4JBWA

Crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbon catabolite repression of the maltose transporter revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Maltose transport system permease protein MalF
total genus 78
structure length 370
sequence length 370
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4jbwA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jbwA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jbwA01
1XXHA 2GXAA 3K9NA 2ZQ5A 4MRSA 2Q3HA 4O2DA 1YI2A 1UFQA 2A78A 3HOXH 3OFND 2EU8A 3K81C 4ESHA 1C7YA 2BDTA 4L4UA 1SVWA 1FGUA 4KFRA 1VQLA 2BKEA 1RYFA 1CU1A 2LSSA 1KJZA 1ZIPA 3AP3A 3A74A 4I7ZC 1E7ZA 1VQMA 2E2IH 1A4RA 1Z6TA 2B8WA 3NH6A 4PSAA 1RRCA 6Q21A 1D5CA 3Q9LA 4R2IA 4W7SA 2YWFA 3K70B 4D25A 5JEAJ 2OHFA 5CB8A 3GTPH 3EW9A 3I5XA 3KQKA 3G71A 5FOVA 1Q0UA 3BC1A 5CDFE 4MDEA 4FI3C 3T61A 4GNXA 1VQBA 1GDDA 1E6CA 3KKNA 3A8JE 3GLIA 1XMQL 1FTSA 2GXUA 5J4HA 1QZXA 1UAAA 3OTOQ 2VH5R 4R7ZA 1QJOA 1II9A 4E22A 3A4LA 1HR0W 3B1ZA 2GZHA 5LMNQ 1E1QD 1XNJA 2IT1A 4HJ8A 1IY1A 2CDNA 4AQYQ 3S2DH 1EYGA 1KHIA 1NP6A 3TAUA 4EPTA 4JI4Q 4M1OA 4BFWA 4TLDA 2O5IC 1C0AA 5IYBG 3DZ8A 1TXYA 4QJ5A 3KUCA 3AF2A 2W0MA 1Q12A 4BLOA 1V43A 1VQ5A 4BFZA 4A8JC 1IW7D 3DXJC 5DE3A 3ERSX 4XIGS 3GO5A 5GAEC 4DB2A 2J59A 2ASEA 4GMXA 4DJTA 2XXAB 3HGBA 2GILA 2OM2A 1IBMQ 2HV8A 2WIAA 2J0SA 5FJ8H 2ZJOA 2ZSAA 3ZZTA 2ZUBA 2OFWA 4P75A 2VS1A 1IQPA 1E98A 4JT4A 1B0UA 1OHHD 1XPUA 1ZJ6A 5FUWA 5FPTA 2D7CA 3IIMA 3FP9A 2A8VA 3NBXX 5E7IA 3TVDA 4G3XA 2K75A 4JI1L 5HGQA 1WXQA 2ZTEA 2QZ4A 2VSFA 4GNKA 1D8TA 4X8LA 2DB3A 2GAAA 2HEIA 3UXMA 1KI8A 2WICA 4X6AH 4JSTA 2WWIA 2ATWA 5JRJA 2QG6A 1Z0FA 3GDEA 1Q90A 2F43A 1TAGA 2Q2IA 2RHSB 4DUZQ 1VQ7A 2FMXA 2K32A 1QVAA 3C16C 4FMDF 2ANBA 2VO1A 1H8EA 1I2MA 3FE2A 4H1UA 5FH9A 2B92A 1K8MA 5KNBA 3G0HA 3IHWA 1Y8PB 1FZQA 2RGNC 2VUMG 1NBMA 4JYCA 1TUEA 4A3DH 3A5ZB 1FFHA 4HB3A 1X8KA 4DLWA 4TYPA 1XNRL 3WBKA 4TSFA 4B3BA 4DR7L 1GNQA 1J8MF 1VIAA 2OCBA 1JPJA 3E9IA 3FHWA 2XJ4A 2GXSA 1IL2A 1LB1B 2K5UA 3H94A 3Q7QA 2I3BA 2QT0A 4P4UA 1G16A 3J81c 4US2R 2PPBC 3A8TA 3CCQA 1S72A 3AF4A 3U7HB 3U44A 2CBZA 2JLRA 2VSOA 2QENA 2A2ZA 1HPCA 2ZM6Q 1Q22A 1Z5ZA 4IFBA 4H44C 4EPYA 5KSZA 4X62L 1HURA 3CF0A 1SVKA 2XGTA 2F43B 4Q9HA 5E4FA 3LLMA 3TKLA 3A37A 2WAXA 3SYLA 4L5BA 1XNQL 4MH0R 1XJ0A 2DWQA 4YDSA 5DHFA 2QPOA 1JJCB 2N3SA 4UY8C 1G7TA 2GXQA 2IF0A 2JAQA 2ODBA 1WF3A 2VF7A 1E0SA 3VA7A 3BH7A 1MOZA 3MD0A 2I5HA 1NF3A 1KK1A 2F4VQ 3M1IA 1NMFA 5GAGC 4P32A 4TYWA 3CP0A 3DOEA 3QNUA 4JK1C 2CJWA 5H1YA 3FFBA 4BZQA 2N46A 2ZJYA 1E79A 2ZSEA 1X6VA 2FFQA 3LBNA 2X2EA 4GSYA 3OW2A 2GEUA 621PA 4TL7A 4JI6L 5A4JA 3CKLA 1O3YA 2FDCA 3C5HA 1CFMA 2A3RA 3BERA 3E0EA 3PFIA 4ABYA 2OESA 1P6XA 2ORIA 3DKPA 2ZRDA 1S3GA 2CCZA 4PC2A 3MCAA 2G9NA 1L4YA 4PHFA 2WB1E 1KMHB 2R6AA 2FPKA 1E2IA 4M0LA 4Q19A 4P3YA 4U5XA 5FBLB 2XB2A 1DXMA 1KZGB 1P2UA 2DBYA 1ZC4A 4ZCIA 3IIKA 1N0WA 1NI3A 221PA 4KCGA 2HXSA 4OWWB 1OW3B 4ERNA 1UBFA 3PJRA 3U61B 4LY6A 2H7VA 4GOJA 5FBQB 2GCOB 5FL7D 1F3OA 3SU8A 3AUXA 2ZEJA 5CIWA 2Z0SA 2D4HA 2OBLA 2ZJZA 1RL2A 4IFEA 3TAHA 3KJGA 1R0YA 1K3RA 1TWAH 4GOPC 2CJWB 4KYUA 3LW7A 4Z54A 2WBLC 2ZRGA 4Q1CA 4JI0Q 3SI7A 4Q4AB 2VEDA 3DVLA 2KCCA 2QMUA 2IUTA 3AKCA 4QJ3A 3U7FB 2NN6I 1T5LA 1UBEA 4B35A 1G8PA 4V0NA 4HLDA 3KF6A 2BEJA 4C0SA 1R0XA 4TMZA 4EAQA 1YRBA 1KMHA 3W1BA 1S9DA 2IX1A 4HJAA 2R62A 1YZGA 2ZREA 3HU3A 4C9BA 2GEVA 4K8OA 5LB4A 1G19A 3BZCA 4A3IH 1G41A 4GKJQ 1S1MA 3OE7D 2BIFA 4D80A 4R4TA 3DLLA 2QM7A 3FMPB 4A4DA 1CKNA 4GLAC 4P33A 3PIRA 4N0EA 2EJMA 2UU9L 2E2JH 2NZOA 1E2GA 1Q1EA 1II8A 4OHZA 4EX5A 3ZQJA 2W2VA 4DV0Q 4LF9L 1EG7A 1N6OA 2VQSA 4JG2A 2Q2TA 1IM2A 1F2UB 3EA0A 1K0RA 3PSIA 1YZTA 1VKJA 1NL3A 5IP7H 1UEJA 4QOSA 3VX4A 4BXXG 3S17H 4U00A 3VTKA 2KI5A 1RIFA 4GN4B 5HZHA 2DGYA 1LYLA 2WOJA 3KF6B 3CPWA 3T06B 3AVUA 2N78A 5CK4A 1XTDA 3FMOB 3T1HQ 3MXNB 2IYUA 2UZ3A 1Z0KA 5GAHC 2W83A 3GLHE 4W5JA 4BEBA 2GJKA 1DARA 1G8FA 2FA9A 1ASYA 1MKHA 1L4UA 3OZXA 2KA7A 1GTVA 2ZJ2A 3IILA 5JS7A 2A6HC 1GNPA 2WWXA 4B2PA 1DVRA 3SYKA 4LSGA 4FD2A 2ZE8A 2N1BA 3BIFA 4KAXA 2HF9A 3K7AH 1E2WA 2EVBA 1E2NA 2P0EA 5C4JH 1OJLA 4Q48A 1Q86C 2OILA 3VAAA 2OEPA 4PZYA 2OCEA 3L7ZC 1KI7A 4DAMA 2K14A 3B6YA 4APVA 1U8YA 3HYRA 2VF8A 4EPWA 5HKKD 1VIYA 2JLQA 4GLXA 2GBLC 4PC1A 4Q03A 1ZVQA 3SFZA 4B3FX 1G6OA 4GN3B 5KOYA 2RF4A 2WSSD 4JYAL 5TB5A 3QPWA 2YC2C 3GEIA 2BMEA 2NGRA 2VIIA 4Q47A 3CCUA 4KLZA 3TJZA 1JR6A 1SXJA 1NG9A 1ZYUA 2GDJA 1IN4A 2Q3FA 3SJCA 1XMSA 5H1SE 5AUNB 2OXRA 1KSGA 1TL7C 3C41J 4B3RQ 3RAPR 4DDWA 3K7UC 2AHOA 1X1SA 4IKEA 1MV5A 3W9YA 4AKGA 4PZ7A 2J0VA 1E2JA 2IW3A 2AWNA 4D82A 1JECA 3KXKA 5KSPA 2LKCA 3U2QA 2XITA 4DV7Q 2F1JA 5M3MG 4A3GH 3CCLA 3AEVA 4B48A 1NY6A 2QAGB 5C46F 4IDQA 3EBEA 4L8GA 4BLQA 3PIOA 2B7CA 4DR1L 2EFCB 3L82B 2BCJQ 2E2HH 4MUBA 5FTMA 1L7VC 5FFMA 3I4NG 1ZAKA 2WKQA 1FL9A 1RE0A 2B8FA 1Y1VH 3CCSA 4A93H 1WA5A 2QGQA 4FMDB 4HDOB 3SE0A 5DH9A 3D8BA 1E9EA 4WXRA 3TE6A 3VKGA 3D3QA 1SXJB 2D2EA 1FOEB 4Q9JA 5AJYA 4DSTA 2ZI3A 2X19A 4GKKQ 2X1VA 1M90C 2IYQA 4JLAA 1NIJA 3NC1C 1PJRA 4NKRA 4TKOB 3A58B 3OIWA 4ZKDA 2ZYVX 5CITA 1T5EA 3IRBA 3HOUG 3BH0A 1OXXK 1GITA 