4JBWA

Crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
370
structure length
370
Chain Sequence
b'ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transport system permease protein MalF
publication title Carbon catabolite repression of the maltose transporter revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 78
structure length 370
sequence length 370
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4jbwA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jbwA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jbwA01
3CCUA 1WXQA 4UY8C 4JT2A 3TLXA 3H0GG 1FP6A 3JC66 4KLKA 3B5JA 3UG7A 5KUTA 2ZJZA 1SROA 4D0LB 3ND8A 2Z5FA 3I92A 4TQ9A 5J4HA 1SZPA 3HOVH 2A6EC 2A30A 1R5OA 4L4UA 1OXXK 4CGZA 5FLMH 1QG2A 5FOSA 4XWOA 5GAHC 2HDNB 2P6UA 1HURA 3U3JA 4Q4JA 4JCVE 1K5DA 4GNKA 2HYIC 1KMHA 1ZIOA 3DLLA 4X8OA 5L3RA 2PX0A 3CMEA 3X1XA 4TLEA 1NI3A 4B35A 4YDHB 4ZDJA 5IK2A 5JFGA 1LUZA 5AK0A 3EN2A 4JI4Q 1VYTA 1NN0A 3W8RA 1T0HB 4JZKA 2I5HA 1UF9A 2PI2A 3B1VA 5F9HA 3CXCA 3GEHA 5IY0A 5IP7G 4QXAA 4DRZA 4YMVA 2QA5A 2V7QD 4P0TA 3CRRA 4DJTA 3BJUA 1HUQA 2IYTA 3I56A 4DUGD 3HPRA 1TUIA 4FMDB 2NN6G 4G7OC 2ZSAA 3DMNA 3K0CC 4I1SA 4A8JA 2PPBC 1Q86C 3J81c 5GJBA 4JIMA 1GO3E 4NDZA 1LYLA 2FXQA 2MMCA 1FL0A 3LV8A 2IYSA 4PANA 5J5CA 1IJEA 1SKYE 1XCMA 1EFHA 2JASA 3BC1A 1KJYA 2IUUA 1DAIA 5C3EG 4R4TA 2VP4A 3AP2A 2AR7A 1HQYE 2IF0A 2YOHA 3BH0A 4Q48A 2OTJA 1RZ3A 4UNPA 3VR1A 4A4DA 1IOZA 3K0SA 3GJ0A 2QTVB 5JRJA 4KN4C 4DLVA 4OHYA 5JEAJ 1GKIA 4AIMA 2R65A 2QM7A 4KFRA 3GFTA 4IJHA 4N1AA 521PA 1AGRA 3PUZA 1HH2P 3NENA 4UP7A 2BA1A 2Q2IA 1HE8B 1KGDA 4JV5Q 4HDOB 4PC2A 3U7GA 1BMFD 4A3MG 2F4VL 5P21A 3MRSA 2WAYA 5FPTA 1F60A 3KJHA 1JQJC 1ODFA 4L5RC 1IONA 1H9MA 4FMDF 4EJSC 2FFAA 1WQ1R 1SXJB 2SHKA 4GZYC 3K0EA 4WBSA 4DC9A 1UPTA 2LMCB 2Z83A 3M4YA 3GLHA 4NYMR 2WIBA 2CLCX 3TW8B 5JBQA 2GAAA 4YMWA 1EIYB 5F2EA 3SEAA 3W90A 5KOYA 2E5LL 2OCEA 2A69C 3HOWG 1EX7A 1VQ5A 3M4QA 4C2MH 2PBRA 2VHQA 2YTYA 3HJNA 1VQPA 2J5XA 4OK6A 3PG5A 1CBUA 4LF4Q 4O2DA 2VP9A 3DL0A 3TKLA 2GRJA 4MITA 3AVWA 5EE0A 1G5PA 2KI5A 3F2BA 2H1LA 2B3GA 1O87A 1W4RA 1W4BA 4NCJA 4XSHA 3TQCA 1WCMG 2WB1E 3CNOA 1H8ED 4R4CA 3CZPA 4B2LA 5D3QA 5EP1A 3HKSA 2MSDB 1QVAA 1XEWX 3P1JA 3SBEA 2E8GA 1A7JA 1OFIA 2PCFB 1DAMA 4D81A 5L3SB 5M3MH 2CLDX 3WHLA 3GLIA 2XB2A 1Q12A 3B1ZA 3ND9A 3ETLA 4A3CH 4GI7A 4HSEA 3RDPA 3W3ZB 4URXR 3MAAC 2XXAA 2VUMG 2EFGA 2GXQA 4DVGA 2D0OA 4K0KQ 4BFVA 4JLAA 2UUBQ 2RGXA 2JCSA 2ZTEA 3LW7A 3MJRA 4B43A 2HHHL 2IWRA 1I94Q 3F0TA 4HUQB 5DI9A 1NMYA 3Q7QA 2VRWA 1C9KA 1O7IA 2AKYA 4JVNA 2GKSA 4DWJA 1K73C 5GAGC 4LFCL 4G5GA 2IWHA 2ATXA 4LF8L 2H8KA 4Q9IA 5KO2A 1Q90A 5IYDH 2J7PD 2IYZA 3AEZA 3U4VA 1N5JA 5JS7A 2E1RA 3CPEA 1OYYA 1VHTA 1PH7A 1H9JA 1VF7A 2PJRA 3C5HA 4LI0A 3GLGB 1W49A 4DV0Q 2B21A 3HOXG 3AUYA 4TMKA 2OG2A 1M74A 5TY0A 4CEJB 2ZSDA 3OAAD 3QQ5A 2JA5G 2G3YA 2XSZA 4BFXA 5DYGA 1YJ5A 5EP4A 4LFAL 3PEYA 1RIFA 2C95A 2OXCA 1QVGA 3BG3A 1PH8A 2ZTDA 1PLJA 4AD8A 1SXJE 1CTQA 2IYXA 3H15A 1EG7A 1Z6AA 1Z0DA 1OW3B 4JI6Q 2CHVA 1E22A 3MD0A 5C4GB 3WRXC 1TAGA 4BLOA 3AH8A 4X62Q 4RFSA 2MNAA 1G4AE 1XU4A 3A5ZB 2A5GA 4LJ4A 3RABA 1BMFA 2ZI7A 2ZTCA 2OV2A 2WKQA 2ONKA 5BR8L 1IXRC 2OCYC 3QKUA 2VSXA 1B9NA 1QJOA 2QF7A 4DR5Q 4QBGB 4LUVA 3BJIC 4FCWA 4UKDA 4DV7L 2PEZA 3M6AA 3O8BA 3S24A 1G7TA 3GJ3A 2EVBA 4C0SA 1G6PA 2VQEQ 1GUAA 2BM1A 1KAWA 1U0LA 4PHTA 3AYHB 2W2TA 2IW3A 2O8EB 1OIWA 4M8NE 5BYKA 3G4SA 2UZIR 2D0PA 1UKVY 4RKEA 4TYWA 1S40A 5AJ3Q 3CRQA 2VNUD 4BA2I 1SRUA 1JR3A 1XX6A 1GUNA 2GCOA 3KJEA 4OO1I 4PZZA 4D4MA 2N3SA 1X3GA 2A3RA 3GLIE 1ZCAA 4AKGA 5M5YH 3U9SA 1GKYA 4EPRA 1XEFA 1XNJA 3IUYA 1KI6A 3HKZE 4DV3Q 2IUTA 3RYTC 3I4NH 4HEJA 3MWLA 4V0OA 5FBRB 4TYQA 2O8DB 2AK3A 2HJVA 4H02A 1QHXA 3EC1A 5FFMA 1NMGA 4HAWA 4C0JA 4V0ME 5AJWA 1VECA 2Z6VA 3W6PA 2K14A 1UE6A 1MRSA 4EQ5A 5JS8A 3W6NA 1G7SA 4D26A 4TZ6A 3NWJA 3TUIC 3OE7A 1QVFA 4Q1FA 4RD6A 2C8VA 1YZUA 3TQFA 5DN6D 3HOWH 4MQBA 4CW7A 3GLGE 4Q9KA 1UBGA 2R7ZH 2QNRA 1E2JA 1NBME 1FQJA 2YC4C 4GN4B 2RGNC 2W6IA 1DS6A 3CF6R 1Q82C 2GXSA 2WOOA 3QKTA 1K8AC 3CCEA 3OFNA 1N5LA 4LPSA 1YR7A 2WKPA 3CO5A 1I6HH 1G3UA 4MRVA 5TVKA 5HE8A 2XITA 1Z29A 3I5XA 1KO1A 4KBGA 1EFCA 1W5SA 2GJ9A 2A5JA 1N3BA 2VY3A 2QRZA 3QXJA 1XJVA 1L8QA 4DNTB 5DHAA 3AF4A 3FMIA 1LM0A 4R2IA 2OQKA 1Z07A 3H94A 2JEBI 3NBFA 3OW2A 1P75A 1ZJ6A 3T1QA 2ZXUA 3X1ZA 5EUQB 3PCRB 2QL6A 3K0AB 3QPVA 4IVPA 1G21E 4BECA 1E2WA 4BXXG 4HDQB 3TR5A 2ERXA 5C44G 2X19A 5GJVC 4U00A 2CQOA 3KFUA 4IVQA 4ZIRA 2QEXA 4JG2A 4LYFA 2VF8A 3EG5A 2WWXA 2ZRFA 1XXHB 2Y0SE 4OHWA 3VR6A 4DUYL 2GVZC 3I4LA 1HZAA 4HB3A 5FL7D 3L7ZC 4KVAA 5C0XG 4DR1Q 2OAP1 2P65A 4JVMA 4UNSA 4CYMA 4V0LA 1N6NA 1VIAA 1MKHA 1EUJA 4IJMA 4B44A 3S2HH 1NLYA 2QMHA 4DBLC 2ANCA 3S1MH 1U9IC 2FV8A 1A0IA 5JSZA 4X66L 5DSZA 2J9RA 4ILEA 3NC1C 1GZSA 1IZ6A 2Q9AA 2CWPA 4BE7B 2EDGA 3C15C 1DTSA 2ZYWX 4V0KA 4A3DH 4W7SA 4GOPB 3QG5A 1AS3A 3A4MA 5EP2A 4GKKL 4AG6A 1T3HA 3S1AB 1I6VC 1DO0A 3CB4A 3H0KA 1GSIA 3UMSA 4A76A 2VHJA 1K8GA 2HUPA 3ZIAD 3ZYCA 1VG1A 1CJMA 1GFIA 3CUEF 2GXAA 4DHEA 4HJ5A 3VX3A 1DPFA 1KSJA 2E76C 1K83H 1D2NA 4KFSA 2QENA 3C7KA 5L3QA 2ZRDA 3THYA 2C9OA 