4JBWA

Crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Carbon catabolite repression of the maltose transporter revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
molecule keywords Maltose transport system permease protein MalF
total genus 78
structure length 370
sequence length 370
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4jbwA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jbwA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jbwA01
2F1HA 1Q3HA 1NSFA 5F3WB 2GN5A 5J4LA 1E2FA 3IHWA 3K80C 2D74A 4AYBE 1AN0A 1Y8OB 2WM9B 2Z6VA 3A36A 4JBYA 4XH9B 4KHPL 2ZRBA 3GLHA 1W2HA 3UWOA 4HIMA 4O0MA 1L2FA 2GCOB 1PH7A 4DK6C 3BZCA 1YVCA 2ZREA 4V0OA 1OKKA 4DZZA 1BH2A 1U0HC 5HKKA 1BBUA 3QKSA 1Z0JA 1H9SA 1DVRA 3I4NH 3AQ4A 2ZRGA 4TVAB 4QL5A 3AF4A 2KENA 4JI3L 3N2EA 4LJ6A 1J5EQ 4MGZR 1Z0FA 3BFVA 3GTLH 5JEAJ 4C0SA 1UEBA 1N33Q 4LZZA 1IN7A 1YZQA 4LFBL 1J99A 1HQCA 3C14C 4A0HA 2J0SA 4HI0E 1EQQA 5H1SE 3IBGA 4A1FA 2AXPA 2J87A 3PUZA 3RZOH 1V9PA 4TMXA 1Y8NB 1VYTA 2GNOA 1FW6A 4WW0A 4JMPA 3W1BA 4LFCQ 1GSIA 1SXJE 4JI1Q 4NPSA 3AB9A 2E5LL 1QZHA 2AL7A 3GTJH 3FP9A 2CDNA 4M1TA 1G8FA 3H3VH 1Q46A 4PTLA 2RGGA 1HE8B 2P6UA 2C9YA 4QG7A 2CCKA 2FDCA 2VF7A 2JIZA 3QF4B 4P75A 3VHLB 1NLZA 4PQRA 1BKBA 3K70D 2EFGA 3A8KE 3EPKA 1ZUNB 4ASUD 2VP4A 3T5DA 1CLUA 1LB1B 4L5RC 2J0UA 2VNUD 2ZJOA 1OH5A 4A2PA 3TVTA 1DCZA 3KX2A 1CU1A 4NCJA 2C35B 4C9BA 2QMHA 2I0QA 2CCZA 3ICEA 2CQOA 4IJLA 2NO7A 2JLWA 1XEXA 3ZD7A 1US8A 4TT3D 2AFIE 4DIDA 5F9FA 2JJ1D 1QHGA 3SC3A 2FXQA 3L0IB 1XRJA 2LSSA 1G6HA 2XAUA 3AVYA 1XD9A 4URZR 5GROA 3BOSA 2IHEA 2HCJB 2ZR9A 4NKRA 4G7HC 4IPDA 1R7RA 1S2MA 4PHGA 4AWXA 4DLTA 4MUBA 2BKUA 4QBGB 2YC4C 4LFCL 4LSGA 3DLLA 5HKKD 4BA2I 1SRUA 1JXOA 2VQEQ 4Q1DA 1NBMD 2ZJBA 4JSYA 4OBEA 1KRSA 2F43B 1G8HA 4HUTA 4OQXA 1NVVQ 2KBEA 1XEWX 3I62A 1QUQA 4KXFB 1VG1A 2QT0A 4HAWA 2JEBI 1IN8A 1A2KC 3NBXX 2NQ2C 2NN6G 3QG5A 2ZJ8A 1JEDA 2DWOA 1I2DA 2HIVA 3ZQ6A 5DN6D 4GNXB 3H1TA 1XJQA 4R4TA 3CNLA 1T8TA 2EFEB 2PMDA 3OFNA 5TMPA 1N9WA 1YKSA 1KAWA 1YJ9A 2BHRA 2VZAA 2B63H 1W49A 2KE5A 4ESVA 3G4SA 2HJVA 2V55B 2JA9A 3AYHB 3NEJA 2JLSA 1E3PA 2UKDA 3ECCA 4XOIA 2OFWA 2XX3A 3RYTC 2Q9CA 3LNCA 4GZLA 4PX9A 3TK1A 2R6AA 4PG3A 1OE0A 3WYFA 4ON9A 3HOXG 4KYIB 1TX4B 3VU9B 2IYXA 4M21A 4TQAA 1Z29A 5KNDA 1EFRD 1NY5A 4ZDIA 1EK0A 1H9JA 5JSZA 1NP6A 4M9QA 4R9UC 1E2JA 3CPWA 3OAAD 4ZCLA 4HDQB 2WWXA 4DV6L 2P67A 5FUYA 3I5XA 1W2GA 2CJWA 2QAGB 4HZIA 3CONA 1LF5A 4B3DA 4AIIA 1GG2A 2ZSDA 3DEFA 5G53C 1B9MA 4NCNA 4JI5L 5LD2B 2NO9A 4LJAA 3AVVA 2F55A 4GT1A 4GKKL 3QBTA 2FE4A 3NC0C 4DKXA 1VQGA 2IF0A 4C0BA 2DB3A 3PGZA 2REBA 3F2DA 3PG5A 1XCPA 1KKMA 3W6PA 4JK1C 3CP0A 1PV4A 1HNWQ 4DDUA 1KDTA 1KO8A 4GP7A 4Q1AA 3Q72A 1OXSC 1YNJC 2IY5B 5F2EA 1JR3D 1KGDA 1NIJA 1II8A 2OFOA 1VQEA 3MLEA 4M1MA 3THXA 3OW2A 3KQHA 1SFOH 3SBEA 5EAYA 3T12A 1G41A 3K8YA 2X77A 2OCAA 1MT0A 2EWWA 1ZCAA 4NYMQ 1SR3A 3RANA 1SULA 4TTQA 3CCJA 2JASA 4JG2A 3RS4A 1XTDA 1TKWB 2X2FA 3NBFA 4GSYA 4HUQA 3F0TA 3FHWA 3PEWA 3AVQA 2VA8A 3ND8A 4QGGA 4BFZA 4PV1C 2F9MA 5CK4A 2OV2A 1KI6A 3PIRA 3E5HA 3SHWA 1YHQA 1UF9A 1KXLA 1W36D 1OIVA 2W6IA 1P7CA 1W1WA 3LV8A 3UIEA 4TYWA 1YR8A 2B8FA 1DE0A 2YINC 1G7SA 4OO1I 5FTLA 1HE1C 4TL7A 3QIAA 3RNLA 1X6VA 2L0XA 1I94L 1TL7C 3FPPA 2K32A 3CPHA 1Z06A 1B23P 1Q0UA 2Q2IA 1KYIA 2GCPA 1VHLA 5D3QA 4XVQA 2MO1A 4Q9IA 5B2ZA 3Q85A 1MO6A 2ZI9A 3REFA 2VUMH 4B2IA 1QHNA 3K70C 1IW7C 3SJBA 1WBDA 4AKGA 4ABYA 4LJ5A 1Y1VG 1E1QA 1ZUHA 2UU9Q 4XWAA 3U44B 4DUZL 1K6MA 5FBVB 1R5NA 1Y63A 2HLDD 3KFXA 1LFDB 1WYDA 1OSNA 3BC1A 1D8LA 4EJSC 3M4QA 3MJRA 2QTHA 5B58C 3E0EA 2H18A 3KKQA 3CC4A 1J70A 1UBCA 2K7VA 1SE8A 4GMDA 2GVZC 2QGNA 4US0R 3ZVRA 2PCFB 5BN5A 3K0AB 4IEIA 1FNNA 3H94A 1GAJA 1II0A 1XMIA 2FZLA 2W0MA 1A62A 4JJZA 5DHAA 5SZHB 3CW2C 3V9PA 2XGTA 3U4VA 4YCWA 3NH9A 3QXCA 3KJOA 4GKJL 2RGNA 3KQUA 4P72A 4DR6Q 1R0ZA 2EYUA 4JBXA 4L9WA 4PZLA 3UG7A 3FGNA 2XTZA 1FL9A 2FGJA 2Z83A 4Q00A 3PCOB 1OYYA 2AKAB 2EQBA 3KZ1E 1G4UR 2QQEA 1F2TB 4N1AA 1R8SA 2VW9A 4TLEA 2EJMA 1H8HD 1M2OB 2PJRA 3MWLA 3KFUA 2ZANA 4C7OB 2LMCB 2ZI3A 4JI0L 1QBKC 3SDZA 4FXPA 4JLVA 4KVGA 4AKHA 3IRBA 1VQ5A 4AURA 4A3EH 1PH2A 1Z28A 1EX6A 3H0GG 1W0JA 2ZRIA 1IBKL 2R44A 3PIPA 2EJGC 4I4LA 3IGFA 2XNSA 1M74A 5TARA 3IKJA 1ZAKA 3LVRE 1IBKQ 2C5LA 1P2UA 1QVAA 1XMSA 2PLFA 1CRPA 4GLAC 2XZPA 2KB0A 1UBGA 1WCMG 2OTLA 5E7MA 2FX3A 2IEYA 4A75A 1S3GA 3LBHA 4HDOB 4OXPA 1G64A 2O8EB 5DLQC 1N32Q 5BN4A 4QJFA 3PO2G 3OTOL 3A5UA 1MR3F 2BVNA 2QY9A 1WE2A 1K8OA 3RRMA 2GXUA 3EZFA 2YNMA 4NDZA 4DCTA 4QJ3A 4JVLA 2FSHA 1SN8A 2EIFA 1GM5A 3J7A5 1DAHA 2ZU0C 4HB3A 1EQRA 4QJ5A 1D7QA 3CNOA 3PSIA 2Z4SA 1VYVA 3VR6A 4FMCF 4U5XA 3P1JA 5AUPB 1E4VA 1L8QA 4B35A 4PC3A 1E96A 4UNRA 4A3KH 3D0FA 2XNDA 3SOPA 3TSWA 1Q44A 1G16A 4MITA 3T1QA 1E94E 1KI8A 5FH9A 1ZD1A 4Q18A 4E5UA 4IJHA 1O78A 1RYHA 1XTIA 2QA5A 2V4ZA 2WICA 3QF7A 1D8TA 1E2KA 2L5TA 4M0LA 4QRHA 1OXXK 3NXSA 1XMOL 2CLDX 2BCJQ 3U4ZA 4K0KL 3IDQA 3WHLA 2BOVA 3LWNA 4LHVA 2NO0A 4NYJR 4AD8A 4UP7A 1DARA 2Q3MA 3A1UA 3I32A 3I2ZA 4M1YA 4RJLA 3AVOA 1OIXA 4BWYA 1NJIC 4NTZA 1FOEB 1YRBA 2D0OA 1E1RD 4V03A 1HH4A 3L0SA 1P2SA 4NB3A 