4HIKA

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggttacggt)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 34
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hikA00
3J81i 1E24A 4L5RC 1JJGA 4BA2I 3GTKH 1VQ9A 2UUBL 3TS2A 5IYCH 1YI2A 4YWKA 4EQ5A 3M4PA 1IBKQ 4B3RQ 4J15A 1XJVA 2BA1A 1MJEA 1TWAH 3GTPH 2NVQH 4DV4Q 3I4MH 2R7ZH 1PH3A 1VCIA 3FP9A 1L0WA 4LF5Q 1YHBA 1B7YB 2DGYA 1EIFA 2WAQG 4NXMQ 2HT1A 1HNWL 1WYDA 3I55A 3IRBA 1AE3A 3HOUH 4YWMA 1AE2A 2Z0SA 5FJ8G 3I4NG 5JJLA 4IJLA 5C44H 4OO1I 5IY0A 1G51A 1VQPA 1PH7A 1A62A 3AQQA 4DV2L 3HFZB 5ELOA 4A3LG 4YCVA 1Y1WG 4X65L 3CF5A 4ME3A 3H0GH 5M3FG 4LUOA 3CC4A 2WB1G 5IYBG 4A75A 2UXBQ 4LUVA 1PH2A 4GOPC 2JK8A 1Q82C 4BY7G 3TS0A 4BXXG 5IWAQ 1SE8A 3L0OA 2I5HA 4OXPA 4JBWA 3UE0A 3CCVA 1PH1A 2VUMH 4LFBQ 1I6HH 4IOCA 2JA7G 1C0AA 1K73C 3ICEA 1LM0A 1Q8KA 5FLMG 1WCMH 3I7FA 4UP9A 3W5OA 3CC7A 1VQ8A 2OQ0A 3ER0A 4A3DG 1E1TA 2F4VQ 4GKKL 3M85A 4UY8C 1V9PA 4GLAC 3A74A 4R4OA 4A3BG 4LFAQ 4A3JH 4AQYL 1TWGH 3UDIA 4LF8Q 3G6EA 3PV0A 3SGIA 4DV6Q 3OTOQ 2VQEL 2JA8G 3BZCA 5JJIA 3HOVG 4RMFA 3K80C 3CW2C 1UE5A 2RCNA 1GO3E 3KJPA 4LF7Q 3PUVA 1PH4A 4JI0Q 1YJWA 4MNOA 4HIDA 5GROA 3ULJA 5C3EH 2ASBA 1FVIA 2WFWA 2ZTCA 3CCRA 1X56A 1FJGL 1XNQQ 3GD7A 1IBMQ 1VQBA 1IBLL 3KDFB 2HHHQ 4LF6Q 4C2MH 5C0XI 4DR5L 2NVTH 4TQUS 4B3ML 4JI2L 1HJPA 4YCWA 4BA1I 2E2HH 4AYBG 5JEAJ 3F2DA 4JYAQ 1MIUA 3TQYA 4BBRH 2DUDA 2KHJA 1BBUA 5LMUL 4DV0L 5LMNQ 3A0JA 1VQKA 1I3QH 3PO2G 3GO5A 1NBWA 3PUZA 4AIMA 4X62L 3PO3G 3FKIH 1SRUA 4DAMA 1HZBA 2VW9A 1YVCA 4B3TL 4YWLA 3DLLA 5JEAG 3F8TA 4EX5A 4GNXB 1GKHA 2JA9A 4JI3L 4C3IH 3H3VH 1YBYA 4JC0A 1Y14B 2IHFA 1I5FA 5J3BA 1SFOH 1N33L 4IFDJ 2D0PA 3B6YA 3OW2A 4BY1G 1VQMA 4JI7L 2H5XA 3AFPA 2VY3A 4QIWE 2UUBQ 4POGA 5IYDG 4DV1L 2R92G 2AHOB 4IPGA 2JEBI 4IPCA 5C4XG 2WP8J 4UP8A 1QVFA 4KHZA 4DV5L 4IFDG 2JA5H 5IT9c 1HNWQ 1PV4A 3HOWG 1SROA 4A3FH 4DR7Q 3KF8B 3H15A 3RR5A 1W3SA 4DV7L 4NPSA 4DV2Q 1Q86C 1I94L 5IP9G 3L2PA 2NVXH 2JQOA 1WJJA 1A63A 3NEMA 1XPUA 2VNUD 4QL5A 4X65Q 1LYLA 1AH9A 1PHJA 3MEFA 3HKZG 3U4ZA 4DK6C 1X55A 4LWCA 3CCUA 5E7NA 3S24A 4C3JH 4YHHL 4R4QA 2L15A 1VQLA 4QY7A 5GQOA 3T1HL 3KFUA 5M5YH 5K36G 1B70B 2N49A 3E9IA 1GVPA 1V43A 4DUZL 4Y7NH 2OTJA 4DR1L 4GKKQ 2ZJPA 1L1OB 4IFDI 1JE5A 3WWVA 1EFWA 1X6OA 4AQYQ 2VL6A 1X3GA 4JI6L 2ATWA 1L1OA 2AWNA 2IX0A 3M3YH 1X54A 2Z6KC 2VQEQ 1VQDA 2K50A 1SR3A 3D0FA 3GDEA 5IYCG 3HOXH 1LUZA 1QZHA 3CPFA 2EIFA 3CMEA 4PZ7A 4DUYL 3GTLH 3RNUA 2R7ZG 3ULPA 1MKHA 3S15H 2MQHA 4MZ9A 1O7IA 1FJGQ 2VS1A 4HJAA 1N32L 3Q8DA 4R4TA 2IY5B 1IBLQ 1ASZA 4JI4L 4JI5L 1PH9A 2NN6I 4DR5Q 4JI2Q 2R6GA 1EOVA 3BZKA 1CSPA 4A3IH 4B3MQ 1RIPA 4A3MG 2E2JH 4A3GH 1UWVA 2VQFL 5LMUQ 1E7ZA 4DV0Q 1JMCA 3KF6B 1FL0A 4A3EG 3HOZG 3S2DH 1PH5A 2A8VA 2EXDA 1C9OA 2MFIA 2N78A 4X62Q 5C4JH 1VQ7A 1XMOL 1P16A 3KF6A 2Y0SG 1Q1EA 3JC66 4B3TQ 3ZJYC 3J80c 1PYBA 4JOIC 1NY4A 1VQ6A 4JI3Q 4JOIA 3S1QH 4UP7A 1LTLA 1VQCA 1Q7YC 1N33Q 2K4KA 1CSQA 4DR4L 1YHQA 1Y1VG 3U50C 3I56A 3PCOB 3UDFA 4JI7Q 4A3CH 1SMXA 1QVCA 2MO0A 1HH2P 3L7ZC 3G71A 3ERSX 5FJ8H 1KXLA 4DV1Q 3OYYA 1PFSA 1OXUA 2PNHA 2BH2A 4GKJL 4A3LH 3F1ZA 3CP0A 4JBMA 1A0IA 1Y1WH 4R4IA 1VQ4A 1UE1A 4DV5Q 4P74A 1VQEA 5M3FH 5IYBH 4LF4L 4IJHA 2CCZA 4KHPL 1VQGA 1G291 1K0RA 4P72A 3KYHC 1HZCA 3STBC 2A19A 1Z47A 3KJOA 2YU9H 1VQIA 4BXXH 1Q1BA 4DV7Q 1TXYA 1PYSB 4X64L 1CKOA 1QVGA 1I94Q 3RLNA 2LXKA 2JA7H 4JV5Q 4DR6L 2B3GA 3RN5A 1J6QA 4OWXB 1I50H 2WAQE 4BBRG 1NE3A 3STBD 4DV3L 3T1YL 1YHAA 5BR8L 5ELNA 4A3DH 4QQBX 1UE7A 4YHHQ 2ZTDA 1VQ5A 2R7DA 4A3BH 2ID0A 2IT1A 3KDFA 2CWAA 2KHIA 3FKIG 4DR2L 2FXQA 3CAMA 1N34Q 1KAWA 2PI2A 1NMFA 3KLWA 2YTXA 3CMAA 4TVAB 4DUZQ 2WB1E 4B3SL 2Q2IA 3HOVH 3JAMi 4DR1Q 2OTLA 1VQNA 5HY6A 1KRTA 1PVOA 4DPGA 2CFMA 3A5ZB 1HNZL 3J7A5 1M1KC 3GTQH 4JI1Q 4R1JA 3F2BA 4JI6Q 3PF5A 4NXNL 4L5TA 4A93G 1RL2A 1KD1C 3CCEA 5M5WH 3CCQA 3RZOH 4GNXA 3D31A 2UU9L 1X3EA 2E8GA 2YV5A 1WI5A 2JE6I 1X65A 5IP7G 2AMCB 4OX9L 4DUYQ 3S16H 2PQAB 4KLKA 3BU2A 2HQLA 2UXBL 2K5HA 4A3FG 3M4OH 4H02A 3ULLA 2QA4A 3PO2H 5GAEC 3K7AH 2MO1A 3S1RH 1VQHA 2D62A 2PQAA 2LXJA 1R9TH 1XPRA 3NBHB 4JI4Q 3PO3H 2QGQA 4JI5Q 3S2HH 2K75A 2UUAL 4WJ3M 4HJ9A 2RHQB 4BBSG 2VQFQ 4IPDA 3F2CA 2K5VA 2GN5A 3UE1A 1JJ2A 1EWIA 4LFCL 1XTDA 3KOJA 1TWFH 5M3MH 4NB3A 2JJQA 4GN5A 3AEVA 4YCUA 2AWOA 4YY3L 4GN4B 1K8GA 1XMOQ 1J5EL 3HKSA 1IYJB 2N3SA 4OONA 1XMQL 4AYBE 4BY1H 5EAYA 4DV6L 3HOYG 1XNRL 2OWOA 1KQSA 2JA6G 1SN8A 2ZJRA 5IYDH 1BKBA 2NZOA 1HR0W 2R92H 4A3KH 2ALYB 1E1OA 3DM3A 3PUYA 2R93G 4P71A 5C4XH 2B63H 1GM5A 4DR4Q 3RZDH 3M9BA 3RN2A 1Q46A 4X66L 2PI2E 2D0OA 4JBJA 3HOWH 1EQRA 3EN2A 5DLQE 1L1OC 1GD7A 1V1QA 1N36L 3E0EA 1BVSA 3HOXG 3TRZA 2Q2HA 4HJ5A 3NENA 5IP9H 3J81c 4ALPA 3U4VA 4LF9L 1U0LA 1HNXL 3K0XA 2CWPA 3S14H 4LF4Q 2EQSA 4KHPQ 2GVAA 1Z9FA 3I4MG 1CKMA 3PUXA 3S1NH 4AH6A 1IXRA 4X64Q 1JB7A 4GLXA 2I0QA 4WJ4A 3HOUG 4OO1G 1PA6A 4GS3A 4DKAC 5C44G 2UXDL 1WFQA 2NVYH 4QGUA 1K9MC 3MXNB 1M90C 4C3HH 1EYGA 3T1YQ 5BR8Q 4PG3A 3VDYA 3H0GG 1Q12A 4IPHA 2ZM6L 2I5MX 4PZ6A 4DR2Q 3J7ZC 1CKNB 3NELA 1BBWA 2YTVA 2Q2TA 3TREA 2VUMG 4Y52H 2ZJQA 3HKZE 4B3SQ 3CPWA 2E5LL 4L5SA 4LW1A 1CKNA 3RLFA 4QJFA 1E22A 3LGJA 1QUQB 1HNZQ 1WCMG 2RHSB 1N8RC 4HIOA 1PH8A 4A3CG 4K0KL 4NXNQ 4JG2A 4R4CA 1QUQA 3AFQA 4DR7L 4A3JG 1IL2A 2E2IH 1VQJA 4JI8L 2UU9Q 2IHEA 2I5LX 4O0AA 3I4NH 4DAYB 4KI0A 1TWCH 3G48A 5C0XJ 1YITA 3CCSA 4OX9Q 4GOPB 4A3MH 3FHWA 1EQQA 1VQFA 4IOAA 2UXCL 2F3IA 3K7UC 1HR0L 4A3EH 1DGSA 5AJ3L 3HOZH 2GVBA 5H1SE 3A5UA 4PMWA 4GOPA 4P73A 1YZ6A 5C3EG 2IX1A 4BY7H 1Q81C 4A4IA 3S17H 1QZGA 3J80i 3GTGH 3I4OA 2NZHA 5GADC 2UUAQ 3I2ZA 1C7YA 5C0XG 3PGZA 1ASYA 1HZ9A 2HIVA 2K52A 3EIVA 4APVA 1T9HA 4LFCQ 4X6AH 3CQZH 5FLMH 1NTGA 1K8AC 1EIYB 1Y1VH 4DNIA 4DR3L 3PUWA 3CD6A 4YY3Q 3GTJH 3M7NA 1J5EQ 1G6PA 4A76A 1XMQQ 1JT8A 2UUCL 1U5KA 2LSSA 1XNRQ 1S3OA 2N8NA 3T1HQ 1D7QA 3JAMc 4GN3B 2VZAA 2JA8H 3CCMA 4HJ8A 5LMNW 4UPAA 3J81j 2Y0SE 4X66Q 1IBKL 4B3RL 1KHIA 4FDBA 2C35B 4DV4L 1N36Q 2PMZE 4NXML 4LF5L 1K83H 1OXSC 4GLVB 2B29A 3K8AA 4GNXC 3W1GA 3PSIA 4POFA 1UEBA 4LF9Q 1HNXQ 1NJIC 3U58A 2HIXA 3UDXA 2AKWB 2V1CC 4MTNA 5IE8A 4HIKA 1IZ6A 1VQAA 2JA5G 1OXXK 4P75A 5IWAL 1N32Q 4LFBL 5FLXc 2UXDQ 1N9WA 2R7FA 3GTMH 1KRSA 4HJ7A 4LNQA 1YIJA 1EUJA 1SLJA 3BJUA 5M3MG 2KCTA 2OQKA 1VQOA 1X9NA 3H3VI 1E3PA 3PF4A 2ZM6Q 2K14A 3GTOH 1YNXA 1HZAA 2F4VL 4OWWB 4A93H 3CCLA 3K81C 3CC2A 4LFAL 2F52A 2KBNA 2ZTEA 1OXTA 2YYZA 4LF8L 2OCEA 2E5LQ 1A8VA 4A3KG 1PH6A 4O2DA 3OTOL 5IP7H 4XIGS 2B63G 1JJCB 1OTCA 3CCJA 1W2BA 1CUKA 1YEZA 2BA0A 4K0KQ 1K3RA 4LF7L 4L5QA 2A1AA 2BH8A 4JI0L 4LUZA 5JJKA 4HIMA 4JI8Q 4IO9A 3RLOA 1KL9A 4JV5L 4JCVE 3W1BA 3EBEA 3E9HA 1KC8C 1OXVA 1XNQL 3M4QA 1B8AA 1IBML 1P8LA 1X3FA 3S1MH 4BBSH 2XTIA 2HHHL 4LF6L 4GKJQ 2UXCQ 1YJNA 1MJCA 1NMGA 1HR0Q 4JYAL 1WOCA 5AJ3Q 2MNAA 1FGUA 4XTCS 1TWHH 5LMNL 5M5XH 2XGTA 1YJ9A 1KIXA 3TEHB 2CKZB 4RG1A 5GAGC 2KENA 1N34L 2Q2UA 3HOYH 2JEAI 4DK3C 2RF4A 3CXCA 2NN6G 3AYHB 2QEXA 3UDGA 5HGQA 2JA6H 2R93H 2CQOA 2ES2A 3PIOA 4DR6Q 4A3IG 3G4SA 1UE6A 1VS0A 2YTYA 4A3GG 4PZ8A 1H95A 4DR3Q 4DV3Q 1L2FA 4OWTB 4JI1L 5GAHC 4JBKA 1D8LA 2KCMA 1S40A 1S72A 2UUCQ 3PIPA 2K5NA 1XPOA 2Z6KA
chains in the Genus database with same CATH superfamily
4BA2I 3NQTA 4XT3B 2UUBL 5IYCH 3I4NB 4EQ5A 3GTPH 4LF5Q 2Q8TA 3JAME 1HTPA 3I55A 2WB1B 3TSSA 1HPCA 3K59A 1LT6D 5CV8A 4IJLA 2YU9B 3AQQA 3GTGB 3HFZB 1G91A 4A3LG 3CF5A 3H0GH 1FNVA 5IYBG 1AZPA 2JK8A 3L0OA 4LFBQ 1PH1A 4J1MA 1WTHA 3KBGA 1ZKOA 3I7FA 4UP9A 3W5OA 2BDOA 5C4HA 3HOVB 4KKUA 1V9PA 2HDMA 2P5ZX 3ND8A 4GLAC 4R4OA 4A3BG 3G7LA 4LFAQ 4AQYL 1TWGH 1A2UA 3SGIA 4DV6Q 2JA8G 1A3TA 5JJIA 4RMFA 4ME5A 3FMCA 3CW2C 1UE5A 3M7GA 3KJPA 1PFMA 1EY5A 3PUVA 5ELFA 1YJWA 1GJXA 4XQJA 5GROA 4AYBB 1FVIA 3S16B 1CHPD 1X56A 1FJGL 3GD7A 5A2QL 1NAPA 1IBLL 4UAIA 3KDFB 4DR5L 4JI2L 1WTQA 2E2HH 5JEAJ 1MIUA 3S2HB 2ZXPA 4WRDA 3J80L 1EZ8A 5EPJA 3A0JA 2MPMA 2M2LA 1I3QH 3PO2G 3GO5A 5IOCA 4G7ZC 3PUZA 4AIMA 4ZUIA 1SRUA 3D6CA 1YVCA 1IYUA 4B3TL 2XNAC 4F87A 3QWNA 1GKHA 2JA9A 4C3IH 1M4VA 1EWCA 1YBYA 4EGVA 1Y14B 1SFOH 2B2YC 5C4XB 2D0PA 2A74C 1VQMA 5EBDA 1DCZA 5EPKA 4QIWE 1K28A 2A5HA 4DV1L 1SNPA 4HMIA 4UP8A 4KHZA 1SJHD 4X3UA 4QUFA 3OIQA 1SNDA 5IT9c 3OWEB 2V4DA 4DR7Q 1K3BC 3HKZB 3KF8B 2RSOA 3RR5A 5IGEA 2K5WA 4DV2Q 3SHLA 1A3VA 2BDNA 3NEMA 3KF8A 2VNUD 4X65Q 1AH9A 2NVYB 1X55A 4HN7A 5E7NA 3S24A 1LTRD 5JOBA 1IL8A 1SBBB 5GQOA 5K36G 1SNQA 4Y7NH 3U9OA 5JAVA 4DR1L 4GKKQ 1JE5A 2IWHA 4E6IA 2QCPX 2XRSD 4XYQA 1BF4A 3HEJA 4BWGB 2AWNA 3M3YH 1X54A 2Z6KC 3OW7A 2VQEQ 1PZJD 4G57A 2K50A 3HOXH 3SVMA 1QE6A 2F0HA 3BVZA 5J22A 1QZHA 2EYFA 3RNUA 3ULPA 3SK8A 4A3MB 1JWSD 2VS1A 1SE3A 1PTOF 4R4TA 2L5TA 4DGZA 2IY5B 1SEBD 4B3MQ 2OXPA 2R6GA 3BZKA 4A3IH 4KJNA 1RIPA 1Z6HA 2EVBA 1K0SA 1ENCA 1ILPA 2CH4W 1H9JA 1IKMA 2F0EA 5C4JH 1XMOL 3FPPA 1PLFA 1EFID 4IUNA 4JOIA 1O7YA 2K4KA 1CSQA 3P75A 1YHQA 1Y1VG 1SDFA 1Q3LA 3N52A 1BXTA 5FLXE 4A3CH 4CBVA 3NP8A 1I4GA 3Q6SA 5C5LA 1ZXTA 1D6EC 2BH2A 2LMCB 3CP0A 3F1ZA 4XQNA 3WDNA 1UE1A 4DV5Q 4P74A 4ZCKA 1PRTB 3H91A 1L0XB 3R2TA 4P72A 1K0RA 3STBC 1HZCA 1JQYD 3CRLC 1Z47A 5COYA 1S5CD 4DV7Q 2QF7A 1I94Q 3ONAB 1JOQA 5EPLA 2FINB 2F03A 4KJOA 3T56B 5IT9E 5DEHA 1WTPA 3K0YA 1I50H 4BBRG 4DV3L 3GTMB 3T1YL 1YHAA 3VA5A 2CWAA 2KHIA 3FKIG 4DR2L 5D65A 1NMFA 2HDLA 4TVAB 2WB1E 4B3SL 2Q2IA 1EY0A 3JAMi 1B9NA 4FO2A 2OTLA 1VQNA 1SJED 1KRTA 2CFMA 3J7A5 2ICEC 4JI1Q 4A93G 1RL2A 1KD1C 4QMGA 3RZOH 4GNXA 3P7JA 2D2CC 3EFXD 4RKLA 2JE6I 