4HIKA

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggttacggt)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
molecule keywords Protection of telomeres protein 1
total genus 34
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hikA00
4O2DA 5ELNA 2QGQA 3NBHB 4OONA 3A5UA 2OTJA 4IPCA 1VQ4A 4X66L 3CCMA 4NXML 4OX9L 1NMGA 4A93H 4HIMA 5LMNW 5IYCG 4B3RQ 4BA2I 2JJQA 4A3JG 4YCUA 2CKZB 1X3FA 1Q8KA 2UUBL 4A3BH 2D0PA 1C0AA 2YTVA 4MZ9A 4DV7Q 2E8GA 1EQQA 1G291 5DLQE 2K4KA 1B8AA 2MNAA 1JJGA 4P73A 1QVGA 1BVSA 4OXPA 5J3BA 2ZM6Q 4A3IG 2DGYA 4DR5L 1ASZA 2R92G 1IZ6A 2PMZE 3KDFA 2ZJQA 3I4MG 1CKOA 1PH4A 1FJGQ 3CMEA 1N32L 1UE5A 4LUVA 3UDXA 4YY3Q 1UE1A 4R4TA 4JI3L 3PIPA 1H95A 2UXBL 5HGQA 1HNWQ 4BA1I 4GNXA 4A3KG 4WJ4A 1VS0A 1UE6A 1AE2A 4A3DG 3F1ZA 2VQEQ 3CCJA 4OO1G 4LFCQ 4KLKA 4UP7A 4DKAC 5M3FG 4X64L 1I94L 2WFWA 5C3EH 4GNXC 1N36L 5IP7G 4BBSG 1CSQA 3UDGA 2ZTDA 3NENA 5GROA 1HZBA 1PH6A 1V9PA 4GS3A 3RLFA 4AYBG 4HJ8A 3HOWG 1PH9A 2JA7H 2KHIA 2VZAA 2N3SA 1HNWL 3GTLH 4DR6Q 1K83H 3PO3H 4UPAA 2IY5B 2GVBA 2NVXH 4IJLA 1VQDA 5LMUL 4DUYQ 3HOYG 3S1MH 3D0FA 5IWAQ 4YWKA 3CPWA 3WWVA 3G71A 2B29A 1MJCA 4DR5Q 2YU9H 4Y52H 2AMCB 2WB1G 4DUYL 4BY1H 5FLMG 1PV4A 1K73C 1E1OA 4GKKQ 2JA8H 4KHPQ 1IYJB 4DV0Q 3S14H 3GTMH 4A3FG 4BBSH 3A0JA 2NN6G 3AEVA 1B7YB 1AE3A 1VQLA 3K7AH 3M9BA 3PF5A 1I5FA 3T1YL 1AH9A 1D7QA 2KBNA 2KENA 3UE0A 1VQBA 1VQ8A 2IX1A 3GTJH 4DR4L 2MO0A 4MTNA 4LFCL 4LNQA 2VQEL 4B3TQ 1Q46A 4C2MH 5E7NA 2OQKA 5H1SE 1EIYB 2WB1E 3A5ZB 2VL6A 2YYZA 2VY3A 1JE5A 1QZGA 4R4OA 4BXXH 4YY3L 2UXCL 5IYDH 1T9HA 1GM5A 1QUQB 3FKIH 4IOCA 5BR8L 2YTXA 4LFBQ 3ER0A 3I2ZA 2JQOA 4JI1L 4A76A 3STBD 2CCZA 3RZOH 3HOVH 1VQ9A 3HOZG 4YWLA 1YI2A 4GOPC 2ID0A 3K80C 4QJFA 1EFWA 4JI0Q 1PYBA 3F2CA 2UXDL 1A62A 1YEZA 1VQAA 1EWIA 3U50C 2JA6H 4PG3A 1K9MC 2XGTA 4GLAC 4RMFA 3M7NA 4IPHA 4DV2L 2WP8J 4B3ML 2IHFA 1XNQQ 3GTPH 1HR0L 1HJPA 3A74A 4JI5L 2R6GA 2Z6KC 3AYHB 4IPDA 3I56A 3S24A 3OTOL 4R4IA 1EOVA 5GAEC 2Y0SG 3HOUG 3D31A 4OWWB 4IPGA 3S2DH 1R9TH 5LMNL 3E9IA 4X66Q 1E1TA 4NXMQ 4KI0A 4OX9Q 1SMXA 1I6HH 4LUOA 2BH2A 1TWCH 2H5XA 2N49A 1X56A 5IP9H 3T1HL 5IY0A 4YCVA 4DUZL 4A3CH 3KYHC 4DR1Q 2UUAQ 1VQMA 1CUKA 3JAMc 2JE6I 3L0OA 4AIMA 2B63H 2R93H 3CC2A 1LM0A 1YNXA 3KJPA 2NVQH 3CCLA 4JI8L 2E2HH 3RLNA 2OTLA 2IX0A 1SE8A 1L1OB 1M90C 4LF6L 4HJAA 3HOWH 4BXXG 3AQQA 2I5LX 2ZTEA 3J80c 3BZCA 1Y14B 3CP0A 4LUZA 3JC66 3PIOA 3CD6A 1KC8C 2EQSA 4JG2A 2PI2A 1N34Q 3ERSX 4A3EH 1X65A 3PUZA 4GLVB 1N34L 5IT9c 4A3KH 2F4VQ 4LFAQ 1XJVA 4L5TA 1XNRL 3H3VH 5IYCH 1VQGA 1BKBA 4HIKA 4A93G 4LF8L 4PZ8A 3W1GA 4LF6Q 2VUMG 1PVOA 3F8TA 3BZKA 2F3IA 3K81C 4UP8A 5GADC 4DV4L 1J5EQ 3J81i 4JOIC 3I4NH 4JI8Q 2LSSA 1PH7A 3KFUA 1QZHA 2RHSB 2Q2TA 5FLMH 3H0GG 4HIOA 4JYAL 4B3SQ 1HH2P 3RLOA 1L1OA 2R92H 4IFDI 3CCEA 4LF5L 4A3IH 1I50H 3T1HQ 4DV5Q 4JBKA 5C4XH 2QA4A 1FL0A 1W3SA 2IT1A 4TVAB 5LMUQ 1VQKA 2VNUD 1K8GA 1N33L 1Y1WG 3KDFB 3ICEA 4JBWA 3HOYH 3U4ZA 4GKJQ 1RIPA 2OCEA 4BBRH 4A3BG 1MJEA 2BA1A 4YHHQ 5AJ3Q 4C3HH 2XTIA 3EBEA 4A3JH 4NXNQ 3UDFA 3CC7A 1TWAH 2K5NA 1IBML 2N78A 2ATWA 1WYDA 2A19A 4X64Q 3CCUA 1HR0Q 2R7ZG 1XNQL 1TXYA 2BH8A 4JOIA 1K0RA 1VQEA 5M3MH 1VQNA 3CQZH 5EAYA 2VW9A 1Y1VH 1LUZA 1MIUA 4P75A 1V43A 1YIJA 1TWHH 3M3YH 1KRTA 4GN3B 2UXBQ 3H15A 4JI5Q 4A75A 2F52A 3RNUA 1XMOQ 4JI6L 4NXNL 3K7UC 2E2JH 1XPUA 4FDBA 1OXTA 1S3OA 3K8AA 1FJGL 1J6QA 1HZ9A 1C7YA 1SLJA 2VQFQ 1YHAA 1WCMG 1YBYA 3BU2A 3CMAA 3IRBA 3CCVA 4DR3L 1XMQQ 1PHJA 1SR3A 3I4MH 3GDEA 5JEAG 3CCRA 3KF6B 2D0OA 1IBLL 1VQHA 2NN6I 4DNIA 4DR2L 2DUDA 4HIDA 4ME3A 4R1JA 3F2DA 2HQLA 3STBC 4DR4Q 1FGUA 1LYLA 1IBKL 1HNZQ 3AFPA 1OXVA 2I5MX 4NPSA 4K0KL 4C3IH 3LGJA 3T1YQ 3NELA 3PUWA 4LF8Q 4B3RL 1E24A 1CKMA 4IO9A 2PQAA 1XTDA 2OQ0A 1XNRQ 2KHJA 3GD7A 4DV0L 4R4QA 3ULJA 5FJ8H 4AQYQ 1U5KA 2Z6KA 3RN2A 1TWFH 3PV0A 2B3GA 1VCIA 2Q2UA 1D8LA 2AWNA 3J7ZC 4R4CA 2EIFA 4LW1A 4GLXA 3KJOA 1MKHA 5GQOA 1OTCA 5IWAL 4LF9L 4DR7L 4GOPA 2B63G 1BBWA 1A63A 5GAHC 4YCWA 3S1RH 3CCSA 1Y1WH 3UDIA 3SGIA 2BA0A 4JI7Q 5IP9G 4EX5A 2N8NA 4KHZA 4DR1L 1KAWA 3MEFA 2UUAL 1OXSC 4QQBX 2UU9Q 1HR0W 2MQHA 3Q8DA 1Q7YC 5C44H 2Q2HA 3H0GH 1A8VA 2HIVA 1CKNA 1YJ9A 1HNXL 1IL2A 3U58A 3PUYA 2HHHQ 4AQYL 1K3RA 1Y1VG 3GTQH 3TREA 5M3MG 1NTGA 2K5VA 2E5LQ 1N9WA 3L7ZC 3S2HH 1ASYA 1DGSA 3FP9A 4HJ9A 2PQAB 3KF8B 4K0KQ 3OYYA 4X65L 5JEAJ 1A0IA 4UP9A 1HZAA 3E9HA 4A3LH 4BBRG 1GO3E 1NBWA 4A3EG 5IYBG 3KF6A 1PH1A 1PH8A 1JT8A 3M85A 1WOCA 3TRZA 3HOVG 1Q1BA 3G48A 1Q86C 4DV1L 4JBJA 4JI0L 2JEAI 1KQSA 1PYSB 2I0QA 2UUCL 5M5YH 2UUCQ 1QVFA 2VQFL 4GOPB 1VQPA 3I4NG 1Q1EA 1WJJA 4LF4Q 2A8VA 4LFBL 3ULLA 5BR8Q 1KD1C 5FLXc 1LTLA 4A3CG 5C0XI 2KCMA 3DLLA 2UUBQ 3S16H 4PMWA 3PO2G 1X54A 1GKHA 1UEBA 2A1AA 3S1QH 3I55A 1XPOA 3W5OA 4DV7L 3RN5A 4DAYB 4A3GG 1VQIA 1OXUA 4UY8C 2ZJPA 4JC0A 5IE8A 4JBMA 4IFDG 3K0XA 3CCQA 1VQJA 4QGUA 1K8AC 1HZCA 4IFDJ 3AFQA 1XPRA 4JI2L 3CAMA 2WAQE 4JCVE 5M5WH 2KCTA 4J15A 2UU9L 4GKJL 1S40A 4QL5A 1UWVA 1Z47A 2JA6G 4IOAA 4JI7L 3PUVA 2CWPA 1IBLQ 1QUQA 5C4JH 3GTOH 1Z9FA 4H02A 4X62L 1IXRA 1YITA 1E7ZA 1Q82C 1CSPA 2IHEA 3W1BA 2JA5G 4PZ7A 1NMFA 2ASBA 2VS1A 4P72A 3PO3G 1J5EL 1Q12A 2JA7G 1M1KC 2WAQG 2NZHA 3FHWA 1NE3A 5ELOA 1PA6A 4X65Q 3M4QA 1P16A 2HIXA 2YV5A 5IP7H 1N8RC 2PNHA 3S17H 2VUMH 2F4VL 3RZDH 1U0LA 5C0XJ 5M3FH 2AHOB 2NVYH 4XIGS 3TS0A 2E5LL 1N36Q 1PH5A 1IBMQ 1Q81C 2HHHL 1IBKQ 1HNZL 1VQ6A 4DV6L 1QVCA 1S72A 2GVAA 4YHHL 3H3VI 3HFZB 1EUJA 1NJIC 3HOZH 3EIVA 3CW2C 3PUXA 4DR2Q 4OWTB 3CPFA 1C9OA 3TQYA 4JI3Q 3GO5A 4AYBE 4DV5L 1BBUA 2D62A 4BY1G 3FKIG 3HKZE 4XTCS 4POFA 1N32Q 1GD7A 1W2BA 4LF9Q 3L2PA 1E3PA 1B70B 2OWOA 2CFMA 1X3EA 4L5QA 3TEHB 3S1NH 2R93G 5JJKA 1VQFA 4DPGA 1L1OC 4ALPA 1VQCA 4JI6Q 3TS2A 2ZM6L 4JV5L 3MXNB 1EYGA 3BJUA 4HJ7A 4A3GH 1X3GA 3HKSA 2JA9A 3CXCA 4L5SA 1YVCA 3ULPA 3JAMi 3VDYA 1O7IA 2MO1A 1JB7A 3HKZG 4JI4Q 3HOUH 4DV2Q 4B3MQ 1SFOH 4A3FH 4NB3A 1GVPA 4A4IA 3J80i 1PFSA 5C3EG 3PSIA 4LF7Q 1KIXA 2NVTH 3OW2A 2QEXA 1KL9A 1JJCB 5C44G 2K14A 2K5HA 3PGZA 4X62Q 1PH2A 2RF4A 1N33Q 4POGA 2Z0SA 1WCMH 3KOJA 2K75A 2JA5H 2CWAA 3F2BA 4HJ5A 4P71A 4LF5Q 4X6AH 3RR5A 4DR3Q 2MFIA 1XMQL 4EQ5A 1SN8A 4B3SL 4APVA 5IYBH 4P74A 2AKWB 4A3LG 1SROA 4JI2Q 4GN4B 3M4OH 4DK3C 1X6OA 2LXKA 5HY6A 3J81c 4DV4Q 1XMOL 5IYDG 3DM3A 4JI4L 1SRUA 2HT1A 1JJ2A 2R7ZH 2ZTCA 5LMNQ 4C3JH 4PZ6A 1YJWA 4DK6C 5FJ8G 4LFAL 4IJHA 4LF7L 3PF4A 1YZ6A 3OTOQ 1CKNB 1YHBA 3M4PA 2I5HA 1VQOA 2C35B 1FVIA 3HOXH 3PCOB 4DV3L 1G6PA 3J7A5 1WI5A 5AJ3L 1X9NA 1VQ5A 4LF4L 3KLWA 3PO2H 4KHPL 2UXDQ 5C4XG 1UE7A 2LXJA 2CQOA 1E22A 4AH6A 4DAMA 3CF5A 5JJLA 2JA8G 1JMCA 4L5RC 4BY7G 4DV1Q 1KXLA 2YTYA 1V1QA 4BY7H 4JI1Q 4QY7A 1X55A 3UE1A 2K52A 4RG1A 2EXDA 1TWGH 2E2IH 4JYAQ 1NY4A 5K36G 2Y0SE 1L0WA 4DR6L 3HOXG 1L2FA 2ES2A 2R7FA 1RL2A 4Y7NH 2JEBI 1KRSA 3NEMA 2ZJRA 4B3TL 4WJ3M 1EIFA 1OXXK 2R7DA 2V1CC 2NZOA 4LWCA 5C0XG 2FXQA 2AWOA 4DV3Q 4DV6Q 4A3MG 1I94Q 1VQ7A 4GNXB 3ZJYC 1G51A 3I7FA 2RHQB 4MNOA 4O0AA 3I4OA 1HNXQ 1I3QH 2JK8A 2K50A 2GN5A 5GAGC 3G4SA 4OWXB 1PH3A 4JV5Q 2ALYB 4A3MH 1P8LA 4GKKL 3J81j 3B6YA 4TQUS 3G6EA 4A3DH 3GTGH 4OO1I 3EN2A 3CC4A 1KHIA 5JJIA 3E0EA 2RCNA 2PI2E 2L15A 4YWMA 1EQRA 1YJNA 3GTKH 3S15H 4DR7Q 4GN5A 1WFQA 2Q2IA 4QIWE 3U4VA 5M5XH 2UXCQ 4DUZQ 1YHQA
chains in the Genus database with same CATH superfamily
2QDLA 4G4KA 3A5UA 5CV8A 4IPCA 1ENFA 4BA2I 3K5NA 4YCUA 2F0SA 2CKZB 4N8X1 5A35A 5JAVA 4I7ZC 1C0AA 2D0PA 2YTVA 1G6ZA 4MZ9A 4DV7Q 2E8GA 5DLQE 2K4KA 1B8AA 2E2HB 3G6JB 3K57A 2NVQB 1A2UA 2DGYA 3S16B 1ASZA 1ZYRD 1IZ6A 1C4QA 1E2WA 3KDFA 1PH4A 3CMEA 1UE5A 3WOEA 2K5WA 5FOBB 2XRQD 4JI3L 4OEMB 5A2QE 2M2LA 1HNWQ 4BA1I 2EYMA 3RMHA 1UE6A 3JAME 1AE2A 3CCJA 2PMZB 4OO1G 4LFCQ 4KLKA 2K5DA 4A3MB 1I94L 4GNXC 4CKEA 5IP7G 4BBSG 3MC0B 3HOWG 3A7AB 3E6ZX 3GTLH 4DR6Q 1K83H 2GVBA 3KLSA 5TSSA 4IJLA 4F88A 1LV9A 4DUYQ 4ZUJA 4G7OC 3S1MH 4LMQD 1E0BA 1RKNA 2B29A 3GTLB 5KIXA 1ML0D 5FLMG 1EOTA 1PV4A 1K73C 5IGBA 3LWUA 1RJTA 3GTMH 4MTKA 2RCFA 1D6EC 1EU4A 1AE3A 3T1YL 1D7QA 1JWUD 1HUMA 3Q24A 3GTJH 2MO0A 1X3PA 2XNAC 4LNQA 2VQEL 1Q46A 3TMEA 5E7NA 2OQKA 2WB1E 3A5ZB 2B2TA 2VL6A 2NTTA 2MGSA 1KAAA 4BXXH 2UXCL 1IL8A 1GM5A 1QUQB 4IOCA 4A3IB 4LFBQ 3SHLA 4JI1L 3STBD 4XQNA 2F0PA 3EQLC 5IIFA 3I4MB 1H9JA 4RFBA 4QJFA 1A62A 3U50C 4UAIA 4L63B 4RMFA 1TWFB 4B3ML 2E2JB 2WAQB 3I91A 2Y0SB 2L4NA 3MA2B 2Z6KC 4IPDA 1AZQA 3S24A 3OTOL 4R4IA 4IFDH 1EOVA 2Y0SG 4X66Q 1E1TA 1SMXA 1PFNA 4LUOA 2LS01 2CVRA 2F0GA 2WIIB 3T56B 3V05A 1I50B 3MWYW 1HFNA 4A3CH 2UUAQ 4O1NA 1DCZA 1LM0A 1YNXA 1AW7A 3GV6A 3OPOA 3RLNA 2OTLA 5KYLA 3DMUA 4K6DA 3AQQA 1O7YA 2EYFA 2I5LX 2ZTEA 4LUZA 1BR9A 1R4PB 2QKIC 1SE2A 4LJZC 5FO8B 1KC8C 1TS4A 4A3EH 3PUZA 1N34L 3NTKA 4NMZA 4LFAQ 4L5TA 2EYHA 1ENAA 5IYCH 1VQGA 4HIKA 4A93G 4LF8L 5EPJA 1LABA 4PZ8A 4RGTA 2VUMG 1PVOA 3F8TA 1I4GA 3BZKA 5FK9C 4DV4L 1J5EQ 4JI8Q 2RHSB 5FLMH 2L1BA 1L1OA 1LTAD 4LF5L 1PZKD 3FPPA 4OHJA 3SE0A 3UI2A 1FL0A 1TS5A 2VNUD 3A8KE 1HTLD 1N33L 1Y1WG 3QO2A 4JBWA 4GKJQ 2OCEA 4BBRH 2RDHA 3EBEA 2SNMA 3FDTA 2HDLA 1PXUA 3UDFA 3G7LA 1JORA 1TWAH 2K5NA 1TS3A 5C5LA 2JSOA 1K0RA 1VQEA 5M3MH 2XWJB 1MIUA 1TWHH 3R3OA 1UUPA 5JVG3 1XMOQ 1XPUA 4FDBA 1OXTA 1U4LA 1DD2A 3ITPA 5E4XA 2WKDA 5K36H 2F0IA 2IPKD 3F2UA 4PV1C 3I4MH 3GDEA 3QG1A 2DY7A 1B3AA 1PRTB 3VR4A 2DUDA 1VF5C 4Z9CB 3GQBA 3CRLC 4DR4Q 1LYLA 1IBKL 1HNZQ 3NELA 1Y8NB 3PUWA 4LF8Q 4B3RL 5D3IB 2PQAA 4XQQA 2CW0C 4R4QA 5FJ8H 5I2XA 1ZYRC 2QW7A 5ELBA 3MXNA 2AWNA 2EIFA 4LF9L 3BS1A 1A63A 3LX0A 3S1RH 3CCSA 2ZT9C 