1JALA 1CKNB 1RC8A 1HA3A 4B44A 1QUQB 4LHZA 1CSPA 2Q3FA 4JLPA 3ZGXA 2NGRA 3ONWA 1IYUA 4JLBA 4QHSA 2A5DA 1Q82C 4F38A 2CHVA 4R1JA 5FOWA 3I1FA 3T1TA 1WI5A 2E2HH 5M3MG 2E5LQ 1NG9A 4YXWD 4BFUA 2Z6KA 5FLXc 1PH8A 5AJ3L 1W0JD 2FSGA 1W48A 3K09C 4TT3A 3AVWA 1X86B 2JJQA 1YZKA 2B92A 4KKUA 2KSQA 4RFVA 2O0JA 2ZYUX 4KI0A 1X56A 4RZ3A 4IRUB 3P4XA 2A8VA 4R2HA 3G6EA 4D0NA 3UG6A 2R92G 2BE5D 1F5NA 3CKLA 1V8QA 4KFSA 4A3CH 3QKTA 3CC2A 4Q7MB 3SJZA 2IS6A 1GNPA 2JLVA 3HU1A 1S4QA 1XMJA 4MRNA 2QE7A 3S15H 4C30A 1TADA 4KKSA 1EFRA 3HP1A 2CHGA 2AKYA 4DT1B 3KL4A 5IF9A 4C0QC 4BUJA 1PH5A 3MCAA 4V0ME 5IY0A 3U3KA 1G1MA 1QVGA 1ZW6A 3TMKA 4BY1H 4GZYC 1P8LA 1S8FA 3W3ZB 3WYAA 2GF0A 1HH2P 1OJLA 2WJHA 3A0JA 1ZNWA 4J15A 2I5MX 1Z08A 4LFBQ 4LOAA 1K8AC 3B60A 5A4JA 3FKSD 1VQPA 2Q2UA 3PQCA 3B1WA 2A19A 3OFND 1P16A 1ZVQA 1H8EA 4IFBA 4EAQA 2O8CA 4Q4LA 4DR1Q 2XTNA 3GFOA 4RCZA 2ZRKA 3DXJC 2F1JA 1B0UA 3QVUA 2DHRA 4FWIB 4TSFA 5FR1A 4DCSA 3VKWA 1E9BA 2DY1A 3PO3G 2WKRA 3TSOA 1MOZA 5FTKA 1JR3A 1ZYRC 2V7QA 3TUZC 4HLDA 1VQOA 1SVMA 1COWD 2O8BB 4RD6A 3TKLA 3GFTA 1GHJA 5LMNL 2GXQA 4Q1CA 4OI0A 5SZJA 3ADDA 1JR6A 1QF9A 3TAUA 4YMTA 3HU3A 3CNNA 4A3DH 2HYDA 2IUSA 3OF5A 3RS5A 2ZRCA 1G6PA 2NVTH 1VMAA 4M22A 1LM0A 1LV7A 4CEJB 3K9HA 1D9ZA 2K5UA 4HZUA 1NMXA 5B57C 1GP2A 3I61A 4LW1A 1EFTA 4F93B 1ZU5A 1KI6B 3Q7PA 4I1UA 1PMRA 3OPOA 4IOAA 1ZIPA 3L8YA 3RSLA 4BZXA 2D7DA 1ZKOA 4A36A 5LBIA 1CKMA 1AJEA 3A1WA 1Q8KA 3UMRA 3GTPH 1G7CA 3A8IE 1DAIA 5GVRA 5EP3A 2X8AA 2UZ3A 3DMNA 5M3MH 5J4HA 3RRZA 2E2JH 1M90C 2DFNA 2PJZA 2MQHA 3HYTA 3QXHA 1PH4A 3CCQA 1FJGQ 4A93G 2GJKA 3FMPB 3GJ3A 5EXXA 1UAAA 4C2TA 2DBYA 3NG1A 4FI3C 2QRNA 4B76A 3LAWA 4JOIC 2NOAA 4GNKA 4EPWA 1P9NA 2JDIA 2IS4A 2REXB 2WAQE 1XTRA 4WXRA 2IYRA 2O8BA 3X2SA 2R7DA 3Q8DA 2OQ0A 5C4MA 3AP3A 3CCMA 5D3MB 4AKIA 2QEQA 1QRAA 1TWFH 3TUIC 5DISB 3I4OA 4MTNA 3SR0A 5KDLA 3K53A 3SJCA 1WF3A 3AP1A 2O52A 1S9HA 3DM3A 2YOFA 4S2EA 4C0LA 1RE0A 1U99A 1CJTC 2A69D 3VNVA 2DFKB 4HJ9A 4OHZA 4ASUA 1GL9B 1EFUA 2PZFA 1K9MC 4NXMQ 3GJ6A 1KRTA 4BZPA 5C3EH 1XU4A 2WWGA 5DIFA 2GAAA 5E3HA 1LVGA 4NXML 2IHYA 3QQ5A 4G5GA 3VQTA 2ZJRA 1KK1A 2JA8G 1W5TA 1W36C 2AWNA 1SGWA 3ZZTA 2NZHA 4G01B 4JYCA 4AYWA 1VQ7A 5LMNQ 2NIPA 4G5RA 1ASYA 3CRVA 4GBMA 4IDQA 4PPNA 3PUWA 1JJVA 2FFQA 3U2QA 3ZH9B 4WBSA 4IPHA 4HB4A 4K8OA 4PO1A 1L1OB 2VHCA 1KSHA 1PLJA 2BA0A 4U02A 1N0VC 4I1SA 3R9IA 1XWIA 1X9NA 5E7IA 4X66L 5IT9c 3GTMH 1TMKA 4ZCIA 3KJPA 5KDOA 3S24A 4X65L 3A1SA 1RIPA 2WWHA 3BERA 3EZ7A 3S16H 2W0SA 2G77B 5K8LA 4QXAA 3DMDA 4BY7H 1PH9A 2O5VA 2QPOA 3LQQA 2C9CA 3EAQA 4LF6L 3K7AH 3ADBA 4MUAA 5IWAL 5L8VA 1Z6GA 4ZDWA 1NJGA 1TEXA 1KNQA 1VCOA 2VHTA 4JBKA 1US8B 2IYYA 3FFAA 4YWLA 4TKOB 1GL7A 2LCFA 2MMGA 4L8GA 2WIAA 4JI3Q 2ZU6A 2ZRNA 3WRXC 1HUQA 2JA1A 4GKJQ 2ZS8A 3EWSA 1G51A 4PC7A 1ZMXA 4OQMA 4A6PA 2EYQA 4FMDB 5AUNB 4CEHB 1CJUC 2PMZE 2UVQA 2VBCA 1KAOA 3B9QA 1CF4A 3JVUA 3GPLA 2JA7H 1SKYE 2OZEA 3NEYA 1L1OA 1IXRA 3A58B 2R7FA 4IPGA 1EWRA 5GVSA 1BVSA 5L3VA 3FVQA 4TL6A 3EA5A 1IBML 2DN8A 2YWFA 2YC2C 4PAMA 4U00A 5KOYA 1QHYA 3BIFA 5EQTA 5JEAG 1GTVA 3AF3A 5KSZA 4MKFA 4WXPA 3BJUA 1T3SA 1MABA 2OM2A 2QPTA 3K1JA 2NPIA 3FKIH 3SFVA 2Q3HA 1OH7A 4U7DA 1QZGA 1GRRA 4LF5L 3Q5DA 1Z6HA 2AK2A 2MSEB 2W6JD 4JLKA 4Z54A 3FB4A 2ZSEA 3KTAA 1OXUA 1BOFA 3GLIA 4KJZA 2UXBL 2KCMA 4DV6Q 2FH5B 3CF6R 2WWFA 2K14A 2ZSBA 2R6DA 1SVWA 4QJ4A 1F3OA 5TDHA 2NVXH 4GOPB 3PR1A 3VX4A 4A3JH 3E9IA 4UY8C 1RVDA 4F91B 2KCCA 1Y1VH 1DO2A 5P21A 3A74A 3L82B 3FMOB 3WHKA 5JWOA 3TRFA 3NELA 4QFMA 3B1YA 2ZRDA 2ZJ2A 2K5NA 3CRMA 5CB6A 2ZM6L 2O0KA 2NVQH 2H57A 3A37A 3EARA 5JI3E 1OV4A 3A4MA 1XBTA 2O0HA 4NONA 3S1MH 4TQUS 4XTCS 1KC8C 2KCTA 5HCNA 3RN5A 1XTJA 4R4OA 1XX6A 3CCSA 2VF8A 1QHSA 4PMWA 3B1ZA 3IUYA 3RS7A 5HPYB 2JLZA 4GLXA 3RWMB 3SYNA 5FTNA 1MABB 2GK7A 1X65A 3BFKA 4A3FH 2ZUBA 3CIOA 3KUDA 2O8CB 2ZTEA 1N5LA 4HLQB 4PR0A 4D82A 2UUAL 2G3YA 2ODBA 1RW4A 3OE7D 3OOCA 5GJVC 2HUPA 3EXAA 3S1RH 4BASA 3U5ZB 2V8OA 2UXBQ 2JCSA 2CK3A 4BPBA 2UUAQ 2RGEA 4HAXA 3GLIB 2ZI5A 5KYKA 1JNYA 1UKZA 1C7YA 2H7VA 4Q7JB 1KDOA 4UQOA 3M7NA 1E32A 2YTXA 2Q0HA 3PEYA 3LA6A 1J90A 1P9RA 4Q02A 3QPVA 1HZBA 4US1R 4Z51A 3CMEA 4LJ4A 1GRNA 2FN4A 4Q1FA 3OIVA 2ORWA 1Y3AA 2YTYA 4A3DG 4RD0A 1IN6A 3QJYA 1N3BA 3ND9A 1Q1QA 3JZMA 3MEFA 4LHWA 5FI0B 4TN1A 3RN2A 2YVUA 1NKTA 4HIKA 4BLQA 4R4QA 1GDDA 3W34A 1E0AA 1TQ4A 5FBLB 4TMVA 2AMCB 1G6OA 4DUZQ 1G5RA 1UKVY 2B63G 2F6RA 2R6GA 2OE2A 4LF4Q 3JZAA 2C04A 3QXJA 2WP8J 5HGQA 1NBMA 2NN6I 1XMOQ 1X8LA 1K8MA 2QG6A 1W3SA 2QI9C 3THWB 2WPDD 2PZGA 1ZCBA 4FIDA 3RVBA 1IY1A 1TF5A 3SYLA 2Z6KC 3GLHB 1PFSA 2NO1A 3G48A 4JV5Q 1GWNA 4G1UC 1XZQA 3CCUA 4D80A 3O8RA 1ZRHA 3LBNA 1P9WA 1KMHB 4YHHL 1BO6A 3QKSB 4MQBA 1PA6A 2CEAA 5G41A 4LBWA 3TW8B 4LWCA 4QQBX 4I1OA 2IEZA 2PT7A 5D3MA 1T9HA 2NTYC 3MXUA 4X62L 1IAQA 2AKWB 1RJ9B 3ASZA 3BDOA 4MKHA 5CM9C 3K0AA 2B7CA 1TU3A 1FQKA 3PO3H 3UK6A 3LGJA 1GRQA 4JL8A 1I6VC 5C4XH 2HQLA 4ZI2A 1A1VA 1YHBA 2JE6I 1BKDR 4OQFA 2VL6A 3DKVA 3REGA 3HOYH 2HYIC 1PLKA 1N25A 2QN6A 2EW1A 4PQYA 1VHTA 4Q7KA 2ASBA 1VG0B 4LX0A 5FPTA 3WDNA 2RHSB 5KNCA 1GFIA 2ORVA 1K73C 2J41A 4FMDF 1F2TA 1NSTA 2ATVA 1HYQA 2P6NA 1FGUA 