4DV2L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv2L00
3PUWA 3G6EA 4A3MG 1C0AA 4A3FH 1GD7A 1HJPA 1X55A 4GS3A 2E2IH 2N49A 4DNIA 3RZDH 3DM3A 4A3KG 3OW2A 4X66L 4DR2L 4JI7L 5IY0A 1JJCB 1U5KA 1UE1A 5M3MH 4JI0L 3RZOH 4DUYL 1HNZQ 1WOCA 4B3RL 1OXUA 4K0KL 1JT8A 4DV4L 3AEVA 4RMFA 2YV5A 4R4IA 5BR8Q 4DV6L 4B3TQ 4JI2Q 3HOVG 1XMQQ 4Y52H 2V1CC 4L5QA 3CCRA 1SLJA 4B3ML 5J3BA 1EIYB 2JA6H 1V9PA 4R1JA 4A3FG 3H3VI 4DUZQ 2F3IA 2JA8H 1V1QA 3A74A 3I55A 2BH2A 2R92G 4GKJQ 2OTLA 2CQOA 2L15A 4LFBL 2K52A 2UXDL 5M3MG 3GDEA 2F52A 1VQ9A 4GN5A 1SRUA 4LFCL 3U58A 2GVBA 3HKSA 4H02A 5GADC 4A75A 4DPGA 3JAMi 4RG1A 3G71A 3H3VH 4L5TA 1AE2A 1NBWA 1G6PA 3E0EA 4P74A 5JJIA 3ER0A 3WWVA 5JJKA 3GTKH 2JA6G 3PF5A 4QY7A 4GNXA 2F4VL 3M4PA 4LFAQ 2UU9Q 2JA8G 1K83H 5M3FH 4BA2I 4IOAA 1BBWA 1J5EQ 1B70B 4JV5L 3GTMH 2BA1A 1DGSA 3D31A 2CWAA 4DV7L 4DR7L 3J7A5 4PZ6A 2KHIA 4NXML 1RL2A 3ERSX 4JC0A 4P75A 5ELNA 1YITA 3H0GH 4P71A 3S14H 4GNXC 1Y14B 3K8AA 4LWCA 1KQSA 3I4NH 1YNXA 3S2HH 2RHSB 4KLKA 3HOWH 5JEAJ 1YVCA 1KAWA 2IX0A 3PV0A 4JI8L 3F2CA 4A76A 2JA7H 3S2DH 1YHQA 3PUVA 1B8AA 1CKNA 1CKMA 3EIVA 5FLXc 3L2PA 2B29A 1SN8A 1PYSB 4IJLA 3TQYA 5M3FG 4A93H 1D7QA 1VQPA 1PH2A 4JI4Q 3HFZB 4X62L 1N36Q 1HNWL 1E3PA 5GQOA 2I5LX 1YJ9A 4JOIA 1TWFH 4YY3Q 4LF7L 1Q8KA 1NE3A 1A62A 3KOJA 1A8VA 3MEFA 3ULJA 2AWOA 1PH5A 2K5VA 4YCUA 2RF4A 4NXNL 3H0GG 1JJ2A 5IWAQ 2VQFL 3CXCA 1QZHA 2RHQB 3I4NG 2N78A 1CSPA 4JI3L 3HOWG 1VQJA 3STBC 3TS0A 2QA4A 1EQQA 3CW2C 2JA7G 3HOYH 3PIOA 2IX1A 2VW9A 5IYBG 2I5MX 3JC66 4A93G 2JQOA 4AYBE 2E5LL 4OO1I 4GLVB 2VQEQ 3T1HL 1HNXL 3U4ZA 3A5UA 4HIMA 1X3FA 1PHJA 4KHPL 1K8GA 4A3GG 2IT1A 2R7FA 2Z0SA 5GAHC 3TRZA 2OQKA 1EUJA 4UP9A 4YCWA 5IT9c 1CUKA 3KF8B 1XNQL 2NZHA 1HR0W 4X64L 4TQUS 4OX9Q 3S16H 4IPGA 1LUZA 3HOYG 1Q1BA 3HOXH 1E24A 3CCJA 4BY7H 2ALYB 4IFDJ 4LF6Q 4DR5Q 3LGJA 4LNQA 1KRSA 4POGA 2MFIA 2EXDA 4DK6C 1L1OB 1LYLA 1SROA 5LMNL 3AFPA 3GTPH 4QIWE 3BU2A 3CCUA 5LMUQ 1HZCA 3B6YA 4GKKL 5JJLA 3S24A 5C0XG 1HZAA 2XGTA 1N32Q 4P73A 1WYDA 2RCNA 1EYGA 4GOPB 4BA1I 5HGQA 4DR4Q 5DLQE 1XNRL 2I5HA 1PH7A 1T9HA 4AQYQ 4FDBA 3HOXG 4LF4L 3HOUH 4AIMA 2ZM6L 1IBKL 2D62A 2HHHL 2FXQA 3Q8DA 4DR6Q 2OQ0A 4LF8L 1VQLA 3PSIA 2K4KA 4A3LH 1XTDA 1PH8A 2UUBL 3KLWA 2NN6G 4DV0Q 5IYDH 1PH3A 1HZBA 4DV3L 4BXXG 3W1GA 4J15A 2GVAA 2KHJA 1KC8C 2R92H 4YHHQ 3PF4A 4A3IH 1HZ9A 3KJPA 4L5SA 2WAQG 1RIPA 3GTJH 1K73C 1KD1C 3VDYA 3HOUG 1YJNA 4LF9Q 1WCMG 1N34Q 2B3GA 1PH6A 4C3HH 4BY1H 4DV5Q 1CSQA 3M9BA 1Q86C 1IBML 4A3LG 4JI5Q 5M5WH 1Q7YC 4YWKA 4LF5L 4DV2L 4PZ7A 1VCIA 1VQDA 5IYDG 5BR8L 1PH9A 1PH4A 1VQBA 1FL0A 1VQFA 4BBRH 2UUCQ 4B3TL 2PQAB 3K0XA 5IP7H 5IP9H 4DR2Q 4XTCS 4JI7Q 2UXCL 1VQ6A 4JI0Q 4A3IG 1EWIA 4EQ5A 2JJQA 4DUYQ 2JEBI 1VQOA 1P16A 4DUZL 1K9MC 3CCSA 1KRTA 4UP8A 2Y0SG 1IBLL 4DV6Q 1C7YA 4JYAQ 4R4TA 4JBJA 4P72A 1TWCH 1FJGQ 1OXTA 2K5NA 3UE1A 4X65L 3CC2A 4BY1G 1N33Q 4C3IH 2WB1E 3RR5A 4DV1Q 2DGYA 3F2BA 1QUQB 2OWOA 4B3MQ 3HOZH 2LXJA 1KHIA 3AYHB 4GN4B 3RLFA 2E2JH 4BBRG 1OXSC 3CCEA 2KCTA 4JYAL 2UXBL 2XTIA 5IP9G 3L7ZC 4NB3A 5IP7G 4LFBQ 4LFCQ 1MJCA 2GN5A 3J80c 3NEMA 1K8AC 2UU9L 4B3SQ 1L1OA 3K81C 4LFAL 4JBKA 1V43A 3HKZG 4L5RC 4GLAC 4JCVE 1OXVA 3CCQA 3GTOH 3PO2H 4Y7NH 4OXPA 1YHBA 4O2DA 3KDFB 4A3BH 4XIGS 3HOZG 1A63A 5GAGC 3ULPA 1E1OA 2K5HA 4PZ8A 2LXKA 1OXXK 2HIVA 2F4VQ 4BBSH 2AHOB 3CMEA 1N8RC 1C9OA 4JV5Q 1L1OC 2IHEA 4A3EH 5IYBH 1H95A 3EBEA 4DR7Q 1YJWA 5FLMH 4KI0A 3J81c 1GKHA 1QZGA 3KF6A 2ZJPA 1VQHA 1WI5A 3E9HA 4GOPC 2MQHA 4A3JH 3BZKA 2R93H 4JI4L 3PO2G 3UDGA 3OYYA 3OTOL 4A3BG 1YBYA 3D0FA 2PI2A 2Z6KC 4JI8Q 1YI2A 3M85A 4C2MH 1VQGA 1I94L 4DR3Q 1XJVA 5LMNW 4BBSG 1W3SA 1J6QA 4HJ5A 3S1RH 2NVTH 2KBNA 2VS1A 1UE5A 5C0XI 4A3EG 3GTLH 1HNWQ 2ZTCA 4X62Q 1KIXA 2WFWA 3NENA 3NELA 4A3DH 1VS0A 5FLMG 5C3EH 1I3QH 1IXRA 1K0RA 1OTCA 2A19A 1VQ8A 5HY6A 2VY3A 4UPAA 4POFA 2NZOA 2IHFA 1YIJA 3EN2A 4A3JG 2K50A 4O0AA 2R93G 1MKHA 1PA6A 2UUAL 1K3RA 2VQEL 4JI3Q 4IFDG 5EAYA 5AJ3Q 3PGZA 1VQEA 3IRBA 2PQAA 1X3GA 1MJEA 3ICEA 4IPHA 3M3YH 5GROA 1E22A 1D8LA 2NN6I 2ZTEA 1W2BA 3RN2A 2BH8A 3K7AH 4OWWB 1FGUA 2C35B 1UE6A 1JMCA 3M7NA 1SMXA 3RLOA 2ASBA 2JE6I 1VQMA 1SFOH 2JA5H 3T1HQ 5IYCH 4A3DG 3GD7A 1WJJA 5C3EG 4JI6L 1IZ6A 1EOVA 3FHWA 4KHPQ 2ES2A 2ZTDA 2ATWA 1QUQA 3F1ZA 4DR5L 1VQ4A 1XMOQ 1Q46A 1VQIA 2N8NA 3PIPA 1M90C 2NVYH 3K7UC 4PG3A 3S1MH 1LTLA 4BXXH 1FVIA 1M1KC 1XNQQ 1BVSA 2CKZB 2IY5B 2YTXA 5C44H 3I7FA 3CC4A 1VQCA 4OWXB 4JI1L 3JAMc 1UEBA 3KYHC 1QVFA 3U50C 2EIFA 1WCMH 4DR4L 5LMNQ 2JA5G 2D0PA 3TREA 2Q2IA 5IYCG 2YTVA 4AQYL 3KDFA 4GKKQ 1X56A 4R4OA 2Q2UA 3STBD 1PH1A 3GO5A 3T1YL 3NBHB 2QEXA 4IPCA 1JJGA 1XNRQ 4LF7Q 4HJ7A 4DV0L 5C44G 1L0WA 3I4MG 2LSSA 3CAMA 2ZM6Q 3DLLA 1TWAH 1CKOA 1IBKQ 1PVOA 3F8TA 1PV4A 4LF8Q 4YHHL 2Q2HA 1HR0Q 4DR1Q 3RLNA 4IO9A 4YCVA 1Z47A 2AMCB 1I94Q 3CP0A 1G291 1N9WA 1HNZL 2VUMH 1B7YB 3I4OA 2B63H 3RN5A 2D0OA 2H5XA 3G48A 1I6HH 1SR3A 4JI2L 4JI5L 3AQQA 2CCZA 1BKBA 1XMQL 2K14A 2PMZE 4X66Q 1PYBA 2NVXH 1KXLA 4R4QA 1S72A 3G4SA 1O7IA 4AH6A 2QGQA 5M5YH 1VQ7A 2UUCL 2R7ZH 4B3RQ 2AKWB 4DV4Q 4K0KQ 1EQRA 2MO1A 4AYBG 5E7NA 4DAYB 4LW1A 3CF5A 4GKJL 4BY7G 3CCLA 1IBMQ 4A4IA 1SE8A 3CC7A 3F2DA 4LF5Q 4DV2Q 3PUXA 4QJFA 2VUMG 3RNUA 1WFQA 1YZ6A 2B63G 3PO3H 1XPRA 2R6GA 1MIUA 4TVAB 1Y1WH 1FJGL 1N33L 2UXCQ 4DV1L 2MO0A 1VQ5A 1NTGA 4WJ4A 4JG2A 2AWNA 4QL5A 2UXDQ 1I5FA 1X54A 3PCOB 5C4XH 3I56A 2OTJA 4KHZA 1S40A 1Q82C 1IBLQ 4HJ8A 4IOCA 3S17H 2R7ZG 4EX5A 3KFUA 2ZJRA 2Q2TA 2A8VA 5JEAG 4X65Q 1Y1VH 3A5ZB 1J5EL 1UE7A 3CQZH 4JBMA 4IPDA 2A1AA 1X9NA 4B3SL 3J81j 1XPOA 3CD6A 2ID0A 1E7ZA 1NMGA 4YWLA 2ZJQA 3ZJYC 2N3SA 3CCMA 3A0JA 1X6OA 1AE3A 3SGIA 4ALPA 4GOPA 1E1TA 1Y1WG 3PO3G 4UY8C 2UXBQ 4IJHA 4IFDI 5FJ8H 1GVPA 2Z6KA 1YHAA 3BZCA 4C3JH 3S15H 4LUVA 3TS2A 4A3GH 4DV7Q 5C4XG 1QVGA 3PUZA 4R4CA 4DAMA 1VQAA 3FP9A 4HJAA 4NXMQ 2R7DA 1Q12A 3AFQA 4MNOA 3S1QH 2VNUD 1Y1VG 1TWGH 3GTGH 4MTNA 1N36L 2WP8J 4QGUA 2VZAA 4YY3L 1L2FA 3W5OA 5IWAL 1TWHH 3FKIH 3L0OA 1BBUA 2JK8A 3UDFA 5FJ8G 3PUYA 3CCVA 3CPWA 1EIFA 4DR3L 1KL9A 3I2ZA 4HIKA 4X6AH 4DK3C 1A0IA 1X65A 1R9TH 2WAQE 1ASYA 2VL6A 4LUOA 1YEZA 4YWMA 1EFWA 4NXNQ 5C4JH 3OTOQ 1I50H 2NVQH 2VQFQ 3BJUA 4QQBX 4MZ9A 4GN3B 4ME3A 3TEHB 1NJIC 2BA0A 1HH2P 1ASZA 1JB7A 3U4VA 2I0QA 2K75A 2KCMA 1UWVA 4OONA 3K80C 5AJ3L 2YTYA 3FKIG 1NMFA 2PI2E 2E5LQ 4JOIC 3MXNB 4OX9L 4WJ3M 2JEAI 1HNXQ 2PNHA 2E8GA 4LUZA 4LF6L 2UUAQ 2Y0SE 1QVCA 2WB1G 2E2HH 4HJ9A 1GM5A 3J80i 1Q1EA 4X64Q 3UE0A 1XMOL 1GO3E 2YYZA 2CWPA 5LMUL 2HIXA 5IE8A 1N32L 1LM0A 2KENA 2EQSA 3J7ZC 3W1BA 4GNXB 2OCEA 3M4QA 4JI6Q 1X3EA 1PFSA 3KJOA 3GTQH 5H1SE 2HT1A 4DR6L 3E9IA 4NPSA 1U0LA 3HKZE 4PMWA 3UDXA 1Q81C 3I4MH 4A3CH 5M5XH 2YU9H 2MNAA 4APVA 1Z9FA 4HIOA 4A3MH 4UP7A 3J81i 3CMAA 1JE5A 3UDIA 4DKAC 5K36G 1VQNA 1S3OA 4HIDA 5GAEC 1AH9A 1IYJB 4JI1Q 4LF4Q 4A3KH 2HHHQ 1P8LA 2DUDA 4OO1G 4OWTB 3ULLA 1IL2A 3H15A 1XPUA 3S1NH 1CKNB 1VQKA 1TXYA 5C0XJ 2CFMA 4GLXA 5ELOA 1NY4A 2HQLA 2UUBQ 3CPFA 3M4OH 4LF9L 4JBWA 4DV3Q 3HOVH 1G51A 1N34L 3KF6B 4DR1L 2JA9A 3T1YQ 1HR0L 4A3CG 4DV5L
chains in the Genus database with same CATH superfamily
3PUWA 3G6EA 2F0TA 3MFGA 4GS3A 2E2IH 1MSHA 1B2TA 3OW2A 3D6CA 5IY0A 1JJCB 2F0SA 1WOCA 4ZLTF 3S9WA 4DV4L 2YV5A 3BVGA 4JI2Q 4RFBA 3HOVG 3I73A 2XNAC 1I6HB 1EIYB 2R61A 3H3VI 1X3QA 1F9RA 1SE3A 4DUZQ 1A3UA 1V1QA 3I55A 2BH2A 5KYLA 4GKJQ 4KY7A 2CQOA 1WD0A 2L15A 2K52A 2UXDL 3V05A 3GDEA 4C1NK 4CBVA 3HKSA 5EJWA 3H3VH 1G6ZA 3G71A 1PDQA 1QOHA 1OO9B 4DAPA 4IURA 5T1IA 2F0JA 2J7ZA 3ER0A 3WWVA 3GTKH 1PTOD 3QIAA 4GNXA 2F4VL 1NSNS 5C4XB 4BA2I 3GTMH 3S17B 1JOQA 1PRTD 3NQTA 4P75A 4JC0A 5ELNA 4FF3A 2OEOA 3H0GH 3NTKA 2PZUA 1Y14B 1KQSA 4KLKA 2LS01 3S2DH 1KAWA 2XWBB 3WOFA 1PRTB 5JVG3 1V8QA 3PUVA 3EIVA 3L2PA 2B29A 4IJLA 1D7QA 1HNWL 1AZPA 1N36Q 1HTLD 4RHRA 1TWFH 5IIFA 3VA5A 1A62A 1A8VA 2RDHA 2K5VA 4HTHA 3H0GG 4QCLA 4K5WA 4JI3L 1VQJA 3STBC 2QA4A 2XSCA 3L3OC 4ZQ3A 2K6AA 3JC66 4E6IA 1PZID 5HURA 1HNXL 3A5UA 4DF7A 2TMPA 2IT1A 1S5BD 2O2LD 5C0XH 5GAHC 2OQKA 1EUJA 3E0JA 4UP9A 1CUKA 2B2TC 4OX9Q 3S16H 4IPGA 3EJIA 1Q1BA 2ALYB 4LF6Q 1K8MA 4Z9CB 4XDXA 2OT2A 4POGA 5FO9B 1SJED 4X3TA 3R2TA 1SROA 5LMNL 3WDNA 5LMUQ 3B6YA 1LLRD 2K5DA 3S24A 5C0XG 1ILQA 1JOOA 2QCPX 1O78A 3A8IE 4BA1I 3VR2A 5DLQE 4CJ0B 1D2BA 1IBKL 3GV6A 2D62A 2HHHL 2FXQA 3GTQB 2OQ0A 2WKCA 3PSIA 2R3ZA 1PH8A 3WOEA 2EYLA 3MFYA 1PH3A 4RKBA 4BXXG 1HRJA 5CBAE 2KHJA 1KC8C 4A3IH 1H9JA 4OHJA 1HZ9A 4KMUC 4QB4A 2WAQG 3S1NB 3VYUA 2SEBD 3RD4A 1HPCA 4EQOA 4JI5Q 4LF5L 4DV2L 3T16A 1VCIA 2HQEA 4B3TL 4BBRH 3T13A 2WINB 4DR2Q 3MXNA 4A3IG 1EWIA 4EQ5A 3H94A 2JEBI 1VQOA 1P16A 3M4YA 2Y0SG 2FHTA 4DV6Q 1NR4A 1TWCH 4X65L 3F2BA 2OWOA 3HOZH 1KHIA 3K5NA 4GN4B 1Y1WB 4CJ1B 1S5DD 3KF8A 4OEMB 2EYJA 4BBRG 1LT4D 2UXBL 4CHTB 3L7ZC 4EQPA 4K14A 1MJCA 2GN5A 3J80c 4LFCQ 1HCZA 4DU9A 1L1OA 1RF2D 2M00A 2F0UA 3BDLA 4L5RC 1KNAA 3GTOH 2P5ZX 4O2DA 3K57A 3KDFB 3HOZG 1SMYC 4PZ8A 2HIVA 2RBMA 5TSSA 2Q8TA 3F2UA 2LFNA 4C3JB 2IHEA 1H95A 4O42A 3C3LA 3EBEA 4DR7Q 1YJWA 5FLMH 2QILA 1QZGA 2ZJPA 3OWFA 3E9HA 3TMEA 3GTGB 3BZKA 3OTOL 4JI8Q 4HCEA 1YI2A 1W3SA 4HJ5A 3D3RA 2KBNA 3BDOA 3KUPA 1UE5A 1K0SA 1SEBD 3GTLH 4DA2A 1KIXA 2B2TA 2E74C 4A3DH 5FLMG 5C3EH 4LF7Q 2VY3A 2XRSD 4YIJA 4POFA 5C4JB 2IHFA 2A5HA 2EZVA 1A3VA 4O0AA 3OOCA 4IFDG 1NAPA 3EROA 5AJ3Q 4FF1A 1G2TA 4U673 1VQEA 3IRBA 1X3GA 5FLXE 1MJEA 3M3YH 3SE0A 3QWNA 1W2BA 4P2CB 1ESRA 1FGUA 3D4RA 3M7NA 2JA5H 4LK1C 3T1HQ 4A3DG 3IFTA 5C3EG 1IZ6A 1EOVA 3FHWA 