1WFQA

Solution structure of the first cold-shock domain of the human kiaa0885 protein (unr protein)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
89
structure length
89
Chain Sequence
GSSGSSGGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The NMR solution structures of the five constituent cold-shock domains (CSD) of the human UNR (upstream of N-ras) protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords UNR protein
total genus 6
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1wfqA01
4LFBL 2Z0SA 2B63G 4OXPA 1PH7A 5JJLA 3K7AH 1VQFA 3OW2A 5C3EH 2IT1A 4B3SQ 4B3TQ 4DR4Q 1Q1BA 1XTDA 1YVCA 2V1CC 3UDGA 2HHHQ 4WJ3M 4JBJA 1I6HH 1VQIA 3CPFA 5GROA 1Z47A 4QL5A 2BH2A 1N32L 1ASZA 2ZM6L 4DR4L 4QIWE 4A3IG 3VDYA 3GTLH 1YZ6A 3F2CA 1VQEA 2LXJA 4HIMA 2VQFL 4APVA 1PHJA 4LF9Q 4DKAC 2IX1A 4A3LH 2PQAA 1VQMA 4JBKA 4NXNL 3DM3A 1S40A 1N33Q 4KHPQ 4K0KL 1I50H 4H02A 2B63H 1IXRA 3AFPA 3HOVH 5M5WH 3K81C 2K52A 3U4VA 5M3MG 1XJVA 1K73C 4DV0Q 3L2PA 1JJCB 4FDBA 2K75A 1PH4A 1NMFA 2CFMA 4RMFA 3TEHB 4LUVA 1YJ9A 3CC7A 1IBML 1Y1VG 1J5EQ 4JI5Q 4A3CG 1G6PA 4MNOA 4KI0A 1X3EA 4DV3L 3KF8B 3J81c 5FJ8G 1PH5A 3UDFA 1VQCA 1WJJA 4GLXA 3ULLA 4DV3Q 4Y7NH 2D62A 2JA7G 1AH9A 1O7IA 2VW9A 4X64Q 3TRZA 3I2ZA 4GNXC 2CQOA 1VCIA 3CCVA 5LMNW 4BY1H 2BA1A 3S24A 1P16A 1AE3A 4QQBX 1BVSA 2K4KA 1HR0W 1OTCA 1SMXA 2F52A 2JE6I 3HOWH 4GNXA 4HJ9A 3E0EA 1X9NA 1RIPA 1S72A 1X54A 3CC2A 2R92H 4A3LG 4LF8L 1FL0A 2E2IH 1A0IA 4JG2A 2JK8A 4JOIC 4GOPC 1N36Q 3PIPA 1K0RA 3G4SA 1Q86C 1PH2A 5EAYA 3CCSA 4A93H 4LFCQ 1CKOA 4DR6Q 1N9WA 2WB1G 3NENA 1YI2A 1EIYB 3HOYH 1QVFA 3EBEA 3HOZH 1KIXA 4DUZQ 1X65A 1N34L 4DR2L 4BBSH 3KYHC 3UE1A 2R93H 4X65L 1N8RC 4OWWB 2Y0SG 3PUVA 2ZJRA 4LUOA 3PUYA 4JI1L 3BZKA 4X62L 4OWXB 4DV7Q 4A3JG 1IL2A 1YHQA 3S2DH 2RF4A 3D31A 1DGSA 2ZTDA 1G291 4P75A 1LTLA 4C3HH 3RLFA 2VQFQ 4P73A 1XPUA 2UUCQ 4DAYB 2LSSA 1MJEA 5M3MH 4LF7L 3G71A 3PUXA 2DGYA 4A3GG 4GN3B 4DK6C 4DV0L 2NVYH 1UE6A 5GADC 1NJIC 4J15A 2VUMG 4GNXB 4A3DH 3H0GG 3KF6A 3J7ZC 3PGZA 2YTVA 4OO1G 1KHIA 3HKSA 1I3QH 1JT8A 3CCQA 4LF6L 1IBLQ 1XNRQ 3J81i 1PFSA 5M5XH 4BY7G 3IRBA 2F4VQ 2MO1A 2ID0A 2RHQB 1IBLL 3CPWA 1WFQA 2ZTCA 4DV4Q 3PF5A 3M85A 3CCLA 4A76A 1V9PA 2F4VL 1NBWA 4DR1Q 1V43A 2AWOA 4O0AA 4A3GH 4NB3A 1L1OB 1Y14B 3K8AA 1HZBA 1FVIA 1NTGA 3GTGH 1B7YB 2VUMH 3U50C 3H0GH 2JA6H 3S2HH 1SN8A 1VQ4A 4JI8Q 4B3SL 1KL9A 3OTOQ 3CCEA 3PO3H 4BY7H 4GKJL 2BH8A 1S3OA 3G6EA 2N49A 2WFWA 5GAEC 1N32Q 4YCUA 4A3MG 4JI2L 1QVCA 2Y0SE 2UXCQ 1YNXA 2ES2A 2GVAA 5FJ8H 3A5UA 2OWOA 3F1ZA 1N36L 1OXSC 1VQ5A 1N33L 4IPCA 3UDXA 1KRTA 2R7ZG 2JA8G 1UE7A 1OXXK 4AQYQ 5C0XG 3D0FA 4JBWA 1EFWA 4JYAL 4YY3Q 1NMGA 5HGQA 3JC66 5E7NA 3PO3G 2QA4A 1D8LA 4LF5L 1WOCA 4KLKA 4OONA 1E3PA 4JC0A 1QUQB 1VQDA 2HIXA 2R93G 3PIOA 1KRSA 4YY3L 2R7DA 4BXXG 1JJGA 1OXVA 1TWHH 3CCUA 3BZCA 4ME3A 4NPSA 4LF5Q 4HIOA 2HT1A 2UXBQ 3HOXG 4B3TL 1IYJB 3S1MH 3U4ZA 2JEBI 2VQEL 4DV2L 4X66Q 3ER0A 4TVAB 4O2DA 5IYDG 1X3GA 2Q2TA 3EN2A 4ALPA 4GS3A 4LW1A 3RLOA 2E5LL 3B6YA 3M3YH 2WP8J 1E7ZA 4DR3L 1K9MC 4X64L 1C0AA 3BJUA 4IPHA 4DK3C 2VNUD 2YYZA 1FGUA 4GLAC 1PVOA 2VL6A 4GOPB 5C4XG 1GVPA 4PZ8A 2E2HH 1L1OC 1A62A 3J7A5 1QVGA 1U5KA 2YV5A 3M4PA 2Z6KA 3KDFA 4JI6L 4A3BG 1C9OA 3CF5A 4WJ4A 5IT9c 2PMZE 3CQZH 4HJ8A 1KC8C 3S15H 1VQGA 4DR1L 2CKZB 4JI6Q 1HZ9A 3ERSX 1YJNA 4R4CA 1VQ9A 2JA6G 2A19A 2KCMA 1QUQA 4UP8A 4IFDG 3S1RH 3JAMc 2CWAA 4DUZL 2K5VA 3NBHB 4A3IH 1UEBA 4GLVB 1M90C 4UP9A 3GTPH 1VQJA 2QGQA 5ELOA 1BKBA 3G48A 4GKKQ 3W1BA 2NVXH 1LM0A 2OTJA 2AMCB 2JA5H 4X62Q 1CSPA 1OXUA 3L7ZC 5IE8A 2ALYB 1U0LA 3F2DA 2VZAA 2WB1E 4B3MQ 2UUCL 1E24A 3I56A 3S17H 2D0PA 1YBYA 4JYAQ 4GOPA 2ZJQA 1VQBA 1TWGH 4NXNQ 4JI0Q 3FKIH 1QZGA 4R4TA 4AYBG 5C4XH 4KHPL 4A3FG 4P74A 4HJ7A 3GTQH 3CC4A 1W3SA 5IYBH 3KDFB 1XPRA 1CKNA 4A3EH 1SRUA 4L5QA 2KCTA 1PH6A 5IP9G 4JOIA 4UPAA 3A74A 4EQ5A 4DV4L 3KFUA 3E9HA 1K83H 3I4OA 4BA2I 1V1QA 2RCNA 1HNWL 2NZHA 1TWFH 3M4QA 1XPOA 2FXQA 3KOJA 2H5XA 4L5RC 4OX9Q 2K50A 3TS2A 2LXKA 5J3BA 3ZJYC 4AIMA 2I5HA 3OTOL 4A3EG 3PF4A 2NN6I 4BA1I 1PH3A 1MIUA 1TWCH 1YIJA 5IP7H 4OX9L 1VQ6A 2R92G 1X3FA 4QGUA 4R4IA 3CCMA 1P8LA 3CCJA 3E9IA 2JA5G 4DAMA 3CP0A 4JI2Q 2KBNA 4JI3L 1L2FA 3NEMA 3OYYA 2UXDQ 1X55A 4R4QA 1JB7A 3I4NH 2AHOB 2N3SA 4IPDA 1AE2A 3JAMi 4XTCS 1GKHA 4HJ5A 1Z9FA 4GN5A 2ZTEA 4OWTB 4BBSG 3S1NH 3S1QH 3TREA 4POFA 1KAWA 3KLWA 2I5MX 4LFCL 4DR6L 4AH6A 4DR5Q 4JI4Q 1PYBA 1XMOL 3GTKH 1GO3E 3RNUA 3K0XA 1YEZA 3AEVA 1KXLA 4GKKL 2MFIA 4DR5L 1BBUA 4DR2Q 4JI4L 5C4JH 1EUJA 4YCVA 1ASYA 4X65Q 5JJKA 1UWVA 1R9TH 4X66L 4DV1L 1I94L 3UDIA 5FLMH 3H15A 3HOZG 3CW2C 3RZDH 5DLQE 3DLLA 3RLNA 1PV4A 4PZ7A 2JEAI 5LMUQ 5AJ3L 2OCEA 3GO5A 1JE5A 1BBWA 4YHHQ 5C0XJ 4A75A 5LMUL 3LGJA 1PA6A 3ICEA 4LFAL 4C2MH 4LF6Q 5GAHC 2VY3A 1FJGL 1XNRL 3CMAA 3RN5A 4JBMA 1HR0L 4B3RL 5M3FG 1UE1A 5FLMG 3FP9A 2UU9L 1HNWQ 1EWIA 4DV5Q 2XTIA 2AKWB 1FJGQ 1RL2A 1Y1VH 2K5NA 1SLJA 1HJPA 2KHIA 3S14H 2CCZA 5M5YH 4IOAA 2K14A 3GTOH 3PO2G 1NY4A 3KJPA 4R4OA 5IP7G 3J80i 2ZJPA 3TS0A 3H3VI 5JEAG 2KHJA 2L15A 1VQ8A 3SGIA 3M4OH 5HY6A 4GKJQ 1CKMA 1SE8A 2I5LX 2EIFA 2JA8H 2CWPA 1SROA 1A8VA 4YCWA 2DUDA 3CMEA 1X6OA 2B3GA 1VS0A 2VS1A 1XMQL 2ATWA 4LF4Q 3STBC 3PO2H 4JI0L 2Q2HA 2JQOA 4BXXH 1WI5A 2EXDA 3TQYA 3A0JA 3L0OA 4AQYL 4HIDA 4A3BH 1LYLA 1Q12A 1H95A 1HZAA 1E22A 4JCVE 1HH2P 4RG1A 1E1OA 3S16H 3MXNB 3W1GA 5M3FH 3RR5A 3PUZA 4UY8C 3I55A 1A63A 3PCOB 3BU2A 4P72A 5IYCG 3I4NG 1SFOH 5LMNL 4L5SA 3HOWG 4BBRG 2Z6KC 2R7FA 4PZ6A 1G51A 2ASBA 1B8AA 4HJAA 2VQEQ 2NVQH 2AWNA 4A4IA 1YITA 2E8GA 2KENA 5AJ3Q 1E1TA 1KQSA 2E5LQ 2UUAQ 1KD1C 3K80C 4IOCA 1M1KC 4IFDJ 4DR3Q 3T1HL 1VQAA 2GN5A 3T1YQ 2F3IA 5K36G 4YHHL 1J6QA 3GTMH 1UE5A 5IWAL 4IO9A 3PSIA 2QEXA 4LFAQ 4YWMA 4R1JA 1IZ6A 1X56A 2PI2E 1K3RA 5JEAJ 4A3KG 4X6AH 5IYCH 2UU9Q 1LUZA 5IWAQ 2UXDL 3W5OA 4DV5L 4JV5Q 1XNQQ 1EQQA 1Q81C 2JA9A 2EQSA 3J80c 3CD6A 2IHEA 1Q7YC 5GQOA 1CUKA 4JV5L 1Q8KA 1PH1A 3H3VH 4LFBQ 1VQNA 2XGTA 5C44H 3RN2A 1GM5A 1B70B 5JJIA 3ULJA 5FLXc 2IY5B 3STBD 3AYHB 3J81j 4LUZA 4YWLA 3HOYG 2N78A 1JJ2A 4DR7Q 4LWCA 2OTLA 4BY1G 4Y52H 4BBRH 2ZM6Q 5C0XI 1PH8A 4JI7L 4DV1Q 1I94Q 1C7YA 4MTNA 4A3FH 1VQ7A 4DR7L 1Y1WH 2PQAB 4B3ML 1MJCA 4A3MH 4K0KQ 1K8AC 4JI7Q 3I7FA 3I4MH 3M7NA 1EYGA 4L5TA 4PG3A 2OQ0A 1D7QA 5IP9H 3MEFA 4EX5A 2OQKA 2A1AA 4A93G 4HIKA 1IBMQ 2WAQG 4IJHA 3GD7A 4DNIA 4A3DG 2NN6G 2NZOA 1WCMH 1T9HA 3GTJH 3RZOH 1YHAA 3M9BA 1GD7A 1Y1WG 3Q8DA 4DV6L 1Q82C 2GVBA 1TWAH 2YU9H 3I4MG 1EIFA 2WAQE 3PUWA 4NXMQ 4C3IH 1PH9A 2UUAL 4JI8L 3HOXH 2UUBQ 1HZCA 1HNXQ 2C35B 3T1YL 3HOVG 3F8TA 4QJFA 2R7ZH 1EQRA 3FHWA 3U58A 3UE0A 2UUBL 1SR3A 4A3KH 2UXCL 1HNXL 2HHHL 2RHSB 1MKHA 2I0QA 1WCMG 3CXCA 2HQLA 2NVTH 3AFQA 1XNQL 1XMQQ 1Q1EA 4DPGA 4IJLA 4QY7A 1IBKL 3EIVA 4JI3Q 4LF4L 4LF8Q 1VQKA 5IYBG 3CCRA 2PNHA 3HKZE 2UXBL 1WYDA 3HOUG 1QZHA 4PMWA 1VQLA 1CKNB 1IBKQ 3NELA 5IYDH 1I5FA 1VQOA 4LNQA 3WWVA 1Q46A 4LF9L 2IX0A 2YTXA 1OXTA 5C3EG 1N34Q 1YHBA 4IFDI 2PI2A 1XMOQ 3HFZB 3GDEA 1L1OA 1HNZL 4GN4B 1L0WA 2YTYA 2Q2IA 2MQHA 2D0OA 2R6GA 5IY0A 4XIGS 4DV2Q 5H1SE 4JI5L 3HKZG 5GAGC 3A5ZB 4JI1Q 5LMNQ 4DV7L 1YJWA 1J5EL 4C3JH 4POGA 1HNZQ 1TXYA 4TQUS 3AQQA 2B29A 2K5HA 1CSQA 2BA0A 3CAMA 3KJOA 4DUYL 4LF7Q 5ELNA 3F2BA 5C44G 4MZ9A 2IHFA 3T1HQ 1JMCA 4OO1I 2JA7H 1EOVA 3KF6B 4P71A 5BR8L 4DUYQ 1VQPA 2N8NA 3PV0A 2A8VA 3ULPA 3FKIG 2JJQA 4UP7A 5BR8Q 4AYBE 2Q2UA 4YWKA 2E2JH 4A3CH 1K8GA 4DV6Q 1PYSB 1HR0Q 1NE3A 4B3RQ 2HIVA 3K7UC 4A3JH 4NXML 1W2BA 3HOUH 1VQHA 4IPGA 2MNAA 2MO0A 4KHZA
chains in the Genus database with same CATH superfamily
3MAQA 4OXPA 2HCCA 2IWHA 3OW2A 4WORA 4R8NA 5C3EH 1XTDA 2HHHQ 1JWMD 4GZYC 5FOBB 3Q22A 1I6HH 4ZKBB 3FPPA 4DR4L 1QE6A 2LMCB 1R9TB 1ML0D 4FF1A 1S40A 1N33Q 2CH4W 4H02A 1IXRA 2AUJD 3K81C 5M3MG 4QUCA 4DV0Q 2LFNA 1JJCB 3LNNA 4FNFA 1NNXA 1NMFA 4N9PA 4ZUIA 2CFMA 3TEHB 4CDDC 4LUVA 1D1IA 1YJ9A 1IBML 2KJXA 2PNRC 4NW2A 4JI5Q 1DD2A 1VMCA 1X3EA 1WD0A 4KTAA 5HURA 3KF8B 3J81c 3UDFA 3J81L 1AH9A 2D62A 1O7IA 2R7ZB 2QEJC 2CQOA 1VCIA 3CCVA 4NDXA 2DY7A 5LMNW 3S24A 3DMUA 3T56B 1AE3A 3HOWH 2F52A 1X9NA 1X54A 3GTJB 1FL0A 4JG2A 4JOIC 1K83B 4GOPC 3PIPA 1PH2A 3G4SA 1Q86C 5FLXE 1KAAA 4RHRA 2WB1G 4OIKA 2NTTA 3TP7A 5IIFA 2EYMA 3IKJA 1ET9A 2DNCA 3DWAA 2F0FA 2C5CA 4C3HH 4B3TQ 2ZTDA 1KLUD 2DNEA 2FMCA 2LSSA 4OHJA 5M3MH 4OEMB 4C3HB 3RUZA 2Z4HA 3KF6A 1I3QH 2K6AA 4OGQC 3MEHA 1XNRQ 1X3QA 2A6EC 1PFSA 4BY7G 5KNDA 1GUNA 1ZYRD 3E5SA 2QDLA 2SEBD 2F4VQ 4K8IA 3P20A 3M85A 3CCLA 2XWBB 1PFNA 2A73B 1L1OB 1Y14B 3K8AA 1RF2D 3U50C 3I4LA 1VQ4A 4JI8Q 1KL9A 1BR9A 3AB9A 2HQEA 1ENFA 2XRSD 1VQ5A 1RTOA 1N33L 4F7XA 4IUUA 1I4GA 3NUCA 1KRTA 4KK7A 5DEHA 2L4NA 2K01A 3OPOA 3NSWA 1NMGA 3JC66 2F3VA 1JICA 1QUQB 2HIXA 1RHPA 4YY3L 3LX0A 3ONAB 2V4DA 1OXVA 1TWHH 3CCUA 4LF5Q 2HT1A 4HIOA 3FVQA 3DWPA 3BDOA 5FO8B 3HOXG 4B3TL 2JEBI 3KF8A 4K2KA 1Z7TA 3ER0A 2Q2TA 4GS3A 2WP8J 1KLGD 4IPHA 1PVOA 4KHVA 1I6HB 4A3IB 1SE2A 2BOSA 2EYHA 2YV5A 1NR2A 3FPUB 1EEFD 4JI6L 1QILA 1Y8PB 2FJ2A 4JVZA 2F0QA 2PW5A 1XX8A 3QWNA 1HQMC 1YJNA 2A19A 2KCMA 1CFMA 1BDOA 2MGSA 3D8GA 2Y0SB 1EZ8A 3BDLA 3NBHB 4RCNA 1MI2A 4RKBA 4GLVB 4A3IH 1M90C 3GTPH 3VR2A 2L0CA 3G48A 3VA7A 1Q8IA 2NVXH 2OTJA 3ND9A 5M3MB 2NTSA 4TRDA 3J7AF 2VZAA 5CBAE 4J8QA 2D0PA 3SDZA 2ZJQA 1PTOC 1TWGH 1AN8A 1UAPA 1TWHB 3R2IA 4K8JA 3GTQH 4K14A 4JK1C 1T5XD 1PH6A 4IALA 3A74A 2Q8IB 4EQ5A 4DV4L 2XNAC 3I72A 4RAUC 3CRKC 5LHY1 3NBHA 3TS2A 3ZJYC 2I5HA 3OTOL 4QUFA 4CDCC 2NN6I 4A3EG 1MIUA 1ONLA 1X3FA 4R4IA 4XYOA 1K8MA 1LT4D 