3S2DH

Rna polymerase ii initiation complex with a 5-nt rna containing a 5br-u
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s2dH00
3T1HL 3KDFA 1V9PA 2A8VA 1WJJA 4B3SQ 4LF8Q 4DV1Q 4QY7A 4A3GH 1WYDA 2K75A 2NZOA 2R7ZG 3I7FA 4LF5L 1EWIA 1S3OA 2OTJA 1K3RA 1B8AA 1SE8A 4UP9A 4A4IA 2N8NA 3M9BA 4IJLA 2KCMA 3CCSA 4EX5A 3HOUH 4BBSG 1C0AA 4Y52H 4IPHA 5IP9G 1IBKL 1I3QH 3U58A 4PZ7A 4IJHA 1HNZQ 4GKJQ 3D31A 1EQQA 1K83H 3PIPA 2UUAL 2UUCQ 4NXMQ 4AH6A 5BR8L 1B70B 1KHIA 1G51A 2K5VA 4J15A 2CFMA 3M4PA 4DR5Q 1A0IA 4RMFA 2JEAI 1K9MC 1TWAH 3FKIH 2IT1A 1TWCH 3AEVA 4X6AH 1JB7A 4A3BG 4JCVE 3S15H 5EAYA 3RZDH 1JMCA 1VS0A 3CD6A 4A3DH 5IYBH 4DKAC 2K52A 2PQAB 3RNUA 1WFQA 2JE6I 4JI6Q 2IY5B 1N34L 1L0WA 2ES2A 2R92G 2ZM6Q 1EIYB 4DUZQ 2MO1A 2D62A 4B3SL 1DGSA 4LF8L 4DV1L 1PV4A 3STBC 5M5XH 2IX1A 3HOXG 4YWMA 2K14A 2OCEA 3DM3A 3PSIA 2RHQB 4P71A 4LF9Q 2JA5H 4A3GG 4ME3A 1XMQL 3UDXA 1EQRA 4LFBQ 3KJOA 4GLAC 4LFAQ 4DV5Q 2OQ0A 1O7IA 1WCMG 2QGQA 4P74A 3CMEA 2AWOA 5GADC 1FJGQ 3S1MH 4A3CH 1JT8A 1KXLA 4AIMA 2CWAA 3IRBA 5HGQA 4BY7G 1HNZL 2B63G 4K0KQ 4JV5L 1HZCA 3PF4A 4A3MH 4IPCA 1A62A 1QZHA 2UUCL 4NXML 4WJ3M 3U4VA 3G6EA 1YITA 4DR5L 5GROA 1K0RA 3BU2A 3MXNB 4ALPA 1TWHH 3KLWA 2N49A 4LW1A 5GAGC 2K50A 2UU9Q 1NJIC 4OWWB 3PO3H 3FKIG 1AE2A 3KF6A 4B3MQ 1IBLQ 4DNIA 2AWNA 4GNXB 2ZM6L 4DUZL 5IYBG 2OQKA 3OTOL 1P8LA 4DV2L 2N3SA 4DR3Q 2HHHQ 2RCNA 3BZCA 1CKNA 4DK3C 4JYAQ 4JOIC 3RN2A 4IOAA 1Q46A 3CW2C 1Y1VG 2A19A 3GO5A 5C0XI 1YZ6A 3PCOB 2CWPA 4LFBL 1B7YB 3CCVA 1WOCA 3A5UA 4JI7Q 3EN2A 3S1NH 1RIPA 3GTKH 1PYSB 4DV7Q 1I6HH 2RHSB 4JBWA 3J7ZC 1TWFH 2JK8A 4JG2A 4JI8Q 4DPGA 5C3EG 1JJ2A 4K0KL 5M5YH 3I4OA 1VCIA 1CKNB 4JI5Q 4MZ9A 3B6YA 1VQLA 3LGJA 2WFWA 5JJIA 2MO0A 3J7A5 1ASYA 4BXXH 1VQ6A 3W1GA 1YIJA 3E9IA 3CC2A 1BBUA 4Y7NH 1U0LA 2WP8J 3A74A 2OWOA 4BY1H 4B3ML 1VQEA 4KHZA 1IBLL 2D0OA 3J81j 1CKMA 3KYHC 1X3FA 4DR2L 2HT1A 2R7ZH 3T1HQ 3L0OA 4KLKA 1VQGA 4DR3L 2HHHL 4JYAL 1SFOH 4A93G 2E5LL 2WAQG 3H0GH 1J6QA 3HKSA 4H02A 4BBSH 1VQBA 4OWTB 1JJCB 4EQ5A 5IP9H 2ZJPA 4JI7L 4LNQA 1CUKA 1PHJA 1NBWA 3CP0A 1FVIA 3M4QA 3PV0A 3T1YQ 4LUOA 3HKZE 4JI8L 4B3RQ 1C7YA 2NN6G 4C2MH 2Q2UA 1LTLA 2AMCB 4OONA 1SN8A 1NTGA 4GN4B 2IHFA 2R6GA 4PMWA 1I94Q 4DK6C 5BR8Q 1YVCA 1W2BA 4BBRG 2I5MX 1HH2P 1S72A 3RN5A 2B29A 2KHIA 2VW9A 1E1OA 1IXRA 2GVAA 4JI4L 2ATWA 2R92H 2R7DA 1GVPA 1L1OC 1QVFA 3GTOH 1UE1A 1I50H 3TQYA 1X54A 1TWGH 3HOXH 1N34Q 3RZOH 4HJAA 4A3JG 3A5ZB 4JBJA 1VQ9A 1K8AC 2F3IA 3K7AH 4JOIA 4IPGA 4OXPA 1OTCA 2R93H 1GKHA 3HOWH 1WCMH 3H0GG 4R4TA 1XMQQ 4QQBX 1SRUA 4BY7H 4DV4Q 2B63H 1N9WA 4DUYL 5IP7G 5C0XJ 3T1YL 1MJEA 5JJKA 3BZKA 4LF6L 4B3RL 4PZ6A 3I4NG 3KDFB 4JV5Q 3UE1A 4BA1I 2Y0SE 2ALYB 1G291 2I5HA 1Z47A 1I94L 4A75A 3UDFA 1Q82C 4DR6L 1AH9A 2XTIA 3GD7A 1CSPA 4UPAA 4HJ8A 2EQSA 3TS2A 1FL0A 2VQEQ 4R4OA 1E24A 2PNHA 2IX0A 3F8TA 4IPDA 3H3VH 3ULJA 1X6OA 2VS1A 4DR4Q 2VY3A 1N36L 1MKHA 1W3SA 4QIWE 4PZ8A 1VQJA 3CC7A 3OTOQ 4DV2Q 3HOYG 1JE5A 1Y1VH 2VZAA 1BBWA 4DV6Q 4X66Q 1EYGA 3TRZA 2Q2TA 2EXDA 5IY0A 3I56A 3G48A 3ULPA 2JA7G 4OX9Q 2NVTH 4WJ4A 5ELOA 1HR0W 4DV4L 1WI5A 1NMGA 5LMNQ 2R93G 5JJLA 5C3EH 3MEFA 3I55A 3G71A 4LUVA 1H95A 2JEBI 4DR1Q 3CPWA 3NENA 5H1SE 1HZ9A 2BH2A 1KC8C 1VQ5A 4GOPC 1A8VA 1EIFA 2MQHA 2BA1A 3S1RH 3L7ZC 3W5OA 1VQ7A 3CQZH 5HY6A 1N32Q 4YWLA 2LXKA 3EIVA 4X64Q 2VQEL 1Q1BA 4HJ7A 2PMZE 2PI2A 3ERSX 4R4IA 3PGZA 3CCJA 1L1OA 2VNUD 1YHQA 4DR4L 2Q2HA 3STBD 5JEAG 2L15A 1UE7A 4DV3Q 1G6PA 4DR2Q 4A93H 1Q12A 1N8RC 1IZ6A 5IYCH 3PUVA 2EIFA 3EBEA 4YCUA 3W1BA 4DV6L 4X66L 1Y1WH 3PO2G 2LXJA 2YTVA 3AFPA 1QVGA 3UE0A 1Q1EA 4POFA 2E5LQ 2UXBQ 3G4SA 1IYJB 4OX9L 1QZGA 4UP7A 5DLQE 5FLXc 5E7NA 1KRSA 5LMNL 3PUZA 4PG3A 1L1OB 3JAMi 3KF6B 5LMUL 1XNQQ 3GTPH 1MJCA 1VQNA 3TEHB 3J81c 4DR1L 1HNXL 1E3PA 2JA6G 2F52A 1GM5A 4POGA 1U5KA 4BBRH 3J80i 3ULLA 3PIOA 4X65Q 5GAEC 5C4XG 2B3GA 3NELA 4GLVB 5ELNA 3GTQH 1N32L 1CKOA 1X9NA 3GTGH 1X55A 1YNXA 2UUBL 3ER0A 3PUYA 3F2BA 1UE6A 4OWXB 4AYBE 4L5RC 1PFSA 4YWKA 2YTXA 4X64L 4XTCS 1JJGA 3CCQA 4R1JA 1LYLA 3OW2A 2BH8A 1ASZA 4JI4Q 4A3JH 2VL6A 1EOVA 1VQHA 2YV5A 4DV3L 1Z9FA 2AKWB 1E7ZA 2I5LX 2RF4A 2ZTCA 4HIKA 1YJWA 1Q7YC 1D7QA 2VUMG 1VQMA 2E2IH 2GVBA 4YCVA 3DLLA 2CKZB 3F2DA 2UXBL 1KAWA 4XIGS 5GAHC 5IYCG 4LF7L 4LWCA 5IYDH 3HKZG 4JI1Q 5IP7H 1Y1WG 2NVYH 3PF5A 1IBML 3ICEA 3D0FA 3I4NH 1XNQL 1X3GA 4KI0A 3H15A 4DUYQ 4B3TQ 2FXQA 2YTYA 2GN5A 4MNOA 4JBKA 1XMOQ 3UDGA 4LF6Q 3F1ZA 3CAMA 4X65L 1PH7A 4GOPA 3H3VI 3U4ZA 2K4KA 2WB1E 4DR6Q 1UEBA 2AHOB 4IOCA 3K8AA 1BVSA 1XPOA 1M90C 3M7NA 2ZJRA 4L5SA 1OXUA 5AJ3Q 3S2DH 4RG1A 1Q86C 3HOYH 2DUDA 1N36Q 5LMNW 4GOPB 4KHPQ 1PH1A 1VQAA 2JA7H 2JJQA 1HZAA 1PH2A 4JI1L 5M3FG 3S1QH 4LUZA 1XPUA 3PUXA 1T9HA 2Y0SG 4HJ9A 4AQYQ 4B3TL 2MFIA 5IYDG 2UXCQ 3NBHB 2HIXA 3Q8DA 2QA4A 3S14H 2VQFQ 1XMOL 4A76A 5C44G 2YU9H 5FLMH 1KD1C 1X56A 4OO1G 4LFCQ 3HOVG 4JI2Q 3M85A 4LF4L 4JI3Q 1VQ8A 1MIUA 3S17H 3CCUA 1D8LA 2N78A 4P73A 4L5QA 1PH3A 4IFDG 1LUZA 3A0JA 3WWVA 1VQCA 4YCWA 3HFZB 3KF8B 5AJ3L 1QUQA 2CQOA 4HIMA 1V1QA 1VQIA 2ZTEA 1PH4A 2PI2E 3TS0A 1UE5A 2MNAA 1J5EQ 1VQKA 4A3LG 4KHPL 2NN6I 1XPRA 4UY8C 4YHHQ 3K0XA 5M3MG 3L2PA 2PQAA 3RLNA 1VQ4A 2UXDL 2Z6KA 4C3HH 1X3EA 1YJNA 3I4MG 2NVXH 1KL9A 3HOWG 2K5NA 5IT9c 1E22A 1VQPA 3FP9A 4C3JH 1QUQB 4A3IG 4AQYL 2JA6H 2UXCL 4GKKL 5LMUQ 5C0XG 3HOZG 4NXNL 2XGTA 1TXYA 2JQOA 5C4XH 4P72A 2VQFL 4A3EG 3S24A 1HJPA 1HNXQ 3CPFA 2ZJQA 3RLOA 2Q2IA 1NMFA 4LFCL 1EUJA 3SGIA 1PH8A 2HIVA 2OTLA 1Q8KA 4JI3L 2CCZA 3CC4A 3PUWA 4JI2L 1N33Q 5JEAJ 4A3FG 2I0QA 2JA8G 1L2FA 5FLMG 2IHEA 1BKBA 1PA6A 3UDIA 2UUBQ 4DV0Q 4NPSA 1YJ9A 2K5HA 1GO3E 3E0EA 3RLFA 2R7FA 3OYYA 3KJPA 2LSSA 3VDYA 1PH6A 4GLXA 1VQDA 2VUMH 4L5TA 2ASBA 5J3BA 2D0PA 1A63A 1J5EL 4JC0A 3CXCA 4YHHL 4OO1I 3HOUG 3AYHB 5C4JH 4GKJL 4GNXA 1M1KC 3KFUA 3JAMc 3NEMA 4JI0Q 4LF7Q 3GTJH 4HJ5A 4IFDI 1OXXK 1RL2A 4DAYB 4GN3B 2QEXA 1HNWQ 5IWAQ 1IBMQ 4O0AA 2E8GA 3J80c 1OXSC 1OXTA 2A1AA 1EFWA 1NE3A 2NVQH 1LM0A 3E9HA 3CF5A 4BA2I 4A3KH 4AYBG 3CCMA 1XNRQ 2F4VQ 4R4QA 1YBYA 4JI6L 1N33L 2BA0A 2KENA 4GS3A 4A3DG 3M4OH 4QL5A 4DV0L 2E2HH 3F2CA 1R9TH 1X65A 5M5WH 1PYBA 2KCTA 3CCLA 2Z0SA 5FJ8H 3U50C 4LF9L 1SROA 4X62Q 1XTDA 4LFAL 1AE3A 1C9OA 4DV5L 2JA5G 1YEZA 1PVOA 1YHBA 1FJGL 4NB3A 1V43A 4GN5A 5M3FH 2Z6KC 1PH5A 3AQQA 4FDBA 4P75A 4YY3Q 4JI0L 3M3YH 1K73C 5K36G 4A3CG 3J81i 4O2DA 5IWAL 1HR0Q 1HNWL 1P16A 4A3MG 1KQSA 5C44H 3CMAA 1FGUA 1UWVA 2WB1G 4DAMA 1K8GA 3HOVH 3GTMH 3TREA 4IO9A 2UU9L 4C3IH 1CSQA 2YYZA 1XNRL 2F4VL 1SMXA 4DR7Q 2V1CC 1OXVA 1QVCA 4LF4Q 3PO3G 4A3KG 4GKKQ 4TQUS 1Y14B 1SLJA 5IE8A 1S40A 1IL2A 2NZHA 2H5XA 1NY4A 1E1TA 1Q81C 3FHWA 3K7UC 2C35B 2KHJA 1VQOA 4LF5Q 3KOJA 4A3LH 4X62L 3K80C 3S16H 5M3MH 1HZBA 3AFQA 4HIDA 3CCEA 2KBNA 2WAQE 3JC66 4R4CA 5FJ8G 3K81C 3GDEA 1SR3A 4UP8A 4DV7L 4TVAB 1YI2A 1IBKQ 2E2JH 3I4MH 1YHAA 4QGUA 4APVA 4YY3L 3CCRA 3I2ZA 3ZJYC 2DGYA 2ZTDA 4GNXC 4A3IH 2UXDQ 5GQOA 4JI5L 1I5FA 3HOZH 1VQFA 2UUAQ 3BJUA 1HR0L 3S2HH 4QJFA 1GD7A 3GTLH 4A3EH 4A3BH 1KRTA 4IFDJ 4NXNQ 3PO2H 4HIOA 2HQLA 2JA9A 1PH9A 4A3FH 4JBMA 2JA8H 4BXXG 4MTNA 1XJVA 4DR7L 3RR5A 2ID0A 1KIXA 4BY1G
chains in the Genus database with same CATH superfamily
3MFGA 5KYIA 5C3EB 3BYYB 2A6HD 2NZOA 2VB2X 3A8KE 3HZXA 3I7FA 1KDAA 2R7ZG 1HUNA 1K3RA 4UP9A 4A4IA 3M9BA 1JCKB 2KCMA 4IJLA 3CCSA 3S1RB 4IPHA 1K8OA 3C1EA 2KEDA 1HNZQ 4GKJQ 4I65A 1K83H 4AH6A 2RA4A 5D3DA 1KHIA 4J15A 2ZXRA 4RMFA 5KEEA 3FKIH 4G7ZC 2B2VC 1B53A 2QILA 4DKAC 3FVQA 3RNUA 1WFQA 4JI6Q 1M8AA 4CDEC 1L0WA 2L1BA 2R92G 1KTKA 1EIYB 2D62A 2L11A 1DGSA 2CH4A 4B3SL 5EPKA 4DV1L 2XWBB 1Y8NB 1C4QA 1YNNC 2OCEA 4P71A 5JPNC 1QWYA 2JA5H 4A3GG 2D9UA 1F2MA 1XMQL 3GTGB 3S1MH 1JWSD 4H44C 1GOZA 5GADC 4AIMA 4JV5L 4HR7B 4IPCA 3G6JB 4HN7A 1FNVA 5IGEA 4DR5L 4B08A 4R9WA 3BU2A 3MXNB 1QG7A 2A68D 5D65A 5I4DA 2OEOA 3KLWA 2UU9Q 2N49A 4LW1A 1NSNS 2K50A 4OWWB 1NJIC 3V96A 3PO3H 1AE2A 1IBLQ 2NVYB 4GNXB 2OQKA 3OTOL 1P8LA 4DV2L 3ND9A 2F0LA 4JYAQ 3H94A 3RN2A 3CW2C 1BCPC 3C1FA 5C0XI 1EIHA 5LL6S 2CWPA 1KABA 1LT4D 2XSCA 3S1NH 2LMCB 5KNBA 3A55A 4JK1C 2JP1A 4MZ9A 3DXJC 1WTPA 4WJWA 3LGJA 1SYBA 5JVH3 3BYTB 1ILPA 3J7A5 4YIJA 1GUOA 3CC2A 4DK0A 3I4MB 3NE5B 3URYA 4B3ML 4KHZA 2D0OA 3S9WA 3J81j 1WTXA 4DR2L 1X3FA 1LTTD 4X3TA 3JAML 2R7ZH 3L0OA 3NP8A 1EWHA 1EZ8A 3T16A 3EJIA 2WAQG 2E5LL 3PO2B 3MVVA 5DAUA 4A3FB 1T5EA 1JJCB 5JAVA 5HURA 4L63B 3BVMA 4LNQA 3MAQA 1IW7C 3E0JA 3QOLA 3S17B 2QKIC 4RCOA 1FVIA 4QMGA 4RH6A 4CKBA 5CGKA 1H9SA 1JWUD 4B3RQ 2Q8IB 2R6GA 5AFWA 2F0PA 2TMPA 5C3WA 4BBRG 1F77A 1SEBD 4LMQD 1JORA 2F0KA 3RN5A 3J80E 2VW9A 1IXRA 1LT6D 5ISRA 3NK9A 2R92H 4C3HB 4G57A 1I50H 1EQVA 4C3JB 4A3JG 1VQ9A 1K8AC 3NUCA 3T56B 1NUCA 3K7AH 2WKCA 1OTCA 3S15B 2X69A 1GKHA 2R93H 2DN8A 3L3OC 3KK7A 4A3DB 1EY7A 1CM9A 1SRUA 2HDMA 2NTSA 2NBFA 2WKDA 5IP7G 4DUYL 1MJEA 1I4HA 4FVMA 2A6EC 5M5XB 5JPMC 3IFDA 4BA1I 4K8IA 1I94L 3SDZA 1Q82C 1AZPA 1EY5A 1BCPB 3FRPB 1TKWB 3ERQA 5T1GA 4ZK9B 3TS2A 4OHJA 1E24A 1UUPA 2VY3A 1MKHA 3N52A 4CDFC 1BBWA 4V190 4RKBA 3TRZA 2Q2TA 2EXDA 4HSPA 5IY0A 3ULPA 1MSHA 3ND8A 1BUVT 5ELOA 3TMEA 4DV4L 1NMGA 1EOTA 1BF4A 1ET6A 2Q8TA 3G71A 1H95A 5M5WB 4KK7A 3DHQA 5TSSA 1ZEQX 1CK1A 1A8VA 4GOPC 2BA1A 3CQZH 2IX3A 3J7AF 3I72A 2VQEL 2PQEA 4R4IA 3PGZA 4F7XA 3M3YB 4DR4L 1SJED 5JEAG 1G6PA 1QOHA 1Q12A 1YNND 2L0CA 4RHSA 3BZDB 3EBEA 1UNSA 2PZTA 3AFPA 1V1PB 3G4SA 1IYJB 4OX9L 3OIQA 5DLQE 1XNQQ 1MJCA 1M4VA 3BVZA 1VQNA 1B3QA 1F2YA 3J81c 2JA6G 2F52A 3I91A 4BBRH 1BNZA 