4HIKA

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggttacggt)
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
138
structure length
138
Chain Sequence
SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
molecule keywords Protection of telomeres protein 1
total genus 34
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hikA00
4JI4L 1I3QH 1K73C 4PZ7A 4GNXA 1X54A 4OX9Q 3CMAA 5M3MH 1C9OA 1N36Q 3BZKA 1WYDA 3RN2A 1PH7A 3TEHB 3E9IA 3RLFA 4A3MH 1S3OA 2R92G 5H1SE 1B8AA 3S24A 1KL9A 2FXQA 5IT9c 1HNWQ 1E1TA 2UUAL 4LF8L 2R7ZG 1SLJA 1UE1A 3KF6A 2E5LL 2UUBL 4LF4Q 4LF7L 2UXCL 1IBMQ 3CCSA 3UE0A 1HNZL 2GVAA 1KQSA 3M4QA 4A3DG 5IP7H 1Q86C 1BVSA 1A8VA 1B7YB 1BBWA 1QUQB 4L5SA 2NN6G 2VNUD 1I5FA 1D7QA 4LF9L 1CKMA 1YEZA 2WFWA 3CCQA 1GM5A 4BY7G 4GKKQ 1UE5A 1VQ8A 1G291 3PUWA 4GKJL 3RLNA 1CKNB 3NENA 1PH2A 3HOYH 4KHZA 4A3JH 4LF8Q 1YZ6A 4A3GH 1V43A 4LF5Q 4JI0L 4DR6Q 4HJ7A 1GO3E 3F8TA 3PUVA 4HIOA 2OWOA 4NXNQ 2EQSA 3S14H 3KF6B 4PZ6A 3CCMA 4DUYQ 2N78A 4BA1I 3NELA 1HNXL 4GN5A 1QVFA 3HOWG 1S40A 4P74A 1JB7A 4P72A 4AH6A 4DV0Q 4AQYQ 4AQYL 4BY1G 5AJ3Q 1ASYA 4LUVA 3D0FA 1IXRA 1PH1A 3CD6A 4JBKA 1I6HH 4GNXB 4IOCA 2D62A 1KAWA 4GNXC 1VQNA 5IYBG 3JAMc 3PCOB 3EN2A 1N8RC 5M3FG 3CCUA 4BA2I 1PH6A 1VQKA 2MO1A 1HZ9A 4QGUA 4LNQA 5M5XH 4GLAC 4DAMA 4GOPA 4RG1A 3K7AH 4LFCL 2F4VL 2JEBI 3TS0A 4B3TQ 5IYDH 2CKZB 3CP0A 3TREA 2RCNA 5C0XI 4IOAA 2V1CC 4C3JH 2MQHA 3GTKH 4YWLA 1IBML 2IHFA 4X64Q 1VQ5A 3PIOA 3PO3H 1SROA 4AYBG 2VL6A 2CCZA 4IFDJ 1DGSA 1X6OA 4IPGA 3CCRA 3GD7A 1YJ9A 1WOCA 2XGTA 4B3SL 2QA4A 1FJGL 2YTXA 3G48A 2VZAA 1M90C 3KDFA 3J81c 3J81i 2AWNA 2OCEA 1KXLA 4L5TA 2B29A 4RMFA 2KBNA 1Q81C 4A3FH 1V1QA 2HIVA 2UXCQ 4HIKA 4GN4B 1Q82C 1VQMA 1P8LA 4A3EG 3CAMA 3A5ZB 4Y7NH 1TWGH 4H02A 5IYBH 4WJ4A 2YU9H 4NXML 4NXMQ 1Q12A 1B70B 4QIWE 1FGUA 4APVA 1KHIA 2JA8G 4DPGA 1N32Q 4HJ5A 1SFOH 2ZTDA 3PSIA 3M3YH 5JJIA 2JA9A 2R6GA 1OXXK 1TXYA 1WJJA 2L15A 3S1QH 4KHPL 3KOJA 3KJOA 1EWIA 4JI8L 3L2PA 1CUKA 3PV0A 4DV1L 2CWAA 1N33Q 4C3IH 4TQUS 1IL2A 1HZCA 1W2BA 1EQRA 4A3BH 4X66Q 1L1OB 1VCIA 4UPAA 2ZM6L 3T1HL 1NMFA 5GAGC 2R7DA 4X62Q 1A63A 4OWXB 4IFDI 2HIXA 1N33L 1YIJA 2OQKA 3GTOH 3HOYG 2Z6KA 5C4JH 2PQAA 1UE7A 1JJCB 1RIPA 3RLOA 1XMQQ 3GTPH 1PH8A 1LUZA 3ER0A 2JE6I 1KIXA 2JA5H 4DKAC 3EBEA 5FLXc 1K9MC 4POFA 1YJNA 1PVOA 3GTQH 3AFQA 2DUDA 2VS1A 2WAQE 1XNQL 1O7IA 3OTOL 3ERSX 1X3FA 3Q8DA 4DK3C 5IYDG 4DV7L 3MXNB 1PYBA 2KHJA 4MNOA 3EIVA 4A3FG 1XPOA 1K3RA 1N34Q 2JA6H 1BBUA 3I55A 3UDGA 1IBLL 1GKHA 5HGQA 1M1KC 2D0OA 4R4TA 1Q46A 4JYAL 4K0KL 5BR8L 5BR8Q 1L1OA 3HKSA 1TWHH 1ASZA 4IFDG 2UXBL 1HZBA 2VY3A 4DR4L 2KCTA 2LSSA 3DLLA 4DR2Q 1XMQL 3OYYA 5M3MG 5DLQE 4HJ9A 1WFQA 1FJGQ 4NXNL 1JT8A 2ZJQA 5IWAQ 1OXUA 2RHQB 3W1GA 3CPFA 2PQAB 5IE8A 3CC2A 4JI7L 2R7FA 4A4IA 4JI3Q 4JG2A 4LFAQ 3ULJA 4GLVB 3G6EA 3HOWH 3CCLA 1NBWA 3AFPA 4J15A 1XNRQ 1PA6A 4DV6L 4LF6Q 4HIMA 1KC8C 1YHBA 1Y1WG 1PYSB 4A3CG 1NJIC 1VQHA 3STBC 4A3IH 1QZHA 4IJHA 3GTMH 3H0GH 1HJPA 1W3SA 2VQEQ 3FKIG 4DR7Q 3H3VI 2PNHA 2JA7H 1NTGA 1XNRL 3ZJYC 4DR5Q 2QEXA 2UUAQ 1BKBA 3MEFA 3H15A 1EOVA 4YWKA 3CQZH 3K8AA 4IPDA 2Q2IA 4L5QA 3K7UC 4OWTB 3CC4A 1N36L 5IY0A 2VUMG 1I94Q 4BBRH 3S15H 4DUYL 4A93H 1YVCA 4JOIC 3HOXG 1YHQA 4A3DH 1CKOA 1VQOA 1J5EQ 2OTJA 4JI4Q 4MTNA 1XTDA 2PMZE 2R7ZH 1OXSC 4KHPQ 2IT1A 1GVPA 2BA1A 3PIPA 4MZ9A 3G71A 5C0XJ 2C35B 3AYHB 3J7ZC 1VQPA 2I0QA 2VUMH 4ME3A 3KDFB 2E2IH 1X3GA 1VQBA 1SE8A 2KENA 3I2ZA 5FLMG 4DR3L 1XMOL 1VS0A 1JJGA 4ALPA 4UP9A 4O2DA 1N9WA 2WB1E 1R9TH 1I50H 4PG3A 2F52A 1MKHA 3T1YQ 1KD1C 2YYZA 1CSQA 3CCEA 3GTJH 3I4NG 1RL2A 5LMUL 2ALYB 4B3ML 1EYGA 2EIFA 4B3RQ 3BZCA 4B3RL 4A3LH 1JJ2A 1HNZQ 5C3EH 4OO1G 3PUZA 3UDXA 2MFIA 1KRTA 2B3GA 2K75A 2YV5A 4P75A 4XIGS 1L0WA 1Q1BA 4DV4L 2B63H 3ICEA 1PH5A 4A93G 5M5WH 2I5MX 2N8NA 5ELOA 4DUZQ 4DV2L 4FDBA 1PH3A 3M9BA 4BBSG 4DV0L 1Q7YC 1XPUA 4HJ8A 1QUQA 4R4QA 1EIFA 1HNXQ 1OXVA 2ID0A 1X55A 3CCVA 2AKWB 1VQ9A 2BA0A 2DGYA 2JA7G 4BBSH 2UXBQ 2RF4A 1CSPA 4UP8A 1Q1EA 3S2DH 4X6AH 1VQIA 3ULPA 4A3IG 4DV5L 3ULLA 4WJ3M 4R1JA 4A75A 3F2CA 3PGZA 2KCMA 1PH4A 1Y1WH 2PI2E 1LM0A 3F2BA 4LUZA 4IPCA 3I4MH 1XNQQ 3HFZB 4QQBX 2K4KA 3UDFA 2YTVA 1PV4A 4JI5Q 3I4NH 3HOXH 4OWWB 1HR0L 4YY3L 4JOIA 1HH2P 1QVCA 4OO1I 3NBHB 1VQ4A 1E3PA 4YHHL 3LGJA 1K8AC 1L1OC 1EUJA 3AQQA 4POGA 4DV6Q 1Y1VH 3J80i 3W5OA 1T9HA 5JJKA 1VQ7A 4GKKL 3PUXA 2GN5A 3FKIH 3UDIA 2A19A 3H0GG 4QL5A 2E8GA 3K81C 4LFCQ 2F4VQ 3HKZE 1S72A 2UXDQ 3TS2A 1WCMG 4A3BG 1EIYB 4YCVA 3RNUA 4BXXH 4BBRG 1J5EL 4IO9A 4OX9L 5JJLA 2F3IA 3HOVH 2Y0SE 2Y0SG 3UE1A 2JA5G 1I94L 2IX1A 2E5LQ 2UUBQ 3I4OA 4P73A 2K5VA 4LW1A 4XTCS 3VDYA 1HR0W 5IYCG 1VQLA 3J80c 1TWAH 2LXKA 4DUZL 4NPSA 3GDEA 3K0XA 4JCVE 3GTLH 3IRBA 4JV5L 3AEVA 4NB3A 4DV4Q 2HT1A 1G51A 1E7ZA 4GN3B 2AMCB 4DR1L 3PF4A 3HOZH 3BJUA 1TWFH 2VQFQ 4DR6L 4C2MH 4YCWA 1EQQA 3HOUH 4DNIA 3PF5A 4OXPA 3U4VA 2I5LX 3S1MH 1YBYA 3CF5A 1JMCA 5K36G 3T1HQ 2E2HH 3BU2A 1UEBA 4DK6C 3NEMA 4DR3Q 4EQ5A 1XMOQ 4GKJQ 4JC0A 1X56A 4DV1Q 5E7NA 2BH2A 3S1NH 3KYHC 4OONA 1VQAA 4LF9Q 4X66L 2AWOA 4LFBQ 1MIUA 2Q2HA 1IBKL 3JC66 2H5XA 4DV5Q 1VQGA 1SRUA 5LMUQ 2Q2TA 2Q2UA 2WB1G 4P71A 2Z6KC 1SR3A 3HOUG 2BH8A 1PFSA 1YNXA 5LMNQ 2JA6G 2HHHQ 2Z0SA 1G6PA 1X9NA 5JEAJ 3STBD 5M3FH 1WI5A 3L0OA 1N34L 1Q8KA 3OTOQ 3CC7A 1HNWL 3RN5A 5FJ8G 3U58A 3A5UA 2HHHL 1XJVA 1K83H 3KLWA 3KJPA 1YHAA 1E22A 4IPHA 2MO0A 4QY7A 4DV3Q 1PH9A 4BY1H 3S1RH 3PO2H 3E9HA 5IYCH 2CWPA 3RZDH 3PO2G 5LMNL 2LXJA 2VQEL 3DM3A 1A62A 1OXTA 4DR7L 3CMEA 4TVAB 4LFBL 4KLKA 5C4XH 5IP9H 1VQDA 4GOPC 1UE6A 4KI0A 2ZJRA 1VQCA 4BXXG 2MNAA 5HY6A 4L5RC 3S16H 3I56A 3FP9A 4A3EH 4JI2Q 4JI2L 1FVIA 3U4ZA 4JBJA 3L7ZC 4A3GG 5IP9G 4R4IA 4HJAA 2NN6I 3OW2A 1EFWA 3KFUA 5C4XG 1L2FA 3PUYA 2K52A 1NE3A 4JI7Q 3J7A5 1Y1VG 1D8LA 3KF8B 1K8GA 5J3BA 4R4CA 3W1BA 2NVXH 3HKZG 4B3MQ 4UY8C 2CQOA 4BY7H 1K0RA 2ZJPA 1AE3A 1U0LA 3CXCA 1LTLA 2JA8H 1AE2A 1X3EA 5M5YH 1XPRA 1HR0Q 5FJ8H 5C0XG 1IZ6A 1OTCA 2NVQH 4JV5Q 4JI5L 4PZ8A 2EXDA 4JBWA 4DAYB 2OTLA 2JK8A 5GQOA 3U50C 4JI3L 3S17H 4C3HH 3CW2C 3M85A 1SMXA 1JE5A 1YI2A 1U5KA 3K80C 4AYBE 4A3JG 3HOZG 2GVBA 4DR4Q 3TQYA 2PI2A 2R92H 1YJWA 3H3VH 5EAYA 3CPWA 2UXDL 2RHSB 3A0JA 1QZGA 1C0AA 4JBMA 3D31A 3JAMi 2I5HA 3SGIA 1SN8A 4LF5L 3PO3G 2NVTH 4GS3A 4UP7A 2N49A 1YITA 1LYLA 2JJQA 2UUCL 1TWCH 4LF6L 1VQFA 4DV2Q 1MJCA 4Y52H 4X62L 4JI1L 5C44G 2ZM6Q 1NY4A 2JQOA 2KHIA 4LFAL 2UUCQ 1J6QA 2E2JH 3GTGH 1E24A 1P16A 2IHEA 2ZTCA 4YHHQ 4GLXA 1VQEA 4LUOA 2NZOA 4LF7Q 2R93G 1KRSA 3T1YL 2K5HA 4JYAQ 4K0KQ 2HQLA 3TRZA 2NVYH 4JI1Q 5GAHC 3I7FA 3RZOH 5AJ3L 1V9PA 2VW9A 4DV3L 2ZTEA 4GOPB 5LMNW 2ES2A 1PHJA 1Z9FA 1A0IA 5FLMH 5IWAL 4DV7Q 4JI6Q 3HOVG 3S2HH 3RR5A 4HIDA 5ELNA 4DR2L 5IP7G 2K14A 2B63G 2WAQG 2JEAI 1VQJA 2K5NA 2N3SA 1WCMH 3E0EA 2CFMA 4IJLA 3J81j 5GAEC 4A76A 4LWCA 5C3EG 1IBLQ 1X65A 4YWMA 3G4SA 1E1OA 4A3KH 4JI0Q 1FL0A 1IBKQ 1VQ6A 2ATWA 3WWVA 2A8VA 4X65Q 2UU9Q 3M4OH 1NMGA 2QGQA 4JI6L 3M4PA 1Z47A 2ASBA 4EX5A 4X64L 2AHOB 1QVGA 3F1ZA 4DR5L 1CKNA 4YCUA 1C7YA 4AIMA 1UWVA 2YTYA 1IYJB 1Y14B 4O0AA 4YY3Q 3F2DA 2VQFL 4B3SQ 3CCJA 2R93H 4A3KG 5JEAG 4DR1Q 3I4MG 2NZHA 3A74A 4LF4L 2OQ0A 1AH9A 2WP8J 1H95A 2XTIA 4A3MG 5GROA 4A3CH 2IX0A 3FHWA 1GD7A 4X65L 5GADC 4PMWA 2UU9L 1N32L 2IY5B 4QJFA 3M7NA 4R4OA 4A3LG 1MJEA 5C44H 4B3TL 4JI8Q 2D0PA 2K50A 3B6YA 2A1AA 3GO5A 1HZAA
chains in the Genus database with same CATH superfamily
4MTKA 4JI4L 2EYHA 1K73C 1STEA 1X54A 4GNXA 1DONA 4TRDA 1IYVA 3BZKA 4ILWA 1HPCA 1SYGA 2L4NA 3E9IA 4K2KA 4CHTB 1S3OA 1B8AA 3S24A 1KL9A 1E1TA 4KKUA 1UE1A 4C3JB 4LF4Q 4LF7L 2UXCL 5ELEA 1C4QA 5A2QE 4B08A 1D7QA 2VNUD 1I5FA 4LF9L 1HTPA 4IN3A 2KHSA 1U9RA 1G291 3PUWA 4GKJL 1XWEA 3HOYH 1SE2A 5ISRA 1G91A 1K3BC 3IKJA 4C3HG 3PUVA 3TP8A 4XYOA 1KDCA 3KF6B 2DY7A 2PCFB 3MC0B 3CCMA 2WAQB 2SNSA 5JOBA 1KNAA 4DK1A 1BF4A 1ZYRD 4AQYL 2BDOA 3AB9A 4CDFC 2XRSD 4LUVA 3D0FA 1IXRA 4MN3A 3TZDA 2FINB 3QJYA 3TSSA 1MBYA 4GNXC 2F0OA 1VQNA 1F9RA 3EN2A 3HOUB 1HZ9A 4WORA 2N55A 2A73B 2JN4A 4RG1A 2JEBI 5D65A 4B3TQ 3ERQA 1PTOF 4C3JH 3GTKH 3BDOA 4YWLA 1IBML 3PIOA 3PO3H 4OIKA 1LT5D 2VL6A 1SYEA 1DGSA 3CCRA 2BE5D 3M7GA 2XGTA 2YTXA 2SNMA 2VZAA 1ILPA 1TS4A 1M90C 1I6HB 3J81c 5FKAC 1HTLD 2MGSA 4CKEA 1KXLA 4L5TA 1BCPB 2F0HA 4PMCA 2UXCQ 1P8LA 1EEID 3BVMA 2B8GA 3CAMA 5M5XB 4S3SA 3N52A 4RAUC 2F0PA 3I8ZA 3URYA 4APVA 1N32Q 4IUNA 2B2YC 2ENBA 1SFOH 1TVXA 1O80A 2ZTDA 3BYTB 3M3YH 5E1FA 1SNOA 5KGUA 2R6GA 1OXXK 4KHPL 5CYUA 2MUYA 3KJOA 1EWIA 3LX0A 1CUKA 1G6ZA 1Y1VB 3X3MA 1KAAA 4KY7A 5IOCA 2B8FA 2ZM6L 2XSCA 1NMFA 4R8IA 5C3XA 3NE5B 2HIXA 4O42A 4EQPA 5D3IB 2F3VA 2JP1A 1K8OA 4RGMA 1LTID 3RLOA 2KCCA 1EYAA 1LUZA 2JE6I 4O1NA 4DKAC 3VR2A 1EEFD 5FO8B 1YJNA 4IUVA 3AFQA 4C3JG 1EFID 1XNQL 4DK3C 2KHJA 1XPOA 4A3FG 3UDGA 1Q46A 2F03A 3H91A 5BR8Q 1L1OA 2CQAA 3HKSA 4HEDA 4F87A 3D4RA 2M9VA 2KCTA 3J81L 3DLLA 1LTBD 4DR2Q 4UAIA 4HJ9A 1PRTF 4DR4L 4RGOS 5IWAQ 3W1GA 3CPFA 4RHRA 1HXYD 5C5MA 1FNUA 2LFNA 4JI7L 4JG2A 2HD3A 3K58A 4A3MB 3AFPA 5IGEA 4I7AA 1TS2A 2Z4HA 1PYSB 4A3CG 5KYLA 3DMUA 3K57A 1Q8IA 3MXPA 2AQ1B 1QZHA 3VYUA 1V1PB 1WTHA 3GTMH 3A7LA 3OMGA 1DOKA 1W3SA 1GUGA 1Y8NB 3NK9A 3H3VI 2PNHA 4UDUC 4DR5Q 3H15A 3SK8A 2M2LA 2Q2IA 1DOLA 4L5QA 4QCLA 5CBEE 1N36L 5IY0A 2VUMG 1RTOA 4DUYL 2MJ8A 4HAEA 4A93H 5C3EB 3HOXG 4A3DH 1J5EQ 1STGA 4MTNA 2K5DA 2PMZE 3BS1A 1OXSC 2EY2A 2EYJA 2A6HD 1GVPA 5K5PA 1R4QB 3FDTA 3VR5A 1PZKD 2VUMH 3KBXA 4U673 2E2IH 5C5LA 4ALPA 1TWHB 5C4HA 1MKHA 2ZXPA 3KLSA 1CSQA 1RCVD 3HZXA 2ALYB 