3S2DH

Rna polymerase ii initiation complex with a 5-nt rna containing a 5br-u
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s2dH00
3AYHB 5IY0A 3CMEA 3KF8B 1X65A 2RHSB 1Q82C 1PH3A 2VZAA 4JI1L 4DR6L 3CCLA 4RG1A 2ZJRA 1AH9A 4A3IG 2JJQA 1I94Q 1GO3E 2JA8G 2AKWB 2VS1A 4L5TA 3F2BA 2BH8A 2ZM6L 5GQOA 5FLMH 4B3TL 1VQ6A 4LNQA 3CC7A 3GTQH 4JBJA 2HIVA 1CKOA 3GDEA 4MNOA 4R4IA 5JJIA 3J7A5 2VQFL 3M9BA 2F4VQ 3OTOL 1JMCA 3K7UC 5IYCG 1B7YB 1Q81C 4A3BG 2VQEQ 1HZBA 4QY7A 2D0PA 3E0EA 4GOPC 1KQSA 3PF4A 4RMFA 5M3FG 5IWAQ 1JJ2A 4NB3A 4B3RL 2AWOA 5LMNQ 1YJNA 1XTDA 3KDFB 3ICEA 1VQOA 3JAMi 3I4MH 1TWFH 1KXLA 1H95A 1IBKL 4POGA 4LFBL 1L2FA 1X3FA 1IXRA 5C0XI 2R7DA 4A3EG 1KHIA 4OONA 1EFWA 3CW2C 3M3YH 4R4OA 3J81i 1IBMQ 4A3KG 1VQHA 4DV2Q 1XNRL 4OXPA 5C0XJ 1QZHA 1HJPA 1X55A 3HKZE 3NENA 4DR2Q 1VQNA 1OXUA 1VQFA 3HOXG 3GO5A 4GNXA 1N33Q 3S1NH 4A3GH 4PZ7A 4A3JG 4JI6L 4A3BH 4LFCL 4DKAC 2E5LL 1NJIC 4OO1G 4JI8L 4APVA 5M3FH 2MO0A 4DR5Q 1X9NA 1QVFA 2R92H 3CP0A 4POFA 4BBSG 1I6HH 5FJ8G 2MFIA 5H1SE 1EQQA 3GTOH 1E22A 1P8LA 1DGSA 2OCEA 4OWTB 3PV0A 1V1QA 4GLVB 1K3RA 1GM5A 3VDYA 1HZCA 4L5QA 1K8AC 1V9PA 2Q2TA 3KFUA 5C3EG 4DV0Q 1MIUA 2ID0A 4X62L 3TS2A 2JA5G 5LMUQ 5IT9c 1VQLA 4GNXB 3TRZA 1SLJA 3S17H 3H3VI 4GN3B 1WCMH 3BZCA 2CFMA 4GLAC 4JI4L 3S2DH 1NMFA 3BZKA 3JC66 1ASZA 2BA0A 1VQGA 4OWWB 4JOIC 1K83H 1CSPA 1CKMA 1YITA 1N34L 2ZJQA 4K0KQ 1VQIA 4KLKA 3CCSA 4A3DH 4AYBE 5IYDH 1HNXL 2AWNA 3UDFA 5FJ8H 3S16H 4UP8A 1VQAA 4JI2L 1L0WA 4C3HH 3STBC 4A3LH 4BY1G 3I55A 1HNZL 2OWOA 1L1OA 2ZTDA 3D0FA 3CPWA 1X56A 4R1JA 3UDXA 2UXCL 1I3QH 4AH6A 1N8RC 1M1KC 5AJ3L 2VUMG 4LWCA 3PIPA 3H0GH 5C44H 4AQYL 4DV3L 1QUQA 3PIOA 1WI5A 1Q86C 1N32Q 2Q2HA 1AE3A 4B3SQ 2DUDA 3PGZA 4P71A 3A0JA 1PH8A 1XMOQ 4LF8L 2ALYB 1HNWQ 4DV4Q 4A93G 1C7YA 3RZDH 1PYBA 3AEVA 2UXDL 2YV5A 1TXYA 2JE6I 2UXBL 3CAMA 4P73A 1YI2A 3H15A 2PNHA 1J6QA 1J5EL 3S14H 3CQZH 4AYBG 3T1YQ 5FLMG 2ES2A 2V1CC 3ULJA 1YHQA 4X64L 3T1HL 3HOYH 4IFDJ 3GD7A 4HIKA 4DV7Q 1XMQL 3TS0A 1EOVA 1BVSA 1FGUA 3S1RH 4A3CH 1G51A 4DV6Q 4YWMA 1OXXK 1UE7A 3GTMH 1VQ7A 4DR7Q 4WJ3M 4PG3A 3F1ZA 2NZHA 4P74A 2I5LX 3PUVA 2PQAB 4DUZL 1VQ5A 4C3JH 4HJ8A 4B3ML 4A93H 3BU2A 3EBEA 2MNAA 2VNUD 4DR1Q 2QA4A 1PV4A 1RL2A 4LFAL 3E9IA 2KENA 4JI7L 1E7ZA 3KLWA 2NVQH 3I4MG 1BBUA 3UE0A 4JV5Q 1YNXA 1Q12A 4ME3A 3RN2A 2NZOA 2PI2A 2QGQA 1A0IA 3L7ZC 2F52A 1LUZA 1WFQA 3AFQA 3KDFA 4YWLA 2N3SA 4WJ4A 1FJGQ 1CKNB 3CPFA 4ALPA 4HJ7A 3HOVH 1OXTA 4OX9L 1JE5A 2VY3A 1GKHA 4IPDA 2UUBQ 1IBLL 2I5MX 1PVOA 1HR0L 4A3GG 1IZ6A 2Q2UA 4DR3L 4JI1Q 1D7QA 4DR6Q 3KOJA 1XNQL 2JA7H 4LF6L 1EIFA 3M7NA 1V43A 2D62A 1VQBA 1B70B 3AFPA 1KD1C 1OTCA 2IX1A 2R92G 2ZM6Q 4Y7NH 3S2HH 1AE2A 1T9HA 3J80c 2QEXA 4B3TQ 4DPGA 3I7FA 5GAGC 4LF7L 2Z6KC 3ZJYC 1PH1A 2LSSA 2WFWA 1A62A 2VQFQ 4XTCS 3I56A 1E1OA 1W2BA 4GKKL 2R93G 5GROA 3OTOQ 1EWIA 3NBHB 4UPAA 5IP9H 4DNIA 1VQKA 4YCVA 1KL9A 1UWVA 1WCMG 4QL5A 1VQEA 2A1AA 4AIMA 4LF5L 1C9OA 3TEHB 2B29A 3GTPH 2DGYA 3CCEA 5IYBH 1ASYA 2Q2IA 2I0QA 4B3RQ 3K8AA 3CD6A 4JCVE 1XPOA 4P75A 1QZGA 4JI3L 1CSQA 1KAWA 4JYAL 2OTJA 4A3DG 1NE3A 3PUXA 4PZ8A 1TWCH 5JJLA 5IYDG 1X3EA 1IBKQ 2HT1A 3U4ZA 1YVCA 2YU9H 2E2IH 4DR4L 1YJWA 1KIXA 4LFBQ 3OW2A 2JQOA 4O0AA 2NN6G 3EIVA 1SR3A 4DV1L 4A4IA 4JBKA 4YHHL 5JEAG 2JA6H 1NMGA 2E2HH 5E7NA 1XNRQ 4YCWA 5BR8L 2R93H 4OO1I 3HOUH 2K4KA 1HR0W 1YJ9A 3S24A 2N78A 3H0GG 5C44G 1XPRA 3MXNB 4JI6Q 1VQJA 4LFCQ 2NN6I 2E5LQ 5FLXc 3W1GA 4LF4L 3UDGA 3ERSX 3PUZA 4JI8Q 3HOWG 4JI5L 2Z0SA 3M4QA 4DK3C 1YHBA 3K0XA 5IE8A 2E8GA 1GVPA 1JB7A 4GLXA 3RN5A 5C4XH 2HIXA 1HH2P 1KC8C 5JJKA 3RLOA 1GD7A 3F2DA 4R4TA 3K80C 1MKHA 1EQRA 3Q8DA 4X62Q 1EYGA 4NXML 2EXDA 4IPHA 1VCIA 5IP7H 1M90C 2B3GA 3UDIA 5M3MH 1UE5A 2L15A 2LXJA 3PF5A 4JI4Q 3U58A 3HOYG 3PUWA 5DLQE 4JBMA 5GAHC 4KHPL 1R9TH 1QVGA 4DUYL 1VS0A 1WOCA 3G71A 1JJCB 2BA1A 4A3CG 1N34Q 5GADC 4NXNL 1O7IA 2LXKA 2AMCB 4LW1A 1SRUA 1Y1VG 2UU9L 4J15A 3L2PA 2GN5A 2GVAA 3HOWH 2ZTEA 4BBRH 1HNXQ 2RCNA 4JI2Q 4DV5L 1SE8A 4GKJL 4LF9L 3I4NH 3KJPA 5M5XH 3I2ZA 1HNZQ 3A5ZB 4JBWA 4MTNA 4IOAA 2XTIA 2PQAA 1LTLA 4X66L 3FKIH 2UXCQ 3L0OA 3CXCA 1VQPA 1EIYB 1Z47A 5HY6A 5AJ3Q 4AQYQ 3F8TA 4DV3Q 2F3IA 1PA6A 4GOPA 2UUAL 3CCJA 4PMWA 3S15H 2K52A 2NVTH 4DAYB 4LF8Q 3HOVG 4X6AH 3J81j 4JI0L 4P72A 1N36L 2UUCL 2NVXH 2HHHL 2IT1A 3K7AH 2UXDQ 2ATWA 4IJLA 1Y1VH 2H5XA 4UP7A 3TREA 4YY3L 3CCMA 4L5SA 1C0AA 2JA7G 1CKNA 2UXBQ 4NPSA 4HJ5A 3AQQA 1XJVA 3IRBA 1J5EQ 1PHJA 4HIDA 3FHWA 4X64Q 4GOPB 3T1HQ 3CCVA 2EIFA 1Q46A 2MQHA 4A3MG 1XMQQ 3BJUA 4DAMA 1Y1WH 1P16A 3JAMc 4GN5A 1MJCA 4A75A 1VQ4A 1PH4A 1I94L 3HKSA 5IP9G 3CC2A 2R7FA 1A8VA 1Q7YC 4A76A 2RF4A 4YWKA 3KJOA 2CCZA 1Y14B 3E9HA 2R7ZH 2NVYH 4HJ9A 3B6YA 5HGQA 4DUZQ 1FL0A 2K5NA 3J81c 4B3MQ 1L1OC 5IYBG 2OQKA 2CQOA 2ASBA 2F4VL 1NBWA 1OXVA 2K5HA 1HZ9A 4QJFA 1PFSA 4LUOA 1Q1EA 4LFAQ 1KRSA 1FVIA 1YZ6A 2VQEL 4JI7Q 4OWXB 1X6OA 3PSIA 1K9MC 3U50C 4QQBX 5ELOA 5IWAL 2A19A 1VQ9A 2AHOB 4A3MH 4XIGS 2PMZE 5LMNL 3U4VA 3RZOH 4FDBA 4JOIA 1D8LA 3F2CA 2JA6G 3HFZB 1LM0A 4OX9Q 3KF6A 4HIOA 3HOUG 1TWAH 3EN2A 3OYYA 1SN8A 3GTJH 1IBLQ 1HR0Q 4QGUA 1S72A 2IY5B 4DR3Q 1CUKA 3PO2H 2Y0SE 3RNUA 5M5WH 1XNQQ 2KBNA 4LF6Q 1S40A 1X54A 3RLNA 2MO1A 4KI0A 2WB1G 1IBML 4BY7H 4DV2L 1YHAA 4DR2L 4IPGA 5C0XG 4IO9A 4LF7Q 1N33L 1SROA 5C4XG 3FP9A 2WAQG 3GTGH 4A3IH 2YTVA 2BH2A 2KCTA 3D31A 3WWVA 4X65L 3KF6B 4DR5L 1K8GA 2JA8H 4GKKQ 4UY8C 3TQYA 1VQMA 5IP7G 2HQLA 3K81C 4GS3A 4GN4B 5M3MG 1EUJA 2OQ0A 1JT8A 2N8NA 4R4CA 4DR4Q 2E2JH 1S3OA 2JEBI 4LF5Q 1IL2A 4EX5A 4DK6C 2A8VA 4DV0L 1WYDA 1UE6A 5GAEC 1QVCA 2FXQA 1HZAA 5LMUL 3PO3G 4A3LG 5IYCH 4JI3Q 1TWGH 4KHZA 4JYAQ 2B63G 1PYSB 2K50A 3I4OA 4LUVA 3STBD 4BA1I 1E24A 1WJJA 2JEAI 4BBRG 4X65Q 4HIMA 2IHFA 2Y0SG 2YTYA 3DM3A 4H02A 1E1TA 3W1BA 4C2MH 3J7ZC 2EQSA 3NEMA 3I4NG 3RR5A 3J80i 2WP8J 3UE1A 5LMNW 4DV1Q 1Q1BA 2D0OA 5JEAJ 1G6PA 4YHHQ 4K0KL 4BA2I 1I50H 4IJHA 3W5OA 5BR8Q 1UEBA 3LGJA 3MEFA 3FKIG 3CF5A 4PZ6A 3S1MH 1Q8KA 2CKZB 5J3BA 3ULLA 4A3EH 2CWPA 1VQ8A 4LF4Q 1NY4A 2ZTCA 1RIPA 1KRTA 4JI5Q 1N9WA 3G48A 4A3KH 4BBSH 3PO3H 1Z9FA 1I5FA 1W3SA 3HOXH 4L5RC 1N32L 4A3JH 2B63H 1PH2A 4B3SL 3HKZG 4O2DA 2IHEA 4NXMQ 4JC0A 1XMOL 2JA9A 4BXXG 1HNWL 4DV4L 1VQCA 3H3VH 2KHJA 3S1QH 4GNXC 1BKBA 2K14A 1XPUA 4KHPQ 4QIWE 1Y1WG 4DUYQ 3PCOB 2RHQB 3M4PA 2CWAA 3RLFA 5C3EH 4R4QA 4C3IH 3PUYA 2VW9A 3CCQA 4LUZA 1PH9A 1MJEA 1U0LA 1PH7A 2JA5H 4NXNQ 3M4OH 4HJAA 3T1YL 3KYHC 3ULPA 2UU9Q 3A74A 2R7ZG 1OXSC 3HOZG 4DV7L 4IFDG 1B8AA 4A3FG 1K73C 1NTGA 3G6EA 3GTLH 2YTXA 2K75A 3M85A 2VL6A 2ZJPA 2N49A 4DV5Q 4DV6L 4LF9Q 4GKJQ 2Z6KA 2IX0A 2C35B 1TWHH 1U5KA 1YEZA 2K5VA 4TVAB 4EQ5A 4JG2A 4DR7L 3DLLA 3CC4A 2I5HA 4X66Q 1L1OB 3NELA 1SFOH 1UE1A 1YBYA 2JK8A 3ER0A 4BXXH 4IFDI 4Y52H 1E3PA 4IPCA 5M5YH 3A5UA 3GTKH 5K36G 2UUAQ 4UP9A 1K0RA 4DR1L 4YCUA 1YIJA 1QUQB 5ELNA 1X3GA 1PH6A 4BY1H 4TQUS 3CCUA 4MZ9A 2KCMA 2KHIA 2PI2E 2GVBA 5EAYA 1N36Q 4JI0Q 2R6GA 2UUCQ 1BBWA 4JV5L 1PH5A 2HHHQ 2VUMH 2WB1E 4YY3Q 3PO2G 3G4SA 5C4JH 1IYJB 3HOZH 2XGTA 3SGIA 4A3FH 1SMXA 3CMAA 1FJGL 1LYLA 1A63A 4BY7G 1G291 1VQDA 2YYZA 3CCRA 4IOCA 2OTLA 2WAQE 1JJGA 2UUBL
chains in the Genus database with same CATH superfamily
1ICWA 3PO2B 4QB4A 5M5WB 2VZAA 4JI1L 1GO3E 3OW7A 3A55A 5K36H 2VS1A 5GQOA 5FLMH 1Q90A 4LNQA 1TWCB 2HIVA 4MNOA 2F4VQ 2F0TA 1V1PB 2VQEQ 4ZQ3A 3E0EA 3HOUB 4NB3A 2K04A 4B3RL 1B1ZA 2V4DA 1XTDA 2CVRA 1GUTA 1MD2D 4DF7A 4LFBL 1L2FA 2SEBD 1X3FA 1IXRA 2R7DA 4OONA 3T13A 3CW2C 2D9UA 1XNRL 2AQ3B 2AQ2B 1XYIA 1N33Q 3GO5A 4M1UB 4PZ7A 4JI6L 4A3BH 3DWQA 1PRTC 4Z9CB 1HQRD 4OO1G 4JI8L 5M3FH 1X9NA 4F88A 2R92H 4G4KA 3A8KE 3NTHA 2B63B 3TN2A 2A6EC 4GLVB 1K3RA 1II3A 5IGGA 2Q2TA 1NNXA 5KRUA 1SNCA 2L12A 1MIUA 3VYUA 1FGBD 5LMUQ 3AMUA 2JN4A 1SLJA 3S17H 2EPBA 2K6AA 4GLAC 1K83H 5C5MA 2ZJQA 2A69D 4K0KQ 1VQIA 4KLKA 4DXGA 5IGBA 4AYBE 2BDNA 5C3WA 1EOTA 1HNXL 4UP8A 1A6XA 1A2UA 1AW7A 2F0MA 1B53A 1ENCA 3A7AB 1PFBA 2UXCL 4AH6A 1ILQA 1N8RC 1M1KC 1ILPA 1ENFA 4CDCC 1N32Q 3PGZA 2C5CA 3GP7A 1M8AA 5FO7B 3MFYA 2MUYA 1ML0D 4RGOS 3RZDH 1C7YA 3J80L 3UI2A 4ODGA 2UXBL 3CAMA 4KJNA 1CQVA 4HAEA 4AYBG 5FLMG 3T1HL 4IFDJ 1O7YA 3CRLC 3JAME 1EOVA 4B08A 1QILA 1TY2A 1G51A 4AYBB 1STHA 5KNBA 1UE7A 2HDMA 1UNSA 1EQVA 4GZYC 2M2LA 3PUVA 3FEWX 5CV4A 1VQ5A 4C3JH 4A93H 1NSNS 2G9DA 5G3LD 1SYEA 1SYGA 1RODA 3E9IA 1A3UA 2KENA 4JI7L 3A8JE 3J80E 1KNEA 1Q12A 2PI2A 2QGQA 4BS9A 1WFQA 3AFQA 3KDFA 4A3IB 1LACA 5F2DA 3CPFA 3M7GA 1B4OA 1JE5A 2VY3A 4JVZA 2I5MX 1TVXA 1IZ6A 2N55A 4DR6Q 2E2JB 3KOJA 2ZXOA 1EIHA 2D62A 2IX1A 1B70B 2R92G 1KD1C 3S2HH 1T9HA 4LF7L 4A3BB 1EZ8A 1GXDC 1RDPD 1PH1A 3R2TA 5M3FB 1SDFA 2A6HC 2R92B 2VQFQ 4XTCS 2R93G 1E1OA 5GROA 3OTOQ 5IP9H 2NYZD 4DNIA 1VQKA 2EYMA 1SEBD 1TS3A 1HA6A 1WTXA 5IYBH 1X32A 4KV6A 1S5CD 3S17B 4JCVE 4P75A 2L1BA 1E2VA 1KAWA 4JYAL 1D1KA 4FXDA 1K83B 2YU9H 4DR4L 4R8IA 1KIXA 4O0AA 4DV1L 4JBKA 4A4IA 2JA6H 1VMPA 5KNDA 1VQJA 2EXZA 2E5LQ 2HCCA 1IL8A 3HOWG 3M4OB 4XYQA 2Z0SA 5IE8A 1PYWD 1GVPA 2E8GA 1BCPD 5CORA 5T1IA 5HURA 1HH2P 1SNOA 1KC8C 1IW7D 1SMYC 1WTWA 2HD3A 3NHHA 2HCIA 3I70A 2EXDA 2Q8TA 3RZDB 1M90C 1S5BD 2J4XA 5M3MH 4CKBA 3U58A 2KVMA 1R9TH 3J81L 2O5JC 2BA1A 1TIID 4BY1B 1SRUA 2B2YC 1TQOA 5I6WA 5FO9B 5I2YA 1DCZA 4DV5L 4IUVA 3KJPA 2FMCA 5C4JB 3I2ZA 1HNZQ 3BVMA 2XTIA 3MVVA 4C3JB 4A93B 1EIYB 1Z47A 4OELB 3F8TA 4DV3Q 2UUAL 4LAAA 5IIFA 5KYIA 1DOLA 4PMWA 3S15H 2NVTH 4LF8Q 4NW2A 1F2LA 4WFN3 1HUNA 3DEPA 3L3OC 1I6VC 2HHHL 2UXDQ 4IJLA 3K0YA 5C3XA 1Y1VH 