4DV2L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv2L00
4HIKA 4LUOA 4GNXB 4YHHL 2VUMH 1OXVA 4JI0L 4UP9A 4JG2A 1AH9A 2CQOA 1XTDA 2WAQG 4OO1G 3Q8DA 2E2JH 3I2ZA 4GLXA 3S2HH 4B3TL 4HJAA 4WJ3M 3H3VH 3I4NH 2BA0A 5M3MG 3T1YL 3HOYG 4A3EH 2R6GA 2OCEA 2JA7H 1PA6A 2UU9L 4LNQA 3M9BA 1EOVA 1X55A 5FJ8G 4PZ6A 2K5HA 1TWAH 5FLXc 4A3DG 3PO2G 3S1MH 3KJPA 4DV2L 1KC8C 1PH9A 1Y14B 2DGYA 2HIXA 3H15A 2ZJRA 4GKJQ 1IBLL 3HFZB 5E7NA 1IYJB 1YBYA 4IPGA 3W5OA 1VQMA 3GTPH 4LF4L 3KFUA 1VQPA 1PVOA 5GROA 1VQ9A 5JEAJ 2VQEQ 2QA4A 3BZCA 1NY4A 4HIDA 4UPAA 4A3KH 3NENA 3RN5A 3K0XA 3I7FA 4JCVE 4DAYB 3ERSX 3S2DH 3CXCA 4AQYQ 2GN5A 4OX9L 3F2DA 4NXML 3A5ZB 1HZAA 5HY6A 3HOWH 3FKIG 4JI2Q 4LF5Q 5LMNL 1I94L 2ZJQA 3M4PA 2R7ZH 3NEMA 2LSSA 2K5NA 4J15A 5IP7G 4DV4Q 2YTVA 1PFSA 3I4OA 1VQ5A 1N36Q 4AIMA 2R7DA 1KRSA 4GN3B 3CCLA 1YVCA 5EAYA 4R4QA 4DR3Q 5C4XH 1G6PA 4BBSG 4JI6L 3AQQA 2RHQB 2RCNA 1XPUA 2OTLA 4H02A 4YCUA 3H0GH 4POFA 1K8GA 3HOZG 1KD1C 2EIFA 5IYDH 1CSPA 2Q2HA 1VQOA 1OXUA 4A3FG 4A3GH 3RN2A 1IBKL 1CUKA 2ZTDA 1GVPA 1VS0A 1X54A 1N33Q 2WFWA 4GOPB 2E2IH 2I5MX 4LF8Q 1U0LA 4X6AH 5JEAG 4LFBL 4B3RQ 1MIUA 3KF8B 4JI5L 5M3FG 3KYHC 4X65L 1NMFA 4JI3Q 5C0XG 4QJFA 2AHOB 3K8AA 2KHIA 4KHPQ 5K36G 1XJVA 1C7YA 2Y0SG 4B3ML 1E3PA 1FVIA 3B6YA 3W1BA 4JI4L 2R92G 4NXNQ 1NE3A 1HJPA 5GAHC 4DKAC 3PUVA 4YWKA 1CKMA 4A76A 4IPDA 2IHEA 5FJ8H 4EX5A 4A3DH 3L0OA 2NZHA 4MTNA 4IOCA 4LFAQ 1QVGA 2L15A 4APVA 1TWFH 3CCUA 3PO2H 4NPSA 4P74A 4GKKL 4Y7NH 1SR3A 1JJ2A 1HR0W 1P16A 1ASYA 5JJLA 2ASBA 1JT8A 1VQDA 1XMOL 4DV7L 1QVFA 1N9WA 1HNXL 1I6HH 4TQUS 1E22A 2N3SA 1E1OA 1XNQL 4OO1I 4BA1I 4GN4B 1A0IA 4P71A 1PH4A 3D0FA 4DR4Q 1N34L 1HNZQ 5C3EG 1SROA 5DLQE 1YHBA 3KLWA 4DR5L 3FKIH 1UWVA 3BU2A 2Z0SA 3BZKA 1XNRL 1EYGA 5IP7H 4LF5L 4IFDG 5GAEC 3GTKH 2HHHQ 1YZ6A 3GTMH 2NN6G 4BY1G 1WOCA 1UEBA 1TWHH 5M5WH 1SMXA 4IPCA 2I5LX 5JJKA 1QZGA 4LUVA 4BBSH 1T9HA 2HQLA 2UXBQ 2UXDL 4R4IA 1S72A 4DR7Q 2VL6A 4BBRH 3CCEA 3HOZH 1XPOA 4GS3A 3OTOQ 3J81j 3K7AH 3M7NA 4HIMA 1WYDA 1A62A 2FXQA 3UDGA 2H5XA 4A3FH 2MFIA 1PH1A 4JBJA 1CKOA 1VQGA 2JK8A 1E7ZA 1VQEA 4HIOA 5IY0A 1TWCH 4DV1Q 3CCVA 2C35B 2BH8A 3G48A 4HJ9A 1LTLA 5M3FH 4OONA 3H0GG 3F1ZA 3U4VA 1XMQQ 2Z6KC 4X64L 4QL5A 4R4OA 5H1SE 2VQEL 1X3FA 3UDIA 3AEVA 4JV5L 3VDYA 2R92H 4IOAA 1K83H 1WFQA 1VQCA 2UUAL 4HJ5A 3PV0A 2YV5A 4A75A 1X3GA 2CFMA 3RLFA 1PH2A 2K75A 1K0RA 4DNIA 1WCMG 1G51A 4JI2L 4A3BG 4K0KQ 5JJIA 1PYBA 3PCOB 1KAWA 5LMNW 1IBMQ 2WB1G 4DR1Q 4QGUA 4IO9A 1L2FA 2B3GA 3J81c 1KXLA 3BJUA 4LW1A 2Q2IA 3CPWA 4KI0A 3S1QH 1B7YB 2V1CC 2MNAA 1BBUA 1LM0A 4X66Q 3WWVA 4DR3L 3G4SA 4IJHA 4A93G 2E8GA 5C3EH 1PYSB 3CCRA 3S1RH 4DK3C 1PH5A 2VNUD 2I5HA 1M1KC 1PH3A 1HZBA 1ASZA 2F4VQ 1EFWA 5IYCG 5C0XJ 1X56A 1PV4A 4XTCS 1VCIA 1HR0Q 4BY1H 4X62Q 2B63G 4B3RL 3H3VI 1FGUA 3A0JA 1Y1WG 1W3SA 2CWAA 5C4JH 4ALPA 1EWIA 4JI3L 2VZAA 1E24A 4DV0Q 4HJ8A 2N49A 3J81i 3NELA 3PIPA 1KL9A 4P75A 1IL2A 4BY7G 2JA8G 4KHPL 2AMCB 5M5XH 4DV3L 5ELNA 1MJEA 4JBWA 3HKZG 4LF6Q 1K3RA 4POGA 4DV5Q 4NXNL 1VQAA 1SFOH 1HZ9A 2RHSB 3CC2A 3CD6A 1D8LA 2JA5G 4LFAL 3M4QA 1IZ6A 5LMUQ 5AJ3Q 4A3JG 1GKHA 1Q8KA 2BA1A 4DR2L 4AYBE 4BBRG 5IWAQ 2XTIA 4DAMA 1M90C 1G291 4C3JH 1N32Q 4QY7A 4PZ7A 1SN8A 1AE2A 1Q1EA 4YCWA 2F3IA 3OYYA 3J7ZC 2VW9A 1GO3E 2Q2TA 4HJ7A 4JI7L 1YNXA 3LGJA 3S16H 2MO0A 1J5EQ 2IX1A 1HNZL 2CWPA 1Q12A 1V43A 4TVAB 4IFDJ 1TWGH 3PUZA 1HZCA 3S15H 4JI1Q 1QUQA 1S40A 1WCMH 2CCZA 4A3BH 3TREA 5IE8A 4DR6Q 2IT1A 1Y1VG 2CKZB 3M3YH 3KOJA 1Q82C 3S17H 2MO1A 4DV2Q 2UUCL 4B3SL 4OWWB 1TXYA 3KF6B 2HHHL 1Q86C 4BXXG 5GADC 4AH6A 4LFCQ 1NMGA 2YYZA 2R93H 3HOVG 1OXXK 2JA6H 3CF5A 3KDFB 1HNWQ 4JI8Q 5BR8L 2A19A 2UXBL 4A93H 2ID0A 3OTOL 4JYAQ 3KF6A 3J80c 3OW2A 1OXSC 2UXCQ 4OX9Q 4OWXB 2A1AA 1EIFA 2QGQA 3EBEA 5LMNQ 3KDFA 2PI2E 5IYCH 1C0AA 4DV1L 1QZHA 1VQJA 1YJWA 4A3MG 2B63H 1DGSA 3I4MG 3G6EA 1Y1WH 1XMQL 4A4IA 4LF9Q 1E1TA 3PO3G 1FJGL 4DUYL 2OQ0A 1WI5A 4BY7H 1V9PA 2D0PA 1L0WA 2OTJA 2UUBQ 2AKWB 2JA8H 4DUZL 3E9HA 4JC0A 3GDEA 4Y52H 3U50C 1EQRA 2LXJA 4R4TA 4FDBA 3G71A 3GTLH 4DPGA 2ZTEA 4A3CG 3STBC 3A74A 1P8LA 2R7FA 1VQLA 2RF4A 3PF4A 1KQSA 4L5SA 1B8AA 2DUDA 3K7UC 4K0KL 2JA5H 1SE8A 4L5QA 4A3JH 2WAQE 4NB3A 4L5RC 1IBML 1UE6A 2Z6KA 3J80i 1EIYB 4KLKA 2JE6I 1JMCA 3RZOH 2WP8J 2JEBI 1YI2A 3MXNB 3T1HQ 3UDXA 3CMAA 2KBNA 4GLAC 2JEAI 2JJQA 4X66L 3ZJYC 2NVYH 4GKJL 4YY3Q 3D31A 4XIGS 1Z9FA 4B3MQ 1SRUA 4DK6C 3J7A5 1QVCA 2NZOA 1VQ7A 1YJNA 1JJCB 1I5FA 2E5LQ 5GAGC 1PH6A 1Y1VH 4P73A 3JC66 1Q7YC 1GD7A 4R1JA 2K4KA 4UP7A 4GKKQ 1NBWA 4A3LH 3TQYA 2KCMA 1HR0L 2ES2A 1KHIA 2GVBA 2YTXA 4AQYL 4BXXH 3S24A 1K8AC 2JA9A 2PQAB 3HOVH 4A3IH 3JAMc 2PMZE 1MJCA 1WJJA 5IP9G 5FLMH 2YU9H 3GTGH 3KJOA 2PNHA 4DV4L 1YJ9A 1PHJA 1W2BA 4LF6L 4PZ8A 4DV5L 3RNUA 1N36L 4YCVA 1X6OA 2PQAA 1VQIA 3MEFA 3NBHB 4DR5Q 2K52A 3L7ZC 2R93G 3AFPA 2JA6G 4KHZA 2XGTA 5AJ3L 5IYBG 5C0XI 4A3MH 3I4MH 3RLOA 1B70B 5IWAL 4ME3A 1N32L 4DV6Q 3PO3H 4MNOA 3ULLA 2VQFQ 1K73C 1Q81C 1PH8A 4IPHA 2AWOA 3HOXG 1J5EL 4LF7Q 2UXDQ 1N33L 2MQHA 4A3CH 4LF8L 1CKNB 3U4ZA 3UDFA 3UE1A 1X9NA 4GNXA 4YWMA 3JAMi 1XPRA 4JI1L 3HKSA 4JBMA 4DR6L 2HT1A 2PI2A 1KRTA 2K14A 4C3HH 3GTQH 3L2PA 1Q1BA 3AYHB 4LWCA 1R9TH 2OWOA 1VQ6A 4PMWA 1CKNA 2ZM6Q 3K81C 2ATWA 3TRZA 2VY3A 4LFCL 4X64Q 4R4CA 1AE3A 2Y0SE 4OXPA 3RLNA 4GNXC 4GN5A 1HNWL 2KHJA 2N8NA 3GD7A 4JI8L 4JV5Q 2ALYB 2NVTH 4BA2I 1VQBA 1UE7A 3SGIA 4JYAL 4JBKA 4YHHQ 3CCJA 2UUAQ 2NVQH 3CW2C 4JI0Q 4IFDI 1QUQB 1IXRA 1BBWA 3HOUG 1OXTA 5GQOA 3F2BA 4QQBX 2UXCL 4PG3A 2NN6I 1L1OB 5HGQA 1X65A 4RMFA 4B3TQ 1JB7A 4OWTB 3GTJH 4UY8C 2IY5B 1H95A 4DR4L 5J3BA 2OQKA 3T1YQ 5C44G 2UU9Q 4LF9L 1CSQA 1L1OA 5IP9H 2UUBL 2HIVA 3PIOA 3CCMA 2D0OA 1OTCA 4A3LG 1IBLQ 2E2HH 4WJ4A 4IJLA 1KIXA 1A63A 1UE5A 2F52A 2VS1A 2JQOA 4LF4Q 1J6QA 4A3IG 3E0EA 2KENA 5IYBH 1VQFA 1UE1A 5FLMG 4DR7L 4QIWE 3U58A 1FL0A 1L1OC 1MKHA 3FHWA 3ULJA 4O0AA 2YTYA 3M4OH 3M85A 3T1HL 1YIJA 3W1GA 1JE5A 4NXMQ 1EUJA 1I3QH 4MZ9A 3I55A 3TS2A 3HOXH 2Q2UA 3PUXA 1YITA 1I94Q 3ICEA 4YY3L 1Z47A 1K9MC 4UP8A 1A8VA 3EIVA 5M3MH 1X3EA 5M5YH 3DLLA 4DV3Q 2ZJPA 3HOYH 4GOPA 1RL2A 2K50A 3I56A 2VUMG 4GLVB 3RZDH 3CMEA 2EQSA 2E5LL 1PH7A 2ZTCA 3TS0A 2GVAA 3PUYA 3F2CA 1YHQA 4AYBG 2I0QA 3CQZH 2BH2A 4JOIA 4JI6Q 3K80C 3F8TA 3CCQA 1VQHA 1NJIC 5ELOA 3IRBA 4DR2Q 3I4NG 2N78A 4A3EG 1VQ4A 2JA7G 3ULPA 1BVSA 2K5VA 4GOPC 2EXDA 2LXKA 4JI7Q 1IBKQ 1VQ8A 2IHFA 4EQ5A 4DR1L 3CAMA 2AWNA 1RIPA 1JJGA 1VQNA 2D62A 4RG1A 1I50H 4JOIC 2WB1E 4LFBQ 3HOUH 4JI5Q 3DM3A 3CPFA 4P72A 4X65Q 3GTOH 3ER0A 4YWLA 1YEZA 3RR5A 3EN2A 4A3KG 3FP9A 2UUCQ 1BKBA 4B3SQ 5C44H 4JI4Q 4LUZA 4C3IH 4DV6L 1D7QA 2F4VL 1LYLA 3TEHB 4C2MH 2VQFL 3E9IA 3STBD 1VQKA 3HOWG 3PF5A 1LUZA 1S3OA 5BR8Q 4LF7L 2A8VA 1HH2P 3CCSA 1Q46A 2R7ZG 2IX0A 4X62L 3S14H 1SLJA 3PGZA 3PUWA 5IT9c 3A5UA 1XMOQ 4DV7Q 4DV0L 1YHAA 1U5KA 1HNXQ 3AFQA 3PSIA 1XNQQ 1NTGA 3UE0A 5C4XG 3CC7A 1O7IA 1N34Q 1EQQA 2ZM6L 3GO5A 1C9OA 5IYDG 2B29A 1FJGQ 3HKZE 4DUYQ 2NVXH 1V1QA 4L5TA 2QEXA 4O2DA 1GM5A 4A3GG 5LMUL 3CP0A 4DUZQ 1N8RC 3CC4A 1XNRQ 2KCTA 3S1NH
chains in the Genus database with same CATH superfamily
1WTRA 2VUMH 1OXVA 4KN7C 5EQ0A 2LMCB 1QJOA 4OO1G 3Q8DA 1BF4A 4CDDC 3BG3A 4IQZA 3DWQA 1RD9D 5M3MG 1STBA 4ME5A 2OCEA 2JA7H 1PA6A 1IHZA 5EPLA 1X55A 5I6YA 4A3DG 4A3GB 3PO2G 1GUTA 3C46A 4QCLA 2DGYA 1IYJB 4RFBA 4IPGA 4ZAIA 1BR9A 5C3XA 1VQ9A 1D2BA 5JEAJ 1NY4A 4HAEA 1SMYC 3NENA 1YNND 4JCVE 4DAYB 3JAML 3S2DH 4KD3A 2FMCA 4AQYQ 2GN5A 5HY6A 5LMNL 3NWSA 3X3NA 3K5MA 3NEMA 1DJRD 5IP7G 1PFSA 3I4OA 3VYUA 4C3IG 2IJ0A 2EJFC 5DEHA 2AQ1B 4DAPA 4JI6L 3K5NA 2RCNA 1G8ZD 3LWEA 3DWAA 3H0GH 4YCUA 3TP8A 1GVPA 2X6LA 1VS0A 1NR4A 1YNJC 3BDOA 2RSOA 4LFBL 1MIUA 3GTMB 1NMFA 4JI3Q 4KK7A 4KJNA 5C0XG 5K36G 4KHPQ 2AQ2B 2ZXPA 1E3PA 1FVIA 3B6YA 4JI4L 1HJPA 1AP0A 5GAHC 4A76A 2IHEA 5FJ8H 3TMEA 2O2LD 2HDMA 3CCUA 4P74A 4GKKL 1ONLA 1SR3A 1HR0W 3R3OA 1HA6A 1BCPD 1P16A 2HCCA 5JJLA 5M3FB 2N3SA 2NVXB 4OO1I 4BA1I 4L63B 5FK9C 1FD7D 3D0FA 1N34L 1HNZQ 3MA2B 1SROA 2QDLA 5EBDA 3MC0B 3SK8A 2Z0SA 1D1KA 3BZKA 2PZWA 3LX0A 4Z9CB 5GAEC 2HHHQ 1MGSA 3OSOA 4BS9A 1YZ6A 2NN6G 2A73B 1BBXC 4NKLA 4LUVA 2UXBQ 2UXDL 3SK6A 2VL6A 1PTOH 3HOZH 2F0FA 4GS3A 5ELDA 2MUYA 4JBJA 1PFBA 1E7ZA 5DM73 1TWCH 2ENBA 1TKWB 5IGCA 2BH8A 4JW0A 3H0GG 3F1ZA 2Z6KC 4C3JG 4R4OA 5H1SE 5CV7A 1X3FA 3W2DA 4RA8A 2R92H 4IOAA 2A68C 4A75A 1SFOB 2K33A 1WCMG 1ZYRC 3PCOB 2WB1G 3J81c 1TQOA 3BJUA 3D4DA 3Q6SA 1LT3D 1Z7TA 1NR2A 1BBUA 4DR3L 3I90A 4A93G 5C3EH 3K5OA 1ASZA 4S3SA 1B9MA 1Y69U 1T5EA 3H09A 5IYCG 4QUFA 4L8JA 3URYA 1G6ZA 1WTVA 1HR0Q 4ALPA 5I2YA 4DV0Q 1E24A 3L3OC 3NELA 1MJEA 4LF6Q 3HKZG 1NSNS 1RTNA 3J7YW 4POGA 4NXNL 1E2VA 4DAVA 2RHSB 2A6HC 3NTHA 3QOLA 5BN4A 5A2QE 5LMUQ 3HGBA 1Q8KA 1M90C 1SSOA 2XTIA 2N88A 2B63B 4MIUA 3CRLC 1Q1EA 3J7ZC 4IUVA 1GO3E 1YNXA 3LGJA 5KYLA 3S16H 1GUSA 3K6OA 2IX1A 2RDFA 4R9WA 1V43A 5FLXL 3PUZA 2F3VA 4JI1Q 5JVG3 3LNNA 5IE8A 2BE5C 3M3YH 3S17H 2F0LA 2UUCL 1C48A 2F0NA 3AB9A 3L9AX 1TXYA 3OW7A 4K6LA 4BBRB 3D4RA 1Q86C 4BXXG 1NMGA 3HOVG 3MFGA 1HNWQ 1CK1A 5E4WC 1WD0A 2PO4A 1SE3A 4JYAQ 1ENCA 4OX9Q 2FMMA 1EIFA 5M9OA 2QGQA 1Y1VB 3KDFA 1C0AA 5HURA 4DV1L 1YJWA 4A3MG 4RH6A 5EJWA 3G6EA 4BWGB 1Y1WH 5JJZA 3PO3G 3TZDA 2JA8H 1EQVA 3SHLA 4F88A 1EQRA 3GTGB 2CH4W 2YU9B 4A3CG 5C4ZA 4DPGA 2ZTEA 3A74A 2JA5H 5KEEA 2WAQE 4C3HG 4MHEA 1UE6A 3J80i 5KNCA 1IBML 2WP8J 2JEBI 3UDXA 2F4IA 1QG7A 4FXKC 4GLAC 2Q8IB 4X66L 4AYBB 4FNFA 1TU2B 4HCEA 1SRUA 4DK6C 5EGTA 1I5FA 4X3UA 