3A8KE

Crystal structure of etd97n-ehred complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
125
Chain Sequence
NVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transport protein
total genus 29
structure length 125
sequence length 126
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3a8kE00
2BE5C 3T56B 2DNCA 1G291 3BG3A 3IKJA 1LABA 3PUZA 1Q12A 2D5DA 3BDOA 3M4YA 3W3AA 4DK1A 1Y8NB 1V8QA 4KI0A 4G7ZC 4DNTB 3I72A 4BA2I 3EQLC 5JEAG 3ND9A 3GD7A 1Y8PB 1I6VC 2B8GA 2V4DA 1ZKOA 3MXUA 3N6RA 4H13C 2B8FA 2E76C 1FYCA 2A6HD 1E2ZA 4H0LC 4RCNA 5JEAH 4KKTA 2PPBC 1ZYRC 1OXTA 1K8MA 1IW7C 2A69D 2LMCB 3HGBA 4L8JA 3VR2A 2A68C 2KA7A 3OW7A 3LNNA 1H9MA 3PUYA 4OO1H 1OXSC 3IFTA 1EWHA 1PMRA 4JBWA 2K32A 1H9JA 1T5EA 4PV1C 1GUGA 2AUJD 2EDGA 2F1MA 3CRLC 3VR4A 1VCIA 2E74C 4XIGS 3H94A 1GUSA 1OXUA 2PCFB 3FPPA 3PUWA 3M85A 4XTCS 1H9RA 1A6XA 5BN3A 2DN8A 4G7OC 2EJGC 1LACA 3PV0A 1SMYC 3PUXA 1BDOA 2K33A 4IQZA 4KKSA 3TZUA 4DNRB 5KNBA 1TU2B 3PUVA 4G7HC 2O5IC 4OO1G 3L7ZC 1CTMA 1DXMA 1OXXK 1CFMA 1GJXA 3I73A 2Q8IB 2A6HC 1DCZA 3WDNA 1TKWB 5K36H 1ONLA 1Z7TA 3D4RA 1Y8OB 2A69C 4TQUS 5BN5A 1Q90A 2NN6I 3P20A 2E75C 4BA1I 2A6ED 5A35A 4OGQC 2R6GA 3A8KE 3VA7A 1HPCA 4HR7B 3A7AB 2CW0C 2IT1A 4JK1C 2JXMB 3RLFA 5C0XH 3SE0A 1O7LA 1VF5C 4IFDG 3QG1A 2ZT9C 2PNRC 3M7NA 2BA0A 1GUOA 3KLRA 1E2WA 3FMCA 4KKUA 1B9NA 1YNJC 2AWOA 2D62A 3DXJC 3I4LA 1HCZA 1V43A 5K36G 1YNNC 2JEBI 3A7LA 4DK0A 4IFDH 3MFYA 1IW7D 2AUKA 1GHJA 2NN6H 3OPOA 1Q1BA 3GQBA 3QJYA 2JEAI 1GHKA 2O5JC 3A8JE 5C0XG 2BE5D 1IYUA 4KN4C 4LJZC 2L5TA 1VDZA 3VR6A 1HQMC 1H9SB 1IYVA 2D2CC 2KCCA 2K7VA 1Y69U 1Z6HA 4GZYC 1OXVA 2EJMA 2A6EC 2JE6I 4TKOB 1GUNA 5BN4A 2BDOA 3D31A 2DNEA 3SDZA 1E2VA 1Q1EA 4KN7C 5KNCA 2YYZA 2QF7A 1H9SA 2NN6G 1H9KA 4LK1C 3AB9A 3T51B 3T53B 3VR5A 4KMUC 3QIAA 3OOCA 3U9SA 4I7ZC 3ND8A 3NE5B 1CI3M 2A68D 1VF7A 4H44C 3LWUA 1QJOA 2EJFC 5KNDA 1GUTA 1FR3A 1B9MA 2EVBA 4KHZA 3VR3A 1DD2A 3A8IE 1HTPA 1K8OA 1O78A 3CRKC 2BA1A
chains in the Genus database with same CATH superfamily
4NXNL 3K7UC 4A3KG 1O7ZA 4ZKCB 4JBKA 1LABA 2NBFA 3W3AA 3S9WA 4HCEA 1KABA 1PH5A 3KBGA 5IGGA 1VQ7A 1RIPA 4LF4Q 3G71A 5ELDA 1RKNA 3PF5A 2IHFA 4JI1Q 1FGBD 5CV4A 1E2ZA 4CDFC 2MNAA 1PRTF 5IGDA 3HGBA 1SYGA 2KA7A 3PUYA 1D5MC 5DAUA 3DMUA 4IUUA 3H3VI 1X3FA 2MJ8A 3NWTA 3GTGB 1AEXA 3ICEA 2RF4A 1JICA 3CRLC 1HUNA 4OHJA 2JA5B 3LWEA 2KECA 4C1NK 3F1ZA 1KAWA 4A4IA 2RQXA 5C44G 1SMYC 3FEWX 2F0PA 2PZTA 4P72A 4DV6Q 1WCMB 5C4JH 1AFPA 4A3GB 4KTAA 1B4OA 2GVAA 4I7AA 4NMZA 3HG9A 4B3SQ 1Y8OB 2MQHA 5D14A 1F9SA 4JI2L 1LLRD 1CKNB 2DGYA 4YHHQ 2Z8LA 4CKCA 3D4WA 5C4XH 2SDFA 2HD3A 4QIWB 2HCIA 1K73C 5C3EH 5M3MB 1EQVA 1FJGQ 1KNEA 3C1FA 5E4XA 1TXYA 1K3BC 1WOCA 2I07B 1XNQQ 1PXUA 4PZ8A 3NQIA 4ZAIA 1HNWL 1E1OA 4A3JH 3S14B 2F0EA 1KRTA 4IOCA 2N8NA 3S24A 2XTIA 1IHZA 1TWHB 2EYFA 5BN4A 2YTYA 3PO3G 5ISRA 1QB5D 5IGCA 1WTOA 2PNHA 2PI2E 5M3FH 1JB7A 3RZOH 5C4JB 3KOJA 1JJCB 1AN8A 1VQJA 1NNXA 1R9TH 2ZJQA 4YY3Q 5EPLA 5IODA 4LF8Q 2B63H 4XQNA 2SNMA 3EBEA 3W1BA 2JSOA 4JI1L 4IFDJ 4DR2Q 1K8OA 4ZLTF 3GTOB 1EY9A 2K6AA 1SFOH 2E2HB 2EYLA 4G7ZC 3M4YA 4OO1I 1RL2A 1EEID 4KI0A 5C4XB 4LUZA 3A74A 3PF4A 1NJIC 2NVYB 1D2BA 4QL5A 4M8AA 4WORA 2GN5A 5LL6X 2VQEL 1ZXTA 2A6HD 2WKCA 1EQRA 3AYHB 2Y0SG 1EY0A 3H09A 2EE1A 3CKIB 4DV6L 1MD2D 5FO8B 1BCPD 2ALYB 2H5XA 1L0YB 3PO2G 1Q8KA 1Y1VH 1O80A 1WTXA 1C48A 3HOXG 4ILWA 3A54A 1E22A 3FPPA 1YITA 4XTCS 4QMGA 4HMJA 4HN7A 1LACA 1L2FA 3RZOB 4K0KQ 1X9NA 3Q24A 3G7LA 4FF1A 3M4QA 4YCUA 3SK5A 1MBYA 3GTLH 4JV5Q 4JI6L 2RBMA 1WYDA 1SE4A 4EQPA 4JG2A 4GOPB 2E75C 1KDAA 1SFOB 3TSSA 2PMZE 1EZ8A 5CBEE 4WJWA 2OTJA 1XNQL 4AYBE 1DJRD 1NBWA 3KLRA 3K5OA 3NELA 5GAEC 1YIJA 1YEZA 4A93H 2JEBI 3J80i 2WACA 5M5WH 4M1UB 2AWNA 3KF6B 3GQBA 3QJYA 1EQQA 3EN2A 4I65A 1FNWA 2BE5D 4KN4C 4YY3L 2F0QA 1IYVA 1Y1VB 2D2CC 2SEBD 3MA2B 1W6JA 2A1AA 1KAAA 4DR2L 2F0JA 3C2PA 1EUJA 1PZID 4LK1C 3T16A 1XNRQ 3M4OH 3L2PA 3A5ZB 3J81i 2DJGC 3GTLB 2JQOA 1YJNA 4RCOA 3BVMA 1NCVA 1K8AC 1QJOA 1P16A 2D0PA 3SXHA 2NZHA 4DV5Q 1K9MC 3KFUA 1HNZQ 1PZKD 2PYKA 4K2KA 2MUYA 2KHSA 2IX3A 5LHY1 1V1OA 3BDOA 3HOYG 2CFMA 3MXPA 5JEAG 4NDXA 4HJ7A 1N8RC 2DJFC 5M5WB 4HAEA 1AW7A 4FF3A 4HJAA 1JT8A 3QWNA 2K04A 5C44H 4K0KL 4IFDI 4FYDA 4DXGA 4TRDA 2AHOB 3R93A 4ZK9B 4JV5L 1PH6A 1HR0Q 1KNAA 5C6AA 3ERQA 1JR0D 1STGA 3OIPA 3V96A 2EDGA 2B39A 3EROA 4YWLA 1HFNA 3KUPA 1QG7A 2CQAA 1YBYA 1A6XA 3S1RH 5I6WA 2UXDQ 4GLVB 1VQLA 1S72A 2B29A 4DR5L 1G91A 3RLNA 1DXMA 2B2YC 3HOZH 3N52A 4BY1B 2F3VA 1I4PA 1YJWA 1N33Q 5KIXA 1QZHA 1SYEA 4R1JA 4CJ2C 2EY2A 1IXRA 5IP7G 3S1QH 1SDFA 1VQBA 3RNUA 4H7BA 1PHJA 4IUVA 3SE0A 2A8VA 1VF5C 4JBJA 2ZT9C 2DY7A 2BA0A 3Q0AA 2YTVA 2R92B 2RDGA 1E2WA 2MGSA 3FMCA 1YNJC 2MFIA 4C3HG 1G2TA 4A76A 1IL8A 1B2TA 2CHBD 5AJ3Q 2JEAI 2UUCQ 4JI7L 3MZ5A 4MIUA 1TWAH 1JJ2A 1IYUA 2B2WA 1BCPB 3NBHA 1H9SB 2K7VA 2K01A 4GZYC 1EYAA 3D6WA 5IYBH 2EJMA 2A6EC 4TKOB 1HNZL 3T1HQ 1LM0A 4FF4A 3D31A 1ET9A 1X55A 3I91A 2NYZD 2XGTA 4XYQA 1T5XD 1QVCA 2C5CA 3OWFA 1HJPA 4B3RQ 2WFWA 3KLSA 1CM9A 2KOLA 2PW7A 3HOZB 4GLAC 3BZCA 4GS3A 1VF7A 3AFPA 5IWAL 1RF2D 3MXNA 1EFID 4YIJA 1LO5D 3RLOA 5DM63 1BOSA 3S1QB 2JXMB 4BY7G 3ERSX 4GN5A 1JC7A 1GXDC 3G48A 2LXKA 1YNXA 1SRUA 1Y8NB 1ASZA 2LSSA 5CGKA 3PO2H 1HZAA 2MO1A 4PZ7A 4CGYB 3MXUA 3I56A 4X66L 2UXDL 2OT2A 4NB3A 4APVA 3D0FA 4HIDA 1ENFA 5FLMH 3SK8A 2EYPA 4C1NI 3TREA 1N33L 3ZYYX 3FDTA 4RGMA 1KXLA 3IL8A 3R2IA 5FLXE 3LX0A 1OXUA 3CCMA 2NTSA 2I5HA 1X3QA 1H9RA 1YNND 2J4XA 1WI5A 2VZAA 3PV0A 4IN3A 5FJ8G 3CPFA 4F7XA 4OIJA 1PA6A 3CAMA 4A3MG 1TY2A 4UPAA 4YWMA 4HMIA 1I4XA 1UE1A 4DR3Q 1GO3E 4KLKA 2QEJC 4QJFA 1RODA 5A2QE 1N34Q 4DV2Q 2UUCL 1F2MA 4OGQC 4FXDA 3A8KE 4HR7B 4JK1C 3MVVA 3SEBA 5I9OA 1VQNA 4P73A 5M5XB 1W2BA 4DK3C 3KYHC 2QEXA 4DF7A 3I70A 1LTID 4WJ4A 3IFDA 1B9NA 3T1HL 1NE3A 3NTKA 5IGFA 1BO0A 5NUCA 2Q2IA 4OXPA 3OPOA 4RGNA 3H3VH 3GTJH 1STNA 1LTTD 2O5JC 1W3SA 2Z0SA 2UXCQ 2JA6H 4JOIA 1XWEA 5H1SE 1EY6A 3VDYA 3L3OC 3F8TA 1PFBA 3BU2A 1HZBA 3FRPB 4PMBA 1JMCA 4KMUC 1Q8IA 3OOCA 5C0XJ 1SJED 3KF8A 2A68D 4JI8Q 1N36Q 4LUVA 4UY8C 4AH6A 2Z6KC 1VQMA 3TMEA 2QW7A 4ID6A 1ET6A 1HRJA 2WAQE 1QUQA 2EY5A 4R8NA 5KGUA 3OTOQ 1B1ZA 3TS2A 1HNXQ 3RZDH 2Q2TA 3QB3A 5C3WA 2ZTCA 3GTJB 3SK6A 1TWFB 1Q81C 1EZ6A 4YCVA 4X64L 1RHPA 1WTQA 1QVGA 2UUAL 4BBSB 4IUTA 2JA6B 1DGSA 4O42A 3F2UA 2VUMG 1I50H 4PV1C 1E1TA 3MEFA 4DR3L 2M2LA 3KJPA 4BXXG 3KLSX 1VQDA 2R93B 1KRSA 1Z47A 2EJGC 2IL8A 3AFQA 2GVBA 1P8LA 2PZUA 4GNXA 1FGUA 4PMWA 4EVOA 3DUZA 3HOVB 2HUGA 3J80L 3I73A 3S2DH 3WDNA 1TKWB 1IBLQ 1S5FD 1STHA 3K81C 3AMUA 4IO9A 5JEAJ 1VQHA 1C4QA 1HPCA 2XSCA 2IT1A 3VA7A 2CCZA 3JAME 4Y52H 3O13A 4DUYQ 3TRZA 2LXJA 1HXYD 1PH8A 2A73B 1SE2A 2TSSA 3G6JB 1I4RA 1NR2A 2ZTEA 3J81L 1Q1BA 1EOTA 1S3OA 4K5WA 3S16B 1K0SA 3IRBA 3VYTA 4L5RC 1CZGA 2JA8G 4LF6L 2L5TA 4OL7A 5C5MA 1JOQA 1N36L 2NB0A 1U5KA 1CKOA 4Q5VA 1EY8A 1STAA 4BY7H 2RCNA 3T53B 1SNPA 4A3CH 3OTOL 2I5LX 4XYOA 5CBAE 2BOSA 1HNXL 1ZYRD 3UDIA 3CCRA 3M4PA 1OO9B 3CMAA 3S2DB 3CCVA 1VQGA 4JI2Q 2GA4B 2I5MX 4IOAA 2WINB 1IYJB 1BBWA 4AYBG 3SVMA 1C0AA 1O78A 3A7LA 3S2HH 1FVIA 1B53A 4JI5L 3PUZA 2F0SA 4UAIA 4R4QA 3U50C 3CQZB 3AU7A 2EXDA 3HKZB 3J80c 1YVCA 4MZ9A 5IYCG 1MHWC 2OEOA 5FOBB 4LF9L 3GDEA 3MEHA 2FMCA 1L1OC 5JJKA 1Q46A 1LT3D 1ESFA 4H02A 4LAAA 5FJ8H 5C5LA 1HNWQ 4DUZL 4KHVA 1SNQA 2CH4W 1K83B 5M5YB 3S17H 2RHSB 1G8ZD 2B2VC 2JJQA 1IBLL 4BY7B 1TR5A 4DA2A 2IHEA 3M85A 3J81c 2WB1B 3R8BA 4OWXB 4HIKA 2HHHQ 4GNXC 3PUXA 2K33A 1PH7A 5KNBA 4DUYL 1A8VA 1PYBA 5IIFA 3PIO3 1PH1A 2Q8IB 4DV1L 3VYSA 3MFGA 1DOLA 1N32L 1SEBD 3PQIA 2O4XA 1YI2A 3STBC 4FO2A 3NUCA 1K8GA 2IWHA 1PRTB 1TS3A 5AFWA 2VQEQ 4X65L 4K8IA 4QIWE 4DK0A 3J7ZC 4U68A 3KJOA 4IFDH 1GVPA 4ZKBB 4WJ3M 2WKDA 3KDFA 2VQFQ 3NBHB 5G3LD 5JPMC 3G6EA 1F9RA 3GTPH 3S17B 4A3EH 3CF5A 5IT9c 2RCFA 1L0WA 1STBA 4LF5L 4B3MQ 1R4PB 2EXZA 3CW2C 1XPUA 3VR5A 2F0KA 4NPSA 3C46A 3MC0B 1HZ9A 3SK4A 4I7ZC 3RR5A 4JI6Q 4IALA 1VMPA 1SN8A 2VL6A 5KNDA 1EU4A 1X3EA 4A3IG 1RTOA 3FKIG 2KEEA 3I4OA 2F4IA 1I4QA 5CV5A 3U9SA 5ELFA 2HIXA 5JJLA 2HQLA 1V8QA 1SMYD 1UE6A 2VUMH 3JC66 3I4NG 2L12A 1MJCA 4EQOA 4HTHA 4OWTB 4Q0FA 4ODGA 4F88A 3I2ZA 4BXXH 1ZKOA 1IKMA 1WTRA 3I4MG 5CC4A 5I4DA 2HHHL 2EQSA 4RCNA 3HOUG 2EOTA 2LMCB 3T1YL 4IJLA 1ML0D 4A3EB 4A3BG 1EWHA 1MSHA 2F0VA 2ATWA 4JI3L 4JW0A 1W6KA 2KEDA 4ME5A 2PCFB 3A55A 3TZDA 1RTNA 1Y1WH 2DN8A 5DM73 5A2QL 1AE2A 5C3EB 5EGTA 1X65A 3U9OA 2YU9H 1X6OA 1K0RA 5ELOA 3CCEA 1BBUA 3K57A 2RSOA 2PZWA 3EJIA 4DV7Q 4L5SA 1KL9A 1C7YA 2VQFL 3CCUA 4A3JB 2ZM6Q 2KCMA 4FNFA 1DYQA 5I9PA 