1N34L 4DB2A 1WDTA 3I73A 2C2HA 2R6CA 3QF4A 4L8JA 4QM7A 1LACA 4AYBG 1XXHE 3HGBA 3K70B 3U7HB 3OTOQ 4C7OA 3QOFA 2Q2TA 4PO8A 3TBKA 3HKZE 1XPRA 1HT1E 4B3RQ 4OGQC 1W4AA 1E2DA 5J4KA 3TQYA 3JAMi 3DHWC 1VQCA 4Y0AA 4CYMA 3UDIA 2IUUA 4IFDJ 3DKPA 5FFMA 4JBWA 2K5VA 1AKYA 4LF6Q 3GLHE 4X62Q 2QUZA 3U6BA 1HV8A 4JYAQ 4YMUA 3DOEA 3KB2A 5H1YA 3FFBA 2FPKA 3TH5A 5AWFC 2I5HA 3TR5A 4LUCA 3RSOA 4KHPQ 4ESHA 2QU8A 4GOPC 3D3QA 1P2TA 3AFQA 2XITA 4LF4L 1JQLB 1CIPA 4DR2Q 3T56B 2VPPA 3GJ4A 4II7A 1H9SB 3T5GA 2OAQ1 1VQMA 4O25A 1T5EA 4H1UA 4OO1G 4QGFA 1DG1G 1E2HA 1M6NA 3W6NA 3CF0A 4EPRA 6Q21A 5C0XJ 3CCEA 4B3FX 3I5YA 2QRZA 1G18A 1FUUA 1IJFA 1SHKA 2P65A 1G5TA 3NBZC 4L5BA 4LBZA 1E3MA 2E74C 1DD2A 2OWOA 1TUEA 3LD9A 4LYJA 5FTJA 1UFQA 1TQ2A 1XTSA 2IYTA 3D4RA 5JWHA 4GOJA 3UMSA 5K8UA 1NN0A 1PUJA 2QM7A 4KSBA 2B8TA 4WIAA 4HSEA 1I5FA 3UATA 1R9TH 4NPHA 3WYGA 2QE7D 4DLYA 4AY2A 2WSSA 1TWHH 3J80i 1BYIA 2FF7A 1E2GA 1IYJB 5C44G 4KKTA 1UKYA 2BBTA 3CR8A 4F92B 1UPTA 4WZ6A 3MSXA 3GEHA 5A5GA 1N2CE 1WRBA 2IC5A 3I4NG 2OXCA 3M4OH 2RAPA 2OCBA 1YIJA 1NG1A 4GN3B 4OHWA 5JJLA 4BA1I 3LO5A 1ZM4A 4LI0A 3LXRA 3AVUA 3ZJYC 5FPKA 2W6JA 1HTWA 1ESNA 1NRJB 1AKEA 5G3ZA 1HR0W 4HLCA 4IHQA 3IQWA 4R4IA 3DVLA 1JBKA 2MMCA 1X6OA 1HNXQ 4OX9L 2JQOA 2CLCX 2A5GA 2F9LA 3O47A 2P6RA 2IXEA 4ZDKA 4AQYL 4IO9A 1H9MA 2FPMA 2ZEJA 3LFUA 2OT3B 1S96A 4KYUA 5FUWA 1JAIA 2YV5A 4GOPA 4C4PA 2RGNC 3OEEA 3A1VA 5LB2A 2JGNA 3LBIA 1R5OA 4NL4H 4QGAA 5IWAQ 2ODWA 4QHYA 2A5FA 3ETLA 4Z8XA 4NYIQ 4A8JA 4XIGS 2HT1A 1E2MA 1O3YA 1MKHA 2D2EA 3K0FB 3ZLJA 4GRAA 1KAGA 2WWWA 2WAQG 1A8VA 1FQJA 5DLQE 3EIVA 4KHZA 2CVHA 2OHFA 3HFZB 2OXRA 2YJTD 4LPSA 2A2ZA 2C8VA 4K46A 4P74A 4OI2A 2GJ9A 1PYSB 4A6XA 1VQBA 2GWHA 1I6HH 2IHBA 2ZR7A 3EPLA 2OCEA 2IX0A 1OYWA 4DV7L 3ULLA 2YOHA 1EIYB 1UBEA 1YRAA 1XXHB 2HDNB 3A8JE 4B3SL 4C2UA 1CR0A 4M4SA 1N5KA 2VLIA 4MYTA 3KXIA 4EPYA 3CX8A 3DZ8A 1N36L 1IBMQ 3KB1A 3CC7A 5DI3A 1Q81C 2C98A 2ZM5A 3FKIG 3NTUA 2FFBA 1SQ5A 3ZYCA 3HOWH 5KPJA 4B3MQ 4QKQA 2RCNA 1NI3A 1JE5A 1Q7YC 1HURA 4NCIA 5M5XH 1JR3E 4F4JA 5BW8A 2O8FA 5GJBA 1YE8A 4DLZA 3UXMA 4B3ML 2JDID 1KD1C 2WAXA 2O8EA 1GKIA 4H0LC 3ICQB 5EE9A 2DWPA 5C2JB 4A2WA 1D6JA 1VDZA 1VS0A 1NL3A 2A6EC 1E24A 4HLUA 4KAXA 4NYMR 3T06B 2FJUA 4EUNA 5K8IA 3ZDQA 2UXCQ 4IDPA 2DPXA 4Z8YA 1VF5C 3AKDA 3B82A 4B2PA 1Z47A 3AH8A 2YKGA 3M4YA 1X55A 3VDYA 1C0AA 2CE2X 2F3TA 1CP2A 3EZ9A 3M4PA 4F4IA 1E2ZA 4B43A 2QZ4A 2EFDB 5EXSA 1F48A 2H1LA 3R9WA 2WV9A 1X1RA 1I50H 1P60A 3VMFA 3HPQA 3VR2A 4B48A 3BGWA 1FP6A 1X3SA 2XB2A 3CX6A 4PC1A 4V0MA 1P5ZB 2BV3A 2WJYA 5JEDA 3IHLA 3THWA 3SE0A 4NZYA 4BBSH 1R2QA 1KKLA 1W2BA 2NG1A 3IPYA 4Q01A 4Q9HA 4Z1MA 1KI2A 4ZI3A 2HF8A 1X8KA 2YYZA 1Z2CA 3SYKA 5J3BA 2D06A 4DEYA 1AQUA 4WJ4A 3GJ0A 1HNZQ 3MG9A 3UMFA 4IQZA 3BU2A 1XF9A 2ORIA 1XMQL 3OIUA 2CW0C 5TVKA 1KL9A 4CGZA 1F2UA 3ERSX 4A3GG 4KLKA 1FZQA 2OCPA 5EXPA 2A6HD 5EE5B 1CKEA 1IBLQ 2XNDD 4FMCB 4BFSA 4BGDA 4P33A 1LYLA 2E2IH 1G3RA 4BFYA 4ILEA 2Q9BA 1IY0A 4Q4AB 5G3YA 2J7PD 4MYHA 4BXXG 1KO5A 1AGPA 1OPXA 4MGYR 4D0LB 4CEHA 2J1LA 2LXKA 5DYIA 2ZRHA 3I3SR 4B73A 2R62A 2UZIR 1G3QA 5DI9A 4O2DA 1R0WA 1U81A 2D0PA 5C0XG 2HHHL 1DPFA 3KQNA 1KSJA 4Q9KA 2NPFA 1CR2A 4RZXA 3MFYA 2ZTDA 5TXGA 4C0JA 1CTQA 3PUVA 4B3RL 5CJ2A 1P6XA 3Q7QA 5M5YH 5AUQA 2YU9H 1KIMA 1QG2A 3HU2A 5FPHA 5AUOB 1N36Q 5H8WA 2GXSA 4XWOA 2VP9A 2IX1A 1ONLA 3BZKA 4DHEA 1S0UA 3CPFA 1WMSA 3D7MA 2AD1A 4YMSA 2UUCQ 1BS1A 1N0WA 1SVOA 4A2QA 3BB3A 3GLGB 3BBPA 1LUZA 2VY3A 3K0EA 4TLDA 4Q4JA 2DFLA 1AQYA 1N6LA 2BIFA 4FWTA 2ZAOA 2IHFA 1U94A 1UDXA 2K75A 4DK0A 4LF7L 4TSFD 5KHOC 5CYPA 1O7LA 4A76A 1T4GA 4DCNA 4DRZA 3QXSA 2ZETA 3HJNA 1VQLA 2AFHE 4PZ6A 3KOJA 2OTJA 4Q1BA 4HB0A 5KUTA 3PVSA 2P5TB 4YWMA 1TQ6A 4LJYA 5GADC 2ZJYA 1YVDA 4G5QA 1PYBA 1I4DD 2EFHB 3WMEA 5LB4A 1OFTA 1VYUA 2J0VA 1AGRA 4HLUC 1VG9B 2D2FA 5KDDA 3ULJA 5BR8Q 1KDPA 2A68C 2Z0MA 3BXZA 4IXMA 2IWHA 4OK3A 3RWOA 4URVR 1N5IA 3AGQA 3G82C 2WBLC 2WJVA 2XEXA 5JWRA 2FOLA 4M53A 1ZD8A 2FPLA 3C5HA 1R4AA 2BWJA 4HDCA 4YMWA 2PZEA 4AG5A 4LJ7A 3K9LA 4QM6A 4NCKA 2ERXA 1DELA 3I72A 4J0QA 4TYPA 1GUAA 3DDCA 2CXXA 1Q90A 4BQSA 5IP7G 4RD2A 1U9IA 3VKGA 1ZM3A 4RMFA 4NYJQ 5LPNA 5EE0A 4D6PA 1KI4A 4Q7LA 1H65A 1XD2B 3IO5A 3G5UA 1YR7A 2ASEA 2YHSA 2ZI7A 3Q9LA 4Q19A 4X8HA 1YJ5A 5HCIA 4DVGA 1TTTA 5AJZA 2BEKA 2K5HA 3CCLA 3K0XA 1N32L 1U9IC 2J7KA 3TW4A 3FTQA 3ZD6A 2H92A 1N6HA 1NMYA 4JKYA 1MO3A 1B7YB 3RRYA 5JSZB 1GNQA 5TV2A 4AKEA 4KITB 1EGAA 1VCIA 3TRZA 3EQLC 4HR7B 4IVQA 5ELXA 3AKYA 4JYAL 2YWEA 1P72A 1RRGA 3CM0A 4RZ2A 2RH5A 1AH9A 4DLVA 3DOFA 2E8GA 1E2QA 3G0HA 3QEOA 2ZTCA 4QBHA 2WTUA 4BY7G 3U7GA 1NLFA 1L2TA 3RC3A 4KSCA 2DCUA 2QBYA 4JSTA 2CL6X 4ME3A 2GEVA 2GZDA 3OIWA 1G17A 2YWHA 2ZQ5A 3THYB 1NVXQ 1S72A 1YR6A 2BBOA 1EIFA 1ZM9A 2ZJAA 3Q3JB 2CE7A 2CHQA 1L4YA 1NF3A 4TZ0A 1DAGA 3NEMA 4AK9A 3CAMA 1R8QA 2VHUA 5EP4A 4KMUC 4TMWA 1TQDA 1Q21A 3PIOA 4KV9A 4JL6A 2CWPA 3IBYA 4FW9A 3D6TB 1VKJA 4DUYL 3B5JA 2JA8H 2R7ZH 1VTKA 5JS7A 2ID0A 2UU9L 1VQ4A 3JAMc 3ADKA 4C0HA 4CIDA 2JLYA 1XXHA 5CLLA 1E79A 4HZUB 4P4UA 1MO4A 5IYDG 2GJSA 2RKOA 1N0UA 1CRQA 4MNOA 4AI6A 3UDGA 1IL2A 2WPDA 5AJVB 3QY0A 4AYTA 3H4MA 2DNEA 3TS0A 