4JBWA

Crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Maltose transport system permease protein MalF
publication title Carbon catabolite repression of the maltose transporter revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
total genus 78
structure length 370
sequence length 370
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4jbwA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jbwA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jbwA01
1M7GA 4BFZA 4ACAA 4GN4B 4WZ6A 4BBSG 4YMTA 1GTVA 4RSGA 1U9IC 2RGCA 5TDHA 4X64Q 2IYVA 3EARA 4ON9A 3REGA 4IOKA 1NL3A 1VQMA 2UXBQ 4A3CG 1Z47A 4C3IH 1X1RA 2CK3D 3W3ZB 2TMKA 4A76A 2BCGY 2GKSA 3SC3A 2K5NA 3WYGA 4KVAA 1LTLA 4UNRA 3FP9A 4Q9JA 1NLZA 4A8JC 2G88A 3EASA 1NF3A 2LKDA 4ESHA 2JIZD 4XWOA 1CKOA 4UP7A 3CCLA 3WHKA 5EP4A 2ZPTX 2N8NA 1E2KA 2QORA 4QXAA 1KK3A 2C8VA 2JJ1A 3HDTA 3BFXA 4PFSA 4RCYA 1COWA 1OE0A 3SNHA 1HCZA 4RD2A 3E0EA 2WZQA 1VQBA 1ANKA 3WBJA 4GPTA 3SR0A 3VR2A 4Y52H 1T0JB 4US0R 1YHQA 1DG3A 3FOZA 3THXB 1TWFH 1N5LA 2QY9A 5DLQC 5E7JA 3KJIA 4DLUA 5DNYB 3M0EA 2P5TB 3S2HH 3KFUA 1RYHA 1SVMA 2V4DA 4MKHA 2QMEA 4TTQA 4XVRA 2R7ZH 4F4IA 4NXNL 2ODWA 3W5OA 4QBHA 2PI2E 2UVQA 5IK2A 2OXRA 2KB0A 5E7IA 2R62A 2IS2A 3WBKA 2PEZA 3LD9A 4PX9A 4V03A 4LF7Q 3AYHB 2EVWX 4B3RL 3B1YA 5DO9A 2WAXA 5AWFC 2ZXUA 1AKEA 1G5PA 2IT1A 2QMUA 3IILA 4RY2A 1DOAA 1VQEA 3FMOB 2E8GA 3WNBA 3ECCA 3EZFA 1LYLA 1A7JA 4GI7A 1G21E 4TL9A 4TLBA 3KLRA 3NE5B 1PH3A 4A4IA 821PA 4M21A 4XTRA 2OEPA 4CEHB 3TNFA 2VZAA 2J0SA 2WKRA 3PEYA 4WJ4A 1TEXA 2R7ZG 1RW4A 1E0SA 5JCPA 2XJ9A 5HZKA 3I4OA 1IBKQ 1AE2A 3MXNB 4R4TA 1ZUIA 2LKCA 3KKQA 3KL4A 3LW8A 3MEFA 3LRPA 1Z0AA 3RSOA 4KKUA 1XNRQ 4Q7MB 3B1WA 4GP6A 2H92A 1N5JA 2QBYA 2P67A 2C95A 2GJ8A 3UIEA 1E2GA 2AUJD 1M6NA 2SHKA 3ZS8A 5C1BA 2J0QA 1U0JA 1M8PA 1XU4A 1JALA 4R4OA 3RWMB 2PMKA 3M3YH 3D7MA 2JXMB 1Q86C 3E70C 5KNCA 3ER0A 4B43A 2EYUA 2X2EA 3MUFA 1VQDA 3F5FA 1XMSA 4KFUA 4QIWE 4DDWA 1GNQA 2E74C 2GZAA 3CPHA 1Q1EA 2KCMA 3QEJA 1NN5A 4JS0A 2Q9CA 4BLOA 4LW1A 2HHHL 1ZCBA 3A4MA 3GJ5A 3THWA 1G8FA 3CQZH 4TMZA 1Z3IX 2W6ID 4PO9A 1OH6A 2E87A 1B8AA 4FXPA 5K8IA 3GFTA 3EPJA 1W49A 4J0QA 4S35A 2JLSA 2J5XA 2WM9B 4J15A 1Z6AA 2ZRBA 1G4AE 4NCJA 4ZDJA 4H44C 5LB4A 3EN2A 1Q3HA 1Z0IA 3AKEA 2UKDA 5HZHA 1W46A 4GZYC 3R7WA 4PZYA 4JI7L 4JI8L 3VA7A 5E7NA 3VU9A 3EPLA 2A5GA 2G3YA 2OLKA 2O8DA 3S1QH 3AVYA 1ZD1A 5FOSA 3PIPA 2ZI5A 3JVVA 1M7BA 4RJLA 4JI0L 1KSJA 3TS2A 5KSOA 5KSZA 1FTNA 1GL9B 4LZZA 1N0VC 1T3LA 1GRQA 2QZ4A 4HAZA 1H65A 1SVIA 2WJIA 4P72A 5DN6A 3H0GG 2QGNA 1JJ2A 2NO0A 1IBML 1RFLA 4O0AA 1JEDA 4D4LA 1TPZA 2RGDA 4DEXA 4AYTA 1G19A 4B73A 4HYYA 2AXNA 4BFTA 3GFOA 5J4HA 4AKGA 4HB4A 4PSKA 1P60A 4DR1L 5JEDA 1Y1VG 4OI2A 2GVBA 2PZFA 4WXPA 4E5UA 5FTNA 2FGJA 4DV4Q 2WV9A 2XNSA 2C04A 5HCIA 4N1AA 5KTYA 3AEVA 1SVWA 2DNEA 2IXGA 3D6TB 3I32A 4A3MG 2FXQA 3L0OA 1PUJA 2ZRCA 1KAWA 4PPGA 1E3MA 3KTAA 1YU9A 3T35A 4AK9A 1Y8OB 2GXQA 4G5RA 1HTPA 4PHGA 2QBYB 1CLUA 5JJKA 1UDWA 3VKWA 1O78A 1DPFA 2V7QD 1F48A 1OKKD 3U3RA 2D2EA 4M1OA 4JJZA 1A63A 3C4JA 2IS6A 3GTLH 5HPYB 2IEZA 5FBLB 4PTLA 1G7CA 5FBQB 2YOGA 3LBIA 1W4BA 1U8AA 4X6AH 2F1JA 4TL6A 3W1GA 1DG1G 4EJSC 3I2ZA 3VX3A 4DDVA 1BMFA 4X66Q 3A1WA 2UUBL 1PMRA 2ATXA 2OCBA 1X9NA 2VPPA 3F8TA 5IYDG 3L2PA 3AF2A 4LFCQ 2QM8A 1K5GA 2IF2A 2R2AA 2VBCA 1JQJC 2RCNA 2AK2A 1ZU5A 3BFKA 2Z6KC 1KO4A 3THWB 1P72A 3NG1A 3Q5DA 2I5MX 3B60A 1IZ6A 3MG9A 2OQKA 3WRYC 2OSBA 3CW2A 5DHAA 2O8BA 1M1KC 2HT1A 1TX4B 4KN7C 3OW2A 2ONJA 2PCFB 1I94Q 5KNBA 1IM2A 3PIOA 2NN6I 2JA5H 3EA0A 4JKIA 2YHSA 3GLHE 2HJGA 4AI6A 5FUXA 1GDDA 3I92A 2ZJQA 3L0PA 2P0EA 2A5DA 5AUPB 1NBMD 3ND8A 3B1XA 4PAMA 3M85A 1MRNA 5K8TA 2L5TA 3L0SA 2P6RA 5C44G 3R7WB 2R6CA 4KU4A 4JBXA 4LBVA 4LUCA 1Q46A 1Q57A 1FVIA 5GADl 3A4NA 2O8DB 1AGPA 1YQTA 4DV3Q 1KKMA 4A36A 5FOVA 4KLKA 2R6AA 2ZS9A 2Q6TA 3C41J 4DV2L 1X6OA 1HJPA 4B3TL 2AHOA 2NO7A 4GZLA 2VEDA 1U9IA 1IONA 2JJ2A 2DWPA 3RYTC 4B48A 3TGPA 1VF7A 3EW9A 1G3IA 1X1SA 4LOAA 5IWAQ 1KMHA 3NTUA 4NU0A 4RMFA 5LMUQ 5FUYA 3PSIA 4Q00A 1QVGA 5HE9A 5LBIA 3HOZH 1E9DA 1V9PA 1G6HA 1ZYUA 4A8JA 2A68D 4XD7A 1GVPA 2Q3FA 2BEJA 2PT5A 2HF8A 4A92A 4M0LA 1Q1QA 1QHGA 1K0RA 4YY3Q 3IEUA 3ZZTA 4B3MQ 1G7TA 5E4FA 1TU2B 3I8SA 1XTSA 2JA8H 1UEJA 1YE8A 4G7ZC 5GQOA 5IYBH 4PSVA 2ZRLA 1GUNA 3UE0A 3TW8B 2ZRHA 1AQUA 4CT5A 3KTAB 1I5FA 4G01B 1SXJA 2ZYVX 1EQQA 3EZ9A 3RRZA 3SBDA 1IBRA 4FCWA 4JI4Q 3NEJA 2ZRKA 2QEQA 4QBIA 3NXSA 3V00A 3HOZG 2WIAA 2XXAA 1R4AA 4KSCA 1JECA 1YVCA 3LX5A 5M5XH 1Z07A 1ZW6A 4IDOA 1HE1C 4AKEA 4PPQA 1GKHA 2H18A 2FJUA 3CCRA 1AS3A 1GUAA 4HUQA 1P9WA 3LQRA 1VG8A 3RLNA 4N3NA 1K8RA 1UADA 3NBZC 3KF8B 3QXCA 1TNDA 4GOKA 2BBWA 4PAOA 4A93G 3LBNA 4QGHA 1AGRA 1FL0A 1HYQA 5IYBG 3B1VA 2V6IA 1X8JA 3EPKA 3DM5A 1IOZA 1IN7A 2DYKA 2OZEA 1NTGA 3PITA 1KRSA 3GLGE 2QROA 2DB3A 1JR3D 5HR5A 3ZVMA 5EJEA 3AFQA 1EWHA 1VYUA 1D7QA 2O8BB 2OFOA 4C0HA 4K8OA 1W3SA 1II0A 5KYKA 3F3YA 3TMKA 2WSSA 3G71A 3LLUA 1NNEA 1B23P 4Q7KA 1P2TA 4TSFD 4M53A 2F4VL 4JLKA 1YHBA 2IUUA 3SDZA 2WVJA 1FNNA 3A0JA 1LM0A 1E9FA 1GL6A 1A1VA 2OCEA 2P6NA 5DISB 3NBHB 3KQUA 4NONA 3SJZA 2AX4A 4U00A 4JLPA 2JE6I 