4JBWA

Crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
370
structure length
370
Chain Sequence
ASVQLQNVTKAWGEVVVSKDINLDIHEGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGEKRMNDTPPAERGVGMVFQSYALYPHLSVAENMSFGLKLAGAKKEVINQRVNQVAEVLQLAHLLDRKPKALSGGQRQRVAIGRTLVAEPSVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKVTATAIDQVQVELPMPNRQQVWLPVESRDVQVGANMSLGIRPEHLLPSDIADVILEGEVQVVEQLGNETQIHIQIPSIRQNLVYRQNDVVLVEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose transport system permease protein MalF
publication title Carbon catabolite repression of the maltose transporter revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transport protein
total genus 78
structure length 370
sequence length 370
chains with identical sequence B, C, D
ec nomenclature ec 7.5.2.1: ABC-type maltose transporter.
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17912 OB_MalK MalK OB fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4jbwA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4jbwA03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jbwA01
3NENA 3QJYA 3EC1A 3NDPA 5IYDG 3NXSA 4CRWB 2HT6A 3AB9A 1TF5A 2C35B 1FJGQ 3B8HA 4GKJQ 3NELA 1YITA 2VH5R 3KB1A 4DT1A 3QVVA 4BZPA 2ZM5A 1LTQA 3P4XA 4FMCF 2O8FA 4A3JH 1E2HA 1IW7C 1NN3A 3L0SA 4JKYA 4YLGA 1YKSA 2WSSD 3D7MA 4A9AA 3W6OA 3K70B 3VKHA 3NEJA 2QI9C 3ZYCA 2NTYC 3HYTA 1XU4A 1ZM2A 3P32A 3P4YA 3E70C 2IW3A 2P67A 1XMVA 3FDIA 2QSZA 4PQRA 1SE8A 3SNHA 4NCJA 2YZ2A 1X3EA 1AS0A 1G21E 2FA9A 3EZ7A 2ZU6A 1Z28A 3K80C 4DAYB 2AHOA 4CIDA 5JEAG 1IZ6A 1OW3B 2CKZB 4A3BG 3QG5A 3PFIA 3WP0A 4DV1L 5SZHB 3M4OH 2G1JA 2WJJA 5CDFE 3U4QA 2EIFA 4LHXA 3FMOB 4TLAA 2KCTA 4ASUA 4H13C 3TRZA 4DR7Q 4GKKL 4G7OC 1IY1A 1MRSA 2D2EA 3JAMi 2MSEB 2VHTA 3VU9B 4PMWA 4U00A 3ADBA 1G51A 2MO1A 5KDDA 3IQXA 4A3JG 2G0TA 4C9BA 2QT0A 3DOFA 3OIVA 3KQKA 3AUYA 5C44H 1CJUC 1N9WA 5AJWA 5SZKB 1RIPA 2ZSFA 2EYQA 2QAGB 2CLDX 2ZVPX 4NBSA 3K09A 2K5VA 3AB3A 2QBYB 4A2PA 2O5JC 3PXGA 1VQ5A 1HJPA 1E2IA 1SRUA 1DO2A 1T0HB 2ZRGA 4Z1MA 3TQFA 4KBFA 2ORWA 3GLIA 1YZQA 1VQ4A 2GKSA 3M4QA 2NVYH 1JALA 1BBUA 2VYFA 3MD0A 5FTKA 2ZYTX 3ZS9A 2ZE7A 1NRJB 4LJAA 3J81j 4HJ8A 2FG5A 4URWR 1M8PA 1Q90A 2CCGA 1XPOA 3EZ9A 4BWYA 2NZHA 1G1MA 3O8DA 2AK3A 4MNOA 1VIYA 2YINC 4HDQB 3DEFA 5DH9A 2VBCA 3C16C 1ASYA 4AYBE 3GLGE 2O5IC 4V0NA 5C18A 2GWHA 1RIFA 4URXR 3TW4A 1A4RA 3VHLB 2HV8A 1Z47A 1NMXA 1D5CA 2JEAI 1OSNA 3SFZA 4IFEA 4NE2A 3CMEA 2H5XA 4JV5Q 2JA5H 4C0SA 4A3MH 5C44G 1VYVA 4DSUA 1NY4A 2DCUA 4JBKA 4JI3Q 1E3PA 4L5TA 1I94L 1YIJA 2Z43A 4M9QA 4JLJA 1N34L 3HYRA 4M22A 5JEEA 2D06A 3JVUA 4LHWA 3HU1A 1AK2A 1PJRA 2CL7X 4QOSA 2QUZA 1W7AA 1JXOA 4Q48A 1HZAA 1LVGA 2B8WA 3SU8A 2WAQG 4CEJB 5EE9A 2YWGA 2HQLA 2PJZA 5IHPA 1XB2A 1CRPA 3S1MH 1SVKA 5KSOA 3QXHA 3AF2A 4TT3D 4EPYA 4PZLA 5J4HA 3ND8A 2VTKA 2MFIA 1JECA 4GOXA 4GZYC 4UP9A 4OYHA 4OWXB 1JB7A 1ESMA 3TVTA 4F4IA 1OXUA 4LF8L 2J0VA 1II8A 1PUJA 3WYFA 1OXVA 1Q8KA 1K8MA 4LF4Q 4AKGA 3UE1A 4AIMA 3TS0A 1MO4A 1M6NA 1G7CA 1W0KD 3I7FA 2P0EA 4FW9A 2JA5G 4A3MG 2A5DA 4V03A 6Q21A 3KXIA 4KBGA 4PZ7A 1JB1A 2W6JD 1R5BA 3GTJH 3CUEF 3VX4A 4PPNA 3VR3A 2GBLC 3QQ5A 2ANCA 4UXHA 4KSCA 1X3FA 2OM2A 1KI1A 1P9RA 5FUXA 3SS8A 3L8YA 2AKWB 3IO5A 4EQ6A 2WWXA 4X62L 4XJXA 4XVQA 2IHBA 4RZ2A 4M53A 4M9SA 3PCOB 1JR3E 3A1UA 5CYPA 3U7HB 1WB9A 4GFDA 5L8VA 2J59A 2E74C 1XD9A 4JKIA 3K1JA 3R7WB 1UDXA 3OTOQ 2Q21A 2RGEA 5AJ3L 4II7A 5CK5A 4D81A 2Y0SG 1G3IA 4XSHA 1JXMA 2X1VA 1E6CA 3CX6A 3U58A 4Q9KA 1EOVA 3X1WA 4CYMA 4O0MA 2AK2A 2BHRA 1ZC3A 2N1BA 1KI7A 4M1YA 4ABYA 3ICQB 4Y7NH 3BZCA 5AJXA 4H9GA 4DNRB 1K83H 1UE6A 4Q19A 3C4JA 2NVXH 4NL4H 3CRLC 1NMFA 1N6KA 3B2EA 3BFXA 2QEQA 4KLNA 5JMTA 2REXB 3QKSB 1ASZA 1E2MA 4NDZA 3WRXC 2XTIA 1SKYB 3CW2A 1KYIA 4OBEA 3MAAC 3X1ZA 1F2UA 3W8NA 1Z63A 1DAKA 1R2QA 2YKGA 4QGAA 1CJKC 2K50A 1QHHA 4BZQA 1KO5A 3RS7A 1G7TA 1GVPA 2VP5A 1XMOQ 4RFSA 3N6RA 5HY6A 1YHNA 1G4UR 4HIKA 4A2WA 1E0JA 1SVOA 1JT8A 3MGCA 5DLQC 1HR0W 1IAQA 4GKJL 3HOWH 2PI2E 2GILA 4PQFA 2IF2A 2AWNA 4D6PA 2BJWA 3GQBA 2ZI3A 1NNEA 1UBGA 4QHTA 5HKKA 2QT1A 4JI5Q 4JVLA 2J9RA 3ZJYA 2Q9AA 2R62A 3THXA 721PA 2KHIA 1K8RA 1W46A 2VSXA 5GADl 3KYHC 4JI6Q 2KWIA 2VHJA 2YJTD 3VNVA 1W4BA 2IYYA 1GG2A 2EFHB 1IW7D 4AYWA 3LXRA 1XTSA 1PMRA 3M4PA 1D9XA 1SVIA 1CR4A 2WICA 4L8GA 4H02A 5EZ6B 2CJWA 1EX7A 3JZMA 4JIMA 1JMCA 4MKHA 3DM3A 4QBGB 2ONJA 3A1WA 3TEHB 1MR3F 2B92A 4PO8A 1XEWY 5FTMA 4DK3C 3QSYA 1Z0DA 3HOXH 2V8OA 5K8TA 2XNDA 4KKUA 2IX1A 4DCTA 3HOWG 4DR7L 3UDGA 2A68C 4HIDA 5ANRB 4LK2A 4A8JC 1A6XA 1ZD9A 4MRSA 4RD6A 1O7IA 3CZPA 1LF0A 3IGFA 4BE7B 4NXNL 1KSJA 1XWIA 2FJUA 2IL1A 1W2GA 1N8RC 4BEBA 3H94A 1KI4A 1SKQA 2WB1E 3K0XA 2RHMA 3CCRA 3LO5A 2QTVB 4CEHA 1E99A 3OIUA 2OCYC 2HYIC 2BA0A 3F1ZA 1TUEA 4IPCA 3QVUA 4WZBE 1X55A 4FDBA 1F48A 2OCAA 4HB4A 2R6AA 1D2NA 1Y8OB 3ADDA 3UMFA 4OI0A 4LF6Q 1UWVA 2R93G 1CBUA 4AK9A 2ZRAA 2ZROA 5FPKA 3UANA 4TYPA 3W34A 1NBME 1M74A 3KF8B 4GP7A 2OFWA 1E1RD 2MMCA 1N6IA 4DUZQ 1Q82C 4JV5L 1TAGA 2ZRDA 3OEEA 3H1TA 4OXPA 4Q21A 2GAAA 1L4UA 4R98A 2IHYA 2RGNC 4QBIA 2GZAA 4OHZA 4Z8YA 1ZM9A 3IRBA 1K9MC 3FE2A 3TSOA 2VP4A 1GOTA 3IIMA 3CIOA 1GRRA 4JBXA 1XF9A 4GLXA 3P26A 1CI3M 3CCVA 8OHMA 