4JBWA

Crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbon catabolite repression of the maltose transporter revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Maltose transport system permease protein MalF
total genus 78
structure length 370
sequence length 370
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4jbwA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jbwA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jbwA01
4Q7JB 4YDHB 1H9SA 3RS2A 1D2EA 1CRPA 2BM1A 3I1FA 2R44A 1Q20A 2B92A 1JECA 3S2DH 4PSKA 5BN4A 1CR2A 2IK8A 2IYXA 3QKSB 1SMXA 3UG6A 1DOAA 2FSIA 2WHXA 1SVMA 3UE1A 1I4LD 1VG8A 2WAXA 2ZIAA 1P62B 4ZDJA 4Q7KA 1DTSA 1E0KA 3SOPA 1FNMA 2GBLC 3PFIA 5EE1A 5F2EA 1VECA 1P2UA 1NVUQ 4LYAA 3ZGXA 1K9MC 5JMTA 4A3JH 3QSYA 1QVGA 2PPBC 5C0XJ 2ZITA 2H7VA 5J4YA 4LF8L 2QTHA 2CBZA 1ZM4A 4URYR 3U3MA 4LF5Q 1W36B 1HR0W 2GNOA 1TQ6A 1XMOL 2JCSA 3D3QA 1G8PA 4TYPA 4H1VA 1VIAA 4P32A 3FKIH 5JLJA 3K81C 1XCMA 2ZTSA 4HDCA 4W5JA 2K32A 1E1RD 2I1QA 1LW7A 4JOIA 3IHWA 3KJPA 2J7KA 3SJBA 4CEJA 4OHYA 3SE0A 3W1BA 2OCBA 1YZNA 3K0EA 4CZ2A 4WBSA 4GNXA 3KLRA 1DELA 2FPLA 3MG9A 1E7ZA 4I1VA 2ZRPA 1X6OA 4X62Q 2WFWA 3R8FA 3EG5A 2UVQA 1IYVA 1D8LA 2JA8G 3A8JE 1K8MA 5B64A 2W0SA 1MT0A 5LBIA 4UXIA 3GJ4A 4C0QC 4LF4Q 2VHCA 2HJVA 4XVUA 3U58A 2A2ZA 4H02A 2F1MA 2GXUA 4B2PA 5JBQA 4ZPXA 4FN5A 4QC2A 4A92A 4ZDWA 4JYAQ 4FMCB 5EZ6B 2GZDA 5KHOC 5B30A 2D7DA 3NE5B 2QTFA 3HU2A 2ZRKA 4RY2A 1HE8B 4B3DA 1E3MA 4JI4Q 2N49A 4RD4A 4URVR 2ZAOA 3CCLA 2GHIA 4KBFA 1K83H 2VF7A 3EIEA 1TWFH 4G5SA 2WSSA 2B7CA 3KUCA 1T3HA 4FMDB 4JI6Q 1U8AA 1DVRA 3SI7A 3CF0A 1CTQA 4KLKA 2YJTD 3GLGA 1G17A 3GJ8A 2QN6A 1KMQA 3VQTA 4LC0A 1OT3A 3CONA 1EQQA 2YNMA 2OHFA 2XGTA 2Y0SG 4EUNA 1KSJA 4JI2L 3RZOH 1GHKA 4DK3C 3E5HA 1OPXA 1ZP6A 3B2EA 4BLOA 1KI1A 4GNXC 2W0MA 4CIDA 2VA8A 1G3RA 2P6NA 5HZKA 1R9TH 4DZZA 1RYHA 5AJ3Q 4BBSH 1AN0A 2V54A 1VQ8A 2F3TA 4HB2A 4OQXA 1YZUA 5HKKA 4C9BA 5KDOA 4XTCS 1UEJA 4P4UA 3HYRA 1UBGA 2ECKA 2NZOA 1ZNWA 3U3KA 4KI0A 1Q1ZA 2CHGA 5DI3A 4DCNA 1G6PA 5IP7G 4JI3Q 4MGKR 3GLFE 2ODEA 3N5CA 2ZRDA 1YZTA 2IYZA 4MRPA 4A3DG 4DR3L 2ZJOA 3AEZA 4DSUA 3A7AB 1NVXQ 4X64L 4Q4AA 3T5DA 3X1WA 1YQTA 2AHOB 3FPAA 3BH6A 1D9ZA 3IKJA 2KE5A 3HWSA 3TW4A 1J7KA 5FI1B 5DSZA 1IJEA 5FUVA 3PEUA 3IFTA 3HOWH 1YHQA 1Z0FA 3W8NA 4C0HA 2VSOA 1E1QD 3A1WA 3B78A 3U7FB 5ELOA 3A36A 3NBYC 2ZSEA 5JWOA 1FP6A 4C3JH 1SN8A 3AB3A 1BDOA 4BE7B 1D5CA 1KHIA 4JS0A 4P31A 4EQ6B 3ZQ6A 3HOZH 2BMFA 4ZIRB 2NMVA 4WZBE 5J4KA 3CW2C 3EBEA 4Q1CA 5IHPA 5HY6A 1E2HA 4EFMA 2C77A 4D25A 2XTIA 1U8YA 2IYRA 4UQOA 3CX7A 3CCJA 2WMOB 3KLWA 1S96A 1XEFA 3F2CA 4JI3L 3RSOA 2ZU0C 4LC1A 1G4AE 5IK2D 1GNQA 2CCZA 1IBLQ 1NVVR 3FP9A 2VHQA 2F1RA 1EWRA 1XWIA 2ASEA 4D4LA 1LACA 1HR0Q 2XEXA 1JXMA 4JL5A 4A3GH 1XPOA 1SHZA 3PITA 3EPKA 4OK5A 2ORWA 3Q7PA 2X2EA 4JLAA 5L3QB 1Y8OB 5SZHB 3J81j 4HAUA 4A93G 4LYFA 5FH9A 1SVWA 1GUNA 3X1DA 1KSHA 1D6JA 3ZD7A 5FL7D 2VQFL 4D0LB 4DVGA 4PAOA 3U44A 4QRHA 4Q7MB 1CKMA 2QE7A 2JDIA 3UDGA 1GVPA 3OE7D 4RD1A 1KI8A 2BOVA 4IXNA 3S1MH 5DHFA 1XF9A 5CM8B 5EXXA 3U3RA 2E75C 3B82A 2DFLA 4FMCF 3I5XA 4BGDA 4JKYA 5IY0A 1GUTA 1IXRA 2GTPA 3ER0A 2BE5D 3ZZTA 5IP9G 3TW8B 4GLAC 3CX8A 4MKHA 1LF0A 4URXR 2A6ED 2BH8A 4JL6A 1JT8A 4HSEA 4QM7A 5FUXA 1KO7A 3GMTA 2HHHQ 4Q00A 1P7CA 1TQ2A 1Q86C 2YTXA 5CB8A 4DR1Q 4MDFA 4MYCA 3ZZUA 4ME3A 4GKKL 5JCPA 3EWSA 4IPCA 1V8QA 4RJLA 1XXHB 4JZKA 1XP8A 4DSTA 3W90A 2FEMA 1YIJA 3IO3A 5E7NA 1U90A 4NE2A 4RD6A 5GAEC 2W6JD 3AH8A 3C16C 5KYKA 4X64Q 1ZM9A 5JWRA 1T0HB 3QPUA 2A6HD 3E2IA 2Q2TA 1T0JB 3LBNA 1TU4A 2A78A 3EIQA 3LXXA 4GZLA 3CC7A 3Q5EA 1I2MA 1PYBA 2VHJA 2EDGA 2WOOA 3GLGB 4LFBQ 1RIFA 2ZI6A 4TL6A 4JLDA 1QG4A 3P1JA 4X65Q 4LF7L 3SDZA 3VDYA 1TXYA 4LW1A 2YWEA 1H9KA 4OONA 5C3EH 1YR7A 2DGYA 3UANA 4NCNA 2CQOA 2GJAA 4JI7Q 4OK6A 2DFKB 1AS0A 3EA5A 3KL4A 2I1VB 2YC4C 1XCPA 4RD3A 4LHYA 1Q82C 4HEJA 5SZKB 4QKQA 4LWCA 2CWPA 4A3BH 1KOFA 4LUCA 4AKHA 3RC3A 2YZ2A 3GTKH 3W34A 2Y0SE 1KGDA 1VQDA 5L3SB 2F4VL 1CR4A 2ZRGA 3LQRA 3MWLA 2WJHA 4RZUA 2XITA 3CF5A 2ZR7A 3CCRA 3KFVA 3I3SR 1G1MA 3L0SA 1TX4B 2CDNA 3K1JA 1VDZA 2EWVA 3U4QB 1HR0L 4ZKEA 2DNEA 2JJQA 4QGHA 3RLNA 2F55A 2HCJB 2ZS7A 1XMOQ 4HLUA 1O7IA 1X1RA 3K09A 1VQHA 3AVYA 4TZ0A 3CAMA 3K7UC 4LF9L 1UEIA 4LJYA 1OJLA 5BW8A 3SEAA 1JJ2A 2P67A 3WWVA 1ZUIA 2KCCA 3CNOA 2IHEA 3W3AA 1DARA 1J8YF 2IYTA 4ALPA 1SKYE 1IY2A 3AV0B 2R92G 4B3BA 2YU9H 3TBKA 2AUJD 3ZS8A 4DR7Q 1E1TA 1Q1QA 2RF4A 4DR4Q 3B1YA 3MWJA 2O8BA 4JT4A 3JC66 4OI1A 4LFCL 2EQSA 1LTLA 2Z6KA 2VYFA 1XNQQ 4YONB 4Z1MA 3A1TA 3GTMH 1HUQA 4HJ8A 1J8MF 2F43A 3TE6A 2C5LA 3I72A 5DLQE 3DM3A 2ERYA 3OF5A 5M3MH 5TV2A 3F0TA 1IBKQ 1XDBA 1JR3D 2WJVA 2IUSA 3GLFA 1NSFA 3G6EA 4IO9A 1Q3TA 3OOCA 5A4JA 2FF7A 3F3YA 4F7WA 4M1OA 2O8EB 1SULA 5K8LA 3P4XA 4RKEA 2IW3A 4MYTA 2VY3A 2JQOA 1N33Q 4X8OA 1N5KA 3RWOA 3NHBA 4TZ6A 3VNVA 5JEEA 1IN4A 4NYIQ 1Z6HA 3SYNA 3TUZC 1CP2A 3H0GH 2IHBA 5DE3A 1TTTA 4IFDG 1VS0A 3A37A 3GFOA 3S15H 5AUNB 4HIMA 4L15A 2GETA 4S2EA 5BWMA 3BB1A 4B33A 4L5RC 4F38A 1EWHA 5IT9c 1Q90A 4BBRG 2H18A 3AUYA 2A8VA 1J90A 4B6FA 5K36H 1T5EA 4JI7L 2VRWA 4DCTA 4B3ML 2IX3A 4QHYA 3TRZA 4MYHA 