1WFQA

Solution structure of the first cold-shock domain of the human kiaa0885 protein (unr protein)
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
89
structure length
89
Chain Sequence
b'GSSGSSGGYPNGTSAALRETGVIEKLLTSYGFIQCSERQARLFFHCSQYNGNLQDLKVGDDVEFEVSSDRRTGKPIAVKLVKISGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNR protein
publication title The NMR solution structures of the five constituent cold-shock domains (CSD) of the human UNR (upstream of N-ras) protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 6
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2004-05-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1wfqA01
5GAGC 4IPHA 4OO1I 4JC0A 4EX5A 2K5HA 3EIVA 4B3MQ 4JI7L 1UEBA 4X64L 4MZ9A 3CCVA 1PH4A 2E2HH 3I4OA 4YCWA 4B3RQ 4DV4Q 4DV3L 4HJ5A 5C3EG 3T1HL 1XNQQ 2ZTDA 4JI6L 4GS3A 3GTKH 1YITA 1PH7A 3CPWA 2Z6KA 3M4OH 4DR6L 5JJIA 3KLWA 4FDBA 4DAMA 5LMNQ 4QY7A 1OXVA 3OYYA 5IY0A 4JOIA 1G291 2UUBQ 4X66Q 2UXDL 3A5UA 2OTLA 4L5QA 1J5EL 4LF7L 4A3FG 1CKMA 1VQBA 1X54A 1N9WA 1X3GA 1JJCB 4IPCA 1VQIA 1TXYA 2JE6I 2NN6G 5GROA 2VS1A 2ZJRA 4GN3B 2QA4A 4JYAQ 4LF6Q 4BY7H 1KC8C 3HOUG 4A3LH 1HNXQ 1BVSA 4OO1G 3M85A 2E2JH 1RL2A 3HOWG 1V43A 4DNIA 4JG2A 1FJGL 3FP9A 1WCMG 1QVFA 1PH6A 4LNQA 2K50A 3CPFA 3PF4A 1I6HH 2YU9H 1VQFA 3H3VH 3BU2A 4DV2L 4DUZL 3S14H 2ASBA 4JI2L 3HOYH 3KOJA 3B6YA 3CF5A 1I94Q 4QL5A 4DV5Q 1QVCA 3T1YL 4QQBX 4B3ML 3ULJA 1AE3A 2F52A 1Q1EA 2CWAA 3TEHB 4DV6L 1XNQL 2VQFL 3M4PA 2NZHA 3ERSX 4DUYL 2K5NA 4LF9Q 3AEVA 1PFSA 3HOXH 2IX1A 3EN2A 5IP7G 4GNXC 1QUQA 1X3EA 3RN5A 4BY1H 1XMQL 4OWWB 4YHHL 5LMNL 2R92G 1K8AC 4KHPQ 1IBLQ 4X66L 1OXSC 5M3MG 1VQ9A 1N33L 1EIYB 4A3CG 2PNHA 3KJOA 1E1OA 1SMXA 2KHJA 2F3IA 2QGQA 2WAQE 2R7DA 4AYBE 3HKZE 3M9BA 4KI0A 3CCRA 3STBD 3CCSA 4DR5Q 1D8LA 1EQQA 1KHIA 2RHQB 3J81c 3CC2A 4B3SQ 3GTQH 4R1JA 2R7FA 4ALPA 3S1NH 4A3DG 5C4XG 1X55A 4Y7NH 2ZJQA 4LFCQ 1UE6A 1VQ4A 3RLOA 1LM0A 5FJ8H 4JBMA 5DLQE 1JT8A 1N34L 2YYZA 3PIPA 1ASYA 4WJ4A 1NY4A 3TREA 2V1CC 1VQNA 5GADC 4Y52H 3KJPA 2HHHL 3M3YH 2YTXA 3GDEA 1K3RA 5IP9H 1QUQB 3HOUH 4DPGA 4OWXB 1VQ8A 5EAYA 4X64Q 2AHOB 1SFOH 4BBRG 3D31A 4MTNA 3D0FA 5J3BA 4DV5L 3UDGA 4DR4L 4ME3A 2VY3A 4YCUA 2HQLA 3CD6A 5M5WH 2JA6G 3PV0A 1XPUA 1U0LA 4X65L 1I50H 4P72A 2JA8G 1Q86C 1WOCA 1N36L 5E7NA 1NBWA 2D62A 2MO0A 2VL6A 1UE7A 1Q46A 5FLXc 3GTGH 1J6QA 3FKIG 4NB3A 4LF7Q 3J80c 1TWGH 1PH5A 4A3EG 1KRSA 3JC66 1V9PA 4GOPA 2JEAI 1VS0A 3J7A5 5GAHC 1Y1WG 3S15H 3AFQA 3KDFA 3HKSA 2I5MX 1YJWA 4DV1Q 1GO3E 4R4CA 2AWOA 5IP7H 4B3SL 5C44G 4LF8Q 3KF6B 1X9NA 2MFIA 4C2MH 4IOCA 1WI5A 2R92H 5JEAG 1HZBA 2R93G 2L15A 4LFCL 4DK3C 4DAYB 4HIOA 2A8VA 3CCQA 1SRUA 5IYDG 1G51A 1YBYA 4A3IG 1M1KC 2ZTEA 3STBC 2CCZA 2YV5A 1L0WA 2R6GA 4A3JG 1VQLA 4A3DH 3RLFA 4C3HH 3G71A 2VUMG 3T1YQ 1VQEA 1A0IA 3F2DA 4B3RL 4PZ6A 3PF5A 3S2HH 5C0XJ 4HJ7A 2E2IH 1X6OA 3HFZB 4GOPB 2AKWB 3UE0A 3UDIA 3S17H 4DV6Q 3SGIA 1NMFA 4DR3Q 1IBKQ 3I4NG 2VQFQ 4DUYQ 1AH9A 3RNUA 3KDFB 4GLAC 1S72A 2H5XA 3PUZA 2UU9L 1S40A 4UP8A 1OXXK 5IT9c 5JJLA 4HIMA 4DR1L 3S1RH 1XMQQ 1VQGA 4YHHQ 2ZM6Q 3DM3A 2BA1A 4QJFA 1CKOA 4RMFA 5IYBG 3I7FA 4HJ8A 4HJ9A 1HR0Q 4LF5L 2JK8A 2E5LL 4IPDA 1N33Q 1XNRL 1GVPA 2K4KA 4GN4B 4IFDJ 2JA7H 3KF8B 2ID0A 3BZKA 2OCEA 4KHZA 4RG1A 1VQDA 2LXJA 4IJHA 2JA8H 3CCJA 1B8AA 1K9MC 1W2BA 4LFBL 3K0XA 3PO3H 4XIGS 4A3MG 4L5TA 1HZCA 1GKHA 2N78A 4DV1L 1TWCH 2CWPA 4A93H 3FKIH 4L5SA 4LF8L 5LMUL 1N34Q 3TS2A 1CKNA 1PYBA 2HHHQ 2HIVA 2DGYA 1LYLA 4PZ7A 1P16A 2ES2A 2RHSB 4BA2I 5LMNW 1YIJA 3RZOH 3ICEA 1CUKA 1MKHA 5M3FH 1EYGA 1KL9A 4DR4Q 5C4JH 4A3GH 2R93H 1Q8KA 3IRBA 2Y0SG 3HOVH 4X65Q 1N32Q 1V1QA 5IYDH 1Z9FA 4A3IH 2JA9A 2CFMA 1N36Q 4DR3L 1IBKL 1L2FA 3K7AH 4AIMA 4A3JH 2R7ZG 3J81i 4JI4L 1KD1C 1Z47A 3NELA 3I55A 1TWAH 4LUZA 5K36G 1DGSA 4R4QA 2ZM6L 5M5YH 1HR0L 2MQHA 1CKNB 1E1TA 3F1ZA 4IPGA 3FHWA 4A75A 1U5KA 4YWKA 4NXNQ 5IYCG 2Z6KC 3S16H 2A19A 5C3EH 2Q2TA 3VDYA 4UPAA 2N49A 1JMCA 1SROA 3CQZH 3ULPA 3W1GA 2K52A 1UE5A 3PO2G 4H02A 4A3KG 1UWVA 1Y1VG 1YHAA 1YHQA 1FL0A 4O0AA 4A3BG 1I5FA 1K8GA 5M5XH 1PV4A 3PUXA 4A3FH 1L1OC 3WWVA 4DKAC 1FVIA 5BR8L 3JAMc 2LXKA 1IZ6A 2KCMA 4UY8C 3A0JA 3I2ZA 4GLXA 4JI1L 4X6AH 3CCEA 2I5HA 5IWAQ 1EQRA 3J7ZC 3CCMA 2N3SA 3AFPA 1QZGA 1N8RC 3HOZG 5H1SE 3U4ZA 3CMEA 2B63G 2KHIA 3HOWH 5C0XI 1MJEA 3AQQA 5ELNA 1VQ7A 2RF4A 1HNZL 4GKJL 5HY6A 1WCMH 4DK6C 2D0OA 4HIKA 4AQYL 5AJ3L 3G6EA 1JE5A 1OTCA 2NVQH 2RCNA 2JA5G 1PVOA 4C3JH 1D7QA 2UU9Q 1N32L 1YEZA 1E22A 1VQOA 5ELOA 2ZJPA 2KENA 1E7ZA 4DR1Q 4GN5A 1VQAA 4WJ3M 4NXMQ 3GO5A 1XTDA 4LF5Q 1BBUA 2E5LQ 2BH2A 3H3VI 2NZOA 1X56A 1VQ5A 1XNRQ 2WB1G 2E8GA 2MO1A 2UUAQ 3PIOA 2UXBQ 4PZ8A 1SLJA 2IT1A 3UE1A 3GTLH 4DV0L 4LFBQ 4NXNL 3PCOB 2IY5B 2UXCL 4YY3L 1PH9A 3M7NA 1CSPA 1E24A 3CMAA 2OWOA 2R7ZH 1OXTA 1IBMQ 1B7YB 1AE2A 5FLMG 4GLVB 2YTVA 3E9HA 1HZ9A 3U4VA 5LMUQ 3W1BA 2PQAA 2JEBI 4JI3L 3S1QH 5M3MH 3K80C 3PGZA 2JJQA 4A3CH 4IJLA 4IOAA 4HJAA 4BXXH 3CC7A 2VZAA 1G6PA 2KBNA 1SE8A 5GQOA 2GVAA 3E0EA 2ALYB 2Z0SA 3F2CA 2K5VA 3RN2A 2CKZB 5C4XH 3LGJA 5JJKA 3UDFA 2I0QA 4A3KH 4PG3A 5IWAL 2VQEL 4OONA 1Y1VH 1HNWL 1IL2A 4BBSG 1S3OA 1IXRA 2GVBA 1PA6A 4K0KL 1BKBA 3HOYG 3RZDH 1JB7A 4DV7L 1NJIC 4UP9A 4A76A 1MIUA 3K81C 1VQMA 4JI4Q 4JV5L 4JI5Q 2GN5A 3I4MG 3H0GG 1QVGA 3S24A 2WP8J 1A8VA 4OXPA 4BBRH 1Q12A 3S2DH 3GD7A 2PMZE 4JBJA 3HOXG 4B3TQ 5GAEC 2JA5H 2JA6H 1HJPA 2UUAL 2OQKA 4XTCS 3GTOH 2UXBL 2N8NA 1SN8A 5JEAJ 4BY1G 1HH2P 4GNXA 2BA0A 2XGTA 2EQSA 1PHJA 3L2PA 2DUDA 1XPRA 1C0AA 3L0OA 3NENA 1IBML 4GOPC 1KQSA 1I3QH 1WJJA 4A3EH 5BR8Q 1XPOA 4P71A 3K7UC 4R4IA 3MXNB 1K73C 3PSIA 3PUVA 4JI1Q 4DR7L 2K75A 2EXDA 1Y1WH 1Q7YC 3CCUA 2QEXA 3NEMA 3Q8DA 5FJ8G 3H15A 1EFWA 3RLNA 5IE8A 3GTJH 4X62Q 1HR0W 4LFAL 5C44H 5FLMH 1HNZQ 2OTJA 1FGUA 1MJCA 4GKJQ 3BZCA 3L7ZC 2F4VQ 2B29A 2WFWA 5AJ3Q 4HIDA 1L1OA 4AQYQ 5IP9G 2NVXH 3TRZA 4IO9A 1NMGA 3CXCA 2YTYA 4LW1A 1EUJA 1TWFH 2IX0A 4GNXB 4KLKA 3DLLA 4GKKL 3PUWA 1LUZA 1VQPA 1X65A 3GTPH 4NPSA 3CAMA 3OW2A 4O2DA 2A1AA 4JI0L 2HT1A 1P8LA 1EWIA 4LWCA 4BA1I 1XJVA 2Q2UA 2VUMH 3S1MH 4JI5L 3NBHB 4PMWA 4POFA 4JBWA 4JI8L 1XMOL 4BBSH 2IHFA 4DV0Q 1EIFA 4TVAB 3I4NH 2UXCQ 3F8TA 4YY3Q 4B3TL 3KFUA 2Y0SE 2EIFA 3ZJYC 3JAMi 2AMCB 4J15A 3M4QA 4JOIC 2WAQG 4AYBG 1VCIA 3HKZG 1PH1A 4DR2Q 2NVYH 3I4MH 3H0GH 4LF4Q 1YNXA 2CQOA 1L1OB 1GD7A 5IYBH 1Q1BA 1E3PA 1EOVA 3J81j 4R4TA 4P75A 1YHBA 1A62A 4YCVA 2MNAA 4DV4L 1YJ9A 4JI3Q 3W5OA 4UP7A 3BJUA 3U58A 1PH3A 4MNOA 2HIXA 1BBWA 1Q81C 2VQEQ 2UUBL 4AH6A 4A3MH 3K8AA 2I5LX 1IYJB 1HNWQ 4X62L 1H95A 1SR3A 4OWTB 1RIPA 4JBKA 1VQCA 3ER0A 4R4OA 1YJNA 4OX9Q 1YI2A 4K0KQ 2F4VL 1LTLA 3J80i 4DV7Q 4JYAL 4LF6L 4P73A 3AYHB 4QIWE 3CP0A 3OTOQ 2B3GA 3CW2C 1HNXL 4JV5Q 2OQ0A 1WFQA 3PUYA 2ATWA 1KAWA 2UUCQ 1QZHA 3EBEA 2JQOA 4YWMA 1KRTA 1X3FA 3A5ZB 3RR5A 1GM5A 2BH8A 4YWLA 3F2BA 3A74A 4IFDI 4JI7Q 3KYHC 1R9TH 2KCTA 1WYDA 4C3IH 1Q82C 1VQ6A 1M90C 3G48A 2PI2E 3KF6A 4JCVE 1YZ6A 1I94L 1A63A 1NE3A 1OXUA 2AWNA 4DV3Q 3T1HQ 4A4IA 2JA7G 4JI6Q 1CSQA 1O7IA 4LUVA 3I56A 1K83H 1TWHH 3CC4A 4DR2L 2ZTCA 3CCLA 4DR6Q 2VW9A 4LF4L 5C0XG 1VQKA 4BY7G 1T9HA 2Q2HA 3PO3G 1PH2A 2C35B 4DR7Q 5IYCH 2WB1E 4LUOA 4LF9L 4A3LG 2UXDQ 1VQJA 4A93G 3U50C 5HGQA 1NTGA 1J5EQ 3G4SA 3TQYA 1YVCA 4LFAQ 3PO2H 4KHPL 2XTIA 2K14A 1KIXA 1C7YA 2IHEA 3GTMH 1IBLL 4POGA 2VNUD 2FXQA 2PI2A 1K0RA 3UDXA 4APVA 4A3BH 2LSSA 4NXML 2D0PA 1B70B 1W3SA 4DR5L 3TS0A 4OX9L 4EQ5A 3ULLA 4GKKQ 4IFDG 1FJGQ 1Y14B 5M3FG 1C9OA 4JI0Q 4A3GG 1JJ2A 1JJGA 3OTOL 1HZAA 1PYSB 4L5RC 1PH8A 2NVTH 3HOVG 4BXXG 1KXLA 3HOZH 2UUCL 1ASZA 4TQUS 2NN6I 4JI8Q 1XMOQ 2PQAB 4DUZQ 4P74A 4DV2Q 4QGUA 2B63H 2Q2IA 3MEFA 1UE1A 3E9IA 4JI2Q 1VQHA
chains in the Genus database with same CATH superfamily
3H6MA 1ENFA 4B3MQ 2B63B 4JI7L 1B53A 2PW7A 1AZPA 3O13A 4MZ9A 3D8GA 3I4OA 1PLFA 1XNQQ 4GZYC 3LWUA 3E5SA 3OHXC 2B39A 3MXPA 4PMBA 4GS3A 4JI6L 3GTKH 1YITA 4F7XA 1PH7A 1PRTD 4KK7A 4RAUC 5KNCA 4DAMA 2LKVA 4JOIA 1G291 3GTKB 2MPMA 1VQBA 1X54A 1D5MC 2XIWA 5GROA 2VS1A 2ZJRA 4K2LA 1ENCA 1LABA 1NAPA 2KEDA 3M85A 1RL2A 2PCFB 2EYLA 4LNQA 4C3JG 3TMEA 1H9KA 3H3VH 3BU2A 4DV2L 3VYSA 4ZRZA 3D6CA 4FF4A 4DNTB 3CF5A 3IAYA 1U9RA 4QL5A 5E4WC 3I91A 3R3OA 4YIJA 4QQBX 1W6JA 1J9OA 1SAPA 5DAUA 4DV6L 3M4PA 4DUYL 2O4XA 1JWUD 2FINB 2M2LA 2IX1A 3EN2A 4JW0A 4FO2A 4XQNA 3URYA 4OWWB 4KHPQ 1K8AC 1VQ9A 2PNHA 1E1OA 2K33A 3HKZE 4KI0A 4QB4A 1EQQA 3CC2A 4FF1A 1D8LA 1KHIA 1DOMA 3J81c 1A2TA 5C4XG 4HMIA 1LT3D 3C46A 3FDTA 2KVMA 1LM0A 1JT8A 3PIPA 1NCVA 3DWQA 4WJ4A 3M3YH 5CORA 2K5WA 1A2UA 2CH4A 1I4QA 1O80A 3KUPA 2F0PA 1SFOH 4BBRG 2DY7A 3J81L 2EDGA 5J3BA 3UDGA 3M3YB 5C4HA 5I2XA 3CD6A 4G7OC 4RFBA 3PV0A 5CYUA 1U0LA 3EJIA 1SFOB 1SNDA 1NBWA 2D62A 2FJ2A 5CV4A 2MO0A 2VL6A 1PTOF 1UE7A 5FLXc 1DCZA 3VR5A 4A3EG 1QE6A 1KRSA 4GOPA 1EIGA 2KHSA 3S15H 1KTKA 2I5MX 2RA4A 1GO3E 4R4CA 1LO5D 1D1KA 2MFIA 4IOCA 1TKWB 1HZBA 3S15B 3UI2A 4HIOA 2A8VA 1IW7C 5FLXL 1G51A 4A3IG 1M1KC 2ZTEA 3KF8A 2CCZA 2KUMA 4L63B 2YV5A 2VUMG 4C3HH 2F03A 1A0IA 2N88A 3KLSA 1JC7A 3GV6A 4KHVA 1EYAA 3UE0A 3S17H 4C3HB 1NMFA 4DR3Q 1V1OA 2X6LA 3PUZA 2UU9L 5IT9c 4DR1L 3S17B 3BVGA 1XMQQ 4YHHQ 4RMFA 4LF5L 1ENAA 4LJZC 1GVPA 2K4KA 4GN4B 1WTVA 4IFDJ 3BZKA 2B2YA 4KHZA 2JA8H 3FEWX 1B8AA 1V1PB 1E2WA 2EY2A 2QILA 3AB9A 1ZEQX 3PO3H 1STYA 2N78A 1GHJA 1TWCH 2JA8B 4L5SA 4LF8L 1N34Q 2XWJB 4BY7B 3PO3B 1CKNA 1PYBA 4XQQA 1HRJA 2HHHQ 2HIVA 1TWCB 5IIFA 2ES2A 3BYTB 1YIJA 5EPLA 1MKHA 1QNUA 1KL9A 2EYFA 2ENBA 5DEHA 5IYDH 2PZUA 5CV9A 1Z9FA 5C3XA 4IURA 1Y8OB 4HEDA 4K5XA 3BS1A 