1P8LA 1JOKA 1SMYC 3E9IA 1QB5D 4DAMA 1B1ZA 3PO3B 1AZPA 4FXDA 3S2HB 1RTNA 3GTGB 1SNPA 4L63B 2AHOB 2AQ2B 4XTCS 1Z9FA 2J0TD 4GN5A 3WOFA 5J1ZA 4BBSG 3WDNA 1WCMB 3KLWA 2EPBA 4DR5Q 4JI4Q 1GO3E 3NQTA 1TKWB 3K0XA 1EY0A 1YEZA 1O7ZA 3ZYYX 3AEVA 4GKKL 4DR2Q 5C4JH 1EUJA 1I50B 1Z6HA 1ASYA 5JJKA 1UWVA 4PMCA 1R9TH 3CHBD 1AW7A 4DV1L 3UDIA 5FLMH 3MXPA 3OW7A 1Y1WB 4A3FB 3D3RA 1GOZA 5JJZA 1WTVA 1JWSD 5C3EB 1Q90A 4A75A 4HCEA 4LF6Q 2VY3A 1FJGL 3CMAA 4X3SA 3GV6A 4KKUA 1EYCA 2OEOA 2E75C 4ZKCB 2K5NA 2KHIA 2KUMA 1PZID 2CCZA 1ZEQX 5M5YH 3H94A 2E2HB 1NY4A 3KJPA 1IW7C 1HHVA 3TS0A 4B08A 3PIO3 5JEAG 2KHJA 2L15A 2KEEA 5I2XA 1CKMA 2EIFA 4YCWA 1EY7A 3MXUA 1X6OA 2B3GA 3D6CA 1VS0A 1H9RA 5C5MA 3HG9A 4H44C 2Q2HA 4JI0L 2EXDA 3A0JA 3L0OA 4AQYL 4HIDA 2B8GA 5IGBA 5EPKA 3SVMA 4RG1A 3MXNB 4CJ0B 1A3UA 3RR5A 4A3BB 4P72A 3N6RA 4L5SA 1K8OA 4X3KA 4BBRG 5C5LA 5I2YA 1CI3M 4A4IA 1JR0D 2E8GA 1YITA 2UUAQ 1TR5A 2E5LQ 2JA8B 3T1HL 1XXGA 3DHQA 3H0GB 1UE5A 4IO9A 2QEXA 1WD1A 2PI2E 4A3GB 4X6AH 1DOMA 2ZXRA 1XNQQ 3VR5A 2JA9A 1CA6A 5GQOA 2E2JB 3H3VH 4LFBQ 1EWHA 4ZK9B 4FXGC 1VQNA 2SNSA 1F9RA 5JEAH 3A8KE 5JJIA 5EBDA 4KY7A 5CGKA 1EU3A 5NUCA 2OTLA 5D65A 4ZAIA 4BY1G 3A8IE 4A3MB 5C0XI 4DV1Q 1EU4A 1PRTF 1F2MA 3P7JA 3S2DB 1FR3A 4DR7L 1VQ7A 4B3ML 1MJCA 4A3MH 4JI7Q 5IT9L 1GHKA 3W2DA 5IP9H 2OQKA 4A93G 3DEPA 1W6KA 2WAQG 1EY4A 3GTKB 4DNIA 3HP3A 2KVMA 1LABA 3GTJH 1WTXA 1QNUA 1Y1WG 1MHWC 2MPMA 1Q82C 1PZJD 1TWAH 2YU9H 1I4HA 1F2ZA 2CH4A 2UUAL 2F0JA 1X3PA 4JI8L 1HFGA 2BCOA 3GTMB 2PCFB 1PTOB 2R7ZH 4ILWA 1SR3A 3K58A 1I6VC 2E76C 1WCMG 3CXCA 2HQLA 2NVTH 1Q1EA 2P5ZX 1Y69U 5EKLA 2LKVA 3HKZE 3HOUG 1QZHA 3M7GA 3KLRA 1CKNB 1IBKQ 1VQLA 1RDPD 3WWVA 3OIQA 2YTXA 1PLFA 1PRTC 1NCVA 1XMOQ 4A3EB 3HFZB 3GDEA 2UXBL 4GN4B 2Q2IA 4HMIA 4DV2Q 1B4OA 1L0YB 1B3QA 1J5EL 3A5ZB 4JI1Q 4DV7L 4C3JH 4MTKA 3I3CA 3KJOA 1BCPF 2F0UA 2K28A 1WTPA 4R9WA 2WAQB 3T1HQ 1JMCA 4TKOB 4DAVA 4DUYQ 4K5VA 2IJ0A 1RODA 1TS4A 3MTSA 4EVOA 3ULPA 3FKIG 1PRTD 2PZUA 5BR8Q 5M5YB 5EKKA 1HR0Q 5KNBA 4A3JH 3QOLA 1VQHA 4IPGA 2XVSA 2F0HA 3S15B 2B63G 3D6WA 2RDHA 1VQFA 2RSOA 4J6HA 1BUVT 4DR4Q 1HTLD 1YNJC 1N32L 1QWYA 5FO7B 4AYBB 2NBFA 4L8JA 4QIWE 4FXKC 3C2PA 5CV9A 3VDYA 1YZ6A 1VQEA 2LXJA 1A3VA 4HIMA 2VQFL 4LF9Q 4NXNL 4KHPQ 4CJ1B 1I50H 3NTHA 1XJVA 1SYGA 3V05A 4U673 1K73C 3S16B 3SE0A 3VYSA 2KCCA 4FDBA 2K75A 4I7AA 4S3SA 2NB0A 4RMFA 2KECA 4OIJA 3DEOA 1ZYRC 4A3CG 4ZLTF 1G6PA 4MNOA 1UUPA 5I9OA 5FJ8G 5CV4A 4IUVA 5DM63 4DV3Q 1R4QB 4Y7NH 2JA7G 2VW9A 4X64Q 1E2ZA 5K5PA 3A8JE 2BA1A 3D4RA 3NE5B 2JE6I 4UDUC 1VDZA 4HJ9A 1TY2A 5ELEA 5CV6A 1TWAB 3EFXD 3HZXA 1S72A 3CC2A 2R92H 5I9PA 2QCPX 2E2IH 4HSVA 1CKOA 1HUMA 3NENA 1YI2A 5FO9B 1EIYB 3HOYH 1O7LA 2F0WA 2K33A 3KYHC 5F2DA 3HRZC 2R93H 1N8RC 4ODGA 3PUVA 5T1GA 4A3JG 3S2DH 4XQQA 2B39A 1YHQA 2RF4A 1MGSA 3D31A 4P75A 2VQFQ 4LF9L 1H9KA 3J81E 1EY5A 3PUXA 1SE4A 4GN3B 2NVYH 5KEEA 4GNXB 4A3DH 4OO1G 1JT8A 3HKSA 3CCQA 4LF6L 3J81i 5M5XH 3S1RB 1FYCA 4RGTA 2WKCA 2FINB 2MO1A 1B9MA 3PF5A 5JPMC 5TSSA 4N8FA 2I46A 1V9PA 4RA8A 4DR1Q 4A3GH 4NKLA 1FVIA 3H0GH 2JA6H 4X3TA 4B3SL 4U68A 2EVBA 3CCEA 4BY7H 1FNWA 4L6TB 1EZ6A 3V96A 2K1BA 3G6EA 3BYTB 2WFWA 1D5MC 4IN3A 2B2TC 2RA4A 3NXWA 4YCUA 2E2DC 3MVVA 4A3MG 2Y0SE 3K59A 4JI2L 4BY1B 1YNXA 2UXCQ 2GVAA 2ICEC 5FJ8H 4DK1A 4G7ZC 2OWOA 3F1ZA 1TWFB 4KY6A 4ZRZA 3QJYA 3UDXA 5M3FB 2JA8G 1UE7A 1SBBB 4DNRB 4ZQ3A 3PO3G 5E7NA 4LF5L 4OONA 4XXEA 2XN9C 3PIOA 4BXXG 4PNYA 3VR6A 3BZCA 4ME3A 2RDGA 5IGCA 3U4ZA 4G4KA 4IURA 2TSSA 5G3LD 3I90A 5CORA 4ALPA 2Q8TA 2D5DA 1D6EC 4LW1A 3B6YA 1EYDA 2E5LL 3M3YH 3M4OB 4DR3L 1Y8OB 4X64L 2VNUD 3BJUA 4DK3C 2JA5B 4GLAC 1JB3A 2RCFA 5C4XG 1VF7A 4PQXA 5KYLA 4PZ8A 2E2HH 1L1OC 3J7A5 1U5KA 3C46A 2VUMB 3M4PA 2IX3A 2Z6KA 4A3BG 2K5WA 1C9OA 2MUYA 2D2CC 4WJ4A 4CDEC 1GJXA 2PMZE 3CQZH 1I4RA 3U9SA 2RDFA 2F0DA 4DR1L 2CKZB 4C2MB 2SNMA 3JAMc 2B2YA 2CWAA 4DUZL 1I3QB 4G7OC 4HCSA 4CGYB 1H9SB 4UP9A 3JAML 1VQJA 3FRPB 5ELOA 1BKBA 3NQIA 3W1BA 2WKDA 3IFTA 2XIWA 3K57A 4FO2A 5IE8A 1LO5D 3L7ZC 3V2TA 4B3MQ 1U0LA 3F2DA 2UUCL 1TY0A 1CTMA 1G91A 1ET6A 1YBYA 3WOEA 2QKIC 4K5WA 2EJMA 4GOPA 3S1MB 1ENAA 1VQBA 2NN6H 4R4TA 5C4XH 2K05A 4A3FG 4P74A 3CC4A 3KDFB 1XPRA 1DXMA 1JC7A 3S1QB 3NWSA 2EOTA 2DN8A 1STNA 4L5QA 1I4QA 2KCTA 4JOIA 4BA2I 3KFUA 3I4OA 1K83H 5AFWA 1V1QA 2NZHA 4K2LA 1D1KA 1XPOA 2FXQA 1SJED 2DY8A 2H5XA 4L5RC 1WTRA 2K50A 1O78A 2VB3X 2GA4B 1JCKB 5E3FA 4DNTB 3ERQA 1MSGA 5IP7H 2B2UC 1RJTA 5JOBA 2L12A 3HEJA 1AFPA 1S5BD 1TS2A 4JI2Q 1IL8A 2KBNA 1X55A 1JB7A 4K5XA 4OELB 4ULLA 2L55A 4KN7C 3EA6A 5L37A 4POFA 1FNUA 2I07B 1XMOL 2JYOA 4RCOA 4DU9A 2MFIA 3HOVB 1BBUA 4YCVA 4X65Q 3IAYA 2Z1CA 3W3AA 2F0SA 3RZDH 4V0BA 4DXGA 2PW7A 4JPBW 4CBVA 1VF5C 2NZ1D 1BBWA 4Q5VA 1PA6A 2B2WA 3ICEA 3TDQA 4LFAL 1XNRL 5C44B 3RN5A 4JBMA 1HR0L 5JVH3 4A93B 5FLMG 2UU9L 1HNWQ 4DV5Q 2XTIA 1RL2A 1Y1VH 2CW0C 3DXJC 3S14H 2K14A 3GTOH 1TS5A 3PO2G 4WFN3 3A56A 1CZWA 4R4OA 2ZT9C 1BCPB 4X3UA 3H3VI 1HTPA 1NR4A 2EDGA 2Q8RE 3TN2A 1J8IA 3H3VC 2CWPA 1SROA 1A15A 1A8VA 1QCBD 2DUDA 2A69C 3T51B 3CMEA 2VS1A 3PIP3 1KNEA 1XMQL 2ATWA 1A6XA 4P2CB 2EYPA 2F0GA 3X3MA 2JQOA 3OWFA 1HZAA 2M00A 3K5NA 2K5DA 4JCVE 1ZKOA 1HH2P 2LS01 1AEXA 3W1GA 2A6ED 5CV5A 1I4XA 4IUPA 3BU2A 3I4NG 5IYCG 1LT5D 2AQ3B 4IUNA 4HJAA 2VQEQ 2PO4A 1DYQA 3VYUA 1KD1C 3K80C 2QDBA 4ZYSA 3O13A 1VQAA 2CQAA 2GN5A 2LY7A 4LAAA 1SYFA 5IWAL 5G3LF 1NSNS 2Z4IA 4LFAQ 4FF2A 4O1NA 1X56A 2C9OA 2UU9Q 3C1FA 2UXDL 1Q81C 4QIWB 2EQSA 2JXMB 2EE1A 1Q8KA 4I7ZC 5I4DA 3TP6A 1SJHD 3H6MA 4YWLA 3EQLC 1RKNA 3E3XA 4DR7Q 4ABNA 4Y52H 1EL0A 4BBRH 1I94Q 3PMFA 4MTNA 5C3WA 2PQAB 3I4MH 1EY6A 4PG3A 5HGTA 2SOBA 1TU2B 1STBA 4H13C 3KLSX 1IBMQ 2H4OA 4I65A 2KOLA 3GD7A 4BWGB 2NN6G 3RZOH 2A68D 1YHAA 4QF4A 4DV6L 1EIFA 3U9OA 1TT2A 5EQ0A 5EPJA 2N88A 5JVG3 2N55A 2X6GA 1HNXQ 3QO2A 2O5IC 4KD3A 3SK6A 3F8TA 1IKLA 3OWEB 3FHWA 4PMBA 1E2WA 3GV3A 2WACA 2HHHL 2RHSB 1U4PA 4E6IA 2OT2A 1I4PA 2I0QA 1C4QA 3URYA 2R61A 4DPGA 1IBKL 1SNDA 1VQKA 2K04A 5IOCA 2D9UA 2PNHA 3CCRA 5COYA 3NELA 5CV8A 4KJNA 1Q46A 3QR8A 1HPCA 3K0YA 2G9HD 5M5WB 1N34Q 4IFDI 3IL8A 4M1UB 3TP8A 5IY0A 2YTYA 2D0OA 3PO2B 5LMNQ 4POGA 1HNZQ 5D3DA 1TXYA 4TQUS 3AQQA 2B29A 4RGNA 1CSQA 2BA0A 3CAMA 5C44G 4DA2A 1SNQA 2JP1A 1AP0A 1MBYA 1TVXA 2N8NA 2RVLA 1BOSA 1SAPA 3F2UA 4AYBE 4UP7A 4YWKA 2VXWA 1O7YA 5IGGA 1B2TA 1K8GA 3MXGA 3BZDB 4DV6Q 1U4RA 1NE3A 5C6AA 3K7UC 4NXML 1CZGA 3HOUH 2XSCA 1ICFB 2MO0A 4QCLA 1E2VA 2Z0SA 1PH7A 1H9JA 5JJLA 3K7AH 3J80E 4KV6A 1Q1BA 2PMZB 4JBJA 1VQIA 2R3ZA 3I8ZA 5GROA 1K0SA 4XT3B 2ZM6L 5IGEA 4FF3A 4A3IG 1ENCA 3GTLH 2NVQB 4APVA 1PHJA 4DKAC 2PQAA 3QIAA 1VQMA 4JBKA 3DM3A 4K0KL 4V190 1STAA 3MC0B 5EKIA 4IZ8A 4ZCKA 5D3IB 1ESFA 4LJZC 1YNND 3LWUA 1BXTA 3BVGA 2EYLA 4KI0A 4DV3L 2Z8LA 1RCVD 3MFGA 1WJJA 4GLXA 3ULLA 4A3KB 4DAYA 4B9XA 5A2QL 1DOLA 1TWCB 4BY1H 1P16A 4DFAA 4QQBX 1BVSA 3HOXB 1OTCA 1SMXA 4GNXA 3NK9A 1TQOA 1RIPA 1KTKA 2JA6B 3MWYW 4MN3A 5IODA 2JK8A 1N36Q 5I6YA 1G8ZD 5EAYA 4A93H 4DR6Q 2B2TA 1N9WA 5EBCA 4PV1C 3EBEA 3HOZH 1AZQA 2TMPA 3FDTA 2PYKA 1N34L 4BBSH 4X65L 1G2SA 4OWWB 4LUOA 4A3DB 1EYAA 3BZKA 4RFBA 3T53B 3S9WA 1IL2A 2NVYB 1DGSA 3RZDB 3RLFA 4DAYB 1LTID 1MJEA 3R93A 2K7VA 4LF7L 3OMGA 4DK6C 4DV0L 1UE6A 3FMCA 4J15A 2VUMG 3TP5A 3J7ZC 3PGZA 2QW7A 1W6JA 4QMGA 3IRBA 1CQVA 1RD9D 3J7YW 2RHQB 1IBLL 3CPWA 2F3WA 4DV4Q 1S5CD 1F9PA 3I4NB 1VMPA 2HD3A 4O0AA 4NB3A 3Q0AA 2MHVA 3LWEA 3OTOQ 4C1NI 5I6WA 2Z6BA 1WTOA 5GAEC 4HTHA 3D4WA 1QVCA 5IGDA 2ES2A 3A5UA 3EJIA 1G6ZA 1SFOB 1N36L 4Y7NB 2B8FA 3NP8A 2ICIA 1SYBA 2R7ZG 5C0XG 3D0FA 4JBWA 3QG1A 3NWTA 1QOHA 2QA4A 1D8LA 4KLKA 2R93G 1FNVA 2R7DA 1JOQA 3FKIB 3ND8A 2UXBQ 1IYJB 4DV2L 2VQEL 4TVAB 4O2DA 3RLOA 1K9MC 3AMUA 2YYZA 4GOPB 5CYUA 1IKMA 2XRQD 4RHSA 2L5TA 1SYDA 1QVGA 3P1HA 1GUOA 3KDFA 5LL6S 1VQGA 3H91A 3ERSX 4A3JB 2OF1A 4R4CA 1LTAD 1VQ9A 2JA6G 4UP8A 1DJRD 4IFDG 4HN7A 3CKIB 3FEWX 3RMHA 1FD7D 2QGQA 2BDOA 4QB4A 3A7LA 2A69D 3T4AC 1SMYD 4GKKQ 1LM0A 3SK4A 2JA5H 4XQJA 2L1BA 2ALYB 4XT1B 1YNJD 1E24A 3I56A 3S17H 1IW7D 5T1IA 2F0MA 1K3BC 2F0LA 2Z9HA 4NXNQ 4KHPL 4JI0Q 3FKIH 1QZGA 4BBSB 2CW0D 1W3SA 2G9DA 4IQZA 5IYBH 1CKNA 5ELDA 4DK0A 1A2TA 5IP9G 4UPAA 3E9HA 4H0LC 2RCNA 1TWFH 1UEAB 5E4WC 2B2WC 3KOJA 1EQTA 3GQBA 1EIHA 2LXKA 1J9OA 3PF4A 1VQ6A 1PH3A 4OX9L 1YIJA 1GHJA 3OSOA 2EY6A 3CCMA 2J7ZA 3CP0A 1EY9A 1XTCD 1L2FA 3NEMA 4HSPA 3NTIA 3I4NH 1SYCA 2N3SA 3JAMi 4IPDA 1HCZA 1IHZA 3BG3A 1GKHA 4HJ5A 3TREA 1KAWA 4LFCL 3CRLC 3BDCA 4AH6A 1PYBA 3GTKH 4IUTA 2AUKA 1B3AA 3S17B 2B63B 1ZXTA 4XDXA 1U9RA 3GTLB 2L11A 3CW2C 1KDAA 3TZUA 4C1NK 5DLQE 4N8X1 3RLNA 4PZ7A 1GUGA 1STGA 5LMUQ 1B9NA 2KCNA 2OCEA 2R93B 1JE5A 1V1PB 2RSNA 4YHHQ 5C0XJ 2EYJA 1HQRD 5D14A 2IW3A 4KJOA 2F03A 5GAHC 1F9SA 2PZTA 4B3RL 1UE1A 2F0NA 5ISRA 1EWIA 2NUCA 4KMUC 2AKWB 3Q6SA 2HDLA 1HJPA 1BCPD 3QB3A 3MZ5A 2B2VC 3E0JA 5EGTA 4F8MA 1PFBA 5IP7G 5C4HA 3J80i 4RWSC 3MA2B 1VQ8A 5HY6A 5KYIA 1LTRD 4DGZA 1HXYD 4GKJQ 4WRDA 1HUNA 4KD4A 2JA8H 3VYRA 5IT9E 1PZKD 4B9WA 4NMZA 4LF4Q 3PO2H 1LTSD 2F4IA 1C48A 1X32A 1BCPC 4BXXH 4RH6A 5JAVA 1WI5A 2BDNA 4UAIA 3EVQA 2FFKB 1LYLA 3NTKA 3G6JB 1E22A 2EYOA 3Q24A 3OHXC 1E1OA 3S16H 3HS0C 3PUZA 4UY8C 1HFNA 1BF4A 2HUGA 2NWGA 2Z6KC 2R7FA 4PZ6A 1G51A 1B8AA 2NVQH 1XWEA 2AWNA 2KENA 1KQSA 2AQ1B 1M1KC 4IOCA 1EQVA 4C3HG 1KABA 4DR3Q 3E6ZX 2WIIB 4RGMA 5K36G 4YHHL 1J6QA 1XYIA 2B2YC 1K3RA 4A3KG 3C3LA 5ELBA 1DOKA 1LUZA 2M2LA 5IWAQ 3W5OA 2F0KA 4JV5Q 1EQQA 1IYUA 3KK7A 1S4ZA 1SNCA 1BNZA 1SNOA 1II3A 1EIGA 5C44H 3X3NA 3RN2A 4EQPA 1SDFA 3KBXA 