3LGJA

Crystal structure of single-stranded binding protein (ssb) from bartonella henselae
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
115
structure length
95
Chain Sequence
GSMLNKVMLIGYLGDDPESKTMTSGAEVVNFRMATFEKTEWHSVVVFNPHFAKIALQYLHKGSKVYIEGKLQTRKWYTTEIVLPQYKGELHLLDA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of single-stranded binding protein (ssb) from Bartonella henselae
rcsb
source organism Bartonella henselae
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein
total genus 18
structure length 95
sequence length 115
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3lgjA00
3CW2C 4JI3L 1C9OA 1NMFA 2JQOA 3VDYA 2KENA 4KI0A 1K0RA 3CMAA 4DUZQ 2N78A 2KCTA 4GNXA 4JI7L 1PHJA 1L2FA 5IYCG 5GROA 5IYBG 3DLLA 4RMFA 5IP9G 4DR3Q 3S2HH 3HOYG 2RF4A 3GDEA 1C7YA 4JI1L 4DV0Q 2A1AA 3GTLH 5C4XG 5GAEC 2VUMH 5FLMG 4LFBL 2PNHA 4DAMA 2BA1A 2HIXA 4X66Q 1FL0A 1G291 3I4MH 1WCMH 2UXCQ 2JE6I 2YTXA 4A3IH 1GD7A 1CKNA 4OO1I 2OQ0A 4A3GH 4BY1H 1SRUA 3J81j 4J15A 3F2CA 5IYDG 4DAYB 4ME3A 1L0WA 3G4SA 4DR5L 4ALPA 1HNZL 4JG2A 1B70B 4PZ8A 4YY3L 3J80c 5IT9c 1VQ4A 4O2DA 2VQEL 4DV1Q 4LFBQ 4DV2L 2UXDL 2PMZE 4AQYQ 1WJJA 3M85A 1MJCA 1HR0W 1X3EA 1X55A 4DV4Q 1YBYA 2ZJQA 1G51A 2PI2A 1GKHA 3CCSA 3ER0A 1M1KC 2PQAA 3K7UC 1VQDA 2VQEQ 4BBSG 4FDBA 1K8AC 2OCEA 5JJLA 4NXNL 4JYAL 3FP9A 4QJFA 1PH9A 4R4QA 4JI3Q 4HIOA 1I94Q 5IYDH 3I2ZA 1X56A 3S16H 1Z9FA 3S2DH 2ZJRA 1IZ6A 4UY8C 1QUQA 4QY7A 5HGQA 2QA4A 4A3EH 2WAQE 5IP7G 2UUAL 1P8LA 3CCRA 4IFDI 2CWPA 3H15A 4IOCA 2JA6G 1VQJA 1KD1C 2JA5G 3AYHB 1VQEA 3PCOB 4DV3Q 4C3JH 1WI5A 4DNIA 3FKIH 4PMWA 5LMUQ 3UE0A 4JV5Q 1BBWA 4A93G 2EQSA 3HOVH 1PV4A 1QZGA 4B3RL 4OWWB 1EOVA 1U0LA 5AJ3L 3HKSA 4POGA 2JEBI 2JEAI 3RLFA 3CCEA 4JI2L 1VQAA 1JB7A 3UE1A 1KRTA 2Q2UA 2JA7G 1IL2A 3NENA 4A3CH 1XMQQ 2YU9H 4A3EG 1EFWA 3KOJA 4DUYL 4YWMA 3T1HQ 4L5RC 3H3VH 5ELNA 1YEZA 3I4MG 4KHPQ 4LF7Q 2FXQA 4MTNA 4JI5L 2JA7H 1VQ6A 3GTGH 2I5HA 3K81C 1KHIA 1XNRQ 3ULJA 2E2JH 2NVXH 3E9HA 1XMQL 5JJKA 2UUBL 3HOWH 3ICEA 4C3HH 2OTJA 1FJGQ 1LYLA 2DUDA 3PUZA 4TQUS 4BBRG 2IT1A 1N32L 4UP8A 1JT8A 4A3KH 1E24A 1GO3E 3M4PA 1L1OB 1NJIC 2NZOA 5EAYA 4APVA 4A3MG 3PO3G 1UEBA 3S1RH 2RCNA 1VQGA 2NVTH 4A3LG 2ZTCA 2AMCB 4P71A 3PUWA 5FJ8G 4X65L 4HJ5A 4A3FH 2Y0SE 3KYHC 4LFCQ 4KHPL 3RZDH 4K0KL 1L1OC 5ELOA 3KDFB 3CCQA 4GKKL 1A0IA 1N34Q 3CC7A 4LFAL 5FJ8H 3PUVA 1HR0L 3AEVA 3HOWG 1WCMG 4LF9L 2WFWA 3L0OA 1TWFH 2IHFA 1Q8KA 1B8AA 3J81i 3PO2G 1X65A 1E3PA 1CKMA 4AIMA 3STBC 1MKHA 3I56A 3H0GG 3Q8DA 4GOPB 5AJ3Q 1E7ZA 3A0JA 1CSPA 1VQ8A 2HHHL 1N36L 1Q81C 2R93H 3AFPA 4B3RQ 1VQFA 3KFUA 1D7QA 1S72A 4A3DH 4B3TL 1CUKA 1PYSB 4O0AA 5FLMH 1YHAA 1YJ9A 1KXLA 2VZAA 3CP0A 3E0EA 5FLXc 4LF7L 1IBML 1Q1BA 4DR1Q 3CPWA 4GLXA 3RN5A 1GVPA 1Y1WG 1KQSA 3CC2A 3CC4A 4L5TA 4X62Q 2ATWA 3PUXA 5LMNW 5M3FH 2LXKA 5C0XG 1X3GA 4JI8L 1N9WA 4KHZA 4A3CG 4X64L 2XGTA 5C3EH 1XJVA 1B7YB 4DV7L 3JAMi 3M4OH 4JYAQ 1GM5A 5K36G 4JOIC 4JI4Q 2ZTDA 4A3JH 2AHOB 2NVYH 2IX1A 2MQHA 3ULLA 1UWVA 3HOXG 2WB1G 4A3DG 1J5EQ 4GLAC 4LUZA 2VQFL 2MO0A 4BBRH 2N3SA 4H02A 2BA0A 5M3MH 1YVCA 5C0XI 5GAGC 4AQYL 4DR5Q 1Y1WH 1PH4A 4DV1L 1LTLA 4DV6Q 3FHWA 3GTPH 1NMGA 1QUQB 4OWTB 3MXNB 1YNXA 4A3MH 1BKBA 5C3EG 3CCUA 2EXDA 4NXNQ 4GKJL 4NB3A 1IYJB 1N34L 4DV6L 2B63G 2R7FA 5LMNQ 4YCWA 1XPUA 2D0OA 3RLOA 3GTKH 2B3GA 3S15H 2F4VQ 3CCMA 1D8LA 4JI1Q 1DGSA 2NN6G 3S17H 4BA2I 2B63H 1V9PA 1XNQL 3TEHB 4A93H 1Y1VG 3HOVG 4OO1G 3I4NG 3CAMA 2D62A 1Q7YC 1M90C 2VL6A 2Z0SA 4YHHQ 2K14A 3EIVA 4B3ML 2CCZA 2JA8H 1TWAH 4JC0A 3U4ZA 4X64Q 3T1YQ 4B3SQ 2ZJPA 4JOIA 4DK6C 4DR2L 3HOYH 4PZ7A 4GS3A 2JJQA 4MNOA 4LF8Q 4BY7H 3KLWA 4AYBE 2PI2E 3OTOQ 2E2HH 3CXCA 4BA1I 4RG1A 4XIGS 4LF6L 4DV0L 4DPGA 4PZ6A 3RR5A 1FGUA 1Q46A 5J3BA 5IP9H 2AWOA 3UDFA 4BY1G 1AH9A 4OWXB 4AYBG 1NY4A 1QVCA 1VQBA 2DGYA 2ALYB 3HOXH 3F2DA 1VQHA 4C3IH 4DR4Q 3JAMc 3PO3H 1EUJA 4IFDG 4P72A 1E1OA 3GTJH 4MZ9A 1W2BA 4HIMA 2N49A 5M3MG 1YI2A 5LMNL 4IPHA 4BY7G 3PUYA 4IPCA 3OTOL 3D0FA 3OYYA 3CD6A 2HIVA 4LFCL 4X65Q 5GADC 1PYBA 4LF4L 4IJLA 3AQQA 3HKZG 1KC8C 4JI6L 2JK8A 1JJCB 3KF6B 1OXTA 2L15A 1WOCA 1Z47A 1PH6A 3D31A 1QVGA 4DR7Q 4B3MQ 2CFMA 5M5YH 4JI4L 4JI0L 1XTDA 1K3RA 3PGZA 4YCVA 5HY6A 3J81c 3CF5A 4DV4L 5C0XJ 4JCVE 3UDGA 4A3JG 2UUBQ 4BXXH 4X6AH 1A8VA 4P74A 1JE5A 2OWOA 1HZAA 3HOUH 2F3IA 4UP9A 3I55A 1VCIA 1PH2A 4JI5Q 4JBKA 2NVQH 4WJ4A 4GN3B 3PIOA 1IBLQ 3WWVA 1Q82C 1I94L 1VQ7A 4TVAB 2E5LL 4QIWE 1HNWL 4GKJQ 4UPAA 4NPSA 2VNUD 3J7ZC 3L2PA 3M3YH 4R4IA 1T9HA 1PH5A 1IBLL 3U58A 2JA6H 1VQNA 5JEAG 5GAHC 4A4IA 2OQKA 4OX9Q 3PIPA 1UE7A 3FKIG 1X3FA 5E7NA 1SFOH 4IOAA 2IY5B 1VS0A 2F52A 1YJNA 4DK3C 1TWHH 3CQZH 2F4VL 1CKNB 4QGUA 1K8GA 1VQIA 1YIJA 1XPOA 4DR3L 1L1OA 3EBEA 3CPFA 2R6GA 2WAQG 4C2MH 1TWGH 3J7A5 3S24A 2IHEA 1EQQA 1HNXL 2K5NA 2KBNA 4UP7A 2V1CC 5BR8L 4A3GG 2PQAB 4JI6Q 5IWAL 3RN2A 2GN5A 3UDIA 1I50H 4GLVB 4IJHA 4A3KG 2OTLA 2R92G 1VQ9A 2YTVA 1SN8A 1RIPA 5C4JH 4P73A 2ASBA 1EIYB 2UUCL 1NTGA 2N8NA 3RLNA 5JEAJ 1IBMQ 2HHHQ 2BH2A 2B29A 4JI0Q 3KF8B 2RHSB 3OW2A 1PFSA 3PF5A 2JA9A 4DV2Q 4B3TQ 1I6HH 2ID0A 1Y1VH 1XMOQ 4IPDA 1VQCA 3LGJA 2E2IH 4LUVA 3T1HL 1HNZQ 4A3BG 4QQBX 1VQOA 3PV0A 3B6YA 4LF9Q 3TQYA 4DV7Q 2C35B 2QEXA 4LFAQ 4A3FG 1HNWQ 1LUZA 5C44G 3PSIA 2E5LQ 1EYGA 2H5XA 2R92H 4HIDA 2VS1A 1K9MC 1J6QA 3G6EA 3GO5A 2Z6KA 1S3OA 2I5LX 4R4CA 5M5XH 3A5ZB 4X66L 1EIFA 2AWNA 4GNXB 1JMCA 1VQLA 3GD7A 3JC66 4GN4B 4IO9A 4LUOA 2EIFA 3CCJA 4LF5L 1H95A 2UU9L 4NXMQ 1PH7A 1OTCA 2I0QA 5M5WH 1KAWA 2LSSA 1V1QA 4HJ7A 3H0GH 3W1GA 3M4QA 3J80i 2Y0SG 1C0AA 1IXRA 2R93G 3I7FA 4LF6Q 2VY3A 3TS0A 1AE3A 4JBJA 1HH2P 2K5VA 5C44H 1Q12A 5LMUL 2QGQA 4JV5L 1PA6A 1N32Q 3AFQA 4DKAC 3BZKA 3NELA 2A8VA 3CCVA 1R9TH 3S14H 2GVBA 4OXPA 2HQLA 1X9NA 4GKKQ 4R4TA 2NN6I 1SMXA 1RL2A 4K0KQ 1PVOA 3A74A 3ULPA 1VQ5A 1Q86C 5IWAQ 4PG3A 4JI2Q 3L7ZC 4DUYQ 2RHQB 4YCUA 3RNUA 1A62A 2K50A 3KDFA 1QZHA 3NBHB 1XMOL 3PF4A 1W3SA 3DM3A 3ZJYC 2WP8J 4YHHL 3F1ZA 2BH8A 3U4VA 1YHQA 1FJGL 2UXBL 1A63A 2IX0A 1E22A 2E8GA 1XNRL 3E9IA 1UE1A 1X54A 4EQ5A 4DR6Q 2UUAQ 1FVIA 4YWKA 4DV3L 3M9BA 1EQRA 1MJEA 1IBKL 4YY3Q 4LF8L 1TXYA 2YV5A 3G71A 2LXJA 2R7DA 5IE8A 3UDXA 4A3IG 1VQPA 1VQKA 3SGIA 3IRBA 3K7AH 2WB1E 5DLQE 4GOPA 1K83H 4JI8Q 2KHJA 5IYBH 4IFDJ 3K80C 5BR8Q 2Q2TA 4X62L 4OONA 2XTIA 4A3LH 1HNXQ 1N33L 3TRZA 1AE2A 1Y14B 1I5FA 1MIUA 1UE6A 2A19A 4GNXC 3TS2A 1IBKQ 2Z6KC 1J5EL 2CKZB 3G48A 4YWLA 1YITA 2VUMG 4DR6L 1TWCH 1ASZA 2VQFQ 2MO1A 2MFIA 4KLKA 3TREA 4OX9L 1N36Q 3M7NA 1UE5A 3K0XA 1N33Q 2GVAA 2KCMA 3I4OA 4DR7L 1I3QH 4DV5Q 4BBSH 1NE3A 3EN2A 1U5KA 4LWCA 4QL5A 1CKOA 2YTYA 3PO2H 4A3BH 1NBWA 1BBUA 1LM0A 1SR3A 3KJPA 4EX5A 2YYZA 5M3FG 4XTCS 3K8AA 2CWAA 4JBWA 3HFZB 4R1JA 4DV5L 3S1MH 2AKWB 3W1BA 1HZCA 2ZM6Q 3ERSX 1SLJA 3U50C 3F2BA 1XPRA 2JA5H 3GTOH 5JJIA 2R7ZG 1OXSC 2Q2HA 1O7IA 1CSQA 1HZBA 3CMEA 3HOZH 1SE8A 2Q2IA 3MEFA 3F8TA 2HT1A 4DR4L 5GQOA 1HZ9A 1PH1A 2UXBQ 2K52A 4DUZL 2R7ZH 3GTMH 3HOZG 1Q1EA 1OXXK 2NZHA 3S1NH 1YZ6A 4LF4Q 3NEMA 1HR0Q 1QVFA 3W5OA 5IP7H 2K5HA 2D0PA 5IY0A 1KRSA 2ES2A 2ZTEA 4IPGA 4WJ3M 4LW1A 2UXCL 1P16A 4DR1L 4POFA 3GTQH 1WYDA 1EWIA 4GOPC 1PH8A 3CCLA 1SROA 3H3VI 1V43A 1OXUA 3BJUA 4R4OA 2I5MX 4Y7NH 2K4KA 4HJAA 3HOUG 3RZOH 4GN5A 4HJ8A 4HIKA 3BZCA 4A75A 2UXDQ 1S40A 3BU2A 2MNAA 4JBMA 4L5QA 1PH3A 3A5UA 1N8RC 1JJGA 1KIXA 4Y52H 1OXVA 1VQMA 3KJOA 4JI7Q 4BXXG 4A76A 4LF5Q 3KF6A 4LNQA 1HJPA 4L5SA 1JJ2A 1XNQQ 1ASYA 1BVSA 4P75A 1YHBA 3HKZE 5H1SE 2JA8G 2UU9Q 4NXML 3STBD 5C4XH 2VW9A 2UUCQ 2ZM6L 4DR2Q 2CQOA 5IYCH 1WFQA 1K73C 1KL9A 1YJWA 3I4NH 1G6PA 1X6OA 2K75A 3T1YL 4B3SL 3S1QH 4AH6A 1E1TA 2KHIA 4HJ9A
chains in the Genus database with same CATH superfamily
1EY6A 4JI3L 3MXGA 3VDYA 1YNND 1B9MA 1STHA 2E74C 2HCIA 2KCTA 2KECA 3FEWX 1WTPA 1PHJA 4DA2A 1V8QA 3HOYG 3E0JA 3RZDB 1BCPC 5KRUA 4LFBL 5M3MB 1KDBA 1Y1WB 4X66Q 2L9HA 4XQJA 1FL0A 2QKIC 2JE6I 4KK7A 4A3IH 1GD7A 3H0GB 2OQ0A 2JYOA 4Z9CB 4BY1H 2QF7A 5K36H 4JG2A 3FVQA 4PZ8A 1VQ4A 3GTOB 4DV2L 1EYCA 2PMZE 2WV6D 4EVOA 4ZCKA 1MJCA 3M85A 4H44C 1GKHA 3CCSA 1FYCA 3K7UC 2PMZB 1BDOA 1SE2A 3P1HA 2A74C 4QJFA 3SK4A 4KN7C 4NP5A 1A3TA 4C3JB 3WOFA 4QY7A 2FFKB 2QA4A 4A3EH 1HA6A 5IP7G 3T51B 2UUAL 1HFGA 2G9DA 2PZUA 3H15A 2JA6G 4J1MA 1KD1C 1YNNC 2QILA 5E4WC 3D4DA 1WI5A 1EQVA 1WTRA 4KD3A 4A93G 1BOSA 4OO1H 1R9TB 2JXMB 4FF4A 2JEBI 1JB7A 2F0EA 2DJGC 3MA2B 3P7JA 4CKCA 1XTCD 5DEHA 4A3EG 2AUJD 4YWMA 1GHJA 3H3VH 5ELNA 4LF7Q 1VQ6A 3GTGH 3DEOA 4NW2A 2I5HA 2F0PA 3H09A 1ET6A 3ITPA 1KHIA 3PQIA 2EY1A 3BVGA 5JJKA 1LTID 4C3HH 2X6LA 3D6WA 2DUDA 4BBRG 5FO7B 3HKZB 1JT8A 4HEDA 3Q22A 3V96A 1F9QA 1NJIC 1GXDC 2NZOA 3T4AC 4A3MG 5FOBB 2K01A 3HEJA 2RCNA 3MEHA 1VQGA 5ELCA 4A3FB 2ZTCA 2AMCB 2NVTH 3PUWA 4K0KL 3RMHA 1ONLA 1A0IA 4LFAL 2CW0D 2EDGA 3L0OA 1Q8KA 3PO2G 4AIMA 4OELB 3A0JA 2R93H 4C3JG 4B3RQ 1CA6A 1D7QA 1S72A 1I6HB 3I91A 1YHAA 5HURA 1KXLA 1IBML 4DR1Q 1Y1WG 1SMYD 3PUXA 3MAQA 2XSCA 1F9PA 5FKAC 4JI8L 4A3CG 2XGTA 3DUZA 3K58A 1B7YB 1GHKA 1GM5A 4JOIC 3GV6A 1U4LA 4A3JH 2MQHA 3OSOA 5K5PA 5CGKA 4A3IB 4LUZA 1I4GA 2N3SA 1Y1WH 5C0XI 5M3MH 5GAGC 1ET9A 5JPMC 3R8BA 4DR5Q 1NMGA 1QUQB 3I70A 1F9RA 4NXNQ 1AW7A 3A7AB 1YNJD 3FMCA 3O13A 3VA7A 1Y8PB 5LMNQ 2AQ1B 1UUPA 2IX3A 5IGBA 3CCMA 3R2TA 4JI1Q 2RDGA 2NN6G 1RDPD 2X6GA 4DAVA 3H91A 3TEHB 3TN2A 2F0QA 3I4NG 1EYAA 1NCVA 2VL6A 4IN3A 2K14A 4YHHQ 5J22A 1FGBD 3MFYA 3U4ZA 3NBIA 3NWSA 4DK6C 4MNOA 4KKTA 4CDCC 1PZID 4AYBE 2K05A 2PI2E 5IIFA 2E2HH 4HMIA 4XXEA 1B9NA 4DV0L 4PZ6A 3RR5A 1Q46A 1FNVA 4OWXB 4AYBG 1IW7D 1JE4A 