4JBWA

Crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transport system permease protein MalF
publication title Carbon catabolite repression of the maltose transporter revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 78
structure length 370
sequence length 370
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4jbwA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jbwA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jbwA01
3TAUA 2GVAA 1I4DD 1NMYA 2WAQE 1RC8A 4R4IA 3PUZA 4R98A 4L4UA 4LF9Q 3SHFA 2VQSA 3PIRA 1B9MA 4JYAL 3EZFA 2BIFA 1A82A 4DDWA 3SDZA 2E2IH 2JJQA 2VW9A 1OYWA 2ZE8A 3QXXA 1NN5A 3H0KA 1G51A 2H17A 3FTQA 3KF6A 1Y8OB 3HR7A 4Y52H 4FCVA 4M1SA 5JWHA 2VP9A 2PMZE 4C3HH 1OXUA 4H13C 1WQ1R 1PUJA 3S1NH 4PPGA 2MFIA 1HNZQ 4DR6L 3J81k 421PA 4AG6A 4JLKA 4CVNA 2N1BA 4DV3L 4YMSA 2Z4SA 1A7JA 4FXPA 2ZQ5A 2QRNA 2R93G 1Z9FA 1KYIA 4DDVA 5JLJA 1SGWA 1N6LA 3A5ZB 2C35B 4BFTA 2IYSA 4FW9A 4LV5B 2O8FB 2KE5A 1TUEA 1YRBA 1DAEA 1DO0A 2PEZA 3S2DH 4YWLA 2VRWA 5D3QA 4CT4B 3R20A 2J7KA 3CPWA 4B3MQ 4ZI3A 4OQMA 1WFQA 5J3BA 121PA 4IFEA 3OIWA 2QORA 4BY7G 2QENA 2OXRA 1Z6TA 4B3TQ 2PZGA 1T6NA 2FWRA 3K0XA 3H84A 1ZKOA 4UPAA 2OEPA 5FOVA 3WRXC 5LMUL 4B73A 2AR7A 4BGDA 2Q0HA 4TMKA 5L3VA 2JJ2D 1ZUHA 3B1VA 3EX7C 3DM9B 1GITA 1IM2A 2D0PA 4LV6A 3W1GA 2A5JA 4JYAQ 2HF8A 2PJZA 1R5OA 4EQ6B 5JHGB 4DLSA 4Q5IA 1H9KA 2JA6G 5KDOA 1S96A 3M4PA 3A4MA 3W9YA 5JEDA 2R6AA 2A8VA 1IN7A 1QG2A 1R6BX 2QP3A 4JLAA 4PAOA 2OCBA 2H1LA 3I92A 3J7A5 1XEFA 3CP0A 1MJEA 1P3JA 4DR6Q 2JDID 2UXDL 5GAEC 2VTKA 3CRQA 3FMFA 3QPVA 3JZAA 4YDHB 3WRYC 5IE8A 3L7ZC 1UADA 3PCRB 4H02A 4DV3Q 4GKKL 3OAAA 3HOUH 5FI0B 2ZU6A 1BO6A 3CCLA 2J0QA 3AF4A 1UEIA 2YC2C 1OXVA 4LJ7A 3AV0B 5AJYA 4DNTB 1J8MF 4AYWA 5TB5A 1NJFA 3FE2A 1XD8A 4Q7MB 2W58A 2R92H 1UF9A 1O78A 2ASEA 3KLRA 221PA 2ZYWX 4P3YA 3SJCA 3QF4A 3MUFA 5FLXc 4JI4L 1KZGB 1JB1A 5K36G 5IP9G 4KVAA 4M1WA 1OIWA 3AVVA 3CF2A 4W9MC 2QEQA 3NG1A 3BU2A 5J4HA 4CF7A 4KLKA 4H9GA 2ONJA 4ESHA 1VQ9A 1E98A 1UKVY 2GJKA 1KXLA 3ZQ6A 2K14A 1KK2A 5LMUQ 1LB1B 1X3SA 2ZRMA 2VL6A 3MG9A 3QKUA 1NP6A 4RD4A 1IZ6A 2ZYUX 5JS8A 3ADBA 4PMWA 3GQBA 4FINA 4XH9B 3K1JA 1UE5A 2KENA 1Q3TA 5FBWB 5H1YA 4A93H 2WIBA 2A1AA 5FUVA 1HZAA 2IEZA 2WWYA 4TWZA 1SLJA 4OK3A 2FFAA 1UFQA 4BBRG 2RGAA 1P73A 1CKEA 1T0JB 4FMDB 4DSNA 5KU1A 1VQ4A 1FQJA 1KDOA 1FL9A 2ZR9A 3FVQA 1KO4A 2UXDQ 5CLQA 2QF7A 1HA3A 1XEXA 2ZM6L 4GKKQ 1CLUA 3LO5A 2JA9A 1D8TA 2FEOA 4UXHA 2ZR0A 2KBFA 4N1AA 4XSGA 3KF6B 3QJYA 2KWIA 4IKEA 5UKDA 1E1TA 2E76C 3K0AA 4IPGA 1II8A 1DAGA 1R5NA 4LYFA 5AWFC 4ALPA 4G5SA 2LMCB 2JA8H 4DCUA 4CEHA 1FNNA 4JI4Q 4B2PA 4FWIB 3SFZA 2SHKA 2VYFA 4XVUA 4ILEA 5JBQA 3CBQA 2FJUA 2GJAA 4BBSG 1P2VA 3KYHC 1RJ9A 2IF0A 1KSGA 3RC3A 2K7VA 4UNSA 4OHYA 3CLVA 5F9FA 1G17A 5HCNA 5FLMG 4AD8A 4C2UA 3KQUA 4Q9IA 3STBC 1VCOA 4QBGB 5J4LA 4GFDA 2C95A 4M1KA 3NELA 4P75A 2H16A 1KSJA 2HCBA 3T15A 3WNBA 1HYQA 1F2UA 2R93H 1VKJA 2PLFA 2WWHA 3KKMA 1GUTA 4URUR 3KQLA 3W8NA 1U94A 1E9RA 3HPQA 1Z3IX 1L4YA 2W2VA 4C0HA 1EFCA 4IFDG 3L8ZA 1N8RC 4LYAA 3PUVA 1EWIA 1Z06A 1DAFA 1WDTA 3T06B 4BUJA 1NN3A 5A0FA 4OI0A 4HEJA 3STBD 4N3NA 5GQOA 3B7GA 1DBSA 1JALA 2GNOA 2HJGA 4NPSA 2A7QA 4BY7H 3VR6A 3G6EA 4A3GH 1Q20A 3AVPA 2WV9A 2ATXA 3FDIA 3OAAD 1X6VA 2VP2A 1EIFA 3BAFA 4Q03A 5DN6A 3WHKA 3CCJA 2ZM6Q 4OX9L 1E9CA 1YHAA 3HWSA 4DWJA 4TZ0A 3L2PA 1KD1C 3U4VA 2ID0A 1Z0DA 4IOLA 3PXGA 1E24A 4KFSA 1B0UA 3UWOA 5C0XG 2BH8A 2XNSA 3K7AH 2OG2A 1N6IA 2YNMA 4PO9A 5G53C 1Z0KA 1LVGA 621PA 2FDCA 1L0WA 1CS4C 5C44G 1VYVA 3CF5A 5DGXA 2W0MA 3AVUA 4IRUB 1MIUA 1QZHA 4LHVA 2WIAA 2GJ8A 4MUBA 1TQ6A 2F7SA 4IFBA 2JA7G 2IBMA 2YOHA 4HJ5A 1B9NA 2RGCA 1VQFA 2P6RA 1ESMA 1G7CA 4IFDI 2IT1A 3BOSA 2XTNA 3U5ZB 2IC5A 4QGFA 4B6FA 1C9KA 3K81C 2WPDA 3V4RA 1PLLA 5CK4A 3QF4B 2X8AA 3PEUA 4L15A 1A2KC 2OCAA 4LBWA 4LJ4A 1A1VA 3FKIG 1ELOA 3CUEF 3RZDH 1PH2A 4D81A 4C0LA 5J5CA 1U0LA 5KSZA 2FPMA 3DM3A 2IYTA 5K36H 4B3RL 2MSCB 2IW3A 1E9BA 5FOWA 3I2ZA 2RHDA 3TRZA 4OWXB 1Z6HA 3C41J 4ME3A 4JSTA 4D2IA 4X62L 4K0KL 1VQOA 3IKJA 2NZJA 3Q8DA 2HIVA 4OX9Q 2NGRA 2NVQH 3G5UA 3WP0A 3ZDQA 3AM1A 2H57A 1QHNA 3HOWH 5C3EG 1H9JA 4DHEA 4HAVA 4B3BA 1NBMA 4GS3A 1E7ZA 3EC2A 1AM4D 2GJ9A 5CDFA 1G20E 2NO7A 4LHZA 4MKIA 4Q4JA 1GG2A 1XEXB 2BDOA 2GCPA 4IQZA 1V1QA 1G4AE 3T34A 2O8DA 3LX5A 2VHTA 4BBRH 2QROA 5FTKA 2EWVA 3P27A 1K6MA 3ZYCA 2ZE5A 1K8RA 2VH5R 3J80c 3K0AB 1N6OA 2LXJA 1OTCA 1Z29A 5IT9c 2GZDA 4LF5L 4ZDWA 2RCNA 6Q21A 4CZ2A 1PFSA 3IGFA 4CEHB 4MRRA 2ZITA 3L43A 1UPTA 3RS5A 1P2SA 3CONA 1OF1A 3EW9A 4MTNA 4KHPL 1D9XA 1FUKA 2QSYA 2V1CC 2UUAL 1E2EA 4LOAA 4F4JA 5JI3E 4C0BA 1W46A 1E32A 2BMEA 1QHIA 4B3RQ 2PBRA 3T56B 2FXQA 2Y0SE 3AEVA 1ZNXA 4QC2A 1P60A 4X64L 1NVVR 1DXMA 5M5XH 4X62Q 1F2UB 4WZAE 3UATA 4P32A 3RSOA 4K0KQ 2IF2A 3C14C 4R1JA 2CCJA 2EFCB 4TSFA 4NCNA 4UXJA 3KJHA 1I2MA 4O3MA 1WRBA 2OILA 4A82A 1E0SA 4L5RC 1KKLA 1OW3B 3IQXA 1LTLA 1VQKA 2ZE6A 4TTPA 3Q7PA 3LH5A 5EE1A 5JJIA 4TTRA 4E03A 4I99A 4IFDH 1ODFA 4JBYA 2I3BA 4GLXA 1NMXA 1Y1VH 3NXSA 1Y1WG 5HGQA 1V9PA 2EW1A 2HUPA 1XPUA 3RZOH 3MEFA 4LBYA 3EC1A 1YHNA 3TZUA 1DPFA 3ZVLA 2WPDD 4QKQA 2I5LX 1WCV1 