3UDGA

Structure of deinococcus radiodurans ssb bound to ssdna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
231
structure length
211
Chain Sequence
RGMNHVYLIGALARDPELRYTGNGMAVFEATVAGEDRVIGERNLPWYHRVSILGKPAEWQAERNLKGGDAVVVEGTLEYRQWEAPEGGKRSAVNVKALRMEQLGTQPELIQDAGGGVRMSGAMNEVLVLGNVTRDPEIRYTPAGDAVLSLSIAVNENYQRQEKVHYIDATLWRDLAENMKELRKGDPVMIMGRLVNESTRVEATRVEALAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Cellular Dynamics of Deinococcus radiodurans Single-stranded DNA (ssDNA)-binding Protein (SSB)-DNA Complexes.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Dna binding protein/dna
molecule keywords Single-stranded DNA-binding protein
total genus 42
structure length 211
sequence length 231
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3udgA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3udgA02
5C3EG 4R4TA 3KJOA 5IYCH 1KAWA 1EQRA 4KI0A 1WI5A 4A3BH 1E24A 1YNXA 2Z0SA 3HOXH 1KHIA 3K80C 1E1TA 2OQ0A 3I4OA 4R4OA 4YY3L 2BH2A 4X66L 3KFUA 1J5EL 1IBKL 2WP8J 1TXYA 4A3MG 1PVOA 4JOIC 3CCEA 3UDXA 4BY7G 4TQUS 4EQ5A 2AWOA 4DR1Q 4A3IG 1QVFA 1I5FA 3CPWA 1XMOQ 2A8VA 1VCIA 2K5NA 1XJVA 3HOWG 4BBSG 2DUDA 4BBRG 4A3CG 4JBJA 5M5YH 3GTJH 4DV2L 3PUZA 3KYHC 3J80i 1EFWA 2K50A 2UXDQ 4LFAQ 3U4VA 1Q7YC 1Q46A 4GKJQ 1PHJA 1WJJA 1OXXK 3GTPH 4QJFA 1HNXQ 2YV5A 4LF4Q 4A3GG 3PIOA 1JB7A 3PUXA 1VQGA 2I5LX 5IE8A 2UXCQ 4L5QA 4B3SQ 3HFZB 1FL0A 1P16A 2BA0A 2ID0A 1VQPA 4YCWA 4X62L 2ASBA 2B63H 1PV4A 4X64L 4AQYQ 4A93H 2Y0SG 5LMUQ 4P72A 2OTLA 2JA5H 3M7NA 1X56A 1HZ9A 3S1RH 3NBHB 4AH6A 4DPGA 3F2DA 1UE7A 5BR8Q 3CCSA 4LF9Q 4X65Q 1KIXA 4GNXC 1VQ9A 2MO0A 1JT8A 4GLXA 1Y1WG 4DR5L 5C3EH 4L5RC 1KL9A 1NMGA 4ME3A 1W3SA 4JI1L 3L7ZC 4P74A 3S17H 3K0XA 5C4XG 4NB3A 1WCMH 1I3QH 1E22A 3EIVA 2E5LL 5HY6A 2YYZA 2RHSB 4IPGA 1HNZL 2AMCB 2N8NA 4B3TL 1XNQL 4A3GH 1CKMA 3RNUA 3RZDH 3AFQA 3S14H 4IPDA 4HJAA 2WB1G 4LF8L 1XMQQ 3CCRA 4J15A 2FXQA 1VQBA 1IZ6A 5GROA 3M4PA 4LUVA 1N34L 1GM5A 3TREA 1J6QA 4BY1H 5IP7H 1KD1C 4A3IH 2C35B 2IY5B 1NTGA 4OONA 4GOPA 1JJ2A 2F3IA 2UXDL 1I6HH 1QVCA 1PH7A 2HIXA 1L1OA 4UP9A 1PYBA 1IYJB 4GNXB 4LF5L 2VW9A 2Z6KC 3M85A 1HNXL 3EBEA 3GDEA 4NXNL 2MQHA 2K5VA 3I56A 4HIOA 1QVGA 3I4MG 1L1OC 1M1KC 2HIVA 3CCLA 4A4IA 1KXLA 1X54A 4QGUA 1PH3A 3CXCA 4MZ9A 3J7ZC 2E2IH 3J81c 4B3SL 3H3VH 2UXBQ 2D0OA 3BZCA 1KRSA 2CWAA 1XPRA 1VQAA 3ULLA 3K7AH 4OWWB 1Q82C 4X64Q 5IYDG 4AQYL 3PCOB 2JA7G 3E9HA 3CW2C 1YVCA 1PH2A 2UU9Q 3D31A 2AWNA 3RR5A 2UUBQ 2F4VL 1EOVA 4XIGS 4P71A 2VUMH 1IBLQ 2ZM6Q 1K0RA 1NY4A 2MNAA 2R7ZG 2NZHA 2E8GA 1SROA 1IBKQ 4GLAC 2QA4A 3HOVG 4OXPA 5GADC 3A5UA 4DR5Q 3IRBA 3H0GG 4BXXG 4DK6C 4LF7L 3J80c 3JC66 4GN3B 1UE5A 1Q12A 4DUYQ 4DV2Q 2MO1A 2WAQE 1Q8KA 4A3JG 4JI3Q 4MNOA 5IT9c 3KF8B 2B63G 3U4ZA 1WFQA 1YHBA 3F8TA 1RIPA 4LF4L 3CD6A 2XTIA 5IWAL 4B3TQ 2JA9A 4KHPL 4HJ5A 4R4CA 2KBNA 1XNQQ 4DUZQ 3M3YH 1BBWA 1E3PA 3RLOA 2JEAI 2UXCL 4UP7A 2N49A 1KQSA 3I7FA 2HHHQ 5FJ8H 4IOAA 4B3RQ 4IFDJ 4C2MH 5C0XI 1A0IA 4A75A 3PO3H 1VQ5A 3M4OH 1N34Q 4JBMA 3PSIA 4BBRH 1X3GA 1E7ZA 3BU2A 1BKBA 5H1SE 5LMUL 4DV4L 4A3MH 1CKNB 3ER0A 1Y14B 4DV7Q 1XNRL 2NZOA 4O2DA 1IBML 1OXUA 3EN2A 4PZ7A 2V1CC 1UWVA 1VQCA 3OYYA 4DR2Q 5C4JH 5IP9G 5M3FH 3D0FA 2YTXA 1TWAH 4NXNQ 1L1OB 4IFDG 3DM3A 4X65L 3MEFA 2ZTDA 3UE0A 5JEAG 2BH8A 1U5KA 2EXDA 1PH8A 2K14A 3E9IA 2CKZB 2JK8A 3OTOQ 3KOJA 2NVQH 3S2DH 2HQLA 1Q81C 2K4KA 1VQOA 4R4QA 4A3EG 3AQQA 4R4IA 4P73A 3CC4A 4JI1Q 1PH9A 3PIPA 3CMEA 3VDYA 4UY8C 1V43A 4DV0L 2VQEQ 1Q1BA 1SMXA 2UU9L 3UE1A 4GLVB 3AFPA 3U50C 1X6OA 1QUQB 4LNQA 1N8RC 3HOUH 4DV3Q 2VS1A 1XPUA 1IBLL 3T1YQ 4DV5Q 2HT1A 3H0GH 3B6YA 4AYBE 3OW2A 1SFOH 1G291 1Y1WH 1GKHA 4YWLA 3RN2A 4LF8Q 1FGUA 1AH9A 5M3MG 5AJ3L 1OXVA 5JJLA 1NMFA 3TQYA 3JAMi 1X3FA 1ASYA 4LF7Q 3U58A 2KHJA 2OQKA 4HJ7A 4JI5Q 1CSQA 1G6PA 4DUYL 5IYBH 3HOUG 3PO2G 4JC0A 2VNUD 2WAQG 2ZJRA 3I2ZA 2K75A 2E2JH 2CFMA 4JYAL 4JG2A 4LF5Q 4GN5A 1JE5A 2JA7H 4DR6L 3E0EA 1VQIA 2ZTCA 1WYDA 4L5TA 4A3DG 4KHPQ 1LUZA 2F52A 3GTMH 1B70B 4DUZL 2PI2E 4JI6L 3KLWA 4GN4B 5GAEC 1ASZA 2R7FA 1KRTA 2UXBL 4LFBL 2Q2HA 2ZTEA 1VQDA 3KDFA 4B3RL 1DGSA 3LGJA 4LF6Q 2PQAA 1NJIC 3TRZA 2WB1E 4DV6Q 1Y1VG 1YHAA 4HJ9A 4DAYB 1N36L 2N3SA 5C0XG 2UUCQ 4PMWA 4DV4Q 1Q86C 2KHIA 1PYSB 1YBYA 2UUBL 2F4VQ 1IBMQ 5LMNL 1MJEA 3CAMA 1MIUA 1A63A 1CKNA 4X6AH 5M5WH 4JI8L 3F2BA 2ZM6L 3RN5A 3T1HQ 4A3KH 3I55A 4Y52H 2NVXH 2I0QA 1LTLA 4YHHQ 1VQ4A 4GKKQ 3PF5A 2UUAL 3M4QA 5JJKA 5FJ8G 4IFDI 1B8AA 1N32L 5C0XJ 3ZJYC 4L5SA 1YJWA 5GAHC 