2K50A 1U4LA 2MP1A 1U4RA 4HEDA 3S24A 3NSWA 3U58A 1C9OA 3CF5A 1B44D 3PO3B 5IGCA 3MXNA 3JAME 4HJ8A 1IBLQ 2WB1E 1JCKB 1Y14B 1DONA 1SNQA 2Z0SA 3CCSA 1V8QA 1MHWC 1MSHA 4OX9L 2Z4IA 4DR2Q 4G7OC 1X3FA 3Q8DA 3OOCA 2UU9Q 1FGUA 3NELA 3L9AX 4AQYQ 5IT9E 4O2DA 3TMEA 4RMFA 4A75A 2WV6D 4JVZA 4QIWE 2JEBI 2LSSA 2MQHA 5J3BA 2BA0A 4K0KL 3TRZA 2EYMA 2SOBA 3ND8A 1LUZA 3OMCA 4B3TQ 1I4HA 2B2YC 2LXJA 2KENA 1UEAB 2BE5D 1Y1VH 1XYIA 2LMCB 3WDNA 3OTOQ 1S5BD 1HTPA 3K5NA 2H1EA 3WOEA 2VQFQ 3GTOH 3LGJA 3S17B 4A3GG 1EY0A 3DM1A 5EPLA 4JI5Q 2Z9HA 4LUZA 4YY3L 1U5KA 2HHHQ 2B63B 1HNXL 4GKJL 2N8NA 1X65A 3S14B 3VYUA 4CBVA 1NSNS 4DR1Q 3DWPA 1MJEA 1GXDC 4N8X1 3STBD 3CCMA 2WIIB 1WCMB 4K0KQ 4OELB 5J1ZA 3BZCA 1GHKA 4E6IA 1QILA 2XSCA 1U4MA 2HIVA 2AUJD 5E3FA 2EYJA 5C0XJ 3N6RA 4B3MQ 2HQEA 1OO9B 2EYPA 4J1MA 3K59A 4ME5A 3LWEA 5HURA 5GROA 3PO3H 1AP0A 5ELOA 3A56A 1V1OA 4A3KG 3R2IA 3FKIG 3TREA 1EEFD 1MGSA 4A3DH 1PTOB 4RA8A 4FO2A 4RCOA 2B63G 4LFCL 1I5FA 1FNVA 2MPMA 1I6HB 3M4YA 1VQOA 1CHQD 2RCFA 3MFYA 4DK0A 3KYHC 4DXFA 5LHY1 3ICEA 3M4OB 1QZGA 1C4QA 5JPNC 1QG7A 4FXKC 4OL7A 1ONLA 4HMIA 1VQ4A 5ELFA 4DK6C 3W1BA 4DUYL 3GTJB 3E9HA 4AYBB 2JSOA 2RQXA 1IBMQ 4GNXB 1BBXC 4LJZC 3UE1A 4L5TA 2RDGA 2Y0SE 4IOCA 4A3MH 2K1BA 4IALA 1CI3M 2PW5A 1VQAA 1B3QA 4UY8C 2F0PA 2F0EA 2FJ2A 2A5HA 2HHHL 2JA5B 4KHVA 3CXCA 4OX9Q 3ERQA 1CA5A 1K83H 4BBSH 1SE3A 4DV2Q 3FDTA 3QWNA 1BUVT 1NR4A 4A3EH 5KRUA 5CV8A 2F0KA 2J4XA 1HR0Q 5KNDA 4BBRB 3K5MA 1HNZL 4DV7Q 3T1HQ 4V190 4R4OA 4C3HG 4BA2I 3I2ZA 2F0IA 1A62A 5COYA 3PUXA 3KLWA 2E2DC 1RF2D 2F4VL 1V9PA 2CH4W 4DR2L 4OO1G 5IYBG 3M7GA 1TXYA 4A3FH 1HFNA 4O1NA 5IP7H 2MO1A 2DY8A 4LNQA 3FKIB 5IT9c 4ID6A 3CP0A 2L4NA 4RGNA 4DNRB 1PH7A 1Q1EA 3KLSA 3SK5A 3HZXA 2GA4B 2ICEC 5J39A 4LK1C 4LF9Q 3ER0A 3PIP3 3I4OA 1TWCH 1LV9A 3W3AA 1JC7A 1A3UA 2E2IB 1PTOD 2LFNA 4IURA 4GKKQ 1SJED 5CV6A 2IT1A 1SJHD 5FJ8H 1QZHA 4DV5Q 2Q2HA 1G6ZA 2OT2A 3BDCA 3P20A 1HRJA 3P1HA 1XX8A 2JJQA 1MJCA 3TZUA 1PRTF 1JE4A 3OHXC 2NUCA 2NN6I 2ENBA 2FXQA 2JA8G 1H9SA 3CRLC 4LF8L 4PNYA 1EIFA 3FP9A 2G5DA 1B8AA 4DR6Q 2JYOA 1SNPA 3M85A 1SLJA 2YTVA 1IW7C 1N9WA 1QUQB 1IBML 4M1UB 4YWLA 4IPGA 2LXKA 5C4XB 2CFMA 1UE5A 1V1PB 2E76C 2JE6I 4A3IB 3S1QH 2R7ZB 3GTLB 1DGSA 1WTWA 2C35B 1KIXA 1SNMA 3I4MG 1R4PB 5BN4A 4DPGA 1VDZA 4CDDC 4A76A 2KEEA 2F0NA 1HZ9A 4R4IA 5EJWA 1ASYA 3A7AB 3I90A 4LFCQ 2C9OA 5JPMC 4KD4A 1D2BA 1HZCA 3CC7A 1YNXA 4YY3Q 1Y8NB 2K03A 1GUOA 1B53A 4O42A 4GN5A 1XXGA 1MSGA 5EBCA 4CGYB 4A3JH 1SYCA 3W1GA 1NR2A 1WD1A 2CH4A 1ICFB 2QGQA 3OWEB 3OTOL 1Q8IA 2EE1A 2F0GA 4JI4L 1KNEA 4JI6L 3H3VC 3CW2C 2KQ3A 2ZXRA 4UP9A 5BR8Q 4N9TA 5DLQE 1FL0A 1VQFA 4LF8Q 4DGZA 1YNJC 3SE0A 3DWQA 2K28A 3S16B 2UUAL 3RZOB 3CC4A 4KY7A 4DA2A 5C4ZA 1M4VA 1SNOA 4OIKA 1S3OA 1Y8OB 5C0XH 3NTHA 3RLNA 1KC8C 1ET9A 4RCNA 5D65A 4JYAL 4PMCA 3AEVA 1RDPD 1VQIA 5CV9A 2ICIA 2WINB 5CBEE 3CRKC 4OGQC 3GTKB 1B9NA 4DV0L 2KCNA 2CVRA 2JA5G 2EJGC 4B3ML 1FNUA 3T4AC 1TWGB 4BY1G 2Z1CA 4DFAA 3NHHA 1YI2A 1LTLA 1C48A 1PLFA 1ML0D 3VR4A 1XMOL 1J8IA 4BA1I 4DAVA 4JI4Q 2L5TA 2CWPA 2JA8B 5M3FG 4HR7B 1AFPA 4C1NK 3HOXH 2MHVA 1EU4A 1IHZA 2QEJC 4X3UA 2EDGA 5IGDA 1RHPA 4EQPA 4LWCA 1LT5D 1HA5A 3E9IA 1JR0D 2QW7A 3T16A 1C8CA 1K8OA 2F52A 4A3FB 3CAMA 2AMCB 3CMEA 5ISRA 1RCVD 4RHSA 5AJ3L 4GOPA 1Q46A 2R92B 3DLLA 1SBBB 4NB3A 4LAAA 4XTCS 2J0TD 4A3KB 1MKHA 1VQNA 3HOVB 1D5MC 3MEHA 4X3SA 3H09A 2MNAA 2F0MA 1VQGA 1F77A 3J7AF 3I3CA 4XDXA 2KHJA 1YNND 1WTQA 1L1OC 3ND9A 3S1NB 4KHPQ 1W6JA 2AWNA 4FP5D 2QDBA 1PDQA 2UUBL 3T56B 1OXXK 4HCEA 3E0JA 4EGVA 1LLRD 5I2YA 5BR8L 3I4NH 3LX0A 1PV4A 2WACA 4R4TA 5CYUA 1Z6HA 2XGTA 1B9MA 1IZ6A 3EIVA 4CHTB 2KECA 4JI7L 3H3VI 4A3FG 3FHWA 2IX0A 4OO1H 1N36L 4DF7A 2NWGA 1K83B 4AH6A 2FHTA 3PO2B 2FMCA 3K5LA 3L3OC 4TQUS 1IKMA 4C3IH 1Q7YC 3HKZB 4DAYB 5E7NA 2OXPA 5C3WA 2H5XA 4LF4Q 2A68C 2B2VA 3E0EA 1CSPA 5ELEA 2ZT9C 1XNQQ 1TVXA 1W6KA 4H13C 4CJ2C 3HGBA 4PMWA 5JJIA 1I3QH 1IXRA 2PO4A 4IUNA 2XVSA 5A2QL 2D5DA 5KYIA 5LMUL 1I6HH 1KAWA 2MUYA 4A3LG 2YYZA 1SNCA 4KN4C 3EQLC 5NUCA 4K6DA 3RLOA 5LL6S 3J7AV 5M3MB 1VQ5A 4HN7A 3FMCA 3WWVA 3M4OH 3VYSA 2I07B 1XJVA 2WB1B 1OTCA 1ICWA 1E0BA 1VQJA 2K7VA 4LFAQ 1TQOA 1J5EQ 1YITA 2L55A 3IFDA 4XXEA 2R93B 1BCPC 2WAQG 5EKKA 5C3EB 4HJ7A 1PH9A 4MNOA 3QOJA 1PFBA 2D62A 1UE7A 4DV2L 4DV5L 3CMAA 4JI3Q 1HA6A 3GV3A 2JK8A 2IHEA 4X3KA 2VZAA 4DKAC 1O80A 3CCVA 3IAYA 1TS4A 4AYBE 5E4XA 5M9OA 1MI2A 1DYQA 4LF9L 1E24A 1S5CD 4QQBX 1RL2A 2B2UA 1UUPA 4BY7B 2F0JA 5L37A 3QR8A 1CTMA 1SYEA 1AZPA 4JI8L 3WOFA 1LTGD 1EOVA 4DNTB 1EWHA 2UUCQ 2LKVA 2NTSA 1SN8A 1X32A 2K33A 1EFWA 3BDOA 1SNDA 2G9HD 1LTBD 2M00A 2UUBQ 1CUKA 3U9SA 4BXXH 1HCZA 4HIDA 3AU7A 1CQVA 2A68D 3AQQA 1NE3A 2IL8A 4DV3L 3I4MB 1XTDA 5CV5A 1XNRL 2PZUA 3UE0A 1JWMD 3G6JB 1PTOF 2R7ZG 3BVMA 1WTOA 2JA7B 4GLXA 3GTLH 3GTPH 2XN9C 2N3SA 5A2QE 2J7ZA 3HOYG 3H3VH 1E22A 2NVTH 2B2TC 4NP5A 2NBFA 3S2DB 1R9TH 1PYBA 1I4RA 4NXNQ 4B9WA 4ALPA 3NWTA 2ZTDA 1Z7TA 1EIYB 3J81i 4HAEA 1SEBD 4X64Q 4B3RL 1NTGA 1EYCA 1S72A 4X65Q 3J81E 2A8VA 4A93B 3TS0A 1VQLA 4EX5A 3D4RA 3UDGA 4K5WA 1X56A 4IUVA 2IX1A 3RD4A 4XIGS 5CMDA 1D1KA 4A3GH 3G71A 3SVMA 3C46A 3BZKA 5KNCA 4J6HA 4LMQD 1ESFA 3ONAB 3QIAA 4JI1L 4BY7G 1PFNA 4MN3A 3W5OA 1JORA 4DV6L 1STGA 1PA6A 4DR4L 2K5VA 5EKLA 3HP3A 4P75A 1IYUA 2VW9A 4JI3L 3HOUH 4KV6A 2IHFA 3HOWH 4A3BB 1JB3A 3TP5A 1G2TA 3EFXD 1WCMG 2NVQB 1JOQA 4A93G 4KLKA 4MZ9A 5FLMG 3CCQA 4KHPL 1EQQA 3PF4A 5DEHA 4Q0FA 2VUMH 1RTNA 3M4QA 1HQRD 4ZUIA 5JJKA 1HUNA 1LTAD 2UU9L 1JWSD 5C4XG 5C5LA 1PH1A 4KI0A 4NXNL 2WFWA 3HOUG 1SE4A 2VQEQ 5BN3A 4L8JA 1IBLL 2WKCA 3J81j 4DR4Q 5AJ3Q 4MTNA 2MFIA 3J80L 1Q90A 2SNSA 5C3XA 1B70B 4MTKA 4JI5L 1FGBD 3HKZE 4WFN3 5C3EH 3S2HH 4HJ9A 1Q81C 2JA5H 1M1KC 1KD1C 2BCOA 1TS3A 4X62L 1O7ZA 2KEDA 3PGZA 3D31A 4F87A 3BVGA 1K8AC 4EQNA 4TSSA 1KLUD 3NPPA 1Q3LA 1B7YB 1GUNA 3AMUA 3VR2A 1JJCB 2AHOB 1ILQA 2Z6KA 3S9WA 4YCVA 5KEEA 1EYDA 2HUGA 2Q8TA 2JA9A 3PUYA 3URYA 1WI5A 4LF6L 5F2DA 4FYDA 2R6GA 2K01A 2RSOA 4A3DG 3NWSA 2VNUD 2PNHA 5FO9B 2V1CC 3DMUA 3KDFA 4GN4B 1TWAH 2WKDA 1KRTA 2WP8J 1LT3D 2NVXH 1YZ6A 1I6VC 2F4IA 5C44B 4A3IG 4PV1C 4DR3Q 1YHQA 4GLAC 1VQBA 1AE2A 4EVOA 4GNXC 1D6EC 1F9QA 3I4NB 3OIPA 5GAGC 1Y1VG 3BYYB 2JP1A 3KDFB 2HDMA 4N9PA 5IYBH 2NTTA 5D3DA 1EQRA 2B63H 4ILWA 4PZ6A 1O7LA 2KVMA 3DHQA 3Q23A 1EIGA 3HOVH 4OONA 4C3IG 3EVQA 2UXCQ 1P16A 1K9MC 4UAIA 2RHSB 4JI8Q 4DR5L 2B2VC 3JAMc 4P2CB 1WJJA 2O4XA 2HQLA 2R92H 2K5HA 1LTRD 1S5DD 1EZ8A 4LFBQ 4FF3A 4LUOA 3MWYW 1QVCA 3DXJC 4LF7L 4KKSA 1VF5C 2HCIA 2K05A 1QUQA 2BE5C 3SEBA 2K52A 4POGA 4BY7H 3MFGA 3SR1A 4B3SL 5M5YB 2L9HA 2F0TA 4ULLA 1U9RA 1HZAA 4UPAA 3C1EA 1HUMA 2A6EC 1L0WA 2F0UA 2IW3A 1JT8A 4IUQA 3M3YH 2FMMA 3K80C 2L0CA 1WTRA 2DN8A 1D5XC 2CKZB 1GUSA 2A6HC 3KBXA 3DEOA 1JB7A 3D0FA 3G4SA 1I50B 4JI0L 1L1OA 4FNFA 4A3BG 5DM73 3PUZA 1TU2B 2F0HA 2DGYA 1EL0A 2M9VA 1TWGH 4HTHA 2SDFA 2VB2X 1E3PA 3KF6B 2ZXPA 5ELDA 1IKLA 3TN2A 4B9XA 1L1OB 1EU3A 4CDCC 5IE8A 1JJGA 1PVOA 1DZ1A 1TR5A 4QY7A 1PH3A 3GTPB 2I5HA 3MXNB 3H94A 2IPKD 5EQ0A 4FVMA 2RF4A 2N78A 1BR9A 1EOTA 1I3QB 1Z9FA 5G3LF 2GVBA 1F2LA 2LS01 2R7FA 1N34Q 2ATWA 1TS2A 3MHBA 4DV0Q 1X3GA 1K0SA 1FVIA 1XMQL 4EQOA 1IL2A 1N36Q 2F0FA 3F1ZA 2E8GA 4NKLA 3HOZB 2D0OA 2JXMB 1PRTC 3NE5B 4IJLA 4DV1Q 4KK7A 3F8TA 2KCCA 3HRZC 4HIKA 4TKOB 3NQIA 1SE8A 5CR3A 4UHVA 1T9HA 3R3OA 4XQNA 3PIO3 1EY9A 4XQJA 1JWUD 5EAYA 4G57A 4Y7NB 1EIHA 5JEAG 5IP9G 1GOZA 1ZYRD 3RNUA 1SAPA 2F0VA 3H0GG 1AW7A 3S1NH 4ZK9B 4IFDJ 1MD2D 2X6LA 3X3MA 4YHHQ 4L5RC 3L2PA 2R7ZH 3S1QB 3HOZG 3LWUA 1BQQT 2PPBC 3E3XA 1A15A 2BDOA 4BS9A 4QGUA 1VQKA 3TQYA 4DAMA 5C4JH 1G51A 4ODGA 4P73A 1JQYD 1GUTA 5M3MH 4C3HH 4K2LA 3GTMH 2Z8LA 3D8GA 5IYDH 2L12A 4L5QA 2B2WA 1CHPD 3BVZA 1GHJA 1KTKA 3GDEA 3P75A 4A93H 3HOXB 4OIJA 3GV6A 4X64L 4YCUA 4WRDA 3VDYA 5C0XG 2DY7A 2B2YA 3MVVA 1CSQA 4DK1A 1Y1WH 5TSSA 1XPOA 2D9UA 4XT3B 1VQPA 2YV5A 1XTCD 1VCIA 3D3RA 1OXVA 1CKMA 3MXPA 3KBGA 3ZJYC 3D6WA 2DJFC 3HOVG 2BA1A 3VA7A 3GP7A 3PO2H 4QIWB 5AFWA 