5ELNA 1W36B 4B3ML 1JAHA 4OWWB 1MO3A 4WA7A 4ALPA 4JI1Q 3IPXA 3SJAA 3GJ4A 4B32A 4B71A 2UU9L 4Z54A 3OF5A 4LJ6A 1T5IA 1Y3AA 3GJ7A 4C0LA 1MO4A 1A62A 1G3QA 1YIJA 3AQ4A 4JI5L 2ZRBA 1N25A 3HYTA 1Q44A 4HR7B 1HT2E 3QF4B 3NE5B 2AD1A 3G71A 1HZCA 2XAUA 3SFVA 1D6JA 1US8A 3CPJB 4JI8Q 4DPGA 2A1AA 1GILA 2CXXA 2FEOA 2WIAA 5BYJA 3RS5A 2IS6A 3C5CA 1X1RA 2W0SA 3L0IB 4Z8XA 4DV5L 1VMAA 4AI6A 1FJGQ 1D2EA 2FSIA 3NHAA 4KO8A 2K5UA 2ZPTX 4LWCA 2G1JA 2NIPA 3S2DH 2ZIAA 3R7WB 3GTQH 4AC9A 2PT7A 1Q1BA 3QPUA 4A3EH 4H1VA 4WJ4A 1N33Q 1OFHA 1WI5A 2PMDA 1SXJC 4YHHL 2ASEA 1ZD1A 4EFNA 2J3EA 4MYTA 1XXHE 2ZUCA 5EP3A 4YONB 4CT5A 1NY4A 4PAQA 4NCNA 1SVMA 5IDVA 1GP2A 4GKJL 3DZ8A 1TWGH 3QKRA 1KO8A 4ZCMA 1VYUA 4MH0R 1VQMA 3EAQA 1N6HA 4MUBA 4DLTA 2ANBA 1KI9A 5FOXA 3G6EA 1P60A 2WICA 2V8OA 3OZXA 1S8FA 4O3MA 2A69D 3EQLC 4TT3D 2IHFA 3LW8A 1TMKA 3TNFA 3I72A 2XOKD 5LDDC 1I2DA 1YNNC 1GHKA 3EARA 3QXSA 3K70D 4V0NA 1X56A 2JA6G 1UJ2A 1W0KA 3U44B 1CJKC 2WWFA 1CR2A 5HKKA 3UDXA 5AUNB 4OGQC 4A93H 3THXB 4Q47A 3A6PC 3PR1A 1P73A 4IJLA 2PX3A 2O8FA 1IW7C 3BFVA 4R2HA 3CCJA 4HLUC 3QG1A 3RR5A 2MMGA 2NO9A 4X64L 4DCUA 1LTQA 1OHHD 4V03A 1OB5A 1R7RA 3GFPA 3H86A 4OQLA 4Q00A 2KA7A 4YDSA 3K09C 1LACA 4HATA 2MSEB 2F1HA 1KQSA 2HF9A 4C3HH 4C0QC 2NN6I 4MZ9A 1E2DA 1J5EL 2QORA 5JZVA 1JXMA 3U4QA 4NXMQ 3EBEA 4S35A 2BMJA 5D3MA 2RCNA 4LBZA 1TF5A 4PO8A 5KSZA 2ZETA 4GFDA 3TVDA 2A68C 5DYIA 3RWOA 4FCVA 4JLJA 1ZYUA 1FNNA 2CNWD 3NEYA 4GP7A 3U7EB 3ECCA 1N0UA 5AWFC 4ASUA 4KI0A 1BKBA 4OWTB 5JHHB 1PV4A 1E79A 3ZVMA 1I4TD 4JBYA 3FOZA 2QT0A 1Z9FA 2EFDB 2ZE8A 1KK0A 4NH0A 3NELA 4A92A 4PZYA 4XVRA 4DR2Q 4IO9A 3K0CA 3PXGA 5B58C 3TW4A 1ZD9A 2JLZA 3ER0A 1EESA 3FGNA 1NKSA 1X3EA 4H0LC 2Y8EA 4BPBA 3PV0A 2REXB 1F3OA 2KWIA 4JI2Q 1R10A 2EFHB 1SULA 4L5BA 4BUJA 5EE9A 3ICEA 4C0KA 2C2HA 4JLVA 1NY6A 1QHIA 3HPQA 1AE2A 4JC0A 3RS3A 2P6RA 2IYWA 3CX7A 1ZAKA 2R6CA 5CYOA 3KKNA 5KDLA 2OBLA 3W3AA 1N34Q 4QL5A 1JB1A 3F5FA 3LX8A 4XD7D 3DKVA 3OIYA 1Z3IX 3BS4A 5GJCA 1S3SA 3Q5EA 2AK2A 1TEVA 3I55A 3QXHA 3KB2A 1QHNA 1W47A 4FI3C 1VCMA 1C7YA 4EJSA 3QXCA 2YKGA 3MFYA 2B7CA 5F3WB 4QJ3A 3JAMc 1AKEA 1H9SB 1E24A 4FDBA 3ULLA 2PMKA 3V00A 1EXMA 2LKCA 2GDJA 2V3CC 1Q46A 4JI4L 3MWJA 2D2FA 1ZVQA 4QJFA 4FMCB 1B7YB 1ZRHA 3NXSA 1E1QD 4Q7MB 4TT3A 4PPFA 4BBRH 1K9MC 1QUQA 4X65Q 3CONA 3NG1A 4Q9HA 1CR4A 2GVAA 3VU9A 3T5DA 1ZNXA 3EWAA 3NKVA 3CX6A 2XB4A 3QI2A 1GVPA 3U3OA 2CW0C 2J59A 1ZNWA 5HY6A 2OHFA 1NJFA 4BFWA 2A78A 4I1VA 1FL9A 1E32A 1S2MA 4LHWA 4LHYA 4OX9Q 3S14H 2OXRA 4PHHA 2VO1A 5FR1A 2RHQB 4A36A 3RSLA 2R2AA 4DXAA 2ODWA 1RW4A 3KOJA 221PA 1D8TA 2FX3A 1RL2A 5EUMA 5SZHB 4URYR 1NNEA 3PO2H 4CEHA 3TREA 2JK8A 1KI2A 1Z6TA 2EYQA 4BBSG 3WMEA 2ZYUX 4OXPA 2CVFA 5DIFA 4XWKA 4D2IA 3WBKA 4NBSA 3PIOA 2XGJA 5JEAH 1SQ5A 2G88A 4YCWA 5EZ6B 1HNXQ 4GPTA 4OO1G 4JV5L 3GFOA 4GZMA 4NHOA 4WIAA 3WY9A 3D31A 4F4JA 1UAAA 5K36H 1CR0A 4BY7G 1KAGA 1KI8A 1KJWA 2JLYA 2ORVA 4H13C 1TF2A 3D7MA 4X6AH 2FA9A 2CCZA 4NTZA 1TTTA 4U02A 1Z63A 2DN8A 1G8YA 2BEKA 2OESA 1WDTA 1Q81C 1T5LA 3ERSX 2R7DA 4QBIA 5JWHA 1IN4A 1GJXA 4HJ9A 4KHPQ 2QAGB 2J41A 4IEEA 4QGGA 4XVUA 1XJQA 2Q3MA 4LF4L 4C7OA 1XMVA 4PC1A 1P72A 1GVNB 3HOVG 3FYHA 3I5YA 3HWSA 5FLMG 1QF9A 1FX0A 5KU1A 4L9SA 1U0HC 2Z43A 2VQFQ 5JLJA 2B63H 2FG5A 1FUUA 4AYBE 1H8HD 1UADA 3FPAA 1YHBA 3U3KA 4A3KH 1KDTA 2MO0A 2WWGA 3VX4A 3HOZG 5DNYB 1HNZL 3D4RA 1HZBA 4AQYQ 5FJ8H 2QN6A 3FMPB 4PHGA 2DHRA 5C4MA 2JA7H 5KTYA 5GADl 3A1WA 1VF5C 4ZKEA 2ZAMA 4K0KL 2HCJB 3E1SA 1ZKOA 4PR0A 2MFIA 2UUBL 3T06B 4D25A 4OYHA 2BH8A 1I94L 4E5UA 1EFRA 2C04A 4GOPC 4AKEA 4DDUA 3OEEA 1GIAA 4MYHA 1JJ7A 3ZS8A 2VZAA 4L8GA 3CR8A 4GOXA 1CFMA 4IW3B 4AK9A 2GEVA 2WJHA 1Y1WH 1E1QA 1IN6A 2PCLA 3SJCA 2CL7X 1SMYC 2UUCQ 4ESVA 4PQRA 3CNLA 5KDOA 1NG9A 1DAHA 3STBC 1F5NA 4DV4Q 3K0FA 3VFDA 3FKIH 4MDFA 4EAQA 3M4OH 2CL0X 1GDDA 3I73A 5J4VA 3KKMA 3IEVA 2ES2A 3KQHA 5IK2D 4B2IA 3UE1A 4DV0L 1OSNA 2NO7A 2NPIA 1W36C 4G01B 1VCOA 4H9GA 3TUJC 4A3BH 3KTAB 1NBWA 2H18A 2NZHA 2CK3A 5A4JA 4IDNA 5C4XH 1UBFA 2F1IA 1FW6A 1JR6A 1KO5A 5AR1A 1OH6A 3WHKA 1ANKA 3K9GA 4UXHA 2W2XA 4M21A 2J0SA 2WMOB 5IYCH 2OBNA 2QU8A 4G5SA 5H1SE 5HZKA 1E7ZA 4JI6L 4XH9B 1T5EA 3P4XA 2AFHE 1HTPA 1VQFA 4M2LA 4R7ZA 2IC5A 4MDEA 4OWXB 1MABA 1ZBDA 2G77B 2JLSA 4X62L 4B3TQ 3KDSE 2ATVA 3C8UA 4NZYA 2ZITA 4QIWE 3ZVRA 2FJUA 4M1YA 4DSUA 3RLFA 2PL3A 1E4VA 1E99A 3L0PA 2PZEA 1TU2B 4PQFA 2RGNA 2OAQ1 1KTVA 2BWJA 1YRAA 1U8YA 2NOAA 4KKUA 4DR5L 4DR6Q 3JVVA 5FBVB 3AVVA 4TL7A 2QTHA 3WYAA 5FTJA 4G7ZC 3NTUA 4BWYA 5JJIA 3MLEA 1P9WA 1S3GA 1HZ9A 3T56B 2DFKB 1FQKA 4OJQA 1S72A 2N49A 1AQUA 2QSZA 3IBYA 2WJIA 4RZUA 5C0XI 3M4PA 5GJWC 1AN0A 1C4OA 3SJBA 2AUKA 5M3MG 1JNYA 2FPMA 3FP9A 4LUZA 4MNOA 3FMOB 4IDQA 5AJ3L 4TL8A 4EQ6B 2JLXA 2OCBA 1E98A 4DKXA 4BRUA 4A3CG 3CPWA 3W1GA 4HIMA 1VPLA 1D9ZA 5KHOC 2G0TA 3GLFB 2WB1G 3QEJA 2ZRCA 2ODNA 5FI1B 4QNRA 1XTIA 3SU8A 3SZRA 2C96A 4GN3B 1FNMA 1L4YA 3KXIA 2QP9X 3SYKA 4OBEA 2CCGA 4DV3L 2A6HC 2FH5B 2VP0A 5EXSA 4JI0Q 4KMUC 1XTKA 3U6BA 3H4MA 2R6DA 1TX4B 4LF6Q 2QGZA 3R9WA 4KN7C 1E3PA 4L5TA 4JBKA 1KZ7B 2XTNA 1L2FA 4B3SQ 2F43A 4OQMA 2WHXA 2K5NA 4Q9LA 4C30A 1U90A 3H1TA 3JAMi 1OFUX 4RVCA 3RC3A 