4JBWA

Crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbon catabolite repression of the maltose transporter revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Maltose transport system permease protein MalF
total genus 78
structure length 370
sequence length 370
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4jbwA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jbwA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jbwA01
4RG1A 3EXAA 1Z6HA 3T51B 2EFEB 1E2ZA 1HE1C 1RVDA 4D6PA 2E87A 1T8TA 3LVQE 4LHVA 1CRQA 3SYLA 4DB4A 1UFQA 1SZPA 4RJLA 5GJBA 4L9WA 1E9SA 2QNRA 1ZVQA 1EWRA 3J81j 1B70B 2Q9BA 1G8GA 1Z63A 3M0EA 3GFPA 3BD9A 4HJAA 4OBEA 5SZJA 2AFHE 4DV6L 1Z8FA 3EC2A 3EZ2A 4QHTA 5G3YA 4B47A 5LDDC 5IY0A 5M5WH 1EX7A 2OT3B 3QVVA 4JZKA 2O8CA 4L5RC 5KOYA 3IEVA 3ZYCA 5H1YA 1KL9A 4MRRA 3QF4A 3K0EA 4EPWA 5JBQA 1WF3A 4B3ML 1H9SA 2Q0HA 4RSGA 3HOZG 1H8EA 3D6TB 1MH1A 5E7IA 2Q21A 3ZVMA 1IONA 3PGZA 4JC0A 1Y8OB 3SBEA 4F7WA 2IYLD 3PG5A 3I92A 3ZVRA 3S17H 4GKKQ 1T0JB 1LM0A 1IJEA 1XJVA 2ZYVX 2UVQA 3DM3A 3HOWG 1GRRA 1IN5A 4MITA 3N2EA 1DGSA 3NWJA 3ZIAD 1Z83A 1YQTA 1E3PA 1KSGA 4R1JA 2VW9A 1OIVA 3KKNA 3N5CA 4JKYA 4PZZA 4UP9A 4HLUA 4AKEA 2F7SA 3VHLB 2EJGC 4BBSH 4IKEA 4TLAA 3ADCA 2ONJA 5EAYA 4ACAA 4DK3C 1J8MF 2XOKA 4A2WA 2FSHA 2QQ0A 2QTFA 5EZ5A 2OXRA 2FG5A 4JI4L 3UWOA 4D2IA 1T5LA 2K75A 2BKEA 4QHSA 1E2FA 1ZUNB 3QJYA 2IL1A 1FL0A 4OO1H 3BDOA 4URYR 4FDBA 4QBGB 1FTSA 2CK3A 4TMZA 3VTKA 4ACBA 1UKVY 1N33L 2PLFA 4BPBA 3UWKA 4OGQC 5C4JH 2A69C 1G5TA 3MAAC 4A6XA 1QZHA 4TYWA 2GKSA 1CS4C 4ZIRB 4OI0A 5FI0B 4UJ3A 3LWUA 4RFSB 2AXPA 4JCVE 2MMGA 2ZRAA 2DNCA 2QY9A 3K0CA 2W6IA 4FI3C 4TLBA 3SHWA 3W3ZB 1G18A 1Q20A 2J1LA 4NU0A 2QQEA 4C0SA 4QJ3A 1JEEA 2ZRJA 1UM8A 1QG4A 3LBNA 3ER0A 4U02A 1NG1A 2ZR9A 5TXGA 3TRFA 1AQUA 2NN6G 1K8MA 1AZTA 1UPTA 2GEDA 1VQHA 2IF2A 4JLAA 4YXWD 4B33A 4DKXA 4PC1A 2D2CC 2A6HD 1QHHB 2G1JA 2JJ2A 2QMEA 4WA7A 1HE8B 4DLVA 4JI7L 4CRWB 3VDYA 2WWHA 2K14A 5FR2A 1Z0KA 1YNXA 1N6OA 5KDOA 4JT2A 3QENA 3LLUA 4A93H 5E7NA 1NSTA 1OHHA 2A30A 4BEJA 4Z54A 3SQWA 1B23P 1AS0A 3WNDA 5M3FH 1JQLB 3OW2A 4DDWA 5JECA 2QORA 4DR6Q 1CR1A 2R6AA 5FLMG 4TL7A 1UJ2A 4OQLA 1RPZA 1E1TA 3F2CA 2JLSA 4HYYA 1XTRA 4EPTA 1VQCA 3S1MH 4X66L 4URZR 4JLDA 3U3OA 3QIAA 3T5GA 1D6JA 2ODBA 3RNLA 1NN3A 3I3SR 4XH9B 3AEZA 1E9EA 2XX3A 2IXFA 3FTQA 4A3DG 2W0MA 5HY6A 1WBDA 2WFWA 5FUYA 1OYWA 3RZDH 2K5NA 3TQCA 4EFLA 3BB4A 2N78A 4D4LA 3D0FA 2VUMH 1N6KA 821PA 4OONA 3K7UC 4HAVA 5JS7A 2GXAA 2FPLA 4HAWA 4EPVA 2O8FA 1NP6A 5C18A 4LF4Q 1W0KD 1YRBA 2F9MA 2ODNA 3EZ6A 2WBLC 4KHPL 4A0FA 2O0KA 2FF7A 4M9QA 2JLVA 4YWMA 4XVQA 5DE3A 5AJWA 3JZMA 4JYAL 5FBQB 1IBLQ 3OEED 4FCVA 5F2EA 3MFYA 1L8QA 4RKFA 5DHFA 4L16A 2BJVA 8OHMA 4BQSA 2DN8A 4M53A 3C4JA 3GFTA 4TLEA 1M1KC 3QXXA 3AYHB 1E6CA 2J46A 4C3IH 4PZ7A 3LH5A 4LYJA 4BLTA 1XXHE 1OXVA 1A8VA 3HOYG 2J3EA 1M74A 4AIMA 4HAYA 2DNEA 4DAYB 4QGUA 4LWZA 1CR4A 2WAQG 2AKAB 3BBPA 2GTPA 3TKLA 5IRCD 4PTLA 2IHFA 2ZYWX 3B13B 4S35A 4URVR 3I61A 2PJRA 4V0MA 3PITA 3IIJA 4HLCA 1TUIA 2IYVA 3TAHA 2GK6A 2ZJRA 1E99A 5K36G 1OLOA 1ZU5A 4XD7A 4D25A 4DV7L 1ZIPA 5FI1B 3OTOL 2H92A 2VHTA 3VR4A 3MJRA 2R7ZG 1CP2A 3CCVA 3QKRB 1TU2B 3X1YA 2DY1A 1EWIA 1WA5A 1GNRA 1UF9A 1XMSA 4KODA 4DDVA 1S1CA 1FYCA 3T1HQ 2EWVA 4B3GA 3RS7A 3PUVA 3EN2A 3KXIA 3Q5DA 4IRUB 3OTOQ 5H1SE 4Y52H 4JLKA 2WKPA 3U7HB 4JI4Q 4MYCA 1XNQQ 3QG5A 4ZI2A 3BZKA 1N6RA 4OK6A 5CLQA 4L5QA 1NBMA 1VPLA 3TREA 2HHHL 4NMMA 3S1AB 4LRWA 1X65A 3LV8A 1Q12A 3WY9A 2OO7A 5IYCH 1ZD9A 5DLQC 5K8TA 4ESHA 2WWGA 4V0OA 1AZSC 2EVBA 4DV2Q 3EZ9A 5BR8Q 2ZRFA 4B3DA 1JALA 1S3GA 4TVAB 5HE8A 3I55A 4QFMA 2KBFA 2MMCA 1EFCA 2L0XA 1FQJA 1CBUA 1MO5A 4OWWB 4OO1I 1W0JA 2CCGA 2ES2A 1N6PA 2V6JA 1OH7A 3RC8A 2JLUA 1YR8A 3C7KA 1V9PA 5AK0A 2JXMB 1UE6A 3H0GG 1FW6A 2IYZA 3TRZA 4DIDA 1D8TA 3QBVA 2QZ4A 2BV3A 1TAGA 3H3VH 2JIZD 1GSIA 4Q7MB 5IYBH 3V00A 1TXYA 4K8OA 4EQ5A 2OCPA 4DR5L 3WYFA 3ZLJA 1U99A 2NN6H 4YY3Q 2IHYA 4IHQA 1PUIA 1U2RA 2OSBA 2AX4A 2GJKA 1COWA 2IWHA 4ZKEA 4ERNA 1NN1A 4PQYA 4UP7A 2VP6A 2BMEA 3AB3A 1YNJC 2WJVA 4KAXA 4LI0A 4IOKA 3CCUA 3U4QB 1W4AA 4Q21A 4D82A 2XXAB 2RHQB 2FA9A 4BRUA 4POFA 1SKYB 5EJEA 1PH9A 2ZSFA 4Q1CA 5GAEC 3G4SA 4FCWA 4G5QA 1VQIA 4WXPA 1PH1A 2NVXH 2YNMA 1RC8A 4DLYA 1VDZA 1ZM9A 3PCOB 4X64Q 1G17A 2AFIE 2JEOA 3OHMA 4H02A 2NVTH 3DMNA 5M04A 1AK2A 4MYUA 3AF1A 4RZ3A 4A93G 3CX8A 4W5WA 1CULC 2FDCA 3P4YA 1HEIA 4KKUA 4MGKR 4DNIA 3CC7A 3GEIA 4A75A 3EX7C 3JC66 3EG5A 2FN4A 3KDSE 1X3GA 4OX9L 3TUIC 3VX4A 3H2YA 3CBQA 4OK3A 3WYAA 3QF4B 5EP2A 1RRCA 2ZI5A 2HV8A 3N6RA 3IPXA 4JS0A 4TYQA 2XEXA 1VS0A 5HCNA 1G7SA 3K0CC 3DZ8A 1E2KA 4MDFA 1R5NA 4H9GA 2R92G 1IAQA 1HNWQ 5GADl 1GHKA 4P31A 3TR0A 1XTDA 3VR3A 4CDGA 2C04A 3FKQA 4TZ0A 1BMFA 3HOWH 3TUJC 5HKKA 4EJSC 4RZ2A 1W48A 1QHSA 1Q57A 1WE2A 4WZBE 4Y0VA 3KUDA 1VQAA 2UXBL 3UMRA 5JWRA 3S1NH 2R65A 1QVFA 1KNXA 2W2TA 1DD2A 4ZI3A 4DLXA 4F91B 2F55A 1P62B 2BC9A 3MUFA 3CIOA 4PHHA 5KPJA 1Q1EA 4PQFA 2GF9A 4X8HA 2F3IA 1U81A 3CR8A 5C0XI 2ANCA 2VPPA 1EOVA 5CIWA 1ESNA 2QP4A 3NBYC 3OIWA 2NMVA 5EE0A 4YCWA 3AVUA 2H5EA 3KLRA 1JEDA 3BORA 2FJUA 1WYDA 4R98A 5LB4A 