2A6HC 4EX5A 3E5SA 2N8NA 2EY5A 2UUAL 2UU9Q 2SOBA 1YNJC 3GP7A 5C44H 3KUPA 1IL2A 2HIVA 3BYTB 1HNXL 3U58A 3H3VC 3C2PA 2E5LQ 1JCKB 2PCFB 1UEAB 2K5QA 2PQAB 3CQZB 5D14A 1EQVA 2CHBD 3OYYA 5CYUA 4A3EG 4JW0A 1JT8A 1PFBA 3M4OB 1BUVT 4TSSA 1Q86C 4JI0L 3VYRA 1PYSB 1SYBA 1RHPA 1H9RA 4GOPB 2A8VA 4LFBL 5BR8Q 4KY5A 5E1FA 2UUBQ 4PMWA 1X54A 1GKHA 3I55A 1STAA 3TDQA 4B9WA 5CC4A 2ZJPA 3S17B 3K0XA 3CCQA 1SEBD 3CAMA 2UU9L 2KCTA 1SAPA 1UWVA 5FLXE 1O78A 1Z9FA 3L3OC 1PRTF 3W1BA 4PZ7A 1NMFA 2ASBA 4P72A 3PO3G 5EKIA 4XQJA 3ERQA 1TY2A 4L6TB 5IODA 2HIXA 4J8QA 5JPNC 1CQFA 2F4VL 1DM0B 2NVYH 1N36Q 2HCIA 3K5LA 4IURA 1IBMQ 2BE5D 4ZK9B 1IBKQ 1HNZL 4QIWB 1QVCA 1UAPA 4A3EB 4DK0A 1EUJA 1XX8A 1NJIC 1BO0A 1K0SA 3PUXA 3CPFA 3TQYA 4JI3Q 4C1NI 2MUYA 4DV5L 2FHTA 1XTCD 4BY1G 3HKZE 3U9OA 4POFA 1KNEA 1GD7A 1W2BA 1EY7A 4LF9Q 3L2PA 1E3PA 2O2LD 4L5QA 5JJKA 1Q90A 1VQFA 4DPGA 1L1OC 2B8GA 2AQ3B 1H9KA 2EJGC 1EFID 3T51B 3I70A 4JI4Q 3HGBA 3KBGA 4J6HA 3J7AV 5C5MA 4CDCC 2C5CA 1U4MA 1E2ZA 1JJCB 3KLSX 1STGA 4DU9A 3PGZA 1LTGD 1S5BD 2RF4A 2Z0SA 3KOJA 5C3XA 4X6AH 1BNZA 2X69A 4H0LC 1HXYD 4FF2A 4A3LG 3SEBA 2RA4A 1K8OA 1S5CD 4DK3C 5M9OA 4A3FB 3J81c 1AZPA 1SXTA 2F0MA 3A54A 3DM3A 4JI4L 1SRUA 2RQXA 4I7AA 5IT9E 4C3JH 1LTTD 3TSSA 4QCLA 4LFAL 3PF4A 1F77A 1YZ6A 4EVOA 1YHBA 3M4PA 5BN3A 4CKBA 2C35B 1FVIA 4K8IA 1WI5A 3KLWA 3PO2H 5C4XB 2JA8B 2D9UA 2G5DA 2M00A 3PIP3 1FYCA 4DXGA 2JA8G 1MD2D 1JMCA 1LACA 1Y1WB 4B9XA 4RG1A 2RBMA 3RUZA 4H7BA 4X3KA 3M3YB 1R4QB 3S1MB 1L2FA 2ZJRA 1KRSA 4B3TL 1JQYD 2ZXRA 1GXDC 1OXXK 2V1CC 4G7ZC 2EYPA 1TU2B 2AUJD 2JK8A 2K50A 4EQPA 1Q3LA 1LT3D 1PH3A 2ALYB 4GKKL 4K2LA 4A3DH 3EN2A 3TP6A 3E0EA 3TN2A 2L9HA 4YWMA 5LHY1 1GJXA 2XSCA 5I9PA 3GTKH 1EIHA 4DR7Q 5EQ0A 3K5MA 3U4VA 3I8ZA 2UXCQ 3D4WA 4FYDA 3MFGA 3NBHB 1TWCB 5ELFA 4G7HC 4IUUA 4NXML 4OX9L 1ONLA 1NMGA 5LMNW 3O13A 1MSHA 5E3FA 4K5XA 2SNSA 5DNFA 2UUBL 3FPUB 4XT1B 3NBHA 2KCNA 5C4HA 4P73A 3SVMA 4KHVA 5M5YB 1V1OA 3MVVA 1DONA 1J8IA 2A6ED 1GOZA 1RTNA 2G9HD 1UE1A 2KHSA 4IN3A 1CHPD 1PRTC 2F0HA 3D6CA 3PIPA 2PZTA 3NE5B 3J81L 2UXBL 1NNXA 1KTKA 1WD1A 4A3DG 2VQEQ 3N52A 3NQIA 2O5JC 1YNNC 1DOLA 4DKAC 4X64L 2Z8LA 2NN6H 2F0JA 2G9DA 3NENA 5GROA 3V2TA 4AYBG 2JA7H 1HNWL 3PO3H 4UPAA 2K05A 5LMUL 3AU7A 1UNSA 2XRSD 5IGGA 3D0FA 1NR4A 1X32A 4YWKA 3CPWA 3CKIB 5DEHA 1WTXA 3BDCA 4HCEA 2AMCB 1IKLA 4DUYL 4K5WA 4DF7A 1E1OA 4GKKQ 2JA8H 5CGKA 1A6XA 1ZEQX 4C56C 1PTOD 1Y1VB 4HN7A 3PF5A 1I5FA 1AH9A 1WTOA 3GTMB 2IX1A 4DR4L 4LFCL 4DN4M 4B3TQ 3K7AB 1HUNA 5H1SE 3BVMA 1EIYB 4JK1C 2YYZA 3A56A 2EY1A 3JAML 4YY3L 1B9NA 2B2UC 1QCBD 1A3UA 1Y8OB 3FKIH 2HCCA 4KJOA 1JWSD 3HOZG 1QE6A 5NUCA 1GUGA 1ZKOA 1FR3A 1Y69U 2Q8TA 3A7LA 1XNQQ 4K14A 3GTPH 2NVYB 3D4DA 3A74A 3J81E 3OIQA 2MJ8A 3PQIA 5GAEC 5EGTA 3D31A 4PQXA 1ENCA 3E9IA 1ET6A 2H5XA 2PW5A 1F9SA 1PLFA 4KY6A 1SYFA 2H4OA 5IP9H 3T1HL 4DUZL 4BY1B 1TY0A 4DR1Q 1VQMA 3JAMc 3NP8A 1KABA 3CC2A 4RHRA 4JI8L 2E2HH 3SK6A 5T1GA 2IX0A 4ABNA 1SE8A 1L1OB 1BDOA 1OO9B 2P5ZX 4C1NK 1M90C 3HOWH 1IHZA 2Z6BA 3J80c 3CP0A 3PIOA 4JG2A 1I4HA 5KEEA 4GLVB 1O7ZA 5D65A 1LTSD 1XNRL 4RCOA 1CA6A 3HP3A 4RHSA 3W1GA 3WOFA 4UP8A 3K81C 3S1QB 3J81i 3I4NH 5EBCA 3PMFA 2Q2TA 4B3SQ 3RLOA 4IFDI 2K6AA 1BBXC 3CCEA 2RDFA 4JBKA 5LMUQ 4TVAB 1VQKA 1K8GA 3KDFB 1SJHD 4A3BG 3VYUA 4GZYC 2E75C 2XTIA 3J80L 3CC7A 4G57A 2A19A 2DJFC 1HHVA 2R7ZG 5EAYA 3M3YH 1Y1VH 5E4WC 1V43A 1KRTA 4OELB 3CU7A 2UXBQ 1BCPB 1PZJD 3H15A 4JI5Q 4A75A 4NXNL 3K7UC 4C3IG 2E2JH 1RDPD 1S3OA 3P7JA 2EE1A 1C7YA 1YHAA 1WCMG 3CCRA 1BXTA 2D0OA 2Z9HA 4KKUA 4EQNA 1K28A 1IBLL 1JOKA 4ZAIA 4DR2L 4N9PA 3S15B 1MGSA 1QOHA 1SFOB 1F2YA 4ME3A 1DJRD 4R1JA 2HQLA 2F0UA 3T1YQ 1E24A 1I3QB 1CKMA 4IO9A 1GHJA 1XTDA 2OQ0A 2XIWA 3GD7A 4JPBW 3ULJA 4HR7B 2Z6KA 1JWMD 2B3GA 3VYSA 3OWFA 1GUNA 4R4CA 4LW1A 2PQEA 4X3UA 1SYGA 3KJOA 4DR7L 1OTCA 3VR3A 1BBWA 2B2YA 3HRZC 3W2DA 3QR8A 4KHZA 1M4VA 4DR1L 4QQBX 2KEEA 1H9SA 1Q7YC 1HA5A 3SK4A 1A8VA 4F8MA 3PUYA 4AQYL 1Y1VG 3TREA 5M3MG 2K33A 3HOUB 2K5VA 2Q8RE 1STYA 3D4RA 1Q8IA 1N9WA 3I90A 3L7ZC 4ME5A 1A3TA 4NKLA 1ASYA 4RKLA 2BOSA 3FP9A 3MTSA 4ID6A 4HJ9A 3NTIA 4ZRZA 5KNDA 2A69C 4UDUC 3KF6A 4WORA 1PH1A 1CHQD 1F9RA 3EROA 1WOCA 2F0EA 2QF7A 3G48A 2JEAI 2E2DC 3FEWX 2B2VA 1F2ZA 3K6OA 1KQSA 4HSPA 4KKTA 3C46A 1QVFA 2VQFL 1PTOC 2K04A 3I4NG 1WJJA 1LTLA 5C0XI 2KCMA 3S16H 2F0OA 3TP7A 2X6LA 5FLXL 2PZUA 2PO4A 2A1AA 1UEBA 4DAYA 3W5OA 4CJ2C 3T4AC 1GUSA 1EYCA 1OXUA 3DM1A 4JBMA 2F3WA 5DM73 4P2CB 3HOWB 4FF4A 1TR5A 2TMPA 4J15A 4GKJL 3M4YA 1Z47A 3HOVB 4IOAA 2CWPA 3EJIA 1QUQA 4HTHA 1HCZA 1YITA 1PZID 4TKOB 2EJFC 3OWEB 1U4PA 5CV6A 1J5EL 1M1KC 3Q6SA 4X65Q 5IP7H 2PNHA 2VUMH 4R8NA 1QG7A 4XIGS 1NSNS 3TS0A 5HGTA 1VQ6A 1EQTA 2LMCB 3HOZH 3EIVA 2K1BA 3CW2C 3H91A 1C9OA 4YIJA 4ZCKA 3GO5A 2E76C 1BBUA 2D62A 5F2DA 3FKIG 4M8AA 4XTCS 1N32Q 5CBAE 2IWHA 5C4JB 3S1NH 1SE4A 3GTJB 4JV5L 2ZM6L 3IAYA 1RTOA 1D5ZC 3BJUA 4HJ7A 2F0WA 4A3GH 2JA9A 2R61A 2R7ZB 2L11A 1L0YB 1JB7A 3HKZG 3HOUH 4B3MQ 4A4IA 5C3EG 3J80i 1PFSA 2NVTH 1EY5A 4PMCA 5C44G 2XWBB 2LY7A 2K5HA 3DXJC 3VYTA 3FMCA 2CWAA 2EPBA 3F2BA 1CZGA 5COYA 1EZ8A 4XYOA 2MFIA 4DR3Q 1XMQL 3NHHA 4B3SL 4APVA 1AP0A 2GA4B 5EPKA 2LXKA 1EEID 1BCPC 4F87A 2HT1A 2QDBA 1S5DD 4PZ6A 2PW7A 4DK6C 5JOBA 4LF7L 4E6IA 3OTOQ 2MP1A 4C3HG 1STNA 2Z4IA 1VQOA 1CFMA 3IFTA 5G3LF 4DV3L 4KHPL 2KCCA 3R2TA 1UE7A 5DAUA 2LKVA 2CQOA 1E22A 4DAMA 4ZKCB 3CF5A 4DV1Q 1KXLA 2YTYA 3HEJA 4JI1Q 4QY7A 4ZKBB 5FO7B 3UE1A 2K52A 2KVMA 2EXDA 1TWGH 4JYAQ 1NY4A 5K36G 2M9VA 4NDXA 1DYQA 4ULLA 4DR6L 3HOXG 2ES2A 1TVXA 2JEBI 3FVQA 1SSOA 3H6MA 2F0TA 2PNRC 2RDGA 2R7DA 5C0XG 2FXQA 2AWOA 1I94Q 4U673 4GNXB 3IFDA 4MNOA 1G51A 1U9RA 4O0AA 4Y7NB 1HNXQ 4BBRB 1BCPF 3G4SA 4OWXB 5C3WA 3E0JA 3B6YA 4TQUS 3G6EA 5JEAH 4TRDA 4OO1I 2A6HD 3CC4A 1KHIA 3HOYB 4QUCA 1LT4D 2L15A 1SNOA 2EVBA 5G3LD 2OXPA 1WFQA 2FMMA 5M5XH 4HCSA 1HQMC 4DUZQ 1WTRA 2OT2A 1O7LA 2F0VA 2QGQA 4OONA 2OTJA 1VQ4A 4QUFA 2F0LA 3H09A 3CCMA 1WTWA 1EL0A 2A69D 1SYDA 2D5DA 4HIMA 2L12A 4XXEA 4A93H 4B3RQ 3V96A 2JJQA 2J4XA 4A3JG 5ISRA 1X3FA 1U4RA 4QMGA 2VUMB 2EXZA 3D3RA 1MHWC 3NWSA 1EQQA 4ZUIA 1JJGA 2MNAA 4CHTB 1QVGA 1BVSA 4OXPA 2F03A 4DAPA 2Q8IB 2R92G 2PYKA 3DWAA 2PMZE 3SK8A 2OF1A 2I07B 1CKOA 3X3MA 4LUVA 2HUGA 3UDXA 1S4ZA 4YY3Q 1CI3M 2RSOA 1H95A 4FF3A 1XYIA 1I4XA 4A3KG 2A68C 1VS0A 3F1ZA 1NAPA 5M3FG 2WFWA 1JC7A 1N36L 4CGYB 1CSQA 2AQ2B 1HZBA 1PH6A 3QWNA 4GS3A 3MZ5A 3S2HB 1PH9A 2KHIA 2VZAA 3ZYYX 1AN8A 2NVXH 3HOYG 2JN4A 5IWAQ 1PTOB 4QF4A 4RA8A 3WWVA 1MJCA 4DR5Q 2YU9H 4Y52H 5JPMC 1QNUA 2RKSA 3X3NA 4KHPQ 2CH4W 3A0JA 3K7AH 3M9BA 2ZXPA 2KBNA 2KENA 1VQ8A 4BBSB 4MTNA 1EY9A 3NK9A 3C1FA 4C3IB 3KBXA 4R4OA 1QZGA 3OMCA 1T9HA 3D8GA 5BR8L 2YTXA 4CJ1B 3ER0A 3I2ZA 2CCZA 5IOCA 4XYQA 2F0DA 1DXMA 3HOVH 1VQ9A 1EEFD 1FNUA 4YWLA 2WB1B 4WFN3 2X6GA 4JI0Q 1G8ZD 1EFWA 2UXDL 2JA6H 1EWIA 4PG3A 1K9MC 1T5EA 3M7NA 4IPHA 4DV2L 2WP8J 2LFNA 1EY4A 1HJPA 1HR0L 4JI5L 2R6GA 3KLRA 3I56A 3K59A 2BDNA 5LMNL 4NXMQ 4OX9Q 4KI0A 1I6HH 3K5OA 4IZ8A 5I6YA 3S14B 1FGBD 1X56A 1EU3A 5FKAC 1I4RA 1SNMA 4YCVA 1CUKA 2R93H 3L0OA 4AIMA 2DJGC 2NVQH 3NQTA 3MXGA 3NTHA 1D2BA 1HFGA 5CV4A 2F3VA 3C3LA 4HJAA 4A3BB 4N8FA 4B08A 2ICIA 1DOKA 2EQSA 5C0XH 2PI2A 1X65A 3RD4A 3SDZA 3TBIB 2FMCA 5IT9c 4XT3B 3DWQA 1SYCA 2NBFA 4OGQC 3BYYB 3H3VH 1BKBA 4QB4A 2F0FA 4LF6Q 2A73B 1D1KA 2F3IA 4JV5Q 4JOIC 2LSSA 4BY7B 1NR2A 1QZHA 3H0GG 5J39A 2R92H 3ND8A 2NUCA 4A3IH 1CK1A 3T1HQ 2QA4A 3HOYH 3BG3A 1GUTA 1RIPA 4IQZA 1MJEA 2BA1A 4N9TA 4YHHQ 5M5WB 2F0KA 5AJ3Q 4C3HH 1F9QA 4A3JH 2N78A 1K8MA 1WYDA 3CCUA 1B50A 5I6WA 1XNQL 1TXYA 2PPBC 1VQNA 4X3TA 3CQZH 2IW3A 2VW9A 4P75A 1LUZA 1YIJA 1ESRA 4AYBB 4IUNA 3Q22A 2F52A 4JI6L 5IGEA 1A3VA 3K8AA 1J6QA 4LK1C 2WACA 2VB2X 1SLJA 2VQFQ 3CMAA 3IRBA 1PHJA 3KF6B 1MSGA 3STBC 1ESFA 1FGUA 2BE5C 2I5MX 4NPSA 3LGJA 2K01A 2KA7A 3PO2B 1TKWB 5LL6X 2OEOA 3MHBA 4DNTB 4PMBA 4DV0L 1TQOA 4AQYQ 4C3JB 1B3QA 3PV0A 1D8LA 3J7ZC 1A15A 2F4IA 1MKHA 3H0GB 3MFYA 2B63G 2KOLA 5GAHC 3UDIA 3SGIA 2Z1CA 4JI7Q 1JR0D 3HOZB 3NBIA 1RCVD 4DAVA 3MEFA 1OXSC 2CH4A 3DWPA 2MQHA 2Q2HA 3H0GH 2HHHQ 3GTQH 1BF4A 2N88A 4H13C 2O4XA 4DGZA 1FNVA 4K0KQ 2DNEA 5C3EB 3I4LA 5JEAJ 1A0IA 3VR5A 2XN9C 3E9HA 4K2KA 4BBRG 2RVLA 5IYBG 1PH8A 3M85A 2L55A 3OMGA 4Q5VA 3S1NB 2MHVA 1TIID 3TRZA 3HOVG 1Q1BA 4DV1L 5IGCA 4FXKC 4O42A 1BCPD 2N55A 2I0QA 3J7AF 2KECA 1VQPA 4LF4Q 1HRJA 3NXWA 3ULLA 1RF2D 1QWYA 2D2CC 5CORA 5FLXc 2V4DA 2AUKA 3BVGA 1KD1C 4R8IA 1K83B 5M3FB 2EDGA 3FRPB 3S1QH 1XPOA 1STHA 1IYUA 3R93A 4A3KB 2HQEA 3OSOA 1VQIA 2BDOA 4UY8C 4ZLTF 4JC0A 3IKJA 2ZXOA 2PZWA 4QGUA 3SR1A 1K8AC 1YNND 1XPRA 5KRUA 3N6RA 4J1MA 4JI2L 2WAQE 4JCVE 2WKCA 5L37A 5M5WH 2NZ1D 1CZWA 3DEOA 2JA6G 3NUCA 1D1IA 4JI7L 3PUVA 1IBLQ 3AMUA 5C4JH 2B63B 1IXRA 1E7ZA 2IHEA 2E74C 3GTOB 1Q12A 1I6HB 3FHWA 1NE3A 1DOMA 1P16A 1KLGD 2YV5A 4FXDA 1I6VC 2KQ3A 2VB3X 3GTQB 3RZDH 1U0LA 2L5TA 5C0XJ 4CDFC 2AHOB 2E5LL 3NWTA 1PH5A 4EGVA 2HHHL 3BDLA 5A2QL 4DV6L 1B44D 1B1ZA 1SBBB 5FO9B 1TWGB 4KD4A 4L8JA 4KKSA 3VA5A 3HFZB 1SYEA 3VA7A 3RZOB 2DNCA 4K5VA 2B2UA 1EYDA 3GV3A 4OWTB 2EJMA 3GTKB 4KK7A 5CMDA 3CRKC 2R93B 5DM63 2JA7B 1AEXA 4JI6Q 3TS2A 3MXNB 2WINB 1S5ED 5CV7A 4KN7C 4L5SA 4KY7A 3P20A 4UHVA 1YVCA 1CA5A 3OHXC 1O7IA 4CKCA 1QILA 4A3FH 4NB3A 1GVPA 2DY8A 3PSIA 1KIXA 1VMPA 5C44B 3R8BA 2K14A 5KNBA 4X62Q 1L0XB 5CBEE 1N33Q 4LAAA 1WCMH 4P71A 4WRDA 3DEPA 4LF5Q 3RR5A 2A68D 1SN8A 2Z4HA 5IYBH 4P74A 2AKWB 1X6OA 5HY6A 2FJ2A 4DV4Q 1XMOL 5IYDG 2R7ZH 2ZTCA 5FJ8G 3ONAB 