4BECA 2BWJA 4K0KQ 1C9OA 4IFDH 4XWKA 3LWUA 3J80i 1G3UA 1XB2A 1J5EL 2C8VA 1S3OA 1W3SA 2NZHA 1ELOA 3LVRE 5FOVA 3QKUA 1PV4A 1UKYA 3FHTA 3PG5A 4B44A 1DE0A 2WP8J 4U5XA 2JJ8A 3VFDA 5JRZA 2O8DA 2R2AA 1N34Q 1KO4A 4YMTA 1NIPA 2MFIA 3FMCA 1JQLB 3MLEA 5M04A 2OQKA 2D3WA 3NBXX 4TL7A 1Y3AA 5CJPA 4IVQA 3MAAC 4QBIA 2CE7A 3IIKA 1YZQA 4JLKA 2QENA 2HT6A 3MUFA 4O0MA 4TMVA 3T12A 1E79D 3T06B 5ELXA 4QM6A 1IBRA 3ZS9A 4G7ZC 2Z0SA 4IJLA 3A74A 2GEDA 1OFUX 2I5LX 4HIDA 2Z43A 3A4NA 3GTOH 3CB4A 3P32A 3ZZ0A 4A0HA 2A1AA 4Q02A 4WXPA 2B8WA 3MFYA 3FHCB 3I8XA 1NN3A 4HLDA 4Q21A 4FCVA 3RS4A 3QG1A 1XTSA 3SBDA 5GQOA 2F1HA 2JLSA 4DJTA 4CVNA 5E95A 4M0LA 1FMLA 4AIMA 3MXNB 521PA 5GROA 3K0CC 2O0HA 3GD7A 2IC5A 3HP1A 4NCJA 2BA0A 2ZM6Q 3C7KA 3QF4B 3W5JA 4EPVA 4GOPA 5AJZA 3K7AH 2RHDA 1E2EA 3D0FA 3AB9A 4DUYQ 1QHNA 1LVGA 2F6RA 1G3QA 2V8OA 3BFVA 3D7MA 2YV5A 2YWHA 5K8TA 3J81k 2PJRA 4D82A 1AGPA 1MO5A 2CWAA 2GVZC 3H3VH 2H17A 1G5PA 4I81A 2OAQ1 4AY2A 3UDXA 2YHSA 5LB4A 2NN6G 1PVOA 1XJCA 3K53A 3AVPA 1CKNB 4C0JA 5AJVB 3I5YA 2AKYA 4Q1DA 4G5QA 4BBSG 3QKRA 3UDFA 5A0FA 3ADCA 2A5JA 2AD5A 2FN4A 4QBGB 4JOIC 4TTPA 5FUWA 3LNNA 1KAOA 5HCNA 1OXTA 2BH2A 2FWRA 2VIIA 3LX5A 1Z2AA 4CYMA 1QDEA 1V1QA 1NBMD 1JB7A 5AUQA 4D80A 1NG9A 2AFHE 2FEOA 1S8FA 2H8KA 3CNNA 2EFEB 4DV6L 2UUBQ 1D2MA 1ZYUA 4PQFA 3E0EA 1ONBA 2GA8A 3P27A 4NDZA 2ZJ2A 4C2TA 4MRNA 1II9A 2HXYA 3SHWA 4TMZA 1G7CA 2OO7A 4U00A 1WA5A 2ZM6L 3KUDA 1XPUA 4TLDA 4B3RQ 4JI0L 1IYJB 1Y1VG 4WAUA 4NP6A 3TRFA 3A5UA 4AQYL 1SXJB 2IY5B 2WV9A 2VP0A 2X19A 1BYIA 4URZR 4JJZA 3SJAA 2WSMA 1YZKA 1IM2A 4KYIB 4NPSA 5BR8Q 1PHJA 5J47A 2C78A 1V5WA 1I4TD 5GADl 3TZUA 2LXKA 3EW9A 3GTPH 4IFDJ 3CR7A 3FMIA 3PEVA 3SYLA 3T35A 3WMEA 4B73A 5KPDA 3R20A 4PANA 2H5XA 3RC8A 4LFAL 1E9AA 1RKBA 3K0AA 3H86A 3BIFA 4AC9A 5KU1A 2CEAA 2YWGA 3C8UA 3BFKA 4FINA 4B6EA 3WRYC 4ESHA 2D2EA 3RN5A 1YBYA 2VEDA 5L3SA 4GDFA 4B3FX 3HFZB 1KK3A 3H1TA 1CJMA 2BKUA 1KSGA 4DKXA 1BH2A 3LD9A 3OTOQ 4A3DH 3PCOB 1C1YA 1XTIA 5HCIA 5UKDA 4KN7C 4KFSA 3FWYA 4W9MC 2GVDC 5BN3A 1DAKA 4GKJL 1HZ9A 5C4XH 3RS3A 2X2FA 1S3SA 1DPFA 1YITA 3EPJA 5FTNA 1E32A 3X1YA 3OPOA 3CQZH 1NMFA 2QMOA 4DUGD 2FDCA 3VX3A 3C4JA 4QJ3A 1G6OA 2GJSA 2EWWA 1KSFX 1KK0A 5JI3E 3TK1A 5IRCD 1YNXA 4KHPL 2J3EA 2QNRA 3T1OA 3TAHA 1K8GA 5JSZB 3DLLA 3V4RA 1GDDA 3HOVG 1G6HA 3CIOA 3T34A 4DV4L 1NBMA 4JBXA 3CCQA 2ZPTX 2WIBA 2IYVA 5G3ZA 1N3BA 1CJVC 2J0UB 3I55A 1U5KA 1E94E 2FOLA 5TMPA 5IE8A 2Q9CA 1KAGA 3OIWA 2KBNA 4PTLA 2WKPA 1SQ5A 4U02A 5JECA 1YEZA 3EASA 4NXMQ 3WNCA 4LUOA 3D31A 2WKQA 1B7YB 1XD8A 2QEXA 1GKUB 4DXAA 2B8FA 4DT1A 4O2RA 4LHVA 3A5ZB 3I4NG 1KD1C 3D6TB 4Q18A 1JALA 4HB3A 5AWFC 5DNYB 3U4QA 2F52A 1SFOH 1RVDA 5B58C 1W2HA 3AYHB 1KHTA 1YR8A 2GILA 4IOJA 4N0DA 4XVQA 4D4MA 4QOSA 2AKWB 2D0PA 2IS4A 5C0XH 1MABA 4A3IG 4BFUA 3UE0A 2KBEA 3QXHA 4LBYA 1Q0UA 3GTJH 1BOFA 3SFZA 3BERA 3DDCA 1Z47A 1U8ZA 4LFCQ 3WNBA 5KUTA 4DV7Q 1S72A 2ZJQA 3RHFA 5AK0A 3N2IA 3ZIAD 4A75A 1A0IA 1EG7A 1YJ9A 3NXSA 1P9NA 4K46A 3JZAA 4BZQA 3N70A 2PQAA 1CJKC 5K8UA 5FOTA 4B2IA 4A3IH 5JS8A 2A6HC 4DR2Q 1XEXA 4A76A 3SQWA 5KDLA 4DC9A 2IYYA 4D81A 2DHRA 3AKEA 1CR0A 4KVAA 1N6RA 3EC1A 1GIAA 5G40A 1GUSA 4LJ5A 4QJ5A 1B9MA 1L1OA 4I7ZC 4X6AH 3T1YL 3QF7A 3SR0A 2JE6I 1R0ZA 1UBEA 2MMCA 5JS7A 4PZ8A 1Q46A 1EFTA 4LHZA 5FJ8H 5EP3A 5J4VA 4KKTA 4LBWA 4RFVA 4A3KH 1VQPA 3I73A 2L5TA 4UP9A 4C0SA 1PLJA 2NO0A 5KTYA 4LOAA 4IDQA 5LD2B 2QPOA 3WY9A 3AVWA 4LJ6A 1DCZA 4QNMA 4B3MQ 3KFUA 3JAMc 2GWHA 4V0ME 3HOYG 4B32A 1FX0B 2VUMG 3NTUA 1CKOA 2ZXUA 3HOXH 1MKHA 3L82B 1OLOA 1UE7A 4PPNA 4B74A 2R7ZH 2BJWA 4MGYR 2QBYB 2R93G 2P3SA 2XGJA 3CPJB 1B23P 2ZE5A 4LX0A 5HTKA 2CL7X 2AK3A 5CDFA 2LCFA 4DCSA 4US2R 1L7VC 2QGNA 3G71A 3P20A 3PXGA 4NXNL 4PPGA 2E2IH 1OIWA 2QORA 1T9HA 1E2LA 1FJGL 4L5TA 3QUSA 1AE3A 3CRQA 3Q5DA 1UFQA 1W48A 2P2LA 4JLOA 4XWAA 2QE7D 3OE7A 2DWQA 4GZMA 4IKEA 5FBRB 3KDFB 4FW9A 3MWYW 3AVUA 2IF2A 3WRXC 4PX9A 2V1XA 1ZBDA 3AVQA 4LYHA 3PCRB 3DHWC 3FFAA 1MV5A 4RD2A 1IZ6A 3GTGH 1XEWY 4DLUA 721PA 3LY5A 4F92B 5IT5A 4JI5Q 3SHFA 3X1XA 2IS2A 1BBUA 3ERSX 4M53A 1E9BA 3MMPA 2CCKA 2E9SA 1TAGA 2ZVPX 4Q03A 3SQXA 4A0FA 1GSIA 4DR2L 1P72A 2AN9A 2CXXA 2PX3A 2R6DA 1ZNYA 1VQFA 2ZJ5A 4NMMA 5KSOA 3GJ7A 5FBVB 3Q85A 5CK5A 1H8HD 4PXAA 1QZXA 1VQEA 2FA9A 4BFXA 5C44G 3KJOA 4AWXA 2XNDA 1QVCA 4A82A 1MJCA 3IRBA 1H8HA 1ANKA 1KY2A 1XRJA 3DOEA 1ASYA 2QAGB 4NL4H 1JEEA 1X8LA 3O47A 2O8CB 1SE8A 2VZAA 1R5NA 2PBRA 1II0A 2ZREA 4FI3C 3TR0A 2O8BB 4DUYL 2A7QA 2DWPA 2XJ4A 2KCTA 3NKVA 1R7RA 3SC3A 1EWQA 3RSLA 3IQWA 1XPRA 4Q4HB 1L1OC 3UWOA 4MDEA 5LMNW 1N0WA 1X86B 3THYA 4DPGA 1ZRHA 4E09A 4KN4C 3EA0A 3REFA 4OHXA 4WA7A 2PZFA 2RGDA 2PMKA 1SMYC 4OBEA 4E5UA 4JSYA 2AX4A 3SU8A 4NYMR 1W49A 2EQBA 2ZJPA 3L0OA 3TEHB 1GNRA 3A0JA 2QI9C 5FOUA 1HZAA 3LO5A 1E9DA 2G83A 2J45A 1EIYB 3IEUA 4Q1FA 3NHAA 4CT5A 2A5FA 4Y0VA 3TAUA 2NVXH 1NIJA 5C46F 3E9HA 5JFGA 4ACBA 1WQ1R 1W4BA 2BMJA 3B8HA 5CYOA 5EUQB 3I4MH 3CP0A 2UXDL 3IBGA 3HOUG 3IUYA 3AQQA 3OFND 1A63A 2PT7A 1EQRA 2ZRAA 1GUGA 2K14A 3DVLA 3FFBA 2PZGA 3PF5A 1XMSA 4NONA 4N0EA 2ZRFA 2BC9A 3BFXA 2QT0A 1VQ4A 2V3CC 3C5HA 1E1QA 2W2VA 5J4HA 1QVAA 3CZQA 1IJFA 1R0XA 