3A8KE

Crystal structure of etd97n-ehred complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
125
Chain Sequence
NVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLED
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transport protein
total genus 29
structure length 125
sequence length 126
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3a8kE00
3KLRA 3W3AA 1VF5C 2PPBC 2CW0C 4IFDG 4OO1H 2O5JC 4IFDH 1V43A 4DNRB 4L8JA 3SE0A 5K36G 2A6ED 4XTCS 3WDNA 1LABA 5K36H 1Y8OB 3A8KE 1H9MA 2E74C 1SMYC 1Q90A 4KHZA 1DXMA 1H9SB 1PMRA 3A8IE 3H94A 3GQBA 1H9JA 1H9SA 3D4RA 1Q1BA 4IQZA 1LACA 2A68D 3DXJC 4G7OC 1IYUA 2AUKA 2Q8IB 1DCZA 3T53B 1ZYRC 3FPPA 1GUNA 3IKJA 2D5DA 2D2CC 3P20A 3T51B 1HTPA 1Y8NB 4KKTA 3CRKC 2A6EC 2EJMA 3LNNA 3I4LA 5A35A 1VF7A 1B9MA 2EJGC 2B8FA 2O5IC 1A6XA 3A7AB 2K32A 2BA1A 3N6RA 2A68C 3OOCA 3U9SA 2BE5D 4TQUS 1YNJC 1VDZA 2JEAI 1CFMA 2BA0A 2JXMB 1G291 2JEBI 3VR5A 3NE5B 4DNTB 3IFTA 2PNRC 3A8JE 1H9RA 1HQMC 2E75C 2YYZA 1T5EA 3T56B 1IW7C 2L5TA 3PUZA 1HCZA 1DD2A 1E2WA 1Z6HA 1I6VC 2EVBA 2K7VA 4G7HC 3CRLC 3FMCA 2JE6I 4H0LC 3VR6A 4DK1A 5KNDA 4RCNA 4KKUA 4KKSA 4XIGS 5BN3A 3M85A 2AWOA 1OXSC 3ND9A 4KMUC 1V8QA 2BE5C 2BDOA 1CI3M 1GUSA 1O78A 3EQLC 1TKWB 1Q12A 1IYVA 3VR4A 1GUGA 2QF7A 3BDOA 5C0XH 1Y69U 1Y8PB 3MFYA 3LWUA 2A6HD 2V4DA 2E76C 4KI0A 3VR3A 1YNNC 4TKOB 4BA2I 1ZKOA 3A7LA 1H9KA 2ZT9C 4KN4C 3SDZA 2R6GA 3L7ZC 2NN6I 3PUVA 4BA1I 5C0XG 2B8GA 3OPOA 3D31A 2KA7A 1BDOA 1ONLA 2IT1A 3QJYA 4KN7C 2EJFC 1K8MA 4OGQC 1OXUA 2PCFB 1VCIA 3MXUA 4LK1C 1K8OA 2AUJD 3QIAA 4JBWA 4GZYC 2A6HC 1CTMA 1FR3A 3PUYA 3ND8A 5KNCA 5KNBA 1GHJA 1B9NA 1GUOA 2A69D 2EDGA 3TZUA 1HPCA 1TU2B 3GD7A 1QJOA 3M4YA 4PV1C 3RLFA 1Z7TA 1E2VA 1GJXA 1OXVA 4H44C 2NN6G 1E2ZA 3AB9A 3PUWA 4H13C 1OXTA 2KCCA 1FYCA 4JK1C 4DK0A 1GHKA 2DNCA 2NN6H 3I73A 1GUTA 3VA7A 1Q1EA 2DN8A 5JEAG 5BN5A 2K33A 2A69C 5JEAH 3I72A 1OXXK 1O7LA 4HR7B 2LMCB 2F1MA 3VR2A 3BG3A 3HGBA 2D62A 3PUXA 3QG1A 4I7ZC 3PV0A 5BN4A 1EWHA 1IW7D 4LJZC 3M7NA 3OW7A 4G7ZC 2DNEA 4OO1G
chains in the Genus database with same CATH superfamily
3TS2A 5LMNL 4OELB 4IFDH 1VQLA 3SE0A 1ENCA 2ATWA 4EX5A 1HZBA 1RHPA 2KEEA 3FKIH 1CT1D 5CBAE 3EIVA 3P7JA 3IL8A 3MAQA 3VYSA 1QVCA 1FVIA 2H5XA 2K52A 3HOYG 5CV7A 4RGOS 2F4VL 2R7FA 1CZWA 2H1EA 1J9OA 3HOWG 4B3RQ 1VQ8A 2HIXA 3D8GA 5AFWA 1KL9A 1STHA 3D6WA 4KHPL 3WOFA 1M1KC 3RZOB 4ODGA 4UY8C 1IBMQ 1KDBA 2F0KA 1SNPA 4EQPA 3CHBD 1IXRA 4ZUIA 2K5DA 4X64L 1B8AA 2L12A 4C3IB 2YTVA 5J3BA 4DR1L 1E2WA 4DR4Q 2VUMH 1EY5A 4I65A 3CW2C 2HDMA 2JA5B 3NWTA 1C7YA 1QUQA 1G91A 2HHHQ 1SE8A 3VR4A 5LHY1 1B2TA 2EIFA 1QCBD 4O0AA 2WKCA 2PW5A 1JJ2A 5HY6A 1YVCA 2WKDA 2PI2E 1SJED 2R6GA 1EY0A 3S1NH 5IOCA 5M5WH 1YJWA 1SNCA 1SNDA 1XYIA 4LFCL 4B3SQ 3H0GB 1TXYA 1I4XA 1A3TA 2G9DA 4B3ML 4HIOA 4A3BH 2XRSD 4HJ7A 5KNBA 2LFNA 3GTLH 4A3GH 1HPCA 1RDPD 1F9SA 3J81i 3NP8A 2PNHA 4H44C 2IW3A 4DFAA 5IY0A 4OWTB 3FEWX 1A3VA 5CV8A 4ZQ3A 2E8GA 2DN8A 1Y1WG 4BY7H 1UUPA 1XTDA 3J81j 1JMCA 3VYRA 2OT2A 3MFGA 5M3FH 3R2IA 1O7LA 1XXGA 3J80L 5KRUA 3J81E 4L5SA 3QG1A 1SYDA 5BR8Q 4A3MG 2RKSA 2IX0A 3I4NH 4IALA 1WCMG 2E5LQ 1BF4A 4L5TA 2NVXB 4LF7Q 3KF8A 1LTRD 3FP9A 2K5WA 2ZXRA 4C3HG 3OIQA 3RMHA 1PMRA 3BVMA 4BY1G 1JR0D 3H3VI 2UU9Q 5EKKA 3K7AH 4GNXA 1F77A 2NTTA 4HEDA 4CBVA 4TRDA 1ET6A 4FP5D 5FLMH 3V96A 3CMAA 1LTID 3HOZG 2F0DA 1CQFA 2AWNA 1TWCB 1X3QA 1ML0D 3KJOA 3GO5A 4BXXG 2YV5A 1IKMA 5FOBB 2YTYA 1QZGA 1ESRA 1YNJC 1UAPA 4ILWA 4B3RL 2EYFA 4LF8Q 1XTCD 1WVLA 4K2KA 1WTHA 4HCSA 1IBML 3HKZE 1WOCA 3U4ZA 4DAYB 3S16B 5C3WA 1Y1VG 4H0LC 1QB5D 3MXPA 4PMWA 4XIGS 3HKSA 5G3LD 3DWAA 3CD6A 2XIWA 3HOXB 4A93G 3T1HQ 1TS3A 3GTOH 1JE5A 3SDZA 2QA4A 1ZEQX 4NKLA 3TREA 3E9IA 4JVZA 2I5MX 2RBMA 4A3KH 4LUZA 1IYJB 5GAEC 2Y0SE 5ELBA 1XMOQ 3GTPB 1LYLA 3A5ZB 3KK7A 4JI5Q 4B3SL 4N8X1 1X9NA 1RIPA 1TU2B 2H4OA 1C48A 1LUZA 5I9OA 2VNUD 2MUYA 1OTCA 3PUWA 3OIPA 4H13C 1DJRD 5M3MH 4WJWA 1C4QA 2BCOA 3S1QH 2KOLA 1H95A 4K5VA 2B39A 1WTQA 1ESFA 2K05A 5E3FA 3GP7A 3T13A 3L3OC 4MTNA 1N36Q 3CPWA 3CCUA 2SEBD 2WFWA 3KFUA 3D3RA 2A8VA 3OTOL 4X3TA 3W3AA 5C0XI 1R9TH 2TSSA 5BR8L 4DNRB 2YU9H 4HTHA 4HCEA 3A5UA 4A3FH 3FHWA 5K36H 1IBLL 1H9MA 1VQNA 1LT4D 3EJIA 4C3IG 2E5LL 4KY5A 5IGGA 4LF7L 1RTNA 4HJ9A 1VQPA 1PH1A 4GLAC 4C2MB 2A5HA 2JA5G 3M4OB 3T53B 1VQBA 1SE4A 2VY3A 2ENBA 1FGBD 1CSPA 1WTRA 1O7ZA 5M5XB 1VQ7A 1CHPD 4A75A 1U4MA 3I4MB 1HQRD 2NYZD 4IPHA 2OQ0A 4X65Q 2NWGA 5T1GA 2JEAI 3H0GG 1K3RA 1SE3A 3KJPA 2BH2A 1G51A 3OSOA 1HQMC 2R61A 1W3SA 3J7A5 2CH4W 4LF8L 2G9HD 2RSOA 3TS0A 5J1ZA 4DR2Q 2EY5A 2BDOA 2FMMA 4JCVE 1IYVA 2F0IA 4IJLA 4DR7Q 2F0TA 2CVRA 3RLNA 1Y14B 1G8ZD 3J81L 2ZT9C 5AJ3L 1JJGA 1B53A 4K6LA 2Z9HA 4XDXA 2Z6BA 1JWUD 3O13A 3OPOA 3DEOA 3T1HL 3H3VH 1ONLA 1SEBD 5J39A 1X6OA 1MHWC 5EPJA 1JE4A 2J7ZA 3MXUA 4MHEA 3AMUA 4XYQA 4JI4L 2Z8LA 3TN2A 2XWJB 2IY5B 1GHJA 4DV5Q 2R93B 3BDLA 1XMOL 2C35B 3PF5A 1PHJA 1SXTA 3M4PA 1CA6A 4X66Q 2SNMA 1WTOA 4QJFA 2L9HA 2KJXA 1S5BD 2MFIA 5JEAG 4C3JB 3F1ZA 1NR4A 2IJ0A 2N49A 1LTTD 5C4JB 2JA7B 4MN3A 4UP8A 2AQ2B 3T4AC 5JPMC 1JORA 5IGEA 3S14H 2KCNA 3Q24A 2IHFA 1Q46A 3URYA 1N36L 5KGUA 2OEOA 3QOLA 5IODA 1BBXC 3MXGA 4RKLA 4A3LG 4K6DA 5C4ZA 1WD1A 3ICEA 3MEFA 1QVGA 3BJUA 1UE1A 1TWAB 2PZTA 3ULLA 3OYYA 4NPSA 1I5FA 4P75A 2C5CA 1ZYRC 4LW1A 1O7IA 5EQ0A 4DV0L 4PMCA 1P16A 4R1JA 5FK9C 2BDNA 3HOXG 4IPGA 5C5LA 2SOBA 1YHBA 3T1YL 2L1BA 1WJJA 2Z6KA 2EYHA 3S9WA 1ET9A 3G7LA 1L0YB 1EQTA 3NE5B 4RA8A 1I94L 3A8JE 4JBJA 3BZDB 3GDEA 1EIFA 1HCZA 2G5DA 2TMPA 2K7VA 2EOTA 3M85A 4BBSH 4RHSA 4KKUA 3DM1A 1ENAA 3CC2A 1A8VA 5C0XH 3KYHC 3CCEA 3HOXH 4O1NA 4GOPA 3MZ5A 5LL6S 1FNUA 3A7LA 4HSVA 4DK3C 4DR7L 2JA9A 1ICWA 2B3GA 3QJYA 4IUTA 4UP9A 4LK1C 2AUJD 3QIAA 4JI3Q 5D65A 2VUMB 1STYA 4CDEC 1KLUD 4MNOA 3L9AX 1V1PA 2SNSA 3JC66 1HR0Q 4ME5A 1E2ZA 5IGDA 1VQGA 4DV5L 1YJ9A 2QGQA 2F3WA 3SK8A 1FD7D 5A2QE 4IFDI 1XNRQ 3AFQA 3H3VC 3S1NB 1EIHA 5M5WB 5BN5A 1PTOH 3QWNA 4YWKA 1AZQA 5IWAL 1W6KA 1VQ5A 4I7ZC 4A3BB 1LV9A 2NZOA 4LUVA 2KCTA 2PMZB 1VQCA 3OW2A 2PZWA 2A19A 3I4MG 1AE3A 2WV6D 3GTLB 4A3GB 5IP9G 3HZXA 4QMGA 3I90A 1MGSA 5CGKA 1XNQQ 3A8IE 3GTMH 2N3SA 5C6AA 4BY7B 1AZPA 4A3DH 1TWGH 3DXJC 5TSSA 1IYUA 1PZKD 4R4QA 1L2FA 1LM0A 5M3FB 4LF9Q 3T51B 3TMEA 4F8MA 1J5EL 1B50A 4YY3Q 1PTOF 2NBFA 3LX0A 5A35A 1IHZA 2HD3A 3HOVH 3I4NB 4JV5Q 4YHHL 2RQXA 3C46A 3N6RA 2A68C 3U9SA 1Z9FA 1X3EA 2P5ZX 2VQEQ 2OWOA 1EY7A 5HGTA 2XWBB 1IZ6A 3VR5A 1W2BA 1S5ED 1H9RA 4A76A 2F0HA 2CH4A 2EVBA 2O2LD 3K7AB 2E2HH 2R93G 2UUCQ 1G6PA 1QG7A 4QUFA 1CI3M 1XJVA 1Q12A 1VQAA 2QW7A 2K1BA 3G4SA 2MO0A 4Q0FA 4LAAA 4QGUA 4C3JG 4EQOA 4R8IA 3FPUB 4P74A 1K0SA 4DAMA 1D7QA 4BA1I 1KNEA 2B8GA 2L55A 2JA7G 2NVYH 4YIJA 3L2PA 3K57A 1PZJD 5ELFA 4ALPA 1A0IA 1W6JA 4OXPA 4RG1A 4PZ6A 1BXTA 2VB3X 1J6QA 3AU7A 3G6JB 4QIWB 4F88A 2B2YA 3GD7A 1NE3A 3U58A 1EQQA 4DR5Q 1K28A 3MWYW 4JI3L 4FDBA 3J7ZC 3SK5A 3H91A 2KENA 1FYCA 3C1FA 1C9OA 4GN4B 4DV7Q 3GTOB 1HR0L 2M00A 5LMUQ 2M9VA 3HP3A 1CKNB 2SDFA 4A3KB 3STBC 3PO2B 2PO4A 3NUCA 3KF6B 1KQSA 1CQVA 4RCOA 2BH8A 4KHZA 4HMIA 1RF2D 2B2WA 2ASBA 2CW0C 1QZHA 4IFDG 2OTLA 1GKHA 3RN5A 2B2UC 1PRTF 5DNFA 5M3MB 3A0JA 3SEBA 5LMNW 1PTOC 2N8NA 1BCPF 3GQBA 5EPKA 3S1QB 2WB1B 1SRUA 1GVPA 2RA4A 3S1MH 1CK1A 1DCZA 1I50H 3D4WA 3J7AF 3IKJA 2ZM6L 4U68A 3CCMA 1N9WA 2A6EC 4LWCA 2EJMA 3EBEA 1G2TA 5IT9E 4J8QA 1B9MA 4IN3A 4LF9L 2IX1A 4MZ9A 2AKWB 1B4OA 3H15A 1R9TB 3DUZA 4YY3L 4RGTA 3R8BA 2YU9B 1A2UA 5DEHA 1SLJA 1IL2A 3DWPA 4A3FB 4JV5L 5IP7G 4B9XA 4DNTB 3IFTA 3UE0A 1C0AA 4F7XA 2VUMG 3NBHA 2VQEL 3NXWA 3EN2A 1STEA 4FF3A 3FMCA 3H6MA 5A2QL 3VYUA 3MHBA 4V0BA 3IFDA 1EIYB 4CHTB 1GOZA 1GXDC 2EYMA 5FO8B 2X6GA 2UUCL 4OO1I 4JI7Q 4KN4C 2KHIA 4L63B 1BR9A 4XQNA 5IT9c 4K5WA 1KABA 5FKAC 5DM73 3AFPA 5IP7H 4JOIC 3HOUH 4IPDA 4A3BG 2B63H 4GN3B 4JBWA 1YJNA 2JN4A 2A6HC 4X3KA 1E22A 3HRZC 3PUYA 2ICEC 1K73C 3A54A 4A3GG 2A69D 2QKIC 1Q7YC 1HHVA 4FVMA 1KAWA 1YEZA 1K8GA 1Z7TA 3RZDH 1JWMD 2R7DA 4OHJA 5EBDA 1HA5A 3TP6A 2VW9A 2UXCQ 3I73A 1PYBA 3RUZA 4BY7G 1FNVA 1DONA 5M3FG 1TS5A 1G2SA 2XSCA 1YI2A 3CCJA 4DV7L 1S3OA 2MO1A 3UDGA 3K0XA 1TS4A 1SMYD 1PRTC 4DV1Q 3I4NG 4OONA 1BCPC 4A3EH 3AEVA 2OXPA 3BYYB 1MJCA 4KHVA 1JICA 1NCVA 1AEXA 3UI2A 4IJHA 1VQIA 4XTCS 5GROA 1E24A 4DR3L 4JI1L 3X3NA 4A3IG 3NHHA 1BVSA 1H9SB 3KDFB 1H9JA 1UNSA 3GV6A 1S5CD 1E1TA 2QEJC 5FLMG 4JI0Q 2FMCA 1EEFD 2Z4HA 1EEID 2NUCA 3R3OA 1K83H 2B2TC 4QL5A 1XPOA 4RGNA 4AQYQ 1LT6D 3S14B 1V1QA 2K4KA 2EXZA 2K14A 3GV3A 3OOCA 3TDQA 4OX9Q 2BE5D 2Y0SB 5JJLA 2K01A 1NUCA 2B2VC 2UUBQ 1IKLA 4Y52H 2ALYB 4RGMA 2PNRC 1YNND 4A3IH 