3CC7A 2CQOA 4A3FH 3KJPA 3CCQA 1L2FA 3PUVA 3M9BA 5IYDH 1PH1A 1EIFA 1VQLA 4JI3L 1WOCA 4QY7A 3STBD 2EIFA 3RLFA 4DV0Q 1PA6A 4IPHA 1JJGA 4Y7NH 4JI4L 2VL6A 5EAYA 2L15A 4IOCA 1CUKA 5IWAQ 4R1JA 1OTCA 3NEMA 3CCMA 4DV5L 2RHQB 2K5HA 5GAGC 2JA6G 3S2HH 2R92H 1Z47A 2HHHL 5M3FG 4H02A 3ULPA 1I94L 2LXJA 4GOPC 2R7ZH 4JV5Q 1HNWQ 1FJGL 2I5MX 1A8VA 1TWCH 1SN8A 3GD7A 3W1BA 1Y1VH 4YCVA 4DV7L 1K8AC 3SGIA 2A1AA 1HR0Q 1VQNA 1XNRQ 1QZGA 4K0KQ 4HIMA 4DR2L 4YWMA 3HKSA 3TS0A 1OXTA 4A93G 4YWKA 4A76A 2KENA 3PGZA 1K83H 1E1OA 4LFCL 1EIYB 4JI6Q 3TS2A 2YTYA 5IY0A 3OTOL 4POGA 1GD7A 1IXRA 2AHOB 4DR3L 4LF6L 1VQKA 4A3FG 3WWVA 3PUWA 4DKAC 3G48A 3MXNB 4BA1I 4POFA 3J81i 1N36Q 4A3LH 2UUCL 4DR4Q 4KLKA 3HOZG 2VQEL 2YU9H 2D0PA 1D8LA 2MFIA 2VY3A 4LFBQ 1YZ6A 5LMNQ 2D62A 4RG1A 1HZCA 5IP9H 1L0WA 4DV3L 4OWXB 2LXKA 4A3CH 3HOWH 2JJQA 2QGQA 3T1YL 3T1HL 1C0AA 2VZAA 3NENA 1GVPA 1EWIA 4YHHL 2JA8G 5AJ3Q 3UDFA 2UUAQ 2EQSA 1HH2P 2R7DA 5E7NA 2LSSA 2VUMG 1LM0A 4DV1L 2E2HH 3HOYG 2PMZE 4OX9L 1SR3A 1EYGA 3GTKH 3UDGA 3HOXG 2GVBA 2K52A 4A3BG 1EUJA 4JI5L 3CCUA 3ERSX 4JI7Q 2R92G 1V9PA 1HZBA 4MTNA 4IJLA 1TWHH 1RL2A 2A19A 3J7A5 1G51A 2PI2A 3A5ZB 4OWTB 3PO3G 1LYLA 1Q1EA 4JYAQ 3CCJA 1N33Q 4JI4Q 4DR6Q 1P8LA 2B3GA 4JCVE 1KC8C 4WJ3M 3S16H 3ULJA 1X3EA 1VQJA 3A0JA 3HKZE 3H15A 1SRUA 4IJHA 3Q8DA 1PFSA 1CKOA 2B29A 4PZ6A 4DV6L 2Q2UA 1AE3A 3S1MH 2JE6I 3JAMc 1HNWL 2ES2A 2I5HA 3G71A 1CSPA 2YTVA 1QUQA 5IP7G 4BY1G 5J3BA 1YITA 1SLJA 1PH6A 5M5XH 4K0KL 2ZJPA 1YIJA 4BY7H 4RMFA 3HOVH 3CP0A 1S40A 4JI8Q 3GTQH 4TVAB 3J81j 3GTLH 4OO1G 2IHEA 4HIKA 1YHQA 2OCEA 1VS0A 2Z6KA 1W2BA 4JI0Q 3W1GA 4GKKL 3CF5A 1N32Q 5JEAJ 3CQZH 1EQQA 3BJUA 4NXMQ 1NBWA 4O0AA 4UPAA 4DR3Q 3RZOH 3G6EA 1WCMG 3FKIG 1FVIA 3CCVA 1D7QA 5DLQE 4C3IH 1U0LA 2ZJQA 2PQAB 2KCMA 3CPFA 4DR4L 3STBC 1VQFA 1MKHA 1UE6A 3F2CA 4YY3Q 1YI2A 1YEZA 1VQ8A 3PF4A 4BXXH 3FP9A 3KDFB 1J5EQ 1XPOA 2IX1A 4P75A 1T9HA 5FLXc 1UE1A 4QQBX 3L0OA 3HOYH 3W5OA 1K8GA 1V1QA 1TWFH 4PG3A 4DR1L 2RCNA 4JI2Q 2JA8H 5GQOA 1I94Q 4A3KG 4OX9Q 4KHZA 1X55A 4JV5L 3K7UC 4GS3A 4PZ8A 5IYCG 3K81C 4JBWA 4OO1I 1HR0L 2NN6G 4XTCS 3PUYA 2PNHA 4YCUA 3S1QH 2ATWA 2CCZA 5LMNW 3NELA 4A3LG 1N9WA 2WFWA 1MJCA 1AE2A 3CC2A 4LW1A 4LFCQ 4B3MQ 1FJGQ 4C3HH 5HGQA 2IHFA 4APVA 3I4MH 1PH4A 3KF6B 5JJIA 4EX5A 2XGTA 2VQFQ 2IT1A 1B7YB 4DR7L 4A3DH 5C4XH 1K9MC 4AIMA 1BBUA 3TEHB 1K73C 2N78A 1O7IA 2R93H 3GO5A 3CMAA 3PV0A 4IPCA 1VQ6A 3PO2H 4X66Q 5IYBG 4JBKA 4LF9L 4LWCA 3ICEA 4HIDA 4DAMA 2ALYB 2BA1A 4FDBA 4JOIA 4QL5A 5FLMG 1VQ7A 1X9NA 1C7YA 2JA5G 2QEXA 3AYHB 2JQOA 2OWOA 1XMOL 3S15H 2NVYH 3BZKA 1S72A 2JEBI 4DV1Q 5K36G 4HJ8A 2JA6H 3UDIA 3FHWA 4LFAL 2GN5A 2H5XA 4NPSA 4GKJL 1C9OA 4JI7L 1QZHA 1S3OA 3FKIH 4QIWE 1YJ9A 1HNZQ 2Q2TA 1N33L 4LUZA 5ELOA 1R9TH 4A3EH 4C3JH 1XMQL 3GTGH 3I4NG 4X62Q 3S1NH 2Y0SE 4A3JH 3HKZG 1VQEA 1JJCB 5FLMH 4BBSH 4JI2L 1K3RA 3A74A 5M3MH 2RF4A 2GVAA 1PH5A 1A62A 4IO9A 1UEBA 1Z9FA 2IX0A 1IL2A 4DK3C 4GOPB 4BA2I 1HZAA 3K8AA 2NVTH 3GTOH 1VQHA 3G4SA 3DLLA 2R93G 5BR8L 1SE8A 3S24A 5ELNA 1HR0W 3L2PA 4DNIA 3I4NH 3HOZH 2AKWB 1OXSC 1VQMA 1HJPA 3F1ZA 4LUOA 1M90C 4ALPA 1H95A 1TWGH 1YJNA 2KCTA 3AEVA 2R6GA 4GNXA 4JI0L 4UP8A 4WJ4A 2NN6I 1GO3E 4B3ML 2OTJA 1XTDA 3RLNA 3H3VI 1I50H 1X65A 2VQFL 1BVSA 1JMCA 5C44G 2CWPA 4DR7Q 3KF6A 2DGYA 4NXML 5C44H 2Q2IA 4AYBG 1NE3A 2E5LQ
chains in the Genus database with same CATH superfamily
1C8CA 3KJOA 1KAWA 4KI0A 1B3AA 5I6WA 1YNXA 4YY3L 1B44D 3I4OA 3K7AB 1B53A 4DXFA 2RCFA 1S5DD 2EYMA 5ISRA 1JICA 4FF4A 4DR1Q 2K5QA 1XMOQ 4EVOA 3HOWG 1EFWA 1PZJD 3U4VA 1Q7YC 3HEJA 5C5MA 1I4QA 4A3GG 3QR8A 1JB7A 1VQGA 2I5LX 3TN2A 4A3EB 3H0GB 1QCBD 3HFZB 1FL0A 1TWHB 1P16A 2ID0A 4FXGC 4J1MA 4X62L 2X6GA 2ASBA 4H7BA 3A7AB 4X64L 4A93H 4WJWA 1HCZA 5D3DA 1JC7A 4U68A 3U9SA 3NE5B 4P72A 1SFOB 1VDZA 4XYOA 5CV5A 1I4PA 1HZ9A 3S1RH 2QKIC 1D1IA 4DPGA 4DU9A 1HHVA 5BR8Q 1UAPA 2N55A 4GLXA 3GTQB 1WTVA 5M5XB 3HOZB 3H91A 4ME3A 1W3SA 4KN7C 3CHBD 4DF7A 4NB3A 1WCMH 1I3QH 1F9QA 4A3DB 3GV6A 2ZT9C 5KYLA 5IODA 2DJGC 2N8NA 4B3TL 3HP3A 1XNQL 4A3GH 1K0SA 2G5DA 2SNSA 3S1NB 2WB1B 4J15A 4C3JB 2FXQA 1VQBA 4K14A 3TREA 1J6QA 2OT2A 4B9WA 4A3IH 2IY5B 1NTGA 1ICWA 5C5LA 1HQMC 4GOPA 2ZXOA 2F3IA 5JAVA 1KABA 4UP9A 1B50A 5BN3A 3M85A 4KY7A 4ULLA 3A55A 3SK4A 3R93A 1Z7TA 2HIVA 4QGUA 4MZ9A 3VR4A 3J7ZC 3H3VH 1GXDC 2CWAA 1EEID 1TVXA 1VQAA 4QUCA 3ULLA 1DOLA 4X64Q 3BYYB 3PCOB 1U4PA 3CW2C 4RWSC 2UU9Q 3RZOB 1MI2A 5IGEA 1K0RA 1NNXA 5E4WC 2B2VC 2QA4A 1KTKA 5GADC 2PO4A 4A3MB 4LK1C 4BXXG 1I4RA 2RSNA 