1Q22A 3UIEA 2KBNA 1E1RA 4A0FA 1EWRA 1PYSB 1A4RA 1FMJA 1YR9A 1MIUA 1G4UR 1H9KA 1U9IA 3BB3A 2D4HA 4LC0A 1X1SA 3QBVA 4BZPA 2JLUA 2DB3A 1SVOA 2VYFA 5DI3B 4JVSB 1Z2AA 1HT1E 1Q8KA 4NPHA 4PC3A 1YBYA 1G8GA 3R8CA 4EPYA 2Q8IB 2QG6A 2BIFA 5E7NA 3LFUA 4QRHA 1FR3A 2K7VA 4UJ3A 4DR3Q 2H57A 5GQOA 3QJYA 4LV5B 5G3YA 3T1YQ 2L5TA 1ZYRC 2OCPA 3V4RA 4US0R 2OILA 4IVRA 2CMKA 1YNJC 2Q3FA 1SE8A 1LV7A 5FTKA 5TB5A 3LRPA 4JI7L 1K8MA 2GJAA 1ZM2A 5JJLA 2XZOA 3CIOA 3HOZH 4QM7A 1G3MA 3U6KA 4NPSA 1E94E 4GL2A 1SVKA 1U99A 3DEFA 1P62B 4LHVA 1LTLA 1W0JA 1C1YA 3SS8A 3QE0A 1CUKA 4DIDA 4HZUB 4YWMA 4TYYA 3P32A 3FVQA 5LB4A 1PH5A 1KNXA 4DV1Q 1WOCA 2ALYB 4KLNA 5LD2B 1GAJA 2ZREA 5EQTA 3N2IA 5FTMA 4JJKA 4OKSA 1AZSC 3OPOA 4BFYA 4GNXB 4JYAQ 1Z28A 1VYVA 3I4OA 1ZP6A 4II7A 4IOAA 5M5WH 2F7SA 3TSWA 4DR1L 2E75C 3UDGA 2DYKA 3PJRA 2XSZD 3E5HA 3KQUA 4Q7JB 5FTNA 2BEJA 1DOAA 1NVWQ 3E2IA 2N1BA 1QHSA 2R6FA 3RRNA 1CSQA 3AKCA 3C41J 5GVRA 1II9A 4A3FH 2DBYA 2HLDA 4WZ6A 1XWIA 3ZZUA 4A2QA 4XTRA 3GLFE 1DXMA 3B85A 4HI0E 1YITA 4AKIA 2A8VA 1YNXA 3FWYA 4Q4LA 3WP1B 1Y1VH 4UXIA 1A2BA 3MXNB 2W2VA 4GS3A 2IF2A 3WP0A 1S3OA 4JL6A 1SXJA 4W5WA 3UMRA 2IXFA 3AP1A 4OJKA 4EUNA 3N5CA 4LF7Q 1NKTA 3RAPR 1Z6XA 3F1ZA 2FGJA 3I4NG 3FKQA 1KSFX 4B76A 1H65A 3Q9LA 5JEDA 3ULJA 1NLFA 2QMEA 5DN6A 5J4YA 1GTVA 1Q3HA 2QRNA 3MMPA 1I50H 4A3LH 2PZGA 1G3RA 4PFSA 4HZIA 5EXPA 4BQSA 3ZD6A 3A1TA 3EA0A 2HEIA 3AVXA 1JEDA 3UWOA 3HKZG 4JI1L 2MSCB 4LJYA 2E2IH 5E7JA 4LBVA 2R7ZG 3LBNA 4MKFA 1RRCA 3G48A 3T15A 5BQ5A 3EX7C 4N0DA 4AYWA 4YWLA 3ICQB 1JR3D 4WW0A 4E07A 2O52A 1IY0A 2D5DA 1DAGA 4M9QA 4XJXA 5L3SA 5J4LA 4QG7A 2HQLA 4BFUA 4L8JA 2FOLA 3OYYA 4WZBE 5EXTA 2VTKA 2A5FA 2ZE6A 1WBBA 4GLVB 3KDFB 3E0EA 1IBRA 1X8LA 4JI8L 1BYUA 1KAOA 2V4ZA 4HLUA 1E9FA 1DVRA 1NRJB 1EX6A 5LMUQ 2YJTD 3BE4A 3EW9A 3SFZA 3T1TA 1D8LA 2D06A 3LXRA 4Q1DA 3KF6B 1G64A 3X1YA 4AY2A 1FJGL 1E2EA 3HOYG 1E9EA 2AL7A 3K09A 2CFMA 4LF5Q 1MO6A 3IDQA 1XNRQ 4HUQA 4DLWA 4EFMA 5IRCD 1E6CA 2ZJYA 2JGNA 4FIDA 2ZJ8A 3OE7D 1LY1A 2ORWA 1LF5A 3QPWA 1U0JA 1N33L 4P4TA 3WNBA 2BBOA 5CB6A 3AV0B 3IKJA 1RKBA 3PUVA 4LWZA 2REBA 4QOSA 2W6ID 4TTPA 4V0MA 1KKLA 2KBFA 4HB2A 1XMSA 1X55A 2CBZA 4YCVA 4NYIR 2ZJPA 2YZ2A 1SR3A 2JA8H 3OFND 1W2HA 4Q4HB 5G40A 2QAGC 2KB0A 2CKZB 3GLGA 3LWUA 2HYDA 2QE7D 1NBMA 1SVLA 2XX3A 4PSAA 4RD1A 1HPCA 1KI3A 1IL2A 1YVDA 4L9WA 4D0GA 2X8AA 1VHLA 2BKEA 3TQYA 4AH6A 3AVOA 2FN4A 1TQ4A 3CRMA 4ZV4A 4CEJA 5F9FA 2R6AA 1COWA 1CI3M 4G5QA 1UBCA 2Y0SG 2FFQA 1MO5A 2FGKA 2HIVA 2WV9A 4A3DG 2G83A 2UUAQ 2K50A 5C18A 2YWEA 1OXSC 4DNRB 4HJAA 2GBLC 2XTZA 2JJ2A 3S17H 4HLQB 4RZXA 2GXUA 3QENA 2DCUA 4NYJQ 1YQTA 3KFVA 1JJCB 1R5BA 3CPFA 3J80c 3B1WA 3QVUA 4DT1B 4DCTA 1BYIA 1J70A 3IBGA 3MJHA 4H1UA 3TS0A 3UDFA 5HGQA 1D5CA 3U7FB 2JLQA 4HB0A 3DXJC 1T3LA 3BFXA 3QY0A 4KFTA 1N6KA 3EZ6A 3KLWA 2PMZE 3I2ZA 3ADCA 2I1QA 2Q3HA 1YR8A 2HT6A 5IYBH 4KKTA 1DCZA 1OJLA 2PZFA 1XFAA 3LLMA 3MGCA 4RD3A 2Z0SA 2OEPA 3VQTA 3ZQ6A 2PH1A 4IOKA 1XB2A 1DEKA 3B6YA 4LYAA 5E7MA 4GN5A 1XP8A 2B6HA 2ID0A 1EWHA 1PH2A 1A5TA 2ZROA 2IYRA 1Z0FA 2F1RA 1IBMQ 2NZ8A 5A0FA 3SI7A 3GTPH 1HTWA 4A3JH 4RFVA 4A9AA 4NL4H 1VQLA 2HIXA 1VQ8A 1A82A 1Q21A 3I32A 4HDCA 1M7HA 3LNNA 2GVBA 3FFBA 4ERNA 2GK7A 4DK0A 1IYVA 1W2BA 4ZDKA 3L2PA 4DB4A 3GPLA 4HUTA 4DR2L 3MCAA 4V02A 3SC3A 1LB1B 4B33A 1MR3F 4PZ8A 3CF5A 1GUTA 2FWRA 5DH9A 1O7LA 5M04A 2O8DA 4A3EG 1IXZA 1G5RA 4PZ7A 4JBMA 3CKLA 4CIDA 3OESA 3K80C 4APVA 2ZI9A 4ZCIA 4JI2L 1CULC 5KNDA 3A4NA 1GNRA 2WWHA 3EWSA 1XD2B 4PXAA 4AYTA 4M53A 3AVYA 1JPNA 2GN5A 1OIVA 1KK1A 1EIFA 1VQCA 3ONWA 1PLLA 1XZQA 3FPPA 1N34L 3REFA 3TMKA 1G8PA 2ZRNA 1Z5ZA 1NE3A 2CVHA 5LBIA 1X54A 1S1MA 2WVJA 2Q0HA 6Q21A 5KYKA 4WAUA 4JLKA 1E2KA 4DK1A 5DLQE 1GD7A 1D2MA 1WJJA 4QGHA 1YJNA 2FU5C 3IIMA 4CT4B 2GHIA 4ZI3A 3S16H 1NSFA 2EU8A 3HU3A 2QE7A 3DOEA 4A93G 4KAXA 3ZQJA 4GDFA 4ZDWA 2EJGC 2JIZA 1UE7A 4OQNA 4TL9A 5ANRB 5IWAQ 3J81i 2GETA 2I3BA 3LXXA 4C3ZA 1I4LD 3K0AA 4OQFA 3WMFA 2R7FA 4X65L 5FPKA 4W5HA 2FEMA 3D3QA 2QPAA 1B70B 3HOYH 2WZQA 2ZVQX 2WWYA 2JAQA 1KO4A 1M7BA 4R98A 4POFA 3B60A 4TSFD 1XXHA 1NLZA 5SZKB 3K8YA 3KZ1E 3NEJA 1TKWB 1Z6HA 2N78A 1IAQA 3SBDA 4DR7Q 3WXMA 4X8MA 3CC2A 4OX9L 2D2EA 1GRNA 3EXAA 5C1BA 1U98A 3BBPA 3MSXA 1CJTC 3Q85A 3SOPA 3VR4A 2GILA 1OT3A 4LK2A 3U5ZB 1WP9A 3A7AB 1NY5A 3KYHC 1W0KD 3T1VA 1BH2A 3ZDQA 1AE3A 2FFHA 5HKKD 1P5ZB 5LB2A 1OH5A 1II8B 4YQFA 1DAFA 1MJEA 3HU2A 1V5WA 2Q21A 4KCGA 3PFIA 3RRYA 3Q8XB 5CK5A 2XEXA 2XZPA 4Q1BA 1VQ9A 4ESHA 2BE5C 5E3HA 3FDIA 1HNXL 3F8TA 4HJ8A 1QBKC 4GOPA 1CP2A 2CL6X 3NBZC 1S4QA 3B7GA 3S1AA 4E03A 2OQ0A 4DK6C 4CVNA 2CJWB 3IO3A 2A6ED 4X8LA 5FPYA 1EGAA 3CF0A 3K9LA 1Z83A 2AWOA 3RLNA 2F3TA 5UKDA 2XNSA 4AURA 2FNAA 1E2NA 3TJZA 1C0AA 1E96A 2BKUA 3CP0A 3EPHA 4KHPL 2RGCA 2ZJ5A 2QMUA 1Z47A 1TWHH 3WWVA 1AA9A 2CE7A 2DPXA 3OIVA 4C7OB 4JI3Q 1E2GA 1CKMA 2ODEA 4JOIC 2REOA 3A36A 1I3QH 2C9CA 3SYNA 1G8HA 3KFXA 4R1JA 3OW7A 4O2LA 621PA 4ASUD 5JECA 5LD2C 1E79D 2QM8A 4RSGA 4YMTA 4GBMA 4AKHA 2K5HA 3K7UC 4GNXC 4DV2Q 4MKHA 2VQFL 2DFNA 2DFLA 3QF4A 4PTLA 1NMZA 3B2EA 2ZRAA 2KENA 3WBJA 1E9BA 4QC2A 2XJ4A 5GROA 2OZEA 1AS0A 4AQYL 4TLDA 1E0JA 3TIFA 2ZI5A 3M1IA 