1K5GA 2Q21A 4EPTA 3J81c 3A58B 3GQBA 4R1JA 3S1RH 2J41A 1T3SA 3ICEA 5FLXc 3BAFA 4KCGA 2VS1A 2KWIA 2PMZE 1XXHE 4G0NA 4I4LA 1IN5A 3W5IA 5CK4A 5HPYB 2VSFA 2F4VQ 5FBQB 1ZKOA 2LSSA 2BVNA 1UM8A 4RZ2A 1XMQQ 4HZIA 2GK6A 4ASUD 4JBYA 3F8TA 4B47A 1RRCA 4R4TA 4UP8A 3RS0A 1QHSA 5JEDA 1CU1A 4BFSA 4CW7A 3VKGA 2ODWA 2D74A 2JEOA 5GJVC 4EX5A 3AGPA 3OW2A 4FXPA 1NLYA 5L3RA 4TYWA 1Z3IX 1GFIA 5TXGA 2DFTA 4RKFA 4TLEA 1CS4C 3K70D 3HOWG 3GJXC 1XMVA 4R9UC 1FJGQ 3H84A 2A30A 3GP8A 3FHWA 1TADA 1X9NA 2VHTA 4NHOA 1QUQB 3CBQA 2HLDD 2RGNC 4URWR 2QPTA 2ZRLA 2VF8A 1X6VA 3LW7A 1E4YA 3O8RA 1AKEA 1LFDB 2BMEA 5BYJA 1R6BX 4OWTB 1OFTA 5AJYA 1JNYA 5JJKA 1R5OA 2OFWA 2VH5R 3ZLJA 3EPHA 4PV1C 4PZLA 3WYAA 5IYBG 1NTGA 2JIZD 3ZVNA 1ZW6A 2JASA 5G41A 1I50H 2X1VA 2ZM5A 3P4YA 1PH2A 2QA4A 2XB4A 4JG2A 4MA4A 1W4CA 3SS8A 3ZYCA 5HZHA 2Q0HA 1Q12A 1XNJA 2A68C 1KI6B 4TTRA 2E2JH 1TL7C 4B3TL 1OHHD 3EPLA 2HYIC 2QM7A 4V02A 3CPEA 1VQLA 1F48A 2JA8H 3GEHA 3B1XA 2JA5G 4CF7A 3RRZA 2ES2A 5KO2A 5ELNA 2G3YA 4M2LA 1HV8A 2E76C 2GRJA 2F43B 5LMUQ 3EARA 4HAXA 3VAAA 1AIPA 4YY3Q 3BBPA 2OEPA 2WJGA 3TMKA 4BFYA 121PA 1D9XA 3L0PA 3LV8A 1ZC4A 3VR5A 1C7YA 4DB4A 4P73A 1DD2A 5SZIA 4C0AC 4NXML 1JE5A 1FL9A 5CJ2A 5C4XG 2Q9AA 3BB3A 4I1SA 2OWOA 1E2GA 2O8EA 2YOHA 2IWHA 2OTJA 3CPHA 2F1JA 2O8FB 2FU5C 1GITA 4Q4AB 4WZAE 3HPQA 5JRJA 5GVRA 1E0SA 4FMBB 2XB2A 3KKPA 1YRBA 5IP9H 1QRAA 2IYQA 2JLQA 4YCVA 2P5TB 4LHWA 3U6KA 2B3GA 2JLUA 1RRPA 4MQBA 3WHKA 1SVIA 2F9MA 2HYDA 4YHHL 1KI4A 1ZU5A 1G8HA 3EZ7A 3BC1A 5DN6A 3UXMA 5DISB 2PEYA 3UK6A 4P33A 1TQ4A 4DV2L 2ZEJA 2QU8A 1RRGA 3HOYH 3ETLA 3G0HA 3OYYA 1FQKA 5HGQA 4LGMA 4R7ZA 4JBJA 4URUR 4CGZA 3Q7QA 4G5GA 3VHXA 2UUAL 4OWWB 2IYWA 1JBKA 2JATA 4LUZA 1UE5A 3SNHA 1VQGA 4ACAA 1GNPA 2ZRHA 3THWB 4DV0Q 2EU8A 1QG2A 3VR6A 1OE0A 1Z28A 3HDTA 3HR7A 3ZDQA 1XCGB 1IONA 4IDOA 1KK2A 3KXKA 3BXZA 3VMFA 4BEJA 1SXJE 2GJKA 1VQCA 4Y7NH 3KJIA 4P75A 2K4KA 4GLVB 2V9PA 1GWNA 1SROA 1A2KC 4W5HA 2ZI3A 5J40A 4JC0A 4DIEA 1ZCBA 3KB1A 3N6RA 4HJAA 1G7TA 3H2YA 1NBME 1T3LA 2PCFB 2DPXA 4KFTA 4R2IA 4ESVA 4QQBX 1JI0A 1MRSA 4IOAA 2B21A 3O8DA 4BA2I 5CDFE 4Y52H 1W0KA 1XD9A 2B63H 2WWFA 4RFSA 4DLSA 2JA9A 4A8JC 2R62A 3RRNA 1KAWA 4R4CA 1S1CA 2QL6A 1Q81C 3RS7A 2AFIE 4BLPA 4O2DA 1PJRA 3K70C 2QZ4A 3JVUA 4QJFA 1BO6A 3A1VA 5EXPA 2A69D 5DO9A 4QIWE 4KXFB 1TKWB 4HB4A 1EIFA 1HQYE 4DR5Q 3PEYA 1VQAA 1N5JA 4L9SA 5DH9A 3UKDA 2FZ4A 3BU2A 4B3TQ 1KO8A 4YXWA 2I5MX 4GI7A 1WRBA 4CT4B 4L8GA 2QGQA 2XOKA 4D0GA 1BKBA 4P71A 1E2NA 3DOFA 3RS5A 1QZHA 4B3SQ 4GFDA 1Z6YA 2A5GA 5C2JB 1FMJA 4QGAA 5FPKA 2ID0A 2JK8A 2E5LL 1N6OA 5EXSA 1G19A 2NTYC 1MKYA 2IXEA 4JK1C 2ZVQX 4BFVA 1P3JA 3T56B 4LUVA 3W5OA 4X66Q 1VG0B 1XZQA 1TF7A 4XIGS 2IUTA 3SYKA 4Q7LA 2F1IA 5P21A 1ODFA 2R92H 4KHZA 3U7HB 2N46A 2V6IA 4IEEA 4OJQA 3PUYA 1OKKA 3VA7A 2GCOA 4AD8A 3K80C 3BGWA 1JJ7A 2FFAA 4TMWA 4DSNA 1IXRC 4M9ZA 4HI0E 1AQYA 5DN6D 1DAEA 2H16A 1Q44A 1YNNC 2PQAB 1TEVA 2OBNA 1N6IA 1E2IA 2P5SA 1PYSB 1H8ED 3AP1A 3WBKA 1Z6XA 2VP4A 4GOKA 1W1WA 4HAZA 1X8JA 2ORIA 1L1OB 3AF0A 2EIFA 4OL0A 1UF9A 1WJJA 2F7SA 2OXCA 4ZI2A 2IYSA 1E2KA 2REXB 5FI0B 5GJCA 4JVSB 3T51B 2BCGY 2GXAA 5FOWA 1ZCAA 2PL3A 1LS6A 1GHJA 2B8GA 3GJ6A 4PZ7A 2AMCB 1W2GA 3J7ZC 1KYIA 1BVSA 1A8VA 4Z8XA 2EFGA 3BS4A 4R98A 1V9PA 4DLXA 1KY3A 4M1YA 4HZUB 3K0SA 1SVOA 5J3BA 1CR1A 3I4OA 1AZSC 3IIJA 3NBZC 2RHQB 3U4VA 2CLSA 5DGXA 3O8CA 3PIOA 4PQYA 4UXJA 4KLZA 3C41J 3LH5A 4LJZC 1E0JA 3CR8A 4ZDIA 3EIHA 4ASUA 1M6NA 1XFAA 1XNRL 2OLJA 3VKWA 1RC8A 1BBWA 2N3SA 2ZUCA 1XEXB 2GK7A 3PIRA 3M4OH 1M1YE 4X8LA 1CFMA 2GXSA 2GJ8A 1Z6AA 1E96A 3M0EA 2AL7A 1ONLA 1Z0IA 3MJHA 4HAVA 4R4IA 3BWDD 2OZEA 4QJ4A 5EUMA 1AA9A 3I2ZA 1AGRA 1VG9B 1XMIA 2OSBA 3U61B 3HKSA 2XSZA 3F2BA 5FBWB 2Z5FA 2EYQA 4DIDA 4A3EG 1Z0JA 1FTNA 4AH6A 4D2IA 4CEHB 1I4DD 1O3YA 4QGGA 3R7WA 4MGIR 3F1ZA 3UMRA 4JV5Q 2J0UA 3KKMA 2ZJ8A 1A62A 1GJXA 2NG1A 4JI4L 2DWOA 1EX6A 3TS2A 1W7AA 4Q66C 3BJIC 1K0RA 4IVRA 2KCMA 1ZAKA 4KSCA 4G5OA 1Z7TA 4NB3A 2OCYC 4EJSC 1SZPA 1T6NA 4TL9A 4Q9KA 4LWZA 4BLQA 2N42A 3GLIE 1IAQA 1UDWA 4YMWA 1KQSA 1N2CE 3RWMB 1LUZA 1H9SB 1TNDA 3MCAA 2CFMA 3ULLA 4DV6Q 2UUBL 4X66L 1YZLA 4O2LA 1F6BA 3MEFA 4DNIA 4ZKDA 1VMAA 1FPMA 1KDTA 4KKSA 1KO5A 3HYTA 2E87A 3WP1B 4DV3L 1G5TA 1Y8PB 3O8BA 3QF4A 3NDBB 5EXTA 1XJ0A 1YU9A 3OIUA 3TH5A 2ZS8A 1RW4A 2ZSBA 1ETUA 1XTKA 1F60A 2ZU6A 4DBLC 3RR5A 3B60A 1IN8A 4J0QA 4UP7A 4UNPA 2O52A 2QMUA 3DPUA 4O3MA 1ZD1A 1P5ZB 2BBTA 1VQIA 4A15A 2Q3FA 4OYHA 1KI7A 4TQAA 2B29A 3R8CA 1E2VA 1K8OA 1Q1BA 3A8IE 3IQXA 5FLMG 2WJYA 4Y0AA 1N9WA 4DUZQ 5LMNL 1A1VA 3A4LA 2DN8A 1MRNA 4B34A 3A4MA 1FQJA 3EN2A 4JI0Q 4B3RL 1YHNA 1HNZL 5L3QA 1VQOA 1XX6A 4JLNA 4LK1C 3B1VA 1HCZA 3KJHA 4OJKA 3S1QH 3LW8A 1HT1E 3W6NA 3FB4A 1N6NA 4LV6A 3ZJYA 1ZMXA 4BEBA 4M4SA 2RGCA 1OXXK 2MMGA 4M1SA 2DFNA 4GZYC 4RD0A 3VTKA 1E2MA 3NENA 2GZAA 1TU2B 2HF8A 1N0UA 4KFUA 1U9IA 3MRSA 5CLQA 3S1NH 3TQYA 1T5IA 1M7GA 4K8OA 2XXAB 3NH6A 4RG1A 2UZIR 4DV4Q 2UUCL 1FFHA 1R4AA 3TVTA 1GUAA 4DDWA 1B8AA 4S35A 3L7ZC 3GLHA 2P6RA 4B3XA 5H70A 5D3QA 1VHTA 1QHXA 3T5GA 3HOXG 4LF9Q 2HEIA 1YE8A 2G9NA 1QHHB 1U9IC 1JPJA 2J0VA 3ZVLA 4A3LG 3M9BA 5JHHB 1E99A 3Q9LA 