2XZOA 3BK7A 1QHSA 1JAHA 1Q1QA 3W6NA 2VP6A 5EE3A 3PV0A 3QPWA 4C0HA 5IWAQ 1YBYA 4DDVA 2QP3A 5HPYB 2ZS9A 1SVLA 3KLRA 1VYTA 4ILEA 3T5GA 3SHWA 3GLHB 1CIPA 2ODEA 2JIZD 3C15C 1QVCA 5AUQA 3CWQA 1JJ2A 1N32Q 3FWYA 2IC5A 3GFTA 4B35A 1E1TA 3AF4A 4OJKA 4S35A 4UNRA 3U5ZB 1K6MA 4LF4L 1B0UA 5GADC 2G9NA 1Q1BA 3ZQ6A 3PIRA 5KYKA 1LYLA 1GHKA 1PA6A 4BRUA 3CCMA 4UJ3A 4BA1I 4Q9LA 1LB1B 3VU9A 3QUSA 1U5KA 2E8GA 1WCMH 1NVVR 2OZEA 4DVGA 1R0XA 2O8BB 1FPMA 1FZQA 3DL0A 3K0CA 3LX8A 2OSBA 4A0RA 4LV5B 4GNXA 1TNDA 1ZNYA 2QAGA 2ORVA 1I6HH 3QXCA 1GL6A 1ZC4A 4DLUA 2ZR0A 4LFAQ 3TE6A 2QBYA 3ERSX 1BYIA 3RS0A 5A4JA 4LV8B 2GA8A 4HDCA 4X8MA 4E07A 3U60B 4TMWA 2EW1A 1EFUA 3CLVA 1GKYA 4GBMA 3SC3A 4G7HC 1IOZA 4YHHQ 2F6RA 2FZLA 4DJTA 1DAEA 4ZCIA 3RS5A 3KB2A 4PR0A 4BFSA 4KAXA 2LCFA 1AS3A 3ULJA 2QNRA 2WJHA 5FOTA 4YWLA 3FMFA 4IDHA 1AE2A 3EZ2A 5KNCA 4TSFA 4GMDA 4YY3Q 1WCMG 4QL3A 1EFHA 2HT1A 3PITA 1IY0A 2WFWA 1EFTA 1OT3A 1Q20A 3KKPA 3V4FA 4E03A 1JEEA 3I5XA 3CKLA 4K8OA 2F55A 4A3GH 1YQTA 2E76C 1KK2A 3L0OA 3AH8A 2IYTA 5AUOB 5LD2C 1OH6A 1G6PA 3O8BA 4WXPA 1A82A 1VKJA 3OE7D 3J7A5 4CEJA 2NMVA 2GJKA 2ZAOA 5FOSA 2CW0C 4X66L 1XMOL 1XJVA 4US2R 1XJQA 3G71A 2RGAA 4ZDKA 2QMEA 2K52A 2FX3A 2Q0HA 3DVLA 3T61A 4BLPA 3AVPA 3AKDA 1EG7A 1W4CA 4HATA 1N25A 4IOJA 4D2IA 2D7DA 2HLDD 3RVBA 1XTKA 1NBWA 2ZJ5A 3FKQA 3WY9A 3KFUA 3TUIC 4J15A 1XP8A 3A8IE 4V0ME 3AVVA 5D3MB 2BC9A 5HZHA 4X65Q 3A5UA 1TPZA 2BMFA 3I8SA 2GVBA 2B63H 3KX2A 3W9YA 3ZVRA 4HYYA 2VF8A 4DSNA 4YMUA 3K9LA 4JI6L 1AQYA 3B5JA 3QXJA 1P75A 3D8BA 2OO7A 4YONB 1K73C 1E24A 2QQEA 1WP9A 4A3GG 1RZ3A 4QGHA 5IP9H 3JC66 1ZYUA 4UXIA 1BMFA 5EZ5A 4NXMQ 2WM9B 2VQFQ 3PUYA 3T12A 3ETLA 1ZNZA 4RZXA 4TTPA 2N78A 3WRYC 4OONA 2Z4RA 2JLZA 2BCJQ 2JJ2D 3RDPA 4AH6A 2ODNA 4LNQA 4GL2A 3REGA 1NLFA 3W5IA 2B29A 3H0KA 5JECA 5CYOA 2WAQE 1F5NA 1YVDA 1S2MA 3BS4A 1Y14B 1G5RA 4KITB 1S3OA 3T5DA 2CVFA 3SJAA 1RRCA 3HOZH 5BN4A 3R7WA 4IO9A 4Q4JB 2QF7A 2XITA 2J7KA 2IA5A 4DAMA 4C3ZA 1OE0A 3NEMA 2WZQA 2XGJA 4RMFA 3C5CA 2B63G 4F4JA 1NJIC 1Z6AA 4Q7KA 3ZQJA 4OX9Q 1AS2A 5C2JB 2NPIA 1VQFA 1PLLA 4JI1Q 3PUVA 4D80A 3TVDA 2CHVA 3GJ3A 2A68D 1XCGB 2ZRFA 5KNDA 1P2SA 2RGBA 2ZREA 4IOKA 4LOAA 1DAFA 2EWVA 2GESA 2OCPA 3F3YA 4TWZA 1YVCA 3S1RH 5IP9G 1IBRA 1XX6A 2B7CA 3GTKH 2GJAA 4UNSA 2C96A 2H8KA 4M0LA 3W5JA 5L3QB 2EQBA 4DCSA 2ZJRA 3QKSA 3PR1A 5G53C 1RYHA 3HOVH 4LF6L 4IQZA 2J45A 4DT1B 3A6PC 2V7QD 1T5LA 4JL5A 1IXRC 3WNBA 2O8FB 2HXSA 4E09A 2EVWX 2QP9X 1H8HD 4UY8C 3LY5A 3HOZG 3VR6A 4EQ5A 1HR0Q 2AKYA 3NC0C 3M85A 1VDZA 4X64Q 4DUZL 4L5BA 2A5FA 621PA 4WBSA 4R4QA 2RCNA 3KLWA 3WXMA 4LK1C 3LBIA 3RANA 1G6OA 2OQKA 3TNFA 1Z6YA 4IPHA 3K09C 1TQDA 1NN5A 1ZJ6A 2FGKA 1SVWA 1BKBA 1CR2A 4OI1A 1M2OB 3CH4B 3PUXA 1G6HA 2WOOA 3S1NH 2RGXA 2O8CB 3TUJC 3TAUA 4DSOA 3UMSA 4DK1A 2CMKA 2QPAA 4NB3A 1W47A 1SMYC 2YOFA 4G01B 5IWAL 4JI7Q 2F1IA 2V1UA 5HTKA 2P2LA 3HOVG 3I5YA 3A7AB 3D6TB 5C0XH 1SULA 3IIJA 2AWOA 2L5TA 5EXTA 3OZXA 4NHOA 1EWRA 4KCGA 1KO4A 2LKDA 1N32L 5IE8A 1D8LA 1E9RA 1N6LA 1TUIA 3LDAA 4P32A 2OQ0A 1UDWA 2ZANA 4PC2A 2CVHA 2GEUA 4QGUA 4WXRA 3BJIC 1XNRQ 3AGPA 2O8EB 4IFDJ 1E1QA 1G16A 2CBZA 2WWFA 3OAAD 3PQCA 1FP7A 3W1BA 1K8AC 5F9FA 1V43A 1AKYA 1X6VA 1VQIA 1FUKA 4GT1A 4TYYA 1YU9A 1GFIA 2E87A 4JVSB 4Q4HB 3WDNA 1N6OA 3BFVA 4B32A 5FBLB 4R71A 4DDUA 5AWFC 2B8TA 3KJGA 2OLKA 3ZDQA 4DUGD 1CJTC 3H4MA 2BCGY 4B73A 3KQUA 4W5HA 1VQ6A 2R44A 2JA8G 4LFAL 1SVSA 3I4OA 1ZUNB 4IXNA 4LJ8A 4JLKA 4EAQA 3FPAA 5UKDA 4ZKDA 3K81C 3I8XA 5E4FA 2AUJD 2QMOA 5C0XG 1MOZA 5FUYA 4IJHA 1X8LA 2R2AA 2WMOB 1VTKA 4YHHL 1IJEA 3CZQA 5M5WH 1BYUA 2DWPA 2O52A 2D4HA 5FOVA 3Q72A 4NCNA 4KLZA 4KN4C 2OEPA 3UIEA 1ZD1A 3UDFA 3QENA 2OHFA 4B6EA 1XNQQ 1G3RA 1OTCA 1IHUA 4ZIRB 1KJZA 3PUWA 2NO7A 2W83A 4LF7Q 1K8GA 4YY3L 4OJQA 4RD4A 5DHFA 4HIMA 3EIEA 3VKGA 5C46F 2R7ZG 5FPTA 3B1ZA 5KHOC 3K0SA 1KAWA 1NL3A 2DHRA 1E9EA 4A75A 2OLJA 1NP6A 4R4TA 4BXXH 1E22A 5EE0A 1KKLA 2RHSB 1OYYA 2FSIA 2IYWA 2OE2A 4PC7A 3S24A 3BERA 3FKIH 1IN7A 4M1MA 4ERNA 2IWHA 3UMRA 1HZ9A 4QJ5A 4DXAA 3I72A 3F2BA 1A2BA 1TQ4A 4PZ6A 3BGWA 5IK2A 1VQHA 2P5SA 2QPOA 1EIFA 1KMQA 4QG7A 4QM7A 1JPJA 2K7VA 4RKFA 2ZRLA 4A0HA 3GTPH 1SFOH 2A6EC 3OEHA 3J80i 2ERYA 1Q0UA 1OXSC 3KOJA 4UNNA 3EIHA 3VR2A 2K5UA 2FZ4A 2WWIA 4FCVA 3J81i 4DIEA 4X65L 4GMXA 4EQ6B 1DO0A 3IPXA 2O0HA 5JBQA 5DI9A 5ELOA 1LABA 3TQYA 1KK0A 5BN5A 2Z83A 1QUQA 1S40A 2I1VB 3FMCA 1L8QA 2JA1A 3AVQA 3R20A 2O8BA 2YVUA 5SZIA 2BE5C 4BXXG 1XCPA 1AKEA 3MJHA 1U9IC 1UF9A 4NXML 1ZCAA 121PA 2VQFL 2B21A 1CEEA 2J5XA 1KO1A 3FKIG 1FMLA 1X8JA 3A4LA 3C7KA 3FYHA 3AM1A 1VECA 2PQAB 1MJEA 3SOPA 1H8EA 1A8VA 2VZAA 1HCZA 1E2GA 4KFTA 4Q1DA 3RRYA 3U3KA 1IN8A 3G4SA 2QEXA 3GFOA 5TXGA 4PHHA 3VKWA 1A63A 1TL7C 1GWNA 1GKHA 3X1YA 1YNXA 4DK6C 3GLHE 3B1XA 3NBZC 4QHSA 2DUDA 4F7WA 1OH8A 1Z7TA 1JJ7A 4TKOB 2ZI9A 3CC7A 2ZYUX 2A19A 5BWMA 2ZTDA 4FXPA 4OX9L 4FN5A 1FL0A 3A7LA 4JI1L 2DYKA 4IDPA 1Z9FA 3TREA 2I5HA 5GAHC 2OG2A 4HI0E 3OF5A 4JJKA 4M9ZA 4W5JA 2IUUA 4OGQC 1FNNA 1KRSA 3L2PA 1MRNA 2IYUA 2PH1A 3SBEA 1R10A 1O3YA 2A7QA 4O25A 1EIYB 3AF3A 4BBRH 2WVJA 4PSKA 2PLRA 1EESA 4I1VA 4DR6Q 1HTWA 2DFKB 2ZJPA 4L9WA 3MMPA 1X3GA 4JBYA 4TZ0A 2ECKA 2JJ1A 2HEIA 2QA4A 3PEUA 4PHTA 4B3FX 5CB6A 4WJ3M 2ONKA 1OFUX 4CF7A 