3UDGA

Structure of deinococcus radiodurans ssb bound to ssdna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
231
structure length
211
Chain Sequence
RGMNHVYLIGALARDPELRYTGNGMAVFEATVAGEDRVIGERNLPWYHRVSILGKPAEWQAERNLKGGDAVVVEGTLEYRQWEAPEGGKRSAVNVKALRMEQLGTQPELIQDAGGGVRMSGAMNEVLVLGNVTRDPEIRYTPAGDAVLSLSIAVNENYQRQEKVHYIDATLWRDLAENMKELRKGDPVMIMGRLVNESTRVEATRVEALAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein
publication title Structure and Cellular Dynamics of Deinococcus radiodurans Single-stranded DNA (ssDNA)-binding Protein (SSB)-DNA Complexes.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein/dna
total genus 42
structure length 211
sequence length 231
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3udgA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3udgA02
1KIXA 1E1TA 4EQ5A 4DR5Q 4B3SQ 1EIFA 5C4XH 1E24A 2AKWB 2DGYA 3HFZB 5IYBH 1AE3A 1VQBA 2CKZB 1K83H 3G71A 4A3DG 3EN2A 2K5NA 1O7IA 2YTXA 4YWMA 1C7YA 4IFDI 4DK6C 4MZ9A 1PH5A 4LF7L 2KHJA 5K36G 1VQGA 4A75A 4GOPB 1YEZA 4JBKA 1YBYA 1W2BA 4Y52H 2YTVA 3M4QA 3KF6A 3KOJA 5FJ8H 5IWAQ 1R9TH 3AFQA 4DAMA 3GDEA 1VQAA 5LMNQ 2E5LQ 1H95A 4A3FH 1VQEA 2KHIA 2E2HH 2K75A 4JOIC 4OWTB 3M85A 3A74A 4IO9A 3VDYA 1WJJA 4LF4L 4OX9L 4GLXA 5GAHC 1Q12A 4A3LG 4DUZL 2PI2E 2N8NA 3M9BA 1YZ6A 4OWXB 4X64Q 3OTOL 1YIJA 1IBKL 4HJ8A 3RZDH 3CC7A 2Q2TA 1K8GA 3PCOB 4DR7L 4JV5L 2QA4A 2IX0A 1I94L 5C0XJ 3CMAA 3PUXA 1XNQQ 1GVPA 4DV2L 4DV6Q 4GOPA 2BH8A 4R4OA 4BY7H 3GTKH 3CF5A 4B3TQ 3PO3G 1YJ9A 4P72A 3S1RH 3CCUA 1N34Q 2Q2UA 4A3DH 1WOCA 3UDXA 1CSQA 3U4VA 4DV3Q 1IXRA 1XNRL 2RHSB 2F4VL 3TRZA 1X54A 2E8GA 3DLLA 3HKZG 4JI8L 3PO2G 2MO0A 1SN8A 3FHWA 3UDIA 4LW1A 3JAMc 1HR0L 4IOAA 3GTJH 1OXXK 2YV5A 1OTCA 4UP8A 4RMFA 4PG3A 5H1SE 4GKJL 2CFMA 4LF5Q 1JJGA 2ZJPA 1WCMG 3ERSX 3CXCA 1PH8A 1V43A 1VCIA 4C3JH 4A93G 1B8AA 3K80C 3S1MH 4DR5L 1RL2A 3T1HQ 1N8RC 1PYBA 4B3SL 4OONA 3I4MG 1IZ6A 3PF4A 3FKIG 4P74A 1X3FA 3U4ZA 4A3CG 4JG2A 2R93G 1EUJA 3GTQH 2JA6G 4WJ4A 1KRTA 4YWKA 2OWOA 4DV4Q 4A3LH 1WI5A 1X9NA 2LXJA 2IY5B 4OO1I 4R1JA 4LWCA 4QJFA 1S3OA 2HT1A 2I5MX 4UPAA 3GD7A 3PIOA 3F2BA 3PUYA 1NE3A 3H0GG 4PZ6A 2HIVA 5IWAL 1D8LA 3E9IA 1PV4A 2NVYH 4AIMA 5ELNA 3PO3H 1YJNA 1V9PA 2E5LL 5IYCH 2ZTDA 1Q82C 2JA8G 5GQOA 4POGA 2UUAL 4MTNA 4AYBE 2KCMA 2WB1G 3CC4A 2A19A 1HZAA 1VQIA 3CCQA 3PO2H 1P8LA 1BBUA 2FXQA 3HOUG 2Q2HA 4X64L 2CWPA 2VW9A 3T1YQ 2Y0SE 1FVIA 4LF6Q 1WCMH 1QVCA 4DV1Q 1EIYB 2MO1A 4A93H 5C0XI 1XNQL 2KBNA 4LUOA 4DV6L 1PHJA 2GN5A 4BA1I 2Z6KA 1VQJA 1VQMA 4B3TL 4LF4Q 1KL9A 4NXMQ 2IX1A 3I4MH 3FKIH 2NVTH 4A3CH 5JEAJ 5M3FH 1N34L 5E7NA 2R93H 4DV3L 2JA6H 1OXVA 4DR7Q 4JOIA 4KLKA 3TQYA 4PMWA 3I2ZA 1Y1WG 1PA6A 1TWCH 1IYJB 2E2JH 3AYHB 4A3IG 4FDBA 2E2IH 2UUBQ 4LF5L 2LXKA 2ID0A 4L5QA 5M5XH 2A1AA 1VQCA 3STBD 2R7ZG 4ME3A 3H0GH 1YHQA 4XTCS 3T1HL 1CKOA 4R4TA 2AWOA 3MEFA 2N78A 5M3MG 1PH7A 4DV7Q 3S16H 3RN5A 2NN6G 2I5LX 3TS0A 1ASYA 3UE0A 3D0FA 2K52A 3ZJYC 3HOWH 2JA8H 1OXTA 4HJ5A 1X56A 1EQQA 1IBLQ 3KF8B 3KFUA 4XIGS 4IPHA 4QGUA 1UWVA 3GTOH 1VQNA 4DV4L 3J81i 3HOUH 1N33Q 4RG1A 1VQDA 1EFWA 2N3SA 2VQEQ 3PV0A 4BXXG 3BZKA 5IYDG 3ICEA 4HIMA 3ULLA 1XMQQ 1HZBA 3H15A 2JK8A 2EXDA 3E9HA 2K50A 1JJ2A 2F52A 1VQ8A 4P75A 1MIUA 1XTDA 3Q8DA 1HR0W 1YHAA 1IBMQ 3M3YH 3EBEA 2K5VA 3JC66 4GS3A 1VQ7A 1YI2A 1QVFA 1L2FA 4BY1G 1Y1WH 2RF4A 1Q1EA 4HJ9A 3T1YL 3CP0A 4A3IH 1GD7A 2Z6KC 4KHPL 3HOVG 1PH1A 4LF6L 4UY8C 4DV1L 4IPGA 3GTLH 1X65A 4LF8L 1NMGA 4BBSG 2R7DA 2UUAQ 2VQFQ 2GVBA 4R4CA 5M3MH 3KJOA 4A3KG 1XMOQ 4HJ7A 1SE8A 1W3SA 2QGQA 4HIKA 2CWAA 4AYBG 4JI4Q 2YYZA 3NBHB 1N9WA 5GADC 1M1KC 1U5KA 4DR6Q 1UE7A 1FGUA 2Y0SG 3S1QH 1V1QA 2EIFA 2F3IA 4JI1Q 5HGQA 4DKAC 2UUBL 4BXXH 5IYDH 4LFAQ 2JEBI 4JI2Q 5LMNW 4X65Q 3AQQA 2MNAA 4IJHA 1GM5A 1S72A 1K9MC 3J81j 2NZHA 4DV7L 3M7NA 4H02A 2UXBQ 4POFA 1P16A 2VNUD 1Q8KA 2QEXA 1IBLL 2HQLA 3ULPA 2A8VA 4BY1H 3S1NH 1Y1VG 2N49A 4KI0A 3KDFB 1VQPA 1N33L 3F2CA 3S14H 4O0AA 2VQEL 4IPCA 3ER0A 3ULJA 1X55A 1A0IA 4LUZA 1XMQL 3J80i 3PUWA 1KC8C 2GVAA 1BVSA 1N36L 5LMUQ 4MNOA 4YHHQ 2D0PA 1TXYA 3I55A 4YCVA 1VQFA 2VUMG 4BBSH 1NY4A 1L1OA 2VY3A 4DV5Q 4A3KH 2JA5G 4IJLA 3BJUA 2BA1A 3PIPA 4DR1Q 1PH2A 1IBML 2R92G 2NVXH 3GTGH 1NMFA 1PVOA 2DUDA 1XPOA 2JJQA 2YU9H 3CMEA 5JJIA 1CUKA 1TWFH 4JCVE 3OW2A 4HJAA 3KDFA 3S24A 3RZOH 3RLOA 1LUZA 3MXNB 1FL0A 2ZM6Q 4DUYL 3H3VH 2B63G 2IHFA 1HZCA 4GN3B 5FLXc 2VQFL 4HIDA 4HIOA 1XMOL 3K0XA 1AH9A 4KHPQ 4JI4L 1N32Q 1M90C 2ZTCA 4TVAB 4DR2Q 1SRUA 3KYHC 2CQOA 2Z0SA 1Y1VH 3NENA 1HZ9A 4DR6L 1E7ZA 3TREA 2CCZA 4LF8Q 1CKNA 4L5RC 4JI5L 4JI1L 2ATWA 3CCMA 3HOZG 1J5EQ 3M4PA 5HY6A 4LFAL 4K0KQ 3D31A 3PUVA 1I50H 4JI2L 2D0OA 3CAMA 1SR3A 4A3MG 1LM0A 4X65L 1JB7A 4LFCQ 4A3GG 3F8TA 1PH3A 2VUMH 2UXDQ 4A76A 1Z9FA 1A63A 4NXML 2LSSA 2NN6I 1NJIC 1EYGA 2JA5H 4JYAQ 2UXBL 5J3BA 1BBWA 5M5YH 2PNHA 5ELOA 3RN2A 2MQHA 4A3JG 3PF5A 2ZJQA 4DNIA 1E1OA 2R92H 1HNZQ 1VQ4A 2JE6I 4A4IA 3G4SA 4B3RQ 4A3EG 2I5HA 5FLMG 3HKSA 4L5TA 1YITA 1L1OC 1Y14B 1KHIA 2JA9A 5BR8Q 4JI3Q 4DR4Q 5JJLA 5GROA 1YNXA 4GN4B 4PZ7A 4DK3C 3G6EA 2B63H 5LMUL 3CPWA 5IP9G 2R7FA 4YWLA 4YHHL 4TQUS 1ASZA 3I4NG 1JT8A 1OXUA 1PH9A 1UE6A 4DAYB 5IE8A 1YVCA 2YTYA 4DV5L 3CCJA 1VQKA 2UU9Q 2PI2A 4LUVA 4DR1L 3J81c 1WFQA 2ALYB 3AFPA 2NVQH 1X3EA 2WAQE 4PZ8A 2IHEA 4NXNQ 1PH6A 4BA2I 4GNXC 4UP7A 2PQAB 1N36Q 3CCVA 1LYLA 2VZAA 1VQ9A 5C44G 1KRSA 1XPUA 3S17H 2XTIA 3BZCA 3HOZH 2UXCQ 3UDFA 2ZM6L 1VQ5A 2OTLA 4A3GH 1JJCB 4A3MH 3A0JA 4YCWA 1Q86C 1A8VA 4JBJA 1MJEA 1YHBA 3HOYG 3A5ZB 1TWHH 2AHOB 5C3EG 4LF9Q 4C3IH 4GLVB 1FJGQ 1G6PA 4A3JH 1NTGA 1VQOA 1Q46A 1QZHA 1JMCA 4BY7G 1N32L 1EQRA 3I7FA 4DR2L 4IOCA 2PMZE 1VQ6A 2R6GA 4DUYQ 4A3EH 5FLMH 4OWWB 2R7ZH 4QQBX 1QUQB 3STBC 2PQAA 3RLNA 4C3HH 2HHHQ 1Z47A 1K73C 1J5EL 4K0KL 3H3VI 2WB1E 3S2HH 1KXLA 3B6YA 4QIWE 4LFCL 3I4NH 5IP9H 2OTJA 2OQKA 2UXDL 2K14A 3K7AH 3L2PA 3U50C 1S40A 1PH4A 2OQ0A 1HNXL 3BU2A 1X3GA 3F2DA 4DV0Q 4JI0Q 2JEAI 4JYAL 3FP9A 4JI5Q 4JBWA 1K8AC 1HNZL 2AWNA 2L15A 1XJVA 3I4OA 3L0OA 4B3RL 3F1ZA 3L7ZC 5GAGC 3DM3A 1L1OB 4GKKQ 4IFDG 3RNUA 4L5SA 2I0QA 1HNWQ 5C44H 1VS0A 5EAYA 3WWVA 1GKHA 1UE5A 1QUQA 2OCEA 2D62A 4GN5A 1L0WA 4JI3L 5BR8L 4JI6Q 1PFSA 4DR4L 3W1GA 4NB3A 4X66Q 3J7A5 1A62A 1VQHA 4WJ3M 4R4QA 3HOYH 4NPSA 3CC2A 2UU9L 4LFBL 3HOXG 5C3EH 1K3RA 1QVGA 4UP9A 4GNXB 1KAWA 4DR3Q 1VQLA 3CQZH 4NXNL 3HOVH 4YY3Q 1YJWA 3PSIA 3U58A 3GTPH 1TWGH 1I5FA 5IY0A 2K5HA 3W5OA 2HIXA 5IYCG 3J80c 3CCEA 5M5WH 4B3MQ 4JI7Q 5JEAG 3UE1A 2VL6A 3PUZA 3AEVA 2UXCL 1HJPA 2KENA 1TWAH 4BBRG 3JAMi 4X62Q 3KJPA 1G291 2RCNA 5DLQE 5AJ3Q 4OXPA 2C35B 1CKNB 1EOVA 3M4OH 1RIPA 4IPDA 4QL5A 4J15A 1KD1C 2UUCL 2BH2A 4YCUA 2EQSA 4LF9L 1FJGL 2WAQG 4P71A 1NBWA 2RHQB 3A5UA 1UEBA 2NZOA 1C9OA 1SROA 4AQYQ 4GNXA 2V1CC 3CCRA 3GO5A 1WYDA 5M3FG 3UDGA 3E0EA 2HHHL 3GTMH 2WP8J 1CSPA 3J7ZC 1UE1A 2JQOA 1X6OA 2H5XA 4X6AH 5C4JH 3K81C 1MJCA 2BA0A 4DV0L 4JI0L 3HOXH 1JE5A 3NELA 4C2MH 1HH2P 2ES2A 3NEMA 2KCTA 4IFDJ 2JA7G 4ALPA 4P73A 1OXSC 4GKKL 1IL2A 3K8AA 4GLAC 5LMNL 4A3BG 2Q2IA 5IP7G 4LF7Q 3G48A 1C0AA 2MFIA 3HOWG 3TEHB 2IT1A 4OO1G 4DPGA 1HNWL 1HNXQ 4QY7A 3S2DH 2VS1A 1BKBA 3RR5A 4BBRH 2B29A 3I56A 4JI6L 3S15H 5JJKA 4Y7NH 4GOPC 1I3QH 4X66L 1B70B 5GAEC 3CCLA 1KQSA 5C4XG 1Q1BA 2B3GA 1SMXA 5IYBG 4EX5A 3CD6A 2ASBA 1SLJA 4DR3L 1G51A 4LFBQ 1D7QA 4YY3L 4OX9Q 3TS2A 2AMCB 4DUZQ 1LTLA 2ZTEA 3HKZE 3LGJA 1IBKQ 4JI7L 3SGIA 3K7UC 3OTOQ 2ZJRA 4B3ML 2XGTA 3IRBA 3EIVA 4JV5Q 4JC0A 1I94Q 1MKHA 4X62L 1QZGA 1U0LA 3W1BA 4R4IA 5C0XG 4DV2Q 1AE2A 3OYYA 4LNQA 1DGSA 4AH6A 5FJ8G 5AJ3L 3KLWA 3CW2C 4KHZA 3CCSA 1PYSB 1Q81C 1E3PA 1K0RA 2K4KA 1XPRA 1Q7YC 3PGZA 4A3FG 5IT9c 4JBMA 1XNRQ 2F4VQ 2WFWA 2JA7H 4JI8Q 4AQYL 1I6HH 1SFOH 1T9HA 3CPFA 1HR0Q 4A3BH 1E22A 4O2DA 1J6QA 5IP7H 4GKJQ 1B7YB 3RLFA 1GO3E 4APVA 1CKMA 3KF6B 1EWIA 2UUCQ
chains in the Genus database with same CATH superfamily
3Q6SA 3CQZB 2DY7A 1F2MA 4B3SQ 1E24A 2AKWB 5M5WB 4DXGA 4I7AA 1U4PA 1TWAB 1YNND 3R2IA 3S9WA 1O7IA 4IFDI 1JR0D 4DK6C 4MZ9A 4LF7L 3MA2B 3QO2A 1VQGA 5BN3A 4A75A 1Z7TA 1XTCD 3H09A 2D2CC 3I4LA 1T5XD 3KF6A 3AFQA 1AW7A 3CU7A 3ITPA 2MP1A 3MFYA 1STEA 1H95A 4A3FH 2E2HH 4OWTB 4IO9A 3A74A 3K5MA 4A3LG 2N8NA 4X64Q 1IBKL 5KRUA 3KLRA 3RZDH 3CC7A 1K8GA 2M2LA 4JV5L 2QA4A 4TRDA 5C0XJ 1R4QB 3DWAA 4K6LA 3CMAA 2B2TC 1LABA 4DV2L 3HEJA 4X3KA 3OMCA 4BY7H 1J9OA 5IT9E 5A2QE 1AZPA 1WOCA 1O78A 1LTAD 2IPKD 1XNRL 2EDGA 4KK7A 2MO0A 3FHWA 3JAMc 4LW1A 4IOAA 5NUCA 3GTJH 2AQ3B 4GKJL 5K36H 4LF5Q 1A3UA 1JJGA 2ZJPA 2WAQB 2K5QA 1PH8A 4JW0A 4C3JH 4A93G 2N55A 3K80C 2B2VA 1BCPF 2JN4A 1PYBA 4UHVA 3U9OA 1QCBD 3DHQA 4A3CG 3U4ZA 1EUJA 2H4OA 4YWKA 2OWOA 1WI5A 2IY5B 5DM73 2LS01 2NUCA 1S3OA 3ERQA 4UPAA 3GD7A 2EJFC 3PIOA 3F2BA 4R8NA 1NE3A 1LTGD 2PMZB 2JA7B 1PV4A 2EY2A 2QF7A 1TS5A 4KMUC 5TSSA 2QKIC 2KCMA 2WB1G 3CC4A 5IGGA 1HZAA 3PO2H 4IQZA 1RDPD 3CCQA 2FXQA 1SE3A 2Y0SE 4LF6Q 1WCMH 4DV1Q 3EVQA 1EIYB 4L63B 2Z6KA 1VQJA 3M4YA 1VQMA 3M3YB 5JEAJ 1N34L 2R93H 2A68C 4XYQA 2JA6H 3D8GA 1BCPD 3JAME 4PMWA 1PA6A 1IYJB 5FKAC 4RH6A 4E6IA 4A3IG 3LX0A 2E2IH 2LXKA 4A3FB 2R7ZG 4FNFA 4ME3A 3H0GH 4DNRB 1V1PB 4XTCS 1CKOA 2AWOA 1UUPA 3NK9A 1Q90A 5C5MA 3MEFA 1QILA 2N78A 4KN7C 1ET6A 4DAPA 3RZDB 2BDNA 5J22A 4LK1C 1JE4A 4HJ5A 4ZYSA 1EQQA 1E2ZA 3KF8B 1IBLQ 3KFUA 3PIO3 3FDTA 1ICWA 4QGUA 3GTOH 4R8IA 3VYUA 4DV4L 1ENCA 3TN2A 2JK8A 5F2DA 2EXDA 2F52A 2L55A 4G7HC 1RODA 3GTJB 1MHWC 1V1PA 5IT9L 5A2QL 1DYQA 3SXHA 3T13A 5JAVA 2KQ3A 5A35A 1YI2A 4BY1G 2RF4A 3KF8A 4KHPL 3HOVG 1PH1A 4UY8C 3HGBA 2F0FA 4LF8L 1NMGA 5LL6X 