2H5XA 4UP7A 3TREA 3U9SA 3PIP3 1L0YB 3I3CA 3J81E 4HJ5A 1JQYD 1J5EQ 4HMJA 1PHJA 4HIDA 3R93A 1FR3A 2R61A 2E2DC 1I4HA 5CV7A 4A75A 4GN5A 1I94L 1EY4A 3QR8A 4HSPA 5IP9G 3CC2A 3S2HB 3BVGA 2RF4A 1SAPA 1Y14B 5BN3A 4IFDH 4B9WA 5IYBG 3NBHA 4G7HC 2DNEA 1I4GA 4LFAQ 3O13A 1YZ6A 3IL8A 4OWXB 3H91A 3MXGA 3T4AC 4LK1C 5ELOA 2QILA 2AHOB 4A3MH 1FNWA 1VDZA 2MP1A 1CZGA 3I4LA 4FDBA 4JOIA 2JA6G 2M9VA 3HFZB 4OX9Q 3EN2A 3MZ5A 1IBLQ 2HDLA 3VA7A 4QGUA 2IY5B 1CUKA 2KBNA 4LF6Q 1S40A 1XTCD 3LWEA 4DR2L 1SROA 4CJ2C 4FO2A 2NZ1D 4ILWA 3TP6A 2DJFC 4Q5VA 1CZWA 4CKCA 1F2YA 1K8GA 1JB3A 4UY8C 1VQMA 3K81C 4GS3A 4G57A 1EEFD 2EOTA 5M3MG 3CU7A 3V2TA 1D6EC 1S3OA 2JEBI 5E4WC 4EX5A 4DK6C 4C3HB 3PO3G 2KA7A 5M3MB 5IYCH 3URYA 3I4OA 2JEAI 1R9TB 1C48A 3HRZC 3W1BA 2EQSA 2IWHA 3J80i 3RR5A 3UE1A 3RD4A 5JEAJ 1G6PA 5CMDA 2B2VC 4DN4M 4YHHQ 2TMPA 3CF5A 4LMQD 4C3IG 4FF1A 2CKZB 1PMRA 1LTBD 4A3EH 4X3TA 2CWPA 4LF4Q 1KRTA 5C6AA 3FPUB 3CQZB 4ABNA 1CTMA 4O1NA 1RHPA 3J7AF 5JVH3 3EROA 3S15B 4NXMQ 4JC0A 4BXXG 1C4QA 4E6IA 1IYUA 1TS4A 2KHJA 2RVLA 5KIXA 1Y1VB 1XPUA 1MBYA 3MFGA 4DUYQ 2RHQB 1CT1D 1PH9A 4XT3B 5A2QE 3OHXC 4NXNQ 3IAYA 4LUZA 2G5DA 2K01A 3T1YL 3KYHC 2UU9Q 1MGSA 3HOZG 1KTKA 4DV7L 4IFDG 4A3FG 4ZCKA 2K75A 3A7LA 2PQEA 1IHZA 2N49A 2Z6KA 2IX0A 1YEZA 4EQ5A 4U68A 4JG2A 4RHRA 5C4HA 1SFOH 1UE1A 4Y52H 4TSSA 1JOOA 2EJMA 4UP9A 1E0BA 1QUQB 2F0NA 3ND9A 2KCMA 1B3AA 1RJTA 5EAYA 4JV5L 2R6GA 2UUCQ 2EYJA 3J7AV 2WB1E 4A3MB 3OWEB 1PZID 3K5OA 3VR6A 2XGTA 1FJGL 1KNAA 4CDDC 1LYLA 4S3SA 1ICFB 4HCSA 2WAQE 5AFWA 2WV6D 2EJFC 3CMEA 1PH3A 2ZJRA 1M4VA 1Y8PB 3SK5A 5IT9L 2ZM6L 4B3TL 1VQ6A 3CC7A 2Z4HA 2LFNA 3J7A5 3M9BA 1CM9A 3T16A 3K7UC 2F0LA 2B2VA 5IYCG 1B7YB 1HZBA 4QY7A 2D0PA 3PF4A 1KQSA 3A8IE 4ZKBB 1JJ2A 2AUJD 3G7LA 2AWOA 3DUZA 2BE5D 3N52A 2WB1B 1KABA 3I4MH 1TWFH 4NKLA 4CDEC 2PPBC 1CQFA 5C0XI 1Q8IA 4A3EG 2WAQB 2DJGC 4RA8A 1ESFA 2SNMA 2JP1A 3J81i 1IBMQ 5IT9E 1HJPA 3HKZE 3NENA 3ZYYX 1VQNA 1OXUA 1K0SA 4HMIA 4A3EB 4LFCL 4DKAC 2OT2A 2LS01 1NJIC 1QVFA 2C9OA 2MFIA 3OIQA 5DNFA 4IN3A 1DGSA 2OCEA 3C3LA 1SBBB 3VDYA 5J22A 4RH6A 2ID0A 4X62L 3E6ZX 1A3TA 2NTSA 1UAPA 3BZCA 4JI4L 3JC66 1VQGA 1TS5A 1N34L 1RCVD 1IYVA 2RBMA 5TSSA 2Q8RE 3CCSA 4A3DH 5IYDH 4L63B 3UDFA 4JI2L 2NN6H 1V8QA 3HKZB 3WOEA 2EYPA 3T56B 2ZTDA 3CPWA 4H13C 1HPCA 1X56A 4JW0A 5ELCA 1GUOA 5LHY1 1LT3D 2SOBA 3DHQA 4F8MA 3LX0A 5AJ3L 2K7VA 4LWCA 3H0GH 3PIOA 2FHTA 2Q2HA 1AE3A 3DMUA 1I4PA 3A0JA 4IQZA 2DN8A 4K8JA 3J7YW 2H4OA 5I6YA 4DV4Q 1HNWQ 2EYHA 1PYBA 4MN3A 1PTOB 4HN7A 4P73A 1K3BC 5NUCA 1F9RA 2V1CC 2A69C 4DGZA 3GD7A 1U4MA 4HIKA 1XMQL 1IKMA 2ZT9C 2EE1A 1FGUA 3S1RH 4A3CH 4G7ZC 1OXXK 3G6JB 3GTMH 3KUPA 4DR7Q 4WJ3M 4PG3A 1SSOA 4K14A 4P74A 3SDZA 2I5LX 4V0BA 4DUZL 4HJ8A 4KY5A 3X3MA 4B3ML 3BU2A 5JOBA 2B2WA 1V1PA 3BYYB 4I7ZC 2L9HA 4K6LA 1EYAA 3I4MG 1W6JA 3NXWA 1YNXA 1QB5D 1SJHD 1EY9A 1A0IA 2F52A 4NDXA 4YWLA 1CKNB 1TWFB 4ALPA 4HJ7A 2DNCA 1OXTA 1GKHA 3EA6A 4IPDA 2UUBQ 1PVOA 1HR0L 1DD2A 4KKSA 1XNQL 1EIFA 1V43A 1VQBA 1R4PB 3AFPA 5I4DA 1JCKB 3OSOA 2IJ0A 2QEXA 2PO4A 2K33A 3I7FA 2WKCA 1YNJD 3ZJYC 2WFWA 1A62A 3DEOA 1AZPA 3R8BA 3I8ZA 4GKKL 3EFXD 2CW0C 4AIMA 5I9PA 2B2UC 1WTRA 4LF5L 2DGYA 1HUMA 3K8AA 5G3LF 5FLXE 1XPOA 2B8FA 1QZGA 2OTJA 2F1MA 4A3DG 1B9NA 3PUXA 5IYDG 1IBKQ 2QDBA 4XQJA 1AP0A 2HT1A 3U4ZA 1YVCA 4N9PA 2E2IH 2JQOA 2NN6G 1SR3A 2F0VA 4A3DB 5JEAG 5E7NA 4DFAA 2R93H 4X3KA 2K4KA 3HS0C 1HR0W 1YJ9A 1PZKD 2N78A 3H0GG 4OEMB 3MXNB 1TR5A 3C1EA 4FNFA 1QNUA 1QOHA 3W1GA 3ERSX 4ZUJA 4JI5L 4PQXA 4DK3C 2RSNA 5C4XH 4EQNA 3OIPA 1GD7A 1S5ED 3GTLB 1EQRA 1F77A 2EYFA 3Q8DA 3JAML 4FVMA 1EYGA 1LTRD 2K05A 4RGNA 1DZ1A 3WDNA 3T53B 2L15A 2LXJA 1G8ZD 5EKIA 4R8NA 1BF4A 3PUWA 2RDFA 1QVGA 3G71A 4A3CG 2WACA 5JJZA 2KEEA 1O7IA 1SE4A 3E3XA 3L2PA 3I91A 2GN5A 2GVAA 3HOWH 2ZTEA 3D4DA 5FOBB 3S1RB 2RCFA 3AB9A 4B9XA 4GKJL 2NWGA 1NAPA 4LF9L 3GTMB 5M5XH 1S4ZA 3QOLA 2A74C 4K2LA 3FKIH 3E0JA 1LT6D 3NWSA 3CXCA 5HY6A 4AQYQ 2KECA 2RKSA 2K52A 2E74C 1IW7C 3GV6A 3J81j 4X6AH 1ESRA 4JI0L 4P72A 3KBGA 1BCPF 1ZYRC 4YY3L 2RDHA 3LNNA 4NPSA 5JPMC 4YIJA 2K5WA 2XRSD 1LTID 4X64Q 1GUNA 3BJUA 1G91A 4KD3A 2K5DA 1RKNA 1A8VA 2GA4B 3VR5A 2CCZA 4RWSC 1F9SA 1XX8A 1O7ZA 2R7ZH 2NVYH 5E3FA 4HJ9A 1L1OC 3HGBA 2ASBA 2CQOA 2F4VL 3F2UA 1NBWA 1OXVA 1RTNA 4EQPA 1PFSA 5A35A 1BBXC 1FNVA 1B9MA 2VQEL 3P1HA 1B50A 3EQLC 1PRTB 4XIGS 3U9OA 1GHJA 2O2LD 1FYCA 1GUWA 2E2IB 3NP8A 2ICEC 4DR3Q 3PMFA 3OWFA 1GUSA 2A6ED 1LO5D 4RKLA 3RLNA 1EEID 2R93B 1LTAD 2FFKB 1BO0A 1WD0A 4IO9A 1EU3A 1N33L 5C4XG 1EY7A 2L0CA 1ZXTA 3CRKC 2YTVA 2BH2A 3WWVA 4X65L 2JA8H 5E1FA 3SK4A 4WORA 2ICIA 4ZUIA 5IGCA 2B2TC 1UE6A 3I90A 4XT1B 5ELFA 1QVCA 5LMUL 1EZ6A 4C56C 4JI3Q 4KHZA 1PYSB 2K50A 4KY7A 1VF5C 2YTYA 4H02A 1DJRD 1PDQA 1QE6A 1S5FD 1Q1BA 2IPKD 3QO2A 1B2TA 1BR9A 4K0KL 1I50H 4K2KA 4IJHA 2PNRC 4XYOA 5BR8Q 3HOWB 3FKIG 1EY6A 2NBFA 4EGVA 3NQTA 4PZ6A 3S1MH 1Q8KA 5M5XB 5K5PA 1F9QA 5IGFA 5J3BA 1NY4A 2D5DA 4JPBW 1RIPA 1JOQA 2I46A 1F2ZA 1YNND 3PO3H 1U9RA 3HOXH 1N32L 1PH2A 1AN8A 4J1MA 2E75C 3BS1A 3H3VH 1ZEQX 1NUCA 5IODA 3S1QH 3H3VC 4GNXC 1SNQA 1BKBA 2F0IA 2KOLA 4KHPQ 1CHQD 3PCOB 3RLFA 5C3EH 4R4QA 4C3IH 4L6TB 2JA5H 2R7ZG 2AUKA 3MWYW 1K73C 1NTGA 2PW7A 1GJXA 1DOMA 2YTXA 1SYDA 2BOSA 2G9HD 4O42A 2PZTA 2K5VA 1D2BA 2NVYB 3CC4A 4X66Q 1L1OB 1AZQA 4BXXH 4IFDI 4IPCA 5M5YH 3GTKH 1BOSA 4CJ0B 1K0RA 4C1NI 4QCLA 1X3GA 2Q8IB 2A73B 3BVZA 5COYA 1N36Q 2I07B 5D14A 2VUMH 3KLSX 3G4SA 3CKIB 4KJOA 1IYJB 3HOZH 1RD9D 4WJWA 3OMGA 1F9PA 3E5SA 5DAUA 3SGIA 4A3FH 2A6HD 1G291 3P20A 2JSOA 2Z6BA 1FD7D 1D1IA 2HUGA 3QG1A 5IY0A 2VB3X 1Q82C 4DR6L 4RG1A 5EGTA 1TS2A 2JA8G 4K8IA 4TRDA 2AKWB 4L5TA 3TBIB 2WIIB 2BH8A 3EJIA 3NPPA 4HR7B 2F3VA 4R4IA 2YU9B 5JJIA 2VQFL 3OTOL 4ZRZA 5E4XA 2K32A 2K28A 1Q81C 1WVLA 2JA6B 2CHBD 3S9WA 4GOPC 1WTPA 1JORA 4RMFA 5IWAQ 4KY6A 1SYBA 5LMNQ 1YJNA 2EVBA 4HSVA 3ICEA 3W2DA 3JAMi 1H95A 1H9KA 4OHJA 2A68D 5D65A 1EFID 1MSHA 2B2YA 1A15A 1STBA 5M9OA 1KLGD 3M3YH 5I9OA 1HA5A 1B44D 4DV2Q 1ET6A 4OXPA 5C0XJ 4UHVA 3R2IA 1VQFA 3HOXG 4GNXA 2MPMA 4A3GH 2XVSA 3NSWA 4KK7A 1HFGA 1LTSD 3ERQA 2E5LL 4DR5Q 1I6HH 3CP0A 4POFA 5D3IB 2NB0A 5FJ8G 3PO3B 5A2QL 5CV8A 3GTOH 1E22A 1P8LA 3IKJA 3PV0A 1GM5A 4A3LG 3VR4A 4L5QA 1SE3A 3KFUA 4QMGA 5C3EG 4DV0Q 3TS2A 4RHSA 2PCFB 2JA5G 5C5LA 1VQLA 5CGKA 1G6ZA 4GNXB 3TRZA 3QB3A 4GN3B 1WCMH 2CFMA 3S2DH 2KQ3A 1ASZA 2BA0A 4C3IB 2JA5B 4IZ8A 1JWMD 2B8GA 1STNA 2NVTB 1G2TA 1VQAA 5KEEA 1L0WA 2K03A 4DNRB 3FVQA 3STBC 1HNZL 2OWOA 3D0FA 3Q0AA 3FRPB 1SYCA 1I3QH 3I72A 5M5YB 1FNUA 2VUMG 3BDCA 3PIPA 5C44H 1ZKOA 4DV3L 1QUQA 1Q86C 4B3SQ 4P71A 3SK6A 4U673 2MHVA 1PH8A 1XMOQ 4LF8L 2ALYB 4DNTB 1U4LA 1GHKA 2FINB 3AEVA 1SJED 2UXDL 2YV5A 3HOZB 4A3FB 1YI2A 2PNHA 1J6QA 1J5EL 3S14H 4OIKA 2ES2A 1JR0D 1YHQA 3HOYH 1D5XC 1H9SA 2VB2X 1BVSA 4DV6Q 4YWMA 1K8OA 3PIO3 2XWBB 2PQAB 1PLFA 5BN4A 2MNAA 2VNUD 4DR1Q 5ELEA 1MHWC 3TZDA 4LFAL 3I73A 1CHPD 1H9SB 1EYCA 1MI2A 1HFNA 2NVQH 3HEJA 1BBUA 3UE0A 3CHBD 1TT2A 3Q6SA 3L7ZC 2ZXPA 2N3SA 2DY7A 5EKKA 3HOVH 2F0WA 3R3OA 4OX9L 1IBLL 4A3GG 4ZYSA 5HGTA 1T5XD 2Q2UA 4JI1Q 1D7QA 2JA7H 3M3YB 4LF6L 3K5NA 1I4QA 1PTOF 2F0EA 1OTCA 2J7ZA 1PFNA 4FF2A 5IOCA 4Y7NH 4A3GB 1AE2A 3J80c 4DPGA 2MJ8A 5GAGC 4ME5A 4NMZA 1AEXA 3I56A 5J1ZA 1EWIA 4UPAA 3GTOB 1KL9A 2NUCA 1WCMG 5KGUA 4BWGB 1VQEA 2A1AA 3GTPH 3TEHB 2B29A 2F03A 1ASYA 2I0QA 4B3RQ 1A2TA 1CSQA 3P7JA 1QWYA 1NE3A 4PZ8A 1TWCH 4K5XA 1D5MC 4LFBQ 1YJWA 1O78A 4ULLA 3SEBA 3X3NA 2CH4W 4YHHL 1NMGA 2E2HH 1A3VA 1XNRQ 4KHVA 4OO1I 3HOUH 3DWPA 2Z1CA 5C44G 1XPRA 4JI6Q 2NN6I 4LF4L 1YNJC 4JI8Q 1KDBA 2CH4A 1EY5A 1SNMA 3C2PA 3K0XA 2P5ZX 1VMCA 5C0XH 4KD4A 5C44B 4GLXA 3D4RA 3RN5A 3NTIA 2HIXA 4R4TA 3K80C 1HTPA 4NXML 1HHVA 1VCIA 2AQ1B 1K28A 2B3GA 2RSOA 3HOYG 4J6HA 5JEAH 1SFOB 4L8JA 5DLQE 5GAHC 5CYUA 3TP5A 4DUYL 3SK8A 2IL8A 5GADC 4NXNL 5FKAC 3S14B 2LXKA 3HZXA 1Y8NB 3HOYB 5EPJA 2UU9L 1SE2A 3M4YA 3MAQA 4BBRH 3L9AX 1HNXQ 2RCNA 3NK9A 3I4NH 3V96A 1JOKA 1C8CA 3V05A 2H1EA 4Q0FA 5EBCA 3OOCA 1PTOD 2UXCQ 1E2WA 3L0OA 2K5QA 4UAIA 1PA6A 2F3IA 1IKLA 2QKIC 3NE5B 2NVQB 4DAYB 3HOVG 1QCBD 4P2CB 1EIGA 3IFTA 2NVXH 2UUCL 2XNAC 3K7AH 2EY6A 1C0AA 4L5SA 4PV1C 3CCMA 3BZDB 2JA7G 1CKNA 2UXBQ 4K5VA 3GV3A 3HOVB 1XJVA 3IRBA 3FHWA 3T1HQ 3SVMA 3MC0B 2MQHA 5J39A 5C4ZA 3CCVA 2EJGC 2F0FA 1Y1WH 3VYTA 1MJCA 3SHLA 2N88A 4Y7NB 2R7FA 4A76A 4YWKA 1STYA 3ONAB 5FLXL 5EBDA 3E9HA 3I4MB 3B6YA 5HGQA 1FL0A 2BDOA 1S5DD 2XRQD 3J81c 1CA6A 2OQKA 1GUGA 1HZ9A 4QJFA 4LUOA 1Q1EA 5CBEE 1QJOA 5CBAE 4JI7Q 2JYOA 3GTPB 1X6OA 2F0PA 3PSIA 3U50C 2L5TA 4ZAIA 5T1GA 1VQ9A 2PMZE 2F0SA 1R4QB 3U4VA 5DM73 3KF6A 3HOUG 1TWAH 3OYYA 1SN8A 3GTJH 1S72A 3HP3A 1G2SA 3H6MA 5IGEA 4FXKC 2E2HB 1X54A 4KI0A 2RQXA 1TU2B 1IBML 4BY7H 1NR2A 4IPGA 5C0XG 3MXNA 4LF7Q 3FP9A 1LLRD 3D8GA 3GTGH 1LTGD 4A3IH 2KCTA 3D31A 2F0HA 3KF6B 1E2ZA 1EYDA 1WTHA 2HQLA 4JK1C 1Z7TA 1EUJA 2OQ0A 1JT8A 1HCZA 2N8NA 4R4CA 3D6WA 2E2JH 1BUVT 2EDGA 1Y8OB 2XIWA 2A8VA 1WYDA 2LKVA 2FXQA 1HZAA 4ZK9B 2SDFA 1MSGA 4XXEA 1TWGH 4JYAQ 1DOKA 2B63G 4BA1I 4K5WA 4BBRG 2PMZB 4X65Q 2IHFA 4DR4Q 4C2MH 3H0GB 3NEMA 3I4NG 2KHSA 3K59A 4DV1Q 1PRTF 2L55A 3W5OA 1UEBA 3LGJA 4BBRB 2ZXRA 3VYSA 5LL6X 3I4NB 3NTKA 3ULLA 1NCVA 2F0OA 3ITPA 1VQ8A 4X3UA 2ZTCA 3G48A 4A3KH 4BBSH 3KK7A 3TMEA 1Z9FA 1I5FA 1W3SA 4IURA 3N6RA 4A3JH 4N9TA 4ZLTF 4O2DA 3A54A 1LTTD 2EY1A 2JA9A 3ND8A 2O4XA 2NVXB 1HNWL 4DV4L 3K7AB 2XSCA 2OF1A 4IALA 4DK1A 1Y1WG 3M4PA 4F7XA 4M8AA 3CCQA 3M4OH 1MJEA 1U0LA 4MTKA 