4DK1A 3X3NA 2ZM6L 3OSOA 1HR0L 2MQHA 4IPGA 1E1TA 3FHWA 1U5KA 3HGBA 4NXNQ 5IYCG 4Q0FA 4RKBA 3S16H 2A19A 2Q2TA 2F3WA 4QF4A 3ULPA 1UE5A 3M4YA 1UWVA 3H3VC 1F9QA 1PV4A 1JWMD 3JAMc 3U9SA 1H9RA 2NN6H 3A0JA 5A2QE 4JI1L 4BS9A 1EQRA 3ONAB 2KCNA 1MHWC 1QZGA 5H1SE 1EQTA 3CMEA 4OO1H 2B63G 1VQ7A 3AQQA 2RF4A 1HNZL 4DK6C 3G6EA 4K2KA 3TBIB 1E22A 4CBVA 5IGFA 1VQOA 2KENA 2CW0C 1GUTA 3GO5A 1HPCA 2E5LQ 1X56A 1PZJD 1XNRQ 2MO1A 2UXBQ 1SLJA 1TQOA 2KECA 4TRDA 2IY5B 1Y8PB 2UXCL 3M7NA 1LTSD 4XT1B 2Y0SB 5EBDA 5CV6A 4DAPA 2LY7A 2XSCA 2PQAA 2QEJC 1EY7A 3DXJC 3K80C 3T4AC 3J80E 4HJAA 4BXXH 4JPBW 1SE8A 3SDZA 2X69A 2ALYB 2K5VA 1KLGD 5JJKA 3UDFA 5D65A 2VQEL 4OONA 4RA8A 4K8IA 1GUGA 1HNWL 1IL2A 1S3OA 1PA6A 4K0KL 3BZDB 2RVLA 3EA6A 3K81C 1MIUA 2A6HD 2Q8IB 4JI4Q 2L12A 2VXWA 5LL6X 1SYCA 1PRTF 1Q12A 1O78A 2F0DA 4B3TQ 2JA5H 2UUAL 3GTOH 1JOKA 2IX3A 1HH2P 1JORA 2G9HD 2EQSA 1GOZA 1UEAB 2JA5B 1IBML 3GTOB 4K14A 1QOHA 5IGBA 1I3QH 2NB0A 1XPOA 5BR8Q 4RCNA 3PSIA 3NXWA 1Y1WH 2EXDA 4R8NA 1I3QB 2F0TA 2F0NA 4LFAL 5CV8A 5FLMH 2F4VQ 1JCKB 2WFWA 1Y1WB 1PMRA 1L1OA 4HIDA 5CBAE 2NVXH 1NMGA 3NSWA 3VA7A 1EUJA 1TWFH 1JR0D 1BO0A 2IX0A 4GNXB 3D4RA 1LUZA 4NPSA 2R93B 2HT1A 1MSGA 3FPUB 1XJVA 3EVQA 1TWFB 3NBHB 4PMWA 4DXFA 5BN4A 1EIFA 3I90A 3KFUA 3CRLC 3HEJA 2EIFA 5TSSA 2PMZB 3I4LA 4RHRA 2XN9C 1PH1A 5EKKA 3I4MH 4LF4Q 2CQOA 1Q1BA 4R4TA 4JI3Q 1YHBA 1YJ9A 2CHBD 4UP7A 1CZGA 2PZTA 2HIXA 3I4MB 1ET9A 3DEOA 1IHZA 3MAQA 1FGBD 2JP1A 2EPBA 2B2WA 2RBMA 2I5LX 1F2YA 4OWTB 1DOLA 1VQCA 3X3MA 3W3AA 4DV7Q 1IKMA 4C3HG 5FO9B 4P73A 2OXPA 2EOTA 3CW2C 1CT1D 1KAWA 4CJ1B 1SMYD 2BOSA 3D4DA 5BN3A 1BOSA 3MFGA 2KCTA 4TKOB 4C3IH 1Q82C 1VQ6A 3KF6A 4Z9CB 2AWNA 4A4IA 1F2MA 1WD1A 4OHJA 2ZTCA 4C3IB 3CCLA 5K36H 2VW9A 1CZWA 1PTOD 3T13A 5KIXA 1VQKA 4BY7G 3PO3G 2C35B 1QJOA 4LUOA 1TY0A 2UXDQ 1VQJA 2JYOA 3U50C 1K0SA 1J5EQ 3G4SA 3TQYA 1YVCA 3PO2H 4KHPL 2K14A 2IHEA 1YNND 4DU9A 2WKCA 4A3BH 2PZWA 1SYGA 4TSSA 3PO2B 3TP7A 4OX9L 4KTAA 4GKKQ 2SOBA 3KK7A 1PFNA 4JI0Q 4A3BB 1Y69U 1JJGA 1SJHD 1TT2A 4CKCA 4L5RC 2NVTH 1A3UA 1NNXA 2NWGA 5E3FA 3HOZH 4G57A 3CRKC 4JI8Q 1WTXA 4QGUA 2NZ1D 1O7LA 3QO2A 4JI2Q 1SE4A 1D5ZC 3SE0A 2NVTB 4KKTA 1U4MA 3EIVA 3HOZB 3OIQA 1UEBA 2F0FA 2EJMA 4OL7A 1PH4A 2AUJD 2E2HH 1J8IA 3J7AF 3T1HL 4DV3L 2Z6KA 3M4OH 2JSOA 4FDBA 2E2HB 2XWBB 4ZLTF 5LMNQ 2Z9HA 3OYYA 3QG1A 4X66Q 4ZAIA 3M4OB 1CKMA 1N9WA 2RQXA 2RDGA 4IPCA 5C3WA 2JE6I 2NN6G 5FO7B 4JYAQ 3MXGA 5C0XH 4LF6Q 4XXEA 3HOUG 4IZ8A 4A3LH 4OO1G 1C4QA 4JG2A 1PH6A 3A7AB 2O5JC 3PF4A 3CPFA 2AUKA 2Z8LA 1RKNA 5JJZA 3C1EA 4LMQD 3S14H 3HOYH 3ZYYX 4I7ZC 2F1MA 2E74C 3KLSX 1PFMA 1EY9A 2K7VA 3NBIA 2K04A 3S14B 3HOYB 1AE3A 1CFMA 3ERSX 2X6GA 2K5NA 1PFSA 3Q24A 3BG3A 4GNXC 1QUQA 1X3EA 4BY1H 1XMQL 4YHHL 3V2TA 3OOCA 2C9OA 3C2PA 4RCOA 1OXSC 1EIYB 1SMXA 5LL6S 4BXXG 2F3IA 2QGQA 4IOAA 4AYBE 4BY1B 4B3SQ 3S1NH 4R1JA 2R7FA 2KA7A 3RLOA 4JBMA 3S1NB 3K6OA 1N34L 2YYZA 1EYCA 1NY4A 2D9UA 2N55A 1ONLA 5KNBA 3C3LA 3CKIB 2HHHL 3GDEA 3FMCA 1B1ZA 3HP3A 3SK4A 1B4OA 3D31A 4MTNA 3D0FA 4DV5L 1CQVA 3K5LA 1FYCA 5FK9C 4YCUA 5M5WH 4DAYA 1PDQA 4N9PA 1JE4A 1U4PA 1BCPB 1WOCA 2B2UC 1ILQA 2HDMA 3F2UA 1J6QA 3FKIG 2IL8A 1STGA 3J80c 1GJXA 3SEBA 1PH5A 5C4ZA 2JEAI 1V9PA 1HFNA 2F0SA 1Y1WG 3AFQA 1BXTA 1YJWA 5E1FA 2WAQB 3DHQA 3MXUA 5IP7H 5CR3A 1SNQA 3NTIA 2R92H 3FRPB 2R93G 3VYUA 4LFCL 4DK3C 3TZUA 2A73B 2QDLA 1LTBD 1PYWD 2R92B 3W2DA 4A3DH 2SNMA 3RLFA 1B50A 3T1YQ 4CGYB 1VQEA 4PZ6A 2EYOA 5C0XJ 1DXMA 4GOPB 1EU4A 1G6ZA 4OELB 4A3DB 2CQAA 2VQFQ 2ZXRA 4FNFA 3RNUA 1S72A 4UP8A 5JJLA 1QB5D 1WTHA 1VQGA 5F2DA 3DM3A 1CKOA 2E5LL 1RHPA 4NDXA 1N33Q 4ZUIA 1XNRL 1STBA 3KF8B 3P20A 4RG1A 1VQDA 4WRDA 2F0VA 3IKJA 3CCJA 1K9MC 1W2BA 3MFYA 1SSOA 1RD9D 4DV1L 3NUCA 5EGTA 4XYQA 3WOEA 2FFKB 2DGYA 2LMCB 1EFID 1LYLA 3MA2B 4PZ7A 2OF1A 2G5DA 3ICEA 4IFDH 1EY8A 5M3FH 4NKLA 3PMFA 2HCCA 4A3GH 4ODGA 3HOVH 4X65Q 2FMCA 3A55A 1B3AA 5M3FB 3K58A 1LT5D 1L2FA 1IBKL 4AIMA 2EE1A 4A3JH 2WACA 4A3GB 4JI4L 3HOVB 3GV3A 1KD1C 5K36G 3LWEA 1DGSA 3F1ZA 1CKNB 4K5WA 1FNUA 1I6VC 1JOQA 4UPAA 5KGUA 4RWSC 2K52A 3PO2G 4HCEA 4A3KG 4RGNA 1Y1VG 2WKDA 1YHQA 2I07B 4A3BG 3PUXA 5IGGA 3WWVA 2BE5D 5BR8L 1IZ6A 1VF7A 3CCEA 2I5HA 2K03A 5IWAQ 4FXKC 1STNA 2N3SA 3HOZG 3HRZC 2A69D 2KHIA 3J7YW 1F77A 1TS4A 4UHVA 4HIKA 1JE5A 2RCNA 2FHTA 1N32L 1CM9A 3R93A 1LLRD 4H7BA 1VQAA 5AFWA 4WJ3M 2Q8TA 3H3VI 2NZOA 2WB1G 3PIOA 3UE1A 4MTKA 2PYKA 4ZK9B 3PCOB 5ELDA 1D2BA 1W6KA 4G7ZC 2R7ZH 3CMAA 1SNPA 1S5DD 2E75C 3U4VA 1HZ9A 5LMUQ 3W1BA 4FF2A 3ITPA 2JEBI 5FKAC 4JI3L 2R7ZB 4OEMB 3AMUA 1BCPC 2VZAA 1G6PA 2MP1A 2KBNA 5GQOA 1G91A 4UDUC 3E0EA 2EY6A 2Z0SA 3F2CA 4KY7A 2I0QA 4PG3A 3OMGA 4ZYSA 4HR7B 1HA6A 4ZCKA 2SEBD 1IXRA 1BKBA 3HOYG 4DV7L 1HFGA 2A68D 2I46A 3MXNA 4XDXA 1PTOH 1IYUA 2DNCA 4CJ0B 3H0GG 3S24A 2WP8J 1SYEA 1PTOB 1JICA 1H9SA 3OWEB 3GQBA 5JEAJ 1R4QB 1LTGD 4N8X1 4BY1G 1PHJA 1WTWA 1XPRA 2EYPA 3L0OA 2R3ZA 4GOPC 1KQSA 5IT9L 1GUSA 1WJJA 3VA5A 4R4IA 1K73C 3PUVA 1T5XD 2K75A 3NEMA 3H15A 1K8OA 1EFWA 3RLNA 5IE8A 5C44H 1EY4A 1FGUA 4GKJQ 2F0UA 1A6XA 2B29A 5JVH3 3TRZA 1O7ZA 3CHBD 5C44B 4PQXA 4KLKA 4I7AA 4GKKL 3PUWA 1NR4A 3FVQA 3OW2A 4JI0L 3VR2A 3S1MH 1P8LA 1EWIA 4LWCA 2EZVA 2Q2UA 4F87A 1ICFB 4JI5L 3SHLA 3NTHA 4WFN3 4JI8L 1XWEA 4BBSH 3QOJA 3OW7A 4DV0Q 3S1MB 4KMUC 3I4NH 4CJ2C 3EROA 2A6HC 3M7GA 1S5BD 1HUMA 1TS2A 5DNFA 1DM0B 1HTLD 2K28A 2WAQG 3MEHA 4DR2Q 2NVYH 3S16B 3I4NB 5IYBH 1L1OB 1L0YB 3J81j 1E3PA 4P75A 2B2YC 2JXMB 3U58A 5E4XA 2KOLA 5HGTA 2NVYB 1STEA 2B8GA 2HCIA 3BVMA 1Q81C 2XVSA 3Q23A 1QWYA 4RH6A 1IW7D 4X62L 1H95A 4P2CB 1SR3A 4IUNA 4JBKA 3ER0A 1LTLA 3MTSA 1I4HA 3J80i 4JYAL 4LF6L 4QIWE 3OTOQ 4FYDA 3PUYA 1VMPA 1QZHA 3EBEA 3HS0C 4YWMA 2BDOA 3JAML 3V05A 2QW7A 3RR5A 1LTRD 3F2BA 4JI7Q 1R9TH 1WYDA 5CC4A 5IGEA 1YZ6A 5ELFA 4JI6Q 4LUVA 1R9TB 4IUTA 2L4NA 2VB3X 2RKSA 1CHPD 2E2DC 1PH2A 4DR7Q 2WINB 1E0BA 3RD4A 5HGQA 1NTGA 4H13C 4ZKBB 2QCPX 2VNUD 2FXQA 3BDLA 4MN3A 1M4VA 1W3SA 3ULLA 5I9PA 4IFDG 5M3FG 1C9OA 1MBYA 4A3GG 4HSVA 3K0YA 1KXLA 3HOVG 1JQYD 4ME5A 2UUCL 1ASZA 4TQUS 2NN6I 1XMOQ 4DV2Q 4J1MA 4P74A 1UE1A 1V1PA 4CKEA 4OO1I 4JC0A 3RUZA 1EY0A 4EX5A 2A6EC 2O5IC 3QIAA 1V8QA 2L5TA 1SMYC 1O7YA 1QCBD 4DV4Q 4HJ5A 3BDOA 2F0OA 4EGVA 2ZTDA 5EBCA 1HQRD 2HD3A 1WD0A 4DR6L 5JJIA 3NQTA 4QY7A 5IY0A 1WTRA 3A5UA 2HDLA 5CBEE 1X3GA 1JJCB 1PTOC 1VQIA 1L0XB 2Z4IA 2QA4A 4GN3B 4CKBA 1EYDA 4ABNA 1KC8C 4RGMA 3T16A 2F0JA 1HNXQ 2E2JH 1JOOA 1EZ8A 5A35A 1FJGL 3FP9A 1QVFA 1RTOA 2NVXB 1YNNC 4J6HA 4C1NK 2MHVA 3SK5A 2F0EA 2E2JB 1VQFA 4DUZL 1PRTB 2ASBA 3B6YA 3VR4A 3S9WA 3T1YL 2IPKD 3SK8A 4B3ML 1HTPA 3ULJA 2Z4HA 1XNQL 2VQFL 1B3QA 3AEVA 1FNVA 3HOXH 4EQOA 2OT2A 1YNJD 1AN8A 3HOXB 2XRQD 1N33L 1IL8A 3KJOA 1FD7D 2R7DA 2E76C 3M9BA 3STBD 4DR5Q 2BDNA 1X32A 1X55A 1WVLA 1UE6A 1VQ4A 3DWPA 5ISRA 4K6LA 4M8AA 4K6DA 2MGSA 3EQLC 5DLQE 1BUVT 5K5PA 2KEEA 3TREA 1VMCA 5GADC 1EY5A 5LHY1 4RKLA 3KJPA 5IP9H 1K3RA 1QUQB 2F0GA 2A74C 1DJRD 4OWXB 4X3UA 1VQ8A 1CQFA 3J81E 4PMCA 4X64Q 1NSNS 4DN4M 3K57A 2QF7A 1CHQD 3DM1A 4ME3A 1F2LA 2KJXA 2VY3A 2HQLA 3QR8A 1SNCA 1XPUA 3C1FA 4X65L 3KLRA 2JA8G 1KABA 2VB2X 4FVMA 1TS3A 1LT6D 3P7JA 1Q46A 3GTGH 4LF7Q 4NB3A 4EQNA 2DJGC 1VS0A 1KDCA 3GTGB 3KDFA 1D5XC 2ICIA 2AWOA 3HKZB 5C44G 4LF8Q 1KDAA 1X9NA 4C2MH 3I8ZA 5FLXE 4DAYB 1SRUA 5IYDG 2QKIC 2RSOA 1L0WA 1WTPA 1ZYRD 4PNYA 3G71A 2L11A 5KYIA 2AQ2B 1SJED 3F2DA 3S2HH 3MC0B 1UUPA 4HJ7A 4BWGB 3HFZB 4DFAA 1CA6A 1SDFA 5EKIA 3I4NG 5CMDA 5KNDA 1AH9A 3S2HB 2SDFA 3QWNA 1S40A 1OXXK 3NPPA 4HIMA 3RMHA 2ZM6Q 2BA1A 2ZXOA 5IYBG 1HR0Q 3I7FA 4HJ8A 2JK8A 2H4OA 2IJ0A 4IPDA 3U9OA 5JAVA 5CGKA 5ELCA 4EVOA 2ID0A 5C5MA 2LXJA 1U4RA 3K0XA 4XIGS 3DMUA 4L5TA 1GKHA 1LT4D 2CWPA 5IT9E 1BF4A 2L0CA 1M8AA 3NBHA 4EQPA 5LMUL 3TS2A 2DY8A 2RHSB 4B9XA 4BA2I 5LMNW 3RZOH 2BCOA 4DR4Q 1GHKA 2F3VA 5JVG3 2MJ8A 3IRBA 4G4KA 1B44D 2Y0SG 3DUZA 5D14A 3TZDA 3RZOB 1E2ZA 4A3IH 5DM63 2CFMA 1N36Q 4DR3L 1B9MA 2P5ZX 2Q8RE 1PFBA 4ZKCB 1Z47A 4A3IB 1TWAH 2JN4A 3D6WA 1K3BC 4LUZA 4XYOA 1S5FD 3EFXD 4A75A 2H1EA 5EQ0A 2B2TA 2Z6KC 3BYYB 5C3EH 2N49A 1SROA 1PRTC 1TWAB 3CQZH 2ZT9C 3W1GA 2A5HA 5C3EB 4O0AA 1Y8NB 1I5FA 1K8GA 5M5XH 3CQZB 2EJGC 2RDFA 4KY5A 4A3FH 4DKAC 4DA2A 4OIKA 3TDQA 3I2ZA 4GLXA 3NWSA 4X6AH 2V4DA 5M5XB 5A2QL 3J7ZC 1HXYD 3CCMA 4A3FB 3U4ZA 3HOWH 4ZQ3A 5C0XI 1MJEA 5C5LA 4GKJL 5HY6A 1WCMH 2D0OA 3D4WA 2NVQH 2WV6D 2JA5G 1PVOA 1AZQA 1YEZA 3HOWB 5ELOA 1DZ1A 3JAME 1WCMB 1PZKD 2NVQB 1U4LA 1STAA 5M5WB 3A8IE 2BH2A 1VQ5A 4L6TB 5ELBA 2E8GA 4ULLA 2UUAQ 5EJWA 4PZ8A 5I2YA 3K5MA 2B2VC 2TSSA 3GTLH 4DV0L 4LFBQ 4NXNL 1PH9A 5IODA 2OWOA 1OXTA 1IBMQ 1E2VA 1B7YB 3Q6SA 5FLMG 4GLVB 2YTVA 3GTLB 4F8MA 2R61A 1RTNA 4RHSA 3S1QH 5M3MH 3PGZA 2JJQA 4A3CH 1NR2A 2J4XA 1D6EC 1FR3A 3J80L 1II3A 3RN2A 1I4PA 2CKZB 3N52A 3KBGA 3S1QB 5M3MB 2EYHA 3OMCA 2GVBA 2BE5C 1EEFD 2NTTA 4X3KA 3RZDH 1JB7A 5M9OA 1NJIC 2M9VA 3IFTA 1VQMA 2TMPA 1TY2A 2A69C 2DJFC 4J8QA 3RZDB 4KJNA 3I4MG 4U68A 1QVGA 3QB3A 4OXPA 1A8VA 5DM73 4L8JA 3GD7A 2PMZE 4JBJA 3HOXG 5GAEC 2JA6H 2UXBL 2OQKA 1SN8A 2BA0A 2DUDA 2JA6B 3NENA 4ZUJA 3K7UC 3MXNB 5T1IA 4DR7L 1Q7YC 5T1GA 3I73A 1SEBD 3NTKA 2QEXA 3CCUA 3GTJH 2K5QA 4X3TA 2OTJA 1MJCA 4KN7C 3BZCA 3L7ZC 4OIJA 4AQYQ 4HTHA 5JEAH 2PQEA 3SR1A 5J39A 5AJ3Q 5IP9G 1H9SB 2DN8A 3GTJB 1UNSA 3TSSA 4B08A 4C3IG 1KNAA 3DLLA 1ESRA 1X65A 3CAMA 2NYZD 4JBWA 1K28A 1XMOL 2PPBC 4A3JB 2IHFA 3KBXA 4TVAB 2A68C 1TR5A 2F4IA 3F8TA 4YY3Q 2C5CA 4B3TL 4ILWA 3E3XA 4J15A 1OO9B 1SE3A 3M4QA 4JOIC 1VCIA 3HKZG 1STHA 1CA5A 1GD7A 4DV4L 4JK1C 4YCVA 1A62A 