4DV2L

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, c912a
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
molecule keywords 16S rRNA
total genus 13
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv2L00
4RG1A 2RHSB 2AMCB 4GLXA 1BVSA 1KL9A 3OTOQ 1VQ9A 1IZ6A 3J81i 3G48A 5C44G 4HIOA 1C0AA 1Y1WG 1NBWA 4IFDJ 1MJEA 2K75A 4JBMA 4JI2Q 2JA5H 3DM3A 3JAMi 3M85A 4DR5L 1WYDA 2VQEL 4B3ML 4A3CG 4HJ8A 3UDIA 4DR2Q 1HNZL 1TXYA 2NN6I 5IE8A 2NZOA 3RLOA 4EQ5A 1KC8C 1PH7A 3PUVA 4POGA 1CKNB 3J80c 4GKJQ 1Q8KA 2VY3A 1CKMA 3L2PA 3A74A 4JBJA 1KRSA 1VQOA 1L2FA 2R7ZH 3GD7A 1C7YA 4GNXB 3PO3H 3HOWG 4KHPL 4P71A 4A3JH 4R4QA 1N33L 1CKNA 4UP9A 1N8RC 2PQAB 4HIDA 1TWFH 3CD6A 1G51A 4JYAL 2UXDQ 4JV5L 1YNXA 4JI6L 4BA2I 3E9HA 4JI7Q 1E22A 1HNXL 3HKZE 1PA6A 3CC4A 2BH8A 4BXXH 1RIPA 2N78A 3FHWA 3K80C 2OCEA 1JE5A 1WI5A 3G4SA 2B29A 2L15A 3RLFA 4HIKA 3HFZB 5IYCG 1SFOH 4X62L 2K5VA 3FKIG 3HOWH 1V9PA 2R7ZG 4QIWE 3PUYA 3W5OA 4EX5A 2BA0A 3CXCA 5M5WH 3CMAA 3PV0A 3CW2C 3T1YL 1PH5A 2KBNA 3U50C 3EBEA 5M3MG 3CMEA 4LUVA 4JI1L 3A5UA 4QQBX 1I5FA 5C4XG 1JB7A 2N8NA 1QZHA 4WJ3M 5GAGC 3OTOL 1GM5A 2UXCL 4GNXA 3EN2A 2IHFA 4DV5Q 2NVTH 4NXNL 4X64Q 2EIFA 1IYJB 4LF8Q 4A3FH 3PO2G 2K50A 4L5QA 3BZCA 3UDXA 3J81j 5EAYA 4LF9Q 1N36L 1PH4A 4A93H 1WJJA 5C44H 1VQFA 2E5LQ 4P72A 4JI7L 1EUJA 2E5LL 4LFCL 5BR8L 1XPUA 1PH2A 5AJ3Q 3GTLH 1HR0Q 2GN5A 3ULPA 3OW2A 2K4KA 1L1OA 3F8TA 1Q12A 3PO2H 2ZTCA 4X66L 3K81C 1PH1A 1NMFA 5IP7H 4IPDA 4LF6L 3MEFA 3CCJA 2VL6A 3HOVH 5ELNA 2Z6KA 3AEVA 1BBWA 1UWVA 1YI2A 1I6HH 4DV0L 4OO1G 1IBLQ 4A3DH 4LFBL 2RHQB 1VQGA 5J3BA 1IBMQ 1WOCA 1S40A 3AQQA 4DUZQ 1HNXQ 1Q81C 4YHHQ 1RL2A 2K5NA 2AWOA 4IPGA 1YHBA 4DUYL 1HR0W 1J6QA 2RCNA 1XNRL 3GTOH 1U0LA 1XTDA 1XNQL 4A3GH 4QY7A 4JV5Q 1SROA 2EQSA 4GN5A 4Y7NH 4A3IG 3STBC 2ID0A 4LUOA 3RLNA 1PH9A 1D8LA 5IWAQ 2IX1A 1WCMH 2KHIA 4A93G 4JI1Q 4IJLA 4AQYQ 4L5SA 4XTCS 1VQ8A 3ZJYC 2UUAQ 2WB1G 3JAMc 1EIFA 3UE1A 5C0XI 4B3RQ 2QA4A 3STBD 1K73C 1D7QA 1SMXA 1NTGA 1XMQQ 1ASYA 4DR6Q 1LTLA 2HHHQ 2KCMA 2IY5B 3W1BA 1UE5A 4LF5L 4RMFA 2JJQA 4JCVE 2RF4A 5C4XH 3H3VH 3TRZA 4X6AH 3CCUA 1VQ6A 3DLLA 1IBML 2KCTA 2ES2A 3I4NH 2V1CC 4JI2L 4OWWB 1BBUA 4A3LG 1N32L 3TEHB 4DV7Q 4C2MH 3KF6B 3HOXG 4GLVB 2EXDA 2B3GA 4C3HH 5IYCH 4BA1I 2FXQA 4JI4L 4JI0Q 4AYBE 3I7FA 2GVAA 3T1YQ 4LFAQ 1X3EA 2CFMA 1YHAA 2DGYA 4A3MH 4IPCA 2E2JH 1HZAA 4BY7H 1C9OA 4MZ9A 4MTNA 2CCZA 4DKAC 4UY8C 1BKBA 4A3GG 1WFQA 4X64L 1XMQL 2I5HA 1IBLL 3S1NH 4OO1I 1A62A 1M1KC 3K0XA 3CCSA 4LF5Q 3PO3G 3W1GA 4DAYB 4BBSG 2NZHA 1QUQB 1VQDA 2D0OA 2KHJA 3CP0A 1Q7YC 1VQHA 4GS3A 2ZM6Q 2UXDL 3I56A 2JE6I 2R93H 4A3DG 1YJWA 1G291 3HOYG 1IBKL 4Y52H 3J81c 3CCQA 4OWXB 3PF4A 4APVA 4DR4L 3RN5A 3I4OA 2WAQE 4A75A 1QUQA 3KF6A 4YCWA 2JEBI 1VQCA 4A3CH 5IWAL 2Q2UA 1Y14B 1EFWA 1VQPA 5GADC 4A3KG 1EQRA 4GOPB 2A19A 4HIMA 2OQKA 4DAMA 1QVCA 1FGUA 4OXPA 5C0XG 4IO9A 1MKHA 3GTQH 4PG3A 3M4QA 2ASBA 2XTIA 4YY3Q 2MO1A 4LFBQ 4GN4B 4JI3L 3G71A 4DK6C 3UDGA 2I5MX 2HT1A 1VQ5A 4JI6Q 1J5EL 1I94L 3ICEA 1GO3E 2IX0A 4YWKA 1I3QH 4L5RC 4A3FG 3PUXA 3CQZH 1VS0A 4DR2L 2NVQH 3S2HH 5E7NA 2AKWB 1N34L 4QGUA 1XPRA 2CWAA 1O7IA 2F3IA 4LWCA 5IYBG 3T1HL 4JC0A 1X55A 1JMCA 4JI4Q 1A63A 3M3YH 3GDEA 4DV4Q 5M3MH 4DK3C 4A3KH 3GTMH 1VCIA 3S16H 1TWGH 4YCUA 2HIXA 3ERSX 3G6EA 4NXMQ 3S1MH 4X66Q 3K8AA 5LMNL 2I0QA 3HOZH 4B3RL 4NPSA 4DR3Q 4OX9Q 4DPGA 4C3JH 1VQMA 4DV5L 4B3SL 3HOYH 1Z47A 4PMWA 1PYBA 2LXJA 4JYAQ 2E8GA 4LUZA 4LF9L 5JJKA 2Q2HA 2YTXA 3SGIA 1K0RA 1OXUA 5IT9c 3WWVA 4GKKQ 2YV5A 1UE1A 2IHEA 3BZKA 2BA1A 5IP9G 4A3EG 4ME3A 1ASZA 2R6GA 1PYSB 3J7ZC 4A3JG 1W3SA 4JOIA 3T1HQ 1GVPA 3S1RH 4K0KL 1X54A 1I50H 4JI5L 5C4JH 4DV2Q 1VQLA 4JI5Q 2R7FA 4GKJL 4IOAA 3B6YA 2MQHA 2Z6KC 5JJLA 1L0WA 3CCEA 1X56A 3UDFA 1NMGA 1PVOA 1X65A 3RR5A 3S15H 1UE7A 1L1OC 2BH2A 1KAWA 4WJ4A 4LF8L 4NXNQ 2B63H 4A3BH 1A0IA 4FDBA 4HJ7A 4PZ8A 2WAQG 2JA8G 1HNWQ 3PUZA 1HNWL 5M5YH 3RZOH 1VQBA 4H02A 2VQFL 4GKKL 2A1AA 4LFCQ 2R92G 2IT1A 1XNRQ 5BR8Q 3M7NA 2OWOA 2OTLA 1QVFA 1S3OA 4A4IA 4ALPA 4BY1H 1YHQA 4LF4L 5JEAG 1WCMG 1E24A 4TVAB 5IYDG 4DV2L 4JI0L 3S14H 2UUCQ 4AQYL 4HJ5A 4O0AA 2ZTEA 4GOPC 1G6PA 2ZTDA 4BBRG 3E0EA 4DR6L 4IPHA 3OYYA 1VQIA 4P75A 4IFDI 1JT8A 1JJ2A 2F52A 2Y0SG 3K7AH 2YYZA 3HOZG 1Y1VH 4R4OA 1CSQA 1FL0A 2DUDA 3CC7A 1N36Q 3CCRA 1N32Q 4DUYQ 3ULJA 4DV7L 2WB1E 3HOVG 4DR7L 1E3PA 3E9IA 1U5KA 2LXKA 2UUBQ 2PQAA 5IY0A 1QVGA 3U4VA 2JEAI 3KFUA 3NENA 2JK8A 4BBRH 1A8VA 1SLJA 2YTYA 3KDFA 1OXSC 2VS1A 1OXVA 4QL5A 2F4VQ 2F4VL 2UUAL 2YTVA 3GTJH 1JJCB 2PI2E 2MNAA 1N33Q 4BY7G 4GN3B 4B3SQ 1XMOQ 1UE6A 3GTGH 4LF6Q 1UEBA 2R92H 4JBKA 4KI0A 4AYBG 4YY3L 1YJNA 1AH9A 1KRTA 2VZAA 3D31A 4L5TA 4JI3Q 2ZJPA 1CUKA 2OTJA 3H3VI 1IL2A 2JA8H 1L1OB 1Q46A 4GNXC 4A3BG 4YHHL 2B63G 5ELOA 5FLMH 3RNUA 1IBKQ 3PIPA 2NN6G 5FLMG 3H15A 3A5ZB 3I4NG 4LF4Q 4A3LH 4OWTB 4LW1A 2JA6H 3I55A 1PH6A 1GKHA 4KLKA 3TS2A 1X3GA 4DR1Q 3CF5A 1S72A 2Q2TA 3PSIA 3KDFB 1SN8A 2OQ0A 4IJHA 1YVCA 1OXTA 1EYGA 4DV3L 4GLAC 5GQOA 1E7ZA 3PUWA 5LMNW 1XMOL 4LF7Q 1GD7A 4IFDG 1CSPA 1Q1BA 1HH2P 1K3RA 5IP9H 2MO0A 5C0XJ 3GO5A 3M4OH 4A3MG 3HKSA 1J5EQ 4JI8Q 3ULLA 4KHZA 3J80i 4B3TQ 3BU2A 4B3TL 2Q2IA 1P16A 4YWMA 4PZ7A 2H5XA 1R9TH 1B70B 1VQ7A 2JA6G 1YJ9A 4DR4Q 5HGQA 2AWNA 1E1TA 1HNZQ 2YU9H 3M9BA 3HOXH 3AYHB 3CCMA 1PH3A 1B7YB 2VUMH 1PHJA 1T9HA 2K14A 4DV6L 3Q8DA 1V43A 2K52A 1VQEA 1Y1VG 2JQOA 3I4MG 3CPWA 1Q1EA 1YIJA 2WP8J 5LMNQ 1X3FA 5IP7G 5IYBH 4DR3L 4OX9L 3J7A5 2ZJQA 3HOUG 1PFSA 1X6OA 2UXBL 3K7UC 2ALYB 3IRBA 4K0KQ 1LYLA 2CQOA 4YWLA 1PH8A 5IYDH 1FVIA 1VQJA 4DUZL 2NVXH 1Z9FA 2D62A 4JI8L 1Y1WH 4DR5Q 4BY1G 2VQFQ 5LMUQ 1V1QA 3A0JA 5GAHC 1LUZA 2MFIA 3KF8B 5JJIA 1B8AA 1TWAH 2GVBA 3PCOB 1E1OA 3HOUH 3FP9A 3F2BA 1HZBA 4X62Q 4DV4L 3S2DH 1KHIA 3PF5A 2Z0SA 1X9NA 3GTPH 5C3EG 2ATWA 4DR1L 3I4MH 3F2CA 3I2ZA 3L0OA 4NXML 1MJCA 3KYHC 4TQUS 3PIOA 4HJAA 1CKOA 3CC2A 1K8AC 2VUMG 4UP8A 4UP7A 1YEZA 4JG2A 3S17H 4UPAA 5HY6A 2HHHL 1NE3A 2UXBQ 5GROA 1XJVA 2N49A 5FLXc 1NJIC 4LNQA 1AE3A 2R93G 3M4PA 2QGQA 4P74A 2HIVA 3RN2A 4AH6A 4QJFA 2K5HA 4JBWA 3H0GH 3TQYA 5M5XH 5LMUL 4YCVA 2VQEQ 4B3MQ 1VQNA 4DR7Q 3GTKH 3F1ZA 1KXLA 4C3IH 1SRUA 3AFQA 5M3FG 1N34Q 3UE0A 4IOCA 4XIGS 1Q86C 2CWPA 2KENA 2C35B 3BJUA 4NB3A 3S24A 4DV6Q 4A3EH 1EIYB 1P8LA 3TS0A 1KQSA 1K83H 4R4CA 4AIMA 2QEXA 4DV1L 2VNUD 4X65L 2N3SA 2PI2A 4X65Q 4P73A 3KJOA 5JEAJ 2A8VA 2JA9A 4R4IA 3HKZG 3AFPA 4MNOA 3MXNB 4DNIA 3S1QH 3NBHB 1KD1C 4DV3Q 4KHPQ 4LF7L 1TWCH 3JC66 2LSSA 2D0PA 1EQQA 4GOPA 1LM0A 2WFWA 4DV0Q 2JA7H 2CKZB 1Q82C 2ZM6L 2JA7G 1YITA 1HZ9A 4O2DA 3F2DA 2UU9Q 2VW9A 1H95A 3L7ZC 2UUBL 1AE2A 5AJ3L 3FKIH 1DGSA 2HQLA 2R7DA 2NVYH 3RZDH 1FJGL 1TWHH 1XNQQ 2XGTA 3CPFA 3KOJA 1JJGA 4BXXG 4R1JA 1HZCA 1VQ4A 2AHOB 1K8GA 2UUCL 3PGZA 1MIUA 3U58A 4J15A 1N9WA 2PNHA 3U4ZA 3VDYA 3KJPA 4OONA 4PZ6A 4A3IH 1YZ6A 5M3FH 4HJ9A 5K36G 1EOVA 3KLWA 1QZGA 5FJ8H 3ER0A 1XPOA 3H0GG 2UXCQ 1SR3A 3CAMA 5DLQE 1W2BA 3EIVA 2E2IH 1I94Q 3NEMA 4JOIC 5GAEC 1OTCA 1NY4A 3TREA 1M90C 2I5LX 1SE8A 3LGJA 5H1SE 3D0FA 1KIXA 1HJPA 2ZJRA 2UU9L 1PV4A 1VQKA 4POFA 4A76A 3CCLA 1FJGQ 1HR0L 2E2HH 2Y0SE 4DV1Q 1EWIA 1VQAA 3CCVA 4BBSH 5C3EH 1IXRA 2JA5G 1OXXK 3NELA 1YBYA 1K9MC 2PMZE 4R4TA 5FJ8G 4LFAL
chains in the Genus database with same CATH superfamily
1GUTA 1I4GA 2F3VA 3OTOQ 1VQ9A 4Y7NB 2YU9B 2R92B 1PYWD 1MJEA 4JI2Q 3K5MA 4MHEA 4DR5L 3JAMi 1WYDA 2VQEL 4B3ML 3MC0B 1EY7A 3UDIA 2IL8A 5IE8A 1KC8C 1W6KA 3PUVA 4DU9A 1Q8KA 2PO4A 2CW0C 3A74A 2R7ZH 1LV9A 1EQTA 4KHPL 3HOWG 3KK7A 1Y69U 1SEBD 4JYAL 3NWTA 1YNNC 1ICWA 4JI6L 4A3BB 5C44B 1HNXL 1HUMA 1RIPA 1L0YB 2N78A 2BDOA 4KTAA 3MA2B 3G4SA 2B29A 3D6WA 2PW7A 4X62L 3FKIG 3GTGB 2EE1A 4QIWE 1STAA 2NTSA 4FF4A 5G3LD 2Z4HA 1PXUA 1SNOA 3PV0A 3T1YL 3C1EA 1HPCA 2Q8IB 4WJ3M 5GAGC 3OTOL 3J80E 1EOTA 1SJHD 3VYSA 2EIFA 1IYJB 4LF8Q 3K59A 1STHA 1YNJC 4A3FH 3PO2G 3BZCA 4A93H 2F0SA 5C44H 2E5LL 4S3SA 4FXGC 1E2WA 2WAQB 5BR8L 4KKUA 4Z9CB 5DEHA 3GTLH 2GN5A 1PLFA 1KABA 3KBXA 2ICIA 4QUCA 3G7LA 1DOKA 1Q12A 3FPUB 2K03A 2R7ZB 3OWFA 4RGTA 4IZ8A 3K81C 1RKNA 4UDUC 3H3VC 4IPDA 1H9MA 1I6HH 1BBWA 1UWVA 2WIIB 1TS5A 3LX0A 2JA7B 1IBMQ 1JWSD 4PNYA 1IYUA 2K1BA 4YHHQ 4DUYL 1HUNA 4A3GH 1LTTD 1XNQL 2DY8A 4JV5Q 4Y7NH 3STBC 3R93A 4HCEA 2IX1A 1WCMH 4IUTA 4IFDH 1QNKA 1T5EA 5M3FB 1K73C 3KF8A 1B3QA 5C4XH 3H3VH 2RF4A 3CCUA 1IBML 5JVG3 4A3LG 1N32L 2K01A 3TEHB 1K83B 4DV7Q 4ZKBB 2AQ2B 4AYBE 2GVAA 1KNEA 2B2VC 5E4XA 4DAYA 3LNNA 1FNVA 1HZAA 4BY7H 4DKAC 3F2UA 4A3GG 1WFQA 1IBLL 1A62A 3PO3G 3CCSA 1QUQB 1VQHA 4GS3A 2R93H 3MEHA 2JE6I 1G291 4K5XA 1U4PA 3MXGA 1LT5D 3MXNA 3I4OA 5KIXA 4A75A 1QUQA 1VQCA 1D5ZC 5GADC 1TY2A 1EQRA 3X3NA 4A3KG 2QCPX 4HIMA 3GV6A 1SYFA 3A7LA 4QUFA 5C0XG 1DCZA 4YY3Q 4U673 3UDGA 2I5MX 2HT1A 4JI6Q 1I4XA 3PUXA 4DR2L 4CDDC 3TSSA 4PQXA 4K5VA 4QGUA 5IYBG 2F3IA 4A3KH 3GTMH 3S16H 2B2TA 1TWGH 4IUVA 3G6EA 2A69D 1K28A 1NNXA 5FO9B 3HOZH 1X3PA 2IW3A 1VQMA 4B3SL 1Z47A 4PMWA 2BE5C 1TWAB 4EVOA 4JYAQ 3ERQA 4LF9L 4KJNA 2Q2HA 3WOEA 4A3EG 2IHEA 2BA1A 5IP9G 4DK0A 1GOZA 2EZVA 4DXFA 2L5TA 3OW7A 3S1RH 1GVPA 1RD9D 3MXPA 2BOSA 1A3TA 4JI5Q 2R7FA 3GV3A 5DM63 4IOAA 1V1OA 1DYQA 5JJLA 3PIP3 3ZYYX 2PZTA 3CCEA 1X65A 3X3MA 1L1OC 1KAWA 4NXNQ 2B63H 1HFGA 4HJ7A 2JA8G 4HEDA 1HNWQ 1C8CA 1PTOB 1W6JA 1E2VA 3M7NA 2OWOA 4FF3A 4NDXA 4QB4A 3MWYW 4OGQC 4WORA 1TU2B 4LF4L 2EYHA 4IUUA 4K5WA 5IYDG 2DY7A 5ISRA 4XQNA 2UUCQ 1NAPA 2E74C 3E0EA 5EJWA 5FO8B 3OYYA 4TSSA 2EJMA 4OIKA 2CHBD 1PTOH 1D1KA 3D6CA 1Y1VH 2A6EC 1XTCD 