3S2DH

Rna polymerase ii initiation complex with a 5-nt rna containing a 5br-u
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s2dH00
4JI6L 4L5QA 4DV1Q 4PZ8A 4QY7A 1D7QA 3UE1A 4K0KQ 2JEBI 5EAYA 2ZTCA 2ASBA 1LTLA 4JI6Q 2EXDA 4YWKA 3CMEA 1VQPA 1HR0L 1GM5A 3J81i 1IL2A 5JJIA 4R4CA 1UEBA 2N3SA 5J3BA 3GTPH 1CSPA 3S2DH 2BA1A 1VQ6A 1HR0Q 3K7AH 4DR5L 2K75A 4OO1G 3KDFB 1YJWA 1V9PA 3M7NA 1KD1C 1UE1A 1PFSA 3RLOA 4J15A 4NXNL 4LF4L 1IBML 3TRZA 4JI1L 3L2PA 1XTDA 1HZCA 3A0JA 5ELOA 1VQAA 4P74A 3H3VH 3KFUA 1KRTA 3RLFA 3H15A 2QEXA 4DV2L 4JI3L 3PIPA 2E5LL 4JI1Q 2ES2A 4IJHA 1IYJB 4LF6L 4QGUA 4A3KG 1SE8A 1YI2A 2UXBQ 1SR3A 3PUZA 2UXDL 3GTKH 1K8GA 4DV2Q 2E5LQ 4JI3Q 4LF9Q 3W1BA 4A3DG 4P75A 1C9OA 1XPOA 1KL9A 5IP7G 3KF8B 1YJNA 2NVYH 4IOCA 3AFQA 2EQSA 4DV5L 4BY7G 4BBRG 4A3CG 1E3PA 2VL6A 5FLMH 1XMQQ 3J81j 2HT1A 5M5WH 1IBLL 4C3JH 2ALYB 1GO3E 2ZM6L 4DV6L 4A3EG 3M3YH 3I4NH 4UY8C 1HJPA 4B3SL 1IBLQ 3JAMc 2CCZA 1FVIA 1X56A 2H5XA 4X65Q 5C44G 2ZM6Q 3CMAA 1Y1VG 2VUMH 3I4MG 1PH5A 1WOCA 4DV6Q 4MZ9A 4B3SQ 1BVSA 3MXNB 5LMNQ 1WYDA 5C3EG 3OYYA 3FKIG 2XTIA 2LXKA 3G4SA 2IHEA 4DV7Q 3K80C 2HHHL 4P71A 3CCEA 3KLWA 3BU2A 4KI0A 3I4OA 4QJFA 2VQFL 1KIXA 4JI4Q 4LF5Q 2AHOB 2K5NA 2HHHQ 4A3FH 5GROA 1O7IA 1XNRL 5K36G 3HKSA 3U50C 2UXCL 1YZ6A 3B6YA 1S72A 1QZHA 1I50H 1UE5A 4P73A 4GOPA 2EIFA 3HOVH 4GNXA 3CC4A 4BXXG 4H02A 1B70B 2D0OA 4GLVB 1Y14B 4GKJL 3K8AA 1XNQQ 1XJVA 2CKZB 1ASYA 2OWOA 2UXCQ 3M4PA 2Z6KA 2VNUD 2Q2TA 1EOVA 4LUVA 3CCUA 3HOZG 4GKJQ 3RR5A 3HKZG 2PI2E 3A74A 2Z0SA 3CCQA 1NMFA 3TS0A 1HR0W 4JI2L 1GD7A 1HNZL 1XPUA 3H3VI 3PO2G 3RLNA 3ULJA 1C0AA 4Y52H 5IE8A 1YNXA 4DR7L 4DKAC 1EFWA 3FHWA 4LUZA 4JI2Q 1SN8A 1SFOH 1NMGA 1HNZQ 4JI5L 2VS1A 1H95A 3CCLA 4HJ5A 4JV5L 1Q7YC 4BY1G 1OXUA 3S17H 4A3LG 3CCJA 3HOXH 3UDXA 2QA4A 1PH8A 4JV5Q 4QQBX 3F8TA 2I0QA 3T1HQ 1VQLA 4YCVA 1YHAA 5C4JH 1K8AC 3S16H 4B3MQ 1X6OA 2A1AA 2JJQA 4X62L 2DGYA 3KF6B 1N34L 1N36L 1X3GA 3E9HA 3DLLA 4AYBE 1PVOA 4GS3A 1VQGA 1EUJA 3STBD 4ME3A 1EYGA 2R92G 2AWOA 1LUZA 3VDYA 2PI2A 2GN5A 2KBNA 1PYBA 2RF4A 1TWAH 3KJPA 3CXCA 3UDGA 4HJAA 1YJ9A 3K7UC 3AEVA 3J7A5 4O0AA 5IYBH 5BR8L 2LSSA 2NZOA 5IYDH 5M3MH 3U4ZA 2CWPA 1XMOL 1MJEA 2IT1A 4A93H 2B63H 3M4OH 1XPRA 1JMCA 3PO3G 4DK6C 2R7ZH 2R7FA 3CCSA 2I5HA 2XGTA 3H0GH 4A3GG 4A3BG 1XMOQ 3ULLA 5LMNW 3HOWG 3SGIA 1X9NA 4B3TL 4GLXA 1A0IA 4A3IG 4JI7L 4DR1L 3ZJYC 3RZDH 3S24A 1OXXK 3TREA 4AIMA 4AQYL 2OQ0A 1K3RA 2WB1G 1VQCA 5GADC 3CC2A 5GQOA 4B3TQ 4DR1Q 4A3MG 4JI7Q 3RNUA 2B29A 3NEMA 4A76A 4AQYQ 1N8RC 3S14H 1CKNB 4LFCL 1TWHH 2V1CC 3G6EA 1IBKL 4IFDI 2KCMA 4IPHA 3MEFA 4IPDA 1DGSA 3S15H 3AFPA 4LFCQ 1I6HH 3M9BA 1IBKQ 4TQUS 1JJCB 1NE3A 3IRBA 1K0RA 4UP8A 4OWTB 4GOPB 2Y0SG 2MQHA 3RN5A 4GNXB 2OCEA 3TEHB 4JOIC 3CW2C 1PHJA 4BA2I 1V1QA 1HZ9A 1X65A 3PF5A 4AH6A 2JA6H 1YIJA 1PH2A 1HH2P 3A5ZB 2F52A 2N49A 3CP0A 5FJ8G 3NELA 4DR5Q 5C0XG 4KHZA 1IXRA 1MJCA 2Q2UA 2WAQG 5HY6A 4L5SA 3U58A 2UUCL 4HJ9A 5JJLA 3PUWA 2I5MX 4NXNQ 4X66L 4LF4Q 1A63A 4MTNA 1IBMQ 1VQKA 3HOUG 1SMXA 5AJ3L 1EQQA 2HQLA 4GN5A 3I56A 1I5FA 2UUCQ 3G48A 3EIVA 3ERSX 2KCTA 5IWAL 4X66Q 1KC8C 3RZOH 1D8LA 4OXPA 5AJ3Q 4LF6Q 2D62A 3S1RH 1MIUA 1WI5A 2ATWA 2UXDQ 2LXJA 4R4QA 2R7DA 3D31A 2E8GA 3T1YL 4LUOA 3CCMA 2YV5A 1Y1WG 3E0EA 1KQSA 4GN4B 4APVA 3RN2A 2MFIA 2PQAB 1PH4A 1EIYB 4HIKA 1Z47A 4DV5Q 1C7YA 1UE6A 1K73C 1M1KC 1VQNA 2JA9A 5C0XJ 2OTJA 2BH2A 4JBMA 2WP8J 2GVBA 1CKOA 1YVCA 4A3DH 1VCIA 3PUXA 4YHHL 4BBSG 4JYAL 1QUQA 4LF7L 4GKKL 1HNXL 1P16A 2HIXA 4AYBG 3FP9A 3JC66 4P72A 4BBRH 5IYCH 3M85A 4BY7H 4A3CH 2PNHA 4JYAQ 2UUAL 4L5RC 1K83H 3PUVA 1HNXQ 4YWMA 1W2BA 1YBYA 4DR6L 3CF5A 4A3EH 2UUAQ 1I3QH 3CAMA 2JA5G 3PF4A 2VQFQ 5JEAG 4LWCA 3I4MH 4A3JG 1Y1VH 1QVCA 3BZCA 2AKWB 3DM3A 1XNRQ 4C2MH 2CQOA 4DUYL 4DK3C 5C3EH 2JA8G 3PIOA 5JJKA 4YCUA 4X6AH 3UDFA 1AH9A 4DUYQ 3TQYA 1TXYA 1K9MC 3U4VA 3J81c 2CWAA 1TWGH 3I7FA 5IP9G 3BJUA 5C4XH 4DR4L 1NBWA 4IFDG 1X55A 4ALPA 3E9IA 3CCRA 5LMUL 4BXXH 4OO1I 2K5VA 4DR7Q 1T9HA 4DR4Q 1S3OA 3PSIA 2MO0A 3AQQA 5JEAJ 4C3HH 1L0WA 4JI0L 4JI5Q 4LF5L 4O2DA 4YY3L 5GAHC 5LMUQ 1VQOA 3BZKA 3HOZH 3KDFA 3W5OA 1MKHA 1N9WA 3W1GA 4NPSA 4A4IA 2JA7H 1S40A 3PO2H 4JI0Q 4YY3Q 1V43A 1JT8A 2E2JH 3GO5A 4TVAB 4LFBL 1PH7A 2A8VA 1SLJA 1X3EA 1WCMG 2NN6I 2YTYA 4MNOA 3GTMH 2YU9H 4X62Q 1N36Q 1FGUA 1U0LA 1N34Q 1AE3A 4JG2A 4RMFA 4WJ4A 2KHJA 2E2IH 4BY1H 3D0FA 2NVTH 4LFBQ 4IFDJ 4A3LH 1PH1A 3UE0A 5M5XH 5IY0A 4DAMA 4NB3A 5BR8Q 3Q8DA 2ZTDA 1N32L 2AWNA 5DLQE 2B63G 3K81C 1VS0A 3KOJA 3GD7A 2R7ZG 3S1MH 3NBHB 3PUYA 5M3FG 3H0GG 2FXQA 4POGA 2R92H 3A5UA 2VY3A 3ICEA 4EX5A 4XIGS 2VZAA 1JE5A 1CUKA 4X64L 1OTCA 3K0XA 3PV0A 2R93G 1L1OA 4PZ7A 1OXSC 4IJLA 2MO1A 4X64Q 2UUBL 1N33L 2N78A 3JAMi 1J5EL 4YWLA 3PO3H 3OW2A 1EIFA 3PCOB 1W3SA 1JJ2A 4A3GH 1YITA 4A3BH 2UUBQ 1N33Q 4DV3L 2K14A 4GLAC 4DV4L 2K52A 1NJIC 4EQ5A 3HOWH 4PG3A 3HOYH 1A62A 3HFZB 2VW9A 4A3IH 1RIPA 4DUZL 2VQEL 1VQFA 1X3FA 4DV3Q 1KXLA 2F4VL 2IY5B 4A3MH 5HGQA 1IZ6A 2L15A 2VQEQ 3HKZE 2QGQA 1TWFH 3LGJA 4DV1L 2Q2HA 3STBC 4OWWB 1PYSB 3J7ZC 1QVFA 4HJ7A 1BBWA 1Z9FA 5GAGC 4UPAA 3CQZH 4JOIA 3KYHC 3L0OA 1OXVA 3I55A 1WJJA 2F3IA 1BKBA 1VQJA 2ID0A 1PV4A 3HOYG 2BH8A 2IX1A 1BBUA 1P8LA 4DR2L 1CSQA 3ER0A 2NZHA 3GTOH 3UDIA 3J80c 3S1NH 5IWAQ 4LFAL 3GDEA 5FJ8H 4DR2Q 2ZTEA 4XTCS 4PMWA 4BA1I 3CC7A 4UP7A 1YHQA 3T1YQ 5FLMG 4LFAQ 3HOUH 2UXBL 1EWIA 1E22A 1OXTA 2UU9L 4A3KH 3CPFA 3GTQH 2JK8A 2JE6I 1VQHA 3KF6A 4QL5A 2ZJPA 1U5KA 1VQ5A 4LF9L 3I4NG 2DUDA 1Q81C 1E24A 2UU9Q 4QIWE 4OWXB 5IP7H 3GTLH 2MNAA 2NN6G 2VUMG 4JI8L 1NTGA 1Y1WH 1XMQL 2KENA 4R4IA 4KHPL 4YHHQ 1VQMA 2RCNA 5IYCG 4LF7Q 2IX0A 4GKKQ 4JBJA 4JI8Q 3KJOA 3CCVA 1VQIA 3OTOL 3EN2A 1Q8KA 1M90C 1JB7A 1LM0A 4KHPQ 1JJGA 2WB1E 3ULPA 4X65L 1J6QA 5FLXc 1QVGA 5C44H 4LW1A 3OTOQ 4A3FG 2N8NA 2YYZA 4DR6Q 4B3RL 1L1OB 1WFQA 1YEZA 3NENA 1HZBA 4BBSH 4R1JA 2I5LX 5LMNL 4DV7L 3S1QH 3PGZA 1EQRA 2YTVA 4C3IH 4HJ8A 3FKIH 1I94L 2RHSB 4B3RQ 1VQDA 4OONA 3WWVA 1VQ9A 2A19A 2D0PA 3F1ZA 3I2ZA 1AE2A 3HOVG 1Q86C 4JI4L 1UWVA 4GOPC 4IOAA 4IPGA 4YCWA 2E2HH 1I94Q 1CKNA 4GNXC 2Y0SE 1SROA 3F2DA 1PA6A 2JA5H 1YHBA 1Q46A 1CKMA 2Z6KC 5ELNA 4A3JH 4FDBA 2K50A 4IPCA 5C4XG 1LYLA 1L2FA 1PH3A 4HIMA 1XNQL 1QZGA 1VQ7A 2HIVA 4JBWA 4A75A 4OX9L 2JA8H 1E1TA 1A8VA 2WAQE 4DNIA 1G6PA 2IHFA 5C0XI 5E7NA 1NY4A 4DR3L 2C35B 1Q82C 2PMZE 3GTGH 4OX9Q 2OTLA 2OQKA 3HOXG 4KLKA 5IP9H 1ASZA 1FJGL 2JA7G 4DR3Q 2NVXH 3M4QA 2Q2IA 4DAYB 1FJGQ 4R4TA 1R9TH 1VQBA 1KHIA 3AYHB 2KHIA 5H1SE 1E1OA 1UE7A 4UP9A 2GVAA 1Q1BA 5IYBG 3T1HL 4IO9A 1TWCH 1Q12A 5M5YH 5IYDG 4B3ML 2R6GA 4JCVE 4POFA 4RG1A 5M3MG 1E7ZA 4L5TA 5IT9c 1VQ4A 4A93G 3CD6A 3CPWA 1Q1EA 3J80i 2K4KA 4HIOA 1KAWA 2PQAA 1G51A 1N32Q 4DV0L 2JEAI 1B7YB 1SRUA 1WCMH 2YTXA 3F2BA 4WJ3M 2BA0A 4DV0Q 2K5HA 1QUQB 3S2HH 1HZAA 1PH9A 1HNWL 2CFMA 4JBKA 1PH6A 4LNQA 2JQOA 1FL0A 1GKHA 4R4OA 2ZJQA 4JC0A 1L1OC 1HNWQ 2ZJRA 1B8AA 3EBEA 1J5EQ 3GTJH 4HIDA 1X54A 2B3GA 1VQEA 3F2CA 1VQ8A 5M3FH 4NXML 4GN3B 1RL2A 4LF8L 2WFWA 1GVPA 4DV4Q 1KRSA 2R93H 3TS2A 2NVQH 2RHQB 4NXMQ 4LF8Q 1G291 3L7ZC 3G71A 4DUZQ 2AMCB 5GAEC 4Y7NH 2F4VQ 4PZ6A 4K0KL 2JA6G 4DPGA
chains in the Genus database with same CATH superfamily
4JI6L 2AQ3B 1TWHB 2FJ2A 1Q90A 2HQEA 4PZ8A 3UE1A 1MHWC 4K0KQ 2LFNA 1B3QA 2ASBA 1HTLD 2ZTCA 3VYRA 2B2YC 1I6HB 1HR0L 3DEOA 4R4CA 3T16A 2XNAC 4GZYC 3GTPH 1XWEA 4J1MA 1DJRD 4OO1G 2HUGA 3NTKA 4RGMA 1PTOC 4LF4L 3PQIA 3C3LA 1XTDA 2F0HA 4P74A 5C3WA 2EYOA 4KMUC 3KFUA 3O13A 2QEXA 1F77A 2I07B 2ES2A 4JI1Q 1IYJB 2CVRA 2UXBQ 3TDQA 1RKNA 2UXDL 4DV2Q 2E5LQ 4LF9Q 3W1BA 4A3DG 3OW7A 3EJIA 2NVYH 1II3A 4DV5L 4A3CG 1E3PA 2VL6A 5FLMH 3J81j 5M5WH 3K59A 2G5DA 3DWAA 4RHSA 1Y8OB 1GHKA 4UY8C 1HJPA 4B3SL 3I90A 1F9PA 3JAMc 2CCZA 2H5XA 3CMAA 1TS3A 1Y1VG 3BVGA 4A3DB 2NUCA 1BVSA 4LF5L 5C3EG 3KBGA 2XTIA 3G4SA 4OIKA 3BU2A 4JI4Q 1WTRA 5A2QE 3FRPB 3BS1A 1DCZA 1O7IA 1I3QB 5K36G 2A68C 3U50C 1PLFA 2PO4A 1I50H 1Y1VB 2SEBD 4IUNA 5DM73 4FF3A 1ENAA 2BDOA 1XNQQ 2EYLA 1XJVA 5C3EB 4V190 2UXCQ 1C48A 1SJED 5KIXA 3K5MA 4RKLA 2Q2TA 1EOVA 3HOZG 5K5PA 4GKJQ 3RR5A 3A74A 4DK0A 2Z0SA 1HR0W 1NMFA 4KY7A 3I72A 5DAUA 3H3VI 3PO2G 3RLNA 2RKSA 4DR7L 5CV8A 3FHWA 4JI2Q 1JCKB 1SN8A 2KOLA 1AN8A 4HJ5A 1Q7YC 4BY1G 4EQPA 1EFID 3HOZB 1PH8A 2LKVA 3PO2B 4QUFA 3BDOA 3A56A 1LO5D 4KKTA 3MZ5A 4G7ZC 1X3GA 3E9HA 1EYGA 1MSHA 1QNKA 1XX8A 2R92G 4B08A 1LUZA 4XT3B 1PYBA 2NTTA 3TP6A 3AB9A 4HJAA 3K7UC 5IYBH 5BR8L 4BY1B 2NZOA 4CJ2C 1YNNC 5M3MH 1XMOL 1EY4A 3R2TA 1IL8A 4DK6C 3CCSA 2XGTA 1K8MA 4A3BG 5LMNW 4IN3A 3I91A 1S5ED 2R92B 3ZJYC 4FF1A 1RCVD 3H91A 2AQ1B 1CQFA 3RMHA 2OQ0A 3CC2A 1VQCA 2G9DA 4A3MG 2Q8IB 5L37A 3GP7A 2PW7A 4IFDI 4A3BB 4CDCC 4PMCA 1IBKQ 1TT2A 1O7ZA 1F9RA 4OWTB 4KV6A 2EYJA 2Y0SG 4UP8A 2ENBA 4LAAA 2HCCA 1DONA 3BG3A 4A3MB 1ZKOA 2B8GA 3CW2C 3RD4A 4F87A 1KNEA 1H9MA 1PH2A 2N49A 3CP0A 1SNPA 4DNTB 3NQTA 4L5SA 4X66L 4LF4Q 2LMCB 1SMXA 1VF7A 3CHBD 2F0UA 2Y0SB 3KK7A 4DAYA 2UUCQ 3K0YA 3G48A 3EIVA 3ERSX 2KCTA 2F0WA 3RZOH 5IT9L 4OXPA 4KJOA 1WI5A 3VA7A 2UXDQ 4R4QA 1KQSA 1F9QA 4GN4B 3RN2A 2PQAB 1MD2D 4HIKA 4DV5Q 1C7YA 1SE4A 3D4DA 1EWHA 1VQNA 2JA9A 5T1IA 2BH2A 4F7XA 4JBMA 4B9XA 3VA5A 1YVCA 4YHHL 1MSGA 3GTKB 3GTLB 2HIXA 3FP9A 1ESRA 2QEJC 4DF7A 4JYAQ 1SDFA 1HNXQ 1E2VA 3VR3A 1YBYA 2F0QA 4LWCA 4PQXA 2FHTA 1SAPA 3A8JE 4OEMB 5EBCA 2EYHA 5KYLA 4DUYL 3U9SA 4OL7A 5JJKA 1EY7A 3UDFA 2XSCA 3HP3A 2OEOA 1HRJA 1RODA 3CRKC 5IGGA 1Q8IA 5IP9G 5FLXE 2XIWA 5C4XH 4DR4L 2M00A 4FO2A 2EDGA 3CCRA 4OO1I 