1SDFA 2L5TA 3EA6A 5IGCA 1NSNS 4CKBA 5KYIA 3S2DH 4K8JA 4KMUC 2Q2IA 1GUGA 3RNUA 1II3A 3I2ZA 2B29A 2V4DA 5CBEE 4MIUA 4R4IA 3SHLA 1HUMA 3J81c 2RCFA 1KRSA 1U5KA 1L1OC 2DUDA 4RAUC 4A3KG 5DM63 4LNQA 4JI7L 1LTBD 1BDOA 3PO2G 1LO5D 4J1MA 5ELOA 3RD4A 3SR1A 1VQ9A 4OIKA 3ND8A 3W1GA 5JEAJ 2YTXA 4JI8Q 5IYBH 2N55A 4BBSB 4PZ8A 2JA8H 4DPGA 4DR4L 1NMFA 5M3MG 3S2HH 4DK0A 1WI5A 2WB1G 1FGUA 1S5DD 2HHHL 2MNAA 3R93A 2MHVA 3U4VA 1STAA 2LKVA 5CV5A 5IT9L 2UXCL 4KJNA 3PO2H 1SJHD 4IUPA 3CPFA 2D62A 4R4OA 1E0BA 4A3JB 2GVAA 3K0YA 1BQQT 1DOMA 4IUNA 4DV1L 1ICFB 3VDYA 4OO1H 4A3FG 5C3XA 4LFBQ 5K36G 4LMQD 2FINB 3A8KE 3S1RH 1SYCA 3E9HA 4IQZA 1LACA 1HXYD 2I46A 1X55A 1PTOB 5I9PA 4HIKA 4QUCA 2VZAA 1EL0A 1CUKA 5CV9A 4X62Q 1A62A 3PQIA 1STNA 4JI0L 1EWCA 3KUPA 3I56A 4FO2A 1Q3LA 2O5IC 2GN5A 3HG9A 4ZRZA 1MKHA 3PCOB 1GO3E 2LXKA 2E2IH 4AQYL 5IGFA 1F9QA 1SYEA 1DGSA 1MBYA 4OX9L 3GTMB 1IW7C 2F0PA 3PUZA 3BZKA 1I4HA 2DGYA 1TWGB 4A3DB 2UUBL 1EFID 3LGJA 3F2UA 3BS1A 1GUSA 3CF5A 2UU9L 1TKWB 2NZ1D 2R3ZA 3BDOA 5DAUA 5JAVA 2DY7A 3JAMi 2CFMA 3VR3A 3HOVB 1CSQA 4BA2I 1ZKOA 4FXKC 3U50C 3BZCA 3DLLA 4DV2Q 3I8ZA 3PUVA 2IX3A 2DJGC 5JOBA 2R92H 3PIO3 4JYAQ 4B3TQ 1HZ9A 1EQVA 4R4TA 1JJCB 5C4XH 2ZTDA 1VCIA 3SK6A 2HUGA 3MXNA 2E2HB 4ULLA 2JSOA 3TRZA 2I5LX 1RODA 3E6ZX 3KF8B 1EU3A 4N8FA 1GJXA 3SGIA 5IGBA 2L15A 1LTSD 4S3SA 2C9OA 4JI8L 5NUCA 4HJAA 1XWEA 1GM5A 2HCIA 1VMPA 4A4IA 1LTLA 1RD9D 2F0JA 4GNXB 4JI6Q 3I72A 4IO9A 3RR5A 2NVYB 4GS3A 3SVMA 1F2YA 1F2LA 3RN2A 4EVOA 2KVMA 3ULJA 4C1NI 4LJZC 3A55A 1PRTB 1F2ZA 2EE1A 1SN8A 3FRPB 2HDLA 4JC0A 2PPBC 2Y0SG 1BCPB 4JI5L 2F0SA 2PZUA 2VL6A 5GAGC 1EUJA 4WJ3M 5I4DA 3C3LA 4AYBE 2HT1A 2A1AA 4LFBL 3OWEB 3EFXD 3NWSA 3CAMA 1EOTA 4GKJQ 3FPPA 2KBNA 2HQEA 1K0RA 4JPBW 4WORA 2GA4B 2X69A 4DAPA 4FYDA 2JA6G 3PSIA 3I4LA 4YCUA 3H09A 2B8FA 2E2DC 2F0FA 2HCCA 4X62L 5ELEA 1U4RA 4Y7NH 3K58A 3CMEA 4CJ0B 2J4XA 3UDXA 2JEBI 1KDAA 4YCWA 2CCZA 4IOAA 1YBYA 1DD2A 4DNIA 3S1MB 1BKBA 4BBSG 1I50B 1I6HH 3IAYA 5C0XG 1V8QA 2OTJA 1R4PB 2L4NA 2JA6H 4KI0A 4DXGA 1U0LA 2K28A 1CA5A 1AW7A 2F0UA 4TVAB 3PIOA 2UUAQ 2XN9C 3CCSA 1KXLA 3PMFA 1DZ1A 2RCNA 1PH5A 2F52A 3S15H 2PQAB 3DHQA 1L1OB 1XMQQ 2EJFC 1K8MA 1VQHA 4X65L 1EQRA 2OQKA 1BBWA 4B08A 4UDUC 4GZYC 4A3JG 5ELNA 4JYAL 1WTVA 4B3TL 2K50A 3GTJH 2R7ZH 2EDGA 1KHIA 1NAPA 4IUQA 2AQ3B 1YNXA 4R4CA 1QJOA 4NDXA 2LY7A 3MVVA 3W2DA 1OXVA 5G3LF 4DR2L 1LT5D 2XTIA 5L37A 2NN6H 2ZJQA 4Z9CB 3KBGA 2PQEA 3NENA 4F87A 4IFDJ 2RF4A 3KLSA 3WOEA 5EGTA 5T1IA 4POFA 3UDIA 1CKNA 3HOUB 2B63B 2RSNA 3HGBA 4JI6L 5CMDA 3KF6A 4A3JH 1WTPA 4G7ZC 2DNEA 1UWVA 3P75A 4NB3A 2WAQB 2OF1A 3RZDB 3K80C 1EIGA 4CJ2C 2GVBA 1QWYA 4P71A 2Z0SA 1Y8OB 1Q90A 4XT1B 4A3DG 3BVZA 4X66L 3P1HA 4FF2A 1YNJD 3DM3A 4BBRH 1NTGA 2WACA 5M9OA 1I4PA 1D6EC 2RHQB 1TR5A 4RWSC 2QEXA 5GADC 3SK4A 2KEDA 4R8NA 4UHVA 3HOVG 4GKJL 1VQ6A 4A3EB 3MA2B 4DF7A 4A3CH 4TQUS 2M2LA 1EOVA 1BBUA 3ITPA 2F0LA 2FXQA 3BDCA 2E75C 3Q22A 5I2XA 4P73A 3T16A 4DR6Q 2ZTEA 3Q8DA 1UEAB 2KECA 4KV6A 3K59A 4N9TA 1TY0A 4DAVA 5IYDH 2K6AA 1ILQA 5H1SE 1K83B 3R2TA 2Z4IA 1HNWQ 3TP8A 4LFAQ 2QCPX 2IWHA 1O7YA 4QY7A 4P2CB 3F2DA 1ASYA 2RVLA 5CORA 5CR3A 2NZHA 4YWLA 2UUAL 2ZXOA 1EY8A 2XGTA 4HMJA 4K5XA 4PQXA 4A3IB 4JI2Q 4Q5VA 2CQOA 5KYLA 1D5ZC 3S2DB 4FF1A 1PH9A 1RKNA 2F0VA 3ZYYX 1E2VA 1VQEA 4YWMA 1KNAA 1VMCA 4OIJA 1HRJA 4ZUJA 5EJWA 1OXTA 4MTKA 4JK1C 2JQOA 3QOJA 3VA5A 1EZ8A 1KD1C 3J80i 3HS0C 4HSPA 1N33Q 2L0CA 1FJGQ 3L0OA 4AH6A 5LL6X 1HR0W 2MP1A 3KLSX 2LMCB 4FXGC 4XXEA 3VR2A 4L6TB 1GD7A 3PV0A 3GTKH 1IW7D 2EYLA 2XNAC 1PYWD 1SMXA 2JA8B 2D0PA 2JYOA 3PF4A 3QB3A 5FLXE 1TWFH 1V43A 2PMZE 4IURA 4L8JA 5FJ8H 3GTQH 4DR1Q 2CWAA 3S2HB 3EVQA 3NEMA 5CV4A 2E2JH 5EBCA 1H9SA 3D4RA 3KDFA 3C2PA 3U9OA 1DM0B 4G7OC 1AP0A 1XNRL 1KAAA 3RLOA 2CKZB 4HJ5A 4YCVA 1EYAA 3AYHB 4KD4A 3V2TA 1N34Q 2RDFA 3HFZB 3LWEA 3CC4A 4V190 2BA1A 1PFMA 4OWXB 4LFCQ 3TBIB 3GTGH 3M7GA 1STBA 1XPRA 1PZID 1FNWA 3S1RB 1UEBA 3W5OA 5FLXc 4OWWB 4K14A 1I6VC 2X6LA 1XNQL 3BVGA 2JE6I 3VR6A 4DK1A 5KIXA 1RTOA 4ZKCB 2KUMA 1OXSC 4EGVA 1V1PB 3FDTA 4JG2A 4DR6L 2K5NA 4DA2A 1VQKA 3G48A 1H9KA 1T5XD 1AE2A 1N8RC 2E2IB 1HNWL 4QF4A 3HOUG 3D31A 2B63G 1UE7A 1B3QA 5C3EH 1EY6A 4IUVA 4DAYA 1NR2A 4O42A 1I3QH 2WAQG 5D3IB 1B9NA 4NP5A 1L0XB 4JI2L 4PV1C 3PO3G 1LLRD 3DEPA 4RH6A 4HN7A 5CYUA 4RHRA 5C44H 4QIWE 3KLWA 4DU9A 4KJOA 2FHTA 4ME3A 1TIID 4LF6Q 2R92B 4HR7B 2LXJA 5C4XB 2F1MA 5I6WA 1N33L 2LSSA 2RHSB 2ZTCA 4A3EG 1FJGL 4X3UA 4ZKBB 5EPLA 5I2YA 1ZYRD 3NQTA 3M3YH 1U9RA 1DOLA 1MSGA 3PO3H 1Q8IA 3K8AA 2F0OA 4GNXC 4HJ8A 4LF5Q 4DR5L 3TP7A 2B2UA 2D9UA 3K5MA 2AUKA 4DGZA 3CKIB 5K5PA 4NXNQ 2EYOA 2EZVA 4CKEA 3CC7A 3P20A 3HOYH 1HTPA 2WB1E 3CXCA 2UXBQ 5LMUL 3HOWH 3TQYA 1I4GA 4X6AH 2ID0A 4KY7A 5HGQA 3HKZB 1DYQA 3CP0A 1N34L 1XPUA 1K3BC 1HUNA 2YYZA 1T5EA 1X32A 1O80A 4XQQA 1SYFA 4XT3B 2EXDA 4CGYB 1A63A 3MEHA 4LUOA 5BN3A 2AWOA 2RDGA 4PZ7A 1QVFA 1VQDA 1JCKB 1P8LA 4X3SA 3A74A 1PH2A 2RDHA 2MJ8A 3LWUA 1V9PA 1HNZQ 1F9PA 1TWHH 4Y7NB 3CCVA 1BUVT 4K8IA 2NVQH 3S24A 4OGQC 3OTOQ 3M9BA 5FLXL 5GAHC 1BNZA 5IYBG 1NY4A 1JT8A 5ISRA 2WINB 3DMUA 2JA8G 4JOIA 3S17H 3K5OA 2KCMA 1I6HB 3TZUA 3J7AV 4ZK9B 1HTLD 4GLVB 1IBLQ 4KK7A 1TVXA 4DV6Q 2Z1CA 3K7UC 1MSHA 3NTKA 3Q23A 2JA6B 4R9WA 2JK8A 2K5HA 1SFOH 1RL2A 1SNQA 4GKKQ 1B1ZA 1Y1WH 1YHAA 4CJ1B 1QILA 3S15B 1WTWA 3DWQA 5E4WC 3TP5A 3BG3A 4LF6L 1TY2A 3OW7A 4P72A 1D1IA 5IE8A 3GTJB 2R7ZB 4A3MH 4OO1G 1EYDA 1WCMH 4APVA 5J22A 4C3HH 1XX8A 1DXMA 5M5YH 2VS1A 3NBHB 5C5MA 5D3DA 1AH9A 3W1BA 2A68D 4QB4A 1CHQD 3CCLA 4BY1H 1RCVD 1WYDA 4DUYQ 3NTIA 4LF5L 1GUNA 4C1NK 4RFBA 2J0TD 1KC8C 2D2CC 2HIVA 5FO9B 1HH2P 5JPNC 1Y8NB 4KKTA 1S72A 2EQSA 3HOZH 4M1UB 5AJ3Q 4NXNL 2XVSA 5KEEA 2EY6A 4DV3Q 1PYSB 2F03A 4J15A 1HNXQ 2UXBL 2VB2X 2B2TA 5I6YA 1L0WA 4BWGB 1U4LA 5C0XJ 1LTAD 4BXXH 4ZYSA 1VQOA 3CQZH 1CFMA 4JI4Q 4IUUA 1KTKA 1RJTA 1Z6HA 2B2VA 2F0WA 4G7HC 4BBRB 3WWVA 1QUQB 4IPCA 1MD2D 4RCNA 1IBKQ 1Y1VH 3ND9A 4GN5A 1X56A 4O2DA 1X54A 1Y8PB 5IIFA 2OCEA 1S5FD 2HQLA 1Q8KA 4PG3A 4A93H 5CV6A 2NN6I 4WFN3 2R92G 2DY8A 3I55A 5C4XG 2K5QA 1HNZL 2QDBA 2NVTH 1PFBA 2PQAA 5ELCA 1L1OA 1GUWA 1B44D 2I0QA 1FR3A 5ELDA 3NK9A 3RLFA 3M4YA 4AYBB 3STBD 3E5SA 3AB9A 4EQNA 1ZXTA 1JC7A 2DNCA 1KDCA 4GLXA 4DV6L 4DV0Q 2MQHA 2CW0D 1EWIA 3X3MA 1M90C 1R4QB 1HZCA 3K5NA 4QQBX 4IZ8A 2F3IA 5E1FA 2V1CC 1B7YB 3B6YA 2LS01 3CU7A 4GKKL 3OMGA 1PTOD 3JAME 3PUXA 3T1YQ 2N88A 5BN4A 3MC0B 1D8LA 4AIMA 2ICIA 1SBBB 2L11A 5E7NA 2AHOB 3KLRA 3RZOH 2UXDQ 2WP8J 1MIUA 3HKZG 2VQFQ 2EYJA 1I94Q 2IHEA 1E3PA 2A6ED 4KD3A 1Z47A 4KTAA 4M8AA 4WJ4A 1D2BA 4C3IH 1TT2A 4PNYA 1JB3A 4G4KA 3N52A 1I4QA 5DLQE 1TS2A 2JA5H 2D5DA 1D5MC 3E3XA 3NSWA 1VQFA 1LTGD 1Q82C 3CRKC 3D4DA 4XYOA 4B9WA 5HURA 3G71A 2Z6KC 3GTKB 4DUYL 3EROA 4LF4Q 2XRQD 2EJGC 3JAMc 2K32A 3F2BA 4ZLTF 3G6EA 2F0NA 4DV4Q 1TWFB 1SYGA 1SROA 2A74C 4DV3L 3GTQB 1QE6A 1YITA 1HNXL 2JXMB 3H0GH 1OO9B 1EFWA 2E2JB 5EAYA 2I5HA 3I4OA 2Q8TA 4KLKA 1SR3A 1JOQA 5KNDA 1PLFA 4KKSA 4GOPC 4ABNA 3ZJYC 2QF7A 1CKOA 1I4RA 1B70B 1K9MC 2QILA 2A6HD 2MGSA 5JVG3 1IBKL 5IWAQ 1PDQA 4NW2A 3GTGB 1PH8A 3L7ZC 1HZAA 3ERQA 3I7FA 4OL7A 2NB0A 1NMGA 1QOHA 1PV4A 1EY4A 1S4ZA 2I07B 1F9RA 1YHQA 1PFSA 2R7ZG 4JW0A 5KNCA 3QO2A 2D0OA 1JB7A 3D6CA 3NPPA 2NVXH 1PRTD 2F0EA 4J6HA 2NN6G 1PH4A 2CHBD 1ILPA 2KHJA 1GHKA 1BCPD 1E7ZA 1GUTA 4N9PA 4CKCA 1Q1EA 4BS9A 3F2CA 4DK6C 3BYTB 1S40A 3F8TA 3QR8A 1J5EQ 2A69C 5JEAH 4XQJA 1OXXK 4RKBA 5F2DA 3IRBA 4DV2L 5C3EB 2FFKB 2KHSA 1KLGD 1A15A 4YHHQ 2JJQA 3I3CA 1TWCH 1EYCA 1EWHA 4CDDC 1SYBA 3M7NA 5C4HA 1BO0A 1I3QB 2F0QA 2K33A 4DXFA 2O4XA 3TZDA 1VF5C 2EYPA 4E6IA 2F0MA 4HIMA 4QCLA 2F0GA 1PFNA 5C44B 3WDNA 4A3LH 1CM9A 4G57A 2E74C 3FKIB 1SMYC 1KRTA 2UXDL 4ZCKA 2VQFL 1HA6A 1SAPA 5JJIA 4U673 3UE1A 4BBRG 1K8AC 5JJZA 4DUZQ 3S16H 3BU2A 1PA6A 2IL8A 2Q2UA 2AQ1B 1WD0A 4JBKA 2QDLA 2MPMA 3ONAB 2Q8RE 1A6XA 4A3CG 1G6ZA 2VXWA 3E0EA 2WIIB 1PH6A 3M3YB 1V1OA 3KBXA 2N78A 4LF4L 3PO3B 5D14A 1QNKA 2BA0A 1EYGA 1G291 3TSSA 4HIDA 4DV4L 1X3PA 1J8IA 2EY2A 1N32Q 3GTPH 4FNFA 3MXNB 5EKLA 4L5RC 1D5XC 4POGA 3CRLC 5IYDG 1KIXA 4AYBG 3HOYB 2BE5C 1O78A 1JWSD 2PI2A 1SE2A 3HOWB 2E76C 2K75A 1TQOA 1YNNC 2NTSA 4TKOB 1MI2A 2JP1A 3JAML 1F2MA 4HAEA 4CDCC 3OWFA 2IT1A 2KA7A 2Q2TA 2PCFB 3KOJA 2B2YC 1CTMA 3K5LA 2PW7A 1VS0A 1WFQA 3I70A 4UPAA 3K81C 1JQYD 4K0KQ 1DOKA 3TEHB 4NXMQ 2IPKD 1LT3D 2KCCA 1T9HA 3PIP3 4FF4A 5JJKA 4H02A 3VYTA 3PGZA 2ZM6Q 3I91A 1TWHB 1EY9A 1X65A 3NTHA 4UP7A 4H7BA 4C2MH 3M4OH 1SNOA 5COYA 3Q6SA 5E4XA 3CCQA 2NVQB 2B2WC 1C8CA 3MTSA 5LMNQ 1ENFA 5M5XH 1MJEA 3OHXC 3C1EA 1XMQL 3S17B 5GQOA 3I4MH 2O5JC 5FJ8G 1Q86C 4L5QA 5IP9H 1X3GA 1BOSA 1VQMA 1LABA 1PH3A 2CQAA 3HEJA 2WAQE 1FL0A 1IL8A 1PXUA 1M8AA 2F3VA 1SFOB 3H94A 2F4VQ 1SSOA 1U4PA 1Q1BA 3V05A 1Q81C 1Y1WB 2Q8IB 2AMCB 1HFGA 2ZXPA 3NBIA 2Q2HA 4KHPQ 3E0JA 1M4VA 2ZJRA 2FJ2A 4C56C 1A3UA 4DUZL 3LNNA 1NNXA 1EZ6A 1VF7A 1HJPA 4DKAC 3A7AB 5FO7B 4A3MB 3J80E 2ES2A 4OEMB 1JOOA 4X64Q 1JOKA 2DJFC 1WCMB 4NMZA 4ZAIA 1VDZA 1NBWA 5EKIA 4C3HB 5IYCG 1PVOA 5M5YB 3T56B 3OMCA 2BOSA 1E1OA 1WTXA 4BY1B 4KY6A 1N32L 3ER0A 2R93H 2A73B 4FXDA 3EQLC 1PH7A 3HOZB 1AFPA 3K6OA 1Y69U 3MFYA 4UAIA 4GOPB 4RMFA 3M4QA 2KQ3A 1QNUA 4ID6A 4TSSA 1EU4A 4C3JH 4B3MQ 2CWPA 2K03A 1YZ6A 3CQZB 1NJIC 3J80c 1VQJA 3NQIA 4I7AA 5C3EG 4KN7C 1CKMA 2PYKA 5C4JH 5JVH3 1OXUA 2JA7H 4WRDA 5IYCH 1K8OA 1AN8A 1GUOA 1D1KA 3J7YW 1Y1VB 3ERSX 1UE6A 1UE5A 4JI1Q 4DR3Q 2K5VA 3PIPA 3CCRA 3UDFA 5C44G 2EPBA 1VQ4A 4IOCA 3AQQA 3FKIG 3NELA 1HFNA 1STGA 4CDFC 1CZGA 3VA7A 4K0KL 3SXHA 4A93B 3D0FA 4EQ5A 1TWAH 5CC4A 4NXML 1SNMA 4K2LA 1B3AA 4LFAL 2ZJPA 1ASZA 3ULPA 2EY1A 4DN4M 2NVTB 4PMBA 2K04A 1A2TA 3FVQA 2F4IA 3Q0AA 4JBMA 3A56A 1YIJA 1X3FA