4XXEA 1ENCA 4B3RQ 1JJ2A 4JK1C 2MFIA 5IGGA 2B3GA 3P1HA 4P75A 4DV4L 2XWJB 4X3UA 4A93G 3L3OC 1PRTC 4DV2L 1JWUD 1PH3A 4F8MA 4DV0L 4LJZC 1Q7YC 1XPUA 1Z6HA 1ET6A 2DGYA 1CSPA 1SXTA 4OHJA 4UP8A 4TSSA 3NSWA 1EY0A 3BVGA 4A75A 3PGZA 4M1UB 1Y1WH 2PI2E 1LM0A 4IPCA 2K4KA 2DN8A 3UDFA 3R2TA 1KLUD 3I4NH 1HR0L 3G6JB 4YY3L 4H13C 1EIGA 1SNMA 1GUTA 2RKSA 1V1OA 1L1OC 4A3GB 1Q90A 3DEPA 3S2DB 3PUXA 3FKIH 4QL5A 2E8GA 4X3TA 3BZDB 4FF4A 1F2ZA 3RNUA 3U9OA 1DXMA 3TZUA 4BXXH 3EQLC 1J5EL 5JJLA 4HMJA 4QF4A 5CV6A 3UE1A 2E5LQ 3HOXB 2KOLA 3I4OA 1TS3A 2K5VA 4P73A 1VQLA 2PZWA 5IYCG 3J80c 1D2BA 1TS5A 1S5BD 2LXKA 3AEVA 4NB3A 5KIXA 1EYDA 3KUPA 1ICWA 4GN3B 2AMCB 3HOZH 2WB1B 2F0SA 3HOUH 2ZXRA 3PF5A 3PMFA 3U4VA 1SE3A 1PTOB 5IGDA 1DCZA 4AYBB 1EZ8A 3T1HQ 1CHPD 3BU2A 1IKLA 4DR3Q 4EQ5A 1EY8A 1XMOQ 1KTKA 3TP5A 3S1NH 2E75C 1VQAA 5EKIA 2H5XA 5LMUQ 4NDXA 2Q2UA 4PQXA 3OIPA 1SR3A 3QB3A 5C4ZA 5LMNQ 2JA6G 1G6PA 4WFN3 4KTAA 1WI5A 3L0OA 5JPNC 1J8IA 4A3FB 2G5DA 1PMRA 3A5UA 1XJVA 5DM73 1K83H 3KLWA 4DV3Q 1YHAA 4IPHA 5EJWA 1ICFB 4LMQD 1MGSA 3S1RH 1VF7A 4BY1H 3D6CA 2CWPA 3RZDH 2LXJA 3CMEA 4M8AA 3AMUA 1CT1D 5LL6X 5G3LD 4OGQC 3BDLA 3FP9A 2A6HC 2QDBA 3U4ZA 3Q23A 2R61A 1EFWA 3BVZA 1SEBD 2FHTA 4JI7Q 1Y1VG 2IPKD 1D8LA 1ESRA 3KF8B 2NVXH 1AW7A 1D6EC 1AE3A 3CXCA 2KQ3A 2NWGA 3J80E 4V190 5M5YH 1UAPA 4PZ8A 4DAYB 4JBWA 2D9UA 2M00A 3RD4A 3VA7A 3U50C 4C3HH 1YI2A 3PIP3 3NTHA 1BXTA 1LT3D 4AYBE 3HOZG 2I07B 3TQYA 2R92H 2F0EA 4RCOA 1PYWD 2PQEA 2EYMA 4LF5L 2I5HA 3SGIA 1SN8A 2NVTH 2N49A 2JJQA 2A5HA 4RH6A 1TWCH 1VQFA 1MJCA 1A3VA 1EQVA 2R3ZA 3T51B 2KHIA 2J0TD 3CHBD 2UUCQ 3NQIA 1J6QA 2E2JH 2FJ2A 1P16A 4GLXA 3NWTA 2R93G 1VF5C 1STBA 4GOPB 5IWAL 1TIID 4N9PA 4DV7Q 4JI6Q 4YIJA 1GHKA 5ELNA 5IP7G 2PNRC 2B63G 2WAQG 1VQJA 3J81j 2CFMA 3KBGA 4U68A 5GAEC 1RD9D 1D1KA 1W6KA 1X65A 4YWMA 4A3KH 3HOVB 2IX3A 2A8VA 2QGQA 2EXZA 2AHOB 5C4JB 4DGZA 3F1ZA 4DR5L 1IHZA 3VYSA 4ZYSA 4O0AA 2K28A 4B3SQ 4LF4L 4G7OC 2FMMA 4EVOA 5GROA 4ULLA 2A69C 2O5IC 4R4OA 5COYA 4JI8Q 3I70A 1HZAA 1EWHA 3CRLC 4OX9Q 1C9OA 1F9PA 3I91A 2WKCA 3TEHB 1PH7A 4DAVA 2E2DC 1HNWQ 1MD2D 3ITPA 1I4RA 3KF6A 2VXWA 1B3AA 2E5LL 4FXDA 1IBMQ 1PFNA 2GVAA 4FF1A 4A3DG 3TDQA 4A3KB 1YNJD 1A8VA 1QNKA 2Z8LA 2HUGA 1H9JA 4N8X1 3SEBA 2J4XA 1CKMA 5IGFA 1YEZA 4GKKQ 3RLNA 3K59A 1PH2A 2L9HA 4A3GH 1PFBA 2RDGA 1ESFA 4HJ7A 1GO3E 3F8TA 3TP6A 2CHBD 2QF7A 4V0BA 4K8JA 4PZ6A 4H0LC 4DUYQ 2KEEA 2N78A 2F0IA 3A55A 1QVFA 1S40A 1NNXA 1JB7A 4P72A 5CGKA 2X6GA 1U4MA 4CGYB 2D62A 3R93A 3C2PA 2VB3X 5I9PA 1N8RC 5M3FG 1PH6A 2MO1A 4QGUA 1LTRD 4XYQA 1EY6A 1I6VC 2B2UC 2RCNA 5C0XI 4IOAA 4X64Q 1VQ5A 1SROA 3FMCA 1BUVT 2CCZA 4IPGA 4B3SL 1CM9A 5CMDA 3KDFA 3J81i 2AWNA 4A3FH 4HIKA 1Q82C 2XWBB 1VQMA 4A3EG 2PMZB 1IKMA 1TWGH 5IYBH 3J81E 4NXML 2EVBA 3RZDB 2JA8G 2JA9A 1T5XD 1TY0A 1BNZA 4A3BH 5J22A 1L1OB 1JOQA 4BY7B 2EYFA 3H09A 1U4LA 3QG1A 3GTOH 4G4KA 1ET9A 1PTOC 1UE7A 3GTPH 3ER0A 1KIXA 4RKBA 4OIJA 3EBEA 5FLXc 1K9MC 2BE5C 3A8KE 2VS1A 3X3NA 1HUMA 1K8MA 2WAQE 2R7ZB 3D8GA 3ERSX 3Q8DA 3W2DA 2G9DA 1N34Q 3GTLB 1PYBA 2G9HD 4MNOA 2JA6H 2XNAC 2EE1A 2R92B 4QMGA 1A3TA 3I55A 1IBLL 4ZKBB 4ZLTF 4R4TA 2JA7B 1QCBD 2BCOA 2UXBL 2Z9HA 3GV3A 1HZBA 3E3XA 2OT2A 5M3MG 1TU2B 1WFQA 4NXNL 1JT8A 1IW7D 2RHQB 3CC2A 5IE8A 4A4IA 1EQTA 4J15A 1XNRQ 1ILQA 4CJ1B 3WDNA 4A3IH 1QG7A 2VQEQ 4XQJA 2WV6D 3HRZC 3QWNA 1JOOA 3P20A 2OF1A 1IW7C 3MEFA 1EOVA 1R9TB 4YWKA 3CQZH 3QO2A 4OWTB 1AZPA 1I94Q 3P75A 3GTPB 1YHQA 1CKOA 1YNND 2LS01 1X32A 4KD3A 1QNUA 2BA1A 3NWSA 3NUCA 1QJOA 1PDQA 3EA6A 1VQPA 3OWFA 2I0QA 1KLGD 3KF8A 1X3GA 1VQBA 2KENA 3T16A 3CKIB 1VS0A 3OW7A 3PQIA 1EU4A 4FYDA 1KQSA 4PG3A 2GA4B 3T1YQ 3CCEA 3GTJH 3I4NG 1RL2A 1EYGA 3BZCA 4A3LH 3M4YA 1LTTD 3Q0AA 4A3DB 1KRTA 2K75A 4IUUA 1FR3A 3ICEA 2B63H 1WVLA 2ZT9C 2I5MX 5ELOA 3GTKB 2PZTA 5EPLA 4BBSG 1QUQA 3GTMB 1EIFA 1GHJA 1OXVA 3CCVA 2E2IB 4KJNA 3L9AX 2JA7G 4BBSH 2UXBQ 1I50B 2JSOA 3ULLA 4WJ3M 3QR8A 5ELBA 3F2CA 2KCMA 3H6MA 5I2YA 3I4MH 1H9KA 4QQBX 2WKDA 2YTVA 1PV4A 4JI5Q 1T5EA 1K0SA 1SJHD 1QVCA 3ZYYX 3NBHB 3RZOB 1TWAB 1K8AC 1B1ZA 1J9OA 1O7ZA 3VR3A 1EUJA 2F0QA 3AQQA 2KCNA 3W5OA 1CI3M 3KLSX 5JJKA 2GN5A 2A19A 1CQVA 1UNSA 2O2LD 3Q6SA 3K81C 1S5DD 2UXDQ 3SE0A 3MTSA 2EY1A 4OX9L 4C56C 2Y0SE 2JA5G 2RA4A 3M4OB 2IX1A 4XTCS 5BN5A 5JAVA 4DUZL 4NPSA 4A3EB 4JCVE 3K0XA 4JV5L 1QILA 1MI2A 1SMYC 1B9MA 1E7ZA 1Y8OB 4QUFA 2O4XA 4L63B 1TWFH 2VQFQ 4C2MH 4DNIA 2I5LX 1YBYA 2RVLA 3T4AC 1UEBA 3NEMA 4GZYC 3QOJA 4GKJQ 4DV1Q 3GQBA 3KYHC 3J7YW 1Q3LA 3S17B 1LV9A 4X66L 2F0FA 1MIUA 2Q2HA 4G7ZC 4N9TA 4RGTA 1ZKOA 4DU9A 4C1NK 2F0JA 1YNXA 2K6AA 1B3QA 2K04A 1HA6A 3HOZB 3STBD 1VMCA 4BWGB 1YNNC 1Q8KA 1DZ1A 4X3SA 3S1MB 1PH9A 1E2ZA 1SYCA 1NR2A 2Y0SB 5IYCH 1ZEQX 3PO2G 3DM3A 5J39A 4LFBL 1WD0A 1VQDA 1FNWA 1UE6A 2MNAA 5HY6A 4L5RC 4XT3B 1Y8PB 4JI2L 1FVIA 2DY8A 4JBJA 5KEEA 5C4XG 3OW2A 4HCEA 3PUYA 2K52A 1NE3A 5I4DA 5J3BA 4IUPA 1S4ZA 4BY7H 1XYIA 3GTQB 2ZJPA 1LTLA 1I4PA 2JA8H 4JV5Q 5C0XG 1IZ6A 3ND8A 2A6ED 2K33A 5GQOA 1PTOD 3S17H 2OEOA 2F0UA 3HS0C 3IL8A 5FLXE 3K80C 3JAME 3K0YA 4DR4Q 5HGTA 2JA6B 2PI2A 1YJWA 3H3VH 3DWQA 3K7AB 4ME5A 2RHSB 3RUZA 3D31A 3JAMi 3PO3G 1FD7D 5CR3A 3HEJA 1YITA 4ZKCB 2UUCL 2J7ZA 4CJ2C 3U9SA 1EU3A 4DV2Q 4Y52H 2RSNA 2ZM6Q 4FF3A 3R2IA 1XX8A 4LFAL 2IHEA 2ZTCA 1SBBB 4C1NI 3NBIA 3GP7A 3CQZB 3T1YL 2QW7A 2NVYH 4JI1Q 4DK0A 1NUCA 5AJ3L 1SFOB 1CZGA 4MIUA 3HOVG 3S2HH 4HIDA 4DR2L 1STYA 1WCMH 1CQFA 3PIO3 4LWCA 1BO0A 3SK6A 1IBLQ 3I4LA 5FOBB 4JI0Q 3LWEA 4X65Q 3C46A 4CDEC 3M4PA 1Z47A 1LLRD 4DNRB 3VA5A 3EFXD 1G2TA 1PXUA 2YTYA 1IYJB 1ENAA 3F2DA 3A54A 5JEAG 1ENFA 1QE6A 3A74A 3GTJB 5CV4A 4I7ZC 1TR5A 4A3CH 1N32L 4X65L 4PMWA 3O13A 2EZVA 4QJFA 5T1GA 3M7NA 3S9WA 1MJEA 1D1IA 3JAML 3FVQA 3B6YA 1E0BA 1SNQA 1JE4A 4KHPQ 4Z9CB 2Z6BA 1I3QH 1XXGA 4Q5VA 3CMAA 5M3MH 1JWSD 1WYDA 3RLFA 5IT9c 2UUAL 1SLJA 2E74C 4WJWA 2F0MA 1JOKA 5KRUA 3UE0A 1HNZL 4NKLA 1Q86C 2B39A 1B7YB 2KVMA 5F2DA 1B9NA 1BBWA 1QUQB 4L5SA 2NN6G 1HQMC 2TMPA 1GM5A 2MHVA 1CKNB 3TP7A 2EYOA 4A3JH 2NTTA 1FNVA 1WTXA 1AN8A 4LF5Q 4JI0L 4K6LA 1I4HA 4HIOA 3G7LA 2OWOA 3F2UA 2CW0C 5D3DA 1EY5A 3MAQA 2RDHA 3NELA 1SYDA 4F88A 4P74A 2VUMB 4AH6A 4DV0Q 4AQYQ 4QIWB 1SJED 3HG9A 4ZUJA 4C3IB 5AJ3Q 2LKVA 1PH1A 3CD6A 1B44D 1I6HH 1YNJC 2KECA 4IOCA 5IYBG 3JAMc 4BA2I 1VQKA 4GLAC 4XT1B 4GOPA 2L12A 5I6WA 3DWAA 1GUSA 3TS0A 2XN9C 3C1FA 5EPJA 3CP0A 1K28A 4IURA 4C2MB 4ZQ3A 2IHFA 1S5FD 3GV6A 1Y69U 2Q8TA 4AYBG 4IFDJ 1X6OA 3GD7A 1YJ9A 1WOCA 4ZRZA 3NXWA 4DNTB 2F0DA 1CFMA 5CORA 5ELDA 1D5ZC 1CHQD 2B29A 4RMFA 5M9OA 1Q81C 2HIVA 3K5OA 4GN4B 4ABNA 4ZK9B 4A3JB 4Y7NH 4C3IG 4H02A 5EGTA 4J1MA 2YU9H 4RFBA 5FK9C 4QIWE 2HCIA 4RWSC 1WTOA 3OHXC 5JJIA 1STAA 2PW7A 2F0WA 1TXYA 3S1QH 4JI8L 4E6IA 1AFPA 2ICEC 3PV0A 2RSOA 4TQUS 4H7BA 1HZCA 2A74C 1EQRA 1VCIA 4UPAA 3T1HL 1EWCA 4OWXB 4IFDI 1N33L 1YIJA 5BN3A 3HOYG 1A6XA 3OIQA 5C4JH 1RIPA 1GUNA 2B2WC 5LHY1 2JA5H 4POFA 2F4IA 3GTQH 2PO4A 4N8FA 5IYDG 1X3FA 5E3FA 1VQ8A 1B53A 1BCPD 3EIVA 3VR4A 4CDCC 1K3RA 1NCVA 1BCPF 2K05A 1STNA 1GKHA 1M1KC 2D0OA 2FMCA 4JYAL 5BR8L 1ASZA 4IFDG 3SDZA 2LSSA 3GTOB 3OYYA 1FJGQ 2B2TC 3OMCA 3A8JE 2B2WA 2ZJQA 1STHA 4CKBA 2YU9B 2PQAB 4JI3Q 3HOWH 3G6EA 3ULJA 4A93B 1NBWA 4KKSA 2F1MA 1HUNA 3C3LA 3GTGB 1PA6A 4DV6L 4LF6Q 1RHPA 3BYYB 3FEWX 1NJIC 3MXNA 4IJHA 2XVSA 2EYLA 2EDGA 1HJPA 4XDXA 4DR7Q 3FKIG 2JA7H 5I2XA 2F0NA 1NTGA 2QEXA 1UEAB 1JORA 3K8AA 1HHVA 2NN6H 3MEHA 4HSVA 1WTVA 3K7UC 3CC4A 3DXJC 4FNFA 4JOIC 3S2HB 1LTGD 3NPPA 1CZWA 1AEXA 2R7ZH 1DM0B 3PIPA 1DD2A 3G71A 3EVQA 2NBFA 2C35B 3AYHB 2PPBC 3KDFB 5CV9A 1SE8A 5FLMG 1ML0D 1U4PA 1E2WA 1HRJA 4O2DA 1N9WA 3UI2A 4DA2A 2YYZA 1L0XB 2Z4IA 3KLRA 4B3ML 4B3RL 2F3WA 1HNZQ 5C3EH 3K6OA 4OO1G 3VYRA 3QOLA 4FP5D 1M8AA 1PLFA 2MP1A 3OSOA 4XIGS 1L0WA 1JC7A 1PH5A 1H9SB 2N8NA 2D2CC 1PFMA 3PO3B 1LT6D 4HJ8A 4R4QA 1HNXQ 4ZAIA 1X55A 1CA5A 2AKWB 3HP3A 1PZID 2RF4A 3S2DH 4FF2A 4IFDH 4DV5L 4R1JA 2NUCA 3N6RA 2CH4A 2P5ZX 4LUZA 1TWGB 2DNEA 5JEAH 1XNQQ 2E2JB 3HOXH 2TSSA 3M3YB 4IUQA 1VQ4A 4EQOA 4YHHL 1SAPA 4ID6A 1E2VA 4POGA 4DV6Q 1Y1VH 3J80i 1TQOA 3UDIA 1HFGA 1EZ6A 1PRTD 2WIIB 4LFCQ 2F4VQ 1S72A 1EIYB 4YCVA 5HURA 3PO2B 5DM63 2BDNA 3HOVH 2Y0SG 1I94L 4HN7A 4J8QA 4R9WA 2UUBQ 1LT4D 1HR0W 1TWAH 2PZUA 3S16B 3GDEA 3GTLH 3FPPA 2HT1A 1G51A 2QDLA 5I6YA 3FKIB 3BJUA 2K01A 4HCSA 2KJXA 4YCWA 3H3VC 2HQEA 4OXPA 3Q22A 3CF5A 5K36G 1K83B 2E2HH 4DK6C 5C44B 3DM1A 2BH2A 1HFNA 4OONA 4LF9Q 4LFBQ 1IBKL 2RDFA 5IGBA 4DV5Q 1SRUA 4P71A 2Z6KC 4DAYA 3BG3A 2CH4W 2F0VA 3VR6A 3HOUG 2XIWA 2KA7A 2Q8IB 2Z0SA 2DJFC 5LL6S 3OTOQ 3CC7A 2FFKB 3RN5A 5FJ8G 4FXKC 4NMZA 3U58A 2HHHL 5NUCA 3KJPA 4FVMA 1WD1A 1E22A 2MO0A 1XTCD 2RBMA 3S1NB 5K36H 4P2CB 2VQEL 1QB5D 3MWYW 4TVAB 4KLKA 4C3HB 5IP9H 3R3OA 4GOPC 2ZJRA 3Q24A 1VQCA 4BXXG 3HOYB 3S16H 5CV5A 3A7AB 4A3EH 1ZXTA 4HTHA 5ELCA 1JR0D 1SDFA 3L7ZC 1A63A 3MZ5A 2A68D 4R4IA 2NN6I 5IP9G 3KFUA 1L2FA 1O7YA 2CW0D 2MPMA 2HDLA 5FO7B 3HKZG 2CQOA 4B9XA 1K0RA 3MXUA 3DHQA 1AE2A 1XPRA 3HGBA 3SVMA 1HR0Q 5FJ8H 1OTCA 4L6TB 4ZCKA 4JI5L 2EXDA 4JI3L 3NQTA 3M85A 1BDOA 1TT2A 1HQRD 1U5KA 3MVVA 4A3JG 1R4PB 2GVBA 1JB3A 1F2LA 1GUOA 2O5JC 3CPWA 1NSNS 2DNCA 2PYKA 4RCNA 2Z1CA 1V8QA 2L5TA 4BBSB 1A3UA 2OXPA 3D3RA 3MHBA 4JI1L 1NY4A 2JQOA 2V4DA 3GTGH 1F77A 2QEJC 3WOFA 4H44C 3I4NB 3MFGA 1KRSA 4KK7A 3SR1A 4JYAQ 2HQLA 3I7FA 2VW9A 2ZTEA 2ES2A 5LMNW 2EY5A 1PHJA 3T56B 1NR4A 2IL8A 5BN4A 4KN4C 4OL7A 1TWCB 2K14A 2K5NA 4IJLA 1M4VA 4MHEA 4A76A 4BBRB 1DJRD 3S15B 4OO1H 3V96A 2WACA 1E1OA 3D6WA 