3S2DH

Rna polymerase ii initiation complex with a 5-nt rna containing a 5br-u
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 18
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s2dH00
5C0XI 2Y0SG 1EUJA 4BBRG 2MNAA 2HT1A 3PCOB 2D0PA 1VQMA 1GVPA 3ER0A 1G291 3FHWA 5GAHC 2BH2A 2K52A 2AWNA 1JJGA 3PV0A 4DV4L 3NBHB 4LF7Q 1YJ9A 5JJIA 4DV5L 4YWLA 4DPGA 1E1TA 1PH7A 1VQLA 1EIYB 2AMCB 1VQJA 4L5RC 1AE3A 3KF6B 2LXJA 3L7ZC 4L5SA 4LF9Q 3M85A 5LMNW 4DV0L 1EFWA 1A8VA 2QGQA 1N33Q 4K0KL 1WOCA 4R4QA 1YZ6A 1HZCA 1QVCA 5IE8A 5J3BA 2ZM6Q 5FLMG 4GNXB 2IY5B 1SMXA 3I55A 2VUMG 4GLVB 3FKIG 4PZ6A 4QY7A 4A3LG 4DR6L 1SROA 1H95A 1C9OA 1HNZL 5C4JH 1SE8A 1FVIA 2E5LQ 4YCUA 1CSPA 4AQYL 4A75A 4DR5Q 2ID0A 3H3VH 3T1YL 2CWPA 3STBC 2R7ZH 1TWAH 4DV6L 1Y1WH 5IT9c 3CCJA 4QQBX 4RMFA 4DV7Q 1NJIC 1XNQL 4DR2Q 1IBMQ 2N49A 3Q8DA 3I56A 4QL5A 2NVTH 5IYDG 4A3GH 1LM0A 2IHFA 3BZKA 1K9MC 4JI8L 2R93G 5K36G 5GADC 2NVYH 5IY0A 4XTCS 1QUQB 2K5HA 1FGUA 3KLWA 3J80i 5M3MG 1IYJB 4GS3A 2KBNA 4GOPA 4LNQA 2PI2E 2B29A 4IO9A 1AE2A 4YWKA 3AQQA 2JA8G 3I4NH 2UXBQ 1N8RC 2MFIA 3ERSX 1J5EL 5JEAJ 4LF8Q 1CKOA 4JOIA 4BXXH 3H0GG 3GD7A 3MEFA 1PH5A 4HIKA 1PVOA 4DUZL 1WYDA 3DM3A 4IOAA 4LUVA 4BY1G 4A3DG 1KRSA 4LFCL 1YBYA 3CCUA 3HOZH 1L1OA 4X66Q 1HZBA 1P8LA 1MJEA 2UUAQ 1YI2A 4OX9L 1IL2A 4A3KH 4JI0Q 4P71A 3M4PA 4DAMA 3CQZH 3KJPA 4HJ8A 1XMQQ 5JJKA 1VQAA 3GDEA 3PIOA 4C3JH 4A3BG 2K14A 4X65L 3S1MH 1KAWA 4YY3L 2AHOB 1A63A 1I94L 4JG2A 2JEAI 2K5NA 3S1NH 5C3EH 4JI3L 4DV4Q 3BJUA 4BBRH 3GTGH 4DV5Q 4B3SL 2EIFA 1VQDA 2NZHA 4H02A 3A5UA 1VQ9A 2R92G 3S2HH 1YJNA 3JAMc 1BBUA 4DV0Q 1E22A 4HIMA 3HOWG 1Q12A 1V9PA 2GVAA 4GOPB 4IPHA 1PV4A 4X62L 1LYLA 2Q2HA 3CCSA 4JI7Q 4K0KQ 3PUVA 5M3FG 3RZDH 2A8VA 2AWOA 4GN4B 4MNOA 3GTJH 3K8AA 5IWAL 5IYCG 3F8TA 1HZAA 3E0EA 1S72A 3J81j 3B6YA 4NXNL 3GTPH 2JA9A 1AH9A 1B70B 4PZ7A 4R1JA 1HZ9A 2OQ0A 4DR3L 4JI2L 1N32Q 2A19A 5FLMH 3PO2G 3CCMA 4IPCA 1U5KA 3DLLA 1NE3A 2VUMH 3PGZA 3L2PA 4AQYQ 1JMCA 3FKIH 4IPGA 4YWMA 5M5WH 2VY3A 3OTOL 4A3LH 2JA6G 4AYBE 2WAQE 2IT1A 3PF5A 4LF6L 3M4QA 1XNQQ 1G6PA 1L1OB 3A74A 2JA5G 3RN2A 4JI4Q 3HFZB 3CXCA 2VNUD 2I5LX 5JJLA 1XTDA 1HNWL 4JI8Q 2BA1A 4JI5L 5GROA 3RNUA 1IXRA 4IPDA 2UU9L 1LUZA 1NY4A 3ZJYC 5IYDH 1X9NA 1CKNA 2IHEA 2HIXA 3TRZA 1OXSC 1BKBA 2R93H 2MQHA 4P72A 1EQQA 1VQNA 4NXML 3CW2C 3CCRA 2MO1A 3E9HA 3S24A 1J5EQ 3OYYA 4BY7G 1I50H 1JJ2A 4GNXC 2UUBL 5M3MH 5BR8L 2YTYA 4QGUA 4DV2Q 2OWOA 1EIFA 4UP8A 4LUZA 2OTLA 4DUZQ 2UUCQ 4JI6Q 2JA8H 4OWTB 2YYZA 5AJ3L 3PO3G 4KHPL 3H0GH 1G51A 5HY6A 2F4VQ 2EQSA 5C3EG 4A3FG 3FP9A 1J6QA 1N36Q 4JV5L 2PI2A 1KL9A 3STBD 4OX9Q 4DUYQ 3PUWA 1VQPA 4BY1H 2RCNA 4KLKA 4OONA 4A3DH 3S17H 4X65Q 4YCVA 3EIVA 3W1GA 2RHSB 3T1HL 4A3MG 5FJ8G 1CUKA 4MTNA 4DV3L 1I94Q 1LTLA 5ELNA 2LXKA 4JBKA 5GQOA 1D8LA 4YHHQ 1QVGA 4JI3Q 4HJ7A 4DR7L 4UP7A 2PMZE 4A3BH 4WJ3M 4BBSG 1YHAA 3SGIA 4AH6A 4DR1L 4JYAL 2CWAA 4LF5Q 2CCZA 3UE1A 4DK6C 1X55A 3LGJA 2VQEL 1XNRL 2VQFL 1YIJA 4A3EG 1IBLQ 4DV1L 4A3JG 2V1CC 1CKNB 1E1OA 4X62Q 4HJ5A 1HNXL 1MKHA 1FJGQ 2QEXA 3U58A 3HOYG 1NBWA 4DR4Q 4EX5A 1GM5A 4HJ9A 3CC7A 4NXNQ 5C0XJ 3HOWH 2Q2TA 2Z6KC 3KYHC 4TVAB 4GKKL 4DR3Q 2NVQH 1P16A 2OTJA 5M3FH 4JI2Q 3S1RH 1NTGA 2R7DA 2BH8A 2CKZB 4C3IH 2K5VA 4OWXB 5IYCH 3J7ZC 1R9TH 3HOUG 2QA4A 1OXVA 4APVA 3OTOQ 3K0XA 2N3SA 2ZTEA 4A3IH 1RIPA 2WB1G 3CD6A 3I4MG 4B3TL 1WFQA 2YTXA 2GN5A 3PO2H 1KHIA 1UE7A 3UDIA 1GO3E 4AIMA 4LF4L 2UXDL 4DKAC 2JA6H 4JI5Q 1TWHH 4A4IA 1N34Q 3J81i 4JBJA 3CC4A 4JC0A 2JA5H 4PMWA 3CMAA 1VQIA 1C7YA 1XPOA 5GAEC 2Y0SE 2ZJPA 1KIXA 2ZJQA 1JE5A 3PSIA 4GKJL 4LFAL 1X3EA 1VS0A 2D62A 3ULPA 4LF7L 4J15A 1UE5A 4LWCA 2CQOA 2Q2UA 5BR8Q 1V43A 2EXDA 1OXTA 1O7IA 1I5FA 3PUYA 4A93G 1ASYA 1HR0L 2WFWA 2DGYA 1Q1EA 2YTVA 4IJLA 4LF9L 1V1QA 4BY7H 5AJ3Q 4PG3A 4R4OA 2IX1A 1N33L 2R7FA 4GLXA 3EN2A 3NEMA 4KHPQ 3KF8B 3GTKH 1L2FA 3E9IA 5HGQA 1PA6A 4JI0L 4B3RL 5GAGC 2ASBA 3S14H 1YVCA 2I5HA 4P75A 5M5YH 5DLQE 4P74A 3PO3H 1Q86C 1VQ6A 1Y1VG 3RR5A 5IYBG 2UXCL 5H1SE 1B8AA 1EYGA 4A3FH 3CC2A 4DR6Q 3U4VA 1UEBA 3HOXG 3F2CA 1PH2A 1HNZQ 3KDFA 2ZTCA 1NMGA 3NELA 4DV3Q 1WI5A 3A0JA 3BU2A 3L0OA 1TWFH 1K8GA 4IFDG 3K7UC 4POFA 4Y7NH 5IP7G 4LW1A 5LMNL 2ES2A 1KQSA 2IX0A 2CFMA 3J80c 1TWGH 3U50C 5FJ8H 5FLXc 4DR2L 3T1YQ 4A3MH 1QZGA 4L5TA 4X64L 4DV6Q 2KCMA 1QVFA 1D7QA 3GO5A 4IFDI 2VQEQ 1A0IA 1GD7A 2VQFQ 3TEHB 1M90C 2B63G 3EBEA 1OXUA 4BBSH 1Z47A 3KF6A 4R4CA 1SRUA 1HNXQ 4HIOA 3CF5A 1S40A 3PUZA 4XIGS 2JK8A 1PHJA 2AKWB 1Q7YC 1VQFA 3KOJA 4A3EH 1I6HH 4GKKQ 5C4XG 4HJAA 1L0WA 4A3JH 2UXBL 1VQGA 2ZJRA 2HIVA 3HOYH 2K50A 3CCVA 1SN8A 1KC8C 1KD1C 1OXXK 1VQBA 3K7AH 4BA1I 1W2BA 2E2IH 1Q81C 1X54A 2YV5A 4FDBA 5M5XH 1E7ZA 2I5MX 2KENA 4O0AA 4UPAA 2OQKA 2DUDA 2K75A 2KHIA 2XGTA 3BZCA 3PIPA 1YJWA 3HOUH 4NPSA 1PH9A 4LFCQ 4LF4Q 1Q46A 1WJJA 4A3CG 1ASZA 1PH4A 2UUAL 2JA7G 1E24A 2C35B 1T9HA 3GTQH 3ULLA 3I4MH 1XMQL 1EWIA 3KDFB 1IBML 1VQHA 2OCEA 1K3RA 4DK3C 1RL2A 3CPFA 1GKHA 2BA0A 1QUQA 4ALPA 2NVXH 1SLJA 1X65A 3CAMA 1VQEA 1WCMG 4GKJQ 1CKMA 4LFAQ 4YY3Q 1JB7A 3M7NA 4DAYB 3UE0A 1Y14B 1YNXA 4OXPA 3CCEA 3OW2A 2HHHL 4B3ML 1YHQA 3M3YH 1JT8A 2E2HH 1UE6A 3CMEA 3HKZG 1HR0Q 4B3SQ 3CCQA 3G71A 1PH3A 2Z0SA 1BBWA 4IFDJ 1KXLA 2JJQA 2KHJA 4UP9A 4JI7L 4LFBL 1I3QH 4WJ4A 4YCWA 4A93H 1XMOL 2Z6KA 4OWWB 2FXQA 1PYBA 4POGA 3TS2A 5IWAQ 3H15A 1U0LA 1NMFA 4HIDA 2L15A 2N78A 2UXCQ 2VS1A 1PFSA 2B3GA 3PUXA 3WWVA 3TQYA 5IP9G 3JAMi 1N32L 4KI0A 3F2BA 1OTCA 2RF4A 3AEVA 3RLOA 2JEBI 4AYBG 2WAQG 4GN3B 4JBMA 1VQKA 2K4KA 2A1AA 4X6AH 3UDGA 1Y1VH 5IYBH 3S16H 5LMNQ 1TXYA 3VDYA 3HOXH 3HOVG 1EQRA 4X64Q 4JI1L 5C44G 1DGSA 5LMUL 1Q82C 4JI4L 4LF6Q 3M4OH 3TS0A 2LSSA 4C3HH 1XPRA 2HQLA 3AYHB 5IP7H 1YITA 1IBKL 3GTLH 2VW9A 1HNWQ 3CP0A 1VQCA 1VQ8A 4EQ5A 4KHZA 2UU9Q 2PQAA 2B63H 3I2ZA 1SFOH 3M9BA 4R4IA 1PH1A 1HH2P 1E3PA 3ULJA 2PNHA 2RHQB 2D0OA 2N8NA 3RZOH 1MJCA 4QIWE 4GOPC 4O2DA 4NXMQ 1VQ5A 4P73A 2NZOA 4R4TA 1IZ6A 3F2DA 4DV2L 3RLNA 1XJVA 3A5ZB 4A76A 2UUCL 2UUBQ 5C4XH 4JI6L 1BVSA 3CPWA 1MIUA 4GLAC 1X56A 4JOIC 3U4ZA 2VL6A 1QZHA 1VQ7A 1K83H 3W1BA 4JCVE 3W5OA 2F4VL 3S15H 3HKSA 4ME3A 4GN5A 3G4SA 1N36L 1X3FA 3MXNB 1M1KC 2NN6G 1Q1BA 3ICEA 2ZM6L 4DUYL 3RLFA 2JE6I 4JV5Q 1B7YB 1SR3A 2E8GA 2YU9H 1K8AC 1UWVA 4OO1G 3D31A 4QJFA 1L1OC 2R7ZG 2MO0A 2NN6I 1TWCH 1Y1WG 4A3CH 4DNIA 3T1HQ 2JA7H 2XTIA 2E5LL 3KFUA 1K73C 1VCIA 4YHHL 4NB3A 4A3GG 3GTMH 2VZAA 2E2JH 2HHHQ 4OO1I 4DR5L 2ZTDA 4B3MQ 3I4OA 4DR7Q 3H3VI 4LF5L 2ATWA 1Z9FA 2F3IA 2ALYB 2Q2IA 4IJHA 4DV7L 4DR1Q 4JYAQ 1WCMH 4PZ8A 3KJOA 3HKZE 1IBLL 1XPUA 4UY8C 3TREA 2R92H 1XNRQ 1VQOA 2PQAB 1FJGL 4LFBQ 4DV1Q 1W3SA 3I4NG 1XMOQ 4DR4L 4BA2I 4Y52H 3AFPA 3JC66 1KRTA 3F1ZA 1Q8KA 1PYSB 4BXXG 1YHBA 3NENA 3J7A5 3K81C 1YEZA 1N9WA 4A3IG 2I0QA 2R6GA 3GTOH 1EOVA 1PH6A 1K0RA 1FL0A 3S1QH 4GNXA 2F52A 4L5QA 4LUOA 1HJPA 4LF8L 4IOCA 1CSQA 1C0AA 1A62A 2KCTA 5ELOA 4JBWA 5EAYA 4B3RQ 3J81c 3S2DH 1VQ4A 3HOZG 5E7NA 3PF4A 2GVBA 1S3OA 3IRBA 3UDFA 5IP9H 3G6EA 3RN5A 1UE1A 3UDXA 5LMUQ 4JI1Q 4A3KG 4B3TQ 4TQUS 5C0XG 4C2MH 2WB1E 1JJCB 3K80C 4RG1A 1X6OA 1PH8A 1HR0W 3D0FA 1IBKQ 1N34L 2UXDQ 3CCLA 2JQOA 3AFQA 2WP8J 4X66L 5JEAG 3HOVH 2H5XA 4MZ9A 1X3GA 5C44H 3G48A 3I7FA
chains in the Genus database with same CATH superfamily
3Q24A 2AQ1B 1EUJA 2Y0SG 1X32A 1EZ8A 1V1PA 2D0PA 1GVPA 1FYCA 3H3VC 2AWNA 4LF7Q 1VF7A 1A2UA 2NVXB 4DV5L 4FXDA 4DF7A 1EIYB 4RFBA 3M85A 4ZLTF 2AQ2B 3M3YB 1EY0A 4K0KL 3KBGA 2Q8TA 1QVCA 1JE4A 5J3BA 2HDMA 1SMXA 3I55A 2VUMG 3TP7A 1SNCA 3FKIG 4PZ6A 4QY7A 1I3QB 2NN6H 1FVIA 4YIJA 2E5LQ 2OT2A 5CV5A 1W6KA 4A75A 1SE4A 4QQBX 4HTHA 1Z7TA 2RVLA 1XNQL 4ME5A 4DR2Q 1U4LA 2NVTH 1NR4A 1LM0A 4DU9A 1Y1VB 2IHFA 2L5TA 1L0YB 1B3AA 1UAPA 5IY0A 4XTCS 3M4OB 1B4OA 4GOPA 1F2MA 1Y8PB 4GS3A 2KBNA 5M3MG 5DEHA 2B29A 4MIUA 1JWUD 3LNNA 2MFIA 1J5EL 1YNJD 1CKOA 4JOIA 3MEFA 1PH5A 2WINB 4HIKA 1SFOB 3SEBA 2LKVA 3QG1A 4IOAA 4LUVA 4EGVA 1KRSA 4XT3B 4KK7A 5C4XB 1SYCA 5G3LD 2NZ1D 1RODA 3DUZA 4OX9L 3CQZH 1HFGA 5JJKA 4K5WA 4K6DA 4KKTA 2BE5C 5JEAH 2F0HA 2JEAI 3S1NH 1SYFA 2YU9B 3J80L 4C1NI 4BBRH 4WFN3 2C9OA 4KKSA 1TWCB 4H02A 2MGSA 3A5UA 3QO2A 1H9RA 4Y7NB 1PV4A 4DAVA 1LYLA 1KDCA 5M3FG 1TWGB 2F0JA 4GN4B 1U4PA 1LT3D 2B2UC 2B2VA 5E4XA 1HZAA 4NXNL 1U4MA 1AH9A 1B70B 4R1JA 1HZ9A 3HKZB 4BBSB 2A19A 2F03A 3BS1A 2G5DA 3DLLA 3GTOB 4IPGA 1RHPA 3OTOL 4RGMA 3A8JE 2EZVA 1L1OB 1F9SA 3A74A 5A35A 3DWPA 3CXCA 2VNUD 1XTDA 4HEDA 4ID6A 4G7OC 5M5XB 5JAVA 1F9PA 3A7LA 3SK5A 1QJOA 1S4ZA 3TRZA 1BKBA 2R93H 1AFPA 1VQNA 3HOVB 1VMCA 4NXML 2MO1A 4K2KA 3OYYA 1G2TA 5T1IA 2IWHA 1CA5A 5I2XA 2YYZA 3CU7A 4RKLA 4QB4A 1HRJA 5HY6A 4KJNA 4A3FG 3D4DA 3FP9A 1CA6A 3U9SA 2MPMA 1VQPA 4BY1H 2Z8LA 4KLKA 4H0LC 4X65Q 1BOSA 2XNAC 2WV6D 4CKEA 4A3MG 1HQRD 1I94Q 5IT9L 4YHHQ 1QVGA 4JI3Q 2PMZE 4WJ3M 3SGIA 3QB3A 4DR1L 1K0SA 2CWAA 2CCZA 3VYRA 1XNRL 1E2VA 1YIJA 4A3EG 1IBLQ 1QCBD 2R7ZB 4X62Q 3VA5A 1Y1WB 1NBWA 4F88A 3FDTA 3CC7A 3P7JA 2Z6KC 2F0NA 2OTJA 1RTOA 1HUMA 4B3RL 2BH8A 4C3IH 5JOBA 3HOUG 1WTQA 3TBIB 3QOLA 4JW0A 3CD6A 5DNFA 1G6ZA 1DONA 2GN5A 2B2WC 3UDIA 1B3QA 2D2CC 5D3DA 4DKAC 1TWHH 1PFBA 2EYOA 5GAEC 2Y0SE 1JE5A 1V1OA 2D62A 3ULPA 4A3KB 4J15A 1SYEA 3V2TA 2Q2UA 5CV9A 3ZYYX 5BR8Q 4Q5VA 1V43A 1OXTA 1ASYA 2WFWA 2K5WA 5C3EB 1IW7C 2WIIB 4BY7H 1GHKA 2Y0SB 4PG3A 4R4OA 1N33L 3GTGB 3NEMA 1EY7A 3KF8B 1HUNA 5GAGC 3D8GA 3HRZC 3S2HB 5CV4A 3K57A 5CORA 2BOSA 3RZDB 5KEEA 1UEBA 2QF7A 3NTHA 3GTJB 4IFDG 1TWFH 1W6JA 2HCCA 4XQNA 2IX0A 5FLXc 5FJ8H 1D7QA 1QZGA 1PFMA 2WKCA 