4KD3A 1G291 1NNXA 2AQ3B 1F2YA 2EY1A 5M3MG 2ES2A 4V0BA 5M5WB 2YU9H 1KHIA 3IKJA 4DN4M 4ABNA 5JJLA 2QDLA 1JICA 3QOLA 3IL8A 3SDZA 4GZYC 4WJ4A 3BYTB 1IYVA 4BBRH 5GAHC 4GLVB 4C1NI 1OXSC 1QVFA 1ZEQX 5EKIA 1RIPA 4PMBA 4B08A 3CC2A 1LACA 4JBWA 3Q22A 1QE6A 5HY6A 3NBHA 4BBSB 2Y0SG 5LMUQ 1L0YB 1YHBA 2QKIC 1FD7D 1GUWA 3ULPA 4JG2A 2PMZB 1PRTD 4OWWB 1BDOA 3M7NA 1NUCA 3ERSX 4S3SA 5M5WH 3S1RH 1GUGA 1A63A 4GN3B 2ASBA 4A3EB 1E2VA 5H1SE 1HNWL 1STAA 1ILPA 3RMHA 1J9OA 4YCWA 2B2TA 1XNRQ 3K7UC 1RJTA 4QCLA 4ZAIA 1LTTD 2F0SA 2F3IA 3O13A 4DV3Q 1HNZQ 1D1IA 3V2TA 1I4QA 3GTJH 4TRDA 1FJGQ 1YNNC 1JOKA 4DR3L 3F2BA 3DEPA 4H7BA 2KCTA 3AFPA 1WTXA 4C3JH 3DM3A 3J80E 2VL6A 1X3QA 2EVBA 3K6OA 1DOKA 4JOIC 4I65A 3A74A 2F0DA 4FF1A 4ZYSA 3H15A 1J6QA 1KQSA 4NDXA 2YTXA 4O0AA 3KLSX 4IPCA 2A69D 5JAVA 1GVPA 1EY8A 2A19A 2OEOA 2A6ED 4A3DB 1NY4A 1S4ZA 1Q86C 1B2TA 5I2XA 2QF7A 1PH2A 3SHLA 3PSIA 3UDIA 5EBDA 4GS3A 3GO5A 2ZM6Q 3J81c 4YIJA 4DNIA 1YVCA 3PV0A 2EPBA 1BOSA 4R1JA 1SMXA 5CV7A 3HS0C 5E1FA 4C3JB 2E2JH 3NP8A 1WYDA 4IPHA 2LY7A 4YWMA 5IP7G 1WCMH 4JI2L 1HHVA 3IRBA 4C3IB 1R4QB 1PYWD 5C6AA 3I56A 1PTOC 1SYBA 4AIMA 3GTQB 1H95A 2P5ZX 3M3YB 3OYYA 5M3FH 4KJNA 1I4PA 1TWCB 4GOPB 1LM0A 2EYHA 2F3VA 4IUTA 4RAUC 1EZ6A 2VQEL 3S1RB 3R93A 2ZJPA 3C3LA 2UXDQ 1YNJD 4DR6L 4HSVA 3V96A 2L1BA 3FKIH 5DNFA 1E1TA 1WFQA 2VXWA 1PH5A 1UAPA 1MBYA 2OTLA 4KMUC 2KCMA 1STBA 1HQMC 4QUFA 4XT1B 2NVQH 1LT4D 2H4OA 1X55A 3CHBD 2ID0A 4P72A 2KOLA 2OQKA 2O5JC 1VF7A 1TY0A 3JC66 3CPFA 2EJFC 3I72A 2KHSA 1H9MA 2UXBL 4JV5Q 3BG3A 4F8MA 4OXPA 5EPJA 3RR5A 4DV6Q 3SXHA 5D3IB 2VS1A 3A8IE 4A3GB 2DJGC 1XMQQ 1KRSA 1X6OA 2R7DA 1D7QA 5CORA 4JI1Q 1U4PA 5I6WA 1QNUA 4RKLA 3MZ5A 2K5DA 1VQDA 2PZWA 1AEXA 2N55A 1WTPA 4RGMA 4POFA 4RH6A 3S15B 5C44H 1ENFA 2NVYB 1HH2P 4APVA 2YU9B 3UDFA 1A6XA 2JA8H 5HGTA 2K4KA 1DXMA 1DCZA 4A3MB 3FVQA 3RN5A 3OPOA 1H9RA 1X54A 2EQSA 1QCBD 2EY2A 1R9TB 5FJ8G 2EIFA 1I94Q 2PQAA 3I70A 4GOPC 3HFZB 2WAQE 4J8QA 2NZOA 3HOYH 3K5OA 4C3HB 4JV5L 3GD7A 3A7LA 1UWVA 2RA4A 4BY1B 5IGEA 1C0AA 1EUJA 4JBJA 3KOJA 4C2MB 4DV4L 3NBHB 3I4MH 1V43A 3X3NA 5JEAJ 1IL8A 1GD7A 1H9JA 1L2FA 1WD0A 3RZOH 4CDEC 4K5XA 2TMPA 4IO9A 5I9PA 1PZKD 5JJZA 3QO2A 1BKBA 4L5SA 4Y7NH 3RZDH 1JMCA 1F2ZA 4IFDH 1EEID 1QVGA 1KAAA 4C3JG 1S5FD 2PMZE 3K81C 3NXWA 2K5NA 4KY6A 1W3SA 3G6EA 1PRTB 2VUMB 5FLXL 3A54A 4Z9CB 3U9OA 5FLXE 1Y1WG 1N32L 1YJWA 4G7HC 1W2BA 1EY6A 1ZKOA 3AB9A 4JI0Q 1TT2A 5FLMH 2D0PA 4A3CG 2JA6B 4TVAB 1YEZA 5DM63 4ZUJA 5IT9L 2YTYA 1I94L 3TP6A 1SDFA 1VQHA 2ZTCA 3AFQA 5CGKA 1C7YA 4K5VA 2IJ0A 2PQEA 2Z4HA 4QMGA 3M9BA 3S1MH 4AQYL 4ZRZA 1ZYRC 1NBWA 5FK9C 1PZJD 1D8LA 4R8IA 5FKAC 2WB1G 3N52A 1CFMA 1AE3A 3HG9A 4NXML 1WTHA 4A3IH 1YJ9A 3TS2A 5IYCG 1EYAA 3HOYB 4DR1L 5IOCA 4EQ5A 4A3LH 4IFDG 1STYA 5ELNA 3F2DA 2KHIA 3H0GB 2PZTA 2QEXA 4R4CA 4DAPA 1XNQL 3U50C 2QCPX 1TKWB 1CZGA 2VQFL 4R9WA 2JEAI 3NUCA 3OMGA 5K5PA 3CCJA 3PO2G 1E1OA 3QG1A 3Q24A 5IIFA 1QWYA 5D14A 2E2HH 1HXYD 1PTOH 1X9NA 1BBWA 5FO7B 2EXDA 4PZ7A 1YHAA 1V1PA 4KKUA 4Y52H 1BCPF 3Q6SA 2NB0A 1E7ZA 2Z6BA 4GNXA 1BVSA 2RCNA 5DAUA 1N32Q 3J7YW 2RDFA 3EN2A 4HSPA 4AYBG 3QJYA 1PH8A 2OF1A 1AH9A 1T5EA 4JCVE 1SSOA 4JI7Q 4H0LC 3E6ZX 5M5XB 3I4LA 4U673 3JAMi 2ZJRA 1PH4A 3VA5A 5C3EG 3MEFA 2EY5A 4DUZQ 3CCLA 1B3AA 2KJXA 3K57A 3OWFA 1CT1D 4DXGA 4XQQA 3T1YL 5M5YH 2EXZA 5G3LD 3A5UA 3KLRA 5E4WC 3HOWB 3VYTA 4DV7L 1P8LA 1SRUA 4UP8A 1DJRD 2A6HD 4X66L 1O7YA 3MC0B 3SK6A 2B3GA 1QB5D 1Y69U 1LYLA 2BOSA 4QL5A 5CBAE 4WJWA 4FF4A 1II3A 5T1GA 1IBKL 4RGTA 4X62Q 5M3FB 4QF4A 2BH8A 1A8VA 4JYAQ 2HCCA 4OO1I 5LMNW 1B50A 4RFBA 2O2LD 4MIUA 5ELBA 4KJOA 2G9DA 1EQTA 4KKTA 1F9RA 2OTJA 1FYCA 1OXTA 1SR3A 5A35A 3BDLA 2R93H 2NVXB 3TBIB 2PYKA 4CJ1B 4LF6Q 1EY7A 2M2LA 2PW7A 2F4VQ 3ULLA 3VYRA 3GTQH 3K8AA 4KHZA 1A2TA 2N88A 3UI2A 2I5LX 1PYSB 3PUWA 2L11A 4G4KA 3TSSA 2C5CA 4OEMB 1N33Q 4I7AA 3GTMB 2ZTEA 2A1AA 4FXDA 4ZLTF 1TWFB 2A73B 1TWHH 3D4WA 3SGIA 4XYQA 1H9SB 3FPUB 5C4JB 1L0XB 1UEBA 3NENA 5C0XI 2CWAA 2NZ1D 1F9PA 2R93G 2AKWB 1QOHA 1FR3A 4M8AA 2F0LA 3V05A 3S2HB 1QJOA 2HD3A 3H91A 5LL6X 4IUUA 4X66Q 1GJXA 2F0OA 2UUAQ 2JA6H 3DWAA 4X3TA 4FF2A 5EGTA 2FINB 1A3TA 2E74C 3EA6A 1B4OA 3T1YQ 2XTIA 2ALYB 3FRPB 2CQAA 1M8AA 4DR7Q 1VS0A 1TY2A 4HIOA 4BXXG 3BZDB 1KABA 3VR3A 1CQFA 3GTGB 1I4GA 2NYZD 3OW2A 1NMGA 1M90C 3VR6A 3T51B 1CK1A 4IPDA 2TSSA 4PG3A 5IP9H 3RN2A 3B6YA 4IQZA 5GAEC 3HKSA 3GTOB 1BO0A 3SK8A 1TIID 4U68A 2BH2A 3HOUB 4L63B 4HCSA 4K2KA 3BS1A 3CQZH 4YHHL 1LTID 2I46A 3I55A 1NAPA 1STEA 5JVH3 1GM5A 1JE5A 2PI2A 2F1MA 4LF5Q 1YIJA 4B3TL 2PNRC 3EROA 3UDXA 2IY5B 2PI2E 1NMFA 2E5LL 3I8ZA 1J5EL 4LFAL 3C2PA 3KJOA 5M5XH 3NTIA 3TP8A 1MIUA 2PQAB 3KK7A 2UXDL 2NN6G 2RSNA 4F7XA 4HJ5A 4JI6Q 5BN5A 3L0OA 3RLFA 5JVG3 5FOBB 1NCVA 2N49A 2Q2UA 3K0YA 1EWIA 2RHQB 1SFOH 1GKHA 1FJGL 3S15H 1LTSD 2K32A 1RTOA 4P71A 4A3JG 3S2DH 1N34L 1STHA 2DNEA 4LF5L 2NVTB 1Y1WB 1SYDA 2B8GA 4BWGB 1Q1BA 1GO3E 3GTKH 1EY4A 2B2UC 1RKNA 3C1FA 5I6YA 2JA6G 1S5ED 1KDAA 1STNA 4XYOA 4CJ0B 5KGUA 3EBEA 3ULJA 2K04A 2L15A 4X6AH 3H0GH 3T53B 1SMYD 2NZHA 1SE2A 2UUCL 5CV4A 5K36G 3G7LA 1DD2A 3PMFA 1OXUA 4IJHA 4RG1A 1WOCA 2VY3A 2B39A 4QUCA 4P74A 2DNCA 1NJIC 5IGGA 3S16H 4NMZA 4BBRG 1HTLD 2QILA 4H44C 3S1MB 3A5ZB 3P7JA 3I73A 3BU2A 1PHJA 4NXMQ 2XRSD 4KTAA 2HT1A 4IZ8A 3K0XA 3KFUA 2I0QA 4JW0A 3TZDA 1XPRA 4N8FA 3NBIA 2CHBD 4Q5VA 2E5LQ 2ZJQA 5IGBA 3PF5A 2OCEA 1AN8A 4A3JB 2RBMA 3G48A 3PIOA 4LF4L 5IWAQ 4BBSG 1K8GA 2F0WA 3CU7A 5LMNL 1IW7D 3J7A5 3K58A 3A0JA 2UXBQ 3EJIA 4I7ZC 1A0IA 1Z47A 3GTGH
chains in the Genus database with same CATH topology
5EPKA 2FFKB 1PFMA 1E2ZA 3RUZA 5K36H 2CW0D 2EYLA 4ZKCB 1TWAB 1KLGD 1E2WA 5JEAH 2XRQD 1CA6A 1HPCA 2K6AA 1B1ZA 1RODA 1WVLA 4K8JA 1WTVA 3OSOA 1O78A 5I9OA 1LO5D 2E2JB 4DAYA 3L7ZC 5IODA 2XNAC 5T1IA 1KNAA 3MA2B 3A8KE 3VR5A 2K5WA 3KF8A 4JK1C 2XIWA 2IWHA 1Q12A 2R3ZA 3SK4A 1SYFA 2AUKA 2EOTA 2HDLA 1DM0B 3W2DA 2Q8IB 1G2SA 2IX3A 2KA7A 2MGSA 5IGFA 2Q8RE 4RGOS 1A2UA 3FEWX 4F88A 3F2UA 3H6MA 2F0QA 2BDNA 1K8MA 3ZYYX 3PUVA 3OW7A 5ELCA 1LT6D 2EJMA 2V4DA 4L6TB 4K8IA 3NQTA 4C56C 3MAQA 1AZQA 2EY6A 4FXGC 2RDHA 3CQZB 4RKBA 2CW0C 3FPPA 1UNSA 4UDUC 5C4HA 3R8BA 1BF4A 4KY5A 4CKEA 3OIQA 2K5QA 1DOLA 4KN7C 1PMRA 2F03A 4MHEA 2X6GA 3J81L 3D6CA 2ZXOA 3TP7A 1HFGA 1ENCA 3K7AB 1JOOA 2KUMA 5FO8B 2MJ8A 1PXUA 4ZKBB 1LABA 3I91A 1ZXTA 1XWEA 3MTSA 3KUPA 4NW2A 5KYLA 3LNNA 2SEBD 4K6LA 4K14A 5KNBA 2R61A 2E2HB 1SYGA 1SFOB 2VB3X 1VMPA 4IFDI 2SNMA 1VMCA 2E75C 3IFTA 2NN6H 2EYOA 1BCPD 2F3WA 2O5IC 1SMYC 1SXTA 1BCPB 3D4DA 3CKIB 1CZWA 1EQVA 1PZID 4QB4A 4RHRA 1H9KA 3TDQA 2Y0SB 3ITPA 4R8NA 1I4XA 5C5MA 3NK9A 4CKCA 1T5XD 1A3VA 3HEJA 3DUZA 3R2TA 2AQ2B 4HMJA 3JAML 1BNZA 4IN3A 1CM9A 3RZDB 2D2CC 3A55A 1ET6A 2PCFB 1DOMA 2B2WC 1FNWA 4WORA 2AQ1B 1EFID 1ESRA 2RKSA 1RD9D 4CKBA 3Q0AA 3QB3A 3MXUA 4IUPA 4ZQ3A 2XWJB 2RVLA 2XWBB 1BXTA 3T13A 1Y1VB 2AWOA 1G91A 5J22A 1TS5A 2A69C 1F9SA 3A8JE 1EWCA 2A74C 1X3PA 4DU9A 2B8FA 1Y8PB 1F2MA 3GQBA 4PQXA 1EY5A 1KDBA 1G8ZD 3E5SA 5JOBA 2X69A 5I4DA 1TWHB 1QNKA 4G7ZC 1ENAA 1D5ZC 5CC4A 4RWSC 2WAQB 1KDCA 4OHJA 2EZVA 3NTKA 3MXGA 2EYFA 5KIXA 1U4LA 2MP1A 1U4RA 4HEDA 3NSWA 1B44D 3PO3B 5IGCA 3MXNA 3JAME 1JCKB 1DONA 1SNQA 1V8QA 1MSHA 2Z4IA 4G7OC 3OOCA 3L9AX 5IT9E 3TMEA 2WV6D 2JEBI 2BA0A 2EYMA 2SOBA 3ND8A 3OMCA 1I4HA 2B2YC 1UEAB 2BE5D 1XYIA 2LMCB 3WDNA 1S5BD 1HTPA 3K5NA 2H1EA 3WOEA 3S17B 1EY0A 3DM1A 5EPLA 2B63B 3S14B 3VYUA 4CBVA 1NSNS 3DWPA 1GXDC 2WIIB 1WCMB 5J1ZA 1GHKA 4E6IA 1QILA 2XSCA 1U4MA 5E3FA 2AUJD 2EYJA 5C0XJ 3N6RA 2HQEA 1OO9B 2EYPA 4J1MA 3K59A 4ME5A 3LWEA 5HURA 1AP0A 3A56A 1V1OA 3R2IA 1EEFD 1MGSA 1PTOB 4RA8A 4FO2A 4RCOA 2MPMA 1FNVA 1I6HB 3M4YA 1CHQD 3MFYA 4DK0A 4DXFA 5LHY1 3M4OB 1C4QA 5JPNC 1QG7A 4FXKC 4OL7A 1ONLA 4HMIA 5ELFA 3GTJB 4AYBB 2JSOA 2RQXA 1BBXC 4LJZC 2RDGA 2K1BA 4IALA 1CI3M 2PW5A 2F0PA 2F0EA 2FJ2A 2A5HA 2JA5B 4KHVA 3ERQA 1CA5A 1SE3A 3FDTA 3QWNA 1BUVT 1NR4A 5KRUA 5CV8A 2F0KA 2J4XA 5KNDA 4BBRB 3K5MA 4V190 4C3HG 4BA2I 