2JDIA 3BORA 4B34A 1VG0B 3Q7PA 4TTQA 5JFGA 3KQLA 3CAMA 4MYTA 1HR0L 3RZDH 1NF3A 4EJSB 1UBFA 4LWZA 4Q5IA 4HAZA 3HDTA 2EFEB 4Q47A 4BEJA 4F91B 2FDCA 2ODBA 4JSYA 4FD2A 3CD6A 3H0GH 2PL3A 5JRZA 5D3MA 1KI6B 1DGSA 1LW7A 4A0FA 4W5WA 1I6VC 1GL9B 1UM8A 1NMYA 2CJWB 4GOPB 1VQLA 2GHIA 2ZRPA 2ZTCA 4IRUB 5JZVA 2R6DA 3FOZA 2A6HC 1RC8A 1PUIA 1HNXQ 5LB4A 3QY0A 1S4QA 4HJ9A 4AYTA 1KIXA 4JI7L 3J7ZC 2G88A 1V9PA 3OYYA 1VG1A 1W3SA 2V54A 4OQMA 4WIAA 4D4LA 4QY7A 1HURA 1L2FA 3THYA 2O8DB 3CPJB 2PMZE 3B9QA 2UXDQ 1MABB 3N70A 2BBWA 1PVOA 2IX0A 1HYQA 2C04A 3CF2A 5FL3A 5LMNQ 2IWRA 2RHDA 4HB2A 1XNRL 1NG9A 3EIQA 5J4VA 3ZVNA 4TLBA 4CEHB 2YYZA 1HZBA 1E2EA 4HDOB 4V02A 1GUOA 3H0GG 3BIFA 2ZJBA 2W58A 4H0LC 1PHJA 1YZNA 1MKYA 5HE8A 4FWTA 3K70C 4GLVB 4C2TA 1V8QA 2TMKA 3WMEA 3CCEA 5SZJA 1LTLA 1OXTA 4B3SQ 3ASYA 3FP9A 4URYR 5FOWA 1RW4A 5DSZA 4Q1BA 1WBBA 2IYLD 5C4GB 1P7CA 1X9NA 1KIMA 1MH1A 4DPGA 1T8TA 3I3SR 5L3QA 1KHTA 2YHSA 4A3LH 1PV4A 3DM5A 5FUVA 1HNZQ 1JR3D 3GJ0A 5G3ZA 5JJKA 1YRBA 1JQJC 1R0ZA 2EFCB 3KJOA 3ZJYC 2VF7A 4MKIA 4UXJA 3GJ7A 1F60A 2JQOA 3I4MH 5H8WA 1W5SA 4DR1L 3PEWA 2A5YB 2C9CA 4QHYA 4NCHA 4YXWD 4DV6Q 1ZD8A 3E2IA 3QXXA 4O2DA 3HKZE 1XNQL 3DPUA 5FBWB 3FTQA 2G77B 3K0CC 4LF7L 4JYBA 1CKMA 2W00A 3EARA 1XXHE 2EJFC 4BLQA 2IHFA 4LFCQ 2E2IH 2VHQA 2ZUBA 2KE5A 2VIIA 1UBEA 1MKHA 2CL0X 5IT5A 3D31A 1EWIA 3KQNA 1W5TA 2HYDA 2O8CA 2H17A 2XEXA 1GUNA 5J4KA 4IVQA 4A3LG 1F3OA 4XIGS 2L15A 2ZJOA 4WJ4A 1GUTA 3LWUA 1I50H 3T1YQ 4EPRA 1VG9B 3IO3A 3BZKA 5TARA 4BFVA 2GVDC 4AG5A 4UNQA 4TL9A 3IPYA 3I4MG 5G40A 1YJ5A 2LXJA 1I2DA 4MRNA 1YR7A 4DWJA 4PXAA 4PG3A 2WIAA 3B6EA 2H18A 1U8ZA 3PVSA 4GP6A 1X8KA 4GNXB 1W0JA 2AN9A 2NPFA 4C0BA 2IXGA 1R6BX 2O8EA 1XMQQ 2DNCA 4JC0A 3AVUA 3S17H 2ZJ2A 4C0AC 5GJVC 4BUJA 2FGJA 4HIOA 1VQAA 2FMXA 1U8YA 5B58C 2A6ED 4Q4HA 1LUZA 2UUAQ 4PO1A 1SXJA 4YCVA 2HHHQ 1RL2A 2QROA 3IHWA 2VUMH 3ZZ0A 4D4JA 1AM4D 5GAGC 4C0KA 1H9SB 2HJVA 1YHQA 3QBVA 4B43A 1GRNA 3U6BA 3T1HQ 4B3BA 4D26A 1EFCA 3KJHA 2BE5D 1OF1A 1LNZA 1HNWQ 1G8PA 4KO8A 1XMIA 5KU1A 3PGZA 1GP2A 1WFQA 4GZLA 3MG9A 4I4LA 1U0LA 4OK3A 1DG3A 4BLRA 1FYCA 2WP8J 2CCJA 4PFSA 4R4CA 5IY0A 1XTRA 3BB4A 4HLUA 4XH9B 3BH0A 5BXQC 3UPUA 4LJ6A 4M1SA 4POAA 3SN6A 4DR4Q 4PHFA 4OHVA 4JOIC 3QIAA 3ZLJA 2DNEA 4L5QA 4O0AA 4OHWA 4TMVA 3G6EA 4ZIRA 1IN5A 2XTZA 3NH9A 4LJ5A 3CF0A 3SE0A 1YZGA 3EX7C 2VEDA 2MSDB 2VUMG 3V9PA 1ZAKA 3RNUA 2VNUD 1MO6A 1WQ1R 1U81A 4JT4A 3GLIE 4OWTB 2O0KA 1PH4A 4HEJA 4Q02A 2V6IA 4DR6L 1XNJA 4KLKA 1FTNA 1TU2B 3AVXA 1U8AA 4RZUA 3N2EA 5CM8B 4O2LA 4LYFA 2VHCA 3AVOA 3E1SA 1QZXA 4KU4A 1R7RA 1NBMD 4M1OA 2GAOA 3IDQA 4LV6A 2AMCB 5BW8A 1Z07A 3AVTA 1S3SA 3SHFA 1YNNC 3IIKA 1Q3HA 2GTPA 4DIDA 2IHEA 2AL7A 2GN5A 5CIQA 4I81A 1S96A 2DWQA 1J2JA 1PZNA 2FFAA 3F0TA 4HAYA 5EUQB 1RJ9B 4R7ZA 3K0FA 2ANBA 3K0AB 2JLXA 2P3SA 5A35A 5FJ8H 2WSSA 3CCUA 1XRJA 1G5TA 2CWAA 2GF9A 2JASA 3KKOA 4LPSA 4NYJR 4DLRA 1NY6A 1UFQA 2F3TA 1KDRA 2AX4A 3W1GA 4NCKA 5FR2A 1XMSA 2A9KA 2ZS7A 1OFHA 1XZQA 3LFUA 2KCCA 5GAEC 3VR4A 2BH8A 2YWEA 1OLOA 2F7SA 1BDOA 2KSQA 1BKDR 5IYBH 4LF5Q 4LUVA 2A6HD 2PQAA 1G7SA 3GTOH 2C9YA 2X77A 4AYXA 2JLVA 4IDOA 4US0R 5LMNL 4TN1A 4OQLA 2CE7A 1E2NA 3M6AA 3B82A 5DYGA 5ELNA 1I4TD 3NVAA 3SEAA 4DKXA 2H1LA 1FTSA 5LDDC 2GRJA 4Q7LA 2A69C 2ERXA 4H44C 1EXMA 2B7BA 5FJ8G 2R6CA 4QBFA 5A0FA 1M7GA 4B3SL 1NSFA 2IXFA 4KYIB 1T91A 2Z6VA 2F1MA 2FU5C 2WKRA 1CXZA 1YJWA 4EPVA 3CCLA 1UEIA 3K70D 1EFWA 1AIPA 4U7DA 1QVFA 5L3VA 1MIUA 1FJGL 1FQKA 1HNZL 2V55B 1KSFX 5FL7D 5HCNA 5KO2A 3OFND 4JI8Q 3A8JE 3A8KE 5IYBG 4FI3C 5FLXc 2IXEA 3KZ1E 1EFRD 2LKCA 2YC2C 4BLSA 2NQ2C 3B6YA 1NVWQ 2EXDA 1DPFA 1B9MA 1HE1C 1HT2E 4JL8A 4LX0A 4DV6L 2ZRKA 4JCVE 3ZS8A 4K46A 4P74A 2Z6KC 2JE6I 4D4KA 4JSTA 1NIPA 2IK8A 4EJSA 4HAUA 4IPGA 5IT9c 5KSZA 2OT3B 4LFCL 2BBTA 3KUDA 5EUMA 1CJMA 1UPTA 1YZLA 2D3WA 2WJIA 3OHMA 4TTRA 3U4ZA 1E2QA 1KI6A 2Q2UA 2JJQA 2A8VA 3A4MA 3EAQA 4WW0A 1XEFA 2KBEA 2D0PA 3A36A 4MGIR 3AKYA 1I3QH 2XOKD 1U2RA 2R93H 1Q1ZA 4GOPA 1G291 5EXSA 2EJMA 4PHGA 1GTVA 3LWNA 1SN8A 1D9ZA 1XFAA 1XEXB 1KI9A 1CKNB 1XZPA 4HB3A 5DISB 3T1YL 3W90A 1RFLA 4MYUA 2VLIA 2KB0A 4LDJA 4UP8A 1K5GA 1OHHD 1KZ7B 1AGRA 2ZYWX 2GZHA 3P27A 1Q57A 4MUAA 4TT3A 4IOLA 2L0XA 1N0VC 2Q8IB 1AE3A 2O8DA 4WZ6A 2ZITA 1FOEB 3Q7QA 2JXMB 2AKAB 1CTQA 1MABA 1KC8C 2IUTA 3B1YA 3CPHA 3T15A 1VQNA 4JVMA 4KHZA 2V3CC 4XTCS 1MJCA 2GEDA 2BA1A 2HUPA 2ZYVX 1OIWA 3TR5A 1XMQL 1W0KA 1FL9A 2C2HA 2HF9A 2PEYA 3L2OB 1GDDA 2JATA 4N0DA 5BQ5A 4EPWA 1L1OC 1ZU5A 1P6XA 4BPBA 3ULPA 4MGYR 1VPLA 2W6JA 4CGZA 3EPLA 3B85A 2UUAL 1XTDA 1Z2AA 4PO9A 2HHHL 3WWVA 1OFTA 4YDHB 1YNJC 2K5NA 1XDBA 4TLDA 1W1WA 1QBKC 2BEKA 2Q2TA 5P21A 3MWJA 4Q03A 1E1OA 2Q2IA 4FMDF 5DE3A 4BGDA 4RZ3A 3MCAA 2BBSA 3EBEA 1X1RA 1N5JA 2VO1A 5FPHA 1CLUA 3ONWA 5EXXA 2E2HH 1HNWL 4A6PA 4ACBA 1KI2A 4HB0A 3EPJA 1CUKA 1P4SA 1TWAH 1UKVY 4JLNA 4JI3L 4DUYQ 1GSIA 4B3RQ 1R5NA 2PMDA 4KFSA 4DV7Q 5IF9A 4DR4L 3CPFA 1P8LA 1JAIA 2BJVA 2BM1A 1Y1VH 1S0UA 4A3CH 1W36C 1GUGA 3P1JA 1G4AE 5J47A 2WBLC 4B3MQ 3AP2A 1KKMA 3SBDA 4A8JB 4DLXA 3ECCA 1HQCA 1J5EQ 1IYVA 2BM0A 3CRVA 3W3ZB 1E0KA 5AJVB 1MT0A 4PAMA 4HZIA 5JI2E 3O8CA 4HAWA 1QHYA 2IYQA 4MYCA 3KKNA 3U4VA 3H2YA 3MJRA 3QOFA 4TMTA 4BZXA 4EFLA 2CLCX 2NVQH 2OCEA 