2Q8IB 4DF7A 1S4ZA 4RA8A 1ONLA 2B2TA 2F0VA 4H02A 3TP5A 2QA4A 4S3SA 2MO1A 3S1RH 2D62A 4XT1B 5BN3A 3PO3H 1F2LA 4JI4Q 1AN8A 3HZXA 4U68A 1E2ZA 1ICWA 3EJIA 3MXPA 1JJ2A 1XTDA 2QDLA 3KOJA 4NB3A 5E4XA 3MC0B 4YY3L 4BY1H 1B53A 2FMMA 3HKSA 4AYBE 1LABA 2QEJC 5EAYA 4DV6L 1XNRL 2JA6G 1B4OA 5JPNC 1BKBA 2R93G 2ALYB 1E1OA 3HOXB 5ISRA 1T5XD 4DR4Q 3RZDH 3M9BA 3RN2A 4IFDH 1Q46A 2PI2E 2D0OA 5IIFA 3HOWH 5DLQE 3EN2A 3X3MA 1N36L 2KA7A 4K8IA 4ABNA 1ESFA 1BVSA 3I4MB 5IP9H 4ALPA 4Q0FA 1U0LA 2CWPA 5C44B 2GVAA 3MA2B 4DNTB 1KLGD 5C4JB 4GS3A 2I46A 1GUGA 1M90C 4C3HH 1I6HB 1KAAA 3H0GG 1H9RA 2ZM6L 1GUNA 5ELEA 3J7ZC 2PMZB 3NELA 3TREA 3HKZE 3VYRA 1QILA 1EWHA 3RLFA 1N8RC 4K5XA 4JG2A 3Q22A 4DR7L 3AFQA 1VQJA 2UU9Q 2ZT9C 3NWSA 2I5LX 1RDPD 2BE5C 5KNCA 3GV6A 5C3EB 1F2MA 4KI0A 5C0XJ 3CCSA 2NTSA 2EDGA 3FHWA 1BDOA 3O13A 2KUMA 3K7UC 3H6MA 2F0GA 2ZXOA 3HOZH 1TS3A 4PMWA 3KLSA 2Z4HA 4C56C 3A8JE 1HFNA 2NZHA 1C7YA 4KHVA 1ASYA 2HIVA 3EIVA 5FO9B 4IUPA 3CQZH 4JVZA 3PUWA 3GTJH 1G6PA 1JT8A 1RTNA 1PZKD 2N8NA 5IGDA 3T1HQ 1JWUD 3RZOB 1SXTA 4CDCC 2JA8H 2VZAA 3BYTB 2RBMA 4HJ8A 3CU7A 4C3IG 1F2ZA 1IBKL 4B3RL 3OIPA 2C35B 2A68C 3FDTA 3FVQA 2QKIC 4DV4L 4JW0A 4NXML 1ESRA 4GLVB 1STBA 1VF7A 3S1RB 3U58A 1V8QA 2K5QA 3H94A 5IE8A 5KYIA 4HIKA 3HGBA 1IZ6A 3T53B 1SYDA 3LNNA 1OXXK 1N32Q 3LX0A 1N9WA 4K6DA 1SNMA 4HJ7A 4LNQA 5M5YB 3I73A 1VQOA 1FNWA 3PF4A 1YNXA 1HZAA 4OWWB 3RMHA 1IW7C 1TR5A 2ZTEA 5IGFA 4NKLA 4LF8L 2E5LQ 4A3KG 3P20A 1CHQD 3QO2A 2BA0A 1K3RA 4JI0L 5DM73 2XRQD 5JJKA 2G9DA 4QB4A 3GTLB 1CQFA 3EBEA 1A15A 1XNQL 1BR9A 1F9QA 2AQ3B 4BBSH 1P8LA 1X3FA 3QOJA 3NWTA 3S1MH 2HHHL 1MJCA 5AJ3Q 5L37A 1TWHH 4EVOA 5GAGC 2Q2UA 1U4MA 1I4HA 4DK3C 3AYHB 3VR5A 5HGQA 2EJGC 5K36H 2CQOA 4A3IG 4PZ8A 4JI1L 5GAHC 1CZGA 2UUCQ 4FXDA 4CHTB 3S1QB 4OIKA 3DWAA 5JVH3 1E24A 1HTLD 3NBIA 1TS5A 3M4PA 4UDUC 1MJEA 2BA1A 2HCIA 1TWAH 3NPPA 2NVQH 3ERQA 2FJ2A 3AB9A 3K58A 1HNWL 1YHBA 2WAQG 1EIFA 2HT1A 2Z8LA 3HOUH 5JJLA 1G51A 5ELOA 4G7HC 5E3FA 4LUOA 4H0LC 2K7VA 4A75A 2UXBQ 4LUVA 4GOPC 3TN2A 1XWEA 3D8GA 3FEWX 5IWAQ 2I5HA 3UE0A 2VUMH 1FYCA 4QIWB 4A3BB 4HTHA 1EIHA 5A35A 5IODA 1Q8KA 5FLMG 1C48A 2RQXA 2JA8B 3CC7A 1VQ8A 5NUCA 3VR2A 3M85A 1HCZA 3A55A 2FHTA 4A3JH 3G6EA 3OTOQ 3BZCA 4G7OC 1PXUA 2AQ2B 3K80C 4H44C 5M5WB 2PO4A 3H3VC 4LF7Q 1PH4A 4MNOA 4HIDA 1G2SA 3R8BA 2ASBA 2WFWA 1CK1A 3I8ZA 1IBMQ 3PO2B 3A54A 3K7AB 4LF6Q 2NVTH 1I4PA 4C2MH 4TQUS 4BA1I 3F2DA 3TQYA 4BBRH 2KHJA 5LMUL 2K32A 4DV0L 1TVXA 4QF4A 1NBWA 1STAA 3PO3G 1GUSA 3FKIH 2VW9A 1LT5D 5BN5A 1B44D 1OO9B 3F8TA 4EX5A 3H3VH 3E6ZX 4K8JA 4HCSA 1I5FA 1SYEA 1N33L 3B6YA 3OW2A 4BY1G 4JI7L 2ICIA 2EPBA 1AEXA 4POGA 4R8NA 2K05A 4FF2A 3TDQA 4IQZA 3T13A 4IFDG 2B8GA 3C1FA 5CC4A 5D14A 3HOWG 3S14B 2F1MA 1SROA 3DWPA 1CA6A 2F0SA 5HGTA 1WTWA 4NPSA 5IP9G 1B3AA 2NVXH 2JQOA 3S1NB 1XPUA 4QL5A 1K8MA 1LYLA 2EXZA 1C4QA 3AMUA 4X3KA 3MEFA 3U4ZA 3ND9A 4DK6C 5C5MA 3ZYYX 1LTSD 1EYDA 4C3JH 4R4QA 2OT2A 3I91A 2Z6BA 5JJZA 1NR4A 3T1HL 3KFUA 1B70B 3E9IA 3KUPA 2OTJA 2NZ1D 4C3HG 2ZJPA 1L1OB 3K5MA 3WWVA 1AFPA 2F0TA 1Y69U 1PMRA 2LKVA 1X6OA 4JI6L 2NVQB 5LL6X 1L1OA 2IX0A 4FF3A 2L12A 3KLRA 2BCOA 2E75C 5CYUA 2EIFA 2E2IB 2K33A 3MFYA 3QB3A 3CMEA 4DUYL 2R7ZG 2MP1A 2B2WA 1O7IA 2EYPA 4HJAA 3K57A 4DN4M 2B2UA 3Q23A 1N32L 2PCFB 1ASZA 4JI5L 1EOVA 1CSPA 2MHVA 1W6JA 4PNYA 1H9SB 2B2VA 1RKNA 2SNSA 4A3GH 1JMCA 3KF6B 2EZVA 3HOZG 3S2DH 1PH5A 1HRJA 1MBYA 1XX8A 1C9OA 1H9SA 2MFIA 4XXEA 4X62Q 1VQ7A 1Y1VB 3KF6A 2RA4A 2E74C 4RCOA 1PYBA 2CW0C 3A7LA 4JOIC 4R9WA 1FNUA 1VQ6A 3QR8A 4JI3Q 2G9HD 2DJFC 1VQCA 3J81L 1RF2D 2XN9C 3I56A 3UDFA 4F88A 4KMUC 1HH2P 3L7ZC 1O78A 5FJ8H 5I2YA 2JYOA 1DJRD 3TZUA 1PFSA 1E0BA 2PNHA 4O42A 5E4WC 1A0IA 1Y1WH 1VQ4A 2NVTB 5M3FH 1A3UA 4LF4L 4IJHA 1D5MC 4BBRB 4RAUC 3KYHC 4IUTA 1EEID 4X64L 1KNAA 4JV5Q 1QVGA 2JA7H 3FKIB 3L3OC 2B3GA 3RN5A 1WVLA 3STBD 3IL8A 4A3DH 5C3WA 1UE7A 1ZYRC 4YHHQ 1VQ5A 1IYVA 2ID0A 2IT1A 3KDFA 3I72A 5AFWA 2FXQA 2PW7A 1N34Q 3OMGA 3GTOB 2C5CA 2PI2A 3CMAA 4DUZQ 5LHY1 4A93B 1PVOA 5LL6S 4HMJA 4TSSA 5CV5A 1SNCA 3CCEA 5T1GA 2H1EA 2YV5A 1WI5A 3R3OA 2IW3A 2AMCB 4OX9L 2NVXB 2DY7A 2EJFC 2B2TC 1HQMC 2UXBL 4O1NA 1EZ6A 4A3FG 3M4OH 3ULLA 5GAEC 1VQHA 1R9TH 4HSPA 1BCPC 2UUAL 4BBSG 2L11A 3W2DA 4CDEC 4U673 5JEAH 2VQFQ 2C9OA 2GN5A 3UE1A 2JA6B 4LFCL 2R93B 2JJQA 4GN5A 3JAML 2AWOA 2D9UA 1IYJB 2N3SA 5FOBB 4ILWA 2OWOA 1KQSA 3A7AB 2WIIB 2NZOA 4OL7A 2R92H 4G4KA 4A3KH 1QOHA 2F0NA 1RJTA 4JBJA 4L63B 1EQRA 4ZKBB 3GTPB 1GD7A 1V1QA 3E0EA 2Q2HA 1SYFA 2MGSA 3U4VA 4LF9L 3NE5B 1HNXL 4KK7A 3K0XA 1CQVA 1KDAA 2EQSA 4KHPQ 1Z9FA 3S2DB 1IXRA 3H0GB 4WJ4A 2I0QA 1FR3A 3HOUG 2UXDL 1WFQA 4QGUA 4IALA 5BR8Q 2F0UA 4L8JA 4GZYC 1Q12A 4IPHA 2I5MX 1LTGD 3QJYA 2EY1A 3J7YW 3DHQA 4OIJA 2VUMG 2ZJQA 2PW5A 3CPWA 4ULLA 4L5SA 3EVQA 4QJFA 1TWGB 1E22A 2SNMA 2K03A 1QUQB 5I6WA 1HNZQ 2RHSB 4IN3A 4ZKCB 1JOOA 4NXNQ 1JOKA 1S5DD 1QUQA 3WOEA 4A3JG 2KCNA 1AP0A 4FXGC 2EYMA 1ICFB 1TWCH 4LJZC 1VQFA 4IOAA 1T5EA 2F3IA 4A3EH 1B3QA 2GVBA 1JR0D 4ZRZA 2E2HB 1TKWB 2BE5D 2F3VA 4P73A 2IX1A 2PZUA 1C8CA 3S17H 1QZGA 3J80i 3DWQA 1I3QB 3A8IE 1HZ9A 4B9WA 1DOLA 4IURA 1BQQT 1T9HA 4ODGA 3WOFA 4X6AH 5FLMH 1AZQA 1NTGA 4DR3L 3PQIA 1J5EQ 4A76A 1XMQQ 3EQLC 2O4XA 2EYJA 4C3IB 2LSSA 5CMDA 1H9KA 1S3OA 1SFOB 3NHHA 1D7QA 1BBXC 1DD2A 2B39A 4DK0A 3NTIA 4X66Q 1CZWA 4FDBA 1VF5C 4LF5L 1K83H 2B29A 3K8AA 2TSSA 5CBAE 1NNXA 3V2TA 3UDXA 2V1CC 2A68D 3FPUB 1SYGA 1VQAA 5KGUA 3OSOA 1DONA 1PFBA 1YNNC 4LFBL 4FNFA 1KRSA 1EUJA 1SLJA 3BJUA 4A3KB 1X9NA 4Y7NB 2HQEA 1KABA 4C3JG 4LFAL 3CC2A 2IX3A 2KBNA 4KD3A 2YYZA 3VR3A 5CV6A 5IP7H 2R3ZA 2J4XA 3M3YB 1JJCB 1OTCA 1ET6A 5EKLA 4K0KQ 1IW7D 4HIMA 1ET9A 4JI8Q 1KL9A 4JV5L 4MTKA 4JCVE 1LLRD 3W1BA 1KC8C 2D5DA 3V96A 4J6HA 1D5ZC 3M4QA 1B8AA 4GKJQ 2UXCQ 1HR0Q 1NMGA 1X3PA 4A3IB 5FLXL 2MUYA 4FVMA 5M5XH 3TEHB 2CKZB 2KENA 1N34L 3HOYH 2JEAI 4RFBA 2RF4A 3NTHA 2WKCA 3CXCA 3UDGA 2PQEA 3RUZA 3PIOA 4DR6Q 3NSWA 2AUJD 2EY5A 4A3GG 4OWTB 4DNRB 3NUCA 1D8LA 2XWJB 3PIPA 1B2TA 2Z6KA 1JJGA 1WTXA 5IT9L 2WAQB 3GTKH 1VQ9A 3VYTA 2BOSA 1TQOA 4DFAA 3DEOA 1ML0D 1FGBD 3T51B 2R7ZH 1VCIA 3FP9A 1L0WA 2DGYA 3BDCA 3BYYB 3OPOA 3IRBA 1AE3A 1AE2A 1CTMA 2Z0SA 4LAAA 5FJ8G 5G3LD 4OEMB 5IY0A 1VQPA 4OO1I 1A62A 4DV2L 4FF4A 4FYDA 4YCVA 1Y1WG 4X65L 4ME3A 5M3FG 3CC4A 3BS1A 1I50B 1PH2A 1Q82C 4BY7G 1SSOA 2X6GA 4JBWA 2XIWA 5DNFA 3VR4A 2JA7G 2N88A 1C0AA 1TY2A 1K73C 1PDQA 3KBXA 4KN7C 1WCMH 4GKKL 1HUMA 3ER0A 4A3DG 2F4VQ 4HSVA 4K2KA 5C6AA 2KVMA 3N6RA 4CKBA 5DAUA 2VQEL 2KECA 4ZQ3A 2AUKA 2NTTA 2JXMB 1GO3E 4DXGA 1GUTA 3OHXC 1KDCA 3D4WA 1F2YA 5C0XH 5C0XI 2A73B 4B3ML 3PO3B 1HJPA 4JYAQ 3R93A 2DUDA 5EKKA 3DUZA 4FF1A 5LMNQ 1VQKA 2WV6D 4ZYSA 1HZBA 5CORA 4BY1B 4L6TB 1LV9A 5D3IB 5JEAG 4K5VA 2K5DA 5BN4A 2IHFA 5J3BA 3T16A 2H5XA 3VYSA 3RZDB 3AFPA 2N55A 2VY3A 4RGNA 3HOWB 2UUBQ 3IAYA 1EY7A 2DNCA 2HUGA 2R92G 2AHOB 3EA6A 1X32A 1QVFA 3HG9A 4DV5L 2JA5H 2PPBC 1SE4A 4A3FH 3OWFA 5FKAC 2JSOA 1JWMD 1W3SA 4DV7L 1MHWC 1Q86C 1I94L 3L2PA 4N9TA 2VXWA 3E5SA 2A69D 1Y8OB 1MGSA 2XVSA 4LWCA 3CCUA 4K14A 4C3HB 2L15A 3PIO3 1VQLA 5CGKA 1HHVA 4N8FA 5KIXA 4QY7A 5ELDA 2N49A 4KKTA 3PIP3 4RHRA 2F0MA 3K5OA 4EQNA 1LTAD 1EYCA 4AQYQ 2ATWA 2VL6A 1X3GA 2QW7A 2R7ZB 1BO0A 1F9SA 1SR3A 3GDEA 1EY4A 1LO5D 1LUZA 2F0DA 2KQ3A 1A2TA 4FXKC 2KHSA 2B2WC 2PNRC 3S15H 2MQHA 3BDLA 4KY5A 1FJGQ 4DK1A 3HOZB 3Q8DA 3TBIB 2NN6H 2K1BA 2KOLA 1IBLQ 4JI4L 1J8IA 2NN6I 2QILA 4DR5Q 4JI2Q 4K5WA 2E2JH 1UWVA 2EY2A 4H13C 2F3WA 4A3EG 3C3LA 1KDBA 5T1IA 2A8VA 2N78A 3CQZB 2Y0SG 1Q1EA 4B3TQ 3GTJB 3ZJYC 5IGGA 3J80c 3OOCA 1K8OA 1B1ZA 1II3A 5KYLA 1HA6A 1Q7YC 4J8QA 4V190 4DR4L 3FRPB 3U50C 3PCOB 2L0CA 2CW0D 2MO0A 1J9OA 3G71A 3U9SA 1CA5A 3I90A 4DV1Q 4GKJL 4JBMA 2DJGC 4R4IA 4I7AA 1DM0B 1I4XA 1VQEA 1QJOA 3BZDB 1VQGA 1G291 2YU9H 4BXXH 2A19A 1VQIA 3TMEA 4R8IA 1BCPF 1PYSB 2EE1A 1CKOA 2B8FA 4DA2A 4DAPA 4DR6L 2WAQE 2KJXA 1NE3A 4N8X1 5ELNA 4QQBX 1H9MA 2XWBB 2M9VA 3KLSX 1F9RA 3CAMA 1G2TA 1KAWA 1TS2A 3HOVH 1I4QA 4DR1Q 1STNA 1ZYRD 2NB0A 2LY7A 4DPGA 3Q0AA 2K28A 3HRZC 4KY7A 1M1KC 5KRUA 4R1JA 3F2BA 3PF5A 2JP1A 1I4RA 1O80A 1GHKA 4WORA 2O5JC 1NUCA 4A3FB 3D31A 1DOMA 2UU9L 2E8GA 3SEBA 5IP7G 1LTBD 2CH4A 1EY9A 3S16H 2PQAB 4KLKA 3BU2A 4BBSB 3S1MB 2RDGA 3QOLA 3K5LA 1RHPA 1QNUA 2X6LA 2PQAA 2A69C 2LXJA 1SAPA 1BNZA 1TWHB 3S2HH 4RKBA 2KEEA 1XYIA 4WJ3M 2RHQB 1M8AA 5I2XA 1L0YB 3F2CA 2K5VA 2I07B 2L55A 5F2DA 1E2WA 1TWFH 4NW2A 4YCUA 2RDFA 1BCPD 1XMOQ 1K8GA 3HOYG 4Z9CB 1SN8A 3J7AF 2ZJRA 5IYDH 5A2QE 3DM3A 3PUYA 4P71A 5C4XH 1RODA 4Q5VA 3J80E 3E3XA 1TWAB 3S15B 3RD4A 3TRZA 4HJ5A 3NENA 3A56A 2F0OA 3CKIB 2J0TD 2SDFA 3HOUB 1SMYD 2E2JB 1CKMA 4CKCA 3PUXA 4AH6A 1Q90A 2F0FA 4OO1G 1PA6A 2EY6A 2NVYH 1K9MC 2VUMB 3F2UA 3T1YQ 4PG3A 1FD7D 3VDYA 5JVG3 1STYA 4CKEA 1IHZA 4NP5A 1QNKA 4PMBA 4PZ6A 4EQPA 4DR2Q 1CKNB 2EYLA 2VB3X 4Y52H 4B3SQ 4N9PA 2E5LL 2A6HC 4HR7B 1CKNA 4A3JB 5C4ZA 2WACA 3LGJA 4KTAA 1XXGA 1WCMG 1PH8A 1HXYD 4KN4C 3C46A 1JE4A 4MIUA 2IHEA 1LACA 2F0JA 4DAYB 3G48A 1X3QA 1YITA 4GOPB 4A3MH 3NTKA 2IJ0A 2RSNA 1EQQA 3J7AV 1EEFD 2DN8A 1DGSA 4DAYA 5AJ3L 4C2MB 5H1SE 2F0IA 3MXGA 4GOPA 1A6XA 3TP7A 1SYCA 4BY7H 1PRTC 1Q81C 2NUCA 3I4OA 5GADC 3I2ZA 2CQAA 5C0XG 3PGZA 1BOSA 5CR3A 2OEOA 4DAVA 2K52A 4APVA 2Q8RE 1K8AC 1EY6A 4DNIA 1EIYB 4XQQA 3CD6A 2FFKB 4YY3Q 3M7NA 3R2IA 2UUCL 2E2DC 1XNRQ 3PMFA 1S5BD 4FP5D 3DXJC 4UPAA 4ZAIA 5KEEA 1KHIA 1Y8NB 3AU7A 1N36Q 3Q24A 1OXSC 1D5XC 4GNXC 3W1GA 4POFA 1WD1A 2A6EC 5ELBA 4MTNA 3GP7A 2O5IC 