1J9OA 2FJ2A 5M3FB 2PQEA 3L9AX 3DXJC 4B3ML 1AZQA 5K36G 1JWUD 1VQAA 2F0UA 5LL6S 2KVMA 3BVGA 1R9TB 3F2DA 1QVFA 2B63B 2B2YA 1PFMA 2R7ZG 1JWMD 2XNAC 2F0NA 2M9VA 4ABNA 5C0XG 1A3UA 1NR4A 2E8GA 4C3JG 1PFSA 3RD4A 3BDLA 1ENCA 2JP1A 4K14A 1MJEA 3QOLA 2A74C 1CT1D 1OXVA 5JVG3 3I3CA 4RKLA 1JOOA 1E2VA 3KF8B 4DR5Q 1Y1WB 2EIFA 3QIAA 3CP0A 4CJ1B 2K03A 3I55A 4HIMA 1QE6A 4YWKA 2RDHA 4HJ8A 3TP8A 4ME3A 4BBRG 5L37A 5IYCH 1QUQB 3QOJA 3OMCA 3J81j 1HUMA 4DR4Q 4FF2A 3ULJA 4AIMA 3X3NA 2E2IH 1MIUA 2ID0A 5G3LF 1R4QB 4BA2I 4R4TA 3HKSA 3CMEA 1FNUA 4A3KH 2K5HA 3URYA 5J39A 2R3ZA 4JI7Q 4C56C 2V4DA 4NW2A 3OWEB 4ZRZA 3CCJA 1ZEQX 4P75A 2C35B 1OXTA 4EQNA 1I4GA 1SYFA 3DEPA 3OW2A 2ICEC 3OW7A 1Q7YC 3IFTA 3GV3A 2KCNA 1S40A 1AH9A 5E7NA 2E74C 1KHIA 4DV7L 1MI2A 1YHAA 2EYJA 2ZM6L 3ER0A 1X3GA 3P1HA 4N8FA 1EOVA 2EY6A 2FXQA 4A93B 5IWAQ 4LF7Q 4ZUIA 4KJOA 4DR6Q 2HQEA 4C3IG 1EWIA 3GTQH 3H0GG 1XPRA 1MSGA 2WAQG 1SYBA 1XMOL 3MAQA 1DCZA 2IY5B 3E3XA 2E2IB 5A35A 1NTGA 2Q8RE 2CW0C 1ILPA 3S1MH 1M4VA 1Z9FA 1Q3LA 3HOWG 2KENA 1GUOA 4A3KB 4X66Q 3M4OB 3I4LA 2D62A 1FNVA 4IUPA 2AKWB 4CJ0B 1GHJA 5FO7B 4DR1Q 2JA7G 1GHKA 4QF4A 4RA8A 1TY0A 2FFKB 1CSQA 5GAHC 1LYLA 2KCCA 3E0EA 2E2JH 1PZJD 4DR4L 2DNEA 4LFCL 3K6OA 4DV3Q 2VB2X 2X69A 1IBML 3FKIH 4HIOA 5EKIA 5JJZA 2CWPA 4E6IA 2ENBA 3GTQB 1KD1C 2ZJRA 3PO3H 4KHPQ 5C44B 3I4NH 3M7GA 1GOZA 1PTOC 2CW0D 4CKEA 1F2LA 1GM5A 3T56B 4JI0L 1TWGH 2DNCA 4H44C 4A3BH 3CC4A 2M00A 2WP8J 3J7YW 5KRUA 1C9OA 3ND9A 3S1RB 5CV8A 3BYYB 1GD7A 2ZXRA 1I6VC 1LTRD 1TQOA 2K4KA 1I94Q 1CA5A 3DWPA 4IJHA 3D8GA 1RJTA 4LF7L 4DR6L 5ELCA 1PVOA 3U4VA 1PDQA 4KY6A 2AUJD 2Z6KA 1B50A 5CV6A 1VCIA 3BZKA 4RHSA 1UE7A 1UEBA 4EQ5A 1YNJD 1EIFA 1B70B 4HJ9A 5BN3A 4DV0Q 3NEMA 4A3FG 5JJIA 3HOXH 5DNFA 3PO3B 3NXWA 4A3DG 1QCBD 2F0HA 3R3OA 1F9PA 4QCLA 1PTOD 2NVTH 4TVAB 5K36H 1TWAB 1KDCA 5I6YA 4LFAQ 1CA6A 4DR1L 3J7AV 5D65A 2A6ED 3AQQA 2AQ2B 2R6GA 4XT1B 1NMGA 3PIP3 2R7ZH 3GTKH 4G57A 5C0XH 3DEOA 4FP5D 3QG1A 3IAYA 4DGZA 4P71A 4Y7NH 3KDFB 4A3LG 2XRSD 2AWOA 1FL0A 1V43A 4DKAC 5EPJA 4X64Q 3HRZC 2FINB 3K5MA 4DV3L 2MPMA 1LTLA 3KLWA 1SLJA 1J6QA 1SNOA 2UUAQ 2B2TC 3QO2A 4JCVE 2C9OA 2JA5G 1RDPD 1WD1A 4XQJA 1CQFA 1C8CA 4KHPL 5LMNW 4TSSA 2Y0SB 3V05A 2Q2HA 1UE5A 4KN7C 2QGQA 1WCMG 2QF7A 2NN6G 3PO2B 1UEAB 4EGVA 4A3GG 4R8IA 2NZOA 4XQQA 2OCEA 4R9WA 2Z1CA 5C4HA 3HOXB 5LMUL 2L55A 1F77A 4UHVA 4XDXA 2KBNA 3NE5B 4PG3A 2PI2A 3A5UA 4BWGB 3DHQA 3OIQA 1CZWA 2NVTB 1XXGA 4K5XA 4DV4Q 1EIHA 4QUCA 2KUMA 2IW3A 2K05A 3Q8DA 4LW1A 1I94L 3ZJYC 3GTKB 1Q12A 5IOCA 2PQAA 3PSIA 4Y7NB 1HZCA 5M3MG 3CHBD 1D5ZC 1QNKA 4MHEA 4N8X1 3V2TA 1XJVA 5GADC 3HOYH 2EY1A 1EWCA 4DV0L 4LF6Q 5JEAH 1EU3A 1I3QH 4OONA 1X3PA 5BR8L 1A0IA 4ULLA 2QDBA 3H0GH 1PMRA 3K0XA 4L6TB 5EKLA 2F4VQ 1X32A 2F1MA 3H94A 3NSWA 4LFAL 4O0AA 2EYMA 3UDGA 3EIVA 4N9PA 2VY3A 2Z4HA 2O5IC 2K28A 3P75A 1CTMA 1VQKA 1JOKA 2XVSA 1WTPA 1II3A 4IUQA 3E0JA 3TEHB 2IPKD 1L1OA 1PTOH 2JK8A 5F2DA 3C1EA 1XTCD 2A69C 2CH4A 4JI5Q 5C4XG 5IP9G 2QA4A 1A2UA 1V1QA 2JA7H 3FP9A 3FHWA 4S3SA 4IURA 2ZJPA 3MWYW 4QGUA 2NVXH 2B2VA 1TIID 2XWJB 1Q86C 5IP7H 2V1CC 4LF9Q 4NXMQ 1J8IA 1GUWA 4RG1A 1BUVT 5DEHA 1A15A 5KYIA 1AZPA 3HOYB 4DUZQ 1XX8A 3K80C 1K3RA 4DAYA 3NK9A 3W5OA 4QB4A 4AQYQ 3GP7A 4K2LA 3S1NH 4C3HH 2K50A 2J0TD 3D6CA 1X54A 2L15A 4F8MA 3TBIB 4DV4L 2NZ1D 3CC2A 3S15H 4RH6A 4V190 1PTOF 3K58A 3RZDB 1KLGD 3NPPA 3JAMi 4JVZA 4DV1Q 2Z9HA 2A19A 5CR3A 1U4PA 4P2CB 1PTOB 5E1FA 4X6AH 2RDFA 1N32Q 4NKLA 1B3AA 2BH8A 2B2UC 5CV7A 4ALPA 1I50B 2HCCA 2EZVA 4CBVA 1G291 2P5ZX 4X65Q 3A0JA 1Q82C 5K5PA 3VYRA 1V1PA 2F4VL 1PYSB 2FHTA 3I72A 3OMGA 1SJHD 3W1GA 3WWVA 3HKZE 1NUCA 3GD7A 2NVQH 4KJNA 2XIWA 3P7JA 2VS1A 1DONA 1PH2A 3DWQA 1Y1VG 2RA4A 4POFA 1G6PA 5IYDG 2RVLA 4A3FH 4C3HB 1PH9A 4LF5Q 3M3YH 2A5HA 1H9JA 4PZ6A 1EIGA 4GOPC 5HURA 4XXEA 5DLQE 3SR1A 1U4RA 1WFQA 1WD0A 3T13A 4L5QA 2EYOA 3TS0A 1XMQL 4DR7L 3R2TA 2WB1E 4IQZA 3K59A 1EEFD 5C0XI 1DM0B 4IZ8A 1IKLA 1CSPA 1OXXK 2L11A 4NXML 3BVZA 5T1GA 5TSSA 4A3LH 1HHVA 3NENA 4GKKQ 2I46A 3UDXA 1SE3A 1ONLA 5CMDA 2CWAA 3CCLA 3E9HA 1Q90A 4A3MH 3F2CA 1O7YA 5FKAC 4AQYL 1S5DD 3GTGH 2FMMA 4DFAA 4CDCC 3SHLA 2KHIA 3M9BA 1EFWA 2JA5H 1SMXA 4F87A 1RCVD 2ES2A 2LY7A 1DZ1A 3OHXC 2HDLA 2NVQB 2JYOA 2F0DA 3FPUB 1I5FA 3T1YQ 1WCMH 2K5NA 2NN6H 5EBDA 1BVSA 2L9HA 3Q6SA 2LKVA 1HTLD 3KBXA 3NBIA 4JI3Q 3S2HB 4ZQ3A 1HQMC 1WTHA 1YJ9A 3TDQA 1E7ZA 2UUBL 1U4MA 5GAGC 2K52A 1UWVA 4BY1G 1CUKA 2Z6BA 3J7A5 1VMCA 4FVMA 2F3IA 1SAPA 2JN4A 5M3MH 2H1EA 4KV6A 4POGA 1GUTA 2F0OA 4QY7A 1S4ZA 4A3MB 4GLXA 2OQ0A 3A8IE 4MTKA 2ASBA 2AQ1B 3HP3A 5CYUA 1I6HH 3S14H 2R92G 2CKZB 3CD6A 3K5NA 1CHQD 4X3TA 1LT5D 4KD3A 1TWHH 1DOKA 2OWOA 1RD9D 3I90A 2VB3X 4J1MA 1JWSD 3MXNB 1JQYD 2F0WA 4H13C 3N6RA 2G5DA 4KKTA 4ZCKA 4LFBL 5J22A 1IW7C 1UAPA 1G6ZA 1H9MA 3K8AA 2UU9Q 3BDCA 3J7AF 5JAVA 1OXSC 1FD7D 1Y14B 4JBWA 3WOFA 2WV6D 3STBD 1GUGA 4GKKL 4JYAQ 4MN3A 3RUZA 3GTOH 3VR4A 4DAVA 3RN2A 2E2HH 4LNQA 4K8JA 5J3BA 3HOZG 1STYA 1GUSA 5IP9H 5HGQA 2NVYH 4OIKA 2HDMA 3L7ZC 1U0LA 5FLXL 1CFMA 4ZYSA 2KCTA 1ESRA 2A6HC 3GTPB 3D4RA 1I6HB 4TQUS 1TS5A 2KQ3A 1BCPC 2K5VA 3RLFA 3H15A 4HSPA 1SNDA 4WRDA 4B9XA 2QDLA 3WOEA 5GROA 5EBCA 4KKUA 1XPOA 1A3TA 1DOMA 1IW7D 3NQTA 4LF4L 1B44D 2PW5A 5I2XA 5IYBG 4JC0A 3E6ZX 5ELBA 3K7AH 5IE8A 1ICFB 1A63A 1GKHA 3MTSA 1TWCH 3C3LA 3K5LA 1CHPD 5HY6A 2BDOA 5EPKA 4OEMB 3PIOA 2JA8H 5E3FA 3AB9A 2VUMB 2QCPX 5T1IA 2N3SA 2AMCB 1XMOQ 3FVQA 3OSOA 4ZUJA 3F2BA 2ZXOA 3LGJA 1LTSD 1U9RA 2UXBQ 1KIXA 4B9WA 2EVBA 1B9MA 1OTCA 2PQAB 1VQPA 3CRKC 4Z9CB 3RMHA 1VQOA 2BE5C 4B3SL 1JB3A 5IYDH 2UU9L 4JI4Q 3HZXA 3TP5A 4K6LA 4YHHL 4JYAL 5FLXc 2N55A 4FXKC 5FLMG 5JVH3 1V9PA 2F0MA 3NTHA 2MHVA 1VQ6A 1VQEA 2YU9B 2E76C 2PO4A 2K5DA 2YV5A 4IUNA 1EQTA 3LNNA 2Z4IA 2RHQB 1VS0A 1FJGL 3K7AB 5D3DA 4JPBW 4J6HA 4LFCQ 3VYUA 1A3VA 1TWCB 3K0YA 5LMNQ 1SE8A 1IBMQ 4XIGS 1WVLA 2JA8B 2K1BA 2I0QA 2F03A 3J80E 4PMCA 1J5EQ 1EY7A 2ZTDA 1EY4A 5JOBA 4KKSA 1L1OB 3PUVA 5E4WC 4G7HC 1LTAD 1LTBD 2Q2UA 3E9IA 4YCWA 1SXTA 1SROA 2RSNA 3B6YA 2O2LD 4B3TQ 4JI0Q 1LT4D 2CQOA 1Z7TA 4DXFA 1WTWA 5BN5A 4LF8L 1HQRD 2NN6I 4LWCA 1TT2A 4UP9A 2PMZB 4P74A 4KD4A 3PMFA 1PFNA 5M9OA 4AYBB 3J81E 1QWYA 2F3WA 4IPDA 2PNRC 3M7NA 4GNXB 1VQFA 2J7ZA 3AEVA 4DAYB 1BNZA 2L1BA 3MHBA 2DY8A 3MFYA 4L5TA 4BBSG 3JAML 3I8ZA 4BY1H 1E24A 2JA6G 2EPBA 4DN4M 1IBKQ 2R93G 2UXBL 4DNIA 2Q8TA 2JE6I 3SDZA 5KNCA 4DK6C 1PH3A 1Q1EA 1STEA 3Q22A 2R92H 3HOVG 3GV6A 1KTKA 4JI4L 1KLUD 3U4ZA 1IZ6A 1CI3M 3PGZA 1T9HA 3H3VC 1S5BD 4K6DA 4QUFA 1BKBA 5IT9E 1CQVA 2B2TA 1V1PB 1WTVA 1MGSA 2BA1A 4OWWB 1H95A 2N49A 1A2TA 4LMQD 5I2YA 4IPGA 4DK1A 1AP0A 3A56A 4A3IH 5EAYA 4DNTB 5LMNL 1PLFA 3X3MA 1B8AA 1MKHA 2B8GA 3BS1A 1L0XB 1J5EL 1LV9A 2B8FA 1FYCA 3BYTB 4H0LC 1K8MA 4L8JA 3ULLA 3MXGA 2RKSA 4J8QA 1D6EC 4KY7A 2QKIC 2K32A 1VQCA 1JE5A 1SNMA 3I4MH 3D4DA 3HOUH 5CORA 4B3TL 1JCKB 2X6LA 3S1MB 2CVRA 5LMUQ 3EA6A 3TQYA 3JAMc 1NMFA 4G7OC 1BCPF 4U673 4GKJQ 4OX9Q 4DNRB 3HS0C 4OO1G 1BR9A 2BDNA 1XNRL 2R7DA 4X3SA 4KK7A 2F0LA 1KC8C 4G4KA 2HT1A 2R7FA 2ZXPA 3P20A 4BA1I 4DV5L 2E2JB 4CKBA 3HKZG 5ELNA 4A3IB 3HFZB 4A75A 1HA6A 1IBKL 2G9DA 4DU9A 1EIYB 2BH2A 1SYDA 1EL0A 3HEJA 1EYDA 1CKNA 3FKIB 3CCQA 2XRQD 2TMPA 1F2ZA 3CU7A 1HCZA 3OYYA 1YNNC 1QNUA 4GN4B 5BR8Q 5EQ0A 4MTNA 1PH4A 3I4NB 1D8LA 5EJWA 4LUOA 2KJXA 1JE4A 4LJZC 1EYCA 1F2YA 1QOHA 1VDZA 2DUDA 2NTTA 2NWGA 4RAUC 5EKKA 3I4MB 1B7YB 1Y69U 3HOUB 2WB1G 1BXTA 1TWGB 4A3CG 2Y0SE 2L4NA 2L0CA 4A3BB 3DWAA 5M5XH 1HR0L 2BCOA 5HGTA 4C3JH 4FXGC 3T51B 2F0IA 1H9KA 4J15A 2ICIA 4DAPA 2D9UA 4JBMA 2QILA 1D7QA 1S5ED 2VXWA 4RGTA 3ITPA 5C3XA 4DPGA 1QZGA 4KHZA 3KK7A 1SBBB 5D3IB 1LUZA 4BBRH 2N88A 1E3PA 5J1ZA 1VQ8A 1LT6D 4B08A 3DM3A 2KHJA 4CDDC 1M90C 1LTGD 3GTMH 5FO9B 5COYA 3PCOB 1ASYA 2HIVA 4GKJL 5IGEA 2PPBC 4OX9L 3UDFA 3VR2A 4EX5A 2A68C 2IX0A 1SYCA 3U58A 1TS2A 5AJ3L 1NSNS 4HJ5A 4BS9A 1VQIA 2E2DC 4FDBA 1JORA 4OELB 2R7ZB 2F0TA 1IL2A 2B2UA 4C3JB 1SSOA 2OTLA 4O1NA 2F52A 4PQXA 1PRTC 4X3UA 1PYWD 1BDOA 3TZUA 1TU2B 1XYIA 2B3GA 3VA5A 2LFNA 4RMFA 4RFBA 1GJXA 1TWFH 2AQ3B 2B2WC 4B3RL 4C2MH 4O2DA 1X56A 3SGIA 1YZ6A 1PV4A 4BBSH 4C3IH 3BZDB 1M8AA 2XWBB 4BBRB 1SR3A 3CXCA 1D5XC 4IFDG 2N78A 3UE0A 4GOPA 2R93H 1NY4A 3GTMB 3L0OA 4IPCA 2XN9C 3CC7A 1N9WA 3NWSA 4A3EG 1BBXC 2AUKA 1E0BA 3HOVH 3HOWH 3GO5A 1M1KC 4R4OA 1QILA 4XT3B 1KQSA 4CHTB 2SNSA 5GQOA 3NP8A 3VR6A 3KF6A 1YHQA 1HR0W 1CKMA 2D0OA 1GUNA 1XMQQ 4DR7Q 1EYGA 1PRTD 2YYZA 4X3KA 1TS4A 4X62Q 5C3EG 1YHBA 4UP7A 3W2DA 4NP5A 4RHRA 3ND8A 3TP6A 2F0GA 1D1IA 2K14A 3PIPA 4A3JG 2MO0A 3QR8A 4C2MB 3LWUA 5JPNC 1I3QB 3T4AC 1WJJA 2K75A 3ULPA 3S16H 3DLLA 1FR3A 1VQ9A 4C3IB 1HTPA 3H0GB 4R4CA 2F0FA 2WAQB 3UE1A 3NTIA 3UI2A 4V0BA 1A62A 1ICWA 4HCSA 5M3FG 3BG3A 3IKJA 4HSVA 4IPHA 2D5DA 5IY0A 1KDBA 3TP7A 1N34L 5C4ZA 4DV2L 2YTXA 1ILQA 4PNYA 3EQLC 4QQBX 2IJ0A 3I7FA 2E5LQ 3G4SA 5IGBA 2B63G 1Y8PB 4RWSC 3E5SA 3HOWB 2SOBA 4K5VA 2OXPA 3TN2A 2LS01 4UDUC 3EFXD 1ZYRC 2A69D 4NXNQ 3H6MA 1F9QA 4OO1H 2OF1A 2UUBQ 3BJUA 2WIIB 1Y1WG 2JA7B 1T5EA 2R61A 1SNCA 1BQQT 1K28A 2JA9A 2UXCL 3PUWA 2NVXB 4R4IA 3CQZH 2NUCA 4DAMA 3NHHA 4L63B 4RGOS 1TVXA 1NAPA 1CK1A 2G9HD 3RN5A 1G2SA 1UNSA 3S1NB 4JOIC 4UP8A 4JI8L 4A3DH 2X6GA 1K83H 4CDEC 5M5YH 5ELEA 2H4OA 3A7AB 3S15B 2VNUD 1O7LA 2IX1A 1JJGA 1G51A 2K5WA 3CPWA 1ENAA 3DM1A 2OQKA 1BF4A 1U4LA 5FK9C 1VQ4A 1HH2P 1UUPA 4LFBQ 4X62L 2MP1A 1XTDA 3H91A 5CV9A 2VW9A 1VQ5A 1AE3A 3A8JE 1D1KA 3D3RA 3CCSA 4RKBA 3Q23A 4N9TA 1Z6HA 1HA5A 1EY5A 4A93G 5KYLA 5IT9L 1S5CD 1H9SA 4GN3B 4KY5A 1HFGA 4MNOA 4WFN3 2EYHA 3ONAB 1B3QA 2E5LL 4HEDA 4A3GH 2EJFC 3EVQA 1I4HA 4A3FB 4A3DB 2K5QA 3VR3A 1DD2A 1O7IA 3M3YB 5KEEA