5CV7A 4KV6A 1FL0A 4A3BB 1ONLA 2ATWA 4KY6A 2UU9Q 2NTSA 1NMGA 1JQYD 1B2TA 4EX5A 3J80L 2SEBD 1CKNA 4YCUA 3LWUA 1C7YA 1F2YA 1UWVA 2D5DA 2VQFL 2L0CA 4QUCA 3I4MG 3DEOA 3S14B 1C48A 1TWFB 1TY2A 2OQ0A 2K1BA 2XTIA 2UU9L 1GD7A 5GADC 4G7HC 3TMEA 2XRQD 3GO5A 1I4QA 1A15A 3WOEA 2ICIA 3T53B 4PZ7A 4PV1C 3R8BA 3EROA 5G3LF 4DN4M 1N36Q 3RN2A 2IW3A 4A3MH 4CJ0B 2R92G 5H1SE 3A56A 2FXQA 5J1ZA 4LF8L 2R7ZG 2F0GA 2UUBL 2JYOA 3CCSA 3M4QA 5IP7H 1BVSA 3S1RB 2SDFA 1VMPA 3ONAB 1SNCA 3FPUB 1I3QB 2WFWA 3CCQA 4OELB 3I3CA 1UE5A 4BY7G 3NENA 1G8ZD 2X69A 4KHZA 4G57A 1YZ6A 4LF8Q 1V43A 2C5CA 4DR6Q 2L11A 1SSOA 4NXNQ 2EQSA 3S14H 2NVXB 5E4WC 1I4XA 4BA1I 2NZ1D 4GN5A 5JJZA 1HNXL 3HOWG 2QKIC 2JA8B 1EOTA 2L1BA 4BS9A 1EY4A 4BY1G 1WTPA 1ASYA 4JBKA 4GNXB 1KAWA 3SXHA 1RODA 4IZ8A 3PCOB 3CU7A 3CCUA 5C3WA 4IALA 5M5XH 1F9SA 4LNQA 1B50A 4DAMA 5IGCA 2E2HB 3ND9A 5FLXL 3K7AH 4LFCL 2F4VL 1H9SA 3C1EA 1X3PA 5IYDH 2CKZB 2NYZD 5DNFA 3TREA 2V1CC 4ODGA 2MQHA 2NVTB 2CVRA 3P7JA 3OPOA 1LABA 3OOCA 4K5WA 1FJGL 2QA4A 1KDBA 3G48A 4EGVA 4CKCA 2H1EA 2OCEA 5M3FB 4CDDC 5KNBA 2KBNA 1KABA 1V1QA 5IIFA 3A5ZB 1IYUA 3DWPA 4PNYA 3CRKC 1PZJD 3IAYA 4WJ4A 4NXMQ 1Q12A 1B70B 3I72A 1FGUA 1KHIA 4DPGA 4HJ5A 1EL0A 3PSIA 4KMUC 5IODA 1WJJA 4R8NA 2L15A 3KOJA 2K5QA 1WCMB 3K5LA 5KNDA 3L2PA 4FXGC 4K5VA 1EY7A 3H0GB 3SK5A 2CWAA 5ELFA 3RMHA 1RJTA 4C3IH 4DV1L 1N33Q 1IL2A 1GXDC 1F2MA 1W2BA 4X66Q 2X6LA 5C4XB 4NP5A 1PRTB 4RKLA 1X3QA 5GAGC 2R7DA 4X62Q 2OQKA 4Y7NB 1RDPD 4J6HA 2Z6KA 2PQAA 1MHWC 1F9QA 1JJCB 1LACA 2A6EC 3DUZA 4FO2A 1XMQQ 1PH8A 2F0LA 1I4GA 4HMIA 2EJMA 4WRDA 1PVOA 2I46A 2DUDA 1O7IA 1U4RA 3OTOL 4DV7L 4DXGA 3MXNB 4PMBA 5C6AA 2NVQB 5T1IA 3LNNA 1DYQA 1BBUA 4A3IB 5HGQA 3E5SA 3I90A 4K0KL 1TWHH 1WTRA 2VY3A 4LAAA 1XMQL 1MSHA 5DLQE 1OXUA 2K32A 2R7FA 4LFAQ 4GLVB 3CCLA 1KNEA 1NAPA 5EKLA 5CV8A 4UHVA 4HIMA 4B9WA 1KC8C 1YHBA 1Y1WG 3J7AF 1D5MC 3S1QB 3SK4A 1VQHA 3STBC 1C8CA 1SYBA 3H0GH 5KNCA 4HR7B 2RQXA 4K2LA 1XNRL 3ZJYC 4DAPA 2UUAQ 1BKBA 2E76C 2NB0A 4BY1B 4IPDA 1GOZA 2EYPA 2B2VC 4BBRH 3S15H 3HOWB 1YVCA 1AZQA 1VQOA 2OTJA 1B4OA 1O7LA 4JI4Q 2JA5B 1XTDA 2B63B 2BOSA 2IT1A 4MZ9A 1CA6A 5C0XJ 1LTAD 3J7ZC 2C9OA 4ME3A 1HCZA 4DR3L 1XMOL 3I2ZA 1JJGA 1SNPA 4UP9A 2R93B 2WB1E 1R9TH 1I50H 2F52A 1KD1C 3K5MA 3FRPB 4NW2A 1L0YB 4KJOA 5LMUL 2B2VA 2A68C 2EIFA 1Y1WB 3PUZA 3UDXA 5FO9B 2EJGC 4KD4A 2YV5A 1Q1BA 4KKTA 1S5ED 1Z7TA 4JW0A 1FGBD 2B2YA 5EPKA 5M5WH 4DUZQ 4FDBA 3M9BA 1V1PA 2VB2X 1LTSD 2ID0A 1VQ9A 2BA0A 3D4DA 1DOMA 1Q1EA 4X6AH 1VQIA 3ULPA 4A3IG 2ZXOA 1G2SA 3NTKA 1PH4A 3F2BA 4K6DA 1KDAA 3HFZB 2LY7A 5L37A 3W3AA 1EYCA 4OWWB 2AUJD 5EQ0A 5KYIA 4JOIA 1HH2P 5JVG3 4OEMB 3SHLA 3V2TA 4OO1I 2EJFC 3I73A 1OO9B 1E3PA 1JICA 2NVYB 3LGJA 2AQ2B 3MA2B 2KEDA 2B2UA 1T9HA 1A2UA 1VQ7A 4I65A 1SYFA 4GKKL 1BQQT 4EQNA 3H0GG 1EIHA 1CK1A 5DAUA 3TN2A 3HKZE 3TS2A 1WCMG 2KUMA 4A3BG 4KN7C 2Q8RE 5CBAE 3VYTA 1PTOH 5EBDA 4BBRG 4IO9A 3H94A 2F3IA 5TSSA 3TBIB 2QILA 3NTIA 4XQQA 4LW1A 5A35A 5M5WB 2F0TA 3T13A 3VDYA 1RF2D 4RHSA 3IRBA 4DV4Q 3NP8A 5DEHA 4DR1L 3PF4A 2EOTA 3J7AV 5EKKA 4DR6L 1FYCA 1EQQA 1ZYRC 3S1MH 5E4XA 1JMCA 3NBHA 5M5YB 4JC0A 1X56A 5E7NA 3NHHA 2AWOA 4ZUIA 4Q0FA 2EPBA 1QWYA 3JC66 1VQGA 2Q2TA 5M3MB 2WB1G 2BH8A 1PFSA 2A69D 2HHHQ 4IUTA 4X3KA 1X9NA 5JEAJ 2LMCB 3IFDA 5M3FH 4K14A 3MFYA 3V05A 3E0JA 1N34L 2WINB 1HNWL 5C0XH 4QY7A 3PO2H 3E9HA 4K5XA 5LMNL 4DR7L 1A62A 1OXTA 2AQ3B 3HKZB 5C4XH 1A2TA 4KI0A 1WTWA 4KHVA 3E6ZX 1W6JA 2IJ0A 3I56A 4F7XA 2HCCA 5A2QL 4JI2Q 3KK7A 5I9OA 2H4OA 4A3GG 4K8IA 4HJAA 3J7A5 1K8GA 4UY8C 4R4CA 3W1BA 4DF7A 4B3MQ 2B2TA 3BDCA 1U0LA 1H9RA 1SNDA 1X3EA 3K5NA 2NVQH 1WTQA 1JWMD 2OTLA 2JK8A 4QB4A 3CW2C 1SMXA 1JE5A 1BBXC 3AU7A 2AUKA 1BR9A 2K03A 1VDZA 4JPBW 1MSGA 5EAYA 4HSPA 2UXDL 1JCKB 3A0JA 1QZGA 1C0AA 4JBMA 1GJXA 1EY9A 4IQZA 3QIAA 2QCPX 2JXMB 4GS3A 4UP7A 1LYLA 1BOSA 2L55A 4LK1C 4LF6L 2PW5A 5JVH3 3A8IE 5AFWA 2HDMA 3OWEB 4X62L 5C44G 4TKOB 1TKWB 4CBVA 4KY5A 4RA8A 5JPMC 3I4MB 5EBCA 1E24A 4YHHQ 1VQEA 4LUOA 1SMYD 2NZOA 3D4WA 1CTMA 4LF7Q 1D5XC 2K5HA 4K0KQ 3TRZA 5GAHC 5IT9L 3RZOH 4JVZA 1V9PA 2RCFA 4RGNA 4DV3L 1Z9FA 1A0IA 5FLMH 1SE4A 3RR5A 2JEAI 2N3SA 3E0EA 5IT9E 5CC4A 4DXFA 3IFTA 2K5WA 5C3EG 3G4SA 1IL8A 1QOHA 5D14A 1LO5D 1S5CD 1IBKQ 1VQ6A 3WWVA 4L8JA 3M4OH 4JI6L 2EY6A 2ASBA 1AP0A 4X64L 1QVGA 2N88A 1UUPA 1II3A 2IWHA 4DFAA 2DJGC 1RTNA 1RKNA 4AIMA 1HA5A 2K7VA 1Y14B 3EJIA 4YY3Q 3CCJA 2R93H 4A3KG 4DR1Q 1BCPC 1GUWA 2F0KA 2NZHA 1O78A 2SOBA 1AH9A 2WP8J 4XQNA 1H95A 4A3MG 2IX0A 3FHWA 2IY5B 1H9MA 4A3LG 5C44H 4B3TL 2D0PA 2K50A 2A1AA 3MXGA
chains in the Genus database with same CATH topology
4JI4L 1I3QH 1K73C 4PZ7A 4GNXA 1X54A 4OX9Q 3CMAA 5M3MH 1C9OA 1N36Q 3BZKA 1WYDA 3RN2A 1PH7A 3TEHB 3E9IA 3RLFA 4A3MH 1S3OA 2R92G 5H1SE 1B8AA 3S24A 1KL9A 2FXQA 5IT9c 1HNWQ 1E1TA 2UUAL 4LF8L 2R7ZG 1SLJA 1UE1A 3KF6A 2E5LL 2UUBL 4LF4Q 4LF7L 2UXCL 1IBMQ 3CCSA 3UE0A 1HNZL 2GVAA 1KQSA 3M4QA 4A3DG 5IP7H 1Q86C 1BVSA 1A8VA 1B7YB 1BBWA 1QUQB 4L5SA 2NN6G 2VNUD 1I5FA 1D7QA 4LF9L 1CKMA 1YEZA 2WFWA 3CCQA 1GM5A 4BY7G 4GKKQ 1UE5A 1VQ8A 1G291 3PUWA 4GKJL 3RLNA 1CKNB 3NENA 1PH2A 3HOYH 4KHZA 4A3JH 4LF8Q 1YZ6A 4A3GH 1V43A 4LF5Q 4JI0L 4DR6Q 4HJ7A 1GO3E 3F8TA 3PUVA 4HIOA 2OWOA 4NXNQ 2EQSA 3S14H 3KF6B 4PZ6A 3CCMA 4DUYQ 2N78A 4BA1I 3NELA 1HNXL 4GN5A 1QVFA 3HOWG 1S40A 4P74A 1JB7A 4P72A 4AH6A 4DV0Q 4AQYQ 4AQYL 4BY1G 5AJ3Q 1ASYA 4LUVA 3D0FA 1IXRA 1PH1A 3CD6A 4JBKA 1I6HH 4GNXB 4IOCA 2D62A 1KAWA 4GNXC 1VQNA 5IYBG 3JAMc 3PCOB 3EN2A 1N8RC 5M3FG 3CCUA 4BA2I 1PH6A 1VQKA 2MO1A 1HZ9A 4QGUA 4LNQA 5M5XH 4GLAC 4DAMA 4GOPA 4RG1A 3K7AH 4LFCL 2F4VL 2JEBI 3TS0A 4B3TQ 5IYDH 2CKZB 3CP0A 3TREA 2RCNA 5C0XI 4IOAA 2V1CC 4C3JH 2MQHA 3GTKH 4YWLA 1IBML 2IHFA 4X64Q 1VQ5A 3PIOA 3PO3H 1SROA 4AYBG 2VL6A 2CCZA 4IFDJ 1DGSA 1X6OA 4IPGA 3CCRA 3GD7A 1YJ9A 1WOCA 2XGTA 4B3SL 2QA4A 1FJGL 2YTXA 3G48A 2VZAA 1M90C 3KDFA 3J81c 3J81i 2AWNA 2OCEA 1KXLA 4L5TA 2B29A 4RMFA 2KBNA 1Q81C 4A3FH 1V1QA 2HIVA 2UXCQ 4HIKA 4GN4B 1Q82C 1VQMA 1P8LA 4A3EG 3CAMA 3A5ZB 4Y7NH 1TWGH 4H02A 5IYBH 4WJ4A 2YU9H 4NXML 4NXMQ 1Q12A 1B70B 4QIWE 1FGUA 4APVA 1KHIA 2JA8G 4DPGA 1N32Q 4HJ5A 1SFOH 2ZTDA 3PSIA 3M3YH 5JJIA 2JA9A 2R6GA 1OXXK 1TXYA 1WJJA 2L15A 3S1QH 4KHPL 3KOJA 3KJOA 1EWIA 4JI8L 3L2PA 1CUKA 3PV0A 4DV1L 2CWAA 1N33Q 4C3IH 4TQUS 1IL2A 1HZCA 1W2BA 1EQRA 4A3BH 4X66Q 1L1OB 1VCIA 4UPAA 2ZM6L 3T1HL 1NMFA 5GAGC 2R7DA 4X62Q 1A63A 4OWXB 4IFDI 2HIXA 1N33L 1YIJA 2OQKA 3GTOH 3HOYG 2Z6KA 5C4JH 2PQAA 1UE7A 1JJCB 1RIPA 3RLOA 1XMQQ 3GTPH 1PH8A 1LUZA 3ER0A 2JE6I 1KIXA 2JA5H 4DKAC 3EBEA 5FLXc 1K9MC 4POFA 1YJNA 1PVOA 3GTQH 3AFQA 2DUDA 2VS1A 2WAQE 1XNQL 1O7IA 3OTOL 3ERSX 1X3FA 3Q8DA 4DK3C 5IYDG 4DV7L 3MXNB 1PYBA 2KHJA 4MNOA 3EIVA 4A3FG 1XPOA 1K3RA 1N34Q 2JA6H 1BBUA 3I55A 3UDGA 1IBLL 1GKHA 5HGQA 1M1KC 2D0OA 4R4TA 1Q46A 4JYAL 4K0KL 5BR8L 5BR8Q 1L1OA 3HKSA 1TWHH 1ASZA 4IFDG 2UXBL 1HZBA 2VY3A 4DR4L 2KCTA 2LSSA 3DLLA 4DR2Q 1XMQL 3OYYA 5M3MG 5DLQE 4HJ9A 1WFQA 1FJGQ 4NXNL 1JT8A 2ZJQA 5IWAQ 1OXUA 2RHQB 3W1GA 3CPFA 2PQAB 5IE8A 3CC2A 4JI7L 2R7FA 4A4IA 4JI3Q 4JG2A 4LFAQ 3ULJA 4GLVB 3G6EA 3HOWH 3CCLA 1NBWA 3AFPA 4J15A 1XNRQ 1PA6A 4DV6L 4LF6Q 4HIMA 1KC8C 1YHBA 1Y1WG 1PYSB 4A3CG 1NJIC 1VQHA 3STBC 4A3IH 1QZHA 4IJHA 3GTMH 3H0GH 1HJPA 1W3SA 2VQEQ 3FKIG 4DR7Q 3H3VI 2PNHA 2JA7H 1NTGA 1XNRL 3ZJYC 4DR5Q 2QEXA 2UUAQ 1BKBA 3MEFA 3H15A 1EOVA 4YWKA 3CQZH 3K8AA 4IPDA 2Q2IA 4L5QA 3K7UC 4OWTB 3CC4A 1N36L 5IY0A 2VUMG 1I94Q 4BBRH 3S15H 4DUYL 4A93H 1YVCA 4JOIC 3HOXG 1YHQA 4A3DH 1CKOA 1VQOA 1J5EQ 2OTJA 4JI4Q 4MTNA 1XTDA 2PMZE 2R7ZH 1OXSC 4KHPQ 2IT1A 1GVPA 2BA1A 3PIPA 4MZ9A 3G71A 5C0XJ 2C35B 3AYHB 3J7ZC 1VQPA 2I0QA 2VUMH 4ME3A 3KDFB 2E2IH 1X3GA 1VQBA 1SE8A 2KENA 3I2ZA 5FLMG 4DR3L 1XMOL 1VS0A 1JJGA 4ALPA 4UP9A 4O2DA 1N9WA 2WB1E 1R9TH 1I50H 4PG3A 2F52A 1MKHA 3T1YQ 1KD1C 2YYZA 1CSQA 3CCEA 3GTJH 3I4NG 1RL2A 5LMUL 2ALYB 4B3ML 1EYGA 2EIFA 4B3RQ 3BZCA 4B3RL 4A3LH 1JJ2A 1HNZQ 5C3EH 4OO1G 3PUZA 3UDXA 2MFIA 1KRTA 2B3GA 2K75A 2YV5A 4P75A 4XIGS 1L0WA 1Q1BA 4DV4L 2B63H 3ICEA 1PH5A 4A93G 5M5WH 2I5MX 2N8NA 5ELOA 4DUZQ 4DV2L 4FDBA 1PH3A 3M9BA 4BBSG 4DV0L 1Q7YC 1XPUA 4HJ8A 1QUQA 4R4QA 1EIFA 1HNXQ 1OXVA 2ID0A 1X55A 3CCVA 2AKWB 1VQ9A 2BA0A 2DGYA 2JA7G 4BBSH 2UXBQ 2RF4A 1CSPA 4UP8A 1Q1EA 3S2DH 4X6AH 1VQIA 3ULPA 4A3IG 4DV5L 3ULLA 4WJ3M 4R1JA 4A75A 3F2CA 3PGZA 2KCMA 1PH4A 1Y1WH 2PI2E 1LM0A 3F2BA 4LUZA 4IPCA 3I4MH 1XNQQ 3HFZB 4QQBX 2K4KA 3UDFA 2YTVA 1PV4A 4JI5Q 3I4NH 3HOXH 4OWWB 1HR0L 4YY3L 4JOIA 1HH2P 1QVCA 4OO1I 3NBHB 1VQ4A 1E3PA 4YHHL 3LGJA 1K8AC 1L1OC 1EUJA 3AQQA 4POGA 4DV6Q 1Y1VH 3J80i 3W5OA 1T9HA 5JJKA 1VQ7A 4GKKL 3PUXA 2GN5A 3FKIH 3UDIA 2A19A 3H0GG 4QL5A 2E8GA 3K81C 4LFCQ 2F4VQ 3HKZE 1S72A 2UXDQ 3TS2A 1WCMG 4A3BG 1EIYB 4YCVA 3RNUA 4BXXH 4BBRG 1J5EL 4IO9A 4OX9L 5JJLA 2F3IA 3HOVH 2Y0SE 2Y0SG 3UE1A 2JA5G 1I94L 2IX1A 2E5LQ 2UUBQ 3I4OA 4P73A 2K5VA 4LW1A 4XTCS 3VDYA 1HR0W 5IYCG 1VQLA 3J80c 1TWAH 2LXKA 4DUZL 4NPSA 3GDEA 3K0XA 4JCVE 3GTLH 3IRBA 4JV5L 3AEVA 4NB3A 4DV4Q 2HT1A 1G51A 1E7ZA 4GN3B 2AMCB 4DR1L 3PF4A 3HOZH 3BJUA 1TWFH 2VQFQ 4DR6L 4C2MH 4YCWA 1EQQA 3HOUH 4DNIA 3PF5A 4OXPA 3U4VA 2I5LX 3S1MH 1YBYA 3CF5A 1JMCA 5K36G 3T1HQ 2E2HH 3BU2A 1UEBA 4DK6C 3NEMA 4DR3Q 4EQ5A 1XMOQ 4GKJQ 4JC0A 1X56A 4DV1Q 5E7NA 2BH2A 3S1NH 3KYHC 4OONA 1VQAA 4LF9Q 4X66L 2AWOA 4LFBQ 1MIUA 2Q2HA 1IBKL 3JC66 2H5XA 4DV5Q 1VQGA 1SRUA 5LMUQ 2Q2TA 2Q2UA 2WB1G 4P71A 2Z6KC 1SR3A 3HOUG 2BH8A 1PFSA 1YNXA 5LMNQ 2JA6G 2HHHQ 2Z0SA 1G6PA 