3JC66 1SMYC 1UE5A 4HSPA 1STYA 4DV2Q 1Q8KA 3GTOB 2B63G 3K58A 1EY0A 2RDFA 1SNPA 4B3TQ 2JA9A 3S16B 1XNQQ 1E3PA 2JEAI 1YNND 1KQSA 5FJ8H 1A3VA 1Y8PB 5ELBA 3HGBA 4B3RQ 4IFDJ 5C0XI 4JBMA 3MWYW 1X3GA 4F88A 5H1SE 1LTRD 4YIJA 5LMUL 1CKNB 3ER0A 4O2DA 4PZ7A 2F0FA 1XX8A 4DR2Q 5IP9G 1RF2D 1TWAH 2ZTDA 2BH8A 1MSGA 3S2DH 3KOJA 1QNUA 2HQLA 4OIJA 4R4QA 3C1FA 4P73A 4JI1Q 4RGTA 3T51B 3ZYYX 5HGTA 4K8IA 1Q1BA 2UU9L 4R8IA 3HOUH 1N8RC 2VS1A 5IOCA 4DV5Q 4GZYC 4RKBA 3OW2A 3T13A 3K5LA 4YWLA 4LF8Q 5AJ3L 1PZKD 1LTID 5KIXA 4CJ1B 4XQNA 3Q0AA 1ASYA 1CQVA 4BY1B 3F2UA 2KHJA 4JI5Q 1ENFA 4JC0A 2VNUD 2WAQG 1ONLA 1JR0D 1H9MA 4DK1A 1TS3A 5J1ZA 1QOHA 2QEJC 3TMEA 1ENCA 3KLWA 1K8MA 2FHTA 2UXBL 2EYFA 2F0DA 4TSSA 2Q2HA 4B3RL 5KNCA 1HXYD 1H9SA 4FF2A 1DYQA 4KHVA 3E3XA 4RCNA 4CKCA 2WB1E 3TRZA 1F2YA 1LLRD 1XWEA 1STHA 4PMWA 3SHLA 1PYSB 5EKLA 3CAMA 1CKNA 1NCVA 4KKUA 4JI8L 1SE3A 1STBA 2KVMA 2VXWA 4A3KH 3I55A 1GUGA 4Y52H 1VQ4A 4YHHQ 5CV4A 5JJZA 5JJKA 3M4QA 2CVRA 2L12A 3S2DB 3C46A 2SEBD 1JOQA 1WTOA 5IYDH 2PNRC 5L37A 1IYUA 3S1QB 4DFAA 3RLFA 1PA6A 1BQQT 1TY2A 2RA4A 4IOCA 4IUPA 1STAA 4DV5L 2K5HA 2JA6G 4X3KA 2R92H 1PYWD 2HHHL 3ND9A 3ULPA 3Q23A 1I94L 2A68D 2CH4W 1I4GA 1SN8A 4DV7L 4CKBA 2A5HA 2XWBB 2A1AA 1ZEQX 4F87A 2F0UA 2Y0SB 2EDGA 4MIUA 3SK8A 4HTHA 3HKSA 1OXTA 4YWKA 3D4DA 4J8QA 1E1OA 4LFCL 1DONA 1EU4A 2JA6B 2EE1A 3TS2A 1MGSA 4POGA 3SVMA 2M9VA 2B2YC 4DR3L 4BA1I 2CW0C 2O2LD 2WIIB 2B2TC 2VQEL 5IGCA 2MFIA 1FYCA 2VY3A 3J81L 1Y69U 3MC0B 3DWQA 2G9DA 3T1YL 3GTLB 1GVPA 4YHHL 2MGSA 1ESRA 1RTNA 1CHQD 5E7NA 3FDTA 3GTKH 3UDGA 2GVBA 1B3QA 3CCUA 4S3SA 1TR5A 3FMCA 3P1HA 2R92G 1RL2A 2A19A 3RD4A 1G51A 2Z1CA 2R92B 3PO3B 1LYLA 1S5BD 1SYFA 1F9PA 3CCJA 1G2TA 2B3GA 2WV6D 3GTKB 1E0BA 1KNAA 3GTPB 1SRUA 1TS5A 4F7XA 3QWNA 3G71A 2J4XA 1YITA 1SLJA 5C3WA 4BY7H 4E6IA 3CP0A 3K5NA 3GTQH 3VR2A 3J81j 4OO1G 2IHEA 1YHQA 1W2BA 3PMFA 2EJGC 3K5MA 1XXGA 2J7ZA 1N32Q 1WVLA 3LX0A 1NBWA 3TP5A 4DR3Q 1FVIA 3D6WA 4R8NA 5DLQE 4C3IH 2NYZD 1I6VC 2PQAB 2KCMA 3STBC 1UE6A 3F2CA 4YY3Q 5TSSA 1VQ8A 3KDFB 5FLXc 2F3VA 4BBSB 3L0OA 1RCVD 2DNEA 1KDBA 4DR1L 2HCCA 4KKSA 5DEHA 4A3KG 4JV5L 4V0BA 1BXTA 4GS3A 3DXJC 1HR0L 4YCUA 1EY7A 3S1QH 1EOTA 5C0XH 5IGDA 4A3LG 1N9WA 2WFWA 3I4MH 4M1UB 4BWGB 2AQ2B 3VYRA 5BN4A 1FNWA 3DHQA 4PV1C 3J80L 3CMAA 5J39A 2SOBA 1AN8A 4IPCA 3MAQA 1VQ6A 4N9TA 4LWCA 4HIDA 4NMZA 4DAMA 5I9OA 4FDBA 3I4NB 5FLMG 4FXDA 5F2DA 3EA6A 3NBIA 2PW7A 3BS1A 3QG1A 2JP1A 4DV1Q 4HJ8A 3OIPA 1NUCA 4LFAL 3BYTB 4NPSA 1C9OA 1DOMA 2MPMA 1G6ZA 1QZHA 3Q22A 3FKIH 4QIWE 5CBEE 3DUZA 4LUZA 5G3LD 1R9TH 2F0LA 3BG3A 1VQEA 2F3WA 4Y7NB 5FLMH 3HKZB 4M8AA 1GUOA 2F0HA 5EKIA 5T1GA 5M3MH 3J81E 1PH5A 1EYAA 1Z9FA 2EJFC 4DK3C 3NSWA 2R93G 4DNIA 4OL7A 1M90C 1OXSC 1HJPA 3F1ZA 1PRTD 1TWGH 1YJNA 2F0MA 4UP8A 1A3TA 2B2YA 3GV3A 2OTJA 1LTTD 1XTDA 3OWEB 3RLNA 1YNNC 3H3VI 1HRJA 1FGBD 4PQXA 3TZUA 1JMCA 1AFPA 1NE3A 3UI2A 5ELEA 1WI5A 2OQ0A 4R4OA 1I4HA 1J5EL 3UDXA 4EQ5A 2AWOA 4A3IG 1QVFA 1VCIA 2K5NA 4IUQA 5BN5A 4A3CG 5M5YH 4DV2L 3PUZA 2K50A 4LFAQ 2F0KA 1WD1A 4RGOS 3NPPA 1Q46A 1PHJA 5CC4A 4P2CB 3GTPH 4K2KA 5IT9L 3OMCA 3T56B 3KF8A 5KRUA 1IKMA 2BA0A 3E5SA 1SYEA 1EY6A 1SSOA 2WACA 4DXGA 5LMUQ 2PPBC 2JA5H 1SJED 5M9OA 3M7NA 1AZPA 2K1BA 4H44C 2VUMB 1X56A 1UE7A 3CCSA 4LF9Q 1KIXA 1DD2A 4ID6A 4QMGA 1Y1WG 4KY6A 4JI1L 4C3HB 1ML0D 3S17H 3CU7A 5C4XG 2L55A 2KEDA 3EIVA 2RHSB 4IPGA 2KEEA 3OW7A 2KUMA 1CKMA 4K5VA 3RZDH 4IPDA 4HJAA 4LF8L 5EPLA 3NP8A 1XMQQ 3CCRA 3M4PA 1ICFB 4BY1H 5I2YA 1KD1C 4QB4A 1QE6A 3NWTA 1I4XA 1JJ2A 5E1FA 1L1OA 4ABNA 3D8GA 2XWJB 3EBEA 4NXNL 2MQHA 2K5VA 4HIOA 2F1MA 2HD3A 1X54A 1PH3A 2E2IH 4ZYSA 3FVQA 2UXBQ 3BZCA 2A6HD 1XPRA 2XVSA 4OWWB 2NVYB 2RBMA 1ENAA 4O42A 5C3XA 2XRSD 3D31A 3NQTA 3RR5A 4DNTB 1PTOC 5CYUA 5C44B 5DAUA 1TWAB 1EZ8A 4A3KB 2MNAA 1TS2A 5DM63 2B2WC 1IBKQ 1PMRA 4GLAC 2A69C 1SNDA 3H0GG 3IRBA 1NR4A 5LL6S 4HEDA 2A69D 2WAQE 4LMQD 4MNOA 5IT9c 3KF8B 3WOFA 3U4ZA 1YHBA 3SXHA 1VMPA 1BBWA 4RHRA 2UXCL 2X6LA 4QF4A 4UP7A 2HHHQ 2NZ1D 2B2TA 1AZQA 1A0IA 3PO3H 2A6HC 4BBRH 4DV4L 2B2VA 4DV7Q 1Y14B 3Q24A 2NZOA 1IBML 2MJ8A 2V1CC 1UWVA 1VQCA 3OYYA 1PDQA 5CV8A 5C4JH 3DMUA 3AMUA 4NXNQ 1L1OB 4J6HA 3DM3A 4X65L 5FO9B 1U5KA 2CKZB 2JK8A 4RAUC 4NW2A 4A3EG 3AQQA 1PH9A 1D6EC 3PIPA 3CMEA 2VQEQ 3FPPA 1EY4A 2RVLA 5IGGA 5IGBA 3AFPA 4LNQA 2O5IC 1JQYD 2OXPA 2SDFA 1XPUA 3T1YQ 1Y1WH 3RN2A 5M3MG 4CDFC 4L8JA 3JAMi 5JVH3 1GUNA 3NBHA 2OQKA 4UDUC 3HOUG 4CKEA 1I6HB 1A15A 1EIGA 4K2LA 2K75A 2CFMA 1EQVA 2EYJA 2ZTCA 3E0EA 