1Y14B 3EPJA 5KSOA 1T3SA 4B44A 4F4CA 3L0OA 2NZOA 3H0KA 3NG1A 1KY2A 3B5JA 4DCVA 1LV7A 1UADA 2LWIA 5JS8A 3B82A 2FOLA 5EUMA 3D7MA 2DYKA 3T15A 3KFXA 1G4UR 1E2JA 1Z22A 4E03A 1KO7A 3ZD7A 4IFBA 2A1AA 3A7AB 2QGZA 3JAMc 3H15A 1K9MC 3HOZH 3RRZA 2UXBQ 3OE7D 4QHYA 3MWJA 2PEYA 3CRMA 3SEAA 3THOA 1SXJC 4NONA 3FHWA 1BBWA 5J4YA 3EWAA 3GLFE 2G77B 1YBYA 3OIUA 1Z2CA 2YWHA 4O2RA 3SZRA 1SKYE 2XOKD 4R4IA 2RCNA 4L8GA 3CPFA 3FE2A 1P61B 1G51A 1SLJA 3GTKH 1AQYA 1EX6A 4R4TA 4DPGA 1NKSA 3TLXA 1YHNA 3B9QA 3GTPH 1ZYRC 4LBVA 1IM2A 1W2GA 5GVRA 2BCGY 1KNQA 1E4YA 1TEVA 1V5WA 3B1XA 4PSAA 5J40A 1G41A 1NTGA 1DELA 1A6XA 5J3BA 1HJPA 1PYBA 4POGA 1HZAA 2PMZE 1K6MA 2WAYA 4PO8A 3PEVA 4Q4AA 1KI6A 2O8EA 3WBKA 2ZM6L 2VQFQ 4D0GA 1XEXA 2XGJA 1K3RA 1SHZA 1M1YE 2DWOA 4B48A 1TNDA 1G8YA 4C3JH 1Z28A 4GN5A 2BMDA 1N8RC 1XNRQ 1P2SA 1QVRA 2EFGA 3BIFA 3DZDA 3KQUA 3HFZB 4BEBA 4WZAE 4CZ2A 1P9NA 2OAQ1 4G5SA 1P75A 1E2VA 1H95A 4IPGA 2Z43A 1XPUA 1L4YA 3PUWA 3HU2A 4QJ4A 3DHWC 4EPRA 1CTQA 4DUZQ 4A4IA 1X1SA 2O0JA 4L9SA 3KZ1E 4BLSA 1VQJA 4DNTB 1HY3A 1UDXA 2C98A 3U3RA 3BERA 4LJYA 1YNNC 5KUTA 1NF3A 1T3LA 2QSZA 1CUKA 3T1YQ 2JE6I 1JAHA 2GCPA 3VKWA 1HNXL 1DS6A 2RGXA 2P6NA 4KLNA 4DSOA 5FUWA 1PLJA 3OIVA 1U0LA 2Q9CA 3ULJA 2VP9A 4TMWA 3U9SA 4BY7G 3MXNB 3H3VI 1EFHA 1XZQA 2IUTA 3DVLA 3K8YA 2K4KA 4HJ5A 1P2UA 4LGMA 4P32A 3SJBA 3AP1A 3IBYA 4TYNA 2JA8H 3GTLH 3BB1A 1PLKA 4L8JA 3AF4A 4NCJA 4IJMA 3CLVA 1IY0A 3HOUG 5D3QA 3U50C 1IW7D 2UUAL 2JJ1D 3K53A 4LHYA 1NKTA 1DPFA 1EXMA 4G5RA 1WBBA 3A4MA 3GDEA 5C1BA 4CF7A 3M85A 4M4SA 4NL4H 3QKRA 5SZKB 5UKDA 3A74A 3CNLA 3WBJA 1T9HA 1S4QA 4KVAA 3NDPA 2CLDX 1F2TA 1TF2A 2NOAA 2WKQA 5FPSA 3TR5A 4HLUC 2OFOA 5TY0A 3EPHA 2IS1A 2WSMA 1R5BA 2OCBA 2ZJOA 3UPUA 4HZUA 3U3KA 2N8NA 2F1JA 2I5HA 3AFQA 4IJLA 1R6BX 4A1FA 3HJNA 4RCZA 1Q90A 5DYGA 3BZCA 2VP2A 3S1AA 3SC3A 1E2IA 1ZW6A 2GBLC 4LF6Q 4DKAC 3DO6A 3TMKA 3ND9A 2XTIA 4OHZA 4PANA 2J7KA 1VCNA 4DLTA 3PF4A 1U90A 3A7LA 1SVIA 1F60A 1XTIA 3AKCA 5HE9A 3FOZA 3SJAA 1H9MA 2GZAA 2W58A 4JVSB 4RD0A 3TQFA 2XNDD 2PZEA 4LUCA 4GI7A 1GUNA 5JLJA 4P33A 1CJKC 1JXMA 1DAFA 2QTHA 3I8XA 4BZXA 2O5IC 1Q3HA 3EC1A 2KCCA 3A5UA 1K83H 3P26A 3OYYA 2IUSA 3UMSA 3MMPA 2EXDA 2EFHB 4C2UA 2CE2X 2PPBC 1K8OA 2WMOB 4DAMA 3E70C 1HQMC 2C77A 4U5XA 2ATXA 5JRZA 3EPKA 4NCNA 2NO1A 2F1MA 1CR2A 4DBLC 4M22A 1HR0L 3KQNA 5FBVB 1UKEA 3OEEA 4RY2A 1R7RA 1EFTA 4JV5L 3EBEA 1WMSA 2I0QA 3IDQA 4LF6L 2ODWA 1YITA 2OQKA 4Q1AA 1XNRL 3WRXC 2R6FA 2JEBI 2KA7A 3B85A 1UEBA 1QHIA 3H1TA 3RR5A 4GKJL 1OIXA 3GLHE 2F9LA 1R9TH 2WVJA 4DWJA 1I6VC 4URUR 2O8CB 3BJUA 1KIXA 4M21A 4QGAA 4IDPA 2LKDA 2LCFA 2NO9A 4N3NA 2QMHA 2R7DA 2A5GA 2QENA 2R44A 2Z0MA 3L0SA 1G6OA 1RIPA 1DE0A 5EXPA 3S16H 2JATA 2JGNA 4PHTA 1GNPA 3LW7A 4DJTA 1MO6A 5CJ2A 1N36Q 3UDIA 1EFWA 2C03A 5CIQA 1ZKOA 5L3SA 4DR6L 1XP8A 1OYYA 4XWAA 1E1QA 3CRVA 1XCMA 2BKUA 2XSZA 2ZJZA 3PR1A 1G7RA 4ZCIA 4JI6Q 2YOGA 3I4LA 2OFXA 4JYCA 4LV6A 3CW2C 4LJAA 4I99A 5LMUL 2XZPA 5JSZA 4LF5Q 1JAIA 4AYXA 1COWD 1GUAA 2W6ID 4MQBA 4C4PA 5FTNA 5FPKA 3F2DA 4A3GH 2HXSA 1N32Q 2J59A 4QBIA 5KSYA 4P4SB 4A3CH 4KFTA 4D81A 4A3KH 2YOFA 5LMUQ 3W5IA 1XBTA 2BE5D 2FH5B 5C46F 4U00A 3IFTA 3WNBA 4TLCA 3NBHB 1SXJB 4DV4L 4B3TL 1Z08A 2FFBA 1CKOA 5BYKA 4TMKA 2BH8A 2WIBA 4BY1G 1FMLA 2FWRA 5J4VA 3GLGE 2CK3D 5HZKA 4R4QA 2J0UA 1MO4A 4BA1I 4W5JA 1JI0A 3F0TA 3WMFA 1VQMA 1VQ8A 4UKDA 2JLYA 3GD7A 4US1R 3LWNA 3DPUA 4AKGA 1U5KA 1KK3A 1F2UA 3RSOA 5L3QA 5CJPA 1JJCB 2HEIA 1K5DA 4XTRA 2EJMA 3QSYA 5J4LA 1PJRA 5B2ZA 2AUKA 1I50H 4JG2A 5FLXc 1VG0B 4F38A 4KVGA 5CK4A 5C4MA 3I4MG 3HOUH 3CF5A 2V6IA 1NI3A 1NBMD 1NN0A 2CMKA 2OV2A 3TIFA 2XZLA 1I6HH 3ULLA 2KENA 5GVSA 5IF9A 4LFAL 3QF7A 4CEHA 4KFUA 2E1RA 1T5IA 1H9KA 3CO5A 3GEHA 4I81A 1W4CA 3U44B 1EG7A 2H5XA 1W36C 2X1VA 1T8UA 1K8AC 5IYDG 1E3MA 4LYHA 1PA6A 1TQDA 4GNXB 3LAWA 1R0WA 4Q00A 5B57C 1KSHA 4QJFA 1JXOA 4KITB 1SMYC 4UJ5A 4C0HA 4IXNA 1XMQQ 1E2DA 1Y1WG 3S24A 4JK1C 1A0IA 1OB5A 4FIDA 4G1UC 5EP3A 1TTTA 2YHSA 4JL6A 1FUUA 1R10A 3AVWA 5F9FA 5LPNA 5LD2C 1GUOA 2ZJ5A 1WCV1 3L43A 4YMSA 4M1YA 1D8LA 1PH5A 4BRWA 1N6LA 1ZNZA 1HURA 2UU9Q 4XSGA 5AJ3Q 2PX3A 3ZDQA 4LF4L 1M34E 4GLXA 2JA7G 4RCYA 3TW4A 1E9FA 2JASA 4AK9A 1VIYA 2BH2A 2YWFA 1KI8A 1E94E 1J5EL 2VH5R 2BMJA 2Z6VA 5L3VA 3CZPA 1UKZA 2IXGA 1Q3TA 3EIEA 4LUVA 2ONKA 2PL3A 4UXJA 5BR8L 1HZ9A 1YZNA 3AQQA 3B1YA 2B7BA 3NDBB 1AKYA 1AGRA 1ZJ6A 2CXXA 3GJ6A 2JLRA 4HUQB 2QUZA 4Q7LA 5E7JA 5KU1A 1E1QD 1CKNB 2C2HA 3W6NA 3RRNA 4OQNA 2OQ0A 4Q7KA 2R6CA 1HPCA 4X66Q 1XJQA 2P5SA 3IHWA 4E22A 4AI6A 3BC1A 1N2CE 2IY5B 3HYRA 1YKSA 1E2QA 2X77A 2IUUA 1QHHA 1TF5A 2N42A 1O3YA 4F4JA 1UE7A 4G0NA 3EA0A 4JI2Q 1RL2A 1QZGA 1V1QA 4FCTA 5IYDH 4PAQA 4B3CA 1S9HA 1QJOA 3OFND 2J5XA 2DR3A 1SR3A 1VQ4A 4LNQA 4DNRB 4D4JA 1OIWA 4OK5A 2E2HH 2N49A 4G7OC 4LDJA 1Q44A 5C0XH 4US2R 3I5XA 4H44C 2G6BA 2ZRNA 5J5CA 5BN5A 5IE8A 2CCJA 2RH5A 5FJ8H 3CRW1 4I1UA 4NTZA 2XNSA 1KI2A 2W0SA 4HAXA 3ZVLA 4X62Q 3RRMA 1BO6A 1JECA 1NSFA 5KTYA 1NN5A 1IQPA 3QE0A 1DG1G 2VLIA 2ZRHA 4NPSA 4KFRA 1PH3A 4WBSA 3Q9LA 4DEXA 1WRBA 1B9NA 4F4IA 3T1YL 3L82B 3GP8A 2ZE8A 1YZUA 4BY1H 4OX9Q 1E79D 1HUQA 1KDTA 2VQSA 3B1ZA 1A7JA 