1SYFA 2PW7A 1FGBD 5M3MH 1XMOQ 3RUZA 2NVXB 1W3SA 3GQBA 4ZKCB 5FO7B 2I46A 2YYZA 4J6HA 3C2PA 1H9MA 4NP5A 1STHA 3FPUB 3BYYB 1UE7A 4BS9A 1V1QA 2O2LD 2RBMA 4HR7B 4CKBA 2UUBL 4BXXH 1KDAA 5LMNW 4J1MA 4QUFA 4X65Q 2ICEC 4RGTA 4EQNA 1IYVA 4R9WA 3M7NA 4H02A 2UXBQ 1TKWB 2F03A 1WCMB 3A7AB 1STAA 1F9RA 3ULPA 1CZWA 2A8VA 5CV9A 1VQPA 3KDFB 3S14H 1S5CD 2EYMA 2VQEL 4IPCA 3ER0A 1KC8C 1XMQL 1KNEA 2R93B 3EQLC 3J80i 2F0QA 2JA6B 5JPMC 2VUMB 4MNOA 3DM1A 3KUPA 1ILQA 4YCVA 3FVQA 3VR3A 2R92B 2E2IB 4IJLA 3L3OC 3H0GB 3JAML 1EIGA 2PO4A 3CMEA 4HJAA 3KDFA 3RLOA 2ZM6Q 2IX3A 3GTOB 1HZCA 4GN3B 4HIOA 4N9PA 2NVQB 4KHPQ 1M90C 4TVAB 3OW7A 1GUNA 1E7ZA 3TREA 4LF8Q 1A3TA 4HSVA 3W2DA 4JI1L 2HD3A 4KKSA 1BXTA 4K0KQ 3IFTA 2LMCB 2D0OA 3VYTA 1JB7A 4JI2L 1PH3A 4A76A 2XSCA 1A63A 4EQOA 5LL6S 2XIWA 5J3BA 3PF5A 5ELOA 1HQMC 4HCEA 5FOBB 1ESRA 1U4MA 3HKSA 5IGEA 1L1OC 3T53B 3A8KE 3K5NA 1KHIA 5JJLA 3D4RA 4GN4B 4K8IA 1NAPA 3I4NG 4TQUS 2CW0D 1PH9A 3CKIB 5EPLA 4DV5L 1UEAB 1W6KA 1UAPA 4G4KA 1X3EA 3DXJC 1GUTA 1UNSA 2PQAB 3CCVA 4FYDA 4K2KA 5C44G 5CORA 3HOZH 3OOCA 1ET9A 2OTLA 1JOOA 1Q86C 3HOYB 1A8VA 4JBJA 1MJEA 3S14B 1TWHH 1BCPC 1LT6D 4G7OC 4LF9Q 2N88A 4A3JH 1LT5D 2LY7A 1BR9A 1RD9D 2R7ZH 4A3EH 4KY6A 3MC0B 2P5ZX 1B44D 2PQAA 3RLNA 1QNKA 5E1FA 4QIWE 2OTJA 5IP9H 3U50C 1B3QA 2V4DA 2Y0SB 4DV0Q 4IUUA 2XN9C 3FP9A 1PZKD 1QNUA 3BYTB 1F2ZA 5KEEA 1HNZL 3VR6A 1L0XB 2L15A 1PYWD 5I2YA 4IFDG 3DM3A 1L1OB 1GKHA 1L0WA 5BR8L 2D62A 4GN5A 1PFSA 3W1GA 1LV9A 3CRLC 2HDLA 3CC2A 2NBFA 2UU9L 4C2MB 1WTRA 2VXWA 1KLUD 3OPOA 5CBAE 4C1NK 1KAWA 4DR3Q 3HOVH 1WVLA 2KEEA 3GTPH 1I5FA 2E2DC 2K5HA 5IYCG 3J80c 3S2DB 5JEAG 1TT2A 2UXCL 1PFNA 3J7YW 1D1KA 2EYFA 3V96A 1G291 1BCPB 1CKNB 3KLSA 2FHTA 4J15A 2UUCL 4YCUA 2WAQG 3X3NA 2DJGC 3A5UA 1NCVA 2NZOA 3OWFA 2A73B 4AQYQ 2IWHA 3CCRA 3HRZC 3NUCA 2HUGA 3E0EA 2HHHL 3C3LA 5ELFA 4GZYC 3IKJA 4OELB 2A74C 2BA0A 4JI0L 1QJOA 4RKBA 4ZUIA 2ES2A 3I73A 1G2SA 2JA7G 4ALPA 1IL2A 1TWHB 2IT1A 1HNWL 1F9QA 4BBRH 4A3JB 5CGKA 3VYRA 1I3QH 1SMYD 4X66L 3CCLA 4A3EB 1KQSA 1E2VA 2B3GA 2KVMA 5G3LD 3MHBA 4FVMA 2WKCA 1SLJA 1AZQA 4DUZQ 4TSSA 3HKZE 4JI7L 1C48A 3SGIA 1F2YA 3OTOQ 2ZJRA 4B3ML 3EIVA 4FO2A 3W1BA 4R4IA 1BNZA 1RTOA 2KA7A 2F0UA 1ICFB 3A55A 3KLWA 2HQEA 4Q0FA 1PFMA 4CHTB 4A3FG 3SEBA 1WTPA 4DXFA 1HR0Q 3I3CA 4MTKA 4YIJA 2UUCQ 2XWBB 1KIXA 1WTWA 4HN7A 1XX8A 2DGYA 2CKZB 1K83H 3G71A 3IAYA 2K5NA 2YTXA 4YWMA 1STGA 5JPNC 1PH5A 1M4VA 5K36G 2Z4IA 4JBKA 2CW0C 1W2BA 4Y52H 3DMUA 2F0JA 1VDZA 5C0XH 4C56C 3MZ5A 4EVOA 4S3SA 5FJ8H 2EYJA 1R9TH 1JCKB 2NZ1D 4DAMA 3GDEA 1VQAA 2OF1A 2E5LQ 3EROA 1X3QA 3VDYA 4LFBL 4LF4L 1WJJA 4GLXA 1Q12A 1HCZA 4OWXB 2PYKA 4DR7L 1I94L 3PUXA 1XNQQ 4R4OA 1LTRD 3CF5A 1PMRA 5IOCA 4O1NA 3CCUA 3Q22A 1SYDA 4A3DH 4DV3Q 1IXRA 4BBRB 4IUQA 1X54A 3SE0A 3PO2G 1CI3M 1OXXK 5JJZA 1OTCA 4RMFA 4PG3A 1WCMG 3CXCA 4EQPA 3NTKA 1SNCA 5E4XA 4ZAIA 4KKTA 4B3SL 3KBXA 1EFID 5M3FB 3PF4A 1HTPA 1EY6A 1X3FA 4FF1A 2A5HA 3J7AF 2R93G 2JA6G 1PZID 1C8CA 3J80L 4LMQD 1L0YB 2LXJA 1X9NA 2WIIB 5M5XB 4R1JA 2Z6BA 4QJFA 2K33A 3H0GG 2HIVA 3IFDA 1D8LA 4OHJA 3A56A 1EZ6A 3PO3H 5ELNA 3HOWB 1YJNA 2JA8B 4ZUJA 5IYCH 2B2YC 5GQOA 4QIWB 4AYBE 4NKLA 1ZYRC 3HOUB 1BBUA 1F9PA 4X64L 1JWSD 5ELEA 1LLRD 1K83B 5ISRA 5C0XI 1H9RA 4LUOA 4X3UA 4L8JA 1KLGD 4LF4Q 1SE4A 4QCLA 5KNDA 2X69A 3FKIH 4IUTA 4DR7Q 1VMCA 1I4QA 1LTSD 1I4PA 3BS1A 2E2JH 1R9TB 1JOKA 3PQIA 5EKIA 3UI2A 4LF5L 2RVLA 4PNYA 1PRTF 1G6ZA 1VQCA 2K04A 1PTOF 4ZK9B 4R4TA 4K5VA 5M3MG 1ASYA 1OXTA 2KHSA 1B4OA 1X56A 2K32A 1UWVA 1VQNA 4CKEA 1N33Q 3PV0A 5CV8A 4BXXG 3L9AX 2R61A 1SMYC 1FD7D 3ULLA 4A3DB 1M8AA 2KECA 3E9HA 1JJ2A 2Z8LA 1VQ8A 1MIUA 1XTDA 3M3YH 5CV5A 1D5ZC 1ENAA 1L2FA 1Y1WH 1Q1EA 4HJ9A 3CP0A 2Z6KC 1VF5C 2XRQD 3ND9A 4LF6L 5K5PA 4DV1L 1NUCA 2B2WC 1X65A 2CQAA 1KDCA 2A69D 1HA6A 1HHVA 2GVBA 4HJ7A 2J4XA 4QUCA 3D4WA 3A54A 1SE8A 1PTOD 3MAQA 2CWAA 4JI4Q 2B2YA 3SK6A 1CZGA 1CA5A 1EQVA 2Y0SG 2R3ZA 2B8FA 1I4XA 2F3IA 3PO3B 2RA4A 3Q23A 1AN8A 4DKAC 5IYDH 2ZXPA 2MNAA 3HKZB 1S72A 2AUJD 1K9MC 2F0LA 2L4NA 2NZHA 3J81j 2MPMA 4POFA 1P16A 2DNEA 1Q8KA 2QEXA 5CV4A 1IBLL 5JOBA 2HQLA 3J81E 3S1NH 4MIUA 3F2CA 2PPBC 2CH4A 3FKIB 1A0IA 1O7LA 3PUWA 3T16A 1DOKA 4F88A 4ZRZA 1TS2A 2EYLA 2JA5B 2E2JB 4KTAA 4A3KH 3BJUA 4IZ8A 1PH2A 2EPBA 2NVXH 4HTHA 1KAAA 2JJQA 2YU9H 5JJIA 1WTOA 1CUKA 2K6AA 1LUZA 2NTTA 2RSOA 4DUYL 2EOTA 3TP8A 1Q8IA 2ICIA 2GA4B 1XMOL 3K0XA 5IIFA 2CQOA 1I4HA 1CQFA 3CCMA 3HOZG 1J5EQ 1ZEQX 2A6HD 4A3GB 1EY9A 3CAMA 4X65L 2B2WA 5IGCA 2MGSA 2UXDQ 4OEMB 1Y1WB 2VUMH 2LSSA 1EEFD 1NJIC 4JYAQ 2UXBL 2ZJQA 1BBWA 2MQHA 4A3JG 2R92H 3GP7A 2C5CA 4B3RQ 4CKCA 4A3EG 4C3HB 1Y14B 2JA9A 1QE6A 1YNXA 4PZ7A 3K7AB 2EVBA 2B63H 5IP9G 2PZWA 1JT8A 1OXUA 5T1GA 5EBDA 5IE8A 1VQKA 2A6EC 2ALYB 3VA5A 2NVQH 4BA2I 3I90A 2CVRA 4NXNQ 1DM0B 1FR3A 2VZAA 1VQ9A 1PFBA 2Z4HA 1XPUA 3S17H 2IW3A 3UDFA 5DNFA 2ZM6L 1JWUD 1VQ5A 1JJCB 1YHBA 2F4IA 3S1NB 2M9VA 4B9WA 3A5ZB 1CHPD 1CK1A 2RDFA 1VQOA 1JMCA 1EQRA 5CV6A 1VQ6A 4DUYQ 5FLMH 3GV6A 5I9OA 1MGSA 4A3KB 5BN4A 4K0KL 4AYBB 2WB1E 2F0NA 1SE2A 1TY2A 2YU9B 3BU2A 1X3GA 3N52A 4FP5D 4HMIA 4PMBA 1WTQA 2AWNA 3L0OA 3F1ZA 3L7ZC 4GKKQ 3T56B 3G7LA 1VS0A 2OXPA 1UE5A 1SXTA 1YNNC 3BDLA 4JI6Q 3U9SA 4M8AA 2XVSA 5C4JB 3J7A5 1VQHA 1SNDA 3HOYH 4NPSA 1I6VC 2PQEA 2L11A 1EQTA 5C3EH 4UP9A 1XXGA 4YY3Q 4ILWA 1YJWA 3HZXA 5IY0A 4PQXA 1W6JA 4HEDA 1FNWA 2NWGA 3PUZA 1HJPA 4BBRG 2A69C 4X62Q 4HMJA 1IW7D 2RCNA 1G2TA 4XQNA 3M4OH 1DXMA 4QL5A 4N8X1 4CDDC 2BH2A 1DCZA 2EQSA 4LF9L 4P71A 1NBWA 2E76C 2B2UC 2RHQB 1MI2A 1C9OA 2B63B 5KIXA 2L1BA 2V1CC 4HCSA 4ID6A 1Z6HA 1DJRD 5M3FG 3UDGA 1CSPA 1UE1A 2JQOA 5M9OA 3QWNA 1EYCA 1PLFA 1TQOA 1SYEA 4ULLA 4DV0L 1U4RA 3NP8A 3HOXH 1JE5A 4C2MH 3S17B 2B8GA 3NEMA 4P73A 3ZYYX 2EJGC 5LMNL 3G48A 3HOWG 3A8IE 2FFKB 3TDQA 3S2DH 5EQ0A 5JJKA 3BVGA 3I56A 2NYZD 4GOPC 1CTMA 5GAEC 4WJWA 2EYPA 1EL0A 2F0MA 1BO0A 4U68A 2JSOA 4DR3L 1D7QA 4OX9Q 3TS2A 4IN3A 2TSSA 4NW2A 3IRBA 1LT4D 1D6EC 1SBBB 4Z9CB 3SR1A 1QZGA 4RWSC 5C0XG 1ILPA 1DGSA 4KN4C 5FJ8G 4N8FA 3EA6A 1CM9A 4JPBW 3NTIA 3TSSA 1B9NA 3DEPA 2F4VQ 4JI8Q 4AQYL 2BOSA 1T9HA 2MHVA 2A6HC 4O2DA 1J6QA 2QILA 5EPJA 1NR4A 5CMDA 1CKMA 5C3EB 1EWIA 1K28A 4K5XA 4EQ5A 4DR5Q 1H9JA 5C4XH 3P20A 3HFZB 5C6AA 5IYBH 1AE3A 2RDGA 2F0GA 4B08A 4A3DG 1TR5A 2B2UA 3EN2A 3X3MA 1C7YA 2QW7A 1Y69U 3M4OB 2KHJA 2KCNA 4GOPB 1YEZA 3S1MB 1GUOA 3I91A 1IKMA 3AMUA 5IWAQ 2X6LA 5LMNQ 1VQEA 2KHIA 2RCFA 1HA5A 4JOIC 4DUZL 3NE5B 2O5IC 1YIJA 3OTOL 4C1NI 3MFGA 2Q2TA 3PCOB 3HOXB 1G91A 3ONAB 4DV6Q 4RA8A 2BH8A 4GOPA 3QIAA 4B3TQ 3PO3G 1YJ9A 3P7JA 4P72A 3UDXA 3U4VA 4I65A 3W3AA 3TRZA 1O80A 2E8GA 3DLLA 3HKZG 2EXZA 5HGTA 1HR0L 5CBEE 3QR8A 4UP8A 5I6YA 4X3TA 1HRJA 2F0KA 3ERSX 3R2TA 5HURA 1VCIA 2EYHA 2QDBA 2G9DA 4K6DA 1RL2A 3D6CA 3T1HQ 4OONA 2PNRC 2CHBD 3FKIG 4P74A 1EYDA 5I9PA 1SYGA 4WJ4A 1TWCB 3QG1A 5T1IA 3I72A 3C1EA 5KYIA 4PZ6A 4OGQC 4RAUC 2BE5D 2E5LL 1V9PA 1HFGA 2ZTDA 1Q82C 1XWEA 2WB1B 4P2CB 2UUAL 4MTNA 3O13A 2A19A 1VQIA 1P8LA 1Y8NB 2Q2HA 2CWPA 3KLSX 3T1YQ 5C4XB 1FVIA 4LJZC 1IW7C 1QVCA 3QOLA 1SNMA 2MO1A 1KTKA 1SJED 1XNQL 2KBNA 3BG3A 2D9UA 2OT2A 2PZUA 4RGNA 4WORA 4BA1I 3I4MH 5IODA 1KL9A 2NVTH 3MXGA 5M3FH 4DV3L 1OXVA 3K58A 1EEID 4JOIA 4K5WA 3I2ZA 3K5OA 1Y1WG 1VMPA 3AYHB 4FDBA 2ID0A 4L5QA 4DF7A 2A1AA 5M5XH 3QB3A 2L0CA 3STBD 3K57A 1YHQA 3LNNA 3HS0C 1IKLA 3S16H 4DV7Q 3D6WA 3RN5A 3SHLA 3D0FA 3HOWH 1QWYA 4K2LA 2BCOA 2JA8H 3FMCA 4XIGS 3J81i 3HOUH 3S1QB 1VQDA 4MN3A 3BZKA 5IYDG 3ICEA 4HIMA 4KY5A 1HZBA 3H15A 1ESFA 1S5DD 1WD0A 1MD2D 4P75A 1IBMQ 3BVMA 2QCPX 4IUNA 1RF2D 1WTXA 3KK7A 1QVFA 5CV7A 4ZCKA 2KOLA 2DJFC 2WACA 4KD3A 3D4DA 4DFAA 3GTLH 3NTHA 4PMCA 1GHJA 2J0TD 2UUAQ 4FXDA 2VQFQ 1JWMD 1R4PB 4A3KG 3GTGB 2NN6H 2QGQA 4HIKA 4AYBG 2K05A 2F0SA 4DR6Q 2EIFA 1DZ1A 3FEWX 4LFAQ 2F0VA 2PCFB 1IYUA 1CFMA 1KABA 3AQQA 5EKLA 2F0IA 3TP7A 2VNUD 2RQXA 5E4WC 4RCOA 4L6TB 1V8QA 2QEJC 5D3DA 4KI0A 3E3XA 1N33L 5ELDA 3I4MB 2SNMA 3NHHA 5D14A 1I50B 2NVTB 3ULJA 1X55A 4XXEA 2RDHA 1HUNA 1EU3A 1BVSA 5LMUQ 1A2UA 4YHHQ 3I55A 1TXYA 2VUMG 4BBSH 2VY3A 5C5LA 2K28A 3PIPA 4DR1Q 2BA1A 1PVOA 2HDMA 2R92G 3FPPA 1NMFA 1BF4A 1S5BD 2DUDA 2JYOA 1K3BC 4QB4A 4FXGC 3S16B 3WOEA 1TWFH 3OW2A 1FL0A 3H3VH 4CDFC 2B63G 3SK4A 3R8BA 4XT3B 5FLXc 1IL8A 2H1EA 1ZXTA 3OIPA 4JI4L 1QB5D 1N32Q 2ZTCA 3BZDB 4DR2Q 1SRUA 3KYHC 1Y1VH 2I07B 1HZ9A 3NENA 4XDXA 4ABNA 4WFN3 4JI5L 2ATWA 2PZTA 3R93A 5HY6A 3PUVA 4RHRA 4LFCQ 3F8TA 3TMEA 4DAVA 4NXML 2NN6I 2JA5H 1A6XA 3PMFA 1VQ4A 2JE6I 3GTLB 4A4IA 3G4SA 5FLMG 3H3VC 4BWGB 4TKOB 1YITA 4JI3Q 4DR4Q 1EIHA 3G6EA 3PIP3 3OSOA 2BE5C 1ASZA 2BDOA 3MTSA 1JC7A 1YVCA 2YTYA 3CCJA 3SDZA 1ONLA 3J81c 3GTQH 2IHEA 1PH6A 4GNXC 4UP7A 2NTSA 3VR2A 1RJTA 1LYLA 5C44B 1RCVD 1LTID 1KRSA 2XTIA 3BZCA 1TIID 3NPPA 1EYAA 4A3GH 1QG7A 5FLXE 3A0JA 4A3MH 5FK9C 3HOYG 3DWPA 5C3EG 4C3IH 1FJGQ 1EZ8A 2Q8RE 1QZHA 1Q46A 3MXUA 4RCNA 1TWGB 2J7ZA 4IOCA 1F77A 2AQ2B 4OWWB 4BBSB 3NXWA 3K0YA 5EBCA 4QQBX 2ZT9C 3CHBD 3STBC 5IGDA 2QDLA 4C3HH 1Z47A 1J5EL 1PRTD 1HXYD 3H3VI 3S2HH 1KXLA 2UXDL 3K7AH 2ENBA 1HNXL 3F2DA 2X6GA 2JEAI 4JYAL 1SDFA 1TWFB 2F3WA 5J1ZA 4JI5Q 4JBWA 1K8AC 4DNTB 3DWQA 1TVXA 2FMMA 5FO8B 3I4OA 4B3RL 4L5SA 3GTMB 1Y8OB 1SSOA 5EAYA 3WWVA 4NXMQ 2OCEA 3K6OA 1J8IA 2RSNA 1A62A 4H13C 1Y1VB 4R4QA 1FNUA 3HOXG 1FYCA 1K3RA 1QVGA 4GNXB 4LAAA 2K7VA 1VQLA 3A8JE 4NXNL 3K5LA 3W5OA 3CCEA 1D5MC 3UE1A 2VL6A 3AEVA 4CDEC 4Y7NB 4RGOS 3KJPA 2XRSD 4XQQA 5AJ3Q 1EOVA 1D2BA 1KD1C 4F8MA 1UEBA 5C4HA 4GNXA 3VR5A 3GO5A 5J39A 2F1MA 3LWUA 2WP8J 3GTQB 3MEHA 1GUGA 1X6OA 2H5XA 4X6AH 