2IYLD 2E1RA 4A3KH 4X8OA 1XCGB 4US2R 2VP2A 1DXMA 3TLXA 5FH9A 3PO3G 4GKKL 3JC66 2WFWA 2AHOB 1TWHH 5AJ3L 4UY8C 3VR4A 4DR3Q 5IHPA 5FR2A 3UPUA 2B63G 2B7BA 5CLQA 2AMCB 1AA9A 3FMCA 4K0KQ 1KAOA 1KMHB 5ANRB 2A69D 1EFWA 2XTNA 1QZHA 3RANA 1ZC3A 1ZYRC 3DL0A 5J4YA 2GF0A 2IYUA 4A4DA 4ZIRB 1N6RA 4BFYA 2F6RA 3G82C 2ZRMA 4A8JB 1S1CA 2J7PD 1Z7TA 3SJBA 4Z1MA 4L5SA 5DSZA 2XB4A 2OM2A 5M3FH 5IT9c 2VQSA 3U50C 4IOMA 3RC3A 3CRLC 3QG1A 1J6QA 5C0XI 4LWZA 3BJIC 1TL7C 3IKJA 3TQYA 1BKBA 4QGUA 3GO5A 2ZAMA 1NJIC 3K0SA 5HE8A 2C2HA 5EZ5A 3VR6A 1ZM7A 2A5YB 2D3WA 2NO1A 5LDDC 3RS0A 4NXML 5BR8L 1Z29A 2WSMA 3LNCA 3CP0A 1VKJA 4QHSA 1KZGB 3NC0C 3CF2A 5EE5B 4DWJA 1F60A 2O8FA 4JBMA 1XMQQ 3FGNA 2QAGA 4QFMA 2IUTA 1P8LA 3H86A 1GUTA 1YNXA 2XXAB 1KGDA 1VQOA 1W4RA 1FL9A 4FCTA 4K81B 3QKTA 1RVDA 5GJCA 2OFXA 1OH8A 3VKHA 4QOSA 1MOZA 1NJGA 4LYHA 3M4OH 1P16A 4BFWA 5M3FG 4HUQB 1E0AA 2WWXA 2EFGA 4XWAA 2D74A 2V8OA 5J40A 2CKZB 1ZRHA 4YCVA 2W6JA 4KJZA 2AXPA 2NTYC 2ZS8A 4NCHA 3CONA 4LUVA 3EPHA 1VF5C 1Z6YA 4AY2A 1JJGA 1JBKA 4HIDA 2ZROA 3CO5A 4X64L 1EWQA 1SMXA 1NMYA 2IHBA 4B6FA 1B9NA 4DNRB 2UXBL 1R8SA 2PJRA 1AQYA 4DUGD 2XZLA 2WIBA 2GZDA 3UG7A 4PSAA 3H2YA 3V4FA 1X86B 4XWKA 3ND9A 1E2DA 1VMAA 1ESMA 2FG5A 1XTJA 3EAQA 3RS2A 2A7QA 1KMQA 3TSWA 4QKQA 4NB3A 3AP1A 5IT5A 1NJFA 3PENA 3X1YA 3R8FA 3FMFA 1YZQA 2A68C 1PHJA 4LYAA 1R6BX 1KY3A 2JIZA 3WMEA 2XTZA 1BKDR 2V6JA 4DV6L 1OSNA 3NEYA 3IUYA 1DELA 3BB1A 1XD8A 2KBEA 4JVLA 2FN4A 1N5IA 4ZKDA 4MGZR 1VIAA 2ZJ8A 3KB1A 3ZYCA 3KJHA 4EJSA 2J45A 3RLFA 2G6BA 1F5NA 3CPFA 3KQKA 3W90A 4AQYQ 1NG1A 3GPLA 4HSEA 4DCVA 2OV2A 4IQZA 2Y0SE 1AIPA 2QTFA 3EC1A 4IOLA 2PH1A 2ORVA 1E1TA 1TWGH 2Z6KA 3GTGH 2WJYA 2Z83A 2NPIA 3NKVA 1Q82C 5CK4A 3W34A 3O8RA 3B6EA 3Q85A 2DHRA 3WYAA 4E07A 1D5CA 1E2LA 3ZQJA 3JZMA 4ERNA 1ODFA 4HAUA 4LV6A 3DO6A 1MO5A 2GETA 5G53C 3AVVA 4LF7L 3QVUA 4Y7NH 4R98A 3D0FA 4QBFA 4GS3A 1C1YA 2X8AA 1X54A 2QA5A 3MJHA 1KSFX 2BBSA 1HA3A 3KF6A 1E99A 2K4KA 4BBRG 1VQ7A 1S0UA 1HT1E 1S8FA 2ZS7A 1E2HA 3QXHA 3SI7A 2WWHA 4BY7H 3DZ8A 3G0HA 3C16C 1ZVQA 1FYCA 2W0MA 3R8CA 2RB4A 1E1OA 4A75A 2BWJA 1SR3A 3GMTA 1KSHA 4PMWA 4JIMA 2VS1A 1FZQA 4HDOB 3A7AB 3KKNA 4TYPA 4Z51A 3REFA 2Q8IB 1IBKL 2CJWB 2VRWA 4A3JH 3TVTA 1VQCA 1CF4A 5JWOA 3S14H 1L0WA 1V8QA 1AKYA 1CJKC 5SZIA 3C8UA 4JL6A 1GO3E 3RRMA 4TYYA 1KI7A 3CIOA 1E1QD 2ZSBA 1X8LA 5GVSA 1HNWQ 1G9XA 1YNJC 1N9WA 1Q1ZA 5A35A 4TQUS 1E24A 1AZSC 2EW1A 3BBPA 3LFUA 4BY7G 1IAQA 1R0ZA 4IFEA 3U6BA 1ZNZA 3U3MA 3TAUA 3FMPB 4C3JH 1QHHA 1NVXQ 4KVGA 1UAAA 5BN3A 1OYWA 1P61B 2OCAA 5SZHB 4F93B 4U02A 4ME3A 1CRPA 3BAFA 5L3VA 3KKPA 2PBRA 1WB9A 1ZKOA 1Q22A 5HCNA 3UXMA 3M4QA 1PYBA 3MMPA 4IDQA 4X65Q 2VW9A 4ZCIA 4KSBA 5FPTA 1VQIA 2W6IA 3MAAC 3V4RA 5K36H 4OQFA 1SFOH 3PJRA 2VHUA 2KBNA 1J90A 4NP6A 1VDZA 4C4PA 1IN8A 3W5JA 3SJAA 2CLDX 4OI1A 2GCPA 3TR0A 3AVWA 5JJLA 1SGWA 4B2PA 4LJ5A 4AC9A 4JLOA 2REBA 2DN8A 1DARA 4TL7A 4BEJA 2B3GA 521PA 4EJSB 2ZU0C 2GK6A 2F1MA 3UG6A 4TYWA 5C0XH 3EIVA 1LS1A 2FSIA 4TQAA 4LFAQ 2FWRA 4DK3C 2J7KA 1JMCA 1C0AA 2ZYWX 4M1TA 4Q1AA 2YV5A 4FD2A 3FKIH 1A82A 1XXHA 1P75A 4M9SA 5EUQB 3ADDA 3Q72A 4L5BA 4DLSA 4GDFA 4IEIA 2D0PA 4DUZQ 4LJ7A 3G48A 4M8NE 3GJXC 4JL8A 3CPWA 4M9QA 1QVCA 2UXCQ 1G291 2F3IA 1C4OA 4G7OC 5K36G 2VSFA 4GLXA 2OG2A 1VQLA 1SN8A 1Z06A 1IQPA 4NDZA 4GOPA 2KHIA 3IHLA 1KK2A 3QUSA 8OHMA 2O5VA 2IYYA 4HJAA 2EU8A 3LLMA 3OIVA 5F3WB 3KF6B 2FSHA 1Z6XA 3K53A 1T9HA 3MRSA 2CNWD 5TXGA 5C0XG 3PCRB 2QGZA 1GKUB 3H1TA 4DAMA 1K6MA 1JPNA 4DR2Q 1KI9A 4L5QA 2F3TA 1UE5A 1CR1A 2B29A 4LF4Q 1ZM9A 3FKIG 2GCOA 2GEDA 2W2TA 3LW7A 4DJTA 1HZ9A 2V1XA 1NMGA 1KDTA 2ZJAA 3RC8A 2HT6A 1TADA 2QU8A 2GXSA 3NIBA 1IXZA 1QVFA 3KFXA 4TT3D 2JLXA 1QUQA 3AUXA 1XCMA 3NWJA 3N6RA 3BXZA 1E1RD 2JA6G 1PUIA 1E4YA 2V7QA 4Q21A 2JLUA 2LSSA 1KHIA 1NIJA 1RRGA 4MGIR 4IDPA 4LPSA 4OK5A 2AR7A 1UFQA 3DPUA 3A8KE 1KD1C 3GJ6A 5AJVB 3T1VA 1G17A 2JLVA 2OO7A 4X66L 2D7DA 1QHHB 5HGQA 4BZQA 2CHGA 3X1WA 1DAEA 1F3OA 4GBMA 2V1UA 4JG2A 3I4MH 5DI3B 4II7A 3W5IA 4JI6Q 5JFGA 2RAPA 4BZXA 2BJWA 3FFBA 3B6YA 1KC8C 2UZIR 2WPDA 3WNDA 1JXOA 1I94L 3RR5A 1ASZA 4NCNA 1QBKC 2WAQE 1Q7YC 2IYZA 3FHWA 2NZHA 4LHWA 5M5YH 4W5WA 1HNZQ 3GLFB 3KFVA 4LF6Q 2GXAA 1ZMXA 1IW7C 1VQ5A 4DDUA 1E69A 3AVQA 4DAYB 1XJ0A 5FPSA 1M2OB 5JWHA 1PA6A 1NBMA 1TMKA 1GOTA 1YZ6A 4DV3L 1NIPA 4Q9LA 3IO5A 4D6PA 3WXMA 5LMNQ 5GADC 2JA1A 2NO9A 3Q8DA 2FFAA 2VHQA 1R0YA 2XSZD 4LPKA 4JYAQ 2N78A 1KI1A 4RZXA 2EXDA 1R0XA 3E5HA 2RHSB 2VP5A 4HAWA 5IWAL 2FFHA 4OQLA 5KPDA 1CSQA 1E2QA 2WOOA 1XB2A 2YNMA 3ZZ0A 3BE4A 5IF9A 5LMUL 4RD4A 1VCOA 1XTDA 5FFMA 4ZI2A 1E6CA 4KFRA 3CF6R 1Y8NB 2YWEA 4JVMA 4PC3A 1G5TA 3LDAA 4P4SA 2IX1A 4O0MA 1VQ8A 1C9KA 4LK2A 2XGJA 4DR5Q 5JEAJ 4JZKA 1IY2A 1YR6A 2CL6X 4YY3L 1LY1A 1YZTA 1ONLA 4MQBA 2EJFC 1PJRA 4PC2A 1XTRA 3AKCA 4Q7LA 2EFCB 3DHWC 4BBSH 2O8CA 3CCMA 4N0EA 5M3MH 4YXWA 1W36D 4HIKA 3KKMA 3Q7PA 1FTSA 3I5XA 3BB3A 2IY5B 4TYNA 4DV7Q 5C46F 1SVOA 4QGGA 3PUZA 4IPGA 4ABYA 2N1BA 1Q21A 4JI4L 3GTJH 2EVBA 1JE5A 4IO9A 2VLIA 2W00A 5JECA 2FFBA 1BOFA 2J0UB 2PZEA 1QUQB 1ZBDA 3FKSA 3CR7A 2WJVA 4M1WA 4RD1A 4WVFA 3HJNA 1YR9A 3QF7A 1E2MA 2ZSFA 4PHHA 5FTLA 1G3RA 3SJCA 