3X3MA 2GA4B 1KNEA 4UP7A 1EY0A 1KHIA 2XNAC 2YTXA 4G4KA 4AQYL 2JA9A 1I4RA 4A3IH 4DF7A 1Z6HA 1LACA 1BO0A 3KJOA 2KCNA 2PNHA 1EEFD 1PHJA 1W2BA 2NVQB 4YCVA 3MXGA 4DR5Q 2K52A 2JXMB 2J7ZA 3P75A 2B2YC 2F1MA 3MXUA 3GTJB 1N32L 3OIPA 2F0HA 3KBXA 1XYIA 1K73C 4IPHA 4RHRA 3TZUA 4HTHA 3GV3A 1U4PA 2EYLA 2MQHA 2XRSD 2KCCA 3UDFA 2WINB 2PYKA 4U673 1ZXTA 2PW5A 4X3KA 1XPRA 3RD4A 4JBMA 3NQIA 4DR6L 2HT1A 2PI2A 1KRTA 2K14A 3GTQH 3ONAB 1Q1BA 3AYHB 4KMUC 4PMWA 2ZM6Q 2ATWA 3TRZA 2EY1A 1AE3A 1NNXA 4JVZA 4JI8L 2D2CC 5C6AA 3HOXB 2NVTH 1X3PA 1SMYD 3DM1A 2UUAQ 1I4XA 1EY9A 1OXTA 4QQBX 3C2PA 4PG3A 2NYZD 4RMFA 1JB7A 2Z8LA 3CQZB 2OQKA 3A54A 1MSHA 5JVH3 5J1ZA 5IP9H 2UUBL 3FMCA 1KABA 2M00A 1WTWA 5CYUA 4DFAA 3HZXA 2F52A 2JQOA 3HOUB 4ABNA 4A3IG 1BDOA 2KENA 3PIP3 1BCPC 1UE1A 1TS4A 1YNJD 4C3IB 1EUJA 4C2MB 2CVRA 1XTCD 1K9MC 1A8VA 3DLLA 3HOYH 1M8AA 3I56A 3CMEA 1EYDA 1L0XB 2L4NA 3VA5A 4F7XA 4QB4A 4J1MA 4DU9A 3F2CA 2AUKA 5HGTA 1A3UA 4JI6Q 2N78A 5KNDA 2EOTA 1EU3A 4JI7Q 4EQ5A 3CAMA 4K2LA 1RIPA 5JOBA 1A3VA 2F0JA 1VQNA 3S1NB 4LFBQ 1S5DD 2VUMB 3VA7A 3O13A 1W6JA 3ER0A 5JPMC 1BKBA 1CA5A 4B3SQ 4JI4Q 2F0UA 2QCPX 2JA7B 1B50A 1D7QA 2QILA 4KKSA 1JB3A 3E9IA 1PZID 1EIHA 3PF5A 1S3OA 4LF7L 5C5MA 1HH2P 3U9SA 3TP6A 3UI2A 4XYOA 2IX0A 4UAIA 4KY6A 1SLJA 3DWPA 4C1NK 4DV0L 1YHAA 1CTMA 2EDGA 5IODA 3OMCA 1PZKD 4KKUA 3J7AF 1N34Q 1VDZA 2B2UA 1CZWA 1C9OA 4YIJA 5IYDG 3S2DB 3J80E 2B29A 1JWMD 4DUYQ 5LMUL 1N8RC 3A55A 4HIKA 5E3FA 3QWNA 4GNXB 4YHHL 2OT2A 4JI0L 4UP9A 4JG2A 1BQQT 2CQOA 2PCFB 2K05A 2B2UC 3RUZA 3OWFA 3H3VH 3I4NH 2BA0A 1HQMC 3T56B 5IGEA 4MTKA 3HOYG 4A3EH 2QW7A 1VMPA 3H0GB 4LNQA 2JYOA 1LT6D 2F0PA 4N9TA 3KJPA 2JSOA 2HIXA 3HFZB 1W6KA 2WAQB 5GROA 3SE0A 3T53B 4UPAA 4A3KH 1F9SA 4OIKA 1O78A 2NTSA 1LLRD 3N6RA 4OX9L 3HOWH 3FKIG 2ZJQA 3M4PA 2R7ZH 1R4QB 3BDLA 4DV4Q 2F0EA 5EKIA 1VQ5A 4UDUC 1UUPA 2AQ3B 1AW7A 2EJGC 3CCLA 4R4QA 4DR3Q 5C4XH 5AFWA 4BBSG 3SK5A 2E74C 4M1UB 1A3TA 4H02A 2DNEA 2EIFA 2PPBC 2Q2HA 2EXZA 4A3FG 2Z6BA 1CI3M 1CUKA 1PXUA 1QE6A 3SEBA 3C3LA 1PMRA 3TSSA 2O5JC 1X54A 4CJ2C 4KD4A 4GOPB 4RGTA 2I5MX 2E2IH 4LF8Q 1U0LA 4OIJA 3KF8B 3KYHC 4X65L 2RKSA 3K8AA 2KHIA 1SE4A 1PTOB 3HOZB 4NXNQ 2H4OA 2EPBA 3PUVA 4A3DH 3PO2H 4MTNA 1TWFH 2VXWA 4J6HA 1SEBD 3RMHA 5FLXE 1TWCB 5I9OA 1VQDA 1DM0B 2RCFA 3IL8A 1FYCA 1A0IA 5I4DA 1PH4A 2ICIA 2R92B 2XVSA 5DLQE 1YHBA 4RCOA 3KLWA 4DR5L 2NUCA 1UWVA 2PZTA 3QR8A 2BCOA 5T1IA 4HEDA 1XNRL 5IP7H 4OL7A 3CHBD 3GTKH 2FFKB 2X69A 4BY1G 1U4RA 1UEBA 5M5WH 1SMXA 2I5LX 4KTAA 1HFNA 1E0BA 1JR0D 1QZGA 3KLRA 2NBFA 4R4IA 2ICEC 3EROA 5C3EB 3BS1A 3K7AH 2JK8A 2B2VA 2L9HA 4HIOA 1VF7A 4DV1Q 1PTOD 1F9RA 1LTLA 4H0LC 3R8BA 5C0XH 2E2DC 3EJIA 2KUMA 5K36H 1TVXA 2UUAL 1QCBD 2B2VC 2EVBA 4HJ5A 3HRZC 1ILPA 1FNVA 4ID6A 1PH2A 4A3BG 2LS01 4JI2L 1PYBA 1KAWA 1IBMQ 4DR1Q 1KXLA 1EZ8A 2Q2IA 3S1QH 1B7YB 2V1CC 1WVLA 2MNAA 4X66Q 1LTAD 3S16B 5I6WA 3DHQA 4KJOA 1V1PB 4K14A 1HZBA 1F9QA 1EY7A 1EFWA 3M3YB 3E5SA 3S17B 2NN6H 1JWSD 3HS0C 3H3VI 2CWAA 4HJ8A 2VZAA 2N49A 4BY7G 3PIPA 1KL9A 1XX8A 2AMCB 1MD2D 5M5XH 2LFNA 1HZ9A 4FF1A 1H9RA 3CD6A 1D8LA 1A6XA 4LFAL 4A3JG 2EY6A 4AYBE 4DAMA 4C3JH 1N32Q 4QY7A 4PZ7A 1SN8A 1Y1WB 3DUZA 2VW9A 3OYYA 2Q2TA 3T4AC 1LTGD 4HJ7A 4JI7L 3HP3A 2JA8B 4HSVA 1E2ZA 2CWPA 4TVAB 4IFDJ 1IYUA 1TWGH 3S15H 2CCZA 1WCMH 4DR6Q 2K01A 2IT1A 2CKZB 2JA5B 4B3SL 1DYQA 3KF6B 4OHJA 4AH6A 5CV6A 1OXXK 3CF5A 4JI8Q 5CC4A 2A19A 1DOKA 4A93H 3MVVA 1D6EC 1Y8NB 3J80c 1OXSC 1K8OA 3NWTA 1GUGA 1HFGA 3V96A 5IYCH 2PZUA 2EYOA 1QZHA 1JWUD 4XT3B 3I4MG 1KAAA 1XMQL 4NDXA 1ML0D 1E1TA 5EPKA 4DUYL 1WI5A 2D0PA 1L0WA 4A3IB 2UUBQ 2F0GA 3E9HA 3U50C 2LXJA 4FDBA 2VB2X 3GTLH 5IGDA 1P8LA 2NZ1D 3NUCA 3TP7A 3K0YA 4K0KL 3QIAA 4L5QA 4XQNA 4NB3A 2Z6KA 2QEJC 5LHY1 2MJ8A 1JMCA 1YI2A 3MXNB 1SNPA 2KBNA 2NVYH 3I8ZA 3D31A 4XIGS 1Z9FA 3J7A5 1QVCA 3T13A 2NZOA 1VQ7A 2HCIA 4ZKCB 5C4JB 2SNMA 3P20A 3GTQB 2K4KA 1LT5D 1KTKA 2KCMA 3GP7A 1WTOA 4BXXH 1ZKOA 1K8AC 2PQAB 3HOVH 3EFXD 3K57A 1MJCA 1WJJA 1BXTA 5FLMH 2NVTB 4DV4L 3EA6A 2G9DA 4DV5L 3MEHA 3CKIB 3OHXC 1O7LA 3L7ZC 3AFPA 4WJWA 2EJMA 4KHZA 1B3AA 5AJ3L 5C0XI 4A3MH 1L0YB 3PO3H 1EY5A 5FOBB 1D5XC 3Q0AA 4ZRZA 1Q81C 1LO5D 5IT9L 1J5EL 4LF7Q 2NB0A 4A3CH 2KOLA 4PV1C 2K5WA 1HCZA 4LF8L 4FF3A 4GNXA 2OF1A 3JAMi 4K6DA 1SNOA 3HKSA 4I65A 2XSCA 4C3HH 1R9TH 2OWOA 5IGFA 4FP5D 1CKNA 2VY3A 4LFCL 4X64Q 4OXPA 2IX3A 4RKBA 4GNXC 1B3QA 2KHJA 2N8NA 3DXJC 2ALYB 4BA2I 4LAAA 1UE7A 2F0OA 2TMPA 4JBKA 4YHHQ 3HOYB 4JI0Q 1BBWA 5GQOA 3J81L 2NN6I 1L1OB 5HGQA 3AU7A 3OOCA 4UY8C 2IY5B 2SOBA 5J3BA 5C44G 3MXPA 5C5LA 2FHTA 3FPUB 1HUMA 4CJ0B 2PW7A 1B1ZA 2D0OA 4O1NA 1D5MC 1EYAA 2E2HH 2LKVA 2PMZB 5TSSA 5FLMG 3ULJA 2EY2A 1HUNA 3M85A 2K03A 1YIJA 1JE5A 4F87A 4LJZC 3OWEB 2KJXA 4CDCC 4OEMB 4EQOA 3D8GA 3ICEA 2DY8A 1ICFB 3EIVA 2KEEA 1X3EA 4NMZA 5M5YH 4GOPA 4DNRB 4PMCA 3P7JA 1STAA 3NXWA 4IURA 1PH7A 2E5LL 3TS0A 2GVAA 3QO2A 4ZLTF 1SJHD 2L11A 2I0QA 4KY7A 3CCQA 1VQHA 2MPMA 1NJIC 2A5HA 3ULPA 4H13C 3K5LA 1BVSA 2K5VA 5CV8A 4GOPC 1H9JA 4DR1L 1F2ZA 1BUVT 1I50H 2WB1E 4P72A 4X65Q 1WTPA 2F0SA 1PTOC 4YWLA 4GZYC 1IW7D 1YEZA 3EN2A 3DEOA 4PQXA 3I4NB 1JOKA 4A3EB 5CGKA 3TEHB 2VQFL 2R61A 3STBD 3WOEA 2A8VA 2L5TA 3A8IE 1Q46A 3QB3A 3QOJA 2RDHA 2DN8A 3A5UA 4EQPA 1X32A 2M9VA 2B2YA 1KLGD 1AZQA 4P2CB 2EYJA 1EY6A 1IYVA 3UE0A 4PNYA 4A3KB 1PFMA 3GO5A 2KECA 1B2TA 3HKZE 2NVXH 1V1QA 2C9OA 4QIWB 1ESRA 2QEXA 4O2DA 3HOWB 4A3GG 2B2TA 4ZKBB 4DUZQ 1XNRQ 2KCTA 1CKMA 2BOSA 2K5DA 2Z9HA 4LUOA 2R7ZB 1HTLD 3I2ZA 4Q0FA 4KHVA 3VR5A 4GLXA 3TP5A 2HD3A 5C4XB 3T1YL 2R6GA 2B2TC 3WOFA 4RAUC 2UU9L 4NW2A 5KIXA 1F9PA 2K5HA 4G7HC 4GKJQ 3A8JE 1Y14B 3H15A 5COYA 1RTOA 3Q24A 1HA5A 1IBLL 2E2IB 1YBYA 3W5OA 1VQMA 3GTPH 1VQPA 1PVOA 2QA4A 4FVMA 3BZCA 2O4XA 1MSGA 3I7FA 3D4WA 5EKLA 5M3MB 2XN9C 4NXML 2EZVA 3A5ZB 4JI2Q 4N9PA 4A3DB 1Y8PB 3PO2B 1TWFB 2LSSA 4J15A 4DAYA 4G7ZC 1N36Q 1S4ZA 1PFNA 1KRSA 4QUCA 1YVCA 3JAME 2RHQB 2OTLA 1E2WA 2F03A 4ZCKA 5IYDH 1IL8A 1KD1C 1CSPA 1OXUA 3R2IA 3RN2A 3A56A 5G3LF 1FR3A 4K5XA 1N33Q 3T51B 1KNAA 5L37A 5JEAG 4TKOB 3GTKB 5M3FG 2F0TA 5M5WB 1NCVA 2Y0SG 2K1BA 3W1BA 3S14B 1PLFA 3K7AB 2KVMA 2XWJB 4IPDA 2B8GA 4EX5A 3L0OA 4LFAQ 4I7AA 2L15A 4Y7NH 1JJ2A 1JT8A 1D5ZC 1QVFA 1N9WA 1EIGA 1I6HH 3GV6A 3PIO3 4GN4B 1QWYA 3C1EA 4MN3A 4EGVA 3FEWX 5IOCA 1DONA 2I07B 3FKIH 4OELB 5E1FA 2M2LA 1C4QA 1SE2A 4HMJA 4LF5L 4IFDG 3U9OA 2OEOA 2Z4HA 4B9XA 1WOCA 3F2UA 1TWHH 3S1QB 4IPCA 5JJKA 4BBSH 4HR7B 4DR7Q 4BBRH 4R8IA 1XPOA 3M7NA 4HIMA 2FXQA 2H5XA 4IZ8A 4A3FH 2MFIA 1PH1A 1CKOA 1T5XD 1VQGA 2F0QA 5IY0A 3TBIB 2C35B 1PTOF 1XMQQ 2A69D 3MXNA 4X64L 4QL5A 5J22A 1SXTA 2VQEL 3AEVA 1O7ZA 3VDYA 1K83H 1WFQA 5M5XB 1VQCA 1B53A 3PV0A 2YV5A 1ENAA 4ZK9B 2CFMA 3RLFA 2K75A 1K0RA 5JJIA 4K0KQ 1WTQA 4QGUA 1TS3A 1L2FA 4DNTB 4X3TA 1M4VA 4KI0A 4C3JB 1FGBD 2EE1A 5ELBA 1LM0A 3WWVA 4IJHA 2R3ZA 2E8GA 1BNZA 4K5WA 1ET9A 3WDNA 3CCRA 3S1RH 4KV6A 1UEAB 4DK3C 3NTIA 2I5HA 2F4VQ 1TWGB 1PH3A 3S15B 2CHBD 1TIID 1WCMB 2WIIB 3ND8A 2WB1B 1PV4A 1A2TA 1VCIA 5A2QL 4BY1H 1K3BC 2F0MA 2B63G 4B3RL 1FGUA 1W3SA 5KRUA 2MGSA 4K8JA 4P75A 5KYIA 4A93B 5A35A 4DV5Q 1VQAA 3CC2A 1EL0A 5IT9E 4ILWA 3M4QA 5AJ3Q 5DNFA 1STEA 1GKHA 2BA1A 4BBRG 3TDQA 1AE2A 1FNUA 4YCWA 3KK7A 2MO0A 1J5EQ 5G3LD 3E6ZX 3VYRA 3HKZB 3GTLB 1HZCA 4A3BH 3SDZA 1Y1VG 2MO1A 4DV2Q 1HHVA 2L0CA 5GADC 4LFCQ 1GUWA 2HDLA 2R93H 1NAPA 2JA6H 4RWSC 3KDFB 2TSSA 3VYSA 3VR4A 2ID0A 3DMUA 3MHBA 3OTOL 2F3WA 2NTTA 1KLUD 4FO2A 3H91A 5D65A 2A1AA 4PMBA 2B39A 1DGSA 4A4IA 2J4XA 1IW7C 4FF4A 2OQ0A 3HOVB 4BY7H 1V9PA 1ENFA 1SYDA 4DUZL 4JC0A 4Q5VA 3GDEA 3G71A 2G5DA 1IKLA 1EWHA 3STBC 5CMDA 5IIFA 2R7FA 3PF4A 2B8FA 3K7UC 4A3JH 1PRTB 5I2XA 3KBGA 1EIYB 3QJYA 4KLKA 3RZOH 3QG1A 4UHVA 4A3MB 3BYTB 2KHSA 3C1FA 4HMIA 3PO3B 3I3CA 5FO8B 3CMAA 2JJQA 4JPBW 3ZJYC 4GKJL 1H9SB 1K0SA 4HSPA 4B3MQ 2EYMA 2K6AA 3NQTA 1JJCB 2E5LQ 1PH6A 3JC66 4C3HB 1GD7A 4CDFC 1EY4A 4RKLA 1NBWA 2D5DA 1R9TB 3TQYA 2ES2A 1HRJA 2GVBA 4LK1C 4WFN3 1TY2A 2SEBD 3JAMc 2PMZE 1DD2A 2IPKD 4R8NA 4PZ8A 2K32A 3T16A 3RNUA 1N36L 1X6OA 2R93G 3KUPA 3NBHB 1S5CD 2JA6G 3LWUA 3A8KE 1XWEA 5CBEE 5IYBG 4XT1B 3J7AV 3I4MH 3RLOA 5IWAL 4ME3A 4H7BA 4MNOA 3E0JA 2BDNA 2VQFQ 4G57A 1PH8A 4LMQD 1PRTD 2A6ED 3BVZA 3HOXG 3VYTA 1N33L 3VR3A 2K28A 5LL6X 3U4ZA 1SNCA 5ELFA 2E2HB 4YWMA 1HQRD 4J8QA 5ELCA 1J8IA 1K28A 1ILQA 4R4CA 3NBIA 3RLNA 5IGBA 4GN5A 4JV5Q 1VQBA 3SGIA 1B44D 4L6TB 3CCJA 5M5YB 1BCPB 1QUQB 3HOUG 3F2BA 2UXCL 1PDQA 4RCNA 4OWTB 4V0BA 3T1YQ 2UU9Q 4LF9L 1S5FD 2WKCA 3PIOA 3CCMA 2CW0C 1OTCA 1IBLQ 1KIXA 1FNWA 1A63A 1I50B 1J6QA 1U4MA 1VQFA 4DR7L 4QIWE 1FL0A 3FHWA 3R93A 3M4YA 1AEXA 3M4OH 5LL6S 3T1HL 4O42A 4NXMQ 1I3QH 1JOQA 3OMGA 4CJ1B 4MZ9A 3I55A 3TS2A 2Q2UA 1V8QA 4YY3L 1F77A 3D6CA 4FXDA 4DV3Q 1AFPA 1RL2A 1RCVD 2K50A 2VUMG 4GLVB 3RZDH 5DAUA 1QNUA 2ZTCA 3R2TA 2V4DA 4JOIA 3MZ5A 4DA2A 4DXGA 4F8MA 1EWCA 3F8TA 5ELOA 4DR2Q 1LV9A 1VQ4A 2JA7G 2EXDA 1J9OA 4CGYB 4G7OC 4CKEA 2XWBB 2IHFA 2AWNA 1F2YA 1G91A 2Y0SB 3BYYB 2D62A 4RG1A 4V190 4JOIC 1G2SA 1QNKA 2MP1A 3GTOH 4KKTA 4IUPA 2A69C 1CM9A 1AZPA 5C44H 4LUZA 4DV6L 2L55A 2F4VL 3J80L 2OXPA 5BR8Q 1QOHA 2BDOA 3CCSA 1DOLA 1Q8IA 1RF2D 2FINB 5IT9c 2AUJD 3GTPB 1SNQA 1PYWD 3AFQA 2I46A 4RGMA 1NTGA 3SK4A 1O7IA 1EZ6A 1EYCA 2KA7A 1FJGQ 3NPPA 1JICA 4IUTA 4L5TA 1LTBD 1SBBB 3CC4A 4LF5Q 1OO9B 2FJ2A 1AH9A 1II3A 2KEDA 1XTDA 2WAQG 3OIQA 4CKCA 2E2JH 4CHTB 4JK1C 3S2HH 4B3TL 4HJAA 4WJ3M 1GUOA 1R4PB 1EFID 3ITPA 1EEID 3V05A 2JN4A 2N55A 