2MNAA 4CHTB 3BJUA 3G7LA 1PH3A 1R4PB 2RCFA 4I65A 1T5EA 1BBWA 1GUOA 1VF5C 3N6RA 3IFDA 5FO8B 4AH6A 4A3MH 1ICWA 4PV1C 4HMJA 1RDPD 3NWTA 4R4OA 4OX9Q 1YI2A 2F4VL 1MI2A 1D1IA 4A3MB 1EQVA 1HNXL 4JV5Q 2OQ0A 2ATWA 1QILA 2JQOA 2K5DA 2K05A 3DEPA 4V190 5J22A 3Q22A 1VDZA 1EEID 1SNOA 1X3FA 4KKUA 3SVMA 1GM5A 2BH8A 1SE2A 4DK0A 5KEEA 4YWLA 3E6ZX 4IFDI 3KYHC 4MHEA 3A56A 1M90C 1IKLA 2PI2E 4JCVE 3HZXA 1A63A 3T1HQ 4DV3Q 3MHBA 2KQ3A 1BNZA 3I56A 1K83H 1TWHH 3NK9A 3NHHA 1RCVD 1A3VA 1QNKA 1A15A 1HQMC 5C0XG 4LF4L 3TP5A 1T9HA 2Q2HA 5COYA 4LK1C 1AP0A 2WB1E 4A3LG 3A7LA 1BQQT 1K83B 1TWHB 1ILPA 2K32A 2PO4A 2XTIA 1C7YA 1QG7A 4H44C 2Z6BA 2HUGA 2LSSA 3TS0A 1B70B 2RSNA 4DR5L 4K5VA 5EPJA 4EQ5A 1Y14B 1XYIA 1JJ2A 4FXGC 2F0QA 1HZAA 3A8KE 1PH8A 2K01A 3GP7A 2PQAB 2RDHA 3V96A 2OEOA 3MEFA 3E9IA 2GA4B 5CV5A 1G2SA 5GAGC 4IPHA 3LX0A 2D2CC 2K5HA 1S4ZA 4X64L 3CCVA 2LFNA 4YCWA 3VYTA 4B3RQ 5C3EG 4CDFC 4V0BA 3CPWA 3OIPA 3KLWA 1OXVA 3TP8A 4IUVA 2EYJA 2UUBQ 2NUCA 4IUPA 2UXDL 2OTLA 4NP5A 4L5QA 1J5EL 4LF7L 4A3FG 4FXDA 4HN7A 1EIHA 1TXYA 2PW5A 2CH4W 4BY7H 1SXTA 1RODA 1BVSA 2G9DA 3K59A 3TN2A 3HOWG 1CTMA 1V43A 4DNIA 4OGQC 4IQZA 1WCMG 4XT3B 2K50A 1XTCD 1I6HH 1SYDA 3NP8A 2YU9H 2F0WA 1SBBB 2Z1CA 1DD2A 4NW2A 1PXUA 4JI2L 1Z7TA 3KOJA 1I94Q 4QUCA 4DV5Q 1QVCA 1I6HB 2FMMA 2YU9B 1KAAA 3OWFA 2D5DA 2QDBA 3D3RA 4BBSB 5I6YA 5FOBB 2EYMA 4X3SA 2F52A 1Q1EA 2CWAA 3TEHB 3L9AX 4KY6A 2NZHA 1X3QA 1LV9A 1NUCA 4LF9Q 1HHVA 5IP7G 3RN5A 2L9HA 5D3IB 2R92G 5LMNL 2DNEA 2EY1A 3AU7A 1IBLQ 4X66L 5M3MG 4A3CG 2KHJA 2WAQE 1BCPD 3CCRA 4UAIA 3CCSA 4NXMQ 3GTQH 1C0AA 2RHQB 4A3DG 4ALPA 5G3LD 3PIP3 4Y7NH 2ZJQA 5D3DA 4LFCQ 3GTQB 5FJ8H 3E0JA 1G2TA 2M00A 3NQIA 4C1NI 1ASYA 1LTAD 2NBFA 4Y7NB 2V1CC 3MVVA 1VQNA 3G6JB 4Y52H 1JB3A 2YTXA 1LTID 1F9RA 3HOUH 1GXDC 4DPGA 5EAYA 2L1BA 3H91A 2AHOB 1PZID 4DR4L 4IALA 2JA6G 3HOUB 1I50H 4P72A 1BDOA 4O1NA 1MGSA 5I6WA 1Q86C 1N36L 3PIO3 5E7NA 5EKLA 5KYLA 1EZ6A 1I50B 1TWGH 3JC66 1KDBA 3J7A5 2SNSA 4RGOS 5GAHC 2NTSA 3HKSA 5CV7A 1TWGB 4DV1Q 4AYBB 4B3SL 3KF6B 4CDDC 1YNJC 1WI5A 3T51B 5JEAG 2L15A 3CCQA 1UAPA 5ELEA 4KV6A 2K1BA 1ESFA 1YBYA 3STBC 2CVRA 2R6GA 4A3JG 1VQLA 3PF5A 4DGZA 2E2IH 1X6OA 2AKWB 3UDIA 1BBXC 1F9PA 4DV6Q 3SGIA 1GUNA 1IBKQ 3PQIA 4DUYQ 3KDFB 4GLAC 4N9TA 2H5XA 2E2IB 1MSHA 1HUNA 3WDNA 2IW3A 1Q90A 1EY6A 3VR6A 3S1RH 2ICEC 2F0LA 4IUUA 4QJFA 4HJ9A 3QJYA 3HG9A 4JVZA 2JA7H 3S1RB 2OCEA 4IJHA 3P1HA 1B2TA 4LFBL 4Q5VA 4K8JA 2LS01 4A3MG 1HZCA 2JA7B 4A93H 1MD2D 5NUCA 3FKIH 3DWAA 3VYRA 2XNAC 5BN5A 4A93B 1P16A 3FKIB 3R2TA 2F0MA 2CW0D 2ZXPA 1CUKA 4IN3A 1WTQA 1EYGA 5C4JH 2R93H 1Q8KA 3J7AV 1N32Q 1V1QA 2WIIB 5I4DA 1XX8A 4KD3A 2JA9A 2K6AA 4NMZA 1ZKOA 3K7AH 5C4JB 1S5ED 1ZYRC 2R7ZG 3J81i 2AQ1B 3NELA 4N8FA 3I55A 1G8ZD 4R4QA 5EPKA 5M5YH 3K7AB 1I4XA 4YWKA 1EOTA 3VDYA 1JMCA 2EVBA 5KRUA 5M5YB 4H02A 2B8FA 2EJFC 2HQEA 1YHAA 3A8JE 1SYBA 1FL0A 3H09A 3LNNA 1SYFA 1L1OC 1FVIA 4FP5D 2LXKA 2KCMA 4UY8C 3OPOA 4E6IA 3AFPA 1C8CA 1N8RC 4KN4C 1AEXA 3ERQA 5ELNA 1SNMA 1OTCA 4AQYL 5AJ3L 1AW7A 4C3JH 1D7QA 3T53B 2A6ED 2UU9Q 1Q8IA 1XXGA 2ZJPA 1E7ZA 2J0TD 4DR1Q 1BR9A 4GN5A 1CI3M 1XTDA 4LF5Q 1WTOA 4C3JB 1BBUA 1HCZA 3T56B 1C48A 1IYVA 3SXHA 2IT1A 1KNEA 4RGTA 4DXGA 4YY3L 1CSPA 1E24A 1EU3A 2MUYA 1AE2A 5JPNC 3E9HA 1I4RA 2B2WC 1ML0D 4QUFA 4ID6A 4IJLA 3CC7A 3CU7A 1KLUD 4C2MB 2GVAA 3L3OC 5C4XH 3LGJA 1TU2B 5HURA 4A3KH 5IWAL 1Y1VH 1F9SA 5IGCA 4BBSG 4HSPA 4O42A 4R8IA 5C4XB 4A3KB 4UP9A 4A76A 3R8BA 1Y1VB 1DOKA 5JPMC 4DNRB 2GN5A 3K5OA 4JI5Q 4JV5L 2EY5A 1Q3LA 4BBRH 1X3PA 3S2DH 1RF2D 4C56C 1HJPA 4XTCS 2L55A 2N8NA 1EWCA 1S5CD 4BBRB 4GNXA 2XGTA 3S2DB 3L2PA 3MZ5A 2AQ3B 4F88A 1RJTA 4KJOA 1EWHA 4A3EH 4G7HC 4P71A 4JI1Q 3ND9A 2EXZA 2WB1B 3Q8DA 4S3SA 5FJ8G 1TS5A 4X62Q 4A3EB 1HR0W 1HNZQ 2PNRC 4CDEC 4WORA 2KCCA 4QCLA 4IO9A 3VR3A 3CXCA 2YTYA 4LW1A 1JWSD 1DYQA 4KD4A 1GUWA 1HA5A 1VQPA 3GTPH 3I70A 1TVXA 4O2DA 2A1AA 3WOFA 2VUMH 4BA1I 1CK1A 3ND8A 4POFA 3TP6A 3GTPB 5JOBA 2VUMB 2O2LD 2UXCQ 3BVZA 2Y0SE 3JAMi 3ZJYC 1H9MA 3MWYW 3I3CA 3NE5B 2B2UA 2AMCB 3A54A 4HCSA 4AYBG 1BCPF 3H0GH 1YNXA 4B3RL 1EOVA 3P75A 2B2VA 3R2IA 4MIUA 5G3LF 3W5OA 4XQJA 4MNOA 4KKSA 3H0GB 2IWHA 2VQEQ 1Z6HA 2UUBL 3K8AA 1IYJB 1HNWQ 1RIPA 4LAAA 4K0KQ 1YJNA 1ZXTA 3AYHB 5IGDA 3CP0A 2B3GA 4WJWA 1WFQA 2UUCQ 1K8MA 4HAEA 1KRTA 2XRSD 5I9OA 3A5ZB 1I4GA 3BDCA 3A74A 5C6AA 1EL0A 3G48A 1I94L 2F0IA 5IOCA 1NE3A 1OXUA 2J7ZA 3IL8A 2JA7G 1CSQA 1O7IA 3CC4A 4DR2L 4QMGA 2B2TC 4DR6Q 1ET6A 1TIID 3FPPA 1H9JA 1LTTD 3QOLA 5IYCH 4DAVA 1B9NA 3K5NA 4LF9L 5L37A 5J1ZA 2F0KA 3Q0AA 4H0LC 4A93G 3H94A 4LFAQ 1F2ZA 1KIXA 4FF3A 3GTMH 1IBLL 4B9WA 4POGA 1DONA 2PI2A 1K0RA 3UDXA 4APVA 4NXML 2D0PA 2F0HA 1LACA 3SK6A 1FJGQ 3GTMB 4IUQA 1AFPA 4DF7A 3OTOL 1PYSB 1A3TA 4QIWB 1FNWA 4CDCC 4M1UB 2B63H 4DUZQ 4U673 2Q2IA 3I72A 1VQHA 4R9WA
chains in the Genus database with same CATH topology
5GAGC 4IPHA 4OO1I 4JC0A 4EX5A 2K5HA 3EIVA 4B3MQ 4JI7L 1UEBA 4X64L 4MZ9A 3CCVA 1PH4A 2E2HH 3I4OA 4YCWA 4B3RQ 4DV4Q 4DV3L 4HJ5A 5C3EG 3T1HL 1XNQQ 2ZTDA 4JI6L 4GS3A 3GTKH 1YITA 1PH7A 3CPWA 2Z6KA 3M4OH 4DR6L 5JJIA 3KLWA 4FDBA 4DAMA 5LMNQ 4QY7A 1OXVA 3OYYA 5IY0A 4JOIA 1G291 2UUBQ 4X66Q 2UXDL 3A5UA 2OTLA 4L5QA 1J5EL 4LF7L 4A3FG 1CKMA 1VQBA 1X54A 1N9WA 1X3GA 1JJCB 4IPCA 1VQIA 1TXYA 2JE6I 2NN6G 5GROA 2VS1A 2ZJRA 4GN3B 2QA4A 4JYAQ 4LF6Q 4BY7H 1KC8C 3HOUG 4A3LH 1HNXQ 1BVSA 4OO1G 3M85A 2E2JH 1RL2A 3HOWG 1V43A 4DNIA 4JG2A 1FJGL 3FP9A 1WCMG 1QVFA 1PH6A 4LNQA 2K50A 3CPFA 3PF4A 1I6HH 2YU9H 1VQFA 3H3VH 3BU2A 4DV2L 4DUZL 3S14H 2ASBA 4JI2L 3HOYH 3KOJA 3B6YA 3CF5A 1I94Q 4QL5A 4DV5Q 1QVCA 3T1YL 4QQBX 4B3ML 3ULJA 1AE3A 2F52A 1Q1EA 2CWAA 3TEHB 4DV6L 1XNQL 2VQFL 3M4PA 2NZHA 3ERSX 4DUYL 2K5NA 4LF9Q 3AEVA 1PFSA 3HOXH 2IX1A 3EN2A 5IP7G 4GNXC 1QUQA 1X3EA 3RN5A 4BY1H 1XMQL 4OWWB 4YHHL 5LMNL 2R92G 1K8AC 4KHPQ 1IBLQ 4X66L 1OXSC 5M3MG 1VQ9A 1N33L 1EIYB 4A3CG 2PNHA 3KJOA 1E1OA 1SMXA 2KHJA 2F3IA 2QGQA 2WAQE 2R7DA 4AYBE 3HKZE 3M9BA 4KI0A 3CCRA 3STBD 3CCSA 4DR5Q 1D8LA 1EQQA 1KHIA 2RHQB 3J81c 3CC2A 4B3SQ 3GTQH 4R1JA 2R7FA 4ALPA 3S1NH 4A3DG 5C4XG 1X55A 4Y7NH 2ZJQA 4LFCQ 1UE6A 1VQ4A 3RLOA 1LM0A 5FJ8H 4JBMA 5DLQE 1JT8A 1N34L 2YYZA 3PIPA 1ASYA 4WJ4A 1NY4A 3TREA 2V1CC 1VQNA 5GADC 4Y52H 3KJPA 2HHHL 3M3YH 2YTXA 3GDEA 1K3RA 5IP9H 1QUQB 3HOUH 4DPGA 4OWXB 1VQ8A 5EAYA 4X64Q 2AHOB 1SFOH 4BBRG 3D31A 4MTNA 3D0FA 5J3BA 4DV5L 3UDGA 4DR4L 4ME3A 2VY3A 4YCUA 2HQLA 3CD6A 5M5WH 2JA6G 3PV0A 1XPUA 1U0LA 4X65L 1I50H 4P72A 2JA8G 1Q86C 1WOCA 1N36L 5E7NA 1NBWA 2D62A 2MO0A 2VL6A 1UE7A 1Q46A 5FLXc 3GTGH 1J6QA 3FKIG 4NB3A 4LF7Q 3J80c 1TWGH 1PH5A 4A3EG 1KRSA 3JC66 1V9PA 4GOPA 2JEAI 1VS0A 3J7A5 5GAHC 1Y1WG 3S15H 3AFQA 3KDFA 3HKSA 2I5MX 1YJWA 4DV1Q 1GO3E 4R4CA 2AWOA 5IP7H 4B3SL 5C44G 4LF8Q 3KF6B 1X9NA 2MFIA 4C2MH 4IOCA 1WI5A 2R92H 5JEAG 1HZBA 2R93G 2L15A 4LFCL 4DK3C 4DAYB 4HIOA 2A8VA 3CCQA 1SRUA 5IYDG 1G51A 1YBYA 4A3IG 1M1KC 2ZTEA 3STBC 2CCZA 2YV5A 1L0WA 2R6GA 4A3JG 1VQLA 4A3DH 3RLFA 4C3HH 3G71A 2VUMG 3T1YQ 1VQEA 1A0IA 3F2DA 4B3RL 4PZ6A 3PF5A 3S2HH 5C0XJ 4HJ7A 2E2IH 1X6OA 3HFZB 4GOPB 2AKWB 3UE0A 3UDIA 3S17H 4DV6Q 3SGIA 1NMFA 4DR3Q 1IBKQ 3I4NG 2VQFQ 4DUYQ 1AH9A 3RNUA 3KDFB 4GLAC 1S72A 2H5XA 3PUZA 2UU9L 1S40A 4UP8A 1OXXK 5IT9c 5JJLA 4HIMA 4DR1L 3S1RH 1XMQQ 1VQGA 4YHHQ 2ZM6Q 3DM3A 2BA1A 4QJFA 1CKOA 4RMFA 5IYBG 3I7FA 4HJ8A 4HJ9A 1HR0Q 4LF5L 2JK8A 2E5LL 4IPDA 1N33Q 1XNRL 1GVPA 2K4KA 4GN4B 4IFDJ 2JA7H 3KF8B 2ID0A 3BZKA 2OCEA 4KHZA 4RG1A 1VQDA 2LXJA 4IJHA 2JA8H 3CCJA 1B8AA 1K9MC 1W2BA 4LFBL 3K0XA 3PO3H 4XIGS 4A3MG 4L5TA 1HZCA 1GKHA 2N78A 4DV1L 1TWCH 2CWPA 4A93H 3FKIH 4L5SA 4LF8L 5LMUL 1N34Q 3TS2A 1CKNA 1PYBA 2HHHQ 2HIVA 2DGYA 1LYLA 4PZ7A 1P16A 2ES2A 2RHSB 4BA2I 5LMNW 1YIJA 3RZOH 3ICEA 1CUKA 1MKHA 5M3FH 1EYGA 1KL9A 4DR4Q 5C4JH 4A3GH 2R93H 1Q8KA 3IRBA 2Y0SG 3HOVH 4X65Q 1N32Q 1V1QA 5IYDH 1Z9FA 4A3IH 2JA9A 2CFMA 1N36Q 4DR3L 1IBKL 1L2FA 3K7AH 4AIMA 4A3JH 2R7ZG 3J81i 4JI4L 1KD1C 1Z47A 3NELA 3I55A 1TWAH 4LUZA 5K36G 1DGSA 4R4QA 2ZM6L 5M5YH 1HR0L 2MQHA 1CKNB 1E1TA 3F1ZA 4IPGA 3FHWA 4A75A 1U5KA 4YWKA 4NXNQ 5IYCG 2Z6KC 3S16H 2A19A 5C3EH 2Q2TA 3VDYA 4UPAA 2N49A 1JMCA 1SROA 3CQZH 3ULPA 3W1GA 2K52A 1UE5A 3PO2G 4H02A 4A3KG 1UWVA 1Y1VG 1YHAA 1YHQA 1FL0A 4O0AA 4A3BG 1I5FA 1K8GA 5M5XH 1PV4A 3PUXA 4A3FH 1L1OC 3WWVA 4DKAC 1FVIA 5BR8L 3JAMc 2LXKA 1IZ6A 2KCMA 4UY8C 3A0JA 3I2ZA 4GLXA 4JI1L 4X6AH 3CCEA 2I5HA 5IWAQ 1EQRA 3J7ZC 3CCMA 2N3SA 3AFPA 1QZGA 1N8RC 3HOZG 5H1SE 3U4ZA 3CMEA 2B63G 2KHIA 3HOWH 5C0XI 1MJEA 3AQQA 5ELNA 1VQ7A 2RF4A 1HNZL 4GKJL 5HY6A 1WCMH 4DK6C 2D0OA 4HIKA 4AQYL 5AJ3L 3G6EA 1JE5A 1OTCA 2NVQH 2RCNA 2JA5G 1PVOA 4C3JH 1D7QA 2UU9Q 1N32L 1YEZA 1E22A 1VQOA 5ELOA 2ZJPA 2KENA 1E7ZA 4DR1Q 4GN5A 1VQAA 4WJ3M 4NXMQ 3GO5A 1XTDA 4LF5Q 1BBUA 2E5LQ 2BH2A 3H3VI 2NZOA 1X56A 1VQ5A 1XNRQ 2WB1G 2E8GA 2MO1A 2UUAQ 3PIOA 2UXBQ 4PZ8A 1SLJA 2IT1A 3UE1A 3GTLH 4DV0L 4LFBQ 4NXNL 3PCOB 2IY5B 2UXCL 4YY3L 1PH9A 3M7NA 1CSPA 1E24A 3CMAA 2OWOA 2R7ZH 1OXTA 1IBMQ 1B7YB 1AE2A 5FLMG 4GLVB 2YTVA 3E9HA 1HZ9A 3U4VA 5LMUQ 3W1BA 2PQAA 2JEBI 4JI3L 3S1QH 5M3MH 3K80C 3PGZA 2JJQA 4A3CH 4IJLA 4IOAA 4HJAA 4BXXH 3CC7A 2VZAA 1G6PA 2KBNA 1SE8A 5GQOA 2GVAA 3E0EA 2ALYB 2Z0SA 3F2CA 2K5VA 3RN2A 2CKZB 5C4XH 3LGJA 5JJKA 3UDFA 2I0QA 4A3KH 4PG3A 5IWAL 2VQEL 4OONA 1Y1VH 1HNWL 1IL2A 4BBSG 1S3OA 1IXRA 2GVBA 1PA6A 4K0KL 1BKBA 3HOYG 3RZDH 1JB7A 4DV7L 1NJIC 4UP9A 4A76A 1MIUA 3K81C 1VQMA 4JI4Q 4JV5L 4JI5Q 2GN5A 3I4MG 3H0GG 1QVGA 3S24A 2WP8J 1A8VA 4OXPA 4BBRH 1Q12A 3S2DH 3GD7A 2PMZE 4JBJA 