1JORA 1ZYRC 1PRTD 2DUDA 3CC7A 1N36Q 4I7ZC 3CCRA 3ULJA 4DV7L 1UUPA 3E9IA 3BDLA 3GQBA 5IY0A 3KFUA 3NENA 3N52A 4BBRH 1SNQA 1ZYRD 2K04A 3KDFA 2VS1A 2F4VL 1II3A 3A7AB 5M5WB 4GN3B 4B3SQ 2B2VA 2B63B 4JBKA 1YJNA 4K6LA 2ZJPA 1CUKA 1IL2A 2JA8H 4KN4C 4RA8A 4HCSA 3HOZB 1GJXA 2B2YC 3PIPA 4JK1C 1V8QA 1U4LA 5I2YA 2JA5B 2DNEA 3S16B 2AQ3B 4LW1A 2JA6H 2H4OA 3BYYB 2F0OA 4X3UA 4RCNA 2Q2TA 3S9WA 1ILQA 1PRTF 1SYGA 3DWAA 2B8FA 4LF7Q 1EY8A 1CSPA 5IP9H 1HH2P 1JWUD 4J8QA 2WKDA 2MGSA 3GO5A 1J5EQ 4DXGA 3ULLA 3J80i 4B3TQ 4CDCC 5C4HA 1GUGA 1P16A 4PZ7A 1QILA 2AWNA 1PH3A 2N55A 2L55A 2Z4IA 1PHJA 4DV6L 2K52A 1VQEA 5I2XA 2FMCA 4DK1A 1PRTC 4C3IB 5LMNQ 3NWSA 3V2TA 4J6HA 1PFSA 1X6OA 1SSOA 1H9RA 3IRBA 4K0KQ 2CQOA 4Q5VA 1FVIA 4DUZL 5AFWA 2D62A 2F0VA 4DR5Q 3I91A 5LMUQ 3N6RA 4BY7B 3BDOA 3PCOB 1ENCA 4LAAA 2GVBA 2KCCA 1SJED 3FP9A 1Z7TA 1HZBA 2EYOA 1PDQA 2LKVA 1KTKA 3NP8A 2ATWA 2XVSA 1IKLA 3HKZB 3F2CA 3EROA 3I2ZA 1JCKB 1JICA 2KA7A 3KYHC 3PIOA 3SK8A 3EFXD 1CKOA 1K8AC 1YEZA 1EL0A 5E4WC 5CMDA 3MVVA 4RCOA 1QOHA 5GROA 4H13C 4QMGA 5FLXc 1NJIC 1EZ6A 1WTQA 1AE3A 3TP6A 4M1UB 1SXTA 1I3QB 1MBYA 4P74A 3RN2A 4QJFA 1MI2A 2VQEQ 4B3MQ 5D14A 3H0GB 1KXLA 1SRUA 3AFQA 3Q0AA 1N34Q 4BXXG 2L1BA 2CWPA 2KENA 1LTID 2C35B 4NB3A 4XT3B 1EIYB 1K83H 4AIMA 3C2PA 2KEDA 2L11A 5KYLA 2PI2A 3KJOA 1F2YA 3AU7A 4R4IA 2M2LA 3MXNB 1NR2A 2J4XA 1TWCH 3JC66 3SEBA 1RTNA 3V96A 2JA7H 1BCPD 2ZM6L 1YITA 2G9HD 2BCOA 1EEFD 3E3XA 5ELBA 1O7YA 1DGSA 2PZWA 1LTAD 3S1NB 1S4ZA 3TZDA 1D5XC 3CPFA 2ZXRA 2ZXPA 1N9WA 2DJGC 3U4ZA 4PZ6A 2EYJA 1MHWC 3HZXA 2K7VA 3KLWA 4MIUA 5FJ8H 1I6HB 1SR3A 3CAMA 5KYIA 2E2IH 5IGFA 5GAEC 3TREA 1M90C 2QF7A 1SE8A 5H1SE 1HJPA 3I4LA 2UU9L 3OIPA 1K8OA 1VQKA 3CCLA 2RA4A 2B2WC 1OXXK 4ID6A 2JA5G 5JEAH 1HHVA 5FJ8G 4A3FB 2AMCB 4GLXA 1BVSA 2F0TA 3H94A 1IZ6A 3J81i 5IGGA 1NBWA 1S5FD 4CKEA 2XRSD 1PRTB 4A3CG 1NCVA 4DR2Q 2NN6I 3VYRA 5IT9E 3NXWA 4EQ5A 1PH7A 1CKNB 5EPJA 3J80c 4NP5A 2IWHA 2VY3A 4JBJA 1KRSA 1L2FA 5CV7A 1C7YA 1GUNA 1WTOA 4P71A 4A3JH 4R4QA 1N33L 4UP9A 3E5SA 4TRDA 1JB3A 5A2QE 2RSNA 3OHXC 1PTOD 4JI7Q 4BXXH 1F2MA 3HKZE 1PA6A 1SYEA 2KEEA 2OCEA 1JE5A 1WI5A 3TP7A 2L15A 4I65A 3HFZB 5IYCG 2K5VA 2A6HC 1STGA 4EX5A 2BA0A 3CXCA 2EJGC 5M5WH 5M3MG 4LUVA 1CT1D 4FXKC 5LL6S 4C1NK 1JB7A 1QZHA 4GNXA 3NTIA 2OF1A 1LLRD 2HUGA 3TP8A 3QO2A 1B9MA 5E1FA 5CV4A 5EAYA 2FINB 1N36L 1PH4A 2QDBA 4CDEC 1WJJA 4BY1B 1VQFA 2K5WA 1PMRA 1EUJA 2EYLA 4N9PA 4F87A 1XPUA 1PH2A 1QB5D 5AJ3Q 1B44D 5BN5A 3OW2A 1STEA 4DFAA 4X66L 1XX8A 4RWSC 4XYQA 4ZYSA 1PH1A 2NVQB 3MEFA 3CCJA 5ELNA 2Z6KA 1DXMA 4OELB 5J3BA 1TY0A 4DUZQ 2K5NA 3D4RA 1J6QA 2M9VA 1SROA 4A3IG 4ZAIA 2HCCA 4LUOA 4DN4M 3MZ5A 3S2HB 1STNA 4C56C 2EY2A 1J9OA 2KHIA 4AQYQ 3TMEA 4L5SA 2UUAQ 1EIFA 3UE1A 5C0XI 4B3RQ 2QA4A 1SMXA 1ASYA 3S1RB 2KCMA 3W1BA 1UE5A 4LF5L 4UHVA 3TRZA 2X69A 1VQ6A 2KCTA 2F0FA 3I4NH 2XWJB 1BBUA 1CZGA 1H9SB 4GLVB 5EKLA 1LTSD 4C3HH 2FXQA 1QG7A 4O42A 4JI4L 4HMJA 3I7FA 1OO9B 2PZUA 4B08A 3DHQA 1TWGB 1LTBD 4ODGA 1YHAA 4A3MH 2E2JH 2CCZA 4MZ9A 1AP0A 1BKBA 2NZ1D 3PQIA 4KHVA 2I5HA 1F77A 4OO1I 2NVXB 4IUQA 3HEJA 4LF5Q 5E3FA 2NZHA 1VQDA 2PMZB 4ILWA 1WTHA 1YJWA 4C3JG 3HOYG 3Q23A 4Y52H 4FNFA 3J81c 3FDTA 3CCQA 2L4NA 3PF4A 4DR4L 1G6ZA 3J81L 2WAQE 2JEBI 1B53A 2VXWA 4L8JA 5IWAL 2HDMA 1CQVA 1IW7D 1VQPA 1WD0A 1ZXTA 4GOPB 1SYCA 3HOXB 4R8NA 2MHVA 3NHHA 1QVCA 3OIQA 2XIWA 3DEOA 4A3EB 2ASBA 2XTIA 1KDBA 1Y8OB 4GN4B 3G71A 2RDHA 3GTPB 1J5EL 1I94L 2R93B 1EIGA 2F0WA 3S2HH 3ND9A 1XPRA 4LWCA 3T1HL 1JMCA 4JI4Q 3L9AX 1F9SA 5IODA 2K5QA 4JW0A 1VCIA 4DAVA 2RVLA 1JE4A 4YCUA 2HIXA 3ERSX 4IQZA 4NXMQ 4X66Q 3K8AA 2E76C 2I0QA 4B3RL 4HTHA 4DR3Q 1JC7A 4U68A 4DPGA 4DV5L 3M4OB 2HD3A 1PYBA 2LXJA 1O80A 2E8GA 2NB0A 3SHLA 3A8JE 2YTXA 5IT9c 2F0HA 4GKKQ 3E6ZX 1AEXA 1UE1A 2CW0D 3BZKA 5FKAC 5L37A 1ASZA 5C4XB 2R6GA 3J7ZC 1DOMA 1W3SA 1X54A 1I50H 1TIID 5C4JH 4DV2Q 1VQLA 4GKJL 4DA2A 2N88A 1YNND 1WCMB 1BDOA 1X56A 1NMGA 4WFN3 1UEAB 4M8AA 3QG1A 2NN6H 4YIJA 1FR3A 1A0IA 4V190 2DNCA 4XXEA 3PUZA 2DN8A 1VQBA 4GKKL 4CHTB 2IT1A 1G91A 4RHRA 2OTLA 4XQQA 3FMCA 1QVFA 3D4WA 4ALPA 4BY1H 1LACA 3AMUA 4KN7C 1WCMG 4KKSA 4DV2L 4H0LC 4JI0L 2QEJC 4HJ5A 1CFMA 4O0AA 2ZTEA 2HDLA 2K6AA 4IN3A 1TVXA 3PIO3 1VQIA 1JT8A 2F52A 3K7AH 5IGCA 2YYZA 3RD4A 3U9OA 1CSQA 4E6IA 1FL0A 3TP5A 1CZWA 4DUYQ 5DM73 1E3PA 3D8GA 5JAVA 1U5KA 3VR3A 1QVGA 2JEAI 3U4VA 1I4RA 5A35A 1QWYA 1A8VA 2YTYA 4QL5A 1OXVA 3RZOB 4A3JB 5K5PA 3GTJH 2MNAA 1N33Q 4BY7G 4QF4A 3GTGH 4DNTB 1I4QA 2PCFB 4LF6Q 2AUJD 2EY1A 4KKTA 4YY3L 1EYDA 1LTGD 1T5XD 4C3HG 1Q46A 3HGBA 2B63G 5ELOA 5KGUA 2F3WA 2F0KA 2EVBA 2A69C 3MAQA 3E0JA 3I4NG 2JP1A 2PYKA 2XWBB 3I55A 1GKHA 3TS2A 3CF5A 3PSIA 5CV9A 1SN8A 3HG9A 3TDQA 3KUPA 4GLAC 1I4HA 3PUWA 4IFDG 5IOCA 4C3JB 3HOYB 1CA5A 1K3RA 4XDXA 4A3MG 1PFBA 4KHZA 4B3TL 3V05A 4FXDA 1TS3A 3H09A 2G5DA 4XQJA 3FEWX 1TR5A 3P75A 3M9BA 2YU9H 3AYHB 4K14A 5JPMC 2PNRC 2E2IB 1D6EC 4XT1B 3Q8DA 1D1IA 2XRQD 1Y1VG 3M4YA 3I4MG 3CPWA 2QILA 4LK1C 4FVMA 4DGZA 1X3FA 3Q22A 3GTKB 5CR3A 5IYBH 4OX9L 3HOUG 2AUKA 3NQTA 2C9OA 1TWCB 2MP1A 1LYLA 3ONAB 1PH8A 5C3WA 1VQJA 4JI8L 2LS01 3RUZA 4BY1G 1BBXC 1V1QA 5GAHC 2MFIA 1LT3D 3R3OA 1B9NA 5I4DA 2ENBA 1E1OA 3F2BA 1CI3M 4DV4L 5T1GA 3I73A 4FP5D 1I4PA 4DR1L 3I4MH 3L0OA 3NUCA 4TQUS 2A74C 2KCNA 4UP8A 1IW7C 4JG2A 4F88A 3S17H 1SYBA 4MTKA 2NVYB 2UXBQ 1IKMA 4WRDA 1CTMA 4LNQA 5IT9L 3CQZB 3CRLC 3NQIA 4QCLA 1EQVA 2HIVA 4JBWA 3H0GH 5M5XH 5LMUL 4DR7Q 3GTKH 1SAPA 5M3FG 4IOCA 3FRPB 4JV5L 3S24A 3GTQB 3FVQA 4DV6Q 2F4IA 4C2MB 3S1QB 4DV1L 1FD7D 4OIJA 2VNUD 1RCVD 4X65Q 2F0NA 2KHSA 4MNOA 3OMGA 1KD1C 5DNFA 1C4QA 1EWHA 2D0PA 1B50A 2A73B 1LM0A 1BR9A 2A68D 4X3TA 1Q82C 2O5JC 4K8JA 4OL7A 1HZ9A 4KK7A 4O2DA 1Y8NB 2VW9A 1H95A 3L7ZC 2UUBL 2HQLA 3RZDH 2XGTA 3KOJA 5JPNC 1CHPD 3LWUA 1VQ4A 2AHOB 2F0PA 1K8GA 1M8AA 3KLRA 5HURA 4JPBW 1YZ6A 1QZGA 1XPOA 3NBHA 2F0JA 1W2BA 1GUOA 1I94Q 3AB9A 3NEMA 3Q6SA 4JOIC 1NY4A 3PO2B 4CGYB 1Y1WB 1ET9A 1PV4A 3GTJB 4N8X1 5FOBB 4ZQ3A 2VB2X 4N8FA 1HR0L 2Y0SE 4DV1Q 2E75C 5C3EH 1K9MC 3ULPA 1STYA 3R8BA 1EU3A 2A5HA 4IUNA 5C44G 4HIOA 1Y1WG 1SMYD 2K75A 1VF7A 2JA5H 1HA5A 3DM3A 3M85A 3IL8A 1F9QA 1R4PB 1TXYA 4BBRB 1HTLD 3HOWB 2NZOA 3BDCA 3WOFA 3RLOA 1BF4A 1EIHA 1LABA 3G6JB 3MHBA 1BOSA 3HS0C 3I90A 1CKNA 4ME5A 2R61A 1KLUD 5T1IA 3K5NA 3CD6A 1TWFH 1AZPA 1G51A 3PO3B 3DUZA 4BA2I 3E9HA 1XXGA 3CC4A 2BH8A 3K80C 2OXPA 2F1MA 2TSSA 5D3IB 3RLFA 4HIKA 1B1ZA 5FLXE 1SFOH 4P2CB 1SNDA 1V9PA 2BDNA 2R7ZG 3PUYA 2JXMB 3QJYA 2KBNA 3U50C 1PZJD 3CMEA 1WTVA 4JI1L 3A5UA 4QQBX 1ZEQX 2J0TD 2UXCL 2IHFA 4K8IA 2NVTH 4X64Q 2K50A 4L5QA 5FLXL 2IJ0A 3J81j 3DWPA 1BCPF 1AFPA 4IURA 4P72A 4LFCL 3C3LA 5I6WA 5CC4A 4I7AA 3A8IE 4KD4A 1MGSA 1L1OA 3F8TA 1KAAA 2LFNA 3C46A 2ZTCA 3FKIB 4HAEA 4FF2A 1NMFA 1Z6HA 2VL6A 2F03A 3HOVH 3AEVA 4K2KA 4C1NI 4DV0L 4OO1G 4A3DH 2RHQB 4AYBB 2ZT9C 1S40A 3AQQA 1HNXQ 2I46A 1Q81C 3KLSA 3L3OC 3WDNA 4IUPA 5M5YB 3GTMB 1Q90A 2RCNA 1XNRL 3GTOH 1U0LA 1XTDA 4QY7A 1G2TA 4GN5A 5JVH3 4KMUC 2ID0A 3S15B 3RLNA 3BZDB 4LMQD 1D8LA 5IWAQ 4A93G 3VR6A 4IJLA 5C3EB 1DD2A 4XTCS 3ZJYC 2WB1G 5TSSA 3JAMc 1S5DD 1O78A 4O1NA 3STBD 1NTGA 1XMQQ 1S5ED 3O13A 4DR6Q 2CQAA 3T4AC 2IY5B 4JCVE 1EY5A 2OEOA 3DLLA 2ES2A 2V1CC 4JI2L 1EU4A 1ESFA 1IL8A 1S5BD 2K5DA 5ELEA 1BCPC 3KF6B 2VB3X 3HOXG 2QDLA 1BNZA 2B3GA 5IYCH 4KY7A 4R9WA 1ET6A 4JI0Q 3T1YQ 1ENAA 4L63B 2H1EA 4F7XA 1DONA 5F2DA 1JOOA 2M00A 1C9OA 3P20A 1WTXA 3M3YB 4X64L 1XMQL 2RCFA 3CKIB 1M1KC 3K0XA 1JWMD 4DAYB 3MTSA 2D0OA 2UXDL 2KHJA 1BCPB 1Q7YC 2ZM6Q 3M7GA 3K5LA 4KJOA 4A3DG 5CV5A 1IBKL 4OWXB 4APVA 4DAPA 4HSVA 3A56A 2X6GA 3KF6A 2P5ZX 4YCWA 1AZQA 1Q3LA 2KJXA 4A3CH 1BQQT 2F0DA 1EFWA 2F0MA 1EYAA 2A19A 3C1FA 1RJTA 4DAMA 4IO9A 1MKHA 3GTQH 4PG3A 3M4QA 1E0BA 2MO1A 2O2LD 4DK6C 1TS4A 1GO3E 2IX0A 1RTOA 3TZUA 3CQZH 2NVQH 1J8IA 1EY9A 4G4KA 5COYA 2AKWB 5E7NA 2O5IC 5KNCA 2CWAA 4EQOA 4JC0A 3P1HA 3GDEA 4DV4Q 5M3MH 4DK3C 4NPSA 2LY7A 5CBAE 3VYUA 4B9XA 1ESRA 3J7AV 4PV1C 1NSNS 4LJZC 1IHZA 1K0RA 1OXUA 2J7ZA 3WWVA 2YV5A 5KRUA 1F9PA 4KY6A 1PYSB 4A3JG 2EJFC 4JOIA 3T1HQ 4MN3A 1ILPA 4FO2A 3LWEA 5D3DA 2Z6KC 4G7HC 1L0WA 4A93B 4GZYC 3URYA 1LT4D 4ZLTF 1PVOA 2G9DA 4N9TA 1UE7A 4WJ4A 1CHQD 4FDBA 2F0LA 2NYZD 4PZ8A 4R8IA 4F8MA 1HNWL 4QIWB 4H02A 1Y8PB 1EYCA 1XNRQ 1MD2D 2A68C 5BR8Q 1DM0B 4B9WA 4A4IA 2KQ3A 4BS9A 2JN4A 1E24A 3IKJA 3NPPA 2IX3A 4K2LA 2Q8TA 2ZTDA 4BBRG 2HCIA 4ZUJA 3D3RA 4DR6L 4IFDI 3K58A 1JJ2A 2MUYA 3HOZG 1QJOA 3K0YA 3VA7A 2K28A 4OO1H 1I6VC 1EFID 5CYUA 1YNJD 2WB1E 3HOVG 3MFGA 1XYIA 5NUCA 3VR5A 2UUBQ 3NTKA 2PQAA 1HXYD 2F0GA 1WD1A 3EJIA 2BE5D 1QCBD 2F4VQ 1MSHA 1JJCB 2F0EA 2R92H 2CH4A 5JJZA 4KI0A 3A8KE 2VZAA 4L5TA 1SNCA 1TKWB 1L1OB 4A3BG 4BBSB 2RBMA 1SMYC 3RNUA 2B2WA 2NN6G 2WV6D 5FLMG 4OHJA 4G7OC 3UI2A 1NR4A 5G3LF 4A3LH 1PH6A 4KLKA 5M3MB 1X3GA 2NTTA 2B39A 4DR1Q 1CQFA 3KDFB 2AQ1B 4IJHA 1YVCA 5CV6A 5A2QL 1EYGA 5LMNW 1E7ZA 5J39A 4HMIA 1Q1BA 5C0XJ 3SK4A 3I72A 3HKSA 3EA6A 4JI8Q 2QKIC 4CJ1B 4YWMA 4HR7B 2H5XA 5CV8A 1B70B 2JA6G 4WJWA 1HNZQ 3CCMA 4RKLA 1B7YB 2K14A 3SK5A 3GP7A 2JQOA 1Q1EA 4DNRB 1BXTA 2Z1CA 5IP7G 4KD3A 5IGDA 2B8GA 3VA5A 1I50B 4A3IB 2UXBL 3K7UC 2B2TC 1X32A 5IYDH 4HSPA 1Z9FA 2VQFQ 2WACA 5D65A 1LUZA 3KF8B 4IALA 3HOUH 1KHIA 3PF5A 1X9NA 3GTPH 5C3EG 3A54A 3SVMA 1GXDC 4NXML 2EY6A 3CC2A 4ABNA 4RGMA 4UPAA 5HY6A 2HHHL 1XJVA 3T13A 1SNMA 2N49A 3BS1A 2RQXA 2QGQA 3OWEB 2K5HA 3TQYA 4RHSA 1KLGD 4YCVA 4C3IH 4XIGS 1Q86C 4A3EH 2IPKD 1SE3A 3BJUA 4JVZA 1P8LA 1KQSA 3OPOA 