1DAEA 5LMUL 3SI7A 4P4SA 4NE2A 1IXZA 2C77A 1D2NA 5DN6A 1UADA 2AD5A 4FCWA 4M1OA 5FOTA 4DXAA 2BEJA 4IOKA 1YZGA 3GTQH 4LC1A 4XD7A 1RRCA 2BDOA 3QENA 1X3FA 3S2HH 1VQDA 1HJPA 5FJ8G 3NIBA 5L3SB 5IYCG 1XTQA 5E95A 5J4YA 1W7AA 1KI1A 2C99A 2WJGA 4A3JG 1KSFX 5IP9H 4UNQA 3Q8XB 3S1NH 4DV4Q 2MSCB 3B78A 2EXDA 4LK1C 1KK0A 1GJXA 1M34E 3IIMA 3SS8A 5KSYA 1XEWY 1BDOA 1OXTA 3G71A 2JA5G 4QBFA 2FMXA 5CK5A 3P27A 1B70B 1YJWA 1DG3A 2GF9A 4JIMA 3LY5A 4E07A 1NVWQ 1KI9A 1OH6A 3OW7A 4G0NA 1F60A 2IBMA 2C03A 5JFGA 1ZC3A 2D62A 3GO5A 4DDTA 1XNJA 3BJIC 3NBHB 1M1KC 3S14H 3T15A 2IYZA 2LXJA 1CBUA 1E0KA 1NN5A 3KXLA 5BXQC 421PA 3ASYA 4TYYA 4ZDJA 4POGA 3GTGH 1S1CA 3T53B 3T1YL 3KJEA 4ARZB 5C0XI 1Q3TA 4TQ9A 4OKSA 4JI8L 2OUKA 5CDFE 1SROA 4B3TQ 2JJ2D 4DSNA 2EVBA 4A0RA 2F1MA 4Q4AA 4QC2A 1LY1A 1G3MA 1T5IA 5G40A 1YR9A 5GADl 3SZRA 4CEJA 4DK1A 3QKRB 4KN7C 1K8RA 5FL7A 3WNCA 5LDDC 2HIXA 2IYUA 2A3RA 2LKCA 3LXXA 3DM9B 3VR1A 4DWJA 2WVJA 4OJKA 4LY6A 3NWJA 4DK3C 1G20E 2F43A 5M5WH 1R5BA 5IYBH 2BMFA 2VHJA 4LF5Q 3RS3A 3KDFA 5EZ5A 2BH2A 4FCTA 3FHCB 4OO1H 2QSZA 2QGZA 5TY0A 1OW3B 3H3VI 4CT4B 4B2LA 3KQLA 1YNXA 1FVIA 5K8TA 2JK8A 1ANKA 1G8YA 2B8WA 2JLRA 3KKPA 3A6PC 4OI4A 2K4KA 2Z0SA 2A30A 3LVQE 3K0SA 1Z0AA 4WVFA 5KO2A 1AE3A 2CFMA 3X1WA 1Z83A 1QHHA 4C3HH 2H16A 2SHKA 5HR5A 2GVAA 3LLUA 3W3AA 4HJ5A 1S9DA 1CEEA 2QORA 1X1SA 3C15C 1TWAH 2K52A 2GVBA 4YHHQ 3HOYG 4TMKA 3LDAA 3N2IA 2OBLA 4TTRA 1QHXA 5C4XG 2B8GA 4TYQA 3QXXA 4XWKA 1RFLA 3L7ZC 2O5JC 1EFCA 2XOKA 3CB4A 2GVDC 2O5IC 5IP7H 3PCRB 4E09A 2XTIA 5HZKA 3L8ZA 1HQYE 2ZVQX 2Q8IB 1YHNA 621PA 5CDFA 1DXMA 3BB1A 2IW3A 4BZQA 1IN5A 1LNZA 3WBJA 1ONBA 4GMXA 1GVPA 4I7ZC 2UXDQ 1OFUX 1E9CA 3PF5A 3KJGA 1SVSA 4X8OA 3A8TA 1O7IA 2QQ0A 3AP2A 5JZVA 2JEAI 3KDFB 5JS8A 1SXJA 1I2MA 2V9PA 4RKFA 3T1OA 4BFWA 3M6AA 1YNNC 4L5TA 1W0KD 2IYVA 4D25A 3GJ8A 2UXCL 1L1OC 2ZJQA 2JJ2A 5JEEA 2KBFA 5JMTA 4NXNQ 4JV5L 5C4GB 2FSIA 3FMFA 4GDFA 2ZE6A 4EDHA 5FL7D 4BEJA 4JVMA 2P5SA 3NDPA 3J80c 3NBYC 5C18A 1QHHB 4I81A 2V1CC 4E03A 2GJAA 4ZCMA 2ZJPA 5IRCD 3HKSA 2IYSA 2BM0A 2G0TA 1E1RA 3V4FA 2HXYA 5C0XH 4HJ7A 1GNRA 2IL1A 1A63A 2XXAA 4Y52H 3RABA 2GDJA 4C3ZA 5IHPA 4LRWA 1FR3A 1KO7A 1IBRA 1FX0A 2ZPTX 3LQRA 3FYHA 1EESA 1HZCA 2GK6A 4JI2L 4OWWB 4KFUA 4O2LA 5HTKA 3VFDA 2ALYB 2BCGY 3RZDH 4KO8A 1HZAA 1T5LA 4PAQA 4N3NA 3UKDA 3EIQA 4A3KG 3EZ6A 2V1UA 1CUKA 1NTGA 1VCMA 1J5EL 1SXJB 5GAEC 1CI3M 4OQNA 4A4IA 2A5JA 2QMOA 4QGUA 1YBYA 2OLKA 5L3QB 1Z8FA 4TL9A 3JC66 4UPAA 1NN1A 4MA4A 2W2TA 2W83A 3K7UC 4DC9A 1A4RA 4PPQA 4M1SA 4BLOA 1R10A 1N6OA 2GEUA 3KLRA 4BECA 3EPJA 3U60B 1EWIA 1A0IA 1FFHA 5EJEA 1ZP6A 4PAOA 3X1XA 4FINA 1WBBA 3BK7A 1AIPA 1E2EA 2A7QA 1E0JA 4QGHA 4YDSA 2GETA 5SZIA 5IYCH 2P0EA 1HY3A 2I1QA 4A3EG 1CR4A 4H44C 5BN3A 1CSQA 3J7ZC 1VQ6A 1KTVA 1CTMA 2ZRLA 2ZJZA 3O8DA 2J3EA 121PA 1I4TD 4JLJA 1KO1A 2E76C 2ATXA 1XPUA 3RDPA 3WXMA 4F4CA 4A3IH 4P32A 4LJZC 2QP3A 1AZSC 4DNRB 1E79D 1JEEA 1JMCA 2ZIAA 3KKOA 4F7WA 4BLRA 4D4LA 4DSUA 4RD4A 2G88A 4LF9L 3HOWG 1XJ0A 2GKSA 5CIWA 2B7BA 2B21A 4LCBA 3AFPA 4MGIR 3PUYA 3AGPA 5TB5A 3R8CA 3GLFB 1YHAA 2DFTA 4M9SA 4XJXA 1OT3A 3RLNA 1K5DA 3U9SA 2N78A 2ZE5A 2O8DB 8OHMA 2RGCA 3CRRA 1G5PA 2FA9A 3GP8A 4QY7A 4YY3Q 3FKQA 2JJ1A 5CYOA 1TF7A 3SU8A 3CPJB 2L15A 1HR0Q 1FNMA 3NHBA 3QPWA 1KK3A 4JLMA 3SJAA 5IT5A 3ADCA 3TZUA 3A5ZB 1GUSA 3KXKA 2A1AA 1E98A 2J46A 5LD2C 4UNSA 4GNXC 2XTMA 1ZINA 4Y7NH 4QL3A 4CZ2A 2HEIA 2WAYA 4Y0VA 3SBDA 1A2BA 3BS4A 4AIMA 3B13B 2PX0A 1JPNA 2C95A 3J81j 3M0EA 5FOXA 4BRWA 2Z43A 3PXGA 3NENA 4DV7Q 2QTFA 3AKEA 1EX7A 5LMNW 4W5JA 4DCVA 4W9MC 3CCRA 3HR7A 2ZS9A 4G7OC 2WIBA 3CRW1 3PEVA 4IVPA 2FNAA 1SKQA 1SKYB 3QSYA 1E1TA 4DUYQ 1EUJA 1Y1WG 4NMMA 4JZKA 1UE6A 4B3BA 3GMTA 1Q1ZA 1G3UA 4MH0R 4DB4A 4X65Q 2ODNA 1WQ1R 4D4KA 5B64A 3B8HA 4PPFA 2CL7X 4Q66C 1E2WA 1W4CA 2Q9AA 1LS1A 2O8DA 4TZ6A 4TMZA 4MYCA 3TE6A 1COWA 3KYHC 4ZIRB 1VG8A 1IJEA 5JCZA 4LUZA 1N6IA 2PQAA 1VQHA 4DR3Q 4Q1EA 1K3RA 1X54A 3VR5A 3I8XA 2XSZA 3QVVA 2QNRA 4PPGA 2A68D 4Q4HB 4DLUA 3K9GA 4TLCA 4B3XA 3RC8A 2J59A 2WSSD 1HTPA 1NNEA 1T3HA 3BH0A 1JB1A 4NBSA 3RS2A 2NZ8A 3OAAA 3IEVA 3TNFA 1WOCA 2HV8A 1TWCH 3UDFA 2X19A 4GP6A 4IPCA 4P3YA 4DR2L 5FPSA 1Z0IA 2ZYTX 2VP6A 3O8CA 4MRSA 4JI6L 4QIWE 3M3YH 1MV5A 3I55A 2VYFA 2WOJA 1GD7A 4DKAC 2NVYH 1W5SA 2ERYA 4D81A 1P75A 4DV4L 5C3EG 3MWYW 3MUFA 2PI2A 3R7WB 1DO0A 2I3BA 4IDNA 4YLGA 3R8FA 1ESMA 4JLDA 3FDIA 2FGKA 1SVKA 3WMGA 1XB2A 1F6BA 1ZIOA 4QNRA 4RKEA 3VKHA 1I4LD 4YMVA 2VSFA 1NBWA 1XFAA 2WB1G 1M7BA 4CF7A 4JYBA 5DO9A 4JKIA 2AHOB 1KJZA 4MDEA 2EU8A 2IA5A 4KBFA 5FJ8H 3PV0A 1FJGL 1NMGA 2PQAB 2W2XA 2X2EA 4IFDI 1T6NA 4Q03A 4URUR 1UM8A 3U3MA 4PSAA 5GQOA 2NO6A 4FMBB 1UKEA 5M3FH 1VQJA 3ZVLA 3K81C 3ZIAD 1N6NA 2BBSA 3MD0A 4LNQA 2EJFC 2WMNB 3EC1A 3S2DH 3ZZUA 3S1QH 1SZPA 1OB2A 1W0KA 5GJCA 3TQCA 1NVUQ 5CIQA 1A82A 3ZVNA 3WNBA 2F3IA 4OHVA 4G7ZC 3EIHA 1E99A 2VH5R 2H17A 2IYWA 1P61B 1E7ZA 1AS0A 4DNTB 1B9NA 2ZUCA 1H9KA 4OWTB 3CCVA 3HR8A 3R20A 3LX5A 1XEFA 5ELNA 4JLNA 2RGXA 4DIEA 4DUGD 2V3CC 3TEHB 3RLOA 4PC6A 2N46A 3R7WA 3B9PA 1TXYA 1OIWA 1YQTA 2R2AA 1H95A 2XOKD 4WAUA 3TVDA 5JCPA 2Y8EA 3W90A 3C5CA 3MJHA 3BWDD 2QT1A 4JBJA 