5C4JH 3K81C 1H9SB 3K59A 1TS3A 2EY6A 5D65A 3QJYA 5C4ZA 2PW5A 4XQJA 1HH2P 2KCTA 4IFDJ 4A3MB 1SFOB 1OXSC 4GKKL 2Q2IA 4LF7Q 2MFIA 1C4QA 3LWEA 3A7LA 4NDXA 3TEHB 4FF4A 1HNXQ 1II3A 4QY7A 4C3IB 1BKBA 4JI6L 3S15H 1OO9B 5FLXL 3NQIA 5C4XG 1Q1BA 5IYBG 5DEHA 4EX5A 1BQQT 2VB2X 1AP0A 1H9SA 3CD6A 3TBIB 1G51A 4YY3L 3S2HB 5C3WA 1LTLA 3LGJA 1IBKQ 4FXKC 1B53A 3K7UC 2XGTA 3F2UA 4JV5Q 1EY7A 4CDCC 2E74C 4X62L 1U0LA 4DV2Q 3OYYA 4LNQA 1EOTA 3Q24A 4AH6A 4KHZA 3CCSA 1Q81C 1E3PA 2E2HB 4JVZA 5EKKA 3TZDA 4EGVA 3PGZA 3WOFA 2B2TA 3N6RA 3TZUA 1XPRA 1Q7YC 1XNRQ 2IL8A 1I6HH 4A3BH 1E22A 5IP7H 2KJXA 4GKJQ 4OO1H 3H94A 4APVA 4NMZA 5BN5A 2MUYA 5KNCA 4BY7B 1E1TA 3ND8A 4IUPA 1EIFA 3DUZA 2ZXOA 3T4AC 3NWSA 4RKLA 3J81L 1VQBA 4CJ0B 5I6WA 1ZKOA 2F0DA 4F7XA 1HFNA 1S4ZA 4C3JB 1YBYA 1LTTD 3I8ZA 2YTVA 1WTHA 3M4QA 3E6ZX 4KY7A 3TP5A 1PTOH 5I4DA 2E75C 3KOJA 3R3OA 5COYA 3RD4A 1Q3LA 2RKSA 4ZQ3A 2K75A 3M85A 1XYIA 4OX9L 5LHY1 2DN8A 5GAHC 1STYA 2F0HA 2PI2E 3M9BA 1YZ6A 1HQRD 4Q5VA 3MVVA 4HJ8A 1A2TA 2IX0A 4JK1C 3DEOA 1GVPA 3GTKH 1HTLD 3S1RH 2K03A 1WTVA 1N34Q 1S5FD 2Q2UA 1AEXA 2LKVA 1CSQA 1GHKA 1F2LA 1HUMA 3S15B 2RHSB 3SK8A 2F4VL 3PO2B 1DONA 4JI8L 3EFXD 1SN8A 3UDIA 2MJ8A 4CGYB 1MSHA 1PRTC 2YV5A 2FINB 1PTOC 5H1SE 1DD2A 2CFMA 3NQTA 2AUKA 1A15A 1V43A 3H91A 1B8AA 3S1MH 4DR5L 1U4LA 1N8RC 2O5JC 1KNAA 4O42A 3I4MG 1FNVA 1PDQA 1IZ6A 4JG2A 1B3AA 2EYOA 2HCIA 1KRTA 1A3VA 4DU9A 4DV4Q 4A3LH 4G57A 4OO1I 1VF7A 1MSGA 4KV6A 1Y8PB 4LWCA 3RMHA 2HT1A 3J7AV 2I5MX 1MBYA 3PUYA 1GJXA 5IWAL 1I6HB 2WKDA 3E9IA 3MXPA 4A3BB 2NVYH 4AIMA 1JOQA 3TP6A 2JA8G 4POGA 2SOBA 1TS4A 3V05A 3CRKC 5ELBA 3HOUG 2EJMA 2VW9A 5C3XA 4UDUC 1B2TA 1E2WA 4A93H 3MWYW 3P75A 4DV6L 1PHJA 1T5EA 2GN5A 4B9XA 4XT1B 4B3TL 2IX1A 4A3CH 5E7NA 1G8ZD 4KLKA 3TQYA 1PRTB 1AFPA 1TWCH 1PTOB 1YNJD 2K5WA 1PZJD 2UUBQ 1BOSA 4H44C 1JORA 4CJ2C 3IL8A 5M3MB 2K01A 3T1HL 1U9RA 1PH7A 3HG9A 2NN6G 2I5LX 3TS0A 2JXMB 4N9TA 3UE0A 2K52A 3ZJYC 4IPHA 3GTKB 4RG1A 1EFWA 1CQVA 2N3SA 2VQEQ 1IHZA 3S1RB 1B1ZA 5DM63 1XMQQ 1CT1D 2L9HA 4KJOA 5KNBA 3G6JB 1KDBA 2K50A 2XWJB 4DA2A 1DOMA 3OWEB 3P1HA 1I4GA 1RTNA 1D1IA 1HR0W 3Q8DA 1YHAA 3EBEA 2K5VA 3JC66 4GS3A 1VQ7A 4M1UB 3T1YL 4A3IH 1GD7A 4H0LC 4IPGA 3HP3A 3VA7A 1O7YA 2R7DA 4BBSG 4R4CA 1LACA 1SYBA 3KJOA 4V190 1EU4A 2DNCA 3NBHB 1N9WA 5GADC 2EE1A 1M1KC 1U5KA 1FGUA 1NSNS 5FO9B 1SJHD 2NVYB 3S1QH 4JI1Q 5HGQA 5EJWA 1H9KA 2JEBI 4JI2Q 4FF3A 4ODGA 4IJHA 1GM5A 5DAUA 1I4RA 2XNAC 1X32A 4DV7L 1EWCA 2SEBD 1K0SA 2O4XA 4A93B 4BY1H 4HAEA 1Y1VG 5L37A 2N49A 2L12A 3NBHA 4O0AA 2IJ0A 2Z1CA 1RKNA 3EJIA 4LUZA 3C1FA 3NBIA 2GVAA 1N36L 3C46A 2D0PA 1VQFA 1ZYRD 1NY4A 1L1OA 2Z9HA 5G3LF 4DV5Q 2JA5G 2EY5A 4KHVA 1IBML 2Q8IB 4ME5A 3GTGH 1K8MA 1XPOA 4UAIA 3H6MA 1HPCA 1NNXA 2VB3X 4JCVE 3S24A 3RZOH 4KKUA 3MXNB 2IHFA 1JQYD 2VQFL 4HIDA 3I70A 4MHEA 4K14A 1AH9A 1V1OA 5EPKA 3BDOA 2Z0SA 4DR6L 2F0EA 5KGUA 2CCZA 1CKNA 4L5RC 3HOZB 3M4PA 4LFAL 3D31A 1SYCA 1I50H 4RFBA 4A3GG 4A3MG 1SR3A 1LM0A 2SDFA 4H7BA 3MXNA 4I7ZC 1Z9FA 5KYLA 1EYGA 4A3IB 4C3IG 5M5YH 2PNHA 3RN2A 4FF2A 1S5ED 5D3IB 4DNIA 1E1OA 1HNZQ 2R7ZB 2I5HA 1EY5A 4L5TA 2G9HD 4C3HG 5BR8Q 1SAPA 3J80E 2KEDA 5GROA 5CC4A 4DK3C 4RGMA 1ENFA 4X3SA 3CPWA 1JB3A 2K1BA 2R7FA 4YWLA 4YHHL 5LMUL 1UE6A 4DAYB 4DN4M 2UU9Q 2PI2A 4LUVA 5AFWA 4DR1L 3FRPB 5EGTA 1WFQA 3AFPA 2WAQE 1BBXC 4PZ8A 4HSPA 1EWHA 1N36Q 1EY4A 2UXCQ 2F3VA 2ZXRA 1CHQD 4YCWA 1SNQA 4BY1B 1JICA 2TMPA 5E3FA 3AB9A 2F0TA 1SNPA 2AHOB 1G6PA 4GLVB 4DAYA 3HOVB 2M00A 1YNJC 5JVH3 1NTGA 1RHPA 3Q0AA 1CA6A 3GTPB 4BY7G 2JP1A 1N32L 1ML0D 2DY8A 3I7FA 4DR2L 2PMZE 2CH4W 2R6GA 3OHXC 1QUQB 2HHHQ 1K73C 4K8JA 3QOJA 3B6YA 4LFCL 3I4NH 2OQKA 4QF4A 2K14A 4KD4A 4F87A 3L2PA 1PXUA 1S40A 1PH4A 2OQ0A 4ZLTF 2NB0A 4JI0Q 2OEOA 4C3JG 2HCCA 3RZOB 4DK1A 2WINB 3VYSA 1XJVA 5GAGC 4PV1C 3RNUA 2F0OA 2I0QA 1HNWQ 5C44H 4JI3L 4J8QA 1QUQA 4DR4L 1SEBD 4OL7A 4V0BA 4NB3A 1QOHA 4X66Q 1LTBD 2FMCA 4WJ3M 4QMGA 4OIKA 2K5DA 3SVMA 3CQZH 3SK5A 3VR4A 1F9SA 3PSIA 3U58A 1TWGH 4JI7Q 3NSWA 2HIXA 3T51B 4CJ1B 5M5WH 4B3MQ 2Q8TA 3GV3A 1DOLA 2L5TA 2KENA 3JAMi 1TWAH 5M5YB 1I3QB 4ZKBB 3BVZA 5ELCA 5DLQE 1GUWA 4OXPA 5JVG3 2C35B 1RIPA 4IPDA 1FJGL 3E5SA 3V2TA 1SROA 4IUVA 1NR2A 4IFDH 2A68D 4G7ZC 2FJ2A 1WYDA 3BDCA 3WDNA 4DK0A 3GTMH 2EZVA 3J7ZC 1D5XC 1STNA 2F0WA 4CBVA 1MJCA 2C9OA 1TU2B 3NELA 4XYOA 1B9MA 1X3PA 3M7GA 4DGZA 1GUSA 4OIJA 3K8AA 4GLAC 4A3BG 2AQ1B 5IP7G 1C0AA 4OO1G 4DPGA 2D5DA 5JEAH 1BDOA 2EY1A 2VS1A 4KJNA 2F0PA 1GXDC 3RR5A 2B29A 2A6ED 4U673 1WD1A 4Y7NH 2B39A 2G5DA 1B70B 2KCCA 1TY0A 1SMXA 1BUVT 1E0BA 2KUMA 1LT3D 3NWTA 1GOZA 1LO5D 3E0JA 2ASBA 5IGBA 4LFBQ 2AMCB 3I4NB 1SNOA 1B50A 2ZTEA 3D3RA 5CR3A 1O7ZA 3OIQA 4JC0A 1MKHA 1I94Q 2WV6D 4WRDA 2B2VC 5I2XA 1AE2A 3AU7A 5CYUA 3URYA 5AJ3L 3CW2C 1K8OA 4RHSA 1PYSB 4IURA 2K4KA 1K0RA 2LFNA 2SNSA 3OMGA 5IT9c 4JBMA 4IALA 2WFWA 2JA7H 1EY0A 3KBGA 5IGFA 1SFOH 3CPFA 1B7YB 1EY8A 1GO3E 3RLFA 3KF6B 1STBA
chains in the Genus database with same CATH topology
1KIXA 1E1TA 4EQ5A 4DR5Q 4B3SQ 1EIFA 5C4XH 1E24A 2AKWB 2DGYA 3HFZB 5IYBH 1AE3A 1VQBA 2CKZB 1K83H 3G71A 4A3DG 3EN2A 2K5NA 1O7IA 2YTXA 4YWMA 1C7YA 4IFDI 4DK6C 4MZ9A 1PH5A 4LF7L 2KHJA 5K36G 1VQGA 4A75A 4GOPB 1YEZA 4JBKA 1YBYA 1W2BA 4Y52H 2YTVA 3M4QA 3KF6A 3KOJA 5FJ8H 5IWAQ 1R9TH 3AFQA 4DAMA 3GDEA 1VQAA 5LMNQ 2E5LQ 1H95A 4A3FH 1VQEA 2KHIA 2E2HH 2K75A 4JOIC 4OWTB 3M85A 3A74A 4IO9A 3VDYA 1WJJA 4LF4L 4OX9L 4GLXA 5GAHC 1Q12A 4A3LG 4DUZL 2PI2E 2N8NA 3M9BA 1YZ6A 4OWXB 4X64Q 3OTOL 1YIJA 1IBKL 4HJ8A 3RZDH 3CC7A 2Q2TA 1K8GA 3PCOB 4DR7L 4JV5L 2QA4A 2IX0A 1I94L 5C0XJ 3CMAA 3PUXA 1XNQQ 1GVPA 4DV2L 4DV6Q 4GOPA 2BH8A 4R4OA 4BY7H 3GTKH 3CF5A 4B3TQ 3PO3G 1YJ9A 4P72A 3S1RH 3CCUA 1N34Q 2Q2UA 4A3DH 1WOCA 3UDXA 1CSQA 3U4VA 4DV3Q 1IXRA 1XNRL 2RHSB 2F4VL 3TRZA 1X54A 2E8GA 3DLLA 3HKZG 4JI8L 3PO2G 2MO0A 1SN8A 3FHWA 3UDIA 4LW1A 3JAMc 1HR0L 4IOAA 3GTJH 1OXXK 2YV5A 1OTCA 4UP8A 4RMFA 4PG3A 5H1SE 4GKJL 2CFMA 4LF5Q 1JJGA 2ZJPA 1WCMG 3ERSX 3CXCA 1PH8A 1V43A 1VCIA 4C3JH 4A93G 1B8AA 3K80C 3S1MH 4DR5L 1RL2A 3T1HQ 1N8RC 1PYBA 4B3SL 4OONA 3I4MG 1IZ6A 3PF4A 3FKIG 4P74A 1X3FA 3U4ZA 4A3CG 4JG2A 2R93G 1EUJA 3GTQH 2JA6G 4WJ4A 1KRTA 4YWKA 2OWOA 4DV4Q 4A3LH 1WI5A 1X9NA 2LXJA 2IY5B 4OO1I 4R1JA 4LWCA 4QJFA 1S3OA 2HT1A 2I5MX 4UPAA 3GD7A 3PIOA 3F2BA 3PUYA 1NE3A 3H0GG 4PZ6A 2HIVA 5IWAL 1D8LA 3E9IA 1PV4A 2NVYH 4AIMA 5ELNA 3PO3H 1YJNA 1V9PA 2E5LL 5IYCH 2ZTDA 1Q82C 2JA8G 5GQOA 4POGA 2UUAL 4MTNA 4AYBE 2KCMA 2WB1G 3CC4A 2A19A 1HZAA 1VQIA 3CCQA 3PO2H 1P8LA 1BBUA 2FXQA 3HOUG 2Q2HA 4X64L 2CWPA 2VW9A 3T1YQ 2Y0SE 1FVIA 4LF6Q 1WCMH 1QVCA 4DV1Q 1EIYB 2MO1A 4A93H 5C0XI 1XNQL 2KBNA 4LUOA 4DV6L 1PHJA 2GN5A 4BA1I 2Z6KA 1VQJA 1VQMA 4B3TL 4LF4Q 1KL9A 4NXMQ 2IX1A 3I4MH 3FKIH 2NVTH 4A3CH 5JEAJ 5M3FH 1N34L 5E7NA 2R93H 4DV3L 2JA6H 1OXVA 4DR7Q 4JOIA 4KLKA 3TQYA 4PMWA 3I2ZA 1Y1WG 1PA6A 1TWCH 1IYJB 2E2JH 3AYHB 4A3IG 4FDBA 2E2IH 2UUBQ 4LF5L 2LXKA 2ID0A 4L5QA 5M5XH 2A1AA 1VQCA 3STBD 2R7ZG 4ME3A 3H0GH 1YHQA 4XTCS 3T1HL 1CKOA 4R4TA 2AWOA 3MEFA 2N78A 5M3MG 1PH7A 4DV7Q 3S16H 3RN5A 2NN6G 2I5LX 3TS0A 1ASYA 3UE0A 3D0FA 2K52A 3ZJYC 3HOWH 2JA8H 1OXTA 4HJ5A 1X56A 1EQQA 1IBLQ 3KF8B 3KFUA 4XIGS 4IPHA 4QGUA 1UWVA 3GTOH 1VQNA 4DV4L 3J81i 3HOUH 1N33Q 4RG1A 1VQDA 1EFWA 2N3SA 2VQEQ 3PV0A 4BXXG 3BZKA 5IYDG 3ICEA 4HIMA 3ULLA 1XMQQ 1HZBA 3H15A 2JK8A 2EXDA 3E9HA 2K50A 1JJ2A 2F52A 1VQ8A 4P75A 1MIUA 1XTDA 3Q8DA 1HR0W 1YHAA 1IBMQ 3M3YH 3EBEA 2K5VA 3JC66 4GS3A 1VQ7A 1YI2A 1QVFA 1L2FA 4BY1G 1Y1WH 2RF4A 1Q1EA 4HJ9A 3T1YL 3CP0A 4A3IH 1GD7A 2Z6KC 4KHPL 3HOVG 1PH1A 4LF6L 4UY8C 4DV1L 4IPGA 3GTLH 1X65A 4LF8L 1NMGA 4BBSG 2R7DA 2UUAQ 2VQFQ 2GVBA 4R4CA 5M3MH 3KJOA 4A3KG 1XMOQ 4HJ7A 1SE8A 1W3SA 2QGQA 4HIKA 2CWAA 4AYBG 4JI4Q 2YYZA 3NBHB 1N9WA 5GADC 1M1KC 1U5KA 4DR6Q 1UE7A 1FGUA 2Y0SG 3S1QH 1V1QA 2EIFA 2F3IA 4JI1Q 5HGQA 4DKAC 2UUBL 4BXXH 5IYDH 4LFAQ 2JEBI 4JI2Q 5LMNW 4X65Q 3AQQA 2MNAA 4IJHA 1GM5A 1S72A 1K9MC 3J81j 2NZHA 4DV7L 3M7NA 4H02A 2UXBQ 4POFA 1P16A 2VNUD 1Q8KA 2QEXA 1IBLL 2HQLA 3ULPA 2A8VA 4BY1H 3S1NH 1Y1VG 2N49A 4KI0A 3KDFB 1VQPA 1N33L 3F2CA 3S14H 4O0AA 2VQEL 4IPCA 3ER0A 3ULJA 1X55A 1A0IA 4LUZA 1XMQL 3J80i 3PUWA 1KC8C 2GVAA 1BVSA 1N36L 5LMUQ 4MNOA 4YHHQ 2D0PA 1TXYA 3I55A 4YCVA 1VQFA 2VUMG 4BBSH 1NY4A 1L1OA 2VY3A 4DV5Q 4A3KH 2JA5G 4IJLA 3BJUA 2BA1A 3PIPA 4DR1Q 1PH2A 1IBML 2R92G 2NVXH 3GTGH 1NMFA 1PVOA 2DUDA 1XPOA 2JJQA 2YU9H 3CMEA 5JJIA 1CUKA 1TWFH 4JCVE 3OW2A 4HJAA 3KDFA 3S24A 3RZOH 3RLOA 1LUZA 3MXNB 1FL0A 2ZM6Q 4DUYL 3H3VH 2B63G 2IHFA 1HZCA 4GN3B 5FLXc 2VQFL 4HIDA 4HIOA 1XMOL 3K0XA 1AH9A 4KHPQ 4JI4L 1N32Q 1M90C 2ZTCA 4TVAB 4DR2Q 1SRUA 3KYHC 2CQOA 2Z0SA 1Y1VH 3NENA 1HZ9A 4DR6L 1E7ZA 3TREA 2CCZA 4LF8Q 1CKNA 4L5RC 4JI5L 4JI1L 2ATWA 3CCMA 3HOZG 1J5EQ 3M4PA 5HY6A 4LFAL 4K0KQ 3D31A 3PUVA 1I50H 4JI2L 2D0OA 3CAMA 1SR3A 4A3MG 1LM0A 4X65L 1JB7A 4LFCQ 4A3GG 3F8TA 1PH3A 2VUMH 2UXDQ 4A76A 1Z9FA 1A63A 4NXML 2LSSA 2NN6I 1NJIC 1EYGA 2JA5H 4JYAQ 2UXBL 5J3BA 1BBWA 5M5YH 2PNHA 5ELOA 3RN2A 2MQHA 4A3JG 3PF5A 2ZJQA 4DNIA 1E1OA 2R92H 1HNZQ 1VQ4A 2JE6I 4A4IA 3G4SA 4B3RQ 4A3EG 2I5HA 5FLMG 3HKSA 4L5TA 1YITA 1L1OC 1Y14B 1KHIA 2JA9A 5BR8Q 4JI3Q 4DR4Q 5JJLA 5GROA 1YNXA 4GN4B 4PZ7A 4DK3C 3G6EA 2B63H 5LMUL 3CPWA 5IP9G 2R7FA 4YWLA 4YHHL 4TQUS 1ASZA 3I4NG 1JT8A 1OXUA 1PH9A 1UE6A 4DAYB 5IE8A 1YVCA 2YTYA 4DV5L 3CCJA 1VQKA 2UU9Q 2PI2A 4LUVA 4DR1L 3J81c 1WFQA 2ALYB 3AFPA 2NVQH 1X3EA 2WAQE 4PZ8A 2IHEA 4NXNQ 1PH6A 4BA2I 4GNXC 4UP7A 2PQAB 1N36Q 3CCVA 1LYLA 2VZAA 1VQ9A 5C44G 1KRSA 1XPUA 3S17H 2XTIA 