3H91A 5I9PA 2CVRA 5CGKA 2A8VA 2JA9A 3HKZG 2E2JB 3SE0A 3NBHB 1DZ1A 1V1PA 2WFWA 4DV0Q 4A3DB 1AN8A 3S2DB 2V4DA 1AE2A 3FKIH 3QR8A 2R7DA 1ZKOA 1K3BC 1TWHH 5KNDA 1EZ8A 2FJ2A 3GTOB 1GUSA 4R1JA 1HZCA 3PGZA 1MIUA 1SE4A 4J15A 3U58A 4OONA 1TQOA 1KDCA 5C0XH 5K36G 1EOVA 4C3HB 3ER0A 3HOVB 3H0GG 1SDFA 5DLQE 2EYFA 1JQYD 1A6XA 1OTCA 1B3AA 2I5LX 1STBA 2ZJRA 3BVMA 1R9TB 5J1ZA 2ZXOA 2JSOA 4POFA 2Z6BA 4A76A 2E2HH 1VQAA 3CCVA 3R2IA 3NELA 2PMZE 4R4TA 2MPMA 5K36H 2RDFA 4RG1A 2RHSB 2L12A 2HQEA 4ZRZA 1KL9A 3G48A 1C0AA 1TWFB 1AW7A 4IFDJ 2SNMA 2Y0SB 4JBMA 1NUCA 1FNUA 3IFTA 4HJ8A 1HNZL 3R2TA 4CKBA 1EY6A 1F2ZA 4POGA 4GKJQ 1CKMA 2SDFA 3DEPA 3L2PA 1VQOA 4RGNA 2GA4B 3GD7A 4GNXB 3PO3H 1SE2A 5ELDA 1N8RC 2PQAB 4HIDA 2UXDQ 1YNXA 4L6TB 1E22A 3FHWA 2SNSA 5HGTA 1UAPA 2KUMA 4RFBA 3HOWH 3K6OA 1ENFA 2XNAC 1UNSA 3J80L 5EKIA 3W5OA 3QOJA 3PMFA 5ELFA 3CMAA 3CW2C 1PH5A 3EBEA 1I5FA 5C4XG 2XN9C 1HQRD 2N8NA 1GM5A 1F2LA 1PZKD 2DJFC 3EN2A 4DV5Q 4NXNL 3S14B 3UDXA 4LF9Q 2EPBA 2E5LQ 4JI7L 3HP3A 1S5CD 1PFMA 4ZKCB 2L9HA 3NTHA 3CU7A 5KNBA 1C48A 1KNAA 1HR0Q 3IAYA 5EGTA 2EY5A 2K4KA 3RMHA 4A3KB 2FFKB 2B2YA 3PO2H 1HTPA 1RF2D 1RODA 2A6ED 5EBDA 4K6DA 5IP7H 4LF6L 4EQNA 3QB3A 1YI2A 2NBFA 1IBLQ 4LFBL 2D2CC 1VQGA 1WOCA 4CDFC 3BVZA 3T53B 1RL2A 2AWOA 4IPGA 1YHBA 1H9SA 1HR0W 1QE6A 2EQSA 1D2BA 3ITPA 2KECA 5LHY1 1PH9A 2E2DC 4JI1Q 2MJ8A 1GHKA 1VQ8A 3S1MB 1D7QA 2X6LA 1SBBB 1VF5C 2O4XA 1LTLA 5C3XA 2HHHQ 1LT6D 1EEID 2Q8RE 3D4DA 4CJ2C 4EQPA 4RMFA 2JJQA 5IGBA 2RDGA 2A6HD 4X6AH 2TMPA 4OWWB 1A15A 3EVQA 3QOLA 2PPBC 3J81E 2NWGA 3EQLC 5M9OA 3HRZC 4C2MH 3NSWA 2EXDA 1SYDA 4BA1I 3MFYA 1A2UA 4EGVA 4LFAQ 1X3EA 4CKCA 2CFMA 2DGYA 4IPCA 1K8MA 4MTNA 4UY8C 3S1NH 3S17B 4BBSG 5J22A 3W1GA 1H9KA 3CP0A 3I56A 1CK1A 3I3CA 3RN5A 5EPKA 2SEBD 3DMUA 4H7BA 2Z8LA 2Q2UA 1Y14B 2F0IA 2OQKA 2D5DA 1FGUA 5CORA 4OXPA 2RSOA 1G8ZD 1WTWA 2R3ZA 1DJRD 1CA6A 4LFBQ 4JI3L 4RAUC 1VQ5A 2KOLA 3ICEA 1RDPD 4YWKA 1I3QH 4L5RC 2K33A 4A3FG 4FYDA 1VS0A 3VR2A 1N34L 1XWEA 1O7IA 5DAUA 1WTRA 1X55A 1A63A 1GHJA 3M3YH 1JOKA 1U4MA 1B4OA 2B2UA 3GTLB 3J7AF 2C5CA 3S1MH 1IYVA 4NW2A 3I8ZA 5LMNL 4OX9Q 4C3JH 3HOYH 1KDAA 1HRJA 5C4ZA 3JAME 1TT2A 4LUZA 2F0UA 3A55A 5JJKA 1PFNA 3NBIA 4XYOA 4PMBA 3SGIA 1VDZA 1ONLA 4ME3A 1U9RA 3VYTA 2L0CA 3NE5B 4JI5L 5BN4A 3OMCA 2D9UA 3P7JA 3B6YA 2MQHA 2LMCB 3ND8A 1U4RA 4X3SA 1E2ZA 3UDFA 3NK9A 3RR5A 3S15H 1R4QB 2BH2A 1HQMC 4ZUIA 4LF8L 4A3BH 2WAQG 3IFDA 5M5YH 3RZOH 4G57A 3K7AB 1A3UA 2VQFL 4J1MA 4FF1A 4CJ0B 1MSGA 2A1AA 3U9SA 1LTRD 4LFCQ 3DWQA 2R92G 3SDZA 1S3OA 4C3IG 1YHQA 3T51B 2FHTA 1EY4A 5JEAG 4TVAB 5I9OA 3S14H 3SR1A 4AQYL 4GOPC 1G6PA 5EBCA 1ICFB 3JAML 2JA6B 2FMMA 4IPHA 4P75A 4G7ZC 2Y0SG 5JOBA 5EKKA 3BVGA 4R4OA 1TS2A 3DXJC 2JA8B 1N32Q 2QW7A 4DR7L 4NKLA 2LXKA 2NVTB 3T56B 3I70A 1B2TA 2JK8A 1SLJA 2ICEC 1Y1VB 5C4JB 1OXSC 1M4VA 2K32A 1F9RA 2UUAL 2YTVA 2PI2E 2RKSA 1XMOQ 1UE6A 1BUVT 1UEBA 1X3QA 1SFOB 1HA6A 2EDGA 5ELCA 4AYBG 1AH9A 1PTOF 1KRTA 2PQEA 1VMPA 3D31A 4JI3Q 2OTJA 1WVLA 3H3VI 3TBIB 4GNXC 3H6MA 4YHHL 5FLMH 1IBKQ 3H15A 2E2HB 3A5ZB 3T16A 4LF4Q 4OWTB 5IGEA 1O7LA 4X3KA 2EOTA 5KEEA 1S72A 4ZCKA 1CM9A 2OQ0A 1OXTA 4RH6A 4DV3L 3TN2A 5GQOA 1XMOL 1JOQA 4K0KL 1GD7A 3M4OH 2MO0A 1ML0D 1BO0A 1HCZA 3KBGA 2OT2A 3VR4A 3BU2A 2NUCA 1D5MC 1SNPA 3KLSX 2Q2IA 2EYPA 1R9TH 1VQ7A 4ULLA 1YJ9A 1LO5D 4DR4Q 5HGQA 1E1TA 3HOXH 1TWHB 2VUMH 1T9HA 1V43A 3QWNA 4UAIA 1EY0A 1JR0D 1YIJA 3OSOA 2WP8J 2EYMA 4PMCA 4DR3L 3J7A5 4RKBA 2PW5A 2ZJQA 2ALYB 2B2UC 2I07B 4YWLA 2NVXH 3BG3A 4ZK9B 1Y1WH 2Z9HA 4HN7A 4CBVA 3A0JA 5BN3A 4A3MB 5JJIA 1B8AA 1O7ZA 3CHBD 1TWAH 1DOLA 3W3AA 4Q0FA 4X62Q 3S2DH 1RHPA 2Z0SA 1EWCA 5I6YA 1MJCA 4HJAA 2VUMG 1FNWA 4UP7A 3SXHA 2SOBA 4H44C 1V1PB 3I4NB 1NE3A 3RZDB 5EQ0A 1H9JA 2KVMA 2R93G 2WKCA 3M4PA 3K5OA 5EPLA 4AH6A 1VQNA 4TKOB 3F1ZA 5C5MA 3J7YW 1FYCA 2WB1B 3UE0A 4NMZA 1GUWA 5IIFA 3TS0A 2QEXA 4R4CA 2VUMB 5FK9C 4X65L 2N3SA 4DF7A 4P73A 3QIAA 5JEAJ 3AFPA 4DNIA 3S1QH 4KHPQ 2JYOA 4DV3Q 1VMCA 4LF7L 2F0QA 4V0BA 3CRKC 2LSSA 1PTOC 4BWGB 1EQQA 4GOPA 2CH4W 2WINB 5M5XB 1QNUA 2CKZB 2JA7G 3BYTB 5LL6X 3HOUB 5CBEE 3F2DA 3K57A 2UU9Q 4KV6A 5AJ3L 3SK6A 2NVYH 1FJGL 1XNQQ 3DM1A 1JJGA 1A2TA 1G2SA 1A3VA 4KY5A 2UUCL 2PNHA 3VDYA 3KJPA 3I4MB 1Q8IA 4OEMB 4A3IH 5M3FH 1WTPA 4HJ9A 5C5LA 2UXCQ 1K0SA 3EIVA 2EXZA 5C6AA 3LGJA 3D0FA 4A3GB 1KIXA 1L0XB 3W2DA 1FGBD 2K05A 1HFNA 3MXUA 3OOCA 2XSCA 1FJGQ 1PZID 4RGOS 1EWIA 4BBSH 3FPPA 1IXRA 3Q24A 1YBYA 5FO7B 4LFAL
chains in the Genus database with same CATH topology
4RG1A 2RHSB 2AMCB 4GLXA 1BVSA 1KL9A 3OTOQ 1VQ9A 1IZ6A 3J81i 3G48A 5C44G 4HIOA 1C0AA 1Y1WG 1NBWA 4IFDJ 1MJEA 2K75A 4JBMA 4JI2Q 2JA5H 3DM3A 3JAMi 3M85A 4DR5L 1WYDA 2VQEL 4B3ML 4A3CG 4HJ8A 3UDIA 4DR2Q 1HNZL 1TXYA 2NN6I 5IE8A 2NZOA 3RLOA 4EQ5A 1KC8C 1PH7A 3PUVA 4POGA 1CKNB 3J80c 4GKJQ 1Q8KA 2VY3A 1CKMA 3L2PA 3A74A 4JBJA 1KRSA 1VQOA 1L2FA 2R7ZH 3GD7A 1C7YA 4GNXB 3PO3H 3HOWG 4KHPL 4P71A 4A3JH 4R4QA 1N33L 1CKNA 4UP9A 1N8RC 2PQAB 4HIDA 1TWFH 3CD6A 1G51A 4JYAL 2UXDQ 4JV5L 1YNXA 4JI6L 4BA2I 3E9HA 4JI7Q 1E22A 1HNXL 3HKZE 1PA6A 3CC4A 2BH8A 4BXXH 1RIPA 2N78A 3FHWA 3K80C 2OCEA 1JE5A 1WI5A 3G4SA 2B29A 2L15A 3RLFA 4HIKA 3HFZB 5IYCG 1SFOH 4X62L 2K5VA 3FKIG 3HOWH 1V9PA 2R7ZG 4QIWE 3PUYA 3W5OA 4EX5A 2BA0A 3CXCA 5M5WH 3CMAA 3PV0A 3CW2C 3T1YL 1PH5A 2KBNA 3U50C 3EBEA 5M3MG 3CMEA 4LUVA 4JI1L 3A5UA 4QQBX 1I5FA 5C4XG 1JB7A 2N8NA 1QZHA 4WJ3M 5GAGC 3OTOL 1GM5A 2UXCL 4GNXA 3EN2A 2IHFA 4DV5Q 2NVTH 4NXNL 4X64Q 2EIFA 1IYJB 4LF8Q 4A3FH 3PO2G 2K50A 4L5QA 3BZCA 3UDXA 3J81j 5EAYA 4LF9Q 1N36L 1PH4A 4A93H 1WJJA 5C44H 1VQFA 2E5LQ 4P72A 4JI7L 1EUJA 2E5LL 4LFCL 5BR8L 1XPUA 1PH2A 5AJ3Q 3GTLH 1HR0Q 2GN5A 3ULPA 3OW2A 2K4KA 1L1OA 3F8TA 1Q12A 3PO2H 2ZTCA 4X66L 3K81C 1PH1A 1NMFA 5IP7H 4IPDA 4LF6L 3MEFA 3CCJA 2VL6A 3HOVH 5ELNA 2Z6KA 3AEVA 1BBWA 1UWVA 1YI2A 1I6HH 4DV0L 4OO1G 1IBLQ 4A3DH 4LFBL 2RHQB 1VQGA 5J3BA 1IBMQ 1WOCA 1S40A 3AQQA 4DUZQ 1HNXQ 1Q81C 4YHHQ 1RL2A 2K5NA 2AWOA 4IPGA 1YHBA 4DUYL 1HR0W 1J6QA 2RCNA 1XNRL 3GTOH 1U0LA 1XTDA 1XNQL 4A3GH 4QY7A 4JV5Q 1SROA 2EQSA 4GN5A 4Y7NH 4A3IG 3STBC 2ID0A 4LUOA 3RLNA 1PH9A 1D8LA 5IWAQ 2IX1A 1WCMH 2KHIA 4A93G 4JI1Q 4IJLA 4AQYQ 4L5SA 4XTCS 1VQ8A 3ZJYC 2UUAQ 2WB1G 3JAMc 1EIFA 3UE1A 5C0XI 4B3RQ 2QA4A 3STBD 1K73C 1D7QA 1SMXA 1NTGA 1XMQQ 1ASYA 4DR6Q 1LTLA 2HHHQ 2KCMA 2IY5B 3W1BA 1UE5A 4LF5L 4RMFA 2JJQA 4JCVE 2RF4A 5C4XH 3H3VH 3TRZA 4X6AH 3CCUA 1VQ6A 3DLLA 1IBML 2KCTA 2ES2A 3I4NH 2V1CC 4JI2L 4OWWB 1BBUA 4A3LG 1N32L 3TEHB 4DV7Q 4C2MH 3KF6B 3HOXG 4GLVB 2EXDA 2B3GA 4C3HH 5IYCH 4BA1I 2FXQA 4JI4L 4JI0Q 4AYBE 3I7FA 2GVAA 3T1YQ 4LFAQ 1X3EA 2CFMA 1YHAA 2DGYA 4A3MH 4IPCA 2E2JH 1HZAA 4BY7H 1C9OA 4MZ9A 4MTNA 2CCZA 4DKAC 4UY8C 1BKBA 4A3GG 1WFQA 4X64L 1XMQL 2I5HA 1IBLL 3S1NH 4OO1I 1A62A 1M1KC 3K0XA 3CCSA 4LF5Q 3PO3G 3W1GA 4DAYB 4BBSG 2NZHA 1QUQB 1VQDA 2D0OA 2KHJA 3CP0A 1Q7YC 1VQHA 4GS3A 2ZM6Q 2UXDL 3I56A 2JE6I 2R93H 4A3DG 1YJWA 1G291 3HOYG 1IBKL 4Y52H 3J81c 3CCQA 4OWXB 3PF4A 4APVA 4DR4L 3RN5A 3I4OA 2WAQE 4A75A 1QUQA 3KF6A 4YCWA 2JEBI 1VQCA 4A3CH 5IWAL 2Q2UA 1Y14B 1EFWA 1VQPA 5GADC 4A3KG 1EQRA 4GOPB 2A19A 4HIMA 2OQKA 4DAMA 1QVCA 1FGUA 4OXPA 5C0XG 4IO9A 1MKHA 3GTQH 4PG3A 3M4QA 2ASBA 2XTIA 4YY3Q 2MO1A 4LFBQ 4GN4B 4JI3L 3G71A 4DK6C 3UDGA 2I5MX 2HT1A 1VQ5A 4JI6Q 1J5EL 1I94L 3ICEA 1GO3E 2IX0A 4YWKA 1I3QH 4L5RC 4A3FG 3PUXA 3CQZH 1VS0A 4DR2L 2NVQH 3S2HH 5E7NA 2AKWB 1N34L 4QGUA 1XPRA 2CWAA 1O7IA 2F3IA 4LWCA 5IYBG 3T1HL 4JC0A 1X55A 1JMCA 4JI4Q 1A63A 3M3YH 3GDEA 4DV4Q 5M3MH 4DK3C 4A3KH 3GTMH 1VCIA 3S16H 1TWGH 4YCUA 2HIXA 3ERSX 3G6EA 4NXMQ 3S1MH 4X66Q 3K8AA 5LMNL 2I0QA 3HOZH 4B3RL 4NPSA 4DR3Q 4OX9Q 4DPGA 4C3JH 1VQMA 4DV5L 4B3SL 3HOYH 1Z47A 4PMWA 1PYBA 2LXJA 4JYAQ 2E8GA 4LUZA 4LF9L 5JJKA 2Q2HA 2YTXA 3SGIA 1K0RA 1OXUA 5IT9c 3WWVA 4GKKQ 2YV5A 1UE1A 2IHEA 3BZKA 2BA1A 5IP9G 4A3EG 4ME3A 1ASZA 2R6GA 1PYSB 3J7ZC 4A3JG 1W3SA 4JOIA 3T1HQ 1GVPA 3S1RH 4K0KL 1X54A 1I50H 4JI5L 5C4JH 4DV2Q 1VQLA 4JI5Q 2R7FA 4GKJL 4IOAA 3B6YA 2MQHA 2Z6KC 5JJLA 1L0WA 3CCEA 1X56A 3UDFA 1NMGA 1PVOA 1X65A 3RR5A 3S15H 1UE7A 1L1OC 2BH2A 1KAWA 4WJ4A 4LF8L 4NXNQ 2B63H 4A3BH 1A0IA 4FDBA 4HJ7A 4PZ8A 2WAQG 2JA8G 1HNWQ 3PUZA 1HNWL 5M5YH 3RZOH 1VQBA 4H02A 2VQFL 4GKKL 2A1AA 4LFCQ 2R92G 2IT1A 1XNRQ 5BR8Q 3M7NA 2OWOA 2OTLA 1QVFA 1S3OA 4A4IA 4ALPA 4BY1H 1YHQA 4LF4L 5JEAG 1WCMG 1E24A 4TVAB 5IYDG 4DV2L 4JI0L 3S14H 2UUCQ 4AQYL 4HJ5A 4O0AA 2ZTEA 4GOPC 1G6PA 2ZTDA 4BBRG 3E0EA 4DR6L 4IPHA 3OYYA 1VQIA 4P75A 4IFDI 1JT8A 1JJ2A 2F52A 2Y0SG 3K7AH 2YYZA 3HOZG 1Y1VH 4R4OA 1CSQA 1FL0A 2DUDA 3CC7A 1N36Q 3CCRA 1N32Q 4DUYQ 3ULJA 4DV7L 2WB1E 3HOVG 4DR7L 1E3PA 3E9IA 1U5KA 2LXKA 2UUBQ 2PQAA 5IY0A 1QVGA 3U4VA 2JEAI 3KFUA 3NENA 2JK8A 4BBRH 1A8VA 1SLJA 2YTYA 3KDFA 1OXSC 2VS1A 1OXVA 4QL5A 2F4VQ 2F4VL 2UUAL 2YTVA 3GTJH 1JJCB 2PI2E 2MNAA 1N33Q 4BY7G 4GN3B 4B3SQ 1XMOQ 1UE6A 3GTGH 4LF6Q 1UEBA 2R92H 4JBKA 4KI0A 4AYBG 4YY3L 1YJNA 1AH9A 1KRTA 2VZAA 3D31A 4L5TA 4JI3Q 2ZJPA 1CUKA 2OTJA 3H3VI 1IL2A 2JA8H 1L1OB 1Q46A 4GNXC 4A3BG 4YHHL 2B63G 5ELOA 5FLMH 3RNUA 1IBKQ 3PIPA 2NN6G 5FLMG 3H15A 3A5ZB 3I4NG 4LF4Q 4A3LH 4OWTB 4LW1A 2JA6H 3I55A 1PH6A 1GKHA 4KLKA 3TS2A 1X3GA 4DR1Q 3CF5A 1S72A 2Q2TA 3PSIA 3KDFB 1SN8A 2OQ0A 4IJHA 1YVCA 1OXTA 1EYGA 4DV3L 4GLAC 5GQOA 1E7ZA 3PUWA 5LMNW 1XMOL 4LF7Q 1GD7A 4IFDG 1CSPA 1Q1BA 1HH2P 1K3RA 5IP9H 2MO0A 5C0XJ 3GO5A 3M4OH 4A3MG 3HKSA 1J5EQ 4JI8Q 3ULLA 4KHZA 3J80i 4B3TQ 3BU2A 4B3TL 2Q2IA 1P16A 4YWMA 4PZ7A 