2JA5G 1TWFB 5I6YA 2RVLA 3SR1A 5IWAL 5FLXc 4C3JB 3K6OA 2R7FA 2F4IA 3GTMH 2HD3A 2AQ1B 1DXMA 5M3MG 1U4RA 1E3PA 2ZM6Q 1YNND 4RWSC 3K81C 5J39A 1OXTA 1QG7A 2OCEA 1PH6A 1B9MA 4O2DA 4WJWA 3OTOL 2B63G 2EYOA 3S9WA 3CCJA 1W2BA 1CUKA 4NDXA 1YEZA 5I9OA 1CI3M 3OMCA 4LF7L 4L5QA 2EJMA 4LUZA 1DOKA 4IO9A 4UHVA 3E9HA 1SMYC 5FO7B 1IBML 1MSGA 2XTIA 4LF6L 1WOCA 1CM9A 2J7ZA 3DM1A 4XTCS 4WFN3 1KIXA 2XGTA 1ENAA 2L9HA 4A3GB 3TP8A 3M4YA 2NN6G 1G8ZD 3E0JA 2QEXA 1G6ZA 1EQVA 3SK6A 3MXUA 3G4SA 1UE6A 1VS0A 1H95A 2F0WA 2H4OA 4M1UB 1U4PA 3VR6A 4JBKA 5CBEE 3I70A 1O7ZA 1JC7A 2K5NA 3MEHA 3J81i 4L5RC 4IUVA 2L1BA 1TU2B 1YI2A 3I3CA 4YWKA 1IBKQ 4B3RQ 4J15A 1XJVA 4DV4Q 3I4MH 1PH3A 4MHEA 1Y1WB 4NXMQ 1B7YB 5M3FB 3SXHA 1WYDA 4OGQC 3I4NG 4YWMA 3P1HA 4BY7B 5C44H 1PH7A 4I65A 1EY8A 4M8AA 2JA7B 1S5ED 4IZ8A 1CFMA 2WB1G 4XYOA 4CDFC 3TS0A 4BXXG 1SE8A 5EJWA 4OXPA 3CCVA 1UUPA 2Z9HA 4A3DB 1I6HH 4HAEA 4IOCA 1VDZA 4OELB 1LM0A 4KV6A 2OQ0A 1E1TA 4UY8C 2R61A 3A74A 4PMCA 2IPKD 4P2CB 3EROA 3UDIA 2PZWA 4LF8Q 3MFGA 3PV0A 3HOVG 4K6LA 2RCNA 4QCLA 3A8KE 1LTID 4QUCA 4JI0Q 3QG1A 4RGMA 3ULJA 5C3EH 2CVRA 2ZTCA 3CCRA 1D1KA 5CV4A 1XNQQ 3M4OB 1RD9D 1VQBA 2HHHQ 3ICEA 4HCEA 1R9TB 2LFNA 2K01A 4KKSA 4YCWA 4AYBG 1GOZA 1BBUA 1NR2A 1QB5D 1F77A 1PTOD 4IUUA 4ZUJA 1NSNS 4X62L 4LK1C 4DAMA 1QCBD 4YWLA 5KNBA 3DLLA 4GNXB 4JI3L 3VA7A 4IFDJ 3L9AX 4JC0A 2R92B 3K5NA 2KCCA 1HQRD 3BVMA 2B2YA 3VYUA 1U9RA 5IYDG 3GQBA 3V05A 4IPGA 2JEBI 4IPCA 5G3LF 2WP8J 4C1NI 5C4XG 2G5DA 2WINB 1HNWQ 1PV4A 1BCPB 1PFNA 1Q8IA 1SYBA 2QDBA 3H15A 2HCCA 5KNDA 1SNOA 2CHBD 5EKIA 1KTKA 1WJJA 1A63A 5EGTA 4RCNA 1PHJA 3HKZG 3D4RA 3HP3A 1MSHA 2K6AA 1JCKB 4YHHL 5CV7A 5M5YH 1UNSA 1GVPA 1V43A 4DUZL 2DY8A 4IFDI 2F0PA 3GV3A 1EFWA 2JN4A 3LWUA 3MZ5A 3H09A 4C1NK 2L4NA 1VQDA 3MVVA 1HFGA 3D0FA 1TY0A 2ENBA 2RCFA 5IYCG 1NCVA 3SK5A 4ID6A 1RTOA 3CPFA 3CHBD 3MHBA 2F0KA 4PZ7A 5C3XA 2Z4IA 3GTLH 4B9XA 3D6WA 1TWCB 1MKHA 1LTTD 1EU3A 4MZ9A 1JORA 4A3EB 4PV1C 1KLUD 1PH9A 4OO1H 2Y0SB 4A3MG 3S17B 1KNEA 2VQFL 4X3TA 1E7ZA 5LMUQ 4DV0Q 1W6KA 1FL0A 1DZ1A 3NXWA 2EXDA 4F7XA 3G6JB 1P16A 3JC66 4KD4A 1TIID 2LS01 1NY4A 3CRKC 4CGYB 2K04A 2DNEA 1LTLA 1STEA 4UP7A 1N33Q 3S1QH 1V1PB 4JI7Q 1SMXA 1ZEQX 1QVCA 3ERSX 1V1PA 3SE0A 1KXLA 3OYYA 4ZK9B 1OXUA 1K83B 1YNJD 4A3LH 4F8MA 4CJ0B 2F0QA 3NQIA 5IYBH 2CCZA 4KHPL 3KJOA 2SEBD 3D3RA 1DYQA 1Q1BA 1TXYA 3RLNA 2LXKA 3TP6A 1PTOC 3MWYW 1J6QA 4OWXB 2IL8A 2M00A 5BR8L 2ZTDA 2R7DA 4A3BH 5FO8B 3BVGA 5FK9C 3KLWA 2YTXA 4X3SA 4RH6A 5HY6A 3A5ZB 3D4DA 1HNZL 4H7BA 5IGBA 1XTCD 3GTQH 4JI6Q 4EQOA 4NXNL 4L5TA 1LT4D 5M5WH 3CCQA 1X3EA 3SK4A 1B50A 1X65A 1PTOH 4DUYQ 4V0BA 2VB2X 1GXDC 1Y8PB 2HQLA 1PYWD 2NWGA 2K5HA 3X3NA 3PO2H 5IGCA 3K7AH 4CJ1B 2O2LD 1E2VA 1XPRA 3NBHB 2QGQA 4JI5Q 1WTVA 2K75A 5M5XB 3MAQA 2PZTA 4HJ9A 3HOYB 4IPDA 3NBHA 4DU9A 1EWIA 1TT2A 5M3MH 3AEVA 4GN4B 1J5EL 5I9PA 1AW7A 1V1OA 4OONA 1XMQL 3LWEA 1HR0W 2MJ8A 5DM63 2SOBA 2RDHA 3C1EA 1GM5A 2B63H 1U4LA 3GTKB 5J1ZA 1EOTA 2X69A 4X66L 1L1OC 1EU4A 3HOXG 3NK9A 2RKSA 3J81c 2NBFA 4OHJA 1QWYA 2Z1CA 1PZID 3S14H 4LF4Q 4HEDA 2NYZD 3I4MG 1PRTF 3S1NH 4X64Q 1JB7A 4GLXA 2B2UC 4MN3A 2E76C 4CJ2C 4DKAC 5C44G 3URYA 1WTOA 3MXNB 4B08A 2B2VC 2ZXRA 1EYGA 1TS4A 3T4AC 2KEDA 3MXNA 1WCMB 1BBWA 2YTVA 2WKDA 5D3DA 3QIAA 4YIJA 2Q2TA 4LW1A 1RCVD 4ZLTF 1HUNA 1ENFA 4LMQD 4HIOA 1D2BA 4A3CG 4K0KL 1YNJC 4R4CA 1UAPA 2F0LA 2A6HD 1IL2A 2E2IH 4JI8L 2PYKA 4O0AA 3I4NH 4OX9Q 2UXCL 1HR0L 5M9OA 1HA5A 1R4QB 3A5UA 4RGOS 1YZ6A 5C3EG 3MTSA 4A4IA 3GTGH 2UUAQ 2XSCA 3TZDA 4LFCQ 1GUOA 3DMUA 1Y1VH 1PRTD 3IFDA 1LT3D 1WD0A 3DEPA 3GTQB 1U5KA 3I4LA 4JK1C 1SE2A 3JAMc 4GN3B 3CCMA 5LMNW 1STGA 3J81j 1VMCA 1R4PB 2Y0SE 1PTOB 1STHA 5HURA 2PMZE 1IKLA 1UEAB 3W3AA 2JA5B 5JPMC 3PSIA 3BDOA 1UEBA 2FMCA 1EYAA 4LF9Q 1HNXQ 1NJIC 1O7LA 5TSSA 4IUQA 2HIXA 4TKOB 2AKWB 4RHSA 4KY6A 2TMPA 1JB3A 5ELCA 5CV9A 3HS0C 4CDDC 5E1FA 4P75A 3J81E 5M3MB 2EOTA 3BG3A 1S5FD 2A6ED 4BS9A 2UXDQ 3IFTA 4PQXA 1YIJA 4JPBW 1JICA 3TS2A 2KCTA 2OQKA 3C2PA 1Z7TA 1EQTA 5EBCA 3H3VI 4DXFA 2K14A 3GTOH 2B63B 2F4VL 4K2LA 4A93H 3CCLA 2F52A 5EQ0A 4RGTA 1A8VA 1GUWA 2EYHA 3ITPA 1BUVT 4XIGS 1MD2D 1D1IA 1GHJA 2OF1A 3KK7A 4NMZA 3UI2A 2A1AA 2BH8A 1WTRA 5K5PA 1EIGA 3RLOA 1F9PA 1OXVA 1CT1D 1YJNA 1VMPA 4JYAL 4XDXA 2MNAA 4TRDA 1FGUA 1EL0A 5LMNL 1YJ9A 4RG1A 5I4DA 2JA6H 1MI2A 2R93H 2ES2A 3IKJA 2GA4B 2YTYA 4DR3Q 4DV3Q 1L2FA 3SDZA 2KCMA 1S40A 1S72A 4I7ZC 1I6VC 1XPOA 1ILQA
chains in the Genus database with same CATH topology
3J81i 1E24A 4L5RC 1JJGA 4BA2I 3GTKH 1VQ9A 2UUBL 3TS2A 5IYCH 1YI2A 4YWKA 4EQ5A 3M4PA 1IBKQ 4B3RQ 4J15A 1XJVA 2BA1A 1MJEA 1TWAH 3GTPH 2NVQH 4DV4Q 3I4MH 2R7ZH 1PH3A 1VCIA 3FP9A 1L0WA 4LF5Q 1YHBA 1B7YB 2DGYA 1EIFA 2WAQG 4NXMQ 2HT1A 1HNWL 1WYDA 3I55A 3IRBA 1AE3A 3HOUH 4YWMA 1AE2A 2Z0SA 5FJ8G 3I4NG 5JJLA 4IJLA 5C44H 4OO1I 5IY0A 1G51A 1VQPA 1PH7A 1A62A 3AQQA 4DV2L 3HFZB 5ELOA 4A3LG 4YCVA 1Y1WG 4X65L 3CF5A 4ME3A 3H0GH 5M3FG 4LUOA 3CC4A 2WB1G 5IYBG 4A75A 2UXBQ 4LUVA 1PH2A 4GOPC 2JK8A 1Q82C 4BY7G 3TS0A 4BXXG 5IWAQ 1SE8A 3L0OA 2I5HA 4OXPA 4JBWA 3UE0A 3CCVA 1PH1A 2VUMH 4LFBQ 1I6HH 4IOCA 2JA7G 1C0AA 1K73C 3ICEA 1LM0A 1Q8KA 5FLMG 1WCMH 3I7FA 4UP9A 3W5OA 3CC7A 1VQ8A 2OQ0A 3ER0A 4A3DG 1E1TA 2F4VQ 4GKKL 3M85A 4UY8C 1V9PA 4GLAC 3A74A 4R4OA 4A3BG 4LFAQ 4A3JH 4AQYL 1TWGH 3UDIA 4LF8Q 3G6EA 3PV0A 3SGIA 4DV6Q 3OTOQ 2VQEL 2JA8G 3BZCA 5JJIA 3HOVG 4RMFA 3K80C 3CW2C 1UE5A 2RCNA 1GO3E 3KJPA 4LF7Q 3PUVA 1PH4A 4JI0Q 1YJWA 4MNOA 4HIDA 5GROA 3ULJA 5C3EH 2ASBA 1FVIA 2WFWA 2ZTCA 3CCRA 1X56A 1FJGL 1XNQQ 3GD7A 1IBMQ 1VQBA 1IBLL 3KDFB 2HHHQ 4LF6Q 4C2MH 5C0XI 4DR5L 2NVTH 4TQUS 4B3ML 4JI2L 1HJPA 4YCWA 4BA1I 2E2HH 4AYBG 5JEAJ 3F2DA 4JYAQ 1MIUA 3TQYA 4BBRH 2DUDA 2KHJA 1BBUA 5LMUL 4DV0L 5LMNQ 3A0JA 1VQKA 1I3QH 3PO2G 3GO5A 1NBWA 3PUZA 4AIMA 4X62L 3PO3G 3FKIH 1SRUA 4DAMA 1HZBA 2VW9A 1YVCA 4B3TL 4YWLA 3DLLA 5JEAG 3F8TA 4EX5A 4GNXB 1GKHA 2JA9A 4JI3L 4C3IH 3H3VH 1YBYA 4JC0A 1Y14B 2IHFA 1I5FA 5J3BA 1SFOH 1N33L 4IFDJ 2D0PA 3B6YA 3OW2A 4BY1G 1VQMA 4JI7L 2H5XA 3AFPA 2VY3A 4QIWE 2UUBQ 4POGA 5IYDG 4DV1L 2R92G 2AHOB 4IPGA 2JEBI 4IPCA 5C4XG 2WP8J 4UP8A 1QVFA 4KHZA 4DV5L 4IFDG 2JA5H 5IT9c 1HNWQ 1PV4A 3HOWG 1SROA 4A3FH 4DR7Q 3KF8B 3H15A 3RR5A 1W3SA 4DV7L 4NPSA 4DV2Q 1Q86C 1I94L 5IP9G 3L2PA 2NVXH 2JQOA 1WJJA 1A63A 3NEMA 1XPUA 2VNUD 4QL5A 4X65Q 1LYLA 1AH9A 1PHJA 3MEFA 3HKZG 3U4ZA 4DK6C 1X55A 4LWCA 3CCUA 5E7NA 3S24A 4C3JH 4YHHL 4R4QA 2L15A 1VQLA 4QY7A 5GQOA 3T1HL 3KFUA 5M5YH 5K36G 1B70B 2N49A 3E9IA 1GVPA 1V43A 4DUZL 4Y7NH 2OTJA 4DR1L 4GKKQ 2ZJPA 1L1OB 4IFDI 1JE5A 3WWVA 1EFWA 1X6OA 4AQYQ 2VL6A 1X3GA 4JI6L 2ATWA 1L1OA 2AWNA 2IX0A 3M3YH 1X54A 2Z6KC 2VQEQ 1VQDA 2K50A 1SR3A 3D0FA 3GDEA 5IYCG 3HOXH 1LUZA 1QZHA 3CPFA 2EIFA 3CMEA 4PZ7A 4DUYL 3GTLH 3RNUA 2R7ZG 3ULPA 1MKHA 3S15H 2MQHA 4MZ9A 1O7IA 1FJGQ 2VS1A 4HJAA 1N32L 3Q8DA 4R4TA 2IY5B 1IBLQ 1ASZA 4JI4L 4JI5L 1PH9A 2NN6I 4DR5Q 4JI2Q 2R6GA 1EOVA 3BZKA 1CSPA 4A3IH 4B3MQ 1RIPA 4A3MG 2E2JH 4A3GH 1UWVA 2VQFL 5LMUQ 1E7ZA 4DV0Q 1JMCA 3KF6B 1FL0A 4A3EG 3HOZG 3S2DH 1PH5A 2A8VA 2EXDA 1C9OA 2MFIA 2N78A 4X62Q 5C4JH 1VQ7A 1XMOL 1P16A 3KF6A 2Y0SG 1Q1EA 3JC66 4B3TQ 3ZJYC 3J80c 1PYBA 4JOIC 1NY4A 1VQ6A 4JI3Q 4JOIA 3S1QH 4UP7A 1LTLA 1VQCA 1Q7YC 1N33Q 2K4KA 1CSQA 4DR4L 1YHQA 1Y1VG 3U50C 3I56A 3PCOB 3UDFA 4JI7Q 4A3CH 1SMXA 1QVCA 2MO0A 1HH2P 3L7ZC 3G71A 3ERSX 5FJ8H 1KXLA 4DV1Q 3OYYA 1PFSA 1OXUA 2PNHA 2BH2A 4GKJL 4A3LH 3F1ZA 3CP0A 4JBMA 1A0IA 1Y1WH 4R4IA 1VQ4A 1UE1A 4DV5Q 4P74A 1VQEA 5M3FH 5IYBH 4LF4L 4IJHA 2CCZA 4KHPL 1VQGA 1G291 1K0RA 4P72A 3KYHC 1HZCA 3STBC 2A19A 1Z47A 3KJOA 2YU9H 1VQIA 4BXXH 1Q1BA 4DV7Q 1TXYA 1PYSB 4X64L 1CKOA 1QVGA 1I94Q 3RLNA 2LXKA 2JA7H 4JV5Q 4DR6L 2B3GA 3RN5A 1J6QA 4OWXB 1I50H 2WAQE 4BBRG 1NE3A 3STBD 4DV3L 3T1YL 1YHAA 5BR8L 5ELNA 4A3DH 4QQBX 1UE7A 4YHHQ 2ZTDA 1VQ5A 2R7DA 4A3BH 2ID0A 2IT1A 3KDFA 2CWAA 2KHIA 3FKIG 4DR2L 2FXQA 3CAMA 1N34Q 1KAWA 2PI2A 1NMFA 3KLWA 2YTXA 3CMAA 4TVAB 4DUZQ 2WB1E 4B3SL 2Q2IA 3HOVH 3JAMi 4DR1Q 2OTLA 1VQNA 5HY6A 1KRTA 1PVOA 4DPGA 2CFMA 3A5ZB 1HNZL 3J7A5 1M1KC 3GTQH 4JI1Q 4R1JA 3F2BA 4JI6Q 3PF5A 4NXNL 4L5TA 4A93G 1RL2A 1KD1C 3CCEA 5M5WH 3CCQA 3RZOH 4GNXA 3D31A 2UU9L 1X3EA 2E8GA 2YV5A 1WI5A 2JE6I 1X65A 5IP7G 2AMCB 4OX9L 4DUYQ 3S16H 2PQAB 4KLKA 3BU2A 2HQLA 2UXBL 2K5HA 4A3FG 3M4OH 4H02A 3ULLA 2QA4A 3PO2H 5GAEC 3K7AH 2MO1A 3S1RH 1VQHA 2D62A 2PQAA 2LXJA 1R9TH 1XPRA 3NBHB 4JI4Q 3PO3H 2QGQA 4JI5Q 3S2HH 2K75A 2UUAL 4WJ3M 4HJ9A 2RHQB 4BBSG 2VQFQ 4IPDA 3F2CA 2K5VA 2GN5A 3UE1A 1JJ2A 1EWIA 4LFCL 1XTDA 3KOJA 1TWFH 5M3MH 4NB3A 2JJQA 4GN5A 3AEVA 4YCUA 2AWOA 4YY3L 4GN4B 1K8GA 1XMOQ 1J5EL 3HKSA 1IYJB 2N3SA 4OONA 1XMQL 4AYBE 4BY1H 5EAYA 4DV6L 3HOYG 1XNRL 2OWOA 1KQSA 2JA6G 1SN8A 2ZJRA 5IYDH 1BKBA 2NZOA 1HR0W 2R92H 4A3KH 2ALYB 1E1OA 3DM3A 3PUYA 2R93G 4P71A 5C4XH 2B63H 1GM5A 4DR4Q 3RZDH 3M9BA 3RN2A 1Q46A 4X66L 2PI2E 2D0OA 4JBJA 3HOWH 1EQRA 3EN2A 5DLQE 1L1OC 1GD7A 1V1QA 1N36L 3E0EA 1BVSA 3HOXG 3TRZA 2Q2HA 4HJ5A 3NENA 5IP9H 3J81c 4ALPA 3U4VA 4LF9L 1U0LA 1HNXL 3K0XA 2CWPA 3S14H 4LF4Q 2EQSA 4KHPQ 2GVAA 1Z9FA 3I4MG 1CKMA 3PUXA 3S1NH 4AH6A 1IXRA 4X64Q 1JB7A 4GLXA 2I0QA 4WJ4A 3HOUG 4OO1G 1PA6A 4GS3A 4DKAC 5C44G 2UXDL 1WFQA 2NVYH 4QGUA 1K9MC 3MXNB 1M90C 4C3HH 1EYGA 3T1YQ 5BR8Q 4PG3A 3VDYA 3H0GG 1Q12A 4IPHA 2ZM6L 2I5MX 4PZ6A 4DR2Q 3J7ZC 1CKNB 3NELA 1BBWA 2YTVA 2Q2TA 3TREA 2VUMG 4Y52H 2ZJQA 3HKZE 4B3SQ 3CPWA 2E5LL 4L5SA 4LW1A 1CKNA 3RLFA 4QJFA 1E22A 