1QVFA 2KCMA 2NYZD 4IFDI 2VQEQ 3E5SA 2VUMB 2VQFQ 3TEHB 3NWSA 3FKIB 4IZ8A 5FKAC 1R4PB 3WOEA 5EKLA 3HS0C 2F0WA 2KEDA 3FPUB 2JP1A 2K50A 1KC8C 1BCPC 4CGYB 4OIJA 4BA1I 3WOFA 1X54A 1E7ZA 4UPAA 2Q8IB 2OQKA 2DUDA 1PMRA 5ELCA 5M3MB 4LF4Q 3FEWX 1PH4A 2JA7G 1D5XC 1E24A 2C35B 3I4MH 3ULLA 1XMQL 1VQHA 1PTOD 1HXYD 3CPFA 5C5MA 3NUCA 1S5ED 1WCMG 4GKJQ 1JB7A 2E76C 2XWBB 1H95A 3VYSA 3CCEA 3CMEA 4KJOA 5KIXA 1QILA 1HR0Q 3Q6SA 1BBWA 1KXLA 2D9UA 4JI7L 4LFBL 2EY5A 4YCWA 1K3BC 4C1NK 4OWWB 3LX0A 1K8OA 4POGA 5IGBA 1JR0D 3H15A 1U0LA 2L15A 1ESRA 3TQYA 4HAEA 4JBMA 5IYBH 1F77A 3QIAA 5M3FB 3HOXH 3S1RB 2V4DA 5LMUL 1DGSA 4B9WA 1NR2A 3SDZA 2BE5D 4C3HH 1QE6A 1F9QA 5IP7H 1YITA 3OPOA 3C3LA 3P75A 2CHBD 3S9WA 4QUCA 2B63H 2P5ZX 3E6ZX 3IKJA 1O7YA 1ET9A 2D0OA 2N8NA 3RZOH 3GV6A 4QIWE 2FJ2A 4G4KA 1C8CA 2KHSA 4NXMQ 2KEEA 4IUPA 2XN9C 4A76A 1IKLA 2UUCL 1DOLA 1EWCA 3CPWA 1MIUA 4GLAC 3U4ZA 2VL6A 4K8IA 1QZHA 2NUCA 2F4VL 3S15H 4K14A 3OMCA 2NN6G 4R9WA 2DNCA 3RLFA 1B7YB 4L6TB 1ENFA 4QJFA 2K01A 3GTKB 4IUNA 2MO0A 2NN6I 4A3CH 4DNIA 2L4NA 2E5LL 3T4AC 1T5EA 2VZAA 2PQEA 1DJRD 4B3MQ 1Z6HA 4A3FB 4DR1Q 3NBHA 2JXMB 2EVBA 2RSNA 1HFNA 4P2CB 1WTPA 2R92H 1XNRQ 1VQOA 1W3SA 4O1NA 4A3MB 4Y52H 3JC66 3BDCA 1N9WA 4A3IG 2I0QA 1BCPF 1PH6A 1WTWA 1FL0A 5FLXE 4GNXA 3I4LA 4L5QA 1HJPA 4IOCA 5IIFA 1CSQA 5AFWA 1LO5D 2ICIA 2WACA 1KDBA 5EAYA 4A3EB 4B3RQ 3J81c 4X3TA 5KYIA 1PXUA 1EFID 5IP9H 1UE1A 3UDXA 4JI1Q 4EQNA 5HURA 2F3WA 3J7AV 3K7AB 4RG1A 2F0MA 3I3CA 5KNBA 1N34L 3MXUA 5IGDA 3AFQA 4OELB 5JEAG 3HZXA 5C44H 3G48A 3IFTA 4FF4A 2A6EC 3HOUB 4BBRG 1SYBA 1SBBB 3GTQB 3ER0A 1G291 1AZPA 3C46A 3S17B 1PRTB 2EJGC 4YWLA 4DPGA 1B53A 1VQLA 2HQEA 4PMCA 1AE3A 3KF6B 2LXJA 4L5SA 4LMQD 5KYLA 5LMNW 2DJFC 1EFWA 2QGQA 2KOLA 3HEJA 2EE1A 1N33Q 2E2HB 1WOCA 4R4QA 4FF1A 1E0BA 3VYUA 1H9SB 5IE8A 2ZM6Q 1S5BD 2EYPA 1WTRA 2A68C 1SROA 1MHWC 1C9OA 1JOKA 1SE8A 2IL8A 4YCUA 1LACA 4FVMA 1CSPA 4PMBA 5IOCA 3H3VH 1LTRD 1A15A 1VDZA 1TWAH 1GUOA 2GA4B 5IT9c 3CCJA 1NJIC 2N49A 3Q8DA 5CC4A 4A3GH 1K9MC 2R93G 1V1PB 5GADC 1BQQT 3DWAA 3CHBD 3J80i 3FPPA 4WORA 1IW7D 1AE2A 4YWKA 3I70A 3SXHA 2EOTA 3D6CA 2EPBA 3T51B 4BXXH 5LHY1 3GD7A 2F0QA 3DM3A 3PIO3 2EY6A 4BY1G 3I73A 1MGSA 3HOZH 1HZBA 1MJEA 2M00A 4QCLA 1K83B 4JI0Q 1XMQQ 3KJPA 4PV1C 1VQAA 3PIOA 2IPKD 4X65L 3S1MH 4YY3L 1A63A 1I94L 1EYAA 4JI3L 5C4ZA 4DV4Q 3BJUA 3G7LA 3TN2A 1IYVA 2CVRA 4B3SL 2DNEA 2EIFA 3OW7A 2JA7B 3OWEB 1VQ9A 1YJNA 4DV0Q 2E2JB 4HIMA 4GOPB 5IGEA 4X62L 4JI7Q 2EY1A 1WCMB 1A3TA 3K8AA 4RGTA 4C3IG 4ZKBB 5IWAL 1RDPD 3E0EA 3H09A 3J81j 2OQ0A 5IGGA 3J80E 5FLMH 4KN7C 1U5KA 1DOKA 5EBDA 4FYDA 3L2PA 1AZQA 1G6PA 4N8FA 2J4XA 3O13A 2IW3A 2IJ0A 4PNYA 3S2DB 4B08A 2NTTA 5JJLA 2XSCA 1D6EC 1SYGA 3D6WA 4JI8Q 1I6VC 5GROA 1GUSA 4IPDA 3ZJYC 5IYDH 1X9NA 1CKNA 3E3XA 2MQHA 1EQQA 1STEA 3CW2C 3LWUA 3E9HA 3S24A 2QCPX 1I50H 3J7AF 4BY7G 5BR8L 2YTYA 4QGUA 4UP8A 4H44C 4LUZA 2UUCQ 1EOTA 4OWTB 3VR4A 4GZYC 3KLRA 4XYQA 1D1KA 2F4VQ 5LL6S 2EQSA 1J6QA 4XT1B 4JV5L 1KL9A 3STBD 1M8AA 3PUWA 2RCNA 3OSOA 4OONA 2HDLA 1V8QA 2FHTA 5M9OA 5FJ8G 4HSVA 4A93B 4MTNA 3T16A 5ELNA 1DYQA 5GQOA 1D8LA 3FRPB 1SDFA 3VR5A 4AH6A 1BXTA 1JC7A 1PTOC 2VQEL 2VQFL 5ISRA 2V1CC 1BO0A 4HJ5A 3S16B 1MKHA 1RKNA 4ZAIA 2BDOA 1Y8OB 2QEXA 1F2YA 3EA6A 2NVTB 3TP8A 3MXNA 2DY8A 4QUFA 3NTKA 5C0XJ 3HOWH 2Q2TA 1TIID 4DR3Q 2NVQH 1P16A 5IT9E 2ZXPA 4JI2Q 4DFAA 4RKBA 1EY5A 3J7ZC 4B9XA 4APVA 3K0XA 2ZTEA 4A3IH 2WB1G 3I4MG 2B2YC 2NTSA 2YTXA 2DJGC 1J9OA 1QNUA 2B8FA 3OOCA 3C2PA 1B50A 4LF4L 1TR5A 2JA6H 2F0OA 2ZXRA 2F3VA 4JI5Q 4ZKCB 1N34Q 2JA5H 2SEBD 4PMWA 3CMAA 5I9OA 3SK8A 4BWGB 2ZJQA 4GKJL 1VS0A 3CQZB 2CQOA 1HR0L 1PLFA 1UNSA 2YTVA 4IJLA 3S1NB 1V1QA 4KY5A 1AEXA 2MJ8A 1ESFA 2B2UA 1FD7D 2IX1A 4KHPQ 2L9HA 1KLGD 2XIWA 1WTVA 4L63B 3PMFA 1Q3LA 1YNNC 1L2FA 2LFNA 3MZ5A 4EVOA 5HGQA 3DEOA 1EWHA 2ASBA 3S14H 2I5HA 3OIPA 3PO3H 3VR3A 3L9AX 5IYBG 2I07B 1EYGA 3CC2A 4HN7A 3HOXG 1PH2A 1JOQA 1STHA 3VR6A 3KDFA 3J81L 1WI5A 3A0JA 1X3QA 3A8KE 1A3VA 2EJMA 4C3HG 4Y7NH 2R61A 5IP7G 5KGUA 2QDBA 4RGOS 2A6ED 3EQLC 1TWGH 4XQQA 2B63G 1M90C 3K0YA 5CV7A 4BBSH 1U9RA 2L55A 4HIOA 3CF5A 3NPPA 4CHTB 3PUZA 1O7ZA 1PHJA 1Q7YC 1EY8A 1VQFA 1MI2A 1I6HH 4A3JH 4J8QA 4F87A 2O2LD 3HOYH 5DAUA 1SN8A 2A69C 3SK6A 2R93B 2YV5A 4FDBA 5M5XH 2KENA 4ODGA 2A68D 3D4WA 1QG7A 2XGTA 1YJWA 4NPSA 1PH9A 2JYOA 1C48A 4A3CG 3H6MA 1T9HA 1F9RA 1Y8NB 2EYMA 3HGBA 2OCEA 4FP5D 3K6OA 3H91A 3EFXD 1VQEA 4LFAQ 4YY3Q 4BY1B 1SNMA 2R92G 1PTOF 1YNXA 3UE0A 1TQOA 1O80A 1YHQA 4B3ML 4F7XA 4NP5A 5KNDA 1D2BA 1LTSD 4B3SQ 5FO8B 2G9HD 4IUUA 4K5XA 3K5LA 4IFDJ 3DEPA 2JJQA 1MSGA 1EQVA 4ZUIA 2Z6KA 2EYLA 2PMZB 4K8JA 5IWAQ 4CKBA 2PZTA 4ZCKA 1STNA 1QOHA 1TVXA 2B3GA 3WWVA 5IP9G 3F2BA 1OTCA 1ILPA 3AEVA 4F8MA 4E6IA 4AYBG 2WAQG 3BVMA 4GN3B 4KY6A 2B2WA 3HG9A 4X6AH 4RHRA 5LMNQ 1LTAD 3I90A 4X64Q 4JI1L 5C44G 2MUYA 4JI4L 1BBXC 3GV3A 2HQLA 2PCFB 3GTLH 4U673 3CP0A 4RCOA 2K28A 1LTID 1VQ8A 3HP3A 4KHZA 3C1FA 3I2ZA 4O42A 3M9BA 3T53B 4EQPA 1HH2P 1E3PA 3ULJA 2PNHA 1TWHB 4O2DA 2B2TC 1SMYC 1XJVA 1G8ZD 1H9KA 5I2YA 1ZYRC 1LTTD 1EU3A 1TY0A 1PDQA 1X3PA 4GN5A 1N36L 4K6LA 1GUTA 2F0DA 4CJ2C 5A2QE 4G7ZC 2JSOA 3E0JA 2ZM6L 4DUYL 4JV5Q 1SR3A 4G7HC 4BY7B 1K8AC 3X3NA 2K5QA 3MAQA 1L1OC 1XXGA 5I6WA 5IGFA 1PFNA 1K73C 3MFYA 4N9PA 3VA7A 1PRTD 3GTMH 4A3GG 5CR3A 3GTPB 3I4OA 3H3VI 4LF5L 2Z4HA 2ALYB 4IJHA 3T13A 5CMDA 1XPUA 4UY8C 1Q90A 3OWFA 1UUPA 3SHLA 4DR4L 1LTBD 1WTXA 1KRTA 1WVLA 1Q8KA 4BXXG 2RCFA 1ZKOA 3NENA 3K81C 3J7A5 2FFKB 1YEZA 2R6GA 1JOOA 1K0RA 3QWNA 1R4QB 2I46A 4CBVA 4KD4A 2A5HA 1C0AA 1JCKB 3K5OA 3HOZG 1ENAA 1WD0A 2GVBA 4FF3A 1I4PA 3IRBA 3UDFA 3RN5A 1KAAA 3NWTA 1JWMD 1TKWB 4C2MH 4IUQA 2WB1E 3FVQA 1PH8A 1X6OA 2M2LA 3D0FA 4HCSA 4FXGC 3R93A 2JQOA 2WP8J 2H5XA 4MZ9A 1X3GA 4JI0L 2F0PA 2HT1A 2F0KA 1VQMA 2WB1B 3I4MB 3FHWA 2RKSA 5GAHC 2BH2A 3PV0A 3U9OA 1JQYD 3NBHB 2F0TA 4IURA 4DXFA 2IX3A 4DV4L 5TSSA 4RGNA 1O78A 3NBIA 4L5RC 2OF1A 3R8BA 4BS9A 3L7ZC 4DV0L 5EKKA 3NXWA 1YZ6A 3L3OC 3MEHA 1DOMA 5FLMG 4GNXB 1ICFB 3MXPA 4GLVB 1EYDA 2G9DA 5C4HA 1CI3M 2SDFA 1LT5D 1RF2D 3A7AB 5C4JH 2PYKA 2A6HC 4TSSA 4RHSA 3DWQA 1LT6D 4DR5Q 2ID0A 5CBEE 3T1YL 3STBC 4DV6L 3I56A 1STBA 5IYDG 2E2DC 2Z6BA 2XWJB 4JI8L 3HOXB 3TP5A 2NVYH 1QUQB 2K5HA 2RDFA 3RMHA 3KLWA 4LNQA 2D5DA 5A2QL 1BNZA 4C3HB 2CW0D 1IYUA 4UHVA 3I4NH 3I8ZA 5JEAJ 1YNND 4OL7A 2B63B 2PZWA 1G2SA 3RZOB 3T56B 1WYDA 2F0SA 3IAYA 1SE3A 4RA8A 4QIWB 3BG3A 3H94A 1YI2A 1IL2A 3M4PA 4DAMA 5C0XH 4HJ8A 5T1GA 1MBYA 1XYIA 3GDEA 3S15B 2XRSD 4C3JH 2K14A 2SNMA 2O5JC 4DA2A 1VF5C 2AHOB 4JG2A 2K5NA 5J22A 4IUVA 4ZRZA 4LJZC 4MTKA 1VQDA 2NZHA 3IFDA 4KY7A 5FK9C 2SOBA 3JAMc 1BBUA 1E22A 2ENBA 3HOWG 1Q12A 2K03A 1V9PA 2GVAA 4IPHA 3PUVA 2A8VA 2A69D 3TZUA 2AWOA 4MNOA 3EJIA 1OO9B 1S72A 3B6YA 2JA9A 5EPKA 3W2DA 4C56C 4DR3L 5ELFA 4JI2L 5E4WC 5L37A 5COYA 1NNXA 1NE3A 3PGZA 4AQYQ 2QKIC 5M5WH 4A3LH 2JA6G 3MWYW 4AYBE 2WAQE 2IT1A 2Q8RE 1CHPD 3M4QA 1GUGA 2JA5G 4JI4Q 1C4QA 1B2TA 2BA1A 3K58A 2NB0A 1D1IA 3DXJC 3F2UA 4JI5L 1IXRA 1SJHD 2CH4W 1B1ZA 1LUZA 4AYBB 2WAQB 1XTCD 4IQZA 2HIXA 5K36H 4P72A 1LABA 1SYDA 4ABNA 2AUKA 5BN4A 3CCRA 5C44B 4KKUA 4ZK9B 4GNXC 1EIFA 1QB5D 4DUZQ 1FNVA 4I65A 2JA8H 3NE5B 3ND8A 1S5CD 3PO3G 4KHPL 2NWGA 3H0GH 1N36Q 4JPBW 1TS3A 2RDGA 3J7YW 5FOBB 4DUYQ 2EYHA 2L11A 1ZXTA 4A3DH 5J39A 3S17H 3R3OA 4WJWA 4YCVA 3EIVA 3W1GA 2RHSB 5I4DA 3T1HL 2K6AA 2RBMA 3K5NA 5JVH3 2LXKA 3IL8A 1SNDA 1HTPA 4HJ7A 4DR7L 5I9PA 1QWYA 1JWSD 4A3BH 4BBSG 1YHAA 1I4RA 4JYAL 4LF5Q 2E74C 3MXGA 3UE1A 4DK6C 1X55A 1HQMC 4A3JG 3MHBA 1CKNB 2HD3A 1FR3A 4CDEC 1SMYD 5EQ0A 2FMMA 3HOYG 1ZYRD 1HTLD 5E1FA 2E75C 4DR4Q 4A3GB 3MFGA 4HJ9A 3KYHC 4NDXA 5DM63 1DCZA 1NTGA 4H13C 1ET6A 2R7DA 1LTGD 5IYCH 2K5VA 4OWXB 1R9TH 3DM1A 3C1EA 1OXVA 2QA4A 4FXKC 3DHQA 1BR9A 1RIPA 4B3TL 1WFQA 5CV8A 3PO2H 1KHIA 4MN3A 4DK1A 1NAPA 1MD2D 1CM9A 4CDFC 5JPMC 1PTOH 1STYA 3MA2B 1A3UA 3J81i 1GHJA 1EEFD 1IKMA 1IL8A 3HOZB 1VQIA 1C7YA 1XPOA 2ZJPA 3PSIA 4LFAL 4H7BA 3X3MA 2EXDA 4L8JA 2O5IC 1O7IA 1I5FA 1H9JA 3PUYA 3S1MB 2DGYA 4LF9L 5AJ3Q 1HA5A 1I4HA 3SR1A 1PA6A 3MTSA 5DM73 1YVCA 1SSOA 4X3KA 5M5YH 4P74A 1Q86C 4KD3A 3RR5A 4KMUC 3F2CA 4JVZA 2ZTCA 1NMGA 4DV3Q 3L0OA 4N8X1 1KDAA 3TZDA 4RCNA 2Z4IA 4LW1A 5LMNL 3S1QB 1KQSA 2CFMA 3T1YQ 1IBML 4L5TA 4X64L 4DV6Q 4DAYA 1EZ6A 1A0IA 1EU4A 3EBEA 4CDDC 4KTAA 3KF6A 4R4CA 1SRUA 4CJ1B 1HNXQ 4U68A 4OEMB 1PRTC 5BN5A 2JK8A 2AKWB 4IALA 4HMIA 1H9SA 1LT4D 3J81E 2HCIA 3D4RA 4ZUJA 1L0WA 4GKKQ 2UXBL 1VQGA 3PIP3 2ZJRA 3A54A 4X3UA 1GXDC 1BDOA 1KD1C 4OHJA 1II3A 1VQBA 1PZJD 2E2IH 1Q81C 2I5MX 5KRUA 1I50B 3PIPA 2A6HD 2L0CA 4HR7B 4V190 1ASZA 2UUAL 2F0VA 1AW7A 3N6RA 1EWIA 1O7LA 3KDFB 2X69A 3ERQA 1TS5A 5K5PA 1K3RA 4DK3C 4DK0A 4ALPA 2NVXH 2HUGA 5EJWA 3M7GA 1CKMA 2TMPA 3M7NA 2RDHA 1GUWA 1Y14B 4OXPA 3OW2A 3M3YH 1UE6A 5FO9B 1GJXA 2EJFC 1BF4A 4HSPA 3G71A 1PH3A 1FGBD 1SJED 2OXPA 1I3QH 4WJ4A 4ULLA 4A93H 4K5VA 2FXQA 5KNCA 2KQ3A 3ITPA 2KCCA 4HCEA 3BYTB 4HIDA 2N78A 3GP7A 2UXCQ 2VS1A 1PFSA 3PUXA 1N32L 3RUZA 2RF4A 2B2YA 4XQJA 2K05A 2A1AA 3HOWB 3UDGA 1Y1VH 3S16H 3KUPA 1TXYA 2NVQB 2EYJA 1EYCA 2B39A 1EQRA 3M4OH 1NUCA 3TS0A 1XPRA 3AYHB 3EVQA 5C3XA 3KK7A 4A3IB 2VW9A 2KJXA 1VQCA 4EQ5A 2EXZA 2PQAA 2VB2X 1SFOH 4R4IA 1PH1A 5D65A 2JA6B 2RHQB 3I91A 1MJCA 2SNSA 4GOPC 1GUNA 2BDNA 4M1UB 2JA5B 2O4XA 1IZ6A 2VXWA 4DV2L 3TSSA 3RLNA 4JI6L 5C4XH 1BVSA 3JAML 1EQTA 1X56A 4JOIC 3MVVA 1VQ7A 4XXEA 2CW0C 1PZID 2H1EA 4ME3A 4BBRB 4HMJA 3DMUA 4M8AA 1Q1BA 