1NVXQ 2NIPA 3DMNA 3QI2A 3IPYA 1CTQA 3EBEA 1CJKC 4QOSA 3QUSA 4LF5Q 1OH5A 2YJTD 1US8A 1SVWA 3J7ZC 1HEIA 2G1KA 3DPUA 4QM6A 3JC66 4F92B 1YR7A 1C9OA 1N34L 3FPAA 1UEBA 4W7SA 2IXEA 4L8GA 5K8IA 2Q8IB 2WB1G 4W5JA 3L82B 3RS2A 4KHPQ 1DG1G 4F93B 5K8LA 2UUAQ 3EPKA 2PEYA 3QIAA 1PA6A 2JATA 1OFTA 2OCPA 4WAUA 1ZP6A 2PL3A 4V0NA 4CRWB 1EFRA 1Q44A 1R7RA 2GTPA 4X64Q 2IYYA 2NN6G 2RGEA 4S2EA 4Z54A 1X3GA 3G48A 4EPVA 2GZHA 1DG3A 1N25A 3AGQA 1QZGA 1KI7A 2ZJZA 4ON9A 3ICQB 1E79A 1NBMD 3BORA 1SHKA 1LF0A 4BFXA 2MMGA 4UP7A 5EZ5A 2QGZA 4JLMA 3UXMA 3FKIH 2QU8A 2B63G 4KLZA 3BE4A 1MV5A 1S2MA 4UP9A 2WM9B 4D6PA 1JQJC 2D2CC 3FHOA 4GOKA 2CWAA 3VTKA 5J4VA 1S9DA 2ZJ2A 1D6JA 5M3MG 4O2DA 4NONA 2BBWA 2JLUA 4NMMA 4IO9A 3NVAA 5FL3A 4LF4L 3TGPA 4BXXG 3KKNA 3LXRA 3NWJA 3DL0A 4OI1A 3RYTC 1G4UR 3CXCA 1S40A 2DPXA 2OE2A 4JVSB 2FEMA 2NO1A 3NC1C 4HLQB 1N34Q 2NOAA 2ZYVX 4Q4JB 5D3MA 5DYIA 2QMOA 1X65A 2VSOA 3VKWA 5C3EH 3FPPA 2HDNB 2O8DB 1YVCA 5IYDG 2ZUCA 1HNWL 1H8HA 3LQRA 3SC3A 3GLHA 5LMNW 1QHGA 3UMSA 4EPWA 5M04A 1N0VC 4LYJA 1XTRA 3TSZA 2OT3B 1Z83A 2BC9A 3FB4A 4TN1A 1IN8A 1ZU5A 1EQQA 4TSFD 1ANKA 3N5CA 1AK2A 4LJAA 4P4UA 3TNFA 2QPTA 3M3YH 3CCRA 4E5UA 4JI0L 1E2IA 5JMTA 2FA9A 1WI5A 2D5DA 2A2ZA 3SFVA 1W0KA 2CW0C 2K5HA 4AKGA 1SQ5A 4ZKDA 2RKOA 1HQYE 2ODNA 3AF1A 3IUYA 2DUDA 1W2BA 1LACA 1A62A 2IS2A 1W2GA 5JJKA 1IN6A 4GT1A 4PZ8A 4V0ME 4LI0A 2ZAMA 3B6EA 1GM5A 4JLNA 4XJXA 2OWOA 2WWIA 2F1JA 2W2TA 4KHZA 1H65A 3HYTA 4BA2I 1L4UA 1YZTA 3BFKA 2ZPTX 3GLGE 2EDGA 2MSDB 4BLOA 3S1QH 4LF4Q 3WMGA 4NYIR 3O8CA 2C8VA 2PLRA 3BH7A 3OW7A 2JLZA 2AKYA 3AQQA 2QQ0A 3GTLH 1KMHA 3I62A 4IOJA 4MZ9A 4DLVA 3IPXA 2ZRFA 4IJHA 1CU1A 2H5EA 4B3DA 4C0QC 1IQPA 3L0PA 3K9HA 4PC3A 3DOEA 3CO5A 1HNWQ 1TF5A 1PV4A 4IOKA 2C9YA 1EFRD 4GOJA 4KN4C 1GILA 4KI0A 5C4MA 3I73A 4QXAA 3IO3A 4RD3A 5DO9A 1US8B 5JRJA 3TQFA 4BLTA 3U6BA 1ZUIA 3H2YA 1TWGH 4PSKA 1EX7A 1E79D 4G5GA 3D3QA 4HDQB 1QHYA 1M1YE 5GADC 3H0GH 2QN6A 2QA5A 1T8UA 2YVUA 1PH3A 2ZS8A 1AZSC 5DHAA 1UWVA 4XIGS 3T35A 2IYQA 2CK3A 2B7CA 3GTJH 4XTRA 1DELA 4LJ8A 1GAJA 1SZPA 1CIPA 1ZM7A 2WSSA 3A4LA 4CT5A 4A3EG 4DXAA 1E2FA 1MT0A 3EXAA 3RABA 4JCVE 1NVWQ 3VQTA 4LUZA 3ZGXA 5AUQA 1WOCA 2MQHA 1NKTA 4IVPA 4JBJA 1VG8A 2ZRKA 4V0OA 2JA5H 3F2CA 2VA8A 3O8BA 4LGMA 1GD7A 4D0GA 1A2BA 1ZNWA 3K70C 3ULPA 5AJXA 2VIIA 2ZI7A 3IEUA 5JEAG 1YNXA 3K0CA 3Q3JB 2UZ3A 2EQBA 1GHJA 4A3JH 1E69A 1NBME 2F9MA 2CE7A 2ZRDA 4GNXA 4G7HC 2I1VB 5FUXA 3TRFA 5CDFE 3CR7A 1H9RA 1IN4A 4MRNA 1T9HA 2BA0A 1FMLA 1VTKA 3S15H 4D4MA 3GTMH 1H8HD 1K83H 2P67A 4GZLA 2A6HC 4NKRA 1OXXK 3K70D 1DO2A 1D2MA 2W83A 1BBWA 4IXNA 4NCKA 4D82A 4DV5L 5AJWA 4BQSA 2WOJA 4KVGA 1QG4A 4NL4H 2ZUBA 5M3MH 1TWCH 4LUOA 2J45A 2KBEA 1G7SA 1N9WA 3E9IA 1ZM2A 4APVA 1S1CA 4RG1A 1W0KD 2BH2A 5D3MB 2A6HD 5EQTA 4ERNA 4JZKA 4BXXH 2VZAA 4HAXA 5KPDA 1M34E 1KI6A 2YHSA 3IHLA 3KKQA 2NTYC 3GLHB 1P4SA 1GUAA 1YKSA 4CIDA 3TVDA 3LVQE 4KITB 4A1FA 3K70B 2WHXA 3S14H 3A74A 1MOZA 3TSOA 1M8PA 1UBEA 2KCTA 2C77A 4BWYA 3TJZA 4JBWA 2ES2A 4A2WA 3ZS9A 5JS7A 3T1QA 1D5CA 2JLRA 1YZ6A 1VG0B 1UKEA 1PYSB 4DR1L 4HJAA 4PC7A 4A6XA 3FMPB 1V5WA 1JJ2A 1NN0A 2GXSA 2IHYA 5C1BA 4L9SA 3ADKA 2JJ1A 5JFGA 2NQ2C 5IP7G 1Z0JA 1V43A 1R2QA 1G3RA 1JMCA 2EJMA 1G3QA 4JVNA 5HZKA 3LGJA 4QNMA 4NHOA 1HE1C 5E7IA 2K4KA 2BKUA 2D74A 2NZ8A 1X6OA 4KCGA 4DAYB 1OB2A 2E74C 3I4MH 1JPNA 1KJWA 1SVMA 1W4BA 2HCJB 2CL6X 1CRQA 4DV5Q 2MNAA 3PIOA 2ZRGA 3AKYA 3OESA 4FMDF 4PC2A 1FZQA 4QGAA 1CJVC 5A4JA 4NDZA 1YU9A 5G40A 3TIFA 2UZIR 3NC0C 4GZYC 1KMHB 3TR0A 4PQFA 2DWOA 2IUTA 2CK3D 4P33A 3ZZTA 2R9VA 3A6PC 4GOXA 4PO1A 1KAWA 1G6OA 3B60A 4LV8B 4X8MA 2GESA 1YHQA 2WJHA 1FMJA 2WSSD 3E9HA 3CB4A 3K0CC 2X77A 1X55A 2JLYA 2FSIA 3UDGA 2OTJA 1ZRHA 2GRJA 4GNXC 2KCCA 5SZIA 1H9SA 4JI5Q 4MQBA 5IT5A 3GPLA 1E9DA 3TEHB 1YBYA 4A3BH 2OBLA 3IDQA 3MFYA 1GIAA 3S17H 1K5DA 1I94L 1IBRA 4DR1Q 4G0NA 4V02A 4AQYL 1E2LA 1SFOH 4ABYA 4ACAA 1SROA 3L0SA 4A2QA 5BW8A 1KO1A 4HATA 4QHSA 1BIFA 2LWIA 4OWTB 4QL5A 1Z63A 3W8RA 3GJ3A 4QGUA 2KHJA 3AF2A 2L5TA 1R10A 3MWKA 4K81B 3TR5A 1E4VA 3KDFA 3CCMA 1ZNZA 1VQHA 2ZROA 5C2JB 1K9MC 4B43A 5E7MA 2IYUA 4GNXB 3QBTA 1TU2B 1G18A 3JVUA 1R9TH 2A9KA 4KLNA 4NYJR 2BMDA 3SYNA 2G83A 4B33A 2JLSA 4GNKA 2XTIA 4IXMA 4DEYA 3JAMc 3IEVA 3RC8A 2P2LA 2ZI4A 2IYRA 3GLHE 2J7PA 4JIMA 2D2EA 1EFUA 2N49A 2FFHA 1R8SA 5B2ZA 4A9AA 1M74A 2BDTA 2YOGA 1IBML 2CLDX 2QMUA 2WAXA 1B7YB 2RF4A 5DH9A 4PV1C 3WXMA 1XNQL 2C96A 2F1HA 3D0FA 2QM8A 2C98A 1I94Q 1K0RA 1VDZA 3I4OA 3KX2A 3GLGB 2ZRJA 2Q2HA 1FX0A 1XTQA 4XD7A 4AQYQ 5JEEA 3MCAA 1XJ0A 3SR0A 2E75C 2ZJPA 2MO0A 2J46A 4BEBA 4C7OA 5M5YH 1MO4A 3QXHA 4TYQA 3BG3A 3K7UC 3CH4B 3A5UA 4DJTA 3HKZE 4JT2A 4M9SA 2VUMH 4Q1FA 1YZQA 2DBYA 3W5IA 2GXUA 4NB3A 4M4SA 4X66L 4LWZA 3HYRA 4YLGA 3HOUG 1N32L 1OLOA 3PEYA 3KJGA 4WZBE 4R4OA 1YEZA 2ZT9C 1VQMA 2QMHA 2OBMA 3K9NA 1HZCA 3QPWA 3SS8A 1HZ9A 4YCVA 2B8WA 2V6IA 3CPFA 3WDNA 2R92G 1Q7YC 1KY3A 2HF9A 2REBA 3CNLA 4LFAL 4TQAA 2F52A 2UXBL 1C0AA 3KTAA 2DWQA 2KB0A 5J47A 5IP7H 5HE9A 2YV5A 1SULA 2P65A 5KHOC 2R7FA 4AURA 2B8GA 5H1SE 1NI3A 3G82C 3D4RA 3HP1A 4TZ6A 2B3GA 4F4CA 4NU0A 1HY3A 5FR2A 2R8RA 1IBMQ 1G7RA 1U8ZA 2H8KA 2QM7A 