3UDGA

Structure of deinococcus radiodurans ssb bound to ssdna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
231
structure length
211
Chain Sequence
RGMNHVYLIGALARDPELRYTGNGMAVFEATVAGEDRVIGERNLPWYHRVSILGKPAEWQAERNLKGGDAVVVEGTLEYRQWEAPEGGKRSAVNVKALRMEQLGTQPELIQDAGGGVRMSGAMNEVLVLGNVTRDPEIRYTPAGDAVLSLSIAVNENYQRQEKVHYIDATLWRDLAENMKELRKGDPVMIMGRLVNESTRVEATRVEALAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein
publication title Structure and Cellular Dynamics of Deinococcus radiodurans Single-stranded DNA (ssDNA)-binding Protein (SSB)-DNA Complexes.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein/dna
total genus 42
structure length 211
sequence length 231
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3udgA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3udgA02
5HGQA 1VQEA 3ULLA 3PCOB 4YWLA 5FLMH 4YHHQ 3F2BA 4DV2Q 4BA2I 4DUZQ 3J80c 3CCRA 4X62L 4OO1G 1GVPA 2N78A 4RG1A 1VQ5A 1IYJB 2HIXA 3CC7A 2K50A 1UE5A 1E7ZA 3S24A 1I6HH 1VQNA 3H15A 2KBNA 4B3ML 1KAWA 2XTIA 3GTQH 2YU9H 1Y1VG 2CCZA 2WAQG 3PUXA 3I7FA 1GO3E 1KRTA 4JI5L 1IBLL 2L15A 2R7ZH 1KHIA 3U4ZA 1PH6A 3ERSX 1XJVA 4QL5A 2I5MX 3PO3G 1OXSC 4JBJA 1V43A 1OXUA 3M7NA 4JG2A 1SE8A 3G71A 2IT1A 5LMUQ 1UE1A 1TWGH 2C35B 2ID0A 4JI0L 3TRZA 4B3RQ 2Z6KC 5IE8A 3HFZB 1G6PA 1A62A 2K75A 2Q2IA 4GOPC 1HR0W 2VQFQ 1VQBA 3ZJYC 1UE6A 5GQOA 2E2HH 1KD1C 4GN4B 4BBRG 4BXXH 4DR1L 1YVCA 3H0GG 3H0GH 3U4VA 1PH8A 2HHHQ 4OWXB 2PQAA 4POGA 4UPAA 4APVA 3HOXG 1VQ4A 3FP9A 4JBMA 4JI4Q 1D7QA 2IHFA 1QUQA 1HJPA 4LUOA 1E1TA 5C44H 3U50C 4A3KH 4PZ6A 1IBKQ 3I4NG 1U5KA 1WI5A 3S1QH 4DV7Q 1LM0A 2JQOA 4IO9A 3G48A 3EN2A 1HR0L 2UUAQ 3CCQA 1X3FA 2HT1A 2NVQH 2CQOA 4L5TA 5AJ3L 3NBHB 1E1OA 1IBML 1YEZA 4P74A 4JI1Q 2JA8G 5M5XH 1CKNB 4NXMQ 2BA0A 1Q1EA 3CW2C 5J3BA 3J7A5 1BBUA 5IP9G 2JEAI 2UXBQ 4O2DA 3CCJA 1HNWQ 3J81c 4JI2L 1J5EQ 1EIFA 4PZ7A 4A3FH 1TWHH 1XNRQ 4KHZA 4IPHA 3J81i 4B3TL 4XIGS 3CF5A 3I4MG 3EBEA 1VQ9A 1N36L 5H1SE 4AYBG 1M1KC 1L1OB 4P73A 1Q82C 1VQKA 4YHHL 3M85A 1YHQA 4DUZL 4ME3A 4GLVB 3KF8B 2QEXA 3L7ZC 3PUWA 4AIMA 1IBLQ 4Y7NH 3J81j 2OQKA 4JI5Q 3HKSA 1YJNA 1AE3A 4A3GH 2VNUD 1YZ6A 4O0AA 4OONA 4GNXB 3I2ZA 3B6YA 4JI6L 4R4CA 2GN5A 1W2BA 1K0RA 2K4KA 2B29A 3CPFA 4JI0Q 1I50H 3CCUA 1DGSA 2NN6I 4DK3C 1S40A 3GD7A 1PH3A 1PYBA 4LUVA 1WJJA 4DV3L 4NXNQ 2VUMG 1X3GA 1K9MC 2KHIA 2Q2TA 1JJ2A 1EFWA 4IOAA 5C0XJ 4DR1Q 1C9OA 4DKAC 3PIPA 3TQYA 5IYCH 3TS0A 2WP8J 4B3RL 3AQQA 3K8AA 5GROA 1O7IA 4POFA 2MQHA 3GTJH 4YCWA 4X66L 4A3EH 1EWIA 2CWPA 4OX9L 2NN6G 1XTDA 1Z47A 4X64Q 4A93H 3GO5A 1YJWA 4LFBQ 4XTCS 1HR0Q 4L5RC 4MZ9A 5IYBG 4AQYQ 2RCNA 4JCVE 3PGZA 4DAYB 5M5WH 2IX0A 5JEAG 5AJ3Q 1IBMQ 1N34L 1T9HA 2IX1A 4DAMA 4A3LH 2B3GA 4R4QA 2A8VA 4IFDJ 2DGYA 2HIVA 4GKKQ 1TXYA 3JAMi 4A3MH 3A5UA 2Z6KA 3A74A 3W5OA 3I4OA 5IP7H 4OO1I 4GOPA 2YV5A 4JI2Q 3PUVA 4BY1H 4GLAC 4A3JH 3KF6B 2BH2A 3KOJA 2Z0SA 4B3TQ 1CKMA 1Y1WH 2PQAB 2UXBL 3PIOA 4GKJL 4WJ3M 1K83H 4X65L 3PF4A 3W1GA 2NVXH 4RMFA 4DV4L 2UUCQ 3ULJA 1EQRA 1XNRL 2R92H 5IWAQ 5FLMG 1HH2P 2ZJPA 4LNQA 4BY7H 4JBKA 4HJAA 4MTNA 2NZOA 5JJLA 1PHJA 1UEBA 2JA5H 3CCLA 3GTMH 2K14A 3T1YL 4GS3A 3E0EA 4TVAB 1L0WA 1VQCA 3RN5A 5C4XH 1VQAA 4JI6Q 1N8RC 2R7ZG 1AE2A 3BJUA 4OWTB 4LWCA 3H3VI 4HIKA 2MO0A 3HOZH 1ASZA 4LF9L 4QY7A 1P8LA 2JE6I 2NVYH 4DV3Q 2EXDA 1HNXL 3E9IA 3UDGA 1X56A 1WCMH 1SLJA 3UE0A 3I55A 5IYDH 1MJCA 3K7AH 3K80C 3S1NH 1TWAH 1OXVA 1X6OA 4NXNL 1VCIA 2K5HA 2RHQB 4X66Q 1I94Q 4OX9Q 4PZ8A 1E22A 1QVFA 1P16A 4BXXG 2Y0SG 3S14H 3UDIA 1NY4A 1B70B 3PUZA 4JOIC 2UUBL 2ZJQA 3M4QA 3IRBA 4JI7L 1E24A 3PSIA 1PV4A 1XPUA 1NMFA 2YYZA 5C44G 1QZGA 3CAMA 4A3KG 1N34Q 4DNIA 4X64L 4H02A 3UDFA 1U0LA 3M4PA 3KJPA 3RN2A 1YI2A 4LFBL 3U58A 4A3CG 2OWOA 4A3BH 2Y0SE 1SR3A 4UP7A 1JE5A 4AQYL 3PF5A 1KXLA 3K0XA 4DV0L 1WFQA 1MIUA 1SMXA 5C4JH 4LFAL 3RNUA 5K36G 4GNXC 3HOYH 1A8VA 3HOUH 3VDYA 4J15A 2K52A 3A5ZB 4GKKL 5GADC 1K73C 1FL0A 2MNAA 5LMNW 4GKJQ 2D0PA 1JJCB 1YIJA 4X65Q 4JI3L 4A3FG 4DV4Q 1K3RA 4A3IH 1KIXA 3GTGH 4KHPL 2BH8A 4ALPA 1J6QA 1KL9A 4EX5A 1VQFA 1VQ6A 4QGUA 1VQLA 1RIPA 3OTOL 2GVAA 4DR7Q 2AHOB 4NB3A 3L2PA 4KLKA 2UUCL 3MEFA 3T1YQ 4LF4L 5IWAL 2PMZE 4L5SA 5GAGC 3M3YH 5LMNL 4YY3Q 1HZCA 3S1RH 1XNQQ 4NPSA 3D31A 1OTCA 3F8TA 1XPOA 1PH9A 4K0KQ 1PH1A 2PI2E 3NELA 1MJEA 4C3IH 2H5XA 4R4TA 4A3GG 2ZTEA 1VQDA 1FGUA 4HIDA 2FXQA 1B7YB 4LF9Q 1HNXQ 3PO2H 2B63H 1AH9A 2ASBA 2NVTH 4DV1Q 2KCTA 2D0OA 5E7NA 1S3OA 1NMGA 2JA7H 5FJ8H 2UU9L 3HOWH 3DM3A 2QGQA 1GM5A 5C3EH 4A3CH 3ICEA 1V9PA 1XMQL 1FJGL 2ZJRA 4UP9A 5GAHC 2ALYB 5IYCG 2UXCL 1IZ6A 2N49A 1D8LA 1HZ9A 2UUBQ 1WYDA 1PYSB 3S2DH 1ASYA 4JI7Q 1N9WA 1I94L 1IXRA 5C0XG 2R93H 4A3EG 4UY8C 3WWVA 1CSQA 2MFIA 1VQMA 1Q1BA 4A93G 2ATWA 1H95A 1B8AA 2K5VA 1MKHA 4PMWA 1M90C 1IL2A 4DV0Q 1PA6A 4LFAQ 2OQ0A 4OXPA 1VQPA 2WB1E 1GD7A 1VQJA 1TWFH 3JAMc 4QIWE 5ELOA 4A3LG 1CKNA 4A3DH 4BBSH 4YWKA 3KFUA 4A3MG 1X54A 2F3IA 5FLXc 5IP7G 1PH7A 1Q12A 4LFCL 4HIOA 2JA9A 2N8NA 1N32L 4DV5L 3RLOA 4BY1G 4A3JG 3PV0A 2LXKA 5EAYA 4HIMA 3AYHB 4JI3Q 4KHPQ 3CC2A 1UE7A 1BKBA 4GN3B 1WOCA 4R1JA 2CFMA 4LW1A 2VQEL 4JOIA 1SRUA 1TWCH 3KYHC 5JEAJ 1Y1WG 1Q7YC 1QVGA 3OTOQ 3HOVH 4QQBX 1RL2A 4GLXA 4DR5L 4MNOA 1QUQB 5M3FH 4BA1I 3W1BA 2R92G 1XMOL 1VQ8A 4LF4Q 2YTVA 4LF7L 4L5QA 4BY7G 5LMNQ 4JYAL 2JA6H 1VQGA 3AFQA 4LF8L 4DR4L 2ZM6L 4B3SQ 1UWVA 3RZDH 2NZHA 4P75A 2JA5G 4LUZA 4DR7L 5M3MH 4Y52H 4GNXA 3T1HL 2ZTDA 1KC8C 4YY3L 4IJHA 4P71A 1XNQL 2PI2A 5C4XG 2LSSA 1SROA 1X9NA 4K0KL 4HJ8A 1CSPA 2UU9Q 4YCVA 1E3PA 1YHBA 3HOZG 5JJKA 1N33L 4IPCA 2RF4A 1BVSA 1XMQQ 3CMEA 1FJGQ 4DV1L 4IOCA 3CXCA 1WCMG 2EQSA 2UXCQ 3RLNA 4IJLA 5IYDG 4IPDA 1X65A 4GN5A 5BR8L 1JT8A 3TS2A 4KI0A 3KDFA 3J80i 5JJIA 1NE3A 4LF5L 2YTXA 1I5FA 1Y1VH 3HKZG 5HY6A 2F4VL 4R4IA 4JBWA 3CMAA 2QA4A 2MO1A 4P72A 4R4OA 1SFOH 3M4OH 3CQZH 3TREA 2IY5B 1LTLA 1GKHA 2N3SA 3EIVA 1PH5A 1L1OC 3Q8DA 1HNZL 3PO3H 2KENA 1YNXA 4HJ5A 3CCVA 4LF6L 4QJFA 4A3BG 4DR6L 3MXNB 3HKZE 2WAQE 4IPGA 4YWMA 3SGIA 1FVIA 4LFCQ 1N32Q 3KLWA 4JI8L 1PFSA 4DV5Q 1QZHA 3S17H 2OTJA 3HOYG 1C0AA 3K7UC 3HOUG 3UDXA 1A63A 2ES2A 3KF6A 3BZKA 4DV6L 1EYGA 3H3VH 4BBRH 2VQEQ 3STBD 4AH6A 1Q46A 4HJ7A 3GTPH 4C3HH 2KCMA 1PVOA 3HOXH 1OXXK 4DR5Q 3S15H 2GVBA 3BU2A 4DUYL 4A3IG 2CKZB 2WFWA 1EOVA 2OCEA 1XMOQ 2UXDL 3RZOH 2E2JH 2VL6A 3D0FA 4LF7Q 3I4NH 4JYAQ 3CP0A 4LF8Q 4DR4Q 5IY0A 2AWOA 2ZM6Q 3TEHB 4C2MH 4EQ5A 1VQIA 4JV5Q 1HZBA 3CCEA 3T1HQ 1PH4A 1NTGA 2JA8H 3GTOH 4HJ9A 5IT9c 4B3SL 1EIYB 2OTLA 2I0QA 4X6AH 2I5HA 3BZCA 1VS0A 5IP9H 3GTLH 1VQHA 3FKIG 3FKIH 3G4SA 4GOPB 2F52A 2JEBI 2VS1A 4DR3Q 3RR5A 1VQOA 1N33Q 3PO2G 3G6EA 3UE1A 2B63G 2JA7G 5C0XI 2EIFA 2R7DA 1XPRA 5FJ8G 3OW2A 4X62Q 3HOWG 3I4MH 5DLQE 1C7YA 2AKWB 4DR2L 2PNHA 1KRSA 1Q8KA 2D62A 2VZAA 3STBC 5BR8Q 2RHSB 5C3EG 2E5LL 2A1AA 2R7FA 3GDEA 1G51A 3F1ZA 1Q86C 4DPGA 4DV2L 4A76A 4B3MQ 4LF5Q 1YBYA 3AEVA 2ZTCA 2F4VQ 1QVCA 1X3EA 2VY3A 5M5YH 2WB1G 4DK6C 3AFPA 3E9HA 2R93G 4AYBE 3A0JA 4OWWB 1HNZQ 3F2CA 4C3JH 2IHEA 1Q81C 3CCMA 4IFDI 1EQQA 2LXJA 1I3QH 4LF6Q 4DR6Q 3KJOA 3CD6A 1EUJA 3DLLA 1JJGA 3K81C 1X55A 4JI8Q 1K8GA 1YHAA 3I56A 3CC4A 2VUMH 5LMUL 4BBSG 1S72A 4DV6Q 2KHJA 2Q2UA 1PH2A 2Q2HA 3CPWA 3F2DA 3GTKH 3J7ZC 3ER0A 3LGJA 2AMCB 4PG3A 4IFDG 1A0IA 1VQ7A 3CCSA 3S16H 3S2HH 2JJQA 4DUYQ 2VQFL 3KDFB 3JC66 1LYLA 1CKOA 4A4IA 1OXTA 2UXDQ 1JB7A 3PUYA 1YJ9A 2HHHL 3HOVG 1V1QA 1LUZA 3M9BA 4JI4L 1K8AC 1Y14B 5IYBH 2I5LX 3L0OA 1NBWA 1L1OA 1NJIC 5M3FG 3S1MH 3RLFA 3FHWA 2E2IH 1G291 4JC0A 1HZAA 2AWNA 1IBKL 1JMCA 2JA6G 4DV7L 2DUDA 2UUAL 4A75A 4FDBA 2R6GA 5ELNA 5M3MG 1R9TH 4JV5L 2XGTA 1YITA 4JI1L 1SN8A 3NEMA 4YCUA 4NXML 1KQSA 3ULPA 1BBWA 2VW9A 2A19A 2V1CC 2YTYA 4A3DG 2E8GA 1W3SA 2CWAA 5GAEC 2BA1A 4WJ4A 1L2FA 3OYYA 3NENA 4TQUS 4DR2Q 2JK8A 1N36Q 1HNWL 4DR3L 2HQLA 4UP8A 1J5EL 2E5LQ 1CUKA 1Z9FA 2K5NA
chains in the Genus database with same CATH superfamily
4MHEA 4DUZQ 3J80c 1EIGA 5IT9L 4X62L 1JOQA 1GVPA 2K50A 1I6HH 2FFKB 2KBNA 2NBFA 5LL6S 2CCZA 2QEJC 2WAQG 3I7FA 4JI5L 2L15A 3DEPA 1ZXTA 4XYQA 1XJVA 1TIID 4L6TB 4QL5A 1OXUA 3DUZA 1J8IA 4HEDA 2JA5B 1TWGH 4B3RQ 4KJOA 2Z6KC 1A62A 2K75A 2Q2IA 1HR0W 1VQBA 2E2HH 2PW5A 1KD1C 2F1MA 1KDBA 4BXXH 3H0GH 1PH8A 2PQAA 4APVA 2F0MA 2XRSD 1D7QA 4F7XA 1A15A 1I4XA 1AN8A 3Q24A 2EY1A 3I4NG 3HGBA 1GUSA 4XXEA 1WI5A 3I91A 5CR3A 3K7AB 3S1NB 3G48A 4A3CH 4Y52H 2WKDA 1X3FA 2Z9HA 2NVQH 2CQOA 4L5TA 1B4OA 2JA8G 3S14B 3HKZB 2LMCB 5JVG3 3KUPA 3J7A5 1BBUA 4O2DA 1SYEA 2HQEA 1J5EQ 4A3FH 4IQZA 2HD3A 4RAUC 3W3AA 4O42A 5C4JB 2IW3A 2K03A 3HOYB 1M1KC 1D5ZC 4P73A 3BS1A 2B2WC 1CA5A 1STHA 4ULLA 4GLVB 3QOLA 3L7ZC 3PUWA 3T13A 5HGTA 2PMZB 2K7VA 1WTQA 1PTOH 4N8FA 4CKBA 3SVMA 2EYJA 3K59A 1STNA 5IIFA 4JI6L 5L37A 3J7AV 2BE5C 1K0RA 2B29A 3CPFA 1MD2D 4JI0Q 4QMGA 1QJOA 4NW2A 1PH3A 4NXNQ 1K9MC 1JJ2A 4C3IB 4DR1Q 1AH9A 3AQQA 4POFA 3NWSA 4GZYC 3PO2B 4A3EH 2CWPA 4OX9L 1XTDA 2NN6G 1DJRD 4X64Q 1WTOA 4LFBQ 3BG3A 4MZ9A 5IYBG 1RD9D 2N88A 5M5WH 4DAYB 2IX0A 5AJ3Q 1IBMQ 4IUTA 4A3LH 1DOKA 4IFDJ 2KQ3A 2R93B 1JCKB 4QIWB 2Z6KA 3A74A 2B2UC 4H13C 2RA4A 5IP7H 1U9RA 4BY1H 4A3JH 1U4MA 2EJMA 2D9UA 1CKMA 3NTKA 3PIOA 1TWFB 4GKJL 4WJ3M 3PF4A 3NTIA 1G8ZD 2R92H 4X3UA 4BY7H 1KNAA 4HJAA 5JJLA 3CCLA 1Q90A 1WTHA 2HCCA 2K14A 1L0WA 3HOVB 1AE2A 3BJUA 4LWCA 3J7AF 4RHRA 3HEJA 1ASZA 5I2XA 1HNXL 2NVYH 4DA2A 1V1OA 3RZDB 1X56A 4K2LA 1TQOA 4RHSA 1HRJA 2SNSA 2RDFA 2E2DC 5IYDH 1MJCA 1TWAH 1IYVA 4CHTB 2DJGC 3LWUA 1CHPD 2XSCA 4BXXG 4PMBA 5DEHA 5C5LA 4B9XA 4JOIC 3NQIA 2QKIC 1MSGA 1CHQD 2ZXOA 3EQLC 5C3XA 1YI2A 1U0LA 4F88A 3KJPA 