2F0IA 5COYA 3PUXA 2E2DC 1RF2D 4OO1G 3M7GA 1HFNA 4O1NA 2DY8A 3FKIB 4ID6A 2L4NA 4RGNA 4DNRB 1Q1EA 3KLSA 3SK5A 3HZXA 2GA4B 2ICEC 5J39A 4LK1C 3PIP3 1LV9A 3W3AA 1JC7A 1A3UA 2E2IB 1PTOD 2LFNA 4IURA 1SJED 5CV6A 2IT1A 1SJHD 1G6ZA 2OT2A 3BDCA 3P20A 1HRJA 3P1HA 1XX8A 3TZUA 1PRTF 1JE4A 3OHXC 2NUCA 2NN6I 2ENBA 1H9SA 3CRLC 4PNYA 2JYOA 1SNPA 3M85A 1IW7C 4M1UB 5C4XB 1V1PB 2E76C 2JE6I 4A3IB 2R7ZB 3GTLB 1WTWA 1SNMA 1R4PB 5BN4A 1VDZA 2KEEA 2F0NA 5EJWA 3A7AB 3I90A 2C9OA 5JPMC 4KD4A 1D2BA 1Y8NB 2K03A 1GUOA 1B53A 4O42A 1XXGA 1MSGA 5EBCA 4CGYB 1SYCA 1NR2A 1WD1A 3OWEB 1Q8IA 2EE1A 2F0GA 1KNEA 3H3VC 2KQ3A 2ZXRA 4N9TA 4DGZA 1YNJC 3SE0A 3DWQA 2K28A 3S16B 3RZOB 4KY7A 4DA2A 5C4ZA 1M4VA 1SNOA 4OIKA 1Y8OB 5C0XH 3NTHA 1ET9A 4RCNA 5D65A 4PMCA 1RDPD 5CV9A 2ICIA 2WINB 5CBEE 3CRKC 4OGQC 3GTKB 1B9NA 2KCNA 2CVRA 2EJGC 1FNUA 3T4AC 1TWGB 2Z1CA 4DFAA 3NHHA 1C48A 1PLFA 1ML0D 3VR4A 1J8IA 4BA1I 4DAVA 2L5TA 2JA8B 4HR7B 1AFPA 4C1NK 2MHVA 1EU4A 1IHZA 2QEJC 4X3UA 2EDGA 5IGDA 1RHPA 4EQPA 1LT5D 1HA5A 1JR0D 3T16A 1C8CA 1K8OA 4A3FB 5ISRA 1RCVD 4RHSA 2R92B 1SBBB 4LAAA 4XTCS 2J0TD 4A3KB 3HOVB 1D5MC 3MEHA 4X3SA 3H09A 2F0MA 1F77A 3J7AF 3I3CA 4XDXA 1YNND 1WTQA 3ND9A 3S1NB 1W6JA 2AWNA 4FP5D 2QDBA 1PDQA 3T56B 1OXXK 4HCEA 3E0JA 4EGVA 1LLRD 5I2YA 3LX0A 2WACA 5CYUA 1Z6HA 1B9MA 4CHTB 2KECA 2IX0A 4OO1H 4DF7A 2NWGA 1K83B 3PO2B 2FHTA 2FMCA 3K5LA 3L3OC 4TQUS 1IKMA 3HKZB 2OXPA 5C3WA 2A68C 2B2VA 5ELEA 2ZT9C 1TVXA 1W6KA 4H13C 4CJ2C 3HGBA 4PMWA 2PO4A 4IUNA 2XVSA 5A2QL 2D5DA 5KYIA 2MUYA 2YYZA 1SNCA 4KN4C 3EQLC 5NUCA 4K6DA 5LL6S 3J7AV 5M3MB 4HN7A 3FMCA 3VYSA 2I07B 2WB1B 1ICWA 1E0BA 2K7VA 1TQOA 2L55A 3IFDA 4XXEA 2R93B 1BCPC 5EKKA 5C3EB 3QOJA 1PFBA 2D62A 1HA6A 3GV3A 4X3KA 3IAYA 1O80A 1TS4A 5E4XA 5M9OA 1MI2A 1DYQA 1S5CD 2B2UA 1UUPA 4BY7B 2F0JA 1CTMA 1SYEA 1AZPA 3WOFA 1LTGD 4DNTB 1EWHA 2LKVA 2NTSA 1X32A 2K33A 3BDOA 1SNDA 2G9HD 1LTBD 2M00A 3U9SA 1HCZA 3AU7A 1CQVA 2A68D 2IL8A 3I4MB 5CV5A 2PZUA 1JWMD 3G6JB 1PTOF 3BVMA 1WTOA 2JA7B 2XN9C 5A2QE 2J7ZA 2B2TC 4NP5A 2NBFA 3S2DB 1I4RA 4B9WA 3NWTA 1Z7TA 4HAEA 1SEBD 1EYCA 3J81E 4A93B 3D4RA 4K5WA 4IUVA 2IX1A 3RD4A 4XIGS 5CMDA 1D1KA 3SVMA 3C46A 5KNCA 4J6HA 4LMQD 1ESFA 3ONAB 3QIAA 1PFNA 4MN3A 1JORA 1STGA 5EKLA 3HP3A 1IYUA 4KV6A 4A3BB 1JB3A 3TP5A 1G2TA 3EFXD 2NVQB 1JOQA 5DEHA 4Q0FA 1RTNA 1HQRD 4ZUIA 1HUNA 1LTAD 1JWSD 5C5LA 4KI0A 1SE4A 5BN3A 4L8JA 2WKCA 3J80L 1Q90A 2SNSA 5C3XA 1FGBD 4WFN3 2BCOA 1TS3A 1O7ZA 2KEDA 3D31A 4F87A 3BVGA 4EQNA 4TSSA 1KLUD 3NPPA 1Q3LA 3AMUA 1GUNA 3VR2A 1ILQA 3S9WA 5KEEA 1EYDA 2HUGA 2Q8TA 3URYA 3PUYA 5F2DA 4FYDA 2R6GA 2K01A 2RSOA 3NWSA 2VNUD 5FO9B 3DMUA 2WKDA 2WP8J 1LT3D 1I6VC 2F4IA 5C44B 4PV1C 4EVOA 1D6EC 1F9QA 3I4NB 3OIPA 3BYYB 2JP1A 2HDMA 4N9PA 2NTTA 5D3DA 4ILWA 1O7LA 2KVMA 3DHQA 3Q23A 1EIGA 4C3IG 3EVQA 4UAIA 2B2VC 4P2CB 2O4XA 1S5DD 1LTRD 1EZ8A 4FF3A 3MWYW 3DXJC 4KKSA 1VF5C 2HCIA 2K05A 3SEBA 2BE5C 3MFGA 3SR1A 5M5YB 2L9HA 2F0TA 4ULLA 1U9RA 3C1EA 1HUMA 2A6EC 2F0UA 2IW3A 4IUQA 2FMMA 2L0CA 1WTRA 2DN8A 1D5XC 1GUSA 2A6HC 3KBXA 3DEOA 1I50B 4FNFA 5DM73 3PUZA 1TU2B 2F0HA 1EL0A 2M9VA 4HTHA 2SDFA 2VB2X 2ZXPA 5ELDA 1IKLA 3TN2A 4B9XA 1EU3A 1DZ1A 1TR5A 3GTPB 3H94A 2IPKD 5EQ0A 4FVMA 1BR9A 1EOTA 1I3QB 5G3LF 1F2LA 2LS01 1TS2A 3MHBA 4EQOA 2F0FA 4NKLA 3HOZB 2JXMB 1PRTC 3NE5B 4KK7A 2KCCA 3HRZC 4TKOB 3NQIA 5CR3A 3R3OA 4XQNA 3PIO3 1EY9A 4XQJA 1JWUD 4G57A 4Y7NB 1EIHA 5JEAG 1GOZA 1ZYRD 1SAPA 2F0VA 1AW7A 4ZK9B 4IFDJ 1MD2D 2X6LA 3X3MA 3S1QB 3LWUA 1BQQT 2PPBC 1A15A 2BDOA 4BS9A 4ODGA 1JQYD 1GUTA 4K2LA 2Z8LA 3D8GA 2L12A 2B2WA 1CHPD 3BVZA 1GHJA 1KTKA 3P75A 3HOXB 4OIJA 3GV6A 4WRDA 5C0XG 2DY7A 2B2YA 3MVVA 4DK1A 5TSSA 2D9UA 4XT3B 1XTCD 1VCIA 3D3RA 1OXVA 3MXPA 3KBGA 3D6WA 3VA7A 2BA1A 3GP7A 4QIWB 5AFWA 4KD3A 1G291 2AQ3B 1F2YA 2EY1A 4V0BA 5M5WB 3IKJA 4DN4M 4ABNA 1JICA 3QOLA 3IL8A 3SDZA 4GZYC 3BYTB 1IYVA 4C1NI 1OXSC 1ZEQX 5EKIA 4PMBA 4B08A 1LACA 4JBWA 3Q22A 1QE6A 3NBHA 4BBSB 1L0YB 2QKIC 1FD7D 1GUWA 2PMZB 1PRTD 3M7NA 1BDOA 1NUCA 4S3SA 1GUGA 4A3EB 1E2VA 1ILPA 1STAA 3RMHA 1J9OA 2B2TA 1RJTA 4QCLA 4ZAIA 1LTTD 2F0SA 3O13A 3V2TA 1D1IA 1I4QA 4TRDA 1YNNC 1JOKA 3DEPA 4H7BA 1WTXA 3J80E 1X3QA 2EVBA 3K6OA 1DOKA 4I65A 2F0DA 4FF1A 4ZYSA 4NDXA 3KLSX 5JAVA 2A69D 1EY8A 2OEOA 2A6ED 4A3DB 1S4ZA 1B2TA 5I2XA 2QF7A 3SHLA 5EBDA 3GO5A 4YIJA 3PV0A 2EPBA 1BOSA 5CV7A 3HS0C 5E1FA 4C3JB 3NP8A 1HHVA 2LY7A 4C3IB 1R4QB 1PYWD 5C6AA 1PTOC 1SYBA 3GTQB 3M3YB 4KJNA 1I4PA 1TWCB 2EYHA 2F3VA 4IUTA 4RAUC 1EZ6A 3S1RB 3R93A 3C3LA 1YNJD 4HSVA 3V96A 2L1BA 5DNFA 2VXWA 1UAPA 1MBYA 4KMUC 1STBA 1HQMC 4QUFA 4XT1B 1LT4D 2H4OA 3CHBD 2ID0A 2KOLA 2O5JC 1VF7A 1TY0A 2EJFC 3I72A 2KHSA 1H9MA 3BG3A 4F8MA 5EPJA 3SXHA 5D3IB 3A8IE 4A3GB 5CORA 1U4PA 5I6WA 1QNUA 4RKLA 3MZ5A 2K5DA 2PZWA 1AEXA 2N55A 1WTPA 4RGMA 4RH6A 3S15B 1ENFA 2NVYB 2YU9B 1A6XA 5HGTA 1DXMA 1DCZA 4A3MB 3FVQA 3OPOA 1H9RA 1QCBD 2EY2A 1R9TB 3I70A 4J8QA 3K5OA 4C3HB 3GD7A 3A7LA 2RA4A 4BY1B 5IGEA 4C2MB 1V43A 3X3NA 5JEAJ 1IL8A 1H9JA 1WD0A 4K5XA 2TMPA 5I9PA 1PZKD 5JJZA 3QO2A 1F2ZA 4IFDH 1EEID 1KAAA 4C3JG 1S5FD 3NXWA 4KY6A 1PRTB 2VUMB 5FLXL 3A54A 4Z9CB 3U9OA 5FLXE 4G7HC 1EY6A 1ZKOA 3AB9A 1TT2A 2JA6B 5DM63 4ZUJA 5IT9L 3TP6A 1SDFA 5CGKA 4K5VA 2IJ0A 2PQEA 2Z4HA 4QMGA 4ZRZA 1ZYRC 5FK9C 1PZJD 4R8IA 5FKAC 3N52A 1CFMA 3HG9A 1EYAA 3HOYB 5IOCA 4IFDG 1STYA 3H0GB 2PZTA 4DAPA 2QCPX 1TKWB 1CZGA 4R9WA 2JEAI 3NUCA 3OMGA 5K5PA 3QG1A 3Q24A 5IIFA 5D14A 1QWYA 1HXYD 1PTOH 5FO7B 1V1PA 4KKUA 1BCPF 3Q6SA 2NB0A 5DAUA 3J7YW 2RDFA 4HSPA 3QJYA 2OF1A 1T5EA 1SSOA 4H0LC 3E6ZX 5M5XB 3I4LA 4U673 3VA5A 2EY5A 1B3AA 2KJXA 3K57A 3OWFA 1CT1D 4DXGA 4XQQA 2EXZA 5G3LD 3KLRA 5E4WC 3HOWB 3VYTA 1DJRD 2A6HD 1O7YA 3MC0B 3SK6A 1Y69U 1QB5D 2BOSA 5CBAE 4WJWA 4FF4A 1II3A 5T1GA 4RGTA 5M3FB 4QF4A 2HCCA 4OO1I 1B50A 4RFBA 2O2LD 4MIUA 5ELBA 4KJOA 2G9DA 1EQTA 4KKTA 1F9RA 1FYCA 1OXTA 5A35A 3BDLA 2NVXB 3TBIB 2PYKA 4CJ1B 1EY7A 2M2LA 2PW7A 3VYRA 4KHZA 1A2TA 2N88A 3UI2A 3PUWA 2L11A 4G4KA 3TSSA 2C5CA 3GTMB 4FXDA 4ZLTF 1TWFB 2A73B 3D4WA 4XYQA 1H9SB 3FPUB 5C4JB 1L0XB 5C0XI 2NZ1D 1F9PA 1QOHA 1FR3A 4M8AA 2F0LA 3V05A 3S2HB 1QJOA 3H91A 5LL6X 4IUUA 1GJXA 2F0OA 3DWAA 4X3TA 4FF2A 5EGTA 2FINB 1A3TA 2E74C 3EA6A 1B4OA 3FRPB 2CQAA 1M8AA 1TY2A 3BZDB 1KABA 3VR3A 1CQFA 3GTGB 1I4GA 2NYZD 3VR6A 3T51B 1CK1A 2TSSA 4IQZA 3GTOB 1BO0A 3SK8A 1TIID 4U68A 3HOUB 4L63B 4HCSA 4K2KA 3BS1A 1LTID 2I46A 5JVH3 1NAPA 1STEA 2F1MA 2PNRC 3EROA 3I8ZA 3C2PA 3NTIA 3TP8A 3KK7A 2NN6G 2RSNA 4F7XA 5BN5A 3RLFA 5JVG3 5FOBB 1NCVA 3K0YA 1LTSD 2K32A 1RTOA 1STHA 2DNEA 2NVTB 1Y1WB 1SYDA 2B8GA 4BWGB 1Q1BA 1EY4A 2B2UC 1RKNA 3C1FA 5I6YA 1S5ED 1KDAA 1STNA 4XYOA 4CJ0B 5KGUA 2K04A 3T53B 1SMYD 1SE2A 5CV4A 5K36G 3G7LA 1DD2A 3PMFA 1OXUA 2B39A 4QUCA 2DNCA 5IGGA 4NMZA 1HTLD 2QILA 4H44C 3S1MB 3P7JA 3I73A 2XRSD 4KTAA 4IZ8A 3TZDA 4Q5VA 3NBIA 2CHBD 5IGBA 1AN8A 4A3JB 2RBMA 2F0WA 3CU7A 1IW7D 3K58A 3EJIA 4I7ZC 1Z47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PMR A;  1B9M A;  2AWO A;  1YNJ C;  2A69 C;  2F1M A;  3U9S A;  3LWU A;  1E2Z A;  3SE0 A;  1GHK A;  1HCZ A;  2PNR C;  2PPB C;  3A8I E;  2A6E C;  1Q90 A;  2BDO A;  5K36 H;  2AUJ D;  2A68 D;  3A8J E;  4OO1 H;  4KKT A;  4DNR B;  1YNN C;  3N6R A;  1Q1E A;  2B8F A;  1FYC A;  1OXT A;  5A35 A;  1Y8P B;  1ZYR C;  2DN8 A;  3GQB A;  1E2W A;  5JEA H;  2EVB A;  4LK1 C;  2A6H C;  1GUS A;  1HPC A;  1Y8O B;  1CFM A;  1LAB A;  4TQU S;  1GUT A;  3D31 A;  3W3A A;  5C0X H;  4RCN A;  2NN6 G;  1O78 A;  5BN5 A;  1A6X A;  2IT1 A;  4KHZ A;  3RLF A;  3L7Z C;  3PUZ A;  1GUN A;  1TU2 B;  3VR2 A;  3LNN A;  2A68 C;  4G7Z C;  1GHJ A;  3P20 A;  4IFD G;  3M4Y A;  3A8K E;  3VR5 A;  1DXM A;  1DCZ A;  3CRK C;  3PUW A;  4JK1 C;  5KNB A;  4OGQ C;  2A69 D;  3PUY A;  2ZT9 C;  1B9N A;  1Q12 A;  3MFY A;  3OPO A;  1H9R A;  3HGB A;  4H13 C;  1Z7T A;  3TZU A;  2EJG C;  2R6G A;  2A6E D;  2AUK A;  2K32 A;  1TKW B;  2NN6 I;  2D5D A;  2JEA I;  5C0X G;  