2H5XA 1R9TH 1B70B 1VQ7A 2JA6G 1YJ9A 4DR4Q 5HGQA 2AWNA 1E1TA 1HNZQ 2YU9H 3M9BA 3HOXH 3AYHB 3CCMA 1PH3A 1B7YB 2VUMH 1PHJA 1T9HA 2K14A 4DV6L 3Q8DA 1V43A 2K52A 1VQEA 1Y1VG 2JQOA 3I4MG 3CPWA 1Q1EA 1YIJA 2WP8J 5LMNQ 1X3FA 5IP7G 5IYBH 4DR3L 4OX9L 3J7A5 2ZJQA 3HOUG 1PFSA 1X6OA 2UXBL 3K7UC 2ALYB 3IRBA 4K0KQ 1LYLA 2CQOA 4YWLA 1PH8A 5IYDH 1FVIA 1VQJA 4DUZL 2NVXH 1Z9FA 2D62A 4JI8L 1Y1WH 4DR5Q 4BY1G 2VQFQ 5LMUQ 1V1QA 3A0JA 5GAHC 1LUZA 2MFIA 3KF8B 5JJIA 1B8AA 1TWAH 2GVBA 3PCOB 1E1OA 3HOUH 3FP9A 3F2BA 1HZBA 4X62Q 4DV4L 3S2DH 1KHIA 3PF5A 2Z0SA 1X9NA 3GTPH 5C3EG 2ATWA 4DR1L 3I4MH 3F2CA 3I2ZA 3L0OA 4NXML 1MJCA 3KYHC 4TQUS 3PIOA 4HJAA 1CKOA 3CC2A 1K8AC 2VUMG 4UP8A 4UP7A 1YEZA 4JG2A 3S17H 4UPAA 5HY6A 2HHHL 1NE3A 2UXBQ 5GROA 1XJVA 2N49A 5FLXc 1NJIC 4LNQA 1AE3A 2R93G 3M4PA 2QGQA 4P74A 2HIVA 3RN2A 4AH6A 4QJFA 2K5HA 4JBWA 3H0GH 3TQYA 5M5XH 5LMUL 4YCVA 2VQEQ 4B3MQ 1VQNA 4DR7Q 3GTKH 3F1ZA 1KXLA 4C3IH 1SRUA 3AFQA 5M3FG 1N34Q 3UE0A 4IOCA 4XIGS 1Q86C 2CWPA 2KENA 2C35B 3BJUA 4NB3A 3S24A 4DV6Q 4A3EH 1EIYB 1P8LA 3TS0A 1KQSA 1K83H 4R4CA 4AIMA 2QEXA 4DV1L 2VNUD 4X65L 2N3SA 2PI2A 4X65Q 4P73A 3KJOA 5JEAJ 2A8VA 2JA9A 4R4IA 3HKZG 3AFPA 4MNOA 3MXNB 4DNIA 3S1QH 3NBHB 1KD1C 4DV3Q 4KHPQ 4LF7L 1TWCH 3JC66 2LSSA 2D0PA 1EQQA 4GOPA 1LM0A 2WFWA 4DV0Q 2JA7H 2CKZB 1Q82C 2ZM6L 2JA7G 1YITA 1HZ9A 4O2DA 3F2DA 2UU9Q 2VW9A 1H95A 3L7ZC 2UUBL 1AE2A 5AJ3L 3FKIH 1DGSA 2HQLA 2R7DA 2NVYH 3RZDH 1FJGL 1TWHH 1XNQQ 2XGTA 3CPFA 3KOJA 1JJGA 4BXXG 4R1JA 1HZCA 1VQ4A 2AHOB 1K8GA 2UUCL 3PGZA 1MIUA 3U58A 4J15A 1N9WA 2PNHA 3U4ZA 3VDYA 3KJPA 4OONA 4PZ6A 4A3IH 1YZ6A 5M3FH 4HJ9A 5K36G 1EOVA 3KLWA 1QZGA 5FJ8H 3ER0A 1XPOA 3H0GG 2UXCQ 1SR3A 3CAMA 5DLQE 1W2BA 3EIVA 2E2IH 1I94Q 3NEMA 4JOIC 5GAEC 1OTCA 1NY4A 3TREA 1M90C 2I5LX 1SE8A 3LGJA 5H1SE 3D0FA 1KIXA 1HJPA 2ZJRA 2UU9L 1PV4A 1VQKA 4POFA 4A76A 3CCLA 1FJGQ 1HR0L 2E2HH 2Y0SE 4DV1Q 1EWIA 1VQAA 3CCVA 4BBSH 5C3EH 1IXRA 2JA5G 1OXXK 3NELA 1YBYA 1K9MC 2PMZE 4R4TA 5FJ8G 4LFAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RG1 A;  2RHS B;  2AMC B;  4GLX A;  1BVS A;  1KL9 A;  3OTO Q;  1VQ9 A;  1IZ6 A;  3J81 i;  3G48 A;  5C44 G;  4HIO A;  1C0A A;  1Y1W G;  1NBW A;  4IFD J;  1MJE A;  2K75 A;  4JBM A;  4JI2 Q;  2JA5 H;  3DM3 A;  3JAM i;  3M85 A;  4DR5 L;  1WYD A;  2VQE L;  4B3M L;  4A3C G;  4HJ8 A;  3UDI A;  4DR2 Q;  1HNZ L;  1TXY A;  2NN6 I;  5IE8 A;  2NZO A;  3RLO A;  4EQ5 A;  1KC8 C;  1PH7 A;  3PUV A;  4POG A;  1CKN B;  3J80 c;  4GKJ Q;  1Q8K A;  2VY3 A;  1CKM A;  3L2P A;  3A74 A;  4JBJ A;  1KRS A;  1VQO A;  1L2F A;  2R7Z H;  3GD7 A;  1C7Y A;  4GNX B;  3PO3 H;  3HOW G;  4KHP L;  4P71 A;  4A3J H;  4R4Q A;  1N33 L;  1CKN A;  4UP9 A;  1N8R C;  2PQA B;  4HID A;  1TWF H;  3CD6 A;  1G51 A;  4JYA L;  2UXD Q;  4JV5 L;  1YNX A;  4JI6 L;  4BA2 I;  3E9H A;  4JI7 Q;  1E22 A;  1HNX L;  3HKZ E;  1PA6 A;  3CC4 A;  2BH8 A;  4BXX H;  1RIP A;  2N78 A;  3FHW A;  3K80 C;  2OCE A;  1JE5 A;  1WI5 A;  3G4S A;  2B29 A;  2L15 A;  3RLF A;  4HIK A;  3HFZ B;  5IYC G;  1SFO H;  4X62 L;  2K5V A;  3FKI G;  3HOW H;  1V9P A;  2R7Z G;  4QIW E;  3PUY A;  3W5O A;  4EX5 A;  2BA0 A;  3CXC A;  5M5W H;  3CMA A;  3PV0 A;  3CW2 C;  3T1Y L;  1PH5 A;  2KBN A;  3U50 C;  3EBE A;  5M3M G;  3CME A;  4LUV A;  4JI1 L;  3A5U A;  4QQB X;  1I5F A;  5C4X G;  1JB7 A;  2N8N A;  1QZH A;  4WJ3 M;  5GAG C;  3OTO L;  1GM5 A;  2UXC L;  4GNX A;  3EN2 A;  2IHF A;  4DV5 Q;  2NVT H;  4NXN L;  4X64 Q;  2EIF A;  1IYJ B;  4LF8 Q;  4A3F H;  3PO2 G;  2K50 A;  4L5Q A;  3BZC A;  3UDX A;  3J81 j;  5EAY A;  4LF9 Q;  1N36 L;  1PH4 A;  4A93 H;  1WJJ A;  5C44 H;  1VQF A;  2E5L Q;  4P72 A;  4JI7 L;  1EUJ A;  2E5L L;  4LFC L;  5BR8 L;  1XPU A;  1PH2 A;  5AJ3 Q;  3GTL H;  1HR0 Q;  2GN5 A;  3ULP A;  3OW2 A;  2K4K A;  1L1O A;  3F8T A;  1Q12 A;  3PO2 H;  2ZTC A;  4X66 L;  3K81 C;  1PH1 A;  1NMF A;  5IP7 H;  4IPD A;  4LF6 L;  3MEF A;  3CCJ A;  2VL6 A;  3HOV H;  5ELN A;  2Z6K A;  3AEV A;  1BBW A;  1UWV A;  1YI2 A;  1I6H H;  4DV0 L;  4OO1 G;  1IBL Q;  4A3D H;  4LFB L;  2RHQ B;  1VQG A;  5J3B A;  1IBM Q;  1WOC A;  1S40 A;  3AQQ A;  4DUZ Q;  1HNX Q;  1Q81 C;  4YHH Q;  1RL2 A;  2K5N A;  2AWO A;  4IPG A;  1YHB A;  4DUY L;  1HR0 W;  1J6Q A;  2RCN A;  1XNR L;  3GTO H;  1U0L A;  1XTD A;  1XNQ L;  4A3G H;  4QY7 A;  4JV5 Q;  1SRO A;  2EQS A;  4GN5 A;  4Y7N H;  4A3I G;  3STB C;  2ID0 A;  4LUO A;  3RLN A;  1PH9 A;  1D8L A;  5IWA Q;  2IX1 A;  1WCM H;  2KHI A;  4A93 G;  4JI1 Q;  4IJL A;  4AQY Q;  4L5S A;  4XTC S;  1VQ8 A;  3ZJY C;  2UUA Q;  2WB1 G;  3JAM c;  1EIF A;  3UE1 A;  5C0X I;  4B3R Q;  2QA4 A;  3STB D;  1K73 C;  1D7Q A;  1SMX A;  1NTG A;  1XMQ Q;  1ASY A;  4DR6 Q;  1LTL A;  2HHH Q;  2KCM A;  2IY5 B;  3W1B A;  1UE5 A;  4LF5 L;  4RMF A;  2JJQ A;  4JCV E;  2RF4 A;  5C4X H;  3H3V H;  3TRZ A;  4X6A H;  3CCU A;  1VQ6 A;  3DLL A;  1IBM L;  2KCT A;  2ES2 A;  3I4N H;  2V1C C;  4JI2 L;  4OWW B;  1BBU A;  4A3L G;  1N32 L;  3TEH B;  4DV7 Q;  4C2M H;  3KF6 B;  3HOX G;  4GLV B;  2EXD A;  2B3G A;  4C3H H;  5IYC H;  4BA1 I;  2FXQ A;  4JI4 L;  4JI0 Q;  4AYB E;  3I7F A;  2GVA A;  3T1Y Q;  4LFA Q;  1X3E A;  2CFM A;  1YHA A;  2DGY A;  4A3M H;  4IPC A;  2E2J H;  1HZA A;  4BY7 H;  1C9O A;  4MZ9 A;  4MTN A;  2CCZ A;  4DKA C;  4UY8 C;  1BKB A;  4A3G G;  1WFQ A;  4X64 L;  1XMQ L;  2I5H A;  1IBL L;  3S1N H;  4OO1 I;  1A62 A;  1M1K C;  3K0X A;  3CCS A;  4LF5 Q;  3PO3 G;  3W1G A;  4DAY B;  4BBS G;  2NZH A;  1QUQ B;  1VQD A;  2D0O A;  2KHJ A;  3CP0 A;  1Q7Y C;  1VQH A;  4GS3 A;  2ZM6 Q;  2UXD L;  3I56 A;  2JE6 I;  2R93 H;  4A3D G;  1YJW A;  1G29 1;  3HOY G;  1IBK L;  4Y52 H;  3J81 c;  3CCQ A;  4OWX B;  3PF4 A;  4APV A;  4DR4 L;  3RN5 A;  3I4O A;  2WAQ E;  4A75 A;  1QUQ A;  3KF6 A;  4YCW A;  2JEB I;  1VQC A;  4A3C H;  5IWA L;  2Q2U A;  1Y14 B;  1EFW A;  1VQP A;  5GAD C;  4A3K G;  1EQR A;  4GOP B;  2A19 A;  4HIM A;  2OQK A;  4DAM A;  1QVC A;  1FGU A;  4OXP A;  5C0X G;  4IO9 A;  1MKH A;  3GTQ H;  4PG3 A;  3M4Q A;  2ASB A;  2XTI A;  4YY3 Q;  2MO1 A;  4LFB Q;  4GN4 B;  4JI3 L;  3G71 A;  4DK6 C;  3UDG A;  2I5M X;  2HT1 A;  1VQ5 A;  4JI6 Q;  1J5E L;  1I94 L;  3ICE A;  1GO3 E;  2IX0 A;  4YWK A;  1I3Q H;  4L5R C;  4A3F G;  3PUX A;  3CQZ H;  1VS0 A;  4DR2 L;  2NVQ H;  3S2H H;  5E7N A;  2AKW B;  1N34 L;  4QGU A;  1XPR A;  2CWA A;  1O7I A;  2F3I A;  4LWC A;  5IYB G;  3T1H L;  4JC0 A;  1X55 A;  1JMC A;  4JI4 Q;  1A63 A;  3M3Y H;  3GDE A;  4DV4 Q;  5M3M H;  4DK3 C;  4A3K H;  3GTM H;  1VCI A;  3S16 H;  1TWG H;  4YCU A;  2HIX A;  3ERS X;  3G6E A;  4NXM Q;  3S1M H;  4X66 Q;  3K8A A;  5LMN L;  2I0Q A;  3HOZ H;  4B3R L;  4NPS A;  4DR3 Q;  4OX9 Q;  4DPG A;  4C3J H;  1VQM A;  4DV5 L;  4B3S L;  3HOY H;  1Z47 A;  4PMW A;  1PYB A;  2LXJ A;  4JYA Q;  2E8G A;  4LUZ A;  4LF9 L;  5JJK A;  2Q2H A;  2YTX A;  3SGI A;  1K0R A;  1OXU A;  5IT9 c;  3WWV A;  4GKK Q;  2YV5 A;  1UE1 A;  2IHE A;  3BZK A;  2BA1 A;  5IP9 G;  4A3E G;  4ME3 A;  1ASZ A;  2R6G A;  1PYS B;  3J7Z C;  4A3J G;  1W3S A;  4JOI A;  3T1H Q;  1GVP A;  3S1R H;  4K0K L;  1X54 A;  1I50 H;  4JI5 L;  5C4J H;  4DV2 Q;  1VQL A;  4JI5 Q;  2R7F A;  4GKJ L;  4IOA A;  3B6Y A;  2MQH A;  2Z6K C;  5JJL A;  1L0W A;  3CCE A;  1X56 A;  3UDF A;  1NMG A;  1PVO A;  1X65 A;  3RR5 A;  3S15 H;  1UE7 A;  1L1O C;  2BH2 A;  1KAW A;  4WJ4 A;  4LF8 L;  4NXN Q;  2B63 H;  4A3B H;  1A0I A;  4FDB A;  4HJ7 A;  4PZ8 A;  2WAQ G;  2JA8 G;  1HNW Q;  3PUZ A;  1HNW L;  5M5Y H;  3RZO H;  1VQB A;  4H02 A;  2VQF L;  4GKK L;  2A1A A;  4LFC Q;  2R92 G;  2IT1 A;  1XNR Q;  5BR8 Q;  3M7N A;  2OWO A;  2OTL A;  1QVF A;  1S3O A;  4A4I A;  4ALP A;  4BY1 H;  1YHQ A;  4LF4 L;  5JEA G;  1WCM G;  1E24 A;  4TVA B;  5IYD G;  4DV2 L;  4JI0 L;  3S14 H;  2UUC Q;  4AQY L;  4HJ5 A;  4O0A A;  2ZTE A;  4GOP C;  1G6P A;  2ZTD A;  4BBR G;  3E0E A;  4DR6 L;  4IPH A;  3OYY A;  1VQI A;  4P75 A;  4IFD I;  1JT8 A;  1JJ2 A;  2F52 A;  2Y0S G;  3K7A H;  2YYZ A;  3HOZ G;  1Y1V H;  4R4O A;  1CSQ A;  1FL0 A;  2DUD A;  3CC7 A;  1N36 Q;  3CCR A;  1N32 Q;  4DUY Q;  3ULJ A;  4DV7 L;  2WB1 E;  3HOV G;  4DR7 L;  1E3P A;  3E9I A;  1U5K A;  2LXK A;  2UUB Q;  2PQA A;  5IY0 A;  1QVG A;  3U4V A;  2JEA I;  3KFU A;  3NEN A;  2JK8 A;  4BBR H;  1A8V A;  1SLJ A;  2YTY A;  3KDF A;  1OXS C;  2VS1 A;  1OXV A;  4QL5 A;  2F4V Q;  2F4V L;  2UUA L;  2YTV A;  3GTJ H;  1JJC B;  2PI2 E;  2MNA A;  1N33 Q;  4BY7 G;  4GN3 B;  4B3S Q;  1XMO Q;  1UE6 A;  3GTG H;  4LF6 Q;  1UEB A;  2R92 H;  4JBK A;  4KI0 A;  4AYB G;  4YY3 L;  1YJN A;  1AH9 A;  1KRT A;  2VZA A;  3D31 A;  4L5T A;  4JI3 Q;  2ZJP A;  1CUK A;  2OTJ A;  3H3V I;  1IL2 A;  2JA8 H;  1L1O B;  1Q46 A;  4GNX C;  4A3B G;  4YHH L;  2B63 G;  5ELO A;  5FLM H;  3RNU A;  1IBK Q;  3PIP A;  2NN6 G;  5FLM G;  3H15 A;  3A5Z B;  3I4N G;  4LF4 Q;  4A3L H;  4OWT B;  4LW1 A;  2JA6 H;  3I55 A;  1PH6 A;  1GKH A;  4KLK A;  3TS2 A;  1X3G A;  4DR1 Q;  3CF5 A;  1S72 A;  2Q2T A;  3PSI A;  3KDF B;  1SN8 A;  2OQ0 A;  4IJH A;  1YVC A;  1OXT A;  1EYG A;  4DV3 L;  4GLA C;  5GQO A;  1E7Z A;  3PUW A;  5LMN W;  1XMO L;  4LF7 Q;  1GD7 A;  4IFD G;  1CSP A;  1Q1B A;  1HH2 P;  1K3R A;  5IP9 H;  2MO0 A;  5C0X J;  3GO5 A;  3M4O H;  4A3M G;  3HKS A;  1J5E Q;  4JI8 Q;  3ULL A;  4KHZ A;  3J80 i;  4B3T Q;  3BU2 A;  4B3T L;  2Q2I A;  1P16 A;  