5FO7B 4A3CG 3IAYA 4A3BH 2Y0SE 3K6OA 4UP7A 2KCCA 1PZKD 2L0CA 3K0XA 2QF7A 1SMXA 1WFQA 4TKOB 5D65A 2WAQB 3HOUH 3NSWA 4FXKC 2ENBA 1SFOB 3CQZB 4GKKL 1F2LA 2K01A 2D0PA 1JJCB 1YIJA 2QCPX 4X65Q 4JI3L 4A3FG 1K3RA 2QDLA 4A3IH 1I4GA 1J6QA 1KL9A 3GQBA 4HCEA 5JOBA 2FJ2A 2UUCL 3MEFA 1LTBD 1TY2A 1D2BA 3GTPB 5LMNL 1DD2A 1XNQQ 1D1KA 2B2UA 3D4DA 5I6WA 1EWCA 4R4TA 1VQDA 1FGUA 2E2JB 3I4NB 4LF9Q 5CBAE 4DV1Q 2D0OA 4C2MB 4FF3A 1LTSD 1NAPA 5T1IA 5FJ8H 2F0UA 1L0XB 1V9PA 3TBIB 2G9DA 1TS3A 4UP9A 5GAHC 2QILA 1TKWB 2CW0C 3S2DH 3NXWA 1I94L 4ZQ3A 4A3EG 4K6LA 5F2DA 1CSQA 2MFIA 1VQMA 1Q1BA 2E75C 4HTHA 3VR2A 3A8KE 1VQPA 4IUVA 4OXPA 4ZYSA 1KAAA 3JAMc 2A69C 4A3LG 3A8IE 4BBSH 5M5YB 3KFUA 3TP6A 1X54A 5FLXc 3KK7A 5IP7G 2EY2A 1PH7A 5EKIA 4BY1G 4A3JG 4HIMA 1I3QB 2LXKA 2Q8TA 4HMJA 5TSSA 1UE7A 1BKBA 1WOCA 4JOIA 1SRUA 1D5MC 1SNOA 4V0BA 2JN4A 1HTPA 5M3FH 2R92G 4LF4Q 1F9SA 4RCNA 2YTVA 4BY7G 1FNUA 4LF8L 4DR4L 1DOMA 1EYCA 4P75A 2XWBB 1X9NA 2EJFC 3S1MB 3E6ZX 1YHBA 4HSVA 4XQJA 1K3BC 5FO8B 3QWNA 4Z9CB 1B44D 1SE3A 5IGGA 3I8ZA 4KY7A 1F77A 3RLNA 5IYDG 1PRTD 2ZXRA 4IPDA 4H0LC 1JT8A 4OIKA 4KD3A 1S5ED 5EJWA 1NE3A 2F0GA 4DNTB 1I5FA 1Y1VH 4PV1C 4MIUA 4R4IA 4JPBW 3M4OH 1S5FD 3O13A 4QF4A 2X69A 1GKHA 4DAYA 1PH5A 4FF2A 1HNZL 4R8NA 1JOOA 4A3BG 4DR6L 3MXNB 3HKZE 3SGIA 4YWMA 1I6HB 3TP5A 1FVIA 5EPJA 4DAPA 1N32Q 4TRDA 1A63A 2OTJA 3HOUG 3UDXA 3PIO3 3TDQA 4HJ7A 2KCMA 1OXXK 4A3IG 1TWGB 2F3WA 2VL6A 2NTSA 3J81E 1JOKA 2OXPA 2AWOA 2D2CC 2ICEC 2E2HB 1TR5A 1PH4A 1NTGA 3H0GB 4XT1B 3D4WA 1I4RA 5IT9c 1HUNA 2CVRA 1VQHA 3FKIH 4GOPB 3RR5A 2F0QA 2NVQB 3IL8A 5FJ8G 5JPNC 5LHY1 3I4MH 2IX3A 3GV3A 4FO2A 1I4HA 2RHSB 1QNUA 2R7FA 3GDEA 4NDXA 3F1ZA 5J1ZA 4DPGA 3VYTA 3OIQA 5KYLA 3GTLB 5IOCA 4IURA 1Y8NB 3EJIA 2Q8IB 2EOTA 4A3FB 2F0DA 3A0JA 4C3JH 4IN3A 1Q81C 2F0EA 4F8MA 1EUJA 1X55A 4JI8Q 4RGTA 1O7YA 1YHAA 3CC4A 2VUMH 4BBSG 4DV6Q 1EY5A 2KHJA 1LTID 3J7ZC 3C3LA 3LGJA 1PTOB 3CCSA 4G7ZC 3QJYA 4DUYQ 1EYAA 3PUYA 3K5NA 1B3QA 2I5LX 1EY6A 3L0OA 5M3FG 3BZDB 4N9PA 4XQQA 1HZAA 1G2TA 1KNEA 2DN8A 4A75A 3CHBD 1HXYD 5C4ZA 2Z1CA 4A3EB 2DJFC 1SN8A 1W6KA 3NEMA 3ULPA 2VW9A 2A19A 1IKLA 1LT3D 1W3SA 2K32A 5GAEC 3OYYA 3BVZA 3NENA 4TQUS 4DR2Q 2EYOA 1J5EL 2SDFA 5ELEA 1ZYRD 3ULLA 3PCOB 3U9OA 4DV2Q 4BA2I 1RHPA 4BY1B 4A3JB 1IYJB 1OO9B 3CC7A 1JWMD 1UE5A 3WOFA 1K8MA 3H15A 4B3ML 1KAWA 3GTQH 3K5OA 3R8BA 1Y1VG 5KNDA 2YU9H 3PUXA 2MHVA 1ENCA 1KHIA 3U4ZA 1PH6A 2R92B 2I5MX 1OXSC 4BY7B 4JBJA 3FMCA 1SE8A 2IT1A 2PZTA 1XXGA 2ID0A 4JI0L 2PNRC 2PYKA 3HFZB 1G6PA 4KKUA 4GOPC 2VQFQ 3LX0A 3PMFA 3ZJYC 1UE6A 1EY8A 2L5TA 4PMCA 3U4VA 4DR1L 1QOHA 4G57A 1VQ4A 2IHFA 1G2SA 4RGMA 1E1TA 5C44H 3U50C 2X6GA 4PZ6A 1IBKQ 1LM0A 2JQOA 3EN2A 1TWAB 1A3VA 5AJ3L 1BR9A 1E1OA 3NBHB 1YEZA 4P74A 1IBML 5K36H 5M5XH 3TN2A 1RJTA 1Q1EA 2O4XA 3CW2C 1GXDC 2UXBQ 4DFAA 3CCJA 1HNWQ 2BCOA 1BCPF 2K5DA 1LTGD 4A3BB 3K5LA 1TWHH 1XNRQ 4XIGS 3CF5A 3I4MG 3EBEA 3LWEA 2K5WA 1PTOC 5ELFA 1L1OB 3HOUB 4YHHL 1BNZA 3KF8B 1PZID 2LY7A 1IBLQ 4Y7NH 2OQKA 5HURA 4A3IB 3HKSA 3R3OA 1YZ6A 1CM9A 4GNXB 2PZWA 4C3JG 4XDXA 3E5SA 2LS01 1D6EC 3NPPA 3MXNA 1W2BA 2K4KA 1O7LA 3CCUA 4CDFC 1PRTB 1PYBA 2ZXPA 2VUMG 1H9SB 4IOAA 1F2ZA 3NQTA 5IYCH 5DNFA 1O7IA 3K0YA 3QIAA 1UUPA 2MQHA 2MJ8A 4YCWA 1I4QA 3LNNA 4ABNA 1AW7A 3MVVA 4K14A 4FYDA 1J9OA 1Z47A 1STYA 5I2YA 1HR0Q 4IUQA 4JCVE 1F9RA 2PO4A 1QE6A 1LO5D 5KNCA 2G9HD 3HZXA 3S2DB 2HIVA 2LKVA 5BN3A 4A3MH 3I4OA 2L11A 4GOPA 2YV5A 4R9WA 5DM73 3KF6B 3SE0A 2X6LA 4MTKA 4Q5VA 2BH2A 4B3TQ 3A55A 1W6JA 4X65L 4BBSB 1GHJA 5IWAQ 5J22A 1VMPA 2RDHA 5BN5A 4X3KA 1UNSA 3J81L 1VF7A 3J80E 2K1BA 1VQCA 5I4DA 3CU7A 4OWTB 5M3FB 2N55A 3H3VI 4O1NA 4LF9L 2OT2A 5EBCA 1PYWD 1SLJA 2O5IC 3K80C 4KN7C 2JXMB 4X66Q 1T5XD 1P16A 1KABA 5IGCA 2ZJQA 2A6ED 2K05A 1HA6A 3IRBA 3PSIA 1NUCA 1PV4A 1NMFA 4N8X1 5C44G 2KECA 1QWYA 1CA6A 1A3TA 3U58A 3QO2A 4RGNA 1ENAA 5EKLA 4AQYL 3PF5A 3TZDA 2A6HD 4RWSC 1TY0A 2HDLA 5K36G 1Y1VB 4GNXC 2OEOA 4PNYA 4RGOS 3M4OB 3VDYA 4DXGA 1FL0A 2F0NA 3K57A 1A6XA 4ZCKA 1STGA 3D6CA 4DV4Q 4ZAIA 3GTGH 1PRTC 2BH8A 4ALPA 1NR2A 2Z4HA 3FEWX 1VQFA 1VQLA 1RIPA 2GVAA 4DR7Q 1PFMA 3L2PA 4LF4L 5GAGC 4P2CB 3S1RH 1LTAD 4RA8A 1OTCA 2B39A 2PI2E 2F0IA 2H5XA 5JAVA 2ZTEA 2OF1A 3A8JE 2FXQA 3KBXA 4J6HA 1WTWA 3SR1A 2KCTA 5E7NA 5A35A 3HOWH 1IW7D 1S4ZA 2AUKA 1KTKA 5C3EH 5CBEE 2CHBD 4QB4A 1F9QA 5IYCG 3FKIB 1WTXA 2KA7A 2UUBQ 1WYDA 1ASYA 4JI7Q 4UY8C 2PQEA 3WWVA 5KNBA 1M4VA 1SNPA 4PMWA 2RBMA 4C1NK 4G7HC 2OQ0A 2XNAC 3Q0AA 1VQJA 3OSOA 4KJNA 3NBHA 1JQYD 2EVBA 3L9AX 3I72A 5EPKA 1ESRA 4A3MG 1Q12A 2EYPA 3VA5A 2JA9A 2B2VC 2N8NA 1TVXA 1CI3M 4C3JB 3RLOA 4IFDH 1N32L 3PV0A 4B9WA 3J7YW 4QCLA 2M00A 5CV5A 4OGQC 1Z7TA 4R1JA 2CFMA 4LW1A 3KYHC 5JEAJ 1XTCD 1RL2A 4GLXA 4MNOA 4OIJA 1QUQB 2ICIA 2VUMB 2O5JC 1VQ8A 3KF8A 1A3UA 2PPBC 4RKBA 2NZHA 5M3MH 1V1PB 4GNXA 1G91A 2RCFA 2B8FA 2Z6BA 4LAAA 4YY3L 4IJHA 1KC8C 5E1FA 1EZ6A 1SROA 1WVLA 4K0KL 1CSPA 2UU9Q 1VMCA 1E3PA 2JP1A 1XMQQ 3CXCA 1H9SA 1PDQA 2H1EA 2UXCQ 4L8JA 3SDZA 2XWJB 4GN5A 1QILA 2B2WA 4KI0A 2AUJD 1XYIA 1C4QA 3MWYW 4FP5D 5JVH3 5HY6A 2MO1A 4P72A 4R4OA 1KLUD 4YIJA 2IY5B 1LTLA 2EZVA 3PO3H 2RDGA 3VYRA 1QB5D 4HJ5A 3SK4A 3CCVA 4QJFA 3ZYYX 4IPGA 5DM63 3GTQB 3KLWA 4JI8L 4DV5Q 2YU9B 3S17H 3NBIA 3G7LA 5IGBA 1CQFA 3KF6A 4R8IA 3BZKA 4DV6L 3AMUA 1DZ1A 3H3VH 4BBRH 2VQEQ 3KLSA 3STBD 3VR3A 4AH6A 1ZYRC 3R2TA 5ELBA 1SXTA 4Q0FA 3S15H 2GVBA 4DUYL 3DHQA 2WFWA 1EOVA 2OCEA 3P20A 3RZOH 4LF7Q 3D0FA 4JYAQ 4KN4C 3CP0A 3H91A 4RFBA 4FNFA 1VQIA 4JV5Q 1HZBA 2KVMA 1SSOA 5G3LF 5CV9A 3GTOH 4HJ9A 5NUCA 4B3SL 2OTLA 4X6AH 2B8GA 3BZCA 1VS0A 2B2VA 5IP9H 5C44B 2F52A 4DR3Q 3MXPA 3G6EA 1YNJD 2WV6D 2L55A 5C0XI 1XPRA 1O78A 3HOWG 4X62Q 5CYUA 5DLQE 1C7YA 1EEID 2IWHA 4DR2L 2KEDA 2JA8B 1Q8KA 5M5XB 3N52A 5C3EG 4L63B 1Q86C 3PQIA 4DV2L 4LF5Q 3AEVA 2ZTCA 3K58A 2F4VQ 1A2UA 4DK6C 3AFPA 3E9HA 5DAUA 1IYUA 1TWHB 1YNND 5CV4A 3F2CA 2WACA 1EYDA 1EQQA 3J80L 3BDLA 1Z6HA 1G6ZA 1BF4A 3K5MA 3I56A 3ND9A 1R4PB 4Y7NB 2Q2UA 3F2DA 3GTKH 3NP8A 3ITPA 2EY6A 3ER0A 3JAME 2RVLA 4PG3A 4IFDG 3S16H 2JJQA 3D3RA 2VQFL 3KDFB 4U673 1BCPD 4ME5A 2UXDQ 5FLXE 1JB7A 3M9BA 1FR3A 1K8AC 3MXGA 1NBWA 1NJIC 2CH4W 1JWUD 2A68D 3RLFA 3WDNA 2AWNA 1IBKL 5ELCA 1E2VA 2PCFB 4FDBA 5ELNA 5M3MG 1FNVA 1SYDA 4ILWA 4KKTA 5A2QE 4FVMA 1JE4A 5FK9C 1H9KA 3OWFA 2CWAA 4WJ4A 3ONAB 1RDPD 1HNWL 2E5LQ 1CUKA 1Z9FA 2NWGA 1VQEA 2VB2X 1A2TA 4A3MB 3MA2B 1LT5D 5CORA 2N78A 4FF1A 1VQ5A 3S24A 1E7ZA 1VQNA 4IUPA 1K28A 1L0YB 3DMUA 1EWHA 3X3NA 1CZWA 1GO3E 1IBLL 2R7ZH 3ERSX 4IUNA 3PO3G 2E76C 3M7NA 4JG2A 4ZLTF 2C35B 4I7AA 3ERQA 2A73B 2ZT9C 5IE8A 1B53A 1TS4A 4BBRG 1YVCA 1KLGD 4ZRZA 4DK0A 2HHHQ 4JI4Q 4JBMA 3FP9A 4G7OC 1QUQA 5IGDA 2F0KA 4LUOA 4A3KH 5EQ0A 1U5KA 2F0OA 4DV7Q 4IO9A 2L4NA 1HR0L 2UUAQ 3CCQA 2HT1A 1LV9A 4DXFA 4JI1Q 4ID6A 2BE5D 4NXMQ 1CKNB 1BUVT 2NZ1D 1RTNA 3A54A 5J3BA 2K28A 5IP9G 3J81c 4CBVA 5IGFA 5IT9E 2KJXA 4I7ZC 3J81i 2MP1A 4B3TL 1VQ9A 1N36L 5H1SE 1NR4A 1Q82C 1VQKA 3I4LA 2AQ1B 1ET9A 1YHQA 4FXGC 4DUZL 3P7JA 4ME3A 2QEXA 4AIMA 4DGZA 4ZKBB 3GTGB 1AE3A 4A3GH 5BN4A 3KLSX 4K5WA 3I2ZA 2A6HC 5IGEA 4R4CA 3GP7A 2NTTA 1LABA 1I50H 2NN6I 1EL0A 2DNEA 4DK3C 1S40A 1HFGA 3S1RB 4LUVA 1GUTA 1WJJA 1EIHA 1EY4A 1X3GA 5C0XJ 2CQAA 2GA4B 3TS0A 4B3RL 2WP8J 2KUMA 3N6RA 4X66L 5C0XH 4NKLA 2JSOA 3HOWB 4JW0A 3L3OC 4XTCS 4CJ2C 5C3EB 1EY0A 5E3FA 1TU2B 3EROA 2IX1A 1T9HA 1IL8A 4OELB 1Y8OB 2DGYA 3NWTA 5EBDA 4GKKQ 1GUWA 2NYZD 4RCOA 3A5UA 4K8JA 4OO1I 2FMMA 4JI2Q 2XRQD 4HSPA 2AQ3B 3KOJA 2Z0SA 4HR7B 5M5WB 1Y1WH 2PQAB 4ZUIA 4ODGA 1MGSA 1K83H 2RKSA 4X3TA 3W1GA 5CMDA 2NVXH 4DV4L 1B2TA 2UUCQ 4ZKCB 3HS0C 4K8IA 2ZJPA 4LNQA 4JBKA 5EGTA 3SEBA 4LJZC 2NZOA 1IKMA 1UEBA 1STBA 3GTMH 3E0EA 4OHJA 3RN5A 5C4XH 1N8RC 2R7ZG 2NUCA 3DXJC 1BO0A 4HIKA 1XWEA 4K2KA 3HOZH 3T51B 1X3PA 2NB0A 4QY7A 1P8LA 2JE6I 4DV3Q 1LACA 3E9IA 3V05A 4RKLA 3UDGA 4CJ0B 1WCMH 4CDDC 5KEEA 3UE0A 2F0TA 2F3VA 3V2TA 5M3MB 3S9WA 3I55A 4KTAA 1I94Q 2RSNA 4NXNL 2K5HA 4PZ8A 1QVFA 2B2TC 2PZUA 3A56A 3UDIA 2UUBL 1SNCA 2NVYB 4JI7L 1XPUA 1E0BA 2IPKD 1SJHD 4LK1C 1QZGA 3CAMA 4A3KG 1N34Q 4DNIA 4X64L 1WTRA 3H6MA 1JWSD 3RN2A 4LFBL 3MXUA 4HCSA 1SR3A 1JE5A 1C48A 1KXLA 1EQVA 1MIUA 1SE4A 1E2ZA 2M9VA 3T16A 2DY7A 4J15A 1BCPB 2K52A 3A5ZB 1SMYD 1KDCA 5GADC 2QDBA 3PO3B 5LMNW 5AFWA 3JAML 4FF4A 1PMRA 3GV6A 2CW0D 1HHVA 2B2YC 3TMEA 3S17B 5EPLA 2AHOB 4NB3A 4KLKA 3TP8A 3T1YQ 4BBRB 3M3YH 4L5SA 3TZUA 3F8TA 1PH9A 3S15B 3OW7A 2A69D 1MJEA 5KRUA 3SK5A 4A3GG 1B9MA 3RZOB 1TT2A 4G4KA 2B63H 2ASBA 2NVTH 2JA7H 2UU9L 2XVSA 2QGQA 1STAA 1HPCA 3GTOB 3BDCA 1XMQL 2ALYB 4RH6A 1IZ6A 2UXCL 1B9NA 1HZ9A 1PYSB 3R93A 1N9WA 4C56C 1PLFA 5C0XG 3OMGA 3I3CA 1ENFA 1H95A 1B8AA 2EJGC 1MKHA 1M90C 4UDUC 1IL2A 4DV0Q 4LFAQ 2WB1E 4K5VA 1SYBA 1Q8IA 3MAQA 1CKNA 3SHLA 5G3LD 1E2WA 4C1NI 4A3DH 2F3IA 2QW7A 4CDCC 3X3MA 4DV5L 4XYOA 4KHPQ 2B2TA 2VQEL 1HA5A 1QVGA 1Y1WG 1D1IA 1TWCH 2EYLA 4DF7A 3OTOQ 4BA1I 3W1BA 1NSNS 2F0WA 4J8QA 4LF7L 3GTKB 4L5QA 4JYAL 2JA6H 1VQGA 1YNNC 3AFQA 2EY5A 2SOBA 4KHVA 3S16B 3OHXC 3KLRA 1AEXA 1DOLA 3UI2A 1TS5A 3NUCA 2ZTDA 2F0HA 3U9SA 3VYUA 4P71A 1XNQL 2PI2A 5C4XG 2LSSA 1AFPA 2TSSA 1O80A 4B08A 4HJ8A 4YCVA 3HOZG 2PW7A 5JJKA 4IPCA 3RMHA 1BVSA 3CMEA 1FJGQ 4DV1L 1WCMG 5KYIA 4H7BA 2B2YA 4OO1H 1SE2A 1BCPC 3BVGA 4IJLA 5D3IB 3TS2A 4XT3B 1I6VC 3J80i 2FHTA 2MPMA 4LF5L 2YTXA 1WD1A 2A68C 3E3XA 4LMQD 2F4VL 2JYOA 3DM1A 2A74C 4HMIA 3MFGA 2N3SA 4M8AA 1L1OC 3Q8DA 1UEAB 1YNXA 3H3VC 2SEBD 1CZGA 3A7LA 1Y69U 4LFCQ 1PFSA 2BDOA 1QZHA 1EOTA 1Y8PB 3K7UC 3OOCA 2R7ZB 1S5CD 1EYGA 3VYSA 4X3SA 1RF2D 