1X9NA 5JEAJ 3STBD 5M3FH 1WI5A 3L0OA 1N34L 1Q8KA 3OTOQ 3CC7A 1HNWL 3RN5A 5FJ8G 3U58A 3A5UA 2HHHL 1XJVA 1K83H 3KLWA 3KJPA 1YHAA 1E22A 4IPHA 2MO0A 4QY7A 4DV3Q 1PH9A 4BY1H 3S1RH 3PO2H 3E9HA 5IYCH 2CWPA 3RZDH 3PO2G 5LMNL 2LXJA 2VQEL 3DM3A 1A62A 1OXTA 4DR7L 3CMEA 4TVAB 4LFBL 4KLKA 5C4XH 5IP9H 1VQDA 4GOPC 1UE6A 4KI0A 2ZJRA 1VQCA 4BXXG 2MNAA 5HY6A 4L5RC 3S16H 3I56A 3FP9A 4A3EH 4JI2Q 4JI2L 1FVIA 3U4ZA 4JBJA 3L7ZC 4A3GG 5IP9G 4R4IA 4HJAA 2NN6I 3OW2A 1EFWA 3KFUA 5C4XG 1L2FA 3PUYA 2K52A 1NE3A 4JI7Q 3J7A5 1Y1VG 1D8LA 3KF8B 1K8GA 5J3BA 4R4CA 3W1BA 2NVXH 3HKZG 4B3MQ 4UY8C 2CQOA 4BY7H 1K0RA 2ZJPA 1AE3A 1U0LA 3CXCA 1LTLA 2JA8H 1AE2A 1X3EA 5M5YH 1XPRA 1HR0Q 5FJ8H 5C0XG 1IZ6A 1OTCA 2NVQH 4JV5Q 4JI5L 4PZ8A 2EXDA 4JBWA 4DAYB 2OTLA 2JK8A 5GQOA 3U50C 4JI3L 3S17H 4C3HH 3CW2C 3M85A 1SMXA 1JE5A 1YI2A 1U5KA 3K80C 4AYBE 4A3JG 3HOZG 2GVBA 4DR4Q 3TQYA 2PI2A 2R92H 1YJWA 3H3VH 5EAYA 3CPWA 2UXDL 2RHSB 3A0JA 1QZGA 1C0AA 4JBMA 3D31A 3JAMi 2I5HA 3SGIA 1SN8A 4LF5L 3PO3G 2NVTH 4GS3A 4UP7A 2N49A 1YITA 1LYLA 2JJQA 2UUCL 1TWCH 4LF6L 1VQFA 4DV2Q 1MJCA 4Y52H 4X62L 4JI1L 5C44G 2ZM6Q 1NY4A 2JQOA 2KHIA 4LFAL 2UUCQ 1J6QA 2E2JH 3GTGH 1E24A 1P16A 2IHEA 2ZTCA 4YHHQ 4GLXA 1VQEA 4LUOA 2NZOA 4LF7Q 2R93G 1KRSA 3T1YL 2K5HA 4JYAQ 4K0KQ 2HQLA 3TRZA 2NVYH 4JI1Q 5GAHC 3I7FA 3RZOH 5AJ3L 1V9PA 2VW9A 4DV3L 2ZTEA 4GOPB 5LMNW 2ES2A 1PHJA 1Z9FA 1A0IA 5FLMH 5IWAL 4DV7Q 4JI6Q 3HOVG 3S2HH 3RR5A 4HIDA 5ELNA 4DR2L 5IP7G 2K14A 2B63G 2WAQG 2JEAI 1VQJA 2K5NA 2N3SA 1WCMH 3E0EA 2CFMA 4IJLA 3J81j 5GAEC 4A76A 4LWCA 5C3EG 1IBLQ 1X65A 4YWMA 3G4SA 1E1OA 4A3KH 4JI0Q 1FL0A 1IBKQ 1VQ6A 2ATWA 3WWVA 2A8VA 4X65Q 2UU9Q 3M4OH 1NMGA 2QGQA 4JI6L 3M4PA 1Z47A 2ASBA 4EX5A 4X64L 2AHOB 1QVGA 3F1ZA 4DR5L 1CKNA 4YCUA 1C7YA 4AIMA 1UWVA 2YTYA 1IYJB 1Y14B 4O0AA 4YY3Q 3F2DA 2VQFL 4B3SQ 3CCJA 2R93H 4A3KG 5JEAG 4DR1Q 3I4MG 2NZHA 3A74A 4LF4L 2OQ0A 1AH9A 2WP8J 1H95A 2XTIA 4A3MG 5GROA 4A3CH 2IX0A 3FHWA 1GD7A 4X65L 5GADC 4PMWA 2UU9L 1N32L 2IY5B 4QJFA 3M7NA 4R4OA 4A3LG 1MJEA 5C44H 4B3TL 4JI8Q 2D0PA 2K50A 3B6YA 2A1AA 3GO5A 1HZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI4 L;  1I3Q H;  1K73 C;  4PZ7 A;  4GNX A;  1X54 A;  4OX9 Q;  3CMA A;  5M3M H;  1C9O A;  1N36 Q;  3BZK A;  1WYD A;  3RN2 A;  1PH7 A;  3TEH B;  3E9I A;  3RLF A;  4A3M H;  1S3O A;  2R92 G;  5H1S E;  1B8A A;  3S24 A;  1KL9 A;  2FXQ A;  5IT9 c;  1HNW Q;  1E1T A;  2UUA L;  4LF8 L;  2R7Z G;  1SLJ A;  1UE1 A;  3KF6 A;  2E5L L;  2UUB L;  4LF4 Q;  4LF7 L;  2UXC L;  1IBM Q;  3CCS A;  3UE0 A;  1HNZ L;  2GVA A;  1KQS A;  3M4Q A;  4A3D G;  5IP7 H;  1Q86 C;  1BVS A;  1A8V A;  1B7Y B;  1BBW A;  1QUQ B;  4L5S A;  2NN6 G;  2VNU D;  1I5F A;  1D7Q A;  4LF9 L;  1CKM A;  1YEZ A;  2WFW A;  3CCQ A;  1GM5 A;  4BY7 G;  4GKK Q;  1UE5 A;  1VQ8 A;  1G29 1;  3PUW A;  4GKJ L;  3RLN A;  1CKN B;  3NEN A;  1PH2 A;  3HOY H;  4KHZ A;  4A3J H;  4LF8 Q;  1YZ6 A;  4A3G H;  1V43 A;  4LF5 Q;  4JI0 L;  4DR6 Q;  4HJ7 A;  1GO3 E;  3F8T A;  3PUV A;  4HIO A;  2OWO A;  4NXN Q;  2EQS A;  3S14 H;  3KF6 B;  4PZ6 A;  3CCM A;  4DUY Q;  2N78 A;  4BA1 I;  3NEL A;  1HNX L;  4GN5 A;  1QVF A;  3HOW G;  1S40 A;  4P74 A;  1JB7 A;  4P72 A;  4AH6 A;  4DV0 Q;  4AQY Q;  4AQY L;  4BY1 G;  5AJ3 Q;  1ASY A;  4LUV A;  3D0F A;  1IXR A;  1PH1 A;  3CD6 A;  4JBK A;  1I6H H;  4GNX B;  4IOC A;  2D62 A;  1KAW A;  4GNX C;  1VQN A;  5IYB G;  3JAM c;  3PCO B;  3EN2 A;  1N8R C;  5M3F G;  3CCU A;  4BA2 I;  1PH6 A;  1VQK A;  2MO1 A;  1HZ9 A;  4QGU A;  4LNQ A;  5M5X H;  4GLA C;  4DAM A;  4GOP A;  4RG1 A;  3K7A H;  4LFC L;  2F4V L;  2JEB I;  3TS0 A;  4B3T Q;  5IYD H;  2CKZ B;  3CP0 A;  3TRE A;  2RCN A;  5C0X I;  4IOA A;  2V1C C;  4C3J H;  2MQH A;  3GTK H;  4YWL A;  1IBM L;  2IHF A;  4X64 Q;  1VQ5 A;  3PIO A;  3PO3 H;  1SRO A;  4AYB G;  2VL6 A;  2CCZ A;  4IFD J;  1DGS A;  1X6O A;  4IPG A;  3CCR A;  3GD7 A;  1YJ9 A;  1WOC A;  2XGT A;  4B3S L;  2QA4 A;  1FJG L;  2YTX A;  3G48 A;  2VZA A;  1M90 C;  3KDF A;  3J81 c;  3J81 i;  2AWN A;  2OCE A;  1KXL A;  4L5T A;  2B29 A;  4RMF A;  2KBN A;  1Q81 C;  4A3F H;  1V1Q A;  2HIV A;  2UXC Q;  4HIK A;  4GN4 B;  1Q82 C;  1VQM A;  1P8L A;  4A3E G;  3CAM A;  3A5Z B;  4Y7N H;  1TWG H;  4H02 A;  5IYB H;  4WJ4 A;  2YU9 H;  4NXM L;  4NXM Q;  1Q12 A;  1B70 B;  4QIW E;  1FGU A;  4APV A;  1KHI A;  2JA8 G;  4DPG A;  1N32 Q;  4HJ5 A;  1SFO H;  2ZTD A;  3PSI A;  3M3Y H;  5JJI A;  2JA9 A;  2R6G A;  1OXX K;  1TXY A;  1WJJ A;  2L15 A;  3S1Q H;  4KHP L;  3KOJ A;  3KJO A;  1EWI A;  4JI8 L;  3L2P A;  1CUK A;  3PV0 A;  4DV1 L;  2CWA A;  1N33 Q;  4C3I H;  4TQU S;  1IL2 A;  1HZC A;  1W2B A;  1EQR A;  4A3B H;  4X66 Q;  1L1O B;  1VCI A;  4UPA A;  2ZM6 L;  3T1H L;  1NMF A;  5GAG C;  2R7D A;  4X62 Q;  1A63 A;  4OWX B;  4IFD I;  2HIX A;  1N33 L;  1YIJ A;  2OQK A;  3GTO H;  3HOY G;  2Z6K A;  5C4J H;  2PQA A;  1UE7 A;  1JJC B;  1RIP A;  3RLO A;  1XMQ Q;  3GTP H;  1PH8 A;  1LUZ A;  3ER0 A;  2JE6 I;  1KIX A;  2JA5 H;  4DKA C;  3EBE A;  5FLX c;  1K9M C;  4POF A;  1YJN A;  1PVO A;  3GTQ H;  3AFQ A;  2DUD A;  2VS1 A;  2WAQ E;  1XNQ L;  1O7I A;  3OTO L;  3ERS X;  1X3F A;  3Q8D A;  4DK3 C;  5IYD G;  4DV7 L;  3MXN B;  1PYB A;  2KHJ A;  4MNO A;  3EIV A;  4A3F G;  1XPO A;  1K3R A;  1N34 Q;  2JA6 H;  1BBU A;  3I55 A;  3UDG A;  1IBL L;  1GKH A;  5HGQ A;  1M1K C;  2D0O A;  4R4T A;  1Q46 A;  4JYA L;  4K0K L;  5BR8 L;  5BR8 Q;  1L1O A;  3HKS A;  1TWH H;  1ASZ A;  4IFD G;  2UXB L;  1HZB A;  2VY3 A;  4DR4 L;  2KCT A;  2LSS A;  3DLL A;  4DR2 Q;  1XMQ L;  3OYY A;  5M3M G;  5DLQ E;  4HJ9 A;  1WFQ A;  1FJG Q;  4NXN L;  1JT8 A;  2ZJQ A;  5IWA Q;  1OXU A;  2RHQ B;  3W1G A;  3CPF A;  2PQA B;  5IE8 A;  3CC2 A;  4JI7 L;  2R7F A;  4A4I A;  4JI3 Q;  4JG2 A;  4LFA Q;  3ULJ A;  4GLV B;  3G6E A;  3HOW H;  3CCL A;  1NBW A;  3AFP A;  4J15 A;  1XNR Q;  1PA6 A;  4DV6 L;  4LF6 Q;  4HIM A;  1KC8 C;  1YHB A;  1Y1W G;  1PYS B;  4A3C G;  1NJI C;  1VQH A;  3STB C;  4A3I H;  1QZH A;  4IJH A;  3GTM H;  3H0G H;  1HJP A;  1W3S A;  2VQE Q;  3FKI G;  4DR7 Q;  3H3V I;  2PNH A;  2JA7 H;  1NTG A;  1XNR L;  3ZJY C;  4DR5 Q;  2QEX A;  2UUA Q;  1BKB A;  3MEF A;  3H15 A;  1EOV A;  4YWK A;  3CQZ H;  3K8A A;  4IPD A;  2Q2I A;  4L5Q A;  3K7U C;  4OWT B;  3CC4 A;  1N36 L;  5IY0 A;  2VUM G;  1I94 Q;  4BBR H;  3S15 H;  4DUY L;  4A93 H;  1YVC A;  4JOI C;  3HOX G;  1YHQ A;  4A3D H;  1CKO A;  1VQO A;  1J5E Q;  2OTJ A;  4JI4 Q;  4MTN A;  1XTD A;  2PMZ E;  2R7Z H;  1OXS C;  4KHP Q;  2IT1 A;  1GVP A;  2BA1 A;  3PIP A;  4MZ9 A;  3G71 A;  5C0X J;  2C35 B;  3AYH B;  3J7Z C;  1VQP A;  2I0Q A;  2VUM H;  4ME3 A;  3KDF B;  2E2I H;  1X3G A;  1VQB A;  1SE8 A;  2KEN A;  3I2Z A;  5FLM G;  4DR3 L;  1XMO L;  1VS0 A;  1JJG A;  4ALP A;  4UP9 A;  4O2D A;  1N9W A;  2WB1 E;  1R9T H;  1I50 H;  4PG3 A;  2F52 A;  1MKH A;  3T1Y Q;  1KD1 C;  2YYZ A;  1CSQ A;  3CCE A;  3GTJ H;  3I4N G;  1RL2 A;  5LMU L;  2ALY B;  4B3M L;  1EYG A;  2EIF A;  4B3R Q;  3BZC A;  4B3R L;  4A3L H;  1JJ2 A;  1HNZ Q;  5C3E H;  4OO1 G;  3PUZ A;  3UDX A;  2MFI A;  1KRT A;  2B3G A;  2K75 A;  2YV5 A;  4P75 A;  4XIG S;  1L0W A;  1Q1B A;  4DV4 L;  2B63 H;  3ICE A;  1PH5 A;  4A93 G;  5M5W H;  2I5M X;  2N8N A;  5ELO A;  4DUZ Q;  4DV2 L;  4FDB A;  1PH3 A;  3M9B A;  4BBS G;  4DV0 L;  1Q7Y C;  1XPU A;  4HJ8 A;  1QUQ A;  4R4Q A;  1EIF A;  1HNX Q;  1OXV A;  2ID0 A;  1X55 A;  3CCV A;  2AKW B;  1VQ9 A;  2BA0 A;  2DGY A;  2JA7 G;  4BBS H;  2UXB Q;  2RF4 A;  1CSP A;  4UP8 A;  1Q1E A;  3S2D H;  4X6A H;  1VQI A;  3ULP A;  4A3I G;  4DV5 L;  3ULL A;  4WJ3 M;  4R1J A;  4A75 A;  3F2C A;  3PGZ A;  2KCM A;  1PH4 A;  1Y1W H;  2PI2 E;  1LM0 A;  3F2B A;  4LUZ A;  4IPC A;  3I4M H;  1XNQ Q;  3HFZ B;  4QQB X;  2K4K A;  3UDF A;  2YTV A;  1PV4 A;  4JI5 Q;  3I4N H;  3HOX H;  4OWW B;  1HR0 L;  4YY3 L;  4JOI A;  1HH2 P;  1QVC A;  4OO1 I;  3NBH B;  1VQ4 A;  1E3P A;  4YHH L;  3LGJ A;  1K8A C;  1L1O C;  1EUJ A;  3AQQ A;  4POG A;  4DV6 Q;  1Y1V H;  3J80 i;  3W5O A;  1T9H A;  5JJK A;  1VQ7 A;  4GKK L;  3PUX A;  2GN5 A;  3FKI H;  3UDI A;  2A19 A;  3H0G G;  4QL5 A;  2E8G A;  3K81 C;  4LFC Q;  2F4V Q;  3HKZ E;  1S72 A;  2UXD Q;  3TS2 A;  1WCM G;  4A3B G;  1EIY B;  4YCV A;  3RNU A;  4BXX H;  4BBR G;  1J5E L;  4IO9 A;  4OX9 L;  5JJL A;  2F3I A;  3HOV H;  2Y0S E;  2Y0S G;  3UE1 A;  2JA5 G;  1I94 L;  2IX1 A;  2E5L Q;  2UUB Q;  3I4O A;  4P73 A;  2K5V A;  4LW1 A;  4XTC S;  3VDY A;  1HR0 W;  5IYC G;  1VQL A;  3J80 c;  1TWA H;  2LXK A;  4DUZ L;  4NPS A;  3GDE A;  3K0X A;  4JCV E;  3GTL H;  3IRB A;  4JV5 L;  3AEV A;  4NB3 A;  4DV4 Q;  2HT1 A;  1G51 A;  1E7Z A;  4GN3 B;  2AMC B;  4DR1 L;  3PF4 A;  3HOZ H;  3BJU A;  1TWF H;  2VQF Q;  4DR6 L;  4C2M H;  4YCW A;  1EQQ A;  3HOU H;  4DNI A;  3PF5 A;  4OXP A;  3U4V A;  2I5L X;  3S1M H;  1YBY A;  3CF5 A;  1JMC A;  5K36 G;  3T1H Q;  2E2H H;  3BU2 A;  1UEB A;  4DK6 C;  3NEM A;  4DR3 Q;  4EQ5 A;  1XMO Q;  4GKJ Q;  4JC0 A;  1X56 A;  4DV1 Q;  5E7N A;  2BH2 A;  3S1N H;  3KYH C;  4OON A;  1VQA A;  4LF9 Q;  4X66 L;  2AWO A;  4LFB Q;  1MIU A;  2Q2H A;  1IBK L;  3JC6 6;  2H5X A;  4DV5 Q;  1VQG A;  1SRU A;  5LMU Q;  2Q2T A;  2Q2U A;  2WB1 G;  4P71 A;  2Z6K C;  1SR3 A;  3HOU G;  2BH8 A;  1PFS A;  1YNX A;  5LMN Q;  2JA6 G;  2HHH Q;  2Z0S A;  1G6P A;  1X9N A;  5JEA J;  3STB D;  5M3F H;  1WI5 A;  