4BXXH 4XQNA 4DR7Q 3DM1A 3AQQA 5JEAJ 1L0WA 1VQOA 3I73A 3VR6A 3W5OA 1MKHA 1N9WA 1RTOA 1MI2A 3TMEA 3GO5A 2SOBA 4TVAB 1SLJA 1FYCA 1X3EA 4NMZA 5E4WC 2YTYA 3GTMH 4KD3A 1AE3A 3I3CA 2L4NA 4RMFA 1R9TB 4WJ4A 2NVTH 2H1EA 3UE0A 5JPNC 5IY0A 1PRTB 4DAMA 4DN4M 5M5YB 5BR8Q 3Q8DA 3K5LA 1QOHA 3KOJA 3GV3A 1F9SA 3K81C 1VMCA 3PUYA 4FNFA 3H0GG 2FXQA 2PYKA 3ICEA 4HAEA 4FF2A 4EX5A 3OMCA 1JE5A 1CUKA 2MGSA 4DU9A 3IKJA 3PV0A 1PFBA 1BDOA 4WRDA 3Q6SA 1N33L 3SVMA 1G6ZA 2JSOA 4IUUA 3OW2A 1EIFA 1W3SA 4A3GH 1YITA 3M4OB 5EKLA 3HOWH 4EQ5A 1KDBA 2WINB 1A62A 3H0GB 1ILPA 1RIPA 1NCVA 2IY5B 1GUWA 3LGJA 4Y7NB 5EPLA 4FVMA 3H6MA 1ONLA 1BBWA 3MHBA 5GAGC 4I7AA 4UPAA 3CQZH 3D8GA 4C56C 3L0OA 1OXVA 1WJJA 1BQQT 4WJWA 3QJYA 1Z6HA 1P8LA 1CSQA 3GTOH 3OIQA 3J80c 3TP5A 4L6TB 3GDEA 5FJ8H 2KEDA 4PMWA 2KCCA 4BA1I 3EROA 5FLMG 3LWEA 4LFAQ 1XTCD 3FPUB 3HOUH 4F8MA 4HMIA 2RQXA 3R93A 1VQHA 4QL5A 4HN7A 4ABNA 2UU9Q 2KA7A 1PZJD 2QILA 1TU2B 1NTGA 2K32A 2KENA 3FEWX 4R4IA 4YHHQ 1VQMA 2MJ8A 2NVYB 1G2TA 3DEPA 4JI8Q 5M5WB 1LM0A 3ULPA 1EY9A 3KLSX 1PFMA 4XQQA 4B3RL 1NSNS 5JJZA 4I65A 4R1JA 4DV7L 3R2IA 1EQRA 1QJOA 4C3IH 3HS0C 5FO7B 4CDFC 1LT4D 2A19A 3MFGA 1Q86C 2E2HH 1I94Q 1CKNA 4GNXC 2Y0SE 2JA5H 3MTSA 5JEAH 4QMGA 1JOKA 3JAME 2K50A 3W2DA 1LTID 3QOLA 2K28A 1LYLA 4FXKC 2HIVA 1S5FD 1E1TA 3OMGA 1VMPA 3G7LA 4DR3L 2C35B 4OX9Q 2OTLA 2N55A 1EL0A 2EJFC 2OQKA 2PQEA 1FJGL 2JA7G 2V4DA 1EIHA 2K05A 3AMUA 4DAYB 3BYTB 5HURA 1KHIA 3C46A 2IW3A 5IYBG 4POFA 5IT9c 5M3MG 2JA7B 2QKIC 1RF2D 4ZLTF 5F2DA 1G51A 1B9NA 2JEAI 2A69D 1WCMH 2ICEC 5KNBA 3OWEB 1L0YB 4G7OC 1KNAA 1LTTD 2F0GA 1HZAA 1HNWL 2JXMB 4WORA 1GKHA 1F2ZA 4R4OA 5M3MB 2F0JA 2B3GA 5CC4A 4CJ1B 1M4VA 2WFWA 3S9WA 1EQVA 2TSSA 4G7HC 1EZ6A 4RGOS 2NVQH 3E6ZX 2RHQB 1H9JA 3MXGA 4R8IA 4LF8Q 1B50A 4K5VA 1D5XC 5GAEC 2HCIA 4PZ6A 2MHVA 3J81L 4K0KL 3HEJA 4QY7A 2DJGC 5ELDA 1K0SA 2JEBI 2XN9C 5EAYA 1LTLA 4YWKA 3J81i 5JJIA 1UEBA 1U9RA 5J3BA 5M9OA 1R4QB 1LTAD 3K7AH 2DN8A 1HPCA 1SNCA 3AU7A 3RLOA 4J15A 1DD2A 1RTNA 3TRZA 4JI1L 3L2PA 1X3PA 1KRTA 4L5RC 4DV2L 2E5LL 4IUPA 1SE8A 2KQ3A 2O5IC 1SR3A 3GTKH 4JI3Q 3RZOB 3DHQA 1XPOA 5IP7G 1EYAA 3AFQA 2EQSA 5DM63 2ALYB 1D5ZC 1GO3E 1I6VC 3FMCA 2ZT9C 1ZEQX 1AZQA 4F88A 1KABA 1NUCA 1FVIA 1X56A 5C44G 2ZM6Q 2NN6H 2VUMH 1PH5A 4DV6Q 3T56B 4MZ9A 4MHEA 4U673 3L3OC 4DV7Q 1WYDA 3CKIB 3NK9A 4N8X1 4H0LC 3CCEA 4KI0A 5LHY1 5ELFA 1NR4A 4QJFA 4XDXA 2HHHQ 2VXWA 4A3FH 5GROA 1FGBD 2UXCL 1YZ6A 5C44B 1UE5A 4P73A 2EIFA 3W3AA 4ZRZA 3CC4A 4BXXG 1B70B 1Y14B 4GKJL 1ASYA 2A5HA 2Z6KA 3CCUA 2Q8TA 3NUCA 5EPKA 4JI2L 2Z8LA 4Y52H 1D1KA 2EY6A 1YNXA 1EFWA 3P75A 1SFOH 1NMGA 1PTOH 1AP0A 1HNZQ 4HSVA 1H95A 3CCLA 2A6HD 2RA4A 3VYUA 1OXUA 4CHTB 3S17H 2EVBA 3F2UA 3CCJA 3UDXA 1A2TA 2K6AA 3HGBA 1VQLA 4OIJA 4DFAA 2A1AA 3NBIA 2HDMA 1V8QA 3DLLA 2Z4HA 4GS3A 2AWOA 1NNXA 1QG7A 3AEVA 3KJPA 1CM9A 3UDGA 4O0AA 5EBDA 2D9UA 2NVTB 3U9OA 2RSNA 5IYDH 3U4ZA 1MJEA 4PMBA 2O4XA 2IT1A 3E5SA 3OOCA 3M4OH 1XPRA 1JMCA 3H0GH 4A3GG 4IQZA 5I2XA 3HOWG 1BCPB 2CH4W 1X9NA 1A0IA 2F0PA 3S24A 4CKCA 2RVLA 2PZUA 4NP5A 3TREA 5I4DA 4CDEC 2QF7A 4H7BA 4DR1Q 1GUOA 4A76A 4AQYQ 1CKNB 2F3WA 2V1CC 4KKSA 1IBKL 1XXGA 4A3GB 1EEFD 2B2UC 4IPHA 1B4OA 3HOWB 4LFCQ 3VYTA 1DOMA 1RDPD 1A3TA 1Y69U 3SE0A 4GNXB 3TEHB 2B39A 4JOIC 1F2LA 5LL6X 4DK1A 4BA2I 1V1QA 1BOSA 1X65A 1HH2P 5I6YA 2F52A 5FJ8G 1I4QA 4EGVA 5JJLA 3U58A 2UUCL 4HJ9A 3CQZB 3HOUG 1FR3A 5D3IB 3MA2B 5IWAL 1D8LA 1MIUA 1PZKD 1ZYRD 3GTOB 1J8IA 2R7DA 3HRZC 2E8GA 3CCMA 3E0EA 4ILWA 5J39A 1ENFA 1PH4A 1EIYB 2EE1A 1Z47A 1UE6A 1K73C 3HOUB 5C0XJ 4C3JG 2OTJA 3NTIA 3VR5A 1SMYD 1Z7TA 4JYAL 3J80E 1QUQA 3Q0AA 1O7LA 1SYGA 4C3IG 1P16A 1HNXL 4AYBG 4BY7H 4BBRH 1HA6A 1LT3D 2PNHA 4O42A 3SK6A 2IJ0A 5D14A 4YWMA 1W2BA 3CF5A 4A3EH 2UUAQ 3CAMA 4C3JB 3QO2A 2JA5G 3PF4A 5JEAG 3A54A 4FXDA 1R4PB 4C3IB 4AYBB 5FO9B 2WV6D 3WDNA 3TQYA 2F0OA 2E2HB 3J81c 1SYCA 1TWGH 1GUSA 4WFN3 3GQBA 4Q5VA 2JA5B 1S5DD 1X55A 1JQYD 3E9IA 4M1UB 2K5VA 4CBVA 4C3HH 1LTRD 4O2DA 3V2TA 3J7YW 3BZKA 1AFPA 2JA7H 4NPSA 3T51B 4ME5A 4JI0Q 4YY3Q 2AQ2B 1JT8A 3H94A 4ID6A 3C1EA 5DEHA 1WCMG 3VYSA 2YU9H 2AUKA 1U0LA 2PZWA 2ICIA 3D0FA 4IFDJ 1UEAB 2NBFA 1JC7A 3WOEA 5M5XH 1Y8PB 4NB3A 5A2QL 5DLQE 2B63G 4POGA 1WCMB 3H09A 3A55A 1QCBD 1B2TA 1K8OA 1LLRD 4IJLA 4X64Q 2N78A 4YWLA 3MXNA 3PO3H 1JJ2A 2A6HC 2F03A 3N6RA 4DV4L 2B63B 1NJIC 4H44C 3HFZB 1VQFA 3UI2A 4DV3Q 4K5WA 2NVQB 4J6HA 1IZ6A 2VQEQ 3HZXA 1I4RA 1HXYD 5IGFA 1TWFH 4OWWB 3NTHA 3J7ZC 5CV7A 1I4HA 3WOFA 3I55A 1BKBA 1U4PA 2CHBD 5EGTA 2RDHA 2IX1A 1BBUA 3UDIA 3K7AB 5IGBA 5IWAQ 3K58A 3S1NH 2B2WC 4LFAL 4HTHA 1CT1D 3CRLC 3CU7A 2EYPA 4XTCS 5C0XH 3C2PA 1PXUA 3CC7A 1KLUD 3LWUA 5BN5A 1YHQA 5C5LA 1OXTA 3PIP3 2UU9L 2EY1A 1JE4A 1VQ5A 3KF6A 1EWCA 4K14A 1E24A 5IP7H 1STGA 2NN6G 2VUMG 4JI8L 1Y1WH 1XMQL 4IURA 5IYCG 2ZXRA 4JBJA 1Q8KA 1JB7A 3N52A 4IUVA 1JJGA 4RWSC 2Z9HA 5C44H 4RH6A 4A3FG 3OTOQ 2YYZA 1L1OB 1WFQA 3NENA 2A6ED 2I5LX 3SDZA 2YTVA 2VUMB 5DNFA 2B2TC 1I94L 1VQ9A 3WWVA 1K28A 3F1ZA 2G9HD 2EZVA 4GOPC 3SXHA 1SROA 1ZYRC 3OPOA 1EU3A 4OGQC 5ELNA 5T1GA 4A3FB 1DZ1A 1L2FA 2JA8H 3I8ZA 4OX9L 1SNDA 1V1PA 3PIO3 2EOTA 2K5DA 2IHFA 1D2BA 1SMYC 3DWPA 4KHVA 1CI3M 3QG1A 2NVXH 4IFDH 1KTKA 2F0VA 1SFOB 1PTOB 2XVSA 3BVMA 1J9OA 1VF5C 1IYUA 4FF4A 1X32A 1SE2A 3H3VC 1TWCH 3S17B 5IYDG 2R6GA 2H4OA 2D2CC 2NB0A 3CD6A 2XWBB 1Q3LA 1SRUA 3F2BA 2KVMA 4WJ3M 2K5HA 1QUQB 3KBXA 3S2HH 4FYDA 1EU4A 4JBKA 1FL0A 2ZJQA 1PRTF 5FLXL 4K5XA 3GTJH 1X54A 1VQ8A 3F2CA 5M3FH 1LT5D 4LF8L 2F0NA 1GVPA 2A73B 4JPBW 4DV4Q 2R93H 1A3UA 4NXMQ 3L7ZC 5HGTA 3G71A 4KTAA 3BYYB 3K5OA 4QIWB 3RUZA 4L5QA 2J4XA 1D7QA 2RDFA 3URYA 1HFNA 2EXDA 4HMJA 1GM5A 5CV9A 4ZK9B 3NHHA 3Q24A 1CSPA 3S2DH 2B2VC 3R8BA 1EY6A 2K75A 2OT2A 1YJWA 1V9PA 3M7NA 1TY2A 1TQOA 5ELEA 2L12A 3IFDA 1IKMA 2BE5D 1H9KA 1HZCA 3A0JA 3RLFA 4HSPA 4JI3L 3PIPA 4QGUA 4A3KG 1YI2A 4DA2A 3PUZA 1LTBD 1SNMA 2F0EA 1KL9A 1YJNA 2PW5A 4IOCA 4BY7G 4BBRG 3V96A 1XMQQ 4DGZA 1O78A 1SYDA 4C3JH 4KD4A 1NAPA 2F4IA 2KJXA 2ZM6L 4DAVA 4DV6L 4A3EG 4O1NA 4A3KB 3I4NH 2GA4B 1IBLQ 5FKAC 4Q0FA 3MXNB 3FKIG 2LXKA 4BY7B 4BBRB 2HHHL 4P71A 5KRUA 2VQFL 1KIXA 2K5NA 4A3EB 2KEEA 2NZ1D 3B6YA 1S72A 1EYDA 4KKUA 4GNXA 4H02A 4GLVB 2FMCA 5TSSA 4CJ0B 3FKIB 4C3HG 3M4PA 1LTGD 2VNUD 2EYFA 5G3LF 3TS0A 3HKZG 3CCQA 1HNZL 1STHA 1XPUA 1O80A 1TWGB 4R8NA 4MIUA 4DKAC 3SR1A 1TS2A 5EQ0A 4JI5L 1CZGA 5CBEE 4C3HB 1HHVA 4RGNA 3HOXH 4QQBX 2A6EC 4JV5Q 3F8TA 3HKZB 2I0QA 1B53A 1YHAA 4YCVA 1K8AC 3S16H 1X6OA 5D65A 1W6KA 2JJQA 2O5JC 4X62L 2DGYA 3KF6B 1DOKA 1EUJA 4ZQ3A 3VDYA 2PI2A 4QUCA 2GN5A 3LNNA 1YJ9A 1TWAH 1EIGA 2YU9B 3J7A5 5CR3A 4C1NK 1SJHD 1JOOA 3M7GA 5M5XB 2CWPA 2IWHA 2B63H 4CGYB 3PO3G 2ZXOA 2RCFA 2R7FA 2I5HA 1TR5A 1JB3A 3ULLA 4UHVA 3JAML 1JICA 1BBXC 1STBA 4DR1L 3RZDH 4ZUJA 4JVZA 4CKBA 3NWSA 1QB5D 4RCNA 2L11A 4AIMA 4AQYL 3NWTA 1HUNA 1SYEA 2WB1G 4B3TQ 3TP7A 1BUVT 2RSOA 5GQOA 4JI7Q 1EY8A 3RNUA 2B29A 3NEMA 3EVQA 1PRTD 4LFCL 3G6EA 3PO3B 4PV1C 3SK4A 2KCMA 3S15H 3AFPA 1IKLA 2QW7A 4TQUS 1JJCB 3X3MA 1NE3A 5KEEA 4GOPB 2X6LA 2MQHA 3RN5A 2WB1B 2OCEA 1V1PB 4KN4C 1PHJA 2R3ZA 2Q8RE 2JA6H 1TWFB 4AH6A 2C5CA 1YIJA 2E74C 3NELA 3NP8A 4KHZA 5C0XG 1MJCA 2Q2UA 4ZUIA 5HY6A 1H9SA 4TRDA 1GUTA 1VQKA 1ICWA 4GN5A 1ESFA 1KC8C 2KCNA 3EQLC 2F3VA 5ELBA 5AJ3Q 2D62A 3S1RH 2LXJA 3D31A 2EYMA 1M8AA 3S1NB 1Y1WG 1I4XA 3KUPA 1G91A 2A68D 1T5EA 4APVA 1WD1A 2PMZB 3TSSA 5E1FA 2FFKB 1CKOA 1ML0D 2M9VA 4LF7L 5IYCH 3M85A 1Y1WB 4MN3A 2UUAL 2VB3X 2X6GA 1K83H 4PNYA 1BNZA 3HG9A 4DR6L 3IL8A 2VQFQ 4KJNA 3I4MH 1CHQD 3BZCA 2KECA 3P1HA 2BE5C 4C2MH 5E4XA 4DK3C 2JA8G 1QNUA 5ISRA 5KNDA 4YCUA 1AH9A 1A6XA 2QDBA 1TXYA 2WACA 3NQIA 2K5WA 3I7FA 2E2DC 4IFDG 4ALPA 1U4MA 5CV6A 2JA8B 4JI0L 4JI5Q 4YY3L 5LMUQ 1FD7D 5G3LD 3KDFA 3W1GA 1S40A 1V43A 2E2JH 3T53B 2CW0D 2XWJB 3T4AC 2NVXB 1PH7A 4G57A 3MAQA 4X62Q 1HTPA 1FGUA 2KHJA 4LFBQ 4A3LH 1GUGA 1SNOA 1PH1A 1TWCB 3KF8A 5I9PA 2ZTDA 1N32L 4TKOB 4LK1C 4ODGA 1FNVA 1KDCA 2P5ZX 1VS0A 3BZDB 1CFMA 3GD7A 2R7ZG 5M3FG 3S1MH 2VY3A 4H13C 2K04A 4X64L 1OTCA 3K0XA 4EQOA 1L1OA 2R93G 4PZ7A 4ZYSA 3SEBA 3S2HB 2MO1A 3MC0B 1J5EL 1PYWD 4QF4A 5JVH3 2UUBQ 1BR9A 4DV3L 2HDLA 2K14A 4GLAC 2K52A 3GTJB 3QOJA 2MUYA 2PNRC 4PG3A 5M3FB 2R7ZB 4A3IH 1JORA 4N9TA 4DUZL 2VQEL 3IAYA 1KXLA 2R93B 1BCPF 1A2UA 5HGQA 2KHSA 2A69C 3HKZE 4V0BA 2QGQA 2B2UA 4DV1L 2Q2HA 2B2YA 1PYSB 1WTHA 1QVFA 1EQTA 4HJ7A 2BDNA 2F0LA 2F0MA 5I2YA 3Q23A 1LACA 2EY5A 1K3BC 4JOIA 2Z6BA 1VQJA 4K8JA 1PV4A 2KUMA 4UAIA 2DNCA 2NZHA 3S2DB 5FO8B 1IYVA 4DR2Q 1S5BD 5EKKA 2MPMA 5CGKA 2CH4A 1GOZA 4A3KH 3SK5A 3CPFA 3GTQH 1PRTC 2JE6I 2ZJPA 1U5KA 3I4NG 1Q81C 2RBMA 3DUZA 4OWXB 2MNAA 4DNRB 1TS5A 4M8AA 5D3DA 1AEXA 3DXJC 4LF7Q 3OTOL 3IFTA 1GHJA 1M90C 3D4WA 4KHPQ 4J8QA 3C1FA 2WB1E 3MFYA 1T5XD 4B9WA 4X65L 1QE6A 4DR6Q 2N8NA 3I4NB 1YEZA 4BBSH 5LMNL 3S1QH 4HJ8A 3FKIH 1VQDA 1JR0D 2EY2A 1AE2A 1UWVA 1WVLA 4IOAA 1C8CA 1SNQA 2L9HA 3TBIB 1PFNA 3F2DA 2J0TD 1YHBA 4ZCKA 3OSOA 4A3JH 2J7ZA 4FDBA 2Z1CA 1EY0A 2OF1A 1O7YA 1PH3A 4HIMA 1ZXTA 1G8ZD 4A75A 4DAPA 1A8VA 3ERQA 4DNIA 1G6PA 5C0XI 5E7NA 1NY4A 1CA6A 1Q82C 3GTGH 2PMZE 3HOXG 4KLKA 1H9SB 1ASZA 2BOSA 3M4QA 5BN3A 1BXTA 4IZ8A 3MEHA 4K2KA 1CQVA 2JN4A 4IALA 3J80L 1VQBA 3AYHB 5H1SE 5C5MA 3T1HL 1Q1BA 2IX3A 3G6JB 5C6AA 2E76C 4B3ML 4L63B 4RG1A 1E7ZA 4L5TA 3HOXB 1W6JA 3ITPA 4NKLA 3CPWA 5E3FA 3J80i 2K4KA 3S16B 1KAWA 1N32Q 4KY5A 4XT1B 1TS4A 2A74C 2JYOA 5EJWA 1PMRA 4DV0Q 1TWAB 2CFMA 2F0IA 1PH6A 4LNQA 2E2IB 2JQOA 