1WRBA 4C3JH 4M1MA 3CCRA 4L5QA 4LFBQ 4TLAA 3THWB 2RGEA 3T1HQ 1GHJA 1M6NA 5EJEA 2D3WA 4BBRG 1DG1G 2Z0MA 5E7IA 3R7WA 3VA7A 1XTDA 5JCZA 3QUSA 2E5LQ 3RSOA 1G16A 2J46A 2HT1A 4KVGA 1UFQA 5IP9H 2UXBQ 1VQBA 2E2JH 3DDCA 4PAMA 4RD2A 5IF9A 1OPXA 1W3SA 1PJRA 2QP4A 4KLZA 1U5KA 2K4KA 4XVQA 2BBWA 2JJQA 4TQAA 2UUCL 3PUWA 5K8LA 5JEEA 1PMRA 2EFCB 1KMQA 2J45A 4RY2A 4DV4L 3QXXA 4P3YA 1XBTA 4DCVA 3PO2G 4IOMA 4IPHA 3EASA 3K1JA 3RN2A 1PFSA 2DNEA 5LMNQ 3PGZA 2WJGA 4TSFA 3RC8A 3THWA 4DUZQ 3GTOH 3KKQA 5JEAG 2ZVPX 3K53A 1F2TB 3KUCA 3I62A 3A8KE 3TVTA 3M9BA 1UBEA 2W0MA 3LBHA 2G1KA 4WXPA 3U44A 2GAOA 5K36G 1G3IA 3THXA 1FOEB 4DLSA 1JQLB 4QNMA 2R8RA 1XF9A 2EJFC 2CE2X 1E2PA 2J0UB 2R93H 5G53C 3RNLA 3HYRA 4Q9JA 2KBEA 2V55B 4RJLA 4DDWA 3OIWA 4RZ3A 4U5XA 2A5YB 4B3TL 1VQJA 3OIUA 2IK8A 5LMNW 2UXDQ 3SGIA 2BDOA 1VQDA 1Q0UA 1PH9A 2KSQA 3G5UA 1L1OB 4MGYR 1EQRA 3F3YA 3E70C 4JSYA 4DR6L 3I4MG 1CKNB 2ECKA 2NTYC 2VHCA 2PNRC 5HPYB 2QBYB 2CLSA 2GWHA 3AKDA 2C5LA 1IN7A 3AF1A 1TUEA 1YVCA 2LSSA 4JK1C 1EFTA 1Q20A 4DSOA 1RFLA 1J6QA 2B63G 1N6PA 1X8KA 2ZYTX 4OI2A 3CM0A 3TAHA 2BV3A 3F2CA 4A3KG 1N5KA 2ZR0A 1XTSA 2Q2UA 2P5SA 5JCPA 1OKKA 5L3VA 1JT8A 4OI4A 1CLUA 5FJ8G 2ZJOA 5AJYA 2YTXA 1RJ9B 3H2YA 2JA7G 1Y8OB 4IPCA 5K8IA 4F93B 4BY1H 3EPKA 2YWFA 3AKYA 3EIQA 5IT9c 3B9QA 1G1MA 1DG3A 2WJVA 1JPJA 1HR0Q 3VNVA 1E9CA 3X2SA 2KHJA 4GSYA 3OEHA 5DLQC 5BWMA 4G3XA 4NYJR 4Q1AA 1KK2A 2HCBA 3TR0A 1H9RA 2I5MX 1VKJA 2K33A 3VHLB 1EQQA 1ESNA 4LF6L 2A5DA 2BJWA 5J3BA 4QGAA 1U81A 2C99A 2LKDA 2H17A 2X2FA 4B3SL 2ZJBA 1Y1WG 3A1UA 2DR3A 2ZRGA 3B9PA 3O47A 4DIEA 3UDIA 1B8AA 1E0SA 4NCHA 1IQPA 2O5JC 2IA5A 4BFSA 2GF9A 3FKIG 1E9AA 2P3SA 2V54A 5AJXA 2KCMA 4URUR 4BLTA 4PAOA 3RRZA 2O8CB 1HR0W 3NVAA 5KSOA 3RANA 1U8AA 4NONA 4BASA 4F4CA 2OUKA 1YHAA 4OK5A 4A3BG 2ZE5A 1KY2A 4C3IH 2JE6I 1ZW6A 5SZIA 3RS2A 1HJPA 3BB1A 2ZEJA 1G18A 3TAUA 1H9SA 1KRSA 3K0XA 1RE0A 2VEDA 3T1YL 3ASZA 3LX5A 3KQLA 4QJ4A 5C4XG 5J47A 1VG9B 1GNQA 2VHUA 3HGBA 2ZSBA 1G5TA 2J0QA 1XZPA 3JZMA 1EFRD 3LNCA 4RCNA 5IYCG 2ZUDA 1ELOA 3OEED 5DE3A 4C0HA 5JHGB 1HH4A 3FMCA 2BOVA 3BGWA 4HAXA 1A63A 2R9VA 3PIRA 2RH5A 1ONBA 3DOFA 3DZDA 4JT4A 4F38A 4DEXA 1XEXB 2CHQA 1B0UA 4P75A 4R71A 1GL6A 1UEIA 4A3GH 4M9XA 2FPLA 3TS2A 5L8VA 4TMXA 4DV1L 4CEIB 1DELA 5JWOA 3THOA 1IBLQ 2GCNA 1KK3A 1UM8A 1YRBA 4LJZC 1P2SA 2YINC 4JMPA 4LY6A 3A8TA 3PO3H 2AFIE 1D7QA 2QQEA 4JYAL 3LA6A 3L82B 4KV9A 3EPJA 1VQNA 1YZQA 2AKAB 1GKHA 4UQOA 4CRWB 3I3SR 4RG1A 1KXLA 3LQRA 3R9IA 1W44A 1XMIA 4B3FX 1XNQQ 4D82A 2CK3D 4Q02A 5B2ZA 4YMUA 1QZGA 1KD1C 2AKWB 2K32A 5DISB 4E22A 2AHOB 2ORIA 3ZLJA 4EPVA 2JLVA 2YTVA 2GA8A 4JVLA 4EKDA 3TSZA 3NIBA 4LJ7A 4FMCF 3J81j 3NHBA 3KKPA 3VR3A 2NZJA 4JLMA 3H84A 4M1TA 1AIPA 1Q1ZA 5TDHA 2ZS9A 1XRJA 3L8YA 1E69A 4ZI2A 4A3IH 1E9DA 3OHMA 3VU9B 3K70B 3DM9B 5JI3E 2ZT9C 4PPGA 1Z22A 1QG4A 2QAGA 4DUYQ 2C77A 1SKQA 2V1CC 3KXLA 4PO9A 2L0XA 1JXOA 1JALA 5JWRA 2VA8A 4Q4AA 5EE1A 1OH8A 2O5IC 1Z0KA 3CWQA 1TWAH 2E9SA 1Z0IA 3E9HA 2AXPA 2FF7A 1VQEA 121PA 4IFDJ 4NYIQ 4QM6A 3I4MH 2KHIA 1AKYA 3CCMA 1KI4A 1S9HA 2Q9BA 2GBLA 2F9MA 2WOJA 2XNDA 4YC7A 5TV2A 3BWDD 3J7A5 3CZQA 2ZM6Q 4GP6A 2O5VA 1QHHB 3VAAA 4P4SB 1N36Q 3EZ2A 2GK6A 2H92A 5LMUL 3PUYA 1KO7A 3ZJYC 2B92A 4DEYA 2OO7A 2GJKA 2FSHA 2EVWX 1W46A 4XIGS 4LF5L 1EOVA 1XNRL 1IXSB 1X6VA 1XMQQ 4WJ3M 3KXKA 1VQ7A 4ARZB 2B8WA 4P4UA 2F55A 1E1RD 1DAEA 2MO1A 3RN5A 1CSPA 4BLRA 2PEYA 4IXMA 2AN9A 4TMVA 4B48A 3SDZA 2FDCA 2VP6A 3VR2A 2EFEB 4LHZA 1KIXA 2DGYA 3BH6A 2FE4A 2JA9A 2JLWA 2EJMA 5CLQA 4QGUA 2JXMB 4TYNA 2NO1A 2H5XA 1KKMA 5K8UA 4EPWA 1Z7TA 3IFTA 4OONA 3ADBA 2F9LA 3U4ZA 3KTAA 1XTRA 3NEMA 1Q3TA 4QBHA 5IT5A 4A3FG 1X3FA 4D4KA 4D80A 3GTJH 1XPOA 1AH9A 2DWOA 2QP3A 4ACBA 5KPDA 5H8WA 4ZO4A 4I4LA 4I1OA 1QZXA 2QT1A 4B3RQ 3CH4B 1Y1VG 2ZRIA 4YY3Q 1W0JD 4NMMA 1CF4A 4IOCA 2UUAL 2RKOA 1OXTA 1A6XA 4DAYB 1J90A 2DWPA 1ZM7A 3KJPA 4HLDA 4PO1A 4A6PA 2IS4A 4QBFA 3GTLH 2OFWA 4UXJA 1YI2A 1CEEA 2WBLC 4JS0A 4IPDA 3W6OA 4TMTA 3HOUH 2PQAB 3VR5A 4A3LG 1AM4D 1S0UA 4J0QA 2RMKA 3IILA 1CRQA 2W6JA 1XMJA 4HAYA 1E2MA 2EXDA 2P6NA 2ZS7A 4FXPA 4MRSA 5TMPA 2WAQE 3MWYW 3VKGA 1IYUA 1VIYA 2LCFA 2V6JA 2E74C 2ZI6A 4URVR 4KYIB 3CW2C 2NO0A 4RKFA 5KDDA 1HQCA 4C2TA 4QQBX 4EPTA 2QQ0A 1UKYA 2HLDD 1R0XA 1F2UB 1ZCBA 1HCZA 3LO5A 4MGKR 2XGTA 1KIMA 3CRVA 4I81A 3LLUA 4I99A 1E2QA 2VQSA 4K81B 4Q21A 3WNCA 2K52A 1E2FA 1XCPA 3PSIA 4EQ6A 4DV6Q 2ZR7A 1T9HA 2VQEL 4DSTA 4IPGA 1GITA 1DADA 1SVSA 1SXJD 1IBML 1DE0A 5FOUA 1R5NA 4B6EA 2IT1A 2IUSA 1UDXA 4L16A 4PPQA 3TE6A 5B30A 3NDBB 3GLFA 4DLUA 1WMSA 1ZM3A 2O8BB 1S96A 2FPKA 1K6MA 1UE1A 3CX8A 1I5FA 2Z6KC 1ONLA 3DM3A 3S1QH 5A35A 2GEUA 4LSGA 3UANA 3EC2A 4AWXA 3BDOA 1BBUA 1ETUA 1GUOA 1G6OA 2BCJQ 2VPPA 1V8QA 3OOCA 3S1NH 1YR6A 2FSGA 4UNQA 1KJZA 4NCIA 4DLXA 1YJWA 2WSSA 3CMAA 2EIFA 1M1YE 2IHYA 1SGWA 3U7HB 1MH1A 2D2CC 1ZIPA 3T35A 2J87A 1N0VC 4NXNQ 4LDJA 3UXMA 1KHTA 3UWKA 2JJ1D 4UNRA 3LQQA 4QJ5A 4Z1MA 3OTOQ 4G0NA 4OHVA 3FKSA 1E9RA 1Z6GA 1M90C 2ZSFA 3CR7A 3IHWA 2JA8G 1WCV1 3P4YA 3KJOA 4LZZA 1G17A 2GJSA 2R92H 5DI3A 3AQQA 3C14C 4DB2A 1TQ6A 2Q2HA 2IHBA 3VDYA 3FHCB 2N8NA 1IW7D 1HNWQ 1S9DA 2FSFA 3AB3A 1GM5A 4JLOA 