3L0O A;  1N34 L;  1Q8K A;  3OTO Q;  3CC7 A;  1HNW L;  3RN5 A;  5FJ8 G;  3U58 A;  3A5U A;  2HHH L;  1XJV A;  1K83 H;  3KLW A;  3KJP A;  1YHA A;  1E22 A;  4IPH A;  2MO0 A;  4QY7 A;  4DV3 Q;  1PH9 A;  4BY1 H;  3S1R H;  3PO2 H;  3E9H A;  5IYC H;  2CWP A;  3RZD H;  3PO2 G;  5LMN L;  2LXJ A;  2VQE L;  3DM3 A;  1A62 A;  1OXT A;  4DR7 L;  3CME A;  4TVA B;  4LFB L;  4KLK A;  5C4X H;  5IP9 H;  1VQD A;  4GOP C;  1UE6 A;  4KI0 A;  2ZJR A;  1VQC A;  4BXX G;  2MNA A;  5HY6 A;  4L5R C;  3S16 H;  3I56 A;  3FP9 A;  4A3E H;  4JI2 Q;  4JI2 L;  1FVI A;  3U4Z A;  4JBJ A;  3L7Z C;  4A3G G;  5IP9 G;  4R4I A;  4HJA A;  2NN6 I;  3OW2 A;  1EFW A;  3KFU A;  5C4X G;  1L2F A;  3PUY A;  2K52 A;  1NE3 A;  4JI7 Q;  3J7A 5;  1Y1V G;  1D8L A;  3KF8 B;  1K8G A;  5J3B A;  4R4C A;  3W1B A;  2NVX H;  3HKZ G;  4B3M Q;  4UY8 C;  2CQO A;  4BY7 H;  1K0R A;  2ZJP A;  1AE3 A;  1U0L A;  3CXC A;  1LTL A;  2JA8 H;  1AE2 A;  1X3E A;  5M5Y H;  1XPR A;  1HR0 Q;  5FJ8 H;  5C0X G;  1IZ6 A;  1OTC A;  2NVQ H;  4JV5 Q;  4JI5 L;  4PZ8 A;  2EXD A;  4JBW A;  4DAY B;  2OTL A;  2JK8 A;  5GQO A;  3U50 C;  4JI3 L;  3S17 H;  4C3H H;  3CW2 C;  3M85 A;  1SMX A;  1JE5 A;  1YI2 A;  1U5K A;  3K80 C;  4AYB E;  4A3J G;  3HOZ G;  2GVB A;  4DR4 Q;  3TQY A;  2PI2 A;  2R92 H;  1YJW A;  3H3V H;  5EAY A;  3CPW A;  2UXD L;  2RHS B;  3A0J A;  1QZG A;  1C0A A;  4JBM A;  3D31 A;  3JAM i;  2I5H A;  3SGI A;  1SN8 A;  4LF5 L;  3PO3 G;  2NVT H;  4GS3 A;  4UP7 A;  2N49 A;  1YIT A;  1LYL A;  2JJQ A;  2UUC L;  1TWC H;  4LF6 L;  1VQF A;  4DV2 Q;  1MJC A;  4Y52 H;  4X62 L;  4JI1 L;  5C44 G;  2ZM6 Q;  1NY4 A;  2JQO A;  2KHI A;  4LFA L;  2UUC Q;  1J6Q A;  2E2J H;  3GTG H;  1E24 A;  1P16 A;  2IHE A;  2ZTC A;  4YHH Q;  4GLX A;  1VQE A;  4LUO A;  2NZO A;  4LF7 Q;  2R93 G;  1KRS A;  3T1Y L;  2K5H A;  4JYA Q;  4K0K Q;  2HQL A;  3TRZ A;  2NVY H;  4JI1 Q;  5GAH C;  3I7F A;  3RZO H;  5AJ3 L;  1V9P A;  2VW9 A;  4DV3 L;  2ZTE A;  4GOP B;  5LMN W;  2ES2 A;  1PHJ A;  1Z9F A;  1A0I A;  5FLM H;  5IWA L;  4DV7 Q;  4JI6 Q;  3HOV G;  3S2H H;  3RR5 A;  4HID A;  5ELN A;  4DR2 L;  5IP7 G;  2K14 A;  2B63 G;  2WAQ G;  2JEA I;  1VQJ A;  2K5N A;  2N3S A;  1WCM H;  3E0E A;  2CFM A;  4IJL A;  3J81 j;  5GAE C;  4A76 A;  4LWC A;  5C3E G;  1IBL Q;  1X65 A;  4YWM A;  3G4S A;  1E1O A;  4A3K H;  4JI0 Q;  1FL0 A;  1IBK Q;  1VQ6 A;  2ATW A;  3WWV A;  2A8V A;  4X65 Q;  2UU9 Q;  3M4O H;  1NMG A;  2QGQ A;  4JI6 L;  3M4P A;  1Z47 A;  2ASB A;  4EX5 A;  4X64 L;  2AHO B;  1QVG A;  3F1Z A;  4DR5 L;  1CKN A;  4YCU A;  1C7Y A;  4AIM A;  1UWV A;  2YTY A;  1IYJ B;  1Y14 B;  4O0A A;  4YY3 Q;  3F2D A;  2VQF L;  4B3S Q;  3CCJ A;  2R93 H;  4A3K G;  5JEA G;  4DR1 Q;  3I4M G;  2NZH A;  3A74 A;  4LF4 L;  2OQ0 A;  1AH9 A;  2WP8 J;  1H95 A;  2XTI A;  4A3M G;  5GRO A;  4A3C H;  2IX0 A;  3FHW A;  1GD7 A;  4X65 L;  5GAD C;  4PMW A;  2UU9 L;  1N32 L;  2IY5 B;  4QJF A;  3M7N A;  4R4O A;  4A3L G;  1MJE A;  5C44 H;  4B3T L;  4JI8 Q;  2D0P A;  2K50 A;  3B6Y A;  2A1A A;  3GO5 A;  1HZA A; 
#chains in the Genus database with same CATH topology
 4MTK A;  4JI4 L;  2EYH A;  1K73 C;  1STE A;  1X54 A;  4GNX A;  1DON A;  4TRD A;  1IYV A;  3BZK A;  4ILW A;  1HPC A;  1SYG A;  2L4N A;  3E9I A;  4K2K A;  4CHT B;  1S3O A;  1B8A A;  3S24 A;  1KL9 A;  1E1T A;  4KKU A;  1UE1 A;  4C3J B;  4LF4 Q;  4LF7 L;  2UXC L;  5ELE A;  1C4Q A;  5A2Q E;  4B08 A;  1D7Q A;  2VNU D;  1I5F A;  4LF9 L;  1HTP A;  4IN3 A;  2KHS A;  1U9R A;  1G29 1;  3PUW A;  4GKJ L;  1XWE A;  3HOY H;  1SE2 A;  5ISR A;  1G91 A;  1K3B C;  3IKJ A;  4C3H G;  3PUV A;  3TP8 A;  4XYO A;  1KDC A;  3KF6 B;  2DY7 A;  2PCF B;  3MC0 B;  3CCM A;  2WAQ B;  2SNS A;  5JOB A;  1KNA A;  4DK1 A;  1BF4 A;  1ZYR D;  4AQY L;  2BDO A;  3AB9 A;  4CDF C;  2XRS D;  4LUV A;  3D0F A;  1IXR A;  4MN3 A;  3TZD A;  2FIN B;  3QJY A;  3TSS A;  1MBY A;  4GNX C;  2F0O A;  1VQN A;  1F9R A;  3EN2 A;  3HOU B;  1HZ9 A;  4WOR A;  2N55 A;  2A73 B;  2JN4 A;  4RG1 A;  2JEB I;  5D65 A;  4B3T Q;  3ERQ A;  1PTO F;  4C3J H;  3GTK H;  3BDO A;  4YWL A;  1IBM L;  3PIO A;  3PO3 H;  4OIK A;  1LT5 D;  2VL6 A;  1SYE A;  1DGS A;  3CCR A;  2BE5 D;  3M7G A;  2XGT A;  2YTX A;  2SNM A;  2VZA A;  1ILP A;  1TS4 A;  1M90 C;  1I6H B;  3J81 c;  5FKA C;  1HTL D;  2MGS A;  4CKE A;  1KXL A;  4L5T A;  1BCP B;  2F0H A;  4PMC A;  2UXC Q;  1P8L A;  1EEI D;  3BVM A;  2B8G A;  3CAM A;  5M5X B;  4S3S A;  3N52 A;  4RAU C;  2F0P A;  3I8Z A;  3URY A;  4APV A;  1N32 Q;  4IUN A;  2B2Y C;  2ENB A;  1SFO H;  1TVX A;  1O80 A;  2ZTD A;  3BYT B;  3M3Y H;  5E1F A;  1SNO A;  5KGU A;  2R6G A;  1OXX K;  4KHP L;  5CYU A;  2MUY A;  3KJO A;  1EWI A;  3LX0 A;  1CUK A;  1G6Z A;  1Y1V B;  3X3M A;  1KAA A;  4KY7 A;  5IOC A;  2B8F A;  2ZM6 L;  2XSC A;  1NMF A;  4R8I A;  5C3X A;  3NE5 B;  2HIX A;  4O42 A;  4EQP A;  5D3I B;  2F3V A;  2JP1 A;  1K8O A;  4RGM A;  1LTI D;  3RLO A;  2KCC A;  1EYA A;  1LUZ A;  2JE6 I;  4O1N A;  4DKA C;  3VR2 A;  1EEF D;  5FO8 B;  1YJN A;  4IUV A;  3AFQ A;  4C3J G;  1EFI D;  1XNQ L;  4DK3 C;  2KHJ A;  1XPO A;  4A3F G;  3UDG A;  1Q46 A;  2F03 A;  3H91 A;  5BR8 Q;  1L1O A;  2CQA A;  3HKS A;  4HED A;  4F87 A;  3D4R A;  2M9V A;  2KCT A;  3J81 L;  3DLL A;  1LTB D;  4DR2 Q;  4UAI A;  4HJ9 A;  1PRT F;  4DR4 L;  4RGO S;  5IWA Q;  3W1G A;  3CPF A;  4RHR A;  1HXY D;  5C5M A;  1FNU A;  2LFN A;  4JI7 L;  4JG2 A;  2HD3 A;  3K58 A;  4A3M B;  3AFP A;  5IGE A;  4I7A A;  1TS2 A;  2Z4H A;  1PYS B;  4A3C G;  5KYL A;  3DMU A;  3K57 A;  1Q8I A;  3MXP A;  2AQ1 B;  1QZH A;  3VYU A;  1V1P B;  1WTH A;  3GTM H;  3A7L A;  3OMG A;  1DOK A;  1W3S A;  1GUG A;  1Y8N B;  3NK9 A;  3H3V I;  2PNH A;  4UDU C;  4DR5 Q;  3H15 A;  3SK8 A;  2M2L A;  2Q2I A;  1DOL A;  4L5Q A;  4QCL A;  5CBE E;  1N36 L;  5IY0 A;  2VUM G;  1RTO A;  4DUY L;  2MJ8 A;  4HAE A;  4A93 H;  5C3E B;  3HOX G;  4A3D H;  1J5E Q;  1STG A;  4MTN A;  2K5D A;  2PMZ E;  3BS1 A;  1OXS C;  2EY2 A;  2EYJ A;  2A6H D;  1GVP A;  5K5P A;  1R4Q B;  3FDT A;  3VR5 A;  1PZK D;  2VUM H;  3KBX A;  4U67 3;  2E2I H;  5C5L A;  4ALP A;  1TWH B;  5C4H A;  1MKH A;  2ZXP A;  3KLS A;  1CSQ A;  1RCV D;  3HZX A;  2ALY B;  4XXE A;  1ENC A;  4B3R Q;  1JJ2 A;  4JK1 C;  2MFI A;  5IGG A;  2B3G A;  3P1H A;  4P75 A;  4DV4 L;  2XWJ B;  4X3U A;  4A93 G;  3L3O C;  1PRT C;  4DV2 L;  1JWU D;  1PH3 A;  4F8M A;  4DV0 L;  4LJZ C;  1Q7Y C;  1XPU A;  1Z6H A;  1ET6 A;  2DGY A;  1CSP A;  1SXT A;  4OHJ A;  4UP8 A;  4TSS A;  3NSW A;  1EY0 A;  3BVG A;  4A75 A;  3PGZ A;  4M1U B;  1Y1W H;  2PI2 E;  1LM0 A;  4IPC A;  2K4K A;  2DN8 A;  3UDF A;  3R2T A;  1KLU D;  3I4N H;  1HR0 L;  3G6J B;  4YY3 L;  4H13 C;  1EIG A;  1SNM A;  1GUT A;  2RKS A;  1V1O A;  1L1O C;  4A3G B;  1Q90 A;  3DEP A;  3S2D B;  3PUX A;  3FKI H;  4QL5 A;  2E8G A;  4X3T A;  3BZD B;  4FF4 A;  1F2Z A;  3RNU A;  3U9O A;  1DXM A;  3TZU A;  4BXX H;  3EQL C;  1J5E L;  5JJL A;  4HMJ A;  4QF4 A;  5CV6 A;  3UE1 A;  2E5L Q;  3HOX B;  2KOL A;  3I4O A;  1TS3 A;  2K5V A;  4P73 A;  1VQL A;  2PZW A;  5IYC G;  3J80 c;  1D2B A;  1TS5 A;  1S5B D;  2LXK A;  3AEV A;  4NB3 A;  5KIX A;  1EYD A;  3KUP A;  1ICW A;  4GN3 B;  2AMC B;  3HOZ H;  2WB1 B;  2F0S A;  3HOU H;  2ZXR A;  3PF5 A;  3PMF A;  3U4V A;  1SE3 A;  1PTO B;  5IGD A;  1DCZ A;  4AYB B;  1EZ8 A;  3T1H Q;  1CHP D;  3BU2 A;  1IKL A;  4DR3 Q;  4EQ5 A;  1EY8 A;  1XMO Q;  1KTK A;  3TP5 A;  3S1N H;  2E75 C;  1VQA A;  5EKI A;  2H5X A;  5LMU Q;  4NDX A;  2Q2U A;  4PQX A;  3OIP A;  1SR3 A;  3QB3 A;  5C4Z A;  5LMN Q;  2JA6 G;  1G6P A;  4WFN 3;  4KTA A;  1WI5 A;  3L0O A;  5JPN C;  1J8I A;  4A3F B;  2G5D A;  1PMR A;  3A5U A;  1XJV A;  5DM7 3;  1K83 H;  3KLW A;  4DV3 Q;  1YHA A;  4IPH A;  5EJW A;  1ICF B;  4LMQ D;  1MGS A;  3S1R H;  1VF7 A;  4BY1 H;  3D6C A;  2CWP A;  3RZD H;  2LXJ A;  3CME A;  4M8A A;  3AMU A;  1CT1 D;  5LL6 X;  5G3L D;  4OGQ C;  3BDL A;  3FP9 A;  2A6H C;  2QDB A;  3U4Z A;  3Q23 A;  2R61 A;  1EFW A;  3BVZ A;  1SEB D;  2FHT A;  4JI7 Q;  1Y1V G;  2IPK D;  1D8L A;  1ESR A;  3KF8 B;  2NVX H;  1AW7 A;  1D6E C;  1AE3 A;  3CXC A;  2KQ3 A;  2NWG A;  3J80 E;  4V19 0;  5M5Y H;  1UAP A;  4PZ8 A;  4DAY B;  4JBW A;  2D9U A;  2M00 A;  3RD4 A;  3VA7 A;  3U50 C;  4C3H H;  1YI2 A;  3PIP 3;  3NTH A;  1BXT A;  1LT3 D;  4AYB E;  3HOZ G;  2I07 B;  3TQY A;  2R92 H;  2F0E A;  4RCO A;  1PYW D;  2PQE A;  2EYM A;  4LF5 L;  2I5H A;  3SGI A;  1SN8 A;  2NVT H;  2N49 A;  2JJQ A;  2A5H A;  4RH6 A;  1TWC H;  1VQF A;  1MJC A;  1A3V A;  1EQV A;  2R3Z A;  3T51 B;  2KHI A;  2J0T D;  3CHB D;  2UUC Q;  3NQI A;  1J6Q A;  2E2J H;  2FJ2 A;  1P16 A;  4GLX A;  3NWT A;  2R93 G;  1VF5 C;  1STB A;  4GOP B;  5IWA L;  1TII D;  4N9P A;  4DV7 Q;  4JI6 Q;  4YIJ A;  1GHK A;  5ELN A;  5IP7 G;  2PNR C;  2B63 G;  2WAQ G;  1VQJ A;  3J81 j;  2CFM A;  3KBG A;  4U68 A;  5GAE C;  1RD9 D;  1D1K A;  1W6K A;  1X65 A;  4YWM A;  4A3K H;  3HOV B;  2IX3 A;  2A8V A;  2QGQ A;  2EXZ A;  2AHO B;  5C4J B;  4DGZ A;  3F1Z A;  4DR5 L;  1IHZ A;  3VYS A;  4ZYS A;  4O0A A;  2K28 A;  4B3S Q;  4LF4 L;  4G7O C;  2FMM A;  4EVO A;  5GRO A;  4ULL A;  2A69 C;  2O5I C;  4R4O A;  5COY A;  4JI8 Q;  3I70 A;  1HZA A;  1EWH A;  3CRL C;  4OX9 Q;  1C9O A;  1F9P A;  3I91 A;  2WKC A;  3TEH B;  1PH7 A;  4DAV A;  2E2D C;  1HNW Q;  1MD2 