1CUKA 1OSNA 4MH0R 1W0KD 3B1ZA 3THOA 1IW7D 4BRUA 3DMDA 1M74A 1FNNA 5H68A 3JZMA 3QKSA 1ZM2A 3OIYA 1M8PA 2J7PD 1KRSA 1JR6A 2H5EA 3CCEA 2OUKA 1OH7A 3WDNA 2B6HA 4DR4L 4N3NA 5IYCG 1ESNA 2ZTDA 1W36C 4ARZB 1GG2A 2CNWD 4H9GA 2AWOA 1QHHA 3KYHC 1Z07A 3ONWA 2IYLD 2OV2A 4OX9L 1FYCA 3RRYA 4A3MG 2R7FA 2ZI4A 4A3KG 3LFUA 4PHGA 3CC2A 5EP2A 2Z4SA 1Y1WG 2WPDA 4M1WA 1G18A 4AURA 4DV5L 4A3CH 2HT1A 1EFWA 1W4RA 2WWIA 1AS2A 2JJ2D 1I2DA 3KB2A 3TLXA 3ULPA 1FW6A 2V4DA 2R93H 1G3MA 1TF5A 1YRAA 3T1HL 3ASYA 4BLSA 4FIDA 3H94A 2VUMH 1CSQA 3HGBA 2A9KA 2YOGA 1VTKA 3CCSA 3ZQJA 2FFQA 2JLVA 5F9FA 1GUOA 4HIOA 1HPCA 4B71A 2WIAA 1DAFA 2R65A 4JYAL 1BKDR 2NVYH 2GF9A 2UXCQ 2QSYA 5AUPB 4K81B 3U9SA 1SVKA 4KLNA 2Q3MA 4N1AA 4NYJR 2Q6TA 1D7QA 4GT1A 4UXHA 4DB2A 1KZGB 3LLMA 2OBLA 2EFHB 4LDJA 4PSAA 4R2HA 3GJ5A 2ALYB 1QVFA 1IXZA 4E03A 1QHIA 2A68D 1YZGA 3EAQA 2KBFA 2ZR0A 2DB3A 1HYQA 1TMKA 3Q8DA 2VW9A 4GP6A 3ULJA 1IY1A 3K0CA 4XTRA 2D62A 1WFQA 3PV0A 4PO1A 1N36Q 4JVMA 4L16A 1E2PA 5C0XI 2N1BA 2LXJA 1R10A 3HU3A 3NELA 4LV8B 1DAGA 1FZQA 1R8SA 1QF9A 1DAIA 2IXFA 5E7MA 3W9YA 5IYDG 3WYFA 1GD7A 1PH6A 2QQEA 2G0TA 3K9NA 3J81i 1HH4A 4RCZA 3EIVA 4UNNA 2PNRC 4IFDI 2VSXA 2BKEA 1NKTA 1EFRA 1ZM3A 2J5XA 4P4SB 3KF6A 1EGAA 3QG5A 3TSZA 4UNRA 2D0OA 2BMDA 1DAMA 1U99A 3PVSA 4TLCA 1E2JA 5L8VA 2V4ZA 4TLBA 3OFNA 3QQ5A 1KO1A 3NVAA 5FL7A 4A2PA 2AWNA 1VKJA 1GAJA 3BK7A 2OCEA 5GVSA 3STBD 3MXUA 1W5SA 4LBZA 2IA5A 5LDDC 4GMDA 4C3HH 4B75A 4JI5L 2JGNA 3T1YQ 1QBKC 2FSHA 4PC7A 5D3MB 1I3QH 1IBML 2X8AA 2CE2X 2LWIA 2Q8IB 1CBUA 2C03A 2JLRA 3S1AA 4D6PA 2VO1A 4GNXB 1T8UA 2J7PA 1ZNXA 2WJJA 3U44B 3A8KE 3WMFA 2RGAA 2WAQE 1K5DA 3OAAA 1NMYA 1OYWA 4YLGA 3QVVA 1DG1G 4PC6A 4DV2Q 3KKQA 3FMFA 1L4UA 3PR1A 1KIXA 3AF1A 1E6CA 4IW3B 5E7JA 4A8JA 1FR3A 2O0JA 3FYHA 1N6HA 4YCUA 1Z5ZA 4LCBA 1GP2A 4RCNA 4LJAA 3K9LA 2B63G 4IOCA 5IYDH 2D2FA 3B7GA 3DMNA 4M22A 1IYUA 3PIPA 4IHQA 4Q47A 4EQ6A 2ZJYA 1W46A 2AKAB 4MYUA 1NJFA 3RLOA 1GRQA 4NPHA 5F3WB 1JJVA 1PLKA 221PA 2E2HH 2LMCB 1GOTA 2ANBA 4BXXG 1EFUA 1O87A 3I8SA 1DXMA 4IQZA 1J70A 1AH9A 1H95A 4Q9HA 3I7FA 3WBJA 2O8CA 1CTMA 2OCAA 1A4RA 4H44C 4GN4B 3RABA 4LF6L 2IX0A 3PENA 2CVHA 1J5EQ 2QY9A 1NMXA 1NN5A 3BH0A 3A1UA 2XSZD 3BG3A 3TQFA 4C0LA 1LM0A 1VQBA 1KJWA 2G1JA 2J59A 4GNKA 5FTJA 3TSOA 4DR6Q 2JJ1D 1YNJC 3T1QA 3W3ZB 2KENA 4HDQB 3GPLA 3VU9A 1IBKL 2QAGC 4BLTA 2G1KA 1G51A 4HJ9A 4GPTA 1M2OB 1SXJD 1KDRA 1PZNA 1KIMA 4PPFA 3B1WA 3B6YA 5FTMA 1A5TA 2YINC 5BYKA 1Z0DA 4HATA 4V0LA 3AF4A 3VX4A 4ON9A 1UE1A 4UNQA 1P2TA 4DAMA 1ZVQA 2RAPA 4LSGA 4HJ7A 1OH5A 1N6LA 1VCIA 2OXRA 2W00A 2BA1A 2RHSB 1SGWA 3GLHE 2HV8A 2CKZB 5DIFA 1YKSA 4UJ5A 4AG5A 1KI2A 3DM5A 2V1CC 3U4ZA 5LMNQ 4GRAA 4HLCA 5KPJA 2O8FA 4NBSA 1P2SA 4DUZL 1R0YA 2QP4A 1FUUA 3OAAD 3HKZG 1E1RA 3M4YA 4JYBA 4LF5L 1RL2A 4M9SA 3KTAB 3FOZA 1IHUA 2CCJA 4M9QA 3WYGA 4XSHA 3MJRA 4D4KA 2W58A 2VP9A 4DDTA 2FSGA 1E2ZA 4BFZA 2GKSA 2C99A 3SBEA 3GJ0A 5E3HA 1P75A 4NU0A 3DXJC 2ZYWX 3QXSA 4G3XA 2IWRA 4DEYA 2EJMA 2ZE6A 1Z08A 2RKOA 4EFLA 1TPZA 3THWA 2VQFQ 4KO8A 1Z9FA 3M1IA 1KI9A 3EZ2A 3VR1A 2QRZA 3JVVA 2ONJA 1LS1A 1NLFA 1Z29A 2J87A 2QP9X 3FKQA 2E5LQ 3U3OA 1VYTA 2REBA 2KJQA 5LB2A 2ZRBA 3GFPA 1Q8KA 4C2MH 3VR2A 4GLXA 5IWAL 1BMFA 3ECCA 1N34L 1F2TA 4I1UA 3BE4A 3TUIC 1CLUA 2IF0A 2ZE8A 4Q9JA 4WW0A 4APVA 2YKGA 3KZ1E 1E9FA 4DR5L 5EE5B 3MWKA 4EPXA 4EQ5A 4Q9IA 2IEYA 2V55B 4AG6A 3TQCA 4DV5Q 4PG3A 2QAJA 2EJGC 4LF7Q 1JR3A 2BCJQ 3GJ3A 3PO3H 1O7LA 1OFHA 1Z83A 2TMKA 4A0RA 2DCUA 1U2RA 4NCIA 4PHFA 2A3RA 2Q3HA 2A5DA 4IRUB 5FLMH 2DYKA 3OZXA 4FWIB 4OQMA 4Q9LA 1CEEA 1DGSA 1T5LA 2NGRA 3TREA 1F3OA 2IXGA 5IK2A 1TEXA 3FE2A 4TN1A 2FJUA 3E1SA 4US1R 4R71A 1MO3A 4JCVE 1SLJA 4MTNA 1G9XA 2CL0X 1E2DA 4BFWA 1KNQA 4TYQA 2R6FA 2ASBA 1IN6A 1PH1A 4DR6L 1VQNA 1WCMG 3AFPA 2C2HA 1Q21A 4XOIA 2RHMA 4XSGA 4CEIB 1PH3A 3BZCA 4KFRA 4ARZA 5BN5A 3EC2A 3S17H 1VCOA 4DDUA 1W47A 1PUJA 2WOJA 3CX6A 5IYCH 5FR2A 1KKMA 1RE0A 3AQ4A 3CRW1 4A3FH 4PO8A 3CRRA 3HR8A 3QXJA 1ZU4A 4GMXA 5M3FG 5BR8L 1XTRA 1EESA 1B9NA 2JA1A 4WIAA 5C44H 3LA6A 3M4PA 1NP6A 4DLRA 1N36L 4LI0A 5M3MG 3PUXA 5C4GB 4ERNA 4LF6Q 5GJBA 2R9VA 3CD6A 1XXHA 1Z0KA 2ZANA 4OX9Q 1WF3A 4ZV4A 1JMCA 3LBHA 3PQCA 1UEBA 2EJFC 3OEEA 5GAHC 3QBVA 4Z8YA 1FUKA 1I6VC 4DK1A 5CIWA 3EZ6A 1E24A 1BMFD 1H9RA 1I6HH 2WWGA 4Z54A 4H1UA 4B43A 5JSZA 5GAGC 2NZJA 1JPNA 3EZ9A 4TVAB 2ONKA 1H9JA 4DAYB 1Z22A 2FE4A 2XTMA 3RAPR 1X65A 1XJVA 3LX8A 3KQLA 5JCZA 4G5RA 4OI0A 1VQ7A 4UNSA 2CLDX 3CUEF 4G7OC 4KU4A 3KX2A 2BE5C 1M7BA 1GTVA 4V0NA 1AQUA 1BIFA 4OHZA 3SJZA 1US8B 3VNUA 4TWZA 4L5SA 3U7EB 1DS6A 3FVQA 2FGKA 3REGA 5A5GA 2QBYA 4Q48A 2KHJA 1QZGA 4IJMA 5FPTA 4K0KL 3UG7A 4NKRA 1NBWA 5AR1A 2Q2HA 2WB1G 1M1KC 2SHKA 1NJIC 2Z6KC 2NOAA 4PFSA 4GOPC 3DL0A 2QGZA 1C4OA 4JMPA 1Y1VH 1HY3A 1ZM7A 4WZ6A 4BY1G 2X77A 3NG1A 3CNLA 5C1BA 5F98A 5KOYA 4JLBA 1JAHA 5KSYA 3EWAA 2WWYA 1FOEB 3IO5A 4TL8A 3UATA 5JI2E 3NDPA 4DV3Q 3LLUA 2KSQA 4DV1Q 2KI5A 2QMEA 2FPKA 3LQQA 4FMDF 1KI3A 3THXB 1KXLA 4OO1H 3S14H 4JT2A 2JEAI 4LJ7A 3KF8B 1GL7A 3AVOA 4POAA 1VQ9A 5FJ8G 4A3GG 1C0AA 4JI1L 2OQ0A 3U60B 1NF3A 4DK0A 2WZQA 3QEOA 1ESMA 1VCMA 1I94Q 2FPMA 3ADBA 2K52A 1IQPA 1SKYB 