1WFQA

Solution structure of the first cold-shock domain of the human kiaa0885 protein (unr protein)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
89
structure length
89
Chain Sequence
GSSGSSGGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords UNR protein
publication title The NMR solution structures of the five constituent cold-shock domains (CSD) of the human UNR (upstream of N-ras) protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 6
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1wfqA01
3HKZE 3TRZA 1XMQQ 1N36Q 1VQ5A 1N9WA 1UE5A 3A5ZB 1YIJA 1VQLA 3OYYA 4LNQA 3I4NH 2K75A 5C4XH 3S1RH 3RR5A 3KF6A 3MXNB 1ASYA 5HY6A 4JI2Q 3A5UA 1N34Q 4JI0Q 2B3GA 3K81C 3AEVA 3HOWG 3WWVA 4IFDG 4JI1Q 1K83H 1OXUA 2E8GA 1YVCA 3CCVA 4AIMA 4DR4L 1G6PA 1NMFA 2ZTDA 4R4IA 1VQ9A 4IPDA 4IFDI 4POGA 2WP8J 1VQCA 4LF9L 5J3BA 4DV6L 3UDXA 1BBUA 1UE6A 2RF4A 3PV0A 1JT8A 4RMFA 4JV5Q 1HNXL 4UP9A 1KHIA 1AE3A 3CCSA 3K7AH 1SN8A 1V1QA 5ELOA 4DR2Q 2MO1A 1VQ8A 1N33Q 2C35B 2VY3A 1LTLA 4LUZA 2IY5B 1EFWA 1TXYA 2JA5G 4P71A 4XIGS 3BU2A 1YBYA 3H3VI 1KRSA 3G48A 4YWMA 2NZOA 3EN2A 3T1HL 5FJ8H 2K5HA 1VQMA 4DR7L 2AWNA 4QL5A 5FLMH 1QVCA 4B3MQ 2K4KA 4JOIC 2UUBQ 4PZ7A 4DPGA 3I56A 3SGIA 1IYJB 1C7YA 1IBLQ 2ZJPA 4J15A 5M3MG 1K73C 4JI2L 4A3DH 4TVAB 4X6AH 4X65L 4JI0L 2DGYA 2R93G 2K14A 4GLVB 2B63G 2NVQH 4A3BH 2Y0SE 2B29A 1XNRQ 2JA6H 4BA1I 4KI0A 5M3FH 4JI6Q 5C4XG 3JC66 4JI3Q 4DUZQ 4BY7H 2BH8A 1KIXA 3PO2H 3TS2A 4IOCA 2UU9L 4JI5Q 3STBC 5C0XG 2NVTH 4JI7Q 5IYCH 1NMGA 4IPHA 2CFMA 2MQHA 2QEXA 2JA7H 3MEFA 3BZCA 4DR2L 1N33L 5C0XI 2ALYB 2ATWA 1PH4A 4UY8C 1XMOL 4A3JG 3HFZB 5IYBH 4BY1G 3PUZA 1LM0A 1CKNB 1Y1VH 3J80c 1PH7A 1EIYB 2IX0A 5GADC 3J81j 2JJQA 2IX1A 1NY4A 4A3CG 3KYHC 4B3ML 4B3TQ 2E2JH 2MNAA 2YU9H 4A3GG 4Y52H 1Z47A 3HOVG 3PIPA 3RLFA 2KCTA 2F4VQ 5E7NA 3NELA 4PMWA 2BH2A 4GS3A 3HOXG 4A3FG 1KC8C 5IY0A 1CKMA 5GROA 5IWAQ 3HOYH 2JA8G 1J6QA 1VS0A 2E2HH 2F52A 4EX5A 1S40A 1WCMG 4IJHA 2QA4A 3KF8B 1EYGA 1HNWL 1YHAA 2E5LQ 4YCVA 3KLWA 5IE8A 3RZOH 2R6GA 3G4SA 5C3EH 4QJFA 2KBNA 4P75A 2OTJA 3H15A 4DUZL 4LFAQ 2CCZA 1W3SA 1KRTA 3I2ZA 3GTPH 1WJJA 4JI7L 1I50H 1Z9FA 5M5XH 3A0JA 5ELNA 1CKNA 3KF6B 3CXCA 2Q2TA 2N8NA 4B3RQ 4DV1Q 1HNZL 1RL2A 5JJKA 2I5MX 1YITA 4KHPQ 1L1OC 1Q8KA 3HKZG 4AH6A 5LMNL 4GN3B 3GTOH 4DR5L 4DV0Q 2R92H 4EQ5A 4L5SA 1VQBA 1QZGA 2UUAQ 3I4MG 4X62L 4A3KG 1L1OB 1XPOA 4DV2L 1YJ9A 1PV4A 3NBHB 4GKKQ 3F2DA 2N3SA 4XTCS 4OX9L 4HJ7A 4DR6Q 3TREA 1IBMQ 1VQKA 4LF6L 4DV3L 1Y1VG 4K0KL 3UDIA 4X64Q 4QIWE 3JAMc 4BXXH 1ASZA 3J80i 5IWAL 4YCWA 5K36G 2V1CC 4IOAA 1BBWA 3BJUA 3K0XA 3U4VA 1SLJA 1PHJA 4O0AA 1A62A 5IP9H 2UXBL 3FKIG 4C3HH 1DGSA 3HOZH 3PGZA 1UE1A 5GQOA 4NXNQ 2MFIA 3ULJA 2A8VA 1WFQA 2EQSA 3W1BA 4DR3L 4A3LG 3NEMA 3DLLA 1N32Q 2YTVA 5FLXc 1SFOH 4A3MH 4LFCQ 3S2DH 4YWLA 1PH9A 4BBSG 1Q7YC 5BR8L 1FJGQ 1XTDA 1K3RA 1X65A 4BBRH 4HIMA 1QUQA 5C3EG 1E3PA 1GD7A 1TWHH 1L1OA 4A3EH 1GM5A 4JI8L 5M5WH 1K9MC 3PF5A 2RHQB 4JCVE 1I94Q 4DAMA 3CQZH 1WI5A 2OTLA 4DV4L 1G51A 4IJLA 4DV7L 1PH6A 3S1MH 1EUJA 2LSSA 4JI4Q 3ULLA 4JG2A 3BZKA 2D0OA 1OXVA 1IL2A 4X66Q 1A0IA 1FGUA 4ALPA 4RG1A 1X6OA 2IT1A 2JK8A 1S72A 1Q46A 1GVPA 4YHHL 3PIOA 4OO1G 4GN4B 2Y0SG 4DR6L 1UEBA 4A3IH 1IBML 2I5LX 2VZAA 1Q81C 1E7ZA 1I3QH 3S14H 4LFBQ 4DR1Q 4OO1I 4LF4Q 2XTIA 2Z6KA 3RZDH 4LF5Q 3PUXA 1XMQL 1N36L 2VNUD 4PZ8A 4POFA 1YEZA 2H5XA 2VUMG 3F2CA 1CKOA 4R4TA 3L2PA 3ICEA 3GO5A 3HOUH 4NXMQ 3PSIA 1L2FA 4BXXG 1PFSA 4L5TA 2AMCB 1PYBA 3JAMi 1Q86C 1M90C 3HKSA 2UUCQ 4A3DG 1MKHA 4TQUS 1X9NA 4LUOA 1N34L 1N32L 5JJLA 4JI1L 4BA2I 3I4NG 2R7ZH 1T9HA 2OCEA 2ZM6Q 5LMUQ 1W2BA 1JJ2A 4GKJQ 1CUKA 4JBWA 2D0PA 1IBKQ 3TQYA 3U50C 4O2DA 2L15A 2AWOA 1N8RC 2I5HA 4OWXB 3GTQH 2QGQA 4JV5L 1VQ6A 3TEHB 1I6HH 1GO3E 2VS1A 5C44H 2AHOB 3ERSX 4PG3A 1Y1WH 2PI2E 1PH5A 4MZ9A 4OXPA 3CMAA 1PVOA 2A1AA 5HGQA 5IP7H 4HIDA 1HR0W 1YHQA 5IYDH 1S3OA 4QY7A 1YJWA 2IHEA 1NBWA 3RLOA 1H95A 4DR1L 3CPFA 1VQIA 1PH8A 2PI2A 3CCMA 4HIKA 2JQOA 2UUBL 1YI2A 2N49A 3DM3A 3CCRA 2FXQA 1IBLL 4HJ8A 5FJ8G 3VDYA 4NPSA 3ULPA 3H0GH 5FLMG 2UUCL 2VQFQ 4A93H 1BVSA 4C3IH 3TS0A 2HHHQ 3AFQA 1OXTA 4DNIA 2WAQG 1V9PA 4DUYQ 1EQQA 1QVFA 1XNRL 1KXLA 1JJCB 4R1JA 3UE0A 4JI6L 2DUDA 4B3SQ 2A19A 1VQEA 1WYDA 3M4OH 1P8LA 3F1ZA 4JI3L 3CCQA 1IBKL 4YY3Q 1PH3A 2LXKA 3RN5A 4JBKA 3CW2C 4JI5L 2CQOA 4A3BG 2JA6G 2EIFA 4LW1A 2Q2IA 5M3FG 3M9BA 1NE3A 3NENA 1LYLA 4BY7G 1FL0A 1SR3A 4R4CA 3PO2G 2Q2UA 3FP9A 3AYHB 4HIOA 3HOWH 2WAQE 4A4IA 5IYCG 1X3FA 2UXCQ 1AH9A 1QUQB 1UWVA 2JA7G 1AE2A 1JE5A 3M85A 3GTJH 1XNQQ 3S16H 4HJAA 4B3TL 2Z0SA 3F8TA 4JBMA 3PUYA 4QQBX 5IYBG 2F4VL 4L5RC 1PH1A 2N78A 1B70B 4DR4Q 4OWWB 4FDBA 4MTNA 5LMNW 4L5QA 3H3VH 2CKZB 4P73A 2NZHA 2LXJA 2K50A 3PO3H 1TWGH 1U0LA 2EXDA 5GAHC 1X55A 3D31A 2KENA 5IT9c 2Z6KC 2HHHL 3FHWA 3LGJA 2JA9A 2JA5H 2E5LL 3KFUA 1HNXQ 5DLQE 5M5YH 3GTMH 4AYBG 2R7DA 3RNUA 4B3SL 3W1GA 2PNHA 4GLAC 3U4ZA 1KD1C 1E22A 3HOYG 5EAYA 3PCOB 4YY3L 3U58A 2JEAI 1FVIA 1K0RA 2GVAA 4LFAL 3I55A 3CC7A 1C0AA 1TWAH 3T1HQ 3L7ZC 2VQEQ 1VQPA 4GNXC 3CPWA 5M3MH 1RIPA 2HIVA 1XJVA 4DR7Q 4NB3A 1J5EQ 4DV1L 4B3RL 4KHPL 2XGTA 1VQGA 1EIFA 1HZAA 1K8AC 4DV0L 1YHBA 4A76A 4GNXB 2B63H 2R93H 1D7QA 4AQYQ 4YWKA 5JJIA 2UUAL 3J7A5 2UXCL 4GN5A 3CP0A 4AYBE 1X3GA 4GOPA 1WOCA 1E1TA 1XNQL 1JB7A 1NTGA 1TWCH 4LF7Q 4ME3A 1VQFA 3G6EA 4GKKL 4X65Q 3RLNA 1P16A 4DAYB 3G71A 2R92G 3J7ZC 3D0FA 2KHJA 4JYAQ 4APVA 3KDFA 1HR0Q 4X64L 3GTLH 4WJ3M 1Q12A 3UDGA 2OQKA 4IO9A 1G291 3I4OA 4YCUA 1X56A 2RCNA 4C3JH 1HZBA 5JEAJ 1LUZA 2NVYH 2F3IA 2PQAB 2UU9Q 3CCJA 1X54A 4KLKA 4A3JH 2I0QA 3CC4A 1YZ6A 2HQLA 3OTOQ 1PH2A 1MJEA 4BY1H 1VQNA 3GTGH 1JMCA 2OWOA 4A3CH 1IZ6A 4NXNL 3CAMA 1D8LA 1KQSA 2BA0A 2YTXA 5AJ3Q 2WFWA 1A63A 1OXSC 3PO3G 3S17H 2UXDQ 4A3GH 3OW2A 2VL6A 4LFCL 3HOVH 1XMOQ 3EBEA 1CSQA 3PUVA 1V43A 4GNXA 5IP9G 1FJGL 4LWCA 2PMZE 4P74A 2ASBA 3HOXH 3E0EA 4IPCA 2VQEL 1Y14B 4A3FH 1XPRA 3HOZG 3CMEA 1Q1EA 2JA8H 1J5EL 3M4PA 1SMXA 1I94L 1WCMH 2ZTCA 4A3MG 3GTKH 4AQYL 4JI4L 1K8GA 1XPUA 4IFDJ 3ER0A 4BBRG 2GVBA 2YV5A 3E9HA 4X66L 2HT1A 4A3EG 3S2HH 4LF8Q 4LF7L 3W5OA 1HNWQ 3B6YA 1B7YB 2PQAA 3CCUA 2ID0A 3GDEA 2MO0A 4OONA 2BA1A 4JYAL 1M1KC 3K80C 4UPAA 1HR0L 1QZHA 4LFBL 4HJ9A 4A75A 1I5FA 1YNXA 1KL9A 4LF4L 1X3EA 4LF5L 4UP8A 3CC2A 3KJPA 1B8AA 3CCEA 4A3IG 2JE6I 1VQDA 2D62A 3OTOL 1UE7A 3T1YQ 4OWTB 3RN2A 3I4MH 3S24A 3STBD 1EWIA 4UP7A 5GAEC 4P72A 4A3KH 4NXML 1HNZQ 4LUVA 5AJ3L 3PF4A 1SE8A 2UXDL 5LMNQ 2K5VA 3J81c 4DR5Q 1EQRA 4DV5Q 1OTCA 2ZJQA 4HJ5A 4R4OA 1Q1BA 2YYZA 2ZTEA 5GAGC 2CWAA 3EIVA 4X62Q 2NVXH 2ZM6L 1VQHA 1GKHA 2IHFA 5LMUL 3HOUG 4GKJL 1JJGA 4DV2Q 2NN6G 3UE1A 4JOIA 2RHSB 1EOVA 1HJPA 2WB1G 4QGUA 2OQ0A 1BKBA 1CSPA 4MNOA 4C2MH 4OX9Q 1E1OA 3S1NH 1VQ7A 2NN6I 1MIUA 3FKIH 4LF6Q 4DV3Q 4K0KQ 2R7ZG 4PZ6A 1TWFH 1VQAA 1O7IA 2ES2A 3KJOA 4A3LH 4DKAC 3M3YH 5H1SE 4LF8L 2GN5A 3GD7A 4R4QA 1HZCA 1U5KA 1IXRA 2YTYA 3L0OA 1QVGA 3S1QH 4BBSH 1SROA 2UXBQ 3CD6A 4GLXA 1HZ9A 1KAWA 5C0XJ 5C44G 4DR3Q 3CF5A 4GOPC 3PUWA 1Y1WG 3ZJYC 2E2IH 2WB1E 1PYSB 1L0WA 3IRBA 5IP7G 5IYDG 1E24A 3I7FA 5BR8Q 1A8VA 1VQJA 4KHZA 3A74A 3AQQA 3T1YL 4GOPB 3CCLA 1R9TH 3AFPA 4JBJA 1VCIA 4DK3C 4LF9Q 2JEBI 4JI8Q 4DV6Q 2VQFL 1MJCA 2Q2HA 4Y7NH 1VQ4A 4DV4Q 2KHIA 2R7FA 4DV5L 4DUYL 2VW9A 4DV7Q 3KDFB 1C9OA 4H02A 5JEAG 3S15H 2KCMA 3H0GG 3K8AA 4DK6C 4A93G 4WJ4A 1OXXK 3E9IA 3UDFA 5C4JH 4IPGA 4YHHQ 1VQOA 2K5NA 1HH2P 1NJIC 4JC0A 1SRUA 3M4QA 3J81i 1Q82C 3M7NA 3KOJA 3Q8DA 1PA6A 2AKWB 2VUMH 3K7UC 2K52A 2HIXA 2CWPA 1YJNA 3F2BA 2ZJRA
chains in the Genus database with same CATH superfamily
1BQQT 2XVSA 2IPKD 1SJHD 3I4NH 5IGCA 5C4XH 3S1RH 1LT3D 1HPCA 3MXNB 1Y8NB 1WTHA 1ASYA 5HY6A 1BXTA 4CKCA 4IFDG 4JI0Q 3AEVA 1UUPA 3K81C 2KUMA 3HOWG 1K83H 1IW7D 1NMFA 4CJ0B 1VQ9A 5EKLA 3X3NA 2BE5D 2F0JA 5EPLA 3H3VC 3UDXA 2RF4A 2QF7A 1JT8A 5L37A 2BDOA 3HGBA 1SN8A 4DR2Q 1F2YA 1LTLA 1EY5A 4LUZA 3D4DA 4Y7NB 2JA5G 1DCZA 4P71A 1ZYRD 2XRSD 2A5HA 3GTMB 3EN2A 3K5MA 5ELEA 4CJ2C 1ET9A 2AWNA 1KDBA 1H9JA 2UUBQ 3M4YA 1C7YA 3SDZA 2QILA 3BDOA 4J15A 3TP5A 3OSOA 4TVAB 1RD9D 3LX0A 2K14A 3KBXA 4GLVB 5CR3A 2XRQD 4CKBA 2B63G 5C4XB 4TKOB 4X3KA 2SEBD 1Y8OB 5FK9C 5J1ZA 3I8ZA 1MGSA 3STBC 2NVTH 4HCSA 2Z4IA 2MQHA 3QJYA 2QEXA 1EOTA 5CGKA 1N33L 3TDQA 5C0XI 4XT1B 4C3JG 4UY8C 4F8MA 1B4OA 4MIUA 4GZYC 3NXWA 5IYBH 4L63B 5CV6A 1LM0A 1CKNB 1PRTF 5AFWA 1PH7A 2ATWA 3J81j 2F0WA 2JJQA 2X6LA 3KYHC 2AQ1B 4B3ML 4K8IA 1K8MA 3HOVB 4I7AA 1AN8A 1TY0A 2O5IC 2BH2A 5D14A 3NK9A 3HOXG 2JA8G 3ERQA 3DWQA 1HNWL 2F0UA 1DOKA 1YHAA 1JE4A 4FNFA 2E5LQ 4DK1A 2R6GA 5DEHA 3G4SA 2ICEC 1NSNS 4IN3A 3VR6A 3I2ZA 3RUZA 3BS1A 1Z9FA 2JP1A 3A0JA 4ZQ3A 3E6ZX 1RL2A 1YITA 4AH6A 1PTOD 3GTOH 4DR5L 4EQ5A 2NVTB 3TBIB 4KJNA 3I4MB 2UUAQ 4X62L 1D1KA 1L1OB 1XPOA 2DJFC 3ND9A 4K6DA 4GKKQ 1IBMQ 1VQKA 3E5SA 4LF6L 3UDIA 4QIWE 1I4GA 1ASZA 5K36G 2EDGA 4FXDA 4V0BA 1A62A 2SOBA 2MFIA 1WFQA 3NE5B 4DR3L 4A3LG 1FD7D 3NEMA 1SYFA 3OW7A 4A3MH 1IYUA 1VF5C 2F0NA 4YWLA 3S1QB 1BCPB 2F0LA 5CV8A 1QUQA 1M8AA 4JI8L 2RHQB 5CC4A 1XXGA 4DAMA 1X32A 1WI5A 1PH6A 1EUJA 2LSSA 3SK6A 3ULLA 1GJXA 3FVQA 2D0OA 1OXVA 1IL2A 1SAPA 1FGUA 1T5XD 1FNVA 1S72A 1Q46A 4OO1G 1E7ZA 5C4HA 2B2TC 3KLRA 4LFBQ 4WORA 2XTIA 1LABA 2VNUD 4F7XA 3GV3A 1PFMA 2VUMG 2A6HC 3PSIA 1PFSA 1Q86C 2NN6H 1M90C 2UUCQ 4TQUS 3SK5A 1EYCA 1KLGD 1F9PA 1EZ8A 1ESFA 1T9HA 1CUKA 3K0YA 3U50C 3K5LA 4RHSA 4A3MB 2AWOA 2A69C 4CKEA 1N8RC 3GTQH 3X3MA 2QGQA 4ABNA 1Q90A 2A68C 1VQ6A 2A69D 3OPOA 3TEHB 3ERSX 4IQZA 3SEBA 4DF7A 5IT9E 3D6CA 