3STBD 5BN5A 3J81j 4LUZA 3OMCA 3HOYG 5ELCA 2QILA 4LWCA 4IFDH 3M4YA 4DXFA 3K5LA 4A3FH 1Y1WH 1DM0B 3IFDA 5J22A 4C3JB 3VA5A 1QG7A 3M7NA 1M8AA 1EYGA 3K6OA 4L5TA 1SSOA 1B53A 2OQ0A 5CR3A 2J4XA 3HOZB 3MEFA 4EX5A 5C4JB 1SEBD 4EQOA 5M9OA 2K5QA 4HIKA 5C4ZA 3L3OC 2RKSA 1LV9A 4IJHA 3C1EA 3AU7A 3M9BA 3Q8DA 2GVBA 4DAPA 3I4MG 5A2QE 2WAQE 1CHQD 4C3IH 1PH9A 1GUWA 2F1MA 3HOXH 1H9SA 4XYQA 3R3OA 2C35B 1UNSA 4Z9CB 2ENBA 4QJFA 1EQRA 2UUBL 2E74C 1HNXL 2HDMA 1OO9B 4J1MA 4YIJA 1CK1A 5EJWA 3AFQA 1XNQL 4JI3Q 4QY7A 4LF8Q 4IUQA 1F2YA 3L9AX 2YU9B 4LF4L 1LT3D 5IYBG 1U4LA 4HMJA 2XWJB 3RZOB 1WYDA 2K03A 5IYDH 1YHBA 1GUTA 2PI2A 3H09A 3TZDA 1HNZL 3GTQB 1BO0A 5KGUA 3I4MB 5C3XA 2B2VA 2EXZA 3KBGA 1STHA 2K5HA 3F2BA 1D2BA 5DM73 4OO1I 4P71A 1VQPA 1NAPA 2A8VA 3GTPB 3N52A 2JJQA 2Q2UA 3VR4A 3S14B 2E2JH 1Y1VB 2IPKD 1S5DD 1PYSB 2HIVA 1W2BA 3MFYA 2MNAA 2JSOA 4KHZA 1BBXC 4LFBL 2F0IA 3GP7A 2IT1A 3KUPA 4B3SQ 3UDGA 1YVCA 2V1CC 2FMMA 4FP5D 4WJ3M 3CPFA 1Z47A 4QL5A 2BH2A 1ASZA 3T16A 1QNKA 3F2CA 2IX1A 4A3LH 2F0OA 3A7AB 4HR7B 4K6DA 4ID6A 2B63H 3PQIA 2PQEA 3AFPA 5M5WH 3HOVH 2K52A 2HCIA 3U4VA 3L2PA 3I73A 1PH4A 5CC4A 3CC7A 1H9MA 1Y1VG 1J5EQ 4ZUJA 1EY8A 1BQQT 1PH5A 1VQCA 1CA5A 2X69A 1Y8NB 1EFID 4CHTB 1WTHA 2PPBC 3TRZA 3I2ZA 4GNXC 3SK8A 3J80L 2K4KA 1HR0W 1QJOA 4C3IB 5CBEE 3E0EA 1D5ZC 1PRTB 2H1EA 5EPLA 2IL8A 4HEDA 3GTOB 2RQXA 1WTWA 1K28A 4A3LG 4LF8L 5J39A 1A0IA 3SK5A 1O80A 2RBMA 1K0RA 2L9HA 3CCSA 2WB1B 4EGVA 4LFCQ 5FK9C 1QVFA 2M9VA 4O42A 1KIXA 4DUZQ 2CVRA 1X65A 4DR2L 1SE3A 3UE1A 5C4XB 2Y0SG 4F87A 2ZJRA 3HGBA 1TIID 3K5MA 3PUYA 4JI1L 4X62L 4DV7Q 4OWXB 1JORA 1CQFA 1G291 1XPUA 1LTLA 4P73A 2F0PA 2UUCQ 2KHSA 2A5HA 3G71A 1JOOA 2DGYA 4A3GG 1NJIC 5GADC 3H0GG 2YTVA 1KHIA 4KKSA 1EEID 1IBLQ 2WV6D 3BYYB 1YNNC 2G5DA 2ID0A 1WFQA 2ZTCA 3HOYB 1KDBA 1S5ED 3MXNA 4A76A 2F4VL 1NBWA 2DJFC 1MD2D 1V43A 2AWOA 1T5EA 3GTGH 1HZBA 1NTGA 1B7YB 2VUMH 4CJ2C 1JQYD 4OO1H 1F2LA 3S2HH 1SN8A 3PO3H 2PZWA 4GKJL 2BH8A 1S3OA 2EYFA 2N49A 4OL7A 1N32Q 1PYWD 2BE5D 4C3IG 1DCZA 1OXSC 1R4PB 4C56C 1ICWA 4IPCA 1OXXK 4AQYQ 1EFWA 4JYAL 4YY3Q 5HGQA 5DAUA 5ELFA 1WOCA 1E3PA 4JC0A 1IYVA 1VQDA 1LLRD 1KRSA 1JJGA 1NUCA 4NPSA 1TWGB 3TSSA 3S1MH 4X66Q 2DJGC 5IYDG 1X3GA 3EN2A 1ILQA 1GUSA 1E7ZA 4KY5A 1C0AA 1FGUA 2NVXB 1ESRA 2VL6A 4G7HC 1GVPA 3KLSA 1EWCA 1A62A 1TS3A 4NP5A 3SHLA 3CF5A 2WINB 5IT9c 3EROA 1KC8C 4HJ8A 1B50A 3S15H 1Q3LA 4JI6Q 1HZ9A 3CQZB 1QUQA 3S1RH 1PDQA 2K5VA 5BN4A 1UEBA 3HKZB 5JPNC 1CM9A 2AMCB 4X62Q 1CSPA 1V1OA 1E0BA 1OXUA 3M3YB 2WB1E 3BVZA 4JYAQ 5KNCA 4CKBA 4AYBG 3NHHA 4RGOS 4G57A 4HJ7A 4LMQD 2A68C 4A3EH 1DONA 1SRUA 3BS1A 2ZXPA 4KKTA 5KIXA 1SNMA 1SXTA 2O5JC 1JE4A 1HNWL 3M4QA 4XQNA 4RKLA 4OX9Q 2FHTA 5J3BA 2A6HC 4ME5A 3P75A 4AIMA 2R92G 4BA1I 1ILPA 1TWCH 4QGUA 4H7BA 3CCJA 2JA5G 1PTOH 4JI3L 3OYYA 2UXDQ 4CKEA 4R4QA 4DN4M 1AE2A 4FF4A 2ZTEA 4OWTB 3SR1A 5BN3A 1C8CA 3S1NH 2ZXOA 3S1QH 4LK1C 1FGBD 2I5MX 3NBIA 3VR3A 4DR6L 5M5XB 3RNUA 4DF7A 5DNFA 1PXUA 1U4MA 2X6LA 1KXLA 2O4XA 4DR5L 4JI4L 5FLXL 1LT6D 3Q23A 4X66L 1I94L 3H15A 3HOZG 2VB2X 3DLLA 1PV4A 2JEAI 2K32A 5AJ3L 3GO5A 4CDFC 1JWUD 3K7AB 4TSSA 5LMUL 3LGJA 1LACA 4C2MH 5A35A 2F0TA 5M3FG 3HOUB 1HA6A 3FP9A 2EY5A 1FJGQ 1SLJA 2EY2A 4IOAA 4K6LA 4C3JG 1PTOD 5IGFA 4FVMA 3OOCA 4WJWA 3CU7A 1KDCA 2ZJPA 3HOWB 2MP1A 3SGIA 3M4OH 2MJ8A 1SE8A 2I5LX 2KA7A 1F77A 3STBC 1DZ1A 2O2LD 3K5OA 1WVLA 5E4XA 2JN4A 3TQYA 4A3BH 1Q12A 1H95A 5FKAC 5M3FH 1HA5A 3I55A 3QOJA 1A63A 3PCOB 5E1FA 1SFOH 5LMNL 3HOWG 2CHBD 2ASBA 3DUZA 4R8IA 2NVTB 2F0VA 3RD4A 5AJ3Q 1E1TA 3A55A 4IFDJ 4BS9A 1KNAA 4BY7B 3TBIB 4M8AA 3T1YQ 2EJGC 2F3IA 3J7AV 3GTMH 1CHPD 3PSIA 1LTTD 4YWMA 4R1JA 1IZ6A 1M4VA 5JEAJ 4F88A 5IYCH 3UI2A 1STEA 4DV5L 4MIUA 4Q0FA 4CKCA 1PFMA 1PMRA 3J80c 3CD6A 2IHEA 1V8QA 1STYA 1Q7YC 1CT1D 1CUKA 4JV5L 3NPPA 3ITPA 1PH1A 1A2UA 2EY1A 4EQNA 2XGTA 2EZVA 1GM5A 1B70B 2SDFA 1L0XB 3ULJA 5FLXc 2IY5B 3AYHB 2N78A 2B2UA 1JJ2A 2JA7B 1LTBD 3BVMA 2BE5C 1B44D 4KN4C 2ZM6Q 1PH8A 4JI7L 1HRJA 1C7YA 2EJFC 4BBRB 1PTOF 4K0KQ 3TMEA 1K8AC 3I7FA 5K36H 1D7QA 1WTQA 1V1PA 2A1AA 2KEDA 2OXPA 1EOTA 4A3DG 5KRUA 1S5FD 3G7LA 2NZOA 1WCMH 1T9HA 2E2IB 3S1NB 1GD7A 2R92B 1G2TA 3A54A 1SYEA 3PUWA 4NXMQ 3DWQA 2A74C 2UUBQ 1HZCA 2QF7A 3T1YL 3HOVG 4HAEA 3T13A 3U58A 3UE0A 4A3KH 2UXCL 3JAME 1D5XC 1MKHA 3VYTA 1GXDC 1MSHA 1XMQQ 4IJLA 3EIVA 2NYZD 5LL6X 3R2TA 4PMWA 3I91A 1I5FA 1VQOA 4LNQA 2IX0A 3D4DA 1OXTA 4N9TA 3DM1A 5C3EG 5C0XH 2KQ3A 1L1OA 2F0EA 1L0WA 2MQHA 2R6GA 4XIGS 5H1SE 4JI5L 3HKZG 5GAGC 3SEBA 1YJWA 3R8BA 4DUYL 4LF7Q 5ELNA 4FYDA 4MZ9A 2IHFA 2A6HD 2JA7H 4JW0A 1EOVA 3KF6B 5BR8L 3PV0A 3SXHA 1LTGD 4MHEA 1A3TA 4A3CH 3OIPA 3MHBA 4B3RQ 4UHVA 1F9QA 5CV7A 3I70A 5CMDA
chains in the Genus database with same CATH topology
4LFBL 2Z0SA 2B63G 4OXPA 1PH7A 5JJLA 3K7AH 1VQFA 3OW2A 5C3EH 2IT1A 4B3SQ 4B3TQ 4DR4Q 1Q1BA 1XTDA 1YVCA 2V1CC 3UDGA 2HHHQ 4WJ3M 4JBJA 1I6HH 1VQIA 3CPFA 5GROA 1Z47A 4QL5A 2BH2A 1N32L 1ASZA 2ZM6L 4DR4L 4QIWE 4A3IG 3VDYA 3GTLH 1YZ6A 3F2CA 1VQEA 2LXJA 4HIMA 2VQFL 4APVA 1PHJA 4LF9Q 4DKAC 2IX1A 4A3LH 2PQAA 1VQMA 4JBKA 4NXNL 3DM3A 1S40A 1N33Q 4KHPQ 4K0KL 1I50H 4H02A 2B63H 1IXRA 3AFPA 3HOVH 5M5WH 3K81C 2K52A 3U4VA 5M3MG 1XJVA 1K73C 4DV0Q 3L2PA 1JJCB 4FDBA 2K75A 1PH4A 1NMFA 2CFMA 4RMFA 3TEHB 4LUVA 1YJ9A 3CC7A 1IBML 1Y1VG 1J5EQ 4JI5Q 4A3CG 1G6PA 4MNOA 4KI0A 1X3EA 4DV3L 3KF8B 3J81c 5FJ8G 1PH5A 3UDFA 1VQCA 1WJJA 4GLXA 3ULLA 4DV3Q 4Y7NH 2D62A 2JA7G 1AH9A 1O7IA 2VW9A 4X64Q 3TRZA 3I2ZA 4GNXC 2CQOA 1VCIA 3CCVA 5LMNW 4BY1H 2BA1A 3S24A 1P16A 1AE3A 4QQBX 1BVSA 2K4KA 1HR0W 1OTCA 1SMXA 2F52A 2JE6I 3HOWH 4GNXA 4HJ9A 3E0EA 1X9NA 1RIPA 1S72A 1X54A 3CC2A 2R92H 4A3LG 4LF8L 1FL0A 2E2IH 1A0IA 4JG2A 2JK8A 4JOIC 4GOPC 1N36Q 3PIPA 1K0RA 3G4SA 1Q86C 1PH2A 5EAYA 3CCSA 4A93H 4LFCQ 1CKOA 4DR6Q 1N9WA 2WB1G 3NENA 1YI2A 1EIYB 3HOYH 1QVFA 3EBEA 3HOZH 1KIXA 4DUZQ 1X65A 1N34L 4DR2L 4BBSH 3KYHC 3UE1A 2R93H 4X65L 1N8RC 4OWWB 2Y0SG 3PUVA 2ZJRA 4LUOA 3PUYA 4JI1L 3BZKA 4X62L 4OWXB 4DV7Q 4A3JG 1IL2A 1YHQA 3S2DH 2RF4A 3D31A 1DGSA 2ZTDA 1G291 4P75A 1LTLA 4C3HH 3RLFA 2VQFQ 4P73A 1XPUA 2UUCQ 4DAYB 2LSSA 1MJEA 5M3MH 4LF7L 3G71A 3PUXA 2DGYA 4A3GG 4GN3B 4DK6C 4DV0L 2NVYH 1UE6A 5GADC 1NJIC 4J15A 2VUMG 4GNXB 4A3DH 3H0GG 3KF6A 3J7ZC 3PGZA 2YTVA 4OO1G 1KHIA 3HKSA 1I3QH 1JT8A 3CCQA 4LF6L 1IBLQ 1XNRQ 3J81i 1PFSA 5M5XH 4BY7G 3IRBA 2F4VQ 2MO1A 2ID0A 2RHQB 1IBLL 3CPWA 1WFQA 2ZTCA 4DV4Q 3PF5A 3M85A 3CCLA 4A76A 1V9PA 2F4VL 1NBWA 4DR1Q 1V43A 2AWOA 4O0AA 4A3GH 4NB3A 1L1OB 1Y14B 3K8AA 1HZBA 1FVIA 1NTGA 3GTGH 1B7YB 2VUMH 3U50C 3H0GH 2JA6H 3S2HH 1SN8A 1VQ4A 4JI8Q 4B3SL 1KL9A 3OTOQ 3CCEA 3PO3H 4BY7H 4GKJL 2BH8A 1S3OA 3G6EA 2N49A 2WFWA 5GAEC 1N32Q 4YCUA 4A3MG 4JI2L 1QVCA 2Y0SE 2UXCQ 1YNXA 2ES2A 2GVAA 5FJ8H 3A5UA 2OWOA 3F1ZA 1N36L 1OXSC 1VQ5A 1N33L 4IPCA 3UDXA 1KRTA 2R7ZG 2JA8G 1UE7A 1OXXK 4AQYQ 5C0XG 3D0FA 4JBWA 1EFWA 4JYAL 4YY3Q 1NMGA 5HGQA 3JC66 5E7NA 3PO3G 2QA4A 1D8LA 4LF5L 1WOCA 4KLKA 4OONA 1E3PA 4JC0A 1QUQB 1VQDA 2HIXA 2R93G 3PIOA 1KRSA 4YY3L 2R7DA 4BXXG 1JJGA 1OXVA 1TWHH 3CCUA 3BZCA 4ME3A 4NPSA 4LF5Q 4HIOA 2HT1A 2UXBQ 3HOXG 4B3TL 1IYJB 3S1MH 3U4ZA 2JEBI 2VQEL 4DV2L 4X66Q 3ER0A 4TVAB 4O2DA 5IYDG 1X3GA 2Q2TA 3EN2A 4ALPA 4GS3A 4LW1A 3RLOA 2E5LL 3B6YA 3M3YH 2WP8J 1E7ZA 4DR3L 1K9MC 4X64L 1C0AA 3BJUA 4IPHA 4DK3C 2VNUD 2YYZA 1FGUA 4GLAC 1PVOA 2VL6A 4GOPB 5C4XG 1GVPA 4PZ8A 2E2HH 1L1OC 1A62A 3J7A5 1QVGA 1U5KA 2YV5A 3M4PA 2Z6KA 3KDFA 4JI6L 4A3BG 1C9OA 3CF5A 4WJ4A 5IT9c 2PMZE 3CQZH 4HJ8A 1KC8C 3S15H 1VQGA 4DR1L 2CKZB 4JI6Q 1HZ9A 3ERSX 1YJNA 4R4CA 1VQ9A 2JA6G 2A19A 2KCMA 1QUQA 4UP8A 4IFDG 3S1RH 3JAMc 2CWAA 4DUZL 2K5VA 3NBHB 4A3IH 1UEBA 4GLVB 1M90C 4UP9A 3GTPH 1VQJA 2QGQA 5ELOA 1BKBA 3G48A 4GKKQ 3W1BA 2NVXH 1LM0A 2OTJA 2AMCB 2JA5H 4X62Q 1CSPA 1OXUA 3L7ZC 5IE8A 2ALYB 1U0LA 3F2DA 2VZAA 2WB1E 4B3MQ 2UUCL 1E24A 3I56A 3S17H 2D0PA 1YBYA 4JYAQ 4GOPA 2ZJQA 1VQBA 1TWGH 4NXNQ 4JI0Q 3FKIH 1QZGA 4R4TA 4AYBG 5C4XH 4KHPL 4A3FG 4P74A 4HJ7A 3GTQH 3CC4A 1W3SA 5IYBH 3KDFB 1XPRA 1CKNA 4A3EH 1SRUA 4L5QA 2KCTA 1PH6A 5IP9G 4JOIA 4UPAA 3A74A 4EQ5A 4DV4L 3KFUA 3E9HA 1K83H 3I4OA 4BA2I 1V1QA 2RCNA 1HNWL 2NZHA 1TWFH 3M4QA 1XPOA 2FXQA 3KOJA 2H5XA 4L5RC 4OX9Q 2K50A 3TS2A 2LXKA 5J3BA 3ZJYC 4AIMA 2I5HA 3OTOL 4A3EG 3PF4A 2NN6I 4BA1I 1PH3A 1MIUA 1TWCH 1YIJA 5IP7H 4OX9L 1VQ6A 2R92G 1X3FA 4QGUA 4R4IA 3CCMA 1P8LA 3CCJA 3E9IA 2JA5G 4DAMA 3CP0A 4JI2Q 2KBNA 4JI3L 1L2FA 3NEMA 3OYYA 2UXDQ 1X55A 4R4QA 1JB7A 3I4NH 2AHOB 2N3SA 4IPDA 1AE2A 3JAMi 4XTCS 1GKHA 4HJ5A 1Z9FA 4GN5A 2ZTEA 4OWTB 4BBSG 3S1NH 3S1QH 3TREA 4POFA 1KAWA 3KLWA 2I5MX 4LFCL 4DR6L 4AH6A 4DR5Q 4JI4Q 1PYBA 1XMOL 3GTKH 1GO3E 3RNUA 3K0XA 1YEZA 3AEVA 1KXLA 4GKKL 2MFIA 4DR5L 1BBUA 4DR2Q 4JI4L 5C4JH 1EUJA 4YCVA 1ASYA 4X65Q 5JJKA 1UWVA 1R9TH 4X66L 4DV1L 1I94L 3UDIA 5FLMH 3H15A 3HOZG 3CW2C 3RZDH 5DLQE 3DLLA 3RLNA 1PV4A 4PZ7A 2JEAI 5LMUQ 5AJ3L 2OCEA 3GO5A 1JE5A 1BBWA 4YHHQ 5C0XJ 4A75A 5LMUL 3LGJA 1PA6A 3ICEA 4LFAL 4C2MH 4LF6Q 5GAHC 2VY3A 1FJGL 1XNRL 3CMAA 3RN5A 4JBMA 1HR0L 4B3RL 5M3FG 1UE1A 5FLMG 3FP9A 2UU9L 1HNWQ 1EWIA 4DV5Q 2XTIA 2AKWB 1FJGQ 1RL2A 1Y1VH 2K5NA 1SLJA 1HJPA 2KHIA 3S14H 2CCZA 5M5YH 4IOAA 2K14A 3GTOH 3PO2G 1NY4A 3KJPA 4R4OA 5IP7G 3J80i 2ZJPA 3TS0A 3H3VI 5JEAG 2KHJA 2L15A 1VQ8A 3SGIA 3M4OH 5HY6A 4GKJQ 1CKMA 1SE8A 2I5LX 2EIFA 2JA8H 2CWPA 1SROA 1A8VA 4YCWA 2DUDA 3CMEA 1X6OA 2B3GA 1VS0A 2VS1A 1XMQL 2ATWA 4LF4Q 3STBC 3PO2H 4JI0L 2Q2HA 2JQOA 4BXXH 1WI5A 2EXDA 3TQYA 3A0JA 3L0OA 4AQYL 4HIDA 