4JW0A 2KOLA 1WYDA 3FRPB 4LJZC 2P5ZX 2F0OA 2Z6BA 4GN4B 5GAEC 3HOYB 2R7FA 1MBYA 1KRTA 3VYUA 3KDFA 5D65A 1DGSA 3MTSA 1V1PB 5EPJA 1NJIC 1CT1D 1Y1VG 1YHAA 4HJ9A 4DAYB 5C0XG 4DV4Q 1STEA 1PXUA 4EQNA 2KHIA 1SAPA 2UUBL 1IBMQ 5LMNL 1D1KA 1MIUA 4X6AH 3F2BA 2HDMA 4CDEC 3BDCA 2F4IA 4HMIA 1HA6A 3PF5A 2UUAL 5FJ8G 1N32L 3ZJYC 4I65A 3S1MB 1PRTF 3CC7A 4OEMB 4A3FH 3KJPA 3CCQA 3V2TA 2BCOA 4JI3L 1Y1VB 1KNEA 4QY7A 1EL0A 2EPBA 2EIFA 2B8GA 2QCPX 1ZYRD 3C2PA 2L15A 1CK1A 4A3JB 4R1JA 3QOJA 1OTCA 3NEMA 2KQ3A 4BBRB 3CCMA 5JVG3 2RHQB 2K03A 3SE0A 1T5XD 1Z47A 4PNYA 3EVQA 1TWFB 5M3FG 4PMBA 4H02A 2NBFA 4JV5Q 4QCLA 3ONAB 3AU7A 5EJWA 4IUVA 4B9XA 1FJGL 3W1BA 2H4OA 4YCVA 3SGIA 1XNRQ 1HR0Q 4K0KQ 4RHSA 3FEWX 1AEXA 5CGKA 3A8JE 4A93G 1WTRA 4A76A 3TDQA 4XQQA 4V190 1J9OA 1K83H 3CQZB 2TMPA 3MXUA 2YTYA 5COYA 3OTOL 2PYKA 4A3LH 4F8MA 5CV9A 2Z9HA 1ET9A 5KYIA 1SE4A 2KJXA 5LMNQ 2F0GA 3NXWA 5IP9H 1L0WA 4A3CH 2LXKA 2QGQA 1PTOH 1DM0B 2UUAQ 2VUMG 2R7DA 2LSSA 2M2LA 4DV1L 1GHKA 2PMZE 1PLFA 1SR3A 2K52A 1MHWC 1TWHH 3PO3G 2PI2A 3A5ZB 4OWTB 2MP1A 3C1EA 1Q1EA 4JYAQ 4KKTA 2JA7B 1P8LA 2XN9C 3PQIA 1LTSD 1PFSA 1CKOA 4Q5VA 4X3SA 1WTQA 3D4WA 3I72A 4WRDA 2I5HA 5T1IA 3T4AC 5IP7G 1QUQA 3VR6A 4BY1G 1EIHA 1PH6A 4K0KL 2ZJPA 3I90A 4RMFA 3HOVH 4ILWA 1CZGA 4TVAB 3C3LA 1TIID 4DN4M 3HOWB 4HIKA 2EJMA 1I50B 1U4MA 3JAML 4GKKL 1EFID 4FNFA 3CQZH 3X3NA 3VA7A 2LKVA 3RZOH 3W2DA 3FKIG 3CCVA 2R93B 2EXZA 1U0LA 2FMCA 5I9PA 3PIO3 1RKNA 2R61A 2QILA 1VQFA 1YEZA 3PF4A 3P75A 4WFN3 1J5EQ 4ZCKA 4P75A 2IX1A 3EROA 1H9SB 1V1QA 2JA8H 4C2MB 3QO2A 5CORA 1UUPA 2ICIA 1HUMA 2JXMB 3LNNA 2RSOA 1K28A 2KHSA 1DXMA 1QJOA 2JYOA 3NELA 5M5YB 3CC2A 2Q8TA 1Q8IA 3JAME 5JJIA 2IHFA 3KF6B 1Z6HA 4EX5A 2K6AA 3U9OA 3TP8A 1QB5D 2FFKB 3BVGA 3I3CA 5C4XH 4AIMA 1BBUA 2MHVA 1YNJD 1K73C 2N78A 2R93H 4A3BB 1LT4D 3H3VC 3PV0A 4RGNA 5A2QE 1TKWB 3MXGA 4X66Q 4LF9L 3QOLA 3ICEA 2JA5B 4QL5A 1VQ7A 2PZWA 1EEFD 5KNBA 2IL8A 1B9NA 2OWOA 4H0LC 1JWUD 3S15H 3S1RB 2JA6H 2BE5D 4K5XA 4DAPA 1EYCA 4GKJL 4JI7L 5D14A 4IUTA 1YJ9A 1SNMA 4K6LA 4OHJA 2Q2TA 1N33L 1FD7D 5ELOA 1SBBB 1XMQL 1EQTA 4CGYB 3S1NH 4IQZA 2Y0SE 1JJCB 4N8X1 2RF4A 1A62A 4HCSA 3WOEA 1UEBA 1IL2A 1CTMA 4GOPB 4BA2I 1HZAA 1WCMB 1VQHA 5G3LF 3DLLA 2K01A 2IX3A 1PFNA 3S24A 3BVZA 1HA5A 1O7LA 3L2PA 3HOZH 1BCPF 2AKWB 3EJIA 1VQMA 4ALPA 3V96A 4WJ4A 4OELB 5D3IB 5KNDA 4JI0L 2LFNA 1I50H 1Y8NB 1QG7A 1X65A 2V4DA 1BVSA 2CWPA 3KF6A 2DGYA 3SEBA 1WJJA 4ZAIA 5C3EB 1F2LA 3R8BA 4R4TA 5C3EG 3HOXH 2Z0SA 1XYIA 2BH2A 2DNCA 4X66L 1FNVA 1IBKL 2WP8J 4IURA 4NDXA 4C1NK 1KLGD 1PVOA 4JOIC 3CCEA 3M4OB 1C48A 4TQUS 2A8VA 1I5FA 3CPWA 1XJVA 2E2JB 2DUDA 4BBRG 3GTJH 4R9WA 3KYHC 2UXDQ 5K5PA 1PTOD 4GKJQ 3VA5A 1DJRD 3FKIB 3PIOA 3I8ZA 3PUXA 1TU2B 4N9PA 3L9AX 2UXCQ 4L5QA 4B3SQ 3OHXC 5CV6A 1VQPA 1PFMA 1II3A 5ELDA 2VB3X 4AQYQ 1SE2A 2Y0SG 1LTGD 3DWAA 3NHHA 2ICEC 2OTLA 2WKCA 2K28A 3MZ5A 3L3OC 4MTKA 2C9OA 3S15B 3HOXB 2FMMA 4ME5A 2CQAA 3I4LA 3O13A 4X65Q 1VQ9A 1EY9A 5C3EH 4L5RC 1KL9A 4DA2A 3K0XA 2NVTB 5I6YA 5HY6A 2YYZA 2AMCB 1SNOA 4IN3A 1E2VA 3RNUA 3S14H 3AB9A 3P20A 3Q6SA 3MXPA 1A2UA 1TWCB 4LUVA 1GM5A 4CJ0B 3IFDA 5IP7H 3ITPA 2RKSA 3VYSA 2UXDL 1I6HH 1QVCA 1PH7A 2L4NA 1BCPD 1HFNA 4KMUC 3GDEA 5A2QL 1BO0A 1L1OC 1M1KC 2K5WA 4EQPA 3CXCA 4B3SL 3J81c 5HURA 2D0OA 2XIWA 1G8ZD 1LV9A 1HTLD 4AQYL 1Q82C 3E9HA 2WAQB 1YVCA 1FR3A 2EOTA 2UUBQ 4XIGS 4NKLA 3A56A 2VUMH 1C4QA 3MVVA 2WKDA 5C4JB 1NY4A 2NZHA 3IFTA 3HOVG 4OXPA 2DJFC 2E2DC 3HOVB 3IKJA 4K5WA 4G7ZC 1SDFA 4GN3B 3TP6A 1HUNA 1Q12A 4DUYQ 1GUSA 4A3JG 4JI3Q 4ZRZA 1JWMD 4A93B 1WFQA 2I07B 1F2MA 1RIPA 1SNQA 1TS4A 4LF4L 3S2HB 2L11A 2Z4HA 4KHPL 2B8FA 3G6JB 4IUUA 4R4CA 4DUZQ 2HUGA 4A3GB 4OGQC 1H9KA 1LTAD 4C2MH 1IYVA 1VQ5A 1U4LA 4ZUJA 3PSIA 1I3QB 3SR1A 1FJGQ 3BU2A 1BKBA 1XNRL 2BDOA 1OXUA 3TZDA 3EN2A 3MEHA 5M3FH 3D0FA 4Q0FA 1SYGA 4IFDG 2K5DA 3MEFA 3UE0A 5JEAG 2NTTA 2EXDA 3E9IA 3OTOQ 2O4XA 3KUPA 1GHJA 1E2ZA 2K4KA 4ZLTF 2VB2X 3W3AA 2B2UA 2XSCA 3A8IE 1SMXA 2D5DA 4GLVB 1K3BC 3U50C 4FO2A 2EY2A 3MXNA 3H0GH 4AYBE 5I4DA 1SFOH 1GKHA 1JORA 1OXVA 3KK7A 5JJLA 1BDOA 4CJ2C 3TQYA 1X3FA 4HJ7A 1G6PA 4MHEA 4DUYL 5IYBH 3PO2G 2MUYA 3GTJB 3I2ZA 2E2JH 2F0TA 4JYAL 4UHVA 4JG2A 4LF5Q 4GN5A 2JA7H 1SYBA 1VQIA 4A3DG 4KHPQ 2F52A 5CR3A 1QNKA 4DUZL 2PI2E 4XXEA 3IL8A 3VR3A 1LACA 2H1EA 2KA7A 1VQDA 2F0EA 4LF6Q 3T16A 2N3SA 1Q86C 2F4VQ 3WDNA 1F9RA 1MJEA 5M5WB 1B2TA 1A63A 5M5WH 2ZM6L 2NVXH 2L1BA 2PQEA 1X3QA 4GKKQ 4ZUIA 2RQXA 3I4MB 2K33A 1PFBA 1S5FD 2CQOA 2G9HD 3K5OA 4FF3A 1SMYD 3M9BA 