chains in the Genus database with same CATH topology
4IFDH 3SE0A 1ENCA 1RHPA 2KEEA 1CT1D 5CBAE 3P7JA 3IL8A 3MAQA 3VYSA 5CV7A 4RGOS 1CZWA 2H1EA 1J9OA 3D8GA 5AFWA 1STHA 3D6WA 3WOFA 3RZOB 4ODGA 1KDBA 2F0KA 1SNPA 4EQPA 3CHBD 4ZUIA 2K5DA 2L12A 4C3IB 1E2WA 1EY5A 4I65A 2HDMA 2JA5B 3NWTA 1G91A 3VR4A 5LHY1 1B2TA 1QCBD 2WKCA 2PW5A 2WKDA 1SJED 2R6GA 1EY0A 5IOCA 1SNCA 1SNDA 1XYIA 3H0GB 1I4XA 1A3TA 2G9DA 2XRSD 5KNBA 2LFNA 1HPCA 1RDPD 1F9SA 3NP8A 4H44C 2IW3A 4DFAA 3FEWX 1A3VA 5CV8A 4ZQ3A 2DN8A 1UUPA 3VYRA 2OT2A 3MFGA 3R2IA 1O7LA 1XXGA 3J80L 5KRUA 3J81E 3QG1A 1SYDA 2RKSA 2IX0A 4IALA 1BF4A 2NVXB 3KF8A 1LTRD 4C3HG 2K5WA 2ZXRA 3OIQA 3RMHA 1PMRA 3BVMA 1JR0D 5EKKA 1F77A 2NTTA 4HEDA 4CBVA 4TRDA 1ET6A 4FP5D 3V96A 1LTID 2F0DA 1CQFA 2AWNA 1TWCB 1X3QA 1ML0D 3GO5A 1IKMA 5FOBB 1ESRA 1YNJC 1UAPA 4ILWA 2EYFA 1XTCD 1WVLA 4K2KA 4HCSA 3S16B 5C3WA 4H0LC 1QB5D 3MXPA 4PMWA 4XIGS 5G3LD 3DWAA 2XIWA 3HOXB 1TS3A 3SDZA 1ZEQX 4NKLA 2RBMA 5ELBA 3GTPB 3KK7A 1TU2B 2H4OA 1C48A 5I9OA 2VNUD 2MUYA 3PUWA 3OIPA 4H13C 1DJRD 4WJWA 1C4QA 2BCOA 2KOLA 4K5VA 2B39A 1WTQA 1ESFA 2K05A 5E3FA 3GP7A 3T13A 3L3OC 2SEBD 3D3RA 4X3TA 3W3AA 5C0XI 2TSSA 4DNRB 4HTHA 4HCEA 5K36H 1H9MA 1LT4D 3EJIA 4C3IG 4KY5A 5IGGA 1RTNA 4C2MB 2A5HA 3M4OB 3T53B 1SE4A 2ENBA 1FGBD 1WTRA 1O7ZA 5M5XB 1CHPD 1U4MA 3I4MB 1HQRD 2NYZD 2NWGA 5T1GA 2JEAI 1SE3A 3OSOA 1HQMC 2R61A 2G9HD 2RSOA 5J1ZA 2EY5A 2BDOA 2FMMA 1IYVA 2F0IA 2F0TA 2CVRA 1G8ZD 3J81L 2ZT9C 1B53A 4K6LA 4XDXA 1JWUD 3O13A 3OPOA 3DEOA 1ONLA 1SEBD 5J39A 5EPJA 1JE4A 2J7ZA 3MXUA 4MHEA 3AMUA 4XYQA 2Z8LA 3TN2A 2XWJB 1GHJA 2R93B 3BDLA 1SXTA 1CA6A 2SNMA 1WTOA 2L9HA 2KJXA 1S5BD 5JEAG 4C3JB 1NR4A 2IJ0A 1LTTD 5C4JB 2JA7B 4MN3A 2AQ2B 3T4AC 5JPMC 1JORA 5IGEA 2KCNA 3Q24A 3URYA 5KGUA 2OEOA 3QOLA 5IODA 1BBXC 3MXGA 4RKLA 4K6DA 5C4ZA 1WD1A 1TWAB 2PZTA 2C5CA 1ZYRC 5EQ0A 4PMCA 5FK9C 2BDNA 5C5LA 2SOBA 2L1BA 2EYHA 3S9WA 1ET9A 3G7LA 1L0YB 1EQTA 3NE5B 4RA8A 3A8JE 3BZDB 1HCZA 2TMPA 2K7VA 2EOTA 3M85A 4RHSA 4KKUA 3DM1A 1ENAA 5C0XH 4O1NA 3MZ5A 5LL6S 1FNUA 3A7LA 4HSVA 1ICWA 3QJYA 4IUTA 4LK1C 2AUJD 3QIAA 5D65A 2VUMB 1STYA 1KLUD 3L9AX 1V1PA 2SNSA 4ME5A 1E2ZA 5IGDA 2F3WA 3SK8A 1FD7D 5A2QE 4IFDI 3H3VC 3S1NB 1EIHA 5M5WB 5BN5A 1PTOH 3QWNA 1AZQA 1W6KA 4I7ZC 4A3BB 1LV9A 2PMZB 2PZWA 2WV6D 3GTLB 4A3GB 3HZXA 4QMGA 3I90A 1MGSA 5CGKA 3A8IE 5C6AA 4BY7B 1AZPA 3DXJC 5TSSA 1IYUA 1PZKD 5M3FB 3T51B 3TMEA 4F8MA 1B50A 1PTOF 2NBFA 3LX0A 5A35A 1IHZA 3I4NB 2RQXA 3C46A 3N6RA 2A68C 3U9SA 1EY7A 5HGTA 2XWBB 3VR5A 1S5ED 1H9RA 2F0HA 2EVBA 2O2LD 3K7AB 1QG7A 4QUFA 1CI3M 1Q12A 2K1BA 4Q0FA 4LAAA 4C3JG 4EQOA 4R8IA 3FPUB 4BA1I 1KNEA 2B8GA 2L55A 4YIJA 3K57A 1PZJD 5ELFA 1W6JA 1BXTA 2VB3X 3AU7A 3G6JB 4QIWB 4F88A 2B2YA 3GD7A 3MWYW 3SK5A 3H91A 1FYCA 3C1FA 3GTOB 2M00A 2M9VA 3HP3A 2SDFA 4A3KB 3PO2B 2PO4A 3NUCA 1CQVA 4RCOA 4KHZA 4HMIA 1RF2D 2B2WA 4IFDG 2CW0C 2B2UC 1PRTF 5DNFA 5M3MB 3SEBA 1PTOC 1BCPF 3GQBA 5EPKA 3S1QB 2WB1B 2RA4A 1CK1A 1DCZA 3D4WA 3J7AF 3IKJA 4U68A 2A6EC 2EJMA 1G2TA 5IT9E 4J8QA 1B9MA 4IN3A 2IX1A 1B4OA 1R9TB 3DUZA 3R8BA 4RGTA 2YU9B 1A2UA 5DEHA 3DWPA 4A3FB 4B9XA 4DNTB 3IFTA 4F7XA 3NBHA 3NXWA 1STEA 4FF3A 3FMCA 3H6MA 5A2QL 3VYUA 3MHBA 4V0BA 3IFDA 4CHTB 1GOZA 1GXDC 2EYMA 5FO8B 2X6GA 4OO1I 4KN4C 4L63B 4XQNA 1BR9A 4K5WA 1KABA 5FKAC 5DM73 4JBWA 2A6HC 4X3KA 3HRZC 3PUYA 2ICEC 3A54A 2A69D 2QKIC 1HHVA 4FVMA 1Z7TA 1JWMD 4OHJA 5EBDA 1HA5A 3TP6A 3I73A 3RUZA 1FNVA 1DONA 1TS5A 1G2SA 2XSCA 1TS4A 1SMYD 1PRTC 1BCPC 2OXPA 3BYYB 4KHVA 1JICA 1NCVA 1AEXA 3UI2A 4XTCS 3X3NA 3NHHA 1H9SB 1H9JA 1UNSA 3GV6A 1S5CD 2QEJC 2FMCA 1EEFD 2Z4HA 1EEID 2NUCA 3R3OA 2B2TC 4RGNA 3S14B 1LT6D 2EXZA 3GV3A 3OOCA 3TDQA 2BE5D 2Y0SB 2K01A 1NUCA 2B2VC 1IKLA 4RGMA 2PNRC 1YNND 1SDFA 2L5TA 3EA6A 5IGCA 1NSNS 4CKBA 5KYIA 4K8JA 4KMUC 1GUGA 1II3A 2V4DA 5CBEE 4MIUA 3SHLA 1HUMA 4RAUC 5DM63 1LTBD 1BDOA 1LO5D 4J1MA 3RD4A 3SR1A 4OIKA 3ND8A 5JEAJ 2N55A 4BBSB 4DK0A 1S5DD 3R93A 2MHVA 1STAA 2LKVA 5CV5A 5IT9L 4KJNA 1SJHD 4IUPA 2D62A 1E0BA 4A3JB 3K0YA 1BQQT 1DOMA 4IUNA 4OO1H 5C3XA 5K36G 4LMQD 2FINB 3A8KE 1SYCA 4IQZA 1LACA 1HXYD 2I46A 1PTOB 5I9PA 4QUCA 1EL0A 5CV9A 1STNA 1EWCA 3KUPA 4FO2A 1Q3LA 2O5IC 3HG9A 4ZRZA 5IGFA 1F9QA 1SYEA 1MBYA 3GTMB 1IW7C 2F0PA 3PUZA 1I4HA 4A3DB 1TWGB 1EFID 3F2UA 3BS1A 1GUSA 1TKWB 2NZ1D 2R3ZA 3BDOA 5DAUA 5JAVA 2DY7A 3VR3A 3HOVB 4BA2I 1ZKOA 4FXKC 3I8ZA 3PUVA 2IX3A 5JOBA 3PIO3 1EQVA 1VCIA 3SK6A 2HUGA 3MXNA 2E2HB 4ULLA 2JSOA 1RODA 3E6ZX 1EU3A 1GJXA 5IGBA 1LTSD 4S3SA 2C9OA 5NUCA 1XWEA 2HCIA 1VMPA 1RD9D 2F0JA 3I72A 2NVYB 3SVMA 1F2YA 1F2LA 4EVOA 2KVMA 4C1NI 4LJZC 3A55A 1PRTB 1F2ZA 2EE1A 3FRPB 2HDLA 2PPBC 1BCPB 2F0SA 2PZUA 5I4DA 3C3LA 3OWEB 3EFXD 3NWSA 1EOTA 3FPPA 2HQEA 4WORA 2GA4B 2X69A 4DAPA 4FYDA 3I4LA 3H09A 2B8FA 2E2DC 2F0FA 2HCCA 5ELEA 1U4RA 3K58A 4CJ0B 2J4XA 2JEBI 1KDAA 1DD2A 3S1MB 1I50B 3IAYA 5C0XG 1V8QA 1R4PB 2L4NA 4KI0A 4DXGA 2K28A 1CA5A 1AW7A 2F0UA 2XN9C 3PMFA 1DZ1A 3DHQA 2EJFC 1K8MA 4B08A 4UDUC 4GZYC 1WTVA 2EDGA 1NAPA 4IUQA 2AQ3B 1QJOA 4NDXA 2LY7A 3MVVA 3W2DA 1OXVA 5G3LF 1LT5D 2NN6H 4Z9CB 3KBGA 2PQEA 4F87A 4IFDJ 3KLSA 3WOEA 5EGTA 5T1IA 3HOUB 2B63B 2RSNA 3HGBA 5CMDA 1WTPA 4G7ZC 2DNEA 3P75A 2WAQB 2OF1A 3RZDB 1EIGA 4CJ2C 1QWYA 1Y8OB 1Q90A 4XT1B 3BVZA 3P1HA 4FF2A 1YNJD 5M9OA 2WACA 1I4PA 1D6EC 1TR5A 4RWSC 3SK4A 2KEDA 4R8NA 4A3EB 3MA2B 4DF7A 4TQUS 2M2LA 3ITPA 2F0LA 3BDCA 2E75C 3Q22A 5I2XA 3T16A 1UEAB 2KECA 4KV6A 3K59A 4N9TA 1TY0A 4DAVA 2K6AA 1ILQA 1K83B 3R2TA 2Z4IA 3TP8A 2QCPX 2IWHA 1O7YA 4P2CB 2RVLA 5CORA 5CR3A 2ZXOA 1EY8A 4PQXA 4HMJA 4K5XA 4A3IB 4Q5VA 5KYLA 1D5ZC 3S2DB 4FF1A 1RKNA 2F0VA 3ZYYX 1E2VA 1KNAA 1VMCA 4OIJA 1HRJA 4ZUJA 5EJWA 1OXTA 4JK1C 3QOJA 3VA5A 1EZ8A 3HS0C 4HSPA 2L0CA 5LL6X 2MP1A 3KLSX 2LMCB 4FXGC 4XXEA 3VR2A 4L6TB 3PV0A 1IW7D 2EYLA 2XNAC 1PYWD 2JA8B 2JYOA 3QB3A 5FLXE 1V43A 4IURA 4L8JA 3S2HB 3EVQA 5CV4A 5EBCA 1H9SA 3D4RA 3C2PA 3U9OA 1DM0B 4G7OC 1AP0A 1KAAA 1EYAA 4KD4A 3V2TA 2RDFA 3LWEA 4V190 2BA1A 1PFMA 3TBIB 3M7GA 1STBA 1PZID 1FNWA 3S1RB 4K14A 1I6VC 2X6LA 3BVGA 2JE6I 3VR6A 4DK1A 5KIXA 1RTOA 4ZKCB 2KUMA 1OXSC 4EGVA 1V1PB 3FDTA 4DA2A 1H9KA 1T5XD 2E2IB 4QF4A 3D31A 1EY6A 4IUVA 4DAYA 1NR2A 4O42A 5D3IB 1B9NA 4NP5A 1L0XB 4PV1C 1LLRD 3DEPA 4RH6A 4HN7A 5CYUA 4RHRA 4DU9A 4KJOA 2FHTA 1TIID 2R92B 4HR7B 5C4XB 2F1MA 5I6WA 4X3UA 4ZKBB 5EPLA 5I2YA 1ZYRD 3NQTA 1U9RA 1DOLA 1MSGA 1Q8IA 2F0OA 3TP7A 2B2UA 2D9UA 3K5MA 2AUKA 4DGZA 3CKIB 5K5PA 2EYOA 2EZVA 4CKEA 3P20A 1HTPA 1I4GA 2ID0A 4KY7A 3HKZB 1DYQA 1HUNA 2YYZA 1T5EA 1X32A 1O80A 4XQQA 1SYFA 4XT3B 4CGYB 3MEHA 5BN3A 2AWOA 2RDGA 1JCKB 4X3SA 2RDHA 2MJ8A 3LWUA 1F9PA 4Y7NB 1BUVT 4K8IA 4OGQC 5FLXL 1BNZA 5ISRA 2WINB 3DMUA 3K5OA 1I6HB 3TZUA 3J7AV 4ZK9B 1HTLD 4KK7A 1TVXA 2Z1CA 1MSHA 3NTKA 3Q23A 2JA6B 4R9WA 1SNQA 1B1ZA 4CJ1B 1QILA 3S15B 1WTWA 3DWQA 5E4WC 3TP5A 3BG3A 1TY2A 3OW7A 1D1IA 3GTJB 2R7ZB 4OO1G 1EYDA 5J22A 1XX8A 1DXMA 5C5MA 5D3DA 2A68D 4QB4A 1CHQD 1RCVD 3NTIA 1GUNA 4C1NK 4RFBA 2J0TD 2D2CC 5FO9B 5JPNC 1Y8NB 4KKTA 4M1UB 2XVSA 5KEEA 2EY6A 2F03A 2VB2X 2B2TA 5I6YA 4BWGB 1U4LA 5C0XJ 1LTAD 4ZYSA 1CFMA 4IUUA 1KTKA 1RJTA 1Z6HA 2B2VA 2F0WA 4G7HC 4BBRB 1MD2D 4RCNA 3ND9A 1Y8PB 5IIFA 1S5FD 5CV6A 2NN6I 4WFN3 2DY8A 2K5QA 2QDBA 1PFBA 5ELCA 1GUWA 1B44D 1FR3A 5ELDA 3NK9A 3RLFA 3M4YA 4AYBB 3E5SA 3AB9A 4EQNA 1ZXTA 1JC7A 2DNCA 1KDCA 2CW0D 3X3MA 1R4QB 3K5NA 4IZ8A 5E1FA 2LS01 3CU7A 3OMGA 1PTOD 3JAME 3PUXA 2N88A 5BN4A 3MC0B 