3MLEA 3AFPA 1ZC3A 5IHPA 1WDTA 3L7ZC 1E1OA 3MCAA 2J0VA 1GUTA 4D4MA 3SGIA 3AUXA 3NIBA 4DR1L 3CQZH 3SFVA 1W44A 2GAOA 2DFNA 2ZRLA 4YDSA 1EQRA 4DXAA 1UBCA 2XITA 4KHPQ 4LHWA 1OXXK 4LSGA 1XMOQ 4QGGA 3CH4B 4A3GG 1K5GA 1ODFA 4Q4HB 4ABYA 2OBNA 4TSFA 2GEVA 2OILA 4B6FA 4DV1L 4GMDA 4JJKA 3A8TA 1OF1A 1T3HA 2GJAA 3QXJA 2DFKB 1P3JA 2I1VB 1G6HA 1NL3A 1ASZA 3FMIA 1ZNYA 3KTAA 5LD2B 4QQBX 2BBOA 3ICQB 3VKHA 1A82A 2A69D 1Q86C 2GVDC 2VIIA 2JK8A 4B6EA 3VR1A 2R92H 2F4VL 2VEDA 1NLFA 4EX5A 2VYFA 1H65A 1GL9B 5F9HA 4GZLA 2F3RA 2VSOA 3Q3JB 5HZHA 1KDPA 3BAFA 1GTVA 2WJYA 3FYHA 3KQHA 5DHAA 2ZSBA 3AUYA 3I7FA 1E0JA 2QSYA 4LV5B 1VG1A 4RFVA 3A4LA 3FPAA 1XPRA 4ON9A 1E2MA 4P74A 1SXJE 2PQAA 4K46A 1II8A 2VA8A 1M7HA 3C15C 4HR7B 3RS2A 4DSTA 1EESA 1Q1ZA 4RZUA 2AK3A 3HR7A 3MWLA 1KC8C 2OWOA 4QIWE 2ORVA 2XTMA 4N0DA 3VU9B 1WB9A 3ZVNA 3WP1B 4Q1DA 1FZQA 3IUYA 4CIDA 4EJSB 4DV2L 1GG2A 1IJFA 1T91A 2QPAA 3DDCA 1JNYA 4Q4JA 3KLWA 1E2NA 4QNRA 4EFMA 1HA3A 4EJSA 1U8YA 3GLIA 1X3FA 4A8JA 5K8UA 1US8A 2AKYA 1G8PA 2V4DA 1LFDB 3GJ8A 3LO5A 4O3MA 2Y0SE 2PNHA 1KDRA 1MKYA 1ZYUA 3MRSA 4I1OA 4Q4AB 1F48A 3PO2H 1QVAA 1II0A 1S1MA 2C78A 1FP6A 2PH1A 2VP5A 4LJ5A 3U4ZA 5JCPA 2D7DA 2QI9C 4GOKA 3CC2A 5JEEA 3IKJA 4OXPA 5B64A 3BH0A 3A6PC 3KJIA 2HT1A 1BKDR 3HYTA 2KE5A 4AYBE 1S40A 3TAUA 4MGZR 4V02A 4HB3A 1XEWY 1C0AA 1KK0A 4MRNA 5CB8A 5DN6D 3K8AA 4DR4L 3CF2A 2EDGA 2I5MX 4BFUA 2Q3HA 2B6HA 1L1OB 3BG3A 1XPOA 3QY0A 4QOSA 1PH6A 1IY2A 1M2OB 2C9CA 2EFCB 5JWOA 1W1WA 4JLVA 521PA 3KXKA 3QKSA 4QC2A 3UDGA 5BN4A 3R9WA 1Z07A 2J41A 3E0EA 1ZCAA 1LYLA 5IYCG 1E0KA 2HF8A 1NLYA 4JVLA 5AR1A 2Q8IB 4AQYL 1CJVC 1HT1E 1P73A 4AG6A 3B6YA 4WW0A 2ZANA 2VP4A 5KHOC 1YIJA 1QBKC 4JI3L 2GF0A 2QPOA 3L8YA 4PC2A 2HIVA 2YZ2A 1YVDA 2CE7A 4AQYQ 1CU1A 2X2EA 4PXAA 5FBLB 4YONB 3VX3A 4BZQA 3SNHA 2ZRCA 3K9HA 2QA5A 2C96A 4TTQA 1ZM2A 3NVAA 4JI1L 3WWVA 4LPSA 3T5DA 3ZGXA 2ZS9A 4GBMA 1KZ7B 1CKEA 3C5CA 4KSBA 4GL2A 1XDBA 1F2TB 2ZXUA 3DKPA 2G88A 1CFMA 1DTSA 1OFUX 5HPYB 1LF5A 2NPFA 3KF6A 2ZTEA 1XD2B 3D8BA 4LHZA 2UXCQ 1J99A 2IYYA 1UAAA 3BWDD 4L5BA 3K1JA 4MTNA 5GJVC 5GAHC 4O0AA 2F1IA 4QGFA 4LPKA 2B63H 1G4AE 3ERSX 1VKJA 1U8ZA 1NY6A 1UDWA 2ZR0A 5FBRB 3UE1A 4MNOA 1U94A 2IX3A 1C4OA 4BGDA 4DCSA 2XGTA 4GNXA 3L2OB 1UE5A 2EYUA 3BOSA 3IQWA 3S1QH 1QUQA 1GKHA 1CIPA 2WJIA 1B0UA 1AS2A 1P4SA 1W47A 2A6HC 4YHHQ 3RANA 3T1TA 4DV5Q 4IOMA 3ADDA 4I7ZC 4AYTA 3HPQA 4FD2A 1GKYA 2G0TA 4GMXA 2LSSA 1OFHA 1NIJA 2F1HA 4GP7A 4QJ5A 3RWMB 2ZTCA 1DAKA 4IOCA 1PLLA 2ZUCA 1E32A 2L15A 1MOZA 3I2ZA 4ZCLA 4GDFA 2IX0A 1KO1A 3SQXA 3HKSA 4XOIA 3BJIC 4HB2A 5CYPA 2UXDQ 1E79A 1XZPA 5DIFA 4XTCS 2Q2HA 2WJJA 4CEIB 1NMZA 3TEHB 2PMDA 4Q4LA 1N6HA 2OXCA 3W6OA 1T5EA 4KXFB 5M5YH 2CL0X 3I4OA 2B8WA 2XB4A 4DT1A 4JLPA 3SYKA 3CXCA 4LYFA 3UG7A 3FHOA 3W8NA 2ODEA 3U4QA 1GAJA 1YZTA 1Q1QA 1W0JD 2OBMA 4X65Q 2VRWA 4P0TA 3SBDA 1KO8A 4G7ZC 2BEJA 1UBEA 1I94Q 5M3FG 2ZETA 3RS3A 3NBFA 3MWKA 3HU1A 3K0AB 4JBJA 5ELXA 4G7HC 4Q02A 4C3HH 5JJKA 1NRJB 3O8DA 5EXSA 4DR4Q 4HIOA 4M9SA 1D5CA 5KNDA 2YTVA 4DSUA 5FTJA 2HYDA 5G3ZA 1Q0UA 4P72A 2O8BB 2WTUA 4DLZA 1ZBDA 1Y8NB 1PH8A 1HR0Q 3FKIG 3C8UA 1MV5A 4LF7Q 1JJGA 3LQRA 3O47A 3RDPA 2G1KA 4PSVA 3T12A 5IP9H 4CEJB 4LY6A 1AN0A 1Z0DA 1ZNWA 4FMDB 2UKDA 2XTNA 4AKHA 3V9PA 2NVYH 4JI8Q 5CYOA 3DEFA 4APVA 5JSZB 2UXDL 1ZUHA 1LW7A 4LFCQ 3QKUA 2VZAA 5FR1A 2C9OA 3CCQA 2QG6A 3F8TA 2R62A 4Q9HA 3T61A 3WYGA 2WWYA 4A82A 4A3JH 4O0MA 4MUBA 4ZCMA 2O8EB 3KJHA 1G7TA 1HH2P 2A5FA 5E4FA 4PAMA 1FPMA 3GLIE 3THYA 4RVCA 1IL2A 3CMEA 5TV2A 3U3MA 2K52A 2QROA 3GLFA 1CR0A 1JBKA 1KZGB 3OFNA 4TMTA 2CWAA 5JJIA 1XF9A 2OEPA 3TK1A 1YE8A 3LXRA 1P9RA 1VIAA 1XRJA 2HYIC 2V9PA 5FUXA 2OTJA 5IK2D 2IYUA 1ZINA 5CDFA 2NO7A 5KYKA 2BE5C 3KDFA 2EQSA 4YMWA 2BJWA 2KHIA 4DV0L 1VQEA 4PAOA 4BBSG 2GZDA 2OM2A 1NVWQ 4UQOA 2P3SA 421PA 5JZVA 2WPDA 5C2JB 2ZUDA 2YOHA 3PXGA 2GK7A 1NVXQ 1G291 3BU2A 3M4QA 3TQYA 5IP9G 5FFMA 1MJEA 5C4GB 4B2LA 1GL7A 2WB1E 4DEYA 2IA5A 4GKJQ 4CEHB 2ZVPX 1XWIA 3OW7A 4JI0L 2ZU0C 5FTMA 3SU8A 2ORIA 2XJ9A 1G3UA 4NBSA 1VQFA 4K0KL 4RD1A 3RZOH 3QXCA 4KN4C 2Q2TA 1G64A 2WJGA 3MEFA 1OFIA 3J7A5 3SR0A 2PI2A 4KKTA 4ITRC 4DR3L 3A37A 3A1WA 1CJMA 2ZYTX 3WHLA 3CD6A 3K0FA 4UPAA 1NJFA 4JYBA 1UBGA 1B7YB 4WVFA 1FUKA 5DI3A 4BFWA 4U7DA 1QHGA 1EFRA 1WQ1R 2NVQH 1NVUQ 2J7PA 4QNMA 4TMVA 4ARZB 1OPXA 2E2JH 4URWR 1XX6A 3KQLA 5EE9A 2J87A 4LFCL 3DKVA 4GRAA 1TUEA 3TJZA 1JJVA 1HT2E 3PO2G 1KK1A 4M9ZA 4A8JB 3O8CA 4KYIB 3CMAA 4HJ9A 5EZ6B 3Q7QA 1I5FA 4B2PA 2MQHA 2JEAI 4GZYC 3D3QA 1QVCA 2ZAOA 4DUGA 2NPIA 4V0LA 2WKRA 3WNCA 4C0LA 4JYAQ 3FWYA 3U2QA 2RGGA 4NZYA 4QM6A 3HKZG 4HATA 4JI5Q 1FMJA 4L5TA 4IPCA 4TN1A 1LB1B 1TWFH 2O8FB 1TWAH 3U60B 1W2BA 1CKNA 4HJ8A 1E1RD 2EWWA 4FW9A 2DUDA 1B8AA 4BBRH 2HF9A 1E7ZA 3QPVA 2JA6H 2FSGA 2R8RA 4LJZC 1XMJA 1XEWX 3NENA 2CEAA 3EW9A 4Q9LA 5ANRB 4MH0R 2ZU6A 4JVMA 4PO1A 1DAEA 5EXTA 1GDDA 1ZD1A 3BFKA 3CNOA 1OE0A 2REXB 3IILA 2QMOA 2D0PA 2F3TA 1RRGA 1YZGA 3BFVA 4A9AA 5H8WA 2GESA 2YYZA 1Q82C 2BEKA 3LD9A 1NMXA 3M7NA 4P4SA 3EIHA 4DUYL 2C99A 4HDOB 5JEAJ 1XD8A 2CHGA 2FFHA 3AQ4A 3F5FA 5P21A 4D0NA 2WM9B 1CEEA 3M1IA 4OI1A 2IWRA 4DLRA 2UXCL 3OOCA 3W1GA 