3BZCA 3HOZH 2UXCQ 3UDFA 2ZM6L 1VQ5A 2OTLA 4A3GH 1JJCB 4A3MH 3A0JA 4YCWA 1Q86C 1A8VA 4JBJA 1MJEA 1YHBA 3HOYG 3A5ZB 1TWHH 2AHOB 5C3EG 4LF9Q 4C3IH 4GLVB 1FJGQ 1G6PA 4A3JH 1NTGA 1VQOA 1Q46A 1QZHA 1JMCA 4BY7G 1N32L 1EQRA 3I7FA 4DR2L 4IOCA 2PMZE 1VQ6A 2R6GA 4DUYQ 4A3EH 5FLMH 4OWWB 2R7ZH 4QQBX 1QUQB 3STBC 2PQAA 3RLNA 4C3HH 2HHHQ 1Z47A 1K73C 1J5EL 4K0KL 3H3VI 2WB1E 3S2HH 1KXLA 3B6YA 4QIWE 4LFCL 3I4NH 5IP9H 2OTJA 2OQKA 2UXDL 2K14A 3K7AH 3L2PA 3U50C 1S40A 1PH4A 2OQ0A 1HNXL 3BU2A 1X3GA 3F2DA 4DV0Q 4JI0Q 2JEAI 4JYAL 3FP9A 4JI5Q 4JBWA 1K8AC 1HNZL 2AWNA 2L15A 1XJVA 3I4OA 3L0OA 4B3RL 3F1ZA 3L7ZC 5GAGC 3DM3A 1L1OB 4GKKQ 4IFDG 3RNUA 4L5SA 2I0QA 1HNWQ 5C44H 1VS0A 5EAYA 3WWVA 1GKHA 1UE5A 1QUQA 2OCEA 2D62A 4GN5A 1L0WA 4JI3L 5BR8L 4JI6Q 1PFSA 4DR4L 3W1GA 4NB3A 4X66Q 3J7A5 1A62A 1VQHA 4WJ3M 4R4QA 3HOYH 4NPSA 3CC2A 2UU9L 4LFBL 3HOXG 5C3EH 1K3RA 1QVGA 4UP9A 4GNXB 1KAWA 4DR3Q 1VQLA 3CQZH 4NXNL 3HOVH 4YY3Q 1YJWA 3PSIA 3U58A 3GTPH 1TWGH 1I5FA 5IY0A 2K5HA 3W5OA 2HIXA 5IYCG 3J80c 3CCEA 5M5WH 4B3MQ 4JI7Q 5JEAG 3UE1A 2VL6A 3PUZA 3AEVA 2UXCL 1HJPA 2KENA 1TWAH 4BBRG 3JAMi 4X62Q 3KJPA 1G291 2RCNA 5DLQE 5AJ3Q 4OXPA 2C35B 1CKNB 1EOVA 3M4OH 1RIPA 4IPDA 4QL5A 4J15A 1KD1C 2UUCL 2BH2A 4YCUA 2EQSA 4LF9L 1FJGL 2WAQG 4P71A 1NBWA 2RHQB 3A5UA 1UEBA 2NZOA 1C9OA 1SROA 4AQYQ 4GNXA 2V1CC 3CCRA 3GO5A 1WYDA 5M3FG 3UDGA 3E0EA 2HHHL 3GTMH 2WP8J 1CSPA 3J7ZC 1UE1A 2JQOA 1X6OA 2H5XA 4X6AH 5C4JH 3K81C 1MJCA 2BA0A 4DV0L 4JI0L 3HOXH 1JE5A 3NELA 4C2MH 1HH2P 2ES2A 3NEMA 2KCTA 4IFDJ 2JA7G 4ALPA 4P73A 1OXSC 4GKKL 1IL2A 3K8AA 4GLAC 5LMNL 4A3BG 2Q2IA 5IP7G 4LF7Q 3G48A 1C0AA 2MFIA 3HOWG 3TEHB 2IT1A 4OO1G 4DPGA 1HNWL 1HNXQ 4QY7A 3S2DH 2VS1A 1BKBA 3RR5A 4BBRH 2B29A 3I56A 4JI6L 3S15H 5JJKA 4Y7NH 4GOPC 1I3QH 4X66L 1B70B 5GAEC 3CCLA 1KQSA 5C4XG 1Q1BA 2B3GA 1SMXA 5IYBG 4EX5A 3CD6A 2ASBA 1SLJA 4DR3L 1G51A 4LFBQ 1D7QA 4YY3L 4OX9Q 3TS2A 2AMCB 4DUZQ 1LTLA 2ZTEA 3HKZE 3LGJA 1IBKQ 4JI7L 3SGIA 3K7UC 3OTOQ 2ZJRA 4B3ML 2XGTA 3IRBA 3EIVA 4JV5Q 4JC0A 1I94Q 1MKHA 4X62L 1QZGA 1U0LA 3W1BA 4R4IA 5C0XG 4DV2Q 1AE2A 3OYYA 4LNQA 1DGSA 4AH6A 5FJ8G 5AJ3L 3KLWA 3CW2C 4KHZA 3CCSA 1PYSB 1Q81C 1E3PA 1K0RA 2K4KA 1XPRA 1Q7YC 3PGZA 4A3FG 5IT9c 4JBMA 1XNRQ 2F4VQ 2WFWA 2JA7H 4JI8Q 4AQYL 1I6HH 1SFOH 1T9HA 3CPFA 1HR0Q 4A3BH 1E22A 4O2DA 1J6QA 5IP7H 4GKJQ 1B7YB 3RLFA 1GO3E 4APVA 1CKMA 3KF6B 1EWIA 2UUCQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KIX A;  1E1T A;  4EQ5 A;  4DR5 Q;  4B3S Q;  1EIF A;  5C4X H;  1E24 A;  2AKW B;  2DGY A;  3HFZ B;  5IYB H;  1AE3 A;  1VQB A;  2CKZ B;  1K83 H;  3G71 A;  4A3D G;  3EN2 A;  2K5N A;  1O7I A;  2YTX A;  4YWM A;  1C7Y A;  4IFD I;  4DK6 C;  4MZ9 A;  1PH5 A;  4LF7 L;  2KHJ A;  5K36 G;  1VQG A;  4A75 A;  4GOP B;  1YEZ A;  4JBK A;  1YBY A;  1W2B A;  4Y52 H;  2YTV A;  3M4Q A;  3KF6 A;  3KOJ A;  5FJ8 H;  5IWA Q;  1R9T H;  3AFQ A;  4DAM A;  3GDE A;  1VQA A;  5LMN Q;  2E5L Q;  1H95 A;  4A3F H;  1VQE A;  2KHI A;  2E2H H;  2K75 A;  4JOI C;  4OWT B;  3M85 A;  3A74 A;  4IO9 A;  3VDY A;  1WJJ A;  4LF4 L;  4OX9 L;  4GLX A;  5GAH C;  1Q12 A;  4A3L G;  4DUZ L;  2PI2 E;  2N8N A;  3M9B A;  1YZ6 A;  4OWX B;  4X64 Q;  3OTO L;  1YIJ A;  1IBK L;  4HJ8 A;  3RZD H;  3CC7 A;  2Q2T A;  1K8G A;  3PCO B;  4DR7 L;  4JV5 L;  2QA4 A;  2IX0 A;  1I94 L;  5C0X J;  3CMA A;  3PUX A;  1XNQ Q;  1GVP A;  4DV2 L;  4DV6 Q;  4GOP A;  2BH8 A;  4R4O A;  4BY7 H;  3GTK H;  3CF5 A;  4B3T Q;  3PO3 G;  1YJ9 A;  4P72 A;  3S1R H;  3CCU A;  1N34 Q;  2Q2U A;  4A3D H;  1WOC A;  3UDX A;  1CSQ A;  3U4V A;  4DV3 Q;  1IXR A;  1XNR L;  2RHS B;  2F4V L;  3TRZ A;  1X54 A;  2E8G A;  3DLL A;  3HKZ G;  4JI8 L;  3PO2 G;  2MO0 A;  1SN8 A;  3FHW A;  3UDI A;  4LW1 A;  3JAM c;  1HR0 L;  4IOA A;  3GTJ H;  1OXX K;  2YV5 A;  1OTC A;  4UP8 A;  4RMF A;  4PG3 A;  5H1S E;  4GKJ L;  2CFM A;  4LF5 Q;  1JJG A;  2ZJP A;  1WCM G;  3ERS X;  3CXC A;  1PH8 A;  1V43 A;  1VCI A;  4C3J H;  4A93 G;  1B8A A;  3K80 C;  3S1M H;  4DR5 L;  1RL2 A;  3T1H Q;  1N8R C;  1PYB A;  4B3S L;  4OON A;  3I4M G;  1IZ6 A;  3PF4 A;  3FKI G;  4P74 A;  1X3F A;  3U4Z A;  4A3C G;  4JG2 A;  2R93 G;  1EUJ A;  3GTQ H;  2JA6 G;  4WJ4 A;  1KRT A;  4YWK A;  2OWO A;  4DV4 Q;  4A3L H;  1WI5 A;  1X9N A;  2LXJ A;  2IY5 B;  4OO1 I;  4R1J A;  4LWC A;  4QJF A;  1S3O A;  2HT1 A;  2I5M X;  4UPA A;  3GD7 A;  3PIO A;  3F2B A;  3PUY A;  1NE3 A;  3H0G G;  4PZ6 A;  2HIV A;  5IWA L;  1D8L A;  3E9I A;  1PV4 A;  2NVY H;  4AIM A;  5ELN A;  3PO3 H;  1YJN A;  1V9P A;  2E5L L;  5IYC H;  2ZTD A;  1Q82 C;  2JA8 G;  5GQO A;  4POG A;  2UUA L;  4MTN A;  4AYB E;  2KCM A;  2WB1 G;  3CC4 A;  2A19 A;  1HZA A;  1VQI A;  3CCQ A;  3PO2 H;  1P8L A;  1BBU A;  2FXQ A;  3HOU G;  2Q2H A;  4X64 L;  2CWP A;  2VW9 A;  3T1Y Q;  2Y0S E;  1FVI A;  4LF6 Q;  1WCM H;  1QVC A;  4DV1 Q;  1EIY B;  2MO1 A;  4A93 H;  5C0X I;  1XNQ L;  2KBN A;  4LUO A;  4DV6 L;  1PHJ A;  2GN5 A;  4BA1 I;  2Z6K A;  1VQJ A;  1VQM A;  4B3T L;  4LF4 Q;  1KL9 A;  4NXM Q;  2IX1 A;  3I4M H;  3FKI H;  2NVT H;  4A3C H;  5JEA J;  5M3F H;  1N34 L;  5E7N A;  2R93 H;  4DV3 L;  2JA6 H;  1OXV A;  4DR7 Q;  4JOI A;  4KLK A;  3TQY A;  4PMW A;  3I2Z A;  1Y1W G;  1PA6 A;  1TWC H;  1IYJ B;  2E2J H;  3AYH B;  4A3I G;  4FDB A;  2E2I H;  2UUB Q;  4LF5 L;  2LXK A;  2ID0 A;  4L5Q A;  5M5X H;  2A1A A;  1VQC A;  3STB D;  2R7Z G;  4ME3 A;  3H0G H;  1YHQ A;  4XTC S;  3T1H L;  1CKO A;  4R4T A;  2AWO A;  3MEF A;  2N78 A;  5M3M G;  1PH7 A;  4DV7 Q;  3S16 H;  3RN5 A;  2NN6 G;  2I5L X;  3TS0 A;  1ASY A;  3UE0 A;  3D0F A;  2K52 A;  3ZJY C;  3HOW H;  2JA8 H;  1OXT A;  4HJ5 A;  1X56 A;  1EQQ A;  1IBL Q;  3KF8 B;  3KFU A;  4XIG S;  4IPH A;  4QGU A;  1UWV A;  3GTO H;  1VQN A;  4DV4 L;  3J81 i;  3HOU H;  1N33 Q;  4RG1 A;  1VQD A;  1EFW A;  2N3S A;  2VQE Q;  3PV0 A;  4BXX G;  3BZK A;  5IYD G;  3ICE A;  4HIM A;  3ULL A;  1XMQ Q;  1HZB A;  3H15 A;  2JK8 A;  2EXD A;  3E9H A;  2K50 A;  1JJ2 A;  2F52 A;  1VQ8 A;  4P75 A;  1MIU A;  1XTD A;  3Q8D A;  1HR0 W;  1YHA A;  1IBM Q;  3M3Y H;  3EBE A;  2K5V A;  3JC6 6;  4GS3 A;  1VQ7 A;  1YI2 A;  1QVF A;  1L2F A;  4BY1 G;  1Y1W H;  2RF4 A;  1Q1E A;  4HJ9 A;  3T1Y L;  3CP0 A;  4A3I H;  1GD7 A;  2Z6K C;  4KHP L;  3HOV G;  1PH1 A;  4LF6 L;  4UY8 C;  4DV1 L;  4IPG A;  3GTL H;  1X65 A;  4LF8 L;  1NMG A;  4BBS G;  2R7D A;  2UUA Q;  2VQF Q;  2GVB A;  4R4C A;  5M3M H;  3KJO A;  4A3K G;  1XMO Q;  4HJ7 A;  1SE8 A;  1W3S A;  2QGQ A;  4HIK A;  2CWA A;  4AYB G;  4JI4 Q;  2YYZ A;  3NBH B;  1N9W A;  5GAD C;  1M1K C;  1U5K A;  4DR6 Q;  1UE7 A;  1FGU A;  2Y0S G;  3S1Q H;  1V1Q A;  2EIF A;  2F3I A;  4JI1 Q;  5HGQ A;  4DKA C;  2UUB L;  4BXX H;  5IYD H;  4LFA Q;  2JEB I;  4JI2 Q;  5LMN W;  4X65 Q;  3AQQ A;  2MNA A;  4IJH A;  1GM5 A;  1S72 A;  1K9M C;  3J81 j;  2NZH A;  4DV7 L;  3M7N A;  4H02 A;  2UXB Q;  4POF A;  1P16 A;  2VNU D;  1Q8K A;  2QEX A;  1IBL L;  2HQL A;  3ULP A;  2A8V A;  4BY1 H;  3S1N H;  1Y1V G;  2N49 A;  4KI0 A;  3KDF B;  1VQP A;  1N33 L;  3F2C A;  3S14 H;  4O0A A;  2VQE L;  4IPC A;  3ER0 A;  3ULJ A;  1X55 A;  1A0I A;  4LUZ A;  1XMQ L;  3J80 i;  3PUW A;  1KC8 C;  2GVA A;  1BVS A;  1N36 L;  5LMU Q;  4MNO A;  4YHH Q;  2D0P A;  1TXY A;  3I55 A;  4YCV A;  1VQF A;  2VUM G;  4BBS H;  1NY4 A;  1L1O A;  2VY3 A;  4DV5 Q;  4A3K H;  2JA5 G;  4IJL A;  3BJU A;  2BA1 A;  3PIP A;  4DR1 Q;  1PH2 A;  1IBM L;  2R92 G;  2NVX H;  3GTG H;  1NMF A;  1PVO A;  2DUD A;  1XPO A;  2JJQ A;  2YU9 H;  3CME A;  5JJI A;  1CUK A;  1TWF H;  4JCV E;  3OW2 A;  4HJA A;  3KDF A;  3S24 A;  3RZO H;  3RLO A;  1LUZ A;  3MXN B;  1FL0 A;  2ZM6 Q;  4DUY L;  3H3V H;  2B63 G;  2IHF A;  1HZC A;  4GN3 B;  5FLX c;  2VQF L;  4HID A;  4HIO A;  1XMO L;  3K0X A;  1AH9 A;  4KHP Q;  4JI4 L;  1N32 Q;  1M90 C;  2ZTC A;  4TVA B;  4DR2 Q;  1SRU A;  3KYH C;  2CQO A;  2Z0S A;  1Y1V H;  3NEN A;  1HZ9 A;  4DR6 L;  1E7Z A;  3TRE A;  2CCZ A;  4LF8 Q;  1CKN A;  4L5R C;  4JI5 L;  4JI1 L;  2ATW A;  3CCM A;  3HOZ G;  1J5E Q;  3M4P A;  5HY6 A;  4LFA L;  4K0K Q;  3D31 A;  3PUV A;  1I50 H;  4JI2 L;  2D0O A;  3CAM A;  1SR3 A;  4A3M G;  1LM0 A;  4X65 L;  1JB7 A;  4LFC Q;  4A3G G;  3F8T A;  1PH3 A;  2VUM H;  2UXD Q;  4A76 A;  1Z9F A;  1A63 A;  4NXM L;  2LSS A;  2NN6 I;  1NJI C;  1EYG A;  2JA5 H;  4JYA Q;  2UXB L;  5J3B A;  1BBW A;  5M5Y H;  2PNH A;  5ELO A;  3RN2 A;  2MQH A;  4A3J G;  3PF5 A;  2ZJQ A;  4DNI A;  1E1O A;  2R92 H;  1HNZ Q;  1VQ4 A;  2JE6 I;  4A4I A;  3G4S A;  4B3R Q;  4A3E G;  2I5H A;  5FLM G;  3HKS A;  4L5T A;  1YIT A;  1L1O C;  1Y14 B;  1KHI A;  2JA9 A;  5BR8 Q;  4JI3 Q;  4DR4 Q;  5JJL A;  5GRO A;  1YNX A;  4GN4 B;  4PZ7 A;  4DK3 C;  3G6E A;  2B63 H;  5LMU L;  3CPW A;  5IP9 G;  2R7F A;  4YWL A;  4YHH L;  4TQU S;  1ASZ A;  3I4N G;  1JT8 A;  1OXU A;  1PH9 A;  1UE6 A;  4DAY B;  5IE8 A;  1YVC A;  2YTY A;  4DV5 L;  3CCJ A;  1VQK A;  2UU9 Q;  2PI2 A;  4LUV A;  4DR1 L;  3J81 c;  1WFQ A;  2ALY B;  3AFP A;  2NVQ H;  1X3E A;  2WAQ E;  4PZ8 A;  2IHE A;  4NXN Q;  1PH6 A;  4BA2 I;  4GNX C;  4UP7 A;  2PQA B;  1N36 Q;  3CCV A;  1LYL A;  2VZA A;  1VQ9 A;  5C44 G;  1KRS A;  1XPU A;  3S17 H;  2XTI A;  3BZC A;  3HOZ H;  2UXC Q;  3UDF A;  2ZM6 L;  1VQ5 A;  2OTL A;  4A3G H;  1JJC B;  4A3M H;  3A0J A;  4YCW A;  1Q86 C;  1A8V A;  4JBJ A;  1MJE A;  1YHB A;  3HOY G;  3A5Z B;  1TWH H;  2AHO B;  5C3E G;  4LF9 Q;  4C3I H;  4GLV B;  1FJG Q;  1G6P