1T5EA 3VR5A 4C3HH 3HOXH 3EVQA 1PVOA 1LTTD 2K04A 1GHKA 4DR5Q 4QUCA 2IJ0A 1XMOQ 2UXDL 1ILPA 2RQXA 5IODA 1I4PA 2F0PA 1ML0D 5IY0A 2ZM6Q 1EU4A 1JC7A 4EQ5A 4M1UB 3MEHA 3F2UA 1CFMA 3CCEA 3T1HQ 1H9JA 1S5BD 1EZ8A 5I9PA 1B3AA 1EIYB 4H44C 2C5CA 2I5HA 3GTLH 1PFNA 4A3KB 1VQOA 1N33Q 2B63G 2JA7G 5K5PA 1LLRD 3OW2A 4WJWA 3NK9A 3QR8A 5BR8Q 1F9PA 2VZAA 2D62A 1FYCA 2E5LL 1X3QA 1SYGA 2A1AA 4NMZA 1G51A 2FINB 4A76A 4B3MQ 1YBYA 3CKIB 2VY3A 2WB1G 4AYBE 4OWWB 4WORA 3CCMA 5I6YA 3I4MB 2LXJA 4LF6Q 2HUGA 1HCZA 5C6AA 1JJGA 1GUGA 3K81C 3MFYA 1MHWC 2J7ZA 4A3DG 3M7GA 1PH2A 3CPWA 4A3GB 1TS2A 4CKEA 3S2HH 4UAIA 1LYLA 4A4IA 1I50B 5ELDA 1YJ9A 3EA6A 2HHHL 1SNQA 3OWEB 1QNKA 4JI4L 1Y14B 3RD4A 3MC0B 3W2DA 1L1OA 4HAEA 1SEBD 3FHWA 2E2IH 1G291 5C4HA 5JEAH 4JC0A 3OPOA 1JMCA 2JA6G 2Q8RE 3C1EA 3QB3A 4DV7L 2DUDA 5D14A 4OEMB 2UUAL 1R9TH 1LT6D 4JI1L 3EFXD 4YCUA 5JJZA 4NXML 1KQSA 1BBWA 2V1CC 2YTYA 1JB3A 1EQTA 3NHHA 2JK8A 3FRPB 3G6JB 5HGQA 4YHHQ 4YWLA 5FLMH 3F2BA 4OO1G 3CCRA 4BS9A 4RG1A 3RUZA 2AQ2B 2HIXA 3FVQA 1WD0A 2XTIA 1Y1WB 4CDEC 1KRTA 1GJXA 1K83B 2NVXB 4I65A 1GUNA 1ICWA 3A7AB 2KOLA 4NP5A 3DEOA 1V43A 2KCNA 4DAVA 1PXUA 3G71A 5LMUQ 1UE1A 1U4PA 3GTMB 3TRZA 4ZUJA 3I70A 4K5XA 5C4XB 5GQOA 2F0LA 4GN4B 1PTOD 3H0GG 4POGA 4OWXB 4C3HG 3HOZB 4UPAA 1SDFA 3HOXG 3QOJA 1HJPA 1WCMB 2C9OA 4CGYB 4EQNA 3S1QH 5J39A 3P1HA 4KMUC 1LT4D 1V8QA 1HQMC 4DN4M 2F0SA 4F87A 2FMCA 1F2MA 2BA0A 2A5HA 1ILQA 5FO9B 1WTPA 2JEAI 1BXTA 4JI2L 1F2YA 4EVOA 1EIFA 4PZ7A 1D5XC 1VDZA 4KHZA 4IPHA 4KD4A 4AYBG 2WKCA 2SNMA 3CRKC 3M85A 3IKJA 4JI5Q 3J81j 2EYHA 2EXZA 2VB3X 1YJNA 3HG9A 5E4XA 3DWQA 2VNUD 4O0AA 4OONA 3B6YA 3E0JA 3AB9A 3OMCA 2GN5A 1DGSA 3M3YB 1HQRD 1M8AA 1SBBB 1SMYC 3GD7A 4IZ8A 5T1GA 4DV3L 4KK7A 2KHIA 2Q2TA 1EFWA 2K33A 2O2LD 1C9OA 4DKAC 3PIPA 3TQYA 3K8AA 5GROA 1CQVA 2F0JA 3GTJH 1SNMA 2B63B 4BWGB 2NVTB 1EWIA 2JA7B 3DWAA 3H94A 4V190 1BDOA 1UAPA 4A93H 3GO5A 1YJWA 1EFID 3P75A 4EQOA 4L5RC 2TMPA 4AQYQ 2RCNA 4S3SA 1ICFB 3PGZA 5JEAG 5M9OA 4JK1C 1N34L 4DAMA 4IALA 2B3GA 4R4QA 5CC4A 2A8VA 5KIXA 2WB1B 1TXYA 2CH4A 3JAMi 3W5OA 1RKNA 3M4YA 1WTVA 3PUVA 1DM0B 4GLAC 1SJED 3OIPA 2G5DA 2UXBL 3Q23A 1DCZA 4RMFA 4A3DB 3FPUB 3ULJA 1EQRA 1JR0D 1XNRL 5FLMG 1HH2P 2M2LA 4DU9A 4MTNA 4DNRB 1PHJA 2JA5H 1CT1D 3BDOA 3QG1A 3T1YL 4GS3A 4TVAB 1FD7D 1TWCB 4CKCA 1VQAA 4JI6Q 3Q22A 5CV8A 2F4IA 2MO0A 3HRZC 4K6DA 2JA6B 2EXDA 1H9RA 4TSSA 2XIWA 3D8GA 4IUUA 3K7AH 5FOBB 3S1NH 3BYYB 1OXVA 1X6OA 4EQPA 1VCIA 2RHQB 4OX9Q 1E22A 2Y0SG 4DK1A 3S14H 3MHBA 1NY4A 1B70B 3MTSA 3PUZA 3M4QA 1E24A 2L12A 2YYZA 2I46A 3D4RA 1RTOA 4H02A 3UDFA 4FXDA 3M4PA 5E4WC 5C5MA 2OWOA 4DV0L 4LFAL 2DY8A 1V1PA 2J4XA 4MN3A 5C4JH 3RNUA 1GOZA 3CRLC 2D5DA 1DYQA 1EY7A 3HOYH 4CJ1B 1A8VA 3BVMA 5CV7A 1GUOA 4EGVA 5I9OA 3KBGA 2Z8LA 1K73C 2MNAA 4GKJQ 3AU7A 5COYA 1EY9A 1KIXA 4KHPL 1BOSA 1U4RA 4EX5A 1VQ6A 4QGUA 3OTOL 3URYA 1NCVA 1AP0A 2A6EC 2LFNA 2PMZE 5IWAL 2L9HA 4YY3Q 1HZCA 4C3HB 4NPSA 2F0FA 3HOXB 3D31A 2EYFA 5C3WA 1SYFA 1XPOA 4K0KQ 1PH1A 3NELA 4C3IH 1XX8A 4HIDA 1B7YB 1HNXQ 3PO2H 2WIIB 1S3OA 1NMGA 1FGBD 2K6AA 2EPBA 3DM3A 1GM5A 3SXHA 3ICEA 1K8OA 1B1ZA 1FJGL 2ZJRA 1Q3LA 1HFNA 2N49A 1D8LA 2EE1A 5FKAC 2R93H 1IXRA 1MSHA 1CTMA 2H4OA 1FNWA 1PZJD 3Q6SA 4A93G 2ATWA 2K5VA 4AYBB 4J1MA 1PA6A 2BOSA 1GD7A 1TWFH 4QIWE 4N9TA 5ELOA 1QCBD 4YWKA 4LFCL 4HIOA 4UHVA 4JI3Q 3H09A 1IW7C 5EAYA 3AYHB 5ISRA 1PTOF 3CC2A 5D3DA 3R2IA 3T56B 4GN3B 3MZ5A 3HOVH 3VA7A 4QQBX 1Q7YC 4DR5L 1EEFD 1EU3A 4XQNA 1XMOL 3T4AC 5LMNQ 1SNDA 4U68A 2ZM6L 4B3SQ 3S2HB 1RCVD 1UWVA 3RZDH 2JA5G 4DR7L 4LUZA 2L1BA 1JORA 4JVZA 4PQXA 3T1HL 2V4DA 2F03A 3C1FA 2KHSA 4OL7A 1DXMA 4HN7A 3TSSA 2BDNA 2E2IB 2F0VA 2HDMA 1N33L 3PIP3 2RF4A 3C2PA 4IOCA 1R9TB 2EQSA 4ZK9B 1X65A 5BR8L 3HP3A 3KDFA 5JJIA 1ZKOA 3D6WA 3SK8A 4KKSA 3HKZG 2E74C 3CMAA 4JBWA 2QA4A 1SFOH 3I73A 3CQZH 3TREA 3C46A 3EIVA 4KV6A 2KENA 1HTLD 3I90A 4LF6L 2WAQE 1MBYA 1B50A 1HUMA 1R4QB 5JPMC 1C0AA 2Z4IA 2K5QA 4KY5A 3HOYG 1DONA 1VF5C 2ES2A 2EDGA 3GTPH 1Q46A 3BU2A 1ESFA 2CKZB 2E2JH 3I4NH 2VXWA 2R3ZA 4LF8Q 4DR4Q 3TEHB 5LL6X 5FLXL 1JICA 4C2MH 3BYTB 1ONLA 1AZPA 2Y0SB 2JA8H 1K0SA 3TP7A 1LTRD 2I0QA 4C3IG 3FPPA 3VR4A 3G4SA 3FKIG 2R61A 2JEBI 2VS1A 2I07B 3S1QB 2DNCA 3PO2G 1ET6A 3UE1A 2EIFA 2R7DA 2IL8A 5A2QL 1IHZA 3IFDA 1X32A 2AKWB 2PNHA 1KRSA 1C8CA 3STBC 2RSOA 1U4LA 1QVCA 1X3EA 2J0TD 5M5YH 4KY6A 2EYMA 2R93G 1H9MA 1KDAA 1HNZQ 2IHEA 1STEA 4IFDI 3T53B 1I3QH 2WINB 4DR6Q 3KJOA 3CD6A 3VR6A 3DLLA 2MGSA 1QG7A 1SAPA 1PFBA 5EKKA 1BBXC 1K8GA 3NTHA 5LMUL 1S72A 2XN9C 2Q2HA 3ND8A 1PRTF 4WFN3 1S5DD 2AMCB 1YNJC 1A0IA 1VQ7A 3JC66 1CKOA 1OXTA 2NN6H 3IFTA 2MUYA 3HOVG 1V1QA 1LUZA 5IYBH 3V96A 5CV6A 3S1MH 1O7ZA 1ZEQX 1NNXA 3WOEA 3GTJB 3SK6A 4E6IA 2KEEA 2R6GA 4JV5L 4QUFA 2XGTA 1YITA 4A93B 5CGKA 1SYCA 3DWPA 2E8GA 1BQQT 2HCIA 1CK1A 1RODA 2BA1A 1L2FA 1AZQA 3NE5B 5KGUA 1MI2A 4DR3L 4WRDA 2HQLA 1N36Q 2P5ZX 3FDTA 4UP8A 1II3A 2K5NA
chains in the Genus database with same CATH topology
5HGQA 1VQEA 3ULLA 3PCOB 4YWLA 5FLMH 4YHHQ 3F2BA 4DV2Q 4BA2I 4DUZQ 3J80c 3CCRA 4X62L 4OO1G 1GVPA 2N78A 4RG1A 1VQ5A 1IYJB 2HIXA 3CC7A 2K50A 1UE5A 1E7ZA 3S24A 1I6HH 1VQNA 3H15A 2KBNA 4B3ML 1KAWA 2XTIA 3GTQH 2YU9H 1Y1VG 2CCZA 2WAQG 3PUXA 3I7FA 1GO3E 1KRTA 4JI5L 1IBLL 2L15A 2R7ZH 1KHIA 3U4ZA 1PH6A 3ERSX 1XJVA 4QL5A 2I5MX 3PO3G 1OXSC 4JBJA 1V43A 1OXUA 3M7NA 4JG2A 1SE8A 3G71A 2IT1A 5LMUQ 1UE1A 1TWGH 2C35B 2ID0A 4JI0L 3TRZA 4B3RQ 2Z6KC 5IE8A 3HFZB 1G6PA 1A62A 2K75A 2Q2IA 4GOPC 1HR0W 2VQFQ 1VQBA 3ZJYC 1UE6A 5GQOA 2E2HH 1KD1C 4GN4B 4BBRG 4BXXH 4DR1L 1YVCA 3H0GG 3H0GH 3U4VA 1PH8A 2HHHQ 4OWXB 2PQAA 4POGA 4UPAA 4APVA 3HOXG 1VQ4A 3FP9A 4JBMA 4JI4Q 1D7QA 2IHFA 1QUQA 1HJPA 4LUOA 1E1TA 5C44H 3U50C 4A3KH 4PZ6A 1IBKQ 3I4NG 1U5KA 1WI5A 3S1QH 4DV7Q 1LM0A 2JQOA 4IO9A 3G48A 3EN2A 1HR0L 2UUAQ 3CCQA 1X3FA 2HT1A 2NVQH 2CQOA 4L5TA 5AJ3L 3NBHB 1E1OA 1IBML 1YEZA 4P74A 4JI1Q 2JA8G 5M5XH 1CKNB 4NXMQ 2BA0A 1Q1EA 3CW2C 5J3BA 3J7A5 1BBUA 5IP9G 2JEAI 2UXBQ 4O2DA 3CCJA 1HNWQ 3J81c 4JI2L 1J5EQ 1EIFA 4PZ7A 4A3FH 1TWHH 1XNRQ 4KHZA 4IPHA 3J81i 4B3TL 4XIGS 3CF5A 3I4MG 3EBEA 1VQ9A 1N36L 5H1SE 4AYBG 1M1KC 1L1OB 4P73A 1Q82C 1VQKA 4YHHL 3M85A 1YHQA 4DUZL 4ME3A 4GLVB 3KF8B 2QEXA 3L7ZC 3PUWA 4AIMA 1IBLQ 4Y7NH 3J81j 2OQKA 4JI5Q 3HKSA 1YJNA 1AE3A 4A3GH 2VNUD 1YZ6A 4O0AA 4OONA 4GNXB 3I2ZA 3B6YA 4JI6L 4R4CA 2GN5A 1W2BA 1K0RA 2K4KA 2B29A 3CPFA 4JI0Q 1I50H 3CCUA 1DGSA 2NN6I 4DK3C 1S40A 3GD7A 1PH3A 1PYBA 4LUVA 1WJJA 4DV3L 4NXNQ 2VUMG 1X3GA 1K9MC 2KHIA 2Q2TA 1JJ2A 1EFWA 4IOAA 5C0XJ 4DR1Q 1C9OA 4DKAC 3PIPA 3TQYA 5IYCH 3TS0A 2WP8J 4B3RL 3AQQA 3K8AA 5GROA 1O7IA 4POFA 2MQHA 3GTJH 4YCWA 4X66L 4A3EH 1EWIA 2CWPA 4OX9L 2NN6G 1XTDA 1Z47A 4X64Q 4A93H 3GO5A 1YJWA 4LFBQ 4XTCS 1HR0Q 4L5RC 4MZ9A 5IYBG 4AQYQ 2RCNA 4JCVE 3PGZA 4DAYB 5M5WH 2IX0A 5JEAG 5AJ3Q 1IBMQ 1N34L 1T9HA 2IX1A 4DAMA 4A3LH 2B3GA 4R4QA 2A8VA 4IFDJ 2DGYA 2HIVA 4GKKQ 1TXYA 3JAMi 4A3MH 3A5UA 2Z6KA 3A74A 3W5OA 3I4OA 5IP7H 4OO1I 4GOPA 2YV5A 4JI2Q 3PUVA 4BY1H 4GLAC 4A3JH 3KF6B 2BH2A 3KOJA 2Z0SA 4B3TQ 1CKMA 1Y1WH 2PQAB 2UXBL 3PIOA 4GKJL 4WJ3M 1K83H 4X65L 3PF4A 3W1GA 2NVXH 4RMFA 4DV4L 2UUCQ 3ULJA 1EQRA 1XNRL 2R92H 5IWAQ 5FLMG 1HH2P 2ZJPA 4LNQA 4BY7H 4JBKA 4HJAA 4MTNA 2NZOA 5JJLA 1PHJA 1UEBA 2JA5H 3CCLA 3GTMH 2K14A 3T1YL 4GS3A 3E0EA 4TVAB 1L0WA 1VQCA 3RN5A 5C4XH 1VQAA 4JI6Q 1N8RC 2R7ZG 1AE2A 3BJUA 4OWTB 4LWCA 3H3VI 4HIKA 2MO0A 3HOZH 1ASZA 4LF9L 4QY7A 1P8LA 2JE6I 2NVYH 4DV3Q 2EXDA 1HNXL 3E9IA 3UDGA 1X56A 1WCMH 1SLJA 3UE0A 3I55A 5IYDH 1MJCA 3K7AH 3K80C 3S1NH 1TWAH 1OXVA 1X6OA 4NXNL 1VCIA 2K5HA 2RHQB 4X66Q 1I94Q 4OX9Q 4PZ8A 1E22A 1QVFA 1P16A 4BXXG 2Y0SG 3S14H 3UDIA 1NY4A 1B70B 3PUZA 4JOIC 2UUBL 2ZJQA 3M4QA 3IRBA 4JI7L 1E24A 3PSIA 1PV4A 1XPUA 1NMFA 2YYZA 5C44G 1QZGA 3CAMA 4A3KG 1N34Q 4DNIA 4X64L 4H02A 3UDFA 1U0LA 3M4PA 3KJPA 3RN2A 1YI2A 4LFBL 3U58A 4A3CG 2OWOA 4A3BH 2Y0SE 1SR3A 4UP7A 1JE5A 4AQYL 3PF5A 1KXLA 3K0XA 4DV0L 1WFQA 1MIUA 1SMXA 5C4JH 4LFAL 3RNUA 5K36G 4GNXC 3HOYH 1A8VA 3HOUH 3VDYA 4J15A 2K52A 3A5ZB 4GKKL 5GADC 1K73C 1FL0A 2MNAA 5LMNW 4GKJQ 2D0PA 1JJCB 1YIJA 4X65Q 4JI3L 4A3FG 4DV4Q 1K3RA 4A3IH 1KIXA 3GTGH 4KHPL 2BH8A 4ALPA 1J6QA 1KL9A 4EX5A 1VQFA 1VQ6A 4QGUA 1VQLA 1RIPA 3OTOL 2GVAA 4DR7Q 2AHOB 4NB3A 3L2PA 4KLKA 2UUCL 3MEFA 3T1YQ 4LF4L 5IWAL 2PMZE 4L5SA 5GAGC 3M3YH 5LMNL 4YY3Q 1HZCA 3S1RH 1XNQQ 4NPSA 3D31A 1OTCA 3F8TA 1XPOA 1PH9A 4K0KQ 1PH1A 2PI2E 3NELA 1MJEA 4C3IH 2H5XA 4R4TA 4A3GG 2ZTEA 1VQDA 1FGUA 4HIDA 2FXQA 1B7YB 4LF9Q 1HNXQ 3PO2H 2B63H 1AH9A 2ASBA 2NVTH 4DV1Q 2KCTA 2D0OA 5E7NA 1S3OA 1NMGA 2JA7H 5FJ8H 2UU9L 3HOWH 3DM3A 2QGQA 1GM5A 5C3EH 4A3CH 3ICEA 1V9PA 1XMQL 1FJGL 2ZJRA 4UP9A 5GAHC 2ALYB 5IYCG 2UXCL 1IZ6A 2N49A 1D8LA 1HZ9A 2UUBQ 1WYDA 1PYSB 3S2DH 1ASYA 4JI7Q 1N9WA 1I94L 1IXRA 5C0XG 2R93H 4A3EG 4UY8C 3WWVA 1CSQA 2MFIA 1VQMA 1Q1BA 4A93G 2ATWA 1H95A 1B8AA 2K5VA 1MKHA 4PMWA 1M90C 1IL2A 4DV0Q 1PA6A 4LFAQ 2OQ0A 4OXPA 1VQPA 2WB1E 1GD7A 1VQJA 1TWFH 3JAMc 4QIWE 5ELOA 4A3LG 1CKNA 4A3DH 4BBSH 4YWKA 3KFUA 4A3MG 1X54A 2F3IA 5FLXc 5IP7G 1PH7A 1Q12A 4LFCL 4HIOA 2JA9A 2N8NA 1N32L 4DV5L 3RLOA 4BY1G 4A3JG 3PV0A 2LXKA 5EAYA 4HIMA 3AYHB 4JI3Q 4KHPQ 3CC2A 1UE7A 1BKBA 4GN3B 1WOCA 4R1JA 2CFMA 4LW1A 2VQEL 4JOIA 1SRUA 1TWCH 3KYHC 5JEAJ 1Y1WG 1Q7YC 1QVGA 3OTOQ 3HOVH 4QQBX 1RL2A 4GLXA 4DR5L 4MNOA 1QUQB 5M3FH 4BA1I 3W1BA 2R92G 1XMOL 1VQ8A 4LF4Q 2YTVA 4LF7L 4L5QA 4BY7G 5LMNQ 4JYAL 2JA6H 1VQGA 3AFQA 4LF8L 4DR4L 2ZM6L 4B3SQ 1UWVA 3RZDH 2NZHA 4P75A 2JA5G 4LUZA 4DR7L 5M3MH 4Y52H 4GNXA 