3EA5A 1NY4A 2HUPA 3PGZA 2D2FA 3KDSE 3QQ5A 4Q4HA 2GK7A 5GAGC 2MFIA 1NMFA 3KYHC 1PFSA 4IVRA 4L5RC 1G51A 1PH9A 4E22A 4OWTB 1PH5A 2O0HA 5M3MG 1QJOA 3OZXA 4ZV4A 4GLAC 1JEEA 4JLBA 2IS1A 3HOVG 3LNNA 1JR3A 2ZYUX 2R6DA 5J5CA 5E3HA 1IBLL 3NH6A 1DO2A 3D31A 1QZXA 4GKJQ 3OAAA 3UKDA 4PO8A 2V1CC 1E98A 3L8ZA 1IL2A 1G6PA 1OXTA 2VYFA 4TSFA 5G41A 2NO6A 1WP9A 3X2SA 2RF4A 1XMOQ 2EIFA 3G5UA 3ADKA 1I6VC 2DWQA 4WA7A 4UNQA 2Q3MA 2F9LA 4M1MA 4BEBA 1EFRD 5AR1A 5A5GA 2JDIA 3QENA 2FEMA 1QRAA 1NRJB 2H17A 3SHWA 1N32Q 1TTTA 1EK0A 1SXJC 2ZRJA 4DR3L 4B3XA 4F38A 2WWYA 3LY5A 4L15A 3TK1A 4IVQA 4B2IA 3AVUA 4K0KL 1ZNWA 3GTPH 2FZLA 1GILA 3RSLA 1GZSA 3I72A 3DM3A 1R8QA 5JJIA 1Y3AA 3VTKA 3OTOQ 4KAXA 2EDGA 4LNQA 1XNQQ 2L15A 3UDIA 1NP6A 2WOJA 3KXIA 1P62B 2FSFA 2QE7D 1TU3A 4BQSA 5BYKA 1I2MA 2PQAA 4H02A 3CH5A 5FTJA 5CIWA 4B71A 3STBD 1GSIA 1EUJA 3CR8A 3KJOA 4JI2Q 1UWVA 4QNMA 1GG2A 2J7PA 1RL2A 2OQ0A 4DR4Q 3U44A 2VHJA 3UANA 2F7SA 3S1RH 2Y8EA 3TVDA 4G5GA 3BZKA 5FOWA 2F55A 1T4GA 4OL0A 3H15A 4PPFA 2O8CB 5L3RA 2ZETA 1NMZA 3T1HQ 3SN6A 2CFMA 2GNOA 5JHGB 2A6ED 2DFKB 2ID0A 2OLJA 5FR1A 5KHOC 2C9CA 4DV1Q 4JKYA 1Q90A 3T15A 3OFND 2I0QA 1XMQL 1KNQA 2ZITA 4XOIA 4XSHA 3B2EA 4PPNA 1VG9B 3T1YQ 3FFAA 1SHKA 4NYIQ 1X65A 1DD2A 2RHDA 3W3AA 3WWVA 4Q1EA 3T51B 3SQXA 4X8MA 4X62Q 2EFEB 5K8LA 3OEED 2F43A 3K0FA 4L9WA 4Q4HB 1X6VA 3ZD7A 1YZLA 2VP6A 2QSZA 5JHHB 3TKLA 4EPXA 1D6JA 1S3OA 2R8RA 3A6PC 1E2PA 2CLSA 2ZJ2A 2OTLA 4IEEA 3K9GA 1BYUA 1CU1A 1NN0A 2X19A 5BXQC 1Z8FA 4PAQA 4KKTA 2J9RA 1R5BA 3K09A 1NN3A 1DO0A 1HZCA 1U0LA 1KI8A 3ZIAD 4B3BA 1HQMC 2VF7A 3HOXG 3CMEA 4H9GA 3RN2A 4EAQA 4LUZA 2XAUA 4DUGA 3NENA 2FPLA 1I4LD 2QPTA 4R2IA 1R5NA 5FUWA 4EPTA 3U3KA 1A62A 3SYNA 3K0XA 1W44A 2GRJA 1R5OA 5G3YA 2BBOA 2UZ3A 3H0GH 2EWVA 1YHAA 1XZQA 4GNKA 1Z6TA 4MNOA 2CLCX 4HZUA 4MYCA 1H9KA 4AYBG 3LQQA 5EP3A 1Q81C 5KNDA 3UWOA 4EPRA 4V02A 4MGYR 4XVQA 1W5SA 4Q47A 4PC1A 1X3EA 2ZM6L 2RHMA 3K9LA 5DHFA 1HH2P 2RGXA 1A2BA 4LV5B 1GNRA 4JBYA 2QAGC 1Y1VH 1EFUA 4C0QC 5KDOA 1T5LA 4W7SA 5FTKA 2GDJA 3CCSA 3WRXC 4AQYL 1U8ZA 3PUYA 3AVOA 4A3MH 1MKYA 1VYVA 1XX6A 4V0MA 1XJCA 2P6UA 2EYQA 4QL3A 2VH5R 2VA8A 2JASA 1DAIA 1WCV1 4UP9A 1K8MA 2QTVB 3DZDA 2OAP1 4LRWA 4HJ9A 2RGAA 5JEAH 1QG2A 3QI2A 4NYMR 3U44B 1R7RA 3CCVA 4TLCA 5TARA 3PF4A 4GLVB 3HFZB 4UJ5A 1N0UA 2HYIC 3JAMc 1E96A 3GCGA 1VCMA 4JL5A 4JYBA 4Q4AA 2AD5A 4DLTA 3FMIA 1MJCA 1HH4A 4I1OA 1DS6A 4DR6Q 4BECA 1IXSB 2QT1A 2Z0MA 4F4CA 1B7YB 3BC1A 1PZNA 2OT3B 3W1BA 1XCPA 3EIHA 5IYDH 2HXSA 4CVNA 1E9BA 2G77B 3K80C 2C99A 121PA 2IHFA 1W1WA 4YMUA 1O7LA 4NL4H 1II9A 2UXDQ 4JJKA 2ERXA 1AN0A 2F43B 2ZRGA 2VIIA 5JEAG 3BRWD 3NVAA 4DR7Q 2KSQA 5JSZA 2JEAI 1W4CA 2ERYA 1QVAA 3OE7D 3D3QA 4D4KA 3AF3A 5B58C 1YI2A 4G1UC 1IJFA 1OIXA 3C14C 3FPAA 3WDNA 2K14A 4A3IH 1LABA 5GROA 1SRUA 3A5ZB 5C44H 4H13C 1HNWL 1TF7A 3M1IA 4MH0R 4WZAE 3UDGA 1QHYA 4UXJA 5AJXA 3H3VI 1S2MA 2LWIA 3ICEA 4Q66C 2AWNA 3T1OA 3ASZA 2B8TA 1YR8A 1TWCH 2JEBI 1V1QA 4A0GA 3GLFE 5BN5A 3N70A 4B33A 4NKRA 3F2DA 2BMFA 1IY1A 3CCJA 2JLZA 1H9RA 4KLNA 2PJZA 4Q02A 2BCJQ 4P0TA 4DKAC 4LI0A 1IYUA 4IRUB 4R71A 2P5SA 1S9DA 2HLDD 4A9AA 4DCUA 2BBTA 3A58B 3O8BA 3HYRA 4HZUB 1EXMA 4AKHA 5JS8A 2G0NA 3STBC 4GMDA 1WFQA 1E9AA 1U81A 3LXRA 3J80i 4EFLA 4A3IG 1ZIPA 3QJYA 1G4UR 1WE2A 2RH5A 4DLVA 1RKBA 3VU9B 3E1SA 1GKYA 4MKIA 4YQFA 1UM8A 3AEZA 4I4LA 1IXRC 4PZ8A 3K0AA 3DEFA 4XJXA 1KJYA 3F0TA 3GEIA 1SMYC 3CNLA 1MO4A 4Q9IA 4QJFA 4YLGA 3TRFA 2ASBA 1XJQA 3CRVA 2QMOA 4IFBA 3FKQA 1E32A 2CW0C 1VCNA 2WWGA 4DUZL 1ZM4A 1E0KA 4KYUA 4A3BH 1ZP6A 2OWOA 2UXCL 2DWOA 2YC2C 2YWHA 4L5TA 2IX3A 1SKYB 2K7VA 4G5QA 2CQOA 3K81C 4C2TA 4B3DA 4HIMA 4QG7A 4RG1A 3NHBA 4Q4AB 4A2QA 5ELNA 2NVXH 1FNMA 2FZ4A 2VP4A 3DVLA 5FPHA 1WBDA 4L8GA 4IW3B 4DB2A 4PR0A 2PL3A 2QAJA 4DK6C 4A93H 3AKDA 1Z22A 3G4SA 1K9MC 3ZDQA 1EX7A 4URZR 3RABA 4HIOA 1ZINA 2GJSA 1SLJA 1PH2A 3ULJA 2Z6VA 3UK6A 4BRWA 2CNWA 3K8AA 4DR2L 2PLFA 1CSPA 4LF4L 4DEYA 2JJ8A 1M1YE 1N6KA 4OK3A 3RWOA 1XEXA 2WICA 4BXXH 1VQFA 1E0JA 4JK1C 2D06A 5M5WH 4QL5A 3B9QA 4KFSA 1E7ZA 4POAA 4A3BG 3UE1A 1N25A 1T8UA 2CCKA 3W6NA 5JSZB 4Q01A 5FOXA 3QXJA 3LA6A 4DSOA 2ZTCA 1U99A 4LC1A 1N34Q 1H8ED 4DIEA 3N2IA 4DCTA 3T53B 2DFLA 3TW4A 3AVTA 4M4SA 4F92B 1KL9A 1A2KC 1E1RA 4EDHA 5EE0A 1CS4C 3X1DA 3EIQA 4A0FA 3K7AH 2H1LA 1KI6A 2PCLA 4DRZA 2IK8A 2GWHA 4WBSA 2MNAA 3PO3H 4EUNA 3AGQA 1W7AA 3FDIA 4C7OA 2EQBA 1DBSA 5CDFE 4LBWA 4XTCS 4P4TA 3RRYA 3I61A 2IYSA 1CKMA 3PFIA 3A8IE 2B63H 1XTIA 3FYHA 4BXXG 3L0IB 1XEWX 4O2RA 5G3ZA 4JI6L 2ZM5A 1KIXA 2J0VA 3CMAA 3PEWA 1CJTC 1KOFA 2QRZA 3ZJYC 5FOTA 4GOPC 2WJJA 4LYFA 2BKEA 4TMWA 4OQNA 2IHEA 3B85A 3GEHA 2RGEA 2ATVA 1HNZL 4JVSB 4LF6L 2AD1A 4CEIB 1X55A 2GEVA 2V9PA 4OI4A 1NVWQ 2AUKA 3SHFA 4QRHA 4HUTA 2YYZA 4R9UC 4M1SA 3U61B 1HR0Q 3T61A 4D25A 4B74A 4V0NA 2KENA 3T34A 3WP1B 3K0AB 3TS0A 1B9MA 1SVSA 4A2WA 4B34A 1YJ9A 1ZIOA 5LMNL 2I1QA 4GT1A 2Z4SA 1HEIA 2MO0A 1UF9A 2JLQA 2W2VA 4JYAL 3RNUA 1OW3B 2B8FA 5FL7D 2W0SA 3NELA 2FU5C 3U7EB 3AP2A 5KSPA 1ZD8A 5FUVA 2ZUDA 2XSZA 2BV3A 1L1OC 1W0JD 3RN5A 2ZE7A 4MRSA 1KHTA 1COWD 1Z0JA 1Z0DA 3SE0A 1H9JA 2WMOB 4LCBA 1OIWA 1JJCB 1MO6A 3QVVA 2Q2TA 