2Q8RE 1RHPA 4GLVB 2RCFA 4CJ0B 3S16B 5M3MB 1YNXA 2EE1A 2WACA 1UAPA 2YTXA 3NSWA 1LYLA 2XWJB 4KJOA 4JI4Q 5EJWA 3MHBA 4TKOB 4A3JH 2VL6A 1VQHA 1E7ZA 2RF4A 2ZTCA 4A3EB 1RJTA 5C4HA 4A3BB 1BCPD 4ILWA 2EVBA 5JOBA 4DXFA 2XIWA 2PMZB 5IYCG 2EPBA 5IYDH 1Y1WG 4KJNA 1SMYD 5IP7H 1IBML 3ICEA 5LL6X 1LT5D 3TN2A 4B3TQ 2B8GA 5ELCA 1LLRD 3QB3A 1ESFA 1YNJC 5IOCA 1XMOQ 4X65L 4KHVA 1WCMB 1B9NA 1S4ZA 1UEBA 4NW2A 4OGQC 1QNUA 4RAUC 4BY7B 3NHHA 1I3QB 1GUSA 1XPOA 1SYGA 2KUMA 4I7AA 2ZJRA 5CC4A 4ABNA 3J81L 5DNFA 4GOPB 1TWAB 2R61A 1IW7D 1XXGA 1HZAA 4JI1L 5M3FG 1LTAD 3KBXA 4HJ9A 4AQYQ 5FLXE 2MFIA 1V1OA 1PZID 1EFID 4RCNA 1ONLA 2HIXA 3S14H 2VQFQ 5C44G 4J8QA 4OO1G 3HOVG 4JI2Q 3SXHA 4LF4L 4C3IG 2NVTB 2LS01 4DFAA 5KRUA 4L5QA 2JN4A 4IFDG 1LUZA 3A0JA 4HMIA 5JEAH 5I2YA 3HFZB 4RHRA 2LY7A 2CQOA 2ZTEA 1G8ZD 1VQKA 2QEJC 2L9HA 2IWHA 1XPRA 3VYTA 1VQ4A 3RLNA 1WD1A 1KL9A 5IT9c 2A6ED 1QUQB 1B1ZA 2JA6H 4GKKL 5LMUQ 4A93B 1J8IA 4XXEA 5IGDA 2ZJQA 2Q2IA 1STHA 2RDFA 3HGBA 2HIVA 1IL2A 1PFMA 1N33Q 2EJMA 2EYHA 1K0SA 2K1BA 4K8JA 2CW0C 2IHEA 3UDIA 2UUBQ 3GTPB 1YJ9A 3H3VC 3E0EA 2R7FA 3VDYA 3T51B 1NAPA 5M5YB 2ASBA 2D0PA 3CXCA 2FJ2A 4GKJL 4GNXA 1M1KC 3KFUA 1GXDC 3NEMA 2PYKA 4HJ5A 4BY1B 4LF7Q 5K5PA 2E8GA 4KKTA 4MHEA 3OMCA 4PMCA 3E9HA 3CF5A 1ENCA 3CCMA 1XNRQ 4JI6L 1TY2A 5IT9L 4DV0L 3F2CA 3F2UA 3J7YW 4IUVA 5FJ8H 3VR4A 1DCZA 4FO2A 4CKCA 1RTOA 1Q90A 1HRJA 4XYQA 4GN5A 5M3FH 1BO0A 4FDBA 4J1MA 2C5CA 1ICWA 3SK8A 4A3CG 4O2DA 5IWAL 3VA5A 2FMMA 3RZOB 1TWGB 5C44H 3A56A 2K32A 3CMAA 1FGUA 2WB1G 4OO1H 3HOVH 2B2VA 3OWEB 2UU9L 1WTHA 4C3IH 1GJXA 2ICIA 2K33A 3UI2A 2V1CC 1OXVA 2QDBA 1VDZA 1O78A 4A3KG 4TQUS 2B63B 2F0HA 2NZHA 2P5ZX 3P7JA 4KN7C 2KHJA 1S5BD 5EPLA 1BBXC 5EQ0A 3K80C 1HZBA 1HQMC 5JVG3 2KBNA 2E2JH 2BCOA 1YI2A 3I2ZA 2OF1A 1F9RA 2UUAQ 3S2HH 1HR0L 2JXMB 2PZUA 1GD7A 1YNJD 3QWNA 4JBMA 4N8FA 1EYCA 4DR7L 2ID0A 4FYDA 3K5MA 1V9PA 1WJJA 4LF8Q 5EKIA 1WYDA 1S3OA 1B8AA 4BBSG 3TDQA 2EYFA 1CA5A 5IP9G 1KLUD 3D4WA 1IBKL 1IKLA 2JSOA 1OO9B 5KIXA 4PZ7A 2F3WA 1LV9A 1Y8PB 3PIPA 3K57A 3NTHA 2VXWA 1G51A 2CFMA 2F0UA 1C8CA 2NUCA 2IT1A 3I70A 5J39A 1TIID 4X6AH 4KY5A 4JCVE 3RZDH 1JMCA 3CD6A 1SYFA 1PTOF 2L4NA 3NPPA 3SE0A 1PV4A 3HOXG 2SEBD 5ELEA 2D2CC 1II3A 3UDXA 1BQQT 1EZ6A 1EQRA 1RODA 4LFBQ 3GTQB 5T1IA 1LABA 2OQ0A 4DV5Q 3CMEA 2E2HB 4A3CH 5CBEE 3PF4A 1A62A 4DAVA 2UUCL 4NXML 3NBIA 4WJ3M 3U4VA 1HQRD 1V1PA 3SVMA 1KDCA 5KNDA 4QUCA 5C6AA 5GAGC 1HFGA 3FKIG 2AWNA 2KJXA 1HCZA 2ZM6L 3OOCA 4DUZL 1ENFA 1TT2A 2N3SA 2HHHQ 1TQOA 2EY6A 1DOLA 4KD3A 1GHJA 1UEAB 3PQIA 2I46A 1Q46A 4PNYA 1Y1VG 4IOAA 2K7VA 4RA8A 1TR5A 4JI7Q 1WOCA 3A5UA 2O5JC 3SEBA 1I6HH 4DV7Q 2RHSB 3J7ZC 1SYDA 1TWFH 2JK8A 3NQTA 4DPGA 5C3EG 4K0KL 2XRSD 1JJ2A 1VCIA 1CKNB 3TP8A 4TRDA 3B6YA 1B4OA 3HOYB 5JJIA 2MO0A 1VQ6A 3MC0B 2JA7B 2XNAC 1VQEA 5FO7B 1SNQA 1JOKA 4DF7A 3T1HQ 4DR3L 1VQGA 2F4IA 4F8MA 3H0GH 1LTBD 1TVXA 2M00A 5IGGA 3HKSA 4BBSH 1VQBA 5IP9H 3HRZC 1CUKA 4BS9A 2AUJD 3CP0A 3T1YQ 4LUOA 3HKZE 5CORA 4JI8L 2NN6G 4C2MH 2Q2UA 1LTLA 4OONA 1IYUA 3OW7A 4RFBA 1SN8A 1NTGA 2SOBA 4WFN3 3JAME 3KLSX 3Q24A 1S72A 1TU2B 2VB3X 1E1OA 4UDUC 4JI4L 4KMUC 2R7DA 1L1OC 2WINB 2NVXB 2R3ZA 1X54A 3HOXH 2F0EA 2RSOA 1QB5D 4JBJA 2M2LA 4AYBB 5E4XA 3K59A 3EVQA 4JOIA 1H9MA 3EQLC 1WTWA 2EZVA 1C48A 1N9WA 1HXYD 4Q5VA 3BZKA 1DJRD 2Y0SE 2ALYB 1Z47A 4A75A 1AH9A 4HJ8A 1CSPA 4UPAA 2EQSA 1FNWA 3S1MB 1FL0A 2PNHA 3F8TA 1SDFA 3GTJB 1X6OA 2VS1A 4ULLA 3I8ZA 4QIWE 3T53B 1JE5A 1A2TA 1Y1VH 3LWEA 4DV6Q 4X66Q 2NVQB 1I4XA 1PTOC 3E5SA 3I56A 3M7GA 4WJ4A 5C5MA 3SK6A 3BVGA 2R93G 1WI5A 5LMNQ 2F0QA 5C3EH 3VR5A 4LUVA 3CRLC 3GP7A 2BDOA 3OPOA 1R9TB 4KKSA 3AU7A 1VQ5A 1ZYRC 1EIFA 3K5OA 3S1RH 3L7ZC 2LXKA 1LACA 3EIVA 4HJ7A 3ERSX 2Q2HA 2L15A 1UE7A 4DV3Q 2EIFA 4YCUA 5G3LF 4ME5A 3MXPA 2LXJA 1Q1EA 2UXBQ 2KQ3A 2Z8LA 1IYVA 1QZGA 2DY8A 3A8IE 5E7NA 1KRSA 4C3HG 1D1IA 3PUZA 5LMUL 1L1OB 5EGTA 2NN6H 3V2TA 1B50A 4DR1L 3QIAA 4XDXA 1GM5A 1KAAA 3J80i 5GAEC 5C4XG 1BXTA 3NELA 1R4PB 4KN4C 1N32L 1CKOA 2EJGC 3GTGH 2UUBL 3N6RA 1UE6A 4AYBE 1ET9A 4NDXA 4X64L 1JJGA 1CQFA 1D1KA 3OW2A 4A3IB 4QB4A 1Q7YC 3GTLB 1WTQA 2F03A 1SAPA 3CU7A 3Q6SA 1LT3D 3DLLA 3I3CA 4LF7L 4FXKC 2SDFA 1V8QA 2XVSA 4FF2A 2NVYH 3CKIB 2KCCA 1E2WA 1GUNA 4X3SA 4LF6Q 4A3GB 4JBKA 3UDGA 3KLSA 4OELB 4KTAA 4ZLTF 4DR6Q 2L55A 1PTOB 3V05A 4B9WA 3EA6A 3HOUB 2NZ1D 5FK9C 1I6VC 5HGTA 2E2DC 2A69C 1JE4A 3TP7A 1M90C 3M7NA 1PXUA 1Q86C 2DUDA 1N36Q 1PDQA 2HQEA 2O5IC 4GZYC 1PH1A 3NWSA 4DA2A 1ESRA 2B2TC 1TWCB 2JJQA 2XN9C 1PH2A 2LFNA 5A2QL 1CFMA 1LTID 1XPUA 1EYDA 1T9HA 2F3VA 3KF8A 4N8X1 3NBHB 5JJZA 5IYDG 3Q8DA 3J81E 2CHBD 2YU9H 1X56A 2X6LA 1RTNA 1VQ8A 2A5HA 2MHVA 3S17H 1T5XD 2N78A 2B8FA 1HTLD 2CQAA 1VQCA 4YCWA 2QDLA 5AJ3L 4HIMA 1VQIA 2PI2E 1UE5A 2MNAA 5KNCA 1J5EQ 4KHPL 2NN6I 3GV3A 5M3MG 2AUKA 2EYMA 1TWHB 4C3HH 1YJNA 1STAA 1E2VA 3FP9A 4C3JH 2KEEA 1WTOA 1NR2A 2UXCL 1I4QA 3EFXD 1TXYA 2K6AA 5C4XH 4P72A 4A3EG 3S24A 1HNXQ 1DOMA 4J6HA 1NMFA 4LFCL 1PH8A 1Q8KA 4JI3L 2I0QA 2ZXOA 1MGSA 2OT2A 4NPSA 3GTKB 3OYYA 3KJPA 3MXUA 2BE5C 4IALA 2FHTA 1PTOD 4JC0A 1JB3A 4YHHL 3T13A 5K36H 4IZ8A 5C4JH 4Y7NB 4HCSA 1HNWQ 4DNRB 4O0AA 1JR0D 3J80c 2F0MA 1OXSC 2SNSA 1LM0A 2B2UC 1SFOB 2IJ0A 1BDOA 4GS3A 4QL5A 3NWTA 2M9VA 3U9SA 2F0NA 4CDDC 5M5WH 1SROA 4X62Q 3R2IA 2EY2A 3R3OA 2Z6BA 4EVOA 5ELDA 4DV5L 1X32A 4ZAIA 1PVOA 1B44D 1YHBA 1RCVD 4NB3A 2G9HD 3T4AC 1CT1D 3AQQA 4YY3Q 1WTRA 4JI0L 3M3YH 3IFTA 3GTOB 5I6YA 5IT9E 4A3MG 5CV5A 1K8GA 3GTMH 3A7AB 1CSQA 2YYZA 2F4VL 4K5XA 4K2KA 4GKKQ 1LTSD 1CZGA 3A8JE 1Y14B 3HG9A 1S40A 1CTMA 5CYUA 1NY4A 1E1TA 3SR1A 1MBYA 1VQOA 2EYPA 3S16H 5M3MH 5FJ8G 2A74C 2WAQE 4R4CA 3K81C 1SR3A 4UP8A 4OL7A 3MFYA 4DV7L 2O4XA 1YHAA 4QGUA 2UXDQ 3CCRA 2ZTDA 5GQOA 1PFBA 1VQFA 5KGUA 4QJFA 4A3EH 4CBVA 4A3BH 4NXNQ 1MI2A 1PH9A 5LHY1 4RGOS 4BXXG 4MTNA 1XJVA 4QF4A 5E3FA 4BY1G 2A69D 3T1HL 4FF3A 2A8VA 4B3SQ 4DV1Q 4QY7A 4LF5L 2OTJA 3K5NA 2F0IA 1SE8A 2N8NA 3R2TA 1H9KA 4EX5A 4Y52H 2K01A 1I3QH 1LO5D 3U58A 2BDNA 4IJHA 2FFKB 1CHQD 1EQQA 4K6LA 5COYA 3TBIB 4H0LC 4DR5Q 1A0IA 1TWAH 1STNA 2H4OA 4MTKA 3DWQA 1Y1WB 1JB7A 1EL0A 5EAYA 3LNNA 1FR3A 1VS0A 3TZUA 5IYBH 2K52A 2PQAB 4R8NA 3K5LA 2MO1A 2IX1A 2K14A 3DM3A 4ME3A 4MN3A 3MXNA 1PFNA 4UAIA 4GLAC 1QNKA 3HOWG 1O7IA 4P74A 2AWOA 2K05A 4IUNA 3VA7A 3IRBA 1RDPD 4C1NI 1HNZL 2B63G 1HZCA 4A3MH 3NQIA 3IL8A 1PMRA 2KA7A 1K0RA 4ALPA 2PW7A 1SE4A 3P1HA 1JC7A 1U4MA 4B3MQ 1Z7TA 4IQZA 5IGFA 2WV6D 3I4NB 2BE5D 2RCNA 4DK3C 3SK4A 1EY8A 2A19A 2AQ1B 3PCOB 3CCVA 1FNUA 3EN2A 1RIPA 1PYSB 3FMCA 4X3UA 4JG2A 5M5YH 4Q0FA 4ZKCB 5G3LD 2K03A 3I4OA 2X6GA 3S2DB 4G4KA 4V0BA 2RDGA 5D14A 3X3NA 4BXXH 1YIJA 1JICA 3E9IA 3MTSA 4DK1A 4QUFA 3A74A 2OWOA 4BY1H 1Y8OB 1IBLL 1JQYD 1CKMA 3KYHC 3S1QB 2HT1A 4G7HC 2RKSA 4KLKA 4JYAL 4O42A 4OWTB 3QOJA 1G91A 3GV6A 1GUTA 1NBWA 3NTKA 1PRTC 5BN4A 1B9MA 3M4QA 3PV0A 2ZXPA 1AW7A 5CV6A 2AMCB 4BWGB 2F0SA 4GN4B 1I94Q 3MA2B 4DK6C 5BR8Q 4C1NK 2I5MX 1HH2P 1K28A 3DEOA 1AEXA 5EBCA 1GVPA 1F2ZA 1UE1A 3NBHA 2HUGA 2A6HC 4P2CB 3TQYA 1TWGH 1N34Q 3RZOH 4HJAA 3A5ZB 4XQJA 2F3IA 1DM0B 1EYAA 5EKLA 2F0GA 4CGYB 5A35A 3HOWH 4R4TA 3H0GG 4DV4Q 1VF5C 2B63H 1F2LA 5IGCA 4LF6L 4B3RL 4FNFA 3KDFB 2VUMB 1G291 2I5HA 4HTHA 3UDFA 4DR6L 3LX0A 2XTIA 3A7LA 1SBBB 3HKZB 4N9TA 4R4OA 2VQEQ 1PYWD 4WORA 2IX0A 3H3VH 4DR4Q 1N36L 1W3SA 3D6CA 2WB1B 4PZ8A 2WIIB 1WD0A 3CC7A 3HOYG 1EY6A 1CQVA 3G48A 4A3KB 4OX9Q 2JA7G 2PW5A 2HD3A 1HR0W 3M4OB 3I55A 2JEBI 5H1SE 1ZKOA 4RGMA 2MQHA 2A68C 2MPMA 1VQ7A 5HY6A 1HPCA 2FMCA 3VYRA 3PMFA 2CW0D 1PRTB 2K28A 2EY1A 4PQXA 2VNUD 2Y0SB 1YHQA 1STEA 2ZT9C 3PIP3 3C46A 3PUVA 4M8AA 3W1BA 2RBMA 2YTVA 1QVGA 1JOOA 2B2TA 4POFA 1GUWA 3TZDA 3E3XA 2F0FA 1HUMA 2KVMA 4UP7A 1VMPA 2K5DA 1QE6A 1U4PA 2HDLA 4QIWB 2DNEA 3JAMi 3KF6B 4DN4M 1HNXL 1E3PA 4K6DA 1W6KA 3PIOA 4X65Q 5DM73 1SE2A 4IUUA 2B3GA 3BS1A 3MWYW 5ELNA 3GTQH 1X9NA 1X55A 3ER0A 2QW7A 4YWKA 4XTCS 3CCQA 1A3UA 4R1JA 2F0WA 2BH8A 2YV5A 3FPUB 1Z9FA 2AKWB 4KY6A 4HIKA 3HOZB 1D7QA 1YJWA 2E2IH 2GVBA 1JOQA 5CV4A 4WRDA 3DM1A 1A6XA 2CKZB 3F2DA 1KAWA 4XIGS 3RMHA 2JA8B 1W6JA 3OWFA 4JI1Q 2DY7A 3PF5A 3HOXB 1XNQL 4HCEA 2FXQA 4XYOA 1STBA 3ONAB 3H3VI 4GOPA 1EU4A 3U4ZA 2K4KA 2WB1E 3CRKC 2AHOB 4IOCA 4XQNA 3K8AA 4L5SA 1OXUA 1K83B 4ZUJA 1WTVA 4RG1A 3HOYH 5FKAC 2EXZA 4ZRZA 2JA7H 3FKIB 5CV8A 3IAYA 1PRTD 3KBGA 4LUZA 3R93A 1S5DD 2F0TA 4B3TL 4M1UB 2N88A 2QA4A 4RGNA 2B2UA 1XMOL 2HCIA 4A76A 5FLMH 1KD1C 3QO2A 1DOKA 4ZCKA 2JA5B 1MIUA 3I73A 5DEHA 1D8LA 4P73A 2DJFC 1Y69U 5A2QE 1QUQA 4B9XA 1AP0A 4IUTA 1V1QA 1ENAA 1LTGD 3TS0A 2AQ3B 3DEPA 3L2PA 2PQAA 2UXDL 3PO3B 3I4MG 2NVXH 4IN3A 1O7LA 2CH4W 1VQPA 1DYQA 1E22A 2F1MA 4FP5D 4IURA 3Q23A 4A3IG 4AQYL 2MP1A 2EJFC 4NXNL 1SSOA 2XGTA 1XYIA 1STYA 1K8MA 5C4ZA 1L0YB 1HJPA 3NXWA 2VQFL 3RLOA 1EUJA 1S5CD 4JI2L 3PO2G 2OTLA 2G9DA 2CCZA 3PUWA 5JEAJ 1EY9A 4A3FG 1L2FA 4DV0Q 1G6ZA 1A15A 3S1NB 3VR6A 3RLFA 5FOBB 2LSSA 3QJYA 1VQDA 3OSOA 1DD2A 1XTCD 1KDBA 5J3BA 2PPBC 5J22A 1RD9D 5EBDA 3HOUG 1PZKD 1FGBD 2B2YC 3AYHB 3FPPA 1ILQA 2KECA 3JAMc 5CMDA 3GTJH 4DAYB 2QEXA 5IWAQ 2R7ZB 3W2DA 2A1AA 4HAEA 5CV7A 1EFWA 1NE3A 4C3JG 2NVQH 2MUYA 4CJ1B 4BA2I 5BN5A 1YBYA 2L12A 3BDLA 1N33L 1U4RA 1IL8A 2KENA 3I4LA 4A3DG 3WOEA 4RGTA 4K5VA 4KD4A 1R9TH 1X65A 4G7OC 1PYBA 3CCLA 2OXPA 1S5FD 2E74C 1D5ZC 1CA6A 1C9OA 1SXTA 1YEZA 1SMYC 1SNOA 2Z6KC 4L8JA 2RQXA 3VR3A 2R92B 5K36G 3J81i 4EQNA 1HR0Q 1Z6HA 1P16A 1I50B 4HSVA 2ICEC 3K6OA 1UWVA 4DAMA 2PO4A 3TREA 3TP6A 1AFPA 3K7AB 