3A8KE

Crystal structure of etd97n-ehred complex
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
126
structure length
125
Chain Sequence
b'NVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLED'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminomethyltransferase
publication title Crystal structure of aminomethyltransferase in complex with dihydrolipoyl-H-protein of the glycine cleavage system: implications for recognition of lipoyl protein substrate, disease-related mutations, and reaction mechanism
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase/transport protein
total genus 29
structure length 125
sequence length 126
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF01597 GCV_H Glycine cleavage H-protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3a8kE00
1GUTA 4KN4C 1Q1EA 2D2CC 3RLFA 4OGQC 2BE5C 3PUVA 2F1MA 5BN4A 1H9JA 2BDOA 2PNRC 4JBWA 3A7AB 2A69D 3D31A 4RCNA 4G7ZC 3M7NA 4G7OC 2DNEA 1O7LA 2D62A 1GHKA 1OXXK 4LJZC 3T56B 1V8QA 3FPPA 3BG3A 4GZYC 1B9MA 3T51B 4DNTB 3U9SA 2O5IC 1CFMA 3CRKC 3ND8A 2R6GA 3ND9A 2JEAI 1Z7TA 2O5JC 2E74C 4KN7C 4DK0A 1VF7A 1FYCA 3T53B 3WDNA 3VR6A 2AUJD 3QG1A 4G7HC 1H9RA 4KKUA 4XTCS 1A6XA 1VF5C 1YNNC 3LNNA 1E2ZA 5C0XH 1VCIA 1GUGA 3PUXA 5BN5A 2ZT9C 3SE0A 1H9KA 2E75C 1T5EA 4IFDH 3QIAA 2NN6I 5C0XG 2YYZA 5BN3A 1B9NA 2AWOA 2JE6I 2DNCA 2KA7A 4IFDG 1VDZA 1I6VC 2A6EC 3H94A 5K36H 4JK1C 1EWHA 3VR3A 3VR2A 2KCCA 2EJMA 1ZYRC 3HGBA 2V4DA 4LK1C 3VR5A 1K8OA 1CTMA 5K36G 3AB9A 1E2VA 1BDOA 1LABA 1H9SA 1GHJA 1IW7D 2BA0A 4I7ZC 3PUWA 3MFYA 1Z6HA 2A6HD 1QJOA 1GJXA 1G291 1Y8OB 1Y8PB 3I4LA 3N6RA 3LWUA 4L8JA 2L5TA 3L7ZC 2PPBC 1FR3A 4H0LC 5KNBA 2BE5D 2A68C 3A8KE 1GUSA 3I73A 3MXUA 1OXSC 2B8GA 1O78A 2LMCB 3P20A 1V43A 2A69C 1OXTA 2CW0C 4IQZA 1OXVA 1Y8NB 2E76C 2K7VA 2PCFB 3PUZA 3A7LA 4KKSA 2DN8A 1GUOA 1CI3M 4XIGS 1H9SB 4TKOB 1DXMA 1YNJC 1TU2B 4OO1H 3A8IE 1HCZA 2JEBI 2AUKA 3FMCA 3OPOA 4TQUS 4H44C 3SDZA 4KHZA 3TZUA 4BA2I 4DNRB 3IFTA 2EJFC 3IKJA 1GUNA 5A35A 4OO1G 2QF7A 5JEAH 3DXJC 1E2WA 2K33A 1Q90A 2IT1A 4PV1C 2Q8IB 3VR4A 1H9MA 2K32A 4H13C 4BA1I 5KNDA 3VA7A 1IYVA 4KKTA 4KMUC 3OOCA 1LACA 5JEAG 3A8JE 1DCZA 1PMRA 2EVBA 4HR7B 1TKWB 3KLRA 3GD7A 3CRLC 1DD2A 2NN6H 2A6ED 2B8FA 4DK1A 3PV0A 3GQBA 3OW7A 3QJYA 5KNCA 1IYUA 1HQMC 1HTPA 3PUYA 3NE5B 1HPCA 2D5DA 2NN6G 1Q12A 1Y69U 2JXMB 1OXUA 3M4YA 2BA1A 3D4RA 1SMYC 1IW7C 1ONLA 2EJGC 1K8MA 3BDOA 3I72A 2A6HC 3W3AA 4KI0A 1Q1BA 1ZKOA 2EDGA 3EQLC 2A68D 3M85A
chains in the Genus database with same CATH superfamily
3BYTB 3S15B 1GUTA 1Q1EA 3CCJA 3CW2C 3WWVA 1S40A 2OWOA 4P73A 1OXXK 4P72A 1ENAA 3FPUB 4R4QA 5HURA 3GTLH 3A5UA 1EQVA 5EPLA 1FNUA 3FRPB 3HOWH 4JI2Q 3K0XA 3TP5A 4X64Q 2O5JC 3A54A 4DUYL 4KN7C 4A3KG 1CKNA 1CA5A 5A2QE 1SLJA 1DYQA 3WDNA 3CC2A 3SK4A 4RHSA 1C48A 2K04A 2NVYB 5E7NA 5C4ZA 3A56A 1RJTA 1K9MC 4C3IB 2ZT9C 3W5OA 5LMNQ 1H9KA 3S17H 1WCMH 2YYZA 1WTPA 2YTXA 1FL0A 1D5ZC 4NXNL 4DV0L 3S1RB 3H94A 4BBSB 4JI8Q 5GAEC 2R7ZB 4DKAC 1QUQB 1BDOA 2JA7H 1UEBA 1VQGA 4QB4A 4LFBL 4KY6A 2JQOA 2K5NA 1XPUA 2A68C 3ONAB 4JI3L 3T13A 4F88A 4DV6Q 5IOCA 1SJHD 2NVXB 2K7VA 2NZHA 4RKLA 1JWMD 1HZ9A 1LUZA 5FLMH 1QE6A 3MXNB 4IPHA 5DLQE 1YNJC 5DM63 1M1KC 3A8IE 1QZGA 1K0RA 1LT6D 3D0FA 1D7QA 2WAQB 3MC0B 3Q0AA 5A35A 5D14A 1I50H 3CAMA 4IUNA 1J5EL 2I07B 2H4OA 3F8TA 2B29A 1PH1A 5IGBA 2L4NA 2PZUA 1LLRD 3IRBA 2ZXOA 4DAMA 1VQ5A 4DR3L 1EU3A 4JI4Q 1WYDA 1YIJA 5M5XH 2B2YC 1VQHA 3PO2B 1I6HB 3DWQA 1MI2A 1KD1C 2I5MX 2SNMA 4DR5Q 3HG9A 4YHHQ 2EYMA 4YCVA 1VQ4A 1D6EC 3PQIA 2EYLA 1TIID 2NTSA 5ELFA 1VQEA 2EJGC 4GNXC 4KHVA 2PQAA 1T9HA 2Q8IB 3HOXH 1AZPA 1D2BA 1VQKA 2JP1A 4A3DG 1S5CD 2K6AA 2PNRC 3RR5A 1UE1A 3I3CA 2BCOA 1HR0L 1JC7A 1XXGA 1X3QA 4FDBA 4LAAA 3TS0A 2OEOA 1LT5D 5FO9B 3G6JB 3H09A 3SK5A 1EYDA 3KF6B 3GTKB 2B2WA 4DR7Q 4LF9Q 3M7GA 2TSSA 1X55A 4HN7A 1XJVA 3GTJB 3T53B 2EYJA 1HJPA 1F2LA 2AUJD 3MFGA 2VW9A 3QO2A 1X3GA 1B50A 2WV6D 1Y1WB 4HAEA 3OIQA 4BS9A 2AQ3B 2VZAA 3ICEA 2KA7A 3GTOB 1LTTD 3DUZA 4NKLA 2Z8LA 4X65Q 1EWHA 1TR5A 4I7AA 5IYCG 3JAMc 2R93G 1VQIA 3PCOB 5M3MH 3H0GH 1BCPB 3AB9A 3MEFA 1E3PA 4L5QA 1SMYD 3DLLA 1IW7D 2IL8A 2UXBQ 1CHPD 1Z9FA 4IJHA 1BOSA 4YIJA 3KLSA 3KJOA 3S1QH 5C4JH 3GTGB 3JC66 4H02A 3CCRA 4MN3A 2ZXPA 3CU7A 2F0LA 1BCPF 4LUVA 4ME5A 2UU9Q 2KCNA 1KXLA 2D9UA 2FHTA 1TU2B 3TN2A 1IBLQ 3TDQA 4DNRB 2EJFC 4YWLA 4K5VA 4DV5L 1SJED 4A3KB 1E2WA 1Q90A 3VR4A 4PZ8A 3H3VC 5C3EH 1TWHB 2TMPA 4CKEA 1ICFB 1V1OA 1LACA 2QKIC 1DCZA 1G91A 2Z4IA 3KFUA 4LNQA 4DK3C 5C4XB 4HCSA 1DGSA 1HUNA 1N8RC 4K5XA 2D5DA 2F0JA 1VQ7A 4WJ3M 3FDTA 4EGVA 1I4RA 2PQAB 5JJIA 1B3QA 3NP8A 2QCPX 1O7ZA 3CC7A 3ZYYX 2MQHA 3E0JA 4IUTA 5ELNA 5CBEE 2A68D 4IPCA 3JAML 1YNXA 1EY0A 3RLFA 2IWHA 5BN4A 1XPOA 5M3FH 4U673 3A7AB 5I6YA 1O7LA 5IWAL 1SE2A 4QJFA 3S1NB 3T56B 1YNJD 1I3QH 2RBMA 1V1PB 1PTOH 2N78A 3BVGA 1SE8A 5J3BA 1HNXL 4A3GH 1LTGD 5EQ0A 2UXDL 2OTLA 1SYCA 4DAPA 1VQ8A 4JYAL 1E0BA 1QB5D 1UUPA 4N8FA 4DR4L 1JICA 4KKUA 1J6QA 4R4OA 1X3EA 5KYIA 1A6XA 1HA5A 1ET6A 1I4HA 3HOYG 3S2DH 3Q6SA 1T5EA 2E5LL 5LMNW 4BBRH 3F2UA 2ZTCA 1DONA 5GQOA 1A3VA 3E9HA 1QZHA 4LUZA 2GN5A 1B1ZA 5E1FA 3BU2A 1BXTA 2ID0A 3MEHA 1QILA 3HGBA 1GD7A 3TS2A 5IP7H 5EPJA 3MTSA 4PG3A 3RNUA 4I7ZC 2M2LA 4OIJA 1QJOA 2K5HA 4DAYA 2B2UA 2KENA 3FHWA 4ZAIA 1G291 3AFQA 4OEMB 2L5TA 1AEXA 5C4HA 1CKOA 4GLAC 1QNUA 4DV3L 3VYTA 2Q2UA 3OWEB 5ELCA 2QDLA 4A3DB 4O2DA 1NR4A 4HJ8A 2F0NA 2VQFQ 4B08A 1OXVA 2RA4A 5I9OA 4CKBA 4ZLTF 5G3LD 1C8CA 1YVCA 2AMCB 1HQRD 3B6YA 2DJGC 2NUCA 1YJ9A 4XDXA 4JBKA 1W6KA 4J8QA 3IKJA 3F2BA 3CCUA 1EQRA 5EBCA 3L9AX 2QF7A 4A3LG 2RHSB 2NVQB 5IP9H 1PMRA 1BBUA 3KBGA 2EVBA 4KJOA 1C7YA 1IBML 1A63A 3NBHA 1HNWL 4DV7Q 4BY7H 1XPRA 1PFNA 3PUYA 4ZQ3A 2ICEC 1Y69U 1L0XB 2Z1CA 1LT3D 2R93B 3V2TA 2JSOA 3C46A 2A6HC 2NYZD 1CHQD 2E2IH 2HHHL 2FMMA 3E0EA 4CJ2C 2HT1A 1Z47A 3BZDB 3P1HA 1KQSA 4L5RC 4JV5L 2D62A 4HIOA 4DNIA 1N34Q 1JJ2A 1JB3A 4GOPA 3RZOH 1KL9A 2WINB 1KNEA 4DR1Q 1A3TA 3F1ZA 2R3ZA 4CBVA 1X3FA 3HOZG 2VQEQ 2QILA 1TS2A 1LTAD 2F0OA 5JJZA 1S3OA 5IT9E 1YITA 5EPKA 3KUPA 4G4KA 5M5YB 3CQZB 4HJAA 1KDBA 1GUGA 3OYYA 1STNA 2A19A 1FJGQ 1BVSA 4DV2L 2JE6I 4K2LA 4CGYB 4IFDG 3V05A 3T1HQ 4JK1C 3OTOL 3CCMA 1WJJA 2CCZA 5LL6S 3M4PA 5IT9c 4HJ7A 2CKZB 4O42A 3SR1A 1SYGA 4LF4Q 4X62L 4QUFA 1U4LA 4NP5A 1R9TB 3KK7A 1STGA 3VA5A 4A3CH 2F3WA 2YU9B 4NPSA 3EVQA 2A69C 1K3RA 4JBJA 4MNOA 3TRZA 2L55A 4XQQA 1H9SB 1JQYD 1CZWA 1SAPA 4BY1G 5DEHA 1KHIA 3SDZA 4YCWA 4A3JG 1SNDA 3JAMi 2GVAA 4OO1G 1XNRQ 2XRSD 2M9VA 1QVFA 4MHEA 1B44D 2XNAC 5JEAG 1SNPA 4A3BG 4V190 3NBHB 2E2JB 5LHY1 4NW2A 2FMCA 1BBXC 1YHQA 2LY7A 2PQEA 3KLRA 3ULPA 2VUMH 3HOYB 3I4OA 4JI6L 1I4XA 1CT1D 1AN8A 1RDPD 3TMEA 4DK1A 5KGUA 1CA6A 2B2UC 3BYYB 3J81j 4HMJA 2EIFA 4X66Q 5C5MA 4B3RL 5C6AA 4NMZA 5C44H 5GAHC 2CVRA 3I8ZA 1N32L 2EDGA 5IGEA 1BQQT 5JJLA 5CV4A 2DGYA 1HXYD 3PUVA 4GOPB 4JI2L 4FF1A 4WORA 4DV4L 1KRSA 1JWSD 1SNCA 2K75A 4LFCQ 1UWVA 3H15A 3CF5A 4GZYC 4ZRZA 3J81E 5JVH3 2SOBA 2RHQB 1SXTA 5JJKA 4KJNA 1SN8A 5LMNL 4HJ5A 2HIXA 2K03A 3HOVH 2D0PA 3S1MH 4HIKA 1JJGA 4JI8L 2KBNA 1B70B 1SE3A 2HD3A 4RFBA 1MGSA 3K80C 3CCLA 2DNCA 4RKBA 1LTID 2F3VA 1SFOB 3NTKA 1O7IA 3R93A 2KCCA 4FO2A 2F0VA 1ZYRC 3G6EA 4Y7NH 2WAQG 3GTLB 1STHA 1F9RA 2NZ1D 2EYPA 2ASBA 2BA0A 3MXPA 2A6HD 1PRTF 3G7LA 4FF4A 4IUVA 1Y8PB 3HP3A 3N6RA 2KQ3A 4IPGA 4LF7Q 3NWTA 2OCEA 1PZID 4RAUC 1QG7A 4R8IA 2ZJRA 3T1YL 4KY5A 2CHBD 2UUAQ 4YCUA 2WFWA 5GADC 1ILQA 1Y1VG 4F7XA 1L1OC 3J80c 1EY8A 1Q8KA 2N49A 1DOKA 4OONA 4BA2I 3HOZB 3K5LA 4JI4L 3CXCA 2A1AA 2JA6G 3DXJC 1YJNA 2JA7B 2NTTA 4POFA 2IHFA 1L0WA 2IHEA 4HSVA 4DR5L 3K5OA 4C3JH 2EYHA 4RWSC 4YHHL 4X3SA 4BXXH 5M3FG 5AFWA 3PIOA 3R2IA 2NB0A 3VYSA 3CMEA 2Q8RE 5CV5A 2EE1A 4O1NA 4P75A 3TSSA 4G57A 1HPCA 3ULJA 1OO9B 3RZDB 4NXMQ 3N52A 3MAQA 4H7BA 3SK8A 1K8MA 3CMAA 1TT2A 4UP8A 3M85A 3DEPA 1SEBD 1SR3A 2BE5C 4DR7L 1H9JA 1KNAA 2K1BA 3TEHB 4LF9L 4MTNA 2A69D 1U4PA 1SBBB 4B3MQ 4MIUA 4UDUC 3J7AF 5CC4A 2K5WA 4JI7Q 1CSQA 3G4SA 3BVZA 1B9MA 1F9PA 4FXKC 3LX0A 1RIPA 4NDXA 1PZJD 3GTMH 4A3IH 1Z7TA 3HKZE 1X9NA 2IY5B 2WACA 2JA5H 1S5ED 4L5SA 4C2MB 1SRUA 2EY6A 1ASZA 4GLVB 4BY1B 4A3EG 3MWYW 1WTVA 1ENCA 4IUPA 2GA4B 3FP9A 4G7HC 1H9RA 3E3XA 2R92H 2VXWA 4X65L 4HTHA 1E2ZA 2K14A 5BR8Q 3Q8DA 4A3BB 3MA2B 3QIAA 2MO0A 2NN6I 2RDFA 4QIWE 4FXDA 2UXBL 2L12A 3ITPA 4I65A 3RLNA 2R61A 1XTCD 5K36H 4BWGB 3M3YH 2EJMA 5C3XA 1KABA 1N33Q 2KHSA 1F2ZA 2UXCL 4HEDA 5COYA 1S5FD 1VQ9A 5T1IA 5FJ8H 1XYIA 2UU9L 4K8JA 1BF4A 3A8KE 4K6DA 2B8GA 1IBLL 3P20A 1V43A 2CW0C 4IUQA 5C4XG 3C1FA 1NMFA 5EAYA 2IX0A 3GV6A 2KECA 3K0YA 3CCQA 1Q3LA 