1STEA 1WTXA 1D5XC 3P20A 5D14A 1VQIA 3PIPA 3D4DA 1FVIA 4HSVA 4QUCA 3OSOA 3G6JB 3KYHC 1CT1D 5D3DA 4DR4L 1I4GA 2JA5G 1XTCD 3OWEB 3TREA 1HUMA 2YTVA 4AQYL 2EY5A 5CV6A 1SXTA 5IT9E 2YU9B 2Q2UA 3GO5A 4IPCA 3LX0A 1L0WA 2LSSA 2VXWA 3QOLA 1X32A 2PCFB 5EPJA 3NPPA 1XWEA 1PTOC 2TSSA 3NWSA 5IGCA 4LF8Q 3HOUB 1HR0Q 2K03A 2IL8A 5KIXA 2AMCB 1HNZL 3M4OB 2B2VA 2F0EA 1I6HH 2RCFA 1SNMA 2CCZA 2X69A 3U9OA 3KBGA 4X66Q 1KXLA 4J6HA 4V0BA 2F0VA 3G4SA 1O7IA 2QGQA 2AKWB 5FLXL 3URYA 3I72A 4G4KA 3RMHA 3KBXA 4C3HB 1D1IA 2PQEA 3RNUA 1DCZA 1CQFA 3X3MA 1YZ6A 3PO3H 1HXYD 1FJGL 1MIUA 1L0XB 1N33L 1JB3A 1EIHA 5T1GA 1A2TA 1KNEA 4JG2A 4MIUA 2E76C 3I56A 5C4XH 2OTJA 2XN9C 3OW7A 1IBLQ 4IOCA 3S17H 1E2WA 2A8VA 3A5ZB 5BN5A 2WKDA 1GXDC 1PTOH 1X9NA 4B3SL 4YWLA 2K5WA 4JYAQ 3A0JA 3PO3G 2B39A 1TIID 3GTKB 3SK5A 2M9VA 5IT9L 4LUVA 3NE5B 4DV7Q 5C4XG 1QVGA 2QKIC 1WTPA 3GTMB 4HJAA 5KNBA 1Q12A 2JXMB 3E6ZX 1B9MA 2KHSA 3BZDB 3MAQA 2VZAA 1VMCA 4RH6A 5I6WA 2PPBC 3FKIH 3UDFA 3MXGA 2FJ2A 3PUYA 2NBFA 1EIFA 4DR3L 1KL9A 4HIKA 1BDOA 4X6AH 1I4QA 1A0IA 1X65A 2WAQE 1ASYA 2VL6A 3DM1A 4PNYA 1LABA 3VR3A 4NXNQ 4JW0A 1TWFB 1TKWB 2N55A 1MGSA 1O7LA 2J4XA 2L11A 2BA0A 1HH2P 1ASZA 1C48A 2I0QA 1EZ6A 3V2TA 2YTYA 3FKIG 1NMFA 4FXKC 4HEDA 3SXHA 3S1RB 1BCPF 3MXNB 2D2CC 1F9SA 3SDZA 2CH4W 5G3LD 2PNHA 3ZYYX 3SVMA 1FNUA 2Y0SE 4F87A 3SHLA 4EVOA 4XQNA 1EYDA 2YYZA 4KKSA 4G7HC 2CWPA 2ZXPA 2HDMA 1N32L 1ICWA 2KENA 4G7ZC 5DM63 2QW7A 2EQSA 1O7ZA 3M4QA 3SR1A 2BOSA 3GTQH 2HT1A 3MTSA 1LTBD 4APVA 1FNWA 4HIOA 2DJGC 4FNFA 4UP7A 1EY5A 4HIDA 2Z8LA 4OIJA 1I4RA 4A3KH 4Q0FA 2DUDA 2WAQB 1B3QA 1EU4A 3S1NH 1CKNB 1H9SA 2F0PA 5EKKA 1NY4A 2HQLA 3K59A 2L12A 4LF9L 4JBWA 4DV3Q 1G51A 3T1YQ 4DR1L 1RHPA 1IKLA 2LMCB 1TS2A 1GD7A 1RD9D 1X55A 1ZYRC 2K28A 2N49A 4KKUA 4CDFC 4A3IB 3RZDH 4A3KG 1U5KA 4JI0L 2H1EA 1GHJA 2KEDA 2Y0SB 4CGYB 4DUYL 1EY0A 1OXUA 4K0KL 4RMFA 2NTSA 2VUMB 4ZUJA 4L5QA 3CCRA 1C4QA 4B3ML 4BBRB 3VR4A 1JWMD 3K0YA 2RSNA 3U9SA 3A74A 2HD3A 1SNQA 4C56C 2SDFA 4K6LA 1VQ9A 4GN5A 1EWCA 2GVBA 4ZRZA 4DPGA 4RG1A 5C6AA 5KGUA 3HOZB 1AE2A 1NBWA 1G6PA 4KN4C 1HQMC 2MHVA 1EFID 5EBDA 4DGZA 2L5TA 3OMGA 4LFAQ 2UU9Q 4IOAA 2L4NA 2IW3A 4R9WA 2HUGA 3J7A5 2KHIA 1KTKA 5CV4A 1RL2A 4NXML 1HUNA 1D5ZC 2D9UA 4GNXC 4C3IG 3I4NH 2F0OA 5JEAJ 1PZJD 4A76A 1Q8IA 1YHQA 3S15B 1SYBA 5FLXc 4XQQA 2XRQD 2EDGA 3EVQA 1Y8OB 3HFZB 1VQPA 2I5LX 1QJOA 1Q8KA 1NE3A 2KCNA 3TS2A 4A3GH 1I94Q 4KK7A 3NTIA 2RF4A 3P1HA 3I4NG 1CI3M 1CSPA 4K6DA 1WTQA 1TWHB 3CW2C 4DAYA 3GTLB 3L9AX 1JR0D 1BF4A 4A3DB 5C3EB 2E5LL 4OO1I 4GLVB 2F3VA 2VQEQ 4EGVA 1SMYD 1I50B 3U4ZA 1X3FA 5M9OA 2RQXA 1K8GA 1B4OA 4A3GG 1AFPA 3D6WA 4PMCA 4K8IA 4YCWA 5IT9c 5EGTA 1XNQL 1Z7TA 3SK8A 1HR0W 2F0LA 1LUZA 4ZKBB 4DR5Q 1DONA 3QJYA 1QE6A 3R2IA 4ID6A 2NN6H 2K32A 4QIWE 1VF5C 4H13C 4GKKL 4PV1C 1HZAA 4ZCKA 1WYDA 1EYGA 1STYA 1K8OA 5HGQA 1KLUD 5C3WA 4CJ2C 1D5MC 1XNRL 1PH7A 3HOUH 4FDBA 2ZM6L 3BVZA 4S3SA 1VQLA 3A54A 3T56B 2F0FA 1PFBA 2KA7A 2O4XA 5CV8A 1F2YA 1XTDA 5M5XB 2NN6G 5IYDH 4A3MB 1HZBA 4BS9A 1B9NA 1CHQD 2NTTA 4G7OC 3KJPA 2N88A 1KD1C 1RIPA 3HOUG 2HDLA 4CDDC 1PH6A 4C3HH 1MSGA 1SSOA 1Q7YC 5I2YA 1T5XD 5IYDG 5ELCA 1PH4A 1FL0A 2PQAB 4DXFA 4A3FB 1CM9A 3K0XA 5IP7H 2UXCL 1SNDA 1VDZA 2M2LA 3IFDA 4DUZL 1CZWA 4XYQA 3RZOB 5J1ZA 4NMZA 4R4TA 5ELBA 1C7YA 4P72A 2K5NA 4C3HG 4QIWB 1CZGA 1SYEA 3MXPA 1QUQB 2KECA 4UHVA 3PO3B 3DXJC 1GUTA 3DUZA 2EJFC 2XTIA 5IP7G 3R3OA 4K2KA 5CYUA 1UAPA 5ELDA 3K81C 2QEJC 3HKZG 4JCVE 1RJTA 1PTOB 1YHBA 5IGEA 4A3BH 1EU3A 1M4VA 1E1OA 2K5HA 2LXKA 1OXXK 2F4VQ 2I07B 2NB0A 4RWSC 1L1OC 5I6YA 1IKMA 1H9SB 3KF6A 4GOPC 3W2DA 1SJHD 3OYYA 4C1NI 2AUJD 4A3BG 3D0FA 3M85A 1UUPA 3FKIB 1J6QA 3S1RH 4RCNA 5C0XI 3EFXD 1HNWQ 2WFWA 4A93B 1VS0A 1K0RA 2A19A 3C1EA 3BDCA 2NZOA 4ABNA 1GUNA 1KAAA 1YIJA 2UUAL 1K3RA 4JI3Q 2OF1A 3ICEA 1BNZA 1JOKA 5CR3A 1E22A 3E5SA 2PZWA 2ZTEA 2BH8A 1SYFA 1SMXA 3RLOA 2BDOA 2F0QA 1KDBA 5IYCH 4JI6L 2EYMA 2XIWA 2ES2A 5KYIA 3VR5A 3TDQA 2ZXRA 3P75A 1XMOQ 3S1MH 5CV9A 3K7UC 4BXXH 2CKZB 3CC4A 2WIIB 5DEHA 3MHBA 1EQTA 3A7LA 5DAUA 4OWXB 4DNRB 2FMCA 1UEBA 3KLSX 3H6MA 5LMNQ 5IYCG 1QWYA 5IGDA 1X56A 4HR7B 1RTOA 1PH1A 1BBXC 1JJGA 4B9WA 1STNA 2L55A 2O5JC 4A3KB 3DLLA 1IBKQ 1TWAH 3F8TA 1PV4A 2B2UC 4PQXA 5IOCA 4QF4A 3A56A 2F0MA 3TN2A 2VUMH 3T4AC 2Q8RE 3NTHA 3I4OA 3RN5A 3G48A 1BOSA 1SR3A 4I65A 4JI5L 3AQQA 2MPMA 1XMQL 2K14A 5EKLA 2A6HD 1MI2A 1RDPD 3K5OA 1V1OA 3O13A 3RZDB 1NNXA 4B3RQ 2R7ZH 3CF5A 1TS3A 4AYBG 4DAYB 1BCPD 3CCLA 2B2VC 4KHVA 3F2DA 4LF5Q 4DV2Q 3D8GA 1PFMA 2B2WA 4QJFA 4XQJA 2VUMG 4V190 5M5WB 1BR9A 1XPRA 4TVAB 2XWJB 3DWPA 3R93A 1UEAB 4IUUA 1Q82C 4HJ8A 2R7ZG 4EX5A 3TBIB 3KFUA 2ZJRA 4X65Q 3FDTA 1Y1VH 1J5EL 1F2MA 4JBMA 3CQZH 5I2XA 4X3UA 3PQIA 5CV5A 4XYOA 1Z6HA 3CD6A 1G2SA 2ID0A 4NP5A 1ZYRD 4C3IB 2ZJQA 3ZJYC 2N3SA 3CCMA 4GOPA 2UXBQ 4UY8C 4IFDI 1YHAA 3S15H 4N9TA 4DAMA 3S1QH 2R7DA 3AFQA 4MNOA 1DZ1A 1Y1VG 1TWGH 4JVZA 3MWYW 2PYKA 4IFDH 1STBA 2E75C 2WP8J 4YY3L 3I4NB 3J7AV 3W5OA 5IWAL 1TWHH 3NK9A 3L0OA 3DEOA 1CQVA 1A15A 3CPWA 5C3XA 1KLGD 4FYDA 3PIO3 2K7VA 1HFNA 3Q6SA 1I50H 3OTOQ 2VQFQ 4QQBX 4MZ9A 1FNVA 4A3JB 3LWUA 4A3GB 2JP1A 2EY6A 1NJIC 1LTID 1JB7A 1HHVA 2K75A 2X6LA 2A73B 2KCMA 5AJ3L 1EY8A 1ENCA 2F0DA 2JYOA 4JOIC 2BCOA 2E8GA 2NUCA 1Y8PB 4LUZA 3KLSA 2WB1G 3UI2A 4HJ9A 5BN3A 3HS0C 5CBEE 4N8FA 1TQOA 4X64Q 5KEEA 2Z9HA 3A8JE 4WJWA 4GNXB 4RKLA 1SAPA 2EYFA 1ENAA 3CHBD 3KJOA 1ET6A 1SFOB 2PZTA 3NXWA 2B2UA 4DR6L 3I4MH 3HKZE 4OL7A 5M5XH 4A3MH 2L9HA 1S3OA 1AH9A 1EY7A 1IYJB 1BQQT 1SNOA 4HCSA 1UNSA 2BDNA 4IUNA 4LF4Q 1P8LA 1CTMA 3H09A 1IL2A 1PRTF 3H15A 4F8MA 1TXYA 2CFMA 2UUBQ 3CPFA 1Y8NB 3LWEA 3I4MG 1N34L 3KF6B 1HR0L 2JA9A 2QDLA 5E4XA 2A69C 3K58A 4DV5L 4Y52H 1JICA 1I4PA 1R4PB 4A3MG 3JAME 1C0AA 3CKIB 4A3FH 1HJPA 4I7AA 4M1UB 4DNIA 4X66L 2F3WA 1A3TA 5LL6S 4JI7L 1UE1A 3RZOH 1HNZQ 3AEVA 1SE4A 4R4IA 5BR8Q 3GP7A 3Q22A 5CMDA 4RGNA 5J3BA 1V9PA 4A3FG 2F0HA 2F3IA 5JOBA 2R92G 4F88A 1YNJC 4OGQC 4LFBL 4X3KA 3HKZB 1SRUA 3KLRA 4H02A 3JAMi 4L5TA 2CQAA 4F7XA 1EEFD 3E0EA 4P74A 5JJIA 3PF5A 4QY7A 4IUQA 1K83H 1W6JA 5M3FH 1BBWA 4JV5L 4HMJA 3K6OA 1QG7A 2CWAA 4DV7L 3I3CA 1ET9A 2X6GA 4PZ6A 3ERSX 1YITA 4P71A 2O5IC 4A3BB 1M8AA 3K8AA 1AN8A 1D6EC 1ZKOA 3NBHA 1G8ZD 1YNXA 3I70A 4LWCA 1YVCA 2IX0A 3F2CA 2DN8A 3P7JA 1CKMA 3MXUA 1SN8A 3JAML 5M3FG 2EOTA 4A93H 2RKSA 2ZT9C 4JI4Q 4X62L 2D5DA 1E3PA 4JOIA 1T5EA 2WV6D 4H44C 1EQVA 5C5LA 4LJZC 4NXNL 1JJ2A 4ZKCB 2RHQB 3TS0A 1GJXA 3EA6A 1EQQA 4TSSA 1TY2A 2IX1A 3FPPA 5IYBG 2I5MX 4A93G 1LO5D 1E2VA 2JQOA 4AYBE 1R9TB 1W6KA 2NVQB 3GV3A 2XVSA 1HQRD 1PHJA 4KHPL 1H9RA 1ONLA 5IGFA 5CC4A 4L63B 3KF8B 2NZHA 1J8IA 4TQUS 3NHHA 4M8AA 2A6HC 3CCJA 1E24A 1STAA 4KD3A 4TKOB 1PMRA 4LNQA 1FGBD 2MFIA 1L1OB 1BCPC 3AB9A 1KABA 3OPOA 1LT5D 3AFPA 3BS1A 4LAAA 3GTPH 3S1MB 3BU2A 3CCUA 1C8CA 5JJLA 1N32Q 1SE2A 4P73A 2RCNA 4GZYC 4GOPB 3VYRA 5E3FA 2I5HA 3ERQA 4OELB 1QNKA 4FXGC 3Q8DA 4A3LH 1G91A 3LNNA 4DV0Q 4DV3L 3W1GA 3N6RA 1MHWC 4J15A 2GVAA 4YHHQ 3PF4A 1STHA 3DWQA 4Q5VA 1TWAB 4L5SA 4AYBB 1K73C 4L8JA 3GTJH 1XYIA 4LF9Q 1WCMG 2F0WA 3Q0AA 1PYWD 1Q86C 1IBML 4A3LG 4H7BA 5M5WH 1PFNA 4YWKA 4PZ7A 5JPMC 5E1FA 1VQDA 4UAIA 1VQFA 2UUCQ 1PZKD 4JI0Q 2JJQA 4DUYQ 2R7ZB 5M3MB 3CCSA 1EIGA 4UP8A 3UE1A 3MVVA 2WB1E 3A7AB 4C3IH 2DGYA 5I4DA 4DV1Q 4B3MQ 2LXJA 3AYHB 3RLFA 1TT2A 2E2JH 2JA6B 2KCTA 1WTOA 4IQZA 2JA8B 3QOJA 2ZXOA 1GUWA 2UU9L 1Y1VB 4ME5A 4LFAL 4JBKA 1V43A 1ZXTA 3CQZB 4U68A 1EWHA 3PO2H 5ELFA 1DYQA 4HSPA 4OXPA 1A63A 3I4LA 2QF7A 2AHOB 2L1BA 3CMEA 2A68D 4A3EH 3MA2B 5LL6X 1WTWA 4KI0A 3S1QB 1RKNA 1JC7A 5JVH3 1TWGB 4A3JH 2R93H 3PO2G 3S14B 1YBYA 1B50A 1VQGA 1I94L 3HOWB 3HZXA 4A3EG 3FRPB 5FO8B 3NENA 2F1MA 1OTCA 1IXRA 1VQ8A 5HY6A 2WB1B 5DNFA 4A3JG 2K50A 2R93G 1PA6A 2VQEL 5EAYA 1F9PA 3NP8A 1IYVA 2KUMA 1D8LA 2NN6I 3RN2A 4G57A 3K7AH 1VQMA 1SFOH 3GD7A 1GUSA 1EL0A 2G9DA 2ZTDA 2ATWA 3F1ZA 4DN4M 4DR5L 1LTRD 1DOMA 1VQ4A 1Q46A 1TR5A 2PO4A 5JJZA 1A6XA 4PG3A 2DNCA 1LTLA 1M1KC 1XNQQ 2IY5B 3I7FA 3NWTA 4JI1L 1TS5A 5IGBA 3NSWA 3OHXC 3JAMc 3U50C 1GHKA 2EIFA 3HOXB 1PXUA 1NR2A 2Q2IA 1HFGA 1FD7D 3I4MB 3KDFA 4GKKQ 3C2PA 3GQBA 2F03A 1KDAA 2SNSA 3NBHB 1XNRQ 5C4ZA 1EY6A 2ZM6Q 1PVOA 4RHSA 3RUZA 1WTRA 3RLNA 1WVLA 4YCVA 1N9WA 2MUYA 1B7YB 2D0OA 4JI2L 1BKBA 1QILA 1HA6A 2NVXH 1PYBA 1S5CD 2LKVA 5DM73 1S72A 2MGSA 2R92B 4K8JA 1K3BC 4AH6A 1SBBB 4DV4Q 2MO1A 3QB3A 5E7NA 4LW1A 4GKJL 4A4IA 3DWAA 1SE8A 1XXGA 3D4WA 2WACA 1WTHA 4BY1B 5C5MA 3T53B 2EYPA 1I4HA 2R6GA 2UXCQ 2MO0A 1VQ5A 4WJ4A 5CGKA 1AEXA 3Q24A 2UXDQ 4KHZA 1RTNA 2FMMA 5G3LF 2B2WC 3AU7A 2Q2TA 5FOBB 2EE1A 2A69D 2IX3A 2HCIA 3I91A 4IPDA 4KV6A 2CVRA 2EY2A 2EXZA 2C9OA 1E7ZA 1NMGA 1XPOA 5FO7B 4UDUC 3SGIA 2EJMA 4ALPA 1E1TA 4FF2A 1TU2B 1MD2D 1GVPA 1JWSD 3BZCA 2BE5D 5COYA 5EPLA 1K83B 5M3FB 3PUZA 2F0NA 1VQAA 2QDBA 2VNUD 1VMPA 3HP3A 2ENBA 4MTNA 1N36L 2B2YA 4Y7NB 4QGUA 3NUCA 4HMIA 1YNJD 4BBSB 1BBUA 2JK8A 2I46A 3CCVA 4NDXA 5I9PA 5EPKA 4DK1A 5J39A 1HA5A 4DK3C 1R9TH 5A2QE 2EJGC 1IW7D 4YWMA 2NVQH 1KDCA 4GN3B 4ME3A 3TEHB 3TP8A 3ND8A 5JPNC 2FFKB 2IWHA 3DHQA 4IALA 4C2MB 2DJFC 4OONA 2Q8IB 3J81E 2MP1A 2NVTB 3QG1A 3NQIA 1E0BA 4OX9L 2JEAI 4I7ZC 1HNXQ 1JWUD 4IUTA 2Z1CA 1I3QB 4LF6L 2UUAQ 4RGOS 4N8X1 1QVCA 2NWGA 1J9OA 4KJNA 5K36H 2J0TD 1QNUA 3UE0A 3NBIA 1GO3E 1XMOL 5LMUL 2HIXA 1EY9A 1V1PA 5IE8A 1LM0A 1CFMA 2CHBD 3J7ZC 4JI6Q 1AW7A 1II3A 1PFSA 5H1SE 1CA6A 1D1KA 1I4XA 1K28A 2DNEA 3E9IA 4NPSA 1U0LA 4B9XA 3UDXA 4A3CH 2MNAA 3GTPB 