1VQLA 1WOCA 4RA8A 3STBD 4XYQA 2HDLA 1GUTA 1CFMA 2BOSA 4IPHA 1MSHA 5EAYA 3RUZA 4KK7A 1CUKA 5IWAQ 1O78A 5DNFA 1VF5C 3GTMB 4CHTB 3S2HH 4WORA 4HMJA 1JB3A 3RZDB 2OEOA 1F77A 1STNA 2LXJA 3KBGA 1HNWQ 3D6CA 1K8AC 3G7LA 1Y1VH 2E74C 4RH6A 2IJ0A 4HIMA 1SEBD 1EYDA 4HN7A 4YWMA 3TS0A 3S17B 3MHBA 1TQOA 2KENA 3OIQA 1LTBD 4I7AA 1EIYB 4PMCA 5IIFA 3QB3A 1RTOA 5IY0A 2LY7A 1JOOA 2EYOA 4RCOA 1IXRA 2AHOB 4LF6L 4O1NA 3LWEA 3MXNB 2F0NA 1VF7A 4DR4Q 3HOZG 2YU9H 2D0PA 1FNUA 1W6KA 4LFBQ 1YZ6A 4RG1A 4DV3L 4OWXB 3HOWH 2EY6A 2JJQA 1M4VA 4DNRB 1TWGB 4G7OC 2BE5C 3UDFA 1BR9A 2EQSA 1HH2P 2DY7A 2E76C 5EBDA 5CV7A 3HOYG 3CKIB 1NSNS 1S4ZA 3ERSX 4JI7Q 4HCEA 4IJLA 4I7ZC 3SK6A 1N33Q 4DR6Q 4C3HG 3OMGA 4WJ3M 3I91A 5EPKA 3ULJA 1VQJA 2TSSA 3A0JA 2JA8B 3HKZE 3H15A 1GOZA 2IPKD 4PZ6A 4DV6L 2Q2UA 1AE3A 3JAMc 1HNWL 3J80E 2YTVA 2E2HB 1JCKB 5J3BA 2NWGA 1WD0A 5M5XH 2FJ2A 1S40A 3K57A 3SK5A 1D5XC 2A68C 2LS01 4XQJA 2K7VA 1VS0A 2Z6KA 4JI0Q 3CF5A 3HS0C 2QW7A 3MA2B 1JWSD 3DM1A 4O0AA 2HQEA 4UPAA 1KAAA 4DR4L 2D9UA 1MKHA 2C5CA 1YI2A 4LFBL 3FP9A 1UE1A 4QQBX 4A3IB 1K8GA 3CRLC 2RCNA 4JI2Q 4G7HC 1V8QA 5GQOA 5AFWA 4K8JA 3V05A 4KHZA 1LABA 1HQRD 2F0WA 2J0TD 3DWPA 4G57A 2R7ZB 3K7UC 4PZ8A 3K81C 3M3YB 2PNHA 2ATWA 2CCZA 3OSOA 2A73B 1IHZA 1C0AA 4B3MQ 1V1OA 4APVA 1PH4A 5CBAE 3E0JA 2VQFQ 3J7AV 5FOBB 2IT1A 1B7YB 1K9MC 2B39A 2NN6H 3TEHB 3J7YW 1BOSA 3DEPA 1L0YB 2EY5A 1H9JA 2Z4IA 3OWFA 3PO2H 1B4OA 2BA1A 4JOIA 4KJNA 1X9NA 5FLXE 1C7YA 2QEXA 3AYHB 3CRKC 4KV6A 1Q90A 2NVYH 1S72A 2JEBI 3E6ZX 3FHWA 2N88A 2H5XA 2E2IB 1IW7C 1S3OA 2L5TA 4K6DA 5JPNC 3D4RA 1EY5A 1EWCA 3X3MA 3M7GA 2DN8A 3HRZC 4A3JH 3HKZG 1EZ6A 1SYCA 4BBSH 1YNJC 4JI2L 1K3RA 3A74A 3PIP3 4JK1C 3H6MA 3GTOH 3G4SA 1EY8A 4U673 5ELNA 3D3RA 1U9RA 1G2SA 1JE4A 1H95A 1NR2A 2R6GA 2IWHA 3KLSA 2NN6I 1GO3E 4FXKC 4UAIA 4B3ML 5IGFA 1PRTB 4L63B 2VQFL 1BCPB 5C44G 2HCIA 4NXML 1VQNA 4AYBG 2E5LQ 2KCNA 4IFDH 5IYCH 1BUVT 1EQRA 4A3BH 1E24A 1WTXA 1KHIA 3K80C 1E1TA 5IT9E 3KFUA 1TXYA 4A3MG 3BDOA 3QIAA 4BY7G 5EGTA 3GQBA 1BNZA 4BBSG 4JBJA 3J80i 1O80A 1U4RA 1OXXK 4QJFA 3TSSA 1HNXQ 2YV5A 4LF4Q 3KLRA 1Q3LA 4TRDA 5IE8A 2Q8RE 1Y1WB 2F0SA 1PRTC 5C4ZA 1EU3A 2EVBA 4YCWA 2B63H 1PV4A 4ZQ3A 3N52A 2EYPA 1B9MA 3NBHB 4AH6A 3F2DA 1DZ1A 1RODA 4GNXC 2MO0A 1JT8A 1O7ZA 4C3JG 4DR5L 3VR5A 1NMGA 1ESFA 3A7LA 3L7ZC 3MFYA 4P74A 1RJTA 1KDCA 1E22A 3TP7A 1SYDA 1Y8OB 1CQFA 5CMDA 2E5LL 5NUCA 1HNZL 4B08A 5M3MB 3AFQA 3NTKA 1CA5A 2WB1G 3LWUA 1AP0A 1IZ6A 5GROA 1N34L 2B2WA 2L0CA 2C35B 4OONA 1HTPA 5FLXL 3J7AF 4DK0A 2HIXA 1PYBA 1IYJB 4GNXB 4LF5L 2VW9A 1PZID 2Z6KC 1HNXL 1QVGA 3I56A 4HAEA 4TKOB 3I4MG 4IUNA 3CCLA 4A4IA 1KXLA 1NAPA 2LMCB 3NK9A 2K32A 1KRSA 3K7AH 2JA7G 5IYDG 1EWHA 1V1PA 1PH2A 1BF4A 2AWNA 3GP7A 2F4VL 3BDLA 1EOVA 4RFBA 4P71A 4C56C 4ZKCB 1ZKOA 4RGMA 2ZXPA 1IBLQ 1G91A 2ZM6Q 5JPMC 5M3FB 1TT2A 2R7ZG 2E8GA 1SROA 1MD2D 1ZYRC 4DGZA 4DR5Q 3A5UA 1CA6A 3EFXD 4DK6C 3J80c 4LF7L 4BY7B 3R3OA 3SDZA 2MO1A 2CHBD 3KLSX 2WINB 4NP5A 4OIKA 2NB0A 2KCCA 3GTGB 3F8TA 2B63B 1DOKA 3CD6A 2XTIA 2R3ZA 5IWAL 3BZDB 4AYBB 4HJ5A 2KBNA 3M3YH 3RLOA 2EZVA 4N8FA 1D5MC 2N49A 2PZUA 1R4QB 3I7FA 2DY8A 4IOAA 4Z9CB 5J22A 4KD3A 3NQIA 5JEAH 4A75A 2BDNA 4XDXA 3M4OH 1N34Q 4JPBW 2CH4A 3H94A 1E7ZA 4A3MH 1PTOB 3URYA 4CDCC 1CI3M 2YTXA 2K05A 5DM73 4A3FB 1A6XA 4C3IB 2F0JA 2K14A 1PH8A 1AW7A 4IALA 4C3IG 2NVQH 5C4HA 5FKAC 1Q81C 1VQOA 3CC4A 4R4IA 4JVZA 4DAVA 2JSOA 3VDYA 4UY8C 3BVMA 1V43A 5E3FA 4DV0L 2F0IA 4H13C 3UE1A 1X6OA 1QUQB 4DV3Q 5C4XB 1IBLL 2HT1A 3B6YA 3NTIA 1G291 1AH9A 5LHY1 1FGUA 2Q8IB 1S5CD 1HFGA 1NMFA 3NWSA 4LF7Q 3U58A 5I2XA 1CSQA 2CW0D 2QDLA 1HPCA 2ZJRA 2E75C 3OOCA 2Z8LA 1JE5A 4DR6L 2I46A 4L5TA 1LUZA 3GTMH 1B70B 2X69A 1R4PB 4JI6L 1L0XB 1ASZA 3S14B 3I73A 2ZTEA 3LGJA 2PQAA 5EBCA 2F0QA 3I70A 4DV6Q 1N36L 5FO8B 2UUCQ 5A35A 3IAYA 1YBYA 2F0VA 1X32A 1IL8A 3RN5A 3T1HQ 2I0QA 1LTLA 4RKLA 1LT3D 4IFDI 1B8AA 5C0XJ 4L5SA 1YJWA 5GAHC 2PCFB 2EYLA 2KECA 5ELFA 1L2FA 3PUVA 1PH1A 1EIFA 4FVMA 4DV0Q 1RHPA 4KN4C 3ERQA 4Y7NH 4JI4L 2VL6A 1JJGA 1H9RA 1X3PA 4HSVA 1WTWA 4L6TB 5GAGC 4G4KA 2O5JC 2B2UC 4GOPC 2R7ZH 3QJYA 4HR7B 2AQ1B 1A8VA 1TWCH 1XTCD 3GD7A 2I5MX 4XT1B 1QWYA 2AUKA 1QZGA 1W6JA 2ZXRA 1ILQA 1GUWA 4DR2L 1UNSA 1SJHD 3PGZA 1KLUD 4JI6Q 1DCZA 4FP5D 2K04A 2NVQB 1GD7A 1VQKA 4A3FG 3WWVA 1RDPD 3PUWA 4DKAC 3G48A 3J81i 2RDGA 1N36Q 2UUCL 1CHPD 2NVXB 1UEAB 2OF1A 4KLKA 1D8LA 3PO2B 1F9SA 2D62A 1HZCA 4OO1H 2A6EC 2PZTA 2M00A 3TBIB 1STGA 2GA4B 3T1HL 3VYTA 2VZAA 3NENA 4C1NI 4ZK9B 1EWIA 3K0YA 