4FMCB 4GFDA 4F91B 4YONB 2YTVA 2VSOA 3J7ZC 4DR5L 3QNUA 2XGTA 2VP0A 4P31A 4D4MA 2ZVQX 3CUEF 1AE3A 4UXIA 1GL7A 5EXSA 3T12A 3IBYA 4A1FA 2FNAA 2F1IA 3TR5A 2DBYA 2NPFA 4EX5A 1M34E 2NOAA 4ZCLA 3KLWA 1MABA 2AKAB 3SZRA 1NVVR 5JBQA 1T5EA 2EJMA 1KYIA 1SXJB 1NY6A 1XEXB 3FHOA 1EQRA 1XMJA 5JMTA 4EPVA 4DV7L 2E2JH 4KBGA 4NYMQ 3FVQA 3R9IA 4LJZC 5DH9A 2IWRA 3V9PA 1F2UA 3CXCA 3AF1A 1LTQA 4I99A 1KO5A 5ELXA 3JVUA 3K0CC 4A3LH 1H8HD 4OO1I 4ACBA 4BA2I 2OAQ1 4TMTA 4DIDA 2NVYH 2F52A 2OESA 3MCAA 4L16A 4PV1C 1IY0A 3ZD6A 4IOAA 2C35B 3HOWH 1KI6B 1W0KD 2NN6H 4YCUA 2WTUA 5G40A 3GFPA 3K9NA 1KDRA 4KLZA 4C7OB 2CWAA 3MLEA 3IIKA 1YZNA 2E75C 2IXEA 4MUAA 4OJQA 3WNCA 2ZE8A 3GJ3A 4TTRA 2CHQA 2PCJA 4L9SA 3M7NA 4XSGA 1FMJA 2ZSAA 5C2JB 4I7ZC 3U4QA 1G20E 4P71A 3U4ZA 1EFTA 3CBQA 2IYXA 2F3RA 4MYHA 4A82A 4AG6A 3HOUH 3TUJC 3B8HA 1X56A 4GKJL 2E76C 2CK3A 2IHYA 3T1QA 4DV0Q 5BQ5A 1CFMA 4A3LG 1WBBA 5IE8A 2P65A 4Z8YA 1TKWB 1IN5A 1RE0A 4W5HA 1ZUNB 4FIDA 1SROA 3UDFA 1UBGA 1XMOL 1AJEA 1N6HA 1NLYA 2PNRC 2RHQB 3HOWG 3A37A 5J4VA 4D82A 3IEVA 2NN6G 1OPXA 1CTMA 3K70D 5J3BA 2FF7A 3T06B 4B6EA 3EG5A 5KOYA 4KYIB 4URYR 4MRVA 1VIYA 4EFNA 4BBRH 1OXSC 1N32L 4RKEA 3U7HB 1MRSA 2D7CA 2WWFA 2R6FA 4JLVA 1GD7A 4YMWA 2UUAQ 2YWGA 3SU8A 2O8EA 1L2TA 4LSGA 4DUYQ 1Y14B 2N3SA 3HOUG 1G41A 3OTOL 2I1VB 1GWNA 1XNQL 2GAOA 3UWKA 1YJ5A 4TWZA 5EP1A 4IPDA 3CRKC 3M4YA 2BMEA 2GHIA 1RZ3A 3U2QA 4CT4B 1GHKA 4YMVA 1RRPA 1P2VA 2QE7A 4JI2L 2GTPA 3KXLA 3K0EA 4DR4L 3U7FB 1DGSA 4AH6A 3W9YA 3HGBA 1WYDA 4HJ8A 1WRBA 3UATA 1FW6A 4BPBA 1SVKA 1T6NA 4NHOA 1UKZA 4M9ZA 3EXAA 2FPMA 5TVKA 5CJPA 1MABB 4MRRA 3T1HL 3KKOA 4BFSA 4RD0A 4BFVA 2KA7A 2V3CC 2BMJA 2ZAOA 2DFTA 2CXXA 2QAGB 3CZQA 4Q48A 4UXHA 4DV1L 1Z5ZA 4S2EA 3KQHA 1W36B 1IXRA 4B2LA 5D3QA 3CX7A 4UNSA 3T1YL 2C9OA 2ZR7A 3OFNA 1F2UB 3U6KA 5K8UA 2CWPA 2WB1G 4C30A 3BDOA 1JPJA 1UEIA 2QEXA 4X62L 2HEIA 1XNRL 2FMXA 3H4MA 4ZCMA 4PXAA 2NIPA 3K8YA 4FMDB 3LX8A 2AFHE 1Z2CA 4HAXA 2YC4C 3TSZA 2BM0A 2VO1A 3O8DA 1HV8A 1XDBA 2GEUA 1N6LA 4NPHA 1X8KA 2O0JA 1FP6A 1KY2A 2FV8A 1LNZA 1GVNB 221PA 4IDHA 2Z43A 4QBGB 3U4QB 1VHLA 2CE2X 1E2WA 5BYJA 2PNHA 4B76A 3T5DA 3LBHA 3UMRA 2ZRDA 2A69C 4I1SA 5C4MA 1Q1BA 1CIPA 2ZEJA 3ZIAA 2C77A 3B82A 3HR7A 4ZPXA 5EE1A 4EPYA 5DE3A 4D81A 4BRUA 5F98A 1K8OA 3AFPA 2AL7A 4QJ5A 2ZT9C 1S1MA 1EIFA 1CXZA 1XMIA 3O8CA 4AKIA 4Q1BA 1JI0A 2ZI4A 4LJ9A 3S1MH 3IIJA 1IN6A 3DOEA 4LY6A 3AM1A 1KI2A 1VCIA 2NZ8A 2ONKA 4GOJA 1GM5A 2GCNA 4HAYA 4CEIA 2Q3HA 4OX9Q 3WMGA 5FLMH 3CC2A 4P4UA 2D0OA 5DYIA 3T56B 3CH4B 4X8HA 5LD2C 5C18A 3A1SA 2VUMH 1PH7A 2XITA 4JI1Q 2PLRA 4JT2A 2WWIA 3HKZG 2A6HD 1G8GA 1SKYE 2XTMA 3TE6A 4YCWA 3WY9A 4DLYA 2O8EB 1Q0UA 2EJGC 3M4PA 2D2CC 1P6XA 1U0HC 2IL1A 1QZGA 1GIAA 1P4SA 2ZJPA 2GVZC 1SZPA 3HR8A 5SZKB 1KJZA 3VKGA 3SS8A 1KO1A 3MFYA 4NZYA 4EKDA 4EPWA 1N6OA 3CWZA 4O3MA 3X1ZA 2R92G 4R1JA 3ZJYA 2KCTA 3MXUA 1FMLA 1US8A 2H8KA 4F4JA 5EE3A 4NYIR 3RAPR 4GZMA 4V0OA 4W9MC 3S1AA 2VL6A 2JA6H 2WAYA 4D0NA 5FLMG 2AK3A 2RGNA 4JCVE 2JJ2D 1B0UA 3K09C 2VUMG 1JAIA 1RJ9A 2QUZA 4OO1H 3HKSA 4B3TQ 4DR6L 2DCUA 2FEOA 3GLHA 3IHWA 4YDSA 1GJXA 1SE8A 1XJVA 5EXXA 1OXVA 5GVRA 4DV4L 2IUSA 2QM7A 2CEAA 3ETLA 4CYMA 1D9XA 2CL7X 5A4JA 2JLRA 2K52A 5HKKD 3U5ZB 1VQ9A 4UJ3A 4XD7D 4YWKA 2UXDL 3B5JA 4GNXA 1OTCA 3S1NH 5P21A 3VR1A 3ONWA 4DT1A 2JLWA 1DAHA 1KDPA 3GD7A 1OFHA 2OXCA 3CNNA 4N0DA 5F2EA 4DSNA 4HB3A 1L1OA 4DR7L 1BH2A 4BFXA 2O0KA 1Q44A 1Q3TA 5JRZA 1A4RA 5AUNB 2GJKA 4PHTA 1NVVQ 1OKKA 3A8JE 5H1SE 3S24A 4B3SQ 3OYYA 1ESNA 5KU1A 3ULLA 2R6GA 4QC2A 2QQ0A 3K70C 4MDFA 1FQJA 3AUYA 4OO1G 3PF5A 2FSGA 3QBTA 3RDPA 4JT4A 4C0LA 2O8FB 1D2MA 2GVAA 1HY3A 1FPMA 4V0LA 4LFCL 1WQ1R 3QPVA 4OJKA 5GAEC 1T5IA 5FPYA 3ADBA 1E94E 2FFQA 2W2XA 3KX2A 3D4RA 3P27A 5DGXA 3I4LA 4Q5IA 4DLZA 3MGCA 2YWFA 3NDPA 2BE5D 2QENA 4KO8A 5TV2A 3ZQ6A 4Q4LA 1NY5A 1I2DA 2XX3A 2A1AA 2BEKA 4JLMA 4O2LA 2PX0A 3SOPA 1OFUX 1O7IA 2A9KA 4HLUC 4A3EG 2BDTA 2HLDA 1SQ5A 3W6OA 2BC9A 3MWKA 4TMKA 4PZ7A 4Y0VA 1E2JA 1K8AC 4ZKEA 1LACA 1XZPA 5BN4A 4P73A 1D2NA 2YZ2A 2ZRNA 3K0CA 1OH5A 5IRCD 2WAQG 4L8JA 1JAHA 4LF9Q 1J5EQ 4C2UA 1YZUA 2B92A 1I3QH 1N5KA 1YRBA 4KN4C 1N6IA 2KWIA 3EIEA 2HQLA 1AH9A 1G6OA 1IYJB 4KXFB 4JVNA 3ZLJA 1KJWA 1CKEA 1AS0A 1XXHB 5LB2A 3THOA 3IIMA 3BD9A 1Z0KA 2O5JC 2QQEA 1PH1A 1OHHD 2VTKA 1S3SA 1XF9A 3B78A 1GHJA 3CZPA 2I5LX 3RS5A 2ZI6A 1EOVA 5EXPA 3EWAA 4GOXA 3GLGA 5C3EG 1VYTA 4OHXA 4GOPB 2BM1A 1US8B 4GSYA 2MO1A 1NI3A 1HZAA 4A3GG 1WDTA 5JWRA 2IC5A 2ODBA 2BOVA 3S1AB 2X2FA 1SXJE 1ZCAA 1GUGA 5DLQE 3R20A 3KJPA 1C7YA 5FBRB 3LWNA 4HI0E 2VHTA 5B2ZA 4ASUD 1RJ9B 3GLHB 4B3ML 1EWRA 3KZ1E 4B75A 2XOKD 5EZ6B 421PA 1K83H 1E2IA 2VQFQ 1A5TA 4ARZA 4GMXA 3J81i 2GCOB 1P2SA 3SFZA 4BWYA 1H9MA 4JBJA 4O25A 4Z1MD 1FX0A 1J8YF 3HOVH 2XZOA 1P5ZB 3TEHB 2HCJB 5HY6A 2ATWA 2ZUCA 1UEBA 2LCFA 4DC9A 1L1OB 3QIAA 1IHUA 1Q20A 4ZO4A 3CM0A 4OHZA 1TQDA 2A19A 4LF8Q 1MH1A 4FCVA 1O3YA 3RVBA 3AB9A 2JK8A 1N34L 1VQ6A 1M74A 1D8TA 4MRNA 3ZGXA 4AIMA 4HLCA 4FN5A 3ZH9B 1GKIA 2MQHA 1H8EA 4A6XA 1G3UA 3CCQA 4FI3C 3OIYA 4TN1A 3VAAA 1QHSA 4KMUC 1J70A 4B44A 4BLPA 4R4CA 2JAQA 4OHVA 5EAYA 1P2UA 3AF4A 3HWSA 4RZ3A 4ALPA 3AKYA 4ESVA 