3T1HL 2ZTDA 1KC8C 4YY3L 4IJHA 4P71A 1XNQL 2PI2A 5C4XG 2LSSA 1SROA 1X9NA 4K0KL 4HJ8A 1CSPA 2UU9Q 4YCVA 1E3PA 1YHBA 3HOZG 5JJKA 1N33L 4IPCA 2RF4A 1BVSA 1XMQQ 3CMEA 1FJGQ 4DV1L 4IOCA 3CXCA 1WCMG 2EQSA 2UXCQ 3RLNA 4IJLA 5IYDG 4IPDA 1X65A 4GN5A 5BR8L 1JT8A 3TS2A 4KI0A 3KDFA 3J80i 5JJIA 1NE3A 4LF5L 2YTXA 1I5FA 1Y1VH 3HKZG 5HY6A 2F4VL 4R4IA 4JBWA 3CMAA 2QA4A 2MO1A 4P72A 4R4OA 1SFOH 3M4OH 3CQZH 3TREA 2IY5B 1LTLA 1GKHA 2N3SA 3EIVA 1PH5A 1L1OC 3Q8DA 1HNZL 3PO3H 2KENA 1YNXA 4HJ5A 3CCVA 4LF6L 4QJFA 4A3BG 4DR6L 3MXNB 3HKZE 2WAQE 4IPGA 4YWMA 3SGIA 1FVIA 4LFCQ 1N32Q 3KLWA 4JI8L 1PFSA 4DV5Q 1QZHA 3S17H 2OTJA 3HOYG 1C0AA 3K7UC 3HOUG 3UDXA 1A63A 2ES2A 3KF6A 3BZKA 4DV6L 1EYGA 3H3VH 4BBRH 2VQEQ 3STBD 4AH6A 1Q46A 4HJ7A 3GTPH 4C3HH 2KCMA 1PVOA 3HOXH 1OXXK 4DR5Q 3S15H 2GVBA 3BU2A 4DUYL 4A3IG 2CKZB 2WFWA 1EOVA 2OCEA 1XMOQ 2UXDL 3RZOH 2E2JH 2VL6A 3D0FA 4LF7Q 3I4NH 4JYAQ 3CP0A 4LF8Q 4DR4Q 5IY0A 2AWOA 2ZM6Q 3TEHB 4C2MH 4EQ5A 1VQIA 4JV5Q 1HZBA 3CCEA 3T1HQ 1PH4A 1NTGA 2JA8H 3GTOH 4HJ9A 5IT9c 4B3SL 1EIYB 2OTLA 2I0QA 4X6AH 2I5HA 3BZCA 1VS0A 5IP9H 3GTLH 1VQHA 3FKIG 3FKIH 3G4SA 4GOPB 2F52A 2JEBI 2VS1A 4DR3Q 3RR5A 1VQOA 1N33Q 3PO2G 3G6EA 3UE1A 2B63G 2JA7G 5C0XI 2EIFA 2R7DA 1XPRA 5FJ8G 3OW2A 4X62Q 3HOWG 3I4MH 5DLQE 1C7YA 2AKWB 4DR2L 2PNHA 1KRSA 1Q8KA 2D62A 2VZAA 3STBC 5BR8Q 2RHSB 5C3EG 2E5LL 2A1AA 2R7FA 3GDEA 1G51A 3F1ZA 1Q86C 4DPGA 4DV2L 4A76A 4B3MQ 4LF5Q 1YBYA 3AEVA 2ZTCA 2F4VQ 1QVCA 1X3EA 2VY3A 5M5YH 2WB1G 4DK6C 3AFPA 3E9HA 2R93G 4AYBE 3A0JA 4OWWB 1HNZQ 3F2CA 4C3JH 2IHEA 1Q81C 3CCMA 4IFDI 1EQQA 2LXJA 1I3QH 4LF6Q 4DR6Q 3KJOA 3CD6A 1EUJA 3DLLA 1JJGA 3K81C 1X55A 4JI8Q 1K8GA 1YHAA 3I56A 3CC4A 2VUMH 5LMUL 4BBSG 1S72A 4DV6Q 2KHJA 2Q2UA 1PH2A 2Q2HA 3CPWA 3F2DA 3GTKH 3J7ZC 3ER0A 3LGJA 2AMCB 4PG3A 4IFDG 1A0IA 1VQ7A 3CCSA 3S16H 3S2HH 2JJQA 4DUYQ 2VQFL 3KDFB 3JC66 1LYLA 1CKOA 4A4IA 1OXTA 2UXDQ 1JB7A 3PUYA 1YJ9A 2HHHL 3HOVG 1V1QA 1LUZA 3M9BA 4JI4L 1K8AC 1Y14B 5IYBH 2I5LX 3L0OA 1NBWA 1L1OA 1NJIC 5M3FG 3S1MH 3RLFA 3FHWA 2E2IH 1G291 4JC0A 1HZAA 2AWNA 1IBKL 1JMCA 2JA6G 4DV7L 2DUDA 2UUAL 4A75A 4FDBA 2R6GA 5ELNA 5M3MG 1R9TH 4JV5L 2XGTA 1YITA 4JI1L 1SN8A 3NEMA 4YCUA 4NXML 1KQSA 3ULPA 1BBWA 2VW9A 2A19A 2V1CC 2YTYA 4A3DG 2E8GA 1W3SA 2CWAA 5GAEC 2BA1A 4WJ4A 1L2FA 3OYYA 3NENA 4TQUS 4DR2Q 2JK8A 1N36Q 1HNWL 4DR3L 2HQLA 4UP8A 1J5EL 2E5LQ 1CUKA 1Z9FA 2K5NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HGQ A;  1VQE A;  3ULL A;  3PCO B;  4YWL A;  5FLM H;  4YHH Q;  3F2B A;  4DV2 Q;  4BA2 I;  4DUZ Q;  3J80 c;  3CCR A;  4X62 L;  4OO1 G;  1GVP A;  2N78 A;  4RG1 A;  1VQ5 A;  1IYJ B;  2HIX A;  3CC7 A;  2K50 A;  1UE5 A;  1E7Z A;  3S24 A;  1I6H H;  1VQN A;  3H15 A;  2KBN A;  4B3M L;  1KAW A;  2XTI A;  3GTQ H;  2YU9 H;  1Y1V G;  2CCZ A;  2WAQ G;  3PUX A;  3I7F A;  1GO3 E;  1KRT A;  4JI5 L;  1IBL L;  2L15 A;  2R7Z H;  1KHI A;  3U4Z A;  1PH6 A;  3ERS X;  1XJV A;  4QL5 A;  2I5M X;  3PO3 G;  1OXS C;  4JBJ A;  1V43 A;  1OXU A;  3M7N A;  4JG2 A;  1SE8 A;  3G71 A;  2IT1 A;  5LMU Q;  1UE1 A;  1TWG H;  2C35 B;  2ID0 A;  4JI0 L;  3TRZ A;  4B3R Q;  2Z6K C;  5IE8 A;  3HFZ B;  1G6P A;  1A62 A;  2K75 A;  2Q2I A;  4GOP C;  1HR0 W;  2VQF Q;  1VQB A;  3ZJY C;  1UE6 A;  5GQO A;  2E2H H;  1KD1 C;  4GN4 B;  4BBR G;  4BXX H;  4DR1 L;  1YVC A;  3H0G G;  3H0G H;  3U4V A;  1PH8 A;  2HHH Q;  4OWX B;  2PQA A;  4POG A;  4UPA A;  4APV A;  3HOX G;  1VQ4 A;  3FP9 A;  4JBM A;  4JI4 Q;  1D7Q A;  2IHF A;  1QUQ A;  1HJP A;  4LUO A;  1E1T A;  5C44 H;  3U50 C;  4A3K H;  4PZ6 A;  1IBK Q;  3I4N G;  1U5K A;  1WI5 A;  3S1Q H;  4DV7 Q;  1LM0 A;  2JQO A;  4IO9 A;  3G48 A;  3EN2 A;  1HR0 L;  2UUA Q;  3CCQ A;  1X3F A;  2HT1 A;  2NVQ H;  2CQO A;  4L5T A;  5AJ3 L;  3NBH B;  1E1O A;  1IBM L;  1YEZ A;  4P74 A;  4JI1 Q;  2JA8 G;  5M5X H;  1CKN B;  4NXM Q;  2BA0 A;  1Q1E A;  3CW2 C;  5J3B A;  3J7A 5;  1BBU A;  5IP9 G;  2JEA I;  2UXB Q;  4O2D A;  3CCJ A;  1HNW Q;  3J81 c;  4JI2 L;  1J5E Q;  1EIF A;  4PZ7 A;  4A3F H;  1TWH H;  1XNR Q;  4KHZ A;  4IPH A;  3J81 i;  4B3T L;  4XIG S;  3CF5 A;  3I4M G;  3EBE A;  1VQ9 A;  1N36 L;  5H1S E;  4AYB G;  1M1K C;  1L1O B;  4P73 A;  1Q82 C;  1VQK A;  4YHH L;  3M85 A;  1YHQ A;  4DUZ L;  4ME3 A;  4GLV B;  3KF8 B;  2QEX A;  3L7Z C;  3PUW A;  4AIM A;  1IBL Q;  4Y7N H;  3J81 j;  2OQK A;  4JI5 Q;  3HKS A;  1YJN A;  1AE3 A;  4A3G H;  2VNU D;  1YZ6 A;  4O0A A;  4OON A;  4GNX B;  3I2Z A;  3B6Y A;  4JI6 L;  4R4C A;  2GN5 A;  1W2B A;  1K0R A;  2K4K A;  2B29 A;  3CPF A;  4JI0 Q;  1I50 H;  3CCU A;  1DGS A;  2NN6 I;  4DK3 C;  1S40 A;  3GD7 A;  1PH3 A;  1PYB A;  4LUV A;  1WJJ A;  4DV3 L;  4NXN Q;  2VUM G;  1X3G A;  1K9M C;  2KHI A;  2Q2T A;  1JJ2 A;  1EFW A;  4IOA A;  5C0X J;  4DR1 Q;  1C9O A;  4DKA C;  3PIP A;  3TQY A;  5IYC H;  3TS0 A;  2WP8 J;  4B3R L;  3AQQ A;  3K8A A;  5GRO A;  1O7I A;  4POF A;  2MQH A;  3GTJ H;  4YCW A;  4X66 L;  4A3E H;  1EWI A;  2CWP A;  4OX9 L;  2NN6 G;  1XTD A;  1Z47 A;  4X64 Q;  4A93 H;  3GO5 A;  1YJW A;  4LFB Q;  4XTC S;  1HR0 Q;  4L5R C;  4MZ9 A;  5IYB G;  4AQY Q;  2RCN A;  4JCV E;  3PGZ A;  4DAY B;  5M5W H;  2IX0 A;  5JEA G;  5AJ3 Q;  1IBM Q;  1N34 L;  1T9H A;  2IX1 A;  4DAM A;  4A3L H;  2B3G A;  4R4Q A;  2A8V A;  4IFD J;  2DGY A;  2HIV A;  4GKK Q;  1TXY A;  3JAM i;  4A3M H;  3A5U A;  2Z6K A;  3A74 A;  3W5O A;  3I4O A;  5IP7 H;  4OO1 I;  4GOP A;  2YV5 A;  4JI2 Q;  3PUV A;  4BY1 H;  4GLA C;  4A3J H;  3KF6 B;  2BH2 A;  3KOJ A;  2Z0S A;  4B3T Q;  1CKM A;  1Y1W H;  2PQA B;  2UXB L;  3PIO A;  4GKJ L;  4WJ3 M;  1K83 H;  4X65 L;  3PF4 A;  3W1G A;  2NVX H;  4RMF A;  4DV4 L;  2UUC Q;  3ULJ A;  1EQR A;  1XNR L;  2R92 H;  5IWA Q;  5FLM G;  1HH2 P;  2ZJP A;  4LNQ A;  4BY7 H;  4JBK A;  4HJA A;  4MTN A;  2NZO A;  5JJL A;  1PHJ A;  1UEB A;  2JA5 H;  3CCL A;  3GTM H;  2K14 A;  3T1Y L;  4GS3 A;  3E0E A;  4TVA B;  1L0W A;  1VQC A;  3RN5 A;  5C4X H;  1VQA A;  4JI6 Q;  1N8R C;  2R7Z G;  1AE2 A;  3BJU A;  4OWT B;  4LWC A;  3H3V I;  4HIK A;  2MO0 A;  3HOZ H;  1ASZ A;  4LF9 L;  4QY7 A;  1P8L A;  2JE6 I;  2NVY H;  4DV3 Q;  2EXD A;  1HNX L;  3E9I A;  3UDG A;  1X56 A;  1WCM H;  1SLJ A;  3UE0 A;  3I55 A;  5IYD H;  1MJC A;  3K7A H;  3K80 C;  3S1N H;  1TWA H;  1OXV A;  1X6O A;  4NXN L;  1VCI A;  2K5H A;  2RHQ B;  4X66 Q;  1I94 Q;  4OX9 Q;  4PZ8 A;  1E22 A;  1QVF A;  1P16 A;  4BXX G;  2Y0S G;  3S14 H;  3UDI A;  1NY4 A;  1B70 B;  3PUZ A;  4JOI C;  2UUB L;  2ZJQ A;  3M4Q A;  3IRB A;  4JI7 L;  1E24 A;  3PSI A;  1PV4 A;  1XPU A;  1NMF A;  2YYZ A;  5C44 G;  1QZG A;  3CAM A;  4A3K G;  1N34 Q;  4DNI A;  4X64 L;  4H02 A;  3UDF A;  1U0L A;  3M4P A;  3KJP A;  3RN2 A;  1YI2 A;  4LFB L;  3U58 A;  4A3C G;  2OWO A;  4A3B H;  2Y0S E;  1SR3 A;  4UP7 A;  1JE5 A;  4AQY L;  3PF5 A;  1KXL A;  3K0X A;  4DV0 L;  1WFQ A;  1MIU A;  1SMX A;  5C4J H;  4LFA L;  3RNU A;  5K36 G;  4GNX C;  3HOY H;  1A8V A;  3HOU H;  3VDY A;  4J15 A;  2K52 A;  3A5Z B;  4GKK L;  5GAD C;  1K73 C;  1FL0 A;  2MNA A;  5LMN W;  4GKJ Q;  2D0P A;  1JJC B;  1YIJ A;  4X65 Q;  4JI3 L;  4A3F G;  4DV4 Q;  1K3R A;  4A3I H;  1KIX A;  3GTG H;  4KHP L;  2BH8 A;  4ALP A;  1J6Q A;  1KL9 A;  4EX5 A;  1VQF A;  1VQ6 A;  4QGU A;  1VQL A;  1RIP A;  3OTO L;  2GVA A;  4DR7 Q;  2AHO B;  4NB3 A;  3L2P A;  4KLK A;  2UUC L;  3MEF A;  3T1Y Q;  4LF4 L;  5IWA L;  2PMZ E;  4L5S A;  5GAG C;  3M3Y H;  5LMN L;  4YY3 Q;  1HZC A;  3S1R H;  1XNQ Q;  4NPS A;  3D31 A;  1OTC A;  3F8T A;  1XPO A;  1PH9 A;  4K0K Q;  1PH1 A;  2PI2 E;  3NEL A;  1MJE A;  4C3I H;  2H5X A;  4R4T A;  4A3G G;  2ZTE A;  1VQD A;  1FGU A;  4HID A;  2FXQ A;  1B7Y B;  4LF9 Q;  1HNX Q;  3PO2 H;  2B63 H;  1AH9 A;  2ASB A;  2NVT H;  4DV1 Q;  2KCT A;  2D0O A;  5E7N A;  1S3O A;  1NMG A;  2JA7 H;  5FJ8 H;  2UU9 L;  3HOW H;  3DM3 A;  2QGQ A;  1GM5 A;  5C3E H;  4A3C H;  3ICE A;  1V9P A;  1XMQ L;  1FJG L;  2ZJR A;  4UP9 A;  5GAH C;  2ALY B;  5IYC G;  2UXC L;  1IZ6 A;  2N49 A;  1D8L A;  1HZ9 A;  2UUB Q;  1WYD A;  1PYS B;  3S2D H;  1ASY A;  4JI7 Q;  1N9W A;  1I94 L;  1IXR A;  5C0X G;  2R93 H;  4A3E G;  4UY8 C;  3WWV A;  1CSQ A;  2MFI A;  1VQM A;  1Q1B A;  4A93 G;  2ATW A;  1H95 A;  1B8A A;  2K5V A;  1MKH A;  4PMW A;  1M90 C;  1IL2 A;  4DV0 Q;  1PA6 A;  4LFA Q;  2OQ0 A;  4OXP A;  1VQP A;  2WB1 E;  1GD7 A;  1VQJ A;  1TWF H;  3JAM c;  4QIW E;  5ELO A;  4A3L G;  1CKN A;  4A3D H;  4BBS H;  4YWK A;  3KFU A;  4A3M G;  1X54 A;  2F3I A;  5FLX c;  5IP7 G;  1PH7 A;  1Q12 A;  4LFC L;  4HIO A;  2JA9 A;  2N8N A;  1N32 L;  4DV5 L;  3RLO A;  4BY1 G;  4A3J G;  3PV0 A;  2LXK A;  5EAY A;  4HIM A;  3AYH B;  4JI3 Q;  4KHP Q;  3CC2 A;  1UE7 A;  1BKB A;  4GN3 B;  1WOC A;  4R1J A;  2CFM A;  4LW1 A;  2VQE L;  4JOI A;  1SRU A;  1TWC H;  3KYH C;  5JEA J;  1Y1W G;  1Q7Y C;  1QVG A;  3OTO Q;  3HOV H;  4QQB X;  1RL2 A;  4GLX A;  4DR5 L;  4MNO A;  1QUQ B;  5M3F H;  4BA1 I;  3W1B A;  2R92 G;  1XMO L;  1VQ8 A;  4LF4 Q;  2YTV A;  4LF7 L;  4L5Q A;  4BY7 G;  5LMN Q;  4JYA L;  2JA6 H;  1VQG A;  3AFQ A;  4LF8 L;  4DR4 L;  2ZM6 L;  4B3S Q;  1UWV A;  3RZD H;  2NZH A;  4P75 A;  2JA5 G;  4LUZ A;  4DR7 L;  5M3M H;  4Y52 H;  4GNX A;  3T1H L;  2ZTD A;  1KC8 C;  4YY3 L;  4IJH A;  4P71 A;  1XNQ L;  2PI2 A;  5C4X G;  2LSS A;  1SRO A;  1X9N A;  4K0K L;  4HJ8 A;  1CSP A;  2UU9 Q;  4YCV A;  1E3P A;  1YHB A;  3HOZ G;  5JJK A;  1N33 L;  4IPC A;  2RF4 A;  1BVS A;  1XMQ Q;  3CME A;  