3HOXG 4B3TQ 5GAEC 2JA5H 2JA6H 1HJPA 2UUAL 2OQKA 4XTCS 3GTOH 2UXBL 2N8NA 1SN8A 5JEAJ 4BY1G 1HH2P 4GNXA 2BA0A 2XGTA 2EQSA 1PHJA 3L2PA 2DUDA 1XPRA 1C0AA 3L0OA 3NENA 1IBML 4GOPC 1KQSA 1I3QH 1WJJA 4A3EH 5BR8Q 1XPOA 4P71A 3K7UC 4R4IA 3MXNB 1K73C 3PSIA 3PUVA 4JI1Q 4DR7L 2K75A 2EXDA 1Y1WH 1Q7YC 3CCUA 2QEXA 3NEMA 3Q8DA 5FJ8G 3H15A 1EFWA 3RLNA 5IE8A 3GTJH 4X62Q 1HR0W 4LFAL 5C44H 5FLMH 1HNZQ 2OTJA 1FGUA 1MJCA 4GKJQ 3BZCA 3L7ZC 2F4VQ 2B29A 2WFWA 5AJ3Q 4HIDA 1L1OA 4AQYQ 5IP9G 2NVXH 3TRZA 4IO9A 1NMGA 3CXCA 2YTYA 4LW1A 1EUJA 1TWFH 2IX0A 4GNXB 4KLKA 3DLLA 4GKKL 3PUWA 1LUZA 1VQPA 1X65A 3GTPH 4NPSA 3CAMA 3OW2A 4O2DA 2A1AA 4JI0L 2HT1A 1P8LA 1EWIA 4LWCA 4BA1I 1XJVA 2Q2UA 2VUMH 3S1MH 4JI5L 3NBHB 4PMWA 4POFA 4JBWA 4JI8L 1XMOL 4BBSH 2IHFA 4DV0Q 1EIFA 4TVAB 3I4NH 2UXCQ 3F8TA 4YY3Q 4B3TL 3KFUA 2Y0SE 2EIFA 3ZJYC 3JAMi 2AMCB 4J15A 3M4QA 4JOIC 2WAQG 4AYBG 1VCIA 3HKZG 1PH1A 4DR2Q 2NVYH 3I4MH 3H0GH 4LF4Q 1YNXA 2CQOA 1L1OB 1GD7A 5IYBH 1Q1BA 1E3PA 1EOVA 3J81j 4R4TA 4P75A 1YHBA 1A62A 4YCVA 2MNAA 4DV4L 1YJ9A 4JI3Q 3W5OA 4UP7A 3BJUA 3U58A 1PH3A 4MNOA 2HIXA 1BBWA 1Q81C 2VQEQ 2UUBL 4AH6A 4A3MH 3K8AA 2I5LX 1IYJB 1HNWQ 4X62L 1H95A 1SR3A 4OWTB 1RIPA 4JBKA 1VQCA 3ER0A 4R4OA 1YJNA 4OX9Q 1YI2A 4K0KQ 2F4VL 1LTLA 3J80i 4DV7Q 4JYAL 4LF6L 4P73A 3AYHB 4QIWE 3CP0A 3OTOQ 2B3GA 3CW2C 1HNXL 4JV5Q 2OQ0A 1WFQA 3PUYA 2ATWA 1KAWA 2UUCQ 1QZHA 3EBEA 2JQOA 4YWMA 1KRTA 1X3FA 3A5ZB 3RR5A 1GM5A 2BH8A 4YWLA 3F2BA 3A74A 4IFDI 4JI7Q 3KYHC 1R9TH 2KCTA 1WYDA 4C3IH 1Q82C 1VQ6A 1M90C 3G48A 2PI2E 3KF6A 4JCVE 1YZ6A 1I94L 1A63A 1NE3A 1OXUA 2AWNA 4DV3Q 3T1HQ 4A4IA 2JA7G 4JI6Q 1CSQA 1O7IA 4LUVA 3I56A 1K83H 1TWHH 3CC4A 4DR2L 2ZTCA 3CCLA 4DR6Q 2VW9A 4LF4L 5C0XG 1VQKA 4BY7G 1T9HA 2Q2HA 3PO3G 1PH2A 2C35B 4DR7Q 5IYCH 2WB1E 4LUOA 4LF9L 4A3LG 2UXDQ 1VQJA 4A93G 3U50C 5HGQA 1NTGA 1J5EQ 3G4SA 3TQYA 1YVCA 4LFAQ 3PO2H 4KHPL 2XTIA 2K14A 1KIXA 1C7YA 2IHEA 3GTMH 1IBLL 4POGA 2VNUD 2FXQA 2PI2A 1K0RA 3UDXA 4APVA 4A3BH 2LSSA 4NXML 2D0PA 1B70B 1W3SA 4DR5L 3TS0A 4OX9L 4EQ5A 3ULLA 4GKKQ 4IFDG 1FJGQ 1Y14B 5M3FG 1C9OA 4JI0Q 4A3GG 1JJ2A 1JJGA 3OTOL 1HZAA 1PYSB 4L5RC 1PH8A 2NVTH 3HOVG 4BXXG 1KXLA 3HOZH 2UUCL 1ASZA 4TQUS 2NN6I 4JI8Q 1XMOQ 2PQAB 4DUZQ 4P74A 4DV2Q 4QGUA 2B63H 2Q2IA 3MEFA 1UE1A 3E9IA 4JI2Q 1VQHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GAG C;  4IPH A;  4OO1 I;  4JC0 A;  4EX5 A;  2K5H A;  3EIV A;  4B3M Q;  4JI7 L;  1UEB A;  4X64 L;  4MZ9 A;  3CCV A;  1PH4 A;  2E2H H;  3I4O A;  4YCW A;  4B3R Q;  4DV4 Q;  4DV3 L;  4HJ5 A;  5C3E G;  3T1H L;  1XNQ Q;  2ZTD A;  4JI6 L;  4GS3 A;  3GTK H;  1YIT A;  1PH7 A;  3CPW A;  2Z6K A;  3M4O H;  4DR6 L;  5JJI A;  3KLW A;  4FDB A;  4DAM A;  5LMN Q;  4QY7 A;  1OXV A;  3OYY A;  5IY0 A;  4JOI A;  1G29 1;  2UUB Q;  4X66 Q;  2UXD L;  3A5U A;  2OTL A;  4L5Q A;  1J5E L;  4LF7 L;  4A3F G;  1CKM A;  1VQB A;  1X54 A;  1N9W A;  1X3G A;  1JJC B;  4IPC A;  1VQI A;  1TXY A;  2JE6 I;  2NN6 G;  5GRO A;  2VS1 A;  2ZJR A;  4GN3 B;  2QA4 A;  4JYA Q;  4LF6 Q;  4BY7 H;  1KC8 C;  3HOU G;  4A3L H;  1HNX Q;  1BVS A;  4OO1 G;  3M85 A;  2E2J H;  1RL2 A;  3HOW G;  1V43 A;  4DNI A;  4JG2 A;  1FJG L;  3FP9 A;  1WCM G;  1QVF A;  1PH6 A;  4LNQ A;  2K50 A;  3CPF A;  3PF4 A;  1I6H H;  2YU9 H;  1VQF A;  3H3V H;  3BU2 A;  4DV2 L;  4DUZ L;  3S14 H;  2ASB A;  4JI2 L;  3HOY H;  3KOJ A;  3B6Y A;  3CF5 A;  1I94 Q;  4QL5 A;  4DV5 Q;  1QVC A;  3T1Y L;  4QQB X;  4B3M L;  3ULJ A;  1AE3 A;  2F52 A;  1Q1E A;  2CWA A;  3TEH B;  4DV6 L;  1XNQ L;  2VQF L;  3M4P A;  2NZH A;  3ERS X;  4DUY L;  2K5N A;  4LF9 Q;  3AEV A;  1PFS A;  3HOX H;  2IX1 A;  3EN2 A;  5IP7 G;  4GNX C;  1QUQ A;  1X3E A;  3RN5 A;  4BY1 H;  1XMQ L;  4OWW B;  4YHH L;  5LMN L;  2R92 G;  1K8A C;  4KHP Q;  1IBL Q;  4X66 L;  1OXS C;  5M3M G;  1VQ9 A;  1N33 L;  1EIY B;  4A3C G;  2PNH A;  3KJO A;  1E1O A;  1SMX A;  2KHJ A;  2F3I A;  2QGQ A;  2WAQ E;  2R7D A;  4AYB E;  3HKZ E;  3M9B A;  4KI0 A;  3CCR A;  3STB D;  3CCS A;  4DR5 Q;  1D8L A;  1EQQ A;  1KHI A;  2RHQ B;  3J81 c;  3CC2 A;  4B3S Q;  3GTQ H;  4R1J A;  2R7F A;  4ALP A;  3S1N H;  4A3D G;  5C4X G;  1X55 A;  4Y7N H;  2ZJQ A;  4LFC Q;  1UE6 A;  1VQ4 A;  3RLO A;  1LM0 A;  5FJ8 H;  4JBM A;  5DLQ E;  1JT8 A;  1N34 L;  2YYZ A;  3PIP A;  1ASY A;  4WJ4 A;  1NY4 A;  3TRE A;  2V1C C;  1VQN A;  5GAD C;  4Y52 H;  3KJP A;  2HHH L;  3M3Y H;  2YTX A;  3GDE A;  1K3R A;  5IP9 H;  1QUQ B;  3HOU H;  4DPG A;  4OWX B;  1VQ8 A;  5EAY A;  4X64 Q;  2AHO B;  1SFO H;  4BBR G;  3D31 A;  4MTN A;  3D0F A;  5J3B A;  4DV5 L;  3UDG A;  4DR4 L;  4ME3 A;  2VY3 A;  4YCU A;  2HQL A;  3CD6 A;  5M5W H;  2JA6 G;  3PV0 A;  1XPU A;  1U0L A;  4X65 L;  1I50 H;  4P72 A;  2JA8 G;  1Q86 C;  1WOC A;  1N36 L;  5E7N A;  1NBW A;  2D62 A;  2MO0 A;  2VL6 A;  1UE7 A;  1Q46 A;  5FLX c;  3GTG H;  1J6Q A;  3FKI G;  4NB3 A;  4LF7 Q;  3J80 c;  1TWG H;  1PH5 A;  4A3E G;  1KRS A;  3JC6 6;  1V9P A;  4GOP A;  2JEA I;  1VS0 A;  3J7A 5;  5GAH C;  1Y1W G;  3S15 H;  3AFQ A;  3KDF A;  3HKS A;  2I5M X;  1YJW A;  4DV1 Q;  1GO3 E;  4R4C A;  2AWO A;  5IP7 H;  4B3S L;  5C44 G;  4LF8 Q;  3KF6 B;  1X9N A;  2MFI A;  4C2M H;  4IOC A;  1WI5 A;  2R92 H;  5JEA G;  1HZB A;  2R93 G;  2L15 A;  4LFC L;  4DK3 C;  4DAY B;  4HIO A;  2A8V A;  3CCQ A;  1SRU A;  5IYD G;  1G51 A;  1YBY A;  4A3I G;  1M1K C;  2ZTE A;  3STB C;  2CCZ A;  2YV5 A;  1L0W A;  2R6G A;  4A3J G;  1VQL A;  4A3D H;  3RLF A;  4C3H H;  3G71 A;  2VUM G;  3T1Y Q;  1VQE A;  1A0I A;  3F2D A;  4B3R L;  4PZ6 A;  3PF5 A;  3S2H H;  5C0X J;  4HJ7 A;  2E2I H;  1X6O A;  3HFZ B;  4GOP B;  2AKW B;  3UE0 A;  3UDI A;  3S17 H;  4DV6 Q;  3SGI A;  1NMF A;  4DR3 Q;  1IBK Q;  3I4N G;  2VQF Q;  4DUY Q;  1AH9 A;  3RNU A;  3KDF B;  4GLA C;  1S72 A;  2H5X A;  3PUZ A;  2UU9 L;  1S40 A;  4UP8 A;  1OXX K;  5IT9 c;  5JJL A;  4HIM A;  4DR1 L;  3S1R H;  1XMQ Q;  1VQG A;  4YHH Q;  2ZM6 Q;  3DM3 A;  2BA1 A;  4QJF A;  1CKO A;  4RMF A;  5IYB G;  3I7F A;  4HJ8 A;  4HJ9 A;  1HR0 Q;  4LF5 L;  2JK8 A;  2E5L L;  4IPD A;  1N33 Q;  1XNR L;  1GVP A;  2K4K A;  4GN4 B;  4IFD J;  2JA7 H;  3KF8 B;  2ID0 A;  3BZK A;  2OCE A;  4KHZ A;  4RG1 A;  1VQD A;  2LXJ A;  4IJH A;  2JA8 H;  3CCJ A;  1B8A A;  1K9M C;  1W2B A;  4LFB L;  3K0X A;  3PO3 H;  4XIG S;  4A3M G;  4L5T A;  1HZC A;  1GKH A;  2N78 A;  4DV1 L;  1TWC H;  2CWP A;  4A93 H;  3FKI H;  4L5S A;  4LF8 L;  5LMU L;  1N34 Q;  3TS2 A;  1CKN A;  1PYB A;  2HHH Q;  2HIV A;  2DGY A;  1LYL A;  4PZ7 A;  1P16 A;  2ES2 A;  2RHS B;  4BA2 I;  5LMN W;  1YIJ A;  3RZO H;  3ICE A;  1CUK A;  1MKH A;  5M3F H;  1EYG A;  1KL9 A;  4DR4 Q;  5C4J H;  4A3G H;  2R93 H;  1Q8K A;  3IRB A;  2Y0S G;  3HOV H;  4X65 Q;  1N32 Q;  1V1Q A;  5IYD H;  1Z9F A;  4A3I H;  2JA9 A;  2CFM A;  1N36 Q;  4DR3 L;  1IBK L;  1L2F A;  3K7A H;  4AIM A;  4A3J H;  2R7Z G;  3J81 i;  4JI4 L;  1KD1 C;  1Z47 A;  3NEL A;  3I55 A;  1TWA H;  4LUZ A;  5K36 G;  1DGS A;  4R4Q A;  2ZM6 L;  5M5Y H;  1HR0 L;  2MQH A;  1CKN B;  1E1T A;  3F1Z A;  4IPG A;  3FHW A;  4A75 A;  1U5K A;  4YWK A;  4NXN Q;  5IYC G;  2Z6K C;  3S16 H;  2A19 A;  5C3E H;  2Q2T A;  3VDY A;  4UPA A;  2N49 A;  1JMC A;  1SRO A;  3CQZ H;  3ULP A;  3W1G A;  2K52 A;  1UE5 A;  3PO2 G;  4H02 A;  4A3K G;  1UWV A;  1Y1V G;  1YHA A;  1YHQ A;  1FL0 A;  4O0A A;  4A3B G;  1I5F A;  1K8G A;  5M5X H;  1PV4 A;  3PUX A;  4A3F H;  1L1O C;  3WWV A;  4DKA C;  1FVI A;  5BR8 L;  3JAM c;  2LXK A;  1IZ6 A;  2KCM A;  4UY8 C;  3A0J A;  3I2Z A;  4GLX A;  4JI1 L;  4X6A H;  3CCE A;  2I5H A;  5IWA Q;  1EQR A;  3J7Z C;  3CCM A;  2N3S A;  3AFP A;  1QZG A;  1N8R C;  3HOZ G;  5H1S E;  3U4Z A;  3CME A;  2B63 G;  2KHI A;  3HOW H;  5C0X I;  1MJE A;  3AQQ A;  5ELN A;  1VQ7 A;  2RF4 A;  1HNZ L;  4GKJ L;  5HY6 A;  1WCM H;  4DK6 C;  2D0O A;  4HIK A;  4AQY L;  5AJ3 L;  3G6E A;  1JE5 A;  1OTC A;  2NVQ H;  2RCN A;  2JA5 G;  1PVO A;  4C3J H;  1D7Q A;  2UU9 Q;  1N32 L;  1YEZ A;  1E22 A;  1VQO A;  5ELO A;  2ZJP A;  2KEN A;  1E7Z A;  4DR1 Q;  4GN5 A;  1VQA A;  4WJ3 M;  4NXM Q;  3GO5 A;  1XTD A;  4LF5 Q;  1BBU A;  2E5L Q;  2BH2 A;  3H3V I;  2NZO A;  1X56 A;  1VQ5 A;  1XNR Q;  2WB1 G;  2E8G A;  2MO1 A;  2UUA Q;  3PIO A;  2UXB Q;  4PZ8 A;  1SLJ A;  2IT1 A;  3UE1 A;  3GTL H;  4DV0 L;  4LFB Q;  4NXN L;  3PCO B;  2IY5 B;  2UXC L;  4YY3 L;  1PH9 A;  3M7N A;  1CSP A;  1E24 A;  3CMA A;  2OWO A;  2R7Z H;  1OXT A;  1IBM Q;  1B7Y B;  1AE2 A;  5FLM G;  4GLV B;  2YTV A;  3E9H A;  1HZ9 A;  3U4V A;  5LMU Q;  3W1B A;  2PQA A;  2JEB I;  4JI3 L;  3S1Q H;  5M3M H;  3K80 C;  3PGZ A;  2JJQ A;  4A3C H;  4IJL A;  4IOA A;  4HJA A;  4BXX H;  3CC7 A;  2VZA A;  1G6P A;  2KBN A;  1SE8 A;  5GQO A;  2GVA A;  3E0E A;  2ALY B;  2Z0S A;  3F2C A;  2K5V A;  3RN2 A;  2CKZ B;  5C4X H;  3LGJ A;  5JJK A;  3UDF A;  2I0Q A;  4A3K H;  4PG3 A;  5IWA L;  2VQE L;  4OON A;  1Y1V H;  1HNW L;  1IL2 A;  4BBS G;  1S3O A;  1IXR A;  2GVB A;  1PA6 A;  4K0K L;  1BKB A;  3HOY G;  3RZD H;  1JB7 A;  4DV7 L;  1NJI C;  4UP9 A;  4A76 A;  1MIU A;  3K81 C;  1VQM A;  4JI4 Q;  4JV5 L;  4JI5 Q;  2GN5 A;  3I4M G;  3H0G G;  1QVG A;  3S24 A;  2WP8 J;  1A8V A;  4OXP A;  4BBR H;  1Q12 A;  3S2D H;  3GD7 A;  2PMZ E;  4JBJ A;  3HOX G;  4B3T Q;  5GAE C;  2JA5 H;  2JA6 H;  1HJP A;  2UUA L;  2OQK A;  4XTC S;  3GTO H;  2UXB L;  2N8N A;  1SN8 A;  5JEA J;  4BY1 G;  1HH2 P;  4GNX A;  2BA0 A;  2XGT A;  2EQS