1XJVA 1XNQQ 1N6RA 2NO6A 4FD2A 2XNDA 1Y8PB 1U98A 2NZOA 2BM0A 3QKRA 4DLXA 1WJJA 3DZ8A 3RAPR 1SMXA 3U7HB 1TKWB 1KRTA 5C46F 4LUCA 4BPBA 1E2DA 4DR4L 1P61B 3A8IE 1H9SB 1RRPA 4B3ML 1XPRA 1BYUA 3K9LA 1CFMA 2W2XA 4WZ6A 5DIFA 1KDTA 2NPFA 4YMUA 2IXGA 4HLUA 4RD6A 1PHJA 2PNHA 1MKYA 4NBSA 4JI7L 2A69C 3NHBA 4DVGA 3KKOA 3M1IA 2WSMA 3KXLA 4DRZA 2DY1A 2HLDA 4G1UC 4X66Q 2LKCA 4QHYA 1JR3A 1Q81C 2K75A 2ZTEA 1N32Q 1CR4A 4PSVA 2O8EA 1TADA 2BA1A 2UXCL 1G9XA 1CEEA 5IY0A 1LNZA 2WFWA 4DZZA 3C15C 4TLDA 2RB4A 4EKDA 5JECA 2A69D 2JA8G 4C0KA 4LFAQ 2ZVPX 3DKPA 5B64A 3HR8A 3PEWA 4A3LH 4B3GA 2J7PD 2UXBQ 4X65L 1GTVA 1X8KA 2CLSA 2WWXA 4DT1A 4TL7A 2V4DA 1SXJA 4BLRA 4X6AH 2GXAA 3KDFB 3OW2A 3GMTA 2CWPA 4MH0R 4A92A 4F38A 2DB3A 2OTLA 3A8KE 1YHBA 1PH7A 1G64A 2DFLA 2GWHA 4Z8YA 2J9RA 1UBGA 2ATVA 2W0SA 2OQKA 5M5WH 1O3YA 3SHWA 4PC1A 1W5SA 2VQEL 1IL2A 1W5TA 1H9MA 1G21E 4JJKA 2GETA 3A7AB 2YC4C 2ECKA 2UKDA 4OL0A 4XD7D 4OHXA 5CM8B 2NVYH 1NE3A 1EIYB 1E0KA 1XD2B 1RZ3A 5DI9A 4OK5A 2QTHA 2GAOA 3EZ6A 5EUQB 3ERSX 2IX1A 4DR4Q 4AC9A 4OXPA 4JL6A 1QHXA 2IL1A 1S3SA 1N6PA 1Q86C 1UM8A 3Q5DA 5JI2E 3CRLC 1KMQA 3IQWA 4A3GG 2OLJA 4JI7Q 3MSXA 2ZSDA 4YDSA 2HHHL 2ODBA 4ZCMA 2EVBA 3BIFA 5BYKA 3KJOA 1CTMA 1FX0B 3UDIA 3X1ZA 1W1WA 3RS4A 2UXCQ 4PG3A 3P4YA 5GJVC 3TLXA 4G5RA 5A35A 1QHHB 4C7OB 2F3TA 3X1DA 2XX3A 2N8NA 2HXYA 3S1MH 4D0LB 3GTPH 3OIYA 3VFDA 1VECA 1U0HC 4AWXA 4ITRC 4X65Q 1X3FA 4HIMA 1TEVA 3U7FB 3FKSA 5L3SA 1N2CE 2PNRC 5EXPA 4MITA 1N6NA 4PANA 1P62B 2AUKA 4A6PA 4HLUC 3KDSE 2XNDD 1G8GA 1QF9A 4RCZA 1S3OA 2V6JA 4OYHA 2VQEQ 4PSAA 3L0IB 1ZUNB 3TH5A 3KTAB 3CNOA 3QG1A 1LFDB 3UMFA 4QRHA 1WA5A 1NL3A 2CCKA 5IWAL 4ZV4A 1LV7A 1N0WA 1BOFA 3ND9A 2PCFB 3M4YA 2WB1E 4EQ5A 1S72A 2HLDD 4JL8A 5AUPB 4Q00A 1Q1ZA 1VQEA 1VQ8A 1SXJC 3D8BA 3QKRB 2ZE7A 2E8GA 5IDVA 2HHHQ 3LY5A 4QM7A 2AD5A 3HOYG 3HOWG 2B92A 2IK8A 1FVIA 1RE0A 2DN8A 2X19A 3U9SA 1BMFA 3M7NA 1CKOA 2VLIA 3NEYA 3VHLB 3ASZA 1SXJD 4Q7JB 3TBKA 1EWRA 3W3ZB 3CMEA 3FHWA 1E22A 3MWLA 1XEWX 4OBEA 2D4HA 4ACBA 2Z6KA 2O8EB 2QGQA 2Q3MA 4MGIR 5FPHA 3IIMA 1ZBDA 4IDPA 4TLEA 3AVTA 2WAYA 2Q2TA 2AK3A 2ZI5A 2DNEA 5FPSA 3AFPA 3H3VI 4C2MH 1FTNA 1CSPA 1AH9A 4B74A 5LD2B 2AK2A 3LVRE 3E1SA 4WJ4A 4KFRA 2H7VA 4DT1B 4PHTA 2CBZA 3FFAA 1SXJB 5KSOA 2VHQA 4G7OC 1QJOA 2GAAA 3H86A 1TU3A 2WWWA 5IWAQ 4IW3B 4C30A 1L2FA 1M6NA 3RS7A 1OJLA 5H68A 4Y7NH 1E2QA 4NTZA 4MGZR 4GMXA 4RSGA 1JJGA 3KB2A 1E3PA 4HZUA 4U00A 3K8YA 5FL7A 4KFUA 3GTQH 5KDLA 4EPYA 5FH9A 3EASA 2XZLA 3WYFA 3CKLA 3NKVA 4QBIA 4HJ8A 4Q4HA 1ZIOA 3LX8A 2HQLA 3VHXA 1OKKA 3A4NA 3RRYA 3FYHA 3VX3A 1CR0A 5LBIA 5JZVA 3NBXX 3A7LA 3GO5A 3EPLA 4N0EA 3AYHB 1A6XA 2O0HA 3AVXA 1VQDA 1SVSA 1UEJA 4TTQA 4MDEA 4KN7C 3HKZG 3FKSD 3FKQA 4DLWA 3ZQJA 4RZXA 3ND8A 4OQXA 1Y1VG 1A4RA 2J87A 4P4TA 1NJIC 3EIQA 5C4GB 3WYGA 1KRSA 3R9WA 1G3UA 1J99A 4A0FA 2XITA 4BRUA 3F0TA 1XMIA 1VQJA 1CR2A 5KOYA 2BM1A 3WNCA 1IW7C 1KIXA 1IN5A 4B3FX 3ZIAA 4K8OA 4U5XA 2CVFA 3AQ4A 4F91B 2JIZA 1IXRA 5CYOA 4OQLA 3U2QA 2FH5B 4DKAC 2WWFA 3R8FA 2JA1A 3A1UA 1A5TA 3ER0A 3I8SA 4MRPA 1J8YF 3B5JA 5L3SB 4WXPA 2Q3FA 2RGBA 3W5JA 1YJ9A 1E2HA 2RH5A 1KAOA 4DCSA 5LMNQ 1IXZA 1HT2E 1X1RA 1VIYA 3G71A 4PC6A 3TS0A 1OXSC 3TS2A 2CLCX 4HIOA 1U8YA 4HB3A 2C78A 2MMCA 4A0RA 2C5LA 2CJWA 3GEHA 1E2ZA 1RRFA 1ZAKA 2AFIE 2Z6KC 2JLXA 2HJVA 2ZJ5A 1FW6A 1HZBA 1FYCA 4JL5A 2WMNB 2R7DA 1I50H 3CF6R 3REFA 4JC0A 1AGRA 1I2DA 2A5GA 1BMFD 2QQEA 4G5OA 3B6YA 2UUBL 1Q22A 3M9BA 3NTUA 5BQ5A 1Q12A 5AJVB 1XF9A 1Z6YA 4OKSA 2DNCA 3OPOA 1WB9A 2J0UA 4MNOA 2CDNA 3B9PA 3H3VH 3ZVRA 2ZSBA 4CDGA 3CWZA 3ONWA 4BLPA 4D4KA 5CITA 2XEXA 1GZSA 2B6HA 1B8AA 3IBGA 1JR3E 3LWNA 4QNRA 3B9QA 3AVQA 3UE0A 3NBZC 1CKMA 1NVVQ 4ZO4A 1S0UA 4RZUA 1GNRA 1SKQA 4IEIA 3EARA 3RRNA 4KFTA 3WMFA 4AI6A 3BD9A 1J2JA 2VY3A 1KK3A 4KXFB 3HOYH 4J0QA 2ZS7A 4P0TA 2Q3HA 2N78A 1K5GA 4HUTA 1XMJA 1SXJE 3NE5B 2LXKA 4DNIA 1HNXL 3C5HA 3I5YA 4FCWA 3T1OA 3SZRA 2UU9L 3KL4A 3OIVA 3CPEA 3Q72A 3UIEA 1JAIA 4MYCA 5FL7D 4PPNA 3C16C 4TVAB 1XTSA 5GJCA 2IYWA 3NHAA 4HB4A 5GVRA 4A0HA 3UE1A 3J81i 4NYMQ 2C9CA 2ORWA 2ANBA 5EP1A 4LF7L 1OKKD 1E94E 4PZLA 4V0MA 2NMVA 4LPKA 1E2VA 3S2HH 5LB2A 1HJPA 3WBJA 3QKSA 1L7VC 3BH0A 1GRNA 2OV2A 2C2HA 2UUBQ 2F1MA 1OV4A 1QVRA 3M6AA 4JLDA 1EXMA 1O7IA 1IXRC 4UXIA 5G3YA 4HAZA 1HTPA 1VMAA 1AS2A 4HDOB 1GNPA 4HZUB 2ORVA 5CIQA 3G0HA 1ONBA 4AKEA 3NDPA 2ZVQX 1R8QA 1RVDA 1ZM9A 3UDFA 4AYXA 3WWVA 4Q4HB 4LZZA 1DEKA 2K32A 3CAMA 1JPJA 4NCIA 4NH0A 3VX4A 3I55A 4B34A 2GVDC 3AH8A 4M22A 3ZIAD 2QL6A 4Q1CA 2JIZD 3U7EB 2BKEA 3CF0A 4HJ7A 5P21A 1FL0A 3NH6A 1ZNYA 2OBNA 1ZIPA 1P7CA 1FQKA 3AP3A 2ZRAA 4QL3A 1AE3A 4A4IA 3PO2H 1NY5A 3WMEA 4B48A 1GOTA 4TMTA 5ELNA 1V8QA 1HNXQ 2A19A 1VQGA 3KJEA 4FMCB 1TXYA 2UU9Q 3CCEA 2K52A 4XVQA 2PJRA 1G5TA 2Z0SA 3LQQA 3EQLC 1A0IA 3M4QA 2C03A 2FFBA 4TL8A 5FBLB 4BY1H 3ZH9B 4B6EA 1NLFA 3U60B 4L5BA 1YITA 4LF7Q 1KZ7B 1YR9A 3H0GG 2Q9AA 5JJLA 2YKGA 3L0OA 1FUUA 4WVFA 3D31A 2YTXA 1Z22A 3FFBA 3LA6A 3TE6A 1F6BA 3T5GA 4AKHA 1SRUA 3KFXA 1UE6A 1RYHA 3VR4A 4LUVA 4LF6L 4GLVB 2BBSA 4BZXA 4HIKA 1AA9A 2CJWB 2PMKA 1LABA 2P5SA 2V3CC 1KDRA 1Y3AA 2WMOB 4KODA 5G3ZA 4JV5L 1KJZA 2JA5G 1AKYA 