2FZLA 2W00A 1ZUHA 2AD5A 3BERA 1B9MA 3SNHA 5J4KA 1TPZA 1KY3A 1CR1A 3IPYA 1W1WA 1OH7A 1BBWA 2HJGA 4LYJA 3X1WA 4OI0A 1Z06A 2OCAA 2V4DA 3TRFA 5IWAL 1NIJA 4Y0AA 2A68D 2OBMA 4YXWA 3ZH9B 3M7NA 2VSFA 2IEZA 2GZHA 3D8BA 1V1QA 3GDEA 3U50C 4HZUA 2A7QA 3HDTA 2A2ZA 4L5SA 4JOIA 2IX1A 4RMFA 5CK4A 2ZRJA 3G82C 4GT1A 2F1JA 3BOSA 4MKGA 3QKSB 1NBMD 821PA 4PV1C 1PH4A 4GNXA 1FP7A 4R9UC 4BZXA 5M3FH 4Y0VA 1SMXA 4DR7L 1TF7A 2PNHA 2WPDA 4BFZA 5IYBG 1G19A 3Q7PA 1COWD 3X1DA 5GVSA 3B6EA 4M0LA 1T3SA 4TMZA 1S1CA 2YWGA 3IQXA 1N0WA 4BLSA 4F7WA 5HZHA 1ZC4A 2P67A 2C35B 3O8CA 4AIIA 1IN8A 3QSYA 1VQKA 4Q4JB 4A3JG 1PUJA 2UXCQ 3L43A 1KMHB 2JJ2D 4FW9A 4K46A 4LJ9A 2R44A 3KQNA 3DKPA 3ZGXA 3R8FA 1PH3A 5KNCA 1TWCH 1BS1A 1JAIA 2ZE7A 5C4JH 4ZDIA 1YKSA 1TEXA 4IOLA 1VQ4A 4OHXA 1MJCA 1N9WA 1LFDB 3AF2A 5AJZA 2QY9A 3T51B 5GADC 1SFOH 1AK2A 1ZUIA 2B7BA 4QFMA 4UJ5A 3AVTA 1X9NA 2EWVA 2EWWA 4Q1CA 2UKDA 4PC7A 2NVQH 2GNOA 1KSHA 2QPTA 2IS2A 3RVBA 5CIWA 1ZUNB 1E2HA 4A8JB 1NG1A 2VP5A 3C16C 4JI3L 2HXSA 5FTLA 3BD9A 2CCKA 2QROA 2IX0A 1M2OB 3W9YA 4ARZA 4LYHA 1UEJA 3CCSA 2GF0A 3AGPA 2WSMA 2JATA 3FMFA 3J7ZC 4NP6A 1JEEA 4A4IA 1QHYA 4DV2L 3W5IA 1E0AA 5FPHA 1U2RA 4KJZA 2JJ1A 1IM2A 2CCJA 2I1VB 5DO9A 3KDFA 4M9ZA 4IDOA 3A0JA 4DNIA 5C46F 2KCTA 2HXYA 3BB4A 2OT3B 1Z0JA 2IY5B 2JQOA 1J7KA 4MRNA 3DM5A 4NCKA 3KF6A 2WTUA 1IYJB 4AYXA 1BO6A 4LFBL 5TXGA 1LVGA 2QGQA 1FVIA 4MGZR 5KSPA 3AP3A 3T1HL 3Q8DA 3RHFA 4DLZA 3CD6A 3WRYC 3LBIA 4D4JA 1XEWY 2BHRA 4FMBB 3PITA 3AFQA 4HIOA 1YZNA 5FL3A 5CDFE 1Y14B 1AS2A 3GLHB 2UXBL 1XMOQ 1Z0AA 4OL0A 1HYQA 3D0FA 1UDWA 4ZKDA 4TL6A 3K70C 4PG3A 3PENA 4B34A 1GUSA 4Q4HA 5FOTA 4URWR 1LS1A 4BGDA 4RD0A 3CQZH 4F4IA 4LGMA 1NL3A 2ZUBA 3UG6A 3A74A 3CH5A 2ZR9A 2IL1A 5HCNA 1KI1A 1ZNYA 1E0KA 2ZS8A 1NN3A 5FR2A 5EAYA 4BLPA 2FZ4A 4C9BA 3ULPA 3M0EA 5FOWA 3VHXA 5LMNL 4LF9Q 1HNZQ 3QIAA 1UEBA 3PQCA 4DR4Q 4DUZL 2IYQA 2JIZD 3KJIA 2JLRA 2WFWA 2YU9H 3LD9A 1KDRA 4POGA 1CS4C 1KNQA 4A1FA 3GLIB 4G5OA 2WM9B 1BDOA 5K8TA 4W9MC 2DWQA 1CJVC 2PI2E 4C0AC 2XXAB 4A75A 1K3RA 1QVCA 1N6OA 1JJ2A 2ZI3A 3A37A 1IHUA 4LW1A 5CITA 2JEAI 2NVYH 1YZKA 3B82A 3BFKA 3O8RA 2ZJRA 2G9NA 4DT1A 2ASBA 4QL3A 4TWZA 1X65A 3NH6A 2ZRPA 2UXDL 4D0NA 5CB8A 1YEZA 2WP8J 1UKZA 4P33A 1VS0A 3PEWA 1D9XA 1M8PA 1P3JA 2V7QA 4EIWA 1U8ZA 2DY1A 1M34E 3EZ9A 2VLIA 3IO5A 2OFOA 3S15H 2BH2A 1II0A 3R20A 4IFDG 4KFUA 4LPKA 2ZI4A 2DUDA 4G1UC 3GTMH 5CYPA 4DUGA 3H0GH 3GTGH 5E4FA 3RS4A 1ESMA 1Q57A 4B6FA 4EPXA 4E09A 3UK6A 4NXML 3AUXA 5H70A 4TLBA 2UVQA 3PUXA 3I7FA 4C4PA 4WXRA 4HYYA 4ACAA 1X3SA 2NQ2C 4ME3A 1CJUC 1B23P 1IY2A 1E2LA 1TNDA 1ZM9A 2O8EA 3SYLA 1E2VA 3HFZB 3PEUA 1R4AA 1ZC3A 5AUOB 2F1MA 1R6BX 1WA5A 3UPUA 2YV5A 4TN1A 3UKDA 3EPLA 3GQBA 3EZFA 2WAXA 1NMXA 4YMSA 1A2KC 1RC8A 3STBD 5EE5B 3IHLA 4O25A 2BC9A 1AGPA 2ONJA 4B3CA 2XTMA 1HR0L 2A9KA 3H3VH 5GAEC 5IP7H 2X77A 2HF8A 2YC2C 1KC8C 1WB9A 1VCNA 3NC0C 2IYVA 1W36D 1LNZA 3GLHE 3RS0A 5FUYA 3QNUA 5IP9G 421PA 1TXYA 1W4AA 2G0NA 2ZAOA 4B3GA 5HCIA 4Y52H 1XD2A 4RFSB 1N32Q 3KLRA 1NN1A 3B1XA 2NN6H 4IFEA 4QGFA 2Q2TA 1N2CE 3SR0A 1OF1A 3TGPA 1ZM4A 1GOTA 1PUIA 3LVRE 4IDPA 2VL7A 2W58A 3ZVNA 4I7ZC 5JJKA 2QSYA 3AFPA 4HLCA 4KBFA 3SN6A 1R2QA 5LPNA 3AKEA 1CKOA 1WYDA 1PHJA 1G8FA 4JL5A 2GJ8A 2ZM5A 2IXGA 1UKEA 2AUJD 3HU1A 5C3EH 1P16A 1J8YF 1NJGA 3RS7A 3AM1A 1EWIA 2V1XA 1VG8A 4Q19A 1HQMC 3QVVA 3T12A 4F91B 2UZ3A 3M3YH 4KODA 2AWNA 1G20E 1H8EA 3RRMA 1OE0A 3GJXC 5TARA 2EQSA 1DD2A 2GCOB 4LOAA 4M9SA 1PH6A 1VCIA 1N6LA 4XOIA 2NVTH 4A3MH 1T6NA 4MRPA 2R93G 5CJPA 3LGJA 4DK3C 3A58B 2ODBA 4TTRA 1W7AA 3CAMA 1IBKQ 4MUAA 2JDID 1KI6B 1IJFA 3BZCA 3GJ6A 4TYPA 5AUPB 2BM0A 3SE0A 4B2PA 5KSYA 2GESA 3E9IA 3PF5A 1E9SA 2R6GA 1VG0B 2D74A 2ZJAA 5F98A 2G6BA 4QY7A 1IBLL 5FOVA 4JYCA 2K75A 2ZJQA 5DHFA 3RWMB 3M85A 3CNNA 1JI0A 3N70A 4GZLA 1V43A 3L0OA 4IEIA 2OM2A 4Q7KA 1AZTA 1O3YA 3TUZC 1RVDA 2CWAA 5JMTA 1KDOA 1ZU4A 1R9TH 4FWTA 1MKYA 2A6HD 1XNQL 1T8TA 2X2EA 1G51A 1WCMH 2H7VA 3R9XA 1II8A 4PZ6A 2GEDA 2J7PA 3ZJYA 1PVOA 1P9RA 1DARA 3AVQA 3L2OB 4DCSA 1PLKA 2F3RA 1Y69U 3QEOA 4MYCA 2IX3A 4JI7Q 4BY1G 4Q5IA 1W48A 2BDTA 4CF7A 2KCCA 4P74A 4OK3A 5FLXc 2CJWA 1SLJA 5FI0B 2FFBA 2VUMH 3T61A 4HIKA 4OQXA 3OAAA 3NBXX 1JBKA 4X8HA 1NF3A 4GRAA 4NB3A 1NVUQ 2O0HA 3EA5A 4Q7LA 1KI7A 4M1WA 1QVRA 5ELOA 1P2UA 1K0RA 4Y7NH 1RYFA 2PJZA 5EZ5A 1P4SA 2VBCA 3HR7A 4B47A 4DCNA 1NVVQ 1G7CA 3AEVA 1L4UA 2PCJA 4JLNA 3B1YA 1VQ6A 4NE2A 2IYUA 2N46A 2YNMA 2ZJ2A 3ZS9A 3FTQA 1L7VC 3PVSA 5IE8A 4ZIRB 4AG5A 2QPOA 2JA1A 4JSTA 3I8SA 1LABA 2ZRLA 1HA3A 4FN5A 3I8XA 3IIKA 4J15A 1Z8FA 1OKKD 3DMDA 3A5UA 3CC7A 4QHYA 1P6XA 2VW9A 4UP9A 4IFDH 4PQYA 1GRQA 1MV5A 2ZU0C 1OB2A 1YZ6A 1NN5A 2NGRA 3HOXH 2ZYVX 5BXQC 3IGFA 1PA6A 1QRAA 3Q72A 2ZM6L 4JLDA 3A4LA 1JR3E 4BA1I 2ZRKA 3OEHD 1N36L 2IEYA 3QF7A 1CIPA 4LUCA 5JSZB 2JA5H 3W5OA 4LBWA 4MYUA 3BXZA 4Z8YA 2VIIA 2F4VQ 1BOFA 3SJZA 3TBKA 4GMDA 1HY3A 4HB4A 4B3DA 3WDNA 4P71A 3CCVA 2WWIA 1E2IA 4IKEA 2OWOA 3WMGA 3C4JA 3P27A 1YE8A 1XMQL 3DHWC 3T1OA 1E1TA 3NDPA 5CM8B 4A3GG 2YYZA 4OHZA 3UMFA 4YWKA 1TU3A 3CW2A 1P7CA 4DSNA 2BBTA 3BRWD 1KDPA 2QEQA 1G41A 2OE2A 5CLLA 3K9NA 4URZR 3S1RH 3PO3G 4M1KA 4PHFA 2JJ8A 5SZJA 3K7AH 