1H9S A;  2E75 C;  3CRL C;  2DNE A;  3IFT A;  2YYZ A;  2QF7 A;  3QG1 A;  2NN6 H;  4DK1 A;  1H9S B;  1ONL A;  2B8G A;  4I7Z C;  4KN4 C;  2Q8I B;  1Q1B A;  2O5I C;  3EQL C;  1SMY C;  3M85 A;  1IW7 C;  3GD7 A;  3VR4 A;  3H94 A;  1VCI A;  3A7L A;  1V8Q A;  3D4R A;  3PV0 A;  4BA1 I;  2KA7 A;  3FMC A;  2L5T A;  4KKU A;  1FR3 A;  1OXV A;  4KN7 C;  4G7O C;  4HR7 B;  4LJZ C;  1I6V C;  1QJO A;  2BA1 A;  2E76 C;  3T53 B;  3OOC A;  3VA7 A;  2JE6 I;  1H9K A;  1GJX A;  4PV1 C;  1G29 1;  1V43 A;  1CI3 M;  2EDG A;  2K7V A;  4XIG S;  5K36 G;  1K8M A;  1H9J A;  3QJY A;  1DD2 A;  5BN4 A;  1OXU A;  1VDZ A;  3OW7 A;  3PUV A;  2JEB I;  3QIA A;  5KNC A;  2E74 C;  3IKJ A;  1K8O A;  1T5E A;  2DNC A;  2BA0 A;  2EJM A;  3ND8 A;  2JXM B;  4DK0 A;  1O7L A;  4H0L C;  2D62 A;  3I4L A;  1IYU A;  3A7A B;  3NE5 B;  3SDZ A;  2V4D A;  4GZY C;  4H44 C;  2BE5 D;  1IYV A;  3VR3 A;  3I73 A;  4XTC S;  2LMC B;  3WDN A;  1HTP A;  4IFD H;  1OXS C;  2KCC A;  3VR6 A;  1LAC A;  4JBW A;  2D2C C;  5KND A;  3T51 B;  1Y8N B;  2PCF B;  4KMU C;  4TKO B;  3KLR A;  1GUO A;  4BA2 I;  1HQM C;  1CTM A;  2CW0 C;  3FPP A;  4IQZ A;  2A6H D;  3ND9 A;  4DNT B;  5JEA G;  3PUX A;  1EWH A;  1BDO A;  3DXJ C;  3M7N A;  4KKS A;  4G7H C;  1VF5 C;  3T56 B;  1ZKO A;  4KI0 A;  1Y69 U;  2BE5 C;  1OXX K;  3AB9 A;  1VF7 A;  1GUG A;  3MXU A;  1IW7 D;  2O5J C;  5BN3 A;  4L8J A;  4OO1 G;  2K33 A;  3BDO A;  2EJF C;  3I72 A;  1H9M A;  1E2V A;  1Z6H A;  3BG3 A; 
#chains in the Genus database with same CATH topology
 5EPK A;  1YBY A;  2FFK B;  1PFM A;  1E2Z A;  4JBM A;  1EYG A;  1VQC A;  4IOA A;  3RUZ A;  5K36 H;  1PFS A;  2Q2I A;  2CW0 D;  2EYL A;  4ZKC B;  1TWA B;  1KLG D;  1E2W A;  5JEA H;  2XRQ D;  2UXC L;  1CA6 A;  1HPC A;  1TWF H;  2K6A A;  1B1Z A;  1ROD A;  1WVL A;  4K8J A;  1XMO Q;  1WTV A;  3OSO A;  1O78 A;  5I9O A;  1LO5 D;  2E2J B;  4DAY A;  2CQO A;  3L7Z C;  4UP7 A;  5IYC H;  5IOD A;  2XNA C;  5IWA L;  5T1I A;  1KNA A;  3MA2 B;  3A8K E;  3VR5 A;  2K5W A;  3KF8 A;  4B3R Q;  4JK1 C;  2XIW A;  2IWH A;  3HOX G;  1Q12 A;  3KJP A;  4A4I A;  5FLX c;  1HNX Q;  1VQE A;  2R3Z A;  3SK4 A;  1VQ9 A;  4BY1 H;  1SYF A;  1ASZ A;  4GKJ Q;  2AUK A;  1K0R A;  2DUD A;  2EOT A;  2HDL A;  1DM0 B;  5C44 G;  4LW1 A;  3W2D A;  2Q8I B;  1G2S A;  1SRO A;  2IX3 A;  1I50 H;  3I4N G;  2KA7 A;  2MGS A;  5IGF A;  2Q8R E;  4RGO S;  2K14 A;  1A2U A;  1N8R C;  4LUV A;  4ZCK A;  3FEW X;  4F88 A;  1HJP A;  2B29 A;  3F2U A;  4JBK A;  3H6M A;  2F0Q A;  4X65 L;  2BDN A;  1K8M A;  3ZYY X;  4YWK A;  1N33 L;  1IYJ B;  3PUV A;  3OW7 A;  5ELC A;  4QJF A;  3K7A H;  4JPB W;  1LT6 D;  2EJM A;  4HJA A;  3PIP A;  3HKZ G;  2I5M X;  2V4D A;  3J7Z C;  4DUY Q;  4L6T B;  4K8I A;  3NQT A;  4J15 A;  4C56 C;  2Q2T A;  3MAQ A;  1AZQ A;  4FDB A;  2GVA A;  3S17 H;  2Z6K C;  2EY6 A;  1VQ6 A;  4FXG C;  2RDH A;  3CCE A;  3CQZ B;  4RKB A;  2CW0 C;  1Q8K A;  3FPP A;  1UNS A;  3J80 i;  5GAD C;  4UDU C;  5C4H A;  2QA4 A;  3R8B A;  3NEM A;  1BF4 A;  1O7I A;  4NPS A;  1XPU A;  4KY5 A;  4CKE A;  3OIQ A;  2K5Q A;  4OWT B;  1HNW Q;  2MO0 A;  1DOL A;  3CCR A;  2ZM6 L;  4KN7 C;  3J80 c;  1PMR A;  2K75 A;  1U0L A;  2X6G A;  4MHE A;  3J81 L;  3D6C A;  2ZXO A;  2F03 A;  4DR7 L;  4CDF C;  3HOW G;  4A3K H;  3TP7 A;  5IY0 A;  4A3C H;  1HFG A;  1JJ2 A;  1ENC A;  3K7A B;  4JOI A;  1JOO A;  2KUM A;  5FO8 B;  2MJ8 A;  1PXU A;  3M4P A;  4ZKB B;  1LAB A;  3I91 A;  1ZXT A;  1XWE A;  3MTS A;  2R92 G;  3CPW A;  1CKN B;  1X3E A;  3KUP A;  4NW2 A;  5KYL A;  3LNN A;  2SEB D;  4K6L A;  1VQM A;  1Q82 C;  4K14 A;  5KNB A;  2R61 A;  2E2H B;  1SYG A;  1HR0 W;  1SFO B;  4ME3 A;  2VB3 X;  1CKO A;  1VMP A;  4IFD I;  2SNM A;  2E2I H;  1VMC A;  3CCU A;  3T1H L;  2E75 C;  3IFT A;  2JA7 H;  2NN6 H;  2EYO A;  1BCP D;  1CKN A;  2F3W A;  2O5I C;  1SMY C;  1SXT A;  1KXL A;  3PQI A;  1BCP B;  3U4V A;  3D4D A;  4B3S Q;  3CKI B;  1CZW A;  1EQV A;  4GKK L;  1PZI D;  4QB4 A;  5HGQ A;  4RHR A;  4PZ8 A;  1H9K A;  3I7F A;  3U4Z A;  4LF7 Q;  3TEH B;  2GN5 A;  4HIM A;  3KF8 B;  4JC0 A;  4WJ3 M;  3STB C;  3TDQ A;  2Y0S B;  2OWO A;  2VUM G;  1UE6 A;  3ITP A;  4R8N A;  1I4X A;  5C5M A;  4DR5 Q;  3NK9 A;  4CKC A;  1T5X D;  1A3V A;  4R4Q A;  3HEJ A;  1K73 C;  1IBK Q;  3DUZ A;  3R2T A;  2AQ2 B;  4HMJ A;  3JAM L;  1BNZ A;  1PH6 A;  4IN3 A;  1CM9 A;  3RZD B;  1G6P A;  2D2C C;  3A55 A;  1ET6 A;  1K28 A;  2PCF B;  3S14 H;  1DOM A;  2HIX A;  2B2W C;  1FNW A;  4H02 A;  4WOR A;  2AQ1 B;  5GQO A;  2JQO A;  1HR0 L;  4JI2 Q;  2JA7 G;  1EFI D;  2CCZ A;  3HOZ H;  1ESR A;  2RKS A;  4DK3 C;  1RD9 D;  4CKB A;  3Q0A A;  3QB3 A;  3MXU A;  1K3R A;  4IUP A;  1KL9 A;  4ZQ3 A;  3AYH B;  2XWJ B;  4DUZ L;  2RVL A;  2XWB B;  1BXT A;  3T13 A;  1Y1V B;  2AWO A;  3PO3 G;  1G91 A;  4C2M H;  5J22 A;  1TS5 A;  2A69 C;  3PCO B;  4LFB L;  1F9S A;  3A8J E;  1VQ7 A;  4A3E G;  1EWC A;  2A74 C;  1X3P A;  4DU9 A;  2B8F A;  2KBN A;  4A3B H;  1Y8P B;  1F2M A;  5C4X H;  3GQB A;  4PQX A;  1EY5 A;  1S40 A;  1KDB A;  1G8Z D;  1HZB A;  4A3M G;  3E5S A;  5LMN Q;  5JOB A;  1BBU A;  2X69 A;  5I4D A;  1VQ8 A;  1V1Q A;  1UE1 A;  1TWH B;  3F2C A;  4OWX B;  2JN4 A;  1QNK A;  4DV1 L;  3CD6 A;  4G7Z C;  1ENA A;  1D5Z C;  5CC4 A;  4RWS C;  1K3B C;  2WAQ B;  2NVY H;  1YJN A;  1KDC A;  3KF6 A;  4OHJ A;  2EZV A;  3NTK A;  3MXG A;  2EYF A;  3BJU A;  5KIX A;  2OQ0 A;  5IYD G;  4DV4 Q;  2K50 A;  1U4L A;  2MP1 A;  1U4R A;  4HED A;  3S24 A;  3NSW A;  3U58 A;  1C9O A;  3CF5 A;  1B44 D;  3PO3 B;  5IGC A;  3MXN A;  3JAM E;  4HJ8 A;  1IBL Q;  2WB1 E;  1JCK B;  1Y14 B;  1DON A;  1SNQ A;  2Z0S A;  3CCS A;  1V8Q A;  1MHW C;  1MSH A;  4OX9 L;  2Z4I A;  4DR2 Q;  4G7O C;  1X3F A;  3Q8D A;  3OOC A;  2UU9 Q;  1FGU A;  3NEL A;  3L9A X;  4AQY Q;  5IT9 E;  4O2D A;  3TME A;  4RMF A;  4A75 A;  2WV6 D;  4JVZ A;  4QIW E;  2JEB I;  2LSS A;  2MQH A;  5J3B A;  2BA0 A;  4K0K L;  3TRZ A;  2EYM A;  2SOB A;  3ND8 A;  1LUZ A;  3OMC A;  4B3T Q;  1I4H A;  2B2Y C;  2LXJ A;  2KEN A;  1UEA B;  2BE5 D;  1Y1V H;  1XYI A;  2LMC B;  3WDN A;  3OTO Q;  1S5B D;  1HTP A;  3K5N A;  2H1E A;  3WOE A;  2VQF Q;  3GTO H;  3LGJ A;  3S17 B;  4A3G G;  1EY0 A;  3DM1 A;  5EPL A;  4JI5 Q;  2Z9H A;  4LUZ A;  4YY3 L;  1U5K A;  2HHH Q;  2B63 B;  1HNX L;  4GKJ L;  2N8N A;  1X65 A;  3S14 B;  3VYU A;  4CBV A;  1NSN S;  4DR1 Q;  3DWP A;  1MJE A;  1GXD C;  4N8X 1;  3STB D;  3CCM A;  2WII B;  1WCM B;  4K0K Q;  4OEL B;  5J1Z A;  3BZC A;  1GHK A;  4E6I A;  1QIL A;  2XSC A;  1U4M A;  2HIV A;  2AUJ D;  5E3F A;  2EYJ A;  5C0X J;  3N6R A;  4B3M Q;  2HQE A;  1OO9 B;  2EYP A;  4J1M A;  3K59 A;  4ME5 A;  3LWE A;  5HUR A;  5GRO A;  3PO3 H;  1AP0 A;  5ELO A;  3A56 A;  1V1O A;  4A3K G;  3R2I A;  3FKI G;  3TRE A;  1EEF D;  1MGS A;  4A3D H;  1PTO B;  4RA8 A;  4FO2 A;  4RCO A;  2B63 G;  4LFC L;  1I5F A;  1FNV A;  2MPM A;  1I6H B;  3M4Y A;  1VQO A;  1CHQ D;  2RCF A;  3MFY A;  4DK0 A;  3KYH C;  4DXF A;  5LHY 1;  3ICE A;  3M4O B;  1QZG A;  1C4Q A;  5JPN C;  1QG7 A;  4FXK C;  4OL7 A;  1ONL A;  4HMI A;  1VQ4 A;  5ELF A;  4DK6 C;  3W1B A;  4DUY L;  3GTJ B;  3E9H A;  4AYB B;  2JSO A;  2RQX A;  1IBM Q;  4GNX B;  1BBX C;  4LJZ C;  3UE1 A;  4L5T A;  2RDG A;  2Y0S E;  4IOC A;  4A3M H;  2K1B A;  4IAL A;  1CI3 M;  2PW5 A;  1VQA A;  1B3Q A;  4UY8 C;  2F0P A;  2F0E A;  2FJ2 A;  2A5H A;  2HHH L;  2JA5 B;  4KHV A;  3CXC A;  4OX9 Q;  3ERQ A;  1CA5 A;  1K83 H;  4BBS H;  1SE3 A;  4DV2 Q;  3FDT A;  3QWN A;  1BUV T;  1NR4 A;  4A3E H;  5KRU A;  5CV8 A;  2F0K A;  2J4X A;  1HR0 Q;  5KND A;  4BBR B;  3K5M A;  1HNZ L;  4DV7 Q;  3T1H Q;  4V19 0;  4R4O A;  4C3H G;  4BA2 I;  3I2Z A;  2F0I A;  1A62 A;  5COY A;  3PUX A;  3KLW A;  2E2D C;  1RF2 D;  2F4V L;  1V9P A;  2CH4 W;  4DR2 L;  4OO1 G;  5IYB G;  3M7G A;  1TXY A;  4A3F H;  1HFN A;  