4YWM A;  4PZ7 A;  2H5X A;  1R9T H;  1B70 B;  1VQ7 A;  2JA6 G;  1YJ9 A;  4DR4 Q;  5HGQ A;  2AWN A;  1E1T A;  1HNZ Q;  2YU9 H;  3M9B A;  3HOX H;  3AYH B;  3CCM A;  1PH3 A;  1B7Y B;  2VUM H;  1PHJ A;  1T9H A;  2K14 A;  4DV6 L;  3Q8D A;  1V43 A;  2K52 A;  1VQE A;  1Y1V G;  2JQO A;  3I4M G;  3CPW A;  1Q1E A;  1YIJ A;  2WP8 J;  5LMN Q;  1X3F A;  5IP7 G;  5IYB H;  4DR3 L;  4OX9 L;  3J7A 5;  2ZJQ A;  3HOU G;  1PFS A;  1X6O A;  2UXB L;  3K7U C;  2ALY B;  3IRB A;  4K0K Q;  1LYL A;  2CQO A;  4YWL A;  1PH8 A;  5IYD H;  1FVI A;  1VQJ A;  4DUZ L;  2NVX H;  1Z9F A;  2D62 A;  4JI8 L;  1Y1W H;  4DR5 Q;  4BY1 G;  2VQF Q;  5LMU Q;  1V1Q A;  3A0J A;  5GAH C;  1LUZ A;  2MFI A;  3KF8 B;  5JJI A;  1B8A A;  1TWA H;  2GVB A;  3PCO B;  1E1O A;  3HOU H;  3FP9 A;  3F2B A;  1HZB A;  4X62 Q;  4DV4 L;  3S2D H;  1KHI A;  3PF5 A;  2Z0S A;  1X9N A;  3GTP H;  5C3E G;  2ATW A;  4DR1 L;  3I4M H;  3F2C A;  3I2Z A;  3L0O A;  4NXM L;  1MJC A;  3KYH C;  4TQU S;  3PIO A;  4HJA A;  1CKO A;  3CC2 A;  1K8A C;  2VUM G;  4UP8 A;  4UP7 A;  1YEZ A;  4JG2 A;  3S17 H;  4UPA A;  5HY6 A;  2HHH L;  1NE3 A;  2UXB Q;  5GRO A;  1XJV A;  2N49 A;  5FLX c;  1NJI C;  4LNQ A;  1AE3 A;  2R93 G;  3M4P A;  2QGQ A;  4P74 A;  2HIV A;  3RN2 A;  4AH6 A;  4QJF A;  2K5H A;  4JBW A;  3H0G H;  3TQY A;  5M5X H;  5LMU L;  4YCV A;  2VQE Q;  4B3M Q;  1VQN A;  4DR7 Q;  3GTK H;  3F1Z A;  1KXL A;  4C3I H;  1SRU A;  3AFQ A;  5M3F G;  1N34 Q;  3UE0 A;  4IOC A;  4XIG S;  1Q86 C;  2CWP A;  2KEN A;  2C35 B;  3BJU A;  4NB3 A;  3S24 A;  4DV6 Q;  4A3E H;  1EIY B;  1P8L A;  3TS0 A;  1KQS A;  1K83 H;  4R4C A;  4AIM A;  2QEX A;  4DV1 L;  2VNU D;  4X65 L;  2N3S A;  2PI2 A;  4X65 Q;  4P73 A;  3KJO A;  5JEA J;  2A8V A;  2JA9 A;  4R4I A;  3HKZ G;  3AFP A;  4MNO A;  3MXN B;  4DNI A;  3S1Q H;  3NBH B;  1KD1 C;  4DV3 Q;  4KHP Q;  4LF7 L;  1TWC H;  3JC6 6;  2LSS A;  2D0P A;  1EQQ A;  4GOP A;  1LM0 A;  2WFW A;  4DV0 Q;  2JA7 H;  2CKZ B;  1Q82 C;  2ZM6 L;  2JA7 G;  1YIT A;  1HZ9 A;  4O2D A;  3F2D A;  2UU9 Q;  2VW9 A;  1H95 A;  3L7Z C;  2UUB L;  1AE2 A;  5AJ3 L;  3FKI H;  1DGS A;  2HQL A;  2R7D A;  2NVY H;  3RZD H;  1FJG L;  1TWH H;  1XNQ Q;  2XGT A;  3CPF A;  3KOJ A;  1JJG A;  4BXX G;  4R1J A;  1HZC A;  1VQ4 A;  2AHO B;  1K8G A;  2UUC L;  3PGZ A;  1MIU A;  3U58 A;  4J15 A;  1N9W A;  2PNH A;  3U4Z A;  3VDY A;  3KJP A;  4OON A;  4PZ6 A;  4A3I H;  1YZ6 A;  5M3F H;  4HJ9 A;  5K36 G;  1EOV A;  3KLW A;  1QZG A;  5FJ8 H;  3ER0 A;  1XPO A;  3H0G G;  2UXC Q;  1SR3 A;  3CAM A;  5DLQ E;  1W2B A;  3EIV A;  2E2I H;  1I94 Q;  3NEM A;  4JOI C;  5GAE C;  1OTC A;  1NY4 A;  3TRE A;  1M90 C;  2I5L X;  1SE8 A;  3LGJ A;  5H1S E;  3D0F A;  1KIX A;  1HJP A;  2ZJR A;  2UU9 L;  1PV4 A;  1VQK A;  4POF A;  4A76 A;  3CCL A;  1FJG Q;  1HR0 L;  2E2H H;  2Y0S E;  4DV1 Q;  1EWI A;  1VQA A;  3CCV A;  4BBS H;  5C3E H;  1IXR A;  2JA5 G;  1OXX K;  3NEL A;  1YBY A;  1K9M C;  2PMZ E;  4R4T A;  5FJ8 G;  4LFA L; 
#chains in the Genus database with same CATH topology
 1GUT A;  1I4G A;  2F3V A;  3OTO Q;  1VQ9 A;  4Y7N B;  2YU9 B;  2R92 B;  1PYW D;  1MJE A;  4JI2 Q;  3K5M A;  4MHE A;  4DR5 L;  3JAM i;  1WYD A;  2VQE L;  4B3M L;  3MC0 B;  1EY7 A;  3UDI A;  2IL8 A;  5IE8 A;  1KC8 C;  1W6K A;  3PUV A;  4DU9 A;  1Q8K A;  2PO4 A;  2CW0 C;  3A74 A;  2R7Z H;  1LV9 A;  1EQT A;  4KHP L;  3HOW G;  3KK7 A;  1Y69 U;  1SEB D;  4JYA L;  3NWT A;  1YNN C;  1ICW A;  4JI6 L;  4A3B B;  5C44 B;  1HNX L;  1HUM A;  1RIP A;  1L0Y B;  2N78 A;  2BDO A;  4KTA A;  3MA2 B;  3G4S A;  2B29 A;  3D6W A;  2PW7 A;  4X62 L;  3FKI G;  3GTG B;  2EE1 A;  4QIW E;  1STA A;  2NTS A;  4FF4 A;  5G3L D;  2Z4H A;  1PXU A;  1SNO A;  3PV0 A;  3T1Y L;  3C1E A;  1HPC A;  2Q8I B;  4WJ3 M;  5GAG C;  3OTO L;  3J80 E;  1EOT A;  1SJH D;  3VYS A;  2EIF A;  1IYJ B;  4LF8 Q;  3K59 A;  1STH A;  1YNJ C;  4A3F H;  3PO2 G;  3BZC A;  4A93 H;  2F0S A;  5C44 H;  2E5L L;  4S3S A;  4FXG C;  1E2W A;  2WAQ B;  5BR8 L;  4KKU A;  4Z9C B;  5DEH A;  3GTL H;  2GN5 A;  1PLF A;  1KAB A;  3KBX A;  2ICI A;  4QUC A;  3G7L A;  1DOK A;  1Q12 A;  3FPU B;  2K03 A;  2R7Z B;  3OWF A;  4RGT A;  4IZ8 A;  3K81 C;  1RKN A;  4UDU C;  3H3V C;  4IPD A;  1H9M A;  1I6H H;  1BBW A;  1UWV A;  2WII B;  1TS5 A;  3LX0 A;  2JA7 B;  1IBM Q;  1JWS D;  4PNY A;  1IYU A;  2K1B A;  4YHH Q;  4DUY L;  1HUN A;  4A3G H;  1LTT D;  1XNQ L;  2DY8 A;  4JV5 Q;  4Y7N H;  3STB C;  3R93 A;  4HCE A;  2IX1 A;  1WCM H;  4IUT A;  4IFD H;  1QNK A;  1T5E A;  5M3F B;  1K73 C;  3KF8 A;  1B3Q A;  5C4X H;  3H3V H;  2RF4 A;  3CCU A;  1IBM L;  5JVG 3;  4A3L G;  1N32 L;  2K01 A;  3TEH B;  1K83 B;  4DV7 Q;  4ZKB B;  2AQ2 B;  4AYB E;  2GVA A;  1KNE A;  2B2V C;  5E4X A;  4DAY A;  3LNN A;  1FNV A;  1HZA A;  4BY7 H;  4DKA C;  3F2U A;  4A3G G;  1WFQ A;  1IBL L;  1A62 A;  3PO3 G;  3CCS A;  1QUQ B;  1VQH A;  4GS3 A;  2R93 H;  3MEH A;  2JE6 I;  1G29 1;  4K5X A;  1U4P A;  3MXG A;  1LT5 D;  3MXN A;  3I4O A;  5KIX A;  4A75 A;  1QUQ A;  1VQC A;  1D5Z C;  5GAD C;  1TY2 A;  1EQR A;  3X3N A;  4A3K G;  2QCP X;  4HIM A;  3GV6 A;  1SYF A;  3A7L A;  4QUF A;  5C0X G;  1DCZ A;  4YY3 Q;  4U67 3;  3UDG A;  2I5M X;  2HT1 A;  4JI6 Q;  1I4X A;  3PUX A;  4DR2 L;  4CDD C;  3TSS A;  4PQX A;  4K5V A;  4QGU A;  5IYB G;  2F3I A;  4A3K H;  3GTM H;  3S16 H;  2B2T A;  1TWG H;  4IUV A;  3G6E A;  2A69 D;  1K28 A;  1NNX A;  5FO9 B;  3HOZ H;  1X3P A;  2IW3 A;  1VQM A;  4B3S L;  1Z47 A;  4PMW A;  2BE5 C;  1TWA B;  4EVO A;  4JYA Q;  3ERQ A;  4LF9 L;  4KJN A;  2Q2H A;  3WOE A;  4A3E G;  2IHE A;  2BA1 A;  5IP9 G;  4DK0 A;  1GOZ A;  2EZV A;  4DXF A;  2L5T A;  3OW7 A;  3S1R H;  1GVP A;  1RD9 D;  3MXP A;  2BOS A;  1A3T A;  4JI5 Q;  2R7F A;  3GV3 A;  5DM6 3;  4IOA A;  1V1O A;  1DYQ A;  5JJL A;  3PIP 3;  3ZYY X;  2PZT A;  3CCE A;  1X65 A;  3X3M A;  1L1O C;  1KAW A;  4NXN Q;  2B63 H;  1HFG A;  4HJ7 A;  2JA8 G;  4HED A;  1HNW Q;  1C8C A;  1PTO B;  1W6J A;  1E2V A;  3M7N A;  2OWO A;  4FF3 A;  4NDX A;  4QB4 A;  3MWY W;  4OGQ C;  4WOR A;  1TU2 B;  4LF4 L;  2EYH A;  4IUU A;  4K5W A;  5IYD G;  2DY7 A;  5ISR A;  4XQN A;  2UUC Q;  1NAP A;  2E74 C;  3E0E A;  5EJW A;  5FO8 B;  3OYY A;  4TSS A;  2EJM A;  4OIK A;  2CHB D;  1PTO H;  1D1K A;  3D6C A;  1Y1V H;  2A6E C;  1XTC D;  1JOR A;  1ZYR C;  1PRT D;  2DUD A;  3CC7 A;  1N36 Q;  4I7Z C;  3CCR A;  3ULJ A;  4DV7 L;  1UUP A;  3E9I A;  3BDL A;  3GQB A;  5IY0 A;  3KFU A;  3NEN A;  3N52 A;  4BBR H;  1SNQ A;  1ZYR D;  2K04 A;  3KDF A;  2VS1 A;  2F4V L;  1II3 A;  3A7A B;  5M5W B;  4GN3 B;  4B3S Q;  2B2V A;  2B63 B;  4JBK A;  1YJN A;  4K6L A;  2ZJP A;  1CUK A;  1IL2 A;  2JA8 H;  4KN4 C;  4RA8 A;  4HCS A;  3HOZ B;  1GJX A;  2B2Y C;  3PIP A;  4JK1 C;  1V8Q A;  1U4L A;  5I2Y A;  2JA5 B;  2DNE A;  3S16 B;  2AQ3 B;  4LW1 A;  2JA6 H;  2H4O A;  3BYY B;  2F0O A;  4X3U A;  4RCN A;  2Q2T A;  3S9W A;  1ILQ A;  1PRT F;  1SYG A;  3DWA A;  2B8F A;  4LF7 Q;  1EY8 A;  1CSP A;  5IP9 H;  1HH2 P;  1JWU D;  4J8Q A;  2WKD A;  2MGS A;  3GO5 A;  1J5E Q;  4DXG A;  3ULL A;  3J80 i;  4B3T Q;  4CDC C;  5C4H A;  1GUG A;  1P16 A;  4PZ7 A;  1QIL A;  2AWN A;  1PH3 A;  2N55 A;  2L55 A;  2Z4I A;  1PHJ A;  4DV6 L;  2K52 A;  1VQE A;  5I2X A;  2FMC A;  4DK1 A;  1PRT C;  4C3I B;  5LMN Q;  3NWS A;  3V2T A;  4J6H A;  1PFS A;  1X6O A;  1SSO A;  1H9R A;  3IRB A;  4K0K Q;  2CQO A;  4Q5V A;  1FVI A;  4DUZ L;  5AFW A;  2D62 A;  2F0V A;  4DR5 Q;  3I91 A;  5LMU Q;  3N6R A;  4BY7 B;  3BDO A;  3PCO B;  1ENC A;  4LAA A;  2GVB A;  2KCC A;  1SJE D;  3FP9 A;  1Z7T A;  1HZB A;  2EYO A;  1PDQ A;  2LKV A;  1KTK A;  3NP8 A;  2ATW A;  2XVS A;  1IKL A;  3HKZ B;  3F2C A;  3ERO A;  3I2Z A;  1JCK B;  1JIC A;  2KA7 A;  3KYH C;  3PIO A;  3SK8 A;  3EFX D;  1CKO A;  1K8A C;  1YEZ A;  1EL0 A;  5E4W C;  5CMD A;  3MVV A;  4RCO A;  1QOH A;  5GRO A;  4H13 C;  4QMG A;  5FLX c;  1NJI C;  1EZ6 A;  1WTQ A;  1AE3 A;  3TP6 A;  4M1U B;  1SXT A;  1I3Q B;  1MBY A;  4P74 A;  3RN2 A;  4QJF A;  1MI2 A;  2VQE Q;  4B3M Q;  5D14 A;  3H0G B;  1KXL A;  1SRU A;  3AFQ A;  3Q0A A;  1N34 Q;  4BXX G;  2L1B A;  2CWP A;  2KEN A;  1LTI D;  2C35 B;  4NB3 A;  4XT3 B;  1EIY B;  1K83 H;  4AIM A;  3C2P A;  2KED A;  2L11 A;  5KYL A;  2PI2 A;  3KJO A;  1F2Y A;  3AU7 A;  4R4I A;  2M2L A;  3MXN B;  1NR2 A;  2J4X A;  1TWC H;  3JC6 6;  3SEB A;  1RTN A;  3V96 A;  2JA7 H;  1BCP D;  2ZM6 L;  1YIT A;  2G9H D;  2BCO A;  1EEF D;  3E3X A;  5ELB A;  1O7Y A;  1DGS A;  2PZW A;  1LTA D;  3S1N B;  1S4Z A;  3TZD A;  1D5X C;  3CPF A;  2ZXR A;  2ZXP A;  1N9W A;  2DJG C;  3U4Z A;  4PZ6 A;  2EYJ A;  1MHW C;  3HZX A;  2K7V A;  3KLW A;  4MIU A;  5FJ8 H;  1I6H B;  1SR3 A;  3CAM A;  5KYI A;  2E2I H;  5IGF A;  5GAE C;  3TRE A;  1M90 C;  2QF7 A;  1SE8 A;  5H1S E;  1HJP A;  3I4L A;  2UU9 L;  3OIP A;  1K8O A;  1VQK A;  3CCL A;  2RA4 A;  2B2W C;  1OXX K;  4ID6 A;  2JA5 G;  5JEA H;  1HHV A;  5FJ8 G;  4A3F B;  2AMC B;  4GLX A;  1BVS A;  2F0T A;  3H94 A;  1IZ6 A;  3J81 i;  5IGG A;  1NBW A;  1S5F D;  4CKE A;  2XRS D;  1PRT B;  4A3C G;  1NCV A;  4DR2 Q;  2NN6 I;  3VYR A;  5IT9 E;  3NXW A;  4EQ5 A;  1PH7 A;  1CKN B;  5EPJ A;  3J80 c;  4NP5 A;  2IWH A;  2VY3 A;  4JBJ A;  1KRS A;  1L2F A;  5CV7 A;  1C7Y A;  1GUN A;  1WTO A;  4P71 A;  4A3J H;  4R4Q A;  1N33 