4IJHA 4A3GB 1D5XC 4KV6A 1CKNB 4U68A 1KLUD 1LLRD 1LO5D 3J7A5 5AJ3L 1X9NA 3EFXD 1VQ5A 2F0NA 4V0BA 4DK1A 2LXJA 3TZUA 5JJLA 3AB9A 2SEBD 4L5RC 3EA6A 4BY7G 4BY7H 2NWGA 2E2IH 2R3ZA 3W3AA 4RWSC 2CQAA 5C6AA 2JA5B 3TZDA 1HQRD 2Y0SE 3I4NB 1KDAA 1W6KA 3DHQA 1WTVA 4IALA 2R7FA 4Y7NH 3NEMA 4CBVA 1W6JA 2ICEC 4LWCA 1EIFA 4DV6Q 2ZJQA 4DV3Q 2QEJC 2SDFA 2NYZD 4A3JB 3ZJYC 3I7FA 2RHQB 1LTRD 3I4OA 1I3QH 1Z6HA 2K03A 3RZDB 2C9OA 3HKZB 5IGFA 1P8LA 4F7XA 3MEHA 5JJIA 3PIO3 5M5XB 4BWGB 1TS2A 3SK5A 2R92B 1YJNA 5IGDA 4IUTA 2EY2A 3HS0C 2Q2IA 1JB3A 1SNCA 1LTBD 2A74C 1YHQA 4O2DA 4WJWA 5ELNA 1TT2A 4X66L 1JICA 1FNWA 4A3DB 3GTPB 2B2WC 5I2YA 5IYCG 5EBDA 2WV6D 4NW2A 1SNDA 4MHEA 2F1MA 1Q8KA 4A3BH 3T13A 3J7YW 4A93B 1G291 5AFWA 5JVH3 4C3JG 5J3BA 4A3IG 2ZM6Q 1SDFA 4DR5L 1Y8PB 2EYLA 1PTOF 1EZ6A 3I4MG 1O80A 3BVZA 1FJGQ 1N32L 3URYA 4R4TA 3HOXB 4ODGA 1V1PB 5HGQA 5BN5A 4GNXA 5EPLA 4WJ4A 1LT6D 4UP7A 1LT5D 5C3EH 1R9TB 3UDGA 4ILWA 2ZTDA 4KMUC 4K6LA 1V9PA 3RLFA 4HJ8A 1V1PA 2N3SA 2IY5B 1SNPA 1I4QA 1H9SB 1VQDA 1MI2A 2E2IB 4FXGC 5BN4A 3G71A 3HZXA 3C1EA 4IUPA 2WB1G 4BY1H 2VXWA 1HA6A 1IYJB 4DV0Q 3S14H 4BBSH 4A3FG 5JJZA 3AEVA 2NN6G 3VR6A 1B7YB 1VQLA 2EYOA 4OO1H 1M8AA 3UE0A 1VQBA 1XXGA 4DXFA 1ICWA 2NB0A 3DUZA 4C2MH 2NTSA 1KDCA 1WTPA 2VY3A 1JE5A 4RH6A 5IYDH 1BQQT 4DFAA 2JQOA 4A76A 1IW7D 3RZOH 1F2LA 1FD7D 3VR2A 1YI2A 4GOPC 2ID0A 3K80C 1TWHB 1PYBA 3F2CA 2JP1A 1YEZA 1HPCA 1I4PA 1VQAA 3I72A 2XGTA 1II3A 4GLAC 2IHFA 3ND9A 4OL7A 4X3SA 3AYHB 2K28A 3HOUG 4RCNA 1B4OA 4OWWB 3S2DH 4IPGA 3R2IA 3P75A 1R9TH 3QJYA 3Q0AA 2BH2A 1TWCH 2N49A 1KDBA 2L0CA 1EY6A 5IY0A 3CHBD 3T53B 4CJ0B 3K58A 3KYHC 2JE6I 1CM9A 2B63H 1IYVA 1SJED 4JVZA 3KJPA 4KN4C 3CCLA 2J0TD 4HEDA 3OIPA 3QOLA 4LF6L 1PDQA 4RGMA 4BXXG 1SNQA 2A6EC 3BZCA 1Y14B 4DA2A 1PYWD 3JC66 3CD6A 2FINB 1N34Q 3ERSX 3SXHA 1PRTD 1K3BC 3MXPA 2F4VQ 4A3KH 1XJVA 1XWEA 1WTQA 1EWHA 5GADC 1PH7A 4ZQ3A 3KFUA 1JE4A 2B2WA 2H1EA 4HIOA 4JYAL 1HH2P 5I9OA 5EJWA 1I50H 2JXMB 4DV5Q 5C4XH 2J7ZA 1W3SA 2IT1A 5D3DA 3ICEA 2B2TC 2EY6A 3U4ZA 4IUQA 2AQ1B 5CR3A 4FNFA 4NXNQ 1IBML 2ATWA 4X64Q 4Q0FA 1HR0Q 2KEDA 2BH8A 4JOIA 1G2SA 4EQOA 4GN3B 3H94A 1B53A 4OIKA 3RNUA 1Z7TA 1CQVA 1FJGL 1HZ9A 2JA6B 1E2VA 3FKIB 1VDZA 1YBYA 3BU2A 1KNAA 4R9WA 1WD0A 3CCVA 1F2MA 4DR3L 1XMQQ 1GUOA 1SR3A 5JEAG 1NUCA 3LWEA 2A5HA 1VQHA 2NN6I 4DNIA 3S1RB 2JYOA 4HIDA 1HTPA 3QIAA 3F2DA 1IW7C 4IUVA 3OOCA 5IT9L 1JOQA 2DN8A 3AFPA 1OXVA 4K0KL 4C3IH 3NPPA 5M3MB 4RGOS 3KF8A 1XNRQ 2KHJA 1QB5D 1U5KA 1SMYD 3RN2A 1TWFH 1VCIA 3KK7A 2Q2UA 3BDOA 4GLXA 4HSVA 1BOSA 5KYIA 5GQOA 3TP5A 5IWAL 4GOPA 4YCWA 1Y1WH 2KJXA 2BA0A 1CTMA 5K5PA 3PO3B 2XVSA 5IP9G 1KAWA 2NVTB 1B2TA 4CDDC 3BZDB 1HR0W 3Q8DA 1YJ9A 1CKNA 2BCOA 1K3RA 4C2MB 5EKKA 1NTGA 3P1HA 1STBA 3S2HH 4CDEC 1DGSA 1DZ1A 3KF8B 1X3QA 4X65L 4C3HB 4UP9A 1HZAA 1ET9A 4A3LH 1GO3E 1NBWA 1TWAB 1F9PA 1WTHA 3U9SA 5J1ZA 4JBJA 2UUCQ 2UUCL 5M5YH 1QNKA 2EOTA 1PFMA 1Q1EA 2B2YC 2MPMA 3EVQA 4A3CG 3DLLA 4DNRB 3PO2G 1EY0A 2B39A 3J80E 4DV7L 3RN5A 4DAYB 4A3GG 3I3CA 4FP5D 2KUMA 4KD3A 5IE8A 4IFDG 1EYAA 1VQJA 5C4ZA 1HZCA 4IFDJ 3AFQA 5ELEA 1ZXTA 4I65A 2IX3A 1S40A 1MBYA 4QL5A 3IL8A 3E3XA 5ELDA 3A55A 1D5MC 3GTOH 4H02A 5HURA 3A8JE 1AFPA 4X62L 4M1UB 4RAUC 1Q82C 1CSPA 2JA5G 2VS1A 3LNNA 4V190 3S2DB 3M7GA 2JA7G 2WAQG 2NZHA 4FO2A 5ELOA 1PA6A 3M4QA 3MXUA 1V8QA 2QILA 4MIUA 5I4DA 1N8RC 3S17H 1G91A 5M3FH 1RD9D 1Q81C 1VF7A 4K8JA 1PMRA 1H9MA 1S72A 2GVAA 4YHHL 3H3VI 3A8IE 1A2TA 2RSNA 3QOJA 2CW0D 4DR2Q 4AYBE 1GUWA 1B9MA 2I46A 1WCMB 2K7VA 1B70B 1LTID 2CFMA 2OWOA 1G2TA 2EYJA 1T5XD 1X3EA 4XDXA 3TEHB 2R93G 4ALPA 2O5IC 1VQCA 3MAQA 1NCVA 1EYGA 2B2VC 1X3GA 2EZVA 3HKSA 4OIJA 1J9OA 3CXCA 3I73A 4H44C 4KJNA 3JAMi 3ULPA 3VDYA 4BS9A 1YNJD 2MO1A 4DV2Q 3QB3A 1SFOH 4LF7Q 5ELCA 3OW2A 2QEXA 3S9WA 1JOOA 1ILPA 1S5FD 1KL9A 1ILQA 1PTOH 1PH2A 2ENBA 4POGA 2K32A 2K75A 2JA5H 4HJ5A 2NVXB 4ZYSA 4MN3A 4EQ5A 4HMJA 1IKMA 5J22A 1SROA 1RODA 4JI2Q 4GN4B 2HD3A 5LL6S 5KGUA 3M4OH 5KNCA 2HDMA 1C8CA 4RKBA 2QCPX 1SE3A 3HG9A 1JJ2A 5LMNQ 1YJWA 1QJOA 3D6WA 1C48A 3Q23A 3OW7A 2I5HA 3T16A 3HOXH 3PCOB 1STEA 1G6PA 5EKLA 3WDNA 4LF4L 1EY8A 1VMCA 2UXDQ 5C4XG 4FVMA 4AH6A 1CT1D 4KTAA 2YU9B 2IJ0A 1EIGA 1V1QA 1X55A 2IL8A 1ICFB 3GTGB 4S3SA 1L0WA 5T1IA 2B8FA 4HMIA 1WVLA 3NSWA 1RL2A 4WJ3M 4RGNA 1SMYC 4A3MG 2NZOA 4FF1A 1VQ7A 2FFKB 5CV5A 2GN5A 5GAGC 4HAEA 4A3MH 5CV9A 3J81j 3GTGH 3K0YA 3TP8A 4PNYA 1EWCA 2RCNA 2PI2E 1EQRA 2TSSA 3L9AX 1GHKA 3S15H 4GN5A 4NP5A 4QIWE 2F0QA
chains in the Genus database with same CATH topology
4O2DA 5ELNA 2QGQA 3NBHB 4OONA 3A5UA 2OTJA 4IPCA 1VQ4A 4X66L 3CCMA 4NXML 4OX9L 1NMGA 4A93H 4HIMA 5LMNW 5IYCG 4B3RQ 4BA2I 2JJQA 4A3JG 4YCUA 2CKZB 1X3FA 1Q8KA 2UUBL 4A3BH 2D0PA 1C0AA 2YTVA 4MZ9A 4DV7Q 2E8GA 1EQQA 1G291 5DLQE 2K4KA 1B8AA 2MNAA 1JJGA 4P73A 1QVGA 1BVSA 4OXPA 5J3BA 2ZM6Q 4A3IG 2DGYA 4DR5L 1ASZA 2R92G 1IZ6A 2PMZE 3KDFA 2ZJQA 3I4MG 1CKOA 1PH4A 1FJGQ 3CMEA 1N32L 1UE5A 4LUVA 3UDXA 4YY3Q 1UE1A 4R4TA 4JI3L 3PIPA 1H95A 2UXBL 5HGQA 1HNWQ 4BA1I 4GNXA 4A3KG 4WJ4A 1VS0A 1UE6A 1AE2A 4A3DG 3F1ZA 2VQEQ 3CCJA 4OO1G 4LFCQ 4KLKA 4UP7A 4DKAC 5M3FG 4X64L 1I94L 2WFWA 5C3EH 4GNXC 1N36L 5IP7G 4BBSG 1CSQA 3UDGA 2ZTDA 3NENA 5GROA 1HZBA 1PH6A 1V9PA 4GS3A 3RLFA 4AYBG 4HJ8A 3HOWG 1PH9A 2JA7H 2KHIA 2VZAA 2N3SA 1HNWL 3GTLH 4DR6Q 1K83H 3PO3H 4UPAA 2IY5B 2GVBA 2NVXH 4IJLA 1VQDA 5LMUL 4DUYQ 3HOYG 3S1MH 3D0FA 5IWAQ 4YWKA 3CPWA 3WWVA 3G71A 2B29A 1MJCA 4DR5Q 2YU9H 4Y52H 2AMCB 2WB1G 4DUYL 4BY1H 5FLMG 1PV4A 1K73C 1E1OA 4GKKQ 2JA8H 4KHPQ 1IYJB 4DV0Q 3S14H 3GTMH 4A3FG 4BBSH 3A0JA 2NN6G 3AEVA 1B7YB 1AE3A 1VQLA 3K7AH 3M9BA 3PF5A 1I5FA 3T1YL 1AH9A 1D7QA 2KBNA 2KENA 3UE0A 1VQBA 1VQ8A 2IX1A 3GTJH 4DR4L 2MO0A 4MTNA 4LFCL 4LNQA 2VQEL 4B3TQ 1Q46A 4C2MH 5E7NA 2OQKA 5H1SE 1EIYB 2WB1E 3A5ZB 2VL6A 2YYZA 2VY3A 1JE5A 1QZGA 4R4OA 4BXXH 4YY3L 2UXCL 5IYDH 1T9HA 1GM5A 1QUQB 3FKIH 4IOCA 5BR8L 2YTXA 4LFBQ 3ER0A 3I2ZA 2JQOA 4JI1L 4A76A 3STBD 2CCZA 3RZOH 3HOVH 1VQ9A 3HOZG 4YWLA 1YI2A 4GOPC 2ID0A 3K80C 4QJFA 1EFWA 4JI0Q 1PYBA 3F2CA 2UXDL 1A62A 1YEZA 1VQAA 1EWIA 3U50C 2JA6H 4PG3A 1K9MC 2XGTA 4GLAC 4RMFA 3M7NA 4IPHA 4DV2L 2WP8J 4B3ML 2IHFA 1XNQQ 3GTPH 1HR0L 1HJPA 3A74A 4JI5L 2R6GA 2Z6KC 3AYHB 4IPDA 3I56A 3S24A 3OTOL 4R4IA 1EOVA 5GAEC 2Y0SG 3HOUG 3D31A 4OWWB 4IPGA 3S2DH 1R9TH 5LMNL 3E9IA 4X66Q 1E1TA 4NXMQ 4KI0A 4OX9Q 1SMXA 1I6HH 4LUOA 2BH2A 1TWCH 2H5XA 2N49A 1X56A 5IP9H 3T1HL 5IY0A 4YCVA 4DUZL 4A3CH 3KYHC 4DR1Q 2UUAQ 1VQMA 1CUKA 3JAMc 2JE6I 3L0OA 4AIMA 2B63H 2R93H 3CC2A 1LM0A 1YNXA 3KJPA 2NVQH 3CCLA 4JI8L 2E2HH 3RLNA 2OTLA 2IX0A 1SE8A 1L1OB 1M90C 4LF6L 4HJAA 3HOWH 4BXXG 3AQQA 2I5LX 2ZTEA 3J80c 3BZCA 1Y14B 3CP0A 4LUZA 3JC66 3PIOA 3CD6A 1KC8C 2EQSA 4JG2A 2PI2A 1N34Q 3ERSX 4A3EH 1X65A 3PUZA 4GLVB 1N34L 5IT9c 4A3KH 2F4VQ 4LFAQ 1XJVA 4L5TA 1XNRL 3H3VH 5IYCH 1VQGA 1BKBA 4HIKA 4A93G 4LF8L 4PZ8A 3W1GA 4LF6Q 2VUMG 1PVOA 3F8TA 3BZKA 2F3IA 3K81C 4UP8A 5GADC 4DV4L 1J5EQ 3J81i 4JOIC 3I4NH 4JI8Q 2LSSA 1PH7A 3KFUA 1QZHA 2RHSB 2Q2TA 5FLMH 3H0GG 4HIOA 4JYAL 4B3SQ 1HH2P 3RLOA 1L1OA 2R92H 4IFDI 3CCEA 4LF5L 4A3IH 1I50H 3T1HQ 4DV5Q 4JBKA 5C4XH 2QA4A 1FL0A 1W3SA 2IT1A 4TVAB 5LMUQ 1VQKA 2VNUD 1K8GA 1N33L 1Y1WG 3KDFB 3ICEA 4JBWA 3HOYH 3U4ZA 4GKJQ 1RIPA 2OCEA 4BBRH 4A3BG 1MJEA 2BA1A 4YHHQ 5AJ3Q 4C3HH 2XTIA 3EBEA 4A3JH 4NXNQ 3UDFA 3CC7A 1TWAH 2K5NA 1IBML 2N78A 2ATWA 1WYDA 2A19A 4X64Q 3CCUA 1HR0Q 2R7ZG 1XNQL 1TXYA 2BH8A 4JOIA 1K0RA 1VQEA 5M3MH 1VQNA 3CQZH 5EAYA 2VW9A 1Y1VH 1LUZA 1MIUA 4P75A 1V43A 1YIJA 1TWHH 3M3YH 1KRTA 4GN3B 2UXBQ 3H15A 4JI5Q 4A75A 2F52A 3RNUA 1XMOQ 4JI6L 4NXNL 3K7UC 2E2JH 1XPUA 4FDBA 1OXTA 1S3OA 3K8AA 1FJGL 1J6QA 1HZ9A 1C7YA 1SLJA 2VQFQ 1YHAA 1WCMG 1YBYA 3BU2A 3CMAA 3IRBA 3CCVA 4DR3L 1XMQQ 1PHJA 1SR3A 3I4MH 3GDEA 5JEAG 3CCRA 3KF6B 2D0OA 1IBLL 1VQHA 2NN6I 4DNIA 4DR2L 2DUDA 4HIDA 4ME3A 4R1JA 3F2DA 2HQLA 3STBC 4DR4Q 1FGUA 1LYLA 1IBKL 1HNZQ 3AFPA 1OXVA 2I5MX 4NPSA 4K0KL 4C3IH 3LGJA 3T1YQ 3NELA 3PUWA 4LF8Q 4B3RL 1E24A 1CKMA 4IO9A 2PQAA 1XTDA 2OQ0A 1XNRQ 2KHJA 3GD7A 4DV0L 4R4QA 3ULJA 5FJ8H 4AQYQ 1U5KA 2Z6KA 3RN2A 1TWFH 3PV0A 2B3GA 1VCIA 2Q2UA 1D8LA 2AWNA 3J7ZC 4R4CA 2EIFA 4LW1A 4GLXA 3KJOA 1MKHA 5GQOA 1OTCA 5IWAL 4LF9L 4DR7L 4GOPA 2B63G 1BBWA 1A63A 5GAHC 4YCWA 3S1RH 3CCSA 1Y1WH 3UDIA 3SGIA 2BA0A 4JI7Q 5IP9G 4EX5A 2N8NA 4KHZA 4DR1L 1KAWA 3MEFA 2UUAL 1OXSC 4QQBX 2UU9Q 1HR0W 2MQHA 3Q8DA 1Q7YC 5C44H 2Q2HA 3H0GH 1A8VA 2HIVA 1CKNA 1YJ9A 1HNXL 1IL2A 3U58A 3PUYA 2HHHQ 4AQYL 1K3RA 1Y1VG 3GTQH 3TREA 5M3MG 1NTGA 2K5VA 2E5LQ 1N9WA 3L7ZC 3S2HH 1ASYA 1DGSA 3FP9A 4HJ9A 2PQAB 3KF8B 4K0KQ 3OYYA 4X65L 5JEAJ 1A0IA 4UP9A 1HZAA 3E9HA 4A3LH 4BBRG 1GO3E 1NBWA 4A3EG 5IYBG 3KF6A 1PH1A 1PH8A 1JT8A 3M85A 1WOCA 3TRZA 3HOVG 1Q1BA 3G48A 1Q86C 4DV1L 4JBJA 4JI0L 2JEAI 1KQSA 1PYSB 2I0QA 2UUCL 5M5YH 2UUCQ 1QVFA 2VQFL 4GOPB 1VQPA 3I4NG 1Q1EA 1WJJA 4LF4Q 2A8VA 4LFBL 3ULLA 5BR8Q 1KD1C 5FLXc 1LTLA 4A3CG 5C0XI 2KCMA 3DLLA 2UUBQ 3S16H 4PMWA 3PO2G 1X54A 1GKHA 1UEBA 2A1AA 3S1QH 3I55A 1XPOA 3W5OA 4DV7L 3RN5A 4DAYB 4A3GG 1VQIA 1OXUA 4UY8C 2ZJPA 4JC0A 5IE8A 4JBMA 4IFDG 3K0XA 3CCQA 1VQJA 4QGUA 1K8AC 1HZCA 4IFDJ 3AFQA 1XPRA 4JI2L 3CAMA 2WAQE 4JCVE 5M5WH 2KCTA 4J15A 2UU9L 4GKJL 1S40A 4QL5A 1UWVA 1Z47A 2JA6G 4IOAA 4JI7L 3PUVA 2CWPA 1IBLQ 1QUQA 5C4JH 3GTOH 1Z9FA 4H02A 4X62L 1IXRA 1YITA 1E7ZA 1Q82C 1CSPA 2IHEA 3W1BA 2JA5G 4PZ7A 1NMFA 2ASBA 2VS1A 4P72A 3PO3G 1J5EL 1Q12A 2JA7G 1M1KC 2WAQG 2NZHA 3FHWA 1NE3A 