1XNRL 1SMXA 1BOSA 4DR7Q 5EKKA 2R93B 3MZ5A 4LK1C 2F0OA 1SLJA 5IE8A 4U673 2B2WC 3K7UC 5M9OA 2C35B 2YU9B 3Q22A 1A2UA 2RDHA 3D3RA 4ID6A 3A54A 3AFQA 4HIDA 3CCEA 3JC66 3E6ZX 5CV9A 1IBKQ 5FO8B 3I4MH 3OIPA 3QR8A 3EROA 3ZJYC 1G2TA 4A3IH 4ZKBB 1I5FA 4NKLA 3BJUA 1FYCA 3GTLH 4Z9CB 3KLRA 4H7BA 1EY0A 4TSSA 5EPJA 3PO2H 5DM63 4IFDJ 4ZUIA 4A3FH 4JW0A 1SNPA 4ODGA 1VF7A 3KDFA 2J0TD 4A3GH 2G5DA 2K75A 5C4XB 1EWIA 4IUQA 1PTOH 3HOUH 1C0AA 1QJOA 3CQZB 1JWMD 3Q0AA 3P75A 4K14A 3D31A 2UUAL 2UUCQ 4NXMQ 5BR8L 1B70B 3TP5A 2K5VA 2WAQB 3M4PA 2JEAI 2EYLA 1K9MC 1Q3LA 1TWCH 3AEVA 4FF1A 4A3BG 3S15H 2J7ZA 5C4JB 4A3DH 1D6EC 1TY0A 1E0BA 2IY5B 2LKVA 2JE6I 1N34L 2ES2A 2ZM6Q 4DUZQ 1KNAA 2KOLA 4LF8L 3STBC 4CHTB 5M5XH 4YWMA 3BG3A 4FF4A 3PSIA 2RHQB 4BBRB 5ELBA 4DXGA 4LF9Q 4EGVA 3KJOA 2K5WA 2GA4B 4LFAQ 1G2SA 5ELFA 2QGQA 1WCMG 1GUGA 4DU9A 1JT8A 1KXLA 1FJGQ 2CWAA 4BY7G 5HGQA 4K0KQ 1QZHA 3W3AA 4A3JB 1AN8A 4EQOA 4ZQ3A 3G6EA 1YITA 5GROA 5D3IB 1ZYRD 4PMBA 5IODA 4RWSC 1TWHH 4XT3B 1SYEA 1KLGD 3KF6A 5E4WC 4DNIA 5IYBG 1EQTA 3D6WA 3VYUA 4DR3Q 1TS5A 1CKNA 3BZCA 4JOIC 3GTMB 3DMUA 2PNRC 4KV6A 3GO5A 1YZ6A 4LFBL 1I4GA 1B7YB 4OEMB 4EQPA 4FXGC 3GTKH 4JBWA 4JI8Q 3I90A 4C56C 2AQ2B 4JI5Q 4L6TB 1VQLA 2WFWA 1ASYA 1FD7D 3W1GA 1BBUA 4Y7NH 1U0LA 2DNCA 2WP8J 2E76C 2CVRA 1DZ1A 3L9AX 1Q8IA 1TS2A 5I2XA 2HHHL 1PRTF 1EY4A 1SFOH 4A93G 1HTPA 1J6QA 4H02A 1LTRD 3J80L 3S14B 3HEJA 3RUZA 1S5ED 4IUPA 4EQ5A 2ZJPA 3AB9A 1DXMA 4JI7L 1PHJA 1DONA 3MEHA 1A3TA 4F88A 1B2TA 1C7YA 3SK5A 3ZYYX 1MHWC 2K5QA 2IPKD 1EU3A 1MD2D 2IHFA 4PMWA 1YVCA 1W2BA 2NWGA 3G7LA 2B29A 2F0DA 2KHIA 4UHVA 1U9RA 2GVAA 2ATWA 1J9OA 1QVFA 3GTOH 2DJGC 3D4DA 2EDGA 3DWPA 4I7ZC 2JA6B 2FINB 1F9PA 4OXPA 4IPGA 1BR9A 3FDTA 5I9OA 1RKNA 1K3BC 1WCMH 3KUPA 3BDOA 1XMQQ 4QQBX 2XRQD 4BY7H 2HCCA 2F0VA 2H1EA 4OIJA 5C0XJ 3T1YL 5JJKA 4PZ6A 3I4NG 2NB0A 1D2BA 1SJHD 4JV5Q 2C9OA 3C3LA 3UE1A 3K58A 3P20A 3GD7A 5IGBA 2IW3A 4N9PA 3RD4A 4R8IA 4IPDA 4A3MB 3ULJA 2NYZD 2KHSA 4U68A 1VQJA 3OTOQ 4DV2Q 2VZAA 1EYGA 4LAAA 2JYOA 1XWEA 4MIUA 2NVTH 2O2LD 2I07B 1NR4A 5JJLA 1CI3M 4XQQA 3MEFA 3DUZA 4DR1Q 3CPWA 3NENA 1HZ9A 4HEDA 2BH2A 1EEFD 2L5TA 1KC8C 4KY7A 3W5OA 1TS3A 1N32Q 4YWLA 4DAYA 4X64Q 1CZWA 1Q1BA 4NMZA 5M3FB 2PMZE 2PI2A 3CCJA 4OIKA 1L1OA 3STBD 4DR2Q 4A93H 1N8RC 1IZ6A 5IYCH 5C44B 4DV6L 4X66L 1A3VA 1Y1WH 5I9PA 2E5LQ 3HOVB 3UE0A 1L0XB 4C3IB 4K5WA 1VMCA 2V4DA 1EIGA 5KYLA 1O7ZA 1X3PA 5FLXc 5LMNL 4PG3A 3GTPH 2PZWA 3MXGA 3TEHB 3AMUA 4POGA 1U5KA 3ULLA 1RF2D 3O13A 1D5XC 2QCPX 3PUYA 3F2BA 5E1FA 4OWXB 4L5RC 1PFSA 2E2JB 2F0JA 1F9QA 1ASZA 4NP5A 1EOVA 4DV3L 1HA6A 2I5LX 3S2HB 3D4RA 2VUMG 4H13C 1VQMA 2KCNA 4YCVA 2UXBL 1MSGA 5GAHC 1X3QA 4LWCA 3HKZG 1O7YA 3LWUA 1D5MC 2RVLA 3D0FA 3I4NH 1X3GA 3H09A 4KI0A 3H15A 4DUYQ 2B39A 5L37A 3HP3A 2YTYA 4RKLA 2GN5A 3H6MA 4MNOA 1NNXA 3F1ZA 3CAMA 5CBAE 1PH7A 4IFDH 3M4YA 1QCBD 3HOWB 2EYOA 1AZQA 1I4RA 4S3SA 1XX8A 3K0YA 5FLXL 4XT1B 1BVSA 2NTTA 5AJ3Q 3S2DH 1H9SB 3FEWX 4LJZC 2D5DA 5LMNW 1NCVA 4KHPQ 1VQAA 3NTIA 2B2YA 3RZDB 5C5LA 1E2ZA 3S1QH 5NUCA 3VYSA 3PUXA 2Y0SG 2PCFB 2UXCQ 2MJ8A 4E6IA 2E75C 1HA5A 4LFCQ 3M85A 4JI3Q 2EOTA 3CCUA 1PH3A 3WWVA 1EEID 1ML0D 4F87A 3KF8B 1IHZA 1PH4A 1KNEA 4A3LG 2K04A 2IL8A 4UY8C 4YHHQ 2ENBA 3K0XA 5C3XA 2BOSA 2Z6KA 2MGSA 3IKJA 2Z9HA 1X3EA 3R8BA 2K5NA 5IIFA 5C0XG 3HOZG 2EY5A 3J7AV 1CHPD 4DNTB 2JQOA 1SE3A 4FXDA 3DWAA 3CPFA 4DAPA 3SGIA 1R4QB 3CC4A 2JA8G 5FLMG 1BKBA 1PA6A 3OHXC 3H91A 2B2WA 2K5HA 1I6HB 1GO3E 1TWFB 1PH6A 2VUMH 1H9RA 4GLXA 4L5TA 1STGA 5FO9B 2RSNA 5BN3A 1A63A 1J5EL 3OMGA 4CKEA 5I6WA 4OO1I 1HFNA 1EWCA 1ICFB 4JI0Q 4IFDI 1OXXK 1RL2A 4GN3B 3GQBA 1IBMQ 2E2IB 5F2DA 1OXTA 3H0GB 4DGZA 3WDNA 4AYBG 4A3KH 2F4VQ 4R4QA 4BBSB 1BCPF 1SYCA 2BA0A 1HHVA 2Z1CA 5J1ZA 4X3KA 3M4OH 1QILA 3VR2A 2E2HH 3QG1A 2SNMA 3HS0C 4JPBW 2KCTA 2Z0SA 3U50C 4PV1C 4C2MB 4LF9L 1GHKA 1SNCA 4KKUA 1PZJD 1XTDA 4LFAL 1AE3A 4QCLA 2JA5G 2N55A 1TS4A 1FJGL 1V43A 2EYJA 3BDCA 1B3AA 1PH5A 4P75A 1K73C 1O80A 1HNWL 1PLFA 2Z4HA 2QF7A 1KQSA 3C2PA 1ZXTA 4IO9A 2TSSA 1U4LA 3U9OA 1SNDA 1QVCA 4LF4Q 4HMJA 3PO3G 1WVLA 3D8GA 1H9JA 1I4PA 2H5XA 1Q81C 3CHBD 3FHWA 4JVZA 4LF5Q 3KOJA 4A3LH 4X62L 3PIO3 1IKMA 4CJ2C 3ITPA 4O1NA 4ZYSA 3GDEA 4K2LA 4TVAB 3SHLA 2A73B 3TSSA 4APVA 4YY3L 4GNXC 2DGYA 5CR3A 4JI5L 5C0XH 1SNMA 3HOZH 1KRTA 2Z4IA 2J4XA 4CDCC 3WOFA 3X3MA 4HIOA 1Y1VB 2HQLA 2JA9A 2JA8H 1F9SA 3RR5A 1KIXA
chains in the Genus database with same CATH topology
3T1HL 3KDFA 1V9PA 2A8VA 1WJJA 4B3SQ 4LF8Q 4DV1Q 4QY7A 4A3GH 1WYDA 2K75A 2NZOA 2R7ZG 3I7FA 4LF5L 1EWIA 1S3OA 2OTJA 1K3RA 1B8AA 1SE8A 4UP9A 4A4IA 2N8NA 3M9BA 4IJLA 2KCMA 3CCSA 4EX5A 3HOUH 4BBSG 1C0AA 4Y52H 4IPHA 5IP9G 1IBKL 1I3QH 3U58A 4PZ7A 4IJHA 1HNZQ 4GKJQ 3D31A 1EQQA 1K83H 3PIPA 2UUAL 2UUCQ 4NXMQ 4AH6A 5BR8L 1B70B 1KHIA 1G51A 2K5VA 4J15A 2CFMA 3M4PA 4DR5Q 1A0IA 4RMFA 2JEAI 1K9MC 1TWAH 3FKIH 2IT1A 1TWCH 3AEVA 4X6AH 1JB7A 4A3BG 4JCVE 3S15H 5EAYA 3RZDH 1JMCA 1VS0A 3CD6A 4A3DH 5IYBH 4DKAC 2K52A 2PQAB 3RNUA 1WFQA 2JE6I 4JI6Q 2IY5B 1N34L 1L0WA 2ES2A 2R92G 2ZM6Q 1EIYB 4DUZQ 2MO1A 2D62A 4B3SL 1DGSA 4LF8L 4DV1L 1PV4A 3STBC 5M5XH 2IX1A 3HOXG 4YWMA 2K14A 2OCEA 3DM3A 3PSIA 2RHQB 4P71A 4LF9Q 2JA5H 4A3GG 4ME3A 1XMQL 3UDXA 1EQRA 4LFBQ 3KJOA 4GLAC 4LFAQ 4DV5Q 2OQ0A 1O7IA 1WCMG 2QGQA 4P74A 3CMEA 2AWOA 5GADC 1FJGQ 3S1MH 4A3CH 1JT8A 1KXLA 4AIMA 2CWAA 3IRBA 5HGQA 4BY7G 1HNZL 2B63G 4K0KQ 4JV5L 1HZCA 3PF4A 4A3MH 4IPCA 1A62A 1QZHA 2UUCL 4NXML 4WJ3M 3U4VA 3G6EA 1YITA 4DR5L 5GROA 1K0RA 3BU2A 3MXNB 4ALPA 1TWHH 3KLWA 2N49A 4LW1A 5GAGC 2K50A 2UU9Q 1NJIC 4OWWB 3PO3H 3FKIG 1AE2A 3KF6A 4B3MQ 1IBLQ 4DNIA 2AWNA 4GNXB 2ZM6L 4DUZL 5IYBG 2OQKA 3OTOL 1P8LA 4DV2L 2N3SA 4DR3Q 2HHHQ 2RCNA 3BZCA 1CKNA 4DK3C 4JYAQ 4JOIC 3RN2A 4IOAA 1Q46A 3CW2C 1Y1VG 2A19A 3GO5A 5C0XI 1YZ6A 3PCOB 2CWPA 4LFBL 1B7YB 3CCVA 1WOCA 3A5UA 4JI7Q 3EN2A 3S1NH 1RIPA 3GTKH 1PYSB 4DV7Q 1I6HH 2RHSB 4JBWA 3J7ZC 1TWFH 2JK8A 4JG2A 4JI8Q 4DPGA 5C3EG 1JJ2A 4K0KL 5M5YH 3I4OA 1VCIA 1CKNB 4JI5Q 4MZ9A 3B6YA 1VQLA 3LGJA 2WFWA 5JJIA 2MO0A 3J7A5 1ASYA 4BXXH 1VQ6A 3W1GA 1YIJA 3E9IA 3CC2A 1BBUA 4Y7NH 1U0LA 2WP8J 3A74A 2OWOA 4BY1H 4B3ML 1VQEA 4KHZA 1IBLL 2D0OA 3J81j 1CKMA 3KYHC 1X3FA 4DR2L 2HT1A 2R7ZH 3T1HQ 3L0OA 4KLKA 1VQGA 4DR3L 2HHHL 4JYAL 1SFOH 4A93G 2E5LL 2WAQG 3H0GH 1J6QA 3HKSA 4H02A 4BBSH 1VQBA 4OWTB 1JJCB 4EQ5A 5IP9H 2ZJPA 4JI7L 4LNQA 1CUKA 1PHJA 1NBWA 3CP0A 1FVIA 3M4QA 3PV0A 3T1YQ 4LUOA 3HKZE 4JI8L 4B3RQ 1C7YA 2NN6G 4C2MH 2Q2UA 1LTLA 2AMCB 4OONA 1SN8A 1NTGA 4GN4B 2IHFA 2R6GA 4PMWA 1I94Q 4DK6C 5BR8Q 1YVCA 1W2BA 4BBRG 2I5MX 1HH2P 1S72A 3RN5A 2B29A 2KHIA 2VW9A 1E1OA 1IXRA 2GVAA 4JI4L 2ATWA 2R92H 2R7DA 1GVPA 1L1OC 1QVFA 3GTOH 1UE1A 1I50H 3TQYA 1X54A 1TWGH 3HOXH 1N34Q 3RZOH 4HJAA 4A3JG 3A5ZB 4JBJA 1VQ9A 1K8AC 2F3IA 3K7AH 4JOIA 4IPGA 4OXPA 1OTCA 2R93H 1GKHA 3HOWH 1WCMH 3H0GG 4R4TA 1XMQQ 4QQBX 1SRUA 4BY7H 4DV4Q 2B63H 1N9WA 4DUYL 5IP7G 5C0XJ 3T1YL 1MJEA 5JJKA 3BZKA 4LF6L 4B3RL 4PZ6A 3I4NG 3KDFB 4JV5Q 3UE1A 4BA1I 2Y0SE 2ALYB 1G291 2I5HA 1Z47A 1I94L 4A75A 3UDFA 1Q82C 4DR6L 1AH9A 2XTIA 3GD7A 1CSPA 4UPAA 4HJ8A 2EQSA 3TS2A 1FL0A 2VQEQ 4R4OA 1E24A 2PNHA 2IX0A 3F8TA 4IPDA 3H3VH 3ULJA 1X6OA 2VS1A 4DR4Q 2VY3A 1N36L 1MKHA 1W3SA 4QIWE 4PZ8A 1VQJA 3CC7A 3OTOQ 4DV2Q 3HOYG 1JE5A 1Y1VH 2VZAA 1BBWA 4DV6Q 4X66Q 1EYGA 3TRZA 2Q2TA 2EXDA 5IY0A 3I56A 3G48A 3ULPA 2JA7G 4OX9Q 2NVTH 4WJ4A 5ELOA 1HR0W 4DV4L 1WI5A 1NMGA 5LMNQ 2R93G 5JJLA 5C3EH 3MEFA 3I55A 3G71A 4LUVA 1H95A 2JEBI 4DR1Q 3CPWA 3NENA 5H1SE 1HZ9A 2BH2A 1KC8C 1VQ5A 4GOPC 1A8VA 1EIFA 2MQHA 2BA1A 3S1RH 3L7ZC 3W5OA 1VQ7A 3CQZH 5HY6A 1N32Q 4YWLA 2LXKA 3EIVA 4X64Q 2VQEL 1Q1BA 4HJ7A 2PMZE 2PI2A 3ERSX 4R4IA 3PGZA 3CCJA 1L1OA 2VNUD 1YHQA 4DR4L 2Q2HA 3STBD 5JEAG 2L15A 1UE7A 4DV3Q 1G6PA 4DR2Q 4A93H 1Q12A 1N8RC 1IZ6A 5IYCH 3PUVA 2EIFA 3EBEA 4YCUA 3W1BA 4DV6L 4X66L 1Y1WH 3PO2G 2LXJA 2YTVA 3AFPA 1QVGA 3UE0A 1Q1EA 4POFA 2E5LQ 2UXBQ 3G4SA 1IYJB 4OX9L 1QZGA 4UP7A 5DLQE 5FLXc 5E7NA 1KRSA 5LMNL 3PUZA 4PG3A 1L1OB 3JAMi 3KF6B 5LMUL 1XNQQ 3GTPH 1MJCA 1VQNA 3TEHB 3J81c 4DR1L 1HNXL 1E3PA 2JA6G 2F52A 1GM5A 4POGA 1U5KA 4BBRH 3J80i 3ULLA 3PIOA 4X65Q 5GAEC 5C4XG 2B3GA 3NELA 4GLVB 5ELNA 3GTQH 1N32L 1CKOA 1X9NA 3GTGH 1X55A 1YNXA 2UUBL 3ER0A 3PUYA 3F2BA 1UE6A 4OWXB 4AYBE 4L5RC 1PFSA 4YWKA 2YTXA 4X64L 4XTCS 1JJGA 3CCQA 4R1JA 1LYLA 3OW2A 2BH8A 1ASZA 4JI4Q 4A3JH 2VL6A 1EOVA 1VQHA 2YV5A 4DV3L 1Z9FA 2AKWB 1E7ZA 2I5LX 2RF4A 2ZTCA 4HIKA 1YJWA 1Q7YC 1D7QA 2VUMG 1VQMA 2E2IH 2GVBA 4YCVA 3DLLA 2CKZB 3F2DA 2UXBL 1KAWA 4XIGS 5GAHC 5IYCG 4LF7L 4LWCA 5IYDH 3HKZG 4JI1Q 5IP7H 1Y1WG 2NVYH 3PF5A 1IBML 3ICEA 3D0FA 3I4NH 1XNQL 1X3GA 4KI0A 3H15A 4DUYQ 4B3TQ 2FXQA 2YTYA 2GN5A 4MNOA 4JBKA 1XMOQ 3UDGA 4LF6Q 3F1ZA 3CAMA 4X65L 1PH7A 4GOPA 3H3VI 3U4ZA 2K4KA 2WB1E 4DR6Q 1UEBA 2AHOB 4IOCA 3K8AA 1BVSA 1XPOA 1M90C 3M7NA 2ZJRA 4L5SA 1OXUA 5AJ3Q 3S2DH 4RG1A 1Q86C 3HOYH 2DUDA 1N36Q 5LMNW 4GOPB 4KHPQ 1PH1A 1VQAA 2JA7H 2JJQA 1HZAA 1PH2A 4JI1L 5M3FG 3S1QH 4LUZA 1XPUA 3PUXA 1T9HA 2Y0SG 4HJ9A 4AQYQ 4B3TL 2MFIA 5IYDG 2UXCQ 3NBHB 2HIXA 3Q8DA 2QA4A 3S14H 2VQFQ 1XMOL 4A76A 5C44G 2YU9H 5FLMH 1KD1C 1X56A 4OO1G 4LFCQ 3HOVG 4JI2Q 3M85A 4LF4L 4JI3Q 1VQ8A 1MIUA 3S17H 3CCUA 1D8LA 2N78A 4P73A 4L5QA 1PH3A 4IFDG 1LUZA 3A0JA 3WWVA 1VQCA 4YCWA 3HFZB 3KF8B 5AJ3L 1QUQA 2CQOA 4HIMA 1V1QA 1VQIA 2ZTEA 1PH4A 2PI2E 3TS0A 1UE5A 2MNAA 1J5EQ 1VQKA 4A3LG 4KHPL 2NN6I 1XPRA 4UY8C 4YHHQ 3K0XA 5M3MG 3L2PA 