1IJFA 3E2IA 5EXXA 4URXR 1TWFH 1T3HA 2IYVA 3PGZA 1K73C 1J5EL 4HSEA 4B2IA 3E0EA 4O0AA 4IPHA 2WKRA 1E2WA 4A3JG 5CB6A 1KDPA 3KZ1E 2EJGC 3OTOL 4DDUA 1YNJC 5IK2A 2C99A 3C8UA 2J0UB 3CIOA 2H18A 2P6NA 3UPUA 3GJ7A 1XP8A 1GRRA 5DSZA 5A5GA 1K8OA 1KKMA 2ZJAA 4ZI2A 3SJZA 5SZJA 2WJVA 2JLWA 3QEJA 1R0XA 3B1WA 3I4NH 3PR1A 1XMQL 3GTOH 4MRVA 2ZTDA 2NZHA 3I5XA 2KSQA 2E2JH 4JBKA 2QSZA 4LJ6A 3WY9A 2D06A 2QAGA 4DLZA 4Q4AB 3ZD7A 4A3KH 3VR2A 3GD7A 1E9EA 1XMVA 1XX6A 2A5DA 1TF2A 3LW7A 1VQBA 1SVIA 3EIEA 3EPHA 4JBMA 1TU4A 3BC1A 4AG5A 2CKZB 4TYNA 1CKNA 1DD2A 1MABA 2KA7A 4LF6Q 3B1YA 2EXDA 2G0NA 3THXA 1UE7A 2JLQA 2NO0A 4JV5Q 4LK2A 1BS1A 4B2LA 3NBHB 1I3QH 5DLQC 4C0JA 4C0SA 4O25A 3QKSB 5CM9C 1J5EQ 4ZCLA 1Z2CA 2YWHA 4A3CH 1RPZA 2JJ8A 4LK1C 3F8TA 3OTOQ 3LFUA 3V9PA 1PH5A 4DBLC 3RLFA 3LBIA 1X8LA 4CEIA 4M8NE 1TQ2A 3OE7A 3I4MG 2X2FA 1VHLA 1DARA 3HPRA 1I4TD 4RCNA 1OSNA 4WBSA 4ASUA 5L3QA 2O5JC 4TYYA 5J4KA 5DI3A 2WBLC 3FWYA 4Q1EA 3BB1A 1XMQQ 2L0XA 4A3FG 4A76A 1P6XA 1W48A 2AFHE 3C4JA 3F1ZA 4EFNA 4DEXA 1HE8B 1W4RA 1T91A 2G6BA 1T0HB 2RGGA 2EIFA 2IYXA 5KTYA 1D7QA 4KMUC 1M7BA 1YNNC 2QG6A 4H0LC 1GWNA 1DAKA 2ONKA 3LNCA 4BE7B 4AIIA 4A3BG 1G19A 1N33L 1I6HH 2B8FA 2HT6A 4HUQA 4NZYA 4Q9HA 4DK1A 4KKUA 3PENA 1N36L 1UBCA 1OE0A 1VYTA 2QPOA 1FR3A 1BKDR 3PG5A 3ULLA 2IWRA 1QVCA 1P2TA 4TQ9A 5IK2D 4DIEA 5JHHB 3FP9A 1HR0W 1G16A 1XEWY 4L5TA 3B1XA 3H1TA 4OJQA 1FFHA 4BFVA 2CEAA 1N3BA 2FN4A 2QAGC 4YWKA 4EDHA 3IILA 3CCSA 1MO3A 2BOVA 2V7QA 3CX8A 2AWOA 1CBUA 3Q5EA 2FFQA 4POAA 2OLKA 4R4TA 3CC4A 3LRPA 1G6HA 1R0ZA 1I5FA 1X3EA 1Q57A 1Q90A 4WW0A 1CF4A 1XPOA 1IYUA 1XU4A 5SZHB 3EG5A 5HTKA 4B3XA 1PH6A 4QY7A 2FSHA 3U3RA 4HIDA 2J3EA 4WIAA 2GK7A 4TLAA 1Z2AA 3AVYA 4DV6L 3HU1A 4BZPA 1M1KC 4RFSA 2W6JA 4Y0VA 3BFVA 1DADA 4DR5L 5DHFA 5EE3A 2WICA 4QG7A 3OYYA 4R9UC 1ZD8A 4RCYA 3GFTA 4GN3B 3X1YA 2GN5A 4V03A 3W3AA 4U7DA 5KPJA 1U2RA 4UKDA 1SMYC 4WOPA 3QXCA 3H94A 3I72A 1XXHB 1NVUQ 1TL7C 2QAGB 3JZMA 4M1YA 1N33Q 3IRBA 1GNQA 2F3RA 2PMDA 3DXJC 4KBFA 1XB2A 1E0JA 1OFUX 1F3OA 3D6TB 1JEDA 1KK0A 1U90A 3DO6A 4P4SA 1N36Q 3ULJA 3HU3A 1K8MA 4LF8L 1PVOA 1Z47A 4L5SA 2HYDA 3LWUA 1WE2A 2R44A 3UK6A 1X1SA 4MDFA 1CKNB 3BGWA 1MABB 5AUNB 1TWAH 3MJRA 3V00A 3T1VA 2R6GA 1CR1A 4B76A 2QE7A 1AS0A 1G1MA 2A3RA 3CX7A 3OE7D 4MKFA 4MYTA 1CP2A 2VP4A 3AKDA 4LC0A 3THXB 2VUMG 4BFYA 2ZRHA 3BS4A 1E3MA 2WVJA 4ASUD 4JI5L 3N2EA 5DN6D 1DS6A 5HPYB 5JWRA 4OQNA 1QUQA 2QGNA 2X2EA 3FHTA 2AHOA 5GROA 2FGJA 2GCNA 1IBKL 1UKZA 4DUYL 1VS0A 3FMOB 4FN5A 1HPCA 1K3RA 4DV6Q 1OPXA 1Z0FA 5F2EA 5FPYA 4CYMA 4KSBA 3ADCA 3VNVA 1KL9A 3NEMA 4DR5Q 4R2IA 2V1UA 4CEIB 1HV8A 2P3SA 4DSTA 1W0JA 1VF5C 3EZ9A 4KV9A 5DLQE 4KKSA 5FPTA 3RN2A 5L3QB 5DI3B 2PQAA 1HH4A 4TYWA 1GKUB 1Z0IA 4TYPA 4DK3C 1GSIA 2G88A 5IRCD 3RANA 3P4XA 3Q9LA 2YINC 4DR7L 1XNJA 3CRMA 2O8CB 2BMFA 2B21A 2ERYA 2QAJA 1GUGA 1I4LD 2HT1A 2CL7X 2XOKA 4A3IH 2VHJA 3N70A 1TMKA 3DEFA 2GVBA 1G3MA 2FOLA 4A3FH 4LF8Q 4I1SA 1NY4A 1W36C 1M90C 1E0AA 5GAGC 1KK1A 2PH1A 4KKTA 2V7QD 3W6OA 1FNMA 3QVUA 1PJRA 4NYJQ 5BN5A 4RMFA 1ZCBA 2G9NA 4DSOA 3ZS8A 2IYZA 3DHWC 4M0LA 3T1TA 3H15A 2K5NA 2FV8A 4HUQB 4LNQA 2ZREA 2OAQ1 4BLSA 3L2OB 3CW2A 5FTMA 3BH6A 3BERA 1N6HA 4BRWA 2ZUDA 1Z6XA 4PHHA 5C0XJ 1KSHA 1UBFA 2WZQA 1ZINA 5F9HA 2W6JD 5DE3A 1DE0A 1E2GA 4C2TA 3KUCA 1IBKQ 1YZNA 4DUYQ 4JLVA 1ZC3A 3PFIA 4UNNA 1DTSA 3KXKA 4IDOA 3TUJC 5KSYA 1EGAA 2WJIA 4D80A 3GTKH 4L16A 3TVTA 4JSYA 2GEVA 4PZ6A 4KSCA 1VQ6A 4A3LG 2GJSA 4H1VA 4O2RA 5GJBA 1E1OA 1ZM3A 3ASYA 4PR0A 2E5LL 4OQFA 4TT3A 5TVKA 4DV1L 1X54A 2FU5C 3FMCA 2KBNA 5JCZA 2HV8A 4UQOA 1D2EA 1W36B 1IHUA 5JWOA 2C04A 3T12A 3P26A 3VR3A 1BVSA 2A5YB 5BN3A 2UVQA 3R7WA 4RFSB 4BFZA 4DR7Q 5CB8A 4MYHA 1KO5A 1VQAA 5IYBH 1XXHE 2Q9BA 3C5CA 4RZ2A 3VR5A 1G5PA 1GP2A 1W2HA 2WKQA 1XZPA 2XJ9A 4I81A 3TQCA 1OXTA 1WBDA 3HJNA 4DKXA 5FUYA 2FGKA 2ALYB 2GILA 2WOOA 2QE7D 1RW4A 4L5QA 4AH6A 2ZR7A 1TNDA 2BJWA 2Z43A 2PPBC 3CRRA 3EWAA 1JJVA 2IUSA 2OUKA 1T4GA 1XD2A 1ZJ6A 1QVAA 4LRWA 2Q2IA 4LFCQ 1UDWA 3E5HA 4LHXA 3VDYA 4RKFA 2R7ZH 2GBLA 2OZEA 3MAAC 3EIVA 3AF3A 3EA5A 4P4SB 3QBVA 5BWMA 1OH8A 4LJZC 4GP6A 1JE5A 5H8WA 1E9FA 2IXFA 2ZRPA 3UKDA 2OQ0A 3HOXG 4YWMA 1U9IA 1YZGA 2XB4A 5KNCA 4P71A 2IY5B 1AIPA 1SVOA 2NG1A 5TXGA 1BDOA 1VIAA 1ZYRC 4X8OA 4XSHA 2JQOA 1JXOA 1XBTA 5EAYA 2FPKA 1ZC4A 2JJ1D 1U81A 4C3IH 721PA 1W0JD 3P1JA 2CHQA 1KI2A 2H5XA 4BFUA 4ZDKA 4UNRA 2FNAA 2E5LQ 2C9OA 3DOFA 1QHHA 2ZRBA 4DV1Q 2XSZA 1P8LA 1QUQB 1P16A 4PX9A 2AHOB 4LW1A 4YQFA 1FOEB 1KQSA 1DAHA 3VNUA 1XCGB 2VNUD 1XTJA 1EQRA 2R6FA 2XOKD 4OK6A 1MO5A 4B75A 2VP0A 4AY2A 2GXQA 4BECA 5L3RA 1JJ7A 2QA4A 4AYBG 2Z5FA 3MJHA 3O8DA 2EU8A 3UG6A 4PQRA 2L15A 5DISB 1J6QA 2EYQA 4OHWA 3K0EA 3Q85A 2PQAB 4JYCA 4A3DH 1G8PA 1NMFA 1G8YA 4I7ZC 2GVZC 3U3KA 2ZRNA 4IPDA 1VHTA 1KO7A 1LM0A 2VF7A 1GL6A 3PO3G 1II0A 4TMZA 3UDXA 5FTJA 3R9XA 2QT0A 4EX5A 3TSWA 2DR3A 3WHLA 2Z4RA 1N5LA 2DFNA 4PZZA 5C18A 4X8LA 4PZYA 1SN8A 3NENA 2F4VQ 1Q3HA 1C4OA 2V4ZA 2V9PA 4PFSA 1Z0AA 4G01B 4BEJA 1VQ5A 3CZPA 3SGIA 1FP6A 4YHHL 2I4IA 4DK0A 3A1SA 4TT3D 5SZKB 3GFPA 1G291 3CWQA 4QBFA 4URYR 5KUTA 3THWA 2Z6VA 2A6EC 1Z5ZA 4JJZA 4PPFA 5L8VA 3E70C 