4A3BH 1LYLA 1Q12A 1H95A 1HZAA 1E22A 4JCVE 1HH2P 4RG1A 1E1OA 3S16H 3MXNB 3W1GA 5M3FH 3RR5A 3PUZA 4UY8C 3I55A 1A63A 3PCOB 3BU2A 4P72A 5IYCG 3I4NG 1SFOH 5LMNL 4L5SA 3HOWG 4BBRG 2Z6KC 2R7FA 4PZ6A 1G51A 2ASBA 1B8AA 4HJAA 2VQEQ 2NVQH 2AWNA 4A4IA 1YITA 2E8GA 2KENA 5AJ3Q 1E1TA 1KQSA 2E5LQ 2UUAQ 1KD1C 3K80C 4IOCA 1M1KC 4IFDJ 4DR3Q 3T1HL 1VQAA 2GN5A 3T1YQ 2F3IA 5K36G 4YHHL 1J6QA 3GTMH 1UE5A 5IWAL 4IO9A 3PSIA 2QEXA 4LFAQ 4YWMA 4R1JA 1IZ6A 1X56A 2PI2E 1K3RA 5JEAJ 4A3KG 4X6AH 5IYCH 2UU9Q 1LUZA 5IWAQ 2UXDL 3W5OA 4DV5L 4JV5Q 1XNQQ 1EQQA 1Q81C 2JA9A 2EQSA 3J80c 3CD6A 2IHEA 1Q7YC 5GQOA 1CUKA 4JV5L 1Q8KA 1PH1A 3H3VH 4LFBQ 1VQNA 2XGTA 5C44H 3RN2A 1GM5A 1B70B 5JJIA 3ULJA 5FLXc 2IY5B 3STBD 3AYHB 3J81j 4LUZA 4YWLA 3HOYG 2N78A 1JJ2A 4DR7Q 4LWCA 2OTLA 4BY1G 4Y52H 4BBRH 2ZM6Q 5C0XI 1PH8A 4JI7L 4DV1Q 1I94Q 1C7YA 4MTNA 4A3FH 1VQ7A 4DR7L 1Y1WH 2PQAB 4B3ML 1MJCA 4A3MH 4K0KQ 1K8AC 4JI7Q 3I7FA 3I4MH 3M7NA 1EYGA 4L5TA 4PG3A 2OQ0A 1D7QA 5IP9H 3MEFA 4EX5A 2OQKA 2A1AA 4A93G 4HIKA 1IBMQ 2WAQG 4IJHA 3GD7A 4DNIA 4A3DG 2NN6G 2NZOA 1WCMH 1T9HA 3GTJH 3RZOH 1YHAA 3M9BA 1GD7A 1Y1WG 3Q8DA 4DV6L 1Q82C 2GVBA 1TWAH 2YU9H 3I4MG 1EIFA 2WAQE 3PUWA 4NXMQ 4C3IH 1PH9A 2UUAL 4JI8L 3HOXH 2UUBQ 1HZCA 1HNXQ 2C35B 3T1YL 3HOVG 3F8TA 4QJFA 2R7ZH 1EQRA 3FHWA 3U58A 3UE0A 2UUBL 1SR3A 4A3KH 2UXCL 1HNXL 2HHHL 2RHSB 1MKHA 2I0QA 1WCMG 3CXCA 2HQLA 2NVTH 3AFQA 1XNQL 1XMQQ 1Q1EA 4DPGA 4IJLA 4QY7A 1IBKL 3EIVA 4JI3Q 4LF4L 4LF8Q 1VQKA 5IYBG 3CCRA 2PNHA 3HKZE 2UXBL 1WYDA 3HOUG 1QZHA 4PMWA 1VQLA 1CKNB 1IBKQ 3NELA 5IYDH 1I5FA 1VQOA 4LNQA 3WWVA 1Q46A 4LF9L 2IX0A 2YTXA 1OXTA 5C3EG 1N34Q 1YHBA 4IFDI 2PI2A 1XMOQ 3HFZB 3GDEA 1L1OA 1HNZL 4GN4B 1L0WA 2YTYA 2Q2IA 2MQHA 2D0OA 2R6GA 5IY0A 4XIGS 4DV2Q 5H1SE 4JI5L 3HKZG 5GAGC 3A5ZB 4JI1Q 5LMNQ 4DV7L 1YJWA 1J5EL 4C3JH 4POGA 1HNZQ 1TXYA 4TQUS 3AQQA 2B29A 2K5HA 1CSQA 2BA0A 3CAMA 3KJOA 4DUYL 4LF7Q 5ELNA 3F2BA 5C44G 4MZ9A 2IHFA 3T1HQ 1JMCA 4OO1I 2JA7H 1EOVA 3KF6B 4P71A 5BR8L 4DUYQ 1VQPA 2N8NA 3PV0A 2A8VA 3ULPA 3FKIG 2JJQA 4UP7A 5BR8Q 4AYBE 2Q2UA 4YWKA 2E2JH 4A3CH 1K8GA 4DV6Q 1PYSB 1HR0Q 1NE3A 4B3RQ 2HIVA 3K7UC 4A3JH 4NXML 1W2BA 3HOUH 1VQHA 4IPGA 2MNAA 2MO0A 4KHZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFB L;  2Z0S A;  2B63 G;  4OXP A;  1PH7 A;  5JJL A;  3K7A H;  1VQF A;  3OW2 A;  5C3E H;  2IT1 A;  4B3S Q;  4B3T Q;  4DR4 Q;  1Q1B A;  1XTD A;  1YVC A;  2V1C C;  3UDG A;  2HHH Q;  4WJ3 M;  4JBJ A;  1I6H H;  1VQI A;  3CPF A;  5GRO A;  1Z47 A;  4QL5 A;  2BH2 A;  1N32 L;  1ASZ A;  2ZM6 L;  4DR4 L;  4QIW E;  4A3I G;  3VDY A;  3GTL H;  1YZ6 A;  3F2C A;  1VQE A;  2LXJ A;  4HIM A;  2VQF L;  4APV A;  1PHJ A;  4LF9 Q;  4DKA C;  2IX1 A;  4A3L H;  2PQA A;  1VQM A;  4JBK A;  4NXN L;  3DM3 A;  1S40 A;  1N33 Q;  4KHP Q;  4K0K L;  1I50 H;  4H02 A;  2B63 H;  1IXR A;  3AFP A;  3HOV H;  5M5W H;  3K81 C;  2K52 A;  3U4V A;  5M3M G;  1XJV A;  1K73 C;  4DV0 Q;  3L2P A;  1JJC B;  4FDB A;  2K75 A;  1PH4 A;  1NMF A;  2CFM A;  4RMF A;  3TEH B;  4LUV A;  1YJ9 A;  3CC7 A;  1IBM L;  1Y1V G;  1J5E Q;  4JI5 Q;  4A3C G;  1G6P A;  4MNO A;  4KI0 A;  1X3E A;  4DV3 L;  3KF8 B;  3J81 c;  5FJ8 G;  1PH5 A;  3UDF A;  1VQC A;  1WJJ A;  4GLX A;  3ULL A;  4DV3 Q;  4Y7N H;  2D62 A;  2JA7 G;  1AH9 A;  1O7I A;  2VW9 A;  4X64 Q;  3TRZ A;  3I2Z A;  4GNX C;  2CQO A;  1VCI A;  3CCV A;  5LMN W;  4BY1 H;  2BA1 A;  3S24 A;  1P16 A;  1AE3 A;  4QQB X;  1BVS A;  2K4K A;  1HR0 W;  1OTC A;  1SMX A;  2F52 A;  2JE6 I;  3HOW H;  4GNX A;  4HJ9 A;  3E0E A;  1X9N A;  1RIP A;  1S72 A;  1X54 A;  3CC2 A;  2R92 H;  4A3L G;  4LF8 L;  1FL0 A;  2E2I H;  1A0I A;  4JG2 A;  2JK8 A;  4JOI C;  4GOP C;  1N36 Q;  3PIP A;  1K0R A;  3G4S A;  1Q86 C;  1PH2 A;  5EAY A;  3CCS A;  4A93 H;  4LFC Q;  1CKO A;  4DR6 Q;  1N9W A;  2WB1 G;  3NEN A;  1YI2 A;  1EIY B;  3HOY H;  1QVF A;  3EBE A;  3HOZ H;  1KIX A;  4DUZ Q;  1X65 A;  1N34 L;  4DR2 L;  4BBS H;  3KYH C;  3UE1 A;  2R93 H;  4X65 L;  1N8R C;  4OWW B;  2Y0S G;  3PUV A;  2ZJR A;  4LUO A;  3PUY A;  4JI1 L;  3BZK A;  4X62 L;  4OWX B;  4DV7 Q;  4A3J G;  1IL2 A;  1YHQ A;  3S2D H;  2RF4 A;  3D31 A;  1DGS A;  2ZTD A;  1G29 1;  4P75 A;  1LTL A;  4C3H H;  3RLF A;  2VQF Q;  4P73 A;  1XPU A;  2UUC Q;  4DAY B;  2LSS A;  1MJE A;  5M3M H;  4LF7 L;  3G71 A;  3PUX A;  2DGY A;  4A3G G;  4GN3 B;  4DK6 C;  4DV0 L;  2NVY H;  1UE6 A;  5GAD C;  1NJI C;  4J15 A;  2VUM G;  4GNX B;  4A3D H;  3H0G G;  3KF6 A;  3J7Z C;  3PGZ A;  2YTV A;  4OO1 G;  1KHI A;  3HKS A;  1I3Q H;  1JT8 A;  3CCQ A;  4LF6 L;  1IBL Q;  1XNR Q;  3J81 i;  1PFS A;  5M5X H;  4BY7 G;  3IRB A;  2F4V Q;  2MO1 A;  2ID0 A;  2RHQ B;  1IBL L;  3CPW A;  1WFQ A;  2ZTC A;  4DV4 Q;  3PF5 A;  3M85 A;  3CCL A;  4A76 A;  1V9P A;  2F4V L;  1NBW A;  4DR1 Q;  1V43 A;  2AWO A;  4O0A A;  4A3G H;  4NB3 A;  1L1O B;  1Y14 B;  3K8A A;  1HZB A;  1FVI A;  1NTG A;  3GTG H;  1B7Y B;  2VUM H;  3U50 C;  3H0G H;  2JA6 H;  3S2H H;  1SN8 A;  1VQ4 A;  4JI8 Q;  4B3S L;  1KL9 A;  3OTO Q;  3CCE A;  3PO3 H;  4BY7 H;  4GKJ L;  2BH8 A;  1S3O A;  3G6E A;  2N49 A;  2WFW A;  5GAE C;  1N32 Q;  4YCU A;  4A3M G;  4JI2 L;  1QVC A;  2Y0S E;  2UXC Q;  1YNX A;  2ES2 A;  2GVA A;  5FJ8 H;  3A5U A;  2OWO A;  3F1Z A;  1N36 L;  1OXS C;  1VQ5 A;  1N33 L;  4IPC A;  3UDX A;  1KRT A;  2R7Z G;  2JA8 G;  1UE7 A;  1OXX K;  4AQY Q;  5C0X G;  3D0F A;  4JBW A;  1EFW A;  4JYA L;  4YY3 Q;  1NMG A;  5HGQ A;  3JC6 6;  5E7N A;  3PO3 G;  2QA4 A;  1D8L A;  4LF5 L;  1WOC A;  4KLK A;  4OON A;  1E3P A;  4JC0 A;  1QUQ B;  1VQD A;  2HIX A;  2R93 G;  3PIO A;  1KRS A;  4YY3 L;  2R7D A;  4BXX G;  1JJG A;  1OXV A;  1TWH H;  3CCU A;  3BZC A;  4ME3 A;  4NPS A;  4LF5 Q;  4HIO A;  2HT1 A;  2UXB Q;  3HOX G;  4B3T L;  1IYJ B;  3S1M H;  3U4Z A;  2JEB I;  2VQE L;  4DV2 L;  4X66 Q;  3ER0 A;  4TVA B;  4O2D A;  5IYD G;  1X3G A;  2Q2T A;  3EN2 A;  4ALP A;  4GS3 A;  4LW1 A;  3RLO A;  2E5L L;  3B6Y A;  3M3Y H;  2WP8 J;  1E7Z A;  4DR3 L;  1K9M C;  4X64 L;  1C0A A;  3BJU A;  4IPH A;  4DK3 C;  2VNU D;  2YYZ A;  1FGU A;  4GLA C;  1PVO A;  2VL6 A;  4GOP B;  5C4X G;  1GVP A;  4PZ8 A;  2E2H H;  1L1O C;  1A62 A;  3J7A 5;  1QVG A;  1U5K A;  2YV5 A;  3M4P A;  2Z6K A;  3KDF A;  4JI6 L;  4A3B G;  1C9O A;  3CF5 A;  4WJ4 A;  5IT9 c;  2PMZ E;  3CQZ H;  4HJ8 A;  1KC8 C;  3S15 H;  1VQG A;  4DR1 L;  2CKZ B;  4JI6 Q;  1HZ9 A;  3ERS X;  1YJN A;  4R4C A;  1VQ9 A;  2JA6 G;  2A19 A;  2KCM A;  1QUQ A;  4UP8 A;  4IFD G;  3S1R H;  3JAM c;  2CWA A;  4DUZ L;  2K5V A;  3NBH B;  4A3I H;  1UEB A;  4GLV B;  1M90 C;  4UP9 A;  3GTP H;  1VQJ A;  2QGQ A;  5ELO A;  1BKB A;  3G48 A;  4GKK Q;  3W1B A;  2NVX H;  1LM0 A;  2OTJ A;  2AMC B;  2JA5 H;  4X62 Q;  1CSP A;  1OXU A;  3L7Z C;  5IE8 A;  2ALY B;  1U0L A;  3F2D A;  2VZA A;  2WB1 E;  4B3M Q;  2UUC L;  1E24 A;  3I56 A;  3S17 H;  2D0P A;  1YBY A;  4JYA Q;  4GOP A;  2ZJQ A;  1VQB A;  1TWG H;  4NXN Q;  4JI0 Q;  3FKI H;  1QZG A;  4R4T A;  4AYB G;  5C4X H;  4KHP L;  4A3F G;  4P74 A;  4HJ7 A;  3GTQ H;  3CC4 A;  1W3S A;  5IYB H;  3KDF B;  1XPR A;  1CKN A;  4A3E H;  1SRU A;  4L5Q A;  2KCT A;  1PH6 A;  5IP9 G;  4JOI A;  4UPA A;  3A74 A;  4EQ5 A;  4DV4 L;  3KFU A;  3E9H A;  1K83 H;  3I4O A;  4BA2 I;  1V1Q A;  2RCN A;  1HNW L;  2NZH A;  1TWF H;  3M4Q A;  1XPO A;  2FXQ A;  3KOJ A;  2H5X A;  4L5R C;  4OX9 Q;  2K50 A;  3TS2 A;  2LXK A;  5J3B A;  3ZJY C;  4AIM A;  2I5H A;  3OTO L;  4A3E G;  3PF4 A;  2NN6 I;  4BA1 I;  1PH3 A;  1MIU A;  1TWC H;  1YIJ A;  5IP7 H;  4OX9 L;  1VQ6 A;  2R92 G;  1X3F A;  4QGU A;  4R4I A;  3CCM A;  1P8L A;  3CCJ A;  3E9I A;  2JA5 G;  4DAM A;  3CP0 A;  4JI2 Q;  2KBN A;  4JI3 L;  1L2F A;  3NEM A;  3OYY A;  2UXD Q;  1X55 A;  4R4Q A;  1JB7 A;  3I4N H;  2AHO B;  2N3S A;  4IPD A;  1AE2 A;  3JAM i;  4XTC S;  1GKH A;  4HJ5 A;  1Z9F A;  4GN5 A;  2ZTE A;  4OWT B;  4BBS G;  3S1N H;  3S1Q H;  3TRE A;  4POF A;  1KAW A;  3KLW A;  2I5M X;  4LFC L;  4DR6 L;  4AH6 A;  4DR5 Q;  4JI4 Q;  1PYB A;  1XMO L;  3GTK H;  1GO3 E;  3RNU A;  3K0X A;  1YEZ A;  3AEV A;  1KXL A;  4GKK L;  2MFI A;  4DR5 L;  1BBU A;  4DR2 Q;  4JI4 L;  5C4J H;  1EUJ A;  4YCV A;  1ASY A;  4X65 Q;  5JJK A;  1UWV A;  1R9T H;  4X66 L;  4DV1 L;  1I94 L;  3UDI A;  5FLM H;  3H15 A;  3HOZ G;  3CW2 C;  3RZD H;  5DLQ E;  3DLL A;  3RLN A;  1PV4 A;  4PZ7 A;  2JEA I;  5LMU Q;  5AJ3 L;  2OCE A;  3GO5 A;  1JE5 A;  1BBW A;  4YHH Q;  5C0X J;  4A75 A;  5LMU L;  3LGJ A;  1PA6 A;  3ICE A;  4LFA L;  4C2M H;  4LF6 Q;  5GAH C;  2VY3 A;  1FJG L;  1XNR L;  3CMA A;  3RN5 A;  4JBM A;  1HR0 L;  4B3R L;  5M3F G;  1UE1 A;  5FLM G;  3FP9 A;  2UU9 L;  1HNW Q;  1EWI A;  4DV5 Q;  2XTI A;  2AKW B;  1FJG Q;  1RL2 A;  1Y1V H;  2K5N A;  1SLJ A;  1HJP A;  2KHI A;  3S14 H;  2CCZ A;  5M5Y H;  4IOA A;  2K14 A;  3GTO H;  3PO2 G;  1NY4 A;  3KJP A;  4R4O A;  5IP7 G;  3J80 i;  2ZJP A;  3TS0 A;  3H3V I;  5JEA G;  2KHJ A;  2L15 A;  1VQ8 A;  3SGI A;  3M4O H;  5HY6 A;  4GKJ Q;  1CKM A;  1SE8 A;  2I5L X;  2EIF A;  2JA8 H;  2CWP A;  1SRO A;  1A8V A;  4YCW A;  2DUD A;  3CME A;  1X6O A;  2B3G A;  1VS0 A;  2VS1 A;  1XMQ L;  2ATW A;  4LF4 Q;  3STB C;  3PO2 H;  4JI0 L;  2Q2H A;  2JQO A;  4BXX H;  1WI5 A;  2EXD A;  3TQY A;  3A0J A;  3L0O A;  4AQY L;  4HID A;  4A3B H;  1LYL A;  1Q12 A;  1H95 A;  1HZA A;  1E22 A;  4JCV E;  1HH2 P;  4RG1 A;  1E1O A;  3S16 H;  3MXN B;  3W1G