A;  4A3J H;  1NTG A;  1VQO A;  1Q46 A;  1QZH A;  1JMC A;  4BY7 G;  1N32 L;  1EQR A;  3I7F A;  4DR2 L;  4IOC A;  2PMZ E;  1VQ6 A;  2R6G A;  4DUY Q;  4A3E H;  5FLM H;  4OWW B;  2R7Z H;  4QQB X;  1QUQ B;  3STB C;  2PQA A;  3RLN A;  4C3H H;  2HHH Q;  1Z47 A;  1K73 C;  1J5E L;  4K0K L;  3H3V I;  2WB1 E;  3S2H H;  1KXL A;  3B6Y A;  4QIW E;  4LFC L;  3I4N H;  5IP9 H;  2OTJ A;  2OQK A;  2UXD L;  2K14 A;  3K7A H;  3L2P A;  3U50 C;  1S40 A;  1PH4 A;  2OQ0 A;  1HNX L;  3BU2 A;  1X3G A;  3F2D A;  4DV0 Q;  4JI0 Q;  2JEA I;  4JYA L;  3FP9 A;  4JI5 Q;  4JBW A;  1K8A C;  1HNZ L;  2AWN A;  2L15 A;  1XJV A;  3I4O A;  3L0O A;  4B3R L;  3F1Z A;  3L7Z C;  5GAG C;  3DM3 A;  1L1O B;  4GKK Q;  4IFD G;  3RNU A;  4L5S A;  2I0Q A;  1HNW Q;  5C44 H;  1VS0 A;  5EAY A;  3WWV A;  1GKH A;  1UE5 A;  1QUQ A;  2OCE A;  2D62 A;  4GN5 A;  1L0W A;  4JI3 L;  5BR8 L;  4JI6 Q;  1PFS A;  4DR4 L;  3W1G A;  4NB3 A;  4X66 Q;  3J7A 5;  1A62 A;  1VQH A;  4WJ3 M;  4R4Q A;  3HOY H;  4NPS A;  3CC2 A;  2UU9 L;  4LFB L;  3HOX G;  5C3E H;  1K3R A;  1QVG A;  4UP9 A;  4GNX B;  1KAW A;  4DR3 Q;  1VQL A;  3CQZ H;  4NXN L;  3HOV H;  4YY3 Q;  1YJW A;  3PSI A;  3U58 A;  3GTP H;  1TWG H;  1I5F A;  5IY0 A;  2K5H A;  3W5O A;  2HIX A;  5IYC G;  3J80 c;  3CCE A;  5M5W H;  4B3M Q;  4JI7 Q;  5JEA G;  3UE1 A;  2VL6 A;  3PUZ A;  3AEV A;  2UXC L;  1HJP A;  2KEN A;  1TWA H;  4BBR G;  3JAM i;  4X62 Q;  3KJP A;  1G29 1;  2RCN A;  5DLQ E;  5AJ3 Q;  4OXP A;  2C35 B;  1CKN B;  1EOV A;  3M4O H;  1RIP A;  4IPD A;  4QL5 A;  4J15 A;  1KD1 C;  2UUC L;  2BH2 A;  4YCU A;  2EQS A;  4LF9 L;  1FJG L;  2WAQ G;  4P71 A;  1NBW A;  2RHQ B;  3A5U A;  1UEB A;  2NZO A;  1C9O A;  1SRO A;  4AQY Q;  4GNX A;  2V1C C;  3CCR A;  3GO5 A;  1WYD A;  5M3F G;  3UDG A;  3E0E A;  2HHH L;  3GTM H;  2WP8 J;  1CSP A;  3J7Z C;  1UE1 A;  2JQO A;  1X6O A;  2H5X A;  4X6A H;  5C4J H;  3K81 C;  1MJC A;  2BA0 A;  4DV0 L;  4JI0 L;  3HOX H;  1JE5 A;  3NEL A;  4C2M H;  1HH2 P;  2ES2 A;  3NEM A;  2KCT A;  4IFD J;  2JA7 G;  4ALP A;  4P73 A;  1OXS C;  4GKK L;  1IL2 A;  3K8A A;  4GLA C;  5LMN L;  4A3B G;  2Q2I A;  5IP7 G;  4LF7 Q;  3G48 A;  1C0A A;  2MFI A;  3HOW G;  3TEH B;  2IT1 A;  4OO1 G;  4DPG A;  1HNW L;  1HNX Q;  4QY7 A;  3S2D H;  2VS1 A;  1BKB A;  3RR5 A;  4BBR H;  2B29 A;  3I56 A;  4JI6 L;  3S15 H;  5JJK A;  4Y7N H;  4GOP C;  1I3Q H;  4X66 L;  1B70 B;  5GAE C;  3CCL A;  1KQS A;  5C4X G;  1Q1B A;  2B3G A;  1SMX A;  5IYB G;  4EX5 A;  3CD6 A;  2ASB A;  1SLJ A;  4DR3 L;  1G51 A;  4LFB Q;  1D7Q A;  4YY3 L;  4OX9 Q;  3TS2 A;  2AMC B;  4DUZ Q;  1LTL A;  2ZTE A;  3HKZ E;  3LGJ A;  1IBK Q;  4JI7 L;  3SGI A;  3K7U C;  3OTO Q;  2ZJR A;  4B3M L;  2XGT A;  3IRB A;  3EIV A;  4JV5 Q;  4JC0 A;  1I94 Q;  1MKH A;  4X62 L;  1QZG A;  1U0L A;  3W1B A;  4R4I A;  5C0X G;  4DV2 Q;  1AE2 A;  3OYY A;  4LNQ A;  1DGS A;  4AH6 A;  5FJ8 G;  5AJ3 L;  3KLW A;  3CW2 C;  4KHZ A;  3CCS A;  1PYS B;  1Q81 C;  1E3P A;  1K0R A;  2K4K A;  1XPR A;  1Q7Y C;  3PGZ A;  4A3F G;  5IT9 c;  4JBM A;  1XNR Q;  2F4V Q;  2WFW A;  2JA7 H;  4JI8 Q;  4AQY L;  1I6H H;  1SFO H;  1T9H A;  3CPF A;  1HR0 Q;  4A3B H;  1E22 A;  4O2D A;  1J6Q A;  5IP7 H;  4GKJ Q;  1B7Y B;  3RLF A;  1GO3 E;  4APV A;  1CKM A;  3KF6 B;  1EWI A;  2UUC Q; 
#chains in the Genus database with same CATH topology
 3Q6S A;  3CQZ B;  2DY7 A;  1F2M A;  4B3S Q;  1E24 A;  2AKW B;  5M5W B;  4DXG A;  4I7A A;  1U4P A;  1TWA B;  1YNN D;  3R2I A;  3S9W A;  1O7I A;  4IFD I;  1JR0 D;  4DK6 C;  4MZ9 A;  4LF7 L;  3MA2 B;  3QO2 A;  1VQG A;  5BN3 A;  4A75 A;  1Z7T A;  1XTC D;  3H09 A;  2D2C C;  3I4L A;  1T5X D;  3KF6 A;  3AFQ A;  1AW7 A;  3CU7 A;  3ITP A;  2MP1 A;  3MFY A;  1STE A;  1H95 A;  4A3F H;  2E2H H;  4OWT B;  4IO9 A;  3A74 A;  3K5M A;  4A3L G;  2N8N A;  4X64 Q;  1IBK L;  5KRU A;  3KLR A;  3RZD H;  3CC7 A;  1K8G A;  2M2L A;  4JV5 L;  2QA4 A;  4TRD A;  5C0X J;  1R4Q B;  3DWA A;  4K6L A;  3CMA A;  2B2T C;  1LAB A;  4DV2 L;  3HEJ A;  4X3K A;  3OMC A;  4BY7 H;  1J9O A;  5IT9 E;  5A2Q E;  1AZP A;  1WOC A;  1O78 A;  1LTA D;  2IPK D;  1XNR L;  2EDG A;  4KK7 A;  2MO0 A;  3FHW A;  3JAM c;  4LW1 A;  4IOA A;  5NUC A;  3GTJ H;  2AQ3 B;  4GKJ L;  5K36 H;  4LF5 Q;  1A3U A;  1JJG A;  2ZJP A;  2WAQ B;  2K5Q A;  1PH8 A;  4JW0 A;  4C3J H;  4A93 G;  2N55 A;  3K80 C;  2B2V A;  1BCP F;  2JN4 A;  1PYB A;  4UHV A;  3U9O A;  1QCB D;  3DHQ A;  4A3C G;  3U4Z A;  1EUJ A;  2H4O A;  4YWK A;  2OWO A;  1WI5 A;  2IY5 B;  5DM7 3;  2LS0 1;  2NUC A;  1S3O A;  3ERQ A;  4UPA A;  3GD7 A;  2EJF C;  3PIO A;  3F2B A;  4R8N A;  1NE3 A;  1LTG D;  2PMZ B;  2JA7 B;  1PV4 A;  2EY2 A;  2QF7 A;  1TS5 A;  4KMU C;  5TSS A;  2QKI C;  2KCM A;  2WB1 G;  3CC4 A;  5IGG A;  1HZA A;  3PO2 H;  4IQZ A;  1RDP D;  3CCQ A;  2FXQ A;  1SE3 A;  2Y0S E;  4LF6 Q;  1WCM H;  4DV1 Q;  3EVQ A;  1EIY B;  4L63 B;  2Z6K A;  1VQJ A;  3M4Y A;  1VQM A;  3M3Y B;  5JEA J;  1N34 L;  2R93 H;  2A68 C;  4XYQ A;  2JA6 H;  3D8G A;  1BCP D;  3JAM E;  4PMW A;  1PA6 A;  1IYJ B;  5FKA C;  4RH6 A;  4E6I A;  4A3I G;  3LX0 A;  2E2I H;  2LXK A;  4A3F B;  2R7Z G;  4FNF A;  4ME3 A;  3H0G H;  4DNR B;  1V1P B;  4XTC S;  1CKO A;  2AWO A;  1UUP A;  3NK9 A;  1Q90 A;  5C5M A;  3MEF A;  1QIL A;  2N78 A;  4KN7 C;  1ET6 A;  4DAP A;  3RZD B;  2BDN A;  5J22 A;  4LK1 C;  1JE4 A;  4HJ5 A;  4ZYS A;  1EQQ A;  1E2Z A;  3KF8 B;  1IBL Q;  3KFU A;  3PIO 3;  3FDT A;  1ICW A;  4QGU A;  3GTO H;  4R8I A;  3VYU A;  4DV4 L;  1ENC A;  3TN2 A;  2JK8 A;  5F2D A;  2EXD A;  2F52 A;  2L55 A;  4G7H C;  1ROD A;  3GTJ B;  1MHW C;  1V1P A;  5IT9 L;  5A2Q L;  1DYQ A;  3SXH A;  3T13 A;  5JAV A;  2KQ3 A;  5A35 A;  1YI2 A;  4BY1 G;  2RF4 A;  3KF8 A;  4KHP L;  3HOV G;  1PH1 A;  4UY8 C;  3HGB A;  2F0F A;  4LF8 L;  1NMG A;  5LL6 X;  1SYF A;  2PW7 A;  1FGB D;  5M3M H;  1XMO Q;  3RUZ A;  2NVX B;  1W3S A;  3GQB A;  4ZKC B;  5FO7 B;  2I46 A;  2YYZ A;  4J6H A;  3C2P A;  1H9M A;  4NP5 A;  1STH A;  3FPU B;  3BYY B;  1UE7 A;  4BS9 A;  1V1Q A;  2O2L D;  2RBM A;  4HR7 B;  4CKB A;  2UUB L;  4BXX H;  1KDA A;  5LMN W;  4J1M A;  4QUF A;  4X65 Q;  2ICE C;  4RGT A;  4EQN A;  1IYV A;  4R9W A;  3M7N A;  4H02 A;  2UXB Q;  1TKW B;  2F03 A;  1WCM B;  3A7A B;  1STA A;  1F9R A;  3ULP A;  1CZW A;  2A8V A;  5CV9 A;  1VQP A;  3KDF B;  3S14 H;  1S5C D;  2EYM A;  2VQE L;  4IPC A;  3ER0 A;  1KC8 C;  1XMQ L;  1KNE A;  2R93 B;  3EQL C;  3J80 i;  2F0Q A;  2JA6 B;  5JPM C;  2VUM B;  4MNO A;  3DM1 A;  3KUP A;  1ILQ A;  4YCV A;  3FVQ A;  3VR3 A;  2R92 B;  2E2I B;  4IJL A;  3L3O C;  3H0G B;  3JAM L;  1EIG A;  2PO4 A;  3CME A;  4HJA A;  3KDF A;  3RLO A;  2ZM6 Q;  2IX3 A;  3GTO B;  1HZC A;  4GN3 B;  4HIO A;  4N9P A;  2NVQ B;  4KHP Q;  1M90 C;  4TVA B;  3OW7 A;  1GUN A;  1E7Z A;  3TRE A;  4LF8 Q;  1A3T A;  4HSV A;  3W2D A;  4JI1 L;  2HD3 A;  4KKS A;  1BXT A;  4K0K Q;  3IFT A;  2LMC B;  2D0O A;  3VYT A;  1JB7 A;  4JI2 L;  1PH3 A;  4A76 A;  2XSC A;  1A63 A;  4EQO A;  5LL6 S;  2XIW A;  5J3B A;  3PF5 A;  5ELO A;  1HQM C;  4HCE A;  5FOB B;  1ESR A;  1U4M A;  3HKS A;  5IGE A;  1L1O C;  3T53 B;  3A8K E;  3K5N A;  1KHI A;  5JJL A;  3D4R A;  4GN4 B;  4K8I A;  1NAP A;  3I4N G;  4TQU S;  2CW0 D;  1PH9 A;  3CKI B;  5EPL A;  4DV5 L;  1UEA B;  1W6K A;  1UAP A;  4G4K A;  1X3E A;  3DXJ C;  1GUT A;  1UNS A;  2PQA B;  3CCV A;  4FYD A;  4K2K A;  5C44 G;  5COR A;  3HOZ H;  3OOC A;  1ET9 A;  2OTL A;  1JOO A;  1Q86 C;  3HOY B;  1A8V A;  4JBJ A;  1MJE A;  3S14 B;  1TWH H;  1BCP C;  1LT6 D;  4G7O C;  4LF9 Q;  2N88 A;  4A3J H;  1LT5 D;  2LY7 A;  1BR9 A;  1RD9 D;  2R7Z H;  4A3E H;  4KY6 A;  3MC0 B;  2P5Z X;  1B44 D;  2PQA A;  3RLN A;  1QNK A;  5E1F A;  4QIW E;  2OTJ A;  5IP9 H;  3U50 C;  1B3Q A;  2V4D A;  2Y0S B;  4DV0 Q;  4IUU A;  2XN9 C;  3FP9 A;  1PZK D;  1QNU A;  3BYT B;  1F2Z A;  5KEE A;  1HNZ L;  3VR6 A;  1L0X B;  2L15 A;  1PYW D;  5I2Y A;  4IFD G;  3DM3 A;  1L1O B;  1GKH A;  1L0W A;  5BR8 L;  2D62 A;  4GN5 A;  1PFS A;  3W1G A;  1LV9 A;  3CRL C;  2HDL A;  3CC2 A;  2NBF A;  2UU9 L;  4C2M B;  1WTR A;  2VXW A;  1KLU D;  3OPO A;  5CBA E;  4C1N K;  1KAW A;  4DR3 Q;  3HOV H;  1WVL A;  2KEE A;  3GTP H;  1I5F A;  2E2D C;  2K5H A;  5IYC G;  3J80 c;  3S2D B;  5JEA G;  1TT2 A;  2UXC L;  1PFN A;  3J7Y W;  1D1K A;  2EYF A;  3V96 A;  1G29 1;  1BCP B;  1CKN B;  3KLS A;  2FHT A;  4J15 A;  2UUC L;  4YCU A;  2WAQ G;  3X3N A;  2DJG C;  3A5U A;  1NCV A;  2NZO A;  3OWF A;  2A73 B;  4AQY Q;  2IWH A;  3CCR A;  3HRZ C;  3NUC A;  2HUG A;  3E0E A;  2HHH L;  3C3L A;  5ELF A;  4GZY C;  3IKJ A;  4OEL B;  2A74 C;  2BA0 A;  4JI0 L;  1QJO A;  4RKB A;  4ZUI A;  2ES2 A;  3I73 A;  1G2S A;  2JA7 G;  4ALP A;  1IL2 A;  1TWH B;  2IT1 A;  1HNW L;  1F9Q A;  4BBR H;  4A3J B;  5CGK A;  3VYR A;  1I3Q H;  1SMY D;  4X66 L;  3CCL A;  4A3E B;  1KQS A;  1E2V A;  2B3G A;  2KVM A;  5G3L D;  3MHB A;  4FVM A;  2WKC A;  1SLJ A;  1AZQ A;  4DUZ Q;  4TSS A;  3HKZ E;  4JI7 L;  1C48 A;  3SGI A;  1F2Y A;  3OTO Q;  2ZJR A;  4B3M L;  3EIV A;  4FO2 A;  3W1B A;  4R4I A;  1BNZ A;  1RTO A;  2KA7 A;  2F0U A;  1ICF B;  3A55 A;  3KLW A;  2HQE A;  4Q0F A;  1PFM A;  4CHT B;  4A3F G;  3SEB A;  1WTP A;  4DXF A;  1HR0 Q;  3I3C A;  4MTK A;  4YIJ A;  2UUC Q;  2XWB B;  1KIX A;  1WTW A;  4HN7 A;  1XX8 A;  2DGY A;  2CKZ B;  1K83 H;  3G71 A;  3IAY A;  2K5N A;  2YTX A;  4YWM A;  1STG