4DXFA 3M9BA 1EOVA 5FJ8G 4PZ6A 3BVMA 1TWAH 5FLXc 3S1MH 4DV2L 1KC8C 1PH9A 3PMFA 2ZJRA 2F0WA 2PQEA 5E7NA 3KFUA 4LF4L 1GHKA 2VQEQ 2IW3A 4KN4C 4CDEC 1B4OA 3V2TA 4HIDA 3RN5A 1IKMA 3K0XA 3FDTA 1STGA 3ERSX 3CXCA 3KLSA 3F2DA 2L1BA 1HZAA 4B08A 3PQIA 3ERQA 1I94L 1EY8A 2B2WA 2K5NA 2K5QA 4Y7NB 2YTVA 3I70A 4AIMA 2R7DA 4GN3B 3AMUA 1I6HB 1G6PA 5EAYA 5CV4A 3AQQA 1XPUA 1K8GA 3FPPA 4H44C 4POFA 3HOZG 2B2WC 4M8AA 2WKDA 1VQOA 2L12A 1CA6A 3FKIB 4A3GH 1H9MA 1IBKL 3NK9A 2ZTDA 1HPCA 2E75C 3HG9A 2WFWA 1LTTD 4X6AH 4B3RQ 3D6WA 4JI5L 1A15A 1CHPD 1TWHB 2G9HD 3IFDA 2AHOB 4QJFA 4BBSB 1TS5A 1XJVA 1G2TA 4I7ZC 1C7YA 4B3ML 2R92G 1C8CA 4OGQC 1NE3A 3KF8A 4DKAC 4TRDA 4YWKA 1U9RA 4A3FB 2NZHA 4IOCA 1QVGA 4APVA 4NPSA 2Q8TA 1CQVA 4DN4M 1WTHA 1ASYA 2ASBA 4RGOS 1XMOL 3P1HA 4DV7L 1HNXL 4TQUS 1E22A 4IN3A 1E1OA 1MHWC 1SNDA 4EQNA 1XNQL 3GQBA 4P71A 4DR4Q 3SVMA 4HN7A 4IALA 1K83B 5C3EG 5I9PA 1DXMA 5T1GA 2CH4A 4FF2A 1S5BD 3BU2A 5FO7B 1EYGA 5BN3A 3CU7A 1O80A 1RJTA 3GTMH 1WTXA 1I4GA 1T9HA 2HQLA 1SDFA 1S72A 3CCEA 2E76C 3OTOQ 1TY0A 3J81j 3S1RB 1WYDA 1A62A 3OPOA 3UDGA 4X3SA 3G6JB 1VQEA 5D3IB 3CCVA 4HJ9A 3G48A 1HTPA 5JEAH 5M3FH 4OONA 3U4VA 4BY1B 2Q8RE 1NUCA 3UDIA 4DK1A 4JV5L 5F2DA 1H9SA 1X3GA 1CT1D 1F2LA 1PRTC 2A6EC 2C5CA 4XDXA 3IFTA 4DNIA 2DNCA 1G51A 1SYFA 5LMNW 3EQLC 1Q90A 2B3GA 2IWHA 4IO9A 3MFYA 1ET6A 4LW1A 2SNSA 3G7LA 3CPWA 2JP1A 1K8MA 1Q3LA 3H94A 1GXDC 3G4SA 1PYSB 5EKKA 3SR1A 1PH5A 2VNUD 3A7LA 1M1KC 4ODGA 4A3BB 3NBHA 1LTRD 1YNNC 4CBVA 4IFDH 5C0XJ 1X56A 4XTCS 2MHVA 4X62Q 3A0JA 1Y1WG 5C4JH 1V1PA 1EWIA 4JI3L 2R93B 1IL2A 3J81i 5ISRA 2JA6B 2JA8G 4KHPL 5JPNC 4DV3L 5ELNA 3A7AB 4JBWA 1K3RA 1SFOH 4RHSA 2QDBA 1RKNA 2JA5G 1UNSA 1IZ6A 2EYFA 2ZT9C 4DR2L 5IWAQ 1I4QA 1G291 4NP5A 1D1IA 2F3IA 4FYDA 4BY7B 1STHA 2XIWA 1HNZL 2WV6D 1Q12A 5EBCA 1S40A 1QUQA 3TREA 2QKIC 2EYPA 3KOJA 1Q82C 4A3JB 1GHJA 1KDCA 4QMGA 4OWWB 2HHHL 1S5ED 1KDAA 3RZOB 1JOOA 4U68A 2CW0D 2YYZA 4WORA 5BR8L 2UXBL 1DOMA 5KNBA 3I4LA 1B9NA 3KF6A 3OW2A 1JE4A 2UXCQ 4OWXB 1JORA 1UAPA 3EBEA 5LMNQ 2PI2E 4XQJA 1VQJA 1I4HA 2B63H 3N52A 3CRKC 4LF9Q 1FJGL 1STNA 4ZUIA 4XYQA 2OTJA 1SYEA 1SYBA 1TR5A 2AKWB 3TN2A 4Y52H 4R4TA 1AN8A 5FKAC 1VQLA 2RF4A 3MWYW 1PZJD 1KQSA 4L5SA 1B8AA 1X3QA 2DUDA 3ND9A 5CORA 1SE8A 4L5RC 4IUQA 3FVQA 2JE6I 5J39A 3I4MB 1VF5C 3T1HQ 3K58A 2VB3X 1CHQD 2JEAI 5CR3A 4YY3Q 4TSSA 1LTID 2DY7A 3I91A 1U4LA 1YJNA 4K2KA 2RDGA 5GAGC 1F2MA 1Y1VH 4P73A 1Q7YC 1CZGA 1Y8OB 1MI2A 4R1JA 5IGGA 3Q23A 4GKKQ 4A3LH 1HR0L 2Z1CA 4C56C 3S24A 1SYCA 1V1OA 1I4PA 5NUCA 2D9UA 5IP9G 3GTGH 4ULLA 2YU9H 1GJXA 2P5ZX 4XQQA 1YJ9A 2F0VA 4LF6L 4K5VA 1SJED 1KDBA 1LT4D 2A74C 2DJFC 2PQAA 1VQIA 2XRQD 3MEFA 5D3DA 3EVQA 2XGTA 1SYGA 1B70B 2O5IC 4HCSA 4DV6Q 2QF7A 1RHPA 2A68D 3ULLA 2PNRC 1JC7A 2AWOA 1MBYA 4IUUA 1PRTF 2RSNA 1ZEQX 2UXDQ 5E4XA 1ZYRD 1CKNB 3UE1A 1X9NA 5CV5A 3BZDB 4JI1L 1ICWA 1LABA 4DK0A 2RA4A 3L2PA 1VQ6A 4LWCA 1BOSA 5CBAE 3BVGA 3K81C 2HQEA 3M4OB 2EYHA 2Y0SE 1I6VC 1GOZA 1I3QB 2K04A 4B9WA 1HNWL 2LY7A 2NWGA 3GD7A 3W3AA 2HUGA 1H9KA 3KLSX 1TS2A 2DJGC 4JYAL 2NVQH 3D3RA 1EU4A 3CW2C 4IFDI 4QF4A 5D14A 1IXRA 2F0KA 3RZDB 3H6MA 4IUNA 1X65A 4B3TQ 1H95A 3GTJH 4DR4L 4FXGC 1STYA 2EY5A 3DEPA 3IAYA 3NHHA 1VMCA 3BDCA 1CSQA 1L1OA 5DM63 2HIVA 2KQ3A 3NTKA 2A6HD 5CV9A 1WD1A 4A3LG 5K5PA 4WJ4A 2IL8A 2RBMA 3J81E 4IJLA 5FO9B 3MAQA 1UE5A 2VS1A 4LF4Q 3VR6A 3GTOB 3E0EA 4ZUJA 1EQTA 3K59A 5IYBH 3NSWA 2NVYB 3U58A 3SXHA 1L1OC 1MKHA 2K7VA 4O0AA 2YTYA 5C44B 4K8IA 3W1GA 4OO1H 2F0DA 3S9WA 4C1NI 2F0IA 1SNMA 3HOXH 2RQXA 1DCZA 1JQYD 3PUXA 1YITA 1I94Q 1Z47A 1QILA 4UP8A 5M3MH 2BE5D 5JAVA 2ZJPA 5C4HA 2EQSA 4WRDA 1RODA 4DGZA 3PUYA 5ELEA 5BN5A 4AYBG 1JCKB 1YHQA 3CQZH 2BH2A 3K80C 4N8FA 3I4NG 4KY5A 3IRBA 1BCPF 4XXEA 3ZYYX 4A3EG 2ZXRA 3NP8A 2LXKA 1SAPA 1IBKQ 2WACA 1VQ8A 2Z4IA 4RGNA 1JJGA 3HOUH 4JI5Q 1XXGA 3DM3A 3CPFA 3I72A 2E2JB 1LTSD 3S2HB 1TT2A 3RR5A 3M7GA 5KGUA 4A3KG 1CQFA 3FP9A 2UUCQ 1HXYD 1O7YA 4ZYSA 4EVOA 4C3IH 2H1EA 3I73A 1GUNA 1QB5D 1A2UA 1LYLA 2J0TD 4C2MH 5C3WA 3NE5B 2RVLA 1VQKA 2CQAA 3HOWG 1LUZA 3HEJA 1EOTA 3FRPB 4ZQ3A 1TWAB 3MTSA 3S1MB 4N8X1 3VR2A 2R7ZG 4X62L 3S14H 3Q22A 3IKJA 3PGZA 3PUWA 1XMOQ 1ESFA 4DV7Q 1HNXQ 1U5KA 2ZXOA 3PSIA 1XNQQ 5C4XG 2SDFA 2X6GA 4CKBA 3CC7A 1EQQA 1CFMA 2ZM6L 5EPJA 4E6IA 1RDPD 1DZ1A 3H3VC 3E3XA 1GM5A 3CP0A 3S1NH
chains in the Genus database with same CATH topology
4HIKA 4LUOA 4GNXB 4YHHL 2VUMH 1OXVA 4JI0L 4UP9A 4JG2A 1AH9A 2CQOA 1XTDA 2WAQG 4OO1G 3Q8DA 2E2JH 3I2ZA 4GLXA 3S2HH 4B3TL 4HJAA 4WJ3M 3H3VH 3I4NH 2BA0A 5M3MG 3T1YL 3HOYG 4A3EH 2R6GA 2OCEA 2JA7H 1PA6A 2UU9L 4LNQA 3M9BA 1EOVA 1X55A 5FJ8G 4PZ6A 2K5HA 1TWAH 5FLXc 4A3DG 3PO2G 3S1MH 3KJPA 4DV2L 1KC8C 1PH9A 1Y14B 2DGYA 2HIXA 3H15A 2ZJRA 4GKJQ 1IBLL 3HFZB 5E7NA 1IYJB 1YBYA 4IPGA 3W5OA 1VQMA 3GTPH 4LF4L 3KFUA 1VQPA 1PVOA 5GROA 1VQ9A 5JEAJ 2VQEQ 2QA4A 3BZCA 1NY4A 4HIDA 4UPAA 4A3KH 3NENA 3RN5A 3K0XA 3I7FA 4JCVE 4DAYB 3ERSX 3S2DH 3CXCA 4AQYQ 2GN5A 4OX9L 3F2DA 4NXML 3A5ZB 1HZAA 5HY6A 3HOWH 3FKIG 4JI2Q 4LF5Q 5LMNL 1I94L 2ZJQA 3M4PA 2R7ZH 3NEMA 2LSSA 2K5NA 4J15A 5IP7G 4DV4Q 2YTVA 1PFSA 3I4OA 1VQ5A 1N36Q 4AIMA 2R7DA 1KRSA 4GN3B 3CCLA 1YVCA 5EAYA 4R4QA 4DR3Q 5C4XH 1G6PA 4BBSG 4JI6L 3AQQA 2RHQB 2RCNA 1XPUA 2OTLA 4H02A 4YCUA 3H0GH 4POFA 1K8GA 3HOZG 1KD1C 2EIFA 5IYDH 1CSPA 2Q2HA 1VQOA 1OXUA 4A3FG 4A3GH 3RN2A 1IBKL 1CUKA 2ZTDA 1GVPA 1VS0A 1X54A 1N33Q 2WFWA 4GOPB 2E2IH 2I5MX 4LF8Q 1U0LA 4X6AH 5JEAG 4LFBL 4B3RQ 1MIUA 3KF8B 4JI5L 5M3FG 3KYHC 4X65L 1NMFA 4JI3Q 5C0XG 4QJFA 2AHOB 3K8AA 2KHIA 4KHPQ 5K36G 1XJVA 1C7YA 2Y0SG 4B3ML 1E3PA 1FVIA 3B6YA 3W1BA 4JI4L 2R92G 4NXNQ 1NE3A 1HJPA 5GAHC 4DKAC 3PUVA 4YWKA 1CKMA 4A76A 4IPDA 2IHEA 5FJ8H 4EX5A 4A3DH 3L0OA 2NZHA 4MTNA 4IOCA 4LFAQ 1QVGA 2L15A 4APVA 1TWFH 3CCUA 3PO2H 4NPSA 4P74A 4GKKL 4Y7NH 1SR3A 1JJ2A 1HR0W 1P16A 1ASYA 5JJLA 2ASBA 1JT8A 1VQDA 1XMOL 4DV7L 1QVFA 1N9WA 1HNXL 1I6HH 4TQUS 1E22A 2N3SA 1E1OA 1XNQL 4OO1I 4BA1I 4GN4B 1A0IA 4P71A 1PH4A 3D0FA 4DR4Q 1N34L 1HNZQ 5C3EG 1SROA 5DLQE 1YHBA 3KLWA 4DR5L 3FKIH 1UWVA 3BU2A 2Z0SA 3BZKA 1XNRL 1EYGA 5IP7H 4LF5L 4IFDG 5GAEC 3GTKH 2HHHQ 1YZ6A 3GTMH 2NN6G 4BY1G 1WOCA 1UEBA 1TWHH 5M5WH 1SMXA 4IPCA 2I5LX 5JJKA 1QZGA 4LUVA 4BBSH 1T9HA 2HQLA 2UXBQ 2UXDL 4R4IA 1S72A 4DR7Q 2VL6A 4BBRH 3CCEA 3HOZH 1XPOA 4GS3A 3OTOQ 3J81j 3K7AH 3M7NA 4HIMA 1WYDA 1A62A 2FXQA 3UDGA 2H5XA 4A3FH 2MFIA 1PH1A 4JBJA 1CKOA 1VQGA 2JK8A 1E7ZA 1VQEA 4HIOA 5IY0A 1TWCH 4DV1Q 3CCVA 2C35B 2BH8A 3G48A 4HJ9A 1LTLA 5M3FH 4OONA 3H0GG 3F1ZA 3U4VA 1XMQQ 2Z6KC 4X64L 4QL5A 4R4OA 5H1SE 2VQEL 1X3FA 3UDIA 3AEVA 4JV5L 3VDYA 2R92H 4IOAA 1K83H 1WFQA 1VQCA 2UUAL 4HJ5A 3PV0A 2YV5A 4A75A 1X3GA 2CFMA 3RLFA 1PH2A 2K75A 1K0RA 4DNIA 1WCMG 1G51A 4JI2L 4A3BG 4K0KQ 5JJIA 1PYBA 3PCOB 1KAWA 5LMNW 1IBMQ 2WB1G 4DR1Q 4QGUA 4IO9A 1L2FA 2B3GA 3J81c 1KXLA 3BJUA 4LW1A 2Q2IA 3CPWA 4KI0A 3S1QH 1B7YB 2V1CC 2MNAA 1BBUA 1LM0A 4X66Q 3WWVA 4DR3L 3G4SA 4IJHA 4A93G 2E8GA 5C3EH 1PYSB 3CCRA 3S1RH 4DK3C 1PH5A 2VNUD 2I5HA 1M1KC 1PH3A 1HZBA 1ASZA 2F4VQ 1EFWA 5IYCG 5C0XJ 1X56A 1PV4A 4XTCS 1VCIA 1HR0Q 4BY1H 4X62Q 2B63G 4B3RL 3H3VI 1FGUA 3A0JA 1Y1WG 1W3SA 2CWAA 5C4JH 4ALPA 1EWIA 4JI3L 2VZAA 1E24A 4DV0Q 4HJ8A 2N49A 3J81i 3NELA 3PIPA 1KL9A 4P75A 1IL2A 4BY7G 2JA8G 4KHPL 2AMCB 5M5XH 4DV3L 5ELNA 1MJEA 4JBWA 3HKZG 4LF6Q 1K3RA 4POGA 4DV5Q 4NXNL 1VQAA 1SFOH 1HZ9A 2RHSB 3CC2A 3CD6A 1D8LA 2JA5G 4LFAL 3M4QA 1IZ6A 5LMUQ 5AJ3Q 4A3JG 1GKHA 1Q8KA 2BA1A 4DR2L 4AYBE 4BBRG 5IWAQ 2XTIA 4DAMA 1M90C 1G291 4C3JH 1N32Q 4QY7A 4PZ7A 1SN8A 1AE2A 1Q1EA 4YCWA 2F3IA 3OYYA 3J7ZC 2VW9A 1GO3E 2Q2TA 4HJ7A 4JI7L 1YNXA 3LGJA 3S16H 2MO0A 1J5EQ 2IX1A 1HNZL 2CWPA 1Q12A 1V43A 4TVAB 4IFDJ 1TWGH 3PUZA 1HZCA 3S15H 4JI1Q 1QUQA 1S40A 1WCMH 2CCZA 4A3BH 3TREA 5IE8A 4DR6Q 2IT1A 1Y1VG 2CKZB 3M3YH 3KOJA 1Q82C 3S17H 2MO1A 4DV2Q 2UUCL 4B3SL 4OWWB 1TXYA 3KF6B 2HHHL 1Q86C 4BXXG 5GADC 4AH6A 4LFCQ 1NMGA 2YYZA 2R93H 3HOVG 1OXXK 2JA6H 3CF5A 3KDFB 1HNWQ 4JI8Q 5BR8L 2A19A 2UXBL 4A93H 2ID0A 3OTOL 4JYAQ 3KF6A 3J80c 3OW2A 1OXSC 2UXCQ 4OX9Q 4OWXB 2A1AA 1EIFA 2QGQA 3EBEA 5LMNQ 3KDFA 2PI2E 5IYCH 1C0AA 4DV1L 1QZHA 1VQJA 1YJWA 4A3MG 2B63H 1DGSA 3I4MG 3G6EA 1Y1WH 1XMQL 4A4IA 4LF9Q 1E1TA 3PO3G 1FJGL 4DUYL 2OQ0A 1WI5A 4BY7H 1V9PA 2D0PA 1L0WA 2OTJA 2UUBQ 2AKWB 2JA8H 4DUZL 3E9HA 4JC0A 3GDEA 4Y52H 3U50C 1EQRA 2LXJA 4R4TA 4FDBA 3G71A 3GTLH 4DPGA 2ZTEA 4A3CG 3STBC 3A74A 1P8LA 2R7FA 1VQLA 2RF4A 3PF4A 1KQSA 4L5SA 1B8AA 2DUDA 3K7UC 4K0KL 2JA5H 1SE8A 4L5QA 4A3JH 2WAQE 4NB3A 4L5RC 1IBML 1UE6A 2Z6KA 3J80i 1EIYB 4KLKA 2JE6I 1JMCA 3RZOH 2WP8J 2JEBI 1YI2A 3MXNB 3T1HQ 3UDXA 3CMAA 2KBNA 4GLAC 2JEAI 2JJQA 4X66L 3ZJYC 2NVYH 4GKJL 4YY3Q 3D31A 4XIGS 1Z9FA 4B3MQ 1SRUA 4DK6C 3J7A5 1QVCA 2NZOA 1VQ7A 1YJNA 1JJCB 1I5FA 2E5LQ 5GAGC 1PH6A 1Y1VH 4P73A 3JC66 1Q7YC 1GD7A 4R1JA 2K4KA 4UP7A 4GKKQ 1NBWA 4A3LH 3TQYA 2KCMA 1HR0L 2ES2A 1KHIA 2GVBA 2YTXA 4AQYL 4BXXH 3S24A 1K8AC 2JA9A 2PQAB 3HOVH 4A3IH 3JAMc 2PMZE 1MJCA 1WJJA 5IP9G 5FLMH 2YU9H 3GTGH 3KJOA 2PNHA 4DV4L 1YJ9A 1PHJA 1W2BA 4LF6L 4PZ8A 4DV5L 3RNUA 1N36L 4YCVA 1X6OA 2PQAA 1VQIA 3MEFA 3NBHB 4DR5Q 2K52A 3L7ZC 2R93G 3AFPA 2JA6G 4KHZA 2XGTA 5AJ3L 5IYBG 5C0XI 4A3MH 3I4MH 3RLOA 1B70B 5IWAL 4ME3A 1N32L 4DV6Q 3PO3H 4MNOA 3ULLA 2VQFQ 1K73C 1Q81C 1PH8A 4IPHA 2AWOA 3HOXG 1J5EL 4LF7Q 2UXDQ 1N33L 2MQHA 4A3CH 4LF8L 1CKNB 3U4ZA 3UDFA 3UE1A 1X9NA 4GNXA 4YWMA 3JAMi 1XPRA 4JI1L 3HKSA 4JBMA 4DR6L 2HT1A 