chains in the Genus database with same CATH topology
1O7ZA 4ZKCB 1LABA 2NBFA 3W3AA 3S9WA 4HCEA 1KABA 3KBGA 5IGGA 5ELDA 1RKNA 1FGBD 5CV4A 1E2ZA 1PRTF 5IGDA 3HGBA 1SYGA 2KA7A 3PUYA 1D5MC 5DAUA 3DMUA 4IUUA 2MJ8A 3NWTA 3GTGB 1AEXA 3CRLC 1JICA 1HUNA 4OHJA 2JA5B 3LWEA 2KECA 4C1NK 2RQXA 1SMYC 3FEWX 2F0PA 2PZTA 1WCMB 1AFPA 4A3GB 4KTAA 1B4OA 4NMZA 3HG9A 1Y8OB 5D14A 1F9SA 1LLRD 2Z8LA 4CKCA 3D4WA 2SDFA 4QIWB 2HCIA 5M3MB 1EQVA 1KNEA 3C1FA 5E4XA 2I07B 1PXUA 3NQIA 4ZAIA 3S14B 2F0EA 5BN4A 1IHZA 1TWHB 2EYFA 5ISRA 1QB5D 5IGCA 1WTOA 5C4JB 1AN8A 5EPLA 5IODA 4XQNA 2SNMA 2JSOA 4IFDJ 1K8OA 4ZLTF 3GTOB 1EY9A 2K6AA 2E2HB 2EYLA 4G7ZC 3M4YA 4OO1I 1EEID 4KI0A 5C4XB 2NVYB 1D2BA 4M8AA 4WORA 5LL6X 1ZXTA 2A6HD 2WKCA 1EY0A 3H09A 2EE1A 3CKIB 1MD2D 5FO8B 1BCPD 1L0YB 1O80A 1WTXA 1C48A 4ILWA 3A54A 3FPPA 4XTCS 4QMGA 4HMJA 4HN7A 1LACA 3RZOB 3Q24A 3G7LA 4FF1A 3SK5A 1MBYA 2RBMA 1SE4A 4EQPA 2E75C 1KDAA 1SFOB 3TSSA 1EZ8A 5CBEE 4WJWA 1DJRD 3KLRA 3K5OA 2JEBI 2WACA 4M1UB 2AWNA 3GQBA 3QJYA 4I65A 1FNWA 2BE5D 4KN4C 2F0QA 1IYVA 1Y1VB 2D2CC 2SEBD 3MA2B 1W6JA 1KAAA 2F0JA 3C2PA 1PZID 4LK1C 3T16A 3GTLB 4RCOA 3BVMA 1NCVA 1QJOA 3SXHA 1PZKD 2PYKA 4K2KA 2MUYA 2KHSA 2IX3A 5LHY1 1V1OA 3BDOA 3MXPA 5JEAG 4NDXA 5M5WB 4HAEA 1AW7A 4FF3A 3QWNA 2K04A 4IFDI 4FYDA 4DXGA 4TRDA 4ZK9B 3R93A 1KNAA 5C6AA 3ERQA 1JR0D 1STGA 3OIPA 3V96A 2EDGA 2B39A 3EROA 1HFNA 3KUPA 1QG7A 2CQAA 1A6XA 5I6WA 1G91A 1DXMA 2B2YC 3N52A 4BY1B 2F3VA 1I4PA 5KIXA 1SYEA 4CJ2C 2EY2A 1SDFA 4H7BA 4IUVA 3SE0A 1VF5C 2ZT9C 2DY7A 2BA0A 3Q0AA 2R92B 2RDGA 1E2WA 2MGSA 3FMCA 1YNJC 4C3HG 1G2TA 1IL8A 1B2TA 2CHBD 2JEAI 3MZ5A 4MIUA 1IYUA 2B2WA 1BCPB 1H9SB 3NBHA 2K7VA 2K01A 4GZYC 1EYAA 3D6WA 2EJMA 2A6EC 4TKOB 4FF4A 3D31A 1ET9A 3I91A 2NYZD 4XYQA 1T5XD 2C5CA 3OWFA 3HOZB 3KLSA 1CM9A 2KOLA 2PW7A 1VF7A 1RF2D 3MXNA 1EFID 4YIJA 1LO5D 5DM63 1BOSA 3S1QB 2JXMB 1JC7A 1GXDC 1Y8NB 5CGKA 4CGYB 3MXUA 2OT2A 1ENFA 3SK8A 2EYPA 4C1NI 3ZYYX 3FDTA 4RGMA 3IL8A 3R2IA 5FLXE 3LX0A 1OXUA 2NTSA 1X3QA 1H9RA 1YNND 2J4XA 3PV0A 4IN3A 4F7XA 4OIJA 1TY2A 4HMIA 1I4XA 2QEJC 1RODA 5A2QE 4FXDA 1F2MA 4OGQC 3A8KE 4HR7B 4JK1C 3MVVA 3SEBA 5I9OA 5M5XB 4DF7A 3I70A 1LTID 3IFDA 1B9NA 3NTKA 5IGFA 1BO0A 5NUCA 3OPOA 4RGNA 1STNA 1LTTD 2O5JC 1XWEA 1EY6A 3L3OC 1PFBA 3FRPB 4PMBA 4KMUC 1Q8IA 3OOCA 5C0XJ 1SJED 3KF8A 2A68D 3TMEA 4ID6A 1ET6A 1HRJA 2EY5A 4R8NA 5KGUA 1B1ZA 3QB3A 5C3WA 3GTJB 3SK6A 1TWFB 1EZ6A 1RHPA 1WTQA 4BBSB 4IUTA 2JA6B 4O42A 3F2UA 4PV1C 2M2LA 3KLSX 2R93B 1Z47A 2EJGC 2IL8A 2PZUA 4PMWA 4EVOA 3DUZA 3HOVB 2HUGA 3J80L 3I73A 3WDNA 1TKWB 1S5FD 1STHA 3AMUA 5JEAJ 3VA7A 1C4QA 1HPCA 2XSCA 2IT1A 3JAME 3O13A 1HXYD 2A73B 1SE2A 2TSSA 3G6JB 1I4RA 1NR2A 3J81L 1Q1BA 1EOTA 4K5WA 3S16B 3VYTA 1CZGA 2L5TA 4OL7A 5C5MA 1JOQA 2NB0A 4Q5VA 1EY8A 1STAA 3T53B 1SNPA 5CBAE 4XYOA 2BOSA 1ZYRD 1OO9B 3S2DB 2GA4B 2WINB 3SVMA 1O78A 3A7LA 1B53A 3PUZA 2F0SA 4UAIA 3CQZB 3AU7A 3HKZB 2OEOA 5FOBB 3MEHA 2FMCA 1LT3D 1ESFA 4LAAA 5C5LA 4KHVA 1SNQA 1K83B 5M5YB 1G8ZD 2B2VC 4BY7B 1TR5A 4DA2A 3M85A 2WB1B 3R8BA 3PUXA 2K33A 5KNBA 5IIFA 3PIO3 2Q8IB 3VYSA 3MFGA 1DOLA 1SEBD 2O4XA 4FO2A 3NUCA 2IWHA 1PRTB 5AFWA 1TS3A 4K8IA 4DK0A 4U68A 4IFDH 4ZKBB 2WKDA 5G3LD 5JPMC 1F9RA 3S17B 1STBA 1R4PB 2EXZA 3VR5A 2F0KA 3C46A 3MC0B 3SK4A 4I7ZC 4IALA 1VMPA 5KNDA 1EU4A 1RTOA 2KEEA 2F4IA 1I4QA 5CV5A 3U9SA 5ELFA 1V8QA 1SMYD 2L12A 4EQOA 4HTHA 4Q0FA 4ODGA 4F88A 1ZKOA 1IKMA 1WTRA 5CC4A 5I4DA 4RCNA 2EOTA 2LMCB 1ML0D 4A3EB 1EWHA 1MSHA 2F0VA 1W6KA 2KEDA 4ME5A 2PCFB 3A55A 3TZDA 1RTNA 2DN8A 5DM73 5A2QL 5C3EB 5EGTA 3U9OA 3K57A 2RSOA 2PZWA 3EJIA 4A3JB 4FNFA 1DYQA 5I9PA 1J9OA 2FJ2A 5M3FB 2PQEA 3L9AX 3DXJC 1AZQA 5K36G 1JWUD 2F0UA 5LL6S 2KVMA 3BVGA 1R9TB 2B63B 2B2YA 1PFMA 1JWMD 2XNAC 2F0NA 2M9VA 4ABNA 5C0XG 1A3UA 1NR4A 4C3JG 3RD4A 3BDLA 1ENCA 2JP1A 4K14A 3QOLA 2A74C 1CT1D 1OXVA 5JVG3 3I3CA 4RKLA 1JOOA 1E2VA 1Y1WB 3QIAA 4CJ1B 2K03A 1QE6A 2RDHA 3TP8A 3QOJA 3OMCA 1HUMA 4FF2A 3X3NA 2ID0A 5G3LF 1R4QB 4BA2I 1FNUA 3URYA 5J39A 2R3ZA 4C56C 2V4DA 4NW2A 3OWEB 4ZRZA 1ZEQX 4EQNA 1OXTA 1I4GA 1SYFA 3DEPA 2ICEC 3OW7A 3IFTA 3GV3A 2KCNA 2E74C 1MI2A 2EYJA 3P1HA 2EY6A 4A93B 4ZUIA 4KJOA 2HQEA 4C3IG 1MSGA 1SYBA 3MAQA 1DCZA 2E2IB 5A35A 2Q8RE 2CW0C 1ILPA 1M4VA 1Q3LA 1GUOA 4A3KB 3M4OB 3I4LA 2D62A 1FNVA 4IUPA 4CJ0B 1GHJA 5FO7B 1GHKA 4QF4A 4RA8A 1TY0A 2FFKB 2KCCA 1PZJD 2DNEA 3K6OA 2VB2X 2X69A 5EKIA 5JJZA 4E6IA 2ENBA 3GTQB 5C44B 3M7GA 1GOZA 1PTOC 2CW0D 4CKEA 1F2LA 3T56B 2DNCA 4H44C 2M00A 2WP8J 3J7YW 5KRUA 3ND9A 3S1RB 5CV8A 3BYYB 2ZXRA 1I6VC 1LTRD 1TQOA 1CA5A 3DWPA 3D8GA 1RJTA 5ELCA 1PDQA 4KY6A 2AUJD 1B50A 5CV6A 1VCIA 4RHSA 1YNJD 5BN3A 5DNFA 3PO3B 3NXWA 1QCBD 2F0HA 3R3OA 1F9PA 4QCLA 1PTOD 5K36H 1TWAB 1KDCA 5I6YA 1CA6A 3J7AV 5D65A 2A6ED 2AQ2B 2R6GA 4XT1B 3PIP3 4G57A 5C0XH 3DEOA 4FP5D 3QG1A 3IAYA 4DGZA 2XRSD 2AWOA 1V43A 5EPJA 3HRZC 2FINB 3K5MA 2MPMA 1SNOA 2B2TC 3QO2A 2C9OA 1RDPD 1WD1A 4XQJA 1CQFA 1C8CA 4TSSA 2Y0SB 3V05A 4KN7C 2QF7A 2NN6G 3PO2B 1UEAB 4EGVA 4R8IA 4XQQA 5C4HA 4R9WA 2Z1CA 3HOXB 2L55A 1F77A 4XDXA 3NE5B 4BWGB 3DHQA 3OIQA 1CZWA 2NVTB 1XXGA 4K5XA 1EIHA 4QUCA 2KUMA 2IW3A 2K05A 3GTKB 1Q12A 5IOCA 4Y7NB 3CHBD 1D5ZC 1QNKA 4MHEA 3V2TA 2EY1A 1EWCA 5JEAH 1EU3A 1X3PA 4ULLA 2QDBA 1PMRA 4L6TB 5EKLA 1X32A 2F1MA 3H94A 3NSWA 2EYMA 4N9PA 2Z4HA 2O5IC 2K28A 3P75A 1CTMA 1JOKA 2XVSA 1WTPA 1II3A 4IUQA 3E0JA 2IPKD 1PTOH 5F2DA 3C1EA 1XTCD 2A69C 1A2UA 4S3SA 4IURA 3MWYW 2B2VA 1TIID 2XWJB 1J8IA 1GUWA 1BUVT 5DEHA 1A15A 5KYIA 1AZPA 3HOYB 1XX8A 4DAYA 3NK9A 4QB4A 3GP7A 4K2LA 2J0TD 3D6CA 4F8MA 3TBIB 2NZ1D 4RH6A 4V190 1PTOF 3K58A 3RZDB 1KLGD 3NPPA 5CR3A 1U4PA 4P2CB 1PTOB 5E1FA 2RDFA 4NKLA 1B3AA 2B2UC 5CV7A 2EZVA 1I50B 2HCCA 4CBVA 1G291 5K5PA 3VYRA 1V1PA 2FHTA 3I72A 3OMGA 1SJHD 1NUCA 3GD7A 4KJNA 2XIWA 3P7JA 1DONA 3DWQA 2RA4A 2RVLA 4C3HB 2A5HA 1H9JA 1EIGA 5HURA 4XXEA 3SR1A 1U4RA 1WD0A 3T13A 2EYOA 3R2TA 4IQZA 3K59A 1EEFD 5C0XI 1DM0B 4IZ8A 1IKLA 1OXXK 2L11A 3BVZA 5T1GA 5TSSA 1HHVA 2I46A 1SE3A 1ONLA 5CMDA 1Q90A 1O7YA 5FKAC 1S5DD 2FMMA 4DFAA 3SHLA 4F87A 1RCVD 2LY7A 1DZ1A 3OHXC 2HDLA 2NVQB 2JYOA 2F0DA 3FPUB 2NN6H 5EBDA 2L9HA 3Q6SA 2LKVA 1HTLD 3KBXA 3NBIA 3S2HB 4ZQ3A 1HQMC 3TDQA 1U4MA 1VMCA 4FVMA 1SAPA 2H1EA 4KV6A 1GUTA 2F0OA 1S4ZA 4A3MB 3A8IE 2AQ1B 3HP3A 5CYUA 3K5NA 1CHQD 4X3TA 1LT5D 4KD3A 1DOKA 1RD9D 3I90A 2VB3X 4J1MA 1JWSD 1JQYD 2F0WA 4H13C 3N6RA 4KKTA 5J22A 1IW7C 1UAPA 1G6ZA 1H9MA 3J7AF 3BDCA 5JAVA 1OXSC 1FD7D 4JBWA 3WOFA 2WV6D 1GUGA 4MN3A 3RUZA 3VR4A 4DAVA 4K8JA 1STYA 1GUSA 4OIKA 2HDMA 3L7ZC 5FLXL 1CFMA 4ZYSA 1ESRA 2A6HC 3GTPB 3D4RA 1I6HB 4TQUS 1TS5A 2KQ3A 1BCPC 3RLFA 4HSPA 1SNDA 4WRDA 4B9XA 3WOEA 5EBCA 4KKUA 1A3TA 1DOMA 1IW7D 3NQTA 1B44D 2PW5A 5I2XA 3E6ZX 5ELBA 3C3LA 3MTSA 3K5LA 1CHPD 2BDOA 5EPKA 5E3FA 3AB9A 2VUMB 2QCPX 5T1IA 3FVQA 3OSOA 4ZUJA 2ZXOA 1LTSD 1U9RA 4B9WA 2EVBA 1B9MA 3CRKC 4Z9CB 3RMHA 2BE5C 1JB3A 3HZXA 3TP5A 4K6LA 2N55A 4FXKC 5JVH3 2F0MA 3NTHA 2MHVA 2YU9B 2E76C 2PO4A 2K5DA 4IUNA 1EQTA 3LNNA 2Z4IA 3K7AB 5D3DA 4J6HA 3VYUA 1A3VA 1TWCB 3K0YA 4XIGS 1WVLA 2JA8B 2K1BA 2F03A 3J80E 4PMCA 1EY7A 1EY4A 5JOBA 4KKSA 3PUVA 5E4WC 4G7HC 1LTAD 1LTBD 1SXTA 2RSNA 2O2LD 1LT4D 1Z7TA 4DXFA 1WTWA 5BN5A 1HQRD 2NN6I 1TT2A 2PMZB 4KD4A 3PMFA 1PFNA 5M9OA 4AYBB 3J81E 1QWYA 2F3WA 2PNRC 3M7NA 2J7ZA 1BNZA 2L1BA 3MHBA 2DY8A 3MFYA 3JAML 3I8ZA 2EPBA 4DN4M 2Q8TA 2JE6I 3SDZA 5KNCA 1Q1EA 1STEA 3Q22A 3GV6A 1KTKA 1KLUD 1CI3M 3H3VC 1S5BD 4K6DA 4QUFA 5IT9E 1CQVA 2B2TA 