1FJG Q;  4DV1 L;  4IOC A;  3CXC A;  1WCM G;  2EQS A;  2UXC Q;  3RLN A;  4IJL A;  5IYD G;  4IPD A;  1X65 A;  4GN5 A;  5BR8 L;  1JT8 A;  3TS2 A;  4KI0 A;  3KDF A;  3J80 i;  5JJI A;  1NE3 A;  4LF5 L;  2YTX A;  1I5F A;  1Y1V H;  3HKZ G;  5HY6 A;  2F4V L;  4R4I A;  4JBW A;  3CMA A;  2QA4 A;  2MO1 A;  4P72 A;  4R4O A;  1SFO H;  3M4O H;  3CQZ H;  3TRE A;  2IY5 B;  1LTL A;  1GKH A;  2N3S A;  3EIV A;  1PH5 A;  1L1O C;  3Q8D A;  1HNZ L;  3PO3 H;  2KEN A;  1YNX A;  4HJ5 A;  3CCV A;  4LF6 L;  4QJF A;  4A3B G;  4DR6 L;  3MXN B;  3HKZ E;  2WAQ E;  4IPG A;  4YWM A;  3SGI A;  1FVI A;  4LFC Q;  1N32 Q;  3KLW A;  4JI8 L;  1PFS A;  4DV5 Q;  1QZH A;  3S17 H;  2OTJ A;  3HOY G;  1C0A A;  3K7U C;  3HOU G;  3UDX A;  1A63 A;  2ES2 A;  3KF6 A;  3BZK A;  4DV6 L;  1EYG A;  3H3V H;  4BBR H;  2VQE Q;  3STB D;  4AH6 A;  1Q46 A;  4HJ7 A;  3GTP H;  4C3H H;  2KCM A;  1PVO A;  3HOX H;  1OXX K;  4DR5 Q;  3S15 H;  2GVB A;  3BU2 A;  4DUY L;  4A3I G;  2CKZ B;  2WFW A;  1EOV A;  2OCE A;  1XMO Q;  2UXD L;  3RZO H;  2E2J H;  2VL6 A;  3D0F A;  4LF7 Q;  3I4N H;  4JYA Q;  3CP0 A;  4LF8 Q;  4DR4 Q;  5IY0 A;  2AWO A;  2ZM6 Q;  3TEH B;  4C2M H;  4EQ5 A;  1VQI A;  4JV5 Q;  1HZB A;  3CCE A;  3T1H Q;  1PH4 A;  1NTG A;  2JA8 H;  3GTO H;  4HJ9 A;  5IT9 c;  4B3S L;  1EIY B;  2OTL A;  2I0Q A;  4X6A H;  2I5H A;  3BZC A;  1VS0 A;  5IP9 H;  3GTL H;  1VQH A;  3FKI G;  3FKI H;  3G4S A;  4GOP B;  2F52 A;  2JEB I;  2VS1 A;  4DR3 Q;  3RR5 A;  1VQO A;  1N33 Q;  3PO2 G;  3G6E A;  3UE1 A;  2B63 G;  2JA7 G;  5C0X I;  2EIF A;  2R7D A;  1XPR A;  5FJ8 G;  3OW2 A;  4X62 Q;  3HOW G;  3I4M H;  5DLQ E;  1C7Y A;  2AKW B;  4DR2 L;  2PNH A;  1KRS A;  1Q8K A;  2D62 A;  2VZA A;  3STB C;  5BR8 Q;  2RHS B;  5C3E G;  2E5L L;  2A1A A;  2R7F A;  3GDE A;  1G51 A;  3F1Z A;  1Q86 C;  4DPG A;  4DV2 L;  4A76 A;  4B3M Q;  4LF5 Q;  1YBY A;  3AEV A;  2ZTC A;  2F4V Q;  1QVC A;  1X3E A;  2VY3 A;  5M5Y H;  2WB1 G;  4DK6 C;  3AFP A;  3E9H A;  2R93 G;  4AYB E;  3A0J A;  4OWW B;  1HNZ Q;  3F2C A;  4C3J H;  2IHE A;  1Q81 C;  3CCM A;  4IFD I;  1EQQ A;  2LXJ A;  1I3Q H;  4LF6 Q;  4DR6 Q;  3KJO A;  3CD6 A;  1EUJ A;  3DLL A;  1JJG A;  3K81 C;  1X55 A;  4JI8 Q;  1K8G A;  1YHA A;  3I56 A;  3CC4 A;  2VUM H;  5LMU L;  4BBS G;  1S72 A;  4DV6 Q;  2KHJ A;  2Q2U A;  1PH2 A;  2Q2H A;  3CPW A;  3F2D A;  3GTK H;  3J7Z C;  3ER0 A;  3LGJ A;  2AMC B;  4PG3 A;  4IFD G;  1A0I A;  1VQ7 A;  3CCS A;  3S16 H;  3S2H H;  2JJQ A;  4DUY Q;  2VQF L;  3KDF B;  3JC6 6;  1LYL A;  1CKO A;  4A4I A;  1OXT A;  2UXD Q;  1JB7 A;  3PUY A;  1YJ9 A;  2HHH L;  3HOV G;  1V1Q A;  1LUZ A;  3M9B A;  4JI4 L;  1K8A C;  1Y14 B;  5IYB H;  2I5L X;  3L0O A;  1NBW A;  1L1O A;  1NJI C;  5M3F G;  3S1M H;  3RLF A;  3FHW A;  2E2I H;  1G29 1;  4JC0 A;  1HZA A;  2AWN A;  1IBK L;  1JMC A;  2JA6 G;  4DV7 L;  2DUD A;  2UUA L;  4A75 A;  4FDB A;  2R6G A;  5ELN A;  5M3M G;  1R9T H;  4JV5 L;  2XGT A;  1YIT A;  4JI1 L;  1SN8 A;  3NEM A;  4YCU A;  4NXM L;  1KQS A;  3ULP A;  1BBW A;  2VW9 A;  2A19 A;  2V1C C;  2YTY A;  4A3D G;  2E8G A;  1W3S A;  2CWA A;  5GAE C;  2BA1 A;  4WJ4 A;  1L2F A;  3OYY A;  3NEN A;  4TQU S;  4DR2 Q;  2JK8 A;  1N36 Q;  1HNW L;  4DR3 L;  2HQL A;  4UP8 A;  1J5E L;  2E5L Q;  1CUK A;  1Z9F A;  2K5N A; 
#chains in the Genus database with same CATH topology
 4MHE A;  4DUZ Q;  3J80 c;  1EIG A;  5IT9 L;  4X62 L;  1JOQ A;  1GVP A;  2K50 A;  1I6H H;  2FFK B;  2KBN A;  2NBF A;  5LL6 S;  2CCZ A;  2QEJ C;  2WAQ G;  3I7F A;  4JI5 L;  2L15 A;  3DEP A;  1ZXT A;  4XYQ A;  1XJV A;  1TII D;  4L6T B;  4QL5 A;  1OXU A;  3DUZ A;  1J8I A;  4HED A;  2JA5 B;  1TWG H;  4B3R Q;  4KJO A;  2Z6K C;  1A62 A;  2K75 A;  2Q2I A;  1HR0 W;  1VQB A;  2E2H H;  2PW5 A;  1KD1 C;  2F1M A;  1KDB A;  4BXX H;  3H0G H;  1PH8 A;  2PQA A;  4APV A;  2F0M A;  2XRS D;  1D7Q A;  4F7X A;  1A15 A;  1I4X A;  1AN8 A;  3Q24 A;  2EY1 A;  3I4N G;  3HGB A;  1GUS A;  4XXE A;  1WI5 A;  3I91 A;  5CR3 A;  3K7A B;  3S1N B;  3G48 A;  4A3C H;  4Y52 H;  2WKD A;  1X3F A;  2Z9H A;  2NVQ H;  2CQO A;  4L5T A;  1B4O A;  2JA8 G;  3S14 B;  3HKZ B;  2LMC B;  5JVG 3;  3KUP A;  3J7A 5;  1BBU A;  4O2D A;  1SYE A;  2HQE A;  1J5E Q;  4A3F H;  4IQZ A;  2HD3 A;  4RAU C;  3W3A A;  4O42 A;  5C4J B;  2IW3 A;  2K03 A;  3HOY B;  1M1K C;  1D5Z C;  4P73 A;  3BS1 A;  2B2W C;  1CA5 A;  1STH A;  4ULL A;  4GLV B;  3QOL A;  3L7Z C;  3PUW A;  3T13 A;  5HGT A;  2PMZ B;  2K7V A;  1WTQ A;  1PTO H;  4N8F A;  4CKB A;  3SVM A;  2EYJ A;  3K59 A;  1STN A;  5IIF A;  4JI6 L;  5L37 A;  3J7A V;  2BE5 C;  1K0R A;  2B29 A;  3CPF A;  1MD2 D;  4JI0 Q;  4QMG A;  1QJO A;  4NW2 A;  1PH3 A;  4NXN Q;  1K9M C;  1JJ2 A;  4C3I B;  4DR1 Q;  1AH9 A;  3AQQ A;  4POF A;  3NWS A;  4GZY C;  3PO2 B;  4A3E H;  2CWP A;  4OX9 L;  1XTD A;  2NN6 G;  1DJR D;  4X64 Q;  1WTO A;  4LFB Q;  3BG3 A;  4MZ9 A;  5IYB G;  1RD9 D;  2N88 A;  5M5W H;  4DAY B;  2IX0 A;  5AJ3 Q;  1IBM Q;  4IUT A;  4A3L H;  1DOK A;  4IFD J;  2KQ3 A;  2R93 B;  1JCK B;  4QIW B;  2Z6K A;  3A74 A;  2B2U C;  4H13 C;  2RA4 A;  5IP7 H;  1U9R A;  4BY1 H;  4A3J H;  1U4M A;  2EJM A;  2D9U A;  1CKM A;  3NTK A;  3PIO A;  1TWF B;  4GKJ L;  4WJ3 M;  3PF4 A;  3NTI A;  1G8Z D;  2R92 H;  4X3U A;  4BY7 H;  1KNA A;  4HJA A;  5JJL A;  3CCL A;  1Q90 A;  1WTH A;  2HCC A;  2K14 A;  1L0W A;  3HOV B;  1AE2 A;  3BJU A;  4LWC A;  3J7A F;  4RHR A;  3HEJ A;  1ASZ A;  5I2X A;  1HNX L;  2NVY H;  4DA2 A;  1V1O A;  3RZD B;  1X56 A;  4K2L A;  1TQO A;  4RHS A;  1HRJ A;  2SNS A;  2RDF A;  2E2D C;  5IYD H;  1MJC A;  1TWA H;  1IYV A;  4CHT B;  2DJG C;  3LWU A;  1CHP D;  2XSC A;  4BXX G;  4PMB A;  5DEH A;  5C5L A;  4B9X A;  4JOI C;  3NQI A;  2QKI C;  1MSG A;  1CHQ D;  2ZXO A;  3EQL C;  5C3X A;  1YI2 A;  1U0L A;  4F88 A;  3KJP A;  5FO7 B;  4A3C G;  3IAY A;  4A3B H;  2Y0S E;  3K6O A;  4UP7 A;  2KCC A;  1PZK D;  2L0C A;  3K0X A;  2QF7 A;  1SMX A;  1WFQ A;  4TKO B;  5D65 A;  2WAQ B;  3HOU H;  3NSW A;  4FXK C;  2ENB A;  1SFO B;  3CQZ B;  4GKK L;  1F2L A;  2K01 A;  2D0P A;  1JJC B;  1YIJ A;  2QCP X;  4X65 Q;  4JI3 L;  4A3F G;  1K3R A;  2QDL A;  4A3I H;  1I4G A;  1J6Q A;  1KL9 A;  3GQB A;  4HCE A;  5JOB A;  2FJ2 A;  2UUC L;  3MEF A;  1LTB D;  1TY2 A;  1D2B A;  3GTP B;  5LMN L;  1DD2 A;  1XNQ Q;  1D1K A;  2B2U A;  3D4D A;  5I6W A;  1EWC A;  4R4T A;  1VQD A;  1FGU A;  2E2J B;  3I4N B;  4LF9 Q;  5CBA E;  4DV1 Q;  2D0O A;  4C2M B;  4FF3 A;  1LTS D;  1NAP A;  5T1I A;  5FJ8 H;  2F0U A;  1L0X B;  1V9P A;  3TBI B;  2G9D A;  1TS3 A;  4UP9 A;  5GAH C;  2QIL A;  1TKW B;  2CW0 C;  3S2D H;  3NXW A;  1I94 L;  4ZQ3 A;  4A3E G;  4K6L A;  5F2D A;  1CSQ A;  2MFI A;  1VQM A;  1Q1B A;  2E75 C;  4HTH A;  3VR2 A;  3A8K E;  1VQP A;  4IUV A;  4OXP A;  4ZYS A;  1KAA A;  3JAM c;  2A69 C;  4A3L G;  3A8I E;  4BBS H;  5M5Y B;  3KFU A;  3TP6 A;  1X54 A;  5FLX c;  3KK7 A;  5IP7 G;  2EY2 A;  1PH7 A;  5EKI A;  4BY1 G;  4A3J G;  4HIM A;  1I3Q B;  2LXK A;  2Q8T A;  4HMJ A;  5TSS A;  1UE7 A;  1BKB A;  1WOC A;  4JOI A;  1SRU A;  1D5M C;  1SNO A;  4V0B A;  2JN4 A;  1HTP A;  5M3F H;  2R92 G;  4LF4 Q;  1F9S A;  4RCN A;  2YTV A;  4BY7 G;  1FNU A;  4LF8 L;  4DR4 L;  1DOM A;  1EYC A;  4P75 A;  2XWB B;  1X9N A;  2EJF C;  3S1M B;  3E6Z X;  1YHB A;  4HSV A;  4XQJ A;  1K3B C;  5FO8 B;  3QWN A;  4Z9C B;  1B44 D;  1SE3 A;  5IGG A;  3I8Z A;  4KY7 A;  1F77 A;  3RLN A;  5IYD G;  1PRT D;  2ZXR A;  4IPD A;  4H0L C;  1JT8 A;  4OIK A;  4KD3 A;  1S5E D;  5EJW A;  1NE3 A;  2F0G A;  4DNT B;  1I5F A;  1Y1V H;  4PV1 C;  4MIU A;  4R4I A;  4JPB W;  3M4O H;  1S5F D;  3O13 A;  4QF4 A;  2X69 A;  1GKH A;  4DAY A;  1PH5 A;  4FF2 A;  1HNZ L;  4R8N A;  1JOO A;  4A3B G;  4DR6 L;  3MXN B;  3HKZ E;  3SGI A;  4YWM A;  1I6H B;  3TP5 A;  1FVI A;  5EPJ A;  4DAP A;  1N32 Q;  4TRD A;  1A63 A;  2OTJ A;  3HOU G;  3UDX A;  3PIO 3;  3TDQ A;  4HJ7 A;  2KCM A;  1OXX K;  4A3I G;  1TWG B;  2F3W A;  2VL6 A;  2NTS A;  3J81 E;  1JOK A;  2OXP A;  2AWO A;  2D2C C;  2ICE C;  2E2H B;  1TR5 A;  1PH4 A;  1NTG A;  3H0G B;  4XT1 B;  3D4W A;  1I4R A;  5IT9 c;  1HUN A;  2CVR A;  1VQH A;  3FKI H;  4GOP B;  3RR5 A;  2F0Q A;  2NVQ B;  3IL8 A;  5FJ8 G;  5JPN C;  5LHY 1;  3I4M H;  2IX3 A;  3GV3 A;  4FO2 A;  1I4H A;  2RHS B;  1QNU A;  2R7F A;  3GDE A;  4NDX A;  3F1Z A;  5J1Z A;  4DPG A;  3VYT A;  3OIQ A;  5KYL A;  3GTL B;  5IOC A;  4IUR A;  1Y8N B;  3EJI A;  2Q8I B;  2EOT A;  4A3F B;  2F0D A;  3A0J A;  4C3J H;  4IN3 A;  1Q81 C;  2F0E A;  4F8M A;  1EUJ A;  1X55 A;  4JI8 Q;  4RGT A;  1O7Y A;  1YHA A;  3CC4 A;  2VUM H;  4BBS G;  4DV6 Q;  1EY5 A;  2KHJ A;  1LTI D;  3J7Z C;  3C3L A;  3LGJ A;  1PTO B;  3CCS A;  4G7Z C;  3QJY A;  4DUY Q;  1EYA A;  3PUY A;  3K5N A;  1B3Q A;  2I5L X;  1EY6 A;  3L0O A;  5M3F G;  3BZD B;  4N9P A;  4XQQ A;  1HZA A;  1G2T A;  1KNE A;  2DN8 A;  4A75 A;  3CHB D;  1HXY D;  5C4Z A;  2Z1C A;  4A3E B;  2DJF C;  1SN8 A;  1W6K A;  3NEM A;  3ULP A;  2VW9 A;  2A19 A;  1IKL A;  1LT3 D;  1W3S A;  2K32 A;  5GAE C;  3OYY A;  3BVZ A;  3NEN A;  4TQU S;  4DR2 Q;  2EYO A;  1J5E L;  2SDF A;  5ELE A;  1ZYR D;  3ULL A;  3PCO B;  3U9O A;  4DV2 Q;  4BA2 I;  1RHP A;  4BY1 B;  4A3J B;  1IYJ B;  1OO9 B;  3CC7 A;  1JWM D;  1UE5 A;  3WOF A;  1K8M A;  3H15 A;  4B3M L;  1KAW A;  3GTQ H;  3K5O A;  3R8B A;  1Y1V G;  5KND A;  2YU9 H;  3PUX A;  2MHV A;  1ENC A;  1KHI