4CJ1B 1S3OA 5CV4A 1H95A 2F0VA 2JQOA 5F2DA 1A2TA 2O2LD 3DM3A 4DAPA 2Z9HA 2L4NA 3H0GH 5FLMG 3E0JA 4DFAA 4C3IH 2HHHQ 4E6IA 1D5ZC 1KXLA 4R1JA 2F0MA 2A19A 1WYDA 2XN9C 4JI3L 2EE1A 3CCQA 2LXKA 3CW2C 4A3BB 2CQOA 2JA6G 5M3FG 1RF2D 1NE3A 1O7YA 1LO5D 3PO2B 4R4CA 3BYYB 3MVVA 1JWUD 2J0TD 1QUQB 4I7ZC 1AE2A 3GTJH 3S16H 1IKMA 1TIID 2L1BA 1WTXA 3IFDA 1PH1A 3H3VH 4RCOA 2NZHA 2LXJA 3NUCA 5JPNC 3P20A 2YU9B 3PO3H 5GAHC 5IT9c 1DJRD 3RNUA 3H0GB 4KMUC 3HOYB 1KD1C 3DMUA 4C3IB 3U58A 2XNAC 1K0RA 4KTAA 5ELFA 4LFAL 3CC7A 2FMCA 2VQEQ 3MFGA 5M3MH 1SE4A 3GP7A 1XJVA 4NB3A 4B3RL 4DV1L 2WACA 1LTRD 2WKCA 1EIFA 4FXGC 4U673 4AQYQ 5JJIA 3TMEA 2UXCL 3HEJA 4AYBE 2L12A 1VQFA 5KNCA 2R92B 3RLNA 1P16A 3G71A 2PMZB 2KHJA 1UNSA 4APVA 4X64L 2PPBC 3S16B 1X56A 2NVYH 1E2ZA 1X54A 3CCJA 4A3JH 2VB2X 2HQLA 1MJEA 3T51B 2OWOA 3CAMA 1EY9A 1KQSA 1Q3LA 3J7AF 2WFWA 3QOLA 3PO3B 2O5JC 3QR8A 3OW2A 2VL6A 4GNXA 4LWCA 1PRTB 4P74A 4C3HG 3HOZB 3E0EA 1RHPA 4J8QA 1J5EL 1SMXA 1HUMA 4DNRB 1I94L 4EQNA 4B9XA 2OEOA 1Y8PB 4JI4L 3ER0A 4BBRG 2EPBA 3KLSX 2GVBA 4X66L 2QKIC 3E9HA 3S2HH 1HNWQ 4KD4A 4M8AA 2PQAA 3S1MB 2ID0A 4K8JA 2BA1A 1RCVD 4OONA 4JYAL 1B2TA 3K80C 3K57A 4A75A 1NR4A 1CTMA 2V4DA 1X3EA 1IL8A 3R2TA 3VYSA 4A3IG 3OTOL 1STBA 2D62A 1CM9A 3LWUA 1EEFD 3JAME 4UP7A 5GAEC 2EYLA 4LUVA 2PZUA 3PF4A 2UXDL 4RHRA 2NVYB 2L55A 4DR5Q 4A3JB 2ZJQA 4XT3B 4R4OA 2YYZA 1BF4A 4X62Q 2NVXH 2ZM6L 1VQHA 4GKJL 3UE1A 5ELCA 1CSPA 4MNOA 1SNDA 3R8BA 3S1NH 3FKIH 4LF6Q 3WOEA 4V190 1TWFH 1VQAA 3M3YH 2J7ZA 5H1SE 2GN5A 1JORA 2CW0D 2L11A 1QVGA 5BN4A 4GLXA 4Q5VA 1LT6D 2NZ1D 1HZ9A 1KAWA 2PZWA 5C44G 4DR3Q 1C4QA 4GOPC 3ZJYC 1K28A 1PYSB 3FPPA 3I7FA 1TR5A 1A8VA 1VQJA 3CCLA 3LNNA 1R9TH 3DM1A 1NAPA 1VCIA 4LF9Q 4JI8Q 1SDFA 5I4DA 1MJCA 2Q2HA 1KNAA 1SE2A 2KHIA 2XSCA 4DUYL 1FR3A 3Q24A 1C48A 5JEAG 3S15H 1G2SA 3CHBD 3K8AA 1EY7A 1WD0A 4A93G 1OXXK 3E9IA 4IPGA 4JC0A 1NCVA 3M4QA 3M7NA 1PA6A 3G7LA 2NVXB 4N8FA 1YJNA 2EJGC 1QZGA 1VQ5A 2F0KA 3NWTA 2M2LA 1UE5A 1CHQD 3OYYA 1RDPD 4EQOA 2D5DA 1ILQA 2E75C 4N9PA 4JI2Q 1BCPD 3A5UA 2B3GA 2FFKB 4DK0A 3M7GA 1F2LA 2X69A 1G6PA 3URYA 2IL8A 2WKDA 2WP8J 1VQCA 2DNCA 3DWPA 4DV6L 4KY6A 3KUPA 4HMJA 5ELDA 4RMFA 1BR9A 4G4KA 4UP9A 1AE3A 3VYTA 1R9TB 5KYLA 1V1QA 4FF3A 1ESRA 1Y69U 2C35B 4RAUC 2IY5B 1TWGB 1TXYA 5EGTA 4XIGS 1PZJD 5IIFA 1KRSA 3G48A 4IURA 1S5ED 5FJ8H 1VQMA 4HR7B 3SXHA 1EY8A 2SNSA 1ENAA 4JOIC 3N52A 4KY7A 3I56A 1H9RA 3MTSA 3SGIA 4K5XA 1TWAB 3V05A 2ZJPA 1LACA 4X3TA 4B08A 1K73C 2R93B 1TKWB 2WINB 2B2VA 2NVQH 3EVQA 1QE6A 5C4XG 3JC66 1MSHA 1TWCB 4G7ZC 4DUZQ 4JI3Q 4BY7H 4JPBW 4IOCA 2UU9L 5C0XG 4PNYA 4JI7Q 5IYCH 3GTLB 4IPHA 2JA7H 3MEFA 1UAPA 3DXJC 2ALYB 3Q6SA 4ZYSA 4BY1B 3AB9A 4HMIA 3CU7A 1Y1VH 2IX0A 1NY4A 3Q23A 4A3GB 2B8FA 2EYFA 5FLXE 3HOVG 3PIPA 2B2YA 2KCTA 5E7NA 3NELA 4A3FB 2L5TA 5IWAQ 1VS0A 1S5BD 1WCMB 1Z6HA 2QA4A 3KF8B 4FO2A 1EYGA 1HTPA 3NP8A 1G6ZA 1F9SA 3RZOH 4QJFA 2B2UC 2OTJA 4EGVA 3TP6A 3H15A 4LFAQ 2JYOA 3Q0AA 4RGOS 1I50H 1V8QA 1PZKD 4QB4A 1CKNA 4QIWB 4B3RQ 4DV1Q 3HKZB 1GUWA 1K8OA 3OOCA 1WVLA 3I4MG 4BWGB 4A3KB 1EQTA 1SMYD 4DV2L 4U68A 1YJ9A 2C5CA 3TREA 3HS0C 1Y1VB 4DV3L 4X64Q 2LFNA 3SK8A 4IOAA 1BBWA 3U4VA 3K0XA 1SLJA 4C2MB 2H1EA 4O0AA 2UXBL 2K03A 1DGSA 5IGGA 1WTPA 3EFXD 1STAA 2A8VA 3FEWX 1STGA 3W1BA 2EQSA 2ZT9C 3AMUA 1IW7C 3DLLA 2YTVA 5FLXc 1EY6A 1PH9A 4BBSG 1Q7YC 1DOMA 1B3AA 1XTDA 2BE5C 1E2VA 1X65A 4ZAIA 5BR8L 1GUSA 3DEPA 1TWHH 1L1OA 5M5WH 1K9MC 2E2IB 4C56C 5D65A 4JK1C 5IOCA 1I94Q 2OTLA 3N6RA 4IJLA 4DV4L 4JI4Q 3BZKA 1SYBA 1O78A 1Z7TA 1A0IA 5T1GA 3TP8A 4IUUA 4X66Q 4RG1A 1ZYRC 2HDMA 2IT1A 2JK8A 3J81E 1GVPA 4F88A 2Y0SB 4DR6L 1UEBA 5J22A 2VZAA 1CZGA 1Q81C 1ICWA 4DNTB 3S14H 4DR1Q 1JWMD 3K6OA 2R61A 2Z6KA 1TS5A 5C4JB 1I6VC 4PZ8A 4RA8A 3F2CA 1CKOA 3ICEA 4RKBA 3GO5A 3HOUH 5KNDA 3KBGA 4L5TA 4A3DB 1PRTD 1X9NA 5JJLA 4LUOA 1N32L 4JI1L 1K3BC 1CK1A 3RMHA 3I4NB 4ZUJA 3S1RB 2R7ZH 1B53A 2ZM6Q 1W2BA 1JJ2A 4GKJQ 1GHKA 4DXFA 3A8KE 4O2DA 2L15A 1K83B 4OWXB 3C46A 4JV5L 1BOSA 1EFID 3NBIA 2CHBD 1I6HH 1GO3E 2AHOB 1Y1WH 5M5WB 3T13A 4MZ9A 4OXPA 3QG1A 3CMAA 2IJ0A 3E3XA 3HZXA 5IP7H 4HIDA 5IYDH 5IGDA 1A2UA 3A56A 3MC0B 1YHQA 2IHEA 3BYTB 4UHVA 3LWEA 3CPFA 2PI2A 2PZTA 1SNCA 2FXQA 1IBLL 4IUNA 2ENBA 4NPSA 3OMGA 4RH6A 1CI3M 2NWGA 1OXTA 1JCKB 2I46A 1O7ZA 4DUYQ 4FF4A 4XYQA 1JJCB 3U9SA 5JAVA 1BDOA 4CHTB 3M4OH 1P8LA 3F1ZA 3MZ5A 1IBKL 1DYQA 3RN5A 1U4MA 4JI5L 4A3BG 2ZXOA 2Q2IA 1MD2D 3M9BA 1PTOC 3NENA 1S4ZA 1LLRD 1TS2A 1SR3A 3PO2G 3AYHB 3R93A 4HIOA 3HOWH 4IFDH 5FO8B 2WAQE 1MI2A 2A6EC 3D3RA 2K05A 2LKVA 2A6ED 2QW7A 1II3A 3F8TA 5I2XA 4QQBX 1B70B 4ZUIA 1YNNC 4HTHA 2CKZB 1EU4A 2Q8TA 1YNND 1X55A 3D31A 3IFTA 2JA5H 1TY2A 3FHWA 1I4RA 2JA9A 3ND8A 1HQRD 1R4PB 5DLQE 4N8X1 4H13C 5M5YH 4AYBB 2BCOA 4B3SL 3OHXC 2PNHA 4GLAC 3W1GA 3HOYG 5EAYA 1H9KA 4YY3L 2M00A 3VR4A 1FVIA 1PYWD 1VQPA 4GNXC 3CPWA 1EL0A 2Q8IB 2HIVA 2XGTA 4LMQD 1VQGA 1HZAA 1K8AC 1YHBA 4A76A 2B63H 2EY6A 3NQTA 3CRKC 5T1IA 4GN5A 2XWJB 1WOCA 5CBEE 1XNQL 1JB7A 2B2WA 3GTOB 1STNA 3G6EA 1EYAA 2R92G 4QCLA 1B44D 3KDFA 3NQIA 4G57A 3J80E 1HR0Q 4WJ3M 1Q12A 3PQIA 2K7VA 4YCUA 4C3JH 1O80A 3OWEB 1LUZA 5DNFA 1AW7A 1JB3A 3VR5A 2UU9Q 1LTGD 3GTGH 1F2ZA 1EWHA 1QNKA 1D8LA 1J9OA 2YTXA 5AJ3Q 1A63A 3S17H 3PO3G 4P2CB 4LFCL 5A2QL 1ET6A 3PUVA 4CBVA 1HTLD 5IP9G 2ASBA 3HOZG 2PNRC 4IALA 4IPCA 3HOXH 1Y14B 4KJOA 3CMEA 5CV5A 2JA8H 4IZ8A 2F0HA 1EEID 3M4PA 5K5PA 2ZTCA 2DY8A 3GTKH 2YV5A 4JVZA 4G7HC 4A3EG 4M1UB 4LF7L 3W5OA 3CCUA 3GDEA 1IKLA 1M1KC 3D4RA 2LMCB 4JW0A 4HJ9A 2PO4A 4LF4L 2MUYA 4LF5L 4UP8A 3CC2A 2EYOA 4K5VA 1VQDA 3T1YQ 1UE7A 2CH4W 4OWTB 3SR1A 3S24A 1L0YB 1DOLA 3MFYA 4NXML 4P72A 3H91A 1SE8A 2K5VA 1PDQA 4DV5Q 4HJ5A 1Q1BA 2ZTEA 5GAGC 3L3OC 2CWAA 4Q0FA 5LMUL 2RA4A 4N9TA 2QCPX 4DV2Q 5K36H 4QGUA 2OQ0A 4WJWA 1XX8A 1HXYD 2NN6I 1GUTA 4DV3Q 1F9RA 2ES2A 5DM63 4A3LH 4LF8L 3GD7A 3GTQB 1IXRA 3TSSA 2UXBQ 4ODGA 1D6EC 1CA5A 1AEXA 5LL6S 1B1ZA 2WB1E 3MHBA 5BR8Q 3ZYYX 4KHZA 4NDXA 1S5FD 3QO2A 4ZLTF 2VQFL 2F0EA 3UI2A 3A7AB 4DV4Q 2R7FA 4R8NA 3KDFB 2IW3A 4H02A 2Q8RE 2O4XA 5I9PA 4K14A 4DK6C 4IUTA 3UDFA 2OT2A 3T56B 1GUGA 1HH2P 5CMDA 1SRUA 1Q82C 3MXUA 4H7BA 1T5EA 2VUMH 2HIXA 1WTVA 3F2BA 2ZJRA 5C5LA 1N9WA 3A5ZB 1ENCA 1PZID 2AQ2B 3KF6A 4ME5A 3PIP3 3MXPA 3VR2A 1RODA 4JI1Q 1OXUA 5JVH3 2B2VC 4DR4L 2ZTDA 3A8IE 4IPDA 5EQ0A 3GTJB 1SEBD 3AU7A 4POGA 5J3BA 5IGBA 4K6LA 1V1PA 4JV5Q 1KHIA 1PFBA 3K7AH 4UAIA 1VQ8A 1N33Q 1NR2A 2MO1A 2VY3A 3DUZA 1GUNA 1EFWA 1SYEA 4HEDA 5I6WA 3VR3A 1XYIA 1LTAD 1JR0D 3BU2A 3H3VI 3OIQA 4YWMA 2D9UA 4QUFA 4DR7L 5FLMH 1QVCA 3VYRA 4B3MQ 2K4KA 3O13A 2DNEA 4MHEA 4PZ7A 2EYMA 4DPGA 5KGUA 1IYJB 3VA7A 3NTIA 1IHZA 1IBLQ 5M3MB 2K5QA 4CDDC 3BDCA 3H09A 4X6AH 1EQVA 4X65L 4JI0L 2R93G 5C3WA 2B29A 2JA6H 5M3FH 4KI0A 3BVMA 5FKAC 2PW5A 4L6TB 4JI5Q 1DXMA 1OO9B 1PTOH 2CFMA 3BZCA 2F3WA 4QF4A 4DR2L 1PH4A 1A15A 2G9HD 1A3TA 1XMOL 1NUCA 2HQEA 4BY1G 4Z9CB 2B2TA 1EIYB 3K7AB 2IX1A 5GADC 4A3CG 2SNMA 1SYGA 1U9RA 2E2JH 2MNAA 4A3GG 1R4QB 1Z47A 4Y52H 1CFMA 1ILPA 1SNOA 3BVZA 2K04A 1F77A 4PMWA 2J4XA 4A3FG 5GROA 1JQYD 2CW0C 1J6QA 1KDCA 4KHVA 1S40A 1WCMG 1H9SB 1QB5D 4YCVA 3KLWA 3K58A 5IE8A 5C3EH 2KBNA 1HFNA 4P75A 4KK7A 3S2HB 5FOBB 3NHHA 1D5MC 4H44C 1W3SA 3GTPH 1KNEA 5M5XH 1J8IA 4NW2A 3KF6B 3CXCA 2N8NA 5IT9L 2LY7A 5JJKA 1L1OC 2KECA 3HKZG 5LMNL 4GN3B 3SK4A 1RTNA 4L5SA 1ZXTA 4A3KG 3DHQA 3NPPA 3C3LA 1W6KA 4OHJA 1V1PB 1TS3A 4KD3A 1STHA 2RKSA 4LAAA 4XTCS 3Q22A 4OX9L 3KF8A 4PQXA 2EJMA 5IODA 1HRJA 5ISRA 1Y1VG 4K0KL 5EPJA 3JAMc 4BXXH 4YCWA 3BJUA 1PHJA 3S1NB 2DY7A 3FKIB 4C3HH 1TWFB 3PGZA 4OGQC 1BCPC 4XQNA 3M3YB 4DGZA 3OWFA 1SFOH 4LFCQ 3S2DH 3QIAA 1G8ZD 1DM0B 1K3RA 2QEJC 4BBRH 1RKNA 5C3EB 3EQLC 2PYKA 1FNWA 4JCVE 3CQZH 4PV1C 1G51A 5KYIA 4X3SA 5DM73 3P1HA 4JG2A 1JC7A 2K5WA 1YNJD 3EJIA 4O1NA 1CZWA 2F0DA 2MPMA 3PIOA 4GN4B 2Y0SG 4RGTA 4A3IH 2TMPA 1IBML 4LK1C 3S15B 1I3QH 1B3QA 1WTWA 3I72A 4LF4Q 3RZDH 4LF5Q 3PUXA 1XMQL 1N36L 1ML0D 4POFA 4R4TA 1PMRA 4NXMQ 1DD2A 2AMCB 1PYBA 3JAMi 4A3DG 1MKHA 1N34L 3C1FA 5IGFA 5G3LF 3I4NG 5JPMC 2G5DA 2OCEA 5LMUQ 1HA6A 5KRUA 3TQYA 1ONLA 2F0OA 4I65A 1PLFA 3D8GA 2CVRA 3VYUA 1V1OA 4FF1A 4KN4C 2BOSA 5C44H 1PH5A 4PG3A 1STEA 3QB3A 4O42A 2VXWA 3CQZB 3MAQA 2A1AA 5HGQA 1HR0W 1YJWA 5M9OA 3NWSA 4CDCC 3TZDA 2PW7A 2EJFC 2EVBA 1VQIA 1PH8A 4HIKA 1YI2A 3C1EA 4CDFC 5HURA 3I90A 1A3VA 1MHWC 3VDYA 5JEAH 3U9OA 2UUCL 3F2UA 2VQFQ 4A93H 1BVSA 3TS0A 5KIXA 2WAQB 1V9PA 5JVG3 1EQQA 1LT4D 1XNRL 3BZDB 3UE0A 4JI6L 1VQEA 1PH3A 1LTSD 4JBKA 2NVQB 2EOTA 4LW1A 4J6HA 1D5XC 1JICA 1EY0A 2KOLA 4BY7B 1LYLA 1FL0A 2EY1A 3FP9A 1ZKOA 4A4IA 1SMYC 1X3FA 4X3UA 2F03A 2UXCQ 1AH9A 2JA7B 3NSWA 2P5ZX 4OELB 3M85A 4B3TL 2DJGC 3PUYA 4DA2A 1AZQA 5IYBG 2F4VL 4L5RC 3JAML 2M9VA 2N78A 4DR4Q 1NNXA 1HCZA 1ENFA 2K1BA 4P73A 2EZVA 1U0LA 2HHHL 4HCEA 2KENA 4K2LA 2PQEA 3GTMH 1I4PA 1ZEQX 4AYBG 2R7DA 3U4ZA 4CGYB 3PCOB 3FMCA 2GVAA 1SYDA 1XTCD 1C0AA 3RZOB 1RIPA 1W6JA 4DR7Q 1J5EQ 4KHPL 3QWNA 2E74C 2EXZA 4DV0L 1D7QA 1I50B 4YWKA 4XXEA 3CP0A 4GOPA 1F2MA 4ME3A 4X65Q 4DAYB 3J7YW 3J7ZC 5C0XH 3D0FA 1A3UA 2L0CA 4JYAQ 4OL7A 4DXGA 2IX3A 3UDGA 4IO9A 3R3OA 3I4OA 3PMFA 5BN5A 2RCNA 3OMCA 4KV6A 1HZBA 3A7LA 2F3IA 1TS4A 3OTOQ 1SJED 1IZ6A 4NXNL 1PRTC 1EY4A 5KNBA 2UXDQ 2L9HA 5CBAE 3HOVH 1XMOQ 1L0XB 2Z1CA 1FJGL 2R3ZA 2VQEL 1Q1EA 3I70A 4ZCKA 3CKIB 4UDUC 4A3MG 4FXKC 4AQYL 1G91A 2OF1A 1XPUA 4IFDJ 4ZK9B 1TWHB 3B6YA 1B7YB 4RGMA 1S5DD 2MO0A 3TN2A 4MN3A 4UPAA 2FINB 1QZHA 2F4IA 1I5FA 1YNXA 2AUJD 4XDXA 5HGTA 5EJWA 5DAUA 1B8AA 3CCEA 