1V1PB 1WTVA 1MGSA 2BA1A 1A2TA 4LMQD 5I2YA 4DK1A 1AP0A 3A56A 4DNTB 1PLFA 3X3MA 3BS1A 2B8GA 1L0XB 1LV9A 2B8FA 1FYCA 3BYTB 4H0LC 1K8MA 4L8JA 3MXGA 2RKSA 4J8QA 1D6EC 4KY7A 2QKIC 2K32A 1SNMA 3D4DA 5CORA 1JCKB 2X6LA 3S1MB 2CVRA 3EA6A 4G7OC 1BCPF 4U673 4DNRB 3HS0C 4OO1G 1BR9A 2BDNA 4X3SA 4KK7A 2F0LA 4G4KA 3P20A 2ZXPA 4BA1I 2E2JB 4CKBA 4A3IB 1HA6A 2G9DA 4DU9A 1EL0A 1SYDA 3HEJA 1EYDA 3FKIB 2XRQD 2TMPA 1F2ZA 3CU7A 1HCZA 1YNNC 1QNUA 5EQ0A 3I4NB 5EJWA 2KJXA 1JE4A 4LJZC 1EYCA 1F2YA 1QOHA 1VDZA 2NTTA 2NWGA 4RAUC 5EKKA 3I4MB 3HOUB 1Y69U 1BXTA 1TWGB 2L4NA 2L0CA 4A3BB 3DWAA 2BCOA 5HGTA 4FXGC 3T51B 2F0IA 1H9KA 2ICIA 4DAPA 2D9UA 2QILA 1S5ED 2VXWA 4RGTA 3ITPA 5C3XA 4KHZA 3KK7A 1SBBB 5D3IB 2N88A 5J1ZA 1LT6D 4B08A 1LTGD 5FO9B 5COYA 5IGEA 2PPBC 3VR2A 2A68C 2IX0A 1SYCA 1TS2A 1NSNS 4BS9A 2E2DC 1JORA 2R7ZB 2F0TA 2B2UA 4C3JB 1SSOA 4O1NA 4PQXA 1PRTC 4X3UA 1PYWD 1BDOA 3TZUA 1TU2B 1XYIA 3VA5A 2LFNA 4RFBA 1GJXA 2AQ3B 2B2WC 3BZDB 1M8AA 2XWBB 4BBRB 1D5XC 4IFDG 3GTMB 2XN9C 3NWSA 1BBXC 2AUKA 1E0BA 3GO5A 1QILA 4XT3B 4CHTB 2SNSA 3VR6A 3NP8A 1GUNA 1PRTD 2YYZA 4X3KA 1TS4A 3W2DA 4RHRA 4NP5A 3ND8A 3TP6A 2F0GA 1D1IA 5JPNC 4C2MB 3LWUA 1I3QB 3T4AC 1FR3A 4C3IB 1HTPA 3H0GB 2F0FA 2WAQB 3NTIA 3UI2A 4V0BA 1ICWA 4HCSA 3BG3A 3IKJA 4HSVA 2D5DA 1KDBA 3TP7A 5C4ZA 1ILQA 4PNYA 3EQLC 2IJ0A 5IGBA 1Y8PB 4RWSC 3E5SA 3HOWB 2SOBA 4K5VA 2OXPA 3TN2A 2LS01 4UDUC 1ZYRC 3EFXD 2A69D 3H6MA 1F9QA 4OO1H 2OF1A 2WIIB 2JA7B 1T5EA 2R61A 1SNCA 1BQQT 3PUWA 2NVXB 2NUCA 3NHHA 4L63B 4RGOS 1TVXA 1NAPA 1CK1A 2G9HD 1G2SA 1UNSA 3S1NB 2X6GA 5ELEA 2H4OA 3A7AB 3S15B 2VNUD 1O7LA 2IX1A 2K5WA 1ENAA 3DM1A 1BF4A 1U4LA 5FK9C 1UUPA 2MP1A 3H91A 5CV9A 3A8JE 1D1KA 3D3RA 4RKBA 3Q23A 4N9TA 1Z6HA 1HA5A 1EY5A 5KYLA 5IT9L 1S5CD 1H9SA 4KY5A 1HFGA 4WFN3 2EYHA 3ONAB 4HEDA 2EJFC 3EVQA 1I4HA 4A3FB 4A3DB 2K5QA 3VR3A 1DD2A 3M3YB 5KEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BE5 C;  3T56 B;  2DNC A;  1G29 1;  3BG3 A;  3IKJ A;  1LAB A;  3PUZ A;  1Q12 A;  2D5D A;  3BDO A;  3M4Y A;  3W3A A;  4DK1 A;  1Y8N B;  1V8Q A;  4KI0 A;  4G7Z C;  4DNT B;  3I72 A;  4BA2 I;  3EQL C;  5JEA G;  3ND9 A;  3GD7 A;  1Y8P B;  1I6V C;  2B8G A;  2V4D A;  1ZKO A;  3MXU A;  3N6R A;  4H13 C;  2B8F A;  2E76 C;  1FYC A;  2A6H D;  1E2Z A;  4H0L C;  4RCN A;  5JEA H;  4KKT A;  2PPB C;  1ZYR C;  1OXT A;  1K8M A;  1IW7 C;  2A69 D;  2LMC B;  3HGB A;  4L8J A;  3VR2 A;  2A68 C;  2KA7 A;  3OW7 A;  3LNN A;  1H9M A;  3PUY A;  4OO1 H;  1OXS C;  3IFT A;  1EWH A;  1PMR A;  4JBW A;  2K32 A;  1H9J A;  1T5E A;  4PV1 C;  1GUG A;  2AUJ D;  2EDG A;  2F1M A;  3CRL C;  3VR4 A;  1VCI A;  2E74 C;  4XIG S;  3H94 A;  1GUS A;  1OXU A;  2PCF B;  3FPP A;  3PUW A;  3M85 A;  4XTC S;  1H9R A;  1A6X A;  5BN3 A;  2DN8 A;  4G7O C;  2EJG C;  1LAC A;  3PV0 A;  1SMY C;  3PUX A;  1BDO A;  2K33 A;  4IQZ A;  4KKS A;  3TZU A;  4DNR B;  5KNB A;  1TU2 B;  3PUV A;  4G7H C;  2O5I C;  4OO1 G;  3L7Z C;  1CTM A;  1DXM A;  1OXX K;  1CFM A;  1GJX A;  3I73 A;  2Q8I B;  2A6H C;  1DCZ A;  3WDN A;  1TKW B;  5K36 H;  1ONL A;  1Z7T A;  3D4R A;  1Y8O B;  2A69 C;  4TQU S;  5BN5 A;  1Q90 A;  2NN6 I;  3P20 A;  2E75 C;  4BA1 I;  2A6E D;  5A35 A;  4OGQ C;  2R6G A;  3A8K E;  3VA7 A;  1HPC A;  4HR7 B;  3A7A B;  2CW0 C;  2IT1 A;  4JK1 C;  2JXM B;  3RLF A;  5C0X H;  3SE0 A;  1O7L A;  1VF5 C;  4IFD G;  3QG1 A;  2ZT9 C;  2PNR C;  3M7N A;  2BA0 A;  1GUO A;  3KLR A;  1E2W A;  3FMC A;  4KKU A;  1B9N A;  1YNJ C;  2AWO A;  2D62 A;  3DXJ C;  3I4L A;  1HCZ A;  1V43 A;  5K36 G;  1YNN C;  2JEB I;  3A7L A;  4DK0 A;  4IFD H;  3MFY A;  1IW7 D;  2AUK A;  1GHJ A;  2NN6 H;  3OPO A;  1Q1B A;  3GQB A;  3QJY A;  2JEA I;  1GHK A;  2O5J C;  3A8J E;  5C0X G;  2BE5 D;  1IYU A;  4KN4 C;  4LJZ C;  2L5T A;  1VDZ A;  3VR6 A;  1HQM C;  1H9S B;  1IYV A;  2D2C C;  2KCC A;  2K7V A;  1Y69 U;  1Z6H A;  4GZY C;  1OXV A;  2EJM A;  2A6E C;  2JE6 I;  4TKO B;  1GUN A;  5BN4 A;  2BDO A;  3D31 A;  2DNE A;  3SDZ A;  1E2V A;  1Q1E A;  4KN7 C;  5KNC A;  2YYZ A;  2QF7 A;  1H9S A;  2NN6 G;  1H9K A;  4LK1 C;  3AB9 A;  3T51 B;  3T53 B;  3VR5 A;  4KMU C;  3QIA A;  3OOC A;  3U9S A;  4I7Z C;  3ND8 A;  3NE5 B;  1CI3 M;  2A68 D;  1VF7 A;  4H44 C;  3LWU A;  1QJO A;  2EJF C;  5KND A;  1GUT A;  1FR3 A;  1B9M A;  2EVB A;  4KHZ A;  3VR3 A;  1DD2 A;  3A8I E;  1HTP A;  1K8O A;  1O78 A;  3CRK C;  2BA1 A; 
#chains in the Genus database with same CATH topology
 4NXN L;  3K7U C;  4A3K G;  1O7Z A;  4ZKC B;  4JBK A;  1LAB A;  2NBF A;  3W3A A;  3S9W A;  4HCE A;  1KAB A;  1PH5 A;  3KBG A;  5IGG A;  1VQ7 A;  1RIP A;  4LF4 Q;  3G71 A;  5ELD A;  1RKN A;  3PF5 A;  2IHF A;  4JI1 Q;  1FGB D;  5CV4 A;  1E2Z A;  4CDF C;  2MNA A;  1PRT F;  5IGD A;  3HGB A;  1SYG A;  2KA7 A;  3PUY A;  1D5M C;  5DAU A;  3DMU A;  4IUU A;  3H3V I;  1X3F A;  2MJ8 A;  3NWT A;  3GTG B;  1AEX A;  3ICE A;  2RF4 A;  1JIC A;  3CRL C;  1HUN A;  4OHJ A;  2JA5 B;  3LWE A;  2KEC A;  4C1N K;  3F1Z A;  1KAW A;  4A4I A;  2RQX A;  5C44 G;  1SMY C;  3FEW X;  2F0P A;  2PZT A;  4P72 A;  4DV6 Q;  1WCM B;  5C4J H;  1AFP A;  4A3G B;  4KTA A;  1B4O A;  2GVA A;  4I7A A;  4NMZ A;  3HG9 A;  4B3S Q;  1Y8O B;  2MQH A;  5D14 A;  1F9S A;  4JI2 L;  1LLR D;  1CKN B;  2DGY A;  4YHH Q;  2Z8L A;  4CKC A;  3D4W A;  5C4X H;  2SDF A;  2HD3 A;  4QIW B;  2HCI A;  1K73 C;  5C3E H;  5M3M B;  1EQV A;  1FJG Q;  1KNE A;  3C1F A;  5E4X A;  1TXY A;  1K3B C;  1WOC A;  2I07 B;  1XNQ Q;  1PXU A;  4PZ8 A;  3NQI A;  4ZAI A;  1HNW L;  1E1O A;  4A3J H;  3S14 B;  2F0E A;  1KRT A;  4IOC A;  2N8N A;  3S24 A;  2XTI A;  1IHZ A;  1TWH B;  2EYF A;  5BN4 A;  2YTY A;  3PO3 G;  5ISR A;  1QB5 D;  5IGC A;  1WTO A;  2PNH A;  2PI2 E;  5M3F H;  1JB7 A;  3RZO H;  5C4J B;  3KOJ A;  1JJC B;  1AN8 A;  1VQJ A;  1NNX A;  1R9T H;  2ZJQ A;  4YY3 Q;  5EPL A;  5IOD A;  4LF8 Q;  2B63 H;  4XQN A;  2SNM A;  3EBE A;  3W1B A;  2JSO A;  4JI1 L;  4IFD J;  4DR2 Q;  1K8O A;  4ZLT F;  3GTO B;  1EY9 A;  2K6A A;  1SFO H;  2E2H B;  2EYL A;  4G7Z C;  3M4Y A;  4OO1 I;  1RL2 A;  1EEI D;  4KI0 A;  5C4X B;  4LUZ A;  3A74 A;  3PF4 A;  1NJI C;  2NVY B;  1D2B A;  4QL5 A;  4M8A A;  4WOR A;  2GN5 A;  5LL6 X;  2VQE L;  1ZXT A;  2A6H D;  2WKC A;  1EQR A;  3AYH B;  2Y0S G;  1EY0 A;  3H09 A;  2EE1 A;  3CKI B;  4DV6 L;  1MD2 D;  5FO8 B;  1BCP D;  2ALY B;  2H5X A;  1L0Y B;  3PO2 G;  1Q8K A;  1Y1V H;  1O80 A;  1WTX A;  1C48 A;  3HOX G;  4ILW A;  3A54 A;  1E22 A;  3FPP A;  1YIT A;  4XTC S;  4QMG A;  4HMJ A;  4HN7 A;  1LAC A;  1L2F A;  3RZO B;  4K0K Q;  1X9N A;  3Q24 A;  3G7L A;  4FF1 A;  3M4Q A;  4YCU A;  3SK5 A;  1MBY A;  3GTL H;  4JV5 Q;  4JI6 L;  2RBM A;  1WYD A;  1SE4 A;  4EQP A;  4JG2 A;  4GOP B;  2E75 C;  1KDA A;  1SFO B;  3TSS A;  2PMZ E;  1EZ8 A;  5CBE E;  4WJW A;  2OTJ A;  1XNQ L;  4AYB E;  1DJR D;  1NBW A;  3KLR A;  3K5O A;  3NEL A;  5GAE C;  1YIJ A;  1YEZ A;  4A93 H;  2JEB I;  3J80 i;  2WAC A;  5M5W H;  4M1U B;  2AWN A;  3KF6 B;  3GQB A;  3QJY A;  1EQQ A;  3EN2 A;  4I65 A;  1FNW A;  2BE5 D;  4KN4 C;  4YY3 L;  2F0Q A;  1IYV A;  1Y1V B;  2D2C C;  2SEB D;  3MA2 B;  1W6J A;  2A1A A;  1KAA A;  4DR2 L;  2F0J A;  3C2P A;  1EUJ A;  1PZI D;  4LK1 C;  3T16 A;  1XNR Q;  3M4O H;  3L2P A;  3A5Z B;  3J81 i;  2DJG C;  3GTL B;  2JQO A;  1YJN A;  4RCO A;  3BVM A;  1NCV A;  1K8A C;  1QJO A;  1P16 A;  2D0P A;  3SXH A;  2NZH A;  4DV5 Q;  1K9M C;  3KFU A;  1HNZ Q;  1PZK D;  2PYK A;  4K2K A;  2MUY A;  2KHS A;  2IX3 A;  5LHY 1;  1V1O A;  3BDO A;  3HOY G;  2CFM A;  3MXP A;  5JEA G;  4NDX A;  4HJ7 A;  1N8R C;  2DJF C;  5M5W B;  4HAE A;  1AW7 A;  4FF3 A;  4HJA A;  1JT8 A;  3QWN A;  2K04 A;  5C44 H;  4K0K L;  4IFD I;  4FYD A;  4DXG A;  4TRD A;  2AHO B;  3R93 A;  4ZK9 B;  4JV5 L;  1PH6 A;  1HR0 Q;  1KNA A;  5C6A A;  3ERQ A;  1JR0 D;  1STG A;  3OIP A;  3V96 A;  2EDG A;  2B39 A;  3ERO A;  4YWL A;  1HFN A;  3KUP A;  1QG7 A;  2CQA A;  1YBY A;  1A6X A;  3S1R H;  5I6W A;  2UXD Q;  4GLV B;  1VQL A;  1S72 A;  2B29 A;  4DR5 L;  1G91 A;  3RLN A;  1DXM A;  2B2Y C;  3HOZ H;  3N52 A;  4BY1 B;  2F3V A;  1I4P A;  1YJW A;  1N33 Q;  5KIX A;  1QZH A;  1SYE A;  4R1J A;  4CJ2 C;  2EY2 A;  1IXR A;  5IP7 G;  3S1Q H;  1SDF A;  1VQB A;  3RNU A;  4H7B A;  1PHJ A;  4IUV A;  3SE0 A;  2A8V A;  1VF5 C;  4JBJ A;  2ZT9 C;  2DY7 A;  2BA0 A;  3Q0A A;  2YTV A;  2R92 B;  2RDG A;  1E2W A;  2MGS A;  3FMC A;  1YNJ C;  2MFI A;  4C3H G;  1G2T A;  4A76 A;  1IL8 