2PQAA 3RLNA 1VQ4A 2UXDL 2Z6KA 4C3HH 1X3EA 1YJNA 3I4MG 2NVXH 1KL9A 3HOWG 2K5NA 5IT9c 1E22A 1VQPA 3FP9A 4C3JH 1QUQB 4A3IG 4AQYL 2JA6H 2UXCL 4GKKL 5LMUQ 5C0XG 3HOZG 4NXNL 2XGTA 1TXYA 2JQOA 5C4XH 4P72A 2VQFL 4A3EG 3S24A 1HJPA 1HNXQ 3CPFA 2ZJQA 3RLOA 2Q2IA 1NMFA 4LFCL 1EUJA 3SGIA 1PH8A 2HIVA 2OTLA 1Q8KA 4JI3L 2CCZA 3CC4A 3PUWA 4JI2L 1N33Q 5JEAJ 4A3FG 2I0QA 2JA8G 1L2FA 5FLMG 2IHEA 1BKBA 1PA6A 3UDIA 2UUBQ 4DV0Q 4NPSA 1YJ9A 2K5HA 1GO3E 3E0EA 3RLFA 2R7FA 3OYYA 3KJPA 2LSSA 3VDYA 1PH6A 4GLXA 1VQDA 2VUMH 4L5TA 2ASBA 5J3BA 2D0PA 1A63A 1J5EL 4JC0A 3CXCA 4YHHL 4OO1I 3HOUG 3AYHB 5C4JH 4GKJL 4GNXA 1M1KC 3KFUA 3JAMc 3NEMA 4JI0Q 4LF7Q 3GTJH 4HJ5A 4IFDI 1OXXK 1RL2A 4DAYB 4GN3B 2QEXA 1HNWQ 5IWAQ 1IBMQ 4O0AA 2E8GA 3J80c 1OXSC 1OXTA 2A1AA 1EFWA 1NE3A 2NVQH 1LM0A 3E9HA 3CF5A 4BA2I 4A3KH 4AYBG 3CCMA 1XNRQ 2F4VQ 4R4QA 1YBYA 4JI6L 1N33L 2BA0A 2KENA 4GS3A 4A3DG 3M4OH 4QL5A 4DV0L 2E2HH 3F2CA 1R9TH 1X65A 5M5WH 1PYBA 2KCTA 3CCLA 2Z0SA 5FJ8H 3U50C 4LF9L 1SROA 4X62Q 1XTDA 4LFAL 1AE3A 1C9OA 4DV5L 2JA5G 1YEZA 1PVOA 1YHBA 1FJGL 4NB3A 1V43A 4GN5A 5M3FH 2Z6KC 1PH5A 3AQQA 4FDBA 4P75A 4YY3Q 4JI0L 3M3YH 1K73C 5K36G 4A3CG 3J81i 4O2DA 5IWAL 1HR0Q 1HNWL 1P16A 4A3MG 1KQSA 5C44H 3CMAA 1FGUA 1UWVA 2WB1G 4DAMA 1K8GA 3HOVH 3GTMH 3TREA 4IO9A 2UU9L 4C3IH 1CSQA 2YYZA 1XNRL 2F4VL 1SMXA 4DR7Q 2V1CC 1OXVA 1QVCA 4LF4Q 3PO3G 4A3KG 4GKKQ 4TQUS 1Y14B 1SLJA 5IE8A 1S40A 1IL2A 2NZHA 2H5XA 1NY4A 1E1TA 1Q81C 3FHWA 3K7UC 2C35B 2KHJA 1VQOA 4LF5Q 3KOJA 4A3LH 4X62L 3K80C 3S16H 5M3MH 1HZBA 3AFQA 4HIDA 3CCEA 2KBNA 2WAQE 3JC66 4R4CA 5FJ8G 3K81C 3GDEA 1SR3A 4UP8A 4DV7L 4TVAB 1YI2A 1IBKQ 2E2JH 3I4MH 1YHAA 4QGUA 4APVA 4YY3L 3CCRA 3I2ZA 3ZJYC 2DGYA 2ZTDA 4GNXC 4A3IH 2UXDQ 5GQOA 4JI5L 1I5FA 3HOZH 1VQFA 2UUAQ 3BJUA 1HR0L 3S2HH 4QJFA 1GD7A 3GTLH 4A3EH 4A3BH 1KRTA 4IFDJ 4NXNQ 3PO2H 4HIOA 2HQLA 2JA9A 1PH9A 4A3FH 4JBMA 2JA8H 4BXXG 4MTNA 1XJVA 4DR7L 3RR5A 2ID0A 1KIXA 4BY1G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T1H L;  3KDF A;  1V9P A;  2A8V A;  1WJJ A;  4B3S Q;  4LF8 Q;  4DV1 Q;  4QY7 A;  4A3G H;  1WYD A;  2K75 A;  2NZO A;  2R7Z G;  3I7F A;  4LF5 L;  1EWI A;  1S3O A;  2OTJ A;  1K3R A;  1B8A A;  1SE8 A;  4UP9 A;  4A4I A;  2N8N A;  3M9B A;  4IJL A;  2KCM A;  3CCS A;  4EX5 A;  3HOU H;  4BBS G;  1C0A A;  4Y52 H;  4IPH A;  5IP9 G;  1IBK L;  1I3Q H;  3U58 A;  4PZ7 A;  4IJH A;  1HNZ Q;  4GKJ Q;  3D31 A;  1EQQ A;  1K83 H;  3PIP A;  2UUA L;  2UUC Q;  4NXM Q;  4AH6 A;  5BR8 L;  1B70 B;  1KHI A;  1G51 A;  2K5V A;  4J15 A;  2CFM A;  3M4P A;  4DR5 Q;  1A0I A;  4RMF A;  2JEA I;  1K9M C;  1TWA H;  3FKI H;  2IT1 A;  1TWC H;  3AEV A;  4X6A H;  1JB7 A;  4A3B G;  4JCV E;  3S15 H;  5EAY A;  3RZD H;  1JMC A;  1VS0 A;  3CD6 A;  4A3D H;  5IYB H;  4DKA C;  2K52 A;  2PQA B;  3RNU A;  1WFQ A;  2JE6 I;  4JI6 Q;  2IY5 B;  1N34 L;  1L0W A;  2ES2 A;  2R92 G;  2ZM6 Q;  1EIY B;  4DUZ Q;  2MO1 A;  2D62 A;  4B3S L;  1DGS A;  4LF8 L;  4DV1 L;  1PV4 A;  3STB C;  5M5X H;  2IX1 A;  3HOX G;  4YWM A;  2K14 A;  2OCE A;  3DM3 A;  3PSI A;  2RHQ B;  4P71 A;  4LF9 Q;  2JA5 H;  4A3G G;  4ME3 A;  1XMQ L;  3UDX A;  1EQR A;  4LFB Q;  3KJO A;  4GLA C;  4LFA Q;  4DV5 Q;  2OQ0 A;  1O7I A;  1WCM G;  2QGQ A;  4P74 A;  3CME A;  2AWO A;  5GAD C;  1FJG Q;  3S1M H;  4A3C H;  1JT8 A;  1KXL A;  4AIM A;  2CWA A;  3IRB A;  5HGQ A;  4BY7 G;  1HNZ L;  2B63 G;  4K0K Q;  4JV5 L;  1HZC A;  3PF4 A;  4A3M H;  4IPC A;  1A62 A;  1QZH A;  2UUC L;  4NXM L;  4WJ3 M;  3U4V A;  3G6E A;  1YIT A;  4DR5 L;  5GRO A;  1K0R A;  3BU2 A;  3MXN B;  4ALP A;  1TWH H;  3KLW A;  2N49 A;  4LW1 A;  5GAG C;  2K50 A;  2UU9 Q;  1NJI C;  4OWW B;  3PO3 H;  3FKI G;  1AE2 A;  3KF6 A;  4B3M Q;  1IBL Q;  4DNI A;  2AWN A;  4GNX B;  2ZM6 L;  4DUZ L;  5IYB G;  2OQK A;  3OTO L;  1P8L A;  4DV2 L;  2N3S A;  4DR3 Q;  2HHH Q;  2RCN A;  3BZC A;  1CKN A;  4DK3 C;  4JYA Q;  4JOI C;  3RN2 A;  4IOA A;  1Q46 A;  3CW2 C;  1Y1V G;  2A19 A;  3GO5 A;  5C0X I;  1YZ6 A;  3PCO B;  2CWP A;  4LFB L;  1B7Y B;  3CCV A;  1WOC A;  3A5U A;  4JI7 Q;  3EN2 A;  3S1N H;  1RIP A;  3GTK H;  1PYS B;  4DV7 Q;  1I6H H;  2RHS B;  4JBW A;  3J7Z C;  1TWF H;  2JK8 A;  4JG2 A;  4JI8 Q;  4DPG A;  5C3E G;  1JJ2 A;  4K0K L;  5M5Y H;  3I4O A;  1VCI A;  1CKN B;  4JI5 Q;  4MZ9 A;  3B6Y A;  1VQL A;  3LGJ A;  2WFW A;  5JJI A;  2MO0 A;  3J7A 5;  1ASY A;  4BXX H;  1VQ6 A;  3W1G A;  1YIJ A;  3E9I A;  3CC2 A;  1BBU A;  4Y7N H;  1U0L A;  2WP8 J;  3A74 A;  2OWO A;  4BY1 H;  4B3M L;  1VQE A;  4KHZ A;  1IBL L;  2D0O A;  3J81 j;  1CKM A;  3KYH C;  1X3F A;  4DR2 L;  2HT1 A;  2R7Z H;  3T1H Q;  3L0O A;  4KLK A;  1VQG A;  4DR3 L;  2HHH L;  4JYA L;  1SFO H;  4A93 G;  2E5L L;  2WAQ G;  3H0G H;  1J6Q A;  3HKS A;  4H02 A;  4BBS H;  1VQB A;  4OWT B;  1JJC B;  4EQ5 A;  5IP9 H;  2ZJP A;  4JI7 L;  4LNQ A;  1CUK A;  1PHJ A;  1NBW A;  3CP0 A;  1FVI A;  3M4Q A;  3PV0 A;  3T1Y Q;  4LUO A;  3HKZ E;  4JI8 L;  4B3R Q;  1C7Y A;  2NN6 G;  4C2M H;  2Q2U A;  1LTL A;  2AMC B;  4OON A;  1SN8 A;  1NTG A;  4GN4 B;  2IHF A;  2R6G A;  4PMW A;  1I94 Q;  4DK6 C;  5BR8 Q;  1YVC A;  1W2B A;  4BBR G;  2I5M X;  1HH2 P;  1S72 A;  3RN5 A;  2B29 A;  2KHI A;  2VW9 A;  1E1O A;  1IXR A;  2GVA A;  4JI4 L;  2ATW A;  2R92 H;  2R7D A;  1GVP A;  1L1O C;  1QVF A;  3GTO H;  1UE1 A;  1I50 H;  3TQY A;  1X54 A;  1TWG H;  3HOX H;  1N34 Q;  3RZO H;  4HJA A;  4A3J G;  3A5Z B;  4JBJ A;  1VQ9 A;  1K8A C;  2F3I A;  3K7A H;  4JOI A;  4IPG A;  4OXP A;  1OTC A;  2R93 H;  1GKH A;  3HOW H;  1WCM H;  3H0G G;  4R4T A;  1XMQ Q;  4QQB X;  1SRU A;  4BY7 H;  4DV4 Q;  2B63 H;  1N9W A;  4DUY L;  5IP7 G;  5C0X J;  3T1Y L;  1MJE A;  5JJK A;  3BZK A;  4LF6 L;  4B3R L;  4PZ6 A;  3I4N G;  3KDF B;  4JV5 Q;  3UE1 A;  4BA1 I;  2Y0S E;  2ALY B;  1G29 1;  2I5H A;  1Z47 A;  1I94 L;  4A75 A;  3UDF A;  1Q82 C;  4DR6 L;  1AH9 A;  2XTI A;  3GD7 A;  1CSP A;  4UPA A;  4HJ8 A;  2EQS A;  3TS2 A;  1FL0 A;  2VQE Q;  4R4O A;  1E24 A;  2PNH A;  2IX0 A;  3F8T A;  4IPD A;  3H3V H;  3ULJ A;  1X6O A;  2VS1 A;  4DR4 Q;  2VY3 A;  1N36 L;  1MKH A;  1W3S A;  4QIW E;  4PZ8 A;  1VQJ A;  3CC7 A;  3OTO Q;  4DV2 Q;  3HOY G;  1JE5 A;  1Y1V H;  2VZA A;  1BBW A;  4DV6 Q;  4X66 Q;  1EYG A;  3TRZ A;  2Q2T A;  2EXD A;  5IY0 A;  3I56 A;  3G48 A;  3ULP A;  2JA7 G;  4OX9 Q;  2NVT H;  4WJ4 A;  5ELO A;  1HR0 W;  4DV4 L;  1WI5 A;  1NMG A;  5LMN Q;  2R93 G;  5JJL A;  5C3E H;  3MEF A;  3I55 A;  3G71 A;  4LUV A;  1H95 A;  2JEB I;  4DR1 Q;  3CPW A;  3NEN A;  5H1S E;  1HZ9 A;  2BH2 A;  1KC8 C;  1VQ5 A;  4GOP C;  1A8V A;  1EIF A;  2MQH A;  2BA1 A;  3S1R H;  3L7Z C;  3W5O A;  1VQ7 A;  3CQZ H;  5HY6 A;  1N32 Q;  4YWL A;  2LXK A;  3EIV A;  4X64 Q;  2VQE L;  1Q1B A;  4HJ7 A;  2PMZ E;  2PI2 A;  3ERS X;  4R4I A;  3PGZ A;  3CCJ A;  1L1O A;  2VNU D;  1YHQ A;  4DR4 L;  2Q2H A;  3STB D;  5JEA G;  2L15 A;  1UE7 A;  4DV3 Q;  1G6P A;  4DR2 Q;  4A93 H;  1Q12 A;  1N8R C;  1IZ6 A;  5IYC H;  3PUV A;  2EIF A;  3EBE A;  4YCU A;  3W1B A;  4DV6 L;  4X66 L;  1Y1W H;  3PO2 G;  2LXJ A;  2YTV A;  3AFP A;  1QVG A;  3UE0 A;  1Q1E A;  4POF A;  2E5L Q;  2UXB Q;  3G4S A;  1IYJ B;  4OX9 L;  1QZG A;  4UP7 A;  5DLQ E;  5FLX c;  5E7N A;  1KRS A;  5LMN L;  3PUZ A;  4PG3 A;  1L1O B;  3JAM i;  3KF6 B;  5LMU L;  1XNQ Q;  3GTP H;  1MJC A;  1VQN A;  3TEH B;  3J81 c;  4DR1 L;  1HNX L;  1E3P A;  2JA6 G;  2F52 A;  1GM5 A;  4POG A;  1U5K A;  4BBR H;  3J80 i;  3ULL A;  3PIO A;  4X65 Q;  5GAE C;  5C4X G;  2B3G A;  3NEL A;  4GLV B;  5ELN A;  3GTQ H;  1N32 L;  1CKO A;  1X9N A;  3GTG H;  1X55 A;  1YNX A;  2UUB L;  3ER0 A;  3PUY A;  3F2B A;  1UE6 A;  4OWX B;  4AYB E;  4L5R C;  1PFS A;  4YWK A;  2YTX A;  4X64 L;  4XTC S;  1JJG A;  3CCQ A;  4R1J A;  1LYL A;  3OW2 A;  2BH8 A;  1ASZ A;  4JI4 Q;  4A3J H;  2VL6 A;  1EOV A;  1VQH A;  2YV5 A;  4DV3 L;  1Z9F A;  2AKW B;  1E7Z A;  2I5L X;  2RF4 A;  2ZTC A;  4HIK A;  1YJW A;  1Q7Y C;  1D7Q A;  2VUM G;  1VQM A;  2E2I H;  2GVB A;  4YCV A;  3DLL A;  2CKZ B;  3F2D A;  2UXB L;  1KAW A;  4XIG S;  5GAH C;  5IYC G;  4LF7 L;  4LWC A;  5IYD H;  3HKZ G;  4JI1 Q;  5IP7 H;  1Y1W G;  2NVY H;  3PF5 A;  1IBM L;  3ICE A;  3D0F A;  3I4N H;  1XNQ L;  1X3G A;  4KI0 A;  3H15 A;  4DUY Q;  4B3T Q;  2FXQ A;  2YTY A;  2GN5 A;  4MNO A;  4JBK A;  1XMO Q;  3UDG A;  4LF6 Q;  3F1Z A;  3CAM A;  4X65 L;  1PH7 A;  4GOP A;  3H3V I;  3U4Z A;  2K4K A;  2WB1 E;  4DR6 Q;  1UEB A;  2AHO B;  4IOC A;  3K8A A;  1BVS A;  1XPO A;  1M90 C;  3M7N A;  2ZJR A;  4L5S A;  1OXU A;  5AJ3 Q;  3S2D H;  4RG1 A;  1Q86 C;  3HOY H;  2DUD A;  1N36 Q;  5LMN W;  4GOP B;  4KHP Q;  1PH1 A;  1VQA A;  2JA7 H;  2JJQ A;  1HZA A;  1PH2 A;  4JI1 L;  5M3F G;  3S1Q H;  4LUZ A;  1XPU A;  3PUX A;  1T9H A;  2Y0S G;  4HJ9 A;  4AQY Q;  4B3T L;  2MFI A;  5IYD G;  2UXC Q;  3NBH B;  2HIX A;  3Q8D A;  2QA4 A;  3S14 H;  2VQF Q;  1XMO L;  4A76 A;  5C44 G;  2YU9 H;  5FLM H;  1KD1 C;  1X56 A;  4OO1 G;  4LFC Q;  3HOV G;  4JI2 Q;  3M85 A;  4LF4 L;  4JI3 Q;  1VQ8 A;  1MIU A;  3S17 H;  3CCU A;  1D8L A;  2N78 A;  4P73 A;  4L5Q A;  1PH3 A;  4IFD G;  1LUZ A;  3A0J A;  3WWV A;  1VQC A;  4YCW A;  3HFZ B;  3KF8 B;  5AJ3 L;  1QUQ A;  2CQO A;  4HIM A;  1V1Q A;  1VQI A;  2ZTE A;  1PH4 A;  2PI2 E;  3TS0 A;  1UE5 A;  2MNA A;  1J5E Q;  1VQK A;  4A3L G;  4KHP L;  2NN6 I;  1XPR