1Z9FA 2NVYB 3J81i 3CMAA 3UDIA 4DKAC 1SYCA 5K36G 1VQNA 3VR6A 1EY4A 5C44B 1AP0A 3ITPA 1EZ8A 2HHHQ 1Q3LA 1VQKA 1WCMB 5C0XJ 4GLXA 2G9HD 4H0LC 1ZEQX 4A3CG 3PIOA 2H4OA 1VQ7A 5A2QL 1SYGA 4K5VA 3ND9A 1NUCA 3J7YW 1DJRD 3DM3A 4DR2L 3GTJB 5M3MH 2A68C 4B3RL 3J81L 1JT8A 4DV6L 4B3TQ 4WRDA 2B63B 1XMQQ 2V1CC 5IODA 3CRLC 4KKTA 4CDEC 1SLJA 1CHPD 2RDFA 2JA6H 1BCPB 4R1JA 2JA8H 2OTLA 5M5YB 2B8FA 5E4WC 3TP7A 2A6ED 5M3MG 2F52A 3MC0B 4NKLA 4CKBA 4LFCL 3U58A 5EQ0A 5GADC 4A75A 5KRUA 3QO2A 2E2JB 5JJKA 2JA6G 1JQYD 5C4HA 3FVQA 1SDFA 3M4PA 2JA8G 2AUKA 4RGTA 1B70B 1J5EQ 2KVMA 1TY0A 2BA1A 1DGSA 3D31A 4DR7L 2EYOA 2F4IA 3PO2B 3S14H 3VYSA 3S2HH 3ONAB 2RHSB 3HOWH 3PV0A 4JI8L 2AQ2B 4ZYSA 2JA7H 2KJXA 2VB3X 4A3EB 1EYAA 1B8AA 1CKNA 1PYSB 4BWGB 3TQYA 1HTPA 1BO0A 5EKIA 2K1BA 1PH2A 5GQOA 2Z4HA 4L6TB 1YJ9A 2B8GA 4LF7L 4YY3Q 2R93B 3KOJA 3BVMA 3MEFA 3ULJA 3K5LA 2AWOA 2PW5A 4YCUA 1PH5A 1O7YA 1RODA 5IWAQ 2VQFL 1YNNC 3CXCA 1QZHA 4B08A 2N78A 4KY6A 3HOWG 4ZUIA 1GUOA 1VF7A 1LV9A 3SEBA 3OMCA 2JA7G 3HOYH 3SK6A 2VW9A 3FMCA 2Z4IA 3HRZC 3T1HL 4HIMA 2R7FA 3QR8A 3V96A 2Z0SA 2K5QA 3FPUB 3TRZA 4X64L 3K7AB 3HOYG 3HOXH 4BY7H 4DAVA 4IFDJ 1R4QB 3LGJA 5D65A 4DNTB 1KRSA 2EXDA 2DY7A 1JE4A 3DMUA 4DK6C 1LYLA 1BUVT 2E2HB 2KEEA 1A2UA 4CDCC 4RA8A 3FEWX 1HZCA 1PTOF 4MTKA 4MHEA 2XGTA 4RAUC 5CORA 2ICIA 5NUCA 4DR4Q 4JK1C 2Z6BA 1T9HA 4AQYQ 3HOXG 4BY7G 4LF4L 2JSOA 4AIMA 4DR6Q 4WFN3 1XX8A 4LF8L 4DFAA 3IL8A 2K4KA 1EOTA 5J22A 4PMBA 1JCKB 2A74C 3KLWA 2UUBL 1H9KA 4KTAA 2VB2X 1U4MA 2RVLA 2R92H 5AFWA 2F0KA 2BE5C 4KY5A 3VDYA 3BG3A 1YJNA 4X3SA 1N34Q 2B3GA 5D3IB 4DV5Q 1CSQA 3M9BA 4BY1H 1LTTD 1PRTC 2EVBA 3HOVB 1ML0D 3CRKC 2L0CA 4XXEA 1LTSD 2IPKD 5BR8L 1PH9A 1VQBA 1DOKA 4ILWA 2NVXB 2CW0D 4J1MA 4XTCS 5IP9H 4JI7Q 2E2IB 1VQ6A 1NCVA 1F2ZA 1SNCA 1K9MC 2C5CA 1KRTA 1IBLL 1BXTA 1SNPA 4JBJA 1FJGQ 1OXTA 3CC2A 1N33Q 4BY1G 1EEID 3RR5A 1IW7C 2KCCA 4OIKA 4QMGA 4ODGA 4JYAL 1OXSC 2G5DA 2KOLA 3CCEA 5IP9G 4NB3A 4HN7A 4LFBQ 1V1PB 1EYCA 2EPBA 3PIP3 5L37A 4R8IA 3NEMA 1K8AC 1F2LA 4B3SQ 3DEPA 4K5XA 4GLAC 3CCQA 1OXVA 5K5PA 4EQNA 4Y7NH 4JPBW 4J8QA 4XIGS 5CV7A 5GAGC 3ULPA 4LMQD 1E2ZA 4BBSH 1U4RA 1N8RC 1C9OA 4JV5Q 2LY7A 1GOZA 2IJ0A 4FVMA 5IYBH 2F0GA 1IYUA 3J81c 1GKHA 5KNCA 1VQHA 1WI5A 1U4LA 2MQHA 4JI4L 2F0IA 3UDGA 4RGMA 3A55A 2K05A 3H0GB 2PI2A 2Z6KC 2GA4B 4C2MH 4DR3Q 2SOBA 1XJVA 4IUPA 5LMNW 4BBSG 2NVTH 3S2DB 2VS1A 1F9QA 4IUVA 3TSSA 2ZTCA 4X62Q 4DXGA 3NELA 3CU7A 1I3QH 3EQLC 2KQ3A 4UPAA 2NZ1D 3EN2A 1MKHA 1B1ZA 3OIQA 3PGZA 1L0YB 2PQAA 2RDGA 4IPHA 5GROA 2PNRC 3TP6A 1QCBD 4OWWB 2C35B 1UE6A 1JMCA 5ELEA 2ASBA 3AMUA 2JE6I 1WJJA 4WORA 3HEJA 5BN4A 3TZUA 4KHPQ 1QUQA 3KK7A 1JORA 2V4DA 2N8NA 1M90C 2NVYH 3N52A 4KN7C 3T51B 4ZAIA 1BVSA 2PW7A 2FINB 2YTXA 5C44H 1VQCA 2AQ3B 3S16B 1F77A 3H91A 1QVFA 2EY1A 4K2LA 1O80A 1WCMH 3K5MA 1ESFA 4IZ8A 3W3AA 2D0PA 4ZK9B 1CK1A 2A6EC 1I6VC 5A35A 4R4OA 2HCCA 3STBD 3OIPA 3T1YL 3E3XA 1LACA 2QEXA 4HJ7A 4DV0L 5C44G 3BYTB 3CAMA 1CKOA 3Q23A 1S5ED 1LT3D 4YHHL 2RA4A 1IL8A 2Q2HA 4DR1Q 5JAVA 4IO9A 1Z47A 1LT6D 1G291 3CP0A 1U9RA 3R8BA 2B63H 2H5XA 4XT3B 2PMZE 1AZQA 4R4QA 1B53A 1LTAD 1S4ZA 5M5YH 2UUCL 3I8ZA 4K0KQ 1EQRA 4WJ3M 5JEAH 3C1FA 1IBMQ 1FR3A 3CC7A 3PUXA 2E2DC 5ISRA 1Y69U 1WFQA 2B63G 4IN3A 1Y1WH 5I9OA 4DV1L 1NTGA 2AWNA 4QL5A 1I5FA 2RSOA 1X54A 3PCOB 3SK4A 5LHY1 1S40A 1DXMA 1CA5A 5JEAG 1LTGD 2ICEC 3M7GA 1UE7A 1FYCA 1TWCB 2A1AA 3J81j 1X6OA 1AE3A 1B44D 1Y1WG 1IHZA 2NYZD 5F2DA 4IJHA 3IAYA 1TVXA 5FJ8H 4C3JH 2Z6KA 2JN4A 4DK0A 1PLFA 3HG9A 4R4CA 3PMFA 5FK9C 2CH4A 3FP9A 4NXMQ 3G7LA 3A8KE 1DD2A 1WTVA 4MN3A 3GTGH 4N9PA 3GTOB 1QB5D 3S2HB 2PMZB 4HAEA 1L2FA 3J80E 1Q90A 2AQ1B 2JA7B 4C3JG 5FJ8G 3I2ZA 1WD1A 1ILPA 4CKEA 5KNDA 2B2YC 4LUOA 1YEZA 1EFWA 5C4JH 3BJUA 3MZ5A 4FP5D 1U4PA 4TRDA 3U4VA 2MJ8A 1H9MA 1UWVA 3K80C 3TZDA 4R8NA 4QUFA 3HOYB 2PI2E 2E5LQ 3X3NA 1GUGA 3BYYB 1ICFB 4ULLA 2DY8A 4KJOA 1STGA 2E2HH 1GM5A 1TS4A 5HGTA 1DOLA 4CKCA 3J80i 1Q1EA 5IGGA 2K33A 4FXDA 3TP5A 3M3YB 3IKJA 4OO1H 2SNMA 3VYTA 3W1BA 2OCEA 1DM0B 1ENFA 2CW0C 4BY7B 1X3EA 4XT1B 1SYDA 2JA5B 1B3AA 1MBYA 2K01A 4O1NA 3I90A 1RCVD 1YNND 3MEHA 4KD4A 4PMWA 1Q81C 2K04A 2EYHA 5EBCA 2YU9H 4NW2A 1JE5A 3C46A 5FKAC 5GAEC 4JI1Q 4FF4A 1X3PA 3VA7A 3J7AF 4OO1G 4FO2A 4OWTB 3H3VC 3ULLA 1XPUA 3J80L 4RCOA 5ELOA 3HGBA 3M4OH 3HOVH 1S5FD 2OXPA
chains in the Genus database with same CATH topology
3PUWA 3G6EA 4A3MG 1C0AA 4A3FH 1GD7A 1HJPA 1X55A 4GS3A 2E2IH 2N49A 4DNIA 3RZDH 3DM3A 4A3KG 3OW2A 4X66L 4DR2L 4JI7L 5IY0A 1JJCB 1U5KA 1UE1A 5M3MH 4JI0L 3RZOH 4DUYL 1HNZQ 1WOCA 4B3RL 1OXUA 4K0KL 1JT8A 4DV4L 3AEVA 4RMFA 2YV5A 4R4IA 5BR8Q 4DV6L 4B3TQ 4JI2Q 3HOVG 1XMQQ 4Y52H 2V1CC 4L5QA 3CCRA 1SLJA 4B3ML 5J3BA 1EIYB 2JA6H 1V9PA 4R1JA 4A3FG 3H3VI 4DUZQ 2F3IA 2JA8H 1V1QA 3A74A 3I55A 2BH2A 2R92G 4GKJQ 2OTLA 2CQOA 2L15A 4LFBL 2K52A 2UXDL 5M3MG 3GDEA 2F52A 1VQ9A 4GN5A 1SRUA 4LFCL 3U58A 2GVBA 3HKSA 4H02A 5GADC 4A75A 4DPGA 3JAMi 4RG1A 3G71A 3H3VH 4L5TA 1AE2A 1NBWA 1G6PA 3E0EA 4P74A 5JJIA 3ER0A 3WWVA 5JJKA 3GTKH 2JA6G 3PF5A 4QY7A 4GNXA 2F4VL 3M4PA 4LFAQ 2UU9Q 2JA8G 1K83H 5M3FH 4BA2I 4IOAA 1BBWA 1J5EQ 1B70B 4JV5L 3GTMH 2BA1A 1DGSA 3D31A 2CWAA 4DV7L 4DR7L 3J7A5 4PZ6A 2KHIA 4NXML 1RL2A 3ERSX 4JC0A 4P75A 5ELNA 1YITA 3H0GH 4P71A 3S14H 4GNXC 1Y14B 3K8AA 4LWCA 1KQSA 3I4NH 1YNXA 3S2HH 2RHSB 4KLKA 3HOWH 5JEAJ 1YVCA 1KAWA 2IX0A 3PV0A 4JI8L 3F2CA 4A76A 2JA7H 3S2DH 1YHQA 3PUVA 1B8AA 1CKNA 1CKMA 3EIVA 5FLXc 3L2PA 2B29A 1SN8A 1PYSB 4IJLA 3TQYA 5M3FG 4A93H 1D7QA 1VQPA 1PH2A 4JI4Q 3HFZB 4X62L 1N36Q 1HNWL 1E3PA 5GQOA 2I5LX 1YJ9A 4JOIA 1TWFH 4YY3Q 4LF7L 1Q8KA 1NE3A 1A62A 3KOJA 1A8VA 3MEFA 3ULJA 2AWOA 1PH5A 2K5VA 4YCUA 2RF4A 4NXNL 3H0GG 1JJ2A 5IWAQ 2VQFL 3CXCA 1QZHA 2RHQB 3I4NG 2N78A 1CSPA 4JI3L 3HOWG 1VQJA 3STBC 3TS0A 2QA4A 1EQQA 3CW2C 2JA7G 3HOYH 3PIOA 2IX1A 2VW9A 5IYBG 2I5MX 3JC66 4A93G 2JQOA 4AYBE 2E5LL 4OO1I 4GLVB 2VQEQ 3T1HL 1HNXL 3U4ZA 3A5UA 4HIMA 1X3FA 1PHJA 4KHPL 1K8GA 4A3GG 2IT1A 2R7FA 2Z0SA 5GAHC 3TRZA 2OQKA 1EUJA 4UP9A 4YCWA 5IT9c 1CUKA 3KF8B 1XNQL 2NZHA 1HR0W 4X64L 4TQUS 4OX9Q 3S16H 4IPGA 1LUZA 3HOYG 1Q1BA 3HOXH 1E24A 3CCJA 4BY7H 2ALYB 4IFDJ 4LF6Q 4DR5Q 3LGJA 4LNQA 1KRSA 4POGA 2MFIA 2EXDA 4DK6C 1L1OB 1LYLA 1SROA 5LMNL 3AFPA 3GTPH 4QIWE 3BU2A 3CCUA 5LMUQ 1HZCA 3B6YA 4GKKL 5JJLA 3S24A 5C0XG 1HZAA 2XGTA 1N32Q 4P73A 1WYDA 2RCNA 1EYGA 4GOPB 4BA1I 5HGQA 4DR4Q 5DLQE 1XNRL 2I5HA 1PH7A 1T9HA 4AQYQ 4FDBA 3HOXG 4LF4L 3HOUH 4AIMA 2ZM6L 1IBKL 2D62A 2HHHL 2FXQA 3Q8DA 4DR6Q 2OQ0A 4LF8L 1VQLA 3PSIA 2K4KA 4A3LH 1XTDA 1PH8A 2UUBL 3KLWA 2NN6G 4DV0Q 5IYDH 1PH3A 1HZBA 4DV3L 4BXXG 3W1GA 4J15A 2GVAA 2KHJA 1KC8C 2R92H 4YHHQ 3PF4A 4A3IH 1HZ9A 3KJPA 4L5SA 2WAQG 1RIPA 3GTJH 1K73C 1KD1C 3VDYA 3HOUG 1YJNA 4LF9Q 1WCMG 1N34Q 2B3GA 1PH6A 4C3HH 4BY1H 4DV5Q 1CSQA 3M9BA 1Q86C 1IBML 4A3LG 4JI5Q 5M5WH 1Q7YC 4YWKA 4LF5L 4DV2L 4PZ7A 1VCIA 1VQDA 5IYDG 5BR8L 1PH9A 1PH4A 1VQBA 1FL0A 1VQFA 4BBRH 2UUCQ 4B3TL 2PQAB 3K0XA 5IP7H 5IP9H 4DR2Q 4XTCS 4JI7Q 2UXCL 1VQ6A 4JI0Q 4A3IG 1EWIA 4EQ5A 2JJQA 4DUYQ 2JEBI 1VQOA 1P16A 4DUZL 1K9MC 3CCSA 1KRTA 4UP8A 2Y0SG 1IBLL 4DV6Q 1C7YA 4JYAQ 4R4TA 4JBJA 4P72A 1TWCH 1FJGQ 1OXTA 2K5NA 3UE1A 4X65L 3CC2A 4BY1G 1N33Q 4C3IH 2WB1E 3RR5A 4DV1Q 2DGYA 3F2BA 1QUQB 2OWOA 4B3MQ 3HOZH 2LXJA 1KHIA 3AYHB 4GN4B 3RLFA 2E2JH 4BBRG 1OXSC 3CCEA 2KCTA 4JYAL 2UXBL 2XTIA 5IP9G 3L7ZC 4NB3A 5IP7G 4LFBQ 4LFCQ 1MJCA 2GN5A 3J80c 3NEMA 1K8AC 2UU9L 4B3SQ 1L1OA 3K81C 4LFAL 4JBKA 1V43A 3HKZG 4L5RC 4GLAC 4JCVE 1OXVA 3CCQA 3GTOH 3PO2H 4Y7NH 4OXPA 1YHBA 4O2DA 3KDFB 4A3BH 4XIGS 3HOZG 1A63A 5GAGC 3ULPA 1E1OA 2K5HA 4PZ8A 2LXKA 1OXXK 2HIVA 2F4VQ 4BBSH 2AHOB 3CMEA 1N8RC 1C9OA 4JV5Q 1L1OC 2IHEA 4A3EH 5IYBH 1H95A 3EBEA 4DR7Q 1YJWA 5FLMH 4KI0A 3J81c 1GKHA 1QZGA 3KF6A 2ZJPA 1VQHA 1WI5A 3E9HA 4GOPC 2MQHA 4A3JH 3BZKA 2R93H 4JI4L 3PO2G 3UDGA 3OYYA 3OTOL 4A3BG 1YBYA 3D0FA 2PI2A 2Z6KC 4JI8Q 1YI2A 3M85A 4C2MH 1VQGA 1I94L 4DR3Q 1XJVA 5LMNW 4BBSG 1W3SA 1J6QA 4HJ5A 3S1RH 2NVTH 2KBNA 2VS1A 1UE5A 5C0XI 4A3EG 3GTLH 1HNWQ 2ZTCA 4X62Q 1KIXA 2WFWA 3NENA 3NELA 4A3DH 1VS0A 5FLMG 5C3EH 1I3QH 1IXRA 1K0RA 1OTCA 2A19A 1VQ8A 5HY6A 2VY3A 4UPAA 4POFA 2NZOA 2IHFA 1YIJA 3EN2A 4A3JG 2K50A 4O0AA 2R93G 1MKHA 1PA6A 2UUAL 1K3RA 2VQEL 4JI3Q 4IFDG 5EAYA 5AJ3Q 3PGZA 1VQEA 3IRBA 2PQAA 1X3GA 1MJEA 3ICEA 4IPHA 3M3YH 5GROA 1E22A 1D8LA 2NN6I 2ZTEA 1W2BA 3RN2A 2BH8A 3K7AH 4OWWB 1FGUA 2C35B 1UE6A 1JMCA 3M7NA 1SMXA 3RLOA 2ASBA 2JE6I 1VQMA 1SFOH 2JA5H 3T1HQ 5IYCH 4A3DG 3GD7A 1WJJA 5C3EG 4JI6L 1IZ6A 1EOVA 3FHWA 4KHPQ 2ES2A 2ZTDA 2ATWA 1QUQA 3F1ZA 4DR5L 1VQ4A 1XMOQ 1Q46A 1VQIA 2N8NA 3PIPA 1M90C 2NVYH 3K7UC 4PG3A 3S1MH 1LTLA 4BXXH 1FVIA 1M1KC 1XNQQ 1BVSA 2CKZB 2IY5B 2YTXA 5C44H 3I7FA 3CC4A 1VQCA 4OWXB 4JI1L 3JAMc 1UEBA 3KYHC 1QVFA 3U50C 2EIFA 1WCMH 4DR4L 5LMNQ 2JA5G 2D0PA 3TREA 2Q2IA 5IYCG 2YTVA 4AQYL 3KDFA 4GKKQ 1X56A 4R4OA 2Q2UA 3STBD 1PH1A 3GO5A 3T1YL 3NBHB 2QEXA 4IPCA 1JJGA 1XNRQ 4LF7Q 4HJ7A 4DV0L 5C44G 1L0WA 3I4MG 2LSSA 3CAMA 2ZM6Q 3DLLA 1TWAH 1CKOA 1IBKQ 1PVOA 3F8TA 1PV4A 4LF8Q 4YHHL 2Q2HA 1HR0Q 4DR1Q 3RLNA 4IO9A 4YCVA 1Z47A 2AMCB 1I94Q 3CP0A 1G291 1N9WA 1HNZL 2VUMH 1B7YB 3I4OA 2B63H 3RN5A 2D0OA 2H5XA 3G48A 1I6HH 1SR3A 4JI2L 4JI5L 3AQQA 2CCZA 1BKBA 1XMQL 2K14A 2PMZE 4X66Q 1PYBA 2NVXH 1KXLA 4R4QA 1S72A 3G4SA 1O7IA 4AH6A 2QGQA 5M5YH 1VQ7A 2UUCL 2R7ZH 4B3RQ 2AKWB 4DV4Q 4K0KQ 1EQRA 2MO1A 4AYBG 5E7NA 4DAYB 4LW1A 3CF5A 4GKJL 