4GKJQ 4LUOA 1HHVA 2BH2A 4QUCA 1DOMA 4X3TA 5JVG3 3CPWA 4GNXB 4KKTA 4XYQA 2KVMA 4LFAL 1EWIA 1SNMA 4UAIA 2G9HD 4HSPA 4A3MH 1HH2P 3BJUA 2B2VA 2NN6H 1EOVA 3RMHA 1TS3A 2VB2X 3K7AH 4TRDA 1HQMC 1ZYRD 3AQQA 4ILWA 1IXRA 1TS4A 5LMUL 2B63G 1NE3A 3PIP3 1D5MC 4DR6L 2C5CA 2CWPA 4YY3Q 1MSGA 3PO3H 1UAPA 5CBAE 2BDOA 5C5LA 2LS01 5KRUA 4HIDA 3GV3A 5FK9C 4K0KQ 4JOIA 1K3BC 4DV1Q 1Y1VB 2JA9A 4CDEC 1WTWA 3GTQB 4DUZQ 1E22A 1PZKD 2YV5A 4IZ8A 5IYBH 4OX9L 4DK0A 3C2PA 1L0YB 4XYOA 1VQAA 1D1IA 4FYDA 1EYGA 1LYLA 2JA6B 3LNNA 1PDQA 2F0MA 4GS3A 1EQQA 3HOUH 2BDNA 5A2QL 1CQVA 5I2YA 5M3FB 1MSHA 1I6VC 3AYHB 1CKNB 5FLXE 3ULLA 2Z9HA 2PW7A 1STYA 3S15H 1K0SA 3GDEA 2MNAA 2HQEA 5CV7A 3ER0A 3NK9A 1I3QB 1G51A 3X3MA 1HRJA 3DWAA 4ZUJA 1WTHA 4P2CB 2BE5D 4AQYQ 1EY6A 1LTLA 1VQJA 1PFMA 1DOLA 1A0IA 2CH4A 2A8VA 4OIKA 3C1EA 4IQZA 3MVVA 5FLXc 1JOQA 4NB3A 4BBRB 5M9OA 5M5WB 1GM5A 2JEBI 2NVYH 3DM1A 1X56A 1X6OA 2SEBD 2SNSA 4UY8C 3I4MG 1FGBD 4C3IH 2F0HA 3CHBD 2IT1A 4LF8Q 4A3EB 1FGUA 3BDLA 4DV7L 2WKCA 5J39A 1EL0A 2FXQA 1GXDC 2I5HA 3K6OA 2CQOA 3FKIG 3S1RH 2UUCL 4BBSH 5J1ZA 2R7ZH 1W2BA 1JOKA 2ZTDA 4AYBE 1DD2A 1XTDA 5ELDA 1TS5A 2B8FA 1A8VA 4OELB 2MP1A 4FNFA 1TWCB 2N55A 1MJCA 4ME3A 1Q86C 3F2DA 1PTOC 3J80i 3I72A 4C3HH 1N34L 2CH4W 2K50A 1B53A 4CJ1B 4A93G 3EQLC 4YWKA 1F9QA 2NVXH 4C1NI 2JA8G 4KN4C 1ESRA 1GKHA 4OGQC 2RSNA 2Z6BA 4RCNA 2CW0D 5GAGC 1AZQA 1A2TA 1RF2D 3NQTA 3H3VI 2F0WA 3RN2A 4P71A 4JCVE 1MJEA 3D4WA 1DM0B 1VF7A 2K01A 5IYDH 3EIVA 1FJGL 4NXNQ 4OL7A 1LTSD 3EROA 3T1HL 2B2VC 3ZJYC 2KCTA 1CSPA 3PO2H 1I6HH 4P74A 5BN5A 4PZ6A 1A62A 4N9PA 2C35B 5C0XG 4LFBQ 1TQOA 1FD7D 1ILPA 1ENFA 3KYHC 2HDLA 1I4GA 2WB1E 2FJ2A 3QWNA 3SEBA 3S14B 4LF4L 2F0QA 3CP0A 3VR5A 4LK1C 4IOCA 3EJIA 1LABA 1AW7A 3MFYA 3UDGA 4GLXA 4DXFA 1CZGA 2B63B 3ERQA 4L8JA 2J0TD 3I4NG 3E5SA 3UE1A 1YEZA 2CFMA 3SK6A 4JOIC 5I2XA 3G48A 3GTKH 4UP9A 3HS0C 1OXTA 1Y8NB 3PMFA 3CKIB 1SYBA 2IX1A 3GTJH 1SYEA 2PYKA 5IY0A 2ZM6Q 1K8GA 1HNZL 3I91A 4DR3Q 2I5LX 4H44C 1Y1WH 1Q82C 4B3TQ 1PHJA 2F0DA 5CR3A 1CUKA 3KLSX 1Q46A 1PFSA 1STAA 4PV1C 4CHTB 4BA1I 5EJWA 1HZCA 2XWBB 1PA6A 3A8JE 3GTOH 5IE8A 4OHJA 2VL6A 4JW0A 1E7ZA 3QOLA 3TP6A 1N9WA 4A3FG 5I9PA 2MJ8A 2XIWA 1HR0Q 4A75A 4X3KA 5IODA 3D8GA 4LF6L 1G2SA 3GTGH 4RGOS 1NJIC 4OWTB 1LTBD 2LXJA 2K5VA 2OT2A 5ELOA 3U9OA 5IGDA 2ZJQA 5EGTA 4L5TA 1XNQQ 1IYJB 1TWAB 3S16B 2ICIA 2IW3A 2MO1A 4A3KH 3RUZA 2H1EA 2JEAI 5IGFA 2K05A 3HOWG 5EKIA 1IKLA 1ML0D 3I4MB 1PH2A 1S72A 2RDHA 2QEJC 4F87A 2ZJPA 2L1BA 1VCIA 4JI1L 1K73C 3SE0A 2E8GA 2LFNA 3CPFA 3FKIB 4DR2Q 3CCEA 1E24A 1VQBA 5FO8B 1PH8A 1WCMG 5FOBB 1SNQA 3S2HB 4LF7L 3HKZG 3STBC 1PTOD 2PW5A 2KHIA 1GJXA 2UUAL 1JB7A 1ICWA 2A73B 2JA7G 1L1OA 2AKWB 1TWGB 1UEAB 4EX5A 3TP7A 3S1NH 2QEXA 3J7A5 4B3SQ 4A93B 3W1BA 4ZKCB 1KLGD 1Q8IA 2JA8B 5T1GA 2EYFA 2F0SA 4K6LA 1PH9A 3BVMA 4KKSA 4JI5Q 3A7LA 2KUMA 2FINB 1GUOA 1LT4D 3RN5A 3M4OB 1XMQQ 1DXMA 1L2FA 4DAYB 4IOAA 5KYLA 5FLMG 1HFNA 2ENBA 4V0BA 2QA4A 3QOJA 1UE6A 3LWEA 2XN9C 4F8MA 1ZEQX 2E2HB 4RH6A 2L0CA 3VYRA 2WIIB 4NXML 5F2DA 1TKWB 1U5KA 1JJCB 1RTOA 2K52A 1JR0D 3PV0A 4IURA 4ULLA 5KNCA 1HZAA 1P16A 4C56C 4IO9A 2JXMB 1HTLD 2X6GA 1LO5D 2XSCA 1U4RA 2F0IA 3W3AA 4A3DH 3J7YW 3OWFA 2LSSA 4QY7A 1M4VA 2F0KA 3HOXG 3I4NB 2L15A 3K7UC 2NVTB 4U68A 1VQNA 2F3IA 2XRQD 2I0QA 2PMZB 5HGTA 4AH6A 3R8BA 1X3PA 3I90A 4Z9CB 1MKHA 2E74C 2NVQH 5BR8L 2YTVA 5H1SE 3TBIB 2WKDA 4OXPA 1B2TA 2Q2HA 1IKMA 5C3WA 2EXZA 2PO4A 1VQDA 1PH5A 3G71A 2B2TA 1EQTA 4A76A 2B39A 3SHLA 4R1JA 2J7ZA 3QR8A 4QQBX 1IBKQ 5ELEA 1EZ8A 3GO5A 4X64L 5IYCH 2EY5A 1RODA 2R93H 1SMXA 5IT9L 4KTAA 1VDZA 3K81C 2PZTA 4A3FB 3CCVA 3S9WA 1NUCA 1L1OB 2KCMA 4L6TB 5M3MG 4R4IA 1Z6HA 3H0GG 3TZDA 2RF4A 4DA2A 1Y8OB 2Y0SE 1LM0A 1IL8A 1BR9A 4H0LC 4GKKQ 1EIGA 1S5DD 1WFQA 4TSSA 1AFPA 2J4XA 4FXGC 4IN3A 1XMOQ 1K83B 5L37A 1RTNA 1EUJA 1NBWA 3PGZA 3GTPH 2KEEA 3J81c 4ALPA 1WVLA 3I56A 1SE4A 1IBMQ 3FMCA 3GP7A 5M5YH 3NENA 3CQZH 4IFDJ 1GUNA 4Q5VA 2WP8J 3WOEA 4DV6L 3K5NA 5JPNC 1EY7A 2K32A 3HOWB 4PZ7A 1UE5A 1VS0A 3NSWA 5C3EG 1J8IA 1VQPA 2Q2IA 3MHBA 1MBYA 5ELBA 4N8X1 4YY3L 3UDFA 3S17B 4R8NA 1Q12A 1WCMB 3STBD 1JWUD 1R9TH 1HR0W 3HKZB 1PYWD 2YU9H 4K0KL 1WOCA 4K5WA 1OTCA 2D2CC 4DUZL 3D31A 2VY3A 3EA6A 2DNEA 4G7OC 4RGTA 4AYBG 4QIWB 5JEAJ 3FPPA 1E1OA 3DHQA 3CRKC 4N9TA 2R6GA 3NXWA 4CKCA 2EQSA 1P8LA 4DV2Q 4ODGA 1PRTC 2E2JH 4A3GG 1QUQA 1T5XD 3QG1A 4KHPQ 3HOYH 4XTCS 3UI2A 3VDYA 3J81L 4IPDA 1I50B 5CORA 3EN2A 3TP8A 1VMPA 2B3GA 2E75C 5CMDA 3R3OA 3S24A 5BN3A 1O7YA 3HRZC 1MIUA 4JG2A 4C1NK 2YTYA 4BBRG 4ZYSA 4AQYL 2OQ0A 1RCVD 4PMCA 5M5XB 3MXNA 3OSOA 2P5ZX 3D6CA 5IP7G 1VQFA 5ISRA 2MFIA 1GUSA 3J80L 2N3SA 5E4XA 4UP7A 1UE7A 1KDCA 1BO0A 3Q23A 3HOXB 2PNHA 3PUZA 3AMUA 2WB1G 1WTXA 4LF8L 3HKSA 3UDIA 4QMGA 1PXUA 1GUWA 4B9WA 3I70A 4R9WA 4MTKA 4JI0Q 4TQUS 1KTKA 3OPOA 4A3LH 4KHZA 2B2TC 1HUMA 2K33A 2GVBA 4H13C 1IYVA 5DAUA 2OXPA 4RG1A 3OOCA 1W3SA 4B3RQ 3DMUA 3NUCA 1IL2A 4IFDI 1SFOH 3KF8A 5IP9G 1QCBD 1N32Q 2MUYA 1A2UA 2XWJB 1CM9A 2F4IA 1EEID 3NE5B 3J7ZC 1QOHA 4BY7G 5CV6A 4DV4Q 3KF6A 3FEWX 3D6WA 1TWFH 2F0FA 2F0GA 1QVGA 5HGQA 5M3MB 2EY1A 3H0GB 1F9SA 4J6HA 2CWAA 3V96A 2HQLA 3S1QB 5C4JB 3HOZH 4ID6A 4OO1I 2O5IC 1CFMA 3C3LA 2OQKA 4DN4M 2E2DC 3EFXD 3IL8A 2NBFA 2EOTA 3U4VA 1AP0A 4XQNA 1BNZA 1IZ6A 4C3HB 3PUXA 4EVOA 4FF2A 3U4ZA 4IFDH 5C3EB 4FVMA 4PNYA 1XX8A 3RZDH 1G6ZA 2H5XA 1WD0A 5G3LF 1WTRA 1EIYB 2MHVA 5TSSA 2KEDA 4LF5Q 4RGNA 1CTMA 3T1YQ 3K57A 4DXGA 1S4ZA 3ERSX 3PUWA 3E9IA 4DAVA 4HCEA 3DWPA 1JCKB 1JORA 1RKNA 2D0OA 4J15A 3PSIA 1GOZA 2ZM6L 3R2TA 1JT8A 1V1QA 1PH7A 1O78A 1UNSA 2ZTEA 3A74A 4A3CG 4B3TL 1HA6A 2DY8A 1FNWA 5AJ3Q 2PCFB 4JBMA 2PI2E 4YWMA 3OHXC 4AYBB 4C2MH 4X3UA 4XT1B 4BY1H 4A3JH 1FNVA 3AFPA 2X69A 4OO1H 1B8AA 3H91A 3IFTA 1PRTD 5JEAH 2VQFL 1EFID 2AHOB 1PTOB 3NTHA 5EKLA 4A3BH 4DFAA 1H9MA 3KF8B 5HY6A 4RMFA 5KNDA 1N36Q 4A3GB 2VB3X 4KMUC 3F2CA 1AE2A 1Q81C 1C4QA 4KLKA 4HR7B 1EEFD 5K5PA 3K59A 1WD1A 3BS1A 3GD7A 4X6AH 4DGZA 3CRLC 3KJPA 2VUMG 1O80A 3S2DB 3JAME 1JE4A 4K14A 2WAQE 4AIMA 2F4VQ 1PTOF 1G8ZD 4RA8A 3M4YA 2BA1A 2F0TA 1V1PA 2BH8A 3J81i 1VQOA 1ONLA 1XNQL 1C0AA 1I94Q 1Q1BA 3RD4A 1VMCA 5C44G 1AE3A 1RL2A 4A4IA 4G7ZC 3RLOA 4HJ9A 1DJRD 3MZ5A 4CDDC 2VNUD 4LJZC 2EY2A 4OWWB 1CK1A 4GN5A 4QL5A 2UUBQ 1R4QB 3BG3A 3T51B 4DNTB 2WB1B 3ND8A 4UHVA 1U4MA 4M1UB 4DR2L 3VR6A 1IHZA 1EFWA 2RKSA 2ES2A 3HOVG 1A3UA 4DR1L 1C9OA 4RHRA 1TY0A 2ATWA 3P7JA 2UXCQ 4DUYQ 1JMCA 2Q8TA 3M9BA 2VQEL 2AQ2B 1B9NA 1R4PB 1SYFA 1TY2A 2AWNA 3H6MA 2F0UA 3VR3A 2F0EA 4B3SL 3QB3A 3Q22A 5E4WC 3AU7A 3LGJA 3NTIA 1DZ1A 4BY7B 3TQYA 1E1TA 4E6IA 4KV6A 3SXHA 1PVOA 4JI5L 4DV0Q 1FR3A 5FLXL 1XMQL 2K5QA 2O2LD 2N88A 3I73A 1SROA 3MXUA 1PH6A 3UDXA 1Y1VH 2E2IB 2LMCB 4ZKBB 3GTQH 4RGMA 1WTQA 2E76C 2HCCA 2I46A 4JC0A 4KD4A 5KEEA 4XIGS 3PF5A 1BCPC 3BZKA 4JI3Q 3PF4A 2K28A 4LFAQ 2KOLA 1HCZA 2JA6H 2AUKA 2OF1A 4K8IA 5CV8A 2JN4A 3RZOB 3U58A 2Y0SG 1TVXA 2HUGA 1EY9A 4DK6C 5LMUQ 1U0LA 3K58A 1J5EQ 3CD6A 4DR6Q 4LMQD 4C3JG 2NZOA 1XNRL 4S3SA 4BXXG 5DNFA 1SNOA 1MHWC 3VYUA 3KDFA 3PIPA 2EZVA 2V1CC 3H3VH 4OWXB 2K4KA 1SYDA 1EYAA 3WOFA 4CDCC 1EU4A 1NNXA 4L63B 1NY4A 1VQ6A 2DJFC 2F1MA 4WJ4A 2JJQA 3EBEA 4OX9Q 1EWCA 4JBWA 1STEA 1RHPA 4X66L 3M7NA 2F0PA 4CDFC 3IFDA 4IUUA 5D3DA 5M5WH 5IGGA 4A3EH 4EQNA 1Q7YC 4TVAB 1IBKL 2R7DA 3U50C 4A3IG 2JA5G 4LFCL 1NR2A 1YNNC 2B2WC 3K5MA 5GROA 2R92G 2X6LA 2K5DA 3M4QA 1TWCH 1EIHA 4LWCA 1F2YA 1QVCA 3E6ZX 2AWOA 1I4PA 4XT3B 4POGA 2IJ0A 2A6EC 3BZCA 4GKKL 2QDBA 2VUMB 1K8OA 5K36G 1E2VA 1TWHH 1PH4A 1H9SA 3L2PA 2XTIA 1XMOL 2G5DA 3NELA 3T4AC 1B3AA 1KDAA 4WJWA 1SSOA 2EPBA 3L7ZC 2G9DA 5FJ8G 5C44B 1WTOA 5C4XH 2R7FA 1OXSC 1D1KA 3O13A 3URYA 1KC8C 3KBXA 4DPGA 3HZXA 2UUCQ 5C0XJ 1YHBA 2ZXRA 3KLWA 2DUDA 3NWSA 5IGCA 3NHHA 3VA7A 1M90C 4QF4A 3HOVB 1B7YB 3S14H 2RSOA 3S1MB 1BBWA 5JPMC 4GN3B 4DV5Q 2Z6KA 1VQCA 4JPBW 3KDFB 1JE5A 3MXGA 4A3MG 3J7AV 3L3OC 2Z0SA 4IJLA 2NN6G 3PIO3 2L9HA 1EIFA 2B63H 2AQ1B 1H95A 3GTPB 3D3RA 2RQXA 1PLFA 3W1GA 3BDOA 1VQMA 4KI0A 3K8AA 4Y7NB 5EBDA 3SVMA 2EXDA 2M00A 1LTRD 1VQLA 3PO3G 1KRTA 5FO7B 3AEVA 3I7FA 2QW7A 3DM3A 3I2ZA 5IIFA 1BCPD 5I4DA 1AH9A 1YBYA 4KHPL 1TXYA 4KY7A 1KAAA 1YI2A 4QCLA 3W2DA 3SGIA 5IWAQ 3P75A 3TREA 4B3ML 2IPKD 1FVIA 5IYBG 4JI7L 1VF5C 2Y0SB 3HFZB 1HNXQ 2F52A 2UXDQ 4ZUIA 4DU9A 1K28A 1LV9A 1NMGA 3UE0A 1EOTA 4JYAQ 5EKKA 4UPAA 4DF7A 1ZXTA 3HOUG 1X32A 4DR4Q 2Z4HA 1KLUD 1NAPA 2NWGA 4M8AA 2HCIA 2JK8A 1D5XC 4C3JB 5FKAC 5E3FA 1B4OA 1PV4A 1M8AA 4J1MA 4GN4B 2E5LQ 1GHJA 4PMWA 5LL6X 4LW1A 3L0OA 2MGSA 2RCFA 2Q2TA 2PZWA 1BUVT 1I5FA 1EZ6A 1ET9A 1TWAH 3OW2A 1X54A 1HNZQ 3S16H 1ESFA 4JI0L 4EQ5A 1N33L 4XQJA 3D4DA 