A;  1PHJ A;  3L2P A;  2DUD A;  1XPR A;  1C0A A;  3L0O A;  3NEN A;  1IBM L;  4GOP C;  1KQS A;  1I3Q H;  1WJJ A;  4A3E H;  5BR8 Q;  1XPO A;  4P71 A;  3K7U C;  4R4I A;  3MXN B;  1K73 C;  3PSI A;  3PUV A;  4JI1 Q;  4DR7 L;  2K75 A;  2EXD A;  1Y1W H;  1Q7Y C;  3CCU A;  2QEX A;  3NEM A;  3Q8D A;  5FJ8 G;  3H15 A;  1EFW A;  3RLN A;  5IE8 A;  3GTJ H;  4X62 Q;  1HR0 W;  4LFA L;  5C44 H;  5FLM H;  1HNZ Q;  2OTJ A;  1FGU A;  1MJC A;  4GKJ Q;  3BZC A;  3L7Z C;  2F4V Q;  2B29 A;  2WFW A;  5AJ3 Q;  4HID A;  1L1O A;  4AQY Q;  5IP9 G;  2NVX H;  3TRZ A;  4IO9 A;  1NMG A;  3CXC A;  2YTY A;  4LW1 A;  1EUJ A;  1TWF H;  2IX0 A;  4GNX B;  4KLK A;  3DLL A;  4GKK L;  3PUW A;  1LUZ A;  1VQP A;  1X65 A;  3GTP H;  4NPS A;  3CAM A;  3OW2 A;  4O2D A;  2A1A A;  4JI0 L;  2HT1 A;  1P8L A;  1EWI A;  4LWC A;  4BA1 I;  1XJV A;  2Q2U A;  2VUM H;  3S1M H;  4JI5 L;  3NBH B;  4PMW A;  4POF A;  4JBW A;  4JI8 L;  1XMO L;  4BBS H;  2IHF A;  4DV0 Q;  1EIF A;  4TVA B;  3I4N H;  2UXC Q;  3F8T A;  4YY3 Q;  4B3T L;  3KFU A;  2Y0S E;  2EIF A;  3ZJY C;  3JAM i;  2AMC B;  4J15 A;  3M4Q A;  4JOI C;  2WAQ G;  4AYB G;  1VCI A;  3HKZ G;  1PH1 A;  4DR2 Q;  2NVY H;  3I4M H;  3H0G H;  4LF4 Q;  1YNX A;  2CQO A;  1L1O B;  1GD7 A;  5IYB H;  1Q1B A;  1E3P A;  1EOV A;  3J81 j;  4R4T A;  4P75 A;  1YHB A;  1A62 A;  4YCV A;  2MNA A;  4DV4 L;  1YJ9 A;  4JI3 Q;  3W5O A;  4UP7 A;  3BJU A;  3U58 A;  1PH3 A;  4MNO A;  2HIX A;  1BBW A;  1Q81 C;  2VQE Q;  2UUB L;  4AH6 A;  4A3M H;  3K8A A;  2I5L X;  1IYJ B;  1HNW Q;  4X62 L;  1H95 A;  1SR3 A;  4OWT B;  1RIP A;  4JBK A;  1VQC A;  3ER0 A;  4R4O A;  1YJN A;  4OX9 Q;  1YI2 A;  4K0K Q;  2F4V L;  1LTL A;  3J80 i;  4DV7 Q;  4JYA L;  4LF6 L;  4P73 A;  3AYH B;  4QIW E;  3CP0 A;  3OTO Q;  2B3G A;  3CW2 C;  1HNX L;  4JV5 Q;  2OQ0 A;  1WFQ A;  3PUY A;  2ATW A;  1KAW A;  2UUC Q;  1QZH A;  3EBE A;  2JQO A;  4YWM A;  1KRT A;  1X3F A;  3A5Z B;  3RR5 A;  1GM5 A;  2BH8 A;  4YWL A;  3F2B A;  3A74 A;  4IFD I;  4JI7 Q;  3KYH C;  1R9T H;  2KCT A;  1WYD A;  4C3I H;  1Q82 C;  1VQ6 A;  1M90 C;  3G48 A;  2PI2 E;  3KF6 A;  4JCV E;  1YZ6 A;  1I94 L;  1A63 A;  1NE3 A;  1OXU A;  2AWN A;  4DV3 Q;  3T1H Q;  4A4I A;  2JA7 G;  4JI6 Q;  1CSQ A;  1O7I A;  4LUV A;  3I56 A;  1K83 H;  1TWH H;  3CC4 A;  4DR2 L;  2ZTC A;  3CCL A;  4DR6 Q;  2VW9 A;  4LF4 L;  5C0X G;  1VQK A;  4BY7 G;  1T9H A;  2Q2H A;  3PO3 G;  1PH2 A;  2C35 B;  4DR7 Q;  5IYC H;  2WB1 E;  4LUO A;  4LF9 L;  4A3L G;  2UXD Q;  1VQJ A;  4A93 G;  3U50 C;  5HGQ A;  1NTG A;  1J5E Q;  3G4S A;  3TQY A;  1YVC A;  4LFA Q;  3PO2 H;  4KHP L;  2XTI A;  2K14 A;  1KIX A;  1C7Y A;  2IHE A;  3GTM H;  1IBL L;  4POG A;  2VNU D;  2FXQ A;  2PI2 A;  1K0R A;  3UDX A;  4APV A;  4A3B H;  2LSS A;  4NXM L;  2D0P A;  1B70 B;  1W3S A;  4DR5 L;  3TS0 A;  4OX9 L;  4EQ5 A;  3ULL A;  4GKK Q;  4IFD G;  1FJG Q;  1Y14 B;  5M3F G;  1C9O A;  4JI0 Q;  4A3G G;  1JJ2 A;  1JJG A;  3OTO L;  1HZA A;  1PYS B;  4L5R C;  1PH8 A;  2NVT H;  3HOV G;  4BXX G;  1KXL A;  3HOZ H;  2UUC L;  1ASZ A;  4TQU S;  2NN6 I;  4JI8 Q;  1XMO Q;  2PQA B;  4DUZ Q;  4P74 A;  4DV2 Q;  4QGU A;  2B63 H;  2Q2I A;  3MEF A;  1UE1 A;  3E9I A;  4JI2 Q;  1VQH A; 
#chains in the Genus database with same CATH topology
 3H6M A;  1ENF A;  4B3M Q;  2B63 B;  4JI7 L;  1B53 A;  2PW7 A;  1AZP A;  3O13 A;  4MZ9 A;  3D8G A;  3I4O A;  1PLF A;  1XNQ Q;  4GZY C;  3LWU A;  3E5S A;  3OHX C;  2B39 A;  3MXP A;  4PMB A;  4GS3 A;  4JI6 L;  3GTK H;  1YIT A;  4F7X A;  1PH7 A;  1PRT D;  4KK7 A;  4RAU C;  5KNC A;  4DAM A;  2LKV A;  4JOI A;  1G29 1;  3GTK B;  2MPM A;  1VQB A;  1X54 A;  1D5M C;  2XIW A;  5GRO A;  2VS1 A;  2ZJR A;  4K2L A;  1ENC A;  1LAB A;  1NAP A;  2KED A;  3M85 A;  1RL2 A;  2PCF B;  2EYL A;  4LNQ A;  4C3J G;  3TME A;  1H9K A;  3H3V H;  3BU2 A;  4DV2 L;  3VYS A;  4ZRZ A;  3D6C A;  4FF4 A;  4DNT B;  3CF5 A;  3IAY A;  1U9R A;  4QL5 A;  5E4W C;  3I91 A;  3R3O A;  4YIJ A;  4QQB X;  1W6J A;  1J9O A;  1SAP A;  5DAU A;  4DV6 L;  3M4P A;  4DUY L;  2O4X A;  1JWU D;  2FIN B;  2M2L A;  2IX1 A;  3EN2 A;  4JW0 A;  4FO2 A;  4XQN A;  3URY A;  4OWW B;  4KHP Q;  1K8A C;  1VQ9 A;  2PNH A;  1E1O A;  2K33 A;  3HKZ E;  4KI0 A;  4QB4 A;  1EQQ A;  3CC2 A;  4FF1 A;  1D8L A;  1KHI A;  1DOM A;  3J81 c;  1A2T A;  5C4X G;  4HMI A;  1LT3 D;  3C46 A;  3FDT A;  2KVM A;  1LM0 A;  1JT8 A;  3PIP A;  1NCV A;  3DWQ A;  4WJ4 A;  3M3Y H;  5COR A;  2K5W A;  1A2U A;  2CH4 A;  1I4Q A;  1O80 A;  3KUP A;  2F0P A;  1SFO H;  4BBR G;  2DY7 A;  3J81 L;  2EDG A;  5J3B A;  3UDG A;  3M3Y B;  5C4H A;  5I2X A;  3CD6 A;  4G7O C;  4RFB A;  3PV0 A;  5CYU A;  1U0L A;  3EJI A;  1SFO B;  1SND A;  1NBW A;  2D62 A;  2FJ2 A;  5CV4 A;  2MO0 A;  2VL6 A;  1PTO F;  1UE7 A;  5FLX c;  1DCZ A;  3VR5 A;  4A3E G;  1QE6 A;  1KRS A;  4GOP A;  1EIG A;  2KHS A;  3S15 H;  1KTK A;  2I5M X;  2RA4 A;  1GO3 E;  4R4C A;  1LO5 D;  1D1K A;  2MFI A;  4IOC A;  1TKW B;  1HZB A;  3S15 B;  3UI2 A;  4HIO A;  2A8V A;  1IW7 C;  5FLX L;  1G51 A;  4A3I G;  1M1K C;  2ZTE A;  3KF8 A;  2CCZ A;  2KUM A;  4L63 B;  2YV5 A;  2VUM G;  4C3H H;  2F03 A;  1A0I A;  2N88 A;  3KLS A;  1JC7 A;  3GV6 A;  4KHV A;  1EYA A;  3UE0 A;  3S17 H;  4C3H B;  1NMF A;  4DR3 Q;  1V1O A;  2X6L A;  3PUZ A;  2UU9 L;  5IT9 c;  4DR1 L;  3S17 B;  3BVG A;  1XMQ Q;  4YHH Q;  4RMF A;  4LF5 L;  1ENA A;  4LJZ C;  1GVP A;  2K4K A;  4GN4 B;  1WTV A;  4IFD J;  3BZK A;  2B2Y A;  4KHZ A;  2JA8 H;  3FEW X;  1B8A A;  1V1P B;  1E2W A;  2EY2 A;  2QIL A;  3AB9 A;  1ZEQ X;  3PO3 H;  1STY A;  2N78 A;  1GHJ A;  1TWC H;  2JA8 B;  4L5S A;  4LF8 L;  1N34 Q;  2XWJ B;  4BY7 B;  3PO3 B;  1CKN A;  1PYB A;  4XQQ A;  1HRJ A;  2HHH Q;  2HIV A;  1TWC B;  5IIF A;  2ES2 A;  3BYT B;  1YIJ A;  5EPL A;  1MKH A;  1QNU A;  1KL9 A;  2EYF A;  2ENB A;  5DEH A;  5IYD H;  2PZU A;  5CV9 A;  1Z9F A;  5C3X A;  4IUR A;  1Y8O B;  4HED A;  4K5X A;  3BS1 A;  4DK1 A;  3X3N A;  2ZM6 L;  3OSO A;  1HR0 L;  2MQH A;  4IPG A;  1E1T A;  3FHW A;  1U5K A;  3HGB A;  4NXN Q;  5IYC G;  4Q0F A;  4RKB A;  3S16 H;  2A19 A;  2Q2T A;  2F3W A;  4QF4 A;  3ULP A;  1UE5 A;  3M4Y A;  1UWV A;  3H3V C;  1F9Q A;  1PV4 A;  1JWM D;  3JAM c;  3U9S A;  1H9R A;  2NN6 H;  3A0J A;  5A2Q E;  4JI1 L;  4BS9 A;  1EQR A;  3ONA B;  2KCN A;  1MHW C;  1QZG A;  5H1S E;  1EQT A;  3CME A;  4OO1 H;  2B63 G;  1VQ7 A;  3AQQ A;  2RF4 A;  1HNZ L;  4DK6 C;  3G6E A;  4K2K A;  3TBI B;  1E22 A;  4CBV A;  5IGF A;  1VQO A;  2KEN A;  2CW0 C;  1GUT A;  3GO5 A;  1HPC A;  2E5L Q;  1X56 A;  1PZJ D;  1XNR Q;  2MO1 A;  2UXB Q;  1SLJ A;  1TQO A;  2KEC A;  4TRD A;  2IY5 B;  1Y8P B;  2UXC L;  3M7N A;  1LTS D;  4XT1 B;  2Y0S B;  5EBD A;  5CV6 A;  4DAP A;  2LY7 A;  2XSC A;  2PQA A;  2QEJ C;  1EY7 A;  3DXJ C;  3K80 C;  3T4A C;  3J80 E;  4HJA A;  4BXX H;  4JPB W;  1SE8 A;  3SDZ A;  2X69 A;  2ALY B;  2K5V A;  1KLG D;  5JJK A;  3UDF A;  5D65 A;  2VQE L;  4OON A;  4RA8 A;  4K8I A;  1GUG A;  1HNW L;  1IL2 A;  1S3O A;  1PA6 A;  4K0K L;  3BZD B;  2RVL A;  3EA6 A;  3K81 C;  1MIU A;  2A6H D;  2Q8I B;  4JI4 Q;  2L12 A;  2VXW A;  5LL6 X;  1SYC A;  1PRT F;  1Q12 A;  1O78 A;  2F0D A;  4B3T Q;  2JA5 H;  2UUA L;  3GTO H;  1JOK A;  2IX3 A;  1HH2 P;  1JOR A;  2G9H D;  2EQS A;  1GOZ A;  1UEA B;  2JA5 B;  1IBM L;  3GTO B;  4K14 A;  1QOH A;  5IGB A;  1I3Q H;  2NB0 A;  1XPO A;  5BR8 Q;  4RCN A;  3PSI A;  3NXW A;  1Y1W H;  2EXD A;  4R8N A;  1I3Q B;  2F0T A;  2F0N A;  4LFA L;  5CV8 A;  5FLM H;  2F4V Q;  1JCK B;  2WFW A;  1Y1W B;  1PMR A;  1L1O A;  4HID A;  5CBA E;  2NVX H;  1NMG A;  3NSW A;  3VA7 A;  1EUJ A;  1TWF H;  1JR0 D;  1BO0 A;  2IX0 A;  4GNX B;  3D4R A;  1LUZ A;  4NPS A;  2R93 B;  2HT1 A;  1MSG A;  3FPU B;  1XJV A;  3EVQ A;  1TWF B;  3NBH B;  4PMW A;  4DXF A;  5BN4 A;  1EIF A;  3I90 A;  3KFU A;  3CRL C;  3HEJ A;  2EIF A;  5TSS A;  2PMZ B;  3I4L A;  4RHR A;  2XN9 C;  1PH1 A;  5EKK A;  3I4M H;  4LF4 Q;  2CQO A;  1Q1B A;  4R4T A;  4JI3 Q;  1YHB A;  1YJ9 A;  2CHB D;  4UP7 A;  1CZG A;  2PZT A;  2HIX A;  3I4M B;  1ET9 A;  3DEO A;  1IHZ A;  3MAQ A;  1FGB D;  2JP1 A;  2EPB A;  2B2W A;  2RBM A;  2I5L X;  1F2Y A;  4OWT B;  1DOL A;  1VQC A;  3X3M A;  3W3A A;  4DV7 Q;  1IKM A;  4C3H G;  5FO9 B;  4P73 A;  2OXP A;  2EOT A;  3CW2 C;  1CT1 D;  1KAW A;  4CJ1 B;  1SMY D;  2BOS A;  3D4D A;  5BN3 A;  1BOS A;  3MFG A;  2KCT A;  4TKO B;  4C3I H;  1Q82 C;  1VQ6 A;  3KF6 A;  4Z9C B;  2AWN A;  4A4I A;  1F2M A;  1WD1 A;  4OHJ A;  2ZTC A;  4C3I B;  3CCL A;  5K36 H;  2VW9 A;  1CZW A;  1PTO D;  3T13 A;  5KIX A;  1VQK A;  4BY7 G;  3PO3 G;  2C35 B;  1QJO A;  4LUO A;  1TY0 A;  2UXD Q;  1VQJ A;  2JYO A;  3U50 C;  1K0S A;  1J5E Q;  3G4S A;  3TQY A;  1YVC A;  3PO2 H;  4KHP L;  2K14 A;  2IHE A;  1YNN D;  4DU9 A;  2WKC A;  4A3B H;  2PZW A;  1SYG A;  4TSS A;  3PO2 B;  3TP7 A;  4OX9 L;  4KTA A;  4GKK Q;  2SOB A;  3KK7 A;  1PFN A;  4JI0 Q;  4A3B B;  1Y69 U;  1JJG A;  1SJH D;  1TT2 A;  4CKC A;  4L5R C;  2NVT H;  1A3U A;  1NNX A;  2NWG A;  5E3F A;  3HOZ H;  4G57 A;  3CRK C;  4JI8 Q;  1WTX A;  4QGU A;  2NZ1 D;  1O7L A;  3QO2 A;  4JI2 Q;  1SE4 A;  1D5Z C;  3SE0 A;  2NVT B;  4KKT A;  1U4M A;  3EIV A;  3HOZ B;  3OIQ A;  1UEB A;  2F0F A;  2EJM A;  4OL7 A;  1PH4 A;  2AUJ D;  2E2H H;  1J8I A;  3J7A F;  3T1H L;  4DV3 L;  2Z6K A;  3M4O H;  2JSO A;  4FDB A;  2E2H B;  2XWB