2WJJA 3JC66 5LMUQ 4WJ4A 2DFNA 3NC0C 1KDPA 2IUUA 4ITRC 3BXZA 1B70B 1ASZA 1BKBA 1IXZA 2AKAB 2NG1A 5IWAQ 3LWUA 1N6HA 4CVNA 4B3TQ 2ZITA 2Y8EA 1WE2A 4DV5Q 5JBQA 4BA1I 1M7BA 2NO6A 4HAXA 4NPHA 3GJ7A 2N42A 4ZIRA 3CX8A 4LV5B 4Q66C 3SJZA 3ZDQA 4OX9Q 2GCPA 2GZAA 2JDIA 4M1TA 3UANA 1EX6A 1NJGA 1TWGH 1ZNWA 4BLRA 4IQZA 4Q9KA 3STBD 2IYSA 1K5GA 3I1FA 3KB1A 3MSXA 4JVLA 4PXAA 4UXIA 5TDHA 5K8IA 4C2TA 3LXXA 3CWQA 1GVPA 1VG8A 5BQ5A 2ID0A 2C9YA 4E09A 5C1BA 1XPRA 1EFTA 4QHSA 1W46A 4O25A 5FL7A 2E76C 2Z6KC 3SR0A 2WWHA 3SEAA 2ZTDA 5C0XH 3WHKA 4A3EH 5SZKB 2B63H 5AK0A 2GVAA 5JZVA 2G88A 2QSZA 3CAMA 2RMKA 2CL7X 3AKDA 3U6BA 4DV0L 2C04A 4DR4L 1LS1A 4A6XA 1UEBA 1VQGA 2ORVA 1Y1VG 4A93G 2QMEA 4QL3A 4C0LA 4D0LB 3KQLA 2VL7A 4GT1A 4HIKA 1D7QA 3NKVA 3PUWA 1T3HA 4DR5L 2PCLA 2PEZA 2ZE5A 5CLQA 1E9SA 4UJ5A 1AZSC 3K0FB 4GZMA 2CKZB 5TV2A 1SFOH 3EX7C 2O5JC 2CE2X 3W8RA 4CF7A 3T34A 4IJMA 4KSCA 4MGKR 3VNUA 2DR3A 2ES2A 3CR7A 3X1YA 1U99A 3OE7A 5DGXA 1HNXL 3U44B 4OO1G 1EWIA 1GM5A 2EJFC 3ZZ0A 3T1TA 1ZW6A 3CH4B 3TH5A 3UDGA 2WIBA 1KJYA 4IPHA 4PPNA 3J7ZC 1Y69U 3U58A 3G5UA 2ZJRA 2X2FA 4C0BA 2ZS8A 1G8HA 4LJZC 1LVGA 1A63A 4GOXA 4QKQA 4HYYA 2ZYWX 3N2EA 4X65L 4A1FA 1VQHA 1X8LA 4FXPA 3AVYA 1N34L 3GTOH 3S14H 2IYRA 3AKEA 4XWKA 4EPRA 4LWZA 2RGGA 3OAAA 5AWFC 1JXOA 1G7CA 1P2SA 1U8ZA 2VHUA 3TK1A 1WCMG 1GP2A 4MZ9A 3ETLA 4XVRA 2CHGA 2UXBQ 5JEEA 1RJ9B 4LF4Q 5G3YA 2XOKD 2PNRC 2J7PA 5IE8A 1U0HC 3ZGXA 4RD3A 2L15A 4Y7NH 1HZCA 5FOTA 4L5SA 3RS0A 5BW8A 1GZSA 1IXSB 5AUQA 4HUTA 2IX3A 1DBSA 5C3EG 1HTWA 1ONLA 4RD2A 3RWMB 3TRFA 2O8CB 3CO5A 3ZLJA 2CQOA 3S1AA 4YY3Q 1FVIA 2IS6A 2C78A 3BE4A 5CJPA 1P62B 5TMPA 1ZD8A 2F3RA 3CRRA 4OWTB 2R44A 1OE0A 2DY1A 4C0QC 1JAIA 1AIPA 1V8QA 3X2SA 1Y14B 3M3YH 2CNWA 2A30A 3VR6A 3CCMA 2PJRA 3O8CA 1Q7YC 4DK1A 1NSTA 1N9WA 2B8GA 3DHWC 3Q8XB 1A0IA 3QXJA 1XD2A 4Q4LA 4KKUA 2QORA 3ZIAA 4LJ8A 4DEXA 3EA5A 3SN6A 5JMTA 5M3MH 2ZT9C 1ZM7A 2WOOA 1KOFA 3AVWA 4RFSA 3FHTA 5EJEA 5IYCG 4PX9A 4L5QA 3SQXA 3C4JA 2OTLA 1JALA 2UUCL 2R6GA 2JJ1D 5L3RA 3QEJA 2VW9A 3OESA 2A19A 3RZDH 1PFSA 1YRAA 1DS6A 1VQNA 2WM9B 2ZI4A 4ASUA 4DUGD 2GEDA 4DR2Q 4II7A 3ZVNA 4K46A 2VQFL 1BOFA 1G3RA 4LHZA 1GO3E 2CHQA 2WZQA 1YZLA 3C8UA 4YDHB 3QUSA 4Z8YA 3R8FA 1XMIA 1KL9A 3CRQA 4S35A 2QEXA 4URUR 4HZUA 1X1RA 3GLFA 4YHHQ 1N5KA 3IBGA 1ZYRC 1WJJA 1YR6A 1W2GA 2Q2HA 1DTSA 1O87A 2ZRLA 4IDPA 4LHWA 4JI4L 5DHAA 2AUJD 3LVQE 5DSZA 2DFKB 4C2MH 1UEIA 3OIVA 5JLJA 2GJSA 3PEVA 5EQTA 3D0FA 2QMHA 1G4UR 2FGJA 4M22A 1M2OB 3QOFA 4A3FG 1XNRQ 3LXRA 2VP5A 1AM4D 3WRXC 3RHFA 4AYBE 2WKRA 5FUVA 5K8TA 4C3ZA 1HZAA 1OXSC 2Z6VA 1C4OA 3EPHA 5JEAG 4CT4B 4MKFA 1KI2A 2WAQG 5BN3A 5M5WH 1JAHA 3MWYW 4DUZL 4JLKA 4WZBE 2JIZD 3NTUA 4JKYA 5BR8Q 2FWRA 1E24A 5C4XH 2EFHB 1N32Q 3B60A 3C15C 3CM0A 3QKRB 3CNOA 2J7PD 4PHTA 4PO1A 3RS4A 1Q1ZA 3AUYA 3FKQA 1ZNYA 3HKZG 1PZNA 5J5CA 1E1RD 1Z07A 4DUYL 1QUQB 1R5BA 2YKGA 2ODEA 1EUJA 3PEUA 3N5CA 2H16A 1CI3M 2D2CC 3PO2H 2Q3MA 2ZJAA 5FUYA 1TQDA 1XPOA 2NTYC 4A15A 4DR2L 1FPMA 5KNDA 1XRJA 1OPXA 2C2HA 3BJIC 4B47A 4UPAA 1XJQA 1Q21A 4CEHA 1EWRA 1XB2A 2CXXA 5SZIA 4D4MA 2KE5A 1N34Q 1WRBA 1FW6A 1YZ6A 1XD9A 4JLMA 4WXPA 2CCJA 2ZRMA 3KB2A 4OK5A 2E8GA 4O0MA 2JA8G 1Z8FA 1H9SB 3QKRA 2BH8A 2IYZA 2L5TA 3KFXA 3BD9A 3QIAA 3EZ2A 4P4SB 5JJIA 1HY3A 2CHVA 1IJEA 2RGEA 4PSKA 3S1QH 2IS4A 4DV5L 3U3JA 2R9VA 2JDID 3J80i 4QGFA 3WHLA 3EZ6A 1P73A 3I2ZA 1CJKC 1KQSA 4KVGA 4FCWA 4AD8A 1NKSA 3K0EA 5EE5B 3D7MA 3QPUA 1D9XA 2JATA 5BR8L 5IRCD 3I62A 1SXJC 5KPJA 1SN8A 2G3YA 2GA8A 1ZM9A 3A4MA 4OO1I 2F4VL 1DAKA 4P0TA 3PCRB 2HT6A 3NDBB 1O7IA 4L5TA 2IYVA 3FPAA 4HLUC 3RZOH 4B43A 3VU9A 4A3LG 3GPLA 1WCMH 2YV5A 2PBRA 3ADKA 2ONKA 4XOIA 4TYYA 3IKJA 3HPRA 4HEJA 1OFTA 1I94L 2VP4A 2R92H 5GQOA 3M7NA 4JI8L 4G5QA 1COWD 3BH6A 3AQQA 1SGWA 1NRJB 2WJGA 5IY0A 2CE7A 4JZKA 4BBSH 3VR4A 1Z6XA 2ZTSA 2XOKA 2QA5A 4JT2A 1OXTA 3KZ1E 4LJ9A 1OSNA 3U4QB 5IP9H 4JYBA 1HNWL 4DV2L 4M9XA 1JB7A 4BBRG 4B34A 3T5GA 1KTVA 3M9BA 1SVMA 1ZU4A 1G20E 2JA7H 1G8GA 2VHCA 4WZ6A 2K50A 1GILA 3L8ZA 4ZDWA 5JCPA 4B32A 1PLLA 4G7HC 1KSFX 2PX0A 4PFSA 4XTRA 3W1GA 1WQ1R 2ZS7A 2JA5G 1JMCA 1T9HA 1TWFH 1PYBA 4LF9Q 2UUAL 3WYGA 4B3SQ 1VPLA 3OIYA 3D4RA 1FJGQ 1DAEA 4C3JH 4NMMA 4WOPA 1SRUA 4I1VA 3VU9B 4F38A 4BWYA 3T15A 2W2TA 3OTOL 3CCEA 5F98A 1OKKD 2JLVA 1D8LA 2L0XA 2W6JD 3GTJH 4ZDJA 4FIDA 4ME3A 2VY3A 3I8SA 1AH9A 2PZEA 4LJAA 3GLFE 3SJAA 1VG0B 2JJQA 3KFUA 3HKSA 3TBKA 1J99A 4LJYA 2Y0SE 4QHYA 5IP7G 1GUNA 1DOAA 2F3TA 4CEIB 1QHYA 4DCVA 3U3KA 5GJBA 3REFA 4US1R 1Z0IA 2G0NA 4TZ0A 3LY5A 1ZCBA 2Q9BA 3HU2A 1L0WA 2BCGY 4Q9IA 4OK6A 2BE5D 4KV9A 3AKYA 4JLOA 1WOCA 3PO3H 3RLNA 4NDZA 3P20A 1N6IA 3A5UA 4BBSG 2QN6A 2O8DA 3AYHB 1JE5A 3EZ9A 2G1KA 1I5FA 1KY2A 2PZGA 3LX8A 2PQAB 1N33Q 4NCKA 2G77B 1AS3A 3LAWA 1AZTA 1RW4A 3CR8A 2JEBI 5JHHB 1Z2CA 5F9HA 3DPUA 3BWDD 5AUOB 4WJ3M 4EKDA 3DDCA 3AM1A 4AY2A 1XMOQ 4XJXA 2ZRNA 2AUKA 3TR5A 1Z9FA 4ZCMA 1IHUA 1H8HA 4CEIA 2B7BA 1GFIA 1T8TA 2FOLA 2QEQA 3LLUA 1OYYA 1ELOA 1M34E 4Q5IA 1MRSA 5G53C 4NYJR 1TEXA 5FLMH 1KC8C 3LX5A 2HQLA 1ZNXA 3QY0A 4GDFA 1XEWY 4LX0A 2IX0A 1U0LA 1PH9A 1E2DA 4HAUA 4L15A 1OXVA 2H57A 1YQTA 5A5GA 5IYDG 3GLGB 