5IT9E 4JC0A 4ZKBB 3ONAB 2ZJRA 1J5EQ 1SYBA 1VQEA 4NXML 4EVOA 4GN3B 1RL2A 1PZID 3SK8A 2ZXPA 2E75C 3RZDB 3D4RA 4JW0A 4DUZQ 2AMCB 2CW0C 1CHPD 1I4PA 3J7AV 2D5DA 1Y8NB 2DJFC 2JA6G 4DPGA 4XQJA 2F0SA 4DV1Q 2L55A 4EQNA 1LABA 1STYA 4JI6Q 1SXTA 3S15B 3CMEA 1BCPD 1VQPA 3FVQA 1IL2A 2N3SA 3LX0A 4KN7C 2HD3A 2BA1A 2DY8A 1VQ6A 1HR0Q 4DR5L 3KDFB 1QILA 1KD1C 2JA6B 4OHJA 1A3VA 1UE1A 1PFSA 5EKIA 1MBYA 4NXNL 1IBML 1JOQA 5ELOA 1VQAA 3H3VH 3MXPA 3H15A 3HOYH 1XYIA 4IJHA 2B2WA 3A8IE 4LF6L 3VR2A 2SNMA 2IPKD 1K8GA 1JWSD 4IUQA 1RD9D 4P75A 1C9OA 3S1RB 3KF8B 4ULLA 1SSOA 2DNEA 4BS9A 2HT1A 4DXGA 1IBLL 3K57A 4QB4A 4DXFA 3M3YH 3NBHA 2PPBC 4X65Q 3I4MG 4HEDA 1WOCA 2BCOA 4B3SQ 4S3SA 1FNUA 5LMNQ 4X6AH 3OYYA 1ET6A 5CBAE 3EFXD 2IHEA 3K80C 5FK9C 3KLWA 4N9PA 1K83B 3I4OA 4LF5Q 5A35A 2AHOB 5KNCA 2B2TA 1XNRL 1IW7D 3HKSA 4X3KA 1QZHA 3I4MB 4GOPA 1F2YA 1OO9B 1EEID 3HOVH 4C2MB 1WTPA 2D0OA 3K8AA 2OWOA 2CKZB 2Z4IA 3BDCA 4LUVA 2QDLA 5C3XA 2PI2E 1GD7A 1C0AA 3VR4A 3ULJA 2AUJD 5IE8A 4LUZA 2F0DA 3M4YA 1CTMA 2VS1A 4KK7A 1SEBD 2K5QA 4U68A 1MGSA 4JV5L 5NUCA 3E0JA 4A3LG 2K01A 4TSSA 1UNSA 2QA4A 3T1HQ 5C4JH 4B3MQ 2E2JB 1F2MA 5I6WA 1N36L 1N34L 1PVOA 4AYBE 1VQGA 1HA5A 3STBD 4ME3A 5EPJA 1KDAA 2KBNA 2RF4A 3CXCA 1PTOF 2LSSA 1YNJD 1I4GA 5JOBA 1U4LA 5IOCA 1C4QA 3QIAA 4A93H 1GJXA 1TY0A 3I70A 4X3TA 3Q22A 2EPBA 2R7ZH 1XMOQ 1DXMA 2XRSD 3KLRA 3S1MB 4FP5D 3SGIA 4B3TL 4GLXA 4A3IG 4JI7L 1OXXK 2QCPX 5CORA 1K3RA 5GADC 3MWYW 4RAUC 2OXPA 1N8RC 2PCFB 2VB2X 3S14H 4K8IA 1STEA 1TWHH 2FMMA 1L0XB 2K33A 4X3SA 1GUNA 4NW2A 3MEFA 3P20A 4IPDA 1DGSA 2M2LA 3M9BA 1I6HH 1SBBB 3ND8A 4A3IB 2F0TA 3IRBA 1K0RA 1SE3A 4UDUC 1WTXA 4RKBA 1HZ9A 3NXWA 3PF5A 5IIFA 3DMUA 3A5ZB 3BDLA 4DR5Q 1ILQA 1B3AA 1IXRA 2WIIB 2WAQG 1JWMD 2B2VA 3PUWA 2I5MX 4NXNQ 1A63A 1D1IA 4MTNA 1IBMQ 1TIID 5AJ3L 1EQQA 2HQLA 3I56A 1CA5A 1I5FA 3NE5B 1HCZA 4OELB 4X66Q 4OO1H 4LF6Q 3GTPB 2LS01 2ATWA 1D5MC 2L0CA 1QWYA 3T1YL 4LUOA 1WTQA 2YV5A 4FXGC 4CDDC 5IODA 3R3OA 2MFIA 2WAQB 1S4ZA 5KGUA 1X3QA 1M1KC 4QCLA 2X69A 5IGEA 4K2LA 3KLSA 3GTQB 2WP8J 2DY7A 2GVBA 4A3DH 1VCIA 3PUXA 2L1BA 4MTKA 4BBSG 3OIPA 1LT6D 4GKKL 1BCPC 4A3CH 4P72A 3JC66 1ICFB 3PUVA 3TZDA 1I3QH 4A3JG 1Y1VH 1QVCA 3DM3A 2AKWB 4X3UA 1XNRQ 4BBSB 2CQOA 3S1QB 4JK1C 3FPPA 5C3EH 3PIOA 5J22A 4DUYQ 4LMQD 5LL6S 1K9MC 2RDGA 3U4VA 2CWAA 5KYIA 4IUTA 3BJUA 5K36H 1STAA 3NPPA 2EXZA 1JWUD 1NBWA 4A3JB 2IL8A 5LMUL 1T9HA 4DR4Q 1I50B 1S3OA 3PSIA 2MO0A 3TN2A 5IGDA 2CQAA 1CZWA 5GAHC 4RA8A 3HOZH 1EYCA 4P2CB 5CV5A 3GTGB 4A4IA 3J81E 3PO2H 2C9OA 3MVVA 2I46A 1NR2A 5JAVA 2NYZD 3QR8A 4LFBL 1E0BA 3GV6A 4E6IA 2A8VA 2NN6I 2F0FA 4MNOA 1WTVA 5JPMC 1N36Q 1N34Q 2WKCA 4JG2A 1H9RA 4ZAIA 4BY1H 2E2IH 1D6EC 4CKEA 1IW7C 1EZ8A 3P7JA 1VDZA 2SDFA 2AWNA 3EA6A 2O2LD 1CK1A 3NBHB 2R92H 1WD0A 3A5UA 4XIGS 2VZAA 1RJTA 3A8KE 1PTOD 1OXSC 4HR7B 4G4KA 4RCOA 1BF4A 3MXUA 2NWGA 3JAMi 2UUBL 1RHPA 1HFGA 1S5CD 3PCOB 1V1OA 3ND9A 4A3BH 1N33Q 4ZKCB 5CYUA 2VW9A 1X3FA 2FINB 2F0KA 1KLGD 2F4VL 4A3MH 3TZUA 2L15A 4I7ZC 2R61A 1E2ZA 3A7AB 3STBC 5AFWA 5JVG3 3QB3A 1UUPA 1SYFA 2EJGC 1Z9FA 4HCSA 1TVXA 4KY6A 1YNJC 1ENCA 1FNWA 3KYHC 4K6DA 2F3IA 2ID0A 3HOYG 2BH8A 1GXDC 3K5NA 3BVZA 4DR2L 3ER0A 3FDTA 3QWNA 2ZTEA 2WKDA 4UP7A 1LV9A 3T1YQ 2UXBL 1EWIA 1E22A 3A7LA 1IHZA 3HOYB 2B8FA 2JK8A 4C1NI 4LF9L 4L8JA 1DOLA 2DUDA 3NSWA 4QIWE 3GTLH 5CMDA 1BO0A 5J1ZA 1E2WA 4RGTA 3ZYYX 4KHPL 1AZPA 1B1ZA 2RCNA 3T13A 2IX0A 4GKKQ 3KJOA 3CCVA 1VQIA 3EN2A 5I9OA 4YIJA 1J6QA 4BWGB 4Z9CB 5FLXc 1QVGA 4LW1A 3M3YB 1U4RA 1HZBA 2PZTA 1DM0B 2L5TA 3PGZA 3K6OA 3SHLA 2RHSB 4B3RQ 3HOVG 4OONA 2D0PA 3I2ZA 4JI4L 1HQMC 3PMFA 4IPGA 1WTOA 4YCWA 1DYQA 1G2SA 3OHXC 5IGCA 1PA6A 4XYOA 4R9WA 1Q46A 1CKMA 2Z6KC 1YNND 4IPCA 3X3NA 5C4XG 1PDQA 1XNQL 1QZGA 1VQ7A 4JBWA 2EJMA 3OWFA 3HOVB 2WAQE 2TMPA 1B44D 2F1MA 1KAAA 5IP9H 4N8FA 4DR3Q 2NTSA 2Q2IA 5C4XB 1FJGQ 4RFBA 3E3XA 4R4TA 1R9TH 3D3RA 4K6LA 3I4LA 2KHIA 5C4ZA 1E1OA 1UE7A 4UP9A 2GVAA 1B9MA 4IO9A 1Q12A 5M5YH 4JCVE 1VQ4A 1ET9A 5C4HA 4A93G 2MP1A 1LTSD 1WTWA 1Q1EA 5C4JB 4HIOA 2PQAA 4RHRA 4DV0L 1B7YB 3D6CA 2YTXA 1HQRD 3J7AF 2K03A 2XRQD 1EOTA 2K7VA 1HUMA 1STNA 2BA0A 3GTMB 2N88A 4LJZC 1UAPA 3V05A 1PH9A 3L9AX 5CV4A 4HCEA 4NDXA 5BN4A 3D6WA 4XXEA 4A93B 1L1OC 1HNWQ 1EY5A 1B8AA 3EBEA 2SNSA 5ELCA 4HIDA 3TP8A 3DWQA 1A15A 2K1BA 1AW7A 1KRSA 3TS2A 5FOBB 1G291 1TKWB 4Y7NH 2F4VQ 2LY7A 5COYA 2JP1A 4XYQA 3S14B
chains in the Genus database with same CATH topology
4JI6L 4L5QA 4DV1Q 4PZ8A 4QY7A 1D7QA 3UE1A 4K0KQ 2JEBI 5EAYA 2ZTCA 2ASBA 1LTLA 4JI6Q 2EXDA 4YWKA 3CMEA 1VQPA 1HR0L 1GM5A 3J81i 1IL2A 5JJIA 4R4CA 1UEBA 2N3SA 5J3BA 3GTPH 1CSPA 3S2DH 2BA1A 1VQ6A 1HR0Q 3K7AH 4DR5L 2K75A 4OO1G 3KDFB 1YJWA 1V9PA 3M7NA 1KD1C 1UE1A 1PFSA 3RLOA 4J15A 4NXNL 4LF4L 1IBML 3TRZA 4JI1L 3L2PA 1XTDA 1HZCA 3A0JA 5ELOA 1VQAA 4P74A 3H3VH 3KFUA 1KRTA 3RLFA 3H15A 2QEXA 4DV2L 4JI3L 3PIPA 2E5LL 4JI1Q 2ES2A 4IJHA 1IYJB 4LF6L 4QGUA 4A3KG 1SE8A 1YI2A 2UXBQ 1SR3A 3PUZA 2UXDL 3GTKH 1K8GA 4DV2Q 2E5LQ 4JI3Q 4LF9Q 3W1BA 4A3DG 4P75A 1C9OA 1XPOA 1KL9A 5IP7G 3KF8B 1YJNA 2NVYH 4IOCA 3AFQA 2EQSA 4DV5L 4BY7G 4BBRG 4A3CG 1E3PA 2VL6A 5FLMH 1XMQQ 3J81j 2HT1A 5M5WH 1IBLL 4C3JH 2ALYB 1GO3E 2ZM6L 4DV6L 4A3EG 3M3YH 3I4NH 4UY8C 1HJPA 4B3SL 1IBLQ 3JAMc 2CCZA 1FVIA 1X56A 2H5XA 4X65Q 5C44G 2ZM6Q 3CMAA 1Y1VG 2VUMH 3I4MG 1PH5A 1WOCA 4DV6Q 4MZ9A 4B3SQ 1BVSA 3MXNB 5LMNQ 1WYDA 5C3EG 3OYYA 3FKIG 2XTIA 2LXKA 3G4SA 2IHEA 4DV7Q 3K80C 2HHHL 4P71A 3CCEA 3KLWA 3BU2A 4KI0A 3I4OA 4QJFA 2VQFL 1KIXA 4JI4Q 4LF5Q 2AHOB 2K5NA 2HHHQ 4A3FH 5GROA 1O7IA 1XNRL 5K36G 3HKSA 3U50C 2UXCL 1YZ6A 3B6YA 1S72A 1QZHA 1I50H 1UE5A 4P73A 4GOPA 2EIFA 3HOVH 4GNXA 3CC4A 4BXXG 4H02A 1B70B 2D0OA 4GLVB 1Y14B 4GKJL 3K8AA 1XNQQ 1XJVA 2CKZB 1ASYA 2OWOA 2UXCQ 3M4PA 2Z6KA 2VNUD 2Q2TA 1EOVA 4LUVA 3CCUA 3HOZG 4GKJQ 3RR5A 3HKZG 2PI2E 3A74A 2Z0SA 3CCQA 1NMFA 3TS0A 1HR0W 4JI2L 1GD7A 1HNZL 1XPUA 3H3VI 3PO2G 3RLNA 3ULJA 1C0AA 4Y52H 5IE8A 1YNXA 4DR7L 4DKAC 1EFWA 3FHWA 4LUZA 4JI2Q 1SN8A 1SFOH 1NMGA 1HNZQ 4JI5L 2VS1A 1H95A 3CCLA 4HJ5A 4JV5L 1Q7YC 4BY1G 1OXUA 3S17H 4A3LG 3CCJA 3HOXH 3UDXA 2QA4A 1PH8A 4JV5Q 4QQBX 3F8TA 2I0QA 3T1HQ 1VQLA 4YCVA 1YHAA 5C4JH 1K8AC 3S16H 4B3MQ 1X6OA 2A1AA 2JJQA 4X62L 2DGYA 3KF6B 1N34L 1N36L 1X3GA 3E9HA 3DLLA 4AYBE 1PVOA 4GS3A 1VQGA 1EUJA 3STBD 4ME3A 1EYGA 2R92G 2AWOA 1LUZA 3VDYA 2PI2A 2GN5A 2KBNA 1PYBA 2RF4A 1TWAH 3KJPA 3CXCA 3UDGA 4HJAA 1YJ9A 3K7UC 3AEVA 3J7A5 4O0AA 5IYBH 5BR8L 2LSSA 2NZOA 5IYDH 5M3MH 3U4ZA 2CWPA 1XMOL 1MJEA 2IT1A 4A93H 2B63H 3M4OH 1XPRA 1JMCA 3PO3G 4DK6C 2R7ZH 2R7FA 3CCSA 2I5HA 2XGTA 3H0GH 4A3GG 4A3BG 1XMOQ 3ULLA 5LMNW 3HOWG 3SGIA 1X9NA 4B3TL 4GLXA 1A0IA 4A3IG 4JI7L 4DR1L 3ZJYC 3RZDH 3S24A 1OXXK 3TREA 4AIMA 4AQYL 2OQ0A 1K3RA 2WB1G 1VQCA 5GADC 3CC2A 5GQOA 4B3TQ 4DR1Q 4A3MG 4JI7Q 3RNUA 2B29A 3NEMA 4A76A 4AQYQ 1N8RC 3S14H 1CKNB 4LFCL 1TWHH 2V1CC 3G6EA 1IBKL 4IFDI 2KCMA 4IPHA 3MEFA 4IPDA 1DGSA 3S15H 3AFPA 4LFCQ 1I6HH 3M9BA 1IBKQ 4TQUS 1JJCB 1NE3A 3IRBA 1K0RA 4UP8A 4OWTB 4GOPB 2Y0SG 2MQHA 3RN5A 4GNXB 2OCEA 3TEHB 4JOIC 3CW2C 1PHJA 4BA2I 1V1QA 1HZ9A 1X65A 3PF5A 4AH6A 2JA6H 1YIJA 1PH2A 1HH2P 3A5ZB 2F52A 2N49A 3CP0A 5FJ8G 3NELA 4DR5Q 5C0XG 4KHZA 1IXRA 1MJCA 2Q2UA 2WAQG 5HY6A 4L5SA 3U58A 2UUCL 4HJ9A 5JJLA 3PUWA 2I5MX 4NXNQ 4X66L 4LF4Q 1A63A 4MTNA 1IBMQ 1VQKA 3HOUG 1SMXA 5AJ3L 1EQQA 2HQLA 4GN5A 3I56A 1I5FA 2UUCQ 3G48A 3EIVA 3ERSX 2KCTA 5IWAL 4X66Q 1KC8C 3RZOH 1D8LA 4OXPA 5AJ3Q 4LF6Q 2D62A 3S1RH 1MIUA 1WI5A 2ATWA 2UXDQ 2LXJA 4R4QA 2R7DA 3D31A 2E8GA 3T1YL 4LUOA 3CCMA 2YV5A 1Y1WG 3E0EA 1KQSA 4GN4B 4APVA 3RN2A 2MFIA 2PQAB 1PH4A 1EIYB 4HIKA 1Z47A 4DV5Q 1C7YA 1UE6A 1K73C 1M1KC 1VQNA 2JA9A 5C0XJ 2OTJA 2BH2A 4JBMA 2WP8J 2GVBA 1CKOA 1YVCA 4A3DH 1VCIA 3PUXA 4YHHL 4BBSG 4JYAL 1QUQA 4LF7L 4GKKL 1HNXL 1P16A 2HIXA 4AYBG 3FP9A 3JC66 4P72A 4BBRH 5IYCH 3M85A 4BY7H 4A3CH 2PNHA 4JYAQ 2UUAL 4L5RC 1K83H 3PUVA 1HNXQ 4YWMA 1W2BA 1YBYA 4DR6L 3CF5A 4A3EH 2UUAQ 1I3QH 3CAMA 2JA5G 3PF4A 2VQFQ 5JEAG 4LWCA 3I4MH 4A3JG 1Y1VH 1QVCA 3BZCA 2AKWB 3DM3A 1XNRQ 4C2MH 2CQOA 4DUYL 4DK3C 5C3EH 2JA8G 3PIOA 5JJKA 4YCUA 4X6AH 3UDFA 1AH9A 4DUYQ 3TQYA 1TXYA 1K9MC 3U4VA 3J81c 2CWAA 1TWGH 3I7FA 5IP9G 3BJUA 5C4XH 4DR4L 1NBWA 4IFDG 1X55A 4ALPA 3E9IA 3CCRA 5LMUL 4BXXH 4OO1I 2K5VA 4DR7Q 1T9HA 4DR4Q 1S3OA 3PSIA 2MO0A 3AQQA 5JEAJ 4C3HH 1L0WA 4JI0L 4JI5Q 4LF5L 4O2DA 4YY3L 5GAHC 5LMUQ 1VQOA 3BZKA 3HOZH 3KDFA 3W5OA 1MKHA 1N9WA 3W1GA 4NPSA 4A4IA 2JA7H 1S40A 3PO2H 4JI0Q 4YY3Q 1V43A 1JT8A 2E2JH 3GO5A 4TVAB 4LFBL 1PH7A 2A8VA 1SLJA 1X3EA 1WCMG 2NN6I 2YTYA 4MNOA 3GTMH 2YU9H 4X62Q 1N36Q 1FGUA 1U0LA 1N34Q 1AE3A 4JG2A 4RMFA 4WJ4A 2KHJA 2E2IH 4BY1H 3D0FA 2NVTH 4LFBQ 4IFDJ 4A3LH 1PH1A 3UE0A 5M5XH 5IY0A 4DAMA 4NB3A 5BR8Q 3Q8DA 2ZTDA 1N32L 2AWNA 5DLQE 2B63G 3K81C 1VS0A 3KOJA 3GD7A 2R7ZG 3S1MH 3NBHB 3PUYA 5M3FG 3H0GG 2FXQA 4POGA 2R92H 3A5UA 2VY3A 3ICEA 4EX5A 4XIGS 2VZAA 1JE5A 1CUKA 4X64L 1OTCA 3K0XA 3PV0A 2R93G 1L1OA 4PZ7A 1OXSC 4IJLA 2MO1A 4X64Q 2UUBL 1N33L 2N78A 3JAMi 1J5EL 4YWLA 3PO3H 3OW2A 1EIFA 3PCOB 1W3SA 1JJ2A 4A3GH 1YITA 4A3BH 2UUBQ 1N33Q 4DV3L 2K14A 4GLAC 4DV4L 2K52A 1NJIC 4EQ5A 3HOWH 4PG3A 3HOYH 1A62A 3HFZB 2VW9A 4A3IH 1RIPA 4DUZL 2VQEL 1VQFA 1X3FA 4DV3Q 1KXLA 2F4VL 2IY5B 4A3MH 5HGQA 1IZ6A 2L15A 2VQEQ 3HKZE 2QGQA 1TWFH 3LGJA 4DV1L 2Q2HA 3STBC 4OWWB 1PYSB 3J7ZC 1QVFA 4HJ7A 1BBWA 1Z9FA 5GAGC 4UPAA 3CQZH 4JOIA 3KYHC 3L0OA 1OXVA 3I55A 1WJJA 2F3IA 1BKBA 1VQJA 