3CXCA 3B85A 1EXMA 1FMLA 2IYLD 2V4DA 2XJ4A 4ZO4A 1A7JA 1YZNA 4YCUA 2KHIA 2JEOA 1E2LA 2WFWA 3PJRA 1W47A 2BKEA 1T91A 2VP5A 4HB2A 3SQWA 2FU5C 3T61A 1QVRA 1PHJA 2GJ8A 3WY9A 3UE1A 3CF5A 2BC9A 1ZD9A 1OHHD 2ZRPA 5FBRB 5L3SA 5DE3A 2QSYA 1U0LA 1NMFA 4URXR 2PPBC 3T1YQ 4DR5L 5KSOA 3T34A 3M85A 4P71A 4N0EA 3P26A 4G5SA 1DTSA 5BR8L 2GCNA 1V5WA 1AE2A 3FE2A 3OIYA 4EFMA 5L3QA 1O87A 4LGMA 3VU9A 1CKOA 4URYR 4JVSB 4G3XA 1A6XA 1MRSA 1TWGH 1CR1A 3GDEA 2WWIA 3MWKA 3U7FB 3N6RA 4DNIA 4X66Q 3H2YA 3VR4A 2JA6H 3C7KA 4HAUA 4K81B 4V0LA 1NY6A 5IK2A 4EJSB 1R0YA 2ZRFA 1PH3A 3AM1A 1IBLL 4LBYA 1FTSA 2EQSA 3A1TA 1SVIA 4IVRA 5DI3B 1P4SA 4D2IA 1E9DA 4XD7D 1TF2A 3TREA 3VA7A 2ES2A 4OYHA 3T51B 1Z22A 3Q5EA 3KF6B 2N42A 1Z6YA 4UXJA 2O8FB 3A4NA 1C9OA 4ERNA 1TU2B 1MIUA 2UUBQ 2QA4A 3OYYA 4JS0A 1CJMA 3W1GA 1XJVA 1VQNA 4KLZA 3W5IA 4HYYA 3HWSA 3X1ZA 721PA 3U6KA 3DL0A 4XSGA 3TGPA 3SFZA 2PEYA 5FL3A 1J8YF 2XZLA 1E2PA 1WJJA 4PSKA 3B2EA 1AK2A 3J81i 4AYXA 4IDOA 2B6HA 2P2LA 1ZM7A 3EZ2A 2WOOA 3KKMA 4AG6A 2I4IA 1E1QD 4IOJA 3FOZA 5K36H 3AVTA 1T3LA 4P4SB 1AA9A 1P2VA 4L4UA 2PX3A 2BM1A 1J7KA 4M1KA 2I5LX 4JI7Q 4QHTA 1OLOA 1MKYA 2ONKA 3J81c 1KZGB 4JI7L 3N70A 4IEEA 4KCGA 5JHHB 2VL7A 2WJJA 4PZ8A 1C1YA 2PNHA 1M1YE 2DWQA 1OHHA 3AQQA 1Z63A 2J0UB 5DH9A 5CLQA 3LWUA 1KY3A 2AWOA 3S1AA 4AC9A 2VRWA 1LF0A 3TUJC 5JRJA 1TU4A 2JLUA 3HDTA 1XDBA 1ZC4A 2ODEA 1IYVA 1MRNA 3E9HA 1E2IA 2DUDA 3U50C 3E2IA 4A3MG 1E22A 2VHQA 2CBZA 2OCYC 2WMOB 1RZ3A 3DM5A 3KUCA 4DBLC 3MRSA 4PSVA 4XTRA 2DYKA 2WB1E 1E2VA 1N6PA 1Q22A 5EXTA 1EWQA 3FHTA 2ZTSA 1NLYA 4YQFA 4WA7A 1UEIA 4DV3L 2E87A 1TEVA 4MRVA 3A7LA 2OAP1 3KJHA 4V02A 3BH6A 2RHQB 2MNAA 1J6QA 4EQ6A 3RRNA 1G9XA 1GUGA 4KN4C 4XSHA 2CKZB 4YWKA 3LW7A 5JHGB 1U5KA 4HAYA 3AVPA 1VQFA 2OSBA 4IOCA 1WXQA 2ZI6A 2J0QA 1KJWA 2VTKA 2R6FA 3W8NA 3STBD 1WCMH 2CMKA 1QHIA 2WZQA 3EN2A 3HOUH 2OBMA 4H9GA 2QGQA 4LYHA 4Q4JB 4AH6A 2CCJA 4C0KA 3UWKA 4TYNA 3AV0B 4PZ7A 3NE5B 1XNQL 2IYQA 2QPAA 4DJTA 1GUTA 1KMQA 2GA8A 4BEBA 2AXNA 3P4YA 4LDJA 4OK5A 4DR1L 1XZPA 5EUQB 2FWRA 3EPHA 3EWAA 1U90A 4JCVE 1WP9A 2QM8A 4BBRG 3TLXA 4OK6A 4I1VA 3GLIE 3A4LA 2ZAMA 3IQXA 2EFCB 4HAZA 4OL0A 5FBQB 4RCYA 4A15A 4UP8A 1Y14B 1BMFD 3KTAB 4GPTA 3TR0A 2F3RA 1RL2A 1NVVR 4WZAE 3U7EB 2CJWB 2GBLC 2QAGA 1FMJA 2R9VA 1KO4A 5ELOA 4B34A 3K0CA 3BFXA 3STBC 3UE0A 3QBVA 4LYAA 3GEIA 4KODA 4L9SA 3CWZA 4DR4L 4BBRH 1S40A 4LF8Q 2GZHA 1ETUA 2RMKA 4Q9JA 2QF7A 1N6RA 3U3OA 3CQZH 4B3TL 1HEIA 2XJ9A 4PZZA 4DLSA 1WFQA 3T35A 2PT5A 4LF8L 3LRPA 4P0TA 3W6OA 1HNWL 3KQKA 3E1SA 3RLFA 2CLSA 2G6BA 3AKCA 1MO5A 1RRPA 3THXB 3U58A 4P4TA 1W44A 1NE3A 1B8AA 4P73A 1MH1A 2QP9X 521PA 1CKNA 2VQEL 2ATWA 1Q57A 2JXMB 1KHTA 1T0JB 3CH5A 4PO9A 3WP1B 4DR3L 2KJQA 4JI1L 2AUJD 4YY3L 1JAHA 1OTCA 1N5JA 1AS3A 3QNUA 1PH6A 3PFIA 5DSZA 1HPCA 1VQ8A 4JT2A 1EYGA 1UE5A 4DV1L 2N1BA 4LUOA 2F1RA 4V0KA 2AK3A 3ZS8A 2F7SA 1U8AA 4H1VA 2ANBA 2KA7A 2JA5H 1XNRL 2D3WA 4DV1Q 4LV6A 5AK0A 4UJ5A 1LW7A 2Y0SE 2E1RA 1JXMA 2XXAB 1KOFA 4JI6Q 3NHAA 4HJ8A 4ZKEA 4QBIA 1SMYC 5J4VA 1VCNA 3EG5A 1SXJC 5CM8B 1L4UA 1ZBDA 1QVCA 1LABA 2A9KA 1D2MA 4KU4A 5FLMG 3THYA 3CRKC 2A69C 2FEMA 3C4JA 4TWZA 1Z0DA 2GRJA 3CH4B 4FD2A 3QEJA 4YONB 4RG1A 3U44A 2MFIA 1NKSA 4JOIA 1U0JA 1ZNYA 4EPXA 4TLAA 2NZOA 2GEDA 3CUEF 1CFMA 4GOXA 4NYIR 2KHJA 4URWR 5E7JA 2VIIA 2JJ8A 3FMIA 1J2JA 1G8GA 2OO7A 4HATA 1MJCA 4YC7A 4M1WA 3TJZA 1G7TA 4BFTA 2AUKA 4HIDA 2HT6A 2G0NA 1ZNXA 2J5XA 1VECA 3X1DA 1RYFA 3PITA 4EPTA 2PBRA 5HE9A 4Q48A 1PVOA 1DGSA 2N3SA 4LJ8A 4L15A 1PUIA 1N6KA 3K09A 2GILA 1CS4C 2K33A 1JJ2A 1DAKA 1FP7A 1JI0A 1S1MA 3VTKA 2QENA 4UXHA 3V4RA 3FMCA 2D4HA 3W9YA 4X8MA 2PCJA 2N49A 5GJWC 4MDFA 1MJEA 2J9RA 4DV2L 1Z9FA 1RJ9A 4C2MH 2PMKA 4Q5IA 3LNNA 1Z6AA 4WJ3M 4LJ9A 2IS1A 3U3RA 4CDGA 2WJIA 1GZSA 1GUOA 5BQ5A 4GN5A 2IT1A 1AZTA 3LX8A 1SHZA 2BMEA 1A5TA 3SN6A 4A82A 4C0AC 4ZKDA 1W36B 4L5SA 5JI2E 3AUXA 1IXRC 4EFNA 2G1KA 4EQ5A 4L5QA 1G7RA 3B1VA 1JJCB 1E1OA 5BWMA 4A0FA 4NXNL 1E6CA 1GKUB 3BB4A 2ZS7A 5K36G 3WNDA 3H86A 1PLLA 1NY4A 4A3LH 4LV5B 1NMZA 3F5FA 3KFVA 2F52A 3WRYC 3ZZ0A 4A3FG 4LHXA 2NN6H 1DADA 4W5WA 1XNRQ 2QTVB 3RR5A 1KI3A 2Q2HA 2ZSFA 3KKNA 4JI5Q 5B30A 2GCOA 4GKKQ 5CB8A 3F8TA 4G5OA 1UE7A 3TS2A 1F2UB 2VQFQ 2CVFA 3CBQA 2YWGA 3OEED 4ZPXA 1FYCA 4EFLA 3GJXC 1P3JA 2OLJA 4BLPA 1BBWA 4A4DA 2C78A 4ACBA 2UXDL 3I56A 4B71A 1X3GA 4GZMA 4C3JH 1I3QH 4NP6A 3CMAA 2V54A 4BE7B 1II9A 4ZV4A 2FV8A 4A3CG 3EC2A 1YZUA 3GTKH 2R92H 4LF7Q 2JA6G 4IFEA 5DYGA 4EX5A 3GFPA 3EIEA 3OZXA 5DHFA 4DPGA 2W6ID 1G19A 4D0GA 5LMUQ 1XD8A 3R9XA 2FFHA 3EASA 4B75A 4EQ6B 2VP2A 2YZ2A 4XVUA 1FUKA 1GKYA 2IXFA 3VHXA 3GLFE 3AVXA 4DV5L 1JT8A 4POAA 4ZIRA 2PNRC 3ULPA 3GLGE 4OHXA 3MWJA 5J5CA 4DR5Q 1PJRA 3GTOH 2E9SA 4A8JC 1KDRA 2BH8A 5FUVA 4Q4HA 1VQAA 4LV8B 5AJ3Q 4HJAA 3H84A 4RFSB 1C9KA 3TAHA 3SEAA 1XMVA 3ZVMA 1Z5ZA 1V43A 4NH0A 2X1VA 3P20A 3MXNB 1KHIA 2MO0A 1HT2E 3IILA 3TIFA 3CWQA 4TL8A 1VQIA 2JA7G 1ODFA 2GESA 4GI7A 3CF2A 5FPYA 1GVNB 4LHYA 2QMUA 1GIAA 3ZJYA 1CXZA 2J45A 3L0PA 4FN5A 1W4BA 4APVA 2Q6TA 3ZIAA 4GN4B 3BH7A 3ER0A 4LWZA 4BLTA 4DLXA 4B6FA 3H15A 1E9SA 2NZJA 3CR7A 1SMXA 1RIFA 4B33A 3U3JA 2ZE7A 5L3RA 2LWIA 1BMFA 