A;  1B2T A;  2CHB D;  5AJ3 Q;  2JEA I;  2UUC Q;  4JI7 L;  3MZ5 A;  4MIU A;  1TWA H;  1JJ2 A;  1IYU A;  2B2W A;  1BCP B;  3NBH A;  1H9S B;  2K7V A;  2K01 A;  4GZY C;  1EYA A;  3D6W A;  5IYB H;  2EJM A;  2A6E C;  4TKO B;  1HNZ L;  3T1H Q;  1LM0 A;  4FF4 A;  3D31 A;  1ET9 A;  1X55 A;  3I91 A;  2NYZ D;  2XGT A;  4XYQ A;  1T5X D;  1QVC A;  2C5C A;  3OWF A;  1HJP A;  4B3R Q;  2WFW A;  3KLS A;  1CM9 A;  2KOL A;  2PW7 A;  3HOZ B;  4GLA C;  3BZC A;  4GS3 A;  1VF7 A;  3AFP A;  5IWA L;  1RF2 D;  3MXN A;  1EFI D;  4YIJ A;  1LO5 D;  3RLO A;  5DM6 3;  1BOS A;  3S1Q B;  2JXM B;  4BY7 G;  3ERS X;  4GN5 A;  1JC7 A;  1GXD C;  3G48 A;  2LXK A;  1YNX A;  1SRU A;  1Y8N B;  1ASZ A;  2LSS A;  5CGK A;  3PO2 H;  1HZA A;  2MO1 A;  4PZ7 A;  4CGY B;  3MXU A;  3I56 A;  4X66 L;  2UXD L;  2OT2 A;  4NB3 A;  4APV A;  3D0F A;  4HID A;  1ENF A;  5FLM H;  3SK8 A;  2EYP A;  4C1N I;  3TRE A;  1N33 L;  3ZYY X;  3FDT A;  4RGM A;  1KXL A;  3IL8 A;  3R2I A;  5FLX E;  3LX0 A;  1OXU A;  3CCM A;  2NTS A;  2I5H A;  1X3Q A;  1H9R A;  1YNN D;  2J4X A;  1WI5 A;  2VZA A;  3PV0 A;  4IN3 A;  5FJ8 G;  3CPF A;  4F7X A;  4OIJ A;  1PA6 A;  3CAM A;  4A3M G;  1TY2 A;  4UPA A;  4YWM A;  4HMI A;  1I4X A;  1UE1 A;  4DR3 Q;  1GO3 E;  4KLK A;  2QEJ C;  4QJF A;  1ROD A;  5A2Q E;  1N34 Q;  4DV2 Q;  2UUC L;  1F2M A;  4OGQ C;  4FXD A;  3A8K E;  4HR7 B;  4JK1 C;  3MVV A;  3SEB A;  5I9O A;  1VQN A;  4P73 A;  5M5X B;  1W2B A;  4DK3 C;  3KYH C;  2QEX A;  4DF7 A;  3I70 A;  1LTI D;  4WJ4 A;  3IFD A;  1B9N A;  3T1H L;  1NE3 A;  3NTK A;  5IGF A;  1BO0 A;  5NUC A;  2Q2I A;  4OXP A;  3OPO A;  4RGN A;  3H3V H;  3GTJ H;  1STN A;  1LTT D;  2O5J C;  1W3S A;  2Z0S A;  2UXC Q;  2JA6 H;  4JOI A;  1XWE A;  5H1S E;  1EY6 A;  3VDY A;  3L3O C;  3F8T A;  1PFB A;  3BU2 A;  1HZB A;  3FRP B;  4PMB A;  1JMC A;  4KMU C;  1Q8I A;  3OOC A;  5C0X J;  1SJE D;  3KF8 A;  2A68 D;  4JI8 Q;  1N36 Q;  4LUV A;  4UY8 C;  4AH6 A;  2Z6K C;  1VQM A;  3TME A;  2QW7 A;  4ID6 A;  1ET6 A;  1HRJ A;  2WAQ E;  1QUQ A;  2EY5 A;  4R8N A;  5KGU A;  3OTO Q;  1B1Z A;  3TS2 A;  1HNX Q;  3RZD H;  2Q2T A;  3QB3 A;  5C3W A;  2ZTC A;  3GTJ B;  3SK6 A;  1TWF B;  1Q81 C;  1EZ6 A;  4YCV A;  4X64 L;  1RHP A;  1WTQ A;  1QVG A;  2UUA L;  4BBS B;  4IUT A;  2JA6 B;  1DGS A;  4O42 A;  3F2U A;  2VUM G;  1I50 H;  4PV1 C;  1E1T A;  3MEF A;  4DR3 L;  2M2L A;  3KJP A;  4BXX G;  3KLS X;  1VQD A;  2R93 B;  1KRS A;  1Z47 A;  2EJG C;  2IL8 A;  3AFQ A;  2GVB A;  1P8L A;  2PZU A;  4GNX A;  1FGU A;  4PMW A;  4EVO A;  3DUZ A;  3HOV B;  2HUG A;  3J80 L;  3I73 A;  3S2D H;  3WDN A;  1TKW B;  1IBL Q;  1S5F D;  1STH A;  3K81 C;  3AMU A;  4IO9 A;  5JEA J;  1VQH A;  1C4Q A;  1HPC A;  2XSC A;  2IT1 A;  3VA7 A;  2CCZ A;  3JAM E;  4Y52 H;  3O13 A;  4DUY Q;  3TRZ A;  2LXJ A;  1HXY D;  1PH8 A;  2A73 B;  1SE2 A;  2TSS A;  3G6J B;  1I4R A;  1NR2 A;  2ZTE A;  3J81 L;  1Q1B A;  1EOT A;  1S3O A;  4K5W A;  3S16 B;  1K0S A;  3IRB A;  3VYT A;  4L5R C;  1CZG A;  2JA8 G;  4LF6 L;  2L5T A;  4OL7 A;  5C5M A;  1JOQ A;  1N36 L;  2NB0 A;  1U5K A;  1CKO A;  4Q5V A;  1EY8 A;  1STA A;  4BY7 H;  2RCN A;  3T53 B;  1SNP A;  4A3C H;  3OTO L;  2I5L X;  4XYO A;  5CBA E;  2BOS A;  1HNX L;  1ZYR D;  3UDI A;  3CCR A;  3M4P A;  1OO9 B;  3CMA A;  3S2D B;  3CCV A;  1VQG A;  4JI2 Q;  2GA4 B;  2I5M X;  4IOA A;  2WIN B;  1IYJ B;  1BBW A;  4AYB G;  3SVM A;  1C0A A;  1O78 A;  3A7L A;  3S2H H;  1FVI A;  1B53 A;  4JI5 L;  3PUZ A;  2F0S A;  4UAI A;  4R4Q A;  3U50 C;  3CQZ B;  3AU7 A;  2EXD A;  3HKZ B;  3J80 c;  1YVC A;  4MZ9 A;  5IYC G;  1MHW C;  2OEO A;  5FOB B;  4LF9 L;  3GDE A;  3MEH A;  2FMC A;  1L1O C;  5JJK A;  1Q46 A;  1LT3 D;  1ESF A;  4H02 A;  4LAA A;  5FJ8 H;  5C5L A;  1HNW Q;  4DUZ L;  4KHV A;  1SNQ A;  2CH4 W;  1K83 B;  5M5Y B;  3S17 H;  2RHS B;  1G8Z D;  2B2V C;  2JJQ A;  1IBL L;  4BY7 B;  1TR5 A;  4DA2 A;  2IHE A;  3M85 A;  3J81 c;  2WB1 B;  3R8B A;  4OWX B;  4HIK A;  2HHH Q;  4GNX C;  3PUX A;  2K33 A;  1PH7 A;  5KNB A;  4DUY L;  1A8V A;  1PYB A;  5IIF A;  3PIO 3;  1PH1 A;  2Q8I B;  4DV1 L;  3VYS A;  3MFG A;  1DOL A;  1N32 L;  1SEB D;  3PQI A;  2O4X A;  1YI2 A;  3STB C;  4FO2 A;  3NUC A;  1K8G A;  2IWH A;  1PRT B;  1TS3 A;  5AFW A;  2VQE Q;  4X65 L;  4K8I A;  4QIW E;  4DK0 A;  3J7Z C;  4U68 A;  3KJO A;  4IFD H;  1GVP A;  4ZKB B;  4WJ3 M;  2WKD A;  3KDF A;  2VQF Q;  3NBH B;  5G3L D;  5JPM C;  3G6E A;  1F9R A;  3GTP H;  3S17 B;  4A3E H;  3CF5 A;  5IT9 c;  2RCF A;  1L0W A;  1STB A;  4LF5 L;  4B3M Q;  1R4P B;  2EXZ A;  3CW2 C;  1XPU A;  3VR5 A;  2F0K A;  4NPS A;  3C46 A;  3MC0 B;  1HZ9 A;  3SK4 A;  4I7Z C;  3RR5 A;  4JI6 Q;  4IAL A;  1VMP A;  1SN8 A;  2VL6 A;  5KND A;  1EU4 A;  1X3E A;  4A3I G;  1RTO A;  3FKI G;  2KEE A;  3I4O A;  2F4I A;  1I4Q A;  5CV5 A;  3U9S A;  5ELF A;  2HIX A;  5JJL A;  2HQL A;  1V8Q A;  1SMY D;  1UE6 A;  2VUM H;  3JC6 6;  3I4N G;  2L12 A;  1MJC A;  4EQO A;  4HTH A;  4OWT B;  4Q0F A;  4ODG A;  4F88 A;  3I2Z A;  4BXX H;  1ZKO A;  1IKM A;  1WTR A;  3I4M G;  5CC4 A;  5I4D A;  2HHH L;  2EQS A;  4RCN A;  3HOU G;  2EOT A;  2LMC B;  3T1Y L;  4IJL A;  1ML0 D;  4A3E B;  4A3B G;  1EWH A;  1MSH A;  2F0V A;  2ATW A;  4JI3 L;  4JW0 A;  1W6K A;  2KED A;  4ME5 A;  2PCF B;  3A55 A;  3TZD A;  1RTN A;  1Y1W H;  2DN8 A;  5DM7 3;  5A2Q L;  1AE2 A;  5C3E B;  5EGT A;  1X65 A;  3U9O A;  2YU9 H;  1X6O A;  1K0R A;  5ELO A;  3CCE A;  1BBU A;  3K57 A;  2RSO A;  2PZW A;  3EJI A;  4DV7 Q;  4L5S A;  1KL9 A;  1C7Y A;  2VQF L;  3CCU A;  4A3J B;  2ZM6 Q;  2KCM A;  4FNF A;  1DYQ A;  5I9P A;  1J9O A;  2FJ2 A;  5M3F B;  2PQE A;  3L9A X;  3DXJ C;  4B3M L;  1AZQ A;  5K36 G;  1JWU D;  1VQA A;  2F0U A;  5LL6 S;  2KVM A;  3BVG A;  1R9T B;  3F2D A;  1QVF A;  2B63 B;  2B2Y A;  1PFM A;  2R7Z G;  1JWM D;  2XNA C;  2F0N A;  2M9V A;  4ABN A;  5C0X G;  1A3U A;  1NR4 A;  2E8G A;  4C3J G;  1PFS A;  3RD4 A;  3BDL A;  1ENC A;  2JP1 A;  4K14 A;  1MJE A;  3QOL A;  2A74 C;  1CT1 D;  1OXV A;  5JVG 3;  3I3C A;  4RKL A;  1JOO A;  1E2V A;  3KF8 B;  4DR5 Q;  1Y1W B;  2EIF A;  3QIA A;  3CP0 A;  4CJ1 B;  2K03 A;  3I55 A;  4HIM A;  1QE6 A;  4YWK A;  2RDH A;  4HJ8 A;  3TP8 A;  4ME3 A;  4BBR G;  5L37 A;  5IYC H;  1QUQ B;  3QOJ A;  3OMC A;  3J81 j;  1HUM A;  4DR4 Q;  4FF2 A;  3ULJ A;  4AIM A;  3X3N A;  2E2I H;  1MIU A;  2ID0 A;  5G3L F;  1R4Q B;  4BA2 I;  4R4T A;  3HKS A;  3CME A;  1FNU A;  4A3K H;  2K5H A;  3URY A;  5J39 A;  2R3Z A;  4JI7 Q;  4C56 C;  2V4D A;  4NW2 A;  3OWE B;  4ZRZ A;  3CCJ A;  1ZEQ X;  4P75 A;  2C35 B;  1OXT A;  4EQN A;  1I4G A;  1SYF A;  3DEP A;  3OW2 A;  2ICE C;  3OW7 A;  1Q7Y C;  3IFT A;  3GV3 A;  2KCN A;  1S40 A;  1AH9 A;  5E7N A;  2E74 C;  1KHI A;  4DV7 L;  1MI2 A;  1YHA A;  2EYJ A;  2ZM6 L;  3ER0 A;  1X3G A;  3P1H A;  4N8F A;  1EOV A;  2EY6 A;  2FXQ A;  4A93 B;  5IWA Q;  4LF7 Q;  4ZUI A;  4KJO A;  4DR6 Q;  2HQE A;  4C3I G;  1EWI A;  3GTQ H;  3H0G G;  1XPR A;  1MSG A;  2WAQ G;  1SYB A;  1XMO L;  3MAQ A;  1DCZ A;  2IY5 B;  3E3X A;  2E2I B;  5A35 A;  1NTG A;  2Q8R E;  2CW0 C;  1ILP A;  3S1M H;  1M4V A;  1Z9F A;  1Q3L A;  3HOW G;  2KEN A;  1GUO A;  4A3K B;  4X66 Q;  3M4O B;  3I4L A;  2D62 A;  1FNV A;  4IUP A;  2AKW B;  4CJ0 B;  1GHJ A;  5FO7 B;  4DR1 Q;  2JA7 G;  1GHK A;  4QF4 A;  4RA8 A;  1TY0 A;  2FFK B;  1CSQ A;  5GAH C;  1LYL A;  2KCC A;  3E0E A;  2E2J H;  1PZJ D;  4DR4 L;  2DNE A;  4LFC L;  3K6O A;  4DV3 Q;  2VB2 X;  2X69 A;  1IBM L;  3FKI H;  4HIO A;  5EKI A;  5JJZ A;  2CWP A;  4E6I A;  2ENB A;  3GTQ B;  1KD1 C;  2ZJR A;  3PO3 H;  4KHP Q;  5C44 B;  3I4N H;  3M7G A;  1GOZ A;  1PTO C;  2CW0 D;  4CKE A;  1F2L A;  1GM5 A;  3T56 B;  4JI0 L;  1TWG H;  2DNC A;  4H44 C;  4A3B H;  3CC4 A;  2M00 A;  2WP8 J;  3J7Y W;  5KRU A;  1C9O A;  3ND9 A;  3S1R B;  5CV8 A;  3BYY B;  1GD7 A;  2ZXR A;  1I6V C;  1LTR D;  1TQO A;  2K4K A;  1I94 Q;  1CA5 A;  3DWP A;  4IJH A;  3D8G A;  1RJT A;  4LF7 L;  4DR6 L;  5ELC A;  1PVO A;  3U4V A;  1PDQ A;  4KY6 A;  2AUJ D;  2Z6K A;  1B50 A;  5CV6 A;  1VCI A;  3BZK A;  4RHS A;  1UE7 A;  1UEB A;  4EQ5 A;  1YNJ D;  1EIF A;  1B70 B;  4HJ9 A;  5BN3 A;  4DV0 Q;  3NEM A;  4A3F G;  5JJI A;  3HOX H;  5DNF A;  3PO3 B;  3NXW A;  4A3D G;  1QCB D;  2F0H A;  3R3O A;  1F9P A;  4QCL A;  1PTO D;  2NVT H;  4TVA B;  5K36 H;  1TWA B;  1KDC A;  5I6Y A;  4LFA Q;  1CA6 A;  4DR1 L;  3J7A V;  5D65 A;  2A6E D;  3AQQ A;  2AQ2 