2ICIA 1SBBB 2L11A 3KLRA 2WP8J 2EYJA 2A6ED 4KD3A 1Z47A 4KTAA 4M8AA 1D2BA 1TT2A 4PNYA 1JB3A 4G4KA 3N52A 1I4QA 1TS2A 2D5DA 1D5MC 3NSWA 1LTGD 3CRKC 3D4DA 4XYOA 4B9WA 5HURA 3GTKB 3EROA 2XRQD 2EJGC 2K32A 4ZLTF 2F0NA 1TWFB 1SYGA 2A74C 3GTQB 1QE6A 2JXMB 1OO9B 2E2JB 2Q8TA 1JOQA 5KNDA 1PLFA 4KKSA 4ABNA 2QF7A 1I4RA 2QILA 2A6HD 2MGSA 5JVG3 1PDQA 4NW2A 3GTGB 3L7ZC 3ERQA 4OL7A 2NB0A 1QOHA 1EY4A 1S4ZA 2I07B 1F9RA 5KNCA 3QO2A 3D6CA 3NPPA 1PRTD 2F0EA 4J6HA 2NN6G 2CHBD 1ILPA 1GHKA 1BCPD 4N9PA 1GUTA 4CKCA 1Q1EA 4BS9A 3BYTB 2A69C 5JEAH 4XQJA 1OXXK 4RKBA 5F2DA 5C3EB 2FFKB 2KHSA 1KLGD 1A15A 3I3CA 1EYCA 1EWHA 1SYBA 3M7NA 5C4HA 1BO0A 1I3QB 2F0QA 2K33A 4DXFA 2O4XA 3TZDA 1VF5C 2EYPA 4E6IA 2F0MA 4QCLA 2F0GA 1PFNA 5C44B 3WDNA 1CM9A 2E74C 4G57A 3FKIB 1SMYC 1HA6A 1SAPA 4U673 5JJZA 2IL8A 2AQ1B 1WD0A 2MPMA 3ONAB 2Q8RE 1A6XA 1G6ZA 2VXWA 2WIIB 3M3YB 1V1OA 3KBXA 3PO3B 5D14A 1QNKA 2BA0A 1G291 3TSSA 1X3PA 1J8IA 2EY2A 4FNFA 5EKLA 1D5XC 3CRLC 3HOYB 2BE5C 1O78A 1JWSD 1SE2A 3HOWB 2E76C 1TQOA 1YNNC 2NTSA 4TKOB 1MI2A 2JP1A 3JAML 1F2MA 4HAEA 2KA7A 2IT1A 3OWFA 2PCFB 2B2YC 1CTMA 3K5LA 2PW7A 3I70A 1JQYD 1DOKA 2IPKD 1LT3D 2KCCA 3PIP3 4FF4A 3VYTA 3I91A 1TWHB 1EY9A 3NTHA 4H7BA 1SNOA 5COYA 3Q6SA 5E4XA 2NVQB 2B2WC 1C8CA 3MTSA 1ENFA 3OHXC 3C1EA 3S17B 2O5JC 1BOSA 1LABA 2CQAA 3HEJA 1PXUA 1IL8A 1M8AA 2F3VA 1SFOB 3H94A 1SSOA 1U4PA 1Q1BA 3V05A 1Y1WB 2Q8IB 1HFGA 2ZXPA 3NBIA 3E0JA 1M4VA 2FJ2A 4C56C 1A3UA 3LNNA 1EZ6A 1VF7A 4A3MB 3A7AB 5FO7B 3J80E 1JOOA 1JOKA 1WCMB 4NMZA 4ZAIA 1VDZA 5EKIA 4C3HB 5M5YB 3T56B 2BOSA 3OMCA 1WTXA 4BY1B 4KY6A 2A73B 4FXDA 3EQLC 3HOZB 1AFPA 3K6OA 1Y69U 3MFYA 4UAIA 2KQ3A 1QNUA 4ID6A 4TSSA 1EU4A 2K03A 3CQZB 3NQIA 4KN7C 2PYKA 5JVH3 1OXUA 4WRDA 1K8OA 1AN8A 1GUOA 1D1KA 3J7YW 1Y1VB 2EPBA 1HFNA 1STGA 1CZGA 3VA7A 3SXHA 4A93B 5CC4A 1SNMA 4K2LA 1B3AA 2EY1A 4DN4M 2NVTB 4PMBA 2K04A 1A2TA 3FVQA 2F4IA 3Q0AA 3A56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KLR A;  3W3A A;  1VF5 C;  2PPB C;  2CW0 C;  4IFD G;  4OO1 H;  2O5J C;  4IFD H;  1V43 A;  4DNR B;  4L8J A;  3SE0 A;  5K36 G;  2A6E D;  4XTC S;  3WDN A;  1LAB A;  5K36 H;  1Y8O B;  3A8K E;  1H9M A;  2E74 C;  1SMY C;  1Q90 A;  4KHZ A;  1DXM A;  1H9S B;  1PMR A;  3A8I E;  3H94 A;  3GQB A;  1H9J A;  1H9S A;  3D4R A;  1Q1B A;  4IQZ A;  1LAC A;  2A68 D;  3DXJ C;  4G7O C;  1IYU A;  2AUK A;  2Q8I B;  1DCZ A;  3T53 B;  1ZYR C;  3FPP A;  1GUN A;  3IKJ A;  2D5D A;  2D2C C;  3P20 A;  3T51 B;  1HTP A;  1Y8N B;  4KKT A;  3CRK C;  2A6E C;  2EJM A;  3LNN A;  3I4L A;  5A35 A;  1VF7 A;  1B9M A;  2EJG C;  2B8F A;  2O5I C;  1A6X A;  3A7A B;  2K32 A;  2BA1 A;  3N6R A;  2A68 C;  3OOC A;  3U9S A;  2BE5 D;  4TQU S;  1YNJ C;  1VDZ A;  2JEA I;  1CFM A;  2BA0 A;  2JXM B;  1G29 1;  2JEB I;  3VR5 A;  3NE5 B;  4DNT B;  3IFT A;  2PNR C;  3A8J E;  1H9R A;  1HQM C;  2E75 C;  2YYZ A;  1T5E A;  3T56 B;  1IW7 C;  2L5T A;  3PUZ A;  1HCZ A;  1DD2 A;  1E2W A;  1Z6H A;  1I6V C;  2EVB A;  2K7V A;  4G7H C;  3CRL C;  3FMC A;  2JE6 I;  4H0L C;  3VR6 A;  4DK1 A;  5KND A;  4RCN A;  4KKU A;  4KKS A;  4XIG S;  5BN3 A;  3M85 A;  2AWO A;  1OXS C;  3ND9 A;  4KMU C;  1V8Q A;  2BE5 C;  2BDO A;  1CI3 M;  1GUS A;  1O78 A;  3EQL C;  1TKW B;  1Q12 A;  1IYV A;  3VR4 A;  1GUG A;  2QF7 A;  3BDO A;  5C0X H;  1Y69 U;  1Y8P B;  3MFY A;  3LWU A;  2A6H D;  2V4D A;  2E76 C;  4KI0 A;  3VR3 A;  1YNN C;  4TKO B;  4BA2 I;  1ZKO A;  3A7L A;  1H9K A;  2ZT9 C;  4KN4 C;  3SDZ A;  2R6G A;  3L7Z C;  2NN6 I;  3PUV A;  4BA1 I;  5C0X G;  2B8G A;  3OPO A;  3D31 A;  2KA7 A;  1BDO A;  1ONL A;  2IT1 A;  3QJY A;  4KN7 C;  2EJF C;  1K8M A;  4OGQ C;  1OXU A;  2PCF B;  1VCI A;  3MXU A;  4LK1 C;  1K8O A;  2AUJ D;  3QIA A;  4JBW A;  4GZY C;  2A6H C;  1CTM A;  1FR3 A;  3PUY A;  3ND8 A;  5KNC A;  5KNB A;  1GHJ A;  1B9N A;  1GUO A;  2A69 D;  2EDG A;  3TZU A;  1HPC A;  1TU2 B;  3GD7 A;  1QJO A;  3M4Y A;  4PV1 C;  3RLF A;  1Z7T A;  1E2V A;  1GJX A;  1OXV A;  4H44 C;  2NN6 G;  1E2Z A;  3AB9 A;  3PUW A;  4H13 C;  1OXT A;  2KCC A;  1FYC A;  4JK1 C;  4DK0 A;  1GHK A;  2DNC A;  2NN6 H;  3I73 A;  1GUT A;  3VA7 A;  1Q1E A;  2DN8 A;  5JEA G;  5BN5 A;  2K33 A;  2A69 C;  5JEA H;  3I72 A;  1OXX K;  1O7L A;  4HR7 B;  2LMC B;  2F1M A;  3VR2 A;  3BG3 A;  3HGB A;  2D62 A;  3PUX A;  3QG1 A;  4I7Z C;  3PV0 A;  5BN4 A;  1EWH A;  1IW7 D;  4LJZ C;  3M7N A;  3OW7 A;  4G7Z C;  2DNE A;  4OO1 G; 
#chains in the Genus database with same CATH topology
 3TS2 A;  5LMN L;  4OEL B;  4IFD H;  1VQL A;  3SE0 A;  1ENC A;  2ATW A;  4EX5 A;  1HZB A;  1RHP A;  2KEE A;  3FKI H;  1CT1 D;  5CBA E;  3EIV A;  3P7J A;  3IL8 A;  3MAQ A;  3VYS A;  1QVC A;  1FVI A;  2H5X A;  2K52 A;  3HOY G;  5CV7 A;  4RGO S;  2F4V L;  2R7F A;  1CZW A;  2H1E A;  1J9O A;  3HOW G;  4B3R Q;  1VQ8 A;  2HIX A;  3D8G A;  5AFW A;  1KL9 A;  1STH A;  3D6W A;  4KHP L;  3WOF A;  1M1K C;  3RZO B;  4ODG A;  4UY8 C;  1IBM Q;  1KDB A;  2F0K A;  1SNP A;  4EQP A;  3CHB D;  1IXR A;  4ZUI A;  2K5D A;  4X64 L;  1B8A A;  2L12 A;  4C3I B;  2YTV A;  5J3B A;  4DR1 L;  1E2W A;  4DR4 Q;  2VUM H;  1EY5 A;  4I65 A;  3CW2 C;  2HDM A;  2JA5 B;  3NWT A;  1C7Y A;  1QUQ A;  1G91 A;  2HHH Q;  1SE8 A;  3VR4 A;  5LHY 1;  1B2T A;  2EIF A;  1QCB D;  4O0A A;  2WKC A;  2PW5 A;  1JJ2 A;  5HY6 A;  1YVC A;  2WKD A;  2PI2 E;  1SJE D;  2R6G A;  1EY0 A;  3S1N H;  5IOC A;  5M5W H;  1YJW A;  1SNC A;  1SND A;  1XYI A;  4LFC L;  4B3S Q;  3H0G B;  1TXY A;  1I4X A;  1A3T A;  2G9D A;  4B3M L;  4HIO A;  4A3B H;  2XRS D;  4HJ7 A;  5KNB A;  2LFN A;  3GTL H;  4A3G H;  1HPC A;  1RDP D;  1F9S A;  3J81 i;  3NP8 A;  2PNH A;  4H44 C;  2IW3 A;  4DFA A;  5IY0 A;  4OWT B;  3FEW X;  1A3V A;  5CV8 A;  4ZQ3 A;  2E8G A;  2DN8 A;  1Y1W G;  4BY7 H;  1UUP A;  1XTD A;  3J81 j;  1JMC A;  3VYR A;  2OT2 A;  3MFG A;  5M3F H;  3R2I A;  1O7L A;  1XXG A;  3J80 L;  5KRU A;  3J81 E;  4L5S A;  3QG1 A;  1SYD A;  5BR8 Q;  4A3M G;  2RKS A;  2IX0 A;  3I4N H;  4IAL A;  1WCM G;  2E5L Q;  1BF4 A;  4L5T A;  2NVX B;  4LF7 Q;  3KF8 A;  1LTR D;  3FP9 A;  2K5W A;  2ZXR A;  4C3H G;  3OIQ A;  3RMH A;  1PMR A;  3BVM A;  4BY1 G;  1JR0 D;  3H3V I;  2UU9 Q;  5EKK A;  3K7A H;  4GNX A;  1F77 A;  2NTT A;  4HED A;  4CBV A;  4TRD A;  1ET6 A;  4FP5 D;  5FLM H;  3V96 A;  3CMA A;  1LTI D;  3HOZ G;  2F0D A;  1CQF A;  2AWN A;  1TWC B;  1X3Q A;  1ML0 D;  3KJO A;  3GO5 A;  4BXX G;  2YV5 A;  1IKM A;  5FOB B;  2YTY A;  1QZG A;  1ESR A;  1YNJ C;  1UAP A;  4ILW A;  4B3R L;  2EYF A;  4LF8 Q;  1XTC D;  1WVL A;  4K2K A;  1WTH A;  4HCS A;  1IBM L;  3HKZ E;  1WOC A;  3U4Z A;  4DAY B;  3S16 B;  5C3W A;  1Y1V G;  4H0L C;  1QB5 D;  3MXP A;  4PMW A;  4XIG S;  3HKS A;  5G3L D;  3DWA A;  3CD6 A;  2XIW A;  3HOX B;  4A93 G;  3T1H Q;  1TS3 A;  3GTO H;  1JE5 A;  3SDZ A;  2QA4 A;  1ZEQ X;  4NKL A;  3TRE A;  3E9I A;  4JVZ A;  2I5M X;  2RBM A;  4A3K H;  4LUZ A;  1IYJ B;  5GAE C;  2Y0S E;  5ELB A;  1XMO Q;  3GTP B;  1LYL A;  3A5Z B;  3KK7 A;  4JI5 Q;  4B3S L;  4N8X 1;  1X9N A;  1RIP A;  1TU2 B;  2H4O A;  1C48 A;  1LUZ A;  5I9O A;  2VNU D;  2MUY A;  1OTC A;  3PUW A;  3OIP A;  4H13 C;  1DJR D;  5M3M H;  4WJW A;  1C4Q A;  2BCO A;  3S1Q H;  2KOL A;  1H95 A;  4K5V A;  2B39 A;  1WTQ A;  1ESF A;  2K05 A;  5E3F A;  3GP7 A;  3T13 A;  3L3O C;  4MTN A;  1N36 Q;  3CPW A;  3CCU A;  2SEB D;  2WFW A;  3KFU A;  3D3R A;  2A8V A;  3OTO L;  4X3T A;  3W3A A;  5C0X I;  1R9T H;  2TSS A;  5BR8 L;  4DNR B;  2YU9 H;  4HTH A;  4HCE A;  3A5U A;  4A3F H;  3FHW A;  5K36 H;  1IBL L;  1H9M A;  1VQN A;  1LT4 D;  3EJI A;  4C3I G;  2E5L L;  4KY5 A;  5IGG A;  4LF7 L;  1RTN A;  4HJ9 A;  1VQP A;  1PH1 A;  4GLA C;  4C2M B;  2A5H A;  2JA5 G;  3M4O B;  3T53 B;  1VQB A;  1SE4 A;  2VY3 A;  2ENB A;  1FGB D;  1CSP A;  1WTR A;  1O7Z A;  5M5X B;  1VQ7 A;  1CHP D;  4A75 A;  1U4M A;  3I4M B;  1HQR D;  2NYZ D;  4IPH A;  2OQ0 A;  4X65 Q;  2NWG A;  5T1G A;  2JEA I;  3H0G G;  1K3R A;  1SE3 A;  3KJP A;  2BH2 A;  1G51 A;  3OSO A;  1HQM C;  2R61 A;  1W3S A;  3J7A 5;  2CH4 W;  4LF8 L;  2G9H D;  2RSO A;  3TS0 A;  5J1Z A;  4DR2 Q;  2EY5 A;  2BDO A;  2FMM A;  4JCV E;  1IYV A;  2F0I A;  4IJL A;  4DR7 Q;  2F0T A;  2CVR A;  3RLN A;  1Y14 B;  1G8Z D;  3J81 L;  2ZT9 C;  5AJ3 L;  1JJG A;  1B53 A;  4K6L A;  2Z9H A;  4XDX A;  2Z6B A;  1JWU D;  3O13 A;  3OPO A;  3DEO A;  3T1H L;  3H3V H;  1ONL A;  1SEB D;  5J39 A;  1X6O A;  1MHW C;  5EPJ A;  1JE4 A;  2J7Z A;  3MXU