B;  4ZLT F;  5LMN Q;  2Z9H A;  3OYY A;  3QG1 A;  4X66 Q;  4ZAI A;  3M4O B;  1CKM A;  1N9W A;  2RQX A;  2RDG A;  4IPC A;  5C3W A;  2JE6 I;  2NN6 G;  5FO7 B;  4JYA Q;  3MXG A;  5C0X H;  4LF6 Q;  4XXE A;  3HOU G;  4IZ8 A;  4A3L H;  4OO1 G;  1C4Q A;  4JG2 A;  1PH6 A;  3A7A B;  2O5J C;  3PF4 A;  3CPF A;  2AUK A;  2Z8L A;  1RKN A;  5JJZ A;  3C1E A;  4LMQ D;  3S14 H;  3HOY H;  3ZYY X;  4I7Z C;  2F1M A;  2E74 C;  3KLS X;  1PFM A;  1EY9 A;  2K7V A;  3NBI A;  2K04 A;  3S14 B;  3HOY B;  1AE3 A;  1CFM A;  3ERS X;  2X6G A;  2K5N A;  1PFS A;  3Q24 A;  3BG3 A;  4GNX C;  1QUQ A;  1X3E A;  4BY1 H;  1XMQ L;  4YHH L;  3V2T A;  3OOC A;  2C9O A;  3C2P A;  4RCO A;  1OXS C;  1EIY B;  1SMX A;  5LL6 S;  4BXX G;  2F3I A;  2QGQ A;  4IOA A;  4AYB E;  4BY1 B;  4B3S Q;  3S1N H;  4R1J A;  2R7F A;  2KA7 A;  3RLO A;  4JBM A;  3S1N B;  3K6O A;  1N34 L;  2YYZ A;  1EYC A;  1NY4 A;  2D9U A;  2N55 A;  1ONL A;  5KNB A;  3C3L A;  3CKI B;  2HHH L;  3GDE A;  3FMC A;  1B1Z A;  3HP3 A;  3SK4 A;  1B4O A;  3D31 A;  4MTN A;  3D0F A;  4DV5 L;  1CQV A;  3K5L A;  1FYC A;  5FK9 C;  4YCU A;  5M5W H;  4DAY A;  1PDQ A;  4N9P A;  1JE4 A;  1U4P A;  1BCP B;  1WOC A;  2B2U C;  1ILQ A;  2HDM A;  3F2U A;  1J6Q A;  3FKI G;  2IL8 A;  1STG A;  3J80 c;  1GJX A;  3SEB A;  1PH5 A;  5C4Z A;  2JEA I;  1V9P A;  1HFN A;  2F0S A;  1Y1W G;  3AFQ A;  1BXT A;  1YJW A;  5E1F A;  2WAQ B;  3DHQ A;  3MXU A;  5IP7 H;  5CR3 A;  1SNQ A;  3NTI A;  2R92 H;  3FRP B;  2R93 G;  3VYU A;  4LFC L;  4DK3 C;  3TZU A;  2A73 B;  2QDL A;  1LTB D;  1PYW D;  2R92 B;  3W2D A;  4A3D H;  2SNM A;  3RLF A;  1B50 A;  3T1Y Q;  4CGY B;  1VQE A;  4PZ6 A;  2EYO A;  5C0X J;  1DXM A;  4GOP B;  1EU4 A;  1G6Z A;  4OEL B;  4A3D B;  2CQA A;  2VQF Q;  2ZXR A;  4FNF A;  3RNU A;  1S72 A;  4UP8 A;  5JJL A;  1QB5 D;  1WTH A;  1VQG A;  5F2D A;  3DM3 A;  1CKO A;  2E5L L;  1RHP A;  4NDX A;  1N33 Q;  4ZUI A;  1XNR L;  1STB A;  3KF8 B;  3P20 A;  4RG1 A;  1VQD A;  4WRD A;  2F0V A;  3IKJ A;  3CCJ A;  1K9M C;  1W2B A;  3MFY A;  1SSO A;  1RD9 D;  4DV1 L;  3NUC A;  5EGT A;  4XYQ A;  3WOE A;  2FFK B;  2DGY A;  2LMC B;  1EFI D;  1LYL A;  3MA2 B;  4PZ7 A;  2OF1 A;  2G5D A;  3ICE A;  4IFD H;  1EY8 A;  5M3F H;  4NKL A;  3PMF A;  2HCC A;  4A3G H;  4ODG A;  3HOV H;  4X65 Q;  2FMC A;  3A55 A;  1B3A A;  5M3F B;  3K58 A;  1LT5 D;  1L2F A;  1IBK L;  4AIM A;  2EE1 A;  4A3J H;  2WAC A;  4A3G B;  4JI4 L;  3HOV B;  3GV3 A;  1KD1 C;  5K36 G;  3LWE A;  1DGS A;  3F1Z A;  1CKN B;  4K5W A;  1FNU A;  1I6V C;  1JOQ A;  4UPA A;  5KGU A;  4RWS C;  2K52 A;  3PO2 G;  4HCE A;  4A3K G;  4RGN A;  1Y1V G;  2WKD A;  1YHQ A;  2I07 B;  4A3B G;  3PUX A;  5IGG A;  3WWV A;  2BE5 D;  5BR8 L;  1IZ6 A;  1VF7 A;  3CCE A;  2I5H A;  2K03 A;  5IWA Q;  4FXK C;  1STN A;  2N3S A;  3HOZ G;  3HRZ C;  2A69 D;  2KHI A;  3J7Y W;  1F77 A;  1TS4 A;  4UHV A;  4HIK A;  1JE5 A;  2RCN A;  2FHT A;  1N32 L;  1CM9 A;  3R93 A;  1LLR D;  4H7B A;  1VQA A;  5AFW A;  4WJ3 M;  2Q8T A;  3H3V I;  2NZO A;  2WB1 G;  3PIO A;  3UE1 A;  4MTK A;  2PYK A;  4ZK9 B;  3PCO B;  5ELD A;  1D2B A;  1W6K A;  4G7Z C;  2R7Z H;  3CMA A;  1SNP A;  1S5D D;  2E75 C;  3U4V A;  1HZ9 A;  5LMU Q;  3W1B A;  4FF2 A;  3ITP A;  2JEB I;  5FKA C;  4JI3 L;  2R7Z B;  4OEM B;  3AMU A;  1BCP C;  2VZA A;  1G6P A;  2MP1 A;  2KBN A;  5GQO A;  1G91 A;  4UDU C;  3E0E A;  2EY6 A;  2Z0S A;  3F2C A;  4KY7 A;  2I0Q A;  4PG3 A;  3OMG A;  4ZYS A;  4HR7 B;  1HA6 A;  4ZCK A;  2SEB D;  1IXR A;  1BKB A;  3HOY G;  4DV7 L;  1HFG A;  2A68 D;  2I46 A;  3MXN A;  4XDX A;  1PTO H;  1IYU A;  2DNC A;  4CJ0 B;  3H0G G;  3S24 A;  2WP8 J;  1SYE A;  1PTO B;  1JIC A;  1H9S A;  3OWE B;  3GQB A;  5JEA J;  1R4Q B;  1LTG D;  4N8X 1;  4BY1 G;  1PHJ A;  1WTW A;  1XPR A;  2EYP A;  3L0O A;  2R3Z A;  4GOP C;  1KQS A;  5IT9 L;  1GUS A;  1WJJ A;  3VA5 A;  4R4I A;  1K73 C;  3PUV A;  1T5X D;  2K75 A;  3NEM A;  3H15 A;  1K8O A;  1EFW A;  3RLN A;  5IE8 A;  5C44 H;  1EY4 A;  1FGU A;  4GKJ Q;  2F0U A;  1A6X A;  2B29 A;  5JVH 3;  3TRZ A;  1O7Z A;  3CHB D;  5C44 B;  4PQX A;  4KLK A;  4I7A A;  4GKK L;  3PUW A;  1NR4 A;  3FVQ A;  3OW2 A;  4JI0 L;  3VR2 A;  3S1M H;  1P8L A;  1EWI A;  4LWC A;  2EZV A;  2Q2U A;  4F87 A;  1ICF B;  4JI5 L;  3SHL A;  3NTH A;  4WFN 3;  4JI8 L;  1XWE A;  4BBS H;  3QOJ A;  3OW7 A;  4DV0 Q;  3S1M B;  4KMU C;  3I4N H;  4CJ2 C;  3ERO A;  2A6H C;  3M7G A;  1S5B D;  1HUM A;  1TS2 A;  5DNF A;  1DM0 B;  1HTL D;  2K28 A;  2WAQ G;  3MEH A;  4DR2 Q;  2NVY H;  3S16 B;  3I4N B;  5IYB H;  1L1O B;  1L0Y B;  3J81 j;  1E3P A;  4P75 A;  2B2Y C;  2JXM B;  3U58 A;  5E4X A;  2KOL A;  5HGT A;  2NVY B;  1STE A;  2B8G A;  2HCI A;  3BVM A;  1Q81 C;  2XVS A;  3Q23 A;  1QWY A;  4RH6 A;  1IW7 D;  4X62 L;  1H95 A;  4P2C B;  1SR3 A;  4IUN A;  4JBK A;  3ER0 A;  1LTL A;  3MTS A;  1I4H A;  3J80 i;  4JYA L;  4LF6 L;  4QIW E;  3OTO Q;  4FYD A;  3PUY A;  1VMP A;  1QZH A;  3EBE A;  3HS0 C;  4YWM A;  2BDO A;  3JAM L;  3V05 A;  2QW7 A;  3RR5 A;  1LTR D;  3F2B A;  4JI7 Q;  1R9T H;  1WYD A;  5CC4 A;  5IGE A;  1YZ6 A;  5ELF A;  4JI6 Q;  4LUV A;  1R9T B;  4IUT A;  2L4N A;  2VB3 X;  2RKS A;  1CHP D;  2E2D C;  1PH2 A;  4DR7 Q;  2WIN B;  1E0B A;  3RD4 A;  5HGQ A;  1NTG A;  4H13 C;  4ZKB B;  2QCP X;  2VNU D;  2FXQ A;  3BDL A;  4MN3 A;  1M4V A;  1W3S A;  3ULL A;  5I9P A;  4IFD G;  5M3F G;  1C9O A;  1MBY A;  4A3G G;  4HSV A;  3K0Y A;  1KXL A;  3HOV G;  1JQY D;  4ME5 A;  2UUC L;  1ASZ A;  4TQU S;  2NN6 I;  1XMO Q;  4DV2 Q;  4J1M A;  4P74 A;  1UE1 A;  1V1P A;  4CKE A;  4OO1 I;  4JC0 A;  3RUZ A;  1EY0 A;  4EX5 A;  2A6E C;  2O5I C;  3QIA A;  1V8Q A;  2L5T A;  1SMY C;  1O7Y A;  1QCB D;  4DV4 Q;  4HJ5 A;  3BDO A;  2F0O A;  4EGV A;  2ZTD A;  5EBC A;  1HQR D;  2HD3 A;  1WD0 A;  4DR6 L;  5JJI A;  3NQT A;  4QY7 A;  5IY0 A;  1WTR A;  3A5U A;  2HDL A;  5CBE E;  1X3G A;  1JJC B;  1PTO C;  1VQI A;  1L0X B;  2Z4I A;  2QA4 A;  4GN3 B;  4CKB A;  1EYD A;  4ABN A;  1KC8 C;  4RGM A;  3T16 A;  2F0J A;  1HNX Q;  2E2J H;  1JOO A;  1EZ8 A;  5A35 A;  1FJG L;  3FP9 A;  1QVF A;  1RTO A;  2NVX B;  1YNN C;  4J6H A;  4C1N K;  2MHV A;  3SK5 A;  2F0E A;  2E2J B;  1VQF A;  4DUZ L;  1PRT B;  2ASB A;  3B6Y A;  3VR4 A;  3S9W A;  3T1Y L;  2IPK D;  3SK8 A;  4B3M L;  1HTP A;  3ULJ A;  2Z4H A;  1XNQ L;  2VQF L;  1B3Q A;  3AEV A;  1FNV A;  3HOX H;  4EQO A;  2OT2 A;  1YNJ D;  1AN8 A;  3HOX B;  2XRQ D;  1N33 L;  1IL8 A;  3KJO A;  1FD7 D;  2R7D A;  2E76 C;  3M9B A;  3STB D;  4DR5 Q;  2BDN A;  1X32 A;  1X55 A;  1WVL A;  1UE6 A;  1VQ4 A;  3DWP A;  5ISR A;  4K6L A;  4M8A A;  4K6D A;  2MGS A;  3EQL C;  5DLQ E;  1BUV T;  5K5P A;  2KEE A;  3TRE A;  1VMC A;  5GAD C;  1EY5 A;  5LHY 1;  4RKL A;  3KJP A;  5IP9 H;  1K3R A;  1QUQ B;  2F0G A;  2A74 C;  1DJR D;  4OWX B;  4X3U A;  1VQ8 A;  1CQF A;  3J81 E;  4PMC A;  4X64 Q;  1NSN S;  4DN4 M;  3K57 A;  2QF7 A;  1CHQ D;  3DM1 A;  4ME3 A;  1F2L A;  2KJX A;  2VY3 A;  2HQL A;  3QR8 A;  1SNC A;  1XPU A;  3C1F A;  4X65 L;  3KLR A;  2JA8 G;  1KAB A;  2VB2 X;  4FVM A;  1TS3 A;  1LT6 D;  3P7J A;  1Q46 A;  3GTG H;  4LF7 Q;  4NB3 A;  4EQN A;  2DJG C;  1VS0 A;  1KDC A;  3GTG B;  3KDF A;  1D5X C;  2ICI A;  2AWO A;  3HKZ B;  5C44 G;  4LF8 Q;  1KDA A;  1X9N A;  4C2M H;  3I8Z A;  5FLX E;  4DAY B;  1SRU A;  5IYD G;  2QKI C;  2RSO A;  1L0W A;  1WTP A;  1ZYR D;  4PNY A;  3G71 A;  2L11 A;  5KYI A;  2AQ2 B;  1SJE D;  3F2D A;  3S2H H;  3MC0 B;  1UUP A;  4HJ7 A;  4BWG B;  3HFZ B;  4DFA A;  1CA6 A;  1SDF A;  5EKI A;  3I4N G;  5CMD A;  5KND A;  1AH9 A;  3S2H B;  2SDF A;  3QWN A;  1S40 A;  1OXX K;  3NPP A;  4HIM A;  3RMH A;  2ZM6 Q;  2BA1 A;  2ZXO A;  5IYB G;  1HR0 Q;  3I7F A;  4HJ8 A;  2JK8 A;  2H4O A;  2IJ0 A;  4IPD A;  3U9O A;  5JAV A;  5CGK A;  5ELC A;  4EVO A;  2ID0 A;  5C5M A;  2LXJ A;  1U4R A;  3K0X A;  4XIG S;  3DMU A;  4L5T A;  1GKH A;  1LT4 D;  2CWP A;  5IT9 E;  1BF4 A;  2L0C A;  1M8A A;  3NBH A;  4EQP A;  5LMU L;  3TS2 A;  2DY8 A;  2RHS B;  4B9X A;  4BA2 I;  5LMN W;  3RZO H;  2BCO A;  4DR4 Q;  1GHK A;  2F3V A;  5JVG 3;  2MJ8 A;  3IRB A;  4G4K A;  1B44 D;  2Y0S G;  3DUZ A;  5D14 A;  3TZD A;  3RZO B;  1E2Z A;  4A3I H;  5DM6 3;  2CFM A;  1N36 Q;  4DR3 L;  1B9M A;  2P5Z X;  2Q8R E;  1PFB A;  4ZKC B;  1Z47 A;  4A3I B;  1TWA H;  2JN4 A;  3D6W A;  1K3B C;  4LUZ A;  4XYO A;  1S5F D;  3EFX D;  4A75 A;  2H1E A;  5EQ0 A;  2B2T A;  2Z6K C;  3BYY B;  5C3E H;  2N49 A;  1SRO A;  1PRT C;  1TWA B;  3CQZ H;  2ZT9 C;  3W1G A;  2A5H A;  5C3E B;  4O0A A;  1Y8N B;  1I5F A;  1K8G A;  5M5X H;  3CQZ B;  2EJG C;  2RDF A;  4KY5 A;  4A3F H;  4DKA C;  4DA2 A;  4OIK A;  3TDQ A;  3I2Z A;  4GLX A;  3NWS A;  4X6A H;  2V4D A;  5M5X B;  5A2Q L;  3J7Z C;  1HXY D;  3CCM A;  4A3F B;  3U4Z A;  3HOW H;  4ZQ3 A;  5C0X I;  1MJE A;  5C5L A;  4GKJ L;  5HY6 A;  1WCM H;  2D0O A;  3D4W A;  2NVQ H;  2WV6 D;  2JA5 G;  1PVO A;  1AZQ A;  1YEZ A;  3HOW B;  5ELO A;  1DZ1 A;  3JAM E;  1WCM B;  1PZK D;  2NVQ B;  1U4L A;  1STA A;  5M5W B;  3A8I E;  2BH2 A;  1VQ5 A;  4L6T B;  5ELB A;  2E8G A;  4ULL A;  2UUA Q;  5EJW A;  4PZ8 A;  5I2Y A;  3K5M A;  2B2V C;  2TSS A;  3GTL H;  4DV0 L;  4LFB Q;  4NXN L;  1PH9 A;  5IOD A;  2OWO A;  1OXT A;  1IBM Q;  1E2V A;  1B7Y B;  3Q6S A;  5FLM G;  4GLV B;  2YTV A;  3GTL B;  4F8M A;  2R61 A;  1RTN A;  4RHS A;  3S1Q H;  5M3M H;  