D;  3ITP A;  1I4R A;  3KF6 A;  2VXW A;  1B3A A;  2E5L L;  4FXD A;  1IBM Q;  1PFN A;  2GVA A;  4FF1 A;  4A3D G;  3TDQ A;  4A3K B;  1YNJ D;  1A8V A;  1QNK A;  2Z8L A;  2HUG A;  1H9J A;  4N8X 1;  3SEB A;  2J4X A;  1CKM A;  5IGF A;  1YEZ A;  4GKK Q;  3RLN A;  3K59 A;  1PH2 A;  2L9H A;  4A3G H;  1PFB A;  2RDG A;  1ESF A;  4HJ7 A;  1GO3 E;  3F8T A;  3TP6 A;  2CHB D;  2QF7 A;  4V0B A;  4K8J A;  4PZ6 A;  4H0L C;  4DUY Q;  2KEE A;  2N78 A;  2F0I A;  3A55 A;  1QVF A;  1S40 A;  1NNX A;  1JB7 A;  4P72 A;  5CGK A;  2X6G A;  1U4M A;  4CGY B;  2D62 A;  3R93 A;  3C2P A;  2VB3 X;  5I9P A;  1N8R C;  5M3F G;  1PH6 A;  2MO1 A;  4QGU A;  1LTR D;  4XYQ A;  1EY6 A;  1I6V C;  2B2U C;  2RCN A;  5C0X I;  4IOA A;  4X64 Q;  1VQ5 A;  1SRO A;  3FMC A;  1BUV T;  2CCZ A;  4IPG A;  4B3S L;  1CM9 A;  5CMD A;  3KDF A;  3J81 i;  2AWN A;  4A3F H;  4HIK A;  1Q82 C;  2XWB B;  1VQM A;  4A3E G;  2PMZ B;  1IKM A;  1TWG H;  5IYB H;  3J81 E;  4NXM L;  2EVB A;  3RZD B;  2JA8 G;  2JA9 A;  1T5X D;  1TY0 A;  1BNZ A;  4A3B H;  5J22 A;  1L1O B;  1JOQ A;  4BY7 B;  2EYF A;  3H09 A;  1U4L A;  3QG1 A;  3GTO H;  4G4K A;  1ET9 A;  1PTO C;  1UE7 A;  3GTP H;  3ER0 A;  1KIX A;  4RKB A;  4OIJ A;  3EBE A;  5FLX c;  1K9M C;  2BE5 C;  3A8K E;  2VS1 A;  3X3N A;  1HUM A;  1K8M A;  2WAQ E;  2R7Z B;  3D8G A;  3ERS X;  3Q8D A;  3W2D A;  2G9D A;  1N34 Q;  3GTL B;  1PYB A;  2G9H D;  4MNO A;  2JA6 H;  2XNA C;  2EE1 A;  2R92 B;  4QMG A;  1A3T A;  3I55 A;  1IBL L;  4ZKB B;  4ZLT F;  4R4T A;  2JA7 B;  1QCB D;  2BCO A;  2UXB L;  2Z9H A;  3GV3 A;  1HZB A;  3E3X A;  2OT2 A;  5M3M G;  1TU2 B;  1WFQ A;  4NXN L;  1JT8 A;  1IW7 D;  2RHQ B;  3CC2 A;  5IE8 A;  4A4I A;  1EQT A;  4J15 A;  1XNR Q;  1ILQ A;  4CJ1 B;  3WDN A;  4A3I H;  1QG7 A;  2VQE Q;  4XQJ A;  2WV6 D;  3HRZ C;  3QWN A;  1JOO A;  3P20 A;  2OF1 A;  1IW7 C;  3MEF A;  1EOV A;  1R9T B;  4YWK A;  3CQZ H;  3QO2 A;  4OWT B;  1AZP A;  1I94 Q;  3P75 A;  3GTP B;  1YHQ A;  1CKO A;  1YNN D;  2LS0 1;  1X32 A;  4KD3 A;  1QNU A;  2BA1 A;  3NWS A;  3NUC A;  1QJO A;  1PDQ A;  3EA6 A;  1VQP A;  3OWF A;  2I0Q A;  1KLG D;  3KF8 A;  1X3G A;  1VQB A;  2KEN A;  3T16 A;  3CKI B;  1VS0 A;  3OW7 A;  3PQI A;  1EU4 A;  4FYD A;  1KQS A;  4PG3 A;  2GA4 B;  3T1Y Q;  3CCE A;  3GTJ H;  3I4N G;  1RL2 A;  1EYG A;  3BZC A;  4A3L H;  3M4Y A;  1LTT D;  3Q0A A;  4A3D B;  1KRT A;  2K75 A;  4IUU A;  1FR3 A;  3ICE A;  2B63 H;  1WVL A;  2ZT9 C;  2I5M X;  5ELO A;  3GTK B;  2PZT A;  5EPL A;  4BBS G;  1QUQ A;  3GTM B;  1EIF A;  1GHJ A;  1OXV A;  3CCV A;  2E2I B;  4KJN A;  3L9A X;  2JA7 G;  4BBS H;  2UXB Q;  1I50 B;  2JSO A;  3ULL A;  4WJ3 M;  3QR8 A;  5ELB A;  3F2C A;  2KCM A;  3H6M A;  5I2Y A;  3I4M H;  1H9K A;  4QQB X;  2WKD A;  2YTV A;  1PV4 A;  4JI5 Q;  1T5E A;  1K0S A;  1SJH D;  1QVC A;  3ZYY X;  3NBH B;  3RZO B;  1TWA B;  1K8A C;  1B1Z A;  1J9O A;  1O7Z A;  3VR3 A;  1EUJ A;  2F0Q A;  3AQQ A;  2KCN A;  3W5O A;  1CI3 M;  3KLS X;  5JJK A;  2GN5 A;  2A19 A;  1CQV A;  1UNS A;  2O2L D;  3Q6S A;  3K81 C;  1S5D D;  2UXD Q;  3SE0 A;  3MTS A;  2EY1 A;  4OX9 L;  4C56 C;  2Y0S E;  2JA5 G;  2RA4 A;  3M4O B;  2IX1 A;  4XTC S;  5BN5 A;  5JAV A;  4DUZ L;  4NPS A;  4A3E B;  4JCV E;  3K0X A;  4JV5 L;  1QIL A;  1MI2 A;  1SMY C;  1B9M A;  1E7Z A;  1Y8O B;  4QUF A;  2O4X A;  4L63 B;  1TWF H;  2VQF Q;  4C2M H;  4DNI A;  2I5L X;  1YBY A;  2RVL A;  3T4A C;  1UEB A;  3NEM A;  4GZY C;  3QOJ A;  4GKJ Q;  4DV1 Q;  3GQB A;  3KYH C;  3J7Y W;  1Q3L A;  3S17 B;  1LV9 A;  4X66 L;  2F0F A;  1MIU A;  2Q2H A;  4G7Z C;  4N9T A;  4RGT A;  1ZKO A;  4DU9 A;  4C1N K;  2F0J A;  1YNX A;  2K6A A;  1B3Q A;  2K04 A;  1HA6 A;  3HOZ B;  3STB D;  1VMC A;  4BWG B;  1YNN C;  1Q8K A;  1DZ1 A;  4X3S A;  3S1M B;  1PH9 A;  1E2Z A;  1SYC A;  1NR2 A;  2Y0S B;  5IYC H;  1ZEQ X;  3PO2 G;  3DM3 A;  5J39 A;  4LFB L;  1WD0 A;  1VQD A;  1FNW A;  1UE6 A;  2MNA A;  5HY6 A;  4L5R C;  4XT3 B;  1Y8P B;  4JI2 L;  1FVI A;  2DY8 A;  4JBJ A;  5KEE A;  5C4X G;  3OW2 A;  4HCE A;  3PUY A;  2K52 A;  1NE3 A;  5I4D A;  5J3B A;  4IUP A;  1S4Z A;  4BY7 H;  1XYI A;  3GTQ B;  2ZJP A;  1LTL A;  1I4P A;  2JA8 H;  4JV5 Q;  5C0X G;  1IZ6 A;  3ND8 A;  2A6E D;  2K33 A;  5GQO A;  1PTO D;  3S17 H;  2OEO A;  2F0U A;  3HS0 C;  3IL8 A;  5FLX E;  3K80 C;  3JAM E;  3K0Y A;  4DR4 Q;  5HGT A;  2JA6 B;  2PI2 A;  1YJW A;  3H3V H;  3DWQ A;  3K7A B;  4ME5 A;  2RHS B;  3RUZ A;  3D31 A;  3JAM i;  3PO3 G;  1FD7 D;  5CR3 A;  3HEJ A;  1YIT A;  4ZKC B;  2UUC L;  2J7Z A;  4CJ2 C;  3U9S A;  1EU3 A;  4DV2 Q;  4Y52 H;  2RSN A;  2ZM6 Q;  4FF3 A;  3R2I A;  1XX8 A;  4LFA L;  2IHE A;  2ZTC A;  1SBB B;  4C1N I;  3NBI A;  3GP7 A;  3CQZ B;  3T1Y L;  2QW7 A;  2NVY H;  4JI1 Q;  4DK0 A;  1NUC A;  5AJ3 L;  1SFO B;  1CZG A;  4MIU A;  3HOV G;  3S2H H;  4HID A;  4DR2 L;  1STY A;  1WCM H;  1CQF A;  3PIO 3;  4LWC A;  1BO0 A;  3SK6 A;  1IBL Q;  3I4L A;  5FOB B;  4JI0 Q;  3LWE A;  4X65 Q;  3C46 A;  4CDE C;  3M4P A;  1Z47 A;  1LLR D;  4DNR B;  3VA5 A;  3EFX D;  1G2T A;  1PXU A;  2YTY A;  1IYJ B;  1ENA A;  3F2D A;  3A54 A;  5JEA G;  1ENF A;  1QE6 A;  3A74 A;  3GTJ B;  5CV4 A;  4I7Z C;  1TR5 A;  4A3C H;  1N32 L;  4X65 L;  4PMW A;  3O13 A;  2EZV A;  4QJF A;  5T1G A;  3M7N A;  3S9W A;  1MJE A;  1D1I A;  3JAM L;  3FVQ A;  3B6Y A;  1E0B A;  1SNQ A;  1JE4 A;  4KHP Q;  4Z9C B;  2Z6B A;  1I3Q H;  1XXG A;  4Q5V A;  3CMA A;  5M3M H;  1JWS D;  1WYD A;  3RLF A;  5IT9 c;  2UUA L;  1SLJ A;  2E74 C;  4WJW A;  2F0M A;  1JOK A;  5KRU A;  3UE0 A;  1HNZ L;  4NKL A;  1Q86 C;  2B39 A;  1B7Y B;  2KVM A;  5F2D A;  1B9N A;  1BBW A;  1QUQ B;  4L5S A;  2NN6 G;  1HQM C;  2TMP A;  1GM5 A;  2MHV A;  1CKN B;  3TP7 A;  2EYO A;  4A3J H;  2NTT A;  1FNV A;  1WTX A;  1AN8 A;  4LF5 Q;  4JI0 L;  4K6L A;  1I4H A;  4HIO A;  3G7L A;  2OWO A;  3F2U A;  2CW0 C;  5D3D A;  1EY5 A;  3MAQ A;  2RDH A;  3NEL A;  1SYD A;  4F88 A;  4P74 A;  2VUM B;  4AH6 A;  4DV0 Q;  4AQY Q;  4QIW B;  1SJE D;  3HG9 A;  4ZUJ A;  4C3I B;  5AJ3 Q;  2LKV A;  1PH1 A;  3CD6 A;  1B44 D;  1I6H H;  1YNJ C;  2KEC A;  4IOC A;  5IYB G;  3JAM c;  4BA2 I;  1VQK A;  4GLA C;  4XT1 B;  4GOP A;  2L12 A;  5I6W A;  3DWA A;  1GUS A;  3TS0 A;  2XN9 C;  3C1F A;  5EPJ A;  3CP0 A;  1K28 A;  4IUR A;  4C2M B;  4ZQ3 A;  2IHF A;  1S5F D;  3GV6 A;  1Y69 U;  2Q8T A;  4AYB G;  4IFD J;  1X6O A;  3GD7 A;  1YJ9 A;  1WOC A;  4ZRZ A;  3NXW A;  4DNT B;  2F0D A;  1CFM A;  5COR A;  5ELD A;  1D5Z C;  1CHQ D;  2B29 A;  4RMF A;  5M9O A;  1Q81 C;  2HIV A;  3K5O A;  4GN4 B;  4ABN A;  4ZK9 B;  4A3J B;  4Y7N H;  4C3I G;  4H02 A;  5EGT A;  4J1M A;  2YU9 H;  4RFB A;  5FK9 C;  4QIW E;  2HCI A;  4RWS C;  1WTO A;  3OHX C;  5JJI A;  1STA A;  2PW7 A;  2F0W A;  1TXY A;  3S1Q H;  4JI8 L;  4E6I A;  1AFP A;  2ICE C;  3PV0 A;  2RSO A;  4TQU S;  4H7B A;  1HZC A;  2A74 C;  1EQR A;  1VCI A;  4UPA A;  3T1H L;  1EWC A;  4OWX B;  4IFD I;  1N33 L;  1YIJ A;  5BN3 A;  3HOY G;  1A6X A;  3OIQ A;  5C4J H;  1RIP A;  1GUN A;  2B2W C;  5LHY 1;  2JA5 H;  4POF A;  2F4I A;  3GTQ H;  2PO4 A;  4N8F A;  5IYD G;  1X3F A;  5E3F A;  1VQ8 A;  1B53 A;  1BCP D;  3EIV A;  3VR4 A;  4CDC C;  1K3R A;  1NCV A;  1BCP F;  2K05 A;  1STN A;  1GKH A;  1M1K C;  2D0O A;  2FMC A;  4JYA L;  5BR8 L;  1ASZ A;  4IFD G;  3SDZ A;  2LSS A;  3GTO B;  3OYY A;  1FJG Q;  2B2T C;  3OMC A;  3A8J E;  2B2W A;  2ZJQ A;  1STH A;  4CKB A;  2YU9 B;  2PQA B;  4JI3 Q;  3HOW H;  3G6E A;  3ULJ A;  4A93 B;  1NBW A;  4KKS A;  2F1M A;  1HUN A;  3C3L A;  3GTG B;  1PA6 A;  4DV6 L;  4LF6 Q;  1RHP A;  3BYY B;  3FEW X;  1NJI C;  3MXN A;  4IJH A;  2XVS A;  2EYL A;  2EDG A;  1HJP A;  4XDX A;  4DR7 Q;  3FKI G;  2JA7 H;  5I2X A;  2F0N A;  1NTG A;  2QEX A;  1UEA B;  1JOR A;  3K8A A;  1HHV A;  2NN6 H;  3MEH A;  4HSV A;  1WTV A;  3K7U C;  3CC4 A;  3DXJ C;  4FNF A;  4JOI C;  3S2H B;  1LTG D;  3NPP A;  1CZW A;  1AEX A;  2R7Z H;  1DM0 B;  3PIP A;  1DD2 A;  3G71 A;  3EVQ A;  2NBF A;  2C35 B;  3AYH B;  2PPB C;  3KDF B;  5CV9 A;  1SE8 A;  5FLM G;  1ML0 D;  1U4P A;  1E2W A;  1HRJ A;  4O2D A;  1N9W A;  3UI2 A;  4DA2 A;  2YYZ A;  1L0X B;  2Z4I A;  3KLR A;  4B3M L;  4B3R L;  2F3W A;  1HNZ Q;  5C3E H;  3K6O A;  4OO1 G;  3VYR A;  3QOL A;  4FP5 D;  1M8A A;  1PLF A;  2MP1 A;  3OSO A;  4XIG S;  1L0W A;  1JC7 A;  1PH5 A;  1H9S B;  2N8N A;  2D2C C;  1PFM A;  3PO3 B;  1LT6 D;  4HJ8 A;  4R4Q A;  1HNX Q;  4ZAI A;  1X55 A;  1CA5 A;  2AKW B;  3HP3 A;  1PZI D;  2RF4 A;  3S2D H;  4FF2 A;  4IFD H;  4DV5 L;  4R1J A;  2NUC A;  3N6R A;  2CH4 A;  2P5Z X;  4LUZ A;  1TWG B;  2DNE A;  5JEA H;  1XNQ Q;  2E2J B;  3HOX H;  2TSS A;  3M3Y B;  4IUQ A;  1VQ4 A;  4EQO A;  4YHH L;  1SAP A;  4ID6 A;  1E2V A;  4POG A;  4DV6 Q;  1Y1V H;  3J80 i;  1TQO A;  3UDI A;  1HFG A;  1EZ6 A;  1PRT D;  2WII B;  4LFC Q;  2F4V Q;  1S72 A;  1EIY B;  4YCV A;  5HUR A;  3PO2 B;  5DM6 3;  2BDN A;  3HOV H;  2Y0S G;  1I94 L;  4HN7 A;  4J8Q A;  4R9W A;  2UUB Q;  1LT4 D;  1HR0 W;  1TWA H;  2PZU A;  3S16 B;  3GDE A;  3GTL H;  3FPP A;  2HT1 A;  1G51 A;  2QDL A;  5I6Y A;  3FKI B;  3BJU A;  2K01 A;  4HCS A;  2KJX A;  4YCW A;  3H3V C;  2HQE A;  4OXP A;  3Q22 A;  3CF5 A;  5K36 G;  1K83 B;  2E2H H;  4DK6 C;  5C44 B;  3DM1 A;  2BH2 A;  1HFN A;  4OON A;  4LF9 Q;  4LFB Q;  1IBK L;  2RDF A;  5IGB A;  4DV5 Q;  