4BY7G 3CCLA 1IBMQ 4A4IA 1SE8A 3CC7A 3F2DA 4LF5Q 4DV2Q 3PUXA 4QJFA 2VUMG 3RNUA 1WFQA 1YZ6A 2B63G 3PO3H 1XPRA 2R6GA 1MIUA 4TVAB 1Y1WH 1FJGL 1N33L 2UXCQ 4DV1L 2MO0A 1VQ5A 1NTGA 4WJ4A 4JG2A 2AWNA 4QL5A 2UXDQ 1I5FA 1X54A 3PCOB 5C4XH 3I56A 2OTJA 4KHZA 1S40A 1Q82C 1IBLQ 4HJ8A 4IOCA 3S17H 2R7ZG 4EX5A 3KFUA 2ZJRA 2Q2TA 2A8VA 5JEAG 4X65Q 1Y1VH 3A5ZB 1J5EL 1UE7A 3CQZH 4JBMA 4IPDA 2A1AA 1X9NA 4B3SL 3J81j 1XPOA 3CD6A 2ID0A 1E7ZA 1NMGA 4YWLA 2ZJQA 3ZJYC 2N3SA 3CCMA 3A0JA 1X6OA 1AE3A 3SGIA 4ALPA 4GOPA 1E1TA 1Y1WG 3PO3G 4UY8C 2UXBQ 4IJHA 4IFDI 5FJ8H 1GVPA 2Z6KA 1YHAA 3BZCA 4C3JH 3S15H 4LUVA 3TS2A 4A3GH 4DV7Q 5C4XG 1QVGA 3PUZA 4R4CA 4DAMA 1VQAA 3FP9A 4HJAA 4NXMQ 2R7DA 1Q12A 3AFQA 4MNOA 3S1QH 2VNUD 1Y1VG 1TWGH 3GTGH 4MTNA 1N36L 2WP8J 4QGUA 2VZAA 4YY3L 1L2FA 3W5OA 5IWAL 1TWHH 3FKIH 3L0OA 1BBUA 2JK8A 3UDFA 5FJ8G 3PUYA 3CCVA 3CPWA 1EIFA 4DR3L 1KL9A 3I2ZA 4HIKA 4X6AH 4DK3C 1A0IA 1X65A 1R9TH 2WAQE 1ASYA 2VL6A 4LUOA 1YEZA 4YWMA 1EFWA 4NXNQ 5C4JH 3OTOQ 1I50H 2NVQH 2VQFQ 3BJUA 4QQBX 4MZ9A 4GN3B 4ME3A 3TEHB 1NJIC 2BA0A 1HH2P 1ASZA 1JB7A 3U4VA 2I0QA 2K75A 2KCMA 1UWVA 4OONA 3K80C 5AJ3L 2YTYA 3FKIG 1NMFA 2PI2E 2E5LQ 4JOIC 3MXNB 4OX9L 4WJ3M 2JEAI 1HNXQ 2PNHA 2E8GA 4LUZA 4LF6L 2UUAQ 2Y0SE 1QVCA 2WB1G 2E2HH 4HJ9A 1GM5A 3J80i 1Q1EA 4X64Q 3UE0A 1XMOL 1GO3E 2YYZA 2CWPA 5LMUL 2HIXA 5IE8A 1N32L 1LM0A 2KENA 2EQSA 3J7ZC 3W1BA 4GNXB 2OCEA 3M4QA 4JI6Q 1X3EA 1PFSA 3KJOA 3GTQH 5H1SE 2HT1A 4DR6L 3E9IA 4NPSA 1U0LA 3HKZE 4PMWA 3UDXA 1Q81C 3I4MH 4A3CH 5M5XH 2YU9H 2MNAA 4APVA 1Z9FA 4HIOA 4A3MH 4UP7A 3J81i 3CMAA 1JE5A 3UDIA 4DKAC 5K36G 1VQNA 1S3OA 4HIDA 5GAEC 1AH9A 1IYJB 4JI1Q 4LF4Q 4A3KH 2HHHQ 1P8LA 2DUDA 4OO1G 4OWTB 3ULLA 1IL2A 3H15A 1XPUA 3S1NH 1CKNB 1VQKA 1TXYA 5C0XJ 2CFMA 4GLXA 5ELOA 1NY4A 2HQLA 2UUBQ 3CPFA 3M4OH 4LF9L 4JBWA 4DV3Q 3HOVH 1G51A 1N34L 3KF6B 4DR1L 2JA9A 3T1YQ 1HR0L 4A3CG 4DV5L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUW A;  3G6E A;  4A3M G;  1C0A A;  4A3F H;  1GD7 A;  1HJP A;  1X55 A;  4GS3 A;  2E2I H;  2N49 A;  4DNI A;  3RZD H;  3DM3 A;  4A3K G;  3OW2 A;  4X66 L;  4DR2 L;  4JI7 L;  5IY0 A;  1JJC B;  1U5K A;  1UE1 A;  5M3M H;  4JI0 L;  3RZO H;  4DUY L;  1HNZ Q;  1WOC A;  4B3R L;  1OXU A;  4K0K L;  1JT8 A;  4DV4 L;  3AEV A;  4RMF A;  2YV5 A;  4R4I A;  5BR8 Q;  4DV6 L;  4B3T Q;  4JI2 Q;  3HOV G;  1XMQ Q;  4Y52 H;  2V1C C;  4L5Q A;  3CCR A;  1SLJ A;  4B3M L;  5J3B A;  1EIY B;  2JA6 H;  1V9P A;  4R1J A;  4A3F G;  3H3V I;  4DUZ Q;  2F3I A;  2JA8 H;  1V1Q A;  3A74 A;  3I55 A;  2BH2 A;  2R92 G;  4GKJ Q;  2OTL A;  2CQO A;  2L15 A;  4LFB L;  2K52 A;  2UXD L;  5M3M G;  3GDE A;  2F52 A;  1VQ9 A;  4GN5 A;  1SRU A;  4LFC L;  3U58 A;  2GVB A;  3HKS A;  4H02 A;  5GAD C;  4A75 A;  4DPG A;  3JAM i;  4RG1 A;  3G71 A;  3H3V H;  4L5T A;  1AE2 A;  1NBW A;  1G6P A;  3E0E A;  4P74 A;  5JJI A;  3ER0 A;  3WWV A;  5JJK A;  3GTK H;  2JA6 G;  3PF5 A;  4QY7 A;  4GNX A;  2F4V L;  3M4P A;  4LFA Q;  2UU9 Q;  2JA8 G;  1K83 H;  5M3F H;  4BA2 I;  4IOA A;  1BBW A;  1J5E Q;  1B70 B;  4JV5 L;  3GTM H;  2BA1 A;  1DGS A;  3D31 A;  2CWA A;  4DV7 L;  4DR7 L;  3J7A 5;  4PZ6 A;  2KHI A;  4NXM L;  1RL2 A;  3ERS X;  4JC0 A;  4P75 A;  5ELN A;  1YIT A;  3H0G H;  4P71 A;  3S14 H;  4GNX C;  1Y14 B;  3K8A A;  4LWC A;  1KQS A;  3I4N H;  1YNX A;  3S2H H;  2RHS B;  4KLK A;  3HOW H;  5JEA J;  1YVC A;  1KAW A;  2IX0 A;  3PV0 A;  4JI8 L;  3F2C A;  4A76 A;  2JA7 H;  3S2D H;  1YHQ A;  3PUV A;  1B8A A;  1CKN A;  1CKM A;  3EIV A;  5FLX c;  3L2P A;  2B29 A;  1SN8 A;  1PYS B;  4IJL A;  3TQY A;  5M3F G;  4A93 H;  1D7Q A;  1VQP A;  1PH2 A;  4JI4 Q;  3HFZ B;  4X62 L;  1N36 Q;  1HNW L;  1E3P A;  5GQO A;  2I5L X;  1YJ9 A;  4JOI A;  1TWF H;  4YY3 Q;  4LF7 L;  1Q8K A;  1NE3 A;  1A62 A;  3KOJ A;  1A8V A;  3MEF A;  3ULJ A;  2AWO A;  1PH5 A;  2K5V A;  4YCU A;  2RF4 A;  4NXN L;  3H0G G;  1JJ2 A;  5IWA Q;  2VQF L;  3CXC A;  1QZH A;  2RHQ B;  3I4N G;  2N78 A;  1CSP A;  4JI3 L;  3HOW G;  1VQJ A;  3STB C;  3TS0 A;  2QA4 A;  1EQQ A;  3CW2 C;  2JA7 G;  3HOY H;  3PIO A;  2IX1 A;  2VW9 A;  5IYB G;  2I5M X;  3JC6 6;  4A93 G;  2JQO A;  4AYB E;  2E5L L;  4OO1 I;  4GLV B;  2VQE Q;  3T1H L;  1HNX L;  3U4Z A;  3A5U A;  4HIM A;  1X3F A;  1PHJ A;  4KHP L;  1K8G A;  4A3G G;  2IT1 A;  2R7F A;  2Z0S A;  5GAH C;  3TRZ A;  2OQK A;  1EUJ A;  4UP9 A;  4YCW A;  5IT9 c;  1CUK A;  3KF8 B;  1XNQ L;  2NZH A;  1HR0 W;  4X64 L;  4TQU S;  4OX9 Q;  3S16 H;  4IPG A;  1LUZ A;  3HOY G;  1Q1B A;  3HOX H;  1E24 A;  3CCJ A;  4BY7 H;  2ALY B;  4IFD J;  4LF6 Q;  4DR5 Q;  3LGJ A;  4LNQ A;  1KRS A;  4POG A;  2MFI A;  2EXD A;  4DK6 C;  1L1O B;  1LYL A;  1SRO A;  5LMN L;  3AFP A;  3GTP H;  4QIW E;  3BU2 A;  3CCU A;  5LMU Q;  1HZC A;  3B6Y A;  4GKK L;  5JJL A;  3S24 A;  5C0X G;  1HZA A;  2XGT A;  1N32 Q;  4P73 A;  1WYD A;  2RCN A;  1EYG A;  4GOP B;  4BA1 I;  5HGQ A;  4DR4 Q;  5DLQ E;  1XNR L;  2I5H A;  1PH7 A;  1T9H A;  4AQY Q;  4FDB A;  3HOX G;  4LF4 L;  3HOU H;  4AIM A;  2ZM6 L;  1IBK L;  2D62 A;  2HHH L;  2FXQ A;  3Q8D A;  4DR6 Q;  2OQ0 A;  4LF8 L;  1VQL A;  3PSI A;  2K4K A;  4A3L H;  1XTD A;  1PH8 A;  2UUB L;  3KLW A;  2NN6 G;  4DV0 Q;  5IYD H;  1PH3 A;  1HZB A;  4DV3 L;  4BXX G;  3W1G A;  4J15 A;  2GVA A;  2KHJ A;  1KC8 C;  2R92 H;  4YHH Q;  3PF4 A;  4A3I H;  1HZ9 A;  3KJP A;  4L5S A;  2WAQ G;  1RIP A;  3GTJ H;  1K73 C;  1KD1 C;  3VDY A;  3HOU G;  1YJN A;  4LF9 Q;  1WCM G;  1N34 Q;  2B3G A;  1PH6 A;  4C3H H;  4BY1 H;  4DV5 Q;  1CSQ A;  3M9B A;  1Q86 C;  1IBM L;  4A3L G;  4JI5 Q;  5M5W H;  1Q7Y C;  4YWK A;  4LF5 L;  4DV2 L;  4PZ7 A;  1VCI A;  1VQD A;  5IYD G;  5BR8 L;  1PH9 A;  1PH4 A;  1VQB A;  1FL0 A;  1VQF A;  4BBR H;  2UUC Q;  4B3T L;  2PQA B;  3K0X A;  5IP7 H;  5IP9 H;  4DR2 Q;  4XTC S;  4JI7 Q;  2UXC L;  1VQ6 A;  4JI0 Q;  4A3I G;  1EWI A;  4EQ5 A;  2JJQ A;  4DUY Q;  2JEB I;  1VQO A;  1P16 A;  4DUZ L;  1K9M C;  3CCS A;  1KRT A;  4UP8 A;  2Y0S G;  1IBL L;  4DV6 Q;  1C7Y A;  4JYA Q;  4R4T A;  4JBJ A;  4P72 A;  1TWC H;  1FJG Q;  1OXT A;  2K5N A;  3UE1 A;  4X65 L;  3CC2 A;  4BY1 G;  1N33 Q;  4C3I H;  2WB1 E;  3RR5 A;  4DV1 Q;  2DGY A;  3F2B A;  1QUQ B;  2OWO A;  4B3M Q;  3HOZ H;  2LXJ A;  1KHI A;  3AYH B;  4GN4 B;  3RLF A;  2E2J H;  4BBR G;  1OXS C;  3CCE A;  2KCT A;  4JYA L;  2UXB L;  2XTI A;  5IP9 G;  3L7Z C;  4NB3 A;  5IP7 G;  4LFB Q;  4LFC Q;  1MJC A;  2GN5 A;  3J80 c;  3NEM A;  1K8A C;  2UU9 L;  4B3S Q;  1L1O A;  3K81 C;  4LFA L;  4JBK A;  1V43 A;  3HKZ G;  4L5R C;  4GLA C;  4JCV E;  1OXV A;  3CCQ A;  3GTO H;  3PO2 H;  4Y7N H;  4OXP A;  1YHB A;  4O2D A;  3KDF B;  4A3B H;  4XIG S;  3HOZ G;  1A63 A;  5GAG C;  3ULP A;  1E1O A;  2K5H A;  4PZ8 A;  2LXK A;  1OXX K;  2HIV A;  2F4V Q;  4BBS H;  2AHO B;  3CME A;  1N8R C;  1C9O A;  4JV5 Q;  1L1O C;  2IHE A;  4A3E H;  5IYB H;  1H95 A;  3EBE A;  4DR7 Q;  1YJW A;  5FLM H;  4KI0 A;  3J81 c;  1GKH A;  1QZG A;  3KF6 A;  2ZJP A;  1VQH A;  1WI5 A;  3E9H A;  4GOP C;  2MQH A;  4A3J H;  3BZK A;  2R93 H;  4JI4 L;  3PO2 G;  3UDG A;  3OYY A;  3OTO L;  4A3B G;  1YBY A;  3D0F A;  2PI2 A;  2Z6K C;  4JI8 Q;  1YI2 A;  3M85 A;  4C2M H;  1VQG A;  1I94 L;  4DR3 Q;  1XJV A;  5LMN W;  4BBS G;  1W3S A;  1J6Q A;  4HJ5 A;  3S1R H;  2NVT H;  2KBN A;  2VS1 A;  1UE5 A;  5C0X I;  4A3E G;  3GTL H;  1HNW Q;  2ZTC A;  4X62 Q;  1KIX A;  2WFW A;  3NEN A;  3NEL A;  4A3D H;  1VS0 A;  5FLM G;  5C3E H;  1I3Q H;  1IXR A;  1K0R A;  1OTC A;  2A19 A;  1VQ8 A;  5HY6 A;  2VY3 A;  4UPA A;  4POF A;  2NZO A;  2IHF A;  1YIJ A;  3EN2 A;  4A3J G;  2K50 A;  4O0A A;  2R93 G;  1MKH A;  1PA6 A;  2UUA L;  1K3R A;  2VQE L;  4JI3 Q;  4IFD G;  5EAY A;  5AJ3 Q;  3PGZ A;  1VQE A;  3IRB A;  2PQA A;  1X3G A;  1MJE A;  3ICE A;  4IPH A;  3M3Y H;  5GRO A;  1E22 A;  1D8L A;  2NN6 I;  2ZTE A;  1W2B A;  3RN2 A;  2BH8 A;  3K7A H;  4OWW B;  1FGU A;  2C35 B;  1UE6 A;  1JMC A;  3M7N A;  1SMX A;  3RLO A;  2ASB A;  2JE6 I;  1VQM A;  1SFO H;  2JA5 H;  3T1H Q;  5IYC H;  4A3D G;  3GD7 A;  1WJJ A;  5C3E G;  4JI6 L;  1IZ6 A;  1EOV A;  3FHW A;  4KHP Q;  2ES2 A;  2ZTD A;  2ATW A;  1QUQ A;  3F1Z A;  4DR5 L;  1VQ4 A;  1XMO Q;  1Q46 A;  1VQI A;  2N8N A;  3PIP A;  1M90 C;  2NVY H;  3K7U C;  4PG3 A;  3S1M H;  1LTL A;  4BXX H;  1FVI A;  1M1K C;  1XNQ Q;  1BVS A;  2CKZ B;  2IY5 B;  2YTX A;  5C44 H;  3I7F A;  3CC4 A;  1VQC A;  4OWX B;  4JI1 L;  3JAM c;  1UEB A;  3KYH C;  1QVF A;  3U50 C;  2EIF A;  1WCM H;  4DR4 L;  5LMN Q;  2JA5 G;  2D0P A;  3TRE A;  2Q2I A;  5IYC G;  2YTV A;  4AQY L;  3KDF A;  4GKK Q;  1X56 A;  4R4O A;  2Q2U A;  3STB D;  1PH1 A;  3GO5 A;  3T1Y L;  3NBH B;  2QEX A;  4IPC A;  1JJG A;  1XNR Q;  4LF7 Q;  4HJ7 A;  4DV0 L;  5C44 G;  1L0W A;  3I4M G;  2LSS A;  3CAM A;  2ZM6 Q;  3DLL A;  1TWA H;  1CKO A;  1IBK Q;  1PVO A;  3F8T A;  1PV4 A;  4LF8 Q;  4YHH L;  2Q2H A;  1HR0 Q;  4DR1 Q;  3RLN A;  4IO9 A;  4YCV A;  1Z47 A;  2AMC B;  1I94 Q;  3CP0 A;  1G29 1;  1N9W A;  1HNZ L;  2VUM H;  1B7Y B;  3I4O A;  2B63 H;  3RN5 A;  2D0O A;  2H5X A;  3G48 A;  1I6H H;  1SR3 A;  4JI2 L;  4JI5 L;  3AQQ A;  2CCZ A;  1BKB A;  1XMQ L;  2K14 A;  2PMZ E;  4X66 Q;  1PYB A;  2NVX H;  1KXL A;  4R4Q A;  1S72 A;  3G4S A;  1O7I A;  4AH6 A;  2QGQ A;  5M5Y H;  1VQ7 A;  2UUC L;  2R7Z H;  4B3R Q;  2AKW B;  4DV4 