3W3AA 3ICEA 2JE6I 2JN4A 2E8GA 3SVMA 2YU9H 1UWVA 3D31A 3BVZA 4R8IA 3NQIA 1TWCH 3T1HQ 3KFUA 3BYYB 2QILA 2RA4A 3S14B 1VCIA 4NB3A 5JPNC 3PO3B 2HHHQ 2F0LA 4DR5L 2ZTDA 4DR7Q 1EY6A 2ATWA 2F3IA 5C5LA 2Q2IA 4JYAQ 2L12A 4KHVA 3KJOA 3HKZE 1PRTF 4ILWA 3TDQA 1FJGL 3I4NG 1XMOQ 4NMZA 4DNTB 1PYSB 1YHBA 3BVGA 3GTOH 1EOVA 2A73B 2B2VC 2F52A 1A62A 2KCTA 5D3IB 2BCOA 1I6HB 1VQ4A 4A3JB 1S3OA 2PW7A 3G6EA 1WD1A 3HOYB 3K5MA 4B3TQ 5C0XG 2J0TD 1B9MA 1JJCB 3K80C 4C3JG 2K32A 2ICEC 3QJYA 2FINB 1IBKQ 1EEID 1TS4A 3HOVH 3M4YA 2MP1A 5C0XI 2MNAA 1PZKD 5D14A 3PCOB 1ILQA 4S3SA 3WDNA 1G91A 3FMCA 2K52A 3KBXA 1JB3A 1VMPA 5BN3A 1JJGA 3P1HA 2KCNA 1CTMA 1YJ9A 1RJTA 2K5DA 1E1TA 1PH7A 2AMCB 3Q23A 1VQJA 1CK1A 4RH6A 4LF9Q 1A8VA 1LV9A 5IGCA 1I4XA 2K33A 1HZCA 1BCPB 2IY5B 3AU7A 1D5ZC 2F0EA 5CBAE 4A3LG 4CDCC 4DR6L 1HNZL 3N52A 1CZWA 5NUCA 2KA7A 3PQIA 4AQYL 2H4OA 4OO1H 4KN4C 2CWPA 2N88A 5J1ZA 2R7ZH 4DN4M 1Y1WH 4RMFA 4DV7Q 1IBMQ 4R8NA 3A56A 2EDGA 4QL5A 1KNAA 4C3IB 1TY2A 1SNPA 2QW7A 4LAAA 3BZKA 5K36G 4PQXA 3A55A 1FGUA 1I4QA 1IYJB 4Z9CB 2CQAA 2PI2E 2B2TA 4IO9A 4DGZA 3GTLB 2N55A 2PZUA 3AQQA 1S5DD 2JA8G 2UXBQ 1N8RC 3ERSX 4LF8Q 5CYUA 5F2DA 1EIHA 3H0GG 1KNEA 4ZYSA 2F0IA 1CQVA 1PVOA 4DUZL 4A3DG 4LFCL 1YBYA 3OIQA 3CCUA 3G6JB 1A2TA 1L1OA 4X66Q 2UUAQ 1P8LA 4ZQ3A 5LL6X 2QEJC 4JK1C 4A3KH 5JJIA 4P71A 1L0XB 3ONAB 3K59A 4A3BG 4NKLA 3OMGA 1KAWA 4LK1C 2XRQD 5C3EH 3GTGH 4FO2A 4DV5Q 3EROA 4MHEA 3S2HH 3GTMB 1TWFB 2PNRC 1DZ1A 5JJZA 3CCSA 2Q2HA 1SE2A 4K0KQ 3RZDH 4NW2A 1S5FD 4RWSC 3GTJH 5IYCG 3F8TA 1F2LA 2F0FA 3GTPH 3NQTA 1A6XA 4PZ7A 1Q8IA 3CRLC 1N32Q 2KVMA 3PO2G 3CCMA 4IPCA 1ICWA 2VUMH 1STGA 3VYTA 4OIKA 1JMCA 3FKIH 2KECA 4YWMA 2VY3A 3PF5A 4LF6L 1XNQQ 2F1MA 2K04A 1M4VA 1RTNA 3NP8A 3RN2A 5IODA 3HFZB 1SAPA 1STAA 2I5LX 1KLUD 1HNWL 3UI2A 3RNUA 2K7VA 1B9NA 2UU9L 4C2MB 1NY4A 1EL0A 1F2ZA 2IHEA 3OHXC 2ZXOA 1OXSC 1SNOA 2C5CA 2X6LA 1BUVT 1J5EQ 1WTOA 1JJ2A 4CKCA 2UUBL 5M3MH 4DV2Q 2OWOA 1E2WA 2OTLA 4JI6Q 1SXTA 4DAPA 1B44D 2KUMA 5AJ3L 2RSOA 3TP6A 1G51A 3ND9A 1FNUA 2PI2A 4UAIA 4OX9Q 4KV6A 5CGKA 1MSHA 3A8IE 3AB9A 1D5MC 2M9VA 1CUKA 4DV3L 1LTLA 4JBKA 2RQXA 1XX8A 1K8MA 1T5XD 4UP7A 5C4JB 1IHZA 3TMEA 5JVG3 3LGJA 1EIGA 5CV6A 4DV1L 1E1OA 1H9MA 1HNXL 1FJGQ 3U58A 2J7ZA 4EX5A 1GM5A 3KF8A 4NXNQ 4GKKL 4TVAB 1CFMA 5M3FH 1LLRD 1CQFA 2NVYB 1U4RA 3S1RH 2CKZB 4I7AA 2PPBC 3OTOQ 3KLSX 2N3SA 3I4NB 3NSWA 1UE7A 1GO3E 4AIMA 2UXDL 5I6YA 4A4IA 4JBJA 3CC4A 4JC0A 2K1BA 5EKIA 1KIXA 1EY4A 1X3EA 4LF7L 4LWCA 1UE5A 4C3JB 1TS2A 4A93G 3R2IA 1NSNS 1Q1EA 2AQ3B 2R7FA 4GLXA 3EN2A 1SNQA 4J6HA 1YNJC 3GTKH 3E9IA 3CRKC 3URYA 3D3RA 1DM0B 2EYFA 3V96A 4P75A 2OEOA 3NHHA 5DLQE 1VQ6A 3VR2A 1Y1VG 2UXCL 2R92B 5H1SE 1B8AA 4A3FH 4DR6Q 3U4VA 1HNZQ 1K8GA 3NELA 1HHVA 3GQBA 3BU2A 2TSSA 1RD9D 1JICA 3K7UC 4POFA 2ES2A 3QOJA 3J80c 3U50C 4A3MH 4DR2L 4TRDA 1TU2B 3GO5A 5ELDA 1GD7A 3P20A 1DXMA 2QDLA 5M5WB 1OXUA 1Z47A 2Z9HA 4QF4A 1S40A 4XIGS 1KABA 2PW5A 2XVSA 3KOJA 4A3EH 5C6AA 5C4XG 4HJAA 4V0BA 2HIVA 3QR8A 1UEAB 5EPJA 3CCVA 2LS01 1OXXK 1RCVD 3K7AH 1W2BA 1ONLA 3SE0A 4O0AA 2K75A 2KHIA 4IN3A 3BZCA 3HOUH 2F0GA 4LFCQ 1Q46A 1WJJA 4TKOB 2JA8B 3GTQH 3BDLA 3NTIA 3MC0B 3H0GB 4WRDA 1RL2A 1GKHA 1ENCA 1QUQA 2BA0A 3V05A 1SLJA 1X65A 3CAMA 4A3DB 4XDXA 4DAYB 3LWEA 1I4GA 4XYOA 4CJ0B 2HHHL 1JT8A 2E2HH 3HKZG 1FNWA 3CCQA 5HGTA 4DXGA 2Z0SA 3KLSA 3BZDB 2KHJA 4UDUC 4A3BB 4G57A 1XMOL 1HCZA 1TWAB 1PYBA 3R2TA 1GOZA 2F4IA 2R3ZA 3TS2A 2WKDA 1NMFA 1KTKA 3JAMi 4KI0A 2FMCA 2Z1CA 3RLOA 2JEBI 1VQKA 2K4KA 4N9TA 1J8IA 1NCVA 3VDYA 1TT2A 3HOVG 2X6GA 1Q82C 4LF6Q 4IFDH 2LSSA 1CZGA 1R9TB 1IBKL 2NBFA 1HNWQ 3PO2B 4K2LA 5C3WA 2UU9Q 1DD2A 1PTOB 1AN8A 3Q0AA 4QMGA 2CH4A 4P73A 2NZOA 4R4TA 1VQ5A 1E2ZA 3F2DA 1Y69U 3A5ZB 2UUBQ 3Q22A 2MHVA 2ZT9C 1K83H 1EY9A 3W1BA 4JCVE 3W5OA 1HPCA 3HKSA 3G4SA 1M1KC 1X3FA 3MXNB 3CKIB 5EGTA 2DN8A 3NK9A 4J1MA 2VB3X 4OO1G 5G3LF 2A74C 2R7ZG 4RAUC 1Y1WG 1ML0D 1CHQD 2JA7H 2XTIA 4YHHL 5FLXL 5M5YB 1HA6A 3JAME 4IUTA 2E2JH 4OO1I 4Q0FA 5ELEA 2LMCB 2EY2A 1Z9FA 4DV7L 1WCMH 4PZ8A 1K28A 1IBLL 3TREA 2DY7A 1BCPD 2PQAB 4LFBQ 4DV1Q 2LY7A 4BA2I 3AFPA 1AP0A 3F1ZA 4EQOA 5EBCA 4OGQC 2L1BA 2PO4A 3S1QH 4FF2A 1CT1D 4FNFA 4LUOA 3SK4A 4LF8L 5ELOA 4DNRB 3AMUA 1PYWD 4JBWA 4X3SA 3S2DH 2B8GA 1ZEQX 5E7NA 5ELBA 1XWEA 3PF4A 3RD4A 1SEBD 2F0UA 3I72A 3BDOA 2AUJD 5EPLA 5FO7B 5LMUQ 4A3KG 4TQUS 1QNKA 5E3FA 4I7ZC 1WTHA 1HR0W 1JORA 2E2IB 2UXDQ 3CCLA 4X66L 4UP9A 5C3EG 3I7FA
chains in the Genus database with same CATH topology
5C0XI 2Y0SG 1EUJA 4BBRG 2MNAA 2HT1A 3PCOB 2D0PA 1VQMA 1GVPA 3ER0A 1G291 3FHWA 5GAHC 2BH2A 2K52A 2AWNA 1JJGA 3PV0A 4DV4L 3NBHB 4LF7Q 1YJ9A 5JJIA 4DV5L 4YWLA 4DPGA 1E1TA 1PH7A 1VQLA 1EIYB 2AMCB 1VQJA 4L5RC 1AE3A 3KF6B 2LXJA 3L7ZC 4L5SA 4LF9Q 3M85A 5LMNW 4DV0L 1EFWA 1A8VA 2QGQA 1N33Q 4K0KL 1WOCA 4R4QA 1YZ6A 1HZCA 1QVCA 5IE8A 5J3BA 2ZM6Q 5FLMG 4GNXB 2IY5B 1SMXA 3I55A 2VUMG 4GLVB 3FKIG 4PZ6A 4QY7A 4A3LG 4DR6L 1SROA 1H95A 1C9OA 1HNZL 5C4JH 1SE8A 1FVIA 2E5LQ 4YCUA 1CSPA 4AQYL 4A75A 4DR5Q 2ID0A 3H3VH 3T1YL 2CWPA 3STBC 2R7ZH 1TWAH 4DV6L 1Y1WH 5IT9c 3CCJA 4QQBX 4RMFA 4DV7Q 1NJIC 1XNQL 4DR2Q 1IBMQ 2N49A 3Q8DA 3I56A 4QL5A 2NVTH 5IYDG 4A3GH 1LM0A 2IHFA 3BZKA 1K9MC 4JI8L 2R93G 5K36G 5GADC 2NVYH 5IY0A 4XTCS 1QUQB 2K5HA 1FGUA 3KLWA 3J80i 5M3MG 1IYJB 4GS3A 2KBNA 4GOPA 4LNQA 2PI2E 2B29A 4IO9A 1AE2A 4YWKA 3AQQA 2JA8G 3I4NH 2UXBQ 1N8RC 2MFIA 3ERSX 1J5EL 5JEAJ 4LF8Q 1CKOA 4JOIA 4BXXH 3H0GG 3GD7A 3MEFA 1PH5A 4HIKA 1PVOA 4DUZL 1WYDA 3DM3A 4IOAA 4LUVA 4BY1G 4A3DG 1KRSA 4LFCL 1YBYA 3CCUA 3HOZH 1L1OA 4X66Q 1HZBA 1P8LA 1MJEA 2UUAQ 1YI2A 4OX9L 1IL2A 4A3KH 4JI0Q 4P71A 3M4PA 4DAMA 3CQZH 3KJPA 4HJ8A 1XMQQ 5JJKA 1VQAA 3GDEA 3PIOA 4C3JH 4A3BG 2K14A 4X65L 3S1MH 1KAWA 4YY3L 2AHOB 1A63A 1I94L 4JG2A 2JEAI 2K5NA 3S1NH 5C3EH 4JI3L 4DV4Q 3BJUA 4BBRH 3GTGH 4DV5Q 4B3SL 2EIFA 1VQDA 2NZHA 4H02A 3A5UA 1VQ9A 2R92G 3S2HH 1YJNA 3JAMc 1BBUA 4DV0Q 1E22A 4HIMA 3HOWG 1Q12A 1V9PA 2GVAA 4GOPB 4IPHA 1PV4A 4X62L 1LYLA 2Q2HA 3CCSA 4JI7Q 4K0KQ 3PUVA 5M3FG 3RZDH 2A8VA 2AWOA 4GN4B 4MNOA 3GTJH 3K8AA 5IWAL 5IYCG 3F8TA 1HZAA 3E0EA 1S72A 3J81j 3B6YA 4NXNL 3GTPH 2JA9A 1AH9A 1B70B 4PZ7A 4R1JA 1HZ9A 2OQ0A 4DR3L 4JI2L 1N32Q 2A19A 5FLMH 3PO2G 3CCMA 4IPCA 1U5KA 3DLLA 1NE3A 2VUMH 3PGZA 3L2PA 4AQYQ 1JMCA 3FKIH 4IPGA 4YWMA 5M5WH 2VY3A 3OTOL 4A3LH 2JA6G 4AYBE 2WAQE 2IT1A 3PF5A 4LF6L 3M4QA 1XNQQ 1G6PA 1L1OB 3A74A 2JA5G 3RN2A 4JI4Q 3HFZB 3CXCA 2VNUD 2I5LX 5JJLA 1XTDA 1HNWL 4JI8Q 2BA1A 4JI5L 5GROA 3RNUA 1IXRA 4IPDA 2UU9L 1LUZA 1NY4A 3ZJYC 5IYDH 1X9NA 1CKNA 2IHEA 2HIXA 3TRZA 1OXSC 1BKBA 2R93H 2MQHA 4P72A 1EQQA 1VQNA 4NXML 3CW2C 3CCRA 2MO1A 3E9HA 3S24A 1J5EQ 3OYYA 4BY7G 1I50H 1JJ2A 4GNXC 2UUBL 5M3MH 5BR8L 2YTYA 4QGUA 4DV2Q 2OWOA 1EIFA 4UP8A 4LUZA 2OTLA 4DUZQ 2UUCQ 4JI6Q 2JA8H 4OWTB 2YYZA 5AJ3L 3PO3G 4KHPL 3H0GH 1G51A 5HY6A 2F4VQ 2EQSA 5C3EG 4A3FG 3FP9A 1J6QA 1N36Q 4JV5L 2PI2A 1KL9A 3STBD 4OX9Q 4DUYQ 3PUWA 1VQPA 4BY1H 2RCNA 4KLKA 4OONA 4A3DH 3S17H 4X65Q 4YCVA 3EIVA 3W1GA 2RHSB 3T1HL 4A3MG 5FJ8G 1CUKA 4MTNA 4DV3L 1I94Q 1LTLA 5ELNA 2LXKA 4JBKA 5GQOA 1D8LA 4YHHQ 1QVGA 4JI3Q 4HJ7A 4DR7L 4UP7A 2PMZE 4A3BH 4WJ3M 4BBSG 1YHAA 3SGIA 4AH6A 4DR1L 4JYAL 2CWAA 4LF5Q 2CCZA 3UE1A 4DK6C 1X55A 3LGJA 2VQEL 1XNRL 2VQFL 1YIJA 4A3EG 1IBLQ 4DV1L 4A3JG 2V1CC 1CKNB 1E1OA 4X62Q 4HJ5A 1HNXL 1MKHA 1FJGQ 2QEXA 3U58A 3HOYG 1NBWA 4DR4Q 4EX5A 1GM5A 4HJ9A 3CC7A 4NXNQ 5C0XJ 3HOWH 2Q2TA 2Z6KC 3KYHC 4TVAB 4GKKL 4DR3Q 2NVQH 1P16A 2OTJA 5M3FH 4JI2Q 3S1RH 1NTGA 2R7DA 2BH8A 2CKZB 4C3IH 2K5VA 4OWXB 5IYCH 3J7ZC 1R9TH 3HOUG 2QA4A 1OXVA 4APVA 3OTOQ 3K0XA 2N3SA 2ZTEA 4A3IH 1RIPA 2WB1G 3CD6A 3I4MG 4B3TL 1WFQA 2YTXA 2GN5A 3PO2H 1KHIA 1UE7A 3UDIA 1GO3E 4AIMA 4LF4L 2UXDL 4DKAC 2JA6H 4JI5Q 1TWHH 4A4IA 1N34Q 3J81i 4JBJA 3CC4A 4JC0A 2JA5H 4PMWA 3CMAA 1VQIA 1C7YA 1XPOA 5GAEC 2Y0SE 2ZJPA 1KIXA 2ZJQA 1JE5A 3PSIA 4GKJL 4LFAL 1X3EA 1VS0A 2D62A 3ULPA 4LF7L 4J15A 1UE5A 4LWCA 2CQOA 2Q2UA 5BR8Q 1V43A 2EXDA 1OXTA 1O7IA 1I5FA 3PUYA 4A93G 1ASYA 1HR0L 2WFWA 2DGYA 1Q1EA 2YTVA 4IJLA 4LF9L 1V1QA 4BY7H 5AJ3Q 4PG3A 4R4OA 2IX1A 1N33L 2R7FA 4GLXA 3EN2A 3NEMA 4KHPQ 3KF8B 3GTKH 1L2FA 3E9IA 5HGQA 1PA6A 4JI0L 4B3RL 5GAGC 2ASBA 3S14H 1YVCA 2I5HA 4P75A 5M5YH 5DLQE 4P74A 3PO3H 1Q86C 1VQ6A 1Y1VG 3RR5A 5IYBG 2UXCL 5H1SE 1B8AA 1EYGA 4A3FH 3CC2A 4DR6Q 3U4VA 1UEBA 3HOXG 3F2CA 1PH2A 1HNZQ 3KDFA 2ZTCA 1NMGA 3NELA 4DV3Q 1WI5A 3A0JA 3BU2A 3L0OA 1TWFH 1K8GA 4IFDG 3K7UC 4POFA 4Y7NH 5IP7G 4LW1A 5LMNL 2ES2A 1KQSA 2IX0A 2CFMA 3J80c 1TWGH 3U50C 5FJ8H 5FLXc 4DR2L 3T1YQ 4A3MH 1QZGA 4L5TA 4X64L 4DV6Q 2KCMA 1QVFA 1D7QA 3GO5A 4IFDI 2VQEQ 1A0IA 1GD7A 2VQFQ 3TEHB 1M90C 2B63G 3EBEA 1OXUA 4BBSH 1Z47A 3KF6A 4R4CA 1SRUA 1HNXQ 4HIOA 3CF5A 1S40A 3PUZA 4XIGS 2JK8A 1PHJA 2AKWB 1Q7YC 1VQFA 3KOJA 4A3EH 1I6HH 4GKKQ 5C4XG 4HJAA 1L0WA 4A3JH 2UXBL 1VQGA 2ZJRA 2HIVA 3HOYH 2K50A 3CCVA 1SN8A 1KC8C 1KD1C 1OXXK 1VQBA 3K7AH 4BA1I 1W2BA 2E2IH 1Q81C 1X54A 2YV5A 4FDBA 5M5XH 1E7ZA 2I5MX 2KENA 4O0AA 4UPAA 2OQKA 2DUDA 2K75A 2KHIA 2XGTA 3BZCA 3PIPA 1YJWA 3HOUH 4NPSA 1PH9A 4LFCQ 4LF4Q 1Q46A 1WJJA 4A3CG 1ASZA 1PH4A 2UUAL 2JA7G 1E24A 2C35B 1T9HA 3GTQH 3ULLA 3I4MH 1XMQL 1EWIA 3KDFB 1IBML 1VQHA 2OCEA 1K3RA 4DK3C 1RL2A 3CPFA 1GKHA 2BA0A 1QUQA 4ALPA 2NVXH 1SLJA 1X65A 3CAMA 1VQEA 1WCMG 4GKJQ 1CKMA 4LFAQ 4YY3Q 1JB7A 3M7NA 4DAYB 3UE0A 1Y14B 1YNXA 4OXPA 3CCEA 3OW2A 2HHHL 4B3ML 1YHQA 3M3YH 1JT8A 2E2HH 1UE6A 3CMEA 3HKZG 1HR0Q 4B3SQ 3CCQA 