1SHKA 2NIPA 5FOSA 4ZDKA 1KTVA 3RN2A 1E1OA 1T4GA 3RDPA 2GVBA 4DHEA 1KK1A 3ND9A 4JBWA 2ZJBA 3KJGA 1P73A 3OEED 2OM2A 3GLIA 1MIUA 1FL0A 1X55A 1HNXL 3CPWA 1XZPA 2JIZA 1KDPA 1NMZA 4A3BG 1OFIA 2B7BA 2UKDA 1GZSA 3T61A 3I32A 1F5NA 2BBWA 3LAWA 1E2QA 1WXQA 2PX0A 2PH1A 2WWWA 3D4RA 3HOZG 4WJ3M 2VPPA 2FX3A 3JAMi 2JLZA 2PCLA 4MUBA 2OTLA 1N8RC 1P2VA 1JAIA 4A9AA 1ZINA 1E9EA 1X3SA 1COWA 2DR3A 4DR1L 3WMGA 1MJEA 4YXWD 2JDID 3IBYA 3B6EA 1E79A 4Q4JB 4BQSA 4ZI3A 3K70B 3AP3A 3J80c 2XX3A 3UPUA 4A6XA 5EP1A 3AKDA 1JXOA 1EFHA 4MNOA 2GDJA 1UDXA 4C7OA 4V0KA 2ZYTX 2FG5A 5J4LA 4AYBG 5EE9A 2H57A 5JZVA 2JXMB 3SN6A 3QXXA 3I62A 1WDTA 1X3GA 1XJQA 5FFMA 4PAQA 4OKSA 1MH1A 2BIFA 1NLZA 4NH0A 3ICQB 1RPZA 4U7DA 1KC8C 1E98A 3WXMA 4PQRA 1SRUA 5FBLB 2ZROA 2WWXA 1KKLA 1CJTC 1Z8FA 2HDNB 2IEZA 2ZRNA 4R4QA 4P74A 2NQ2C 3FDIA 4OHVA 3BZKA 1TWCH 3OHMA 4MRVA 4A36A 4DV1L 1DAHA 1QVRA 4P4TA 4C3ZA 3L8YA 2NPFA 2YTYA 3U7GA 4US0R 4XWOA 1MO4A 2VHUA 2CCGA 3RNUA 4JI6L 3PUZA 1OIVA 4JJKA 3CPFA 4LFAQ 4TLAA 2DY1A 4XH9B 1I5FA 1M90C 2Z4RA 4H0LC 1P61B 5FPHA 2Q9BA 3FKSD 4YMUA 4X65L 2V7QD 3RZDH 3QKTA 4AYBE 4EPRA 1GVNB 2NO7A 2I3BA 2YOFA 4MKFA 2QAGA 1II8A 4A3MH 4RMFA 1X56A 3NEMA 2GESA 3GFTA 1JEDA 3ZD6A 4PC1A 4AQYQ 1Q7YC 2GBLA 4OQNA 2RMKA 4J15A 2YYZA 4Q1EA 1Z2CA 2JJ2A 3AP2A 3CF6R 4A93H 621PA 4JI1Q 1GO3E 2QRNA 3D8BA 2JA6H 4KITB 2O8DB 2IUUA 5CITA 2MO0A 1CKEA 2C9CA 4UJ3A 1G8FA 2NO1A 3LRPA 4TSFD 4C4PA 1GM5A 4TQ9A 1W4AA 3C14C 3GLHB 1L8QA 4IFBA 4QXAA 2FXQA 4AKGA 3L43A 1WP9A 2AK2A 3AGQA 3OIVA 4M1MA 2IHYA 2Y8EA 1E0AA 1WBBA 1HJPA 1PFSA 5F9HA 3M4QA 4JIMA 4GP7A 3EX7C 1DADA 5EP4A 2J46A 1NKSA 3CXCA 4QHTA 5IP7H 1IN7A 2RB4A 4HR7B 2WWHA 3PJRA 4D26A 3L2PA 2K50A 3A8TA 4IPHA 4PR0A 4BUJA 4EPWA 2OILA 2G88A 4KJZA 1W44A 1K3RA 1A6XA 4W7SA 1Y14B 2QM8A 3CW2A 1C9KA 2ZYVX 3TR5A 1JQJC 2D4HA 1G4UR 2VP6A 2ATVA 3T1TA 3UWKA 2IHFA 4AKEA 2YWFA 1FTSA 2QPAA 4AYWA 2NO6A 3FKSA 3THXA 1COWD 2CJWB 1VYUA 3AF3A 3RLFA 3NC1C 2MQHA 4IEIA 4KKUA 4QNRA 2W6JA 1II8B 3R9IA 3AF2A 4DEXA 1KL9A 3OEHD 1X8KA 1AS3A 4A3CG 4MRRA 4P72A 1XNQL 1Q3HA 2VP5A 4D4JA 1EFRD 3IILA 2VL6A 3KXIA 5E7IA 4JSTA 4YQFA 1W5TA 3V00A 4EJSB 3PO3G 1YI2A 4V0OA 4CRWB 3I92A 3S16H 3GO5A 1PA6A 3MGCA 4II7A 1OKKD 1VHLA 4LRWA 4A4IA 2MNAA 2V7QA 4A3LH 4QY7A 3QIAA 3LGJA 3K9HA 1A82A 3OESA 4AK9A 2QQ0A 3QE0A 2HLDA 1P8LA 5C3EG 2WMNB 2MSCB 1U0LA 2JA7H 1FX0A 2HHHL 4XD7A 1WCV1 4C3IH 1Q57A 1VG1A 2BDTA 1IY0A 3A7LA 2BJVA 4LFBL 1XTJA 1JB1A 2R8RA 3CMEA 5EZ5A 3KQUA 5FOXA 3NIBA 5HKKD 4AYTA 3B85A 3HOVH 4HIKA 4TYYA 5IF9A 4MRSA 1AKYA 1VF7A 1S1MA 3CCVA 5EE3A 4Z51A 2ZSAA 3AKCA 1P60A 2ZI9A 1NY5A 1G21E 5JJIA 1OV4A 4ZCLA 4DCVA 5H1SE 3CRLC 3I56A 2HCBA 4PC2A 1MR3F 2DUDA 1XU4A 4H13C 3K0FA 1H8EA 1NN1A 2NO9A 1PMRA 4KSBA 4TYNA 5EAYA 2ZJZA 2NZ8A 4OQLA 1G8GA 1NY4A 4DSOA 5L3VA 4A3FG 5TY0A 2WBLC 2JJ1A 2RGGA 5CLLA 4ZIRA 4KBGA 1K8RA 1SKQA 4A0GA 3S24A 1W36D 2UU9Q 1H9MA 2KA7A 2FMXA 1UJ2A 2I4IA 3CM0A 5BQ5A 2K33A 3UIEA 2RCNA 2YVUA 1HT2E 2EFCB 3K9GA 1G291 1U98A 4Q4HA 2GZHA 2WM9B 2JA6G 2QP3A 1J99A 3GEIA 5KSZA 3NEYA 5D3MA 1HNWQ 4V03A 4Q1BA 1P16A 4Q01A 2QTVB 2VQEQ 1X54A 4IXMA 1HZBA 4NYMQ 4ILEA 2ZI5A 4KAXA 4A2QA 4I1OA 3LVQE 5TB5A 1ZIPA 3TSWA 4FCWA 1N6KA 5K36G 3HJNA 1UKVY 3BH7A 1G41A 2AUKA 4OO1G 2GCOB 2LKCA 4QGFA 4F4JA 3E70C 2EVWX 1NVVQ 4GSYA 5FL3A 3TGPA 1WOCA 3GDEA 1G7SA 2HF9A 4JYCA 4BWYA 1LTQA 2B8TA 1WB9A 2PNHA 2L15A 5JEAJ 2F3IA 1U81A 2IBMA 1KNXA 3QVUA 4OI4A 2CW0C 5CIQA 5IDVA 3H0GG 4UY8C 3IEVA 2RGNA 2PLFA 4WJ4A 4IOKA 1EWIA 4E22A 1PH5A 2NVQH 5LD2C 4YMSA 2WVJA 3KDFA 1NJGA 2QUZA 1SVSA 5JWHA 2WJIA 3VR3A 3WNDA 1YHAA 5JJLA 4BRWA 4LK2A 1G64A 5FPYA 4QFMA 3BDOA 5KNDA 2ZRJA 3ZVRA 1OXUA 1RJ9A 1HE1C 2R6GA 1HNXQ 3L8ZA 1E2FA 1K73C 3J7A5 2QROA 1N33L 4QG7A 4C0KA 2ZSDA 4DWJA 3KQNA 1EXMA 1GKHA 5M5WH 1EK0A 4IPGA 1YJNA 1N0VC 4GKJQ 3CH4B 4Q4LA 4QGUA 1CXZA 2OCPA 5AJ3L 2ZUDA 2ATXA 5M5YH 4LPSA 5AJXA 1W0JD 1VQJA 3QPWA 4PSVA 3M6AA 1KRTA 2OAP1 1OB2A 2CLCX 2RGEA 2JA7G 2VTKA 1EX7A 1S3GA 4PZZA 2XTNA 4CEJB 4Q5IA 1HQMC 3CC4A 4TT3D 2PI2E 2K5NA 1OH8A 3ZJYC 4A4DA 3BJUA 4BA1I 3UDIA 1RZ3A 1W2BA 4RVCA 3KJEA 2XZOA 1IBLL 1PH8A 2C98A 3NBFA 4IOLA 2G77B 3BRWD 2UUAQ 1DEKA 3G5UA 1Y63A 4XVRA 4G1UC 4POFA 4LF8Q 4G01B 5KNCA 4L4UA 3AEVA 1UWVA 2AD1A 3IDQA 2KHIA 3DO6A 3QNUA 4V0MA 4PC3A 1VYVA 4GS3A 2JA5H 3B9PA 1WMSA 4BLRA 4PAMA 3KQHA 4BY7G 5HE9A 4L9WA 4HUTA 4KVGA 3WP0A 3NWJA 1UPTA 2KB0A 4EKDA 2NN6I 1V43A 1UKEA 1ZUNB 2J9RA 4A8JB 2QG6A 4A3JG 4LHXA 3PEWA 4L5BA 2XAUA 3PUVA 4GKKQ 4Q19A 4E07A 2UXBL 821PA 1KJZA 1L2FA 1N6PA 3I4LA 3FTQA 1XMJA 1G5RA 1CI3M 4WOPA 2O5JC 1RRFA 2NN6H 3LBIA 4M1KA 5H1YA 3TVDA 1M7HA 3EXAA 2ODBA 4KODA 2I5HA 1IL2A 2EW1A 2OG2A 4XJXA 2GF0A 5A35A 3PGZA 4DV0L 1DO2A 2ERXA 3BD9A 4OK3A 1E3PA 2UZ3A 2BHRA 1ZC3A 2ZYUX 3HKZE 4BZXA 2YTVA 3NBHB 3AFQA 3S2HH 2JLYA 3K0FB 2LKDA 2ZJRA 3QY0A 4LJ4A 5H8WA 3QKRB 1GKIA 1YVCA 1VQ5A 1ZNZA 1DO0A 2GJ9A 4YWMA 3IIMA 1AM4D 3W8RA 3QPVA 2K75A 1IBMQ 1LV7A 1CSPA 1OF1A 4JKIA 1Y8NB 2CNWA 4LYJA 3MSXA 5AJWA 4A3EH 3GTQH 3PO2H 4EDHA 2C95A 4BXXH 5G53C 3ZIAA 4HAYA 4DUGA 2D5DA 2R6CA 4HLUC 4B3SL 5CYPA 3ZH9B 2VQSA 4X62L 5M5XH 4JBMA 2ANCA 2RH5A 2K5UA 