3C8UA 2G9NA 2JIZD 1OFIA 2WKQA 1N34Q 2PI2E 1VQKA 1LTQA 2OG2A 2PL3A 3TSZA 2JAQA 4MZ9A 2QAGC 4A3BG 4PHTA 2FFAA 2GHIA 2I1VB 4ARZA 4JVNA 4X6AH 4JL5A 4UJ3A 2ZJ5A 5IYBG 4UNPA 4YDHB 4OONA 4KFRA 4CRWB 4OWXB 2IWRA 4IOMA 3CRLC 5EUMA 4HIOA 2PH1A 2RHMA 1G21E 2CL0X 2W00A 3PO2H 4L16A 3WBKA 2OFXA 4EJSA 1E9FA 3QKRA 4DV3Q 1YZTA 2VO1A 821PA 5CITA 2BDTA 3AEZA 1Z07A 2ZT9C 4POFA 4A8JB 1E9AA 1TNDA 3FWYA 1NJFA 3IIJA 3IIKA 4IW3B 4RFSA 1KNXA 2ZITA 5C44H 2BJWA 4NHOA 1FL0A 1CULC 1G8PA 3AF2A 3W5JA 4JI0Q 4N0DA 1ELOA 1XD2A 3EA0A 2DR3A 4UKDA 2QMEA 4X8LA 2A6HC 2EWVA 1IQPA 3B7GA 4M9ZA 5E7NA 2BE5C 1WB9A 1DS6A 3SQXA 1FX0B 2ZYWX 2KBNA 5JLJA 3JVVA 3U4QA 4IDHA 1K8GA 4YCVA 1DBSA 5AJYA 1Q12A 3ZQJA 1N33L 5JBQA 3NVAA 4W5HA 4LK2A 1UEJA 4M8NE 3A7AB 2A6ED 4LUVA 1XNQQ 2IS2A 2GZAA 5ANRB 4OI1A 1U98A 4JJKA 3V00A 4A3BH 1JPJA 1PH1A 2ZSAA 1Y8PB 3NH6A 5EP1A 3EX7C 4FCVA 1Y1WH 3LH5A 3K0CC 1D2EA 2MSDB 3GJ7A 3I4LA 1XEXB 1YU9A 1Q1EA 1UDWA 2GAOA 4Q9LA 5E4FA 5JJIA 4M2LA 4S35A 1JJ7A 3IO3A 4GOKA 3PF4A 5IYDH 3CO5A 2CWAA 3OESA 4D4MA 2F4VL 1YZLA 4ALPA 1HR0L 2Q21A 4UXIA 1E9EA 3I8SA 1ZM2A 2IF2A 3U61B 1IONA 3QE0A 1IXSB 3OE7A 1DAMA 4R2IA 3I4MH 2PEZA 1R0XA 1G291 2CK3D 2HCBA 1VF7A 3S1AB 4DLWA 2QP4A 1OFHA 2PLRA 4PZYA 4X64Q 3MMPA 5CJPA 4K0KQ 5EE1A 2IXGA 1YZ6A 4DAMA 3C41J 3CX7A 4V0NA 4O3MA 1GO3E 4X64L 2WWYA 4NCHA 4A93H 4B3GA 5KNBA 4LYFA 3WMFA 3U4QB 4RCNA 1V1QA 2DNCA 4GNXA 4EKDA 4YXWA 2W2VA 2JLXA 2ONJA 1NBME 4RZUA 3UANA 2RB4A 4DLRA 5FOUA 4DDWA 2R7ZG 4O2RA 2GBLA 1IHUA 3QPUA 3FHOA 1X8JA 4OQLA 2FSFA 1TPZA 4BFXA 5JEAH 1U2RA 3OHMA 5F98A 1UBFA 1G4AE 2R93H 3C16C 1T0HB 1K83H 3WP0A 3O8BA 1EG7A 1HNZL 3F2CA 3CW2A 3DZDA 3OEHA 1C4OA 2ZROA 4TLBA 3GLFA 1TAGA 3SGIA 3AEVA 1ZJ6A 4JI2Q 1XJCA 4QOSA 3EBEA 4IFDG 2PCLA 3BAFA 5KTYA 2VUMG 3QKUA 2V6JA 4C3IH 2V6IA 1EWHA 2ZR0A 2C96A 3QUSA 1AS2A 4P31A 4ACAA 2XSZD 3L43A 3NDBB 2CNWA 3AB3A 3W8RA 4XVRA 4A0GA 3DO6A 4R98A 5IDVA 4B6EA 2DGYA 5FR2A 4DR4Q 3L2PA 4MYUA 1KJYA 1P73A 1PZNA 3HOZH 2XGJA 5BYJA 4D4JA 1I94Q 3CD6A 3AF0A 1H8ED 3HYRA 2QEXA 3M1IA 3VNUA 1FPMA 3KJIA 2B29A 3GD7A 4A3LG 4NU0A 4RVCA 5SZKB 3IFTA 3P32A 5J47A 4MGKR 2AN9A 4H02A 2YTVA 4A3IG 4IKEA 2G83A 4UNNA 3RHFA 2A78A 1Q1BA 1XPOA 5A0FA 3B1XA 1YEZA 2RHDA 2LKDA 2F4VQ 1LTLA 4LC0A 4E22A 1P62B 1KI7A 2HXSA 1NN3A 4DDVA 1WCV1 3DPUA 1YJNA 2OBNA 4JLAA 2CCGA 4DUGA 2N8NA 4O0AA 4B3CA 4MRRA 2FZ4A 5AJWA 1Z3IX 4KBGA 1XCGB 4HUQB 2BMDA 3HOUG 2D2CC 2KWIA 2FG5A 2YOGA 3WWVA 1T8UA 2VEDA 4RY2A 3D31A 3KF8B 3K8AA 3I92A 5M04A 2GXAA 1WA5A 3SNHA 2HJGA 2ZRAA 3IPXA 3T1HQ 3FKSA 2BMJA 5FOSA 1HNXL 4OX9Q 3BE4A 1H9RA 2VS1A 2KI5A 4DV2Q 1GITA 4PXAA 3QI2A 2OQKA 4GS3A 4PC2A 3RAPR 1HCZA 3OEHD 1GOTA 1KY2A 1GKHA 3KLWA 2WHXA 4GFDA 5FBWB 4RSGA 4BFVA 4Q21A 1N8RC 2Z4RA 3J81k 2XZOA 2BJVA 5J40A 1XP8A 2GTPA 1DOAA 2QAJA 1EFHA 1Z2AA 3K9NA 4R7ZA 4DAYB 5H68A 3RS0A 3L2OB 1LS6A 5JJKA 3HOXH 1IY2A 3HOVG 2AX4A 3I7FA 4KVAA 1FTNA 5GAGC 1KIXA 4JC0A 5IK2D 2RGBA 4KFTA 4A3MH 5M3FG 2IX3A 3CZPA 2ZRJA 4R71A 1EOVA 4JBMA 1Z0KA 3D8BA 4QNMA 2HHHQ 3CLVA 2RGDA 1ZYUA 1K5GA 3RNUA 3HOVH 1S3SA 2RGAA 3N5CA 1OB5A 5HY6A 1QZXA 1Y69U 1SVLA 2ZE8A 5KSPA 2AHOA 2D5DA 4EPVA 2C9OA 2B3GA 2BBWA 5BYKA 5FTMA 5FOVA 2WSMA 2Y0SG 1U8YA 4LBVA 2VSOA 2BA1A 1W46A 4A9AA 1VIAA 4B74A 3PUXA 2FEOA 3CRQA 4A3GH 1E2NA 1Q86C 4PHFA 4Q47A 2VQSA 2ZUDA 2UUCL 5KU1A 4BRUA 5IE8A 3GJ5A 4B32A 3H0KA 1RPZA 2HF9A 2R8RA 1OXVA 2QROA 3VAAA 4PQFA 2QBYB 5GAHC 1D5CA 1QDEA 3PEUA 4JT4A 3AUYA 4GLVB 5DGXA 1UJ2A 4BXXH 1KSGA 2UUBL 2OESA 4B47A 3GLGA 4M9XA 4I99A 3HOZG 4RD1A 1QVFA 3L0OA 4DSTA 4D26A 4LFAQ 3KDSE 1OH8A 4A92A 2E75C 1NIPA 2P3SA 221PA 4TTPA 3X1YA 4DR6L 3H0GH 1BYUA 4DV5Q 1YITA 5AR1A 1RKBA 2ZI4A 1Z7TA 4HAVA 1IM2A 2EVWX 3T1HL 2VSXA 4EIWA 4JI8Q 4IFDH 4JI4L 2H5XA 2R65A 4HEJA 4BLSA 4OHYA 1AM4D 4US2R 1JQJC 4B3SQ 1IN4A 4JI4Q 1L7VC 1CJVC 3T1VA 4DT1A 4IJMA 5JRZA 3GQBA 4WOPA 4BBSG 4DR7Q 2R93G 2ECKA 3UPUA 1IOZA 4KLNA 3B6EA 1Z6TA 3IEUA 2RF4A 4MKGA 4Z1MD 2EDGA 3CZQA 1E0SA 1YI2A 5F9HA 5C1BA 2OEPA 2TMKA 2QL6A 4UP9A 3QG1A 1UWVA 5EE3A 4DSOA 2JLQA 1S3OA 2ZXUA 3CPEA 4TMTA 3TQFA 4ITRC 3BORA 5HE8A 3LW8A 1QJOA 5DNYB 1ZUIA 1QG4A 4IOLA 4BY1G 4LF9Q 1E69A 1KZ7B 2ZYVX 1JECA 3F2BA 4RD3A 5H70A 1KQSA 4FDBA 3SHFA 1RRFA 1VIYA 1X3EA 1D9XA 3K0FA 4H13C 3BD9A 1HQMC 4DV0Q 3E70C 5UKDA 1OKKD 1GL6A 1M7HA 1II8B 5IP9G 1M8PA 2A5YB 2J7PA 3MAAC 5FI1B 3ZS9A 4CEIA 3BG3A 1KMHA 3AF1A 1E4YA 4DV0L 4CW7A 3VX3A 3KF6A 3S17H 2ZM6Q 3UDXA 4PANA 1OF1A 3I4MG 1BIFA 3MGCA 1KK2A 1IW7D 3M9BA 1ZNZA 3PENA 2IK8A 3EW9A 1DAFA 2OILA 5KPDA 1UE1A 4MRPA 5HZHA 2HLDA 4PHHA 5JECA 1W4RA 4AQYQ 1DEKA 2G1JA 3NC1C 3NKVA 1GUNA 2AR7A 4IXNA 1K0RA 1GHKA 1G3IA 4WZBE 4DR7L 1TUIA 1CJKC 2ZRMA 5C46F 4DEXA 2VP0A 1SXJD 5FUXA 3W5OA 2IUTA 1ASZA 2H5EA 5AJXA 2XB4A 1XMQQ 1EFWA 1R6BX 2ZVPX 3F3YA 1XTKA 4MKIA 4JLOA 2JATA 2W58A 2H8KA 1SLJA 2Z5FA 1XCMA 4R4CA 3THOA 2NMVA 5EZ6B 1Z6XA 3F1ZA 4OJQA 1L0WA 4CT5A 5EP2A 2K50A 1U8ZA 1JJGA 1J8MF 5C4JH 2V1XA 4W7SA 1GILA 2F1IA 1HZ9A 2V7QD 4LFAL 2WKPA 3HPRA 5A35A 5FLMH 1ZU4A 3LLMA 1VPLA 3GEEA 4PFSA 1VQ9A 3FPAA 3B6YA 1JB7A 1M7GA 2D7CA 4LPKA 1H8HA 4GL2A 2CNWD 4CVNA 4DCUA 4CEIB 3VR3A 2VQFL 1E9RA 3GCGA 2ANCA 2REOA 3BRWD 1IZ6A 3HKZG 1Q20A