A;  4MHE A;  3AMU A;  4XYQ A;  4JI4 L;  2Z8L A;  3TN2 A;  2XWJ B;  2IY5 B;  1GHJ A;  4DV5 Q;  2R93 B;  3BDL A;  1XMO L;  2C35 B;  3PF5 A;  1PHJ A;  1SXT A;  3M4P A;  1CA6 A;  4X66 Q;  2SNM A;  1WTO A;  4QJF A;  2L9H A;  2KJX A;  1S5B D;  2MFI A;  5JEA G;  4C3J B;  3F1Z A;  1NR4 A;  2IJ0 A;  2N49 A;  1LTT D;  5C4J B;  2JA7 B;  4MN3 A;  4UP8 A;  2AQ2 B;  3T4A C;  5JPM C;  1JOR A;  5IGE A;  3S14 H;  2KCN A;  3Q24 A;  2IHF A;  1Q46 A;  3URY A;  1N36 L;  5KGU A;  2OEO A;  3QOL A;  5IOD A;  1BBX C;  3MXG A;  4RKL A;  4A3L G;  4K6D A;  5C4Z A;  1WD1 A;  3ICE A;  3MEF A;  1QVG A;  3BJU A;  1UE1 A;  1TWA B;  2PZT A;  3ULL A;  3OYY A;  4NPS A;  1I5F A;  4P75 A;  2C5C A;  1ZYR C;  4LW1 A;  1O7I A;  5EQ0 A;  4DV0 L;  4PMC A;  1P16 A;  4R1J A;  5FK9 C;  2BDN A;  3HOX G;  4IPG A;  5C5L A;  2SOB A;  1YHB A;  3T1Y L;  2L1B A;  1WJJ A;  2Z6K A;  2EYH A;  3S9W A;  1ET9 A;  3G7L A;  1L0Y B;  1EQT A;  3NE5 B;  4RA8 A;  1I94 L;  3A8J E;  4JBJ A;  3BZD B;  3GDE A;  1EIF A;  1HCZ A;  2G5D A;  2TMP A;  2K7V A;  2EOT A;  3M85 A;  4BBS H;  4RHS A;  4KKU A;  3DM1 A;  1ENA A;  3CC2 A;  1A8V A;  5C0X H;  3KYH C;  3CCE A;  3HOX H;  4O1N A;  4GOP A;  3MZ5 A;  5LL6 S;  1FNU A;  3A7L A;  4HSV A;  4DK3 C;  4DR7 L;  2JA9 A;  1ICW A;  2B3G A;  3QJY A;  4IUT A;  4UP9 A;  4LK1 C;  2AUJ D;  3QIA A;  4JI3 Q;  5D65 A;  2VUM B;  1STY A;  4CDE C;  1KLU D;  4MNO A;  3L9A X;  1V1P A;  2SNS A;  3JC6 6;  1HR0 Q;  4ME5 A;  1E2Z A;  5IGD A;  1VQG A;  4DV5 L;  1YJ9 A;  2QGQ A;  2F3W A;  3SK8 A;  1FD7 D;  5A2Q E;  4IFD I;  1XNR Q;  3AFQ A;  3H3V C;  3S1N B;  1EIH A;  5M5W B;  5BN5 A;  1PTO H;  3QWN A;  4YWK A;  1AZQ A;  5IWA L;  1W6K A;  1VQ5 A;  4I7Z C;  4A3B B;  1LV9 A;  2NZO A;  4LUV A;  2KCT A;  2PMZ B;  1VQC A;  3OW2 A;  2PZW A;  2A19 A;  3I4M G;  1AE3 A;  2WV6 D;  3GTL B;  4A3G B;  5IP9 G;  3HZX A;  4QMG A;  3I90 A;  1MGS A;  5CGK A;  1XNQ Q;  3A8I E;  3GTM H;  2N3S A;  5C6A A;  4BY7 B;  1AZP A;  4A3D H;  1TWG H;  3DXJ C;  5TSS A;  1IYU A;  1PZK D;  4R4Q A;  1L2F A;  1LM0 A;  5M3F B;  4LF9 Q;  3T51 B;  3TME A;  4F8M A;  1J5E L;  1B50 A;  4YY3 Q;  1PTO F;  2NBF A;  3LX0 A;  5A35 A;  1IHZ A;  2HD3 A;  3HOV H;  3I4N B;  4JV5 Q;  4YHH L;  2RQX A;  3C46 A;  3N6R A;  2A68 C;  3U9S A;  1Z9F A;  1X3E A;  2P5Z X;  2VQE Q;  2OWO A;  1EY7 A;  5HGT A;  2XWB B;  1IZ6 A;  3VR5 A;  1W2B A;  1S5E D;  1H9R A;  4A76 A;  2F0H A;  2CH4 A;  2EVB A;  2O2L D;  3K7A B;  2E2H H;  2R93 G;  2UUC Q;  1G6P A;  1QG7 A;  4QUF A;  1CI3 M;  1XJV A;  1Q12 A;  1VQA A;  2QW7 A;  2K1B A;  3G4S A;  2MO0 A;  4Q0F A;  4LAA A;  4QGU A;  4C3J G;  4EQO A;  4R8I A;  3FPU B;  4P74 A;  1K0S A;  4DAM A;  1D7Q A;  4BA1 I;  1KNE A;  2B8G A;  2L55 A;  2JA7 G;  2NVY H;  4YIJ A;  3L2P A;  3K57 A;  1PZJ D;  5ELF A;  4ALP A;  1A0I A;  1W6J A;  4OXP A;  4RG1 A;  4PZ6 A;  1BXT A;  2VB3 X;  1J6Q A;  3AU7 A;  3G6J B;  4QIW B;  4F88 A;  2B2Y A;  3GD7 A;  1NE3 A;  3U58 A;  1EQQ A;  4DR5 Q;  1K28 A;  3MWY W;  4JI3 L;  4FDB A;  3J7Z C;  3SK5 A;  3H91 A;  2KEN A;  1FYC A;  3C1F A;  1C9O A;  4GN4 B;  4DV7 Q;  3GTO B;  1HR0 L;  2M00 A;  5LMU Q;  2M9V A;  3HP3 A;  1CKN B;  2SDF A;  4A3K B;  3STB C;  3PO2 B;  2PO4 A;  3NUC A;  3KF6 B;  1KQS A;  1CQV A;  4RCO A;  2BH8 A;  4KHZ A;  4HMI A;  1RF2 D;  2B2W A;  2ASB A;  2CW0 C;  1QZH A;  4IFD G;  2OTL A;  1GKH A;  3RN5 A;  2B2U C;  1PRT F;  5DNF A;  5M3M B;  3A0J A;  3SEB A;  5LMN W;  1PTO C;  2N8N A;  1BCP F;  3GQB A;  5EPK A;  3S1Q B;  2WB1 B;  1SRU A;  1GVP A;  2RA4 A;  3S1M H;  1CK1 A;  1DCZ A;  1I50 H;  3D4W A;  3J7A F;  3IKJ A;  2ZM6 L;  4U68 A;  3CCM A;  1N9W A;  2A6E C;  4LWC A;  2EJM A;  3EBE A;  1G2T A;  5IT9 E;  4J8Q A;  1B9M A;  4IN3 A;  4LF9 L;  2IX1 A;  4MZ9 A;  2AKW B;  1B4O A;  3H15 A;  1R9T B;  3DUZ A;  4YY3 L;  4RGT A;  3R8B A;  2YU9 B;  1A2U A;  5DEH A;  1SLJ A;  1IL2 A;  3DWP A;  4A3F B;  4JV5 L;  5IP7 G;  4B9X A;  4DNT B;  3IFT A;  3UE0 A;  1C0A A;  4F7X A;  2VUM G;  3NBH A;  2VQE L;  3NXW A;  3EN2 A;  1STE A;  4FF3 A;  3FMC A;  3H6M A;  5A2Q L;  3VYU A;  3MHB A;  4V0B A;  3IFD A;  1EIY B;  4CHT B;  1GOZ A;  1GXD C;  2EYM A;  5FO8 B;  2X6G A;  2UUC L;  4OO1 I;  4JI7 Q;  4KN4 C;  2KHI A;  4L63 B;  1BR9 A;  4XQN A;  5IT9 c;  4K5W A;  1KAB A;  5FKA C;  5DM7 3;  3AFP A;  5IP7 H;  4JOI C;  3HOU H;  4IPD A;  4A3B G;  2B63 H;  4GN3 B;  4JBW A;  1YJN A;  2JN4 A;  2A6H C;  4X3K A;  1E22 A;  3HRZ C;  3PUY A;  2ICE C;  1K73 C;  3A54 A;  4A3G G;  2A69 D;  2QKI C;  1Q7Y C;  1HHV A;  4FVM A;  1KAW A;  1YEZ A;  1K8G A;  1Z7T A;  3RZD H;  1JWM D;  2R7D A;  4OHJ A;  5EBD A;  1HA5 A;  3TP6 A;  2VW9 A;  2UXC Q;  3I73 A;  1PYB A;  3RUZ A;  4BY7 G;  1FNV A;  1DON A;  5M3F G;  1TS5 A;  1G2S A;  2XSC A;  1YI2 A;  3CCJ A;  4DV7 L;  1S3O A;  2MO1 A;  3UDG A;  3K0X A;  1TS4 A;  1SMY D;  1PRT C;  4DV1 Q;  3I4N G;  4OON A;  1BCP C;  4A3E H;  3AEV A;  2OXP A;  3BYY B;  1MJC A;  4KHV A;  1JIC A;  1NCV A;  1AEX A;  3UI2 A;  4IJH A;  1VQI A;  4XTC S;  5GRO A;  1E24 A;  4DR3 L;  4JI1 L;  3X3N A;  4A3I G;  3NHH A;  1BVS A;  1H9S B;  3KDF B;  1H9J A;  1UNS A;  3GV6 A;  1S5C D;  1E1T A;  2QEJ C;  5FLM G;  4JI0 Q;  2FMC A;  1EEF D;  2Z4H A;  1EEI D;  2NUC A;  3R3O A;  1K83 H;  2B2T C;  4QL5 A;  1XPO A;  4RGN A;  4AQY Q;  1LT6 D;  3S14 B;  1V1Q A;  2K4K A;  2EXZ A;  2K14 A;  3GV3 A;  3OOC A;  3TDQ A;  4OX9 Q;  2BE5 D;  2Y0S B;  5JJL A;  2K01 A;  1NUC A;  2B2V C;  2UUB Q;  1IKL A;  4Y52 H;  2ALY B;  4RGM A;  2PNR C;  1YNN D;  4A3I H;  1SDF A;  2L5T A;  3EA6 A;  5IGC A;  1NSN S;  4CKB A;  5KYI A;  3S2D H;  4K8J A;  4KMU C;  2Q2I A;  1GUG A;  3RNU A;  1II3 A;  3I2Z A;  2B29 A;  2V4D A;  5CBE E;  4MIU A;  4R4I A;  3SHL A;  1HUM A;  3J81 c;  2RCF A;  1KRS A;  1U5K A;  1L1O C;  2DUD A;  4RAU C;  4A3K G;  5DM6 3;  4LNQ A;  4JI7 L;  1LTB D;  1BDO A;  3PO2 G;  1LO5 D;  4J1M A;  5ELO A;  3RD4 A;  3SR1 A;  1VQ9 A;  4OIK A;  3ND8 A;  3W1G A;  5JEA J;  2YTX A;  4JI8 Q;  5IYB H;  2N55 A;  4BBS B;  4PZ8 A;  2JA8 H;  4DPG A;  4DR4 L;  1NMF A;  5M3M G;  3S2H H;  4DK0 A;  1WI5 A;  2WB1 G;  1FGU A;  1S5D D;  2HHH L;  2MNA A;  3R93 A;  2MHV A;  3U4V A;  1STA A;  2LKV A;  5CV5 A;  5IT9 L;  2UXC L;  4KJN A;  3PO2 H;  1SJH D;  4IUP A;  3CPF A;  2D62 A;  4R4O A;  1E0B A;  4A3J B;  2GVA A;  3K0Y A;  1BQQ T;  1DOM A;  4IUN A;  4DV1 L;  1ICF B;  3VDY A;  4OO1 H;  4A3F G;  5C3X A;  4LFB Q;  5K36 G;  4LMQ D;  2FIN B;  3A8K E;  3S1R H;  1SYC A;  3E9H A;  4IQZ A;  1LAC A;  1HXY D;  2I46 A;  1X55 A;  1PTO B;  5I9P A;  4HIK A;  4QUC A;  2VZA A;  1EL0 A;  1CUK A;  5CV9 A;  4X62 Q;  1A62 A;  3PQI A;  1STN A;  4JI0 L;  1EWC A;  3KUP A;  3I56 A;  4FO2 A;  1Q3L A;  2O5I C;  2GN5 A;  3HG9 A;  4ZRZ A;  1MKH A;  3PCO B;  1GO3 E;  2LXK A;  2E2I H;  4AQY L;  5IGF A;  1F9Q A;  1SYE A;  1DGS A;  1MBY A;  4OX9 L;  3GTM B;  1IW7 C;  2F0P A;  3PUZ A;  3BZK A;  1I4H A;  2DGY A;  1TWG B;  4A3D B;  2UUB L;  1EFI D;  3LGJ A;  3F2U A;  3BS1 A;  1GUS A;  3CF5 A;  2UU9 L;  1TKW B;  2NZ1 D;  2R3Z A;  3BDO A;  5DAU A;  5JAV A;  2DY7 A;  3JAM i;  2CFM A;  3VR3 A;  3HOV B;  1CSQ A;  4BA2 I;  1ZKO A;  4FXK C;  3U50 C;  3BZC A;  3DLL A;  4DV2 Q;  3I8Z A;  3PUV A;  2IX3 A;  2DJG C;  5JOB A;  2R92 H;  3PIO 3;  4JYA Q;  4B3T Q;  1HZ9 A;  1EQV A;  4R4T A;  1JJC B;  5C4X H;  2ZTD A;  1VCI A;  3SK6 A;  2HUG A;  3MXN A;  2E2H B;  4ULL A;  2JSO A;  3TRZ A;  2I5L X;  1ROD A;  3E6Z X;  3KF8 B;  1EU3 A;  4N8F A;  1GJX A;  3SGI A;  5IGB A;  2L15 A;  1LTS D;  4S3S A;  2C9O A;  4JI8 L;  5NUC A;  4HJA A;  1XWE A;  1GM5 A;  2HCI A;  1VMP A;  4A4I A;  1LTL A;  1RD9 D;  2F0J A;  4GNX B;  4JI6 Q;  3I72 A;  4IO9 A;  3RR5 A;  2NVY B;  4GS3 A;  3SVM A;  1F2Y A;  1F2L A;  3RN2 A;  4EVO A;  2KVM A;  3ULJ A;  4C1N I;  4LJZ C;  3A55 A;  1PRT B;  1F2Z A;  2EE1 A;  1SN8 A;  3FRP B;  2HDL A;  4JC0 A;  2PPB C;  2Y0S G;  1BCP B;  4JI5 L;  2F0S A;  2PZU A;  2VL6 A;  5GAG C;  1EUJ A;  4WJ3 M;  5I4D A;  3C3L A;  4AYB E;  2HT1 A;  2A1A A;  4LFB L;  3OWE B;  3EFX D;  3NWS A;  3CAM A;  1EOT A;  4GKJ Q;  3FPP A;  2KBN A;  2HQE A;  1K0R A;  4JPB W;  4WOR A;  2GA4 B;  2X69 A;  4DAP A;  4FYD A;  2JA6 G;  3PSI A;  3I4L A;  4YCU A;  3H09 A;  2B8F A;  2E2D C;  2F0F A;  2HCC A;  4X62 L;  5ELE A;  1U4R A;  4Y7N H;  3K58 A;  3CME A;  4CJ0 B;  2J4X A;  3UDX A;  2JEB I;  1KDA A;  4YCW A;  2CCZ A;  4IOA A;  