1VQBA 2DGYA 1PTOB 3F2DA 1VQHA 4DR4Q 1EUJA 4UAIA 1E1OA 1STYA 1LTGD 3D0FA 1AZPA 3CD6A 4IJLA 3AQQA 3HKZG 4JI6L 1S5BD 1LTSD 2L15A 2K28A 5EPJA 2B8FA 2B2YA 2SDFA 5M5YH 4JI4L 4JI0L 3J81c 5HY6A 4YCVA 3WOEA 3CF5A 5C0XJ 4X6AH 4RGTA 1A8VA 1ICFB 4P74A 1JE5A 4CHTB 1HZAA 2F3IA 2BDOA 1VCIA 2R61A 2IWHA 1MI2A 4HR7B 3I4NB 1I94L 1VQ7A 4A3BB 4QIWE 1QCBD 3VYSA 2RVLA 3M3YH 1KNAA 5JEAG 3NTKA 4A4IA 5LL6S 4OX9Q 1WTOA 5JPNC 3FKIG 4IOAA 2IY5B 1PXUA 2F52A 1YJNA 2D9UA 2F4VL 1K8GA 1CHPD 3MVVA 3WDNA 4Y7NB 3EBEA 2RSNA 1JORA 5CV8A 3J7A5 3VR2A 3S24A 2VB2X 3EQLC 4QCLA 1PTOC 1RODA 3HOYB 5BR8L 2MP1A 3RN2A 2GN5A 3UDIA 1KAAA 5JEAH 1K0SA 2DJFC 1UNSA 5JEAJ 3KF8B 2JA9A 4DV2Q 1ZYRD 4B3TQ 1Y1VH 4BY7B 1XMOQ 3Q6SA 4LUVA 1LT3D 4ME5A 2N55A 4QQBX 1VQOA 1I4XA 1CFMA 1K28A 2C35B 3E5SA 1LUZA 1TWHB 3EA6A 2E5LQ 1EYGA 2K32A 2RKSA 4HIDA 1K9MC 4OEMB 4RWSC 1S3OA 2I5LX 4X66L 2AWNA 3GD7A 3JC66 4IO9A 2P5ZX 4LUOA 1RJTA 4LF5L 4NXMQ 1PH7A 1OTCA 5M5WH 1Q8IA 5IGEA 3H0GH 3J80L 3M4QA 3J80i 3TP6A 2A68D 4LF6Q 2VY3A 4JBJA 1HH2P 2K5QA 4JV5L 2QGQA 4N8X1 1N32Q 1TKWB 2F0OA 3NBHA 4ODGA 3BZKA 1GUGA 3CCVA 2A8VA 4OXPA 2HQLA 1X9NA 1SNDA 3GP7A 1SMXA 2ENBA 3N52A 3GV3A 4PNYA 3ULPA 2WINB 4PG3A 3L7ZC 5EPKA 2QCPX 2F0UA 1JCKB 1QZHA 1WTHA 1XMOL 3DM3A 4MTKA 2KVMA 3F1ZA 3U4VA 3VR4A 1QJOA 5BN5A 4EQ5A 3IL8A 1IBKL 2C9OA 4RGNA 1M8AA 4A3DB 4DFAA 1VQKA 3QJYA 4GOPA 2KHJA 3K80C 5KYIA 4G7HC 1HQRD 2CH4A 2JP1A 2A6ED 1N33L 5I9PA 4IURA 4JPBW 4GNXC 1KABA 4PQXA 4RA8A 3I8ZA 2SNSA 4YWLA 4CJ2C 1SAPA 4OX9L 2MFIA 2NBFA 1UE5A 3K0XA 2JA8B 2HCCA 2GVAA 1JOQA 2OF1A 4DV5Q 3C1EA 1NE3A 2YTYA 1U4PA 1ESRA 1SR3A 2YU9B 4XTCS 1GOZA 2HQEA 2PW5A 4ZQ3A 2JSOA 1A6XA 3EROA 3U50C 3GTOH 4U673 4QUCA 1HZBA 1SYDA 4B08A 2IL8A 4DR4L 2KJXA 3F8TA 4K6DA 5JOBA 1HZ9A 1SNOA 3GTPB 2F3VA 2OXPA 3PO3B 4C1NK 3E3XA 3NEMA 1HR0Q 1PMRA 4CGYB 2MHVA 1KRSA 1LABA 1P16A 3S1MB 1BBXC 1SROA 3H3VI 1OXUA 4FVMA 1SBBB 1VDZA 4Y7NH 3HOUG 3RZOH 3BZCA 2H1EA 4JBMA 1WTQA 3KJOA 1FNWA 4BXXG 4K5VA 4J8QA 4KY7A 1ASYA 1J9OA 4P75A 1LT5D 3HKZE 2NVYB 2EYMA 1ENCA 2B8GA 2Z8LA 5CV4A 4NXML 3X3MA 3W3AA 4ZLTF 1STAA 2UUCQ 2ZM6L 1CZWA 2CQOA 3AU7A 3I4NH 5E3FA 4AH6A 1BBWA 2KHIA 4ULLA 3T1HL 2IPKD 2WB1B 3CW2C 4BWGB 1TQOA 1C9OA 1NMFA 2KENA 4GNXA 3ND8A 5IYBG 5M5YB 3DLLA 4RMFA 1BUVT 3NUCA 3ZYYX 4JI1L 4DV0Q 3GTQB 3Q0AA 3OWFA 1AZQA 1EFID 2PNHA 5A35A 4DAMA 2UXCQ 1HRJA 4OO1I 1CKNA 2DNCA 4J15A 3D6CA 5IGCA 4DR5L 3TSSA 4ALPA 1HNZL 4IFDH 1RTOA 4DV1Q 1SSOA 2B2YC 1B53A 1WJJA 1HR0W 1X55A 3U9SA 4PMCA 2ZJQA 1G51A 4RGOS 2L0CA 2E2HB 1H9JA 4TRDA 5CORA 1M1KC 2VQEQ 1CM9A 2BE5D 4NXNL 4JYAL 3FP9A 2A73B 1S5DD 3DM1A 4BBRB 3S16H 3J7YW 1TS2A 5M5XB 4ABNA 1XWEA 2CWPA 3GTMB 2R7ZB 5IGGA 4IOCA 3QWNA 5IOCA 3AYHB 3PCOB 1CA5A 2RDHA 3S16B 3KUPA 4DNIA 3FKIH 5LMUQ 3GQBA 1D6EC 3TMEA 1QZGA 1PV4A 4OWWB 5KNCA 1EOVA 5AJ3L 3HKSA 2QW7A 3RLFA 4JI2L 3UE1A 1KRTA 2Q2UA 3NENA 4FF1A 5CMDA 3KOJA 5L37A 4HCSA 1IW7C 4DK0A 1DXMA 1EEFD 3I4MG 2FXQA 2JA7H 1CTMA 3AB9A 3S1RB 3K81C 3C2PA 3ULJA 2NVXH 1XNRQ 4M8AA 2UUBL 3DXJC 2EYPA 4L8JA 3H6MA 2MGSA 1GO3E 2JN4A 1Y8OB 5EAYA 2E2JB 3BVZA 3CHBD 2F0GA 1T5XD 1CZGA 1GUOA 1I4QA 3OMCA 4A3LG 1Y1VB 3RD4A 4UDUC 4G7OC 1VF7A 1HR0L 2Q8RE 1B2TA 5DM63 4QIWB 2WFWA 2K04A 1JWUD 1EY8A 1E3PA 2F0MA 2EYOA 1MKHA 3HOUB 3H0GG 5AJ3Q 1E7ZA 5C3EB 3V2TA 2HHHL 1Q81C 1QE6A 4ZAIA 2A6HD 1YJ9A 1TS4A 2VZAA 1H9MA 1SXTA 2PW7A 4LF7L 2A69D 1Y8NB 4R9WA 4K14A 5LMNW 1RCVD 1X3GA 1N9WA 2NVTB 3HOVB 4DV7L 3M4OH 1LO5D 1FD7D 4JYAQ 5K36G 2K33A 1QG7A 2F0SA 2NVYH 1UWVA 3HOXG 5IT9L 5IT9E 1K3BC 1EWCA 2VQFL 1F77A 4H02A 4DV1L 3GTPH 4DV6Q 3FHWA 3NHHA 4OWTB 1RKNA 3CCUA 2EXDA 3S17B 1N34L 3MXUA 2OT2A 3L9AX 2RQXA 2R7FA 3GTKH 4CBVA 3HOWB 3K6OA 4A93H 4OO1G 1Q7YC 2K1BA 4C3HG 3EIVA 2CQAA 5KNDA 2LKVA 2F0NA 2CCZA 4JC0A 3T1YQ 2JA8H 2CH4W 4JOIA 4GS3A 4X3KA 4LF8Q 3P75A 5CR3A 3KLWA 4HAEA 2BOSA 3OTOQ 3NE5B 2RBMA 1PTOH 4BA1I 4LF6L 1HA5A 1UEAB 1E0BA 1FGUA 2F0TA 2FMCA 2K6AA 1NY4A 1QVCA 4C3IH 5C4XB 1B3QA 2F0LA 4HIMA 1YI2A 4B9WA 5F2DA 4ZUJA 3PUYA 3CU7A 3HOXB 1Z6HA 1U4MA 1ENAA 1U9RA 3EVQA 5GADC 4LF4L 4FO2A 2F0VA 2O2LD 1JJCB 1OXTA 1WOCA 1R4QB 1TS5A 1ESFA 1Z7TA 1Z47A 1TU2B 1SYCA 4B3MQ 1MHWC 4BXXH 4A3JG 1O80A 2CW0C 2OWOA 4IQZA 2NVQH 5EQ0A 3WWVA 3OMGA 3D4RA 1EOTA 2XRQD 1TS3A 2RSOA 4GKJQ 4UPAA 1MGSA 3J7ZC 4CDFC 1PYWD 1T9HA 2F0HA 1PH5A 1VQNA 3I90A 3PO2B 2F03A 2ICIA 1TWCB 4RCNA 1UE7A 1X3FA 3K5LA 4WORA 4XT3B 1VS0A 3KLSX 4DK3C 1TWHH 1Y69U 1VQIA 1YIJA 1BCPD 2L55A 1XPOA 1EL0A 1D1IA 1QOHA 3IAYA 4P2CB 1NR2A 1SNPA 5CV5A 4A3JB 1EY4A 2K5NA 3LX0A 4UP7A 1G8ZD 3PIP3 4CKBA 4JI6Q 5IWAL 4A3KG 4GLVB 3KF8A 2R92G 4DN4M 5AFWA 5C4JH 1PTOD 2N8NA 2HHHQ 5EJWA 4JI0Q 3A55A 3OW2A 1PFSA 2MPMA 5C3XA 2ID0A 1I6HH 2KCCA 4IUVA 3GTKB 2EZVA 5A2QL 4A3BG 4QUFA 1CT1D 1WTXA 3PV0A 1LTBD 1HPCA 2RCFA 5C44G 5CV9A 1STBA 1S5ED 2H5XA 4M1UB 2R92H 3KLRA 4Q0FA 3G6EA 3GO5A 2Z6KA 5COYA 2ZXRA 1A3UA 3U9OA 1DD2A 1I3QB 2MUYA 1JMCA 1KDCA 1X32A 2EIFA 1I6VC 2EJMA 2I0QA 1EQTA 1KAWA 4HJ7A 3VA5A 1C0AA 3QG1A 3SE0A 1IXRA 3I4MB 4TKOB 3SHLA 2B2TA 5C44H 1PA6A 3AFQA 2DY8A 4DKAC 5C4HA 2XNAC 1R9TH 4C3HB 2GVBA 5FLXE 4GKKQ 2NN6I 4MHEA 3M3YB 1RL2A 5C0XH 3A74A 1XX8A 1Q86C 4JI2Q 4DUYQ 4YCUA 5FO9B 3RNUA 1A62A 3QB3A 2O5JC 5EBDA 5ELDA 2BH8A 4G57A 1A63A 1FJGL 1E22A 1I4RA 3A54A 1UE1A 2L4NA 5G3LD 1XXGA 1M4VA 1BXTA 4DV3L 2WKCA 4IUPA 4YY3Q 3QO2A 4LF8L 2R7DA 3UDXA 1E2VA 1SYEA 5C4JB 3IRBA 2J0TD 3K7AH 2WB1E 3X3NA 4JI8Q 5JJZA 5E1FA 3FDTA 5BR8Q 2Q2TA 2IJ0A 4OONA 4KJOA 4A3LH 1AE2A 1Y14B 1XYIA 1MIUA 1IKMA 3R2IA 2VUMG 2L1BA 1TWCH 4ZRZA 5IODA 4DR6L 2Z4IA 3BVMA 2VQFQ 4KLKA 3M7NA 2CHBD 1CK1A 3I4OA 4DXGA 4DR7L 4BBSH 2JA7B 3PO2H 4QL5A 4RGMA 1NBWA 1BBUA 1SE4A 2RDFA 2QDBA 4K5WA 4EX5A 3K8AA 4JBWA 3HFZB 2NVQB 4RKLA 1PFNA 4EQPA 2B2WC 3F2BA 2JA5H 1O7IA 2TMPA 1HQMC 3CMEA 1JQYD 2L12A 3MEFA 5LHY1 2HT1A 2BCOA 1V1PA 3BYYB 4KY5A 2R7ZH 3GTMH 1Q1EA 1QNKA 2PYKA 4ZUIA 4XQNA 1OXXK 2NZHA 4RCOA 1QVFA 1JR0D 5IY0A 4OIJA 2ZTEA 1B3AA 3W2DA 1ZYRC 2K5DA 4C2MB 1H9KA 1V43A 3S2HB 4R4OA 4HJAA 4FF2A 2I5MX 3A7LA 3LNNA 5IGFA 4A75A 5EKLA 1N8RC 2XVSA 1OXVA 3H94A 1VQMA 4JI7Q 1AN8A 4I7AA 4LNQA 2EYJA 1HJPA 4L5SA 3J80E 1XNQQ 1B50A 1BVSA 5G3LF 2ZXPA 1TY0A 4FXKC 2DN8A 2EE1A 2JA8G 5C4XH 4DR2Q 1YJWA 5J39A 4B3SL 5C4ZA 3D8GA 1HHVA 3FRPB 4RHRA 1I4PA 3CMAA 2LFNA 1ILQA 3NQTA 4JI7L 1SNQA 5GROA 2QDLA 2VB3X 4DR3Q 2RF4A 1OO9B 3GDEA 3GTLH 3MWYW 5C4XG 1B44D 1F2ZA 5GAEC 5FLMG 1PRTD 2EOTA 2HIXA 1D1KA 3NQIA 1WCMH 1F2YA 3I73A 2YTXA 3BS1A 4A3GH 4L63B 3J81j 1TVXA 1QWYA 1EYDA 1VF5C 5IYDG 4DAYB 4H0LC 2E2DC 3K0YA 1HCZA 2HDMA 1B70B 4YY3L 1DOKA 3OWEB 5IT9c 3J80c 4O2DA 2VQEL 3A8KE 4LFBQ 5EKIA 1H9RA 3SDZA 1GUNA 1X3EA 4DV4Q 1YBYA 1E2ZA 1EZ6A 3ER0A 2PQAA 3HS0C 5I6YA 1JC7A 2OCEA 1K8AC 1PH9A 5IYDH 1SYFA 4R4QA 4JI3Q 3OOCA 2B2TC 3S2DH 1IZ6A 4UY8C 1QUQA 1HTLD 2WAQE 1P8LA 4IFDI 2BE5C 4DXFA 1ZEQX 1VQEA 3IKJA 4DV3Q 4C3JH 1RHPA 4KD4A 3UE0A 2EQSA 3HOVH 4B3RL 4DGZA 3K5MA 1F2MA 4K8JA 2QEJC 2JEAI 1TWAB 2JA7G 1IL2A 4A3CH 2YU9H 1V1PB 1EFWA 4DUYL 3T1HQ 1UAPA 1YEZA 4KHPQ 1LTTD 4PMBA 4JI5L 4S3SA 1IKLA 2E2JH 1XMQL 1H9SA 3ICEA 2OTJA 1FJGQ 1LYLA 3TZUA 3LWEA 3PUZA 4TQUS 2KHSA 2IT1A 4A3KH 4L6TB 1RD9D 1E24A 2NVXB 4APVA 3HZXA 3PO3G 5JVH3 1TT2A 1UEBA 3S1RH 4A3MB 3SK8A 2EXZA 4P71A 5KIXA 4X65L 4ZKCB 4HJ5A 2Y0SE 4KHVA 4LFCQ 3J81E 3RZDH 4ZK9B 1L1OC 5ELOA 3KDFB 2Q8TA 4GKKL 3CC7A 3AEVA 5FJ8H 2PQEA 2A5HA 2V4DA 4C1NI 1X65A 1CKMA 5ELEA 3STBC 5EGTA 3I56A 2A69C 4GOPB 1G2SA 1CSPA 2ZT9C 3PMFA 4EQOA 3AFPA 4KY6A 4A3DH 1CUKA 4O0AA 5ELBA 1IYVA 2F0WA 5FLXc 4DK1A 5JVG3 1LT6D 3CPWA 3RN5A 4L5TA 2ATWA 5M3FH 5C0XG 4X64L 2KA7A 1XJVA 3ONAB 3DWPA 3NPPA 1SEBD 1R4PB 1DOLA 2PNRC 4A3DG 1FR3A 3D4WA 1O7ZA 4GLAC 1I50B 2F0IA 2B2WA 2WKDA 4BBRH 4F8MA 2KEDA 2BA0A 1DJRD 1LTLA 4C56C 1YNXA 1WTVA 4A3MH 4AYBB 4X3SA 1BKBA 1A3VA 4OHJA 4H7BA 4GKJL 5CBAE 1JOOA 5LL6X 1J8IA 1B1ZA 1G91A 4YCWA 1XPUA 2D0OA 2B3GA 3S15H 4KN4C 1D8LA 1A2UA 1NUCA 5CV7A 4BA2I 2B63H 1STGA 2HUGA 3H3VC 1SDFA 2FINB 4GZYC 3MC0B 4B3ML 4K2LA 1RF2D 1TIID 2E76C 1PRTB 1TWAH 4X64Q 4DNRB 3HOYH 4PZ7A 3DHQA 2LY7A 2JJQA 3DWAA 4BY7H 1CQVA 2EJFC 2M9VA 4RAUC 4XIGS 2M00A 5IP9H 3UDFA 4BY1G 1AH9A 5A2QE 5CV6A 1H9SB 5DM73 1LTAD 3NSWA 4K6LA 4P72A 1W2BA 4MZ9A 1EY9A 5M3MG 4EGVA 4BY7G 3OTOL 2K03A 1FNUA 1DYQA 2HIVA 4LFCL 4X65Q 1JWSD 3K5OA 2Y0SB 1KC8C 2JK8A 4KKSA 1F2LA 2VUMB 3KF6B 4ILWA 4CDDC 3RUZA 1EIHA 2Z6BA 4DU9A 1XTDA 4DV4L 3UDGA 3OW7A 2UXDL 2NN6H 5BN4A 5CC4A 4DNTB 1S4ZA 3HOUH 4UP9A 3I55A 1PH2A 1NR4A 4JI5Q 4JBKA 2LS01 2H4OA 4GN3B 4CKEA 4RH6A 1IBLQ 1Q82C 1IL8A 1DM0B 2E5LL 2KQ3A 3K5NA 4NPSA 3L2PA 1PFBA 3U58A 3S9WA 1AP0A 1HFNA 5D14A 4OL7A 1O78A 3CQZH 3KK7A 4QGUA 3TZDA 4DR3L 3T16A 2PCFB 4DAYA 3CPFA 2WAQG 1W6JA 2LMCB 1U4RA 2IHEA 1EQQA 1HNXL 2KBNA 1BCPF 4A3GG 2PQAB 1I50H 1K8OA 2YTVA 3KBXA 4P73A 2ASBA 4N8FA 3HG9A 5I9OA 1VMPA 3V05A 1NTGA 3RLNA 5T1GA 1BQQT 2B29A 3VR3A 2BH2A 2RHSB 1GUSA 3BDLA 3TP8A 5CBEE 4IPDA 3LGJA 4XT1B 2Z4HA 2E2IB 1S5FD 1DCZA 4NKLA 2J7ZA 4DV7Q 5C44B 1SJED 2I46A 3E6ZX 4A3FG 4LFAQ 3K59A 4N9TA 2VS1A 1BF4A 3MXNA 4R4CA 1SE3A 5M5XH 3A5ZB 3MFGA 1WD0A 1VQLA 2JA6B 5IGDA 1KNEA 2JA5B 2UU9L 4F87A 4OGQC 4E6IA 1V1QA 2NZ1D 4A3GB 1A2TA 3W1GA 5C6AA 1LV9A 2R92B 2KCNA 5KGUA 2NYZD 3I7FA 1AE3A 5NUCA 5LMUL 5M5WB 3S14H 5I4DA 1BCPB 4R4TA 4CJ0B 2KUMA 1PVOA 1VQ5A 3T13A 3P20A 3SK6A 2RHQB 3QIAA 2K50A 3KDFA 5T1IA 3NBHB 4H13C 3PF4A 3ZJYC 3NTIA 4YHHL 2O5IC 4RFBA 1YHQA 2UXBL 2IX0A 1XNRL 1CHQD 4DR6Q 2UUAQ 1FVIA 1JICA 1MJEA 4G7ZC 3M9BA 1C8CA 3A8JE 1TXYA 2YV5A 3G71A 2R3ZA 