1EK0A 2JASA 2IYLD 1II9A 2QRZA 2OFXA 1JJCB 3AFQA 2GK6A 4JI1L 3D7MA 1Q1EA 4DK6C 1FP7A 2EFDB 3BXZA 2QBYA 2GHIA 3MWJA 4H1UA 2CQOA 3GJ6A 5JRZA 2FZLA 3M85A 2GBLC 4G5QA 3BB4A 2DWPA 1S1MA 3LDAA 3GJ8A 4R71A 4ZDJA 4FIDA 3ZVNA 2NVTH 1IAQA 2A6ED 3OF5A 1U9IC 2OAP1 4NE2A 1GRQA 4LBVA 1K8GA 4EPXA 1MJCA 1IYJB 2B29A 2A30A 1G6PA 1KI9A 1RIPA 3R7WB 4Q1AA 2IA5A 1KI1A 5CIWA 1WF3A 1Q0UA 4LJYA 4R7ZA 1U5KA 3PITA 3KQKA 2ZJRA 3GJ5A 4IJMA 1N6KA 1R5BA 1ZU4A 4FMCF 3SU8A 1DGSA 4DCVA 5M3FH 2FMXA 2CE2X 2WKPA 3T53B 4DR3L 5ELOA 1E1QA 2E87A 3N2IA 4B44A 1YJWA 3PSIA 4CEJA 2D0OA 1CJTC 4UNQA 3VAAA 1IY2A 1SVKA 2WTUA 3K53A 5JSZA 2YOFA 3QY0A 1SE8A 3CC7A 3WNDA 2CHVA 3T1HL 4YHHQ 4LY6A 5GADl 3EN2A 3AF0A 2XSZD 4B3CA 2HYIC 3B13B 4JG2A 2QTVB 1EWQA 1TWHH 1GJXA 3PUWA 1T5LA 2I5HA 3F3YA 4B35A 1WP9A 2IHEA 4JI1Q 1XD9A 3QPUA 1B23P 3HOVH 1EESA 4D25A 1PLJA 3HOXH 3UG7A 3DM5A 1W4AA 4IHQA 4HB2A 1DAIA 3GJ0A 3KF8B 1DAMA 4DIDA 1IYVA 2IX3A 2ZAOA 4OO1I 4LX0A 4YC7A 1M7GA 1NKSA 1ZM4A 3VMFA 1UDXA 4FWTA 4Q01A 3SI7A 4Q7KA 1YJ5A 3SQWA 3A58B 4C3ZA 4O0MA 5AJZA 4XVRA 2CCZA 1OFIA 1Z08A 4M1MA 5FBQB 3LLMA 3DZDA 4LSGA 5TY0A 4JOIA 1P9RA 4GBMA 2AUJD 4S35A 4Y0AA 4DR3Q 2CXXA 2J0VA 4MKHA 1WBBA 2GCOA 3W1BA 3MXUA 2D7DA 3HGBA 1Y14B 2IHFA 1SKYB 2O5VA 3LV8A 2PZFA 3MMPA 4W5WA 4P72A 1NLZA 2QPAA 3T1HQ 1NJGA 1NMZA 1A63A 4FCTA 3LBHA 4URZR 2P0EA 5FUWA 2ZJBA 2CCGA 3QG5A 5AJ3L 4PTLA 4RD2A 1GKIA 4XWKA 5LD2C 1F2TA 3PO3H 1PMRA 1Z8FA 4XWOA 5KDDA 1JR3D 1NIPA 2JXMB 4J15A 2O0JA 4Z51A 1A8VA 3DMDA 2IHBA 4URWR 4ZKEA 2VSFA 2ODWA 1T8TA 1GO3E 2F43A 1R0WA 4PHGA 3V4FA 3KQHA 3THWB 1FPMA 4M9XA 2AXNA 3SJBA 4II7A 1HH2P 4POFA 3B8HA 1YZLA 1QHSA 1JR6A 5EE5B 2KHIA 1XJQA 1PYBA 1GDDA 4A36A 2QBYB 1ZCAA 1FJGL 1KHIA 1PH9A 1U0JA 1ZMXA 1AGPA 5HCIA 1E1RA 1D8LA 2QI9C 1RYFA 4XWAA 3K0SA 3GTGH 4BFSA 5CJPA 4JLJA 5FJ8H 1E1QD 2J0SA 3SQXA 3VU9A 3R8CA 4Q21A 3IIKA 3RRZA 5C4XH 2QUZA 4BZQA 2XZOA 3HU2A 4M1OA 1W7AA 1AJEA 4K46A 2J1LA 1ASZA 1E6CA 2GEUA 3BK7A 1GKYA 1U8AA 3U3OA 4C0AC 1E4YA 4QHTA 2KI5A 3CRKC 1F60A 1NIJA 1VQ7A 1N0UA 5LMNL 3WYAA 5DNYB 1T3SA 5ELXA 1LUZA 5JEAJ 5AJ3Q 1E2PA 4HJ9A 2AX4A 3RLOA 3A1TA 3KKPA 5TV2A 3SNHA 4CEJB 1D9ZA 2R6CA 1YR6A 4OO1H 5JSZB 2PCJA 2CVHA 1WYDA 2QP4A 4HAUA 4M53A 2ZSFA 1XJCA 2AN9A 1GVPA 4JOIC 5IYCH 1NTGA 4MGYR 3I3SR 3KOJA 2AD1A 4UJ3A 5F98A 3PO2G 3KUDA 4DLTA 4A8JA 5BXQC 1VYUA 1NLYA 1QVFA 2PX0A 3SOPA 5FI1B 3TUZC 4RY2A 1KIMA 4DB4A 3LW8A 1XDBA 1K8AC 2BBTA 3J80i 1FJGQ 3Q7QA 1XFAA 3CQZH 2OHFA 4BY1G 1SR3A 3TAHA 3ZD6A 3T61A 4LJ5A 3X1WA 4A3MG 2FZ4A 4Q9LA 3UWKA 3O8RA 2N46A 4NXNL 2WJGA 1TF7A 2ZTCA 1L2TA 2QNRA 2GF9A 2ZU0C 1J70A 3QEOA 4M9QA 2TMKA 4DSUA 1XTIA 1SKYE 4BA1I 4YCWA 2ZETA 3FHCB 1VCIA 2YWGA 3GCGA 4GKJL 3FMIA 2E9SA 4C9BA 4DC9A 5H70A 5LPNA 1Q1BA 1OB5A 1GUSA 1N5JA 5BR8L 4R4QA 2V8OA 1P72A 4KYUA 1IW7D 1AS3A 2OM2A 2F3IA 4GZMA 2I0QA 1YRAA 1PUIA 1HURA 1MR3F 2GCOB 1VCNA 3U4ZA 4DAMA 1DVRA 1GHKA 2EVWX 2ODEA 3MXNB 4U02A 1O87A 2IS6A 3U58A 1HR0L 2EWWA 2HXSA 2BVNA 3CD6A 1LF5A 1YQTA 4FMBB 2YWEA 3CPHA 2VHUA 3CR8A 2GF0A 4Q47A 4RFVA 4JKYA 5EE9A 5IHPA 2R62A 3ZJYA 5KSPA 2ZTSA 4GRAA 1F2TB 1XCPA 4RZ3A 1E1RD 2QEXA 1CULC 2ZRLA 1NN1A 5K8UA 4A2PA 4WJ3M 2Z83A 2JA6H 3I4NG 2ERXA 2V1XA 4HAWA 1TTTA 4EAQA 1XCMA 4TMWA 3SN6A 2F43B 4Q9JA 3K80C 1JXMA 1OT3A 2UUCL 5J40A 2GA8A 3B1ZA 4JMPA 2IS1A 4A3KG 2OCYC 4JI6L 1P2UA 3F5FA 4HB0A 4NXNQ 1PZNA 1YVDA 4MKGA 1OIXA 3KQNA 2ZS9A 4PQYA 2VO1A 4Q4AA 3PF4A 4IOAA 1TQDA 3LBNA 4GKJQ 1AN0A 3GDEA 4QJFA 4GPTA 4E09A 8OHMA 3I61A 4QJ4A 1QRAA 4A8JC 2AWNA 3FGNA 5BR8Q 3VU9B 1T3LA 1BYIA 1Z28A 3U50C 2Q2UA 1XTKA 3KFVA 1KTVA 2I5MX 5IP9H 1GFIA 3NBYC 4KJZA 4PPQA 1TEXA 2XGJA 5C0XI 1XMOL 2YU9H 4GI7A 2A5FA 1NNEA 1CRPA 2ZI6A 4TMXA 3L8YA 4RD1A 2ZXUA 2WAQG 1HR0Q 4A3CG 3PQCA 4QGGA 4HAYA 4YMWA 5B58C 3AP1A 1OHHA 2ZJYA 4GOPA 2PT7A 1E9SA 3IIJA 4JLBA 5AR1A 3CPJB 3ZZUA 4BASA 5AK0A 3OEEA 4JT4A 3HKSA 4EFMA 2GZAA 3T1YL 4BFWA 1NBWA 1CJMA 1Y69U 4JK1C 5BYJA 4TLBA 4UJ5A 3S1AA 3I32A 2ANCA 5ANRB 1TQ4A 3TW8B 1P75A 1UE1A 1IJEA 2FE4A 4G3XA 3A37A 3MRSA 5FPKA 4DV0L 3AKEA 2UUCQ 2E2HH 3CRW1 3IO5A 3CRVA 1QDEA 4NPHA 3I8XA 2LSSA 3PF5A 4JI6Q 1GL7A 3NEJA 2VSXA 1II8B 2OFWA 2VF8A 4X8HA 5TMPA 4GN4B 3PIPA 3RNUA 3MGCA 3GLIA 1RKBA 1VQPA 1YZUA 3F2DA 3OHMA 4H44C 2PCLA 1W36D 3AKCA 5C4JH 2YTVA 3REGA 4QGHA 2EJFC 3ZJYC 2ZM5A 1RJ9B 1EG7A 1KC8C 3QF7A 3B2EA 3ZVMA 3BB3A 2RAPA 2VP5A 4QBHA 2VP6A 5HY6A 3TREA 4DLUA 4B32A 4CGZA 1JEEA 1XMOQ 3RS0A 3A8TA 3K8AA 2XTZA 4A3MH 4BBSH 1KSFX 1LYLA 1PLKA 3DLLA 3U3MA 5FLMH 3WP1B 1W4CA 3B78A 2PZEA 1M2OB 1Z7TA 2HIXA 1RFLA 2EFHB 3F2BA 4DCTA 4TL9A 3RLNA 5FOXA 1OYYA 2ZJQA 3EAQA 2XXAA 4KYIB 2JEBI 3T1YQ 1W44A 1QVGA 2N3SA 2CMKA 1GVNB 3QE0A 3M4OH 5FTLA 1IXSB 5EP3A 3Q8XB 4G7ZC 1H8EA 3MWYW 1VQNA 1VG9B 2QT1A 4NYMR 4DV0Q 4PHFA 2RHSB 3THYA 5G41A 1VQCA 2XGTA 3LNNA 1XZQA 3BJUA 4D4JA 1UAAA 3AP2A 1TPZA 1CSQA 4JBXA 4ZCIA 1RRGA 2GDJA 2F55A 2B7BA 4GOPC 2Q9CA 5C0XH 3BFXA 4EPRA 4JI3L 3X1XA 3ADDA 2XZPA 4DLYA 4YMVA 3SJAA 2BWJA 1LS1A 4KU4A 1COWA 3W90A 4ARZA 3PV0A 5AUOB 5C44H 1JBKA 3OEHA 4Z1MA 3AVOA 1YE8A 2IX0A 1OIVA 1KI3A 4URVR 1IOZA 1ESNA 3GLFA 1ASYA 3SYKA 2WWGA 3BBPA 4L8JA 1J7KA 3KJPA 