3LGJA 1QUQB 1HNZQ 1WCMG 2RHSB 1N8RC 4HIOA 1PH8A 4A3CG 4K0KL 4NXNQ 4JG2A 4R4CA 1QUQA 3AFQA 4DR7L 4A3JG 1IL2A 2E2IH 1VQJA 4JI8L 2UU9Q 2IHEA 2I5LX 4O0AA 3I4NH 4DAYB 4KI0A 1TWCH 3G48A 5C0XJ 1YITA 3CCSA 4OX9Q 4GOPB 4A3MH 3FHWA 1EQQA 1VQFA 4IOAA 2UXCL 2F3IA 3K7UC 1HR0L 4A3EH 1DGSA 5AJ3L 3HOZH 2GVBA 5H1SE 3A5UA 4PMWA 4GOPA 4P73A 1YZ6A 5C3EG 2IX1A 4BY7H 1Q81C 4A4IA 3S17H 1QZGA 3J80i 3GTGH 3I4OA 2NZHA 5GADC 2UUAQ 3I2ZA 1C7YA 5C0XG 3PGZA 1ASYA 1HZ9A 2HIVA 2K52A 3EIVA 4APVA 1T9HA 4LFCQ 4X6AH 3CQZH 5FLMH 1NTGA 1K8AC 1EIYB 1Y1VH 4DNIA 4DR3L 3PUWA 3CD6A 4YY3Q 3GTJH 3M7NA 1J5EQ 1G6PA 4A76A 1XMQQ 1JT8A 2UUCL 1U5KA 2LSSA 1XNRQ 1S3OA 2N8NA 3T1HQ 1D7QA 3JAMc 4GN3B 2VZAA 2JA8H 3CCMA 4HJ8A 5LMNW 4UPAA 3J81j 2Y0SE 4X66Q 1IBKL 4B3RL 1KHIA 4FDBA 2C35B 4DV4L 1N36Q 2PMZE 4NXML 4LF5L 1K83H 1OXSC 4GLVB 2B29A 3K8AA 4GNXC 3W1GA 3PSIA 4POFA 1UEBA 4LF9Q 1HNXQ 1NJIC 3U58A 2HIXA 3UDXA 2AKWB 2V1CC 4MTNA 5IE8A 4HIKA 1IZ6A 1VQAA 2JA5G 1OXXK 4P75A 5IWAL 1N32Q 4LFBL 5FLXc 2UXDQ 1N9WA 2R7FA 3GTMH 1KRSA 4HJ7A 4LNQA 1YIJA 1EUJA 1SLJA 3BJUA 5M3MG 2KCTA 2OQKA 1VQOA 1X9NA 3H3VI 1E3PA 3PF4A 2ZM6Q 2K14A 3GTOH 1YNXA 1HZAA 2F4VL 4OWWB 4A93H 3CCLA 3K81C 3CC2A 4LFAL 2F52A 2KBNA 2ZTEA 1OXTA 2YYZA 4LF8L 2OCEA 2E5LQ 1A8VA 4A3KG 1PH6A 4O2DA 3OTOL 5IP7H 4XIGS 2B63G 1JJCB 1OTCA 3CCJA 1W2BA 1CUKA 1YEZA 2BA0A 4K0KQ 1K3RA 4LF7L 4L5QA 2A1AA 2BH8A 4JI0L 4LUZA 5JJKA 4HIMA 4JI8Q 4IO9A 3RLOA 1KL9A 4JV5L 4JCVE 3W1BA 3EBEA 3E9HA 1KC8C 1OXVA 1XNQL 3M4QA 1B8AA 1IBML 1P8LA 1X3FA 3S1MH 4BBSH 2XTIA 2HHHL 4LF6L 4GKJQ 2UXCQ 1YJNA 1MJCA 1NMGA 1HR0Q 4JYAL 1WOCA 5AJ3Q 2MNAA 1FGUA 4XTCS 1TWHH 5LMNL 5M5XH 2XGTA 1YJ9A 1KIXA 3TEHB 2CKZB 4RG1A 5GAGC 2KENA 1N34L 2Q2UA 3HOYH 2JEAI 4DK3C 2RF4A 3CXCA 2NN6G 3AYHB 2QEXA 3UDGA 5HGQA 2JA6H 2R93H 2CQOA 2ES2A 3PIOA 4DR6Q 4A3IG 3G4SA 1UE6A 1VS0A 2YTYA 4A3GG 4PZ8A 1H95A 4DR3Q 4DV3Q 1L2FA 4OWTB 4JI1L 5GAHC 4JBKA 1D8LA 2KCMA 1S40A 1S72A 2UUCQ 3PIPA 2K5NA 1XPOA 2Z6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 i;  1E24 A;  4L5R C;  1JJG A;  4BA2 I;  3GTK H;  1VQ9 A;  2UUB L;  3TS2 A;  5IYC H;  1YI2 A;  4YWK A;  4EQ5 A;  3M4P A;  1IBK Q;  4B3R Q;  4J15 A;  1XJV A;  2BA1 A;  1MJE A;  1TWA H;  3GTP H;  2NVQ H;  4DV4 Q;  3I4M H;  2R7Z H;  1PH3 A;  1VCI A;  3FP9 A;  1L0W A;  4LF5 Q;  1YHB A;  1B7Y B;  2DGY A;  1EIF A;  2WAQ G;  4NXM Q;  2HT1 A;  1HNW L;  1WYD A;  3I55 A;  3IRB A;  1AE3 A;  3HOU H;  4YWM A;  1AE2 A;  2Z0S A;  5FJ8 G;  3I4N G;  5JJL A;  4IJL A;  5C44 H;  4OO1 I;  5IY0 A;  1G51 A;  1VQP A;  1PH7 A;  1A62 A;  3AQQ A;  4DV2 L;  3HFZ B;  5ELO A;  4A3L G;  4YCV A;  1Y1W G;  4X65 L;  3CF5 A;  4ME3 A;  3H0G H;  5M3F G;  4LUO A;  3CC4 A;  2WB1 G;  5IYB G;  4A75 A;  2UXB Q;  4LUV A;  1PH2 A;  4GOP C;  2JK8 A;  1Q82 C;  4BY7 G;  3TS0 A;  4BXX G;  5IWA Q;  1SE8 A;  3L0O A;  2I5H A;  4OXP A;  4JBW A;  3UE0 A;  3CCV A;  1PH1 A;  2VUM H;  4LFB Q;  1I6H H;  4IOC A;  2JA7 G;  1C0A A;  1K73 C;  3ICE A;  1LM0 A;  1Q8K A;  5FLM G;  1WCM H;  3I7F A;  4UP9 A;  3W5O A;  3CC7 A;  1VQ8 A;  2OQ0 A;  3ER0 A;  4A3D G;  1E1T A;  2F4V Q;  4GKK L;  3M85 A;  4UY8 C;  1V9P A;  4GLA C;  3A74 A;  4R4O A;  4A3B G;  4LFA Q;  4A3J H;  4AQY L;  1TWG H;  3UDI A;  4LF8 Q;  3G6E A;  3PV0 A;  3SGI A;  4DV6 Q;  3OTO Q;  2VQE L;  2JA8 G;  3BZC A;  5JJI A;  3HOV G;  4RMF A;  3K80 C;  3CW2 C;  1UE5 A;  2RCN A;  1GO3 E;  3KJP A;  4LF7 Q;  3PUV A;  1PH4 A;  4JI0 Q;  1YJW A;  4MNO A;  4HID A;  5GRO A;  3ULJ A;  5C3E H;  2ASB A;  1FVI A;  2WFW A;  2ZTC A;  3CCR A;  1X56 A;  1FJG L;  1XNQ Q;  3GD7 A;  1IBM Q;  1VQB A;  1IBL L;  3KDF B;  2HHH Q;  4LF6 Q;  4C2M H;  5C0X I;  4DR5 L;  2NVT H;  4TQU S;  4B3M L;  4JI2 L;  1HJP A;  4YCW A;  4BA1 I;  2E2H H;  4AYB G;  5JEA J;  3F2D A;  4JYA Q;  1MIU A;  3TQY A;  4BBR H;  2DUD A;  2KHJ A;  1BBU A;  5LMU L;  4DV0 L;  5LMN Q;  3A0J A;  1VQK A;  1I3Q H;  3PO2 G;  3GO5 A;  1NBW A;  3PUZ A;  4AIM A;  4X62 L;  3PO3 G;  3FKI H;  1SRU A;  4DAM A;  1HZB A;  2VW9 A;  1YVC A;  4B3T L;  4YWL A;  3DLL A;  5JEA G;  3F8T A;  4EX5 A;  4GNX B;  1GKH A;  2JA9 A;  4JI3 L;  4C3I H;  3H3V H;  1YBY A;  4JC0 A;  1Y14 B;  2IHF A;  1I5F A;  5J3B A;  1SFO H;  1N33 L;  4IFD J;  2D0P A;  3B6Y A;  3OW2 A;  4BY1 G;  1VQM A;  4JI7 L;  2H5X A;  3AFP A;  2VY3 A;  4QIW E;  2UUB Q;  4POG A;  5IYD G;  4DV1 L;  2R92 G;  2AHO B;  4IPG A;  2JEB I;  4IPC A;  5C4X G;  2WP8 J;  4UP8 A;  1QVF A;  4KHZ A;  4DV5 L;  4IFD G;  2JA5 H;  5IT9 c;  1HNW Q;  1PV4 A;  3HOW G;  1SRO A;  4A3F H;  4DR7 Q;  3KF8 B;  3H15 A;  3RR5 A;  1W3S A;  4DV7 L;  4NPS A;  4DV2 Q;  1Q86 C;  1I94 L;  5IP9 G;  3L2P A;  2NVX H;  2JQO A;  1WJJ A;  1A63 A;  3NEM A;  1XPU A;  2VNU D;  4QL5 A;  4X65 Q;  1LYL A;  1AH9 A;  1PHJ A;  3MEF A;  3HKZ G;  3U4Z A;  4DK6 C;  1X55 A;  4LWC A;  3CCU A;  5E7N A;  3S24 A;  4C3J H;  4YHH L;  4R4Q A;  2L15 A;  1VQL A;  4QY7 A;  5GQO A;  3T1H L;  3KFU A;  5M5Y H;  5K36 G;  1B70 B;  2N49 A;  3E9I A;  1GVP A;  1V43 A;  4DUZ L;  4Y7N H;  2OTJ A;  4DR1 L;  4GKK Q;  2ZJP A;  1L1O B;  4IFD I;  1JE5 A;  3WWV A;  1EFW A;  1X6O A;  4AQY Q;  2VL6 A;  1X3G A;  4JI6 L;  2ATW A;  1L1O A;  2AWN A;  2IX0 A;  3M3Y H;  1X54 A;  2Z6K C;  2VQE Q;  1VQD A;  2K50 A;  1SR3 A;  3D0F A;  3GDE A;  5IYC G;  3HOX H;  1LUZ A;  1QZH A;  3CPF A;  2EIF A;  3CME A;  4PZ7 A;  4DUY L;  3GTL H;  3RNU A;  2R7Z G;  3ULP A;  1MKH A;  3S15 H;  2MQH A;  4MZ9 A;  1O7I A;  1FJG Q;  2VS1 A;  4HJA A;  1N32 L;  3Q8D A;  4R4T A;  2IY5 B;  1IBL Q;  1ASZ A;  4JI4 L;  4JI5 L;  1PH9 A;  2NN6 I;  4DR5 Q;  4JI2 Q;  2R6G A;  1EOV A;  3BZK A;  1CSP A;  4A3I H;  4B3M Q;  1RIP A;  4A3M G;  2E2J H;  4A3G H;  1UWV A;  2VQF L;  5LMU Q;  1E7Z A;  4DV0 Q;  1JMC A;  3KF6 B;  1FL0 A;  4A3E G;  3HOZ G;  3S2D H;  1PH5 A;  2A8V A;  2EXD A;  1C9O A;  2MFI A;  2N78 A;  4X62 Q;  5C4J H;  1VQ7 A;  1XMO L;  1P16 A;  3KF6 A;  2Y0S G;  1Q1E A;  3JC6 6;  4B3T Q;  3ZJY C;  3J80 c;  1PYB A;  4JOI C;  1NY4 A;  1VQ6 A;  4JI3 Q;  4JOI A;  3S1Q H;  4UP7 A;  1LTL A;  1VQC A;  1Q7Y C;  1N33 Q;  2K4K A;  1CSQ A;  4DR4 L;  1YHQ A;  1Y1V G;  3U50 C;  3I56 A;  3PCO B;  3UDF A;  4JI7 Q;  4A3C H;  1SMX A;  1QVC A;  2MO0 A;  1HH2 P;  3L7Z C;  3G71 A;  3ERS X;  5FJ8 H;  1KXL A;  4DV1 Q;  3OYY A;  1PFS A;  1OXU A;  2PNH A;  2BH2 A;  4GKJ L;  4A3L H;  3F1Z A;  3CP0 A;  4JBM A;  1A0I A;  1Y1W H;  4R4I A;  1VQ4 A;  1UE1 A;  4DV5 Q;  4P74 A;  1VQE A;  5M3F H;  5IYB H;  4LF4 L;  4IJH A;  2CCZ A;  4KHP L;  1VQG A;  1G29 1;  1K0R A;  4P72 A;  3KYH C;  1HZC A;  3STB C;  2A19 A;  1Z47 A;  3KJO A;  2YU9 H;  1VQI A;  4BXX H;  1Q1B A;  4DV7 Q;  1TXY A;  1PYS B;  4X64 L;  1CKO A;  1QVG A;  1I94 Q;  3RLN A;  2LXK A;  2JA7 H;  4JV5 Q;  4DR6 L;  2B3G A;  3RN5 A;  1J6Q A;  4OWX B;  1I50 H;  2WAQ E;  4BBR G;  1NE3 A;  3STB D;  4DV3 L;  3T1Y L;  1YHA A;  5BR8 L;  5ELN A;  4A3D H;  4QQB X;  1UE7 A;  4YHH Q;  2ZTD A;  1VQ5 A;  2R7D A;  4A3B H;  2ID0 A;  2IT1 A;  3KDF A;  2CWA A;  2KHI A;  3FKI G;  4DR2 L;  2FXQ A;  3CAM A;  1N34 Q;  1KAW A;  2PI2 A;  1NMF A;  3KLW A;  2YTX A;  3CMA A;  4TVA B;  4DUZ Q;  2WB1 E;  4B3S L;  2Q2I A;  3HOV H;  3JAM i;  4DR1 Q;  2OTL A;  1VQN A;  5HY6 A;  1KRT A;  1PVO A;  4DPG A;  2CFM A;  3A5Z B;  1HNZ L;  3J7A 5;  1M1K C;  3GTQ H;  4JI1 Q;  4R1J A;  3F2B A;  4JI6 Q;  3PF5 A;  4NXN L;  4L5T A;  4A93 G;  1RL2 A;  1KD1 C;  3CCE A;  5M5W H;  3CCQ A;  3RZO H;  4GNX A;  3D31 A;  2UU9 L;  1X3E A;  2E8G A;  2YV5 A;  1WI5 A;  2JE6 I;  1X65 A;  5IP7 G;  2AMC B;  4OX9 L;  4DUY Q;  3S16 H;  2PQA B;  4KLK A;  3BU2 A;  2HQL A;  2UXB L;  2K5H A;  4A3F G;  3M4O H;  4H02 A;  3ULL A;  2QA4 A;  3PO2 H;  5GAE C;  3K7A H;  2MO1 A;  3S1R H;  1VQH A;  2D62 A;  2PQA A;  2LXJ A;  1R9T H;  1XPR A;  3NBH B;  4JI4 Q;  3PO3 H;  2QGQ A;  4JI5 Q;  3S2H H;  2K75 A;  2UUA L;  4WJ3 M;  4HJ9 A;  2RHQ B;  4BBS G;  2VQF Q;  4IPD A;  3F2C A;  2K5V A;  2GN5 A;  3UE1 A;  1JJ2 A;  1EWI A;  4LFC L;  1XTD A;  3KOJ A;  1TWF H;  5M3M H;  4NB3 A;  2JJQ A;  4GN5 A;  3AEV A;  4YCU A;  2AWO A;  4YY3 L;  4GN4 B;  1K8G A;  1XMO Q;  1J5E L;  3HKS A;  1IYJ B;  2N3S A;  4OON A;  1XMQ L;  4AYB E;  4BY1 H;  5EAY A;  4DV6 L;  3HOY G;  1XNR L;  2OWO A;  1KQS A;  2JA6 G;  1SN8 A;  2ZJR A;  5IYD H;  1BKB A;  2NZO A;  1HR0 W;  2R92 H;  4A3K H;  2ALY B;  1E1O A;  3DM3 A;  3PUY A;  2R93 G;  4P71 A;  5C4X H;  2B63 H;  1GM5 A;  4DR4 Q;  3RZD H;  3M9B A;  3RN2 A;  1Q46 A;  4X66 L;  2PI2 E;  2D0O A;  4JBJ A;  3HOW H;  1EQR A;  3EN2 A;  5DLQ E;  1L1O C;  1GD7 A;  1V1Q A;  1N36 L;  3E0E A;  1BVS A;  3HOX G;  3TRZ A;  2Q2H A;  4HJ5 A;  3NEN A;  5IP9 H;  3J81 c;  4ALP A;  3U4V A;  4LF9 L;  1U0L A;  1HNX L;  3K0X A;  2CWP A;  3S14 H;  4LF4 Q;  2EQS A;  4KHP Q;  2GVA A;  1Z9F A;  3I4M G;  1CKM A;  3PUX A;  3S1N H;  4AH6 A;  1IXR A;  4X64 Q;  1JB7 A;  4GLX A;  2I0Q A;  4WJ4 A;  3HOU G;  4OO1 G;  1PA6 A;  4GS3 A;  4DKA C;  5C44 G;  2UXD L;  1WFQ A;  2NVY H;  4QGU A;  1K9M C;  3MXN B;  1M90 C;  4C3H H;  1EYG A;  3T1Y Q;  5BR8 Q;  4PG3 A;  3VDY A;  3H0G G;  1Q12 A;  4IPH A;  2ZM6 L;  2I5M X;  4PZ6 A;  4DR2 Q;  3J7Z C;  1CKN B;  3NEL A;  1BBW A;  2YTV A;  2Q2T A;  3TRE A;  2VUM G;  4Y52 H;  2ZJQ A;  3HKZ E;  4B3S Q;  3CPW A;  2E5L L;  4L5S A;  4LW1 A;  1CKN A;  