2HUPA 2V6JA 2WPDD 2OE2A 4TT3A 1KZ7B 3KFXA 4GOJA 3ASZA 4M21A 4KV9A 2XNSA 1J6QA 1NN0A 2P6UA 1HNZQ 3FMPB 1X3FA 1E9SA 2L0XA 4RCYA 4HZUA 1P6XA 1E2WA 4RFSB 1JJCB 4B48A 4C7OB 3DEFA 4YCWA 3P26A 1TUIA 4NTZA 4POGA 1ASZA 2EVBA 1JR3E 2Z6VA 4Q4JA 1EYGA 5DI9A 2VP2A 2XTZA 2ORVA 1E9RA 3DZ8A 4TTQA 1HH2P 2QT1A 3W6OA 3KDSE 1GL6A 1VPLA 4O25A 2AHOA 1G8YA 4TMTA 2BV3A 2WSSD 1VQMA 4F93B 1IOZA 1FP7A 4CDGA 1NNEA 8OHMA 3KOJA 1QUQA 2OLKA 4NYIR 1H65A 1Q22A 2VL7A 2WKRA 1U0JA 4WVFA 1GRNA 3TUJC 4BZPA 3ZVMA 3H4MA 1G7RA 1QHYA 3VR4A 2ZQ5A 2GAOA 3AVTA 4DKAC 1PH9A 1J2JA 4OGQC 2GEUA 1X3EA 3K0AB 2C35B 1N5IA 1R0WA 4JLVA 3FPPA 1KI6A 1HEIA 3K8YA 1TWAH 4DR7L 1Z0AA 1ZYRC 3CRMA 3NH9A 4FCTA 4IDPA 4P4SA 3A6PC 5KSPA 3RYTC 1E22A 1AK2A 3ND8A 4JLMA 4Q1AA 421PA 4EAQA 2FSFA 1B0UA 2ZRMA 3V9PA 2D7CA 4AKIA 3VKHA 1RIPA 2YC2C 3GTLH 3CZPA 1S9HA 4QBHA 2VLIA 5TDHA 4C30A 3R7WB 3U6BA 3CLVA 3HU1A 1P9WA 1Z6TA 2MSEB 5GADC 2W6ID 4A6PA 2A69C 3H0KA 4NXNQ 4PPQA 1Y69U 4JLJA 4YY3L 5FTKA 4YHHQ 2DNCA 2WICA 1NY6A 2C04A 3F2DA 1HNWL 5IYBH 2XOKD 3KTAA 4TKOB 1IW7C 2HQLA 2HIVA 2N8NA 1US8A 4OQFA 1W0JA 3SJCA 3Q3JB 3OTOL 1NL3A 1RJ9B 1EOVA 1P4SA 2PZEA 4X8HA 3U50C 2BDOA 2AXPA 5DHAA 1QJOA 2FZLA 2ZAMA 1AJEA 1NRJB 2V1UA 5KNBA 2Z0MA 1E9CA 3W1GA 4B2LA 4OHWA 2UXCL 3CMAA 5SZJA 2WTUA 2UXBQ 1KMHA 3IPYA 2RGXA 1OB5A 2XJ9A 5FR1A 4QBFA 3M7NA 5DI3B 5FTLA 3CWQA 5C4JH 1VQKA 4EFNA 4JBKA 2QA5A 2FV8A 3L0IB 2CK3A 4HUQA 3CF2A 4LJ8A 3I61A 4PHHA 5C4MA 1AE2A 3GCGA 4YDSA 4TSFA 1CKNA 3PO2G 1XTDA 1LNZA 1G16A 1L4YA 4MUAA 3TIFA 4B3CA 2JEBI 2WB1E 5C18A 1MABB 3CKLA 3QI2A 1SR3A 4HJ5A 2O5IC 1ZD9A 2WAQG 2ZRCA 4YC7A 1PH4A 2UU9L 4RZ3A 5CM9C 2F9LA 5HE8A 2E8GA 3I4NH 3B9QA 2MO1A 4TQUS 3X2SA 1NE3A 1CIPA 1UBCA 4HUQB 5EQTA 2OFOA 4JV5L 2OFXA 1NVWQ 1S2MA 1UBFA 2QMHA 2ZI7A 4LJ9A 4OXPA 3PUWA 1CULC 1HZCA 2K5VA 3AM1A 1OW3B 2CMKA 2CVFA 3IHLA 4DT1B 4M9XA 3GLIB 2XXAA 2Q2IA 2PI2A 2PCJA 5GJWC 3QXCA 5J5CA 2P0EA 2ZR9A 4GL2A 1R2QA 3PSIA 1D2NA 3AKYA 4P3YA 4XD7D 3K8AA 3A1SA 1WYDA 1S0UA 3IGFA 1ZIOA 1L2TA 3RNLA 4ABYA 3LWNA 3X1ZA 4DLTA 3EQLC 2FFBA 2ZS9A 3IPXA 3SFVA 1YJWA 3R9WA 3MD0A 5B57C 1A2BA 5JHGB 3HOUH 3OEHA 2OBMA 2GEVA 3T1VA 4YWKA 1XBTA 2ATWA 4ZCMA 4PMWA 1VIYA 2W2XA 3SZRA 2JLWA 1NMGA 1MOZA 1X1SA 3G82C 2JAQA 3ADKA 2G6BA 1D8TA 1WE2A 3TJZA 4EPYA 1M34E 2R6AA 1VF5C 1WI5A 4ZCIA 2E74C 4LPKA 5DYIA 5JEAG 1CRQA 3LDAA 3TS0A 2VNUD 2NVTH 3QEJA 4JVLA 2C96A 2J0SA 5EJEA 5M3FH 2ZE7A 3FHOA 2QEQA 3CCMA 1XMQL 4QL3A 4BFTA 2IYUA 4BASA 3QOFA 1GL9B 4HB0A 3DKVA 3FKIG 3DZDA 4GBMA 3GEEA 3T53B 1OXVA 2H1LA 4O0AA 1UADA 1S9DA 2N78A 1U94A 2C9OA 4NZYA 3E9IA 3K0XA 4DV7L 5C0XG 2PJZA 1P9RA 2FNAA 2Z83A 3KKOA 4Z1MD 2D06A 4F91B 1Z06A 3L2OB 4LY6A 1N32L 4MITA 4JL8A 4UPAA 1N25A 2PT5A 2GN5A 1AZTA 2MSDB 4L8JA 4OWXB 4MKIA 5FUYA 2GCNA 4KYUA 3UMSA 1S40A 4NYJQ 2R7ZG 2IL1A 4EIWA 5JEAH 2F3RA 1EFCA 3RVBA 4QL5A 1HQCA 4DLVA 2QF7A 4ITRC 3VHLB 3T1HQ 2VBCA 2HXSA 3I4MG 1HTWA 3RANA 1L0WA 1LABA 2GAAA 2OESA 3M85A 4DLZA 4ZO4A 1I94L 2UUCQ 2A5YB 2XNDD 3UMFA 1UAAA 2A19A 3CRVA 1YVDA 4D0NA 4LF4L 1PH7A 1YR9A 4FD2A 5K8IA 3GLFB 4HAWA 4F4IA 1TU3A 1SXJC 2AXNA 4HLQB 4G7HC 4RZXA 2Q2UA 2RGBA 3G4SA 2XZPA 2FFHA 2BEKA 4PHTA 3U5ZB 1NI3A 4YWLA 4IOMA 1G3IA 5DLQC 2BM0A 3T15A 2PMDA 4IPDA 1K6MA 4PZYA 3Q8XB 1CF4A 1TUEA 4BY1H 3NC0C 4GOPB 2W6IA 2D2CC 4I99A 4TMXA 1FVIA 4BY7H 4IVPA 2W2TA 2J0QA 4PZ6A 2J1LA 3HPRA 1GRRA 2BEJA 1OXSC 1XNRQ 1TQDA 1KMHB 2ZT9C 1KJYA 1SVLA 4BBRH 5BXQC 4LV5B 1R8QA 4DLYA 2H92A 3U2QA 4L5QA 3KKNA 4HYYA 1HTPA 5LMUL 2OT3B 3WHLA 1T8TA 2A6EC 1NSTA 4GN3B 4LZZA 4UKDA 1OTCA 4R4OA 2EFDB 3BORA 1LYLA 4JVNA 2P65A 4GOXA 4JI2Q 3CCUA 4F4CA 2CL6X 2HIXA 1WBDA 4KMUC 3H15A 1UKZA 4QHSA 3KQKA 5KDDA 1EUJA 2CJWA 4DCUA 1U0HC 3QJYA 3GLGE 1OHHA 1QHGA 1YR6A 3FMOB 4DRZA 2FH5B 3DKPA 4CEHA 1KDOA 3OW7A 2GCPA 2O0KA 2QSZA 1YZ6A 3EZFA 2IT1A 4P0TA 4EJSA 1DBSA 3THYB 2IS6A 1CJUC 4JI8Q 1LB1B 3QENA 4M1TA 3S1AB 1E4VA 1HA3A 3V4FA 4DNTB 5E4FA 2BBOA 4BPBA 4A1FA 4MKGA 2K5HA 2ZUBA 2I0QA 1DG3A 2GVAA 1OIXA 4DR3Q 1GKYA 1XTQA 1Z6GA 3AVVA 2R7DA 6Q21A 4M8NE 4GN5A 4HDOB 1O78A 4TMKA 3U3JA 1F2TB 1F2UB 2VQEL 2EYUA 5IWAQ 1VCNA 2DBYA 1LY1A 3W6PA 1YJ5A 2O5VA 3ADDA 2C9YA 4DNRB 1N32Q 2UXDQ 1VQ6A 4RSGA 1RYFA 2ODNA 4FDBA 4DLWA 1FGUA 4OO1I 1NG1A 5TVKA 1UE6A 1ZD8A 3SGIA 2AR7A 4AYXA 1BYUA 3TKLA 3LNCA 1LF5A 2FGJA 3BB4A 1F2UA 4LBVA 1ZJ6A 2ZJAA 5ANRB 4OI2A 4KHPQ 3DM9B 2BBSA 2ZRIA 3C15C 4MGZR 5HR5A 3CH5A 2HJGA 1GILA 3KXLA 1PLLA 2CHQA 3R9XA 4MZ9A 3CO5A 3NEJA 3QBTA 3BOSA 3F5FA 4NCKA 5G3YA 4DDVA 1R5BA 5CB6A 4IJHA 4LNQA 1XD2B 4B35A 5AUOB 3B13B 2REOA 3AUXA 2K7VA 4X8MA 1A7JA 2E1RA 1K8AC 1YHBA 1T91A 2EXDA 4A2WA 2G0NA 3KF6B 2IS1A 1TWGH 1TWHH 3CRKC 1RFLA 2WAYA 2ZETA 2CK3D 1IXSB 3B5JA 5LPNA 5TARA 2PEZA 1B70B 1OH6A 3LXRA 3H3VI 1N5LA 1E69A 5DYGA 1XD2A 3AVXA 2W83A 1JJGA 1Q1EA 4JI8L 2ZSFA 3K09C 4IFEA 2ZTEA 3G48A 1TF2A 4PO9A 4B3GA 3STBC 3VU9B 4IDNA 1ZUHA 2CHVA 1G20E 1Z63A 2PLRA 3N2EA 2ZTCA 4DK6C 1SXJA 1XEWX 1MO6A 4C2UA 1HURA 2GXQA 3C5CA 1OYYA 4IDHA 4NCHA 4AIIA 2IX1A 4JLPA 5FPSA 2XZLA 3TNFA 2NPIA 5EE0A 4C0BA 4W5WA 4WXRA 3Q72A 4AI6A 1S4QA 1PUIA 3PF4A 3FGNA 5B2ZA 4B76A 4FWTA 2JLXA 1WCMH 4YMVA 1Y1WH 3RRMA 4CEIA 3M3YH 3CWZA 1BS1A