2ID0A 1PV4A 3HOYG 2BH8A 2IX1A 1BBUA 1P8LA 4DR2L 1CSQA 3ER0A 2NZHA 3GTOH 3UDIA 3J80c 3S1NH 5IWAQ 4LFAL 3GDEA 5FJ8H 4DR2Q 2ZTEA 4XTCS 4PMWA 4BA1I 3CC7A 4UP7A 1YHQA 3T1YQ 5FLMG 4LFAQ 3HOUH 2UXBL 1EWIA 1E22A 1OXTA 2UU9L 4A3KH 3CPFA 3GTQH 2JK8A 2JE6I 1VQHA 3KF6A 4QL5A 2ZJPA 1U5KA 1VQ5A 4LF9L 3I4NG 2DUDA 1Q81C 1E24A 2UU9Q 4QIWE 4OWXB 5IP7H 3GTLH 2MNAA 2NN6G 2VUMG 4JI8L 1NTGA 1Y1WH 1XMQL 2KENA 4R4IA 4KHPL 4YHHQ 1VQMA 2RCNA 5IYCG 4LF7Q 2IX0A 4GKKQ 4JBJA 4JI8Q 3KJOA 3CCVA 1VQIA 3OTOL 3EN2A 1Q8KA 1M90C 1JB7A 1LM0A 4KHPQ 1JJGA 2WB1E 3ULPA 4X65L 1J6QA 5FLXc 1QVGA 5C44H 4LW1A 3OTOQ 4A3FG 2N8NA 2YYZA 4DR6Q 4B3RL 1L1OB 1WFQA 1YEZA 3NENA 1HZBA 4BBSH 4R1JA 2I5LX 5LMNL 4DV7L 3S1QH 3PGZA 1EQRA 2YTVA 4C3IH 4HJ8A 3FKIH 1I94L 2RHSB 4B3RQ 1VQDA 4OONA 3WWVA 1VQ9A 2A19A 2D0PA 3F1ZA 3I2ZA 1AE2A 3HOVG 1Q86C 4JI4L 1UWVA 4GOPC 4IOAA 4IPGA 4YCWA 2E2HH 1I94Q 1CKNA 4GNXC 2Y0SE 1SROA 3F2DA 1PA6A 2JA5H 1YHBA 1Q46A 1CKMA 2Z6KC 5ELNA 4A3JH 4FDBA 2K50A 4IPCA 5C4XG 1LYLA 1L2FA 1PH3A 4HIMA 1XNQL 1QZGA 1VQ7A 2HIVA 4JBWA 4A75A 4OX9L 2JA8H 1E1TA 1A8VA 2WAQE 4DNIA 1G6PA 2IHFA 5C0XI 5E7NA 1NY4A 4DR3L 2C35B 1Q82C 2PMZE 3GTGH 4OX9Q 2OTLA 2OQKA 3HOXG 4KLKA 5IP9H 1ASZA 1FJGL 2JA7G 4DR3Q 2NVXH 3M4QA 2Q2IA 4DAYB 1FJGQ 4R4TA 1R9TH 1VQBA 1KHIA 3AYHB 2KHIA 5H1SE 1E1OA 1UE7A 4UP9A 2GVAA 1Q1BA 5IYBG 3T1HL 4IO9A 1TWCH 1Q12A 5M5YH 5IYDG 4B3ML 2R6GA 4JCVE 4POFA 4RG1A 5M3MG 1E7ZA 4L5TA 5IT9c 1VQ4A 4A93G 3CD6A 3CPWA 1Q1EA 3J80i 2K4KA 4HIOA 1KAWA 2PQAA 1G51A 1N32Q 4DV0L 2JEAI 1B7YB 1SRUA 1WCMH 2YTXA 3F2BA 4WJ3M 2BA0A 4DV0Q 2K5HA 1QUQB 3S2HH 1HZAA 1PH9A 1HNWL 2CFMA 4JBKA 1PH6A 4LNQA 2JQOA 1FL0A 1GKHA 4R4OA 2ZJQA 4JC0A 1L1OC 1HNWQ 2ZJRA 1B8AA 3EBEA 1J5EQ 3GTJH 4HIDA 1X54A 2B3GA 1VQEA 3F2CA 1VQ8A 5M3FH 4NXML 4GN3B 1RL2A 4LF8L 2WFWA 1GVPA 4DV4Q 1KRSA 2R93H 3TS2A 2NVQH 2RHQB 4NXMQ 4LF8Q 1G291 3L7ZC 3G71A 4DUZQ 2AMCB 5GAEC 4Y7NH 2F4VQ 4PZ6A 4K0KL 2JA6G 4DPGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 L;  4L5Q A;  4DV1 Q;  4PZ8 A;  4QY7 A;  1D7Q A;  3UE1 A;  4K0K Q;  2JEB I;  5EAY A;  2ZTC A;  2ASB A;  1LTL A;  4JI6 Q;  2EXD A;  4YWK A;  3CME A;  1VQP A;  1HR0 L;  1GM5 A;  3J81 i;  1IL2 A;  5JJI A;  4R4C A;  1UEB A;  2N3S A;  5J3B A;  3GTP H;  1CSP A;  3S2D H;  2BA1 A;  1VQ6 A;  1HR0 Q;  3K7A H;  4DR5 L;  2K75 A;  4OO1 G;  3KDF B;  1YJW A;  1V9P A;  3M7N A;  1KD1 C;  1UE1 A;  1PFS A;  3RLO A;  4J15 A;  4NXN L;  4LF4 L;  1IBM L;  3TRZ A;  4JI1 L;  3L2P A;  1XTD A;  1HZC A;  3A0J A;  5ELO A;  1VQA A;  4P74 A;  3H3V H;  3KFU A;  1KRT A;  3RLF A;  3H15 A;  2QEX A;  4DV2 L;  4JI3 L;  3PIP A;  2E5L L;  4JI1 Q;  2ES2 A;  4IJH A;  1IYJ B;  4LF6 L;  4QGU A;  4A3K G;  1SE8 A;  1YI2 A;  2UXB Q;  1SR3 A;  3PUZ A;  2UXD L;  3GTK H;  1K8G A;  4DV2 Q;  2E5L Q;  4JI3 Q;  4LF9 Q;  3W1B A;  4A3D G;  4P75 A;  1C9O A;  1XPO A;  1KL9 A;  5IP7 G;  3KF8 B;  1YJN A;  2NVY H;  4IOC A;  3AFQ A;  2EQS A;  4DV5 L;  4BY7 G;  4BBR G;  4A3C G;  1E3P A;  2VL6 A;  5FLM H;  1XMQ Q;  3J81 j;  2HT1 A;  5M5W H;  1IBL L;  4C3J H;  2ALY B;  1GO3 E;  2ZM6 L;  4DV6 L;  4A3E G;  3M3Y H;  3I4N H;  4UY8 C;  1HJP A;  4B3S L;  1IBL Q;  3JAM c;  2CCZ A;  1FVI A;  1X56 A;  2H5X A;  4X65 Q;  5C44 G;  2ZM6 Q;  3CMA A;  1Y1V G;  2VUM H;  3I4M G;  1PH5 A;  1WOC A;  4DV6 Q;  4MZ9 A;  4B3S Q;  1BVS A;  3MXN B;  5LMN Q;  1WYD A;  5C3E G;  3OYY A;  3FKI G;  2XTI A;  2LXK A;  3G4S A;  2IHE A;  4DV7 Q;  3K80 C;  2HHH L;  4P71 A;  3CCE A;  3KLW A;  3BU2 A;  4KI0 A;  3I4O A;  4QJF A;  2VQF L;  1KIX A;  4JI4 Q;  4LF5 Q;  2AHO B;  2K5N A;  2HHH Q;  4A3F H;  5GRO A;  1O7I A;  1XNR L;  5K36 G;  3HKS A;  3U50 C;  2UXC L;  1YZ6 A;  3B6Y A;  1S72 A;  1QZH A;  1I50 H;  1UE5 A;  4P73 A;  4GOP A;  2EIF A;  3HOV H;  4GNX A;  3CC4 A;  4BXX G;  4H02 A;  1B70 B;  2D0O A;  4GLV B;  1Y14 B;  4GKJ L;  3K8A A;  1XNQ Q;  1XJV A;  2CKZ B;  1ASY A;  2OWO A;  2UXC Q;  3M4P A;  2Z6K A;  2VNU D;  2Q2T A;  1EOV A;  4LUV A;  3CCU A;  3HOZ G;  4GKJ Q;  3RR5 A;  3HKZ G;  2PI2 E;  3A74 A;  2Z0S A;  3CCQ A;  1NMF A;  3TS0 A;  1HR0 W;  4JI2 L;  1GD7 A;  1HNZ L;  1XPU A;  3H3V I;  3PO2 G;  3RLN A;  3ULJ A;  1C0A A;  4Y52 H;  5IE8 A;  1YNX A;  4DR7 L;  4DKA C;  1EFW A;  3FHW A;  4LUZ A;  4JI2 Q;  1SN8 A;  1SFO H;  1NMG A;  1HNZ Q;  4JI5 L;  2VS1 A;  1H95 A;  3CCL A;  4HJ5 A;  4JV5 L;  1Q7Y C;  4BY1 G;  1OXU A;  3S17 H;  4A3L G;  3CCJ A;  3HOX H;  3UDX A;  2QA4 A;  1PH8 A;  4JV5 Q;  4QQB X;  3F8T A;  2I0Q A;  3T1H Q;  1VQL A;  4YCV A;  1YHA A;  5C4J H;  1K8A C;  3S16 H;  4B3M Q;  1X6O A;  2A1A A;  2JJQ A;  4X62 L;  2DGY A;  3KF6 B;  1N34 L;  1N36 L;  1X3G A;  3E9H A;  3DLL A;  4AYB E;  1PVO A;  4GS3 A;  1VQG A;  1EUJ A;  3STB D;  4ME3 A;  1EYG A;  2R92 G;  2AWO A;  1LUZ A;  3VDY A;  2PI2 A;  2GN5 A;  2KBN A;  1PYB A;  2RF4 A;  1TWA H;  3KJP A;  3CXC A;  3UDG A;  4HJA A;  1YJ9 A;  3K7U C;  3AEV A;  3J7A 5;  4O0A A;  5IYB H;  5BR8 L;  2LSS A;  2NZO A;  5IYD H;  5M3M H;  3U4Z A;  2CWP A;  1XMO L;  1MJE A;  2IT1 A;  4A93 H;  2B63 H;  3M4O H;  1XPR A;  1JMC A;  3PO3 G;  4DK6 C;  2R7Z H;  2R7F A;  3CCS A;  2I5H A;  2XGT A;  3H0G H;  4A3G G;  4A3B G;  1XMO Q;  3ULL A;  5LMN W;  3HOW G;  3SGI A;  1X9N A;  4B3T L;  4GLX A;  1A0I A;  4A3I G;  4JI7 L;  4DR1 L;  3ZJY C;  3RZD H;  3S24 A;  1OXX K;  3TRE A;  4AIM A;  4AQY L;  2OQ0 A;  1K3R A;  2WB1 G;  1VQC A;  5GAD C;  3CC2 A;  5GQO A;  4B3T Q;  4DR1 Q;  4A3M G;  4JI7 Q;  3RNU A;  2B29 A;  3NEM A;  4A76 A;  4AQY Q;  1N8R C;  3S14 H;  1CKN B;  4LFC L;  1TWH H;  2V1C C;  3G6E A;  1IBK L;  4IFD I;  2KCM A;  4IPH A;  3MEF A;  4IPD A;  1DGS A;  3S15 H;  3AFP A;  4LFC Q;  1I6H H;  3M9B A;  1IBK Q;  4TQU S;  1JJC B;  1NE3 A;  3IRB A;  1K0R A;  4UP8 A;  4OWT B;  4GOP B;  2Y0S G;  2MQH A;  3RN5 A;  4GNX B;  2OCE A;  3TEH B;  4JOI C;  3CW2 C;  1PHJ A;  4BA2 I;  1V1Q A;  1HZ9 A;  1X65 A;  3PF5 A;  4AH6 A;  2JA6 H;  1YIJ A;  1PH2 A;  1HH2 P;  3A5Z B;  2F52 A;  2N49 A;  3CP0 A;  5FJ8 G;  3NEL A;  4DR5 Q;  5C0X G;  4KHZ A;  1IXR A;  1MJC A;  2Q2U A;  2WAQ G;  5HY6 A;  4L5S A;  3U58 A;  2UUC L;  4HJ9 A;  5JJL A;  3PUW A;  2I5M X;  4NXN Q;  4X66 L;  4LF4 Q;  1A63 A;  4MTN A;  1IBM Q;  1VQK A;  3HOU G;  1SMX A;  5AJ3 L;  1EQQ A;  2HQL A;  4GN5 A;  3I56 A;  1I5F A;  2UUC Q;  3G48 A;  3EIV A;  3ERS X;  2KCT A;  5IWA L;  4X66 Q;  1KC8 C;  3RZO H;  1D8L A;  4OXP A;  5AJ3 Q;  4LF6 Q;  2D62 A;  3S1R H;  1MIU A;  1WI5 A;  2ATW A;  2UXD Q;  2LXJ A;  4R4Q A;  2R7D A;  3D31 A;  2E8G A;  3T1Y L;  4LUO A;  3CCM A;  2YV5 A;  1Y1W G;  3E0E A;  1KQS A;  4GN4 B;  4APV A;  3RN2 A;  2MFI A;  2PQA B;  1PH4 A;  1EIY B;  4HIK A;  1Z47 A;  4DV5 Q;  1C7Y A;  1UE6 A;  1K73 C;  1M1K C;  1VQN A;  2JA9 A;  5C0X J;  2OTJ A;  2BH2 A;  4JBM A;  2WP8 J;  2GVB A;  1CKO A;  1YVC A;  4A3D H;  1VCI A;  3PUX A;  4YHH L;  4BBS G;  4JYA L;  1QUQ A;  4LF7 L;  4GKK L;  1HNX L;  1P16 A;  2HIX A;  4AYB G;  3FP9 A;  3JC6 6;  4P72 A;  4BBR H;  5IYC H;  3M85 A;  4BY7 H;  4A3C H;  2PNH A;  4JYA Q;  2UUA L;  4L5R C;  1K83 H;  3PUV A;  1HNX Q;  4YWM A;  1W2B A;  1YBY A;  4DR6 L;  3CF5 A;  4A3E H;  2UUA Q;  1I3Q H;  3CAM A;  2JA5 G;  3PF4 A;  2VQF Q;  5JEA G;  4LWC A;  3I4M H;  4A3J G;  1Y1V H;  1QVC A;  3BZC A;  2AKW B;  3DM3 A;  1XNR Q;  4C2M H;  2CQO A;  4DUY L;  4DK3 C;  5C3E H;  2JA8 G;  3PIO A;  5JJK A;  4YCU A;  4X6A H;  3UDF A;  1AH9 A;  4DUY Q;  3TQY A;  1TXY A;  1K9M C;  3U4V A;  3J81 c;  2CWA A;  1TWG H;  3I7F A;  5IP9 G;  3BJU A;  5C4X H;  4DR4 L;  1NBW A;  4IFD G;  1X55 A;  4ALP A;  3E9I A;  3CCR A;  5LMU L;  4BXX H;  4OO1 I;  2K5V A;  4DR7 Q;  1T9H A;  4DR4 Q;  1S3O A;  3PSI A;  2MO0 A;  3AQQ A;  5JEA J;  4C3H H;  1L0W A;  4JI0 L;  4JI5 Q;  4LF5 L;  4O2D A;  4YY3 L;  5GAH C;  5LMU Q;  1VQO A;  3BZK A;  3HOZ H;  3KDF A;  3W5O A;  1MKH A;  1N9W A;  3W1G A;  4NPS A;  4A4I A;  2JA7 H;  1S40 A;  3PO2 H;  4JI0 Q;  4YY3 Q;  1V43 A;  1JT8 A;  2E2J H;  3GO5 A;  4TVA B;  4LFB L;  1PH7 A;  2A8V A;  1SLJ A;  1X3E A;  1WCM G;  2NN6 I;  2YTY A;  4MNO A;  3GTM H;  2YU9 H;  4X62 Q;  1N36 Q;  1FGU A;  1U0L A;  1N34 Q;  1AE3 A;  4JG2 A;  4RMF A;  4WJ4 A;  2KHJ A;  2E2I H;  4BY1 H;  3D0F A;  2NVT H;  4LFB Q;  4IFD J;  4A3L H;  1PH1 A;  3UE0 A;  5M5X H;  5IY0 A;  4DAM A;  4NB3 A;  5BR8 Q;  3Q8D A;  2ZTD A;  1N32 L;  2AWN A;  5DLQ E;  2B63 G;  3K81 C;  1VS0 A;  3KOJ A;  3GD7 A;  2R7Z G;  3S1M H;  3NBH B;  3PUY A;  5M3F G;  3H0G G;  2FXQ A;  4POG A;  2R92 H;  3A5U A;  2VY3 A;  3ICE A;  4EX5 A;  4XIG S;  2VZA A;  1JE5 A;  1CUK A;  4X64 L;  1OTC A;  3K0X A;  3PV0 A;  2R93 G;  1L1O A;  4PZ7 A;  1OXS C;  4IJL A;  2MO1 A;  4X64 Q;  2UUB L;  1N33 L;  2N78 A;  3JAM i;  1J5E L;  4YWL A;  3PO3 H;  3OW2 A;  1EIF A;  3PCO B;  1W3S A;  1JJ2 A;  4A3G H;  1YIT A;  4A3B H;  2UUB Q;  1N33 Q;  4DV3 L;  2K14 A;  4GLA C;  4DV4 L;  2K52 A;  1NJI C;  4EQ5 A;  3HOW H;  4PG3 A;  3HOY H;  1A62 A;  3HFZ B;  2VW9 A;  4A3I H;  1RIP A;  4DUZ L;  2VQE L;  1VQF A;  1X3F A;  4DV3 Q;  1KXL A;  2F4V L;  2IY5 B;  4A3M H;  5HGQ A;  1IZ6 A;  2L15 A;  2VQE Q;  3HKZ E;  2QGQ A;  1TWF H;  3LGJ A;  4DV1 L;  2Q2H A;  3STB C;  4OWW B;  1PYS B;  3J7Z C;  1QVF A;  4HJ7 A;  1BBW A;  1Z9F A;  5GAG C;  4UPA A;  3CQZ H;  4JOI A;  3KYH C;  3L0O A;  1OXV