4O1N A;  5IP7 H;  2MO1 A;  2DY8 A;  4LNQ A;  3FKI B;  5IT9 c;  4ID6 A;  3CP0 A;  2L4N A;  4RGN A;  4DNR B;  1PH7 A;  1Q1E A;  3KLS A;  3SK5 A;  3HZX A;  2GA4 B;  2ICE C;  5J39 A;  4LK1 C;  4LF9 Q;  3ER0 A;  3PIP 3;  3I4O A;  1TWC H;  1LV9 A;  3W3A A;  1JC7 A;  1A3U A;  2E2I B;  1PTO D;  2LFN A;  4IUR A;  4GKK Q;  1SJE D;  5CV6 A;  2IT1 A;  1SJH D;  5FJ8 H;  1QZH A;  4DV5 Q;  2Q2H A;  1G6Z A;  2OT2 A;  3BDC A;  3P20 A;  1HRJ A;  3P1H A;  1XX8 A;  2JJQ A;  1MJC A;  3TZU A;  1PRT F;  1JE4 A;  3OHX C;  2NUC A;  2NN6 I;  2ENB A;  2FXQ A;  2JA8 G;  1H9S A;  3CRL C;  4LF8 L;  4PNY A;  1EIF A;  3FP9 A;  2G5D A;  1B8A A;  4DR6 Q;  2JYO A;  1SNP A;  3M85 A;  1SLJ A;  2YTV A;  1IW7 C;  1N9W A;  1QUQ B;  1IBM L;  4M1U B;  4YWL A;  4IPG A;  2LXK A;  5C4X B;  2CFM A;  1UE5 A;  1V1P B;  2E76 C;  2JE6 I;  4A3I B;  3S1Q H;  2R7Z B;  3GTL B;  1DGS A;  1WTW A;  2C35 B;  1KIX A;  1SNM A;  3I4M G;  1R4P B;  5BN4 A;  4DPG A;  1VDZ A;  4CDD C;  4A76 A;  2KEE A;  2F0N A;  1HZ9 A;  4R4I A;  5EJW A;  1ASY A;  3A7A B;  3I90 A;  4LFC Q;  2C9O A;  5JPM C;  4KD4 A;  1D2B A;  1HZC A;  3CC7 A;  1YNX A;  4YY3 Q;  1Y8N B;  2K03 A;  1GUO A;  1B53 A;  4O42 A;  4GN5 A;  1XXG A;  1MSG A;  5EBC A;  4CGY B;  4A3J H;  1SYC A;  3W1G A;  1NR2 A;  1WD1 A;  2CH4 A;  1ICF B;  2QGQ A;  3OWE B;  3OTO L;  1Q8I A;  2EE1 A;  2F0G A;  4JI4 L;  1KNE A;  4JI6 L;  3H3V C;  3CW2 C;  2KQ3 A;  2ZXR A;  4UP9 A;  5BR8 Q;  4N9T A;  5DLQ E;  1FL0 A;  1VQF A;  4LF8 Q;  4DGZ A;  1YNJ C;  3SE0 A;  3DWQ A;  2K28 A;  3S16 B;  2UUA L;  3RZO B;  3CC4 A;  4KY7 A;  4DA2 A;  5C4Z A;  1M4V A;  1SNO A;  4OIK A;  1S3O A;  1Y8O B;  5C0X H;  3NTH A;  3RLN A;  1KC8 C;  1ET9 A;  4RCN A;  5D65 A;  4JYA L;  4PMC A;  3AEV A;  1RDP D;  1VQI A;  5CV9 A;  2ICI A;  2WIN B;  5CBE E;  3CRK C;  4OGQ C;  3GTK B;  1B9N A;  4DV0 L;  2KCN A;  2CVR A;  2JA5 G;  2EJG C;  4B3M L;  1FNU A;  3T4A C;  1TWG B;  4BY1 G;  2Z1C A;  4DFA A;  3NHH A;  1YI2 A;  1LTL A;  1C48 A;  1PLF A;  1ML0 D;  3VR4 A;  1XMO L;  1J8I A;  4BA1 I;  4DAV A;  4JI4 Q;  2L5T A;  2CWP A;  2JA8 B;  5M3F G;  4HR7 B;  1AFP A;  4C1N K;  3HOX H;  2MHV A;  1EU4 A;  1IHZ A;  2QEJ C;  4X3U A;  2EDG A;  5IGD A;  1RHP A;  4EQP A;  4LWC A;  1LT5 D;  1HA5 A;  3E9I A;  1JR0 D;  2QW7 A;  3T16 A;  1C8C A;  1K8O A;  2F52 A;  4A3F B;  3CAM A;  2AMC B;  3CME A;  5ISR A;  1RCV D;  4RHS A;  5AJ3 L;  4GOP A;  1Q46 A;  2R92 B;  3DLL A;  1SBB B;  4NB3 A;  4LAA A;  4XTC S;  2J0T D;  4A3K B;  1MKH A;  1VQN A;  3HOV B;  1D5M C;  3MEH A;  4X3S A;  3H09 A;  2MNA A;  2F0M A;  1VQG A;  1F77 A;  3J7A F;  3I3C A;  4XDX A;  2KHJ A;  1YNN D;  1WTQ A;  1L1O C;  3ND9 A;  3S1N B;  4KHP Q;  1W6J A;  2AWN A;  4FP5 D;  2QDB A;  1PDQ A;  2UUB L;  3T56 B;  1OXX K;  4HCE A;  3E0J A;  4EGV A;  1LLR D;  5I2Y A;  5BR8 L;  3I4N H;  3LX0 A;  1PV4 A;  2WAC A;  4R4T A;  5CYU A;  1Z6H A;  2XGT A;  1B9M A;  1IZ6 A;  3EIV A;  4CHT B;  2KEC A;  4JI7 L;  3H3V I;  4A3F G;  3FHW A;  2IX0 A;  4OO1 H;  1N36 L;  4DF7 A;  2NWG A;  1K83 B;  4AH6 A;  2FHT A;  3PO2 B;  2FMC A;  3K5L A;  3L3O C;  4TQU S;  1IKM A;  4C3I H;  1Q7Y C;  3HKZ B;  4DAY B;  5E7N A;  2OXP A;  5C3W A;  2H5X A;  4LF4 Q;  2A68 C;  2B2V A;  3E0E A;  1CSP A;  5ELE A;  2ZT9 C;  1XNQ Q;  1TVX A;  1W6K A;  4H13 C;  4CJ2 C;  3HGB A;  4PMW A;  5JJI A;  1I3Q H;  1IXR A;  2PO4 A;  4IUN A;  2XVS A;  5A2Q L;  2D5D A;  5KYI A;  5LMU L;  1I6H H;  1KAW A;  2MUY A;  4A3L G;  2YYZ A;  1SNC A;  4KN4 C;  3EQL C;  5NUC A;  4K6D A;  3RLO A;  5LL6 S;  3J7A V;  5M3M B;  1VQ5 A;  4HN7 A;  3FMC A;  3WWV A;  3M4O H;  3VYS A;  2I07 B;  1XJV A;  2WB1 B;  1OTC A;  1ICW A;  1E0B A;  1VQJ A;  2K7V A;  4LFA Q;  1TQO A;  1J5E Q;  1YIT A;  2L55 A;  3IFD A;  4XXE A;  2R93 B;  1BCP C;  2WAQ G;  5EKK A;  5C3E B;  4HJ7 A;  1PH9 A;  4MNO A;  3QOJ A;  1PFB A;  2D62 A;  1UE7 A;  4DV2 L;  4DV5 L;  3CMA A;  4JI3 Q;  1HA6 A;  3GV3 A;  2JK8 A;  2IHE A;  4X3K A;  2VZA A;  4DKA C;  1O80 A;  3CCV A;  3IAY A;  1TS4 A;  4AYB E;  5E4X A;  5M9O A;  1MI2 A;  1DYQ A;  4LF9 L;  1E24 A;  1S5C D;  4QQB X;  1RL2 A;  2B2U A;  1UUP A;  4BY7 B;  2F0J A;  5L37 A;  3QR8 A;  1CTM A;  1SYE A;  1AZP A;  4JI8 L;  3WOF A;  1LTG D;  1EOV A;  4DNT B;  1EWH A;  2UUC Q;  2LKV A;  2NTS A;  1SN8 A;  1X32 A;  2K33 A;  1EFW A;  3BDO A;  1SND A;  2G9H D;  1LTB D;  2M00 A;  2UUB Q;  1CUK A;  3U9S A;  4BXX H;  1HCZ A;  4HID A;  3AU7 A;  1CQV A;  2A68 D;  3AQQ A;  1NE3 A;  2IL8 A;  4DV3 L;  3I4M B;  1XTD A;  5CV5 A;  1XNR L;  2PZU A;  3UE0 A;  1JWM D;  3G6J B;  1PTO F;  2R7Z G;  3BVM A;  1WTO A;  2JA7 B;  4GLX A;  3GTL H;  3GTP H;  2XN9 C;  2N3S A;  5A2Q E;  2J7Z A;  3HOY G;  3H3V H;  1E22 A;  2NVT H;  2B2T C;  4NP5 A;  2NBF A;  3S2D B;  1R9T H;  1PYB A;  1I4R A;  4NXN Q;  4B9W A;  4ALP A;  3NWT A;  2ZTD A;  1Z7T A;  1EIY B;  3J81 i;  4HAE A;  1SEB D;  4X64 Q;  4B3R L;  1NTG A;  1EYC A;  1S72 A;  4X65 Q;  3J81 E;  2A8V A;  4A93 B;  3TS0 A;  1VQL A;  4EX5 A;  3D4R A;  3UDG A;  4K5W A;  1X56 A;  4IUV A;  2IX1 A;  3RD4 A;  4XIG S;  5CMD A;  1D1K A;  4A3G H;  3G71 A;  3SVM A;  3C46 A;  3BZK A;  5KNC A;  4J6H A;  4LMQ D;  1ESF A;  3ONA B;  3QIA A;  4JI1 L;  4BY7 G;  1PFN A;  4MN3 A;  3W5O A;  1JOR A;  4DV6 L;  1STG A;  1PA6 A;  4DR4 L;  2K5V A;  5EKL A;  3HP3 A;  4P75 A;  1IYU A;  2VW9 A;  4JI3 L;  3HOU H;  4KV6 A;  2IHF A;  3HOW H;  4A3B B;  1JB3 A;  3TP5 A;  1G2T A;  3EFX D;  1WCM G;  2NVQ B;  1JOQ A;  4A93 G;  4KLK A;  4MZ9 A;  5FLM G;  3CCQ A;  4KHP L;  1EQQ A;  3PF4 A;  5DEH A;  4Q0F A;  2VUM H;  1RTN A;  3M4Q A;  1HQR D;  4ZUI A;  5JJK A;  1HUN A;  1LTA D;  2UU9 L;  1JWS D;  5C4X G;  5C5L A;  1PH1 A;  4KI0 A;  4NXN L;  2WFW A;  3HOU G;  1SE4 A;  2VQE Q;  5BN3 A;  4L8J A;  1IBL L;  2WKC A;  3J81 j;  4DR4 Q;  5AJ3 Q;  4MTN A;  2MFI A;  3J80 L;  1Q90 A;  2SNS A;  5C3X A;  1B70 B;  4MTK A;  4JI5 L;  1FGB D;  3HKZ E;  4WFN 3;  5C3E H;  3S2H H;  4HJ9 A;  1Q81 C;  2JA5 H;  1M1K C;  1KD1 C;  2BCO A;  1TS3 A;  4X62 L;  1O7Z A;  2KED A;  3PGZ A;  3D31 A;  4F87 A;  3BVG A;  1K8A C;  4EQN A;  4TSS A;  1KLU D;  3NPP A;  1Q3L A;  1B7Y B;  1GUN A;  3AMU A;  3VR2 A;  1JJC B;  2AHO B;  1ILQ A;  2Z6K A;  3S9W A;  4YCV A;  5KEE A;  1EYD A;  2HUG A;  2Q8T A;  2JA9 A;  3PUY A;  3URY A;  1WI5 A;  4LF6 L;  5F2D A;  4FYD A;  2R6G A;  2K01 A;  2RSO A;  4A3D G;  3NWS A;  2VNU D;  2PNH A;  5FO9 B;  2V1C C;  3DMU A;  3KDF A;  4GN4 B;  1TWA H;  2WKD A;  1KRT A;  2WP8 J;  1LT3 D;  2NVX H;  1YZ6 A;  1I6V C;  2F4I A;  5C44 B;  4A3I G;  4PV1 C;  4DR3 Q;  1YHQ A;  4GLA C;  1VQB A;  1AE2 A;  4EVO A;  4GNX C;  1D6E C;  1F9Q A;  3I4N B;  3OIP A;  5GAG C;  1Y1V G;  3BYY B;  2JP1 A;  3KDF B;  2HDM A;  4N9P A;  5IYB H;  2NTT A;  5D3D A;  1EQR A;  2B63 H;  4ILW A;  4PZ6 A;  1O7L A;  2KVM A;  3DHQ A;  3Q23 A;  1EIG A;  3HOV H;  4OON A;  4C3I G;  3EVQ A;  2UXC Q;  1P16 A;  1K9M C;  4UAI A;  2RHS B;  4JI8 Q;  4DR5 L;  2B2V C;  3JAM c;  4P2C B;  1WJJ A;  2O4X A;  2HQL A;  2R92 H;  2K5H A;  1LTR D;  1S5D D;  1EZ8 A;  4LFB Q;  4FF3 A;  4LUO A;  3MWY W;  1QVC A;  3DXJ C;  4LF7 L;  4KKS A;  1VF5 C;  2HCI A;  2K05 A;  1QUQ A;  2BE5 C;  3SEB A;  2K52 A;  4POG A;  4BY7 H;  3MFG A;  3SR1 A;  4B3S L;  5M5Y B;  2L9H A;  2F0T A;  4ULL A;  1U9R A;  1HZA A;  4UPA A;  3C1E A;  1HUM A;  2A6E C;  1L0W A;  2F0U A;  2IW3 A;  1JT8 A;  4IUQ A;  3M3Y H;  2FMM A;  3K80 C;  2L0C A;  1WTR A;  2DN8 A;  1D5X C;  2CKZ B;  1GUS A;  2A6H C;  3KBX A;  3DEO A;  1JB7 A;  3D0F A;  3G4S A;  1I50 B;  4JI0 L;  1L1O A;  4FNF A;  4A3B G;  5DM7 3;  3PUZ A;  1TU2 B;  2F0H A;  2DGY A;  1EL0 A;  2M9V A;  1TWG H;  4HTH A;  2SDF A;  2VB2 X;  1E3P A;  3KF6 B;  2ZXP A;  5ELD A;  1IKL A;  3TN2 A;  4B9X A;  1L1O B;  1EU3 A;  4CDC C;  5IE8 A;  1JJG A;  1PVO A;  