A;  5M3F H;  3RR5 A;  3PUZ A;  4UY8 C;  3I55 A;  1A63 A;  3PCO B;  3BU2 A;  4P72 A;  5IYC G;  3I4N G;  1SFO H;  5LMN L;  4L5S A;  3HOW G;  4BBR G;  2Z6K C;  2R7F A;  4PZ6 A;  1G51 A;  2ASB A;  1B8A A;  4HJA A;  2VQE Q;  2NVQ H;  2AWN A;  4A4I A;  1YIT A;  2E8G A;  2KEN A;  5AJ3 Q;  1E1T A;  1KQS A;  2E5L Q;  2UUA Q;  1KD1 C;  3K80 C;  4IOC A;  1M1K C;  4IFD J;  4DR3 Q;  3T1H L;  1VQA A;  2GN5 A;  3T1Y Q;  2F3I A;  5K36 G;  4YHH L;  1J6Q A;  3GTM H;  1UE5 A;  5IWA L;  4IO9 A;  3PSI A;  2QEX A;  4LFA Q;  4YWM A;  4R1J A;  1IZ6 A;  1X56 A;  2PI2 E;  1K3R A;  5JEA J;  4A3K G;  4X6A H;  5IYC H;  2UU9 Q;  1LUZ A;  5IWA Q;  2UXD L;  3W5O A;  4DV5 L;  4JV5 Q;  1XNQ Q;  1EQQ A;  1Q81 C;  2JA9 A;  2EQS A;  3J80 c;  3CD6 A;  2IHE A;  1Q7Y C;  5GQO A;  1CUK A;  4JV5 L;  1Q8K A;  1PH1 A;  3H3V H;  4LFB Q;  1VQN A;  2XGT A;  5C44 H;  3RN2 A;  1GM5 A;  1B70 B;  5JJI A;  3ULJ A;  5FLX c;  2IY5 B;  3STB D;  3AYH B;  3J81 j;  4LUZ A;  4YWL A;  3HOY G;  2N78 A;  1JJ2 A;  4DR7 Q;  4LWC A;  2OTL A;  4BY1 G;  4Y52 H;  4BBR H;  2ZM6 Q;  5C0X I;  1PH8 A;  4JI7 L;  4DV1 Q;  1I94 Q;  1C7Y A;  4MTN A;  4A3F H;  1VQ7 A;  4DR7 L;  1Y1W H;  2PQA B;  4B3M L;  1MJC A;  4A3M H;  4K0K Q;  1K8A C;  4JI7 Q;  3I7F A;  3I4M H;  3M7N A;  1EYG A;  4L5T A;  4PG3 A;  2OQ0 A;  1D7Q A;  5IP9 H;  3MEF A;  4EX5 A;  2OQK A;  2A1A A;  4A93 G;  4HIK A;  1IBM Q;  2WAQ G;  4IJH A;  3GD7 A;  4DNI A;  4A3D G;  2NN6 G;  2NZO A;  1WCM H;  1T9H A;  3GTJ H;  3RZO H;  1YHA A;  3M9B A;  1GD7 A;  1Y1W G;  3Q8D A;  4DV6 L;  1Q82 C;  2GVB A;  1TWA H;  2YU9 H;  3I4M G;  1EIF A;  2WAQ E;  3PUW A;  4NXM Q;  4C3I H;  1PH9 A;  2UUA L;  4JI8 L;  3HOX H;  2UUB Q;  1HZC A;  1HNX Q;  2C35 B;  3T1Y L;  3HOV G;  3F8T A;  4QJF A;  2R7Z H;  1EQR A;  3FHW A;  3U58 A;  3UE0 A;  2UUB L;  1SR3 A;  4A3K H;  2UXC L;  1HNX L;  2HHH L;  2RHS B;  1MKH A;  2I0Q A;  1WCM G;  3CXC A;  2HQL A;  2NVT H;  3AFQ A;  1XNQ L;  1XMQ Q;  1Q1E A;  4DPG A;  4IJL A;  4QY7 A;  1IBK L;  3EIV A;  4JI3 Q;  4LF4 L;  4LF8 Q;  1VQK A;  5IYB G;  3CCR A;  2PNH A;  3HKZ E;  2UXB L;  1WYD A;  3HOU G;  1QZH A;  4PMW A;  1VQL A;  1CKN B;  1IBK Q;  3NEL A;  5IYD H;  1I5F A;  1VQO A;  4LNQ A;  3WWV A;  1Q46 A;  4LF9 L;  2IX0 A;  2YTX A;  1OXT A;  5C3E G;  1N34 Q;  1YHB A;  4IFD I;  2PI2 A;  1XMO Q;  3HFZ B;  3GDE A;  1L1O A;  1HNZ L;  4GN4 B;  1L0W A;  2YTY A;  2Q2I A;  2MQH A;  2D0O A;  2R6G A;  5IY0 A;  4XIG S;  4DV2 Q;  5H1S E;  4JI5 L;  3HKZ G;  5GAG C;  3A5Z B;  4JI1 Q;  5LMN Q;  4DV7 L;  1YJW A;  1J5E L;  4C3J H;  4POG A;  1HNZ Q;  1TXY A;  4TQU S;  3AQQ A;  2B29 A;  2K5H A;  1CSQ A;  2BA0 A;  3CAM A;  3KJO A;  4DUY L;  4LF7 Q;  5ELN A;  3F2B A;  5C44 G;  4MZ9 A;  2IHF A;  3T1H Q;  1JMC A;  4OO1 I;  2JA7 H;  1EOV A;  3KF6 B;  4P71 A;  5BR8 L;  4DUY Q;  1VQP A;  2N8N A;  3PV0 A;  2A8V A;  3ULP A;  3FKI G;  2JJQ A;  4UP7 A;  5BR8 Q;  4AYB E;  2Q2U A;  4YWK A;  2E2J H;  4A3C H;  1K8G A;  4DV6 Q;  1PYS B;  1HR0 Q;  1NE3 A;  4B3R Q;  2HIV A;  3K7U C;  4A3J H;  4NXM L;  1W2B A;  3HOU H;  1VQH A;  4IPG A;  2MNA A;  2MO0 A;  4KHZ A; 
#chains in the Genus database with same CATH topology
 3MAQ A;  4OXP A;  2HCC A;  2IWH A;  3OW2 A;  4WOR A;  4R8N A;  5C3E H;  1XTD A;  2HHH Q;  1JWM D;  4GZY C;  5FOB B;  3Q22 A;  1I6H H;  4ZKB B;  3FPP A;  4DR4 L;  1QE6 A;  2LMC B;  1R9T B;  1ML0 D;  4FF1 A;  1S40 A;  1N33 Q;  2CH4 W;  4H02 A;  1IXR A;  2AUJ D;  3K81 C;  5M3M G;  4QUC A;  4DV0 Q;  2LFN A;  1JJC B;  3LNN A;  4FNF A;  1NNX A;  1NMF A;  4N9P A;  4ZUI A;  2CFM A;  3TEH B;  4CDD C;  4LUV A;  1D1I A;  1YJ9 A;  1IBM L;  2KJX A;  2PNR C;  4NW2 A;  4JI5 Q;  1DD2 A;  1VMC A;  1X3E A;  1WD0 A;  4KTA A;  5HUR A;  3KF8 B;  3J81 c;  3UDF A;  3J81 L;  1AH9 A;  2D62 A;  1O7I A;  2R7Z B;  2QEJ C;  2CQO A;  1VCI A;  3CCV A;  4NDX A;  2DY7 A;  5LMN W;  3S24 A;  3DMU A;  3T56 B;  1AE3 A;  3HOW H;  2F52 A;  1X9N A;  1X54 A;  3GTJ B;  1FL0 A;  4JG2 A;  4JOI C;  1K83 B;  4GOP C;  3PIP A;  1PH2 A;  3G4S A;  1Q86 C;  5FLX E;  1KAA A;  4RHR A;  2WB1 G;  4OIK A;  2NTT A;  3TP7 A;  5IIF A;  2EYM A;  3IKJ A;  1ET9 A;  2DNC A;  3DWA A;  2F0F A;  2C5C A;  4C3H H;  4B3T Q;  2ZTD A;  1KLU D;  2DNE A;  2FMC A;  2LSS A;  4OHJ A;  5M3M H;  4OEM B;  4C3H B;  3RUZ A;  2Z4H A;  3KF6 A;  1I3Q H;  2K6A A;  4OGQ C;  3MEH A;  1XNR Q;  1X3Q A;  2A6E C;  1PFS A;  4BY7 G;  5KND A;  1GUN A;  1ZYR D;  3E5S A;  2QDL A;  2SEB D;  2F4V Q;  4K8I A;  3P20 A;  3M85 A;  3CCL A;  2XWB B;  1PFN A;  2A73 B;  1L1O B;  1Y14 B;  3K8A A;  1RF2 D;  3U50 C;  3I4L A;  1VQ4 A;  4JI8 Q;  1KL9 A;  1BR9 A;  3AB9 A;  2HQE A;  1ENF A;  2XRS D;  1VQ5 A;  1RTO A;  1N33 L;  4F7X A;  4IUU A;  1I4G A;  3NUC A;  1KRT A;  4KK7 A;  5DEH A;  2L4N A;  2K01 A;  3OPO A;  3NSW A;  1NMG A;  3JC6 6;  2F3V A;  1JIC A;  1QUQ B;  2HIX A;  1RHP A;  4YY3 L;  3LX0 A;  3ONA B;  2V4D A;  1OXV A;  1TWH H;  3CCU A;  4LF5 Q;  2HT1 A;  4HIO A;  3FVQ A;  3DWP A;  3BDO A;  5FO8 B;  3HOX G;  4B3T L;  2JEB I;  3KF8 A;  4K2K A;  1Z7T A;  3ER0 A;  2Q2T A;  4GS3 A;  2WP8 J;  1KLG D;  4IPH A;  1PVO A;  4KHV A;  1I6H B;  4A3I B;  1SE2 A;  2BOS A;  2EYH A;  2YV5 A;  1NR2 A;  3FPU B;  1EEF D;  4JI6 L;  1QIL A;  1Y8P B;  2FJ2 A;  4JVZ A;  2F0Q A;  2PW5 A;  1XX8 A;  3QWN A;  1HQM C;  1YJN A;  2A19 A;  2KCM A;  1CFM A;  1BDO A;  2MGS A;  3D8G A;  2Y0S B;  1EZ8 A;  3BDL A;  3NBH B;  4RCN A;  1MI2 A;  4RKB A;  4GLV B;  4A3I H;  1M90 C;  3GTP H;  3VR2 A;  2L0C A;  3G48 A;  3VA7 A;  1Q8I A;  2NVX H;  2OTJ A;  3ND9 A;  5M3M B;  2NTS A;  4TRD A;  3J7A F;  2VZA A;  5CBA E;  4J8Q A;  2D0P A;  3SDZ A;  2ZJQ A;  1PTO C;  1TWG H;  1AN8 A;  1UAP A;  1TWH B;  3R2I A;  4K8J A;  3GTQ H;  4K14 A;  4JK1 C;  1T5X D;  1PH6 A;  4IAL A;  3A74 A;  2Q8I B;  4EQ5 A;  4DV4 L;  2XNA C;  3I72 A;  4RAU C;  3CRK C;  5LHY 1;  3NBH A;  3TS2 A;  3ZJY C;  2I5H A;  3OTO L;  4QUF A;  4CDC C;  2NN6 I;  4A3E G;  1MIU A;  1ONL A;  1X3F A;  4R4I A;  4XYO A;  1K8M A;  1LT4 D;  1P8L A;  1JOK A;  1SMY C;  3E9I A;  1QB5 D;  4DAM A;  1B1Z A;  3PO3 B;  1AZP A;  4FXD A;  3S2H B;  1RTN A;  3GTG B;  1SNP A;  4L63 B;  2AHO B;  2AQ2 B;  4XTC S;  1Z9F A;  2J0T D;  4GN5 A;  3WOF A;  5J1Z A;  4BBS G;  3WDN A;  1WCM B;  3KLW A;  2EPB A;  4DR5 Q;  4JI4 Q;  1GO3 E;  3NQT A;  1TKW B;  3K0X A;  1EY0 A;  1YEZ A;  1O7Z A;  3ZYY X;  3AEV A;  4GKK L;  4DR2 Q;  5C4J H;  1EUJ A;  1I50 B;  1Z6H A;  1ASY A;  5JJK A;  1UWV A;  4PMC A;  1R9T H;  3CHB D;  1AW7 A;  4DV1 L;  3UDI A;  5FLM H;  3MXP A;  3OW7 A;  1Y1W B;  4A3F B;  3D3R A;  1GOZ A;  5JJZ A;  1WTV A;  1JWS D;  5C3E B;  1Q90 A;  4A75 A;  4HCE A;  4LF6 Q;  2VY3 A;  1FJG L;  3CMA A;  4X3S A;  3GV6 A;  4KKU A;  1EYC A;  2OEO A;  2E75 C;  4ZKC B;  2K5N A;  2KHI A;  2KUM A;  1PZI D;  2CCZ A;  1ZEQ X;  5M5Y H;  3H94 A;  2E2H B;  1NY4 A;  3KJP A;  1IW7 C;  1HHV A;  3TS0 A;  4B08 A;  3PIO 3;  5JEA G;  2KHJ A;  2L15 A;  2KEE A;  5I2X A;  1CKM A;  2EIF A;  4YCW A;  1EY7 A;  3MXU A;  1X6O A;  2B3G A;  3D6C A;  1VS0 A;  1H9R A;  5C5M A;  3HG9 A;  4H44 C;  2Q2H A;  4JI0 L;  2EXD A;  3A0J A;  3L0O A;  4AQY L;  4HID A;  2B8G A;  5IGB A;  5EPK A;  3SVM A;  4RG1 A;  3MXN B;  4CJ0 B;  1A3U A;  3RR5 A;  4A3B B;  4P72 A;  3N6R A;  4L5S A;  1K8O A;  4X3K A;  4BBR G;  5C5L A;  5I2Y A;  1CI3 M;  4A4I A;  1JR0 D;  2E8G A;  1YIT A;  2UUA Q;  1TR5 A;  2E5L Q;  2JA8 B;  3T1H L;  1XXG A;  3DHQ A;  3H0G B;  1UE5 A;  4IO9 A;  2QEX A;  1WD1 A;  2PI2 E;  4A3G B;  4X6A H;  1DOM A;  2ZXR A;  1XNQ Q;  3VR5 A;  2JA9 A;  1CA6 A;  5GQO A;  2E2J B;  3H3V H;  4LFB Q;  1EWH A;  4ZK9 B;  4FXG C;  1VQN A;  2SNS A;  1F9R A;  5JEA H;  3A8K E;  5JJI A;  5EBD A;  4KY7 A;  5CGK A;  1EU3 A;  5NUC A;  2OTL A;  5D65 A;  4ZAI A;  4BY1 G;  3A8I E;  4A3M B;  5C0X I;  4DV1 Q;  1EU4 A;  1PRT F;  1F2M A;  3P7J A;  3S2D B;  1FR3 A;  4DR7 L;  1VQ7 A;  4B3M L;  1MJC A;  4A3M H;  4JI7 Q;  5IT9 L;  1GHK A;  3W2D A;  5IP9 H;  2OQK A;  4A93 G;  3DEP A;  1W6K A;  2WAQ G;  1EY4 A;  3GTK B;  4DNI A;  3HP3 A;  2KVM A;  1LAB A;  3GTJ H;  1WTX A;  1QNU A;  1Y1W G;  1MHW C;  2MPM A;  1Q82 C;  1PZJ D;  1TWA H;  2YU9 H;  1I4H A;  1F2Z A;  2CH4 A;  2UUA L;  2F0J A;  1X3P A;  4JI8 L;  1HFG A;  2BCO A;  3GTM B;  2PCF B;  1PTO B;  2R7Z H;  4ILW A;  1SR3 A;  3K58 A;  1I6V C;  2E76 C;  1WCM G;  3CXC A;  2HQL A;  2NVT H;  1Q1E A;  2P5Z X;  1Y69 U;  5EKL A;  2LKV A;  3HKZ E;  3HOU G;  1QZH A;  3M7G A;  3KLR A;  1CKN B;  1IBK Q;  1VQL A;  1RDP D;  3WWV A;  3OIQ A;  2YTX A;  1PLF A;  1PRT C;  1NCV A;  1XMO Q;  4A3E B;  3HFZ B;  3GDE A;  2UXB L;  4GN4 B;  2Q2I A;  4HMI A;  4DV2 Q;  1B4O A;  1L0Y B;  1B3Q A;  1J5E L;  3A5Z B;  4JI1 Q;  4DV7 L;  4C3J H;  4MTK A;  3I3C A;  3KJO A;  1BCP F;  2F0U A;  2K28 A;  1WTP A;  4R9W A;  2WAQ B;  3T1H Q;  1JMC A;  4TKO B;  4DAV A;  4DUY Q;  4K5V A;  2IJ0 A;  1ROD A;  1TS4 A;  3MTS A;  4EVO A;  3ULP A;  3FKI G;  1PRT D;  2PZU A;  5BR8 Q;  5M5Y B;  5EKK A;  1HR0 Q;  5KNB A;  4A3J H;  3QOL A;  1VQH A;  4IPG A;  2XVS A;  2F0H A;  3S15 B;  2B63 G;  3D6W A;  2RDH A;  1VQF A;  2RSO A;  4J6H A;  1BUV T;  4DR4 Q;  1HTL D;  1YNJ C;  1N32 L;  1QWY A;  5FO7 B;  4AYB B;  2NBF A;  4L8J A;  4QIW E;  4FXK C;  3C2P A;  5CV9 A;  3VDY A;  1YZ6 A;  1VQE A;  2LXJ A;  1A3V