1NTGA 2F03A 2RVLA 3DEOA 5CYUA 5I6WA 3I4MH 4DV3Q 2DY7A 3TZUA 4B9XA 5CV9A 5D3IB 3HEJA 1S5BD 4IALA 1F77A 3NEMA 3I55A 3FVQA 4ZK9B 4WFN3 5NUCA 1II3A 2LKVA 3FKIH 2HIVA 4Y52H 1YNND 3GTMB 5C0XI 4A3IB 4C3IG 2JA5B 2KHJA 1V9PA 4GKJL 3S2HH 2MPMA 1KIXA 4LF6Q 4EQPA 2R92B 4K2KA 4BBSG 1QWYA 2A6ED 1SDFA 1NSNS 4Q0FA 3Q24A 2R7ZG 2XGTA 3GQBA 1HFGA 1IYUA 2SDFA 2ALYB 1TWGH 1HZBA 1OXUA 4QGUA 4JVZA 3NBIA 4PQXA 1PH3A 4A93H 1STBA 2JA8H 3M3YB 1HNWQ 2RCNA 1WI5A 1ZKOA 4XXEA 1PRTB 4KK7A 4C3HG 2RDGA 3M4OH 1Y14B 2A5HA 2PMZE 5KIXA 1GHKA 1V8QA 2HHHQ 2C9OA 5JAVA 1U9RA 4JI1Q 1W6JA 1NCVA 3J80E 3U9SA 2OTJA 1ASYA 3ND9A 4JV5Q 2E2HH 1K8AC 4HMIA 1FYCA 3A0JA 3CC4A 2XVSA 2Z6KC 5IYDG 4GOPC 1PYBA 4LF5L 2LXKA 1TWFB 4DV1L 3BDCA 5C0XH 3NQIA 1YJWA 3PO2G 3OMGA 3OMCA 4KD3A 3NPPA 4EQOA 2FFKB 3KOJA 3VR2A 3T16A 4A3MB 2V4DA 1D8LA 4RCOA 4O0AA 2B2YA 5JOBA 1GO3E 1GVPA 2N8NA 2PI2A 3K7AB 5D65A 3I4NH 1F2MA 1EY5A 1XWEA 5AJ3L 2NVTH 3I4LA 4R4TA 3LWUA 2PPBC 2CQAA 2EYOA 5KNBA 3OTOQ 1G2TA 1RD9D 1QNKA 4FF3A 2HDMA 2QGQA 4ZCKA 2JYOA 1CKMA 4GNXA 3PO3B 2DN8A 2A74C 4X62Q 1CI3M 1N36L 5CGKA 4TKOB 1I4QA 1YZ6A 2KJXA 4FP5D 1X65A 4R4CA 4APVA 4PMBA 2O4XA 4MZ9A 1Y1WG 3CCSA 4ABNA 1EYCA 5DM73 3A55A 2VS1A 4A3FH 1PYSB 3IAYA 2F4VL 4CJ0B 1MD2D 2BOSA 1I94L 3HOUB 3OW7A 3X3NA 3QJYA 1CQFA 1HTPA 2IX3A 3A5ZB 1A15A 3OIPA 1J9OA 1JOOA 1EY4A 5J22A 1KAWA 1YHAA 3D4RA 4A3JB 1SMYC 4JI6Q 1IW7C 4HIMA 2L11A 1BKBA 4WRDA 1G6PA 1PFBA 2UUBL 1K83H
chains in the Genus database with same CATH topology
3BYTB 3S15B 1GUTA 1Q1EA 1OXXK 1ENAA 3FPUB 5HURA 1EQVA 5EPLA 1FNUA 3FRPB 3TP5A 2O5JC 3A54A 4KN7C 1CA5A 5A2QE 1DYQA 3WDNA 3SK4A 4RHSA 1C48A 2K04A 2NVYB 5C4ZA 3A56A 1RJTA 4C3IB 2ZT9C 1H9KA 2YYZA 1WTPA 1D5ZC 3S1RB 3H94A 4BBSB 2R7ZB 1BDOA 4QB4A 4KY6A 2A68C 3ONAB 3T13A 4F88A 5IOCA 1SJHD 2NVXB 2K7VA 4RKLA 1JWMD 1QE6A 1YNJC 5DM63 3A8IE 1LT6D 2WAQB 3MC0B 3Q0AA 5A35A 5D14A 4IUNA 2I07B 2H4OA 5IGBA 2L4NA 2PZUA 1LLRD 2ZXOA 1EU3A 2B2YC 3PO2B 1I6HB 3DWQA 1MI2A 2SNMA 3HG9A 2EYMA 1D6EC 2EYLA 1TIID 2NTSA 5ELFA 2EJGC 4KHVA 2Q8IB 1AZPA 1D2BA 2JP1A 1S5CD 2K6AA 2PNRC 3I3CA 2BCOA 1JC7A 1XXGA 1X3QA 4LAAA 2OEOA 1LT5D 5FO9B 3G6JB 3H09A 3SK5A 1EYDA 3GTKB 2B2WA 3M7GA 2TSSA 4HN7A 3GTJB 3T53B 2EYJA 1F2LA 2AUJD 3MFGA 3QO2A 1B50A 2WV6D 1Y1WB 4HAEA 3OIQA 4BS9A 2AQ3B 2KA7A 3GTOB 1LTTD 3DUZA 4NKLA 2Z8LA 1EWHA 1TR5A 1BCPB 3AB9A 1SMYD 1IW7D 2IL8A 1CHPD 1BOSA 4YIJA 3KLSA 3GTGB 4MN3A 2ZXPA 3CU7A 2F0LA 1BCPF 4ME5A 2KCNA 2D9UA 2FHTA 1TU2B 3TN2A 3TDQA 4DNRB 2EJFC 4K5VA 1SJED 4A3KB 1E2WA 1Q90A 3VR4A 3H3VC 1TWHB 2TMPA 4CKEA 1V1OA 1LACA 2QKIC 1DCZA 1G91A 2Z4IA 5C4XB 4HCSA 1HUNA 4K5XA 2D5DA 2F0JA 3FDTA 4EGVA 1I4RA 3NP8A 2QCPX 1O7ZA 3ZYYX 3E0JA 4IUTA 5CBEE 2A68D 3JAML 1EY0A 3RLFA 2IWHA 5BN4A 4U673 3A7AB 5I6YA 1O7LA 1SE2A 3S1NB 3T56B 1YNJD 2RBMA 1V1PB 1PTOH 3BVGA 1LTGD 5EQ0A 1SYCA 4DAPA 1E0BA 1QB5D 1UUPA 1JICA 4KKUA 1A6XA 5KYIA 1HA5A 1ET6A 1I4HA 3Q6SA 1T5EA 3F2UA 1DONA 1A3VA 1B1ZA 5E1FA 1BXTA 2ID0A 3MEHA 1QILA 3HGBA 5EPJA 3MTSA 4I7ZC 2M2LA 4OIJA 1QJOA 4DAYA 2B2UA 4ZAIA 1G291 2L5TA 1AEXA 5C4HA 1QNUA 3VYTA 3OWEB 5ELCA 4A3DB 1NR4A 2F0NA 4B08A 1OXVA 2RA4A 5I9OA 4CKBA 4ZLTF 5G3LD 1C8CA 1HQRD 2NUCA 4XDXA 1W6KA 4J8QA 3IKJA 5EBCA 3L9AX 2QF7A 2NVQB 1PMRA 3KBGA 2EVBA 4KJOA 3NBHA 1PFNA 3PUYA 4ZQ3A 2ICEC 1Y69U 1L0XB 2Z1CA 1LT3D 2R93B 3V2TA 2JSOA 3C46A 2A6HC 2NYZD 1CHQD 2FMMA 4CJ2C 1Z47A 3BZDB 3P1HA 2D62A 1JB3A 2WINB 1KNEA 1A3TA 2R3ZA 4CBVA 2QILA 1TS2A 1LTAD 2F0OA 5JJZA 5IT9E 5EPKA 3KUPA 4G4KA 5M5YB 3CQZB 1KDBA 1GUGA 1STNA 2JE6I 4K2LA 4CGYB 4IFDG 3V05A 4JK1C 5LL6S 4O42A 3SR1A 1SYGA 4QUFA 1U4LA 4NP5A 1R9TB 3KK7A 1STGA 3VA5A 2F3WA 2YU9B 3EVQA 2A69C 2L55A 4XQQA 1H9SB 1JQYD 1CZWA 1SAPA 5DEHA 3SDZA 1SNDA 4OO1G 2XRSD 2M9VA 4MHEA 1B44D 2XNAC 5JEAG 1SNPA 4V190 2E2JB 5LHY1 4NW2A 2FMCA 1BBXC 2LY7A 2PQEA 3KLRA 3HOYB 1I4XA 1CT1D 1AN8A 1RDPD 3TMEA 4DK1A 5KGUA 1CA6A 2B2UC 3BYYB 4HMJA 5C5MA 5C6AA 4NMZA 2CVRA 3I8ZA 2EDGA 5IGEA 1BQQT 5CV4A 1HXYD 3PUVA 4FF1A 4WORA 1SNCA 1JWSD 4GZYC 4ZRZA 3J81E 5JVH3 2SOBA 1SXTA 4KJNA 2K03A 1SE3A 4RFBA 1MGSA 2DNCA 4RKBA 1LTID 2F3VA 1SFOB 3NTKA 3R93A 2KCCA 4FO2A 2F0VA 1ZYRC 3GTLB 1STHA 1F9RA 2NZ1D 2EYPA 2BA0A 3MXPA 2A6HD 1PRTF 3G7LA 4FF4A 4IUVA 1Y8PB 3HP3A 3N6RA 2KQ3A 3NWTA 1PZID 4RAUC 1QG7A 4R8IA 4KY5A 2CHBD 1ILQA 4F7XA 1EY8A 1DOKA 4BA2I 3HOZB 3K5LA 3DXJC 2JA7B 2NTTA 4HSVA 3K5OA 2EYHA 4RWSC 4X3SA 5AFWA 3R2IA 2NB0A 3VYSA 2Q8RE 5CV5A 2EE1A 4O1NA 3TSSA 4G57A 1HPCA 1OO9B 3RZDB 3N52A 3MAQA 4H7BA 3SK8A 1K8MA 1TT2A 3M85A 3DEPA 1SEBD 2BE5C 1H9JA 1KNAA 2K1BA 2A69D 1U4PA 1SBBB 4MIUA 4UDUC 3J7AF 5CC4A 2K5WA 3BVZA 1B9MA 1F9PA 4FXKC 3LX0A 4NDXA 1PZJD 1Z7TA 2WACA 1S5ED 4C2MB 2EY6A 4BY1B 3MWYW 1WTVA 1ENCA 4IUPA 2GA4B 4G7HC 1H9RA 2VXWA 4HTHA 1E2ZA 4A3BB 3MA2B 3QIAA 2NN6I 2RDFA 4FXDA 2L12A 3ITPA 4I65A 2R61A 1XTCD 5K36H 4BWGB 2EJMA 5C3XA 1KABA 2KHSA 1F2ZA 4HEDA 5COYA 1S5FD 5T1IA 1XYIA 4K8JA 1BF4A 3A8KE 4K6DA 2B8GA 3P20A 1V43A 2CW0C 4IUQA 3C1FA 2IX0A 3GV6A 2KECA 3K0YA 1Q3LA 1HHVA 4QUCA 1DOMA 4X3TA 5JVG3 4KKTA 4XYQA 2KVMA 4UAIA 1SNMA 2G9HD 4HSPA 2B2VA 2NN6H 3RMHA 1TS3A 2VB2X 4TRDA 1HQMC 1ZYRD 4ILWA 1TS4A 3PIP3 1D5MC 2C5CA 1MSGA 1UAPA 5CBAE 2BDOA 5C5LA 2LS01 5KRUA 3GV3A 5FK9C 1Y1VB 1WTWA 3GTQB 1PZKD 4IZ8A 4DK0A 3C2PA 1L0YB 4XYOA 1D1IA 4FYDA 2JA6B 3LNNA 1PDQA 2F0MA 2BDNA 5A2QL 1CQVA 5I2YA 5M3FB 1MSHA 1I6VC 5FLXE 2PW7A 1STYA 2HQEA 5CV7A 3NK9A 1I3QB 3X3MA 1HRJA 3DWAA 4ZUJA 4P2CB 2BE5D 1EY6A 1PFMA 1DOLA 4OIKA 3C1EA 4IQZA 3MVVA 1JOQA 4BBRB 5M9OA 5M5WB 2JEBI 3DM1A 2SEBD 2SNSA 1FGBD 2F0HA 3CHBD 2IT1A 4A3EB 3BDLA 2WKCA 5J39A 1EL0A 1GXDC 3K6OA 5J1ZA 1JOKA 1DD2A 5ELDA 1TS5A 2B8FA 2MP1A 4FNFA 1TWCB 2N55A 1PTOC 3I72A 1B53A 4CJ1B 3EQLC 1F9QA 4C1NI 4KN4C 1ESRA 4OGQC 2RSNA 4RCNA 2CW0D 1AZQA 1A2TA 1RF2D 3NQTA 2F0WA 3D4WA 1DM0B 1VF7A 2K01A 4OL7A 1LTSD 3EROA 2B2VC 5BN5A 4N9PA 5C0XG 1TQOA 1FD7D 1ILPA 1ENFA 2HDLA 1I4GA 2FJ2A 3QWNA 3SEBA 3S14B 2F0QA 3VR5A 4LK1C 3EJIA 1LABA 1AW7A 3MFYA 4DXFA 1CZGA 2B63B 3ERQA 4L8JA 2J0TD 3E5SA 3SK6A 5I2XA 3HS0C 1OXTA 1Y8NB 3PMFA 3CKIB 1SYBA 2IX1A 1SYEA 2PYKA 3I91A 4H44C 2F0DA 5CR3A 3KLSX 4PV1C 1STAA 4CHTB 4BA1I 5EJWA 2XWBB 3A8JE 4OHJA 3QOLA 3TP6A 5I9PA 2MJ8A 2XIWA 4X3KA 5IODA 3D8GA 1G2SA 4RGOS 1LTBD 2OT2A 3U9OA 5IGDA 5EGTA 1TWAB 3S16B 2ICIA 2IW3A 3RUZA 2H1EA 2JEAI 5IGFA 2K05A 5EKIA 1IKLA 1ML0D 3I4MB 2RDHA 2QEJC 4F87A 2L1BA 1VCIA 3SE0A 2LFNA 3FKIB 5FO8B 5FOBB 1SNQA 3S2HB 1PTOD 2PW5A 1GJXA 1ICWA 2A73B 1TWGB 1UEAB 3TP7A 4A93B 4ZKCB 1KLGD 1Q8IA 2JA8B 5T1GA 2EYFA 2F0SA 4K6LA 3BVMA 4KKSA 3A7LA 2KUMA 2FINB 1GUOA 1LT4D 3M4OB 1DXMA 5KYLA 1HFNA 2ENBA 4V0BA 3QOJA 3LWEA 2XN9C 4F8MA 1ZEQX 2E2HB 4RH6A 2L0CA 3VYRA 2WIIB 5F2DA 1TKWB 1RTOA 1JR0D 3PV0A 4IURA 4ULLA 5KNCA 4C56C 2JXMB 1HTLD 2X6GA 1LO5D 2XSCA 1U4RA 2F0IA 3W3AA 3J7YW 3OWFA 1M4VA 2F0KA 3I4NB 2NVTB 4U68A 2XRQD 2PMZB 5HGTA 3R8BA 1X3PA 3I90A 4Z9CB 2E74C 3TBIB 2WKDA 1B2TA 1IKMA 5C3WA 2EXZA 2PO4A 2B2TA 1EQTA 2B39A 3SHLA 2J7ZA 5ELEA 1EZ8A 3GO5A 2EY5A 1RODA 5IT9L 4KTAA 1VDZA 2PZTA 4A3FB 3S9WA 1NUCA 4L6TB 1Z6HA 3TZDA 4DA2A 1Y8OB 1IL8A 1BR9A 4H0LC 1EIGA 1S5DD 1AFPA 4TSSA 2J4XA 4FXGC 4IN3A 1K83B 1RTNA 2KEEA 1WVLA 1SE4A 3FMCA 3GP7A 4IFDJ 1GUNA 4Q5VA 2WP8J 3WOEA 3K5NA 5JPNC 1EY7A 2K32A 3HOWB 3NSWA 1J8IA 3MHBA 1MBYA 5ELBA 3S17B 4R8NA 1Q12A 1WCMB 1JWUD 3HKZB 1PYWD 4K5WA 2D2CC 3D31A 4G7OC 3EA6A 2DNEA 4RGTA 4QIWB 5JEAJ 3FPPA 3DHQA 3CRKC 4N9TA 2R6GA 3NXWA 4CKCA 4ODGA 1PRTC 1T5XD 3QG1A 4XTCS 3UI2A 3J81L 1I50B 5CORA 3TP8A 1VMPA 2E75C 5CMDA 3R3OA 5BN3A 1O7YA 3HRZC 4C1NK 4ZYSA 1RCVD 4PMCA 5M5XB 3MXNA 3OSOA 3D6CA 5ISRA 1GUSA 3J80L 5E4XA 1KDCA 1BO0A 3Q23A 3HOXB 3PUZA 3AMUA 1WTXA 4QMGA 1PXUA 1GUWA 4B9WA 3I70A 4R9WA 4TQUS 1KTKA 3OPOA 4KHZA 2B2TC 1HUMA 2K33A 4H13C 1IYVA 5DAUA 2OXPA 3OOCA 3DMUA 3NUCA 4IFDI 3KF8A 1QCBD 2MUYA 1A2UA 2XWJB 1CM9A 2F4IA 1EEID 3NE5B 1QOHA 5CV6A 3FEWX 3D6WA 2F0FA 2F0GA 5M3MB 2EY1A 3H0GB 1F9SA 4J6HA 3V96A 3S1QB 5C4JB 4ID6A 4OO1I 2O5IC 1CFMA 3C3LA 4DN4M 2E2DC 3EFXD 3IL8A 2NBFA 2EOTA 1AP0A 4XQNA 1BNZA 4C3HB 3PUXA 4EVOA 4FF2A 4IFDH 5C3EB 4FVMA 4PNYA 1XX8A 1G6ZA 1WD0A 5G3LF 1WTRA 2MHVA 5TSSA 2KEDA 4RGNA 1CTMA 3K57A 4DXGA 1S4ZA 3PUWA 4DAVA 4HCEA 3DWPA 1JCKB 1JORA 1RKNA 1GOZA 3R2TA 1O78A 1UNSA 1HA6A 2DY8A 1FNWA 2PCFB 3OHXC 4AYBB 4X3UA 4XT1B 1FNVA 2X69A 4OO1H 3H91A 3IFTA 1PRTD 5JEAH 1EFID 3NTHA 1PTOB 5EKLA 4DFAA 1H9MA 5KNDA 4A3GB 2VB3X 4KMUC 1C4QA 4HR7B 1EEFD 5K5PA 3K59A 1WD1A 3BS1A 3GD7A 4DGZA 3CRLC 1O80A 3S2DB 3JAME 1JE4A 4K14A 1PTOF 1G8ZD 4RA8A 3M4YA 2BA1A 2F0TA 1V1PA 1ONLA 3RD4A 1Q1BA 1VMCA 4G7ZC 