4QF4A 1BCPC 4HJAA 2OXPA 3Q22A 2B39A 3ULPA 4V190 2QCPX 1Y1WB 2F0GA 1B8AA 3VR3A 4DK0A 4DV5Q 3M85A 2ZJPA 1Y69U 5LL6S 1BQQT 2C35B 1TWHH 1U5KA 4DU9A 4N8FA 4RGTA 2PZUA 4DR7L 2I5HA 3KLRA 3NELA 1LT4D 1YNNC 3A5UA 5K36G 2UUAQ 3KF8A 1YIJA 4YCUA 2B2UA 4OL7A 5ELNA 4BY1H 4TQUS 3CCUA 5CV9A 2KHIA 2PI2E 1WD1A 1K8MA 1LABA 1PH5A 2HHHQ 1H9JA 3SE0A 4KN4C 5C4JH 1CI3M 1U4RA 4XQQA 2BCOA 1A63A 1SMXA 3CMAA 5DM63 4BY7G 1VQDA 1TWAB 2YYZA 4IOCA 3GTJB 2PYKA 2UUBL 3AYHB 3KF8B 1X65A 2RHSB 3CCLA 2CW0D 1AH9A 4A3IG 2XN9C 2JJQA 4TKOB 1I94Q 4BY7B 4IUTA 3K5MA 4RKBA 3F2BA 1L0XB 1PRTD 3GTQH 5CR3A 3GTGB 4JBJA 1CKOA 3GDEA 2Z4IA 4CDFC 1JC7A 1JMCA 3DXJC 3D4WA 4A3BG 5I2XA 3A56A 5M3FG 1NR4A 5ELDA 4MIUA 3DWAA 1TWGB 4QUCA 2QF7A 4EVOA 1JWSD 3BDLA 3KDFB 1VQOA 1KXLA 1IBKL 4POGA 4C2MB 5C4XB 3OPOA 3EVQA 4HTHA 4RCNA 1KHIA 1WTOA 1EFWA 1O80A 4R4OA 2J0TD 4A3KG 1VQHA 4BBSG 1QZHA 1X55A 4DR2Q 3S1NH 3KLSA 4A3JG 4I7AA 4A3KB 4APVA 2RA4A 2MO0A 4BBSB 1Z6HA 1JICA 1EQQA 5H1SE 4IUUA 4A3JB 3QOJA 4OWTB 1V1QA 1K8AC 1HZCA 1V9PA 1JWUD 2IW3A 5L37A 4KTAA 5IT9c 2PZWA 5CV5A 5ISRA 3H3VI 1NMFA 3BZKA 3FKIB 3TDQA 4OWWB 4JOIC 1CSPA 1BCPB 1CKMA 1YITA 2A68C 2WKDA 5EKLA 2X69A 2EZVA 1F2MA 2AWNA 2KJXA 2EYOA 1EQTA 4H0LC 5FJ8H 3S16H 1KDCA 1ZYRD 1Q3LA 1TWHB 4C3HH 4A3LH 4BY1G 3I55A 1L1OA 1ET9A 1SYFA 4R1JA 3UDXA 4AQYL 4CGYB 1WI5A 3FPPA 2DUDA 4IUPA 4K6DA 4C3JG 2F0DA 4PNYA 3TZUA 3K57A 4A93G 4RFBA 5KYLA 2R7ZB 3TSSA 1TXYA 3C46A 2JE6I 4I65A 4NP5A 4EQOA 3P75A 3H15A 3FDTA 3CQZH 3T1YQ 3W3AA 3ULJA 1EY0A 4X64L 2X6GA 4DV7Q 3TS0A 1AFPA 3OMCA 3VA5A 1VQ7A 3GTQB 5JAVA 2EY2A 3GQBA 4KKUA 3F1ZA 2NZHA 3TP7A 5JVG3 3EBEA 4FYDA 2Z8LA 2QA4A 1PV4A 1RL2A 3NBIA 2B2TA 5IGDA 1E7ZA 3KLWA 4JV5Q 4XDXA 4ME3A 3RN2A 2NZOA 1UUPA 1QG7A 4WJ4A 1LUZA 4CBVA 1VF7A 2XWJB 4PMBA 1DYQA 1ENAA 1FJGQ 2F0QA 2JA8B 2F0UA 3MXUA 5FK9C 2K1BA 1H9MA 4DR3L 3DM1A 3VYRA 3M7NA 2LMCB 2KEDA 3NWTA 1X3PA 4DA2A 3S1NB 2ZM6Q 3BYTB 4B3TQ 2Z6KC 3MHBA 4FXGC 2LSSA 1EL0A 4KKTA 1LT5D 1HXYD 4OGQC 1W2BA 3NQIA 1STAA 3NBHB 1GOZA 4YCVA 1UWVA 1B3QA 1I50B 4QL5A 1SMYD 1EU4A 1C9OA 3CCEA 2Q2IA 3S1MB 4N8X1 1I4XA 2A5HA 3C1FA 4JI3L 3H09A 4DXFA 5JJLA 1X3EA 3HOXB 4FP5D 3OW2A 4WRDA 3EIVA 4C3HG 2KCCA 4X3SA 1D5ZC 2L4NA 4YCWA 5BR8L 3S16B 1QNKA 3S1QB 2L11A 3S24A 5EPKA 2RDGA 1WTVA 4LFCQ 5JPNC 4FF3A 2BE5C 5FLXc 1WTQA 4DAPA 3UDGA 1PFMA 3PUZA 5C3EB 3MXPA 4C1NK 4RAUC 3M4QA 3VR2A 1YHBA 1JB7A 3AU7A 4ZKCB 2KUMA 3RLOA 5JJKA 3F2DA 2R3ZA 1MKHA 4X62Q 3FMCA 4IPHA 5IP7H 4MHEA 3UDIA 1BNZA 4R9WA 1UE5A 3PF5A 4JI4Q 4H7BA 4JBMA 4KHPL 1VS0A 1WOCA 1JJCB 3GTKB 3TP8A 1UEAB 1N34Q 5CV6A 4KMUC 2EYLA 4XQNA 2AMCB 3HG9A 4LW1A 2IX3A 1Y1VG 1CA5A 4J15A 2JXMB 1XXGA 1EWCA 2VUMB 2F3WA 4JI2Q 1SE8A 4DAVA 4IUQA 3A5ZB 2F0KA 4JBWA 4MTNA 4IOAA 2PQAA 1LTLA 1SNPA 4X66L 1JE4A 4UDUC 1VQPA 5AJ3Q 2M00A 4GOPA 3CCJA 2OEOA 3LWUA 2FJ2A 3WOFA 1I4RA 2LY7A 5D3DA 1N36L 1DONA 2IT1A 2ATWA 3D6CA 1RTOA 1KLUD 1J9OA 2O5IC 3AQQA 1RF2D 1PXUA 1LV9A 1O7LA 4RGMA 4GOPB 4A3MG 2EIFA 1Q46A 1XMQQ 1CFMA 4DAMA 1P16A 3JAMc 2PW5A 1VQ4A 1PH4A 3HKSA 1Q7YC 3KJOA 1H9RA 2NTTA 1V1OA 1PTOH 2F4IA 2K5NA 4CKEA 4DUZQ 1PTOC 4B3MQ 1BDOA 5EPLA 1STEA 2K5HA 1TKWB 1KRSA 1FVIA 4F87A 2CQAA 3QIAA 1K9MC 4QQBX 3MEHA 5CC4A 5IWAL 4LJZC 2A19A 4RCOA 5LMNL 1DXMA 3RZOH 3F2CA 1D8LA 1I6HB 3SXHA 1LM0A 1OO9B 4HIOA 3H94A 4CJ1B 5EQ0A 3QWNA 1HR0Q 4HCEA 3PO2H 2Y0SE 3RNUA 5M5WH 1XNQQ 2VXWA 4H44C 3KBXA 2MO1A 2WB1G 1CK1A 4DV2L 5BN5A 1YHAA 1DM0B 1WCMB 5FO8B 3S2DB 4KN7C 2WAQG 1EY8A 1TY0A 4GKKQ 4DR5L 4FF4A 1KDAA 3TQYA 4J8QA 3SR1A 5IP7G 1EWHA 4GN4B 2B2WC 5DEHA 1W6KA 4G7OC 4QUFA 4LF5Q 1IL2A 4DV0L 3RMHA 5GAEC 2HQEA 2TSSA 3D3RA 3K58A 4LUVA 3STBD 1E24A 1WJJA 3MTSA 2SNSA 1I3QB 4HIMA 3J7ZC 2Y0SG 2Z9HA 3DM3A 3CD6A 1E1TA 1BXTA 1SXTA 5LMNW 2WP8J 2ENBA 2D0OA 2WINB 4PMCA 4BA2I 5KNCA 2F0JA 1ONLA 2EY5A 3MEFA 3RUZA 2Y0SB 2E76C 1SNDA 4JI5Q 1N9WA 1HQMC 4L5RC 1T5EA 2B63H 4B3SL 3HKZG 3QJYA 4DAYA 2IHEA 2QEJC 4OO1H 1XMOL 3NUCA 3Q24A 2DY8A 1HTLD 1VQCA 3BDOA 1PZJD 1XWEA 2K14A 4CHTB 4QIWE 2QW7A 2KCNA 4HEDA 2CWAA 2VW9A 3BG3A 3PUYA 1PH7A 3K5LA 3A74A 1STGA 1OXSC 5ELBA 3G6EA 3Q23A 3GTLH 1J8IA 2VL6A 4GKJQ 4LF9Q 4DV6L 4TVAB 4ID6A 3DLLA 2FMMA 1YBYA 2JK8A 3ER0A 4OIJA 1E3PA 2QDLA 4DR1L 5EJWA 1HRJA 2JA7B 1PH6A 4IUNA 3K6OA 2D2CC 4MZ9A 1U4PA 1KAAA 2GVBA 4JI0Q 1BBWA 1X3QA 4YY3Q 3PO2G 3IFDA 2MGSA 3RZOB 3T51B 1JJGA 3PQIA 2X6LA 3CCRA 2OTLA 3MA2B 4QIWB
chains in the Genus database with same CATH topology
3AYHB 5IY0A 3CMEA 3KF8B 1X65A 2RHSB 1Q82C 1PH3A 2VZAA 4JI1L 4DR6L 3CCLA 4RG1A 2ZJRA 1AH9A 4A3IG 2JJQA 1I94Q 1GO3E 2JA8G 2AKWB 2VS1A 4L5TA 3F2BA 2BH8A 2ZM6L 5GQOA 5FLMH 4B3TL 1VQ6A 4LNQA 3CC7A 3GTQH 4JBJA 2HIVA 1CKOA 3GDEA 4MNOA 4R4IA 5JJIA 3J7A5 2VQFL 3M9BA 2F4VQ 3OTOL 1JMCA 3K7UC 5IYCG 1B7YB 1Q81C 4A3BG 2VQEQ 1HZBA 4QY7A 2D0PA 3E0EA 4GOPC 1KQSA 3PF4A 4RMFA 5M3FG 5IWAQ 1JJ2A 4NB3A 4B3RL 2AWOA 5LMNQ 1YJNA 1XTDA 3KDFB 3ICEA 1VQOA 3JAMi 3I4MH 1TWFH 1KXLA 1H95A 1IBKL 4POGA 4LFBL 1L2FA 1X3FA 1IXRA 5C0XI 2R7DA 4A3EG 1KHIA 4OONA 1EFWA 3CW2C 3M3YH 4R4OA 3J81i 1IBMQ 4A3KG 1VQHA 4DV2Q 1XNRL 4OXPA 5C0XJ 1QZHA 1HJPA 1X55A 3HKZE 3NENA 4DR2Q 1VQNA 1OXUA 1VQFA 3HOXG 3GO5A 4GNXA 1N33Q 3S1NH 4A3GH 4PZ7A 4A3JG 4JI6L 4A3BH 4LFCL 4DKAC 2E5LL 1NJIC 4OO1G 4JI8L 4APVA 5M3FH 2MO0A 4DR5Q 1X9NA 1QVFA 2R92H 3CP0A 4POFA 4BBSG 1I6HH 5FJ8G 2MFIA 5H1SE 1EQQA 3GTOH 1E22A 1P8LA 1DGSA 2OCEA 4OWTB 3PV0A 1V1QA 4GLVB 1K3RA 1GM5A 3VDYA 1HZCA 4L5QA 1K8AC 1V9PA 2Q2TA 3KFUA 5C3EG 4DV0Q 1MIUA 2ID0A 4X62L 3TS2A 2JA5G 5LMUQ 5IT9c 1VQLA 4GNXB 3TRZA 1SLJA 3S17H 3H3VI 4GN3B 1WCMH 3BZCA 2CFMA 4GLAC 4JI4L 3S2DH 1NMFA 3BZKA 3JC66 1ASZA 2BA0A 1VQGA 4OWWB 4JOIC 1K83H 1CSPA 1CKMA 1YITA 1N34L 2ZJQA 4K0KQ 1VQIA 4KLKA 3CCSA 4A3DH 4AYBE 5IYDH 1HNXL 2AWNA 3UDFA 5FJ8H 3S16H 4UP8A 1VQAA 4JI2L 1L0WA 4C3HH 3STBC 4A3LH 4BY1G 3I55A 1HNZL 2OWOA 1L1OA 2ZTDA 3D0FA 3CPWA 1X56A 4R1JA 3UDXA 2UXCL 1I3QH 4AH6A 1N8RC 1M1KC 5AJ3L 2VUMG 4LWCA 3PIPA 3H0GH 5C44H 4AQYL 4DV3L 1QUQA 3PIOA 1WI5A 1Q86C 1N32Q 2Q2HA 1AE3A 4B3SQ 2DUDA 3PGZA 4P71A 3A0JA 1PH8A 1XMOQ 4LF8L 2ALYB 1HNWQ 4DV4Q 4A93G 1C7YA 3RZDH 1PYBA 3AEVA 2UXDL 2YV5A 1TXYA 2JE6I 2UXBL 3CAMA 4P73A 1YI2A 3H15A 2PNHA 1J6QA 1J5EL 3S14H 3CQZH 4AYBG 3T1YQ 5FLMG 2ES2A 2V1CC 3ULJA 1YHQA 4X64L 3T1HL 3HOYH 4IFDJ 3GD7A 4HIKA 4DV7Q 1XMQL 3TS0A 1EOVA 1BVSA 1FGUA 3S1RH 4A3CH 1G51A 4DV6Q 4YWMA 1OXXK 1UE7A 3GTMH 1VQ7A 4DR7Q 4WJ3M 4PG3A 3F1ZA 2NZHA 4P74A 2I5LX 3PUVA 2PQAB 4DUZL 1VQ5A 4C3JH 4HJ8A 4B3ML 4A93H 3BU2A 3EBEA 2MNAA 2VNUD 4DR1Q 2QA4A 1PV4A 1RL2A 4LFAL 3E9IA 2KENA 4JI7L 1E7ZA 3KLWA 2NVQH 3I4MG 1BBUA 3UE0A 4JV5Q 1YNXA 1Q12A 4ME3A 3RN2A 2NZOA 2PI2A 2QGQA 1A0IA 3L7ZC 2F52A 1LUZA 1WFQA 3AFQA 3KDFA 4YWLA 2N3SA 4WJ4A 1FJGQ 1CKNB 3CPFA 4ALPA 4HJ7A 3HOVH 1OXTA 4OX9L 1JE5A 2VY3A 1GKHA 4IPDA 2UUBQ 1IBLL 2I5MX 1PVOA 1HR0L 4A3GG 1IZ6A 2Q2UA 4DR3L 4JI1Q 1D7QA 4DR6Q 3KOJA 1XNQL 2JA7H 4LF6L 1EIFA 3M7NA 1V43A 2D62A 1VQBA 1B70B 3AFPA 1KD1C 1OTCA 2IX1A 2R92G 2ZM6Q 4Y7NH 3S2HH 1AE2A 1T9HA 3J80c 2QEXA 4B3TQ 4DPGA 3I7FA 5GAGC 4LF7L 2Z6KC 3ZJYC 1PH1A 2LSSA 2WFWA 1A62A 2VQFQ 4XTCS 3I56A 1E1OA 1W2BA 4GKKL 2R93G 5GROA 3OTOQ 1EWIA 3NBHB 4UPAA 5IP9H 4DNIA 1VQKA 4YCVA 1KL9A 1UWVA 1WCMG 4QL5A 1VQEA 2A1AA 4AIMA 4LF5L 1C9OA 3TEHB 2B29A 3GTPH 2DGYA 3CCEA 5IYBH 1ASYA 2Q2IA 2I0QA 4B3RQ 3K8AA 3CD6A 4JCVE 1XPOA 4P75A 1QZGA 4JI3L 1CSQA 1KAWA 4JYAL 2OTJA 4A3DG 1NE3A 3PUXA 4PZ8A 1TWCH 5JJLA 5IYDG 1X3EA 1IBKQ 2HT1A 3U4ZA 1YVCA 2YU9H 2E2IH 4DR4L 1YJWA 1KIXA 4LFBQ 3OW2A 2JQOA 4O0AA 2NN6G 3EIVA 1SR3A 4DV1L 4A4IA 4JBKA 4YHHL 5JEAG 2JA6H 1NMGA 2E2HH 5E7NA 1XNRQ 4YCWA 5BR8L 2R93H 4OO1I 3HOUH 2K4KA 1HR0W 1YJ9A 3S24A 2N78A 3H0GG 5C44G 1XPRA 3MXNB 4JI6Q 1VQJA 4LFCQ 2NN6I 2E5LQ 5FLXc 3W1GA 4LF4L 3UDGA 3ERSX 3PUZA 4JI8Q 3HOWG 4JI5L 2Z0SA 3M4QA 4DK3C 1YHBA 3K0XA 5IE8A 2E8GA 1GVPA 1JB7A 4GLXA 3RN5A 5C4XH 2HIXA 1HH2P 1KC8C 5JJKA 3RLOA 1GD7A 3F2DA 4R4TA 3K80C 1MKHA 1EQRA 3Q8DA 4X62Q 1EYGA 4NXML 2EXDA 4IPHA 1VCIA 5IP7H 1M90C 2B3GA 3UDIA 5M3MH 1UE5A 2L15A 2LXJA 3PF5A 4JI4Q 3U58A 3HOYG 3PUWA 5DLQE 4JBMA 5GAHC 4KHPL 1R9TH 1QVGA 4DUYL 1VS0A 1WOCA 3G71A 1JJCB 2BA1A 4A3CG 1N34Q 5GADC 4NXNL 1O7IA 2LXKA 2AMCB 4LW1A 1SRUA 1Y1VG 2UU9L 4J15A 3L2PA 2GN5A 2GVAA 3HOWH 2ZTEA 4BBRH 1HNXQ 2RCNA 4JI2Q 4DV5L 1SE8A 4GKJL 4LF9L 3I4NH 3KJPA 5M5XH 3I2ZA 1HNZQ 3A5ZB 4JBWA 4MTNA 4IOAA 2XTIA 2PQAA 1LTLA 4X66L 3FKIH 2UXCQ 3L0OA 3CXCA 1VQPA 1EIYB 1Z47A 5HY6A 5AJ3Q 4AQYQ 3F8TA 4DV3Q 2F3IA 1PA6A 4GOPA 2UUAL 3CCJA 4PMWA 3S15H 2K52A 2NVTH 4DAYB 4LF8Q 3HOVG 4X6AH 3J81j 4JI0L 4P72A 1N36L 2UUCL 2NVXH 2HHHL 2IT1A 3K7AH 2UXDQ 2ATWA 4IJLA 1Y1VH 2H5XA 4UP7A 3TREA 4YY3L 3CCMA 4L5SA 1C0AA 2JA7G 1CKNA 2UXBQ 4NPSA 4HJ5A 3AQQA 1XJVA 3IRBA 1J5EQ 1PHJA 4HIDA 3FHWA 4X64Q 4GOPB 3T1HQ 3CCVA 2EIFA 1Q46A 2MQHA 4A3MG 1XMQQ 3BJUA 4DAMA 1Y1WH 1P16A 3JAMc 4GN5A 1MJCA 4A75A 1VQ4A 1PH4A 1I94L 3HKSA 5IP9G 3CC2A 2R7FA 1A8VA 1Q7YC 4A76A 2RF4A 4YWKA 3KJOA 2CCZA 1Y14B 3E9HA 2R7ZH 2NVYH 4HJ9A 3B6YA 5HGQA 4DUZQ 1FL0A 2K5NA 3J81c 4B3MQ 1L1OC 5IYBG 2OQKA 2CQOA 2ASBA 2F4VL 1NBWA 1OXVA 2K5HA 1HZ9A 4QJFA 1PFSA 4LUOA 1Q1EA 4LFAQ 1KRSA 1FVIA 1YZ6A 2VQEL 4JI7Q 4OWXB 1X6OA 3PSIA 1K9MC 3U50C 4QQBX 5ELOA 5IWAL 2A19A 1VQ9A 2AHOB 4A3MH 4XIGS 2PMZE 5LMNL 3U4VA 3RZOH 4FDBA 4JOIA 1D8LA 3F2CA 2JA6G 3HFZB 1LM0A 4OX9Q 3KF6A 4HIOA 3HOUG 1TWAH 3EN2A 3OYYA 1SN8A 3GTJH 1IBLQ 1HR0Q 4QGUA 1S72A 2IY5B 4DR3Q 1CUKA 3PO2H 2Y0SE 3RNUA 