2AUKA 3A55A 1B9MA 2JE6I 3RN2A 3I4MH 3STBD 3S14B 2B39A 3HRZC 5I2YA 5KEEA 5LMNQ 5COYA 3J81c 2KHSA 1EQRA 1CHPD 1OTCA 2F3VA 1I4XA 3HOUB 3HP3A 1GKHA 2IHFA 2H4OA 2N88A 3L9AX 1MSGA 2NN6G 4JOIA 1EOVA 1HJPA 2WB1B 1BKBA 4OX9Q 5EBDA 4ZRZA 4K0KQ 2R7ZB 2Z4HA 3T53B 2BDNA 3KLSA 4ID6A 3KJOA 1SYCA 5E4WC 5CV7A 3R2IA 4IUPA 1VF7A 3V96A 1BO0A 1U5KA 4BBSH 3S1QH 3W3AA 1SROA 3SHLA 3CD6A 1I6HB 2KVMA 3FRPB 1Y1WB 1DZ1A 1SNQA 1L0WA 3IRBA 3V2TA 5EKIA 1E24A 1E0BA 3A74A 3AQQA 4GOPB 1LT5D 3AFPA 4DK3C 4DV6Q 4R8IA 2PCFB 1RJTA 1LTBD 1HUNA 3RD4A 1C9OA 2KCMA 3H0GG 1I4HA 5FLXL 4C3IG 4LJZC 1VDZA 2A74C 4RGNA 3DWAA 2C9OA 2K5NA 1NJIC 3J81i 2NTTA 5D3IB 4DN4M 3KOJA 2GA4B 3Q8DA 4K5WA 3K7UC 2K52A 3M4OB 2CWPA 5CORA 4ULLA 3HKZE 4QUCA 5IGEA 1XMQQ 3TRZA 1N36Q 3IKJA 4YIJA 1YIJA 1VQLA 4LNQA 1PTOF 2B2UA 2K75A 3RR5A 2QDBA 2K32A 4ZKCB 2AQ3B 1N34Q 3HOWB 3WWVA 2MGSA 4BBSB 2E8GA 1YVCA 4ILWA 4AIMA 3CCVA 2ZXRA 4R4IA 5JOBA 4IFDI 4LF9L 1BBUA 1MBYA 1UE6A 3S9WA 3PV0A 1SNMA 3NBHA 3K5NA 2NBFA 2RQXA 1HNXL 3CCSA 5ELOA 2JA5B 5I9OA 1YBYA 3MA2B 5ELBA 3K5OA 3T1HL 2NZOA 5M5YB 2SDFA 1IYVA 2K5HA 4B9WA 4K2KA 4QL5A 4EQPA 4FVMA 2RDHA 4KY5A 3I3CA 3TP7A 5M3MG 1CQFA 3BG3A 2RBMA 2A6HD 3WDNA 4JI2L 2DGYA 2B63B 4A3BH 2Y0SE 1XNRQ 2N55A 4BA1I 4JI6Q 2QDLA 1WD1A 2BH8A 4J1MA 1KIXA 3PO2H 3TS2A 1LV9A 4KKSA 4EVOA 1X3QA 1NMGA 4H0LC 5EKKA 1EU3A 2A68D 1QJOA 2DN8A 2JSOA 4C3JB 3J81L 4ZKBB 5BN3A 4A3JG 1FGBD 2KCNA 3HFZB 5TSSA 4WFN3 3GTGB 3PUZA 3J80c 2JXMB 1QILA 3S17B 4B3TQ 2YU9H 3RLFA 2F4VQ 4OIKA 3HOXB 4GS3A 1AP0A 2F0PA 2OXPA 1WTOA 5IY0A 1KC8C 1CKMA 2EY2A 2JA8B 3HOYH 2E2HH 2F52A 4EX5A 1LTID 4DAVA 3PIO3 4IJHA 4PMCA 3GTKB 4KKTA 2RDFA 1C8CA 4OIJA 5A35A 4DUZL 2HCCA 2NUCA 4NKLA 2CCZA 1KRTA 1WJJA 4JI7L 1STYA 2F0IA 3I91A 5ELNA 2Q2TA 3IL8A 1HNZL 2I5MX 1CA6A 4KHPQ 2Z6BA 1Q8KA 2FHTA 2ZXPA 4DV0Q 2R92H 4OO1H 1VQBA 1DONA 3GQBA 1G2TA 1KLUD 1KABA 1WTRA 1PV4A 4HSVA 3NBHB 1QNUA 2N3SA 4C1NI 3F2DA 1H9SA 2X6GA 4HJ7A 4DR6Q 1SSOA 4HN7A 2KEDA 1H9MA 4HAEA 3J80i 5IWAL 1LTTD 2V1CC 2EY5A 1HQMC 2Z8LA 5IP9H 3FKIG 3HOZH 1UE1A 5GQOA 4NXNQ 3ULJA 1F9QA 2E2HB 2HD3A 2TSSA 1N32Q 2XIWA 1FJGQ 5I6YA 4HIMA 5C3EG 2CQAA 1E3PA 1GD7A 5LHY1 1PFNA 4A3EH 1GM5A 5J39A 3PF5A 1HFGA 4DV7L 3S1MH 4RKLA 1O7LA 4ALPA 1XWEA 1TVXA 1X6OA 1SE3A 4QMGA 4OEMB 4YHHL 1TQOA 4CDEC 2I5LX 2K6AA 4OO1I 5D3DA 4FF2A 2CH4A 2B2YC 1YEZA 2H5XA 2VUMB 1GOZA 3L2PA 4BXXG 1FYCA 1L2FA 3HKSA 3VA5A 4XQJA 1HA5A 4KKUA 4BA2I 3NTHA 5C3XA 2KA7A 1K0SA 1TT2A 2EYJA 4MTKA 3A8JE 3P75A 4JBWA 2D0PA 1IBKQ 2I5HA 4TSSA 3IAYA 1JOKA 2VS1A 4A3EB 3I73A 2PI2E 1B9NA 4L8JA 3P7JA 4G7OC 1PVOA 3J80L 4QY7A 1NBWA 3H94A 4FYDA 2KCCA 3RLOA 5E1FA 4DR1L 1BNZA 1RTOA 4RCNA 3CCMA 2UUBL 1SBBB 1UEAB 2N49A 3CCRA 5E3FA 3G6JB 4HJ8A 5FJ8G 3ULPA 1WTQA 3AFQA 4DNIA 2WAQG 3MXGA 1QVFA 4PMBA 2RSOA 2DUDA 3D6WA 2JN4A 4B3SQ 2K28A 3KK7A 1EIHA 4YY3Q 2NYZD 4XQQA 1D2BA 2JA6B 2EIFA 5M3FB 2RDGA 2I07B 4BY7G 1B50A 2Q2UA 3ITPA 2RVLA 2XWBB 2F0TA 4F87A 5IYCG 1PTOB 1QG7A 1CQVA 1UWVA 4RFBA 1QCBD 2JA7G 4R9WA 1XNQQ 1JE5A 2HDLA 2EYHA 4HJAA 5JJZA 2Z0SA 4JBMA 1X3PA 1E2WA 2NB0A 3C2PA 4OWWB 4FDBA 2F0SA 4MTNA 4L5QA 5LMNW 3T4AC 2E2JB 2K50A 1TWGH 2EXDA 2Z6KC 1M4VA 1EYDA 3LGJA 2G9DA 2E5LL 3WOFA 1HNXQ 3KFUA 4TRDA 2MJ8A 1E22A 2JEAI 2NTSA 1ICFB 5LL6X 3I55A 3K59A 1TWAH 3T1HQ 3H6MA 3L7ZC 2HCIA 1AFPA 5C5MA 3BVGA 3D4WA 2E2DC 2F0QA 3GTPB 3SE0A 2EYPA 2WIIB 4GNXB 2R93H 1YNJC 3MEHA 1U4RA 5M5XB 2UUAL 3QOJA 3J7A5 1X3GA 1E1TA 1NTGA 1TWCH 5G3LD 4LF7Q 2KJXA 4GKKL 5EPKA 2FJ2A 3FPUB 3GTLH 4IUQA 2A73B 3HG9A 2OQKA 1G291 5JEAJ 2ICIA 3CC4A 2PQAB 5EBCA 2I0QA 4KLKA 1YZ6A 1PH2A 4BY1H 1VQNA 1VMPA 1BBXC 1JMCA 1BUVT 4A3CH 2BA0A 2K01A 5CYUA 1OXSC 1GXDC 2RCFA 1SXTA 4A3GH 2D2CC 2IWHA 3EBEA 1CSQA 1V43A 2MHVA 4C3HB 1BCPF 2PMZE 4A3FH 1XPRA 4WRDA 4BS9A 4C1NK 3MXNA 1SFOB 4NP5A 1WCMH 3S2DB 3TZUA 4DAYA 1K8GA 4BBRB 3NTKA 2HT1A 5FO7B 4LF8Q 2K5DA 1D1IA 3SVMA 4IUVA 1HR0L 1KTKA 1EWCA 4LFBL 1KL9A 5E4XA 2MP1A 3KJPA 2LS01 4A3IB 3ONAB 1VMCA 5CV9A 3CRLC 1U4PA 1I3QB 3DEOA 1FNUA 1EWIA 3FDTA 5FO9B 1GHJA 4A3KH 3OIPA 2FMMA 5C6AA 1HNZQ 5AJ3L 3RZDB 2HUGA 4DU9A 4XYOA 2F0GA 3EIVA 4KN7C 3GV6A 3HOUG 1JJGA 2F0FA 4NMZA 2RHSB 2F1MA 1Q8IA 2WB1G 4C2MH 1E1OA 1A6XA 1VQ7A 2RSNA 1MIUA 5C4ZA 2R7ZG 4PZ6A 1JWSD 1O7IA 3MWYW 1JOQA 4DKAC 1SNPA 1AZPA 3W2DA 4R4QA 1HZCA 2YTYA 4S3SA 3L0OA 3A54A 1GUOA 1I4QA 1S5CD 5C0XJ 5C44B 3T16A 1Y1WG 3CF5A 3PUWA 1QWYA 2B2WC 5NUCA 2E2IH 5IP7G 3EA6A 5IYDG 1EIGA 2VB3X 3T1YL 1HHVA 1KDAA 4JBJA 2B8GA 2JEBI 1QOHA 1JOOA 1KAAA 4RWSC 4Y7NH 1VQ4A 2KEEA 4DV5L 4DV7Q 2VW9A 3I4LA 2E76C 2K33A 1TU2B 1CT1D 2KQ3A 4A93B 4WJ4A 3EROA 1PXUA 5C4JH 4YHHQ 1VQOA 1U4LA 4FP5D 1EZ6A 5A2QE 2AKWB 4HSPA 2WV6D 3BDLA 3J7AV 4A3DH
chains in the Genus database with same CATH topology
3HKZE 3TRZA 1XMQQ 1N36Q 1VQ5A 1N9WA 1UE5A 3A5ZB 1YIJA 1VQLA 3OYYA 4LNQA 3I4NH 2K75A 5C4XH 3S1RH 3RR5A 3KF6A 3MXNB 1ASYA 5HY6A 4JI2Q 3A5UA 1N34Q 4JI0Q 2B3GA 3K81C 3AEVA 3HOWG 3WWVA 4IFDG 4JI1Q 1K83H 1OXUA 2E8GA 1YVCA 3CCVA 4AIMA 4DR4L 1G6PA 1NMFA 2ZTDA 4R4IA 1VQ9A 4IPDA 4IFDI 4POGA 2WP8J 1VQCA 4LF9L 5J3BA 4DV6L 3UDXA 1BBUA 1UE6A 2RF4A 3PV0A 1JT8A 4RMFA 4JV5Q 1HNXL 4UP9A 1KHIA 1AE3A 3CCSA 3K7AH 1SN8A 1V1QA 5ELOA 4DR2Q 2MO1A 1VQ8A 1N33Q 2C35B 2VY3A 1LTLA 4LUZA 2IY5B 1EFWA 1TXYA 2JA5G 4P71A 4XIGS 3BU2A 1YBYA 3H3VI 1KRSA 3G48A 4YWMA 2NZOA 3EN2A 3T1HL 5FJ8H 2K5HA 1VQMA 4DR7L 2AWNA 4QL5A 5FLMH 1QVCA 4B3MQ 2K4KA 4JOIC 2UUBQ 4PZ7A 4DPGA 3I56A 3SGIA 1IYJB 1C7YA 1IBLQ 2ZJPA 4J15A 5M3MG 1K73C 4JI2L 4A3DH 4TVAB 4X6AH 4X65L 4JI0L 2DGYA 2R93G 2K14A 4GLVB 2B63G 2NVQH 4A3BH 2Y0SE 2B29A 1XNRQ 2JA6H 4BA1I 4KI0A 5M3FH 4JI6Q 5C4XG 3JC66 4JI3Q 4DUZQ 4BY7H 2BH8A 1KIXA 3PO2H 3TS2A 4IOCA 2UU9L 4JI5Q 3STBC 5C0XG 2NVTH 4JI7Q 5IYCH 1NMGA 4IPHA 2CFMA 2MQHA 2QEXA 2JA7H 3MEFA 3BZCA 4DR2L 1N33L 5C0XI 2ALYB 2ATWA 1PH4A 4UY8C 1XMOL 4A3JG 3HFZB 5IYBH 4BY1G 3PUZA 1LM0A 1CKNB 1Y1VH 3J80c 1PH7A 1EIYB 2IX0A 5GADC 3J81j 2JJQA 2IX1A 1NY4A 4A3CG 3KYHC 4B3ML 4B3TQ 2E2JH 2MNAA 2YU9H 4A3GG 4Y52H 1Z47A 3HOVG 3PIPA 3RLFA 2KCTA 2F4VQ 5E7NA 3NELA 4PMWA 2BH2A 4GS3A 3HOXG 4A3FG 1KC8C 5IY0A 1CKMA 5GROA 5IWAQ 3HOYH 2JA8G 1J6QA 1VS0A 2E2HH 2F52A 4EX5A 1S40A 1WCMG 4IJHA 2QA4A 3KF8B 1EYGA 1HNWL 1YHAA 2E5LQ 4YCVA 3KLWA 5IE8A 3RZOH 2R6GA 3G4SA 5C3EH 4QJFA 2KBNA 4P75A 2OTJA 3H15A 4DUZL 4LFAQ 2CCZA 1W3SA 1KRTA 3I2ZA 3GTPH 1WJJA 4JI7L 1I50H 1Z9FA 5M5XH 3A0JA 5ELNA 1CKNA 3KF6B 3CXCA 2Q2TA 2N8NA 4B3RQ 4DV1Q 1HNZL 1RL2A 5JJKA 2I5MX 1YITA 4KHPQ 1L1OC 1Q8KA 3HKZG 4AH6A 5LMNL 4GN3B 3GTOH 4DR5L 4DV0Q 2R92H 4EQ5A 4L5SA 1VQBA 1QZGA 2UUAQ 3I4MG 4X62L 4A3KG 1L1OB 1XPOA 4DV2L 1YJ9A 1PV4A 3NBHB 4GKKQ 3F2DA 2N3SA 4XTCS 4OX9L 4HJ7A 4DR6Q 3TREA 1IBMQ 1VQKA 4LF6L 4DV3L 1Y1VG 4K0KL 3UDIA 4X64Q 4QIWE 3JAMc 4BXXH 1ASZA 3J80i 5IWAL 4YCWA 5K36G 2V1CC 4IOAA 1BBWA 3BJUA 3K0XA 3U4VA 1SLJA 1PHJA 4O0AA 1A62A 5IP9H 2UXBL 3FKIG 4C3HH 1DGSA 3HOZH 3PGZA 1UE1A 5GQOA 4NXNQ 2MFIA 3ULJA 2A8VA 1WFQA 2EQSA 3W1BA 4DR3L 4A3LG 3NEMA 3DLLA 1N32Q 2YTVA 5FLXc 1SFOH 4A3MH 4LFCQ 3S2DH 4YWLA 1PH9A 4BBSG 1Q7YC 5BR8L 1FJGQ 1XTDA 1K3RA 1X65A 4BBRH 4HIMA 1QUQA 5C3EG 1E3PA 1GD7A 1TWHH 1L1OA 4A3EH 1GM5A 4JI8L 5M5WH 1K9MC 3PF5A 2RHQB 4JCVE 1I94Q 4DAMA 3CQZH 1WI5A 2OTLA 4DV4L 1G51A 4IJLA 4DV7L 1PH6A 3S1MH 1EUJA 2LSSA 4JI4Q 3ULLA 4JG2A 3BZKA 2D0OA 1OXVA 1IL2A 4X66Q 1A0IA 1FGUA 4ALPA 4RG1A 1X6OA 2IT1A 2JK8A 1S72A 1Q46A 1GVPA 4YHHL 3PIOA 4OO1G 4GN4B 2Y0SG 4DR6L 1UEBA 4A3IH 1IBML 2I5LX 2VZAA 1Q81C 1E7ZA 1I3QH 3S14H 4LFBQ 4DR1Q 4OO1I 4LF4Q 2XTIA 2Z6KA 3RZDH 4LF5Q 3PUXA 1XMQL 1N36L 2VNUD 4PZ8A 4POFA 1YEZA 2H5XA 2VUMG 3F2CA 1CKOA 4R4TA 3L2PA 3ICEA 3GO5A 3HOUH 4NXMQ 3PSIA 1L2FA 4BXXG 1PFSA 4L5TA 2AMCB 1PYBA 3JAMi 1Q86C 1M90C 3HKSA 2UUCQ 4A3DG 1MKHA 4TQUS 1X9NA 4LUOA 1N34L 1N32L 5JJLA 4JI1L 4BA2I 3I4NG 2R7ZH 1T9HA 2OCEA 2ZM6Q 5LMUQ 1W2BA 1JJ2A 4GKJQ 1CUKA 4JBWA 2D0PA 1IBKQ 3TQYA 3U50C 4O2DA 2L15A 2AWOA 1N8RC 2I5HA 4OWXB 3GTQH 2QGQA 4JV5L 1VQ6A 3TEHB 1I6HH 1GO3E 2VS1A 5C44H 2AHOB 3ERSX 4PG3A 1Y1WH 2PI2E 1PH5A 4MZ9A 4OXPA 3CMAA 1PVOA 2A1AA 5HGQA 5IP7H 4HIDA 1HR0W 1YHQA 5IYDH 1S3OA 4QY7A 1YJWA 2IHEA 1NBWA 3RLOA 1H95A 4DR1L 3CPFA 1VQIA 1PH8A 2PI2A 3CCMA 4HIKA 2JQOA 2UUBL 1YI2A 2N49A 3DM3A 3CCRA 2FXQA 1IBLL 4HJ8A 5FJ8G 3VDYA 4NPSA 3ULPA 3H0GH 5FLMG 2UUCL 2VQFQ 4A93H 1BVSA 4C3IH 3TS0A 2HHHQ 3AFQA 1OXTA 4DNIA 2WAQG 1V9PA 4DUYQ 1EQQA 1QVFA 1XNRL 1KXLA 1JJCB 4R1JA 3UE0A 4JI6L 2DUDA 4B3SQ 2A19A 1VQEA 1WYDA 3M4OH 1P8LA 3F1ZA 4JI3L 3CCQA 1IBKL 4YY3Q 1PH3A 2LXKA 3RN5A 4JBKA 3CW2C 4JI5L 2CQOA 4A3BG 2JA6G 2EIFA 4LW1A 2Q2IA 5M3FG 3M9BA 1NE3A 3NENA 1LYLA 4BY7G 1FL0A 1SR3A 4R4CA 3PO2G 2Q2UA 3FP9A 3AYHB 4HIOA 3HOWH 2WAQE 4A4IA 5IYCG 1X3FA 2UXCQ 1AH9A 1QUQB 1UWVA 2JA7G 1AE2A 1JE5A 3M85A 3GTJH 1XNQQ 3S16H 4HJAA 4B3TL 2Z0SA 3F8TA 4JBMA 3PUYA 4QQBX 5IYBG 2F4VL 4L5RC 1PH1A 2N78A 1B70B 4DR4Q 4OWWB 4FDBA 4MTNA 5LMNW 4L5QA 3H3VH 2CKZB 4P73A 2NZHA 2LXJA 2K50A 3PO3H 1TWGH 1U0LA 2EXDA 5GAHC 1X55A 3D31A 2KENA 5IT9c 2Z6KC 2HHHL 3FHWA 3LGJA 2JA9A 2JA5H 2E5LL 3KFUA 1HNXQ 5DLQE 5M5YH 3GTMH 4AYBG 2R7DA 3RNUA 4B3SL 3W1GA 2PNHA 4GLAC 3U4ZA 1KD1C 1E22A 3HOYG 5EAYA 3PCOB 4YY3L 3U58A 2JEAI 1FVIA 1K0RA 2GVAA 4LFAL 3I55A 3CC7A 1C0AA 1TWAH 3T1HQ 3L7ZC 2VQEQ 1VQPA 4GNXC 3CPWA 5M3MH 1RIPA 2HIVA 1XJVA 4DR7Q 4NB3A 1J5EQ 4DV1L 4B3RL 4KHPL 2XGTA 1VQGA 1EIFA 1HZAA 1K8AC 4DV0L 1YHBA 4A76A 4GNXB 2B63H 2R93H 1D7QA 4AQYQ 4YWKA 5JJIA 2UUAL 3J7A5 2UXCL 4GN5A 3CP0A 4AYBE 1X3GA 4GOPA 1WOCA 1E1TA 1XNQL 