1DJRD 3MZ5A 2VNUD 4LJZC 2EY2A 1CK1A 1R4QB 3BG3A 3T51B 4DNTB 2WB1B 3ND8A 1U4MA 4M1UB 3VR6A 1IHZA 2RKSA 1A3UA 4RHRA 1TY0A 3P7JA 2Q8TA 2AQ2B 1B9NA 1R4PB 1SYFA 1TY2A 2AWNA 3H6MA 2F0UA 3VR3A 2F0EA 3QB3A 3Q22A 5E4WC 3AU7A 3NTIA 1DZ1A 4BY7B 4E6IA 4KV6A 3SXHA 1FR3A 5FLXL 2K5QA 2O2LD 2N88A 3I73A 3MXUA 2E2IB 2LMCB 4ZKBB 4RGMA 1WTQA 2E76C 2HCCA 2I46A 4KD4A 5KEEA 4XIGS 1BCPC 2K28A 2KOLA 1HCZA 2AUKA 2OF1A 4K8IA 5CV8A 3RZOB 1TVXA 2HUGA 1EY9A 3K58A 4LMQD 4C3JG 4S3SA 5DNFA 1SNOA 3VYUA 2EZVA 1SYDA 1EYAA 3WOFA 1EU4A 4L63B 2F1MA 1EWCA 4JBWA 1STEA 1RHPA 3M7NA 2F0PA 3IFDA 4IUUA 5D3DA 5IGGA 4EQNA 1NR2A 1YNNC 2B2WC 3K5MA 2X6LA 2K5DA 1EIHA 1F2YA 3E6ZX 2AWOA 1I4PA 4XT3B 2IJ0A 2A6EC 2QDBA 2VUMB 1K8OA 5K36G 1E2VA 1H9SA 3T4AC 1B3AA 1KDAA 4WJWA 1SSOA 2EPBA 3L7ZC 2G9DA 1WTOA 5C44B 1OXSC 1D1KA 3O13A 3URYA 3KBXA 3HZXA 5C0XJ 2ZXRA 3NWSA 5IGCA 3NHHA 3VA7A 4QF4A 3HOVB 2RSOA 3S1MB 5JPMC 3MXGA 3J7AV 3L3OC 3PIO3 2NN6G 2L9HA 2AQ1B 3GTPB 3D3RA 2RQXA 1PLFA 3BDOA 4KI0A 4Y7NB 5EBDA 3SVMA 2M00A 1LTRD 5FO7B 5IIFA 1BCPD 5I4DA 4KY7A 1KAAA 4QCLA 3W2DA 3P75A 2IPKD 1VF5C 2Y0SB 4ZUIA 4DU9A 1LV9A 1EOTA 5EKKA 4DF7A 1ZXTA 1X32A 2Z4HA 1KLUD 1NAPA 2NWGA 4M8AA 2HCIA 4C3JB 1D5XC 5FKAC 5E3FA 1B4OA 1M8AA 4J1MA 1GHJA 4PMWA 5LL6X 2MGSA 2PZWA 1BUVT 1EZ6A 1ET9A 1ESFA 4XQJA 3D4DA 2F03A 2RVLA 3DEOA 5CYUA 5I6WA 2DY7A 3TZUA 4B9XA 5CV9A 5D3IB 3HEJA 1S5BD 4IALA 1F77A 3FVQA 4ZK9B 4WFN3 5NUCA 1II3A 2LKVA 1YNND 3GTMB 5C0XI 4A3IB 4C3IG 2JA5B 2MPMA 4EQPA 2R92B 4K2KA 1QWYA 2A6ED 1SDFA 1NSNS 4Q0FA 3Q24A 3GQBA 1HFGA 1IYUA 2SDFA 1OXUA 3NBIA 4PQXA 1STBA 3M3YB 1ZKOA 4XXEA 1PRTB 4KK7A 4C3HG 2RDGA 2A5HA 5KIXA 1GHKA 1V8QA 2C9OA 5JAVA 1U9RA 1W6JA 1NCVA 3J80E 3U9SA 3ND9A 4HMIA 1FYCA 2XVSA 1TWFB 3BDCA 5C0XH 3NQIA 3OMGA 3OMCA 4KD3A 3NPPA 4EQOA 2FFKB 3VR2A 3T16A 4A3MB 2V4DA 4RCOA 2B2YA 5JOBA 3K7AB 5D65A 1F2MA 1EY5A 1XWEA 3I4LA 3LWUA 2PPBC 2CQAA 2EYOA 5KNBA 1G2TA 1RD9D 1QNKA 4FF3A 2HDMA 2JYOA 3PO3B 2DN8A 2A74C 1CI3M 5CGKA 4TKOB 1I4QA 2KJXA 4FP5D 4PMBA 2O4XA 4ABNA 1EYCA 5DM73 3A55A 3IAYA 4CJ0B 1MD2D 2BOSA 3HOUB 3OW7A 3X3NA 3QJYA 1CQFA 1HTPA 2IX3A 1A15A 3OIPA 1J9OA 1JOOA 1EY4A 5J22A 3D4RA 4A3JB 1SMYC 1IW7C 2L11A 4WRDA 1PFBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUT A;  4KN4 C;  1Q1E A;  2D2C C;  3RLF A;  4OGQ C;  2BE5 C;  3PUV A;  2F1M A;  5BN4 A;  1H9J A;  2BDO A;  2PNR C;  4JBW A;  3A7A B;  2A69 D;  3D31 A;  4RCN A;  4G7Z C;  3M7N A;  4G7O C;  2DNE A;  1O7L A;  2D62 A;  1GHK A;  1OXX K;  4LJZ C;  3T56 B;  1V8Q A;  3FPP A;  3BG3 A;  4GZY C;  1B9M A;  3T51 B;  4DNT B;  3U9S A;  2O5I C;  1CFM A;  3CRK C;  3ND8 A;  2R6G A;  3ND9 A;  2JEA I;  1Z7T A;  2O5J C;  2E74 C;  4KN7 C;  4DK0 A;  1VF7 A;  1FYC A;  3T53 B;  3WDN A;  3VR6 A;  2AUJ D;  3QG1 A;  4G7H C;  1H9R A;  4KKU A;  4XTC S;  1A6X A;  1VF5 C;  1YNN C;  3LNN A;  1E2Z A;  5C0X H;  1VCI A;  1GUG A;  3PUX A;  5BN5 A;  2ZT9 C;  3SE0 A;  1H9K A;  2E75 C;  1T5E A;  4IFD H;  3QIA A;  2NN6 I;  5C0X G;  2YYZ A;  5BN3 A;  1B9N A;  2AWO A;  2JE6 I;  2DNC A;  2KA7 A;  4IFD G;  1VDZ A;  1I6V C;  2A6E C;  3H94 A;  5K36 H;  4JK1 C;  1EWH A;  3VR3 A;  3VR2 A;  2KCC A;  2EJM A;  1ZYR C;  3HGB A;  2V4D A;  4LK1 C;  3VR5 A;  1K8O A;  1CTM A;  5K36 G;  3AB9 A;  1E2V A;  1BDO A;  1LAB A;  1H9S A;  1GHJ A;  1IW7 D;  2BA0 A;  4I7Z C;  3PUW A;  3MFY A;  1Z6H A;  2A6H D;  1QJO A;  1GJX A;  1G29 1;  1Y8O B;  1Y8P B;  3I4L A;  3N6R A;  3LWU A;  4L8J A;  2L5T A;  3L7Z C;  2PPB C;  1FR3 A;  4H0L C;  5KNB A;  2BE5 D;  2A68 C;  3A8K E;  1GUS A;  3I73 A;  3MXU A;  1OXS C;  2B8G A;  1O78 A;  2LMC B;  3P20 A;  1V43 A;  2A69 C;  1OXT A;  2CW0 C;  4IQZ A;  1OXV A;  1Y8N B;  2E76 C;  2K7V A;  2PCF B;  3PUZ A;  3A7L A;  4KKS A;  2DN8 A;  1GUO A;  1CI3 M;  4XIG S;  1H9S B;  4TKO B;  1DXM A;  1YNJ C;  1TU2 B;  4OO1 H;  3A8I E;  1HCZ A;  2JEB I;  2AUK A;  3FMC A;  3OPO A;  4TQU S;  4H44 C;  3SDZ A;  4KHZ A;  3TZU A;  4BA2 I;  4DNR B;  3IFT A;  2EJF C;  3IKJ A;  1GUN A;  5A35 A;  4OO1 G;  2QF7 A;  5JEA H;  3DXJ C;  1E2W A;  2K33 A;  1Q90 A;  2IT1 A;  4PV1 C;  2Q8I B;  3VR4 A;  1H9M A;  2K32 A;  4H13 C;  4BA1 I;  5KND A;  3VA7 A;  1IYV A;  4KKT A;  4KMU C;  3OOC A;  1LAC A;  5JEA G;  3A8J E;  1DCZ A;  1PMR A;  2EVB A;  4HR7 B;  1TKW B;  3KLR A;  3GD7 A;  3CRL C;  1DD2 A;  2NN6 H;  2A6E D;  2B8F A;  4DK1 A;  3PV0 A;  3GQB A;  3OW7 A;  3QJY A;  5KNC A;  1IYU A;  1HQM C;  1HTP A;  3PUY A;  3NE5 B;  1HPC A;  2D5D A;  2NN6 G;  1Q12 A;  1Y69 U;  2JXM B;  1OXU A;  3M4Y A;  2BA1 A;  3D4R A;  1SMY C;  1IW7 C;  1ONL A;  2EJG C;  1K8M A;  3BDO A;  3I72 A;  2A6H C;  3W3A A;  4KI0 A;  1Q1B A;  1ZKO A;  2EDG A;  3EQL C;  2A68 D;  3M85 A; 
#chains in the Genus database with same CATH topology
 3BYT B;  3S15 B;  1GUT A;  1Q1E A;  3CCJ A;  3CW2 C;  3WWV A;  1S40 A;  2OWO A;  4P73 A;  1OXX K;  4P72 A;  1ENA A;  3FPU B;  4R4Q A;  5HUR A;  3GTL H;  3A5U A;  1EQV A;  5EPL A;  1FNU A;  3FRP B;  3HOW H;  4JI2 Q;  3K0X A;  3TP5 A;  4X64 Q;  2O5J C;  3A54 A;  4DUY L;  4KN7 C;  4A3K G;  1CKN A;  1CA5 A;  5A2Q E;  1SLJ A;  1DYQ A;  3WDN A;  3CC2 A;  3SK4 A;  4RHS A;  1C48 A;  2K04 A;  2NVY B;  5E7N A;  5C4Z A;  3A56 A;  1RJT A;  1K9M C;  4C3I B;  2ZT9 C;  3W5O A;  5LMN Q;  1H9K A;  3S17 H;  1WCM H;  2YYZ A;  1WTP A;  2YTX A;  1FL0 A;  1D5Z C;  4NXN L;  4DV0 L;  3S1R B;  3H94 A;  4BBS B;  4JI8 Q;  5GAE C;  2R7Z B;  4DKA C;  1QUQ B;  1BDO A;  2JA7 H;  1UEB A;  1VQG A;  4QB4 A;  4LFB L;  4KY6 A;  2JQO A;  2K5N A;  1XPU A;  2A68 C;  3ONA B;  4JI3 L;  3T13 A;  4F88 A;  4DV6 Q;  5IOC A;  1SJH D;  2NVX B;  2K7V A;  2NZH A;  4RKL A;  1JWM D;  1HZ9 A;  1LUZ A;  5FLM H;  1QE6 A;  3MXN B;  4IPH A;  5DLQ E;  1YNJ C;  5DM6 3;  1M1K C;  3A8I E;  1QZG A;  1K0R A;  1LT6 D;  3D0F A;  1D7Q A;  2WAQ B;  3MC0 B;  3Q0A A;  5A35 A;  5D14 A;  1I50 H;  3CAM A;  4IUN A;  1J5E L;  2I07 B;  2H4O A;  3F8T A;  2B29 A;  1PH1 A;  5IGB A;  2L4N A;  2PZU A;  1LLR D;  3IRB A;  2ZXO A;  4DAM A;  1VQ5 A;  4DR3 L;  1EU3 A;  4JI4 Q;  1WYD A;  1YIJ A;  5M5X H;  2B2Y C;  1VQH A;  3PO2 B;  1I6H B;  3DWQ A;  1MI2 A;  1KD1 C;  2I5M X;  2SNM A;  4DR5 Q;  3HG9 A;  4YHH Q;  2EYM A;  4YCV A;  1VQ4 A;  1D6E C;  3PQI A;  2EYL A;  1TII D;  2NTS A;  5ELF A;  1VQE A;  2EJG C;  4GNX C;  4KHV A;  2PQA A;  1T9H A;  2Q8I B;  3HOX H;  1AZP A;  1D2B A;  1VQK A;  2JP1 A;  4A3D G;  1S5C D;  2K6A A;  2PNR C;  3RR5 A;  1UE1 A;  3I3C A;  2BCO A;  1HR0 L;  1JC7 A;  1XXG A;  1X3Q A;  4FDB A;  4LAA A;  3TS0 A;  2OEO A;  1LT5 D;  5FO9 B;  3G6J B;  3H09 A;  3SK5 A;  1EYD A;  3KF6 B;  3GTK B;  2B2W A;  4DR7 Q;  4LF9 Q;  3M7G A;  2TSS A;  1X55 A;  4HN7 A;  1XJV A;  3GTJ B;  3T53 B;  2EYJ A;  1HJP A;  1F2L A;  2AUJ D;  3MFG A;  2VW9 A;  3QO2 A;  1X3G A;  1B50 A;  2WV6 D;  1Y1W B;  4HAE A;  3OIQ A;  4BS9 A;  2AQ3 B;  2VZA A;  3ICE A;  2KA7 A;  3GTO B;  1LTT D;  3DUZ A;  4NKL A;  2Z8L A;  4X65 Q;  1EWH A;  1TR5 A;  4I7A A;  5IYC G;  3JAM c;  2R93 G;  1VQI A;  3PCO B;  5M3M H;  3H0G H;  1BCP B;  3AB9 A;  3MEF A;  1E3P A;  4L5Q A;  1SMY D;  3DLL A;  1IW7 D;  2IL8 A;  2UXB Q;  1CHP D;  1Z9F A;  4IJH A;  1BOS A;  4YIJ A;  3KLS A;  3KJO A;  3S1Q H;  5C4J H;  3GTG B;  3JC6 6;  4H02 A;  3CCR A;  4MN3 A;  2ZXP A;  3CU7 A;  2F0L A;  1BCP F;  4LUV A;  4ME5 A;  2UU9 Q;  2KCN A;  1KXL A;  2D9U A;  2FHT A;  1TU2 B;  3TN2 A;  1IBL Q;  3TDQ A;  4DNR B;  2EJF C;  4YWL A;  4K5V A;  4DV5 L;  1SJE D;  4A3K B;  1E2W A;  1Q90 A;  3VR4 A;  4PZ8 A;  3H3V C;  5C3E H;  1TWH B;  2TMP A;  4CKE A;  1ICF B;  1V1O A;  1LAC A;  2QKI C;  1DCZ A;  1G91 A;  2Z4I A;  3KFU A;  4LNQ A;  4DK3 C;  5C4X B;  4HCS A;  1DGS A;  1HUN A;  1N8R C;  4K5X A;  2D5D A;  2F0J A;  1VQ7 A;  4WJ3 M;  3FDT A;  4EGV A;  1I4R A;  2PQA B;  5JJI A;  1B3Q A;  3NP8 A;  2QCP X;  1O7Z A;  3CC7 A;  3ZYY X;  2MQH A;  3E0J A;  4IUT A;  5ELN A;  5CBE E;  2A68 D;  4IPC A;  3JAM L;  1YNX A;  1EY0 A;  3RLF A;  2IWH A;  5BN4 A;  1XPO A;  5M3F H;  4U67 3;  3A7A B;  5I6Y A;  1O7L A;  5IWA L;  1SE2 A;  4QJF A;  3S1N B;  3T56 B;  1YNJ D;  1I3Q H;  2RBM A;  1V1P B;  1PTO H;  2N78 A;  3BVG A;  1SE8 A;  5J3B A;  1HNX L;  4A3G H;  1LTG D;  5EQ0 A;  2UXD L;  2OTL A;  1SYC A;  4DAP A;  1VQ8 A;  4JYA L;  1E0B A;  1QB5 D;  1UUP A;  4N8F A;  4DR4 L;  1JIC A;  4KKU A;  1J6Q A;  4R4O A;  1X3E A;  5KYI A;  1A6X A;  1HA5 A;  1ET6 A;  1I4H A;  3HOY G;  3S2D H;  3Q6S A;  1T5E A;  2E5L L;  5LMN W;  4BBR H;  3F2U A;  2ZTC A;  1DON