A;  5JPN C;  1PH5 A;  1M4V A;  5K36 G;  2Z4I A;  4JBK A;  2CW0 C;  1W2B A;  4Y52 H;  3DMU A;  2F0J A;  1VDZ A;  5C0X H;  4C56 C;  3MZ5 A;  4EVO A;  4S3S A;  5FJ8 H;  2EYJ A;  1R9T H;  1JCK B;  2NZ1 D;  4DAM A;  3GDE A;  1VQA A;  2OF1 A;  2E5L Q;  3ERO A;  1X3Q A;  3VDY A;  4LFB L;  4LF4 L;  1WJJ A;  4GLX A;  1Q12 A;  1HCZ A;  4OWX B;  2PYK A;  4DR7 L;  1I94 L;  3PUX A;  1XNQ Q;  4R4O A;  1LTR D;  3CF5 A;  1PMR A;  5IOC A;  4O1N A;  3CCU A;  3Q22 A;  1SYD A;  4A3D H;  4DV3 Q;  1IXR A;  4BBR B;  4IUQ A;  1X54 A;  3SE0 A;  3PO2 G;  1CI3 M;  1OXX K;  5JJZ A;  1OTC A;  4RMF A;  4PG3 A;  1WCM G;  3CXC A;  4EQP A;  3NTK A;  1SNC A;  5E4X A;  4ZAI A;  4KKT A;  4B3S L;  3KBX A;  1EFI D;  5M3F B;  3PF4 A;  1HTP A;  1EY6 A;  1X3F A;  4FF1 A;  2A5H A;  3J7A F;  2R93 G;  2JA6 G;  1PZI D;  1C8C A;  3J80 L;  4LMQ D;  1L0Y B;  2LXJ A;  1X9N A;  2WII B;  5M5X B;  4R1J A;  2Z6B A;  4QJF A;  2K33 A;  3H0G G;  2HIV A;  3IFD A;  1D8L A;  4OHJ A;  3A56 A;  1EZ6 A;  3PO3 H;  5ELN A;  3HOW B;  1YJN A;  2JA8 B;  4ZUJ A;  5IYC H;  2B2Y C;  5GQO A;  4QIW B;  4AYB E;  4NKL A;  1ZYR C;  3HOU B;  1BBU A;  1F9P A;  4X64 L;  1JWS D;  5ELE A;  1LLR D;  1K83 B;  5ISR A;  5C0X I;  1H9R A;  4LUO A;  4X3U A;  4L8J A;  1KLG D;  4LF4 Q;  1SE4 A;  4QCL A;  5KND A;  2X69 A;  3FKI H;  4IUT A;  4DR7 Q;  1VMC A;  1I4Q A;  1LTS D;  1I4P A;  3BS1 A;  2E2J H;  1R9T B;  1JOK A;  3PQI A;  5EKI A;  3UI2 A;  4LF5 L;  2RVL A;  4PNY A;  1PRT F;  1G6Z A;  1VQC A;  2K04 A;  1PTO F;  4ZK9 B;  4R4T A;  4K5V A;  5M3M G;  1ASY A;  1OXT A;  2KHS A;  1B4O A;  1X56 A;  2K32 A;  1UWV A;  1VQN A;  4CKE A;  1N33 Q;  3PV0 A;  5CV8 A;  4BXX G;  3L9A X;  2R61 A;  1SMY C;  1FD7 D;  3ULL A;  4A3D B;  1M8A A;  2KEC A;  3E9H A;  1JJ2 A;  2Z8L A;  1VQ8 A;  1MIU A;  1XTD A;  3M3Y H;  5CV5 A;  1D5Z C;  1ENA A;  1L2F A;  1Y1W H;  1Q1E A;  4HJ9 A;  3CP0 A;  2Z6K C;  1VF5 C;  2XRQ D;  3ND9 A;  4LF6 L;  5K5P A;  4DV1 L;  1NUC A;  2B2W C;  1X65 A;  2CQA A;  1KDC A;  2A69 D;  1HA6 A;  1HHV A;  2GVB A;  4HJ7 A;  2J4X A;  4QUC A;  3D4W A;  3A54 A;  1SE8 A;  1PTO D;  3MAQ A;  2CWA A;  4JI4 Q;  2B2Y A;  3SK6 A;  1CZG A;  1CA5 A;  1EQV A;  2Y0S G;  2R3Z A;  2B8F A;  1I4X A;  2F3I A;  3PO3 B;  2RA4 A;  3Q23 A;  1AN8 A;  4DKA C;  5IYD H;  2ZXP A;  2MNA A;  3HKZ B;  1S72 A;  2AUJ D;  1K9M C;  2F0L A;  2L4N A;  2NZH A;  3J81 j;  2MPM A;  4POF A;  1P16 A;  2DNE A;  1Q8K A;  2QEX A;  5CV4 A;  1IBL L;  5JOB A;  2HQL A;  3J81 E;  3S1N H;  4MIU A;  3F2C A;  2PPB C;  2CH4 A;  3FKI B;  1A0I A;  1O7L A;  3PUW A;  3T16 A;  1DOK A;  4F88 A;  4ZRZ A;  1TS2 A;  2EYL A;  2JA5 B;  2E2J B;  4KTA A;  4A3K H;  3BJU A;  4IZ8 A;  1PH2 A;  2EPB A;  2NVX H;  4HTH A;  1KAA A;  2JJQ A;  2YU9 H;  5JJI A;  1WTO A;  1CUK A;  2K6A A;  1LUZ A;  2NTT A;  2RSO A;  4DUY L;  2EOT A;  3TP8 A;  1Q8I A;  2ICI A;  2GA4 B;  1XMO L;  3K0X A;  5IIF A;  2CQO A;  1I4H A;  1CQF A;  3CCM A;  3HOZ G;  1J5E Q;  1ZEQ X;  2A6H D;  4A3G B;  1EY9 A;  3CAM A;  4X65 L;  2B2W A;  5IGC A;  2MGS A;  2UXD Q;  4OEM B;  1Y1W B;  2VUM H;  2LSS A;  1EEF D;  1NJI C;  4JYA Q;  2UXB L;  2ZJQ A;  1BBW A;  2MQH A;  4A3J G;  2R92 H;  3GP7 A;  2C5C A;  4B3R Q;  4CKC A;  4A3E G;  4C3H B;  1Y14 B;  2JA9 A;  1QE6 A;  1YNX A;  4PZ7 A;  3K7A B;  2EVB A;  2B63 H;  5IP9 G;  2PZW A;  1JT8 A;  1OXU A;  5T1G A;  5EBD A;  5IE8 A;  1VQK A;  2A6E C;  2ALY B;  3VA5 A;  2NVQ H;  4BA2 I;  3I90 A;  2CVR A;  4NXN Q;  1DM0 B;  1FR3 A;  2VZA A;  1VQ9 A;  1PFB A;  2Z4H A;  1XPU A;  3S17 H;  2IW3 A;  3UDF A;  5DNF A;  2ZM6 L;  1JWU D;  1VQ5 A;  1JJC B;  1YHB A;  2F4I A;  3S1N B;  2M9V A;  4B9W A;  3A5Z B;  1CHP D;  1CK1 A;  2RDF A;  1VQO A;  1JMC A;  1EQR A;  5CV6 A;  1VQ6 A;  4DUY Q;  5FLM H;  3GV6 A;  5I9O A;  1MGS A;  4A3K B;  5BN4 A;  4K0K L;  4AYB B;  2WB1 E;  2F0N A;  1SE2 A;  1TY2 A;  2YU9 B;  3BU2 A;  1X3G A;  3N52 A;  4FP5 D;  4HMI A;  4PMB A;  1WTQ A;  2AWN A;  3L0O A;  3F1Z A;  3L7Z C;  4GKK Q;  3T56 B;  3G7L A;  1VS0 A;  2OXP A;  1UE5 A;  1SXT A;  1YNN C;  3BDL A;  4JI6 Q;  3U9S A;  4M8A A;  2XVS A;  5C4J B;  3J7A 5;  1VQH A;  1SND A;  3HOY H;  4NPS A;  1I6V C;  2PQE A;  2L11 A;  1EQT A;  5C3E H;  4UP9 A;  1XXG A;  4YY3 Q;  4ILW A;  1YJW A;  3HZX A;  5IY0 A;  4PQX A;  1W6J A;  4HED A;  1FNW A;  2NWG A;  3PUZ A;  1HJP A;  4BBR G;  2A69 C;  4X62 Q;  4HMJ A;  1IW7 D;  2RCN A;  1G2T A;  4XQN A;  3M4O H;  1DXM A;  4QL5 A;  4N8X 1;  4CDD C;  2BH2 A;  1DCZ A;  2EQS A;  4LF9 L;  4P71 A;  1NBW A;  2E76 C;  2B2U C;  2RHQ B;  1MI2 A;  1C9O A;  2B63 B;  5KIX A;  2L1B A;  2V1C C;  4HCS A;  4ID6 A;  1Z6H A;  1DJR D;  5M3F G;  3UDG A;  1CSP A;  1UE1 A;  2JQO A;  5M9O A;  3QWN A;  1EYC A;  1PLF A;  1TQO A;  1SYE A;  4ULL A;  4DV0 L;  1U4R A;  3NP8 A;  3HOX H;  1JE5 A;  4C2M H;  3S17 B;  2B8G A;  3NEM A;  4P73 A;  3ZYY X;  2EJG C;  5LMN L;  3G48 A;  3HOW G;  3A8I E;  2FFK B;  3TDQ A;  3S2D H;  5EQ0 A;  5JJK A;  3BVG A;  3I56 A;  2NYZ D;  4GOP C;  1CTM A;  5GAE C;  4WJW A;  2EYP A;  1EL0 A;  2F0M A;  1BO0 A;  4U68 A;  2JSO A;  4DR3 L;  1D7Q A;  4OX9 Q;  3TS2 A;  4IN3 A;  2TSS A;  4NW2 A;  3IRB A;  1LT4 D;  1D6E C;  1SBB B;  4Z9C B;  3SR1 A;  1QZG A;  4RWS C;  5C0X G;  1ILP A;  1DGS A;  4KN4 C;  5FJ8 G;  4N8F A;  3EA6 A;  1CM9 A;  4JPB W;  3NTI A;  3TSS A;  1B9N A;  3DEP A;  2F4V Q;  4JI8 Q;  4AQY L;  2BOS A;  1T9H A;  2MHV A;  2A6H C;  4O2D A;  1J6Q A;  2QIL A;  5EPJ A;  1NR4 A;  5CMD A;  1CKM A;  5C3E B;  1EWI A;  1K28 A;  4K5X A;  4EQ5 A;  4DR5 Q;  1H9J A;  5C4X H;  3P20 A;  3HFZ B;  5C6A A;  5IYB H;  1AE3 A;  2RDG A;  2F0G A;  4B08 A;  4A3D G;  1TR5 A;  2B2U A;  3EN2 A;  3X3M A;  1C7Y A;  2QW7 A;  1Y69 U;  3M4O B;  2KHJ A;  2KCN A;  4GOP B;  1YEZ A;  3S1M B;  1GUO A;  3I91 A;  1IKM A;  3AMU A;  5IWA Q;  2X6L A;  5LMN Q;  1VQE A;  2KHI A;  2RCF A;  1HA5 A;  4JOI C;  4DUZ L;  3NE5 B;  2O5I C;  1YIJ A;  3OTO L;  4C1N I;  3MFG A;  2Q2T A;  3PCO B;  3HOX B;  1G91 A;  3ONA B;  4DV6 Q;  4RA8 A;  2BH8 A;  4GOP A;  3QIA A;  4B3T Q;  3PO3 G;  1YJ9 A;  3P7J A;  4P72 A;  3UDX A;  3U4V A;  4I65 A;  3W3A A;  3TRZ A;  1O80 A;  2E8G A;  3DLL A;  3HKZ G;  2EXZ A;  5HGT A;  1HR0 L;  5CBE E;  3QR8 A;  4UP8 A;  5I6Y A;  4X3T A;  1HRJ A;  2F0K A;  3ERS X;  3R2T A;  5HUR A;  1VCI A;  2EYH A;  2QDB A;  2G9D A;  4K6D A;  1RL2 A;  3D6C A;  3T1H Q;  4OON A;  2PNR C;  2CHB D;  3FKI G;  4P74 A;  1EYD A;  5I9P A;  1SYG A;  4WJ4 A;  1TWC B;  3QG1 A;  5T1I A;  3I72 A;  3C1E A;  5KYI A;  4PZ6 A;  4OGQ C;  4RAU C;  2BE5 D;  2E5L L;  1V9P A;  1HFG A;  2ZTD A;  1Q82 C;  1XWE A;  2WB1 B;  4P2C B;  2UUA L;  4MTN A;  3O13 A;  2A19 A;  1VQI A;  1P8L A;  1Y8N B;  2Q2H A;  2CWP A;  3KLS X;  3T1Y Q;  5C4X B;  1FVI A;  4LJZ C;  1IW7 C;  1QVC A;  3QOL A;  1SNM A;  2MO1 A;  1KTK A;  1SJE D;  1XNQ L;  2KBN A;  3BG3 A;  2D9U A;  2OT2 A;  2PZU A;  4RGN A;  4WOR A;  4BA1 I;  3I4M H;  5IOD A;  1KL9 A;  2NVT H;  3MXG A;  5M3F H;  4DV3 L;  1OXV A;  3K58 A;  1EEI D;  4JOI A;  4K5W A;  3I2Z A;  3K5O A;  1Y1W G;  1VMP A;  3AYH B;  4FDB A;  2ID0 A;  4L5Q A;  4DF7 A;  2A1A A;  5M5X H;  3QB3 A;  2L0C A;  3STB D;  3K57 A;  1YHQ A;  3LNN A;  3HS0 C;  1IKL A;  3S16 H;  4DV7 Q;  3D6W A;  3RN5 A;  3SHL A;  3D0F A;  3HOW H;  1QWY A;  4K2L A;  2BCO A;  2JA8 H;  3FMC A;  4XIG S;  3J81 i;  3HOU H;  3S1Q B;  1VQD A;  4MN3 A;  3BZK A;  5IYD G;  3ICE A;  4HIM A;  4KY5 A;  1HZB A;  3H15 A;  1ESF A;  1S5D D;  1WD0 A;  1MD2 D;  4P75 A;  1IBM Q;  3BVM A;  2QCP X;  4IUN A;  1RF2 D;  1WTX A;  3KK7 A;  1QVF A;  5CV7 A;  4ZCK A;  2KOL A;  2DJF C;  2WAC A;  4KD3 A;  3D4D A;  4DFA A;  3GTL H;  3NTH A;  4PMC A;  1GHJ A;  2J0T D;  2UUA Q;  4FXD A;  2VQF Q;  1JWM D;  1R4P B;  4A3K G;  3GTG B;  2NN6 H;  2QGQ A;  4HIK A;  4AYB G;  2K05 A;  2F0S A;  4DR6 Q;  2EIF A;  1DZ1 A;  3FEW X;  4LFA Q;  2F0V A;  2PCF B;  1IYU A;  1CFM A;  1KAB A;  3AQQ A;  5EKL A;  2F0I A;  3TP7 A;  2VNU D;  2RQX A;  5E4W C;  4RCO A;  4L6T B;  1V8Q A;  2QEJ C;  5D3D A;  4KI0 A;  3E3X A;  1N33 L;  5ELD A;  3I4M B;  2SNM A;  3NHH A;  5D14 A;  1I50 B;  2NVT B;  3ULJ A;  1X55 A;  4XXE A;  2RDH A;  1HUN A;  1EU3 A;  1BVS A;  5LMU Q;  1A2U A;  4YHH Q;  3I55 A;  1TXY A;  2VUM G;  4BBS H;  2VY3 A;  5C5L A;  2K28 A;  3PIP A;  4DR1 Q;  2BA1 A;  1PVO A;  2HDM A;  2R92 G;  3FPP A;  1NMF A;  1BF4 A;  1S5B D;  2DUD A;  2JYO A;  1K3B C;  4QB4 A;  4FXG C;  3S16 B;  3WOE A;  1TWF H;  3OW2 A;  1FL0 A;  3H3V H;  4CDF C;  2B63 G;  3SK4 A;  3R8B A;  4XT3 B;  5FLX c;  1IL8 A;  2H1E A;  1ZXT A;  3OIP A;  4JI4 L;  1QB5 D;  1N32 Q;  2ZTC A;  3BZD B;  4DR2 Q;  1SRU A;  3KYH C;  1Y1V H;  2I07 B;  1HZ9 A;  3NEN A;  4XDX A;  4ABN A;  4WFN 3;  4JI5 L;  2ATW A;  2PZT A;  3R93 A;  5HY6 A;  3PUV A;  4RHR A;  4LFC Q;  3F8T A;  3TME A;  4DAV A;  4NXM L;  2NN6 I;  2JA5 H;  1A6X A;  3PMF A;  1VQ4 A;  2JE6 I;  3GTL B;  4A4I A;  3G4S A;  5FLM G;  3H3V C;  4BWG B;  4TKO B;  1YIT A;  4JI3 Q;  4DR4 Q;  1EIH A;  3G6E A;  3PIP 3;  3OSO A;  2BE5 C;  1ASZ A;  2BDO A;  3MTS A;  1JC7 A;  1YVC A;  2YTY A;  3CCJ A;  3SDZ A;  1ONL A;  3J81 c;  3GTQ H;  2IHE A;  1PH6 A;  4GNX C;  4UP7 A;  2NTS A;  3VR2 A;  1RJT A;  1LYL A;  5C44 B;  1RCV D;  1LTI D;  1KRS A;  2XTI A;  3BZC A;  1TII D;  3NPP A;  1EYA A;  4A3G H;  1QG7 A;  5FLX E;  3A0J A;  