1JB7A 1NTGA 1TWCH 4LF7Q 4ME3A 1VQFA 3G6EA 4GKKL 4X65Q 3RLNA 1P16A 4DAYB 3G71A 2R92G 3J7ZC 3D0FA 2KHJA 4JYAQ 4APVA 3KDFA 1HR0Q 4X64L 3GTLH 4WJ3M 1Q12A 3UDGA 2OQKA 4IO9A 1G291 3I4OA 4YCUA 1X56A 2RCNA 4C3JH 1HZBA 5JEAJ 1LUZA 2NVYH 2F3IA 2PQAB 2UU9Q 3CCJA 1X54A 4KLKA 4A3JH 2I0QA 3CC4A 1YZ6A 2HQLA 3OTOQ 1PH2A 1MJEA 4BY1H 1VQNA 3GTGH 1JMCA 2OWOA 4A3CH 1IZ6A 4NXNL 3CAMA 1D8LA 1KQSA 2BA0A 2YTXA 5AJ3Q 2WFWA 1A63A 1OXSC 3PO3G 3S17H 2UXDQ 4A3GH 3OW2A 2VL6A 4LFCL 3HOVH 1XMOQ 3EBEA 1CSQA 3PUVA 1V43A 4GNXA 5IP9G 1FJGL 4LWCA 2PMZE 4P74A 2ASBA 3HOXH 3E0EA 4IPCA 2VQEL 1Y14B 4A3FH 1XPRA 3HOZG 3CMEA 1Q1EA 2JA8H 1J5EL 3M4PA 1SMXA 1I94L 1WCMH 2ZTCA 4A3MG 3GTKH 4AQYL 4JI4L 1K8GA 1XPUA 4IFDJ 3ER0A 4BBRG 2GVBA 2YV5A 3E9HA 4X66L 2HT1A 4A3EG 3S2HH 4LF8Q 4LF7L 3W5OA 1HNWQ 3B6YA 1B7YB 2PQAA 3CCUA 2ID0A 3GDEA 2MO0A 4OONA 2BA1A 4JYAL 1M1KC 3K80C 4UPAA 1HR0L 1QZHA 4LFBL 4HJ9A 4A75A 1I5FA 1YNXA 1KL9A 4LF4L 1X3EA 4LF5L 4UP8A 3CC2A 3KJPA 1B8AA 3CCEA 4A3IG 2JE6I 1VQDA 2D62A 3OTOL 1UE7A 3T1YQ 4OWTB 3RN2A 3I4MH 3S24A 3STBD 1EWIA 4UP7A 5GAEC 4P72A 4A3KH 4NXML 1HNZQ 4LUVA 5AJ3L 3PF4A 1SE8A 2UXDL 5LMNQ 2K5VA 3J81c 4DR5Q 1EQRA 4DV5Q 1OTCA 2ZJQA 4HJ5A 4R4OA 1Q1BA 2YYZA 2ZTEA 5GAGC 2CWAA 3EIVA 4X62Q 2NVXH 2ZM6L 1VQHA 1GKHA 2IHFA 5LMUL 3HOUG 4GKJL 1JJGA 4DV2Q 2NN6G 3UE1A 4JOIA 2RHSB 1EOVA 1HJPA 2WB1G 4QGUA 2OQ0A 1BKBA 1CSPA 4MNOA 4C2MH 4OX9Q 1E1OA 3S1NH 1VQ7A 2NN6I 1MIUA 3FKIH 4LF6Q 4DV3Q 4K0KQ 2R7ZG 4PZ6A 1TWFH 1VQAA 1O7IA 2ES2A 3KJOA 4A3LH 4DKAC 3M3YH 5H1SE 4LF8L 2GN5A 3GD7A 4R4QA 1HZCA 1U5KA 1IXRA 2YTYA 3L0OA 1QVGA 3S1QH 4BBSH 1SROA 2UXBQ 3CD6A 4GLXA 1HZ9A 1KAWA 5C0XJ 5C44G 4DR3Q 3CF5A 4GOPC 3PUWA 1Y1WG 3ZJYC 2E2IH 2WB1E 1PYSB 1L0WA 3IRBA 5IP7G 5IYDG 1E24A 3I7FA 5BR8Q 1A8VA 1VQJA 4KHZA 3A74A 3AQQA 3T1YL 4GOPB 3CCLA 1R9TH 3AFPA 4JBJA 1VCIA 4DK3C 4LF9Q 2JEBI 4JI8Q 4DV6Q 2VQFL 1MJCA 2Q2HA 4Y7NH 1VQ4A 4DV4Q 2KHIA 2R7FA 4DV5L 4DUYL 2VW9A 4DV7Q 3KDFB 1C9OA 4H02A 5JEAG 3S15H 2KCMA 3H0GG 3K8AA 4DK6C 4A93G 4WJ4A 1OXXK 3E9IA 3UDFA 5C4JH 4IPGA 4YHHQ 1VQOA 2K5NA 1HH2P 1NJIC 4JC0A 1SRUA 3M4QA 3J81i 1Q82C 3M7NA 3KOJA 3Q8DA 1PA6A 2AKWB 2VUMH 3K7UC 2K52A 2HIXA 2CWPA 1YJNA 3F2BA 2ZJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ E;  3TRZ A;  1XMQ Q;  1N36 Q;  1VQ5 A;  1N9W A;  1UE5 A;  3A5Z B;  1YIJ A;  1VQL A;  3OYY A;  4LNQ A;  3I4N H;  2K75 A;  5C4X H;  3S1R H;  3RR5 A;  3KF6 A;  3MXN B;  1ASY A;  5HY6 A;  4JI2 Q;  3A5U A;  1N34 Q;  4JI0 Q;  2B3G A;  3K81 C;  3AEV A;  3HOW G;  3WWV A;  4IFD G;  4JI1 Q;  1K83 H;  1OXU A;  2E8G A;  1YVC A;  3CCV A;  4AIM A;  4DR4 L;  1G6P A;  1NMF A;  2ZTD A;  4R4I A;  1VQ9 A;  4IPD A;  4IFD I;  4POG A;  2WP8 J;  1VQC A;  4LF9 L;  5J3B A;  4DV6 L;  3UDX A;  1BBU A;  1UE6 A;  2RF4 A;  3PV0 A;  1JT8 A;  4RMF A;  4JV5 Q;  1HNX L;  4UP9 A;  1KHI A;  1AE3 A;  3CCS A;  3K7A H;  1SN8 A;  1V1Q A;  5ELO A;  4DR2 Q;  2MO1 A;  1VQ8 A;  1N33 Q;  2C35 B;  2VY3 A;  1LTL A;  4LUZ A;  2IY5 B;  1EFW A;  1TXY A;  2JA5 G;  4P71 A;  4XIG S;  3BU2 A;  1YBY A;  3H3V I;  1KRS A;  3G48 A;  4YWM A;  2NZO A;  3EN2 A;  3T1H L;  5FJ8 H;  2K5H A;  1VQM A;  4DR7 L;  2AWN A;  4QL5 A;  5FLM H;  1QVC A;  4B3M Q;  2K4K A;  4JOI C;  2UUB Q;  4PZ7 A;  4DPG A;  3I56 A;  3SGI A;  1IYJ B;  1C7Y A;  1IBL Q;  2ZJP A;  4J15 A;  5M3M G;  1K73 C;  4JI2 L;  4A3D H;  4TVA B;  4X6A H;  4X65 L;  4JI0 L;  2DGY A;  2R93 G;  2K14 A;  4GLV B;  2B63 G;  2NVQ H;  4A3B H;  2Y0S E;  2B29 A;  1XNR Q;  2JA6 H;  4BA1 I;  4KI0 A;  5M3F H;  4JI6 Q;  5C4X G;  3JC6 6;  4JI3 Q;  4DUZ Q;  4BY7 H;  2BH8 A;  1KIX A;  3PO2 H;  3TS2 A;  4IOC A;  2UU9 L;  4JI5 Q;  3STB C;  5C0X G;  2NVT H;  4JI7 Q;  5IYC H;  1NMG A;  4IPH A;  2CFM A;  2MQH A;  2QEX A;  2JA7 H;  3MEF A;  3BZC A;  4DR2 L;  1N33 L;  5C0X I;  2ALY B;  2ATW A;  1PH4 A;  4UY8 C;  1XMO L;  4A3J G;  3HFZ B;  5IYB H;  4BY1 G;  3PUZ A;  1LM0 A;  1CKN B;  1Y1V H;  3J80 c;  1PH7 A;  1EIY B;  2IX0 A;  5GAD C;  3J81 j;  2JJQ A;  2IX1 A;  1NY4 A;  4A3C G;  3KYH C;  4B3M L;  4B3T Q;  2E2J H;  2MNA A;  2YU9 H;  4A3G G;  4Y52 H;  1Z47 A;  3HOV G;  3PIP A;  3RLF A;  2KCT A;  2F4V Q;  5E7N A;  3NEL A;  4PMW A;  2BH2 A;  4GS3 A;  3HOX G;  4A3F G;  1KC8 C;  5IY0 A;  1CKM A;  5GRO A;  5IWA Q;  3HOY H;  2JA8 G;  1J6Q A;  1VS0 A;  2E2H H;  2F52 A;  4EX5 A;  1S40 A;  1WCM G;  4IJH A;  2QA4 A;  3KF8 B;  1EYG A;  1HNW L;  1YHA A;  2E5L Q;  4YCV A;  3KLW A;  5IE8 A;  3RZO H;  2R6G A;  3G4S A;  5C3E H;  4QJF A;  2KBN A;  4P75 A;  2OTJ A;  3H15 A;  4DUZ L;  4LFA Q;  2CCZ A;  1W3S A;  1KRT A;  3I2Z A;  3GTP H;  1WJJ A;  4JI7 L;  1I50 H;  1Z9F A;  5M5X H;  3A0J A;  5ELN A;  1CKN A;  3KF6 B;  3CXC A;  2Q2T A;  2N8N A;  4B3R Q;  4DV1 Q;  1HNZ L;  1RL2 A;  5JJK A;  2I5M X;  1YIT A;  4KHP Q;  1L1O C;  1Q8K A;  3HKZ G;  4AH6 A;  5LMN L;  4GN3 B;  3GTO H;  4DR5 L;  4DV0 Q;  2R92 H;  4EQ5 A;  4L5S A;  1VQB A;  1QZG A;  2UUA Q;  3I4M G;  4X62 L;  4A3K G;  1L1O B;  1XPO A;  4DV2 L;  1YJ9 A;  1PV4 A;  3NBH B;  4GKK Q;  3F2D A;  2N3S A;  4XTC S;  4OX9 L;  4HJ7 A;  4DR6 Q;  3TRE A;  1IBM Q;  1VQK A;  4LF6 L;  4DV3 L;  1Y1V G;  4K0K L;  3UDI A;  4X64 Q;  4QIW E;  3JAM c;  4BXX H;  1ASZ A;  3J80 i;  5IWA L;  4YCW A;  5K36 G;  2V1C C;  4IOA A;  1BBW A;  3BJU A;  3K0X A;  3U4V A;  1SLJ A;  1PHJ A;  4O0A A;  1A62 A;  5IP9 H;  2UXB L;  3FKI G;  4C3H H;  1DGS A;  3HOZ H;  3PGZ A;  1UE1 A;  5GQO A;  4NXN Q;  2MFI A;  3ULJ A;  2A8V A;  1WFQ A;  2EQS A;  3W1B A;  4DR3 L;  4A3L G;  3NEM A;  3DLL A;  1N32 Q;  2YTV A;  5FLX c;  1SFO H;  4A3M H;  4LFC Q;  3S2D H;  4YWL A;  1PH9 A;  4BBS G;  1Q7Y C;  5BR8 L;  1FJG Q;  1XTD A;  1K3R A;  1X65 A;  4BBR H;  4HIM A;  1QUQ A;  5C3E G;  1E3P A;  1GD7 A;  1TWH H;  1L1O A;  4A3E H;  1GM5 A;  4JI8 L;  5M5W H;  1K9M C;  3PF5 A;  2RHQ B;  4JCV E;  1I94 Q;  4DAM A;  3CQZ H;  1WI5 A;  2OTL A;  4DV4 L;  1G51 A;  4IJL A;  4DV7 L;  1PH6 A;  3S1M H;  1EUJ A;  2LSS A;  4JI4 Q;  3ULL A;  4JG2 A;  3BZK A;  2D0O A;  1OXV A;  1IL2 A;  4X66 Q;  1A0I A;  1FGU A;  4ALP A;  4RG1 A;  1X6O A;  2IT1 A;  2JK8 A;  1S72 A;  1Q46 A;  1GVP A;  4YHH L;  3PIO A;  4OO1 G;  4GN4 B;  2Y0S G;  4DR6 L;  1UEB A;  4A3I H;  1IBM L;  2I5L X;  2VZA A;  1Q81 C;  1E7Z A;  1I3Q H;  3S14 H;  4LFB Q;  4DR1 Q;  4OO1 I;  4LF4 Q;  2XTI A;  2Z6K A;  3RZD H;  4LF5 Q;  3PUX A;  1XMQ L;  1N36 L;  2VNU D;  4PZ8 A;  4POF A;  1YEZ A;  2H5X A;  2VUM G;  3F2C A;  1CKO A;  4R4T A;  3L2P A;  3ICE A;  3GO5 A;  3HOU H;  4NXM Q;  3PSI A;  1L2F A;  4BXX G;  1PFS A;  4L5T A;  2AMC B;  1PYB A;  3JAM i;  1Q86 C;  1M90 C;  3HKS A;  2UUC Q;  4A3D G;  1MKH A;  4TQU S;  1X9N A;  4LUO A;  1N34 L;  1N32 L;  5JJL A;  4JI1 L;  4BA2 I;  3I4N G;  2R7Z H;  1T9H A;  2OCE A;  2ZM6 Q;  5LMU Q;  1W2B A;  1JJ2 A;  4GKJ Q;  1CUK A;  4JBW A;  2D0P A;  1IBK Q;  3TQY A;  3U50 C;  4O2D A;  2L15 A;  2AWO A;  1N8R C;  2I5H A;  4OWX B;  3GTQ H;  2QGQ A;  4JV5 L;  1VQ6 A;  3TEH B;  1I6H H;  1GO3 E;  2VS1 A;  5C44 H;  2AHO B;  3ERS X;  4PG3 A;  1Y1W H;  2PI2 E;  1PH5 A;  4MZ9 A;  4OXP A;  3CMA A;  1PVO A;  2A1A A;  5HGQ A;  5IP7 H;  4HID A;  1HR0 W;  1YHQ A;  5IYD H;  1S3O A;  4QY7 A;  1YJW A;  2IHE A;  1NBW A;  3RLO A;  1H95 A;  4DR1 L;  3CPF A;  1VQI A;  1PH8 A;  2PI2 A;  3CCM A;  4HIK A;  2JQO A;  2UUB L;  1YI2 A;  2N49 A;  3DM3 A;  3CCR A;  2FXQ A;  1IBL L;  4HJ8 A;  5FJ8 G;  3VDY A;  4NPS A;  3ULP A;  3H0G H;  5FLM G;  2UUC L;  2VQF Q;  4A93 H;  1BVS A;  4C3I H;  3TS0 A;  2HHH Q;  3AFQ A;  1OXT A;  4DNI A;  2WAQ G;  1V9P A;  4DUY Q;  1EQQ A;  1QVF A;  1XNR L;  1KXL A;  1JJC B;  4R1J A;  3UE0 A;  4JI6 L;  2DUD A;  4B3S Q;  2A19 A;  1VQE A;  1WYD A;  3M4O H;  1P8L A;  3F1Z A;  4JI3 L;  3CCQ A;  1IBK L;  4YY3 Q;  1PH3 A;  2LXK A;  3RN5 A;  4JBK A;  3CW2 C;  4JI5 L;  2CQO A;  4A3B G;  2JA6 G;  2EIF A;  4LW1 A;  2Q2I A;  5M3F G;  3M9B A;  1NE3 A;  3NEN A;  1LYL A;  4BY7 G;  1FL0 A;  1SR3 A;  4R4C A;  3PO2 G;  2Q2U A;  3FP9 A;  3AYH B;  4HIO A;  3HOW H;  2WAQ E;  4A4I A;  5IYC G;  1X3F A;  2UXC Q;  1AH9 A;  1QUQ B;  1UWV A;  2JA7 G;  1AE2 A;  1JE5 A;  3M85 A;  3GTJ H;  1XNQ Q;  3S16 H;  4HJA A;  4B3T L;  2Z0S A;  3F8T A;  4JBM A;  3PUY A;  4QQB X;  5IYB G;  2F4V L;  4L5R C;  1PH1 A;  2N78 A;  1B70 B;  4DR4 Q;  4OWW B;  4FDB A;  4MTN A;  5LMN W;  4L5Q A;  3H3V H;  2CKZ B;  4P73 A;  2NZH A;  2LXJ A;  2K50 A;  3PO3 H;  1TWG H;  1U0L A;  2EXD A;  5GAH C;  1X55 A;  3D31 A;  2KEN A;  5IT9 c;  2Z6K C;  2HHH L;  3FHW A;  3LGJ A;  2JA9 A;  2JA5 H;  2E5L L;  3KFU A;  1HNX Q;  5DLQ E;  5M5Y H;  3GTM H;  4AYB G;  2R7D A;  3RNU A;  4B3S L;  3W1G A;  2PNH A;  4GLA C;  3U4Z A;  1KD1 C;  1E22 A;  3HOY G;  5EAY A;  3PCO B;  4YY3 L;  3U58 A;  2JEA I;  1FVI A;  1K0R A;  2GVA A;  4LFA L;  3I55 A;  3CC7 A;  1C0A A;  1TWA H;  3T1H Q;  3L7Z C;  2VQE Q;  1VQP A;  4GNX C;  3CPW A;  5M3M H;  1RIP A;  2HIV A;  1XJV A;  4DR7 Q;  4NB3 A;  1J5E Q;  4DV1 L;  4B3R L;  4KHP L;  2XGT A;  1VQG A;  1EIF A;  1HZA A;  1K8A C;  4DV0 L;  1YHB A;  4A76 A;  4GNX B;  2B63 H;  2R93 H;  1D7Q A;  4AQY Q;  4YWK A;  5JJI A;  2UUA L;  3J7A 5;  2UXC L;  4GN5 A;  3CP0 A;  4AYB E;  1X3G A;  4GOP A;  1WOC A;  1E1T A;  1XNQ L;  1JB7 A;  1NTG A;  1TWC H;  4LF7 Q;  4ME3 A;  1VQF A;  3G6E A;  4GKK L;  4X65 Q;  3RLN A;  1P16 A;  4DAY B;  3G71 A;  2R92 