A;  3I55 A;  1WJJ A;  2F3I A;  1BKB A;  1VQJ A;  2ID0 A;  1PV4 A;  3HOY G;  2BH8 A;  2IX1 A;  1BBU A;  1P8L A;  4DR2 L;  1CSQ A;  3ER0 A;  2NZH A;  3GTO H;  3UDI A;  3J80 c;  3S1N H;  5IWA Q;  4LFA L;  3GDE A;  5FJ8 H;  4DR2 Q;  2ZTE A;  4XTC S;  4PMW A;  4BA1 I;  3CC7 A;  4UP7 A;  1YHQ A;  3T1Y Q;  5FLM G;  4LFA Q;  3HOU H;  2UXB L;  1EWI A;  1E22 A;  1OXT A;  2UU9 L;  4A3K H;  3CPF A;  3GTQ H;  2JK8 A;  2JE6 I;  1VQH A;  3KF6 A;  4QL5 A;  2ZJP A;  1U5K A;  1VQ5 A;  4LF9 L;  3I4N G;  2DUD A;  1Q81 C;  1E24 A;  2UU9 Q;  4QIW E;  4OWX B;  5IP7 H;  3GTL H;  2MNA A;  2NN6 G;  2VUM G;  4JI8 L;  1NTG A;  1Y1W H;  1XMQ L;  2KEN A;  4R4I A;  4KHP L;  4YHH Q;  1VQM A;  2RCN A;  5IYC G;  4LF7 Q;  2IX0 A;  4GKK Q;  4JBJ A;  4JI8 Q;  3KJO A;  3CCV A;  1VQI A;  3OTO L;  3EN2 A;  1Q8K A;  1M90 C;  1JB7 A;  1LM0 A;  4KHP Q;  1JJG A;  2WB1 E;  3ULP A;  4X65 L;  1J6Q A;  5FLX c;  1QVG A;  5C44 H;  4LW1 A;  3OTO Q;  4A3F G;  2N8N A;  2YYZ A;  4DR6 Q;  4B3R L;  1L1O B;  1WFQ A;  1YEZ A;  3NEN A;  1HZB A;  4BBS H;  4R1J A;  2I5L X;  5LMN L;  4DV7 L;  3S1Q H;  3PGZ A;  1EQR A;  2YTV A;  4C3I H;  4HJ8 A;  3FKI H;  1I94 L;  2RHS B;  4B3R Q;  1VQD A;  4OON A;  3WWV A;  1VQ9 A;  2A19 A;  2D0P A;  3F1Z A;  3I2Z A;  1AE2 A;  3HOV G;  1Q86 C;  4JI4 L;  1UWV A;  4GOP C;  4IOA A;  4IPG A;  4YCW A;  2E2H H;  1I94 Q;  1CKN A;  4GNX C;  2Y0S E;  1SRO A;  3F2D A;  1PA6 A;  2JA5 H;  1YHB A;  1Q46 A;  1CKM A;  2Z6K C;  5ELN A;  4A3J H;  4FDB A;  2K50 A;  4IPC A;  5C4X G;  1LYL A;  1L2F A;  1PH3 A;  4HIM A;  1XNQ L;  1QZG A;  1VQ7 A;  2HIV A;  4JBW A;  4A75 A;  4OX9 L;  2JA8 H;  1E1T A;  1A8V A;  2WAQ E;  4DNI A;  1G6P A;  2IHF A;  5C0X I;  5E7N A;  1NY4 A;  4DR3 L;  2C35 B;  1Q82 C;  2PMZ E;  3GTG H;  4OX9 Q;  2OTL A;  2OQK A;  3HOX G;  4KLK A;  5IP9 H;  1ASZ A;  1FJG L;  2JA7 G;  4DR3 Q;  2NVX H;  3M4Q A;  2Q2I A;  4DAY B;  1FJG Q;  4R4T A;  1R9T H;  1VQB A;  1KHI A;  3AYH B;  2KHI A;  5H1S E;  1E1O A;  1UE7 A;  4UP9 A;  2GVA A;  1Q1B A;  5IYB G;  3T1H L;  4IO9 A;  1TWC H;  1Q12 A;  5M5Y H;  5IYD G;  4B3M L;  2R6G A;  4JCV E;  4POF A;  4RG1 A;  5M3M G;  1E7Z A;  4L5T A;  5IT9 c;  1VQ4 A;  4A93 G;  3CD6 A;  3CPW A;  1Q1E A;  3J80 i;  2K4K A;  4HIO A;  1KAW A;  2PQA A;  1G51 A;  1N32 Q;  4DV0 L;  2JEA I;  1B7Y B;  1SRU A;  1WCM H;  2YTX A;  3F2B A;  4WJ3 M;  2BA0 A;  4DV0 Q;  2K5H A;  1QUQ B;  3S2H H;  1HZA A;  1PH9 A;  1HNW L;  2CFM A;  4JBK A;  1PH6 A;  4LNQ A;  2JQO A;  1FL0 A;  1GKH A;  4R4O A;  2ZJQ A;  4JC0 A;  1L1O C;  1HNW Q;  2ZJR A;  1B8A A;  3EBE A;  1J5E Q;  3GTJ H;  4HID A;  1X54 A;  2B3G A;  1VQE A;  3F2C A;  1VQ8 A;  5M3F H;  4NXM L;  4GN3 B;  1RL2 A;  4LF8 L;  2WFW A;  1GVP A;  4DV4 Q;  1KRS A;  2R93 H;  3TS2 A;  2NVQ H;  2RHQ B;  4NXM Q;  4LF8 Q;  1G29 1;  3L7Z C;  3G71 A;  4DUZ Q;  2AMC B;  5GAE C;  4Y7N H;  2F4V Q;  4PZ6 A;  4K0K L;  2JA6 G;  4DPG A; 
#chains in the Genus database with same CATH topology
 4JI6 L;  2AQ3 B;  1TWH B;  2FJ2 A;  1Q90 A;  2HQE A;  4PZ8 A;  3UE1 A;  1MHW C;  4K0K Q;  2LFN A;  1B3Q A;  2ASB A;  1HTL D;  2ZTC A;  3VYR A;  2B2Y C;  1I6H B;  1HR0 L;  3DEO A;  4R4C A;  3T16 A;  2XNA C;  4GZY C;  3GTP H;  1XWE A;  4J1M A;  1DJR D;  4OO1 G;  2HUG A;  3NTK A;  4RGM A;  1PTO C;  4LF4 L;  3PQI A;  3C3L A;  1XTD A;  2F0H A;  4P74 A;  5C3W A;  2EYO A;  4KMU C;  3KFU A;  3O13 A;  2QEX A;  1F77 A;  2I07 B;  2ES2 A;  4JI1 Q;  1IYJ B;  2CVR A;  2UXB Q;  3TDQ A;  1RKN A;  2UXD L;  4DV2 Q;  2E5L Q;  4LF9 Q;  3W1B A;  4A3D G;  3OW7 A;  3EJI A;  2NVY H;  1II3 A;  4DV5 L;  4A3C G;  1E3P A;  2VL6 A;  5FLM H;  3J81 j;  5M5W H;  3K59 A;  2G5D A;  3DWA A;  4RHS A;  1Y8O B;  1GHK A;  4UY8 C;  1HJP A;  4B3S L;  3I90 A;  1F9P A;  3JAM c;  2CCZ A;  2H5X A;  3CMA A;  1TS3 A;  1Y1V G;  3BVG A;  4A3D B;  2NUC A;  1BVS A;  4LF5 L;  5C3E G;  3KBG A;  2XTI A;  3G4S A;  4OIK A;  3BU2 A;  4JI4 Q;  1WTR A;  5A2Q E;  3FRP B;  3BS1 A;  1DCZ A;  1O7I A;  1I3Q B;  5K36 G;  2A68 C;  3U50 C;  1PLF A;  2PO4 A;  1I50 H;  1Y1V B;  2SEB D;  4IUN A;  5DM7 3;  4FF3 A;  1ENA A;  2BDO A;  1XNQ Q;  2EYL A;  1XJV A;  5C3E B;  4V19 0;  2UXC Q;  1C48 A;  1SJE D;  5KIX A;  3K5M A;  4RKL A;  2Q2T A;  1EOV A;  3HOZ G;  5K5P A;  4GKJ Q;  3RR5 A;  3A74 A;  4DK0 A;  2Z0S A;  1HR0 W;  1NMF A;  4KY7 A;  3I72 A;  5DAU A;  3H3V I;  3PO2 G;  3RLN A;  2RKS A;  4DR7 L;  5CV8 A;  3FHW A;  4JI2 Q;  1JCK B;  1SN8 A;  2KOL A;  1AN8 A;  4HJ5 A;  1Q7Y C;  4BY1 G;  4EQP A;  1EFI D;  3HOZ B;  1PH8 A;  2LKV A;  3PO2 B;  4QUF A;  3BDO A;  3A56 A;  1LO5 D;  4KKT A;  3MZ5 A;  4G7Z C;  1X3G A;  3E9H A;  1EYG A;  1MSH A;  1QNK A;  1XX8 A;  2R92 G;  4B08 A;  1LUZ A;  4XT3 B;  1PYB A;  2NTT A;  3TP6 A;  3AB9 A;  4HJA A;  3K7U C;  5IYB H;  5BR8 L;  4BY1 B;  2NZO A;  4CJ2 C;  1YNN C;  5M3M H;  1XMO L;  1EY4 A;  3R2T A;  1IL8 A;  4DK6 C;  3CCS A;  2XGT A;  1K8M A;  4A3B G;  5LMN W;  4IN3 A;  3I91 A;  1S5E D;  2R92 B;  3ZJY C;  4FF1 A;  1RCV D;  3H91 A;  2AQ1 B;  1CQF A;  3RMH A;  2OQ0 A;  3CC2 A;  1VQC A;  2G9D A;  4A3M G;  2Q8I B;  5L37 A;  3GP7 A;  2PW7 A;  4IFD I;  4A3B B;  4CDC C;  4PMC A;  1IBK Q;  1TT2 A;  1O7Z A;  1F9R A;  4OWT B;  4KV6 A;  2EYJ A;  2Y0S G;  4UP8 A;  2ENB A;  4LAA A;  2HCC A;  1DON A;  3BG3 A;  4A3M B;  1ZKO A;  2B8G A;  3CW2 C;  3RD4 A;  4F87 A;  1KNE A;  1H9M A;  1PH2 A;  2N49 A;  3CP0 A;  1SNP A;  4DNT B;  3NQT A;  4L5S A;  4X66 L;  4LF4 Q;  2LMC B;  1SMX A;  1VF7 A;  3CHB D;  2F0U A;  2Y0S B;  3KK7 A;  4DAY A;  2UUC Q;  3K0Y A;  3G48 A;  3EIV A;  3ERS X;  2KCT A;  2F0W A;  3RZO H;  5IT9 L;  4OXP A;  4KJO A;  1WI5 A;  3VA7 A;  2UXD Q;  4R4Q A;  1KQS A;  1F9Q A;  4GN4 B;  3RN2 A;  2PQA B;  1MD2 D;  4HIK A;  4DV5 Q;  1C7Y A;  1SE4 A;  3D4D A;  1EWH A;  1VQN A;  2JA9 A;  5T1I A;  2BH2 A;  4F7X A;  4JBM A;  4B9X A;  3VA5 A;  1YVC A;  4YHH L;  1MSG A;  3GTK B;  3GTL B;  2HIX A;  3FP9 A;  1ESR A;  2QEJ C;  4DF7 A;  4JYA Q;  1SDF A;  1HNX Q;  1E2V A;  3VR3 A;  1YBY A;  2F0Q A;  4LWC A;  4PQX A;  2FHT A;  1SAP A;  3A8J E;  4OEM B;  5EBC A;  2EYH A;  5KYL A;  4DUY L;  3U9S A;  4OL7 A;  5JJK A;  1EY7 A;  3UDF A;  2XSC A;  3HP3 A;  2OEO A;  1HRJ A;  1ROD A;  3CRK C;  5IGG A;  1Q8I A;  5IP9 G;  5FLX E;  2XIW A;  5C4X H;  4DR4 L;  2M00 A;  4FO2 A;  2EDG A;  3CCR A;  4OO1 I;  4BXX H;  4XQN A;  4DR7 Q;  3DM1 A;  3AQQ A;  5JEA J;  1L0W A;  1VQO A;  3I73 A;  3VR6 A;  3W5O A;  1MKH A;  1N9W A;  1RTO A;  1MI2 A;  3TME A;  3GO5 A;  2SOB A;  4TVA B;  1SLJ A;  1FYC A;  1X3E A;  4NMZ A;  5E4W C;  2YTY A;  3GTM H;  4KD3 A;  1AE3 A;  3I3C A;  2L4N A;  4RMF A;  1R9T B;  4WJ4 A;  2NVT H;  2H1E A;  3UE0 A;  5JPN C;  5IY0 A;  1PRT B;  4DAM A;  4DN4 M;  5M5Y B;  5BR8 Q;  3Q8D A;  3K5L A;  1QOH A;  3KOJ A;  3GV3 A;  1F9S A;  3K81 C;  1VMC A;  3PUY A;  4FNF A;  3H0G G;  2FXQ A;  2PYK A;  3ICE A;  4HAE A;  4FF2 A;  4EX5 A;  3OMC A;  1JE5 A;  1CUK A;  2MGS A;  4DU9 A;  3IKJ A;  3PV0 A;  1PFB A;  1BDO A;  4WRD A;  3Q6S A;  1N33 L;  3SVM A;  1G6Z A;  2JSO A;  4IUU A;  3OW2 A;  1EIF A;  1W3S A;  4A3G H;  1YIT A;  3M4O B;  5EKL A;  3HOW H;  4EQ5 A;  1KDB A;  2WIN B;  1A62 A;  3H0G B;  1ILP A;  1RIP A;  1NCV A;  2IY5 B;  1GUW A;  3LGJ A;  4Y7N B;  5EPL A;  4FVM A;  3H6M A;  1ONL A;  1BBW A;  3MHB A;  5GAG C;  4I7A A;  4UPA A;  3CQZ H;  3D8G A;  4C56 C;  3L0O A;  1OXV A;  1WJJ A;  1BQQ T;  4WJW A;  3QJY A;  1Z6H A;  1P8L A;  1CSQ A;  3GTO H;  3OIQ A;  3J80 c;  3TP5 A;  4L6T B;  3GDE A;  5FJ8 H;  2KED A;  4PMW A;  2KCC A;  4BA1 I;  3ERO A;  5FLM G;  3LWE A;  4LFA Q;  1XTC D;  3FPU B;  3HOU H;  4F8M A;  4HMI A;  2RQX A;  3R93 A;  1VQH A;  4QL5 A;  4HN7 A;  4ABN A;  2UU9 Q;  2KA7 A;  1PZJ D;  2QIL A;  1TU2 B;  1NTG A;  2K32 A;  2KEN A;  3FEW X;  4R4I A;  4YHH Q;  1VQM A;  2MJ8 A;  2NVY B;  1G2T A;  3DEP A;  4JI8 Q;  5M5W B;  1LM0 A;  3ULP A;  1EY9 A;  3KLS X;  1PFM A;  4XQQ A;  4B3R L;  1NSN S;  5JJZ A;  4I65 A;  4R1J A;  4DV7 L;  3R2I A;  1EQR A;  1QJO A;  4C3I H;  3HS0 C;  5FO7 B;  4CDF C;  1LT4 D;  2A19 A;  3MFG A;  1Q86 C;  2E2H H;  1I94 Q;  1CKN A;  4GNX C;  2Y0S E;  2JA5 H;  3MTS A;  5JEA H;  4QMG A;  1JOK A;  3JAM E;  2K50 A;  3W2D A;  1LTI D;  3QOL A;  2K28 A;  1LYL A;  4FXK C;  2HIV A;  1S5F D;  1E1T A;  3OMG A;  1VMP A;  3G7L A;  4DR3 L;  2C35 B;  4OX9 Q;  2OTL A;  2N55 A;  1EL0 A;  2EJF C;  2OQK A;  2PQE A;  1FJG L;  2JA7 G;  2V4D A;  1EIH A;  2K05 A;  3AMU A;  4DAY B;  3BYT B;  5HUR A;  1KHI A;  3C46 A;  2IW3 A;  5IYB G;  4POF A;  5IT9 c;  5M3M G;  2JA7 B;  2QKI C;  1RF2 D;  4ZLT F;  5F2D A;  1G51 A;  1B9N A;  2JEA I;  2A69 D;  1WCM H;  2ICE C;  5KNB A;  3OWE B;  1L0Y B;  4G7O C;  1KNA A;  1LTT D;  2F0G A;  1HZA A;  1HNW L;  2JXM B;  4WOR A;  1GKH A;  1F2Z A;  4R4O A;  5M3M B;  2F0J A;  2B3G A;  5CC4 A;  4CJ1 B;  1M4V A;  2WFW A;  3S9W A;  1EQV A;  2TSS A;  4G7H C;  1EZ6 A;  4RGO S;  2NVQ H;  3E6Z X;  2RHQ B;  1H9J A;  3MXG A;  4R8I A;  4LF8 Q;  1B50 A;  4K5V A;  1D5X C;  5GAE C;  2HCI A;  4PZ6 A;  2MHV A;  3J81 L;  4K0K L;  3HEJ A;  4QY7 A;  2DJG C;  5ELD A;  1K0S A;  2JEB I;  2XN9 C;  5EAY A;  1LTL A;  4YWK A;  3J81 i;  5JJI A;  1UEB A;  1U9R A;  5J3B A;  5M9O A;  1R4Q B;  1LTA D;  3K7A H;  2DN8 A;  