4I81A 4GN3B 1X3SA 4LWCA 2QF7A 1W47A 3QKSA 4NTZA 3S17H 1WI5A 1A0IA 4KITB 2EFHB 3NBXX 2W6JD 5IDVA 1KKLA 2CCGA 3KJGA 2HCBA 2IYRA 3NBYC 4Q1FA 4KHZA 3RZOH 1YKSA 1R0WA 3TH5A 3J81k 3J80c 5GAHC 3TQFA 2Z5FA 3H84A 1W4AA 1BVSA 4BY1H 1YNNC 3EZ6A 3HYTA 3M6AA 4TYQA 3DM9B 2QI9C 1HR0L 2E5LQ 1XNJA 4OHWA 1PH6A 2CCZA 3S2DH 1FP7A 1N36Q 2OE2A 2OTJA 4R7ZA 4UKDA 1YBYA 2RGGA 1OLOA 1K8GA 3QXXA 1UDXA 2ZREA 4IHQA 1U98A 4KCGA 4WOPA 4MDEA 1W48A 1CR2A 2IF0A 1OYYA 1JB7A 4WJ3M 4JV5Q 4IDNA 4PO1A 1E2FA 3GLGB 3IO3A 4NH0A 4XH9B 3BB4A 3K9HA 4OBEA 4WIAA 3U58A 2VP9A 5FL7A 5FI1B 1HZBA 4MYTA 3RNLA 1YEZA 3TREA 1UPTA 4P4SB 5CYPA 5EXTA 1W0JA 4DV6Q 2YOFA 1MR3F 4BY1G 1VQ4A 4BLRA 1E9RA 1WCMH 4EQ6A 5FBVB 2G0TA 4M9XA 3W8NA 1LB1B 2QA4A 2CL0X 1ZJ6A 3C15C 4C0AC 2WHXA 3KDFA 4POGA 4ARZB 1E2NA 4JC0A 4HAVA 5FBWB 3GLIA 3LH5A 3Q8XB 4OWXB 5L8VA 4Q19A 4P74A 3PUVA 2ZR9A 4RKFA 4QNRA 2ZRFA 1J7KA 2AKYA 2QP9X 2R93H 1FX0B 4HLQB 2NZOA 5KUTA 2ZSDA 3QOFA 1P7CA 2UUCQ 2WBLC 3MD0A 2QT0A 1Y1WH 3HOXH 5GJWC 2BE5C 2NVQH 3CB4A 4X8LA 2GXUA 2D62A 1G5RA 1G8PA 1E79D 1EGAA 2J59A 4OWWB 3GJ0A 1FUKA 4XIGS 1ETUA 4YC7A 3UMFA 2ZJOA 3PG5A 1YJNA 4FWTA 1WCMG 4DZZA 1YR7A 1LUZA 4LF5Q 2BKUA 4LJYA 2DFNA 4LX0A 3TUIC 3AP3A 2BH2A 3EC2A 3K7UC 3WHLA 2K33A 1KQSA 3U4VA 1H8HA 1L8QA 4H1UA 1J99A 1ZAKA 1L4YA 4IPHA 4FINA 1YRAA 1YZKA 5KO2A 1OB5A 2IEYA 5KPJA 3GP8A 2K50A 4G0NA 5BWMA 1W0KA 1V43A 4C2MH 3I5YA 3MSXA 4UNPA 2KE5A 4D26A 5GJBA 4JLJA 5FL3A 2R93G 4QQBX 1KIMA 1JB1A 1II8A 3CRQA 3QKSB 5H68A 3G6EA 4A2PA 1RPZA 4PZZA 1Y1WG 5FI0B 5UKDA 1EESA 1U8YA 1W2HA 1ASYA 4HR7B 4TLEA 3VHLB 4GN5A 1Z0FA 1J8MF 2AFIE 4HB2A 4Q9KA 2FX3A 1MIUA 1VS0A 2OBLA 1TXYA 2OCYC 3WP0A 1S40A 4DV0L 1DTSA 5FJ8H 2Z4RA 1S4QA 2WJHA 5J47A 1DCZA 3P4YA 1U90A 5KSYA 2OCPA 1J2JA 2IYWA 4DHEA 5J4KA 5CYOA 3CRW1 1E3PA 2VSXA 2ECKA 1XRJA 3QG5A 2UU9Q 3IDQA 4TTPA 1OB2A 4DSUA 5LMNW 3KUCA 3CC4A 3VNUA 3VNVA 2X1VA 1XTKA 3AVPA 5CIQA 5AJZA 4KBFA 2QP4A 5CLLA 2J87A 2C78A 4JLNA 3D8BA 2I5HA 3BU2A 1XPRA 2NGRA 4DBLC 1W36C 1Z6HA 2J41A 1UE7A 4AYBE 2UUAL 2N46A 2DNCA 3CX6A 4DUYL 2HYDA 1XD2A 2AN9A 2BA0A 2PT7A 4LJ4A 1XBTA 2ZJBA 4KV9A 1Z83A 1NBWA 1PYSB 2PQAB 5FJ8G 1XWIA 3GEEA 4B47A 1K5DA 3DMNA 3LV8A 1DADA 2C98A 2QRNA 3I3SR 1OH7A 3OESA 2JA9A 3HPQA 4EQ6B 3MJRA 4DLRA 4GP7A 4A6PA 4LFBQ 1KTVA 2F9MA 1HUQA 2BMDA 4HLUA 3KDFB 5DI9A 4LGMA 5KDLA 4DLWA 4EIWA 3SEAA 5LPNA 3GLIB 5DIFA 4YMSA 2VHCA 5JLJA 1O87A 2ZJZA 5LD2B 1WOCA 3GTOH 2PZGA 3A5UA 2G9NA 3VFDA 3VR3A 2PMZE 4BA1I 1U5KA 1YHNA 1Q8KA 2XNDD 2V55B 3BFVA 4Q9HA 1C9OA 1ZUHA 2K32A 4MITA 5BW8A 2G1JA 1OT3A 5FLXc 3Q7QA 4TMVA 2KCCA 1KXLA 4FDBA 2Q2IA 3CF5A 1OJLA 3A4LA 3K0FB 4TMXA 2BDOA 4Y0AA 2ZU6A 2BVNA 1G1MA 3CKLA 2FPKA 3OEHD 3TQCA 4UQOA 3PCOB 4RCZA 4QGAA 1NLFA 1N33Q 4E03A 3QXSA 3LGJA 1CTQA 5CITA 5F9HA 3FE2A 1GP2A 4URXR 3CF0A 1RRFA 2LXKA 4DV5Q 4PHFA 1Z08A 1ZM2A 4BLQA 1EFHA 1E1QA 1LF0A 1L2FA 2VQEQ 1Z6GA 3BOSA 4IJLA 1II8B 2YINC 3PEUA 3PVSA 4R2HA 4B3GA 3QE0A 2N42A 4RFVA 4RZUA 1E2VA 4YHHQ 1MT0A 5CJ2A 3B1ZA 3BH0A 3CPEA 3HU3A 5M04A 3JZAA 3FWYA 3OIWA 1PV4A 2YJTD 3QBVA 1UKYA 2D4HA 2VL7A 3I62A 2H7VA 3EX7C 4X65L 5JEEA 2DGYA 1RIFA 4JI3Q 1OFIA 3AB3A 1CR0A 5IP9H 1CP2A 2ZTEA 4PC7A 1DAMA 4LK1C 1XXHE 6Q21A 4CZ2A 4Q03A 4OX9L 4D0GA 2QSYA 5H70A 3K70B 1HNXQ 3DKVA 3TRZA 1BS1A 2OILA 4JI1L 2A6EC 2FA9A 1G8HA 1VECA 4TKOB 2WPDD 3RHFA 3QPUA 3VHXA 4LFAL 1HQCA 1T0HB 1XEFA 2V54A 4Q7JB 1XD2B 2XJ4A 5CM9C 2J3EA 2ASEA 2A78A 3DKPA 4PG3A 2J46A 4JI5Q 3GQBA 1QDEA 4C9BA 3DOFA 4M22A 4K46A 3THYA 1G7SA 4OI0A 4LJ8A 4L4UA 3L7ZC 1P73A 1GNPA 4ZDKA 4RFSA 1YJWA 1DAFA 1L7VC 2MSDB 5IP9G 2ZYTX 5TB5A 1N6NA 3IRBA 1DAKA 3U3OA 3CX8A 2PX3A 3DDCA 1EX6A 2QNRA 4DNTB 2A2ZA 2CCJA 3GTKH 1KK0A 4B3FX 1IN4A 4AYWA 2A3RA 2ZRPA 4AYXA 2JGNA 3MWJA 2OHFA 4NCIA 1TQ6A 3S16H 1GRNA 3Q3JB 4HATA 1TU4A 4E09A 1UE6A 4CDGA 2JA5G 2Q2UA 1PLLA 5E7MA 4Q1CA 4ZIRA 5FPKA 3NBFA 2IXFA 3GJ8A 2B8GA 2JCSA 3MWYW 5AUOB 4GL2A 1VQAA 5HKKA 1SULA 4LDJA 2I3BA 4B35A 1H9SA 5CB6A 2GN5A 3EBEA 2ZI7A 1NKTA 1T3SA 1SHZA 4EQ5A 3GTQH 1BIFA 4TT3A 4G3XA 3ICQB 3PO2H 3AV0B 4DCNA 3EZ2A 4YXWD 5TY0A 2AKWB 4B3SL 5JI2E 2GILA 1PLKA 2H5XA 2ZQ5A 3RZDH 1KZ7B 2R9VA 1G7RA 3A1TA 2ANCA 3IPXA 4NYJR 4C0BA 1N2CE 3BORA 2ODEA 1GITA 4TLAA 1CJMA 1FJGQ 2C96A 4IPCA 2GBLC 2WKPA 1KDOA 1RYFA 3FKSD 5HTKA 3KQLA 1NSTA 2REXB 1NBME 2CMKA 1RC8A 2HV8A 4KHPQ 3RRNA 3A7LA 3SGIA 5L3SA 4MKGA 5A0FA 2IA5A 4B3CA 4BE7B 2J1LA 2JQOA 3HPRA 1W2BA 3TIFA 2YTXA 3BJUA 4KFTA 2P2LA 1X3GA 1GUOA 3PO2G 1KI4A 2RGNC 3W8RA 4RVCA 2JA8G 4Q1DA 3GTMH 3IFTA 1TEVA 2R44A 3U3JA 3U7GA 1CULC 3GDEA 4URWR 1XEWY 2OUKA 4LF9L 1HTWA 1J5EL 1XFAA 3O47A 3Q9LA 3PEVA 2A30A 3PV0A 3GJ4A 3LXXA 2CE7A 3OAAD 1GRRA 1ZU4A 3CCEA 2MMGA 4Q4JA 1IBLQ 3TUZC 4GNXC 3THYB 3ASYA 4WW0A 1YVDA 4CIDA 1VQGA 2JJQA 4LBZA 3QSYA 4QHYA 4CEJA 2IS4A 4OONA 1ZM3A 3CNOA 2JJ1D 4RFSB 1P3JA 4MUBA 3H94A 5AK0A 1HURA 2QMHA 3RS4A 2ZR0A 5FOUA 1U94A 1OHHA 2CVHA 2K5UA 4AD8A 1M7HA 2JDID 3A1UA 3PR1A 3CRMA 2HJVA 4R4IA 4RD3A 2BHRA 5L3QA 2N49A 1MO3A 1VG1A 2ZJ5A 4POFA 3C5CA 5EP2A 4TZ6A 2DR3A 1KO7A 2QP3A 4URVR 2ODNA 4HZIA 2XTIA 4P32A 3KOJA 1KAGA 3UMSA 1BDOA 1JJVA 1ZD9A 1BBWA 1G18A 3AH8A 4ASUA 