1OHHD 1XXHA 5F3WB 2JA7H 4R4CA 5HZHA 4PO8A 3RR5A 3A0JA 4POGA 2F9LA 3OFNA 1Y63A 1JECA 1ZVQA 3OEED 2ZI9A 4HZIA 1FTSA 4NYIQ 3PUXA 5EUMA 3J81c 2JK8A 1KAGA 1VG1A 2PI2A 2YTYA 4CW7A 1YR8A 3KLWA 3X2SA 1R4AA 5J4YA 1IY1A 1X86B 2OSBA 1NG9A 3S24A 4B3SL 2FSGA 1G41A 1S3GA 1QBKC 2G0TA 4KAXA 5E4FA 1VQLA 1N5IA 2JCSA 4DR2L 4LYHA 5TARA 3AUXA 1W47A 4GOPB 4GLAC 3CNNA 4UNPA 1NRJB 4JI8L 5LB4A 2ZYTX 3B82A 2EFEB 3KJIA 4OHZA 5FBVB 5K8TA 5FBRB 5KYKA 3U44A 3U7GA 1Q8KA 3KFUA 4TL6A 2GEDA 2QTFA 4GN5A 2J41A 4DCNA 4IEEA 3S1AB 2BE5C 3P20A 1L1OA 1XRJA 2VBCA 1UKYA 2NN6I 2K50A 4JI3Q 1KHTA 2QZ4A 3KXIA 2FX3A 4RVCA 5EP4A 4B47A 1JT8A 5E7NA 4A3IG 3U3JA 3UMRA 5HKKA 4DDTA 2Q21A 1CI3M 4EJSA 3M0EA 3EPJA 1IBLL 4IJLA 1RIFA 2V54A 2F6RA 2WP8J 4LC1A 2EQSA 1D2NA 1T5EA 2RHQB 3GLIB 2PT5A 2O8CA 2P5TB 2BE5D 4AYBE 4YXWA 1MRNA 1EOVA 1LY1A 1YI2A 2GKSA 4FDBA 2BCGY 2QY9A 2VQFL 5FOSA 3W6NA 4LBZA 1Q21A 2AXPA 2ZI3A 5EE0A 4IVQA 2RMKA 2VL7A 1G8HA 1VQIA 3NDBB 1KI8A 3RRMA 2R2AA 5E3HA 2ZRIA 4IDQA 1X8JA 4ZPXA 2G1JA 4JS0A 1HCZA 4DB2A 2YYZA 1CJUC 1H8ED 4B3SQ 3H4MA 3G4SA 3THOA 4DR2Q 1MKHA 2R6DA 1SHZA 1ZW6A 1KGDA 3GJ4A 1U99A 4IOCA 1IY0A 3K09A 4JI8Q 1GL9B 1NY6A 1C1YA 2K5UA 3EZ7A 4E07A 5B57C 3CC2A 3GP8A 4LJ9A 4JVLA 3B85A 1KNQA 2BV3A 1AKEA 1AQUA 1TUIA 2OFOA 2QP9X 2XXAB 5E95A 2NPIA 2ZEJA 3QENA 2VHCA 1JB7A 1COWD 3HFZB 4HLDA 3OEHD 2VEDA 4Z1MD 5IYBG 2O8BA 5DYGA 4Q1BA 2VPPA 1AZTA 3GEEA 3THYB 2D62A 4LFBL 4GP7A 2DFTA 4EUNA 1F48A 2RHMA 4Q1DA 2NVXH 3MD0A 1IBLQ 4TKOB 2F1IA 3MLEA 1Y1WH 4LHYA 3RDPA 3GLGA 3OFND 3CCUA 3BJIC 2YWFA 4MRSA 3BZKA 3QVVA 3RWOA 2REXB 3TKLA 4BLQA 1WCMG 4LPSA 2VQFQ 1VCMA 2H92A 2Z0MA 4JI0Q 1WXQA 5GVSA 4PAQA 2XJ4A 3SE0A 4NXML 4ARZB 2MO1A 3I7FA 1YZKA 1CUKA 2R7ZG 1E96A 2BCJQ 3CM0A 4M9ZA 3RWMB 4D4LA 3GLFB 1OH7A 1PH4A 1XNRL 3A1WA 2A78A 1MRSA 2G3YA 1NSFA 1XTDA 1L1OC 1EFHA 2REOA 3GFOA 4Q4LA 2O0KA 5CJ2A 1N5KA 2HEIA 1OH6A 1KO8A 1E2NA 2F1RA 3BWDD 2ZSAA 4NP6A 5EXSA 4M21A 2IUUA 2Q6TA 4EJSC 3BZCA 2KCMA 4ZIRA 5FFMA 4YY3L 1LS6A 2NN6H 2AL7A 3LLUA 1BH2A 4FI3C 1O7LA 3RSLA 5KNBA 3BRWD 4F7WA 4MYUA 4QQBX 1G7TA 2IS4A 3O47A 4IOMA 3QQ5A 4AKIA 1Q46A 1GUNA 4DNRB 1HT1E 3K0FA 4US0R 3NBFA 4JYBA 5HKKD 3SBEA 3DDCA 3RN5A 2VS1A 2B63H 2FPLA 1AE2A 1YIJA 5BN4A 3HOZG 3IBYA 4LFBQ 3OIUA 3DKVA 4TLCA 3U44B 2RGDA 2YZ2A 2XB2A 3JAMi 3BDOA 3PUYA 3GJXC 4YXWD 4DUGA 2JEAI 3QNUA 3AB9A 1GUOA 3GLIE 3T51B 4QFMA 1EUJA 4A3DG 1HUQA 3K09C 3J81j 1L1OB 4V0LA 3CX6A 3EA0A 1QZXA 4DV2L 2DCUA 4YONB 4NXMQ 4OHVA 4RD0A 3QSYA 4KBGA 4Q66C 3VA7A 5HE8A 4EJSB 1XMSA 2K33A 1XNRQ 2Y0SG 3UANA 3AB3A 4B71A 5IYDH 4W5HA 4JVMA 3AVWA 4Q02A 1R0YA 2CNWA 4KO8A 3U4QA 4DV7L 4OONA 3EWSA 4JKIA 4MA4A 4EIWA 4EPTA 4IFDJ 2ZJOA 2OCEA 4LHWA 2DHRA 1VF7A 2Y8EA 3VKHA 2ZSEA 1DCZA 3TMKA 3T5DA 4C4PA 4YY3Q 1S4QA 3CH5A 3S1RH 3CZQA 3OOCA 1CXZA 1E99A 3LAWA 1MH1A 3CCVA 2A68C 1ZYUA 4TMVA 5FOUA 1JNYA 3RS3A 4LFCL 3LXXA 3RHFA 4GMDA 4I1VA 2BEKA 3VR1A 2D2FA 3AGPA 4GDFA 3R9IA 1NF3A 2FSFA 4PZ7A 1SVLA 1TX4B 4C3JH 2A68D 3IHWA 1ZD1A 4AK9A 1Q1QA 1C7YA 4PAMA 4M1TA 3PCOB 4XTCS 2JAQA 3TUIC 4IPCA 4JI2L 4MUAA 3I1FA 1IONA 4NCHA 2O52A 2FF7A 1BKBA 4WXRA 2IWHA 3I4LA 4RJLA 4US1R 2O8BB 4DV2Q 1KY2A 2ASBA 4OI4A 4HLCA 3AUYA 3CMAA 2EYUA 2W6IA 2I1QA 2LCFA 1EFWA 5EZ6B 2JLVA 5M3FG 1EFTA 3GLFE 1Z6AA 4XOIA 4L9WA 3U6KA 1AQYA 5KO2A 1MO6A 3A1VA 2OXCA 1KJYA 3IFTA 1PH8A 3KB1A 1JAHA 4PXAA 4QJ3A 4DV7Q 3QXSA 1DOAA 1E2MA 5CYPA 4A15A 1E9AA 1G5RA 2DGYA 1KI4A 4N0DA 1Z07A 4GSYA 1ONLA 1NMGA 2PI2E 3JVVA 1WCMH 2RGXA 4UP8A 4YCUA 4QIWE 1G3IA 1JQLB 2QMEA 1HQCA 2BBOA 2WJJA 5B30A 3ICEA 1LW7A 3A8JE 1KNXA 3K9GA 2CHGA 3OZXA 1OFHA 1EX6A 3A36A 3PEVA 3HOVG 2RGNA 3ECCA 4Q19A 3NH9A 4A75A 4A3EH 4Q48A 2ZANA 4Q7LA 4DV4L 1HQMC 3HDTA 4DUGD 3RNLA 4LWCA 4ZIRB 2PX3A 2ZRCA 1F5NA 2F4VL 2JE6I 2BMJA 2CL0X 4GL2A 3AEZA 3LD9A 1T5IA 521PA 1H95A 2B8TA 2ORIA 3W6PA 4JI2Q 1HTWA 3K0FB 4HDCA 4DUZL 3TQYA 4WA7A 2R65A 5JEAH 3RVBA 5EXTA 3QKTA 4ZDIA 3U61B 1E2KA 1YJNA 5IF9A 2O8FA 4P73A 1Z6GA 2X1VA 2XTMA 2BJVA 1TAGA 2CNWD 2EFGA 4Z8XA 5EP2A 3VKGA 2ZIAA 1I6VC 1KOFA 2WJYA 1NSTA 2JGNA 3SEAA 1M7HA 4V0KA 3NIBA 2MSEB 3HOZH 2AKAB 3CW2C 4R2HA 4IDNA 4MGKR 4OWWB 3QOFA 4OJKA 1KI6B 2LKDA 4NCJA 2AKWB 2J59A 4HYYA 4P31A 2OO7A 1UJ2A 4RKEA 1J90A 5GJWC 1EYGA 3S16H 4OGQC 3W5OA 4YMTA 2K5VA 2DFKB 1P5ZB 1XWIA 4ESVA 1EWHA 3ETLA 1W3SA 1P9NA 4JLOA 2N42A 3WBKA 4EQ6A 4TQUS 2OESA 2O5IC 3U4QB 1E2JA 4I1UA 5FOTA 2G77B 2ZJ8A 4DPGA 2BHRA 2V55B 5FTNA 4A0GA 1S9HA 4EFLA 1RRCA 5E7JA 4DV4Q 3EZ2A 4I4LA 4M2LA 5LDDC 2BEJA 5GAHC 5HR5A 5CLLA 3N6RA 3FOZA 4E22A 1ZD9A 3ZLJA 1Q82C 2JEOA 1GKHA 4LF9L 4LCBA 4AIMA 4QJ5A 2JJ2A 3TK1A 5CK5A 3CCQA 4DUZQ 2W00A 2D7CA 4A4DA 2W6ID 1X9NA 2J5XA 3EIHA 1FGUA 5FJ8G 4IDHA 1LTQA 1Y8NB 4IVRA 3QXJA 1BBUA 4HI0E 1ETUA 3SBDA 1W49A 5JCPA 4A8JB 1HNZL 3W34A 5C4XG 4LDJA 3P32A 2P6UA 5TDHA 3SYLA 1S8FA 5FR1A 821PA 2RGNC 3PJRA 2DYKA 1B70B 4Q18A 1WMSA 2JDIA 4OI2A 4P74A 1L8QA 3PVSA 3TW4A 2D3WA 1G8FA 4Q9KA 1VPLA 2ATWA 3GEIA 3ZZ0A 4US2R 2E1RA 1RL2A 1P9WA 4DLRA 1JI0A 5KNDA 2AMCB 4A93G 4F4IA 4D26A 4JLPA 1NG1A 4I1OA 4HR7B 3C7KA 5EJEA 4D0NA 2CFMA 2IEYA 3I56A 4OO1G 1X56A 4B3TL 2NO9A 4AYTA 2KJQA 2FG5A 5IYCG 4UY8C 4O2LA 2XAUA 1PH1A 3DVLA