G;  3J7Z C;  3D0F A;  2KHJ A;  4JYA Q;  4APV A;  3KDF A;  1HR0 Q;  4X64 L;  3GTL H;  4WJ3 M;  1Q12 A;  3UDG A;  2OQK A;  4IO9 A;  1G29 1;  3I4O A;  4YCU A;  1X56 A;  2RCN A;  4C3J H;  1HZB A;  5JEA J;  1LUZ A;  2NVY H;  2F3I A;  2PQA B;  2UU9 Q;  3CCJ A;  1X54 A;  4KLK A;  4A3J H;  2I0Q A;  3CC4 A;  1YZ6 A;  2HQL A;  3OTO Q;  1PH2 A;  1MJE A;  4BY1 H;  1VQN A;  3GTG H;  1JMC A;  2OWO A;  4A3C H;  1IZ6 A;  4NXN L;  3CAM A;  1D8L A;  1KQS A;  2BA0 A;  2YTX A;  5AJ3 Q;  2WFW A;  1A63 A;  1OXS C;  3PO3 G;  3S17 H;  2UXD Q;  4A3G H;  3OW2 A;  2VL6 A;  4LFC L;  3HOV H;  1XMO Q;  3EBE A;  1CSQ A;  3PUV A;  1V43 A;  4GNX A;  5IP9 G;  1FJG L;  4LWC A;  2PMZ E;  4P74 A;  2ASB A;  3HOX H;  3E0E A;  4IPC A;  2VQE L;  1Y14 B;  4A3F H;  1XPR A;  3HOZ G;  3CME A;  1Q1E A;  2JA8 H;  1J5E L;  3M4P A;  1SMX A;  1I94 L;  1WCM H;  2ZTC A;  4A3M G;  3GTK H;  4AQY L;  4JI4 L;  1K8G A;  1XPU A;  4IFD J;  3ER0 A;  4BBR G;  2GVB A;  2YV5 A;  3E9H A;  4X66 L;  2HT1 A;  4A3E G;  3S2H H;  4LF8 Q;  4LF7 L;  3W5O A;  1HNW Q;  3B6Y A;  1B7Y B;  2PQA A;  3CCU A;  2ID0 A;  3GDE A;  2MO0 A;  4OON A;  2BA1 A;  4JYA L;  1M1K C;  3K80 C;  4UPA A;  1HR0 L;  1QZH A;  4LFB L;  4HJ9 A;  4A75 A;  1I5F A;  1YNX A;  1KL9 A;  4LF4 L;  1X3E A;  4LF5 L;  4UP8 A;  3CC2 A;  3KJP A;  1B8A A;  3CCE A;  4A3I G;  2JE6 I;  1VQD A;  2D62 A;  3OTO L;  1UE7 A;  3T1Y Q;  4OWT B;  3RN2 A;  3I4M H;  3S24 A;  3STB D;  1EWI A;  4UP7 A;  5GAE C;  4P72 A;  4A3K H;  4NXM L;  1HNZ Q;  4LUV A;  5AJ3 L;  3PF4 A;  1SE8 A;  2UXD L;  5LMN Q;  2K5V A;  3J81 c;  4DR5 Q;  1EQR A;  4DV5 Q;  1OTC A;  2ZJQ A;  4HJ5 A;  4R4O A;  1Q1B A;  2YYZ A;  2ZTE A;  5GAG C;  2CWA A;  3EIV A;  4X62 Q;  2NVX H;  2ZM6 L;  1VQH A;  1GKH A;  2IHF A;  5LMU L;  3HOU G;  4GKJ L;  1JJG A;  4DV2 Q;  2NN6 G;  3UE1 A;  4JOI A;  2RHS B;  1EOV A;  1HJP A;  2WB1 G;  4QGU A;  2OQ0 A;  1BKB A;  1CSP A;  4MNO A;  4C2M H;  4OX9 Q;  1E1O A;  3S1N H;  1VQ7 A;  2NN6 I;  1MIU A;  3FKI H;  4LF6 Q;  4DV3 Q;  4K0K Q;  2R7Z G;  4PZ6 A;  1TWF H;  1VQA A;  1O7I A;  2ES2 A;  3KJO A;  4A3L H;  4DKA C;  3M3Y H;  5H1S E;  4LF8 L;  2GN5 A;  3GD7 A;  4R4Q A;  1HZC A;  1U5K A;  1IXR A;  2YTY A;  3L0O A;  1QVG A;  3S1Q H;  4BBS H;  1SRO A;  2UXB Q;  3CD6 A;  4GLX A;  1HZ9 A;  1KAW A;  5C0X J;  5C44 G;  4DR3 Q;  3CF5 A;  4GOP C;  3PUW A;  1Y1W G;  3ZJY C;  2E2I H;  2WB1 E;  1PYS B;  1L0W A;  3IRB A;  5IP7 G;  5IYD G;  1E24 A;  3I7F A;  5BR8 Q;  1A8V A;  1VQJ A;  4KHZ A;  3A74 A;  3AQQ A;  3T1Y L;  4GOP B;  3CCL A;  1R9T H;  3AFP A;  4JBJ A;  1VCI A;  4DK3 C;  4LF9 Q;  2JEB I;  4JI8 Q;  4DV6 Q;  2VQF L;  1MJC A;  2Q2H A;  4Y7N H;  1VQ4 A;  4DV4 Q;  2KHI A;  2R7F A;  4DV5 L;  4DUY L;  2VW9 A;  4DV7 Q;  3KDF B;  1C9O A;  4H02 A;  5JEA G;  3S15 H;  2KCM A;  3H0G G;  3K8A A;  4DK6 C;  4A93 G;  4WJ4 A;  1OXX K;  3E9I A;  3UDF A;  5C4J H;  4IPG A;  4YHH Q;  1VQO A;  2K5N A;  1HH2 P;  1NJI C;  4JC0 A;  1SRU A;  3M4Q A;  3J81 i;  1Q82 C;  3M7N A;  3KOJ A;  3Q8D A;  1PA6 A;  2AKW B;  2VUM H;  3K7U C;  2K52 A;  2HIX A;  2CWP A;  1YJN A;  3F2B A;  2ZJR A; 
#chains in the Genus database with same CATH topology
 1BQQ T;  2XVS A;  2IPK D;  1SJH D;  3I4N H;  5IGC A;  5C4X H;  3S1R H;  1LT3 D;  1HPC A;  3MXN B;  1Y8N B;  1WTH A;  1ASY A;  5HY6 A;  1BXT A;  4CKC A;  4IFD G;  4JI0 Q;  3AEV A;  1UUP A;  3K81 C;  2KUM A;  3HOW G;  1K83 H;  1IW7 D;  1NMF A;  4CJ0 B;  1VQ9 A;  5EKL A;  3X3N A;  2BE5 D;  2F0J A;  5EPL A;  3H3V C;  3UDX A;  2RF4 A;  2QF7 A;  1JT8 A;  5L37 A;  2BDO A;  3HGB A;  1SN8 A;  4DR2 Q;  1F2Y A;  1LTL A;  1EY5 A;  4LUZ A;  3D4D A;  4Y7N B;  2JA5 G;  1DCZ A;  4P71 A;  1ZYR D;  2XRS D;  2A5H A;  3GTM B;  3EN2 A;  3K5M A;  5ELE A;  4CJ2 C;  1ET9 A;  2AWN A;  1KDB A;  1H9J A;  2UUB Q;  3M4Y A;  1C7Y A;  3SDZ A;  2QIL A;  3BDO A;  4J15 A;  3TP5 A;  3OSO A;  4TVA B;  1RD9 D;  3LX0 A;  2K14 A;  3KBX A;  4GLV B;  5CR3 A;  2XRQ D;  4CKB A;  2B63 G;  5C4X B;  4TKO B;  4X3K A;  2SEB D;  1Y8O B;  5FK9 C;  5J1Z A;  3I8Z A;  1MGS A;  3STB C;  2NVT H;  4HCS A;  2Z4I A;  2MQH A;  3QJY A;  2QEX A;  1EOT A;  5CGK A;  1N33 L;  3TDQ A;  5C0X I;  4XT1 B;  4C3J G;  4UY8 C;  4F8M A;  1B4O A;  4MIU A;  4GZY C;  3NXW A;  5IYB H;  4L63 B;  5CV6 A;  1LM0 A;  1CKN B;  1PRT F;  5AFW A;  1PH7 A;  2ATW A;  3J81 j;  2F0W A;  2JJQ A;  2X6L A;  3KYH C;  2AQ1 B;  4B3M L;  4K8I A;  1K8M A;  3HOV B;  4I7A A;  1AN8 A;  1TY0 A;  2O5I C;  2BH2 A;  5D14 A;  3NK9 A;  3HOX G;  2JA8 G;  3ERQ A;  3DWQ A;  1HNW L;  2F0U A;  1DOK A;  1YHA A;  1JE4 A;  4FNF A;  2E5L Q;  4DK1 A;  2R6G A;  5DEH A;  3G4S A;  2ICE C;  1NSN S;  4IN3 A;  3VR6 A;  3I2Z A;  3RUZ A;  3BS1 A;  1Z9F A;  2JP1 A;  3A0J A;  4ZQ3 A;  3E6Z X;  1RL2 A;  1YIT A;  4AH6 A;  1PTO D;  3GTO H;  4DR5 L;  4EQ5 A;  2NVT B;  3TBI B;  4KJN A;  3I4M B;  2UUA Q;  4X62 L;  1D1K A;  1L1O B;  1XPO A;  2DJF C;  3ND9 A;  4K6D A;  4GKK Q;  1IBM Q;  1VQK A;  3E5S A;  4LF6 L;  3UDI A;  4QIW E;  1I4G A;  1ASZ A;  5K36 G;  2EDG A;  4FXD A;  4V0B A;  1A62 A;  2SOB A;  2MFI A;  1WFQ A;  3NE5 B;  4DR3 L;  4A3L G;  1FD7 D;  3NEM A;  1SYF A;  3OW7 A;  4A3M H;  1IYU A;  1VF5 C;  2F0N A;  4YWL A;  3S1Q B;  1BCP B;  2F0L A;  5CV8 A;  1QUQ A;  1M8A A;  4JI8 L;  2RHQ B;  5CC4 A;  1XXG A;  4DAM A;  1X32 A;  1WI5 A;  1PH6 A;  1EUJ A;  2LSS A;  3SK6 A;  3ULL A;  1GJX A;  3FVQ A;  2D0O A;  1OXV A;  1IL2 A;  1SAP A;  1FGU A;  1T5X D;  1FNV A;  1S72 A;  1Q46 A;  4OO1 G;  1E7Z A;  5C4H A;  2B2T C;  3KLR A;  4LFB Q;  4WOR A;  2XTI A;  1LAB A;  2VNU D;  4F7X A;  3GV3 A;  1PFM A;  2VUM G;  2A6H C;  3PSI A;  1PFS A;  1Q86 C;  2NN6 H;  1M90 C;  2UUC Q;  4TQU S;  3SK5 A;  1EYC A;  1KLG D;  1F9P A;  1EZ8 A;  1ESF A;  1T9H A;  1CUK A;  3K0Y A;  3U50 C;  3K5L A;  4RHS A;  4A3M B;  2AWO A;  2A69 C;  4CKE A;  1N8R C;  3GTQ H;  3X3M A;  2QGQ A;  4ABN A;  1Q90 A;  2A68 C;  1VQ6 A;  2A69 D;  3OPO A;  3TEH B;  3ERS X;  4IQZ A;  3SEB A;  4DF7 A;  5IT9 E;  3D6C A;  4CJ1 B;  1S3O A;  5CV4 A;  1H95 A;  2F0V A;  2JQO A;  5F2D A;  1A2T A;  2O2L D;  3DM3 A;  4DAP A;  2Z9H A;  2L4N A;  3H0G H;  5FLM G;  3E0J A;  4DFA A;  4C3I H;  2HHH Q;  4E6I A;  1D5Z C;  1KXL A;  4R1J A;  2F0M A;  2A19 A;  1WYD A;  2XN9 C;  4JI3 L;  2EE1 A;  3CCQ A;  2LXK A;  3CW2 C;  4A3B B;  2CQO A;  2JA6 G;  5M3F G;  1RF2 D;  1NE3 A;  1O7Y A;  1LO5 D;  3PO2 B;  4R4C A;  3BYY B;  3MVV A;  1JWU D;  2J0T D;  1QUQ B;  4I7Z C;  1AE2 A;  3GTJ H;  3S16 H;  1IKM A;  1TII D;  2L1B A;  1WTX A;  3IFD A;  1PH1 A;  3H3V H;  4RCO A;  2NZH A;  2LXJ A;  3NUC A;  5JPN C;  3P20 A;  2YU9 B;  3PO3 H;  5GAH C;  5IT9 c;  1DJR D;  3RNU A;  3H0G B;  4KMU C;  3HOY B;  1KD1 C;  3DMU A;  4C3I B;  3U58 A;  2XNA C;  1K0R A;  4KTA A;  5ELF A;  4LFA L;  3CC7 A;  2FMC A;  2VQE Q;  3MFG A;  5M3M H;  1SE4 A;  3GP7 A;  1XJV A;  4NB3 A;  4B3R L;  4DV1 L;  2WAC A;  1LTR D;  2WKC A;  1EIF A;  4FXG C;  4U67 3;  4AQY Q;  5JJI A;  3TME A;  2UXC L;  3HEJ A;  4AYB E;  2L12 A;  1VQF A;  5KNC A;  2R92 B;  3RLN A;  1P16 A;  3G71 A;  2PMZ B;  2KHJ A;  1UNS A;  4APV A;  4X64 L;  2PPB C;  3S16 B;  1X56 A;  2NVY H;  1E2Z A;  1X54 A;  3CCJ A;  4A3J H;  2VB2 X;  2HQL A;  1MJE A;  3T51 B;  2OWO A;  3CAM A;  1EY9 A;  1KQS A;  1Q3L A;  3J7A F;  2WFW A;  3QOL A;  3PO3 B;  2O5J C;  3QR8 A;  3OW2 A;  2VL6 A;  4GNX A;  4LWC A;  1PRT B;  4P74 A;  4C3H G;  3HOZ B;  3E0E A;  1RHP A;  4J8Q A;  1J5E L;  1SMX A;  1HUM A;  4DNR B;  1I94 L;  4EQN A;  4B9X A;  2OEO A;  1Y8P B;  4JI4 L;  3ER0 A;  4BBR G;  2EPB A;  3KLS X;  2GVB A;  4X66 L;  2QKI C;  3E9H A;  3S2H H;  1HNW Q;  4KD4 A;  4M8A A;  2PQA A;  3S1M B;  2ID0 A;  4K8J A;  2BA1 A;  1RCV D;  4OON A;  4JYA L;  1B2T A;  3K80 C;  3K57 A;  4A75 A;  1NR4 A;  1CTM A;  2V4D A;  1X3E A;  1IL8 A;  3R2T A;  3VYS A;  4A3I G;  3OTO L;  1STB A;  2D62 A;  1CM9 A;  3LWU A;  1EEF D;  3JAM E;  4UP7 A;  5GAE C;  2EYL A;  4LUV A;  2PZU A;  3PF4 A;  2UXD L;  4RHR A;  2NVY B;  2L55 A;  4DR5 Q;  4A3J B;  2ZJQ A;  4XT3 B;  4R4O A;  2YYZ A;  1BF4 A;  4X62 Q;  2NVX H;  2ZM6 L;  1VQH A;  4GKJ L;  3UE1 A;  5ELC A;  1CSP A;  4MNO A;  1SND A;  3R8B A;  3S1N H;  3FKI H;  4LF6 Q;  3WOE A;  4V19 0;  1TWF H;  1VQA A;  3M3Y H;  2J7Z A;  5H1S E;  2GN5 A;  1JOR A;  2CW0 D;  2L11 A;  1QVG A;  5BN4 A;  4GLX A;  4Q5V A;  1LT6 D;  2NZ1 D;  1HZ9 A;  1KAW A;  2PZW A;  5C44 G;  4DR3 Q;  1C4Q A;  4GOP C;  3ZJY C;  1K28 A;  1PYS B;  3FPP A;  3I7F A;  1TR5 A;  1A8V A;  1VQJ A;  3CCL A;  3LNN A;  1R9T H;  3DM1 A;  1NAP A;  1VCI A;  4LF9 Q;  4JI8 Q;  1SDF A;  5I4D A;  1MJC A;  2Q2H A;  1KNA A;  1SE2 A;  2KHI A;  2XSC A;  4DUY L;  1FR3 A;  3Q24 A;  1C48 A;  5JEA G;  3S15 H;  1G2S A;  3CHB D;  3K8A A;  1EY7 A;  1WD0 A;  4A93 G;  1OXX K;  3E9I A;  4IPG A;  4JC0 A;  1NCV A;  3M4Q A;  3M7N A;  1PA6 A;  3G7L A;  2NVX B;  4N8F A;  1YJN A;  2EJG C;  1QZG A;  1VQ5 A;  2F0K A;  3NWT A;  2M2L A;  1UE5 A;  1CHQ D;  3OYY A;  1RDP D;  4EQO A;  2D5D A;  1ILQ A;  2E75 C;  4N9P A;  4JI2 Q;  1BCP D;  3A5U A;  2B3G A;  2FFK B;  4DK0 A;  3M7G A;  1F2L A;  2X69 A;  1G6P A;  3URY A;  2IL8 A;  2WKD A;  2WP8 J;  1VQC A;  2DNC A;  3DWP A;  4DV6 L;  4KY6 A;  3KUP A;  4HMJ A;  5ELD A;  4RMF A;  1BR9 A;  4G4K A;  4UP9 A;  1AE3 A;  3VYT A;  1R9T B;  