2PI2A 1KRTA 2K14A 4C3HH 3GTQH 3L2PA 1Q1BA 3AYHB 4LWCA 1R9TH 2OWOA 1VQ6A 4PMWA 1CKNA 2ZM6Q 3K81C 2ATWA 3TRZA 2VY3A 4LFCL 4X64Q 4R4CA 1AE3A 2Y0SE 4OXPA 3RLNA 4GNXC 4GN5A 1HNWL 2KHJA 2N8NA 3GD7A 4JI8L 4JV5Q 2ALYB 2NVTH 4BA2I 1VQBA 1UE7A 3SGIA 4JYAL 4JBKA 4YHHQ 3CCJA 2UUAQ 2NVQH 3CW2C 4JI0Q 4IFDI 1QUQB 1IXRA 1BBWA 3HOUG 1OXTA 5GQOA 3F2BA 4QQBX 2UXCL 4PG3A 2NN6I 1L1OB 5HGQA 1X65A 4RMFA 4B3TQ 1JB7A 4OWTB 3GTJH 4UY8C 2IY5B 1H95A 4DR4L 5J3BA 2OQKA 3T1YQ 5C44G 2UU9Q 4LF9L 1CSQA 1L1OA 5IP9H 2UUBL 2HIVA 3PIOA 3CCMA 2D0OA 1OTCA 4A3LG 1IBLQ 2E2HH 4WJ4A 4IJLA 1KIXA 1A63A 1UE5A 2F52A 2VS1A 2JQOA 4LF4Q 1J6QA 4A3IG 3E0EA 2KENA 5IYBH 1VQFA 1UE1A 5FLMG 4DR7L 4QIWE 3U58A 1FL0A 1L1OC 1MKHA 3FHWA 3ULJA 4O0AA 2YTYA 3M4OH 3M85A 3T1HL 1YIJA 3W1GA 1JE5A 4NXMQ 1EUJA 1I3QH 4MZ9A 3I55A 3TS2A 3HOXH 2Q2UA 3PUXA 1YITA 1I94Q 3ICEA 4YY3L 1Z47A 1K9MC 4UP8A 1A8VA 3EIVA 5M3MH 1X3EA 5M5YH 3DLLA 4DV3Q 2ZJPA 3HOYH 4GOPA 1RL2A 2K50A 3I56A 2VUMG 4GLVB 3RZDH 3CMEA 2EQSA 2E5LL 1PH7A 2ZTCA 3TS0A 2GVAA 3PUYA 3F2CA 1YHQA 4AYBG 2I0QA 3CQZH 2BH2A 4JOIA 4JI6Q 3K80C 3F8TA 3CCQA 1VQHA 1NJIC 5ELOA 3IRBA 4DR2Q 3I4NG 2N78A 4A3EG 1VQ4A 2JA7G 3ULPA 1BVSA 2K5VA 4GOPC 2EXDA 2LXKA 4JI7Q 1IBKQ 1VQ8A 2IHFA 4EQ5A 4DR1L 3CAMA 2AWNA 1RIPA 1JJGA 1VQNA 2D62A 4RG1A 1I50H 4JOIC 2WB1E 4LFBQ 3HOUH 4JI5Q 3DM3A 3CPFA 4P72A 4X65Q 3GTOH 3ER0A 4YWLA 1YEZA 3RR5A 3EN2A 4A3KG 3FP9A 2UUCQ 1BKBA 4B3SQ 5C44H 4JI4Q 4LUZA 4C3IH 4DV6L 1D7QA 2F4VL 1LYLA 3TEHB 4C2MH 2VQFL 3E9IA 3STBD 1VQKA 3HOWG 3PF5A 1LUZA 1S3OA 5BR8Q 4LF7L 2A8VA 1HH2P 3CCSA 1Q46A 2R7ZG 2IX0A 4X62L 3S14H 1SLJA 3PGZA 3PUWA 5IT9c 3A5UA 1XMOQ 4DV7Q 4DV0L 1YHAA 1U5KA 1HNXQ 3AFQA 3PSIA 1XNQQ 1NTGA 3UE0A 5C4XG 3CC7A 1O7IA 1N34Q 1EQQA 2ZM6L 3GO5A 1C9OA 5IYDG 2B29A 1FJGQ 3HKZE 4DUYQ 2NVXH 1V1QA 4L5TA 2QEXA 4O2DA 1GM5A 4A3GG 5LMUL 3CP0A 4DUZQ 1N8RC 3CC4A 1XNRQ 2KCTA 3S1NH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HIK A;  4LUO A;  4GNX B;  4YHH L;  2VUM H;  1OXV A;  4JI0 L;  4UP9 A;  4JG2 A;  1AH9 A;  2CQO A;  1XTD A;  2WAQ G;  4OO1 G;  3Q8D A;  2E2J H;  3I2Z A;  4GLX A;  3S2H H;  4B3T L;  4HJA A;  4WJ3 M;  3H3V H;  3I4N H;  2BA0 A;  5M3M G;  3T1Y L;  3HOY G;  4A3E H;  2R6G A;  2OCE A;  2JA7 H;  1PA6 A;  2UU9 L;  4LNQ A;  3M9B A;  1EOV A;  1X55 A;  5FJ8 G;  4PZ6 A;  2K5H A;  1TWA H;  5FLX c;  4A3D G;  3PO2 G;  3S1M H;  3KJP A;  4DV2 L;  1KC8 C;  1PH9 A;  1Y14 B;  2DGY A;  2HIX A;  3H15 A;  2ZJR A;  4GKJ Q;  1IBL L;  3HFZ B;  5E7N A;  1IYJ B;  1YBY A;  4IPG A;  3W5O A;  1VQM A;  3GTP H;  4LF4 L;  3KFU A;  1VQP A;  1PVO A;  5GRO A;  1VQ9 A;  5JEA J;  2VQE Q;  2QA4 A;  3BZC A;  1NY4 A;  4HID A;  4UPA A;  4A3K H;  3NEN A;  3RN5 A;  3K0X A;  3I7F A;  4JCV E;  4DAY B;  3ERS X;  3S2D H;  3CXC A;  4AQY Q;  2GN5 A;  4OX9 L;  3F2D A;  4NXM L;  3A5Z B;  1HZA A;  5HY6 A;  3HOW H;  3FKI G;  4JI2 Q;  4LF5 Q;  5LMN L;  1I94 L;  2ZJQ A;  3M4P A;  2R7Z H;  3NEM A;  2LSS A;  2K5N A;  4J15 A;  5IP7 G;  4DV4 Q;  2YTV A;  1PFS A;  3I4O A;  1VQ5 A;  1N36 Q;  4AIM A;  2R7D A;  1KRS A;  4GN3 B;  3CCL A;  1YVC A;  5EAY A;  4R4Q A;  4DR3 Q;  5C4X H;  1G6P A;  4BBS G;  4JI6 L;  3AQQ A;  2RHQ B;  2RCN A;  1XPU A;  2OTL A;  4H02 A;  4YCU A;  3H0G H;  4POF A;  1K8G A;  3HOZ G;  1KD1 C;  2EIF A;  5IYD H;  1CSP A;  2Q2H A;  1VQO A;  1OXU A;  4A3F G;  4A3G H;  3RN2 A;  1IBK L;  1CUK A;  2ZTD A;  1GVP A;  1VS0 A;  1X54 A;  1N33 Q;  2WFW A;  4GOP B;  2E2I H;  2I5M X;  4LF8 Q;  1U0L A;  4X6A H;  5JEA G;  4LFB L;  4B3R Q;  1MIU A;  3KF8 B;  4JI5 L;  5M3F G;  3KYH C;  4X65 L;  1NMF A;  4JI3 Q;  5C0X G;  4QJF A;  2AHO B;  3K8A A;  2KHI A;  4KHP Q;  5K36 G;  1XJV A;  1C7Y A;  2Y0S G;  4B3M L;  1E3P A;  1FVI A;  3B6Y A;  3W1B A;  4JI4 L;  2R92 G;  4NXN Q;  1NE3 A;  1HJP A;  5GAH C;  4DKA C;  3PUV A;  4YWK A;  1CKM A;  4A76 A;  4IPD A;  2IHE A;  5FJ8 H;  4EX5 A;  4A3D H;  3L0O A;  2NZH A;  4MTN A;  4IOC A;  4LFA Q;  1QVG A;  2L15 A;  4APV A;  1TWF H;  3CCU A;  3PO2 H;  4NPS A;  4P74 A;  4GKK L;  4Y7N H;  1SR3 A;  1JJ2 A;  1HR0 W;  1P16 A;  1ASY A;  5JJL A;  2ASB A;  1JT8 A;  1VQD A;  1XMO L;  4DV7 L;  1QVF A;  1N9W A;  1HNX L;  1I6H H;  4TQU S;  1E22 A;  2N3S A;  1E1O A;  1XNQ L;  4OO1 I;  4BA1 I;  4GN4 B;  1A0I A;  4P71 A;  1PH4 A;  3D0F A;  4DR4 Q;  1N34 L;  1HNZ Q;  5C3E G;  1SRO A;  5DLQ E;  1YHB A;  3KLW A;  4DR5 L;  3FKI H;  1UWV A;  3BU2 A;  2Z0S A;  3BZK A;  1XNR L;  1EYG A;  5IP7 H;  4LF5 L;  4IFD G;  5GAE C;  3GTK H;  2HHH Q;  1YZ6 A;  3GTM H;  2NN6 G;  4BY1 G;  1WOC A;  1UEB A;  1TWH H;  5M5W H;  1SMX A;  4IPC A;  2I5L X;  5JJK A;  1QZG A;  4LUV A;  4BBS H;  1T9H A;  2HQL A;  2UXB Q;  2UXD L;  4R4I A;  1S72 A;  4DR7 Q;  2VL6 A;  4BBR H;  3CCE A;  3HOZ H;  1XPO A;  4GS3 A;  3OTO Q;  3J81 j;  3K7A H;  3M7N A;  4HIM A;  1WYD A;  1A62 A;  2FXQ A;  3UDG A;  2H5X A;  4A3F H;  2MFI A;  1PH1 A;  4JBJ A;  1CKO A;  1VQG A;  2JK8 A;  1E7Z A;  1VQE A;  4HIO A;  5IY0 A;  1TWC H;  4DV1 Q;  3CCV A;  2C35 B;  2BH8 A;  3G48 A;  4HJ9 A;  1LTL A;  5M3F H;  4OON A;  3H0G G;  3F1Z A;  3U4V A;  1XMQ Q;  2Z6K C;  4X64 L;  4QL5 A;  4R4O A;  5H1S E;  2VQE L;  1X3F A;  3UDI A;  3AEV A;  4JV5 L;  3VDY A;  2R92 H;  4IOA A;  1K83 H;  1WFQ A;  1VQC A;  2UUA L;  4HJ5 A;  3PV0 A;  2YV5 A;  4A75 A;  1X3G A;  2CFM A;  3RLF A;  1PH2 A;  2K75 A;  1K0R A;  4DNI A;  1WCM G;  1G51 A;  4JI2 L;  4A3B G;  4K0K Q;  5JJI A;  1PYB A;  3PCO B;  1KAW A;  5LMN W;  1IBM Q;  2WB1 G;  4DR1 Q;  4QGU A;  4IO9 A;  1L2F A;  2B3G A;  3J81 c;  1KXL A;  3BJU A;  4LW1 A;  2Q2I A;  3CPW A;  4KI0 A;  3S1Q H;  1B7Y B;  2V1C C;  2MNA A;  1BBU A;  1LM0 A;  4X66 Q;  3WWV A;  4DR3 L;  3G4S A;  4IJH A;  4A93 G;  2E8G A;  5C3E H;  1PYS B;  3CCR A;  3S1R H;  4DK3 C;  1PH5 A;  2VNU D;  2I5H A;  1M1K C;  1PH3 A;  1HZB A;  1ASZ A;  2F4V Q;  1EFW A;  5IYC G;  5C0X J;  1X56 A;  1PV4 A;  4XTC S;  1VCI A;  1HR0 Q;  4BY1 H;  4X62 Q;  2B63 G;  4B3R L;  3H3V I;  1FGU A;  3A0J A;  1Y1W G;  1W3S A;  2CWA A;  5C4J H;  4ALP A;  1EWI A;  4JI3 L;  2VZA A;  1E24 A;  4DV0 Q;  4HJ8 A;  2N49 A;  3J81 i;  3NEL A;  3PIP A;  1KL9 A;  4P75 A;  1IL2 A;  4BY7 G;  2JA8 G;  4KHP L;  2AMC B;  5M5X H;  4DV3 L;  5ELN A;  1MJE A;  4JBW A;  3HKZ G;  4LF6 Q;  1K3R A;  4POG A;  4DV5 Q;  4NXN L;  1VQA A;  1SFO H;  1HZ9 A;  2RHS B;  3CC2 A;  3CD6 A;  1D8L A;  2JA5 G;  4LFA L;  3M4Q A;  1IZ6 A;  5LMU Q;  5AJ3 Q;  4A3J G;  1GKH A;  1Q8K A;  2BA1 A;  4DR2 L;  4AYB E;  4BBR G;  5IWA Q;  2XTI A;  4DAM A;  1M90 C;  1G29 1;  4C3J H;  1N32 Q;  4QY7 A;  4PZ7 A;  1SN8 A;  1AE2 A;  1Q1E A;  4YCW A;  2F3I A;  3OYY A;  3J7Z C;  2VW9 A;  1GO3 E;  2Q2T A;  4HJ7 A;  4JI7 L;  1YNX A;  3LGJ A;  3S16 H;  2MO0 A;  1J5E Q;  2IX1 A;  1HNZ L;  2CWP A;  1Q12 A;  1V43 A;  4TVA B;  4IFD J;  1TWG H;  3PUZ A;  1HZC A;  3S15 H;  4JI1 Q;  1QUQ A;  1S40 A;  1WCM H;  2CCZ A;  4A3B H;  3TRE A;  5IE8 A;  4DR6 Q;  2IT1 A;  1Y1V G;  2CKZ B;  3M3Y H;  3KOJ A;  1Q82 C;  3S17 H;  2MO1 A;  4DV2 Q;  2UUC L;  4B3S L;  4OWW B;  1TXY A;  3KF6 B;  2HHH L;  1Q86 C;  4BXX G;  5GAD C;  4AH6 A;  4LFC Q;  1NMG A;  2YYZ A;  2R93 H;  3HOV G;  1OXX K;  2JA6 H;  3CF5 A;  3KDF B;  1HNW Q;  4JI8 Q;  5BR8 L;  2A19 A;  2UXB L;  4A93 H;  2ID0 A;  3OTO L;  4JYA Q;  3KF6 A;  3J80 c;  3OW2 A;  1OXS C;  2UXC Q;  4OX9 Q;  4OWX B;  2A1A A;  1EIF A;  2QGQ A;  3EBE A;  5LMN Q;  3KDF A;  2PI2 E;  5IYC H;  1C0A A;  4DV1 L;  1QZH A;  1VQJ A;  1YJW A;  4A3M G;  2B63 H;  1DGS A;  3I4M G;  3G6E A;  1Y1W H;  1XMQ L;  4A4I A;  4LF9 Q;  1E1T A;  3PO3 G;  1FJG L;  4DUY L;  2OQ0 A;  1WI5 A;  4BY7 H;  1V9P A;  2D0P A;  1L0W A;  2OTJ A;  2UUB Q;  2AKW B;  2JA8 H;  4DUZ L;  3E9H A;  4JC0 A;  3GDE A;  4Y52 H;  3U50 C;  1EQR A;  2LXJ A;  4R4T A;  4FDB A;  3G71 A;  3GTL H;  4DPG A;  2ZTE A;  4A3C G;  3STB C;  3A74 A;  1P8L A;  2R7F A;  1VQL A;  2RF4 A;  3PF4 A;  1KQS A;  4L5S A;  1B8A A;  2DUD A;  3K7U C;  4K0K L;  2JA5 H;  1SE8 A;  4L5Q A;  4A3J H;  2WAQ E;  4NB3 A;  4L5R C;  1IBM L;  1UE6 A;  2Z6K A;  3J80 i;  1EIY B;  4KLK A;  2JE6 I;  1JMC A;  3RZO H;  2WP8 J;  2JEB I;  1YI2 A;  3MXN B;  3T1H Q;  3UDX A;  3CMA A;  2KBN A;  4GLA C;  2JEA I;  2JJQ A;  4X66 L;  3ZJY C;  2NVY H;  4GKJ L;  4YY3 Q;  3D31 A;  4XIG S;  1Z9F A;  4B3M Q;  1SRU A;  4DK6 C;  3J7A 5;  1QVC A;  2NZO A;  1VQ7 A;  1YJN A;  1JJC B;  1I5F A;  2E5L Q;  5GAG C;  1PH6 A;  1Y1V H;  4P73 A;  3JC6 6;  1Q7Y C;  1GD7 A;  4R1J A;  2K4K A;  4UP7 A;  4GKK Q;  1NBW A;  4A3L H;  3TQY A;  2KCM A;  1HR0 L;  2ES2 A;  1KHI A;  2GVB A;  2YTX A;  4AQY L;  4BXX H;  3S24 A;  1K8A C;  2JA9 A;  2PQA B;  3HOV H;  4A3I H;  3JAM c;  2PMZ E;  1MJC A;  1WJJ A;  5IP9 G;  5FLM H;  2YU9 H;  3GTG H;  3KJO A;  2PNH A;  4DV4 L;  1YJ9 A;  1PHJ A;  1W2B A;  4LF6 L;  4PZ8 A;  4DV5 L;  3RNU A;  1N36 L;  4YCV A;  1X6O A;  2PQA A;  1VQI A;  3MEF A;  3NBH B;  4DR5 Q;  2K52 A;  3L7Z C;  2R93 G;  3AFP A;  2JA6 G;  4KHZ A;  2XGT A;  5AJ3 L;  5IYB G;  5C0X I;  4A3M H;  3I4M H;  3RLO A;  1B70 B;  5IWA L;  4ME3 A;  1N32 L;  4DV6 Q;  3PO3 H;  4MNO A;  3ULL A;  2VQF Q;  1K73 C;  1Q81 C;  1PH8 A;  4IPH A;  2AWO A;  3HOX G;  1J5E L;  4LF7 Q;  2UXD Q;  1N33 L;  2MQH A;  4A3C H;  4LF8 L;  1CKN B;  3U4Z A;  3UDF A;  3UE1 A;  1X9N