A;  3U4Z A;  1PH6 A;  2R92 B;  2I5M X;  1OXS C;  4BY7 B;  4JBJ A;  3FMC A;  1SE8 A;  2IT1 A;  2PZT A;  1XXG A;  2ID0 A;  4JI0 L;  2PNR C;  2PYK A;  3HFZ B;  1G6P A;  4KKU A;  4GOP C;  2VQF Q;  3LX0 A;  3PMF A;  3ZJY C;  1UE6 A;  1EY8 A;  2L5T A;  4PMC A;  3U4V A;  4DR1 L;  1QOH A;  4G57 A;  1VQ4 A;  2IHF A;  1G2S A;  4RGM A;  1E1T A;  5C44 H;  3U50 C;  2X6G A;  4PZ6 A;  1IBK Q;  1LM0 A;  2JQO A;  3EN2 A;  1TWA B;  1A3V A;  5AJ3 L;  1BR9 A;  1E1O A;  3NBH B;  1YEZ A;  4P74 A;  1IBM L;  5K36 H;  5M5X H;  3TN2 A;  1RJT A;  1Q1E A;  2O4X A;  3CW2 C;  1GXD C;  2UXB Q;  4DFA A;  3CCJ A;  1HNW Q;  2BCO A;  1BCP F;  2K5D A;  1LTG D;  4A3B B;  3K5L A;  1TWH H;  1XNR Q;  4XIG S;  3CF5 A;  3I4M G;  3EBE A;  3LWE A;  2K5W A;  1PTO C;  5ELF A;  1L1O B;  3HOU B;  4YHH L;  1BNZ A;  3KF8 B;  1PZI D;  2LY7 A;  1IBL Q;  4Y7N H;  2OQK A;  5HUR A;  4A3I B;  3HKS A;  3R3O A;  1YZ6 A;  1CM9 A;  4GNX B;  2PZW A;  4C3J G;  4XDX A;  3E5S A;  2LS0 1;  1D6E C;  3NPP A;  3MXN A;  1W2B A;  2K4K A;  1O7L A;  3CCU A;  4CDF C;  1PRT B;  1PYB A;  2ZXP A;  2VUM G;  1H9S B;  4IOA A;  1F2Z A;  3NQT A;  5IYC H;  5DNF A;  1O7I A;  3K0Y A;  3QIA A;  1UUP A;  2MQH A;  2MJ8 A;  4YCW A;  1I4Q A;  3LNN A;  4ABN A;  1AW7 A;  3MVV A;  4K14 A;  4FYD A;  1J9O A;  1Z47 A;  1STY A;  5I2Y A;  1HR0 Q;  4IUQ A;  4JCV E;  1F9R A;  2PO4 A;  1QE6 A;  1LO5 D;  5KNC A;  2G9H D;  3HZX A;  3S2D B;  2HIV A;  2LKV A;  5BN3 A;  4A3M H;  3I4O A;  2L11 A;  4GOP A;  2YV5 A;  4R9W A;  5DM7 3;  3KF6 B;  3SE0 A;  2X6L A;  4MTK A;  4Q5V A;  2BH2 A;  4B3T Q;  3A55 A;  1W6J A;  4X65 L;  4BBS B;  1GHJ A;  5IWA Q;  5J22 A;  1VMP A;  2RDH A;  5BN5 A;  4X3K A;  1UNS A;  3J81 L;  1VF7 A;  3J80 E;  2K1B A;  1VQC A;  5I4D A;  3CU7 A;  4OWT B;  5M3F B;  2N55 A;  3H3V I;  4O1N A;  4LF9 L;  2OT2 A;  5EBC A;  1PYW D;  1SLJ A;  2O5I C;  3K80 C;  4KN7 C;  2JXM B;  4X66 Q;  1T5X D;  1P16 A;  1KAB A;  5IGC A;  2ZJQ A;  2A6E D;  2K05 A;  1HA6 A;  3IRB A;  3PSI A;  1NUC A;  1PV4 A;  1NMF A;  4N8X 1;  5C44 G;  2KEC A;  1QWY A;  1CA6 A;  1A3T A;  3U58 A;  3QO2 A;  4RGN A;  1ENA A;  5EKL A;  4AQY L;  3PF5 A;  3TZD A;  2A6H D;  4RWS C;  1TY0 A;  2HDL A;  5K36 G;  1Y1V B;  4GNX C;  2OEO A;  4PNY A;  4RGO S;  3M4O B;  3VDY A;  4DXG A;  1FL0 A;  2F0N A;  3K57 A;  1A6X A;  4ZCK A;  1STG A;  3D6C A;  4DV4 Q;  4ZAI A;  3GTG H;  1PRT C;  2BH8 A;  4ALP A;  1NR2 A;  2Z4H A;  3FEW X;  1VQF A;  1VQL A;  1RIP A;  2GVA A;  4DR7 Q;  1PFM A;  3L2P A;  4LF4 L;  5GAG C;  4P2C B;  3S1R H;  1LTA D;  4RA8 A;  1OTC A;  2B39 A;  2PI2 E;  2F0I A;  2H5X A;  5JAV A;  2ZTE A;  2OF1 A;  3A8J E;  2FXQ A;  3KBX A;  4J6H A;  1WTW A;  3SR1 A;  2KCT A;  5E7N A;  5A35 A;  3HOW H;  1IW7 D;  1S4Z A;  2AUK A;  1KTK A;  5C3E H;  5CBE E;  2CHB D;  4QB4 A;  1F9Q A;  5IYC G;  3FKI B;  1WTX A;  2KA7 A;  2UUB Q;  1WYD A;  1ASY A;  4JI7 Q;  4UY8 C;  2PQE A;  3WWV A;  5KNB A;  1M4V A;  1SNP A;  4PMW A;  2RBM A;  4C1N K;  4G7H C;  2OQ0 A;  2XNA C;  3Q0A A;  1VQJ A;  3OSO A;  4KJN A;  3NBH A;  1JQY D;  2EVB A;  3L9A X;  3I72 A;  5EPK A;  1ESR A;  4A3M G;  1Q12 A;  2EYP A;  3VA5 A;  2JA9 A;  2B2V C;  2N8N A;  1TVX A;  1CI3 M;  4C3J B;  3RLO A;  4IFD H;  1N32 L;  3PV0 A;  4B9W A;  3J7Y W;  4QCL A;  2M00 A;  5CV5 A;  4OGQ C;  1Z7T A;  4R1J A;  2CFM A;  4LW1 A;  3KYH C;  5JEA J;  1XTC D;  1RL2 A;  4GLX A;  4MNO A;  4OIJ A;  1QUQ B;  2ICI A;  2VUM B;  2O5J C;  1VQ8 A;  3KF8 A;  1A3U A;  2PPB C;  4RKB A;  2NZH A;  5M3M H;  1V1P B;  4GNX A;  1G91 A;  2RCF A;  2B8F A;  2Z6B A;  4LAA A;  4YY3 L;  4IJH A;  1KC8 C;  5E1F A;  1EZ6 A;  1SRO A;  1WVL A;  4K0K L;  1CSP A;  2UU9 Q;  1VMC A;  1E3P A;  2JP1 A;  1XMQ Q;  3CXC A;  1H9S A;  1PDQ A;  2H1E A;  2UXC Q;  4L8J A;  3SDZ A;  2XWJ B;  4GN5 A;  1QIL A;  2B2W A;  4KI0 A;  2AUJ D;  1XYI A;  1C4Q A;  3MWY W;  4FP5 D;  5JVH 3;  5HY6 A;  2MO1 A;  4P72 A;  4R4O A;  1KLU D;  4YIJ A;  2IY5 B;  1LTL A;  2EZV A;  3PO3 H;  2RDG A;  3VYR A;  1QB5 D;  4HJ5 A;  3SK4 A;  3CCV A;  4QJF A;  3ZYY X;  4IPG A;  5DM6 3;  3GTQ B;  3KLW A;  4JI8 L;  4DV5 Q;  2YU9 B;  3S17 H;  3NBI A;  3G7L A;  5IGB A;  1CQF A;  3KF6 A;  4R8I A;  3BZK A;  4DV6 L;  3AMU A;  1DZ1 A;  3H3V H;  4BBR H;  2VQE Q;  3KLS A;  3STB D;  3VR3 A;  4AH6 A;  1ZYR C;  3R2T A;  5ELB A;  1SXT A;  4Q0F A;  3S15 H;  2GVB A;  4DUY L;  3DHQ A;  2WFW A;  1EOV A;  2OCE A;  3P20 A;  3RZO H;  4LF7 Q;  3D0F A;  4JYA Q;  4KN4 C;  3CP0 A;  3H91 A;  4RFB A;  4FNF A;  1VQI A;  4JV5 Q;  1HZB A;  2KVM A;  1SSO A;  5G3L F;  5CV9 A;  3GTO H;  4HJ9 A;  5NUC A;  4B3S L;  2OTL A;  4X6A H;  2B8G A;  3BZC A;  1VS0 A;  2B2V A;  5IP9 H;  5C44 B;  2F52 A;  4DR3 Q;  3MXP A;  3G6E A;  1YNJ D;  2WV6 D;  2L55 A;  5C0X I;  1XPR A;  1O78 A;  3HOW G;  4X62 Q;  5CYU A;  5DLQ E;  1C7Y A;  1EEI D;  2IWH A;  4DR2 L;  2KED A;  2JA8 B;  1Q8K A;  5M5X B;  3N52 A;  5C3E G;  4L63 B;  1Q86 C;  3PQI A;  4DV2 L;  4LF5 Q;  3AEV A;  2ZTC A;  3K58 A;  2F4V Q;  1A2U A;  4DK6 C;  3AFP A;  3E9H A;  5DAU A;  1IYU A;  1TWH B;  1YNN D;  5CV4 A;  3F2C A;  2WAC A;  1EYD A;  1EQQ A;  3J80 L;  3BDL A;  1Z6H A;  1G6Z A;  1BF4 A;  3K5M A;  3I56 A;  3ND9 A;  1R4P B;  4Y7N B;  2Q2U A;  3F2D A;  3GTK H;  3NP8 A;  3ITP A;  2EY6 A;  3ER0 A;  3JAM E;  2RVL A;  4PG3 A;  4IFD G;  3S16 H;  2JJQ A;  3D3R A;  2VQF L;  3KDF B;  4U67 3;  1BCP D;  4ME5 A;  2UXD Q;  5FLX E;  1JB7 A;  3M9B A;  1FR3 A;  1K8A C;  3MXG A;  1NBW A;  1NJI C;  2CH4 W;  1JWU D;  2A68 D;  3RLF A;  3WDN A;  2AWN A;  1IBK L;  5ELC A;  1E2V A;  2PCF B;  4FDB A;  5ELN A;  5M3M G;  1FNV A;  1SYD A;  4ILW A;  4KKT A;  5A2Q E;  4FVM A;  1JE4 A;  5FK9 C;  1H9K A;  3OWF A;  2CWA A;  4WJ4 A;  3ONA B;  1RDP D;  1HNW L;  2E5L Q;  1CUK A;  1Z9F A;  2NWG A;  1VQE A;  2VB2 X;  1A2T A;  4A3M B;  3MA2 B;  1LT5 D;  5COR A;  2N78 A;  4FF1 A;  1VQ5 A;  3S24 A;  1E7Z A;  1VQN A;  4IUP A;  1K28 A;  1L0Y B;  3DMU A;  1EWH A;  3X3N A;  1CZW A;  1GO3 E;  1IBL L;  2R7Z H;  3ERS X;  4IUN A;  3PO3 G;  2E76 C;  3M7N A;  4JG2 A;  4ZLT F;  2C35 B;  4I7A A;  3ERQ A;  2A73 B;  2ZT9 C;  5IE8 A;  1B53 A;  1TS4 A;  4BBR G;  1YVC A;  1KLG D;  4ZRZ A;  4DK0 A;  2HHH Q;  4JI4 Q;  4JBM A;  3FP9 A;  4G7O C;  1QUQ A;  5IGD A;  2F0K A;  4LUO A;  4A3K H;  5EQ0 A;  1U5K A;  2F0O A;  4DV7 Q;  4IO9 A;  2L4N A;  1HR0 L;  2UUA Q;  3CCQ A;  2HT1 A;  1LV9 A;  4DXF A;  4JI1 Q;  4ID6 A;  2BE5 D;  4NXM Q;  1CKN B;  1BUV T;  2NZ1 D;  1RTN A;  3A54 A;  5J3B A;  2K28 A;  5IP9 G;  3J81 c;  4CBV A;  5IGF A;  5IT9 E;  2KJX A;  4I7Z C;  3J81 i;  2MP1 A;  4B3T L;  1VQ9 A;  1N36 L;  5H1S E;  1NR4 A;  1Q82 C;  1VQK A;  3I4L A;  2AQ1 B;  1ET9 A;  1YHQ A;  4FXG C;  4DUZ L;  3P7J A;  4ME3 A;  2QEX A;  4AIM A;  4DGZ A;  4ZKB B;  3GTG B;  1AE3 A;  4A3G H;  5BN4 A;  3KLS X;  4K5W A;  3I2Z A;  2A6H C;  5IGE A;  4R4C A;  3GP7 A;  2NTT A;  1LAB A;  1I50 H;  2NN6 I;  1EL0 A;  2DNE A;  4DK3 C;  1S40 A;  1HFG A;  3S1R B;  4LUV A;  1GUT A;  1WJJ A;  1EIH A;  1EY4 A;  1X3G A;  5C0X J;  2CQA A;  2GA4 B;  3TS0 A;  4B3R L;  2WP8 J;  2KUM A;  3N6R A;  4X66 L;  5C0X H;  4NKL A;  2JSO A;  3HOW B;  4JW0 A;  3L3O C;  4XTC S;  4CJ2 C;  5C3E B;  1EY0 A;  5E3F A;  1TU2 B;  3ERO A;  2IX1 A;  1T9H A;  1IL8 A;  4OEL B;  1Y8O B;  2DGY A;  3NWT A;  5EBD A;  4GKK Q;  1GUW A;  2NYZ D;  4RCO A;  3A5U A;  4K8J A;  4OO1 I;  2FMM A;  4JI2 Q;  2XRQ D;  4HSP A;  2AQ3 B;  3KOJ A;  2Z0S A;  4HR7 B;  5M5W B;  1Y1W H;  2PQA B;  4ZUI A;  4ODG A;  1MGS A;  1K83 H;  2RKS A;  4X3T A;  3W1G A;  5CMD A;  2NVX H;  4DV4 L;  1B2T A;  2UUC Q;  4ZKC B;  3HS0 C;  4K8I A;  2ZJP A;  4LNQ A;  4JBK A;  5EGT A;  3SEB A;  4LJZ C;  2NZO A;  1IKM A;  1UEB A;  1STB A;  3GTM H;  3E0E A;  4OHJ A;  3RN5 A;  5C4X H;  1N8R C;  2R7Z G;  2NUC A;  3DXJ C;  1BO0 A;  4HIK A;  1XWE A;  4K2K A;  3HOZ H;  3T51 B;  1X3P A;  2NB0 A;  4QY7 A;  1P8L A;  2JE6 I;  4DV3 Q;  1LAC A;  3E9I A;  3V05 A;  4RKL A;  3UDG A;  4CJ0 B;  1WCM H;  4CDD C;  5KEE A;  3UE0 A;  2F0T A;  2F3V A;  3V2T A;  5M3M B;  3S9W A;  3I55 A;  4KTA A;  1I94 Q;  2RSN A;  4NXN L;  2K5H A;  4PZ8 A;  1QVF A;  2B2T C;  2PZU A;  3A56 A;  3UDI A;  2UUB L;  1SNC A;  2NVY B;  4JI7 L;  1XPU A;  1E0B A;  2IPK D;  1SJH D;  4LK1 C;  1QZG A;  3CAM A;  4A3K G;  1N34 Q;  4DNI A;  4X64 L;  1WTR A;  3H6M A;  1JWS D;  3RN2 A;  4LFB L;  3MXU A;  4HCS A;  1SR3 A;  1JE5 A;  1C48 A;  1KXL A;  1EQV A;  1MIU A;  1SE4 A;  1E2Z A;  2M9V A;  3T16 A;  2DY7 A;  4J15 A;  1BCP B;  2K52 A;  3A5Z B;  1SMY D;  1KDC A;  5GAD C;  2QDB A;  3PO3 B;  5LMN W;  5AFW A;  3JAM L;  4FF4 A;  1PMR A;  3GV6 A;  2CW0 D;  1HHV A;  2B2Y C;  3TME A;  3S17 B;  5EPL A;  2AHO B;  4NB3 A;  4KLK A;  3TP8 A;  3T1Y Q;  4BBR B;  3M3Y H;  4L5S A;  3TZU A;  3F8T A;  1PH9 A;  3S15 B;  3OW7 A;  2A69 D;  1MJE A;  5KRU A;  3SK5 A;  4A3G G;  1B9M A;  3RZO B;  1TT2 A;  4G4K A;  2B63 H;  2ASB A;  2NVT H;  2JA7 H;  2UU9 L;  2XVS A;  2QGQ A;  1STA A;  1HPC A;  3GTO B;  3BDC A;  1XMQ L;  2ALY B;  4RH6 A;  1IZ6 A;  2UXC L;  1B9N A;  1HZ9 A;  1PYS B;  3R93 A;  1N9W A;  4C56 C;  1PLF A;  5C0X G;  3OMG A;  3I3C A;  1ENF A;  1H95 A;  1B8A A;  2EJG C;  1MKH A;  1M90 C;  4UDU C;  1IL2 A;  4DV0 Q;  4LFA Q;  2WB1 E;  4K5V A;  1SYB A;  1Q8I A;  3MAQ A;  1CKN A;  3SHL A;  5G3L D;  1E2W A;  4C1N I;  4A3D H;  