1SRU A;  4P71 A;  2Z6K C;  4DAY A;  3BG3 A;  2CH4 W;  2F0V A;  3VR6 A;  3HOU G;  2XIW A;  2KA7 A;  2Q8I B;  2Z0S A;  2DJF C;  5LL6 S;  3OTO Q;  3CC7 A;  2FFK B;  3RN5 A;  5FJ8 G;  4FXK C;  4NMZ A;  3U58 A;  2HHH L;  5NUC A;  3KJP A;  4FVM A;  1WD1 A;  1E22 A;  2MO0 A;  1XTC D;  2RBM A;  3S1N B;  5K36 H;  4P2C B;  2VQE L;  1QB5 D;  3MWY W;  4TVA B;  4KLK A;  4C3H B;  5IP9 H;  3R3O A;  4GOP C;  2ZJR A;  3Q24 A;  1VQC A;  4BXX G;  3HOY B;  3S16 H;  5CV5 A;  3A7A B;  4A3E H;  1ZXT A;  4HTH A;  5ELC A;  1JR0 D;  1SDF A;  3L7Z C;  1A63 A;  3MZ5 A;  2A68 D;  4R4I A;  2NN6 I;  5IP9 G;  3KFU A;  1L2F A;  1O7Y A;  2CW0 D;  2MPM A;  2HDL A;  5FO7 B;  3HKZ G;  2CQO A;  4B9X A;  1K0R A;  3MXU A;  3DHQ A;  1AE2 A;  1XPR A;  3HGB A;  3SVM A;  1HR0 Q;  5FJ8 H;  1OTC A;  4L6T B;  4ZCK A;  4JI5 L;  2EXD A;  4JI3 L;  3NQT A;  3M85 A;  1BDO A;  1TT2 A;  1HQR D;  1U5K A;  3MVV A;  4A3J G;  1R4P B;  2GVB A;  1JB3 A;  1F2L A;  1GUO A;  2O5J C;  3CPW A;  1NSN S;  2DNC A;  2PYK A;  4RCN A;  2Z1C A;  1V8Q A;  2L5T A;  4BBS B;  1A3U A;  2OXP A;  3D3R A;  3MHB A;  4JI1 L;  1NY4 A;  2JQO A;  2V4D A;  3GTG H;  1F77 A;  2QEJ C;  3WOF A;  4H44 C;  3I4N B;  3MFG A;  1KRS A;  4KK7 A;  3SR1 A;  4JYA Q;  2HQL A;  3I7F A;  2VW9 A;  2ZTE A;  2ES2 A;  5LMN W;  2EY5 A;  1PHJ A;  3T56 B;  1NR4 A;  2IL8 A;  5BN4 A;  4KN4 C;  4OL7 A;  1TWC B;  2K14 A;  2K5N A;  4IJL A;  1M4V A;  4MHE A;  4A76 A;  4BBR B;  1DJR D;  3S15 B;  4OO1 H;  3V96 A;  2WAC A;  1E1O A;  3D6W A;  5CV7 A;  4KV6 A;  1FL0 A;  4A3B B;  1ONL A;  2ATW A;  4KY6 A;  2UU9 Q;  2NTS A;  1NMG A;  1JQY D;  1B2T A;  4EX5 A;  3J80 L;  2SEB D;  1CKN A;  4YCU A;  3LWU A;  1C7Y A;  1F2Y A;  1UWV A;  2D5D A;  2VQF L;  2L0C A;  4QUC A;  3I4M G;  3DEO A;  3S14 B;  1C48 A;  1TWF B;  1TY2 A;  2OQ0 A;  2K1B A;  2XTI A;  2UU9 L;  1GD7 A;  5GAD C;  4G7H C;  3TME A;  2XRQ D;  3GO5 A;  1I4Q A;  1A15 A;  3WOE A;  2ICI A;  3T53 B;  4PZ7 A;  4PV1 C;  3R8B A;  3ERO A;  5G3L F;  4DN4 M;  1N36 Q;  3RN2 A;  2IW3 A;  4A3M H;  4CJ0 B;  2R92 G;  5H1S E;  3A56 A;  2FXQ A;  5J1Z A;  4LF8 L;  2R7Z G;  2F0G A;  2UUB L;  2JYO A;  3CCS A;  3M4Q A;  5IP7 H;  1BVS A;  3S1R B;  2SDF A;  1VMP A;  3ONA B;  1SNC A;  3FPU B;  1I3Q B;  2WFW A;  3CCQ A;  4OEL B;  3I3C A;  1UE5 A;  4BY7 G;  3NEN A;  1G8Z D;  2X69 A;  4KHZ A;  4G57 A;  1YZ6 A;  4LF8 Q;  1V43 A;  2C5C A;  4DR6 Q;  2L11 A;  1SSO A;  4NXN Q;  2EQS A;  3S14 H;  2NVX B;  5E4W C;  1I4X A;  4BA1 I;  2NZ1 D;  4GN5 A;  5JJZ A;  1HNX L;  3HOW G;  2QKI C;  2JA8 B;  1EOT A;  2L1B A;  4BS9 A;  1EY4 A;  4BY1 G;  1WTP A;  1ASY A;  4JBK A;  4GNX B;  1KAW A;  3SXH A;  1ROD A;  4IZ8 A;  3PCO B;  3CU7 A;  3CCU A;  5C3W A;  4IAL A;  5M5X H;  1F9S A;  4LNQ A;  1B50 A;  4DAM A;  5IGC A;  2E2H B;  3ND9 A;  5FLX L;  3K7A H;  4LFC L;  2F4V L;  1H9S A;  3C1E A;  1X3P A;  5IYD H;  2CKZ B;  2NYZ D;  5DNF A;  3TRE A;  2V1C C;  4ODG A;  2MQH A;  2NVT B;  2CVR A;  3P7J A;  3OPO A;  1LAB A;  3OOC A;  4K5W A;  1FJG L;  2QA4 A;  1KDB A;  3G48 A;  4EGV A;  4CKC A;  2H1E A;  2OCE A;  5M3F B;  4CDD C;  5KNB A;  2KBN A;  1KAB A;  1V1Q A;  5IIF A;  3A5Z B;  1IYU A;  3DWP A;  4PNY A;  3CRK C;  1PZJ D;  3IAY A;  4WJ4 A;  4NXM Q;  1Q12 A;  1B70 B;  3I72 A;  1FGU A;  1KHI A;  4DPG A;  4HJ5 A;  1EL0 A;  3PSI A;  4KMU C;  5IOD A;  1WJJ A;  4R8N A;  2L15 A;  3KOJ A;  2K5Q A;  1WCM B;  3K5L A;  5KND A;  3L2P A;  4FXG C;  4K5V A;  1EY7 A;  3H0G B;  3SK5 A;  2CWA A;  5ELF A;  3RMH A;  1RJT A;  4C3I H;  4DV1 L;  1N33 Q;  1IL2 A;  1GXD C;  1F2M A;  1W2B A;  4X66 Q;  2X6L A;  5C4X B;  4NP5 A;  1PRT B;  4RKL A;  1X3Q A;  5GAG C;  2R7D A;  4X62 Q;  2OQK A;  4Y7N B;  1RDP D;  4J6H A;  2Z6K A;  2PQA A;  1MHW C;  1F9Q A;  1JJC B;  1LAC A;  2A6E C;  3DUZ A;  4FO2 A;  1XMQ Q;  1PH8 A;  2F0L A;  1I4G A;  4HMI A;  2EJM A;  4WRD A;  1PVO A;  2I46 A;  2DUD A;  1O7I A;  1U4R A;  3OTO L;  4DV7 L;  4DXG A;  3MXN B;  4PMB A;  5C6A A;  2NVQ B;  5T1I A;  3LNN A;  1DYQ A;  1BBU A;  4A3I B;  5HGQ A;  3E5S A;  3I90 A;  4K0K L;  1TWH H;  1WTR A;  2VY3 A;  4LAA A;  1XMQ L;  1MSH A;  5DLQ E;  1OXU A;  2K32 A;  2R7F A;  4LFA Q;  4GLV B;  3CCL A;  1KNE A;  1NAP A;  5EKL A;  5CV8 A;  4UHV A;  4HIM A;  4B9W A;  1KC8 C;  1YHB A;  1Y1W G;  3J7A F;  1D5M C;  3S1Q B;  3SK4 A;  1VQH A;  3STB C;  1C8C A;  1SYB A;  3H0G H;  5KNC A;  4HR7 B;  2RQX A;  4K2L A;  1XNR L;  3ZJY C;  4DAP A;  2UUA Q;  1BKB A;  2E76 C;  2NB0 A;  4BY1 B;  4IPD A;  1GOZ A;  2EYP A;  2B2V C;  4BBR H;  3S15 H;  3HOW B;  1YVC A;  1AZQ A;  1VQO A;  2OTJ A;  1B4O A;  1O7L A;  4JI4 Q;  2JA5 B;  1XTD A;  2B63 B;  2BOS A;  2IT1 A;  4MZ9 A;  1CA6 A;  5C0X J;  1LTA D;  3J7Z C;  2C9O A;  4ME3 A;  1HCZ A;  4DR3 L;  1XMO L;  3I2Z A;  1JJG A;  1SNP A;  4UP9 A;  2R93 B;  2WB1 E;  1R9T H;  1I50 H;  2F52 A;  1KD1 C;  3K5M A;  3FRP B;  4NW2 A;  1L0Y B;  4KJO A;  5LMU L;  2B2V A;  2A68 C;  2EIF A;  1Y1W B;  3PUZ A;  3UDX A;  5FO9 B;  2EJG C;  4KD4 A;  2YV5 A;  1Q1B A;  4KKT A;  1S5E D;  1Z7T A;  4JW0 A;  1FGB D;  2B2Y A;  5EPK A;  5M5W H;  4DUZ Q;  4FDB A;  3M9B A;  1V1P A;  2VB2 X;  1LTS D;  2ID0 A;  1VQ9 A;  2BA0 A;  3D4D A;  1DOM A;  1Q1E A;  4X6A H;  1VQI A;  3ULP A;  4A3I G;  2ZXO A;  1G2S A;  3NTK A;  1PH4 A;  3F2B A;  4K6D A;  1KDA A;  3HFZ B;  2LY7 A;  5L37 A;  3W3A A;  1EYC A;  4OWW B;  2AUJ D;  5EQ0 A;  5KYI A;  4JOI A;  1HH2 P;  5JVG 3;  4OEM B;  3SHL A;  3V2T A;  4OO1 I;  2EJF C;  3I73 A;  1OO9 B;  1E3P A;  1JIC A;  2NVY B;  3LGJ A;  2AQ2 B;  3MA2 B;  2KED A;  2B2U A;  1T9H A;  1A2U A;  1VQ7 A;  4I65 A;  1SYF A;  4GKK L;  1BQQ T;  4EQN A;  3H0G G;  1EIH A;  1CK1 A;  5DAU A;  3TN2 A;  3HKZ E;  3TS2 A;  1WCM G;  2KUM A;  4A3B G;  4KN7 C;  2Q8R E;  5CBA E;  3VYT A;  1PTO H;  5EBD A;  4BBR G;  4IO9 A;  3H94 A;  2F3I A;  5TSS A;  3TBI B;  2QIL A;  3NTI A;  4XQQ A;  4LW1 A;  5A35 A;  5M5W B;  2F0T A;  3T13 A;  3VDY A;  1RF2 D;  4RHS A;  3IRB A;  4DV4 Q;  3NP8 A;  5DEH A;  4DR1 L;  3PF4 A;  2EOT A;  3J7A V;  5EKK A;  4DR6 L;  1FYC A;  1EQQ A;  1ZYR C;  3S1M H;  5E4X A;  1JMC A;  3NBH A;  5M5Y B;  4JC0 A;  1X56 A;  5E7N A;  3NHH A;  2AWO A;  4ZUI A;  4Q0F A;  2EPB A;  1QWY A;  3JC6 6;  1VQG A;  2Q2T A;  5M3M B;  2WB1 G;  2BH8 A;  1PFS A;  2A69 D;  2HHH Q;  4IUT A;  4X3K A;  1X9N A;  5JEA J;  2LMC B;  3IFD A;  5M3F H;  4K14 A;  3MFY A;  3V05 A;  3E0J A;  1N34 L;  2WIN B;  1HNW L;  5C0X H;  4QY7 A;  3PO2 H;  3E9H A;  4K5X A;  5LMN L;  4DR7 L;  1A62 A;  1OXT A;  2AQ3 B;  3HKZ B;  5C4X H;  1A2T A;  4KI0 A;  1WTW A;  4KHV A;  3E6Z X;  1W6J A;  2IJ0 A;  3I56 A;  4F7X A;  2HCC A;  5A2Q L;  4JI2 Q;  3KK7 A;  5I9O A;  2H4O A;  4A3G G;  4K8I A;  4HJA A;  3J7A 5;  1K8G A;  4UY8 C;  4R4C A;  3W1B A;  4DF7 A;  4B3M Q;  2B2T A;  3BDC A;  1U0L A;  1H9R A;  1SND A;  1X3E A;  3K5N A;  2NVQ H;  1WTQ A;  1JWM D;  2OTL A;  2JK8 A;  4QB4 A;  3CW2 C;  1SMX A;  1JE5 A;  1BBX C;  3AU7 A;  2AUK A;  1BR9 A;  2K03 A;  1VDZ A;  4JPB W;  1MSG A;  5EAY A;  4HSP A;  2UXD L;  1JCK B;  3A0J A;  1QZG A;  1C0A A;  4JBM A;  1GJX A;  1EY9 A;  4IQZ A;  3QIA A;  2QCP X;  2JXM B;  4GS3 A;  4UP7 A;  1LYL A;  1BOS A;  2L55 A;  4LK1 C;  4LF6 L;  2PW5 A;  5JVH 3;  3A8I E;  5AFW A;  2HDM A;  3OWE B;  4X62 L;  5C44 G;  4TKO B;  1TKW B;  4CBV A;  4KY5 A;  4RA8 A;  5JPM C;  3I4M B;  5EBC A;  1E24 A;  4YHH Q;  1VQE A;  4LUO A;  1SMY D;  2NZO A;  3D4W A;  1CTM A;  4LF7 Q;  1D5X C;  2K5H A;  4K0K Q;  3TRZ A;  5GAH C;  5IT9 L;  3RZO H;  4JVZ A;  1V9P A;  2RCF A;  4RGN A;  4DV3 L;  1Z9F A;  1A0I A;  5FLM H;  1SE4 A;  3RR5 A;  2JEA I;  2N3S A;  3E0E A;  5IT9 E;  5CC4 A;  4DXF A;  3IFT A;  2K5W A;  5C3E G;  3G4S A;  1IL8 A;  1QOH A;  5D14 A;  1LO5 D;  1S5C D;  1IBK Q;  1VQ6 A;  3WWV A;  4L8J A;  3M4O H;  4JI6 L;  2EY6 A;  2ASB A;  1AP0 A;  4X64 L;  1QVG A;  2N88 A;  1UUP A;  1II3 A;  2IWH A;  4DFA A;  2DJG C;  1RTN A;  1RKN A;  4AIM A;  1HA5 A;  2K7V A;  1Y14 B;  3EJI A;  4YY3 Q;  3CCJ A;  2R93 H;  4A3K G;  4DR1 Q;  1BCP C;  1GUW A;  2F0K A;  2NZH A;  1O78 A;  2SOB A;  1AH9 A;  2WP8 J;  4XQN A;  1H95 A;  4A3M G;  2IX0 A;  3FHW A;  2IY5 B;  1H9M A;  4A3L G;  5C44 H;  4B3T L;  2D0P A;  2K50 A;  2A1A A;  3MXG A; 
#chains in the Genus database with same CATH homology