3PGZ A;  2JJQ A;  4A3C H;  1NR2 A;  2J4X A;  1D6E C;  1FR3 A;  3J80 L;  1II3 A;  3RN2 A;  1I4P A;  2CKZ B;  3N52 A;  3KBG A;  3S1Q B;  5M3M B;  2EYH A;  3OMC A;  2GVB A;  2BE5 C;  1EEF D;  2NTT A;  4X3K A;  3RZD H;  1JB7 A;  5M9O A;  1NJI C;  2M9V A;  3IFT A;  1VQM A;  2TMP A;  1TY2 A;  2A69 C;  2DJF C;  4J8Q A;  3RZD B;  4KJN A;  3I4M G;  4U68 A;  1QVG A;  3QB3 A;  4OXP A;  1A8V A;  5DM7 3;  4L8J A;  3GD7 A;  2PMZ E;  4JBJ A;  3HOX G;  5GAE C;  2JA6 H;  2UXB L;  2OQK A;  1SN8 A;  2BA0 A;  2DUD A;  2JA6 B;  3NEN A;  4ZUJ A;  3K7U C;  3MXN B;  5T1I A;  4DR7 L;  1Q7Y C;  5T1G A;  3I73 A;  1SEB D;  3NTK A;  2QEX A;  3CCU A;  3GTJ H;  2K5Q A;  4X3T A;  2OTJ A;  1MJC A;  4KN7 C;  3BZC A;  3L7Z C;  4OIJ A;  4AQY Q;  4HTH A;  5JEA H;  2PQE A;  3SR1 A;  5J39 A;  5AJ3 Q;  5IP9 G;  1H9S B;  2DN8 A;  3GTJ B;  1UNS A;  3TSS A;  4B08 A;  4C3I G;  1KNA A;  3DLL A;  1ESR A;  1X65 A;  3CAM A;  2NYZ D;  4JBW A;  1K28 A;  1XMO L;  2PPB C;  4A3J B;  2IHF A;  3KBX A;  4TVA B;  2A68 C;  1TR5 A;  2F4I A;  3F8T A;  4YY3 Q;  2C5C A;  4B3T L;  4ILW A;  3E3X A;  4J15 A;  1OO9 B;  1SE3 A;  3M4Q A;  4JOI C;  1VCI A;  3HKZ G;  1STH A;  1CA5 A;  1GD7 A;  4DV4 L;  4JK1 C;  4YCV A;  1A62 A;  2MNA A;  4CHT B;  3BJU A;  3G7L A;  1PH3 A;  1R4P B;  2RCF A;  4I65 A;  1T5E A;  1BBW A;  1GUO A;  1VF5 C;  3N6R A;  3IFD A;  5FO8 B;  4AH6 A;  4A3M H;  1ICW A;  4PV1 C;  4HMJ A;  1RDP D;  3NWT A;  4R4O A;  4OX9 Q;  1YI2 A;  2F4V L;  1MI2 A;  1D1I A;  4A3M B;  1EQV A;  1HNX L;  4JV5 Q;  2OQ0 A;  2ATW A;  1QIL A;  2JQO A;  2K5D A;  2K05 A;  3DEP A;  4V19 0;  5J22 A;  3Q22 A;  1VDZ A;  1EEI D;  1SNO A;  1X3F A;  4KKU A;  3SVM A;  1GM5 A;  2BH8 A;  1SE2 A;  4DK0 A;  5KEE A;  4YWL A;  3E6Z X;  4IFD I;  3KYH C;  4MHE A;  3A56 A;  1M90 C;  1IKL A;  2PI2 E;  4JCV E;  3HZX A;  1A63 A;  3T1H Q;  4DV3 Q;  3MHB A;  2KQ3 A;  1BNZ A;  3I56 A;  1K83 H;  1TWH H;  3NK9 A;  3NHH A;  1RCV D;  1A3V A;  1QNK A;  1A15 A;  1HQM C;  5C0X G;  4LF4 L;  3TP5 A;  1T9H A;  2Q2H A;  5COY A;  4LK1 C;  1AP0 A;  2WB1 E;  4A3L G;  3A7L A;  1BQQ T;  1K83 B;  1TWH B;  1ILP A;  2K32 A;  2PO4 A;  2XTI A;  1C7Y A;  1QG7 A;  4H44 C;  2Z6B A;  2HUG A;  2LSS A;  3TS0 A;  1B70 B;  2RSN A;  4DR5 L;  4K5V A;  5EPJ A;  4EQ5 A;  1Y14 B;  1XYI A;  1JJ2 A;  4FXG C;  2F0Q A;  1HZA A;  3A8K E;  1PH8 A;  2K01 A;  3GP7 A;  2PQA B;  2RDH A;  3V96 A;  2OEO A;  3MEF A;  3E9I A;  2GA4 B;  5CV5 A;  1G2S A;  5GAG C;  4IPH A;  3LX0 A;  2D2C C;  2K5H A;  1S4Z A;  4X64 L;  3CCV A;  2LFN A;  4YCW A;  3VYT A;  4B3R Q;  5C3E G;  4CDF C;  4V0B A;  3CPW A;  3OIP A;  3KLW A;  1OXV A;  3TP8 A;  4IUV A;  2EYJ A;  2UUB Q;  2NUC A;  4IUP A;  2UXD L;  2OTL A;  4NP5 A;  4L5Q A;  1J5E L;  4LF7 L;  4A3F G;  4FXD A;  4HN7 A;  1EIH A;  1TXY A;  2PW5 A;  2CH4 W;  4BY7 H;  1SXT A;  1ROD A;  1BVS A;  2G9D A;  3K59 A;  3TN2 A;  3HOW G;  1CTM A;  1V43 A;  4DNI A;  4OGQ C;  4IQZ A;  1WCM G;  4XT3 B;  2K50 A;  1XTC D;  1I6H H;  1SYD A;  3NP8 A;  2YU9 H;  2F0W A;  1SBB B;  2Z1C A;  1DD2 A;  4NW2 A;  1PXU A;  4JI2 L;  1Z7T A;  3KOJ A;  1I94 Q;  4QUC A;  4DV5 Q;  1QVC A;  1I6H B;  2FMM A;  2YU9 B;  1KAA A;  3OWF A;  2D5D A;  2QDB A;  3D3R A;  4BBS B;  5I6Y A;  5FOB B;  2EYM A;  4X3S A;  2F52 A;  1Q1E A;  2CWA A;  3TEH B;  3L9A X;  4KY6 A;  2NZH A;  1X3Q A;  1LV9 A;  1NUC A;  4LF9 Q;  1HHV A;  5IP7 G;  3RN5 A;  2L9H A;  5D3I B;  2R92 G;  5LMN L;  2DNE A;  2EY1 A;  3AU7 A;  1IBL Q;  4X66 L;  5M3M G;  4A3C G;  2KHJ A;  2WAQ E;  1BCP D;  3CCR A;  4UAI A;  3CCS A;  4NXM Q;  3GTQ H;  1C0A A;  2RHQ B;  4A3D G;  4ALP A;  5G3L D;  3PIP 3;  4Y7N H;  2ZJQ A;  5D3D A;  4LFC Q;  3GTQ B;  5FJ8 H;  3E0J A;  1G2T A;  2M00 A;  3NQI A;  4C1N I;  1ASY A;  1LTA D;  2NBF A;  4Y7N B;  2V1C C;  3MVV A;  1VQN A;  3G6J B;  4Y52 H;  1JB3 A;  2YTX A;  1LTI D;  1F9R A;  3HOU H;  1GXD C;  4DPG A;  5EAY A;  2L1B A;  3H91 A;  2AHO B;  1PZI D;  4DR4 L;  4IAL A;  2JA6 G;  3HOU B;  1I50 H;  4P72 A;  1BDO A;  4O1N A;  1MGS A;  5I6W A;  1Q86 C;  1N36 L;  3PIO 3;  5E7N A;  5EKL A;  5KYL A;  1EZ6 A;  1I50 B;  1TWG H;  3JC6 6;  1KDB A;  3J7A 5;  2SNS A;  4RGO S;  5GAH C;  2NTS A;  3HKS A;  5CV7 A;  1TWG B;  4DV1 Q;  4AYB B;  4B3S L;  3KF6 B;  4CDD C;  1YNJ C;  1WI5 A;  3T51 B;  5JEA G;  2L15 A;  3CCQ A;  1UAP A;  5ELE A;  4KV6 A;  2K1B A;  1ESF A;  1YBY A;  3STB C;  2CVR A;  2R6G A;  4A3J G;  1VQL A;  3PF5 A;  4DGZ A;  2E2I H;  1X6O A;  2AKW B;  3UDI A;  1BBX C;  1F9P A;  4DV6 Q;  3SGI A;  1GUN A;  1IBK Q;  3PQI A;  4DUY Q;  3KDF B;  4GLA C;  4N9T A;  2H5X A;  2E2I B;  1MSH A;  1HUN A;  3WDN A;  2IW3 A;  1Q90 A;  1EY6 A;  3VR6 A;  3S1R H;  2ICE C;  2F0L A;  4IUU A;  4QJF A;  4HJ9 A;  3QJY A;  3HG9 A;  4JVZ A;  2JA7 H;  3S1R B;  2OCE A;  4IJH A;  3P1H A;  1B2T A;  4LFB L;  4Q5V A;  4K8J A;  2LS0 1;  4A3M G;  1HZC A;  2JA7 B;  4A93 H;  1MD2 D;  5NUC A;  3FKI H;  3DWA A;  3VYR A;  2XNA C;  5BN5 A;  4A93 B;  1P16 A;  3FKI B;  3R2T A;  2F0M A;  2CW0 D;  2ZXP A;  1CUK A;  4IN3 A;  1WTQ A;  1EYG A;  5C4J H;  2R93 H;  1Q8K A;  3J7A V;  1N32 Q;  1V1Q A;  2WII B;  5I4D A;  1XX8 A;  4KD3 A;  2JA9 A;  2K6A A;  4NMZ A;  1ZKO A;  3K7A H;  5C4J B;  1S5E D;  1ZYR C;  2R7Z G;  3J81 i;  2AQ1 B;  3NEL A;  4N8F A;  3I55 A;  1G8Z D;  4R4Q A;  5EPK A;  5M5Y H;  3K7A B;  1I4X A;  4YWK A;  1EOT A;  3VDY A;  1JMC A;  2EVB A;  5KRU A;  5M5Y B;  4H02 A;  2B8F A;  2EJF C;  2HQE A;  1YHA A;  3A8J E;  1SYB A;  1FL0 A;  3H09 A;  3LNN A;  1SYF A;  1L1O C;  1FVI A;  4FP5 D;  2LXK A;  2KCM A;  4UY8 C;  3OPO A;  4E6I A;  3AFP A;  1C8C A;  1N8R C;  4KN4 C;  1AEX A;  3ERQ A;  5ELN A;  1SNM A;  1OTC A;  4AQY L;  5AJ3 L;  1AW7 A;  4C3J H;  1D7Q A;  3T53 B;  2A6E D;  2UU9 Q;  1Q8I A;  1XXG A;  2ZJP A;  1E7Z A;  2J0T D;  4DR1 Q;  1BR9 A;  4GN5 A;  1CI3 M;  1XTD A;  4LF5 Q;  1WTO A;  4C3J B;  1BBU A;  1HCZ A;  3T56 B;  1C48 A;  1IYV A;  3SXH A;  2IT1 A;  1KNE A;  4RGT A;  4DXG A;  4YY3 L;  1CSP A;  1E24 A;  1EU3 A;  2MUY A;  1AE2 A;  5JPN C;  3E9H A;  1I4R A;  2B2W C;  1ML0 D;  4QUF A;  4ID6 A;  4IJL A;  3CC7 A;  3CU7 A;  1KLU D;  4C2M B;  2GVA A;  3L3O C;  5C4X H;  3LGJ A;  1TU2 B;  5HUR A;  4A3K H;  5IWA L;  1Y1V H;  1F9S A;  5IGC A;  4BBS G;  4HSP A;  4O42 A;  4R8I A;  5C4X B;  4A3K B;  4UP9 A;  4A76 A;  3R8B A;  1Y1V B;  1DOK A;  5JPM C;  4DNR B;  2GN5 A;  3K5O A;  4JI5 Q;  4JV5 L;  2EY5 A;  1Q3L A;  4BBR H;  1X3P A;  3S2D H;  1RF2 D;  4C56 C;  1HJP A;  4XTC S;  2L55 A;  2N8N A;  1EWC A;  1S5C D;  4BBR B;  4GNX A;  2XGT A;  3S2D B;  3L2P A;  3MZ5 A;  2AQ3 B;  4F88 A;  1RJT A;  4KJO A;  1EWH A;  4A3E H;  4G7H C;  4P71 A;  4JI1 Q;  3ND9 A;  2EXZ A;  2WB1 B;  3Q8D A;  4S3S A;  5FJ8 G;  1TS5 A;  4X62 Q;  4A3E B;  1HR0 W;  1HNZ Q;  2PNR C;  4CDE C;  4WOR A;  2KCC A;  4QCL A;  4IO9 A;  3VR3 A;  3CXC A;  2YTY A;  4LW1 A;  1JWS D;  1DYQ A;  4KD4 A;  1GUW A;  1HA5 A;  1VQP A;  3GTP H;  3I70 A;  1TVX A;  4O2D A;  2A1A A;  3WOF A;  2VUM H;  4BA1 I;  1CK1 A;  3ND8 A;  4POF A;  3TP6 A;  3GTP B;  5JOB A;  2VUM B;  2O2L D;  2UXC Q;  3BVZ A;  2Y0S E;  3JAM i;  3ZJY C;  1H9M A;  3MWY W;  3I3C A;  3NE5 B;  2B2U A;  2AMC B;  3A54 A;  4HCS A;  4AYB G;  1BCP F;  3H0G H;  1YNX A;  4B3R L;  1EOV A;  3P75 A;  2B2V A;  3R2I A;  4MIU A;  5G3L F;  3W5O A;  4XQJ A;  4MNO A;  4KKS A;  3H0G B;  2IWH A;  2VQE Q;  1Z6H A;  2UUB L;  3K8A A;  1IYJ B;  1HNW Q;  1RIP A;  4LAA A;  4K0K Q;  1YJN A;  1ZXT A;  3AYH B;  5IGD A;  3CP0 A;  2B3G A;  4WJW A;  1WFQ A;  2UUC Q;  1K8M A;  4HAE A;  1KRT A;  2XRS D;  5I9O A;  3A5Z B;  1I4G A;  3BDC A;  3A74 A;  5C6A A;  1EL0 A;  3G48 A;  1I94 L;  2F0I A;  5IOC A;  1NE3 A;  1OXU A;  2J7Z A;  3IL8 A;  2JA7 G;  1CSQ A;  1O7I A;  3CC4 A;  4DR2 L;  4QMG A;  2B2T C;  4DR6 Q;  1ET6 A;  1TII D;  3FPP A;  1H9J A;  1LTT D;  3QOL A;  5IYC H;  4DAV A;  1B9N A;  3K5N A;  4LF9 L;  5L37 A;  5J1Z A;  2F0K A;  3Q0A A;  4H0L C;  4A93 G;  3H94 A;  4LFA Q;  1F2Z A;  1KIX A;  4FF3 A;  3GTM H;  1IBL L;  4B9W A;  4POG A;  1DON A;  2PI2 A;  1K0R A;  3UDX A;  4APV A;  4NXM L;  2D0P A;  2F0H A;  1LAC A;  3SK6 A;  1FJG Q;  3GTM B;  4IUQ A;  1AFP A;  4DF7 A;  3OTO L;  1PYS B;  1A3T A;  4QIW B;  1FNW A;  4CDC C;  4M1U B;  2B63 H;  4DUZ Q;  4U67 3;  2Q2I A;  3I72 A;  1VQH A;  4R9W A; 
#chains in the Genus database with same CATH homology