A;  5GQO A;  1A3V A;  3E9H A;  1QZH A;  4LUZ A;  2GN5 A;  1B1Z A;  5E1F A;  3BU2 A;  1BXT A;  2ID0 A;  3MEH A;  1QIL A;  3HGB A;  1GD7 A;  3TS2 A;  5IP7 H;  5EPJ A;  3MTS A;  4PG3 A;  3RNU A;  4I7Z C;  2M2L A;  4OIJ A;  1QJO A;  2K5H A;  4DAY A;  2B2U A;  2KEN A;  3FHW A;  4ZAI A;  1G29 1;  3AFQ A;  4OEM B;  2L5T A;  1AEX A;  5C4H A;  1CKO A;  4GLA C;  1QNU A;  4DV3 L;  3VYT A;  2Q2U A;  3OWE B;  5ELC A;  2QDL A;  4A3D B;  4O2D A;  1NR4 A;  4HJ8 A;  2F0N A;  2VQF Q;  4B08 A;  1OXV A;  2RA4 A;  5I9O A;  4CKB A;  4ZLT F;  5G3L D;  1C8C A;  1YVC A;  2AMC B;  1HQR D;  3B6Y A;  2DJG C;  2NUC A;  1YJ9 A;  4XDX A;  4JBK A;  1W6K A;  4J8Q A;  3IKJ A;  3F2B A;  3CCU A;  1EQR A;  5EBC A;  3L9A X;  2QF7 A;  4A3L G;  2RHS B;  2NVQ B;  5IP9 H;  1PMR A;  1BBU A;  3KBG A;  2EVB A;  4KJO A;  1C7Y A;  1IBM L;  1A63 A;  3NBH A;  1HNW L;  4DV7 Q;  4BY7 H;  1XPR A;  1PFN A;  3PUY A;  4ZQ3 A;  2ICE C;  1Y69 U;  1L0X B;  2Z1C A;  1LT3 D;  2R93 B;  3V2T A;  2JSO A;  3C46 A;  2A6H C;  2NYZ D;  1CHQ D;  2E2I H;  2HHH L;  2FMM A;  3E0E A;  4CJ2 C;  2HT1 A;  1Z47 A;  3BZD B;  3P1H A;  1KQS A;  4L5R C;  4JV5 L;  2D62 A;  4HIO A;  4DNI A;  1N34 Q;  1JJ2 A;  1JB3 A;  4GOP A;  3RZO H;  1KL9 A;  2WIN B;  1KNE A;  4DR1 Q;  1A3T A;  3F1Z A;  2R3Z A;  4CBV A;  1X3F A;  3HOZ G;  2VQE Q;  2QIL A;  1TS2 A;  1LTA D;  2F0O A;  5JJZ A;  1S3O A;  5IT9 E;  1YIT A;  5EPK A;  3KUP A;  4G4K A;  5M5Y B;  3CQZ B;  4HJA A;  1KDB A;  1GUG A;  3OYY A;  1STN A;  2A19 A;  1FJG Q;  1BVS A;  4DV2 L;  2JE6 I;  4K2L A;  4CGY B;  4IFD G;  3V05 A;  3T1H Q;  4JK1 C;  3OTO L;  3CCM A;  1WJJ A;  2CCZ A;  5LL6 S;  3M4P A;  5IT9 c;  4HJ7 A;  2CKZ B;  4O42 A;  3SR1 A;  1SYG A;  4LF4 Q;  4X62 L;  4QUF A;  1U4L A;  4NP5 A;  1R9T B;  3KK7 A;  1STG A;  3VA5 A;  4A3C H;  2F3W A;  2YU9 B;  4NPS A;  3EVQ A;  2A69 C;  1K3R A;  4JBJ A;  4MNO A;  3TRZ A;  2L55 A;  4XQQ A;  1H9S B;  1JQY D;  1CZW A;  1SAP A;  4BY1 G;  5DEH A;  1KHI A;  3SDZ A;  4YCW A;  4A3J G;  1SND A;  3JAM i;  2GVA A;  4OO1 G;  1XNR Q;  2XRS D;  2M9V A;  1QVF A;  4MHE A;  1B44 D;  2XNA C;  5JEA G;  1SNP A;  4A3B G;  4V19 0;  3NBH B;  2E2J B;  5LHY 1;  4NW2 A;  2FMC A;  1BBX C;  1YHQ A;  2LY7 A;  2PQE A;  3KLR A;  3ULP A;  2VUM H;  3HOY B;  3I4O A;  4JI6 L;  1I4X A;  1CT1 D;  1AN8 A;  1RDP D;  3TME A;  4DK1 A;  5KGU A;  1CA6 A;  2B2U C;  3BYY B;  3J81 j;  4HMJ A;  2EIF A;  4X66 Q;  5C5M A;  4B3R L;  5C6A A;  4NMZ A;  5C44 H;  5GAH C;  2CVR A;  3I8Z A;  1N32 L;  2EDG A;  5IGE A;  1BQQ T;  5JJL A;  5CV4 A;  2DGY A;  1HXY D;  3PUV A;  4GOP B;  4JI2 L;  4FF1 A;  4WOR A;  4DV4 L;  1KRS A;  1JWS D;  1SNC A;  2K75 A;  4LFC Q;  1UWV A;  3H15 A;  3CF5 A;  4GZY C;  4ZRZ A;  3J81 E;  5JVH 3;  2SOB A;  2RHQ B;  1SXT A;  5JJK A;  4KJN A;  1SN8 A;  5LMN L;  4HJ5 A;  2HIX A;  2K03 A;  3HOV H;  2D0P A;  3S1M H;  4HIK A;  1JJG A;  4JI8 L;  2KBN A;  1B70 B;  1SE3 A;  2HD3 A;  4RFB A;  1MGS A;  3K80 C;  3CCL A;  2DNC A;  4RKB A;  1LTI D;  2F3V A;  1SFO B;  3NTK A;  1O7I A;  3R93 A;  2KCC A;  4FO2 A;  2F0V A;  1ZYR C;  3G6E A;  4Y7N H;  2WAQ G;  3GTL B;  1STH A;  1F9R A;  2NZ1 D;  2EYP A;  2ASB A;  2BA0 A;  3MXP A;  2A6H D;  1PRT F;  3G7L A;  4FF4 A;  4IUV A;  1Y8P B;  3HP3 A;  3N6R A;  2KQ3 A;  4IPG A;  4LF7 Q;  3NWT A;  2OCE A;  1PZI D;  4RAU C;  1QG7 A;  4R8I A;  2ZJR A;  3T1Y L;  4KY5 A;  2CHB D;  2UUA Q;  4YCU A;  2WFW A;  5GAD C;  1ILQ A;  1Y1V G;  4F7X A;  1L1O C;  3J80 c;  1EY8 A;  1Q8K A;  2N49 A;  1DOK A;  4OON A;  4BA2 I;  3HOZ B;  3K5L A;  4JI4 L;  3CXC A;  2A1A A;  2JA6 G;  3DXJ C;  1YJN A;  2JA7 B;  2NTT A;  4POF A;  2IHF A;  1L0W A;  2IHE A;  4HSV A;  4DR5 L;  3K5O A;  4C3J H;  2EYH A;  4RWS C;  4YHH L;  4X3S A;  4BXX H;  5M3F G;  5AFW A;  3PIO A;  3R2I A;  2NB0 A;  3VYS A;  3CME A;  2Q8R E;  5CV5 A;  2EE1 A;  4O1N A;  4P75 A;  3TSS A;  4G57 A;  1HPC A;  3ULJ A;  1OO9 B;  3RZD B;  4NXM Q;  3N52 A;  3MAQ A;  4H7B A;  3SK8 A;  1K8M A;  3CMA A;  1TT2 A;  4UP8 A;  3M85 A;  3DEP A;  1SEB D;  1SR3 A;  2BE5 C;  4DR7 L;  1H9J A;  1KNA A;  2K1B A;  3TEH B;  4LF9 L;  4MTN A;  2A69 D;  1U4P A;  1SBB B;  4B3M Q;  4MIU A;  4UDU C;  3J7A F;  5CC4 A;  2K5W A;  4JI7 Q;  1CSQ A;  3G4S A;  3BVZ A;  1B9M A;  1F9P A;  4FXK C;  3LX0 A;  1RIP A;  4NDX A;  1PZJ D;  3GTM H;  4A3I H;  1Z7T A;  3HKZ E;  1X9N A;  2IY5 B;  2WAC A;  2JA5 H;  1S5E D;  4L5S A;  4C2M B;  1SRU A;  2EY6 A;  1ASZ A;  4GLV B;  4BY1 B;  4A3E G;  3MWY W;  1WTV A;  1ENC A;  4IUP A;  2GA4 B;  3FP9 A;  4G7H C;  1H9R A;  3E3X A;  2R92 H;  2VXW A;  4X65 L;  4HTH A;  1E2Z A;  2K14 A;  5BR8 Q;  3Q8D A;  4A3B B;  3MA2 B;  3QIA A;  2MO0 A;  2NN6 I;  2RDF A;  4QIW E;  4FXD A;  2UXB L;  2L12 A;  3ITP A;  4I65 A;  3RLN A;  2R61 A;  1XTC D;  5K36 H;  4BWG B;  3M3Y H;  2EJM A;  5C3X A;  1KAB A;  1N33 Q;  2KHS A;  1F2Z A;  2UXC L;  4HED A;  5COY A;  1S5F D;  1VQ9 A;  5T1I A;  5FJ8 H;  1XYI A;  2UU9 L;  4K8J A;  1BF4 A;  3A8K E;  4K6D A;  2B8G A;  1IBL L;  3P20 A;  1V43 A;  2CW0 C;  4IUQ A;  5C4X G;  3C1F A;  1NMF A;  5EAY A;  2IX0 A;  3GV6 A;  2KEC A;  3K0Y A;  3CCQ A;  1Q3L A;  4GKJ Q;  4LUO A;  1HHV A;  2BH2 A;  4QUC A;  1DOM A;  4X3T A;  5JVG 3;  3CPW A;  4GNX B;  4KKT A;  4XYQ A;  2KVM A;  4LFA L;  1EWI A;  1SNM A;  4UAI A;  2G9H D;  4HSP A;  4A3M H;  1HH2 P;  3BJU A;  2B2V A;  2NN6 H;  1EOV A;  3RMH A;  1TS3 A;  2VB2 X;  3K7A H;  4TRD A;  1HQM C;  1ZYR D;  3AQQ A;  4ILW A;  1IXR A;  1TS4 A;  5LMU L;  2B63 G;  1NE3 A;  3PIP 3;  1D5M C;  4DR6 L;  2C5C A;  2CWP A;  4YY3 Q;  1MSG A;  3PO3 H;  1UAP A;  5CBA E;  2BDO A;  5C5L A;  2LS0 1;  5KRU A;  4HID A;  3GV3 A;  5FK9 C;  4K0K Q;  4JOI A;  1K3B C;  4DV1 Q;  1Y1V B;  2JA9 A;  4CDE C;  1WTW A;  3GTQ B;  4DUZ Q;  1E22 A;  1PZK D;  2YV5 A;  4IZ8 A;  5IYB H;  4OX9 L;  4DK0 A;  3C2P A;  1L0Y B;  4XYO A;  1VQA A;  1D1I A;  4FYD A;  1EYG A;  1LYL A;  2JA6 B;  3LNN A;  1PDQ A;  2F0M A;  4GS3 A;  1EQQ A;  3HOU H;  2BDN A;  5A2Q L;  1CQV A;  5I2Y A;  5M3F B;  1MSH A;  1I6V C;  3AYH B;  1CKN B;  5FLX E;  3ULL A;  2Z9H A;  2PW7 A;  1STY A;  3S15 H;  1K0S A;  3GDE A;  2MNA A;  2HQE A;  5CV7 A;  3ER0 A;  3NK9 A;  1I3Q B;  1G51 A;  3X3M A;  1HRJ A;  3DWA A;  4ZUJ A;  1WTH A;  4P2C B;  2BE5 D;  4AQY Q;  1EY6 A;  1LTL A;  1VQJ A;  1PFM A;  1DOL A;  1A0I A;  2CH4 A;  2A8V A;  4OIK A;  3C1E A;  4IQZ A;  3MVV A;  5FLX c;  1JOQ A;  4NB3 A;  4BBR B;  5M9O A;  5M5W B;  1GM5 A;  2JEB I;  2NVY H;  3DM1 A;  1X56 A;  1X6O A;  2SEB D;  2SNS A;  4UY8 C;  3I4M G;  1FGB D;  4C3I H;  2F0H A;  3CHB D;  2IT1 A;  4LF8 Q;  4A3E B;  1FGU A;  3BDL A;  4DV7 L;  2WKC A;  5J39 A;  1EL0 A;  2FXQ A;  1GXD C;  2I5H A;  3K6O A;  2CQO A;  3FKI G;  3S1R H;  2UUC L;  4BBS H;  5J1Z A;  2R7Z H;  1W2B A;  1JOK A;  2ZTD A;  4AYB E;  1DD2 A;  1XTD A;  5ELD A;  1TS5 A;  2B8F A;  1A8V A;  4OEL B;  2MP1 A;  4FNF A;  1TWC B;  2N55 A;  1MJC A;  4ME3 A;  1Q86 C;  3F2D A;  1PTO C;  3J80 i;  3I72 A;  4C3H H;  1N34 L;  2CH4 W;  2K50 A;  1B53 A;  4CJ1 B;  4A93 G;  3EQL C;  4YWK A;  1F9Q A;  2NVX H;  4C1N I;  2JA8 G;  4KN4 C;  1ESR A;  1GKH A;  4OGQ C;  2RSN A;  2Z6B A;  4RCN A;  2CW0 D;  5GAG C;  1AZQ A;  1A2T A;  1RF2 D;  3NQT A;  3H3V I;  2F0W A;  3RN2 A;  4P71 A;  4JCV E;  1MJE A;  3D4W A;  1DM0 B;  1VF7 A;  2K01 A;  5IYD H;  3EIV A;  1FJG L;  4NXN Q;  4OL7 A;  1LTS D;  3ERO A;  3T1H L;  2B2V C;  3ZJY C;  2KCT A;  1CSP A;  3PO2 H;  1I6H H;  4P74 A;  5BN5 A;  4PZ6 A;  1A62 A;  4N9P A;  2C35 B;  5C0X G;  4LFB Q;  1TQO A;  1FD7 D;  1ILP A;  1ENF A;  3KYH C;  2HDL A;  1I4G A;  2WB1 E;  2FJ2 A;  3QWN A;  3SEB A;  3S14 B;  4LF4 L;  2F0Q A;  3CP0 A;  3VR5 A;  4LK1 C;  4IOC A;  3EJI A;  1LAB A;  1AW7 A;  3MFY A;  3UDG A;  4GLX A;  4DXF A;  1CZG A;  2B63 B;  3ERQ A;  4L8J A;  2J0T D;  3I4N G;  3E5S A;  3UE1 A;  1YEZ A;  2CFM A;  3SK6 A;  4JOI C;  5I2X A;  3G48 A;  3GTK H;  4UP9 A;  3HS0 C;  1OXT A;  1Y8N B;  3PMF A;  3CKI B;  1SYB A;  2IX1 A;  3GTJ H;  1SYE A;  2PYK A;  5IY0 A;  2ZM6 Q;  1K8G A;  1HNZ L;  3I91 A;  4DR3 Q;  2I5L X;  4H44 C;  1Y1W H;  1Q82 C;  4B3T Q;  1PHJ A;  2F0D A;  5CR3 A;  1CUK A;  3KLS X;  1Q46 A;  1PFS A;  1STA A;  4PV1 C;  4CHT B;  4BA1 I;  5EJW A;  1HZC A;  2XWB B;  1PA6 A;  3A8J E;  3GTO H;  5IE8 A;  4OHJ A;  2VL6 A;  4JW0 A;  1E7Z A;  3QOL A;  3TP6 A;  1N9W A;  4A3F G;  5I9P A;  2MJ8 A;  2XIW A;  1HR0 Q;  4A75 A;  4X3K A;  5IOD A;  3D8G A;  