A;  4UY8 C;  4YHH Q;  3K0X A;  5M3M G;  3L2P A;  2PQA A;  3RLN A;  1VQ4 A;  2UXD L;  2Z6K A;  4C3H H;  1X3E A;  1YJN A;  3I4M G;  2NVX H;  1KL9 A;  3HOW G;  2K5N A;  5IT9 c;  1E22 A;  1VQP A;  3FP9 A;  4C3J H;  1QUQ B;  4A3I G;  4AQY L;  2JA6 H;  2UXC L;  4GKK L;  5LMU Q;  5C0X G;  3HOZ G;  4NXN L;  2XGT A;  1TXY A;  2JQO A;  5C4X H;  4P72 A;  2VQF L;  4A3E G;  3S24 A;  1HJP A;  1HNX Q;  3CPF A;  2ZJQ A;  3RLO A;  2Q2I A;  1NMF A;  4LFC L;  1EUJ A;  3SGI A;  1PH8 A;  2HIV A;  2OTL A;  1Q8K A;  4JI3 L;  2CCZ A;  3CC4 A;  3PUW A;  4JI2 L;  1N33 Q;  5JEA J;  4A3F G;  2I0Q A;  2JA8 G;  1L2F A;  5FLM G;  2IHE A;  1BKB A;  1PA6 A;  3UDI A;  2UUB Q;  4DV0 Q;  4NPS A;  1YJ9 A;  2K5H A;  1GO3 E;  3E0E A;  3RLF A;  2R7F A;  3OYY A;  3KJP A;  2LSS A;  3VDY A;  1PH6 A;  4GLX A;  1VQD A;  2VUM H;  4L5T A;  2ASB A;  5J3B A;  2D0P A;  1A63 A;  1J5E L;  4JC0 A;  3CXC A;  4YHH L;  4OO1 I;  3HOU G;  3AYH B;  5C4J H;  4GKJ L;  4GNX A;  1M1K C;  3KFU A;  3JAM c;  3NEM A;  4JI0 Q;  4LF7 Q;  3GTJ H;  4HJ5 A;  4IFD I;  1OXX K;  1RL2 A;  4DAY B;  4GN3 B;  2QEX A;  1HNW Q;  5IWA Q;  1IBM Q;  4O0A A;  2E8G A;  3J80 c;  1OXS C;  1OXT A;  2A1A A;  1EFW A;  1NE3 A;  2NVQ H;  1LM0 A;  3E9H A;  3CF5 A;  4BA2 I;  4A3K H;  4AYB G;  3CCM A;  1XNR Q;  2F4V Q;  4R4Q A;  1YBY A;  4JI6 L;  1N33 L;  2BA0 A;  2KEN A;  4GS3 A;  4A3D G;  3M4O H;  4QL5 A;  4DV0 L;  2E2H H;  3F2C A;  1R9T H;  1X65 A;  5M5W H;  1PYB A;  2KCT A;  3CCL A;  2Z0S A;  5FJ8 H;  3U50 C;  4LF9 L;  1SRO A;  4X62 Q;  1XTD A;  4LFA L;  1AE3 A;  1C9O A;  4DV5 L;  2JA5 G;  1YEZ A;  1PVO A;  1YHB A;  1FJG L;  4NB3 A;  1V43 A;  4GN5 A;  5M3F H;  2Z6K C;  1PH5 A;  3AQQ A;  4FDB A;  4P75 A;  4YY3 Q;  4JI0 L;  3M3Y H;  1K73 C;  5K36 G;  4A3C G;  3J81 i;  4O2D A;  5IWA L;  1HR0 Q;  1HNW L;  1P16 A;  4A3M G;  1KQS A;  5C44 H;  3CMA A;  1FGU A;  1UWV A;  2WB1 G;  4DAM A;  1K8G A;  3HOV H;  3GTM H;  3TRE A;  4IO9 A;  2UU9 L;  4C3I H;  1CSQ A;  2YYZ A;  1XNR L;  2F4V L;  1SMX A;  4DR7 Q;  2V1C C;  1OXV A;  1QVC A;  4LF4 Q;  3PO3 G;  4A3K G;  4GKK Q;  4TQU S;  1Y14 B;  1SLJ A;  5IE8 A;  1S40 A;  1IL2 A;  2NZH A;  2H5X A;  1NY4 A;  1E1T A;  1Q81 C;  3FHW A;  3K7U C;  2C35 B;  2KHJ A;  1VQO A;  4LF5 Q;  3KOJ A;  4A3L H;  4X62 L;  3K80 C;  3S16 H;  5M3M H;  1HZB A;  3AFQ A;  4HID A;  3CCE A;  2KBN A;  2WAQ E;  3JC6 6;  4R4C A;  5FJ8 G;  3K81 C;  3GDE A;  1SR3 A;  4UP8 A;  4DV7 L;  4TVA B;  1YI2 A;  1IBK Q;  2E2J H;  3I4M H;  1YHA A;  4QGU A;  4APV A;  4YY3 L;  3CCR A;  3I2Z A;  3ZJY C;  2DGY A;  2ZTD A;  4GNX C;  4A3I H;  2UXD Q;  5GQO A;  4JI5 L;  1I5F A;  3HOZ H;  1VQF A;  2UUA Q;  3BJU A;  1HR0 L;  3S2H H;  4QJF A;  1GD7 A;  3GTL H;  4A3E H;  4A3B H;  1KRT A;  4IFD J;  4NXN Q;  3PO2 H;  4HIO A;  2HQL A;  2JA9 A;  1PH9 A;  4A3F H;  4JBM A;  2JA8 H;  4BXX G;  4MTN A;  1XJV A;  4DR7 L;  3RR5 A;  2ID0 A;  1KIX A;  4BY1 G; 
#chains in the Genus database with same CATH topology
 3MFG A;  5KYI A;  5C3E B;  3BYY B;  2A6H D;  2NZO A;  2VB2 X;  3A8K E;  3HZX A;  3I7F A;  1KDA A;  2R7Z G;  1HUN A;  1K3R A;  4UP9 A;  4A4I A;  3M9B A;  1JCK B;  2KCM A;  4IJL A;  3CCS A;  3S1R B;  4IPH A;  1K8O A;  3C1E A;  2KED A;  1HNZ Q;  4GKJ Q;  4I65 A;  1K83 H;  4AH6 A;  2RA4 A;  5D3D A;  1KHI A;  4J15 A;  2ZXR A;  4RMF A;  5KEE A;  3FKI H;  4G7Z C;  2B2V C;  1B53 A;  2QIL A;  4DKA C;  3FVQ A;  3RNU A;  1WFQ A;  4JI6 Q;  1M8A A;  4CDE C;  1L0W A;  2L1B A;  2R92 G;  1KTK A;  1EIY B;  2D62 A;  2L11 A;  1DGS A;  2CH4 A;  4B3S L;  5EPK A;  4DV1 L;  2XWB B;  1Y8N B;  1C4Q A;  1YNN C;  2OCE A;  4P71 A;  5JPN C;  1QWY A;  2JA5 H;  4A3G G;  2D9U A;  1F2M A;  1XMQ L;  3GTG B;  3S1M H;  1JWS D;  4H44 C;  1GOZ A;  5GAD C;  4AIM A;  4JV5 L;  4HR7 B;  4IPC A;  3G6J B;  4HN7 A;  1FNV A;  5IGE A;  4DR5 L;  4B08 A;  4R9W A;  3BU2 A;  3MXN B;  1QG7 A;  2A68 D;  5D65 A;  5I4D A;  2OEO A;  3KLW A;  2UU9 Q;  2N49 A;  4LW1 A;  1NSN S;  2K50 A;  4OWW B;  1NJI C;  3V96 A;  3PO3 H;  1AE2 A;  1IBL Q;  2NVY B;  4GNX B;  2OQK A;  3OTO L;  1P8L A;  4DV2 L;  3ND9 A;  2F0L A;  4JYA Q;  3H94 A;  3RN2 A;  3CW2 C;  1BCP C;  3C1F A;  5C0X I;  1EIH A;  5LL6 S;  2CWP A;  1KAB A;  1LT4 D;  2XSC A;  3S1N H;  2LMC B;  5KNB A;  3A55 A;  4JK1 C;  2JP1 A;  4MZ9 A;  3DXJ C;  1WTP A;  4WJW A;  3LGJ A;  1SYB A;  5JVH 3;  3BYT B;  1ILP A;  3J7A 5;  4YIJ A;  1GUO A;  3CC2 A;  4DK0 A;  3I4M B;  3NE5 B;  3URY A;  4B3M L;  4KHZ A;  2D0O A;  3S9W A;  3J81 j;  1WTX A;  4DR2 L;  1X3F A;  1LTT D;  4X3T A;  3JAM L;  2R7Z H;  3L0O A;  3NP8 A;  1EWH A;  1EZ8 A;  3T16 A;  3EJI A;  2WAQ G;  2E5L L;  3PO2 B;  3MVV A;  5DAU A;  4A3F B;  1T5E A;  1JJC B;  5JAV A;  5HUR A;  4L63 B;  3BVM A;  4LNQ A;  3MAQ A;  1IW7 C;  3E0J A;  3QOL A;  3S17 B;  2QKI C;  4RCO A;  1FVI A;  4QMG A;  4RH6 A;  4CKB A;  5CGK A;  1H9S A;  1JWU D;  4B3R Q;  2Q8I B;  2R6G A;  5AFW A;  2F0P A;  2TMP A;  5C3W A;  4BBR G;  1F77 A;  1SEB D;  4LMQ D;  1JOR A;  2F0K A;  3RN5 A;  3J80 E;  2VW9 A;  1IXR A;  1LT6 D;  5ISR A;  3NK9 A;  2R92 H;  4C3H B;  4G57 A;  1I50 H;  1EQV A;  4C3J B;  4A3J G;  1VQ9 A;  1K8A C;  3NUC A;  3T56 B;  1NUC A;  3K7A H;  2WKC A;  1OTC A;  3S15 B;  2X69 A;  1GKH A;  2R93 H;  2DN8 A;  3L3O C;  3KK7 A;  4A3D B;  1EY7 A;  1CM9 A;  1SRU A;  2HDM A;  2NTS A;  2NBF A;  2WKD A;  5IP7 G;  4DUY L;  1MJE A;  1I4H A;  4FVM A;  2A6E C;  5M5X B;  5JPM C;  3IFD A;  4BA1 I;  4K8I A;  1I94 L;  3SDZ A;  1Q82 C;  1AZP A;  1EY5 A;  1BCP B;  3FRP B;  1TKW B;  3ERQ A;  5T1G A;  4ZK9 B;  3TS2 A;  4OHJ A;  1E24 A;  1UUP A;  2VY3 A;  1MKH A;  3N52 A;  4CDF C;  1BBW A;  4V19 0;  4RKB A;  3TRZ A;  2Q2T A;  2EXD A;  4HSP A;  5IY0 A;  3ULP A;  1MSH A;  3ND8 A;  1BUV T;  5ELO A;  3TME A;  4DV4 L;  1NMG A;  1EOT A;  1BF4 A;  1ET6 A;  2Q8T A;  3G71 A;  1H95 A;  5M5W B;  4KK7 A;  3DHQ A;  5TSS A;  1ZEQ X;  1CK1 A;  1A8V A;  4GOP C;  2BA1 A;  3CQZ H;  2IX3 A;  3J7A F;  3I72 A;  2VQE L;  2PQE A;  4R4I A;  3PGZ A;  4F7X A;  3M3Y B;  4DR4 L;  1SJE D;  5JEA G;  1G6P A;  1QOH A;  1Q12 A;  1YNN D;  2L0C A;  4RHS A;  3BZD B;  3EBE A;  1UNS A;  2PZT A;  3AFP A;  1V1P B;  3G4S A;  1IYJ B;  4OX9 L;  3OIQ A;  5DLQ E;  1XNQ Q;  1MJC A;  1M4V A;  3BVZ A;  1VQN A;  1B3Q A;  1F2Y A;  3J81 c;  2JA6 G;  2F52 A;  3I91 A;  4BBR H;  1BNZ A;  2Q8R E;  1RHP A;  4GLV B;  2RCF A;  4CJ0 B;  3S16 B;  5M3M B;  1YNX A;  2EE1 A;  2WAC A;  1UAP A;  2YTX A;  3NSW A;  1LYL A;  2XWJ B;  4KJO A;  4JI4 Q;  5EJW A;  3MHB A;  4TKO B;  4A3J H;  2VL6 A;  1VQH A;  1E7Z A;  2RF4 A;  2ZTC A;  4A3E B;  1RJT A;  5C4H A;  4A3B B;  1BCP D;  4ILW A;  2EVB A;  5JOB A;  4DXF A;  2XIW A;  2PMZ B;  5IYC G;  2EPB A;  5IYD H;  1Y1W G;  4KJN A;  1SMY D;  5IP7 H;  1IBM L;  3ICE A;  5LL6 X;  1LT5 D;  3TN2 A;  4B3T Q;  2B8G A;  5ELC A;  1LLR D;  3QB3 A;  1ESF A;  1YNJ C;  5IOC A;  1XMO Q;  4X65 L;  4KHV A;  1WCM B;  1B9N A;  1S4Z A;  1UEB A;  4NW2 A;  4OGQ C;  1QNU A;  4RAU C;  4BY7 B;  3NHH A;  1I3Q B;  1GUS A;  1XPO A;  1SYG A;  2KUM A;  4I7A A;  2ZJR A;  5CC4 A;  4ABN A;  3J81 L;  5DNF A;  4GOP B;  1TWA B;  2R61 A;  1IW7 D;  1XXG A;  1HZA A;  4JI1 L;  5M3F G;  1LTA D;  3KBX A;  4HJ9 A;  4AQY Q;  5FLX E;  2MFI A;  1V1O A;  1PZI D;  1EFI D;  4RCN A;  1ONL A;  2HIX A;  3S14 H;  2VQF Q;  5C44 G;  4J8Q A;  4OO1 G;  3HOV G;  4JI2 Q;  3SXH A;  4LF4 L;  4C3I G;  2NVT B;  2LS0 1;  4DFA A;  5KRU A;  4L5Q A;  2JN4 A;  4IFD G;  1LUZ A;  3A0J A;  4HMI A;  5JEA H;  5I2Y A;  3HFZ B;  4RHR A;  2LY7 A;  2CQO A;  2ZTE A;  1G8Z D;  1VQK A;  2QEJ C;  2L9H A;  2IWH A;  1XPR A;  3VYT A;  1VQ4 A;  3RLN A;  1WD1 A;  1KL9 A;  5IT9 c;  2A6E D;  1QUQ B;  1B1Z A;  2JA6 H;  4GKK L;  5LMU Q;  4A93 B;  1J8I A;  4XXE A;  5IGD A;  2ZJQ A;  2Q2I A;  1STH A;  2RDF A;  3HGB A;  2HIV A;  1IL2 A;  1PFM A;  1N33 Q;  2EJM A;  2EYH A;  1K0S A;  2K1B A;  4K8J A;  2CW0 C;  2IHE A;  3UDI A;  2UUB Q;  3GTP B;  1YJ9 A;  3H3V C;  3E0E A;  2R7F A;  3VDY A;  3T51 B;  1NAP A;  5M5Y B;  2ASB A;  2D0P A;  3CXC A;  2FJ2 A;  4GKJ L;  4GNX A;  1M1K C;  3KFU A;  1GXD C;  3NEM A;  2PYK A;  4HJ5 A;  4BY1 B;  4LF7 Q;  5K5P A;  2E8G A;  4KKT A;  4MHE A;  3OMC A;  4PMC A;  3E9H A;  3CF5 A;  1ENC A;  3CCM A;  1XNR Q;  4JI6 L;  1TY2 A;  5IT9 L;  4DV0 L;  3F2C A;  3F2U A;  3J7Y W;  4IUV A;  5FJ8 H;  3VR4 A;  1DCZ A;  4FO2 A;  4CKC A;  1RTO A;  1Q90 A;  1HRJ A;  4XYQ A;  4GN5 A;  5M3F H;  1BO0 A;  4FDB A;  4J1M A;  2C5C A;  1ICW A;  3SK8 A;  4A3C G;  4O2D A;  5IWA L;  3VA5 A;  2FMM A;  3RZO B;  1TWG B;  5C44 H;  3A56 A;  2K32 A;  3CMA A;  1FGU A;  2WB1 G;  4OO1 H;  3HOV H;  2B2V A;  3OWE B;  2UU9 L;  1WTH A;  4C3I H;  1GJX A;  2ICI A;  2K33 A;  3UI2 A;  2V1C C;  1OXV A;  2QDB A;  1VDZ A;  1O78 A;  4A3K G;  4TQU S;  2B63 B;  2F0H A;  2NZH A;  2P5Z X;  3P7J A;  4KN7 C;  2KHJ A;  1S5B D;  5EPL A;  1BBX C;  5EQ0 A;  3K80 C;  1HZB A;  1HQM C;  5JVG 3;  2KBN A;  2E2J H;  2BCO A;  1YI2 A;  3I2Z A;  2OF1 A;  1F9R A;  2UUA Q;  3S2H H;  1HR0 L;  2JXM B;  2PZU A;  1GD7 A;  1YNJ D;  3QWN A;  4JBM A;  4N8F A;  1EYC A;  4DR7 L;  2ID0 A;  4FYD A;  3K5M A;  1V9P A;  1WJJ A;  4LF8 Q;  5EKI A;  1WYD A;  1S3O A;  1B8A A;  4BBS G;  3TDQ A;  2EYF A;  1CA5 A;  5IP9 G;  