2F3I A;  2QW7 A;  4CDC C;  3X3M A;  4DV5 L;  4XYO A;  4KHP Q;  2B2T A;  2VQE L;  1HA5 A;  1QVG A;  1Y1W G;  1D1I A;  1TWC H;  2EYL A;  4DF7 A;  3OTO Q;  4BA1 I;  3W1B A;  1NSN S;  2F0W A;  4J8Q A;  4LF7 L;  3GTK B;  4L5Q A;  4JYA L;  2JA6 H;  1VQG A;  1YNN C;  3AFQ A;  2EY5 A;  2SOB A;  4KHV A;  3S16 B;  3OHX C;  3KLR A;  1AEX A;  1DOL A;  3UI2 A;  1TS5 A;  3NUC A;  2ZTD A;  2F0H A;  3U9S A;  3VYU A;  4P71 A;  1XNQ L;  2PI2 A;  5C4X G;  2LSS A;  1AFP A;  2TSS A;  1O80 A;  4B08 A;  4HJ8 A;  4YCV A;  3HOZ G;  2PW7 A;  5JJK A;  4IPC A;  3RMH A;  1BVS A;  3CME A;  1FJG Q;  4DV1 L;  1WCM G;  5KYI A;  4H7B A;  2B2Y A;  4OO1 H;  1SE2 A;  1BCP C;  3BVG A;  4IJL A;  5D3I B;  3TS2 A;  4XT3 B;  1I6V C;  3J80 i;  2FHT A;  2MPM A;  4LF5 L;  2YTX A;  1WD1 A;  2A68 C;  3E3X A;  4LMQ D;  2F4V L;  2JYO A;  3DM1 A;  2A74 C;  4HMI A;  3MFG A;  2N3S A;  4M8A A;  1L1O C;  3Q8D A;  1UEA B;  1YNX A;  3H3V C;  2SEB D;  1CZG A;  3A7L A;  1Y69 U;  4LFC Q;  1PFS A;  2BDO A;  1QZH A;  1EOT A;  1Y8P B;  3K7U C;  3OOC A;  2R7Z B;  1S5C D;  1EYG A;  3VYS A;  4X3S A;  1RF2 D;  1T5E A;  3VR5 A;  4C3H H;  3HOX H;  3EVQ A;  1PVO A;  1LTT D;  2K04 A;  1GHK A;  4DR5 Q;  4QUC A;  2IJ0 A;  1XMO Q;  2UXD L;  1ILP A;  2RQX A;  5IOD A;  1I4P A;  2F0P A;  1ML0 D;  5IY0 A;  2ZM6 Q;  1EU4 A;  1JC7 A;  4EQ5 A;  4M1U B;  3MEH A;  3F2U A;  1CFM A;  3CCE A;  3T1H Q;  1H9J A;  1S5B D;  1EZ8 A;  5I9P A;  1B3A A;  1EIY B;  4H44 C;  2C5C A;  2I5H A;  3GTL H;  1PFN A;  4A3K B;  1VQO A;  1N33 Q;  2B63 G;  2JA7 G;  5K5P A;  1LLR D;  3OW2 A;  4WJW A;  3NK9 A;  3QR8 A;  5BR8 Q;  1F9P A;  2VZA A;  2D62 A;  1FYC A;  2E5L L;  1X3Q A;  1SYG A;  2A1A A;  4NMZ A;  1G51 A;  2FIN B;  4A76 A;  4B3M Q;  1YBY A;  3CKI B;  2VY3 A;  2WB1 G;  4AYB E;  4OWW B;  4WOR A;  3CCM A;  5I6Y A;  3I4M B;  2LXJ A;  4LF6 Q;  2HUG A;  1HCZ A;  5C6A A;  1JJG A;  1GUG A;  3K81 C;  3MFY A;  1MHW C;  2J7Z A;  4A3D G;  3M7G A;  1PH2 A;  3CPW A;  4A3G B;  1TS2 A;  4CKE A;  3S2H H;  4UAI A;  1LYL A;  4A4I A;  1I50 B;  5ELD A;  1YJ9 A;  3EA6 A;  2HHH L;  1SNQ A;  3OWE B;  1QNK A;  4JI4 L;  1Y14 B;  3RD4 A;  3MC0 B;  3W2D A;  1L1O A;  4HAE A;  1SEB D;  3FHW A;  2E2I H;  1G29 1;  5C4H A;  5JEA H;  4JC0 A;  3OPO A;  1JMC A;  2JA6 G;  2Q8R E;  3C1E A;  3QB3 A;  4DV7 L;  2DUD A;  5D14 A;  4OEM B;  2UUA L;  1R9T H;  1LT6 D;  4JI1 L;  3EFX D;  4YCU A;  5JJZ A;  4NXM L;  1KQS A;  1BBW A;  2V1C C;  2YTY A;  1JB3 A;  1EQT A;  3NHH A;  2JK8 A;  3FRP B;  3G6J B;  5HGQ A;  4YHH Q;  4YWL A;  5FLM H;  3F2B A;  4OO1 G;  3CCR A;  4BS9 A;  4RG1 A;  3RUZ A;  2AQ2 B;  2HIX A;  3FVQ A;  1WD0 A;  2XTI A;  1Y1W B;  4CDE C;  1KRT A;  1GJX A;  1K83 B;  2NVX B;  4I65 A;  1GUN A;  1ICW A;  3A7A B;  2KOL A;  4NP5 A;  3DEO A;  1V43 A;  2KCN A;  4DAV A;  1PXU A;  3G71 A;  5LMU Q;  1UE1 A;  1U4P A;  3GTM B;  3TRZ A;  4ZUJ A;  3I70 A;  4K5X A;  5C4X B;  5GQO A;  2F0L A;  4GN4 B;  1PTO D;  3H0G G;  4POG A;  4OWX B;  4C3H G;  3HOZ B;  4UPA A;  1SDF A;  3HOX G;  3QOJ A;  1HJP A;  1WCM B;  2C9O A;  4CGY B;  4EQN A;  3S1Q H;  5J39 A;  3P1H A;  4KMU C;  1LT4 D;  1V8Q A;  1HQM C;  4DN4 M;  2F0S A;  4F87 A;  2FMC A;  1F2M A;  2BA0 A;  2A5H A;  1ILQ A;  5FO9 B;  1WTP A;  2JEA I;  1BXT A;  4JI2 L;  1F2Y A;  4EVO A;  1EIF A;  4PZ7 A;  1D5X C;  1VDZ A;  4KHZ A;  4IPH A;  4KD4 A;  4AYB G;  2WKC A;  2SNM A;  3CRK C;  3M85 A;  3IKJ A;  4JI5 Q;  3J81 j;  2EYH A;  2EXZ A;  2VB3 X;  1YJN A;  3HG9 A;  5E4X A;  3DWQ A;  2VNU D;  4O0A A;  4OON A;  3B6Y A;  3E0J A;  3AB9 A;  3OMC A;  2GN5 A;  1DGS A;  3M3Y B;  1HQR D;  1M8A A;  1SBB B;  1SMY C;  3GD7 A;  4IZ8 A;  5T1G A;  4DV3 L;  4KK7 A;  2KHI A;  2Q2T A;  1EFW A;  2K33 A;  2O2L D;  1C9O A;  4DKA C;  3PIP A;  3TQY A;  3K8A A;  5GRO A;  1CQV A;  2F0J A;  3GTJ H;  1SNM A;  2B63 B;  4BWG B;  2NVT B;  1EWI A;  2JA7 B;  3DWA A;  3H94 A;  4V19 0;  1BDO A;  1UAP A;  4A93 H;  3GO5 A;  1YJW A;  1EFI D;  3P75 A;  4EQO A;  4L5R C;  2TMP A;  4AQY Q;  2RCN A;  4S3S A;  1ICF B;  3PGZ A;  5JEA G;  5M9O A;  4JK1 C;  1N34 L;  4DAM A;  4IAL A;  2B3G A;  4R4Q A;  5CC4 A;  2A8V A;  5KIX A;  2WB1 B;  1TXY A;  2CH4 A;  3JAM i;  3W5O A;  1RKN A;  3M4Y A;  1WTV A;  3PUV A;  1DM0 B;  4GLA C;  1SJE D;  3OIP A;  2G5D A;  2UXB L;  3Q23 A;  1DCZ A;  4RMF A;  4A3D B;  3FPU B;  3ULJ A;  1EQR A;  1JR0 D;  1XNR L;  5FLM G;  1HH2 P;  2M2L A;  4DU9 A;  4MTN A;  4DNR B;  1PHJ A;  2JA5 H;  1CT1 D;  3BDO A;  3QG1 A;  3T1Y L;  4GS3 A;  4TVA B;  1FD7 D;  1TWC B;  4CKC A;  1VQA A;  4JI6 Q;  3Q22 A;  5CV8 A;  2F4I A;  2MO0 A;  3HRZ C;  4K6D A;  2JA6 B;  2EXD A;  1H9R A;  4TSS A;  2XIW A;  3D8G A;  4IUU A;  3K7A H;  5FOB B;  3S1N H;  3BYY B;  1OXV A;  1X6O A;  4EQP A;  1VCI A;  2RHQ B;  4OX9 Q;  1E22 A;  2Y0S G;  4DK1 A;  3S14 H;  3MHB A;  1NY4 A;  1B70 B;  3MTS A;  3PUZ A;  3M4Q A;  1E24 A;  2L12 A;  2YYZ A;  2I46 A;  3D4R A;  1RTO A;  4H02 A;  3UDF A;  4FXD A;  3M4P A;  5E4W C;  5C5M A;  2OWO A;  4DV0 L;  4LFA L;  2DY8 A;  1V1P A;  2J4X A;  4MN3 A;  5C4J H;  3RNU A;  1GOZ A;  3CRL C;  2D5D A;  1DYQ A;  1EY7 A;  3HOY H;  4CJ1 B;  1A8V A;  3BVM A;  5CV7 A;  1GUO A;  4EGV A;  5I9O A;  3KBG A;  2Z8L A;  1K73 C;  2MNA A;  4GKJ Q;  3AU7 A;  5COY A;  1EY9 A;  1KIX A;  4KHP L;  1BOS A;  1U4R A;  4EX5 A;  1VQ6 A;  4QGU A;  3OTO L;  3URY A;  1NCV A;  1AP0 A;  2A6E C;  2LFN A;  2PMZ E;  5IWA L;  2L9H A;  4YY3 Q;  1HZC A;  4C3H B;  4NPS A;  2F0F A;  3HOX B;  3D31 A;  2EYF A;  5C3W A;  1SYF A;  1XPO A;  4K0K Q;  1PH1 A;  3NEL A;  4C3I H;  1XX8 A;  4HID A;  1B7Y B;  1HNX Q;  3PO2 H;  2WII B;  1S3O A;  1NMG A;  1FGB D;  2K6A A;  2EPB A;  3DM3 A;  1GM5 A;  3SXH A;  3ICE A;  1K8O A;  1B1Z A;  1FJG L;  2ZJR A;  1Q3L A;  1HFN A;  2N49 A;  1D8L A;  2EE1 A;  5FKA C;  2R93 H;  1IXR A;  1MSH A;  1CTM A;  2H4O A;  1FNW A;  1PZJ D;  3Q6S A;  4A93 G;  2ATW A;  2K5V A;  4AYB B;  4J1M A;  1PA6 A;  2BOS A;  1GD7 A;  1TWF H;  4QIW E;  4N9T A;  5ELO A;  1QCB D;  4YWK A;  4LFC L;  4HIO A;  4UHV A;  4JI3 Q;  3H09 A;  1IW7 C;  5EAY A;  3AYH B;  5ISR A;  1PTO F;  3CC2 A;  5D3D A;  3R2I A;  3T56 B;  4GN3 B;  3MZ5 A;  3HOV H;  3VA7 A;  4QQB X;  1Q7Y C;  4DR5 L;  1EEF D;  1EU3 A;  4XQN A;  1XMO L;  3T4A C;  5LMN Q;  1SND A;  4U68 A;  2ZM6 L;  4B3S Q;  3S2H B;  1RCV D;  1UWV A;  3RZD H;  2JA5 G;  4DR7 L;  4LUZ A;  2L1B A;  1JOR A;  4JVZ A;  4PQX A;  3T1H L;  2V4D A;  2F03 A;  3C1F A;  2KHS A;  4OL7 A;  1DXM A;  4HN7 A;  3TSS A;  2BDN A;  2E2I B;  2F0V A;  2HDM A;  1N33 L;  3PIP 3;  2RF4 A;  3C2P A;  4IOC A;  1R9T B;  2EQS A;  4ZK9 B;  1X65 A;  5BR8 L;  3HP3 A;  3KDF A;  5JJI A;  1ZKO A;  3D6W A;  3SK8 A;  4KKS A;  3HKZ G;  2E74 C;  3CMA A;  4JBW A;  2QA4 A;  1SFO H;  3I73 A;  3CQZ H;  3TRE A;  3C46 A;  3EIV A;  4KV6 A;  2KEN A;  1HTL D;  3I90 A;  4LF6 L;  2WAQ E;  1MBY A;  1B50 A;  1HUM A;  1R4Q B;  5JPM C;  1C0A A;  2Z4I A;  2K5Q A;  4KY5 A;  3HOY G;  1DON A;  1VF5 C;  2ES2 A;  2EDG A;  3GTP H;  1Q46 A;  3BU2 A;  1ESF A;  2CKZ B;  2E2J H;  3I4N H;  2VXW A;  2R3Z A;  4LF8 Q;  4DR4 Q;  3TEH B;  5LL6 X;  5FLX L;  1JIC A;  4C2M H;  3BYT B;  1ONL A;  1AZP A;  2Y0S B;  2JA8 H;  1K0S A;  3TP7 A;  1LTR D;  2I0Q A;  4C3I G;  3FPP A;  3VR4 A;  3G4S A;  3FKI G;  2R61 A;  2JEB I;  2VS1 A;  2I07 B;  3S1Q B;  2DNC A;  3PO2 G;  1ET6 A;  3UE1 A;  2EIF A;  2R7D A;  2IL8 A;  5A2Q L;  1IHZ A;  3IFD A;  1X32 A;  2AKW B;  2PNH A;  1KRS A;  1C8C A;  3STB C;  2RSO A;  1U4L A;  1QVC A;  1X3E A;  2J0T D;  5M5Y H;  4KY6 A;  2EYM A;  2R93 G;  1H9M A;  1KDA A;  1HNZ Q;  2IHE A;  1STE A;  4IFD I;  3T53 B;  1I3Q H;  2WIN B;  4DR6 Q;  3KJO A;  3CD6 A;  3VR6 A;  3DLL A;  2MGS A;  1QG7 A;  1SAP A;  1PFB A;  5EKK A;  1BBX C;  1K8G A;  3NTH A;  5LMU L;  1S72 A;  2XN9 C;  2Q2H A;  3ND8 A;  1PRT F;  4WFN 3;  1S5D D;  2AMC B;  1YNJ C;  1A0I A;  1VQ7 A;  3JC6 6;  1CKO A;  1OXT A;  2NN6 H;  3IFT A;  2MUY A;  3HOV G;  1V1Q A;  1LUZ A;  5IYB H;  3V96 A;  5CV6 A;  3S1M H;  1O7Z A;  1ZEQ X;  1NNX A;  3WOE A;  3GTJ B;  3SK6 A;  4E6I A;  2KEE A;  2R6G A;  4JV5 L;  4QUF A;  2XGT A;  1YIT A;  4A93 B;  5CGK A;  1SYC A;  3DWP A;  2E8G A;  1BQQ T;  2HCI A;  1CK1 A;  1ROD A;  2BA1 A;  1L2F A;  1AZQ A;  3NE5 B;  5KGU A;  1MI2 A;  4DR3 L;  4WRD A;  2HQL A;  1N36 Q;  2P5Z X;  3FDT A;  4UP8 A;  1II3 A;  2K5N A; 
#chains in the Genus database with same CATH homology