3G71A 1PH3A 2Z0SA 1BBWA 4IFDJ 1KXLA 2JJQA 2KHJA 4UP9A 4JI7L 4LFBL 1I3QH 4WJ4A 4YCWA 4A93H 1XMOL 2Z6KA 4OWWB 2FXQA 1PYBA 4POGA 3TS2A 5IWAQ 3H15A 1U0LA 1NMFA 4HIDA 2L15A 2N78A 2UXCQ 2VS1A 1PFSA 2B3GA 3PUXA 3WWVA 3TQYA 5IP9G 3JAMi 1N32L 4KI0A 3F2BA 1OTCA 2RF4A 3AEVA 3RLOA 2JEBI 4AYBG 2WAQG 4GN3B 4JBMA 1VQKA 2K4KA 2A1AA 4X6AH 3UDGA 1Y1VH 5IYBH 3S16H 5LMNQ 1TXYA 3VDYA 3HOXH 3HOVG 1EQRA 4X64Q 4JI1L 5C44G 1DGSA 5LMUL 1Q82C 4JI4L 4LF6Q 3M4OH 3TS0A 2LSSA 4C3HH 1XPRA 2HQLA 3AYHB 5IP7H 1YITA 1IBKL 3GTLH 2VW9A 1HNWQ 3CP0A 1VQCA 1VQ8A 4EQ5A 4KHZA 2UU9Q 2PQAA 2B63H 3I2ZA 1SFOH 3M9BA 4R4IA 1PH1A 1HH2P 1E3PA 3ULJA 2PNHA 2RHQB 2D0OA 2N8NA 3RZOH 1MJCA 4QIWE 4GOPC 4O2DA 4NXMQ 1VQ5A 4P73A 2NZOA 4R4TA 1IZ6A 3F2DA 4DV2L 3RLNA 1XJVA 3A5ZB 4A76A 2UUCL 2UUBQ 5C4XH 4JI6L 1BVSA 3CPWA 1MIUA 4GLAC 1X56A 4JOIC 3U4ZA 2VL6A 1QZHA 1VQ7A 1K83H 3W1BA 4JCVE 3W5OA 2F4VL 3S15H 3HKSA 4ME3A 4GN5A 3G4SA 1N36L 1X3FA 3MXNB 1M1KC 2NN6G 1Q1BA 3ICEA 2ZM6L 4DUYL 3RLFA 2JE6I 4JV5Q 1B7YB 1SR3A 2E8GA 2YU9H 1K8AC 1UWVA 4OO1G 3D31A 4QJFA 1L1OC 2R7ZG 2MO0A 2NN6I 1TWCH 1Y1WG 4A3CH 4DNIA 3T1HQ 2JA7H 2XTIA 2E5LL 3KFUA 1K73C 1VCIA 4YHHL 4NB3A 4A3GG 3GTMH 2VZAA 2E2JH 2HHHQ 4OO1I 4DR5L 2ZTDA 4B3MQ 3I4OA 4DR7Q 3H3VI 4LF5L 2ATWA 1Z9FA 2F3IA 2ALYB 2Q2IA 4IJHA 4DV7L 4DR1Q 4JYAQ 1WCMH 4PZ8A 3KJOA 3HKZE 1IBLL 1XPUA 4UY8C 3TREA 2R92H 1XNRQ 1VQOA 2PQAB 1FJGL 4LFBQ 4DV1Q 1W3SA 3I4NG 1XMOQ 4DR4L 4BA2I 4Y52H 3AFPA 3JC66 1KRTA 3F1ZA 1Q8KA 1PYSB 4BXXG 1YHBA 3NENA 3J7A5 3K81C 1YEZA 1N9WA 4A3IG 2I0QA 2R6GA 3GTOH 1EOVA 1PH6A 1K0RA 1FL0A 3S1QH 4GNXA 2F52A 4L5QA 4LUOA 1HJPA 4LF8L 4IOCA 1CSQA 1C0AA 1A62A 2KCTA 5ELOA 4JBWA 5EAYA 4B3RQ 3J81c 3S2DH 1VQ4A 3HOZG 5E7NA 3PF4A 2GVBA 1S3OA 3IRBA 3UDFA 5IP9H 3G6EA 3RN5A 1UE1A 3UDXA 5LMUQ 4JI1Q 4A3KG 4B3TQ 4TQUS 5C0XG 4C2MH 2WB1E 1JJCB 3K80C 4RG1A 1X6OA 1PH8A 1HR0W 3D0FA 1IBKQ 1N34L 2UXDQ 3CCLA 2JQOA 3AFQA 2WP8J 4X66L 5JEAG 3HOVH 2H5XA 4MZ9A 1X3GA 5C44H 3G48A 3I7FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0X I;  2Y0S G;  1EUJ A;  4BBR G;  2MNA A;  2HT1 A;  3PCO B;  2D0P A;  1VQM A;  1GVP A;  3ER0 A;  1G29 1;  3FHW A;  5GAH C;  2BH2 A;  2K52 A;  2AWN A;  1JJG A;  3PV0 A;  4DV4 L;  3NBH B;  4LF7 Q;  1YJ9 A;  5JJI A;  4DV5 L;  4YWL A;  4DPG A;  1E1T A;  1PH7 A;  1VQL A;  1EIY B;  2AMC B;  1VQJ A;  4L5R C;  1AE3 A;  3KF6 B;  2LXJ A;  3L7Z C;  4L5S A;  4LF9 Q;  3M85 A;  5LMN W;  4DV0 L;  1EFW A;  1A8V A;  2QGQ A;  1N33 Q;  4K0K L;  1WOC A;  4R4Q A;  1YZ6 A;  1HZC A;  1QVC A;  5IE8 A;  5J3B A;  2ZM6 Q;  5FLM G;  4GNX B;  2IY5 B;  1SMX A;  3I55 A;  2VUM G;  4GLV B;  3FKI G;  4PZ6 A;  4QY7 A;  4A3L G;  4DR6 L;  1SRO A;  1H95 A;  1C9O A;  1HNZ L;  5C4J H;  1SE8 A;  1FVI A;  2E5L Q;  4YCU A;  1CSP A;  4AQY L;  4A75 A;  4DR5 Q;  2ID0 A;  3H3V H;  3T1Y L;  2CWP A;  3STB C;  2R7Z H;  1TWA H;  4DV6 L;  1Y1W H;  5IT9 c;  3CCJ A;  4QQB X;  4RMF A;  4DV7 Q;  1NJI C;  1XNQ L;  4DR2 Q;  1IBM Q;  2N49 A;  3Q8D A;  3I56 A;  4QL5 A;  2NVT H;  5IYD G;  4A3G H;  1LM0 A;  2IHF A;  3BZK A;  1K9M C;  4JI8 L;  2R93 G;  5K36 G;  5GAD C;  2NVY H;  5IY0 A;  4XTC S;  1QUQ B;  2K5H A;  1FGU A;  3KLW A;  3J80 i;  5M3M G;  1IYJ B;  4GS3 A;  2KBN A;  4GOP A;  4LNQ A;  2PI2 E;  2B29 A;  4IO9 A;  1AE2 A;  4YWK A;  3AQQ A;  2JA8 G;  3I4N H;  2UXB Q;  1N8R C;  2MFI A;  3ERS X;  1J5E L;  5JEA J;  4LF8 Q;  1CKO A;  4JOI A;  4BXX H;  3H0G G;  3GD7 A;  3MEF A;  1PH5 A;  4HIK A;  1PVO A;  4DUZ L;  1WYD A;  3DM3 A;  4IOA A;  4LUV A;  4BY1 G;  4A3D G;  1KRS A;  4LFC L;  1YBY A;  3CCU A;  3HOZ H;  1L1O A;  4X66 Q;  1HZB A;  1P8L A;  1MJE A;  2UUA Q;  1YI2 A;  4OX9 L;  1IL2 A;  4A3K H;  4JI0 Q;  4P71 A;  3M4P A;  4DAM A;  3CQZ H;  3KJP A;  4HJ8 A;  1XMQ Q;  5JJK A;  1VQA A;  3GDE A;  3PIO A;  4C3J H;  4A3B G;  2K14 A;  4X65 L;  3S1M H;  1KAW A;  4YY3 L;  2AHO B;  1A63 A;  1I94 L;  4JG2 A;  2JEA I;  2K5N A;  3S1N H;  5C3E H;  4JI3 L;  4DV4 Q;  3BJU A;  4BBR H;  3GTG H;  4DV5 Q;  4B3S L;  2EIF A;  1VQD A;  2NZH A;  4H02 A;  3A5U A;  1VQ9 A;  2R92 G;  3S2H H;  1YJN A;  3JAM c;  1BBU A;  4DV0 Q;  1E22 A;  4HIM A;  3HOW G;  1Q12 A;  1V9P A;  2GVA A;  4GOP B;  4IPH A;  1PV4 A;  4X62 L;  1LYL A;  2Q2H A;  3CCS A;  4JI7 Q;  4K0K Q;  3PUV A;  5M3F G;  3RZD H;  2A8V A;  2AWO A;  4GN4 B;  4MNO A;  3GTJ H;  3K8A A;  5IWA L;  5IYC G;  3F8T A;  1HZA A;  3E0E A;  1S72 A;  3J81 j;  3B6Y A;  4NXN L;  3GTP H;  2JA9 A;  1AH9 A;  1B70 B;  4PZ7 A;  4R1J A;  1HZ9 A;  2OQ0 A;  4DR3 L;  4JI2 L;  1N32 Q;  2A19 A;  5FLM H;  3PO2 G;  3CCM A;  4IPC A;  1U5K A;  3DLL A;  1NE3 A;  2VUM H;  3PGZ A;  3L2P A;  4AQY Q;  1JMC A;  3FKI H;  4IPG A;  4YWM A;  5M5W H;  2VY3 A;  3OTO L;  4A3L H;  2JA6 G;  4AYB E;  2WAQ E;  2IT1 A;  3PF5 A;  4LF6 L;  3M4Q A;  1XNQ Q;  1G6P A;  1L1O B;  3A74 A;  2JA5 G;  3RN2 A;  4JI4 Q;  3HFZ B;  3CXC A;  2VNU D;  2I5L X;  5JJL A;  1XTD A;  1HNW L;  4JI8 Q;  2BA1 A;  4JI5 L;  5GRO A;  3RNU A;  1IXR A;  4IPD A;  2UU9 L;  1LUZ A;  1NY4 A;  3ZJY C;  5IYD H;  1X9N A;  1CKN A;  2IHE A;  2HIX A;  3TRZ A;  1OXS C;  1BKB A;  2R93 H;  2MQH A;  4P72 A;  1EQQ A;  1VQN A;  4NXM L;  3CW2 C;  3CCR A;  2MO1 A;  3E9H A;  3S24 A;  1J5E Q;  3OYY A;  4BY7 G;  1I50 H;  1JJ2 A;  4GNX C;  2UUB L;  5M3M H;  5BR8 L;  2YTY A;  4QGU A;  4DV2 Q;  2OWO A;  1EIF A;  4UP8 A;  4LUZ A;  2OTL A;  4DUZ Q;  2UUC Q;  4JI6 Q;  2JA8 H;  4OWT B;  2YYZ A;  5AJ3 L;  3PO3 G;  4KHP L;  3H0G H;  1G51 A;  5HY6 A;  2F4V Q;  2EQS A;  5C3E G;  4A3F G;  3FP9 A;  1J6Q A;  1N36 Q;  4JV5 L;  2PI2 A;  1KL9 A;  3STB D;  4OX9 Q;  4DUY Q;  3PUW A;  1VQP A;  4BY1 H;  2RCN A;  4KLK A;  4OON A;  4A3D H;  3S17 H;  4X65 Q;  4YCV A;  3EIV A;  3W1G A;  2RHS B;  3T1H L;  4A3M G;  5FJ8 G;  1CUK A;  4MTN A;  4DV3 L;  1I94 Q;  1LTL A;  5ELN A;  2LXK A;  4JBK A;  5GQO A;  1D8L A;  4YHH Q;  1QVG A;  4JI3 Q;  4HJ7 A;  4DR7 L;  4UP7 A;  2PMZ E;  4A3B H;  4WJ3 M;  4BBS G;  1YHA A;  3SGI A;  4AH6 A;  4DR1 L;  4JYA L;  2CWA A;  4LF5 Q;  2CCZ A;  3UE1 A;  4DK6 C;  1X55 A;  3LGJ A;  2VQE L;  1XNR L;  2VQF L;  1YIJ A;  4A3E G;  1IBL Q;  4DV1 L;  4A3J G;  2V1C C;  1CKN B;  1E1O A;  4X62 Q;  4HJ5 A;  1HNX L;  1MKH A;  1FJG Q;  2QEX A;  3U58 A;  3HOY G;  1NBW A;  4DR4 Q;  4EX5 A;  1GM5 A;  4HJ9 A;  3CC7 A;  4NXN Q;  5C0X J;  3HOW H;  2Q2T A;  2Z6K C;  3KYH C;  4TVA B;  4GKK L;  4DR3 Q;  2NVQ H;  1P16 A;  2OTJ A;  5M3F H;  4JI2 Q;  3S1R H;  1NTG A;  2R7D A;  2BH8 A;  2CKZ B;  4C3I H;  2K5V A;  4OWX B;  5IYC H;  3J7Z C;  1R9T H;  3HOU G;  2QA4 A;  1OXV A;  4APV A;  3OTO Q;  3K0X A;  2N3S A;  2ZTE A;  4A3I H;  1RIP A;  2WB1 G;  3CD6 A;  3I4M G;  4B3T L;  1WFQ A;  2YTX A;  2GN5 A;  3PO2 H;  1KHI A;  1UE7 A;  3UDI A;  1GO3 E;  4AIM A;  4LF4 L;  2UXD L;  4DKA C;  2JA6 H;  4JI5 Q;  1TWH H;  4A4I A;  1N34 Q;  3J81 i;  4JBJ A;  3CC4 A;  4JC0 A;  2JA5 H;  4PMW A;  3CMA A;  1VQI A;  1C7Y A;  1XPO A;  5GAE C;  2Y0S E;  2ZJP A;  1KIX A;  2ZJQ A;  1JE5 A;  3PSI A;  4GKJ L;  4LFA L;  1X3E A;  1VS0 A;  2D62 A;  3ULP A;  4LF7 L;  4J15 A;  1UE5 A;  4LWC A;  2CQO A;  2Q2U A;  5BR8 Q;  1V43 A;  2EXD A;  1OXT A;  1O7I A;  1I5F A;  3PUY A;  4A93 G;  1ASY A;  1HR0 L;  2WFW A;  2DGY A;  1Q1E A;  2YTV A;  4IJL A;  4LF9 L;  1V1Q A;  4BY7 H;  5AJ3 Q;  4PG3 A;  4R4O A;  2IX1 A;  1N33 L;  2R7F A;  4GLX A;  3EN2 A;  3NEM A;  4KHP Q;  3KF8 B;  3GTK H;  1L2F A;  3E9I A;  5HGQ A;  1PA6 A;  4JI0 L;  4B3R L;  5GAG C;  2ASB A;  3S14 H;  1YVC A;  2I5H A;  4P75 A;  5M5Y H;  5DLQ E;  4P74 A;  3PO3 H;  1Q86 C;  1VQ6 A;  1Y1V G;  3RR5 A;  5IYB G;  2UXC L;  5H1S E;  1B8A A;  1EYG A;  4A3F H;  3CC2 A;  4DR6 Q;  3U4V A;  1UEB A;  3HOX G;  3F2C A;  1PH2 A;  1HNZ Q;  3KDF A;  2ZTC A;  1NMG A;  3NEL A;  4DV3 Q;  1WI5 A;  3A0J A;  3BU2 A;  3L0O A;  1TWF H;  1K8G A;  4IFD G;  3K7U C;  4POF A;  4Y7N H;  5IP7 G;  4LW1 A;  5LMN L;  2ES2 A;  1KQS A;  2IX0 A;  2CFM A;  3J80 c;  1TWG H;  3U50 C;  5FJ8 H;  5FLX c;  4DR2 L;  3T1Y Q;  4A3M H;  1QZG A;  4L5T A;  4X64 L;  4DV6 Q;  2KCM A;  1QVF A;  1D7Q A;  3GO5 A;  4IFD I;  2VQE Q;  1A0I A;  1GD7 A;  2VQF Q;  3TEH B;  1M90 C;  2B63 G;  3EBE A;  1OXU A;  4BBS H;  1Z47 A;  3KF6 A;  4R4C A;  1SRU A;  1HNX Q;  4HIO A;  3CF5 A;  1S40 A;  3PUZ A;  4XIG S;  2JK8 A;  1PHJ A;  2AKW B;  1Q7Y C;  1VQF A;  3KOJ A;  4A3E H;  1I6H H;  4GKK Q;  5C4X G;  4HJA A;  1L0W A;  4A3J H;  2UXB L;  1VQG A;  2ZJR A;  2HIV A;  3HOY H;  2K50 A;  3CCV A;  1SN8 A;  1KC8 C;  1KD1 C;  1OXX K;  1VQB A;  3K7A H;  4BA1 I;  1W2B A;  2E2I H;  1Q81 C;  1X54 A;  2YV5 A;  4FDB A;  5M5X H;  1E7Z A;  2I5M X;  2KEN A;  4O0A A;  4UPA A;  2OQK A;  2DUD A;  2K75 A;  2KHI A;  2XGT A;  3BZC A;  3PIP A;  1YJW A;  3HOU H;  4NPS A;  1PH9 A;  4LFC Q;  4LF4 Q;  1Q46 A;  1WJJ A;  4A3C G;  1ASZ A;  1PH4 A;  2UUA L;  2JA7 G;  1E24 A;  2C35 B;  1T9H A;  3GTQ H;  3ULL A;  3I4M H;  1XMQ L;  1EWI A;  3KDF B;  1IBM L;  1VQH A;  2OCE A;  1K3R A;  4DK3 C;  1RL2 A;  3CPF A;  1GKH A;  2BA0 A;  1QUQ A;  4ALP A;  2NVX H;  1SLJ A;  1X65 A;  3CAM A;  1VQE A;  1WCM G;  4GKJ Q;  1CKM A;  4LFA Q;  4YY3 Q;  1JB7 A;  3M7N A;  4DAY B;  3UE0 A;  1Y14 B;  1YNX A;  4OXP A;  3CCE A;  3OW2 A;  2HHH L;  4B3M L;  1YHQ A;  3M3Y H;  1JT8 A;  2E2H H;  1UE6 A;  3CME A;  3HKZ G;  1HR0 