5ELOA 1PA6A 4X65Q 3M4QA 1P16A 2HIXA 2YV5A 5IP7H 1N8RC 2PNHA 3S17H 2VUMH 2F4VL 3RZDH 1U0LA 5C0XJ 5M3FH 2AHOB 2NVYH 4XIGS 3TS0A 2E5LL 1N36Q 1PH5A 1IBMQ 1Q81C 2HHHL 1IBKQ 1HNZL 1VQ6A 4DV6L 1QVCA 1S72A 2GVAA 4YHHL 3H3VI 3HFZB 1EUJA 1NJIC 3HOZH 3EIVA 3CW2C 3PUXA 4DR2Q 4OWTB 3CPFA 1C9OA 3TQYA 4JI3Q 3GO5A 4AYBE 4DV5L 1BBUA 2D62A 4BY1G 3FKIG 3HKZE 4XTCS 4POFA 1N32Q 1GD7A 1W2BA 4LF9Q 3L2PA 1E3PA 1B70B 2OWOA 2CFMA 1X3EA 4L5QA 3TEHB 3S1NH 2R93G 5JJKA 1VQFA 4DPGA 1L1OC 4ALPA 1VQCA 4JI6Q 3TS2A 2ZM6L 4JV5L 3MXNB 1EYGA 3BJUA 4HJ7A 4A3GH 1X3GA 3HKSA 2JA9A 3CXCA 4L5SA 1YVCA 3ULPA 3JAMi 3VDYA 1O7IA 2MO1A 1JB7A 3HKZG 4JI4Q 3HOUH 4DV2Q 4B3MQ 1SFOH 4A3FH 4NB3A 1GVPA 4A4IA 3J80i 1PFSA 5C3EG 3PSIA 4LF7Q 1KIXA 2NVTH 3OW2A 2QEXA 1KL9A 1JJCB 5C44G 2K14A 2K5HA 3PGZA 4X62Q 1PH2A 2RF4A 1N33Q 4POGA 2Z0SA 1WCMH 3KOJA 2K75A 2JA5H 2CWAA 3F2BA 4HJ5A 4P71A 4LF5Q 4X6AH 3RR5A 4DR3Q 2MFIA 1XMQL 4EQ5A 1SN8A 4B3SL 4APVA 5IYBH 4P74A 2AKWB 4A3LG 1SROA 4JI2Q 4GN4B 3M4OH 4DK3C 1X6OA 2LXKA 5HY6A 3J81c 4DV4Q 1XMOL 5IYDG 3DM3A 4JI4L 1SRUA 2HT1A 1JJ2A 2R7ZH 2ZTCA 5LMNQ 4C3JH 4PZ6A 1YJWA 4DK6C 5FJ8G 4LFAL 4IJHA 4LF7L 3PF4A 1YZ6A 3OTOQ 1CKNB 1YHBA 3M4PA 2I5HA 1VQOA 2C35B 1FVIA 3HOXH 3PCOB 4DV3L 1G6PA 3J7A5 1WI5A 5AJ3L 1X9NA 1VQ5A 4LF4L 3KLWA 3PO2H 4KHPL 2UXDQ 5C4XG 1UE7A 2LXJA 2CQOA 1E22A 4AH6A 4DAMA 3CF5A 5JJLA 2JA8G 1JMCA 4L5RC 4BY7G 4DV1Q 1KXLA 2YTYA 1V1QA 4BY7H 4JI1Q 4QY7A 1X55A 3UE1A 2K52A 4RG1A 2EXDA 1TWGH 2E2IH 4JYAQ 1NY4A 5K36G 2Y0SE 1L0WA 4DR6L 3HOXG 1L2FA 2ES2A 2R7FA 1RL2A 4Y7NH 2JEBI 1KRSA 3NEMA 2ZJRA 4B3TL 4WJ3M 1EIFA 1OXXK 2R7DA 2V1CC 2NZOA 4LWCA 5C0XG 2FXQA 2AWOA 4DV3Q 4DV6Q 4A3MG 1I94Q 1VQ7A 4GNXB 3ZJYC 1G51A 3I7FA 2RHQB 4MNOA 4O0AA 3I4OA 1HNXQ 1I3QH 2JK8A 2K50A 2GN5A 5GAGC 3G4SA 4OWXB 1PH3A 4JV5Q 2ALYB 4A3MH 1P8LA 4GKKL 3J81j 3B6YA 4TQUS 3G6EA 4A3DH 3GTGH 4OO1I 3EN2A 3CC4A 1KHIA 5JJIA 3E0EA 2RCNA 2PI2E 2L15A 4YWMA 1EQRA 1YJNA 3GTKH 3S15H 4DR7Q 4GN5A 1WFQA 2Q2IA 4QIWE 3U4VA 5M5XH 2UXCQ 4DUZQ 1YHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O2D A;  5ELN A;  2QGQ A;  3NBH B;  4OON A;  3A5U A;  2OTJ A;  4IPC A;  1VQ4 A;  4X66 L;  3CCM A;  4NXM L;  4OX9 L;  1NMG A;  4A93 H;  4HIM A;  5LMN W;  5IYC G;  4B3R Q;  4BA2 I;  2JJQ A;  4A3J G;  4YCU A;  2CKZ B;  1X3F A;  1Q8K A;  2UUB L;  4A3B H;  2D0P A;  1C0A A;  2YTV A;  4MZ9 A;  4DV7 Q;  2E8G A;  1EQQ A;  1G29 1;  5DLQ E;  2K4K A;  1B8A A;  2MNA A;  1JJG A;  4P73 A;  1QVG A;  1BVS A;  4OXP A;  5J3B A;  2ZM6 Q;  4A3I G;  2DGY A;  4DR5 L;  1ASZ A;  2R92 G;  1IZ6 A;  2PMZ E;  3KDF A;  2ZJQ A;  3I4M G;  1CKO A;  1PH4 A;  1FJG Q;  3CME A;  1N32 L;  1UE5 A;  4LUV A;  3UDX A;  4YY3 Q;  1UE1 A;  4R4T A;  4JI3 L;  3PIP A;  1H95 A;  2UXB L;  5HGQ A;  1HNW Q;  4BA1 I;  4GNX A;  4A3K G;  4WJ4 A;  1VS0 A;  1UE6 A;  1AE2 A;  4A3D G;  3F1Z A;  2VQE Q;  3CCJ A;  4OO1 G;  4LFC Q;  4KLK A;  4UP7 A;  4DKA C;  5M3F G;  4X64 L;  1I94 L;  2WFW A;  5C3E H;  4GNX C;  1N36 L;  5IP7 G;  4BBS G;  1CSQ A;  3UDG A;  2ZTD A;  3NEN A;  5GRO A;  1HZB A;  1PH6 A;  1V9P A;  4GS3 A;  3RLF A;  4AYB G;  4HJ8 A;  3HOW G;  1PH9 A;  2JA7 H;  2KHI A;  2VZA A;  2N3S A;  1HNW L;  3GTL H;  4DR6 Q;  1K83 H;  3PO3 H;  4UPA A;  2IY5 B;  2GVB A;  2NVX H;  4IJL A;  1VQD A;  5LMU L;  4DUY Q;  3HOY G;  3S1M H;  3D0F A;  5IWA Q;  4YWK A;  3CPW A;  3WWV A;  3G71 A;  2B29 A;  1MJC A;  4DR5 Q;  2YU9 H;  4Y52 H;  2AMC B;  2WB1 G;  4DUY L;  4BY1 H;  5FLM G;  1PV4 A;  1K73 C;  1E1O A;  4GKK Q;  2JA8 H;  4KHP Q;  1IYJ B;  4DV0 Q;  3S14 H;  3GTM H;  4A3F G;  4BBS H;  3A0J A;  2NN6 G;  3AEV A;  1B7Y B;  1AE3 A;  1VQL A;  3K7A H;  3M9B A;  3PF5 A;  1I5F A;  3T1Y L;  1AH9 A;  1D7Q A;  2KBN A;  2KEN A;  3UE0 A;  1VQB A;  1VQ8 A;  2IX1 A;  3GTJ H;  4DR4 L;  2MO0 A;  4MTN A;  4LFC L;  4LNQ A;  2VQE L;  4B3T Q;  1Q46 A;  4C2M H;  5E7N A;  2OQK A;  5H1S E;  1EIY B;  2WB1 E;  3A5Z B;  2VL6 A;  2YYZ A;  2VY3 A;  1JE5 A;  1QZG A;  4R4O A;  4BXX H;  4YY3 L;  2UXC L;  5IYD H;  1T9H A;  1GM5 A;  1QUQ B;  3FKI H;  4IOC A;  5BR8 L;  2YTX A;  4LFB Q;  3ER0 A;  3I2Z A;  2JQO A;  4JI1 L;  4A76 A;  3STB D;  2CCZ A;  3RZO H;  3HOV H;  1VQ9 A;  3HOZ G;  4YWL A;  1YI2 A;  4GOP C;  2ID0 A;  3K80 C;  4QJF A;  1EFW A;  4JI0 Q;  1PYB A;  3F2C A;  2UXD L;  1A62 A;  1YEZ A;  1VQA A;  1EWI A;  3U50 C;  2JA6 H;  4PG3 A;  1K9M C;  2XGT A;  4GLA C;  4RMF A;  3M7N A;  4IPH A;  4DV2 L;  2WP8 J;  4B3M L;  2IHF A;  1XNQ Q;  3GTP H;  1HR0 L;  1HJP A;  3A74 A;  4JI5 L;  2R6G A;  2Z6K C;  3AYH B;  4IPD A;  3I56 A;  3S24 A;  3OTO L;  4R4I A;  1EOV A;  5GAE C;  2Y0S G;  3HOU G;  3D31 A;  4OWW B;  4IPG A;  3S2D H;  1R9T H;  5LMN L;  3E9I A;  4X66 Q;  1E1T A;  4NXM Q;  4KI0 A;  4OX9 Q;  1SMX A;  1I6H H;  4LUO A;  2BH2 A;  1TWC H;  2H5X A;  2N49 A;  1X56 A;  5IP9 H;  3T1H L;  5IY0 A;  4YCV A;  4DUZ L;  4A3C H;  3KYH C;  4DR1 Q;  2UUA Q;  1VQM A;  1CUK A;  3JAM c;  2JE6 I;  3L0O A;  4AIM A;  2B63 H;  2R93 H;  3CC2 A;  1LM0 A;  1YNX A;  3KJP A;  2NVQ H;  3CCL A;  4JI8 L;  2E2H H;  3RLN A;  2OTL A;  2IX0 A;  1SE8 A;  1L1O B;  1M90 C;  4LF6 L;  4HJA A;  3HOW H;  4BXX G;  3AQQ A;  2I5L X;  2ZTE A;  3J80 c;  3BZC A;  1Y14 B;  3CP0 A;  4LUZ A;  3JC6 6;  3PIO A;  3CD6 A;  1KC8 C;  2EQS A;  4JG2 A;  2PI2 A;  1N34 Q;  3ERS X;  4A3E H;  1X65 A;  3PUZ A;  4GLV B;  1N34 L;  5IT9 c;  4A3K H;  2F4V Q;  4LFA Q;  1XJV A;  4L5T A;  1XNR L;  3H3V H;  5IYC H;  1VQG A;  1BKB A;  4HIK A;  4A93 G;  4LF8 L;  4PZ8 A;  3W1G A;  4LF6 Q;  2VUM G;  1PVO A;  3F8T A;  3BZK A;  2F3I A;  3K81 C;  4UP8 A;  5GAD C;  4DV4 L;  1J5E Q;  3J81 i;  4JOI C;  3I4N H;  4JI8 Q;  2LSS A;  1PH7 A;  3KFU A;  1QZH A;  2RHS B;  2Q2T A;  5FLM H;  3H0G G;  4HIO A;  4JYA L;  4B3S Q;  1HH2 P;  3RLO A;  1L1O A;  2R92 H;  4IFD I;  3CCE A;  4LF5 L;  4A3I H;  1I50 H;  3T1H Q;  4DV5 Q;  4JBK A;  5C4X H;  2QA4 A;  1FL0 A;  1W3S A;  2IT1 A;  4TVA B;  5LMU Q;  1VQK A;  2VNU D;  1K8G A;  1N33 L;  1Y1W G;  3KDF B;  3ICE A;  4JBW A;  3HOY H;  3U4Z A;  4GKJ Q;  1RIP A;  2OCE A;  4BBR H;  4A3B G;  1MJE A;  2BA1 A;  4YHH Q;  5AJ3 Q;  4C3H H;  2XTI A;  3EBE A;  4A3J H;  4NXN Q;  3UDF A;  3CC7 A;  1TWA H;  2K5N A;  1IBM L;  2N78 A;  2ATW A;  1WYD A;  2A19 A;  4X64 Q;  3CCU A;  1HR0 Q;  2R7Z G;  1XNQ L;  1TXY A;  2BH8 A;  4JOI A;  1K0R A;  1VQE A;  5M3M H;  1VQN A;  3CQZ H;  5EAY A;  2VW9 A;  1Y1V H;  1LUZ A;  1MIU A;  4P75 A;  1V43 A;  1YIJ A;  1TWH H;  3M3Y H;  1KRT A;  4GN3 B;  2UXB Q;  3H15 A;  4JI5 Q;  4A75 A;  2F52 A;  3RNU A;  1XMO Q;  4JI6 L;  4NXN L;  3K7U C;  2E2J H;  1XPU A;  4FDB A;  1OXT A;  1S3O A;  3K8A A;  1FJG L;  1J6Q A;  1HZ9 A;  1C7Y A;  1SLJ A;  2VQF Q;  1YHA A;  1WCM G;  1YBY A;  3BU2 A;  3CMA A;  3IRB A;  3CCV A;  4DR3 L;  1XMQ Q;  1PHJ A;  1SR3 A;  3I4M H;  3GDE A;  5JEA G;  3CCR A;  3KF6 B;  2D0O A;  1IBL L;  1VQH A;  2NN6 I;  4DNI A;  4DR2 L;  2DUD A;  4HID A;  4ME3 A;  4R1J A;  3F2D A;  2HQL A;  3STB C;  4DR4 Q;  1FGU A;  1LYL A;  1IBK L;  1HNZ Q;  3AFP A;  1OXV A;  2I5M X;  4NPS A;  4K0K L;  4C3I H;  3LGJ A;  3T1Y Q;  3NEL A;  3PUW A;  4LF8 Q;  4B3R L;  1E24 A;  1CKM A;  4IO9 A;  2PQA A;  1XTD A;  2OQ0 A;  1XNR Q;  2KHJ A;  3GD7 A;  4DV0 L;  4R4Q A;  3ULJ A;  5FJ8 H;  4AQY Q;  1U5K A;  2Z6K A;  3RN2 A;  1TWF H;  3PV0 A;  2B3G A;  1VCI A;  2Q2U A;  1D8L A;  2AWN A;  3J7Z C;  4R4C A;  2EIF A;  4LW1 A;  4GLX A;  3KJO A;  1MKH A;  5GQO A;  1OTC A;  5IWA L;  4LF9 L;  4DR7 L;  4GOP A;  2B63 G;  1BBW A;  1A63 A;  5GAH C;  4YCW A;  3S1R H;  3CCS A;  1Y1W H;  3UDI A;  3SGI A;  2BA0 A;  4JI7 Q;  5IP9 G;  4EX5 A;  2N8N A;  4KHZ A;  4DR1 L;  1KAW A;  3MEF A;  2UUA L;  1OXS C;  4QQB X;  2UU9 Q;  1HR0 W;  2MQH A;  3Q8D A;  1Q7Y C;  5C44 H;  2Q2H A;  3H0G H;  1A8V A;  2HIV A;  1CKN A;  1YJ9 A;  1HNX L;  1IL2 A;  3U58 A;  3PUY A;  2HHH Q;  4AQY L;  1K3R A;  1Y1V G;  3GTQ H;  3TRE A;  5M3M G;  1NTG A;  2K5V A;  2E5L Q;  1N9W A;  3L7Z C;  3S2H H;  1ASY A;  1DGS A;  3FP9 A;  4HJ9 A;  2PQA B;  3KF8 B;  4K0K Q;  3OYY A;  4X65 L;  5JEA J;  1A0I A;  4UP9 A;  1HZA A;  3E9H A;  4A3L H;  4BBR G;  1GO3 E;  1NBW A;  4A3E G;  5IYB G;  3KF6 A;  1PH1 A;  1PH8 A;  1JT8 A;  3M85 A;  1WOC A;  3TRZ A;  3HOV G;  1Q1B A;  3G48 A;  1Q86 C;  4DV1 L;  4JBJ A;  4JI0 L;  2JEA I;  1KQS A;  1PYS B;  2I0Q A;  2UUC L;  5M5Y H;  2UUC Q;  1QVF A;  2VQF L;  4GOP B;  1VQP A;  3I4N G;  1Q1E A;  1WJJ A;  4LF4 Q;  2A8V A;  4LFB L;  3ULL A;  5BR8 Q;  1KD1 C;  5FLX c;  1LTL A;  4A3C G;  5C0X I;  2KCM A;  3DLL A;  2UUB Q;  3S16 H;  4PMW A;  3PO2 G;  1X54 A;  1GKH A;  1UEB A;  2A1A A;  3S1Q H;  3I55 A;  1XPO A;  3W5O A;  4DV7 L;  3RN5 A;  4DAY B;  4A3G G;  1VQI A;  1OXU A;  4UY8 C;  2ZJP A;  4JC0 A;  5IE8 A;  4JBM A;  4IFD G;  3K0X A;  3CCQ A;  1VQJ A;  4QGU A;  1K8A C;  1HZC A;  4IFD J;  3AFQ A;  1XPR A;  4JI2 L;  3CAM A;  2WAQ E;  4JCV E;  5M5W H;  2KCT A;  4J15 A;  2UU9 L;  4GKJ L;  1S40 A;  4QL5 A;  1UWV A;  1Z47 A;  2JA6 G;  4IOA A;  4JI7 L;  3PUV A;  2CWP A;  1IBL Q;  1QUQ A;  5C4J H;  3GTO H;  1Z9F A;  4H02 A;  4X62 L;  1IXR A;  1YIT A;  1E7Z A;  1Q82 C;  1CSP A;  2IHE A;  3W1B A;  2JA5 G;  4PZ7 A;  1NMF A;  2ASB A;  2VS1 A;  4P72 A;  3PO3 G;  1J5E L;  1Q12 A;  2JA7 G;  1M1K C;  2WAQ G;  2NZH A;  3FHW A;  1NE3 A;  5ELO