1OF1A 2Z6KA 3OFNA 4RZXA 2VBCA 1VQJA 2OFOA 2FEMA 4PANA 4JBKA 1YZKA 2V6IA 3SGIA 2DFLA 2PQAA 1JR3A 3TW8B 1JJ2A 4DK6C 4G0NA 5J4VA 3WDNA 2GJ9A 4DK3C 4FWIB 4DNRB 4KXFB 3UKDA 3BFXA 3QBVA 2JIZA 1BS1A 3LO5A 4LCBA 4Q7LA 5HR5A 2WKPA 1X9NA 2CLCX 4C2UA 4A3DG 2J0QA 3VDYA 2FNAA 3MAAC 2G1JA 3HOXG 2VSXA 5BN4A 5BXQC 3L43A 1MABB 4C0HA 3U6KA 1BBWA 2EXDA 2KCTA 4OJQA 4DHEA 2MO1A 3NWJA 3B9QA 4OI0A 1HV8A 3UIEA 1A2BA 1E2LA 1WYDA 2EIFA 4DBLC 1ZUHA 3GFTA 4YMUA 4DCSA 3AVTA 1L1OB 1YBYA 3RN5A 3BOSA 3FVQA 5LD2B 3ZJYA 4ZV4A 4DKAC 1KI9A 2YWHA 3PXGA 4LGMA 3BK7A 1TF2A 3MJRA 4BEJA 3NH9A 4OXPA 2Q9AA 2UKDA 5IWAL 3A1VA 1E1TA 3SBDA 3EPKA 5HCIA 4F4CA 3I72A 5EXPA 3A8KE 3S1MH 3BB4A 3ZQ6A 4DR6Q 3I56A 5HE9A 2IF2A 2PLRA 4GFDA 5UKDA 4TL8A 3PV0A 1KXLA 3H3VI 5IYDH 4LW1A 1ANKA 1E32A 1D9ZA 1KGDA 1R4AA 2K7VA 3EIVA 1YR7A 4UNRA 1UE6A 4BY7G 4M53A 1VCNA 2IWRA 3UK6A 1CF4A 4JLDA 1PH2A 1IBLQ 3U3RA 4DCTA 3AF0A 1G291 3ZIAD 4UP8A 3I3SR 1HQMC 1SR3A 3HWSA 2V3CC 4PQRA 3AB9A 2AKWB 4PHHA 1NY5A 3H84A 1WB9A 1YJ9A 1RPZA 1XCMA 2XSZD 3ZVMA 4IHQA 4X66Q 3HOWG 2OQ0A 2RGDA 4M9QA 2IXGA 4DSUA 5LPNA 2DCUA 2ZYTX 1NKTA 3VFDA 4GRAA 1QVCA 1E99A 3IBYA 4OI2A 2BJVA 3DM9B 4A76A 1KHTA 1LF5A 4UXJA 2JLSA 4HDQB 5SZJA 4B6FA 1DAIA 4EIWA 2BOVA 4LK2A 4G5SA 4XVQA 3KXIA 2ZM5A 3LV8A 1YHBA 2IL1A 3K1JA 5LMNL 1YVDA 2BMFA 4TYNA 3H0GG 4A75A 2AXPA 5J4KA 1XEWX 4Q4HB 1H8HD 2D5DA 1XJVA 3WNDA 2ZANA 2FEOA 2I4IA 3PR1A 3PIPA 1XCPA 2OBNA 4PR0A 2PCFB 1S9HA 3RLOA 5L3SB 2ZRKA 2UUAQ 4HAZA 1LUZA 1GUTA 3BJUA 1H8ED 3CCRA 4HATA 4Q4JA 2QRZA 3EAQA 4PZ6A 1RYHA 2FZ4A 5LDDC 2H17A 5J4LA 4DLYA 2YTXA 2F6RA 3LWNA 2IYTA 4BASA 2WSMA 3F0TA 4FDBA 4HJ5A 3P4YA 3AGQA 2BVNA 3UPUA 1V9PA 2HYDA 1VHLA 1CIPA 4IFDH 4IPDA 3UE0A 1I4DD 4LF8L 2IK8A 1W4BA 3B8HA 3QXXA 1B8AA 1PYSB 2PMZE 1VQKA 4V0KA 1UKZA 4B3MQ 2ZRBA 4JI1Q 2G0TA 3MGCA 1IAQA 4NONA 1T3LA 4TYQA 1MO6A 4HIDA 3THYA 5L3QA 1NNEA 4GKJL 4L5RC 4DLZA 1OH6A 2JLWA 4IXMA 2G6BA 4ZKEA 1GRQA 4G5OA 3FKIH 4RZ3A 1IBKQ 2R7DA 2HXYA 2R6FA 2CWAA 3BORA 3QF4A 5GVSA 2ODWA 2HUPA 3GTMH 4P31A 5HCNA 2WJHA 2W2XA 5KNCA 4A3CH 3H1TA 3R9WA 2D62A 4B3SL 2GN5A 3VNVA 1KO4A 2IEYA 1I6VC 1JNYA 5GADl 3LNNA 4DV7L 1AKEA 3MFYA 1D2EA 1M1YE 2JGNA 2QMOA 1F2TB 2CL0X 3GTQH 3OEEA 1PH6A 4HAVA 4LYJA 4QGGA 3Q72A 3THWA 5GJVC 1NE3A 4M8NE 4Y52H 1T8UA 4GI7A 1Z63A 3UMSA 1G1MA 3PGZA 4YCUA 1KAOA 1XX6A 4IPGA 2AFHE 3QKSB 4D26A 1N0VC 4MKGA 4NTZA 2OT3B 2REBA 2PLFA 3A1WA 5L3QB 4A0GA 4MKHA 2IXFA 5BYJA 4JBMA 4G7ZC 2G83A 3DMNA 4IDHA 4X62Q 4RKEA 4BFVA 4BGDA 2WSSA 1PVOA 4J0QA 4QM7A 3U3MA 3TZUA 1S8FA 2F1RA 2Z83A 2QAGC 3QF4B 3VQTA 1PH4A 3TGPA 5ANRB 4FWTA 3HR8A 3ZS8A 2JA9A 5LMUL 3N6RA 4HB4A 4LNQA 1A5TA 4H0LC 2IXEA 1QG4A 1SVLA 2NO9A 4PPGA 4JL8A 4DR3Q 4LHVA 1Z3IX 2HIXA 4LI0A 4XSHA 521PA 1ZKOA 3OHMA 4WIAA 4YHHL 1Y63A 1A1VA 2KBFA 3ZZUA 1BMFD 2WWWA 4X64Q 1HJPA 1KO7A 3CB4A 5LB2A 3OW7A 1SXJE 3QENA 3SHFA 4BFTA 4BLSA 4JLPA 2VQFQ 3PITA 3QKSA 2V54A 1Z7TA 2ZTCA 2NVQH 1N32L 1JB1A 4WA7A 3S24A 3W8NA 1PLKA 4TQUS 1CKEA 1FUUA 3CLVA 1SULA 4NHOA 1ZMXA 3ZYCA 1AS2A 4JI2L 3RR5A 4KLNA 1NBWA 5CK5A 1N5JA 4DT1A 4N0DA 1EFWA 4WAUA 4G01B 4M1YA 1W49A 4LFBQ 2MMGA 4JI6Q 4B74A 1PH5A 2WHXA 4B6EA 4AYWA 1VECA 2RH5A 3B7GA 2I5MX 3B13B 1H9KA 1MO3A 1M7GA 3ECCA 5FPKA 3U5ZB 2KB0A 3QI2A 2JCSA 4OBEA 3EG5A 5E95A 1AGPA 5EE1A 4A3MG 3E9HA 4RCYA 4B71A 2QF7A 3NELA 4PV1C 1SQ5A 5FOUA 2EFGA 1KZ7B 3KKOA 1HZ9A 4TQ9A 4FCTA 4US0R 2IYYA 4ON9A 4L9WA 5JWOA 2XXAA 5C18A 3A1UA 1YHNA 2ZAOA 3K70C 1FUKA 1E3PA 2HF8A 3AFPA 3VKHA 1SZPA 1UADA 4PC6A 4Q7MB 3L0PA 4LF6Q 4D4LA 4FMCB 3I92A 2K5VA 3CMEA 4IPCA 2RGBA 4OWXB 2YOGA 2R65A 2E87A 3RANA 2R2AA 2ZIAA 5BWMA 4DR5Q 4OO1H 1MR3F 2WPDA 1FR3A 4F7WA 2BBWA 1SVOA 2WTUA 3MEFA 5KDDA 1SXJD 4LPSA 2E9SA 1Z6AA 4PTLA 4RD0A 1GKUB 1NTGA 2O0KA 3AB3A 2FZLA 4BZXA 4AKIA 2QNRA 2RCNA 2ZRJA 2CK3A 1YE8A 1S3OA 1QVRA 2JA6G 5JHGB 1E2QA 5JEAH 1JT8A 1C1YA 1UDWA 2WWYA 1H9MA 4JBWA 1EFCA 721PA 3RS3A 1MIUA 4N1AA 1R2QA 1KK3A 3KX2A 1ZC3A 3WXMA 2QU8A 5CYOA 1KO1A 2V1UA 3B2EA 4OQNA 3CC2A 5FJ8G 1XP8A 1IOZA 2WJVA 1NLYA 4YLGA 4G5RA 3J81i 1X3FA 4LYAA 1H95A 1RRPA 5AJZA 1FYCA 2CFMA 4A3BH 3THXB 1S4QA 1UKYA 1EIYB 2VHQA 2A5FA 3IUYA 3DZDA 821PA 1PV4A 2CL6X 5LD2C 1BMFA 1VYVA 1Q57A 2P3SA 4DAYB 4B75A 4RCZA 4C0AC 4Q02A 1U81A 2WMOB 3GCGA 1G6HA 1HQYE 4C0JA 2W0SA 5C0XI 5IF9A 2GWHA 1HNZQ 4ARZA 3KUDA 2X8AA 4IOMA 4P73A 3E5HA 2AKYA 4LBZA 2XB4A 4IJHA 4Q21A 3J80c 2RGAA 2JA7G 1P9RA 2KSQA 5GJWC 1CTQA 4YQFA 3QKUA 3HPQA 1VQFA 4PZLA 2ZJQA 2VA8A 3W3ZB 1E69A 4QL5A 4POAA 4ZDKA 1U2RA 4Q1AA 2JA5H 2NZ8A 2PJZA 4D0GA 4UNQA 4JBXA 2H18A 3IPXA 5C0XG 5EZ6B 1PH8A 3HOVH 2NZJA 4R71A 1VQDA 1L1OC 1PH1A 2V7QA 1EQQA 2XNDA 4QQBX 2AWOA 4JYAQ 3P27A 2C5LA 2WB1G 4L9SA 4DB4A 2IS2A 2ASBA 3MWJA 3CNLA 4IJLA 1LABA 5D3MA 2NPFA 1QHSA 2AK3A 2GF9A 1EFUA 4X8MA 3BAFA 2Z4RA 3NHBA 4LF4L 1KSHA 4A3JH 1RIPA 1P61B 2DHRA 2HCJB 3UDXA 3NG1A 3ONWA 1YNJC 3KQNA 4OHYA 3S1NH 1O78A 2QSYA 1GUSA 3OAAD 4ARZB 3D6TB 2QTVB 2Y0SG 4MGZR 1X65A 3I32A 1GNRA 2GCOA 4CW7A 1VQEA 3DM5A 4LF8Q 2VNUD 3E2IA 1KIMA 4V0LA 5JS8A 1HTPA 3KL4A 3G48A 2ZR7A 1NVWQ 4NYJQ 3ZS9A 4AIMA 3M4PA 3ZH9B 1GJXA 4Z1MA 4EFNA 2FSFA 3EIEA 4GZLA 