 4JI4 L;  1I3Q H;  1K73 C;  4PZ7 A;  4GNX A;  1X54 A;  4OX9 Q;  3CMA A;  5M3M H;  1C9O A;  1N36 Q;  3BZK A;  1WYD A;  3RN2 A;  1PH7 A;  3TEH B;  3E9I A;  3RLF A;  4A3M H;  1S3O A;  2R92 G;  5H1S E;  1B8A A;  3S24 A;  1KL9 A;  2FXQ A;  5IT9 c;  1HNW Q;  1E1T A;  2UUA L;  4LF8 L;  2R7Z G;  1SLJ A;  1UE1 A;  3KF6 A;  2E5L L;  2UUB L;  4LF4 Q;  4LF7 L;  2UXC L;  1IBM Q;  3CCS A;  3UE0 A;  1HNZ L;  2GVA A;  1KQS A;  3M4Q A;  4A3D G;  5IP7 H;  1Q86 C;  1BVS A;  1A8V A;  1B7Y B;  1BBW A;  1QUQ B;  4L5S A;  2NN6 G;  2VNU D;  1I5F A;  1D7Q A;  4LF9 L;  1CKM A;  1YEZ A;  2WFW A;  3CCQ A;  1GM5 A;  4BY7 G;  4GKK Q;  1UE5 A;  1VQ8 A;  1G29 1;  3PUW A;  4GKJ L;  3RLN A;  1CKN B;  3NEN A;  1PH2 A;  3HOY H;  4KHZ A;  4A3J H;  4LF8 Q;  1YZ6 A;  4A3G H;  1V43 A;  4LF5 Q;  4JI0 L;  4DR6 Q;  4HJ7 A;  1GO3 E;  3F8T A;  3PUV A;  4HIO A;  2OWO A;  4NXN Q;  2EQS A;  3S14 H;  3KF6 B;  4PZ6 A;  3CCM A;  4DUY Q;  2N78 A;  4BA1 I;  3NEL A;  1HNX L;  4GN5 A;  1QVF A;  3HOW G;  1S40 A;  4P74 A;  1JB7 A;  4P72 A;  4AH6 A;  4DV0 Q;  4AQY Q;  4AQY L;  4BY1 G;  5AJ3 Q;  1ASY A;  4LUV A;  3D0F A;  1IXR A;  1PH1 A;  3CD6 A;  4JBK A;  1I6H H;  4GNX B;  4IOC A;  2D62 A;  1KAW A;  4GNX C;  1VQN A;  5IYB G;  3JAM c;  3PCO B;  3EN2 A;  1N8R C;  5M3F G;  3CCU A;  4BA2 I;  1PH6 A;  1VQK A;  2MO1 A;  1HZ9 A;  4QGU A;  4LNQ A;  5M5X H;  4GLA C;  4DAM A;  4GOP A;  4RG1 A;  3K7A H;  4LFC L;  2F4V L;  2JEB I;  3TS0 A;  4B3T Q;  5IYD H;  2CKZ B;  3CP0 A;  3TRE A;  2RCN A;  5C0X I;  4IOA A;  2V1C C;  4C3J H;  2MQH A;  3GTK H;  4YWL A;  1IBM L;  2IHF A;  4X64 Q;  1VQ5 A;  3PIO A;  3PO3 H;  1SRO A;  4AYB G;  2VL6 A;  2CCZ A;  4IFD J;  1DGS A;  1X6O A;  4IPG A;  3CCR A;  3GD7 A;  1YJ9 A;  1WOC A;  2XGT A;  4B3S L;  2QA4 A;  1FJG L;  2YTX A;  3G48 A;  2VZA A;  1M90 C;  3KDF A;  3J81 c;  3J81 i;  2AWN A;  2OCE A;  1KXL A;  4L5T A;  2B29 A;  4RMF A;  2KBN A;  1Q81 C;  4A3F H;  1V1Q A;  2HIV A;  2UXC Q;  4HIK A;  4GN4 B;  1Q82 C;  1VQM A;  1P8L A;  4A3E G;  3CAM A;  3A5Z B;  4Y7N H;  1TWG H;  4H02 A;  5IYB H;  4WJ4 A;  2YU9 H;  4NXM L;  4NXM Q;  1Q12 A;  1B70 B;  4QIW E;  1FGU A;  4APV A;  1KHI A;  2JA8 G;  4DPG A;  1N32 Q;  4HJ5 A;  1SFO H;  2ZTD A;  3PSI A;  3M3Y H;  5JJI A;  2JA9 A;  2R6G A;  1OXX K;  1TXY A;  1WJJ A;  2L15 A;  3S1Q H;  4KHP L;  3KOJ A;  3KJO A;  1EWI A;  4JI8 L;  3L2P A;  1CUK A;  3PV0 A;  4DV1 L;  2CWA A;  1N33 Q;  4C3I H;  4TQU S;  1IL2 A;  1HZC A;  1W2B A;  1EQR A;  4A3B H;  4X66 Q;  1L1O B;  1VCI A;  4UPA A;  2ZM6 L;  3T1H L;  1NMF A;  5GAG C;  2R7D A;  4X62 Q;  1A63 A;  4OWX B;  4IFD I;  2HIX A;  1N33 L;  1YIJ A;  2OQK A;  3GTO H;  3HOY G;  2Z6K A;  5C4J H;  2PQA A;  1UE7 A;  1JJC B;  1RIP A;  3RLO A;  1XMQ Q;  3GTP H;  1PH8 A;  1LUZ A;  3ER0 A;  2JE6 I;  1KIX A;  2JA5 H;  4DKA C;  3EBE A;  5FLX c;  1K9M C;  4POF A;  1YJN A;  1PVO A;  3GTQ H;  3AFQ A;  2DUD A;  2VS1 A;  2WAQ E;  1XNQ L;  1O7I A;  3OTO L;  3ERS X;  1X3F A;  3Q8D A;  4DK3 C;  5IYD G;  4DV7 L;  3MXN B;  1PYB A;  2KHJ A;  4MNO A;  3EIV A;  4A3F G;  1XPO A;  1K3R A;  1N34 Q;  2JA6 H;  1BBU A;  3I55 A;  3UDG A;  1IBL L;  1GKH A;  5HGQ A;  1M1K C;  2D0O A;  4R4T A;  1Q46 A;  4JYA L;  4K0K L;  5BR8 L;  5BR8 Q;  1L1O A;  3HKS A;  1TWH H;  1ASZ A;  4IFD G;  2UXB L;  1HZB A;  2VY3 A;  4DR4 L;  2KCT A;  2LSS A;  3DLL A;  4DR2 Q;  1XMQ L;  3OYY A;  5M3M G;  5DLQ E;  4HJ9 A;  1WFQ A;  1FJG Q;  4NXN L;  1JT8 A;  2ZJQ A;  5IWA Q;  1OXU A;  2RHQ B;  3W1G A;  3CPF A;  2PQA B;  5IE8 A;  3CC2 A;  4JI7 L;  2R7F A;  4A4I A;  4JI3 Q;  4JG2 A;  4LFA Q;  3ULJ A;  4GLV B;  3G6E A;  3HOW H;  3CCL A;  1NBW A;  3AFP A;  4J15 A;  1XNR Q;  1PA6 A;  4DV6 L;  4LF6 Q;  4HIM A;  1KC8 C;  1YHB A;  1Y1W G;  1PYS B;  4A3C G;  1NJI C;  1VQH A;  3STB C;  4A3I H;  1QZH A;  4IJH A;  3GTM H;  3H0G H;  1HJP A;  1W3S A;  2VQE Q;  3FKI G;  4DR7 Q;  3H3V I;  2PNH A;  2JA7 H;  1NTG A;  1XNR L;  3ZJY C;  4DR5 Q;  2QEX A;  2UUA Q;  1BKB A;  3MEF A;  3H15 A;  1EOV A;  4YWK A;  3CQZ H;  3K8A A;  4IPD A;  2Q2I A;  4L5Q A;  3K7U C;  4OWT B;  3CC4 A;  1N36 L;  5IY0 A;  2VUM G;  1I94 Q;  4BBR H;  3S15 H;  4DUY L;  4A93 H;  1YVC A;  4JOI C;  3HOX G;  1YHQ A;  4A3D H;  1CKO A;  1VQO A;  1J5E Q;  2OTJ A;  4JI4 Q;  4MTN A;  1XTD A;  2PMZ E;  2R7Z H;  1OXS C;  4KHP Q;  2IT1 A;  1GVP A;  2BA1 A;  3PIP A;  4MZ9 A;  3G71 A;  5C0X J;  2C35 B;  3AYH B;  3J7Z C;  1VQP A;  2I0Q A;  2VUM H;  4ME3 A;  3KDF B;  2E2I H;  1X3G A;  1VQB A;  1SE8 A;  2KEN A;  3I2Z A;  5FLM G;  4DR3 L;  1XMO L;  1VS0 A;  1JJG A;  4ALP A;  4UP9 A;  4O2D A;  1N9W A;  2WB1 E;  1R9T H;  1I50 H;  4PG3 A;  2F52 A;  1MKH A;  3T1Y Q;  1KD1 C;  2YYZ A;  1CSQ A;  3CCE A;  3GTJ H;  3I4N G;  1RL2 A;  5LMU L;  2ALY B;  4B3M L;  1EYG A;  2EIF A;  4B3R Q;  3BZC A;  4B3R L;  4A3L H;  1JJ2 A;  1HNZ Q;  5C3E H;  4OO1 G;  3PUZ A;  3UDX A;  2MFI A;  1KRT A;  2B3G A;  2K75 A;  2YV5 A;  4P75 A;  4XIG S;  1L0W A;  1Q1B A;  4DV4 L;  2B63 H;  3ICE A;  1PH5 A;  4A93 G;  5M5W H;  2I5M X;  2N8N A;  5ELO A;  4DUZ Q;  4DV2 L;  4FDB A;  1PH3 A;  3M9B A;  4BBS G;  4DV0 L;  1Q7Y C;  1XPU A;  4HJ8 A;  1QUQ A;  4R4Q A;  1EIF A;  1HNX Q;  1OXV A;  2ID0 A;  1X55 A;  3CCV A;  2AKW B;  1VQ9 A;  2BA0 A;  2DGY A;  2JA7 G;  4BBS H;  2UXB Q;  2RF4 A;  1CSP A;  4UP8 A;  1Q1E A;  3S2D H;  4X6A H;  1VQI A;  3ULP A;  4A3I G;  4DV5 L;  3ULL A;  4WJ3 M;  4R1J A;  4A75 A;  3F2C A;  3PGZ A;  2KCM A;  1PH4 A;  1Y1W H;  2PI2 E;  1LM0 A;  3F2B A;  4LUZ A;  4IPC A;  3I4M H;  1XNQ Q;  3HFZ B;  4QQB X;  2K4K A;  3UDF A;  2YTV A;  1PV4 A;  4JI5 Q;  3I4N H;  3HOX H;  4OWW B;  1HR0 L;  4YY3 L;  4JOI A;  1HH2 P;  1QVC A;  4OO1 I;  3NBH B;  1VQ4 A;  1E3P A;  4YHH L;  3LGJ A;  1K8A C;  1L1O C;  1EUJ A;  3AQQ A;  4POG A;  4DV6 Q;  1Y1V H;  3J80 i;  3W5O A;  1T9H A;  5JJK A;  1VQ7 A;  4GKK L;  3PUX A;  2GN5 A;  3FKI H;  3UDI A;  2A19 A;  3H0G G;  4QL5 A;  2E8G A;  3K81 C;  4LFC Q;  2F4V Q;  3HKZ E;  1S72 A;  2UXD Q;  3TS2 A;  1WCM G;  4A3B G;  1EIY B;  4YCV A;  3RNU A;  4BXX H;  4BBR G;  1J5E L;  4IO9 A;  4OX9 L;  5JJL A;  2F3I A;  3HOV H;  2Y0S E;  2Y0S G;  3UE1 A;  2JA5 G;  1I94 L;  2IX1 A;  2E5L Q;  2UUB Q;  3I4O A;  4P73 A;  2K5V A;  4LW1 A;  4XTC S;  3VDY A;  1HR0 W;  5IYC G;  1VQL A;  3J80 c;  1TWA H;  2LXK A;  4DUZ L;  4NPS A;  3GDE A;  3K0X A;  4JCV E;  3GTL H;  3IRB A;  4JV5 L;  3AEV A;  4NB3 A;  4DV4 Q;  2HT1 A;  1G51 A;  1E7Z A;  4GN3 B;  2AMC B;  4DR1 L;  3PF4 A;  3HOZ H;  3BJU A;  1TWF H;  2VQF Q;  4DR6 L;  4C2M H;  4YCW A;  1EQQ A;  3HOU H;  4DNI A;  3PF5 A;  4OXP A;  3U4V A;  2I5L X;  3S1M H;  1YBY A;  3CF5 A;  1JMC A;  5K36 G;  3T1H Q;  2E2H H;  3BU2 A;  1UEB A;  4DK6 C;  3NEM A;  4DR3 Q;  4EQ5 A;  1XMO Q;  4GKJ Q;  4JC0 A;  1X56 A;  4DV1 Q;  5E7N A;  2BH2 A;  3S1N H;  3KYH C;  4OON A;  1VQA A;  4LF9 Q;  4X66 L;  2AWO A;  4LFB Q;  1MIU A;  2Q2H A;  1IBK L;  3JC6 6;  2H5X A;  4DV5 Q;  1VQG A;  1SRU A;  5LMU Q;  2Q2T A;  2Q2U A;  2WB1 G;  4P71 A;  2Z6K C;  1SR3 A;  3HOU G;  2BH8 A;  1PFS A;  1YNX A;  5LMN Q;  2JA6 G;  2HHH Q;  2Z0S A;  1G6P A;  1X9N A;  5JEA J;  3STB D;  5M3F H;  1WI5 A;  3L0O A;  1N34 L;  1Q8K A;  3OTO Q;  3CC7 A;  1HNW L;  3RN5 A;  5FJ8 G;  3U58 A;  3A5U A;  2HHH L;  1XJV A;  1K83 H;  3KLW A;  3KJP A;  1YHA A;  1E22 A;  4IPH A;  2MO0 A;  4QY7 A;  4DV3 Q;  1PH9 A;  4BY1 H;  3S1R H;  3PO2 H;  3E9H A;  5IYC H;  2CWP A;  3RZD H;  3PO2 G;  5LMN L;  2LXJ A;  2VQE L;  3DM3 A;  1A62 A;  1OXT A;  4DR7 L;  3CME A;  4TVA B;  4LFB L;  4KLK A;  5C4X H;  5IP9 H;  1VQD A;  4GOP C;  1UE6 A;  4KI0 A;  2ZJR A;  1VQC A;  4BXX G;  2MNA A;  5HY6 A;  4L5R C;  3S16 H;  3I56 A;  3FP9 A;  4A3E H;  4JI2 Q;  4JI2 L;  1FVI A;  3U4Z A;  4JBJ A;  3L7Z C;  4A3G G;  5IP9 G;  4R4I A;  4HJA A;  2NN6 I;  3OW2 A;  1EFW A;  3KFU A;  5C4X G;  1L2F A;  3PUY A;  2K52 A;  1NE3 A;  4JI7 Q;  3J7A 5;  1Y1V G;  1D8L A;  3KF8 B;  1K8G A;  5J3B A;  4R4C A;  3W1B A;  2NVX H;  3HKZ G;  4B3M Q;  4UY8 C;  2CQO A;  4BY7 H;  1K0R A;  2ZJP A;  1AE3 A;  1U0L A;  3CXC A;  1LTL A;  2JA8 H;  1AE2 A;  1X3E A;  5M5Y H;  1XPR A;  1HR0 Q;  5FJ8 H;  5C0X G;  1IZ6 A;  1OTC A;  2NVQ H;  4JV5 Q;  4JI5 L;  4PZ8 A;  2EXD A;  4JBW A;  4DAY B;  2OTL A;  2JK8 A;  5GQO A;  3U50 C;  4JI3 L;  3S17 H;  4C3H H;  3CW2 C;  3M85 A;  1SMX A;  1JE5 A;  1YI2 A;  1U5K A;  3K80 C;  4AYB E;  4A3J G;  3HOZ G;  2GVB A;  4DR4 Q;  3TQY A;  2PI2 A;  2R92 H;  1YJW A;  3H3V H;  5EAY A;  3CPW A;  2UXD L;  2RHS B;  3A0J A;  1QZG A;  1C0A A;  4JBM A;  3D31 A;  3JAM i;  2I5H A;  3SGI A;  1SN8 A;  4LF5 L;  3PO3 G;  2NVT H;  4GS3 A;  4UP7 A;  2N49 A;  1YIT A;  1LYL A;  2JJQ A;  2UUC L;  1TWC H;  4LF6 L;  1VQF A;  4DV2 Q;  1MJC A;  4Y52 H;  4X62 L;  4JI1 L;  5C44 G;  2ZM6 Q;  1NY4 A;  2JQO A;  2KHI A;  4LFA L;  2UUC Q;  1J6Q A;  2E2J H;  3GTG H;  1E24 A;  1P16 A;  2IHE A;  2ZTC A;  4YHH Q;  4GLX A;  1VQE A;  4LUO A;  2NZO A;  4LF7 Q;  2R93 G;  1KRS A;  3T1Y L;  2K5H A;  4JYA Q;  4K0K Q;  2HQL A;  3TRZ A;  2NVY H;  4JI1 Q;  5GAH C;  3I7F A;  3RZO H;  5AJ3 L;  1V9P A;  2VW9 A;  4DV3 L;  2ZTE A;  4GOP B;  5LMN W;  2ES2 A;  1PHJ A;  1Z9F A;  1A0I A;  5FLM H;  5IWA L;  4DV7 Q;  4JI6 Q;  3HOV G;  3S2H H;  3RR5 A;  4HID A;  5ELN A;  4DR2 L;  5IP7 G;  2K14 A;  2B63 G;  2WAQ G;  2JEA I;  1VQJ A;  2K5N A;  2N3S A;  1WCM H;  3E0E A;  2CFM A;  4IJL A;  3J81 j;  5GAE C;  4A76 A;  4LWC A;  5C3E G;  1IBL Q;  1X65 A;  4YWM A;  3G4S A;  1E1O A;  4A3K H;  4JI0 Q;  1FL0 A;  1IBK Q;  1VQ6 A;  2ATW A;  3WWV A;  2A8V A;  4X65 Q;  2UU9 Q;  3M4O H;  1NMG A;  2QGQ A;  4JI6 L;  3M4P A;  1Z47 A;  2ASB A;  4EX5 A;  4X64 L;  2AHO B;  1QVG A;  3F1Z A;  4DR5 L;  1CKN A;  4YCU A;  1C7Y A;  4AIM A;  1UWV A;  2YTY A;  1IYJ B;  1Y14 B;  4O0A A;  4YY3 Q;  3F2D A;  2VQF L;  4B3S Q;  3CCJ A;  2R93 H;  4A3K G;  5JEA G;  4DR1 Q;  3I4M G;  2NZH A;  3A74 A;  4LF4 L;  2OQ0 A;  1AH9 A;  2WP8 J;  1H95 A;  2XTI A;  4A3M G;  5GRO A;  4A3C H;  2IX0 A;  3FHW A;  1GD7 A;  4X65 L;  5GAD C;  4PMW A;  2UU9 L;  1N32 L;  2IY5 B;  4QJF A;  3M7N A;  4R4O A;  4A3L G;  1MJE A;  5C44 H;  4B3T L;  4JI8 Q;  2D0P A;  2K50 A;  3B6Y A;  2A1A A;  3GO5 A;  1HZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...