2WPDD 4PPGA 3U3OA 2ZSBA 4TQ9A 3V00A 3RR5A 2KHJA 4B2PA 4DR5Q 4OL0A 3PO2H 2BBOA 4JI4Q 1VQBA 3RRZA 4EDHA 3J81k 3QKTA 2V9PA 4JG2A 2YWFA 2MO0A 1E2ZA 3EN2A 3G5UA 1QUQB 3K8YA 5DI3B 1NKTA 4F4CA 1HV8A 2QRNA 4ZDIA 2HIVA 1US8B 3CQZH 2QE7D 4P73A 3C41J 3IBYA 1WBDA 3I56A 2Q3FA 3GPLA 5JWRA 1Y1VG 1WCV1 1Z5ZA 4A3CG 2Q9CA 2DFTA 2IF0A 5LB2A 4UQOA 2B8GA 3ICEA 1M7HA 3A37A 3QKUA 1QVGA 2B3GA 3GTGH 2P6UA 1VG8A 1BH2A 2BKEA 2VQEQ 2EJGC 1B70B 3BE4A 1OIVA 1IBLQ 3SQWA 1UADA 2Q3HA 3KDSE 1QJOA 2J87A 5G3YA 4GLAC 4XD7D 2VL6A 3OTOL 1H9SA 4YCWA 1TQ2A 3PO2G 2JA7H 1BS1A 1UE1A 1LV7A 4LF5L 1KHIA 1X1SA 4QGFA 4FCWA 3PIPA 4P0TA 3HKSA 1G8YA 3PEVA 4IDQA 3AKCA 2BMEA 4F92B 1FP6A 1Z6GA 2VL7A 2GJ9A 2VA8A 2GVAA 2XSZD 3HPRA 3PUZA 1Q86C 4M1TA 3FHOA 2XJ4A 5GVSA 1XJ0A 2WSMA 4CZ2A 4DLYA 3K8AA 4GSYA 2BWJA 2KBNA 1YR6A 1KQSA 4NH0A 3ZD7A 4MDFA 3BXZA 4JMPA 1OV4A 2W6ID 5GJCA 3TKLA 3AGQA 4V0MA 1YZKA 3F5FA 2JK8A 1P2TA 3NKVA 1VCNA 5HR5A 2CK3D 2A69D 4C2UA 3P20A 2YNMA 3MSXA 4G3XA 2IYZA 3NBFA 4DEXA 4Q4LA 3VA7A 3WBJA 2JA7G 4JI8L 3BAFA 3ZIAD 2REBA 1QRAA 3GEHA 5EP2A 1DXMA 2RGDA 2ZUDA 1NJGA 5BR8Q 2XX3A 4NCIA 3U9SA 4JI5L 3CH5A 3O8RA 3B1WA 3DMDA 2VY3A 4C30A 2P6RA 2I5MX 1PH9A 3L8ZA 4M9XA 2FPMA 1E1RA 3Q5EA 1B7YB 2H7VA 1T9HA 4MITA 1CR0A 5KPDA 4AQYQ 2VHUA 1N3BA 2ZTSA 4HLQB 2PEZA 4RD1A 2N3SA 1RJ9A 3RHFA 4LJ4A 2PJRA 3THYB 4IFDH 2QM8A 1Q46A 3FHWA 2GVZC 1DARA 3K0AA 4U02A 1S1CA 4QNMA 4QIWE 2VQSA 3HU2A 4KVAA 2Q6TA 1JJGA 2AD1A 4DV3Q 2NO9A 2UZIR 1BVSA 2KENA 3HWSA 4DR3Q 2NZJA 4DHEA 1PFSA 4US1R 2HCBA 4D82A 1S8FA 5LMNW 2B8FA 3WYAA 4B6FA 4C3JH 3TQCA 1R5OA 1RPZA 221PA 2ZRBA 4Q1CA 3B1VA 4LC0A 2GNOA 2JIZA 3AKEA 1ZYRC 5LD2B 2WWHA 4V0KA 4Z51A 2WKQA 2PCLA 3LRPA 4JS0A 2DWOA 3KJIA 1E79D 1G8FA 2NZ8A 5EE1A 2OXCA 3DHWC 4D4MA 4JI0Q 1E2VA 1KNQA 1VQEA 4A2QA 4DSTA 3SYLA 3AF1A 3NBYC 3UWOA 1Q81C 4IFDG 3G0HA 4JI2Q 4IJLA 3KDFB 4JLDA 4G5QA 3S1QH 2QMHA 3N2IA 2RGGA 4BFYA 3K9HA 3T53B 1P72A 1Z6HA 3RN2A 4EFNA 2D0OA 1VS0A 1LFDB 1KO8A 4URZR 1E0SA 3TW8B 3CP0A 4DNIA 2FSFA 5E3HA 1VHLA 2IYSA 1P73A 2NVTH 4KHPQ 1X56A 2JJ8A 4POGA 2GBLA 4QL5A 4TVAB 1WI5A 1Y1WH 3LX5A 1I4DD 2J0UB 4OI2A 4UKDA 1N6NA 1ZIPA 5TB5A 5JSZB 2XXAB 1JR6A 3LBNA 1FMJA 4K0KQ 4RCNA 5KSPA 2XZLA 2Y0SE 4DUYL 4B3RL 2W2XA 3F2DA 3TBKA 4DV7L 1K0RA 2GK7A 4LYAA 3UE0A 3VNUA 1O78A 3OEHD 2JA8H 4MGZR 4ZI2A 4G5OA 4XWKA 4B3ML 3TIFA 1W49A 2Q3MA 5DN6D 4ME3A 1J5EL 1VQGA 4QJFA 5C4XH 4OWWB 2XJ9A 1BIFA 2EFGA 2GZDA 2QENA 1Z0JA 1ZMXA 1QHIA 4XVUA 2UUCQ 4Z54A 4JBWA 3FMPB 1W36D 4ZDWA 4IPDA 5G41A 1LM0A 3WNDA 1SKYE 2F1HA 1SVMA 3AVWA 3ZD6A 1D7QA 4DR5L 1XEXA 1XTJA 3AP3A 3OE7A 4JI4L 5HGQA 1CKNA 1YZTA 2QN6A 4X8OA 2LXKA 3GDEA 1Y1WG 2KI5A 3I32A 5FBRB 3GLGB 1PH5A 3B78A 3QEJA 1KOFA 1BOFA 4LUCA 4NYIR 1SXJB 2E5LQ 2ZT9C 2R7ZH 3U44B 3D4RA 3U50C 1DADA 2V4ZA 4P4SB 2GXAA 2FEMA 2G0NA 3Q9LA 4A3KH 3FKSD 3VDYA 2FPLA 3DOEA 3GFPA 3QI2A 4IKEA 3RZOH 4Q1AA 4YMSA 4ZCLA 3GJ5A 2CNWD 1T8UA 1H9RA 2HDNB 5C4XG 4F93B 5M3MH 1TMKA 4IJMA 2VQEL 4IOAA 1ZM4A 1XPRA 3FFAA 1IBLL 1WDTA 1Z0FA 5AR1A 2AFHE 3THOA 3LVRE 3TMKA 2F1JA 1OKKD 3CM0A 3NIBA 1OYWA 3NTUA 4D0GA 3GJ8A 4GN3B 2ZU0C 5E7MA 2XB4A 1LS6A 1X86B 2PZGA 2JJ2A 2QM7A 3L0PA 2HJGA 4MDEA 4L16A 3U6KA 1DOAA 1FNMA 3RYTC 1AA9A 1NJFA 4DZZA 2H92A 3ER0A 1OH5A 2R8RA 1EWQA 2ZI5A 1K3RA 2JDID 2W0MA 4R2HA 1GM5A 4R2IA 4PQYA 3QXSA 1N6PA 1X65A 2ZIAA 3QF4B 1M7BA 2ZE6A 2VS1A 4A3KG 3QKRB 5IDVA 3NH6A 3AVYA 5JEDA 2PNHA 1ODFA 1NLYA 4EIWA 1FGUA 4Q66C 3FFBA 5AJZA 5JI3E 2FXQA 5EP1A 5M3MG 2GJ8A 4LHZA 4OQNA 3S15H 4A8JA 3F2CA 4S2EA 4NYMR 5KPJA 5EP3A 2J41A 4OQXA 1SHZA 2O5VA 3PCRB 3RWOA 3AUXA 2J7PD 4G5GA 3LQQA 2F43B 1GITA 4NP6A 2VW9A 4A76A 2FF7A 4GS3A 3GP8A 2N8NA 2HXYA 4PZYA 2V7QA 3QF7A 5AJYA 4A1FA 5BR8L 1HE8B 4PSVA 3K0FB 4BQSA 2EWWA 1AQUA 4MRPA 1VCOA 3DZ8A 4ZPXA 4HJ7A 2VP2A 2ZRNA 1H8HA 4IXMA 1E96A 1RE0A 2R7DA 4XWAA 2C99A 5DI3A 4BFUA 3EPHA 1I4LD 3LXXA 1US8A 3CW2C 2V6JA 4LYJA 1NSTA 5JWHA 4ESHA 1DAGA 4NONA 4M2LA 1A1VA 1H9KA 1PLKA 3EG5A 4DCNA 1GHJA 4AWXA 1S9DA 1CKOA 3IILA 1NKSA 4HJAA 3BBPA 2RGCA 3LW7A 4BY1H 2N46A 3W6PA 3FHTA 3A1TA 4G5RA 4NKRA 1COWD 4BFWA 2W2TA 3H15A 4DR3L 4KKTA 1PH1A 2RGNA 4KYUA 3JAMc 2ORIA 4X8LA 5D3QA 5C4MA 4E5UA 4I1OA 4GPTA 2ZM6Q 3LA6A 4NMMA 3PO3H 2NO6A 3X1XA 4XWOA 3CC2A 3CRKC 2IUSA 2KJQA 2JGNA 3RAPR 1KY2A 1CFMA 1R0YA 5B57C 4ALPA 3GTLH 3PF5A 1ETUA 2QMUA 1EUJA 3T35A 1C9OA 4Y0AA 3RS2A 4AG6A 2I4IA 4BECA 3OAAA 4JI0L 3MWLA 4PAQA 4JLPA 1UEJA 4MA4A 4DV4Q 2HIXA 1GNRA 2WIBA 2WOJA 4IFDI 3TSWA 2GETA 4PANA 1TWFH 1HY3A 2K4KA 3GLFA 3KF6A 4GOPC 1M1KC 4BY1G 2W0SA 2RMKA 4DUGA 2ZSAA 3O47A 3DLLA 1RRFA 4B75A 1Q12A 4B74A 1PH7A 1NG1A 2LWIA 4JBJA 2X2EA 3CX8A 4HAVA 2P5TB 4BFZA 2C9OA 3PO3G 1NI3A 4KHPL 4MYHA 4X64L 1UKEA 1KAGA 2JLRA 1WMSA 4BY7H 3I92A 4ASUD 1YR9A 4A4DA 5H68A 2I0QA 4K0KL 2BDTA 1NN0A 4ESVA 2I5LX 1RYFA 1U0HC 3LQRA 1P16A 1Z08A 4YWMA 3HR7A 3MUFA 4QBHA 4A36A 1JJCB 1U0JA 2C8VA 3QPVA 1FW6A 1KI3A 2OILA 2KBFA 2R7FA 3GTQH 2F9MA 1NN1A 4A92A 4FMCB 1S3GA 4OHXA 5TMPA 4PAOA 4LYHA 1D6JA 3EZFA 4DC9A 5GQOA 1BBWA 2A1AA 2WB1G 2ODWA 3CPEA 4RFVA 5FPSA 1SR3A 2ZRHA 3SZRA 3UKDA 4G5SA 4KODA 2VP0A 4QFMA 4Q1EA 2UUCL 4RY2A 3VX3A 4MZ9A 3H3VH 3TUZC 3PENA 2WJYA 2CFMA 3TRFA 4IVPA 3AQQA 1BO6A 2QPTA 1IQPA 2R6GA 4IEEA 