A;  1PA6 A;  4X65 Q;  3M4Q A;  1P16 A;  2HIX A;  2YV5 A;  5IP7 H;  1N8R C;  2PNH A;  3S17 H;  2VUM H;  2F4V L;  3RZD H;  1U0L A;  5C0X J;  5M3F H;  2AHO B;  2NVY H;  4XIG S;  3TS0 A;  2E5L L;  1N36 Q;  1PH5 A;  1IBM Q;  1Q81 C;  2HHH L;  1IBK Q;  1HNZ L;  1VQ6 A;  4DV6 L;  1QVC A;  1S72 A;  2GVA A;  4YHH L;  3H3V I;  3HFZ B;  1EUJ A;  1NJI C;  3HOZ H;  3EIV A;  3CW2 C;  3PUX A;  4DR2 Q;  4OWT B;  3CPF A;  1C9O A;  3TQY A;  4JI3 Q;  3GO5 A;  4AYB E;  4DV5 L;  1BBU A;  2D62 A;  4BY1 G;  3FKI G;  3HKZ E;  4XTC S;  4POF A;  1N32 Q;  1GD7 A;  1W2B A;  4LF9 Q;  3L2P A;  1E3P A;  1B70 B;  2OWO A;  2CFM A;  1X3E A;  4L5Q A;  3TEH B;  3S1N H;  2R93 G;  5JJK A;  1VQF A;  4DPG A;  1L1O C;  4ALP A;  1VQC A;  4JI6 Q;  3TS2 A;  2ZM6 L;  4JV5 L;  3MXN B;  1EYG A;  3BJU A;  4HJ7 A;  4A3G H;  1X3G A;  3HKS A;  2JA9 A;  3CXC A;  4L5S A;  1YVC A;  3ULP A;  3JAM i;  3VDY A;  1O7I A;  2MO1 A;  1JB7 A;  3HKZ G;  4JI4 Q;  3HOU H;  4DV2 Q;  4B3M Q;  1SFO H;  4A3F H;  4NB3 A;  1GVP A;  4A4I A;  3J80 i;  1PFS A;  5C3E G;  3PSI A;  4LF7 Q;  1KIX A;  2NVT H;  3OW2 A;  2QEX A;  1KL9 A;  1JJC B;  5C44 G;  2K14 A;  2K5H A;  3PGZ A;  4X62 Q;  1PH2 A;  2RF4 A;  1N33 Q;  4POG A;  2Z0S A;  1WCM H;  3KOJ A;  2K75 A;  2JA5 H;  2CWA A;  3F2B A;  4HJ5 A;  4P71 A;  4LF5 Q;  4X6A H;  3RR5 A;  4DR3 Q;  2MFI A;  1XMQ L;  4EQ5 A;  1SN8 A;  4B3S L;  4APV A;  5IYB H;  4P74 A;  2AKW B;  4A3L G;  1SRO A;  4JI2 Q;  4GN4 B;  3M4O H;  4DK3 C;  1X6O A;  2LXK A;  5HY6 A;  3J81 c;  4DV4 Q;  1XMO L;  5IYD G;  3DM3 A;  4JI4 L;  1SRU A;  2HT1 A;  1JJ2 A;  2R7Z H;  2ZTC A;  5LMN Q;  4C3J H;  4PZ6 A;  1YJW A;  4DK6 C;  5FJ8 G;  4LFA L;  4IJH A;  4LF7 L;  3PF4 A;  1YZ6 A;  3OTO Q;  1CKN B;  1YHB A;  3M4P A;  2I5H A;  1VQO A;  2C35 B;  1FVI A;  3HOX H;  3PCO B;  4DV3 L;  1G6P A;  3J7A 5;  1WI5 A;  5AJ3 L;  1X9N A;  1VQ5 A;  4LF4 L;  3KLW A;  3PO2 H;  4KHP L;  2UXD Q;  5C4X G;  1UE7 A;  2LXJ A;  2CQO A;  1E22 A;  4AH6 A;  4DAM A;  3CF5 A;  5JJL A;  2JA8 G;  1JMC A;  4L5R C;  4BY7 G;  4DV1 Q;  1KXL A;  2YTY A;  1V1Q A;  4BY7 H;  4JI1 Q;  4QY7 A;  1X55 A;  3UE1 A;  2K52 A;  4RG1 A;  2EXD A;  1TWG H;  2E2I H;  4JYA Q;  1NY4 A;  5K36 G;  2Y0S E;  1L0W A;  4DR6 L;  3HOX G;  1L2F A;  2ES2 A;  2R7F A;  1RL2 A;  4Y7N H;  2JEB I;  1KRS A;  3NEM A;  2ZJR A;  4B3T L;  4WJ3 M;  1EIF A;  1OXX K;  2R7D A;  2V1C C;  2NZO A;  4LWC A;  5C0X G;  2FXQ A;  2AWO A;  4DV3 Q;  4DV6 Q;  4A3M G;  1I94 Q;  1VQ7 A;  4GNX B;  3ZJY C;  1G51 A;  3I7F A;  2RHQ B;  4MNO A;  4O0A A;  3I4O A;  1HNX Q;  1I3Q H;  2JK8 A;  2K50 A;  2GN5 A;  5GAG C;  3G4S A;  4OWX B;  1PH3 A;  4JV5 Q;  2ALY B;  4A3M H;  1P8L A;  4GKK L;  3J81 j;  3B6Y A;  4TQU S;  3G6E A;  4A3D H;  3GTG H;  4OO1 I;  3EN2 A;  3CC4 A;  1KHI A;  5JJI A;  3E0E A;  2RCN A;  2PI2 E;  2L15 A;  4YWM A;  1EQR A;  1YJN A;  3GTK H;  3S15 H;  4DR7 Q;  4GN5 A;  1WFQ A;  2Q2I A;  4QIW E;  3U4V A;  5M5X H;  2UXC Q;  4DUZ Q;  1YHQ A; 
#chains in the Genus database with same CATH topology
 2QDL A;  4G4K A;  3A5U A;  5CV8 A;  4IPC A;  1ENF A;  4BA2 I;  3K5N A;  4YCU A;  2F0S A;  2CKZ B;  4N8X 1;  5A35 A;  5JAV A;  4I7Z C;  1C0A A;  2D0P A;  2YTV A;  1G6Z A;  4MZ9 A;  4DV7 Q;  2E8G A;  5DLQ E;  2K4K A;  1B8A A;  2E2H B;  3G6J B;  3K57 A;  2NVQ B;  1A2U A;  2DGY A;  3S16 B;  1ASZ A;  1ZYR D;  1IZ6 A;  1C4Q A;  1E2W A;  3KDF A;  1PH4 A;  3CME A;  1UE5 A;  3WOE A;  2K5W A;  5FOB B;  2XRQ D;  4JI3 L;  4OEM B;  5A2Q E;  2M2L A;  1HNW Q;  4BA1 I;  2EYM A;  3RMH A;  1UE6 A;  3JAM E;  1AE2 A;  3CCJ A;  2PMZ B;  4OO1 G;  4LFC Q;  4KLK A;  2K5D A;  4A3M B;  1I94 L;  4GNX C;  4CKE A;  5IP7 G;  4BBS G;  3MC0 B;  3HOW G;  3A7A B;  3E6Z X;  3GTL H;  4DR6 Q;  1K83 H;  2GVB A;  3KLS A;  5TSS A;  4IJL A;  4F88 A;  1LV9 A;  4DUY Q;  4ZUJ A;  4G7O C;  3S1M H;  4LMQ D;  1E0B A;  1RKN A;  2B29 A;  3GTL B;  5KIX A;  1ML0 D;  5FLM G;  1EOT A;  1PV4 A;  1K73 C;  5IGB A;  3LWU A;  1RJT A;  3GTM H;  4MTK A;  2RCF A;  1D6E C;  1EU4 A;  1AE3 A;  3T1Y L;  1D7Q A;  1JWU D;  1HUM A;  3Q24 A;  3GTJ H;  2MO0 A;  1X3P A;  2XNA C;  4LNQ A;  2VQE L;  1Q46 A;  3TME A;  5E7N A;  2OQK A;  2WB1 E;  3A5Z B;  2B2T A;  2VL6 A;  2NTT A;  2MGS A;  1KAA A;  4BXX H;  2UXC L;  1IL8 A;  1GM5 A;  1QUQ B;  4IOC A;  4A3I B;  4LFB Q;  3SHL A;  4JI1 L;  3STB D;  4XQN A;  2F0P A;  3EQL C;  5IIF A;  3I4M B;  1H9J A;  4RFB A;  4QJF A;  1A62 A;  3U50 C;  4UAI A;  4L63 B;  4RMF A;  1TWF B;  4B3M L;  2E2J B;  2WAQ B;  3I91 A;  2Y0S B;  2L4N A;  3MA2 B;  2Z6K C;  4IPD A;  1AZQ A;  3S24 A;  3OTO L;  4R4I A;  4IFD H;  1EOV A;  2Y0S G;  4X66 Q;  1E1T A;  1SMX A;  1PFN A;  4LUO A;  2LS0 1;  2CVR A;  2F0G A;  2WII B;  3T56 B;  3V05 A;  1I50 B;  3MWY W;  1HFN A;  4A3C H;  2UUA Q;  4O1N A;  1DCZ A;  1LM0 A;  1YNX A;  1AW7 A;  3GV6 A;  3OPO A;  3RLN A;  2OTL A;  5KYL A;  3DMU A;  4K6D A;  3AQQ A;  1O7Y A;  2EYF A;  2I5L X;  2ZTE A;  4LUZ A;  1BR9 A;  1R4P B;  2QKI C;  1SE2 A;  4LJZ C;  5FO8 B;  1KC8 C;  1TS4 A;  4A3E H;  3PUZ A;  1N34 L;  3NTK A;  4NMZ A;  4LFA Q;  4L5T A;  2EYH A;  1ENA A;  5IYC H;  1VQG A;  4HIK A;  4A93 G;  4LF8 L;  5EPJ A;  1LAB A;  4PZ8 A;  4RGT A;  2VUM G;  1PVO A;  3F8T A;  1I4G A;  3BZK A;  5FK9 C;  4DV4 L;  1J5E Q;  4JI8 Q;  2RHS B;  5FLM H;  2L1B A;  1L1O A;  1LTA D;  4LF5 L;  1PZK D;  3FPP A;  4OHJ A;  3SE0 A;  3UI2 A;  1FL0 A;  1TS5 A;  2VNU D;  3A8K E;  1HTL D;  1N33 L;  1Y1W G;  3QO2 A;  4JBW A;  4GKJ Q;  2OCE A;  4BBR H;  2RDH A;  3EBE A;  2SNM A;  3FDT A;  2HDL A;  1PXU A;  3UDF A;  3G7L A;  1JOR A;  1TWA H;  2K5N A;  1TS3 A;  5C5L A;  2JSO A;  1K0R A;  1VQE A;  5M3M H;  2XWJ B;  1MIU A;  1TWH H;  3R3O A;  1UUP A;  5JVG 3;  1XMO Q;  1XPU A;  4FDB A;  1OXT A;  1U4L A;  1DD2 A;  3ITP A;  5E4X A;  2WKD A;  5K36 H;  2F0I A;  2IPK D;  3F2U A;  4PV1 C;  3I4M H;  3GDE A;  3QG1 A;  2DY7 A;  1B3A A;  1PRT B;  3VR4 A;  2DUD A;  1VF5 C;  4Z9C B;  3GQB A;  3CRL C;  4DR4 Q;  1LYL A;  1IBK L;  1HNZ Q;  3NEL A;  1Y8N B;  3PUW A;  4LF8 Q;  4B3R L;  5D3I B;  2PQA A;  4XQQ A;  2CW0 C;  4R4Q A;  5FJ8 H;  5I2X A;  1ZYR C;  2QW7 A;  5ELB A;  3MXN A;  2AWN A;  2EIF A;  4LF9 L;  3BS1 A;  1A63 A;  3LX0 A;  3S1R H;  3CCS A;  2ZT9 C;  2A6H C;  4EX5 A;  3E5S A;  2N8N A;  2EY5 A;  2UUA L;  2UU9 Q;  2SOB A;  1YNJ C;  3GP7 A;  5C44 H;  3KUP A;  1IL2 A;  2HIV A;  3BYT B;  1HNX L;  3U58 A;  3H3V C;  3C2P A;  2E5L Q;  1JCK B;  2PCF B;  1UEA B;  2K5Q A;  2PQA B;  3CQZ B;  5D14 A;  1EQV A;  2CHB D;  3OYY A;  5CYU A;  4A3E G;  4JW0 A;  1JT8 A;  1PFB A;  3M4O B;  1BUV T;  4TSS A;  1Q86 C;  4JI0 L;  3VYR A;  1PYS B;  1SYB A;  1RHP A;  1H9R A;  4GOP B;  2A8V A;  4LFB L;  5BR8 Q;  4KY5 A;  5E1F A;  2UUB Q;  4PMW A;  1X54 A;  1GKH A;  3I55 A;  1STA A;  3TDQ A;  4B9W A;  5CC4 A;  2ZJP A;  3S17 B;  3K0X A;  3CCQ A;  1SEB D;  3CAM A;  2UU9 L;  2KCT A;  1SAP A;  1UWV A;  5FLX E;  1O78 A;  1Z9F A;  3L3O C;  1PRT F;  3W1B A;  4PZ7 A;  1NMF A;  2ASB A;  4P72 A;  3PO3 G;  5EKI A;  4XQJ A;  3ERQ A;  1TY2 A;  4L6T B;  5IOD A;  2HIX A;  4J8Q A;  5JPN C;  1CQF A;  2F4V L;  1DM0 B;  2NVY H;  1N36 Q;  2HCI A;  3K5L A;  4IUR A;  1IBM Q;  2BE5 D;  4ZK9 B;  1IBK Q;  1HNZ L;  4QIW B;  1QVC A;  1UAP A;  4A3E B;  4DK0 A;  1EUJ A;  1XX8 A;  1NJI C;  1BO0 A;  1K0S A;  3PUX A;  3CPF A;  3TQY A;  4JI3 Q;  4C1N I;  2MUY A;  4DV5 L;  2FHT A;  1XTC D;  4BY1 G;  3HKZ E;  3U9O A;  4POF A;  1KNE A;  1GD7 A;  1W2B A;  1EY7 A;  4LF9 Q;  3L2P A;  1E3P A;  2O2L D;  4L5Q A;  5JJK A;  1Q90 A;  1VQF A;  4DPG A;  1L1O C;  2B8G A;  2AQ3 B;  1H9K A;  2EJG C;  1EFI D;  3T51 B;  3I70 A;  4JI4 Q;  3HGB A;  3KBG A;  4J6H A;  3J7A V;  5C5M A;  4CDC C;  2C5C A;  1U4M A;  1E2Z A;  1JJC B;  3KLS X;  1STG A;  4DU9 A;  3PGZ A;  1LTG D;  1S5B D;  2RF4 A;  2Z0S A;  3KOJ A;  5C3X A;  4X6A H;  1BNZ A;  2X69 A;  4H0L C;  1HXY D;  4FF2 A;  4A3L G;  3SEB A;  2RA4 A;  1K8O A;  1S5C D;  4DK3 C;  5M9O A;  4A3F B;  3J81 c;  1AZP A;  1SXT A;  2F0M A;  3A54 A;  3DM3 A;  4JI4 L;  1SRU A;  2RQX A;  4I7A A;  5IT9 E;  4C3J H;  1LTT D;  3TSS A;  4QCL A;  4LFA L;  3PF4 A;  1F77 A;  1YZ6 A;  4EVO A;  1YHB A;  3M4P A;  5BN3 A;  4CKB A;  2C35 B;  1FVI A;  4K8I A;  1WI5 A;  3KLW A;  3PO2 H;  5C4X B;  2JA8 B;  2D9U A;  2G5D A;  2M00 A;  3PIP 3;  1FYC A;  4DXG A;  2JA8 G;  1MD2 D;  1JMC A;  1LAC A;  1Y1W B;  4B9X A;  4RG1 A;  2RBM A;  3RUZ A;  4H7B A;  4X3K A;  3M3Y B;  1R4Q B;  3S1M B;  1L2F A;  2ZJR A;  1KRS A;  4B3T L;  1JQY D;  2ZXR A;  1GXD C;  1OXX K;  2V1C C;  4G7Z C;  2EYP A;  1TU2 B;  2AUJ D;  2JK8 A;  2K50 A;  4EQP A;  1Q3L A;  1LT3 D;  1PH3 A;  2ALY B;  4GKK L;  4K2L A;  4A3D H;  3EN2 A;  3TP6 A;  3E0E A;  3TN2 A;  2L9H A;  4YWM A;  5LHY 1;  1GJX A;  2XSC A;  5I9P A;  3GTK H;  1EIH A;  4DR7 Q;  5EQ0 A;  3K5M A;  3U4V A;  3I8Z A;  2UXC Q;  3D4W A;  4FYD A;  3MFG A;  3NBH B;  1TWC B;  5ELF A;  4G7H C;  4IUU A;  4NXM L;  4OX9 L;  1ONL A;  1NMG A;  5LMN W;  3O13 A;  1MSH A;  5E3F A;  4K5X A;  2SNS A;  5DNF A;  2UUB L;  3FPU B;  4XT1 B;  3NBH A;  2KCN A;  5C4H A;  4P73 A;  3SVM A;  4KHV A;  5M5Y B;  1V1O A;  3MVV A;  1DON A;  1J8I A;  2A6E D;  1GOZ A;  1RTN A;  2G9H D;  1UE1 A;  2KHS A;  4IN3 A;  1CHP D;  1PRT C;  2F0H A;  3D6C