5E3HA 4DRZA 1IXSB 2J7PD 4WAUA 2EVWX 1E9DA 2FGJA 4FMCB 1RRPA 4YY3L 2V54A 4JSTA 2A6ED 4BUJA 4Q9IA 3W8RA 1TEXA 3C14C 1ZD8A 3STBD 3GO5A 2R6GA 2FZ4A 2YVUA 2GHIA 4TQ9A 5J4KA 2CFMA 3HKZE 1FX0B 2AHOA 4QBHA 4WOPA 1F2UB 3PIRA 1FP7A 3T06B 3J81c 3W34A 2OUKA 3RN2A 1G20E 3MD0A 3S1RH 5K36H 1O87A 4DV5L 3S15H 3I4NH 1JPJA 2F43B 2ZI9A 3ECCA 3LGJA 2PCJA 4NPHA 4OYHA 1IXZA 4BFYA 2ZR7A 4DV6Q 2WP8J 1P5ZB 5KSPA 4PMWA 1YR7A 4YXWA 2WWIA 2O8DA 3ND8A 2A68C 1SVSA 3UIEA 4DC9A 4C7OB 4HJ7A 4IFDG 5JI3E 2K5HA 5K8IA 4OHYA 4C2MH 1NJGA 2BOVA 3OE7A 2OCAA 3K9LA 4A4DA 4DUYQ 2AL7A 2IK8A 3MWYW 4BFXA 4LJ9A 2NIPA 4B75A 3QI2A 1EWHA 1FVIA 5GAGC 1P6XA 2DPXA 1VQ6A 2Q3FA 2WSSA 3UDXA 5FOXA 2GNOA 2GXQA 4S2EA 4QL5A 4MUAA 4LK2A 4BASA 4TTPA 1OH6A 4UNSA 1TF7A 4A15A 2WZQA 4AD8A 1FJGL 3KTAB 4DV7Q 1KO5A 2QF7A 3P4XA 5LMNW 5C0XG 4E5UA 2VQFL 3GLHA 1IYVA 3HPRA 3I1FA 3E9HA 4EIWA 1FR3A 2CDNA 2J0SA 1FNMA 2GZHA 1PH7A 4NXNL 2ZJBA 4KLZA 1OTCA 2N46A 3EZFA 1XMOL 2D74A 4MKHA 4PO9A 5SZHB 1JT8A 1X9NA 4LZZA 3A58B 4DUGD 4N0EA 1GP2A 4JIMA 2ZRIA 3QBTA 3EA5A 1YHBA 2VSXA 3CP0A 2J0UB 3NC0C 4OJKA 5LB2A 4XWKA 2PQAB 5HGQA 4AH6A 3PO3H 2W2VA 1X55A 1N34Q 2W6JD 2WMNB 3U3JA 4QM7A 4HEJA 4WXRA 1E1RA 1SVMA 3FPPA 5LMNL 1JMCA 5EE1A 1N9WA 5FPHA 2FGKA 2GCNA 4TYYA 3ETLA 4IPHA 3PFIA 2GILA 3P20A 5A5GA 3X1XA 1BKBA 5FLMH 1E24A 1X3EA 1KI4A 1OFTA 2RGNA 3AVPA 3DL0A 5FUVA 4DT1B 2FU5C 2YC2C 3AEVA 3ZJYA 4CW7A 2IYTA 2NO0A 4PPGA 5TVKA 4LF5L 1XNJA 4M1OA 4IOAA 4BFSA 1IBLL 1ZCBA 1KRSA 1R0XA 4JLJA 4R2HA 4D0LB 4GLAC 2VSFA 3FHTA 4ASUA 1KAWA 1VQPA 1N0WA 1OV4A 5DI9A 3SFZA 3WXMA 1UWVA 3K9NA 2UUBL 1N6IA 3GPLA 3CWZA 2L5TA 1N5JA 1DAMA 4X8OA 5DO9A 5FOSA 3C5HA 2H7VA 2CLCX 4DB2A 2Z0SA 3LX8A 4TQAA 4L5SA 4DR2L 1H9SB 2HLDA 2ZI6A 1CXZA 1SHKA 4FMCF 5KDDA 1GD7A 3HWSA 3THWB 3NEJA 3FMCA 2VY3A 2BBTA 2QBYA 4MYTA 1TKWB 4DIEA 1VF7A 5M5XH 3HR8A 2CHVA 1I4DD 4LF8Q 4JT4A 4EFNA 3M4OH 1C9KA 1CSPA 3W1BA 1L1OA 5EXXA 2RMKA 1TPZA 4YMVA 3E5HA 1ZC4A 3H86A 4NYJQ 4PFSA 5L3SB 2KWIA 3A36A 4A3FH 1E2PA 2BBWA 2CJWB 1IZ6A 1I4LD 1W4BA 3DM9B 2V1UA 5GROA 5JI2E 3AB9A 1LS1A 1SVOA 3OEHA 5TB5A 4IXMA 4IFEA 3AH8A 4Q66C 1KI3A 2GA8A 4FN5A 2GETA 4RD3A 1T0HB 2RAPA 3VHXA 1E2HA 2HJVA 3KKPA 4KV9A 4P4UA 4PSKA 1V8QA 3KUCA 5LMNQ 4Z1MA 3TZUA 5CB6A 2PMKA 2ZEJA 2CQOA 1DOAA 1G3MA 3EAQA 4A3LH 2IF0A 2NZHA 3ULPA 2NTYC 1YRAA 1W46A 4MGYR 5JEDA 3PUXA 2RHMA 1Z2AA 4FXPA 2GCOA 5AJZA 4DVGA 4JBYA 5FL7D 4CVNA 2BA0A 4JBWA 1E9CA 2JJ8A 4Q9JA 1MKHA 1Z6XA 5ELOA 3O8RA 2F4VQ 1HNWL 2FFQA 1N34L 2DCUA 2ZT9C 1TWGH 4PV1C 3KJOA 2B92A 4QY7A 2AR7A 2QRNA 2EJFC 2KB0A 3MSXA 2ZIAA 4NYIR 1C7YA 4TT3D 5BYJA 5L3QB 4DZZA 1BVSA 3GJ0A 3CX7A 2RB4A 5FJ8G 3GTQH 4JSYA 1A2KC 1X6OA 4TQUS 2B3GA 2DFTA 4A3KG 1ASYA 1DO2A 1DADA 1NY5A 1FJGQ 2FXQA 1MABA 3PIPA 2QAGA 4IVQA 5TDHA 3U5ZB 2O5JC 5FPTA 2XB2A 2K50A 4JOIC 3HOVG 3BRWD 3HOVH 1ZNXA 1YHQA 1PMRA 2YTXA 2ZRKA 5AUOB 3EPLA 3IO5A 5BW8A 1XXHA 5F3WB 1SROA 1WI5A 3ZIAA 1IN4A 1P7CA 2FX3A 4DHEA 5DLQE 5FTKA 4ZPXA 1OJLA 4M1SA 1X8KA 3IEUA 1PZNA 1GVPA 1E9AA 3QNUA 4NH0A 3L0PA 3J7ZC 2DHRA 1VQBA 3PF5A 3DOEA 2ZTDA 3L0IB 3AP3A 3EIVA 1XTJA 1XJCA 4Q4JB 3TW8B 1Z06A 4GKKL 2WOJA 1PHJA 2ERYA 3G82C 4ZKDA 4OHWA 3THYB 6Q21A 1Y69U 1SKQA 2HLDD 1XEFA 4BWYA 5LBIA 4K81B 1Z9FA 3R7WB 3NTUA 3RS0A 3K09A 1NJIC 2X19A 3RLNA 1TX4B 1Z0IA 2IBMA 3IQXA 3Q85A 4GPTA 4JLMA 2ATVA 3CB4A 2CKZB 4A6PA 2GXUA 2IYRA 4Q4HA 3TUZC 3RYTC 3I62A 5L3RA 3K70D 2GN5A 1NIPA 1XEXB 3PSIA 1KRTA 1X56A 1XFAA 3AKDA 4H1UA 4A3EG 2JA7H 4LC1A 3CCLA 4EQ6A 1CI3M 2HT6A 1Q81C 1ZMXA 5CM8B 3FFAA 4O2LA 1NBME 2QEXA 3NH6A 5TMPA 2OTLA 2AXNA 1S3OA 3U7FB 4TL6A 3PEUA 1XU4A 4R2IA 1BMFD 3OIYA 3A8JE 3UKDA 3R9XA 2JDID 1R0YA 2OZEA 3KXLA 1W49A 3AKYA 3NH9A 3G6EA 1D2EA 2VQEL 1KKMA 4G01B 4G5GA 4IDOA 4V0KA 1JQJC 2YINC 3MJHA 5GJWC 5AUPB 3VR6A 2MSCB 1W4RA 1VF5C 1XB2A 2H57A 3CPJB 5HTKA 4PZ8A 1SVKA 2ZS7A 4QL3A 2O5VA 3A4NA 4W5HA 5FPYA 4LOAA 4B3XA 3GJ4A 1BYIA 3RABA 4Z1MD 5IYBG 3K0XA 4MZ9A 4DSNA 5IT9c 2A5DA 2D62A 3GMTA 5JJLA 3UMFA 2ZVQX 2ZJAA 4ASUD 1OH5A 1ZRHA 2AD5A 3R8FA 4W9MC 4JLBA 4MKGA 1JJ7A 3I4MH 4CT5A 1KTVA 4BFZA 4DV1Q 1UEJA 2GJSA 4DK6C 3ZZUA 3RS5A 4LX0A 3E9IA 1J7KA 2IC5A 4X65L 1E2GA 5C44H 3TS2A 1E98A 4UP8A 1OW3B 1Z0FA 2LKCA 1VQ5A 4JV5Q 2G83A 3KKQA 3X1ZA 1NBWA 1M90C 1IN8A 1N6NA 4YMTA 5DH9A 1QHYA 1TADA 1D9XA 1NVVQ 4W7SA 3GJXC 3ADBA 1G9XA 4AYWA 4LBWA 2QPTA 1V43A 1HZCA 3B1WA 2QM7A 3C16C 2WAQE 2WB1G 4EAQA 1YJNA 3A0JA 3PO3G 2MNAA 1I3QH 4HI0E 4X62L 3S2HH 2DFLA 3B9PA 3UATA 3S2DH 4DR7L 2EU8A 3LFUA 5J4HA 1KK2A 4IQZA 4IEEA 2R7FA 2K5UA 2K33A 4B3BA 3I4NG 3JZAA 3PQCA 2R93H 3LQQA 3L2PA 2J45A 4M1TA 3U7GA 1L2FA 5C3EG 1EFUA 1E2EA 1E9BA 1TU3A 4HIKA 1DXMA 2CHQA 1XCGB 1P16A 3X2SA 4UXHA 4QG7A 3GTMH 2UZIR 3A5ZB 4LFBL 2ZRBA 2N3SA 2W83A 3JVUA 2P65A 2CVFA 2JA8G 1KSJA 1RJ9B 4NKRA 1XMVA 3Q72A 3AM1A 2ID0A 1SGWA 2FMXA 1JJ2A 2HJGA 4A3MH 4PPNA 3ASZA 3VQTA 3U6BA 1RJ9A 2G0NA 2XZOA 3BK7A 4NYJR 3QEJA 3PV0A 2AKWB 4KCGA 1GFIA 3I72A 4QKQA 1E2LA 2H17A 3CCEA 3AGPA 3KL4A 2QGQA 2D3WA 3CF0A 4Q1BA 5M3MH 1G19A 1Q22A 1W0KA 3CRKC 2KSQA 2WWFA 4IFDH 3LDAA 1D9ZA 1A5TA 221PA 5AUQA 2ORWA 5DGXA 4KMUC 3CCJA 1GOTA 3MG9A 1EUJA 2EFDB 4JL8A 