4AYTA 5KPDA 2XZLA 2PZFA 4BY1H 4DLXA 3AF3A 2GNOA 3DM3A 2FPMA 1ONBA 1VS0A 2JJ1A 5D3MB 4Q1BA 2UXCL 1NBME 3AVVA 4TLCA 3BG3A 2F9MA 5A0FA 4Z51A 1J5EQ 2DWPA 2CNWD 3HYTA 3GTGH 1E79D 2BC9A 3FPPA 2V55B 1PMRA 3V4FA 4BRWA 1D2MA 4E5UA 2XTMA 3T56B 2Q9CA 5FOXA 1E2ZA 3J81k 1E2EA 4OYHA 2A6EC 3RRYA 2XSZA 1IZ6A 4LF6L 1F6BA 1MKYA 4IOLA 4TL9A 4F4JA 3LQRA 3GJ8A 1E9BA 1TKWB 4KFSA 2QGNA 3LD9A 1R5NA 1N33L 4DNIA 4NU0A 3SC3A 1VQIA 1HEIA 4FW9A 2QPAA 1FMJA 1KDTA 1UBCA 5AJ3Q 2V8OA 1ZD9A 1F2UA 3ZJYC 1KMQA 5TARA 2H8KA 2IWHA 2DFTA 4KMUC 2NVTH 4Q1FA 3JZAA 4NCJA 2Q21A 4URYR 1I6HH 5DO9A 5H68A 4IVRA 4DUGA 1GVNB 4DEYA 4PC3A 3DL0A 4JI0L 1GKHA 2HHHL 1KKMA 3MXUA 4DUYQ 2YU9H 2OV2A 4FINA 4RZUA 1IYUA 4KLKA 4TSFD 2GVBA 1AQYA 1UJ2A 1U90A 4LUVA 3CUEF 4B3TL 1GUOA 4MYTA 3RS2A 1G51A 3M4OH 4KN7C 1J8YF 2D06A 3RYTC 2FXQA 1Y3AA 1Y8OB 5GROA 1XF9A 3SHWA 4DCNA 3CRVA 3PUYA 4OHVA 3B6EA 4HIMA 3CD6A 4D81A 1P75A 3UG7A 1OFIA 3K80C 3KXLA 3FMIA 4TMTA 5EE0A 2ZJ5A 3UMFA 2B63G 3T1YQ 2GK6A 3TEHB 1QHGA 4GOPB 1K5DA 1US8B 4DIDA 1NBMD 4YWMA 1RVDA 1YR9A 2E1RA 4HSEA 3RABA 4JI3Q 4KHPL 4NCIA 1XZPA 3TQYA 1XTIA 4DPGA 4MYUA 1LF0A 1LFDB 1A2KC 1NVVQ 2NVYH 4IOAA 2W00A 3MUFA 4KBFA 5K36G 2JQOA 4ACAA 4ESVA 2H1LA 3BFVA 4TLBA 1Z29A 4LRWA 4DLSA 2YVUA 3CRW1 2IBMA 1KDRA 2AHOB 2AN9A 3KDSE 4YMWA 4O0AA 1NMXA 1NLFA 2IC5A 3FYHA 2ORWA 2GJAA 2NPIA 3CRMA 2WP8J 2MNAA 2YWEA 3B1XA 3H2YA 4ZPXA 3T53B 2BWJA 2OE2A 3HKZE 4JL6A 4DDVA 1IW7C 1AS0A 4Y0AA 1CRPA 3FMFA 3B1WA 1N36Q 1Q44A 4LBWA 5AJXA 2CW0C 4TWZA 3PUZA 1DADA 4KKSA 1N6PA 2OLKA 3WP1B 1SLJA 4QNMA 1LNZA 4PC7A 2ERXA 3GQBA 1E0JA 1ZUNB 3MJHA 1ZM2A 1WBBA 2XZPA 3I7FA 2WAQE 5FI0B 3IDQA 4B3DA 5C4MA 2D0PA 3KJHA 1GD7A 2XJ9A 5C4XG 4RFVA 4DV1Q 2Z5FA 1A7JA 5B2ZA 3SS8A 2VHTA 3KLRA 2VZAA 4AYBG 1E9AA 1GIAA 4DC9A 2R7FA 3BDOA 2YJTD 1K73C 3CW2A 1OH7A 3I73A 3I4MG 1WDTA 2GHIA 2F1HA 3OIUA 1QHNA 1SKQA 1UM8A 3Q5DA 4DV4L 2JLUA 1ESNA 2VQEL 4KHPQ 5KSOA 3K09C 3DMDA 5DI3A 3BRWD 2FN4A 2ZVPX 2AMCB 2IY5B 1R7RA 3KTAA 5FI1B 2NMVA 3BS4A 3VX3A 3KOJA 1E4VA 5J4YA 4ZIRB 2AFIE 2ZJBA 3WYAA 1S3SA 4QBIA 3EN2A 4JCVE 4JS0A 1W4CA 4BBRH 1ZM3A 3F2BA 1QDEA 3BU2A 1K8GA 1BIFA 1BYUA 4RKFA 1W4AA 4URXR 3B1VA 3LRPA 3IO5A 3Q5EA 4UXHA 1DGSA 1YHQA 3J81j 3KJIA 5FTNA 4HAWA 1HZBA 1M6NA 3WBJA 3AP1A 3R20A 3K0CA 1Q1QA 3TRZA 1UDXA 1DG1G 4M1WA 1RFLA 4OI4A 1H9JA 4OGQC 2ZSFA 5KSYA 3FOZA 4BY7H 5B57C 3AH8A 5FTKA 1WI5A 4P72A 1N2CE 4AI6A 3KJEA 4G7OC 2W6ID 2JASA 1VG9B 2HJGA 2OSBA 3HFZB 1NMYA 5CLLA 5IT9c 3KQUA 3PEYA 4QIWE 2EFEB 2P67A 2W6JA 3NIBA 1KD1C 1UWVA 1W48A 3GEEA 1XD8A 2B21A 4GOKA 2QPTA 3DOFA 2C95A 4NYIR 1ESMA 4X8OA 4A3MH 1VYUA 3PEWA 3L0OA 2P6NA 5FR2A 4RD4A 5E7JA 3EIHA 4DR1Q 1T0HB 1SHZA 1FTNA 2J46A 3NEMA 3K0FA 1XJCA 2IHYA 2BE5C 1XNQQ 3HOZH 1T91A 5FOWA 4CEJA 2ZI5A 3EARA 4AIIA 4LUZA 4DIEA 4C3HH 2HJVA 3K0SA 2JLXA 2ZUDA 4FCVA 3EQLC 2VQEQ 2ZI9A 5F9FA 1XZQA 1NN0A 3DEFA 3O47A 3K9LA 3HOYG 1GSIA 4MITA 4QJ4A 2UXCQ 4TVAB 1VCOA 2A68D 1YKSA 2XX3A 5JFGA 4A0FA 4H02A 1DCZA 1JBKA 4LYHA 1W36D 1R0ZA 4ACBA 4IVQA 1KI3A 4HJ7A 1G64A 4A8JB 3W5OA 3L8YA 3WNCA 2YTVA 3UG6A 4B3GA 1WMSA 1FP6A 2WV9A 3EC1A 4V02A 4TLAA 1GUGA 3NE5B 3P26A 4JLBA 1XXHB 4RY2A 1BKDR 4QJFA 1Z0AA 4IVPA 3Q8DA 2ZI7A 1NJIC 1A82A 1V5WA 3K0AB 3AV0B 2CMKA 3LBIA 1AK2A 2ZR0A 2XNSA 3EWSA 4CEJB 3W90A 2A7QA 1G5TA 4XH9B 4JJKA 1U9IA 4AWXA 1Y1WH 1R10A 1CR1A 2NN6G 3NBHB 3B85A 1MO5A 4OQXA 3LH5A 3SDZA 4AKEA 2KWIA 2ZETA 3GLHA 1COWA 2O8BB 2OG2A 4MYCA 4NXMQ 1I4LD 3FWYA 1JEEA 5K36H 2UUBQ 2AD5A 2CLSA 1IBML 1Q8KA 1E22A 3S2HH 3KFVA 3R7WB 1G7RA 4AKHA 2RGCA 5IP9G 3KKQA 5DLQC 421PA 4UP7A 4E07A 4A8JA 2EQSA 2F1IA 1E1OA 1ZM4A 4GNXB 5M5XH 4S2EA 1K8OA 4X64L 3CCVA 2ZU6A 3CPHA 3SYNA 4F92B 4MRVA 5TXGA 4DLRA 5JI2E 3GLIB 4JLVA 3UDIA 1I4TD 1VCIA 5FTJA 4A36A 1LACA 2BKUA 1XD2B 2MO0A 2OCAA 1P16A 3SBEA 4CDGA 3HOYH 5G40A 2R6CA 3K0AA 4XVUA 1P8LA 1ODFA 2B6HA 5L8VA 1VQCA 5E7MA 5ELXA 2HLDA 3M4YA 4XD7A 3AP2A 5HY6A 4RFSB 2JLZA 4B44A 2ZE6A 2LXKA 1Z6GA 5JJKA 5C2JB 1YHAA 4JBYA 4QBGB 1KNQA 1QVGA 2D0OA 1W0KA 4A0HA 3GLHB 1NSFA 3AVXA 2O8BA 3PO2G 1SKYB 3ND8A 1Z2AA 3LQQA 2GETA 3R7WA 2LMCB 1LM0A 3E70C 5AR1A 4A3KH 1Z6HA 4YY3L 3VHLB 1TEVA 4YC7A 1GG2A 4LJ4A 1ZIOA 5E3HA 3ADCA 3RRZA 2V1CC 1XU4A 1K8AC 2UVQA 2E5LQ 1DG3A 4LC0A 5JRZA 4JI5L 3CONA 2EWWA 1E2MA 4QXAA 4IO9A 3MWLA 2GCNA 1JXMA 4F93B 1GAJA 5CB6A 3TUZC 1XFAA 3GJ3A 5EP4A 3FDIA 3VR1A 2J7KA 1FL0A 3KYHC 1HR0Q 3ER0A 4TT3D 5DN6D 5IYCH 1S0UA 4PO8A 4NP6A 2P5SA 2A68C 4B73A 1RKBA 3GJ4A 4P4TA 2B3GA 1G18A 1BVSA 1JJGA 1GL9B 2YWGA 2DNEA 3RDPA 4F4IA 2WWGA 4BA2I 4TMXA 1J6QA 1EWQA 5DI9A 4B3ML 1VF7A 5M04A 3RWOA 4IFDG 121PA 4DWJA 4G5GA 3UATA 5KDOA 5C4GB 1VYTA 3SJBA 4U7DA 2C9CA 1JEDA 4UQOA 1KI1A 1A6XA 1AE2A 3SNHA 1R5OA 1QUQA 1HNZL 1TWCH 4E03A 3IGFA 1W47A 1NG1A 4B3XA 4QG7A 3NBZC 1KRSA 3NDPA 3FKIG 5JEDA 1J2JA 2NVXH 2VP9A 3LBHA 2HIVA 1F48A 4OHXA 4B3CA 4JVNA 4EPVA 3VR3A 3A6PC 2BM0A 4FN5A 3RC8A 2VTKA 4CEHB 4NH0A 1ZRHA 5FBVB 1P5ZB 2QQEA 5H8WA 1OIWA 3EXAA 1TU2B 3ICQB 1II0A 4PQYA 5P21A 5FR1A 5LMNW 4KFUA 3PG5A 3JZMA 4DV4Q 5KO2A 3WWVA 1U98A 2GKSA 5TY0A 2QTFA 3RSLA 3RLFA 2NIPA 5J40A 3FKSD 3CPFA 2YOFA 4LPKA 1JQLB 3BGWA 1IYVA 