A;  3PIP A;  2PZT A;  3NE5 B;  3J81 L;  2UXB L;  1NNX A;  1KTK A;  1WD1 A;  4A3D G;  2VQE Q;  3N52 A;  3NQI A;  2O5J C;  1YNN C;  1DOL A;  4DKA C;  4X64 L;  2Z8L A;  2NN6 H;  2F0J A;  2G9D A;  3NEN A;  5GRO A;  3V2T A;  4AYB G;  2JA7 H;  1HNW L;  3PO3 H;  4UPA A;  2K05 A;  5LMU L;  3AU7 A;  1UNS A;  2XRS D;  5IGG A;  3D0F A;  1NR4 A;  1X32 A;  4YWK A;  3CPW A;  3CKI B;  5DEH A;  1WTX A;  3BDC A;  4HCE A;  2AMC B;  1IKL A;  4DUY L;  4K5W A;  4DF7 A;  1E1O A;  4GKK Q;  2JA8 H;  5CGK A;  1A6X A;  1ZEQ X;  4C56 C;  1PTO D;  1Y1V B;  4HN7 A;  3PF5 A;  1I5F A;  1AH9 A;  1WTO A;  3GTM B;  2IX1 A;  4DR4 L;  4LFC L;  4DN4 M;  4B3T Q;  3K7A B;  1HUN A;  5H1S E;  3BVM A;  1EIY B;  4JK1 C;  2YYZ A;  3A56 A;  2EY1 A;  3JAM L;  4YY3 L;  1B9N A;  2B2U C;  1QCB D;  1A3U A;  1Y8O B;  3FKI H;  2HCC A;  4KJO A;  1JWS D;  3HOZ G;  1QE6 A;  5NUC A;  1GUG A;  1ZKO A;  1FR3 A;  1Y69 U;  2Q8T A;  3A7L A;  1XNQ Q;  4K14 A;  3GTP H;  2NVY B;  3D4D A;  3A74 A;  3J81 E;  3OIQ A;  2MJ8 A;  3PQI A;  5GAE C;  5EGT A;  3D31 A;  4PQX A;  1ENC A;  3E9I A;  1ET6 A;  2H5X A;  2PW5 A;  1F9S A;  1PLF A;  4KY6 A;  1SYF A;  2H4O A;  5IP9 H;  3T1H L;  4DUZ L;  4BY1 B;  1TY0 A;  4DR1 Q;  1VQM A;  3JAM c;  3NP8 A;  1KAB A;  3CC2 A;  4RHR A;  4JI8 L;  2E2H H;  3SK6 A;  5T1G A;  2IX0 A;  4ABN A;  1SE8 A;  1L1O B;  1BDO A;  1OO9 B;  2P5Z X;  4C1N K;  1M90 C;  3HOW H;  1IHZ A;  2Z6B A;  3J80 c;  3CP0 A;  3PIO A;  4JG2 A;  1I4H A;  5KEE A;  4GLV B;  1O7Z A;  5D65 A;  1LTS D;  1XNR L;  4RCO A;  1CA6 A;  3HP3 A;  4RHS A;  3W1G A;  3WOF A;  4UP8 A;  3K81 C;  3S1Q B;  3J81 i;  3I4N H;  5EBC A;  3PMF A;  2Q2T A;  4B3S Q;  3RLO A;  4IFD I;  2K6A A;  1BBX C;  3CCE A;  2RDF A;  4JBK A;  5LMU Q;  4TVA B;  1VQK A;  1K8G A;  3KDF B;  1SJH D;  4A3B G;  3VYU A;  4GZY C;  2E75 C;  2XTI A;  3J80 L;  3CC7 A;  4G57 A;  2A19 A;  2DJF C;  1HHV A;  2R7Z G;  5EAY A;  3M3Y H;  1Y1V H;  5E4W C;  1V43 A;  1KRT A;  4OEL B;  3CU7 A;  2UXB Q;  1BCP B;  1PZJ D;  3H15 A;  4JI5 Q;  4A75 A;  4NXN L;  3K7U C;  4C3I G;  2E2J H;  1RDP D;  1S3O A;  3P7J A;  2EE1 A;  1C7Y A;  1YHA A;  1WCM G;  3CCR A;  1BXT A;  2D0O A;  2Z9H A;  4KKU A;  4EQN A;  1K28 A;  1IBL L;  1JOK A;  4ZAI A;  4DR2 L;  4N9P A;  3S15 B;  1MGS A;  1QOH A;  1SFO B;  1F2Y A;  4ME3 A;  1DJR D;  4R1J A;  2HQL A;  2F0U A;  3T1Y Q;  1E24 A;  1I3Q B;  1CKM A;  4IO9 A;  1GHJ A;  1XTD A;  2OQ0 A;  2XIW A;  3GD7 A;  4JPB W;  3ULJ A;  4HR7 B;  2Z6K A;  1JWM D;  2B3G A;  3VYS A;  3OWF A;  1GUN A;  4R4C A;  4LW1 A;  2PQE A;  4X3U A;  1SYG A;  3KJO A;  4DR7 L;  1OTC A;  3VR3 A;  1BBW A;  2B2Y A;  3HRZ C;  3W2D A;  3QR8 A;  4KHZ A;  1M4V A;  4DR1 L;  4QQB X;  2KEE A;  1H9S A;  1Q7Y C;  1HA5 A;  3SK4 A;  1A8V A;  4F8M A;  3PUY A;  4AQY L;  1Y1V G;  3TRE A;  5M3M G;  2K33 A;  3HOU B;  2K5V A;  2Q8R E;  1STY A;  3D4R A;  1Q8I A;  1N9W A;  3I90 A;  3L7Z C;  4ME5 A;  1A3T A;  4NKL A;  1ASY A;  4RKL A;  2BOS A;  3FP9 A;  3MTS A;  4ID6 A;  4HJ9 A;  3NTI A;  4ZRZ A;  5KND A;  2A69 C;  4UDU C;  3KF6 A;  4WOR A;  1PH1 A;  1CHQ D;  1F9R A;  3ERO A;  1WOC A;  2F0E A;  2QF7 A;  3G48 A;  2JEA I;  2E2D C;  3FEW X;  2B2V A;  1F2Z A;  3K6O A;  1KQS A;  4HSP A;  4KKT A;  3C46 A;  1QVF A;  2VQF L;  1PTO C;  2K04 A;  3I4N G;  1WJJ A;  1LTL A;  5C0X I;  2KCM A;  3S16 H;  2F0O A;  3TP7 A;  2X6L A;  5FLX L;  2PZU A;  2PO4 A;  2A1A A;  1UEB A;  4DAY A;  3W5O A;  4CJ2 C;  3T4A C;  1GUS A;  1EYC A;  1OXU A;  3DM1 A;  4JBM A;  2F3W A;  5DM7 3;  4P2C B;  3HOW B;  4FF4 A;  1TR5 A;  2TMP A;  4J15 A;  4GKJ L;  3M4Y A;  1Z47 A;  3HOV B;  4IOA A;  2CWP A;  3EJI A;  1QUQ A;  4HTH A;  1HCZ A;  1YIT A;  1PZI D;  4TKO B;  2EJF C;  3OWE B;  1U4P A;  5CV6 A;  1J5E L;  1M1K C;  3Q6S A;  4X65 Q;  5IP7 H;  2PNH A;  2VUM H;  4R8N A;  1QG7 A;  4XIG S;  1NSN S;  3TS0 A;  5HGT A;  1VQ6 A;  1EQT A;  2LMC B;  3HOZ H;  3EIV A;  2K1B A;  3CW2 C;  3H91 A;  1C9O A;  4YIJ A;  4ZCK A;  3GO5 A;  2E76 C;  1BBU A;  2D62 A;  5F2D A;  3FKI G;  4M8A A;  4XTC S;  1N32 Q;  5CBA E;  2IWH A;  5C4J B;  3S1N H;  1SE4 A;  3GTJ B;  4JV5 L;  2ZM6 L;  3IAY A;  1RTO A;  1D5Z C;  3BJU A;  4HJ7 A;  2F0W A;  4A3G H;  2JA9 A;  2R61 A;  2R7Z B;  2L11 A;  1L0Y B;  1JB7 A;  3HKZ G;  3HOU H;  4B3M Q;  4A4I A;  5C3E G;  3J80 i;  1PFS A;  2NVT H;  1EY5 A;  4PMC A;  5C44 G;  2XWB B;  2LY7 A;  2K5H A;  3DXJ C;  3VYT A;  3FMC A;  2CWA A;  2EPB A;  3F2B A;  1CZG A;  5COY A;  1EZ8 A;  4XYO A;  2MFI A;  4DR3 Q;  1XMQ L;  3NHH A;  4B3S L;  4APV A;  1AP0 A;  2GA4 B;  5EPK A;  2LXK A;  1EEI D;  1BCP C;  4F87 A;  2HT1 A;  2QDB A;  1S5D D;  4PZ6 A;  2PW7 A;  4DK6 C;  5JOB A;  4LF7 L;  4E6I A;  3OTO Q;  2MP1 A;  4C3H G;  1STN A;  2Z4I A;  1VQO A;  1CFM A;  3IFT A;  5G3L F;  4DV3 L;  4KHP L;  2KCC A;  3R2T A;  1UE7 A;  5DAU A;  2LKV A;  2CQO A;  1E22 A;  4DAM A;  4ZKC B;  3CF5 A;  4DV1 Q;  1KXL A;  2YTY A;  3HEJ A;  4JI1 Q;  4QY7 A;  4ZKB B;  5FO7 B;  3UE1 A;  2K52 A;  2KVM A;  2EXD A;  1TWG H;  4JYA Q;  1NY4 A;  5K36 G;  2M9V A;  4NDX A;  1DYQ A;  4ULL A;  4DR6 L;  3HOX G;  2ES2 A;  1TVX A;  2JEB I;  3FVQ A;  1SSO A;  3H6M A;  2F0T A;  2PNR C;  2RDG A;  2R7D A;  5C0X G;  2FXQ A;  2AWO A;  1I94 Q;  4U67 3;  4GNX B;  3IFD A;  4MNO A;  1G51 A;  1U9R A;  4O0A A;  4Y7N B;  1HNX Q;  4BBR B;  1BCP F;  3G4S A;  4OWX B;  5C3W A;  3E0J A;  3B6Y A;  4TQU S;  3G6E A;  5JEA H;  4TRD A;  4OO1 I;  2A6H D;  3CC4 A;  1KHI A;  3HOY B;  4QUC A;  1LT4 D;  2L15 A;  1SNO A;  2EVB A;  5G3L D;  2OXP A;  1WFQ A;  2FMM A;  5M5X H;  4HCS A;  1HQM C;  4DUZ Q;  1WTR A;  2OT2 A;  1O7L A;  2F0V A;  2QGQ A;  4OON A;  2OTJ A;  1VQ4 A;  4QUF A;  2F0L A;  3H09 A;  3CCM A;  1WTW A;  1EL0 A;  2A69 D;  1SYD A;  2D5D A;  4HIM A;  2L12 A;  4XXE A;  4A93 H;  4B3R Q;  3V96 A;  2JJQ A;  2J4X A;  4A3J G;  5ISR A;  1X3F A;  1U4R A;  4QMG A;  2VUM B;  2EXZ A;  3D3R A;  1MHW C;  3NWS A;  1EQQ A;  4ZUI A;  1JJG A;  2MNA A;  4CHT B;  1QVG A;  1BVS A;  4OXP A;  2F03 A;  4DAP A;  2Q8I B;  2R92 G;  2PYK A;  3DWA A;  2PMZ E;  3SK8 A;  2OF1 A;  2I07 B;  1CKO A;  3X3M A;  4LUV A;  2HUG A;  3UDX A;  1S4Z A;  4YY3 Q;  1CI3 M;  2RSO A;  1H95 A;  4FF3 A;  1XYI A;  1I4X A;  4A3K G;  2A68 C;  1VS0 A;  3F1Z A;  1NAP A;  5M3F G;  2WFW A;  1JC7 A;  1N36 L;  4CGY B;  1CSQ A;  2AQ2 B;  1HZB A;  1PH6 A;  3QWN A;  4GS3 A;  3MZ5 A;  3S2H B;  1PH9 A;  2KHI A;  2VZA A;  3ZYY X;  1AN8 A;  2NVX H;  3HOY G;  2JN4 A;  5IWA Q;  1PTO B;  4QF4 A;  4RA8 A;  3WWV A;  1MJC A;  4DR5 Q;  2YU9 H;  4Y52 H;  5JPM C;  1QNU A;  2RKS A;  3X3N A;  4KHP Q;  2CH4 W;  3A0J A;  3K7A H;  3M9B A;  2ZXP A;  2KBN A;  2KEN A;  1VQ8 A;  4BBS B;  4MTN A;  1EY9 A;  3NK9 A;  3C1F A;  4C3I B;  3KBX A;  4R4O A;  1QZG A;  3OMC A;  1T9H A;  3D8G A;  5BR8 L;  2YTX A;  4CJ1 B;  3ER0 A;  3I2Z A;  2CCZ A;  5IOC A;  4XYQ A;  2F0D A;  1DXM A;  3HOV H;  1VQ9 A;  1EEF D;  1FNU A;  4YWL A;  2WB1 B;  4WFN 3;  2X6G A;  4JI0 Q;  1G8Z D;  1EFW A;  2UXD L;  2JA6 H;  1EWI A;  4PG3 A;  1K9M C;  1T5E A;  3M7N A;  4IPH A;  4DV2 L;  2WP8 J;  2LFN A;  1EY4 A;  1HJP A;  1HR0 L;  4JI5 L;  2R6G A;  3KLR A;  3I56 A;  3K59 A;  2BDN A;  5LMN L;  4NXM Q;  4OX9 Q;  4KI0 A;  1I6H H;  3K5O A;  4IZ8 A;  5I6Y A;  3S14 B;  1FGB D;  1X56 A;  1EU3 A;  5FKA C;  1I4R A;  1SNM A;  4YCV A;  1CUK A;  2R93 H;  3L0O A;  4AIM A;  2DJG C;  2NVQ H;  3NQT A;  3MXG A;  3NTH A;  1D2B A;  1HFG A;  5CV4 A;  2F3V A;  3C3L A;  4HJA A;  4A3B B;  4N8F A;  4B08 A;  2ICI A;  1DOK A;  2EQS A;  5C0X H;  2PI2 A;  1X65 A;  3RD4 A;  3SDZ A;  3TBI B;  2FMC A;  5IT9 c;  4XT3 B;  3DWQ A;  1SYC A;  2NBF A;  4OGQ C;  3BYY B;  3H3V H;  1BKB A;  4QB4 A;  2F0F A;  4LF6 Q;  2A73 B;  1D1K A;  2F3I A;  4JV5 Q;  4JOI C;  2LSS A;  4BY7 B;  1NR2 A;  1QZH A;  3H0G G;  5J39 A;  2R92 H;  3ND8 A;  2NUC A;  4A3I H;  1CK1 A;  3T1H Q;  2QA4 A;  3HOY H;  3BG3 A;  1GUT A;  1RIP A;  4IQZ A;  1MJE A;  2BA1 A;  4N9T A;  4YHH Q;  5M5W B;  2F0K A;  5AJ3 Q;  4C3H H;  1F9Q A;  4A3J H;  2N78 A;  1K8M A;  1WYD A;  3CCU A;  1B50 A;  5I6W A;  1XNQ L;  1TXY A;  2PPB C;  1VQN A;  4X3T A;  3CQZ H;  2IW3 A;  2VW9 A;  4P75 A;  1LUZ A;  1YIJ A;  1ESR A;  4AYB B;  4IUN A;  3Q22 A;  2F52 A;  4JI6 L;  5IGE A;  1A3V A;  3K8A A;  1J6Q A;  4LK1 C;  2WAC A;  2VB2 X;  1SLJ A;  2VQF Q;  3CMA A;  3IRB A;  1PHJ A;  3KF6 B;  1MSG A;  3STB C;  1ESF A;  1FGU A;  2BE5 C;  2I5M X;  4NPS A;  3LGJ A;  2K01 A;  2KA7 A;  3PO2 B;  1TKW B;  5LL6 X;  2OEO A;  3MHB A;  4DNT B;  4PMB A;  4DV0 L;  1TQO A;  4AQY Q;  4C3J B;  1B3Q A;  3PV0 A;  1D8L A;  3J7Z C;  1A15 A;  2F4I A;  1MKH A;  3H0G B;  3MFY A;  2B63 G;  2KOL A;  5GAH C;  3UDI A;  3SGI A;  2Z1C A;  4JI7 Q;  1JR0 D;  3HOZ B;  3NBI A;  1RCV D;  4DAV A;  3MEF A;  1OXS C;  2CH4 A;  3DWP A;  2MQH A;  2Q2H A;  3H0G H;  2HHH Q;  3GTQ H;  1BF4 A;  2N88 A;  4H13 C;  2O4X A;  4DGZ A;  1FNV A;  4K0K Q;  2DNE A;  5C3E B;  3I4L A;  5JEA J;  1A0I A;  3VR5 A;  2XN9 C;  3E9H A;  4K2K A;  4BBR G;  2RVL A;  5IYB G;  1PH8 A;  3M85 A;  2L55 A;  3OMG A;  4Q5V A;  3S1N B;  2MHV A;  1TII D;  3TRZ A;  3HOV G;  1Q1B A;  4DV1 L;  5IGC A;  4FXK C;  4O42 A;  1BCP D;  2N55 A;  2I0Q A;  3J7A F;  2KEC A;  1VQP A;  4LF4 Q;  1HRJ A;  3NXW A;  3ULL A;  1RF2 