Q;  4B3S Q;  3CCQ A;  3G71 A;  1PH3 A;  2Z0S A;  1BBW A;  4IFD J;  1KXL A;  2JJQ A;  2KHJ A;  4UP9 A;  4JI7 L;  4LFB L;  1I3Q H;  4WJ4 A;  4YCW A;  4A93 H;  1XMO L;  2Z6K A;  4OWW B;  2FXQ A;  1PYB A;  4POG A;  3TS2 A;  5IWA Q;  3H15 A;  1U0L A;  1NMF A;  4HID A;  2L15 A;  2N78 A;  2UXC Q;  2VS1 A;  1PFS A;  2B3G A;  3PUX A;  3WWV A;  3TQY A;  5IP9 G;  3JAM i;  1N32 L;  4KI0 A;  3F2B A;  1OTC A;  2RF4 A;  3AEV A;  3RLO A;  2JEB I;  4AYB G;  2WAQ G;  4GN3 B;  4JBM A;  1VQK A;  2K4K A;  2A1A A;  4X6A H;  3UDG A;  1Y1V H;  5IYB H;  3S16 H;  5LMN Q;  1TXY A;  3VDY A;  3HOX H;  3HOV G;  1EQR A;  4X64 Q;  4JI1 L;  5C44 G;  1DGS A;  5LMU L;  1Q82 C;  4JI4 L;  4LF6 Q;  3M4O H;  3TS0 A;  2LSS A;  4C3H H;  1XPR A;  2HQL A;  3AYH B;  5IP7 H;  1YIT A;  1IBK L;  3GTL H;  2VW9 A;  1HNW Q;  3CP0 A;  1VQC A;  1VQ8 A;  4EQ5 A;  4KHZ A;  2UU9 Q;  2PQA A;  2B63 H;  3I2Z A;  1SFO H;  3M9B A;  4R4I A;  1PH1 A;  1HH2 P;  1E3P A;  3ULJ A;  2PNH A;  2RHQ B;  2D0O A;  2N8N A;  3RZO H;  1MJC A;  4QIW E;  4GOP C;  4O2D A;  4NXM Q;  1VQ5 A;  4P73 A;  2NZO A;  4R4T A;  1IZ6 A;  3F2D A;  4DV2 L;  3RLN A;  1XJV A;  3A5Z B;  4A76 A;  2UUC L;  2UUB Q;  5C4X H;  4JI6 L;  1BVS A;  3CPW A;  1MIU A;  4GLA C;  1X56 A;  4JOI C;  3U4Z A;  2VL6 A;  1QZH A;  1VQ7 A;  1K83 H;  3W1B A;  4JCV E;  3W5O A;  2F4V L;  3S15 H;  3HKS A;  4ME3 A;  4GN5 A;  3G4S A;  1N36 L;  1X3F A;  3MXN B;  1M1K C;  2NN6 G;  1Q1B A;  3ICE A;  2ZM6 L;  4DUY L;  3RLF A;  2JE6 I;  4JV5 Q;  1B7Y B;  1SR3 A;  2E8G A;  2YU9 H;  1K8A C;  1UWV A;  4OO1 G;  3D31 A;  4QJF A;  1L1O C;  2R7Z G;  2MO0 A;  2NN6 I;  1TWC H;  1Y1W G;  4A3C H;  4DNI A;  3T1H Q;  2JA7 H;  2XTI A;  2E5L L;  3KFU A;  1K73 C;  1VCI A;  4YHH L;  4NB3 A;  4A3G G;  3GTM H;  2VZA A;  2E2J H;  2HHH Q;  4OO1 I;  4DR5 L;  2ZTD A;  4B3M Q;  3I4O A;  4DR7 Q;  3H3V I;  4LF5 L;  2ATW A;  1Z9F A;  2F3I A;  2ALY B;  2Q2I A;  4IJH A;  4DV7 L;  4DR1 Q;  4JYA Q;  1WCM H;  4PZ8 A;  3KJO A;  3HKZ E;  1IBL L;  1XPU A;  4UY8 C;  3TRE A;  2R92 H;  1XNR Q;  1VQO A;  2PQA B;  1FJG L;  4LFB Q;  4DV1 Q;  1W3S A;  3I4N G;  1XMO Q;  4DR4 L;  4BA2 I;  4Y52 H;  3AFP A;  3JC6 6;  1KRT A;  3F1Z A;  1Q8K A;  1PYS B;  4BXX G;  1YHB A;  3NEN A;  3J7A 5;  3K81 C;  1YEZ A;  1N9W A;  4A3I G;  2I0Q A;  2R6G A;  3GTO H;  1EOV A;  1PH6 A;  1K0R A;  1FL0 A;  3S1Q H;  4GNX A;  2F52 A;  4L5Q A;  4LUO A;  1HJP A;  4LF8 L;  4IOC A;  1CSQ A;  1C0A A;  1A62 A;  2KCT A;  5ELO A;  4JBW A;  5EAY A;  4B3R Q;  3J81 c;  3S2D H;  1VQ4 A;  3HOZ G;  5E7N A;  3PF4 A;  2GVB A;  1S3O A;  3IRB A;  3UDF A;  5IP9 H;  3G6E A;  3RN5 A;  1UE1 A;  3UDX A;  5LMU Q;  4JI1 Q;  4A3K G;  4B3T Q;  4TQU S;  5C0X G;  4C2M H;  2WB1 E;  1JJC B;  3K80 C;  4RG1 A;  1X6O A;  1PH8 A;  1HR0 W;  3D0F A;  1IBK Q;  1N34 L;  2UXD Q;  3CCL A;  2JQO A;  3AFQ A;  2WP8 J;  4X66 L;  5JEA G;  3HOV H;  2H5X A;  4MZ9 A;  1X3G A;  5C44 H;  3G48 A;  3I7F A; 
#chains in the Genus database with same CATH topology
 3Q24 A;  2AQ1 B;  1EUJ A;  2Y0S G;  1X32 A;  1EZ8 A;  1V1P A;  2D0P A;  1GVP A;  1FYC A;  3H3V C;  2AWN A;  4LF7 Q;  1VF7 A;  1A2U A;  2NVX B;  4DV5 L;  4FXD A;  4DF7 A;  1EIY B;  4RFB A;  3M85 A;  4ZLT F;  2AQ2 B;  3M3Y B;  1EY0 A;  4K0K L;  3KBG A;  2Q8T A;  1QVC A;  1JE4 A;  5J3B A;  2HDM A;  1SMX A;  3I55 A;  2VUM G;  3TP7 A;  1SNC A;  3FKI G;  4PZ6 A;  4QY7 A;  1I3Q B;  2NN6 H;  1FVI A;  4YIJ A;  2E5L Q;  2OT2 A;  5CV5 A;  1W6K A;  4A75 A;  1SE4 A;  4QQB X;  4HTH A;  1Z7T A;  2RVL A;  1XNQ L;  4ME5 A;  4DR2 Q;  1U4L A;  2NVT H;  1NR4 A;  1LM0 A;  4DU9 A;  1Y1V B;  2IHF A;  2L5T A;  1L0Y B;  1B3A A;  1UAP A;  5IY0 A;  4XTC S;  3M4O B;  1B4O A;  4GOP A;  1F2M A;  1Y8P B;  4GS3 A;  2KBN A;  5M3M G;  5DEH A;  2B29 A;  4MIU A;  1JWU D;  3LNN A;  2MFI A;  1J5E L;  1YNJ D;  1CKO A;  4JOI A;  3MEF A;  1PH5 A;  2WIN B;  4HIK A;  1SFO B;  3SEB A;  2LKV A;  3QG1 A;  4IOA A;  4LUV A;  4EGV A;  1KRS A;  4XT3 B;  4KK7 A;  5C4X B;  1SYC A;  5G3L D;  2NZ1 D;  1ROD A;  3DUZ A;  4OX9 L;  3CQZ H;  1HFG A;  5JJK A;  4K5W A;  4K6D A;  4KKT A;  2BE5 C;  5JEA H;  2F0H A;  2JEA I;  3S1N H;  1SYF A;  2YU9 B;  3J80 L;  4C1N I;  4BBR H;  4WFN 3;  2C9O A;  4KKS A;  1TWC B;  4H02 A;  2MGS A;  3A5U A;  3QO2 A;  1H9R A;  4Y7N B;  1PV4 A;  4DAV A;  1LYL A;  1KDC A;  5M3F G;  1TWG B;  2F0J A;  4GN4 B;  1U4P A;  1LT3 D;  2B2U C;  2B2V A;  5E4X A;  1HZA A;  4NXN L;  1U4M A;  1AH9 A;  1B70 B;  4R1J A;  1HZ9 A;  3HKZ B;  4BBS B;  2A19 A;  2F03 A;  3BS1 A;  2G5D A;  3DLL A;  3GTO B;  4IPG A;  1RHP A;  3OTO L;  4RGM A;  3A8J E;  2EZV A;  1L1O B;  1F9S A;  3A74 A;  5A35 A;  3DWP A;  3CXC A;  2VNU D;  1XTD A;  4HED A;  4ID6 A;  4G7O C;  5M5X B;  5JAV A;  1F9P A;  3A7L A;  3SK5 A;  1QJO A;  1S4Z A;  3TRZ A;  1BKB A;  2R93 H;  1AFP A;  1VQN A;  3HOV B;  1VMC A;  4NXM L;  2MO1 A;  4K2K A;  3OYY A;  1G2T A;  5T1I A;  2IWH A;  1CA5 A;  5I2X A;  2YYZ A;  3CU7 A;  4RKL A;  4QB4 A;  1HRJ A;  5HY6 A;  4KJN A;  4A3F G;  3D4D A;  3FP9 A;  1CA6 A;  3U9S A;  2MPM A;  1VQP A;  4BY1 H;  2Z8L A;  4KLK A;  4H0L C;  4X65 Q;  1BOS A;  2XNA C;  2WV6 D;  4CKE A;  4A3M G;  1HQR D;  1I94 Q;  5IT9 L;  4YHH Q;  1QVG A;  4JI3 Q;  2PMZ E;  4WJ3 M;  3SGI A;  3QB3 A;  4DR1 L;  1K0S A;  2CWA A;  2CCZ A;  3VYR A;  1XNR L;  1E2V A;  1YIJ A;  4A3E G;  1IBL Q;  1QCB D;  2R7Z B;  4X62 Q;  3VA5 A;  1Y1W B;  1NBW A;  4F88 A;  3FDT A;  3CC7 A;  3P7J A;  2Z6K C;  2F0N A;  2OTJ A;  1RTO A;  1HUM A;  4B3R L;  2BH8 A;  4C3I H;  5JOB A;  3HOU G;  1WTQ A;  3TBI B;  3QOL A;  4JW0 A;  3CD6 A;  5DNF A;  1G6Z A;  1DON A;  2GN5 A;  2B2W C;  3UDI A;  1B3Q A;  2D2C C;  5D3D A;  4DKA C;  1TWH H;  1PFB A;  2EYO A;  5GAE C;  2Y0S E;  1JE5 A;  1V1O A;  2D62 A;  3ULP A;  4A3K B;  4J15 A;  1SYE A;  3V2T A;  2Q2U A;  5CV9 A;  3ZYY X;  5BR8 Q;  4Q5V A;  1V43 A;  1OXT A;  1ASY A;  2WFW A;  2K5W A;  5C3E B;  1IW7 C;  2WII B;  4BY7 H;  1GHK A;  2Y0S B;  4PG3 A;  4R4O A;  1N33 L;  3GTG B;  3NEM A;  1EY7 A;  3KF8 B;  1HUN A;  5GAG C;  3D8G A;  3HRZ C;  3S2H B;  5CV4 A;  3K57 A;  5COR A;  2BOS A;  3RZD B;  5KEE A;  1UEB A;  2QF7 A;  3NTH A;  3GTJ B;  4IFD G;  1TWF H;  1W6J A;  2HCC A;  4XQN A;  2IX0 A;  5FLX c;  5FJ8 H;  1D7Q A;  1QZG A;  1PFM A;  2WKC A;  1QVF A;  2KCM A;  2NYZ D;  4IFD I;  2VQE Q;  3E5S A;  2VUM B;  2VQF Q;  3TEH B;  3NWS A;  3FKI B;  4IZ8 A;  5FKA C;  1R4P B;  3WOE A;  5EKL A;  3HS0 C;  2F0W A;  2KED A;  3FPU B;  2JP1 A;  2K50 A;  1KC8 C;  1BCP C;  4CGY B;  4OIJ A;  4BA1 I;  3WOF A;  1X54 A;  1E7Z A;  4UPA A;  2Q8I B;  2OQK A;  2DUD A;  1PMR A;  5ELC A;  5M3M B;  4LF4 Q;  3FEW X;  1PH4 A;  2JA7 G;  1D5X C;  1E24 A;  2C35 B;  3I4M H;  3ULL A;  1XMQ L;  1VQH A;  1PTO D;  1HXY D;  3CPF A;  5C5M A;  3NUC A;  1S5E D;  1WCM G;  4GKJ Q;  1JB7 A;  2E76 C;  2XWB B;  1H95 A;  3VYS A;  3CCE A;  3CME A;  4KJO A;  5KIX A;  1QIL A;  1HR0 Q;  3Q6S A;  1BBW A;  1KXL A;  2D9U A;  4JI7 L;  4LFB L;  2EY5 A;  4YCW A;  1K3B C;  4C1N K;  4OWW B;  3LX0 A;  1K8O A;  4POG A;  5IGB A;  1JR0 D;  3H15 A;  1U0L A;  2L15 A;  1ESR A;  3TQY A;  4HAE A;  4JBM A;  5IYB H;  1F77 A;  3QIA A;  5M3F B;  3HOX H;  3S1R B;  2V4D A;  5LMU L;  1DGS A;  4B9W A;  1NR2 A;  3SDZ A;  2BE5 D;  4C3H H;  1QE6 A;  1F9Q A;  5IP7 H;  1YIT A;  3OPO A;  3C3L A;  3P75 A;  2CHB D;  3S9W A;  4QUC A;  2B63 H;  2P5Z X;  3E6Z X;  3IKJ A;  1O7Y A;  1ET9 A;  2D0O A;  2N8N A;  3RZO H;  3GV6 A;  4QIW E;  2FJ2 A;  4G4K A;  1C8C A;  2KHS A;  4NXM Q;  2KEE A;  4IUP A;  2XN9 C;  4A76 A;  1IKL A;  2UUC L;  1DOL A;  1EWC A;  3CPW A;  1MIU A;  4GLA C;  3U4Z A;  2VL6 A;  4K8I A;  1QZH A;  2NUC A;  2F4V L;  3S15 H;  4K14 A;  3OMC A;  2NN6 G;  4R9W A;  2DNC A;  3RLF A;  1B7Y B;  4L6T B;  1ENF A;  4QJF A;  2K01 A;  3GTK B;  4IUN A;  2MO0 A;  2NN6 I;  4A3C H;  4DNI A;  2L4N A;  2E5L L;  3T4A C;  1T5E A;  2VZA A;  2PQE A;  1DJR D;  4B3M Q;  1Z6H A;  4A3F B;  4DR1 Q;  3NBH A;  2JXM B;  2EVB A;  2RSN A;  1HFN A;  4P2C B;  1WTP A;  2R92 H;  1XNR Q;  1VQO A;  1W3S A;  4O1N A;  4A3M B;  4Y52 H;  3JC6 6;  3BDC A;  1N9W A;  4A3I G;  2I0Q A;  1BCP F;  1PH6 A;  1WTW A;  1FL0 A;  5FLX E;  4GNX A;  3I4L A;  4L5Q A;  1HJP A;  4IOC A;  5IIF A;  1CSQ A;  5AFW A;  1LO5 D;  2ICI A;  2WAC A;  1KDB A;  5EAY A;  4A3E B;  4B3R Q;  3J81 c;  4X3T A;  5KYI A;  1PXU A;  1EFI D;  5IP9 H;  1UE1 A;  3UDX A;  4JI1 Q;  4EQN A;  5HUR A;  2F3W A;  3J7A V;  3K7A B;  4RG1 A;  2F0M A;  3I3C A;  5KNB A;  1N34 L;  3MXU A;  5IGD A;  3AFQ A;  4OEL B;  5JEA G;  3HZX A;  5C44 H;  3G48 A;  3IFT A;  4FF4 A;  2A6E C;  3HOU B;  4BBR G;  1SYB A;  1SBB B;  3GTQ B;  3ER0 A;  1G29 1;  1AZP A;  3C46 A;  3S17 B;  1PRT B;  2EJG C;  4YWL A;  4DPG A;  1B53 A;  1VQL A;  2HQE A;  4PMC A;  1AE3 A;  3KF6 B;  2LXJ A;  4L5S A;  4LMQ D;  5KYL A;  5LMN W;  2DJF C;  1EFW A;  2QGQ A;  2KOL A;  3HEJ A;  2EE1 A;  1N33 Q;  2E2H B;  1WOC A;  4R4Q A;  4FF1 A;  1E0B A;  3VYU A;  1H9S B;  5IE8 A;  2ZM6 Q;  1S5B D;  2EYP A;  1WTR A;  2A68 C;  1SRO A;  1MHW C;  1C9O A;  1JOK A;  1SE8 A;  2IL8 A;  4YCU A;  1LAC A;  4FVM A;  1CSP A;  4PMB A;  5IOC A;  3H3V H;  1LTR D;  1A15 A;  1VDZ A;  1TWA H;  1GUO A;  2GA4 B;  5IT9 c;  3CCJ A;  1NJI C;  2N49 