L;  4UP9 A;  3E5S A;  4TRD A;  1JB3 A;  5A2Q E;  2RSN A;  3OHX C;  1PTO D;  4JI7 Q;  4BXX H;  1F2M A;  3HKZ E;  1PA6 A;  1SYE A;  2KEE A;  2OCE A;  1JE5 A;  1WI5 A;  3TP7 A;  2L15 A;  4I65 A;  3HFZ B;  5IYC G;  2K5V A;  2A6H C;  1STG A;  4EX5 A;  2BA0 A;  3CXC A;  2EJG C;  5M5W H;  5M3M G;  4LUV A;  1CT1 D;  4FXK C;  5LL6 S;  4C1N K;  1JB7 A;  1QZH A;  4GNX A;  3NTI A;  2OF1 A;  1LLR D;  2HUG A;  3TP8 A;  3QO2 A;  1B9M A;  5E1F A;  5CV4 A;  5EAY A;  2FIN B;  1N36 L;  1PH4 A;  2QDB A;  4CDE C;  1WJJ A;  4BY1 B;  1VQF A;  2K5W A;  1PMR A;  1EUJ A;  2EYL A;  4N9P A;  4F87 A;  1XPU A;  1PH2 A;  1QB5 D;  5AJ3 Q;  1B44 D;  5BN5 A;  3OW2 A;  1STE A;  4DFA A;  4X66 L;  1XX8 A;  4RWS C;  4XYQ A;  4ZYS A;  1PH1 A;  2NVQ B;  3MEF A;  3CCJ A;  5ELN A;  2Z6K A;  1DXM A;  4OEL B;  5J3B A;  1TY0 A;  4DUZ Q;  2K5N A;  3D4R A;  1J6Q A;  2M9V A;  1SRO A;  4A3I G;  4ZAI A;  2HCC A;  4LUO A;  4DN4 M;  3MZ5 A;  3S2H B;  1STN A;  4C56 C;  2EY2 A;  1J9O A;  2KHI A;  4AQY Q;  3TME A;  4L5S A;  2UUA Q;  1EIF A;  3UE1 A;  5C0X I;  4B3R Q;  2QA4 A;  1SMX A;  1ASY A;  3S1R B;  2KCM A;  3W1B A;  1UE5 A;  4LF5 L;  4UHV A;  3TRZ A;  2X69 A;  1VQ6 A;  2KCT A;  2F0F A;  3I4N H;  2XWJ B;  1BBU A;  1CZG A;  1H9S B;  4GLV B;  5EKL A;  1LTS D;  4C3H H;  2FXQ A;  1QG7 A;  4O42 A;  4JI4 L;  4HMJ A;  3I7F A;  1OO9 B;  2PZU A;  4B08 A;  3DHQ A;  1TWG B;  1LTB D;  4ODG A;  1YHA A;  4A3M H;  2E2J H;  2CCZ A;  4MZ9 A;  1AP0 A;  1BKB A;  2NZ1 D;  3PQI A;  4KHV A;  2I5H A;  1F77 A;  4OO1 I;  2NVX B;  4IUQ A;  3HEJ A;  4LF5 Q;  5E3F A;  2NZH A;  1VQD A;  2PMZ B;  4ILW A;  1WTH A;  1YJW A;  4C3J G;  3HOY G;  3Q23 A;  4Y52 H;  4FNF A;  3J81 c;  3FDT A;  3CCQ A;  2L4N A;  3PF4 A;  4DR4 L;  1G6Z A;  3J81 L;  2WAQ E;  2JEB I;  1B53 A;  2VXW A;  4L8J A;  5IWA L;  2HDM A;  1CQV A;  1IW7 D;  1VQP A;  1WD0 A;  1ZXT A;  4GOP B;  1SYC A;  3HOX B;  4R8N A;  2MHV A;  3NHH A;  1QVC A;  3OIQ A;  2XIW A;  3DEO A;  4A3E B;  2ASB A;  2XTI A;  1KDB A;  1Y8O B;  4GN4 B;  3G71 A;  2RDH A;  3GTP B;  1J5E L;  1I94 L;  2R93 B;  1EIG A;  2F0W A;  3S2H H;  3ND9 A;  1XPR A;  4LWC A;  3T1H L;  1JMC A;  4JI4 Q;  3L9A X;  1F9S A;  5IOD A;  2K5Q A;  4JW0 A;  1VCI A;  4DAV A;  2RVL A;  1JE4 A;  4YCU A;  2HIX A;  3ERS X;  4IQZ A;  4NXM Q;  4X66 Q;  3K8A A;  2E76 C;  2I0Q A;  4B3R L;  4HTH A;  4DR3 Q;  1JC7 A;  4U68 A;  4DPG A;  4DV5 L;  3M4O B;  2HD3 A;  1PYB A;  2LXJ A;  1O80 A;  2E8G A;  2NB0 A;  3SHL A;  3A8J E;  2YTX A;  5IT9 c;  2F0H A;  4GKK Q;  3E6Z X;  1AEX A;  1UE1 A;  2CW0 D;  3BZK A;  5FKA C;  5L37 A;  1ASZ A;  5C4X B;  2R6G A;  3J7Z C;  1DOM A;  1W3S A;  1X54 A;  1I50 H;  1TII D;  5C4J H;  4DV2 Q;  1VQL A;  4GKJ L;  4DA2 A;  2N88 A;  1YNN D;  1WCM B;  1BDO A;  1X56 A;  1NMG A;  4WFN 3;  1UEA B;  4M8A A;  3QG1 A;  2NN6 H;  4YIJ A;  1FR3 A;  1A0I A;  4V19 0;  2DNC A;  4XXE A;  3PUZ A;  2DN8 A;  1VQB A;  4GKK L;  4CHT B;  2IT1 A;  1G91 A;  4RHR A;  2OTL A;  4XQQ A;  3FMC A;  1QVF A;  3D4W A;  4ALP A;  4BY1 H;  1LAC A;  3AMU A;  4KN7 C;  1WCM G;  4KKS A;  4DV2 L;  4H0L C;  4JI0 L;  2QEJ C;  4HJ5 A;  1CFM A;  4O0A A;  2ZTE A;  2HDL A;  2K6A A;  4IN3 A;  1TVX A;  3PIO 3;  1VQI A;  1JT8 A;  2F52 A;  3K7A H;  5IGC A;  2YYZ A;  3RD4 A;  3U9O A;  1CSQ A;  4E6I A;  1FL0 A;  3TP5 A;  1CZW A;  4DUY Q;  5DM7 3;  1E3P A;  3D8G A;  5JAV A;  1U5K A;  3VR3 A;  1QVG A;  2JEA I;  3U4V A;  1I4R A;  5A35 A;  1QWY A;  1A8V A;  2YTY A;  4QL5 A;  1OXV A;  3RZO B;  4A3J B;  5K5P A;  3GTJ H;  2MNA A;  1N33 Q;  4BY7 G;  4QF4 A;  3GTG H;  4DNT B;  1I4Q A;  2PCF B;  4LF6 Q;  2AUJ D;  2EY1 A;  4KKT A;  4YY3 L;  1EYD A;  1LTG D;  1T5X D;  4C3H G;  1Q46 A;  3HGB A;  2B63 G;  5ELO A;  5KGU A;  2F3W A;  2F0K A;  2EVB A;  2A69 C;  3MAQ A;  3E0J A;  3I4N G;  2JP1 A;  2PYK A;  2XWB B;  3I55 A;  1GKH A;  3TS2 A;  3CF5 A;  3PSI A;  5CV9 A;  1SN8 A;  3HG9 A;  3TDQ A;  3KUP A;  4GLA C;  1I4H A;  3PUW A;  4IFD G;  5IOC A;  4C3J B;  3HOY B;  1CA5 A;  1K3R A;  4XDX A;  4A3M G;  1PFB A;  4KHZ A;  4B3T L;  3V05 A;  4FXD A;  1TS3 A;  3H09 A;  2G5D A;  4XQJ A;  3FEW X;  1TR5 A;  3P75 A;  3M9B A;  2YU9 H;  3AYH B;  4K14 A;  5JPM C;  2PNR C;  2E2I B;  1D6E C;  4XT1 B;  3Q8D A;  1D1I A;  2XRQ D;  1Y1V G;  3M4Y A;  3I4M G;  3CPW A;  2QIL A;  4LK1 C;  4FVM A;  4DGZ A;  1X3F A;  3Q22 A;  3GTK B;  5CR3 A;  5IYB H;  4OX9 L;  3HOU G;  2AUK A;  3NQT A;  2C9O A;  1TWC B;  2MP1 A;  1LYL A;  3ONA B;  1PH8 A;  5C3W A;  1VQJ A;  4JI8 L;  2LS0 1;  3RUZ A;  4BY1 G;  1BBX C;  1V1Q A;  5GAH C;  2MFI A;  1LT3 D;  3R3O A;  1B9N A;  5I4D A;  2ENB A;  1E1O A;  3F2B A;  1CI3 M;  4DV4 L;  5T1G A;  3I73 A;  4FP5 D;  1I4P A;  4DR1 L;  3I4M H;  3L0O A;  3NUC A;  4TQU S;  2A74 C;  2KCN A;  4UP8 A;  1IW7 C;  4JG2 A;  4F88 A;  3S17 H;  1SYB A;  4MTK A;  2NVY B;  2UXB Q;  1IKM A;  4WRD A;  1CTM A;  4LNQ A;  5IT9 L;  3CQZ B;  3CRL C;  3NQI A;  4QCL A;  1EQV A;  2HIV A;  4JBW A;  3H0G H;  5M5X H;  5LMU L;  4DR7 Q;  3GTK H;  1SAP A;  5M3F G;  4IOC A;  3FRP B;  4JV5 L;  3S24 A;  3GTQ B;  3FVQ A;  4DV6 Q;  2F4I A;  4C2M B;  3S1Q B;  4DV1 L;  1FD7 D;  4OIJ A;  2VNU D;  1RCV D;  4X65 Q;  2F0N A;  2KHS A;  4MNO A;  3OMG A;  1KD1 C;  5DNF A;  1C4Q A;  1EWH A;  2D0P A;  1B50 A;  2A73 B;  1LM0 A;  1BR9 A;  2A68 D;  4X3T A;  1Q82 C;  2O5J C;  4K8J A;  4OL7 A;  1HZ9 A;  4KK7 A;  4O2D A;  1Y8N B;  2VW9 A;  1H95 A;  3L7Z C;  2UUB L;  2HQL A;  3RZD H;  2XGT A;  3KOJ A;  5JPN C;  1CHP D;  3LWU A;  1VQ4 A;  2AHO B;  2F0P A;  1K8G A;  1M8A A;  3KLR A;  5HUR A;  4JPB W;  1YZ6 A;  1QZG A;  1XPO A;  3NBH A;  2F0J A;  1W2B A;  1GUO A;  1I94 Q;  3AB9 A;  3NEM A;  3Q6S A;  4JOI C;  1NY4 A;  3PO2 B;  4CGY B;  1Y1W B;  1ET9 A;  1PV4 A;  3GTJ B;  4N8X 1;  5FOB B;  4ZQ3 A;  2VB2 X;  4N8F A;  1HR0 L;  2Y0S E;  4DV1 Q;  2E75 C;  5C3E H;  1K9M C;  3ULP A;  1STY A;  3R8B A;  1EU3 A;  2A5H A;  4IUN A;  5C44 G;  4HIO A;  1Y1W G;  1SMY D;  2K75 A;  1VF7 A;  2JA5 H;  1HA5 A;  3DM3 A;  3M85 A;  3IL8 A;  1F9Q A;  1R4P B;  1TXY A;  4BBR B;  1HTL D;  3HOW B;  2NZO A;  3BDC A;  3WOF A;  3RLO A;  1BF4 A;  1EIH A;  1LAB A;  3G6J B;  3MHB A;  1BOS A;  3HS0 C;  3I90 A;  1CKN A;  4ME5 A;  2R61 A;  1KLU D;  5T1I A;  3K5N A;  3CD6 A;  1TWF H;  1AZP A;  1G51 A;  3PO3 B;  3DUZ A;  4BA2 I;  3E9H A;  1XXG A;  3CC4 A;  2BH8 A;  3K80 C;  2OXP A;  2F1M A;  2TSS A;  5D3I B;  3RLF A;  4HIK A;  1B1Z A;  5FLX E;  1SFO H;  4P2C B;  1SND A;  1V9P A;  2BDN A;  2R7Z G;  3PUY A;  2JXM B;  3QJY A;  2KBN A;  3U50 C;  1PZJ D;  3CME A;  1WTV A;  4JI1 L;  3A5U A;  4QQB X;  1ZEQ X;  2J0T D;  2UXC L;  2IHF A;  4K8I A;  2NVT H;  4X64 Q;  2K50 A;  4L5Q A;  5FLX L;  2IJ0 A;  3J81 j;  3DWP A;  1BCP F;  1AFP A;  4IUR A;  4P72 A;  4LFC L;  3C3L A;  5I6W A;  5CC4 A;  4I7A A;  3A8I E;  4KD4 A;  1MGS A;  1L1O A;  3F8T A;  1KAA A;  2LFN A;  3C46 A;  2ZTC A;  3FKI B;  4HAE A;  4FF2 A;  1NMF A;  1Z6H A;  2VL6 A;  2F03 A;  3HOV H;  3AEV A;  4K2K A;  4C1N I;  4DV0 L;  4OO1 G;  4A3D H;  2RHQ B;  4AYB B;  2ZT9 C;  1S40 A;  3AQQ A;  1HNX Q;  2I46 A;  1Q81 C;  3KLS A;  3L3O C;  3WDN A;  4IUP A;  5M5Y B;  3GTM B;  1Q90 A;  2RCN A;  1XNR L;  3GTO H;  1U0L A;  1XTD A;  4QY7 A;  1G2T A;  4GN5 A;  5JVH 3;  4KMU C;  2ID0 A;  3S15 B;  3RLN A;  3BZD B;  4LMQ D;  1D8L A;  5IWA Q;  4A93 G;  3VR6 A;  4IJL A;  5C3E B;  1DD2 A;  4XTC S;  3ZJY C;  2WB1 G;  5TSS A;  3JAM c;  1S5D D;  1O78 A;  4O1N A;  3STB D;  1NTG A;  1XMQ Q;  1S5E D;  3O13 A;  4DR6 Q;  2CQA A;  3T4A C;  2IY5 B;  4JCV E;  1EY5 A;  2OEO A;  3DLL A;  2ES2 A;  2V1C C;  4JI2 L;  1EU4 A;  1ESF A;  1IL8 A;  1S5B D;  2K5D A;  5ELE A;  1BCP C;  3KF6 B;  2VB3 X;  3HOX G;  2QDL A;  1BNZ A;  2B3G A;  5IYC H;  4KY7 A;  4R9W A;  1ET6 A;  4JI0 Q;  3T1Y Q;  1ENA A;  4L63 B;  2H1E A;  4F7X A;  1DON A;  5F2D A;  1JOO A;  2M00 A;  1C9O A;  3P20 A;  1WTX A;  3M3Y B;  4X64 L;  1XMQ L;  2RCF A;  3CKI B;  1M1K C;  3K0X A;  1JWM D;  4DAY B;  3MTS A;  2D0O A;  2UXD L;  2KHJ A;  1BCP B;  1Q7Y C;  2ZM6 Q;  3M7G A;  3K5L A;  4KJO A;  4A3D G;  5CV5 A;  1IBK L;  4OWX B;  4APV A;  4DAP A;  4HSV A;  3A56 A;  2X6G A;  3KF6 A;  2P5Z X;  4YCW A;  1AZQ A;  1Q3L A;  2KJX A;  4A3C H;  1BQQ T;  2F0D A;  1EFW A;  2F0M A;  1EYA A;  2A19 A;  3C1F A;  1RJT A;  4DAM A;  4IO9 A;  1MKH A;  3GTQ H;  4PG3 A;  3M4Q A;  1E0B A;  2MO1 A;  2O2L D;  4DK6 C;  1TS4 A;  1GO3 E;  2IX0 A;  1RTO A;  3TZU A;  3CQZ H;  2NVQ H;  1J8I A;  1EY9 A;  4G4K A;  5COY A;  2AKW B;  5E7N A;  2O5I C;  5KNC A;  2CWA A;  4EQO A;  4JC0 A;  3P1H A;  3GDE A;  4DV4 Q;  5M3M H;  4DK3 C;  4NPS A;  2LY7 A;  5CBA E;  3VYU A;  4B9X A;  1ESR A;  3J7A V;  4PV1 C;  1NSN S;  4LJZ C;  1IHZ A;  1K0R A;  1OXU A;  2J7Z A;  3WWV A;  2YV5 A;  5KRU A;  1F9P A;  4KY6 A;  1PYS B;  4A3J G;  2EJF C;  4JOI A;  3T1H Q;  4MN3 A;  1ILP A;  4FO2 A;  3LWE A;  5D3D A;  2Z6K C;  4G7H C;  1L0W A;  4A93 B;  4GZY C;  3URY A;  1LT4 D;  4ZLT F;  1PVO A;  2G9D A;  4N9T A;  1UE7 A;  4WJ4 A;  1CHQ D;  4FDB A;  2F0L A;  2NYZ D;  4PZ8 A;  4R8I A;  4F8M A;  1HNW L;  4QIW B;  4H02 A;  1Y8P B;  1EYC A;  1XNR Q;  1MD2 D;  2A68 C;  5BR8 Q;  1DM0 B;  4B9W A;  4A4I A;  2KQ3 A;  4BS9 A;  2JN4 A;  1E24 A;  3IKJ A;  3NPP A;  2IX3 A;  