 5GAG C;  4IPH A;  4OO1 I;  4JC0 A;  4EX5 A;  2K5H A;  3EIV A;  4B3M Q;  4JI7 L;  1UEB A;  4X64 L;  4MZ9 A;  3CCV A;  1PH4 A;  2E2H H;  3I4O A;  4YCW A;  4B3R Q;  4DV4 Q;  4DV3 L;  4HJ5 A;  5C3E G;  3T1H L;  1XNQ Q;  2ZTD A;  4JI6 L;  4GS3 A;  3GTK H;  1YIT A;  1PH7 A;  3CPW A;  2Z6K A;  3M4O H;  4DR6 L;  5JJI A;  3KLW A;  4FDB A;  4DAM A;  5LMN Q;  4QY7 A;  1OXV A;  3OYY A;  5IY0 A;  4JOI A;  1G29 1;  2UUB Q;  4X66 Q;  2UXD L;  3A5U A;  2OTL A;  4L5Q A;  1J5E L;  4LF7 L;  4A3F G;  1CKM A;  1VQB A;  1X54 A;  1N9W A;  1X3G A;  1JJC B;  4IPC A;  1VQI A;  1TXY A;  2JE6 I;  2NN6 G;  5GRO A;  2VS1 A;  2ZJR A;  4GN3 B;  2QA4 A;  4JYA Q;  4LF6 Q;  4BY7 H;  1KC8 C;  3HOU G;  4A3L H;  1HNX Q;  1BVS A;  4OO1 G;  3M85 A;  2E2J H;  1RL2 A;  3HOW G;  1V43 A;  4DNI A;  4JG2 A;  1FJG L;  3FP9 A;  1WCM G;  1QVF A;  1PH6 A;  4LNQ A;  2K50 A;  3CPF A;  3PF4 A;  1I6H H;  2YU9 H;  1VQF A;  3H3V H;  3BU2 A;  4DV2 L;  4DUZ L;  3S14 H;  2ASB A;  4JI2 L;  3HOY H;  3KOJ A;  3B6Y A;  3CF5 A;  1I94 Q;  4QL5 A;  4DV5 Q;  1QVC A;  3T1Y L;  4QQB X;  4B3M L;  3ULJ A;  1AE3 A;  2F52 A;  1Q1E A;  2CWA A;  3TEH B;  4DV6 L;  1XNQ L;  2VQF L;  3M4P A;  2NZH A;  3ERS X;  4DUY L;  2K5N A;  4LF9 Q;  3AEV A;  1PFS A;  3HOX H;  2IX1 A;  3EN2 A;  5IP7 G;  4GNX C;  1QUQ A;  1X3E A;  3RN5 A;  4BY1 H;  1XMQ L;  4OWW B;  4YHH L;  5LMN L;  2R92 G;  1K8A C;  4KHP Q;  1IBL Q;  4X66 L;  1OXS C;  5M3M G;  1VQ9 A;  1N33 L;  1EIY B;  4A3C G;  2PNH A;  3KJO A;  1E1O A;  1SMX A;  2KHJ A;  2F3I A;  2QGQ A;  2WAQ E;  2R7D A;  4AYB E;  3HKZ E;  3M9B A;  4KI0 A;  3CCR A;  3STB D;  3CCS A;  4DR5 Q;  1D8L A;  1EQQ A;  1KHI A;  2RHQ B;  3J81 c;  3CC2 A;  4B3S Q;  3GTQ H;  4R1J A;  2R7F A;  4ALP A;  3S1N H;  4A3D G;  5C4X G;  1X55 A;  4Y7N H;  2ZJQ A;  4LFC Q;  1UE6 A;  1VQ4 A;  3RLO A;  1LM0 A;  5FJ8 H;  4JBM A;  5DLQ E;  1JT8 A;  1N34 L;  2YYZ A;  3PIP A;  1ASY A;  4WJ4 A;  1NY4 A;  3TRE A;  2V1C C;  1VQN A;  5GAD C;  4Y52 H;  3KJP A;  2HHH L;  3M3Y H;  2YTX A;  3GDE A;  1K3R A;  5IP9 H;  1QUQ B;  3HOU H;  4DPG A;  4OWX B;  1VQ8 A;  5EAY A;  4X64 Q;  2AHO B;  1SFO H;  4BBR G;  3D31 A;  4MTN A;  3D0F A;  5J3B A;  4DV5 L;  3UDG A;  4DR4 L;  4ME3 A;  2VY3 A;  4YCU A;  2HQL A;  3CD6 A;  5M5W H;  2JA6 G;  3PV0 A;  1XPU A;  1U0L A;  4X65 L;  1I50 H;  4P72 A;  2JA8 G;  1Q86 C;  1WOC A;  1N36 L;  5E7N A;  1NBW A;  2D62 A;  2MO0 A;  2VL6 A;  1UE7 A;  1Q46 A;  5FLX c;  3GTG H;  1J6Q A;  3FKI G;  4NB3 A;  4LF7 Q;  3J80 c;  1TWG H;  1PH5 A;  4A3E G;  1KRS A;  3JC6 6;  1V9P A;  4GOP A;  2JEA I;  1VS0 A;  3J7A 5;  5GAH C;  1Y1W G;  3S15 H;  3AFQ A;  3KDF A;  3HKS A;  2I5M X;  1YJW A;  4DV1 Q;  1GO3 E;  4R4C A;  2AWO A;  5IP7 H;  4B3S L;  5C44 G;  4LF8 Q;  3KF6 B;  1X9N A;  2MFI A;  4C2M H;  4IOC A;  1WI5 A;  2R92 H;  5JEA G;  1HZB A;  2R93 G;  2L15 A;  4LFC L;  4DK3 C;  4DAY B;  4HIO A;  2A8V A;  3CCQ A;  1SRU A;  5IYD G;  1G51 A;  1YBY A;  4A3I G;  1M1K C;  2ZTE A;  3STB C;  2CCZ A;  2YV5 A;  1L0W A;  2R6G A;  4A3J G;  1VQL A;  4A3D H;  3RLF A;  4C3H H;  3G71 A;  2VUM G;  3T1Y Q;  1VQE A;  1A0I A;  3F2D A;  4B3R L;  4PZ6 A;  3PF5 A;  3S2H H;  5C0X J;  4HJ7 A;  2E2I H;  1X6O A;  3HFZ B;  4GOP B;  2AKW B;  3UE0 A;  3UDI A;  3S17 H;  4DV6 Q;  3SGI A;  1NMF A;  4DR3 Q;  1IBK Q;  3I4N G;  2VQF Q;  4DUY Q;  1AH9 A;  3RNU A;  3KDF B;  4GLA C;  1S72 A;  2H5X A;  3PUZ A;  2UU9 L;  1S40 A;  4UP8 A;  1OXX K;  5IT9 c;  5JJL A;  4HIM A;  4DR1 L;  3S1R H;  1XMQ Q;  1VQG A;  4YHH Q;  2ZM6 Q;  3DM3 A;  2BA1 A;  4QJF A;  1CKO A;  4RMF A;  5IYB G;  3I7F A;  4HJ8 A;  4HJ9 A;  1HR0 Q;  4LF5 L;  2JK8 A;  2E5L L;  4IPD A;  1N33 Q;  1XNR L;  1GVP A;  2K4K A;  4GN4 B;  4IFD J;  2JA7 H;  3KF8 B;  2ID0 A;  3BZK A;  2OCE A;  4KHZ A;  4RG1 A;  1VQD A;  2LXJ A;  4IJH A;  2JA8 H;  3CCJ A;  1B8A A;  1K9M C;  1W2B A;  4LFB L;  3K0X A;  3PO3 H;  4XIG S;  4A3M G;  4L5T A;  1HZC A;  1GKH A;  2N78 A;  4DV1 L;  1TWC H;  2CWP A;  4A93 H;  3FKI H;  4L5S A;  4LF8 L;  5LMU L;  1N34 Q;  3TS2 A;  1CKN A;  1PYB A;  2HHH Q;  2HIV A;  2DGY A;  1LYL A;  4PZ7 A;  1P16 A;  2ES2 A;  2RHS B;  4BA2 I;  5LMN W;  1YIJ A;  3RZO H;  3ICE A;  1CUK A;  1MKH A;  5M3F H;  1EYG A;  1KL9 A;  4DR4 Q;  5C4J H;  4A3G H;  2R93 H;  1Q8K A;  3IRB A;  2Y0S G;  3HOV H;  4X65 Q;  1N32 Q;  1V1Q A;  5IYD H;  1Z9F A;  4A3I H;  2JA9 A;  2CFM A;  1N36 Q;  4DR3 L;  1IBK L;  1L2F A;  3K7A H;  4AIM A;  4A3J H;  2R7Z G;  3J81 i;  4JI4 L;  1KD1 C;  1Z47 A;  3NEL A;  3I55 A;  1TWA H;  4LUZ A;  5K36 G;  1DGS A;  4R4Q A;  2ZM6 L;  5M5Y H;  1HR0 L;  2MQH A;  1CKN B;  1E1T A;  3F1Z A;  4IPG A;  3FHW A;  4A75 A;  1U5K A;  4YWK A;  4NXN Q;  5IYC G;  2Z6K C;  3S16 H;  2A19 A;  5C3E H;  2Q2T A;  3VDY A;  4UPA A;  2N49 A;  1JMC A;  1SRO A;  3CQZ H;  3ULP A;  3W1G A;  2K52 A;  1UE5 A;  3PO2 G;  4H02 A;  4A3K G;  1UWV A;  1Y1V G;  1YHA A;  1YHQ A;  1FL0 A;  4O0A A;  4A3B G;  1I5F A;  1K8G A;  5M5X H;  1PV4 A;  3PUX A;  4A3F H;  1L1O C;  3WWV A;  4DKA C;  1FVI A;  5BR8 L;  3JAM c;  2LXK A;  1IZ6 A;  2KCM A;  4UY8 C;  3A0J A;  3I2Z A;  4GLX A;  4JI1 L;  4X6A H;  3CCE A;  2I5H A;  5IWA Q;  1EQR A;  3J7Z C;  3CCM A;  2N3S A;  3AFP A;  1QZG A;  1N8R C;  3HOZ G;  5H1S E;  3U4Z A;  3CME A;  2B63 G;  2KHI A;  3HOW H;  5C0X I;  1MJE A;  3AQQ A;  5ELN A;  1VQ7 A;  2RF4 A;  1HNZ L;  4GKJ L;  5HY6 A;  1WCM H;  4DK6 C;  2D0O A;  4HIK A;  4AQY L;  5AJ3 L;  3G6E A;  1JE5 A;  1OTC A;  2NVQ H;  2RCN A;  2JA5 G;  1PVO A;  4C3J H;  1D7Q A;  2UU9 Q;  1N32 L;  1YEZ A;  1E22 A;  1VQO A;  5ELO A;  2ZJP A;  2KEN A;  1E7Z A;  4DR1 Q;  4GN5 A;  1VQA A;  4WJ3 M;  4NXM Q;  3GO5 A;  1XTD A;  4LF5 Q;  1BBU A;  2E5L Q;  2BH2 A;  3H3V I;  2NZO A;  1X56 A;  1VQ5 A;  1XNR Q;  2WB1 G;  2E8G A;  2MO1 A;  2UUA Q;  3PIO A;  2UXB Q;  4PZ8 A;  1SLJ A;  2IT1 A;  3UE1 A;  3GTL H;  4DV0 L;  4LFB Q;  4NXN L;  3PCO B;  2IY5 B;  2UXC L;  4YY3 L;  1PH9 A;  3M7N A;  1CSP A;  1E24 A;  3CMA A;  2OWO A;  2R7Z H;  1OXT A;  1IBM Q;  1B7Y B;  1AE2 A;  5FLM G;  4GLV B;  2YTV A;  3E9H A;  1HZ9 A;  3U4V A;  5LMU Q;  3W1B A;  2PQA A;  2JEB I;  4JI3 L;  3S1Q H;  5M3M H;  3K80 C;  3PGZ A;  2JJQ A;  4A3C H;  4IJL A;  4IOA A;  4HJA A;  4BXX H;  3CC7 A;  2VZA A;  1G6P A;  2KBN A;  1SE8 A;  5GQO A;  2GVA A;  3E0E A;  2ALY B;  2Z0S A;  3F2C A;  2K5V A;  3RN2 A;  2CKZ B;  5C4X H;  3LGJ A;  5JJK A;  3UDF A;  2I0Q A;  4A3K H;  4PG3 A;  5IWA L;  2VQE L;  4OON A;  1Y1V H;  1HNW L;  1IL2 A;  4BBS G;  1S3O A;  1IXR A;  2GVB A;  1PA6 A;  4K0K L;  1BKB A;  3HOY G;  3RZD H;  1JB7 A;  4DV7 L;  1NJI C;  4UP9 A;  4A76 A;  1MIU A;  3K81 C;  1VQM A;  4JI4 Q;  4JV5 L;  4JI5 Q;  2GN5 A;  3I4M G;  3H0G G;  1QVG A;  3S24 A;  2WP8 J;  1A8V A;  4OXP A;  4BBR H;  1Q12 A;  3S2D H;  3GD7 A;  2PMZ E;  4JBJ A;  3HOX G;  4B3T Q;  5GAE C;  2JA5 H;  2JA6 H;  1HJP A;  2UUA L;  2OQK A;  4XTC S;  3GTO H;  2UXB L;  2N8N A;  1SN8 A;  5JEA J;  4BY1 G;  1HH2 P;  4GNX A;  2BA0 A;  2XGT A;  2EQS A;  1PHJ A;  3L2P A;  2DUD A;  1XPR A;  1C0A A;  3L0O A;  3NEN A;  1IBM L;  4GOP C;  1KQS A;  1I3Q H;  1WJJ A;  4A3E H;  5BR8 Q;  1XPO A;  4P71 A;  3K7U C;  4R4I A;  3MXN B;  1K73 C;  3PSI A;  3PUV A;  4JI1 Q;  4DR7 L;  2K75 A;  2EXD A;  1Y1W H;  1Q7Y C;  3CCU A;  2QEX A;  3NEM A;  3Q8D A;  5FJ8 G;  3H15 A;  1EFW A;  3RLN A;  5IE8 A;  3GTJ H;  4X62 Q;  1HR0 W;  4LFA L;  5C44 H;  5FLM H;  1HNZ Q;  2OTJ A;  1FGU A;  1MJC A;  4GKJ Q;  3BZC A;  3L7Z C;  2F4V Q;  2B29 A;  2WFW A;  5AJ3 Q;  4HID A;  1L1O A;  4AQY Q;  5IP9 G;  2NVX H;  3TRZ A;  4IO9 A;  1NMG A;  3CXC A;  2YTY A;  4LW1 A;  1EUJ A;  1TWF H;  2IX0 A;  4GNX B;  4KLK A;  3DLL A;  4GKK L;  3PUW A;  1LUZ A;  1VQP A;  1X65 A;  3GTP H;  4NPS A;  3CAM A;  3OW2 A;  4O2D A;  2A1A A;  4JI0 L;  2HT1 A;  1P8L A;  1EWI A;  4LWC A;  4BA1 I;  1XJV A;  2Q2U A;  2VUM H;  3S1M H;  4JI5 L;  3NBH B;  4PMW A;  4POF A;  4JBW A;  4JI8 L;  1XMO L;  4BBS H;  2IHF A;  4DV0 Q;  1EIF A;  4TVA B;  3I4N H;  2UXC Q;  3F8T A;  4YY3 Q;  4B3T L;  3KFU A;  2Y0S E;  2EIF A;  3ZJY C;  3JAM i;  2AMC B;  4J15 A;  3M4Q A;  4JOI C;  2WAQ G;  4AYB G;  1VCI A;  3HKZ G;  1PH1 A;  4DR2 Q;  2NVY H;  3I4M H;  3H0G H;  4LF4 Q;  1YNX A;  2CQO A;  1L1O B;  1GD7 A;  5IYB H;  1Q1B A;  1E3P A;  1EOV A;  3J81 j;  4R4T A;  4P75 A;  1YHB A;  1A62 A;  4YCV A;  2MNA A;  4DV4 L;  1YJ9 A;  4JI3 Q;  3W5O A;  4UP7 A;  3BJU A;  3U58 A;  1PH3 A;  4MNO A;  2HIX A;  1BBW A;  1Q81 C;  2VQE Q;  2UUB L;  4AH6 A;  4A3M H;  3K8A A;  2I5L X;  1IYJ B;  1HNW Q;  4X62 L;  1H95 A;  1SR3 A;  4OWT B;  1RIP A;  4JBK A;  1VQC A;  3ER0 A;  4R4O A;  1YJN A;  4OX9 Q;  1YI2 A;  4K0K Q;  2F4V L;  1LTL A;  3J80 i;  4DV7 Q;  4JYA L;  4LF6 L;  4P73 A;  3AYH B;  4QIW E;  3CP0 A;  3OTO Q;  2B3G A;  3CW2 C;  1HNX L;  4JV5 Q;  2OQ0 A;  1WFQ A;  3PUY A;  2ATW A;  1KAW A;  2UUC Q;  1QZH A;  3EBE A;  2JQO A;  4YWM A;  1KRT A;  1X3F A;  3A5Z B;  3RR5 A;  1GM5 A;  2BH8 A;  4YWL A;  3F2B A;  3A74 A;  4IFD I;  4JI7 Q;  3KYH C;  1R9T H;  2KCT A;  1WYD A;  4C3I H;  1Q82 C;  1VQ6 A;  1M90 C;  3G48 A;  2PI2 E;  3KF6 A;  4JCV E;  1YZ6 A;  1I94 L;  1A63 A;  1NE3 A;  1OXU A;  2AWN A;  4DV3 Q;  3T1H Q;  4A4I A;  2JA7 G;  4JI6 Q;  1CSQ A;  1O7I A;  4LUV A;  3I56 A;  1K83 H;  1TWH H;  3CC4 A;  4DR2 L;  2ZTC A;  3CCL A;  4DR6 Q;  2VW9 A;  4LF4 L;  5C0X G;  1VQK A;  4BY7 G;  1T9H A;  2Q2H A;  3PO3 G;  1PH2 A;  2C35 B;  4DR7 Q;  5IYC H;  2WB1 E;  4LUO A;  4LF9 L;  4A3L G;  2UXD Q;  1VQJ A;  4A93 G;  3U50 C;  5HGQ A;  1NTG A;  1J5E Q;  3G4S A;  3TQY A;  1YVC A;  4LFA Q;  3PO2 H;  4KHP L;  2XTI A;  2K14 A;  1KIX A;  1C7Y A;  2IHE A;  3GTM H;  1IBL L;  4POG A;  2VNU D;  2FXQ A;  2PI2 A;  1K0R A;  3UDX A;  4APV A;  4A3B H;  2LSS A;  4NXM L;  2D0P A;  1B70 B;  1W3S A;  4DR5 L;  3TS0 A;  4OX9 L;  4EQ5 A;  3ULL A;  4GKK Q;  4IFD G;  1FJG Q;  1Y14 B;  5M3F G;  1C9O A;  4JI0 Q;  4A3G G;  1JJ2 A;  1JJG A;  3OTO L;  1HZA A;  1PYS B;  4L5R C;  1PH8 A;  2NVT H;  3HOV G;  4BXX G;  1KXL A;  3HOZ H;  2UUC L;  1ASZ A;  4TQU S;  2NN6 I;  4JI8 Q;  1XMO Q;  2PQA B;  4DUZ Q;  4P74 A;  4DV2 Q;  4QGU A;  2B63 H;  2Q2I A;  3MEF A;  1UE1 A;  3E9I A;  4JI2 Q;  1VQH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...