2JA8G 5AJ3Q 2D2CC 1K83B 1LM0A 3K59A 3M4YA 2E2HH 2F03A 5LL6X 4OX9L 1E2WA 1EYGA 1D2BA 3HOXG 2RDHA 5EKKA 4A3BG 2A6ED 1EUJA 4JI5L 4EQOA 1V9PA 1HZBA 4MTNA 1A3UA 1BBXC 3J7A5 2NTSA 4X3TA 4KJOA 2SNMA 4JI4Q 2QDBA 4JCVE 1SNCA 1KC8C 1CM9A 1LO5D 3S16H 1X3EA 3N6RA 4FF1A 1WTHA 4IJHA 3Q8DA 1ET6A 2B29A 5FK9C 1PTOF 1VMCA 2JE6I 5FO7B 2ENBA 2ES2A 3S1MH 5EQ0A 1CSPA 1D5ZC 3R2TA 1WTPA 4X3UA 1YIJA 3DEOA 4JI8Q 3HOUB 3GTLH 3KBXA 5JOBA 2OCEA 3W1GA 3H09A 5ELCA 4XT3B 4ODGA 2YU9B 1EQQA 3BJUA 1GJXA 3OPOA 4NXMQ 2A74C 3G6EA 1WCMG 1LT5D 1D7QA 2ZJQA 3CPFA 2FINB 4MN3A 3NTHA 3A54A 1F2ZA 4BXXH 5K36H 1XPOA 1T9HA 3EQLC 3HOYH 3W5OA 4QIWB 1TWFH 4PG3A 3P7JA 2PMZB 1S5ED 1IKLA 4DAYA 1I94Q 4OX9Q 3T53B 1X55A 5KGUA 1J8IA 1OO9B 5IYCG 1A2TA 4JBWA 1O7YA 4OO1I 2NN6G 4XTCS 3PUYA 5LMNW 1SXTA 1MJCA 1AE2A 2JN4A 4KTAA 4LW1A 1RD9D 4LFCQ 2EYHA 4C3HH 3ND8A 4CDDC 5HGQA 4BS9A 2XGTA 1M8AA 4DR7L 4A3DH 1BCPC 4QUFA 2PW5A 5C6AA 1O7IA 1KDAA 1B1ZA 3FPUB 3GO5A 3RMHA 2AQ3B 5IYBG 4JBKA 4FYDA 1TY0A 1ZXTA 2ALYB 3S9WA 2XRQD 2NUCA 2JA5G 2IW3A 5E4XA 3NUCA 4LAAA 2JQOA 1IW7D 1XMOL 1ILPA 1LT6D 3BZKA 5K36G 3UDIA 2GN5A 4EGVA 1JOKA 1HNZQ 2F0PA 1R9TB 4ZKBB 3A8KE 4A3EH 4C3JH 1K8OA 4IZ8A 3GTGH 1T5EA 4X62Q 3I4NG 2XNAC 5KEEA 2QF7A 2GVAA 4IO9A 4KY5A 2IX0A 3K6OA 3K8AA 2NVTH 2L9HA 5BR8L 1SE8A 1CZWA 2AUJD 1HR0W 3HG9A 3I4NH 1QILA 4LUOA 3MFGA 3AEVA 2KCTA 4KD4A 4GNXA 4CBVA 3HZXA 3R2IA 4DR7Q 2EY1A 5C44H 2Q2IA 4POFA 5JEAJ
chains in the Genus database with same CATH topology
5C3EG 4R4TA 3KJOA 5IYCH 1KAWA 1EQRA 4KI0A 1WI5A 4A3BH 1E24A 1YNXA 2Z0SA 3HOXH 1KHIA 3K80C 1E1TA 2OQ0A 3I4OA 4R4OA 4YY3L 2BH2A 4X66L 3KFUA 1J5EL 1IBKL 2WP8J 1TXYA 4A3MG 1PVOA 4JOIC 3CCEA 3UDXA 4BY7G 4TQUS 4EQ5A 2AWOA 4DR1Q 4A3IG 1QVFA 1I5FA 3CPWA 1XMOQ 2A8VA 1VCIA 2K5NA 1XJVA 3HOWG 4BBSG 2DUDA 4BBRG 4A3CG 4JBJA 5M5YH 3GTJH 4DV2L 3PUZA 3KYHC 3J80i 1EFWA 2K50A 2UXDQ 4LFAQ 3U4VA 1Q7YC 1Q46A 4GKJQ 1PHJA 1WJJA 1OXXK 3GTPH 4QJFA 1HNXQ 2YV5A 4LF4Q 4A3GG 3PIOA 1JB7A 3PUXA 1VQGA 2I5LX 5IE8A 2UXCQ 4L5QA 4B3SQ 3HFZB 1FL0A 1P16A 2BA0A 2ID0A 1VQPA 4YCWA 4X62L 2ASBA 2B63H 1PV4A 4X64L 4AQYQ 4A93H 2Y0SG 5LMUQ 4P72A 2OTLA 2JA5H 3M7NA 1X56A 1HZ9A 3S1RH 3NBHB 4AH6A 4DPGA 3F2DA 1UE7A 5BR8Q 3CCSA 4LF9Q 4X65Q 1KIXA 4GNXC 1VQ9A 2MO0A 1JT8A 4GLXA 1Y1WG 4DR5L 5C3EH 4L5RC 1KL9A 1NMGA 4ME3A 1W3SA 4JI1L 3L7ZC 4P74A 3S17H 3K0XA 5C4XG 4NB3A 1WCMH 1I3QH 1E22A 3EIVA 2E5LL 5HY6A 2YYZA 2RHSB 4IPGA 1HNZL 2AMCB 2N8NA 4B3TL 1XNQL 4A3GH 1CKMA 3RNUA 3RZDH 3AFQA 3S14H 4IPDA 4HJAA 2WB1G 4LF8L 1XMQQ 3CCRA 4J15A 2FXQA 1VQBA 1IZ6A 5GROA 3M4PA 4LUVA 1N34L 1GM5A 3TREA 1J6QA 4BY1H 5IP7H 1KD1C 4A3IH 2C35B 2IY5B 1NTGA 4OONA 4GOPA 1JJ2A 2F3IA 2UXDL 1I6HH 1QVCA 1PH7A 2HIXA 1L1OA 4UP9A 1PYBA 1IYJB 4GNXB 4LF5L 2VW9A 2Z6KC 3M85A 1HNXL 3EBEA 3GDEA 4NXNL 2MQHA 2K5VA 3I56A 4HIOA 1QVGA 3I4MG 1L1OC 1M1KC 2HIVA 3CCLA 4A4IA 1KXLA 1X54A 4QGUA 1PH3A 3CXCA 4MZ9A 3J7ZC 2E2IH 3J81c 4B3SL 3H3VH 2UXBQ 2D0OA 3BZCA 1KRSA 2CWAA 1XPRA 1VQAA 3ULLA 3K7AH 4OWWB 1Q82C 4X64Q 5IYDG 4AQYL 3PCOB 2JA7G 3E9HA 3CW2C 1YVCA 1PH2A 2UU9Q 3D31A 2AWNA 3RR5A 2UUBQ 2F4VL 1EOVA 4XIGS 4P71A 2VUMH 1IBLQ 2ZM6Q 1K0RA 1NY4A 2MNAA 2R7ZG 2NZHA 2E8GA 1SROA 1IBKQ 4GLAC 2QA4A 3HOVG 4OXPA 5GADC 3A5UA 4DR5Q 3IRBA 3H0GG 4BXXG 4DK6C 4LF7L 3J80c 3JC66 4GN3B 1UE5A 1Q12A 4DUYQ 4DV2Q 2MO1A 2WAQE 1Q8KA 4A3JG 4JI3Q 4MNOA 5IT9c 3KF8B 2B63G 3U4ZA 1WFQA 1YHBA 3F8TA 1RIPA 4LF4L 3CD6A 2XTIA 5IWAL 4B3TQ 2JA9A 4KHPL 4HJ5A 4R4CA 2KBNA 1XNQQ 4DUZQ 3M3YH 1BBWA 1E3PA 3RLOA 2JEAI 2UXCL 4UP7A 2N49A 1KQSA 3I7FA 2HHHQ 5FJ8H 4IOAA 4B3RQ 4IFDJ 4C2MH 5C0XI 1A0IA 4A75A 3PO3H 1VQ5A 3M4OH 1N34Q 4JBMA 3PSIA 4BBRH 1X3GA 1E7ZA 3BU2A 1BKBA 5H1SE 5LMUL 4DV4L 4A3MH 1CKNB 3ER0A 1Y14B 4DV7Q 1XNRL 2NZOA 4O2DA 1IBML 1OXUA 3EN2A 4PZ7A 2V1CC 1UWVA 1VQCA 3OYYA 4DR2Q 5C4JH 5IP9G 5M3FH 3D0FA 2YTXA 1TWAH 4NXNQ 1L1OB 4IFDG 3DM3A 4X65L 3MEFA 2ZTDA 3UE0A 5JEAG 2BH8A 1U5KA 2EXDA 1PH8A 2K14A 3E9IA 2CKZB 2JK8A 3OTOQ 3KOJA 2NVQH 3S2DH 2HQLA 1Q81C 2K4KA 1VQOA 4R4QA 4A3EG 3AQQA 4R4IA 4P73A 3CC4A 4JI1Q 1PH9A 3PIPA 3CMEA 3VDYA 4UY8C 1V43A 4DV0L 2VQEQ 1Q1BA 1SMXA 2UU9L 3UE1A 4GLVB 3AFPA 3U50C 1X6OA 1QUQB 4LNQA 1N8RC 3HOUH 4DV3Q 2VS1A 1XPUA 1IBLL 3T1YQ 4DV5Q 2HT1A 3H0GH 3B6YA 4AYBE 3OW2A 1SFOH 1G291 1Y1WH 1GKHA 4YWLA 3RN2A 4LF8Q 1FGUA 1AH9A 5M3MG 5AJ3L 1OXVA 5JJLA 1NMFA 3TQYA 3JAMi 1X3FA 1ASYA 4LF7Q 3U58A 2KHJA 2OQKA 4HJ7A 4JI5Q 1CSQA 1G6PA 4DUYL 5IYBH 3HOUG 3PO2G 4JC0A 2VNUD 2WAQG 2ZJRA 3I2ZA 2K75A 2E2JH 2CFMA 