3RLF A;  4QJF A;  1E22 A;  3LGJ A;  1QUQ B;  1HNZ Q;  1WCM G;  2RHS B;  1N8R C;  4HIO A;  1PH8 A;  4A3C G;  4K0K L;  4NXN Q;  4JG2 A;  4R4C A;  1QUQ A;  3AFQ A;  4DR7 L;  4A3J G;  1IL2 A;  2E2I H;  1VQJ A;  4JI8 L;  2UU9 Q;  2IHE A;  2I5L X;  4O0A A;  3I4N H;  4DAY B;  4KI0 A;  1TWC H;  3G48 A;  5C0X J;  1YIT A;  3CCS A;  4OX9 Q;  4GOP B;  4A3M H;  3FHW A;  1EQQ A;  1VQF A;  4IOA A;  2UXC L;  2F3I A;  3K7U C;  1HR0 L;  4A3E H;  1DGS A;  5AJ3 L;  3HOZ H;  2GVB A;  5H1S E;  3A5U A;  4PMW A;  4GOP A;  4P73 A;  1YZ6 A;  5C3E G;  2IX1 A;  4BY7 H;  1Q81 C;  4A4I A;  3S17 H;  1QZG A;  3J80 i;  3GTG H;  3I4O A;  2NZH A;  5GAD C;  2UUA Q;  3I2Z A;  1C7Y A;  5C0X G;  3PGZ A;  1ASY A;  1HZ9 A;  2HIV A;  2K52 A;  3EIV A;  4APV A;  1T9H A;  4LFC Q;  4X6A H;  3CQZ H;  5FLM H;  1NTG A;  1K8A C;  1EIY B;  1Y1V H;  4DNI A;  4DR3 L;  3PUW A;  3CD6 A;  4YY3 Q;  3GTJ H;  3M7N A;  1J5E Q;  1G6P A;  4A76 A;  1XMQ Q;  1JT8 A;  2UUC L;  1U5K A;  2LSS A;  1XNR Q;  1S3O A;  2N8N A;  3T1H Q;  1D7Q A;  3JAM c;  4GN3 B;  2VZA A;  2JA8 H;  3CCM A;  4HJ8 A;  5LMN W;  4UPA A;  3J81 j;  2Y0S E;  4X66 Q;  1IBK L;  4B3R L;  1KHI A;  4FDB A;  2C35 B;  4DV4 L;  1N36 Q;  2PMZ E;  4NXM L;  4LF5 L;  1K83 H;  1OXS C;  4GLV B;  2B29 A;  3K8A A;  4GNX C;  3W1G A;  3PSI A;  4POF A;  1UEB A;  4LF9 Q;  1HNX Q;  1NJI C;  3U58 A;  2HIX A;  3UDX A;  2AKW B;  2V1C C;  4MTN A;  5IE8 A;  4HIK A;  1IZ6 A;  1VQA A;  2JA5 G;  1OXX K;  4P75 A;  5IWA L;  1N32 Q;  4LFB L;  5FLX c;  2UXD Q;  1N9W A;  2R7F A;  3GTM H;  1KRS A;  4HJ7 A;  4LNQ A;  1YIJ A;  1EUJ A;  1SLJ A;  3BJU A;  5M3M G;  2KCT A;  2OQK A;  1VQO A;  1X9N A;  3H3V I;  1E3P A;  3PF4 A;  2ZM6 Q;  2K14 A;  3GTO H;  1YNX A;  1HZA A;  2F4V L;  4OWW B;  4A93 H;  3CCL A;  3K81 C;  3CC2 A;  4LFA L;  2F52 A;  2KBN A;  2ZTE A;  1OXT A;  2YYZ A;  4LF8 L;  2OCE A;  2E5L Q;  1A8V A;  4A3K G;  1PH6 A;  4O2D A;  3OTO L;  5IP7 H;  4XIG S;  2B63 G;  1JJC B;  1OTC A;  3CCJ A;  1W2B A;  1CUK A;  1YEZ A;  2BA0 A;  4K0K Q;  1K3R A;  4LF7 L;  4L5Q A;  2A1A A;  2BH8 A;  4JI0 L;  4LUZ A;  5JJK A;  4HIM A;  4JI8 Q;  4IO9 A;  3RLO A;  1KL9 A;  4JV5 L;  4JCV E;  3W1B A;  3EBE A;  3E9H A;  1KC8 C;  1OXV A;  1XNQ L;  3M4Q A;  1B8A A;  1IBM L;  1P8L A;  1X3F A;  3S1M H;  4BBS H;  2XTI A;  2HHH L;  4LF6 L;  4GKJ Q;  2UXC Q;  1YJN A;  1MJC A;  1NMG A;  1HR0 Q;  4JYA L;  1WOC A;  5AJ3 Q;  2MNA A;  1FGU A;  4XTC S;  1TWH H;  5LMN L;  5M5X H;  2XGT A;  1YJ9 A;  1KIX A;  3TEH B;  2CKZ B;  4RG1 A;  5GAG C;  2KEN A;  1N34 L;  2Q2U A;  3HOY H;  2JEA I;  4DK3 C;  2RF4 A;  3CXC A;  2NN6 G;  3AYH B;  2QEX A;  3UDG A;  5HGQ A;  2JA6 H;  2R93 H;  2CQO A;  2ES2 A;  3PIO A;  4DR6 Q;  4A3I G;  3G4S A;  1UE6 A;  1VS0 A;  2YTY A;  4A3G G;  4PZ8 A;  1H95 A;  4DR3 Q;  4DV3 Q;  1L2F A;  4OWT B;  4JI1 L;  5GAH C;  4JBK A;  1D8L A;  2KCM A;  1S40 A;  1S72 A;  2UUC Q;  3PIP A;  2K5N A;  1XPO A;  2Z6K A; 
#chains in the Genus database with same CATH topology
 4BA2 I;  3NQT A;  4XT3 B;  2UUB L;  5IYC H;  3I4N B;  4EQ5 A;  3GTP H;  4LF5 Q;  2Q8T A;  3JAM E;  1HTP A;  3I55 A;  2WB1 B;  3TSS A;  1HPC A;  3K59 A;  1LT6 D;  5CV8 A;  4IJL A;  2YU9 B;  3AQQ A;  3GTG B;  3HFZ B;  1G91 A;  4A3L G;  3CF5 A;  3H0G H;  1FNV A;  5IYB G;  1AZP A;  2JK8 A;  3L0O A;  4LFB Q;  1PH1 A;  4J1M A;  1WTH A;  3KBG A;  1ZKO A;  3I7F A;  4UP9 A;  3W5O A;  2BDO A;  5C4H A;  3HOV B;  4KKU A;  1V9P A;  2HDM A;  2P5Z X;  3ND8 A;  4GLA C;  4R4O A;  4A3B G;  3G7L A;  4LFA Q;  4AQY L;  1TWG H;  1A2U A;  3SGI A;  4DV6 Q;  2JA8 G;  1A3T A;  5JJI A;  4RMF A;  4ME5 A;  3FMC A;  3CW2 C;  1UE5 A;  3M7G A;  3KJP A;  1PFM A;  1EY5 A;  3PUV A;  5ELF A;  1YJW A;  1GJX A;  4XQJ A;  5GRO A;  4AYB B;  1FVI A;  3S16 B;  1CHP D;  1X56 A;  1FJG L;  3GD7 A;  5A2Q L;  1NAP A;  1IBL L;  4UAI A;  3KDF B;  4DR5 L;  4JI2 L;  1WTQ A;  2E2H H;  5JEA J;  1MIU A;  3S2H B;  2ZXP A;  4WRD A;  3J80 L;  1EZ8 A;  5EPJ A;  3A0J A;  2MPM A;  2M2L A;  1I3Q H;  3PO2 G;  3GO5 A;  5IOC A;  4G7Z C;  3PUZ A;  4AIM A;  4ZUI A;  1SRU A;  3D6C A;  1YVC A;  1IYU A;  4B3T L;  2XNA C;  4F87 A;  3QWN A;  1GKH A;  2JA9 A;  4C3I H;  1M4V A;  1EWC A;  1YBY A;  4EGV A;  1Y14 B;  1SFO H;  2B2Y C;  5C4X B;  2D0P A;  2A74 C;  1VQM A;  5EBD A;  1DCZ A;  5EPK A;  4QIW E;  1K28 A;  2A5H A;  4DV1 L;  1SNP A;  4HMI A;  4UP8 A;  4KHZ A;  1SJH D;  4X3U A;  4QUF A;  3OIQ A;  1SND A;  5IT9 c;  3OWE B;  2V4D A;  4DR7 Q;  1K3B C;  3HKZ B;  3KF8 B;  2RSO A;  3RR5 A;  5IGE A;  2K5W A;  4DV2 Q;  3SHL A;  1A3V A;  2BDN A;  3NEM A;  3KF8 A;  2VNU D;  4X65 Q;  1AH9 A;  2NVY B;  1X55 A;  4HN7 A;  5E7N A;  3S24 A;  1LTR D;  5JOB A;  1IL8 A;  1SBB B;  5GQO A;  5K36 G;  1SNQ A;  4Y7N H;  3U9O A;  5JAV A;  4DR1 L;  4GKK Q;  1JE5 A;  2IWH A;  4E6I A;  2QCP X;  2XRS D;  4XYQ A;  1BF4 A;  3HEJ A;  4BWG B;  2AWN A;  3M3Y H;  1X54 A;  2Z6K C;  3OW7 A;  2VQE Q;  1PZJ D;  4G57 A;  2K50 A;  3HOX H;  3SVM A;  1QE6 A;  2F0H A;  3BVZ A;  5J22 A;  1QZH A;  2EYF A;  3RNU A;  3ULP A;  3SK8 A;  4A3M B;  1JWS D;  2VS1 A;  1SE3 A;  1PTO F;  4R4T A;  2L5T A;  4DGZ A;  2IY5 B;  1SEB D;  4B3M Q;  2OXP A;  2R6G A;  3BZK A;  4A3I H;  4KJN A;  1RIP A;  1Z6H A;  2EVB A;  1K0S A;  1ENC A;  1ILP A;  2CH4 W;  1H9J A;  1IKM A;  2F0E A;  5C4J H;  1XMO L;  3FPP A;  1PLF A;  1EFI D;  4IUN A;  4JOI A;  1O7Y A;  2K4K A;  1CSQ A;  3P75 A;  1YHQ A;  1Y1V G;  1SDF A;  1Q3L A;  3N52 A;  1BXT A;  5FLX E;  4A3C H;  4CBV A;  3NP8 A;  1I4G A;  3Q6S A;  5C5L A;  1ZXT A;  1D6E C;  2BH2 A;  2LMC B;  3CP0 A;  3F1Z A;  4XQN A;  3WDN A;  1UE1 A;  4DV5 Q;  4P74 A;  4ZCK A;  1PRT B;  3H91 A;  1L0X B;  3R2T A;  4P72 A;  1K0R A;  3STB C;  1HZC A;  1JQY D;  3CRL C;  1Z47 A;  5COY A;  1S5C D;  4DV7 Q;  2QF7 A;  1I94 Q;  3ONA B;  1JOQ A;  5EPL A;  2FIN B;  2F03 A;  4KJO A;  3T56 B;  5IT9 E;  5DEH A;  1WTP A;  3K0Y A;  1I50 H;  4BBR G;  4DV3 L;  3GTM B;  3T1Y L;  1YHA A;  3VA5 A;  2CWA A;  2KHI A;  3FKI G;  4DR2 L;  5D65 A;  1NMF A;  2HDL A;  4TVA B;  2WB1 E;  4B3S L;  2Q2I A;  1EY0 A;  3JAM i;  1B9N A;  4FO2 A;  2OTL A;  1VQN A;  1SJE D;  1KRT A;  2CFM A;  3J7A 5;  2ICE C;  4JI1 Q;  4A93 G;  1RL2 A;  1KD1 C;  4QMG A;  3RZO H;  4GNX A;  3P7J A;  2D2C C;  3EFX D;  4RKL A;  2JE6 I;  2Q8I B;  4DF7 A;  1S4Z A;  4RA8 A;  1ONL A;  2B2T A;  2F0V A;  4H02 A;  3TP5 A;  2QA4 A;  4S3S A;  2MO1 A;  3S1R H;  2D62 A;  4XT1 B;  5BN3 A;  3PO3 H;  1F2L A;  4JI4 Q;  1AN8 A;  3HZX A;  4U68 A;  1E2Z A;  1ICW A;  3EJI A;  3MXP A;  1JJ2 A;  1XTD A;  2QDL A;  3KOJ A;  4NB3 A;  5E4X A;  3MC0 B;  4YY3 L;  4BY1 H;  1B53 A;  2FMM A;  3HKS A;  4AYB E;  1LAB A;  2QEJ C;  5EAY A;  4DV6 L;  1XNR L;  2JA6 G;  1B4O A;  5JPN C;  1BKB A;  2R93 G;  2ALY B;  1E1O A;  3HOX B;  5ISR A;  1T5X D;  4DR4 Q;  3RZD H;  3M9B A;  3RN2 A;  4IFD H;  1Q46 A;  2PI2 E;  2D0O A;  5IIF A;  3HOW H;  5DLQ E;  3EN2 A;  3X3M A;  1N36 L;  2KA7 A;  4K8I A;  4ABN A;  1ESF A;  1BVS A;  3I4M B;  5IP9 H;  4ALP A;  4Q0F A;  1U0L A;  2CWP A;  5C44 B;  2GVA A;  3MA2 B;  4DNT B;  1KLG D;  5C4J B;  4GS3 A;  2I46 A;  1GUG A;  1M90 C;  4C3H H;  1I6H B;  1KAA A;  3H0G G;  1H9R A;  2ZM6 L;  1GUN A;  5ELE A;  3J7Z C;  2PMZ B;  3NEL A;  3TRE A;  3HKZ E;  3VYR A;  1QIL A;  1EWH A;  3RLF A;  1N8R C;  4K5X A;  4JG2 A;  3Q22 A;  4DR7 L;  3AFQ A;  1VQJ A;  2UU9 Q;  2ZT9 C;  3NWS A;  2I5L X;  1RDP D;  2BE5 C;  5KNC A;  3GV6 A;  5C3E B;  1F2M A;  4KI0 A;  5C0X J;  3CCS A;  2NTS A;  2EDG A;  3FHW A;  1BDO A;  3O13 A;  2KUM A;  3K7U C;  3H6M A;  2F0G A;  2ZXO A;  3HOZ H;  1TS3 A;  4PMW A;  3KLS A;  2Z4H A;  4C56 C;  3A8J E;  1HFN A;  2NZH A;  1C7Y A;  4KHV A;  1ASY A;  2HIV A;  3EIV A;  5FO9 B;  4IUP A;  3CQZ H;  4JVZ A;  3PUW A;  3GTJ H;  1G6P A;  1JT8 A;  1RTN A;  1PZK D;  2N8N A;  5IGD A;  3T1H Q;  1JWU D;  3RZO B;  1SXT A;  4CDC C;  2JA8 H;  2VZA A;  3BYT B;  2RBM A;  4HJ8 A;  3CU7 A;  4C3I G;  1F2Z A;  1IBK L;  4B3R L;  3OIP A;  2C35 B;  2A68 C;  3FDT A;  3FVQ A;  2QKI C;  4DV4 L;  4JW0 A;  4NXM L;  1ESR A;  4GLV B;  1STB A;  1VF7 A;  3S1R B;  3U58 A;  1V8Q A;  2K5Q A;  3H94 A;  5IE8 A;  5KYI A;  4HIK A;  3HGB A;  1IZ6 A;  3T53 B;  1SYD A;  3LNN A;  1OXX K;  1N32 Q;  3LX0 A;  1N9W A;  4K6D A;  1SNM A;  4HJ7 A;  4LNQ A;  5M5Y B;  3I73 A;  1VQO A;  1FNW A;  3PF4 A;  1YNX A;  1HZA A;  4OWW B;  3RMH A;  1IW7 C;  1TR5 A;  2ZTE A;  5IGF A;  4NKL A;  4LF8 L;  2E5L Q;  4A3K G;  3P20 A;  1CHQ D;  3QO2 A;  2BA0 A;  1K3R A;  4JI0 L;  5DM7 3;  2XRQ D;  5JJK A;  2G9D A;  4QB4 A;  3GTL B;  1CQF A;  3EBE A;  1A15 A;  1XNQ L;  1BR9 A;  1F9Q A;  2AQ3 B;  4BBS H;  1P8L A;  1X3F A;  3QOJ A;  3NWT A;  3S1M H;  2HHH L;  1MJC A;  5AJ3 Q;  5L37 A;  1TWH H;  4EVO A;  5GAG C;  2Q2U A;  1U4M A;  1I4H A;  4DK3 C;  3AYH B;  3VR5 A;  5HGQ A;  2EJG C;  5K36 H;  2CQO A;  4A3I G;  4PZ8 A;  4JI1 L;  5GAH C;  1CZG A;  2UUC Q;  4FXD A;  4CHT B;  3S1Q B;  4OIK A;  3DWA A;  5JVH 3;  1E24 A;  1HTL D;  3NBI A;  1TS5 A;  3M4P A;  4UDU C;  1MJE A;  2BA1 A;  2HCI A;  1TWA H;  3NPP A;  2NVQ H;  3ERQ A;  2FJ2 A;  3AB9 A;  3K58 A;  1HNW L;  1YHB A;  2WAQ G;  1EIF A;  2HT1 A;  2Z8L A;  3HOU H;  5JJL A;  1G51 A;  5ELO A;  4G7H C;  5E3F A;  4LUO A;  4H0L C;  