D;  1QWY A;  2D2C C;  5COR A;  5FLX c;  2V4D A;  2AUK A;  3BVG A;  1KD1 C;  4R8I A;  1K83 B;  5M3F B;  2EDG A;  3FRP B;  3S1Q H;  1XPO A;  1STH A;  1IYU A;  3R93 A;  4A3K B;  2HQE A;  3OSO A;  1VQI A;  2BDO A;  4UY8 C;  4ZLT F;  4JC0 A;  3IKJ A;  2ZXO A;  2PZW A;  4QGU A;  3SR1 A;  1K8A C;  1YNN D;  1XPR A;  5KRU A;  3N6R A;  4J1M A;  4JI2 L;  2WAQ E;  4JCV E;  2WKC A;  5L37 A;  5M5W H;  2NZ1 D;  1CZW A;  3DEO A;  2JA6 G;  3NUC A;  1D1I A;  4JI7 L;  3PUV A;  1IBL Q;  3AMU A;  5C4J H;  2B63 B;  1IXR A;  1E7Z A;  2IHE A;  2E74 C;  3GTO B;  1Q12 A;  1I6H B;  3FHW A;  1NE3 A;  1DOM A;  1P16 A;  1KLG D;  2YV5 A;  4FXD A;  1I6V C;  2KQ3 A;  2VB3 X;  3GTQ B;  3RZD H;  1U0L A;  2L5T A;  5C0X J;  4CDF C;  2AHO B;  2E5L L;  3NWT A;  1PH5 A;  4EGV A;  2HHH L;  3BDL A;  5A2Q L;  4DV6 L;  1B44 D;  1B1Z A;  1SBB B;  5FO9 B;  1TWG B;  4KD4 A;  4L8J A;  4KKS A;  3VA5 A;  3HFZ B;  1SYE A;  3VA7 A;  3RZO B;  2DNC A;  4K5V A;  2B2U A;  1EYD A;  3GV3 A;  4OWT B;  2EJM A;  3GTK B;  4KK7 A;  5CMD A;  3CRK C;  2R93 B;  5DM6 3;  2JA7 B;  1AEX A;  4JI6 Q;  3TS2 A;  3MXN B;  2WIN B;  1S5E D;  5CV7 A;  4KN7 C;  4L5S A;  4KY7 A;  3P20 A;  4UHV A;  1YVC A;  1CA5 A;  3OHX C;  1O7I A;  4CKC A;  1QIL A;  4A3F H;  4NB3 A;  1GVP A;  2DY8 A;  3PSI A;  1KIX A;  1VMP A;  5C44 B;  3R8B A;  2K14 A;  5KNB A;  4X62 Q;  1L0X B;  5CBE E;  1N33 Q;  4LAA A;  1WCM H;  4P71 A;  4WRD A;  3DEP A;  4LF5 Q;  3RR5 A;  2A68 D;  1SN8 A;  2Z4H A;  5IYB H;  4P74 A;  2AKW B;  1X6O A;  5HY6 A;  2FJ2 A;  4DV4 Q;  1XMO L;  5IYD G;  2R7Z H;  2ZTC A;  5FJ8 G;  3ONA B;  4IJH A;  4A3G B;  1D5X C;  4KV6 A;  1CKN B;  4U68 A;  1KLU D;  1LLR D;  1LO5 D;  3J7A 5;  5AJ3 L;  1X9N A;  3EFX D;  1VQ5 A;  2F0N A;  4V0B A;  4DK1 A;  2LXJ A;  3TZU A;  5JJL A;  3AB9 A;  2SEB D;  4L5R C;  3EA6 A;  4BY7 G;  4BY7 H;  2NWG A;  2E2I H;  2R3Z A;  3W3A A;  4RWS C;  2CQA A;  5C6A A;  2JA5 B;  3TZD A;  1HQR D;  2Y0S E;  3I4N B;  1KDA A;  1W6K A;  3DHQ A;  1WTV A;  4IAL A;  2R7F A;  4Y7N H;  3NEM A;  4CBV A;  1W6J A;  2ICE C;  4LWC A;  1EIF A;  4DV6 Q;  2ZJQ A;  4DV3 Q;  2QEJ C;  2SDF A;  2NYZ D;  4A3J B;  3ZJY C;  3I7F A;  2RHQ B;  1LTR D;  3I4O A;  1I3Q H;  1Z6H A;  2K03 A;  3RZD B;  2C9O A;  3HKZ B;  5IGF A;  1P8L A;  4F7X A;  3MEH A;  5JJI A;  3PIO 3;  5M5X B;  4BWG B;  1TS2 A;  3SK5 A;  2R92 B;  1YJN A;  5IGD A;  4IUT A;  2EY2 A;  3HS0 C;  2Q2I A;  1JB3 A;  1SNC A;  1LTB D;  2A74 C;  1YHQ A;  4O2D A;  4WJW A;  5ELN A;  1TT2 A;  4X66 L;  1JIC A;  1FNW A;  4A3D B;  3GTP B;  2B2W C;  5I2Y A;  5IYC G;  5EBD A;  2WV6 D;  4NW2 A;  1SND A;  4MHE A;  2F1M A;  1Q8K A;  4A3B H;  3T13 A;  3J7Y W;  4A93 B;  1G29 1;  5AFW A;  5JVH 3;  4C3J G;  5J3B A;  4A3I G;  2ZM6 Q;  1SDF A;  4DR5 L;  1Y8P B;  2EYL A;  1PTO F;  1EZ6 A;  3I4M G;  1O80 A;  3BVZ A;  1FJG Q;  1N32 L;  3URY A;  4R4T A;  3HOX B;  4ODG A;  1V1P B;  5HGQ A;  5BN5 A;  4GNX A;  5EPL A;  4WJ4 A;  1LT6 D;  4UP7 A;  1LT5 D;  5C3E H;  1R9T B;  3UDG A;  4ILW A;  2ZTD A;  4KMU C;  4K6L A;  1V9P A;  3RLF A;  4HJ8 A;  1V1P A;  2N3S A;  2IY5 B;  1SNP A;  1I4Q A;  1H9S B;  1VQD A;  1MI2 A;  2E2I B;  4FXG C;  5BN4 A;  3G71 A;  3HZX A;  3C1E A;  4IUP A;  2WB1 G;  4BY1 H;  2VXW A;  1HA6 A;  1IYJ B;  4DV0 Q;  3S14 H;  4BBS H;  4A3F G;  5JJZ A;  3AEV A;  2NN6 G;  3VR6 A;  1B7Y B;  1VQL A;  2EYO A;  4OO1 H;  1M8A A;  3UE0 A;  1VQB A;  1XXG A;  4DXF A;  1ICW A;  2NB0 A;  3DUZ A;  4C2M H;  2NTS A;  1KDC A;  1WTP A;  2VY3 A;  1JE5 A;  4RH6 A;  5IYD H;  1BQQ T;  4DFA A;  2JQO A;  4A76 A;  1IW7 D;  3RZO H;  1F2L A;  1FD7 D;  3VR2 A;  1YI2 A;  4GOP C;  2ID0 A;  3K80 C;  1TWH B;  1PYB A;  3F2C A;  2JP1 A;  1YEZ A;  1HPC A;  1I4P A;  1VQA A;  3I72 A;  2XGT A;  1II3 A;  4GLA C;  2IHF A;  3ND9 A;  4OL7 A;  4X3S A;  3AYH B;  2K28 A;  3HOU G;  4RCN A;  1B4O A;  4OWW B;  3S2D H;  4IPG A;  3R2I A;  3P75 A;  1R9T H;  3QJY A;  3Q0A A;  2BH2 A;  1TWC H;  2N49 A;  1KDB A;  2L0C A;  1EY6 A;  5IY0 A;  3CHB D;  3T53 B;  4CJ0 B;  3K58 A;  3KYH C;  2JE6 I;  1CM9 A;  2B63 H;  1IYV A;  1SJE D;  4JVZ A;  3KJP A;  4KN4 C;  3CCL A;  2J0T D;  4HED A;  3OIP A;  3QOL A;  4LF6 L;  1PDQ A;  4RGM A;  4BXX G;  1SNQ A;  2A6E C;  3BZC A;  1Y14 B;  4DA2 A;  1PYW D;  3JC6 6;  3CD6 A;  2FIN B;  1N34 Q;  3ERS X;  3SXH A;  1PRT D;  1K3B C;  3MXP A;  2F4V Q;  4A3K H;  1XJV A;  1XWE A;  1WTQ A;  1EWH A;  5GAD C;  1PH7 A;  4ZQ3 A;  3KFU A;  1JE4 A;  2B2W A;  2H1E A;  4HIO A;  4JYA L;  1HH2 P;  5I9O A;  5EJW A;  1I50 H;  2JXM B;  4DV5 Q;  5C4X H;  2J7Z A;  1W3S A;  2IT1 A;  5D3D A;  3ICE A;  2B2T C;  2EY6 A;  3U4Z A;  4IUQ A;  2AQ1 B;  5CR3 A;  4FNF A;  4NXN Q;  1IBM L;  2ATW A;  4X64 Q;  4Q0F A;  1HR0 Q;  2KED A;  2BH8 A;  4JOI A;  1G2S A;  4EQO A;  4GN3 B;  3H94 A;  1B53 A;  4OIK A;  3RNU A;  1Z7T A;  1CQV A;  1FJG L;  1HZ9 A;  2JA6 B;  1E2V A;  3FKI B;  1VDZ A;  1YBY A;  3BU2 A;  1KNA A;  4R9W A;  1WD0 A;  3CCV A;  1F2M A;  4DR3 L;  1XMQ Q;  1GUO A;  1SR3 A;  5JEA G;  1NUC A;  3LWE A;  2A5H A;  1VQH A;  2NN6 I;  4DNI A;  3S1R B;  2JYO A;  4HID A;  1HTP A;  3QIA A;  3F2D A;  1IW7 C;  4IUV A;  3OOC A;  5IT9 L;  1JOQ A;  2DN8 A;  3AFP A;  1OXV A;  4K0K L;  4C3I H;  3NPP A;  5M3M B;  4RGO S;  3KF8 A;  1XNR Q;  2KHJ A;  1QB5 D;  1U5K A;  1SMY D;  3RN2 A;  1TWF H;  1VCI A;  3KK7 A;  2Q2U A;  3BDO A;  4GLX A;  4HSV A;  1BOS A;  5KYI A;  5GQO A;  3TP5 A;  5IWA L;  4GOP A;  4YCW A;  1Y1W H;  2KJX A;  2BA0 A;  1CTM A;  5K5P A;  3PO3 B;  2XVS A;  5IP9 G;  1KAW A;  2NVT B;  1B2T A;  4CDD C;  3BZD B;  1HR0 W;  3Q8D A;  1YJ9 A;  1CKN A;  2BCO A;  1K3R A;  4C2M B;  5EKK A;  1NTG A;  3P1H A;  1STB A;  3S2H H;  4CDE C;  1DGS A;  1DZ1 A;  3KF8 B;  1X3Q A;  4X65 L;  4C3H B;  4UP9 A;  1HZA A;  1ET9 A;  4A3L H;  1GO3 E;  1NBW A;  1TWA B;  1F9P A;  1WTH A;  3U9S A;  5J1Z A;  4JBJ A;  2UUC Q;  2UUC L;  5M5Y H;  1QNK A;  2EOT A;  1PFM A;  1Q1E A;  2B2Y C;  2MPM A;  3EVQ A;  4A3C G;  3DLL A;  4DNR B;  3PO2 G;  1EY0 A;  2B39 A;  3J80 E;  4DV7 L;  3RN5 A;  4DAY B;  4A3G G;  3I3C A;  4FP5 D;  2KUM A;  4KD3 A;  5IE8 A;  4IFD G;  1EYA A;  1VQJ A;  5C4Z A;  1HZC A;  4IFD J;  3AFQ A;  5ELE A;  1ZXT A;  4I65 A;  2IX3 A;  1S40 A;  1MBY A;  4QL5 A;  3IL8 A;  3E3X A;  5ELD A;  3A55 A;  1D5M C;  3GTO H;  4H02 A;  5HUR A;  3A8J E;  1AFP A;  4X62 L;  4M1U B;  4RAU C;  1Q82 C;  1CSP A;  2JA5 G;  2VS1 A;  3LNN A;  4V19 0;  3S2D B;  3M7G A;  2JA7 G;  2WAQ G;  2NZH A;  4FO2 A;  5ELO A;  1PA6 A;  3M4Q A;  3MXU A;  1V8Q A;  2QIL A;  4MIU A;  5I4D A;  1N8R C;  3S17 H;  1G91 A;  5M3F H;  1RD9 D;  1Q81 C;  1VF7 A;  4K8J A;  1PMR A;  1H9M A;  1S72 A;  2GVA A;  4YHH L;  3H3V I;  3A8I E;  1A2T A;  2RSN A;  3QOJ A;  2CW0 D;  4DR2 Q;  4AYB E;  1GUW A;  1B9M A;  2I46 A;  1WCM B;  2K7V A;  1B70 B;  1LTI D;  2CFM A;  2OWO A;  1G2T A;  2EYJ A;  1T5X D;  1X3E A;  4XDX A;  3TEH B;  2R93 G;  4ALP A;  2O5I C;  1VQC A;  3MAQ A;  1NCV A;  1EYG A;  2B2V C;  1X3G A;  2EZV A;  3HKS A;  4OIJ A;  1J9O A;  3CXC A;  3I73 A;  4H44 C;  4KJN A;  3JAM i;  3ULP A;  3VDY A;  4BS9 A;  1YNJ D;  2MO1 A;  4DV2 Q;  3QB3 A;  1SFO H;  4LF7 Q;  5ELC A;  3OW2 A;  2QEX A;  3S9W A;  1JOO A;  1ILP A;  1S5F D;  1KL9 A;  1ILQ A;  1PTO H;  1PH2 A;  2ENB A;  4POG A;  2K32 A;  2K75 A;  2JA5 H;  4HJ5 A;  2NVX B;  4ZYS A;  4MN3 A;  4EQ5 A;  4HMJ A;  1IKM A;  5J22 A;  1SRO A;  1ROD A;  4JI2 Q;  4GN4 B;  2HD3 A;  5LL6 S;  5KGU A;  3M4O H;  5KNC A;  2HDM A;  1C8C A;  4RKB A;  2QCP X;  1SE3 A;  3HG9 A;  1JJ2 A;  5LMN Q;  1YJW A;  1QJO A;  3D6W A;  1C48 A;  3Q23 A;  3OW7 A;  2I5H A;  3T16 A;  3HOX H;  3PCO B;  1STE A;  1G6P A;  5EKL A;  3WDN A;  4LF4 L;  1EY8 A;  1VMC A;  2UXD Q;  5C4X G;  4FVM A;  4AH6 A;  1CT1 D;  4KTA A;  2YU9 B;  2IJ0 A;  1EIG A;  1V1Q A;  1X55 A;  2IL8 A;  1ICF B;  3GTG B;  4S3S A;  1L0W A;  5T1I A;  2B8F A;  4HMI A;  1WVL A;  3NSW A;  1RL2 A;  4WJ3 M;  4RGN A;  1SMY C;  4A3M G;  2NZO A;  4FF1 A;  1VQ7 A;  2FFK B;  5CV5 A;  2GN5 A;  5GAG C;  4HAE A;  4A3M H;  5CV9 A;  3J81 j;  3GTG H;  3K0Y A;  3TP8 A;  4PNY A;  1EWC A;  2RCN A;  2PI2 E;  1EQR A;  2TSS A;  3L9A X;  1GHK A;  3S15 H;  4GN5 A;  4NP5 A;  4QIW E;  2F0Q A; 
#chains in the Genus database with same CATH homology