2K4KA 2F1MA 1NMGA 2NZHA 3TW4A 4R1JA 2IUSA 5CM8B 3ZVRA 4W5HA 5KU1A 2C96A 4RZ2A 3B1YA 2R93H 1S2MA 4A3JG 5EUQB 3T51B 1X3EA 1IXRC 4LWCA 1QZHA 1N0UA 2C99A 4QM6A 1Z0JA 2J5XA 1UF9A 3QE0A 2W6IA 4H13C 2FFAA 4M2LA 2O8EB 2UXBL 4TLEA 1NN3A 2QE7A 4JMPA 1IXRA 3GFOA 2ZPTX 3A0JA 1J70A 1M7HA 3QBTA 3QVVA 3U7GA 3LGJA 3ADDA 4LFCQ 4BFYA 3GD7A 1JJVA 3PO3G 4Q7KA 2IYXA 5AJWA 4TMKA 3E1SA 3W6PA 2EYQA 4DKXA 3GP8A 4DLTA 1Z6YA 1P72A 4V0MA 1XWIA 2A6HD 3U4QA 2EWVA 4QFMA 2ZVQX 2YOHA 5M5YH 1W2BA 4Q4AA 1IY0A 2Z0MA 2C77A 4OQLA 4V03A 1N5IA 1CKOA 2JA6H 2PH1A 1Z08A 2D74A 2Q6TA 2XTNA 3CWZA 3K09A 1NN5A 4LUOA 3NBYC 4WVFA 4D2IA 4KN4C 1AA9A 3REGA 1CR2A 1E0KA 1YJWA 1F5NA 2EVWX 3MWKA 1U0JA 4MUAA 3THOA 2ZJ8A 1K6MA 5JJLA 4YONB 1TTTA 1YZQA 2KHIA 2PI2A 3L2PA 2O8EA 2C9OA 3WYFA 5DIFA 1BYIA 2F52A 1CKNB 3RVBA 4LJ6A 1II8B 1M74A 3LW8A 1HT1E 3CXCA 4JLNA 4LBYA 1R6BX 2H5EA 1GOTA 2IYWA 2CLDX 2OTJA 5FUXA 1AGRA 4IW3B 4DR3L 3U50C 4HB0A 5AUPB 3IFTA 3FTQA 3PUVA 4IDNA 1W0KD 2I1VB 2GBLA 3VR5A 4B3RL 3CNNA 4DVGA 4LFAQ 3VMFA 5HPYB 1HE1C 1P9NA 1TX4B 1G3IA 5CYPA 2Q0HA 1GL7A 1YNXA 4R4CA 4JV5L 2ZAMA 3NEJA 4GPTA 1EQRA 1IBLL 4URVR 3FKSA 2PCJA 4JI3L 4DXAA 3F5FA 1K9MC 3L0IB 1IBRA 2O8DB 4AYXA 1Z0DA 3U4VA 4LF5Q 4AG6A 2IHEA 4IOKA 4PO9A 3K70D 1H65A 1FJGL 1FMLA 2JJ8A 1A62A 1M1KC 1N6LA 2I1QA 3KJOA 2DYKA 2RGXA 4IEIA 1KRTA 2VPPA 5B58C 3CCJA 1GRNA 2WMNB 1KKLA 3O8DA 4XTCS 2ATXA 2GVZC 1RC8A 1W1WA 4CGZA 1W44A 4PMWA 5FPYA 2A69C 1SVSA 3H0KA 2CCGA 1E0AA 4C30A 2BV3A 1YJNA 3CC7A 4BRUA 4MRNA 1HA3A 4KBGA 5B64A 3U9SA 4MTNA 4NXNL 1DEKA 4Q1EA 1HNWQ 3F3YA 5GVRA 3PUXA 4HDCA 3VKWA 1CS4C 1G6PA 2CEAA 3QF7A 2FX3A 4PHGA 1TUIA 3TR0A 2FSGA 4BFXA 1OKKA 4A3CG 4EQ6A 5AJVB 4JBJA 1AN0A 3JAMi 3TVTA 3CZQA 1HUQA 4QNRA 4IRUB 4JC0A 2ANCA 2PT7A 3SOPA 1DD2A 2OFXA 1CBUA 4JLJA 3T12A 5K8LA 2Z4SA 3Q7PA 4LC1A 5EP1A 2JA8H 1G7SA 2XEXA 3CPJB 2BEKA 3B82A 3FFAA 1KO8A 3EWAA 1E94E 2JEOA 5F2EA 1XMVA 1Q1BA 2E74C 4DK0A 2QAGA 4BXXH 1IN7A 3QXSA 1U9IC 1LTQA 4HUQB 4DZZA 2LWIA 3G82C 4Q00A 4OX9L 5KYKA 4L8JA 1KDOA 3WRYC 3R8CA 4KU4A 2ZRHA 3CX6A 4EDHA 4QRHA 3S1RH 1N8RC 5FPSA 1ZD1A 2PI2E 4JV5Q 1IYJB 4AQYL 3ASYA 3B9PA 4LDJA 2E5LL 2DN8A 1G3QA 4YXWD 2QRNA 1MABA 3QXCA 1Y8NB 1KJWA 1KSJA 3IHLA 1IY2A 2QP4A 4QBHA 3RSOA 3JAMc 1XEXA 4EQ6B 5FLMG 2ZRAA 4A3BG 1OFHA 2NO1A 1XEFA 4FMBB 4Q18A 3F1ZA 1OTCA 4PG3A 1Q82C 1E9FA 2CCKA 4YMVA 1LW7A 3SFVA 2ZRFA 1NMZA 1OT3A 1ZBDA 5IDVA 1SE8A 2DWOA 3H0GH 1QZGA 2AL7A 2BMJA 2ERYA 2ZU0C 2VYFA 2ZSDA 3AF1A 2EFDB 2OZEA 1BH2A 1VG1A 3BB1A 1MJCA 4NXNQ 1Z47A 5DISB 4POGA 4K0KQ 3ZD7A 2V7QD 1Q46A 4EQ5A 2XNDD 2JEAI 4HUQA 3EZFA 3PF5A 2D7DA 3CRKC 3HDTA 5KDLA 1E1QA 4P71A 4LOAA 2O5VA 4KJZA 4O2LA 4ZCLA 1W3SA 1KK2A 1N25A 1XMOL 2X77A 4JL5A 2RGNA 3O8RA 1H9RA 1B7YB 1T6NA 5EZ5A 4OQFA 4KITB 5IK2D 3QJYA 3GJXC 3T1OA 4B2IA 4NE2A 3KLWA 4M9SA 3UE1A 1SVIA 2C35B 1T0JB 3PENA 2K33A 1CKMA 4V0OA 1XEXB 2ZRPA 3GJ0A 3FHOA 4A6PA 3T1HL 1P7CA 2VLIA 3FGNA 1DAHA 3AQ4A 1VQ8A 3I8XA 4UKDA 1TNDA 2HLDD 1N6RA 4XD7D 1OH5A 1TPZA 2Q2UA 1SKYE 4UNPA 1EK0A 1OYWA 3CH5A 2A5JA 1OB2A 5HTKA 1SMYC 4QHTA 2YZ2A 2TMKA 1C9OA 3QQ5A 5B30A 3M4QA 1E9RA 1U8AA 4I4LA 3ICEA 5EE3A 4A3IG 4GL2A 5F3WB 4JI2Q 2V6JA 2ZRCA 1VQ9A 1EX7A 2QUZA 4H1VA 4A0RA 3TIFA 1KNXA 2AXNA 4LFBL 2RAPA 3G6EA 4DR6L 2ZI6A 3OEHD 4NYIQ 4R4QA 4DSNA 3TSWA 3A7LA 2WWFA 3NXSA 2CVHA 2MSCB 2BA0A 3AVQA 1E1RA 4OK3A 4R98A 5DYIA 3WMFA 1UE5A 1N6NA 1RRGA 3X1WA 4MQBA 5JSZA 3GLIE 3HU1A 4MRRA 4URZR 2FE4A 1JR3E 1N5LA 4B2LA 5L3SA 3RN2A 3EZ7A 1V1QA 3CMAA 1CRQA 1DE0A 2NOAA 3JVUA 1UBGA 4A4IA 2RB4A 4NBSA 2MSEB 2R7ZH 3W34A 3AGPA 4OKSA 1CJMA 1EXMA 2D2FA 4I81A 2WAYA 3C7KA 5J3BA 3X1DA 5C44H 2QQ0A 2VP6A 4AH6A 1ZCAA 4JIMA 3T35A 1P9WA 1TQ2A 2QT1A 1PUJA 4EFLA 1GWNA 1NY4A 3LVRE 3DKVA 1CSQA 2OCYC 4WBSA 4AC9A 3TUIC 2UUBL 1QRAA 4EUNA 1FNNA 4A3EG 4DR7Q 2WJIA 1S40A 2UUCQ 3THYB 1RJ9A 1JJ7A 4G1UC 3CZPA 3M85A 1I2DA 4JSYA 1YVCA 2FU5C 5FL3A 5ELOA 1QHXA 2P6RA 1X3SA 3H3VH 1CJUC 5EP2A 4KI0A 2FFBA 3A1SA 4UNSA 3IIJA 1W5TA 5A35A 3GJ5A 2PMDA 3RNLA 5JSZB 3CF5A 1S96A 2O8CA 3U7EB 1IONA 4QC2A 3S1AB 3HOZG 4O2RA 1NLZA 4D6PA 5KTYA 4LJ5A 3TUJC 2OAP1 1OV4A 1TADA 1F2TA 1ZP6A 2HHHQ 3THWB 2Z43A 4DLVA 4URWR 2F9LA 3I55A 2IHFA 1GUAA 2WFWA 3TREA 2MSDB 3Q85A 1B23P 3GTLH 3U3OA 1L8QA 1JR3D 5FPHA 2OUKA 4TMWA 2JE6I 2OQKA 4PZ8A 1HT2E 2N8NA 4R4OA 3IPYA 4MGYR 4ALPA 4LF7Q 2VHJA 2OCPA 1N6KA 4A2QA 4M1MA 3WNBA 1CJVC 1C9KA 1LY1A 1KYIA 4C3IH 2NQ2C 1AE3A 3T1YL 3U4ZA 3GLGE 1VHTA 3W5JA 4DV6Q 2IEZA 3T1QA 3AFQA 4ZO4A 1PUIA 1X55A 2REOA 1IN5A 1AJEA 2QTHA 2EDGA 3V9PA 3GLFB 3CF2A 4OQMA 3OEHA 4HZUB 1BDOA 4YXWA 4ZDIA 1QBKC 3FB4A 1G3MA 3KKPA 4M9ZA 1KI4A 1FQKA 1EIFA 2KBNA 2BH2A 5EUMA 2MQHA 1IJFA 4K81B 5JI3E 3N2IA 1D6JA 5JWHA 2V4DA 1U94A 4LZZA 2A1AA 1P2VA 3ULLA 2AR7A 3OF5A 4UJ3A 1PA6A 2OWOA 3FHCB 3H86A 5DYGA 5GJCA 3X1ZA 4D4JA 1G17A 1E96A 4MKIA 5EXTA 1HH4A 1CTMA 2VL6A 3GMTA 2ONJA 1LS6A 4DT1B 5DNYB 1R9TH 1VMAA 2KBEA 1GL6A 1I3QH 5TVKA 4D4KA 4PAOA 4BQSA 4YMSA 3BZKA 4A9AA 1NN1A 2OLJA 3M6AA 4KODA 3IQWA 2RHMA 3NBFA 4GBMA 4A82A 3GTKH 3OPOA 1E2FA 4HI0E 2O0JA 4JVSB 4LHYA 5EP3A 4LK1C 1XTRA 4QGHA 3H15A 1HR0L 2FFHA 2NO0A 2VP0A 2F55A 