5M5WH 1XNQQ 2KBNA 4LF6Q 1S40A 1X54A 3RLNA 2MO1A 4KI0A 2WB1G 1IBML 4BY7H 4DV2L 1YHAA 4DR2L 4IPGA 5C0XG 4IO9A 4LF7Q 1N33L 1SROA 5C4XG 3FP9A 2WAQG 3GTGH 4A3IH 2YTVA 2BH2A 2KCTA 3D31A 3WWVA 4X65L 3KF6B 4DR5L 1K8GA 2JA8H 4GKKQ 4UY8C 3TQYA 1VQMA 5IP7G 2HQLA 3K81C 4GS3A 4GN4B 5M3MG 1EUJA 2OQ0A 1JT8A 2N8NA 4R4CA 4DR4Q 2E2JH 1S3OA 2JEBI 4LF5Q 1IL2A 4EX5A 4DK6C 2A8VA 4DV0L 1WYDA 1UE6A 5GAEC 1QVCA 2FXQA 1HZAA 5LMUL 3PO3G 4A3LG 5IYCH 4JI3Q 1TWGH 4KHZA 4JYAQ 2B63G 1PYSB 2K50A 3I4OA 4LUVA 3STBD 4BA1I 1E24A 1WJJA 2JEAI 4BBRG 4X65Q 4HIMA 2IHFA 2Y0SG 2YTYA 3DM3A 4H02A 1E1TA 3W1BA 4C2MH 3J7ZC 2EQSA 3NEMA 3I4NG 3RR5A 3J80i 2WP8J 3UE1A 5LMNW 4DV1Q 1Q1BA 2D0OA 5JEAJ 1G6PA 4YHHQ 4K0KL 4BA2I 1I50H 4IJHA 3W5OA 5BR8Q 1UEBA 3LGJA 3MEFA 3FKIG 3CF5A 4PZ6A 3S1MH 1Q8KA 2CKZB 5J3BA 3ULLA 4A3EH 2CWPA 1VQ8A 4LF4Q 1NY4A 2ZTCA 1RIPA 1KRTA 4JI5Q 1N9WA 3G48A 4A3KH 4BBSH 3PO3H 1Z9FA 1I5FA 1W3SA 3HOXH 4L5RC 1N32L 4A3JH 2B63H 1PH2A 4B3SL 3HKZG 4O2DA 2IHEA 4NXMQ 4JC0A 1XMOL 2JA9A 4BXXG 1HNWL 4DV4L 1VQCA 3H3VH 2KHJA 3S1QH 4GNXC 1BKBA 2K14A 1XPUA 4KHPQ 4QIWE 1Y1WG 4DUYQ 3PCOB 2RHQB 3M4PA 2CWAA 3RLFA 5C3EH 4R4QA 4C3IH 3PUYA 2VW9A 3CCQA 4LUZA 1PH9A 1MJEA 1U0LA 1PH7A 2JA5H 4NXNQ 3M4OH 4HJAA 3T1YL 3KYHC 3ULPA 2UU9Q 3A74A 2R7ZG 1OXSC 3HOZG 4DV7L 4IFDG 1B8AA 4A3FG 1K73C 1NTGA 3G6EA 3GTLH 2YTXA 2K75A 3M85A 2VL6A 2ZJPA 2N49A 4DV5Q 4DV6L 4LF9Q 4GKJQ 2Z6KA 2IX0A 2C35B 1TWHH 1U5KA 1YEZA 2K5VA 4TVAB 4EQ5A 4JG2A 4DR7L 3DLLA 3CC4A 2I5HA 4X66Q 1L1OB 3NELA 1SFOH 1UE1A 1YBYA 2JK8A 3ER0A 4BXXH 4IFDI 4Y52H 1E3PA 4IPCA 5M5YH 3A5UA 3GTKH 5K36G 2UUAQ 4UP9A 1K0RA 4DR1L 4YCUA 1YIJA 1QUQB 5ELNA 1X3GA 1PH6A 4BY1H 4TQUS 3CCUA 4MZ9A 2KCMA 2KHIA 2PI2E 2GVBA 5EAYA 1N36Q 4JI0Q 2R6GA 2UUCQ 1BBWA 4JV5L 1PH5A 2HHHQ 2VUMH 2WB1E 4YY3Q 3PO2G 3G4SA 5C4JH 1IYJB 3HOZH 2XGTA 3SGIA 4A3FH 1SMXA 3CMAA 1FJGL 1LYLA 1A63A 4BY7G 1G291 1VQDA 2YYZA 3CCRA 4IOCA 2OTLA 2WAQE 1JJGA 2UUBL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AYH B;  5IY0 A;  3CME A;  3KF8 B;  1X65 A;  2RHS B;  1Q82 C;  1PH3 A;  2VZA A;  4JI1 L;  4DR6 L;  3CCL A;  4RG1 A;  2ZJR A;  1AH9 A;  4A3I G;  2JJQ A;  1I94 Q;  1GO3 E;  2JA8 G;  2AKW B;  2VS1 A;  4L5T A;  3F2B A;  2BH8 A;  2ZM6 L;  5GQO A;  5FLM H;  4B3T L;  1VQ6 A;  4LNQ A;  3CC7 A;  3GTQ H;  4JBJ A;  2HIV A;  1CKO A;  3GDE A;  4MNO A;  4R4I A;  5JJI A;  3J7A 5;  2VQF L;  3M9B A;  2F4V Q;  3OTO L;  1JMC A;  3K7U C;  5IYC G;  1B7Y B;  1Q81 C;  4A3B G;  2VQE Q;  1HZB A;  4QY7 A;  2D0P A;  3E0E A;  4GOP C;  1KQS A;  3PF4 A;  4RMF A;  5M3F G;  5IWA Q;  1JJ2 A;  4NB3 A;  4B3R L;  2AWO A;  5LMN Q;  1YJN A;  1XTD A;  3KDF B;  3ICE A;  1VQO A;  3JAM i;  3I4M H;  1TWF H;  1KXL A;  1H95 A;  1IBK L;  4POG A;  4LFB L;  1L2F A;  1X3F A;  1IXR A;  5C0X I;  2R7D A;  4A3E G;  1KHI A;  4OON A;  1EFW A;  3CW2 C;  3M3Y H;  4R4O A;  3J81 i;  1IBM Q;  4A3K G;  1VQH A;  4DV2 Q;  1XNR L;  4OXP A;  5C0X J;  1QZH A;  1HJP A;  1X55 A;  3HKZ E;  3NEN A;  4DR2 Q;  1VQN A;  1OXU A;  1VQF A;  3HOX G;  3GO5 A;  4GNX A;  1N33 Q;  3S1N H;  4A3G H;  4PZ7 A;  4A3J G;  4JI6 L;  4A3B H;  4LFC L;  4DKA C;  2E5L L;  1NJI C;  4OO1 G;  4JI8 L;  4APV A;  5M3F H;  2MO0 A;  4DR5 Q;  1X9N A;  1QVF A;  2R92 H;  3CP0 A;  4POF A;  4BBS G;  1I6H H;  5FJ8 G;  2MFI A;  5H1S E;  1EQQ A;  3GTO H;  1E22 A;  1P8L A;  1DGS A;  2OCE A;  4OWT B;  3PV0 A;  1V1Q A;  4GLV B;  1K3R A;  1GM5 A;  3VDY A;  1HZC A;  4L5Q A;  1K8A C;  1V9P A;  2Q2T A;  3KFU A;  5C3E G;  4DV0 Q;  1MIU A;  2ID0 A;  4X62 L;  3TS2 A;  2JA5 G;  5LMU Q;  5IT9 c;  1VQL A;  4GNX B;  3TRZ A;  1SLJ A;  3S17 H;  3H3V I;  4GN3 B;  1WCM H;  3BZC A;  2CFM A;  4GLA C;  4JI4 L;  3S2D H;  1NMF A;  3BZK A;  3JC6 6;  1ASZ A;  2BA0 A;  1VQG A;  4OWW B;  4JOI C;  1K83 H;  1CSP A;  1CKM A;  1YIT A;  1N34 L;  2ZJQ A;  4K0K Q;  1VQI A;  4KLK A;  3CCS A;  4A3D H;  4AYB E;  5IYD H;  1HNX L;  2AWN A;  3UDF A;  5FJ8 H;  3S16 H;  4UP8 A;  1VQA A;  4JI2 L;  1L0W A;  4C3H H;  3STB C;  4A3L H;  4BY1 G;  3I55 A;  1HNZ L;  2OWO A;  1L1O A;  2ZTD A;  3D0F A;  3CPW A;  1X56 A;  4R1J A;  3UDX A;  2UXC L;  1I3Q H;  4AH6 A;  1N8R C;  1M1K C;  5AJ3 L;  2VUM G;  4LWC A;  3PIP A;  3H0G H;  5C44 H;  4AQY L;  4DV3 L;  1QUQ A;  3PIO A;  1WI5 A;  1Q86 C;  1N32 Q;  2Q2H A;  1AE3 A;  4B3S Q;  2DUD A;  3PGZ A;  4P71 A;  3A0J A;  1PH8 A;  1XMO Q;  4LF8 L;  2ALY B;  1HNW Q;  4DV4 Q;  4A93 G;  1C7Y A;  3RZD H;  1PYB A;  3AEV A;  2UXD L;  2YV5 A;  1TXY A;  2JE6 I;  2UXB L;  3CAM A;  4P73 A;  1YI2 A;  3H15 A;  2PNH A;  1J6Q A;  1J5E L;  3S14 H;  3CQZ H;  4AYB G;  3T1Y Q;  5FLM G;  2ES2 A;  2V1C C;  3ULJ A;  1YHQ A;  4X64 L;  3T1H L;  3HOY H;  4IFD J;  3GD7 A;  4HIK A;  4DV7 Q;  1XMQ L;  3TS0 A;  1EOV A;  1BVS A;  1FGU A;  3S1R H;  4A3C H;  1G51 A;  4DV6 Q;  4YWM A;  1OXX K;  1UE7 A;  3GTM H;  1VQ7 A;  4DR7 Q;  4WJ3 M;  4PG3 A;  3F1Z A;  2NZH A;  4P74 A;  2I5L X;  3PUV A;  2PQA B;  4DUZ L;  1VQ5 A;  4C3J H;  4HJ8 A;  4B3M L;  4A93 H;  3BU2 A;  3EBE A;  2MNA A;  2VNU D;  4DR1 Q;  2QA4 A;  1PV4 A;  1RL2 A;  4LFA L;  3E9I A;  2KEN A;  4JI7 L;  1E7Z A;  3KLW A;  2NVQ H;  3I4M G;  1BBU A;  3UE0 A;  4JV5 Q;  1YNX A;  1Q12 A;  4ME3 A;  3RN2 A;  2NZO A;  2PI2 A;  2QGQ A;  1A0I A;  3L7Z C;  2F52 A;  1LUZ A;  1WFQ A;  3AFQ A;  3KDF A;  4YWL A;  2N3S A;  4WJ4 A;  1FJG Q;  1CKN B;  3CPF A;  4ALP A;  4HJ7 A;  3HOV H;  1OXT A;  4OX9 L;  1JE5 A;  2VY3 A;  1GKH A;  4IPD A;  2UUB Q;  1IBL L;  2I5M X;  1PVO A;  1HR0 L;  4A3G G;  1IZ6 A;  2Q2U A;  4DR3 L;  4JI1 Q;  1D7Q A;  4DR6 Q;  3KOJ A;  1XNQ L;  2JA7 H;  4LF6 L;  1EIF A;  3M7N A;  1V43 A;  2D62 A;  1VQB A;  1B70 B;  3AFP A;  1KD1 C;  1OTC A;  2IX1 A;  2R92 G;  2ZM6 Q;  4Y7N H;  3S2H H;  1AE2 A;  1T9H A;  3J80 c;  2QEX A;  4B3T Q;  4DPG A;  3I7F A;  5GAG C;  4LF7 L;  2Z6K C;  3ZJY C;  1PH1 A;  2LSS A;  2WFW A;  1A62 A;  2VQF Q;  4XTC S;  3I56 A;  1E1O A;  1W2B A;  4GKK L;  2R93 G;  5GRO A;  3OTO Q;  1EWI A;  3NBH B;  4UPA A;  5IP9 H;  4DNI A;  1VQK A;  4YCV A;  1KL9 A;  1UWV A;  1WCM G;  4QL5 A;  1VQE A;  2A1A A;  4AIM A;  4LF5 L;  1C9O A;  3TEH B;  2B29 A;  3GTP H;  2DGY A;  3CCE A;  5IYB H;  1ASY A;  2Q2I A;  2I0Q A;  4B3R Q;  3K8A A;  3CD6 A;  4JCV E;  1XPO A;  4P75 A;  1QZG A;  4JI3 L;  1CSQ A;  1KAW A;  4JYA L;  2OTJ A;  4A3D G;  1NE3 A;  3PUX A;  4PZ8 A;  1TWC H;  5JJL A;  5IYD G;  1X3E A;  1IBK Q;  2HT1 A;  3U4Z A;  1YVC A;  2YU9 H;  2E2I H;  4DR4 L;  1YJW A;  1KIX A;  4LFB Q;  3OW2 A;  2JQO A;  4O0A A;  2NN6 G;  3EIV A;  1SR3 A;  4DV1 L;  4A4I A;  4JBK A;  4YHH L;  5JEA G;  2JA6 H;  1NMG A;  2E2H H;  5E7N A;  1XNR Q;  4YCW A;  5BR8 L;  2R93 H;  4OO1 I;  3HOU H;  2K4K A;  1HR0 W;  1YJ9 A;  3S24 A;  2N78 A;  3H0G G;  5C44 G;  1XPR A;  3MXN B;  4JI6 Q;  1VQJ A;  4LFC Q;  2NN6 I;  2E5L Q;  5FLX c;  3W1G A;  4LF4 L;  3UDG A;  3ERS X;  3PUZ A;  4JI8 Q;  3HOW G;  4JI5 L;  2Z0S A;  3M4Q A;  4DK3 C;  1YHB A;  3K0X A;  5IE8 A;  2E8G A;  1GVP A;  1JB7 A;  4GLX A;  3RN5 A;  5C4X H;  2HIX A;  1HH2 P;  1KC8 C;  5JJK A;  3RLO A;  1GD7 A;  3F2D A;  4R4T A;  3K80 C;  1MKH A;  1EQR A;  3Q8D A;  4X62 Q;  1EYG A;  4NXM L;  2EXD A;  4IPH A;  1VCI A;  5IP7 H;  1M90 C;  2B3G A;  3UDI A;  5M3M H;  1UE5 A;  2L15 A;  2LXJ A;  3PF5 A;  4JI4 Q;  3U58 A;  3HOY G;  3PUW A;  5DLQ E;  4JBM A;  5GAH C;  4KHP L;  1R9T H;  1QVG A;  4DUY L;  1VS0 A;  1WOC A;  3G71 A;  1JJC B;  2BA1 A;  4A3C G;  1N34 Q;  5GAD C;  4NXN L;  1O7I A;  2LXK A;  2AMC B;  4LW1 A;  1SRU A;  1Y1V G;  2UU9 L;  4J15 A;  3L2P A;  2GN5 A;  2GVA A;  3HOW H;  2ZTE A;  4BBR H;  1HNX Q;  2RCN A;  4JI2 Q;  4DV5 L;  1SE8 A;  4GKJ L;  4LF9 L;  3I4N H;  3KJP A;  5M5X H;  3I2Z A;  1HNZ Q;  3A5Z B;  4JBW A;  4MTN A;  4IOA A;  2XTI A;  2PQA A;  1LTL A;  4X66 L;  3FKI H;  2UXC Q;  3L0O A;  3CXC A;  1VQP A;  1EIY B;  1Z47 A;  5HY6 A;  5AJ3 Q;  4AQY Q;  3F8T A;  4DV3 Q;  2F3I A;  1PA6 A;  4GOP A;  2UUA L;  3CCJ A;  4PMW A;  3S15 H;  2K52 A;  2NVT H;  4DAY B;  4LF8 Q;  3HOV G;  4X6A H;  3J81 j;  4JI0 L;  4P72 A;  1N36 L;  2UUC L;  2NVX H;  2HHH L;  2IT1 A;  3K7A H;  2UXD Q;  2ATW A;  4IJL A;  1Y1V H;  2H5X A;  4UP7 A;  3TRE A;  4YY3 L;  3CCM A;  4L5S A;  1C0A A;  2JA7 G;  1CKN A;  2UXB Q;  4NPS A;  4HJ5 A;  3AQQ A;  1XJV A;  3IRB A;  1J5E Q;  1PHJ A;  4HID A;  3FHW A;  4X64 Q;  4GOP B;  3T1H Q;  3CCV A;  2EIF A;  1Q46 A;  2MQH A;  4A3M G;  1XMQ Q;  3BJU A;  4DAM A;  1Y1W H;  1P16 A;  3JAM c;  4GN5 A;  1MJC A;  4A75 A;  1VQ4 A;  1PH4 A;  1I94 L;  3HKS A;  5IP9 G;  3CC2 A;  2R7F A;  1A8V A;  1Q7Y C;  4A76 A;  2RF4 A;  4YWK A;  3KJO A;  2CCZ A;  1Y14 B;  3E9H A;  2R7Z H;  2NVY H;  4HJ9 A;  3B6Y A;  5HGQ A;  4DUZ Q;  1FL0 A;  2K5N A;  3J81 c;  4B3M Q;  1L1O C;  5IYB G;  2OQK A;  2CQO A;  2ASB A;  2F4V L;  1NBW A;  1OXV A;  2K5H A;  1HZ9 A;  4QJF A;  1PFS A;  4LUO A;  1Q1E A;  4LFA Q;  1KRS A;  1FVI A;  1YZ6 A;  2VQE L;  4JI7 Q;  4OWX B;  1X6O A;  3PSI A;  1K9M C;  3U50 C;  4QQB X;  5ELO A;  5IWA L;  2A19 A;  1VQ9 A;  2AHO B;  4A3M H;  4XIG S;  2PMZ E;  5LMN L;  3U4V A;  3RZO H;  4FDB A;  4JOI A;  1D8L A;  3F2C A;  2JA6 G;  3HFZ B;  1LM0 A;  4OX9 Q;  3KF6 A;  4HIO A;  3HOU G;  1TWA H;  3EN2 A;  3OYY A;  1SN8 A;  3GTJ H;  1IBL Q;  1HR0 Q;  4QGU A;  1S72 A;  2IY5 