 4O2D A;  5ELN A;  2QGQ A;  3NBH B;  4OON A;  3A5U A;  2OTJ A;  4IPC A;  1VQ4 A;  4X66 L;  3CCM A;  4NXM L;  4OX9 L;  1NMG A;  4A93 H;  4HIM A;  5LMN W;  5IYC G;  4B3R Q;  4BA2 I;  2JJQ A;  4A3J G;  4YCU A;  2CKZ B;  1X3F A;  1Q8K A;  2UUB L;  4A3B H;  2D0P A;  1C0A A;  2YTV A;  4MZ9 A;  4DV7 Q;  2E8G A;  1EQQ A;  1G29 1;  5DLQ E;  2K4K A;  1B8A A;  2MNA A;  1JJG A;  4P73 A;  1QVG A;  1BVS A;  4OXP A;  5J3B A;  2ZM6 Q;  4A3I G;  2DGY A;  4DR5 L;  1ASZ A;  2R92 G;  1IZ6 A;  2PMZ E;  3KDF A;  2ZJQ A;  3I4M G;  1CKO A;  1PH4 A;  1FJG Q;  3CME A;  1N32 L;  1UE5 A;  4LUV A;  3UDX A;  4YY3 Q;  1UE1 A;  4R4T A;  4JI3 L;  3PIP A;  1H95 A;  2UXB L;  5HGQ A;  1HNW Q;  4BA1 I;  4GNX A;  4A3K G;  4WJ4 A;  1VS0 A;  1UE6 A;  1AE2 A;  4A3D G;  3F1Z A;  2VQE Q;  3CCJ A;  4OO1 G;  4LFC Q;  4KLK A;  4UP7 A;  4DKA C;  5M3F G;  4X64 L;  1I94 L;  2WFW A;  5C3E H;  4GNX C;  1N36 L;  5IP7 G;  4BBS G;  1CSQ A;  3UDG A;  2ZTD A;  3NEN A;  5GRO A;  1HZB A;  1PH6 A;  1V9P A;  4GS3 A;  3RLF A;  4AYB G;  4HJ8 A;  3HOW G;  1PH9 A;  2JA7 H;  2KHI A;  2VZA A;  2N3S A;  1HNW L;  3GTL H;  4DR6 Q;  1K83 H;  3PO3 H;  4UPA A;  2IY5 B;  2GVB A;  2NVX H;  4IJL A;  1VQD A;  5LMU L;  4DUY Q;  3HOY G;  3S1M H;  3D0F A;  5IWA Q;  4YWK A;  3CPW A;  3WWV A;  3G71 A;  2B29 A;  1MJC A;  4DR5 Q;  2YU9 H;  4Y52 H;  2AMC B;  2WB1 G;  4DUY L;  4BY1 H;  5FLM G;  1PV4 A;  1K73 C;  1E1O A;  4GKK Q;  2JA8 H;  4KHP Q;  1IYJ B;  4DV0 Q;  3S14 H;  3GTM H;  4A3F G;  4BBS H;  3A0J A;  2NN6 G;  3AEV A;  1B7Y B;  1AE3 A;  1VQL A;  3K7A H;  3M9B A;  3PF5 A;  1I5F A;  3T1Y L;  1AH9 A;  1D7Q A;  2KBN A;  2KEN A;  3UE0 A;  1VQB A;  1VQ8 A;  2IX1 A;  3GTJ H;  4DR4 L;  2MO0 A;  4MTN A;  4LFC L;  4LNQ A;  2VQE L;  4B3T Q;  1Q46 A;  4C2M H;  5E7N A;  2OQK A;  5H1S E;  1EIY B;  2WB1 E;  3A5Z B;  2VL6 A;  2YYZ A;  2VY3 A;  1JE5 A;  1QZG A;  4R4O A;  4BXX H;  4YY3 L;  2UXC L;  5IYD H;  1T9H A;  1GM5 A;  1QUQ B;  3FKI H;  4IOC A;  5BR8 L;  2YTX A;  4LFB Q;  3ER0 A;  3I2Z A;  2JQO A;  4JI1 L;  4A76 A;  3STB D;  2CCZ A;  3RZO H;  3HOV H;  1VQ9 A;  3HOZ G;  4YWL A;  1YI2 A;  4GOP C;  2ID0 A;  3K80 C;  4QJF A;  1EFW A;  4JI0 Q;  1PYB A;  3F2C A;  2UXD L;  1A62 A;  1YEZ A;  1VQA A;  1EWI A;  3U50 C;  2JA6 H;  4PG3 A;  1K9M C;  2XGT A;  4GLA C;  4RMF A;  3M7N A;  4IPH A;  4DV2 L;  2WP8 J;  4B3M L;  2IHF A;  1XNQ Q;  3GTP H;  1HR0 L;  1HJP A;  3A74 A;  4JI5 L;  2R6G A;  2Z6K C;  3AYH B;  4IPD A;  3I56 A;  3S24 A;  3OTO L;  4R4I A;  1EOV A;  5GAE C;  2Y0S G;  3HOU G;  3D31 A;  4OWW B;  4IPG A;  3S2D H;  1R9T H;  5LMN L;  3E9I A;  4X66 Q;  1E1T A;  4NXM Q;  4KI0 A;  4OX9 Q;  1SMX A;  1I6H H;  4LUO A;  2BH2 A;  1TWC H;  2H5X A;  2N49 A;  1X56 A;  5IP9 H;  3T1H L;  5IY0 A;  4YCV A;  4DUZ L;  4A3C H;  3KYH C;  4DR1 Q;  2UUA Q;  1VQM A;  1CUK A;  3JAM c;  2JE6 I;  3L0O A;  4AIM A;  2B63 H;  2R93 H;  3CC2 A;  1LM0 A;  1YNX A;  3KJP A;  2NVQ H;  3CCL A;  4JI8 L;  2E2H H;  3RLN A;  2OTL A;  2IX0 A;  1SE8 A;  1L1O B;  1M90 C;  4LF6 L;  4HJA A;  3HOW H;  4BXX G;  3AQQ A;  2I5L X;  2ZTE A;  3J80 c;  3BZC A;  1Y14 B;  3CP0 A;  4LUZ A;  3JC6 6;  3PIO A;  3CD6 A;  1KC8 C;  2EQS A;  4JG2 A;  2PI2 A;  1N34 Q;  3ERS X;  4A3E H;  1X65 A;  3PUZ A;  4GLV B;  1N34 L;  5IT9 c;  4A3K H;  2F4V Q;  4LFA Q;  1XJV A;  4L5T A;  1XNR L;  3H3V H;  5IYC H;  1VQG A;  1BKB A;  4HIK A;  4A93 G;  4LF8 L;  4PZ8 A;  3W1G A;  4LF6 Q;  2VUM G;  1PVO A;  3F8T A;  3BZK A;  2F3I A;  3K81 C;  4UP8 A;  5GAD C;  4DV4 L;  1J5E Q;  3J81 i;  4JOI C;  3I4N H;  4JI8 Q;  2LSS A;  1PH7 A;  3KFU A;  1QZH A;  2RHS B;  2Q2T A;  5FLM H;  3H0G G;  4HIO A;  4JYA L;  4B3S Q;  1HH2 P;  3RLO A;  1L1O A;  2R92 H;  4IFD I;  3CCE A;  4LF5 L;  4A3I H;  1I50 H;  3T1H Q;  4DV5 Q;  4JBK A;  5C4X H;  2QA4 A;  1FL0 A;  1W3S A;  2IT1 A;  4TVA B;  5LMU Q;  1VQK A;  2VNU D;  1K8G A;  1N33 L;  1Y1W G;  3KDF B;  3ICE A;  4JBW A;  3HOY H;  3U4Z A;  4GKJ Q;  1RIP A;  2OCE A;  4BBR H;  4A3B G;  1MJE A;  2BA1 A;  4YHH Q;  5AJ3 Q;  4C3H H;  2XTI A;  3EBE A;  4A3J H;  4NXN Q;  3UDF A;  3CC7 A;  1TWA H;  2K5N A;  1IBM L;  2N78 A;  2ATW A;  1WYD A;  2A19 A;  4X64 Q;  3CCU A;  1HR0 Q;  2R7Z G;  1XNQ L;  1TXY A;  2BH8 A;  4JOI A;  1K0R A;  1VQE A;  5M3M H;  1VQN A;  3CQZ H;  5EAY A;  2VW9 A;  1Y1V H;  1LUZ A;  1MIU A;  4P75 A;  1V43 A;  1YIJ A;  1TWH H;  3M3Y H;  1KRT A;  4GN3 B;  2UXB Q;  3H15 A;  4JI5 Q;  4A75 A;  2F52 A;  3RNU A;  1XMO Q;  4JI6 L;  4NXN L;  3K7U C;  2E2J H;  1XPU A;  4FDB A;  1OXT A;  1S3O A;  3K8A A;  1FJG L;  1J6Q A;  1HZ9 A;  1C7Y A;  1SLJ A;  2VQF Q;  1YHA A;  1WCM G;  1YBY A;  3BU2 A;  3CMA A;  3IRB A;  3CCV A;  4DR3 L;  1XMQ Q;  1PHJ A;  1SR3 A;  3I4M H;  3GDE A;  5JEA G;  3CCR A;  3KF6 B;  2D0O A;  1IBL L;  1VQH A;  2NN6 I;  4DNI A;  4DR2 L;  2DUD A;  4HID A;  4ME3 A;  4R1J A;  3F2D A;  2HQL A;  3STB C;  4DR4 Q;  1FGU A;  1LYL A;  1IBK L;  1HNZ Q;  3AFP A;  1OXV A;  2I5M X;  4NPS A;  4K0K L;  4C3I H;  3LGJ A;  3T1Y Q;  3NEL A;  3PUW A;  4LF8 Q;  4B3R L;  1E24 A;  1CKM A;  4IO9 A;  2PQA A;  1XTD A;  2OQ0 A;  1XNR Q;  2KHJ A;  3GD7 A;  4DV0 L;  4R4Q A;  3ULJ A;  5FJ8 H;  4AQY Q;  1U5K A;  2Z6K A;  3RN2 A;  1TWF H;  3PV0 A;  2B3G A;  1VCI A;  2Q2U A;  1D8L A;  2AWN A;  3J7Z C;  4R4C A;  2EIF A;  4LW1 A;  4GLX A;  3KJO A;  1MKH A;  5GQO A;  1OTC A;  5IWA L;  4LF9 L;  4DR7 L;  4GOP A;  2B63 G;  1BBW A;  1A63 A;  5GAH C;  4YCW A;  3S1R H;  3CCS A;  1Y1W H;  3UDI A;  3SGI A;  2BA0 A;  4JI7 Q;  5IP9 G;  4EX5 A;  2N8N A;  4KHZ A;  4DR1 L;  1KAW A;  3MEF A;  2UUA L;  1OXS C;  4QQB X;  2UU9 Q;  1HR0 W;  2MQH A;  3Q8D A;  1Q7Y C;  5C44 H;  2Q2H A;  3H0G H;  1A8V A;  2HIV A;  1CKN A;  1YJ9 A;  1HNX L;  1IL2 A;  3U58 A;  3PUY A;  2HHH Q;  4AQY L;  1K3R A;  1Y1V G;  3GTQ H;  3TRE A;  5M3M G;  1NTG A;  2K5V A;  2E5L Q;  1N9W A;  3L7Z C;  3S2H H;  1ASY A;  1DGS A;  3FP9 A;  4HJ9 A;  2PQA B;  3KF8 B;  4K0K Q;  3OYY A;  4X65 L;  5JEA J;  1A0I A;  4UP9 A;  1HZA A;  3E9H A;  4A3L H;  4BBR G;  1GO3 E;  1NBW A;  4A3E G;  5IYB G;  3KF6 A;  1PH1 A;  1PH8 A;  1JT8 A;  3M85 A;  1WOC A;  3TRZ A;  3HOV G;  1Q1B A;  3G48 A;  1Q86 C;  4DV1 L;  4JBJ A;  4JI0 L;  2JEA I;  1KQS A;  1PYS B;  2I0Q A;  2UUC L;  5M5Y H;  2UUC Q;  1QVF A;  2VQF L;  4GOP B;  1VQP A;  3I4N G;  1Q1E A;  1WJJ A;  4LF4 Q;  2A8V A;  4LFB L;  3ULL A;  5BR8 Q;  1KD1 C;  5FLX c;  1LTL A;  4A3C G;  5C0X I;  2KCM A;  3DLL A;  2UUB Q;  3S16 H;  4PMW A;  3PO2 G;  1X54 A;  1GKH A;  1UEB A;  2A1A A;  3S1Q H;  3I55 A;  1XPO A;  3W5O A;  4DV7 L;  3RN5 A;  4DAY B;  4A3G G;  1VQI A;  1OXU A;  4UY8 C;  2ZJP A;  4JC0 A;  5IE8 A;  4JBM A;  4IFD G;  3K0X A;  3CCQ A;  1VQJ A;  4QGU A;  1K8A C;  1HZC A;  4IFD J;  3AFQ A;  1XPR A;  4JI2 L;  3CAM A;  2WAQ E;  4JCV E;  5M5W H;  2KCT A;  4J15 A;  2UU9 L;  4GKJ L;  1S40 A;  4QL5 A;  1UWV A;  1Z47 A;  2JA6 G;  4IOA A;  4JI7 L;  3PUV A;  2CWP A;  1IBL Q;  1QUQ A;  5C4J H;  3GTO H;  1Z9F A;  4H02 A;  4X62 L;  1IXR A;  1YIT A;  1E7Z A;  1Q82 C;  1CSP A;  2IHE A;  3W1B A;  2JA5 G;  4PZ7 A;  1NMF A;  2ASB A;  2VS1 A;  4P72 A;  3PO3 G;  1J5E L;  1Q12 A;  2JA7 G;  1M1K C;  2WAQ G;  2NZH A;  3FHW A;  1NE3 A;  5ELO A;  1PA6 A;  4X65 Q;  3M4Q A;  1P16 A;  2HIX A;  2YV5 A;  5IP7 H;  1N8R C;  2PNH A;  3S17 H;  2VUM H;  2F4V L;  3RZD H;  1U0L A;  5C0X J;  5M3F H;  2AHO B;  2NVY H;  4XIG S;  3TS0 A;  2E5L L;  1N36 Q;  1PH5 A;  1IBM Q;  1Q81 C;  2HHH L;  1IBK Q;  1HNZ L;  1VQ6 A;  4DV6 L;  1QVC A;  1S72 A;  2GVA A;  4YHH L;  3H3V I;  3HFZ B;  1EUJ A;  1NJI C;  3HOZ H;  3EIV A;  3CW2 C;  3PUX A;  4DR2 Q;  4OWT B;  3CPF A;  1C9O A;  3TQY A;  4JI3 Q;  3GO5 A;  4AYB E;  4DV5 L;  1BBU A;  2D62 A;  4BY1 G;  3FKI G;  3HKZ E;  4XTC S;  4POF A;  1N32 Q;  1GD7 A;  1W2B A;  4LF9 Q;  3L2P A;  1E3P A;  1B70 B;  2OWO A;  2CFM A;  1X3E A;  4L5Q A;  3TEH B;  3S1N H;  2R93 G;  5JJK A;  1VQF A;  4DPG A;  1L1O C;  4ALP A;  1VQC A;  4JI6 Q;  3TS2 A;  2ZM6 L;  4JV5 L;  3MXN B;  1EYG A;  3BJU A;  4HJ7 A;  4A3G H;  1X3G A;  3HKS A;  2JA9 A;  3CXC A;  4L5S A;  1YVC A;  3ULP A;  3JAM i;  3VDY A;  1O7I A;  2MO1 A;  1JB7 A;  3HKZ G;  4JI4 Q;  3HOU H;  4DV2 Q;  4B3M Q;  1SFO H;  4A3F H;  4NB3 A;  1GVP A;  4A4I A;  3J80 i;  1PFS A;  5C3E G;  3PSI A;  4LF7 Q;  1KIX A;  2NVT H;  3OW2 A;  2QEX A;  1KL9 A;  1JJC B;  5C44 G;  2K14 A;  2K5H A;  3PGZ A;  4X62 Q;  1PH2 A;  2RF4 A;  1N33 Q;  4POG A;  2Z0S A;  1WCM H;  3KOJ A;  2K75 A;  2JA5 H;  2CWA A;  3F2B A;  4HJ5 A;  4P71 A;  4LF5 Q;  4X6A H;  3RR5 A;  4DR3 Q;  2MFI A;  1XMQ L;  4EQ5 A;  1SN8 A;  4B3S L;  4APV A;  5IYB H;  4P74 A;  2AKW B;  4A3L G;  1SRO A;  4JI2 Q;  4GN4 B;  3M4O H;  4DK3 C;  1X6O A;  2LXK A;  5HY6 A;  3J81 c;  4DV4 Q;  1XMO L;  5IYD G;  3DM3 A;  4JI4 L;  1SRU A;  2HT1 A;  1JJ2 A;  2R7Z H;  2ZTC A;  5LMN Q;  4C3J H;  4PZ6 A;  1YJW A;  4DK6 C;  5FJ8 G;  4LFA L;  4IJH A;  4LF7 L;  3PF4 A;  1YZ6 A;  3OTO Q;  1CKN B;  1YHB A;  3M4P A;  2I5H A;  1VQO A;  2C35 B;  1FVI A;  3HOX H;  3PCO B;  4DV3 L;  1G6P A;  3J7A 5;  1WI5 A;  5AJ3 L;  1X9N A;  1VQ5 A;  4LF4 L;  3KLW A;  3PO2 H;  4KHP L;  2UXD Q;  5C4X G;  1UE7 A;  2LXJ A;  2CQO A;  1E22 A;  4AH6 A;  4DAM A;  3CF5 A;  5JJL A;  2JA8 G;  1JMC A;  4L5R C;  4BY7 G;  4DV1 Q;  1KXL A;  2YTY A;  1V1Q A;  4BY7 H;  4JI1 Q;  4QY7 A;  1X55 A;  3UE1 A;  2K52 A;  4RG1 A;  2EXD A;  1TWG H;  2E2I H;  4JYA Q;  1NY4 A;  5K36 G;  2Y0S E;  1L0W A;  4DR6 L;  3HOX G;  1L2F A;  2ES2 A;  2R7F A;  1RL2 A;  4Y7N H;  2JEB I;  1KRS A;  3NEM A;  2ZJR A;  4B3T L;  4WJ3 M;  1EIF A;  1OXX K;  2R7D A;  2V1C C;  2NZO A;  4LWC A;  5C0X G;  2FXQ A;  2AWO A;  4DV3 Q;  4DV6 Q;  4A3M G;  1I94 Q;  1VQ7 A;  4GNX B;  3ZJY C;  1G51 A;  3I7F A;  2RHQ B;  4MNO A;  4O0A A;  3I4O A;  1HNX Q;  1I3Q H;  2JK8 A;  2K50 A;  2GN5 A;  5GAG C;  3G4S A;  4OWX B;  1PH3 A;  4JV5 Q;  2ALY B;  4A3M H;  1P8L A;  4GKK L;  3J81 j;  3B6Y A;  4TQU S;  3G6E A;  4A3D H;  3GTG H;  4OO1 I;  3EN2 A;  3CC4 A;  1KHI A;  5JJI A;  3E0E A;  2RCN A;  2PI2 E;  2L15 A;  4YWM A;  1EQR A;  1YJN A;  3GTK H;  3S15 H;  4DR7 Q;  4GN5 A;  1WFQ A;  2Q2I A;  4QIW E;  3U4V A;  5M5X H;  2UXC Q;  4DUZ Q;  1YHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...