Q;  4K0K Q;  1EQR A;  2MO1 A;  4AYB G;  5E7N A;  4DAY B;  4LW1 A;  3CF5 A;  4GKJ L;  4BY7 G;  3CCL A;  1IBM Q;  4A4I A;  1SE8 A;  3CC7 A;  3F2D A;  4LF5 Q;  4DV2 Q;  3PUX A;  4QJF A;  2VUM G;  3RNU A;  1WFQ A;  1YZ6 A;  2B63 G;  3PO3 H;  1XPR A;  2R6G A;  1MIU A;  4TVA B;  1Y1W H;  1FJG L;  1N33 L;  2UXC Q;  4DV1 L;  2MO0 A;  1VQ5 A;  1NTG A;  4WJ4 A;  4JG2 A;  2AWN A;  4QL5 A;  2UXD Q;  1I5F A;  1X54 A;  3PCO B;  5C4X H;  3I56 A;  2OTJ A;  4KHZ A;  1S40 A;  1Q82 C;  1IBL Q;  4HJ8 A;  4IOC A;  3S17 H;  2R7Z G;  4EX5 A;  3KFU A;  2ZJR A;  2Q2T A;  2A8V A;  5JEA G;  4X65 Q;  1Y1V H;  3A5Z B;  1J5E L;  1UE7 A;  3CQZ H;  4JBM A;  4IPD A;  2A1A A;  1X9N A;  4B3S L;  3J81 j;  1XPO A;  3CD6 A;  2ID0 A;  1E7Z A;  1NMG A;  4YWL A;  2ZJQ A;  3ZJY C;  2N3S A;  3CCM A;  3A0J A;  1X6O A;  1AE3 A;  3SGI A;  4ALP A;  4GOP A;  1E1T A;  1Y1W G;  3PO3 G;  4UY8 C;  2UXB Q;  4IJH A;  4IFD I;  5FJ8 H;  1GVP A;  2Z6K A;  1YHA A;  3BZC A;  4C3J H;  3S15 H;  4LUV A;  3TS2 A;  4A3G H;  4DV7 Q;  5C4X G;  1QVG A;  3PUZ A;  4R4C A;  4DAM A;  1VQA A;  3FP9 A;  4HJA A;  4NXM Q;  2R7D A;  1Q12 A;  3AFQ A;  4MNO A;  3S1Q H;  2VNU D;  1Y1V G;  1TWG H;  3GTG H;  4MTN A;  1N36 L;  2WP8 J;  4QGU A;  2VZA A;  4YY3 L;  1L2F A;  3W5O A;  5IWA L;  1TWH H;  3FKI H;  3L0O A;  1BBU A;  2JK8 A;  3UDF A;  5FJ8 G;  3PUY A;  3CCV A;  3CPW A;  1EIF A;  4DR3 L;  1KL9 A;  3I2Z A;  4HIK A;  4X6A H;  4DK3 C;  1A0I A;  1X65 A;  1R9T H;  2WAQ E;  1ASY A;  2VL6 A;  4LUO A;  1YEZ A;  4YWM A;  1EFW A;  4NXN Q;  5C4J H;  3OTO Q;  1I50 H;  2NVQ H;  2VQF Q;  3BJU A;  4QQB X;  4MZ9 A;  4GN3 B;  4ME3 A;  3TEH B;  1NJI C;  2BA0 A;  1HH2 P;  1ASZ A;  1JB7 A;  3U4V A;  2I0Q A;  2K75 A;  2KCM A;  1UWV A;  4OON A;  3K80 C;  5AJ3 L;  2YTY A;  3FKI G;  1NMF A;  2PI2 E;  2E5L Q;  4JOI C;  3MXN B;  4OX9 L;  4WJ3 M;  2JEA I;  1HNX Q;  2PNH A;  2E8G A;  4LUZ A;  4LF6 L;  2UUA Q;  2Y0S E;  1QVC A;  2WB1 G;  2E2H H;  4HJ9 A;  1GM5 A;  3J80 i;  1Q1E A;  4X64 Q;  3UE0 A;  1XMO L;  1GO3 E;  2YYZ A;  2CWP A;  5LMU L;  2HIX A;  5IE8 A;  1N32 L;  1LM0 A;  2KEN A;  2EQS A;  3J7Z C;  3W1B A;  4GNX B;  2OCE A;  3M4Q A;  4JI6 Q;  1X3E A;  1PFS A;  3KJO A;  3GTQ H;  5H1S E;  2HT1 A;  4DR6 L;  3E9I A;  4NPS A;  1U0L A;  3HKZ E;  4PMW A;  3UDX A;  1Q81 C;  3I4M H;  4A3C H;  5M5X H;  2YU9 H;  2MNA A;  4APV A;  1Z9F A;  4HIO A;  4A3M H;  4UP7 A;  3J81 i;  3CMA A;  1JE5 A;  3UDI A;  4DKA C;  5K36 G;  1VQN A;  1S3O A;  4HID A;  5GAE C;  1AH9 A;  1IYJ B;  4JI1 Q;  4LF4 Q;  4A3K H;  2HHH Q;  1P8L A;  2DUD A;  4OO1 G;  4OWT B;  3ULL A;  1IL2 A;  3H15 A;  1XPU A;  3S1N H;  1CKN B;  1VQK A;  1TXY A;  5C0X J;  2CFM A;  4GLX A;  5ELO A;  1NY4 A;  2HQL A;  2UUB Q;  3CPF A;  3M4O H;  4LF9 L;  4JBW A;  4DV3 Q;  3HOV H;  1G51 A;  1N34 L;  3KF6 B;  4DR1 L;  2JA9 A;  3T1Y Q;  1HR0 L;  4A3C G;  4DV5 L; 
#chains in the Genus database with same CATH topology
 3PUW A;  3G6E A;  2F0T A;  3MFG A;  4GS3 A;  2E2I H;  1MSH A;  1B2T A;  3OW2 A;  3D6C A;  5IY0 A;  1JJC B;  2F0S A;  1WOC A;  4ZLT F;  3S9W A;  4DV4 L;  2YV5 A;  3BVG A;  4JI2 Q;  4RFB A;  3HOV G;  3I73 A;  2XNA C;  1I6H B;  1EIY B;  2R61 A;  3H3V I;  1X3Q A;  1F9R A;  1SE3 A;  4DUZ Q;  1A3U A;  1V1Q A;  3I55 A;  2BH2 A;  5KYL A;  4GKJ Q;  4KY7 A;  2CQO A;  1WD0 A;  2L15 A;  2K52 A;  2UXD L;  3V05 A;  3GDE A;  4C1N K;  4CBV A;  3HKS A;  5EJW A;  3H3V H;  1G6Z A;  3G71 A;  1PDQ A;  1QOH A;  1OO9 B;  4DAP A;  4IUR A;  5T1I A;  2F0J A;  2J7Z A;  3ER0 A;  3WWV A;  3GTK H;  1PTO D;  3QIA A;  4GNX A;  2F4V L;  1NSN S;  5C4X B;  4BA2 I;  3GTM H;  3S17 B;  1JOQ A;  1PRT D;  3NQT A;  4P75 A;  4JC0 A;  5ELN A;  4FF3 A;  2OEO A;  3H0G H;  3NTK A;  2PZU A;  1Y14 B;  1KQS A;  4KLK A;  2LS0 1;  3S2D H;  1KAW A;  2XWB B;  3WOF A;  1PRT B;  5JVG 3;  1V8Q A;  3PUV A;  3EIV A;  3L2P A;  2B29 A;  4IJL A;  1D7Q A;  1HNW L;  1AZP A;  1N36 Q;  1HTL D;  4RHR A;  1TWF H;  5IIF A;  3VA5 A;  1A62 A;  1A8V A;  2RDH A;  2K5V A;  4HTH A;  3H0G G;  4QCL A;  4K5W A;  4JI3 L;  1VQJ A;  3STB C;  2QA4 A;  2XSC A;  3L3O C;  4ZQ3 A;  2K6A A;  3JC6 6;  4E6I A;  1PZI D;  5HUR A;  1HNX L;  3A5U A;  4DF7 A;  2TMP A;  2IT1 A;  1S5B D;  2O2L D;  5C0X H;  5GAH C;  2OQK A;  1EUJ A;  3E0J A;  4UP9 A;  1CUK A;  2B2T C;  4OX9 Q;  3S16 H;  4IPG A;  3EJI A;  1Q1B A;  2ALY B;  4LF6 Q;  1K8M A;  4Z9C B;  4XDX A;  2OT2 A;  4POG A;  5FO9 B;  1SJE D;  4X3T A;  3R2T A;  1SRO A;  5LMN L;  3WDN A;  5LMU Q;  3B6Y A;  1LLR D;  2K5D A;  3S24 A;  5C0X G;  1ILQ A;  1JOO A;  2QCP X;  1O78 A;  3A8I E;  4BA1 I;  3VR2 A;  5DLQ E;  4CJ0 B;  1D2B A;  1IBK L;  3GV6 A;  2D62 A;  2HHH L;  2FXQ A;  3GTQ B;  2OQ0 A;  2WKC A;  3PSI A;  2R3Z A;  1PH8 A;  3WOE A;  2EYL A;  3MFY A;  1PH3 A;  4RKB A;  4BXX G;  1HRJ A;  5CBA E;  2KHJ A;  1KC8 C;  4A3I H;  1H9J A;  4OHJ A;  1HZ9 A;  4KMU C;  4QB4 A;  2WAQ G;  3S1N B;  3VYU A;  2SEB D;  3RD4 A;  1HPC A;  4EQO A;  4JI5 Q;  4LF5 L;  4DV2 L;  3T16 A;  1VCI A;  2HQE A;  4B3T L;  4BBR H;  3T13 A;  2WIN B;  4DR2 Q;  3MXN A;  4A3I G;  1EWI A;  4EQ5 A;  3H94 A;  2JEB I;  1VQO A;  1P16 A;  3M4Y A;  2Y0S G;  2FHT A;  4DV6 Q;  1NR4 A;  1TWC H;  4X65 L;  3F2B A;  2OWO A;  3HOZ H;  1KHI A;  3K5N A;  4GN4 B;  1Y1W B;  4CJ1 B;  1S5D D;  3KF8 A;  4OEM B;  2EYJ A;  4BBR G;  1LT4 D;  2UXB L;  4CHT B;  3L7Z C;  4EQP A;  4K14 A;  1MJC A;  2GN5 A;  3J80 c;  4LFC Q;  1HCZ A;  4DU9 A;  1L1O A;  1RF2 D;  2M00 A;  2F0U A;  3BDL A;  4L5R C;  1KNA A;  3GTO H;  2P5Z X;  4O2D A;  3K57 A;  3KDF B;  3HOZ G;  1SMY C;  4PZ8 A;  2HIV A;  2RBM A;  5TSS A;  2Q8T A;  3F2U A;  2LFN A;  4C3J B;  2IHE A;  1H95 A;  4O42 A;  3C3L A;  3EBE A;  4DR7 Q;  1YJW A;  5FLM H;  2QIL A;  1QZG A;  2ZJP A;  3OWF A;  3E9H A;  3TME A;  3GTG B;  3BZK A;  3OTO L;  4JI8 Q;  4HCE A;  1YI2 A;  1W3S A;  4HJ5 A;  3D3R A;  2KBN A;  3BDO A;  3KUP A;  1UE5 A;  1K0S A;  1SEB D;  3GTL H;  4DA2 A;  1KIX A;  2B2T A;  2E74 C;  4A3D H;  5FLM G;  5C3E H;  4LF7 Q;  2VY3 A;  2XRS D;  4YIJ A;  4POF A;  5C4J B;  2IHF A;  2A5H A;  2EZV A;  1A3V A;  4O0A A;  3OOC A;  4IFD G;  1NAP A;  3ERO A;  5AJ3 Q;  4FF1 A;  1G2T A;  4U67 3;  1VQE A;  3IRB A;  1X3G A;  5FLX E;  1MJE A;  3M3Y H;  3SE0 A;  3QWN A;  1W2B A;  4P2C B;  1ESR A;  1FGU A;  3D4R A;  3M7N A;  2JA5 H;  4LK1 C;  3T1H Q;  4A3D G;  3IFT A;  5C3E G;  1IZ6 A;  1EOV A;  3FHW A;  1STE A;  1WTX A;  1D5X C;  3P20 A;  5D14 A;  1VQI A;  3PIP A;  3D4D A;  1FVI A;  4HSV A;  4QUC A;  3OSO A;  3G6J B;  3KYH C;  1CT1 D;  5D3D A;  4DR4 L;  1I4G A;  2JA5 G;  1XTC D;  3OWE B;  3TRE A;  1HUM A;  2YTV A;  4AQY L;  2EY5 A;  5CV6 A;  1SXT A;  5IT9 E;  2YU9 B;  2Q2U A;  3GO5 A;  4IPC A;  3LX0 A;  1L0W A;  2LSS A;  2VXW A;  3QOL A;  1X32 A;  2PCF B;  5EPJ A;  3NPP A;  1XWE A;  1PTO C;  2TSS A;  3NWS A;  5IGC A;  4LF8 Q;  3HOU B;  1HR0 Q;  2K03 A;  2IL8 A;  5KIX A;  2AMC B;  1HNZ L;  3M4O B;  2B2V A;  2F0E A;  1I6H H;  2RCF A;  1SNM A;  2CCZ A;  2X69 A;  3U9O A;  3KBG A;  4X66 Q;  1KXL A;  4J6H A;  4V0B A;  2F0V A;  3G4S A;  1O7I A;  2QGQ A;  2AKW B;  5FLX L;  3URY A;  3I72 A;  4G4K A;  3RMH A;  3KBX A;  4C3H B;  1D1I A;  2PQE A;  3RNU A;  1DCZ A;  1CQF A;  3X3M A;  1YZ6 A;  3PO3 H;  1HXY D;  1FJG L;  1MIU A;  1L0X B;  1N33 L;  1JB3 A;  1EIH A;  5T1G A;  1A2T A;  1KNE A;  4JG2 A;  4MIU A;  2E76 C;  3I56 A;  5C4X H;  2OTJ A;  2XN9 C;  3OW7 A;  1IBL Q;  4IOC A;  3S17 H;  1E2W A;  2A8V A;  3A5Z B;  5BN5 A;  2WKD A;  1GXD C;  1PTO H;  1X9N A;  4B3S L;  4YWL A;  2K5W A;  4JYA Q;  3A0J A;  3PO3 G;  2B39 A;  1TII D;  3GTK B;  3SK5 A;  2M9V A;  5IT9 L;  4LUV A;  3NE5 B;  4DV7 Q;  5C4X G;  1QVG A;  2QKI C;  1WTP A;  3GTM B;  4HJA A;  5KNB A;  1Q12 A;  2JXM B;  3E6Z X;  1B9M A;  2KHS A;  3BZD B;  3MAQ A;  2VZA A;  1VMC A;  4RH6 A;  5I6W A;  2PPB C;  3FKI H;  3UDF A;  3MXG A;  2FJ2 A;  3PUY A;  2NBF A;  1EIF A;  4DR3 L;  1KL9 A;  4HIK A;  1BDO A;  4X6A H;  1I4Q A;  1A0I A;  1X65 A;  2WAQ E;  1ASY A;  2VL6 A;  3DM1 A;  4PNY A;  1LAB A;  3VR3 A;  4NXN Q;  4JW0 A;  1TWF B;  1TKW B;  2N55 A;  1MGS A;  1O7L A;  2J4X A;  2L11 A;  2BA0 A;  1HH2 P;  1ASZ A;  1C48 A;  2I0Q A;  1EZ6 A;  3V2T A;  2YTY A;  3FKI G;  1NMF A;  4FXK C;  4HED A;  3SXH A;  3S1R B;  1BCP F;  3MXN B;  2D2C C;  1F9S A;  3SDZ A;  2CH4 W;  5G3L D;  2PNH A;  3ZYY X;  3SVM A;  1FNU A;  2Y0S E;  4F87 A;  3SHL A;  4EVO A;  4XQN A;  1EYD A;  2YYZ A;  4KKS A;  4G7H C;  2CWP A;  2ZXP A;  2HDM A;  1N32 L;  1ICW A;  2KEN A;  4G7Z C;  5DM6 3;  2QW7 A;  2EQS A;  1O7Z A;  3M4Q A;  3SR1 A;  2BOS A;  3GTQ H;  2HT1 A;  3MTS A;  1LTB D;  4APV A;  1FNW A;  4HIO A;  2DJG C;  4FNF A;  4UP7 A;  1EY5 A;  4HID A;  2Z8L A;  4OIJ A;  1I4R A;  4A3K H;  4Q0F A;  2DUD A;  2WAQ B;  1B3Q A;  1EU4 A;  3S1N H;  1CKN B;  1H9S A;  2F0P A;  5EKK A;  1NY4 A;  2HQL A;  3K59 A;  2L12 A;  4LF9 L;  4JBW A;  4DV3 Q;  1G51 A;  3T1Y Q;  4DR1 L;  1RHP A;  1IKL A;  2LMC B;  1TS2 A;  1GD7 A;  1RD9 D;  1X55 A;  1ZYR C;  2K28 A;  2N49 A;  4KKU A;  4CDF C;  4A3I B;  3RZD H;  4A3K G;  1U5K A;  4JI0 L;  2H1E A;  1GHJ A;  2KED A;  2Y0S B;  4CGY B;  4DUY L;  1EY0 A;  1OXU A;  4K0K L;  4RMF A;  2NTS A;  2VUM B;  4ZUJ A;  4L5Q A;  3CCR A;  