4A3FH 4M1WA 1YE8A 1YZUA 4PC6A 4DLWA 4DKAC 4DR2Q 3DM9B 4BY7G 3CRW1 4C0LA 1GO3E 4B3GA 5FPYA 2LMCB 2IYRA 3GTMH 1YR8A 2NO0A 3C8UA 3EWAA 5J4YA 3G48A 1VCIA 3Q8DA 4GRAA 3WP1B 2E5LL 2N42A 1CP2A 3M7NA 4P72A 1OPXA 1QHXA 1QDEA 2A2ZA 4PX9A 4LWCA 1G41A 1CF4A 3AFPA 1FFHA 1LACA 2BOVA 3GD7A 5CK4A 5F3WB 5TDHA 4GOJA 3I4NH 2OV2A 2OTLA 5C0XI 1V5WA 1TF2A 3HOUH 2W2VA 4A3DG 2F4VQ 3KDFA 1VQKA 1OFIA 4QNRA 4UJ5A 3GEEA 1OB2A 2DR3A 4TZ6A 1I5FA 1HUQA 1X6OA 4Y52H 1VQDA 4MKGA 4A3FG 2QGZA 4PTLA 1ONLA 1W2BA 1VQPA 2NN6H 2QAJA 3GJXC 5CLQA 1N0WA 3MWYW 4P71A 4KV9A 2R92H 4R9UC 4C2MH 4XTRA 5CDFA 1IY2A 1CTMA 1YJ9A 2J0UA 3ZVLA 5JSZA 3D3QA 1OB5A 2XXAA 3M0EA 4GNXC 1YHAA 1IBKQ 1KK1A 2QAGC 4NPHA 4PC3A 4QJ3A 3QPUA 3WHLA 1HZCA 1AH9A 1XD2B 1KK3A 4JJZA 4POFA 2A5JA 3I4NG 4UP7A 1NVXQ 3HOUG 3TS2A 2FPKA 3L0IB 2ZJQA 3GCGA 4TQAA 1TWCH 2QG6A 2FH5B 4FMBB 4RSGA 3U2QA 2YV5A 1PYBA 4DV5Q 5DIFA 5EJEA 3OW7A 2E75C 3RN5A 2Y8EA 1Z6TA 3MRSA 2UZ3A 4LZZA 4DBLC 4DV0Q 2OBNA 5FBVB 5F9HA 2CHGA 5J5CA 1A2KC 2NN6G 1TXYA 1R4AA 1IM2A 5EP4A 4L4UA 2R92G 3HP1A 3TSZA 2ZI7A 4JLOA 3B60A 1QZHA 5EXPA 3GLGA 2JLWA 5FFMA 4BA2I 3BC1A 4LY6A 1KL9A 3RNLA 1Z2CA 4N0EA 1IL2A 421PA 4HR7B 4Q7JB 1IXRA 1JI0A 1Z83A 3U44A 4LBYA 4QGGA 1LS1A 4P4SA 1TWHH 1JBKA 1IYUA 1W44A 2NO1A 3KJPA 3GJ6A 1QHGA 3K9NA 2KA7A 3S2HH 3DKPA 5M3FH 1E2JA 4ZI3A 2PCJA 3OOCA 5DO9A 5E95A 2Q2HA 3CONA 4NXNQ 4A15A 2DPXA 2DGYA 2KCMA 3EC2A 3LLMA 4KFRA 5IRCD 5LMUQ 2ZM6L 1CU1A 1KO7A 1S1MA 4LHVA 1ZINA 2QGNA 3TH5A 1VQ9A 2IS6A 2R9VA 3BB1A 2UUBQ 1KNXA 4OQFA 2JLUA 3UDIA 2BDOA 3BU2A 1GKUB 1E94E 2QY9A 1JPNA 1E2WA 3S16H 1GVNB 4KXFB 1P9WA 1DELA 3SJCA 1ZP6A 4DLVA 2F1RA 4K81B 3FVQA 4TL7A 4TYNA 1PH8A 3CRQA 5HKKD 3I55A 4MRVA 1WA5A 4AC9A 2C5LA 1N5IA 3DKVA 5DHAA 2K33A 1W48A 2OAP1 4DV4L 1EQQA 5FH9A 3QF4A 2WJVA 2ZS8A 1G3QA 2GCOB 3QKRA 4TLEA 3QBTA 4V0OA 4WAUA 4XSGA 4BRWA 4ZCMA 1ZM7A 1SXJE 2K14A 4JLMA 4XOIA 5M3FG 5JEAJ 2K5HA 2CE2X 2YWHA 2J46A 1EWHA 5KUTA 5GJWC 1YEZA 2I3BA 2V4DA 3KXKA 5KDOA 1FR3A 2J0QA 3U7GA 3QNUA 2PX0A 2IYVA 3OESA 1YRAA 1U98A 4JLBA 1KJYA 3ADCA 3NEYA 1JR3A 1KDPA 2QTHA 3CCQA 2F43A 2ZE8A 3NWJA 3B13B 4CT5A 5JJLA 1E9FA 1Y63A 2X2FA 1ELOA 1Q21A 2LSSA 1SZPA 1Z22A 2XNDD 4KI0A 4DK0A 3UDXA 3ND9A 1HQYE 2JA9A 4OO1H 1E9DA 1U90A 3CF6R 1E2DA 1Y8PB 2MNAA 1J90A 1DCZA 4A4IA 2UXCQ 4HLDA 4LPKA 5IYCH 4QXAA 2AR7A 4YXWA 3TR0A 4E22A 2VP9A 2ALYB 1WRBA 2WTUA 5E7JA 3DXJC 1HA3A 4KMUC 1NVVQ 1HNXL 1IN4A 3Q5DA 1TEVA 2IS2A 4HZUB 1W2HA 4LW1A 5M04A 1T5IA 1IBMQ 1X3SA 5L3SB 1G8GA 4P75A 4L5RC 3M3YH 1KI8A 2D7CA 2VSOA 3U61B 1TQ6A 1Y69U 2UXDL 4Q9IA 4ZO4A 1XJCA 3BH7A 4IOMA 1ZKOA 3W3AA 3RLNA 3K53A 1YHBA 4DRZA 4AY2A 3KKMA 4JYAQ 4AI6A 4DR2L 4NPSA 4NTZA 4LJZC 4Q1FA 4AKHA 2DFNA 1TX4B 2ZJYA 4CW7A 1NY5A 4OO1G 2Z0SA 1P2VA 1CJVC 2H57A 2QZ4A 3ZH9B 3OEED 3H84A 2PI2A 5IYCG 4LRWA 3T06B 3VAAA 4W9MC 1XPUA 1R8SA 2CXXA 1E4VA 1H9JA 3IHLA 521PA 2ZJZA 1G3UA 2AXPA 5KNBA 3QG1A 2A78A 2PZEA 4WA7A 5DNYB 3SYNA 3UK6A 1U99A 5C1BA 2JLSA 1G20E 4KKSA 4PV1C 4A3IH 3SGIA 4WZAE 3H3VI 1E4YA 4KN7C 4GZMA 4AKIA 2F4VL 4JK1C 4ARZB 1F6BA 2E9SA 3C5HA 4RCYA 1SMXA 1KGDA 3BOSA 1N33Q 3PIOA 5JJIA 3PEYA 1JE5A 3CO5A 3OIWA 2EFDB 1ZIOA 3X2SA 4GNKA 4L5SA 1J6QA 1UEBA 2ATWA 1GNPA 1KAOA 2YC4C 3UG6A 1U9IA 3CXCA 1D2EA 3VFDA 4Y0VA 1GUSA 4FMDB 4X66Q 1IBKL 2FOLA 1VIAA 1T6NA 1OJLA 2I1QA 5CITA 1FX0B 2IBMA 4P4UA 3CR8A 3DDCA 3CCJA 3HGBA 3E5HA 3EPKA 1O7LA 1J7KA 1N0UA 5B64A 4A3IG 1KJWA 3GEIA 1K5DA 1WF3A 4URUR 3IQWA 4IDNA 4F38A 2IX3A 4C3HH 1EX6A 5TV2A 3KQHA 1TEXA 4HSEA 1IJFA 2IYXA 1GL7A 2WKPA 4LBWA 4OKSA 4D0LB 5CB8A 4DV5L 1VQJA 5J3BA 4BFTA 1YZ6A 3M4YA 1TTTA 2FSGA 3IBGA 2YU9H 2NN6I 1E2PA 4DV0L 4N3NA 2ZEJA 4QQBX 4PZ8A 5HCIA 1N6RA 4YCUA 1KMHB 4A82A 4WOPA 1NBMA 1IXSB 3D0FA 1ZM3A 2DBYA 2ZRJA 5FBQB 2Q9BA 5TVKA 3A0JA 1RRPA 5GROA 3R9IA 4BFXA 2F3RA 2FSHA 3CRRA 1KSGA 1DAMA 2QORA 3BJUA 4TSFD 4BLOA 3T56B 4PC1A 3SDZA 1E9CA 2XNSA 4MGKR 1P62B 1KSHA 1Z0AA 4MRRA 4TL6A 3W8RA 1CR1A 4LSGA 1PLJA 2DB3A 2ASEA 4ZDJA 2OUKA 2DN8A 1N36Q 3T1HL 1CRQA 4URVR 3DMNA 4OHYA 1DTSA 4DV2Q 4A3EH 2PMKA 4DLSA 1X54A 4X8HA 4KSBA 3WMGA 3MFYA 2P6NA 3Q8XB 5LMUL 1O87A 2PCFB 3HOYH 2K32A 4DCVA 3K7UC 2D62A 2FFQA 2UUBL 3UWKA 1L7VC 3AQ4A 1P3JA 4HUQB 5FI1B 3RRMA 1VQCA 4HUTA 1S72A 4PSAA 2ZUCA 4LJ9A 5JHGB 4YMTA 4B3TQ 4GOKA 4YQFA 2FE4A 3U3JA 2C77A 2ATXA 3R9XA 3H86A 3OIYA 3LBHA 2WAYA 3HOXG 3PG5A 1SLJA 4EX5A 1H95A 3EXAA 3UG7A 3BDOA 4NZYA 2GDJA 2OWOA 2H16A 2QGQA 1XD2A 4Z1MD 2ZI6A 3SI7A 1VCMA 1DVRA 1GJXA 5H1SE 4A3EG 1BMFD 3LW8A 1L1OB 3BFKA 2F52A 2NG1A 3NDBB 2JCSA 2OBLA 1Z29A 1IYJB 3HOYG 4LF9Q 2IEZA 2PLFA 1CSQA 4JLVA 2XAUA 1F2TB 4C3IH 1XTQA 2XB2A 1K8OA 5FL7A 1B8AA 2GXUA 3OFNA 2PX3A 4UNPA 2BEJA 4G1UC 2JLYA 4B3XA 1LY1A 3ASZA 1EFRA 3CBQA 4G0NA 3CMAA 4HLCA 4Q18A 4QRHA 1TF7A 5AK0A 1ZRHA 1AN0A 3THWB 1UKYA 2UXCL 2QQ0A 1HEIA 4G7ZC 2V1CC 3KKQA 4GI7A 3RABA 3A1SA 5EE5B 3NHBA 4Z8XA 2F9LA 4R4IA 1GZSA 3FPPA 1KY3A 4OI4A 3KJEA 4TMXA 2RB4A 1PH6A 2JEBI 2NZOA 1ZCBA 4NYIQ 3A58B 2G1KA 1E32A 2QSYA 4B47A 5FTNA 2FFBA 3RSOA 1XCMA 1IBML 5K8UA 4M1KA 1T0JB 1E9SA 1Z3IX 1HTPA 1P9NA 2N49A 1WYDA 2ZR7A 3M1IA 1WOCA 1Z06A 3FB4A 4M21A 4U5XA 5JCZA 4C7OB 3B7GA 3KTAB 3TAHA 4DLZA 5KOYA 3AP1A 1W36B 2YTYA 2XOKA 2PBRA 3CNLA 4EPXA 