chains in the Genus database with same CATH superfamily
2QUKA 2VTDA 1QH8A 3Q8KA 3IXQA 1CRPA 2I55A 3OZAA 4U1RA 5I7OA 1I8TA 1R6AA 1A9XB 5BN4A 1SVNA 3B70A 2ZXFA 4U2EA 3E15A 2IYXA 1JEJA 4X6UA 4ATNA 1D4FA 5IJ9A 1POWA 5KNLA 5H82A 1SVMA 2HOQA 1P62B 2VUTA 1HE2A 4ZDJA 4AQYB 4FW8A 4Q7KA 1RABA 3CT6A 2BRUC 2RVLA 3PFIA 2I22A 1ILQA 2YXPX 3G2KA 1VECA 1JIQA 1WDLA 1NVUQ 4L8FA 5DWQA 1QV6A 4YJFB 2ZITA 2C4UA 3BCSA 2PU7A 5A5VA 3HEMA 4UBOA 1EHIA 5J4YA 2QTHA 2CBZA 3IP3A 2Y05A 4Z9FA 3IKMB 2J3LA 2HD3A 4ZANA 4X84A 1HR0W 4KNVA 4D3YA 2HBZA 3FTPA 2W2KB 7AT1A 5KYNA 4YV0A 2V45A 4H1VA 4H4CA 1ZGAA 5JLJA 4EOGA 3ETCA 3V1KA 3CBGA 3P9SA 5FFFA 4OHYA 4AMBA 3KJPA 2J7KA 4RIEA 2IZ6A 5ETJA 4H60A 4AZ3A 5EJ6A 2R1TA 1UMKA 1YZNA 3KYCB 4PHCA 3PP8A 4GP9A 5F2NA 4WBSA 4XDXA 4LCJA 1E7ZA 1IULA 1JQKA 2YYYA 4XR9A 2BI8A 2Z95A 4ZQGA 5C0OE 1CS0B 3WZMA 3BVGA 3OTIA 1BA2A 3SR3A 4X62Q 2VNJA 3NHYA 2X0IA 3WJAA 4TTVA 5K0FA 4XPZA 3CR3C 1CERA 3F9IA 4CT0A 4D46A 1B7GO 2CH4W 1U8UA 4GM0A 4YAIA 2G5GX 2JANA 3EXHC 1RZUA 5T4EA 4ZQIA 1CUHA 2RAFA 4Y0NA 2QD4A 2VHCA 3UHOA 4F8EA 1TA4A 5INTA 2A2ZA 1RADA 2GXUA 4HVCA 3HDJA 4UQPA 2VTVA 1FDVA 3IS3A 3RTBA 4BQQA 2ST1A 5JZOA 2F0SA 1RI2A 3OM0A 3SR4A 3RK0A 4ZDWA 1LQ2A 4BRZA 4FMCB 2BDNA 3EZNA 3C3CA 5EOVA 4OUDA 4RY2A 1HE8B 1TM7E 4URVR 5HKOA 3UMMA 1ZSYA 2ZAOA 3CCLA 3PWZA 1DFHA 1EUQA 1C50A 1ZGBA 1O58A 1K83H 2A5LA 3HG9A 3AEKA 3GZJA 1TWFH 3LT4A 3OURA 4KBYA 1YRLA 4G5SA 1MMFB 5DF1A 2ZBEA 5DTRA 5B3LA 4O4IA 3MC1A 3PHIA 1CTQA 1NUUA 1TT7A 4HNTA 3R9XB 1G17A 1K9SA 4QMGA 2IP2A 4FOOA 2DPGA 4N0PA 5IBRA 1EVIA 3RASA 3GEDA 1XZEA 3CONA 4L0MA 2YNMA 2XGTA 2H54A 2Y0CA 4JI2L 1FW8A 4BTLA 2V3VA 4C4RA 1OPXA 4J0HA 1X32A 4GNXC 4FF2A 1B43A 1AZLA 1ODKA 1SG0A 4ZAZA 3UAOA 1G3RA 5DZSA 4E1VA 5HZKA 1PR5A 4RDCA 1V1PA 1SOUA 5FV7A 3CURA 3SZOA 5AJ3Q 4UU1A 3IE1A 3K5MA 5I9LA 1UEJA 3I91A 1F7UA 3HYRA 2VAPA 2NZOA 3AILA 3DQQA 3KQYA 3OD1A 3HJAA 4KKXB 1VIVA 4L74A 1LLRD 4YWHA 3C46A 2F59A 4YRDA 3GLFE 3PQEA 2JLBA 1YR2A 4A3GB 2VSQA 2CBXA 2IYZA 4MRPA 1YK1A 1SNMA 4DSUA 4WBNF 2GSDA 3ZKAA 2VQ6A 1ESFA 2JH8A 4G26A 2GKGA 3IKJA 1FPQA 1NVEA 2NNWB 3C45A 3ETEA 1J7KA 5FI1B 1C48A 4A03A 1LPNA 3W8NA 3UJ8A 1Z0FA 2VQEB 3GFQA 4H31A 1RHQA 1UKBA 3AY3A 3IP5A 4HNSA 4A3BB 4DLNA 4R2JA 5FWYB 3HBFA 2O2XA 2QNIA 1TYEB 1D5CA 2AOTB 4D97A 1G2IA 4EY7A 4XYQA 2J85A 2AKEA 3ZQ6A 2Z1DA 2I03A 2R1VB 1SA0A 1X0XA 3G9TA 3O4GA 4F2WA 2NMVA 3CRNA 5I45A 3EBEA 4UFOA 3C1TA 4ETWA 1KRXA 4XWGA 3LIPA 1TW3A 1RYBA 1Z56C 5E0KB 3UWPA 1MAVA 3STUA 2IYRA 5EWLB 4AX8A 3ZZ1A 1MT3A 3CX7A 3I9OA 5HF6A 2WMOB 1VJGA 3USCS 3WLNA 2G8LA 3P9QA 3F2CA 3BS1A 4HADA 1EEXB 2UVPB 2PFSA 3QKWA 5C8ZA 2XGMA 1G4AE 3MW8A 3ZE1B 5IK2D 5IXJA 3ZLJA 3N8NA 4CMHA 2CCZA 3F6EX 1IBLQ 4EHHA 3FP9A 2BUCA 2JARA 3EPHA 2F1RA 5CFPA 1XWIA 1HR0Q 2XEXA 4N82A 5JJBA 1T13A 5BWLA 1I4QA 1SHZA 3EPKA 3Q7PA 5G1PA 2X2EA 1ISJA 1U8CB 4J7CA 3RO7A 4KACA 3JQDA 4NOJA 2HQ1A 4A93G 3A6KA 3JQQA 4EG7A 2PS1A 1XZ8A 2VSYA 1C80A 2PX8A 5F9MA 2QRVA 1KR2A 1S89A 3DTNA 1P1CA 4HEQA 4O2AA 4GKJB 4D0LB 2A3NA 3U44A 1NVAA 2AH5A 1HDZA 4QRHA 1MJFA 2QE7A 2XHEA 4EJSA 2BOVA 3DDWA 3S1MH 3HB4X 3JWIA 5CM8B 3U3RA 4AO6A 4D9KA 5B4UA 3B82A 2YWRA 2DFLA 3TJRA 3VQTA 4JKYA 4WCDA 1SHLA 4EF6A 1MOPA 1VHWA 1IXRA 3U3DA 2GM9A 2HTFA 4YWJA 2B9EA 4URXR 4N7BA 2C94A 4RQBA 4FF1A 4FHEA 4RPHA 4LHSA 6ADHA 4HSEA 3GMTA 3RFUA 4NFYA 3H5LA 4Q00A 2YTXA 4B4KA 3I53A 4UOEA 4M37A 5CB8A 4ME3A 4GKKL 3K5HA 4XXEA 3TINA 1TUBB 5JCPA 1F51E 1HDGO 1QTNA 1V8QA 1YQDA 1ZH2A 2PMZB 1XXHB 2W6OA 3BXFA 4HQ6A 4D43A 4DSTA 2HJWA 4LF8B 3FGPA 4MWSA 1FA9A 3ONEA 1A9PA 3JQAA 4RD6A 4R9RA 2PZMA 3D81A 5B53A 1GPH1 4X64Q 2K1BA 5ALUA 2G72A 3E5NA 4K14A 4ALMA 1IPFA 3AUJB 3NATA 4FOSA 5GINE 1T0JB 2H0RA 1TU4A 2W93A 5TT1A 2A78A 4D9NA 1F2DA 2OHVA 1A9QA 2CMFA 3CC7A 2B2TA 4FFMA 4LRSB 1BHQ1 2GSWA 4DF7A 2WOOA 2GEBA 4JIGA 5ICSA 2GI4A 5KX5F 4NOLA 3IRUA 4TL6A 5EKUA 2N3ZA 4YTEA 4X65Q 1IQRA 3VDYA 4JNKA 2YHIB 2YWEA 5EJFA 1RQXA 5FI3A 3WDLA 3EG9B 1PTOC 1NI4A 1C7RA 1RWNA 2NQ8A 3ZHZA 3H0EA 4GOLD 4NCNA 3ZWXA 1F2ZA 2R87A 4RHYA 2EKDA 3EA5A 2HJ9A 4A3KB 4QECA 5B58T 2I1VB 1EYCA 4RHTA 1XCPA 4RD3A 5LZ5A 3WLOA 4P0PB 2LPMA 4HEJA 4NDNE 3G49A 3FF4A 1YUNA 1C4WA 4JEHA 3FPHA 3HY6A 1F0NA 4P4GA 3GUUA 4UTXA 3T0GA 2GRAA 3L4JA 4AKHA 3O4JA 1M73E 3K32A 5D8DA 4TRDA 2ZRGA 5K3AA 2WJHA 2GAJA 4U3JB 3CF5A 4MB2A 4CG3A 1TECE 1Z9BA 1Y4ZA 1PRTF 1YSCA 2XECA 1DKRA 4OJYA 4S0XA 3PUHA 3ZEAA 3L0SA 2H4OA 1VDZA 1ZQ1A 2DNEA 2JJQA 1IWPB 1LVHA 4QGHA 3LS2A 3RLNA 3RH0A 2HCJB 2ZS7A 1XMOQ 1EDZA 3GH1A 4FI3F 1M6EX 4PY2A 3AESB 1M8GA 1HGXA 1V39A 3K09A 4JLWA 4Y67A 1VQHA 5IWCA 1USUA 1V2HE 2J0TD 3CAMA 2ZAGA 4WBXC 2NN3C 3U6KA 1OJLA 3GRAA 3EEIA 3ELYA 3QKIA 2I2DA 3L7NA 1ZUIA 3ILSA 3M5CA 5BW8A 1Y7PA 4XM1A 1OAOA 1WUTA 5CMLA 5IRCD 1DARA 3ZLBA 4XYOA 4ALPA 1SKYE 2ORED 2WUDA 3BMOB 4MW4A 4BQFA 4DA9A 2WSBA 1JICA 3DKRA 3TBKA 4QU9A 5CLGA 4DR7Q 2EBFX 2AMVA 2O7VA 1SE3A 3F96A 2A9OA 3MWJA 1RAEA 3A05A 1C4XA 1NQWA 3QFSA 4MR8A 4ZOEA 3TRIA 2E49A 4DLVA 4OI1A 3O5AA 1BO0A 4LFCL 1U2PA 1RKNA 3M7IA 1XNQQ 5K0EA 4FXOA 5BRNA 1FLDA 4DWVA 3N0XA 1JFLA 3GTMH 4HJ8A 1J8MF 2B2UA 