B;  2R6G A;  4XT1 B;  1NMG A;  3PIP 3;  2R7Z H;  3GTK H;  4G57 A;  5C0X H;  3DEO A;  4FP5 D;  3QG1 A;  3IAY A;  4DGZ A;  4P71 A;  4Y7N H;  3KDF B;  4A3L G;  2XRS D;  2AWO A;  1FL0 A;  1V43 A;  4DKA C;  5EPJ A;  4X64 Q;  3HRZ C;  2FIN B;  3K5M A;  4DV3 L;  2MPM A;  1LTL A;  3KLW A;  1SLJ A;  1J6Q A;  1SNO A;  2UUA Q;  2B2T C;  3QO2 A;  4JCV E;  2C9O A;  2JA5 G;  1RDP D;  1WD1 A;  4XQJ A;  1CQF A;  1C8C A;  4KHP L;  5LMN W;  4TSS A;  2Y0S B;  3V05 A;  2Q2H A;  1UE5 A;  4KN7 C;  2QGQ A;  1WCM G;  2QF7 A;  2NN6 G;  3PO2 B;  1UEA B;  4EGV A;  4A3G G;  4R8I A;  2NZO A;  4XQQ A;  2OCE A;  4R9W A;  2Z1C A;  5C4H A;  3HOX B;  5LMU L;  2L55 A;  1F77 A;  4UHV A;  4XDX A;  2KBN A;  3NE5 B;  4PG3 A;  2PI2 A;  3A5U A;  4BWG B;  3DHQ A;  3OIQ A;  1CZW A;  2NVT B;  1XXG A;  4K5X A;  4DV4 Q;  1EIH A;  4QUC A;  2KUM A;  2IW3 A;  2K05 A;  3Q8D A;  4LW1 A;  1I94 L;  3ZJY C;  3GTK B;  1Q12 A;  5IOC A;  2PQA A;  3PSI A;  4Y7N B;  1HZC A;  5M3M G;  3CHB D;  1D5Z C;  1QNK A;  4MHE A;  4N8X 1;  3V2T A;  1XJV A;  5GAD C;  3HOY H;  2EY1 A;  1EWC A;  4DV0 L;  4LF6 Q;  5JEA H;  1EU3 A;  1I3Q H;  4OON A;  1X3P A;  5BR8 L;  1A0I A;  4ULL A;  2QDB A;  3H0G H;  1PMR A;  3K0X A;  4L6T B;  5EKL A;  2F4V Q;  1X32 A;  2F1M A;  3H94 A;  3NSW A;  4LFA L;  4O0A A;  2EYM A;  3UDG A;  3EIV A;  4N9P A;  2VY3 A;  2Z4H A;  2O5I C;  2K28 A;  3P75 A;  1CTM A;  1VQK A;  1JOK A;  2XVS A;  1WTP A;  1II3 A;  4IUQ A;  3E0J A;  3TEH B;  2IPK D;  1L1O A;  1PTO H;  2JK8 A;  5F2D A;  3C1E A;  1XTC D;  2A69 C;  2CH4 A;  4JI5 Q;  5C4X G;  5IP9 G;  2QA4 A;  1A2U A;  1V1Q A;  2JA7 H;  3FP9 A;  3FHW A;  4S3S A;  4IUR A;  2ZJP A;  3MWY W;  4QGU A;  2NVX H;  2B2V A;  1TII D;  2XWJ B;  1Q86 C;  5IP7 H;  2V1C C;  4LF9 Q;  4NXM Q;  1J8I A;  1GUW A;  4RG1 A;  1BUV T;  5DEH A;  1A15 A;  5KYI A;  1AZP A;  3HOY B;  4DUZ Q;  1XX8 A;  3K80 C;  1K3R A;  4DAY A;  3NK9 A;  3W5O A;  4QB4 A;  4AQY Q;  3GP7 A;  4K2L A;  3S1N H;  4C3H H;  2K50 A;  2J0T D;  3D6C A;  1X54 A;  2L15 A;  4F8M A;  3TBI B;  4DV4 L;  2NZ1 D;  3CC2 A;  3S15 H;  4RH6 A;  4V19 0;  1PTO F;  3K58 A;  3RZD B;  1KLG D;  3NPP A;  3JAM i;  4JVZ A;  4DV1 Q;  2Z9H A;  2A19 A;  5CR3 A;  1U4P A;  4P2C B;  1PTO B;  5E1F A;  4X6A H;  2RDF A;  1N32 Q;  4NKL A;  1B3A A;  2BH8 A;  2B2U C;  5CV7 A;  4ALP A;  1I50 B;  2HCC A;  2EZV A;  4CBV A;  1G29 1;  2P5Z X;  4X65 Q;  3A0J A;  1Q82 C;  5K5P A;  3VYR A;  1V1P A;  2F4V L;  1PYS B;  2FHT A;  3I72 A;  3OMG A;  1SJH D;  3W1G A;  3WWV A;  3HKZ E;  1NUC A;  3GD7 A;  2NVQ H;  4KJN A;  2XIW A;  3P7J A;  2VS1 A;  1DON A;  1PH2 A;  3DWQ A;  1Y1V G;  2RA4 A;  4POF A;  1G6P A;  5IYD G;  2RVL A;  4A3F H;  4C3H B;  1PH9 A;  4LF5 Q;  3M3Y H;  2A5H A;  1H9J A;  4PZ6 A;  1EIG A;  4GOP C;  5HUR A;  4XXE A;  5DLQ E;  3SR1 A;  1U4R A;  1WFQ A;  1WD0 A;  3T13 A;  4L5Q A;  2EYO A;  3TS0 A;  1XMQ L;  4DR7 L;  3R2T A;  2WB1 E;  4IQZ A;  3K59 A;  1EEF D;  5C0X I;  1DM0 B;  4IZ8 A;  1IKL A;  1CSP A;  1OXX K;  2L11 A;  4NXM L;  3BVZ A;  5T1G A;  5TSS A;  4A3L H;  1HHV A;  3NEN A;  4GKK Q;  2I46 A;  3UDX A;  1SE3 A;  1ONL A;  5CMD A;  2CWA A;  3CCL A;  3E9H A;  1Q90 A;  4A3M H;  3F2C A;  1O7Y A;  5FKA C;  4AQY L;  1S5D D;  3GTG H;  2FMM A;  4DFA A;  4CDC C;  3SHL A;  2KHI A;  3M9B A;  1EFW A;  2JA5 H;  1SMX A;  4F87 A;  1RCV D;  2ES2 A;  2LY7 A;  1DZ1 A;  3OHX C;  2HDL A;  2NVQ B;  2JYO A;  2F0D A;  3FPU B;  1I5F A;  3T1Y Q;  1WCM H;  2K5N A;  2NN6 H;  5EBD A;  1BVS A;  2L9H A;  3Q6S A;  2LKV A;  1HTL D;  3KBX A;  3NBI A;  4JI3 Q;  3S2H B;  4ZQ3 A;  1HQM C;  1WTH A;  1YJ9 A;  3TDQ A;  1E7Z A;  2UUB L;  1U4M A;  5GAG C;  2K52 A;  1UWV A;  4BY1 G;  1CUK A;  2Z6B A;  3J7A 5;  1VMC A;  4FVM A;  2F3I A;  1SAP A;  2JN4 A;  5M3M H;  2H1E A;  4KV6 A;  4POG A;  1GUT A;  2F0O A;  4QY7 A;  1S4Z A;  4A3M B;  4GLX A;  2OQ0 A;  3A8I E;  4MTK A;  2ASB A;  2AQ1 B;  3HP3 A;  5CYU A;  1I6H H;  3S14 H;  2R92 G;  2CKZ B;  3CD6 A;  3K5N A;  1CHQ D;  4X3T A;  1LT5 D;  4KD3 A;  1TWH H;  1DOK A;  2OWO A;  1RD9 D;  3I90 A;  2VB3 X;  4J1M A;  1JWS D;  3MXN B;  1JQY D;  2F0W A;  4H13 C;  3N6R A;  2G5D A;  4KKT A;  4ZCK A;  4LFB L;  5J22 A;  1IW7 C;  1UAP A;  1G6Z A;  1H9M A;  3K8A A;  2UU9 Q;  3BDC A;  3J7A F;  5JAV A;  1OXS C;  1FD7 D;  1Y14 B;  4JBW A;  3WOF A;  2WV6 D;  3STB D;  1GUG A;  4GKK L;  4JYA Q;  4MN3 A;  3RUZ A;  3GTO H;  3VR4 A;  4DAV A;  3RN2 A;  2E2H H;  4LNQ A;  4K8J A;  5J3B A;  3HOZ G;  1STY A;  1GUS A;  5IP9 H;  5HGQ A;  2NVY H;  4OIK A;  2HDM A;  3L7Z C;  1U0L A;  5FLX L;  1CFM A;  4ZYS A;  2KCT A;  1ESR A;  2A6H C;  3GTP B;  3D4R A;  1I6H B;  4TQU S;  1TS5 A;  2KQ3 A;  1BCP C;  2K5V A;  3RLF A;  3H15 A;  4HSP A;  1SND A;  4WRD A;  4B9X A;  2QDL A;  3WOE A;  5GRO A;  5EBC A;  4KKU A;  1XPO A;  1A3T A;  1DOM A;  1IW7 D;  3NQT A;  4LF4 L;  1B44 D;  2PW5 A;  5I2X A;  5IYB G;  4JC0 A;  3E6Z X;  5ELB A;  3K7A H;  5IE8 A;  1ICF B;  1A63 A;  1GKH A;  3MTS A;  1TWC H;  3C3L A;  3K5L A;  1CHP D;  5HY6 A;  2BDO A;  5EPK A;  4OEM B;  3PIO A;  2JA8 H;  5E3F A;  3AB9 A;  2VUM B;  2QCP X;  5T1I A;  2N3S A;  2AMC B;  1XMO Q;  3FVQ A;  3OSO A;  4ZUJ A;  3F2B A;  2ZXO A;  3LGJ A;  1LTS D;  1U9R A;  2UXB Q;  1KIX A;  4B9W A;  2EVB A;  1B9M A;  1OTC A;  2PQA B;  1VQP A;  3CRK C;  4Z9C B;  3RMH A;  1VQO A;  2BE5 C;  4B3S L;  1JB3 A;  5IYD H;  2UU9 L;  4JI4 Q;  3HZX A;  3TP5 A;  4K6L A;  4YHH L;  4JYA L;  5FLX c;  2N55 A;  4FXK C;  5FLM G;  5JVH 3;  1V9P A;  2F0M A;  3NTH A;  2MHV A;  1VQ6 A;  1VQE A;  2YU9 B;  2E76 C;  2PO4 A;  2K5D A;  2YV5 A;  4IUN A;  1EQT A;  3LNN A;  2Z4I A;  2RHQ B;  1VS0 A;  1FJG L;  3K7A B;  5D3D A;  4JPB W;  4J6H A;  4LFC Q;  3VYU A;  1A3V A;  1TWC B;  3K0Y A;  5LMN Q;  1SE8 A;  1IBM Q;  4XIG S;  1WVL A;  2JA8 B;  2K1B A;  2I0Q A;  2F03 A;  3J80 E;  4PMC A;  1J5E Q;  1EY7 A;  2ZTD A;  1EY4 A;  5JOB A;  4KKS A;  1L1O B;  3PUV A;  5E4W C;  4G7H C;  1LTA D;  1LTB D;  2Q2U A;  3E9I A;  4YCW A;  1SXT A;  1SRO A;  2RSN A;  3B6Y A;  2O2L D;  4B3T Q;  4JI0 Q;  1LT4 D;  2CQO A;  1Z7T A;  4DXF A;  1WTW A;  5BN5 A;  4LF8 L;  1HQR D;  2NN6 I;  4LWC A;  1TT2 A;  4UP9 A;  2PMZ B;  4P74 A;  4KD4 A;  3PMF A;  1PFN A;  5M9O A;  4AYB B;  3J81 E;  1QWY A;  2F3W A;  4IPD A;  2PNR C;  3M7N A;  4GNX B;  1VQF A;  2J7Z A;  3AEV A;  4DAY B;  1BNZ A;  2L1B A;  3MHB A;  2DY8 A;  3MFY A;  4L5T A;  4BBS G;  3JAM L;  3I8Z A;  4BY1 H;  1E24 A;  2JA6 G;  2EPB A;  4DN4 M;  1IBK Q;  2R93 G;  2UXB L;  4DNI A;  2Q8T A;  2JE6 I;  3SDZ A;  5KNC A;  4DK6 C;  1PH3 A;  1Q1E A;  1STE A;  3Q22 A;  2R92 H;  3HOV G;  3GV6 A;  1KTK A;  4JI4 L;  1KLU D;  3U4Z A;  1IZ6 A;  1CI3 M;  3PGZ A;  1T9H A;  3H3V C;  1S5B D;  4K6D A;  4QUF A;  1BKB A;  5IT9 E;  1CQV A;  2B2T A;  1V1P B;  1WTV A;  1MGS A;  2BA1 A;  4OWW B;  1H95 A;  2N49 A;  1A2T A;  4LMQ D;  5I2Y A;  4IPG A;  4DK1 A;  1AP0 A;  3A56 A;  4A3I H;  5EAY A;  4DNT B;  5LMN L;  1PLF A;  3X3M A;  1B8A A;  1MKH A;  2B8G A;  3BS1 A;  1L0X B;  1J5E L;  1LV9 A;  2B8F A;  1FYC A;  3BYT B;  4H0L C;  1K8M A;  4L8J A;  3ULL A;  3MXG A;  2RKS A;  4J8Q A;  1D6E C;  4KY7 A;  2QKI C;  2K32 A;  1VQC A;  1JE5 A;  1SNM A;  3I4M H;  3D4D A;  3HOU H;  5COR A;  4B3T L;  1JCK B;  2X6L A;  3S1M B;  2CVR A;  5LMU Q;  3EA6 A;  3TQY A;  3JAM c;  1NMF A;  4G7O C;  1BCP F;  4U67 3;  4GKJ Q;  4OX9 Q;  4DNR B;  3HS0 C;  4OO1 G;  1BR9 A;  2BDN A;  1XNR L;  2R7D A;  4X3S A;  4KK7 A;  2F0L A;  1KC8 C;  4G4K A;  2HT1 A;  2R7F A;  2ZXP A;  3P20 A;  4BA1 I;  4DV5 L;  2E2J B;  4CKB A;  3HKZ G;  5ELN A;  4A3I B;  3HFZ B;  4A75 A;  1HA6 A;  1IBK L;  2G9D A;  4DU9 A;  1EIY B;  2BH2 A;  1SYD A;  1EL0 A;  3HEJ A;  1EYD A;  1CKN A;  3FKI B;  3CCQ A;  2XRQ D;  2TMP A;  1F2Z A;  3CU7 A;  1HCZ A;  3OYY A;  1YNN C;  1QNU A;  4GN4 B;  5BR8 Q;  5EQ0 A;  4MTN A;  1PH4 A;  3I4N B;  1D8L A;  5EJW A;  4LUO A;  2KJX A;  1JE4 A;  4LJZ C;  1EYC A;  1F2Y A;  1QOH A;  1VDZ A;  2DUD A;  2NTT A;  2NWG A;  4RAU C;  5EKK A;  3I4M B;  1B7Y B;  1Y69 U;  3HOU B;  2WB1 G;  1BXT A;  1TWG B;  4A3C G;  2Y0S E;  2L4N A;  2L0C A;  4A3B B;  3DWA A;  5M5X H;  1HR0 L;  2BCO A;  5HGT A;  4C3J H;  4FXG C;  3T51 B;  2F0I A;  1H9K A;  4J15 A;  2ICI A;  4DAP A;  2D9U A;  4JBM A;  2QIL A;  1D7Q A;  1S5E D;  2VXW A;  4RGT A;  3ITP A;  5C3X A;  4DPG A;  1QZG A;  4KHZ A;  3KK7 A;  