A;  4HIM A;  2VQF L;  4LF9 Q;  4NXN L;  4KHP Q;  4CJ1 B;  1I50 H;  3NTH A;  1XJV A;  1SYG A;  3V05 A;  4U67 3;  1K73 C;  3S16 B;  3SE0 A;  3VYS A;  2KCC A;  4FDB A;  2K75 A;  4I7A A;  4S3S A;  2NB0 A;  4RMF A;  2KEC A;  4OIJ A;  3DEO A;  1ZYR C;  4A3C G;  4ZLT F;  1G6P A;  4MNO A;  1UUP A;  5I9O A;  5FJ8 G;  5CV4 A;  4IUV A;  5DM6 3;  4DV3 Q;  1R4Q B;  4Y7N H;  2JA7 G;  2VW9 A;  4X64 Q;  1E2Z A;  5K5P A;  3A8J E;  2BA1 A;  3D4R A;  3NE5 B;  2JE6 I;  4UDU C;  1VDZ A;  4HJ9 A;  1TY2 A;  5ELE A;  5CV6 A;  1TWA B;  3EFX D;  3HZX A;  1S72 A;  3CC2 A;  2R92 H;  5I9P A;  2QCP X;  2E2I H;  4HSV A;  1CKO A;  1HUM A;  3NEN A;  1YI2 A;  5FO9 B;  1EIY B;  3HOY H;  1O7L A;  2F0W A;  2K33 A;  3KYH C;  5F2D A;  3HRZ C;  2R93 H;  1N8R C;  4ODG A;  3PUV A;  5T1G A;  4A3J G;  3S2D H;  4XQQ A;  2B39 A;  1YHQ A;  2RF4 A;  1MGS A;  3D31 A;  4P75 A;  2VQF Q;  4LF9 L;  1H9K A;  3J81 E;  1EY5 A;  3PUX A;  1SE4 A;  4GN3 B;  2NVY H;  5KEE A;  4GNX B;  4A3D H;  4OO1 G;  1JT8 A;  3HKS A;  3CCQ A;  4LF6 L;  3J81 i;  5M5X H;  3S1R B;  1FYC A;  4RGT A;  2WKC A;  2FIN B;  2MO1 A;  1B9M A;  3PF5 A;  5JPM C;  5TSS A;  4N8F A;  2I46 A;  1V9P A;  4RA8 A;  4DR1 Q;  4A3G H;  4NKL A;  1FVI A;  3H0G H;  2JA6 H;  4X3T A;  4B3S L;  4U68 A;  2EVB A;  3CCE A;  4BY7 H;  1FNW A;  4L6T B;  1EZ6 A;  3V96 A;  2K1B A;  3G6E A;  3BYT B;  2WFW A;  1D5M C;  4IN3 A;  2B2T C;  2RA4 A;  3NXW A;  4YCU A;  2E2D C;  3MVV A;  4A3M G;  2Y0S E;  3K59 A;  4JI2 L;  4BY1 B;  1YNX A;  2UXC Q;  2GVA A;  2ICE C;  5FJ8 H;  4DK1 A;  4G7Z C;  2OWO A;  3F1Z A;  1TWF B;  4KY6 A;  4ZRZ A;  3QJY A;  3UDX A;  5M3F B;  2JA8 G;  1UE7 A;  1SBB B;  4DNR B;  4ZQ3 A;  3PO3 G;  5E7N A;  4LF5 L;  4OON A;  4XXE A;  2XN9 C;  3PIO A;  4BXX G;  4PNY A;  3VR6 A;  3BZC A;  4ME3 A;  2RDG A;  5IGC A;  3U4Z A;  4G4K A;  4IUR A;  2TSS A;  5G3L D;  3I90 A;  5COR A;  4ALP A;  2Q8T A;  2D5D A;  1D6E C;  4LW1 A;  3B6Y A;  1EYD A;  2E5L L;  3M3Y H;  3M4O B;  4DR3 L;  1Y8O B;  4X64 L;  2VNU D;  3BJU A;  4DK3 C;  2JA5 B;  4GLA C;  1JB3 A;  2RCF A;  5C4X G;  1VF7 A;  4PQX A;  5KYL A;  4PZ8 A;  2E2H H;  1L1O C;  3J7A 5;  1U5K A;  3C46 A;  2VUM B;  3M4P A;  2IX3 A;  2Z6K A;  4A3B G;  2K5W A;  1C9O A;  2MUY A;  2D2C C;  4WJ4 A;  4CDE C;  1GJX A;  2PMZ E;  3CQZ H;  1I4R A;  3U9S A;  2RDF A;  2F0D A;  4DR1 L;  2CKZ B;  4C2M B;  2SNM A;  3JAM c;  2B2Y A;  2CWA A;  4DUZ L;  1I3Q B;  4G7O C;  4HCS A;  4CGY B;  1H9S B;  4UP9 A;  3JAM L;  1VQJ A;  3FRP B;  5ELO A;  1BKB A;  3NQI A;  3W1B A;  2WKD A;  3IFT A;  2XIW A;  3K57 A;  4FO2 A;  5IE8 A;  1LO5 D;  3L7Z C;  3V2T A;  4B3M Q;  1U0L A;  3F2D A;  2UUC L;  1TY0 A;  1CTM A;  1G91 A;  1ET6 A;  1YBY A;  3WOE A;  2QKI C;  4K5W A;  2EJM A;  4GOP A;  3S1M B;  1ENA A;  1VQB A;  2NN6 H;  4R4T A;  5C4X H;  2K05 A;  4A3F G;  4P74 A;  3CC4 A;  3KDF B;  1XPR A;  1DXM A;  1JC7 A;  3S1Q B;  3NWS A;  2EOT A;  2DN8 A;  1STN A;  4L5Q A;  1I4Q A;  2KCT A;  4JOI A;  4BA2 I;  3KFU A;  3I4O A;  1K83 H;  5AFW A;  1V1Q A;  2NZH A;  4K2L A;  1D1K A;  1XPO A;  2FXQ A;  1SJE D;  2DY8 A;  2H5X A;  4L5R C;  1WTR A;  2K50 A;  1O78 A;  2VB3 X;  2GA4 B;  1JCK B;  5E3F A;  4DNT B;  3ERQ A;  1MSG A;  5IP7 H;  2B2U C;  1RJT A;  5JOB A;  2L12 A;  3HEJ A;  1AFP A;  1S5B D;  1TS2 A;  4JI2 Q;  1IL8 A;  2KBN A;  1X55 A;  1JB7 A;  4K5X A;  4OEL B;  4ULL A;  2L55 A;  4KN7 C;  3EA6 A;  5L37 A;  4POF A;  1FNU A;  2I07 B;  1XMO L;  2JYO A;  4RCO A;  4DU9 A;  2MFI A;  3HOV B;  1BBU A;  4YCV A;  4X65 Q;  3IAY A;  2Z1C A;  3W3A A;  2F0S A;  3RZD H;  4V0B A;  4DXG A;  2PW7 A;  4JPB W;  4CBV A;  1VF5 C;  2NZ1 D;  1BBW A;  4Q5V A;  1PA6 A;  2B2W A;  3ICE A;  3TDQ A;  4LFA L;  1XNR L;  5C44 B;  3RN5 A;  4JBM A;  1HR0 L;  5JVH 3;  4A93 B;  5FLM G;  2UU9 L;  1HNW Q;  4DV5 Q;  2XTI A;  1RL2 A;  1Y1V H;  2CW0 C;  3DXJ C;  3S14 H;  2K14 A;  3GTO H;  1TS5 A;  3PO2 G;  4WFN 3;  3A56 A;  1CZW A;  4R4O A;  2ZT9 C;  1BCP B;  4X3U A;  3H3V I;  1HTP A;  1NR4 A;  2EDG A;  2Q8R E;  3TN2 A;  1J8I A;  3H3V C;  2CWP A;  1SRO A;  1A15 A;  1A8V A;  1QCB D;  2DUD A;  2A69 C;  3T51 B;  3CME A;  2VS1 A;  3PIP 3;  1KNE A;  1XMQ L;  2ATW A;  1A6X A;  4P2C B;  2EYP A;  2F0G A;  3X3M A;  2JQO A;  3OWF A;  1HZA A;  2M00 A;  3K5N A;  2K5D A;  4JCV E;  1ZKO A;  1HH2 P;  2LS0 1;  1AEX A;  3W1G A;  2A6E D;  5CV5 A;  1I4X A;  4IUP A;  3BU2 A;  3I4N G;  5IYC G;  1LT5 D;  2AQ3 B;  4IUN A;  4HJA A;  2VQE Q;  2PO4 A;  1DYQ A;  3VYU A;  1KD1 C;  3K80 C;  2QDB A;  4ZYS A;  3O13 A;  1VQA A;  2CQA A;  2GN5 A;  2LY7 A;  4LAA A;  1SYF A;  5IWA L;  5G3L F;  1NSN S;  2Z4I A;  4LFA Q;  4FF2 A;  4O1N A;  1X56 A;  2C9O A;  2UU9 Q;  3C1F A;  2UXD L;  1Q81 C;  4QIW B;  2EQS A;  2JXM B;  2EE1 A;  1Q8K A;  4I7Z C;  5I4D A;  3TP6 A;  1SJH D;  3H6M A;  4YWL A;  3EQL C;  1RKN A;  3E3X A;  4DR7 Q;  4ABN A;  4Y52 H;  1EL0 A;  4BBR H;  1I94 Q;  3PMF A;  4MTN A;  5C3W A;  2PQA B;  3I4M H;  1EY6 A;  4PG3 A;  5HGT A;  2SOB A;  1TU2 B;  1STB A;  4H13 C;  3KLS X;  1IBM Q;  2H4O A;  4I65 A;  2KOL A;  3GD7 A;  4BWG B;  2NN6 G;  3RZO H;  2A68 D;  1YHA A;  4QF4 A;  4DV6 L;  1EIF A;  3U9O A;  1TT2 A;  5EQ0 A;  5EPJ A;  2N88 A;  5JVG 3;  2N55 A;  2X6G A;  1HNX Q;  3QO2 A;  2O5I C;  4KD3 A;  3SK6 A;  3F8T A;  1IKL A;  3OWE B;  3FHW A;  4PMB A;  1E2W A;  3GV3 A;  2WAC A;  2HHH L;  2RHS B;  1U4P A;  4E6I A;  2OT2 A;  1I4P A;  2I0Q A;  1C4Q A;  3URY A;  2R61 A;  4DPG A;  1IBK L;  1SND A;  1VQK A;  2K04 A;  5IOC A;  2D9U A;  2PNH A;  3CCR A;  5COY A;  3NEL A;  5CV8 A;  4KJN A;  1Q46 A;  3QR8 A;  1HPC A;  3K0Y A;  2G9H D;  5M5W B;  1N34 Q;  4IFD I;  3IL8 A;  4M1U B;  3TP8 A;  5IY0 A;  2YTY A;  2D0O A;  3PO2 B;  5LMN Q;  4POG A;  1HNZ Q;  5D3D A;  1TXY A;  4TQU S;  3AQQ A;  2B29 A;  4RGN A;  1CSQ A;  2BA0 A;  3CAM A;  5C44 G;  4DA2 A;  1SNQ A;  2JP1 A;  1AP0 A;  1MBY A;  1TVX A;  2N8N A;  2RVL A;  1BOS A;  1SAP A;  3F2U A;  4AYB E;  4UP7 A;  4YWK A;  2VXW A;  1O7Y A;  5IGG A;  1B2T A;  1K8G A;  3MXG A;  3BZD B;  4DV6 Q;  1U4R A;  1NE3 A;  5C6A A;  3K7U C;  4NXM L;  1CZG A;  3HOU H;  2XSC A;  1ICF B;  2MO0 A;  4QCL A;  1E2V A;  2Z0S A;  1PH7 A;  1H9J A;  5JJL A;  3K7A H;  3J80 E;  4KV6 A;  1Q1B A;  2PMZ B;  4JBJ A;  1VQI A;  2R3Z A;  3I8Z A;  5GRO A;  1K0S A;  4XT3 B;  2ZM6 L;  5IGE A;  4FF3 A;  4A3I G;  1ENC A;  3GTL H;  2NVQ B;  4APV A;  1PHJ A;  4DKA C;  2PQA A;  3QIA A;  1VQM A;  4JBK A;  3DM3 A;  4K0K L;  4V19 0;  1STA A;  3MC0 B;  5EKI A;  4IZ8 A;  4ZCK A;  5D3I B;  1ESF A;  4LJZ C;  1YNN D;  3LWU A;  1BXT A;  3BVG A;  2EYL A;  4KI0 A;  4DV3 L;  2Z8L A;  1RCV D;  3MFG A;  1WJJ A;  4GLX A;  3ULL A;  4A3K B;  4DAY A;  4B9X A;  5A2Q L;  1DOL A;  1TWC B;  4BY1 H;  1P16 A;  4DFA A;  4QQB X;  1BVS A;  3HOX B;  1OTC A;  1SMX A;  4GNX A;  3NK9 A;  1TQO A;  1RIP A;  1KTK A;  2JA6 B;  3MWY W;  4MN3 A;  5IOD A;  2JK8 A;  1N36 Q;  5I6Y A;  1G8Z D;  5EAY A;  4A93 H;  4DR6 Q;  2B2T A;  1N9W A;  5EBC A;  4PV1 C;  3EBE A;  3HOZ H;  1AZQ A;  2TMP A;  3FDT A;  2PYK A;  1N34 L;  4BBS H;  4X65 L;  1G2S A;  4OWW B;  4LUO A;  4A3D B;  1EYA A;  3BZK A;  4RFB A;  3T53 B;  3S9W A;  1IL2 A;  2NVY B;  1DGS A;  3RZD B;  3RLF A;  4DAY B;  1LTI D;  1MJE A;  3R93 A;  2K7V A;  4LF7 L;  3OMG A;  4DK6 C;  4DV0 L;  1UE6 A;  3FMC A;  4J15 A;  2VUM G;  3TP5 A;  3J7Z C;  3PGZ A;  2QW7 A;  1W6J A;  4QMG A;  3IRB A;  1CQV A;  1RD9 D;  3J7Y W;  2RHQ B;  1IBL L;  3CPW A;  2F3W A;  4DV4 Q;  1S5C D;  1F9P A;  3I4N B;  1VMP A;  2HD3 A;  4O0A A;  4NB3 A;  3Q0A A;  2MHV A;  3LWE A;  3OTO Q;  4C1N I;  5I6W A;  2Z6B A;  1WTO A;  5GAE C;  4HTH A;  3D4W A;  1QVC A;  5IGD A;  2ES2 A;  3A5U A;  3EJI A;  1G6Z A;  1SFO B;  1N36 L;  4Y7N B;  2B8F A;  3NP8 A;  2ICI A;  1SYB A;  2R7Z G;  5C0X G;  3D0F A;  4JBW A;  3QG1 A;  3NWT A;  1QOH A;  2QA4 A;  1D8L A;  4KLK A;  2R93 G;  1FNV A;  2R7D A;  1JOQ A;  3FKI B;  3ND8 A;  2UXB Q;  1IYJ B;  4DV2 L;  2VQE L;  4TVA B;  4O2D A;  3RLO A;  1K9M C;  3AMU A;  2YYZ A;  4GOP B;  5CYU A;  1IKM A;  2XRQ D;  4RHS A;  2L5T A;  1SYD A;  1QVG A;  3P1H A;  1GUO A;  3KDF A;  5LL6 S;  1VQG A;  3H91 A;  3ERS X;  4A3J B;  2OF1 A;  4R4C A;  1LTA D;  1VQ9 A;  2JA6 G;  4UP8 A;  1DJR D;  4IFD G;  4HN7 A;  3CKI B;  3FEW X;  3RMH A;  1FD7 D;  2QGQ A;  2BDO A;  4QB4 A;  3A7L A;  2A69 D;  3T4A C;  1SMY D;  4GKK Q;  1LM0 A;  3SK4 A;  2JA5 H;  4XQJ A;  2L1B A;  2ALY B;  4XT1 B;  1YNJ D;  1E24 A;  3I56 A;  3S17 H;  1IW7 D;  5T1I A;  2F0M A;  1K3B C;  2F0L A;  2Z9H A;  4NXN Q;  4KHP L;  4JI0 Q;  3FKI H;  1QZG A;  4BBS B;  2CW0 D;  1W3S A;  2G9D A;  4IQZ A;  5IYB H;  1CKN A;  5ELD A;  4DK0 A;  1A2T A;  5IP9 G;  4UPA A;  3E9H A;  4H0L C;  2RCN A;  1TWF H;  1UEA B;  5E4W C;  2B2W C;  3KOJ A;  1EQT A;  3GQB A;  1EIH A;  2LXK A;  1J9O A;  3PF4 A;  1VQ6 A;  1PH3 A;  4OX9 L;  1YIJ A;  1GHJ A;  3OSO A;  2EY6 A;  3CCM A;  2J7Z A;  3CP0 A;  1EY9 A;  1XTC D;  1L2F A;  3NEM A;  4HSP A;  3NTI A;  3I4N H;  1SYC A;  2N3S A;  3JAM i;  4IPD A;  1HCZ A;  1IHZ A;  3BG3 A;  1GKH A;  4HJ5 A;  3TRE A;  1KAW A;  4LFC L;  3CRL C;  3BDC A;  4AH6 A;  1PYB A;  3GTK H;  4IUT A;  2AUK A;  1B3A A;  3S17 B;  2B63 B;  1ZXT A;  4XDX A;  1U9R A;  3GTL B;  2L11 A;  3CW2 C;  1KDA A;  3TZU A;  4C1N K;  5DLQ E;  4N8X 1;  