1HPC A;  1SNC A;  3AU7 A;  3RLO A;  4J15 A;  1DD2 A;  1RTN A;  3TRZ A;  4JI1 L;  3L2P A;  1X3P A;  1KRT A;  4L5R C;  4DV2 L;  2E5L L;  4IUP A;  1SE8 A;  2KQ3 A;  2O5I C;  1SR3 A;  3GTK H;  4JI3 Q;  3RZO B;  3DHQ A;  1XPO A;  5IP7 G;  1EYA A;  3AFQ A;  2EQS A;  5DM6 3;  2ALY B;  1D5Z C;  1GO3 E;  1I6V C;  3FMC A;  2ZT9 C;  1ZEQ X;  1AZQ A;  4F88 A;  1KAB A;  1NUC A;  1FVI A;  1X56 A;  5C44 G;  2ZM6 Q;  2NN6 H;  2VUM H;  1PH5 A;  4DV6 Q;  3T56 B;  4MZ9 A;  4MHE A;  4U67 3;  3L3O C;  4DV7 Q;  1WYD A;  3CKI B;  3NK9 A;  4N8X 1;  4H0L C;  3CCE A;  4KI0 A;  5LHY 1;  5ELF A;  1NR4 A;  4QJF A;  4XDX A;  2HHH Q;  2VXW A;  4A3F H;  5GRO A;  1FGB D;  2UXC L;  1YZ6 A;  5C44 B;  1UE5 A;  4P73 A;  2EIF A;  3W3A A;  4ZRZ A;  3CC4 A;  4BXX G;  1B70 B;  1Y14 B;  4GKJ L;  1ASY A;  2A5H A;  2Z6K A;  3CCU A;  2Q8T A;  3NUC A;  5EPK A;  4JI2 L;  2Z8L A;  4Y52 H;  1D1K A;  2EY6 A;  1YNX A;  1EFW A;  3P75 A;  1SFO H;  1NMG A;  1PTO H;  1AP0 A;  1HNZ Q;  4HSV A;  1H95 A;  3CCL A;  2A6H D;  2RA4 A;  3VYU A;  1OXU A;  4CHT B;  3S17 H;  2EVB A;  3F2U A;  3CCJ A;  3UDX A;  1A2T A;  2K6A A;  3HGB A;  1VQL A;  4OIJ A;  4DFA A;  2A1A A;  3NBI A;  2HDM A;  1V8Q A;  3DLL A;  2Z4H A;  4GS3 A;  2AWO A;  1NNX A;  1QG7 A;  3AEV A;  3KJP A;  1CM9 A;  3UDG A;  4O0A A;  5EBD A;  2D9U A;  2NVT B;  3U9O A;  2RSN A;  5IYD H;  3U4Z A;  1MJE A;  4PMB A;  2O4X A;  2IT1 A;  3E5S A;  3OOC A;  3M4O H;  1XPR A;  1JMC A;  3H0G H;  4A3G G;  4IQZ A;  5I2X A;  3HOW G;  1BCP B;  2CH4 W;  1X9N A;  1A0I A;  2F0P A;  3S24 A;  4CKC A;  2RVL A;  2PZU A;  4NP5 A;  3TRE A;  5I4D A;  4CDE C;  2QF7 A;  4H7B A;  4DR1 Q;  1GUO A;  4A76 A;  4AQY Q;  1CKN B;  2F3W A;  2V1C C;  4KKS A;  1IBK L;  1XXG A;  4A3G B;  1EEF D;  2B2U C;  4IPH A;  1B4O A;  3HOW B;  4LFC Q;  3VYT A;  1DOM A;  1RDP D;  1A3T A;  1Y69 U;  3SE0 A;  4GNX B;  3TEH B;  2B39 A;  4JOI C;  1F2L A;  5LL6 X;  4DK1 A;  4BA2 I;  1V1Q A;  1BOS A;  1X65 A;  1HH2 P;  5I6Y A;  2F52 A;  5FJ8 G;  1I4Q A;  4EGV A;  5JJL A;  3U58 A;  2UUC L;  4HJ9 A;  3CQZ B;  3HOU G;  1FR3 A;  5D3I B;  3MA2 B;  5IWA L;  1D8L A;  1MIU A;  1PZK D;  1ZYR D;  3GTO B;  1J8I A;  2R7D A;  3HRZ C;  2E8G A;  3CCM A;  3E0E A;  4ILW A;  5J39 A;  1ENF A;  1PH4 A;  1EIY B;  2EE1 A;  1Z47 A;  1UE6 A;  1K73 C;  3HOU B;  5C0X J;  4C3J G;  2OTJ A;  3NTI A;  3VR5 A;  1SMY D;  1Z7T A;  4JYA L;  3J80 E;  1QUQ A;  3Q0A A;  1O7L A;  1SYG A;  4C3I G;  1P16 A;  1HNX L;  4AYB G;  4BY7 H;  4BBR H;  1HA6 A;  1LT3 D;  2PNH A;  4O42 A;  3SK6 A;  2IJ0 A;  5D14 A;  4YWM A;  1W2B A;  3CF5 A;  4A3E H;  2UUA Q;  3CAM A;  4C3J B;  3QO2 A;  2JA5 G;  3PF4 A;  5JEA G;  3A54 A;  4FXD A;  1R4P B;  4C3I B;  4AYB B;  5FO9 B;  2WV6 D;  3WDN A;  3TQY A;  2F0O A;  2E2H B;  3J81 c;  1SYC A;  1TWG H;  1GUS A;  4WFN 3;  3GQB A;  4Q5V A;  2JA5 B;  1S5D D;  1X55 A;  1JQY D;  3E9I A;  4M1U B;  2K5V A;  4CBV A;  4C3H H;  1LTR D;  4O2D A;  3V2T A;  3J7Y W;  3BZK A;  1AFP A;  2JA7 H;  4NPS A;  3T51 B;  4ME5 A;  4JI0 Q;  4YY3 Q;  2AQ2 B;  1JT8 A;  3H94 A;  4ID6 A;  3C1E A;  5DEH A;  1WCM G;  3VYS A;  2YU9 H;  2AUK A;  1U0L A;  2PZW A;  2ICI A;  3D0F A;  4IFD J;  1UEA B;  2NBF A;  1JC7 A;  3WOE A;  5M5X H;  1Y8P B;  4NB3 A;  5A2Q L;  5DLQ E;  2B63 G;  4POG A;  1WCM B;  3H09 A;  3A55 A;  1QCB D;  1B2T A;  1K8O A;  1LLR D;  4IJL A;  4X64 Q;  2N78 A;  4YWL A;  3MXN A;  3PO3 H;  1JJ2 A;  2A6H C;  2F03 A;  3N6R A;  4DV4 L;  2B63 B;  1NJI C;  4H44 C;  3HFZ B;  1VQF A;  3UI2 A;  4DV3 Q;  4K5W A;  2NVQ B;  4J6H A;  1IZ6 A;  2VQE Q;  3HZX A;  1I4R A;  1HXY D;  5IGF A;  1TWF H;  4OWW B;  3NTH A;  3J7Z C;  5CV7 A;  1I4H A;  3WOF A;  3I55 A;  1BKB A;  1U4P A;  2CHB D;  5EGT A;  2RDH A;  2IX1 A;  1BBU A;  3UDI A;  3K7A B;  5IGB A;  5IWA Q;  3K58 A;  3S1N H;  2B2W C;  4LFA L;  4HTH A;  1CT1 D;  3CRL C;  3CU7 A;  2EYP A;  4XTC S;  5C0X H;  3C2P A;  1PXU A;  3CC7 A;  1KLU D;  3LWU A;  5BN5 A;  1YHQ A;  5C5L A;  1OXT A;  3PIP 3;  2UU9 L;  2EY1 A;  1JE4 A;  1VQ5 A;  3KF6 A;  1EWC A;  4K14 A;  1E24 A;  5IP7 H;  1STG A;  2NN6 G;  2VUM G;  4JI8 L;  1Y1W H;  1XMQ L;  4IUR A;  5IYC G;  2ZXR A;  4JBJ A;  1Q8K A;  1JB7 A;  3N52 A;  4IUV A;  1JJG A;  4RWS C;  2Z9H A;  5C44 H;  4RH6 A;  4A3F G;  3OTO Q;  2YYZ A;  1L1O B;  1WFQ A;  3NEN A;  2A6E D;  2I5L X;  3SDZ A;  2YTV A;  2VUM B;  5DNF A;  2B2T C;  1I94 L;  1VQ9 A;  3WWV A;  1K28 A;  3F1Z A;  2G9H D;  2EZV A;  4GOP C;  3SXH A;  1SRO A;  1ZYR C;  3OPO A;  1EU3 A;  4OGQ C;  5ELN A;  5T1G A;  4A3F B;  1DZ1 A;  1L2F A;  2JA8 H;  3I8Z A;  4OX9 L;  1SND A;  1V1P A;  3PIO 3;  2EOT A;  2K5D A;  2IHF A;  1D2B A;  1SMY C;  3DWP A;  4KHV A;  1CI3 M;  3QG1 A;  2NVX H;  4IFD H;  1KTK A;  2F0V A;  1SFO B;  1PTO B;  2XVS A;  3BVM A;  1J9O A;  1VF5 C;  1IYU A;  4FF4 A;  1X32 A;  1SE2 A;  3H3V C;  1TWC H;  3S17 B;  5IYD G;  2R6G A;  2H4O A;  2D2C C;  2NB0 A;  3CD6 A;  2XWB B;  1Q3L A;  1SRU A;  3F2B A;  2KVM A;  4WJ3 M;  2K5H A;  1QUQ B;  3KBX A;  3S2H H;  4FYD A;  1EU4 A;  4JBK A;  1FL0 A;  2ZJQ A;  1PRT F;  5FLX L;  4K5X A;  3GTJ H;  1X54 A;  1VQ8 A;  3F2C A;  5M3F H;  1LT5 D;  4LF8 L;  2F0N A;  1GVP A;  2A73 B;  4JPB W;  4DV4 Q;  2R93 H;  1A3U A;  4NXM Q;  3L7Z C;  5HGT A;  3G71 A;  4KTA A;  3BYY B;  3K5O A;  4QIW B;  3RUZ A;  4L5Q A;  2J4X A;  1D7Q A;  2RDF A;  3URY A;  1HFN A;  2EXD A;  4HMJ A;  1GM5 A;  5CV9 A;  4ZK9 B;  3NHH A;  3Q24 A;  1CSP A;  3S2D H;  2B2V C;  3R8B A;  1EY6 A;  2K75 A;  2OT2 A;  1YJW A;  1V9P A;  3M7N A;  1TY2 A;  1TQO A;  5ELE A;  2L12 A;  3IFD A;  1IKM A;  2BE5 D;  1H9K A;  1HZC A;  3A0J A;  3RLF A;  4HSP A;  4JI3 L;  3PIP A;  4QGU A;  4A3K G;  1YI2 A;  4DA2 A;  3PUZ A;  1LTB D;  1SNM A;  2F0E A;  1KL9 A;  1YJN A;  2PW5 A;  4IOC A;  4BY7 G;  4BBR G;  3V96 A;  1XMQ Q;  4DGZ A;  1O78 A;  1SYD A;  4C3J H;  4KD4 A;  1NAP A;  2F4I A;  2KJX A;  2ZM6 L;  4DAV A;  4DV6 L;  4A3E G;  4O1N A;  4A3K B;  3I4N H;  2GA4 B;  1IBL Q;  5FKA C;  4Q0F A;  3MXN B;  3FKI G;  2LXK A;  4BY7 B;  4BBR B;  2HHH L;  4P71 A;  5KRU A;  2VQF L;  1KIX A;  2K5N A;  4A3E B;  2KEE A;  2NZ1 D;  3B6Y A;  1S72 A;  1EYD A;  4KKU A;  4GNX A;  4H02 A;  4GLV B;  2FMC A;  5TSS A;  4CJ0 B;  3FKI B;  4C3H G;  3M4P A;  1LTG D;  2VNU D;  2EYF A;  5G3L F;  3TS0 A;  3HKZ G;  3CCQ A;  1HNZ L;  1STH A;  1XPU A;  1O80 A;  1TWG B;  4R8N A;  4MIU A;  4DKA C;  3SR1 A;  1TS2 A;  5EQ0 A;  4JI5 L;  1CZG A;  5CBE E;  4C3H B;  1HHV A;  4RGN A;  3HOX H;  4QQB X;  2A6E C;  4JV5 Q;  3F8T A;  3HKZ B;  2I0Q A;  1B53 A;  1YHA A;  4YCV A;  1K8A C;  3S16 H;  1X6O A;  5D65 A;  1W6K A;  2JJQ A;  2O5J C;  4X62 L;  2DGY A;  3KF6 B;  1DOK A;  1EUJ A;  4ZQ3 A;  3VDY A;  2PI2 A;  4QUC A;  2GN5 A;  3LNN A;  1YJ9 A;  1TWA H;  1EIG A;  2YU9 B;  3J7A 5;  5CR3 A;  4C1N K;  1SJH D;  1JOO A;  3M7G A;  5M5X B;  2CWP A;  2IWH A;  2B63 H;  4CGY B;  3PO3 G;  2ZXO A;  2RCF A;  2R7F A;  2I5H A;  1TR5 A;  1JB3 A;  3ULL A;  4UHV A;  3JAM L;  1JIC A;  1BBX C;  1STB A;  4DR1 L;  3RZD H;  4ZUJ A;  4JVZ A;  4CKB A;  3NWS A;  1QB5 D;  4RCN A;  2L11 A;  4AIM A;  4AQY L;  3NWT A;  1HUN A;  1SYE A;  2WB1 G;  4B3T Q;  3TP7 A;  1BUV T;  2RSO A;  5GQO A;  4JI7 Q;  1EY8 A;  3RNU A;  2B29 A;  3NEM A;  3EVQ A;  1PRT D;  4LFC L;  3G6E A;  3PO3 B;  4PV1 C;  3SK4 A;  2KCM A;  3S15 H;  3AFP A;  1IKL A;  2QW7 A;  4TQU S;  1JJC B;  3X3M A;  1NE3 A;  5KEE A;  4GOP B;  2X6L A;  2MQH A;  3RN5 A;  2WB1 B;  2OCE A;  1V1P B;  4KN4 C;  1PHJ A;  2R3Z A;  2Q8R E;  2JA6 H;  1TWF B;  4AH6 A;  2C5C A;  1YIJ A;  2E74 C;  3NEL A;  3NP8 A;  4KHZ A;  5C0X G;  1MJC A;  2Q2U A;  4ZUI A;  5HY6 A;  1H9S A;  4TRD A;  1GUT A;  1VQK A;  1ICW A;  4GN5 A;  1ESF A;  1KC8 C;  2KCN A;  3EQL C;  2F3V A;  5ELB A;  5AJ3 Q;  2D62 A;  3S1R H;  2LXJ A;  3D31 A;  2EYM A;  1M8A A;  3S1N B;  1Y1W G;  1I4X A;  3KUP A;  1G91 A;  2A68 D;  1T5E A;  4APV A;  1WD1 A;  2PMZ B;  3TSS A;  5E1F A;  2FFK B;  1CKO A;  1ML0 D;  2M9V A;  4LF7 L;  5IYC H;  3M85 A;  1Y1W B;  4MN3 A;  2UUA L;  2VB3 X;  2X6G A;  1K83 H;  4PNY A;  1BNZ A;  3HG9 A;  4DR6 L;  3IL8 A;  2VQF Q;  4KJN A;  3I4M H;  1CHQ D;  3BZC A;  2KEC A;  3P1H A;  2BE5 C;  4C2M H;  5E4X A;  4DK3 C;  2JA8 G;  1QNU A;  5ISR A;  5KND A;  4YCU A;  1AH9 A;  1A6X A;  2QDB A;  1TXY A;  2WAC A;  3NQI A;  2K5W A;  3I7F A;  2E2D C;  4IFD G;  4ALP A;  1U4M A;  5CV6 A;  2JA8 B;  4JI0 L;  4JI5 Q;  4YY3 L;  5LMU Q;  1FD7 D;  5G3L D;  3KDF A;  3W1G A;  1S40 A;  1V43 A;  2E2J H;  3T53 B;  2CW0 D;  2XWJ B;  3T4A C;  2NVX B;  1PH7 A;  4G57 A;  3MAQ A;  4X62 Q;  1HTP A;  1FGU A;  2KHJ A;  4LFB Q;  4A3L H;  1GUG A;  1SNO A;  1PH1 A;  1TWC B;  3KF8 A;  5I9P A;  2ZTD A;  1N32 L;  4TKO B;  4LK1 C;  4ODG A;  1FNV A;  1KDC A;  2P5Z X;  1VS0 A;  3BZD B;  1CFM A;  3GD7 A;  2R7Z G;  5M3F G;  3S1M H;  2VY3 A;  4H13 C;  2K04 A;  4X64 L;  1OTC A;  3K0X A;  4EQO A;  1L1O A;  2R93 G;  4PZ7 A;  4ZYS A;  3SEB A;  3S2H B;  2MO1 A;  3MC0 B;  1J5E L;  1PYW D;  4QF4 A;  5JVH 3;  2UUB Q;  1BR9 A;  4DV3 L;  2HDL A;  2K14 A;  4GLA C;  2K52 A;  3GTJ B;  3QOJ A;  2MUY A;  2PNR C;  4PG3 A;  5M3F B;  2R7Z B;  4A3I H;  1JOR A;  4N9T A;  4DUZ L;  2VQE L;  3IAY A;  1KXL A;  2R93 B;  1BCP F;  1A2U A;  5HGQ A;  2KHS