chains in the Genus database with same CATH superfamily
5KU7A 1WXDA 3MQFA 2HD4A 3DMYA 1R9TB 3W1VA 2QZJA 1RR6A 3LBAA 5JT1A 1TCCA 4FGUA 1E2FA 5J4LA 3RSGA 3HXOA 2Z6VA 1J06A 4D9HA 1J2EA 2PQ6A 7MDHA 1E1KA 3GLHA 3MTQA 3KCNA 4G8BA 4G0WA 4AAYA 1L2FA 1D5ZC 4MUNA 1B6SA 2CL5A 5AM1A 4YQEA 3BZCA 4V0OA 4ALKA 2Z6AA 1ZJ5A 3GFQA 3SC2A 2E2HB 2OVBA 3U9OA 1Y34E 1RYNA 4W6ZA 1H9SA 3I4NH 1OJ7A 2EDAA 3AF4A 2MSNA 3D0OA 2KENA 3UPTA 2IHNA 1JFFA 4Y2YA 3H5WA 3GPBA 5BW6B 1ENFA 3QO2A 1Z0FA 3BFVA 5JEAJ 4C0SA 1UEBA 5I6WA 3EMBA 4GZ5A 4J16A 4JI2B 1TGVA 4LFBL 1PVDA 4A0HA 2J0SA 1SBTA 4F1WA 2ZJ3A 1NJSA 5H1SE 2OBYA 1Y6ZA 3HMQA 2AXPA 2FRDC 2J87A 3EH1A 3HSKA 3PUZA 4A3IB 1WHSB 4P6VF 3QVMA 1E7WA 4WASA 4ZCTA 2Z2IA 1FW6A 3H9QA 4G0YA 3L6BA 1IVNA 3DCIA 3ZQ4A 5AD1A 1PS8A 3SK5A 4NPSA 3AB9A 1BAPA 1WNTA 2OCKA 3MJTA 3MJVA 4KXUA 4O5AA 4PTLA 4HNUA 1Q46A 4DA4A 4KW7A 1VL5A 1HE8B 2P6UA 3G9UA 4HDMB 2VF7A 3C6MA 4H35A 3SK6A 3QF4B 3VHLB 2PR7A 1YK0A 2HO4A 1NOIA 1FU8A 3LL4A 4RJIA 4RK1A 1PEYA 2DOKA 1CLUA 2A5LA 3ACDA 4HNSA 4JX8A 4NX2A 5F4BA 1LB1B 1RJFA 2J0UA 1CNEA 1M2VA 2OGUA 4B3HA 4BTVA 1C7RA 1OH5A 3D8HA 1DCZA 1L5HB 1OY1A 4C9BA 2C35B 1NBIA 3SS7X 2PX6A 3ICEA 2F0IA 1NZJA 3SMQA 2A3NA 4NU5A 2RJOA 4J1SA 3SM9A 2IFTA 3V8PA 4CE6A 1X7WB 1YS7A 3O3OB 3JYQA 2Z08A 4CM4A 3CH7A 2WU8A 3C5WP 5F9FA 4MO2A 2FXQA 5JS2A 3RGWS 3H2SA 1EYCA 2DLNA 5GROA 2IHEA 5E8JA 2ZR9A 1DQSA 1R7RA 2R8ZA 4DLTA 1TS3A 3GZNA 3G2PA 4NQRA 4AN4A 3DLLA 1JXOA 1Z36A 3CS3A 2ZJBA 2YXLA 4IDBA 4Q1DA 2OCIA 3NKLA 2ZKLA 1N8SA 2F43B 1V8PA 1ZXLA 2F90A 3FSGD 4RL6A 3WO0A 1F8GA 2X2PA 3CSUA 1BMTA 5TGZA 1U2SA 3A56A 3WNZA 1OVGA 1T26A 4KXFB 3RJ5A 3S1LA 1V5EA 1WVIA 2YJ6A 1GPUA 2JEBI 1FLAA 3BRSA 4B6OA 1CR6A 2I6UA 4QFBA 1QSGA 1NR1A 1TS5A 2YBEA 5DN6D 3MS7A 2IYFA 4WERA 3NANA 4ME5A 4R4TA 1XJQA 1YQGA 3K16A 3P2EA 3W04A 5AVUA 2EFEB 2PMDA 5TMPA 3IVAA 2BHRA 1KAWA 1YJ9A 2PYIA 3C3JA 3Q4GA 4FE7A 3BFPA 2VZAA 4MGHA 4BL5A 2KE5A 2HQSA 3N5KA 1JEOA 2X0RA 3IP1A 4W9RA 1KAHA 2D1SA 4MW1A 4XOIA 1U31A 2JLSA 2UKDA 3ZCVA 1JDBC 1MIOA 1WLSA 2Q7XA 3H13A 3H83A 4CDRA 2R6AA 4K6MA 4JI8B 3V1NA 2GPNA 5DCLA 1TX4B 2MWMA 1GAQA 3OCZA 4KLCA 4TM8A 3HVUA 4F3KA 4ND7A 4WEOA 1EK0A 1X32A 2PKYX 2FWJA 2FZWA 4PBSA 4FFWA 2P2NA 3F6SA 3OAAD 5EXDA 2E6KA 2GN0A 4FEAA 3FTDA 4GXNA 2XXBA 4DV6L 3L9XA 4HDQB 4KO1S 4RVDA 1W2GA 5FUYA 2CJWA 2OQIA 2QAGB 4NMZA 4HZIA 2DHQA 4IZ8A 4AX4A 3NHRA 1L5RA 3D4PA 3CONA 2FG7C 5ADUS 3O92A 4KJXA 2XWQA 3CINA 2D59A 3L6UA 2PW7A 9LDBA 3TG8A 2F55A 3AL2A 1X3QA 1QOZA 4PRYA 4IS3A 4DKXA 4DPKA 2YYAA 3PGZA 4EGVA 4BNUA 1X1CA 2QB5A 1XCPA 1KKMA 3GUYA 3CP0A 1HNWQ 1PV4A 2B4YA 2GOYA 1M8KA 3AR6A 4C4YA 2PUGA 1EZZA 4HP8A 2G9DA 5JR3A 1YNJC 2BOSA 1NIJA 1L7NA 2YZNA 3TMYA 3TSCA 4Q6BA 5BSWA 3KQHA 2HA4A 1QU3A 1VE1A 5EAYA 1TYCA 1EWCA 3IBGA 4FHDA 3R5KA 2HF7A 1L7MA 2X77A 4IV8A 3I9FA 4UMFA 1SR3A 3RANA 5EKXA 2HEGA 1PZMA 2I4NA 1ZK4A 4DZTA 4LQCA 1TKWB 2EJBA 1KVRA 3NBFA 4RENA 1H42A 3F0TA 3FHWA 4CLOB 4ZQEA 3GN2A 1SBCA 3E48A 3IRVA 1YHYA 3G0GA 3NETA 4TWIA 4QGGA 3WO1A 4A73A 5KJ1A 4QMGA 2L9HA 1RWWA 2OUIA 3LM8A 2OV2A 3PIRA 4L1KA 1UBKS 3SHWA 1YO6A 1UF9A 2A0WA 1AUPA 1ULUA 1XMQB 1MAUA 2C7BA 3UIEA 5BR7A 4MQEA 5C18A 5ICCA 5JXWA 1M5UA 1YQ9A 5AI0A 4D46A 1PVVA 2WYIA 2Y6VA 2NZ1D 1VL0A 5FTLA 3QIAA 5C8DA 3TXYA 3AVYA 3FPPA 2K32A 3FTCA 1B23P 1Z06A 3CO0S 1Q0UA 3D4DA 1WCIB 5IH3A 2DT5A 3REFA 4B2IA 5CFOA 3S1RB 5JISA 2VUMH 1QHNA 1YI1A 1IW7C 1A15A 1OA0A 2OGSA 1WBDA 2R79A 1E1QA 1ZUHA 2UU9Q 5CG2A 3O3NB 4DUZL 1K6MA 1T8WA 1JG2A 2Q8PA 3QFHA 4QIWB 3R2JA 4YLEA 2VK2A 4RWSC 4MV3A 1P6QA 1WYDA 2AUTA 3BC1A 3LT5A 4EJSC 2I22A 3M4QA 4JC8A 1ZI6A 1TO2E 3G8YA 3MJRA 3QXGA 1MB4A 4GMDA 1SE8A 4ES6A 3UMYA 2FPSA 1POWA 5BNWA 5BN5A 1X19A 3ABSB 4IEIA 1M34B 4JITA 4EO7A 1XMIA 3WAJA 2W0MA 1GNVA 4JJZA 4C5AA 4G5HA 3OPMA 3R6LA 3RREA 2OC9A 1LPNA 2I2WA 5CFZA 3EXHA 4GKJL 2RGNA 3ZX5A 4O1HA 1Z4KA 1R0ZA 2EYUA 1VPWA 5DV9A 3MS4A 3SC2B 5ER6A 1J0AA 3ZK9A 4BIMA 5B7QA 5TQVA 4BBZA 2FGJA 5J5VA 1TC1A 3EF1A 3KZ1E 4LAAA 3DE4X 4QRIA 3ROGA 1UP6A 1CDDA 3INTA 3SQOA 1J5EB 2P77A 3ZNPA 1XVVA 4PAGA 1H8HD 4IIDA 3VHXB 1MCZA 3R3HA 1M2OB 2JW5A 1AZLA 4XWYA 1XNHA 1Z7WA 3KFUA 5HIMA 3UBTA 3O9MA 4DDKA 4RF4A 3NW9A 4QLOA 1DEXA 2PT9A 1AZPA 3EDOA 5CT6A 2R44A 5AKXA 4KZKA 2EJGC 1QB5D 1M74A 5K51A 4NBLA 4FBGA 1SG6A 3MIZA 4P34A 1IRIA 1P2UA 1CRPA 3R3JA 1J8FA 1NHWA 1D5MC 1WCMG 2OTLA 3TZ6A 4A75A 1S3GA 1T5TA 2NYZD 1BXTA 1Y37A 1AK9A 3LBHA 4G4SO 4OXPA 3H0GB 2W9XA 1RBQA 2X76A 3GUCA 4PLGA 1N32Q 3OTOL 4QJFA 3PO2G 3A5UA 2BVNA 2IQ5A 3EXEA 2Q8TA 1WE2A 5DWVA 5EG5A 3WMXA 1GG9A 2NPOA 2YNMA 3EUAA 2I7XA 1ZXXA 4JQYA 4JVLA 4P35A 1SN8A 2EIFA 1JFVA 4ARVA 4QJ3A 2Q1XA 1F0KA 1D7QA 3M5DA 3MTIA 3BGIA 3AR2A 3VR6A 4IZ6A 2HQ1A 1CSEE 3ZE2B 5A9TA 1E4VA 3UAYA 3T5AA 4FQ8A 2XNDA 2Z9CA 1UWKA 3I23A 4O1MA 4CPDA 4G8JA 5B37A 3ERQA 3T1QA 1GTMA 1OR8A 5FH9A 4E5UA 5IF9A 3ETGA 4IJHA 5IXSA 1XTIA 4I8XA 2QA5A 4RXMA 1E2KA 4H6PA 2L5TA 3LP8A 4M0LA 1NLMA 1XA0A 4ITVA 4QRHA 4ZGWA 1XMOL 2CLDX 2SCUA 1ZJZA 3IDQA 1OI2A 3A9UA 1AV7A 3AJRA 3DXYA 2Y67A 2VAXA 4PAWA 3WLNA 4G97A 2R6ZA 5FLXL 1N8TA 3SK4A 4UP7A 3A1UA 4M1YA 4N7JA 