2LXJA 4K5XA 2GA4B 3SEBA 4A3IG 3OIQA 3SGIA 3EJIA 1K83H 4X62L 2XTIA 3TRZA 1UE6A 2A19A 3J7AF 2G9HD 3TS2A 2Z6KC 1J5EL 3GTJB 1O7YA 3G48A 1ASZA 1EEID 3TREA 1KDAA 1N36Q 4I65A 1N33Q 5TSSA 1II3A 3A8IE 4FP5D 1U5KA 4LWCA 4A3BH 1LM0A 4IALA 1B4OA 3RZOB 5M3FG 4KKUA 1PZKD 2EVBA 3S1MH 2AKWB 3W1BA 1HZCA 2ZM6Q 1A15A 3KBGA 2EYFA 5D65A 2R7ZG 2Q2HA 3Q24A 4IUNA 5ELFA 2UXBQ 3HOZG 3S1NH 5BN3A 5D3IB 1MSGA 4C3IB 4CJ1B 2B2VA 2BDNA 5IP7H 2D0PA 4X3UA 4YIJA 1LTRD 4LW1A 4N9PA 1V1OA 4QMGA 2UXCL 4WJ3M 4DR1L 2F3WA 1PH8A 4RKBA 3CCLA 2SEBD 4IZ8A 4GN5A 4HJ8A 4HIKA 1G2TA 2UXDQ 1TY2A 3LWUA 1S40A 2MNAA 4L5QA 5C3WA 3A5UA 1JJGA 4A3EB 1KIXA 4Y52H 1JOKA 4A76A 4LF5Q 3TBIB 3I72A 1JJ2A 3VR6A 1YHBA 2F4IA 5I2YA 1GUWA 2UU9Q 3STBD 1S5CD 1LACA 2VW9A 4A93B 4KV6A 4QF4A 1WFQA 1K73C 1KL9A 1G6PA 2F0DA 5C5LA 1BR9A 1E1TA 4HJ9A 2JQOA 2HDLA 4KI0A 5I2XA 1K0RA 2O4XA 4DUZQ 2N78A 1STNA 4HMJA 1L2FA 5IYCG 1VMCA 5IP9G 3S2HH 4NMZA 1C7YA 2A1AA 1ICWA 4G4KA 2A6HC 4KTAA 2HD3A 2VUMH 2D5DA 2BA1A 1CI3M 4XYOA 1G291 5M9OA 3I4MH 5KEEA 1SRUA 3F2CA 1EWHA 3NK9A 2PPBC 1NNXA 3CRKC 4ME3A 1L0WA 5E4XA 3G4SA 3NWTA 3OHXC 5I6WA 4AQYQ 2X69A 2DY7A 3NXWA 4FNFA 1BO0A 1SMYC 1HXYD 2KEEA 3HP3A 1D2BA 1SYBA 2PI2A 3SVMA 1VQDA 4BBSG 1L0YB 3ERQA 4FDBA 4BBSB 1SYGA 5JJLA 4HIOA 1I94Q 3I2ZA 1X56A 3G7LA 1Z9FA 5FLXL 2ZJRA 5HGQA 3J7AV 3N6RA 4FXGC 3C3LA 3CCRA 2K5WA 3URYA 3TDQA 1VQJA 2JA5G 3IFTA 5EBCA 2KOLA 5HGTA 2B63B 4PMWA 4JV5Q 1QILA 3HRZC 4LK1C 3K7AB 3S14B 2E75C 1U0LA 4IUQA 2XN9C 4POGA 3CCEA 1VQAA 4LMQD 1XMQQ 2XIWA 2B2UA 1EY0A 4HN7A 4L5RC 3M7GA 1ENFA 2R93B 4MTNA 4LJZC 1JWMD 4HSPA 3E9HA 3HOWH 1PTOF 1NAPA 2B2VC 1N32L 4UP8A 1EU4A 3M4PA 1L1OB 4U68A 3GTGB 2J4XA 4A3FH 5FJ8G 4KHPL 4XQQA 3KYHC 1LLRD 1MSHA 2XWJB 1IYUA 4OIKA 1GJXA 2L5TA 4WJWA 3CCQA 1N34Q 3Q23A 3PUVA 3HOWG 1WCMG 4LF9L 1TWFH 2F0KA 2IHFA 2A6EC 1B8AA 2XRSD 3J81L 3J81i 2NUCA 3MTSA 4JK1C 4MN3A 1C4QA 3Q8DA 4J6HA 1VQ8A 2SNMA 3SXHA 1N36L 1VQFA 3KFUA 2EY6A 4B3TL 1PYSB 5FLMH 1PFMA 3CP0A 3E0EA 4HTHA 1DZ1A 1Q1BA 4GLXA 1KQSA 1GVPA 3CC2A 3CC4A 4X62Q 3NTHA 3NP8A 1MBYA 2LXKA 1PZJD 4IUTA 4KHZA 4QB4A 1ML0D 3JAML 5C3EH 4HCEA 3JAMi 2NWGA 2EY5A 1LT4D 4PV1C 1X3QA 2ZTDA 4FYDA 2ZXOA 2AHOB 4A3KB 2IX1A 3ULLA 2WB1G 4IUUA 1J5EQ 1AFPA 4LAAA 2MO0A 4JI4Q 4AQYL 1YVCA 1PH4A 3S1NB 3AMUA 1QB5D 3MXNB 3VYTA 5C3EG 4CDEC 1IHZA 3FPUB 2TSSA 3TP7A 3JAME 4NB3A 1IYJB 4DV6L 2B63G 1WD1A 3RLOA 4DF7A 2F4VQ 4JW0A 1DGSA 1EY7A 3S17H 2NTTA 1V9PA 1YNJC 1XNQL 1Y1VG 3HOVG 3CAMA 2D62A 2NTSA 3F2UA 1M90C 2Z0SA 3VYRA 4ZYSA 2F0FA 5KYLA 3BG3A 2F0JA 3T53B 2NB0A 4B3SQ 4HSVA 1DONA 2ZJPA 4DR2L 2C5CA 4BS9A 3TP5A 3CXCA 1L0XB 1W6KA 4RG1A 1K83B 3L3OC 4DPGA 2Z9HA 2WACA 1D5XC 5J3BA 2AWOA 3S1QB 2IW3A 2ALYB 3C1FA 3HOXH 3JAMc 3PO3H 4IFDG 3GTJH 1Q90A 4V190 3MXPA 1ILPA 2N49A 1SNMA 2I07B 5LMNL 4IPHA 4IPCA 3BYTB 1I4HA 1ZKOA 3QR8A 3MZ5A 3OYYA 4FXDA 5DAUA 1PYBA 3OIPA 2M2LA 3BZDB 1SFOB 2EY2A 3EFXD 3GTLB 3HGBA 1PH6A 3D31A 1QVGA 4DR7Q 2CFMA 1D5MC 1K3RA 3PGZA 4O42A 1KLUD 2UUBQ 4JCVE 3ND9A 5CYUA 3HOZB 4WJ4A 3PIOA 3S15B 1CQFA 4F88A 1PLFA 3VYUA 4TVAB 5DNFA 2AUKA 1HNWL 5ISRA 2VNUD 1KLGD 4R4IA 1IBLL 2B2UC 4F7XA 2JA6H 5GAHC 2OQKA 3DEPA 2N88A 3PIPA 5E7NA 1SFOH 2DNEA 2PZWA 1CKNB 2EJGC 3R93A 1L1OA 1JB3A 2R6GA 4K2KA 4C2MH 1TWGH 2WAQB 4C3IG 4NDXA 2PO4A 2D2CC 4V0BA 3SK5A 2V1CC 3I4LA 4O1NA 2OTLA 1EU3A 4IJHA 1GUTA 1VQ9A 4I7ZC 4RHSA 1SN8A 1RIPA 4KMUC 2VXWA 1EIYB 2UUCL 2FJ2A 1IBMQ 1MD2D 3PF5A 3M4OB 1VQCA 4R8IA 2E2IH 1HNZQ 3DWQA 3B6YA 5FK9C 2Q8IB 4LF9Q 3TQYA 3IFDA 2OEOA 4DAPA 2QEXA 3R3OA 1HNWQ 3CQZB 3PSIA 4KJNA 1J6QA 3D3RA 5EPLA 1EIFA 4K8IA 4GNXB 2EYLA 4GN4B 1SNCA 2FHTA 4MIUA 3CCJA 1HUNA 3SR1A 1H95A 2LSSA 1KTKA 3BDOA 2Y0SG 2R93G 3TS0A 2K5VA 3I3CA 1Q12A 5C5MA 3NELA 3MHBA 1RTNA 1Q3LA 3VR5A 1HTPA 2A68C 1EIGA 4K0KQ 1EZ8A 2ICEC 5J1ZA 5IWAQ 4BY1B 1F9SA 2XWBB 1EY5A 1W3SA 1G6ZA 2WP8J 5FO8B 3BDCA 4TSSA 2EPBA 3KLSA 2E8GA 3E9IA 2G5DA 1X54A 2B39A 5EKKA 2MJ8A 1WTWA 1PRTC 4YWKA 1EQRA 2K7VA 1WVLA 3K57A 2FMMA 5IE8A 4XDXA 4JVZA 1VQPA 5D3DA 3G6JB 1E2WA 5DLQE 4IFDJ 5IYBH 3S2DB 3FKIB 1O7LA 2L11A 1HNXQ 1C48A 1I5FA 2AQ2B 1IBKQ 2PZTA 3CRLC 3A56A 3DMUA 1QNUA 1TWFB 2CKZB 1YITA 3M4YA 1X3PA 1T5EA 4B9XA 2MO1A 1HUMA 2KCMA 4XYQA 1I3QH 2RA4A 4Q5VA 1TWGB 3EN2A 2AQ3B 1CKOA 1AEXA 2EYHA 3KJPA 2YYZA 2CWAA 5KNBA 4R1JA 4DV5L 2F1MA 2CVRA 2SOBA 3QOJA 3ERSX 1SLJA 1WCMB 1XPRA 5JJIA 1K8MA 3HOZH 1OXSC 1CSQA 4WFN3 1SE8A 2Q2IA 3UI2A 5GQOA 1PH1A 2K52A 4DUZL 4WRDA 3C46A 1YZ6A 4LF4Q 1PRTF 3W5OA 1NSNS 1ZXTA 2K5HA 2ES2A 4IPGA 2Z1CA 3T56B 4POFA 3GTQH 1WYDA 3FPPA 1EWIA 4GOPC 1DOMA 4ID6A 3BJUA 2K4KA 1TR5A 1D5ZC 3OPOA 2WIIB 1PDQA 5JAVA 3BU2A 4FF3A 5M3FB 3CKIB 1PH3A 4ZKBB 3PIO3 1BNZA 4EQNA 3KF6A 1STEA 5H1SE 3QOLA 4R8NA 4X3TA 1X6OA 2K75A 3T1YL 3S1QH 1SJHD 4UHVA 5IYCH
chains in the Genus database with same CATH topology
3CW2C 4JI3L 1C9OA 1NMFA 2JQOA 3VDYA 2KENA 4KI0A 1K0RA 3CMAA 4DUZQ 2N78A 2KCTA 4GNXA 4JI7L 1PHJA 1L2FA 5IYCG 5GROA 5IYBG 3DLLA 4RMFA 5IP9G 4DR3Q 3S2HH 3HOYG 2RF4A 3GDEA 1C7YA 4JI1L 4DV0Q 2A1AA 3GTLH 5C4XG 5GAEC 2VUMH 5FLMG 4LFBL 2PNHA 4DAMA 2BA1A 2HIXA 4X66Q 1FL0A 1G291 3I4MH 1WCMH 2UXCQ 2JE6I 2YTXA 4A3IH 1GD7A 1CKNA 4OO1I 2OQ0A 4A3GH 4BY1H 1SRUA 3J81j 4J15A 3F2CA 5IYDG 4DAYB 4ME3A 1L0WA 3G4SA 4DR5L 4ALPA 1HNZL 4JG2A 1B70B 4PZ8A 4YY3L 3J80c 5IT9c 1VQ4A 4O2DA 2VQEL 4DV1Q 4LFBQ 4DV2L 2UXDL 2PMZE 4AQYQ 1WJJA 3M85A 1MJCA 1HR0W 1X3EA 1X55A 4DV4Q 1YBYA 2ZJQA 1G51A 2PI2A 1GKHA 3CCSA 3ER0A 1M1KC 2PQAA 3K7UC 1VQDA 2VQEQ 4BBSG 4FDBA 1K8AC 2OCEA 5JJLA 4NXNL 4JYAL 3FP9A 4QJFA 1PH9A 4R4QA 4JI3Q 4HIOA 1I94Q 5IYDH 3I2ZA 1X56A 3S16H 1Z9FA 3S2DH 2ZJRA 1IZ6A 4UY8C 1QUQA 4QY7A 5HGQA 2QA4A 4A3EH 2WAQE 5IP7G 2UUAL 1P8LA 3CCRA 4IFDI 2CWPA 3H15A 4IOCA 2JA6G 1VQJA 1KD1C 2JA5G 3AYHB 1VQEA 3PCOB 4DV3Q 4C3JH 1WI5A 4DNIA 3FKIH 4PMWA 5LMUQ 3UE0A 4JV5Q 1BBWA 4A93G 2EQSA 3HOVH 1PV4A 1QZGA 4B3RL 4OWWB 1EOVA 1U0LA 5AJ3L 3HKSA 4POGA 2JEBI 2JEAI 3RLFA 3CCEA 4JI2L 1VQAA 1JB7A 3UE1A 1KRTA 2Q2UA 2JA7G 1IL2A 3NENA 4A3CH 1XMQQ 2YU9H 4A3EG 1EFWA 3KOJA 4DUYL 4YWMA 3T1HQ 4L5RC 3H3VH 5ELNA 1YEZA 3I4MG 4KHPQ 4LF7Q 2FXQA 4MTNA 4JI5L 2JA7H 1VQ6A 3GTGH 2I5HA 3K81C 1KHIA 1XNRQ 3ULJA 2E2JH 2NVXH 3E9HA 1XMQL 5JJKA 2UUBL 3HOWH 3ICEA 4C3HH 2OTJA 1FJGQ 1LYLA 2DUDA 3PUZA 4TQUS 4BBRG 2IT1A 1N32L 4UP8A 1JT8A 4A3KH 1E24A 1GO3E 3M4PA 1L1OB 1NJIC 2NZOA 5EAYA 4APVA 4A3MG 3PO3G 1UEBA 3S1RH 2RCNA 1VQGA 2NVTH 4A3LG 2ZTCA 2AMCB 4P71A 3PUWA 5FJ8G 4X65L 4HJ5A 4A3FH 2Y0SE 3KYHC 4LFCQ 4KHPL 3RZDH 4K0KL 1L1OC 5ELOA 3KDFB 3CCQA 4GKKL 1A0IA 1N34Q 3CC7A 4LFAL 5FJ8H 3PUVA 1HR0L 3AEVA 3HOWG 1WCMG 4LF9L 2WFWA 3L0OA 1TWFH 2IHFA 1Q8KA 1B8AA 3J81i 3PO2G 1X65A 1E3PA 1CKMA 4AIMA 3STBC 1MKHA 3I56A 3H0GG 3Q8DA 4GOPB 5AJ3Q 1E7ZA 3A0JA 1CSPA 1VQ8A 2HHHL 1N36L 1Q81C 2R93H 3AFPA 4B3RQ 1VQFA 3KFUA 1D7QA 1S72A 4A3DH 4B3TL 1CUKA 1PYSB 4O0AA 5FLMH 1YHAA 1YJ9A 1KXLA 2VZAA 3CP0A 3E0EA 5FLXc 4LF7L 1IBML 1Q1BA 4DR1Q 3CPWA 4GLXA 3RN5A 1GVPA 1Y1WG 1KQSA 3CC2A 3CC4A 4L5TA 4X62Q 2ATWA 3PUXA 5LMNW 5M3FH 2LXKA 5C0XG 1X3GA 4JI8L 1N9WA 4KHZA 4A3CG 4X64L 2XGTA 5C3EH 1XJVA 1B7YB 4DV7L 3JAMi 3M4OH 4JYAQ 1GM5A 5K36G 4JOIC 4JI4Q 2ZTDA 4A3JH 2AHOB 2NVYH 2IX1A 2MQHA 3ULLA 1UWVA 3HOXG 2WB1G 4A3DG 1J5EQ 4GLAC 4LUZA 2VQFL 2MO0A 4BBRH 2N3SA 4H02A 2BA0A 5M3MH 1YVCA 5C0XI 5GAGC 4AQYL 4DR5Q 1Y1WH 1PH4A 4DV1L 1LTLA 4DV6Q 3FHWA 3GTPH 1NMGA 1QUQB 4OWTB 3MXNB 1YNXA 4A3MH 1BKBA 5C3EG 3CCUA 2EXDA 4NXNQ 4GKJL 4NB3A 1IYJB 1N34L 4DV6L 2B63G 2R7FA 5LMNQ 4YCWA 1XPUA 2D0OA 3RLOA 3GTKH 2B3GA 3S15H 2F4VQ 3CCMA 1D8LA 4JI1Q 1DGSA 2NN6G 3S17H 4BA2I 2B63H 1V9PA 1XNQL 3TEHB 4A93H 1Y1VG 3HOVG 4OO1G 3I4NG 3CAMA 2D62A 1Q7YC 1M90C 2VL6A 2Z0SA 4YHHQ 2K14A 3EIVA 4B3ML 2CCZA 2JA8H 1TWAH 4JC0A 3U4ZA 4X64Q 3T1YQ 4B3SQ 2ZJPA 4JOIA 4DK6C 4DR2L 3HOYH 4PZ7A 4GS3A 2JJQA 4MNOA 4LF8Q 4BY7H 3KLWA 4AYBE 2PI2E 3OTOQ 2E2HH 3CXCA 4BA1I 4RG1A 4XIGS 4LF6L 4DV0L 4DPGA 4PZ6A 3RR5A 1FGUA 1Q46A 5J3BA 5IP9H 2AWOA 3UDFA 4BY1G 1AH9A 4OWXB 4AYBG 1NY4A 1QVCA 1VQBA 2DGYA 2ALYB 3HOXH 3F2DA 1VQHA 4C3IH 4DR4Q 3JAMc 3PO3H 1EUJA 4IFDG 4P72A 1E1OA 3GTJH 4MZ9A 1W2BA 4HIMA 2N49A 5M3MG 1YI2A 5LMNL 4IPHA 4BY7G 3PUYA 4IPCA 3OTOL 3D0FA 3OYYA 3CD6A 2HIVA 4LFCL 4X65Q 5GADC 1PYBA 4LF4L 4IJLA 3AQQA 3HKZG 1KC8C 4JI6L 2JK8A 1JJCB 3KF6B 1OXTA 2L15A 1WOCA 1Z47A 1PH6A 3D31A 1QVGA 4DR7Q 4B3MQ 2CFMA 5M5YH 4JI4L 4JI0L 1XTDA 1K3RA 3PGZA 4YCVA 5HY6A 3J81c 3CF5A 4DV4L 5C0XJ 4JCVE 3UDGA 4A3JG 2UUBQ 4BXXH 4X6AH 1A8VA 4P74A 1JE5A 2OWOA 1HZAA 3HOUH 2F3IA 4UP9A 3I55A 1VCIA 1PH2A 4JI5Q 4JBKA 2NVQH 4WJ4A 4GN3B 3PIOA 1IBLQ 3WWVA 1Q82C 1I94L 1VQ7A 4TVAB 2E5LL 4QIWE 1HNWL 4GKJQ 4UPAA 4NPSA 2VNUD 3J7ZC 3L2PA 3M3YH 4R4IA 1T9HA 1PH5A 1IBLL 3U58A 2JA6H 1VQNA 5JEAG 5GAHC 4A4IA 2OQKA 4OX9Q 3PIPA 1UE7A 3FKIG 1X3FA 5E7NA 1SFOH 4IOAA 2IY5B 1VS0A 2F52A 1YJNA 4DK3C 1TWHH 3CQZH 2F4VL 1CKNB 4QGUA 1K8GA 1VQIA 1YIJA 1XPOA 4DR3L 1L1OA 3EBEA 3CPFA 2R6GA 2WAQG 4C2MH 1TWGH 3J7A5 3S24A 2IHEA 1EQQA 1HNXL 2K5NA 2KBNA 4UP7A 2V1CC 5BR8L 4A3GG 2PQAB 4JI6Q 5IWAL 3RN2A 2GN5A 3UDIA 1I50H 4GLVB 4IJHA 4A3KG 2OTLA 2R92G 1VQ9A 2YTVA 1SN8A 1RIPA 5C4JH 4P73A 2ASBA 1EIYB 2UUCL 1NTGA 2N8NA 3RLNA 5JEAJ 1IBMQ 2HHHQ 2BH2A 2B29A 4JI0Q 3KF8B 2RHSB 3OW2A 1PFSA 3PF5A 2JA9A 4DV2Q 4B3TQ 1I6HH 2ID0A 1Y1VH 1XMOQ 4IPDA 1VQCA 3LGJA 2E2IH 4LUVA 3T1HL 1HNZQ 4A3BG 4QQBX 1VQOA 3PV0A 3B6YA 4LF9Q 3TQYA 4DV7Q 2C35B 2QEXA 4LFAQ 4A3FG 1HNWQ 1LUZA 5C44G 3PSIA 2E5LQ 1EYGA 2H5XA 2R92H 4HIDA 2VS1A 1K9MC 1J6QA 3G6EA 3GO5A 2Z6KA 1S3OA 