A;  2A69 C;  3HKZ E;  4V0B A;  2QGQ A;  2B2U A;  4DV1 L;  2Q2H A;  2B2Y A;  1PYS B;  1WTH A;  1QVF A;  1EQT A;  4HJ7 A;  2BDN A;  2F0L A;  2F0M A;  5I2Y A;  3Q23 A;  1LAC A;  2EY5 A;  1K3B C;  4JOI A;  2Z6B A;  1VQJ A;  4K8J A;  1PV4 A;  2KUM A;  4UAI A;  2DNC A;  2NZH A;  3S2D B;  5FO8 B;  1IYV A;  4DR2 Q;  1S5B D;  5EKK A;  2MPM A;  5CGK A;  2CH4 A;  1GOZ A;  4A3K H;  3SK5 A;  3CPF A;  3GTQ H;  1PRT C;  2JE6 I;  2ZJP A;  1U5K A;  3I4N G;  1Q81 C;  2RBM A;  3DUZ A;  4OWX B;  2MNA A;  4DNR B;  1TS5 A;  4M8A A;  5D3D A;  1AEX A;  3DXJ C;  4LF7 Q;  3OTO L;  3IFT A;  1GHJ A;  1M90 C;  3D4W A;  4KHP Q;  4J8Q A;  3C1F A;  2WB1 E;  3MFY A;  1T5X D;  4B9W A;  4X65 L;  1QE6 A;  4DR6 Q;  2N8N A;  3I4N B;  1YEZ A;  4BBS H;  5LMN L;  3S1Q H;  4HJ8 A;  3FKI H;  1VQD A;  1JR0 D;  2EY2 A;  1AE2 A;  1UWV A;  1WVL A;  4IOA A;  1C8C A;  1SNQ A;  2L9H A;  3TBI B;  1PFN A;  3F2D A;  2J0T D;  1YHB A;  4ZCK A;  3OSO A;  4A3J H;  2J7Z A;  4FDB A;  2Z1C A;  1EY0 A;  2OF1 A;  1O7Y A;  1PH3 A;  4HIM A;  1ZXT A;  1G8Z D;  4A75 A;  4DAP A;  1A8V A;  3ERQ A;  4DNI A;  1G6P A;  5C0X I;  5E7N A;  1NY4 A;  1CA6 A;  1Q82 C;  3GTG H;  2PMZ E;  3HOX G;  4KLK A;  1H9S B;  1ASZ A;  2BOS A;  3M4Q A;  5BN3 A;  1BXT A;  4IZ8 A;  3MEH A;  4K2K A;  1CQV A;  2JN4 A;  4IAL A;  3J80 L;  1VQB A;  3AYH B;  5H1S E;  5C5M A;  3T1H L;  1Q1B A;  2IX3 A;  3G6J B;  5C6A A;  2E76 C;  4B3M L;  4L63 B;  4RG1 A;  1E7Z A;  4L5T A;  3HOX B;  1W6J A;  3ITP A;  4NKL A;  3CPW A;  5E3F A;  3J80 i;  2K4K A;  3S16 B;  1KAW A;  1N32 Q;  4KY5 A;  4XT1 B;  1TS4 A;  2A74 C;  2JYO A;  5EJW A;  1PMR A;  4DV0 Q;  1TWA B;  2CFM A;  2F0I A;  1PH6 A;  4LNQ A;  2E2I B;  2JQO A;  5IT9 E;  4JC0 A;  4ZKB B;  3ONA B;  2ZJR A;  1J5E Q;  1SYB A;  1VQE A;  4NXM L;  4EVO A;  4GN3 B;  1RL2 A;  1PZI D;  3SK8 A;  2ZXP A;  2E75 C;  3RZD B;  3D4R A;  4JW0 A;  4DUZ Q;  2AMC B;  2CW0 C;  1CHP D;  1I4P A;  3J7A V;  2D5D A;  1Y8N B;  2DJF C;  2JA6 G;  4DPG A;  4XQJ A;  2F0S A;  4DV1 Q;  2L55 A;  4EQN A;  1LAB A;  1STY A;  4JI6 Q;  1SXT A;  3S15 B;  3CME A;  1BCP D;  1VQP A;  3FVQ A;  1IL2 A;  2N3S A;  3LX0 A;  4KN7 C;  2HD3 A;  2BA1 A;  2DY8 A;  1VQ6 A;  1HR0 Q;  4DR5 L;  3KDF B;  1QIL A;  1KD1 C;  2JA6 B;  4OHJ A;  1A3V A;  1UE1 A;  1PFS A;  5EKI A;  1MBY A;  4NXN L;  1IBM L;  1JOQ A;  5ELO A;  1VQA A;  3H3V H;  3MXP A;  3H15 A;  3HOY H;  1XYI A;  4IJH A;  2B2W A;  3A8I E;  4LF6 L;  3VR2 A;  2SNM A;  2IPK D;  1K8G A;  1JWS D;  4IUQ A;  1RD9 D;  4P75 A;  1C9O A;  3S1R B;  3KF8 B;  4ULL A;  1SSO A;  2DNE A;  4BS9 A;  2HT1 A;  4DXG A;  1IBL L;  3K57 A;  4QB4 A;  4DXF A;  3M3Y H;  3NBH A;  2PPB C;  4X65 Q;  3I4M G;  4HED A;  1WOC A;  2BCO A;  4B3S Q;  4S3S A;  1FNU A;  5LMN Q;  4X6A H;  3OYY A;  1ET6 A;  5CBA E;  3EFX D;  2IHE A;  3K80 C;  5FK9 C;  3KLW A;  4N9P A;  1K83 B;  3I4O A;  4LF5 Q;  5A35 A;  2AHO B;  5KNC A;  2B2T A;  1XNR L;  1IW7 D;  3HKS A;  4X3K A;  1QZH A;  3I4M B;  4GOP A;  1F2Y A;  1OO9 B;  1EEI D;  3HOV H;  4C2M B;  1WTP A;  2D0O A;  3K8A A;  2OWO A;  2CKZ B;  2Z4I A;  3BDC A;  4LUV A;  2QDL A;  5C3X A;  2PI2 E;  1GD7 A;  1C0A A;  3VR4 A;  3ULJ A;  2AUJ D;  5IE8 A;  4LUZ A;  2F0D A;  3M4Y A;  1CTM A;  2VS1 A;  4KK7 A;  1SEB D;  2K5Q A;  4U68 A;  1MGS A;  4JV5 L;  5NUC A;  3E0J A;  4A3L G;  2K01 A;  4TSS A;  1UNS A;  2QA4 A;  3T1H Q;  5C4J H;  4B3M Q;  2E2J B;  1F2M A;  5I6W A;  1N36 L;  1N34 L;  1PVO A;  4AYB E;  1VQG A;  1HA5 A;  3STB D;  4ME3 A;  5EPJ A;  1KDA A;  2KBN A;  2RF4 A;  3CXC A;  1PTO F;  2LSS A;  1YNJ D;  1I4G A;  5JOB A;  1U4L A;  5IOC A;  1C4Q A;  3QIA A;  4A93 H;  1GJX A;  1TY0 A;  3I70 A;  4X3T A;  3Q22 A;  2EPB A;  2R7Z H;  1XMO Q;  1DXM A;  2XRS D;  3KLR A;  3S1M B;  4FP5 D;  3SGI A;  4B3T L;  4GLX A;  4A3I G;  4JI7 L;  1OXX K;  2QCP X;  5COR A;  1K3R A;  5GAD C;  3MWY W;  4RAU C;  2OXP A;  1N8R C;  2PCF B;  2VB2 X;  3S14 H;  4K8I A;  1STE A;  1TWH H;  2FMM A;  1L0X B;  2K33 A;  4X3S A;  1GUN A;  4NW2 A;  3MEF A;  3P20 A;  4IPD A;  1DGS A;  2M2L A;  3M9B A;  1I6H H;  1SBB B;  3ND8 A;  4A3I B;  2F0T A;  3IRB A;  1K0R A;  1SE3 A;  4UDU C;  1WTX A;  4RKB A;  1HZ9 A;  3NXW A;  3PF5 A;  5IIF A;  3DMU A;  3A5Z B;  3BDL A;  4DR5 Q;  1ILQ A;  1B3A A;  1IXR A;  2WII B;  2WAQ G;  1JWM D;  2B2V A;  3PUW A;  2I5M X;  4NXN Q;  1A63 A;  1D1I A;  4MTN A;  1IBM Q;  1TII D;  5AJ3 L;  1EQQ A;  2HQL A;  3I56 A;  1CA5 A;  1I5F A;  3NE5 B;  1HCZ A;  4OEL B;  4X66 Q;  4OO1 H;  4LF6 Q;  3GTP B;  2LS0 1;  2ATW A;  1D5M C;  2L0C A;  1QWY A;  3T1Y L;  4LUO A;  1WTQ A;  2YV5 A;  4FXG C;  4CDD C;  5IOD A;  3R3O A;  2MFI A;  2WAQ B;  1S4Z A;  5KGU A;  1X3Q A;  1M1K C;  4QCL A;  2X69 A;  5IGE A;  4K2L A;  3KLS A;  3GTQ B;  2WP8 J;  2DY7 A;  2GVB A;  4A3D H;  1VCI A;  3PUX A;  2L1B A;  4MTK A;  4BBS G;  3OIP A;  1LT6 D;  4GKK L;  1BCP C;  4A3C H;  4P72 A;  3JC6 6;  1ICF B;  3PUV A;  3TZD A;  1I3Q H;  4A3J G;  1Y1V H;  1QVC A;  3DM3 A;  2AKW B;  4X3U A;  1XNR Q;  4BBS B;  2CQO A;  3S1Q B;  4JK1 C;  3FPP A;  5C3E H;  3PIO A;  5J22 A;  4DUY Q;  4LMQ D;  5LL6 S;  1K9M C;  2RDG A;  3U4V A;  2CWA A;  5KYI A;  4IUT A;  3BJU A;  5K36 H;  1STA A;  3NPP A;  2EXZ A;  1JWU D;  1NBW A;  4A3J B;  2IL8 A;  5LMU L;  1T9H A;  4DR4 Q;  1I50 B;  1S3O A;  3PSI A;  2MO0 A;  3TN2 A;  5IGD A;  2CQA A;  1CZW A;  5GAH C;  4RA8 A;  3HOZ H;  1EYC A;  4P2C B;  5CV5 A;  3GTG B;  4A4I A;  3J81 E;  3PO2 H;  2C9O A;  3MVV A;  2I46 A;  1NR2 A;  5JAV A;  2NYZ D;  3QR8 A;  4LFB L;  1E0B A;  3GV6 A;  4E6I A;  2A8V A;  2NN6 I;  2F0F A;  4MNO A;  1WTV A;  5JPM C;  1N36 Q;  1N34 Q;  2WKC A;  4JG2 A;  1H9R A;  4ZAI A;  4BY1 H;  2E2I H;  1D6E C;  4CKE A;  1IW7 C;  1EZ8 A;  3P7J A;  1VDZ A;  2SDF A;  2AWN A;  3EA6 A;  2O2L D;  1CK1 A;  3NBH B;  2R92 H;  1WD0 A;  3A5U A;  4XIG S;  2VZA A;  1RJT A;  3A8K E;  1PTO D;  1OXS C;  4HR7 B;  4G4K A;  4RCO A;  1BF4 A;  3MXU A;  2NWG A;  3JAM i;  2UUB L;  1RHP A;  1HFG A;  1S5C D;  3PCO B;  1V1O A;  3ND9 A;  4A3B H;  1N33 Q;  4ZKC B;  5CYU A;  2VW9 A;  1X3F A;  2FIN B;  2F0K A;  1KLG D;  2F4V L;  4A3M H;  3TZU A;  2L15 A;  4I7Z C;  2R61 A;  1E2Z A;  3A7A B;  3STB C;  5AFW A;  5JVG 3;  3QB3 A;  1UUP A;  1SYF A;  2EJG C;  1Z9F A;  4HCS A;  1TVX A;  4KY6 A;  1YNJ C;  1ENC A;  1FNW A;  3KYH C;  4K6D A;  2F3I A;  2ID0 A;  3HOY G;  2BH8 A;  1GXD C;  3K5N A;  3BVZ A;  4DR2 L;  3ER0 A;  3FDT A;  3QWN A;  2ZTE A;  2WKD A;  4UP7 A;  1LV9 A;  3T1Y Q;  2UXB L;  1EWI A;  1E22 A;  3A7L A;  1IHZ A;  3HOY B;  2B8F A;  2JK8 A;  4C1N I;  4LF9 L;  4L8J A;  1DOL A;  2DUD A;  3NSW A;  4QIW E;  3GTL H;  5CMD A;  1BO0 A;  5J1Z A;  1E2W A;  4RGT A;  3ZYY X;  4KHP L;  1AZP A;  1B1Z A;  2RCN A;  3T13 A;  2IX0 A;  4GKK Q;  3KJO A;  3CCV A;  1VQI A;  3EN2 A;  5I9O A;  4YIJ A;  1J6Q A;  4BWG B;  4Z9C B;  5FLX c;  1QVG A;  4LW1 A;  3M3Y B;  1U4R A;  1HZB A;  2PZT A;  1DM0 B;  2L5T A;  3PGZ A;  3K6O A;  3SHL A;  2RHS B;  4B3R Q;  3HOV G;  4OON A;  2D0P A;  3I2Z A;  4JI4 L;  1HQM C;  3PMF A;  4IPG A;  1WTO A;  4YCW A;  1DYQ A;  1G2S A;  3OHX C;  5IGC A;  1PA6 A;  4XYO A;  4R9W A;  1Q46 A;  1CKM A;  2Z6K C;  1YNN D;  4IPC A;  3X3N A;  5C4X G;  1PDQ A;  1XNQ L;  1QZG A;  1VQ7 A;  4JBW A;  2EJM A;  3OWF A;  3HOV B;  2WAQ E;  2TMP A;  1B44 D;  2F1M A;  1KAA A;  5IP9 H;  4N8F A;  4DR3 Q;  2NTS A;  2Q2I A;  5C4X B;  1FJG Q;  4RFB A;  3E3X A;  4R4T A;  1R9T H;  3D3R A;  4K6L A;  3I4L A;  2KHI A;  5C4Z A;  1E1O A;  1UE7 A;  4UP9 A;  2GVA A;  1B9M A;  4IO9 A;  1Q12 A;  5M5Y H;  4JCV E;  1VQ4 A;  1ET9 A;  5C4H A;  4A93 G;  2MP1 A;  1LTS D;  1WTW A;  1Q1E A;  5C4J B;  4HIO A;  2PQA A;  4RHR A;  4DV0 L;  1B7Y B;  3D6C A;  2YTX A;  1HQR D;  3J7A F;  2K03 A;  2XRQ D;  1EOT A;  2K7V A;  1HUM A;  1STN A;  2BA0 A;  3GTM B;  2N88 A;  4LJZ C;  1UAP A;  3V05 A;  1PH9 A;  3L9A X;  5CV4 A;  4HCE A;  4NDX A;  5BN4 A;  3D6W A;  4XXE A;  4A93 B;  1L1O C;  1HNW Q;  1EY5 A;  1B8A A;  3EBE A;  2SNS A;  5ELC A;  4HID A;  3TP8 A;  3DWQ A;  1A15 A;  2K1B A;  1AW7 A;  1KRS A;  3TS2 A;  5FOB B;  1G29 1;  1TKW B;  4Y7N H;  2F4V Q;  2LY7 A;  5COY A;  2JP1 A;  4XYQ A;  3S14 B; 
#chains in the Genus database with same CATH homology