chains in the Genus database with same CATH superfamily
3VSDA 4PTZA 4K28A 5KKCA 3HZHA 4Y7DA 1OYWA 3P0HA 1VQ1A 1H93A 4AKSA 2QRNA 4K6MA 1KYIA 3WSWA 1SGWA 2HJWA 1M2EA 2XW6A 4FU0A 4EHJA 3IL8A 4KWCA 121PA 1FA9A 3RW9A 2OXRA 2FWRA 4JP5A 1GR0A 1JUDA 4F3CA 2CKMA 4NXMB 4BB9A 4LV6A 5EIBC 2DM6A 4OPMA 2JA6G 1XEFA 5LYYA 2BGLA 3JZAA 3L7ZC 2XUDA 4JWTA 4DV3Q 2J0QA 1WO8A 5KNDD 2Z1DA 3WGOA 3SJCA 2OGWA 4KVAA 5IP9G 4NICA 4W9MC 2AKEA 1SRQA 3BU2A 3WOHA 1E4EA 3QKUA 5A71A 1W1IA 2O2SA 2YMLA 2HY7A 1ATIA 1CKEA 4FMDB 1OROA 3DHQA 2NZWA 2OUIA 2KBFA 3ESBA 4L50A 5COAA 5IM5A 1X42A 4GX5A 4GIBA 4CTJA 4B2PA 3SFZA 1B26A 1L0BA 4B6PA 4BBSG 5FLMG 4PCVA 5TEWA 2PVPA 3UAOA 1XWEA 1TT5A 3QW2A 3L8HA 2DR0A 3L18A 4HQNA 4H7HA 2AV6A 1JALA 4NPSA 4WZAB 2WV9A 3OAAD 4KXNA 3T7JA 2XNSA 4PFQA 4U7JA 3SQMA 5HFNA 2O14A 1D6MA 4UFNA 4F46A 3W06A 1JG2A 4IIVA 4IZ6A 5H81A 1TXGA 1QYCA 4X7MA 1GCUA 2HWXA 3KVNA 4YRLA 4OXIA 2OCAA 3PXCX 4PPYA 1GPYA 3EN0A 3WKAA 3GIWA 1NW8A 1ADCA 2W4IA 5C7LO 5C3XA 2N75A 1ENAA 2HNAA 3U9OA 4XD2A 1XWWA 4N0PA 1V1QA 3ZOZA 3NHFA 4RJTA 1K6MA 5CB4B 4CM8A 1E6WA 3R6LA 4Z4HA 5CG1A 4LOAA 4F4JA 2J4CA 1GAXA 3BMOB 2Y0SE 3AEVA 1ZNXA 2FXIA 2FEKA 3O2QB 1M2NA 3EQ2A 1THZA 4ZAFA 1FFEA 5CH5A 1TIKA 1KKLA 2ZE6A 3CZCA 2D5IA 1ODFA 5EI5A 3QI2A 3QUSA 3NOOA 3A6LA 2F48A 3G5LA 1LQ2A 3PYLA 3TIVA 5DTIA 1YCGA 3WICA 4W7HA 4CHTB 4UCFA 3EQ9A 3VJKA 4WK6A 1DQNA 1QNFA 2EJBA 5JE8A 5JD4A 3EEFA 4I4IA 4BQIA 1OYVA 1S2MA 4MN3A 5CVCA 3O4HA 2AJBA 4NMMA 4I66A 4ZAGA 4IJQA 3K1YA 1ID8A 4JROA 1YS7A 3DFFA 1YE3A 5C3EH 1PL0A 5IYDG 2CHUA 3ZTWA 3NQIA 1SG9A 2PY6A 4JIGA 3ZD8A 2RC6A 3IT2A 4HXYA 3FTCA 2P4SA 4RLHA 3BHJA 5JMTA 4KN5A 3G2OA 3C5WP 1PR5A 2K5HA 1HQYE 4C56C 2CSUA 2G6TA 2ODNA 3IUYA 1PN3A 4O4LA 5CVDA 4RK7A 1IN6A 4BY7B 4RPJA 2PUGA 2EGHA 2ZRQA 3B6EA 1ZN2A 4Z0TA 3CLSC 3BS1A 3BFKA 3O8CA 1NBIA 3EOAI 4BY9E 4B3DA 3L0PA 2CEKA 2B0CA 3DAPA 5DO9A 1D2HA 3WHIA 1EX7A 3B5EA 4FHFA 2ZS8A 1EY4A 2VB2X 2JIQA 1BDJA 2FWIA 4Q9DA 4WFN3 5A4DA 3DEKA 2P67A 3E9NA 2A6HC 4NKRA 3NRJA 4BBRB 1YFJA 4KOEC 1QG4A 1U9JA 4EEZA 4U7WA 2B9VA 1QZTA 5D3MB 3UHOA 4HPXB 4BXXH 4JJGA 4LMQD 1PG2A 1YKSA 4WFJA 4I5FA 4EX7A 5CBPB 1Y7PA 5JS7A 2JCVA 3GDHA 1IDN1 3TOSA 1Z0JA 4C08A 1R2QA 1ID1A 3TWOA 1MC8A 4E3ZA 3IX7A 3I4MH 4K0KB 1KJJA 3NBAA 2FLVA 2AOVA 3NHKA 2AQHA 3NU1A 2R9VA 5AICA 4GOXA 3HBAA 5H82A 5CR3A 3PDWA 3VZSA 3GPLA 4MQBA 3R7LA 3A0UA 2YFHA 4XYEA 1GIAA 3S17H 2BGJA 2LW7A 3T4AC 4LOLA 5IWCA 4A2QA 4QPDA 1KO1A 3L41A 3D5TA 5DT9A 3OIGA 5AMXA 3BHNA 3O8OB 4HTFB 2WT4A 1ODSA 3J80E 4K81B 1E4VA 1NPYA 5C2JB 1KDVA 4ZN6A 4L76A 1F1BA 2JLSA 4GNKA 4OAPA 3Q12A 3UUFA 3TJMA 3RFFA 5DH9A 1B7YB 1E3WA 4PV1C 1Y3DE 2R7NA 3BL5A 1KVUA 1SWVA 1TQHA 3TTWA 4AMBA 1SCIA 4X66L 2OBMA 2AX3A 3MJFA 4MK4A 4YCVA 4YV0A 3CF4G 3G5MA 2DQYA 4LFAL 3CS3A 2QQGA 1C0AA 1SULA 2VN8A 5H1SE 2FZEA 3LPCA 2NZ2A 2PUHA 2GGSA 2WVHA 3WIEA 4LGVA 4L6IA 4NAVA 4BPBA 2FZKA 1V71A 4S3SA 1HNWB 4B3ML 2P90A 4WK2B 2NPFA 4ZU1X 3L7JA 4KEAA 3SEBA 1Z62A 2ZJFA 4G1UC 3AETB 4MVJI 4KDCA 4ZHQB 3HV0A 2Z58A 1GUBA 3KE8A 4K8RB 1YMQA 3IR7A 3ILSA 1JICA 5J39A 3RQIA 1RLJA 2B63B 3BRQA 4MH0R 2PMEA 3VZQA 2FPGA 2OTLA 5JXJA 1YHBA 2BDNA 1PH7A 1GZVA 2ATVA 3EBOA 1W5TA 5AVRA 5C1OA 2GETA 2UKDA 5DI9A 1U0TA 1MEOA 4NJEB 2GAOA 3EZ6A 2IX1A 3NASA 1QHXA 3T5AA 4YJGA 1O6GA 4BGIA 4NABA 1EB9A 3VVMA 3UDIA 4G5HA 4WINA 1C4KA 3VFDA 1MG5A 2YS6A 5IVKA 2QN3A 5EXPA 4BO0A 3FPHA 2Q4DA 4AAYA 1U3FA 4FP9A 1REQB 4JXJA 1ZUNB 3DT6A 4HH3C 3RYCA 2WYVA 4DA6A 4HGYA 3UMFA 1EG2A 1N5MA 4RH6A 3BRSA 1APBA 1LV7A 3NAGA 1XV5A 4F8MA 4FFWA 2D8AA 2X7XA 5I5GA 3D8BA 4DGSA 4Z4CA 2FJ2A 2XKBA 4M76B 3PRYA 1SCJA 2FW8A 2Q5HA 4M8AA 2WAYA 1FE8A 5LP6A 4GMKA 1U04A 2H7VA 1Y80A 1SXJB 2OGUA 4C30A 4MS4B 1VMEA 3GZNB 3RRYA 3RSZA 4MROA 1A6XA 3O1LA 1SVSA 3EFOA 3BMQB 1RQRA 4DLAA 1WTHA 1VQJA 1G42A 4J3JA 4K8OA 3AQ4A 3AY7A 3U2QA 2WWFA 1MB2A 3LBYA 3O75A 1JJAA 2BONA 3EVGA 4O08A 4C4TA 5DYYA 3TMYA 3ESZA 4ULLA 5FNVB 1TKCA 1I6LA 1XROA 2YY6A 1AGRA 3CTMA 5LP6C 3SLRA 1JLMA 3N58A 4RGNA 3CWZA 2H07A 2XWBB 3OZVA 5DGCA 1N2XA 1JR3E 1SBIA 1P2DA 4KFTA 4KUGA 3T3OA 3K4HA 1CZLA 4DNIA 4C3HB 3I5YA 1A5SB 2GZ2A 1N32B 2IYWA 4HB4A 3UJ9A 4BNDB 5DW0A 2C9CA 1UP4A 3DFZA 4I55F 3E1KA 3GP7A 4XB2A 3KSDO 1EXMA 4UXIA 1G2IA 3H5OA 4HDOB 3EGXB 1YRLA 4BB5A 3ANSA 4AYXA 3I55A 3SVZA 4WBNA 4LQCA 3JQGA 1V1RB 2JCBA 2CWDA 1XZCA 5E2AA 3UGQA 4BNYA 5LR6A 3DBVO 4BQPA 1YR9A 2WTXA 1STNA 5D01A 3IBTA 2BBSA 4GLVB 1D2AA 2QJOA 4JENA 1GPWB 3O5AA 2WJZB 3C3PA 4HQLA 2PMBA 4F7DA 1Q3LA 1B16A 2NW6A 4HH0A 5EJAA 2GS9A 2WAMA 1G8MA 3AZQA 5B4UA 5A5GA 1OBOA 4HNQA 1FTYA 1JG6A 2O23A 1QWSA 2AVNA 2JEZA 3V33A 2RSOA 1UC4B 1CFJA 4LCEA 2D1RA 3BC1A 4ZQCB 3N0RA 4Y7NB 3E9ZA 3THXA 4LZAA 3PSAA 4LK2A 5D5HA 3DMFA 1S02A 5E6RB 1WR8A 3K0BA 3UNXA 4A3CH 3LFUA 3VZPA 3E9RA 2A0KA 5JSKA 2X2FA 1I80A 1Q95A 4YAOA 1SCUB 4MTCA 1GSAA 1YBMA 2F1KA 4RA6A 3OM9A 1O89A 2F00A 3RVSA 1PEKE 2CW0D 1QYVA 3K9QO 2D1QA 3UT5A 2G6BA 3TLEA 2WJ3A 4F8YA 1MX9A 5DX8A 4UHKA 3BMCA 4PNYA 5HQTA 4H27A 3PC6A 4Q9HA 3ULLA 1QVCA 1P2TA 3CEPB 2B1IA 1FFHA 5C5MA 2H4YA 1NUQA 2QVGA 2G08A 1BWQA 4TV9B 4WW0A 1XQWA 4QY7A 