2I5LX 4R4CA 5M5XH 3A5ZB 4X66L 1EIFA 2AWNA 4GNXB 1JMCA 1VQLA 3GD7A 3JC66 4GN4B 4IO9A 4LUOA 2EIFA 3CCJA 4LF5L 1H95A 2UU9L 4NXMQ 1PH7A 1OTCA 2I0QA 5M5WH 1KAWA 2LSSA 1V1QA 4HJ7A 3H0GH 3W1GA 3M4QA 3J80i 2Y0SG 1C0AA 1IXRA 2R93G 3I7FA 4LF6Q 2VY3A 3TS0A 1AE3A 4JBJA 1HH2P 2K5VA 5C44H 1Q12A 5LMUL 2QGQA 4JV5L 1PA6A 1N32Q 3AFQA 4DKAC 3BZKA 3NELA 2A8VA 3CCVA 1R9TH 3S14H 2GVBA 4OXPA 2HQLA 1X9NA 4GKKQ 4R4TA 2NN6I 1SMXA 1RL2A 4K0KQ 1PVOA 3A74A 3ULPA 1VQ5A 1Q86C 5IWAQ 4PG3A 4JI2Q 3L7ZC 4DUYQ 2RHQB 4YCUA 3RNUA 1A62A 2K50A 3KDFA 1QZHA 3NBHB 1XMOL 3PF4A 1W3SA 3DM3A 3ZJYC 2WP8J 4YHHL 3F1ZA 2BH8A 3U4VA 1YHQA 1FJGL 2UXBL 1A63A 2IX0A 1E22A 2E8GA 1XNRL 3E9IA 1UE1A 1X54A 4EQ5A 4DR6Q 2UUAQ 1FVIA 4YWKA 4DV3L 3M9BA 1EQRA 1MJEA 1IBKL 4YY3Q 4LF8L 1TXYA 2YV5A 3G71A 2LXJA 2R7DA 5IE8A 3UDXA 4A3IG 1VQPA 1VQKA 3SGIA 3IRBA 3K7AH 2WB1E 5DLQE 4GOPA 1K83H 4JI8Q 2KHJA 5IYBH 4IFDJ 3K80C 5BR8Q 2Q2TA 4X62L 4OONA 2XTIA 4A3LH 1HNXQ 1N33L 3TRZA 1AE2A 1Y14B 1I5FA 1MIUA 1UE6A 2A19A 4GNXC 3TS2A 1IBKQ 2Z6KC 1J5EL 2CKZB 3G48A 4YWLA 1YITA 2VUMG 4DR6L 1TWCH 1ASZA 2VQFQ 2MO1A 2MFIA 4KLKA 3TREA 4OX9L 1N36Q 3M7NA 1UE5A 3K0XA 1N33Q 2GVAA 2KCMA 3I4OA 4DR7L 1I3QH 4DV5Q 4BBSH 1NE3A 3EN2A 1U5KA 4LWCA 4QL5A 1CKOA 2YTYA 3PO2H 4A3BH 1NBWA 1BBUA 1LM0A 1SR3A 3KJPA 4EX5A 2YYZA 5M3FG 4XTCS 3K8AA 2CWAA 4JBWA 3HFZB 4R1JA 4DV5L 3S1MH 2AKWB 3W1BA 1HZCA 2ZM6Q 3ERSX 1SLJA 3U50C 3F2BA 1XPRA 2JA5H 3GTOH 5JJIA 2R7ZG 1OXSC 2Q2HA 1O7IA 1CSQA 1HZBA 3CMEA 3HOZH 1SE8A 2Q2IA 3MEFA 3F8TA 2HT1A 4DR4L 5GQOA 1HZ9A 1PH1A 2UXBQ 2K52A 4DUZL 2R7ZH 3GTMH 3HOZG 1Q1EA 1OXXK 2NZHA 3S1NH 1YZ6A 4LF4Q 3NEMA 1HR0Q 1QVFA 3W5OA 5IP7H 2K5HA 2D0PA 5IY0A 1KRSA 2ES2A 2ZTEA 4IPGA 4WJ3M 4LW1A 2UXCL 1P16A 4DR1L 4POFA 3GTQH 1WYDA 1EWIA 4GOPC 1PH8A 3CCLA 1SROA 3H3VI 1V43A 1OXUA 3BJUA 4R4OA 2I5MX 4Y7NH 2K4KA 4HJAA 3HOUG 3RZOH 4GN5A 4HJ8A 4HIKA 3BZCA 4A75A 2UXDQ 1S40A 3BU2A 2MNAA 4JBMA 4L5QA 1PH3A 3A5UA 1N8RC 1JJGA 1KIXA 4Y52H 1OXVA 1VQMA 3KJOA 4JI7Q 4BXXG 4A76A 4LF5Q 3KF6A 4LNQA 1HJPA 4L5SA 1JJ2A 1XNQQ 1ASYA 1BVSA 4P75A 1YHBA 3HKZE 5H1SE 2JA8G 2UU9Q 4NXML 3STBD 5C4XH 2VW9A 2UUCQ 2ZM6L 4DR2Q 2CQOA 5IYCH 1WFQA 1K73C 1KL9A 1YJWA 3I4NH 1G6PA 1X6OA 2K75A 3T1YL 4B3SL 3S1QH 4AH6A 1E1TA 2KHIA 4HJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CW2 C;  4JI3 L;  1C9O A;  1NMF A;  2JQO A;  3VDY A;  2KEN A;  4KI0 A;  1K0R A;  3CMA A;  4DUZ Q;  2N78 A;  2KCT A;  4GNX A;  4JI7 L;  1PHJ A;  1L2F A;  5IYC G;  5GRO A;  5IYB G;  3DLL A;  4RMF A;  5IP9 G;  4DR3 Q;  3S2H H;  3HOY G;  2RF4 A;  3GDE A;  1C7Y A;  4JI1 L;  4DV0 Q;  2A1A A;  3GTL H;  5C4X G;  5GAE C;  2VUM H;  5FLM G;  4LFB L;  2PNH A;  4DAM A;  2BA1 A;  2HIX A;  4X66 Q;  1FL0 A;  1G29 1;  3I4M H;  1WCM H;  2UXC Q;  2JE6 I;  2YTX A;  4A3I H;  1GD7 A;  1CKN A;  4OO1 I;  2OQ0 A;  4A3G H;  4BY1 H;  1SRU A;  3J81 j;  4J15 A;  3F2C A;  5IYD G;  4DAY B;  4ME3 A;  1L0W A;  3G4S A;  4DR5 L;  4ALP A;  1HNZ L;  4JG2 A;  1B70 B;  4PZ8 A;  4YY3 L;  3J80 c;  5IT9 c;  1VQ4 A;  4O2D A;  2VQE L;  4DV1 Q;  4LFB Q;  4DV2 L;  2UXD L;  2PMZ E;  4AQY Q;  1WJJ A;  3M85 A;  1MJC A;  1HR0 W;  1X3E A;  1X55 A;  4DV4 Q;  1YBY A;  2ZJQ A;  1G51 A;  2PI2 A;  1GKH A;  3CCS A;  3ER0 A;  1M1K C;  2PQA A;  3K7U C;  1VQD A;  2VQE Q;  4BBS G;  4FDB A;  1K8A C;  2OCE A;  5JJL A;  4NXN L;  4JYA L;  3FP9 A;  4QJF A;  1PH9 A;  4R4Q A;  4JI3 Q;  4HIO A;  1I94 Q;  5IYD H;  3I2Z A;  1X56 A;  3S16 H;  1Z9F A;  3S2D H;  2ZJR A;  1IZ6 A;  4UY8 C;  1QUQ A;  4QY7 A;  5HGQ A;  2QA4 A;  4A3E H;  2WAQ E;  5IP7 G;  2UUA L;  1P8L A;  3CCR A;  4IFD I;  2CWP A;  3H15 A;  4IOC A;  2JA6 G;  1VQJ A;  1KD1 C;  2JA5 G;  3AYH B;  1VQE A;  3PCO B;  4DV3 Q;  4C3J H;  1WI5 A;  4DNI A;  3FKI H;  4PMW A;  5LMU Q;  3UE0 A;  4JV5 Q;  1BBW A;  4A93 G;  2EQS A;  3HOV H;  1PV4 A;  1QZG A;  4B3R L;  4OWW B;  1EOV A;  1U0L A;  5AJ3 L;  3HKS A;  4POG A;  2JEB I;  2JEA I;  3RLF A;  3CCE A;  4JI2 L;  1VQA A;  1JB7 A;  3UE1 A;  1KRT A;  2Q2U A;  2JA7 G;  1IL2 A;  3NEN A;  4A3C H;  1XMQ Q;  2YU9 H;  4A3E G;  1EFW A;  3KOJ A;  4DUY L;  4YWM A;  3T1H Q;  4L5R C;  3H3V H;  5ELN A;  1YEZ A;  3I4M G;  4KHP Q;  4LF7 Q;  2FXQ A;  4MTN A;  4JI5 L;  2JA7 H;  1VQ6 A;  3GTG H;  2I5H A;  3K81 C;  1KHI A;  1XNR Q;  3ULJ A;  2E2J H;  2NVX H;  3E9H A;  1XMQ L;  5JJK A;  2UUB L;  3HOW H;  3ICE A;  4C3H H;  2OTJ A;  1FJG Q;  1LYL A;  2DUD A;  3PUZ A;  4TQU S;  4BBR G;  2IT1 A;  1N32 L;  4UP8 A;  1JT8 A;  4A3K H;  1E24 A;  1GO3 E;  3M4P A;  1L1O B;  1NJI C;  2NZO A;  5EAY A;  4APV A;  4A3M G;  3PO3 G;  1UEB A;  3S1R H;  2RCN A;  1VQG A;  2NVT H;  4A3L G;  2ZTC A;  2AMC B;  4P71 A;  3PUW A;  5FJ8 G;  4X65 L;  4HJ5 A;  4A3F H;  2Y0S E;  3KYH C;  4LFC Q;  4KHP L;  3RZD H;  4K0K L;  1L1O C;  5ELO A;  3KDF B;  3CCQ A;  4GKK L;  1A0I A;  1N34 Q;  3CC7 A;  4LFA L;  5FJ8 H;  3PUV A;  1HR0 L;  3AEV A;  3HOW G;  1WCM G;  4LF9 L;  2WFW A;  3L0O A;  1TWF H;  2IHF A;  1Q8K A;  1B8A A;  3J81 i;  3PO2 G;  1X65 A;  1E3P A;  1CKM A;  4AIM A;  3STB C;  1MKH A;  3I56 A;  3H0G G;  3Q8D A;  4GOP B;  5AJ3 Q;  1E7Z A;  3A0J A;  1CSP A;  1VQ8 A;  2HHH L;  1N36 L;  1Q81 C;  2R93 H;  3AFP A;  4B3R Q;  1VQF A;  3KFU A;  1D7Q A;  1S72 A;  4A3D H;  4B3T L;  1CUK A;  1PYS B;  4O0A A;  5FLM H;  1YHA A;  1YJ9 A;  1KXL A;  2VZA A;  3CP0 A;  3E0E A;  5FLX c;  4LF7 L;  1IBM L;  1Q1B A;  4DR1 Q;  3CPW A;  4GLX A;  3RN5 A;  1GVP A;  1Y1W G;  1KQS A;  3CC2 A;  3CC4 A;  4L5T A;  4X62 Q;  2ATW A;  3PUX A;  5LMN W;  5M3F H;  2LXK A;  5C0X G;  1X3G A;  4JI8 L;  1N9W A;  4KHZ A;  4A3C G;  4X64 L;  2XGT A;  5C3E H;  1XJV A;  1B7Y B;  4DV7 L;  3JAM i;  3M4O H;  4JYA Q;  1GM5 A;  5K36 G;  4JOI C;  4JI4 Q;  2ZTD A;  4A3J H;  2AHO B;  2NVY H;  2IX1 A;  2MQH A;  3ULL A;  1UWV A;  3HOX G;  2WB1 G;  4A3D G;  1J5E Q;  4GLA C;  4LUZ A;  2VQF L;  2MO0 A;  4BBR H;  2N3S A;  4H02 A;  2BA0 A;  5M3M H;  1YVC A;  5C0X I;  5GAG C;  4AQY L;  4DR5 Q;  1Y1W H;  1PH4 A;  4DV1 L;  1LTL A;  4DV6 Q;  3FHW A;  3GTP H;  1NMG A;  1QUQ B;  4OWT B;  3MXN B;  1YNX A;  4A3M H;  1BKB A;  5C3E G;  3CCU A;  2EXD A;  4NXN Q;  4GKJ L;  4NB3 A;  1IYJ B;  1N34 L;  4DV6 L;  2B63 G;  2R7F A;  5LMN Q;  4YCW A;  1XPU A;  2D0O A;  3RLO A;  3GTK H;  2B3G A;  3S15 H;  2F4V Q;  3CCM A;  1D8L A;  4JI1 Q;  1DGS A;  2NN6 G;  3S17 H;  4BA2 I;  2B63 H;  1V9P A;  1XNQ L;  3TEH B;  4A93 H;  1Y1V G;  3HOV G;  4OO1 G;  3I4N G;  3CAM A;  2D62 A;  1Q7Y C;  1M90 C;  2VL6 A;  2Z0S A;  4YHH Q;  2K14 A;  3EIV A;  4B3M L;  2CCZ A;  2JA8 H;  1TWA H;  4JC0 A;  3U4Z A;  4X64 Q;  3T1Y Q;  4B3S Q;  2ZJP A;  4JOI A;  4DK6 C;  4DR2 L;  3HOY H;  4PZ7 A;  4GS3 A;  2JJQ A;  4MNO A;  4LF8 Q;  4BY7 H;  3KLW A;  4AYB E;  2PI2 E;  3OTO Q;  2E2H H;  3CXC A;  4BA1 I;  4RG1 A;  4XIG S;  4LF6 L;  4DV0 L;  4DPG A;  4PZ6 A;  3RR5 A;  1FGU A;  1Q46 A;  5J3B A;  5IP9 H;  2AWO A;  3UDF A;  4BY1 G;  1AH9 A;  4OWX B;  4AYB G;  1NY4 A;  1QVC A;  1VQB A;  2DGY A;  2ALY B;  3HOX H;  3F2D A;  1VQH A;  4C3I H;  4DR4 Q;  3JAM c;  3PO3 H;  1EUJ A;  4IFD G;  4P72 A;  1E1O A;  3GTJ H;  4MZ9 A;  1W2B A;  4HIM A;  2N49 A;  5M3M G;  1YI2 A;  5LMN L;  4IPH A;  4BY7 G;  3PUY A;  4IPC A;  3OTO L;  3D0F A;  3OYY A;  3CD6 A;  2HIV A;  4LFC L;  4X65 Q;  5GAD C;  1PYB A;  4LF4 L;  4IJL A;  3AQQ A;  3HKZ G;  1KC8 C;  4JI6 L;  2JK8 A;  1JJC B;  3KF6 B;  1OXT A;  2L15 A;  1WOC A;  1Z47 A;  1PH6 A;  3D31 A;  1QVG A;  4DR7 Q;  4B3M Q;  2CFM A;  5M5Y H;  4JI4 L;  4JI0 L;  1XTD A;  1K3R A;  3PGZ A;  4YCV A;  5HY6 A;  3J81 c;  3CF5 A;  4DV4 L;  5C0X J;  4JCV E;  3UDG A;  4A3J G;  2UUB Q;  4BXX H;  4X6A H;  1A8V A;  4P74 A;  1JE5 A;  2OWO A;  1HZA A;  3HOU H;  2F3I A;  4UP9 A;  3I55 A;  1VCI A;  1PH2 A;  4JI5 Q;  4JBK A;  2NVQ H;  4WJ4 A;  4GN3 B;  3PIO A;  1IBL Q;  3WWV A;  1Q82 C;  1I94 L;  1VQ7 A;  4TVA B;  2E5L L;  4QIW E;  1HNW L;  4GKJ Q;  4UPA A;  4NPS A;  2VNU D;  3J7Z C;  3L2P A;  3M3Y H;  4R4I A;  1T9H A;  1PH5 A;  1IBL L;  3U58 A;  2JA6 H;  1VQN A;  5JEA G;  5GAH C;  4A4I A;  2OQK A;  4OX9 Q;  3PIP A;  1UE7 A;  3FKI G;  1X3F A;  5E7N A;  1SFO H;  4IOA A;  2IY5 B;  1VS0 A;  2F52 A;  1YJN A;  4DK3 C;  1TWH H;  3CQZ H;  2F4V L;  1CKN B;  4QGU A;  1K8G A;  1VQI A;  1YIJ A;  1XPO A;  4DR3 L;  1L1O A;  3EBE A;  3CPF A;  2R6G A;  2WAQ G;  4C2M H;  1TWG H;  3J7A 5;  3S24 A;  2IHE A;  1EQQ A;  1HNX L;  2K5N A;  2KBN A;  4UP7 A;  2V1C C;  5BR8 L;  4A3G G;  2PQA B;  4JI6 Q;  5IWA L;  3RN2 A;  2GN5 A;  3UDI A;  1I50 H;  4GLV B;  4IJH A;  4A3K G;  2OTL A;  2R92 G;  1VQ9 A;  2YTV A;  1SN8 A;  1RIP A;  5C4J H;  4P73 A;  2ASB A;  1EIY B;  2UUC L;  1NTG A;  2N8N A;  3RLN A;  5JEA J;  1IBM Q;  2HHH Q;  2BH2 A;  2B29 A;  4JI0 Q;  3KF8 B;  2RHS B;  3OW2 A;  1PFS A;  3PF5 A;  2JA9 A;  4DV2 Q;  4B3T Q;  1I6H H;  2ID0 A;  1Y1V H;  1XMO Q;  4IPD A;  1VQC A;  3LGJ A;  2E2I H;  4LUV A;  3T1H L;  1HNZ Q;  4A3B G;  4QQB X;  1VQO A;  3PV0 A;  3B6Y A;  4LF9 Q;  3TQY A;  4DV7 Q;  2C35 B;  2QEX A;  4LFA Q;  4A3F G;  1HNW Q;  1LUZ A;  5C44 G;  3PSI A;  2E5L Q;  1EYG A;  2H5X A;  2R92 H;  4HID A;  2VS1 A;  1K9M C;  1J6Q A;  3G6E A;  3GO5 A;  2Z6K A;  1S3O A;  2I5L X;  4R4C A;  5M5X H;  3A5Z B;  4X66 L;  1EIF A;  2AWN A;  4GNX B;  1JMC A;  1VQL A;  3GD7 A;  3JC6 6;  4GN4 B;  4IO9 A;  4LUO A;  2EIF A;  3CCJ A;  