5KYL A;  1V1Q A;  4FF3 A;  1ESR A;  1Y69 U;  2C35 B;  4RAU C;  2IY5 B;  1TWG B;  1TXY A;  5EGT A;  4XIG S;  1PZJ D;  5IIF A;  1KRS A;  3G48 A;  4IUR A;  1S5E D;  5FJ8 H;  1VQM A;  4HR7 B;  3SXH A;  1EY8 A;  2SNS A;  1ENA A;  4JOI C;  3N52 A;  4KY7 A;  3I56 A;  1H9R A;  3MTS A;  3SGI A;  4K5X A;  1TWA B;  3V05 A;  2ZJP A;  1LAC A;  4X3T A;  4B08 A;  1K73 C;  2R93 B;  1TKW B;  2WIN B;  2B2V A;  2NVQ H;  3EVQ A;  1QE6 A;  5C4X G;  3JC6 6;  1MSH A;  1TWC B;  4G7Z C;  4DUZ Q;  4JI3 Q;  4BY7 H;  4JPB W;  4IOC A;  2UU9 L;  5C0X G;  4PNY A;  4JI7 Q;  5IYC H;  3GTL B;  4IPH A;  2JA7 H;  3MEF A;  1UAP A;  3DXJ C;  2ALY B;  3Q6S A;  4ZYS A;  4BY1 B;  3AB9 A;  4HMI A;  3CU7 A;  1Y1V H;  2IX0 A;  1NY4 A;  3Q23 A;  4A3G B;  2B8F A;  2EYF A;  5FLX E;  3HOV G;  3PIP A;  2B2Y A;  2KCT A;  5E7N A;  3NEL A;  4A3F B;  2L5T A;  5IWA Q;  1VS0 A;  1S5B D;  1WCM B;  1Z6H A;  2QA4 A;  3KF8 B;  4FO2 A;  1EYG A;  1HTP A;  3NP8 A;  1G6Z A;  1F9S A;  3RZO H;  4QJF A;  2B2U C;  2OTJ A;  4EGV A;  3TP6 A;  3H15 A;  4LFA Q;  2JYO A;  3Q0A A;  4RGO S;  1I50 H;  1V8Q A;  1PZK D;  4QB4 A;  1CKN A;  4QIW B;  4B3R Q;  4DV1 Q;  3HKZ B;  1GUW A;  1K8O A;  3OOC A;  1WVL A;  3I4M G;  4BWG B;  4A3K B;  1EQT A;  1SMY D;  4DV2 L;  4U68 A;  1YJ9 A;  2C5C A;  3TRE A;  3HS0 C;  1Y1V B;  4DV3 L;  4X64 Q;  2LFN A;  3SK8 A;  4IOA A;  1BBW A;  3U4V A;  3K0X A;  1SLJ A;  4C2M B;  2H1E A;  4O0A A;  2UXB L;  2K03 A;  1DGS A;  5IGG A;  1WTP A;  3EFX D;  1STA A;  2A8V A;  3FEW X;  1STG A;  3W1B A;  2EQS A;  2ZT9 C;  3AMU A;  1IW7 C;  3DLL A;  2YTV A;  5FLX c;  1EY6 A;  1PH9 A;  4BBS G;  1Q7Y C;  1DOM A;  1B3A A;  1XTD A;  2BE5 C;  1E2V A;  1X65 A;  4ZAI A;  5BR8 L;  1GUS A;  3DEP A;  1TWH H;  1L1O A;  5M5W H;  1K9M C;  2E2I B;  4C56 C;  5D65 A;  4JK1 C;  5IOC A;  1I94 Q;  2OTL A;  3N6R A;  4IJL A;  4DV4 L;  4JI4 Q;  3BZK A;  1SYB A;  1O78 A;  1Z7T A;  1A0I A;  5T1G A;  3TP8 A;  4IUU A;  4X66 Q;  4RG1 A;  1ZYR C;  2HDM A;  2IT1 A;  2JK8 A;  3J81 E;  1GVP A;  4F88 A;  2Y0S B;  4DR6 L;  1UEB A;  5J22 A;  2VZA A;  1CZG A;  1Q81 C;  1ICW A;  4DNT B;  3S14 H;  4DR1 Q;  1JWM D;  3K6O A;  2R61 A;  2Z6K A;  1TS5 A;  5C4J B;  1I6V C;  4PZ8 A;  4RA8 A;  3F2C A;  1CKO A;  3ICE A;  4RKB A;  3GO5 A;  3HOU H;  5KND A;  3KBG A;  4L5T A;  4A3D B;  1PRT D;  1X9N A;  5JJL A;  4LUO A;  1N32 L;  4JI1 L;  1K3B C;  1CK1 A;  3RMH A;  3I4N B;  4ZUJ A;  3S1R B;  2R7Z H;  1B53 A;  2ZM6 Q;  1W2B A;  1JJ2 A;  4GKJ Q;  1GHK A;  4DXF A;  3A8K E;  4O2D A;  2L15 A;  1K83 B;  4OWX B;  3C46 A;  4JV5 L;  1BOS A;  1EFI D;  3NBI A;  2CHB D;  1I6H H;  1GO3 E;  2AHO B;  1Y1W H;  5M5W B;  3T13 A;  4MZ9 A;  4OXP A;  3QG1 A;  3CMA A;  2IJ0 A;  3E3X A;  3HZX A;  5IP7 H;  4HID A;  5IYD H;  5IGD A;  1A2U A;  3A56 A;  3MC0 B;  1YHQ A;  2IHE A;  3BYT B;  4UHV A;  3LWE A;  3CPF A;  2PI2 A;  2PZT A;  1SNC A;  2FXQ A;  1IBL L;  4IUN A;  2ENB A;  4NPS A;  3OMG A;  4RH6 A;  1CI3 M;  2NWG A;  1OXT A;  1JCK B;  2I46 A;  1O7Z A;  4DUY Q;  4FF4 A;  4XYQ A;  1JJC B;  3U9S A;  5JAV A;  1BDO A;  4CHT B;  3M4O H;  1P8L A;  3F1Z A;  3MZ5 A;  1IBK L;  1DYQ A;  3RN5 A;  1U4M A;  4JI5 L;  4A3B G;  2ZXO A;  2Q2I A;  1MD2 D;  3M9B A;  1PTO C;  3NEN A;  1S4Z A;  1LLR D;  1TS2 A;  1SR3 A;  3PO2 G;  3AYH B;  3R93 A;  4HIO A;  3HOW H;  4IFD H;  5FO8 B;  2WAQ E;  1MI2 A;  2A6E C;  3D3R A;  2K05 A;  2LKV A;  2A6E D;  2QW7 A;  1II3 A;  3F8T A;  5I2X A;  4QQB X;  1B70 B;  4ZUI A;  1YNN C;  4HTH A;  2CKZ B;  1EU4 A;  2Q8T A;  1YNN D;  1X55 A;  3D31 A;  3IFT A;  2JA5 H;  1TY2 A;  3FHW A;  1I4R A;  2JA9 A;  3ND8 A;  1HQR D;  1R4P B;  5DLQ E;  4N8X 1;  4H13 C;  5M5Y H;  4AYB B;  2BCO A;  4B3S L;  3OHX C;  2PNH A;  4GLA C;  3W1G A;  3HOY G;  5EAY A;  1H9K A;  4YY3 L;  2M00 A;  3VR4 A;  1FVI A;  1PYW D;  1VQP A;  4GNX C;  3CPW A;  1EL0 A;  2Q8I B;  2HIV A;  2XGT A;  4LMQ D;  1VQG A;  1HZA A;  1K8A C;  1YHB A;  4A76 A;  2B63 H;  2EY6 A;  3NQT A;  3CRK C;  5T1I A;  4GN5 A;  2XWJ B;  1WOC A;  5CBE E;  1XNQ L;  1JB7 A;  2B2W A;  3GTO B;  1STN A;  3G6E A;  1EYA A;  2R92 G;  4QCL A;  1B44 D;  3KDF A;  3NQI A;  4G57 A;  3J80 E;  1HR0 Q;  4WJ3 M;  1Q12 A;  3PQI A;  2K7V A;  4YCU A;  4C3J H;  1O80 A;  3OWE B;  1LUZ A;  5DNF A;  1AW7 A;  1JB3 A;  3VR5 A;  2UU9 Q;  1LTG D;  3GTG H;  1F2Z A;  1EWH A;  1QNK A;  1D8L A;  1J9O A;  2YTX A;  5AJ3 Q;  1A63 A;  3S17 H;  3PO3 G;  4P2C B;  4LFC L;  5A2Q L;  1ET6 A;  3PUV A;  4CBV A;  1HTL D;  5IP9 G;  2ASB A;  3HOZ G;  2PNR C;  4IAL A;  4IPC A;  3HOX H;  1Y14 B;  4KJO A;  3CME A;  5CV5 A;  2JA8 H;  4IZ8 A;  2F0H A;  1EEI D;  3M4P A;  5K5P A;  2ZTC A;  2DY8 A;  3GTK H;  2YV5 A;  4JVZ A;  4G7H C;  4A3E G;  4M1U B;  4LF7 L;  3W5O A;  3CCU A;  3GDE A;  1IKL A;  1M1K C;  3D4R A;  2LMC B;  4JW0 A;  4HJ9 A;  2PO4 A;  4LF4 L;  2MUY A;  4LF5 L;  4UP8 A;  3CC2 A;  2EYO A;  4K5V A;  1VQD A;  3T1Y Q;  1UE7 A;  2CH4 W;  4OWT B;  3SR1 A;  3S24 A;  1L0Y B;  1DOL A;  3MFY A;  4NXM L;  4P72 A;  3H91 A;  1SE8 A;  2K5V A;  1PDQ A;  4DV5 Q;  4HJ5 A;  1Q1B A;  2ZTE A;  5GAG C;  3L3O C;  2CWA A;  4Q0F A;  5LMU L;  2RA4 A;  4N9T A;  2QCP X;  4DV2 Q;  5K36 H;  4QGU A;  2OQ0 A;  4WJW A;  1XX8 A;  1HXY D;  2NN6 I;  1GUT A;  4DV3 Q;  1F9R A;  2ES2 A;  5DM6 3;  4A3L H;  4LF8 L;  3GD7 A;  3GTQ B;  1IXR A;  3TSS A;  2UXB Q;  4ODG A;  1D6E C;  1CA5 A;  1AEX A;  5LL6 S;  1B1Z A;  2WB1 E;  3MHB A;  5BR8 Q;  3ZYY X;  4KHZ A;  4NDX A;  1S5F D;  3QO2 A;  4ZLT F;  2VQF L;  2F0E A;  3UI2 A;  3A7A B;  4DV4 Q;  2R7F A;  4R8N A;  3KDF B;  2IW3 A;  4H02 A;  2Q8R E;  2O4X A;  5I9P A;  4K14 A;  4DK6 C;  4IUT A;  3UDF A;  2OT2 A;  3T56 B;  1GUG A;  1HH2 P;  5CMD A;  1SRU A;  1Q82 C;  3MXU A;  4H7B A;  1T5E A;  2VUM H;  2HIX A;  1WTV A;  3F2B A;  2ZJR A;  5C5L A;  1N9W A;  3A5Z B;  1ENC A;  1PZI D;  2AQ2 B;  3KF6 A;  4ME5 A;  3PIP 3;  3MXP A;  3VR2 A;  1ROD A;  4JI1 Q;  1OXU A;  5JVH 3;  2B2V C;  4DR4 L;  2ZTD A;  3A8I E;  4IPD A;  5EQ0 A;  3GTJ B;  1SEB D;  3AU7 A;  4POG A;  5J3B A;  5IGB A;  4K6L A;  1V1P A;  4JV5 Q;  1KHI A;  1PFB A;  3K7A H;  4UAI A;  1VQ8 A;  1N33 Q;  1NR2 A;  2MO1 A;  2VY3 A;  3DUZ A;  1GUN A;  1EFW A;  1SYE A;  4HED A;  5I6W A;  3VR3 A;  1XYI A;  1LTA D;  1JR0 D;  3BU2 A;  3H3V I;  3OIQ A;  4YWM A;  2D9U A;  4QUF A;  4DR7 L;  5FLM H;  1QVC A;  3VYR A;  4B3M Q;  2K4K A;  3O13 A;  2DNE A;  4MHE A;  4PZ7 A;  2EYM A;  4DPG A;  5KGU A;  1IYJ B;  3VA7 A;  3NTI A;  1IHZ A;  1IBL Q;  5M3M B;  2K5Q A;  4CDD C;  3BDC A;  3H09 A;  4X6A H;  1EQV A;  4X65 L;  4JI0 L;  2R93 G;  5C3W A;  2B29 A;  2JA6 H;  5M3F H;  4KI0 A;  3BVM A;  5FKA C;  2PW5 A;  4L6T B;  4JI5 Q;  1DXM A;  1OO9 B;  1PTO H;  2CFM A;  3BZC A;  2F3W A;  4QF4 A;  4DR2 L;  1PH4 A;  1A15 A;  2G9H D;  1A3T A;  1XMO L;  1NUC A;  2HQE A;  4BY1 G;  4Z9C B;  2B2T A;  1EIY B;  3K7A B;  2IX1 A;  5GAD C;  4A3C G;  2SNM A;  1SYG A;  1U9R A;  2E2J H;  2MNA A;  4A3G G;  1R4Q B;  1Z47 A;  4Y52 H;  1CFM A;  1ILP A;  1SNO A;  3BVZ A;  2K04 A;  1F77 A;  4PMW A;  2J4X A;  4A3F G;  5GRO A;  1JQY D;  2CW0 C;  1J6Q A;  1KDC A;  4KHV A;  1S40 A;  1WCM G;  1H9S B;  1QB5 D;  4YCV A;  3KLW A;  3K58 A;  5IE8 A;  5C3E H;  2KBN A;  1HFN A;  4P75 A;  4KK7 A;  3S2H B;  5FOB B;  3NHH A;  1D5M C;  4H44 C;  1W3S A;  3GTP H;  1KNE A;  5M5X H;  1J8I A;  4NW2 A;  3KF6 B;  3CXC A;  2N8N A;  5IT9 L;  2LY7 A;  5JJK A;  1L1O C;  2KEC A;  3HKZ G;  5LMN L;  4GN3 B;  3SK4 A;  1RTN A;  4L5S A;  1ZXT A;  4A3K G;  3DHQ A;  3NPP A;  3C3L A;  1W6K A;  4OHJ A;  1V1P B;  1TS3 A;  4KD3 A;  1STH A;  2RKS A;  4LAA A;  4XTC S;  3Q22 A;  4OX9 L;  3KF8 A;  4PQX A;  2EJM A;  5IOD A;  1HRJ A;  5ISR A;  1Y1V G;  4K0K L;  5EPJ A;  3JAM c;  4BXX H;  4YCW A;  3BJU A;  1PHJ A;  3S1N B;  2DY7 A;  3FKI B;  4C3H H;  1TWF B;  3PGZ A;  4OGQ C;  1BCP C;  4XQN A;  3M3Y B;  4DGZ A;  3OWF A;  1SFO H;  4LFC Q;  3S2D H;  3QIA A;  1G8Z D;  1DM0 B;  1K3R A;  2QEJ C;  4BBR H;  1RKN A;  5C3E B;  3EQL C;  2PYK A;  1FNW A;  4JCV E;  3CQZ H;  4PV1 C;  1G51 A;  5KYI A;  4X3S A;  5DM7 3;  3P1H A;  4JG2 A;  1JC7 A;  2K5W A;  1YNJ D;  3EJI A;  4O1N A;  1CZW A;  2F0D A;  2MPM A;  3PIO A;  4GN4 B;  2Y0S G;  4RGT A;  4A3I H;  2TMP A;  1IBM L;  4LK1 C;  3S15 B;  1I3Q H;  1B3Q A;  1WTW A;  3I72 A;  4LF4 Q;  3RZD H;  4LF5 Q;  3PUX A;  1XMQ L;  1N36 L;  1ML0 D;  4POF A;  4R4T A;  1PMR A;  4NXM Q;  1DD2 A;  2AMC B;  1PYB A;  3JAM i;  4A3D G;  1MKH A;  1N34 L;  3C1F A;  5IGF A;  5G3L F;  3I4N G;  5JPM C;  2G5D A;  2OCE A;  5LMU Q;  1HA6 A;  5KRU A;  3TQY A;  1ONL A;  2F0O A;  4I65 A;  1PLF A;  3D8G A;  2CVR A;  3VYU A;  1V1O A;  4FF1 A;  4KN4 C;  2BOS A;  5C44 H;  1PH5 A;  4PG3 A;  1STE A;  3QB3 A;  4O42 A;  2VXW A;  3CQZ B;  3MAQ A;  2A1A A;  5HGQ A;  1HR0 W;  1YJW A;  5M9O A;  3NWS A;  4CDC C;  3TZD A;  2PW7 A;  2EJF C;  2EVB A;  1VQI A;  1PH8 A;  4HIK A;  1YI2 A;  3C1E A;  4CDF C;  5HUR A;  3I90 A;  1A3V A;  1MHW C;  3VDY A;  5JEA H;  3U9O A;  2UUC L;  3F2U A;  2VQF Q;  4A93 H;  1BVS A;  3TS0 A;  5KIX A;  2WAQ B;  1V9P A;  5JVG 3;  1EQQ A;  1LT4 D;  1XNR L;  3BZD B;  3UE0 A;  4JI6 L;  1VQE A;  1PH3 A;  1LTS D;  4JBK A;  2NVQ B;  2EOT A;  4LW1 A;  4J6H A;  1D5X C;  1JIC A;  1EY0 A;  2KOL A;  4BY7 B;  1LYL A;  1FL0 A;  2EY1 A;  3FP9 A;  