1ETHA 3L0YA 2WWRA 3GHHA 1U8XX 1NXPA 1AXEA 4HSVA 3QFFA 4D9EA 4YR9A 2YY5A 4R9UC 1KZ4A 2HOQA 1U2RA 3QXCA 1RTTA 3DV2A 3H3XA 4N0MA 1T5SA 1KRXA 1F3OA 1PSWA 1PVOA 3R0QA 2C1ZA 3SQDA 5AUNB 2NO5A 3MJRA 4OY3A 2QX4A 2FDXA 1XNGA 3TZKA 1DHRA 3D1VA 2W8BB 4ASUD 3JZIA 3DDWA 2XD9A 5DYGA 1Z0FA 2Y1WA 3ICOA 4BBZA 2RCYA 1VF5C 3RN2A 1BS2A 1QH1A 1XZLA 4P3PA 1Y1VB 3P4XA 3MINB 3H16A 3CRMA 2XCSB 3PXBA 2FG7C 1K7XB 2A35A 2ZSUA 1PGOA 4IJVA 3KWLA 2V7QD 3W6OA 1PJRA 4J7CA 1XZEA 2NTTA 5FTMA 2VJQA 3T95A 4YMGA 4CI9A 4TV8F 4JD5A 1DTSA 1O6CA 1RAFA 2I1WA 4WY8A 1YS6A 1EFLA 2FN7A 4EYSA 4UTPA 5I9TA 4UQOA 3LQ2A 1YRWA 4ZT4A 1TJ4A 4OQPA 3SHVA 3C5CA 1N2BA 3ZQKA 3TQCA 1OXTA 2FGKA 2IH4A 2XMRA 3HGMA 3W5BA 4MMXB 2BJWA 1JJVA 3RODA 3C3DA 1L4LA 5K1ZA 4XVHA 4RKWA 1C9YA 2X40A 3ZLVA 4TOIA 1OPRA 2OQ0A 4KQGA 4P71A 4XSHA 1VL2A 2HLPA 5DNUA 2E5LQ 4OK6A 1JJ7A 3DPSA 2EU8A 4MI1A 3CRZA 1UL1X 4OHWA 2D5CA 2G8LA 1G8PA 1U2DA 2XA2A 2GVZC 1BQQT 1VHTA 1II0A 3CFYA 3I0ZA 5K3AA 4Q7QA 3HY4A 1DWOA 1MUUA 3R40A 3H5WA 2V4ZA 4W4TA 2QZPA 3VNSA 4F5YA 3OQBA 2FAXA 5KYXB 1Z8DA 2RSLA 1M8GA 1Z4NA 3JAWA 1II9A 3U4DA 1JJCB 4J7XA 4FXKC 2JW5A 3MAQA 5DWDA 3BB4A 2I4NA 4QUGA 3OF5A 4EYEA 2AJDA 3QV1A 3SU8A 4D3FA 5KNCD 2HUGA 2QN8A 3OTIA 3C3EA 3QY0A 4JJEA 1NXQA 5COYA 2BY4A 3M9WA 1O4WA 3WLRA 2HYIC 3KT3A 4MVJF 2JFOA 1NYLA 1U2DC 1HXHA 4K26A 1EXNA 5TVGA 4DABA 3G79A 2ETVA 2UZ1B 4LX0A 1M7GA 1V6SA 1JZTA 2G1AA 3I9NA 1RLIA 5DMHA 5HKLA 5GPBA 4MIYA 4A3FB 4MKHA 3HGBA 1OLSB 4GBJA 3VU8A 3FR8A 3T1HQ 4LOJA 4FCTA 3AG6A 2XMCA 4F84A 1USIA 4WN9B 4AJLA 2O0JA 5CGZA 4YX9A 4EKYA 4BVBA 4W1SA 2ODWA 2IJGX 5DRYA 4PHGA 1SQGA 2F8SA 1JFRA 3VH2A 1D4FA 2ZVDA 2OCLA 3T7CA 1QOQB 2GN4A 2Y1CA 1VIDA 4BZQA 1RXYA 1XZFA 4M99A 3GEPA 3MMSA 5A04A 4QRIA 1F60A 1A98A 2R7ZB 1T3SA 2O3SA 3JX9A 5L45A 1JF8A 3PB3A 5CP8A 4M53A 2JANA 2ADFA 1VYUA 5DU2A 3EMDA 1JEYB 3RS8A 5DEIA 3EBLA 4TTTS 1RHMA 3ZD6A 3ZYYX 3WK6A 2WJGA 2QNRA 4K6DA 1AKTA 2QAIA 2QDLA 1Q1BA 3DJFA 1DKUA 4I6JA 1W5EA 1KBZA 3L46A 3EFEA 1ZJ5A 5A3JA 4E32A 4O0LA 4ZYYA 4L4YA 4A5OA 4GRAA 1TZMA 3REQB 2ZRLA 2JA6H 1ARZA 2V1XA 1TTTA 1Y8QB 2F43B 5J40A 2EYFA 2IS1A 4JI6L 3WIOA 4R1NA 1Y5MA 2VO1A 5F23A 2HCFA 1WMAA 4DIBA 1Z28A 1PCXA 1QXSA 1XTKA 5LZ9A 3VZCA 5IP9H 1ISHA 2XODA 3ZDZB 3EVZA 3CPJB 1SNMA 2GZAA 3T1YL 1SC3A 4Y98A 5K09A 2P91A 2A57A 5LYJB 3W0LB 1YQGA 1LXCA 4A8JB 4YHHB 3P9CA 4RM3A 4XFKA 4TTSA 3FHJA 4BNWA 4KE7A 4DWWA 3OOWA 5LSAA 3BB3A 4UASA 4B6RA 4BBSH 3DLLA 2C94A 4J0DA 1UDBA 5FLMH 1Z7TA 1C7FA 4JU8A 3RLNA 4RVGA 2MDTA 2C2BA 2DAPA 2JAHA 3T7KA 2DWCA 3DW1X 2HWKA 2YXPX 1XZQA 3SC2B 4YMVA 2I4MA 5A2GA 3SYKA 2RQXA 3H4IA 1FXSA 2JK8A 1Q6YA 3KQVA 3VV2A 1JHMA 2C0PA 2QRPA 2GFIA 2QSJA 1ENYA 3I9KA 1CUEA 1Z25A 3AUXA 3HA3A 4MS1B 1TM3E 3ETCA 5LB4A 1Q8KA 4R8RA 4XCVA 1U0BB 2EG5A 4FX5A 4UE3S 2QZ4A 4YN3A 4A3IG 4EB6B 2V54A 4JBIA 2QY9A 2IKQA 4I7EA 3RSCA 3KCQA 1EEFD 2ZIXB 4JS0A 1H8ED 3H4MA 2G1UA 3PFKA 5BRJA 3CXRA 2BV3A 1CVIA 4YRQA 2ZBQA 1XZ8A 1L5MA 2FWNA 4EUNA 2FWJA 5PGMA 3WB0A 1SUDA 4KLAA 2QN2A 4M9ZA 4LDRA 1D6SA 3DVRX 2PIAA 1E2BA 2ZSAA 3S2HB 2OYCA 3P9XA 1YJQA 3VVBA 3SBEA 1B43A 2VS1A 4BNUA 4RTSA 1YIJA 2AH5A 3HOZG 2YDYA 5I7WA 2YZ2A 1V2GA 3DVAB 3VTAA 5AQEA 2HR1A 3GMIA 2EDCA 4NXMQ 2QMQA 2HSZA 5HTOA 1G98A 3DEZA 5IYDH 3B2NA 4DNOA 4ROSA 2OCEA 5JD5A 3CZQA 3OOCA 4U7PB 1ZYUA 3GELA 3AF5A 4WKOA 2WYOA 1Z36A 2ZSHA 4IPCA 3P9ZA 5A4AA 4LJSA 1T2NA 4MUFA 4WXRA 1KY2A 3U31A 2I1QA 2JLVA 1PZEA 2E2JB 4DDHA 4A3KB 3VO9A 2RSNA 3I34X 5KNDH 4L0DA 2CNKA 3PS9A 3ICEA 2C58A 2PN1A 3PQ7A 4C76A 1T6XA 1I3QB 4Q19A 4IZ8A 3WIBA 2PX3A 4MRMA 4CV0A 1E8DA 2JE6I 1K5HA 5B55A 4YT5A 4M1UB 1HL7A 1ZYRD 3AESB 2PZ8A 1TAGA 2ZIAA 4HEDA 2C83A 5KTMA 2J59A 2RDFA 4X3OA 4IUYA 2V7WA 4ZRMA 4I1UA 5LDGA 1GA1A 4CLRB 2BEJA 4P0QB 1USUA 3K6OA 2P9GA 2W6ID 1TJPB 3K73O 1V6AA 5FJ8G 1LTQA 1GSOA 1X1TA 3SBDA 1RWBA 3WRXA 4JI8B 1A50B 4BNXA 3PQIA 4Q9KA 2H9IA 1RYDA 2YJZA 2AMCB 2DJFC 4QU9A 1FFCA 3NWOA 1JX6A 3KSUA 4LE1A 1YHZA 4PQGA 4UCQA 4WERA 5C0OE 2P2SA 1L5OA 2EJTA 3FVTA 2AG5A 3P96A 4H13C 4FYYA 3S1NH 4EARA 2PHZA 2OWDA 4FFMA 5D84A 2IYSA 4IURA 2KE5A 3BF7A 1K6EA 3R20A 3CPWA 1SKAA 4QTYA 3FJOA 3WRXC 2MOKA 1QC5B 3TOXA 3E5SA 2B37A 4JP8A 1XNRB 4Z4IA 3BTOA 3T9CA 4RWZA 1M6WA 1LTKA 3FMFA 3KLOA 2P78A 2AOXA 3HZXA 4X7BA 3SCZA 3P9KA 1TUBA 1PZMA 2CH4W 3G2QA 2RGYA 2VL6A 3Q5GA 1TAUA 1YUMA 2ZYUX 1AK1A 3E3MA 1Z5UA 2VHYA 2XYGA 5FUVA 4OK3A 4I4TB 1UPCA 2QF7A 4EI7A 3HEJA 1CR6A 4KTTE 3LO5A 4N8EA 3L7DA 3R7SA 2BGUA 4Z9XA 1H4VB 1G20B 1NUCA 3NXKA 1A4IA 5BY2A 3KYHC 5M3BA 1C29B 3ZWQA 3HA7A 1KSJA 1SHTX 4A3DB 2PLFA 4URUR 2HTFA 3W8NA 3HPQA 2C7BA 4UM7A 4FYHA 3OX1A 4M0DA 1YGYA 5A0FA 3IMCA 1DKNA 1PYGA 3VR6A 4V0MA 4Q03A 1FLVA 3BWXA 1RQLA 1NNI1 2ZK7A 2OG2A 2YNMA 3CF5A 1PDWA 3AVUA 3FSJX 3SVLA 3HBLA 3PGXA 1PZXA 2JA7G 2IY9A 1C9KA 4JZYA 5HGTA 1P81A 1A2KC 4QO8A 4C0LA 5FEMA 1ZA1A 4EI8A 1FC0A 1CUSA 3GEMA 3T16A 4FKBA 1QYIA 2Q1SA 3NK9A 1MU0A 2H57A 5C3EG 3EC2A 3LX5A 4H0FA 1Q19A 1M6EX 4H7KA 6Q21A 3RIXA 1WZNA 1E2EA 2YNMC 1EWTA 3JQ8A 3X3NA 2NZUG 2Q5LA 1Y6GA 4K0KQ 3CCCA 4BN4A 1A04A 1QO9A 3EVFA 1DTEA 2FN8A 3WWCA 1RJDA 4TTRA 2I46A 3ZWMA 4GKVA 1Y4SA 1UMCA 1NVXQ 3IPYA 1US8A