3RLN A;  4PZ7 A;  1GUG A;  1STG A;  5LMU Q;  1B9N A;  2KCN A;  2OCE A;  2R93 B;  1JE5 A;  1V1P B;  2RSN A;  4YHH Q;  5C0X J;  2EYJ A;  1HQR D;  5D14 A;  2IW3 A;  4KJO A;  2F03 A;  5GAH C;  1F9S A;  2PZT A;  4B3R L;  1UE1 A;  2F0N A;  5ISR A;  1EWI A;  2NUC A;  4KMU C;  2AKW B;  3Q6S A;  2HDL A;  1HJP A;  1BCP D;  3QB3 A;  3MZ5 A;  2B2V C;  3E0J A;  5EGT A;  4F8M A;  1PFB A;  5IP7 G;  5C4H A;  3J80 i;  4RWS C;  3MA2 B;  1VQ8 A;  5HY6 A;  5KYI A;  1LTR D;  4DGZ A;  1HXY D;  4GKJ Q;  4WRD A;  1HUN A;  4KD4 A;  2JA8 H;  3VYR A;  5IT9 E;  1PZK D;  4B9W A;  4NMZ A;  4LF4 Q;  3PO2 H;  1LTS D;  2F4I A;  1C48 A;  1X32 A;  1BCP C;  4BXX H;  4RH6 A;  5JAV A;  1WI5 A;  2BDN A;  4UAI A;  3EVQ A;  2FFK B;  1LYL A;  3NTK A;  3G6J B;  1E22 A;  2EYO A;  3Q24 A;  3OHX C;  1E1O A;  3S16 H;  3HS0 C;  3PUZ A;  4UY8 C;  1HFN A;  1BF4 A;  2HUG A;  2NWG A;  2Z6K C;  2R7F A;  4PZ6 A;  1G51 A;  1B8A A;  2NVQ H;  1XWE A;  2AWN A;  2KEN A;  1KQS A;  2AQ1 B;  1M1K C;  4IOC A;  1EQV A;  4C3H G;  1KAB A;  4DR3 Q;  3E6Z X;  2WII B;  4RGM A;  5K36 G;  4YHH L;  1J6Q A;  1XYI A;  2B2Y C;  1K3R A;  4A3K G;  3C3L A;  5ELB A;  1DOK A;  1LUZ A;  2M2L A;  5IWA Q;  3W5O A;  2F0K A;  4JV5 Q;  1EQQ A;  1IYU A;  3KK7 A;  1S4Z A;  1SNC A;  1BNZ A;  1SNO A;  1II3 A;  1EIG A;  5C44 H;  3X3N A;  3RN2 A;  4EQP A;  1SDF A;  3KBX A;  3STB D;  5BN5 A;  3J81 j;  4LUZ A;  3OMC A;  3HOY G;  5ELC A;  2QIL A;  4LWC A;  4IFD H;  3M4Y A;  4DXF A;  3K5L A;  4A3F H;  1Y1W H;  1DM0 B;  3IFD A;  5J22 A;  4C3J B;  3VA5 A;  1QG7 A;  3M7N A;  1M8A A;  1EYG A;  3K6O A;  4L5T A;  1SSO A;  1B53 A;  2OQ0 A;  5CR3 A;  2J4X A;  3HOZ B;  3MEF A;  4EX5 A;  5C4J B;  1SEB D;  4EQO A;  5M9O A;  2K5Q A;  4HIK A;  5C4Z A;  3L3O C;  2RKS A;  1LV9 A;  4IJH A;  3C1E A;  3AU7 A;  3M9B A;  3Q8D A;  2GVB A;  4DAP A;  3I4M G;  5A2Q E;  2WAQ E;  1CHQ D;  4C3I H;  1PH9 A;  1GUW A;  2F1M A;  3HOX H;  1H9S A;  4XYQ A;  3R3O A;  2C35 B;  1UNS A;  4Z9C B;  2ENB A;  4QJF A;  1EQR A;  2UUB L;  2E74 C;  1HNX L;  2HDM A;  1OO9 B;  4J1M A;  4YIJ A;  1CK1 A;  5EJW A;  3AFQ A;  1XNQ L;  4JI3 Q;  4QY7 A;  4LF8 Q;  4IUQ A;  1F2Y A;  3L9A X;  2YU9 B;  4LF4 L;  1LT3 D;  5IYB G;  1U4L A;  4HMJ A;  2XWJ B;  3RZO B;  1WYD A;  2K03 A;  5IYD H;  1YHB A;  1GUT A;  2PI2 A;  3H09 A;  3TZD A;  1HNZ L;  3GTQ B;  1BO0 A;  5KGU A;  3I4M B;  5C3X A;  2B2V A;  2EXZ A;  3KBG A;  1STH A;  2K5H A;  3F2B A;  1D2B A;  5DM7 3;  4OO1 I;  4P71 A;  1VQP A;  1NAP A;  2A8V A;  3GTP B;  3N52 A;  2JJQ A;  2Q2U A;  3VR4 A;  3S14 B;  2E2J H;  1Y1V B;  2IPK D;  1S5D D;  1PYS B;  2HIV A;  1W2B A;  3MFY A;  2MNA A;  2JSO A;  4KHZ A;  1BBX C;  4LFB L;  2F0I A;  3GP7 A;  2IT1 A;  3KUP A;  4B3S Q;  3UDG A;  1YVC A;  2V1C C;  2FMM A;  4FP5 D;  4WJ3 M;  3CPF A;  1Z47 A;  4QL5 A;  2BH2 A;  1ASZ A;  3T16 A;  1QNK A;  3F2C A;  2IX1 A;  4A3L H;  2F0O A;  3A7A B;  4HR7 B;  4K6D A;  4ID6 A;  2B63 H;  3PQI A;  2PQE A;  3AFP A;  5M5W H;  3HOV H;  2K52 A;  2HCI A;  3U4V A;  3L2P A;  3I73 A;  1PH4 A;  5CC4 A;  3CC7 A;  1H9M A;  1Y1V G;  1J5E Q;  4ZUJ A;  1EY8 A;  1BQQ T;  1PH5 A;  1VQC A;  1CA5 A;  2X69 A;  1Y8N B;  1EFI D;  4CHT B;  1WTH A;  2PPB C;  3TRZ A;  3I2Z A;  4GNX C;  3SK8 A;  3J80 L;  2K4K A;  1HR0 W;  1QJO A;  4C3I B;  5CBE E;  3E0E A;  1D5Z C;  1PRT B;  2H1E A;  5EPL A;  2IL8 A;  4HED A;  3GTO B;  2RQX A;  1WTW A;  1K28 A;  4A3L G;  4LF8 L;  5J39 A;  1A0I A;  3SK5 A;  1O80 A;  2RBM A;  1K0R A;  2L9H A;  3CCS A;  2WB1 B;  4EGV A;  4LFC Q;  5FK9 C;  1QVF A;  2M9V A;  4O42 A;  1KIX A;  4DUZ Q;  2CVR A;  1X65 A;  4DR2 L;  1SE3 A;  3UE1 A;  5C4X B;  2Y0S G;  4F87 A;  2ZJR A;  3HGB A;  1TII D;  3K5M A;  3PUY A;  4JI1 L;  4X62 L;  4DV7 Q;  4OWX B;  1JOR A;  1CQF A;  1G29 1;  1XPU A;  1LTL A;  4P73 A;  2F0P A;  2UUC Q;  2KHS A;  2A5H A;  3G71 A;  1JOO A;  2DGY A;  4A3G G;  1NJI C;  5GAD C;  3H0G G;  2YTV A;  1KHI A;  4KKS A;  1EEI D;  1IBL Q;  2WV6 D;  3BYY B;  1YNN C;  2G5D A;  2ID0 A;  1WFQ A;  2ZTC A;  3HOY B;  1KDB A;  1S5E D;  3MXN A;  4A76 A;  2F4V L;  1NBW A;  2DJF C;  1MD2 D;  1V43 A;  2AWO A;  1T5E A;  3GTG H;  1HZB A;  1NTG A;  1B7Y B;  2VUM H;  4CJ2 C;  1JQY D;  4OO1 H;  1F2L A;  3S2H H;  1SN8 A;  3PO3 H;  2PZW A;  4GKJ L;  2BH8 A;  1S3O A;  2EYF A;  2N49 A;  4OL7 A;  1N32 Q;  1PYW D;  2BE5 D;  4C3I G;  1DCZ A;  1OXS C;  1R4P B;  4C56 C;  1ICW A;  4IPC A;  1OXX K;  4AQY Q;  1EFW A;  4JYA L;  4YY3 Q;  5HGQ A;  5DAU A;  5ELF A;  1WOC A;  1E3P A;  4JC0 A;  1IYV A;  1VQD A;  1LLR D;  1KRS A;  1JJG A;  1NUC A;  4NPS A;  1TWG B;  3TSS A;  3S1M H;  4X66 Q;  2DJG C;  5IYD G;  1X3G A;  3EN2 A;  1ILQ A;  1GUS A;  1E7Z A;  4KY5 A;  1C0A A;  1FGU A;  2NVX B;  1ESR A;  2VL6 A;  4G7H C;  1GVP A;  3KLS A;  1EWC A;  1A62 A;  1TS3 A;  4NP5 A;  3SHL A;  3CF5 A;  2WIN B;  5IT9 c;  3ERO A;  1KC8 C;  4HJ8 A;  1B50 A;  3S15 H;  1Q3L A;  4JI6 Q;  1HZ9 A;  3CQZ B;  1QUQ A;  3S1R H;  1PDQ A;  2K5V A;  5BN4 A;  1UEB A;  3HKZ B;  5JPN C;  1CM9 A;  2AMC B;  4X62 Q;  1CSP A;  1V1O A;  1E0B A;  1OXU A;  3M3Y B;  2WB1 E;  3BVZ A;  4JYA Q;  5KNC A;  4CKB A;  4AYB G;  3NHH A;  4RGO S;  4G57 A;  4HJ7 A;  4LMQ D;  2A68 C;  4A3E H;  1DON A;  1SRU A;  3BS1 A;  2ZXP A;  4KKT A;  5KIX A;  1SNM A;  1SXT A;  2O5J C;  1JE4 A;  1HNW L;  3M4Q A;  4XQN A;  4RKL A;  4OX9 Q;  2FHT A;  5J3B A;  2A6H C;  4ME5 A;  3P75 A;  4AIM A;  2R92 G;  4BA1 I;  1ILP A;  1TWC H;  4QGU A;  4H7B A;  3CCJ A;  2JA5 G;  1PTO H;  4JI3 L;  3OYY A;  2UXD Q;  4CKE A;  4R4Q A;  4DN4 M;  1AE2 A;  4FF4 A;  2ZTE A;  4OWT B;  3SR1 A;  5BN3 A;  1C8C A;  3S1N H;  2ZXO A;  3S1Q H;  4LK1 C;  1FGB D;  2I5M X;  3NBI A;  3VR3 A;  4DR6 L;  5M5X B;  3RNU A;  4DF7 A;  5DNF A;  1PXU A;  1U4M A;  2X6L A;  1KXL A;  2O4X A;  4DR5 L;  4JI4 L;  5FLX L;  1LT6 D;  3Q23 A;  4X66 L;  1I94 L;  3H15 A;  3HOZ G;  2VB2 X;  3DLL A;  1PV4 A;  2JEA I;  2K32 A;  5AJ3 L;  3GO5 A;  4CDF C;  1JWU D;  3K7A B;  4TSS A;  5LMU L;  3LGJ A;  1LAC A;  4C2M H;  5A35 A;  2F0T A;  5M3F G;  3HOU B;  1HA6 A;  3FP9 A;  2EY5 A;  1FJG Q;  1SLJ A;  2EY2 A;  4IOA A;  4K6L A;  4C3J G;  1PTO D;  5IGF A;  4FVM A;  3OOC A;  4WJW A;  3CU7 A;  1KDC A;  2ZJP A;  3HOW B;  2MP1 A;  3SGI A;  3M4O H;  2MJ8 A;  1SE8 A;  2I5L X;  2KA7 A;  1F77 A;  3STB C;  1DZ1 A;  2O2L D;  3K5O A;  1WVL A;  5E4X A;  2JN4 A;  3TQY A;  4A3B H;  1Q12 A;  1H95 A;  5FKA C;  5M3F H;  1HA5 A;  3I55 A;  3QOJ A;  1A63 A;  3PCO B;  5E1F A;  1SFO H;  5LMN L;  3HOW G;  2CHB D;  2ASB A;  3DUZ A;  4R8I A;  2NVT B;  2F0V A;  3RD4 A;  5AJ3 Q;  1E1T A;  3A55 A;  4IFD J;  4BS9 A;  1KNA A;  4BY7 B;  3TBI B;  4M8A A;  3T1Y Q;  2EJG C;  2F3I A;  3J7A V;  3GTM H;  1CHP D;  3PSI A;  1LTT D;  4YWM A;  4R1J A;  1IZ6 A;  1M4V A;  5JEA J;  4F88 A;  5IYC H;  3UI2 A;  1STE A;  4DV5 L;  4MIU A;  4Q0F A;  4CKC A;  1PFM A;  1PMR A;  3J80 c;  3CD6 A;  2IHE A;  1V8Q A;  1STY A;  1Q7Y C;  1CT1 D;  1CUK A;  4JV5 L;  3NPP A;  3ITP A;  1PH1 A;  1A2U A;  2EY1 A;  4EQN A;  2XGT A;  2EZV A;  1GM5 A;  1B70 B;  2SDF A;  1L0X B;  3ULJ A;  5FLX c;  2IY5 B;  3AYH B;  2N78 A;  2B2U A;  1JJ2 A;  2JA7 B;  1LTB D;  3BVM A;  2BE5 C;  1B44 D;  4KN4 C;  2ZM6 Q;  1PH8 A;  4JI7 L;  1HRJ A;  1C7Y A;  2EJF C;  4BBR B;  1PTO F;  4K0K Q;  3TME A;  1K8A C;  3I7F A;  5K36 H;  1D7Q A;  1WTQ A;  1V1P A;  2A1A A;  2KED A;  2OXP A;  1EOT A;  4A3D G;  5KRU A;  1S5F D;  3G7L A;  2NZO A;  1WCM H;  1T9H A;  2E2I B;  3S1N B;  1GD7 A;  2R92 B;  1G2T A;  3A54 A;  1SYE A;  3PUW A;  4NXM Q;  3DWQ A;  2A74 C;  2UUB Q;  1HZC A;  2QF7 A;  3T1Y L;  3HOV G;  4HAE A;  3T13 A;  3U58 A;  3UE0 A;  4A3K H;  2UXC L;  3JAM E;  1D5X C;  1MKH A;  3VYT A;  1GXD C;  1MSH A;  1XMQ Q;  4IJL A;  3EIV A;  2NYZ D;  5LL6 X;  3R2T A;  4PMW A;  3I91 A;  1I5F A;  1VQO A;  4LNQ A;  2IX0 A;  3D4D A;  1OXT A;  4N9T A;  3DM1 A;  5C3E G;  5C0X H;  2KQ3 A;  1L1O A;  2F0E A;  1L0W A;  2MQH A;  2R6G A;  4XIG S;  5H1S E;  4JI5 L;  3HKZ G;  5GAG C;  3SEB A;  1YJW A;  3R8B A;  4DUY L;  4LF7 Q;  5ELN A;  4FYD A;  4MZ9 A;  2IHF A;  2A6H D;  2JA7 H;  4JW0 A;  1EOV A;  3KF6 B;  5BR8 L;  3PV0 A;  3SXH A;  1LTG D;  4MHE A;  1A3T A;  4A3C H;  3OIP A;  3MHB A;  4B3R Q;  4UHV A;  1F9Q A;  5CV7 A;  3I70 A;  5CMD A; 
#chains in the Genus database with same CATH homology