4JYAL 4JG2A 4LF5Q 4GN5A 1JE5A 2JA7H 4DR6L 3E0EA 1VQIA 2ZTCA 1WYDA 4L5TA 4A3DG 4KHPQ 1LUZA 2F52A 3GTMH 1B70B 4DUZL 2PI2E 4JI6L 3KLWA 4GN4B 5GAEC 1ASZA 2R7FA 1KRTA 2UXBL 4LFBL 2Q2HA 2ZTEA 1VQDA 3KDFA 4B3RL 1DGSA 3LGJA 4LF6Q 2PQAA 1NJIC 3TRZA 2WB1E 4DV6Q 1Y1VG 1YHAA 4HJ9A 4DAYB 1N36L 2N3SA 5C0XG 2UUCQ 4PMWA 4DV4Q 1Q86C 2KHIA 1PYSB 1YBYA 2UUBL 2F4VQ 1IBMQ 5LMNL 1MJEA 3CAMA 1MIUA 1A63A 1CKNA 4X6AH 5M5WH 4JI8L 3F2BA 2ZM6L 3RN5A 3T1HQ 4A3KH 3I55A 4Y52H 2NVXH 2I0QA 1LTLA 4YHHQ 1VQ4A 4GKKQ 3PF5A 2UUAL 3M4QA 5JJKA 5FJ8G 4IFDI 1B8AA 1N32L 5C0XJ 3ZJYC 4L5SA 1YJWA 5GAHC 3CC7A 2CQOA 4A3FH 3KJPA 3CCQA 1L2FA 3PUVA 3M9BA 5IYDH 1PH1A 1EIFA 1VQLA 4JI3L 1WOCA 4QY7A 3STBD 2EIFA 3RLFA 4DV0Q 1PA6A 4IPHA 1JJGA 4Y7NH 4JI4L 2VL6A 5EAYA 2L15A 4IOCA 1CUKA 5IWAQ 4R1JA 1OTCA 3NEMA 3CCMA 4DV5L 2RHQB 2K5HA 5GAGC 2JA6G 3S2HH 2R92H 1Z47A 2HHHL 5M3FG 4H02A 3ULPA 1I94L 2LXJA 4GOPC 2R7ZH 4JV5Q 1HNWQ 1FJGL 2I5MX 1A8VA 1TWCH 1SN8A 3GD7A 3W1BA 1Y1VH 4YCVA 4DV7L 1K8AC 3SGIA 2A1AA 1HR0Q 1VQNA 1XNRQ 1QZGA 4K0KQ 4HIMA 4DR2L 4YWMA 3HKSA 3TS0A 1OXTA 4A93G 4YWKA 4A76A 2KENA 3PGZA 1K83H 1E1OA 4LFCL 1EIYB 4JI6Q 3TS2A 2YTYA 5IY0A 3OTOL 4POGA 1GD7A 1IXRA 2AHOB 4DR3L 4LF6L 1VQKA 4A3FG 3WWVA 3PUWA 4DKAC 3G48A 3MXNB 4BA1I 4POFA 3J81i 1N36Q 4A3LH 2UUCL 4DR4Q 4KLKA 3HOZG 2VQEL 2YU9H 2D0PA 1D8LA 2MFIA 2VY3A 4LFBQ 1YZ6A 5LMNQ 2D62A 4RG1A 1HZCA 5IP9H 1L0WA 4DV3L 4OWXB 2LXKA 4A3CH 3HOWH 2JJQA 2QGQA 3T1YL 3T1HL 1C0AA 2VZAA 3NENA 1GVPA 1EWIA 4YHHL 2JA8G 5AJ3Q 3UDFA 2UUAQ 2EQSA 1HH2P 2R7DA 5E7NA 2LSSA 2VUMG 1LM0A 4DV1L 2E2HH 3HOYG 2PMZE 4OX9L 1SR3A 1EYGA 3GTKH 3UDGA 3HOXG 2GVBA 2K52A 4A3BG 1EUJA 4JI5L 3CCUA 3ERSX 4JI7Q 2R92G 1V9PA 1HZBA 4MTNA 4IJLA 1TWHH 1RL2A 2A19A 3J7A5 1G51A 2PI2A 3A5ZB 4OWTB 3PO3G 1LYLA 1Q1EA 4JYAQ 3CCJA 1N33Q 4JI4Q 4DR6Q 1P8LA 2B3GA 4JCVE 1KC8C 4WJ3M 3S16H 3ULJA 1X3EA 1VQJA 3A0JA 3HKZE 3H15A 1SRUA 4IJHA 3Q8DA 1PFSA 1CKOA 2B29A 4PZ6A 4DV6L 2Q2UA 1AE3A 3S1MH 2JE6I 3JAMc 1HNWL 2ES2A 2I5HA 3G71A 1CSPA 2YTVA 1QUQA 5IP7G 4BY1G 5J3BA 1YITA 1SLJA 1PH6A 5M5XH 4K0KL 2ZJPA 1YIJA 4BY7H 4RMFA 3HOVH 3CP0A 1S40A 4JI8Q 3GTQH 4TVAB 3J81j 3GTLH 4OO1G 2IHEA 4HIKA 1YHQA 2OCEA 1VS0A 2Z6KA 1W2BA 4JI0Q 3W1GA 4GKKL 3CF5A 1N32Q 5JEAJ 3CQZH 1EQQA 3BJUA 4NXMQ 1NBWA 4O0AA 4UPAA 4DR3Q 3RZOH 3G6EA 1WCMG 3FKIG 1FVIA 3CCVA 1D7QA 5DLQE 4C3IH 1U0LA 2ZJQA 2PQAB 2KCMA 3CPFA 4DR4L 3STBC 1VQFA 1MKHA 1UE6A 3F2CA 4YY3Q 1YI2A 1YEZA 1VQ8A 3PF4A 4BXXH 3FP9A 3KDFB 1J5EQ 1XPOA 2IX1A 4P75A 1T9HA 5FLXc 1UE1A 4QQBX 3L0OA 3HOYH 3W5OA 1K8GA 1V1QA 1TWFH 4PG3A 4DR1L 2RCNA 4JI2Q 2JA8H 5GQOA 1I94Q 4A3KG 4OX9Q 4KHZA 1X55A 4JV5L 3K7UC 4GS3A 4PZ8A 5IYCG 3K81C 4JBWA 4OO1I 1HR0L 2NN6G 4XTCS 3PUYA 2PNHA 4YCUA 3S1QH 2ATWA 2CCZA 5LMNW 3NELA 4A3LG 1N9WA 2WFWA 1MJCA 1AE2A 3CC2A 4LW1A 4LFCQ 4B3MQ 1FJGQ 4C3HH 5HGQA 2IHFA 4APVA 3I4MH 1PH4A 3KF6B 5JJIA 4EX5A 2XGTA 2VQFQ 2IT1A 1B7YB 4DR7L 4A3DH 5C4XH 1K9MC 4AIMA 1BBUA 3TEHB 1K73C 2N78A 1O7IA 2R93H 3GO5A 3CMAA 3PV0A 4IPCA 1VQ6A 3PO2H 4X66Q 5IYBG 4JBKA 4LF9L 4LWCA 3ICEA 4HIDA 4DAMA 2ALYB 2BA1A 4FDBA 4JOIA 4QL5A 5FLMG 1VQ7A 1X9NA 1C7YA 2JA5G 2QEXA 3AYHB 2JQOA 2OWOA 1XMOL 3S15H 2NVYH 3BZKA 1S72A 2JEBI 4DV1Q 5K36G 4HJ8A 2JA6H 3UDIA 3FHWA 4LFAL 2GN5A 2H5XA 4NPSA 4GKJL 1C9OA 4JI7L 1QZHA 1S3OA 3FKIH 4QIWE 1YJ9A 1HNZQ 2Q2TA 1N33L 4LUZA 5ELOA 1R9TH 4A3EH 4C3JH 1XMQL 3GTGH 3I4NG 4X62Q 3S1NH 2Y0SE 4A3JH 3HKZG 1VQEA 1JJCB 5FLMH 4BBSH 4JI2L 1K3RA 3A74A 5M3MH 2RF4A 2GVAA 1PH5A 1A62A 4IO9A 1UEBA 1Z9FA 2IX0A 1IL2A 4DK3C 4GOPB 4BA2I 1HZAA 3K8AA 2NVTH 3GTOH 1VQHA 3G4SA 3DLLA 2R93G 5BR8L 1SE8A 3S24A 5ELNA 1HR0W 3L2PA 4DNIA 3I4NH 3HOZH 2AKWB 1OXSC 1VQMA 1HJPA 3F1ZA 4LUOA 1M90C 4ALPA 1H95A 1TWGH 1YJNA 2KCTA 3AEVA 2R6GA 4GNXA 4JI0L 4UP8A 4WJ4A 2NN6I 1GO3E 4B3ML 2OTJA 1XTDA 3RLNA 3H3VI 1I50H 1X65A 2VQFL 1BVSA 1JMCA 5C44G 2CWPA 4DR7Q 3KF6A 2DGYA 4NXML 5C44H 2Q2IA 4AYBG 1NE3A 2E5LQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3E G;  4R4T A;  3KJO A;  5IYC H;  1KAW A;  1EQR A;  4KI0 A;  1WI5 A;  4A3B H;  1E24 A;  1YNX A;  2Z0S A;  3HOX H;  1KHI A;  3K80 C;  1E1T A;  2OQ0 A;  3I4O A;  4R4O A;  4YY3 L;  2BH2 A;  4X66 L;  3KFU A;  1J5E L;  1IBK L;  2WP8 J;  1TXY A;  4A3M G;  1PVO A;  4JOI C;  3CCE A;  3UDX A;  4BY7 G;  4TQU S;  4EQ5 A;  2AWO A;  4DR1 Q;  4A3I G;  1QVF A;  1I5F A;  3CPW A;  1XMO Q;  2A8V A;  1VCI A;  2K5N A;  1XJV A;  3HOW G;  4BBS G;  2DUD A;  4BBR G;  4A3C G;  4JBJ A;  5M5Y H;  3GTJ H;  