1DZ1 A;  1TR5 A;  4QY7 A;  1PH3 A;  3GTP B;  2I5H A;  3MXN B;  3H94 A;  2IPK D;  5EQ0 A;  4FVM A;  2RF4 A;  2N78 A;  1BR9 A;  1EOT A;  1I3Q B;  1Z9F A;  5G3L F;  2GVB A;  1F2L A;  2LS0 1;  2R7F A;  1N34 Q;  2ATW A;  1TS2 A;  3MHB A;  4DV0 Q;  1X3G A;  1K0S A;  1FVI A;  1XMQ L;  4EQO A;  1IL2 A;  1N36 Q;  2F0F A;  3F1Z A;  2E8G A;  4NKL A;  3HOZ B;  2D0O A;  2JXM B;  1PRT C;  3NE5 B;  4IJL A;  4DV1 Q;  4KK7 A;  3F8T A;  2KCC A;  3HRZ C;  4HIK A;  4TKO B;  3NQI A;  1SE8 A;  5CR3 A;  4UHV A;  1T9H A;  3R3O A;  4XQN A;  3PIO 3;  1EY9 A;  4XQJ A;  1JWU D;  5EAY A;  4G57 A;  4Y7N B;  1EIH A;  5JEA G;  5IP9 G;  1GOZ A;  1ZYR D;  3RNU A;  1SAP A;  2F0V A;  3H0G G;  1AW7 A;  3S1N H;  4ZK9 B;  4IFD J;  1MD2 D;  2X6L A;  3X3M A;  4YHH Q;  4L5R C;  3L2P A;  2R7Z H;  3S1Q B;  3HOZ G;  3LWU A;  1BQQ T;  2PPB C;  3E3X A;  1A15 A;  2BDO A;  4BS9 A;  4QGU A;  1VQK A;  3TQY A;  4DAM A;  5C4J H;  1G51 A;  4ODG A;  4P73 A;  1JQY D;  1GUT A;  5M3M H;  4C3H H;  4K2L A;  3GTM H;  2Z8L A;  3D8G A;  5IYD H;  2L12 A;  4L5Q A;  2B2W A;  1CHP D;  3BVZ A;  1GHJ A;  1KTK A;  3GDE A;  3P75 A;  4A93 H;  3HOX B;  4OIJ A;  3GV6 A;  4X64 L;  4YCU A;  4WRD A;  3VDY A;  5C0X G;  2DY7 A;  2B2Y A;  3MVV A;  1CSQ A;  4DK1 A;  1Y1W H;  5TSS A;  1XPO A;  2D9U A;  4XT3 B;  1VQP A;  2YV5 A;  1XTC D;  1VCI A;  3D3R A;  1OXV A;  1CKM A;  3MXP A;  3KBG A;  3ZJY C;  3D6W A;  2DJF C;  3HOV G;  2BA1 A;  3VA7 A;  3GP7 A;  3PO2 H;  4QIW B;  5AFW A;  4KD3 A;  1G29 1;  1NNX A;  2AQ3 B;  1F2Y A;  2EY1 A;  5M3M G;  2ES2 A;  4V0B A;  5M5W B;  2YU9 H;  1KHI A;  3IKJ A;  4DN4 M;  4ABN A;  5JJL A;  2QDL A;  1JIC A;  3QOL A;  3IL8 A;  3SDZ A;  4GZY C;  4WJ4 A;  3BYT B;  1IYV A;  4BBR H;  5GAH C;  4GLV B;  4C1N I;  1OXS C;  1QVF A;  1ZEQ X;  5EKI A;  1RIP A;  4PMB A;  4B08 A;  3CC2 A;  1LAC A;  4JBW A;  3Q22 A;  1QE6 A;  5HY6 A;  3NBH A;  4BBS B;  2Y0S G;  5LMU Q;  1L0Y B;  1YHB A;  2QKI C;  1FD7 D;  1GUW A;  3ULP A;  4JG2 A;  2PMZ B;  1PRT D;  4OWW B;  1BDO A;  3M7N A;  1NUC A;  3ERS X;  4S3S A;  5M5W H;  3S1R H;  1GUG A;  1A63 A;  4GN3 B;  2ASB A;  4A3E B;  1E2V A;  5H1S E;  1HNW L;  1STA A;  1ILP A;  3RMH A;  1J9O A;  4YCW A;  2B2T A;  1XNR Q;  3K7U C;  1RJT A;  4QCL A;  4ZAI A;  1LTT D;  2F0S A;  2F3I A;  3O13 A;  4DV3 Q;  1HNZ Q;  1D1I A;  3V2T A;  1I4Q A;  3GTJ H;  4TRD A;  1FJG Q;  1YNN C;  1JOK A;  4DR3 L;  3F2B A;  3DEP A;  4H7B A;  2KCT A;  3AFP A;  1WTX A;  4C3J H;  3DM3 A;  3J80 E;  2VL6 A;  1X3Q A;  2EVB A;  3K6O A;  1DOK A;  4JOI C;  4I65 A;  3A74 A;  2F0D A;  4FF1 A;  4ZYS A;  3H15 A;  1J6Q A;  1KQS A;  4NDX A;  2YTX A;  4O0A A;  3KLS X;  4IPC A;  2A69 D;  5JAV A;  1GVP A;  1EY8 A;  2A19 A;  2OEO A;  2A6E D;  4A3D B;  1NY4 A;  1S4Z A;  1Q86 C;  1B2T A;  5I2X A;  2QF7 A;  1PH2 A;  3SHL A;  3PSI A;  3UDI A;  5EBD A;  4GS3 A;  3GO5 A;  2ZM6 Q;  3J81 c;  4YIJ A;  4DNI A;  1YVC A;  3PV0 A;  2EPB A;  1BOS A;  4R1J A;  1SMX A;  5CV7 A;  3HS0 C;  5E1F A;  4C3J B;  2E2J H;  3NP8 A;  1WYD A;  4IPH A;  2LY7 A;  4YWM A;  5IP7 G;  1WCM H;  4JI2 L;  1HHV A;  3IRB A;  4C3I B;  1R4Q B;  1PYW D;  5C6A A;  3I56 A;  1PTO C;  1SYB A;  4AIM A;  3GTQ B;  1H95 A;  2P5Z X;  3M3Y B;  3OYY A;  5M3F H;  4KJN A;  1I4P A;  1TWC B;  4GOP B;  1LM0 A;  2EYH A;  2F3V A;  4IUT A;  4RAU C;  1EZ6 A;  2VQE L;  3S1R B;  3R93 A;  2ZJP A;  3C3L A;  2UXD Q;  1YNJ D;  4DR6 L;  4HSV A;  3V96 A;  2L1B A;  3FKI H;  5DNF A;  1E1T A;  1WFQ A;  2VXW A;  1PH5 A;  1UAP A;  1MBY A;  2OTL A;  4KMU C;  2KCM A;  1STB A;  1HQM C;  4QUF A;  4XT1 B;  2NVQ H;  1LT4 D;  2H4O A;  1X55 A;  3CHB D;  2ID0 A;  4P72 A;  2KOL A;  2OQK A;  2O5J C;  1VF7 A;  1TY0 A;  3JC6 6;  3CPF A;  2EJF C;  3I72 A;  2KHS A;  1H9M A;  2UXB L;  4JV5 Q;  3BG3 A;  4F8M A;  4OXP A;  5EPJ A;  3RR5 A;  4DV6 Q;  3SXH A;  5D3I B;  2VS1 A;  3A8I E;  4A3G B;  2DJG C;  1XMQ Q;  1KRS A;  1X6O A;  2R7D A;  1D7Q A;  5COR A;  4JI1 Q;  1U4P A;  5I6W A;  1QNU A;  4RKL A;  3MZ5 A;  2K5D A;  1VQD A;  2PZW A;  1AEX A;  2N55 A;  1WTP A;  4RGM A;  4POF A;  4RH6 A;  3S15 B;  5C44 H;  1ENF A;  2NVY B;  1HH2 P;  4APV A;  2YU9 B;  3UDF A;  1A6X A;  2JA8 H;  5HGT A;  2K4K A;  1DXM A;  1DCZ A;  4A3M B;  3FVQ A;  3RN5 A;  3OPO A;  1H9R A;  1X54 A;  2EQS A;  1QCB D;  2EY2 A;  1R9T B;  5FJ8 G;  2EIF A;  1I94 Q;  2PQA A;  3I70 A;  4GOP C;  3HFZ B;  2WAQ E;  4J8Q A;  2NZO A;  3HOY H;  3K5O A;  4C3H B;  4JV5 L;  3GD7 A;  3A7L A;  1UWV A;  2RA4 A;  4BY1 B;  5IGE A;  1C0A A;  1EUJ A;  4JBJ A;  3KOJ A;  4C2M B;  4DV4 L;  3NBH B;  3I4M H;  1V43 A;  3X3N A;  5JEA J;  1IL8 A;  1GD7 A;  1H9J A;  1L2F A;  1WD0 A;  3RZO H;  4CDE C;  4K5X A;  2TMP A;  4IO9 A;  5I9P A;  1PZK D;  5JJZ A;  3QO2 A;  1BKB A;  4L5S A;  4Y7N H;  3RZD H;  1JMC A;  1F2Z A;  4IFD H;  1EEI D;  1QVG A;  1KAA A;  4C3J G;  1S5F D;  2PMZ E;  3K81 C;  3NXW A;  2K5N A;  4KY6 A;  1W3S A;  3G6E A;  1PRT B;  2VUM B;  5FLX L;  3A54 A;  4Z9C B;  3U9O A;  5FLX E;  1Y1W G;  1N32 L;  1YJW A;  4G7H C;  1W2B A;  1EY6 A;  1ZKO A;  3AB9 A;  4JI0 Q;  1TT2 A;  5FLM H;  2D0P A;  4A3C G;  2JA6 B;  4TVA B;  1YEZ A;  5DM6 3;  4ZUJ A;  5IT9 L;  2YTY A;  1I94 L;  3TP6 A;  1SDF A;  1VQH A;  2ZTC A;  3AFQ A;  5CGK A;  1C7Y A;  4K5V A;  2IJ0 A;  2PQE A;  2Z4H A;  4QMG A;  3M9B A;  3S1M H;  4AQY L;  4ZRZ A;  1ZYR C;  1NBW A;  5FK9 C;  1PZJ D;  1D8L A;  4R8I A;  5FKA C;  2WB1 G;  3N52 A;  1CFM A;  1AE3 A;  3HG9 A;  4NXM L;  1WTH A;  4A3I H;  1YJ9 A;  3TS2 A;  5IYC G;  1EYA A;  3HOY B;  4DR1 L;  5IOC A;  4EQ5 A;  4A3L H;  4IFD G;  1STY A;  5ELN A;  3F2D A;  2KHI A;  3H0G B;  2PZT A;  2QEX A;  4R4C A;  4DAP A;  1XNQ L;  3U50 C;  2QCP X;  1TKW B;  1CZG A;  2VQF L;  4R9W A;  2JEA I;  3NUC A;  3OMG A;  5K5P A;  3CCJ A;  3PO2 G;  1E1O A;  3QG1 A;  3Q24 A;  5IIF A;  1QWY A;  5D14 A;  2E2H H;  1HXY D;  1PTO H;  1X9N A;  1BBW A;  5FO7 B;  2EXD A;  4PZ7 A;  1YHA A;  1V1P A;  4KKU A;  4Y52 H;  1BCP F;  3Q6S A;  2NB0 A;  1E7Z A;  2Z6B A;  4GNX A;  1BVS A;  2RCN A;  5DAU A;  1N32 Q;  3J7Y W;  2RDF A;  3EN2 A;  4HSP A;  4AYB G;  3QJY A;  1PH8 A;  2OF1 A;  1AH9 A;  1T5E A;  4JCV E;  1SSO A;  4JI7 Q;  4H0L C;  3E6Z X;  5M5X B;  3I4L A;  4U67 3;  3JAM i;  2ZJR A;  1PH4 A;  3VA5 A;  5C3E G;  3MEF A;  2EY5 A;  4DUZ Q;  3CCL A;  1B3A A;  2KJX A;  3K57 A;  3OWF A;  1CT1 D;  4DXG A;  4XQQ A;  3T1Y L;  5M5Y H;  2EXZ A;  5G3L D;  3A5U A;  3KLR A;  5E4W C;  3HOW B;  3VYT A;  4DV7 L;  1P8L A;  1SRU A;  4UP8 A;  1DJR D;  2A6H D;  4X66 L;  1O7Y A;  3MC0 B;  3SK6 A;  2B3G A;  1QB5 D;  1Y69 U;  1LYL A;  2BOS A;  4QL5 A;  5CBA E;  4WJW A;  4FF4 A;  1II3 A;  5T1G A;  1IBK L;  4RGT A;  4X62 Q;  5M3F B;  4QF4 A;  2BH8 A;  1A8V A;  4JYA Q;  2HCC A;  4OO1 I;  5LMN W;  1B50 A;  4RFB A;  2O2L D;  4MIU A;  5ELB A;  4KJO A;  2G9D A;  1EQT A;  4KKT A;  1F9R A;  2OTJ A;  1FYC A;  1OXT A;  1SR3 A;  5A35 A;  3BDL A;  2R93 H;  2NVX B;  3TBI B;  2PYK A;  4CJ1 B;  4LF6 Q;  1EY7 A;  2M2L A;  2PW7 A;  2F4V Q;  3ULL A;  3VYR A;  3GTQ H;  3K8A A;  4KHZ A;  1A2T A;  2N88 A;  3UI2 A;  2I5L X;  1PYS B;  3PUW A;  2L11 A;  4G4K A;  3TSS A;  2C5C A;  4OEM B;  1N33 Q;  4I7A A;  3GTM B;  2ZTE A;  2A1A A;  4FXD A;  4ZLT F;  1TWF B;  2A73 B;  1TWH H;  3D4W A;  3SGI A;  4XYQ A;  1H9S B;  3FPU B;  5C4J B;  1L0X B;  1UEB A;  3NEN A;  5C0X I;  2CWA A;  2NZ1 D;  1F9P A;  2R93 G;  2AKW B;  1QOH A;  1FR3 A;  4M8A A;  2F0L A;  3V05 A;  3S2H B;  1QJO A;  2HD3 A;  3H91 A;  5LL6 X;  4IUU A;  4X66 Q;  1GJX A;  2F0O A;  2UUA Q;  2JA6 H;  3DWA A;  4X3T A;  4FF2 A;  5EGT A;  2FIN B;  1A3T A;  2E74 C;  3EA6 A;  1B4O A;  3T1Y Q;  2XTI A;  2ALY B;  3FRP B;  2CQA A;  1M8A A;  4DR7 Q;  1VS0 A;  1TY2 A;  4HIO A;  4BXX G;  3BZD B;  1KAB A;  3VR3 A;  1CQF A;  3GTG B;  1I4G A;  2NYZ D;  3OW2 