1ZKO A;  4A4I A;  1SMY C;  1X3F A;  4X3U A;  2F03 A;  2UXC Q;  1AH9 A;  2JA7 B;  3NSW A;  2P5Z X;  4OEL B;  3M85 A;  4B3T L;  2DJG C;  3PUY A;  4DA2 A;  1AZQ A;  5IYB G;  2F4V L;  4L5R C;  3JAM L;  2M9V A;  2N78 A;  4DR4 Q;  1NNX A;  1HCZ A;  1ENF A;  2K1B A;  4P73 A;  2EZV A;  1U0L A;  2HHH L;  4HCE A;  2KEN A;  4K2L A;  2PQE A;  3GTM H;  1I4P A;  1ZEQ X;  4AYB G;  2R7D A;  3U4Z A;  4CGY B;  3PCO B;  3FMC A;  2GVA A;  1SYD A;  1XTC D;  1C0A A;  3RZO B;  1RIP A;  1W6J A;  4DR7 Q;  1J5E Q;  4KHP L;  3QWN A;  2E74 C;  2EXZ A;  4DV0 L;  1D7Q A;  1I50 B;  4YWK A;  4XXE A;  3CP0 A;  4GOP A;  1F2M A;  4ME3 A;  4X65 Q;  4DAY B;  3J7Y W;  3J7Z C;  5C0X H;  3D0F A;  1A3U A;  2L0C A;  4JYA Q;  4OL7 A;  4DXG A;  2IX3 A;  3UDG A;  4IO9 A;  3R3O A;  3I4O A;  3PMF A;  5BN5 A;  2RCN A;  3OMC A;  4KV6 A;  1HZB A;  3A7L A;  2F3I A;  1TS4 A;  3OTO Q;  1SJE D;  1IZ6 A;  4NXN L;  1PRT C;  1EY4 A;  5KNB A;  2UXD Q;  2L9H A;  5CBA E;  3HOV H;  1XMO Q;  1L0X B;  2Z1C A;  1FJG L;  2R3Z A;  2VQE L;  1Q1E A;  3I70 A;  4ZCK A;  3CKI B;  4UDU C;  4A3M G;  4FXK C;  4AQY L;  1G91 A;  2OF1 A;  1XPU A;  4IFD J;  4ZK9 B;  1TWH B;  3B6Y A;  1B7Y B;  4RGM A;  1S5D D;  2MO0 A;  3TN2 A;  4MN3 A;  4UPA A;  2FIN B;  1QZH A;  2F4I A;  1I5F A;  1YNX A;  2AUJ D;  4XDX A;  5HGT A;  5EJW A;  5DAU A;  1B8A A;  3CCE A;  2AUK A;  3A55 A;  1B9M A;  2JE6 I;  3RN2 A;  3I4M H;  3STB D;  3S14 B;  2B39 A;  3HRZ C;  5I2Y A;  5KEE A;  5LMN Q;  5COY A;  3J81 c;  2KHS A;  1EQR A;  1CHP D;  1OTC A;  2F3V A;  1I4X A;  3HOU B;  3HP3 A;  1GKH A;  2IHF A;  2H4O A;  2N88 A;  3L9A X;  1MSG A;  2NN6 G;  4JOI A;  1EOV A;  1HJP A;  2WB1 B;  1BKB A;  4OX9 Q;  5EBD A;  4ZRZ A;  4K0K Q;  2R7Z B;  2Z4H A;  3T53 B;  2BDN A;  3KLS A;  4ID6 A;  3KJO A;  1SYC A;  5E4W C;  5CV7 A;  3R2I A;  4IUP A;  1VF7 A;  3V96 A;  1BO0 A;  1U5K A;  4BBS H;  3S1Q H;  3W3A A;  1SRO A;  3SHL A;  3CD6 A;  1I6H B;  2KVM A;  3FRP B;  1Y1W B;  1DZ1 A;  1SNQ A;  1L0W A;  3IRB A;  3V2T A;  5EKI A;  1E24 A;  1E0B A;  3A74 A;  3AQQ A;  4GOP B;  1LT5 D;  3AFP A;  4DK3 C;  4DV6 Q;  4R8I A;  2PCF B;  1RJT A;  1LTB D;  1HUN A;  3RD4 A;  1C9O A;  2KCM A;  3H0G G;  1I4H A;  5FLX L;  4C3I G;  4LJZ C;  1VDZ A;  2A74 C;  4RGN A;  3DWA A;  2C9O A;  2K5N A;  1NJI C;  3J81 i;  2NTT A;  5D3I B;  4DN4 M;  3KOJ A;  2GA4 B;  3Q8D A;  4K5W A;  3K7U C;  2K52 A;  3M4O B;  2CWP A;  5COR A;  4ULL A;  3HKZ E;  4QUC A;  5IGE A;  1XMQ Q;  3TRZ A;  1N36 Q;  3IKJ A;  4YIJ A;  1YIJ A;  1VQL A;  4LNQ A;  1PTO F;  2B2U A;  2K75 A;  3RR5 A;  2QDB A;  2K32 A;  4ZKC B;  2AQ3 B;  1N34 Q;  3HOW B;  3WWV A;  2MGS A;  4BBS B;  2E8G A;  1YVC A;  4ILW A;  4AIM A;  3CCV A;  2ZXR A;  4R4I A;  5JOB A;  4IFD I;  4LF9 L;  1BBU A;  1MBY A;  1UE6 A;  3S9W A;  3PV0 A;  1SNM A;  3NBH A;  3K5N A;  2NBF A;  2RQX A;  1HNX L;  3CCS A;  5ELO A;  2JA5 B;  5I9O A;  1YBY A;  3MA2 B;  5ELB A;  3K5O A;  3T1H L;  2NZO A;  5M5Y B;  2SDF A;  1IYV A;  2K5H A;  4B9W A;  4K2K A;  4QL5 A;  4EQP A;  4FVM A;  2RDH A;  4KY5 A;  3I3C A;  3TP7 A;  5M3M G;  1CQF A;  3BG3 A;  2RBM A;  2A6H D;  3WDN A;  4JI2 L;  2DGY A;  2B63 B;  4A3B H;  2Y0S E;  1XNR Q;  2N55 A;  4BA1 I;  4JI6 Q;  2QDL A;  1WD1 A;  2BH8 A;  4J1M A;  1KIX A;  3PO2 H;  3TS2 A;  1LV9 A;  4KKS A;  4EVO A;  1X3Q A;  1NMG A;  4H0L C;  5EKK A;  1EU3 A;  2A68 D;  1QJO A;  2DN8 A;  2JSO A;  4C3J B;  3J81 L;  4ZKB B;  5BN3 A;  4A3J G;  1FGB D;  2KCN A;  3HFZ B;  5TSS A;  4WFN 3;  3GTG B;  3PUZ A;  3J80 c;  2JXM B;  1QIL A;  3S17 B;  4B3T Q;  2YU9 H;  3RLF A;  2F4V Q;  4OIK A;  3HOX B;  4GS3 A;  1AP0 A;  2F0P A;  2OXP A;  1WTO A;  5IY0 A;  1KC8 C;  1CKM A;  2EY2 A;  2JA8 B;  3HOY H;  2E2H H;  2F52 A;  4EX5 A;  1LTI D;  4DAV A;  3PIO 3;  4IJH A;  4PMC A;  3GTK B;  4KKT A;  2RDF A;  1C8C A;  4OIJ A;  5A35 A;  4DUZ L;  2HCC A;  2NUC A;  4NKL A;  2CCZ A;  1KRT A;  1WJJ A;  4JI7 L;  1STY A;  2F0I A;  3I91 A;  5ELN A;  2Q2T A;  3IL8 A;  1HNZ L;  2I5M X;  1CA6 A;  4KHP Q;  2Z6B A;  1Q8K A;  2FHT A;  2ZXP A;  4DV0 Q;  2R92 H;  4OO1 H;  1VQB A;  1DON A;  3GQB A;  1G2T A;  1KLU D;  1KAB A;  1WTR A;  1PV4 A;  4HSV A;  3NBH B;  1QNU A;  2N3S A;  4C1N I;  3F2D A;  1H9S A;  2X6G A;  4HJ7 A;  4DR6 Q;  1SSO A;  4HN7 A;  2KED A;  1H9M A;  4HAE A;  3J80 i;  5IWA L;  1LTT D;  2V1C C;  2EY5 A;  1HQM C;  2Z8L A;  5IP9 H;  3FKI G;  3HOZ H;  1UE1 A;  5GQO A;  4NXN Q;  3ULJ A;  1F9Q A;  2E2H B;  2HD3 A;  2TSS A;  1N32 Q;  2XIW A;  1FJG Q;  5I6Y A;  4HIM A;  5C3E G;  2CQA A;  1E3P A;  1GD7 A;  5LHY 1;  1PFN A;  4A3E H;  1GM5 A;  5J39 A;  3PF5 A;  1HFG A;  4DV7 L;  3S1M H;  4RKL A;  1O7L A;  4ALP A;  1XWE A;  1TVX A;  1X6O A;  1SE3 A;  4QMG A;  4OEM B;  4YHH L;  1TQO A;  4CDE C;  2I5L X;  2K6A A;  4OO1 I;  5D3D A;  4FF2 A;  2CH4 A;  2B2Y C;  1YEZ A;  2H5X A;  2VUM B;  1GOZ A;  3L2P A;  4BXX G;  1FYC A;  1L2F A;  3HKS A;  3VA5 A;  4XQJ A;  1HA5 A;  4KKU A;  4BA2 I;  3NTH A;  5C3X A;  2KA7 A;  1K0S A;  1TT2 A;  2EYJ A;  4MTK A;  3A8J E;  3P75 A;  4JBW A;  2D0P A;  1IBK Q;  2I5H A;  4TSS A;  3IAY A;  1JOK A;  2VS1 A;  4A3E B;  3I73 A;  2PI2 E;  1B9N A;  4L8J A;  3P7J A;  4G7O C;  1PVO A;  3J80 L;  4QY7 A;  1NBW A;  3H94 A;  4FYD A;  2KCC A;  3RLO A;  5E1F A;  4DR1 L;  1BNZ A;  1RTO A;  4RCN A;  3CCM A;  2UUB L;  1SBB B;  1UEA B;  2N49 A;  3CCR A;  5E3F A;  3G6J B;  4HJ8 A;  5FJ8 G;  3ULP A;  1WTQ A;  3AFQ A;  4DNI A;  2WAQ G;  3MXG A;  1QVF A;  4PMB A;  2RSO A;  2DUD A;  3D6W A;  2JN4 A;  4B3S Q;  2K28 A;  3KK7 A;  1EIH A;  4YY3 Q;  2NYZ D;  4XQQ A;  1D2B A;  2JA6 B;  2EIF A;  5M3F B;  2RDG A;  2I07 B;  4BY7 G;  1B50 A;  2Q2U A;  3ITP A;  2RVL A;  2XWB B;  2F0T A;  4F87 A;  5IYC G;  1PTO B;  1QG7 A;  1CQV A;  1UWV A;  4RFB A;  1QCB D;  2JA7 G;  4R9W A;  1XNQ Q;  1JE5 A;  2HDL A;  2EYH A;  4HJA A;  5JJZ A;  2Z0S A;  4JBM A;  1X3P A;  1E2W A;  2NB0 A;  3C2P A;  4OWW B;  4FDB A;  2F0S A;  4MTN A;  4L5Q A;  5LMN W;  3T4A C;  2E2J B;  2K50 A;  1TWG H;  2EXD A;  2Z6K C;  1M4V A;  1EYD A;  3LGJ A;  2G9D A;  2E5L L;  3WOF A;  1HNX Q;  3KFU A;  4TRD A;  2MJ8 A;  1E22 A;  2JEA I;  2NTS A;  1ICF B;  5LL6 X;  3I55 A;  3K59 A;  1TWA H;  3T1H Q;  3H6M A;  3L7Z C;  2HCI A;  1AFP A;  5C5M A;  3BVG A;  3D4W A;  2E2D C;  2F0Q A;  3GTP B;  3SE0 A;  2EYP A;  2WII B;  4GNX B;  2R93 H;  1YNJ C;  3MEH A;  1U4R A;  5M5X B;  2UUA L;  3QOJ A;  3J7A 5;  1X3G A;  1E1T A;  1NTG A;  1TWC H;  5G3L D;  4LF7 Q;  2KJX A;  4GKK L;  5EPK A;  2FJ2 A;  3FPU B;  3GTL H;  4IUQ A;  2A73 B;  3HG9 A;  2OQK A;  1G29 1;  5JEA J;  2ICI A;  3CC4 A;  2PQA B;  5EBC A;  2I0Q A;  4KLK A;  1YZ6 A;  1PH2 A;  4BY1 H;  1VQN A;  1VMP A;  1BBX C;  1JMC A;  1BUV T;  4A3C H;  2BA0 A;  2K01 A;  5CYU A;  1OXS C;  1GXD C;  2RCF A;  1SXT A;  4A3G H;  2D2C C;  2IWH A;  3EBE A;  1CSQ A;  1V43 A;  2MHV A;  4C3H B;  1BCP F;  2PMZ E;  4A3F H;  1XPR A;  4WRD A;  4BS9 A;  4C1N K;  3MXN A;  1SFO B;  4NP5 A;  1WCM H;  3S2D B;  3TZU A;  4DAY A;  1K8G A;  4BBR B;  3NTK A;  2HT1 A;  5FO7 B;  4LF8 Q;  2K5D A;  1D1I A;  3SVM A;  4IUV A;  1HR0 L;  1KTK A;  1EWC A;  4LFB L;  1KL9 A;  5E4X A;  2MP1 A;  3KJP A;  2LS0 1;  4A3I B;  3ONA B;  1VMC A;  5CV9 A;  3CRL C;  1U4P A;  1I3Q B;  3DEO A;  1FNU A;  1EWI A;  3FDT A;  5FO9 B;  1GHJ A;  4A3K H;  3OIP A;  2FMM A;  5C6A A;  1HNZ Q;  5AJ3 L;  3RZD B;  2HUG A;  4DU9 A;  4XYO A;  2F0G A;  3EIV A;  4KN7 C;  3GV6 A;  3HOU G;  1JJG A;  2F0F A;  4NMZ A;  2RHS B;  2F1M A;  1Q8I A;  2WB1 G;  4C2M H;  1E1O A;  1A6X A;  1VQ7 A;  2RSN A;  1MIU A;  5C4Z A;  2R7Z G;  4PZ6 A;  1JWS D;  1O7I A;  3MWY W;  1JOQ A;  4DKA C;  1SNP A;  1AZP A;  3W2D A;  4R4Q A;  1HZC A;  2YTY A;  4S3S A;  3L0O A;  3A54 A;  1GUO A;  1I4Q A;  1S5C D;  5C0X J;  5C44 B;  3T16 A;  1Y1W G;  3CF5 A;  3PUW A;  1QWY A;  2B2W C;  5NUC A;  2E2I H;  5IP7 G;  3EA6 A;  5IYD G;  1EIG A;  2VB3 X;  3T1Y L;  1HHV A;  1KDA A;  4JBJ A;  2B8G A;  2JEB I;  1QOH A;  1JOO A;  1KAA A;  4RWS C;  4Y7N H;  1VQ4 A;  2KEE A;  4DV5 L;  4DV7 Q;  2VW9 A;  3I4L A;  2E76 C;  2K33 A;  1TU2 B;  1CT1 D;  2KQ3 A;  4A93 B;  4WJ4 A;  3ERO A;  1PXU A;  5C4J H;  4YHH Q;  1VQO A;  1U4L A;  4FP5 D;  1EZ6 A;  5A2Q E;  2AKW B;  4HSP A;  2WV6 D;  3BDL A;  3J7A V;  4A3D H; 
#chains in the Genus database with same CATH homology