2K7V A;  4A75 A;  2UXB Q;  4LUV A;  4GOP C;  3TN2 A;  1XWE A;  3D8G A;  3FEW X;  5IWA Q;  2I5H A;  3UE0 A;  2VUM H;  1FYC A;  4QIW B;  4A3B B;  4HTH A;  1EIH A;  5A35 A;  5IOD A;  1Q8K A;  5FLM G;  1C48 A;  2RQX A;  2JA8 B;  3CC7 A;  1VQ8 A;  5NUC A;  3VR2 A;  3M85 A;  1HCZ A;  3A55 A;  2FHT A;  4A3J H;  3G6E A;  3OTO Q;  3BZC A;  4G7O C;  1PXU A;  2AQ2 B;  3K80 C;  4H44 C;  5M5W B;  2PO4 A;  3H3V C;  4LF7 Q;  1PH4 A;  4MNO A;  4HID A;  1G2S A;  3R8B A;  2ASB A;  2WFW A;  1CK1 A;  3I8Z A;  1IBM Q;  3PO2 B;  3A54 A;  3K7A B;  4LF6 Q;  2NVT H;  1I4P A;  4C2M H;  4TQU S;  4BA1 I;  3F2D A;  3TQY A;  4BBR H;  2KHJ A;  5LMU L;  2K32 A;  4DV0 L;  1TVX A;  4QF4 A;  1NBW A;  1STA A;  3PO3 G;  1GUS A;  3FKI H;  2VW9 A;  1LT5 D;  5BN5 A;  1B44 D;  1OO9 B;  3F8T A;  4EX5 A;  3H3V H;  3E6Z X;  4K8J A;  4HCS A;  1I5F A;  1SYE A;  1N33 L;  3B6Y A;  3OW2 A;  4BY1 G;  4JI7 L;  2ICI A;  2EPB A;  1AEX A;  4POG A;  4R8N A;  2K05 A;  4FF2 A;  3TDQ A;  4IQZ A;  3T13 A;  4IFD G;  2B8G A;  3C1F A;  5CC4 A;  5D14 A;  3HOW G;  3S14 B;  2F1M A;  1SRO A;  3DWP A;  1CA6 A;  2F0S A;  5HGT A;  1WTW A;  4NPS A;  5IP9 G;  1B3A A;  2NVX H;  2JQO A;  3S1N B;  1XPU A;  4QL5 A;  1K8M A;  1LYL A;  2EXZ A;  1C4Q A;  3AMU A;  4X3K A;  3MEF A;  3U4Z A;  3ND9 A;  4DK6 C;  5C5M A;  3ZYY X;  1LTS D;  1EYD A;  4C3J H;  4R4Q A;  2OT2 A;  3I91 A;  2Z6B A;  5JJZ A;  1NR4 A;  3T1H L;  3KFU A;  1B70 B;  3E9I A;  3KUP A;  2OTJ A;  2NZ1 D;  4C3H G;  2ZJP A;  1L1O B;  3K5M A;  3WWV A;  1AFP A;  2F0T A;  1Y69 U;  1PMR A;  2LKV A;  1X6O A;  4JI6 L;  2NVQ B;  5LL6 X;  1L1O A;  2IX0 A;  4FF3 A;  2L12 A;  3KLR A;  2BCO A;  2E75 C;  5CYU A;  2EIF A;  2E2I B;  2K33 A;  3MFY A;  3QB3 A;  3CME A;  4DUY L;  2R7Z G;  2MP1 A;  2B2W A;  1O7I A;  2EYP A;  4HJA A;  3K57 A;  4DN4 M;  2B2U A;  3Q23 A;  1N32 L;  2PCF B;  1ASZ A;  4JI5 L;  1EOV A;  1CSP A;  2MHV A;  1W6J A;  4PNY A;  1H9S B;  2B2V A;  1RKN A;  2SNS A;  4A3G H;  1JMC A;  3KF6 B;  2EZV A;  3HOZ G;  3S2D H;  1PH5 A;  1HRJ A;  1MBY A;  1XX8 A;  1C9O A;  1H9S A;  2MFI A;  4XXE A;  4X62 Q;  1VQ7 A;  1Y1V B;  3KF6 A;  2RA4 A;  2E74 C;  4RCO A;  1PYB A;  2CW0 C;  3A7L A;  4JOI C;  4R9W A;  1FNU A;  1VQ6 A;  3QR8 A;  4JI3 Q;  2G9H D;  2DJF C;  1VQC A;  3J81 L;  1RF2 D;  2XN9 C;  3I56 A;  3UDF A;  4F88 A;  4KMU C;  1HH2 P;  3L7Z C;  1O78 A;  5FJ8 H;  5I2Y A;  2JYO A;  1DJR D;  3TZU A;  1PFS A;  1E0B A;  2PNH A;  4O42 A;  5E4W C;  1A0I A;  1Y1W H;  1VQ4 A;  2NVT B;  5M3F H;  1A3U A;  4LF4 L;  4IJH A;  1D5M C;  4BBR B;  4RAU C;  3KYH C;  4IUT A;  1EEI D;  4X64 L;  1KNA A;  4JV5 Q;  1QVG A;  2JA7 H;  3FKI B;  3L3O C;  2B3G A;  3RN5 A;  1WVL A;  3STB D;  3IL8 A;  4A3D H;  5C3W A;  1UE7 A;  1ZYR C;  4YHH Q;  1VQ5 A;  1IYV A;  2ID0 A;  2IT1 A;  3KDF A;  3I72 A;  5AFW A;  2FXQ A;  2PW7 A;  1N34 Q;  3OMG A;  3GTO B;  2C5C A;  2PI2 A;  3CMA A;  4DUZ Q;  5LHY 1;  4A93 B;  1PVO A;  5LL6 S;  4HMJ A;  4TSS A;  5CV5 A;  1SNC A;  3CCE A;  5T1G A;  2H1E A;  2YV5 A;  1WI5 A;  3R3O A;  2IW3 A;  2AMC B;  4OX9 L;  2NVX B;  2DY7 A;  2EJF C;  2B2T C;  1HQM C;  2UXB L;  4O1N A;  1EZ6 A;  4A3F G;  3M4O H;  3ULL A;  5GAE C;  1VQH A;  1R9T H;  4HSP A;  1BCP C;  2UUA L;  4BBS G;  2L11 A;  3W2D A;  4CDE C;  4U67 3;  5JEA H;  2VQF Q;  2C9O A;  2GN5 A;  3UE1 A;  2JA6 B;  4LFC L;  2R93 B;  2JJQ A;  4GN5 A;  3JAM L;  2AWO A;  2D9U A;  1IYJ B;  2N3S A;  5FOB B;  4ILW A;  2OWO A;  1KQS A;  3A7A B;  2WII B;  2NZO A;  4OL7 A;  2R92 H;  4G4K A;  4A3K H;  1QOH A;  2F0N A;  1RJT A;  4JBJ A;  4L63 B;  1EQR A;  4ZKB B;  3GTP B;  1GD7 A;  1V1Q A;  3E0E A;  2Q2H A;  1SYF A;  2MGS A;  3U4V A;  4LF9 L;  3NE5 B;  1HNX L;  4KK7 A;  3K0X A;  1CQV A;  1KDA A;  2EQS A;  4KHP Q;  1Z9F A;  3S2D B;  1IXR A;  3H0G B;  4WJ4 A;  2I0Q A;  1FR3 A;  3HOU G;  2UXD L;  1WFQ A;  4QGU A;  4IAL A;  5BR8 Q;  2F0U A;  4L8J A;  4GZY C;  1Q12 A;  4IPH A;  2I5M X;  1LTG D;  3QJY A;  2EY1 A;  3J7Y W;  3DHQ A;  4OIJ A;  2VUM G;  2ZJQ A;  2PW5 A;  3CPW A;  4ULL A;  4L5S A;  3EVQ A;  4QJF A;  1TWG B;  1E22 A;  2SNM A;  2K03 A;  1QUQ B;  5I6W A;  1HNZ Q;  2RHS B;  4IN3 A;  4ZKC B;  1JOO A;  4NXN Q;  1JOK A;  1S5D D;  1QUQ A;  3WOE A;  4A3J G;  2KCN A;  1AP0 A;  4FXG C;  2EYM A;  1ICF B;  1TWC H;  4LJZ C;  1VQF A;  4IOA A;  1T5E A;  2F3I A;  4A3E H;  1B3Q A;  2GVB A;  1JR0 D;  4ZRZ A;  2E2H B;  1TKW B;  2BE5 D;  2F3V A;  4P73 A;  2IX1 A;  2PZU A;  1C8C A;  3S17 H;  1QZG A;  3J80 i;  3DWQ A;  1I3Q B;  3A8I E;  1HZ9 A;  4B9W A;  1DOL A;  4IUR A;  1BQQ T;  1T9H A;  4ODG A;  3WOF A;  4X6A H;  5FLM H;  1AZQ A;  1NTG A;  4DR3 L;  3PQI A;  1J5E Q;  4A76 A;  1XMQ Q;  3EQL C;  2O4X A;  2EYJ A;  4C3I B;  2LSS A;  5CMD A;  1H9K A;  1S3O A;  1SFO B;  3NHH A;  1D7Q A;  1BBX C;  1DD2 A;  2B39 A;  4DK0 A;  3NTI A;  4X66 Q;  1CZW A;  4FDB A;  1VF5 C;  4LF5 L;  1K83 H;  2B29 A;  3K8A A;  2TSS A;  5CBA E;  1NNX A;  3V2T A;  3UDX A;  2V1C C;  2A68 D;  3FPU B;  1SYG A;  1VQA A;  5KGU A;  3OSO A;  1DON A;  1PFB A;  1YNN C;  4LFB L;  4FNF A;  1KRS A;  1EUJ A;  1SLJ A;  3BJU A;  4A3K B;  1X9N A;  4Y7N B;  2HQE A;  1KAB A;  4C3J G;  4LFA L;  3CC2 A;  2IX3 A;  2KBN A;  4KD3 A;  2YYZ A;  3VR3 A;  5CV6 A;  5IP7 H;  2R3Z A;  2J4X A;  3M3Y B;  1JJC B;  1OTC A;  1ET6 A;  5EKL A;  4K0K Q;  1IW7 D;  4HIM A;  1ET9 A;  4JI8 Q;  1KL9 A;  4JV5 L;  4MTK A;  4JCV E;  1LLR D;  3W1B A;  1KC8 C;  2D5D A;  3V96 A;  4J6H A;  1D5Z C;  3M4Q A;  1B8A A;  4GKJ Q;  2UXC Q;  1HR0 Q;  1NMG A;  1X3P A;  4A3I B;  5FLX L;  2MUY A;  4FVM A;  5M5X H;  3TEH B;  2CKZ B;  2KEN A;  1N34 L;  3HOY H;  2JEA I;  4RFB A;  2RF4 A;  3NTH A;  2WKC A;  3CXC A;  3UDG A;  2PQE A;  3RUZ A;  3PIO A;  4DR6 Q;  3NSW A;  2AUJ D;  2EY5 A;  4A3G G;  4OWT B;  4DNR B;  3NUC A;  1D8L A;  2XWJ B;  3PIP A;  1B2T A;  2Z6K A;  1JJG A;  1WTX A;  5IT9 L;  2WAQ B;  3GTK H;  1VQ9 A;  3VYT A;  2BOS A;  1TQO A;  4DFA A;  3DEO A;  1ML0 D;  1FGB D;  3T51 B;  2R7Z H;  1VCI A;  3FP9 A;  1L0W A;  2DGY A;  3BDC A;  3BYY B;  3OPO A;  3IRB A;  1AE3 A;  1AE2 A;  1CTM A;  2Z0S A;  4LAA A;  5FJ8 G;  5G3L D;  4OEM B;  5IY0 A;  1VQP A;  4OO1 I;  1A62 A;  4DV2 L;  4FF4 A;  4FYD A;  4YCV A;  1Y1W G;  4X65 L;  4ME3 A;  5M3F G;  3CC4 A;  3BS1 A;  1I50 B;  1PH2 A;  1Q82 C;  4BY7 G;  1SSO A;  2X6G A;  4JBW A;  2XIW A;  5DNF A;  3VR4 A;  2JA7 G;  2N88 A;  1C0A A;  1TY2 A;  1K73 C;  1PDQ A;  3KBX A;  4KN7 C;  1WCM H;  4GKK L;  1HUM A;  3ER0 A;  4A3D G;  2F4V Q;  4HSV A;  4K2K A;  5C6A A;  2KVM A;  3N6R A;  4CKB A;  5DAU A;  2VQE L;  2KEC A;  4ZQ3 A;  2AUK A;  2NTT A;  2JXM B;  1GO3 E;  4DXG A;  1GUT A;  3OHX C;  1KDC A;  3D4W A;  1F2Y A;  5C0X H;  5C0X I;  2A73 B;  4B3M L;  3PO3 B;  1HJP A;  4JYA Q;  3R93 A;  2DUD A;  5EKK A;  3DUZ A;  4FF1 A;  5LMN Q;  1VQK A;  2WV6 D;  4ZYS A;  1HZB A;  5COR A;  4BY1 B;  4L6T B;  1LV9 A;  5D3I B;  5JEA G;  4K5V A;  2K5D A;  5BN4 A;  2IHF A;  5J3B A;  3T16 A;  2H5X A;  3VYS A;  3RZD B;  3AFP A;  2N55 A;  2VY3 A;  4RGN A;  3HOW B;  2UUB Q;  3IAY A;  1EY7 A;  2DNC A;  2HUG A;  2R92 G;  2AHO B;  3EA6 A;  1X32 A;  1QVF A;  3HG9 A;  4DV5 L;  2JA5 H;  2PPB C;  1SE4 A;  4A3F H;  3OWF A;  5FKA C;  2JSO A;  1JWM D;  1W3S A;  4DV7 L;  1MHW C;  1Q86 C;  1I94 L;  3L2P A;  4N9T A;  2VXW A;  3E5S A;  2A69 D;  1Y8O B;  1MGS A;  2XVS A;  4LWC A;  3CCU A;  4K14 A;  4C3H B;  2L15 A;  3PIO 3;  1VQL A;  5CGK A;  1HHV A;  4N8F A;  5KIX A;  4QY7 A;  5ELD A;  2N49 A;  4KKT A;  3PIP 3;  4RHR A;  2F0M A;  3K5O A;  4EQN A;  1LTA D;  1EYC A;  4AQY Q;  2ATW A;  2VL6 A;  1X3G A;  2QW7 A;  2R7Z B;  1BO0 A;  1F9S A;  1SR3 A;  3GDE A;  1EY4 A;  1LO5 D;  1LUZ A;  2F0D A;  2KQ3 A;  1A2T A;  4FXK C;  2KHS A;  2B2W C;  2PNR C;  3S15 H;  2MQH A;  3BDL A;  4KY5 A;  1FJG Q;  4DK1 A;  3HOZ B;  3Q8D A;  3TBI B;  2NN6 H;  2K1B A;  2KOL A;  1IBL Q;  4JI4 L;  1J8I A;  2NN6 I;  2QIL A;  4DR5 Q;  4JI2 Q;  4K5W A;  2E2J H;  1UWV A;  2EY2 A;  4H13 C;  2F3W A;  4A3E G;  3C3L A;  1KDB A;  5T1I A;  2A8V A;  2N78 A;  3CQZ B;  2Y0S G;  1Q1E A;  4B3T Q;  3GTJ B;  3ZJY C;  5IGG A;  3J80 c;  3OOC A;  1K8O A;  1B1Z A;  1II3 A;  5KYL A;  1HA6 A;  1Q7Y C;  4J8Q A;  4V19 0;  4DR4 L;  3FRP B;  3U50 C;  3PCO B;  2L0C A;  2CW0 D;  2MO0 A;  1J9O A;  3G71 A;  3U9S A;  1CA5 A;  3I90 A;  4DV1 Q;  4GKJ L;  4JBM A;  2DJG C;  4R4I A;  4I7A A;  1DM0 B;  1I4X A;  1VQE A;  1QJO A;  3BZD B;  1VQG A;  1G29 1;  2YU9 H;  4BXX H;  2A19 A;  1VQI A;  3TME A;  4R8I A;  1BCP F;  1PYS B;  2EE1 A;  1CKO A;  2B8F A;  4DA2 A;  4DAP A;  4DR6 L;  2WAQ E;  2KJX A;  1NE3 A;  4N8X 1;  5ELN A;  4QQB X;  1H9M A;  2XWB B;  2M9V A;  3KLS X;  1F9R A;  3CAM A;  1G2T A;  1KAW A;  1TS2 A;  3HOV H;  1I4Q A;  4DR1 Q;  1STN A;  1ZYR D;  2NB0 A;  2LY7 A;  4DPG A;  3Q0A A;  2K28 A;  3HRZ C;  4KY7 A;  1M1K C;  5KRU A;  4R1J A;  3F2B A;  3PF5 A;  2JP1 A;  1I4R A;  1O80 A;  1GHK A;  4WOR A;  2O5J C;  1NUC A;  4A3F B;  3D31 A;  1DOM A;  2UU9 L;  2E8G A;  3SEB A;  5IP7 G;  1LTB D;  2CH4 A;  1EY9 A;  3S16 H;  2PQA B;  4KLK A;  3BU2 A;  4BBS B;  3S1M B;  2RDG A;  3QOL A;  3K5L A;  1RHP A;  1QNU A;  2X6L A;  2PQA A;  2A69 C;  2LXJ A;  1SAP A;  1BNZ A;  1TWH B;  3S2H H;  4RKB A;  2KEE A;  1XYI A;  4WJ3 