4LF5 L;  1H95 A;  2UU9 L;  4NXM Q;  1PH7 A;  1OTC A;  2I0Q A;  5M5W H;  1KAW A;  2LSS A;  1V1Q A;  4HJ7 A;  3H0G H;  3W1G A;  3M4Q A;  3J80 i;  2Y0S G;  1C0A A;  1IXR A;  2R93 G;  3I7F A;  4LF6 Q;  2VY3 A;  3TS0 A;  1AE3 A;  4JBJ A;  1HH2 P;  2K5V A;  5C44 H;  1Q12 A;  5LMU L;  2QGQ A;  4JV5 L;  1PA6 A;  1N32 Q;  3AFQ A;  4DKA C;  3BZK A;  3NEL A;  2A8V A;  3CCV A;  1R9T H;  3S14 H;  2GVB A;  4OXP A;  2HQL A;  1X9N A;  4GKK Q;  4R4T A;  2NN6 I;  1SMX A;  1RL2 A;  4K0K Q;  1PVO A;  3A74 A;  3ULP A;  1VQ5 A;  1Q86 C;  5IWA Q;  4PG3 A;  4JI2 Q;  3L7Z C;  4DUY Q;  2RHQ B;  4YCU A;  3RNU A;  1A62 A;  2K50 A;  3KDF A;  1QZH A;  3NBH B;  1XMO L;  3PF4 A;  1W3S A;  3DM3 A;  3ZJY C;  2WP8 J;  4YHH L;  3F1Z A;  2BH8 A;  3U4V A;  1YHQ A;  1FJG L;  2UXB L;  1A63 A;  2IX0 A;  1E22 A;  2E8G A;  1XNR L;  3E9I A;  1UE1 A;  1X54 A;  4EQ5 A;  4DR6 Q;  2UUA Q;  1FVI A;  4YWK A;  4DV3 L;  3M9B A;  1EQR A;  1MJE A;  1IBK L;  4YY3 Q;  4LF8 L;  1TXY A;  2YV5 A;  3G71 A;  2LXJ A;  2R7D A;  5IE8 A;  3UDX A;  4A3I G;  1VQP A;  1VQK A;  3SGI A;  3IRB A;  3K7A H;  2WB1 E;  5DLQ E;  4GOP A;  1K83 H;  4JI8 Q;  2KHJ A;  5IYB H;  4IFD J;  3K80 C;  5BR8 Q;  2Q2T A;  4X62 L;  4OON A;  2XTI A;  4A3L H;  1HNX Q;  1N33 L;  3TRZ A;  1AE2 A;  1Y14 B;  1I5F A;  1MIU A;  1UE6 A;  2A19 A;  4GNX C;  3TS2 A;  1IBK Q;  2Z6K C;  1J5E L;  2CKZ B;  3G48 A;  4YWL A;  1YIT A;  2VUM G;  4DR6 L;  1TWC H;  1ASZ A;  2VQF Q;  2MO1 A;  2MFI A;  4KLK A;  3TRE A;  4OX9 L;  1N36 Q;  3M7N A;  1UE5 A;  3K0X A;  1N33 Q;  2GVA A;  2KCM A;  3I4O A;  4DR7 L;  1I3Q H;  4DV5 Q;  4BBS H;  1NE3 A;  3EN2 A;  1U5K A;  4LWC A;  4QL5 A;  1CKO A;  2YTY A;  3PO2 H;  4A3B H;  1NBW A;  1BBU A;  1LM0 A;  1SR3 A;  3KJP A;  4EX5 A;  2YYZ A;  5M3F G;  4XTC S;  3K8A A;  2CWA A;  4JBW A;  3HFZ B;  4R1J A;  4DV5 L;  3S1M H;  2AKW B;  3W1B A;  1HZC A;  2ZM6 Q;  3ERS X;  1SLJ A;  3U50 C;  3F2B A;  1XPR A;  2JA5 H;  3GTO H;  5JJI A;  2R7Z G;  1OXS C;  2Q2H A;  1O7I A;  1CSQ A;  1HZB A;  3CME A;  3HOZ H;  1SE8 A;  2Q2I A;  3MEF A;  3F8T A;  2HT1 A;  4DR4 L;  5GQO A;  1HZ9 A;  1PH1 A;  2UXB Q;  2K52 A;  4DUZ L;  2R7Z H;  3GTM H;  3HOZ G;  1Q1E A;  1OXX K;  2NZH A;  3S1N H;  1YZ6 A;  4LF4 Q;  3NEM A;  1HR0 Q;  1QVF A;  3W5O A;  5IP7 H;  2K5H A;  2D0P A;  5IY0 A;  1KRS A;  2ES2 A;  2ZTE A;  4IPG A;  4WJ3 M;  4LW1 A;  2UXC L;  1P16 A;  4DR1 L;  4POF A;  3GTQ H;  1WYD A;  1EWI A;  4GOP C;  1PH8 A;  3CCL A;  1SRO A;  3H3V I;  1V43 A;  1OXU A;  3BJU A;  4R4O A;  2I5M X;  4Y7N H;  2K4K A;  4HJA A;  3HOU G;  3RZO H;  4GN5 A;  4HJ8 A;  4HIK A;  3BZC A;  4A75 A;  2UXD Q;  1S40 A;  3BU2 A;  2MNA A;  4JBM A;  4L5Q A;  1PH3 A;  3A5U A;  1N8R C;  1JJG A;  1KIX A;  4Y52 H;  1OXV A;  1VQM A;  3KJO A;  4JI7 Q;  4BXX G;  4A76 A;  4LF5 Q;  3KF6 A;  4LNQ A;  1HJP A;  4L5S A;  1JJ2 A;  1XNQ Q;  1ASY A;  1BVS A;  4P75 A;  1YHB A;  3HKZ E;  5H1S E;  2JA8 G;  2UU9 Q;  4NXM L;  3STB D;  5C4X H;  2VW9 A;  2UUC Q;  2ZM6 L;  4DR2 Q;  2CQO A;  5IYC H;  1WFQ A;  1K73 C;  1KL9 A;  1YJW A;  3I4N H;  1G6P A;  1X6O A;  2K75 A;  3T1Y L;  4B3S L;  3S1Q H;  4AH6 A;  1E1T A;  2KHI A;  4HJ9 A; 
#chains in the Genus database with same CATH topology
 1EY6 A;  4JI3 L;  3MXG A;  3VDY A;  1YNN D;  1B9M A;  1STH A;  2E74 C;  2HCI A;  2KCT A;  2KEC A;  3FEW X;  1WTP A;  1PHJ A;  4DA2 A;  1V8Q A;  3HOY G;  3E0J A;  3RZD B;  1BCP C;  5KRU A;  4LFB L;  5M3M B;  1KDB A;  1Y1W B;  4X66 Q;  2L9H A;  4XQJ A;  1FL0 A;  2QKI C;  2JE6 I;  4KK7 A;  4A3I H;  1GD7 A;  3H0G B;  2OQ0 A;  2JYO A;  4Z9C B;  4BY1 H;  2QF7 A;  5K36 H;  4JG2 A;  3FVQ A;  4PZ8 A;  1VQ4 A;  3GTO B;  4DV2 L;  1EYC A;  2PMZ E;  2WV6 D;  4EVO A;  4ZCK A;  1MJC A;  3M85 A;  4H44 C;  1GKH A;  3CCS A;  1FYC A;  3K7U C;  2PMZ B;  1BDO A;  1SE2 A;  3P1H A;  2A74 C;  4QJF A;  3SK4 A;  4KN7 C;  4NP5 A;  1A3T A;  4C3J B;  3WOF A;  4QY7 A;  2FFK B;  2QA4 A;  4A3E H;  1HA6 A;  5IP7 G;  3T51 B;  2UUA L;  1HFG A;  2G9D A;  2PZU A;  3H15 A;  2JA6 G;  4J1M A;  1KD1 C;  1YNN C;  2QIL A;  5E4W C;  3D4D A;  1WI5 A;  1EQV A;  1WTR A;  4KD3 A;  4A93 G;  1BOS A;  4OO1 H;  1R9T B;  2JXM B;  4FF4 A;  2JEB I;  1JB7 A;  2F0E A;  2DJG C;  3MA2 B;  3P7J A;  4CKC A;  1XTC D;  5DEH A;  4A3E G;  2AUJ D;  4YWM A;  1GHJ A;  3H3V H;  5ELN A;  4LF7 Q;  1VQ6 A;  3GTG H;  3DEO A;  4NW2 A;  2I5H A;  2F0P A;  3H09 A;  1ET6 A;  3ITP A;  1KHI A;  3PQI A;  2EY1 A;  3BVG A;  5JJK A;  1LTI D;  4C3H H;  2X6L A;  3D6W A;  2DUD A;  4BBR G;  5FO7 B;  3HKZ B;  1JT8 A;  4HED A;  3Q22 A;  3V96 A;  1F9Q A;  1NJI C;  1GXD C;  2NZO A;  3T4A C;  4A3M G;  5FOB B;  2K01 A;  3HEJ A;  2RCN A;  3MEH A;  1VQG A;  5ELC A;  4A3F B;  2ZTC A;  2AMC B;  2NVT H;  3PUW A;  4K0K L;  3RMH A;  1ONL A;  1A0I A;  4LFA L;  2CW0 D;  2EDG A;  3L0O A;  1Q8K A;  3PO2 G;  4AIM A;  4OEL B;  3A0J A;  2R93 H;  4C3J G;  4B3R Q;  1CA6 A;  1D7Q A;  1S72 A;  1I6H B;  3I91 A;  1YHA A;  5HUR A;  1KXL A;  1IBM L;  4DR1 Q;  1Y1W G;  1SMY D;  3PUX A;  3MAQ A;  2XSC A;  1F9P A;  5FKA C;  4JI8 L;  4A3C G;  2XGT A;  3DUZ A;  3K58 A;  1B7Y B;  1GHK A;  1GM5 A;  4JOI C;  3GV6 A;  1U4L A;  4A3J H;  2MQH A;  3OSO A;  5K5P A;  5CGK A;  4A3I B;  4LUZ A;  1I4G A;  2N3S A;  1Y1W H;  5C0X I;  5M3M H;  5GAG C;  1ET9 A;  5JPM C;  3R8B A;  4DR5 Q;  1NMG A;  1QUQ B;  3I70 A;  1F9R A;  4NXN Q;  1AW7 A;  3A7A B;  1YNJ D;  3FMC A;  3O13 A;  3VA7 A;  1Y8P B;  5LMN Q;  2AQ1 B;  1UUP A;  2IX3 A;  5IGB A;  3CCM A;  3R2T A;  4JI1 Q;  2RDG A;  2NN6 G;  1RDP D;  2X6G A;  4DAV A;  3H91 A;  3TEH B;  3TN2 A;  2F0Q A;  3I4N G;  1EYA A;  1NCV A;  2VL6 A;  4IN3 A;  2K14 A;  4YHH Q;  5J22 A;  1FGB D;  3MFY A;  3U4Z A;  3NBI A;  3NWS A;  4DK6 C;  4MNO A;  4KKT A;  4CDC C;  1PZI D;  4AYB E;  2K05 A;  2PI2 E;  5IIF A;  2E2H H;  4HMI A;  4XXE A;  1B9N A;  4DV0 L;  4PZ6 A;  3RR5 A;  1Q46 A;  1FNV A;  4OWX B;  4AYB G;  1IW7 D;  1JE4 A;  1VQB A;  2DGY A;  1PTO B;  3F2D A;  1VQH A;  4DR4 Q;  1EUJ A;  4UAI A;  1E1O A;  1STY A;  1LTG D;  3D0F A;  1AZP A;  3CD6 A;  4IJL A;  3AQQ A;  3HKZ G;  4JI6 L;  1S5B D;  1LTS D;  2L15 A;  2K28 A;  5EPJ A;  2B8F A;  2B2Y A;  2SDF A;  5M5Y H;  4JI4 L;  4JI0 L;  3J81 c;  5HY6 A;  4YCV A;  3WOE A;  3CF5 A;  5C0X J;  4X6A H;  4RGT A;  1A8V A;  1ICF B;  4P74 A;  1JE5 A;  4CHT B;  1HZA A;  2F3I A;  2BDO A;  1VCI A;  2R61 A;  2IWH A;  1MI2 A;  4HR7 B;  3I4N B;  1I94 L;  1VQ7 A;  4A3B B;  4QIW E;  1QCB D;  3VYS A;  2RVL A;  3M3Y H;  1KNA A;  5JEA G;  3NTK A;  4A4I A;  5LL6 S;  4OX9 Q;  1WTO A;  5JPN C;  3FKI G;  4IOA A;  2IY5 B;  1PXU A;  2F52 A;  1YJN A;  2D9U A;  2F4V L;  1K8G A;  1CHP D;  3MVV A;  3WDN A;  4Y7N B;  3EBE A;  2RSN A;  1JOR A;  5CV8 A;  3J7A 5;  3VR2 A;  3S24 A;  2VB2 X;  3EQL C;  4QCL A;  1PTO C;  1ROD A;  3HOY B;  5BR8 L;  2MP1 A;  3RN2 A;  2GN5 A;  3UDI A;  1KAA A;  5JEA H;  1K0S A;  2DJF C;  1UNS A;  5JEA J;  3KF8 B;  2JA9 A;  4DV2 Q;  1ZYR D;  4B3T Q;  1Y1V H;  4BY7 B;  1XMO Q;  3Q6S A;  4LUV A;  1LT3 D;  4ME5 A;  2N55 A;  4QQB X;  1VQO A;  1I4X A;  1CFM A;  1K28 A;  2C35 B;  3E5S A;  1LUZ A;  1TWH B;  3EA6 A;  2E5L Q;  1EYG A;  2K32 A;  2RKS A;  4HID A;  1K9M C;  4OEM B;  4RWS C;  1S3O A;  2I5L X;  4X66 L;  2AWN A;  3GD7 A;  3JC6 6;  4IO9 A;  2P5Z X;  4LUO A;  1RJT A;  4LF5 L;  4NXM Q;  1PH7 A;  1OTC A;  5M5W H;  1Q8I A;  5IGE A;  3H0G H;  3J80 L;  3M4Q A;  3J80 i;  3TP6 A;  2A68 D;  4LF6 Q;  2VY3 A;  4JBJ A;  1HH2 P;  2K5Q A;  4JV5 L;  2QGQ A;  4N8X 1;  1N32 Q;  1TKW B;  2F0O A;  3NBH A;  4ODG A;  3BZK A;  1GUG A;  3CCV A;  2A8V A;  4OXP A;  2HQL A;  1X9N A;  1SND A;  3GP7 A;  1SMX A;  2ENB A;  3N52 A;  3GV3 A;  4PNY A;  3ULP A;  2WIN B;  4PG3 A;  3L7Z C;  5EPK A;  2QCP X;  2F0U A;  1JCK B;  1QZH A;  1WTH A;  1XMO L;  3DM3 A;  4MTK A;  2KVM A;  3F1Z A;  3U4V A;  3VR4 A;  1QJO A;  5BN5 A;  4EQ5 A;  3IL8 A;  1IBK L;  2C9O A;  4RGN A;  1M8A A;  4A3D B;  4DFA A;  1VQK A;  3QJY A;  4GOP A;  2KHJ A;  3K80 C;  5KYI A;  4G7H C;  1HQR D;  2CH4 A;  2JP1 A;  2A6E D;  1N33 L;  5I9P A;  4IUR A;  4JPB W;  4GNX C;  1KAB A;  4PQX A;  4RA8 A;  3I8Z A;  2SNS A;  4YWL A;  4CJ2 C;  1SAP A;  4OX9 L;  2MFI A;  2NBF A;  1UE5 A;  3K0X A;  2JA8 B;  2HCC A;  2GVA A;  1JOQ A;  2OF1 A;  4DV5 Q;  3C1E A;  1NE3 A;  2YTY A;  1U4P A;  1ESR A;  1SR3 A;  2YU9 B;  4XTC S;  1GOZ A;  2HQE A;  2PW5 A;  4ZQ3 A;  2JSO A;  1A6X A;  3ERO A;  3U50 C;  3GTO H;  4U67 3;  4QUC A;  1HZB A;  1SYD A;  4B08 A;  2IL8 A;  4DR4 L;  2KJX A;  3F8T A;  4K6D A;  5JOB A;  1HZ9 A;  1SNO A;  3GTP B;  2F3V A;  2OXP A;  3PO3 B;  4C1N K;  3E3X A;  3NEM A;  1HR0 Q;  1PMR A;  4CGY B;  2MHV A;  1KRS A;  1LAB A;  1P16 A;  3S1M B;  1BBX C;  1SRO A;  3H3V I;  1OXU A;  4FVM A;  1SBB B;  1VDZ A;  4Y7N H;  3HOU G;  3RZO H;  3BZC A;  2H1E A;  4JBM A;  1WTQ A;  3KJO A;  1FNW A;  4BXX G;  4K5V A;  4J8Q A;  4KY7 A;  1ASY A;  1J9O A;  4P75 A;  1LT5 D;  3HKZ E;  2NVY B;  2EYM A;  1ENC A;  2B8G A;  2Z8L A;  5CV4 A;  4NXM L;  3X3M A;  3W3A A;  4ZLT F;  1STA A;  2UUC Q;  2ZM6 L;  1CZW A;  2CQO A;  3AU7 A;  3I4N H;  5E3F A;  4AH6 A;  1BBW A;  2KHI A;  4ULL A;  3T1H L;  2IPK D;  2WB1 B;  3CW2 C;  4BWG B;  1TQO A;  1C9O A;  1NMF A;  2KEN A;  4GNX A;  3ND8 A;  5IYB G;  5M5Y B;  3DLL A;  4RMF A;  1BUV T;  3NUC A;  3ZYY