1X3GA 2B29A 1P2TA 1RRFA 1PLJA 2KHJA 2XAUA 4Z8XA 4BE7B 5FBRB 1SROA 1XBTA 4IEEA 5HZKA 2PT5A 4QGUA 2A6ED 4JOIC 1OIXA 1AKYA 2J0UB 2RKOA 4GP6A 4LBVA 4X65Q 2V4ZA 3KQHA 4X66L 1J90A 4EJSB 1X6OA 2JXMB 2CVFA 3NVAA 4NPSA 4A3KG 1PH7A 1T5IA 3MLEA 3QG5A 4L16A 3W6OA 3SZRA 1J7KA 3TQFA 5FLXc 3O8BA 1EWHA 1E2HA 3GFPA 4IFDI 2K52A 1NVXQ 1X86B 2GESA 1P3JA 3IEUA 3B78A 2HYIC 4CYMA 1EESA 5M3FH 1E2KA 2YNMA 1UKVY 4NYMQ 4I1UA 2R8RA 2A5GA 1G8YA 2K5NA 4HLUA 4HR7B 4R9UC 4POFA 5HKKA 4TTRA 2BDOA 2EYUA 1I50H 3KDFA 2HCBA 2HDNB 3K0CC 2P5TB 1AQUA 3GEHA 1CEEA 5K8UA 1H9SA 4TTQA 1M8PA 3EC2A 2ZRIA 4LUCA 4P4SA 2BJWA 2I0QA 2J41A 3K53A 5JECA 5AJ3L 1NVUQ 3UDFA 4QY7A 2J0UA 5KUTA 3W5IA 3LA6A 1CLUA 2FSIA 2RHDA 3AEZA 2QROA 2KENA 4IXNA 4EJSA 5J47A 1WFQA 4BPBA 2R93G 1CR4A 1R0WA 2GF0A 5E7NA 2WVJA 4BLTA 3ZVLA 4P74A 4RSGA 5L3VA 3I4MH 4DCUA 1YU9A 1DAGA 1KO5A 5LBIA 1O7LA 3THXA 2QP3A 4IOJA 4EJSC 2ZM6L 2OAQ1 2VRWA 3MMPA 1J5EL 2GAOA 2O52A 2W58A 4NCNA 5JWRA 2IHBA 4NCHA 4IFDJ 2VP2A 3QXHA 3UWOA 3VHXA 2ZE7A 3AVOA 4M21A 1D2NA 1ETUA 4W9MC 3KDFB 1BBUA 3K0XA 3RC3A 3S15H 2J87A 3IO3A 2SHKA 1QG2A 5FBWB 4AG5A 3CW2C 3NHAA 1G9XA 3RRNA 2WPDD 1BO6A 4PSVA 4DDUA 1EFRD 1X56A 1KY3A 3OEED 4HLQB 4GKKL 3CPEA 1YR8A 2EJGC 2VUMH 1LTLA 2WJYA 3MG9A 2H5XA 1IN8A 3BFKA 4DSOA 2EQBA 2V1XA 1VQ4A 3A1TA 3LFUA 3I4LA 5CM9C 2DNCA 1MH1A 4HZIA 3QG1A 4I1OA 4KVAA 1K8RA 4PZZA 1YEZA 3K8YA 4LFCL 4MRPA 1UPTA 4GP7A 1XCGB 1G3UA 3CRLC 5D3QA 4KKTA 1VQPA 1P60A 4DV3Q 1A8VA 1DO2A 2A5DA 2J1LA 1DO0A 3HR7A 1K83H 2JJ2A 1CR0A 1DPFA 1CXZA 3RNUA 1SHKA 5BN5A 4GNXC 3F8TA 2ZUCA 4DLUA 3QKTA 3RS7A 4IOCA 2A5YB 4MNOA 1VDZA 3K9HA 2IYLD 1XTSA 1Q20A 1ZINA 5C3EH 3JVVA 3P1JA 3SQWA 2GRJA 2FPLA 2YYZA 1JPNA 3ULJA 3P4XA 4JI5Q 2AX4A 3Q3JB 4M4SA 4EFMA 3I61A 5FOSA 5EXSA 2UXDL 1W0JD 3TS2A 2BHRA 2DUDA 4JI7Q 2QA4A 2PX3A 4CT5A 3CC4A 2PL3A 3KJPA 2A69D 1W4RA 4UP9A 1XTJA 2ZSBA 3N70A 4TZ6A 3STBC 3QEOA 4PPQA 4BFSA 2YINC 3B5JA 3DO6A 4H9GA 4X8HA 2ZROA 3A36A 3PVSA 5IHPA 1OH8A 1E3MA 4NYMR 2J3EA 5IK2A 2XTZA 1ZU5A 4A2PA 1Z22A 3HOVG 1CULC 5SZHB 1TQ6A 5BYKA 5KHOC 1HH2P 2A9KA 5H70A 1OFUX 2FGKA 5EXXA 1VTKA 1XDBA 4C7OA 2O8FB 4RCNA 4DNTB 4DV1L 2GTPA 2J45A 4KYIB 3TQCA 4BZPA 1HYQA 2QGZA 1JQJC 4R4IA 1HE8B 1CP2A 1N3BA 2V9PA 5C44G 4MGIR 1TWHH 3RS5A 1S1CA 4TL6A 1YIJA 1XTQA 1W2HA 4MYHA 2IS1A 1E2PA 1YNNC 3W6NA 4GLVB 1TF5A 4YCWA 2F7SA 4GZYC 4HB2A 3TNFA 4YMTA 3R9XA 1UE7A 1XMQQ 4LF5L 1E9DA 3UMRA 4QGAA 4R2HA 3L0SA 2BMDA 4A3LH 2BBSA 4ASUD 1T4GA 3NEYA 3F2DA 3WMGA 1W36B 1DAMA 4LF7L 4A2WA 3D31A 1ZUIA 4LV6A 4AK9A 1FP7A 3ND9A 1QHIA 3EPJA 3V00A 3P32A 1E2VA 3GLGA 3GJ6A 1E9CA 3VR2A 4HLCA 3ULPA 3K9GA 1B9MA 4M1KA 3CQZH 4JI8Q 2ZR9A 2P65A 8OHMA 4C7OB 3QSYA 2UU9Q 3F2CA 1P4SA 4DV6L 4XWAA 2O8FA 1JI0A 1KI6B 2AD1A 4TN1A 3TMKA 2QAJA 1Z06A 2R7ZG 2PMKA 1HQCA 4CZ2A 1EGAA 4DRZA 3L2OB 1TQ4A 4CRWB 1W7AA 4KHZA 3KF8B 1I94Q 2B8TA 2QY9A 1WBDA 4MDFA 1SMXA 4PPFA 1OB5A 1TF7A 2CK3D 2LKDA 3G4SA 1W36C 2JLYA 4GOPA 1US8A 4GN5A 4JVMA 1OHHA 1Q81C 1G5PA 1R8QA 2AK2A 2ZYUX 4LHXA 4LYFA 4PAQA 4WW0A 1WP9A 2OXCA 3TS0A 2FV8A 4W5WA 1FNMA 1L1OA 1L2FA 1VF5C 2PEYA 2BM1A 1T3SA 3HOWH 2J9RA 3QPVA 1DELA 1FQJA 4B76A 1UKEA 2FJUA 3NENA 3BBPA 3PQCA 4IDOA 4LV8B 4UNNA 4TTPA 4EPXA 5FTLA 4FMCF 1L2TA 1KI6A 1U5KA 1YJ5A 2C03A 2QI9C 3M0EA 4HJ9A 4D0NA 3OYYA 4GS3A 5GADC 3PF4A 2FH5B 3TSOA 1PHJA 4RG1A 1GKIA 1YZNA 4GMDA 4XSGA 5EE9A 3HJNA 3R9IA 1YZUA 3OOCA 3BB3A 2K5HA 1GHJA 1Q3HA 4C4PA 2XGJA 4NZYA 2BBTA 3V4RA 4PQFA 2QE7D 5C0XJ 4K0KL 2GJ8A 2FF7A 4PAMA 4F91B 1FX0A 3EPLA 3C14C 3WP0A 5IT5A 1RZ3A 2XZOA 1KK0A 2RHQB 5DLQE 1VQOA 3S16H 1R8SA 2BBOA 1CUKA 5EAYA 2CWPA 2P6UA 5HE8A 3LDAA 2QP9X 2MFIA 3T5DA 1G21E 3AVPA 4LJ7A 2DPXA 2OBMA 2LXJA 1QF9A 1VCMA 1IN6A 4NL4H 1EFHA 5G41A 3PCOB 2HT1A 2C8VA 3KKMA 3RRMA 4ZI3A 2JK8A 4TT3A 1NVVR 1OLOA 4YWLA 5DN6A 3U60B 1EFRA 4KO8A 5CIQA 1B9NA 2O0HA 4RMFA 2LCFA 2ATVA 5ELNA 1XTKA 3T1VA 4KFTA 2GK7A 4JI7L 1Z28A 4NXML 3HOUH 4WZAE 1NJFA 3CIOA 3CX7A 3WMEA 4O3MA 3A7AB 3LNCA 4BUJA 3FMCA 5DI3B 4NB3A 2R6DA 3W3AA 1Z83A 3QVUA 3KTAB 4I99A 4RJLA 4C0KA 1IBKL 1VQ6A 2PNHA 4OJKA 3X1XA 4BLPA 4Q4HA 2P2LA 4CIDA 4AURA 4OI1A 2ZJPA 2YHSA 3ADBA 4YCVA 4OHWA 1OXUA 1N36L 1CJTC 1GRRA 1YITA 1FX0B 4BY1G 3I5YA 1KAGA 3I4OA 2JA1A 3ASZA 4A92A 4BECA 1TU4A 1HCZA 3I4NH 3EIQA 4Q4JB 4TMVA 1F60A 3TSZA 2QL6A 3IEVA 1UE1A 1XMJA 2REXB 1MO4A 2I5LX 5CDFA 4Z1MD 4HIOA 1DAFA 1TU3A 2QM8A 4RVCA 4ZI2A 2Q8IB 1CSPA 4QBFA 3IQXA 4HAYA 4DR4Q 1QHHB 4OL0A 1QVFA 1OIVA 4M1SA 3WY9A 1TMKA 4Q1DA 2QBYA 2ODNA 1Y1WG 1G5RA 4ILEA 1NIPA 2NN6H 2GZDA 4MA4A 1HNXQ 3J7A5 1Q3TA 4B33A 1KIXA 1X8JA 1MRNA 1WCV1 3EASA 4JJZA 1X54A 2BA1A 4YWKA 3HP1A 2MMCA 4Q9LA 2XTIA 2ALYB 2F3IA 4N3NA 1MJEA 1W0JA 2ZXUA 1MT0A 1VQAA 1XXHE 5G3ZA 3TLXA 4TQAA 2KCMA 2YC4C 4KSBA 2JJ2D 1PH3A 4I1SA 5CJ2A 4DV3L 2R92G 2C98A 2UZIR 1G4AE 2GVDC 2E75C 1KAWA 5M3FG 2H92A 2N49A 2NO7A 3CBQA 3A8IE 4LFAL 4RD6A 4BFUA 3ZD6A 2OO7A 4A3GG 3H4MA 4DV2Q 2ECKA 1EOVA 4A3FH 3K8AA 2ZS9A 2D3WA 1QHHA 2FG5A 4Y0VA 1GKYA 2FSHA 2QBYB 5JCZA 4J15A 5IYBH 1E4YA 3CF6R 4JKIA 1LV7A 1ZNZA 4RD1A 4JOIA 4OONA 2IA5A 2KJQA 4Q01A 4Q7JB 4U02A 3MRSA 1W5SA 4V0ME 3UWKA 1GHKA 2UXDQ 2EW1A 4DDTA 4XWOA 3C5CA 3A4NA 2YTYA