2Q9AA 5JEAH 4YWKA 2I4IA 3AP2A 2A7QA 2JIZA 3KKMA 4NCHA 2QP3A 4DV4Q 4B3TQ 1JR3A 1U9IA 2QE7D 4DV0Q 4DV3Q 2RGDA 1Q8KA 5C4XH 1Q7YC 1IXRC 3I32A 3K0FB 3M6AA 1BBUA 4GLVB 4LUZA 1OSNA 2IYSA 2E75C 2OLKA 2ZRGA 3A8IE 3NEMA 3R20A 2IS4A 2AK2A 2XXAA 4BLPA 4CGZA 2UUAQ 3LBIA 3ZZ0A 4II7A 4B3MQ 1J6QA 1NY4A 1PVOA 1OXTA 1LACA 4GOPA 1KOFA 1Q21A 1U98A 4HAUA 3NE5B 1XD2A 4KYUA 4A0RA 2KBEA 3PJRA 2AN9A 5FL3A 4JI6L 1AS3A 1J8YF 1M7GA 2B7CA 2CBZA 3F3YA 3IBGA 4HZUB 1QZXA 3NKVA 4JI3Q 4XJXA 3RHFA 3AVXA 2LXJA 5GQOA 3ZQ6A 3CCRA 2OCEA 1ESMA 1Z29A 3AGQA 2GRJA 3LBHA 5IT5A 3CZQA 2K5VA 2RHDA 4HB0A 4LYAA 2JAQA 4M8NE 4NYMR 2OG2A 2XJ4A 1N5LA 1ZU4A 2JQOA 2XTZA 1EFRD 1XNQL 2Q2IA 4IFDI 3J81i 3FGNA 4MRSA 2ANBA 2V8OA 4FMBB 4NCIA 4WZ6A 4BLQA 4PHFA 3NHBA 3CPWA 1AM4D 3CPEA 5BWMA 2JA6G 4OWXB 2ZSDA 2CL6X 2ZTSA 1A1VA 1BYUA 3E2IA 1PV4A 5JCZA 1DO0A 2A19A 2W6JA 1VCOA 4RMFA 1DAHA 4BFVA 1NMFA 2ZI3A 2AUJD 1I4TD 4KN7C 1JPNA 1JR3D 2KJQA 2QE7A 4JI0Q 3PEYA 3W6PA 1U9IC 4NP6A 1IBML 2JLZA 2E9SA 1YVCA 3N2IA 3H4MA 5EE5B 2VBCA 1FTNA 3ZS9A 1IW7C 1LTLA 2QMUA 1CJTC 5AWFC 1P8LA 4C0AC 1HTWA 2D7CA 4PR0A 2JLQA 2QT1A 4AC9A 3P32A 4AY2A 1YZQA 3CWQA 2RGAA 3WP0A 4EKDA 3AVYA 1E2WA 4OI4A 2JDIA 3NEYA 3H84A 3BE4A 4LF9L 1EQQA 4O2DA 2H8KA 3X1DA 2A5YB 2QGNA 2GCOB 2BM0A 3UE0A 3AKEA 1G7CA 3Q8XB 2PNRC 2FSIA 4FINA 3HDTA 1GO3E 2VF8A 2J0QA 5IDVA 1SRUA 3HGBA 4C30A 2KCTA 1G16A 1VYUA 2PLRA 3B2EA 3QEOA 4GOXA 4C7OA 1VG9B 4P3YA 2F52A 4UNNA 4C0BA 4BY7H 1T4GA 2IEZA 4HLDA 3KB2A 2QAGB 1W7AA 1FNNA 1QRAA 3KQKA 3P27A 1D2MA 4RD2A 2YJTD 1R2QA 4A0HA 1Z0AA 3RVBA 2H1LA 2QTVB 4OJQA 1KYIA 1VQ7A 1XXHB 4MRVA 2YWGA 1OHHD 1RYHA 2E2IH 4LBZA 4HSEA 4JVNA 4US0R 3JVVA 1GUSA 2I3BA 2ZRMA 3FKSA 4XD7D 2IEYA 3RC3A 4Q1EA 1YZKA 5IWAQ 1K8RA 4YQFA 3U58A 3M4YA 4QGHA 3TSOA 1UEIA 1GITA 1AE2A 3SDZA 4JBMA 4GSYA 1S96A 4R4CA 3WDNA 1G1MA 1VQKA 5DYIA 2QL6A 2MFIA 3GLFB 1BOFA 4B3RL 3H94A 4H1VA 1ONLA 3F1ZA 2UUCQ 2GVZC 3CC4A 1R8SA 4KO8A 3QXHA 2IX1A 1G8HA 3FMFA 4I4LA 5FOVA 3JAMi 1VMAA 1NMGA 2P6RA 1HZBA 1TU4A 1KI6B 2K7VA 3QXSA 4DR7Q 1AIPA 2Q2UA 3TVDA 1UKYA 4TKOB 1S3SA 3N70A 1ONBA 2CLSA 2O0HA 4A3JG 2DWQA 5A4JA 1Y1VG 5EQTA 2O52A 4RCNA 4HUQA 2Z6KC 2WIAA 4POAA 2P0EA 4IOJA 4C9BA 2VNUD 4LCBA 3AVTA 3AF2A 2ZROA 4M2LA 3QOFA 1DEKA 4OQMA 4ZDKA 1YI2A 4GFDA 2NN6I 1AKEA 3QQ5A 4KLKA 4IDNA 3RAPR 2FV8A 3FKIH 3Q8DA 4OHXA 1Y63A 1KAGA 1KJZA 2IHBA 4HDCA 1GIAA 2GXSA 2ZE6A 1O7IA 3V4FA 3PVSA 1OB2A 3TSWA 1EWQA 3THXB 2BM1A 1LY1A 4HIMA 3T1VA 2DGYA 2DBYA 1NVVR 4DLUA 4B3RQ 3UANA 2AWNA 1U0HC 2GAAA 1E9RA 2RHSB 4HDQB 4Q48A 5G53C 4A36A 1R4AA 1LUZA 4AIIA 5CDFE 5A0FA 4V03A 1HV8A 4BXXG 2ZITA 2E5LL 1S9DA 4BZPA 3BGWA 4XVUA 4BLOA 5IWAL 2O8BA 1XCPA 4B34A 4PZYA 2UUCL 4LF8L 1BDOA 4KKSA 2VHUA 3LRPA 3SI7A 3W9YA 1TL7C 5EE3A 3T53B 5CITA 1AJEA 2ZAMA 1JR3E 4R4OA 1VTKA 2BCJQ 1G3IA 2CJWA 2JJ1A 1RW4A 1U8AA 3BFXA 3OZXA 4OL0A 1ETUA 1H8ED 4TMXA 2REBA 4ZO4A 4CEJA 1YR6A 4Q9KA 2B63G 3F2BA 1Y1VH 2C95A 5AJYA 1HTPA 1E4VA 3GLGB 3DXJC 3ZD6A 2FNAA 2PZGA 3NHAA 2GWHA 3AVOA 3PENA 1G3RA 3G71A 3GLGA 1Z5ZA 1E69A 3LVRE 3OAAD 3RWOA 2O8DB 4CYMA 1HYQA 3B60A 4IJHA 3MGCA 4ILEA 4MKFA 3VAAA 1LF0A 1MT0A 1M6NA 2WV9A 1KHIA 4QBFA 3TE6A 5AUNB 3QPWA 1OXUA 1IXRA 1ANKA 4QRHA 3R8CA 3SOPA 3T1OA 5JRJA 2DB3A 5J47A 1CF4A 1X3SA 3K9GA 4JI7Q 2YC4C 2R7ZH 1SQ5A 1ZM7A 2PZFA 2AD1A 4G3XA 4JLOA 2W00A 3J81k 3PUZA 2ZSAA 1MRNA 2CWPA 4TT3A 1LNZA 1FL9A 4X8LA 1YJ9A 2E74C 3EARA 1I2DA 2Z5FA 4GT1A 1VQLA 1DBSA 4NE2A 5K8LA 1QG2A 3EWSA 3FMOB 3FMPB 1M8PA 3LW8A 4BE7B 5KO2A 1KSFX 3KOJA 3LA6A 1H9RA 1XTQA 3HOYH 4HLQB 4TSFD 3K70B 5M3MG 1H8HD 1W2HA 2CL7X 1WFQA 4PPQA 3J80c 1AH9A 1HR0W 3PEWA 1HCZA 1NMYA 5KNBA 1ZIOA 1VQDA 2D06A 4M1KA 3STBC 2IYQA 3SYNA 2PCFB 4DUZL 4NCKA 3VFDA 2JA5G 1X8LA 1MIUA 4BECA 1W36B 1GJXA 1WJJA 1NE3A 4NHOA 3REFA 4EPYA 1GKUB 2AHOB 1FX0A 1EK0A 5SZIA 3GJ5A 1J2JA 1CJUC 3FP9A 4LK1C 4OQFA 1PUJA 4PZ6A 2FPMA 2ECKA 4OI2A 1SN8A 1K0RA 4GNKA 1O78A 3U6KA 4L15A 5C3EH 5AJXA 1FGUA 3IIKA 1E22A 1DVRA 2EYQA 1LABA 1X6VA 2WSSD 4M1WA 3Q5EA 4KBFA 1VYVA 2VUMG 4PQRA 1YJWA 2ZM6Q 1KMQA 2GBLA 4Q03A 5DI3B 3R7WA 2EQBA 4PZLA 2LXKA 2ZJ8A 3K0SA 4A3IH 3UDFA 1US8B 3EASA 4DCUA 4C2TA 5CM9C 3I73A 1IYJB 3KJPA 4A3DH 4FWIB 3BH6A 1DAIA 2IXEA 3M3YH 3HP1A 2D5DA 4FMDF 4Q01A 3WMGA 1HNZQ 1KXLA 5TARA 3CM0A 4IVRA 4Q18A 4WIAA 5JHHB 4BA2I 1RKBA 2A78A 2BHRA 2A3RA 2FFAA 3NC1C 3OF5A 4YDHB 3T1QA 4B3FX 1NG9A 1G5RA 1H8HA 4ALPA 5G41A 4B35A 4RFSA 4URXR 3H0GH 2REOA 3GLHB 1NNEA 4DLWA 4MRPA 3RN5A 2RGBA 2QT0A 3KX2A 1OKKD 3HU3A 4I1SA 1R0ZA 1IY1A 2JJQA 2C5LA 1WOCA 1FQKA 3CAMA 3GTGH 1XTSA 3AF0A 4DDTA 4Z8XA 1G3QA 1VCMA 4Y0AA 2V7QD 4LV8B 4YCUA 1BS1A 2CNWD 3VMFA 2G9NA 2V1CC 2WICA 3GCGA 2B8GA 4IFDJ 4Q1FA 3CX6A 1ZM3A 3GTOH 1XJ0A 3FB4A 2MO0A 1D7QA 3TGPA 4Q47A 2XNDA 4C3ZA 4JBXA 3GQBA 2OFWA 4R7ZA 1II8B 5B30A 1CRPA 4GNXC 2R2AA 4A3IG 1Y3AA 4KU4A 2ZUBA 3RS4A 3QPUA 4X6AH 4LWCA 3WRYC 5DNYB 1N0UA 3B7GA 4LBYA 2EW1A 1KJYA 4DR2Q 3ASYA 1SVWA 2BIFA 2ZJYA 1IOZA 4R71A 3D4RA 1L2TA 1DCZA 3G48A 1GWNA 4EPXA 2IW3A 2A68D 1VQNA 4PC3A 2UU9L 4A3EH 4JKIA 3Q7PA 2GDJA 3KF8B 1SMXA 2ERXA 2VHJA 2VHCA 2ZJ2A 3KB1A 4ESVA 3R9IA 1X86B 1L4UA 4F93B 3LY5A 