X;  4JI1 L;  4DV0 Q;  3GTQ B;  3Q0A A;  3OWF A;  1AZQ A;  1EFI D;  2PNH A;  5A35 A;  4DAM A;  2UXC Q;  1HRJ A;  4OO1 I;  1CKN A;  2DNC A;  4J15 A;  3D6C A;  5IGC A;  4DR5 L;  3TSS A;  4ALP A;  1HNZ L;  4IFD H;  1RTO A;  4DV1 Q;  1SSO A;  2B2Y C;  1B53 A;  1WJJ A;  1HR0 W;  1X55 A;  3U9S A;  4PMC A;  2ZJQ A;  1G51 A;  4RGO S;  2L0C A;  2E2H B;  1H9J A;  4TRD A;  5COR A;  1M1K C;  2VQE Q;  1CM9 A;  2BE5 D;  4NXN L;  4JYA L;  3FP9 A;  2A73 B;  1S5D D;  3DM1 A;  4BBR B;  3S16 H;  3J7Y W;  1TS2 A;  5M5X B;  4ABN A;  1XWE A;  2CWP A;  3GTM B;  2R7Z B;  5IGG A;  4IOC A;  3QWN A;  5IOC A;  3AYH B;  3PCO B;  1CA5 A;  2RDH A;  3S16 B;  3KUP A;  4DNI A;  3FKI H;  5LMU Q;  3GQB A;  1D6E C;  3TME A;  1QZG A;  1PV4 A;  4OWW B;  5KNC A;  1EOV A;  5AJ3 L;  3HKS A;  2QW7 A;  3RLF A;  4JI2 L;  3UE1 A;  1KRT A;  2Q2U A;  3NEN A;  4FF1 A;  5CMD A;  3KOJ A;  5L37 A;  4HCS A;  1IW7 C;  4DK0 A;  1DXM A;  1EEF D;  3I4M G;  2FXQ A;  2JA7 H;  1CTM A;  3AB9 A;  3S1R B;  3K81 C;  3C2P A;  3ULJ A;  2NVX H;  1XNR Q;  4M8A A;  2UUB L;  3DXJ C;  2EYP A;  4L8J A;  3H6M A;  2MGS A;  1GO3 E;  2JN4 A;  1Y8O B;  5EAY A;  2E2J B;  3BVZ A;  3CHB D;  2F0G A;  1T5X D;  1CZG A;  1GUO A;  1I4Q A;  3OMC A;  4A3L G;  1Y1V B;  3RD4 A;  4UDU C;  4G7O C;  1VF7 A;  1HR0 L;  2Q8R E;  1B2T A;  5DM6 3;  4QIW B;  2WFW A;  2K04 A;  1JWU D;  1EY8 A;  1E3P A;  2F0M A;  2EYO A;  1MKH A;  3HOU B;  3H0G G;  5AJ3 Q;  1E7Z A;  5C3E B;  3V2T A;  2HHH L;  1Q81 C;  1QE6 A;  4ZAI A;  2A6H D;  1YJ9 A;  1TS4 A;  2VZA A;  1H9M A;  1SXT A;  2PW7 A;  4LF7 L;  2A69 D;  1Y8N B;  4R9W A;  4K14 A;  5LMN W;  1RCV D;  1X3G A;  1N9W A;  2NVT B;  3HOV B;  4DV7 L;  3M4O H;  1LO5 D;  1FD7 D;  4JYA Q;  5K36 G;  2K33 A;  1QG7 A;  2F0S A;  2NVY H;  1UWV A;  3HOX G;  5IT9 L;  5IT9 E;  1K3B C;  1EWC A;  2VQF L;  1F77 A;  4H02 A;  4DV1 L;  3GTP H;  4DV6 Q;  3FHW A;  3NHH A;  4OWT B;  1RKN A;  3CCU A;  2EXD A;  3S17 B;  1N34 L;  3MXU A;  2OT2 A;  3L9A X;  2RQX A;  2R7F A;  3GTK H;  4CBV A;  3HOW B;  3K6O A;  4A93 H;  4OO1 G;  1Q7Y C;  2K1B A;  4C3H G;  3EIV A;  2CQA A;  5KND A;  2LKV A;  2F0N A;  2CCZ A;  4JC0 A;  3T1Y Q;  2JA8 H;  2CH4 W;  4JOI A;  4GS3 A;  4X3K A;  4LF8 Q;  3P75 A;  5CR3 A;  3KLW A;  4HAE A;  2BOS A;  3OTO Q;  3NE5 B;  2RBM A;  1PTO H;  4BA1 I;  4LF6 L;  1HA5 A;  1UEA B;  1E0B A;  1FGU A;  2F0T A;  2FMC A;  2K6A A;  1NY4 A;  1QVC A;  4C3I H;  5C4X B;  1B3Q A;  2F0L A;  4HIM A;  1YI2 A;  4B9W A;  5F2D A;  4ZUJ A;  3PUY A;  3CU7 A;  3HOX B;  1Z6H A;  1U4M A;  1ENA A;  1U9R A;  3EVQ A;  5GAD C;  4LF4 L;  4FO2 A;  2F0V A;  2O2L D;  1JJC B;  1OXT A;  1WOC A;  1R4Q B;  1TS5 A;  1ESF A;  1Z7T A;  1Z47 A;  1TU2 B;  1SYC A;  4B3M Q;  1MHW C;  4BXX H;  4A3J G;  1O80 A;  2CW0 C;  2OWO A;  4IQZ A;  2NVQ H;  5EQ0 A;  3WWV A;  3OMG A;  3D4R A;  1EOT A;  2XRQ D;  1TS3 A;  2RSO A;  4GKJ Q;  4UPA A;  1MGS A;  3J7Z C;  4CDF C;  1PYW D;  1T9H A;  2F0H A;  1PH5 A;  1VQN A;  3I90 A;  3PO2 B;  2F03 A;  2ICI A;  1TWC B;  4RCN A;  1UE7 A;  1X3F A;  3K5L A;  4WOR A;  4XT3 B;  1VS0 A;  3KLS X;  4DK3 C;  1TWH H;  1Y69 U;  1VQI A;  1YIJ A;  1BCP D;  2L55 A;  1XPO A;  1EL0 A;  1D1I A;  1QOH A;  3IAY A;  4P2C B;  1NR2 A;  1SNP A;  5CV5 A;  4A3J B;  1EY4 A;  2K5N A;  3LX0 A;  4UP7 A;  1G8Z D;  3PIP 3;  4CKB A;  4JI6 Q;  5IWA L;  4A3K G;  4GLV B;  3KF8 A;  2R92 G;  4DN4 M;  5AFW A;  5C4J H;  1PTO D;  2N8N A;  2HHH Q;  5EJW A;  4JI0 Q;  3A55 A;  3OW2 A;  1PFS A;  2MPM A;  5C3X A;  2ID0 A;  1I6H H;  2KCC A;  4IUV A;  3GTK B;  2EZV A;  5A2Q L;  4A3B G;  4QUF A;  1CT1 D;  1WTX A;  3PV0 A;  1LTB D;  1HPC A;  2RCF A;  5C44 G;  5CV9 A;  1STB A;  1S5E D;  2H5X A;  4M1U B;  2R92 H;  3KLR A;  4Q0F A;  3G6E A;  3GO5 A;  2Z6K A;  5COY A;  2ZXR A;  1A3U A;  3U9O A;  1DD2 A;  1I3Q B;  2MUY A;  1JMC A;  1KDC A;  1X32 A;  2EIF A;  1I6V C;  2EJM A;  2I0Q A;  1EQT A;  1KAW A;  4HJ7 A;  3VA5 A;  1C0A A;  3QG1 A;  3SE0 A;  1IXR A;  3I4M B;  4TKO B;  3SHL A;  2B2T A;  5C44 H;  1PA6 A;  3AFQ A;  2DY8 A;  4DKA C;  5C4H A;  2XNA C;  1R9T H;  4C3H B;  2GVB A;  5FLX E;  4GKK Q;  2NN6 I;  4MHE A;  3M3Y B;  1RL2 A;  5C0X H;  3A74 A;  1XX8 A;  1Q86 C;  4JI2 Q;  4DUY Q;  4YCU A;  5FO9 B;  3RNU A;  1A62 A;  3QB3 A;  2O5J C;  5EBD A;  5ELD A;  2BH8 A;  4G57 A;  1A63 A;  1FJG L;  1E22 A;  1I4R A;  3A54 A;  1UE1 A;  2L4N A;  5G3L D;  1XXG A;  1M4V A;  1BXT A;  4DV3 L;  2WKC A;  4IUP A;  4YY3 Q;  3QO2 A;  4LF8 L;  2R7D A;  3UDX A;  1E2V A;  1SYE A;  5C4J B;  3IRB A;  2J0T D;  3K7A H;  2WB1 E;  3X3N A;  4JI8 Q;  5JJZ A;  5E1F A;  3FDT A;  5BR8 Q;  2Q2T A;  2IJ0 A;  4OON A;  4KJO A;  4A3L H;  1AE2 A;  1Y14 B;  1XYI A;  1MIU A;  1IKM A;  3R2I A;  2VUM G;  2L1B A;  1TWC H;  4ZRZ A;  5IOD A;  4DR6 L;  2Z4I A;  3BVM A;  2VQF Q;  4KLK A;  3M7N A;  2CHB D;  1CK1 A;  3I4O A;  4DXG A;  4DR7 L;  4BBS H;  2JA7 B;  3PO2 H;  4QL5 A;  4RGM A;  1NBW A;  1BBU A;  1SE4 A;  2RDF A;  2QDB A;  4K5W A;  4EX5 A;  3K8A A;  4JBW A;  3HFZ B;  2NVQ B;  4RKL A;  1PFN A;  4EQP A;  2B2W C;  3F2B A;  2JA5 H;  1O7I A;  2TMP A;  1HQM C;  3CME A;  1JQY D;  2L12 A;  3MEF A;  5LHY 1;  2HT1 A;  2BCO A;  1V1P A;  3BYY B;  4KY5 A;  2R7Z H;  3GTM H;  1Q1E A;  1QNK A;  2PYK A;  4ZUI A;  4XQN A;  1OXX K;  2NZH A;  4RCO A;  1QVF A;  1JR0 D;  5IY0 A;  4OIJ A;  2ZTE A;  1B3A A;  3W2D A;  1ZYR C;  2K5D A;  4C2M B;  1H9K A;  1V43 A;  3S2H B;  4R4O A;  4HJA A;  4FF2 A;  2I5M X;  3A7L A;  3LNN A;  5IGF A;  4A75 A;  5EKL A;  1N8R C;  2XVS A;  1OXV A;  3H94 A;  1VQM A;  4JI7 Q;  1AN8 A;  4I7A A;  4LNQ A;  2EYJ A;  1HJP A;  4L5S A;  3J80 E;  1XNQ Q;  1B50 A;  1BVS A;  5G3L F;  2ZXP A;  1TY0 A;  4FXK C;  2DN8 A;  2EE1 A;  2JA8 G;  5C4X H;  4DR2 Q;  1YJW A;  5J39 A;  4B3S L;  5C4Z A;  3D8G A;  1HHV A;  3FRP B;  4RHR A;  1I4P A;  3CMA A;  2LFN A;  1ILQ A;  3NQT A;  4JI7 L;  1SNQ A;  5GRO A;  2QDL A;  2VB3 X;  4DR3 Q;  2RF4 A;  1OO9 B;  3GDE A;  3GTL H;  3MWY W;  5C4X G;  1B44 D;  1F2Z A;  5GAE C;  5FLM G;  1PRT D;  2EOT A;  2HIX A;  1D1K A;  3NQI A;  1WCM H;  1F2Y A;  3I73 A;  2YTX A;  3BS1 A;  4A3G H;  4L63 B;  3J81 j;  1TVX A;  1QWY A;  1EYD A;  1VF5 C;  5IYD G;  4DAY B;  4H0L C;  2E2D C;  3K0Y A;  1HCZ A;  2HDM A;  1B70 B;  4YY3 L;  1DOK A;  3OWE B;  5IT9 c;  3J80 c;  4O2D A;  2VQE L;  3A8K E;  4LFB Q;  5EKI A;  1H9R A;  3SDZ A;  1GUN A;  1X3E A;  4DV4 Q;  1YBY A;  1E2Z A;  1EZ6 A;  3ER0 A;  2PQA A;  3HS0 C;  5I6Y A;  1JC7 A;  2OCE A;  1K8A C;  1PH9 A;  5IYD H;  1SYF A;  4R4Q A;  4JI3 Q;  3OOC A;  2B2T C;  3S2D H;  1IZ6 A;  4UY8 C;  1QUQ A;  1HTL D;  2WAQ E;  1P8L A;  4IFD I;  2BE5 C;  4DXF A;  1ZEQ X;  1VQE A;  3IKJ A;  4DV3 Q;  4C3J H;  1RHP A;  4KD4 A;  3UE0 A;  2EQS A;  3HOV H;  4B3R L;  4DGZ A;  3K5M A;  1F2M A;  4K8J A;  2QEJ C;  2JEA I;  1TWA B;  2JA7 G;  1IL2 A;  4A3C H;  2YU9 H;  1V1P B;  1EFW A;  4DUY L;  3T1H Q;  1UAP A;  1YEZ A;  4KHP Q;  1LTT D;  4PMB A;  4JI5 L;  4S3S A;  1IKL A;  2E2J H;  1XMQ L;  1H9S A;  3ICE A;  2OTJ A;  1FJG Q;  1LYL A;  3TZU A;  3LWE A;  3PUZ A;  4TQU S;  2KHS A;  2IT1 A;  4A3K H;  4L6T B;  1RD9 D;  1E24 A;  2NVX B;  4APV A;  3HZX A;  3PO3 G;  5JVH 3;  1TT2 A;  1UEB A;  3S1R H;  4A3M B;  3SK8 A;  2EXZ A;  4P71 A;  5KIX A;  4X65 L;  4ZKC B;  4HJ5 A;  2Y0S E;  4KHV A;  4LFC Q;  3J81 E;  3RZD H;  4ZK9 B;  1L1O C;  5ELO A;  3KDF B;  2Q8T A;  4GKK L;  3CC7 A;  3AEV A;  5FJ8 H;  2PQE A;  2A5H A;  2V4D A;  4C1N I;  1X65 A;  1CKM A;  5ELE A;  3STB C;  5EGT A;  3I56 A;  2A69 C;  4GOP B;  1G2S A;  1CSP A;  2ZT9 C;  3PMF A;  4EQO A;  3AFP A;  4KY6 A;  4A3D H;  1CUK A;  4O0A A;  5ELB A;  1IYV A;  2F0W A;  5FLX c;  4DK1 A;  5JVG 3;  1LT6 D;  3CPW A;  3RN5 A;  4L5T A;  2ATW A;  5M3F H;  5C0X G;  4X64 L;  2KA7 A;  1XJV A;  3ONA B;  3DWP A;  3NPP A;  1SEB D;  1R4P B;  1DOL A;  2PNR C;  4A3D G;  1FR3 A;  3D4W A;  1O7Z A;  4GLA C;  1I50 B;  2F0I A;  2B2W A;  2WKD A;  4BBR H;  4F8M A;  2KED A;  2BA0 A;  1DJR D;  1LTL A;  4C56 C;  1YNX A;  1WTV A;  4A3M H;  4AYB B;  4X3S A;  1BKB A;  1A3V A;  4OHJ A;  4H7B A;  4GKJ L;  5CBA E;  1JOO A;  5LL6 X;  1J8I A;  1B1Z A;  1G91 A;  4YCW A;  1XPU A;  2D0O A;  2B3G A;  3S15 H;  4KN4 C;  1D8L A;  1A2U A;  1NUC A;  5CV7 A;  4BA2 I;  2B63 H;  1STG A;  2HUG A;  3H3V C;  1SDF A;  2FIN B;  4GZY C;  3MC0 B;  4B3M L;  4K2L A;  1RF2 D;  1TII D;  2E76 C;  1PRT B;  1TWA H;  4X64 Q;  4DNR B;  3HOY H;  4PZ7 A;  3DHQ A;  2LY7 A;  2JJQ A;  3DWA A;  4BY7 H;  1CQV A;  2EJF C;  2M9V A;  4RAU C;  4XIG S;  2M00 A;  5IP9 H;  3UDF A;  4BY1 G;  1AH9 A;  5A2Q E;  5CV6 A;  1H9S B;  5DM7 3;  1LTA D;  3NSW A;  4K6L A;  4P72 A;  1W2B A;  4MZ9 A;  1EY9 A;  5M3M G;  4EGV A;  4BY7 G;  3OTO L;  2K03 A;  1FNU A;  1DYQ A;  2HIV A;  4LFC L;  4X65 Q;  1JWS D;  3K5O A;  2Y0S B;  1KC8 C;  2JK8 A;  4KKS A;  1F2L A;  2VUM B;  3KF6 B;  4ILW A;  4CDD C;  3RUZ A;  1EIH A;  2Z6B A;  4DU9 A;  1XTD A;  4DV4 L;  3UDG A;  3OW7 A;  2UXD L;  2NN6 H;  5BN4 A;  5CC4 A;  4DNT B;  1S4Z A;  3HOU H;  4UP9 A;  3I55 A;  1PH2 A;  1NR4 A;  4JI5 Q;  4JBK A;  2LS0 1;  2H4O A;  4GN3 B;  4CKE A;  4RH6 A;  1IBL Q;  1Q82 C;  1IL8 A;  1DM0 B;  2E5L L;  2KQ3 A;  3K5N A;  4NPS A;  3L2P A;  1PFB A;  3U58 A;  3S9W A;  1AP0 A;  1HFN A;  5D14 A;  4OL7 A;  1O78 A;  3CQZ H;  3KK7 