2C9YA 4WOPA 3BU2A 2N42A 4P31A 2JDIA 5L3QB 1XD8A 2Q6TA 3THYB 3BH7A 1ZU5A 4PSVA 1JJGA 3TZUA 4B3BA 1I4DD 3PEVA 4A8JC 4GLAC 5G3ZA 3PF4A 1R8SA 2ZRHA 2DFTA 2WJYA 1TL7C 2ZANA 2I5LX 3K9HA 4A2PA 4CDGA 2IXEA 1FTNA 2BBSA 1U94A 2Z6KA 3FFAA 1AJEA 5A5GA 1F2TA 4A0HA 4BLQA 4PSKA 2J1LA 3KKOA 4Q1EA 3CC4A 3B78A 3J80i 1LS6A 3DO6A 2RF4A 2QMOA 3L8ZA 4GMXA 4B3RL 1GWNA 3NH9A 4YY3L 4KKSA 1US8B 1JE5A 3EIVA 5E95A 3LY5A 2J0UA 4A3IG 1G7RA 3P20A 1DGSA 3Q3JB 4Q03A 2IS1A 2RAPA 2HHHQ 3LVQE 4TQUS 1T0JB 2E87A 2QTFA 5FUXA 3T53B 1P9NA 3BAFA 1L1OA 3KJGA 4FD2A 1KOFA 2CEAA 1JB7A 2C78A 3VNUA 1CKNA 4LFCQ 5BN5A 1NTGA 4KITB 2QBYA 4LF8Q 1F48A 1JMCA 1W5TA 1P2TA 3TH5A 5BN3A 1J2JA 3KX2A 4NU0A 5FPSA 2LXKA 2BVNA 5H68A 1C9OA 1SVIA 4I1UA 1PYBA 3QKRB 1E2ZA 4B74A 3W1BA 1TQ2A 3KQKA 1W2GA 4U7DA 3AVUA 4JBJA 1RRPA 3RZDH 2IHEA 1OTCA 4DV6L 1EFUA 2QA4A 1ZINA 2BA0A 2Q9CA 4JLPA 4LBYA 5EE3A 5FL7A 3W34A 1RJ9A 4US1R 4DLYA 2KJQA 5JI2E 1XTJA 3A7LA 4BEJA 3A8JE 4WVFA 4LFAQ 2P5TB 1N8RC 3WYFA 4OI1A 3SQWA 2V6IA 1JECA 3H3VI 2H5EA 3U60B 4TKOB 2RHMA 3TK1A 2B8FA 4XTCS 4DDVA 4JYBA 3RLOA 1R0ZA 3UATA 1GKUB 1OXVA 4LJAA 5BN4A 1EFWA 4MKIA 2O8FB 1XPRA 4W5JA 5M5XH 4POAA 4AYBG 3GCGA 1E4YA 4JKIA 4JI0L 4BXXH 3U3RA 4LNQA 5C44H 5FUWA 4NXNL 1HE1C 4ABYA 1J99A 2FMXA 5BR8Q 3GMTA 3OTOL 1IY1A 3CBQA 1EK0A 3ZIAA 2J0VA 2ZQ5A 3A1SA 4TZ0A 1VQHA 2OTLA 4DV7Q 5HE9A 4LK1C 5CJ2A 3WNDA 3U4QB 2O8CA 2XNDD 2J7KA 3AGQA 4IQZA 5D3MB 3K8AA 1KSGA 3ZVLA 1HNWL 2XTIA 5C0XH 1DO2A 2O0JA 3BZKA 1HEIA 1FUKA 2RHDA 3AB9A 4BRWA 4O2RA 4MTNA 3FHOA 4LC1A 2D7DA 1FZQA 3FE2A 4D6PA 2QGNA 2X1VA 4L15A 5FBQB 3CPHA 1FTSA 1L0WA 4WZAE 4HAUA 4US2R 4DR3L 3TSOA 2RB4A 1A1VA 4H44C 2C03A 4HIDA 4O0AA 1ZNZA 4UPAA 5FBLB 1K8RA 5H1YA 3KUDA 3VKWA 2IYYA 3SHWA 2D7CA 4D4LA 1XEXA 2A19A 4LJ5A 1VQAA 3VKHA 1OXUA 3HOUG 4BZQA 1E3MA 1XD9A 1AQYA 4CEIA 4R4IA 2V1UA 3A1VA 2MQHA 2GTPA 1RPZA 1XCGB 2Z4RA 2QI9C 2IYLD 2OFXA 5B57C 3TEHB 1SHZA 1NJIC 1Y8NB 3MG9A 3GTKH 1X6OA 4LHXA 4B73A 4Q66C 1XTQA 4RCZA 4P32A 2BMDA 1M1KC 2OLKA 3D6TB 4A2WA 1N6RA 2EYUA 3BIFA 2AHOA 2NMVA 4A6XA 2QZ4A 1R0YA 3REGA 3PCOB 2NPFA 1ZD8A 2WAQG 1LW7A 2UXCL 3EIEA 4KU4A 3VMFA 4KYUA 1I2MA 1T91A 4EJSB 5KNBA 1UE5A 4B75A 1OV4A 4R4QA 2XJ9A 1QZHA 1FPMA 1GNPA 1HV8A 1ASZA 2VH5R 4FWIB 3HR8A 1TWFH 4TVAB 2H16A 2LWIA 2XOKA 3CWZA 4PZLA 1WE2A 2W6JD 5ELXA 1G9XA 2DNCA 2YWHA 4B3XA 3U2QA 1LF0A 1R0WA 1P8LA 4NYMQ 2GVDC 1QUQB 4LF7L 4C0BA 2NO6A 2BMEA 1OYWA 3CCQA 2V9PA 2I0QA 3I1FA 1EYGA 1XJCA 4DKAC 1YU9A 1OIXA 2XZLA 3GJ8A 2IBMA 4GOKA 1KYIA 4A0GA 4EX5A 1FMLA 2ZRMA 4MRRA 5DGXA 3EIHA 4M1SA 2R92G 1OHHA 1DAKA 4LUOA 3ASYA 4YCUA 1YHQA 2I4IA 1OLOA 4IFDI 1UWVA 4M1OA 5CM9C 4Q01A 3GEIA 4F92B 4CEHB 3W5JA 2VF7A 2LXJA 4BFTA 3U58A 3UE0A 2TMKA 4PC6A 4YLGA 5G41A 1BIFA 1IN5A 1YZTA 1QHHA 2NG1A 4LRWA 4P4SA 4X66Q 5B64A 4GOJA 2B8TA 3LDAA 2GZAA 3GJ5A 1VQIA 1F6BA 2EW1A 1ASYA 2CNWA 1T4GA 4QHTA 1Q1EA 4RZ2A 2WSSD 2F6RA 2JA6H 2CDNA 1K8OA 2B29A 1CRPA 2HV8A 1YZLA 4MGIR 2AXNA 4GKKQ 2YOGA 1YHNA 3AF3A 2F52A 3AVPA 2Z4SA 3Q5DA 4KXFB 2YHSA 1GG2A 4TMWA 5J40A 1Y8PB 3V4FA 3ZZ0A 4Z1MD 3G0HA 4TLCA 3FKSD 3ZZTA 2AMCB 5AUQA 1CXZA 4FINA 4KSBA 4DDTA 1NSTA 2EQBA 4BEBA 2RGAA 1SHKA 4IRUB 3GD7A 1VDZA 1XMOL 1J8MF 2CHGA 2AX4A 2C98A 4S2EA 4EDHA 1NVVR 3J81k 3DPUA 3LH5A 3P26A 2BCGY 4EFLA 2BE5D 3PIPA 5M3FG 1RRGA 4JL8A 3HP1A 1P2VA 4Q4AB 5FUVA 3TRZA 1NVXQ 4B3MQ 3O8DA 4ON9A 5KPJA 1KZGB 3I61A 3IQWA 3MWKA 2ZU6A 4NKRA 2UU9Q 3FHWA 2KE5A 3CF2A 4KSCA 4P73A 3WYGA 4IHQA 3DVLA 4A82A 1RIPA 2K5VA 4JI5Q 1FX0B 1X8JA 2BMFA 3MEFA 2PLFA 4PX9A 2E2HH 4LF9L 4IDHA 5BW8A 2VP2A 3F2DA 4DR4L 5HTKA 2OLJA 4JLBA 3CCLA 4YXWD 2WKRA 4Z51A 4XD7A 5EXXA 2L15A 1PH1A 1L2TA 3LWNA 2GZDA 5CIQA 3U3MA 3EZ7A 1IXRA 4DV5Q 4QKQA 3BORA 3CRKC 1KRTA 1CU1A 1Q1QA 1FYCA 2D62A 2RHSB 3GO5A 1GL7A 1GL9B 4JJZA 2R62A 3GEEA 3SHFA 4KHZA 2PQAA 1MT0A 1RYHA 4LV8B 4N0EA 3V9PA 2WPDD 3L0SA 5JRZA 4JBWA 4HJ7A 4N3NA 4YHHQ 4TTQA 1KL9A 1N5IA 1VQOA 2RGBA 1JJVA 1BKDR 2WMNB 3CRLC 3N2EA 1TADA 2GCPA 3B13B 3RZOH 2NZOA 4GKJQ 1NP6A 4G5RA 4JKYA 1F2UA 3KF8B 2PT5A 3QBTA 3IRBA 3K0FB 4MA4A 4RCYA 4A15A 2P2LA 1GUGA 1W4CA 1PZNA 3FB4A 4LV6A 3T34A 2F3IA 4LCBA 4G7HC 3T5GA 1KHIA 1TQDA 5FBWB 2ERYA 2YVUA 1YJ9A 2NVXH 1Z2CA 1YZGA 721PA 1Y63A 3NBHB 2JEOA 3JZAA 1WBDA 1SVWA 2O8BA 8OHMA 1DBSA 2QAJA 3CRW1 4M22A 4LJ8A 4DAMA 3RNUA 3B8HA 3NBYC 4CZ2A 1G6HA 4DZZA 4ZCLA 1WFQA 2BJVA 4XWAA 5AJVB 1K5GA 1NIPA 5HR5A 1QHGA 2VHTA 1CKEA 1M7GA 3GP8A 4X64Q 4P72A 1MOZA 4IFBA 5IHPA 3ZD7A 1MABB 1NMFA 2B8GA 1XDBA 1R8QA 2ZTSA 4K8OA 1N32L 4PPNA 1H95A 4UNNA 2YOFA 5C2JB 3IIJA 1J5EQ 4XSGA 3KL4A 1EWQA 1XJ0A 2P0EA 1Z6YA 4UP8A 2W83A 2WJJA 4PMWA 4A0RA 1Q7YC 1XPUA 4O0MA 2ATWA 3U61B 1E1OA 2VL6A 2QUZA 1CTMA 1SKYB 1BVSA 4R4OA 3A8IE 2VSOA 4M4SA 1L1OC 3CLVA 3K81C 3ADKA 5C0XJ 1FGUA 1V9PA 1OFTA 4BBSH 4HAVA 1GRRA 4JBXA 1X86B 3SQXA 3JVUA 3ADDA 3MXUA 3KB1A 3QOFA 4RD4A 4C2UA 1P61B 2WWWA 2OSBA 2O0KA 2ZSEA 3N6RA 1O78A 4OO1H 1H8HA 1WF3A 3MUFA 3W8NA 4HAZA 2PLRA 4IOJA 1SN8A 2VS1A 4IXNA 3FHTA 1VQGA 4BY7H 1IBKL 3IEUA 1Z08A 4ZPXA 4GLXA 4Q18A 1G291 1N6IA 1RRFA 2RGGA 5IYDG 1MRNA 4LX0A 1TU4A 3BK7A 1ZMXA 5CDFA 1QDEA 3LAWA 1T8UA 3QKSA 2RGDA 1FFHA 4QHSA 3VTKA 1A8VA 5FH9A 4FCTA 4DLRA 2F43B 4ITRC 1VTKA 3AF0A