1SBB B;  5D3I B;  1LUZ A;  4BBR H;  2N88 A;  1E3P A;  5J1Z A;  1VQ8 A;  1LT6 D;  4B08 A;  3DM3 A;  2KHJ A;  4CDD C;  1M90 C;  1LTG D;  3GTM H;  5FO9 B;  5COY A;  3PCO B;  1ASY A;  2HIV A;  4GKJ L;  5IGE A;  2PPB C;  4OX9 L;  3UDF A;  3VR2 A;  4EX5 A;  2A68 C;  2IX0 A;  1SYC A;  3U58 A;  1TS2 A;  5AJ3 L;  1NSN S;  4HJ5 A;  4BS9 A;  1VQI A;  2E2D C;  4FDB A;  1JOR A;  4OEL B;  2R7Z B;  2F0T A;  1IL2 A;  2B2U A;  4C3J B;  1SSO A;  2OTL A;  4O1N A;  2F52 A;  4PQX A;  1PRT C;  4X3U A;  1PYW D;  1BDO A;  3TZU A;  1TU2 B;  1XYI A;  2B3G A;  3VA5 A;  2LFN A;  4RMF A;  4RFB A;  1GJX A;  1TWF H;  2AQ3 B;  2B2W C;  4B3R L;  4C2M H;  4O2D A;  1X56 A;  3SGI A;  1YZ6 A;  1PV4 A;  4BBS H;  4C3I H;  3BZD B;  1M8A A;  2XWB B;  4BBR B;  1SR3 A;  3CXC A;  1D5X C;  4IFD G;  2N78 A;  3UE0 A;  4GOP A;  2R93 H;  1NY4 A;  3GTM B;  3L0O A;  4IPC A;  2XN9 C;  3CC7 A;  1N9W A;  3NWS A;  4A3E G;  1BBX C;  2AUK A;  1E0B A;  3HOV H;  3HOW H;  3GO5 A;  1M1K C;  4R4O A;  1QIL A;  4XT3 B;  1KQS A;  4CHT B;  2SNS A;  5GQO A;  3NP8 A;  3VR6 A;  3KF6 A;  1YHQ A;  1HR0 W;  1CKM A;  2D0O A;  1GUN A;  1XMQ Q;  4DR7 Q;  1EYG A;  1PRT D;  2YYZ A;  4X3K A;  1TS4 A;  4X62 Q;  5C3E G;  1YHB A;  4UP7 A;  3W2D A;  4NP5 A;  4RHR A;  3ND8 A;  3TP6 A;  2F0G A;  1D1I A;  2K14 A;  3PIP A;  4A3J G;  2MO0 A;  3QR8 A;  4C2M B;  3LWU A;  5JPN C;  1I3Q B;  3T4A C;  1WJJ A;  2K75 A;  3ULP A;  3S16 H;  3DLL A;  1FR3 A;  1VQ9 A;  4C3I B;  1HTP A;  3H0G B;  4R4C A;  2F0F A;  2WAQ B;  3UE1 A;  3NTI A;  3UI2 A;  4V0B A;  1A62 A;  1ICW A;  4HCS A;  5M3F G;  3BG3 A;  3IKJ A;  4HSV A;  4IPH A;  2D5D A;  5IY0 A;  1KDB A;  3TP7 A;  1N34 L;  5C4Z A;  4DV2 L;  2YTX A;  1ILQ A;  4PNY A;  3EQL C;  4QQB X;  2IJ0 A;  3I7F A;  2E5L Q;  3G4S A;  5IGB A;  2B63 G;  1Y8P B;  4RWS C;  3E5S A;  3HOW B;  2SOB A;  4K5V A;  2OXP A;  3TN2 A;  2LS0 1;  4UDU C;  3EFX D;  1ZYR C;  2A69 D;  4NXN Q;  3H6M A;  1F9Q A;  4OO1 H;  2OF1 A;  2UUB Q;  3BJU A;  2WII B;  1Y1W G;  2JA7 B;  1T5E A;  2R61 A;  1SNC A;  1BQQ T;  1K28 A;  2JA9 A;  2UXC L;  3PUW A;  2NVX B;  4R4I A;  3CQZ H;  2NUC A;  4DAM A;  3NHH A;  4L63 B;  4RGO S;  1TVX A;  1NAP A;  1CK1 A;  2G9H D;  3RN5 A;  1G2S A;  1UNS A;  3S1N B;  4JOI C;  4UP8 A;  4JI8 L;  4A3D H;  2X6G A;  1K83 H;  4CDE C;  5M5Y H;  5ELE A;  2H4O A;  3A7A B;  3S15 B;  2VNU D;  1O7L A;  2IX1 A;  1JJG A;  1G51 A;  2K5W A;  3CPW A;  1ENA A;  3DM1 A;  2OQK A;  1BF4 A;  1U4L A;  5FK9 C;  1VQ4 A;  1HH2 P;  1UUP A;  4LFB Q;  4X62 L;  2MP1 A;  1XTD A;  3H91 A;  5CV9 A;  2VW9 A;  1VQ5 A;  1AE3 A;  3A8J E;  1D1K A;  3D3R A;  3CCS A;  4RKB A;  3Q23 A;  4N9T A;  1Z6H A;  1HA5 A;  1EY5 A;  4A93 G;  5KYL A;  5IT9 L;  1S5C D;  1H9S A;  4GN3 B;  4KY5 A;  1HFG A;  4MNO A;  4WFN 3;  2EYH A;  3ONA B;  1B3Q A;  2E5L L;  4HED A;  4A3G H;  2EJF C;  3EVQ A;  1I4H A;  4A3F B;  4A3D B;  2K5Q A;  3VR3 A;  1DD2 A;  1O7I A;  3M3Y B;  5KEE A; 
#chains in the Genus database with same CATH homology
 1O7Z A;  4ZKC B;  1LAB A;  2NBF A;  3W3A A;  3S9W A;  4HCE A;  1KAB A;  3KBG A;  5IGG A;  5ELD A;  1RKN A;  1FGB D;  5CV4 A;  1E2Z A;  1PRT F;  5IGD A;  3HGB A;  1SYG A;  2KA7 A;  3PUY A;  1D5M C;  5DAU A;  3DMU A;  4IUU A;  2MJ8 A;  3NWT A;  3GTG B;  1AEX A;  3CRL C;  1JIC A;  1HUN A;  4OHJ A;  2JA5 B;  3LWE A;  2KEC A;  4C1N K;  2RQX A;  1SMY C;  3FEW X;  2F0P A;  2PZT A;  1WCM B;  1AFP A;  4A3G B;  4KTA A;  1B4O A;  4NMZ A;  3HG9 A;  1Y8O B;  5D14 A;  1F9S A;  1LLR D;  2Z8L A;  4CKC A;  3D4W A;  2SDF A;  4QIW B;  2HCI A;  5M3M B;  1EQV A;  1KNE A;  3C1F A;  5E4X A;  2I07 B;  1PXU A;  3NQI A;  4ZAI A;  3S14 B;  2F0E A;  5BN4 A;  1IHZ A;  1TWH B;  2EYF A;  5ISR A;  1QB5 D;  5IGC A;  1WTO A;  5C4J B;  1AN8 A;  5EPL A;  5IOD A;  4XQN A;  2SNM A;  2JSO A;  4IFD J;  1K8O A;  4ZLT F;  3GTO B;  1EY9 A;  2K6A A;  2E2H B;  2EYL A;  4G7Z C;  3M4Y A;  4OO1 I;  1EEI D;  4KI0 A;  5C4X B;  2NVY B;  1D2B A;  4M8A A;  4WOR A;  5LL6 X;  1ZXT A;  2A6H D;  2WKC A;  1EY0 A;  3H09 A;  2EE1 A;  3CKI B;  1MD2 D;  5FO8 B;  1BCP D;  1L0Y B;  1O80 A;  1WTX A;  1C48 A;  4ILW A;  3A54 A;  3FPP A;  4XTC S;  4QMG A;  4HMJ A;  4HN7 A;  1LAC A;  3RZO B;  3Q24 A;  3G7L A;  4FF1 A;  3SK5 A;  1MBY A;  2RBM A;  1SE4 A;  4EQP A;  2E75 C;  1KDA A;  1SFO B;  3TSS A;  1EZ8 A;  5CBE E;  4WJW A;  1DJR D;  3KLR A;  3K5O A;  2JEB I;  2WAC A;  4M1U B;  2AWN A;  3GQB A;  3QJY A;  4I65 A;  1FNW A;  2BE5 D;  4KN4 C;  2F0Q A;  1IYV A;  1Y1V B;  2D2C C;  2SEB D;  3MA2 B;  1W6J A;  1KAA A;  2F0J A;  3C2P A;  1PZI D;  4LK1 C;  3T16 A;  3GTL B;  4RCO A;  3BVM A;  1NCV A;  1QJO A;  3SXH A;  1PZK D;  2PYK A;  4K2K A;  2MUY A;  2KHS A;  2IX3 A;  5LHY 1;  1V1O A;  3BDO A;  3MXP A;  5JEA G;  4NDX A;  5M5W B;  4HAE A;  1AW7 A;  4FF3 A;  3QWN A;  2K04 A;  4IFD I;  4FYD A;  4DXG A;  4TRD A;  4ZK9 B;  3R93 A;  1KNA A;  5C6A A;  3ERQ A;  1JR0 D;  1STG A;  3OIP A;  3V96 A;  2EDG A;  2B39 A;  3ERO A;  1HFN A;  3KUP A;  1QG7 A;  2CQA A;  1A6X A;  5I6W A;  1G91 A;  1DXM A;  2B2Y C;  3N52 A;  4BY1 B;  2F3V A;  1I4P A;  5KIX A;  1SYE A;  4CJ2 C;  2EY2 A;  1SDF A;  4H7B A;  4IUV A;  3SE0 A;  1VF5 C;  2ZT9 C;  2DY7 A;  2BA0 A;  3Q0A A;  2R92 B;  2RDG A;  1E2W A;  2MGS A;  3FMC A;  1YNJ C;  4C3H G;  1G2T A;  1IL8 A;  1B2T A;  2CHB D;  2JEA I;  3MZ5 A;  4MIU A;  1IYU A;  2B2W A;  1BCP B;  1H9S B;  3NBH A;  2K7V A;  2K01 A;  4GZY C;  1EYA A;  3D6W A;  2EJM A;  2A6E C;  4TKO B;  4FF4 A;  3D31 A;  1ET9 A;  3I91 A;  2NYZ D;  4XYQ A;  1T5X D;  2C5C A;  3OWF A;  3HOZ B;  3KLS A;  1CM9 A;  2KOL A;  2PW7 A;  1VF7 A;  1RF2 D;  3MXN A;  1EFI D;  4YIJ A;  1LO5 D;  5DM6 3;  1BOS A;  3S1Q B;  2JXM B;  1JC7 A;  1GXD C;  1Y8N B;  5CGK A;  4CGY B;  3MXU A;  2OT2 A;  1ENF A;  3SK8 A;  2EYP A;  4C1N I;  3ZYY X;  3FDT A;  4RGM A;  3IL8 A;  3R2I A;  5FLX E;  3LX0 A;  1OXU A;  2NTS A;  1X3Q A;  1H9R A;  1YNN D;  2J4X A;  3PV0 A;  4IN3 A;  4F7X A;  4OIJ A;  1TY2 A;  4HMI A;  1I4X A;  2QEJ C;  1ROD A;  5A2Q E;  4FXD A;  1F2M A;  4OGQ C;  3A8K E;  4HR7 B;  4JK1 C;  3MVV A;  3SEB A;  5I9O A;  5M5X B;  4DF7 A;  3I70 A;  1LTI D;  3IFD A;  1B9N A;  3NTK A;  5IGF A;  1BO0 A;  5NUC A;  3OPO A;  4RGN A;  1STN A;  1LTT D;  2O5J C;  1XWE A;  1EY6 A;  3L3O C;  1PFB A;  3FRP B;  4PMB A;  4KMU C;  1Q8I A;  3OOC A;  5C0X J;  1SJE D;  3KF8 A;  2A68 D;  3TME A;  4ID6 A;  1ET6 A;  1HRJ A;  2EY5 A;  4R8N A;  5KGU A;  1B1Z A;  3QB3 A;  5C3W A;  3GTJ B;  3SK6 A;  1TWF B;  1EZ6 A;  1RHP A;  1WTQ A;  4BBS B;  4IUT A;  2JA6 B;  4O42 A;  3F2U A;  4PV1 C;  2M2L A;  3KLS X;  2R93 B;  1Z47 A;  2EJG C;  2IL8 A;  2PZU A;  4PMW A;  4EVO A;  3DUZ A;  3HOV B;  2HUG A;  3J80 L;  3I73 A;  3WDN A;  1TKW B;  1S5F D;  1STH A;  3AMU A;  5JEA J;  3VA7 A;  1C4Q A;  1HPC A;  2XSC A;  2IT1 A;  3JAM E;  3O13 A;  1HXY D;  2A73 B;  1SE2 A;  2TSS A;  3G6J B;  1I4R A;  1NR2 A;  3J81 L;  1Q1B A;  1EOT A;  4K5W A;  3S16 B;  3VYT A;  1CZG A;  2L5T A;  4OL7 A;  5C5M A;  1JOQ A;  2NB0 A;  4Q5V A;  1EY8 A;  1STA A;  3T53 B;  1SNP A;  5CBA E;  4XYO A;  2BOS A;  1ZYR D;  1OO9 B;  3S2D B;  2GA4 B;  2WIN B;  3SVM A;  1O78 A;  3A7L A;  1B53 A;  3PUZ A;  2F0S A;  4UAI A;  3CQZ B;  3AU7 A;  3HKZ B;  2OEO A;  5FOB B;  3MEH A;  2FMC A;  1LT3 D;  1ESF A;  4LAA A;  5C5L A;  4KHV A;  1SNQ A;  1K83 B;  5M5Y B;  1G8Z D;  2B2V C;  4BY7 B;  1TR5 A;  4DA2 A;  3M85 A;  2WB1 B;  3R8B A;  3PUX A;  2K33 A;  5KNB A;  5IIF A;  3PIO 3;  2Q8I B;  3VYS A;  3MFG A;  1DOL A;  1SEB D;  2O4X A;  4FO2 A;  3NUC A;  2IWH A;  1PRT B;  5AFW A;  1TS3 A;  4K8I A;  4DK0 A;  4U68 A;  4IFD H;  4ZKB B;  2WKD A;  5G3L D;  5JPM C;  1F9R A;  3S17 B;  1STB A;  1R4P B;  2EXZ A;  3VR5 A;  2F0K A;  3C46 A;  3MC0 B;  3SK4 A;  4I7Z C;  4IAL A;  1VMP A;  5KND A;  1EU4 A;  1RTO A;  2KEE A;  2F4I A;  1I4Q A;  5CV5 A;  3U9S A;  5ELF A;  1V8Q A;  1SMY D;  2L12 A;  4EQO A;  4HTH A;  4Q0F A;  4ODG A;  4F88 A;  1ZKO A;  1IKM A;  1WTR A;  5CC4 A;  5I4D A;  4RCN A;  2EOT A;  2LMC B;  1ML0 D;  4A3E B;  1EWH A;  1MSH A;  2F0V A;  1W6K A;  2KED A;  4ME5 A;  2PCF B;  3A55 A;  3TZD A;  1RTN A;  2DN8 A;  5DM7 3;  5A2Q L;  5C3E B;  5EGT A;  3U9O A;  3K57 A;  2RSO A;  2PZW A;  3EJI A;  4A3J B;  4FNF A;  1DYQ A;  5I9P A;  1J9O A;  2FJ2 A;  5M3F B;  2PQE A;  3L9A X;  3DXJ C;  1AZQ A;  5K36 G;  1JWU D;  2F0U A;  5LL6 S;  