2F43A 5DNWA 3IV6A 3QJGA 3PSAA 5IHXA 3S81A 1OXKB 3DM3A 2RHGB 1SHJA 4OHMA 5CXXA 3BVZA 1U3WA 3SXUB 1ISRA 3S1NB 1E64A 1XDBA 4Y1RA 3CUTA 4EDFA 1DCTA 2QQGA 3QI7A 1Q3TA 1NVMB 1CE8B 1Z75A 2CLFB 4M1OA 2R4UA 5K8LA 1NXSA 4X24A 2JQOA 1N33Q 4ZREA 5KNDH 3ET5A 3NHBA 4AL4A 5JQGF 4NYIQ 3SYNA 5IEBA 3UC5A 1H1TA 5DE3A 1FYWA 2C1XA 1MB4A 1HLPA 2EY1A 1DC5A 1EUCA 2RHBA 3OPXA 4ZN6A 2A92A 2WZCA 2J6BA 5AUNB 1BEEA 4FFWA 4HIMA 5AW1A 4S2EA 2CLEB 3DCNA 4CUZA 4L5RC 1KC3A 2CV0A 4YY3B 1R9GA 4L6AA 3PS9A 4IUVA 1SZJG 2WA2A 4NU6A 1U1FA 3WKEA 2H18A 3PJFA 3AUYA 3HFJA 4AJ4A 2BI4A 3KHSA 5K36H 1T5EA 1V1OA 2VRWA 4B3ML 3B9RA 2IX3A 3E84A 3TRZA 2P9BA 5IOCA 4CFZA 3BN3A 3LUDA 4K0KQ 1B1ZA 4NHEA 1MBZA 2WYHA 1LTID 4REMA 3J80i 1XB2A 1G3UA 1POXA 2C8VA 3L0ZA 1S3OA 2R60A 3T94A 2IJ0A 4RGOS 2C9MA 3VO8A 4BWFB 3OF2A 3R3VA 1UNSA 3PBKA 3QLEA 3QKUA 2E2DC 2VJDA 1KORA 3HVIA 1Z26A 1K75A 3PG5A 2D8AA 4OBWA 4BZZA 1E6EA 5K0BA 3CG4A 2JJ8A 3YASA 4EKNB 2N88A 2O8DA 3SC4A 1E8MA 1F06A 3WDMA 2HEGA 2ZBQA 2G4LA 3LQYA 1JQLB 1PR0A 5KYXB 3DAFA 3N5KA 3TOXA 5ENVA 3IR7A 3TB4A 1Y3AA 4ZXPA 2GCGA 1PZID 3KBXA 2CE7A 5K0JA 2QENA 4LDRA 3MUFA 3T12A 4LCEA 1IBRA 2XA2A 3IVXA 4JY7A 2NVUA 2Z0SA 1RPTA 3IT0A 1XDZA 2EOTA 2I5LX 1Z36A 2AG0A 1YB1A 3FRHA 2Q1YA 3N2GA 5D86A 1U7HA 1XU9A 3CJRA 3FNBA 5LBUA 3FNQA 5AVZA 5CCXA 3FHCB 4Q21A 3MT8A 4MQ6A 1NVGA 2VNKA 4JXKA 1U7UA 5GQOA 1Z62A 2F1HA 4MCIA 2LRHA 4J07A 3S4YA 1FMLA 3S8MA 3K0CC 4UU0A 4EPVA 1ZN7A 3QF4B 1THGA 3HCWA 4IP0A 5B37A 1T6YA 3K7AH 1DRWA 3IIEA 4IQGA 5ER9A 1Y7HA 4GNKA 3D0FA 3J80A 3BFVA 1LVGA 5FKAC 2A88A 3E9EA 3LUAA 5KYVA 1CDEA 5E9QA 4D82A 3J81k 1AGPA 3TQIA 2CWAA 2WPNA 4XQCA 5DGCA 2IIQA 3BZBA 1KYVA 4AY2A 1X7DA 2XWBF 1PVOA 2H2FA 4EEXA 3AVPA 1CKNB 1NASA 4G5QA 3NHZA 4PMBA 3WLJA 2AD5A 1XZLA 3KOOA 4G4JA 4JOIC 1KWKA 2NU6B 1KAOA 3REOA 5DXFA 1OXTA 3LX5A 2D5AA 2XXBA 1QDEA 1FVXA 1NBMD 2BY4A 2CHBD 1I3OA 2B61A 2H8KA 5F5LA 2AT1A 3AIKA 4U7HA 1TU0A 4DLBA 2EFEB 4ZFNA 1ZYUA 1QQ5A 5LP6B 2GA8A 3OT1B 1EFPA 3VNRA 1AOXA 2ZJ2A 3IFDA 1LVUA 4MLDA 5LU9A 2HXYA 3JQ6A 3HXQA 1H2RS 2OO7A 4U00A 3KUDA 2DOKA 4JI0L 4B3RQ 1IYJB 1Y1VG 1N8KA 2F00A 2Q3EA 2IDJA 3DB2A 1SNCA 1FP4A 3VDMA 3SDSA 4AQYL 3EEQA 4URZR 3BMCB 5JD4A 1MAWA 1N7JA 4BN5A 3NVDA 1JKXA 4KYIB 5BQPA 4F1JA 3F4KA 3BPSA 5KQGA 4R41A 3OWEB 3TZUA 1XAIA 4B73A 3CR7A 1VJTA 1FVHA 1N2SA 1P3Y1 1Y8QA 3PEVA 1X7XA 2X2OA 2X2PA 2JD2A 3IQEA 2EC5A 4FDUA 4PLPA 2H5XA 1Y9JA 1FRZA 5CAEB 2OA0A 4KR3A 3L9WA 5LWHA 2CUZA 4CTKA 4B09A 3UTCA 1NULA 4AC9A 4EF4A 5D2CA 4OHKA 1V1RA 2Q3JA 3BFKA 3C8UA 4US1R 5SY4A 4B31A 4DM7A 1Z34A 2O19A 2W4MA 1T1EA 4UZFA 2Q0XA 1U31A 1WDKA 1UXIA 3H5VA 3IOMA 4GDFA 3HFZB 3H1TA 3KTOA 1PNVA 2GOYA 1KSGA 1EG2A 4DKXA 2PZLA 1RI4A 2G9NA 2ZIWB 3PCOB 2VAMA 1PL0A 4RVUA 3OQJA 4QCLA 3S14B 1CK1A 4FUQA 1RHJA 4MV4A 1H3EA 2X2FA 3HWWA 4WK0B 1BWQA 5JI3E 4TV8B 4M7WA 3X1YA 1X1BA 1NMFA 2FDCA 1S8OA 1GGEA 4YJGB 3WA6A 4Z7OB 1YFZA 2BHSA 5KKCA 3ERCA 3ER9A 3VBEA 3SHVA 4KO4S 2I8AA 1MG5A 1X7HA 4AS1A 1GY8A 4PPYA 3T34A 1UEAB 2WHYA 3MXTA 4WADA 3WB0A 3DV9A 2WIBA 1G6ZA 1N3BA 3LWDA 3I55A 3PRKE 3U40A 3OIWA 1NAIA 4PTLA 5TMEA 3OTGA 5M3FB 1UJ6A 2B2VC 4U02A 5JECA 3QVXA 1EVKA 3PO2B 4MPJA 4FYJA 3TLMA 5JXJA 2YNMD 2B1IA 3KG2A 5KNDD 1QRUA 5KTRA 1B7YB 4E88A 2RSLA 1QYXA 2B8FA 2E21A 3L1HA 1EBFA 1CZUA 4G36A 3I58A 5JSQA 2BGWA 4Q18A 2NU8B 2GPYA 3CU7A 5KTSA 4YJ3A 5FJJA 4Y3UA 4H0NA 4KN6A 6NULA 2F52A 2IY9A 1W2HA 1YR8A 1KHTA 3DHYA 4IOJA 4N0DA 4S1VA 4LRTB 2FEKA 2PWYA 2DGDA 4XVQA 4D4MA 4NATA 3W2HA 4LBYA 3QFFA 4MCJA 1J2RA 1Q0UA 2I2CA 4HEHA 3V4OA 4C7KA 3GTJH 1MPTA 4ERXA 4LFCQ 1BDBA 1Q11A 4DV7Q 3BJZA 4XIJA 4ZU6X 1QJ4A 3WNBA 1JG2A 5AK0A 1W35A 4C7MA 5CXQA 1N5RA 1CUEA 4IAOA 4Y6RA 3ZIAD 4A75A 1IAVA 1RRMA 1A0IA 1EG7A 1E6WA 1V11B 2JGIA 3CH6A 3NXSA 4ODIA 1NV9A 4YRKA 1FBNA 2PQAA 1CJKC 2C3UA 3N70A 3TSAA 2NU7B 4B6JA 5BVHA 4UTRA 1PRTD 3TZBA 4DR2Q 1XEXA 2VPWA 3W5CA 3N8IA 2GPTA 3MC0B 2OXTA 4NULA 1CR0A 1N2ZA 4KVAA 4Q0MA 5D85A 3LUBA 3KBBA 4LJ5A 1SOVA 3CW9A 1B9MA 3T1YL 1OASA 3QF7A 3SR0A 3W3AH 2O4UX 1WCMB 4IDGA 1R0ZA 4QDUA 1J25A 1UBEA 2MMCA 4RMGA 5JS7A 2R7KA 4BRSA 5L7WA 5FJ8H 1PZKD 4N9QA 4KKTA 3NBQA 1SH7A 4LBWA 5ENDA 3D8GA 3WADA 3I73A 4JC8A 1W6JA 1SKBA 1SOWA 2FPIB 2XA9A 3H87A 4MS3B 3TFQA 3NNDA 3OC6A 2B2WC 1DHRA 2NSJA 5KTYA 4OX9Y 4LOAA 4M99A 1CDOA 1OI3A 5LD2B 3I1JA 3IT2A 3LKBA 5CR9A 1YHYA 3OLYA 3L9AX 1DCZA 4PV7A 4B3MQ 2O0LA 3JAMc 3GDWA 4KE9A 1FX0B 3NTUA 4UREA 1T5TA 4JI0B 5JU6A 3PGVA 4CN8A 3B3FA 1P1RA 4M0EA 1EEHA 3QOJA 3ZQ4A 1N1DA 3CPJB 2A9RA 2LCFA 3PICA 3AMVA 1SO8A 1NU6A 2QGNA 3COYA 4V39A 1RHMA 4NXNL 4BVHA 1XZAA 1E6MA 2QORA 2IFTA 1T9HA 2M6LA 3SC6A 1E2LA 3U7QB 3V7UA 3HJFA 4L5TA 2FN8A 2W2OA 4Q15A 1AE3A 4TVKA 3CRQA 5KVVA 4C7OA 4JLOA 5FBRB 4DA7A 1W5BA 2QE7D 1HOXA 4MMXB 2NTSA 2RGWA 4XX0A 4YQZA 3K6RA 4JGGA 4PX9A 3KYDB 3DHWC 1MV5A 1IZ6A 3EUAA 1KVQA 2NVYB 3LY5A 4X6LA 4ZOCA 4F92B 3SHFA 5M7EA 1BBUA 1PNTA 4NK5A 5A2GA 5JZ9A 5AVWA 2CCKA 2E9SA 1P7YA 4RQTA 1OZ0A 4OGGA 3A14A 2B25A 2BZSA 1LV9A 2CXXA 2R1TB 3G1TA 4J0FA 4A0FA 4BNDA 1JB9A 3IFSA 3MWEB 1TWAB 1QZUA 1JN0A 1H5UA 3R0VA 4L2IA 3VISA 2WB1B 1WHTA 4PXAA 1JLKA 1VQEA 4MR7B 2R25B 5C44G 3PF8A