3PUWA 2VQFL 1VPLA 1ZNYA 1WMSA 1NVUQ 5AJWA 4HDCA 5C0XJ 1OXUA 5IYCH 2XOKA 4A15A 4NE2A 2IWHA 1PH8A 5IK2D 2ZE5A 3EZ7A 4QY7A 4BASA 4NXNQ 1TWAH 4GRAA 3H3VH 2HXYA 4C0SA 5JRJA 2RMKA 1BO6A 1H9SB 4AWXA 4C3ZA 1Q12A 2O52A 1CJUC 1X3FA 1JQLB 4MKFA 4B3RQ 1VG0B 1FGUA 4A3KG 1GAJA 2H57A 3GJ7A 4LF8L 1TUIA 2WP8J 1JR3E 1UJ2A 1WXQA 3JAMi 2NMVA 2QG6A 3BERA 4IXMA 3LAWA 4JLDA 4JOIC 2ZRAA 2PI2A 3P4XA 1I50H 2JA7H 3IQXA 2FOLA 3SYLA 1QF9A 1F6BA 4LJAA 5IYCG 1YIJA 4LHZA 5JCZA 2Z0SA 1HPCA 1WF3A 3CRRA 2A5JA 1I4DD 3PXGA 5E95A 3ZVLA 3NH9A 4R4QA 1QHIA 3MWLA 4U7DA 4DSTA 1G8YA 4MTNA 1KI3A 2Q2HA 3L8YA 4TZ0A 1WA5A 4M2LA 1FUUA 2CJWA 3I55A 4D80A 2YU9H 5L3SB 3BIFA 1E9EA 4DLXA 4URUR 3WYFA 1E9SA 3PIRA 1N0WA 4IVPA 4PZ6A 2FDCA 2R7FA 3IQWA 3SYKA 3BK7A 1U2RA 1K3RA 1KO8A 2IX0A 4YDHB 3EWSA 4IFDJ 3R9XA 2XZPA 4OKSA 4LYJA 1G3QA 3I1FA 4P75A 2G83A 2OBNA 2WMNB 1ELOA 2KJQA 2QTHA 1I6HH 1PVOA 4KKSA 4JBKA 2JA7G 2H5EA 2WKQA 2E5LL 4W5JA 4RCNA 4YWMA 4OHYA 1L4UA 1XTQA 1E2ZA 4QJ4A 2CBZA 1N36L 2NG1A 2QN6A 4RZ2A 1EFRA 2DY1A 4NMMA 4Q4JB 1UE1A 2HHHQ 1YITA 3E2IA 4IFDI 4BFUA 5H8WA 4DDTA 1CI3M 4CGZA 5CK5A 4CEJB 4OYHA 1G3MA 1HQYE 1ZNXA 2MMCA 4LC0A 1RRCA 4FW9A 4I1UA 4JV5L 3DLLA 3R9WA 3IPYA 3BZCA 3NHAA 1KSGA 3GLIE 4MZ9A 3E9IA 1E2EA 3F2BA 2A5FA 2L0XA 4LJ6A 4V0KA 1JR6A 4I1VA 5L3QB 2KI5A 1PH4A 3K1JA 5B57C 5AJYA 5C4JH 2Y0SG 3AVXA 2VF8A 1VTKA 3BS4A 4DXAA 3T1TA 2HF9A 3J81j 2IYQA 3LVQE 4JI7Q 4JI8Q 2ZM6Q 3A1VA 4EFMA 4Z8XA 1KNXA 2ZSEA 2JLYA 3CD6A 2XB2A 1E4VA 1XD9A 3J81c 1MV5A 3VMFA 5KDDA 3KJEA 4JI0Q 4PANA 3ADCA 5IY0A 4YWLA 2LXJA 2ZANA 1RIPA 3C7KA 3HOYH 2ZTSA 3KUDA 3N5CA 4Q18A 5F9FA 1H95A 3SFVA 2HDNB 2UUCL 2Q0HA 5DN6D 1Z28A 1D2EA 3VX4A 4BLSA 3A74A 4WAUA 3OOCA 4H0LC 4OXPA 1T3HA 1T8TA 4LV8B 1IBMQ 1B70B 3FPPA 1Y69U 1IW7D 3OIUA 2ORIA 1NN1A 3KQNA 1E79A 1EWIA 3BH6A 2QPAA 3IGFA 4LF5L 3OEEA 4DR1Q 1Z9FA 5JZVA 1DE0A 3P1JA 1JXMA 2B7CA 2YVUA 3BGWA 2WB1E 1NKSA 1Z63A 1CRQA 5B64A 2DUDA 3QY0A 1Y8PB 3DXJC 1N8RC 2LMCB 3VR5A 3HOYG 1CJVC 2CDNA 2YTYA 4C0JA 1XP8A 1FR3A 3PUXA 3OPOA 3I4NH 2Q21A 2RGBA 2X77A 3FHCB 4FMCF 2NZJA 3A36A 3WMFA 3CPJB 3VQTA 2IW3A 1UKEA 2ZE6A 5TMPA 1HT2E 3QEOA 3LWUA 1VQPA 3B9PA 1GUSA 1E9CA 4DPGA 2DPXA 2FH5B 1M90C 5AUQA 3TZUA 3X1XA 1MJEA 3CC7A 2ZVPX 2VNUD 3N2EA 1EYGA 4NYJQ 4UNNA 4HJ5A 1XPUA 1BMFD 2QGQA 3AF0A 2KHJA 4UP8A 2R92H 1HR0W 2C03A 3AQ4A 4AIIA 1QVRA 2GVDC 1R9TH 4V0ME 2GZHA 4QJ3A 1ZC4A 3AQQA 3B7GA 2UUBQ 3M9BA 5ELOA 1QG4A 3L43A 2GA8A 3QKUA 2MSCB 2B21A 2UU9L 2BA1A 2QL6A 5CM8B 3F1ZA 4BZPA 1LF5A 3AGPA 1WJJA 1JT8A 2CVFA 3BH7A 3QKRA 1TQ4A 4Z54A 1SVLA 4G5OA 2PMDA 3Q5EA 4JYCA 3I4NG 1DVRA 5DI3A 3ZS9A 4O2DA 1A6XA 3I7FA 2P3SA 1CEEA 4A3JG 1EIYB 1DAGA 2NQ2C 4ZDIA 3FHTA 2GBLA 2BH8A 1NMXA 4A0RA 3U60B 2C5LA 1CUKA 2NVTH 4JLAA 4QGFA 3TAHA 5GJVC 1PLJA 3LO5A 5J4LA 5JS7A 1A8VA 3GLFA 1G64A 3NDBB 4KI0A 3HKZE 1HE8B 5FTMA 2YKGA 1UBEA 2V4ZA 1D9ZA 4M1YA 4MYUA 1AK2A 4LFBL 1BBUA 4IOJA 3RS7A 3TJZA 2ZUBA 3ZVRA 2PEYA 1V5WA 3U9SA 2ALYB 4DV2Q 2QPOA 3SBEA 3F2CA 2FE4A 2G1KA 5C4GB 4HLDA 2HIXA 5DYGA 4DVGA 4F7WA 5CB8A 4CW7A 1JJ7A 1EFCA 4TL8A 1W5TA 1CKNA 3QPWA 1P9RA 2ZRIA 3S15H 2W58A 2XNDA 4HDQB 1EG7A 1NG9A 1P9NA 3CLVA 4IKEA 1NE3A 4WZBE 2HIVA 2JATA 3LVRE 4B32A 3HU1A 3ERSX 3J7A5 1DEKA 4ZI3A 3HP1A 4QM6A 1W2GA 4DK1A 4PQRA 3CWQA 5EE9A 3E9HA 2ZJYA 2GAAA 3BWDD 3TBKA 2K5HA 2BIFA 4A3EH 2Q9BA 1N33L 3PQCA 1TAGA 3OEHA 5D3MA 2O5IC 5JI3E 3OE7A 3I73A 2R65A 1KK1A 4DNIA 4DV5L 2A8VA 1SXJD 4KODA 4AURA 2VQEL 2ZIAA 1XPOA 3W6PA 4LHYA 4ILEA 2F1HA 1UBCA 4HB0A 1IJEA 3ZVNA 5EUMA 2EFDB 3ZZUA 5IP7H 1F2TA 4YHHL 2CHVA 4AG5A 5B30A 4DB4A 1SKQA 1LS6A 1TF5A 1OXXK 4D0LB 1UBFA 2AWOA 1LW7A 2E2HH 2J0UA 1UKVY 2Q9AA 5SZJA 4TVAB 2PPBC 4IFDH 1GFIA 621PA 3FTQA 2GJAA 1BYIA 3I8XA 3P32A 3DMDA 5C3EH 4JI3L 4A3GH 1QHXA 3KB2A 4G7HC 4A0HA 2KBFA 2K5VA 2H16A 3QF4A 4C0KA 2ORWA 4P33A 2ZTDA 3RS3A 4OGQC 2WWWA 3RLOA 1G16A 1NSFA 1S3GA 2GESA 3OF5A 4XVUA 1TQ2A 3P20A 3FB4A 3QKRB 3C5HA 2OFWA 1HNXL 3OHMA 4US1R 4UPAA 1FFHA 1N3BA 4JOIA 2WSSD 4JMPA 4MRPA 3I56A 1TUEA 2EWWA 5IP7G 1S72A 1VQJA 4IJMA 4LUOA 4QHTA 1OF1A 2C9YA 2K75A 4A3FH 1MKHA 4PC6A 4JBWA 2I4IA 3L82B 4FMDF 2F4VQ 4JI5L 1YZGA 1E22A 2ZI9A 1LFDB 4IFDG 4D2IA 4ITRC 1VQNA 4QM7A 1AM4D 4RD6A 2GF9A 3NEMA 5CDFA 2E2IH 4BUJA 1I4TD 1QHNA 1CR4A 2XEXA 4APVA 1FQKA 2JEOA 1Z2AA 2EQSA 4MA4A 2MSEB 3T5GA 1Y63A 4M1KA 4GKKQ 1LV7A 3ULPA 2REOA 2ZJRA 4NBSA 2R7DA 4IJHA 3VDYA 5AJ3Q 4OK6A 3I4MG 4ZDWA 1T91A 4FWIB 1TF2A 1D8LA 1S96A 4G5SA 4TQ9A 2D5DA 4DCSA 5C4XH 5EQTA 3THXA 2ES2A 1CKNB 2F1RA 4LHVA 4A3FG 721PA 2GJ9A 3L2OB 1ONBA 2VY3A 1AZTA 1CBUA 4CF7A 3SQWA 4NCKA 4GNXB 3BG3A 4JSYA 4MGKR 4DT1B 2BJVA 3CCUA 3B13B 4A3DH 4JSTA 2RKOA 3H0KA 1VQKA 1N6PA 1R10A 3IBGA 4DKXA 1R2QA 3NC1C 4H1VA 4P3YA 5D3MB 4TLDA 1OFTA 1VHTA 3HU2A 2OBMA 4WXRA 2WJGA 4NPSA 4BLTA 3UDXA 1JNYA 1OV4A 4NXMQ 5BR8Q 2B8WA 2ZI3A 4CRWB 4D4JA 3TSOA 3OW7A 2ANBA 3CW2C 1K73C 5C4XG 1XMVA 1LVGA 4DK0A 1IYVA 1S9HA 2IYTA 4PZLA 5H1YA 4HEJA 1KRTA 2A6HC 3CAMA 4A3CH 1F2TB 2YOHA 3KXKA 1FJGL 4CEHA 1OIVA 3EQLC 4PQYA 2E9SA 4FMBB 4LBYA 4LHXA 4A3DG 4U5XA 2FGKA 3P26A 4BGDA 2W83A 4OQMA 4KHPL 4OQXA 1VQHA 2IBMA 4PQFA 4IXNA 4C3HH 1FOEB 3A8TA 3QF4B 1AS2A 4IOCA 4HJ7A 2B6HA