1KLU D;  3D4W A;  1IBK L;  1IKL A;  2JSO A;  1OO9 B;  5KIX A;  4PZ7 A;  2F3W A;  1LV9 A;  1Y8P B;  3PIP A;  3K57 A;  3NTH A;  2VXW A;  1G51 A;  2CFM A;  2F0U A;  1C8C A;  2NUC A;  2IT1 A;  3I70 A;  5J39 A;  1TII D;  4X6A H;  4KY5 A;  4JCV E;  3RZD H;  1JMC A;  3CD6 A;  1SYF A;  1PTO F;  2L4N A;  3NPP A;  3SE0 A;  1PV4 A;  3HOX G;  2SEB D;  5ELE A;  2D2C C;  1II3 A;  3UDX A;  1BQQ T;  1EZ6 A;  1EQR A;  1ROD A;  4LFB Q;  3GTQ B;  5T1I A;  1LAB A;  2OQ0 A;  4DV5 Q;  3CME A;  2E2H B;  4A3C H;  5CBE E;  3PF4 A;  1A62 A;  4DAV A;  2UUC L;  4NXM L;  3NBI A;  4WJ3 M;  3U4V A;  1HQR D;  1V1P A;  3SVM A;  1KDC A;  5KND A;  4QUC A;  5C6A A;  5GAG C;  1HFG A;  3FKI G;  2AWN A;  2KJX A;  1HCZ A;  2ZM6 L;  3OOC A;  4DUZ L;  1ENF A;  1TT2 A;  2N3S A;  2HHH Q;  1TQO A;  2EY6 A;  1DOL A;  4KD3 A;  1GHJ A;  1UEA B;  3PQI A;  2I46 A;  1Q46 A;  4PNY A;  1Y1V G;  4IOA A;  2K7V A;  4RA8 A;  1TR5 A;  4JI7 Q;  1WOC A;  3A5U A;  2O5J C;  3SEB A;  1I6H H;  4DV7 Q;  2RHS B;  3J7Z C;  1SYD A;  1TWF H;  2JK8 A;  3NQT A;  4DPG A;  5C3E G;  4K0K L;  2XRS D;  1JJ2 A;  1VCI A;  1CKN B;  3TP8 A;  4TRD A;  3B6Y A;  1B4O A;  3HOY B;  5JJI A;  2MO0 A;  1VQ6 A;  3MC0 B;  2JA7 B;  2XNA C;  1VQE A;  5FO7 B;  1SNQ A;  1JOK A;  4DF7 A;  3T1H Q;  4DR3 L;  1VQG A;  2F4I A;  4F8M A;  3H0G H;  1LTB D;  1TVX A;  2M00 A;  5IGG A;  3HKS A;  4BBS H;  1VQB A;  5IP9 H;  3HRZ C;  1CUK A;  4BS9 A;  2AUJ D;  3CP0 A;  3T1Y Q;  4LUO A;  3HKZ E;  5COR A;  4JI8 L;  2NN6 G;  4C2M H;  2Q2U A;  1LTL A;  4OON A;  1IYU A;  3OW7 A;  4RFB A;  1SN8 A;  1NTG A;  2SOB A;  4WFN 3;  3JAM E;  3KLS X;  3Q24 A;  1S72 A;  1TU2 B;  2VB3 X;  1E1O A;  4UDU C;  4JI4 L;  4KMU C;  2R7D A;  1L1O C;  2WIN B;  2NVX B;  2R3Z A;  1X54 A;  3HOX H;  2F0E A;  2RSO A;  1QB5 D;  4JBJ A;  2M2L A;  4AYB B;  5E4X A;  3K59 A;  3EVQ A;  4JOI A;  1H9M A;  3EQL C;  1WTW A;  2EZV A;  1C48 A;  1N9W A;  1HXY D;  4Q5V A;  3BZK A;  1DJR D;  2Y0S E;  2ALY B;  1Z47 A;  4A75 A;  1AH9 A;  4HJ8 A;  1CSP A;  4UPA A;  2EQS A;  1FNW A;  3S1M B;  1FL0 A;  2PNH A;  3F8T A;  1SDF A;  3GTJ B;  1X6O A;  2VS1 A;  4ULL A;  3I8Z A;  4QIW E;  3T53 B;  1JE5 A;  1A2T A;  1Y1V H;  3LWE A;  4DV6 Q;  4X66 Q;  2NVQ B;  1I4X A;  1PTO C;  3E5S A;  3I56 A;  3M7G A;  4WJ4 A;  5C5M A;  3SK6 A;  3BVG A;  2R93 G;  1WI5 A;  5LMN Q;  2F0Q A;  5C3E H;  3VR5 A;  4LUV A;  3CRL C;  3GP7 A;  2BDO A;  3OPO A;  1R9T B;  4KKS A;  3AU7 A;  1VQ5 A;  1ZYR C;  1EIF A;  3K5O A;  3S1R H;  3L7Z C;  2LXK A;  1LAC A;  3EIV A;  4HJ7 A;  3ERS X;  2Q2H A;  2L15 A;  1UE7 A;  4DV3 Q;  2EIF A;  4YCU A;  5G3L F;  4ME5 A;  3MXP A;  2LXJ A;  1Q1E A;  2UXB Q;  2KQ3 A;  2Z8L A;  1IYV A;  1QZG A;  2DY8 A;  3A8I E;  5E7N A;  1KRS A;  4C3H G;  1D1I A;  3PUZ A;  5LMU L;  1L1O B;  5EGT A;  2NN6 H;  3V2T A;  1B50 A;  4DR1 L;  3QIA A;  4XDX A;  1GM5 A;  1KAA A;  3J80 i;  5GAE C;  5C4X G;  1BXT A;  3NEL A;  1R4P B;  4KN4 C;  1N32 L;  1CKO A;  2EJG C;  3GTG H;  2UUB L;  3N6R A;  1UE6 A;  4AYB E;  1ET9 A;  4NDX A;  4X64 L;  1JJG A;  1CQF A;  1D1K A;  3OW2 A;  4A3I B;  4QB4 A;  1Q7Y C;  3GTL B;  1WTQ A;  2F03 A;  1SAP A;  3CU7 A;  3Q6S A;  1LT3 D;  3DLL A;  3I3C A;  4LF7 L;  4FXK C;  2SDF A;  1V8Q A;  2XVS A;  4FF2 A;  2NVY H;  3CKI B;  2KCC A;  1E2W A;  1GUN A;  4X3S A;  4LF6 Q;  4A3G B;  4JBK A;  3UDG A;  3KLS A;  4OEL B;  4KTA A;  4ZLT F;  4DR6 Q;  2L55 A;  1PTO B;  3V05 A;  4B9W A;  3EA6 A;  3HOU B;  2NZ1 D;  5FK9 C;  1I6V C;  5HGT A;  2E2D C;  2A69 C;  1JE4 A;  3TP7 A;  1M90 C;  3M7N A;  1PXU A;  1Q86 C;  2DUD A;  1N36 Q;  1PDQ A;  2HQE A;  2O5I C;  4GZY C;  1PH1 A;  3NWS A;  4DA2 A;  1ESR A;  2B2T C;  1TWC B;  2JJQ A;  2XN9 C;  1PH2 A;  2LFN A;  5A2Q L;  1CFM A;  1LTI D;  1XPU A;  1EYD A;  1T9H A;  2F3V A;  3KF8 A;  4N8X 1;  3NBH B;  5JJZ A;  5IYD G;  3Q8D A;  3J81 E;  2CHB D;  2YU9 H;  1X56 A;  2X6L A;  1RTN A;  1VQ8 A;  2A5H A;  2MHV A;  3S17 H;  1T5X D;  2N78 A;  2B8F A;  1HTL D;  2CQA A;  1VQC A;  4YCW A;  2QDL A;  5AJ3 L;  4HIM A;  1VQI A;  2PI2 E;  1UE5 A;  2MNA A;  5KNC A;  1J5E Q;  4KHP L;  2NN6 I;  3GV3 A;  5M3M G;  2AUK A;  2EYM A;  1TWH B;  4C3H H;  1YJN A;  1STA A;  1E2V A;  3FP9 A;  4C3J H;  2KEE A;  1WTO A;  1NR2 A;  2UXC L;  1I4Q A;  3EFX D;  1TXY A;  2K6A A;  5C4X H;  4P72 A;  4A3E G;  3S24 A;  1HNX Q;  1DOM A;  4J6H A;  1NMF A;  4LFC L;  1PH8 A;  1Q8K A;  4JI3 L;  2I0Q A;  2ZXO A;  1MGS A;  2OT2 A;  4NPS A;  3GTK B;  3OYY A;  3KJP A;  3MXU A;  2BE5 C;  4IAL A;  2FHT A;  1PTO D;  4JC0 A;  1JB3 A;  4YHH L;  3T13 A;  5K36 H;  4IZ8 A;  5C4J H;  4Y7N B;  4HCS A;  1HNW Q;  4DNR B;  4O0A A;  1JR0 D;  3J80 c;  2F0M A;  1OXS C;  2SNS A;  1LM0 A;  2B2U C;  1SFO B;  2IJ0 A;  1BDO A;  4GS3 A;  4QL5 A;  3NWT A;  2M9V A;  3U9S A;  2F0N A;  4CDD C;  5M5W H;  1SRO A;  4X62 Q;  3R2I A;  2EY2 A;  3R3O A;  2Z6B A;  4EVO A;  5ELD A;  4DV5 L;  1X32 A;  4ZAI A;  1PVO A;  1B44 D;  1YHB A;  1RCV D;  4NB3 A;  2G9H D;  3T4A C;  1CT1 D;  3AQQ A;  4YY3 Q;  1WTR A;  4JI0 L;  3M3Y H;  3IFT A;  3GTO B;  5I6Y A;  5IT9 E;  4A3M G;  5CV5 A;  1K8G A;  3GTM H;  3A7A B;  1CSQ A;  2YYZ A;  2F4V L;  4K5X A;  4K2K A;  4GKK Q;  1LTS D;  1CZG A;  3A8J E;  1Y14 B;  3HG9 A;  1S40 A;  1CTM A;  5CYU A;  1NY4 A;  1E1T A;  3SR1 A;  1MBY A;  1VQO A;  2EYP A;  3S16 H;  5M3M H;  5FJ8 G;  2A74 C;  2WAQ E;  4R4C A;  3K81 C;  1SR3 A;  4UP8 A;  4OL7 A;  3MFY A;  4DV7 L;  2O4X A;  1YHA A;  4QGU A;  2UXD Q;  3CCR A;  2ZTD A;  5GQO A;  1PFB A;  1VQF A;  5KGU A;  4QJF A;  4A3E H;  4CBV A;  4A3B H;  4NXN Q;  1MI2 A;  1PH9 A;  5LHY 1;  4RGO S;  4BXX G;  4MTN A;  1XJV A;  4QF4 A;  5E3F A;  4BY1 G;  2A69 D;  3T1H L;  4FF3 A;  2A8V A;  4B3S Q;  4DV1 Q;  4QY7 A;  4LF5 L;  2OTJ A;  3K5N A;  2F0I A;  1SE8 A;  2N8N A;  3R2T A;  1H9K A;  4EX5 A;  4Y52 H;  2K01 A;  1I3Q H;  1LO5 D;  3U58 A;  2BDN A;  4IJH A;  2FFK B;  1CHQ D;  1EQQ A;  4K6L A;  5COY A;  3TBI B;  4H0L C;  4DR5 Q;  1A0I A;  1TWA H;  1STN A;  2H4O A;  4MTK A;  3DWQ A;  1Y1W B;  1JB7 A;  1EL0 A;  5EAY A;  3LNN A;  1FR3 A;  1VS0 A;  3TZU A;  5IYB H;  2K52 A;  2PQA B;  4R8N A;  3K5L A;  2MO1 A;  2IX1 A;  2K14 A;  3DM3 A;  4ME3 A;  4MN3 A;  3MXN A;  1PFN A;  4UAI A;  4GLA C;  1QNK A;  3HOW G;  1O7I A;  4P74 A;  2AWO A;  2K05 A;  4IUN A;  3VA7 A;  3IRB A;  1RDP D;  4C1N I;  1HNZ L;  2B63 G;  1HZC A;  4A3M H;  3NQI A;  3IL8 A;  1PMR A;  2KA7 A;  1K0R A;  4ALP A;  2PW7 A;  1SE4 A;  3P1H A;  1JC7 A;  1U4M A;  4B3M Q;  1Z7T A;  4IQZ A;  5IGF A;  2WV6 D;  3I4N B;  2BE5 D;  2RCN A;  4DK3 C;  3SK4 A;  1EY8 A;  2A19 A;  2AQ1 B;  3PCO B;  3CCV A;  1FNU A;  3EN2 A;  1RIP A;  1PYS B;  3FMC A;  4X3U A;  4JG2 A;  5M5Y H;  4Q0F A;  4ZKC B;  5G3L D;  2K03 A;  3I4O A;  2X6G A;  3S2D B;  4G4K A;  4V0B A;  2RDG A;  5D14 A;  3X3N A;  4BXX H;  1YIJ A;  1JIC A;  3E9I A;  3MTS A;  4DK1 A;  4QUF A;  3A74 A;  2OWO A;  4BY1 H;  1Y8O B;  1IBL L;  1JQY D;  1CKM A;  3KYH C;  3S1Q B;  2HT1 A;  4G7H C;  2RKS A;  4KLK A;  4JYA L;  4O42 A;  4OWT B;  3QOJ A;  1G91 A;  3GV6 A;  1GUT A;  1NBW A;  3NTK A;  1PRT C;  5BN4 A;  1B9M A;  3M4Q A;  3PV0 A;  2ZXP A;  1AW7 A;  5CV6 A;  2AMC B;  4BWG B;  2F0S A;  4GN4 B;  1I94 Q;  3MA2 B;  4DK6 C;  5BR8 Q;  4C1N K;  2I5M X;  1HH2 P;  1K28 A;  3DEO A;  1AEX A;  5EBC A;  1GVP A;  1F2Z A;  1UE1 A;  3NBH A;  2HUG A;  2A6H C;  4P2C B;  3TQY A;  1TWG H;  1N34 Q;  3RZO H;  4HJA A;  3A5Z B;  4XQJ A;  2F3I A;  1DM0 B;  1EYA A;  5EKL A;  2F0G A;  4CGY B;  5A35 A;  3HOW H;  4R4T A;  3H0G G;  4DV4 Q;  1VF5 C;  2B63 H;  1F2L A;  5IGC A;  4LF6 L;  4B3R L;  4FNF A;  3KDF B;  2VUM B;  1G29 1;  2I5H A;  4HTH A;  3UDF A;  4DR6 L;  3LX0 A;  2XTI A;  3A7L A;  1SBB B;  3HKZ B;  4N9T A;  4R4O A;  2VQE Q;  1PYW D;  4WOR A;  2IX0 A;  3H3V H;  4DR4 Q;  1N36 L;  1W3S A;  3D6C A;  2WB1 B;  4PZ8 A;  2WII B;  1WD0 A;  3CC7 A;  3HOY G;  1EY6 A;  1CQV A;  3G48 A;  4A3K B;  4OX9 Q;  2JA7 G;  2PW5 A;  2HD3 A;  1HR0 W;  3M4O B;  3I55 A;  2JEB I;  5H1S E;  1ZKO A;  4RGM A;  2MQH A;  2A68 C;  2MPM A;  1VQ7 A;  5HY6 A;  1HPC A;  2FMC A;  3VYR A;  3PMF A;  2CW0 D;  1PRT B;  2K28 A;  2EY1 A;  4PQX A;  2VNU D;  2Y0S B;  1YHQ A;  1STE A;  2ZT9 C;  3PIP 3;  3C46 A;  3PUV A;  4M8A A;  3W1B A;  2RBM A;  2YTV A;  1QVG A;  1JOO A;  2B2T A;  4POF A;  1GUW A;  3TZD A;  3E3X A;  2F0F A;  1HUM A;  2KVM A;  4UP7 A;  1VMP A;  2K5D A;  1QE6 A;  1U4P A;  2HDL A;  4QIW B;  2DNE A;  3JAM i;  3KF6 B;  4DN4 M;  1HNX L;  1E3P A;  4K6D A;  1W6K A;  3PIO A;  4X65 Q;  5DM7 3;  1SE2 A;  4IUU A;  2B3G A;  3BS1 A;  3MWY W;  5ELN A;  3GTQ H;  1X9N A;  1X55 A;  3ER0 A;  2QW7 A;  4YWK A;  4XTC S;  3CCQ A;  1A3U A;  4R1J A;  2F0W A;  2BH8 A;  2YV5 A;  3FPU B;  1Z9F A;  2AKW B;  4KY6 A;  4HIK A;  3HOZ B;  1D7Q A;  1YJW A;  2E2I H;  2GVB A;  1JOQ A;  5CV4 A;  4WRD A;  3DM1 A;  1A6X A;  2CKZ B;  3F2D A;  1KAW A;  4XIG S;  3RMH A;  2JA8 B;  1W6J A;  3OWF A;  4JI1 Q;  2DY7 A;  3PF5 A;  3HOX B;  1XNQ L;  4HCE A;  2FXQ A;  4XYO A;  1STB A;  3ONA B;  3H3V I;  4GOP A;  1EU4 A;  3U4Z A;  2K4K A;  2WB1 E;  3CRK C;  2AHO B;  4IOC A;  4XQN A;  3K8A A;  4L5S A;  1OXU A;  1K83 B;  4ZUJ A;  1WTV A;  4RG1 A;  3HOY H;  5FKA C;  2EXZ A;  4ZRZ A;  2JA7 H;  3FKI