1YBY A;  1DD2 A;  4DNI A;  3S1M B;  1BKB A;  4BBS G;  1I50 B;  1I6H H;  3IAY A;  5C0X G;  1V8Q A;  2OTJ A;  1R4P B;  2L4N A;  2JA6 H;  4KI0 A;  4DXG A;  1U0L A;  2K28 A;  1CA5 A;  1AW7 A;  2F0U A;  4TVA B;  3PIO A;  2UUA Q;  2XN9 C;  3CCS A;  1KXL A;  3PMF A;  1DZ1 A;  2RCN A;  1PH5 A;  2F52 A;  3S15 H;  2PQA B;  3DHQ A;  1L1O B;  1XMQ Q;  2EJF C;  1K8M A;  1VQH A;  4X65 L;  1EQR A;  2OQK A;  1BBW A;  4B08 A;  4UDU C;  4GZY C;  4A3J G;  5ELN A;  4JYA L;  1WTV A;  4B3T L;  2K50 A;  3GTJ H;  2R7Z H;  2EDG A;  1KHI A;  1NAP A;  4IUQ A;  2AQ3 B;  1YNX A;  4R4C A;  1QJO A;  4NDX A;  2LY7 A;  3MVV A;  3W2D A;  1OXV A;  5G3L F;  4DR2 L;  1LT5 D;  2XTI A;  5L37 A;  2NN6 H;  2ZJQ A;  4Z9C B;  3KBG A;  2PQE A;  3NEN A;  4F87 A;  4IFD J;  2RF4 A;  3KLS A;  3WOE A;  5EGT A;  5T1I A;  4POF A;  3UDI A;  1CKN A;  3HOU B;  2B63 B;  2RSN A;  3HGB A;  4JI6 L;  5CMD A;  3KF6 A;  4A3J H;  1WTP A;  4G7Z C;  2DNE A;  1UWV A;  3P75 A;  4NB3 A;  2WAQ B;  2OF1 A;  3RZD B;  3K80 C;  1EIG A;  4CJ2 C;  2GVB A;  1QWY A;  4P71 A;  2Z0S A;  1Y8O B;  1Q90 A;  4XT1 B;  4A3D G;  3BVZ A;  4X66 L;  3P1H A;  4FF2 A;  1YNJ D;  3DM3 A;  4BBR H;  1NTG A;  2WAC A;  5M9O A;  1I4P A;  1D6E C;  2RHQ B;  1TR5 A;  4RWS C;  2QEX A;  5GAD C;  3SK4 A;  2KED A;  4R8N A;  4UHV A;  3HOV G;  4GKJ L;  1VQ6 A;  4A3E B;  3MA2 B;  4DF7 A;  4A3C H;  4TQU S;  2M2L A;  1EOV A;  1BBU A;  3ITP A;  2F0L A;  2FXQ A;  3BDC A;  2E75 C;  3Q22 A;  5I2X A;  4P73 A;  3T16 A;  4DR6 Q;  2ZTE A;  3Q8D A;  1UEA B;  2KEC A;  4KV6 A;  3K59 A;  4N9T A;  1TY0 A;  4DAV A;  5IYD H;  2K6A A;  1ILQ A;  5H1S E;  1K83 B;  3R2T A;  2Z4I A;  1HNW Q;  3TP8 A;  4LFA Q;  2QCP X;  2IWH A;  1O7Y A;  4QY7 A;  4P2C B;  3F2D A;  1ASY A;  2RVL A;  5COR A;  5CR3 A;  2NZH A;  4YWL A;  2UUA L;  2ZXO A;  1EY8 A;  2XGT A;  4HMJ A;  4K5X A;  4PQX A;  4A3I B;  4JI2 Q;  4Q5V A;  2CQO A;  5KYL A;  1D5Z C;  3S2D B;  4FF1 A;  1PH9 A;  1RKN A;  2F0V A;  3ZYY X;  1E2V A;  1VQE A;  4YWM A;  1KNA A;  1VMC A;  4OIJ A;  1HRJ A;  4ZUJ A;  5EJW A;  1OXT A;  4MTK A;  4JK1 C;  2JQO A;  3QOJ A;  3VA5 A;  1EZ8 A;  1KD1 C;  3J80 i;  3HS0 C;  4HSP A;  1N33 Q;  2L0C A;  1FJG Q;  3L0O A;  4AH6 A;  5LL6 X;  1HR0 W;  2MP1 A;  3KLS X;  2LMC B;  4FXG C;  4XXE A;  3VR2 A;  4L6T B;  1GD7 A;  3PV0 A;  3GTK H;  1IW7 D;  2EYL A;  2XNA C;  1PYW D;  1SMX A;  2JA8 B;  2D0P A;  2JYO A;  3PF4 A;  3QB3 A;  5FLX E;  1TWF H;  1V43 A;  2PMZ E;  4IUR A;  4L8J A;  5FJ8 H;  3GTQ H;  4DR1 Q;  2CWA A;  3S2H B;  3EVQ A;  3NEM A;  5CV4 A;  2E2J H;  5EBC A;  1H9S A;  3D4R A;  3KDF A;  3C2P A;  3U9O A;  1DM0 B;  4G7O C;  1AP0 A;  1XNR L;  1KAA A;  3RLO A;  2CKZ B;  4HJ5 A;  4YCV A;  1EYA A;  3AYH B;  4KD4 A;  3V2T A;  1N34 Q;  2RDF A;  3HFZ B;  3LWE A;  3CC4 A;  4V19 0;  2BA1 A;  1PFM A;  4OWX B;  4LFC Q;  3TBI B;  3GTG H;  3M7G A;  1STB A;  1XPR A;  1PZI D;  1FNW A;  3S1R B;  1UEB A;  3W5O A;  5FLX c;  4OWW B;  4K14 A;  1I6V C;  2X6L A;  1XNQ L;  3BVG A;  2JE6 I;  3VR6 A;  4DK1 A;  5KIX A;  1RTO A;  4ZKC B;  2KUM A;  1OXS C;  4EGV A;  1V1P B;  3FDT A;  4JG2 A;  4DR6 L;  2K5N A;  4DA2 A;  1VQK A;  3G48 A;  1H9K A;  1T5X D;  1AE2 A;  1N8R C;  2E2I B;  1HNW L;  4QF4 A;  3HOU G;  3D31 A;  2B63 G;  1UE7 A;  1B3Q A;  5C3E H;  1EY6 A;  4IUV A;  4DAY A;  1NR2 A;  4O42 A;  1I3Q H;  2WAQ G;  5D3I B;  1B9N A;  4NP5 A;  1L0X B;  4JI2 L;  4PV1 C;  3PO3 G;  1LLR D;  3DEP A;  4RH6 A;  4HN7 A;  5CYU A;  4RHR A;  5C44 H;  4QIW E;  3KLW A;  4DU9 A;  4KJO A;  2FHT A;  4ME3 A;  1TII D;  4LF6 Q;  2R92 B;  4HR7 B;  2LXJ A;  5C4X B;  2F1M A;  5I6W A;  1N33 L;  2LSS A;  2RHS B;  2ZTC A;  4A3E G;  1FJG L;  4X3U A;  4ZKB B;  5EPL A;  5I2Y A;  1ZYR D;  3NQT A;  3M3Y H;  1U9R A;  1DOL A;  1MSG A;  3PO3 H;  1Q8I A;  3K8A A;  2F0O A;  4GNX C;  4HJ8 A;  4LF5 Q;  4DR5 L;  3TP7 A;  2B2U A;  2D9U A;  3K5M A;  2AUK A;  4DGZ A;  3CKI B;  5K5P A;  4NXN Q;  2EYO A;  2EZV A;  4CKE A;  3CC7 A;  3P20 A;  3HOY H;  1HTP A;  2WB1 E;  3CXC A;  2UXB Q;  5LMU L;  3HOW H;  3TQY A;  1I4G A;  4X6A H;  2ID0 A;  4KY7 A;  5HGQ A;  3HKZ B;  1DYQ A;  3CP0 A;  1N34 L;  1XPU A;  1K3B C;  1HUN A;  2YYZ A;  1T5E A;  1X32 A;  1O80 A;  4XQQ A;  1SYF A;  4XT3 B;  2EXD A;  4CGY B;  1A63 A;  3MEH A;  4LUO A;  5BN3 A;  2AWO A;  2RDG A;  4PZ7 A;  1QVF A;  1VQD A;  1JCK B;  1P8L A;  4X3S A;  3A74 A;  1PH2 A;  2RDH A;  2MJ8 A;  3LWU A;  1V9P A;  1HNZ Q;  1F9P A;  1TWH H;  4Y7N B;  3CCV A;  1BUV T;  4K8I A;  2NVQ H;  3S24 A;  4OGQ C;  3OTO Q;  3M9B A;  5FLX L;  5GAH C;  1BNZ A;  5IYB G;  1NY4 A;  1JT8 A;  5ISR A;  2WIN B;  3DMU A;  2JA8 G;  4JOI A;  3S17 H;  3K5O A;  2KCM A;  1I6H B;  3TZU A;  3J7A V;  4ZK9 B;  1HTL D;  4GLV B;  1IBL Q;  4KK7 A;  1TVX A;  4DV6 Q;  2Z1C A;  3K7U C;  1MSH A;  3NTK A;  3Q23 A;  2JA6 B;  4R9W A;  2JK8 A;  2K5H A;  1SFO H;  1RL2 A;  1SNQ A;  4GKK Q;  1B1Z A;  1Y1W H;  1YHA A;  4CJ1 B;  1QIL A;  3S15 B;  1WTW A;  3DWQ A;  5E4W C;  3TP5 A;  3BG3 A;  4LF6 L;  1TY2 A;  3OW7 A;  4P72 A;  1D1I A;  5IE8 A;  3GTJ B;  2R7Z B;  4A3M H;  4OO1 G;  1EYD A;  1WCM H;  4APV A;  5J22 A;  4C3H H;  1XX8 A;  1DXM A;  5M5Y H;  2VS1 A;  3NBH B;  5C5M A;  5D3D A;  1AH9 A;  3W1B A;  2A68 D;  4QB4 A;  1CHQ D;  3CCL A;  4BY1 H;  1RCV D;  1WYD A;  4DUY Q;  3NTI A;  4LF5 L;  1GUN A;  4C1N K;  4RFB A;  2J0T D;  1KC8 C;  2D2C C;  2HIV A;  5FO9 B;  1HH2 P;  5JPN C;  1Y8N B;  4KKT A;  1S72 A;  2EQS A;  3HOZ H;  4M1U B;  5AJ3 Q;  4NXN L;  2XVS A;  5KEE A;  2EY6 A;  4DV3 Q;  1PYS B;  2F03 A;  4J15 A;  1HNX Q;  2UXB L;  2VB2 X;  2B2T A;  5I6Y A;  1L0W A;  4BWG B;  1U4L A;  5C0X J;  1LTA D;  4BXX H;  4ZYS A;  1VQO A;  3CQZ H;  1CFM A;  4JI4 Q;  4IUU A;  1KTK A;  1RJT A;  1Z6H A;  2B2V A;  2F0W A;  4G7H C;  4BBR B;  3WWV A;  1QUQ B;  4IPC A;  1MD2 D;  4RCN A;  1IBK Q;  1Y1V H;  3ND9 A;  4GN5 A;  1X56 A;  4O2D A;  1X54 A;  1Y8P B;  5IIF A;  2OCE A;  1S5F D;  2HQL A;  1Q8K A;  4PG3 A;  4A93 H;  5CV6 A;  2NN6 I;  4WFN 3;  2R92 G;  2DY8 A;  3I55 A;  5C4X G;  2K5Q A;  1HNZ L;  2QDB A;  2NVT H;  1PFB A;  2PQA A;  5ELC A;  1L1O A;  1GUW A;  1B44 D;  2I0Q A;  1FR3 A;  5ELD A;  3NK9 A;  3RLF A;  3M4Y A;  4AYB B;  3STB D;  3E5S A;  3AB9 A;  4EQN A;  1ZXT A;  1JC7 A;  2DNC A;  1KDC A;  4GLX A;  4DV6 L;  4DV0 Q;  2MQH A;  2CW0 D;  1EWI A;  3X3M A;  1M90 C;  1R4Q B;  1HZC A;  3K5N A;  4QQB X;  4IZ8 A;  2F3I A;  5E1F A;  2V1C C;  1B7Y B;  3B6Y A;  2LS0 1;  3CU7 A;  4GKK L;  3OMG A;  1PTO D;  3JAM E;  3PUX A;  3T1Y Q;  2N88 A;  5BN4 A;  3MC0 B;  1D8L A;  4AIM A;  2ICI A;  1SBB B;  2L11 A;  5E7N A;  2AHO B;  3KLR A;  3RZO H;  2UXD Q;  2WP8 J;  1MIU A;  3HKZ G;  2VQF Q;  2EYJ A;  1I94 Q;  2IHE A;  1E3P A;  2A6E D;  4KD3 A;  1Z47 A;  4KTA A;  4M8A A;  4WJ4 A;  1D2B A;  4C3I H;  1TT2 A;  4PNY A;  1JB3 A;  4G4K A;  3N52 A;  1I4Q A;  5DLQ E;  1TS2 A;  2JA5 H;  2D5D A;  1D5M C;  3E3X A;  3NSW A;  1VQF A;  1LTG D;  1Q82 C;  3CRK C;  3D4D A;  4XYO A;  4B9W A;  5HUR A;  3G71 A;  2Z6K C;  3GTK B;  4DUY L;  3ERO A;  4LF4 Q;  2XRQ D;  2EJG C;  3JAM c;  2K32 A;  3F2B A;  4ZLT F;  3G6E A;  2F0N A;  4DV4 Q;  1TWF B;  1SYG A;  1SRO A;  2A74 C;  4DV3 L;  3GTQ B;  1QE6 A;  1YIT A;  1HNX L;  2JXM B;  3H0G H;  1OO9 B;  1EFW A;  2E2J B;  5EAY A;  2I5H A;  3I4O A;  2Q8T A;  4KLK A;  1SR3 A;  1JOQ A;  5KND A;  1PLF A;  4KKS A;  4GOP C;  4ABN A;  3ZJY C;  2QF7 A;  1CKO A;  1I4R A;  1B70 B;  1K9M C;  2QIL A;  2A6H D;  2MGS A;  5JVG 3;  1IBK L;  5IWA Q;  1PDQ A;  4NW2 A;  3GTG B;  1PH8 A;  3L7Z C;  1HZA A;  3ERQ A;  3I7F A;  4OL7 A;  2NB0 A;  1NMG A;  1QOH A;  1PV4 A;  1EY4 A;  1S4Z A;  2I07 B;  1F9R A;  1YHQ A;  1PFS A;  2R7Z G;  4JW0 A;  5KNC A;  3QO2 A;  2D0O A;  1JB7 A;  3D6C A;  3NPP A;  2NVX H;  1PRT D;  2F0E A;  4J6H A;  2NN6 G;  1PH4 A;  2CHB D;  1ILP A;  2KHJ A;  1GHK A;  1BCP D;  1E7Z A;  1GUT A;  4N9P A;  4CKC A;  1Q1E A;  4BS9 A;  3F2C A;  4DK6 C;  3BYT B;  1S40 A;  3F8T A;  3QR8 A;  1J5E Q;  2A69 C;  5JEA H;  4XQJ A;  1OXX K;  4RKB A;  5F2D A;  3IRB A;  4DV2 L;  5C3E B;  2FFK B;  2KHS A;  1KLG D;  1A15 A;  4YHH Q;  2JJQ A;  3I3C A;  1TWC H;  1EYC A;  1EWH A;  4CDD C;  1SYB A;  3M7N A;  5C4H A;  1BO0 A;  1I3Q B;  2F0Q A;  2K33 A;  4DXF A;  2O4X A;  3TZD A;  1VF5 C;  2EYP A;  4E6I A;  2F0M A;  4HIM A;  4QCL A;  2F0G A;  1PFN A;  5C44 B;  3WDN A;  4A3L H;  1CM9 A;  4G57 