A;  4GNX A;  4YWM A;  3JAM i;  1XPR A;  4JI1 L;  3HKS A;  4JBM A;  4DR6 L;  2HT1 A;  2PI2 A;  1KRT A;  2K14 A;  4C3H H;  3GTQ H;  3L2P A;  1Q1B A;  3AYH B;  4LWC A;  1R9T H;  2OWO A;  1VQ6 A;  4PMW A;  1CKN A;  2ZM6 Q;  3K81 C;  2ATW A;  3TRZ A;  2VY3 A;  4LFC L;  4X64 Q;  4R4C A;  1AE3 A;  2Y0S E;  4OXP A;  3RLN A;  4GNX C;  4GN5 A;  1HNW L;  2KHJ A;  2N8N A;  3GD7 A;  4JI8 L;  4JV5 Q;  2ALY B;  2NVT H;  4BA2 I;  1VQB A;  1UE7 A;  3SGI A;  4JYA L;  4JBK A;  4YHH Q;  3CCJ A;  2UUA Q;  2NVQ H;  3CW2 C;  4JI0 Q;  4IFD I;  1QUQ B;  1IXR A;  1BBW A;  3HOU G;  1OXT A;  5GQO A;  3F2B A;  4QQB X;  2UXC L;  4PG3 A;  2NN6 I;  1L1O B;  5HGQ A;  1X65 A;  4RMF A;  4B3T Q;  1JB7 A;  4OWT B;  3GTJ H;  4UY8 C;  2IY5 B;  1H95 A;  4DR4 L;  5J3B A;  2OQK A;  3T1Y Q;  5C44 G;  2UU9 Q;  4LF9 L;  1CSQ A;  1L1O A;  5IP9 H;  2UUB L;  2HIV A;  3PIO A;  3CCM A;  2D0O A;  1OTC A;  4A3L G;  1IBL Q;  2E2H H;  4WJ4 A;  4IJL A;  1KIX A;  1A63 A;  1UE5 A;  2F52 A;  2VS1 A;  2JQO A;  4LF4 Q;  1J6Q A;  4A3I G;  3E0E A;  2KEN A;  5IYB H;  1VQF A;  1UE1 A;  5FLM G;  4DR7 L;  4QIW E;  3U58 A;  1FL0 A;  1L1O C;  1MKH A;  3FHW A;  3ULJ A;  4O0A A;  2YTY A;  3M4O H;  3M85 A;  3T1H L;  1YIJ A;  3W1G A;  1JE5 A;  4NXM Q;  1EUJ A;  1I3Q H;  4MZ9 A;  3I55 A;  3TS2 A;  3HOX H;  2Q2U A;  3PUX A;  1YIT A;  1I94 Q;  3ICE A;  4YY3 L;  1Z47 A;  1K9M C;  4UP8 A;  1A8V A;  3EIV A;  5M3M H;  1X3E A;  5M5Y H;  3DLL A;  4DV3 Q;  2ZJP A;  3HOY H;  4GOP A;  1RL2 A;  2K50 A;  3I56 A;  2VUM G;  4GLV B;  3RZD H;  3CME A;  2EQS A;  2E5L L;  1PH7 A;  2ZTC A;  3TS0 A;  2GVA A;  3PUY A;  3F2C A;  1YHQ A;  4AYB G;  2I0Q A;  3CQZ H;  2BH2 A;  4JOI A;  4JI6 Q;  3K80 C;  3F8T A;  3CCQ A;  1VQH A;  1NJI C;  5ELO A;  3IRB A;  4DR2 Q;  3I4N G;  2N78 A;  4A3E G;  1VQ4 A;  2JA7 G;  3ULP A;  1BVS A;  2K5V A;  4GOP C;  2EXD A;  2LXK A;  4JI7 Q;  1IBK Q;  1VQ8 A;  2IHF A;  4EQ5 A;  4DR1 L;  3CAM A;  2AWN A;  1RIP A;  1JJG A;  1VQN A;  2D62 A;  4RG1 A;  1I50 H;  4JOI C;  2WB1 E;  4LFB Q;  3HOU H;  4JI5 Q;  3DM3 A;  3CPF A;  4P72 A;  4X65 Q;  3GTO H;  3ER0 A;  4YWL A;  1YEZ A;  3RR5 A;  3EN2 A;  4A3K G;  3FP9 A;  2UUC Q;  1BKB A;  4B3S Q;  5C44 H;  4JI4 Q;  4LUZ A;  4C3I H;  4DV6 L;  1D7Q A;  2F4V L;  1LYL A;  3TEH B;  4C2M H;  2VQF L;  3E9I A;  3STB D;  1VQK A;  3HOW G;  3PF5 A;  1LUZ A;  1S3O A;  5BR8 Q;  4LF7 L;  2A8V A;  1HH2 P;  3CCS A;  1Q46 A;  2R7Z G;  2IX0 A;  4X62 L;  3S14 H;  1SLJ A;  3PGZ A;  3PUW A;  5IT9 c;  3A5U A;  1XMO Q;  4DV7 Q;  4DV0 L;  1YHA A;  1U5K A;  1HNX Q;  3AFQ A;  3PSI A;  1XNQ Q;  1NTG A;  3UE0 A;  5C4X G;  3CC7 A;  1O7I A;  1N34 Q;  1EQQ A;  2ZM6 L;  3GO5 A;  1C9O A;  5IYD G;  2B29 A;  1FJG Q;  3HKZ E;  4DUY Q;  2NVX H;  1V1Q A;  4L5T A;  2QEX A;  4O2D A;  1GM5 A;  4A3G G;  5LMU L;  3CP0 A;  4DUZ Q;  1N8R C;  3CC4 A;  1XNR Q;  2KCT A;  3S1N H; 
#chains in the Genus database with same CATH topology
 1WTR A;  2VUM H;  1OXV A;  4KN7 C;  5EQ0 A;  2LMC B;  1QJO A;  4OO1 G;  3Q8D A;  1BF4 A;  4CDD C;  3BG3 A;  4IQZ A;  3DWQ A;  1RD9 D;  5M3M G;  1STB A;  4ME5 A;  2OCE A;  2JA7 H;  1PA6 A;  1IHZ A;  5EPL A;  1X55 A;  5I6Y A;  4A3D G;  4A3G B;  3PO2 G;  1GUT A;  3C46 A;  4QCL A;  2DGY A;  1IYJ B;  4RFB A;  4IPG A;  4ZAI A;  1BR9 A;  5C3X A;  1VQ9 A;  1D2B A;  5JEA J;  1NY4 A;  4HAE A;  1SMY C;  3NEN A;  1YNN D;  4JCV E;  4DAY B;  3JAM L;  3S2D H;  4KD3 A;  2FMC A;  4AQY Q;  2GN5 A;  5HY6 A;  5LMN L;  3NWS A;  3X3N A;  3K5M A;  3NEM A;  1DJR D;  5IP7 G;  1PFS A;  3I4O A;  3VYU A;  4C3I G;  2IJ0 A;  2EJF C;  5DEH A;  2AQ1 B;  4DAP A;  4JI6 L;  3K5N A;  2RCN A;  1G8Z D;  3LWE A;  3DWA A;  3H0G H;  4YCU A;  3TP8 A;  1GVP A;  2X6L A;  1VS0 A;  1NR4 A;  1YNJ C;  3BDO A;  2RSO A;  4LFB L;  1MIU A;  3GTM B;  1NMF A;  4JI3 Q;  4KK7 A;  4KJN A;  5C0X G;  5K36 G;  4KHP Q;  2AQ2 B;  2ZXP A;  1E3P A;  1FVI A;  3B6Y A;  4JI4 L;  1HJP A;  1AP0 A;  5GAH C;  4A76 A;  2IHE A;  5FJ8 H;  3TME A;  2O2L D;  2HDM A;  3CCU A;  4P74 A;  4GKK L;  1ONL A;  1SR3 A;  1HR0 W;  3R3O A;  1HA6 A;  1BCP D;  1P16 A;  2HCC A;  5JJL A;  5M3F B;  2N3S A;  2NVX B;  4OO1 I;  4BA1 I;  4L63 B;  5FK9 C;  1FD7 D;  3D0F A;  1N34 L;  1HNZ Q;  3MA2 B;  1SRO A;  2QDL A;  5EBD A;  3MC0 B;  3SK8 A;  2Z0S A;  1D1K A;  3BZK A;  2PZW A;  3LX0 A;  4Z9C B;  5GAE C;  2HHH Q;  1MGS A;  3OSO A;  4BS9 A;  1YZ6 A;  2NN6 G;  2A73 B;  1BBX C;  4NKL A;  4LUV A;  2UXB Q;  2UXD L;  3SK6 A;  2VL6 A;  1PTO H;  3HOZ H;  2F0F A;  4GS3 A;  5ELD A;  2MUY A;  4JBJ A;  1PFB A;  1E7Z A;  5DM7 3;  1TWC H;  2ENB A;  1TKW B;  5IGC A;  2BH8 A;  4JW0 A;  3H0G G;  3F1Z A;  2Z6K C;  4C3J G;  4R4O A;  5H1S E;  5CV7 A;  1X3F A;  3W2D A;  4RA8 A;  2R92 H;  4IOA A;  2A68 C;  4A75 A;  1SFO B;  2K33 A;  1WCM G;  1ZYR C;  3PCO B;  2WB1 G;  3J81 c;  1TQO A;  3BJU A;  3D4D A;  3Q6S A;  1LT3 D;  1Z7T A;  1NR2 A;  1BBU A;  4DR3 L;  3I90 A;  4A93 G;  5C3E H;  3K5O A;  1ASZ A;  4S3S A;  1B9M A;  1Y69 U;  1T5E A;  3H09 A;  5IYC G;  4QUF A;  4L8J A;  3URY A;  1G6Z A;  1WTV A;  1HR0 Q;  4ALP A;  5I2Y A;  4DV0 Q;  1E24 A;  3L3O C;  3NEL A;  1MJE A;  4LF6 Q;  3HKZ G;  1NSN S;  1RTN A;  3J7Y W;  4POG A;  4NXN L;  1E2V A;  4DAV A;  2RHS B;  2A6H C;  3NTH A;  3QOL A;  5BN4 A;  5A2Q E;  5LMU Q;  3HGB A;  1Q8K A;  1M90 C;  1SSO A;  2XTI A;  2N88 A;  2B63 B;  4MIU A;  3CRL C;  1Q1E A;  3J7Z C;  4IUV A;  1GO3 E;  1YNX A;  3LGJ A;  5KYL A;  3S16 H;  1GUS A;  3K6O A;  2IX1 A;  2RDF A;  4R9W A;  1V43 A;  5FLX L;  3PUZ A;  2F3V A;  4JI1 Q;  5JVG 3;  3LNN A;  5IE8 A;  2BE5 C;  3M3Y H;  3S17 H;  2F0L A;  2UUC L;  1C48 A;  2F0N A;  3AB9 A;  3L9A X;  1TXY A;  3OW7 A;  4K6L A;  4BBR B;  3D4R A;  1Q86 C;  4BXX G;  1NMG A;  3HOV G;  3MFG A;  1HNW Q;  1CK1 A;  5E4W C;  1WD0 A;  2PO4 A;  1SE3 A;  4JYA Q;  1ENC A;  4OX9 Q;  2FMM A;  1EIF A;  5M9O A;  2QGQ A;  1Y1V B;  3KDF A;  1C0A A;  5HUR A;  4DV1 L;  1YJW A;  4A3M G;  4RH6 A;  5EJW A;  3G6E A;  4BWG B;  1Y1W H;  5JJZ A;  3PO3 G;  3TZD A;  2JA8 H;  1EQV A;  3SHL A;  4F88 A;  1EQR A;  3GTG B;  2CH4 W;  2YU9 B;  4A3C G;  5C4Z A;  4DPG A;  2ZTE A;  3A74 A;  2JA5 H;  5KEE A;  2WAQ E;  4C3H G;  4MHE A;  1UE6 A;  3J80 i;  5KNC A;  1IBM L;  2WP8 J;  2JEB I;  3UDX A;  2F4I A;  1QG7 A;  4FXK C;  4GLA C;  2Q8I B;  4X66 L;  4AYB B;  4FNF A;  1TU2 B;  4HCE A;  1SRU A;  4DK6 C;  5EGT A;  1I5F A;  4X3U A;  3X3M A;  2GA4 B;  1KNE A;  4UP7 A;  1EY0 A;  1KHI A;  2XNA C;  2YTX A;  4G4K A;  4AQY L;  2JA9 A;  1I4R A;  4A3I H;  4DF7 A;  1Z6H A;  1LAC A;  1BO0 A;  3KJO A;  2KCN A;  2PNH A;  1EEF D;  1PHJ A;  1W2B A;  2NVQ B;  4YCV A;  3MXG A;  4DR5 Q;  2K52 A;  2JXM B;  2J7Z A;  3P75 A;  2B2Y C;  2F1M A;  3MXU A;  3GTJ B;  1N32 L;  3OIP A;  2F0H A;  3KBX A;  1XYI A;  1K73 C;  4IPH A;  4RHR A;  3TZU A;  4HTH A;  3GV3 A;  1U4P A;  2EYL A;  2MQH A;  2XRS D;  2KCC A;  3UDF A;  2WIN B;  2PYK A;  4U67 3;  1ZXT A;  2PW5 A;  4X3K A;  1XPR A;  3RD4 A;  4JBM A;  3NQI A;  4DR6 L;  2HT1 A;  2PI2 A;  1KRT A;  2K14 A;  3GTQ H;  3ONA B;  1Q1B A;  3AYH B;  4KMU C;  4PMW A;  2ZM6 Q;  2ATW A;  3TRZ A;  2EY1 A;  1AE3 A;  1NNX A;  4JVZ A;  4JI8 L;  2D2C C;  5C6A A;  3HOX B;  2NVT H;  1X3P A;  1SMY D;  3DM1 A;  2UUA Q;  1I4X A;  1EY9 A;  1OXT A;  4QQB X;  3C2P A;  4PG3 A;  2NYZ D;  4RMF A;  1JB7 A;  2Z8L A;  3CQZ B;  2OQK A;  3A54 A;  1MSH A;  5JVH 3;  5J1Z A;  5IP9 H;  2UUB L;  3FMC A;  1KAB A;  2M00 A;  1WTW A;  5CYU A;  4DFA A;  3HZX A;  2F52 A;  2JQO A;  3HOU B;  4ABN A;  4A3I G;  1BDO A;  2KEN A;  3PIP 3;  1BCP C;  1UE1 A;  1TS4 A;  1YNJ D;  4C3I B;  1EUJ A;  4C2M B;  2CVR A;  1XTC D;  1K9M C;  1A8V A;  3DLL A;  3HOY H;  1M8A A;  3I56 A;  3CME A;  1EYD A;  1L0X B;  2L4N A;  3VA5 A;  4F7X A;  4QB4 A;  4J1M A;  4DU9 A;  3F2C A;  2AUK A;  5HGT A;  1A3U A;  4JI6 Q;  2N78 A;  5KND A;  2EOT A;  1EU3 A;  4JI7 Q;  4EQ5 A;  3CAM A;  4K2L A;  1RIP A;  5JOB A;  1A3V A;  2F0J A;  1VQN A;  3S1N B;  4LFB Q;  1S5D D;  2VUM B;  3VA7 A;  3O13 A;  1W6J A;  3ER0 A;  5JPM C;  1BKB A;  1CA5 A;  4B3S Q;  4JI4 Q;  2F0U A;  2QCP X;  2JA7 B;  1B50 A;  1D7Q A;  2QIL A;  4KKS A;  1JB3 A;  3E9I A;  1PZI D;  1EIH A;  3PF5 A;  1S3O A;  4LF7 L;  5C5M A;  1HH2 P;  3U9S A;  3TP6 A;  3UI2 A;  4XYO A;  2IX0 A;  4UAI A;  4KY6 A;  1SLJ A;  3DWP A;  4C1N K;  4DV0 L;  1YHA A;  1CTM A;  2EDG A;  5IOD A;  3OMC A;  1PZK D;  4KKU A;  3J7A F;  1N34 Q;  1VDZ A;  2B2U A;  1CZW A;  1C9O A;  4YIJ A;  5IYD G;  3S2D B;  3J80 E;  2B29 A;  1JWM D;  4DUY Q;  5LMU L;  1N8R C;  3A55 A;  4HIK A;  5E3F A;  3QWN A;  4GNX B;  4YHH L;  2OT2 A;  4JI0 L;  4UP9 A;  4JG2 A;  1BQQ T;  2CQO A;  2PCF B;  2K05 A;  2B2U C;  3RUZ A;  3OWF A;  3H3V H;  3I4N H;  2BA0 A;  1HQM C;  3T56 B;  5IGE A;  4MTK A;  3HOY G;  4A3E H;  2QW7 A;  1VMP A;  3H0G B;  4LNQ A;  2JYO A;  1LT6 D;  2F0P A;  4N9T A;  3KJP A;  2JSO A;  2HIX A;  3HFZ B;  1W6K A;  2WAQ B;  5GRO A;  3SE0 A;  3T53 B;  4UPA A;  4A3K H;  1F9S A;  4OIK A;  1O78 A;  2NTS A;  1LLR D;  3N6R A;  4OX9 L;  3HOW H;  3FKI G;  2ZJQ A;  3M4P A;  2R7Z H;  1R4Q B;  3BDL A;  4DV4 Q;  2F0E A;  5EKI A;  1VQ5 A;  4UDU C;  1UUP A;  2AQ3 B;  1AW7 A;  2EJG C;  3CCL A;  4R4Q A;  4DR3 Q;  5C4X H;  5AFW A;  