A;  3Q8D A;  5CC4 A;  4A3G H;  1K9M C;  2R93 G;  1V1P B;  5GAD C;  1BQQ T;  3DWA A;  3CHB D;  3J80 i;  3FPP A;  4WOR A;  1IW7 D;  1AE2 A;  4YWK A;  3I70 A;  3SXH A;  2EOT A;  3D6C A;  2EPB A;  3T51 B;  4BXX H;  5LHY 1;  3GD7 A;  2F0Q A;  3DM3 A;  3PIO 3;  2EY6 A;  4BY1 G;  3I73 A;  1MGS A;  3HOZ H;  1HZB A;  1MJE A;  2M00 A;  4QCL A;  1K83 B;  4JI0 Q;  1XMQ Q;  3KJP A;  4PV1 C;  1VQA A;  3PIO A;  2IPK D;  4X65 L;  3S1M H;  4YY3 L;  1A63 A;  1I94 L;  1EYA A;  4JI3 L;  5C4Z A;  4DV4 Q;  3BJU A;  3G7L A;  3TN2 A;  1IYV A;  2CVR A;  4B3S L;  2DNE A;  2EIF A;  3OW7 A;  2JA7 B;  3OWE B;  1VQ9 A;  1YJN A;  4DV0 Q;  2E2J B;  4HIM A;  4GOP B;  5IGE A;  4X62 L;  4JI7 Q;  2EY1 A;  1WCM B;  1A3T A;  3K8A A;  4RGT A;  4C3I G;  4ZKB B;  5IWA L;  1RDP D;  3E0E A;  3H09 A;  3J81 j;  2OQ0 A;  5IGG A;  3J80 E;  5FLM H;  4KN7 C;  1U5K A;  1DOK A;  5EBD A;  4FYD A;  3L2P A;  1AZQ A;  1G6P A;  4N8F A;  2J4X A;  3O13 A;  2IW3 A;  2IJ0 A;  4PNY A;  3S2D B;  4B08 A;  2NTT A;  5JJL A;  2XSC A;  1D6E C;  1SYG A;  3D6W A;  4JI8 Q;  1I6V C;  5GRO A;  1GUS A;  4IPD A;  3ZJY C;  5IYD H;  1X9N A;  1CKN A;  3E3X A;  2MQH A;  1EQQ A;  1STE A;  3CW2 C;  3LWU A;  3E9H A;  3S24 A;  2QCP X;  1I50 H;  3J7A F;  4BY7 G;  5BR8 L;  2YTY A;  4QGU A;  4UP8 A;  4H44 C;  4LUZ A;  2UUC Q;  1EOT A;  4OWT B;  3VR4 A;  4GZY C;  3KLR A;  4XYQ A;  1D1K A;  2F4V Q;  5LL6 S;  2EQS A;  1J6Q A;  4XT1 B;  4JV5 L;  1KL9 A;  3STB D;  1M8A A;  3PUW A;  2RCN A;  3OSO A;  4OON A;  2HDL A;  1V8Q A;  2FHT A;  5M9O A;  5FJ8 G;  4HSV A;  4A93 B;  4MTN A;  3T16 A;  5ELN A;  1DYQ A;  5GQO A;  1D8L A;  3FRP B;  1SDF A;  3VR5 A;  4AH6 A;  1BXT A;  1JC7 A;  1PTO C;  2VQE L;  2VQF L;  5ISR A;  2V1C C;  1BO0 A;  4HJ5 A;  3S16 B;  1MKH A;  1RKN A;  4ZAI A;  2BDO A;  1Y8O B;  2QEX A;  1F2Y A;  3EA6 A;  2NVT B;  3TP8 A;  3MXN A;  2DY8 A;  4QUF A;  3NTK A;  5C0X J;  3HOW H;  2Q2T A;  1TII D;  4DR3 Q;  2NVQ H;  1P16 A;  5IT9 E;  2ZXP A;  4JI2 Q;  4DFA A;  4RKB A;  1EY5 A;  3J7Z C;  4B9X A;  4APV A;  3K0X A;  2ZTE A;  4A3I H;  2WB1 G;  3I4M G;  2B2Y C;  2NTS A;  2YTX A;  2DJG C;  1J9O A;  1QNU A;  2B8F A;  3OOC A;  3C2P A;  1B50 A;  4LF4 L;  1TR5 A;  2JA6 H;  2F0O A;  2ZXR A;  2F3V A;  4JI5 Q;  4ZKC B;  1N34 Q;  2JA5 H;  2SEB D;  4PMW A;  3CMA A;  5I9O A;  3SK8 A;  4BWG B;  2ZJQ A;  4GKJ L;  1VS0 A;  3CQZ B;  2CQO A;  1HR0 L;  1PLF A;  1UNS A;  2YTV A;  4IJL A;  3S1N B;  1V1Q A;  4KY5 A;  1AEX A;  2MJ8 A;  1ESF A;  2B2U A;  1FD7 D;  2IX1 A;  4KHP Q;  2L9H A;  1KLG D;  2XIW A;  1WTV A;  4L63 B;  3PMF A;  1Q3L A;  1YNN C;  1L2F A;  2LFN A;  3MZ5 A;  4EVO A;  5HGQ A;  3DEO A;  1EWH A;  2ASB A;  3S14 H;  2I5H A;  3OIP A;  3PO3 H;  3VR3 A;  3L9A X;  5IYB G;  2I07 B;  1EYG A;  3CC2 A;  4HN7 A;  3HOX G;  1PH2 A;  1JOQ A;  1STH A;  3VR6 A;  3KDF A;  3J81 L;  1WI5 A;  3A0J A;  1X3Q A;  3A8K E;  1A3V A;  2EJM A;  4C3H G;  4Y7N H;  2R61 A;  5IP7 G;  5KGU A;  2QDB A;  4RGO S;  2A6E D;  3EQL C;  1TWG H;  4XQQ A;  2B63 G;  1M90 C;  3K0Y A;  5CV7 A;  4BBS H;  1U9R A;  2L55 A;  4HIO A;  3CF5 A;  3NPP A;  4CHT B;  3PUZ A;  1O7Z A;  1PHJ A;  1Q7Y C;  1EY8 A;  1VQF A;  1MI2 A;  1I6H H;  4A3J H;  4J8Q A;  4F87 A;  2O2L D;  3HOY H;  5DAU A;  1SN8 A;  2A69 C;  3SK6 A;  2R93 B;  2YV5 A;  4FDB A;  5M5X H;  2KEN A;  4ODG A;  2A68 D;  3D4W A;  1QG7 A;  2XGT A;  1YJW A;  4NPS A;  1PH9 A;  2JYO A;  1C48 A;  4A3C G;  3H6M A;  1T9H A;  1F9R A;  1Y8N B;  2EYM A;  3HGB A;  2OCE A;  4FP5 D;  3K6O A;  3H91 A;  3EFX D;  1VQE A;  4LFA Q;  4YY3 Q;  4BY1 B;  1SNM A;  2R92 G;  1PTO F;  1YNX A;  3UE0 A;  1TQO A;  1O80 A;  1YHQ A;  4B3M L;  4F7X A;  4NP5 A;  5KND A;  1D2B A;  1LTS D;  4B3S Q;  5FO8 B;  2G9H D;  4IUU A;  4K5X A;  3K5L A;  4IFD J;  3DEP A;  2JJQ A;  1MSG A;  1EQV A;  4ZUI A;  2Z6K A;  2EYL A;  2PMZ B;  4K8J A;  5IWA Q;  4CKB A;  2PZT A;  4ZCK A;  1STN A;  1QOH A;  1TVX A;  2B3G A;  3WWV A;  5IP9 G;  3F2B A;  1OTC A;  1ILP A;  3AEV A;  4F8M A;  4E6I A;  4AYB G;  2WAQ G;  3BVM A;  4GN3 B;  4KY6 A;  2B2W A;  3HG9 A;  4X6A H;  4RHR A;  5LMN Q;  1LTA D;  3I90 A;  4X64 Q;  4JI1 L;  5C44 G;  2MUY A;  4JI4 L;  1BBX C;  3GV3 A;  2HQL A;  2PCF B;  3GTL H;  4U67 3;  3CP0 A;  4RCO A;  2K28 A;  1LTI D;  1VQ8 A;  3HP3 A;  4KHZ A;  3C1F A;  3I2Z A;  4O42 A;  3M9B A;  3T53 B;  4EQP A;  1HH2 P;  1E3P A;  3ULJ A;  2PNH A;  1TWH B;  4O2D A;  2B2T C;  1SMY C;  1XJV A;  1G8Z D;  1H9K A;  5I2Y A;  1ZYR C;  1LTT D;  1EU3 A;  1TY0 A;  1PDQ A;  1X3P A;  4GN5 A;  1N36 L;  4K6L A;  1GUT A;  2F0D A;  4CJ2 C;  5A2Q E;  4G7Z C;  2JSO A;  3E0J A;  2ZM6 L;  4DUY L;  4JV5 Q;  1SR3 A;  4G7H C;  4BY7 B;  1K8A C;  3X3N A;  2K5Q A;  3MAQ A;  1L1O C;  1XXG A;  5I6W A;  5IGF A;  1PFN A;  1K73 C;  3MFY A;  4N9P A;  3VA7 A;  1PRT D;  3GTM H;  4A3G G;  5CR3 A;  3GTP B;  3I4O A;  3H3V I;  4LF5 L;  2Z4H A;  2ALY B;  4IJH A;  3T13 A;  5CMD A;  1XPU A;  4UY8 C;  1Q90 A;  3OWF A;  1UUP A;  3SHL A;  4DR4 L;  1LTB D;  1WTX A;  1KRT A;  1WVL A;  1Q8K A;  4BXX G;  2RCF A;  1ZKO A;  3NEN A;  3K81 C;  3J7A 5;  2FFK B;  1YEZ A;  2R6G A;  1JOO A;  1K0R A;  3QWN A;  1R4Q B;  2I46 A;  4CBV A;  4KD4 A;  2A5H A;  1C0A A;  1JCK B;  3K5O A;  3HOZ G;  1ENA A;  1WD0 A;  2GVB A;  4FF3 A;  1I4P A;  3IRB A;  3UDF A;  3RN5 A;  1KAA A;  3NWT A;  1JWM D;  1TKW B;  4C2M H;  4IUQ A;  2WB1 E;  3FVQ A;  1PH8 A;  1X6O A;  2M2L A;  3D0F A;  4HCS A;  4FXG C;  3R93 A;  2JQO A;  2WP8 J;  2H5X A;  4MZ9 A;  1X3G A;  4JI0 L;  2F0P A;  2HT1 A;  2F0K A;  1VQM A;  2WB1 B;  3I4M B;  3FHW A;  2RKS A;  5GAH C;  2BH2 A;  3PV0 A;  3U9O A;  1JQY D;  3NBH B;  2F0T A;  4IUR A;  4DXF A;  2IX3 A;  4DV4 L;  5TSS A;  4RGN A;  1O78 A;  3NBI A;  4L5R C;  2OF1 A;  3R8B A;  4BS9 A;  3L7Z C;  4DV0 L;  5EKK A;  3NXW A;  1YZ6 A;  3L3O C;  3MEH A;  1DOM A;  5FLM G;  4GNX B;  1ICF B;  3MXP A;  4GLV B;  1EYD A;  2G9D A;  5C4H A;  1CI3 M;  2SDF A;  1LT5 D;  1RF2 D;  3A7A B;  5C4J H;  2PYK A;  2A6H C;  4TSS A;  4RHS A;  3DWQ A;  1LT6 D;  4DR5 Q;  2ID0 A;  5CBE E;  3T1Y L;  3STB C;  4DV6 L;  3I56 A;  1STB A;  5IYD G;  2E2D C;  2Z6B A;  2XWJ B;  4JI8 L;  3HOX B;  3TP5 A;  2NVY H;  1QUQ B;  2K5H A;  2RDF A;  3RMH A;  3KLW A;  4LNQ A;  2D5D A;  5A2Q L;  1BNZ A;  4C3H B;  2CW0 D;  1IYU A;  4UHV A;  3I4N H;  3I8Z A;  5JEA J;  1YNN D;  4OL7 A;  2B63 B;  2PZW A;  1G2S A;  3RZO B;  3T56 B;  1WYD A;  2F0S A;  3IAY A;  1SE3 A;  4RA8 A;  4QIW B;  3BG3 A;  3H94 A;  1YI2 A;  1IL2 A;  3M4P A;  4DAM A;  5C0X H;  4HJ8 A;  5T1G A;  1MBY A;  1XYI A;  3GDE A;  3S15 B;  2XRS D;  4C3J H;  2K14 A;  2SNM A;  2O5J C;  4DA2 A;  1VF5 C;  2AHO B;  4JG2 A;  2K5N A;  5J22 A;  4IUV A;  4ZRZ A;  4LJZ C;  4MTK A;  1VQD A;  2NZH A;  3IFD A;  4KY7 A;  5FK9 C;  2SOB A;  3JAM c;  1BBU A;  1E22 A;  2ENB A;  3HOW G;  1Q12 A;  2K03 A;  1V9P A;  2GVA A;  4IPH A;  3PUV A;  2A8V A;  2A69 D;  3TZU A;  2AWO A;  4MNO A;  3EJI A;  1OO9 B;  1S72 A;  3B6Y A;  2JA9 A;  5EPK A;  3W2D A;  4C56 C;  4DR3 L;  5ELF A;  4JI2 L;  5E4W C;  5L37 A;  5COY A;  1NNX A;  1NE3 A;  3PGZ A;  4AQY Q;  2QKI C;  5M5W H;  4A3L H;  2JA6 G;  3MWY W;  4AYB E;  2WAQ E;  2IT1 A;  2Q8R E;  1CHP D;  3M4Q A;  1GUG A;  2JA5 G;  4JI4 Q;  1C4Q A;  1B2T A;  2BA1 A;  3K58 A;  2NB0 A;  1D1I A;  3DXJ C;  3F2U A;  4JI5 L;  1IXR A;  1SJH D;  2CH4 W;  1B1Z A;  1LUZ A;  4AYB B;  2WAQ B;  1XTC D;  4IQZ A;  2HIX A;  5K36 H;  4P72 A;  1LAB A;  1SYD A;  4ABN A;  2AUK A;  5BN4 A;  3CCR A;  5C44 B;  4KKU A;  4ZK9 B;  4GNX C;  1EIF A;  1QB5 D;  4DUZ Q;  1FNV A;  4I65 A;  2JA8 H;  3NE5 B;  3ND8 A;  1S5C D;  3PO3 G;  4KHP L;  2NWG A;  3H0G H;  1N36 Q;  4JPB W;  1TS3 A;  2RDG A;  3J7Y W;  5FOB B;  4DUY Q;  2EYH A;  2L11 A;  1ZXT A;  4A3D H;  5J39 A;  3S17 H;  3R3O A;  4WJW A;  4YCV A;  3EIV A;  3W1G A;  2RHS B;  5I4D A;  3T1H L;  2K6A A;  2RBM A;  3K5N A;  5JVH 3;  2LXK A;  3IL8 A;  1SND A;  1HTP A;  4HJ7 A;  4DR7 L;  5I9P A;  1QWY A;  1JWS D;  4A3B H;  4BBS G;  1YHA A;  1I4R A;  4JYA L;  4LF5 Q;  2E74 C;  3MXG A;  3UE1 A;  4DK6 C;  1X55 A;  1HQM C;  4A3J G;  3MHB A;  1CKN B;  2HD3 A;  1FR3 A;  4CDE C;  1SMY D;  5EQ0 A;  2FMM A;  3HOY G;  1ZYR D;  1HTL D;  5E1F A;  2E75 C;  4DR4 Q;  4A3G B;  3MFG A;  4HJ9 A;  3KYH C;  4NDX A;  5DM6 3;  1DCZ A;  1NTG A;  4H13 C;  1ET6 A;  2R7D A;  1LTG D;  5IYC H;  2K5V A;  4OWX B;  1R9T H;  3DM1 A;  3C1E A;  1OXV A;  2QA4 A;  4FXK C;  3DHQ A;  1BR9 A;  1RIP A;  4B3T L;  1WFQ A;  5CV8 A;  3PO2 H;  1KHI A;  4MN3 A;  4DK1 A;  1NAP A;  1MD2 D;  1CM9 A;  4CDF C;  5JPM C;  1PTO H;  1STY A;  3MA2 B;  1A3U A;  3J81 i;  1GHJ A;  1EEF D;  1IKM A;  1IL8 A;  3HOZ B;  1VQI A;  1C7Y A;  1XPO A;  2ZJP A;  3PSI A;  4LFA L;  4H7B A;  3X3M A;  2EXD A;  4L8J A;  2O5I C;  1O7I A;  1I5F A;  1H9J A;  3PUY A;  3S1M B;  2DGY A;  4LF9 L;  5AJ3 Q;  1HA5 A;  1I4H A;  3SR1 A;  1PA6 A;  3MTS A;  5DM7 3;  1YVC A;  1SSO A;  4X3K A;  5M5Y H;  4P74 A;  1Q86 C;  4KD3 A;  3RR5 A;  4KMU C;  3F2C A;  4JVZ A;  2ZTC A;  1NMG A;  4DV3 Q;  3L0O A;  4N8X 1;  1KDA A;  3TZD A;  4RCN A;  2Z4I A;  4LW1 A;  5LMN L;  3S1Q B;  1KQS A;  2CFM A;  3T1Y Q;  1IBM L;  4L5T A;  4X64 L;  4DV6 Q;  4DAY A;  1EZ6 A;  1A0I A;  1EU4 A;  3EBE A;  4CDD C;  4KTA A;  