A;  1NMG A;  1M90 C;  3VR6 A;  3T51 B;  1CK1 A;  4IPD A;  2TSS A;  4PG3 A;  5IP9 H;  3RN2 A;  3B6Y A;  4IQZ A;  5GAE C;  3HKS A;  3GTO B;  1BO0 A;  3SK8 A;  1TII D;  4U68 A;  2BH2 A;  3HOU B;  4L63 B;  4HCS A;  4K2K A;  3BS1 A;  3CQZ H;  4YHH L;  1LTI D;  2I46 A;  3I55 A;  1NAP A;  1STE A;  5JVH 3;  1GM5 A;  1JE5 A;  2PI2 A;  2F1M A;  4LF5 Q;  1YIJ A;  4B3T L;  2PNR C;  3ERO A;  3UDX A;  2IY5 B;  2PI2 E;  1NMF A;  2E5L L;  3I8Z A;  1J5E L;  4LFA L;  3C2P A;  3KJO A;  5M5X H;  3NTI A;  3TP8 A;  1MIU A;  2PQA B;  3KK7 A;  2UXD L;  2NN6 G;  2RSN A;  4F7X A;  4HJ5 A;  4JI6 Q;  5BN5 A;  3L0O A;  3RLF A;  5JVG 3;  5FOB B;  1NCV A;  2N49 A;  2Q2U A;  3K0Y A;  1EWI A;  2RHQ B;  1SFO H;  1GKH A;  1FJG L;  3S15 H;  1LTS D;  2K32 A;  1RTO A;  4P71 A;  4A3J G;  3S2D H;  1N34 L;  1STH A;  2DNE A;  4LF5 L;  2NVT B;  1Y1W B;  1SYD A;  2B8G A;  4BWG B;  1Q1B A;  1GO3 E;  3GTK H;  1EY4 A;  2B2U C;  1RKN A;  3C1F A;  5I6Y A;  2JA6 G;  1S5E D;  1KDA A;  1STN A;  4XYO A;  4CJ0 B;  5KGU A;  3EBE A;  3ULJ A;  2K04 A;  2L15 A;  4X6A H;  3H0G H;  3T53 B;  1SMY D;  2NZH A;  1SE2 A;  2UUC L;  5CV4 A;  5K36 G;  3G7L A;  1DD2 A;  3PMF A;  1OXU A;  4IJH A;  4RG1 A;  1WOC A;  2VY3 A;  2B39 A;  4QUC A;  4P74 A;  2DNC A;  1NJI C;  5IGG A;  3S16 H;  4NMZ A;  4BBR G;  1HTL D;  2QIL A;  4H44 C;  3S1M B;  3A5Z B;  3P7J A;  3I73 A;  3BU2 A;  1PHJ A;  4NXM Q;  2XRS D;  4KTA A;  2HT1 A;  4IZ8 A;  3K0X A;  3KFU A;  2I0Q A;  4JW0 A;  3TZD A;  1XPR A;  4N8F A;  3NBI A;  2CHB D;  4Q5V A;  2E5L Q;  2ZJQ A;  5IGB A;  3PF5 A;  2OCE A;  1AN8 A;  4A3J B;  2RBM A;  3G48 A;  3PIO A;  4LF4 L;  5IWA Q;  4BBS G;  1K8G A;  2F0W A;  3CU7 A;  5LMN L;  1IW7 D;  3J7A 5;  3K58 A;  3A0J A;  2UXB Q;  3EJI A;  4I7Z C;  1A0I A;  1Z47 A;  3GTG H; 
#chains in the Genus database with same CATH homology
 5EPK A;  2FFK B;  1PFM A;  1E2Z A;  3RUZ A;  5K36 H;  2CW0 D;  2EYL A;  4ZKC B;  1TWA B;  1KLG D;  1E2W A;  5JEA H;  2XRQ D;  1CA6 A;  1HPC A;  2K6A A;  1B1Z A;  1ROD A;  1WVL A;  4K8J A;  1WTV A;  3OSO A;  1O78 A;  5I9O A;  1LO5 D;  2E2J B;  4DAY A;  3L7Z C;  5IOD A;  2XNA C;  5T1I A;  1KNA A;  3MA2 B;  3A8K E;  3VR5 A;  2K5W A;  3KF8 A;  4JK1 C;  2XIW A;  2IWH A;  1Q12 A;  2R3Z A;  3SK4 A;  1SYF A;  2AUK A;  2EOT A;  2HDL A;  1DM0 B;  3W2D A;  2Q8I B;  1G2S A;  2IX3 A;  2KA7 A;  2MGS A;  5IGF A;  2Q8R E;  4RGO S;  1A2U A;  3FEW X;  4F88 A;  3F2U A;  3H6M A;  2F0Q A;  2BDN A;  1K8M A;  3ZYY X;  3PUV A;  3OW7 A;  5ELC A;  1LT6 D;  2EJM A;  2V4D A;  4L6T B;  4K8I A;  3NQT A;  4C56 C;  3MAQ A;  1AZQ A;  2EY6 A;  4FXG C;  2RDH A;  3CQZ B;  4RKB A;  2CW0 C;  3FPP A;  1UNS A;  4UDU C;  5C4H A;  3R8B A;  1BF4 A;  4KY5 A;  4CKE A;  3OIQ A;  2K5Q A;  1DOL A;  4KN7 C;  1PMR A;  2F03 A;  4MHE A;  2X6G A;  3J81 L;  3D6C A;  2ZXO A;  3TP7 A;  1HFG A;  1ENC A;  3K7A B;  1JOO A;  2KUM A;  5FO8 B;  2MJ8 A;  1PXU A;  4ZKB B;  1LAB A;  3I91 A;  1ZXT A;  1XWE A;  3MTS A;  3KUP A;  4NW2 A;  5KYL A;  3LNN A;  2SEB D;  4K6L A;  4K14 A;  5KNB A;  2R61 A;  2E2H B;  1SYG A;  1SFO B;  2VB3 X;  1VMP A;  4IFD I;  2SNM A;  1VMC A;  2E75 C;  3IFT A;  2NN6 H;  2EYO A;  1BCP D;  2F3W A;  2O5I C;  1SMY C;  1SXT A;  1BCP B;  3D4D A;  3CKI B;  1CZW A;  1EQV A;  1PZI D;  4QB4 A;  4RHR A;  1H9K A;  3TDQ A;  2Y0S B;  3ITP A;  4R8N A;  1I4X A;  5C5M A;  3NK9 A;  4CKC A;  1T5X D;  1A3V A;  3HEJ A;  3DUZ A;  3R2T A;  2AQ2 B;  4HMJ A;  3JAM L;  1BNZ A;  4IN3 A;  1CM9 A;  3RZD B;  2D2C C;  3A55 A;  1ET6 A;  2PCF B;  1DOM A;  2B2W C;  1FNW A;  4WOR A;  2AQ1 B;  1EFI D;  1ESR A;  2RKS A;  1RD9 D;  4CKB A;  3Q0A A;  3QB3 A;  3MXU A;  4IUP A;  4ZQ3 A;  2XWJ B;  2RVL A;  2XWB B;  1BXT A;  3T13 A;  1Y1V B;  2AWO A;  1G91 A;  5J22 A;  1TS5 A;  2A69 C;  1F9S A;  3A8J E;  1EWC A;  2A74 C;  1X3P A;  4DU9 A;  2B8F A;  1Y8P B;  1F2M A;  3GQB A;  4PQX A;  1EY5 A;  1KDB A;  1G8Z D;  3E5S A;  5JOB A;  2X69 A;  5I4D A;  1TWH B;  1QNK A;  4G7Z C;  1ENA A;  1D5Z C;  5CC4 A;  4RWS C;  2WAQ B;  1KDC A;  4OHJ A;  2EZV A;  3NTK A;  3MXG A;  2EYF A;  5KIX A;  1U4L A;  2MP1 A;  1U4R A;  4HED A;  3NSW A;  1B44 D;  3PO3 B;  5IGC A;  3MXN A;  3JAM E;  1JCK B;  1DON A;  1SNQ A;  1V8Q A;  1MSH A;  2Z4I A;  4G7O C;  3OOC A;  3L9A X;  5IT9 E;  3TME A;  2WV6 D;  2JEB I;  2BA0 A;  2EYM A;  2SOB A;  3ND8 A;  3OMC A;  1I4H A;  2B2Y C;  1UEA B;  2BE5 D;  1XYI A;  2LMC B;  3WDN A;  1S5B D;  1HTP A;  3K5N A;  2H1E A;  3WOE A;  3S17 B;  1EY0 A;  3DM1 A;  5EPL A;  2B63 B;  3S14 B;  3VYU A;  4CBV A;  1NSN S;  3DWP A;  1GXD C;  2WII B;  1WCM B;  5J1Z A;  1GHK A;  4E6I A;  1QIL A;  2XSC A;  1U4M A;  5E3F A;  2AUJ D;  2EYJ A;  5C0X J;  3N6R A;  2HQE A;  1OO9 B;  2EYP A;  4J1M A;  3K59 A;  4ME5 A;  3LWE A;  5HUR A;  1AP0 A;  3A56 A;  1V1O A;  3R2I A;  1EEF D;  1MGS A;  1PTO B;  4RA8 A;  4FO2 A;  4RCO A;  2MPM A;  1FNV A;  1I6H B;  3M4Y A;  1CHQ D;  3MFY A;  4DK0 A;  4DXF A;  5LHY 1;  3M4O B;  1C4Q A;  5JPN C;  1QG7 A;  4FXK C;  4OL7 A;  1ONL A;  4HMI A;  5ELF A;  3GTJ B;  4AYB B;  2JSO A;  2RQX A;  1BBX C;  4LJZ C;  2RDG A;  2K1B A;  4IAL A;  1CI3 M;  2PW5 A;  2F0P A;  2F0E A;  2FJ2 A;  2A5H A;  2JA5 B;  4KHV A;  3ERQ A;  1CA5 A;  1SE3 A;  3FDT A;  3QWN A;  1BUV T;  1NR4 A;  5KRU A;  5CV8 A;  2F0K A;  2J4X A;  5KND A;  4BBR B;  3K5M A;  4V19 0;  4C3H G;  4BA2 I;  2F0I A;  5COY A;  3PUX A;  2E2D C;  1RF2 D;  4OO1 G;  3M7G A;  1HFN A;  4O1N A;  2DY8 A;  3FKI B;  4ID6 A;  2L4N A;  4RGN A;  4DNR B;  1Q1E A;  3KLS A;  3SK5 A;  3HZX A;  2GA4 B;  2ICE C;  5J39 A;  4LK1 C;  3PIP 3;  1LV9 A;  3W3A A;  1JC7 A;  1A3U A;  2E2I B;  1PTO D;  2LFN A;  4IUR A;  1SJE D;  5CV6 A;  2IT1 A;  1SJH D;  1G6Z A;  2OT2 A;  3BDC A;  3P20 A;  1HRJ A;  3P1H A;  1XX8 A;  3TZU A;  1PRT F;  1JE4 A;  3OHX C;  2NUC A;  2NN6 I;  2ENB A;  1H9S A;  3CRL C;  4PNY A;  2JYO A;  1SNP A;  3M85 A;  1IW7 C;  4M1U B;  5C4X B;  1V1P B;  2E76 C;  2JE6 I;  4A3I B;  2R7Z B;  3GTL B;  1WTW A;  1SNM A;  1R4P B;  5BN4 A;  1VDZ A;  2KEE A;  2F0N A;  5EJW A;  3A7A B;  3I90 A;  2C9O A;  5JPM C;  4KD4 A;  1D2B A;  1Y8N B;  2K03 A;  1GUO A;  1B53 A;  4O42 A;  1XXG A;  1MSG A;  5EBC A;  4CGY B;  1SYC A;  1NR2 A;  1WD1 A;  3OWE B;  1Q8I A;  2EE1 A;  2F0G A;  1KNE A;  3H3V C;  2KQ3 A;  2ZXR A;  4N9T A;  4DGZ A;  1YNJ C;  3SE0 A;  3DWQ A;  2K28 A;  3S16 B;  3RZO B;  4KY7 A;  4DA2 A;  5C4Z A;  1M4V A;  1SNO A;  4OIK A;  1Y8O B;  5C0X H;  3NTH A;  1ET9 A;  4RCN A;  5D65 A;  4PMC A;  1RDP D;  5CV9 A;  2ICI A;  2WIN B;  5CBE E;  3CRK C;  4OGQ C;  3GTK B;  1B9N A;  2KCN A;  2CVR A;  2EJG C;  1FNU A;  3T4A C;  1TWG B;  2Z1C A;  4DFA A;  3NHH A;  1C48 A;  1PLF A;  1ML0 D;  3VR4 A;  1J8I A;  4BA1 I;  4DAV A;  2L5T A;  2JA8 B;  4HR7 B;  1AFP A;  4C1N K;  2MHV A;  1EU4 A;  1IHZ A;  2QEJ C;  4X3U A;  2EDG A;  5IGD A;  1RHP A;  4EQP A;  1LT5 D;  1HA5 A;  1JR0 D;  3T16 A;  1C8C A;  1K8O A;  4A3F B;  5ISR A;  1RCV D;  4RHS A;  2R92 B;  1SBB B;  4LAA A;  4XTC S;  2J0T D;  4A3K B;  3HOV B;  1D5M C;  3MEH A;  4X3S A;  3H09 A;  2F0M A;  1F77 A;  3J7A F;  3I3C A;  4XDX A;  1YNN D;  1WTQ A;  3ND9 A;  3S1N B;  1W6J A;  2AWN A;  4FP5 D;  2QDB A;  1PDQ A;  3T56 B;  1OXX K;  4HCE A;  3E0J A;  4EGV A;  1LLR D;  5I2Y A;  3LX0 A;  2WAC A;  5CYU A;  1Z6H A;  1B9M A;  4CHT B;  2KEC A;  2IX0 A;  4OO1 H;  4DF7 A;  2NWG A;  1K83 B;  3PO2 B;  2FHT A;  2FMC A;  3K5L A;  3L3O C;  4TQU S;  1IKM A;  3HKZ B;  2OXP A;  5C3W A;  2A68 C;  2B2V A;  5ELE A;  2ZT9 C;  1TVX A;  1W6K A;  4H13 C;  4CJ2 C;  3HGB A;  4PMW A;  2PO4 A;  4IUN A;  2XVS A;  5A2Q L;  2D5D A;  5KYI A;  2MUY A;  2YYZ A;  1SNC A;  4KN4 C;  3EQL C;  5NUC A;  4K6D A;  5LL6 S;  3J7A V;  5M3M B;  4HN7 A;  3FMC A;  3VYS A;  2I07 B;  2WB1 B;  1ICW A;  1E0B A;  2K7V