chains in the Genus database with same CATH superfamily
4MRSA 3FDZB 2J3LA 3O9ZA 1Q6ZA 1Z5OA 4ZUIA 1R4NB 1KZ1A 2G5PA 2O48X 3T4AC 3BCHA 2EU8A 4YUZA 5ITVA 2BDTA 1TQ8A 2HREA 1FGUA 4DAPA 1ADCA 1VQLA 1QPBA 3EEYA 3L0CA 2C7GA 2QW1A 4ZIRB 4JV5B 2VNKA 3O91A 3PHCA 5BP7A 1KJZA 4ZCQA 5JY6A 2UAGA 1Z6TA 1VQMA 3NH6A 3DAGA 3LY7A 2F3VA 4C08A 1D5CA 4UTXA 1A8IA 1JOOA 4XB1A 4PYKA 5JEAJ 1UFOA 3I2YX 3I5XA 3KQKA 1X1TA 1Q0UA 3Q22A 2AQIA 3BC1A 3DXYA 4K88A 4MDEA 4BHTA 1VQBA 2Q6IA 5PNTA 1E6CA 3VPSA 3WG9A 2BYTA 2IJGX 1XMQL 3ERQA 1AMOA 5I9LA 2I76A 4ZAWA 1Z8DA 4JIGA 5IEJA 3F47A 2IHKA 2RBEA 5LMNQ 4E30A 3GR6A 1KQNA 2HCIA 4EHNA 3U7QB 1Z4IA 3WYNA 2H7XA 2P9GA 1AGNA 1FMTA 1MGPA 4BFWA 1I32A 3FLBA 4GBGA 4WN3A 1VMKA 5IYBG 2PUCA 1SPXA 1MU0A 5EJ4A 4XT3B 5IT9L 5EC8A 2V7TA 3LWZA 2B5WA 2W0MA 4JMLA 4KLRA 5DCYA 2WK1A 3H4VA 1V43A 3EBPA 3OCXA 3UB3A 3OM0A 4DLNA 1IW7D 2C9DA 5C9ZA 3ZZNA 5GAEC 2COEA 4XDGA 5BR7A 5I7WA 5JCOA 1KLGD 2ASEA 5HW0A 1GQRA 4GMXA 3T3EA 1XA0A 2B78A 5K0FA 3BSFA 2ZUBA 5JT1A 4P75A 1DFIA 1BQEA 1IQPA 1I01A 1P7YA 4JT4A 1HXHA 2E89A 1XPUA 3NUQA 2ST1A 3KO8A 3IURA 1QVZA 2YN0A 5DRTA 1W34A 2OP0A 3AHGA 3PJFA 4O8CA 3TVDA 4FONA 4JI1L 1WXQA 4GNKA 5IBPA 4X8LA 4EB0A 3DEPA 4WJWA 3T6KA 3UXMA 1KI8A 1XQYA 2WICA 2VPIA 1QG0A 4FW8A 1AK9A 2KHSA 4Q82A 5J1ZA 4XDHA 4DUZQ 2FMXA 5DM73 2K32A 1ESCA 3C16C 3DLIA 2ANBA 1FDUA 4MI9A 3GG9A 2BFMA 3IHWA 5JO9A 1Y8PB 3VNQA 1M6YA 4YT4A 2HQOA 3CLRC 1NBMA 3F9IA 5C8YB 1XKQA 4A3DH 1FNVA 3G8CA 1FFHA 3KHTA 4HB3A 4MUFA 4DLBA 1O7YA 4CTMA 4W5NA 4BCCA 3OIFA 2I6UA 1VIMA 4LQ4A 4DR7L 1BWRA 2ZGVA 5F4ZA 2OCBA 1V4NA 1YCFA 4GVLA 4HRVA 4I66A 4P08A 4R2XA 2XJ4A 1MAVA 2GXSA 1FTYA 4JQYA 4NDNE 3H94A 2I3BA 2R8PA 5EMMA 1JJAA 2RHHA 1BRTA 4FS8A 1I4OA 3MAJA 3KTFA 3H2KA 3O0TA 2VSQA 3DZCA 1ZXBA 4ZYVA 1GAXA 3MXPA 3U1BA 1QNFA 1AHIA 2JLRA 1E8MA 1P0MA 1HPCA 3G49A 4H44C 2CT8A 3RW9A 4D9MA 4X62L 2Z4IA 4Q3EA 4PG6A 2HL6A 4UOQA 3S2GA 3A37A 2WAXA 4NIMA 5TX7A 1XNQL 4MH0R 1XJ0A 3SYLA 2X86A 1L7EA 4N76A 4CKBB 4BV3A 1ZFNA 3O4JA 1EY5A 1RABA 3THRA 2GXQA 1NV9A 2ODBA 2E6UX 3E35A 3RYIA 5LJIA 3VA7A 1DX4A 2WLTA 5LFAA 3TLMA 3M3HA 2A0KA 4TRRA 5KQRA 3B7PA 1NMFA 2R3SA 4QXOA 1EJ6A 3CP0A 4DMLA 3QNUA 4EVSA 4EJMA 4LXGA 3FFBA 3S55A 2H2DA 4MRMB 3H9UA 1E79A 1QQ5A 4GSYA 1DV2A 1VPVA 2X2EA 2GEUA 5HMLA 3ZN2A 1BJKA 2REQA 3CKLA 3FD8A 3W5BA 4H60A 1BVUA 3BERA 3CCFA 1HFKA 4JYPA 4ABYA 1JBQA 1N1EA 2ORIA 5A2QL 4PC2A 5CA1F 4IO0A 1E66A 4OGLA 1L4YA 1X3LA 2G9NA 2WB1E 4ZRZA 4GYYA 4EZEA 1B2TA 1V7CA 5CV6A 2I3AA 3KLNA 3OJWA 4HYTA 1KZGB 3DEHA 3V42A 4KCGA 4OFZA 2G06A 4L4ZA 4LFCB 3ROPA 1P0CA 1L3CA 1UBFA 1YS4A 3HCOA 2D13A 1SB8A 2WJ3A 3KOWA 4GSKA 1GAEO 4F2WA 2HUNA 2OM6A 3SU8A 5ESXA 5K0SA 4AN4A 4WGFA 2G5DA 3U3DA 5FUQA 2D4HA 3Q2OA 2W2LD 4AS3A 3TAHA 4R83A 5SY9A 4C0WA 1GA4A 4KYUA 5AVVA 4V190 1V3TA 4R9WA 4G5YA 1SBNE 2MR5A 2ZRGA 3HP7A 5C7OO 4JD5A 1XA4A 2VEDA 2E5WA 3A25A 3AKCA 1X80A 3U7FB 3RC2A 2V7XA 5DB4A 2GYVA 3TBIB 5CH3A 4AX8A 4HLDA 4YV2A 5IAOA 3O2JA 3K1AB 4QUHA 3GGJA 4OIFA 4RGNA 1TZ2A 2F0PA 3J7AV 3KUUA 3ZW8A 4B8YA 3PHIA 4BNVA 2ZREA 4WFJA 4C9BA 1YZGA 3SVLA 4P3XA 5LB4A 5T4EA 1G19A 1NYQA 3PIO3 2VRNA 3V2GA 1G41A 1LRJA 2VCHA 3JR7A 5LWHA 3I8OA 3V96A 3QW2A 1JI3A 3T7KA 4GLAC 2E2JH 5IDQA 4DFAA 1B73A 1Q1EA 1II8A 1IG3A 4UASA 2YFHA 2PD4A 1EYAA 3K0HA 1N6OA 2VQSA 4H7JA 4JG2A 3WYCA 1U4RA 3EA0A 1F2UB 1JEYB 1K0RA 3PSIA 3IULA 2EOAA 3LCJA 2QRPA 1C3VA 3ZV4A 1HE4A 3KJNA 3KZKA 4A5OA 2QYHA 4PIPA 5D7NA 3E5MA 2NAFA 3HWX1 3RSQA 3GNSA 4U00A 3VTKA 1RXSA 4F5EA 5CFRA 4GN4B 4AT1A 1LYLA 4IV8A 4N3GA 4YCBA 3K1AA 3KOOA 1IY9A 3SLKA 3T06B 2N78A 1JDNA 3GWGA 1XTDA 3FMOB 2IYUA 5ALKA 4W5JA 1M34A 1RLJA 3FRPB 2D5IA 3HKCB 2GJKA 1N2GA 3I1YA 3WQRA 3DHQA 1ZOSA 4RJJA 4C7VA 3I9V6 4POOA 1GNPA 1TIPA 4KQWA 4CU5A 1Y89A 2N1BA 3HJBA 2EVBA 1GN9A 3UV6A 1KTKA 2Q8TA 1Q86C 1H5QA 5JAQA 3BXGA 3ZH2A 5GONA 1P6UA 3X3HA 4DAMA 3ZE8A 1ODKA 1U8YA 3BVPA 4OATA 1RQLA 4MW9A 3GVHA 1XZCA 4Q03A 1KNEA 4MDHA 2J31A 3QPWA 4G0ZA 2BMEA 2VIIA 5CH5A 3OMGA 3CCUA 3ZJ5A 4AN0A 2AB0A 4BQIA 2W6OA 3KPJA 4I5GA 4JC8A 1RYDA 2IZOA 2GDJA 2YR0A 5DW3A 3SJCA 2PIAA 1KSGA 3L02A 4G0UA 3V4OA 3K7UC 2AT1A 3RWBA 2HRCA 5CCEA 2BHNA 4QECA 1W52X 1TIBA 3O83A 4UCFA 2IW3A 3AFHA 3F3SA 3LHFA 5D86A 3UCFA 4BYMA 5KSPA 2PAAA 4B46A 2HH9A 2HU5A 3AR8A 2VDUE 3GC6A 4RL6A 2Y0BA 4UBIA 3BRSA 1WXDA 4F6RB 3BF8A 1G6Q1 3PIOA 3FRJA 4EYSA 2B7CA 2EFCB 3N1UA 2BCJQ 5FTMA 1L7VC 1LT5D 1P3DA 3F49S 1B00A 3Q15C 1FL9A 1RE0A 4A93H 3GJTA 2QGQA 3NOVA 3HADA 3SE0A 4OB7A 4QPJC 4J2HA 2D0PB 1R0SA 5DH9A 2IUFA 5JFOA 3PNVA 2XVZA 1C0PA 1E9EA 2AR9A 2P6PA 3ISTA 3TE6A 3D3QA 3WSVA 4DBVO 3DO8A 4DF7A 4BJ3A 5JASA 1KS9A 2WYIA 5A7FA 5FWYB 1MJFA 4WSOA 5JSQA 4JLAA 1C41A 1PJRA 4IXTA 1ST3A 4NKRA 4WEOA 4ZKDA 3HZHA 1A2QA 1T5EA 2D7JA 2X0IA 1IEQA 2R48A 3EY4A 3T7IA 4RF4A 3UWDA 1OXXK 3OECA 3KT6A 3NC0C 4P34A 1KDPA 3ETEA 3K94A 3BXZA 2B5OA 1RAHA 3IJPA 4RETA 3SYMA 3U80A 1KJIA 1W30A 2NG1A 5IWAQ 4CVNA 2PMCA 2EL7A 2Y8EA 4ILKA 5FO8B 3ED5A 5L7YA 3PP8A 4FFPA 4ISBA 1F1JA 4XQJA 4GZ3A 1YRWA 4LV5B 4MMYB 2C59A 4OX9Q 4BFCA 3KHKA 1CCWA 1ZNWA 1A1VA 4EQOA 4Q9KA 4E5SA 1WNFA 