3KF6 A;  4R4C A;  1SRU A;  4CJ1 B;  1HNX Q;  4U68 A;  4OEM B;  1PRT C;  5BN5 A;  2JK8 A;  2AKW B;  4IAL A;  4HMI A;  1H9S A;  1LT4 D;  3J81 E;  2HCI A;  3D4R A;  4ZUJ A;  1L0W A;  4GKK Q;  2UXB L;  1VQG A;  3PIP 3;  2ZJR A;  3A54 A;  4X3U A;  1GXD C;  1BDO A;  1KD1 C;  4OHJ A;  1II3 A;  1VQB A;  1PZJ D;  2E2I H;  1Q81 C;  2I5M X;  5KRU A;  1I50 B;  3PIP A;  2A6H D;  2L0C A;  4HR7 B;  4V19 0;  1ASZ A;  2UUA L;  2F0V A;  1AW7 A;  3N6R A;  1EWI A;  1O7L A;  3KDF B;  2X69 A;  3ERQ A;  1TS5 A;  5K5P A;  1K3R A;  4DK3 C;  4DK0 A;  4ALP A;  2NVX H;  2HUG A;  5EJW A;  3M7G A;  1CKM A;  2TMP A;  3M7N A;  2RDH A;  1GUW A;  1Y14 B;  4OXP A;  3OW2 A;  3M3Y H;  1UE6 A;  5FO9 B;  1GJX A;  2EJF C;  1BF4 A;  4HSP A;  3G71 A;  1PH3 A;  1FGB D;  1SJE D;  2OXP A;  1I3Q H;  4WJ4 A;  4ULL A;  4A93 H;  4K5V A;  2FXQ A;  5KNC A;  2KQ3 A;  3ITP A;  2KCC A;  4HCE A;  3BYT B;  4HID A;  2N78 A;  3GP7 A;  2UXC Q;  2VS1 A;  1PFS A;  3PUX A;  1N32 L;  3RUZ A;  2RF4 A;  2B2Y A;  4XQJ A;  2K05 A;  2A1A A;  3HOW B;  3UDG A;  1Y1V H;  3S16 H;  3KUP A;  1TXY A;  2NVQ B;  2EYJ A;  1EYC A;  2B39 A;  1EQR A;  3M4O H;  1NUC A;  3TS0 A;  1XPR A;  3AYH B;  3EVQ A;  5C3X A;  3KK7 A;  4A3I B;  2VW9 A;  2KJX A;  1VQC A;  4EQ5 A;  2EXZ A;  2PQA A;  2VB2 X;  1SFO H;  4R4I A;  1PH1 A;  5D65 A;  2JA6 B;  2RHQ B;  3I91 A;  1MJC A;  2SNS A;  4GOP C;  1GUN A;  2BDN A;  4M1U B;  2JA5 B;  2O4X A;  1IZ6 A;  2VXW A;  4DV2 L;  3TSS A;  3RLN A;  4JI6 L;  5C4X H;  1BVS A;  3JAM L;  1EQT A;  1X56 A;  4JOI C;  3MVV A;  1VQ7 A;  4XXE A;  2CW0 C;  1PZI D;  2H1E A;  4ME3 A;  4BBR B;  4HMJ A;  3DMU A;  4M8A A;  1Q1B A;  3W3A A;  3ICE A;  2JE6 I;  2JN4 A;  2E8G A;  3SVM A;  2YU9 H;  1UWV A;  3D31 A;  3BVZ A;  4R8I A;  3NQI A;  1TWC H;  3T1H Q;  3KFU A;  3BYY B;  2QIL A;  2RA4 A;  3S14 B;  1VCI A;  4NB3 A;  5JPN C;  3PO3 B;  2HHH Q;  2F0L A;  4DR5 L;  2ZTD A;  4DR7 Q;  1EY6 A;  2ATW A;  2F3I A;  5C5L A;  2Q2I A;  4JYA Q;  2L12 A;  4KHV A;  3KJO A;  3HKZ E;  1PRT F;  4ILW A;  3TDQ A;  1FJG L;  3I4N G;  1XMO Q;  4NMZ A;  4DNT B;  1PYS B;  1YHB A;  3BVG A;  3GTO H;  1EOV A;  2A73 B;  2B2V C;  2F52 A;  1A62 A;  2KCT A;  5D3I B;  2BCO A;  1I6H B;  1VQ4 A;  4A3J B;  1S3O A;  2PW7 A;  3G6E A;  1WD1 A;  3HOY B;  3K5M A;  4B3T Q;  5C0X G;  2J0T D;  1B9M A;  1JJC B;  3K80 C;  4C3J G;  2K32 A;  2ICE C;  3QJY A;  2FIN B;  1IBK Q;  1EEI D;  1TS4 A;  3HOV H;  3M4Y A;  2MP1 A;  5C0X I;  2MNA A;  1PZK D;  5D14 A;  3PCO B;  1ILQ A;  4S3S A;  3WDN A;  1G91 A;  3FMC A;  2K52 A;  3KBX A;  1JB3 A;  1VMP A;  5BN3 A;  1JJG A;  3P1H A;  2KCN A;  1CTM A;  1YJ9 A;  1RJT A;  2K5D A;  1E1T A;  1PH7 A;  2AMC B;  3Q23 A;  1VQJ A;  1CK1 A;  4RH6 A;  4LF9 Q;  1A8V A;  1LV9 A;  5IGC A;  1I4X A;  2K33 A;  1HZC A;  1BCP B;  2IY5 B;  3AU7 A;  1D5Z C;  2F0E A;  5CBA E;  4A3L G;  4CDC C;  4DR6 L;  1HNZ L;  3N52 A;  1CZW A;  5NUC A;  2KA7 A;  3PQI A;  4AQY L;  2H4O A;  4OO1 H;  4KN4 C;  2CWP A;  2N88 A;  5J1Z A;  2R7Z H;  4DN4 M;  1Y1W H;  4RMF A;  4DV7 Q;  1IBM Q;  4R8N A;  3A56 A;  2EDG A;  4QL5 A;  1KNA A;  4C3I B;  1TY2 A;  1SNP A;  2QW7 A;  4LAA A;  3BZK A;  5K36 G;  4PQX A;  3A55 A;  1FGU A;  1I4Q A;  1IYJ B;  4Z9C B;  2CQA A;  2PI2 E;  2B2T A;  4IO9 A;  4DGZ A;  3GTL B;  2N55 A;  2PZU A;  3AQQ A;  1S5D D;  2JA8 G;  2UXB Q;  1N8R C;  3ERS X;  4LF8 Q;  5CYU A;  5F2D A;  1EIH A;  3H0G G;  1KNE A;  4ZYS A;  2F0I A;  1CQV A;  1PVO A;  4DUZ L;  4A3D G;  4LFC L;  1YBY A;  3OIQ A;  3CCU A;  3G6J B;  1A2T A;  1L1O A;  4X66 Q;  2UUA Q;  1P8L A;  4ZQ3 A;  5LL6 X;  2QEJ C;  4JK1 C;  4A3K H;  5JJI A;  4P71 A;  1L0X B;  3ONA B;  3K59 A;  4A3B G;  4NKL A;  3OMG A;  1KAW A;  4LK1 C;  2XRQ D;  5C3E H;  3GTG H;  4FO2 A;  4DV5 Q;  3ERO A;  4MHE A;  3S2H H;  3GTM B;  1TWF B;  2PNR C;  1DZ1 A;  5JJZ A;  3CCS A;  2Q2H A;  1SE2 A;  4K0K Q;  3RZD H;  4NW2 A;  1S5F D;  4RWS C;  3GTJ H;  5IYC G;  3F8T A;  1F2L A;  2F0F A;  3GTP H;  3NQT A;  1A6X A;  4PZ7 A;  1Q8I A;  3CRL C;  1N32 Q;  2KVM A;  3PO2 G;  3CCM A;  4IPC A;  1ICW A;  2VUM H;  1STG A;  3VYT A;  4OIK A;  1JMC A;  3FKI H;  2KEC A;  4YWM A;  2VY3 A;  3PF5 A;  4LF6 L;  1XNQ Q;  2F1M A;  2K04 A;  1M4V A;  1RTN A;  3NP8 A;  3RN2 A;  5IOD A;  3HFZ B;  1SAP A;  1STA A;  2I5L X;  1KLU D;  1HNW L;  3UI2 A;  3RNU A;  2K7V A;  1B9N A;  2UU9 L;  4C2M B;  1NY4 A;  1EL0 A;  1F2Z A;  2IHE A;  3OHX C;  2ZXO A;  1OXS C;  1SNO A;  2C5C A;  2X6L A;  1BUV T;  1J5E Q;  1WTO A;  1JJ2 A;  4CKC A;  2UUB L;  5M3M H;  4DV2 Q;  2OWO A;  1E2W A;  2OTL A;  4JI6 Q;  1SXT A;  4DAP A;  1B44 D;  2KUM A;  5AJ3 L;  2RSO A;  3TP6 A;  1G51 A;  3ND9 A;  1FNU A;  2PI2 A;  4UAI A;  4OX9 Q;  4KV6 A;  5CGK A;  1MSH A;  3A8I E;  3AB9 A;  1D5M C;  2M9V A;  1CUK A;  4DV3 L;  1LTL A;  4JBK A;  2RQX A;  1XX8 A;  1K8M A;  1T5X D;  4UP7 A;  5C4J B;  1IHZ A;  3TME A;  5JVG 3;  3LGJ A;  1EIG A;  5CV6 A;  4DV1 L;  1E1O A;  1H9M A;  1HNX L;  1FJG Q;  3U58 A;  2J7Z A;  4EX5 A;  1GM5 A;  3KF8 A;  4NXN Q;  4GKK L;  4TVA B;  1CFM A;  5M3F H;  1LLR D;  1CQF A;  2NVY B;  1U4R A;  3S1R H;  2CKZ B;  4I7A A;  2PPB C;  3OTO Q;  3KLS X;  2N3S A;  3I4N B;  3NSW A;  1UE7 A;  1GO3 E;  4AIM A;  2UXD L;  5I6Y A;  4A4I A;  4JBJ A;  3CC4 A;  4JC0 A;  2K1B A;  5EKI A;  1KIX A;  1EY4 A;  1X3E A;  4LF7 L;  4LWC A;  1UE5 A;  4C3J B;  1TS2 A;  4A93 G;  3R2I A;  1NSN S;  1Q1E A;  2AQ3 B;  2R7F A;  4GLX A;  3EN2 A;  1SNQ A;  4J6H A;  1YNJ C;  3GTK H;  3E9I A;  3CRK C;  3URY A;  3D3R A;  1DM0 B;  2EYF A;  3V96 A;  4P75 A;  2OEO A;  3NHH A;  5DLQ E;  1VQ6 A;  3VR2 A;  1Y1V G;  2UXC L;  2R92 B;  5H1S E;  1B8A A;  4A3F H;  4DR6 Q;  3U4V A;  1HNZ Q;  1K8G A;  3NEL A;  1HHV A;  3GQB A;  3BU2 A;  2TSS A;  1RD9 D;  1JIC A;  3K7U C;  4POF A;  2ES2 A;  3QOJ A;  3J80 c;  3U50 C;  4A3M H;  4DR2 L;  4TRD A;  1TU2 B;  3GO5 A;  5ELD A;  1GD7 A;  3P20 A;  1DXM A;  2QDL A;  5M5W B;  1OXU A;  1Z47 A;  2Z9H A;  4QF4 A;  1S40 A;  4XIG S;  1KAB A;  2PW5 A;  2XVS A;  3KOJ A;  4A3E H;  5C6A A;  5C4X G;  4HJA A;  4V0B A;  2HIV A;  3QR8 A;  1UEA B;  5EPJ A;  3CCV A;  2LS0 1;  1OXX K;  1RCV D;  3K7A H;  1W2B A;  1ONL A;  3SE0 A;  4O0A A;  2K75 A;  2KHI A;  4IN3 A;  3BZC A;  3HOU H;  2F0G A;  4LFC Q;  1Q46 A;  1WJJ A;  4TKO B;  2JA8 B;  3GTQ H;  3BDL A;  3NTI A;  3MC0 B;  3H0G B;  4WRD A;  1RL2 A;  1GKH A;  1ENC A;  1QUQ A;  2BA0 A;  3V05 A;  1SLJ A;  1X65 A;  3CAM A;  4A3D B;  4XDX A;  4DAY B;  3LWE A;  1I4G A;  4XYO A;  4CJ0 B;  2HHH L;  1JT8 A;  2E2H H;  3HKZ G;  1FNW A;  3CCQ A;  5HGT A;  4DXG A;  2Z0S A;  3KLS A;  3BZD B;  2KHJ A;  4UDU C;  4A3B B;  4G57 A;  1XMO L;  1HCZ A;  1TWA B;  1PYB A;  3R2T A;  1GOZ A;  2F4I A;  2R3Z A;  3TS2 A;  2WKD A;  1NMF A;  1KTK A;  3JAM i;  4KI0 A;  2FMC A;  2Z1C A;  3RLO A;  2JEB I;  1VQK A;  2K4K A;  4N9T A;  1J8I A;  1NCV A;  3VDY A;  1TT2 A;  3HOV G;  2X6G A;  1Q82 C;  4LF6 Q;  4IFD H;  2LSS A;  1CZG A;  1R9T B;  1IBK L;  2NBF A;  1HNW Q;  3PO2 B;  4K2L A;  5C3W A;  2UU9 Q;  1DD2 A;  1PTO B;  1AN8 A;  3Q0A A;  4QMG A;  2CH4 A;  4P73 A;  2NZO A;  4R4T A;  1VQ5 A;  1E2Z A;  3F2D A;  1Y69 U;  3A5Z B;  2UUB Q;  3Q22 A;  2MHV A;  2ZT9 C;  1K83 H;  1EY9 A;  3W1B A;  4JCV E;  3W5O A;  1HPC A;  3HKS A;  3G4S A;  1M1K C;  1X3F A;  3MXN B;  3CKI B;  5EGT A;  2DN8 A;  3NK9 A;  4J1M A;  2VB3 X;  4OO1 G;  5G3L F;  2A74 C;  2R7Z G;  4RAU C;  1Y1W G;  1ML0 D;  1CHQ D;  2JA7 H;  2XTI A;  4YHH L;  5FLX L;  5M5Y B;  1HA6 A;  3JAM E;  4IUT A;  2E2J H;  4OO1 I;  4Q0F A;  5ELE A;  2LMC B;  2EY2 A;  1Z9F A;  4DV7 L;  1WCM H;  4PZ8 A;  1K28 A;  1IBL L;  3TRE A;  2DY7 A;  1BCP D;  2PQA B;  4LFB Q;  4DV1 Q;  2LY7 A;  4BA2 I;  3AFP A;  1AP0 A;  3F1Z A;  4EQO A;  5EBC A;  4OGQ C;  2L1B A;  2PO4 A;  3S1Q H;  4FF2 A;  1CT1 D;  4FNF A;  4LUO A;  3SK4 A;  4LF8 L;  5ELO A;  4DNR B;  3AMU A;  1PYW D;  4JBW A;  4X3S A;  3S2D H;  2B8G A;  1ZEQ X;  5E7N A;  5ELB A;  1XWE A;  3PF4 A;  3RD4 A;  1SEB D;  2F0U A;  3I72 A;  3BDO A;  2AUJ D;  5EPL A;  5FO7 B;  5LMU Q;  4A3K G;  4TQU S;  1QNK A;  5E3F A;  4I7Z C;  1WTH A;  1HR0 W;  1JOR A;  2E2I B;  2UXD Q;  3CCL A;  4X66 L;  4UP9 A;  5C3E G;  3I7F A; 
#chains in the Genus database with same CATH homology