A;  1TQO A;  2L55 A;  3IFD A;  4XXE A;  2R93 B;  1BCP C;  5EKK A;  5C3E B;  3QOJ A;  1PFB A;  2D62 A;  1HA6 A;  3GV3 A;  4X3K A;  3IAY A;  1O80 A;  1TS4 A;  5E4X A;  5M9O A;  1MI2 A;  1DYQ A;  1S5C D;  2B2U A;  1UUP A;  4BY7 B;  2F0J A;  1CTM A;  1SYE A;  1AZP A;  3WOF A;  1LTG D;  4DNT B;  1EWH A;  2LKV A;  2NTS A;  1X32 A;  2K33 A;  3BDO A;  1SND A;  2G9H D;  1LTB D;  2M00 A;  3U9S A;  1HCZ A;  3AU7 A;  1CQV A;  2A68 D;  2IL8 A;  3I4M B;  5CV5 A;  2PZU A;  1JWM D;  3G6J B;  1PTO F;  3BVM A;  1WTO A;  2JA7 B;  2XN9 C;  5A2Q E;  2J7Z A;  2B2T C;  4NP5 A;  2NBF A;  3S2D B;  1I4R A;  4B9W A;  3NWT A;  1Z7T A;  4HAE A;  1SEB D;  1EYC A;  3J81 E;  4A93 B;  3D4R A;  4K5W A;  4IUV A;  2IX1 A;  3RD4 A;  4XIG S;  5CMD A;  1D1K A;  3SVM A;  3C46 A;  5KNC A;  4J6H A;  4LMQ D;  1ESF A;  3ONA B;  3QIA A;  1PFN A;  4MN3 A;  1JOR A;  1STG A;  5EKL A;  3HP3 A;  1IYU A;  4KV6 A;  4A3B B;  1JB3 A;  3TP5 A;  1G2T A;  3EFX D;  2NVQ B;  1JOQ A;  5DEH A;  4Q0F A;  1RTN A;  1HQR D;  4ZUI A;  1HUN A;  1LTA D;  1JWS D;  5C5L A;  4KI0 A;  1SE4 A;  5BN3 A;  4L8J A;  2WKC A;  3J80 L;  1Q90 A;  2SNS A;  5C3X A;  1FGB D;  4WFN 3;  2BCO A;  1TS3 A;  1O7Z A;  2KED A;  3D31 A;  4F87 A;  3BVG A;  4EQN A;  4TSS A;  1KLU D;  3NPP A;  1Q3L A;  3AMU A;  1GUN A;  3VR2 A;  1ILQ A;  3S9W A;  5KEE A;  1EYD A;  2HUG A;  2Q8T A;  3URY A;  3PUY A;  5F2D A;  4FYD A;  2R6G A;  2K01 A;  2RSO A;  3NWS A;  2VNU D;  5FO9 B;  3DMU A;  2WKD A;  2WP8 J;  1LT3 D;  1I6V C;  2F4I A;  5C44 B;  4PV1 C;  4EVO A;  1D6E C;  1F9Q A;  3I4N B;  3OIP A;  3BYY B;  2JP1 A;  2HDM A;  4N9P A;  2NTT A;  5D3D A;  4ILW A;  1O7L A;  2KVM A;  3DHQ A;  3Q23 A;  1EIG A;  4C3I G;  3EVQ A;  4UAI A;  2B2V C;  4P2C B;  2O4X A;  1S5D D;  1LTR D;  1EZ8 A;  4FF3 A;  3MWY W;  3DXJ C;  4KKS A;  1VF5 C;  2HCI A;  2K05 A;  3SEB A;  2BE5 C;  3MFG A;  3SR1 A;  5M5Y B;  2L9H A;  2F0T A;  4ULL A;  1U9R A;  3C1E A;  1HUM A;  2A6E C;  2F0U A;  2IW3 A;  4IUQ A;  2FMM A;  2L0C A;  1WTR A;  2DN8 A;  1D5X C;  1GUS A;  2A6H C;  3KBX A;  3DEO A;  1I50 B;  4FNF A;  5DM7 3;  3PUZ A;  1TU2 B;  2F0H A;  1EL0 A;  2M9V A;  4HTH A;  2SDF A;  2VB2 X;  2ZXP A;  5ELD A;  1IKL A;  3TN2 A;  4B9X A;  1EU3 A;  1DZ1 A;  1TR5 A;  3GTP B;  3H94 A;  2IPK D;  5EQ0 A;  4FVM A;  1BR9 A;  1EOT A;  1I3Q B;  5G3L F;  1F2L A;  2LS0 1;  1TS2 A;  3MHB A;  4EQO A;  2F0F A;  4NKL A;  3HOZ B;  2JXM B;  1PRT C;  3NE5 B;  4KK7 A;  2KCC A;  3HRZ C;  4TKO B;  3NQI A;  5CR3 A;  3R3O A;  4XQN A;  3PIO 3;  1EY9 A;  4XQJ A;  1JWU D;  4G57 A;  4Y7N B;  1EIH A;  5JEA G;  1GOZ A;  1ZYR D;  1SAP A;  2F0V A;  1AW7 A;  4ZK9 B;  4IFD J;  1MD2 D;  2X6L A;  3X3M A;  3S1Q B;  3LWU A;  1BQQ T;  2PPB C;  1A15 A;  2BDO A;  4BS9 A;  4ODG A;  1JQY D;  1GUT A;  4K2L A;  2Z8L A;  3D8G A;  2L12 A;  2B2W A;  1CHP D;  3BVZ A;  1GHJ A;  1KTK A;  3P75 A;  3HOX B;  4OIJ A;  3GV6 A;  4WRD A;  5C0X G;  2DY7 A;  2B2Y A;  3MVV A;  4DK1 A;  5TSS A;  2D9U A;  4XT3 B;  1XTC D;  1VCI A;  3D3R A;  1OXV A;  3MXP A;  3KBG A;  3D6W A;  3VA7 A;  2BA1 A;  3GP7 A;  4QIW B;  5AFW A;  4KD3 A;  1G29 1;  2AQ3 B;  1F2Y A;  2EY1 A;  4V0B A;  5M5W B;  3IKJ A;  4DN4 M;  4ABN A;  1JIC A;  3QOL A;  3IL8 A;  3SDZ A;  4GZY C;  3BYT B;  1IYV A;  4C1N I;  1OXS C;  1ZEQ X;  5EKI A;  4PMB A;  4B08 A;  1LAC A;  4JBW A;  3Q22 A;  1QE6 A;  3NBH A;  4BBS B;  1L0Y B;  2QKI C;  1FD7 D;  1GUW A;  2PMZ B;  1PRT D;  3M7N A;  1BDO A;  1NUC A;  4S3S A;  1GUG A;  4A3E B;  1E2V A;  1ILP A;  1STA A;  3RMH A;  1J9O A;  2B2T A;  1RJT A;  4QCL A;  4ZAI A;  1LTT D;  2F0S A;  3O13 A;  3V2T A;  1D1I A;  1I4Q A;  4TRD A;  1YNN C;  1JOK A;  3DEP A;  4H7B A;  1WTX A;  3J80 E;  1X3Q A;  2EVB A;  3K6O A;  1DOK A;  4I65 A;  2F0D A;  4FF1 A;  4ZYS A;  4NDX A;  3KLS X;  5JAV A;  2A69 D;  1EY8 A;  2OEO A;  2A6E D;  4A3D B;  1S4Z A;  1B2T A;  5I2X A;  2QF7 A;  3SHL A;  5EBD A;  3GO5 A;  4YIJ A;  3PV0 A;  2EPB A;  1BOS A;  5CV7 A;  3HS0 C;  5E1F A;  4C3J B;  3NP8 A;  1HHV A;  2LY7 A;  4C3I B;  1R4Q B;  1PYW D;  5C6A A;  1PTO C;  1SYB A;  3GTQ B;  3M3Y B;  4KJN A;  1I4P A;  1TWC B;  2EYH A;  2F3V A;  4IUT A;  4RAU C;  1EZ6 A;  3S1R B;  3R93 A;  3C3L A;  1YNJ D;  4HSV A;  3V96 A;  2L1B A;  5DNF A;  2VXW A;  1UAP A;  1MBY A;  4KMU C;  1STB A;  1HQM C;  4QUF A;  4XT1 B;  1LT4 D;  2H4O A;  3CHB D;  2ID0 A;  2KOL A;  2O5J C;  1VF7 A;  1TY0 A;  2EJF C;  3I72 A;  2KHS A;  1H9M A;  3BG3 A;  4F8M A;  5EPJ A;  3SXH A;  5D3I B;  3A8I E;  4A3G B;  5COR A;  1U4P A;  5I6W A;  1QNU A;  4RKL A;  3MZ5 A;  2K5D A;  2PZW A;  1AEX A;  2N55 A;  1WTP A;  4RGM A;  4RH6 A;  3S15 B;  1ENF A;  2NVY B;  2YU9 B;  1A6X A;  5HGT A;  1DXM A;  1DCZ A;  4A3M B;  3FVQ A;  3OPO A;  1H9R A;  1QCB D;  2EY2 A;  1R9T B;  3I70 A;  4J8Q A;  3K5O A;  4C3H B;  3GD7 A;  3A7L A;  2RA4 A;  4BY1 B;  5IGE A;  4C2M B;  1V43 A;  3X3N A;  5JEA J;  1IL8 A;  1H9J A;  1WD0 A;  4K5X A;  2TMP A;  5I9P A;  1PZK D;  5JJZ A;  3QO2 A;  1F2Z A;  4IFD H;  1EEI D;  1KAA A;  4C3J G;  1S5F D;  3NXW A;  4KY6 A;  1PRT B;  2VUM B;  5FLX L;  3A54 A;  4Z9C B;  3U9O A;  5FLX E;  4G7H C;  1EY6 A;  1ZKO A;  3AB9 A;  1TT2 A;  2JA6 B;  5DM6 3;  4ZUJ A;  5IT9 L;  3TP6 A;  1SDF A;  5CGK A;  4K5V A;  2IJ0 A;  2PQE A;  2Z4H A;  4QMG A;  4ZRZ A;  1ZYR C;  5FK9 C;  1PZJ D;  4R8I A;  5FKA C;  3N52 A;  1CFM A;  3HG9 A;  1EYA A;  3HOY B;  5IOC A;  4IFD G;  1STY A;  3H0G B;  2PZT A;  4DAP A;  2QCP X;  1TKW B;  1CZG A;  4R9W A;  2JEA I;  3NUC A;  3OMG A;  5K5P A;  3QG1 A;  3Q24 A;  5IIF A;  5D14 A;  1QWY A;  1HXY D;  1PTO H;  5FO7 B;  1V1P A;  4KKU A;  1BCP F;  3Q6S A;  2NB0 A;  5DAU A;  3J7Y W;  2RDF A;  4HSP A;  3QJY A;  2OF1 A;  1T5E A;  1SSO A;  4H0L C;  3E6Z X;  5M5X B;  3I4L A;  4U67 3;  3VA5 A;  2EY5 A;  1B3A A;  2KJX A;  3K57 A;  3OWF A;  1CT1 D;  4DXG A;  4XQQ A;  2EXZ A;  5G3L D;  3KLR A;  5E4W C;  3HOW B;  3VYT A;  1DJR D;  2A6H D;  1O7Y A;  3MC0 B;  3SK6 A;  1Y69 U;  1QB5 D;  2BOS A;  5CBA E;  4WJW A;  4FF4 A;  1II3 A;  5T1G A;  4RGT A;  5M3F B;  4QF4 A;  2HCC A;  4OO1 I;  1B50 A;  4RFB A;  2O2L D;  4MIU A;  5ELB A;  4KJO A;  2G9D A;  1EQT A;  4KKT A;  1F9R A;  1FYC A;  1OXT A;  5A35 A;  3BDL A;  2NVX B;  3TBI B;  2PYK A;  4CJ1 B;  1EY7 A;  2M2L A;  2PW7 A;  3VYR A;  4KHZ A;  1A2T A;  2N88 A;  3UI2 A;  3PUW A;  2L11 A;  4G4K A;  3TSS A;  2C5C A;  3GTM B;  4FXD A;  4ZLT F;  1TWF B;  2A73 B;  3D4W A;  4XYQ A;  1H9S B;  3FPU B;  5C4J B;  1L0X B;  5C0X I;  2NZ1 D;  1F9P A;  1QOH A;  1FR3 A;  4M8A A;  2F0L A;  3V05 A;  3S2H B;  1QJO A;  3H91 A;  5LL6 X;  4IUU A;  1GJX A;  2F0O A;  3DWA A;  4X3T A;  4FF2 A;  5EGT A;  2FIN B;  1A3T A;  2E74 C;  3EA6 A;  1B4O A;  3FRP B;  2CQA A;  1M8A A;  1TY2 A;  3BZD B;  1KAB A;  3VR3 A;  1CQF A;  3GTG B;  1I4G A;  2NYZ D;  3VR6 A;  3T51 B;  1CK1 A;  2TSS A;  4IQZ A;  3GTO B;  1BO0 A;  3SK8 A;  1TII D;  4U68 A;  3HOU B;  4L63 B;  4HCS A;  4K2K A;  3BS1 A;  1LTI D;  2I46 A;  5JVH 3;  1NAP A;  1STE A;  2F1M A;  2PNR C;  3ERO A;  3I8Z A;  3C2P A;  3NTI A;  3TP8 A;  3KK7 A;  2NN6 G;  2RSN A;  4F7X A;  5BN5 A;  3RLF A;  5JVG 3;  5FOB B;  1NCV A;  3K0Y A;  1LTS D;  2K32 A;  1RTO A;  1STH A;  2DNE A;  2NVT B;  1Y1W B;  1SYD A;  2B8G A;  4BWG B;  1Q1B A;  1EY4 A;  2B2U C;  1RKN A;  3C1F A;  5I6Y A;  1S5E D;  1KDA A;  1STN A;  4XYO A;  4CJ0 B;  5KGU A;  2K04 A;  3T53 B;  1SMY D;  1SE2 A;  5CV4 A;  5K36 G;  3G7L A;  1DD2 A;  3PMF A;  1OXU A;  2B39 A;  4QUC A;  2DNC A;  5IGG A;  4NMZ A;  1HTL D;  2QIL A;  4H44 C;  3S1M B;  3P7J A;  3I73 A;  2XRS D;  4KTA A;  4IZ8 A;  3TZD A;  4Q5V A;  3NBI A;  2CHB D;  5IGB A;  1AN8 A;  4A3J B;  2RBM A;  2F0W A;  3CU7 A;  1IW7 D;  3K58 A;  3EJI A;  4I7Z C;  1Z47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...