B;  4DR3 Q;  1CUK A;  3PO2 H;  2Y0S E;  3RNU A;  5M5W H;  1XNQ Q;  2KBN A;  4LF6 Q;  1S40 A;  1X54 A;  3RLN A;  2MO1 A;  4KI0 A;  2WB1 G;  1IBM L;  4BY7 H;  4DV2 L;  1YHA A;  4DR2 L;  4IPG A;  5C0X G;  4IO9 A;  4LF7 Q;  1N33 L;  1SRO A;  5C4X G;  3FP9 A;  2WAQ G;  3GTG H;  4A3I H;  2YTV A;  2BH2 A;  2KCT A;  3D31 A;  3WWV A;  4X65 L;  3KF6 B;  4DR5 L;  1K8G A;  2JA8 H;  4GKK Q;  4UY8 C;  3TQY A;  1VQM A;  5IP7 G;  2HQL A;  3K81 C;  4GS3 A;  4GN4 B;  5M3M G;  1EUJ A;  2OQ0 A;  1JT8 A;  2N8N A;  4R4C A;  4DR4 Q;  2E2J H;  1S3O A;  2JEB I;  4LF5 Q;  1IL2 A;  4EX5 A;  4DK6 C;  2A8V A;  4DV0 L;  1WYD A;  1UE6 A;  5GAE C;  1QVC A;  2FXQ A;  1HZA A;  5LMU L;  3PO3 G;  4A3L G;  5IYC H;  4JI3 Q;  1TWG H;  4KHZ A;  4JYA Q;  2B63 G;  1PYS B;  2K50 A;  3I4O A;  4LUV A;  3STB D;  4BA1 I;  1E24 A;  1WJJ A;  2JEA I;  4BBR G;  4X65 Q;  4HIM A;  2IHF A;  2Y0S G;  2YTY A;  3DM3 A;  4H02 A;  1E1T A;  3W1B A;  4C2M H;  3J7Z C;  2EQS A;  3NEM A;  3I4N G;  3RR5 A;  3J80 i;  2WP8 J;  3UE1 A;  5LMN W;  4DV1 Q;  1Q1B A;  2D0O A;  5JEA J;  1G6P A;  4YHH Q;  4K0K L;  4BA2 I;  1I50 H;  4IJH A;  3W5O A;  5BR8 Q;  1UEB A;  3LGJ A;  3MEF A;  3FKI G;  3CF5 A;  4PZ6 A;  3S1M H;  1Q8K A;  2CKZ B;  5J3B A;  3ULL A;  4A3E H;  2CWP A;  1VQ8 A;  4LF4 Q;  1NY4 A;  2ZTC A;  1RIP A;  1KRT A;  4JI5 Q;  1N9W A;  3G48 A;  4A3K H;  4BBS H;  3PO3 H;  1Z9F A;  1I5F A;  1W3S A;  3HOX H;  4L5R C;  1N32 L;  4A3J H;  2B63 H;  1PH2 A;  4B3S L;  3HKZ G;  4O2D A;  2IHE A;  4NXM Q;  4JC0 A;  1XMO L;  2JA9 A;  4BXX G;  1HNW L;  4DV4 L;  1VQC A;  3H3V H;  2KHJ A;  3S1Q H;  4GNX C;  1BKB A;  2K14 A;  1XPU A;  4KHP Q;  4QIW E;  1Y1W G;  4DUY Q;  3PCO B;  2RHQ B;  3M4P A;  2CWA A;  3RLF A;  5C3E H;  4R4Q A;  4C3I H;  3PUY A;  2VW9 A;  3CCQ A;  4LUZ A;  1PH9 A;  1MJE A;  1U0L A;  1PH7 A;  2JA5 H;  4NXN Q;  3M4O H;  4HJA A;  3T1Y L;  3KYH C;  3ULP A;  2UU9 Q;  3A74 A;  2R7Z G;  1OXS C;  3HOZ G;  4DV7 L;  4IFD G;  1B8A A;  4A3F G;  1K73 C;  1NTG A;  3G6E A;  3GTL H;  2YTX A;  2K75 A;  3M85 A;  2VL6 A;  2ZJP A;  2N49 A;  4DV5 Q;  4DV6 L;  4LF9 Q;  4GKJ Q;  2Z6K A;  2IX0 A;  2C35 B;  1TWH H;  1U5K A;  1YEZ A;  2K5V A;  4TVA B;  4EQ5 A;  4JG2 A;  4DR7 L;  3DLL A;  3CC4 A;  2I5H A;  4X66 Q;  1L1O B;  3NEL A;  1SFO H;  1UE1 A;  1YBY A;  2JK8 A;  3ER0 A;  4BXX H;  4IFD I;  4Y52 H;  1E3P A;  4IPC A;  5M5Y H;  3A5U A;  3GTK H;  5K36 G;  2UUA Q;  4UP9 A;  1K0R A;  4DR1 L;  4YCU A;  1YIJ A;  1QUQ B;  5ELN A;  1X3G A;  1PH6 A;  4BY1 H;  4TQU S;  3CCU A;  4MZ9 A;  2KCM A;  2KHI A;  2PI2 E;  2GVB A;  5EAY A;  1N36 Q;  4JI0 Q;  2R6G A;  2UUC Q;  1BBW A;  4JV5 L;  1PH5 A;  2HHH Q;  2VUM H;  2WB1 E;  4YY3 Q;  3PO2 G;  3G4S A;  5C4J H;  1IYJ B;  3HOZ H;  2XGT A;  3SGI A;  4A3F H;  1SMX A;  3CMA A;  1FJG L;  1LYL A;  1A63 A;  4BY7 G;  1G29 1;  1VQD A;  2YYZ A;  3CCR A;  4IOC A;  2OTL A;  2WAQ E;  1JJG A;  2UUB L; 
#chains in the Genus database with same CATH topology
 1ICW A;  3PO2 B;  4QB4 A;  5M5W B;  2VZA A;  4JI1 L;  1GO3 E;  3OW7 A;  3A55 A;  5K36 H;  2VS1 A;  5GQO A;  5FLM H;  1Q90 A;  4LNQ A;  1TWC B;  2HIV A;  4MNO A;  2F4V Q;  2F0T A;  1V1P B;  2VQE Q;  4ZQ3 A;  3E0E A;  3HOU B;  4NB3 A;  2K04 A;  4B3R L;  1B1Z A;  2V4D A;  1XTD A;  2CVR A;  1GUT A;  1MD2 D;  4DF7 A;  4LFB L;  1L2F A;  2SEB D;  1X3F A;  1IXR A;  2R7D A;  4OON A;  3T13 A;  3CW2 C;  2D9U A;  1XNR L;  2AQ3 B;  2AQ2 B;  1XYI A;  1N33 Q;  3GO5 A;  4M1U B;  4PZ7 A;  4JI6 L;  4A3B H;  3DWQ A;  1PRT C;  4Z9C B;  1HQR D;  4OO1 G;  4JI8 L;  5M3F H;  1X9N A;  4F88 A;  2R92 H;  4G4K A;  3A8K E;  3NTH A;  2B63 B;  3TN2 A;  2A6E C;  4GLV B;  1K3R A;  1II3 A;  5IGG A;  2Q2T A;  1NNX A;  5KRU A;  1SNC A;  2L12 A;  1MIU A;  3VYU A;  1FGB D;  5LMU Q;  3AMU A;  2JN4 A;  1SLJ A;  3S17 H;  2EPB A;  2K6A A;  4GLA C;  1K83 H;  5C5M A;  2ZJQ A;  2A69 D;  4K0K Q;  1VQI A;  4KLK A;  4DXG A;  5IGB A;  4AYB E;  2BDN A;  5C3W A;  1EOT A;  1HNX L;  4UP8 A;  1A6X A;  1A2U A;  1AW7 A;  2F0M A;  1B53 A;  1ENC A;  3A7A B;  1PFB A;  2UXC L;  4AH6 A;  1ILQ A;  1N8R C;  1M1K C;  1ILP A;  1ENF A;  4CDC C;  1N32 Q;  3PGZ A;  2C5C A;  3GP7 A;  1M8A A;  5FO7 B;  3MFY A;  2MUY A;  1ML0 D;  4RGO S;  3RZD H;  1C7Y A;  3J80 L;  3UI2 A;  4ODG A;  2UXB L;  3CAM A;  4KJN A;  1CQV A;  4HAE A;  4AYB G;  5FLM G;  3T1H L;  4IFD J;  1O7Y A;  3CRL C;  3JAM E;  1EOV A;  4B08 A;  1QIL A;  1TY2 A;  1G51 A;  4AYB B;  1STH A;  5KNB A;  1UE7 A;  2HDM A;  1UNS A;  1EQV A;  4GZY C;  2M2L A;  3PUV A;  3FEW X;  5CV4 A;  1VQ5 A;  4C3J H;  4A93 H;  1NSN S;  2G9D A;  5G3L D;  1SYE A;  1SYG A;  1ROD A;  3E9I A;  1A3U A;  2KEN A;  4JI7 L;  3A8J E;  3J80 E;  1KNE A;  1Q12 A;  2PI2 A;  2QGQ A;  4BS9 A;  1WFQ A;  3AFQ A;  3KDF A;  4A3I B;  1LAC A;  5F2D A;  3CPF A;  3M7G A;  1B4O A;  1JE5 A;  2VY3 A;  4JVZ A;  2I5M X;  1TVX A;  1IZ6 A;  2N55 A;  4DR6 Q;  2E2J B;  3KOJ A;  2ZXO A;  1EIH A;  2D62 A;  2IX1 A;  1B70 B;  2R92 G;  1KD1 C;  3S2H H;  1T9H A;  4LF7 L;  4A3B B;  1EZ8 A;  1GXD C;  1RDP D;  1PH1 A;  3R2T A;  5M3F B;  1SDF A;  2A6H C;  2R92 B;  2VQF Q;  4XTC S;  2R93 G;  1E1O A;  5GRO A;  3OTO Q;  5IP9 H;  2NYZ D;  4DNI A;  1VQK A;  2EYM A;  1SEB D;  1TS3 A;  1HA6 A;  1WTX A;  5IYB H;  1X32 A;  4KV6 A;  1S5C D;  3S17 B;  4JCV E;  4P75 A;  2L1B A;  1E2V A;  1KAW A;  4JYA L;  1D1K A;  4FXD A;  1K83 B;  2YU9 H;  4DR4 L;  4R8I A;  1KIX A;  4O0A A;  4DV1 L;  4JBK A;  4A4I A;  2JA6 H;  1VMP A;  5KND A;  1VQJ A;  2EXZ A;  2E5L Q;  2HCC A;  1IL8 A;  3HOW G;  3M4O B;  4XYQ A;  2Z0S A;  5IE8 A;  1PYW D;  1GVP A;  2E8G A;  1BCP D;  5COR A;  5T1I A;  5HUR A;  1HH2 P;  1SNO A;  1KC8 C;  1IW7 D;  1SMY C;  1WTW A;  2HD3 A;  3NHH A;  2HCI A;  3I70 A;  2EXD A;  2Q8T A;  3RZD B;  1M90 C;  1S5B D;  2J4X A;  5M3M H;  4CKB A;  3U58 A;  2KVM A;  1R9T H;  3J81 L;  2O5J C;  2BA1 A;  1TII D;  4BY1 B;  1SRU A;  2B2Y C;  1TQO A;  5I6W A;  5FO9 B;  5I2Y A;  1DCZ A;  4DV5 L;  4IUV A;  3KJP A;  2FMC A;  5C4J B;  3I2Z A;  1HNZ Q;  3BVM A;  2XTI A;  3MVV A;  4C3J B;  4A93 B;  1EIY B;  1Z47 A;  4OEL B;  3F8T A;  4DV3 Q;  2UUA L;  4LAA A;  5IIF A;  5KYI A;  1DOL A;  4PMW A;  3S15 H;  2NVT H;  4LF8 Q;  4NW2 A;  1F2L A;  4WFN 3;  1HUN A;  3DEP A;  3L3O C;  1I6V C;  2HHH L;  2UXD Q;  4IJL A;  3K0Y A;  5C3X A;  1Y1V H;  2H5X A;  4UP7 A;  3TRE A;  3U9S A;  3PIP 3;  1L0Y B;  3I3C A;  3J81 E;  4HJ5 A;  1JQY D;  1J5E Q;  4HMJ A;  1PHJ A;  4HID A;  3R93 A;  1FR3 A;  2R61 A;  2E2D C;  1I4H A;  5CV7 A;  4A75 A;  4GN5 A;  1I94 L;  1EY4 A;  3QR8 A;  4HSP A;  5IP9 G;  3CC2 A;  3S2H B;  3BVG A;  2RF4 A;  1SAP A;  1Y14 B;  5BN3 A;  4IFD H;  4B9W A;  5IYB G;  3NBH A;  4G7H C;  2DNE A;  1I4G A;  4LFA Q;  3O13 A;  1YZ6 A;  3IL8 A;  4OWX B;  3H91 A;  3MXG A;  3T4A C;  4LK1 C;  5ELO A;  2QIL A;  2AHO B;  4A3M H;  1FNW A;  1VDZ A;  2MP1 A;  1CZG A;  3I4L A;  4FDB A;  4JOI A;  2JA6 G;  2M9V A;  3HFZ B;  4OX9 Q;  3EN2 A;  3MZ5 A;  1IBL Q;  2HDL A;  3VA7 A;  4QGU A;  2IY5 B;  1CUK A;  2KBN A;  4LF6 Q;  1S40 A;  1XTC D;  3LWE A;  4DR2 L;  1SRO A;  4CJ2 C;  4FO2 A;  2NZ1 D;  4ILW A;  3TP6 A;  2DJF C;  4Q5V A;  1CZW A;  4CKC A;  1F2Y A;  1K8G A;  1JB3 A;  4UY8 C;  1VQM A;  3K81 C;  4GS3 A;  4G57 A;  1EEF D;  2EOT A;  5M3M G;  3CU7 A;  3V2T A;  1D6E C;  1S3O A;  2JEB I;  5E4W C;  4EX5 A;  4DK6 C;  4C3H B;  3PO3 G;  2KA7 A;  5M3M B;  5IYC H;  3URY A;  3I4O A;  2JEA I;  1R9T B;  1C48 A;  3HRZ C;  3W1B A;  2EQS A;  2IWH A;  3J80 i;  3RR5 A;  3UE1 A;  3RD4 A;  5JEA J;  1G6P A;  5CMD A;  2B2V C;  4DN4 M;  4YHH Q;  2TMP A;  3CF5 A;  4LMQ D;  4C3I G;  4FF1 A;  2CKZ B;  1PMR A;  1LTB D;  4A3E H;  4X3T A;  2CWP A;  4LF4 Q;  1KRT A;  5C6A A;  3FPU B;  3CQZ B;  4ABN A;  1CTM A;  4O1N A;  1RHP A;  3J7A F;  5JVH 3;  3ERO A;  3S15 B;  4NXM Q;  4JC0 A;  4BXX G;  1C4Q A;  4E6I A;  1IYU A;  1TS4 A;  2KHJ A;  2RVL A;  5KIX A;  1Y1V B;  1XPU A;  1MBY A;  3MFG A;  4DUY Q;  2RHQ B;  1CT1 D;  1PH9 A;  4XT3 B;  5A2Q E;  3OHX C;  4NXN Q;  3IAY A;  4LUZ A;  2G5D A;  2K01 A;  3T1Y L;  3KYH C;  2UU9 Q;  1MGS A;  3HOZ G;  1KTK A;  4DV7 L;  4IFD G;  4A3F G;  4ZCK A;  2K75 A;  3A7L A;  2PQE A;  1IHZ A;  2N49 A;  2Z6K A;  2IX0 A;  1YEZ A;  4EQ5 A;  4U68 A;  4JG2 A;  4RHR A;  5C4H A;  1SFO H;  1UE1 A;  4Y52 H;  4TSS A;  1JOO A;  2EJM A;  4UP9 A;  1E0B A;  1QUQ B;  2F0N A;  3ND9 A;  2KCM A;  1B3A A;  1RJT A;  5EAY A;  4JV5 L;  2R6G A;  2UUC Q;  2EYJ A;  3J7A V;  2WB1 E;  4A3M B;  3OWE B;  1PZI D;  3K5O A;  3VR6 A;  2XGT A;  1FJG L;  1KNA A;  4CDD C;  1LYL A;  4S3S A;  1ICF B;  4HCS A;  2WAQ E;  5AFW A;  2WV6 D;  2EJF C;  3CME A;  1PH3 A;  2ZJR A;  1M4V A;  1Y8P B;  3SK5 A;  5IT9 L;  2ZM6 L;  4B3T L;  1VQ6 A;  3CC7 A;  2Z4H A;  2LFN A;  3J7A 5;  3M9B A;  1CM9 A;  3T16 A;  3K7U C;  2F0L A;  2B2V A;  5IYC G;  1B7Y B;  1HZB A;  4QY7 A;  2D0P A;  3PF4 A;  1KQS A;  3A8I E;  4ZKB B;  1JJ2 A;  2AUJ D;  3G7L A;  2AWO A;  3DUZ A;  2BE5 D;  3N52 A;  2WB1 B;  1KAB A;  3I4M H;  1TWF H;  4NKL A;  4CDE C;  2PPB C;  1CQF A;  5C0X I;  1Q8I A;  4A3E G;  2WAQ B;  2DJG C;  4RA8 A;  1ESF A;  2SNM A;  2JP1 A;  3J81 i;  1IBM Q;  5IT9 E;  1HJP A;  3HKZ E;  3NEN A;  3ZYY X;  1VQN A;  1OXU A;  1K0S A;  4HMI A;  