 5HGQ A;  1VQE A;  3ULL A;  3PCO B;  4YWL A;  5FLM H;  4YHH Q;  3F2B A;  4DV2 Q;  4BA2 I;  4DUZ Q;  3J80 c;  3CCR A;  4X62 L;  4OO1 G;  1GVP A;  2N78 A;  4RG1 A;  1VQ5 A;  1IYJ B;  2HIX A;  3CC7 A;  2K50 A;  1UE5 A;  1E7Z A;  3S24 A;  1I6H H;  1VQN A;  3H15 A;  2KBN A;  4B3M L;  1KAW A;  2XTI A;  3GTQ H;  2YU9 H;  1Y1V G;  2CCZ A;  2WAQ G;  3PUX A;  3I7F A;  1GO3 E;  1KRT A;  4JI5 L;  1IBL L;  2L15 A;  2R7Z H;  1KHI A;  3U4Z A;  1PH6 A;  3ERS X;  1XJV A;  4QL5 A;  2I5M X;  3PO3 G;  1OXS C;  4JBJ A;  1V43 A;  1OXU A;  3M7N A;  4JG2 A;  1SE8 A;  3G71 A;  2IT1 A;  5LMU Q;  1UE1 A;  1TWG H;  2C35 B;  2ID0 A;  4JI0 L;  3TRZ A;  4B3R Q;  2Z6K C;  5IE8 A;  3HFZ B;  1G6P A;  1A62 A;  2K75 A;  2Q2I A;  4GOP C;  1HR0 W;  2VQF Q;  1VQB A;  3ZJY C;  1UE6 A;  5GQO A;  2E2H H;  1KD1 C;  4GN4 B;  4BBR G;  4BXX H;  4DR1 L;  1YVC A;  3H0G G;  3H0G H;  3U4V A;  1PH8 A;  2HHH Q;  4OWX B;  2PQA A;  4POG A;  4UPA A;  4APV A;  3HOX G;  1VQ4 A;  3FP9 A;  4JBM A;  4JI4 Q;  1D7Q A;  2IHF A;  1QUQ A;  1HJP A;  4LUO A;  1E1T A;  5C44 H;  3U50 C;  4A3K H;  4PZ6 A;  1IBK Q;  3I4N G;  1U5K A;  1WI5 A;  3S1Q H;  4DV7 Q;  1LM0 A;  2JQO A;  4IO9 A;  3G48 A;  3EN2 A;  1HR0 L;  2UUA Q;  3CCQ A;  1X3F A;  2HT1 A;  2NVQ H;  2CQO A;  4L5T A;  5AJ3 L;  3NBH B;  1E1O A;  1IBM L;  1YEZ A;  4P74 A;  4JI1 Q;  2JA8 G;  5M5X H;  1CKN B;  4NXM Q;  2BA0 A;  1Q1E A;  3CW2 C;  5J3B A;  3J7A 5;  1BBU A;  5IP9 G;  2JEA I;  2UXB Q;  4O2D A;  3CCJ A;  1HNW Q;  3J81 c;  4JI2 L;  1J5E Q;  1EIF A;  4PZ7 A;  4A3F H;  1TWH H;  1XNR Q;  4KHZ A;  4IPH A;  3J81 i;  4B3T L;  4XIG S;  3CF5 A;  3I4M G;  3EBE A;  1VQ9 A;  1N36 L;  5H1S E;  4AYB G;  1M1K C;  1L1O B;  4P73 A;  1Q82 C;  1VQK A;  4YHH L;  3M85 A;  1YHQ A;  4DUZ L;  4ME3 A;  4GLV B;  3KF8 B;  2QEX A;  3L7Z C;  3PUW A;  4AIM A;  1IBL Q;  4Y7N H;  3J81 j;  2OQK A;  4JI5 Q;  3HKS A;  1YJN A;  1AE3 A;  4A3G H;  2VNU D;  1YZ6 A;  4O0A A;  4OON A;  4GNX B;  3I2Z A;  3B6Y A;  4JI6 L;  4R4C A;  2GN5 A;  1W2B A;  1K0R A;  2K4K A;  2B29 A;  3CPF A;  4JI0 Q;  1I50 H;  3CCU A;  1DGS A;  2NN6 I;  4DK3 C;  1S40 A;  3GD7 A;  1PH3 A;  1PYB A;  4LUV A;  1WJJ A;  4DV3 L;  4NXN Q;  2VUM G;  1X3G A;  1K9M C;  2KHI A;  2Q2T A;  1JJ2 A;  1EFW A;  4IOA A;  5C0X J;  4DR1 Q;  1C9O A;  4DKA C;  3PIP A;  3TQY A;  5IYC H;  3TS0 A;  2WP8 J;  4B3R L;  3AQQ A;  3K8A A;  5GRO A;  1O7I A;  4POF A;  2MQH A;  3GTJ H;  4YCW A;  4X66 L;  4A3E H;  1EWI A;  2CWP A;  4OX9 L;  2NN6 G;  1XTD A;  1Z47 A;  4X64 Q;  4A93 H;  3GO5 A;  1YJW A;  4LFB Q;  4XTC S;  1HR0 Q;  4L5R C;  4MZ9 A;  5IYB G;  4AQY Q;  2RCN A;  4JCV E;  3PGZ A;  4DAY B;  5M5W H;  2IX0 A;  5JEA G;  5AJ3 Q;  1IBM Q;  1N34 L;  1T9H A;  2IX1 A;  4DAM A;  4A3L H;  2B3G A;  4R4Q A;  2A8V A;  4IFD J;  2DGY A;  2HIV A;  4GKK Q;  1TXY A;  3JAM i;  4A3M H;  3A5U A;  2Z6K A;  3A74 A;  3W5O A;  3I4O A;  5IP7 H;  4OO1 I;  4GOP A;  2YV5 A;  4JI2 Q;  3PUV A;  4BY1 H;  4GLA C;  4A3J H;  3KF6 B;  2BH2 A;  3KOJ A;  2Z0S A;  4B3T Q;  1CKM A;  1Y1W H;  2PQA B;  2UXB L;  3PIO A;  4GKJ L;  4WJ3 M;  1K83 H;  4X65 L;  3PF4 A;  3W1G A;  2NVX H;  4RMF A;  4DV4 L;  2UUC Q;  3ULJ A;  1EQR A;  1XNR L;  2R92 H;  5IWA Q;  5FLM G;  1HH2 P;  2ZJP A;  4LNQ A;  4BY7 H;  4JBK A;  4HJA A;  4MTN A;  2NZO A;  5JJL A;  1PHJ A;  1UEB A;  2JA5 H;  3CCL A;  3GTM H;  2K14 A;  3T1Y L;  4GS3 A;  3E0E A;  4TVA B;  1L0W A;  1VQC A;  3RN5 A;  5C4X H;  1VQA A;  4JI6 Q;  1N8R C;  2R7Z G;  1AE2 A;  3BJU A;  4OWT B;  4LWC A;  3H3V I;  4HIK A;  2MO0 A;  3HOZ H;  1ASZ A;  4LF9 L;  4QY7 A;  1P8L A;  2JE6 I;  2NVY H;  4DV3 Q;  2EXD A;  1HNX L;  3E9I A;  3UDG A;  1X56 A;  1WCM H;  1SLJ A;  3UE0 A;  3I55 A;  5IYD H;  1MJC A;  3K7A H;  3K80 C;  3S1N H;  1TWA H;  1OXV A;  1X6O A;  4NXN L;  1VCI A;  2K5H A;  2RHQ B;  4X66 Q;  1I94 Q;  4OX9 Q;  4PZ8 A;  1E22 A;  1QVF A;  1P16 A;  4BXX G;  2Y0S G;  3S14 H;  3UDI A;  1NY4 A;  1B70 B;  3PUZ A;  4JOI C;  2UUB L;  2ZJQ A;  3M4Q A;  3IRB A;  4JI7 L;  1E24 A;  3PSI A;  1PV4 A;  1XPU A;  1NMF A;  2YYZ A;  5C44 G;  1QZG A;  3CAM A;  4A3K G;  1N34 Q;  4DNI A;  4X64 L;  4H02 A;  3UDF A;  1U0L A;  3M4P A;  3KJP A;  3RN2 A;  1YI2 A;  4LFB L;  3U58 A;  4A3C G;  2OWO A;  4A3B H;  2Y0S E;  1SR3 A;  4UP7 A;  1JE5 A;  4AQY L;  3PF5 A;  1KXL A;  3K0X A;  4DV0 L;  1WFQ A;  1MIU A;  1SMX A;  5C4J H;  4LFA L;  3RNU A;  5K36 G;  4GNX C;  3HOY H;  1A8V A;  3HOU H;  3VDY A;  4J15 A;  2K52 A;  3A5Z B;  4GKK L;  5GAD C;  1K73 C;  1FL0 A;  2MNA A;  5LMN W;  4GKJ Q;  2D0P A;  1JJC B;  1YIJ A;  4X65 Q;  4JI3 L;  4A3F G;  4DV4 Q;  1K3R A;  4A3I H;  1KIX A;  3GTG H;  4KHP L;  2BH8 A;  4ALP A;  1J6Q A;  1KL9 A;  4EX5 A;  1VQF A;  1VQ6 A;  4QGU A;  1VQL A;  1RIP A;  3OTO L;  2GVA A;  4DR7 Q;  2AHO B;  4NB3 A;  3L2P A;  4KLK A;  2UUC L;  3MEF A;  3T1Y Q;  4LF4 L;  5IWA L;  2PMZ E;  4L5S A;  5GAG C;  3M3Y H;  5LMN L;  4YY3 Q;  1HZC A;  3S1R H;  1XNQ Q;  4NPS A;  3D31 A;  1OTC A;  3F8T A;  1XPO A;  1PH9 A;  4K0K Q;  1PH1 A;  2PI2 E;  3NEL A;  1MJE A;  4C3I H;  2H5X A;  4R4T A;  4A3G G;  2ZTE A;  1VQD A;  1FGU A;  4HID A;  2FXQ A;  1B7Y B;  4LF9 Q;  1HNX Q;  3PO2 H;  2B63 H;  1AH9 A;  2ASB A;  2NVT H;  4DV1 Q;  2KCT A;  2D0O A;  5E7N A;  1S3O A;  1NMG A;  2JA7 H;  5FJ8 H;  2UU9 L;  3HOW H;  3DM3 A;  2QGQ A;  1GM5 A;  5C3E H;  4A3C H;  3ICE A;  1V9P A;  1XMQ L;  1FJG L;  2ZJR A;  4UP9 A;  5GAH C;  2ALY B;  5IYC G;  2UXC L;  1IZ6 A;  2N49 A;  1D8L A;  1HZ9 A;  2UUB Q;  1WYD A;  1PYS B;  3S2D H;  1ASY A;  4JI7 Q;  1N9W A;  1I94 L;  1IXR A;  5C0X G;  2R93 H;  4A3E G;  4UY8 C;  3WWV A;  1CSQ A;  2MFI A;  1VQM A;  1Q1B A;  4A93 G;  2ATW A;  1H95 A;  1B8A A;  2K5V A;  1MKH A;  4PMW A;  1M90 C;  1IL2 A;  4DV0 Q;  1PA6 A;  4LFA Q;  2OQ0 A;  4OXP A;  1VQP A;  2WB1 E;  1GD7 A;  1VQJ A;  1TWF H;  3JAM c;  4QIW E;  5ELO A;  4A3L G;  1CKN A;  4A3D H;  4BBS H;  4YWK A;  3KFU A;  4A3M G;  1X54 A;  2F3I A;  5FLX c;  5IP7 G;  1PH7 A;  1Q12 A;  4LFC L;  4HIO A;  2JA9 A;  2N8N A;  1N32 L;  4DV5 L;  3RLO A;  4BY1 G;  4A3J G;  3PV0 A;  2LXK A;  5EAY A;  4HIM A;  3AYH B;  4JI3 Q;  4KHP Q;  3CC2 A;  1UE7 A;  1BKB A;  4GN3 B;  1WOC A;  4R1J A;  2CFM A;  4LW1 A;  2VQE L;  4JOI A;  1SRU A;  1TWC H;  3KYH C;  5JEA J;  1Y1W G;  1Q7Y C;  1QVG A;  3OTO Q;  3HOV H;  4QQB X;  1RL2 A;  4GLX A;  4DR5 L;  4MNO A;  1QUQ B;  5M3F H;  4BA1 I;  3W1B A;  2R92 G;  1XMO L;  1VQ8 A;  4LF4 Q;  2YTV A;  4LF7 L;  4L5Q A;  4BY7 G;  5LMN Q;  4JYA L;  2JA6 H;  1VQG A;  3AFQ A;  4LF8 L;  4DR4 L;  2ZM6 L;  4B3S Q;  1UWV A;  3RZD H;  2NZH A;  4P75 A;  2JA5 G;  4LUZ A;  4DR7 L;  5M3M H;  4Y52 H;  4GNX A;  3T1H L;  2ZTD A;  1KC8 C;  4YY3 L;  4IJH A;  4P71 A;  1XNQ L;  2PI2 A;  5C4X G;  2LSS A;  1SRO A;  1X9N A;  4K0K L;  4HJ8 A;  1CSP A;  2UU9 Q;  4YCV A;  1E3P A;  1YHB A;  3HOZ G;  5JJK A;  1N33 L;  4IPC A;  2RF4 A;  1BVS A;  1XMQ Q;  3CME A;  1FJG Q;  4DV1 L;  4IOC A;  3CXC A;  1WCM G;  2EQS A;  2UXC Q;  3RLN A;  4IJL A;  5IYD G;  4IPD A;  1X65 A;  4GN5 A;  5BR8 L;  1JT8 A;  3TS2 A;  4KI0 A;  3KDF A;  3J80 i;  5JJI A;  1NE3 A;  4LF5 L;  2YTX A;  1I5F A;  1Y1V H;  3HKZ G;  5HY6 A;  2F4V L;  4R4I A;  4JBW A;  3CMA A;  2QA4 A;  2MO1 A;  4P72 A;  4R4O A;  1SFO H;  3M4O H;  3CQZ H;  3TRE A;  2IY5 B;  1LTL A;  1GKH A;  2N3S A;  3EIV A;  1PH5 A;  1L1O C;  3Q8D A;  1HNZ L;  3PO3 H;  2KEN A;  1YNX A;  4HJ5 A;  3CCV A;  4LF6 L;  4QJF A;  4A3B G;  4DR6 L;  3MXN B;  3HKZ E;  2WAQ E;  4IPG A;  4YWM A;  3SGI A;  1FVI A;  4LFC Q;  1N32 Q;  3KLW A;  4JI8 L;  1PFS A;  4DV5 Q;  1QZH A;  3S17 H;  2OTJ A;  3HOY G;  1C0A A;  3K7U C;  3HOU G;  3UDX A;  1A63 A;  2ES2 A;  3KF6 A;  3BZK A;  4DV6 L;  1EYG A;  3H3V H;  4BBR H;  2VQE Q;  3STB D;  4AH6 A;  1Q46 A;  4HJ7 A;  3GTP H;  4C3H H;  2KCM A;  1PVO A;  3HOX H;  1OXX K;  4DR5 Q;  3S15 H;  2GVB A;  3BU2 A;  4DUY L;  4A3I G;  2CKZ B;  2WFW A;  1EOV A;  2OCE A;  1XMO Q;  2UXD L;  3RZO H;  2E2J H;  2VL6 A;  3D0F A;  4LF7 Q;  3I4N H;  4JYA Q;  3CP0 A;  4LF8 Q;  4DR4 Q;  5IY0 A;  2AWO A;  2ZM6 Q;  3TEH B;  4C2M H;  4EQ5 A;  1VQI A;  4JV5 Q;  1HZB A;  3CCE A;  3T1H Q;  1PH4 A;  1NTG A;  2JA8 H;  3GTO H;  4HJ9 A;  5IT9 c;  4B3S L;  1EIY B;  2OTL A;  2I0Q A;  4X6A H;  2I5H A;  3BZC A;  1VS0 A;  5IP9 H;  3GTL H;  1VQH A;  3FKI G;  3FKI H;  3G4S A;  4GOP B;  2F52 A;  2JEB I;  2VS1 A;  4DR3 Q;  3RR5 A;  1VQO A;  1N33 Q;  3PO2 G;  3G6E A;  3UE1 A;  2B63 G;  2JA7 G;  5C0X I;  2EIF A;  2R7D A;  1XPR A;  5FJ8 G;  3OW2 A;  4X62 Q;  3HOW G;  3I4M H;  5DLQ E;  1C7Y A;  2AKW B;  4DR2 L;  2PNH A;  1KRS A;  1Q8K A;  2D62 A;  2VZA A;  3STB C;  5BR8 Q;  2RHS B;  5C3E G;  2E5L L;  2A1A A;  2R7F A;  3GDE A;  1G51 A;  3F1Z A;  1Q86 C;  4DPG A;  4DV2 L;  4A76 A;  4B3M Q;  4LF5 Q;  1YBY A;  3AEV A;  2ZTC A;  2F4V Q;  1QVC A;  1X3E A;  2VY3 A;  5M5Y H;  2WB1 G;  4DK6 C;  3AFP A;  3E9H A;  2R93 G;  4AYB E;  3A0J A;  4OWW B;  1HNZ Q;  3F2C A;  4C3J H;  2IHE A;  1Q81 C;  3CCM A;  4IFD I;  1EQQ A;  2LXJ A;  1I3Q H;  4LF6 Q;  4DR6 Q;  3KJO A;  3CD6 A;  1EUJ A;  3DLL A;  1JJG A;  3K81 C;  1X55 A;  4JI8 Q;  1K8G A;  1YHA A;  3I56 A;  3CC4 A;  2VUM H;  5LMU L;  4BBS G;  1S72 A;  4DV6 Q;  2KHJ A;  2Q2U A;  1PH2 A;  2Q2H A;  3CPW A;  3F2D A;  3GTK H;  3J7Z C;  3ER0 A;  3LGJ A;  2AMC B;  4PG3 A;  4IFD G;  1A0I A;  1VQ7 A;  3CCS A;  3S16 H;  3S2H H;  2JJQ A;  4DUY Q;  2VQF L;  3KDF B;  3JC6 6;  1LYL A;  1CKO A;  4A4I A;  1OXT A;  2UXD Q;  1JB7 A;  3PUY A;  1YJ9 A;  2HHH L;  3HOV G;  1V1Q A;  1LUZ A;  3M9B A;  4JI4 L;  1K8A C;  1Y14 B;  5IYB H;  2I5L X;  3L0O A;  1NBW A;  1L1O A;  1NJI C;  5M3F G;  3S1M H;  3RLF A;  3FHW A;  2E2I H;  1G29 1;  4JC0 A;  1HZA A;  2AWN A;  1IBK L;  1JMC A;  2JA6 G;  4DV7 L;  2DUD A;  2UUA L;  4A75 A;  4FDB A;  2R6G A;  5ELN A;  5M3M G;  1R9T H;  4JV5 L;  2XGT A;  1YIT A;  4JI1 L;  1SN8 A;  3NEM A;  4YCU A;  4NXM L;  1KQS A;  3ULP A;  1BBW A;  2VW9 A;  2A19 A;  2V1C C;  2YTY A;  4A3D G;  2E8G A;  1W3S A;  2CWA A;  5GAE C;  2BA1 A;  4WJ4 A;  1L2F A;  3OYY A;  3NEN A;  4TQU S;  4DR2 Q;  2JK8 A;  1N36 Q;  1HNW L;  4DR3 L;  2HQL A;  4UP8 A;  1J5E L;  2E5L Q;  1CUK A;  1Z9F A;  2K5N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...