M;  2RHQ B;  1M8A A;  5I2X A;  1L0Y B;  3F2C A;  2K5V A;  2I07 B;  2L55 A;  5F2D A;  1E2W A;  1TWF H;  4NW2 A;  4YCU A;  2RDF A;  1BCP D;  1XMO Q;  1K8G A;  3HOY G;  4Z9C B;  1SN8 A;  3J7A F;  2ZJR A;  5IYD H;  5A2Q E;  3DM3 A;  3PUY A;  4P71 A;  5C4X H;  1ROD A;  4Q5V A;  3J80 E;  3E3X A;  1TWA B;  3S15 B;  3RD4 A;  3TRZ A;  4HJ5 A;  3NEN A;  3A56 A;  2F0O A;  3CKI B;  2J0T D;  2SDF A;  3HOU B;  1SMY D;  2E2J B;  1CKM A;  4CKC A;  3PUX A;  4AH6 A;  1Q90 A;  2F0F A;  4OO1 G;  1PA6 A;  2EY6 A;  2NVY H;  1K9M C;  2VUM B;  3F2U A;  3T1Y Q;  4PG3 A;  1FD7 D;  3VDY A;  5JVG 3;  1STY A;  4CKE A;  1IHZ A;  4NP5 A;  1QNK A;  4PMB A;  4PZ6 A;  4EQP A;  4DR2 Q;  1CKN B;  2EYL A;  2VB3 X;  4Y52 H;  4B3S Q;  4N9P A;  2E5L L;  2A6H C;  4HR7 B;  1CKN A;  4A3J B;  5C4Z A;  2WAC A;  3LGJ A;  4KTA A;  1XXG A;  1WCM G;  1PH8 A;  1HXY D;  4KN4 C;  3C46 A;  1JE4 A;  4MIU A;  2IHE A;  1LAC A;  2F0J A;  4DAY B;  3G48 A;  1X3Q A;  1YIT A;  4GOP B;  4A3M H;  3NTK A;  2IJ0 A;  2RSN A;  1EQQ A;  3J7A V;  1EEF D;  2DN8 A;  1DGS A;  4DAY A;  5AJ3 L;  4C2M B;  5H1S E;  2F0I A;  3MXG A;  4GOP A;  1A6X A;  3TP7 A;  1SYC A;  4BY7 H;  1PRT C;  1Q81 C;  2NUC A;  3I4O A;  5GAD C;  3I2Z A;  2CQA A;  5C0X G;  3PGZ A;  1BOS A;  5CR3 A;  2OEO A;  4DAV A;  2K52 A;  4APV A;  2Q8R E;  1K8A C;  1EY6 A;  4DNI A;  1EIY B;  4XQQ A;  3CD6 A;  2FFK B;  4YY3 Q;  3M7N A;  3R2I A;  2UUC L;  2E2D C;  1XNR Q;  3PMF A;  1S5B D;  4FP5 D;  3DXJ C;  4UPA A;  4ZAI A;  5KEE A;  1KHI A;  1Y8N B;  3AU7 A;  1N36 Q;  3Q24 A;  1OXS C;  1D5X C;  4GNX C;  3W1G A;  4POF A;  1WD1 A;  2A6E C;  5ELB A;  4MTN A;  3GP7 A;  2O5I C;  2JA5 G;  1TWF B;  5I6Y A;  2RVL A;  3SR1 A;  5IWA L;  5FLX c;  4C3J B;  3K6O A;  2R7F A;  2F4I A;  3GTM H;  2HD3 A;  2AQ1 B;  1DXM A;  5M3M G;  1U4R A;  1E3P A;  2ZM6 Q;  1YNN D;  4RWS C;  3K81 C;  5J39 A;  1OXT A;  1QG7 A;  2OCE A;  1PH6 A;  1B9M A;  4O2D A;  4WJW A;  3OTO L;  2B63 G;  2EYO A;  3S9W A;  3CCJ A;  1W2B A;  1CUK A;  4NDX A;  1YEZ A;  5I9O A;  1CI3 M;  3OMC A;  4LF7 L;  4L5Q A;  2EJM A;  4LUZ A;  1DOK A;  4IO9 A;  4UHV A;  3E9H A;  1SMY C;  5FO7 B;  1IBM L;  1MSG A;  2XTI A;  4LF6 L;  1WOC A;  1CM9 A;  2J7Z A;  3DM1 A;  4XTC S;  4WFN 3;  1KIX A;  2XGT A;  1ENA A;  2L9H A;  4A3G B;  3TP8 A;  3M4Y A;  2NN6 G;  1G8Z D;  3E0J A;  2QEX A;  1G6Z A;  1EQV A;  3SK6 A;  3MXU A;  3G4S A;  1UE6 A;  1VS0 A;  1H95 A;  2F0W A;  2H4O A;  4M1U B;  1U4P A;  3VR6 A;  4JBK A;  5CBE E;  3I70 A;  1O7Z A;  1JC7 A;  2K5N A;  3MEH A;  3J81 i;  4L5R C;  4IUV A;  2L1B A;  1TU2 B;  1YI2 A;  3I3C A;  4YWK A;  1IBK Q;  4B3R Q;  4J15 A;  1XJV A;  4DV4 Q;  3I4M H;  1PH3 A;  4MHE A;  1Y1W B;  4NXM Q;  1B7Y B;  5M3F B;  3SXH A;  1WYD A;  4OGQ C;  3I4N G;  4YWM A;  3P1H A;  4BY7 B;  5C44 H;  1PH7 A;  4I65 A;  1EY8 A;  4M8A A;  2JA7 B;  1S5E D;  4IZ8 A;  1CFM A;  2WB1 G;  4XYO A;  4CDF C;  3TS0 A;  4BXX G;  1SE8 A;  5EJW A;  4OXP A;  3CCV A;  1UUP A;  2Z9H A;  4A3D B;  1I6H H;  4HAE A;  4IOC A;  1VDZ A;  4OEL B;  1LM0 A;  4KV6 A;  2OQ0 A;  1E1T A;  4UY8 C;  2R61 A;  3A74 A;  4PMC A;  2IPK D;  4P2C B;  3ERO A;  3UDI A;  2PZW A;  4LF8 Q;  3MFG A;  3PV0 A;  3HOV G;  4K6L A;  2RCN A;  4QCL A;  3A8K E;  1LTI D;  4QUC A;  4JI0 Q;  3QG1 A;  4RGM A;  3ULJ A;  5C3E H;  2CVR A;  2ZTC A;  3CCR A;  1D1K A;  5CV4 A;  1XNQ Q;  3M4O B;  1RD9 D;  1VQB A;  2HHH Q;  3ICE A;  4HCE A;  1R9T B;  2LFN A;  2K01 A;  4KKS A;  4YCW A;  4AYB G;  1GOZ A;  1BBU A;  1NR2 A;  1QB5 D;  1F77 A;  1PTO D;  4IUU A;  4ZUJ A;  1NSN S;  4X62 L;  4LK1 C;  4DAM A;  1QCB D;  4YWL A;  5KNB A;  3DLL A;  4GNX B;  4JI3 L;  3VA7 A;  4IFD J;  3L9A X;  4JC0 A;  2R92 B;  3K5N A;  2KCC A;  1HQR D;  3BVM A;  2B2Y A;  3VYU A;  1U9R A;  5IYD G;  3GQB A;  3V05 A;  4IPG A;  2JEB I;  4IPC A;  5G3L F;  2WP8 J;  4C1N I;  5C4X G;  2G5D A;  2WIN B;  1HNW Q;  1PV4 A;  1BCP B;  1PFN A;  1Q8I A;  1SYB A;  2QDB A;  3H15 A;  2HCC A;  5KND A;  1SNO A;  2CHB D;  5EKI A;  1KTK A;  1WJJ A;  1A63 A;  5EGT A;  4RCN A;  1PHJ A;  3HKZ G;  3D4R A;  3HP3 A;  1MSH A;  2K6A A;  1JCK B;  4YHH L;  5CV7 A;  5M5Y H;  1UNS A;  1GVP A;  1V43 A;  4DUZ L;  2DY8 A;  4IFD I;  2F0P A;  3GV3 A;  1EFW A;  2JN4 A;  3LWU A;  3MZ5 A;  3H09 A;  4C1N K;  2L4N A;  1VQD A;  3MVV A;  1HFG A;  3D0F A;  1TY0 A;  2ENB A;  2RCF A;  5IYC G;  1NCV A;  3SK5 A;  4ID6 A;  1RTO A;  3CPF A;  3CHB D;  3MHB A;  2F0K A;  4PZ7 A;  5C3X A;  2Z4I A;  3GTL H;  4B9X A;  3D6W A;  1TWC B;  1MKH A;  1LTT D;  1EU3 A;  4MZ9 A;  1JOR A;  4A3E B;  4PV1 C;  1KLU D;  1PH9 A;  4OO1 H;  2Y0S B;  4A3M G;  3S17 B;  1KNE A;  2VQF L;  4X3T A;  1E7Z A;  5LMU Q;  4DV0 Q;  1W6K A;  1FL0 A;  1DZ1 A;  3NXW A;  2EXD A;  4F7X A;  3G6J B;  1P16 A;  3JC6 6;  4KD4 A;  1TII D;  2LS0 1;  1NY4 A;  3CRK C;  4CGY B;  2K04 A;  2DNE A;  1LTL A;  1STE A;  4UP7 A;  1N33 Q;  3S1Q H;  1V1P B;  4JI7 Q;  1SMX A;  1ZEQ X;  1QVC A;  3ERS X;  1V1P A;  3SE0 A;  1KXL A;  3OYY A;  4ZK9 B;  1OXU A;  1K83 B;  1YNJ D;  4A3L H;  4F8M A;  4CJ0 B;  2F0Q A;  3NQI A;  5IYB H;  2CCZ A;  4KHP L;  3KJO A;  2SEB D;  3D3R A;  1DYQ A;  1Q1B A;  1TXY A;  3RLN A;  2LXK A;  3TP6 A;  1PTO C;  3MWY W;  1J6Q A;  4OWX B;  2IL8 A;  2M00 A;  5BR8 L;  2ZTD A;  2R7D A;  4A3B H;  5FO8 B;  3BVG A;  5FK9 C;  3KLW A;  2YTX A;  4X3S A;  4RH6 A;  5HY6 A;  3A5Z B;  3D4D A;  1HNZ L;  4H7B A;  5IGB A;  1XTC D;  3GTQ H;  4JI6 Q;  4EQO A;  4NXN L;  4L5T A;  1LT4 D;  5M5W H;  3CCQ A;  1X3E A;  3SK4 A;  1B50 A;  1X65 A;  1PTO H;  4DUY Q;  4V0B A;  2VB2 X;  1GXD C;  1Y8P B;  2HQL A;  1PYW D;  2NWG A;  2K5H A;  3X3N A;  3PO2 H;  5IGC A;  3K7A H;  4CJ1 B;  2O2L D;  1E2V A;  1XPR A;  3NBH B;  2QGQ A;  4JI5 Q;  1WTV A;  2K75 A;  5M5X B;  3MAQ A;  2PZT A;  4HJ9 A;  3HOY B;  4IPD A;  3NBH A;  4DU9 A;  1EWI A;  1TT2 A;  5M3M H;  3AEV A;  4GN4 B;  1J5E L;  5I9P A;  1AW7 A;  1V1O A;  4OON A;  1XMQ L;  3LWE A;  1HR0 W;  2MJ8 A;  5DM6 3;  2SOB A;  2RDH A;  3C1E A;  1GM5 A;  2B63 H;  1U4L A;  3GTK B;  5J1Z A;  1EOT A;  2X69 A;  4X66 L;  1L1O C;  1EU4 A;  3HOX G;  3NK9 A;  2RKS A;  3J81 c;  2NBF A;  4OHJ A;  1QWY A;  2Z1C A;  1PZI D;  3S14 H;  4LF4 Q;  4HED A;  2NYZ D;  3I4M G;  1PRT F;  3S1N H;  4X64 Q;  1JB7 A;  4GLX A;  2B2U C;  4MN3 A;  2E76 C;  4CJ2 C;  4DKA C;  5C44 G;  3URY A;  1WTO A;  3MXN B;  4B08 A;  2B2V C;  2ZXR A;  1EYG A;  1TS4 A;  3T4A C;  2KED A;  3MXN A;  1WCM B;  1BBW A;  2YTV A;  2WKD A;  5D3D A;  3QIA A;  4YIJ A;  2Q2T A;  4LW1 A;  1RCV D;  4ZLT F;  1HUN A;  1ENF A;  4LMQ D;  4HIO A;  1D2B A;  4A3C G;  4K0K L;  1YNJ C;  4R4C A;  1UAP A;  2F0L A;  2A6H D;  1IL2 A;  2E2I H;  4JI8 L;  2PYK A;  4O0A A;  3I4N H;  4OX9 Q;  2UXC L;  1HR0 L;  5M9O A;  1HA5 A;  1R4Q B;  3A5U A;  4RGO S;  1YZ6 A;  5C3E G;  3MTS A;  4A4I A;  3GTG H;  2UUA Q;  2XSC A;  3TZD A;  4LFC Q;  1GUO A;  3DMU A;  1Y1V H;  1PRT D;  3IFD A;  1LT3 D;  1WD0 A;  3DEP A;  3GTQ B;  1U5K A;  3I4L A;  4JK1 C;  1SE2 A;  3JAM c;  4GN3 B;  3CCM A;  5LMN W;  1STG A;  3J81 j;  1VMC A;  1R4P B;  2Y0S E;  1PTO B;  1STH A;  5HUR A;  2PMZ E;  1IKL A;  1UEA B;  3W3A A;  2JA5 B;  5JPM C;  3PSI A;  3BDO A;  1UEB A;  2FMC A;  1EYA A;  4LF9 Q;  1HNX Q;  1NJI C;  1O7L A;  5TSS A;  4IUQ A;  2HIX A;  4TKO B;  2AKW B;  4RHS A;  4KY6 A;  2TMP A;  1JB3 A;  5ELC A;  5CV9 A;  3HS0 C;  4CDD C;  5E1F A;  4P75 A;  3J81 E;  5M3M B;  2EOT A;  3BG3 A;  1S5F D;  2A6E D;  4BS9 A;  2UXD Q;  3IFT A;  4PQX A;  1YIJ A;  4JPB W;  1JIC A;  3TS2 A;  2KCT A;  2OQK A;  3C2P A;  1Z7T A;  1EQT A;  5EBC A;  3H3V I;  4DXF A;  2K14 A;  3GTO H;  2B63 B;  2F4V L;  4K2L A;  4A93 H;  3CCL A;  2F52 A;  5EQ0 A;  4RGT A;  1A8V A;  1GUW A;  2EYH A;  3ITP A;  1BUV T;  4XIG S;  1MD2 D;  1D1I A;  1GHJ A;  2OF1 A;  3KK7 A;  4NMZ A;  3UI2 A;  2A1A A;  2BH8 A;  1WTR A;  5K5P A;  1EIG A;  3RLO A;  1F9P A;  1OXV A;  1CT1 D;  1YJN A;  1VMP A;  4JYA L;  4XDX A;  2MNA A;  4TRD A;  1FGU A;  1EL0 A;  5LMN L;  1YJ9 A;  4RG1 A;  5I4D A;  2JA6 H;  1MI2 A;  2R93 H;  2ES2 A;  3IKJ A;  2GA4 B;  2YTY A;  4DR3 Q;  4DV3 Q;  1L2F A;  3SDZ A;  2KCM A;  1S40 A;  1S72 A;  4I7Z C;  1I6V C;  1XPO A;  1ILQ A; 
#chains in the Genus database with same CATH homology