1C4Q A;  4B3M L;  4BBR B;  3VR4 A;  1JWM D;  3K0Y A;  2RSN A;  3U9S A;  3A74 A;  2HD3 A;  1SNQ A;  4C56 C;  2SDF A;  4K6L A;  1VQ9 A;  4GN5 A;  1EWC A;  2GVB A;  4ZRZ A;  4DPG A;  4RG1 A;  5C6A A;  5KGU A;  3HOZ B;  1AE2 A;  1NBW A;  1G6P A;  4KN4 C;  1HQM C;  2MHV A;  1EFI D;  5EBD A;  4DGZ A;  2L5T A;  3OMG A;  4LFA Q;  2UU9 Q;  4IOA A;  2L4N A;  2IW3 A;  4R9W A;  2HUG A;  3J7A 5;  2KHI A;  1KTK A;  5CV4 A;  1RL2 A;  4NXM L;  1HUN A;  1D5Z C;  2D9U A;  4GNX C;  4C3I G;  3I4N H;  2F0O A;  5JEA J;  1PZJ D;  4A76 A;  1Q8I A;  1YHQ A;  3S15 B;  1SYB A;  5FLX c;  4XQQ A;  2XRQ D;  2EDG A;  3EVQ A;  1Y8O B;  3HFZ B;  1VQP A;  2I5L X;  1QJO A;  1Q8K A;  1NE3 A;  2KCN A;  3TS2 A;  4A3G H;  1I94 Q;  4KK7 A;  3NTI A;  2RF4 A;  3P1H A;  3I4N G;  1CI3 M;  1CSP A;  4K6D A;  1WTQ A;  1TWH B;  3CW2 C;  4DAY A;  3GTL B;  3L9A X;  1JR0 D;  1BF4 A;  4A3D B;  5C3E B;  2E5L L;  4OO1 I;  4GLV B;  2F3V A;  2VQE Q;  4EGV A;  1SMY D;  1I50 B;  3U4Z A;  1X3F A;  5M9O A;  2RQX A;  1K8G A;  1B4O A;  4A3G G;  1AFP A;  3D6W A;  4PMC A;  4K8I A;  4YCW A;  5IT9 c;  5EGT A;  1XNQ L;  1Z7T A;  3SK8 A;  1HR0 W;  2F0L A;  1LUZ A;  4ZKB B;  4DR5 Q;  1DON A;  3QJY A;  1QE6 A;  3R2I A;  4ID6 A;  2NN6 H;  2K32 A;  4QIW E;  1VF5 C;  4H13 C;  4GKK L;  4PV1 C;  1HZA A;  4ZCK A;  1WYD A;  1EYG A;  1STY A;  1K8O A;  5HGQ A;  1KLU D;  5C3W A;  4CJ2 C;  1D5M C;  1XNR L;  1PH7 A;  3HOU H;  4FDB A;  2ZM6 L;  3BVZ A;  4S3S A;  1VQL A;  3A54 A;  3T56 B;  2F0F A;  1PFB A;  2KA7 A;  2O4X A;  5CV8 A;  1F2Y A;  1XTD A;  5M5X B;  2NN6 G;  5IYD H;  4A3M B;  1HZB A;  4BS9 A;  1B9N A;  1CHQ D;  2NTT A;  4G7O C;  3KJP A;  2N88 A;  1KD1 C;  1RIP A;  3HOU G;  2HDL A;  4CDD C;  1PH6 A;  4C3H H;  1MSG A;  1SSO A;  1Q7Y C;  5I2Y A;  1T5X D;  5IYD G;  5ELC A;  1PH4 A;  1FL0 A;  2PQA B;  4DXF A;  4A3F B;  1CM9 A;  3K0X A;  5IP7 H;  2UXC L;  1SND A;  1VDZ A;  2M2L A;  3IFD A;  4DUZ L;  1CZW A;  4XYQ A;  3RZO B;  5J1Z A;  4NMZ A;  4R4T A;  5ELB A;  1C7Y A;  4P72 A;  2K5N A;  4C3H G;  4QIW B;  1CZG A;  1SYE A;  3MXP A;  1QUQ B;  2KEC A;  4UHV A;  3PO3 B;  3DXJ C;  1GUT A;  3DUZ A;  2EJF C;  2XTI A;  5IP7 G;  3R3O A;  4K2K A;  5CYU A;  1UAP A;  5ELD A;  3K81 C;  2QEJ C;  3HKZ G;  4JCV E;  1RJT A;  1PTO B;  1YHB A;  5IGE A;  4A3B H;  1EU3 A;  1M4V A;  1E1O A;  2K5H A;  2LXK A;  1OXX K;  2F4V Q;  2I07 B;  2NB0 A;  4RWS C;  1L1O C;  5I6Y A;  1IKM A;  1H9S B;  3KF6 A;  4GOP C;  3W2D A;  1SJH D;  3OYY A;  4C1N I;  2AUJ D;  4A3B G;  3D0F A;  3M85 A;  1UUP A;  3FKI B;  1J6Q A;  3S1R H;  4RCN A;  5C0X I;  3EFX D;  1HNW Q;  2WFW A;  4A93 B;  1VS0 A;  1K0R A;  2A19 A;  3C1E A;  3BDC A;  2NZO A;  4ABN A;  1GUN A;  1KAA A;  1YIJ A;  2UUA L;  1K3R A;  4JI3 Q;  2OF1 A;  3ICE A;  1BNZ A;  1JOK A;  5CR3 A;  1E22 A;  3E5S A;  2PZW A;  2ZTE A;  2BH8 A;  1SYF A;  1SMX A;  3RLO A;  2BDO A;  2F0Q A;  1KDB A;  5IYC H;  4JI6 L;  2EYM A;  2XIW A;  2ES2 A;  5KYI A;  3VR5 A;  3TDQ A;  2ZXR A;  3P75 A;  1XMO Q;  3S1M H;  5CV9 A;  3K7U C;  4BXX H;  2CKZ B;  3CC4 A;  2WII B;  5DEH A;  3MHB A;  1EQT A;  3A7L A;  5DAU A;  4OWX B;  4DNR B;  2FMC A;  1UEB A;  3KLS X;  3H6M A;  5LMN Q;  5IYC G;  1QWY A;  5IGD A;  1X56 A;  4HR7 B;  1RTO A;  1PH1 A;  1BBX C;  1JJG A;  4B9W A;  1STN A;  2L55 A;  2O5J C;  4A3K B;  3DLL A;  1IBK Q;  1TWA H;  3F8T A;  1PV4 A;  2B2U C;  4PQX A;  5IOC A;  4QF4 A;  3A56 A;  2F0M A;  3TN2 A;  2VUM H;  3T4A C;  2Q8R E;  3NTH A;  3I4O A;  3RN5 A;  3G48 A;  1BOS A;  1SR3 A;  4I65 A;  4JI5 L;  3AQQ A;  2MPM A;  1XMQ L;  2K14 A;  5EKL A;  2A6H D;  1MI2 A;  1RDP D;  3K5O A;  1V1O A;  3O13 A;  3RZD B;  1NNX A;  4B3R Q;  2R7Z H;  3CF5 A;  1TS3 A;  4AYB G;  4DAY B;  1BCP D;  3CCL A;  2B2V C;  4KHV A;  3F2D A;  4LF5 Q;  4DV2 Q;  3D8G A;  1PFM A;  2B2W A;  4QJF A;  4XQJ A;  2VUM G;  4V19 0;  5M5W B;  1BR9 A;  1XPR A;  4TVA B;  2XWJ B;  3DWP A;  3R93 A;  1UEA B;  4IUU A;  1Q82 C;  4HJ8 A;  2R7Z G;  4EX5 A;  3TBI B;  3KFU A;  2ZJR A;  4X65 Q;  3FDT A;  1Y1V H;  1J5E L;  1F2M A;  4JBM A;  3CQZ H;  5I2X A;  4X3U A;  3PQI A;  5CV5 A;  4XYO A;  1Z6H A;  3CD6 A;  1G2S A;  2ID0 A;  4NP5 A;  1ZYR D;  4C3I B;  2ZJQ A;  3ZJY C;  2N3S A;  3CCM A;  4GOP A;  2UXB Q;  4UY8 C;  4IFD I;  1YHA A;  3S15 H;  4N9T A;  4DAM A;  3S1Q H;  2R7D A;  3AFQ A;  4MNO A;  1DZ1 A;  1Y1V G;  1TWG H;  4JVZ A;  3MWY W;  2PYK A;  4IFD H;  1STB A;  2E75 C;  2WP8 J;  4YY3 L;  3I4N B;  3J7A V;  3W5O A;  5IWA L;  1TWH H;  3NK9 A;  3L0O A;  3DEO A;  1CQV A;  1A15 A;  3CPW A;  5C3X A;  1KLG D;  4FYD A;  3PIO 3;  2K7V A;  1HFN A;  3Q6S A;  1I50 H;  3OTO Q;  2VQF Q;  4QQB X;  4MZ9 A;  1FNV A;  4A3J B;  3LWU A;  4A3G B;  2JP1 A;  2EY6 A;  1NJI C;  1LTI D;  1JB7 A;  1HHV A;  2K75 A;  2X6L A;  2A73 B;  2KCM A;  5AJ3 L;  1EY8 A;  1ENC A;  2F0D A;  2JYO A;  4JOI C;  2BCO A;  2E8G A;  2NUC A;  1Y8P B;  4LUZ A;  3KLS A;  2WB1 G;  3UI2 A;  4HJ9 A;  5BN3 A;  3HS0 C;  5CBE E;  4N8F A;  1TQO A;  4X64 Q;  5KEE A;  2Z9H A;  3A8J E;  4WJW A;  4GNX B;  4RKL A;  1SAP A;  2EYF A;  1ENA A;  3CHB D;  3KJO A;  1ET6 A;  1SFO B;  2PZT A;  3NXW A;  2B2U A;  4DR6 L;  3I4M H;  3HKZ E;  4OL7 A;  5M5X H;  4A3M H;  2L9H A;  1S3O A;  1AH9 A;  1EY7 A;  1IYJ B;  1BQQ T;  1SNO A;  4HCS A;  1UNS A;  2BDN A;  4IUN A;  4LF4 Q;  1P8L A;  1CTM A;  3H09 A;  1IL2 A;  1PRT F;  3H15 A;  4F8M A;  1TXY A;  2CFM A;  2UUB Q;  3CPF A;  1Y8N B;  3LWE A;  3I4M G;  1N34 L;  3KF6 B;  1HR0 L;  2JA9 A;  2QDL A;  5E4X A;  2A69 C;  3K58 A;  4DV5 L;  4Y52 H;  1JIC A;  1I4P A;  1R4P B;  4A3M G;  3JAM E;  1C0A A;  3CKI B;  4A3F H;  1HJP A;  4I7A A;  4M1U B;  4DNI A;  4X66 L;  2F3W A;  1A3T A;  5LL6 S;  4JI7 L;  1UE1 A;  3RZO H;  1HNZ Q;  3AEV A;  1SE4 A;  4R4I A;  5BR8 Q;  3GP7 A;  3Q22 A;  5CMD A;  4RGN A;  5J3B A;  1V9P A;  4A3F G;  2F0H A;  2F3I A;  5JOB A;  2R92 G;  4F88 A;  1YNJ C;  4OGQ C;  4LFB L;  4X3K A;  3HKZ B;  1SRU A;  3KLR A;  4H02 A;  3JAM i;  4L5T A;  2CQA A;  4F7X A;  1EEF D;  3E0E A;  4P74 A;  5JJI A;  3PF5 A;  4QY7 A;  4IUQ A;  1K83 H;  1W6J A;  5M3F H;  1BBW A;  4JV5 L;  4HMJ A;  3K6O A;  1QG7 A;  2CWA A;  4DV7 L;  3I3C A;  1ET9 A;  2X6G A;  4PZ6 A;  3ERS X;  1YIT A;  4P71 A;  2O5I C;  4A3B B;  1M8A A;  3K8A A;  1AN8 A;  1D6E C;  1ZKO A;  3NBH A;  1G8Z D;  1YNX A;  3I70 A;  4LWC A;  1YVC A;  2IX0 A;  3F2C A;  2DN8 A;  3P7J A;  1CKM A;  3MXU A;  1SN8 A;  3JAM L;  5M3F G;  2EOT A;  4A93 H;  2RKS A;  2ZT9 C;  4JI4 Q;  4X62 L;  2D5D A;  1E3P A;  4JOI A;  1T5E A;  2WV6 D;  4H44 C;  1EQV A;  5C5L A;  4LJZ C;  4NXN L;  1JJ2 A;  4ZKC B;  2RHQ B;  3TS0 A;  1GJX A;  3EA6 A;  1EQQ A;  4TSS A;  1TY2 A;  2IX1 A;  3FPP A;  5IYB G;  2I5M X;  4A93 G;  1LO5 D;  1E2V A;  2JQO A;  4AYB E;  1R9T B;  1W6K A;  2NVQ B;  3GV3 A;  2XVS A;  1HQR D;  1PHJ A;  4KHP L;  1H9R A;  1ONL A;  5IGF A;  5CC4 A;  4L63 B;  3KF8 B;  2NZH A;  1J8I A;  4TQU S;  3NHH A;  4M8A A;  2A6H C;  3CCJ A;  1E24 A;  1STA A;  4KD3 A;  4TKO B;  1PMR A;  4LNQ A;  1FGB D;  2MFI A;  1L1O B;  1BCP C;  3AB9 A;  1KAB A;  3OPO A;  1LT5 D;  3AFP A;  3BS1 A;  4LAA A;  3GTP H;  3S1M B;  3BU2 A;  3CCU A;  1C8C A;  5JJL A;  1N32 Q;  1SE2 A;  4P73 A;  2RCN A;  4GZY C;  4GOP B;  3VYR A;  5E3F A;  2I5H A;  3ERQ A;  4OEL B;  1QNK A;  4FXG C;  3Q8D A;  4A3L H;  1G91 A;  3LNN A;  4DV0 Q;  4DV3 L;  3W1G A;  3N6R A;  1MHW C;  4J15 A;  2GVA A;  4YHH Q;  3PF4 A;  1STH A;  3DWQ A;  4Q5V A;  1TWA B;  4L5S A;  4AYB B;  1K73 C;  4L8J A;  3GTJ H;  1XYI A;  4LF9 Q;  1WCM G;  2F0W A;  3Q0A A;  1PYW D;  1Q86 C;  1IBM L;  4A3L G;  4H7B A;  5M5W H;  1PFN A;  4YWK A;  4PZ7 A;  5JPM C;  5E1F A;  1VQD A;  4UAI A;  1VQF A;  2UUC Q;  1PZK D;  4JI0 Q;  2JJQ A;  4DUY Q;  2R7Z B;  5M3M B;  3CCS A;  1EIG A;  4UP8 A;  3UE1 A;  3MVV A;  2WB1 E;  3A7A B;  4C3I H;  2DGY A;  5I4D A;  4DV1 Q;  4B3M Q;  2LXJ A;  3AYH B;  3RLF A;  1TT2 A;  2E2J H;  2JA6 B;  2KCT A;  1WTO A;  4IQZ A;  2JA8 B;  3QOJ A;  2ZXO A;  1GUW A;  2UU9 L;  1Y1V B;  4ME5 A;  4LFA L;  4JBK A;  1V43 A;  1ZXT A;  3CQZ B;  4U68 A;  1EWH A;  3PO2 H;  5ELF A;  1DYQ A;  4HSP A;  4OXP A;  1A63 A;  3I4L A;  2QF7 A;  2AHO B;  2L1B A;  3CME A;  2A68 D;  4A3E H;  3MA2 B;  5LL6 X;  1WTW A;  4KI0 A;  3S1Q B;  1RKN A;  1JC7 A;  5JVH 3;  1TWG B;  4A3J H;  2R93 H;  3PO2 G;  3S14 B;  1YBY A;  1B50 A;  1VQG A;  1I94 L;  3HOW B;  3HZX A;  4A3E G;  3FRP B;  5FO8 B;  3NEN A;  2F1M A;  1OTC A;  1IXR A;  1VQ8 A;  5HY6 A;  2WB1 B;  5DNF A;  4A3J G;  2K50 A;  2R93 G;  1PA6 A;  2VQE L;  5EAY A;  1F9P A;  3NP8 A;  1IYV A;  2KUM A;  1D8L A;  2NN6 I;  3RN2 A;  4G57 A;  3K7A H;  1VQM A;  1SFO H;  3GD7 A;  1GUS A;  1EL0 A;  2G9D A;  2ZTD A;  2ATW A;  3F1Z A;  4DN4 M;  4DR5 L;  1LTR D;  1DOM A;  1VQ4 A;  1Q46 A;  1TR5 A;  2PO4 A;  5JJZ A;  1A6X A;  4PG3 A;  2DNC A;  1LTL A;  1M1K C;  1XNQ Q;  2IY5 B;  3I7F A;  3NWT A;  4JI1 L;  1TS5 A;  5IGB A;  3NSW A;  3OHX C;  3JAM c;  3U50 C;  1GHK A;  2EIF A;  3HOX B;  1PXU A;  1NR2 A;  2Q2I A;  1HFG A;  1FD7 D;  3I4M B;  3KDF A;  4GKK Q;  3C2P A;  3GQB A;  2F03 A;  1KDA A;  2SNS A;  3NBH B;  1XNR Q;  5C4Z A;  1EY6 A;  2ZM6 Q;  1PVO A;  4RHS A;  3RUZ A;  1WTR A;  3RLN A;  1WVL A;  4YCV A;  1N9W A;  2MUY