chains in the Genus database with same CATH superfamily
1VPTA 5B4UA 1GTVA 3REGA 4XFJA 3ZJ4A 3E84A 1YL7A 4Q0FA 4IPTA 4A76A 2Y1WA 1TT5B 2WM2A 3I37X 1Y9AA 2C8VA 1UMKA 4NS4A 4GPTA 1YHQA 1DG3A 3THXB 3QMMA 1TWFH 1NZJA 2ODWA 3ZDRA 2IS2A 4RHUA 4P36A 3CKMA 4Z9CB 1Y8AA 1DOAA 3WNBA 1DU4A 4F86A 3GD5A 4WUTA 1XRPA 4YP0A 3WDLA 2FR0A 4I6EA 2VLBA 1E0SA 2X7HA 2LKCA 2GN0A 4FC6A 3Q15C 1N5JA 4BV2A 2AUJD 1M6NA 3ZS8A 5JS2A 4IJKA 1S7GA 3ER0A 1VQDA 2LXNA 2EZUA 3PGVA 1MZPA 5E9QA 3H09A 3IBCA 1B8AA 1XOIA 5KOJB 3EN2A 3A7DA 4JI7L 3L4BC 4Q24A 1OWOA 3K6KA 5BY2A 5KSZA 1GL9B 1YACA 5L7WA 3OT1B 1H65A 2WJIA 1SUCA 1GPDG 3FMVA 1TPZA 2C7BA 1CUBA 2DERA 1OAOA 2IPNA 1KOGA 1MAVA 1Z5WA 1FIUA 5ED0A 1BN7A 3AEVA 3EZLA 2ZRCA 1LW6E 4CMKA 3HHEA 4JWKA 1OKKD 4AZSA 2WUDA 4LQCA 3ILYA 2DT5A 2UUBL 5AM5A 5A62A 4YDRA 3NG1A 2PY6A 3WIDA 5CH5A 1T2CA 2F9FA 1BJTA 4MUMA 3B1XA 5JCJA 1MUUA 1Q57A 2I6UA 4JA2A 2R6AA 3P9ZA 5KCZA 1C4WA 3OICA 3ZI7A 1E5LA 1P5RA 4Q00A 3DTVD 2GBCA 1KJQA 3FUWA 2R1VA 2YH2A 3RRJA 2PT5A 4RVHA 3T9CA 3KVOA 5EJ9A 1TU2B 1TMGE 3IEIA 1KVSA 3VM6A 1NX9A 1MX9A 3ZWAA 2GAIA 4IIFA 2VT6A 4MQ5A 1ZOSA 3RF7A 3IOMA 1GUAA 2NVWA 3VZRA 1TVMA 3ZDEA 3W5SA 3DM5A 3BL8A 4RXMA 5KS2A 5CTJA 5HR5A 4LTNA 3ROXA 1AW7A 4O33A 1DGQA 1XHLA 5KYKA 1Y1RA 1OYOA 1SE4A 4RDXA 2VXYA 2PRYA 2VJAA 4WY5A 4NONA 4M8IA 5D2CA 3HCEA 1C9EA 3CLKA 3K4PA 4WTOA 2B7BA 3UT0A 3ESBA 2JNWA 3LYHA 3OFSA 3SJBA 1IN1A 1RDPD 1AHPA 2L0CA 4LWZA 3K0SA 2QV7A 2PU5A 5C37A 1ZM7A 2D3WA 5BR8L 1XMQQ 2A74C 1FYVA 1STEA 3NC4A 3FLAA 3F6BX 4K81B 4BMXA 3E35A 4GWKA 1E0AA 1R6UA 4XWAA 2DG2A 4J9VA 5BP7A 3CT4A 4FM9A 3EPHA 2IZ5A 1TCUA 5H9WA 5I4CA 3H3JA 3WE7A 5EMMA 4BWGA 2PU7A 3VPCA 2JIZA 4UTRA 3LT5A 4XLTA 4G56A 1V5FA 3BB1A 2CV2A 1TVCA 4BBSB 1IMOA 3AI3A 3MT9A 1AKVA 2ORVA 2HAEA 4FIZA 3NV7A 1KYYA 4HAUA 1BCSB 1H2HA 3RAGA 4QBFA 3KF6A 3FHJA 3KIPA 2PSJA 1R9MA 1S0UA 4M7OA 2O8FB 3QXHA 4P5EA 4UM7A 1OAKA 3L8CA 2OBXA 3KKNA 3LX0A 1E3LA 2UUAB 2JC3A 5HCUA 5JWOA 3SD7A 3S14H 3I64A 3BHJA 4IP0A 2C61A 4MI1A 3M6LA 3JAME 3RBXA 2O4CA 1X1DA 2BEWA 3QUTA 3CUTA 3ZIUA 1F0KA 4I8XA 1PYBA 1L8AA 5JNTA 5FPTA 3MAAC 1SFOH 4WN9A 1HA5A 1FVXA 4B2PA 3NJRA 3FUXA 1M2OA 2ILTA 4M83A 5ER6A 5AKYA 4TYWA 3EIVA 1P0CA 3K9FC 4Z0TA 3T16A 3FKIH 4B17A 1BZYA 3R74A 3UJDA 1VQLA 4CJ1B 4NDZA 8OHMA 1W6JA 1AE1A 1D4AA 1YJQA 5ALYA 2UZ4A 3BCSA 5DP1A 4CETA 1ACLA 3DAPA 3DEIA 4LF4Q 3PYXA 4V3BA 2GXSA 1IXZA 2W42A 2GZSA 2XODA 3PRKE 2YZKA 2AR7A 4GC5A 3T1VA 1KR5A 3SXUB 3S1QB 1C9JA 4GBMA 4BXOB 4K6HA 1YRQA 4JOBA 4YRGA 2AA3A 4CU2A 2WAQE 3GLFB 4F72A 4OIKA 1GYPA 4DDUA 2TMPA 2JI9A 2XDQA 1I7LA 3D5TA 3LX4A 4ZU6X 1JEYA 4ZCSA 1R0YA 1HXYD 4PICA 1W6UA 1WJGA 5I7SA 5CMDA 2ERCA 3G79A 1VQ8A 1CJBA 5JEAJ 4OX9Y 4YY3L 1LY1A 3R5TA 3AKCA 3CZRA 4WI1A 1PEYA 3BB3A 2J48A 2YL2A 1G3RA 5G3LD 1NY4A 3EGXB 2BF7A 2HADA 1SU8A 2SKCA 4J2TA 4X94A 4NCAA 5EJ6A 3H2ZA 3I9KA 1KEEA 1G6PA 1FBNA 1G38A 1SOUA 3ZWKA 2EG5A 3OQVA 1DDGA 4OJMX 1NRJB 5KC8A 2HGZA 3H9BA 4LG1A 3AVUA 3GTPH 1GILA 1YVRA 2FSFA 3WLPA 3BS1A 3D8GA 4CN9A 5LYJB 2IEDA 5ER9A 3HLKA 4AZVA 1D6EC 3PKIA 4H1HA 3RW9A 3UB2A 2RHHA 2Y99A 3T15A 4EUHA 3KL2A 2JHPA 3SQXA 5K8LA 2X4GA 4W8GA 1JQ3A 3U4AA 1QB8A 4W5NA 3JYHA 1KRXA 1IU9A 1CU1A 3TMYA 1Z8FA 2RBEA 4N5DA 3K09A 1XDDA 1QIDA 3CLUD 4RO0A 1RLTA 1I0LA 3UAOA 3DLBA 3SIPA 3GJQA 1MPXA 5EIOA 3WZLA 1A62A 2AJLI 2D1QA 5CDGA 4EKGA 1T4CA 4GNKA 3L7MA 1KY5A 4BAUA 4EQOA 1OV6A 4OEHA 1B3BA 2JBAB 3O7MA 4CKYA 1U8ZA 1QG7A 3M4OB 1ZOOA 2Q2WA 4OPMA 4J7CA 4CMHA 4XJVA 2C20A 2OF1A 4YMUA 1YA8A 2JFVA 3VZDA 3NHRA 1IJFA 2Z6BA 4A3IH 2E7ZA 1EDOA 4X1YA 4HCJA 2FRVA 1I1NA 4J76A 3F2DA 1Z73A 4IRUB 2GPNA 1YA6A 4A9AA 3HYRA 4HZUB 1KVTA 1QM5A 4YQFA 3PWZA 1UM8A 4FGWA 3WOVA 4NG5A 1GTG1 1JILA 3E15A 1ZJZA 3GPBA 2QMOA 2HSDA 3EFHA 3L7KA 1ZP6A 2P41A 1SNQA 3NHSA 2O1EA 4FS8A 2J5BA 2Q3DA 1WBDA 4L8GA 2OO3A 5KTTA 1K9MC 3RABA 1PH2A 4Z7JA 3K8AA 4DR2L 4K9QA 1Z4MA 3W5BA 2R68A 3AIKA 2RSLA 3KVYA 3MPUA 2VDRB 1E0JA 1L7NA 4MUJA 2FZGA 1H8ED 1U7HA 2ODAA 1I6MA 2AOUB 3EIQA 1XGKA 2GDZA 3RVJA 1SRRA 5IAAA 3KSBC 1XTIA 4BXXG 1KU6A 3CMAA 4RMIA 5CGQB 2IGTA 3B3JA 2BKEA 4NWIA 1UBOS 2AUKA 2VUHB 4N3BA 2KENA 3K0AB 4JDPA 2I71A 5FLKA 4MUXA 1GZ6A 3GWZA 2Q4RA 2W2VA 3O9ZA 2BGNA 3FYUA 2EF0A 2JJYA 4YONB 1BKSB 1GQRA 4I9FA 4UXIA 1GADO 2DBYA 4ZCLA 1NVVR 1UQRA 1Z0ZA 3T7JA 3OX2A 4I99A 1G6ZA 4TMTA 4FFPA 1RHQA 3KYDA 3QHPA 5KQGA 3U4MA 1GAWA 2UVPA 4RIGA 1MEOA 4FE3A 5F4BA 3T1QA 3MMZA 3UDFA 2LGJA 3LUAA 1XMOL 2PNRC 2RHQB 3OG9A 3BN3A 4RTOA 3RFTA 4EI2A 1FXSA 4ETWA 4B4UA 1XU7A 3QV2A 3AU8A 1IFXA 2R6FA 1GOZA 1EM8A 1QWOA 5DK6A 4ZZ0A 3CRKC 2BMEA 2GSWA 1UQUA 3HS0C 1JZSA 1FW6A 1Z5VA 3UATA 1CEYA 5AKEA 5TVKA 1W94A 3AOEA 1GEEA 3KQHA 5H4HA 4QOHA 3BDOA 3DDOA 2FMXA 3H4MA 4LWOA 4FMDB 4O2AF 1ZRSA 3NUQA 4RMGA 3TSZA 2VO1A 3OX3A 1XELA 2CSXA 3HFSA 3T5DA 3CPSA 1M4VA 5DEIA 5LMZA 4YACA 3VVLA 4LJ9A 1ZD4A 1AH2A 4GOJA 1DMRA 3NNSA 5EHQA 3R0QA 4CEIA 1NJ1A 4PM4A 3A1SA 6GPBA 4JI1Q 2I2CA 4EJ0A 2QYTA 2IL1A 3A9UA 4GX0A 1ZGZA 1ZN8A 2X1HA 2O3TA 4U7FA 1AO0A 1YIDA 4KY6A 1WHSA 1JJFA 4NYIR 3TKYA 2JA6H 4QT0A 2BTQB 2AHRA 1UPAA 1O89A 3IHWA 3EPRA 4HK4A 5DU2A 