4LF6 L;  1G2S A;  3GTG H;  4RGO S;  1NJI C;  4OWT B;  1LTB D;  2LXJ A;  2K5V A;  2OT2 A;  5ELO A;  3U9O A;  5IGD A;  2ZJQ A;  5EGT A;  4L5T A;  1XNQ Q;  1IYJ B;  1TWA B;  3S16 B;  2ICI A;  2IW3 A;  2MO1 A;  4A3K H;  3RUZ A;  2H1E A;  2JEA I;  5IGF A;  2K05 A;  3HOW G;  5EKI A;  1IKL A;  1ML0 D;  3I4M B;  1PH2 A;  1S72 A;  2RDH A;  2QEJ C;  4F87 A;  2ZJP A;  2L1B A;  1VCI A;  4JI1 L;  1K73 C;  3SE0 A;  2E8G A;  2LFN A;  3CPF A;  3FKI B;  4DR2 Q;  3CCE A;  1E24 A;  1VQB A;  5FO8 B;  1PH8 A;  1WCM G;  5FOB B;  1SNQ A;  3S2H B;  4LF7 L;  3HKZ G;  3STB C;  1PTO D;  2PW5 A;  2KHI A;  1GJX A;  2UUA L;  1JB7 A;  1ICW A;  2A73 B;  2JA7 G;  1L1O A;  2AKW B;  1TWG B;  1UEA B;  4EX5 A;  3TP7 A;  3S1N H;  2QEX A;  3J7A 5;  4B3S Q;  4A93 B;  3W1B A;  4ZKC B;  1KLG D;  1Q8I A;  2JA8 B;  5T1G A;  2EYF A;  2F0S A;  4K6L A;  1PH9 A;  3BVM A;  4KKS A;  4JI5 Q;  3A7L A;  2KUM A;  2FIN B;  1GUO A;  1LT4 D;  3RN5 A;  3M4O B;  1XMQ Q;  1DXM A;  1L2F A;  4DAY B;  4IOA A;  5KYL A;  5FLM G;  1HFN A;  2ENB A;  4V0B A;  2QA4 A;  3QOJ A;  1UE6 A;  3LWE A;  2XN9 C;  4F8M A;  1ZEQ X;  2E2H B;  4RH6 A;  2L0C A;  3VYR A;  2WII B;  4NXM L;  5F2D A;  1TKW B;  1U5K A;  1JJC B;  1RTO A;  2K52 A;  1JR0 D;  3PV0 A;  4IUR A;  4ULL A;  5KNC A;  1HZA A;  1P16 A;  4C56 C;  4IO9 A;  2JXM B;  1HTL D;  2X6G A;  1LO5 D;  2XSC A;  1U4R A;  2F0I A;  3W3A A;  4A3D H;  3J7Y W;  3OWF A;  2LSS A;  4QY7 A;  1M4V A;  2F0K A;  3HOX G;  3I4N B;  2L15 A;  3K7U C;  2NVT B;  4U68 A;  1VQN A;  2F3I A;  2XRQ D;  2I0Q A;  2PMZ B;  5HGT A;  4AH6 A;  3R8B A;  1X3P A;  3I90 A;  4Z9C B;  1MKH A;  2E74 C;  2NVQ H;  5BR8 L;  2YTV A;  5H1S E;  3TBI B;  2WKD A;  4OXP A;  1B2T A;  2Q2H A;  1IKM A;  5C3W A;  2EXZ A;  2PO4 A;  1VQD A;  1PH5 A;  3G71 A;  2B2T A;  1EQT A;  4A76 A;  2B39 A;  3SHL A;  4R1J A;  2J7Z A;  3QR8 A;  4QQB X;  1IBK Q;  5ELE A;  1EZ8 A;  3GO5 A;  4X64 L;  5IYC H;  2EY5 A;  1ROD A;  2R93 H;  1SMX A;  5IT9 L;  4KTA A;  1VDZ A;  3K81 C;  2PZT A;  4A3F B;  3CCV A;  3S9W A;  1NUC A;  1L1O B;  2KCM A;  4L6T B;  5M3M G;  4R4I A;  1Z6H A;  3H0G G;  3TZD A;  2RF4 A;  4DA2 A;  1Y8O B;  2Y0S E;  1LM0 A;  1IL8 A;  1BR9 A;  4H0L C;  4GKK Q;  1EIG A;  1S5D D;  1WFQ A;  4TSS A;  1AFP A;  2J4X A;  4FXG C;  4IN3 A;  1XMO Q;  1K83 B;  5L37 A;  1RTN A;  1EUJ A;  1NBW A;  3PGZ A;  3GTP H;  2KEE A;  3J81 c;  4ALP A;  1WVL A;  3I56 A;  1SE4 A;  1IBM Q;  3FMC A;  3GP7 A;  5M5Y H;  3NEN A;  3CQZ H;  4IFD J;  1GUN A;  4Q5V A;  2WP8 J;  3WOE A;  4DV6 L;  3K5N A;  5JPN C;  1EY7 A;  2K32 A;  3HOW B;  4PZ7 A;  1UE5 A;  1VS0 A;  3NSW A;  5C3E G;  1J8I A;  1VQP A;  2Q2I A;  3MHB A;  1MBY A;  5ELB A;  4N8X 1;  4YY3 L;  3UDF A;  3S17 B;  4R8N A;  1Q12 A;  1WCM B;  3STB D;  1JWU D;  1R9T H;  1HR0 W;  3HKZ B;  1PYW D;  2YU9 H;  4K0K L;  1WOC A;  4K5W A;  1OTC A;  2D2C C;  4DUZ L;  3D31 A;  2VY3 A;  3EA6 A;  2DNE A;  4G7O C;  4RGT A;  4AYB G;  4QIW B;  5JEA J;  3FPP A;  1E1O A;  3DHQ A;  3CRK C;  4N9T A;  2R6G A;  3NXW A;  4CKC A;  2EQS A;  1P8L A;  4DV2 Q;  4ODG A;  1PRT C;  2E2J H;  4A3G G;  1QUQ A;  1T5X D;  3QG1 A;  4KHP Q;  3HOY H;  4XTC S;  3UI2 A;  3VDY A;  3J81 L;  4IPD A;  1I50 B;  5COR A;  3EN2 A;  3TP8 A;  1VMP A;  2B3G A;  2E75 C;  5CMD A;  3R3O A;  3S24 A;  5BN3 A;  1O7Y A;  3HRZ C;  1MIU A;  4JG2 A;  4C1N K;  2YTY A;  4BBR G;  4ZYS A;  4AQY L;  2OQ0 A;  1RCV D;  4PMC A;  5M5X B;  3MXN A;  3OSO A;  2P5Z X;  3D6C A;  5IP7 G;  1VQF A;  5ISR A;  2MFI A;  1GUS A;  3J80 L;  2N3S A;  5E4X A;  4UP7 A;  1UE7 A;  1KDC A;  1BO0 A;  3Q23 A;  3HOX B;  2PNH A;  3PUZ A;  3AMU A;  2WB1 G;  1WTX A;  4LF8 L;  3HKS A;  3UDI A;  4QMG A;  1PXU A;  1GUW A;  4B9W A;  3I70 A;  4R9W A;  4MTK A;  4JI0 Q;  4TQU S;  1KTK A;  3OPO A;  4A3L H;  4KHZ A;  2B2T C;  1HUM A;  2K33 A;  2GVB A;  4H13 C;  1IYV A;  5DAU A;  2OXP A;  4RG1 A;  3OOC A;  1W3S A;  4B3R Q;  3DMU A;  3NUC A;  1IL2 A;  4IFD I;  1SFO H;  3KF8 A;  5IP9 G;  1QCB D;  1N32 Q;  2MUY A;  1A2U A;  2XWJ B;  1CM9 A;  2F4I A;  1EEI D;  3NE5 B;  3J7Z C;  1QOH A;  4BY7 G;  5CV6 A;  4DV4 Q;  3KF6 A;  3FEW X;  3D6W A;  1TWF H;  2F0F A;  2F0G A;  1QVG A;  5HGQ A;  5M3M B;  2EY1 A;  3H0G B;  1F9S A;  4J6H A;  2CWA A;  3V96 A;  2HQL A;  3S1Q B;  5C4J B;  3HOZ H;  4ID6 A;  4OO1 I;  2O5I C;  1CFM A;  3C3L A;  2OQK A;  4DN4 M;  2E2D C;  3EFX D;  3IL8 A;  2NBF A;  2EOT A;  3U4V A;  1AP0 A;  4XQN A;  1BNZ A;  1IZ6 A;  4C3H B;  3PUX A;  4EVO A;  4FF2 A;  3U4Z A;  4IFD H;  5C3E B;  4FVM A;  4PNY A;  1XX8 A;  3RZD H;  1G6Z A;  2H5X A;  1WD0 A;  5G3L F;  1WTR A;  1EIY B;  2MHV A;  5TSS A;  2KED A;  4LF5 Q;  4RGN A;  1CTM A;  3T1Y Q;  3K57 A;  4DXG A;  1S4Z A;  3ERS X;  3PUW A;  3E9I A;  4DAV A;  4HCE A;  3DWP A;  1JCK B;  1JOR A;  1RKN A;  2D0O A;  4J15 A;  3PSI A;  1GOZ A;  2ZM6 L;  3R2T A;  1JT8 A;  1V1Q A;  1PH7 A;  1O78 A;  1UNS A;  2ZTE A;  3A74 A;  4A3C G;  4B3T L;  1HA6 A;  2DY8 A;  1FNW A;  5AJ3 Q;  2PCF B;  4JBM A;  2PI2 E;  4YWM A;  3OHX C;  4AYB B;  4C2M H;  4X3U A;  4XT1 B;  4BY1 H;  4A3J H;  1FNV A;  3AFP A;  2X69 A;  4OO1 H;  1B8A A;  3H91 A;  3IFT A;  1PRT D;  5JEA H;  2VQF L;  1EFI D;  2AHO B;  1PTO B;  3NTH A;  5EKL A;  4A3B H;  4DFA A;  1H9M A;  3KF8 B;  5HY6 A;  4RMF A;  5KND A;  1N36 Q;  4A3G B;  2VB3 X;  4KMU C;  3F2C A;  1AE2 A;  1Q81 C;  1C4Q A;  4KLK A;  4HR7 B;  1EEF D;  5K5P A;  3K59 A;  1WD1 A;  3BS1 A;  3GD7 A;  4X6A H;  4DGZ A;  3CRL C;  3KJP A;  2VUM G;  1O80 A;  3S2D B;  3JAM E;  1JE4 A;  4K14 A;  2WAQ E;  4AIM A;  2F4V Q;  1PTO F;  1G8Z D;  4RA8 A;  3M4Y A;  2BA1 A;  2F0T A;  1V1P A;  2BH8 A;  3J81 i;  1VQO A;  1ONL A;  1XNQ L;  1C0A A;  1I94 Q;  1Q1B A;  3RD4 A;  1VMC A;  5C44 G;  1AE3 A;  1RL2 A;  4A4I A;  4G7Z C;  3RLO A;  4HJ9 A;  1DJR D;  3MZ5 A;  4CDD C;  2VNU D;  4LJZ C;  2EY2 A;  4OWW B;  1CK1 A;  4GN5 A;  4QL5 A;  2UUB Q;  1R4Q B;  3BG3 A;  3T51 B;  4DNT B;  2WB1 B;  3ND8 A;  4UHV A;  1U4M A;  4M1U B;  4DR2 L;  3VR6 A;  1IHZ A;  1EFW A;  2RKS A;  2ES2 A;  3HOV G;  1A3U A;  4DR1 L;  1C9O A;  4RHR A;  1TY0 A;  2ATW A;  3P7J A;  2UXC Q;  4DUY Q;  1JMC A;  2Q8T A;  3M9B A;  2VQE L;  2AQ2 B;  1B9N A;  1R4P B;  1SYF A;  1TY2 A;  2AWN A;  3H6M A;  2F0U A;  3VR3 A;  2F0E A;  4B3S L;  3QB3 A;  3Q22 A;  5E4W C;  3AU7 A;  3LGJ A;  3NTI A;  1DZ1 A;  4BY7 B;  3TQY A;  1E1T A;  4E6I A;  4KV6 A;  3SXH A;  1PVO A;  4JI5 L;  4DV0 Q;  1FR3 A;  5FLX L;  1XMQ L;  2K5Q A;  2O2L D;  2N88 A;  3I73 A;  1SRO A;  3MXU A;  1PH6 A;  3UDX A;  1Y1V H;  2E2I B;  2LMC B;  4ZKB B;  3GTQ H;  4RGM A;  1WTQ A;  2E76 C;  2HCC A;  2I46 A;  4JC0 A;  4KD4 A;  5KEE A;  4XIG S;  3PF5 A;  1BCP C;  3BZK A;  4JI3 Q;  3PF4 A;  2K28 A;  4LFA Q;  2KOL A;  1HCZ A;  2JA6 H;  2AUK A;  2OF1 A;  4K8I A;  5CV8 A;  2JN4 A;  3RZO B;  3U58 A;  2Y0S G;  1TVX A;  2HUG A;  1EY9 A;  4DK6 C;  5LMU Q;  1U0L A;  3K58 A;  1J5E Q;  3CD6 A;  4DR6 Q;  4LMQ D;  4C3J G;  2NZO A;  1XNR L;  4S3S A;  4BXX G;  5DNF A;  1SNO A;  1MHW C;  3VYU A;  3KDF A;  3PIP A;  2EZV A;  2V1C C;  3H3V H;  4OWX B;  2K4K A;  1SYD A;  1EYA A;  3WOF A;  4CDC C;  1EU4 A;  1NNX A;  4L63 B;  1NY4 A;  1VQ6 A;  2DJF C;  2F1M A;  4WJ4 A;  2JJQ A;  3EBE A;  4OX9 Q;  1EWC A;  4JBW A;  1STE A;  1RHP A;  4X66 L;  3M7N A;  2F0P A;  4CDF C;  3IFD A;  4IUU A;  5D3D A;  5M5W H;  5IGG A;  4A3E H;  4EQN A;  1Q7Y C;  4TVA B;  1IBK L;  2R7D A;  3U50 C;  4A3I G;  2JA5 G;  4LFC L;  1NR2 A;  1YNN C;  2B2W C;  3K5M A;  5GRO A;  2R92 G;  2X6L A;  2K5D A;  3M4Q A;  1TWC H;  1EIH A;  4LWC A;  1F2Y A;  1QVC A;  3E6Z X;  2AWO A;  1I4P A;  4XT3 B;  4POG A;  2IJ0 A;  2A6E C;  3BZC A;  4GKK L;  2QDB A;  2VUM B;  1K8O A;  5K36 G;  1E2V A;  1TWH H;  1PH4 A;  1H9S A;  3L2P A;  2XTI A;  1XMO L;  2G5D A;  3NEL A;  3T4A C;  1B3A A;  1KDA A;  4WJW A;  1SSO A;  2EPB A;  3L7Z C;  2G9D A;  5FJ8 G;  5C44 B;  1WTO A;  5C4X H;  2R7F A;  1OXS C;  1D1K A;  3O13 A;  3URY A;  1KC8 C;  3KBX A;  4DPG A;  3HZX A;  2UUC Q;  5C0X J;  1YHB A;  2ZXR A;  3KLW A;  2DUD A;  3NWS A;  5IGC A;  3NHH A;  3VA7 A;  1M90 C;  4QF4 A;  3HOV B;  1B7Y B;  3S14 H;  2RSO A;  3S1M B;  1BBW A;  5JPM C;  4GN3 B;  4DV5 Q;  2Z6K A;  1VQC A;  4JPB W;  3KDF B;  1JE5 A;  3MXG A;  4A3M G;  3J7A V;  3L3O C;  2Z0S A;  4IJL A;  2NN6 G;  3PIO 3;  2L9H A;  1EIF A;  2B63 H;  2AQ1 B;  1H95 A;  3GTP B;  3D3R A;  2RQX A;  1PLF A;  3W1G A;  3BDO A;  1VQM A;  4KI0 A;  3K8A