B;  5CV8 A;  3IAY A;  1PRT D;  3KBG A;  4LUZ A;  3R93 A;  1S5D D;  2F0T A;  4B3T L;  4M1U B;  2N88 A;  2QA4 A;  4RGN A;  2B2U A;  1XMO L;  2HCI A;  4A76 A;  5FLM H;  1KD1 C;  3QO2 A;  1DOK A;  4ZCK A;  2JA5 B;  1MIU A;  3I73 A;  5DEH A;  1D8L A;  4P73 A;  2DJF C;  1Y69 U;  5A2Q E;  1QUQ A;  4B9X A;  1AP0 A;  4IUT A;  1V1Q A;  1ENA A;  1LTG D;  3TS0 A;  2AQ3 B;  3DEP A;  3L2P A;  2PQA A;  2UXD L;  3PO3 B;  3I4M G;  2NVX H;  4IN3 A;  1O7L A;  2CH4 W;  1VQP A;  1DYQ A;  1E22 A;  2F1M A;  4FP5 D;  4IUR A;  3Q23 A;  4A3I G;  4AQY L;  2MP1 A;  2EJF C;  4NXN L;  1SSO A;  2XGT A;  1XYI A;  1STY A;  1K8M A;  5C4Z A;  1L0Y B;  1HJP A;  3NXW A;  2VQF L;  3RLO A;  1EUJ A;  1S5C D;  4JI2 L;  3PO2 G;  2OTL A;  2G9D A;  2CCZ A;  3PUW A;  5JEA J;  1EY9 A;  4A3F G;  1L2F A;  4DV0 Q;  1G6Z A;  1A15 A;  3S1N B;  3VR6 A;  3RLF A;  5FOB B;  2LSS A;  3QJY A;  1VQD A;  3OSO A;  1DD2 A;  1XTC D;  1KDB A;  5J3B A;  2PPB C;  5J22 A;  1RD9 D;  5EBD A;  3HOU G;  1PZK D;  1FGB D;  2B2Y C;  3AYH B;  3FPP A;  1ILQ A;  2KEC A;  3JAM c;  5CMD A;  3GTJ H;  4DAY B;  2QEX A;  5IWA Q;  2R7Z B;  3W2D A;  2A1A A;  4HAE A;  5CV7 A;  1EFW A;  1NE3 A;  4C3J G;  2NVQ H;  2MUY A;  4CJ1 B;  4BA2 I;  5BN5 A;  1YBY A;  2L12 A;  3BDL A;  1N33 L;  1U4R A;  1IL8 A;  2KEN A;  3I4L A;  4A3D G;  3WOE A;  4RGT A;  4K5V A;  4KD4 A;  1R9T H;  1X65 A;  4G7O C;  1PYB A;  3CCL A;  2OXP A;  1S5F D;  2E74 C;  1D5Z C;  1CA6 A;  1C9O A;  1SXT A;  1YEZ A;  1SMY C;  1SNO A;  2Z6K C;  4L8J A;  2RQX A;  3VR3 A;  2R92 B;  5K36 G;  3J81 i;  4EQN A;  1HR0 Q;  1Z6H A;  1P16 A;  1I50 B;  4HSV A;  2ICE C;  3K6O A;  1UWV A;  4DAM A;  2PO4 A;  3TRE A;  3TP6 A;  1AFP A;  3K7A B;  1XNR L;  1SMX A;  1BOS A;  4DR7 Q;  5EKK A;  2R93 B;  3MZ5 A;  4LK1 C;  2F0O A;  1SLJ A;  5IE8 A;  4U67 3;  2B2W C;  3K7U C;  5M9O A;  2C35 B;  2YU9 B;  3Q22 A;  1A2U A;  2RDH A;  3D3R A;  4ID6 A;  3A54 A;  3AFQ A;  4HID A;  3CCE A;  3JC6 6;  3E6Z X;  5CV9 A;  1IBK Q;  5FO8 B;  3I4M H;  3OIP A;  3QR8 A;  3ERO A;  3ZJY C;  1G2T A;  4A3I H;  4ZKB B;  1I5F A;  4NKL A;  3BJU A;  1FYC A;  3GTL H;  4Z9C B;  3KLR A;  4H7B A;  1EY0 A;  4TSS A;  5EPJ A;  3PO2 H;  5DM6 3;  4IFD J;  4ZUI A;  4A3F H;  4JW0 A;  1SNP A;  4ODG A;  1VF7 A;  3KDF A;  2J0T D;  4A3G H;  2G5D A;  2K75 A;  5C4X B;  1EWI A;  4IUQ A;  1PTO H;  3HOU H;  1C0A A;  1QJO A;  3CQZ B;  1JWM D;  3Q0A A;  3P75 A;  4K14 A;  3D31 A;  2UUA L;  2UUC Q;  4NXM Q;  5BR8 L;  1B70 B;  3TP5 A;  2K5V A;  2WAQ B;  3M4P A;  2JEA I;  2EYL A;  1K9M C;  1Q3L A;  1TWC H;  3AEV A;  4FF1 A;  4A3B G;  3S15 H;  2J7Z A;  5C4J B;  4A3D H;  1D6E C;  1TY0 A;  1E0B A;  2IY5 B;  2LKV A;  2JE6 I;  1N34 L;  2ES2 A;  2ZM6 Q;  4DUZ Q;  1KNA A;  2KOL A;  4LF8 L;  3STB C;  4CHT B;  5M5X H;  4YWM A;  3BG3 A;  4FF4 A;  3PSI A;  2RHQ B;  4BBR B;  5ELB A;  4DXG A;  4LF9 Q;  4EGV A;  3KJO A;  2K5W A;  2GA4 B;  4LFA Q;  1G2S A;  5ELF A;  2QGQ A;  1WCM G;  1GUG A;  4DU9 A;  1JT8 A;  1KXL A;  1FJG Q;  2CWA A;  4BY7 G;  5HGQ A;  4K0K Q;  1QZH A;  3W3A A;  4A3J B;  1AN8 A;  4EQO A;  4ZQ3 A;  3G6E A;  1YIT A;  5GRO A;  5D3I B;  1ZYR D;  4PMB A;  5IOD A;  4RWS C;  1TWH H;  4XT3 B;  1SYE A;  1KLG D;  3KF6 A;  5E4W C;  4DNI A;  5IYB G;  1EQT A;  3D6W A;  3VYU A;  4DR3 Q;  1TS5 A;  1CKN A;  3BZC A;  4JOI C;  3GTM B;  3DMU A;  2PNR C;  4KV6 A;  3GO5 A;  1YZ6 A;  4LFB L;  1I4G A;  1B7Y B;  4OEM B;  4EQP A;  4FXG C;  3GTK H;  4JBW A;  4JI8 Q;  3I90 A;  4C56 C;  2AQ2 B;  4JI5 Q;  4L6T B;  1VQL A;  2WFW A;  1ASY A;  1FD7 D;  3W1G A;  1BBU A;  4Y7N H;  1U0L A;  2DNC A;  2WP8 J;  2E76 C;  2CVR A;  1DZ1 A;  3L9A X;  1Q8I A;  1TS2 A;  5I2X A;  2HHH L;  1PRT F;  1EY4 A;  1SFO H;  4A93 G;  1HTP A;  1J6Q A;  4H02 A;  1LTR D;  3J80 L;  3S14 B;  3HEJ A;  3RUZ A;  1S5E D;  4IUP A;  4EQ5 A;  2ZJP A;  3AB9 A;  1DXM A;  4JI7 L;  1PHJ A;  1DON A;  3MEH A;  1A3T A;  4F88 A;  1B2T A;  1C7Y A;  3SK5 A;  3ZYY X;  1MHW C;  2K5Q A;  2IPK D;  1EU3 A;  1MD2 D;  2IHF A;  4PMW A;  1YVC A;  1W2B A;  2NWG A;  3G7L A;  2B29 A;  2F0D A;  2KHI A;  4UHV A;  1U9R A;  2GVA A;  2ATW A;  1J9O A;  1QVF A;  3GTO H;  2DJG C;  3D4D A;  2EDG A;  3DWP A;  4I7Z C;  2JA6 B;  2FIN B;  1F9P A;  4OXP A;  4IPG A;  1BR9 A;  3FDT A;  5I9O A;  1RKN A;  1K3B C;  1WCM H;  3KUP A;  3BDO A;  1XMQ Q;  4QQB X;  2XRQ D;  4BY7 H;  2HCC A;  2F0V A;  2H1E A;  4OIJ A;  5C0X J;  3T1Y L;  5JJK A;  4PZ6 A;  3I4N G;  2NB0 A;  1D2B A;  1SJH D;  4JV5 Q;  2C9O A;  3C3L A;  3UE1 A;  3K58 A;  3P20 A;  3GD7 A;  5IGB A;  2IW3 A;  4N9P A;  3RD4 A;  4R8I A;  4IPD A;  4A3M B;  3ULJ A;  2NYZ D;  2KHS A;  4U68 A;  1VQJ A;  3OTO Q;  4DV2 Q;  2VZA A;  1EYG A;  4LAA A;  2JYO A;  1XWE A;  4MIU A;  2NVT H;  2O2L D;  2I07 B;  1NR4 A;  5JJL A;  1CI3 M;  4XQQ A;  3MEF A;  3DUZ A;  4DR1 Q;  3CPW A;  3NEN A;  1HZ9 A;  4HED A;  2BH2 A;  1EEF D;  2L5T A;  1KC8 C;  4KY7 A;  3W5O A;  1TS3 A;  1N32 Q;  4YWL A;  4DAY A;  4X64 Q;  1CZW A;  1Q1B A;  4NMZ A;  5M3F B;  2PMZ E;  2PI2 A;  3CCJ A;  4OIK A;  1L1O A;  3STB D;  4DR2 Q;  4A93 H;  1N8R C;  1IZ6 A;  5IYC H;  5C44 B;  4DV6 L;  4X66 L;  1A3V A;  1Y1W H;  5I9P A;  2E5L Q;  3HOV B;  3UE0 A;  1L0X B;  4C3I B;  4K5W A;  1VMC A;  2V4D A;  1EIG A;  5KYL A;  1O7Z A;  1X3P A;  5FLX c;  5LMN L;  4PG3 A;  3GTP H;  2PZW A;  3MXG A;  3TEH B;  3AMU A;  4POG A;  1U5K A;  3ULL A;  1RF2 D;  3O13 A;  1D5X C;  2QCP X;  3PUY A;  3F2B A;  5E1F A;  4OWX B;  4L5R C;  1PFS A;  2E2J B;  2F0J A;  1F9Q A;  1ASZ A;  4NP5 A;  1EOV A;  4DV3 L;  1HA6 A;  2I5L X;  3S2H B;  3D4R A;  2VUM G;  4H13 C;  1VQM A;  2KCN A;  4YCV A;  2UXB L;  1MSG A;  5GAH C;  1X3Q A;  4LWC A;  3HKZ G;  1O7Y A;  3LWU A;  1D5M C;  2RVL A;  3D0F A;  3I4N H;  1X3G A;  3H09 A;  4KI0 A;  3H15 A;  4DUY Q;  2B39 A;  5L37 A;  3HP3 A;  2YTY A;  4RKL A;  2GN5 A;  3H6M A;  4MNO A;  1NNX A;  3F1Z A;  3CAM A;  5CBA E;  1PH7 A;  4IFD H;  3M4Y A;  1QCB D;  3HOW B;  2EYO A;  1AZQ A;  1I4R A;  4S3S A;  1XX8 A;  3K0Y A;  5FLX L;  4XT1 B;  1BVS A;  2NTT A;  5AJ3 Q;  3S2D H;  1H9S B;  3FEW X;  4LJZ C;  2D5D A;  5LMN W;  1NCV A;  4KHP Q;  1VQA A;  3NTI A;  2B2Y A;  3RZD B;  5C5L A;  1E2Z A;  3S1Q H;  5NUC A;  3VYS A;  3PUX A;  2Y0S G;  2PCF B;  2UXC Q;  2MJ8 A;  4E6I A;  2E75 C;  1HA5 A;  4LFC Q;  3M85 A;  4JI3 Q;  2EOT A;  3CCU A;  1PH3 A;  3WWV A;  1EEI D;  1ML0 D;  4F87 A;  3KF8 B;  1IHZ A;  1PH4 A;  1KNE A;  4A3L G;  2K04 A;  2IL8 A;  4UY8 C;  4YHH Q;  2ENB A;  3K0X A;  5C3X A;  2BOS A;  2Z6K A;  2MGS A;  3IKJ A;  2Z9H A;  1X3E A;  3R8B A;  2K5N A;  5IIF A;  5C0X G;  3HOZ G;  2EY5 A;  3J7A V;  1CHP D;  4DNT B;  2JQO A;  1SE3 A;  4FXD A;  3DWA A;  3CPF A;  4DAP A;  3SGI A;  1R4Q B;  3CC4 A;  2JA8 G;  5FLM G;  1BKB A;  1PA6 A;  3OHX C;  3H91 A;  2B2W A;  2K5H A;  1I6H B;  1GO3 E;  1TWF B;  1PH6 A;  2VUM H;  1H9R A;  4GLX A;  4L5T A;  1STG A;  5FO9 B;  2RSN A;  5BN3 A;  1A63 A;  1J5E L;  3OMG A;  4CKE A;  5I6W A;  4OO1 I;  1HFN A;  1EWC A;  1ICF B;  4JI0 Q;  4IFD I;  1OXX K;  1RL2 A;  4GN3 B;  3GQB A;  1IBM Q;  2E2I B;  5F2D A;  1OXT A;  3H0G B;  4DGZ A;  3WDN A;  4AYB G;  4A3K H;  2F4V Q;  4R4Q A;  4BBS B;  1BCP F;  1SYC A;  2BA0 A;  1HHV A;  2Z1C A;  5J1Z A;  4X3K A;  3M4O H;  1QIL A;  3VR2 A;  2E2H H;  3QG1 A;  2SNM A;  3HS0 C;  4JPB W;  2KCT A;  2Z0S A;  3U50 C;  4PV1 C;  4C2M B;  4LF9 L;  1GHK A;  1SNC A;  4KKU A;  1PZJ D;  1XTD A;  4LFA L;  1AE3 A;  4QCL A;  2JA5 G;  2N55 A;  1TS4 A;  1FJG L;  1V43 A;  2EYJ A;  3BDC A;  1B3A A;  1PH5 A;  4P75 A;  1K73 C;  1O80 A;  1HNW L;  1PLF A;  2Z4H A;  2QF7 A;  1KQS A;  3C2P A;  1ZXT A;  4IO9 A;  2TSS A;  1U4L A;  3U9O A;  1SND A;  1QVC A;  4LF4 Q;  4HMJ A;  3PO3 G;  1WVL A;  3D8G A;  1H9J A;  1I4P A;  2H5X A;  1Q81 C;  3CHB D;  3FHW A;  4JVZ A;  4LF5 Q;  3KOJ A;  4A3L H;  4X62 L;  3PIO 3;  1IKM A;  4CJ2 C;  3ITP A;  4O1N A;  4ZYS A;  3GDE A;  4K2L A;  4TVA B;  3SHL A;  2A73 B;  3TSS A;  4APV A;  4YY3 L;  4GNX C;  2DGY A;  5CR3 A;  4JI5 L;  5C0X H;  1SNM A;  3HOZ H;  1KRT A;  2Z4I A;  2J4X A;  4CDC C;  3WOF A;  3X3M A;  4HIO A;  1Y1V B;  2HQL A;  2JA9 A;  2JA8 H;  1F9S A;  3RR5 A;  1KIX A; 
#chains in the Genus database with same CATH homology