4BBS G;  3SK5 A;  2E74 C;  4M1U B;  1A3T A;  4H02 A;  2DNE A;  2EIF A;  2PPB C;  2Q2H A;  2EXZ A;  4A3F G;  2Z6B A;  1CI3 M;  1CUK A;  1PXU A;  1QE6 A;  3SEB A;  3C3L A;  1PMR A;  3TSS A;  2O5J C;  1X54 A;  4CJ2 C;  4KD4 A;  4GOP B;  4RGT A;  2I5M X;  2E2I H;  4LF8 Q;  1U0L A;  4OIJ A;  3KF8 B;  3KYH C;  4X65 L;  2RKS A;  3K8A A;  2KHI A;  1SE4 A;  1PTO B;  3HOZ B;  4NXN Q;  2H4O A;  2EPB A;  3PUV A;  4A3D H;  3PO2 H;  4MTN A;  1TWF H;  2VXW A;  4J6H A;  1SEB D;  3RMH A;  5FLX E;  1TWC B;  5I9O A;  1VQD A;  1DM0 B;  2RCF A;  3IL8 A;  1FYC A;  1A0I A;  5I4D A;  1PH4 A;  2ICI A;  2R92 B;  2XVS A;  5DLQ E;  1YHB A;  4RCO A;  3KLW A;  4DR5 L;  2NUC A;  1UWV A;  2PZT A;  3QR8 A;  2BCO A;  5T1I A;  4HED A;  1XNR L;  5IP7 H;  4OL7 A;  3CHB D;  3GTK H;  2FFK B;  2X69 A;  4BY1 G;  1U4R A;  1UEB A;  5M5W H;  1SMX A;  2I5L X;  4KTA A;  1HFN A;  1E0B A;  1JR0 D;  1QZG A;  3KLR A;  2NBF A;  4R4I A;  2ICE C;  3ERO A;  5C3E B;  3BS1 A;  3K7A H;  2JK8 A;  2B2V A;  2L9H A;  4HIO A;  1VF7 A;  4DV1 Q;  1PTO D;  1F9R A;  1LTL A;  4H0L C;  3R8B A;  5C0X H;  2E2D C;  3EJI A;  2KUM A;  5K36 H;  1TVX A;  2UUA L;  1QCB D;  2B2V C;  2EVB A;  4HJ5 A;  3HRZ C;  1ILP A;  1FNV A;  4ID6 A;  1PH2 A;  4A3B G;  2LS0 1;  4JI2 L;  1PYB A;  1KAW A;  1IBM Q;  4DR1 Q;  1KXL A;  1EZ8 A;  2Q2I A;  3S1Q H;  1B7Y B;  2V1C C;  1WVL A;  2MNA A;  4X66 Q;  1LTA D;  3S16 B;  5I6W A;  3DHQ A;  4KJO A;  1V1P B;  4K14 A;  1HZB A;  1F9Q A;  1EY7 A;  1EFW A;  3M3Y B;  3E5S A;  3S17 B;  2NN6 H;  1JWS D;  3HS0 C;  3H3V I;  2CWA A;  4HJ8 A;  2VZA A;  2N49 A;  4BY7 G;  3PIP A;  1KL9 A;  1XX8 A;  2AMC B;  1MD2 D;  5M5X H;  2LFN A;  1HZ9 A;  4FF1 A;  1H9R A;  3CD6 A;  1D8L A;  1A6X A;  4LFA L;  4A3J G;  2EY6 A;  4AYB E;  4DAM A;  4C3J H;  1N32 Q;  4QY7 A;  4PZ7 A;  1SN8 A;  1Y1W B;  3DUZ A;  2VW9 A;  3OYY A;  2Q2T A;  3T4A C;  1LTG D;  4HJ7 A;  4JI7 L;  3HP3 A;  2JA8 B;  4HSV A;  1E2Z A;  2CWP A;  4TVA B;  4IFD J;  1IYU A;  1TWG H;  3S15 H;  2CCZ A;  1WCM H;  4DR6 Q;  2K01 A;  2IT1 A;  2CKZ B;  2JA5 B;  4B3S L;  1DYQ A;  3KF6 B;  4OHJ A;  4AH6 A;  5CV6 A;  1OXX K;  3CF5 A;  4JI8 Q;  5CC4 A;  2A19 A;  1DOK A;  4A93 H;  3MVV A;  1D6E C;  1Y8N B;  3J80 c;  1OXS C;  1K8O A;  3NWT A;  1GUG A;  1HFG A;  3V96 A;  5IYC H;  2PZU A;  2EYO A;  1QZH A;  1JWU D;  4XT3 B;  3I4M G;  1KAA A;  1XMQ L;  4NDX A;  1ML0 D;  1E1T A;  5EPK A;  4DUY L;  1WI5 A;  2D0P A;  1L0W A;  4A3I B;  2UUB Q;  2F0G A;  3E9H A;  3U50 C;  2LXJ A;  4FDB A;  2VB2 X;  3GTL H;  5IGD A;  1P8L A;  2NZ1 D;  3NUC A;  3TP7 A;  3K0Y A;  4K0K L;  3QIA A;  4L5Q A;  4XQN A;  4NB3 A;  2Z6K A;  2QEJ C;  5LHY 1;  2MJ8 A;  1JMC A;  1YI2 A;  3MXN B;  1SNP A;  2KBN A;  2NVY H;  3I8Z A;  3D31 A;  4XIG S;  1Z9F A;  3J7A 5;  1QVC A;  3T13 A;  2NZO A;  1VQ7 A;  2HCI A;  4ZKC B;  5C4J B;  2SNM A;  3P20 A;  3GTQ B;  2K4K A;  1LT5 D;  1KTK A;  2KCM A;  3GP7 A;  1WTO A;  4BXX H;  1ZKO A;  1K8A C;  2PQA B;  3HOV H;  3EFX D;  3K57 A;  1MJC A;  1WJJ A;  1BXT A;  5FLM H;  2NVT B;  4DV4 L;  3EA6 A;  2G9D A;  4DV5 L;  3MEH A;  3CKI B;  3OHX C;  1O7L A;  3L7Z C;  3AFP A;  4WJW A;  2EJM A;  4KHZ A;  1B3A A;  5AJ3 L;  5C0X I;  4A3M H;  1L0Y B;  3PO3 H;  1EY5 A;  5FOB B;  1D5X C;  3Q0A A;  4ZRZ A;  1Q81 C;  1LO5 D;  5IT9 L;  1J5E L;  4LF7 Q;  2NB0 A;  4A3C H;  2KOL A;  4PV1 C;  2K5W A;  1HCZ A;  4LF8 L;  4FF3 A;  4GNX A;  2OF1 A;  3JAM i;  4K6D A;  1SNO A;  3HKS A;  4I65 A;  2XSC A;  4C3H H;  1R9T H;  2OWO A;  5IGF A;  4FP5 D;  1CKN A;  2VY3 A;  4LFC L;  4X64 Q;  4OXP A;  2IX3 A;  4RKB A;  4GNX C;  1B3Q A;  2KHJ A;  2N8N A;  3DXJ C;  2ALY B;  4BA2 I;  4LAA A;  1UE7 A;  2F0O A;  2TMP A;  4JBK A;  4YHH Q;  3HOY B;  4JI0 Q;  1BBW A;  5GQO A;  3J81 L;  2NN6 I;  1L1O B;  5HGQ A;  3AU7 A;  3OOC A;  4UY8 C;  2IY5 B;  2SOB A;  5J3B A;  5C44 G;  3MXP A;  5C5L A;  2FHT A;  3FPU B;  1HUM A;  4CJ0 B;  2PW7 A;  1B1Z A;  2D0O A;  4O1N A;  1D5M C;  1EYA A;  2E2H H;  2LKV A;  2PMZ B;  5TSS A;  5FLM G;  3ULJ A;  2EY2 A;  1HUN A;  3M85 A;  2K03 A;  1YIJ A;  1JE5 A;  4F87 A;  4LJZ C;  3OWE B;  2KJX A;  4CDC C;  4OEM B;  4EQO A;  3D8G A;  3ICE A;  2DY8 A;  1ICF B;  3EIV A;  2KEE A;  1X3E A;  4NMZ A;  5M5Y H;  4GOP A;  4DNR B;  4PMC A;  3P7J A;  1STA A;  3NXW A;  4IUR A;  1PH7 A;  2E5L L;  3TS0 A;  2GVA A;  3QO2 A;  4ZLT F;  1SJH D;  2L11 A;  2I0Q A;  4KY7 A;  3CCQ A;  1VQH A;  2MPM A;  1NJI C;  2A5H A;  3ULP A;  4H13 C;  3K5L A;  1BVS A;  2K5V A;  5CV8 A;  4GOP C;  1H9J A;  4DR1 L;  1F2Z A;  1BUV T;  1I50 H;  2WB1 E;  4P72 A;  4X65 Q;  1WTP A;  2F0S A;  1PTO C;  4YWL A;  4GZY C;  1IW7 D;  1YEZ A;  3EN2 A;  3DEO A;  4PQX A;  3I4N B;  1JOK A;  4A3E B;  5CGK A;  3TEH B;  2VQF L;  2R61 A;  3STB D;  3WOE A;  2A8V A;  2L5T A;  3A8I E;  1Q46 A;  3QB3 A;  3QOJ A;  2RDH A;  2DN8 A;  3A5U A;  4EQP A;  1X32 A;  2M9V A;  2B2Y A;  1KLG D;  1AZQ A;  4P2C B;  2EYJ A;  1EY6 A;  1IYV A;  3UE0 A;  4PNY A;  4A3K B;  1PFM A;  3GO5 A;  2KEC A;  1B2T A;  3HKZ E;  2NVX H;  1V1Q A;  2C9O A;  4QIW B;  1ESR A;  2QEX A;  4O2D A;  3HOW B;  4A3G G;  2B2T A;  4ZKB B;  4DUZ Q;  1XNR Q;  2KCT A;  1CKM A;  2BOS A;  2K5D A;  2Z9H A;  4LUO A;  2R7Z B;  1HTL D;  3I2Z A;  4Q0F A;  4KHV A;  3VR5 A;  4GLX A;  3TP5 A;  2HD3 A;  5C4X B;  3T1Y L;  2R6G A;  2B2T C;  3WOF A;  4RAU C;  2UU9 L;  4NW2 A;  5KIX A;  1F9P A;  2K5H A;  4G7H C;  4GKJ Q;  3A8J E;  1Y14 B;  3H15 A;  5COY A;  1RTO A;  3Q24 A;  1HA5 A;  1IBL L;  2E2I B;  1YBY A;  3W5O A;  1VQM A;  3GTP H;  1VQP A;  1PVO A;  2QA4 A;  4FVM A;  3BZC A;  2O4X A;  1MSG A;  3I7F A;  3D4W A;  5EKL A;  5M3M B;  2XN9 C;  4NXM L;  2EZV A;  3A5Z B;  4JI2 Q;  4N9P A;  4A3D B;  1Y8P B;  3PO2 B;  1TWF B;  2LSS A;  4J15 A;  4DAY A;  4G7Z C;  1N36 Q;  1S4Z A;  1PFN A;  1KRS A;  4QUC A;  1YVC A;  3JAM E;  2RHQ B;  2OTL A;  1E2W A;  2F03 A;  4ZCK A;  5IYD H;  1IL8 A;  1KD1 C;  1CSP A;  1OXU A;  3R2I A;  3RN2 A;  3A56 A;  5G3L F;  1FR3 A;  4K5X A;  1N33 Q;  3T51 B;  1KNA A;  5L37 A;  5JEA G;  4TKO B;  3GTK B;  5M3F G;  2F0T A;  5M5W B;  1NCV A;  2Y0S G;  2K1B A;  3W1B A;  3S14 B;  1PLF A;  3K7A B;  2KVM A;  2XWJ B;  4IPD A;  2B8G A;  4EX5 A;  3L0O A;  4LFA Q;  4I7A A;  2L15 A;  4Y7N H;  1JJ2 A;  1JT8 A;  1D5Z C;  1QVF A;  1N9W A;  1EIG A;  1I6H H;  3GV6 A;  3PIO 3;  4GN4 B;  1QWY A;  3C1E A;  4MN3 A;  4EGV A;  3FEW X;  5IOC A;  1DON A;  2I07 B;  3FKI H;  4OEL B;  5E1F A;  2M2L A;  1C4Q A;  1SE2 A;  4HMJ A;  4LF5 L;  4IFD G;  3U9O A;  2OEO A;  2Z4H A;  4B9X A;  1WOC A;  3F2U A;  1TWH H;  3S1Q B;  4IPC A;  5JJK A;  4BBS H;  4HR7 B;  4DR7 Q;  4BBR H;  4R8I A;  1XPO A;  3M7N A;  4HIM A;  2FXQ A;  2H5X A;  4IZ8 A;  4A3F H;  2MFI A;  1PH1 A;  1CKO A;  1T5X D;  1VQG A;  2F0Q A;  5IY0 A;  3TBI B;  2C35 B;  1PTO F;  1XMQ Q;  2A69 D;  3MXN A;  4X64 L;  4QL5 A;  5J22 A;  1SXT A;  2VQE L;  3AEV A;  1O7Z A;  3VDY A;  1K83 H;  1WFQ A;  5M5X B;  1VQC A;  1B53 A;  3PV0 A;  2YV5 A;  1ENA A;  4ZK9 B;  2CFM A;  3RLF A;  2K75 A;  1K0R A;  5JJI A;  4K0K Q;  1WTQ A;  4QGU A;  1TS3 A;  1L2F A;  4DNT B;  4X3T A;  1M4V A;  4KI0 A;  4C3J B;  1FGB D;  2EE1 A;  5ELB A;  1LM0 A;  3WWV A;  4IJH A;  2R3Z A;  2E8G A;  1BNZ A;  4K5W A;  1ET9 A;  3WDN A;  3CCR A;  3S1R H;  4KV6 A;  1UEA B;  4DK3 C;  3NTI A;  2I5H A;  2F4V Q;  1TWG B;  1PH3 A;  3S15 B;  2CHB D;  1TII D;  1WCM B;  2WII B;  3ND8 A;  2WB1 B;  1PV4 A;  1A2T A;  1VCI A;  5A2Q L;  4BY1 H;  1K3B C;  2F0M A;  2B63 G;  4B3R L;  1FGU A;  1W3S A;  5KRU A;  2MGS A;  4K8J A;  4P75 A;  5KYI A;  4A93 B;  5A35 A;  4DV5 Q;  1VQA A;  3CC2 A;  1EL0 A;  5IT9 E;  4ILW A;  3M4Q A;  5AJ3 Q;  5DNF A;  1STE A;  1GKH A;  2BA1 A;  4BBR G;  3TDQ A;  1AE2 A;  1FNU A;  4YCW A;  3KK7 A;  2MO0 A;  1J5E Q;  5G3L D;  3E6Z X;  3VYR A;  3HKZ B;  3GTL B;  1HZC A;  4A3B H;  3SDZ A;  1Y1V G;  2MO1 A;  4DV2 Q;  1HHV A;  2L0C A;  5GAD C;  4LFC Q;  1GUW A;  2HDL A;  2R93 H;  1NAP A;  2JA6 H;  4RWS C;  3KDF B;  2TSS A;  3VYS A;  3VR4 A;  2ID0 A;  3DMU A;  3MHB A;  3OTO L;  2F3W A;  2NTT A;  1KLU D;  4FO2 A;  3H91 A;  5D65 A;  2A1A A;  4PMB A;  2B39 A;  1DGS A;  4A4I A;  2J4X A;  1IW7 C;  4FF4 A;  2OQ0 A;  3HOV B;  4BY7 H;  1V9P A;  1ENF A;  1SYD A;  4DUZ L;  4JC0 A;  4Q5V A;  3GDE A;  3G71 A;  2G5D A;  1IKL A;  1EWH A;  3STB C;  5CMD A;  5IIF A;  2R7F A;  3PF4 A;  2B8F A;  3K7U C;  4A3J H;  1PRT B;  5I2X A;  3KBG A;  1EIY B;  3QJY A;  4KLK A;  3RZO H;  3QG1 A;  4UHV A;  4A3M B;  3BYT B;  2KHS A;  3C1F A;  4HMI A;  3PO3 B;  3I3C A;  5FO8 B;  3CMA A;  2JJQ A;  4JPB W;  3ZJY C;  4GKJ L;  1H9S B;  1K0S A;  4HSP A;  4B3M Q;  2EYM A;  2K6A A;  3NQT A;  1JJC B;  2E5L Q;  1PH6 A;  3JC6 6;  4C3H B;  1GD7 A;  4CDF C;  1EY4 A;  4RKL A;  1NBW A;  2D5D A;  1R9T B;  3TQY A;  2ES2 A;  1HRJ A;  2GVB A;  4LK1 C;  4WFN 3;  1TY2 A;  2SEB D;  3JAM c;  2PMZ E;  1DD2 A;  2IPK D;  4R8N A;  4PZ8 A;  2K32 A;  3T16 A;  3RNU A;  1N36 L;  1X6O A;  2R93 G;  3KUP A;  3NBH B;  1S5C D;  2JA6 G;  3LWU A;  3A8K E;  1XWE A;  5CBE E;  5IYB G;  4XT1 B;  3J7A V;  3I4M H;  3RLO A;  5IWA L;  4ME3 A;  4H7B A;  4MNO A;  3E0J A;  2BDN A;  2VQF Q;  4G57 A;  1PH8 A;  4LMQ D;  1PRT D;  2A6E D;  3BVZ A;  3HOX G;  3VYT A;  1N33 L;  