A;  4Y7N B;  5EBD A;  3SVM A;  2EXD A;  2M00 A;  1LTR D;  1VQL A;  3PO3 G;  1KRT A;  5FO7 B;  3AEV A;  3I7F A;  2QW7 A;  3DM3 A;  3I2Z A;  5IIF A;  1BCP D;  5I4D A;  1AH9 A;  1YBY A;  4KHP L;  1TXY A;  4KY7 A;  1KAA A;  1YI2 A;  4QCL A;  3W2D A;  3SGI A;  5IWA Q;  3P75 A;  3TRE A;  4B3M L;  2IPK D;  1FVI A;  5IYB G;  4JI7 L;  1VF5 C;  2Y0S B;  3HFZ B;  1HNX Q;  2F52 A;  2UXD Q;  4ZUI A;  4DU9 A;  1K28 A;  1LV9 A;  1NMG A;  3UE0 A;  1EOT A;  4JYA Q;  5EKK A;  4UPA A;  4DF7 A;  1ZXT A;  3HOU G;  1X32 A;  4DR4 Q;  2Z4H A;  1KLU D;  1NAP A;  2NWG A;  4M8A A;  2HCI A;  2JK8 A;  1D5X C;  4C3J B;  5FKA C;  5E3F A;  1B4O A;  1PV4 A;  1M8A A;  4J1M A;  4GN4 B;  2E5L Q;  1GHJ A;  4PMW A;  5LL6 X;  4LW1 A;  3L0O A;  2MGS A;  2RCF A;  2Q2T A;  2PZW A;  1BUV T;  1I5F A;  1EZ6 A;  1ET9 A;  1TWA H;  3OW2 A;  1X54 A;  1HNZ Q;  3S16 H;  1ESF A;  4JI0 L;  4EQ5 A;  1N33 L;  4XQJ A;  3D4D A;  1NTG A;  2F03 A;  2RVL A;  3DEO A;  5CYU A;  5I6W A;  3I4M H;  4DV3 Q;  2DY7 A;  3TZU A;  4B9X A;  5CV9 A;  5D3I B;  3HEJ A;  1S5B D;  4IAL A;  1F77 A;  3NEM A;  3I55 A;  3FVQ A;  4ZK9 B;  4WFN 3;  5NUC A;  1II3 A;  2LKV A;  3FKI H;  2HIV A;  4Y52 H;  1YNN D;  3GTM B;  5C0X I;  4A3I B;  4C3I G;  2JA5 B;  2KHJ A;  1V9P A;  4GKJ L;  3S2H H;  2MPM A;  1KIX A;  4LF6 Q;  4EQP A;  2R92 B;  4K2K A;  4BBS G;  1QWY A;  2A6E D;  1SDF A;  1NSN S;  4Q0F A;  3Q24 A;  2R7Z G;  2XGT A;  3GQB A;  1HFG A;  1IYU A;  2SDF A;  2ALY B;  1TWG H;  1HZB A;  1OXU A;  4QGU A;  4JVZ A;  3NBI A;  4PQX A;  1PH3 A;  4A93 H;  1STB A;  2JA8 H;  3M3Y B;  1HNW Q;  2RCN A;  1WI5 A;  1ZKO A;  4XXE A;  1PRT B;  4KK7 A;  4C3H G;  2RDG A;  3M4O H;  1Y14 B;  2A5H A;  2PMZ E;  5KIX A;  1GHK A;  1V8Q A;  2HHH Q;  2C9O A;  5JAV A;  1U9R A;  4JI1 Q;  1W6J A;  1NCV A;  3J80 E;  3U9S A;  2OTJ A;  1ASY A;  3ND9 A;  4JV5 Q;  2E2H H;  1K8A C;  4HMI A;  1FYC A;  3A0J A;  3CC4 A;  2XVS A;  2Z6K C;  5IYD G;  4GOP C;  1PYB A;  4LF5 L;  2LXK A;  1TWF B;  4DV1 L;  3BDC A;  5C0X H;  3NQI A;  1YJW A;  3PO2 G;  3OMG A;  3OMC A;  4KD3 A;  3NPP A;  4EQO A;  2FFK B;  3KOJ A;  3VR2 A;  3T16 A;  4A3M B;  2V4D A;  1D8L A;  4RCO A;  4O0A A;  2B2Y A;  5JOB A;  1GO3 E;  1GVP A;  2N8N A;  2PI2 A;  3K7A B;  5D65 A;  3I4N H;  1F2M A;  1EY5 A;  1XWE A;  5AJ3 L;  2NVT H;  3I4L A;  4R4T A;  3LWU A;  2PPB C;  2CQA A;  2EYO A;  5KNB A;  3OTO Q;  1G2T A;  1RD9 D;  1QNK A;  4FF3 A;  2HDM A;  2QGQ A;  4ZCK A;  2JYO A;  1CKM A;  4GNX A;  3PO3 B;  2DN8 A;  2A74 C;  4X62 Q;  1CI3 M;  1N36 L;  5CGK A;  4TKO B;  1I4Q A;  1YZ6 A;  2KJX A;  4FP5 D;  1X65 A;  4R4C A;  4APV A;  4PMB A;  2O4X A;  4MZ9 A;  1Y1W G;  3CCS A;  4ABN A;  1EYC A;  5DM7 3;  3A55 A;  2VS1 A;  4A3F H;  1PYS B;  3IAY A;  2F4V L;  4CJ0 B;  1MD2 D;  2BOS A;  1I94 L;  3HOU B;  3OW7 A;  3X3N A;  3QJY A;  1CQF A;  1HTP A;  2IX3 A;  3A5Z B;  1A15 A;  3OIP A;  1J9O A;  1JOO A;  1EY4 A;  5J22 A;  1KAW A;  1YHA A;  3D4R A;  4A3J B;  1SMY C;  4JI6 Q;  1IW7 C;  4HIM A;  2L11 A;  1BKB A;  4WRD A;  1G6P A;  1PFB A;  2UUB L;  1K83 H; 
#chains in the Genus database with same CATH homology
 3BYT B;  3S15 B;  1GUT A;  1Q1E A;  1OXX K;  1ENA A;  3FPU B;  5HUR A;  1EQV A;  5EPL A;  1FNU A;  3FRP B;  3TP5 A;  2O5J C;  3A54 A;  4KN7 C;  1CA5 A;  5A2Q E;  1DYQ A;  3WDN A;  3SK4 A;  4RHS A;  1C48 A;  2K04 A;  2NVY B;  5C4Z A;  3A56 A;  1RJT A;  4C3I B;  2ZT9 C;  1H9K A;  2YYZ A;  1WTP A;  1D5Z C;  3S1R B;  3H94 A;  4BBS B;  2R7Z B;  1BDO A;  4QB4 A;  4KY6 A;  2A68 C;  3ONA B;  3T13 A;  4F88 A;  5IOC A;  1SJH D;  2NVX B;  2K7V A;  4RKL A;  1JWM D;  1QE6 A;  1YNJ C;  5DM6 3;  3A8I E;  1LT6 D;  2WAQ B;  3MC0 B;  3Q0A A;  5A35 A;  5D14 A;  4IUN A;  2I07 B;  2H4O A;  5IGB A;  2L4N A;  2PZU A;  1LLR D;  2ZXO A;  1EU3 A;  2B2Y C;  3PO2 B;  1I6H B;  3DWQ A;  1MI2 A;  2SNM A;  3HG9 A;  2EYM A;  1D6E C;  2EYL A;  1TII D;  2NTS A;  5ELF A;  2EJG C;  4KHV A;  2Q8I B;  1AZP A;  1D2B A;  2JP1 A;  1S5C D;  2K6A A;  2PNR C;  3I3C A;  2BCO A;  1JC7 A;  1XXG A;  1X3Q A;  4LAA A;  2OEO A;  1LT5 D;  5FO9 B;  3G6J B;  3H09 A;  3SK5 A;  1EYD A;  3GTK B;  2B2W A;  3M7G A;  2TSS A;  4HN7 A;  3GTJ B;  3T53 B;  2EYJ A;  1F2L A;  2AUJ D;  3MFG A;  3QO2 A;  1B50 A;  2WV6 D;  1Y1W B;  4HAE A;  3OIQ A;  4BS9 A;  2AQ3 B;  2KA7 A;  3GTO B;  1LTT D;  3DUZ A;  4NKL A;  2Z8L A;  1EWH A;  1TR5 A;  1BCP B;  3AB9 A;  1SMY D;  1IW7 D;  2IL8 A;  1CHP D;  1BOS A;  4YIJ A;  3KLS A;  3GTG B;  4MN3 A;  2ZXP A;  3CU7 A;  2F0L A;  1BCP F;  4ME5 A;  2KCN A;  2D9U A;  2FHT A;  1TU2 B;  3TN2 A;  3TDQ A;  4DNR B;  2EJF C;  4K5V A;  1SJE D;  4A3K B;  1E2W A;  1Q90 A;  3VR4 A;  3H3V C;  1TWH B;  2TMP A;  4CKE A;  1V1O A;  1LAC A;  2QKI C;  1DCZ A;  1G91 A;  2Z4I A;  5C4X B;  4HCS A;  1HUN A;  4K5X A;  2D5D A;  2F0J A;  3FDT A;  4EGV A;  1I4R A;  3NP8 A;  2QCP X;  1O7Z A;  3ZYY X;  3E0J A;  4IUT A;  5CBE E;  2A68 D;  3JAM L;  1EY0 A;  3RLF A;  2IWH A;  5BN4 A;  4U67 3;  3A7A B;  5I6Y A;  1O7L A;  1SE2 A;  3S1N B;  3T56 B;  1YNJ D;  2RBM A;  1V1P B;  1PTO H;  3BVG A;  1LTG D;  5EQ0 A;  1SYC A;  4DAP A;  1E0B A;  1QB5 D;  1UUP A;  1JIC A;  4KKU A;  1A6X A;  5KYI A;  1HA5 A;  1ET6 A;  1I4H A;  3Q6S A;  1T5E A;  3F2U A;  1DON A;  1A3V A;  1B1Z A;  5E1F A;  1BXT A;  2ID0 A;  3MEH A;  1QIL A;  3HGB A;  5EPJ A;  3MTS A;  4I7Z C;  2M2L A;  4OIJ A;  1QJO A;  4DAY A;  2B2U A;  4ZAI A;  1G29 1;  2L5T A;  1AEX A;  5C4H A;  1QNU A;  3VYT A;  3OWE B;  5ELC A;  4A3D B;  1NR4 A;  2F0N A;  4B08 A;  1OXV A;  2RA4 A;  5I9O A;  4CKB A;  4ZLT F;  5G3L D;  1C8C A;  1HQR D;  2NUC A;  4XDX A;  1W6K A;  4J8Q A;  3IKJ A;  5EBC A;  3L9A X;  2QF7 A;  2NVQ B;  1PMR A;  3KBG A;  2EVB A;  4KJO A;  3NBH A;  1PFN A;  3PUY A;  4ZQ3 A;  2ICE C;  1Y69 U;  1L0X B;  2Z1C A;  1LT3 D;  2R93 B;  3V2T A;  2JSO A;  3C46 A;  2A6H C;  2NYZ D;  1CHQ D;  2FMM A;  4CJ2 C;  1Z47 A;  3BZD B;  3P1H A;  2D62 A;  1JB3 A;  2WIN B;  1KNE A;  1A3T A;  2R3Z A;  4CBV A;  2QIL A;  1TS2 A;  1LTA D;  2F0O A;  5JJZ A;  5IT9 E;  5EPK A;  3KUP A;  4G4K A;  5M5Y B;  3CQZ B;  1KDB A;  1GUG A;  1STN A;  2JE6 I;  4K2L A;  4CGY B;  4IFD G;  3V05 A;  4JK1 C;  5LL6 S;  4O42 A;  3SR1 A;  1SYG A;  4QUF A;  1U4L A;  4NP5 A;  1R9T B;  3KK7 A;  1STG A;  3VA5 A;  2F3W A;  2YU9 B;  3EVQ A;  2A69 C;  2L55 A;  4XQQ A;  1H9S B;  1JQY D;  1CZW A;  1SAP A;  5DEH A;  3SDZ A;  1SND A;  4OO1 G;  2XRS D;  2M9V A;  4MHE A;  1B44 D;  2XNA C;  5JEA G;  1SNP A;  4V19 0;  2E2J B;  5LHY 1;  4NW2 A;  2FMC A;  1BBX C;  2LY7 A;  2PQE A;  3KLR A;  3HOY B;  1I4X A;  1CT1 D;  1AN8 A;  1RDP D;  3TME A;  4DK1 A;  5KGU A;  1CA6 A;  2B2U C;  3BYY B;  4HMJ A;  5C5M A;  5C6A A;  4NMZ A;  2CVR A;  3I8Z A;  2EDG A;  5IGE A;  1BQQ T;  5CV4 A;  1HXY D;  3PUV A;  4FF1 A;  4WOR A;  1SNC A;  1JWS D;  4GZY C;  4ZRZ A;  3J81 E;  5JVH 3;  2SOB A;  1SXT A;  4KJN A;  2K03 A;  1SE3 A;  4RFB A;  1MGS A;  2DNC A;  4RKB A;  1LTI D;  2F3V A;  1SFO B;  3NTK A;  3R93 A;  2KCC A;  4FO2 A;  2F0V A;  1ZYR C;  3GTL B;  1STH A;  1F9R A;  2NZ1 D;  2EYP A;  2BA0 A;  3MXP A;  2A6H D;  1PRT F;  3G7L A;  4FF4 A;  4IUV A;  1Y8P B;  3HP3 A;  3N6R A;  2KQ3 A;  3NWT A;  1PZI D;  4RAU C;  1QG7 A;  4R8I A;  4KY5 A;  2CHB D;  1ILQ A;  4F7X A;  1EY8 A;  1DOK A;  4BA2 I;  3HOZ B;  3K5L A;  3DXJ C;  2JA7 B;  2NTT A;  4HSV A;  3K5O A;  2EYH A;  4RWS C;  4X3S A;  5AFW A;  3R2I A;  2NB0 A;  3VYS A;  2Q8R E;  5CV5 A;  2EE1 A;  4O1N A;  3TSS A;  4G57 A;  1HPC A;  1OO9 B;  3RZD B;  3N52 A;  3MAQ A;  4H7B A;  3SK8 A;  1K8M A;  1TT2 A;  3M85 A;  3DEP A;  1SEB D;  2BE5 C;  1H9J A;  1KNA A;  2K1B A;  2A69 D;  1U4P A;  1SBB B;  4MIU A;  4UDU C;  3J7A F;  5CC4 A;  2K5W A;  3BVZ A;  1B9M A;  1F9P A;  4FXK C;  3LX0 A;  4NDX A;  1PZJ D;  1Z7T A;  2WAC A;  1S5E D;  4C2M B;  2EY6 A;  4BY1 B;  3MWY W;  1WTV A;  1ENC A;  4IUP A;  2GA4 B;  4G7H C;  1H9R A;  2VXW A;  4HTH A;  1E2Z A;  4A3B B;  3MA2 B;  3QIA A;  2NN6 I;  2RDF A;  4FXD A;  2L12 A;  3ITP A;  4I65 A;  2R61 A;  1XTC D;  5K36 H;  4BWG B;  2EJM A;  5C3X A;  1KAB A;  2KHS A;  1F2Z A;  4HED A;  5COY A;  1S5F D;  5T1I A;  1XYI A;  4K8J A;  1BF4 A;  3A8K E;  4K6D A;  2B8G A;  3P20 A;  1V43 A;  2CW0 C;  4IUQ A;  3C1F A;  2IX0 A;  3GV6 A;  2KEC A;  3K0Y A;  1Q3L A;  1HHV A;  4QUC A;  1DOM A;  4X3T A;  5JVG 3;  4KKT A;  4XYQ A;  2KVM A;  4UAI A;  1SNM A;  2G9H D;  4HSP A;  2B2V A;  2NN6 H;  3RMH A;  