 4LFB L;  2Z0S A;  2B63 G;  4OXP A;  1PH7 A;  5JJL A;  3K7A H;  1VQF A;  3OW2 A;  5C3E H;  2IT1 A;  4B3S Q;  4B3T Q;  4DR4 Q;  1Q1B A;  1XTD A;  1YVC A;  2V1C C;  3UDG A;  2HHH Q;  4WJ3 M;  4JBJ A;  1I6H H;  1VQI A;  3CPF A;  5GRO A;  1Z47 A;  4QL5 A;  2BH2 A;  1N32 L;  1ASZ A;  2ZM6 L;  4DR4 L;  4QIW E;  4A3I G;  3VDY A;  3GTL H;  1YZ6 A;  3F2C A;  1VQE A;  2LXJ A;  4HIM A;  2VQF L;  4APV A;  1PHJ A;  4LF9 Q;  4DKA C;  2IX1 A;  4A3L H;  2PQA A;  1VQM A;  4JBK A;  4NXN L;  3DM3 A;  1S40 A;  1N33 Q;  4KHP Q;  4K0K L;  1I50 H;  4H02 A;  2B63 H;  1IXR A;  3AFP A;  3HOV H;  5M5W H;  3K81 C;  2K52 A;  3U4V A;  5M3M G;  1XJV A;  1K73 C;  4DV0 Q;  3L2P A;  1JJC B;  4FDB A;  2K75 A;  1PH4 A;  1NMF A;  2CFM A;  4RMF A;  3TEH B;  4LUV A;  1YJ9 A;  3CC7 A;  1IBM L;  1Y1V G;  1J5E Q;  4JI5 Q;  4A3C G;  1G6P A;  4MNO A;  4KI0 A;  1X3E A;  4DV3 L;  3KF8 B;  3J81 c;  5FJ8 G;  1PH5 A;  3UDF A;  1VQC A;  1WJJ A;  4GLX A;  3ULL A;  4DV3 Q;  4Y7N H;  2D62 A;  2JA7 G;  1AH9 A;  1O7I A;  2VW9 A;  4X64 Q;  3TRZ A;  3I2Z A;  4GNX C;  2CQO A;  1VCI A;  3CCV A;  5LMN W;  4BY1 H;  2BA1 A;  3S24 A;  1P16 A;  1AE3 A;  4QQB X;  1BVS A;  2K4K A;  1HR0 W;  1OTC A;  1SMX A;  2F52 A;  2JE6 I;  3HOW H;  4GNX A;  4HJ9 A;  3E0E A;  1X9N A;  1RIP A;  1S72 A;  1X54 A;  3CC2 A;  2R92 H;  4A3L G;  4LF8 L;  1FL0 A;  2E2I H;  1A0I A;  4JG2 A;  2JK8 A;  4JOI C;  4GOP C;  1N36 Q;  3PIP A;  1K0R A;  3G4S A;  1Q86 C;  1PH2 A;  5EAY A;  3CCS A;  4A93 H;  4LFC Q;  1CKO A;  4DR6 Q;  1N9W A;  2WB1 G;  3NEN A;  1YI2 A;  1EIY B;  3HOY H;  1QVF A;  3EBE A;  3HOZ H;  1KIX A;  4DUZ Q;  1X65 A;  1N34 L;  4DR2 L;  4BBS H;  3KYH C;  3UE1 A;  2R93 H;  4X65 L;  1N8R C;  4OWW B;  2Y0S G;  3PUV A;  2ZJR A;  4LUO A;  3PUY A;  4JI1 L;  3BZK A;  4X62 L;  4OWX B;  4DV7 Q;  4A3J G;  1IL2 A;  1YHQ A;  3S2D H;  2RF4 A;  3D31 A;  1DGS A;  2ZTD A;  1G29 1;  4P75 A;  1LTL A;  4C3H H;  3RLF A;  2VQF Q;  4P73 A;  1XPU A;  2UUC Q;  4DAY B;  2LSS A;  1MJE A;  5M3M H;  4LF7 L;  3G71 A;  3PUX A;  2DGY A;  4A3G G;  4GN3 B;  4DK6 C;  4DV0 L;  2NVY H;  1UE6 A;  5GAD C;  1NJI C;  4J15 A;  2VUM G;  4GNX B;  4A3D H;  3H0G G;  3KF6 A;  3J7Z C;  3PGZ A;  2YTV A;  4OO1 G;  1KHI A;  3HKS A;  1I3Q H;  1JT8 A;  3CCQ A;  4LF6 L;  1IBL Q;  1XNR Q;  3J81 i;  1PFS A;  5M5X H;  4BY7 G;  3IRB A;  2F4V Q;  2MO1 A;  2ID0 A;  2RHQ B;  1IBL L;  3CPW A;  1WFQ A;  2ZTC A;  4DV4 Q;  3PF5 A;  3M85 A;  3CCL A;  4A76 A;  1V9P A;  2F4V L;  1NBW A;  4DR1 Q;  1V43 A;  2AWO A;  4O0A A;  4A3G H;  4NB3 A;  1L1O B;  1Y14 B;  3K8A A;  1HZB A;  1FVI A;  1NTG A;  3GTG H;  1B7Y B;  2VUM H;  3U50 C;  3H0G H;  2JA6 H;  3S2H H;  1SN8 A;  1VQ4 A;  4JI8 Q;  4B3S L;  1KL9 A;  3OTO Q;  3CCE A;  3PO3 H;  4BY7 H;  4GKJ L;  2BH8 A;  1S3O A;  3G6E A;  2N49 A;  2WFW A;  5GAE C;  1N32 Q;  4YCU A;  4A3M G;  4JI2 L;  1QVC A;  2Y0S E;  2UXC Q;  1YNX A;  2ES2 A;  2GVA A;  5FJ8 H;  3A5U A;  2OWO A;  3F1Z A;  1N36 L;  1OXS C;  1VQ5 A;  1N33 L;  4IPC A;  3UDX A;  1KRT A;  2R7Z G;  2JA8 G;  1UE7 A;  1OXX K;  4AQY Q;  5C0X G;  3D0F A;  4JBW A;  1EFW A;  4JYA L;  4YY3 Q;  1NMG A;  5HGQ A;  3JC6 6;  5E7N A;  3PO3 G;  2QA4 A;  1D8L A;  4LF5 L;  1WOC A;  4KLK A;  4OON A;  1E3P A;  4JC0 A;  1QUQ B;  1VQD A;  2HIX A;  2R93 G;  3PIO A;  1KRS A;  4YY3 L;  2R7D A;  4BXX G;  1JJG A;  1OXV A;  1TWH H;  3CCU A;  3BZC A;  4ME3 A;  4NPS A;  4LF5 Q;  4HIO A;  2HT1 A;  2UXB Q;  3HOX G;  4B3T L;  1IYJ B;  3S1M H;  3U4Z A;  2JEB I;  2VQE L;  4DV2 L;  4X66 Q;  3ER0 A;  4TVA B;  4O2D A;  5IYD G;  1X3G A;  2Q2T A;  3EN2 A;  4ALP A;  4GS3 A;  4LW1 A;  3RLO A;  2E5L L;  3B6Y A;  3M3Y H;  2WP8 J;  1E7Z A;  4DR3 L;  1K9M C;  4X64 L;  1C0A A;  3BJU A;  4IPH A;  4DK3 C;  2VNU D;  2YYZ A;  1FGU A;  4GLA C;  1PVO A;  2VL6 A;  4GOP B;  5C4X G;  1GVP A;  4PZ8 A;  2E2H H;  1L1O C;  1A62 A;  3J7A 5;  1QVG A;  1U5K A;  2YV5 A;  3M4P A;  2Z6K A;  3KDF A;  4JI6 L;  4A3B G;  1C9O A;  3CF5 A;  4WJ4 A;  5IT9 c;  2PMZ E;  3CQZ H;  4HJ8 A;  1KC8 C;  3S15 H;  1VQG A;  4DR1 L;  2CKZ B;  4JI6 Q;  1HZ9 A;  3ERS X;  1YJN A;  4R4C A;  1VQ9 A;  2JA6 G;  2A19 A;  2KCM A;  1QUQ A;  4UP8 A;  4IFD G;  3S1R H;  3JAM c;  2CWA A;  4DUZ L;  2K5V A;  3NBH B;  4A3I H;  1UEB A;  4GLV B;  1M90 C;  4UP9 A;  3GTP H;  1VQJ A;  2QGQ A;  5ELO A;  1BKB A;  3G48 A;  4GKK Q;  3W1B A;  2NVX H;  1LM0 A;  2OTJ A;  2AMC B;  2JA5 H;  4X62 Q;  1CSP A;  1OXU A;  3L7Z C;  5IE8 A;  2ALY B;  1U0L A;  3F2D A;  2VZA A;  2WB1 E;  4B3M Q;  2UUC L;  1E24 A;  3I56 A;  3S17 H;  2D0P A;  1YBY A;  4JYA Q;  4GOP A;  2ZJQ A;  1VQB A;  1TWG H;  4NXN Q;  4JI0 Q;  3FKI H;  1QZG A;  4R4T A;  4AYB G;  5C4X H;  4KHP L;  4A3F G;  4P74 A;  4HJ7 A;  3GTQ H;  3CC4 A;  1W3S A;  5IYB H;  3KDF B;  1XPR A;  1CKN A;  4A3E H;  1SRU A;  4L5Q A;  2KCT A;  1PH6 A;  5IP9 G;  4JOI A;  4UPA A;  3A74 A;  4EQ5 A;  4DV4 L;  3KFU A;  3E9H A;  1K83 H;  3I4O A;  4BA2 I;  1V1Q A;  2RCN A;  1HNW L;  2NZH A;  1TWF H;  3M4Q A;  1XPO A;  2FXQ A;  3KOJ A;  2H5X A;  4L5R C;  4OX9 Q;  2K50 A;  3TS2 A;  2LXK A;  5J3B A;  3ZJY C;  4AIM A;  2I5H A;  3OTO L;  4A3E G;  3PF4 A;  2NN6 I;  4BA1 I;  1PH3 A;  1MIU A;  1TWC H;  1YIJ A;  5IP7 H;  4OX9 L;  1VQ6 A;  2R92 G;  1X3F A;  4QGU A;  4R4I A;  3CCM A;  1P8L A;  3CCJ A;  3E9I A;  2JA5 G;  4DAM A;  3CP0 A;  4JI2 Q;  2KBN A;  4JI3 L;  1L2F A;  3NEM A;  3OYY A;  2UXD Q;  1X55 A;  4R4Q A;  1JB7 A;  3I4N H;  2AHO B;  2N3S A;  4IPD A;  1AE2 A;  3JAM i;  4XTC S;  1GKH A;  4HJ5 A;  1Z9F A;  4GN5 A;  2ZTE A;  4OWT B;  4BBS G;  3S1N H;  3S1Q H;  3TRE A;  4POF A;  1KAW A;  3KLW A;  2I5M X;  4LFC L;  4DR6 L;  4AH6 A;  4DR5 Q;  4JI4 Q;  1PYB A;  1XMO L;  3GTK H;  1GO3 E;  3RNU A;  3K0X A;  1YEZ A;  3AEV A;  1KXL A;  4GKK L;  2MFI A;  4DR5 L;  1BBU A;  4DR2 Q;  4JI4 L;  5C4J H;  1EUJ A;  4YCV A;  1ASY A;  4X65 Q;  5JJK A;  1UWV A;  1R9T H;  4X66 L;  4DV1 L;  1I94 L;  3UDI A;  5FLM H;  3H15 A;  3HOZ G;  3CW2 C;  3RZD H;  5DLQ E;  3DLL A;  3RLN A;  1PV4 A;  4PZ7 A;  2JEA I;  5LMU Q;  5AJ3 L;  2OCE A;  3GO5 A;  1JE5 A;  1BBW A;  4YHH Q;  5C0X J;  4A75 A;  5LMU L;  3LGJ A;  1PA6 A;  3ICE A;  4LFA L;  4C2M H;  4LF6 Q;  5GAH C;  2VY3 A;  1FJG L;  1XNR L;  3CMA A;  3RN5 A;  4JBM A;  1HR0 L;  4B3R L;  5M3F G;  1UE1 A;  5FLM G;  3FP9 A;  2UU9 L;  1HNW Q;  1EWI A;  4DV5 Q;  2XTI A;  2AKW B;  1FJG Q;  1RL2 A;  1Y1V H;  2K5N A;  1SLJ A;  1HJP A;  2KHI A;  3S14 H;  2CCZ A;  5M5Y H;  4IOA A;  2K14 A;  3GTO H;  3PO2 G;  1NY4 A;  3KJP A;  4R4O A;  5IP7 G;  3J80 i;  2ZJP A;  3TS0 A;  3H3V I;  5JEA G;  2KHJ A;  2L15 A;  1VQ8 A;  3SGI A;  3M4O H;  5HY6 A;  4GKJ Q;  1CKM A;  1SE8 A;  2I5L X;  2EIF A;  2JA8 H;  2CWP A;  1SRO A;  1A8V A;  4YCW A;  2DUD A;  3CME A;  1X6O A;  2B3G A;  1VS0 A;  2VS1 A;  1XMQ L;  2ATW A;  4LF4 Q;  3STB C;  3PO2 H;  4JI0 L;  2Q2H A;  2JQO A;  4BXX H;  1WI5 A;  2EXD A;  3TQY A;  3A0J A;  3L0O A;  4AQY L;  4HID A;  4A3B H;  1LYL A;  1Q12 A;  1H95 A;  1HZA A;  1E22 A;  4JCV E;  1HH2 P;  4RG1 A;  1E1O A;  3S16 H;  3MXN B;  3W1G A;  5M3F H;  3RR5 A;  3PUZ A;  4UY8 C;  3I55 A;  1A63 A;  3PCO B;  3BU2 A;  4P72 A;  5IYC G;  3I4N G;  1SFO H;  5LMN L;  4L5S A;  3HOW G;  4BBR G;  2Z6K C;  2R7F A;  4PZ6 A;  1G51 A;  2ASB A;  1B8A A;  4HJA A;  2VQE Q;  2NVQ H;  2AWN A;  4A4I A;  1YIT A;  2E8G A;  2KEN A;  5AJ3 Q;  1E1T A;  1KQS A;  2E5L Q;  2UUA Q;  1KD1 C;  3K80 C;  4IOC A;  1M1K C;  4IFD J;  4DR3 Q;  3T1H L;  1VQA A;  2GN5 A;  3T1Y Q;  2F3I A;  5K36 G;  4YHH L;  1J6Q A;  3GTM H;  1UE5 A;  5IWA L;  4IO9 A;  3PSI A;  2QEX A;  4LFA Q;  4YWM A;  4R1J A;  1IZ6 A;  1X56 A;  2PI2 E;  1K3R A;  5JEA J;  4A3K G;  4X6A H;  5IYC H;  2UU9 Q;  1LUZ A;  5IWA Q;  2UXD L;  3W5O A;  4DV5 L;  4JV5 Q;  1XNQ Q;  1EQQ A;  1Q81 C;  2JA9 A;  2EQS A;  3J80 c;  3CD6 A;  2IHE A;  1Q7Y C;  5GQO A;  1CUK A;  4JV5 L;  1Q8K A;  1PH1 A;  3H3V H;  4LFB Q;  1VQN A;  2XGT A;  5C44 H;  3RN2 A;  1GM5 A;  1B70 B;  5JJI A;  3ULJ A;  5FLX c;  2IY5 B;  3STB D;  3AYH B;  3J81 j;  4LUZ A;  4YWL A;  3HOY G;  2N78 A;  1JJ2 A;  4DR7 Q;  4LWC A;  2OTL A;  4BY1 G;  4Y52 H;  4BBR H;  2ZM6 Q;  5C0X I;  1PH8 A;  4JI7 L;  4DV1 Q;  1I94 Q;  1C7Y A;  4MTN A;  4A3F H;  1VQ7 A;  4DR7 L;  1Y1W H;  2PQA B;  4B3M L;  1MJC A;  4A3M H;  4K0K Q;  1K8A C;  4JI7 Q;  3I7F A;  3I4M H;  3M7N A;  1EYG A;  4L5T A;  4PG3 A;  2OQ0 A;  1D7Q A;  5IP9 H;  3MEF A;  4EX5 A;  2OQK A;  2A1A A;  4A93 G;  4HIK A;  1IBM Q;  2WAQ G;  4IJH A;  3GD7 A;  4DNI A;  4A3D G;  2NN6 G;  2NZO A;  1WCM H;  1T9H A;  3GTJ H;  3RZO H;  1YHA A;  3M9B A;  1GD7 A;  1Y1W G;  3Q8D A;  4DV6 L;  1Q82 C;  2GVB A;  1TWA H;  2YU9 H;  3I4M G;  1EIF A;  2WAQ E;  3PUW A;  4NXM Q;  4C3I H;  1PH9 A;  2UUA L;  4JI8 L;  3HOX H;  2UUB Q;  1HZC A;  1HNX Q;  2C35 B;  3T1Y L;  3HOV G;  3F8T A;  4QJF A;  2R7Z H;  1EQR A;  3FHW A;  3U58 A;  3UE0 A;  2UUB L;  1SR3 A;  4A3K H;  2UXC L;  1HNX L;  2HHH L;  2RHS B;  1MKH A;  2I0Q A;  1WCM G;  3CXC A;  2HQL A;  2NVT H;  3AFQ A;  1XNQ L;  1XMQ Q;  1Q1E A;  4DPG A;  4IJL A;  4QY7 A;  1IBK L;  3EIV A;  4JI3 Q;  4LF4 L;  4LF8 Q;  1VQK A;  5IYB G;  3CCR A;  2PNH A;  3HKZ E;  2UXB L;  1WYD A;  3HOU G;  1QZH A;  4PMW A;  1VQL A;  1CKN B;  1IBK Q;  3NEL A;  5IYD H;  1I5F A;  1VQO A;  4LNQ A;  3WWV A;  1Q46 A;  4LF9 L;  2IX0 A;  2YTX A;  1OXT A;  5C3E G;  1N34 Q;  1YHB A;  4IFD I;  2PI2 A;  1XMO Q;  3HFZ B;  3GDE A;  1L1O A;  1HNZ L;  4GN4 B;  1L0W A;  2YTY A;  2Q2I A;  2MQH A;  2D0O A;  2R6G A;  5IY0 A;  4XIG S;  4DV2 Q;  5H1S E;  4JI5 L;  3HKZ G;  5GAG C;  3A5Z B;  4JI1 Q;  5LMN Q;  4DV7 L;  1YJW A;  1J5E L;  4C3J H;  4POG A;  1HNZ Q;  1TXY A;  4TQU S;  3AQQ A;  2B29 A;  2K5H A;  1CSQ A;  2BA0 A;  3CAM A;  3KJO A;  4DUY L;  4LF7 Q;  5ELN A;  3F2B A;  5C44 G;  4MZ9 A;  2IHF A;  3T1H Q;  1JMC A;  4OO1 I;  2JA7 H;  1EOV A;  3KF6 B;  4P71 A;  5BR8 L;  4DUY Q;  1VQP A;  2N8N A;  3PV0 A;  2A8V A;  3ULP A;  3FKI G;  2JJQ A;  4UP7 A;  5BR8 Q;  4AYB E;  2Q2U A;  4YWK A;  2E2J H;  4A3C H;  1K8G A;  4DV6 Q;  1PYS B;  1HR0 Q;  1NE3 A;  4B3R Q;  2HIV A;  3K7U C;  4A3J H;  4NXM L;  1W2B A;  3HOU H;  1VQH A;  4IPG A;  2MNA A;  2MO0 A;  4KHZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...