4A3M H;  5FK9 C;  3HOY G;  3DWP A;  5C3E G;  4C3I H;  1FJG Q;  1EZ8 A;  2Q8R E;  1QZH A;  1Q46 A;  3MXU A;  4RCN A;  1TWG B;  2J7Z A;  4IOC A;  1F77 A;  2AQ2 B;  4OWW B;  4BBS B;  3NXW A;  3K0Y A;  5EBC A;  4QQB X;  2ZT9 C;  3CHB D;  3STB C;  5IGD A;  2QDL A;  4C3H H;  1Z47 A;  1J5E L;  1PRT D;  1HXY D;  3H3V I;  3S2H H;  1KXL A;  2UXD L;  3K7A H;  2ENB A;  1HNX L;  3F2D A;  2X6G A;  2JEA I;  4JYA L;  1SDF A;  1TWF B;  2F3W A;  5J1Z A;  4JI5 Q;  4JBW A;  1K8A C;  4DNT B;  3DWQ A;  1TVX A;  2FMM A;  5FO8 B;  3I4O A;  4B3R L;  4L5S A;  3GTM B;  1Y8O B;  1SSO A;  5EAY A;  3WWV A;  4NXM Q;  2OCE A;  3K6O A;  1J8I A;  2RSN A;  1A62 A;  4H13 C;  1Y1V B;  4R4Q A;  1FNU A;  3HOX G;  1FYC A;  1K3R A;  1QVG A;  4GNX B;  4LAA A;  2K7V A;  1VQL A;  3A8J E;  4NXN L;  3K5L A;  3W5O A;  3CCE A;  1D5M C;  3UE1 A;  2VL6 A;  3AEV A;  4CDE C;  4Y7N B;  4RGO S;  3KJP A;  2XRS D;  4XQQ A;  5AJ3 Q;  1EOV A;  1D2B A;  1KD1 C;  4F8M A;  1UEB A;  5C4H A;  4GNX A;  3VR5 A;  3GO5 A;  5J39 A;  2F1M A;  3LWU A;  2WP8 J;  3GTQ B;  3MEH A;  1GUG A;  1X6O A;  2H5X A;  4X6A H;  5C4J H;  3K81 C;  1H9S B;  3K59 A;  1TS3 A;  2EY6 A;  5D65 A;  3QJY A;  5C4Z A;  2PW5 A;  4XQJ A;  1HH2 P;  2KCT A;  4IFD J;  4A3M B;  1SFO B;  1OXS C;  4GKK L;  2Q2I A;  4LF7 Q;  2MFI A;  1C4Q A;  3LWE A;  3A7L A;  4NDX A;  3TEH B;  4FF4 A;  1HNX Q;  1II3 A;  4QY7 A;  4C3I B;  1BKB A;  4JI6 L;  3S15 H;  1OO9 B;  5FLX L;  3NQI A;  5C4X G;  1Q1B A;  5IYB G;  5DEH A;  4EX5 A;  1BQQ T;  2VB2 X;  1AP0 A;  1H9S A;  3CD6 A;  3TBI B;  1G51 A;  4YY3 L;  3S2H B;  5C3W A;  1LTL A;  3LGJ A;  1IBK Q;  4FXK C;  1B53 A;  3K7U C;  2XGT A;  3F2U A;  4JV5 Q;  1EY7 A;  4CDC C;  2E74 C;  4X62 L;  1U0L A;  4DV2 Q;  3OYY A;  4LNQ A;  1EOT A;  3Q24 A;  4AH6 A;  4KHZ A;  3CCS A;  1Q81 C;  1E3P A;  2E2H B;  4JVZ A;  5EKK A;  3TZD A;  4EGV A;  3PGZ A;  3WOF A;  2B2T A;  3N6R A;  3TZU A;  1XPR A;  1Q7Y C;  1XNR Q;  2IL8 A;  1I6H H;  4A3B H;  1E22 A;  5IP7 H;  2KJX A;  4GKJ Q;  4OO1 H;  3H94 A;  4APV A;  4NMZ A;  5BN5 A;  2MUY A;  5KNC A;  4BY7 B;  1E1T A;  3ND8 A;  4IUP A;  1EIF A;  3DUZ A;  2ZXO A;  3T4A C;  3NWS A;  4RKL A;  3J81 L;  1VQB A;  4CJ0 B;  5I6W A;  1ZKO A;  2F0D A;  4F7X A;  1HFN A;  1S4Z A;  4C3J B;  1YBY A;  1LTT D;  3I8Z A;  2YTV A;  1WTH A;  3M4Q A;  3E6Z X;  4KY7 A;  3TP5 A;  1PTO H;  5I4D A;  2E75 C;  3KOJ A;  3R3O A;  5COY A;  3RD4 A;  1Q3L A;  2RKS A;  4ZQ3 A;  2K75 A;  3M85 A;  1XYI A;  4OX9 L;  5LHY 1;  2DN8 A;  5GAH C;  1STY A;  2F0H A;  2PI2 E;  3M9B A;  1YZ6 A;  1HQR D;  4Q5V A;  3MVV A;  4HJ8 A;  1A2T A;  2IX0 A;  4JK1 C;  3DEO A;  1GVP A;  3GTK H;  1HTL D;  3S1R H;  2K03 A;  1WTV A;  1N34 Q;  1S5F D;  2Q2U A;  1AEX A;  2LKV A;  1CSQ A;  1GHK A;  1F2L A;  1HUM A;  3S15 B;  2RHS B;  3SK8 A;  2F4V L;  3PO2 B;  1DON A;  4JI8 L;  3EFX D;  1SN8 A;  3UDI A;  2MJ8 A;  4CGY B;  1MSH A;  1PRT C;  2YV5 A;  2FIN B;  1PTO C;  5H1S E;  1DD2 A;  2CFM A;  3NQT A;  2AUK A;  1A15 A;  1V43 A;  3H91 A;  1B8A A;  3S1M H;  4DR5 L;  1U4L A;  1N8R C;  2O5J C;  1KNA A;  4O42 A;  3I4M G;  1FNV A;  1PDQ A;  1IZ6 A;  4JG2 A;  1B3A A;  2EYO A;  2HCI A;  1KRT A;  1A3V A;  4DU9 A;  4DV4 Q;  4A3L H;  4G57 A;  4OO1 I;  1VF7 A;  1MSG A;  4KV6 A;  1Y8P B;  4LWC A;  3RMH A;  2HT1 A;  3J7A V;  2I5M X;  1MBY A;  3PUY A;  1GJX A;  5IWA L;  1I6H B;  2WKD A;  3E9I A;  3MXP A;  4A3B B;  2NVY H;  4AIM A;  1JOQ A;  3TP6 A;  2JA8 G;  4POG A;  2SOB A;  1TS4 A;  3V05 A;  3CRK C;  5ELB A;  3HOU G;  2EJM A;  2VW9 A;  5C3X A;  4UDU C;  1B2T A;  1E2W A;  4A93 H;  3MWY W;  3P75 A;  4DV6 L;  1PHJ A;  1T5E A;  2GN5 A;  4B9X A;  4XT1 B;  4B3T L;  2IX1 A;  4A3C H;  5E7N A;  1G8Z D;  4KLK A;  3TQY A;  1PRT B;  1AFP A;  1TWC H;  1PTO B;  1YNJ D;  2K5W A;  1PZJ D;  2UUB Q;  1BOS A;  4H44 C;  1JOR A;  4CJ2 C;  3IL8 A;  5M3M B;  2K01 A;  3T1H L;  1U9R A;  1PH7 A;  3HG9 A;  2NN6 G;  2I5L X;  3TS0 A;  2JXM B;  4N9T A;  3UE0 A;  2K52 A;  3ZJY C;  4IPH A;  3GTK B;  4RG1 A;  1EFW A;  1CQV A;  2N3S A;  2VQE Q;  1IHZ A;  3S1R B;  1B1Z A;  5DM6 3;  1XMQ Q;  1CT1 D;  2L9H A;  4KJO A;  5KNB A;  3G6J B;  1KDB A;  2K50 A;  2XWJ B;  4DA2 A;  1DOM A;  3OWE B;  3P1H A;  1I4G A;  1RTN A;  1D1I A;  1HR0 W;  3Q8D A;  1YHA A;  3EBE A;  2K5V A;  3JC6 6;  4GS3 A;  1VQ7 A;  4M1U B;  3T1Y L;  4A3I H;  1GD7 A;  4H0L C;  4IPG A;  3HP3 A;  3VA7 A;  1O7Y A;  2R7D A;  4BBS G;  4R4C A;  1LAC A;  1SYB A;  3KJO A;  4V19 0;  1EU4 A;  2DNC A;  3NBH B;  1N9W A;  5GAD C;  2EE1 A;  1M1K C;  1U5K A;  1FGU A;  1NSN S;  5FO9 B;  1SJH D;  2NVY B;  3S1Q H;  4JI1 Q;  5HGQ A;  5EJW A;  1H9K A;  2JEB I;  4JI2 Q;  4FF3 A;  4ODG A;  4IJH A;  1GM5 A;  5DAU A;  1I4R A;  2XNA C;  1X32 A;  4DV7 L;  1EWC A;  2SEB D;  1K0S A;  2O4X A;  4A93 B;  4BY1 H;  4HAE A;  1Y1V G;  5L37 A;  2N49 A;  2L12 A;  3NBH A;  4O0A A;  2IJ0 A;  2Z1C A;  1RKN A;  3EJI A;  4LUZ A;  3C1F A;  3NBI A;  2GVA A;  1N36 L;  3C46 A;  2D0P A;  1VQF A;  1ZYR D;  1NY4 A;  1L1O A;  2Z9H A;  5G3L F;  4DV5 Q;  2JA5 G;  2EY5 A;  4KHV A;  1IBM L;  2Q8I B;  4ME5 A;  3GTG H;  1K8M A;  1XPO A;  4UAI A;  3H6M A;  1HPC A;  1NNX A;  2VB3 X;  4JCV E;  3S24 A;  3RZO H;  4KKU A;  3MXN B;  2IHF A;  1JQY D;  2VQF L;  4HID A;  3I70 A;  4MHE A;  4K14 A;  1AH9 A;  1V1O A;  5EPK A;  3BDO A;  2Z0S A;  4DR6 L;  2F0E A;  5KGU A;  2CCZ A;  1CKN A;  4L5R C;  3HOZ B;  3M4P A;  4LFA L;  3D31 A;  1SYC A;  1I50 H;  4RFB A;  4A3G G;  4A3M G;  1SR3 A;  1LM0 A;  2SDF A;  4H7B A;  3MXN A;  4I7Z C;  1Z9F A;  5KYL A;  1EYG A;  4A3I B;  4C3I G;  5M5Y H;  2PNH A;  3RN2 A;  4FF2 A;  1S5E D;  5D3I B;  4DNI A;  1E1O A;  1HNZ Q;  2R7Z B;  2I5H A;  1EY5 A;  4L5T A;  2G9H D;  4C3H G;  5BR8 Q;  1SAP A;  3J80 E;  2KED A;  5GRO A;  5CC4 A;  4DK3 C;  4RGM A;  1ENF A;  4X3S A;  3CPW A;  1JB3 A;  2K1B A;  2R7F A;  4YWL A;  4YHH L;  5LMU L;  1UE6 A;  4DAY B;  4DN4 M;  2UU9 Q;  2PI2 A;  4LUV A;  5AFW A;  4DR1 L;  3FRP B;  5EGT A;  1WFQ A;  3AFP A;  2WAQ E;  1BBX C;  4PZ8 A;  4HSP A;  1EWH A;  1N36 Q;  1EY4 A;  2UXC Q;  2F3V A;  2ZXR A;  1CHQ D;  4YCW A;  1SNQ A;  4BY1 B;  1JIC A;  2TMP A;  5E3F A;  3AB9 A;  2F0T A;  1SNP A;  2AHO B;  1G6P A;  4GLV B;  4DAY A;  3HOV B;  2M00 A;  1YNJ C;  5JVH 3;  1NTG A;  1RHP A;  3Q0A A;  1CA6 A;  3GTP B;  4BY7 G;  2JP1 A;  1N32 L;  1ML0 D;  2DY8 A;  3I7F A;  4DR2 L;  2PMZ E;  2CH4 W;  2R6G A;  3OHX C;  1QUQ B;  2HHH Q;  1K73 C;  4K8J A;  3QOJ A;  3B6Y A;  4LFC L;  3I4N H;  2OQK A;  4QF4 A;  2K14 A;  4KD4 A;  4F87 A;  3L2P A;  1PXU A;  1S40 A;  1PH4 A;  2OQ0 A;  4ZLT F;  2NB0 A;  4JI0 Q;  2OEO A;  4C3J G;  2HCC A;  3RZO B;  4DK1 A;  2WIN B;  3VYS A;  1XJV A;  5GAG C;  4PV1 C;  3RNU A;  2F0O A;  2I0Q A;  1HNW Q;  5C44 H;  4JI3 L;  4J8Q A;  1QUQ A;  4DR4 L;  1SEB D;  4OL7 A;  4V0B A;  4NB3 A;  1QOH A;  4X66 Q;  1LTB D;  2FMC A;  4WJ3 M;  4QMG A;  4OIK A;  2K5D A;  3SVM A;  3CQZ H;  3SK5 A;  3VR4 A;  1F9S A;  3PSI A;  3U58 A;  1TWG H;  4JI7 Q;  3NSW A;  2HIX A;  3T51 B;  4CJ1 B;  5M5W H;  4B3M Q;  2Q8T A;  3GV3 A;  1DOL A;  2L5T A;  2KEN A;  3JAM i;  1TWA H;  5M5Y B;  1I3Q B;  4ZKB B;  3BVZ A;  5ELC A;  5DLQ E;  1GUW A;  4OXP A;  5JVG 3;  2C35 B;  1RIP A;  4IPD A;  1FJG L;  3E5S A;  3V2T A;  1SRO A;  4IUV A;  1NR2 A;  4IFD H;  2A68 D;  4G7Z C;  2FJ2 A;  1WYD A;  3BDC A;  3WDN A;  4DK0 A;  3GTM H;  2EZV A;  3J7Z C;  1D5X C;  1STN A;  2F0W A;  4CBV A;  1MJC A;  2C9O A;  1TU2 B;  3NEL A;  4XYO A;  1B9M A;  1X3P A;  3M7G A;  4DGZ A;  1GUS A;  4OIJ A;  3K8A A;  4GLA C;  4A3B G;  2AQ1 B;  5IP7 G;  1C0A A;  4OO1 G;  4DPG A;  2D5D A;  5JEA H;  1BDO A;  2EY1 A;  2VS1 A;  4KJN A;  2F0P A;  1GXD C;  3RR5 A;  2B29 A;  2A6E D;  4U67 3;  1WD1 A;  4Y7N H;  2B39 A;  2G5D A;  1B70 B;  2KCC A;  1TY0 A;  1SMX A;  1BUV T;  1E0B A;  2KUM A;  1LT3 D;  3NWT A;  1GOZ A;  1LO5 D;  3E0J A;  2ASB A;  5IGB A;  4LFB Q;  2AMC B;  3I4N B;  1SNO A;  1B50 A;  2ZTE A;  3D3R A;  5CR3 A;  1O7Z A;  3OIQ A;  4JC0 A;  1MKH A;  1I94 Q;  2WV6 D;  4WRD A;  2B2V C;  5I2X A;  1AE2 A;  3AU7 A;  5CYU A;  3URY A;  5AJ3 L;  3CW2 C;  1K8O A;  4RHS A;  1PYS B;  4IUR A;  2K4K A;  1K0R A;  2LFN A;  2SNS A;  3OMG A;  5IT9 c;  4JBM A;  4IAL A;  2WFW A;  2JA7 H;  1EY0 A;  3KBG A;  5IGF A;  1SFO H;  3CPF A;  1B7Y B;  1EY8 A;  1GO3 E;  3RLF A;  3KF6 B;  1STB A; 
#chains in the Genus database with same CATH homology