A;  2E74 C;  3FKI B;  1SMY C;  1KRT A;  2UXD L;  4ZCK A;  2VQF L;  1HA6 A;  1SAP A;  5JJI A;  4U67 3;  3UE1 A;  4BBR G;  1K8A C;  5JJZ A;  4DUZ Q;  3S16 H;  3BU2 A;  1PA6 A;  2IL8 A;  2Q2U A;  2AQ1 B;  1WD0 A;  4JBK A;  2QDL A;  2MPM A;  3ONA B;  2Q8R E;  1A6X A;  4A3C G;  1G6Z A;  2VXW A;  3E0E A;  2WII B;  1PH6 A;  3M3Y B;  1V1O A;  3KBX A;  2N78 A;  4LF4 L;  3PO3 B;  5D14 A;  1QNK A;  2BA0 A;  1EYG A;  1G29 1;  3TSS A;  4HID A;  4DV4 L;  1X3P A;  1J8I A;  2EY2 A;  1N32 Q;  3GTP H;  4FNF A;  3MXN B;  5EKL A;  4L5R C;  1D5X C;  4POG A;  3CRL C;  5IYD G;  1KIX A;  4AYB G;  3HOY B;  2BE5 C;  1O78 A;  1JWS D;  2PI2 A;  1SE2 A;  3HOW B;  2E76 C;  2K75 A;  1TQO A;  1YNN C;  2NTS A;  4TKO B;  1MI2 A;  2JP1 A;  3JAM L;  1F2M A;  4HAE A;  4CDC C;  3OWF A;  2IT1 A;  2KA7 A;  2Q2T A;  2PCF B;  3KOJ A;  2B2Y C;  1CTM A;  3K5L A;  2PW7 A;  1VS0 A;  1WFQ A;  3I70 A;  4UPA A;  3K81 C;  1JQY D;  4K0K Q;  1DOK A;  3TEH B;  4NXM Q;  2IPK D;  1LT3 D;  2KCC A;  1T9H A;  3PIP 3;  4FF4 A;  5JJK A;  4H02 A;  3VYT A;  3PGZ A;  2ZM6 Q;  3I91 A;  1TWH B;  1EY9 A;  1X65 A;  3NTH A;  4UP7 A;  4H7B A;  4C2M H;  3M4O H;  1SNO A;  5COY A;  3Q6S A;  5E4X A;  3CCQ A;  2NVQ B;  2B2W C;  1C8C A;  3MTS A;  5LMN Q;  1ENF A;  5M5X H;  1MJE A;  3OHX C;  3C1E A;  1XMQ L;  3S17 B;  5GQO A;  3I4M H;  2O5J C;  5FJ8 G;  1Q86 C;  4L5Q A;  5IP9 H;  1X3G A;  1BOS A;  1VQM A;  1LAB A;  1PH3 A;  2CQA A;  3HEJ A;  2WAQ E;  1FL0 A;  1IL8 A;  1PXU A;  1M8A A;  2F3V A;  1SFO B;  3H94 A;  2F4V Q;  1SSO A;  1U4P A;  1Q1B A;  3V05 A;  1Q81 C;  1Y1W B;  2Q8I B;  2AMC B;  1HFG A;  2ZXP A;  3NBI A;  2Q2H A;  4KHP Q;  3E0J A;  1M4V A;  2ZJR A;  2FJ2 A;  4C56 C;  1A3U A;  4DUZ L;  3LNN A;  1NNX A;  1EZ6 A;  1VF7 A;  1HJP A;  4DKA C;  3A7A B;  5FO7 B;  4A3M B;  3J80 E;  2ES2 A;  4OEM B;  1JOO A;  4X64 Q;  1JOK A;  2DJF C;  1WCM B;  4NMZ A;  4ZAI A;  1VDZ A;  1NBW A;  5EKI A;  4C3H B;  5IYC G;  1PVO A;  5M5Y B;  3T56 B;  3OMC A;  2BOS A;  1E1O A;  1WTX A;  4BY1 B;  4KY6 A;  1N32 L;  3ER0 A;  2R93 H;  2A73 B;  4FXD A;  3EQL C;  1PH7 A;  3HOZ B;  1AFP A;  3K6O A;  1Y69 U;  3MFY A;  4UAI A;  4GOP B;  4RMF A;  3M4Q A;  2KQ3 A;  1QNU A;  4ID6 A;  4TSS A;  1EU4 A;  4C3J H;  4B3M Q;  2CWP A;  2K03 A;  1YZ6 A;  3CQZ B;  1NJI C;  3J80 c;  1VQJ A;  3NQI A;  4I7A A;  5C3E G;  4KN7 C;  1CKM A;  2PYK A;  5C4J H;  5JVH 3;  1OXU A;  2JA7 H;  4WRD A;  5IYC H;  1K8O A;  1AN8 A;  1GUO A;  1D1K A;  3J7Y W;  1Y1V B;  3ERS X;  1UE6 A;  1UE5 A;  4JI1 Q;  4DR3 Q;  2K5V A;  3PIP A;  3CCR A;  3UDF A;  5C44 G;  2EPB A;  1VQ4 A;  4IOC A;  3AQQ A;  3FKI G;  3NEL A;  1HFN A;  1STG A;  4CDF C;  1CZG A;  3VA7 A;  4K0K L;  3SXH A;  4A93 B;  3D0F A;  4EQ5 A;  1TWA H;  5CC4 A;  4NXM L;  1SNM A;  4K2L A;  1B3A A;  4LFA L;  2ZJP A;  1ASZ A;  3ULP A;  2EY1 A;  4DN4 M;  2NVT B;  4PMB A;  2K04 A;  1A2T A;  3FVQ A;  2F4I A;  3Q0A A;  4JBM A;  3A56 A;  1YIJ A;  1X3F A; 
#chains in the Genus database with same CATH homology
 4IFD H;  3SE0 A;  1ENC A;  1RHP A;  2KEE A;  1CT1 D;  5CBA E;  3P7J A;  3IL8 A;  3MAQ A;  3VYS A;  5CV7 A;  4RGO S;  1CZW A;  2H1E A;  1J9O A;  3D8G A;  5AFW A;  1STH A;  3D6W A;  3WOF A;  3RZO B;  4ODG A;  1KDB A;  2F0K A;  1SNP A;  4EQP A;  3CHB D;  4ZUI A;  2K5D A;  2L12 A;  4C3I B;  1E2W A;  1EY5 A;  4I65 A;  2HDM A;  2JA5 B;  3NWT A;  1G91 A;  3VR4 A;  5LHY 1;  1B2T A;  1QCB D;  2WKC A;  2PW5 A;  2WKD A;  1SJE D;  2R6G A;  1EY0 A;  5IOC A;  1SNC A;  1SND A;  1XYI A;  3H0G B;  1I4X A;  1A3T A;  2G9D A;  2XRS D;  5KNB A;  2LFN A;  1HPC A;  1RDP D;  1F9S A;  3NP8 A;  4H44 C;  2IW3 A;  4DFA A;  3FEW X;  1A3V A;  5CV8 A;  4ZQ3 A;  2DN8 A;  1UUP A;  3VYR A;  2OT2 A;  3MFG A;  3R2I A;  1O7L A;  1XXG A;  3J80 L;  5KRU A;  3J81 E;  3QG1 A;  1SYD A;  2RKS A;  2IX0 A;  4IAL A;  1BF4 A;  2NVX B;  3KF8 A;  1LTR D;  4C3H G;  2K5W A;  2ZXR A;  3OIQ A;  3RMH A;  1PMR A;  3BVM A;  1JR0 D;  5EKK A;  1F77 A;  2NTT A;  4HED A;  4CBV A;  4TRD A;  1ET6 A;  4FP5 D;  3V96 A;  1LTI D;  2F0D A;  1CQF A;  2AWN A;  1TWC B;  1X3Q A;  1ML0 D;  3GO5 A;  1IKM A;  5FOB B;  1ESR A;  1YNJ C;  1UAP A;  4ILW A;  2EYF A;  1XTC D;  1WVL A;  4K2K A;  4HCS A;  3S16 B;  5C3W A;  4H0L C;  1QB5 D;  3MXP A;  4PMW A;  4XIG S;  5G3L D;  3DWA A;  2XIW A;  3HOX B;  1TS3 A;  3SDZ A;  1ZEQ X;  4NKL A;  2RBM A;  5ELB A;  3GTP B;  3KK7 A;  1TU2 B;  2H4O A;  1C48 A;  5I9O A;  2VNU D;  2MUY A;  3PUW A;  3OIP A;  4H13 C;  1DJR D;  4WJW A;  1C4Q A;  2BCO A;  2KOL A;  4K5V A;  2B39 A;  1WTQ A;  1ESF A;  2K05 A;  5E3F A;  3GP7 A;  3T13 A;  3L3O C;  2SEB D;  3D3R A;  4X3T A;  3W3A A;  5C0X I;  2TSS A;  4DNR B;  4HTH A;  4HCE A;  5K36 H;  1H9M A;  1LT4 D;  3EJI A;  4C3I G;  4KY5 A;  5IGG A;  1RTN A;  4C2M B;  2A5H A;  3M4O B;  3T53 B;  1SE4 A;  2ENB A;  1FGB D;  1WTR A;  1O7Z A;  5M5X B;  1CHP D;  1U4M A;  3I4M B;  1HQR D;  2NYZ D;  2NWG A;  5T1G A;  2JEA I;  1SE3 A;  3OSO A;  1HQM C;  2R61 A;  2G9H D;  2RSO A;  5J1Z A;  2EY5 A;  2BDO A;  2FMM A;  1IYV A;  2F0I A;  2F0T A;  2CVR A;  1G8Z D;  3J81 L;  2ZT9 C;  1B53 A;  4K6L A;  4XDX A;  1JWU D;  3O13 A;  3OPO A;  3DEO A;  1ONL A;  1SEB D;  5J39 A;  5EPJ A;  1JE4 A;  2J7Z A;  3MXU A;  4MHE A;  3AMU A;  4XYQ A;  2Z8L A;  3TN2 A;  2XWJ B;  1GHJ A;  2R93 B;  3BDL A;  1SXT A;  1CA6 A;  2SNM A;  1WTO A;  2L9H A;  2KJX A;  1S5B D;  5JEA G;  4C3J B;  1NR4 A;  2IJ0 A;  1LTT D;  5C4J B;  2JA7 B;  4MN3 A;  2AQ2 B;  3T4A C;  5JPM C;  1JOR A;  5IGE A;  2KCN A;  3Q24 A;  3URY A;  5KGU A;  2OEO A;  3QOL A;  5IOD A;  1BBX C;  3MXG A;  4RKL A;  4K6D A;  5C4Z A;  1WD1 A;  1TWA B;  2PZT A;  2C5C A;  1ZYR C;  5EQ0 A;  4PMC A;  5FK9 C;  2BDN A;  5C5L A;  2SOB A;  2L1B A;  2EYH A;  3S9W A;  1ET9 A;  3G7L A;  1L0Y B;  1EQT A;  3NE5 B;  4RA8 A;  3A8J E;  3BZD B;  1HCZ A;  2TMP A;  2K7V A;  2EOT A;  3M85 A;  4RHS A;  4KKU A;  3DM1 A;  1ENA A;  5C0X H;  4O1N A;  3MZ5 A;  5LL6 S;  1FNU A;  3A7L A;  4HSV A;  1ICW A;  3QJY A;  4IUT A;  4LK1 C;  2AUJ D;  3QIA A;  5D65 A;  2VUM B;  1STY A;  1KLU D;  3L9A X;  1V1P A;  2SNS A;  4ME5 A;  1E2Z A;  5IGD A;  2F3W A;  3SK8 A;  1FD7 D;  5A2Q E;  4IFD I;  3H3V C;  3S1N B;  1EIH A;  5M5W B;  5BN5 A;  1PTO H;  3QWN A;  1AZQ A;  1W6K A;  4I7Z C;  4A3B B;  1LV9 A;  2PMZ B;  2PZW A;  2WV6 D;  3GTL B;  4A3G B;  3HZX A;  4QMG A;  3I90 A;  1MGS A;  5CGK A;  3A8I E;  5C6A A;  4BY7 B;  1AZP A;  3DXJ C;  5TSS A;  1IYU A;  1PZK D;  5M3F B;  3T51 B;  3TME A;  4F8M A;  1B50 A;  1PTO F;  2NBF A;  3LX0 A;  5A35 A;  1IHZ A;  3I4N B;  2RQX A;  3C46 A;  3N6R A;  2A68 C;  3U9S A;  1EY7 A;  5HGT A;  2XWB B;  3VR5 A;  1S5E D;  1H9R A;  2F0H A;  2EVB A;  2O2L D;  3K7A B;  1QG7 A;  4QUF A;  1CI3 M;  1Q12 A;  2K1B A;  4Q0F A;  4LAA A;  4C3J G;  4EQO A;  4R8I A;  3FPU B;  4BA1 I;  1KNE A;  2B8G A;  2L55 A;  4YIJ A;  3K57 A;  1PZJ D;  5ELF A;  1W6J A;  1BXT A;  2VB3 X;  3AU7 A;  3G6J B;  4QIW B;  4F88 A;  2B2Y A;  3GD7 A;  3MWY W;  3SK5 A;  3H91 A;  1FYC A;  3C1F A;  3GTO B;  2M00 A;  2M9V A;  3HP3 A;  2SDF A;  4A3K B;  3PO2 B;  2PO4 A;  3NUC A;  1CQV A;  4RCO A;  4KHZ A;  4HMI A;  1RF2 D;  2B2W A;  4IFD G;  2CW0 C;  2B2U C;  1PRT F;  5DNF A;  5M3M B;  3SEB A;  1PTO C;  1BCP F;  3GQB A;  5EPK A;  3S1Q B;  2WB1 B;  2RA4 A;  1CK1 A;  1DCZ A;  3D4W A;  3J7A F;  3IKJ A;  4U68 A;  2A6E C;  2EJM A;  1G2T A;  5IT9 E;  4J8Q A;  1B9M A;  4IN3 A;  2IX1 A;  1B4O A;  1R9T B;  3DUZ A;  3R8B A;  4RGT A;  2YU9 B;  1A2U A;  5DEH A;  3DWP A;  4A3F B;  4B9X A;  4DNT B;  3IFT A;  4F7X A;  3NBH A;  3NXW A;  1STE A;  4FF3 A;  3FMC A;  3H6M A;  5A2Q L;  3VYU A;  3MHB A;  4V0B A;  3IFD A;  4CHT B;  1GOZ A;  1GXD C;  2EYM A;  5FO8 B;  2X6G A;  4OO1 I;  4KN4 C;  4L63 B;  4XQN A;  1BR9 A;  4K5W A;  1KAB A;  5FKA C;  5DM7 3;  4JBW A;  2A6H C;  4X3K A;  3HRZ C;  3PUY A;  2ICE C;  3A54 A;  2A69 D;  2QKI C;  1HHV A;  4FVM A;  1Z7T A;  1JWM D;  4OHJ A;  5EBD A;  1HA5 A;  3TP6 A;  3I73 A;  3RUZ A;  1FNV A;  1DON A;  1TS5 A;  1G2S A;  2XSC A;  1TS4 A;  1SMY D;  1PRT C;  1BCP C;  2OXP A;  3BYY B;  4KHV A;  1JIC A;  1NCV A;  1AEX A;  3UI2 A;  4XTC S;  3X3N A;  3NHH A;  1H9S B;  1H9J A;  1UNS A;  3GV6 A;  1S5C D;  2QEJ C;  2FMC A;  1EEF D;  2Z4H A;  1EEI D;  2NUC A;  3R3O A;  2B2T C;  4RGN A;  3S14 B;  1LT6 D;  2EXZ A;  3GV3 A;  3OOC A;  3TDQ A;  2BE5 D;  