2IYSA 4MNTA 4C2TA 1B1CA 1YRQA 4KNWA 3ZXSA 1L7OA 5I9NA 1N1MA 1SNYA 3LXXA 5HQ3A 1DOLA 4UM9B 5BQ5A 3B51X 3ZWWA 2C9YA 3E82A 2Q5HA 4MS3A 1EFTA 2IPLA 5TF4A 3VOTA 3SAJA 1NDHA 3LUDA 1LK7A 3DV0A 2Z6KC 4P22A 5FWYA 1MNQA 2O5EA 4YMIA 5DNEA 1PRTD 2AF3C 4A3EH 5SZKB 3VZSA 4Y2RA 2N3ZA 4JOSA 2CL7X 3U6BA 3EYWA 3EG9B 1Y1VG 2QMEA 3RBXA 4D0LB 3KQLA 2ZIXB 2VL7A 3VJRA 2H1FA 3HKDB 5ALTA 2YL2A 3RU7A 1ES9A 3Q7TA 2PEZA 5JVDF 1VZ2A 3DZBA 1AZSC 5LP6C 3R7LA 3NP9A 3E2MA 4E2XA 1F8UA 3EX7C 4K8IA 4X1IB 5KIAA 2FRVA 4IJMA 4TWAA 4YO7A 5KZMB 1PTKA 5JNUA 1EP1B 5AW5A 4XXHA 2Z1CA 2IDJA 3T9EA 2BGGA 4OP3A 3L4BC 3X1YA 4BKPA 1V6CA 3OE7A 3FUUA 1HNXL 5BNZA 1EWIA 2EYHA 4W63A 3ZZ0A 1OBFO 3ET5A 1ZW6A 1FQOA 4MS3B 4QOHA 3T1TA 2V98A 3TH5A 4JXZA 4AZ3B 1M1NB 5DX1A 2W42A 1A5BB 5ER9A 1RF2D 1KJYA 4HO1X 2Z1NA 2XW6A 1OGYA 3G5UA 1I94B 1JAYA 4R2JA 4C0BA 4X44A 4LJZC 1HE5A 1A63A 3TG8A 4ZZIA 2C4MA 5FFFA 1FEZA 3ONEA 1HTTA 3EG9A 3IAUA 4FXPA 3GTOH 1G55A 3AFNA 3FAKA 4NP5A 4LMBA 5A5EA 3HKDA 1MB9A 3A6ZA 3FCXA 4YCAA 5JVH3 3JATA 4XWKA 2I55A 1JH9A 1QCZA 5AWFC 1Y1QA 3AB7A 1G7CA 3BN3A 2VCYA 1RCVD 4X0EA 5CG1A 4CR6A 2OCDA 1YV9A 1E62A 4LDZA 2CHGA 4UVIA 4KPYA 3DT9A 5G3YA 3V6MA 5AK6A 5DCUA 1D04A 5IE8A 1SWWA 5EESA 1DC6A 1RLOA 1HZCA 5FNVF 4E5YA 1MAUA 2ZIEA 1LX6A 4BOYA 1X42A 3ZY3A 1IPEA 3OZSA 2RI0A 1N34B 2QVBA 2VQ3A 3TRFA 1KVQA 1M1NA 4J76A 2P4EA 5CVCA 3HFGA 1PRTF 3S1AA 2AOTB 3ABSB 1WD1A 1E3EA 4DNOA 5CJPA 2PWZA 3CVXA 1BC5A 1ZD8A 3CRRA 2PGDA 2FW1A 1JAIA 1Z38A 3ICCA 1AIPA 3A3OA 2OHIA 4LNUA 3GO4A 1Y14B 4Q7EA 1PJ4A 1U2DC 3X2SA 2A30A 3CCMA 2R3ZA 4CN8A 2PJRA 3KZOA 1ESZA 1C7IA 4DK1A 4ZLTF 2JFZA 1N9WA 3EIOA 4DADA 1LLUA 1N33B 3JATB 4K5WA 1J5PA 2O6HA 3D0OA 3P0JA 3UMCA 4DEXA 4LJ8A 2H4HA 1SMYD 2V0CA 2DBRA 2ZT9C 1YGPA 1TK9A 3FHTA 1JNXX 2HQRA 4NESA 3GJRA 1ZX1A 3AI7A 4PCAA 4PX9A 4MUGA 2DQKA 4FHEA 1WSAA 1JALA 2UUCL 2QR2A 3NJ4A 3N53A 3P5SA 2Q3DA 4FGZA 2X9NA 1RI1A 5FLEX 2H08A 1WXFA 3PSHA 4V0SA 2FETA 4ASUA 2JGRA 4H7IA 2GEDA 4XIYA 1IBLB 4UOZA 4K46A 3OKCA 2JFVA 2OVBA 5BV2P 1VJ5A 2AOTA 2FLVA 3TFQA 3ABOB 3S15B 1YZLA 3QVKA 3R8FA 5K3OA 3DUZA 4S35A 5HIAA 2GEJA 2A4MA 1X1RA 2JAXA 4YHHQ 1N5KA 2CFCA 2Q1TA 1WJJA 1ZYRC 1TMYA 1YR6A 1CRWG 3QFSA 2ZRLA 3D81A 4LNUB 5IT0A 4JI4L 1ABEA 2JFUA 3OICA 1YS1X 3ED1A 1CQVA 2AUJD 1MD9A 2AUMA 2Q50A 1KMCA 2PXXA 2YWRA 4C2MH 5DSZA 3HG9A 1PFKA 2GJSA 2WTNA 3PEVA 4L75A 4X3OA 5IVIA 3SK4A 3S81A 4RPHA 4ZQFA 4B6RA 1AE1A 1GPNA 2GBFA 4FHFA 3D8RA 4A8PA 4A3FG 3PI7A 5IHXA 5TVGA 1STBA 2R6ZA 3TI9A 2F17A 1PHRA 4AJEA 3W6UA 2V0GA 4CIWA 2VK1A 5K8TA 4C3ZA 1HZAA 1OXSC 1QUEA 3O3OB 4ZMSA 4MWZA 1WAMA 3HDJA 5DNAA 3CSDA 3RHTA 4QFBA 5E1DA 2WAQG 2XZTA 5BN3A 4R5HA 3HXQA 1NRIA 4EYKA 4NQZA 1V1OA 3VR2D 1JMVA 3NTUA 3TLBA 2B2CA 4PYQA 1XZBA 2TSYB 4C29A 1NVTA 4P1ZA 5L53A 5C4XH 4YDQA 1PZEA 2VRCA 3NQ41 4QIHA 3W2IA 4D02A 3NDJA 1FSSA 1Y5IA 3QKRB 3CNOA 2QM0A 3D3KA 5HF5A 3RS4A 1Q1ZA 2IOYA 3AUYA 3FKQA 3HSKA 3IUEA 3PRYA 4WOBA 3SG0A 4DSZA 4TKUA 4UFPA 3ONNA 1R5BA 5BSKA 3WGVA 1KEPA 1KQOA 1ZEJA 1K6EA 3FB1A 4DZTA 2ZJAA 1XPOA 4A15A 5JPIA 2VYCA 5KNDA 4HBZA 3L6RA 3QGMA 4OF4A 1XRJA 1YRHA 4FX5A 5K6RA 2LZ0A 3DFUA 2YRXA 1X3QA 3QUAA 1MEJA 3T7AA 5C4IA 3G2LA 1A9TA 1ZO8A 2ZJFA 2J33A 3TTUA 2QRKA 4WFQA 1EWRA 1A8QA 3F7OA 2ET6A 3F2IA 3N8IA 1E4OA 1AT1A 1N34Q 1WRBA 5ARDA 3GCZA 5AVUA 1XZAA 5KEEA 3PKIA 1XD9A 3IMKA 4W9RA 2CCJA 2E4UA 3KB2A 1RYEA 3GG2A 1EHIA 5BVGB 3CJTA 4U2GA 3GFBA 3LBYA 4K8JA 4MPJA 1IIBA 3QKRA 4I6GA 4P4SB 3S2DB 2O2GA 3QIAA 2A1TR 4M8KA 4CIXA 4YUAA 1H6DA 1IJEA 3I76A 4IIJA 4DR5B 4DV5L 3U3JA 2R9VA 4MHTA 4EI2A 2ZIVB 4JASB 3EZ6A 3HRKA 3KTOA 2B2TA 1CJKC 2GVNA 1WTWA 2DTDA 4IGEA 1QQAA 1XOIA 1G60A 4DNXA 5TLSA 4Q4DA 4E13A 3UF0A 3DV9A 2CH4A 4YDRA 4IDCA 4AULA 2GCIA 3FDFA 4G1BA 3A4MA 1C29B 2AG8A 4Q3AA 3V7WA 1HLGA 5E3IA 4X84A 3GPLA 4HLUC 4B43A 5AM2A 3RZOH 5K3FA 4A3LG 4EMSA 1YZYA 3LF2A 3ADKA 4C4RA 2ONZA 3BEDA 3I1IA 4UNIA 4RJTA 4ZJYA 3RRBA 1U1IA 2R92H 1RTKA 4MQEB 4JI8L 3M7NA 2E2IB 1JIVA 1RVV1 4FFDA 3UJBA 3ZWVA 2BUBA 4A7PA 2OTCA 3ROFA 1T36A 1Y4ZA 3AUKA 3DL7A 3RAGA 4BBSH 1LBQA 3TOSA 5C35A 3HEMA 4P92A 1Z6XA 3KYDB 5LDGA 4YMHA 1IZ7A 4WLVA 4ZVVA 1Q14A 1C7EA 1OSNA 2F4VB 3NTXA 4AY6A 1UBRS 1OWLA 1Y6JA 4YRRA 4B34A 2B1GA 1KTVA 3T5GA 3HL4A 1G20E 4MKXA 4WZ6A 2K50A 4IQGA 5AM1A 1AQIA 5LHY1 1P8AA 1PLLA 3AZPA 5B3LA 5I48A 5CVVA 3LC7O 4MQ4A 2VG8A 1WQ1R 2F1KA 1XALA 3HWRA 2HD4A 3OZCA 1TWFH 4FFOA 1I5OA 4XD2A 4B3SQ 2FOXA 1VPLA 1W76A 2DFVA 3FZGA 4S1NA 3FVTA 3VHRA 1JUDA 4C6HA 4QGSA 4KX3A 4GXRA 3H5AA 1Y9DA 1BXRB 3NTKA 2MINB 1NVBA 5U4QA 4AZWA 4BWYA 1U1CA 2WYWA 1CZNA 1HNWB 1XZGA 3E61A 4JDUA 5F98A 2JLVA 2W6JD 4OELB 3PE4A 4LWQA 2QVLA 4CTJA 1GEGA 1KYYA 3S5UA 1VG0B 3IXLA 5D1NA 3U9OA 2C4HA 1ENOA 2YIDA 2L11A 2KLBA 3KYDA 1AP0A 1J99A 2Y0SE 1D4FA 4QHYA 4HAEA 1BHQ1 1DOAA 1JF8A 1MJ5A 4N8FA 1ZXXA 2R00A 4KK7A 1QM5A 3AYXB 1VHDA 3MN1A 4MVJE 4YR7A 5JC8A 3REFA 2G0NA 4EG5A 4YIJA 2C5BA 4JA2A 1ZCBA 5JAVA 4S2UA 3LCCA 2CKDA 1U0TA 4TXHA 4BQQA 4BBJA 4J1MA 2JHAA 1WOCA 1U2ZA 3RLNA 2CFTA 2PRZA 1EUZA 1YNJD 4LIPD 5EPJA 3P20A 1GZ6A 4YRDA 2H2WA 1K4KA 2IEAA 3O3MB 1JE5A 4J7CA 3IHTA 4RADA 4V2IA 3GYBA 3Q6SA 2JH9A 3K5PA 4RVGA