1TS3 A;  2VB2 X;  4TRD A;  1HQM C;  1ZYR D;  4ILW A;  1TS4 A;  3PIP 3;  1D5M C;  2C5C A;  1MSG A;  1UAP A;  5CBA E;  2BDO A;  5C5L A;  2LS0 1;  5KRU A;  3GV3 A;  5FK9 C;  1Y1V B;  1WTW A;  3GTQ B;  1PZK D;  4IZ8 A;  4DK0 A;  3C2P A;  1L0Y B;  4XYO A;  1D1I A;  4FYD A;  2JA6 B;  3LNN A;  1PDQ A;  2F0M A;  2BDN A;  5A2Q L;  1CQV A;  5I2Y A;  5M3F B;  1MSH A;  1I6V C;  5FLX E;  2PW7 A;  1STY A;  2HQE A;  5CV7 A;  3NK9 A;  1I3Q B;  3X3M A;  1HRJ A;  3DWA A;  4ZUJ A;  4P2C B;  2BE5 D;  1EY6 A;  1PFM A;  1DOL A;  4OIK A;  3C1E A;  4IQZ A;  3MVV A;  1JOQ A;  4BBR B;  5M9O A;  5M5W B;  2JEB I;  3DM1 A;  2SEB D;  2SNS A;  1FGB D;  2F0H A;  3CHB D;  2IT1 A;  4A3E B;  3BDL A;  2WKC A;  5J39 A;  1EL0 A;  1GXD C;  3K6O A;  5J1Z A;  1JOK A;  1DD2 A;  5ELD A;  1TS5 A;  2B8F A;  2MP1 A;  4FNF A;  1TWC B;  2N55 A;  1PTO C;  3I72 A;  1B53 A;  4CJ1 B;  3EQL C;  1F9Q A;  4C1N I;  4KN4 C;  1ESR A;  4OGQ C;  2RSN A;  4RCN A;  2CW0 D;  1AZQ A;  1A2T A;  1RF2 D;  3NQT A;  2F0W A;  3D4W A;  1DM0 B;  1VF7 A;  2K01 A;  4OL7 A;  1LTS D;  3ERO A;  2B2V C;  5BN5 A;  4N9P A;  5C0X G;  1TQO A;  1FD7 D;  1ILP A;  1ENF A;  2HDL A;  1I4G A;  2FJ2 A;  3QWN A;  3SEB A;  3S14 B;  2F0Q A;  3VR5 A;  4LK1 C;  3EJI A;  1LAB A;  1AW7 A;  3MFY A;  4DXF A;  1CZG A;  2B63 B;  3ERQ A;  4L8J A;  2J0T D;  3E5S A;  3SK6 A;  5I2X A;  3HS0 C;  1OXT A;  1Y8N B;  3PMF A;  3CKI B;  1SYB A;  2IX1 A;  1SYE A;  2PYK A;  3I91 A;  4H44 C;  2F0D A;  5CR3 A;  3KLS X;  4PV1 C;  1STA A;  4CHT B;  4BA1 I;  5EJW A;  2XWB B;  3A8J E;  4OHJ A;  3QOL A;  3TP6 A;  5I9P A;  2MJ8 A;  2XIW A;  4X3K A;  5IOD A;  3D8G A;  1G2S A;  4RGO S;  1LTB D;  2OT2 A;  3U9O A;  5IGD A;  5EGT A;  1TWA B;  3S16 B;  2ICI A;  2IW3 A;  3RUZ A;  2H1E A;  2JEA I;  5IGF A;  2K05 A;  5EKI A;  1IKL A;  1ML0 D;  3I4M B;  2RDH A;  2QEJ C;  4F87 A;  2L1B A;  1VCI A;  3SE0 A;  2LFN A;  3FKI B;  5FO8 B;  5FOB B;  1SNQ A;  3S2H B;  1PTO D;  2PW5 A;  1GJX A;  1ICW A;  2A73 B;  1TWG B;  1UEA B;  3TP7 A;  4A93 B;  4ZKC B;  1KLG D;  1Q8I A;  2JA8 B;  5T1G A;  2EYF A;  2F0S A;  4K6L A;  3BVM A;  4KKS A;  3A7L A;  2KUM A;  2FIN B;  1GUO A;  1LT4 D;  3M4O B;  1DXM A;  5KYL A;  1HFN A;  2ENB A;  4V0B A;  3QOJ A;  3LWE A;  2XN9 C;  4F8M A;  1ZEQ X;  2E2H B;  4RH6 A;  2L0C A;  3VYR A;  2WII B;  5F2D A;  1TKW B;  1RTO A;  1JR0 D;  3PV0 A;  4IUR A;  4ULL A;  5KNC A;  4C56 C;  2JXM B;  1HTL D;  2X6G A;  1LO5 D;  2XSC A;  1U4R A;  2F0I A;  3W3A A;  3J7Y W;  3OWF A;  1M4V A;  2F0K A;  3I4N B;  2NVT B;  4U68 A;  2XRQ D;  2PMZ B;  5HGT A;  3R8B A;  1X3P A;  3I90 A;  4Z9C B;  2E74 C;  3TBI B;  2WKD A;  1B2T A;  1IKM A;  5C3W A;  2EXZ A;  2PO4 A;  2B2T A;  1EQT A;  2B39 A;  3SHL A;  2J7Z A;  5ELE A;  1EZ8 A;  3GO5 A;  2EY5 A;  1ROD A;  5IT9 L;  4KTA A;  1VDZ A;  2PZT A;  4A3F B;  3S9W A;  1NUC A;  4L6T B;  1Z6H A;  3TZD A;  4DA2 A;  1Y8O B;  1IL8 A;  1BR9 A;  4H0L C;  1EIG A;  1S5D D;  1AFP A;  4TSS A;  2J4X A;  4FXG C;  4IN3 A;  1K83 B;  1RTN A;  2KEE A;  1WVL A;  1SE4 A;  3FMC A;  3GP7 A;  4IFD J;  1GUN A;  4Q5V A;  2WP8 J;  3WOE A;  3K5N A;  5JPN C;  1EY7 A;  2K32 A;  3HOW B;  3NSW A;  1J8I A;  3MHB A;  1MBY A;  5ELB A;  3S17 B;  4R8N A;  1Q12 A;  1WCM B;  1JWU D;  3HKZ B;  1PYW D;  4K5W A;  2D2C C;  3D31 A;  4G7O C;  3EA6 A;  2DNE A;  4RGT A;  4QIW B;  5JEA J;  3FPP A;  3DHQ A;  3CRK C;  4N9T A;  2R6G A;  3NXW A;  4CKC A;  4ODG A;  1PRT C;  1T5X D;  3QG1 A;  4XTC S;  3UI2 A;  3J81 L;  1I50 B;  5COR A;  3TP8 A;  1VMP A;  2E75 C;  5CMD A;  3R3O A;  5BN3 A;  1O7Y A;  3HRZ C;  4C1N K;  4ZYS A;  1RCV D;  4PMC A;  5M5X B;  3MXN A;  3OSO A;  3D6C A;  5ISR A;  1GUS A;  3J80 L;  5E4X A;  1KDC A;  1BO0 A;  3Q23 A;  3HOX B;  3PUZ A;  3AMU A;  1WTX A;  4QMG A;  1PXU A;  1GUW A;  4B9W A;  3I70 A;  4R9W A;  4TQU S;  1KTK A;  3OPO A;  4KHZ A;  2B2T C;  1HUM A;  2K33 A;  4H13 C;  1IYV A;  5DAU A;  2OXP A;  3OOC A;  3DMU A;  3NUC A;  4IFD I;  3KF8 A;  1QCB D;  2MUY A;  1A2U A;  2XWJ B;  1CM9 A;  2F4I A;  1EEI D;  3NE5 B;  1QOH A;  5CV6 A;  3FEW X;  3D6W A;  2F0F A;  2F0G A;  5M3M B;  2EY1 A;  3H0G B;  1F9S A;  4J6H A;  3V96 A;  3S1Q B;  5C4J B;  4ID6 A;  4OO1 I;  2O5I C;  1CFM A;  3C3L A;  4DN4 M;  2E2D C;  3EFX D;  3IL8 A;  2NBF A;  2EOT A;  1AP0 A;  4XQN A;  1BNZ A;  4C3H B;  3PUX A;  4EVO A;  4FF2 A;  4IFD H;  5C3E B;  4FVM A;  4PNY A;  1XX8 A;  1G6Z A;  1WD0 A;  5G3L F;  1WTR A;  2MHV A;  5TSS A;  2KED A;  4RGN A;  1CTM A;  3K57 A;  4DXG A;  1S4Z A;  3PUW A;  4DAV A;  4HCE A;  3DWP A;  1JCK B;  1JOR A;  1RKN A;  1GOZ A;  3R2T A;  1O78 A;  1UNS A;  1HA6 A;  2DY8 A;  1FNW A;  2PCF B;  3OHX C;  4AYB B;  4X3U A;  4XT1 B;  1FNV A;  2X69 A;  4OO1 H;  3H91 A;  3IFT A;  1PRT D;  5JEA H;  1EFI D;  3NTH A;  1PTO B;  5EKL A;  4DFA A;  1H9M A;  5KND A;  4A3G B;  2VB3 X;  4KMU C;  1C4Q A;  4HR7 B;  1EEF D;  5K5P A;  3K59 A;  1WD1 A;  3BS1 A;  3GD7 A;  4DGZ A;  3CRL C;  1O80 A;  3S2D B;  3JAM E;  1JE4 A;  4K14 A;  1PTO F;  1G8Z D;  4RA8 A;  3M4Y A;  2BA1 A;  2F0T A;  1V1P A;  1ONL A;  3RD4 A;  1Q1B A;  1VMC A;  4G7Z C;  1DJR D;  3MZ5 A;  2VNU D;  4LJZ C;  2EY2 A;  1CK1 A;  1R4Q B;  3BG3 A;  3T51 B;  4DNT B;  2WB1 B;  3ND8 A;  1U4M A;  4M1U B;  3VR6 A;  1IHZ A;  2RKS A;  1A3U A;  4RHR A;  1TY0 A;  3P7J A;  2Q8T A;  2AQ2 B;  1B9N A;  1R4P B;  1SYF A;  1TY2 A;  2AWN A;  3H6M A;  2F0U A;  3VR3 A;  2F0E A;  3QB3 A;  3Q22 A;  5E4W C;  3AU7 A;  3NTI A;  1DZ1 A;  4BY7 B;  4E6I A;  4KV6 A;  3SXH A;  1FR3 A;  5FLX L;  2K5Q A;  2O2L D;  2N88 A;  3I73 A;  3MXU A;  2E2I B;  2LMC B;  4ZKB B;  4RGM A;  1WTQ A;  2E76 C;  2HCC A;  2I46 A;  4KD4 A;  5KEE A;  4XIG S;  1BCP C;  2K28 A;  2KOL A;  1HCZ A;  2AUK A;  2OF1 A;  4K8I A;  5CV8 A;  3RZO B;  1TVX A;  2HUG A;  1EY9 A;  3K58 A;  4LMQ D;  4C3J G;  4S3S A;  5DNF A;  1SNO A;  3VYU A;  2EZV A;  1SYD A;  1EYA A;  3WOF A;  1EU4 A;  4L63 B;  2F1M A;  1EWC A;  4JBW A;  1STE A;  1RHP A;  3M7N A;  2F0P A;  3IFD A;  4IUU A;  5D3D A;  5IGG A;  4EQN A;  1NR2 A;  1YNN C;  2B2W C;  3K5M A;  2X6L A;  2K5D A;  1EIH A;  1F2Y A;  3E6Z X;  2AWO A;  1I4P A;  4XT3 B;  2IJ0 A;  2A6E C;  2QDB A;  2VUM B;  1K8O A;  5K36 G;  1E2V A;  1H9S A;  3T4A C;  1B3A A;  1KDA A;  4WJW A;  1SSO A;  2EPB A;  3L7Z C;  2G9D A;  1WTO A;  5C44 B;  1OXS C;  1D1K A;  3O13 A;  3URY A;  3KBX A;  3HZX A;  5C0X J;  2ZXR A;  3NWS A;  5IGC A;  3NHH A;  3VA7 A;  4QF4 A;  3HOV B;  2RSO A;  3S1M B;  5JPM C;  3MXG A;  3J7A V;  3L3O C;  3PIO 3;  2NN6 G;  2L9H A;  2AQ1 B;  3GTP B;  3D3R A;  2RQX A;  1PLF A;  3BDO A;  4KI0 A;  4Y7N B;  5EBD A;  3SVM A;  2M00 A;  1LTR D;  5FO7 B;  5IIF A;  1BCP D;  5I4D A;  4KY7 A;  1KAA A;  4QCL A;  3W2D A;  3P75 A;  2IPK D;  1VF5 C;  2Y0S B;  4ZUI A;  4DU9 A;  1LV9 A;  1EOT A;  5EKK A;  4DF7 A;  1ZXT A;  1X32 A;  2Z4H A;  1KLU D;  1NAP A;  2NWG A;  4M8A A;  2HCI A;  4C3J B;  1D5X C;  5FKA C;  5E3F A;  1B4O A;  1M8A A;  4J1M A;  1GHJ A;  4PMW A;  5LL6 X;  2MGS A;  2PZW A;  1BUV T;  1EZ6 A;  1ET9 A;  1ESF A;  4XQJ A;  3D4D A;  2F03 A;  2RVL A;  3DEO A;  5CYU A;  5I6W A;  2DY7 A;  3TZU A;  4B9X A;  5CV9 A;  5D3I B;  3HEJ A;  1S5B D;  4IAL A;  1F77 A;  3FVQ A;  4ZK9 B;  4WFN 3;  5NUC A;  1II3 A;  2LKV A;  1YNN D;  3GTM B;  5C0X I;  4A3I B;  4C3I G;  2JA5 B;  2MPM A;  4EQP A;  2R92 B;  4K2K A;  1QWY A;  2A6E D;  1SDF A;  1NSN S;  4Q0F A;  3Q24 A;  3GQB A;  1HFG A;  1IYU A;  2SDF A;  1OXU A;  3NBI A;  4PQX A;  1STB A;  3M3Y B;  1ZKO A;  4XXE A;  1PRT B;  4KK7 A;  4C3H G;  2RDG A;  2A5H A;  5KIX A;  1GHK A;  1V8Q A;  2C9O A;  5JAV A;  1U9R A;  1W6J A;  1NCV A;  3J80 E;  3U9S A;  3ND9 A;  4HMI A;  1FYC A;  2XVS A;  1TWF B;  3BDC A;  5C0X H;  3NQI A;  3OMG A;  3OMC A;  4KD3 A;  3NPP A;  4EQO A;  2FFK B;  3VR2 A;  3T16 A;  4A3M B;  2V4D A;  4RCO A;  2B2Y A;  5JOB A;  3K7A B;  5D65 A;  1F2M A;  1EY5 A;  1XWE A;  3I4L A;  3LWU A;  2PPB C;  2CQA A;  2EYO A;  5KNB A;  1G2T A;  1RD9 D;  1QNK A;  4FF3 A;  2HDM A;  2JYO A;  3PO3 B;  2DN8 A;  2A74 C;  1CI3 M;  5CGK A;  4TKO B;  1I4Q A;  2KJX A;  4FP5 D;  4PMB A;  2O4X A;  4ABN A;  1EYC A;  5DM7 3;  3A55 A;  3IAY A;  4CJ0 B;  1MD2 D;  2BOS A;  3HOU B;  3OW7 A;  3X3N A;  3QJY A;  1CQF A;  1HTP A;  2IX3 A;  1A15 A;  3OIP A;  1J9O A;  1JOO A;  1EY4 A;  5J22 A;  3D4R A;  4A3J B;  1SMY C;  1IW7 C;  2L11 A;  4WRD A;  1PFB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...