4K2L A;  2Q8T A;  2ZTD A;  4BBR G;  2HCI A;  4ZUJ A;  3D3R A;  4DR6 L;  4IFD I;  3K58 A;  1JJ2 A;  2MUY A;  3HOZ G;  1QJO A;  3K0Y A;  3VA7 A;  2K28 A;  4OO1 H;  1I6V C;  1EFI D;  5CYU A;  1YNJ D;  2WB1 E;  3HOV G;  3MFG A;  1XYI A;  5NUC A;  3VR5 A;  2UUB Q;  3NTK A;  2PQA A;  1HXY D;  2F0G A;  1WD1 A;  3EJI A;  2BE5 D;  1QCB D;  2F4V Q;  1MSH A;  1JJC B;  2F0E A;  2R92 H;  2CH4 A;  5JJZ A;  4KI0 A;  3A8K E;  2VZA A;  4L5T A;  1SNC A;  1TKW B;  1L1O B;  4A3B G;  4BBS B;  2RBM A;  1SMY C;  3RNU A;  2B2W A;  2NN6 G;  2WV6 D;  5FLM G;  4OHJ A;  4G7O C;  3UI2 A;  1NR4 A;  5G3L F;  4A3L H;  1PH6 A;  4KLK A;  5M3M B;  1X3G A;  2NTT A;  2B39 A;  4DR1 Q;  1CQF A;  3KDF B;  2AQ1 B;  4IJH A;  1YVC A;  5CV6 A;  5A2Q L;  1EYG A;  5LMN W;  1E7Z A;  5J39 A;  4HMI A;  1Q1B A;  5C0X J;  3SK4 A;  3I72 A;  3HKS A;  3EA6 A;  4JI8 Q;  2QKI C;  4CJ1 B;  4YWM A;  4HR7 B;  2H5X A;  5CV8 A;  1B70 B;  2JA6 G;  4WJW A;  1HNZ Q;  3CCM A;  4RKL A;  1B7Y B;  2K14 A;  3SK5 A;  3GP7 A;  2JQO A;  1Q1E A;  4DNR B;  1BXT A;  2Z1C A;  5IP7 G;  4KD3 A;  5IGD A;  2B8G A;  3VA5 A;  1I50 B;  4A3I B;  2UXB L;  3K7U C;  2B2T C;  1X32 A;  5IYD H;  4HSP A;  1Z9F A;  2VQF Q;  2WAC A;  5D65 A;  1LUZ A;  3KF8 B;  4IAL A;  3HOU H;  1KHI A;  3PF5 A;  1X9N A;  3GTP H;  5C3E G;  3A54 A;  3SVM A;  1GXD C;  4NXM L;  2EY6 A;  3CC2 A;  4ABN A;  4RGM A;  4UPA A;  5HY6 A;  2HHH L;  1XJV A;  3T13 A;  1SNM A;  2N49 A;  3BS1 A;  2RQX A;  2QGQ A;  3OWE B;  2K5H A;  3TQY A;  4RHS A;  1KLG D;  4YCV A;  4C3I H;  4XIG S;  1Q86 C;  4A3E H;  2IPK D;  1SE3 A;  3BJU A;  4JVZ A;  1P8L A;  1KQS A;  3OPO A;  3H91 A;  5I9P A;  2CVR A;  5CGK A;  2A8V A;  2JA9 A;  3HKZ G;  2E2J B;  3SE0 A;  3NBH B;  1DZ1 A;  1V1P A;  2WFW A;  4DV0 Q;  4A3D B;  1AN8 A;  3S2D B;  2V4D A;  1AE2 A;  3FKI H;  3QR8 A;  2R7D A;  1ZKO A;  1K3B C;  1TWH H;  5KND A;  1EZ8 A;  2FJ2 A;  3GTO B;  1GUS A;  4R1J A;  1HZC A;  3PGZ A;  1MIU A;  1SE4 A;  4J15 A;  3U58 A;  4OON A;  1TQO A;  1KDC A;  5C0X H;  5K36 G;  1EOV A;  4C3H B;  3ER0 A;  3HOV B;  3H0G G;  1SDF A;  5DLQ E;  2EYF A;  1JQY D;  1A6X A;  1OTC A;  1B3A A;  2I5L X;  1STB A;  2ZJR A;  3BVM A;  1R9T B;  5J1Z A;  2ZXO A;  2JSO A;  4POF A;  2Z6B A;  4A76 A;  2E2H H;  1VQA A;  3CCV A;  3R2I A;  3NEL A;  2PMZ E;  4R4T A;  2MPM A;  5K36 H;  2RDF A;  4RG1 A;  2RHS B;  2L12 A;  2HQE A;  4ZRZ A;  1KL9 A;  3G48 A;  1C0A A;  1TWF B;  1AW7 A;  4IFD J;  2SNM A;  2Y0S B;  4JBM A;  1NUC A;  1FNU A;  3IFT A;  4HJ8 A;  1HNZ L;  3R2T A;  4CKB A;  1EY6 A;  1F2Z A;  4POG A;  4GKJ Q;  1CKM A;  2SDF A;  3DEP A;  3L2P A;  1VQO A;  4RGN A;  2GA4 B;  3GD7 A;  4GNX B;  3PO3 H;  1SE2 A;  5ELD A;  1N8R C;  2PQA B;  4HID A;  2UXD Q;  1YNX A;  4L6T B;  1E22 A;  3FHW A;  2SNS A;  5HGT A;  1UAP A;  2KUM A;  4RFB A;  3HOW H;  3K6O A;  1ENF A;  2XNA C;  1UNS A;  3J80 L;  5EKI A;  3W5O A;  3QOJ A;  3PMF A;  5ELF A;  3CMA A;  3CW2 C;  1PH5 A;  3EBE A;  1I5F A;  5C4X G;  2XN9 C;  1HQR D;  2N8N A;  1GM5 A;  1F2L A;  1PZK D;  2DJF C;  3EN2 A;  4DV5 Q;  4NXN L;  3S14 B;  3UDX A;  4LF9 Q;  2EPB A;  2E5L Q;  4JI7 L;  3HP3 A;  1S5C D;  1PFM A;  4ZKC B;  2L9H A;  3NTH A;  3CU7 A;  5KNB A;  1C48 A;  1KNA A;  1HR0 Q;  3IAY A;  5EGT A;  2EY5 A;  2K4K A;  3RMH A;  4A3K B;  2FFK B;  2B2Y A;  3PO2 H;  1HTP A;  1RF2 D;  1ROD A;  2A6E D;  5EBD A;  4K6D A;  5IP7 H;  4LF6 L;  4EQN A;  3QB3 A;  1YI2 A;  2NBF A;  1IBL Q;  4LFB L;  2D2C C;  1VQG A;  1WOC A;  4CDF C;  3BVZ A;  3T53 B;  1RL2 A;  2AWO A;  4IPG A;  1YHB A;  1H9S A;  1HR0 W;  1QE6 A;  2EQS A;  1D2B A;  3ITP A;  2KEC A;  5LHY 1;  1PH9 A;  2E2D C;  4JI1 Q;  2MJ8 A;  1GHK A;  1VQ8 A;  3S1M B;  1D7Q A;  2X6L A;  1SBB B;  1VF5 C;  2O4X A;  1LTL A;  5C3X A;  2HHH Q;  1LT6 D;  1EEI D;  2Q8R E;  3D4D A;  4CJ2 C;  4EQP A;  4RMF A;  2JJQ A;  5IGB A;  2RDG A;  2A6H D;  4X6A H;  2TMP A;  4OWW B;  1A15 A;  3EVQ A;  3QOL A;  2PPB C;  3J81 E;  2NWG A;  3EQL C;  5M9O A;  3HRZ C;  4C2M H;  3NSW A;  2EXD A;  1SYD A;  4BA1 I;  3MFY A;  1A2U A;  4EGV A;  4LFA Q;  1X3E A;  4CKC A;  2CFM A;  2DGY A;  4IPC A;  1K8M A;  4MTN A;  4UY8 C;  3S1N H;  3S17 B;  4BBS G;  5J22 A;  3W1G A;  1H9K A;  3CP0 A;  3I56 A;  1CK1 A;  3I3C A;  3RN5 A;  5EPK A;  2SEB D;  3DMU A;  4H7B A;  2Z8L A;  2Q2U A;  1Y14 B;  2F0I A;  2OQK A;  2D5D A;  1FGU A;  5COR A;  4OXP A;  2RSO A;  1G8Z D;  1WTW A;  2R3Z A;  1DJR D;  1CA6 A;  4LFB Q;  4JI3 L;  4RAU C;  1VQ5 A;  2KOL A;  3ICE A;  1RDP D;  4YWK A;  1I3Q H;  4L5R C;  2K33 A;  4A3F G;  4FYD A;  1VS0 A;  3VR2 A;  1N34 L;  1XWE A;  1O7I A;  5DAU A;  1WTR A;  1X55 A;  1A63 A;  1GHJ A;  3M3Y H;  1JOK A;  1U4M A;  1B4O A;  2B2U A;  3GTL B;  3J7A F;  2C5C A;  3S1M H;  1IYV A;  4NW2 A;  3I8Z A;  5LMN L;  4OX9 Q;  4C3J H;  3HOY H;  1KDA A;  1HRJ A;  5C4Z A;  3JAM E;  1TT2 A;  4LUZ A;  2F0U A;  3A55 A;  5JJK A;  1PFN A;  3NBI A;  4XYO A;  4PMB A;  3SGI A;  1VDZ A;  1ONL A;  4ME3 A;  1U9R A;  3VYT A;  2L0C A;  3NE5 B;  4JI5 L;  5BN4 A;  3OMC A;  2D9U A;  3P7J A;  3B6Y A;  2MQH A;  2LMC B;  3ND8 A;  1U4R A;  4X3S A;  1E2Z A;  3UDF A;  3NK9 A;  3RR5 A;  3S15 H;  1R4Q B;  2BH2 A;  1HQM C;  4ZUI A;  4LF8 L;  4A3B H;  2WAQ G;  3IFD A;  5M5Y H;  3RZO H;  4G57 A;  3K7A B;  1A3U A;  2VQF L;  4J1M A;  4FF1 A;  4CJ0 B;  1MSG A;  2A1A A;  3U9S A;  1LTR D;  4LFC Q;  3DWQ A;  2R92 G;  3SDZ A;  1S3O A;  4C3I G;  1YHQ A;  3T51 B;  2FHT A;  1EY4 A;  5JEA G;  4TVA B;  5I9O A;  3S14 H;  3SR1 A;  4AQY L;  4GOP C;  1G6P A;  5EBC A;  1ICF B;  3JAM L;  2JA6 B;  2FMM A;  4IPH A;  4P75 A;  4G7Z C;  2Y0S G;  5JOB A;  5EKK A;  3BVG A;  4R4O A;  1TS2 A;  3DXJ C;  2JA8 B;  1N32 Q;  2QW7 A;  4DR7 L;  4NKL A;  2LXK A;  2NVT B;  3T56 B;  3I70 A;  1B2T A;  2JK8 A;  1SLJ A;  2ICE C;  1Y1V B;  5C4J B;  1OXS C;  1M4V A;  2K32 A;  1F9R A;  2UUA L;  2YTV A;  2PI2 E;  2RKS A;  1XMO Q;  1UE6 A;  1BUV T;  1UEB A;  1X3Q A;  1SFO B;  1HA6 A;  2EDG A;  5ELC A;  4AYB G;  1AH9 A;  1PTO F;  1KRT A;  2PQE A;  1VMP A;  3D31 A;  4JI3 Q;  2OTJ A;  1WVL A;  3H3V I;  3TBI B;  4GNX C;  3H6M A;  4YHH L;  5FLM H;  1IBK Q;  3H15 A;  2E2H B;  3A5Z B;  3T16 A;  4LF4 Q;  4OWT B;  5IGE A;  1O7L A;  4X3K A;  2EOT A;  5KEE A;  1S72 A;  4ZCK A;  1CM9 A;  2OQ0 A;  1OXT A;  4RH6 A;  4DV3 L;  3TN2 A;  5GQO A;  1XMO L;  1JOQ A;  4K0K L;  1GD7 A;  3M4O H;  2MO0 A;  1ML0 D;  1BO0 A;  1HCZ A;  3KBG A;  2OT2 A;  3VR4 A;  3BU2 A;  2NUC A;  1D5M C;  1SNP A;  3KLS X;  2Q2I A;  2EYP A;  1R9T H;  1VQ7 A;  4ULL A;  1YJ9 A;  1LO5 D;  4DR4 Q;  5HGQ A;  1E1T A;  3HOX H;  1TWH B;  2VUM H;  1T9H A;  1V43 A;  3QWN A;  4UAI A;  1EY0 A;  1JR0 D;  1YIJ A;  3OSO A;  2WP8 J;  2EYM A;  4PMC A;  4DR3 L;  3J7A 5;  4RKB A;  2PW5 A;  2ZJQ A;  2ALY B;  2B2U C;  2I07 B;  4YWL A;  2NVX H;  3BG3 A;  4ZK9 B;  1Y1W H;  2Z9H A;  4HN7 A;  4CBV A;  3A0J A;  5BN3 A;  4A3M B;  5JJI A;  1B8A A;  1O7Z A;  3CHB D;  1TWA H;  1DOL A;  3W3A A;  4Q0F A;  4X62 Q;  3S2D H;  1RHP A;  2Z0S A;  1EWC A;  5I6Y A;  1MJC A;  4HJA A;  2VUM G;  1FNW A;  4UP7 A;  3SXH A;  2SOB A;  4H44 C;  1V1P B;  3I4N B;  1NE3 A;  3RZD B;  5EQ0 A;  1H9J A;  2KVM A;  2R93 G;  2WKC A;  3M4P A;  3K5O A;  5EPL A;  4AH6 A;  1VQN A;  4TKO B;  3F1Z A;  5C5M A;  3J7Y W;  1FYC A;  2WB1 B;  3UE0 A;  4NMZ A;  1GUW A;  5IIF A;  3TS0 A;  2QEX A;  4R4C A;  2VUM B;  5FK9 C;  4X65 L;  2N3S A;  4DF7 A;  4P73 A;  3QIA A;  5JEA J;  3AFP A;  4DNI A;  3S1Q H;  4KHP Q;  2JYO A;  4DV3 Q;  1VMC A;  4LF7 L;  2F0Q A;  4V0B A;  3CRK C;  2LSS A;  1PTO C;  4BWG B;  1EQQ A;  4GOP A;  2CH4 W;  2WIN B;  5M5X B;  1QNU A;  2CKZ B;  2JA7 G;  3BYT B;  5LL6 X;  3HOU B;  5CBE E;  3F2D A;  3K57 A;  2UU9 Q;  4KV6 A;  5AJ3 L;  3SK6 A;  2NVY H;  1FJG L;  1XNQ Q;  3DM1 A;  1JJG A;  1A2T A;  1G2S A;  1A3V A;  4KY5 A;  2UUC L;  2PNH A;  3VDY A;  3KJP A;  3I4M B;  1Q8I A;  4OEM B;  4A3I H;  5M3F H;  1WTP A;  4HJ9 A;  5C5L A;  2UXC Q;  1K0S A;  3EIV A;  2EXZ A;  5C6A A;  3LGJ A;  3D0F A;  4A3G B;  1KIX A;  1L0X B;  3W2D A;  1FGB D;  2K05 A;  1HFN A;  3MXU A;  3OOC A;  2XSC A;  1FJG Q;  1PZI D;  4RGO S;  1EWI A;  4BBS H;  3FPP A;  1IXR A;  3Q24 A;  1YBY A;  5FO7 B;  4LFA L; 
#chains in the Genus database with same CATH homology