A;  4QGU A;  3TZD A;  4DR3 L;  3T16 A;  2PCF B;  4DAY A;  3CPF A;  2WAQ G;  1W6J A;  2LMC B;  1U4R A;  2IHE A;  1EQQ A;  1HNX L;  2KBN A;  1BCP F;  4A3G G;  2PQA B;  1I50 H;  1K8O A;  2YTV A;  3KBX A;  4P73 A;  2ASB A;  4N8F A;  3HG9 A;  5I9O A;  1VMP A;  3V05 A;  1NTG A;  3RLN A;  5T1G A;  1BQQ T;  2B29 A;  3VR3 A;  2BH2 A;  2RHS B;  1GUS A;  3BDL A;  3TP8 A;  5CBE E;  4IPD A;  3LGJ A;  4XT1 B;  2Z4H A;  2E2I B;  1S5F D;  1DCZ A;  4NKL A;  2J7Z A;  4DV7 Q;  5C44 B;  1SJE D;  2I46 A;  3E6Z X;  4A3F G;  4LFA Q;  3K59 A;  4N9T A;  2VS1 A;  1BF4 A;  3MXN A;  4R4C A;  1SE3 A;  5M5X H;  3A5Z B;  3MFG A;  1WD0 A;  1VQL A;  2JA6 B;  5IGD A;  1KNE A;  2JA5 B;  2UU9 L;  4F87 A;  4OGQ C;  4E6I A;  1V1Q A;  2NZ1 D;  4A3G B;  1A2T A;  3W1G A;  5C6A A;  1LV9 A;  2R92 B;  2KCN A;  5KGU A;  2NYZ D;  3I7F A;  1AE3 A;  5NUC A;  5LMU L;  5M5W B;  3S14 H;  5I4D A;  1BCP B;  4R4T A;  4CJ0 B;  2KUM A;  1PVO A;  1VQ5 A;  3T13 A;  3P20 A;  3SK6 A;  2RHQ B;  3QIA A;  2K50 A;  3KDF A;  5T1I A;  3NBH B;  4H13 C;  3PF4 A;  3ZJY C;  3NTI A;  4YHH L;  2O5I C;  4RFB A;  1YHQ A;  2UXB L;  2IX0 A;  1XNR L;  1CHQ D;  4DR6 Q;  2UUA Q;  1FVI A;  1JIC A;  1MJE A;  4G7Z C;  3M9B A;  1C8C A;  3A8J E;  1TXY A;  2YV5 A;  3G71 A;  2R3Z A;  2LXJ A;  4K5X A;  2GA4 B;  3SEB A;  4A3I G;  3OIQ A;  3SGI A;  3EJI A;  1K83 H;  4X62 L;  2XTI A;  3TRZ A;  1UE6 A;  2A19 A;  3J7A F;  2G9H D;  3TS2 A;  2Z6K C;  1J5E L;  3GTJ B;  1O7Y A;  3G48 A;  1ASZ A;  1EEI D;  3TRE A;  1KDA A;  1N36 Q;  4I65 A;  1N33 Q;  5TSS A;  1II3 A;  3A8I E;  4FP5 D;  1U5K A;  4LWC A;  4A3B H;  1LM0 A;  4IAL A;  1B4O A;  3RZO B;  5M3F G;  4KKU A;  1PZK D;  2EVB A;  3S1M H;  2AKW B;  3W1B A;  1HZC A;  2ZM6 Q;  1A15 A;  3KBG A;  2EYF A;  5D65 A;  2R7Z G;  2Q2H A;  3Q24 A;  4IUN A;  5ELF A;  2UXB Q;  3HOZ G;  3S1N H;  5BN3 A;  5D3I B;  1MSG A;  4C3I B;  4CJ1 B;  2B2V A;  2BDN A;  5IP7 H;  2D0P A;  4X3U A;  4YIJ A;  1LTR D;  4LW1 A;  4N9P A;  1V1O A;  4QMG A;  2UXC L;  4WJ3 M;  4DR1 L;  2F3W A;  1PH8 A;  4RKB A;  3CCL A;  2SEB D;  4IZ8 A;  4GN5 A;  4HJ8 A;  4HIK A;  1G2T A;  2UXD Q;  1TY2 A;  3LWU A;  1S40 A;  2MNA A;  4L5Q A;  5C3W A;  3A5U A;  1JJG A;  4A3E B;  1KIX A;  4Y52 H;  1JOK A;  4A76 A;  4LF5 Q;  3TBI B;  3I72 A;  1JJ2 A;  3VR6 A;  1YHB A;  2F4I A;  5I2Y A;  1GUW A;  2UU9 Q;  3STB D;  1S5C D;  1LAC A;  2VW9 A;  4A93 B;  4KV6 A;  4QF4 A;  1WFQ A;  1K73 C;  1KL9 A;  1G6P A;  2F0D A;  5C5L A;  1BR9 A;  1E1T A;  4HJ9 A;  2JQO A;  2HDL A;  4KI0 A;  5I2X A;  1K0R A;  2O4X A;  4DUZ Q;  2N78 A;  1STN A;  4HMJ A;  1L2F A;  5IYC G;  1VMC A;  5IP9 G;  3S2H H;  4NMZ A;  1C7Y A;  2A1A A;  1ICW A;  4G4K A;  2A6H C;  4KTA A;  2HD3 A;  2VUM H;  2D5D A;  2BA1 A;  1CI3 M;  4XYO A;  1G29 1;  5M9O A;  3I4M H;  5KEE A;  1SRU A;  3F2C A;  1EWH A;  3NK9 A;  2PPB C;  1NNX A;  3CRK C;  4ME3 A;  1L0W A;  5E4X A;  3G4S A;  3NWT A;  3OHX C;  5I6W A;  4AQY Q;  2X69 A;  2DY7 A;  3NXW A;  4FNF A;  1BO0 A;  1SMY C;  1HXY D;  2KEE A;  3HP3 A;  1D2B A;  1SYB A;  2PI2 A;  3SVM A;  1VQD A;  4BBS G;  1L0Y B;  3ERQ A;  4FDB A;  4BBS B;  1SYG A;  5JJL A;  4HIO A;  1I94 Q;  3I2Z A;  1X56 A;  3G7L A;  1Z9F A;  5FLX L;  2ZJR A;  5HGQ A;  3J7A V;  3N6R A;  4FXG C;  3C3L A;  3CCR A;  2K5W A;  3URY A;  3TDQ A;  1VQJ A;  2JA5 G;  3IFT A;  5EBC A;  2KOL A;  5HGT A;  2B63 B;  4PMW A;  4JV5 Q;  1QIL A;  3HRZ C;  4LK1 C;  3K7A B;  3S14 B;  2E75 C;  1U0L A;  4IUQ A;  2XN9 C;  4POG A;  3CCE A;  1VQA A;  4LMQ D;  1XMQ Q;  2XIW A;  2B2U A;  1EY0 A;  4HN7 A;  4L5R C;  3M7G A;  1ENF A;  2R93 B;  4MTN A;  4LJZ C;  1JWM D;  4HSP A;  3E9H A;  3HOW H;  1PTO F;  1NAP A;  2B2V C;  1N32 L;  4UP8 A;  1EU4 A;  3M4P A;  1L1O B;  4U68 A;  3GTG B;  2J4X A;  4A3F H;  5FJ8 G;  4KHP L;  4XQQ A;  3KYH C;  1LLR D;  1MSH A;  2XWJ B;  1IYU A;  4OIK A;  1GJX A;  2L5T A;  4WJW A;  3CCQ A;  1N34 Q;  3Q23 A;  3PUV A;  3HOW G;  1WCM G;  4LF9 L;  1TWF H;  2F0K A;  2IHF A;  2A6E C;  1B8A A;  2XRS D;  3J81 L;  3J81 i;  2NUC A;  3MTS A;  4JK1 C;  4MN3 A;  1C4Q A;  3Q8D A;  4J6H A;  1VQ8 A;  2SNM A;  3SXH A;  1N36 L;  1VQF A;  3KFU A;  2EY6 A;  4B3T L;  1PYS B;  5FLM H;  1PFM A;  3CP0 A;  3E0E A;  4HTH A;  1DZ1 A;  1Q1B A;  4GLX A;  1KQS A;  1GVP A;  3CC2 A;  3CC4 A;  4X62 Q;  3NTH A;  3NP8 A;  1MBY A;  2LXK A;  1PZJ D;  4IUT A;  4KHZ A;  4QB4 A;  1ML0 D;  3JAM L;  5C3E H;  4HCE A;  3JAM i;  2NWG A;  2EY5 A;  1LT4 D;  4PV1 C;  1X3Q A;  2ZTD A;  4FYD A;  2ZXO A;  2AHO B;  4A3K B;  2IX1 A;  3ULL A;  2WB1 G;  4IUU A;  1J5E Q;  1AFP A;  4LAA A;  2MO0 A;  4JI4 Q;  4AQY L;  1YVC A;  1PH4 A;  3S1N B;  3AMU A;  1QB5 D;  3MXN B;  3VYT A;  5C3E G;  4CDE C;  1IHZ A;  3FPU B;  2TSS A;  3TP7 A;  3JAM E;  4NB3 A;  1IYJ B;  4DV6 L;  2B63 G;  1WD1 A;  3RLO A;  4DF7 A;  2F4V Q;  4JW0 A;  1DGS A;  1EY7 A;  3S17 H;  2NTT A;  1V9P A;  1YNJ C;  1XNQ L;  1Y1V G;  3HOV G;  3CAM A;  2D62 A;  2NTS A;  3F2U A;  1M90 C;  2Z0S A;  3VYR A;  4ZYS A;  2F0F A;  5KYL A;  3BG3 A;  2F0J A;  3T53 B;  2NB0 A;  4B3S Q;  4HSV A;  1DON A;  2ZJP A;  4DR2 L;  2C5C A;  4BS9 A;  3TP5 A;  3CXC A;  1L0X B;  1W6K A;  4RG1 A;  1K83 B;  3L3O C;  4DPG A;  2Z9H A;  2WAC A;  1D5X C;  5J3B A;  2AWO A;  3S1Q B;  2IW3 A;  2ALY B;  3C1F A;  3HOX H;  3JAM c;  3PO3 H;  4IFD G;  3GTJ H;  1Q90 A;  4V19 0;  3MXP A;  1ILP A;  2N49 A;  1SNM A;  2I07 B;  5LMN L;  4IPH A;  4IPC A;  3BYT B;  1I4H A;  1ZKO A;  3QR8 A;  3MZ5 A;  3OYY A;  4FXD A;  5DAU A;  1PYB A;  3OIP A;  2M2L A;  3BZD B;  1SFO B;  2EY2 A;  3EFX D;  3GTL B;  3HGB A;  1PH6 A;  3D31 A;  1QVG A;  4DR7 Q;  2CFM A;  1D5M C;  1K3R A;  3PGZ A;  4O42 A;  1KLU D;  2UUB Q;  4JCV E;  3ND9 A;  5CYU A;  3HOZ B;  4WJ4 A;  3PIO A;  3S15 B;  1CQF A;  4F88 A;  1PLF A;  3VYU A;  4TVA B;  5DNF A;  2AUK A;  1HNW L;  5ISR A;  2VNU D;  1KLG D;  4R4I A;  1IBL L;  2B2U C;  4F7X A;  2JA6 H;  5GAH C;  2OQK A;  3DEP A;  2N88 A;  3PIP A;  5E7N A;  1SFO H;  2DNE A;  2PZW A;  1CKN B;  2EJG C;  3R93 A;  1L1O A;  1JB3 A;  2R6G A;  4K2K A;  4C2M H;  1TWG H;  2WAQ B;  4C3I G;  4NDX A;  2PO4 A;  2D2C C;  4V0B A;  3SK5 A;  2V1C C;  3I4L A;  4O1N A;  2OTL A;  1EU3 A;  4IJH A;  1GUT A;  1VQ9 A;  4I7Z C;  4RHS A;  1SN8 A;  1RIP A;  4KMU C;  2VXW A;  1EIY B;  2UUC L;  2FJ2 A;  1IBM Q;  1MD2 D;  3PF5 A;  3M4O B;  1VQC A;  4R8I A;  2E2I H;  1HNZ Q;  3DWQ A;  3B6Y A;  5FK9 C;  2Q8I B;  4LF9 Q;  3TQY A;  3IFD A;  2OEO A;  4DAP A;  2QEX A;  3R3O A;  1HNW Q;  3CQZ B;  3PSI A;  4KJN A;  1J6Q A;  3D3R A;  5EPL A;  1EIF A;  4K8I A;  4GNX B;  2EYL A;  4GN4 B;  1SNC A;  2FHT A;  4MIU A;  3CCJ A;  1HUN A;  3SR1 A;  1H95 A;  2LSS A;  1KTK A;  3BDO A;  2Y0S G;  2R93 G;  3TS0 A;  2K5V A;  3I3C A;  1Q12 A;  5C5M A;  3NEL A;  3MHB A;  1RTN A;  1Q3L A;  3VR5 A;  1HTP A;  2A68 C;  1EIG A;  4K0K Q;  1EZ8 A;  2ICE C;  5J1Z A;  5IWA Q;  4BY1 B;  1F9S A;  2XWB B;  1EY5 A;  1W3S A;  1G6Z A;  2WP8 J;  5FO8 B;  3BDC A;  4TSS A;  2EPB A;  3KLS A;  2E8G A;  3E9I A;  2G5D A;  1X54 A;  2B39 A;  5EKK A;  2MJ8 A;  1WTW A;  1PRT C;  4YWK A;  1EQR A;  2K7V A;  1WVL A;  3K57 A;  2FMM A;  5IE8 A;  4XDX A;  4JVZ A;  1VQP A;  5D3D A;  3G6J B;  1E2W A;  5DLQ E;  4IFD J;  5IYB H;  3S2D B;  3FKI B;  1O7L A;  2L11 A;  1HNX Q;  1C48 A;  1I5F A;  2AQ2 B;  1IBK Q;  2PZT A;  3CRL C;  3A56 A;  3DMU A;  1QNU A;  1TWF B;  2CKZ B;  1YIT A;  3M4Y A;  1X3P A;  1T5E A;  4B9X A;  2MO1 A;  1HUM A;  2KCM A;  4XYQ A;  1I3Q H;  2RA4 A;  4Q5V A;  1TWG B;  3EN2 A;  2AQ3 B;  1CKO A;  1AEX A;  2EYH A;  3KJP A;  2YYZ A;  2CWA A;  5KNB A;  4R1J A;  4DV5 L;  2F1M A;  2CVR A;  2SOB A;  3QOJ A;  3ERS X;  1SLJ A;  1WCM B;  1XPR A;  5JJI A;  1K8M A;  3HOZ H;  1OXS C;  1CSQ A;  4WFN 3;  1SE8 A;  2Q2I A;  3UI2 A;  5GQO A;  1PH1 A;  2K52 A;  4DUZ L;  4WRD A;  3C46 A;  1YZ6 A;  4LF4 Q;  1PRT F;  3W5O A;  1NSN S;  1ZXT A;  2K5H A;  2ES2 A;  4IPG A;  2Z1C A;  3T56 B;  4POF A;  3GTQ H;  1WYD A;  3FPP A;  1EWI A;  4GOP C;  1DOM A;  4ID6 A;  3BJU A;  2K4K A;  1TR5 A;  1D5Z C;  3OPO A;  2WII B;  1PDQ A;  5JAV A;  3BU2 A;  4FF3 A;  5M3F B;  3CKI B;  1PH3 A;  4ZKB B;  3PIO 3;  1BNZ A;  4EQN A;  3KF6 A;  1STE A;  5H1S E;  3QOL A;  4R8N A;  4X3T A;  1X6O A;  2K75 A;  3T1Y L;  3S1Q H;  1SJH D;  4UHV A;  5IYC H; 
#chains in the Genus database with same CATH homology