4A3E B;  4LFC L;  4DKA C;  2OT2 A;  2LS0 1;  1NJI C;  1QVF A;  2C9O A;  2MFI A;  3OIQ A;  5DNF A;  4IN3 A;  1DGS A;  2OCE A;  3C3L A;  1SBB B;  3VDY A;  5J22 A;  4RH6 A;  2ID0 A;  4X62 L;  3E6Z X;  1A3T A;  2NTS A;  1UAP A;  3BZC A;  4JI4 L;  3JC6 6;  1VQG A;  1TS5 A;  1N34 L;  1RCV D;  1IYV A;  2RBM A;  5TSS A;  2Q8R E;  3CCS A;  4A3D H;  5IYD H;  4L63 B;  3UDF A;  4JI2 L;  2NN6 H;  1V8Q A;  3HKZ B;  3WOE A;  2EYP A;  3T56 B;  2ZTD A;  3CPW A;  4H13 C;  1HPC A;  1X56 A;  4JW0 A;  5ELC A;  1GUO A;  5LHY 1;  1LT3 D;  2SOB A;  3DHQ A;  4F8M A;  3LX0 A;  5AJ3 L;  2K7V A;  4LWC A;  3H0G H;  3PIO A;  2FHT A;  2Q2H A;  1AE3 A;  3DMU A;  1I4P A;  3A0J A;  4IQZ A;  2DN8 A;  4K8J A;  3J7Y W;  2H4O A;  5I6Y A;  4DV4 Q;  1HNW Q;  2EYH A;  1PYB A;  4MN3 A;  1PTO B;  4HN7 A;  4P73 A;  1K3B C;  5NUC A;  1F9R A;  2V1C C;  2A69 C;  4DGZ A;  3GD7 A;  1U4M A;  4HIK A;  1XMQ L;  1IKM A;  2ZT9 C;  2EE1 A;  1FGU A;  3S1R H;  4A3C H;  4G7Z C;  1OXX K;  3G6J B;  3GTM H;  3KUP A;  4DR7 Q;  4WJ3 M;  4PG3 A;  1SSO A;  4K14 A;  4P74 A;  3SDZ A;  2I5L X;  4V0B A;  4DUZ L;  4HJ8 A;  4KY5 A;  3X3M A;  4B3M L;  3BU2 A;  5JOB A;  2B2W A;  1V1P A;  3BYY B;  4I7Z C;  2L9H A;  4K6L A;  1EYA A;  3I4M G;  1W6J A;  3NXW A;  1YNX A;  1QB5 D;  1SJH D;  1EY9 A;  1A0I A;  2F52 A;  4NDX A;  4YWL A;  1CKN B;  1TWF B;  4ALP A;  4HJ7 A;  2DNC A;  1OXT A;  1GKH A;  3EA6 A;  4IPD A;  2UUB Q;  1PVO A;  1HR0 L;  1DD2 A;  4KKS A;  1XNQ L;  1EIF A;  1V43 A;  1VQB A;  1R4P B;  3AFP A;  5I4D A;  1JCK B;  3OSO A;  2IJ0 A;  2QEX A;  2PO4 A;  2K33 A;  3I7F A;  2WKC A;  1YNJ D;  3ZJY C;  2WFW A;  1A62 A;  3DEO A;  1AZP A;  3R8B A;  3I8Z A;  4GKK L;  3EFX D;  2CW0 C;  4AIM A;  5I9P A;  2B2U C;  1WTR A;  4LF5 L;  2DGY A;  1HUM A;  3K8A A;  5G3L F;  5FLX E;  1XPO A;  2B8F A;  1QZG A;  2OTJ A;  2F1M A;  4A3D G;  1B9N A;  3PUX A;  5IYD G;  1IBK Q;  2QDB A;  4XQJ A;  1AP0 A;  2HT1 A;  3U4Z A;  1YVC A;  4N9P A;  2E2I H;  2JQO A;  2NN6 G;  1SR3 A;  2F0V A;  4A3D B;  5JEA G;  5E7N A;  4DFA A;  2R93 H;  4X3K A;  2K4K A;  3HS0 C;  1HR0 W;  1YJ9 A;  1PZK D;  2N78 A;  3H0G G;  4OEM B;  3MXN B;  1TR5 A;  3C1E A;  4FNF A;  1QNU A;  1QOH A;  3W1G A;  3ERS X;  4ZUJ A;  4JI5 L;  4PQX A;  4DK3 C;  2RSN A;  5C4X H;  4EQN A;  3OIP A;  1GD7 A;  1S5E D;  3GTL B;  1EQR A;  1F77 A;  2EYF A;  3Q8D A;  3JAM L;  4FVM A;  1EYG A;  1LTR D;  2K05 A;  4RGN A;  1DZ1 A;  3WDN A;  3T53 B;  2L15 A;  2LXJ A;  1G8Z D;  5EKI A;  4R8N A;  1BF4 A;  3PUW A;  2RDF A;  1QVG A;  3G71 A;  4A3C G;  2WAC A;  5JJZ A;  2KEE A;  1O7I A;  1SE4 A;  3E3X A;  3L2P A;  3I91 A;  2GN5 A;  2GVA A;  3HOW H;  2ZTE A;  3D4D A;  5FOB B;  3S1R B;  2RCF A;  3AB9 A;  4B9X A;  4GKJ L;  2NWG A;  1NAP A;  4LF9 L;  3GTM B;  5M5X H;  1S4Z A;  3QOL A;  2A74 C;  4K2L A;  3FKI H;  3E0J A;  1LT6 D;  3NWS A;  3CXC A;  5HY6 A;  4AQY Q;  2KEC A;  2RKS A;  2K52 A;  2E74 C;  1IW7 C;  3GV6 A;  3J81 j;  4X6A H;  1ESR A;  4JI0 L;  4P72 A;  3KBG A;  1BCP F;  1ZYR C;  4YY3 L;  2RDH A;  3LNN A;  4NPS A;  5JPM C;  4YIJ A;  2K5W A;  2XRS D;  1LTI D;  4X64 Q;  1GUN A;  3BJU A;  1G91 A;  4KD3 A;  2K5D A;  1RKN A;  1A8V A;  2GA4 B;  3VR5 A;  2CCZ A;  4RWS C;  1F9S A;  1XX8 A;  1O7Z A;  2R7Z H;  2NVY H;  5E3F A;  4HJ9 A;  1L1O C;  3HGB A;  2ASB A;  2CQO A;  2F4V L;  3F2U A;  1NBW A;  1OXV A;  1RTN A;  4EQP A;  1PFS A;  5A35 A;  1BBX C;  1FNV A;  1B9M A;  2VQE L;  3P1H A;  1B50 A;  3EQL C;  1PRT B;  4XIG S;  3U9O A;  1GHJ A;  2O2L D;  1FYC A;  1GUW A;  2E2I B;  3NP8 A;  2ICE C;  4DR3 Q;  3PMF A;  3OWF A;  1GUS A;  2A6E D;  1LO5 D;  4RKL A;  3RLN A;  1EEI D;  2R93 B;  1LTA D;  2FFK B;  1BO0 A;  1WD0 A;  4IO9 A;  1EU3 A;  1N33 L;  5C4X G;  1EY7 A;  2L0C A;  1ZXT A;  3CRK C;  2YTV A;  2BH2 A;  3WWV A;  4X65 L;  2JA8 H;  5E1F A;  3SK4 A;  4WOR A;  2ICI A;  4ZUI A;  5IGC A;  2B2T C;  1UE6 A;  3I90 A;  4XT1 B;  5ELF A;  1QVC A;  5LMU L;  1EZ6 A;  4C56 C;  4JI3 Q;  4KHZ A;  1PYS B;  2K50 A;  4KY7 A;  1VF5 C;  2YTY A;  4H02 A;  1DJR D;  1PDQ A;  1QE6 A;  1S5F D;  1Q1B A;  2IPK D;  3QO2 A;  1B2T A;  1BR9 A;  4K0K L;  1I50 H;  4K2K A;  4IJH A;  2PNR C;  4XYO A;  5BR8 Q;  3HOW B;  3FKI G;  1EY6 A;  2NBF A;  4EGV A;  3NQT A;  4PZ6 A;  3S1M H;  1Q8K A;  5M5X B;  5K5P A;  1F9Q A;  5IGF A;  5J3B A;  1NY4 A;  2D5D A;  4JPB W;  1RIP A;  1JOQ A;  2I46 A;  1F2Z A;  1YNN D;  3PO3 H;  1U9R A;  3HOX H;  1N32 L;  1PH2 A;  1AN8 A;  4J1M A;  2E75 C;  3BS1 A;  3H3V H;  1ZEQ X;  1NUC A;  5IOD A;  3S1Q H;  3H3V C;  4GNX C;  1SNQ A;  1BKB A;  2F0I A;  2KOL A;  4KHP Q;  1CHQ D;  3PCO B;  3RLF A;  5C3E H;  4R4Q A;  4C3I H;  4L6T B;  2JA5 H;  2R7Z G;  2AUK A;  3MWY W;  1K73 C;  1NTG A;  2PW7 A;  1GJX A;  1DOM A;  2YTX A;  1SYD A;  2BOS A;  2G9H D;  4O42 A;  2PZT A;  2K5V A;  1D2B A;  2NVY B;  3CC4 A;  4X66 Q;  1L1O B;  1AZQ A;  4BXX H;  4IFD I;  4IPC A;  5M5Y H;  3GTK H;  1BOS A;  4CJ0 B;  1K0R A;  4C1N I;  4QCL A;  1X3G A;  2Q8I B;  2A73 B;  3BVZ A;  5COY A;  1N36 Q;  2I07 B;  5D14 A;  2VUM H;  3KLS X;  3G4S A;  3CKI B;  4KJO A;  1IYJ B;  3HOZ H;  1RD9 D;  4WJW A;  3OMG A;  1F9P A;  3E5S A;  5DAU A;  3SGI A;  4A3F H;  2A6H D;  1G29 1;  3P20 A;  2JSO A;  2Z6B A;  1FD7 D;  1D1I A;  2HUG A;  3QG1 A;  5IY0 A;  2VB3 X;  1Q82 C;  4DR6 L;  4RG1 A;  5EGT A;  1TS2 A;  2JA8 G;  4K8I A;  4TRD A;  2AKW B;  4L5T A;  3TBI B;  2WII B;  2BH8 A;  3EJI A;  3NPP A;  4HR7 B;  2F3V A;  4R4I A;  2YU9 B;  5JJI A;  2VQF L;  3OTO L;  4ZRZ A;  5E4X A;  2K32 A;  2K28 A;  1Q81 C;  1WVL A;  2JA6 B;  2CHB D;  3S9W A;  4GOP C;  1WTP A;  1JOR A;  4RMF A;  5IWA Q;  4KY6 A;  1SYB A;  5LMN Q;  1YJN A;  2EVB A;  4HSV A;  3ICE A;  3W2D A;  3JAM i;  1H95 A;  1H9K A;  4OHJ A;  2A68 D;  5D65 A;  1EFI D;  1MSH A;  2B2Y A;  1A15 A;  1STB A;  5M9O A;  1KLG D;  3M3Y H;  5I9O A;  1HA5 A;  1B44 D;  4DV2 Q;  1ET6 A;  4OXP A;  5C0X J;  4UHV A;  3R2I A;  1VQF A;  3HOX G;  4GNX A;  2MPM A;  4A3G H;  2XVS A;  3NSW A;  4KK7 A;  1HFG A;  1LTS D;  3ERQ A;  2E5L L;  4DR5 Q;  1I6H H;  3CP0 A;  4POF A;  5D3I B;  2NB0 A;  5FJ8 G;  3PO3 B;  5A2Q L;  5CV8 A;  3GTO H;  1E22 A;  1P8L A;  3IKJ A;  3PV0 A;  1GM5 A;  4A3L G;  3VR4 A;  4L5Q A;  1SE3 A;  3KFU A;  4QMG A;  5C3E G;  4DV0 Q;  3TS2 A;  4RHS A;  2PCF B;  2JA5 G;  5C5L A;  1VQL A;  5CGK A;  1G6Z A;  4GNX B;  3TRZ A;  3QB3 A;  4GN3 B;  1WCM H;  2CFM A;  3S2D H;  2KQ3 A;  1ASZ A;  2BA0 A;  4C3I B;  2JA5 B;  4IZ8 A;  1JWM D;  2B8G A;  1STN A;  2NVT B;  1G2T A;  1VQA A;  5KEE A;  1L0W A;  2K03 A;  4DNR B;  3FVQ A;  3STB C;  1HNZ L;  2OWO A;  3D0F A;  3Q0A A;  3FRP B;  1SYC A;  1I3Q H;  3I72 A;  5M5Y B;  1FNU A;  2VUM G;  3BDC A;  3PIP A;  5C44 H;  1ZKO A;  4DV3 L;  1QUQ A;  1Q86 C;  4B3S Q;  4P71 A;  3SK6 A;  4U67 3;  2MHV A;  1PH8 A;  1XMO Q;  4LF8 L;  2ALY B;  4DNT B;  1U4L A;  1GHK A;  2FIN B;  3AEV A;  1SJE D;  2UXD L;  2YV5 A;  3HOZ B;  4A3F B;  1YI2 A;  2PNH A;  1J6Q A;  1J5E L;  3S14 H;  4OIK A;  2ES2 A;  1JR0 D;  1YHQ A;  3HOY H;  1D5X C;  1H9S A;  2VB2 X;  1BVS A;  4DV6 Q;  4YWM A;  1K8O A;  3PIO 3;  2XWB B;  2PQA B;  1PLF A;  5BN4 A;  2MNA A;  2VNU D;  4DR1 Q;  5ELE A;  1MHW C;  3TZD A;  4LFA L;  3I73 A;  1CHP D;  1H9S B;  1EYC A;  1MI2 A;  1HFN A;  2NVQ H;  3HEJ A;  1BBU A;  3UE0 A;  3CHB D;  1TT2 A;  3Q6S A;  3L7Z C;  2ZXP A;  2N3S A;  2DY7 A;  5EKK A;  3HOV H;  2F0W A;  3R3O A;  4OX9 L;  1IBL L;  4A3G G;  4ZYS A;  5HGT A;  1T5X D;  2Q2U A;  4JI1 Q;  1D7Q A;  2JA7 H;  3M3Y B;  4LF6 L;  3K5N A;  1I4Q A;  1PTO F;  2F0E A;  1OTC A;  2J7Z A;  1PFN A;  4FF2 A;  5IOC A;  4Y7N H;  4A3G B;  1AE2 A;  3J80 c;  4DPG A;  2MJ8 A;  5GAG C;  4ME5 A;  4NMZ A;  1AEX A;  3I56 A;  5J1Z A;  1EWI A;  4UPA A;  3GTO B;  1KL9 A;  2NUC A;  1WCM G;  5KGU A;  4BWG B;  1VQE A;  2A1A A;  3GTP H;  3TEH B;  2B29 A;  2F03 A;  1ASY A;  2I0Q A;  4B3R Q;  1A2T A;  1CSQ A;  3P7J A;  1QWY A;  1NE3 A;  4PZ8 A;  1TWC H;  4K5X A;  1D5M C;  4LFB Q;  1YJW A;  1O78 A;  4ULL A;  3SEB A;  3X3N A;  2CH4 W;  4YHH L;  1NMG A;  2E2H H;  1A3V A;  1XNR Q;  4KHV A;  4OO1 I;  3HOU H;  3DWP A;  2Z1C A;  5C44 G;  1XPR A;  4JI6 Q;  2NN6 I;  4LF4 L;  1YNJ C;  4JI8 Q;  1KDB A;  2CH4 A;  1EY5 A;  1SNM A;  3C2P A;  3K0X A;  2P5Z X;  1VMC A;  5C0X H;  4KD4 A;  5C44 B;  4GLX A;  3D4R A;  3RN5 A;  3NTI A;  2HIX A;  4R4T A;  3K80 C;  1HTP A;  4NXM L;  1HHV A;  1VCI A;  2AQ1 B;  1K28 A;  2B3G A;  2RSO A;  3HOY G;  4J6H A;  5JEA H;  1SFO B;  4L8J A;  5DLQ E;  5GAH C;  5CYU A;  3TP5 A;  4DUY L;  3SK8 A;  2IL8 A;  5GAD C;  4NXN L;  5FKA C;  3S14 B;  2LXK A;  3HZX A;  1Y8N B;  3HOY B;  5EPJ A;  2UU9 L;  1SE2 A;  3M4Y A;  3MAQ A;  4BBR H;  3L9A X;  1HNX Q;  2RCN A;  3NK9 A;  3I4N H;  3V96 A;  1JOK A;  1C8C A;  3V05 A;  2H1E A;  4Q0F A;  5EBC A;  3OOC A;  1PTO D;  2UXC Q;  1E2W A;  3L0O A;  2K5Q A;  4UAI A;  1PA6 A;  2F3I A;  1IKL A;  2QKI C;  3NE5 B;  2NVQ B;  4DAY B;  3HOV G;  1QCB D;  4P2C B;  1EIG A;  3IFT A;  2NVX H;  2UUC L;  2XNA C;  3K7A H;  2EY6 A;  1C0A A;  4L5S A;  4PV1 C;  3CCM A;  3BZD B;  2JA7 G;  1CKN A;  2UXB Q;  4K5V A;  3GV3 A;  3HOV B;  1XJV A;  3IRB A;  3FHW A;  3T1H Q;  3SVM A;  3MC0 B;  2MQH A;  5J39 A;  5C4Z A;  3CCV A;  2EJG C;  2F0F A;  1Y1W