A;  1B7Y B;  2D0O A;  4JI2 L;  1BKB A;  1QIL A;  1HA6 A;  2NVX H;  1PYB A;  1S5C D;  2LKV A;  5DM7 3;  1S72 A;  2MGS A;  2R92 B;  4K8J A;  1K3B C;  4AH6 A;  1SBB B;  4DV4 Q;  2MO1 A;  3QB3 A;  5E7N A;  4LW1 A;  4GKJ L;  4A4I A;  3DWA A;  1SE8 A;  1XXG A;  3D4W A;  2WAC A;  1WTH A;  4BY1 B;  5C5M A;  3T53 B;  2EYP A;  1I4H A;  2R6G A;  2UXC Q;  2MO0 A;  1VQ5 A;  4WJ4 A;  5CGK A;  1AEX A;  3Q24 A;  2UXD Q;  4KHZ A;  1RTN A;  2FMM A;  5G3L F;  2B2W C;  3AU7 A;  2Q2T A;  5FOB B;  2EE1 A;  2A69 D;  2IX3 A;  2HCI A;  3I91 A;  4IPD A;  4KV6 A;  2CVR A;  2EY2 A;  2EXZ A;  2C9O A;  1E7Z A;  1NMG A;  1XPO A;  5FO7 B;  4UDU C;  3SGI A;  2EJM A;  4ALP A;  1E1T A;  4FF2 A;  1TU2 B;  1MD2 D;  1GVP A;  1JWS D;  3BZC A;  2BE5 D;  5COY A;  5EPL A;  1K83 B;  5M3F B;  3PUZ A;  2F0N A;  1VQA A;  2QDB A;  2VNU D;  1VMP A;  3HP3 A;  2ENB A;  4MTN A;  1N36 L;  2B2Y A;  4Y7N B;  4QGU A;  3NUC A;  4HMI A;  1YNJ D;  4BBS B;  1BBU A;  2JK8 A;  2I46 A;  3CCV A;  4NDX A;  5I9P A;  5EPK A;  4DK1 A;  5J39 A;  1HA5 A;  4DK3 C;  1R9T H;  5A2Q E;  2EJG C;  1IW7 D;  4YWM A;  2NVQ H;  1KDC A;  4GN3 B;  4ME3 A;  3TEH B;  3TP8 A;  3ND8 A;  5JPN C;  2FFK B;  2IWH A;  3DHQ A;  4IAL A;  4C2M B;  2DJF C;  4OON A;  2Q8I B;  3J81 E;  2MP1 A;  2NVT B;  3QG1 A;  3NQI A;  1E0B A;  4OX9 L;  2JEA I;  4I7Z C;  1HNX Q;  1JWU D;  4IUT A;  2Z1C A;  1I3Q B;  4LF6 L;  2UUA Q;  4RGO S;  4N8X 1;  1QVC A;  2NWG A;  1J9O A;  4KJN A;  5K36 H;  2J0T D;  1QNU A;  3UE0 A;  3NBI A;  1GO3 E;  1XMO L;  5LMU L;  2HIX A;  1EY9 A;  1V1P A;  5IE8 A;  1LM0 A;  1CFM A;  2CHB D;  3J7Z C;  4JI6 Q;  1AW7 A;  1II3 A;  1PFS A;  5H1S E;  1CA6 A;  1D1K A;  1I4X A;  1K28 A;  2DNE A;  3E9I A;  4NPS A;  1U0L A;  4B9X A;  3UDX A;  4A3C H;  2MNA A;  3GTP B;  1Z9F A;  2NVY B;  3J81 i;  3CMA A;  3UDI A;  4DKA C;  1SYC A;  5K36 G;  1VQN A;  3VR6 A;  1EY4 A;  5C44 B;  1AP0 A;  3ITP A;  1EZ8 A;  2HHH Q;  1Q3L A;  1VQK A;  1WCM B;  5C0X J;  4GLX A;  2G9H D;  4H0L C;  1ZEQ X;  4A3C G;  3PIO A;  2H4O A;  1VQ7 A;  5A2Q L;  1SYG A;  4K5V A;  3ND9 A;  1NUC A;  3J7Y W;  1DJR D;  3DM3 A;  4DR2 L;  3GTJ B;  5M3M H;  2A68 C;  4B3R L;  3J81 L;  1JT8 A;  4DV6 L;  4B3T Q;  4WRD A;  2B63 B;  1XMQ Q;  2V1C C;  5IOD A;  3CRL C;  4KKT A;  4CDE C;  1SLJ A;  1CHP D;  2RDF A;  2JA6 H;  1BCP B;  4R1J A;  2JA8 H;  2OTL A;  5M5Y B;  2B8F A;  5E4W C;  3TP7 A;  2A6E D;  5M3M G;  2F52 A;  3MC0 B;  4NKL A;  4CKB A;  4LFC L;  3U58 A;  5EQ0 A;  5GAD C;  4A75 A;  5KRU A;  3QO2 A;  2E2J B;  5JJK A;  2JA6 G;  1JQY D;  5C4H A;  3FVQ A;  1SDF A;  3M4P A;  2JA8 G;  2AUK A;  4RGT A;  1B70 B;  1J5E Q;  2KVM A;  1TY0 A;  2BA1 A;  1DGS A;  3D31 A;  4DR7 L;  2EYO A;  2F4I A;  3PO2 B;  3S14 H;  3VYS A;  3S2H H;  3ONA B;  2RHS B;  3HOW H;  3PV0 A;  4JI8 L;  2AQ2 B;  4ZYS A;  2JA7 H;  2KJX A;  2VB3 X;  4A3E B;  1EYA A;  1B8A A;  1CKN A;  1PYS B;  4BWG B;  3TQY A;  1HTP A;  1BO0 A;  5EKI A;  2K1B A;  1PH2 A;  5GQO A;  2Z4H A;  4L6T B;  1YJ9 A;  2B8G A;  4LF7 L;  4YY3 Q;  2R93 B;  3KOJ A;  3BVM A;  3MEF A;  3ULJ A;  3K5L A;  2AWO A;  2PW5 A;  4YCU A;  1PH5 A;  1O7Y A;  1ROD A;  5IWA Q;  2VQF L;  1YNN C;  3CXC A;  1QZH A;  4B08 A;  2N78 A;  4KY6 A;  3HOW G;  4ZUI A;  1GUO A;  1VF7 A;  1LV9 A;  3SEB A;  3OMC A;  2JA7 G;  3HOY H;  3SK6 A;  2VW9 A;  3FMC A;  2Z4I A;  3HRZ C;  3T1H L;  4HIM A;  2R7F A;  3QR8 A;  3V96 A;  2Z0S A;  2K5Q A;  3FPU B;  3TRZ A;  4X64 L;  3K7A B;  3HOY G;  3HOX H;  4BY7 H;  4DAV A;  4IFD J;  1R4Q B;  3LGJ A;  5D65 A;  4DNT B;  1KRS A;  2EXD A;  2DY7 A;  1JE4 A;  3DMU A;  4DK6 C;  1LYL A;  1BUV T;  2E2H B;  2KEE A;  1A2U A;  4CDC C;  4RA8 A;  3FEW X;  1HZC A;  1PTO F;  4MTK A;  4MHE A;  2XGT A;  4RAU C;  5COR A;  2ICI A;  5NUC A;  4DR4 Q;  4JK1 C;  2Z6B A;  1T9H A;  4AQY Q;  3HOX G;  4BY7 G;  4LF4 L;  2JSO A;  4AIM A;  4DR6 Q;  4WFN 3;  1XX8 A;  4LF8 L;  4DFA A;  3IL8 A;  2K4K A;  1EOT A;  5J22 A;  4PMB A;  1JCK B;  2A74 C;  3KLW A;  2UUB L;  1H9K A;  4KTA A;  2VB2 X;  1U4M A;  2RVL A;  2R92 H;  5AFW A;  2F0K A;  2BE5 C;  4KY5 A;  3VDY A;  3BG3 A;  1YJN A;  4X3S A;  1N34 Q;  2B3G A;  5D3I B;  4DV5 Q;  1CSQ A;  3M9B A;  4BY1 H;  1LTT D;  1PRT C;  2EVB A;  3HOV B;  1ML0 D;  3CRK C;  2L0C A;  4XXE A;  1LTS D;  2IPK D;  5BR8 L;  1PH9 A;  1VQB A;  1DOK A;  4ILW A;  2NVX B;  2CW0 D;  4J1M A;  4XTC S;  5IP9 H;  4JI7 Q;  2E2I B;  1VQ6 A;  1NCV A;  1F2Z A;  1SNC A;  1K9M C;  2C5C A;  1KRT A;  1IBL L;  1BXT A;  1SNP A;  4JBJ A;  1FJG Q;  1OXT A;  3CC2 A;  1N33 Q;  4BY1 G;  1EEI D;  3RR5 A;  1IW7 C;  2KCC A;  4OIK A;  4QMG A;  4ODG A;  4JYA L;  1OXS C;  2G5D A;  2KOL A;  3CCE A;  5IP9 G;  4NB3 A;  4HN7 A;  4LFB Q;  1V1P B;  1EYC A;  2EPB A;  3PIP 3;  5L37 A;  4R8I A;  3NEM A;  1K8A C;  1F2L A;  4B3S Q;  3DEP A;  4K5X A;  4GLA C;  3CCQ A;  1OXV A;  5K5P A;  4EQN A;  4Y7N H;  4JPB W;  4J8Q A;  4XIG S;  5CV7 A;  5GAG C;  3ULP A;  4LMQ D;  1E2Z A;  4BBS H;  1U4R A;  1N8R C;  1C9O A;  4JV5 Q;  2LY7 A;  1GOZ A;  2IJ0 A;  4FVM A;  5IYB H;  2F0G A;  1IYU A;  3J81 c;  1GKH A;  5KNC A;  1VQH A;  1WI5 A;  1U4L A;  2MQH A;  4JI4 L;  2F0I A;  3UDG A;  4RGM A;  3A55 A;  2K05 A;  3H0G B;  2PI2 A;  2Z6K C;  2GA4 B;  4C2M H;  4DR3 Q;  2SOB A;  1XJV A;  4IUP A;  5LMN W;  4BBS G;  2NVT H;  3S2D B;  2VS1 A;  1F9Q A;  4IUV A;  3TSS A;  2ZTC A;  4X62 Q;  4DXG A;  3NEL A;  3CU7 A;  1I3Q H;  3EQL C;  2KQ3 A;  4UPA A;  2NZ1 D;  3EN2 A;  1MKH A;  1B1Z A;  3OIQ A;  3PGZ A;  1L0Y B;  2PQA A;  2RDG A;  4IPH A;  5GRO A;  2PNR C;  3TP6 A;  1QCB D;  4OWW B;  2C35 B;  1UE6 A;  1JMC A;  5ELE A;  2ASB A;  3AMU A;  2JE6 I;  1WJJ A;  4WOR A;  3HEJ A;  5BN4 A;  3TZU A;  4KHP Q;  1QUQ A;  3KK7 A;  1JOR A;  2V4D A;  2N8N A;  1M90 C;  2NVY H;  3N52 A;  4KN7 C;  3T51 B;  4ZAI A;  1BVS A;  2PW7 A;  2FIN B;  2YTX A;  5C44 H;  1VQC A;  2AQ3 B;  3S16 B;  1F77 A;  3H91 A;  1QVF A;  2EY1 A;  4K2L A;  1O80 A;  1WCM H;  3K5M A;  1ESF A;  4IZ8 A;  3W3A A;  2D0P A;  4ZK9 B;  1CK1 A;  2A6E C;  1I6V C;  5A35 A;  4R4O A;  2HCC A;  3STB D;  3OIP A;  3T1Y L;  3E3X A;  1LAC A;  2QEX A;  4HJ7 A;  4DV0 L;  5C44 G;  3BYT B;  3CAM A;  1CKO A;  3Q23 A;  1S5E D;  1LT3 D;  4YHH L;  2RA4 A;  1IL8 A;  2Q2H A;  4DR1 Q;  5JAV A;  4IO9 A;  1Z47 A;  1LT6 D;  1G29 1;  3CP0 A;  1U9R A;  3R8B A;  2B63 H;  2H5X A;  4XT3 B;  2PMZ E;  1AZQ A;  4R4Q A;  1B53 A;  1LTA D;  1S4Z A;  5M5Y H;  2UUC L;  3I8Z A;  4K0K Q;  1EQR A;  4WJ3 M;  5JEA H;  3C1F A;  1IBM Q;  1FR3 A;  3CC7 A;  3PUX A;  2E2D C;  5ISR A;  1Y69 U;  1WFQ A;  2B63 G;  4IN3 A;  1Y1W H;  5I9O A;  4DV1 L;  1NTG A;  2AWN A;  4QL5 A;  1I5F A;  2RSO A;  1X54 A;  3PCO B;  3SK4 A;  5LHY 1;  1S40 A;  1DXM A;  1CA5 A;  5JEA G;  1LTG D;  2ICE C;  3M7G A;  1UE7 A;  1FYC A;  1TWC B;  2A1A A;  3J81 j;  1X6O A;  1AE3 A;  1B44 D;  1Y1W G;  1IHZ A;  2NYZ D;  5F2D A;  4IJH A;  3IAY A;  1TVX A;  5FJ8 H;  4C3J H;  2Z6K A;  2JN4 A;  4DK0 A;  1PLF A;  3HG9 A;  4R4C A;  3PMF A;  5FK9 C;  2CH4 A;  3FP9 A;  4NXM Q;  3G7L A;  3A8K E;  1DD2 A;  1WTV A;  4MN3 A;  3GTG H;  4N9P A;  3GTO B;  1QB5 D;  3S2H B;  2PMZ B;  4HAE A;  1L2F A;  3J80 E;  1Q90 A;  2AQ1 B;  2JA7 B;  4C3J G;  5FJ8 G;  3I2Z A;  1WD1 A;  1ILP A;  4CKE A;  5KND A;  2B2Y C;  4LUO A;  1YEZ A;  1EFW A;  5C4J H;  3BJU A;  3MZ5 A;  4FP5 D;  1U4P A;  4TRD A;  3U4V A;  2MJ8 A;  1H9M A;  1UWV A;  3K80 C;  3TZD A;  4R8N A;  4QUF A;  3HOY B;  2PI2 E;  2E5L Q;  3X3N A;  1GUG A;  3BYY B;  1ICF B;  4ULL A;  2DY8 A;  4KJO A;  1STG A;  2E2H H;  1GM5 A;  1TS4 A;  5HGT A;  1DOL A;  4CKC A;  3J80 i;  1Q1E A;  5IGG A;  2K33 A;  4FXD A;  3TP5 A;  3M3Y B;  3IKJ A;  4OO1 H;  2SNM A;  3VYT A;  3W1B A;  2OCE A;  1DM0 B;  1ENF A;  2CW0 C;  4BY7 B;  1X3E A;  4XT1 B;  1SYD A;  2JA5 B;  1B3A A;  1MBY A;  2K01 A;  4O1N A;  3I90 A;  1RCV D;  1YNN D;  3MEH A;  4KD4 A;  4PMW A;  1Q81 C;  2K04 A;  2EYH A;  5EBC A;  2YU9 H;  4NW2 A;  1JE5 A;  3C46 A;  5FKA C;  5GAE C;  4JI1 Q;  4FF4 A;  1X3P A;  3VA7 A;  3J7A F;  4OO1 G;  4FO2 A;  4OWT B;  3H3V C;  3ULL A;  1XPU A;  3J80 L;  4RCO A;  5ELO A;  3HGB A;  3M4O H;  3HOV H;  1S5F D;  2OXP A; 
#chains in the Genus database with same CATH homology