 3CW2 C;  4JI3 L;  1C9O A;  1NMF A;  2JQO A;  3VDY A;  2KEN A;  4KI0 A;  1K0R A;  3CMA A;  4DUZ Q;  2N78 A;  2KCT A;  4GNX A;  4JI7 L;  1PHJ A;  1L2F A;  5IYC G;  5GRO A;  5IYB G;  3DLL A;  4RMF A;  5IP9 G;  4DR3 Q;  3S2H H;  3HOY G;  2RF4 A;  3GDE A;  1C7Y A;  4JI1 L;  4DV0 Q;  2A1A A;  3GTL H;  5C4X G;  5GAE C;  2VUM H;  5FLM G;  4LFB L;  2PNH A;  4DAM A;  2BA1 A;  2HIX A;  4X66 Q;  1FL0 A;  1G29 1;  3I4M H;  1WCM H;  2UXC Q;  2JE6 I;  2YTX A;  4A3I H;  1GD7 A;  1CKN A;  4OO1 I;  2OQ0 A;  4A3G H;  4BY1 H;  1SRU A;  3J81 j;  4J15 A;  3F2C A;  5IYD G;  4DAY B;  4ME3 A;  1L0W A;  3G4S A;  4DR5 L;  4ALP A;  1HNZ L;  4JG2 A;  1B70 B;  4PZ8 A;  4YY3 L;  3J80 c;  5IT9 c;  1VQ4 A;  4O2D A;  2VQE L;  4DV1 Q;  4LFB Q;  4DV2 L;  2UXD L;  2PMZ E;  4AQY Q;  1WJJ A;  3M85 A;  1MJC A;  1HR0 W;  1X3E A;  1X55 A;  4DV4 Q;  1YBY A;  2ZJQ A;  1G51 A;  2PI2 A;  1GKH A;  3CCS A;  3ER0 A;  1M1K C;  2PQA A;  3K7U C;  1VQD A;  2VQE Q;  4BBS G;  4FDB A;  1K8A C;  2OCE A;  5JJL A;  4NXN L;  4JYA L;  3FP9 A;  4QJF A;  1PH9 A;  4R4Q A;  4JI3 Q;  4HIO A;  1I94 Q;  5IYD H;  3I2Z A;  1X56 A;  3S16 H;  1Z9F A;  3S2D H;  2ZJR A;  1IZ6 A;  4UY8 C;  1QUQ A;  4QY7 A;  5HGQ A;  2QA4 A;  4A3E H;  2WAQ E;  5IP7 G;  2UUA L;  1P8L A;  3CCR A;  4IFD I;  2CWP A;  3H15 A;  4IOC A;  2JA6 G;  1VQJ A;  1KD1 C;  2JA5 G;  3AYH B;  1VQE A;  3PCO B;  4DV3 Q;  4C3J H;  1WI5 A;  4DNI A;  3FKI H;  4PMW A;  5LMU Q;  3UE0 A;  4JV5 Q;  1BBW A;  4A93 G;  2EQS A;  3HOV H;  1PV4 A;  1QZG A;  4B3R L;  4OWW B;  1EOV A;  1U0L A;  5AJ3 L;  3HKS A;  4POG A;  2JEB I;  2JEA I;  3RLF A;  3CCE A;  4JI2 L;  1VQA A;  1JB7 A;  3UE1 A;  1KRT A;  2Q2U A;  2JA7 G;  1IL2 A;  3NEN A;  4A3C H;  1XMQ Q;  2YU9 H;  4A3E G;  1EFW A;  3KOJ A;  4DUY L;  4YWM A;  3T1H Q;  4L5R C;  3H3V H;  5ELN A;  1YEZ A;  3I4M G;  4KHP Q;  4LF7 Q;  2FXQ A;  4MTN A;  4JI5 L;  2JA7 H;  1VQ6 A;  3GTG H;  2I5H A;  3K81 C;  1KHI A;  1XNR Q;  3ULJ A;  2E2J H;  2NVX H;  3E9H A;  1XMQ L;  5JJK A;  2UUB L;  3HOW H;  3ICE A;  4C3H H;  2OTJ A;  1FJG Q;  1LYL A;  2DUD A;  3PUZ A;  4TQU S;  4BBR G;  2IT1 A;  1N32 L;  4UP8 A;  1JT8 A;  4A3K H;  1E24 A;  1GO3 E;  3M4P A;  1L1O B;  1NJI C;  2NZO A;  5EAY A;  4APV A;  4A3M G;  3PO3 G;  1UEB A;  3S1R H;  2RCN A;  1VQG A;  2NVT H;  4A3L G;  2ZTC A;  2AMC B;  4P71 A;  3PUW A;  5FJ8 G;  4X65 L;  4HJ5 A;  4A3F H;  2Y0S E;  3KYH C;  4LFC Q;  4KHP L;  3RZD H;  4K0K L;  1L1O C;  5ELO A;  3KDF B;  3CCQ A;  4GKK L;  1A0I A;  1N34 Q;  3CC7 A;  4LFA L;  5FJ8 H;  3PUV A;  1HR0 L;  3AEV A;  3HOW G;  1WCM G;  4LF9 L;  2WFW A;  3L0O A;  1TWF H;  2IHF A;  1Q8K A;  1B8A A;  3J81 i;  3PO2 G;  1X65 A;  1E3P A;  1CKM A;  4AIM A;  3STB C;  1MKH A;  3I56 A;  3H0G G;  3Q8D A;  4GOP B;  5AJ3 Q;  1E7Z A;  3A0J A;  1CSP A;  1VQ8 A;  2HHH L;  1N36 L;  1Q81 C;  2R93 H;  3AFP A;  4B3R Q;  1VQF A;  3KFU A;  1D7Q A;  1S72 A;  4A3D H;  4B3T L;  1CUK A;  1PYS B;  4O0A A;  5FLM H;  1YHA A;  1YJ9 A;  1KXL A;  2VZA A;  3CP0 A;  3E0E A;  5FLX c;  4LF7 L;  1IBM L;  1Q1B A;  4DR1 Q;  3CPW A;  4GLX A;  3RN5 A;  1GVP A;  1Y1W G;  1KQS A;  3CC2 A;  3CC4 A;  4L5T A;  4X62 Q;  2ATW A;  3PUX A;  5LMN W;  5M3F H;  2LXK A;  5C0X G;  1X3G A;  4JI8 L;  1N9W A;  4KHZ A;  4A3C G;  4X64 L;  2XGT A;  5C3E H;  1XJV A;  1B7Y B;  4DV7 L;  3JAM i;  3M4O H;  4JYA Q;  1GM5 A;  5K36 G;  4JOI C;  4JI4 Q;  2ZTD A;  4A3J H;  2AHO B;  2NVY H;  2IX1 A;  2MQH A;  3ULL A;  1UWV A;  3HOX G;  2WB1 G;  4A3D G;  1J5E Q;  4GLA C;  4LUZ A;  2VQF L;  2MO0 A;  4BBR H;  2N3S A;  4H02 A;  2BA0 A;  5M3M H;  1YVC A;  5C0X I;  5GAG C;  4AQY L;  4DR5 Q;  1Y1W H;  1PH4 A;  4DV1 L;  1LTL A;  4DV6 Q;  3FHW A;  3GTP H;  1NMG A;  1QUQ B;  4OWT B;  3MXN B;  1YNX A;  4A3M H;  1BKB A;  5C3E G;  3CCU A;  2EXD A;  4NXN Q;  4GKJ L;  4NB3 A;  1IYJ B;  1N34 L;  4DV6 L;  2B63 G;  2R7F A;  5LMN Q;  4YCW A;  1XPU A;  2D0O A;  3RLO A;  3GTK H;  2B3G A;  3S15 H;  2F4V Q;  3CCM A;  1D8L A;  4JI1 Q;  1DGS A;  2NN6 G;  3S17 H;  4BA2 I;  2B63 H;  1V9P A;  1XNQ L;  3TEH B;  4A93 H;  1Y1V G;  3HOV G;  4OO1 G;  3I4N G;  3CAM A;  2D62 A;  1Q7Y C;  1M90 C;  2VL6 A;  2Z0S A;  4YHH Q;  2K14 A;  3EIV A;  4B3M L;  2CCZ A;  2JA8 H;  1TWA H;  4JC0 A;  3U4Z A;  4X64 Q;  3T1Y Q;  4B3S Q;  2ZJP A;  4JOI A;  4DK6 C;  4DR2 L;  3HOY H;  4PZ7 A;  4GS3 A;  2JJQ A;  4MNO A;  4LF8 Q;  4BY7 H;  3KLW A;  4AYB E;  2PI2 E;  3OTO Q;  2E2H H;  3CXC A;  4BA1 I;  4RG1 A;  4XIG S;  4LF6 L;  4DV0 L;  4DPG A;  4PZ6 A;  3RR5 A;  1FGU A;  1Q46 A;  5J3B A;  5IP9 H;  2AWO A;  3UDF A;  4BY1 G;  1AH9 A;  4OWX B;  4AYB G;  1NY4 A;  1QVC A;  1VQB A;  2DGY A;  2ALY B;  3HOX H;  3F2D A;  1VQH A;  4C3I H;  4DR4 Q;  3JAM c;  3PO3 H;  1EUJ A;  4IFD G;  4P72 A;  1E1O A;  3GTJ H;  4MZ9 A;  1W2B A;  4HIM A;  2N49 A;  5M3M G;  1YI2 A;  5LMN L;  4IPH A;  4BY7 G;  3PUY A;  4IPC A;  3OTO L;  3D0F A;  3OYY A;  3CD6 A;  2HIV A;  4LFC L;  4X65 Q;  5GAD C;  1PYB A;  4LF4 L;  4IJL A;  3AQQ A;  3HKZ G;  1KC8 C;  4JI6 L;  2JK8 A;  1JJC B;  3KF6 B;  1OXT A;  2L15 A;  1WOC A;  1Z47 A;  1PH6 A;  3D31 A;  1QVG A;  4DR7 Q;  4B3M Q;  2CFM A;  5M5Y H;  4JI4 L;  4JI0 L;  1XTD A;  1K3R A;  3PGZ A;  4YCV A;  5HY6 A;  3J81 c;  3CF5 A;  4DV4 L;  5C0X J;  4JCV E;  3UDG A;  4A3J G;  2UUB Q;  4BXX H;  4X6A H;  1A8V A;  4P74 A;  1JE5 A;  2OWO A;  1HZA A;  3HOU H;  2F3I A;  4UP9 A;  3I55 A;  1VCI A;  1PH2 A;  4JI5 Q;  4JBK A;  2NVQ H;  4WJ4 A;  4GN3 B;  3PIO A;  1IBL Q;  3WWV A;  1Q82 C;  1I94 L;  1VQ7 A;  4TVA B;  2E5L L;  4QIW E;  1HNW L;  4GKJ Q;  4UPA A;  4NPS A;  2VNU D;  3J7Z C;  3L2P A;  3M3Y H;  4R4I A;  1T9H A;  1PH5 A;  1IBL L;  3U58 A;  2JA6 H;  1VQN A;  5JEA G;  5GAH C;  4A4I A;  2OQK A;  4OX9 Q;  3PIP A;  1UE7 A;  3FKI G;  1X3F A;  5E7N A;  1SFO H;  4IOA A;  2IY5 B;  1VS0 A;  2F52 A;  1YJN A;  4DK3 C;  1TWH H;  3CQZ H;  2F4V L;  1CKN B;  4QGU A;  1K8G A;  1VQI A;  1YIJ A;  1XPO A;  4DR3 L;  1L1O A;  3EBE A;  3CPF A;  2R6G A;  2WAQ G;  4C2M H;  1TWG H;  3J7A 5;  3S24 A;  2IHE A;  1EQQ A;  1HNX L;  2K5N A;  2KBN A;  4UP7 A;  2V1C C;  5BR8 L;  4A3G G;  2PQA B;  4JI6 Q;  5IWA L;  3RN2 A;  2GN5 A;  3UDI A;  1I50 H;  4GLV B;  4IJH A;  4A3K G;  2OTL A;  2R92 G;  1VQ9 A;  2YTV A;  1SN8 A;  1RIP A;  5C4J H;  4P73 A;  2ASB A;  1EIY B;  2UUC L;  1NTG A;  2N8N A;  3RLN A;  5JEA J;  1IBM Q;  2HHH Q;  2BH2 A;  2B29 A;  4JI0 Q;  3KF8 B;  2RHS B;  3OW2 A;  1PFS A;  3PF5 A;  2JA9 A;  4DV2 Q;  4B3T Q;  1I6H H;  2ID0 A;  1Y1V H;  1XMO Q;  4IPD A;  1VQC A;  3LGJ A;  2E2I H;  4LUV A;  3T1H L;  1HNZ Q;  4A3B G;  4QQB X;  1VQO A;  3PV0 A;  3B6Y A;  4LF9 Q;  3TQY A;  4DV7 Q;  2C35 B;  2QEX A;  4LFA Q;  4A3F G;  1HNW Q;  1LUZ A;  5C44 G;  3PSI A;  2E5L Q;  1EYG A;  2H5X A;  2R92 H;  4HID A;  2VS1 A;  1K9M C;  1J6Q A;  3G6E A;  3GO5 A;  2Z6K A;  1S3O A;  2I5L X;  4R4C A;  5M5X H;  3A5Z B;  4X66 L;  1EIF A;  2AWN A;  4GNX B;  1JMC A;  1VQL A;  3GD7 A;  3JC6 6;  4GN4 B;  4IO9 A;  4LUO A;  2EIF A;  3CCJ A;  4LF5 L;  1H95 A;  2UU9 L;  4NXM Q;  1PH7 A;  1OTC A;  2I0Q A;  5M5W H;  1KAW A;  2LSS A;  1V1Q A;  4HJ7 A;  3H0G H;  3W1G A;  3M4Q A;  3J80 i;  2Y0S G;  1C0A A;  1IXR A;  2R93 G;  3I7F A;  4LF6 Q;  2VY3 A;  3TS0 A;  1AE3 A;  4JBJ A;  1HH2 P;  2K5V A;  5C44 H;  1Q12 A;  5LMU L;  2QGQ A;  4JV5 L;  1PA6 A;  1N32 Q;  3AFQ A;  4DKA C;  3BZK A;  3NEL A;  2A8V A;  3CCV A;  1R9T H;  3S14 H;  2GVB A;  4OXP A;  2HQL A;  1X9N A;  4GKK Q;  4R4T A;  2NN6 I;  1SMX A;  1RL2 A;  4K0K Q;  1PVO A;  3A74 A;  3ULP A;  1VQ5 A;  1Q86 C;  5IWA Q;  4PG3 A;  4JI2 Q;  3L7Z C;  4DUY Q;  2RHQ B;  4YCU A;  3RNU A;  1A62 A;  2K50 A;  3KDF A;  1QZH A;  3NBH B;  1XMO L;  3PF4 A;  1W3S A;  3DM3 A;  3ZJY C;  2WP8 J;  4YHH L;  3F1Z A;  2BH8 A;  3U4V A;  1YHQ A;  1FJG L;  2UXB L;  1A63 A;  2IX0 A;  1E22 A;  2E8G A;  1XNR L;  3E9I A;  1UE1 A;  1X54 A;  4EQ5 A;  4DR6 Q;  2UUA Q;  1FVI A;  4YWK A;  4DV3 L;  3M9B A;  1EQR A;  1MJE A;  1IBK L;  4YY3 Q;  4LF8 L;  1TXY A;  2YV5 A;  3G71 A;  2LXJ A;  2R7D A;  5IE8 A;  3UDX A;  4A3I G;  1VQP A;  1VQK A;  3SGI A;  3IRB A;  3K7A H;  2WB1 E;  5DLQ E;  4GOP A;  1K83 H;  4JI8 Q;  2KHJ A;  5IYB H;  4IFD J;  3K80 C;  5BR8 Q;  2Q2T A;  4X62 L;  4OON A;  2XTI A;  4A3L H;  1HNX Q;  1N33 L;  3TRZ A;  1AE2 A;  1Y14 B;  1I5F A;  1MIU A;  1UE6 A;  2A19 A;  4GNX C;  3TS2 A;  1IBK Q;  2Z6K C;  1J5E L;  2CKZ B;  3G48 A;  4YWL A;  1YIT A;  2VUM G;  4DR6 L;  1TWC H;  1ASZ A;  2VQF Q;  2MO1 A;  2MFI A;  4KLK A;  3TRE A;  4OX9 L;  1N36 Q;  3M7N A;  1UE5 A;  3K0X A;  1N33 Q;  2GVA A;  2KCM A;  3I4O A;  4DR7 L;  1I3Q H;  4DV5 Q;  4BBS H;  1NE3 A;  3EN2 A;  1U5K A;  4LWC A;  4QL5 A;  1CKO A;  2YTY A;  3PO2 H;  4A3B H;  1NBW A;  1BBU A;  1LM0 A;  1SR3 A;  3KJP A;  4EX5 A;  2YYZ A;  5M3F G;  4XTC S;  3K8A A;  2CWA A;  4JBW A;  3HFZ B;  4R1J A;  4DV5 L;  3S1M H;  2AKW B;  3W1B A;  1HZC A;  2ZM6 Q;  3ERS X;  1SLJ A;  3U50 C;  3F2B A;  1XPR A;  2JA5 H;  3GTO H;  5JJI A;  2R7Z G;  1OXS C;  2Q2H A;  1O7I A;  1CSQ A;  1HZB A;  3CME A;  3HOZ H;  1SE8 A;  2Q2I A;  3MEF A;  3F8T A;  2HT1 A;  4DR4 L;  5GQO A;  1HZ9 A;  1PH1 A;  2UXB Q;  2K52 A;  4DUZ L;  2R7Z H;  3GTM H;  3HOZ G;  1Q1E A;  1OXX K;  2NZH A;  3S1N H;  1YZ6 A;  4LF4 Q;  3NEM A;  1HR0 Q;  1QVF A;  3W5O A;  5IP7 H;  2K5H A;  2D0P A;  5IY0 A;  1KRS A;  2ES2 A;  2ZTE A;  4IPG A;  4WJ3 M;  4LW1 A;  2UXC L;  1P16 A;  4DR1 L;  4POF A;  3GTQ H;  1WYD A;  1EWI A;  4GOP C;  1PH8 A;  3CCL A;  1SRO A;  3H3V I;  1V43 A;  1OXU A;  3BJU A;  4R4O A;  2I5M X;  4Y7N H;  2K4K A;  4HJA A;  3HOU G;  3RZO H;  4GN5 A;  4HJ8 A;  4HIK A;  3BZC A;  4A75 A;  2UXD Q;  1S40 A;  3BU2 A;  2MNA A;  4JBM A;  4L5Q A;  1PH3 A;  3A5U A;  1N8R C;  1JJG A;  1KIX A;  4Y52 H;  1OXV A;  1VQM A;  3KJO A;  4JI7 Q;  4BXX G;  4A76 A;  4LF5 Q;  3KF6 A;  4LNQ A;  1HJP A;  4L5S A;  1JJ2 A;  1XNQ Q;  1ASY A;  1BVS A;  4P75 A;  1YHB A;  3HKZ E;  5H1S E;  2JA8 G;  2UU9 Q;  4NXM L;  3STB D;  5C4X H;  2VW9 A;  2UUC Q;  2ZM6 L;  4DR2 Q;  2CQO A;  5IYC H;  1WFQ A;  1K73 C;  1KL9 A;  1YJW A;  3I4N H;  1G6P A;  1X6O A;  2K75 A;  3T1Y L;  4B3S L;  3S1Q H;  4AH6 A;  1E1T A;  2KHI A;  4HJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...