chains in the Genus database with same CATH superfamily
4CMJA 1WXQA 3H0GG 3DV9A 4RH0A 2Q4BA 1OLSA 3FKJA 4DGSA 3QPBA 5HQ3B 4N5LA 3B1VA 4ZZ0A 3RYCA 4H7HA 2VDWB 4JBHA 4IGEA 2V98A 5DNFA 1U2ZA 1GGKA 2ZIXB 4UFOA 1CRZA 3PLAE 1KF0A 3U7QA 4TN5A 5E6RA 1LYLA 2FXQA 4PANA 2B25A 2JASA 3R3ZA 1XYIA 1MNQA 4DAPA 4K05A 4BB9A 2HWWA 3DF7A 5D00A 1G66A 5P21A 4MPJA 4CCWA 1ZJ4A 2SHKA 2XGOA 3E9CA 4FTWA 3SK5A 4D57A 4QAJA 3R9KA 1VQ5A 3M4QA 1G1AA 4DN4M 4V1CA 1CBUA 4FBMA 5HZGA 4DBLE 5KTTA 2REQB 3QU2A 4G89A 4BP1A 1B4OA 5ITSA 2ENBA 5FRDA 5M3MH 3ETLA 2AYZA 4ZYUA 4YWHA 3F0TA 5DI9A 4P35A 1NMYA 4QRDA 1WIWA 3KZNA 2H4FA 5GAGC 4FR0A 2M6KA 3PQ5A 2Y0BA 2Q41A 3O1HB 2IEAA 2AW5A 4PMBA 1JLLA 3G88A 1IATA 4F60A 1WNTA 2FZGA 1JQ5A 2W2PA 2ZTDA 1Z6AA 2ZT8A 2CHVA 1E22A 5IDXA 1NW4A 4EH1A 4DV5B 2QLFA 3A5ZB 3OU6A 1SNQA 5BR8L 5EIOA 3OETA 5JQGB 2QRGA 1FNUA 1SHJA 1GUAA 1KEWA 4TYWA 4LZLA 1Y7PA 3KIPA 1CY8A 2N3SA 4AMVA 1SUDA 3IUYA 2GI4A 1OX4B 4K6FA 3I45A 1NMGA 3DT8A 2CNOA 2BSAA 4MW4A 3OE7A 4ZK2A 4QARA 5BMVB 3GLGE 3FWZA 4KUEA 3V2IA 1G8KA 2NU6A 5COQA 3UI2A 2YXNA 2HMUA 4B4WA 1RU3A 4Z7OB 1LTTD 4YDQA 4ARIA 4G09A 2KCNA 1P7VA 3NVKI 2POCA 4AMYA 4ZIRA 3DE4X 3EG5A 5A4FS 1Q0TA 4MO9A 4WK4B 1NRIA 4G4SO 1EUJA 1GCGA 3QPDA 4DBLC 2AQ3B 5JCXA 4X66L 2Q9AA 2FCAA 3NWSA 4MV3A 1G98A 4ECEA 3QG5A 2QR3A 3UMSA 3ZYCA 5LA6B 4RHSA 1F9EA 1DPFA 2E76C 4XDHA 3VH4A 1V3TA 2PQ2A 2CUKA 1XZHA 4ZZ2A 3H5OA 2XAUA 4DPGA 4ZV7A 2P2YA 4LC9A 1D2EA 3PL5A 4DCCA 2K5UA 4UHFA 1Y48E 2OORA 1F77A 4FF3A 1ZD1A 1FFAA 1XXHE 6GPBA 1GSAA 1EYDA 1IKLA 1JDVA 3COWA 4GKJL 2X13A 3ROXA 1WU7A 3AJDA 1G2PA 1JHDA 4KJOA 4C5BA 1GHKA 4IHJA 4A6DA 2C92A 5CXUA 3RK4A 1F2ZA 1KYVA 4HLUC 4UW9A 3VO1A 1EBFA 4Q00A 3VDRA 3R3OA 2GR9A 4E1BA 3EBEA 1IZ7A 3EBOA 1WDKA 3HCRA 3TVDA 3PQ2A 3IUQA 5I6YA 3N6XA 3KAPA 5BWBA 4YH1A 3FOZA 3B70A 3QYPA 5B58T 1O8CA 1NKSA 4BPBA 5C1IA 1SN7A 1LJUA 1PTOF 5GMOA 2P7IA 3BILA 4IAOA 4CNQA 1KORA 4HEDA 1N34Q 1BFDA 4XD7D 3BS4A 1BHO1 3Q3EA 4FDBA 2Y2VA 4JI4L 3MWJA 4FMCB 4I9GA 3L7YA 3T0IA 4L85A 1K9MC 5JJBA 2NU9B 2PFSA 3MIZA 1STYA 1SXTA 4LHYA 5B58C 5HF9A 4URYR 2CN1A 3VYUB 1DQZA 4X90A 4IJWA 5CGQB 4NBSA 3EVEA 2X3UA 1X77A 3GRKA 2D0IA 4OKNA 1XVUA 5F23A 1KI8A 1T9GS 3FPSA 3GT0A 2YFYA 1CNFA 3JQ8B 3VAYA 4Q34A 2QRVA 2PGDA 3IRUA 3OJLA 2CZCA 3MUOA 3H17A 5FA6A 2Y76A 7AT1A 3RRXA 5DDIP 2BHLA 3KWJA 4EHDA 2Q8TA 1HNZL 1HZBA 5JATA 1EUQA 1Y1SA 4BMCA 4D25A 2MFIA 4QF4A 2VYVA 3PDIA 2QM3A 4R9VA 3RK0A 4WADA 5BWCA 3FW1A 2YV3A 1J21A 1PU2A 1NQUA 3E82A 3ZXUB 2IUFA 3K0FA 4DV4Q 2VJMA 4L6AA 3U4MA 4M6WB 3KKLA 5SY9A 1Q84A 1QH8B 1P2DA 1JR6A 3T5MA 4BXOB 4BDSA 2W6QA 1ND5A 4B3TQ 1FA9A 2OAQ1 2QPLA 3FNFA 2BWJA 2NOAA 4H3VA 2E4UA 4D74A 4Q0FA 4F0JA 4NKLA 4R1QA 3ZGYA 1HZ9A 1SFOB 3LY7A 2HPZA 1AN0A 2WDZA 2YUIA 1EZ6A 4A3CG 3GLFB 3GV6A 1FDTA 5B53A 2B30A 4M8SA 1XTKA 1E3WB 4AU1A 3TRHA 2CYAA 3R9WA 4UAGA 1LTHR 4Q9LA 1G4UR 4BZPA 2IOFA 1NF2A 5KX5F 2QG6A 1ZLYA 4TRJA 4WZBB 3OWOA 2QKYA 5IP5A 1VA4A 5JJLA 2F62A 2PAFA 4E5PA 3U6KA 3DEFA 2PUCA 4GYKA 4YWMA 1M0WA 1AZSC 5ADUS 4CL8A 5KVQA 1NVWQ 3C41J 2F8TA 4DWWA 4EO4A 4OXQA 1II3A 2WC1A 3H0GB 3QLVA 3UJ3X 4ZMBA 1D3AA 3HJHA 4FP9A 3NW9A 1NLFA 1DXQA 3ZIDA 3U7QB 3MT0A 2PIDA 5DTJA 2PZGA 1DC8A 1O95A 4GBJA 4RHEA 3LBNA 4N0DA 1U2GC 1O1YA 4O29A 2G4VA 1WTHA 4L8JA 5B37A 1DVRA 3BE4A 3SR3A 1G64A 1FJGL 3V7YA 4LF5Q 4EFMA 1HZZC 5KJ1A 3VU0A 4OREX 1E6CA 1HO3A 3JR7A 3ANXA 3OE7D 3QLTA 1NPTO 1XDZA 2P2NA 4NYIR 3N52A 1SRRA 1AKWA 2NQTA 3CRMA 1BRMA 1TJ3A 1F9AA 5CR9A 4H7KA 2R2GA 1LNQA 3S17H 2JK0A 4H1UA 1L4BA 3BFXA 3QY0A 5SY6A 3RD4A 3KHSA 3UK0A 1IOVA 1IEWA 1LRKA 4RXUA 3TWOA 1DAOA 2JGEA 3KQMA 2WIGA 4WN3A 4DK0A 3PFHA 5CCDA 5ALQA 4A3EG 4JX9A 4NOLA 4GC9A 5LYJB 2WWHA 1USKA 3R5SA 1GTRA 3KU4A 2WB2A 1KYQA 3RC1A 1VQCA 3NTOA 3FCAA 3DBRA 3FPLA 3D4OA 1FFXA 2IH2A 4BE4A 2WVJA 5THKA 4DC0A 4C29A 1CHNA 1D2MA 3NDJA 5FP0A 2EU8A 3DOEA 4PLTA 1XVLA 4TQGA 2R7FA 1I13A 1FU8A 4KQKA 2QPAA 4DY6A 2ZVQX 2JI8A 4ZQ3A 1DAPA 3TTUA 3P9YA 2FOXA 3O2SB 3AUSA 4KE9A 1F14A 2CD7A 5TMEA 3KYHC 4R8NA 3V1UA 1WQ3A 1P5ZB 3J7TA 4YQFA 2B2UA 4KO1S 4KIWA 3DG9A 2XQVA 2BE5C 4J07A 2HRZA 5BR4A 1UP4A 1SC9A 1P44A 2XNHA 1D5ZC 3H1AA 5C3XA 3AIMA 1PL6A 2QMUA 3WWVA 1Y3HA 3GX1A 5HF6A 3R74A 3EG9B 3ZWAA 4RETA 4OGFA 2NSLA 3LP6A 2C29D 3ED5A 1I5RA 1CEQA 1E0JA 2AEEA 3A2KA 1S5CD 2OHJA 4RUKA 2Z57A 3UJHA 1NUTA 4WNYA 2O1SA 1G5QA 4PYRA 4OD0A 4ABNA 4F9EA 1MEJA 5C32A 5LP6C 1KMQA 2DKOA 3OC0A 5EWJB 3VC2A 1XBTA 2NYVA 4IPHA 3UUFA 3JRWA 2KPOA 4MA5A 3KKQA 5DM70 3SHOA 4QD3A 1M8GA 3PYMA 1ACMA 2G1KA 3VPSA 4PNHA 3AESB 4Z4QA 1U2PA 1C48A 5ED0A 2I7XA 3HYRA 4QULA 1RTTA 3FZEA 4CHTA 4DSZA 4MGYR 1IC6A 1RTOA 3L7KA 4HWPA 2LSSA 3R6WA 3SMVA 3HJGA 1PK9A 3ZNNA 1WG8A 1R0KA 2RQXA 3NHYA 3EMVA 4Y1RB 4IPCA 1CB0A 2EYPA 4ZVUA 3RUFA 1TR5A 2A5DA 3H9EO 3AI3A 3O47A 1N7HA 5LDHA 4NCHA 3A3OA 4GDMA 3PEFA 1HJPA 2VYVD 2LFNA 2UAGA 2Q7DA 5JBIA 2BOVA 3FPHA 4UHDA 2ZT5A 3D7LA 3JWPA 5KWIA 3WDMA 1DELA 3DS8A 3FR8A 2DECA 1TM7E 1P2SA 2FZEA 4MVJG 3PNLA 3A0UA 3OOYA 1UBRS 5DISB 4LS3A 2ORIA 4EPVA 1JICA 3TSZA 1CDDA 3V46A 4CR6A 2J3LA 3JQQA 2NZJA 3MS2A 4JLMA 5TDHA 