1HNZL 2ZYUX 4XWOA 1EYGA 5JEAG 2VO1A 5AJ3L 2JA5H 1N5IA 3LX5A 2J9RA 3OAAA 5D3MB 3ZZTA 1U0JA 4B32A 4ZDJA 1GRNA 2JLXA 1KI1A 1E0AA 5D3MA 2X8AA 3D31A 1DARA 2NGRA 3B1VA 2HDNB 2Q3MA 2RGCA 1XMIA 1G8FA 4LC0A 1HNXQ 1L7VC 2OBLA 5EP4A 2A6EC 3B6EA 2QP9X 1ZUIA 4D4KA 5EP1A 4UNQA 2V55B 3WHKA 3K7AH 1YEZA 1GUGA 4UNPA 1GM5A 2KCMA 4LFAQ 4A3MG 2VL7A 2HIXA 4AWXA 3NBZC 1KMHA 3VNVA 4YWLA 2QU8A 1OT3A 2H18A 4O25A 3QG1A 2KI5A 2SHKA 4Q5IA 1KMHB 4X64L 1F6BA 3U7EB 4C0QC 1FOEB 2D0OA 3TNFA 1A4RA 2CVHA 1K73C 4HAZA 2E8GA 3FVQA 1LVGA 4M9XA 1RRFA 4OQXA 5JWHA 5F98A 1SXJA 3GFOA 3K09C 3KJEA 3CPHA 4TLDA 4MKIA 3HOXG 3IGFA 1N0VC 2VF7A 1TMKA 2NG1A 2YV5A 4GN4B 3DM5A 5DSZA 4A3BH 4NB3A 5HKKD 2V3CC 1VHLA 3OESA 3GEEA 1KI9A 4EQ6B 4B43A 1C1YA 1P2VA 2QRZA 1VQOA 1N3BA 5DN6A 1VQGA 4DR5Q 2WPDD 2GJ8A 4ZIRA 4HB4A 2AMCB 1SULA 2B29A 2GVAA 1Z7TA 5C0XJ 4P73A 1YU9A 1Z6TA 2P67A 2UUBQ 2OE2A 5C44G 1JR6A 2C8VA 5IK2A 2ALYB 1MABB 3T56B 4P71A 4OKSA 2K32A 4B2IA 4BXXH 5E95A 3UG6A 1BIFA 3CW2A 4M1MA 5BQ5A 4JOIA 1AGPA 1W5TA 1KKLA 1Z3IX 1CSQA 3BH7A 4NDZA 4GOPC 4NYMQ 4Q7JB 2A5JA 4RKEA 3ZS8A 3U44A 1GZSA 4NXML 1IBKQ 4UY8C 1YZLA 4TYPA 2YKGA 4G5OA 2P5TB 5H68A 1K8GA 2YWEA 3THXA 4LJ6A 1HQCA 4A3FG 1LS6A 1N36L 4C0KA 5JMTA 5IP7G 3M9BA 1ZAKA 4DV3L 1F5NA 1MO3A 2FZLA 1IYUA 2HHHQ 1H9JA 4D26A 1II9A 2RF4A 4IVPA 3G0HA 1CKMA 4BLRA 1Y1WH 3IIMA 2LMCB 2ASEA 3EZ7A 3A1TA 2ZJPA 4PX9A 1KD1C 2FSFA 3B78A 4LF7L 1KI7A 3LNNA 1QDEA 1QHNA 3SS8A 1YR9A 3KFVA 4HUTA 2QN6A 3OPOA 3A8KE 1GILA 2NZ8A 5IP7H 2Z4SA 3LLMA 5FH9A 2OESA 3IHLA 621PA 1YHAA 1ZP6A 2NZJA 1KY3A 2MSEB 4CT4B 1ELOA 4L4UA 5KDLA 2R6DA 3CRQA 4CEIA 2IHEA 1J5EQ 4OO1G 3UXMA 2HXYA 2VTKA 2PT5A 5ELNA 1RYFA 2JA1A 3PIOA 1SVLA 1VHTA 2V4ZA 3QVUA 2JLWA 5FOTA 2OHFA 4JI5L 4TL9A 1PH4A 121PA 5JFGA 1QF9A 2W2XA 1R5OA 1TQ2A 2PX0A 3W3AA 1E0SA 3FKSD 4PC6A 2X2FA 1OKKA 4LW1A 2OLJA 1A62A 4JJZA 4BFTA 4C0JA 2WWXA 3U61B 2TMKA 1R8QA 3K0AA 3KYHC 2ZE5A 3TVTA 1HH4A 1WP9A 3K81C 2CW0C 3KFUA 4A3BG 1RFLA 1Z6YA 3IPYA 4HIDA 2NO6A 1UE1A 1YJ5A 3SN6A 1Z6GA 4A8JC 1MRSA 1P72A 2A2ZA 1WCMH 4H13C 3HOXH 1Y8PB 1P9WA 4DR3Q 2WWWA 3I56A 2N1BA 2ZI7A 3FFBA 4J0QA 2YTYA 1W5SA 3ONWA 1JE5A 4JMPA 3RLOA 3S14H 5G40A 4X8MA 3SJZA 2ZRDA 4NXNQ 1E96A 3AF3A 4YCVA 1JB7A 4DK0A 1N33Q 5EUQB 1IBRA 4XSHA 3CRRA 1P60A 2OCYC 2PCLA 3DOFA 5KPDA 4YLGA 2XAUA 1QHXA 2IYXA 4KSCA 1XD9A 2I1QA 4XVRA 4DCTA 3X1WA 4A92A 2WHXA 2PBRA 2XSZD 4A2QA 3A1SA 4MGIR 4AG5A 2B8TA 2QA4A 4GZMA 1B9MA 3RLFA 2VL6A 2ATWA 2Y8EA 4E09A 2OAP1 3ZJYC 2IT1A 2ZI4A 2IS6A 4ARZA 1FFHA 4DCNA 5KNCA 3BB3A 2I5LX 3AVVA 4A3LG 4RD4A 1BH2A 2R9VA 5FOUA 4IW3B 3CONA 1J70A 5E7MA 3K80C 2ZPTX 1X1RA 5AJVB 3UK6A 2WJHA 3CCMA 2NQ2C 4ZDIA 3V4RA 1VYTA 3TSZA 4A3CG 4ME3A 3KDFB 1LTQA 2BVNA 2E76C 1IBKL 2FPKA 2YU9H 4GS3A 1PH2A 4M0LA 4N1AA 4LF9Q 3LNCA 4H0LC 4LJ4A 3PUYA 2ASBA 2C9YA 2H16A 3SHFA 5CLLA 3REGA 4MA4A 4D80A 1PFSA 3T34A 4WJ3M 4RZXA 2EIFA 2WOOA 4XIGS 1UBFA 5FTLA 1G21E 1OH8A 2B8FA 4Y7NH 3W90A 1SXJD 1XMQL 2ZSEA 4DDUA 4TL8A 1Q1BA 4LUOA 5HR5A 4YMUA 3EIQA 4TZ6A 3NELA 4KHZA 3VA7A 1N25A 2PJZA 1KDOA 3A1UA 2Q6TA 3I8SA 3IO3A 3QKSB 4IEIA 3KJGA 4LHXA 2FEOA 3T35A 3J80i 2P2LA 2HQLA 4JLNA 2WAXA 721PA 1NLZA 3P1JA 2JCSA 2BMFA 3I5YA 1VG8A 4GN3B 4B71A 2HCBA 1J90A 3FHCB 1Z0JA 4JL5A 4GOJA 5B58C 2RGNC 4DK1A 5HCIA 1VQ9A 1GVNB 3VU9A 3DLLA 1IHUA 3T1HL 1TWCH 1SE8A 3O8BA 4A0GA 4KFSA 2CCZA 2GEUA 2A9KA 3GLIB 1JB1A 1RE0A 3ICEA 1EIFA 5GADC 3RNUA 4F92B 4B3SL 1IN7A 1S72A 4IO9A 5C4XG 4HZIA 3RRYA 5FOWA 3CRLC 2AWOA 1GNQA 5CK5A 2JJ2D 4IPDA 1I94L 2V1XA 1W36D 2IYWA 1D2NA 3KKOA 4J15A 2D2EA 4GP6A 4IOLA 3K70C 1F3OA 4KBGA 4E07A 1IN6A 1Z47A 4AURA 4EDHA 5JHGB 2IS2A 1PYSB 3B8HA 4R9UC 1DG3A 4IDQA 4B73A 4UNRA 5H70A 1M7BA 1C9OA 4WJ4A 2CNWA 4I1VA 2V7QA 3W5JA 4AKIA 2JA9A 2VP0A 1N32L 4ZV4A 4NXMQ 2GJ9A 1KAOA 2DWPA 2D2FA 3C41J 5BXQC 3VKGA 1W3SA 1CLUA 2ZRPA 3CCSA 1QUQB 3M4PA 3BXZA 2Z4RA 4ZDWA 2QAJA 4A2PA 3QKTA 4Z8YA 1OXSC 1P2TA 4UXIA 4Q19A 1MJCA 2BA1A 3G5UA 4IDHA 3BS4A 2B21A 2R93G 3EQLC 1T6NA 2KBNA 4V0NA 2BDTA 1WCMG 1KGDA 2PI2E 3MXUA 4JI2L 4TWZA 3TBKA 1G6PA 3CNNA 3ZH9B 1X8JA 2ZQ5A 3QUSA 4P75A 1RIFA 2BDOA 2Z6KA 1S0UA 4PC7A 5KSZA 1GRQA 4LJ7A 3AV0B 1XTKA 1GKIA 3FDIA 4EUNA 3W5OA 2E5LQ 2G3YA 3DMDA 2Y0SG 4B3SQ 2GVBA 1S8FA 1TQ6A 2F6RA 1TWHH 2ZJQA 2ZS8A 2D4HA 1AE3A 3NBXX 3GJ7A 1AA9A 4RD6A 2VHQA 1N5KA 1KQSA 3NXSA 2UZ3A 2KHJA 3PCRB 4JBKA 1S2MA 2F43A 2FE4A 2MSDB 3E1SA 3AVQA 1Q46A 2PEZA 3L8ZA 2VS1A 1VECA 4YC7A 3RSLA 1DAGA 4TTRA 1GHJA 4DR1Q 3KF6B 4MDEA 4LFBQ 1Z6AA 1KHTA 4MYHA 4GOPB 3WMEA 2QEQA 4PG3A 3LXXA 4JI1Q 4A76A 2P6UA 4NYIQ 4KI0A 2ZM5A 1VCIA 3GTJH 1MR3F 2HCJB 2RKOA 2Z83A 3CH5A 1X54A 3SJCA 3ZQJA 2BBSA 1KJWA 4PPFA 2A8VA 3CF6R 5L8VA 3U4VA 1QVGA 1A2BA 3ADKA 4P4TA 3CR7A 4PHGA 4JI8L 3THWA 4FWTA 2QM8A 2ZE7A 2QBYB 1KIMA 1HQYE 2FEMA 4B74A 3CUEF 2PT7A 2F1RA 3TH5A 5BN3A 4B76A 1O7LA 2QAGC 3A1VA 1IBMQ 4OHVA 1I2MA 5DISB 1YZ6A 3TS0A 1L0WA 4BBRG 4OWTB 1CTMA 1EIYB 1GL6A 2HUPA 2C35B 4LJ8A 2MO1A 5FL7A 1SFOH 1KO4A 2BWJA 4K0KQ 2CCKA 3GJ3A 1RZ3A 3IRBA 5GJCA 4KJZA 4V0ME 1ZM4A 3OEHD 4YHHL 3VNUA 4DLSA 3CKLA 5A35A 1EGAA 1L1OC 4QXAA 4Z51A 4AYBG 1G5PA 1TQ4A 2RGEA 2ZREA 5FBWB 3VR2A 1WXQA 3SE0A 1A63A 3VR5A 2VQEQ