2Y0S B;  2K01 A;  1NUC A;  2B2V C;  1IKL A;  4RGM A;  2PNR C;  1YNN D;  1SDF A;  2L5T A;  3EA6 A;  5IGC A;  1NSN S;  4CKB A;  5KYI A;  4K8J A;  4KMU C;  1GUG A;  1II3 A;  2V4D A;  5CBE E;  4MIU A;  3SHL A;  1HUM A;  4RAU C;  5DM6 3;  1LTB D;  1BDO A;  1LO5 D;  4J1M A;  3RD4 A;  3SR1 A;  4OIK A;  3ND8 A;  5JEA J;  2N55 A;  4BBS B;  4DK0 A;  1S5D D;  3R93 A;  2MHV A;  1STA A;  2LKV A;  5CV5 A;  5IT9 L;  4KJN A;  1SJH D;  4IUP A;  2D62 A;  1E0B A;  4A3J B;  3K0Y A;  1BQQ T;  1DOM A;  4IUN A;  4OO1 H;  5C3X A;  5K36 G;  4LMQ D;  2FIN B;  3A8K E;  1SYC A;  4IQZ A;  1LAC A;  1HXY D;  2I46 A;  1PTO B;  5I9P A;  4QUC A;  1EL0 A;  5CV9 A;  1STN A;  1EWC A;  3KUP A;  4FO2 A;  1Q3L A;  2O5I C;  3HG9 A;  4ZRZ A;  5IGF A;  1F9Q A;  1SYE A;  1MBY A;  3GTM B;  1IW7 C;  2F0P A;  3PUZ A;  1I4H A;  4A3D B;  1TWG B;  1EFI D;  3F2U A;  3BS1 A;  1GUS A;  1TKW B;  2NZ1 D;  2R3Z A;  3BDO A;  5DAU A;  5JAV A;  2DY7 A;  3VR3 A;  3HOV B;  4BA2 I;  1ZKO A;  4FXK C;  3I8Z A;  3PUV A;  2IX3 A;  5JOB A;  3PIO 3;  1EQV A;  1VCI A;  3SK6 A;  2HUG A;  3MXN A;  2E2H B;  4ULL A;  2JSO A;  1ROD A;  3E6Z X;  1EU3 A;  1GJX A;  5IGB A;  1LTS D;  4S3S A;  2C9O A;  5NUC A;  1XWE A;  2HCI A;  1VMP A;  1RD9 D;  2F0J A;  3I72 A;  2NVY B;  3SVM A;  1F2Y A;  1F2L A;  4EVO A;  2KVM A;  4C1N I;  4LJZ C;  3A55 A;  1PRT B;  1F2Z A;  2EE1 A;  3FRP B;  2HDL A;  2PPB C;  1BCP B;  2F0S A;  2PZU A;  5I4D A;  3C3L A;  3OWE B;  3EFX D;  3NWS A;  1EOT A;  3FPP A;  2HQE A;  4WOR A;  2GA4 B;  2X69 A;  4DAP A;  4FYD A;  3I4L A;  3H09 A;  2B8F A;  2E2D C;  2F0F A;  2HCC A;  5ELE A;  1U4R A;  3K58 A;  4CJ0 B;  2J4X A;  2JEB I;  1KDA A;  1DD2 A;  3S1M B;  1I50 B;  3IAY A;  5C0X G;  1V8Q A;  1R4P B;  2L4N A;  4KI0 A;  4DXG A;  2K28 A;  1CA5 A;  1AW7 A;  2F0U A;  2XN9 C;  3PMF A;  1DZ1 A;  3DHQ A;  2EJF C;  1K8M A;  4B08 A;  4UDU C;  4GZY C;  1WTV A;  2EDG A;  1NAP A;  4IUQ A;  2AQ3 B;  1QJO A;  4NDX A;  2LY7 A;  3MVV A;  3W2D A;  1OXV A;  5G3L F;  1LT5 D;  2NN6 H;  4Z9C B;  3KBG A;  2PQE A;  4F87 A;  4IFD J;  3KLS A;  3WOE A;  5EGT A;  5T1I A;  3HOU B;  2B63 B;  2RSN A;  3HGB A;  5CMD A;  1WTP A;  4G7Z C;  2DNE A;  3P75 A;  2WAQ B;  2OF1 A;  3RZD B;  1EIG A;  4CJ2 C;  1QWY A;  1Y8O B;  1Q90 A;  4XT1 B;  3BVZ A;  3P1H A;  4FF2 A;  1YNJ D;  5M9O A;  2WAC A;  1I4P A;  1D6E C;  1TR5 A;  4RWS C;  3SK4 A;  2KED A;  4R8N A;  4A3E B;  3MA2 B;  4DF7 A;  4TQU S;  2M2L A;  3ITP A;  2F0L A;  3BDC A;  2E75 C;  3Q22 A;  5I2X A;  3T16 A;  1UEA B;  2KEC A;  4KV6 A;  3K59 A;  4N9T A;  1TY0 A;  4DAV A;  2K6A A;  1ILQ A;  1K83 B;  3R2T A;  2Z4I A;  3TP8 A;  2QCP X;  2IWH A;  1O7Y A;  4P2C B;  2RVL A;  5COR A;  5CR3 A;  2ZXO A;  1EY8 A;  4PQX A;  4HMJ A;  4K5X A;  4A3I B;  4Q5V A;  5KYL A;  1D5Z C;  3S2D B;  4FF1 A;  1RKN A;  2F0V A;  3ZYY X;  1E2V A;  1KNA A;  1VMC A;  4OIJ A;  1HRJ A;  4ZUJ A;  5EJW A;  1OXT A;  4JK1 C;  3QOJ A;  3VA5 A;  1EZ8 A;  3HS0 C;  4HSP A;  2L0C A;  5LL6 X;  2MP1 A;  3KLS X;  2LMC B;  4FXG C;  4XXE A;  3VR2 A;  4L6T B;  3PV0 A;  1IW7 D;  2EYL A;  2XNA C;  1PYW D;  2JA8 B;  2JYO A;  3QB3 A;  5FLX E;  1V43 A;  4IUR A;  4L8J A;  3S2H B;  3EVQ A;  5CV4 A;  5EBC A;  1H9S A;  3D4R A;  3C2P A;  3U9O A;  1DM0 B;  4G7O C;  1AP0 A;  1KAA A;  1EYA A;  4KD4 A;  3V2T A;  2RDF A;  3LWE A;  4V19 0;  2BA1 A;  1PFM A;  3TBI B;  3M7G A;  1STB A;  1PZI D;  1FNW A;  3S1R B;  4K14 A;  1I6V C;  2X6L A;  3BVG A;  2JE6 I;  3VR6 A;  4DK1 A;  5KIX A;  1RTO A;  4ZKC B;  2KUM A;  1OXS C;  4EGV A;  1V1P B;  3FDT A;  4DA2 A;  1H9K A;  1T5X D;  2E2I B;  4QF4 A;  3D31 A;  1EY6 A;  4IUV A;  4DAY A;  1NR2 A;  4O42 A;  5D3I B;  1B9N A;  4NP5 A;  1L0X B;  4PV1 C;  1LLR D;  3DEP A;  4RH6 A;  4HN7 A;  5CYU A;  4RHR A;  4DU9 A;  4KJO A;  2FHT A;  1TII D;  2R92 B;  4HR7 B;  5C4X B;  2F1M A;  5I6W A;  4X3U A;  4ZKB B;  5EPL A;  5I2Y A;  1ZYR D;  3NQT A;  1U9R A;  1DOL A;  1MSG A;  1Q8I A;  2F0O A;  3TP7 A;  2B2U A;  2D9U A;  3K5M A;  2AUK A;  4DGZ A;  3CKI B;  5K5P A;  2EYO A;  2EZV A;  4CKE A;  3P20 A;  1HTP A;  1I4G A;  2ID0 A;  4KY7 A;  3HKZ B;  1DYQ A;  1HUN A;  2YYZ A;  1T5E A;  1X32 A;  1O80 A;  4XQQ A;  1SYF A;  4XT3 B;  4CGY B;  3MEH A;  5BN3 A;  2AWO A;  2RDG A;  1JCK B;  4X3S A;  2RDH A;  2MJ8 A;  3LWU A;  1F9P A;  4Y7N B;  1BUV T;  4K8I A;  4OGQ C;  5FLX L;  1BNZ A;  5ISR A;  2WIN B;  3DMU A;  3K5O A;  1I6H B;  3TZU A;  3J7A V;  4ZK9 B;  1HTL D;  4KK7 A;  1TVX A;  2Z1C A;  1MSH A;  3NTK A;  3Q23 A;  2JA6 B;  4R9W A;  1SNQ A;  1B1Z A;  4CJ1 B;  1QIL A;  3S15 B;  1WTW A;  3DWQ A;  5E4W C;  3TP5 A;  3BG3 A;  1TY2 A;  3OW7 A;  1D1I A;  3GTJ B;  2R7Z B;  4OO1 G;  1EYD A;  5J22 A;  1XX8 A;  1DXM A;  5C5M A;  5D3D A;  2A68 D;  4QB4 A;  1CHQ D;  1RCV D;  3NTI A;  1GUN A;  4C1N K;  4RFB A;  2J0T D;  2D2C C;  5FO9 B;  5JPN C;  1Y8N B;  4KKT A;  4M1U B;  2XVS A;  5KEE A;  2EY6 A;  2F03 A;  2VB2 X;  2B2T A;  5I6Y A;  4BWG B;  1U4L A;  5C0X J;  1LTA D;  4ZYS A;  1CFM A;  4IUU A;  1KTK A;  1RJT A;  1Z6H A;  2B2V A;  2F0W A;  4G7H C;  4BBR B;  1MD2 D;  4RCN A;  3ND9 A;  1Y8P B;  5IIF A;  1S5F D;  5CV6 A;  2NN6 I;  4WFN 3;  2DY8 A;  2K5Q A;  2QDB A;  1PFB A;  5ELC A;  1GUW A;  1B44 D;  1FR3 A;  5ELD A;  3NK9 A;  3RLF A;  3M4Y A;  4AYB B;  3E5S A;  3AB9 A;  4EQN A;  1ZXT A;  1JC7 A;  2DNC A;  1KDC A;  2CW0 D;  3X3M A;  1R4Q B;  3K5N A;  4IZ8 A;  5E1F A;  2LS0 1;  3CU7 A;  3OMG A;  1PTO D;  3JAM E;  3PUX A;  2N88 A;  5BN4 A;  3MC0 B;  2ICI A;  1SBB B;  2L11 A;  3KLR A;  2WP8 J;  2EYJ A;  2A6E D;  4KD3 A;  1Z47 A;  4KTA A;  4M8A A;  1D2B A;  1TT2 A;  4PNY A;  1JB3 A;  4G4K A;  3N52 A;  1I4Q A;  1TS2 A;  2D5D A;  1D5M C;  3NSW A;  1LTG D;  3CRK C;  3D4D A;  4XYO A;  4B9W A;  5HUR A;  3GTK B;  3ERO A;  2XRQ D;  2EJG C;  2K32 A;  4ZLT F;  2F0N A;  1TWF B;  1SYG A;  2A74 C;  3GTQ B;  1QE6 A;  2JXM B;  1OO9 B;  2E2J B;  2Q8T A;  1JOQ A;  5KND A;  1PLF A;  4KKS A;  4ABN A;  2QF7 A;  1I4R A;  2QIL A;  2A6H D;  2MGS A;  5JVG 3;  1PDQ A;  4NW2 A;  3GTG B;  3L7Z C;  3ERQ A;  4OL7 A;  2NB0 A;  1QOH A;  1EY4 A;  1S4Z A;  2I07 B;  1F9R A;  5KNC A;  3QO2 A;  3D6C A;  3NPP A;  1PRT D;  2F0E A;  4J6H A;  2NN6 G;  2CHB D;  1ILP A;  1GHK A;  1BCP D;  4N9P A;  1GUT A;  4CKC A;  1Q1E A;  4BS9 A;  3BYT B;  2A69 C;  5JEA H;  4XQJ A;  1OXX K;  4RKB A;  5F2D A;  5C3E B;  2FFK B;  2KHS A;  1KLG D;  1A15 A;  3I3C A;  1EYC A;  1EWH A;  1SYB A;  3M7N A;  5C4H A;  1BO0 A;  1I3Q B;  2F0Q A;  2K33 A;  4DXF A;  2O4X A;  3TZD A;  1VF5 C;  2EYP A;  4E6I A;  2F0M A;  4QCL A;  2F0G A;  1PFN A;  5C44 B;  3WDN A;  1CM9 A;  2E74 C;  4G57 A;  3FKI B;  1SMY C;  1HA6 A;  1SAP A;  4U67 3;  5JJZ A;  2IL8 A;  2AQ1 B;  1WD0 A;  2MPM A;  3ONA B;  2Q8R E;  1A6X A;  1G6Z A;  2VXW A;  2WII B;  3M3Y B;  1V1O A;  3KBX A;  3PO3 B;  5D14 A;  1QNK A;  2BA0 A;  1G29 1;  3TSS A;  1X3P A;  1J8I A;  2EY2 A;  4FNF A;  5EKL A;  1D5X C;  3CRL C;  3HOY B;  2BE5 C;  1O78 A;  1JWS D;  1SE2 A;  3HOW B;  2E76 C;  1TQO A;  1YNN C;  2NTS A;  4TKO B;  1MI2 A;  2JP1 A;  3JAM L;  1F2M A;  4HAE A;  2KA7 A;  2IT1 A;  3OWF A;  2PCF B;  2B2Y C;  1CTM A;  3K5L A;  2PW7 A;  3I70 A;  1JQY D;  1DOK A;  2IPK D;  1LT3 D;  2KCC A;  3PIP 3;  4FF4 A;  3VYT A;  3I91 A;  1TWH B;  1EY9 A;  3NTH A;  4H7B A;  1SNO A;  5COY A;  3Q6S A;  5E4X A;  2NVQ B;  2B2W C;  1C8C A;  3MTS A;  1ENF A;  3OHX C;  3C1E A;  3S17 B;  2O5J C;  1BOS A;  1LAB A;  2CQA A;  3HEJ A;  1PXU A;  1IL8 A;  1M8A A;  2F3V A;  1SFO B;  3H94 A;  1SSO A;  1U4P A;  1Q1B A;  3V05 A;  1Y1W B;  2Q8I B;  1HFG A;  2ZXP A;  3NBI A;  3E0J A;  1M4V A;  2FJ2 A;  4C56 C;  1A3U A;  3LNN A;  1EZ6 A;  1VF7 A;  4A3M B;  3A7A B;  5FO7 B;  3J80 E;  1JOO A;  1JOK A;  1WCM B;  4NMZ A;  4ZAI A;  1VDZ A;  5EKI A;  4C3H B;  5M5Y B;  3T56 B;  2BOS A;  3OMC A;  1WTX A;  4BY1 B;  4KY6 A;  2A73 B;  4FXD A;  3EQL C;  3HOZ B;  1AFP A;  3K6O A;  1Y69 U;  3MFY A;  4UAI A;  2KQ3 A;  1QNU A;  4ID6 A;  4TSS A;  1EU4 A;  2K03 A;  3CQZ B;  3NQI A;  4KN7 C;  2PYK A;  5JVH 3;  1OXU A;  4WRD A;  1K8O A;  1AN8 A;  1GUO A;  1D1K A;  3J7Y W;  1Y1V B;  2EPB A;  1HFN A;  1STG A;  1CZG A;  3VA7 A;  3SXH A;  4A93 B;  5CC4 A;  1SNM A;  4K2L A;  1B3A A;  2EY1 A;  4DN4 M;  2NVT B;  4PMB A;  2K04 A;  1A2T A;  3FVQ A;  2F4I A;  3Q0A A;  3A56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...