 3HKZ E;  3TRZ A;  1XMQ Q;  1N36 Q;  1VQ5 A;  1N9W A;  1UE5 A;  3A5Z B;  1YIJ A;  1VQL A;  3OYY A;  4LNQ A;  3I4N H;  2K75 A;  5C4X H;  3S1R H;  3RR5 A;  3KF6 A;  3MXN B;  1ASY A;  5HY6 A;  4JI2 Q;  3A5U A;  1N34 Q;  4JI0 Q;  2B3G A;  3K81 C;  3AEV A;  3HOW G;  3WWV A;  4IFD G;  4JI1 Q;  1K83 H;  1OXU A;  2E8G A;  1YVC A;  3CCV A;  4AIM A;  4DR4 L;  1G6P A;  1NMF A;  2ZTD A;  4R4I A;  1VQ9 A;  4IPD A;  4IFD I;  4POG A;  2WP8 J;  1VQC A;  4LF9 L;  5J3B A;  4DV6 L;  3UDX A;  1BBU A;  1UE6 A;  2RF4 A;  3PV0 A;  1JT8 A;  4RMF A;  4JV5 Q;  1HNX L;  4UP9 A;  1KHI A;  1AE3 A;  3CCS A;  3K7A H;  1SN8 A;  1V1Q A;  5ELO A;  4DR2 Q;  2MO1 A;  1VQ8 A;  1N33 Q;  2C35 B;  2VY3 A;  1LTL A;  4LUZ A;  2IY5 B;  1EFW A;  1TXY A;  2JA5 G;  4P71 A;  4XIG S;  3BU2 A;  1YBY A;  3H3V I;  1KRS A;  3G48 A;  4YWM A;  2NZO A;  3EN2 A;  3T1H L;  5FJ8 H;  2K5H A;  1VQM A;  4DR7 L;  2AWN A;  4QL5 A;  5FLM H;  1QVC A;  4B3M Q;  2K4K A;  4JOI C;  2UUB Q;  4PZ7 A;  4DPG A;  3I56 A;  3SGI A;  1IYJ B;  1C7Y A;  1IBL Q;  2ZJP A;  4J15 A;  5M3M G;  1K73 C;  4JI2 L;  4A3D H;  4TVA B;  4X6A H;  4X65 L;  4JI0 L;  2DGY A;  2R93 G;  2K14 A;  4GLV B;  2B63 G;  2NVQ H;  4A3B H;  2Y0S E;  2B29 A;  1XNR Q;  2JA6 H;  4BA1 I;  4KI0 A;  5M3F H;  4JI6 Q;  5C4X G;  3JC6 6;  4JI3 Q;  4DUZ Q;  4BY7 H;  2BH8 A;  1KIX A;  3PO2 H;  3TS2 A;  4IOC A;  2UU9 L;  4JI5 Q;  3STB C;  5C0X G;  2NVT H;  4JI7 Q;  5IYC H;  1NMG A;  4IPH A;  2CFM A;  2MQH A;  2QEX A;  2JA7 H;  3MEF A;  3BZC A;  4DR2 L;  1N33 L;  5C0X I;  2ALY B;  2ATW A;  1PH4 A;  4UY8 C;  1XMO L;  4A3J G;  3HFZ B;  5IYB H;  4BY1 G;  3PUZ A;  1LM0 A;  1CKN B;  1Y1V H;  3J80 c;  1PH7 A;  1EIY B;  2IX0 A;  5GAD C;  3J81 j;  2JJQ A;  2IX1 A;  1NY4 A;  4A3C G;  3KYH C;  4B3M L;  4B3T Q;  2E2J H;  2MNA A;  2YU9 H;  4A3G G;  4Y52 H;  1Z47 A;  3HOV G;  3PIP A;  3RLF A;  2KCT A;  2F4V Q;  5E7N A;  3NEL A;  4PMW A;  2BH2 A;  4GS3 A;  3HOX G;  4A3F G;  1KC8 C;  5IY0 A;  1CKM A;  5GRO A;  5IWA Q;  3HOY H;  2JA8 G;  1J6Q A;  1VS0 A;  2E2H H;  2F52 A;  4EX5 A;  1S40 A;  1WCM G;  4IJH A;  2QA4 A;  3KF8 B;  1EYG A;  1HNW L;  1YHA A;  2E5L Q;  4YCV A;  3KLW A;  5IE8 A;  3RZO H;  2R6G A;  3G4S A;  5C3E H;  4QJF A;  2KBN A;  4P75 A;  2OTJ A;  3H15 A;  4DUZ L;  4LFA Q;  2CCZ A;  1W3S A;  1KRT A;  3I2Z A;  3GTP H;  1WJJ A;  4JI7 L;  1I50 H;  1Z9F A;  5M5X H;  3A0J A;  5ELN A;  1CKN A;  3KF6 B;  3CXC A;  2Q2T A;  2N8N A;  4B3R Q;  4DV1 Q;  1HNZ L;  1RL2 A;  5JJK A;  2I5M X;  1YIT A;  4KHP Q;  1L1O C;  1Q8K A;  3HKZ G;  4AH6 A;  5LMN L;  4GN3 B;  3GTO H;  4DR5 L;  4DV0 Q;  2R92 H;  4EQ5 A;  4L5S A;  1VQB A;  1QZG A;  2UUA Q;  3I4M G;  4X62 L;  4A3K G;  1L1O B;  1XPO A;  4DV2 L;  1YJ9 A;  1PV4 A;  3NBH B;  4GKK Q;  3F2D A;  2N3S A;  4XTC S;  4OX9 L;  4HJ7 A;  4DR6 Q;  3TRE A;  1IBM Q;  1VQK A;  4LF6 L;  4DV3 L;  1Y1V G;  4K0K L;  3UDI A;  4X64 Q;  4QIW E;  3JAM c;  4BXX H;  1ASZ A;  3J80 i;  5IWA L;  4YCW A;  5K36 G;  2V1C C;  4IOA A;  1BBW A;  3BJU A;  3K0X A;  3U4V A;  1SLJ A;  1PHJ A;  4O0A A;  1A62 A;  5IP9 H;  2UXB L;  3FKI G;  4C3H H;  1DGS A;  3HOZ H;  3PGZ A;  1UE1 A;  5GQO A;  4NXN Q;  2MFI A;  3ULJ A;  2A8V A;  1WFQ A;  2EQS A;  3W1B A;  4DR3 L;  4A3L G;  3NEM A;  3DLL A;  1N32 Q;  2YTV A;  5FLX c;  1SFO H;  4A3M H;  4LFC Q;  3S2D H;  4YWL A;  1PH9 A;  4BBS G;  1Q7Y C;  5BR8 L;  1FJG Q;  1XTD A;  1K3R A;  1X65 A;  4BBR H;  4HIM A;  1QUQ A;  5C3E G;  1E3P A;  1GD7 A;  1TWH H;  1L1O A;  4A3E H;  1GM5 A;  4JI8 L;  5M5W H;  1K9M C;  3PF5 A;  2RHQ B;  4JCV E;  1I94 Q;  4DAM A;  3CQZ H;  1WI5 A;  2OTL A;  4DV4 L;  1G51 A;  4IJL A;  4DV7 L;  1PH6 A;  3S1M H;  1EUJ A;  2LSS A;  4JI4 Q;  3ULL A;  4JG2 A;  3BZK A;  2D0O A;  1OXV A;  1IL2 A;  4X66 Q;  1A0I A;  1FGU A;  4ALP A;  4RG1 A;  1X6O A;  2IT1 A;  2JK8 A;  1S72 A;  1Q46 A;  1GVP A;  4YHH L;  3PIO A;  4OO1 G;  4GN4 B;  2Y0S G;  4DR6 L;  1UEB A;  4A3I H;  1IBM L;  2I5L X;  2VZA A;  1Q81 C;  1E7Z A;  1I3Q H;  3S14 H;  4LFB Q;  4DR1 Q;  4OO1 I;  4LF4 Q;  2XTI A;  2Z6K A;  3RZD H;  4LF5 Q;  3PUX A;  1XMQ L;  1N36 L;  2VNU D;  4PZ8 A;  4POF A;  1YEZ A;  2H5X A;  2VUM G;  3F2C A;  1CKO A;  4R4T A;  3L2P A;  3ICE A;  3GO5 A;  3HOU H;  4NXM Q;  3PSI A;  1L2F A;  4BXX G;  1PFS A;  4L5T A;  2AMC B;  1PYB A;  3JAM i;  1Q86 C;  1M90 C;  3HKS A;  2UUC Q;  4A3D G;  1MKH A;  4TQU S;  1X9N A;  4LUO A;  1N34 L;  1N32 L;  5JJL A;  4JI1 L;  4BA2 I;  3I4N G;  2R7Z H;  1T9H A;  2OCE A;  2ZM6 Q;  5LMU Q;  1W2B A;  1JJ2 A;  4GKJ Q;  1CUK A;  4JBW A;  2D0P A;  1IBK Q;  3TQY A;  3U50 C;  4O2D A;  2L15 A;  2AWO A;  1N8R C;  2I5H A;  4OWX B;  3GTQ H;  2QGQ A;  4JV5 L;  1VQ6 A;  3TEH B;  1I6H H;  1GO3 E;  2VS1 A;  5C44 H;  2AHO B;  3ERS X;  4PG3 A;  1Y1W H;  2PI2 E;  1PH5 A;  4MZ9 A;  4OXP A;  3CMA A;  1PVO A;  2A1A A;  5HGQ A;  5IP7 H;  4HID A;  1HR0 W;  1YHQ A;  5IYD H;  1S3O A;  4QY7 A;  1YJW A;  2IHE A;  1NBW A;  3RLO A;  1H95 A;  4DR1 L;  3CPF A;  1VQI A;  1PH8 A;  2PI2 A;  3CCM A;  4HIK A;  2JQO A;  2UUB L;  1YI2 A;  2N49 A;  3DM3 A;  3CCR A;  2FXQ A;  1IBL L;  4HJ8 A;  5FJ8 G;  3VDY A;  4NPS A;  3ULP A;  3H0G H;  5FLM G;  2UUC L;  2VQF Q;  4A93 H;  1BVS A;  4C3I H;  3TS0 A;  2HHH Q;  3AFQ A;  1OXT A;  4DNI A;  2WAQ G;  1V9P A;  4DUY Q;  1EQQ A;  1QVF A;  1XNR L;  1KXL A;  1JJC B;  4R1J A;  3UE0 A;  4JI6 L;  2DUD A;  4B3S Q;  2A19 A;  1VQE A;  1WYD A;  3M4O H;  1P8L A;  3F1Z A;  4JI3 L;  3CCQ A;  1IBK L;  4YY3 Q;  1PH3 A;  2LXK A;  3RN5 A;  4JBK A;  3CW2 C;  4JI5 L;  2CQO A;  4A3B G;  2JA6 G;  2EIF A;  4LW1 A;  2Q2I A;  5M3F G;  3M9B A;  1NE3 A;  3NEN A;  1LYL A;  4BY7 G;  1FL0 A;  1SR3 A;  4R4C A;  3PO2 G;  2Q2U A;  3FP9 A;  3AYH B;  4HIO A;  3HOW H;  2WAQ E;  4A4I A;  5IYC G;  1X3F A;  2UXC Q;  1AH9 A;  1QUQ B;  1UWV A;  2JA7 G;  1AE2 A;  1JE5 A;  3M85 A;  3GTJ H;  1XNQ Q;  3S16 H;  4HJA A;  4B3T L;  2Z0S A;  3F8T A;  4JBM A;  3PUY A;  4QQB X;  5IYB G;  2F4V L;  4L5R C;  1PH1 A;  2N78 A;  1B70 B;  4DR4 Q;  4OWW B;  4FDB A;  4MTN A;  5LMN W;  4L5Q A;  3H3V H;  2CKZ B;  4P73 A;  2NZH A;  2LXJ A;  2K50 A;  3PO3 H;  1TWG H;  1U0L A;  2EXD A;  5GAH C;  1X55 A;  3D31 A;  2KEN A;  5IT9 c;  2Z6K C;  2HHH L;  3FHW A;  3LGJ A;  2JA9 A;  2JA5 H;  2E5L L;  3KFU A;  1HNX Q;  5DLQ E;  5M5Y H;  3GTM H;  4AYB G;  2R7D A;  3RNU A;  4B3S L;  3W1G A;  2PNH A;  4GLA C;  3U4Z A;  1KD1 C;  1E22 A;  3HOY G;  5EAY A;  3PCO B;  4YY3 L;  3U58 A;  2JEA I;  1FVI A;  1K0R A;  2GVA A;  4LFA L;  3I55 A;  3CC7 A;  1C0A A;  1TWA H;  3T1H Q;  3L7Z C;  2VQE Q;  1VQP A;  4GNX C;  3CPW A;  5M3M H;  1RIP A;  2HIV A;  1XJV A;  4DR7 Q;  4NB3 A;  1J5E Q;  4DV1 L;  4B3R L;  4KHP L;  2XGT A;  1VQG A;  1EIF A;  1HZA A;  1K8A C;  4DV0 L;  1YHB A;  4A76 A;  4GNX B;  2B63 H;  2R93 H;  1D7Q A;  4AQY Q;  4YWK A;  5JJI A;  2UUA L;  3J7A 5;  2UXC L;  4GN5 A;  3CP0 A;  4AYB E;  1X3G A;  4GOP A;  1WOC A;  1E1T A;  1XNQ L;  1JB7 A;  1NTG A;  1TWC H;  4LF7 Q;  4ME3 A;  1VQF A;  3G6E A;  4GKK L;  4X65 Q;  3RLN A;  1P16 A;  4DAY B;  3G71 A;  2R92 G;  3J7Z C;  3D0F A;  2KHJ A;  4JYA Q;  4APV A;  3KDF A;  1HR0 Q;  4X64 L;  3GTL H;  4WJ3 M;  1Q12 A;  3UDG A;  2OQK A;  4IO9 A;  1G29 1;  3I4O A;  4YCU A;  1X56 A;  2RCN A;  4C3J H;  1HZB A;  5JEA J;  1LUZ A;  2NVY H;  2F3I A;  2PQA B;  2UU9 Q;  3CCJ A;  1X54 A;  4KLK A;  4A3J H;  2I0Q A;  3CC4 A;  1YZ6 A;  2HQL A;  3OTO Q;  1PH2 A;  1MJE A;  4BY1 H;  1VQN A;  3GTG H;  1JMC A;  2OWO A;  4A3C H;  1IZ6 A;  4NXN L;  3CAM A;  1D8L A;  1KQS A;  2BA0 A;  2YTX A;  5AJ3 Q;  2WFW A;  1A63 A;  1OXS C;  3PO3 G;  3S17 H;  2UXD Q;  4A3G H;  3OW2 A;  2VL6 A;  4LFC L;  3HOV H;  1XMO Q;  3EBE A;  1CSQ A;  3PUV A;  1V43 A;  4GNX A;  5IP9 G;  1FJG L;  4LWC A;  2PMZ E;  4P74 A;  2ASB A;  3HOX H;  3E0E A;  4IPC A;  2VQE L;  1Y14 B;  4A3F H;  1XPR A;  3HOZ G;  3CME A;  1Q1E A;  2JA8 H;  1J5E L;  3M4P A;  1SMX A;  1I94 L;  1WCM H;  2ZTC A;  4A3M G;  3GTK H;  4AQY L;  4JI4 L;  1K8G A;  1XPU A;  4IFD J;  3ER0 A;  4BBR G;  2GVB A;  2YV5 A;  3E9H A;  4X66 L;  2HT1 A;  4A3E G;  3S2H H;  4LF8 Q;  4LF7 L;  3W5O A;  1HNW Q;  3B6Y A;  1B7Y B;  2PQA A;  3CCU A;  2ID0 A;  3GDE A;  2MO0 A;  4OON A;  2BA1 A;  4JYA L;  1M1K C;  3K80 C;  4UPA A;  1HR0 L;  1QZH A;  4LFB L;  4HJ9 A;  4A75 A;  1I5F A;  1YNX A;  1KL9 A;  4LF4 L;  1X3E A;  4LF5 L;  4UP8 A;  3CC2 A;  3KJP A;  1B8A A;  3CCE A;  4A3I G;  2JE6 I;  1VQD A;  2D62 A;  3OTO L;  1UE7 A;  3T1Y Q;  4OWT B;  3RN2 A;  3I4M H;  3S24 A;  3STB D;  1EWI A;  4UP7 A;  5GAE C;  4P72 A;  4A3K H;  4NXM L;  1HNZ Q;  4LUV A;  5AJ3 L;  3PF4 A;  1SE8 A;  2UXD L;  5LMN Q;  2K5V A;  3J81 c;  4DR5 Q;  1EQR A;  4DV5 Q;  1OTC A;  2ZJQ A;  4HJ5 A;  4R4O A;  1Q1B A;  2YYZ A;  2ZTE A;  5GAG C;  2CWA A;  3EIV A;  4X62 Q;  2NVX H;  2ZM6 L;  1VQH A;  1GKH A;  2IHF A;  5LMU L;  3HOU G;  4GKJ L;  1JJG A;  4DV2 Q;  2NN6 G;  3UE1 A;  4JOI A;  2RHS B;  1EOV A;  1HJP A;  2WB1 G;  4QGU A;  2OQ0 A;  1BKB A;  1CSP A;  4MNO A;  4C2M H;  4OX9 Q;  1E1O A;  3S1N H;  1VQ7 A;  2NN6 I;  1MIU A;  3FKI H;  4LF6 Q;  4DV3 Q;  4K0K Q;  2R7Z G;  4PZ6 A;  1TWF H;  1VQA A;  1O7I A;  2ES2 A;  3KJO A;  4A3L H;  4DKA C;  3M3Y H;  5H1S E;  4LF8 L;  2GN5 A;  3GD7 A;  4R4Q A;  1HZC A;  1U5K A;  1IXR A;  2YTY A;  3L0O A;  1QVG A;  3S1Q H;  4BBS H;  1SRO A;  2UXB Q;  3CD6 A;  4GLX A;  1HZ9 A;  1KAW A;  5C0X J;  5C44 G;  4DR3 Q;  3CF5 A;  4GOP C;  3PUW A;  1Y1W G;  3ZJY C;  2E2I H;  2WB1 E;  1PYS B;  1L0W A;  3IRB A;  5IP7 G;  5IYD G;  1E24 A;  3I7F A;  5BR8 Q;  1A8V A;  1VQJ A;  4KHZ A;  3A74 A;  3AQQ A;  3T1Y L;  4GOP B;  3CCL A;  1R9T H;  3AFP A;  4JBJ A;  1VCI A;  4DK3 C;  4LF9 Q;  2JEB I;  4JI8 Q;  4DV6 Q;  2VQF L;  1MJC A;  2Q2H A;  4Y7N H;  1VQ4 A;  4DV4 Q;  2KHI A;  2R7F A;  4DV5 L;  4DUY L;  2VW9 A;  4DV7 Q;  3KDF B;  1C9O A;  4H02 A;  5JEA G;  3S15 H;  2KCM A;  3H0G G;  3K8A A;  4DK6 C;  4A93 G;  4WJ4 A;  1OXX K;  3E9I A;  3UDF A;  5C4J H;  4IPG A;  4YHH Q;  1VQO A;  2K5N A;  1HH2 P;  1NJI C;  4JC0 A;  1SRU A;  3M4Q A;  3J81 i;  1Q82 C;  3M7N A;  3KOJ A;  3Q8D A;  1PA6 A;  2AKW B;  2VUM H;  3K7U C;  2K52 A;  2HIX A;  2CWP A;  1YJN A;  3F2B A;  2ZJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...