3VR3 A;  2K28 A;  5LL6 X;  3U4Z A;  1SNC A;  5ELF A;  2E2H B;  4YWM A;  1HQR D;  4J8Q A;  5ELC A;  1J8I A;  1K28 A;  1ILQ A;  4R4C A;  3NBI A;  3RLN A;  5IGB A;  4GN5 A;  4JV5 Q;  1VQB A;  3SGI A;  1B44 D;  4L6T B;  3CCJ A;  5M5Y B;  1BCP B;  1QUQ B;  3HOU G;  3F2B A;  2UXC L;  1PDQ A;  4RCN A;  4OWT B;  4V0B A;  3T1Y Q;  2UU9 Q;  4LF9 L;  1S5F D;  2WKC A;  3PIO A;  3CCM A;  2CW0 C;  1OTC A;  1IBL Q;  1KIX A;  1FNW A;  1A63 A;  1I50 B;  1J6Q A;  1U4M A;  1VQF A;  4DR7 L;  4QIW E;  1FL0 A;  3FHW A;  3R93 A;  3M4Y A;  1AEX A;  3M4O H;  5LL6 S;  3T1H L;  4O42 A;  4NXM Q;  1I3Q H;  1JOQ A;  3OMG A;  4CJ1 B;  4MZ9 A;  3I55 A;  3TS2 A;  2Q2U A;  1V8Q A;  4YY3 L;  1F77 A;  3D6C A;  4FXD A;  4DV3 Q;  1AFP A;  1RL2 A;  1RCV D;  2K50 A;  2VUM G;  4GLV B;  3RZD H;  5DAU A;  1QNU A;  2ZTC A;  3R2T A;  2V4D A;  4JOI A;  3MZ5 A;  4DA2 A;  4DXG A;  4F8M A;  1EWC A;  3F8T A;  5ELO A;  4DR2 Q;  1LV9 A;  1VQ4 A;  2JA7 G;  2EXD A;  1J9O A;  4CGY B;  4G7O C;  4CKE A;  2XWB B;  2IHF A;  2AWN A;  1F2Y A;  1G91 A;  2Y0S B;  3BYY B;  2D62 A;  4RG1 A;  4V19 0;  4JOI C;  1G2S A;  1QNK A;  2MP1 A;  3GTO H;  4KKT A;  4IUP A;  2A69 C;  1CM9 A;  1AZP A;  5C44 H;  4LUZ A;  4DV6 L;  2L55 A;  2F4V L;  3J80 L;  2OXP A;  5BR8 Q;  1QOH A;  2BDO A;  3CCS A;  1DOL A;  1Q8I A;  1RF2 D;  2FIN B;  5IT9 c;  2AUJ D;  3GTP B;  1SNQ A;  1PYW D;  3AFQ A;  2I46 A;  4RGM A;  1NTG A;  3SK4 A;  1O7I A;  1EZ6 A;  1EYC A;  2KA7 A;  1FJG Q;  3NPP A;  1JIC A;  4IUT A;  4L5T A;  1LTB D;  1SBB B;  3CC4 A;  4LF5 Q;  1OO9 B;  2FJ2 A;  1AH9 A;  1II3 A;  2KED A;  1XTD A;  2WAQ G;  3OIQ A;  4CKC A;  2E2J H;  4CHT B;  4JK1 C;  3S2H H;  4B3T L;  4HJA A;  4WJ3 M;  1GUO A;  1R4P B;  1EFI D;  3ITP A;  1EEI D;  3V05 A;  2JN4 A;  2N55 A;  4DXF A;  3M9B A;  1EOV A;  5FJ8 G;  4PZ6 A;  3BVM A;  1TWA H;  5FLX c;  3S1M H;  4DV2 L;  1KC8 C;  1PH9 A;  3PMF A;  2ZJR A;  2F0W A;  2PQE A;  5E7N A;  3KFU A;  4LF4 L;  1GHK A;  2VQE Q;  2IW3 A;  4KN4 C;  4CDE C;  1B4O A;  3V2T A;  4HID A;  3RN5 A;  1IKM A;  3K0X A;  3FDT A;  1STG A;  3ERS X;  3CXC A;  3KLS A;  3F2D A;  2L1B A;  1HZA A;  4B08 A;  3PQI A;  3ERQ A;  1I94 L;  1EY8 A;  2B2W A;  2K5N A;  2K5Q A;  4Y7N B;  2YTV A;  3I70 A;  4AIM A;  2R7D A;  4GN3 B;  3AMU A;  1I6H B;  1G6P A;  5EAY A;  5CV4 A;  3AQQ A;  1XPU A;  1K8G A;  3FPP A;  4H44 C;  4POF A;  3HOZ G;  2B2W C;  4M8A A;  2WKD A;  1VQO A;  2L12 A;  1CA6 A;  3FKI B;  4A3G H;  1H9M A;  1IBK L;  3NK9 A;  2ZTD A;  1HPC A;  2E75 C;  3HG9 A;  2WFW A;  1LTT D;  4X6A H;  4B3R Q;  3D6W A;  4JI5 L;  1A15 A;  1CHP D;  1TWH B;  2G9H D;  3IFD A;  2AHO B;  4QJF A;  4BBS B;  1TS5 A;  1XJV A;  1G2T A;  4I7Z C;  1C7Y A;  4B3M L;  2R92 G;  1C8C A;  4OGQ C;  1NE3 A;  3KF8 A;  4DKA C;  4TRD A;  4YWK A;  1U9R A;  4A3F B;  2NZH A;  4IOC A;  1QVG A;  4APV A;  4NPS A;  2Q8T A;  1CQV A;  4DN4 M;  1WTH A;  1ASY A;  2ASB A;  4RGO S;  1XMO L;  3P1H A;  4DV7 L;  1HNX L;  4TQU S;  1E22 A;  4IN3 A;  1E1O A;  1MHW C;  1SND A;  4EQN A;  1XNQ L;  3GQB A;  4P71 A;  4DR4 Q;  3SVM A;  4HN7 A;  4IAL A;  1K83 B;  5C3E G;  5I9P A;  1DXM A;  5T1G A;  2CH4 A;  4FF2 A;  1S5B D;  3BU2 A;  5FO7 B;  1EYG A;  5BN3 A;  3CU7 A;  1O80 A;  1RJT A;  3GTM H;  1WTX A;  1I4G A;  1T9H A;  2HQL A;  1SDF A;  1S72 A;  3CCE A;  2E76 C;  3OTO Q;  1TY0 A;  3J81 j;  3S1R B;  1WYD A;  1A62 A;  3OPO A;  3UDG A;  4X3S A;  3G6J B;  1VQE A;  5D3I B;  3CCV A;  4HJ9 A;  3G48 A;  1HTP A;  5JEA H;  5M3F H;  4OON A;  3U4V A;  4BY1 B;  2Q8R E;  1NUC A;  3UDI A;  4DK1 A;  4JV5 L;  5F2D A;  1H9S A;  1X3G A;  1CT1 D;  1F2L A;  1PRT C;  2A6E C;  2C5C A;  4XDX A;  3IFT A;  4DNI A;  2DNC A;  1G51 A;  1SYF A;  5LMN W;  3EQL C;  1Q90 A;  2B3G A;  2IWH A;  4IO9 A;  3MFY A;  1ET6 A;  4LW1 A;  2SNS A;  3G7L A;  3CPW A;  2JP1 A;  1K8M A;  1Q3L A;  3H94 A;  1GXD C;  3G4S A;  1PYS B;  5EKK A;  3SR1 A;  1PH5 A;  2VNU D;  3A7L A;  1M1K C;  4ODG A;  4A3B B;  3NBH A;  1LTR D;  1YNN C;  4CBV A;  4IFD H;  5C0X J;  1X56 A;  4XTC S;  2MHV A;  4X62 Q;  3A0J A;  1Y1W G;  5C4J H;  1V1P A;  1EWI A;  4JI3 L;  2R93 B;  1IL2 A;  3J81 i;  5ISR A;  2JA6 B;  2JA8 G;  4KHP L;  5JPN C;  4DV3 L;  5ELN A;  3A7A B;  4JBW A;  1K3R A;  1SFO H;  4RHS A;  2QDB A;  1RKN A;  2JA5 G;  1UNS A;  1IZ6 A;  2EYF A;  2ZT9 C;  4DR2 L;  5IWA Q;  1I4Q A;  1G29 1;  4NP5 A;  1D1I A;  2F3I A;  4FYD A;  4BY7 B;  1STH A;  2XIW A;  1HNZ L;  2WV6 D;  1Q12 A;  5EBC A;  1S40 A;  1QUQ A;  3TRE A;  2QKI C;  2EYP A;  3KOJ A;  1Q82 C;  4A3J B;  1GHJ A;  1KDC A;  4QMG A;  4OWW B;  2HHH L;  1S5E D;  1KDA A;  3RZO B;  1JOO A;  4U68 A;  2CW0 D;  2YYZ A;  4WOR A;  5BR8 L;  2UXB L;  1DOM A;  5KNB A;  3I4L A;  1B9N A;  3KF6 A;  3OW2 A;  1JE4 A;  2UXC Q;  4OWX B;  1JOR A;  1UAP A;  3EBE A;  5LMN Q;  2PI2 E;  4XQJ A;  1VQJ A;  1I4H A;  2B63 H;  3N52 A;  3CRK C;  4LF9 Q;  1FJG L;  1STN A;  4ZUI A;  4XYQ A;  2OTJ A;  1SYE A;  1SYB A;  1TR5 A;  2AKW B;  3TN2 A;  4Y52 H;  4R4T A;  1AN8 A;  5FKA C;  1VQL A;  2RF4 A;  3MWY W;  1PZJ D;  1KQS A;  4L5S A;  1B8A A;  1X3Q A;  2DUD A;  3ND9 A;  5COR A;  1SE8 A;  4L5R C;  4IUQ A;  3FVQ A;  2JE6 I;  5J39 A;  3I4M B;  1VF5 C;  3T1H Q;  3K58 A;  2VB3 X;  1CHQ D;  2JEA I;  5CR3 A;  4YY3 Q;  4TSS A;  1LTI D;  2DY7 A;  3I91 A;  1U4L A;  1YJN A;  4K2K A;  2RDG A;  5GAG C;  1F2M A;  1Y1V H;  4P73 A;  1Q7Y C;  1CZG A;  1Y8O B;  1MI2 A;  4R1J A;  5IGG A;  3Q23 A;  4GKK Q;  4A3L H;  1HR0 L;  2Z1C A;  4C56 C;  3S24 A;  1SYC A;  1V1O A;  1I4P A;  5NUC A;  2D9U A;  5IP9 G;  3GTG H;  4ULL A;  2YU9 H;  1GJX A;  2P5Z X;  4XQQ A;  1YJ9 A;  2F0V A;  4LF6 L;  4K5V A;  1SJE D;  1KDB A;  1LT4 D;  2A74 C;  2DJF C;  2PQA A;  1VQI A;  2XRQ D;  3MEF A;  5D3D A;  3EVQ A;  2XGT A;  1SYG A;  1B70 B;  2O5I C;  4HCS A;  4DV6 Q;  2QF7 A;  1RHP A;  2A68 D;  3ULL A;  2PNR C;  1JC7 A;  2AWO A;  1MBY A;  4IUU A;  1PRT F;  2RSN A;  1ZEQ X;  2UXD Q;  5E4X A;  1ZYR D;  1CKN B;  3UE1 A;  1X9N A;  5CV5 A;  3BZD B;  4JI1 L;  1ICW A;  1LAB A;  4DK0 A;  2RA4 A;  3L2P A;  1VQ6 A;  4LWC A;  1BOS A;  5CBA E;  3BVG A;  3K81 C;  2HQE A;  3M4O B;  2EYH A;  2Y0S E;  1I6V C;  1GOZ A;  1I3Q B;  2K04 A;  4B9W A;  1HNW L;  2LY7 A;  2NWG A;  3GD7 A;  3W3A A;  2HUG A;  1H9K A;  3KLS X;  1TS2 A;  2DJG C;  4JYA L;  2NVQ H;  3D3R A;  1EU4 A;  3CW2 C;  4IFD I;  4QF4 A;  5D14 A;  1IXR A;  2F0K A;  3RZD B;  3H6M A;  4IUN A;  1X65 A;  4B3T Q;  1H95 A;  3GTJ H;  4DR4 L;  4FXG C;  1STY A;  2EY5 A;  3DEP A;  3IAY A;  3NHH A;  1VMC A;  3BDC A;  1CSQ A;  1L1O A;  5DM6 3;  2HIV A;  2KQ3 A;  3NTK A;  2A6H D;  5CV9 A;  1WD1 A;  4A3L G;  5K5P A;  4WJ4 A;  2IL8 A;  2RBM A;  3J81 E;  4IJL A;  5FO9 B;  3MAQ A;  1UE5 A;  2VS1 A;  4LF4 Q;  3VR6 A;  3GTO B;  3E0E A;  4ZUJ A;  1EQT A;  3K59 A;  5IYB H;  3NSW A;  2NVY B;  3U58 A;  3SXH A;  1L1O C;  1MKH A;  2K7V A;  4O0A A;  2YTY A;  5C44 B;  4K8I A;  3W1G A;  4OO1 H;  2F0D A;  3S9W A;  4C1N I;  2F0I A;  1SNM A;  3HOX H;  2RQX A;  1DCZ A;  1JQY D;  3PUX A;  1YIT A;  1I94 Q;  1Z47 A;  1QIL A;  4UP8 A;  5M3M H;  2BE5 D;  5JAV A;  2ZJP A;  5C4H A;  2EQS A;  4WRD A;  1ROD A;  4DGZ A;  3PUY A;  5ELE A;  5BN5 A;  4AYB G;  1JCK B;  1YHQ A;  3CQZ H;  2BH2 A;  3K80 C;  4N8F A;  3I4N G;  4KY5 A;  3IRB A;  1BCP F;  4XXE A;  3ZYY X;  4A3E G;  2ZXR A;  3NP8 A;  2LXK A;  1SAP A;  1IBK Q;  2WAC A;  1VQ8 A;  2Z4I A;  4RGN A;  1JJG A;  3HOU H;  4JI5 Q;  1XXG A;  3DM3 A;  3CPF A;  3I72 A;  2E2J B;  1LTS D;  3S2H B;  1TT2 A;  3RR5 A;  3M7G A;  5KGU A;  4A3K G;  1CQF A;  3FP9 A;  2UUC Q;  1HXY D;  1O7Y A;  4ZYS A;  4EVO A;  4C3I H;  2H1E A;  3I73 A;  1GUN A;  1QB5 D;  1A2U A;  1LYL A;  2J0T D;  4C2M H;  5C3W A;  3NE5 B;  2RVL A;  1VQK A;  2CQA A;  3HOW G;  1LUZ A;  3HEJ A;  1EOT A;  3FRP B;  4ZQ3 A;  1TWA B;  3MTS A;  3S1M B;  4N8X 1;  3VR2 A;  2R7Z G;  4X62 L;  3S14 H;  3Q22 A;  3IKJ A;  3PGZ A;  3PUW A;  1XMO Q;  1ESF A;  4DV7 Q;  1HNX Q;  1U5K A;  2ZXO A;  3PSI A;  1XNQ Q;  5C4X G;  2SDF A;  2X6G A;  4CKB A;  3CC7 A;  1EQQ A;  1CFM A;  2ZM6 L;  5EPJ A;  4E6I A;  1RDP D;  1DZ1 A;  3H3V C;  3E3X A;  1GM5 A;  3CP0 A;  3S1N H; 
#chains in the Genus database with same CATH homology