 3PUW A;  3G6E A;  4A3M G;  1C0A A;  4A3F H;  1GD7 A;  1HJP A;  1X55 A;  4GS3 A;  2E2I H;  2N49 A;  4DNI A;  3RZD H;  3DM3 A;  4A3K G;  3OW2 A;  4X66 L;  4DR2 L;  4JI7 L;  5IY0 A;  1JJC B;  1U5K A;  1UE1 A;  5M3M H;  4JI0 L;  3RZO H;  4DUY L;  1HNZ Q;  1WOC A;  4B3R L;  1OXU A;  4K0K L;  1JT8 A;  4DV4 L;  3AEV A;  4RMF A;  2YV5 A;  4R4I A;  5BR8 Q;  4DV6 L;  4B3T Q;  4JI2 Q;  3HOV G;  1XMQ Q;  4Y52 H;  2V1C C;  4L5Q A;  3CCR A;  1SLJ A;  4B3M L;  5J3B A;  1EIY B;  2JA6 H;  1V9P A;  4R1J A;  4A3F G;  3H3V I;  4DUZ Q;  2F3I A;  2JA8 H;  1V1Q A;  3A74 A;  3I55 A;  2BH2 A;  2R92 G;  4GKJ Q;  2OTL A;  2CQO A;  2L15 A;  4LFB L;  2K52 A;  2UXD L;  5M3M G;  3GDE A;  2F52 A;  1VQ9 A;  4GN5 A;  1SRU A;  4LFC L;  3U58 A;  2GVB A;  3HKS A;  4H02 A;  5GAD C;  4A75 A;  4DPG A;  3JAM i;  4RG1 A;  3G71 A;  3H3V H;  4L5T A;  1AE2 A;  1NBW A;  1G6P A;  3E0E A;  4P74 A;  5JJI A;  3ER0 A;  3WWV A;  5JJK A;  3GTK H;  2JA6 G;  3PF5 A;  4QY7 A;  4GNX A;  2F4V L;  3M4P A;  4LFA Q;  2UU9 Q;  2JA8 G;  1K83 H;  5M3F H;  4BA2 I;  4IOA A;  1BBW A;  1J5E Q;  1B70 B;  4JV5 L;  3GTM H;  2BA1 A;  1DGS A;  3D31 A;  2CWA A;  4DV7 L;  4DR7 L;  3J7A 5;  4PZ6 A;  2KHI A;  4NXM L;  1RL2 A;  3ERS X;  4JC0 A;  4P75 A;  5ELN A;  1YIT A;  3H0G H;  4P71 A;  3S14 H;  4GNX C;  1Y14 B;  3K8A A;  4LWC A;  1KQS A;  3I4N H;  1YNX A;  3S2H H;  2RHS B;  4KLK A;  3HOW H;  5JEA J;  1YVC A;  1KAW A;  2IX0 A;  3PV0 A;  4JI8 L;  3F2C A;  4A76 A;  2JA7 H;  3S2D H;  1YHQ A;  3PUV A;  1B8A A;  1CKN A;  1CKM A;  3EIV A;  5FLX c;  3L2P A;  2B29 A;  1SN8 A;  1PYS B;  4IJL A;  3TQY A;  5M3F G;  4A93 H;  1D7Q A;  1VQP A;  1PH2 A;  4JI4 Q;  3HFZ B;  4X62 L;  1N36 Q;  1HNW L;  1E3P A;  5GQO A;  2I5L X;  1YJ9 A;  4JOI A;  1TWF H;  4YY3 Q;  4LF7 L;  1Q8K A;  1NE3 A;  1A62 A;  3KOJ A;  1A8V A;  3MEF A;  3ULJ A;  2AWO A;  1PH5 A;  2K5V A;  4YCU A;  2RF4 A;  4NXN L;  3H0G G;  1JJ2 A;  5IWA Q;  2VQF L;  3CXC A;  1QZH A;  2RHQ B;  3I4N G;  2N78 A;  1CSP A;  4JI3 L;  3HOW G;  1VQJ A;  3STB C;  3TS0 A;  2QA4 A;  1EQQ A;  3CW2 C;  2JA7 G;  3HOY H;  3PIO A;  2IX1 A;  2VW9 A;  5IYB G;  2I5M X;  3JC6 6;  4A93 G;  2JQO A;  4AYB E;  2E5L L;  4OO1 I;  4GLV B;  2VQE Q;  3T1H L;  1HNX L;  3U4Z A;  3A5U A;  4HIM A;  1X3F A;  1PHJ A;  4KHP L;  1K8G A;  4A3G G;  2IT1 A;  2R7F A;  2Z0S A;  5GAH C;  3TRZ A;  2OQK A;  1EUJ A;  4UP9 A;  4YCW A;  5IT9 c;  1CUK A;  3KF8 B;  1XNQ L;  2NZH A;  1HR0 W;  4X64 L;  4TQU S;  4OX9 Q;  3S16 H;  4IPG A;  1LUZ A;  3HOY G;  1Q1B A;  3HOX H;  1E24 A;  3CCJ A;  4BY7 H;  2ALY B;  4IFD J;  4LF6 Q;  4DR5 Q;  3LGJ A;  4LNQ A;  1KRS A;  4POG A;  2MFI A;  2EXD A;  4DK6 C;  1L1O B;  1LYL A;  1SRO A;  5LMN L;  3AFP A;  3GTP H;  4QIW E;  3BU2 A;  3CCU A;  5LMU Q;  1HZC A;  3B6Y A;  4GKK L;  5JJL A;  3S24 A;  5C0X G;  1HZA A;  2XGT A;  1N32 Q;  4P73 A;  1WYD A;  2RCN A;  1EYG A;  4GOP B;  4BA1 I;  5HGQ A;  4DR4 Q;  5DLQ E;  1XNR L;  2I5H A;  1PH7 A;  1T9H A;  4AQY Q;  4FDB A;  3HOX G;  4LF4 L;  3HOU H;  4AIM A;  2ZM6 L;  1IBK L;  2D62 A;  2HHH L;  2FXQ A;  3Q8D A;  4DR6 Q;  2OQ0 A;  4LF8 L;  1VQL A;  3PSI A;  2K4K A;  4A3L H;  1XTD A;  1PH8 A;  2UUB L;  3KLW A;  2NN6 G;  4DV0 Q;  5IYD H;  1PH3 A;  1HZB A;  4DV3 L;  4BXX G;  3W1G A;  4J15 A;  2GVA A;  2KHJ A;  1KC8 C;  2R92 H;  4YHH Q;  3PF4 A;  4A3I H;  1HZ9 A;  3KJP A;  4L5S A;  2WAQ G;  1RIP A;  3GTJ H;  1K73 C;  1KD1 C;  3VDY A;  3HOU G;  1YJN A;  4LF9 Q;  1WCM G;  1N34 Q;  2B3G A;  1PH6 A;  4C3H H;  4BY1 H;  4DV5 Q;  1CSQ A;  3M9B A;  1Q86 C;  1IBM L;  4A3L G;  4JI5 Q;  5M5W H;  1Q7Y C;  4YWK A;  4LF5 L;  4DV2 L;  4PZ7 A;  1VCI A;  1VQD A;  5IYD G;  5BR8 L;  1PH9 A;  1PH4 A;  1VQB A;  1FL0 A;  1VQF A;  4BBR H;  2UUC Q;  4B3T L;  2PQA B;  3K0X A;  5IP7 H;  5IP9 H;  4DR2 Q;  4XTC S;  4JI7 Q;  2UXC L;  1VQ6 A;  4JI0 Q;  4A3I G;  1EWI A;  4EQ5 A;  2JJQ A;  4DUY Q;  2JEB I;  1VQO A;  1P16 A;  4DUZ L;  1K9M C;  3CCS A;  1KRT A;  4UP8 A;  2Y0S G;  1IBL L;  4DV6 Q;  1C7Y A;  4JYA Q;  4R4T A;  4JBJ A;  4P72 A;  1TWC H;  1FJG Q;  1OXT A;  2K5N A;  3UE1 A;  4X65 L;  3CC2 A;  4BY1 G;  1N33 Q;  4C3I H;  2WB1 E;  3RR5 A;  4DV1 Q;  2DGY A;  3F2B A;  1QUQ B;  2OWO A;  4B3M Q;  3HOZ H;  2LXJ A;  1KHI A;  3AYH B;  4GN4 B;  3RLF A;  2E2J H;  4BBR G;  1OXS C;  3CCE A;  2KCT A;  4JYA L;  2UXB L;  2XTI A;  5IP9 G;  3L7Z C;  4NB3 A;  5IP7 G;  4LFB Q;  4LFC Q;  1MJC A;  2GN5 A;  3J80 c;  3NEM A;  1K8A C;  2UU9 L;  4B3S Q;  1L1O A;  3K81 C;  4LFA L;  4JBK A;  1V43 A;  3HKZ G;  4L5R C;  4GLA C;  4JCV E;  1OXV A;  3CCQ A;  3GTO H;  3PO2 H;  4Y7N H;  4OXP A;  1YHB A;  4O2D A;  3KDF B;  4A3B H;  4XIG S;  3HOZ G;  1A63 A;  5GAG C;  3ULP A;  1E1O A;  2K5H A;  4PZ8 A;  2LXK A;  1OXX K;  2HIV A;  2F4V Q;  4BBS H;  2AHO B;  3CME A;  1N8R C;  1C9O A;  4JV5 Q;  1L1O C;  2IHE A;  4A3E H;  5IYB H;  1H95 A;  3EBE A;  4DR7 Q;  1YJW A;  5FLM H;  4KI0 A;  3J81 c;  1GKH A;  1QZG A;  3KF6 A;  2ZJP A;  1VQH A;  1WI5 A;  3E9H A;  4GOP C;  2MQH A;  4A3J H;  3BZK A;  2R93 H;  4JI4 L;  3PO2 G;  3UDG A;  3OYY A;  3OTO L;  4A3B G;  1YBY A;  3D0F A;  2PI2 A;  2Z6K C;  4JI8 Q;  1YI2 A;  3M85 A;  4C2M H;  1VQG A;  1I94 L;  4DR3 Q;  1XJV A;  5LMN W;  4BBS G;  1W3S A;  1J6Q A;  4HJ5 A;  3S1R H;  2NVT H;  2KBN A;  2VS1 A;  1UE5 A;  5C0X I;  4A3E G;  3GTL H;  1HNW Q;  2ZTC A;  4X62 Q;  1KIX A;  2WFW A;  3NEN A;  3NEL A;  4A3D H;  1VS0 A;  5FLM G;  5C3E H;  1I3Q H;  1IXR A;  1K0R A;  1OTC A;  2A19 A;  1VQ8 A;  5HY6 A;  2VY3 A;  4UPA A;  4POF A;  2NZO A;  2IHF A;  1YIJ A;  3EN2 A;  4A3J G;  2K50 A;  4O0A A;  2R93 G;  1MKH A;  1PA6 A;  2UUA L;  1K3R A;  2VQE L;  4JI3 Q;  4IFD G;  5EAY A;  5AJ3 Q;  3PGZ A;  1VQE A;  3IRB A;  2PQA A;  1X3G A;  1MJE A;  3ICE A;  4IPH A;  3M3Y H;  5GRO A;  1E22 A;  1D8L A;  2NN6 I;  2ZTE A;  1W2B A;  3RN2 A;  2BH8 A;  3K7A H;  4OWW B;  1FGU A;  2C35 B;  1UE6 A;  1JMC A;  3M7N A;  1SMX A;  3RLO A;  2ASB A;  2JE6 I;  1VQM A;  1SFO H;  2JA5 H;  3T1H Q;  5IYC H;  4A3D G;  3GD7 A;  1WJJ A;  5C3E G;  4JI6 L;  1IZ6 A;  1EOV A;  3FHW A;  4KHP Q;  2ES2 A;  2ZTD A;  2ATW A;  1QUQ A;  3F1Z A;  4DR5 L;  1VQ4 A;  1XMO Q;  1Q46 A;  1VQI A;  2N8N A;  3PIP A;  1M90 C;  2NVY H;  3K7U C;  4PG3 A;  3S1M H;  1LTL A;  4BXX H;  1FVI A;  1M1K C;  1XNQ Q;  1BVS A;  2CKZ B;  2IY5 B;  2YTX A;  5C44 H;  3I7F A;  3CC4 A;  1VQC A;  4OWX B;  4JI1 L;  3JAM c;  1UEB A;  3KYH C;  1QVF A;  3U50 C;  2EIF A;  1WCM H;  4DR4 L;  5LMN Q;  2JA5 G;  2D0P A;  3TRE A;  2Q2I A;  5IYC G;  2YTV A;  4AQY L;  3KDF A;  4GKK Q;  1X56 A;  4R4O A;  2Q2U A;  3STB D;  1PH1 A;  3GO5 A;  3T1Y L;  3NBH B;  2QEX A;  4IPC A;  1JJG A;  1XNR Q;  4LF7 Q;  4HJ7 A;  4DV0 L;  5C44 G;  1L0W A;  3I4M G;  2LSS A;  3CAM A;  2ZM6 Q;  3DLL A;  1TWA H;  1CKO A;  1IBK Q;  1PVO A;  3F8T A;  1PV4 A;  4LF8 Q;  4YHH L;  2Q2H A;  1HR0 Q;  4DR1 Q;  3RLN A;  4IO9 A;  4YCV A;  1Z47 A;  2AMC B;  1I94 Q;  3CP0 A;  1G29 1;  1N9W A;  1HNZ L;  2VUM H;  1B7Y B;  3I4O A;  2B63 H;  3RN5 A;  2D0O A;  2H5X A;  3G48 A;  1I6H H;  1SR3 A;  4JI2 L;  4JI5 L;  3AQQ A;  2CCZ A;  1BKB A;  1XMQ L;  2K14 A;  2PMZ E;  4X66 Q;  1PYB A;  2NVX H;  1KXL A;  4R4Q A;  1S72 A;  3G4S A;  1O7I A;  4AH6 A;  2QGQ A;  5M5Y H;  1VQ7 A;  2UUC L;  2R7Z H;  4B3R Q;  2AKW B;  4DV4 Q;  4K0K Q;  1EQR A;  2MO1 A;  4AYB G;  5E7N A;  4DAY B;  4LW1 A;  3CF5 A;  4GKJ L;  4BY7 G;  3CCL A;  1IBM Q;  4A4I A;  1SE8 A;  3CC7 A;  3F2D A;  4LF5 Q;  4DV2 Q;  3PUX A;  4QJF A;  2VUM G;  3RNU A;  1WFQ A;  1YZ6 A;  2B63 G;  3PO3 H;  1XPR A;  2R6G A;  1MIU A;  4TVA B;  1Y1W H;  1FJG L;  1N33 L;  2UXC Q;  4DV1 L;  2MO0 A;  1VQ5 A;  1NTG A;  4WJ4 A;  4JG2 A;  2AWN A;  4QL5 A;  2UXD Q;  1I5F A;  1X54 A;  3PCO B;  5C4X H;  3I56 A;  2OTJ A;  4KHZ A;  1S40 A;  1Q82 C;  1IBL Q;  4HJ8 A;  4IOC A;  3S17 H;  2R7Z G;  4EX5 A;  3KFU A;  2ZJR A;  2Q2T A;  2A8V A;  5JEA G;  4X65 Q;  1Y1V H;  3A5Z B;  1J5E L;  1UE7 A;  3CQZ H;  4JBM A;  4IPD A;  2A1A A;  1X9N A;  4B3S L;  3J81 j;  1XPO A;  3CD6 A;  2ID0 A;  1E7Z A;  1NMG A;  4YWL A;  2ZJQ A;  3ZJY C;  2N3S A;  3CCM A;  3A0J A;  1X6O A;  1AE3 A;  3SGI A;  4ALP A;  4GOP A;  1E1T A;  1Y1W G;  3PO3 G;  4UY8 C;  2UXB Q;  4IJH A;  4IFD I;  5FJ8 H;  1GVP A;  2Z6K A;  1YHA A;  3BZC A;  4C3J H;  3S15 H;  4LUV A;  3TS2 A;  4A3G H;  4DV7 Q;  5C4X G;  1QVG A;  3PUZ A;  4R4C A;  4DAM A;  1VQA A;  3FP9 A;  4HJA A;  4NXM Q;  2R7D A;  1Q12 A;  3AFQ A;  4MNO A;  3S1Q H;  2VNU D;  1Y1V G;  1TWG H;  3GTG H;  4MTN A;  1N36 L;  2WP8 J;  4QGU A;  2VZA A;  4YY3 L;  1L2F A;  3W5O A;  5IWA L;  1TWH H;  3FKI H;  3L0O A;  1BBU A;  2JK8 A;  3UDF A;  5FJ8 G;  3PUY A;  3CCV A;  3CPW A;  1EIF A;  4DR3 L;  1KL9 A;  3I2Z A;  4HIK A;  4X6A H;  4DK3 C;  1A0I A;  1X65 A;  1R9T H;  2WAQ E;  1ASY A;  2VL6 A;  4LUO A;  1YEZ A;  4YWM A;  1EFW A;  4NXN Q;  5C4J H;  3OTO Q;  1I50 H;  2NVQ H;  2VQF Q;  3BJU A;  4QQB X;  4MZ9 A;  4GN3 B;  4ME3 A;  3TEH B;  1NJI C;  2BA0 A;  1HH2 P;  1ASZ A;  1JB7 A;  3U4V A;  2I0Q A;  2K75 A;  2KCM A;  1UWV A;  4OON A;  3K80 C;  5AJ3 L;  2YTY A;  3FKI G;  1NMF A;  2PI2 E;  2E5L Q;  4JOI C;  3MXN B;  4OX9 L;  4WJ3 M;  2JEA I;  1HNX Q;  2PNH A;  2E8G A;  4LUZ A;  4LF6 L;  2UUA Q;  2Y0S E;  1QVC A;  2WB1 G;  2E2H H;  4HJ9 A;  1GM5 A;  3J80 i;  1Q1E A;  4X64 Q;  3UE0 A;  1XMO L;  1GO3 E;  2YYZ A;  2CWP A;  5LMU L;  2HIX A;  5IE8 A;  1N32 L;  1LM0 A;  2KEN A;  2EQS A;  3J7Z C;  3W1B A;  4GNX B;  2OCE A;  3M4Q A;  4JI6 Q;  1X3E A;  1PFS A;  3KJO A;  3GTQ H;  5H1S E;  2HT1 A;  4DR6 L;  3E9I A;  4NPS A;  1U0L A;  3HKZ E;  4PMW A;  3UDX A;  1Q81 C;  3I4M H;  4A3C H;  5M5X H;  2YU9 H;  2MNA A;  4APV A;  1Z9F A;  4HIO A;  4A3M H;  4UP7 A;  3J81 i;  3CMA A;  1JE5 A;  3UDI A;  4DKA C;  5K36 G;  1VQN A;  1S3O A;  4HID A;  5GAE C;  1AH9 A;  1IYJ B;  4JI1 Q;  4LF4 Q;  4A3K H;  2HHH Q;  1P8L A;  2DUD A;  4OO1 G;  4OWT B;  3ULL A;  1IL2 A;  3H15 A;  1XPU A;  3S1N H;  1CKN B;  1VQK A;  1TXY A;  5C0X J;  2CFM A;  4GLX A;  5ELO A;  1NY4 A;  2HQL A;  2UUB Q;  3CPF A;  3M4O H;  4LF9 L;  4JBW A;  4DV3 Q;  3HOV H;  1G51 A;  1N34 L;  3KF6 B;  4DR1 L;  2JA9 A;  3T1Y Q;  1HR0 L;  4A3C G;  4DV5 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...