H;  3VYT A;  1MJC A;  3SHL A;  2N88 A;  4Y7N B;  2R7F A;  4A76 A;  4YWK A;  1STY A;  3ONA B;  5FLX L;  5EBD A;  3E9H A;  3I4M B;  3B6Y A;  5HGQ A;  1FL0 A;  2BDO A;  1S5D D;  2XRQ D;  3J81 c;  1CA6 A;  2OQK A;  1GUG A;  1HZ9 A;  4QJF A;  4LUO A;  1Q1E A;  5CBE E;  1QJO A;  5CBA E;  4JI7 Q;  2JYO A;  3GTP B;  1X6O A;  2F0P A;  3PSI A;  3U50 C;  2L5T A;  4ZAI A;  5T1G A;  1VQ9 A;  2PMZ E;  2F0S A;  1R4Q B;  3U4V A;  5DM7 3;  3KF6 A;  3HOU G;  1TWA H;  3OYY A;  1SN8 A;  3GTJ H;  1S72 A;  3HP3 A;  1G2S A;  3H6M A;  5IGE A;  4FXK C;  2E2H B;  1X54 A;  4KI0 A;  2RQX A;  1TU2 B;  1IBM L;  4BY7 H;  1NR2 A;  4IPG A;  5C0X G;  3MXN A;  4LF7 Q;  3FP9 A;  1LLR D;  3D8G A;  3GTG H;  1LTG D;  4A3I H;  2KCT A;  3D31 A;  2F0H A;  3KF6 B;  1E2Z A;  1EYD A;  1WTH A;  2HQL A;  4JK1 C;  1Z7T A;  1EUJ A;  2OQ0 A;  1JT8 A;  1HCZ A;  2N8N A;  4R4C A;  3D6W A;  2E2J H;  1BUV T;  2EDG A;  1Y8O B;  2XIW A;  2A8V A;  1WYD A;  2LKV A;  2FXQ A;  1HZA A;  4ZK9 B;  2SDF A;  1MSG A;  4XXE A;  1TWG H;  4JYA Q;  1DOK A;  2B63 G;  4BA1 I;  4K5W A;  4BBR G;  2PMZ B;  4X65 Q;  2IHF A;  4DR4 Q;  4C2M H;  3H0G B;  3NEM A;  3I4N G;  2KHS A;  3K59 A;  4DV1 Q;  1PRT F;  2L55 A;  3W5O A;  1UEB A;  3LGJ A;  4BBR B;  2ZXR A;  3VYS A;  5LL6 X;  3I4N B;  3NTK A;  3ULL A;  1NCV A;  2F0O A;  3ITP A;  1VQ8 A;  4X3U A;  2ZTC A;  3G48 A;  4A3K H;  4BBS H;  3KK7 A;  3TME A;  1Z9F A;  1I5F A;  1W3S A;  4IUR A;  3N6R A;  4A3J H;  4N9T A;  4ZLT F;  4O2D A;  3A54 A;  1LTT D;  2EY1 A;  2JA9 A;  3ND8 A;  2O4X A;  2NVX B;  1HNW L;  4DV4 L;  3K7A B;  2XSC A;  2OF1 A;  4IAL A;  4DK1 A;  1Y1W G;  3M4P A;  4F7X A;  4M8A A;  3CCQ A;  3M4O H;  1MJE A;  1U0L A;  4MTK A;  4QF4 A;  1BCP C;  4HJA A;  2OXP A;  3Q22 A;  2B39 A;  3ULP A;  4V19 0;  2QCP X;  1Y1W B;  2F0G A;  1B8A A;  3VR3 A;  4DK0 A;  4DV5 Q;  3M85 A;  2ZJP A;  1Y69 U;  5LL6 S;  1BQQ T;  2C35 B;  1TWH H;  1U5K A;  4DU9 A;  4N8F A;  4RGT A;  2PZU A;  4DR7 L;  2I5H A;  3KLR A;  3NEL A;  1LT4 D;  1YNN C;  3A5U A;  5K36 G;  2UUA Q;  3KF8 A;  1YIJ A;  4YCU A;  2B2U A;  4OL7 A;  5ELN A;  4BY1 H;  4TQU S;  3CCU A;  5CV9 A;  2KHI A;  2PI2 E;  1WD1 A;  1K8M A;  1LAB A;  1PH5 A;  2HHH Q;  1H9J A;  3SE0 A;  4KN4 C;  5C4J H;  1CI3 M;  1U4R A;  4XQQ A;  2BCO A;  1A63 A;  1SMX A;  3CMA A;  5DM6 3;  4BY7 G;  1VQD A;  1TWA B;  2YYZ A;  4IOC A;  3GTJ B;  2PYK A;  2UUB L;  3AYH B;  3KF8 B;  1X65 A;  2RHS B;  3CCL A;  2CW0 D;  1AH9 A;  4A3I G;  2XN9 C;  2JJQ A;  4TKO B;  1I94 Q;  4BY7 B;  4IUT A;  3K5M A;  4RKB A;  3F2B A;  1L0X B;  1PRT D;  3GTQ H;  5CR3 A;  3GTG B;  4JBJ A;  1CKO A;  3GDE A;  2Z4I A;  4CDF C;  1JC7 A;  1JMC A;  3DXJ C;  3D4W A;  4A3B G;  5I2X A;  3A56 A;  5M3F G;  1NR4 A;  5ELD A;  4MIU A;  3DWA A;  1TWG B;  4QUC A;  2QF7 A;  4EVO A;  1JWS D;  3BDL A;  3KDF B;  1VQO A;  1KXL A;  1IBK L;  4POG A;  4C2M B;  5C4X B;  3OPO A;  3EVQ A;  4HTH A;  4RCN A;  1KHI A;  1WTO A;  1EFW A;  1O80 A;  4R4O A;  2J0T D;  4A3K G;  1VQH A;  4BBS G;  1QZH A;  1X55 A;  4DR2 Q;  3S1N H;  3KLS A;  4A3J G;  4I7A A;  4A3K B;  4APV A;  2RA4 A;  2MO0 A;  4BBS B;  1Z6H A;  1JIC A;  1EQQ A;  5H1S E;  4IUU A;  4A3J B;  3QOJ A;  4OWT B;  1V1Q A;  1K8A C;  1HZC A;  1V9P A;  1JWU D;  2IW3 A;  5L37 A;  4KTA A;  5IT9 c;  2PZW A;  5CV5 A;  5ISR A;  3H3V I;  1NMF A;  3BZK A;  3FKI B;  3TDQ A;  4OWW B;  4JOI C;  1CSP A;  1BCP B;  1CKM A;  1YIT A;  2A68 C;  2WKD A;  5EKL A;  2X69 A;  2EZV A;  1F2M A;  2AWN A;  2KJX A;  2EYO A;  1EQT A;  4H0L C;  5FJ8 H;  3S16 H;  1KDC A;  1ZYR D;  1Q3L A;  1TWH B;  4C3H H;  4A3L H;  4BY1 G;  3I55 A;  1L1O A;  1ET9 A;  1SYF A;  4R1J A;  3UDX A;  4AQY L;  4CGY B;  1WI5 A;  3FPP A;  2DUD A;  4IUP A;  4K6D A;  4C3J G;  2F0D A;  4PNY A;  3TZU A;  3K57 A;  4A93 G;  4RFB A;  5KYL A;  2R7Z B;  3TSS A;  1TXY A;  3C46 A;  2JE6 I;  4I65 A;  4NP5 A;  4EQO A;  3P75 A;  3H15 A;  3FDT A;  3CQZ H;  3T1Y Q;  3W3A A;  3ULJ A;  1EY0 A;  4X64 L;  2X6G A;  4DV7 Q;  3TS0 A;  1AFP A;  3OMC A;  3VA5 A;  1VQ7 A;  3GTQ B;  5JAV A;  2EY2 A;  3GQB A;  4KKU A;  3F1Z A;  2NZH A;  3TP7 A;  5JVG 3;  3EBE A;  4FYD A;  2Z8L A;  2QA4 A;  1PV4 A;  1RL2 A;  3NBI A;  2B2T A;  5IGD A;  1E7Z A;  3KLW A;  4JV5 Q;  4XDX A;  4ME3 A;  3RN2 A;  2NZO A;  1UUP A;  1QG7 A;  4WJ4 A;  1LUZ A;  4CBV A;  1VF7 A;  2XWJ B;  4PMB A;  1DYQ A;  1ENA A;  1FJG Q;  2F0Q A;  2JA8 B;  2F0U A;  3MXU A;  5FK9 C;  2K1B A;  1H9M A;  4DR3 L;  3DM1 A;  3VYR A;  3M7N A;  2LMC B;  2KED A;  3NWT A;  1X3P A;  4DA2 A;  3S1N B;  2ZM6 Q;  3BYT B;  4B3T Q;  2Z6K C;  3MHB A;  4FXG C;  2LSS A;  1EL0 A;  4KKT A;  1LT5 D;  1HXY D;  4OGQ C;  1W2B A;  3NQI A;  1STA A;  3NBH B;  1GOZ A;  4YCV A;  1UWV A;  1B3Q A;  1I50 B;  4QL5 A;  1SMY D;  1EU4 A;  1C9O A;  3CCE A;  2Q2I A;  3S1M B;  4N8X 1;  1I4X A;  2A5H A;  3C1F A;  4JI3 L;  3H09 A;  4DXF A;  5JJL A;  1X3E A;  3HOX B;  4FP5 D;  3OW2 A;  4WRD A;  3EIV A;  4C3H G;  2KCC A;  4X3S A;  1D5Z C;  2L4N A;  4YCW A;  5BR8 L;  3S16 B;  1QNK A;  3S1Q B;  2L11 A;  3S24 A;  5EPK A;  2RDG A;  1WTV A;  4LFC Q;  5JPN C;  4FF3 A;  2BE5 C;  5FLX c;  1WTQ A;  4DAP A;  3UDG A;  1PFM A;  3PUZ A;  5C3E B;  3MXP A;  4C1N K;  4RAU C;  3M4Q A;  3VR2 A;  1YHB A;  1JB7 A;  3AU7 A;  4ZKC B;  2KUM A;  3RLO A;  5JJK A;  3F2D A;  2R3Z A;  1MKH A;  4X62 Q;  3FMC A;  4IPH A;  5IP7 H;  4MHE A;  3UDI A;  1BNZ A;  4R9W A;  1UE5 A;  3PF5 A;  4JI4 Q;  4H7B A;  4JBM A;  4KHP L;  1VS0 A;  1WOC A;  1JJC B;  3GTK B;  3TP8 A;  1UEA B;  1N34 Q;  5CV6 A;  4KMU C;  2EYL A;  4XQN A;  2AMC B;  3HG9 A;  4LW1 A;  2IX3 A;  1Y1V G;  1CA5 A;  4J15 A;  2JXM B;  1XXG A;  1EWC A;  2VUM B;  2F3W A;  4JI2 Q;  1SE8 A;  4DAV A;  4IUQ A;  3A5Z B;  2F0K A;  4JBW A;  4MTN A;  4IOA A;  2PQA A;  1LTL A;  1SNP A;  4X66 L;  1JE4 A;  4UDU C;  1VQP A;  5AJ3 Q;  2M00 A;  4GOP A;  3CCJ A;  2OEO A;  3LWU A;  2FJ2 A;  3WOF A;  1I4R A;  2LY7 A;  5D3D A;  1N36 L;  1DON A;  2IT1 A;  2ATW A;  3D6C A;  1RTO A;  1KLU D;  1J9O A;  2O5I C;  3AQQ A;  1RF2 D;  1PXU A;  1LV9 A;  1O7L A;  4RGM A;  4GOP B;  4A3M G;  2EIF A;  1Q46 A;  1XMQ Q;  1CFM A;  4DAM A;  1P16 A;  3JAM c;  2PW5 A;  1VQ4 A;  1PH4 A;  3HKS A;  1Q7Y C;  3KJO A;  1H9R A;  2NTT A;  1V1O A;  1PTO H;  2F4I A;  2K5N A;  4CKE A;  4DUZ Q;  1PTO C;  4B3M Q;  1BDO A;  5EPL A;  1STE A;  2K5H A;  1TKW B;  1KRS A;  1FVI A;  4F87 A;  2CQA A;  3QIA A;  1K9M C;  4QQB X;  3MEH A;  5CC4 A;  5IWA L;  4LJZ C;  2A19 A;  4RCO A;  5LMN L;  1DXM A;  3RZO H;  3F2C A;  1D8L A;  1I6H B;  3SXH A;  1LM0 A;  1OO9 B;  4HIO A;  3H94 A;  4CJ1 B;  5EQ0 A;  3QWN A;  1HR0 Q;  4HCE A;  3PO2 H;  2Y0S E;  3RNU A;  5M5W H;  1XNQ Q;  2VXW A;  4H44 C;  3KBX A;  2MO1 A;  2WB1 G;  1CK1 A;  4DV2 L;  5BN5 A;  1YHA A;  1DM0 B;  1WCM B;  5FO8 B;  3S2D B;  4KN7 C;  2WAQ G;  1EY8 A;  1TY0 A;  4GKK Q;  4DR5 L;  4FF4 A;  1KDA A;  3TQY A;  4J8Q A;  3SR1 A;  5IP7 G;  1EWH A;  4GN4 B;  2B2W C;  5DEH A;  1W6K A;  4G7O C;  4QUF A;  4LF5 Q;  1IL2 A;  4DV0 L;  3RMH A;  5GAE C;  2HQE A;  2TSS A;  3D3R A;  3K58 A;  4LUV A;  3STB D;  1E24 A;  1WJJ A;  3MTS A;  2SNS A;  1I3Q B;  4HIM A;  3J7Z C;  2Y0S G;  2Z9H A;  3DM3 A;  3CD6 A;  1E1T A;  1BXT A;  1SXT A;  5LMN W;  2WP8 J;  2ENB A;  2D0O A;  2WIN B;  4PMC A;  4BA2 I;  5KNC A;  2F0J A;  1ONL A;  2EY5 A;  3MEF A;  3RUZ A;  2Y0S B;  2E76 C;  1SND A;  4JI5 Q;  1N9W A;  1HQM C;  4L5R C;  1T5E A;  2B63 H;  4B3S L;  3HKZ G;  3QJY A;  4DAY A;  2IHE A;  2QEJ C;  4OO1 H;  1XMO L;  3NUC A;  3Q24 A;  2DY8 A;  1HTL D;  1VQC A;  3BDO A;  1PZJ D;  1XWE A;  2K14 A;  4CHT B;  4QIW E;  2QW7 A;  2KCN A;  4HED A;  2CWA A;  2VW9 A;  3BG3 A;  3PUY A;  1PH7 A;  3K5L A;  3A74 A;  1STG A;  1OXS C;  5ELB A;  3G6E A;  3Q23 A;  3GTL H;  1J8I A;  2VL6 A;  4GKJ Q;  4LF9 Q;  4DV6 L;  4TVA B;  4ID6 A;  3DLL A;  2FMM A;  1YBY A;  2JK8 A;  3ER0 A;  4OIJ A;  1E3P A;  2QDL A;  4DR1 L;  5EJW A;  1HRJ A;  2JA7 B;  1PH6 A;  4IUN A;  3K6O A;  2D2C C;  4MZ9 A;  1U4P A;  1KAA A;  2GVB A;  4JI0 Q;  1BBW A;  1X3Q A;  4YY3 Q;  3PO2 G;  3IFD A;  2MGS A;  3RZO B;  3T51 B;  1JJG A;  3PQI A;  2X6L A;  3CCR A;  2OTL A;  3MA2 B;  4QIW B; 
#chains in the Genus database with same CATH homology