1Q22A 2ZSEA 2G3YA 4FCTA 2A30A 4AD8A 5H1YA 4AURA 4JVNA 1Q3TA 1UE7A 4JYAL 5F98A 1OHHA 4OO1I 3S1AB 2FEOA 5AUNB 4PZZA 4LBZA 1G3MA 3WHKA 3GLFB 3KF6B 3FGNA 4HJ5A 1NTGA 1JJVA 1TU4A 3VHXA 1SGWA 4FWIB 1ESNA 4Q9HA 3T1QA 2QA5A 1ZW6A 3VMFA 1CS4C 2OESA 2FNAA 4QM6A 4OK6A 2FWRA 1ZVQA 4IOCA 1W4AA 3AV0B 1E9AA 1AGPA 2GCOA 2GCPA 4MTNA 4ON9A 2BMDA 2ZSDA 4C0QC 1PH3A 2BVNA 1XBTA 1II0A 4BLTA 1YJNA 2WAXA 1N2CE 1UBCA 4RD0A 3KXLA 1AJEA 1N33L 2A5GA 4JYCA 1E98A 1G7RA 1GRQA 4LGMA 5DGXA 4NYMQ 1WJJA 1ZUIA 4C4PA 3T1TA 1M90C 4P4TA 4IFBA 3RWMB 3VQTA 3NBXX 2GK6A 4RCZA 3CC4A 1HH4A 2NOAA 3HJNA 3VR1A 5JS8A 1E1QD 1HT1E 3KUCA 2PT5A 3ADKA 3I1FA 3CPWA 5FTLA 4J0QA 1Z8FA 5CM9C 1FVIA 1P2UA 1GUAA 5M5YH 5DYIA 1RKBA 2QRZA 1CSPA 1OIXA 4APVA 2BKUA 2G6BA 2GXQA 4ACAA 4L8JA 3AF0A 4IHQA 3T1VA 1J8MF 3TK1A 1VYUA 1P60A 4CEIB 4HZUA 1VQOA 2YOHA 1ZNWA 2PPBC 5L3SA 2ZVQX 3TJZA 2OBMA 1QZGA 2HCJB 3J80c 2Z4SA 4JOIA 2ZJ8A 2ZETA 1KXLA 2WWGA 1V1QA 5CJPA 3I2ZA 5FTJA 3RC8A 3Q3JB 3J81c 1UKZA 2WPDA 4EKDA 4B2LA 5J40A 3STBC 3U3RA 4GN5A 4M8NE 4MQBA 1QG2A 4B33A 4IVRA 2P65A 3OPOA 2CEAA 2QP4A 2J3EA 3E9HA 2AUKA 3S2DH 3CWZA 3WBKA 3LGJA 1ONBA 4RG1A 1Q1EA 4DCUA 4FIDA 3EIVA 1IONA 1UJ2A 5IP7H 2EQSA 1SQ5A 3RS4A 1E3MA 3LAWA 3HKZG 1T3LA 4A93H 3HR8A 2DY1A 2QE7A 2V1XA 1R0WA 1XD8A 1RRGA 1XXHB 3JZAA 4LC1A 2DFLA 3SYKA 3TGPA 5GJBA 3CR7A 5JCPA 2ATVA 4MH0R 4LBVA 4RJLA 1N36L 1DG1G 2ZJAA 1Z0IA 1EGAA 2CCZA 1A0IA 2WHXA 2EU8A 4DV2L 1R8QA 2VSFA 4LHYA 1G9XA 4Q4AB 4KJZA 4WVFA 3GO5A 4P31A 1MO5A 4ARZA 4H1VA 5KSYA 1T4GA 4XD7A 2J1LA 3RS3A 1ANKA 5IK2D 4JLAA 2ZI4A 4DNTB 1UAAA 3U7EB 1W4RA 3WMFA 1E2KA 4CT4B 1HQMC 1GAJA 3GMTA 3U7FB 3IFTA 4W7SA 5HE9A 4B3TL 821PA 5IP7G 1AZSC 2J0SA 1EYGA 1QF9A 3E0EA 1SXJC 2XSZA 2ZRIA 3C14C 1S9HA 3HU3A 4CVNA 1P5ZB 4A93G 2NGRA 3F8TA 3A1VA 5JRJA 5ELXA 4O3MA 2OXRA 1Y8NB 3SQXA 1FX0A 3A74A 4Q7MB 2E2JH 3HFZB 1G8HA 2ZR9A 2O0JA 1IN6A 1NIJA 4ZV4A 2ES2A 2AXNA 1N6HA 2CCKA 2W6IA 3T1OA 4AKEA 5JWOA 4D25A 4N1AA 2OCBA 4O2RA 1OH7A 2NIPA 3MWKA 1VQ8A 1E69A 1NLZA 1DAIA 2D74A 3CCSA 2AHOB 1P61B 2RH5A 5A5GA 4LF9L 2CK3A 4B3DA 4TYQA 1RVDA 2D2CC 4AYBG 5FLMH 4HLUC 4DDTA 1H8ED 1VMAA 1C9KA 2B6HA 3BB3A 3LV8A 3QE0A 3U4QB 3ZIAA 5JS7A 1EK0A 3MXUA 2OAQ1 3M9BA 1FQJA 2HLDA 2VRWA 3NE5B 3CF5A 1Q7YC 2JLQA 1GILA 2FN4A 3EASA 3KL4A 1E2FA 4EUNA 1KMHA 4TLCA 3BG3A 5H70A 1QHNA 2QU8A 2E1RA 2QL6A 2GJSA 1NMZA 1Q44A 5FOUA 3ZGXA 1L4YA 1VQMA 2WWWA 5KTYA 2EYUA 3X1DA 3E9IA 4MUBA 2UU9Q 2PZFA 3BD9A 4LFBQ 4H1UA 3TLXA 5F2EA 4YMVA 3JVVA 2X19A 2JAQA 3FHCB 2D5DA 1J8YF 4QC2A 5GVRA 4P33A 4DB4A 2Z6KA 3GLIB 4B3CA 3V4RA 3A5ZB 4I7ZC 3IUYA 3L7ZC 1OXXK 5C3EH 1T3HA 2MMGA 2WWYA 1C4OA 1GNQA 4JT2A 4QKQA 2SHKA 4C0JA 2CWPA 3I62A 4DB2A 5FLMG 2UXBQ 5BYJA 2JJ1D 4RKEA 3BRWD 1VF7A 4JL6A 2C78A 3KFXA 3AEVA 2OTJA 2X8AA 3PSIA 1HPCA 2C98A 3CNNA 2C95A 2RHQB 1AZTA 1MV5A 1VHTA 2MSCB 3LH5A 4HUQA 5K8IA 3GJ4A 1C0AA 3K9GA 1A7JA 1TADA 3G82C 1TU3A 1E79A 4R4OA 3PF4A 2XGTA 2GCNA 3FMIA 2GXSA 5C4JH 4DR1Q 3SR0A 2RF4A 5TY0A 5DLQE 3EWSA 4AIIA 4HAXA 1XMJA 3L43A 1UE5A 1CKEA 1QVAA 5C3EG 1LF5A 3ZZUA 3EQLC 1HH2P 1PYSB 4BBSH 2BIFA 1L1OA 2AFIE 2IS4A 2ZQ5A 1SHKA 3EW9A 4I1SA 4LCBA 2YTVA 2BV3A 1DE0A 1QG4A 2D2FA 3NHAA 4LJYA 3RSLA 1F2TA 4NU0A 1E9BA 3UXMA 1II8B 4DV1Q 1DEKA 3LNNA 1DBSA 1TKWB 4LUOA 1M34E 1M1YE 1Z0KA 2JEOA 2UVQA 2XTMA 3LD9A 4DEYA 1GIAA 4AQYL 3LVQE 1A62A 1Y3AA 2IEYA 4GKKQ 4ITRC 3THWA 3UATA 2IS1A 3I73A 4B2IA 3GLHA 4L15A 3A4NA 2CQOA 1I2MA 4DV3L 2AD5A 2REOA 3SJBA 2XZPA 3T34A 5C0XJ 1CULC 3ZZTA 5DN6A 1JQLB 3R9WA 4JZKA 3T51B 4ZKEA 1XTIA 5M5XH 5LBIA 1KZGB 1IXZA 5BYKA 1G19A 1H65A 4C7OA 5BN3A 4BBSG 2WV9A 3KTAA 5CJ2A 3Q85A 3W5OA 4JBMA 5AUPB 4EPTA 3TZUA 3I4LA 2K75A 2CLSA 1NMGA 4EJSC 2EVBA 3KFVA 5FUWA 3AYHB 3MLEA 1G64A 3ULLA 3CX7A 1WXQA 3NC1C 1R9TH 5FI0B 3R8CA 3IEUA 2JA6H 3RLFA 1C7YA 3RC3A 2WJGA 3S1AA 2YTXA 2Z0MA 4B76A 4CDGA 3RLOA 3STBD 4UPAA 3WNCA 3EA0A 3MXNB 4JI2L 2PNRC 3BWDD 4KVGA 2H5EA 1G17A 2RKOA 1KDTA 2VPPA 2ASBA 1XEWX 4BASA 3FKSA 3NBHB 3AFQA 1I94Q 3L82B 4YWKA 4PPQA 2ZAMA 1N34Q 1A5TA 1JEDA 1ZBDA 2R65A 4RVCA 2CNWA 4B44A 3U3MA 3OW2A 1F2UB 3HPQA 3REFA 5K8LA 3MEFA 1PH2A 1U94A 1WE2A 2BMJA 4B48A 3IEVA 1QHHB 4GN4B 1OKKA 1G18A 2OFXA 3SJZA 4LUZA 2BH2A 4RFSB 5FOXA 4IW3B 5KDLA 4V0LA 1DAHA 4B71A 2YOGA 3DO6A 5E7IA 2ZXUA 5CLLA 4TQUS 1E2LA 2QTFA 2ZTEA 1DD2A 3IKJA 5K36H 1KDOA 2ZE5A 1KD1C 1NE3A 2ZRCA 1QVRA 1SROA 5EAYA 1ZU4A 2IT1A 3K7AH 4MKFA 4LF8Q 3VR5A 2MQHA 1B9NA 2XTNA 2JA6G 2FFHA 4YMWA 5J4LA 1G5PA 1W0JD 4M4SA 4L9SA 3N5CA 4EFMA 1B23P 1N5LA 5CIWA 3THXB 4PPFA 1KTVA 1Z6XA 3EA5A 1NVUQ 1ZUHA 4A3DH 5L3RA 3K0EA 2A3RA 3CRMA 3GLFE 5JHHB 1SXJD 4NYJQ 3VTKA 1J70A 3SFVA 4Q9JA 4LJ7A 2GEVA 4FINA 3PJRA 2R6FA 4DLTA 1J99A 4OK5A 3EZ6A 4RD3A 4TYWA 4A6XA 4KFUA 4CEIA 1E7ZA 2ID0A 3B9PA 4RD2A 3BH6A 1EQRA 2F3IA 4X62Q 1C1YA 1T3SA 2G83A 3CNOA 5B2ZA 1T5EA 1D2MA 2J7PA 3LLUA 4YDSA 4A0GA 3I61A 2ZPTX 4BBRG 1N5KA 5EQTA 5JLJA 3WYGA 5K36G 2WMNB 5IYDH 3DZDA 4Q01A 2PT7A 3NG1A 1TWGH 2EDGA 5AJ3Q 1L2TA 3LNCA 4IEIA 4QJ4A 4R1JA 1KRTA 5B30A 1II9A 2UKDA 2GF0A 5E7NA 4Q00A 4DDWA 1GKIA 3ZVMA 5FR1A 1E0AA 4TL8A 4XVRA 2UU9L 2RAPA 1MO3A 4LFBL 1L0WA 1FUUA 1XXHA 3AEZA 3RRNA 2CHQA 1DS6A 4TMKA 4D0NA 1GD7A 4X6AH 2OFOA 4Q4JA 5HZKA 2CDNA 1JNYA 5LPNA 3QEOA 4TMZA 4Q4AA 4YC7A 1COWA 1YI2A 1H9MA 2CL6X 2Z5FA 3A8TA 3R8FA 3CB4A 2IY5B 1ZNXA 2FV8A 2UXBL 2ZRMA 4LI0A 1VF5C 4GDFA 2HF8A 4I99A 5JEAH 2C03A 1D8TA 4I1UA 4P3YA 3S14H 1VQ7A 4A3BH