 4HIK A;  4LUO A;  4GNX B;  4YHH L;  2VUM H;  1OXV A;  4JI0 L;  4UP9 A;  4JG2 A;  1AH9 A;  2CQO A;  1XTD A;  2WAQ G;  4OO1 G;  3Q8D A;  2E2J H;  3I2Z A;  4GLX A;  3S2H H;  4B3T L;  4HJA A;  4WJ3 M;  3H3V H;  3I4N H;  2BA0 A;  5M3M G;  3T1Y L;  3HOY G;  4A3E H;  2R6G A;  2OCE A;  2JA7 H;  1PA6 A;  2UU9 L;  4LNQ A;  3M9B A;  1EOV A;  1X55 A;  5FJ8 G;  4PZ6 A;  2K5H A;  1TWA H;  5FLX c;  4A3D G;  3PO2 G;  3S1M H;  3KJP A;  4DV2 L;  1KC8 C;  1PH9 A;  1Y14 B;  2DGY A;  2HIX A;  3H15 A;  2ZJR A;  4GKJ Q;  1IBL L;  3HFZ B;  5E7N A;  1IYJ B;  1YBY A;  4IPG A;  3W5O A;  1VQM A;  3GTP H;  4LF4 L;  3KFU A;  1VQP A;  1PVO A;  5GRO A;  1VQ9 A;  5JEA J;  2VQE Q;  2QA4 A;  3BZC A;  1NY4 A;  4HID A;  4UPA A;  4A3K H;  3NEN A;  3RN5 A;  3K0X A;  3I7F A;  4JCV E;  4DAY B;  3ERS X;  3S2D H;  3CXC A;  4AQY Q;  2GN5 A;  4OX9 L;  3F2D A;  4NXM L;  3A5Z B;  1HZA A;  5HY6 A;  3HOW H;  3FKI G;  4JI2 Q;  4LF5 Q;  5LMN L;  1I94 L;  2ZJQ A;  3M4P A;  2R7Z H;  3NEM A;  2LSS A;  2K5N A;  4J15 A;  5IP7 G;  4DV4 Q;  2YTV A;  1PFS A;  3I4O A;  1VQ5 A;  1N36 Q;  4AIM A;  2R7D A;  1KRS A;  4GN3 B;  3CCL A;  1YVC A;  5EAY A;  4R4Q A;  4DR3 Q;  5C4X H;  1G6P A;  4BBS G;  4JI6 L;  3AQQ A;  2RHQ B;  2RCN A;  1XPU A;  2OTL A;  4H02 A;  4YCU A;  3H0G H;  4POF A;  1K8G A;  3HOZ G;  1KD1 C;  2EIF A;  5IYD H;  1CSP A;  2Q2H A;  1VQO A;  1OXU A;  4A3F G;  4A3G H;  3RN2 A;  1IBK L;  1CUK A;  2ZTD A;  1GVP A;  1VS0 A;  1X54 A;  1N33 Q;  2WFW A;  4GOP B;  2E2I H;  2I5M X;  4LF8 Q;  1U0L A;  4X6A H;  5JEA G;  4LFB L;  4B3R Q;  1MIU A;  3KF8 B;  4JI5 L;  5M3F G;  3KYH C;  4X65 L;  1NMF A;  4JI3 Q;  5C0X G;  4QJF A;  2AHO B;  3K8A A;  2KHI A;  4KHP Q;  5K36 G;  1XJV A;  1C7Y A;  2Y0S G;  4B3M L;  1E3P A;  1FVI A;  3B6Y A;  3W1B A;  4JI4 L;  2R92 G;  4NXN Q;  1NE3 A;  1HJP A;  5GAH C;  4DKA C;  3PUV A;  4YWK A;  1CKM A;  4A76 A;  4IPD A;  2IHE A;  5FJ8 H;  4EX5 A;  4A3D H;  3L0O A;  2NZH A;  4MTN A;  4IOC A;  4LFA Q;  1QVG A;  2L15 A;  4APV A;  1TWF H;  3CCU A;  3PO2 H;  4NPS A;  4P74 A;  4GKK L;  4Y7N H;  1SR3 A;  1JJ2 A;  1HR0 W;  1P16 A;  1ASY A;  5JJL A;  2ASB A;  1JT8 A;  1VQD A;  1XMO L;  4DV7 L;  1QVF A;  1N9W A;  1HNX L;  1I6H H;  4TQU S;  1E22 A;  2N3S A;  1E1O A;  1XNQ L;  4OO1 I;  4BA1 I;  4GN4 B;  1A0I A;  4P71 A;  1PH4 A;  3D0F A;  4DR4 Q;  1N34 L;  1HNZ Q;  5C3E G;  1SRO A;  5DLQ E;  1YHB A;  3KLW A;  4DR5 L;  3FKI H;  1UWV A;  3BU2 A;  2Z0S A;  3BZK A;  1XNR L;  1EYG A;  5IP7 H;  4LF5 L;  4IFD G;  5GAE C;  3GTK H;  2HHH Q;  1YZ6 A;  3GTM H;  2NN6 G;  4BY1 G;  1WOC A;  1UEB A;  1TWH H;  5M5W H;  1SMX A;  4IPC A;  2I5L X;  5JJK A;  1QZG A;  4LUV A;  4BBS H;  1T9H A;  2HQL A;  2UXB Q;  2UXD L;  4R4I A;  1S72 A;  4DR7 Q;  2VL6 A;  4BBR H;  3CCE A;  3HOZ H;  1XPO A;  4GS3 A;  3OTO Q;  3J81 j;  3K7A H;  3M7N A;  4HIM A;  1WYD A;  1A62 A;  2FXQ A;  3UDG A;  2H5X A;  4A3F H;  2MFI A;  1PH1 A;  4JBJ A;  1CKO A;  1VQG A;  2JK8 A;  1E7Z A;  1VQE A;  4HIO A;  5IY0 A;  1TWC H;  4DV1 Q;  3CCV A;  2C35 B;  2BH8 A;  3G48 A;  4HJ9 A;  1LTL A;  5M3F H;  4OON A;  3H0G G;  3F1Z A;  3U4V A;  1XMQ Q;  2Z6K C;  4X64 L;  4QL5 A;  4R4O A;  5H1S E;  2VQE L;  1X3F A;  3UDI A;  3AEV A;  4JV5 L;  3VDY A;  2R92 H;  4IOA A;  1K83 H;  1WFQ A;  1VQC A;  2UUA L;  4HJ5 A;  3PV0 A;  2YV5 A;  4A75 A;  1X3G A;  2CFM A;  3RLF A;  1PH2 A;  2K75 A;  1K0R A;  4DNI A;  1WCM G;  1G51 A;  4JI2 L;  4A3B G;  4K0K Q;  5JJI A;  1PYB A;  3PCO B;  1KAW A;  5LMN W;  1IBM Q;  2WB1 G;  4DR1 Q;  4QGU A;  4IO9 A;  1L2F A;  2B3G A;  3J81 c;  1KXL A;  3BJU A;  4LW1 A;  2Q2I A;  3CPW A;  4KI0 A;  3S1Q H;  1B7Y B;  2V1C C;  2MNA A;  1BBU A;  1LM0 A;  4X66 Q;  3WWV A;  4DR3 L;  3G4S A;  4IJH A;  4A93 G;  2E8G A;  5C3E H;  1PYS B;  3CCR A;  3S1R H;  4DK3 C;  1PH5 A;  2VNU D;  2I5H A;  1M1K C;  1PH3 A;  1HZB A;  1ASZ A;  2F4V Q;  1EFW A;  5IYC G;  5C0X J;  1X56 A;  1PV4 A;  4XTC S;  1VCI A;  1HR0 Q;  4BY1 H;  4X62 Q;  2B63 G;  4B3R L;  3H3V I;  1FGU A;  3A0J A;  1Y1W G;  1W3S A;  2CWA A;  5C4J H;  4ALP A;  1EWI A;  4JI3 L;  2VZA A;  1E24 A;  4DV0 Q;  4HJ8 A;  2N49 A;  3J81 i;  3NEL A;  3PIP A;  1KL9 A;  4P75 A;  1IL2 A;  4BY7 G;  2JA8 G;  4KHP L;  2AMC B;  5M5X H;  4DV3 L;  5ELN A;  1MJE A;  4JBW A;  3HKZ G;  4LF6 Q;  1K3R A;  4POG A;  4DV5 Q;  4NXN L;  1VQA A;  1SFO H;  1HZ9 A;  2RHS B;  3CC2 A;  3CD6 A;  1D8L A;  2JA5 G;  4LFA L;  3M4Q A;  1IZ6 A;  5LMU Q;  5AJ3 Q;  4A3J G;  1GKH A;  1Q8K A;  2BA1 A;  4DR2 L;  4AYB E;  4BBR G;  5IWA Q;  2XTI A;  4DAM A;  1M90 C;  1G29 1;  4C3J H;  1N32 Q;  4QY7 A;  4PZ7 A;  1SN8 A;  1AE2 A;  1Q1E A;  4YCW A;  2F3I A;  3OYY A;  3J7Z C;  2VW9 A;  1GO3 E;  2Q2T A;  4HJ7 A;  4JI7 L;  1YNX A;  3LGJ A;  3S16 H;  2MO0 A;  1J5E Q;  2IX1 A;  1HNZ L;  2CWP A;  1Q12 A;  1V43 A;  4TVA B;  4IFD J;  1TWG H;  3PUZ A;  1HZC A;  3S15 H;  4JI1 Q;  1QUQ A;  1S40 A;  1WCM H;  2CCZ A;  4A3B H;  3TRE A;  5IE8 A;  4DR6 Q;  2IT1 A;  1Y1V G;  2CKZ B;  3M3Y H;  3KOJ A;  1Q82 C;  3S17 H;  2MO1 A;  4DV2 Q;  2UUC L;  4B3S L;  4OWW B;  1TXY A;  3KF6 B;  2HHH L;  1Q86 C;  4BXX G;  5GAD C;  4AH6 A;  4LFC Q;  1NMG A;  2YYZ A;  2R93 H;  3HOV G;  1OXX K;  2JA6 H;  3CF5 A;  3KDF B;  1HNW Q;  4JI8 Q;  5BR8 L;  2A19 A;  2UXB L;  4A93 H;  2ID0 A;  3OTO L;  4JYA Q;  3KF6 A;  3J80 c;  3OW2 A;  1OXS C;  2UXC Q;  4OX9 Q;  4OWX B;  2A1A A;  1EIF A;  2QGQ A;  3EBE A;  5LMN Q;  3KDF A;  2PI2 E;  5IYC H;  1C0A A;  4DV1 L;  1QZH A;  1VQJ A;  1YJW A;  4A3M G;  2B63 H;  1DGS A;  3I4M G;  3G6E A;  1Y1W H;  1XMQ L;  4A4I A;  4LF9 Q;  1E1T A;  3PO3 G;  1FJG L;  4DUY L;  2OQ0 A;  1WI5 A;  4BY7 H;  1V9P A;  2D0P A;  1L0W A;  2OTJ A;  2UUB Q;  2AKW B;  2JA8 H;  4DUZ L;  3E9H A;  4JC0 A;  3GDE A;  4Y52 H;  3U50 C;  1EQR A;  2LXJ A;  4R4T A;  4FDB A;  3G71 A;  3GTL H;  4DPG A;  2ZTE A;  4A3C G;  3STB C;  3A74 A;  1P8L A;  2R7F A;  1VQL A;  2RF4 A;  3PF4 A;  1KQS A;  4L5S A;  1B8A A;  2DUD A;  3K7U C;  4K0K L;  2JA5 H;  1SE8 A;  4L5Q A;  4A3J H;  2WAQ E;  4NB3 A;  4L5R C;  1IBM L;  1UE6 A;  2Z6K A;  3J80 i;  1EIY B;  4KLK A;  2JE6 I;  1JMC A;  3RZO H;  2WP8 J;  2JEB I;  1YI2 A;  3MXN B;  3T1H Q;  3UDX A;  3CMA A;  2KBN A;  4GLA C;  2JEA I;  2JJQ A;  4X66 L;  3ZJY C;  2NVY H;  4GKJ L;  4YY3 Q;  3D31 A;  4XIG S;  1Z9F A;  4B3M Q;  1SRU A;  4DK6 C;  3J7A 5;  1QVC A;  2NZO A;  1VQ7 A;  1YJN A;  1JJC B;  1I5F A;  2E5L Q;  5GAG C;  1PH6 A;  1Y1V H;  4P73 A;  3JC6 6;  1Q7Y C;  1GD7 A;  4R1J A;  2K4K A;  4UP7 A;  4GKK Q;  1NBW A;  4A3L H;  3TQY A;  2KCM A;  1HR0 L;  2ES2 A;  1KHI A;  2GVB A;  2YTX A;  4AQY L;  4BXX H;  3S24 A;  1K8A C;  2JA9 A;  2PQA B;  3HOV H;  4A3I H;  3JAM c;  2PMZ E;  1MJC A;  1WJJ A;  5IP9 G;  5FLM H;  2YU9 H;  3GTG H;  3KJO A;  2PNH A;  4DV4 L;  1YJ9 A;  1PHJ A;  1W2B A;  4LF6 L;  4PZ8 A;  4DV5 L;  3RNU A;  1N36 L;  4YCV A;  1X6O A;  2PQA A;  1VQI A;  3MEF A;  3NBH B;  4DR5 Q;  2K52 A;  3L7Z C;  2R93 G;  3AFP A;  2JA6 G;  4KHZ A;  2XGT A;  5AJ3 L;  5IYB G;  5C0X I;  4A3M H;  3I4M H;  3RLO A;  1B70 B;  5IWA L;  4ME3 A;  1N32 L;  4DV6 Q;  3PO3 H;  4MNO A;  3ULL A;  2VQF Q;  1K73 C;  1Q81 C;  1PH8 A;  4IPH A;  2AWO A;  3HOX G;  1J5E L;  4LF7 Q;  2UXD Q;  1N33 L;  2MQH A;  4A3C H;  4LF8 L;  1CKN B;  3U4Z A;  3UDF A;  3UE1 A;  1X9N A;  4GNX A;  4YWM A;  3JAM i;  1XPR A;  4JI1 L;  3HKS A;  4JBM A;  4DR6 L;  2HT1 A;  2PI2 A;  1KRT A;  2K14 A;  4C3H H;  3GTQ H;  3L2P A;  1Q1B A;  3AYH B;  4LWC A;  1R9T H;  2OWO A;  1VQ6 A;  4PMW A;  1CKN A;  2ZM6 Q;  3K81 C;  2ATW A;  3TRZ A;  2VY3 A;  4LFC L;  4X64 Q;  4R4C A;  1AE3 A;  2Y0S E;  4OXP A;  3RLN A;  4GNX C;  4GN5 A;  1HNW L;  2KHJ A;  2N8N A;  3GD7 A;  4JI8 L;  4JV5 Q;  2ALY B;  2NVT H;  4BA2 I;  1VQB A;  1UE7 A;  3SGI A;  4JYA L;  4JBK A;  4YHH Q;  3CCJ A;  2UUA Q;  2NVQ H;  3CW2 C;  4JI0 Q;  4IFD I;  1QUQ B;  1IXR A;  1BBW A;  3HOU G;  1OXT A;  5GQO A;  3F2B A;  4QQB X;  2UXC L;  4PG3 A;  2NN6 I;  1L1O B;  5HGQ A;  1X65 A;  4RMF A;  4B3T Q;  1JB7 A;  4OWT B;  3GTJ H;  4UY8 C;  2IY5 B;  1H95 A;  4DR4 L;  5J3B A;  2OQK A;  3T1Y Q;  5C44 G;  2UU9 Q;  4LF9 L;  1CSQ A;  1L1O A;  5IP9 H;  2UUB L;  2HIV A;  3PIO A;  3CCM A;  2D0O A;  1OTC A;  4A3L G;  1IBL Q;  2E2H H;  4WJ4 A;  4IJL A;  1KIX A;  1A63 A;  1UE5 A;  2F52 A;  2VS1 A;  2JQO A;  4LF4 Q;  1J6Q A;  4A3I G;  3E0E A;  2KEN A;  5IYB H;  1VQF A;  1UE1 A;  5FLM G;  4DR7 L;  4QIW E;  3U58 A;  1FL0 A;  1L1O C;  1MKH A;  3FHW A;  3ULJ A;  4O0A A;  2YTY A;  3M4O H;  3M85 A;  3T1H L;  1YIJ A;  3W1G A;  1JE5 A;  4NXM Q;  1EUJ A;  1I3Q H;  4MZ9 A;  3I55 A;  3TS2 A;  3HOX H;  2Q2U A;  3PUX A;  1YIT A;  1I94 Q;  3ICE A;  4YY3 L;  1Z47 A;  1K9M C;  4UP8 A;  1A8V A;  3EIV A;  5M3M H;  1X3E A;  5M5Y H;  3DLL A;  4DV3 Q;  2ZJP A;  3HOY H;  4GOP A;  1RL2 A;  2K50 A;  3I56 A;  2VUM G;  4GLV B;  3RZD H;  3CME A;  2EQS A;  2E5L L;  1PH7 A;  2ZTC A;  3TS0 A;  2GVA A;  3PUY A;  3F2C A;  1YHQ A;  4AYB G;  2I0Q A;  3CQZ H;  2BH2 A;  4JOI A;  4JI6 Q;  3K80 C;  3F8T A;  3CCQ A;  1VQH A;  1NJI C;  5ELO A;  3IRB A;  4DR2 Q;  3I4N G;  2N78 A;  4A3E G;  1VQ4 A;  2JA7 G;  3ULP A;  1BVS A;  2K5V A;  4GOP C;  2EXD A;  2LXK A;  4JI7 Q;  1IBK Q;  1VQ8 A;  2IHF A;  4EQ5 A;  4DR1 L;  3CAM A;  2AWN A;  1RIP A;  1JJG A;  1VQN A;  2D62 A;  4RG1 A;  1I50 H;  4JOI C;  2WB1 E;  4LFB Q;  3HOU H;  4JI5 Q;  3DM3 A;  3CPF A;  4P72 A;  4X65 Q;  3GTO H;  3ER0 A;  4YWL A;  1YEZ A;  3RR5 A;  3EN2 A;  4A3K G;  3FP9 A;  2UUC Q;  1BKB A;  4B3S Q;  5C44 H;  4JI4 Q;  4LUZ A;  4C3I H;  4DV6 L;  1D7Q A;  2F4V L;  1LYL A;  3TEH B;  4C2M H;  2VQF L;  3E9I A;  3STB D;  1VQK A;  3HOW G;  3PF5 A;  1LUZ A;  1S3O A;  5BR8 Q;  4LF7 L;  2A8V A;  1HH2 P;  3CCS A;  1Q46 A;  2R7Z G;  2IX0 A;  4X62 L;  3S14 H;  1SLJ A;  3PGZ A;  3PUW A;  5IT9 c;  3A5U A;  1XMO Q;  4DV7 Q;  4DV0 L;  1YHA A;  1U5K A;  1HNX Q;  3AFQ A;  3PSI A;  1XNQ Q;  1NTG A;  3UE0 A;  5C4X G;  3CC7 A;  1O7I A;  1N34 Q;  1EQQ A;  2ZM6 L;  3GO5 A;  1C9O A;  5IYD G;  2B29 A;  1FJG Q;  3HKZ E;  4DUY Q;  2NVX H;  1V1Q A;  4L5T A;  2QEX A;  4O2D A;  1GM5 A;  4A3G G;  5LMU L;  3CP0 A;  4DUZ Q;  1N8R C;  3CC4 A;  1XNR Q;  2KCT A;  3S1N H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...