 5C0X I;  2Y0S G;  1EUJ A;  4BBR G;  2MNA A;  2HT1 A;  3PCO B;  2D0P A;  1VQM A;  1GVP A;  3ER0 A;  1G29 1;  3FHW A;  5GAH C;  2BH2 A;  2K52 A;  2AWN A;  1JJG A;  3PV0 A;  4DV4 L;  3NBH B;  4LF7 Q;  1YJ9 A;  5JJI A;  4DV5 L;  4YWL A;  4DPG A;  1E1T A;  1PH7 A;  1VQL A;  1EIY B;  2AMC B;  1VQJ A;  4L5R C;  1AE3 A;  3KF6 B;  2LXJ A;  3L7Z C;  4L5S A;  4LF9 Q;  3M85 A;  5LMN W;  4DV0 L;  1EFW A;  1A8V A;  2QGQ A;  1N33 Q;  4K0K L;  1WOC A;  4R4Q A;  1YZ6 A;  1HZC A;  1QVC A;  5IE8 A;  5J3B A;  2ZM6 Q;  5FLM G;  4GNX B;  2IY5 B;  1SMX A;  3I55 A;  2VUM G;  4GLV B;  3FKI G;  4PZ6 A;  4QY7 A;  4A3L G;  4DR6 L;  1SRO A;  1H95 A;  1C9O A;  1HNZ L;  5C4J H;  1SE8 A;  1FVI A;  2E5L Q;  4YCU A;  1CSP A;  4AQY L;  4A75 A;  4DR5 Q;  2ID0 A;  3H3V H;  3T1Y L;  2CWP A;  3STB C;  2R7Z H;  1TWA H;  4DV6 L;  1Y1W H;  5IT9 c;  3CCJ A;  4QQB X;  4RMF A;  4DV7 Q;  1NJI C;  1XNQ L;  4DR2 Q;  1IBM Q;  2N49 A;  3Q8D A;  3I56 A;  4QL5 A;  2NVT H;  5IYD G;  4A3G H;  1LM0 A;  2IHF A;  3BZK A;  1K9M C;  4JI8 L;  2R93 G;  5K36 G;  5GAD C;  2NVY H;  5IY0 A;  4XTC S;  1QUQ B;  2K5H A;  1FGU A;  3KLW A;  3J80 i;  5M3M G;  1IYJ B;  4GS3 A;  2KBN A;  4GOP A;  4LNQ A;  2PI2 E;  2B29 A;  4IO9 A;  1AE2 A;  4YWK A;  3AQQ A;  2JA8 G;  3I4N H;  2UXB Q;  1N8R C;  2MFI A;  3ERS X;  1J5E L;  5JEA J;  4LF8 Q;  1CKO A;  4JOI A;  4BXX H;  3H0G G;  3GD7 A;  3MEF A;  1PH5 A;  4HIK A;  1PVO A;  4DUZ L;  1WYD A;  3DM3 A;  4IOA A;  4LUV A;  4BY1 G;  4A3D G;  1KRS A;  4LFC L;  1YBY A;  3CCU A;  3HOZ H;  1L1O A;  4X66 Q;  1HZB A;  1P8L A;  1MJE A;  2UUA Q;  1YI2 A;  4OX9 L;  1IL2 A;  4A3K H;  4JI0 Q;  4P71 A;  3M4P A;  4DAM A;  3CQZ H;  3KJP A;  4HJ8 A;  1XMQ Q;  5JJK A;  1VQA A;  3GDE A;  3PIO A;  4C3J H;  4A3B G;  2K14 A;  4X65 L;  3S1M H;  1KAW A;  4YY3 L;  2AHO B;  1A63 A;  1I94 L;  4JG2 A;  2JEA I;  2K5N A;  3S1N H;  5C3E H;  4JI3 L;  4DV4 Q;  3BJU A;  4BBR H;  3GTG H;  4DV5 Q;  4B3S L;  2EIF A;  1VQD A;  2NZH A;  4H02 A;  3A5U A;  1VQ9 A;  2R92 G;  3S2H H;  1YJN A;  3JAM c;  1BBU A;  4DV0 Q;  1E22 A;  4HIM A;  3HOW G;  1Q12 A;  1V9P A;  2GVA A;  4GOP B;  4IPH A;  1PV4 A;  4X62 L;  1LYL A;  2Q2H A;  3CCS A;  4JI7 Q;  4K0K Q;  3PUV A;  5M3F G;  3RZD H;  2A8V A;  2AWO A;  4GN4 B;  4MNO A;  3GTJ H;  3K8A A;  5IWA L;  5IYC G;  3F8T A;  1HZA A;  3E0E A;  1S72 A;  3J81 j;  3B6Y A;  4NXN L;  3GTP H;  2JA9 A;  1AH9 A;  1B70 B;  4PZ7 A;  4R1J A;  1HZ9 A;  2OQ0 A;  4DR3 L;  4JI2 L;  1N32 Q;  2A19 A;  5FLM H;  3PO2 G;  3CCM A;  4IPC A;  1U5K A;  3DLL A;  1NE3 A;  2VUM H;  3PGZ A;  3L2P A;  4AQY Q;  1JMC A;  3FKI H;  4IPG A;  4YWM A;  5M5W H;  2VY3 A;  3OTO L;  4A3L H;  2JA6 G;  4AYB E;  2WAQ E;  2IT1 A;  3PF5 A;  4LF6 L;  3M4Q A;  1XNQ Q;  1G6P A;  1L1O B;  3A74 A;  2JA5 G;  3RN2 A;  4JI4 Q;  3HFZ B;  3CXC A;  2VNU D;  2I5L X;  5JJL A;  1XTD A;  1HNW L;  4JI8 Q;  2BA1 A;  4JI5 L;  5GRO A;  3RNU A;  1IXR A;  4IPD A;  2UU9 L;  1LUZ A;  1NY4 A;  3ZJY C;  5IYD H;  1X9N A;  1CKN A;  2IHE A;  2HIX A;  3TRZ A;  1OXS C;  1BKB A;  2R93 H;  2MQH A;  4P72 A;  1EQQ A;  1VQN A;  4NXM L;  3CW2 C;  3CCR A;  2MO1 A;  3E9H A;  3S24 A;  1J5E Q;  3OYY A;  4BY7 G;  1I50 H;  1JJ2 A;  4GNX C;  2UUB L;  5M3M H;  5BR8 L;  2YTY A;  4QGU A;  4DV2 Q;  2OWO A;  1EIF A;  4UP8 A;  4LUZ A;  2OTL A;  4DUZ Q;  2UUC Q;  4JI6 Q;  2JA8 H;  4OWT B;  2YYZ A;  5AJ3 L;  3PO3 G;  4KHP L;  3H0G H;  1G51 A;  5HY6 A;  2F4V Q;  2EQS A;  5C3E G;  4A3F G;  3FP9 A;  1J6Q A;  1N36 Q;  4JV5 L;  2PI2 A;  1KL9 A;  3STB D;  4OX9 Q;  4DUY Q;  3PUW A;  1VQP A;  4BY1 H;  2RCN A;  4KLK A;  4OON A;  4A3D H;  3S17 H;  4X65 Q;  4YCV A;  3EIV A;  3W1G A;  2RHS B;  3T1H L;  4A3M G;  5FJ8 G;  1CUK A;  4MTN A;  4DV3 L;  1I94 Q;  1LTL A;  5ELN A;  2LXK A;  4JBK A;  5GQO A;  1D8L A;  4YHH Q;  1QVG A;  4JI3 Q;  4HJ7 A;  4DR7 L;  4UP7 A;  2PMZ E;  4A3B H;  4WJ3 M;  4BBS G;  1YHA A;  3SGI A;  4AH6 A;  4DR1 L;  4JYA L;  2CWA A;  4LF5 Q;  2CCZ A;  3UE1 A;  4DK6 C;  1X55 A;  3LGJ A;  2VQE L;  1XNR L;  2VQF L;  1YIJ A;  4A3E G;  1IBL Q;  4DV1 L;  4A3J G;  2V1C C;  1CKN B;  1E1O A;  4X62 Q;  4HJ5 A;  1HNX L;  1MKH A;  1FJG Q;  2QEX A;  3U58 A;  3HOY G;  1NBW A;  4DR4 Q;  4EX5 A;  1GM5 A;  4HJ9 A;  3CC7 A;  4NXN Q;  5C0X J;  3HOW H;  2Q2T A;  2Z6K C;  3KYH C;  4TVA B;  4GKK L;  4DR3 Q;  2NVQ H;  1P16 A;  2OTJ A;  5M3F H;  4JI2 Q;  3S1R H;  1NTG A;  2R7D A;  2BH8 A;  2CKZ B;  4C3I H;  2K5V A;  4OWX B;  5IYC H;  3J7Z C;  1R9T H;  3HOU G;  2QA4 A;  1OXV A;  4APV A;  3OTO Q;  3K0X A;  2N3S A;  2ZTE A;  4A3I H;  1RIP A;  2WB1 G;  3CD6 A;  3I4M G;  4B3T L;  1WFQ A;  2YTX A;  2GN5 A;  3PO2 H;  1KHI A;  1UE7 A;  3UDI A;  1GO3 E;  4AIM A;  4LF4 L;  2UXD L;  4DKA C;  2JA6 H;  4JI5 Q;  1TWH H;  4A4I A;  1N34 Q;  3J81 i;  4JBJ A;  3CC4 A;  4JC0 A;  2JA5 H;  4PMW A;  3CMA A;  1VQI A;  1C7Y A;  1XPO A;  5GAE C;  2Y0S E;  2ZJP A;  1KIX A;  2ZJQ A;  1JE5 A;  3PSI A;  4GKJ L;  4LFA L;  1X3E A;  1VS0 A;  2D62 A;  3ULP A;  4LF7 L;  4J15 A;  1UE5 A;  4LWC A;  2CQO A;  2Q2U A;  5BR8 Q;  1V43 A;  2EXD A;  1OXT A;  1O7I A;  1I5F A;  3PUY A;  4A93 G;  1ASY A;  1HR0 L;  2WFW A;  2DGY A;  1Q1E A;  2YTV A;  4IJL A;  4LF9 L;  1V1Q A;  4BY7 H;  5AJ3 Q;  4PG3 A;  4R4O A;  2IX1 A;  1N33 L;  2R7F A;  4GLX A;  3EN2 A;  3NEM A;  4KHP Q;  3KF8 B;  3GTK H;  1L2F A;  3E9I A;  5HGQ A;  1PA6 A;  4JI0 L;  4B3R L;  5GAG C;  2ASB A;  3S14 H;  1YVC A;  2I5H A;  4P75 A;  5M5Y H;  5DLQ E;  4P74 A;  3PO3 H;  1Q86 C;  1VQ6 A;  1Y1V G;  3RR5 A;  5IYB G;  2UXC L;  5H1S E;  1B8A A;  1EYG A;  4A3F H;  3CC2 A;  4DR6 Q;  3U4V A;  1UEB A;  3HOX G;  3F2C A;  1PH2 A;  1HNZ Q;  3KDF A;  2ZTC A;  1NMG A;  3NEL A;  4DV3 Q;  1WI5 A;  3A0J A;  3BU2 A;  3L0O A;  1TWF H;  1K8G A;  4IFD G;  3K7U C;  4POF A;  4Y7N H;  5IP7 G;  4LW1 A;  5LMN L;  2ES2 A;  1KQS A;  2IX0 A;  2CFM A;  3J80 c;  1TWG H;  3U50 C;  5FJ8 H;  5FLX c;  4DR2 L;  3T1Y Q;  4A3M H;  1QZG A;  4L5T A;  4X64 L;  4DV6 Q;  2KCM A;  1QVF A;  1D7Q A;  3GO5 A;  4IFD I;  2VQE Q;  1A0I A;  1GD7 A;  2VQF Q;  3TEH B;  1M90 C;  2B63 G;  3EBE A;  1OXU A;  4BBS H;  1Z47 A;  3KF6 A;  4R4C A;  1SRU A;  1HNX Q;  4HIO A;  3CF5 A;  1S40 A;  3PUZ A;  4XIG S;  2JK8 A;  1PHJ A;  2AKW B;  1Q7Y C;  1VQF A;  3KOJ A;  4A3E H;  1I6H H;  4GKK Q;  5C4X G;  4HJA A;  1L0W A;  4A3J H;  2UXB L;  1VQG A;  2ZJR A;  2HIV A;  3HOY H;  2K50 A;  3CCV A;  1SN8 A;  1KC8 C;  1KD1 C;  1OXX K;  1VQB A;  3K7A H;  4BA1 I;  1W2B A;  2E2I H;  1Q81 C;  1X54 A;  2YV5 A;  4FDB A;  5M5X H;  1E7Z A;  2I5M X;  2KEN A;  4O0A A;  4UPA A;  2OQK A;  2DUD A;  2K75 A;  2KHI A;  2XGT A;  3BZC A;  3PIP A;  1YJW A;  3HOU H;  4NPS A;  1PH9 A;  4LFC Q;  4LF4 Q;  1Q46 A;  1WJJ A;  4A3C G;  1ASZ A;  1PH4 A;  2UUA L;  2JA7 G;  1E24 A;  2C35 B;  1T9H A;  3GTQ H;  3ULL A;  3I4M H;  1XMQ L;  1EWI A;  3KDF B;  1IBM L;  1VQH A;  2OCE A;  1K3R A;  4DK3 C;  1RL2 A;  3CPF A;  1GKH A;  2BA0 A;  1QUQ A;  4ALP A;  2NVX H;  1SLJ A;  1X65 A;  3CAM A;  1VQE A;  1WCM G;  4GKJ Q;  1CKM A;  4LFA Q;  4YY3 Q;  1JB7 A;  3M7N A;  4DAY B;  3UE0 A;  1Y14 B;  1YNX A;  4OXP A;  3CCE A;  3OW2 A;  2HHH L;  4B3M L;  1YHQ A;  3M3Y H;  1JT8 A;  2E2H H;  1UE6 A;  3CME A;  3HKZ G;  1HR0 Q;  4B3S Q;  3CCQ A;  3G71 A;  1PH3 A;  2Z0S A;  1BBW A;  4IFD J;  1KXL A;  2JJQ A;  2KHJ A;  4UP9 A;  4JI7 L;  4LFB L;  1I3Q H;  4WJ4 A;  4YCW A;  4A93 H;  1XMO L;  2Z6K A;  4OWW B;  2FXQ A;  1PYB A;  4POG A;  3TS2 A;  5IWA Q;  3H15 A;  1U0L A;  1NMF A;  4HID A;  2L15 A;  2N78 A;  2UXC Q;  2VS1 A;  1PFS A;  2B3G A;  3PUX A;  3WWV A;  3TQY A;  5IP9 G;  3JAM i;  1N32 L;  4KI0 A;  3F2B A;  1OTC A;  2RF4 A;  3AEV A;  3RLO A;  2JEB I;  4AYB G;  2WAQ G;  4GN3 B;  4JBM A;  1VQK A;  2K4K A;  2A1A A;  4X6A H;  3UDG A;  1Y1V H;  5IYB H;  3S16 H;  5LMN Q;  1TXY A;  3VDY A;  3HOX H;  3HOV G;  1EQR A;  4X64 Q;  4JI1 L;  5C44 G;  1DGS A;  5LMU L;  1Q82 C;  4JI4 L;  4LF6 Q;  3M4O H;  3TS0 A;  2LSS A;  4C3H H;  1XPR A;  2HQL A;  3AYH B;  5IP7 H;  1YIT A;  1IBK L;  3GTL H;  2VW9 A;  1HNW Q;  3CP0 A;  1VQC A;  1VQ8 A;  4EQ5 A;  4KHZ A;  2UU9 Q;  2PQA A;  2B63 H;  3I2Z A;  1SFO H;  3M9B A;  4R4I A;  1PH1 A;  1HH2 P;  1E3P A;  3ULJ A;  2PNH A;  2RHQ B;  2D0O A;  2N8N A;  3RZO H;  1MJC A;  4QIW E;  4GOP C;  4O2D A;  4NXM Q;  1VQ5 A;  4P73 A;  2NZO A;  4R4T A;  1IZ6 A;  3F2D A;  4DV2 L;  3RLN A;  1XJV A;  3A5Z B;  4A76 A;  2UUC L;  2UUB Q;  5C4X H;  4JI6 L;  1BVS A;  3CPW A;  1MIU A;  4GLA C;  1X56 A;  4JOI C;  3U4Z A;  2VL6 A;  1QZH A;  1VQ7 A;  1K83 H;  3W1B A;  4JCV E;  3W5O A;  2F4V L;  3S15 H;  3HKS A;  4ME3 A;  4GN5 A;  3G4S A;  1N36 L;  1X3F A;  3MXN B;  1M1K C;  2NN6 G;  1Q1B A;  3ICE A;  2ZM6 L;  4DUY L;  3RLF A;  2JE6 I;  4JV5 Q;  1B7Y B;  1SR3 A;  2E8G A;  2YU9 H;  1K8A C;  1UWV A;  4OO1 G;  3D31 A;  4QJF A;  1L1O C;  2R7Z G;  2MO0 A;  2NN6 I;  1TWC H;  1Y1W G;  4A3C H;  4DNI A;  3T1H Q;  2JA7 H;  2XTI A;  2E5L L;  3KFU A;  1K73 C;  1VCI A;  4YHH L;  4NB3 A;  4A3G G;  3GTM H;  2VZA A;  2E2J H;  2HHH Q;  4OO1 I;  4DR5 L;  2ZTD A;  4B3M Q;  3I4O A;  4DR7 Q;  3H3V I;  4LF5 L;  2ATW A;  1Z9F A;  2F3I A;  2ALY B;  2Q2I A;  4IJH A;  4DV7 L;  4DR1 Q;  4JYA Q;  1WCM H;  4PZ8 A;  3KJO A;  3HKZ E;  1IBL L;  1XPU A;  4UY8 C;  3TRE A;  2R92 H;  1XNR Q;  1VQO A;  2PQA B;  1FJG L;  4LFB Q;  4DV1 Q;  1W3S A;  3I4N G;  1XMO Q;  4DR4 L;  4BA2 I;  4Y52 H;  3AFP A;  3JC6 6;  1KRT A;  3F1Z A;  1Q8K A;  1PYS B;  4BXX G;  1YHB A;  3NEN A;  3J7A 5;  3K81 C;  1YEZ A;  1N9W A;  4A3I G;  2I0Q A;  2R6G A;  3GTO H;  1EOV A;  1PH6 A;  1K0R A;  1FL0 A;  3S1Q H;  4GNX A;  2F52 A;  4L5Q A;  4LUO A;  1HJP A;  4LF8 L;  4IOC A;  1CSQ A;  1C0A A;  1A62 A;  2KCT A;  5ELO A;  4JBW A;  5EAY A;  4B3R Q;  3J81 c;  3S2D H;  1VQ4 A;  3HOZ G;  5E7N A;  3PF4 A;  2GVB A;  1S3O A;  3IRB A;  3UDF A;  5IP9 H;  3G6E A;  3RN5 A;  1UE1 A;  3UDX A;  5LMU Q;  4JI1 Q;  4A3K G;  4B3T Q;  4TQU S;  5C0X G;  4C2M H;  2WB1 E;  1JJC B;  3K80 C;  4RG1 A;  1X6O A;  1PH8 A;  1HR0 W;  3D0F A;  1IBK Q;  1N34 L;  2UXD Q;  3CCL A;  2JQO A;  3AFQ A;  2WP8 J;  4X66 L;  5JEA G;  3HOV H;  2H5X A;  4MZ9 A;  1X3G A;  5C44 H;  3G48 A;  3I7F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...