chains in the Genus database with same CATH superfamily
5HDBB 2F3VA 3AB9A 4ULLA 1LRKA 4BZZA 2O8FA 4P92A 1IW7C 4R54A 2QI9C 5AVVA 5FX2A 1MI2A 3FNFA 2XMZA 5C7OO 5FJIA 4HOYA 1KZ1A 5FA8A 1G8ZD 4K26A 4QQNA 1G5HA 2W70A 5FWYB 1AW7A 1YDFA 4LAAA 4LQDA 1ISMA 1AUXA 5LUBA 4Z9YA 1CJUC 4OFXA 2RBMA 2OHIA 3NHJA 1GCGA 4F2DA 3E9RA 5I7RA 2K5VA 1E2IA 5BSFA 3DVAA 3NEPX 1GADO 5FTKA 2YWJA 4URWR 4BWYA 1XPOA 3M4OB 1G1MA 2BRUC 5KVAA 3L8FA 1RIFA 2HV8A 1A5SB 1D0IA 2RHBA 2VNKA 4JBKA 4LZAA 1MPXA 1KC3A 4MOWA 1JQYD 3BQ9A 4KAFA 1QC5B 1MBZA 1MX3A 3AF2A 3OSUA 4PZLA 5J4HA 1JECA 4F4IA 4OWXB 1OXUA 4Z7QB 3QITA 4POOA 4LF4Q 3BRCA 4NS1A 2FSVA 3USCS 4BP9A 2X4GA 1LPBB 3GTJH 1TAUA 1XT6A 2YASA 3SS8A 4BV8A 2WWXA 4XVQA 3IQIX 1NYRA 3C7CB 4AECA 3C3MA 1LX6A 1M6HA 1XTVA 3U7HB 4D81A 4Y67A 3IBCA 5C81A 1ZC3A 2I29A 3EXHB 5AJXA 3C4JA 4W8GA 3NBHA 4J03A 1NF2A 4RSRA 1L9XA 4OBEA 3TXXA 3W8NA 4ZEWA 4QGAA 3RS7A 5LLDA 1H6BA 3C2QA 5IHXA 1K5HA 2BJWA 2ZI3A 1UBGA 4PPYA 5CT8A 1CIVA 1M5TA 4MVJE 1W4BA 5DK6A 3RK1A 1GG2A 1NR5A 1IW7D 3QLUA 4HVLA 3M4PA 3NJ4A 3T9AA 3DV9A 1CUGA 3DM3A 1DCFA 5AD1A 1J5PA 4QUDA 4YRZA 4UVIA 3IV9A 2ZT8A 1ZD9A 3HDVA 3IQHX 4GKAA 4XEUA 5AOCA 2I6SA 4LWOA 4N7RA 1LLRD 3VPAA 4RC9A 1PJ4A 1SG0A 2JI9A 2ZRAA 1H2HA 3KHKA 3ISJA 3DTTA 4P82A 4F6RB 2ZRDA 4MJLA 2IHYA 5HGTA 1WP4A 2VA9A 3D4IA 2FUNB 1QK3A 5EFOA 1JAHA 1Q1QA 4ZU1X 2O0LA 2P7IA 1CIPA 2ODEA 4OJKA 4RNCA 3ZQ6A 1GHKA 4UJ3A 5CHEA 2E8GA 1QE5A 3OY7A 5IT9L 4DV1B 2ORVA 3TE6A 4BB5A 4A5OA 1PFQA 2VNSA 3OHSX 5JZ9A 5FNVA 2NN3C 2LCFA 3A7EA 2TYSB 3ZHSA 1USIA 4DNQA 3C3LA 3L7BA 1GDHA 3PJGA 3I5XA 2NV2B 3P9XA 2F1OA 4QAQA 2N0SA 4GM4A 2I3GA 4KPEC 3A25A 5U1PA 1Z88A 1EG7A 2R8XA 5AMXA 2PKEA 4BGIA 3B5JA 3TM5A 1P75A 2XV1A 3BK2A 4QGHA 3EC7A 4TTVA 1KAAA 3RDPA 4NPCA 5CYOA 3SK5A 4ND2A 2HH9A 4GP9A 1CUWA 4U2CA 1ZQ1A 2WZQA 4WNCA 4EQNA 2B63G 4Q7KA 1E3LA 2CHVA 2DVMA 4ZALA 5IC6A 2WKDA 4MJXA 4RX1A 1L7AA 2F0NA 3AI1A 1VLHA 1HR0Q 3M85A 4UAVA 2GD1O 3W4JA 4IPHA 3OCVA 3K1ZA 3PUXA 4DSOA 1M1NA 4MCIA 2VNJA 4RHSA 5EXTA 3JQAD 3WS7A 3LHFA 4N6GA 4UBOA 4ID6A 4V1CB 2CVHA 4QGUA 2QTTA 3MMXA 3BJIC 4IFDJ 2CBZA 2Z5GA 3ANTA 3FMVA 4BO1A 1JJBA 3ITNA 3KJGA 1WNTA 1ZUNB 2LTAA 4EAQA 5BSTA 5UKDA 4Z99A 4ZJYA 3TMAA 5KYVA 4B6EA 4NV1A 1TIPA 1IZYA 2F90A 4YS6A 2J6CA 3AMUA 1TMGE 2EYHA 2Q99A 1ISPA 3NTHA 1X13A 4G8BA 3FRPB 3MYRA 1VQHA 2QPOA 2PZMA 2YJ4A 3GTPH 3UT5A 2PRYA 2K5UA 5AVYA 3E0JA 4FT2A 4A26A 5ITZB 2J3DA 1MJ5A 2Z83A 3FMCA 4MO9A 4L08A 3MFQA 3RAFC 3S2GA 4ZYZA 3MJHA 1YMUA 4RPJA 1LT5D 2J5XA 3FKIG 3C7KA 5EUCA 5ILOA 3D7LA 5JZSA 1OTHA 3AKZA 4QDOA 1DRWA 3K6JA 3LC2O 2WWTA 5IMBA 5BNTA 3BT7A 2C8JA 5BWMA 2PQ0A 3UJ9A 1PZMA 1X1QA 5K05A 2MJLA 2A7QA 2VXYA 1EESA 3VZDA 1D7OA 2CL5A 5AKIA 4XYQA 3I0MA 2QA4A 2X13A 2XI4A 4NNJA 1RHJA 4Q47A 2EFEB 4F91B 2ZP1A 4G1FA 1V8FA 4A0FA 3R3ZA 4HNTA 2ZTCA 1YULA 4LJRA 3MINB 1FFSA 5IPFA 4JN6B 1W3SA 4D4LA 4N9PA 1C0KA 4V1CI 4ZRZA 3KLNA 1TM7E 1JQAA 1LTTD 1I4GA 3B2NA 1GUOA 1FTYA 2VPTA 4WKCA 1P74A 2A86A 2IYLD 2A1UA 1XL0A 4XYEA 1DXYA 3LIPA 4BKRA 4D46A 1VJGA 1F60A 5M7EA 4EGCB 3L6DA 5EA2A 1B8OA 3IJPA 4ND8A 1P18A 3JXEA 2VAVA 1H22A 5ITVA 3KT6A 1H9AA 1QPGA 1AXEA 1GUTA 3LWUA 3MILA 5BYAA 3M6VA 3I4MG 4K05A 1U8ZA 10MHA 1WDMA 5C53B 1ARZA 1Q16A 5ABPA 4RA9A 4AO6A 1ZHFA 3NPPA 1YHQA 2IEDA 3DXXA 1H2RS 3KJHA 2B69A 1IZ9A 1B44D 1LRLA 4AZVA 4Y6PA 2V0NA 4QTYA 4GZ6A 2R66A 5K7SA 3N8KA 3ZLJA 2DNEA 4L5QA 4ZIRA 1UP4A 4W6ZA 4DQKA 4L9RA 5DRTA 4DLBA 2HZ7A 3TTUA 4QFBA 3CH7A 4Y2YA 5B5SA 2XMRA 5LA6B 1QZXA 3O8LA 5BW8A 1S3SA 3D7KA 3MT8A 4L6IA 2Z58A 2GN5A 3QI7A 3URYA 4BB9A 2DLNA 5A35A 2Q6IA 1M4VA 2YXNA 2GF9A 3WFJA 4BO5A 4BO6A 1BDOA 3VO8A 1TEHA 1YWGO 4OJNA 3B82A 5IT9A 5E0KB 4EY3A 1FTSA 2AYXA 4QBFA 2RKSA 4LDRA 4Y2PA 4JC5A 3X0DA 5KTTA 1ACLA 2Y0CA 5FL7D 4FI3C 5FFNA 3A8KE 3EIXA 2IXEA 2ZLBA 4FFRA 4TS3A 2Z6KC 3QVLA 1QKJA 3P5SA 1QFJA 5BUZA 3KUDA 4KWCA 3QFFA 4IQ8A 4ECAA 3U4ZA 2JJQA 4PHGA 2GJ4A 1SN8A 5FIUA 4M83A 2OXEA 3EWNA 1Q57A 2X69A 4I5EA 2AKAB 1NPYA 1YD7A 1VQNA 1MJCA 5CDSA 1W0KA 4EPWA 1OAOA 3NQIA 2OOKA 4PO9A 1CY7A 1W1WA 5G0UA 1AZQA 1KJ9A 2BEKA 1E1OA 1M54A 1OC2A 2VO1A 3B6JA 4RGYA 4DJAA 2D5CA 2QTBA 2R0QC 1K9VF 2OEOA 2Q1YA 1KYTA 7ABPA 3Q3VA 4AXBA 3GMDA 2EQ5A 4EJMA 3ROXA 3ECCA 2XCLA 2NVBA 3OURA 4KW7A 4J49A 2NVQH 4A3EB 3H87A 4MUXA 2YWDA 1YASA 1FRFS 5JVDB 1OWPA 4B4KA 5BN5B 3K8YA 3PNSA 2Y9PB 4F4CA 2JG3A 1WBDA 4LMRA 2IXAA 1ID8A 3E58A 2VCYA 1CUVA 2QKYA 3AG6A 1ENPA 4D7AA 5G3YA 4RZQA 5GZ6A 1EKXA 2E4YA 4WNIA 1FP6A 2GJ9A 3PJDA 5T1IA 3CZ5A 3U81A 1I1HA 4PX3A 1XJ0A 2WSMA 3K8AA 5KKAA 5H82A 4LISA 1XKQA 4IUVA 2W6ID 4R51A 4BMDA 1PL7A 3ZNNA 4E30A 2JA7B 1U3VA 1YKFA 4JI5L 4I1PA 3FAKA 3Q5EA 4DBLE 4J3FA 3D8SA 2PEZA 4J16C 2F0OA 1NXTA 3HU2A 2HEGA 1CDEA 3CNHA 2DG2A 4CJ0B 1HDGO 2GNOA 5IDWA 2P3OA 3OA2A 4BWVA 3WI7A 4UUBA 1WCXA 1SIBE 1VHLA 3F9CA 3KD2A 2XDQB 1CHNA 1HHVA 1BH6A 1K0RA 1BC5A 2J4FA 3N75A 4MGZR 1VQGA 2GZDA 3L8HA 2O7NA 1I4EB 4DV6B 4DR5L 3BREA 3WOVA 1W96A 1Y1WB 3JQ8B 1I2ZA 2VDLB 4LFCB 3S7ZA 3M81A 3ZY3A 5ELEA 4KVZA 1MW9X 2OFFA 