 1KIX A;  1E1T A;  4EQ5 A;  4DR5 Q;  4B3S Q;  1EIF A;  5C4X H;  1E24 A;  2AKW B;  2DGY A;  3HFZ B;  5IYB H;  1AE3 A;  1VQB A;  2CKZ B;  1K83 H;  3G71 A;  4A3D G;  3EN2 A;  2K5N A;  1O7I A;  2YTX A;  4YWM A;  1C7Y A;  4IFD I;  4DK6 C;  4MZ9 A;  1PH5 A;  4LF7 L;  2KHJ A;  5K36 G;  1VQG A;  4A75 A;  4GOP B;  1YEZ A;  4JBK A;  1YBY A;  1W2B A;  4Y52 H;  2YTV A;  3M4Q A;  3KF6 A;  3KOJ A;  5FJ8 H;  5IWA Q;  1R9T H;  3AFQ A;  4DAM A;  3GDE A;  1VQA A;  5LMN Q;  2E5L Q;  1H95 A;  4A3F H;  1VQE A;  2KHI A;  2E2H H;  2K75 A;  4JOI C;  4OWT B;  3M85 A;  3A74 A;  4IO9 A;  3VDY A;  1WJJ A;  4LF4 L;  4OX9 L;  4GLX A;  5GAH C;  1Q12 A;  4A3L G;  4DUZ L;  2PI2 E;  2N8N A;  3M9B A;  1YZ6 A;  4OWX B;  4X64 Q;  3OTO L;  1YIJ A;  1IBK L;  4HJ8 A;  3RZD H;  3CC7 A;  2Q2T A;  1K8G A;  3PCO B;  4DR7 L;  4JV5 L;  2QA4 A;  2IX0 A;  1I94 L;  5C0X J;  3CMA A;  3PUX A;  1XNQ Q;  1GVP A;  4DV2 L;  4DV6 Q;  4GOP A;  2BH8 A;  4R4O A;  4BY7 H;  3GTK H;  3CF5 A;  4B3T Q;  3PO3 G;  1YJ9 A;  4P72 A;  3S1R H;  3CCU A;  1N34 Q;  2Q2U A;  4A3D H;  1WOC A;  3UDX A;  1CSQ A;  3U4V A;  4DV3 Q;  1IXR A;  1XNR L;  2RHS B;  2F4V L;  3TRZ A;  1X54 A;  2E8G A;  3DLL A;  3HKZ G;  4JI8 L;  3PO2 G;  2MO0 A;  1SN8 A;  3FHW A;  3UDI A;  4LW1 A;  3JAM c;  1HR0 L;  4IOA A;  3GTJ H;  1OXX K;  2YV5 A;  1OTC A;  4UP8 A;  4RMF A;  4PG3 A;  5H1S E;  4GKJ L;  2CFM A;  4LF5 Q;  1JJG A;  2ZJP A;  1WCM G;  3ERS X;  3CXC A;  1PH8 A;  1V43 A;  1VCI A;  4C3J H;  4A93 G;  1B8A A;  3K80 C;  3S1M H;  4DR5 L;  1RL2 A;  3T1H Q;  1N8R C;  1PYB A;  4B3S L;  4OON A;  3I4M G;  1IZ6 A;  3PF4 A;  3FKI G;  4P74 A;  1X3F A;  3U4Z A;  4A3C G;  4JG2 A;  2R93 G;  1EUJ A;  3GTQ H;  2JA6 G;  4WJ4 A;  1KRT A;  4YWK A;  2OWO A;  4DV4 Q;  4A3L H;  1WI5 A;  1X9N A;  2LXJ A;  2IY5 B;  4OO1 I;  4R1J A;  4LWC A;  4QJF A;  1S3O A;  2HT1 A;  2I5M X;  4UPA A;  3GD7 A;  3PIO A;  3F2B A;  3PUY A;  1NE3 A;  3H0G G;  4PZ6 A;  2HIV A;  5IWA L;  1D8L A;  3E9I A;  1PV4 A;  2NVY H;  4AIM A;  5ELN A;  3PO3 H;  1YJN A;  1V9P A;  2E5L L;  5IYC H;  2ZTD A;  1Q82 C;  2JA8 G;  5GQO A;  4POG A;  2UUA L;  4MTN A;  4AYB E;  2KCM A;  2WB1 G;  3CC4 A;  2A19 A;  1HZA A;  1VQI A;  3CCQ A;  3PO2 H;  1P8L A;  1BBU A;  2FXQ A;  3HOU G;  2Q2H A;  4X64 L;  2CWP A;  2VW9 A;  3T1Y Q;  2Y0S E;  1FVI A;  4LF6 Q;  1WCM H;  1QVC A;  4DV1 Q;  1EIY B;  2MO1 A;  4A93 H;  5C0X I;  1XNQ L;  2KBN A;  4LUO A;  4DV6 L;  1PHJ A;  2GN5 A;  4BA1 I;  2Z6K A;  1VQJ A;  1VQM A;  4B3T L;  4LF4 Q;  1KL9 A;  4NXM Q;  2IX1 A;  3I4M H;  3FKI H;  2NVT H;  4A3C H;  5JEA J;  5M3F H;  1N34 L;  5E7N A;  2R93 H;  4DV3 L;  2JA6 H;  1OXV A;  4DR7 Q;  4JOI A;  4KLK A;  3TQY A;  4PMW A;  3I2Z A;  1Y1W G;  1PA6 A;  1TWC H;  1IYJ B;  2E2J H;  3AYH B;  4A3I G;  4FDB A;  2E2I H;  2UUB Q;  4LF5 L;  2LXK A;  2ID0 A;  4L5Q A;  5M5X H;  2A1A A;  1VQC A;  3STB D;  2R7Z G;  4ME3 A;  3H0G H;  1YHQ A;  4XTC S;  3T1H L;  1CKO A;  4R4T A;  2AWO A;  3MEF A;  2N78 A;  5M3M G;  1PH7 A;  4DV7 Q;  3S16 H;  3RN5 A;  2NN6 G;  2I5L X;  3TS0 A;  1ASY A;  3UE0 A;  3D0F A;  2K52 A;  3ZJY C;  3HOW H;  2JA8 H;  1OXT A;  4HJ5 A;  1X56 A;  1EQQ A;  1IBL Q;  3KF8 B;  3KFU A;  4XIG S;  4IPH A;  4QGU A;  1UWV A;  3GTO H;  1VQN A;  4DV4 L;  3J81 i;  3HOU H;  1N33 Q;  4RG1 A;  1VQD A;  1EFW A;  2N3S A;  2VQE Q;  3PV0 A;  4BXX G;  3BZK A;  5IYD G;  3ICE A;  4HIM A;  3ULL A;  1XMQ Q;  1HZB A;  3H15 A;  2JK8 A;  2EXD A;  3E9H A;  2K50 A;  1JJ2 A;  2F52 A;  1VQ8 A;  4P75 A;  1MIU A;  1XTD A;  3Q8D A;  1HR0 W;  1YHA A;  1IBM Q;  3M3Y H;  3EBE A;  2K5V A;  3JC6 6;  4GS3 A;  1VQ7 A;  1YI2 A;  1QVF A;  1L2F A;  4BY1 G;  1Y1W H;  2RF4 A;  1Q1E A;  4HJ9 A;  3T1Y L;  3CP0 A;  4A3I H;  1GD7 A;  2Z6K C;  4KHP L;  3HOV G;  1PH1 A;  4LF6 L;  4UY8 C;  4DV1 L;  4IPG A;  3GTL H;  1X65 A;  4LF8 L;  1NMG A;  4BBS G;  2R7D A;  2UUA Q;  2VQF Q;  2GVB A;  4R4C A;  5M3M H;  3KJO A;  4A3K G;  1XMO Q;  4HJ7 A;  1SE8 A;  1W3S A;  2QGQ A;  4HIK A;  2CWA A;  4AYB G;  4JI4 Q;  2YYZ A;  3NBH B;  1N9W A;  5GAD C;  1M1K C;  1U5K A;  4DR6 Q;  1UE7 A;  1FGU A;  2Y0S G;  3S1Q H;  1V1Q A;  2EIF A;  2F3I A;  4JI1 Q;  5HGQ A;  4DKA C;  2UUB L;  4BXX H;  5IYD H;  4LFA Q;  2JEB I;  4JI2 Q;  5LMN W;  4X65 Q;  3AQQ A;  2MNA A;  4IJH A;  1GM5 A;  1S72 A;  1K9M C;  3J81 j;  2NZH A;  4DV7 L;  3M7N A;  4H02 A;  2UXB Q;  4POF A;  1P16 A;  2VNU D;  1Q8K A;  2QEX A;  1IBL L;  2HQL A;  3ULP A;  2A8V A;  4BY1 H;  3S1N H;  1Y1V G;  2N49 A;  4KI0 A;  3KDF B;  1VQP A;  1N33 L;  3F2C A;  3S14 H;  4O0A A;  2VQE L;  4IPC A;  3ER0 A;  3ULJ A;  1X55 A;  1A0I A;  4LUZ A;  1XMQ L;  3J80 i;  3PUW A;  1KC8 C;  2GVA A;  1BVS A;  1N36 L;  5LMU Q;  4MNO A;  4YHH Q;  2D0P A;  1TXY A;  3I55 A;  4YCV A;  1VQF A;  2VUM G;  4BBS H;  1NY4 A;  1L1O A;  2VY3 A;  4DV5 Q;  4A3K H;  2JA5 G;  4IJL A;  3BJU A;  2BA1 A;  3PIP A;  4DR1 Q;  1PH2 A;  1IBM L;  2R92 G;  2NVX H;  3GTG H;  1NMF A;  1PVO A;  2DUD A;  1XPO A;  2JJQ A;  2YU9 H;  3CME A;  5JJI A;  1CUK A;  1TWF H;  4JCV E;  3OW2 A;  4HJA A;  3KDF A;  3S24 A;  3RZO H;  3RLO A;  1LUZ A;  3MXN B;  1FL0 A;  2ZM6 Q;  4DUY L;  3H3V H;  2B63 G;  2IHF A;  1HZC A;  4GN3 B;  5FLX c;  2VQF L;  4HID A;  4HIO A;  1XMO L;  3K0X A;  1AH9 A;  4KHP Q;  4JI4 L;  1N32 Q;  1M90 C;  2ZTC A;  4TVA B;  4DR2 Q;  1SRU A;  3KYH C;  2CQO A;  2Z0S A;  1Y1V H;  3NEN A;  1HZ9 A;  4DR6 L;  1E7Z A;  3TRE A;  2CCZ A;  4LF8 Q;  1CKN A;  4L5R C;  4JI5 L;  4JI1 L;  2ATW A;  3CCM A;  3HOZ G;  1J5E Q;  3M4P A;  5HY6 A;  4LFA L;  4K0K Q;  3D31 A;  3PUV A;  1I50 H;  4JI2 L;  2D0O A;  3CAM A;  1SR3 A;  4A3M G;  1LM0 A;  4X65 L;  1JB7 A;  4LFC Q;  4A3G G;  3F8T A;  1PH3 A;  2VUM H;  2UXD Q;  4A76 A;  1Z9F A;  1A63 A;  4NXM L;  2LSS A;  2NN6 I;  1NJI C;  1EYG A;  2JA5 H;  4JYA Q;  2UXB L;  5J3B A;  1BBW A;  5M5Y H;  2PNH A;  5ELO A;  3RN2 A;  2MQH A;  4A3J G;  3PF5 A;  2ZJQ A;  4DNI A;  1E1O A;  2R92 H;  1HNZ Q;  1VQ4 A;  2JE6 I;  4A4I A;  3G4S A;  4B3R Q;  4A3E G;  2I5H A;  5FLM G;  3HKS A;  4L5T A;  1YIT A;  1L1O C;  1Y14 B;  1KHI A;  2JA9 A;  5BR8 Q;  4JI3 Q;  4DR4 Q;  5JJL A;  5GRO A;  1YNX A;  4GN4 B;  4PZ7 A;  4DK3 C;  3G6E A;  2B63 H;  5LMU L;  3CPW A;  5IP9 G;  2R7F A;  4YWL A;  4YHH L;  4TQU S;  1ASZ A;  3I4N G;  1JT8 A;  1OXU A;  1PH9 A;  1UE6 A;  4DAY B;  5IE8 A;  1YVC A;  2YTY A;  4DV5 L;  3CCJ A;  1VQK A;  2UU9 Q;  2PI2 A;  4LUV A;  4DR1 L;  3J81 c;  1WFQ A;  2ALY B;  3AFP A;  2NVQ H;  1X3E A;  2WAQ E;  4PZ8 A;  2IHE A;  4NXN Q;  1PH6 A;  4BA2 I;  4GNX C;  4UP7 A;  2PQA B;  1N36 Q;  3CCV A;  1LYL A;  2VZA A;  1VQ9 A;  5C44 G;  1KRS A;  1XPU A;  3S17 H;  2XTI A;  3BZC A;  3HOZ H;  2UXC Q;  3UDF A;  2ZM6 L;  1VQ5 A;  2OTL A;  4A3G H;  1JJC B;  4A3M H;  3A0J A;  4YCW A;  1Q86 C;  1A8V A;  4JBJ A;  1MJE A;  1YHB A;  3HOY G;  3A5Z B;  1TWH H;  2AHO B;  5C3E G;  4LF9 Q;  4C3I H;  4GLV B;  1FJG Q;  1G6P A;  4A3J H;  1NTG A;  1VQO A;  1Q46 A;  1QZH A;  1JMC A;  4BY7 G;  1N32 L;  1EQR A;  3I7F A;  4DR2 L;  4IOC A;  2PMZ E;  1VQ6 A;  2R6G A;  4DUY Q;  4A3E H;  5FLM H;  4OWW B;  2R7Z H;  4QQB X;  1QUQ B;  3STB C;  2PQA A;  3RLN A;  4C3H H;  2HHH Q;  1Z47 A;  1K73 C;  1J5E L;  4K0K L;  3H3V I;  2WB1 E;  3S2H H;  1KXL A;  3B6Y A;  4QIW E;  4LFC L;  3I4N H;  5IP9 H;  2OTJ A;  2OQK A;  2UXD L;  2K14 A;  3K7A H;  3L2P A;  3U50 C;  1S40 A;  1PH4 A;  2OQ0 A;  1HNX L;  3BU2 A;  1X3G A;  3F2D A;  4DV0 Q;  4JI0 Q;  2JEA I;  4JYA L;  3FP9 A;  4JI5 Q;  4JBW A;  1K8A C;  1HNZ L;  2AWN A;  2L15 A;  1XJV A;  3I4O A;  3L0O A;  4B3R L;  3F1Z A;  3L7Z C;  5GAG C;  3DM3 A;  1L1O B;  4GKK Q;  4IFD G;  3RNU A;  4L5S A;  2I0Q A;  1HNW Q;  5C44 H;  1VS0 A;  5EAY A;  3WWV A;  1GKH A;  1UE5 A;  1QUQ A;  2OCE A;  2D62 A;  4GN5 A;  1L0W A;  4JI3 L;  5BR8 L;  4JI6 Q;  1PFS A;  4DR4 L;  3W1G A;  4NB3 A;  4X66 Q;  3J7A 5;  1A62 A;  1VQH A;  4WJ3 M;  4R4Q A;  3HOY H;  4NPS A;  3CC2 A;  2UU9 L;  4LFB L;  3HOX G;  5C3E H;  1K3R A;  1QVG A;  4UP9 A;  4GNX B;  1KAW A;  4DR3 Q;  1VQL A;  3CQZ H;  4NXN L;  3HOV H;  4YY3 Q;  1YJW A;  3PSI A;  3U58 A;  3GTP H;  1TWG H;  1I5F A;  5IY0 A;  2K5H A;  3W5O A;  2HIX A;  5IYC G;  3J80 c;  3CCE A;  5M5W H;  4B3M Q;  4JI7 Q;  5JEA G;  3UE1 A;  2VL6 A;  3PUZ A;  3AEV A;  2UXC L;  1HJP A;  2KEN A;  1TWA H;  4BBR G;  3JAM i;  4X62 Q;  3KJP A;  1G29 1;  2RCN A;  5DLQ E;  5AJ3 Q;  4OXP A;  2C35 B;  1CKN B;  1EOV A;  3M4O H;  1RIP A;  4IPD A;  4QL5 A;  4J15 A;  1KD1 C;  2UUC L;  2BH2 A;  4YCU A;  2EQS A;  4LF9 L;  1FJG L;  2WAQ G;  4P71 A;  1NBW A;  2RHQ B;  3A5U A;  1UEB A;  2NZO A;  1C9O A;  1SRO A;  4AQY Q;  4GNX A;  2V1C C;  3CCR A;  3GO5 A;  1WYD A;  5M3F G;  3UDG A;  3E0E A;  2HHH L;  3GTM H;  2WP8 J;  1CSP A;  3J7Z C;  1UE1 A;  2JQO A;  1X6O A;  2H5X A;  4X6A H;  5C4J H;  3K81 C;  1MJC A;  2BA0 A;  4DV0 L;  4JI0 L;  3HOX H;  1JE5 A;  3NEL A;  4C2M H;  1HH2 P;  2ES2 A;  3NEM A;  2KCT A;  4IFD J;  2JA7 G;  4ALP A;  4P73 A;  1OXS C;  4GKK L;  1IL2 A;  3K8A A;  4GLA C;  5LMN L;  4A3B G;  2Q2I A;  5IP7 G;  4LF7 Q;  3G48 A;  1C0A A;  2MFI A;  3HOW G;  3TEH B;  2IT1 A;  4OO1 G;  4DPG A;  1HNW L;  1HNX Q;  4QY7 A;  3S2D H;  2VS1 A;  1BKB A;  3RR5 A;  4BBR H;  2B29 A;  3I56 A;  4JI6 L;  3S15 H;  5JJK A;  4Y7N H;  4GOP C;  1I3Q H;  4X66 L;  1B70 B;  5GAE C;  3CCL A;  1KQS A;  5C4X G;  1Q1B A;  2B3G A;  1SMX A;  5IYB G;  4EX5 A;  3CD6 A;  2ASB A;  1SLJ A;  4DR3 L;  1G51 A;  4LFB Q;  1D7Q A;  4YY3 L;  4OX9 Q;  3TS2 A;  2AMC B;  4DUZ Q;  1LTL A;  2ZTE A;  3HKZ E;  3LGJ A;  1IBK Q;  4JI7 L;  3SGI A;  3K7U C;  3OTO Q;  2ZJR A;  4B3M L;  2XGT A;  3IRB A;  3EIV A;  4JV5 Q;  4JC0 A;  1I94 Q;  1MKH A;  4X62 L;  1QZG A;  1U0L A;  3W1B A;  4R4I A;  5C0X G;  4DV2 Q;  1AE2 A;  3OYY A;  4LNQ A;  1DGS A;  4AH6 A;  5FJ8 G;  5AJ3 L;  3KLW A;  3CW2 C;  4KHZ A;  3CCS A;  1PYS B;  1Q81 C;  1E3P A;  1K0R A;  2K4K A;  1XPR A;  1Q7Y C;  3PGZ A;  4A3F G;  5IT9 c;  4JBM A;  1XNR Q;  2F4V Q;  2WFW A;  2JA7 H;  4JI8 Q;  4AQY L;  1I6H H;  1SFO H;  1T9H A;  3CPF A;  1HR0 Q;  4A3B H;  1E22 A;  4O2D A;  1J6Q A;  5IP7 H;  4GKJ Q;  1B7Y B;  3RLF A;  1GO3 E;  4APV A;  1CKM A;  3KF6 B;  1EWI A;  2UUC Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...