 4RG1 A;  2RHS B;  2AMC B;  4GLX A;  1BVS A;  1KL9 A;  3OTO Q;  1VQ9 A;  1IZ6 A;  3J81 i;  3G48 A;  5C44 G;  4HIO A;  1C0A A;  1Y1W G;  1NBW A;  4IFD J;  1MJE A;  2K75 A;  4JBM A;  4JI2 Q;  2JA5 H;  3DM3 A;  3JAM i;  3M85 A;  4DR5 L;  1WYD A;  2VQE L;  4B3M L;  4A3C G;  4HJ8 A;  3UDI A;  4DR2 Q;  1HNZ L;  1TXY A;  2NN6 I;  5IE8 A;  2NZO A;  3RLO A;  4EQ5 A;  1KC8 C;  1PH7 A;  3PUV A;  4POG A;  1CKN B;  3J80 c;  4GKJ Q;  1Q8K A;  2VY3 A;  1CKM A;  3L2P A;  3A74 A;  4JBJ A;  1KRS A;  1VQO A;  1L2F A;  2R7Z H;  3GD7 A;  1C7Y A;  4GNX B;  3PO3 H;  3HOW G;  4KHP L;  4P71 A;  4A3J H;  4R4Q A;  1N33 L;  1CKN A;  4UP9 A;  1N8R C;  2PQA B;  4HID A;  1TWF H;  3CD6 A;  1G51 A;  4JYA L;  2UXD Q;  4JV5 L;  1YNX A;  4JI6 L;  4BA2 I;  3E9H A;  4JI7 Q;  1E22 A;  1HNX L;  3HKZ E;  1PA6 A;  3CC4 A;  2BH8 A;  4BXX H;  1RIP A;  2N78 A;  3FHW A;  3K80 C;  2OCE A;  1JE5 A;  1WI5 A;  3G4S A;  2B29 A;  2L15 A;  3RLF A;  4HIK A;  3HFZ B;  5IYC G;  1SFO H;  4X62 L;  2K5V A;  3FKI G;  3HOW H;  1V9P A;  2R7Z G;  4QIW E;  3PUY A;  3W5O A;  4EX5 A;  2BA0 A;  3CXC A;  5M5W H;  3CMA A;  3PV0 A;  3CW2 C;  3T1Y L;  1PH5 A;  2KBN A;  3U50 C;  3EBE A;  5M3M G;  3CME A;  4LUV A;  4JI1 L;  3A5U A;  4QQB X;  1I5F A;  5C4X G;  1JB7 A;  2N8N A;  1QZH A;  4WJ3 M;  5GAG C;  3OTO L;  1GM5 A;  2UXC L;  4GNX A;  3EN2 A;  2IHF A;  4DV5 Q;  2NVT H;  4NXN L;  4X64 Q;  2EIF A;  1IYJ B;  4LF8 Q;  4A3F H;  3PO2 G;  2K50 A;  4L5Q A;  3BZC A;  3UDX A;  3J81 j;  5EAY A;  4LF9 Q;  1N36 L;  1PH4 A;  4A93 H;  1WJJ A;  5C44 H;  1VQF A;  2E5L Q;  4P72 A;  4JI7 L;  1EUJ A;  2E5L L;  4LFC L;  5BR8 L;  1XPU A;  1PH2 A;  5AJ3 Q;  3GTL H;  1HR0 Q;  2GN5 A;  3ULP A;  3OW2 A;  2K4K A;  1L1O A;  3F8T A;  1Q12 A;  3PO2 H;  2ZTC A;  4X66 L;  3K81 C;  1PH1 A;  1NMF A;  5IP7 H;  4IPD A;  4LF6 L;  3MEF A;  3CCJ A;  2VL6 A;  3HOV H;  5ELN A;  2Z6K A;  3AEV A;  1BBW A;  1UWV A;  1YI2 A;  1I6H H;  4DV0 L;  4OO1 G;  1IBL Q;  4A3D H;  4LFB L;  2RHQ B;  1VQG A;  5J3B A;  1IBM Q;  1WOC A;  1S40 A;  3AQQ A;  4DUZ Q;  1HNX Q;  1Q81 C;  4YHH Q;  1RL2 A;  2K5N A;  2AWO A;  4IPG A;  1YHB A;  4DUY L;  1HR0 W;  1J6Q A;  2RCN A;  1XNR L;  3GTO H;  1U0L A;  1XTD A;  1XNQ L;  4A3G H;  4QY7 A;  4JV5 Q;  1SRO A;  2EQS A;  4GN5 A;  4Y7N H;  4A3I G;  3STB C;  2ID0 A;  4LUO A;  3RLN A;  1PH9 A;  1D8L A;  5IWA Q;  2IX1 A;  1WCM H;  2KHI A;  4A93 G;  4JI1 Q;  4IJL A;  4AQY Q;  4L5S A;  4XTC S;  1VQ8 A;  3ZJY C;  2UUA Q;  2WB1 G;  3JAM c;  1EIF A;  3UE1 A;  5C0X I;  4B3R Q;  2QA4 A;  3STB D;  1K73 C;  1D7Q A;  1SMX A;  1NTG A;  1XMQ Q;  1ASY A;  4DR6 Q;  1LTL A;  2HHH Q;  2KCM A;  2IY5 B;  3W1B A;  1UE5 A;  4LF5 L;  4RMF A;  2JJQ A;  4JCV E;  2RF4 A;  5C4X H;  3H3V H;  3TRZ A;  4X6A H;  3CCU A;  1VQ6 A;  3DLL A;  1IBM L;  2KCT A;  2ES2 A;  3I4N H;  2V1C C;  4JI2 L;  4OWW B;  1BBU A;  4A3L G;  1N32 L;  3TEH B;  4DV7 Q;  4C2M H;  3KF6 B;  3HOX G;  4GLV B;  2EXD A;  2B3G A;  4C3H H;  5IYC H;  4BA1 I;  2FXQ A;  4JI4 L;  4JI0 Q;  4AYB E;  3I7F A;  2GVA A;  3T1Y Q;  4LFA Q;  1X3E A;  2CFM A;  1YHA A;  2DGY A;  4A3M H;  4IPC A;  2E2J H;  1HZA A;  4BY7 H;  1C9O A;  4MZ9 A;  4MTN A;  2CCZ A;  4DKA C;  4UY8 C;  1BKB A;  4A3G G;  1WFQ A;  4X64 L;  1XMQ L;  2I5H A;  1IBL L;  3S1N H;  4OO1 I;  1A62 A;  1M1K C;  3K0X A;  3CCS A;  4LF5 Q;  3PO3 G;  3W1G A;  4DAY B;  4BBS G;  2NZH A;  1QUQ B;  1VQD A;  2D0O A;  2KHJ A;  3CP0 A;  1Q7Y C;  1VQH A;  4GS3 A;  2ZM6 Q;  2UXD L;  3I56 A;  2JE6 I;  2R93 H;  4A3D G;  1YJW A;  1G29 1;  3HOY G;  1IBK L;  4Y52 H;  3J81 c;  3CCQ A;  4OWX B;  3PF4 A;  4APV A;  4DR4 L;  3RN5 A;  3I4O A;  2WAQ E;  4A75 A;  1QUQ A;  3KF6 A;  4YCW A;  2JEB I;  1VQC A;  4A3C H;  5IWA L;  2Q2U A;  1Y14 B;  1EFW A;  1VQP A;  5GAD C;  4A3K G;  1EQR A;  4GOP B;  2A19 A;  4HIM A;  2OQK A;  4DAM A;  1QVC A;  1FGU A;  4OXP A;  5C0X G;  4IO9 A;  1MKH A;  3GTQ H;  4PG3 A;  3M4Q A;  2ASB A;  2XTI A;  4YY3 Q;  2MO1 A;  4LFB Q;  4GN4 B;  4JI3 L;  3G71 A;  4DK6 C;  3UDG A;  2I5M X;  2HT1 A;  1VQ5 A;  4JI6 Q;  1J5E L;  1I94 L;  3ICE A;  1GO3 E;  2IX0 A;  4YWK A;  1I3Q H;  4L5R C;  4A3F G;  3PUX A;  3CQZ H;  1VS0 A;  4DR2 L;  2NVQ H;  3S2H H;  5E7N A;  2AKW B;  1N34 L;  4QGU A;  1XPR A;  2CWA A;  1O7I A;  2F3I A;  4LWC A;  5IYB G;  3T1H L;  4JC0 A;  1X55 A;  1JMC A;  4JI4 Q;  1A63 A;  3M3Y H;  3GDE A;  4DV4 Q;  5M3M H;  4DK3 C;  4A3K H;  3GTM H;  1VCI A;  3S16 H;  1TWG H;  4YCU A;  2HIX A;  3ERS X;  3G6E A;  4NXM Q;  3S1M H;  4X66 Q;  3K8A A;  5LMN L;  2I0Q A;  3HOZ H;  4B3R L;  4NPS A;  4DR3 Q;  4OX9 Q;  4DPG A;  4C3J H;  1VQM A;  4DV5 L;  4B3S L;  3HOY H;  1Z47 A;  4PMW A;  1PYB A;  2LXJ A;  4JYA Q;  2E8G A;  4LUZ A;  4LF9 L;  5JJK A;  2Q2H A;  2YTX A;  3SGI A;  1K0R A;  1OXU A;  5IT9 c;  3WWV A;  4GKK Q;  2YV5 A;  1UE1 A;  2IHE A;  3BZK A;  2BA1 A;  5IP9 G;  4A3E G;  4ME3 A;  1ASZ A;  2R6G A;  1PYS B;  3J7Z C;  4A3J G;  1W3S A;  4JOI A;  3T1H Q;  1GVP A;  3S1R H;  4K0K L;  1X54 A;  1I50 H;  4JI5 L;  5C4J H;  4DV2 Q;  1VQL A;  4JI5 Q;  2R7F A;  4GKJ L;  4IOA A;  3B6Y A;  2MQH A;  2Z6K C;  5JJL A;  1L0W A;  3CCE A;  1X56 A;  3UDF A;  1NMG A;  1PVO A;  1X65 A;  3RR5 A;  3S15 H;  1UE7 A;  1L1O C;  2BH2 A;  1KAW A;  4WJ4 A;  4LF8 L;  4NXN Q;  2B63 H;  4A3B H;  1A0I A;  4FDB A;  4HJ7 A;  4PZ8 A;  2WAQ G;  2JA8 G;  1HNW Q;  3PUZ A;  1HNW L;  5M5Y H;  3RZO H;  1VQB A;  4H02 A;  2VQF L;  4GKK L;  2A1A A;  4LFC Q;  2R92 G;  2IT1 A;  1XNR Q;  5BR8 Q;  3M7N A;  2OWO A;  2OTL A;  1QVF A;  1S3O A;  4A4I A;  4ALP A;  4BY1 H;  1YHQ A;  4LF4 L;  5JEA G;  1WCM G;  1E24 A;  4TVA B;  5IYD G;  4DV2 L;  4JI0 L;  3S14 H;  2UUC Q;  4AQY L;  4HJ5 A;  4O0A A;  2ZTE A;  4GOP C;  1G6P A;  2ZTD A;  4BBR G;  3E0E A;  4DR6 L;  4IPH A;  3OYY A;  1VQI A;  4P75 A;  4IFD I;  1JT8 A;  1JJ2 A;  2F52 A;  2Y0S G;  3K7A H;  2YYZ A;  3HOZ G;  1Y1V H;  4R4O A;  1CSQ A;  1FL0 A;  2DUD A;  3CC7 A;  1N36 Q;  3CCR A;  1N32 Q;  4DUY Q;  3ULJ A;  4DV7 L;  2WB1 E;  3HOV G;  4DR7 L;  1E3P A;  3E9I A;  1U5K A;  2LXK A;  2UUB Q;  2PQA A;  5IY0 A;  1QVG A;  3U4V A;  2JEA I;  3KFU A;  3NEN A;  2JK8 A;  4BBR H;  1A8V A;  1SLJ A;  2YTY A;  3KDF A;  1OXS C;  2VS1 A;  1OXV A;  4QL5 A;  2F4V Q;  2F4V L;  2UUA L;  2YTV A;  3GTJ H;  1JJC B;  2PI2 E;  2MNA A;  1N33 Q;  4BY7 G;  4GN3 B;  4B3S Q;  1XMO Q;  1UE6 A;  3GTG H;  4LF6 Q;  1UEB A;  2R92 H;  4JBK A;  4KI0 A;  4AYB G;  4YY3 L;  1YJN A;  1AH9 A;  1KRT A;  2VZA A;  3D31 A;  4L5T A;  4JI3 Q;  2ZJP A;  1CUK A;  2OTJ A;  3H3V I;  1IL2 A;  2JA8 H;  1L1O B;  1Q46 A;  4GNX C;  4A3B G;  4YHH L;  2B63 G;  5ELO A;  5FLM H;  3RNU A;  1IBK Q;  3PIP A;  2NN6 G;  5FLM G;  3H15 A;  3A5Z B;  3I4N G;  4LF4 Q;  4A3L H;  4OWT B;  4LW1 A;  2JA6 H;  3I55 A;  1PH6 A;  1GKH A;  4KLK A;  3TS2 A;  1X3G A;  4DR1 Q;  3CF5 A;  1S72 A;  2Q2T A;  3PSI A;  3KDF B;  1SN8 A;  2OQ0 A;  4IJH A;  1YVC A;  1OXT A;  1EYG A;  4DV3 L;  4GLA C;  5GQO A;  1E7Z A;  3PUW A;  5LMN W;  1XMO L;  4LF7 Q;  1GD7 A;  4IFD G;  1CSP A;  1Q1B A;  1HH2 P;  1K3R A;  5IP9 H;  2MO0 A;  5C0X J;  3GO5 A;  3M4O H;  4A3M G;  3HKS A;  1J5E Q;  4JI8 Q;  3ULL A;  4KHZ A;  3J80 i;  4B3T Q;  3BU2 A;  4B3T L;  2Q2I A;  1P16 A;  4YWM A;  4PZ7 A;  2H5X A;  1R9T H;  1B70 B;  1VQ7 A;  2JA6 G;  1YJ9 A;  4DR4 Q;  5HGQ A;  2AWN A;  1E1T A;  1HNZ Q;  2YU9 H;  3M9B A;  3HOX H;  3AYH B;  3CCM A;  1PH3 A;  1B7Y B;  2VUM H;  1PHJ A;  1T9H A;  2K14 A;  4DV6 L;  3Q8D A;  1V43 A;  2K52 A;  1VQE A;  1Y1V G;  2JQO A;  3I4M G;  3CPW A;  1Q1E A;  1YIJ A;  2WP8 J;  5LMN Q;  1X3F A;  5IP7 G;  5IYB H;  4DR3 L;  4OX9 L;  3J7A 5;  2ZJQ A;  3HOU G;  1PFS A;  1X6O A;  2UXB L;  3K7U C;  2ALY B;  3IRB A;  4K0K Q;  1LYL A;  2CQO A;  4YWL A;  1PH8 A;  5IYD H;  1FVI A;  1VQJ A;  4DUZ L;  2NVX H;  1Z9F A;  2D62 A;  4JI8 L;  1Y1W H;  4DR5 Q;  4BY1 G;  2VQF Q;  5LMU Q;  1V1Q A;  3A0J A;  5GAH C;  1LUZ A;  2MFI A;  3KF8 B;  5JJI A;  1B8A A;  1TWA H;  2GVB A;  3PCO B;  1E1O A;  3HOU H;  3FP9 A;  3F2B A;  1HZB A;  4X62 Q;  4DV4 L;  3S2D H;  1KHI A;  3PF5 A;  2Z0S A;  1X9N A;  3GTP H;  5C3E G;  2ATW A;  4DR1 L;  3I4M H;  3F2C A;  3I2Z A;  3L0O A;  4NXM L;  1MJC A;  3KYH C;  4TQU S;  3PIO A;  4HJA A;  1CKO A;  3CC2 A;  1K8A C;  2VUM G;  4UP8 A;  4UP7 A;  1YEZ A;  4JG2 A;  3S17 H;  4UPA A;  5HY6 A;  2HHH L;  1NE3 A;  2UXB Q;  5GRO A;  1XJV A;  2N49 A;  5FLX c;  1NJI C;  4LNQ A;  1AE3 A;  2R93 G;  3M4P A;  2QGQ A;  4P74 A;  2HIV A;  3RN2 A;  4AH6 A;  4QJF A;  2K5H A;  4JBW A;  3H0G H;  3TQY A;  5M5X H;  5LMU L;  4YCV A;  2VQE Q;  4B3M Q;  1VQN A;  4DR7 Q;  3GTK H;  3F1Z A;  1KXL A;  4C3I H;  1SRU A;  3AFQ A;  5M3F G;  1N34 Q;  3UE0 A;  4IOC A;  4XIG S;  1Q86 C;  2CWP A;  2KEN A;  2C35 B;  3BJU A;  4NB3 A;  3S24 A;  4DV6 Q;  4A3E H;  1EIY B;  1P8L A;  3TS0 A;  1KQS A;  1K83 H;  4R4C A;  4AIM A;  2QEX A;  4DV1 L;  2VNU D;  4X65 L;  2N3S A;  2PI2 A;  4X65 Q;  4P73 A;  3KJO A;  5JEA J;  2A8V A;  2JA9 A;  4R4I A;  3HKZ G;  3AFP A;  4MNO A;  3MXN B;  4DNI A;  3S1Q H;  3NBH B;  1KD1 C;  4DV3 Q;  4KHP Q;  4LF7 L;  1TWC H;  3JC6 6;  2LSS A;  2D0P A;  1EQQ A;  4GOP A;  1LM0 A;  2WFW A;  4DV0 Q;  2JA7 H;  2CKZ B;  1Q82 C;  2ZM6 L;  2JA7 G;  1YIT A;  1HZ9 A;  4O2D A;  3F2D A;  2UU9 Q;  2VW9 A;  1H95 A;  3L7Z C;  2UUB L;  1AE2 A;  5AJ3 L;  3FKI H;  1DGS A;  2HQL A;  2R7D A;  2NVY H;  3RZD H;  1FJG L;  1TWH H;  1XNQ Q;  2XGT A;  3CPF A;  3KOJ A;  1JJG A;  4BXX G;  4R1J A;  1HZC A;  1VQ4 A;  2AHO B;  1K8G A;  2UUC L;  3PGZ A;  1MIU A;  3U58 A;  4J15 A;  1N9W A;  2PNH A;  3U4Z A;  3VDY A;  3KJP A;  4OON A;  4PZ6 A;  4A3I H;  1YZ6 A;  5M3F H;  4HJ9 A;  5K36 G;  1EOV A;  3KLW A;  1QZG A;  5FJ8 H;  3ER0 A;  1XPO A;  3H0G G;  2UXC Q;  1SR3 A;  3CAM A;  5DLQ E;  1W2B A;  3EIV A;  2E2I H;  1I94 Q;  3NEM A;  4JOI C;  5GAE C;  1OTC A;  1NY4 A;  3TRE A;  1M90 C;  2I5L X;  1SE8 A;  3LGJ A;  5H1S E;  3D0F A;  1KIX A;  1HJP A;  2ZJR A;  2UU9 L;  1PV4 A;  1VQK A;  4POF A;  4A76 A;  3CCL A;  1FJG Q;  1HR0 L;  2E2H H;  2Y0S E;  4DV1 Q;  1EWI A;  1VQA A;  3CCV A;  4BBS H;  5C3E H;  1IXR A;  2JA5 G;  1OXX K;  3NEL A;  1YBY A;  1K9M C;  2PMZ E;  4R4T A;  5FJ8 G;  4LFA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...