4E6PA 5FAKA 5C4XG 1Z68A 4YUXA 5H3CA 3FHLA 4KC0A 1X86B 2PZGA 3L0PA 1XMQB 3PSAA 1JSRA 2VATA 4PNHA 1K3RA 1JOKA 2JDID 1VKOA 3GMSA 1WMBA 3M1AA 2XRQD 5AJZA 3W2HA 4AUNA 3RD4A 4Q9AA 4NICA 3S15H 3HBNA 4J2TA 1UM9A 1GPKA 4TWIA 4PZYA 5K8CA 4GGPA 3V7FA 1US8A 1DAGA 4DCNA 2CBGA 3FXAA 3IILA 2RGCA 2N46A 4O4IA 2PO7A 5CXUA 3NOXA 4JROA 4EY4A 5BQPA 4TRDA 4RV4A 5JAZA 4GPTA 2ZM6Q 2NO6A 2B4RO 2FR8A 2NWGA 3K5OA 4LXXA 4OL9A 5LZ5A 2W2LD 4JLPA 4MA4A 3TLCA 4PANA 1RTOA 5AVQA 4M0EA 2ZYAA 2JGLA 4MMYB 3DLLA 1V9SA 4B74A 3H18A 5I7FA 1NG1A 2XE7A 4KHPL 3P2JA 3PGKA 5CCXA 1WMFA 1YR9A 3OZEA 2I0QA 3FVRA 3OQOA 5CVVA 3HR7A 2C92A 4I66A 1KI3A 2OILA 4I7EA 3C3JA 3KALA 4Q1EA 3RIHA 4KXUA 4W6QA 3G8CA 2BISA 2HDHA 4RYLA 4H4EA 2VZ8A 2XECA 2OHGA 1NVBA 4L7VA 3LK6A 4P72A 3NHZA 1BMDA 4QUFA 4UHDA 1XN1A 4OVKA 1TZMA 3GD7A 1P0QA 1KEEB 1U6KA 4HX9A 5JY6A 5J1ZA 4M1EA 4RK7A 2CUZA 3ANNA 2CZCA 4IMJB 1RAGA 4ZK2A 1F38A 1UFRA 3OPYI 3FPUB 3AJEA 1ZRNA 1RAFA 2ZG6A 4QOFA 4RSGA 1PYBA 4CR6A 2E75C 2Z3ZA 3IL2A 4LZZA 4KQGA 1MB4A 2CHGA 3GRYA 3KBBA 5KIXA 4L4UA 4L5CA 1WETA 4QO7A 5A9SB 2XE6A 3LUBA 1JYSA 4PBSA 4KQHA 4EHNA 4NXNQ 3HJUA 3PQ7A 4XD2A 4L76A 5IRCD 4BMOB 5KX5B 5YASA 1CNMA 13PKA 1CIJA 4I08A 4KXFB 4L4XA 5LYYA 3G6JB 2J9YB 3DLCA 2XADA 3I55A 5J58A 1TWHB 3FWHA 3KUUA 3IDFA 1TA4A 2YWHA 2CE2X 3WJAA 2XUAA 1BFKA 1FR3A 4KD4A 2L18A 3OZTA 2QUBA 1YXMA 5JYEA 5BSMA 2ZBDA 3IRUA 5IAGA 4QF4A 2X2FA 3OETA 4Z7OB 4RDHA 2YJ5A 2JBWA 2VP9A 5FWDA 1BEEA 2QN1A 1X3SA 4UCQA 1XLTC 1Q7TA 1LBTA 1UMCB 3LWDA 2LPMA 4NPSA 1R64A 1D03A 1QXSA 4C01A 1SOMA 4WKNA 4CMEC 1PIWA 3ESRA 3SGIA 4WZAE 3OOWA 3L49A 5JJIA 4EVQA 2YXBA 2VZ9A 2VR1A 1YL5A 4J8QA 4ER3A 3TD2A 2AXQA 1NMSA 3HMQA 3CCJA 5AXBA 4KE7A 4NX2A 4AZ0B 1LLQA 4EW2A 4HJRA 4OKSA 4WZBA 4D0LB 2Q6OA 1V3VA 3IBGA 4DV0L 3VBEA 3RYIA 1RJWA 4UBMA 1GPLA 2BONA 2PSFA 4HCSA 4FYVA 1VIVA 4TSFD 4TL6A 1U2GC 2VYND 5L3ZA 2JGDA 4ZVRA 4UMDA 4LE0A 4ZDJA 2I3AA 2R1UA 2DN8A 1N36Q 1CRQA 4C3HG 4KSBA 4LNUA 5HFJA 1OVGA 1LT6D 2WIIB 2ZUCA 1FE8A 3MPOA 4K2LA 3L07A 3UPDA 3FRIA 3LBHA 4XYOA 3D3EA 1M2HA 3PNOA 3T0FA 3RVLA 1TT2A 1EU1A 4BWGA 1GFZA 2F64A 4RTNA 4G1UC 4HLCA 1EFRA 1LPAB 2NUPA 5D6NA 4WECA 3DBHA 3EGOA 4X3UA 3ZJYA 4NYIQ 1KDZA 5K8UA 2L4NA 4H7IA 3HKBB 2AV6A 4NDXA 1CDZA 3PK0A 3H4IA 3QE4A 3F3SA 1Q3TA 4EUKA 4UHVA 1QGOA 4H6XA 3OZSA 1ESNA 1V71A 2POQX 1U0EA 1LDGA 3LX0A 1PH3A 2XODA 1NVMB 1CJCA 5DGXA 2PMZB 1ZUIA 3DWIA 1ORVA 1DJRD 2Z95A 4GKBA 3VPGA 1HT1E 2HSWA 5BSEA 4Z86A 4MLPA 4FDTA 2BKUA 2GXQA 1YJXA 4YAEA 3ZXXA 4DY6A 1J09A 4XWWA 4JOIA 3G59A 2XNJA 4N7BA 5K0SA 3KQYA 3H9GA 3WBKA 4RG1A 4LRQA 1JE4A 4RWZA 1T3LA 5GP1A 1RJFA 3NVDA 3S8EA 2ZJAA 5E1MA 3JQ6A 2N55A 1R8QA 2VSFA 3RVRA 4ARZA 1T4GA 3TLBA 2IPXA 1SD2A 1MGOA 3U7EB 5ECYA 3WL7A 3SPXA 4B3TL 4LNHA 3OPXA 821PA 1QF9A 5LP6A 2PX8A 3HCOA 3EVZA 4HDAA 3Q2KA 3FBWA 3NV7A 2AXNA 1BWRA 2NIPA 3LP8A 1Z2EA 4TYQA 4JJIA 1E3DA 4QREA 1KMHA 3BG3A 1RRVA 2K2QB 4S24A 3B3FA 4MJ3A 2R61A 2F0LA 5I01A 4HSPA 3VVBA 3EEQA 1P0IA 3ILYA 2C3UA 1LQUA 1A7JA 3JQBC 1TS3A 4FZRA 3SR0A 2QXTA 3EWSA 4H7HA 3AR9A 2UUBB 1JOQA 1A9XA 3E82A 1EFVA 2D9UA 2ZKIA 2X6TA 1U1GA 2W6PA 2BV3A 1NR4A 1TGYA 1DBSA 1NKVA 2C9DA 4YRDA 4ZOLF 5JJZA 3OLWA 3QMVA 3O4JA 2R1ZA 4F1JA 3JAME 4JZKA 4QTTB 3ETCA 3QFTA 4MMZB 4EPTA 3I4LA 4EJSC 2EVBA 2C2BA 3D59A 1JG3A 1FUIA 3L0BA 2WV6D 3DTVD 1ESFA 3SR1A 5HBRA 4U0JA 1N34Q 2HCIA 3U3MA 5LJLA 5HZMA 1MZVA 2BLLA 2NP7A 1SKMA 2XF2A 2OFXA 3NHMA 1KD1C 2FKNA 4MQBA 3JWJA 1VJ0A 2MQHA 4YJGB 1L5HB 4Q3NA 3N5CA 4YCSA 4GGOA 2Q4TA 5C5DA 3TTTA 1HQKA 4KFUA 1CB7A 1MB3A 4KXQA 2LXNA 4JX9A 1C1YA 2AJDA 3RJ5A 3WYGA 1XN4A 2ZYIA 9ABPA 4PX5A 4QJ4A 3P75A 1F6WA 2E6KA 3ADPA 4BO0A 3ZVMA 1WKCA 5FR1A 3TSAA 3ZDBA 4DMRA 4Q4JA 4HDRA 4XX0A 5IYDG 2HT6A 2QMQA 2WZCA 2PZKA 1AQIA 2C35B 3WJ7A 4PWYA 4G86A 3L7KA 3B5IA 1A9PA 3LUDA 2WFAA 3K9FC 3VKHA 2F4NA 3W5CA 5BSWA 3FDIA 1AS0A 5DOZA 3PFIA 4OSPA 4LZJA 2KCTA 4PLFA 2M1ZA 4OB6A 1JFFA 5D5HA 3AUYA 2YNMC 2IIQA 3IMKA 5TRTA 1T0HB 2YYYA 2VYFA 4KY6A 3PFKA 3BRQA 3QE3A 4AYBE 2O5IC 1Z47A 4IZIA 1LDMA 4D3FA 4IFEA 4IX1A 3QR8A 2B6NA 2JA5H 3V3KA 1KOLA 3O1JC 4IF4A 4JLJA 1ENYA 4KACA 5JEEA 4QIWB 2Y0PA 4EJFA 4QOSA 4OH7A 4RH0A 3GRAA 2DQ4A 4GC5A 4BQPA 2MFIA 2OBBA 1PUJA 1OCEA 2P0EA 3I7FA 1B6SA 5FT9A 4KMRA 5I9NA 1JHRA 5E9QA 4CDMA 3PCOB 2Y6UA 2O3TA 4LK3A 3KLSX 3FG9A 4REMA 1DCTA 1FNUA 1AFPA 5EVJA 4JU8A 4H16A 4M1YA 2NVUA 3L7NA 1O57A 3BFXA 2FZVA 4KLNA 4EVIA 4CKCB 4OXYA 4O02B 1KYIA 2RCFA 1VHQA 5TF4A 3CB2A 3B7PA 4CCSA 2IF2A 5HKKA 4QU5A 4F2PA 5CLIA 3ZWPA 4M3NA 5TEWA 3ESZA 2YVKA 2CJWA 3JZMA 4HMPA 4R69A 2V8OA 2BGMA 2VNAA 1JG6A 5TSDA 1ZMBA 3C3EA 2LW7A 1KI4A 1GVHA 4N18A 3FWPA 2YNMD 4H6PA 4MQ6A 4JQZA 4QUEA 4AK9A 2BFFB 3HWX1 1ECCA 1WMAA 2VQ3A 1L4UA 4CM3A 4L2IB 1OA1A 3TOSA 1DRJA 1LTSD 2HU2A 4PGGA 1WXDA 2X0EA 2XBUA 5IWAQ 3K2EA 3R76A 4BVKA 4J7XA 3DDOA 3SG0A 1NVAA 4LOJA 1EDDA 1E1TA 3AF4A 16PKA 3KKZA 4RE6A 3OQBA 1BW9A 1WCMH 1FZQA 2OSBA 1Y1VB 2YWRA 5HTOA 1ZNYA 1J0DA 4LV8B 4LRTB 2O4UX 2VK8A 3RU7A 2CWDA 4ETNA 4FP5D 1AS3A 4W63A 1AE2A 5C7LO 4B4UA 1JGTA 2IV2X 3KKPA 1MJGA 2CXHA 2F55A 1YQTA 3NWSA 2IYTA 1PZEA 4RPHA 1ESRA 4X66L 6GPBA 3EVAA 3DVLA 4DYDA 1R6AA 3HNRA 3UAOA 3WGVA 2Q5HA 2NPOA 1NBWA 5DPMA 3A8IE 5AKJA 3EDRA 4A3GG 4J3JA 3EA6A