4DT1A 1DAHA 1YQQA 3ZY5A 3BRWA 1VL0A 1IMJA 4OO1G 1XQVA 4YJDA 5F5XA 5C4HA 3KPUA 2CYCA 1LTSD 2MT9A 4UUOA 2PQMA 2BDTA 1OVMA 2YZ2A 1O9GA 1J2TA 4YJ2F 4ALKA 2BI8A 2X58A 4X3TA 5LZ2A 1M2NA 3TBIB 1T10A 2DECA 1HTTA 4ZUIA 3A3KA 3UCEA 5I6YA 2FPPA 1HDZA 3GROA 1ZMOA 1J5EB 4I1PA 1UJ6A 4Z1MD 3MRXA 3TEHB 1NATA 1IZZA 4MAMA 4WKOA 1ZIXA 2CV0A 2H3EA 3RJ5A 4B87A 3C1EA 1X3SA 2H0RA 4P4GA 2H4XA 1TFUA 4NTZA 3RFXA 2QD1A 4MVJG 3L06A 4NAUA 4GWGA 3VVCA 1YNNC 3L5KA 2E5LQ 2CCZA 3JZFA 3BXPA 4ID9A 2X2PA 1LVHA 3FFTA 2PUJA 4HX2A 1X1BA 2IF0A 3A3YA 3GLGB 4RLHA 1WQ4A 3EVBA 3UGKA 2RGYA 1NBHA 1CNFA 2CL0X 3AWDA 1BDMA 4HAVA 3KT3A 4OWXB 4KBYA 1J7KA 4L27A 5EKXA 4YC7A 3K1AB 4R9WA 4Y2TA 3TUIC 4LK3A 1G0NA 4GICA 1POWA 4G0NA 3C8HA 4LA4A 2IOQA 2P4SA 1U0OC 1PX0A 1HSOA 2DAPA 3HBMA 3GP3A 3CH7A 3SK4A 3NCTA 1V1RA 3R23A 2P30A 1XTKA 1NR7A 4X6LA 1W36C 2Z2KA 4JW0A 4ZOLF 2Y9PB 4NZZA 4ETMA 2C5HA 2HWKA 1PKEA 1K5DA 3DMNA 3I3SR 1LPNA 4A6PA 2QD5A 3VNAA 1E89A 4P3KA 2C2WA 2QUAA 3CINA 5LD2B 4ZC1A 5TJ9A 1Q77A 5I51A 2VJBA 4TMVA 1KXLA 1PJ8A 5IVDA 2VXCA 3HZXA 2Z56A 4HFJA 2C0QA 4OUDB 1CTQA 3ZNPA 5CDHA 2V7VA 5G1PA 1FDWA 5BV8A 1IHOA 2EX0A 2XOEA 3MTQA 5MN5A 2N75A 3I62A 4MPRA 4L1KA 5ERGB 1QLWA 1P3DA 5DASA 2R1TA 5D7NA 2QSYA 1TQHA 3DKVA 1BS1A 4CMBA 2QR3A 1G8HA 2GN1A 1HQCA 2J6BA 2VWPA 4HDKA 2ZWPA 4I55A 1SYCA 4OI0A 1J22A 5TB5A 1RXWA 4L76A 4FHZA 1TA9A 1WTAA 4J1QA 4DA0A 5IDQA 2QM3A 3AEKA 1JDVA 4ENUA 1EWKA 2JCSA 4GLBA 3OZRA 2IU4A 3G9ZA 3HACA 1BIFA 3GTQH 3UA4A 3GWGA 1KZ7B 2PTHA 1GDHA 4DV3B 3FKSD 3KOYA 5AFSA 2VPTA 3D02A 4Y7DA 2J1LA 3ZHUA 3QFCA 3IQDB 1RAGA 3EH1A 3GDEA 1ADCA 2Y71A 4HS9A 1ZL0A 3MB5A 3DFIA 1SOMA 3ROZA 1DTWA 4L8YA 4MPDA 2ZB2A 3H94A 3CEHA 1U94A 2Q2VA 2K5UA 3NBAA 3FJYA 4D9FA 2QP3A 2ODNA 4LNHA 1V41E 2XOKA 2OFPA 3F67A 1AN8A 1TWAH 3N8DA 2XUZA 4GE0A 1CQJA 1JQLB 2B4RO 2DJFC 4F9FA 5BSHA 5A71A 1Z3CA 3UC5A 1F6BA 1ULSA 1XNGA 4U7DA 5ADVA 3NHJA 3I55A 1WF6A 4IVPA 3PJDA 4B6SA 1F2ZA 2Z9BA 1I6HH 2P1RA 3T9AA 1GGJA 4O4JA 3FMGA 3GFSA 5H8WA 2FB9A 2GWRA 1M6VA 2MINB 1ZGCA 3GLIE 4LJ6A 5F2OA 3DLAA 4UDXX 2G76A 5C5CA 3J81c 1GAEO 4ETNA 4N41A 2ZANA 3HOYH 3N5CA 1LBQA 3PDHA 4XIJA 3OOCA 4QICA 4L51A 3SX4A 3IELA 1E79A 2VT2A 4ZZ1A 5CXSA 5B64A 2OL4A 4FHDA 3UK1A 2B25A 5CNKA 2IOHA 3HCFA 2CMDA 1Q92A 5T5QA 1EYGA 2P9GA 5DAUA 3WKCA 3KLOA 2ES4A 5A6SB 2B39A 2R93B 3TDNA 4A3JG 1HLPA 2QUJA 1CUKA 2A5HA 1GPYA 2YFHA 3AINA 4UATA 5JPNC 4FTWA 4IOJA 2ZUBA 3TJZA 3ZVRA 2GEJA 3MTSA 5DBEX 2IXDA 2ZTUA 3G8YA 4I50B 4NBVA 1P9NA 4B32A 3PD0A 4AW9A 2KEDA 5AVUA 4MW2A 4G0ZA 1O7ZA 4PQRA 4XYBA 1EFPB 5FIUA 3O26A 4H17A 1ML0D 2P69A 2BEVA 3WIOA 3NS7A 3WWCA 3B5EA 4HB0A 3F2UA 2ID4A 4YCCA 4NAVA 1JA0A 1UKVY 3NTLA 3D0KA 1GFIA 5A04A 3P32A 2BGTA 5FO8B 1SUIA 4P33A 2JZNA 1NSFA 1TTPB 3KOWA 1TW2A 3ZWPA 4KR3A 1XO1A 3I56A 2WZDA 4JXXA 1VQJA 4Y9TA 2I4IA 5ALLA 2D3TA 1FQKA 4MIUA 2REOA 3ONVA 2IXBA 4C4ZA 5HRCA 2PFKA 7REQA 3P9KA 1ORRA 3OLXA 4QEDA 5SYAA 4O4JF 3KUUA 1HNZB 4LF6B 2CUTA 2BMWA 3OJLA 5I4DA 2IP2A 2QR2A 3UHPA 3I2IA 1UZUA 5GPBA 4LHXA 4U5XA 4R6XA 4OQXA 1NAIA 1UC9A 3MGKA 4KTAA 1X13A 4JCCA 4RY2A 1JGTA 4GN4B 4S12A 5K45A 3E9QA 4ODIA 3MJSA 3C8DA 5DT2A 1N5OX 2TMKA 3SC3A 3HEBA 2W8BB 5EQFA 6PFKA 1NLUA 3W1EA 2ZPTX 3AM4A 1ZJWA 3FSJX 4F4HA 1LZLA 2WZQA 1VQBA 5CVVA 4ER0A 3KJIA 2H54A 3R3YA 1J5PA 5EQDA 3VPDA 5TR9A 3WWEA 3QGMA 5FEUA 2CNBA 2WAXA 4GMGA 2DM6A 5U4XA 3FMOB 4OM7A 4WA8A 4KPFC 4NEQA 1A7JA 3NU1A 3VKFA 3L07A 3TNFA 2WKRA 3PEYA 1LV8A 3HKEB 3TCKA 1RTNA 4RORA 3BREA 1TK3A 4Q4CA 2P1ZA 4F06A 3M4XA 4QYMA 4W8HA 1ZK3A 1M8PA 5ALUA 1YDMA 3MUFA 2XIWA 5G0TA 1FXWF 2X0KA 1OGIA 1G8FA 1TYEB 5C8YA 2WQ6A 4RELA 4U7PB 2EJWA 1OTXA 1KYVA 1ZVKA 2PS3A 1JPVA 4UEKA 2OMEA 1W46A 4PZYA 3EPLA 5C8VA 2NVUA 4Z6KA 1R5JA 2B2VC 3JVVA 1M7BA 3G2MA 3TTWA 1OWPA 4MAAA 5ISMA 1JJ2A 3DMYA 4WPGA 4WGGA 1T4MA 3BVGA 2NW6A 3FAKA 4BLUA 2Y0SB 3R09A 3CLHA 2GA4B 2QYHA 4HL6A 2BDUA 5FTNA 5KU7A 1T9DA 2PX2A 1N7JA 1E3MA 1LBEA 2F0IA 2XNJA 4MUHA 1CLUA 3BDLA 1O78A 1PZGA 1A63A 5FBLB 5E38A 1C7QA 2OOKA 4TL6A 2ATXA 3AF2A 1QAOA 4Z9YA 5DBIA 2Z6KC 5ECWA 4YRQA 1GPAA 1RCTE 5KYVA 4RSHA 1GT91 2P0EA 4DDMA 4E46A 1MRNA 2P6RA 2L5TA 5KBYA 3KSRA 4CCAA 1L5FA 2O8DB 3C41J 2FUKA 2M6LA 4FYHA 4DG5A 3NTUA 1HTLD 3BZUA 1PDVA 2QV0A 3THSA 1QKKA 3D3JA 4ZAFA 4ZAYA 5KREA 1GUNA 4FDVA 4NDNE 4OB7A 3SBDA 4ZYUA 1X77A 3FWZA 3HOZG 5A02A 4DIBA 5C4ZA 4X7BA 4MMYB 4L0DA 1NP3A 2W90A 3KF8B 3HP4A 1Y8QB 4EB6B 1NTGA 3VI3B 1SXHA 3ZVMA 5EJEA 2MGSA 2HQSA 2WSSA 4YI3A 1B23P 2QDLA 1PFBA 5FADA 2IUUA 3SDZA 1LM0A 1EJ2A 4J6FA 3JS5A 2VP2A 1N34B 4RVSA 2AJBA 4Q1VA 4WKCA 1MD2D 2B63G 1H4SA 1KAOA 5ANRB 4A4DA 3RHSA 4A8JB 1Z18A 2HJ9A 3MB8A 5CUQA 4WGFA 1MLDA 2OM2A 2VQSA 3KPYA 4YJFA 1J6QA 1J49A 5HKAA 4AECA 2AMFA 5LP1A 4YP6A 2I34A 3L4BA 4JBMA 3X43A 3FGNA 3P75A 2FPSA 1R9NA 1GA4A 2XXAB 2K03A 2DTEA 5DTEA 5CAEB 4HUQB 2VBIA 2XAAA 1A5ZA 3C6ZA 1ZRHA 3P0HA 4DNPA 2M9MA 1YHZA 3IPRA 5K99A 4HIDA 4OHPA 3TI7A 2XLCA 4AJNA 5IASA 4KDFA 5EUBA 1X86B 3I23A 3KAJA 3BUSA 4MHOA 3HB7A 3AEQA 1C7ZA 4LSWA 3ZYCA 3QMPA 2G70A 4FHGA 3KQKA 4DCVA 1OZ0A 3D59A 5KZMB 3WNZA 3ZQ4A 2DY7A 4EL5A 1SY7A 5A9TA 5FI3A 3DR5A 1KSFX 2NSHA 3VR3D 2VQ3A 4L4ZA