chains in the Genus database with same CATH superfamily
1Z6HA 1G5QA 2EFEB 2JC3A 2JW5A 2QMQA 2P77A 2XWJI 3DCNA 2E87A 3RAGA 3EIUA 4LHVA 3SYLA 5DKFA 4RJLA 4F5EA 5GJBA 1B16A 1E77A 2GPBA 5ESWA 1EWRA 5E2IA 2V45A 1B70B 3DKIA 5HILA 5HOQA 4Q3NA 1NHWA 3GNTA 3M0EA 1JTEA 5FKAC 1KJIA 5COQA 2X41A 1QMGA 3DHNA 3QNMA 4DV6L 3EZ2A 4RGTA 2HJRA 2ZGVA 4MQFA 3WDMA 5K2OA 5IY0A 3QEBZ 4ARCA 1EX7A 1U0EA 1J09A 5E0KB 1ONOA 4B7CA 3IEVA 3ZYCA 4CCSA 4HHEA 4FF3A 1O6BA 4MRRA 4Y2XA 2V3WA 2Q0HA 1AEXA 2XA2A 1MH1A 3D6TB 4DA2A 4RM3A 2PXHA 3LKBA 2HNAA 8LDHA 3Q7TA 4JC0A 1Y8OB 3LPNA 1EHYA 4TZKA 3PC4A 2HA7A 2IYLD 3NOQA 3OM0A 5AI5A 5A9TA 1T0JB 1LM0A 1SUDA 3QQPA 5JADA 1UH5A 2RK3A 2WU4A 1DGSA 4HZGA 1YQTA 1E3PA 3IT2A 1OIVA 2R84A 3IUJA 1O08A 4X95A 5ERGB 4AX8A 1JPVA 1KEPA 5C8YA 4JV5B 1U4OA 1YQUA 2PWAA 1PZXA 4I8IA 4AKTA 4CUJA 4BXOB 5C8YB 3LFHA 1T2FA 5EAYA 3A06A 4ACAA 1GGVA 4HC4A 1RRKA 5EZ5A 5I48A 1FX1A 4FGZA 2NVQB 3O1JC 4QHSA 2K75A 2BKEA 3DMYA 4K8IA 4GNRA 4TLMB 3CF4G 5DW3A 2PLWA 5DTJA 4BO1A 1E3WA 1YT5A 2FW9A 1QKKA 4R5HA 4GO1A 4KQKA 2OZPA 4NOMA 5JDCA 4ACBA 1N32B 4PINA 4ZMSA 1MPTA 1XZLA 4HCEA 4NWIA 4F4FA 4Q24A 2OFPA 3GRVA 4RJ2A 3FYUC 3RT9A 1RBMA 4LF5B 4H7PA 1D2AA 4J76A 4WNAA 1XQ1A 2C1ZA 4TYWA 3FGOA 4YGYA 4I8XA 4OI0A 3ZQKA 3LXUX 3MWEA 3LWUA 1C9EA 5E4JA 2AXPA 4JCVE 4BNDA 3O21A 5JYEA 1A97A 5T8KC 2WSLA 3LZCA 2P78A 1Z0ZA 3OZUA 4XUCA 4EVQA 2PRSA 4PY2A 3TSSA 4J1SA 4C0SA 5H9WA 1JEEA 2FMHA 4DAPA 4MDYA 5AM1A 1QG4A 4GX5A 2IDMA 5E9AA 1NG1A 3VNQA 4YJGA 1BWSA 5B3JC 3QO2A 1L0BA 4CDMA 5KQGA 1K8MA 1I1HA 4JLAA 1VQHA 4YXWD 4B33A 3C3CA 3F8SA 4QATA 2D2CC 2A6HD 3SEBA 1EE1A 1PL6A 1QHHB 2A0WA 1HE8B 2FEXA 1OZAA 2QMEA 1O80A 2JN4A 3VDYA 1R1DA 2JEYA 2Z30A 1Z0KA 3A26A 1BWQA 1T6YA 2LY7A 1YCHA 2FMKA 1N6OA 5AKIA 4YWHA 4DNQA 1W8IA 4JT2A 1JSRA 5BOSB 3QENA 1AMNA 1OILA 2G9QA 4RORA 4R40A 4B46A 1Q14A 4FYPA 4NY1A 4PGFA 1OYVA 3PXEA 1W6JA 1RD4A 4BWGB 4UVIA 1TKCA 4W9NC 1RKNA 1Q5PA 3M5DA 4TL7A 3F2CA 2BTQA 1UINA 2Z2IA 4MDHA 4XDHA 3O3OB 2VDJA 3EVTA 2UUPA 2ODBA 1CDDA 4CMIB 1G21A 2GPWA 3AEZA 5JAQA 2IXFA 4HWRA 2W0MA 4L0CA 2N55A 2WFWA 4DNFA 3LGSA 4IJUA 4DEVA 3RZDH 1X0VA 3DPSA 2OQRA 4BC1A 1P7WA 1WV0A 4MGEA 4Y2GA 4XGIA 4NMHA 2UXBB 3UWDA 1N6KA 4H08A 4XQ0A 5AI8A 4TTTS 3W2EA 3LL4A 5JS7A 1BCRA 1ESRA 3QA3E 3A9SA 3WSTA 1X19A 4RHCA 4EPVA 1VRCA 3OIFA 1CZOA 1W0KD 1YRBA 3CH6A 3L4BA 4OH7A 3T0IA 1BWPA 4KHPL 4A0FA 1WWKA 3I70A 2B5OA 3EUWA 4L7VA 4M9QA 4XVQA 3R9XB 3QXGA 2C58A 1EFAA 1F8FA 1VHWA 3JQGA 4FCVA 5KKAA 4BLWA 4DNPA 4A3JB 1GV1A 2PBZA 3JRWA 5K0JA 5IMSA 1ZRNA 1GAWA 3QVTA 3H91A 2BJVA 2NZWA 2UZ1B 3PHIA 4L16A 5C53B 5M5WB 2Q1UA 3IAHA 5J63A 2WACA 4M8AA 4M53A 3H5WA 1M1KC 3NO4A 3QXXA 1E6CA 2J46A 4YLEA 2PYZA 4C3IH 3JYLA 3BXEA 3JAME 2H1CA 3MILA 4MKRA 4ZZ3A 2XVMA 2J3EA 2JB9A 4LWZA 1F8UA 2UYHA 1LT4D 4QGUA 4OUDA 4DCSA 1CR4A 4DV5B 2MYTA 3BBPA 5EZSA 1XZGA 1C14A 2A67A 3B13B 2BEUB 2FPPB 4WCFC 4EYQA 3EXEB 1L5ZA 4POOA 3WA7A 1JJAA 1Y3DE 1G2IA 2DRIA 2IYVA 4X00A 3AY6A 4MWBA 4K6LA 1E99A 1ZU5A 4NESA 3RRJA 1LPSA 4D25A 4DV7L 1ZGJA 5HHTA 4BNYA 5FI1B 2H92A 4C78A 4WK6A 2R7ZG 1UM9A 1CHQD 1LTTD 1TU2B 4GXRA 5KS2A 4ZVQA 4OJYA 1QP8A 1ZK1A 1SU8A 2AQHA 1D5MC 2EWVA 3BJEA 4GIBA 5C1IA 3EN2A 2RAVA 3Q5DA 1J5XA 3CLUC 2IP1A 5H1SE 1J07A 1T10A 3QEMA 4R1TA 5DIZA 2EERA 2AFIB 2PMBA 4G9BA 4EVSA 5IKEA 1V2GA 2QVCA 1D1QA 3NHSA 2QV0A 5CT5A 4JI4Q 2DUNA 2O7QA 3LVFO 5IARA 1E63A 2IHJA 5TMBA 3AU7A 4JCCA 3TREA 2WNIA 4NMMA 1X7ZB 1ZXBA 1R6VA 2E85A 3BD7A 4Z9AA 5HEKA 1JEQB 3SLKA 4U9IS 2BH9A 1AZSC 4UHCA 5HDQA 3LO8A 4IAOA 2L12A 3KT3A 4TVAB 2NYUA 5HE8A 4DGZA 4FYWA 4IIUA 1QS0B 1ENCA 2MMCA 4KSCA 3V1TC 1FQJA 1FYDA 1XRQA 1BEUB 3KM0A 1USUA 4TXMA 4ZK9B 3OCWA 4C6RA 1D5XC 3C7KA 3H3FA 3IL8A 1QVVA 1QGED 5F2OA 4R8NA 3INYA 3H0GG 4FLFA 1FQOA 1AKVA 5ALSA 3T3GA 5CVCA 3BDAA 2DWCA 4E7PA 1D8TA 4OHRA 3H3VH 3ROXA 5LP6F 5IYBH 1PLFA 1VRVA 2LVBA 3V00A 1DIAA 2KPOA 4YTEA 2VTEA 2VQFB 5KVQA 1PQUA 1U99A 5FADA 3M82A 2NN6H 1AKTA 4YY3Q 4HH3C 1NYRA 2R93B 2XV1A 5M3MB 1U2RA 4DY6A 3CCBA 2AX4A 2GJKA 3KWLA 5H80A 4DCOA 4ZKEA 4BBSB 1MJ5A 2QSUA 2E6KA 3O26A 3HBFA 3R7SA 3UVEA 1ZJJA 4FFPA 5BVHA 2PX5A 4IOKA 5C7LO 1R16A 1ST3A 4C14A 1WQ4A 5A62A 5ALIA 4NE9A 4D3ZA 3KJXA 3WGGA 2ZWVA 1FTWA 2ZSFA 1RC8A 1VQIA 2W8BB 1PH1A 3GQVA 2DE0X 1X1CA 1VDZA 1ZM9A 3PCOB 4QQ8A 2VDWB 4UAGA 2ECQA 4UREA 3RIHA 1RLMA 3DMNA 1JFSA 4F12A 3S0JA 3HH8A 3HXLA 2BM8A 1SXGA 3VKUA 2I46A 1CULC 3P4YA 1HEIA 4KKUA 3U56A 4KR6A 1CY4A 3CEHA 3LDGA 3EG5A 4JXJA 3KYDA 4OX9L 1V1OA 4OSPA 3S2SA 4AIRA 3H2YA 3S2DB 1FNUA 1GQFA 3K1YA 2WPNA 3QF4B 5EP2A 4JP2A 5ELMA 4YRAA 2B2UA 1TYZA 2JH8A 2VF2A 5ES3A 4TYQA 1VLQA 2WTMA 4L73A 5T8KA 1K86A 1PJ3A 5HCNA 3TMEA 5KNDD 4LVCA 3DZ8A 4WBNB 5KTMA 1QANA 3AR3A 1E2KA 3EDQA 3KJNA 3KUXA 2R92G 4H9GA 4IWNA 3GXBA 5GADl 1JICA 1V45E 3TR0A 4CDGA 5BQFA 3NAGA 2RHGB 4L2IA 3SICE 1LGYA 2W2LA 4OM8A 3M4XA 5EHNA 5HF5A 3HOWH 3UJAA 4A6EA 4B81A 4K2AA 5F51A 5K2MA 3OOJA 3BE5A 5ALZA 3E0JA 1WE2A 1QHSA 1A2OA 3MBKA 4CMAA 2Y1KA 1ADJA 1H85A 2RBKA 2RAFA 4HNAB 2PFKA 4DMCA 5KWIA 3EVNA 3EZXA 2UXBL 3R0ZA 4PNPA 3UGTA 3UMRA 3NATA 1H0SA 4IUUA 4ZN6A 