 3AYH B;  5IY0 A;  3CME A;  3KF8 B;  1X65 A;  2RHS B;  1Q82 C;  1PH3 A;  2VZA A;  4JI1 L;  4DR6 L;  3CCL A;  4RG1 A;  2ZJR A;  1AH9 A;  4A3I G;  2JJQ A;  1I94 Q;  1GO3 E;  2JA8 G;  2AKW B;  2VS1 A;  4L5T A;  3F2B A;  2BH8 A;  2ZM6 L;  5GQO A;  5FLM H;  4B3T L;  1VQ6 A;  4LNQ A;  3CC7 A;  3GTQ H;  4JBJ A;  2HIV A;  1CKO A;  3GDE A;  4MNO A;  4R4I A;  5JJI A;  3J7A 5;  2VQF L;  3M9B A;  2F4V Q;  3OTO L;  1JMC A;  3K7U C;  5IYC G;  1B7Y B;  1Q81 C;  4A3B G;  2VQE Q;  1HZB A;  4QY7 A;  2D0P A;  3E0E A;  4GOP C;  1KQS A;  3PF4 A;  4RMF A;  5M3F G;  5IWA Q;  1JJ2 A;  4NB3 A;  4B3R L;  2AWO A;  5LMN Q;  1YJN A;  1XTD A;  3KDF B;  3ICE A;  1VQO A;  3JAM i;  3I4M H;  1TWF H;  1KXL A;  1H95 A;  1IBK L;  4POG A;  4LFB L;  1L2F A;  1X3F A;  1IXR A;  5C0X I;  2R7D A;  4A3E G;  1KHI A;  4OON A;  1EFW A;  3CW2 C;  3M3Y H;  4R4O A;  3J81 i;  1IBM Q;  4A3K G;  1VQH A;  4DV2 Q;  1XNR L;  4OXP A;  5C0X J;  1QZH A;  1HJP A;  1X55 A;  3HKZ E;  3NEN A;  4DR2 Q;  1VQN A;  1OXU A;  1VQF A;  3HOX G;  3GO5 A;  4GNX A;  1N33 Q;  3S1N H;  4A3G H;  4PZ7 A;  4A3J G;  4JI6 L;  4A3B H;  4LFC L;  4DKA C;  2E5L L;  1NJI C;  4OO1 G;  4JI8 L;  4APV A;  5M3F H;  2MO0 A;  4DR5 Q;  1X9N A;  1QVF A;  2R92 H;  3CP0 A;  4POF A;  4BBS G;  1I6H H;  5FJ8 G;  2MFI A;  5H1S E;  1EQQ A;  3GTO H;  1E22 A;  1P8L A;  1DGS A;  2OCE A;  4OWT B;  3PV0 A;  1V1Q A;  4GLV B;  1K3R A;  1GM5 A;  3VDY A;  1HZC A;  4L5Q A;  1K8A C;  1V9P A;  2Q2T A;  3KFU A;  5C3E G;  4DV0 Q;  1MIU A;  2ID0 A;  4X62 L;  3TS2 A;  2JA5 G;  5LMU Q;  5IT9 c;  1VQL A;  4GNX B;  3TRZ A;  1SLJ A;  3S17 H;  3H3V I;  4GN3 B;  1WCM H;  3BZC A;  2CFM A;  4GLA C;  4JI4 L;  3S2D H;  1NMF A;  3BZK A;  3JC6 6;  1ASZ A;  2BA0 A;  1VQG A;  4OWW B;  4JOI C;  1K83 H;  1CSP A;  1CKM A;  1YIT A;  1N34 L;  2ZJQ A;  4K0K Q;  1VQI A;  4KLK A;  3CCS A;  4A3D H;  4AYB E;  5IYD H;  1HNX L;  2AWN A;  3UDF A;  5FJ8 H;  3S16 H;  4UP8 A;  1VQA A;  4JI2 L;  1L0W A;  4C3H H;  3STB C;  4A3L H;  4BY1 G;  3I55 A;  1HNZ L;  2OWO A;  1L1O A;  2ZTD A;  3D0F A;  3CPW A;  1X56 A;  4R1J A;  3UDX A;  2UXC L;  1I3Q H;  4AH6 A;  1N8R C;  1M1K C;  5AJ3 L;  2VUM G;  4LWC A;  3PIP A;  3H0G H;  5C44 H;  4AQY L;  4DV3 L;  1QUQ A;  3PIO A;  1WI5 A;  1Q86 C;  1N32 Q;  2Q2H A;  1AE3 A;  4B3S Q;  2DUD A;  3PGZ A;  4P71 A;  3A0J A;  1PH8 A;  1XMO Q;  4LF8 L;  2ALY B;  1HNW Q;  4DV4 Q;  4A93 G;  1C7Y A;  3RZD H;  1PYB A;  3AEV A;  2UXD L;  2YV5 A;  1TXY A;  2JE6 I;  2UXB L;  3CAM A;  4P73 A;  1YI2 A;  3H15 A;  2PNH A;  1J6Q A;  1J5E L;  3S14 H;  3CQZ H;  4AYB G;  3T1Y Q;  5FLM G;  2ES2 A;  2V1C C;  3ULJ A;  1YHQ A;  4X64 L;  3T1H L;  3HOY H;  4IFD J;  3GD7 A;  4HIK A;  4DV7 Q;  1XMQ L;  3TS0 A;  1EOV A;  1BVS A;  1FGU A;  3S1R H;  4A3C H;  1G51 A;  4DV6 Q;  4YWM A;  1OXX K;  1UE7 A;  3GTM H;  1VQ7 A;  4DR7 Q;  4WJ3 M;  4PG3 A;  3F1Z A;  2NZH A;  4P74 A;  2I5L X;  3PUV A;  2PQA B;  4DUZ L;  1VQ5 A;  4C3J H;  4HJ8 A;  4B3M L;  4A93 H;  3BU2 A;  3EBE A;  2MNA A;  2VNU D;  4DR1 Q;  2QA4 A;  1PV4 A;  1RL2 A;  4LFA L;  3E9I A;  2KEN A;  4JI7 L;  1E7Z A;  3KLW A;  2NVQ H;  3I4M G;  1BBU A;  3UE0 A;  4JV5 Q;  1YNX A;  1Q12 A;  4ME3 A;  3RN2 A;  2NZO A;  2PI2 A;  2QGQ A;  1A0I A;  3L7Z C;  2F52 A;  1LUZ A;  1WFQ A;  3AFQ A;  3KDF A;  4YWL A;  2N3S A;  4WJ4 A;  1FJG Q;  1CKN B;  3CPF A;  4ALP A;  4HJ7 A;  3HOV H;  1OXT A;  4OX9 L;  1JE5 A;  2VY3 A;  1GKH A;  4IPD A;  2UUB Q;  1IBL L;  2I5M X;  1PVO A;  1HR0 L;  4A3G G;  1IZ6 A;  2Q2U A;  4DR3 L;  4JI1 Q;  1D7Q A;  4DR6 Q;  3KOJ A;  1XNQ L;  2JA7 H;  4LF6 L;  1EIF A;  3M7N A;  1V43 A;  2D62 A;  1VQB A;  1B70 B;  3AFP A;  1KD1 C;  1OTC A;  2IX1 A;  2R92 G;  2ZM6 Q;  4Y7N H;  3S2H H;  1AE2 A;  1T9H A;  3J80 c;  2QEX A;  4B3T Q;  4DPG A;  3I7F A;  5GAG C;  4LF7 L;  2Z6K C;  3ZJY C;  1PH1 A;  2LSS A;  2WFW A;  1A62 A;  2VQF Q;  4XTC S;  3I56 A;  1E1O A;  1W2B A;  4GKK L;  2R93 G;  5GRO A;  3OTO Q;  1EWI A;  3NBH B;  4UPA A;  5IP9 H;  4DNI A;  1VQK A;  4YCV A;  1KL9 A;  1UWV A;  1WCM G;  4QL5 A;  1VQE A;  2A1A A;  4AIM A;  4LF5 L;  1C9O A;  3TEH B;  2B29 A;  3GTP H;  2DGY A;  3CCE A;  5IYB H;  1ASY A;  2Q2I A;  2I0Q A;  4B3R Q;  3K8A A;  3CD6 A;  4JCV E;  1XPO A;  4P75 A;  1QZG A;  4JI3 L;  1CSQ A;  1KAW A;  4JYA L;  2OTJ A;  4A3D G;  1NE3 A;  3PUX A;  4PZ8 A;  1TWC H;  5JJL A;  5IYD G;  1X3E A;  1IBK Q;  2HT1 A;  3U4Z A;  1YVC A;  2YU9 H;  2E2I H;  4DR4 L;  1YJW A;  1KIX A;  4LFB Q;  3OW2 A;  2JQO A;  4O0A A;  2NN6 G;  3EIV A;  1SR3 A;  4DV1 L;  4A4I A;  4JBK A;  4YHH L;  5JEA G;  2JA6 H;  1NMG A;  2E2H H;  5E7N A;  1XNR Q;  4YCW A;  5BR8 L;  2R93 H;  4OO1 I;  3HOU H;  2K4K A;  1HR0 W;  1YJ9 A;  3S24 A;  2N78 A;  3H0G G;  5C44 G;  1XPR A;  3MXN B;  4JI6 Q;  1VQJ A;  4LFC Q;  2NN6 I;  2E5L Q;  5FLX c;  3W1G A;  4LF4 L;  3UDG A;  3ERS X;  3PUZ A;  4JI8 Q;  3HOW G;  4JI5 L;  2Z0S A;  3M4Q A;  4DK3 C;  1YHB A;  3K0X A;  5IE8 A;  2E8G A;  1GVP A;  1JB7 A;  4GLX A;  3RN5 A;  5C4X H;  2HIX A;  1HH2 P;  1KC8 C;  5JJK A;  3RLO A;  1GD7 A;  3F2D A;  4R4T A;  3K80 C;  1MKH A;  1EQR A;  3Q8D A;  4X62 Q;  1EYG A;  4NXM L;  2EXD A;  4IPH A;  1VCI A;  5IP7 H;  1M90 C;  2B3G A;  3UDI A;  5M3M H;  1UE5 A;  2L15 A;  2LXJ A;  3PF5 A;  4JI4 Q;  3U58 A;  3HOY G;  3PUW A;  5DLQ E;  4JBM A;  5GAH C;  4KHP L;  1R9T H;  1QVG A;  4DUY L;  1VS0 A;  1WOC A;  3G71 A;  1JJC B;  2BA1 A;  4A3C G;  1N34 Q;  5GAD C;  4NXN L;  1O7I A;  2LXK A;  2AMC B;  4LW1 A;  1SRU A;  1Y1V G;  2UU9 L;  4J15 A;  3L2P A;  2GN5 A;  2GVA A;  3HOW H;  2ZTE A;  4BBR H;  1HNX Q;  2RCN A;  4JI2 Q;  4DV5 L;  1SE8 A;  4GKJ L;  4LF9 L;  3I4N H;  3KJP A;  5M5X H;  3I2Z A;  1HNZ Q;  3A5Z B;  4JBW A;  4MTN A;  4IOA A;  2XTI A;  2PQA A;  1LTL A;  4X66 L;  3FKI H;  2UXC Q;  3L0O A;  3CXC A;  1VQP A;  1EIY B;  1Z47 A;  5HY6 A;  5AJ3 Q;  4AQY Q;  3F8T A;  4DV3 Q;  2F3I A;  1PA6 A;  4GOP A;  2UUA L;  3CCJ A;  4PMW A;  3S15 H;  2K52 A;  2NVT H;  4DAY B;  4LF8 Q;  3HOV G;  4X6A H;  3J81 j;  4JI0 L;  4P72 A;  1N36 L;  2UUC L;  2NVX H;  2HHH L;  2IT1 A;  3K7A H;  2UXD Q;  2ATW A;  4IJL A;  1Y1V H;  2H5X A;  4UP7 A;  3TRE A;  4YY3 L;  3CCM A;  4L5S A;  1C0A A;  2JA7 G;  1CKN A;  2UXB Q;  4NPS A;  4HJ5 A;  3AQQ A;  1XJV A;  3IRB A;  1J5E Q;  1PHJ A;  4HID A;  3FHW A;  4X64 Q;  4GOP B;  3T1H Q;  3CCV A;  2EIF A;  1Q46 A;  2MQH A;  4A3M G;  1XMQ Q;  3BJU A;  4DAM A;  1Y1W H;  1P16 A;  3JAM c;  4GN5 A;  1MJC A;  4A75 A;  1VQ4 A;  1PH4 A;  1I94 L;  3HKS A;  5IP9 G;  3CC2 A;  2R7F A;  1A8V A;  1Q7Y C;  4A76 A;  2RF4 A;  4YWK A;  3KJO A;  2CCZ A;  1Y14 B;  3E9H A;  2R7Z H;  2NVY H;  4HJ9 A;  3B6Y A;  5HGQ A;  4DUZ Q;  1FL0 A;  2K5N A;  3J81 c;  4B3M Q;  1L1O C;  5IYB G;  2OQK A;  2CQO A;  2ASB A;  2F4V L;  1NBW A;  1OXV A;  2K5H A;  1HZ9 A;  4QJF A;  1PFS A;  4LUO A;  1Q1E A;  4LFA Q;  1KRS A;  1FVI A;  1YZ6 A;  2VQE L;  4JI7 Q;  4OWX B;  1X6O A;  3PSI A;  1K9M C;  3U50 C;  4QQB X;  5ELO A;  5IWA L;  2A19 A;  1VQ9 A;  2AHO B;  4A3M H;  4XIG S;  2PMZ E;  5LMN L;  3U4V A;  3RZO H;  4FDB A;  4JOI A;  1D8L A;  3F2C A;  2JA6 G;  3HFZ B;  1LM0 A;  4OX9 Q;  3KF6 A;  4HIO A;  3HOU G;  1TWA H;  3EN2 A;  3OYY A;  1SN8 A;  3GTJ H;  1IBL Q;  1HR0 Q;  4QGU A;  1S72 A;  2IY5 B;  4DR3 Q;  1CUK A;  3PO2 H;  2Y0S E;  3RNU A;  5M5W H;  1XNQ Q;  2KBN A;  4LF6 Q;  1S40 A;  1X54 A;  3RLN A;  2MO1 A;  4KI0 A;  2WB1 G;  1IBM L;  4BY7 H;  4DV2 L;  1YHA A;  4DR2 L;  4IPG A;  5C0X G;  4IO9 A;  4LF7 Q;  1N33 L;  1SRO A;  5C4X G;  3FP9 A;  2WAQ G;  3GTG H;  4A3I H;  2YTV A;  2BH2 A;  2KCT A;  3D31 A;  3WWV A;  4X65 L;  3KF6 B;  4DR5 L;  1K8G A;  2JA8 H;  4GKK Q;  4UY8 C;  3TQY A;  1VQM A;  5IP7 G;  2HQL A;  3K81 C;  4GS3 A;  4GN4 B;  5M3M G;  1EUJ A;  2OQ0 A;  1JT8 A;  2N8N A;  4R4C A;  4DR4 Q;  2E2J H;  1S3O A;  2JEB I;  4LF5 Q;  1IL2 A;  4EX5 A;  4DK6 C;  2A8V A;  4DV0 L;  1WYD A;  1UE6 A;  5GAE C;  1QVC A;  2FXQ A;  1HZA A;  5LMU L;  3PO3 G;  4A3L G;  5IYC H;  4JI3 Q;  1TWG H;  4KHZ A;  4JYA Q;  2B63 G;  1PYS B;  2K50 A;  3I4O A;  4LUV A;  3STB D;  4BA1 I;  1E24 A;  1WJJ A;  2JEA I;  4BBR G;  4X65 Q;  4HIM A;  2IHF A;  2Y0S G;  2YTY A;  3DM3 A;  4H02 A;  1E1T A;  3W1B A;  4C2M H;  3J7Z C;  2EQS A;  3NEM A;  3I4N G;  3RR5 A;  3J80 i;  2WP8 J;  3UE1 A;  5LMN W;  4DV1 Q;  1Q1B A;  2D0O A;  5JEA J;  1G6P A;  4YHH Q;  4K0K L;  4BA2 I;  1I50 H;  4IJH A;  3W5O A;  5BR8 Q;  1UEB A;  3LGJ A;  3MEF A;  3FKI G;  3CF5 A;  4PZ6 A;  3S1M H;  1Q8K A;  2CKZ B;  5J3B A;  3ULL A;  4A3E H;  2CWP A;  1VQ8 A;  4LF4 Q;  1NY4 A;  2ZTC A;  1RIP A;  1KRT A;  4JI5 Q;  1N9W A;  3G48 A;  4A3K H;  4BBS H;  3PO3 H;  1Z9F A;  1I5F A;  1W3S A;  3HOX H;  4L5R C;  1N32 L;  4A3J H;  2B63 H;  1PH2 A;  4B3S L;  3HKZ G;  4O2D A;  2IHE A;  4NXM Q;  4JC0 A;  1XMO L;  2JA9 A;  4BXX G;  1HNW L;  4DV4 L;  1VQC A;  3H3V H;  2KHJ A;  3S1Q H;  4GNX C;  1BKB A;  2K14 A;  1XPU A;  4KHP Q;  4QIW E;  1Y1W G;  4DUY Q;  3PCO B;  2RHQ B;  3M4P A;  2CWA A;  3RLF A;  5C3E H;  4R4Q A;  4C3I H;  3PUY A;  2VW9 A;  3CCQ A;  4LUZ A;  1PH9 A;  1MJE A;  1U0L A;  1PH7 A;  2JA5 H;  4NXN Q;  3M4O H;  4HJA A;  3T1Y L;  3KYH C;  3ULP A;  2UU9 Q;  3A74 A;  2R7Z G;  1OXS C;  3HOZ G;  4DV7 L;  4IFD G;  1B8A A;  4A3F G;  1K73 C;  1NTG A;  3G6E A;  3GTL H;  2YTX A;  2K75 A;  3M85 A;  2VL6 A;  2ZJP A;  2N49 A;  4DV5 Q;  4DV6 L;  4LF9 Q;  4GKJ Q;  2Z6K A;  2IX0 A;  2C35 B;  1TWH H;  1U5K A;  1YEZ A;  2K5V A;  4TVA B;  4EQ5 A;  4JG2 A;  4DR7 L;  3DLL A;  3CC4 A;  2I5H A;  4X66 Q;  1L1O B;  3NEL A;  1SFO H;  1UE1 A;  1YBY A;  2JK8 A;  3ER0 A;  4BXX H;  4IFD I;  4Y52 H;  1E3P A;  4IPC A;  5M5Y H;  3A5U A;  3GTK H;  5K36 G;  2UUA Q;  4UP9 A;  1K0R A;  4DR1 L;  4YCU A;  1YIJ A;  1QUQ B;  5ELN A;  1X3G A;  1PH6 A;  4BY1 H;  4TQU S;  3CCU A;  4MZ9 A;  2KCM A;  2KHI A;  2PI2 E;  2GVB A;  5EAY A;  1N36 Q;  4JI0 Q;  2R6G A;  2UUC Q;  1BBW A;  4JV5 L;  1PH5 A;  2HHH Q;  2VUM H;  2WB1 E;  4YY3 Q;  3PO2 G;  3G4S A;  5C4J H;  1IYJ B;  3HOZ H;  2XGT A;  3SGI A;  4A3F H;  1SMX A;  3CMA A;  1FJG L;  1LYL A;  1A63 A;  4BY7 G;  1G29 1;  1VQD A;  2YYZ A;  3CCR A;  4IOC A;  2OTL A;  2WAQ E;  1JJG A;  2UUB L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...