4AP6A 1FYVA 4MVJA 1E69A 4I8XA 1U6JA 2H31A 4EHLA 5IWAB 3E4DA 2BEUA 4EHBA 5FOQA 2VA8A 2MPMA 4EFDA 2BE7A 3IT3A 1AUPA 4N8FA 3VYWA 1F3LA 4KUGA 4ZAGA 1AKYA 3I58A 3IAFA 1GPJA 4OY3A 4P54A 1XC7A 3VAAA 1Z4JA 1R0BA 3A6DA 2OO7A 4NS4A 3M6MD 1W46A 2OLEA 1U2QA 2L42A 4ARZB 1G38A 3CWCA 1S7GA 1C3OA 3X44A 5G4KA 2B99A 3AFGA 2NO1A 4OGKA 1Z7TA 2MYPA 3MTGA 2F9LA 3L07A 3DC7A 3KTAA 1XTRA 4L51A 3WL5A 4UTZA 4JI1B 4JXJA 1TD1A 3KD3A 3W6OA 1S0UA 3O9ZA 3IILA 5FX2A 4EI8A 5K09A 5CVJA 4HXEB 3MWYW 3L0BA 1IB0A 2ZI6A 4PTZA 2FJ2A 3B3GA 4K81B 5MGBA 3P1HA 3QEKA 1T9HA 2VQEL 2I46A 3VH1A 4AUNA 2FXVA 1I5FA 1BBUA 4CMBA 3S1NH 1O95D 2XUKA 1KJZA 4DLXA 4COOA 3KUKA 4EY3A 1SGWA 4D5GA 2X9NA 1EB8A 4RGTA 5IM4A 3VVLA 1ISJA 1QGUB 5BSMA 4M87A 4PCUA 5ERYA 1L5LA 3RCBA 1UJBA 3D8BA 3GDEA 4HZUA 3G82C 1Y4SA 1UQTA 1RRMA 1TF7A 1NWHA 4TMZA 3LQFA 5JNUA 2CHEA 2A0WA 2CV1A 2P67A 4PLGA 1VQKA 2Q3DA 5TVGA 1KMHB 3VR5H 4DWOA 3ZGXA 4CMEC 1F8YA 3OY7A 4ZDIA 3G23A 3ILYA 3O4IA 4WJZA 3BJZA 3DBIA 1O77A 4MUJA 3JQAA 3RVLA 3BIXA 3ZXSA 1UMCA 1JEEA 3U09A 4KJZA 1DXOA 2SICE 1T6ZA 3WYEA 1LRJA 1ZH4A 4EEKA 4DNIA 1PNTA 1XQVA 4OMDA 1J7KA 2BRUC 4M38A 1VJ1A 1U0EA 1LW6E 2QGQA 4QOFA 4BMVA 3CLTC 4B9EA 1MJHA 3K70C 2WYUA 4YMLA 4I36A 4URWR 3A74A 4YUZA 4R1OA 1HDXA 3ULPA 3HJAA 4YV2A 4ZCSA 3QIAA 2ZIVB 1GQRA 4RK1A 1AKRA 4POGA 5SYMA 3BJEA 1QVCA 2ZM6B 4PYNA 2F3QA 5I9MA 1P2GA 2E3JA 4BVHA 4LZWA 2P91A 4ARSA 3IKMB 3IEKA 3R20A 4LPKA 5CYPA 3K57A 1ZS9A 3RS4A 3EDRA 3I7FA 1PTKA 3ETGA 1K4YA 4A3SA 4ZK6A 1R4AA 1ZC3A 4ZYSA 1DBIA 3EZFA 1HR0L 4X1YA 4DZRA 1BVYF 1QGZA 5GAEC 1TXYA 1VHJA 2C2XA 2NZUG 4H0NA 1K8XB 3BCHA 2P2ZA 3GUZA 5JH7B 1KEUA 3IUEA 5G0WA 5K3CA 2JIDA 4EA7A 3BFPA 2QI9F 3LUBA 1YQ9A 5CJPA 3B3QA 1U9CA 1TIPA 3K5MA 1I6LA 4B7CA 3DQZA 2C59A 5G0SA 5F98A 1UFRA 2EDAA 5DHFA 4IJKA 5JMTA 4S1NA 1R9TH 4BNJA 2GEDA 4HGOA 1MAUA 3TNLA 1GZVA 2Y93A 2PZ8A 2F3RA 2GYUA 5L4LA 2ERCA 3S55A 3Q3GE 3B2QA 4OA5A 2O0HA 1KH2A 1E6KA 3ME5A 4NE2A 4INOA 1L7VC 4J0JA 1ZRSA 3I8SA 3DMDA 2XMGA 1P6XA 5A3VA 1NN5A 4K5QA 3UJBA 5CFPA 3TSCA 2CYBA 1YTUA 2HH9A 2PG3A 2L82A 2WWIA 1E2IA 1PV2A 2JLAA 5DSTA 9LDBA 2AVDA 1E1TA 4I4TF 3H1EA 4OHZA 3D2BA 1A8PA 2DUWA 4DSNA 4CLOA 4GC5A 3KHUA 3QBJA 1V45E 4O02B 3PNYA 3WQQA 1EHCA 4L74A 2PZJA 3ESAA 3P20A 2IS1A 3NIWA 3NHRA 4LN1A 2AQKA 1WPQA 1NI5A 4EY5A 4Z7JA 5BSEA 3NPPA 3QHAA 1L5GB 5EJAA 5IBPA 1OTCA 1O5OA 4G2TA 1RKNA 2AEFA 5F51A 5JI2E 4UEOA 2F0NA 3CLHA 4FFBB 4RU1A 3HKDB 4LWOA 3NTHA 1ZAYA 1WKBA 4G1VA 1K6JA 4JI0L 1PFQA 1WVMA 2JCVA 2J8ZA 4C4YA 1SCQA 1V5FA 3PNKA 5AVOA 2JA6B 3FWPA 4NQRA 1EUDB 5KU7A 4J90A 1SUEA 1WABA 1RQGA 3CPHA 4GI5A 4US2R 3ESCA 5FBLB 3WV5A 2V9CA 4FSDA 1E77A 5AESA 1C14A 2WKCA 4RH1A 2E7ZA 3CURA 1GFZA 4IMIB 1AO3A 4TZTA 5A71A 2GCIA 3REGA 2NPFA 2QM0A 3VMFA 1TIBA 4X3UA 4OQDA 3EZNA 2GF2A 4FUQA 2XOKA 3CWZA 2ZBDA 4PZLA 2X6LA 4HVTA 4B45A 4OEMB 5F7OA 2UVDA 4RJJA 3QBDA 3EIXA 3AO0B 3O31A 2P8JA 1BDHA 2NV0A 3MMNA 2J32A 1U4SA 1YUMA 3M9WA 4EBFA 3CUSA 4QCLA 2AMCB 1KQGA 4FINA 5EHIA 3LH5A 4ZEMA 4CV0A 5BVGA 2JANA 1UPXA 2LV8A 3CF2A 3EA4A 1MAWA 3JYQA 3AEQA 4LGVA 5BUQA 3F67A 1H42A 3F2DA 3CCLA 3ZV4A 3TZ6A 3E3XA 3FTPA 1L5HB 1P33A 3WMWA 2ZWIA 4QEDA 2Z4TA 3B13B 2IJ0A 4EPYA 3E9YA 1SYBA 1LC0A 4CIXA 3C24A 1WBDA 8OHMA 3FJYA 2DKFA 4XWAA 2VHTA 4DF7A 3GP8A 1S4ZA 3JQAD 4K1XA 5FADA 1N7JA 1MF7A 1P4AA 1RJEA 4X60A 3NJ8A 3U61B 4AMZA 2R1TA 3EQ2A 3JVUA 5CFZA 3W5SA 2JI9A 1ZMTA 1PG5A 2O0KA 1DDIA 3W8NA 1TS3A 3FHTA 1RLJA 4BY7H 4LFAB 1JHRA 2FZ5A 5BT8A 1MRNA 3EQ7A 1A8VA 4JJIA 2PUAA 3D59A 2DVMA 3ZCRA 3UAOA 3JC66 3O0DA 2BJHA 1HHVA 3I92A 3HOVH 3H18A 4L7VA 1LK7A 4DV7B 1UOEA 1TUGA 4L0CA 3VPHA 2PX0A 3X1XA 2ETXA 2FWAA 4B35A 4YDHB 5AK0A 4JZKA 4HEHA 1PR6A 5KOJA 3NS7A 4O4JF 2WHPB 4MB0A 2VHXA 4JU9A 1Z37A 2XMRA 1LEHA 4I5EA 2I2XB 1IJEA 3TLCA 3LGAA 1MIOB 4EL0A 1WHSB 1UP7A 3E1KA 3GJ0A 4J7CA 5D8DA 2F0MA 2WD7B 3M6VA 2O8VA 2BR3A 4FMDF 2P4SA 1XRPA 2XRZA 4GZYC 1K2VN 4UCXA 4NYMR 2WIBA 2IHNA 3IP1A 2FPPA 3OZGA 1WD5A 2PBRA 1RXWA 1QAMA 1QOZA 1XZEA 3TKLA 4JVZA 2G1UA 4AWBA 1W4RA 4MQ4A 3R3WA 3CEAA 1R6UA 2OC4A 4KZKA 3P1JA 1UZNA 4EYKA 3B1ZA 4P3KA 3LT4A 2OGSA 3SHTA 4N47A 2D0OA 2ZSIA 4U2KA 1CQIB 4DIUA 1I94Q 4HUQB 1EFAA 1NOIA 2ZDQA 3BS1A 2IYZA 3AEZA 2ODTX 1WTCA 3AFMA 4X61A 4CDFC 2Z1DA 4IJVA 4B3MB 3E9RA 1IBCA 2JA5G 1PLJA 2I2FA 3H15A 4HGZA 4RGOS 3ED1A 1JMYA 1OMOA 4J3JA 4KKXB 1IAVA 1G4AE 1JWLA 2ZI7A 2ZTCA 2WKQA 2ONKA 3KOMA 3DL4A 2PEZA 2JZCA 3S24A 4UZFA 1LBSA 4RHFA 5DCUA 5CFNA 3BIWA 2P5ZX 2D0PA 3NBMA 1S40A 4KSYA 4ZQEA 1TWHB 1X3GA 3AU7A 3TI9A 3C6BA 3IVRA 3TW6A 4K14A 1ZY2A 2FMMA 1QVFA 1BQ4A 3AR9A 3CRQA 7MHTA 3ILVA 3NTQA 2WOOA 3RUIA 3L7NA 1N5LA 1I6HH 1T25A 2XITA 5ER6A 4OXYA 1RJTA 1ZZEA 3V34A 3HXKA 3HDJA 3V1KA 2WJ6A 4BXXG 3QV1A 2ERXA 2X19A 3HKEA 2QUAA 2DR0A 2CQOA 4Y2RA 4XIFA 2JCGA 1F5SA 4KLAA 1B73A 5C0XG 4UNSA 1QIFA 2XWBB 1VIAA 2OXFA 5ELLA 3S2HH 4BWGA 2FV8A 5FBZA 1EXNA 1UR5A 4DU9A 4HUJA 3S1AB 4H15A 3EIOA 3H0KA 1TQOA 4TXHA 5T6MA 1TQ8A 3C7KA 3THYA 2DJ5A 3SJAA 4LJ6A 4U9UA 1HYEA 2DH5A 2ZRBA 2DHCA 1GCAA 3SGLA 2YMQA 2EFYA 2A1AA 3V5NA 2WIAA 1HFJA 1CQJA 1Y81A 3HEMA 1C3XA 3IUJA 4AI6A 1K63A 4RMIA 3V4ZA 4R0VA 4H1VA 5JJ5A 1N33Q 2ASEA 1Q95A