1KNXA 5HK9A 1DD2A 4F91B 1KBQA 3GG2A 4XEHA 4OLAA 3MUFA 5BP7A 1HYBA 3A1DA 4MLDA 1EVLA 2GF9A 3HA5A 3OC0A 4J6HA 3CR8A 5DHPA 2HA5A 2ANCA 1HTTA 2YVLA 1OJ7A 3DXYA 3ZE2B 1OA1A 5EE0A 5C8YF 4YCWA 4ZAWA 1JILA 3KLRA 1JEOA 3BORA 1QV9A 2FJUA 5CX4A 5ALGA 1I4HA 1Y14B 1BVUA 2XYGA 1HE5A 4WA8A 4JR1A 1DEOA 1WB6A 1FD7D 1T3SA 1JE1A 3NTVA 2QKYA 4J16C 3FUCA 5AM0A 5DX1A 3S3TA 1JOOA 2WSYB 1UEXC 3RYFA 3B38A 5CLHA 5J2UB 3B5JA 2LWIA 3DE3X 4RMHA 1MMFB 1SBZA 5ALFA 1FYWA 1BFKA 1FXUA 4IH4A 1PTOB 1E2JA 1C3OA 2R60A 3L6OO 1N4DA 1H22A 1TVXA 2HQ1A 4IFBA 4QPDA 4ROTA 4X3KA 5AVXA 1RPJA 3H15A 2QZ9A 1LEHA 1K9MC 2LE0A 3GBPA 2UXBQ 3AUUA 3FMVA 3AHIA 3MWJA 3OE7D 1P77A 4ZZ0A 3GLRA 3FHWA 2E2DC 1KAEA 1T2UA 2G77B 4L8LA 1YBYA 3N28A 1YXMA 3RFUA 6GPBA 1M0SA 2JIMA 3SZRA 2CXRA 4JI3B 4WN9B 1C3JA 2XOKD 4DA6A 5A4DA 1UT6A 4L8GA 3IOYA 1P61B 1SLJA 1AQYA 2CXHA 5THQA 2HIMA 9ATCA 2XCRB 3MT0A 3P0HA 1IM2A 1W2GA 2XMCA 3ZQ4A 1KNQA 1TEVA 2HK6A 1YUNA 3DZJA 4U8HA 2B39A 1AB6A 3QLUC 1A6XA 3D8UA 4MHTA 1XRSB 5L6LB 3Q15C 1PYBA 4POGA 5ALKA 1HZAA 3FBGA 1FFDA 1K6MA 1PV1A 1LT5D 2FN7A 4ZKBB 4BAGA 3ANTA 4C7JA 1QRSA 2BKAA 5GZ6A 2OD9A 1SHZA 1J24A 3I52A 2UV8A 5CAEA 3Q7EA 1TNDA 1X7XB 3OOEA 1N8RC 1XNRQ 1QVRA 2J9FA 2Z09A 2ZIFA 4ZTBA 1F0NA 5ADUS 5C4MA 1HRJA 2BONA 3QH4A 1MB9A 4LEIA 4WZAE 1C9JA 3P9KA 3WIUA 4ENVA 1O58A 3IKTA 4U673 2ET6A 4FZ3A 3I23A 3RZDB 3HU2A 1J1ZA 4EG6A 5LOVB 2Y0DA 3R41A 5BR8B 1WAMA 1X1SA 2D1FA 2PQMA 3JWPA 3SQLA 4DNTB 5EKIA 1UDXA 3BERA 3AM3A 4Q16A 1TC2A 2J85A 4S0XA 4H2DA 1HNXL 4XFJA 5FFFA 3TZQA 4CWAA 2AV6A 4KLNA 2NSDA 3CZ9A 1PLJA 1YACA 3VR6H 4F7WA 2Q9CA 1V16A 3ULJA 3DWPA 1OGJA 1YUMA 4B3IA 2HBZA 4TMWA 1U1EA 1A8QA 3BMQB 3IQIX 3TIXB 1EFHA 2E1PA 2PSFA 2IUTA 3MB5A 1WW8A 4KXYA 2K4KA 4HJ5A 2FOIA 1ZO8A 4C7MA 2F2TA 3IBYA 4CQLA 5L3VA 3GUHA 4N82A 4L8JA 5ELEA 1EZ8A 1B8PA 4IJMA 5CM2Z 3N8DA 1SCQA 2I66A 4A5OA 3R8XA 2K28A 5JZBA 5KJFA 1IW7D 2YMQA 4MWTA 3DEKA 2HFKA 1QQ5A 1AOXA 1DPFA 1SPXA 1ZA2A 2P2ZA 1T5XD 3GDEA 3BULA 3H9QA 3TOVA 3A74A 1KAMA 3CNLA 5D65A 1H5QA 3WBJA 1WKCA 3MD9A 3S99A 2JKZA 4ZZ1A 1F2TA 1TF2A 2XZOA 2WKQA 3JQDA 4HLUC 1MD2D 3E15A 4DZRA 3LM8A 2WSMA 4KR9A 2YVQA 4HZUA 2Y1FA 3U3KA 4G4IA 2F1JA 3N0TA 1I24A 3Q1KA 2UAGA 5DZSA 4IIFA 3Q41A 4H31A 3ZUPA 4IGAA 4A1FA 5CIYA 4MWDA 2PQ0A 5DYGA 2VJCA 1I6HB 1YNJD 1GN8A 3OSZA 4P22A 3ZYYX 1E2IA 3SC3A 3MCWA 5EUBA 3DO6A 3ND9A 5B1HA 2PUJA 4OHZA 3F71A 3X2EA 3A6LA 1Y3FE 1VMKA 2QLBA 3WWEA 5B1EA 3A7LA 1SVIA 3LUPA 5AHKA 1F60A 5JYBA 3FOZA 2QD2A 2GZAA 3NUQA 1HT3A 3L7LA 4MWOA 4RD0A 3TQFA 3OF3A 4G84A 2EZVA 1QZTA 2AFHB 4DLNA 1E1CA 4E2ZA 5BNWA 1GUNA 5LMUB 2Q5LA 3LZ6A 1TB4A 1MJHA 2QTHA 2WFAA 1OOEA 4NZMA 4XPIA 2C3MA 2I3GA 5IVDA 2O5IC 1OXBB 3D3RA 2OYSA 2KCCA 3A5UA 3VGJA 3H1EA 1K83H 5JEEA 3UA3A 1QGYA 1DKQA 1H1DA 3EY9A 2NV0A 2HRCA 1SZCA 2EFHB 3BTVA 3GH1A 3RI3A 2O48X 2LIPA 3GELA 5JALA 3MGGA 4C2UA 1I4WA 1F0KA 3HOYB 1FNBA 2ATXA 1MAUA 4PZPA 4FB4A 3SBOA 2P79A 3MVEA 4HXEB 1FTQA 4S1WA 1HR0L 4IF6A 4ZFNA 4K6OA 5FBVB 1UKEA 2CYBA 3VOSA 5KYWB 4JV5L 4XYLA 4DR6B 3C8HA 3IDQA 5L3ZA 3ZWXA 3RFVA 2HHJA 1XNRL 4N5IX 4ZI5A 2R6FA 3VOAA 2C7GA 5HFAA 2XMRA 3IP3A 3KKZA 4O4LA 1QHIA 1GPNA 1PP4A 1TJYA 1Y1KE 2JVKA 3H1TA 4FYHA 3JQAA 3JU3A 3K9QO 3UTDA 1VMIA 1A2UA 1R9TH 5DRTA 2Z4TA 3WBBA 4BNHA 4DWJA 3BJUA 3LQ2A 4M21A 1JQKA 3QITA 2R8XA 4IDPA 5IDYA 4ERXA 2WUVA 2HRDA 2WD9A 3L0SA 4YRQA 4EYEA 1RWBA 1JA0A 1QYVA 3D2BA 3RK1A 1U04A 4PHTA 1PL8A 1GNPA 2JI4A 4HGYA 5FBHA 4CL8A 4MRMB 1MO6A 4N3GA 1N36Q 1LLUA 1T0BA 1EFWA 1ZGZA 2C03A 1B15A 3EGVA 4GM0A 3SSOA 4HMIA 3DEJA 2KW5A 3ZWPA 5HW0A 1VSVA 2H2GA 1ECBA 2XSZA 4JU8A 4WMLA 4HKTA 1REQB 1EYCA 4LV6A 4JYCA 3ZWVA 1E5DA 4HSVA 4B1FA 4ZICA 4I99A 2W6CX 5K20A 4J1MA 1PFKA 4NEGA 4CKEA 4CFZA 4IX1A 4L0DA 3K94A 3F2DA 5JC8A 4RTPA 1ZA1A 3DZBA 3KKEA 3VYRB 3PXAA 2RC5A 3CZAA 4NEQA 4P4SB 3LCUA 4D81A 4A3KH 1IM5A 4MMXB 4N5NA 2FH5B 4IPTA 4P34A 2PUAA 1C3LA 4TLCA 1PN3A 1SXJB 2NSHA 1NLMA 4HXGA 4I6EA 2KQUA 2FWRA 4OP2A 4TXNA 5HZKA 1PXUA 3H4TA 2PG3A 4H4CA 4BYMA 4H27A 4R4QA 2FFKB 1G6ZA 2Z1NA 3P97A 5JQGA 4RQAA 4OKIA 4HNVA 3A9WA 4KE9A 4QUJA 3EWNA 4AKGA 4G5YA 4JH0A 4MS4B 3AZPA 4CM8B 3PBKA 1Z82A 3LC2O 1SRQA 5NULA 2GUWA 2HEIA 1K5DA 1WTXA 2SNIE 3EVAA 3CEMA 1XLTA 1UL1X 4LJLA 1ISGA 2ID7A 4H6XA 4MUGA 5FUQA 2AUKA 1VG0B 3NYRA 4Z7NB 3AVUA 3P2EA 4LF8B 1A76A 4QDZA 2UXCB 4ZQGA 4EGSA 2I7TA 4XWWA 1NBMD 2IXBA 2CMKA 3MUOA 3VV3A 1U31A 2VSYA 4CEHA 4MQLA 3AM4A 5M2QA 4B6OA 1QNKA 3GEHA 1W36C 4KIJA 2H5XA 4C07A 1HSOA 4GF5A 4RANA 1YU6A 1TQDA 2DAPA 4BZWA 4C4RA 1R0WA 2X13A 3DLHA 4Z4FA 4KN6A 1T1GA 3IAYA 2O2LD 1RTOA 1SMYC 2A74C 4UJ5A 4XSVA 4V0RA 4KITB 1R4QB 4EGAA 4TGLA 5ICGA 2BCOA 4AROA 1E2DA 5HM8A 4ND6A 3UXHA 4OAOA 4JK1C 1A9XA 2OB2A 3ZDBA 1FMFA 4G1UC 3ICPA 2KYRA 5FKJA 4JL6A 1R10A 3AVWA 4LMBA 4ZV9A 2ZJ5A 3O13A 3L43A 5JS1A 1EX1A 1ZUWA 4ZOCA 3OM8A 5B6PA 2GO7A 2O9JA 1ZNZA 4U9UA 3ZDQA 3AJEA 1J8FA 4M9CA 5C3EB 3TW4A 1AZLA 1U6JA 4FXDA 2CHEA 2BH2A 1LDNA 2JASA 3CY6A 3H2IA 4Q82A 3RYIA 2VH5R 5CH8A 4FYVA 3CZPA 4ARBA 2K01A 3EIEA 2X3UA 5ESRA 4ZUJA 3FDJA 1GU0A 5BR8L 3LRTA 4R16A 5DCLA 3Q8WA 3VSEA 2B7BA 1AKYA 3NV9A 1AGRA 1H2BA 1A5SB 2VH1A 2WWRA 3JQBA 4Q37A