4RCOA 3QITA 1SDFA 1NE2A 1YRBA 2I8LA 3CHYA 3RTAA 1JEYA 1P2SA 3E1GA 1CKNB 1GTJ1 4B44A 5CVUA 3X3MA 1LVUA 4G25A 4JLPA 3ONWA 4JLBA 4QHSA 1T8RA 2VTEA 4KY5A 4II3A 1Q82C 4B79A 1XVAA 4F38A 4R1JA 3I1FA 3FSJX 4IIEA 3T1TA 3WKBA 5IWAB 3THYB 2E5LQ 1F14A 4BBPA 3OLVA 1O9GA 2WYUA 4XX1A 1PH8A 2FSGA 1W48A 4UQPA 1B8VA 3PHHA 1X86B 3WDSA 2R93B 5FT9A 1L5QA 2WEKA 1EB8A 2O0JA 2V3VA 2VJPA 2Z1NA 3Q3IA 4ND5A 4KI0A 3HB5X 4U63A 5KAPA 4RKRA 3EGEA 1EM8A 3SIWA 1QNUA 4RFBA 1MT3A 1VKOA 1H2EA 3Q1KA 4ZVLA 3RKSA 3UG6A 3F9CA 4AZVA 3CKLA 2WNIA 2XE8A 3IMFA 3QKTA 4KFSA 4ZRDA 3DZJA 3IBTA 1M76A 2FTKE 2HBRA 2KEEA 2JLVA 4ZV9A 3S15H 4O2BB 4KKSA 3H8JA 1PX0A 4YB8A 4U673 2XMDA 4RV4A 2CHGA 2AKYA 3BMQB 4C0QC 3I4NB 1ZDMA 3ZDDA 4NCAA 4LA4A 1Y8RB 3WYAA 2VXWA 4MHEA 4GZYC 4F8EA 2LBPA 1F8XA 4JR0A 3UJDA 2WJHA 3NM4A 2K03A 1VDMA 1ZHOA 4B5KA 2WZCA 1NVMB 1H93A 3H9GA 1JBQA 1K8AC 1P91A 2PSEA 2ZB2A 3FKSD 4NE9A 3VZBA 2D0DA 2G04A 1ENAA 5A4JA 2VUMB 4IFBA 4YCNA 3ZVKA 1E3WB 2ZULA 3EW7A 4Q4LA 2AC4A 1DJNA 1VL8A 1VP9A 2Z98A 4QRDA 4C05A 2OENG 1XAGA 4X44A 1TZBA 1P2BA 1GA1A 4LNAA 4F6RB 4DCSA 2FETA 5JJ5A 2DY1A 2P5YA 3COPA 1WBJB 1MOZA 1J0XO 3IAYA 1ZYRC 1JR3A 3FMVA 3QEMA 1VQOA 1XDDA 3NBHA 2V6GA 2TMDA 5AKKA 5DNDA 3ZGNA 5LSAA 3KZXA 2PUFA 3RB8A 1GHJA 3JASB 3S1NB 4TSKA 1YR2A 1YKGA 5KVQA 1X92A 4HH3C 4QGSA 3ENWA 2XOXA 3NOOA 2PK3A 1JKXA 3NUZA 1X7ZA 1LX6A 2CYCA 4GX2A 5G02A 1WSAA 4CL3A 2HYDA 3RS5A 1UEAB 2YFHA 3TNLA 3PTAA 3SHLA 3G2KA 4ILWA 1VMAA 1LM0A 4J1MA 1LV7A 3M9LA 4RPIA 4IDCA 5CVCA 5A5FA 4MYDA 4DIOA 3A6ZA 3FZNA 4BNLA 2JFXA 4OX9Y 3HDJA 4F93B 3WLKX 10MHA 1ZIPA 3CV3A 2G36A 1TIPA 4IO0A 2LIPA 3IV6A 4RIIA 4E2XA 4N18A 3IERA 4XGRA 2WB4A 3Q9NA 4J03A 1G7CA 4S1TA 5EP3A 3VGPA 2HHJA 5AFWA 4B4KA 3ZCPA 5COYA 1GPAA 1TZCA 2MQHA 4AYBB 3RFUA 1WVGA 2HJHA 3N7UA 4DMKA 5B3KA 5IGGA 4U7JA 3JD3A 2GRAA 3G68A 3S4YA 1CV2A 1PQUA 4B76A 1LO5D 1SVNA 3K8OE 3P7JA 2IEIA 4RK4A 2W70A 2VQFB 2IS4A 2F0GA 5A2QE 3L7IA 2O2SA 4MRAA 3X2SA 3H7IA 2VN8A 4QT0A 4AZWA 1C0EA 3CCMA 4FXDA 1QRAA 3TUIC 1Z45A 4G67A 1OWMA 3H2BA 1Z73A 3TJZA 1PTOF 4QDKA 3K53A 2I91A 2B2VC 4GW3A 1M34A 1DX9A 3DWQA 1OI4A 3EDRA 3HBMA 1M1YA 3NTIA 4L28A 4S2EA 1ZXTA 3QPDA 4CMEC 2Z5VA 3B6KA 5DTEA 5HF6A 1NAIA 1U99A 1CJTC 4OLJA 3G89A 3UUGA 4KZPA 3W5BA 4HJ9A 1Z7EA 4OHZA 3OZCA 1K9MC 1BSVA 3JD0A 3VYWA 4E7OA 3U5TA 4IIYA 1X38A 5KUTA 4DXFA 4TUYA 5E3HA 4B0PA 5ADWA 3CA8A 2WWVD 3SQLA 1UOOA 4Z0TA 4CIAA 3F2UA 1KFBB 3M89A 1RPTA 1K28A 2FRDA 1W36C 5JZSA 4M86A 3ZZTA 2XUQA 1X7HA 1XCJA 4HMPA 2UYGA 5LMNQ 3VH2A 4AYWA 1ASYA 5AW2A 1ISJA 3WWYA 3PUWA 1JJVA 5IRCD 1LC0A 4KE7A 4DIMA 4K8OA 4KTTE 3FJYA 3JARB 3KSDO 3M33A 5GIOE 5F1OA 3ZOZA 4EQNA 3EDQA 2NT4A 1PR6A 2PV0A 5BRNA 5A6SA 3OC6A 3FAZA 1K0FA 3PZRA 3GTMH 4ZVPA 5KRUA 1K88A 4JUAA 5AHKA 3RTEA 2MJ8A 3A1SA 1XL0A 3S16H 3V46A 1CHNA 2NXEA 2XA2A 3JAWB 4BY7H 4OJNA 3FUTA 4QXAA 2C2KA 4HZGA 4Q0FA 3ZCRA 3LQQA 5IC4A 1NQAO 2GSDA 3K7AH 3ZGYA 1XKQA 3AR3A 4XT1B 5HIKA 2JA7B 5HX7A 3ZE0B 2H31A 4CDEC 1GPWB 5E6SA 3N75A 1MJGA 3NHPA 1O80A 1Z75A 1V3UA 3DUFA 4EKIA 1QCCA 5F1PA 3W9UA 4E2WA 4CM4B 4U5QA 1QNLA 1PJ8A 4ER0A 2JA1A 4D96A 2BD0A 4TN5A 3EWSA 3MTBA 1G51A 4CJXA 3OFVA 3UA4A 1IJBA 3I0MA 4DXHA 4A6PA 1VMKA 1ND6A 4MAFA 2WY2D 5AUNB 4CEHB 3ZWPA 5CB4F 3PC2A 3OJEA 1YH3A 3ESDA 3JR7A 4JJ7A 5JE8A 2FW7A 2OZEA 4BUZA 5F76A 5FX2A 2YJ5A 1YS1X 1M2WA 3NEYA 1L1OA 1IXRA 1ZPDA 1EFAA 3GGGA 1EWRA 3GF4A 4TYMA 1E4OA 4UHFA 1GPNA 5KOYA 4PAMA 4FGLA 2DN8A 4U00A 5FWXA 3BIFA 3C8ZA 1GTVA 1JVSA 3OCXA 4NV3A 2W2KB 4WXPA 1M72A 2XLCA 1T3SA 5DGIA 4CMCA 1WTQA 1SC4A 2Q3HA 2ZB8A 2JLUA 4IIGA 2EZUA 1QZGA 2O0LA 4F9GA 2VOJA 1Z3CA 2HA0A 4B46A 4HCSA 5ALHA 2WINB 3TINA 4RK5A 1Z6HA 2BR4A 1PFYA 1ARZA 3OPVA 1QLJA 4TZTA 2SKEA 3RJZA 1C4WA 3MCTA 1CEYA 1B3QA 5HIJA 5FDFA 4A16A 4DV6Q 2B0JA 1ZGHA 3P2IA 2H2IA 4HRAA 2V5UA 2V7WA 3D7SA 3DV9A 3HKBA 3QHPA 2PN1A 2R6DA 5JAUA 1L3IA 1WXHA 5KB3A 5IASA 3PR1A 1RVDA 4UY8C 1W0CA 2C4HA 2XUZA 4FNAA 3IJ5A 2KCCA 5P21A 2L55A 1WCIA 3A74A 2CHBD 1XSEA 1M73E 1ZK0A 1GPMA 2IDKA 3FMOB 3L82B 2ES4A 4QFMA 5AW4A 1TK2A 2ZRDA 2K5NA 1PT9A 4N9TA 4OELB 3HYLA 3EEBA 3DC2A 1L1RA 4JI1B 2H57A 3EARA 1TJPB 2HU7A 1OV4A 3S29A 3A4MA 8AT1A 1NUUA 1SZCA 3ZKAA 3U7QB 1AHIA 3T7SA 4LYGA 3GJQA 3ZBQA 4XDYA 1QH0A 4XTCS 4BU1A 4QYIB 3DEPA 3UM9A 1P9LA 1PR3A 3WLIA 4KN8A 1EVEA 1XTJA 2OV8A 2OXEA 2VF8A 3AT1A 1QHSA 2EKPA 3CMMA 3H87A 2CUKA 3MJSA 4QGBA 3RWMB 1RRVA 2CW0D 1YJQA 2CFTA 3KUDA 1VA5A 2ZUBA 3OZEA 1NMEA 3OOEA 5CV4A 3BZUA 1LCIA 4Z9AA 1XU7A 1NONA 2UUAL 1RW4A 4F6RA 2HUPA 3U5ZB 4QXMA 4Y2SA 3K30A 4BASA 4RY8A 4EHHA 3WYDA 3U19A 1MW8X 2KEDA 2RGEA 3EF3A 3I2IA 4HAXA 2FZGA 4RF3A 4Y6LA 3KOOA 5LYJA 2KM1A 4ZICA 3IHKA 2ZCVA 4M76B 3IOCA 4RA6A 4XQCA 1BCRB 2C4UA 2QV0A 5ESWA 2Q0HA 3AIIA 1YDWA 1JJBA 2WD8A 5ITZA 1CYDA 1BXGB 3PA8A 4US1R 2B7LA 1GRNA 3MTJA 2QL7A 3OIVA 1Y3AA 1R4MB 4EABA 1TKRA 2FUNB 2JIPA 3QFRA 2I7CA 1Q1QA 4LY3A 1DC6A 1NUAA 1QX4A 2DBQA 2DKNA 2ZJFA 1BS2A 1NKTA 3ZDEA 4R4QA 1GDDA 3STYA 2LFNA 1TQ4A 2DT8A 3ABQB 2YW2A 4TMVA 3OT4A 5KTMA 4DUZQ 2OLEA 3R0XA 4HGRA 2H3EA 1ZI9A 4MS1B 4TS1A 2F6RA 2VDNB 4TV9F 1UBHS 1B3AA 2AOUB 3QFTA 2OE2A 3R3ZA 4LF4Q 5IMSA 3JZAA 5IM4A