 3T1H L;  3KDF A;  1V9P A;  2A8V A;  1WJJ A;  4B3S Q;  4LF8 Q;  4DV1 Q;  4QY7 A;  4A3G H;  1WYD A;  2K75 A;  2NZO A;  2R7Z G;  3I7F A;  4LF5 L;  1EWI A;  1S3O A;  2OTJ A;  1K3R A;  1B8A A;  1SE8 A;  4UP9 A;  4A4I A;  2N8N A;  3M9B A;  4IJL A;  2KCM A;  3CCS A;  4EX5 A;  3HOU H;  4BBS G;  1C0A A;  4Y52 H;  4IPH A;  5IP9 G;  1IBK L;  1I3Q H;  3U58 A;  4PZ7 A;  4IJH A;  1HNZ Q;  4GKJ Q;  3D31 A;  1EQQ A;  1K83 H;  3PIP A;  2UUA L;  2UUC Q;  4NXM Q;  4AH6 A;  5BR8 L;  1B70 B;  1KHI A;  1G51 A;  2K5V A;  4J15 A;  2CFM A;  3M4P A;  4DR5 Q;  1A0I A;  4RMF A;  2JEA I;  1K9M C;  1TWA H;  3FKI H;  2IT1 A;  1TWC H;  3AEV A;  4X6A H;  1JB7 A;  4A3B G;  4JCV E;  3S15 H;  5EAY A;  3RZD H;  1JMC A;  1VS0 A;  3CD6 A;  4A3D H;  5IYB H;  4DKA C;  2K52 A;  2PQA B;  3RNU A;  1WFQ A;  2JE6 I;  4JI6 Q;  2IY5 B;  1N34 L;  1L0W A;  2ES2 A;  2R92 G;  2ZM6 Q;  1EIY B;  4DUZ Q;  2MO1 A;  2D62 A;  4B3S L;  1DGS A;  4LF8 L;  4DV1 L;  1PV4 A;  3STB C;  5M5X H;  2IX1 A;  3HOX G;  4YWM A;  2K14 A;  2OCE A;  3DM3 A;  3PSI A;  2RHQ B;  4P71 A;  4LF9 Q;  2JA5 H;  4A3G G;  4ME3 A;  1XMQ L;  3UDX A;  1EQR A;  4LFB Q;  3KJO A;  4GLA C;  4LFA Q;  4DV5 Q;  2OQ0 A;  1O7I A;  1WCM G;  2QGQ A;  4P74 A;  3CME A;  2AWO A;  5GAD C;  1FJG Q;  3S1M H;  4A3C H;  1JT8 A;  1KXL A;  4AIM A;  2CWA A;  3IRB A;  5HGQ A;  4BY7 G;  1HNZ L;  2B63 G;  4K0K Q;  4JV5 L;  1HZC A;  3PF4 A;  4A3M H;  4IPC A;  1A62 A;  1QZH A;  2UUC L;  4NXM L;  4WJ3 M;  3U4V A;  3G6E A;  1YIT A;  4DR5 L;  5GRO A;  1K0R A;  3BU2 A;  3MXN B;  4ALP A;  1TWH H;  3KLW A;  2N49 A;  4LW1 A;  5GAG C;  2K50 A;  2UU9 Q;  1NJI C;  4OWW B;  3PO3 H;  3FKI G;  1AE2 A;  3KF6 A;  4B3M Q;  1IBL Q;  4DNI A;  2AWN A;  4GNX B;  2ZM6 L;  4DUZ L;  5IYB G;  2OQK A;  3OTO L;  1P8L A;  4DV2 L;  2N3S A;  4DR3 Q;  2HHH Q;  2RCN A;  3BZC A;  1CKN A;  4DK3 C;  4JYA Q;  4JOI C;  3RN2 A;  4IOA A;  1Q46 A;  3CW2 C;  1Y1V G;  2A19 A;  3GO5 A;  5C0X I;  1YZ6 A;  3PCO B;  2CWP A;  4LFB L;  1B7Y B;  3CCV A;  1WOC A;  3A5U A;  4JI7 Q;  3EN2 A;  3S1N H;  1RIP A;  3GTK H;  1PYS B;  4DV7 Q;  1I6H H;  2RHS B;  4JBW A;  3J7Z C;  1TWF H;  2JK8 A;  4JG2 A;  4JI8 Q;  4DPG A;  5C3E G;  1JJ2 A;  4K0K L;  5M5Y H;  3I4O A;  1VCI A;  1CKN B;  4JI5 Q;  4MZ9 A;  3B6Y A;  1VQL A;  3LGJ A;  2WFW A;  5JJI A;  2MO0 A;  3J7A 5;  1ASY A;  4BXX H;  1VQ6 A;  3W1G A;  1YIJ A;  3E9I A;  3CC2 A;  1BBU A;  4Y7N H;  1U0L A;  2WP8 J;  3A74 A;  2OWO A;  4BY1 H;  4B3M L;  1VQE A;  4KHZ A;  1IBL L;  2D0O A;  3J81 j;  1CKM A;  3KYH C;  1X3F A;  4DR2 L;  2HT1 A;  2R7Z H;  3T1H Q;  3L0O A;  4KLK A;  1VQG A;  4DR3 L;  2HHH L;  4JYA L;  1SFO H;  4A93 G;  2E5L L;  2WAQ G;  3H0G H;  1J6Q A;  3HKS A;  4H02 A;  4BBS H;  1VQB A;  4OWT B;  1JJC B;  4EQ5 A;  5IP9 H;  2ZJP A;  4JI7 L;  4LNQ A;  1CUK A;  1PHJ A;  1NBW A;  3CP0 A;  1FVI A;  3M4Q A;  3PV0 A;  3T1Y Q;  4LUO A;  3HKZ E;  4JI8 L;  4B3R Q;  1C7Y A;  2NN6 G;  4C2M H;  2Q2U A;  1LTL A;  2AMC B;  4OON A;  1SN8 A;  1NTG A;  4GN4 B;  2IHF A;  2R6G A;  4PMW A;  1I94 Q;  4DK6 C;  5BR8 Q;  1YVC A;  1W2B A;  4BBR G;  2I5M X;  1HH2 P;  1S72 A;  3RN5 A;  2B29 A;  2KHI A;  2VW9 A;  1E1O A;  1IXR A;  2GVA A;  4JI4 L;  2ATW A;  2R92 H;  2R7D A;  1GVP A;  1L1O C;  1QVF A;  3GTO H;  1UE1 A;  1I50 H;  3TQY A;  1X54 A;  1TWG H;  3HOX H;  1N34 Q;  3RZO H;  4HJA A;  4A3J G;  3A5Z B;  4JBJ A;  1VQ9 A;  1K8A C;  2F3I A;  3K7A H;  4JOI A;  4IPG A;  4OXP A;  1OTC A;  2R93 H;  1GKH A;  3HOW H;  1WCM H;  3H0G G;  4R4T A;  1XMQ Q;  4QQB X;  1SRU A;  4BY7 H;  4DV4 Q;  2B63 H;  1N9W A;  4DUY L;  5IP7 G;  5C0X J;  3T1Y L;  1MJE A;  5JJK A;  3BZK A;  4LF6 L;  4B3R L;  4PZ6 A;  3I4N G;  3KDF B;  4JV5 Q;  3UE1 A;  4BA1 I;  2Y0S E;  2ALY B;  1G29 1;  2I5H A;  1Z47 A;  1I94 L;  4A75 A;  3UDF A;  1Q82 C;  4DR6 L;  1AH9 A;  2XTI A;  3GD7 A;  1CSP A;  4UPA A;  4HJ8 A;  2EQS A;  3TS2 A;  1FL0 A;  2VQE Q;  4R4O A;  1E24 A;  2PNH A;  2IX0 A;  3F8T A;  4IPD A;  3H3V H;  3ULJ A;  1X6O A;  2VS1 A;  4DR4 Q;  2VY3 A;  1N36 L;  1MKH A;  1W3S A;  4QIW E;  4PZ8 A;  1VQJ A;  3CC7 A;  3OTO Q;  4DV2 Q;  3HOY G;  1JE5 A;  1Y1V H;  2VZA A;  1BBW A;  4DV6 Q;  4X66 Q;  1EYG A;  3TRZ A;  2Q2T A;  2EXD A;  5IY0 A;  3I56 A;  3G48 A;  3ULP A;  2JA7 G;  4OX9 Q;  2NVT H;  4WJ4 A;  5ELO A;  1HR0 W;  4DV4 L;  1WI5 A;  1NMG A;  5LMN Q;  2R93 G;  5JJL A;  5C3E H;  3MEF A;  3I55 A;  3G71 A;  4LUV A;  1H95 A;  2JEB I;  4DR1 Q;  3CPW A;  3NEN A;  5H1S E;  1HZ9 A;  2BH2 A;  1KC8 C;  1VQ5 A;  4GOP C;  1A8V A;  1EIF A;  2MQH A;  2BA1 A;  3S1R H;  3L7Z C;  3W5O A;  1VQ7 A;  3CQZ H;  5HY6 A;  1N32 Q;  4YWL A;  2LXK A;  3EIV A;  4X64 Q;  2VQE L;  1Q1B A;  4HJ7 A;  2PMZ E;  2PI2 A;  3ERS X;  4R4I A;  3PGZ A;  3CCJ A;  1L1O A;  2VNU D;  1YHQ A;  4DR4 L;  2Q2H A;  3STB D;  5JEA G;  2L15 A;  1UE7 A;  4DV3 Q;  1G6P A;  4DR2 Q;  4A93 H;  1Q12 A;  1N8R C;  1IZ6 A;  5IYC H;  3PUV A;  2EIF A;  3EBE A;  4YCU A;  3W1B A;  4DV6 L;  4X66 L;  1Y1W H;  3PO2 G;  2LXJ A;  2YTV A;  3AFP A;  1QVG A;  3UE0 A;  1Q1E A;  4POF A;  2E5L Q;  2UXB Q;  3G4S A;  1IYJ B;  4OX9 L;  1QZG A;  4UP7 A;  5DLQ E;  5FLX c;  5E7N A;  1KRS A;  5LMN L;  3PUZ A;  4PG3 A;  1L1O B;  3JAM i;  3KF6 B;  5LMU L;  1XNQ Q;  3GTP H;  1MJC A;  1VQN A;  3TEH B;  3J81 c;  4DR1 L;  1HNX L;  1E3P A;  2JA6 G;  2F52 A;  1GM5 A;  4POG A;  1U5K A;  4BBR H;  3J80 i;  3ULL A;  3PIO A;  4X65 Q;  5GAE C;  5C4X G;  2B3G A;  3NEL A;  4GLV B;  5ELN A;  3GTQ H;  1N32 L;  1CKO A;  1X9N A;  3GTG H;  1X55 A;  1YNX A;  2UUB L;  3ER0 A;  3PUY A;  3F2B A;  1UE6 A;  4OWX B;  4AYB E;  4L5R C;  1PFS A;  4YWK A;  2YTX A;  4X64 L;  4XTC S;  1JJG A;  3CCQ A;  4R1J A;  1LYL A;  3OW2 A;  2BH8 A;  1ASZ A;  4JI4 Q;  4A3J H;  2VL6 A;  1EOV A;  1VQH A;  2YV5 A;  4DV3 L;  1Z9F A;  2AKW B;  1E7Z A;  2I5L X;  2RF4 A;  2ZTC A;  4HIK A;  1YJW A;  1Q7Y C;  1D7Q A;  2VUM G;  1VQM A;  2E2I H;  2GVB A;  4YCV A;  3DLL A;  2CKZ B;  3F2D A;  2UXB L;  1KAW A;  4XIG S;  5GAH C;  5IYC G;  4LF7 L;  4LWC A;  5IYD H;  3HKZ G;  4JI1 Q;  5IP7 H;  1Y1W G;  2NVY H;  3PF5 A;  1IBM L;  3ICE A;  3D0F A;  3I4N H;  1XNQ L;  1X3G A;  4KI0 A;  3H15 A;  4DUY Q;  4B3T Q;  2FXQ A;  2YTY A;  2GN5 A;  4MNO A;  4JBK A;  1XMO Q;  3UDG A;  4LF6 Q;  3F1Z A;  3CAM A;  4X65 L;  1PH7 A;  4GOP A;  3H3V I;  3U4Z A;  2K4K A;  2WB1 E;  4DR6 Q;  1UEB A;  2AHO B;  4IOC A;  3K8A A;  1BVS A;  1XPO A;  1M90 C;  3M7N A;  2ZJR A;  4L5S A;  1OXU A;  5AJ3 Q;  3S2D H;  4RG1 A;  1Q86 C;  3HOY H;  2DUD A;  1N36 Q;  5LMN W;  4GOP B;  4KHP Q;  1PH1 A;  1VQA A;  2JA7 H;  2JJQ A;  1HZA A;  1PH2 A;  4JI1 L;  5M3F G;  3S1Q H;  4LUZ A;  1XPU A;  3PUX A;  1T9H A;  2Y0S G;  4HJ9 A;  4AQY Q;  4B3T L;  2MFI A;  5IYD G;  2UXC Q;  3NBH B;  2HIX A;  3Q8D A;  2QA4 A;  3S14 H;  2VQF Q;  1XMO L;  4A76 A;  5C44 G;  2YU9 H;  5FLM H;  1KD1 C;  1X56 A;  4OO1 G;  4LFC Q;  3HOV G;  4JI2 Q;  3M85 A;  4LF4 L;  4JI3 Q;  1VQ8 A;  1MIU A;  3S17 H;  3CCU A;  1D8L A;  2N78 A;  4P73 A;  4L5Q A;  1PH3 A;  4IFD G;  1LUZ A;  3A0J A;  3WWV A;  1VQC A;  4YCW A;  3HFZ B;  3KF8 B;  5AJ3 L;  1QUQ A;  2CQO A;  4HIM A;  1V1Q A;  1VQI A;  2ZTE A;  1PH4 A;  2PI2 E;  3TS0 A;  1UE5 A;  2MNA A;  1J5E Q;  1VQK A;  4A3L G;  4KHP L;  2NN6 I;  1XPR A;  4UY8 C;  4YHH Q;  3K0X A;  5M3M G;  3L2P A;  2PQA A;  3RLN A;  1VQ4 A;  2UXD L;  2Z6K A;  4C3H H;  1X3E A;  1YJN A;  3I4M G;  2NVX H;  1KL9 A;  3HOW G;  2K5N A;  5IT9 c;  1E22 A;  1VQP A;  3FP9 A;  4C3J H;  1QUQ B;  4A3I G;  4AQY L;  2JA6 H;  2UXC L;  4GKK L;  5LMU Q;  5C0X G;  3HOZ G;  4NXN L;  2XGT A;  1TXY A;  2JQO A;  5C4X H;  4P72 A;  2VQF L;  4A3E G;  3S24 A;  1HJP A;  1HNX Q;  3CPF A;  2ZJQ A;  3RLO A;  2Q2I A;  1NMF A;  4LFC L;  1EUJ A;  3SGI A;  1PH8 A;  2HIV A;  2OTL A;  1Q8K A;  4JI3 L;  2CCZ A;  3CC4 A;  3PUW A;  4JI2 L;  1N33 Q;  5JEA J;  4A3F G;  2I0Q A;  2JA8 G;  1L2F A;  5FLM G;  2IHE A;  1BKB A;  1PA6 A;  3UDI A;  2UUB Q;  4DV0 Q;  4NPS A;  1YJ9 A;  2K5H A;  1GO3 E;  3E0E A;  3RLF A;  2R7F A;  3OYY A;  3KJP A;  2LSS A;  3VDY A;  1PH6 A;  4GLX A;  1VQD A;  2VUM H;  4L5T A;  2ASB A;  5J3B A;  2D0P A;  1A63 A;  1J5E L;  4JC0 A;  3CXC A;  4YHH L;  4OO1 I;  3HOU G;  3AYH B;  5C4J H;  4GKJ L;  4GNX A;  1M1K C;  3KFU A;  3JAM c;  3NEM A;  4JI0 Q;  4LF7 Q;  3GTJ H;  4HJ5 A;  4IFD I;  1OXX K;  1RL2 A;  4DAY B;  4GN3 B;  2QEX A;  1HNW Q;  5IWA Q;  1IBM Q;  4O0A A;  2E8G A;  3J80 c;  1OXS C;  1OXT A;  2A1A A;  1EFW A;  1NE3 A;  2NVQ H;  1LM0 A;  3E9H A;  3CF5 A;  4BA2 I;  4A3K H;  4AYB G;  3CCM A;  1XNR Q;  2F4V Q;  4R4Q A;  1YBY A;  4JI6 L;  1N33 L;  2BA0 A;  2KEN A;  4GS3 A;  4A3D G;  3M4O H;  4QL5 A;  4DV0 L;  2E2H H;  3F2C A;  1R9T H;  1X65 A;  5M5W H;  1PYB A;  2KCT A;  3CCL A;  2Z0S A;  5FJ8 H;  3U50 C;  4LF9 L;  1SRO A;  4X62 Q;  1XTD A;  4LFA L;  1AE3 A;  1C9O A;  4DV5 L;  2JA5 G;  1YEZ A;  1PVO A;  1YHB A;  1FJG L;  4NB3 A;  1V43 A;  4GN5 A;  5M3F H;  2Z6K C;  1PH5 A;  3AQQ A;  4FDB A;  4P75 A;  4YY3 Q;  4JI0 L;  3M3Y H;  1K73 C;  5K36 G;  4A3C G;  3J81 i;  4O2D A;  5IWA L;  1HR0 Q;  1HNW L;  1P16 A;  4A3M G;  1KQS A;  5C44 H;  3CMA A;  1FGU A;  1UWV A;  2WB1 G;  4DAM A;  1K8G A;  3HOV H;  3GTM H;  3TRE A;  4IO9 A;  2UU9 L;  4C3I H;  1CSQ A;  2YYZ A;  1XNR L;  2F4V L;  1SMX A;  4DR7 Q;  2V1C C;  1OXV A;  1QVC A;  4LF4 Q;  3PO3 G;  4A3K G;  4GKK Q;  4TQU S;  1Y14 B;  1SLJ A;  5IE8 A;  1S40 A;  1IL2 A;  2NZH A;  2H5X A;  1NY4 A;  1E1T A;  1Q81 C;  3FHW A;  3K7U C;  2C35 B;  2KHJ A;  1VQO A;  4LF5 Q;  3KOJ A;  4A3L H;  4X62 L;  3K80 C;  3S16 H;  5M3M H;  1HZB A;  3AFQ A;  4HID A;  3CCE A;  2KBN A;  2WAQ E;  3JC6 6;  4R4C A;  5FJ8 G;  3K81 C;  3GDE A;  1SR3 A;  4UP8 A;  4DV7 L;  4TVA B;  1YI2 A;  1IBK Q;  2E2J H;  3I4M H;  1YHA A;  4QGU A;  4APV A;  4YY3 L;  3CCR A;  3I2Z A;  3ZJY C;  2DGY A;  2ZTD A;  4GNX C;  4A3I H;  2UXD Q;  5GQO A;  4JI5 L;  1I5F A;  3HOZ H;  1VQF A;  2UUA Q;  3BJU A;  1HR0 L;  3S2H H;  4QJF A;  1GD7 A;  3GTL H;  4A3E H;  4A3B H;  1KRT A;  4IFD J;  4NXN Q;  3PO2 H;  4HIO A;  2HQL A;  2JA9 A;  1PH9 A;  4A3F H;  4JBM A;  2JA8 H;  4BXX G;  4MTN A;  1XJV A;  4DR7 L;  3RR5 A;  2ID0 A;  1KIX A;  4BY1 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...