2KVM A;  3BVG A;  1R9T B;  2B63 B;  2B2Y A;  1PFM A;  1JWM D;  2XNA C;  2F0N A;  2M9V A;  4ABN A;  5C0X G;  1A3U A;  1NR4 A;  4C3J G;  3RD4 A;  3BDL A;  1ENC A;  2JP1 A;  4K14 A;  3QOL A;  2A74 C;  1CT1 D;  1OXV A;  5JVG 3;  3I3C A;  4RKL A;  1JOO A;  1E2V A;  1Y1W B;  3QIA A;  4CJ1 B;  2K03 A;  1QE6 A;  2RDH A;  3TP8 A;  3QOJ A;  3OMC A;  1HUM A;  4FF2 A;  3X3N A;  2ID0 A;  5G3L F;  1R4Q B;  4BA2 I;  1FNU A;  3URY A;  5J39 A;  2R3Z A;  4C56 C;  2V4D A;  4NW2 A;  3OWE B;  4ZRZ A;  1ZEQ X;  4EQN A;  1OXT A;  1I4G A;  1SYF A;  3DEP A;  2ICE C;  3OW7 A;  3IFT A;  3GV3 A;  2KCN A;  2E74 C;  1MI2 A;  2EYJ A;  3P1H A;  2EY6 A;  4A93 B;  4ZUI A;  4KJO A;  2HQE A;  4C3I G;  1MSG A;  1SYB A;  3MAQ A;  1DCZ A;  2E2I B;  5A35 A;  2Q8R E;  2CW0 C;  1ILP A;  1M4V A;  1Q3L A;  1GUO A;  4A3K B;  3M4O B;  3I4L A;  2D62 A;  1FNV A;  4IUP A;  4CJ0 B;  1GHJ A;  5FO7 B;  1GHK A;  4QF4 A;  4RA8 A;  1TY0 A;  2FFK B;  2KCC A;  1PZJ D;  2DNE A;  3K6O A;  2VB2 X;  2X69 A;  5EKI A;  5JJZ A;  4E6I A;  2ENB A;  3GTQ B;  5C44 B;  3M7G A;  1GOZ A;  1PTO C;  2CW0 D;  4CKE A;  1F2L A;  3T56 B;  2DNC A;  4H44 C;  2M00 A;  2WP8 J;  3J7Y W;  5KRU A;  3ND9 A;  3S1R B;  5CV8 A;  3BYY B;  2ZXR A;  1I6V C;  1LTR D;  1TQO A;  1CA5 A;  3DWP A;  3D8G A;  1RJT A;  5ELC A;  1PDQ A;  4KY6 A;  2AUJ D;  1B50 A;  5CV6 A;  1VCI A;  4RHS A;  1YNJ D;  5BN3 A;  5DNF A;  3PO3 B;  3NXW A;  1QCB D;  2F0H A;  3R3O A;  1F9P A;  4QCL A;  1PTO D;  5K36 H;  1TWA B;  1KDC A;  5I6Y A;  1CA6 A;  3J7A V;  5D65 A;  2A6E D;  2AQ2 B;  2R6G A;  4XT1 B;  3PIP 3;  4G57 A;  5C0X H;  3DEO A;  4FP5 D;  3QG1 A;  3IAY A;  4DGZ A;  2XRS D;  2AWO A;  1V43 A;  5EPJ A;  3HRZ C;  2FIN B;  3K5M A;  2MPM A;  1SNO A;  2B2T C;  3QO2 A;  2C9O A;  1RDP D;  1WD1 A;  4XQJ A;  1CQF A;  1C8C A;  4TSS A;  2Y0S B;  3V05 A;  4KN7 C;  2QF7 A;  2NN6 G;  3PO2 B;  1UEA B;  4EGV A;  4R8I A;  4XQQ A;  5C4H A;  4R9W A;  2Z1C A;  3HOX B;  2L55 A;  1F77 A;  4XDX A;  3NE5 B;  4BWG B;  3DHQ A;  3OIQ A;  1CZW A;  2NVT B;  1XXG A;  4K5X A;  1EIH A;  4QUC A;  2KUM A;  2IW3 A;  2K05 A;  3GTK B;  1Q12 A;  5IOC A;  4Y7N B;  3CHB D;  1D5Z C;  1QNK A;  4MHE A;  3V2T A;  2EY1 A;  1EWC A;  5JEA H;  1EU3 A;  1X3P A;  4ULL A;  2QDB A;  1PMR A;  4L6T B;  5EKL A;  1X32 A;  2F1M A;  3H94 A;  3NSW A;  2EYM A;  4N9P A;  2Z4H A;  2O5I C;  2K28 A;  3P75 A;  1CTM A;  1JOK A;  2XVS A;  1WTP A;  1II3 A;  4IUQ A;  3E0J A;  2IPK D;  1PTO H;  5F2D A;  3C1E A;  1XTC D;  2A69 C;  1A2U A;  4S3S A;  4IUR A;  3MWY W;  2B2V A;  1TII D;  2XWJ B;  1J8I A;  1GUW A;  1BUV T;  5DEH A;  1A15 A;  5KYI A;  1AZP A;  3HOY B;  1XX8 A;  4DAY A;  3NK9 A;  4QB4 A;  3GP7 A;  4K2L A;  2J0T D;  3D6C A;  4F8M A;  3TBI B;  2NZ1 D;  4RH6 A;  4V19 0;  1PTO F;  3K58 A;  3RZD B;  1KLG D;  3NPP A;  5CR3 A;  1U4P A;  4P2C B;  1PTO B;  5E1F A;  2RDF A;  4NKL A;  1B3A A;  2B2U C;  5CV7 A;  2EZV A;  1I50 B;  2HCC A;  4CBV A;  1G29 1;  5K5P A;  3VYR A;  1V1P A;  2FHT A;  3I72 A;  3OMG A;  1SJH D;  1NUC A;  3GD7 A;  4KJN A;  2XIW A;  3P7J A;  1DON A;  3DWQ A;  2RA4 A;  2RVL A;  4C3H B;  2A5H A;  1H9J A;  1EIG A;  5HUR A;  4XXE A;  3SR1 A;  1U4R A;  1WD0 A;  3T13 A;  2EYO A;  3R2T A;  4IQZ A;  3K59 A;  1EEF D;  5C0X I;  1DM0 B;  4IZ8 A;  1IKL A;  1OXX K;  2L11 A;  3BVZ A;  5T1G A;  5TSS A;  1HHV A;  2I46 A;  1SE3 A;  1ONL A;  5CMD A;  1Q90 A;  1O7Y A;  5FKA C;  1S5D D;  2FMM A;  4DFA A;  3SHL A;  4F87 A;  1RCV D;  2LY7 A;  1DZ1 A;  3OHX C;  2HDL A;  2NVQ B;  2JYO A;  2F0D A;  3FPU B;  2NN6 H;  5EBD A;  2L9H A;  3Q6S A;  2LKV A;  1HTL D;  3KBX A;  3NBI A;  3S2H B;  4ZQ3 A;  1HQM C;  3TDQ A;  1U4M A;  1VMC A;  4FVM A;  1SAP A;  2H1E A;  4KV6 A;  1GUT A;  2F0O A;  1S4Z A;  4A3M B;  3A8I E;  2AQ1 B;  3HP3 A;  5CYU A;  3K5N A;  1CHQ D;  4X3T A;  1LT5 D;  4KD3 A;  1DOK A;  1RD9 D;  3I90 A;  2VB3 X;  4J1M A;  1JWS D;  1JQY D;  2F0W A;  4H13 C;  3N6R A;  4KKT A;  5J22 A;  1IW7 C;  1UAP A;  1G6Z A;  1H9M A;  3J7A F;  3BDC A;  5JAV A;  1OXS C;  1FD7 D;  4JBW A;  3WOF A;  2WV6 D;  1GUG A;  4MN3 A;  3RUZ A;  3VR4 A;  4DAV A;  4K8J A;  1STY A;  1GUS A;  4OIK A;  2HDM A;  3L7Z C;  5FLX L;  1CFM A;  4ZYS A;  1ESR A;  2A6H C;  3GTP B;  3D4R A;  1I6H B;  4TQU S;  1TS5 A;  2KQ3 A;  1BCP C;  3RLF A;  4HSP A;  1SND A;  4WRD A;  4B9X A;  3WOE A;  5EBC A;  4KKU A;  1A3T A;  1DOM A;  1IW7 D;  3NQT A;  1B44 D;  2PW5 A;  5I2X A;  3E6Z X;  5ELB A;  3C3L A;  3MTS A;  3K5L A;  1CHP D;  2BDO A;  5EPK A;  5E3F A;  3AB9 A;  2VUM B;  2QCP X;  5T1I A;  3FVQ A;  3OSO A;  4ZUJ A;  2ZXO A;  1LTS D;  1U9R A;  4B9W A;  2EVB A;  1B9M A;  3CRK C;  4Z9C B;  3RMH A;  2BE5 C;  1JB3 A;  3HZX A;  3TP5 A;  4K6L A;  2N55 A;  4FXK C;  5JVH 3;  2F0M A;  3NTH A;  2MHV A;  2YU9 B;  2E76 C;  2PO4 A;  2K5D A;  4IUN A;  1EQT A;  3LNN A;  2Z4I A;  3K7A B;  5D3D A;  4J6H A;  3VYU A;  1A3V A;  1TWC B;  3K0Y A;  4XIG S;  1WVL A;  2JA8 B;  2K1B A;  2F03 A;  3J80 E;  4PMC A;  1EY7 A;  1EY4 A;  5JOB A;  4KKS A;  3PUV A;  5E4W C;  4G7H C;  1LTA D;  1LTB D;  1SXT A;  2RSN A;  2O2L D;  1LT4 D;  1Z7T A;  4DXF A;  1WTW A;  5BN5 A;  1HQR D;  2NN6 I;  1TT2 A;  2PMZ B;  4KD4 A;  3PMF A;  1PFN A;  5M9O A;  4AYB B;  3J81 E;  1QWY A;  2F3W A;  2PNR C;  3M7N A;  2J7Z A;  1BNZ A;  2L1B A;  3MHB A;  2DY8 A;  3MFY A;  3JAM L;  3I8Z A;  2EPB A;  4DN4 M;  2Q8T A;  2JE6 I;  3SDZ A;  5KNC A;  1Q1E A;  1STE A;  3Q22 A;  3GV6 A;  1KTK A;  1KLU D;  1CI3 M;  3H3V C;  1S5B D;  4K6D A;  4QUF A;  5IT9 E;  1CQV A;  2B2T A;  1V1P B;  1WTV A;  1MGS A;  2BA1 A;  1A2T A;  4LMQ D;  5I2Y A;  4DK1 A;  1AP0 A;  3A56 A;  4DNT B;  1PLF A;  3X3M A;  3BS1 A;  2B8G A;  1L0X B;  1LV9 A;  2B8F A;  1FYC A;  3BYT B;  4H0L C;  1K8M A;  4L8J A;  3MXG A;  2RKS A;  4J8Q A;  1D6E C;  4KY7 A;  2QKI C;  2K32 A;  1SNM A;  3D4D A;  5COR A;  1JCK B;  2X6L A;  3S1M B;  2CVR A;  3EA6 A;  4G7O C;  1BCP F;  4U67 3;  4DNR B;  3HS0 C;  4OO1 G;  1BR9 A;  2BDN A;  4X3S A;  4KK7 A;  2F0L A;  4G4K A;  3P20 A;  2ZXP A;  4BA1 I;  2E2J B;  4CKB A;  4A3I B;  1HA6 A;  2G9D A;  4DU9 A;  1EL0 A;  1SYD A;  3HEJ A;  1EYD A;  3FKI B;  2XRQ D;  2TMP A;  1F2Z A;  3CU7 A;  1HCZ A;  1YNN C;  1QNU A;  5EQ0 A;  3I4N B;  5EJW A;  2KJX A;  1JE4 A;  4LJZ C;  1EYC A;  1F2Y A;  1QOH A;  1VDZ A;  2NTT A;  2NWG A;  4RAU C;  5EKK A;  3I4M B;  3HOU B;  1Y69 U;  1BXT A;  1TWG B;  2L4N A;  2L0C A;  4A3B B;  3DWA A;  2BCO A;  5HGT A;  4FXG C;  3T51 B;  2F0I A;  1H9K A;  2ICI A;  4DAP A;  2D9U A;  2QIL A;  1S5E D;  2VXW A;  4RGT A;  3ITP A;  5C3X A;  4KHZ A;  3KK7 A;  1SBB B;  5D3I B;  2N88 A;  5J1Z A;  1LT6 D;  4B08 A;  1LTG D;  5FO9 B;  5COY A;  5IGE A;  2PPB C;  3VR2 A;  2A68 C;  2IX0 A;  1SYC A;  1TS2 A;  1NSN S;  4BS9 A;  2E2D C;  1JOR A;  2R7Z B;  2F0T A;  2B2U A;  4C3J B;  1SSO A;  4O1N A;  4PQX A;  1PRT C;  4X3U A;  1PYW D;  1BDO A;  3TZU A;  1TU2 B;  1XYI A;  3VA5 A;  2LFN A;  4RFB A;  1GJX A;  2AQ3 B;  2B2W C;  3BZD B;  1M8A A;  2XWB B;  4BBR B;  1D5X C;  4IFD G;  3GTM B;  2XN9 C;  3NWS A;  1BBX C;  2AUK A;  1E0B A;  3GO5 A;  1QIL A;  4XT3 B;  4CHT B;  2SNS A;  3VR6 A;  3NP8 A;  1GUN A;  1PRT D;  2YYZ A;  4X3K A;  1TS4 A;  3W2D A;  4RHR A;  4NP5 A;  3ND8 A;  3TP6 A;  2F0G A;  1D1I A;  5JPN C;  4C2M B;  3LWU A;  1I3Q B;  3T4A C;  1FR3 A;  4C3I B;  1HTP A;  3H0G B;  2F0F A;  2WAQ B;  3NTI A;  3UI2 A;  4V0B A;  1ICW A;  4HCS A;  3BG3 A;  3IKJ A;  4HSV A;  2D5D A;  1KDB A;  3TP7 A;  5C4Z A;  1ILQ A;  4PNY A;  3EQL C;  2IJ0 A;  5IGB A;  1Y8P B;  4RWS C;  3E5S A;  3HOW B;  2SOB A;  4K5V A;  2OXP A;  3TN2 A;  2LS0 1;  4UDU C;  1ZYR C;  3EFX D;  2A69 D;  3H6M A;  1F9Q A;  4OO1 H;  2OF1 A;  2WII B;  2JA7 B;  1T5E A;  2R61 A;  1SNC A;  1BQQ T;  3PUW A;  2NVX B;  2NUC A;  3NHH A;  4L63 B;  4RGO S;  1TVX A;  1NAP A;  1CK1 A;  2G9H D;  1G2S A;  1UNS A;  3S1N B;  2X6G A;  5ELE A;  2H4O A;  3A7A B;  3S15 B;  2VNU D;  1O7L A;  2IX1 A;  2K5W A;  1ENA A;  3DM1 A;  1BF4 A;  1U4L A;  5FK9 C;  1UUP A;  2MP1 A;  3H91 A;  5CV9 A;  3A8J E;  1D1K A;  3D3R A;  4RKB A;  3Q23 A;  4N9T A;  1Z6H A;  1HA5 A;  1EY5 A;  5KYL A;  5IT9 L;  1S5C D;  1H9S A;  4KY5 A;  1HFG A;  4WFN 3;  2EYH A;  3ONA B;  4HED A;  2EJF C;  3EVQ A;  1I4H A;  4A3F B;  4A3D B;  2K5Q A;  3VR3 A;  1DD2 A;  3M3Y B;  5KEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...