 4JI6 L;  4L5Q A;  4DV1 Q;  4PZ8 A;  4QY7 A;  1D7Q A;  3UE1 A;  4K0K Q;  2JEB I;  5EAY A;  2ZTC A;  2ASB A;  1LTL A;  4JI6 Q;  2EXD A;  4YWK A;  3CME A;  1VQP A;  1HR0 L;  1GM5 A;  3J81 i;  1IL2 A;  5JJI A;  4R4C A;  1UEB A;  2N3S A;  5J3B A;  3GTP H;  1CSP A;  3S2D H;  2BA1 A;  1VQ6 A;  1HR0 Q;  3K7A H;  4DR5 L;  2K75 A;  4OO1 G;  3KDF B;  1YJW A;  1V9P A;  3M7N A;  1KD1 C;  1UE1 A;  1PFS A;  3RLO A;  4J15 A;  4NXN L;  4LF4 L;  1IBM L;  3TRZ A;  4JI1 L;  3L2P A;  1XTD A;  1HZC A;  3A0J A;  5ELO A;  1VQA A;  4P74 A;  3H3V H;  3KFU A;  1KRT A;  3RLF A;  3H15 A;  2QEX A;  4DV2 L;  4JI3 L;  3PIP A;  2E5L L;  4JI1 Q;  2ES2 A;  4IJH A;  1IYJ B;  4LF6 L;  4QGU A;  4A3K G;  1SE8 A;  1YI2 A;  2UXB Q;  1SR3 A;  3PUZ A;  2UXD L;  3GTK H;  1K8G A;  4DV2 Q;  2E5L Q;  4JI3 Q;  4LF9 Q;  3W1B A;  4A3D G;  4P75 A;  1C9O A;  1XPO A;  1KL9 A;  5IP7 G;  3KF8 B;  1YJN A;  2NVY H;  4IOC A;  3AFQ A;  2EQS A;  4DV5 L;  4BY7 G;  4BBR G;  4A3C G;  1E3P A;  2VL6 A;  5FLM H;  1XMQ Q;  3J81 j;  2HT1 A;  5M5W H;  1IBL L;  4C3J H;  2ALY B;  1GO3 E;  2ZM6 L;  4DV6 L;  4A3E G;  3M3Y H;  3I4N H;  4UY8 C;  1HJP A;  4B3S L;  1IBL Q;  3JAM c;  2CCZ A;  1FVI A;  1X56 A;  2H5X A;  4X65 Q;  5C44 G;  2ZM6 Q;  3CMA A;  1Y1V G;  2VUM H;  3I4M G;  1PH5 A;  1WOC A;  4DV6 Q;  4MZ9 A;  4B3S Q;  1BVS A;  3MXN B;  5LMN Q;  1WYD A;  5C3E G;  3OYY A;  3FKI G;  2XTI A;  2LXK A;  3G4S A;  2IHE A;  4DV7 Q;  3K80 C;  2HHH L;  4P71 A;  3CCE A;  3KLW A;  3BU2 A;  4KI0 A;  3I4O A;  4QJF A;  2VQF L;  1KIX A;  4JI4 Q;  4LF5 Q;  2AHO B;  2K5N A;  2HHH Q;  4A3F H;  5GRO A;  1O7I A;  1XNR L;  5K36 G;  3HKS A;  3U50 C;  2UXC L;  1YZ6 A;  3B6Y A;  1S72 A;  1QZH A;  1I50 H;  1UE5 A;  4P73 A;  4GOP A;  2EIF A;  3HOV H;  4GNX A;  3CC4 A;  4BXX G;  4H02 A;  1B70 B;  2D0O A;  4GLV B;  1Y14 B;  4GKJ L;  3K8A A;  1XNQ Q;  1XJV A;  2CKZ B;  1ASY A;  2OWO A;  2UXC Q;  3M4P A;  2Z6K A;  2VNU D;  2Q2T A;  1EOV A;  4LUV A;  3CCU A;  3HOZ G;  4GKJ Q;  3RR5 A;  3HKZ G;  2PI2 E;  3A74 A;  2Z0S A;  3CCQ A;  1NMF A;  3TS0 A;  1HR0 W;  4JI2 L;  1GD7 A;  1HNZ L;  1XPU A;  3H3V I;  3PO2 G;  3RLN A;  3ULJ A;  1C0A A;  4Y52 H;  5IE8 A;  1YNX A;  4DR7 L;  4DKA C;  1EFW A;  3FHW A;  4LUZ A;  4JI2 Q;  1SN8 A;  1SFO H;  1NMG A;  1HNZ Q;  4JI5 L;  2VS1 A;  1H95 A;  3CCL A;  4HJ5 A;  4JV5 L;  1Q7Y C;  4BY1 G;  1OXU A;  3S17 H;  4A3L G;  3CCJ A;  3HOX H;  3UDX A;  2QA4 A;  1PH8 A;  4JV5 Q;  4QQB X;  3F8T A;  2I0Q A;  3T1H Q;  1VQL A;  4YCV A;  1YHA A;  5C4J H;  1K8A C;  3S16 H;  4B3M Q;  1X6O A;  2A1A A;  2JJQ A;  4X62 L;  2DGY A;  3KF6 B;  1N34 L;  1N36 L;  1X3G A;  3E9H A;  3DLL A;  4AYB E;  1PVO A;  4GS3 A;  1VQG A;  1EUJ A;  3STB D;  4ME3 A;  1EYG A;  2R92 G;  2AWO A;  1LUZ A;  3VDY A;  2PI2 A;  2GN5 A;  2KBN A;  1PYB A;  2RF4 A;  1TWA H;  3KJP A;  3CXC A;  3UDG A;  4HJA A;  1YJ9 A;  3K7U C;  3AEV A;  3J7A 5;  4O0A A;  5IYB H;  5BR8 L;  2LSS A;  2NZO A;  5IYD H;  5M3M H;  3U4Z A;  2CWP A;  1XMO L;  1MJE A;  2IT1 A;  4A93 H;  2B63 H;  3M4O H;  1XPR A;  1JMC A;  3PO3 G;  4DK6 C;  2R7Z H;  2R7F A;  3CCS A;  2I5H A;  2XGT A;  3H0G H;  4A3G G;  4A3B G;  1XMO Q;  3ULL A;  5LMN W;  3HOW G;  3SGI A;  1X9N A;  4B3T L;  4GLX A;  1A0I A;  4A3I G;  4JI7 L;  4DR1 L;  3ZJY C;  3RZD H;  3S24 A;  1OXX K;  3TRE A;  4AIM A;  4AQY L;  2OQ0 A;  1K3R A;  2WB1 G;  1VQC A;  5GAD C;  3CC2 A;  5GQO A;  4B3T Q;  4DR1 Q;  4A3M G;  4JI7 Q;  3RNU A;  2B29 A;  3NEM A;  4A76 A;  4AQY Q;  1N8R C;  3S14 H;  1CKN B;  4LFC L;  1TWH H;  2V1C C;  3G6E A;  1IBK L;  4IFD I;  2KCM A;  4IPH A;  3MEF A;  4IPD A;  1DGS A;  3S15 H;  3AFP A;  4LFC Q;  1I6H H;  3M9B A;  1IBK Q;  4TQU S;  1JJC B;  1NE3 A;  3IRB A;  1K0R A;  4UP8 A;  4OWT B;  4GOP B;  2Y0S G;  2MQH A;  3RN5 A;  4GNX B;  2OCE A;  3TEH B;  4JOI C;  3CW2 C;  1PHJ A;  4BA2 I;  1V1Q A;  1HZ9 A;  1X65 A;  3PF5 A;  4AH6 A;  2JA6 H;  1YIJ A;  1PH2 A;  1HH2 P;  3A5Z B;  2F52 A;  2N49 A;  3CP0 A;  5FJ8 G;  3NEL A;  4DR5 Q;  5C0X G;  4KHZ A;  1IXR A;  1MJC A;  2Q2U A;  2WAQ G;  5HY6 A;  4L5S A;  3U58 A;  2UUC L;  4HJ9 A;  5JJL A;  3PUW A;  2I5M X;  4NXN Q;  4X66 L;  4LF4 Q;  1A63 A;  4MTN A;  1IBM Q;  1VQK A;  3HOU G;  1SMX A;  5AJ3 L;  1EQQ A;  2HQL A;  4GN5 A;  3I56 A;  1I5F A;  2UUC Q;  3G48 A;  3EIV A;  3ERS X;  2KCT A;  5IWA L;  4X66 Q;  1KC8 C;  3RZO H;  1D8L A;  4OXP A;  5AJ3 Q;  4LF6 Q;  2D62 A;  3S1R H;  1MIU A;  1WI5 A;  2ATW A;  2UXD Q;  2LXJ A;  4R4Q A;  2R7D A;  3D31 A;  2E8G A;  3T1Y L;  4LUO A;  3CCM A;  2YV5 A;  1Y1W G;  3E0E A;  1KQS A;  4GN4 B;  4APV A;  3RN2 A;  2MFI A;  2PQA B;  1PH4 A;  1EIY B;  4HIK A;  1Z47 A;  4DV5 Q;  1C7Y A;  1UE6 A;  1K73 C;  1M1K C;  1VQN A;  2JA9 A;  5C0X J;  2OTJ A;  2BH2 A;  4JBM A;  2WP8 J;  2GVB A;  1CKO A;  1YVC A;  4A3D H;  1VCI A;  3PUX A;  4YHH L;  4BBS G;  4JYA L;  1QUQ A;  4LF7 L;  4GKK L;  1HNX L;  1P16 A;  2HIX A;  4AYB G;  3FP9 A;  3JC6 6;  4P72 A;  4BBR H;  5IYC H;  3M85 A;  4BY7 H;  4A3C H;  2PNH A;  4JYA Q;  2UUA L;  4L5R C;  1K83 H;  3PUV A;  1HNX Q;  4YWM A;  1W2B A;  1YBY A;  4DR6 L;  3CF5 A;  4A3E H;  2UUA Q;  1I3Q H;  3CAM A;  2JA5 G;  3PF4 A;  2VQF Q;  5JEA G;  4LWC A;  3I4M H;  4A3J G;  1Y1V H;  1QVC A;  3BZC A;  2AKW B;  3DM3 A;  1XNR Q;  4C2M H;  2CQO A;  4DUY L;  4DK3 C;  5C3E H;  2JA8 G;  3PIO A;  5JJK A;  4YCU A;  4X6A H;  3UDF A;  1AH9 A;  4DUY Q;  3TQY A;  1TXY A;  1K9M C;  3U4V A;  3J81 c;  2CWA A;  1TWG H;  3I7F A;  5IP9 G;  3BJU A;  5C4X H;  4DR4 L;  1NBW A;  4IFD G;  1X55 A;  4ALP A;  3E9I A;  3CCR A;  5LMU L;  4BXX H;  4OO1 I;  2K5V A;  4DR7 Q;  1T9H A;  4DR4 Q;  1S3O A;  3PSI A;  2MO0 A;  3AQQ A;  5JEA J;  4C3H H;  1L0W A;  4JI0 L;  4JI5 Q;  4LF5 L;  4O2D A;  4YY3 L;  5GAH C;  5LMU Q;  1VQO A;  3BZK A;  3HOZ H;  3KDF A;  3W5O A;  1MKH A;  1N9W A;  3W1G A;  4NPS A;  4A4I A;  2JA7 H;  1S40 A;  3PO2 H;  4JI0 Q;  4YY3 Q;  1V43 A;  1JT8 A;  2E2J H;  3GO5 A;  4TVA B;  4LFB L;  1PH7 A;  2A8V A;  1SLJ A;  1X3E A;  1WCM G;  2NN6 I;  2YTY A;  4MNO A;  3GTM H;  2YU9 H;  4X62 Q;  1N36 Q;  1FGU A;  1U0L A;  1N34 Q;  1AE3 A;  4JG2 A;  4RMF A;  4WJ4 A;  2KHJ A;  2E2I H;  4BY1 H;  3D0F A;  2NVT H;  4LFB Q;  4IFD J;  4A3L H;  1PH1 A;  3UE0 A;  5M5X H;  5IY0 A;  4DAM A;  4NB3 A;  5BR8 Q;  3Q8D A;  2ZTD A;  1N32 L;  2AWN A;  5DLQ E;  2B63 G;  3K81 C;  1VS0 A;  3KOJ A;  3GD7 A;  2R7Z G;  3S1M H;  3NBH B;  3PUY A;  5M3F G;  3H0G G;  2FXQ A;  4POG A;  2R92 H;  3A5U A;  2VY3 A;  3ICE A;  4EX5 A;  4XIG S;  2VZA A;  1JE5 A;  1CUK A;  4X64 L;  1OTC A;  3K0X A;  3PV0 A;  2R93 G;  1L1O A;  4PZ7 A;  1OXS C;  4IJL A;  2MO1 A;  4X64 Q;  2UUB L;  1N33 L;  2N78 A;  3JAM i;  1J5E L;  4YWL A;  3PO3 H;  3OW2 A;  1EIF A;  3PCO B;  1W3S A;  1JJ2 A;  4A3G H;  1YIT A;  4A3B H;  2UUB Q;  1N33 Q;  4DV3 L;  2K14 A;  4GLA C;  4DV4 L;  2K52 A;  1NJI C;  4EQ5 A;  3HOW H;  4PG3 A;  3HOY H;  1A62 A;  3HFZ B;  2VW9 A;  4A3I H;  1RIP A;  4DUZ L;  2VQE L;  1VQF A;  1X3F A;  4DV3 Q;  1KXL A;  2F4V L;  2IY5 B;  4A3M H;  5HGQ A;  1IZ6 A;  2L15 A;  2VQE Q;  3HKZ E;  2QGQ A;  1TWF H;  3LGJ A;  4DV1 L;  2Q2H A;  3STB C;  4OWW B;  1PYS B;  3J7Z C;  1QVF A;  4HJ7 A;  1BBW A;  1Z9F A;  5GAG C;  4UPA A;  3CQZ H;  4JOI A;  3KYH C;  3L0O A;  1OXV A;  3I55 A;  1WJJ A;  2F3I A;  1BKB A;  1VQJ A;  2ID0 A;  1PV4 A;  3HOY G;  2BH8 A;  2IX1 A;  1BBU A;  1P8L A;  4DR2 L;  1CSQ A;  3ER0 A;  2NZH A;  3GTO H;  3UDI A;  3J80 c;  3S1N H;  5IWA Q;  4LFA L;  3GDE A;  5FJ8 H;  4DR2 Q;  2ZTE A;  4XTC S;  4PMW A;  4BA1 I;  3CC7 A;  4UP7 A;  1YHQ A;  3T1Y Q;  5FLM G;  4LFA Q;  3HOU H;  2UXB L;  1EWI A;  1E22 A;  1OXT A;  2UU9 L;  4A3K H;  3CPF A;  3GTQ H;  2JK8 A;  2JE6 I;  1VQH A;  3KF6 A;  4QL5 A;  2ZJP A;  1U5K A;  1VQ5 A;  4LF9 L;  3I4N G;  2DUD A;  1Q81 C;  1E24 A;  2UU9 Q;  4QIW E;  4OWX B;  5IP7 H;  3GTL H;  2MNA A;  2NN6 G;  2VUM G;  4JI8 L;  1NTG A;  1Y1W H;  1XMQ L;  2KEN A;  4R4I A;  4KHP L;  4YHH Q;  1VQM A;  2RCN A;  5IYC G;  4LF7 Q;  2IX0 A;  4GKK Q;  4JBJ A;  4JI8 Q;  3KJO A;  3CCV A;  1VQI A;  3OTO L;  3EN2 A;  1Q8K A;  1M90 C;  1JB7 A;  1LM0 A;  4KHP Q;  1JJG A;  2WB1 E;  3ULP A;  4X65 L;  1J6Q A;  5FLX c;  1QVG A;  5C44 H;  4LW1 A;  3OTO Q;  4A3F G;  2N8N A;  2YYZ A;  4DR6 Q;  4B3R L;  1L1O B;  1WFQ A;  1YEZ A;  3NEN A;  1HZB A;  4BBS H;  4R1J A;  2I5L X;  5LMN L;  4DV7 L;  3S1Q H;  3PGZ A;  1EQR A;  2YTV A;  4C3I H;  4HJ8 A;  3FKI H;  1I94 L;  2RHS B;  4B3R Q;  1VQD A;  4OON A;  3WWV A;  1VQ9 A;  2A19 A;  2D0P A;  3F1Z A;  3I2Z A;  1AE2 A;  3HOV G;  1Q86 C;  4JI4 L;  1UWV A;  4GOP C;  4IOA A;  4IPG A;  4YCW A;  2E2H H;  1I94 Q;  1CKN A;  4GNX C;  2Y0S E;  1SRO A;  3F2D A;  1PA6 A;  2JA5 H;  1YHB A;  1Q46 A;  1CKM A;  2Z6K C;  5ELN A;  4A3J H;  4FDB A;  2K50 A;  4IPC A;  5C4X G;  1LYL A;  1L2F A;  1PH3 A;  4HIM A;  1XNQ L;  1QZG A;  1VQ7 A;  2HIV A;  4JBW A;  4A75 A;  4OX9 L;  2JA8 H;  1E1T A;  1A8V A;  2WAQ E;  4DNI A;  1G6P A;  2IHF A;  5C0X I;  5E7N A;  1NY4 A;  4DR3 L;  2C35 B;  1Q82 C;  2PMZ E;  3GTG H;  4OX9 Q;  2OTL A;  2OQK A;  3HOX G;  4KLK A;  5IP9 H;  1ASZ A;  1FJG L;  2JA7 G;  4DR3 Q;  2NVX H;  3M4Q A;  2Q2I A;  4DAY B;  1FJG Q;  4R4T A;  1R9T H;  1VQB A;  1KHI A;  3AYH B;  2KHI A;  5H1S E;  1E1O A;  1UE7 A;  4UP9 A;  2GVA A;  1Q1B A;  5IYB G;  3T1H L;  4IO9 A;  1TWC H;  1Q12 A;  5M5Y H;  5IYD G;  4B3M L;  2R6G A;  4JCV E;  4POF A;  4RG1 A;  5M3M G;  1E7Z A;  4L5T A;  5IT9 c;  1VQ4 A;  4A93 G;  3CD6 A;  3CPW A;  1Q1E A;  3J80 i;  2K4K A;  4HIO A;  1KAW A;  2PQA A;  1G51 A;  1N32 Q;  4DV0 L;  2JEA I;  1B7Y B;  1SRU A;  1WCM H;  2YTX A;  3F2B A;  4WJ3 M;  2BA0 A;  4DV0 Q;  2K5H A;  1QUQ B;  3S2H H;  1HZA A;  1PH9 A;  1HNW L;  2CFM A;  4JBK A;  1PH6 A;  4LNQ A;  2JQO A;  1FL0 A;  1GKH A;  4R4O A;  2ZJQ A;  4JC0 A;  1L1O C;  1HNW Q;  2ZJR A;  1B8A A;  3EBE A;  1J5E Q;  3GTJ H;  4HID A;  1X54 A;  2B3G A;  1VQE A;  3F2C A;  1VQ8 A;  5M3F H;  4NXM L;  4GN3 B;  1RL2 A;  4LF8 L;  2WFW A;  1GVP A;  4DV4 Q;  1KRS A;  2R93 H;  3TS2 A;  2NVQ H;  2RHQ B;  4NXM Q;  4LF8 Q;  1G29 1;  3L7Z C;  3G71 A;  4DUZ Q;  2AMC B;  5GAE C;  4Y7N H;  2F4V Q;  4PZ6 A;  4K0K L;  2JA6 G;  4DPG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...