 3J81 i;  1E24 A;  4L5R C;  1JJG A;  4BA2 I;  3GTK H;  1VQ9 A;  2UUB L;  3TS2 A;  5IYC H;  1YI2 A;  4YWK A;  4EQ5 A;  3M4P A;  1IBK Q;  4B3R Q;  4J15 A;  1XJV A;  2BA1 A;  1MJE A;  1TWA H;  3GTP H;  2NVQ H;  4DV4 Q;  3I4M H;  2R7Z H;  1PH3 A;  1VCI A;  3FP9 A;  1L0W A;  4LF5 Q;  1YHB A;  1B7Y B;  2DGY A;  1EIF A;  2WAQ G;  4NXM Q;  2HT1 A;  1HNW L;  1WYD A;  3I55 A;  3IRB A;  1AE3 A;  3HOU H;  4YWM A;  1AE2 A;  2Z0S A;  5FJ8 G;  3I4N G;  5JJL A;  4IJL A;  5C44 H;  4OO1 I;  5IY0 A;  1G51 A;  1VQP A;  1PH7 A;  1A62 A;  3AQQ A;  4DV2 L;  3HFZ B;  5ELO A;  4A3L G;  4YCV A;  1Y1W G;  4X65 L;  3CF5 A;  4ME3 A;  3H0G H;  5M3F G;  4LUO A;  3CC4 A;  2WB1 G;  5IYB G;  4A75 A;  2UXB Q;  4LUV A;  1PH2 A;  4GOP C;  2JK8 A;  1Q82 C;  4BY7 G;  3TS0 A;  4BXX G;  5IWA Q;  1SE8 A;  3L0O A;  2I5H A;  4OXP A;  4JBW A;  3UE0 A;  3CCV A;  1PH1 A;  2VUM H;  4LFB Q;  1I6H H;  4IOC A;  2JA7 G;  1C0A A;  1K73 C;  3ICE A;  1LM0 A;  1Q8K A;  5FLM G;  1WCM H;  3I7F A;  4UP9 A;  3W5O A;  3CC7 A;  1VQ8 A;  2OQ0 A;  3ER0 A;  4A3D G;  1E1T A;  2F4V Q;  4GKK L;  3M85 A;  4UY8 C;  1V9P A;  4GLA C;  3A74 A;  4R4O A;  4A3B G;  4LFA Q;  4A3J H;  4AQY L;  1TWG H;  3UDI A;  4LF8 Q;  3G6E A;  3PV0 A;  3SGI A;  4DV6 Q;  3OTO Q;  2VQE L;  2JA8 G;  3BZC A;  5JJI A;  3HOV G;  4RMF A;  3K80 C;  3CW2 C;  1UE5 A;  2RCN A;  1GO3 E;  3KJP A;  4LF7 Q;  3PUV A;  1PH4 A;  4JI0 Q;  1YJW A;  4MNO A;  4HID A;  5GRO A;  3ULJ A;  5C3E H;  2ASB A;  1FVI A;  2WFW A;  2ZTC A;  3CCR A;  1X56 A;  1FJG L;  1XNQ Q;  3GD7 A;  1IBM Q;  1VQB A;  1IBL L;  3KDF B;  2HHH Q;  4LF6 Q;  4C2M H;  5C0X I;  4DR5 L;  2NVT H;  4TQU S;  4B3M L;  4JI2 L;  1HJP A;  4YCW A;  4BA1 I;  2E2H H;  4AYB G;  5JEA J;  3F2D A;  4JYA Q;  1MIU A;  3TQY A;  4BBR H;  2DUD A;  2KHJ A;  1BBU A;  5LMU L;  4DV0 L;  5LMN Q;  3A0J A;  1VQK A;  1I3Q H;  3PO2 G;  3GO5 A;  1NBW A;  3PUZ A;  4AIM A;  4X62 L;  3PO3 G;  3FKI H;  1SRU A;  4DAM A;  1HZB A;  2VW9 A;  1YVC A;  4B3T L;  4YWL A;  3DLL A;  5JEA G;  3F8T A;  4EX5 A;  4GNX B;  1GKH A;  2JA9 A;  4JI3 L;  4C3I H;  3H3V H;  1YBY A;  4JC0 A;  1Y14 B;  2IHF A;  1I5F A;  5J3B A;  1SFO H;  1N33 L;  4IFD J;  2D0P A;  3B6Y A;  3OW2 A;  4BY1 G;  1VQM A;  4JI7 L;  2H5X A;  3AFP A;  2VY3 A;  4QIW E;  2UUB Q;  4POG A;  5IYD G;  4DV1 L;  2R92 G;  2AHO B;  4IPG A;  2JEB I;  4IPC A;  5C4X G;  2WP8 J;  4UP8 A;  1QVF A;  4KHZ A;  4DV5 L;  4IFD G;  2JA5 H;  5IT9 c;  1HNW Q;  1PV4 A;  3HOW G;  1SRO A;  4A3F H;  4DR7 Q;  3KF8 B;  3H15 A;  3RR5 A;  1W3S A;  4DV7 L;  4NPS A;  4DV2 Q;  1Q86 C;  1I94 L;  5IP9 G;  3L2P A;  2NVX H;  2JQO A;  1WJJ A;  1A63 A;  3NEM A;  1XPU A;  2VNU D;  4QL5 A;  4X65 Q;  1LYL A;  1AH9 A;  1PHJ A;  3MEF A;  3HKZ G;  3U4Z A;  4DK6 C;  1X55 A;  4LWC A;  3CCU A;  5E7N A;  3S24 A;  4C3J H;  4YHH L;  4R4Q A;  2L15 A;  1VQL A;  4QY7 A;  5GQO A;  3T1H L;  3KFU A;  5M5Y H;  5K36 G;  1B70 B;  2N49 A;  3E9I A;  1GVP A;  1V43 A;  4DUZ L;  4Y7N H;  2OTJ A;  4DR1 L;  4GKK Q;  2ZJP A;  1L1O B;  4IFD I;  1JE5 A;  3WWV A;  1EFW A;  1X6O A;  4AQY Q;  2VL6 A;  1X3G A;  4JI6 L;  2ATW A;  1L1O A;  2AWN A;  2IX0 A;  3M3Y H;  1X54 A;  2Z6K C;  2VQE Q;  1VQD A;  2K50 A;  1SR3 A;  3D0F A;  3GDE A;  5IYC G;  3HOX H;  1LUZ A;  1QZH A;  3CPF A;  2EIF A;  3CME A;  4PZ7 A;  4DUY L;  3GTL H;  3RNU A;  2R7Z G;  3ULP A;  1MKH A;  3S15 H;  2MQH A;  4MZ9 A;  1O7I A;  1FJG Q;  2VS1 A;  4HJA A;  1N32 L;  3Q8D A;  4R4T A;  2IY5 B;  1IBL Q;  1ASZ A;  4JI4 L;  4JI5 L;  1PH9 A;  2NN6 I;  4DR5 Q;  4JI2 Q;  2R6G A;  1EOV A;  3BZK A;  1CSP A;  4A3I H;  4B3M Q;  1RIP A;  4A3M G;  2E2J H;  4A3G H;  1UWV A;  2VQF L;  5LMU Q;  1E7Z A;  4DV0 Q;  1JMC A;  3KF6 B;  1FL0 A;  4A3E G;  3HOZ G;  3S2D H;  1PH5 A;  2A8V A;  2EXD A;  1C9O A;  2MFI A;  2N78 A;  4X62 Q;  5C4J H;  1VQ7 A;  1XMO L;  1P16 A;  3KF6 A;  2Y0S G;  1Q1E A;  3JC6 6;  4B3T Q;  3ZJY C;  3J80 c;  1PYB A;  4JOI C;  1NY4 A;  1VQ6 A;  4JI3 Q;  4JOI A;  3S1Q H;  4UP7 A;  1LTL A;  1VQC A;  1Q7Y C;  1N33 Q;  2K4K A;  1CSQ A;  4DR4 L;  1YHQ A;  1Y1V G;  3U50 C;  3I56 A;  3PCO B;  3UDF A;  4JI7 Q;  4A3C H;  1SMX A;  1QVC A;  2MO0 A;  1HH2 P;  3L7Z C;  3G71 A;  3ERS X;  5FJ8 H;  1KXL A;  4DV1 Q;  3OYY A;  1PFS A;  1OXU A;  2PNH A;  2BH2 A;  4GKJ L;  4A3L H;  3F1Z A;  3CP0 A;  4JBM A;  1A0I A;  1Y1W H;  4R4I A;  1VQ4 A;  1UE1 A;  4DV5 Q;  4P74 A;  1VQE A;  5M3F H;  5IYB H;  4LF4 L;  4IJH A;  2CCZ A;  4KHP L;  1VQG A;  1G29 1;  1K0R A;  4P72 A;  3KYH C;  1HZC A;  3STB C;  2A19 A;  1Z47 A;  3KJO A;  2YU9 H;  1VQI A;  4BXX H;  1Q1B A;  4DV7 Q;  1TXY A;  1PYS B;  4X64 L;  1CKO A;  1QVG A;  1I94 Q;  3RLN A;  2LXK A;  2JA7 H;  4JV5 Q;  4DR6 L;  2B3G A;  3RN5 A;  1J6Q A;  4OWX B;  1I50 H;  2WAQ E;  4BBR G;  1NE3 A;  3STB D;  4DV3 L;  3T1Y L;  1YHA A;  5BR8 L;  5ELN A;  4A3D H;  4QQB X;  1UE7 A;  4YHH Q;  2ZTD A;  1VQ5 A;  2R7D A;  4A3B H;  2ID0 A;  2IT1 A;  3KDF A;  2CWA A;  2KHI A;  3FKI G;  4DR2 L;  2FXQ A;  3CAM A;  1N34 Q;  1KAW A;  2PI2 A;  1NMF A;  3KLW A;  2YTX A;  3CMA A;  4TVA B;  4DUZ Q;  2WB1 E;  4B3S L;  2Q2I A;  3HOV H;  3JAM i;  4DR1 Q;  2OTL A;  1VQN A;  5HY6 A;  1KRT A;  1PVO A;  4DPG A;  2CFM A;  3A5Z B;  1HNZ L;  3J7A 5;  1M1K C;  3GTQ H;  4JI1 Q;  4R1J A;  3F2B A;  4JI6 Q;  3PF5 A;  4NXN L;  4L5T A;  4A93 G;  1RL2 A;  1KD1 C;  3CCE A;  5M5W H;  3CCQ A;  3RZO H;  4GNX A;  3D31 A;  2UU9 L;  1X3E A;  2E8G A;  2YV5 A;  1WI5 A;  2JE6 I;  1X65 A;  5IP7 G;  2AMC B;  4OX9 L;  4DUY Q;  3S16 H;  2PQA B;  4KLK A;  3BU2 A;  2HQL A;  2UXB L;  2K5H A;  4A3F G;  3M4O H;  4H02 A;  3ULL A;  2QA4 A;  3PO2 H;  5GAE C;  3K7A H;  2MO1 A;  3S1R H;  1VQH A;  2D62 A;  2PQA A;  2LXJ A;  1R9T H;  1XPR A;  3NBH B;  4JI4 Q;  3PO3 H;  2QGQ A;  4JI5 Q;  3S2H H;  2K75 A;  2UUA L;  4WJ3 M;  4HJ9 A;  2RHQ B;  4BBS G;  2VQF Q;  4IPD A;  3F2C A;  2K5V A;  2GN5 A;  3UE1 A;  1JJ2 A;  1EWI A;  4LFC L;  1XTD A;  3KOJ A;  1TWF H;  5M3M H;  4NB3 A;  2JJQ A;  4GN5 A;  3AEV A;  4YCU A;  2AWO A;  4YY3 L;  4GN4 B;  1K8G A;  1XMO Q;  1J5E L;  3HKS A;  1IYJ B;  2N3S A;  4OON A;  1XMQ L;  4AYB E;  4BY1 H;  5EAY A;  4DV6 L;  3HOY G;  1XNR L;  2OWO A;  1KQS A;  2JA6 G;  1SN8 A;  2ZJR A;  5IYD H;  1BKB A;  2NZO A;  1HR0 W;  2R92 H;  4A3K H;  2ALY B;  1E1O A;  3DM3 A;  3PUY A;  2R93 G;  4P71 A;  5C4X H;  2B63 H;  1GM5 A;  4DR4 Q;  3RZD H;  3M9B A;  3RN2 A;  1Q46 A;  4X66 L;  2PI2 E;  2D0O A;  4JBJ A;  3HOW H;  1EQR A;  3EN2 A;  5DLQ E;  1L1O C;  1GD7 A;  1V1Q A;  1N36 L;  3E0E A;  1BVS A;  3HOX G;  3TRZ A;  2Q2H A;  4HJ5 A;  3NEN A;  5IP9 H;  3J81 c;  4ALP A;  3U4V A;  4LF9 L;  1U0L A;  1HNX L;  3K0X A;  2CWP A;  3S14 H;  4LF4 Q;  2EQS A;  4KHP Q;  2GVA A;  1Z9F A;  3I4M G;  1CKM A;  3PUX A;  3S1N H;  4AH6 A;  1IXR A;  4X64 Q;  1JB7 A;  4GLX A;  2I0Q A;  4WJ4 A;  3HOU G;  4OO1 G;  1PA6 A;  4GS3 A;  4DKA C;  5C44 G;  2UXD L;  1WFQ A;  2NVY H;  4QGU A;  1K9M C;  3MXN B;  1M90 C;  4C3H H;  1EYG A;  3T1Y Q;  5BR8 Q;  4PG3 A;  3VDY A;  3H0G G;  1Q12 A;  4IPH A;  2ZM6 L;  2I5M X;  4PZ6 A;  4DR2 Q;  3J7Z C;  1CKN B;  3NEL A;  1BBW A;  2YTV A;  2Q2T A;  3TRE A;  2VUM G;  4Y52 H;  2ZJQ A;  3HKZ E;  4B3S Q;  3CPW A;  2E5L L;  4L5S A;  4LW1 A;  1CKN A;  3RLF A;  4QJF A;  1E22 A;  3LGJ A;  1QUQ B;  1HNZ Q;  1WCM G;  2RHS B;  1N8R C;  4HIO A;  1PH8 A;  4A3C G;  4K0K L;  4NXN Q;  4JG2 A;  4R4C A;  1QUQ A;  3AFQ A;  4DR7 L;  4A3J G;  1IL2 A;  2E2I H;  1VQJ A;  4JI8 L;  2UU9 Q;  2IHE A;  2I5L X;  4O0A A;  3I4N H;  4DAY B;  4KI0 A;  1TWC H;  3G48 A;  5C0X J;  1YIT A;  3CCS A;  4OX9 Q;  4GOP B;  4A3M H;  3FHW A;  1EQQ A;  1VQF A;  4IOA A;  2UXC L;  2F3I A;  3K7U C;  1HR0 L;  4A3E H;  1DGS A;  5AJ3 L;  3HOZ H;  2GVB A;  5H1S E;  3A5U A;  4PMW A;  4GOP A;  4P73 A;  1YZ6 A;  5C3E G;  2IX1 A;  4BY7 H;  1Q81 C;  4A4I A;  3S17 H;  1QZG A;  3J80 i;  3GTG H;  3I4O A;  2NZH A;  5GAD C;  2UUA Q;  3I2Z A;  1C7Y A;  5C0X G;  3PGZ A;  1ASY A;  1HZ9 A;  2HIV A;  2K52 A;  3EIV A;  4APV A;  1T9H A;  4LFC Q;  4X6A H;  3CQZ H;  5FLM H;  1NTG A;  1K8A C;  1EIY B;  1Y1V H;  4DNI A;  4DR3 L;  3PUW A;  3CD6 A;  4YY3 Q;  3GTJ H;  3M7N A;  1J5E Q;  1G6P A;  4A76 A;  1XMQ Q;  1JT8 A;  2UUC L;  1U5K A;  2LSS A;  1XNR Q;  1S3O A;  2N8N A;  3T1H Q;  1D7Q A;  3JAM c;  4GN3 B;  2VZA A;  2JA8 H;  3CCM A;  4HJ8 A;  5LMN W;  4UPA A;  3J81 j;  2Y0S E;  4X66 Q;  1IBK L;  4B3R L;  1KHI A;  4FDB A;  2C35 B;  4DV4 L;  1N36 Q;  2PMZ E;  4NXM L;  4LF5 L;  1K83 H;  1OXS C;  4GLV B;  2B29 A;  3K8A A;  4GNX C;  3W1G A;  3PSI A;  4POF A;  1UEB A;  4LF9 Q;  1HNX Q;  1NJI C;  3U58 A;  2HIX A;  3UDX A;  2AKW B;  2V1C C;  4MTN A;  5IE8 A;  4HIK A;  1IZ6 A;  1VQA A;  2JA5 G;  1OXX K;  4P75 A;  5IWA L;  1N32 Q;  4LFB L;  5FLX c;  2UXD Q;  1N9W A;  2R7F A;  3GTM H;  1KRS A;  4HJ7 A;  4LNQ A;  1YIJ A;  1EUJ A;  1SLJ A;  3BJU A;  5M3M G;  2KCT A;  2OQK A;  1VQO A;  1X9N A;  3H3V I;  1E3P A;  3PF4 A;  2ZM6 Q;  2K14 A;  3GTO H;  1YNX A;  1HZA A;  2F4V L;  4OWW B;  4A93 H;  3CCL A;  3K81 C;  3CC2 A;  4LFA L;  2F52 A;  2KBN A;  2ZTE A;  1OXT A;  2YYZ A;  4LF8 L;  2OCE A;  2E5L Q;  1A8V A;  4A3K G;  1PH6 A;  4O2D A;  3OTO L;  5IP7 H;  4XIG S;  2B63 G;  1JJC B;  1OTC A;  3CCJ A;  1W2B A;  1CUK A;  1YEZ A;  2BA0 A;  4K0K Q;  1K3R A;  4LF7 L;  4L5Q A;  2A1A A;  2BH8 A;  4JI0 L;  4LUZ A;  5JJK A;  4HIM A;  4JI8 Q;  4IO9 A;  3RLO A;  1KL9 A;  4JV5 L;  4JCV E;  3W1B A;  3EBE A;  3E9H A;  1KC8 C;  1OXV A;  1XNQ L;  3M4Q A;  1B8A A;  1IBM L;  1P8L A;  1X3F A;  3S1M H;  4BBS H;  2XTI A;  2HHH L;  4LF6 L;  4GKJ Q;  2UXC Q;  1YJN A;  1MJC A;  1NMG A;  1HR0 Q;  4JYA L;  1WOC A;  5AJ3 Q;  2MNA A;  1FGU A;  4XTC S;  1TWH H;  5LMN L;  5M5X H;  2XGT A;  1YJ9 A;  1KIX A;  3TEH B;  2CKZ B;  4RG1 A;  5GAG C;  2KEN A;  1N34 L;  2Q2U A;  3HOY H;  2JEA I;  4DK3 C;  2RF4 A;  3CXC A;  2NN6 G;  3AYH B;  2QEX A;  3UDG A;  5HGQ A;  2JA6 H;  2R93 H;  2CQO A;  2ES2 A;  3PIO A;  4DR6 Q;  4A3I G;  3G4S A;  1UE6 A;  1VS0 A;  2YTY A;  4A3G G;  4PZ8 A;  1H95 A;  4DR3 Q;  4DV3 Q;  1L2F A;  4OWT B;  4JI1 L;  5GAH C;  4JBK A;  1D8L A;  2KCM A;  1S40 A;  1S72 A;  2UUC Q;  3PIP A;  2K5N A;  1XPO A;  2Z6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...