4DV2 L;  3PUZ A;  3KYH C;  3J80 i;  1EFW A;  2K50 A;  2UXD Q;  4LFA Q;  3U4V A;  1Q7Y C;  1Q46 A;  4GKJ Q;  1PHJ A;  1WJJ A;  1OXX K;  3GTP H;  4QJF A;  1HNX Q;  2YV5 A;  4LF4 Q;  4A3G G;  3PIO A;  1JB7 A;  3PUX A;  1VQG A;  2I5L X;  5IE8 A;  2UXC Q;  4L5Q A;  4B3S Q;  3HFZ B;  1FL0 A;  1P16 A;  2BA0 A;  2ID0 A;  1VQP A;  4YCW A;  4X62 L;  2ASB A;  2B63 H;  1PV4 A;  4X64 L;  4AQY Q;  4A93 H;  2Y0S G;  5LMU Q;  4P72 A;  2OTL A;  2JA5 H;  3M7N A;  1X56 A;  1HZ9 A;  3S1R H;  3NBH B;  4AH6 A;  4DPG A;  3F2D A;  1UE7 A;  5BR8 Q;  3CCS A;  4LF9 Q;  4X65 Q;  1KIX A;  4GNX C;  1VQ9 A;  2MO0 A;  1JT8 A;  4GLX A;  1Y1W G;  4DR5 L;  5C3E H;  4L5R C;  1KL9 A;  1NMG A;  4ME3 A;  1W3S A;  4JI1 L;  3L7Z C;  4P74 A;  3S17 H;  3K0X A;  5C4X G;  4NB3 A;  1WCM H;  1I3Q H;  1E22 A;  3EIV A;  2E5L L;  5HY6 A;  2YYZ A;  2RHS B;  4IPG A;  1HNZ L;  2AMC B;  2N8N A;  4B3T L;  1XNQ L;  4A3G H;  1CKM A;  3RNU A;  3RZD H;  3AFQ A;  3S14 H;  4IPD A;  4HJA A;  2WB1 G;  4LF8 L;  1XMQ Q;  3CCR A;  4J15 A;  2FXQ A;  1VQB A;  1IZ6 A;  5GRO A;  3M4P A;  4LUV A;  1N34 L;  1GM5 A;  3TRE A;  1J6Q A;  4BY1 H;  5IP7 H;  1KD1 C;  4A3I H;  2C35 B;  2IY5 B;  1NTG A;  4OON A;  4GOP A;  1JJ2 A;  2F3I A;  2UXD L;  1I6H H;  1QVC A;  1PH7 A;  2HIX A;  1L1O A;  4UP9 A;  1PYB A;  1IYJ B;  4GNX B;  4LF5 L;  2VW9 A;  2Z6K C;  3M85 A;  1HNX L;  3EBE A;  3GDE A;  4NXN L;  2MQH A;  2K5V A;  3I56 A;  4HIO A;  1QVG A;  3I4M G;  1L1O C;  1M1K C;  2HIV A;  3CCL A;  4A4I A;  1KXL A;  1X54 A;  4QGU A;  1PH3 A;  3CXC A;  4MZ9 A;  3J7Z C;  2E2I H;  3J81 c;  4B3S L;  3H3V H;  2UXB Q;  2D0O A;  3BZC A;  1KRS A;  2CWA A;  1XPR A;  1VQA A;  3ULL A;  3K7A H;  4OWW B;  1Q82 C;  4X64 Q;  5IYD G;  4AQY L;  3PCO B;  2JA7 G;  3E9H A;  3CW2 C;  1YVC A;  1PH2 A;  2UU9 Q;  3D31 A;  2AWN A;  3RR5 A;  2UUB Q;  2F4V L;  1EOV A;  4XIG S;  4P71 A;  2VUM H;  1IBL Q;  2ZM6 Q;  1K0R A;  1NY4 A;  2MNA A;  2R7Z G;  2NZH A;  2E8G A;  1SRO A;  1IBK Q;  4GLA C;  2QA4 A;  3HOV G;  4OXP A;  5GAD C;  3A5U A;  4DR5 Q;  3IRB A;  3H0G G;  4BXX G;  4DK6 C;  4LF7 L;  3J80 c;  3JC6 6;  4GN3 B;  1UE5 A;  1Q12 A;  4DUY Q;  4DV2 Q;  2MO1 A;  2WAQ E;  1Q8K A;  4A3J G;  4JI3 Q;  4MNO A;  5IT9 c;  3KF8 B;  2B63 G;  3U4Z A;  1WFQ A;  1YHB A;  3F8T A;  1RIP A;  4LF4 L;  3CD6 A;  2XTI A;  5IWA L;  4B3T Q;  2JA9 A;  4KHP L;  4HJ5 A;  4R4C A;  2KBN A;  1XNQ Q;  4DUZ Q;  3M3Y H;  1BBW A;  1E3P A;  3RLO A;  2JEA I;  2UXC L;  4UP7 A;  2N49 A;  1KQS A;  3I7F A;  2HHH Q;  5FJ8 H;  4IOA A;  4B3R Q;  4IFD J;  4C2M H;  5C0X I;  1A0I A;  4A75 A;  3PO3 H;  1VQ5 A;  3M4O H;  1N34 Q;  4JBM A;  3PSI A;  4BBR H;  1X3G A;  1E7Z A;  3BU2 A;  1BKB A;  5H1S E;  5LMU L;  4DV4 L;  4A3M H;  1CKN B;  3ER0 A;  1Y14 B;  4DV7 Q;  1XNR L;  2NZO A;  4O2D A;  1IBM L;  1OXU A;  3EN2 A;  4PZ7 A;  2V1C C;  1UWV A;  1VQC A;  3OYY A;  4DR2 Q;  5C4J H;  5IP9 G;  5M3F H;  3D0F A;  2YTX A;  1TWA H;  4NXN Q;  1L1O B;  4IFD G;  3DM3 A;  4X65 L;  3MEF A;  2ZTD A;  3UE0 A;  5JEA G;  2BH8 A;  1U5K A;  2EXD A;  1PH8 A;  2K14 A;  3E9I A;  2CKZ B;  2JK8 A;  3OTO Q;  3KOJ A;  2NVQ H;  3S2D H;  2HQL A;  1Q81 C;  2K4K A;  1VQO A;  4R4Q A;  4A3E G;  3AQQ A;  4R4I A;  4P73 A;  3CC4 A;  4JI1 Q;  1PH9 A;  3PIP A;  3CME A;  3VDY A;  4UY8 C;  1V43 A;  4DV0 L;  2VQE Q;  1Q1B A;  1SMX A;  2UU9 L;  3UE1 A;  4GLV B;  3AFP A;  3U50 C;  1X6O A;  1QUQ B;  4LNQ A;  1N8R C;  3HOU H;  4DV3 Q;  2VS1 A;  1XPU A;  1IBL L;  3T1Y Q;  4DV5 Q;  2HT1 A;  3H0G H;  3B6Y A;  4AYB E;  3OW2 A;  1SFO H;  1G29 1;  1Y1W H;  1GKH A;  4YWL A;  3RN2 A;  4LF8 Q;  1FGU A;  1AH9 A;  5M3M G;  5AJ3 L;  1OXV A;  5JJL A;  1NMF A;  3TQY A;  3JAM i;  1X3F A;  1ASY A;  4LF7 Q;  3U58 A;  2KHJ A;  2OQK A;  4HJ7 A;  4JI5 Q;  1CSQ A;  1G6P A;  4DUY L;  5IYB H;  3HOU G;  3PO2 G;  4JC0 A;  2VNU D;  2WAQ G;  2ZJR A;  3I2Z A;  2K75 A;  2E2J H;  2CFM A;  4JYA L;  4JG2 A;  4LF5 Q;  4GN5 A;  1JE5 A;  2JA7 H;  4DR6 L;  3E0E A;  1VQI A;  2ZTC A;  1WYD A;  4L5T A;  4A3D G;  4KHP Q;  1LUZ A;  2F52 A;  3GTM H;  1B70 B;  4DUZ L;  2PI2 E;  4JI6 L;  3KLW A;  4GN4 B;  5GAE C;  1ASZ A;  2R7F A;  1KRT A;  2UXB L;  4LFB L;  2Q2H A;  2ZTE A;  1VQD A;  3KDF A;  4B3R L;  1DGS A;  3LGJ A;  4LF6 Q;  2PQA A;  1NJI C;  3TRZ A;  2WB1 E;  4DV6 Q;  1Y1V G;  1YHA A;  4HJ9 A;  4DAY B;  1N36 L;  2N3S A;  5C0X G;  2UUC Q;  4PMW A;  4DV4 Q;  1Q86 C;  2KHI A;  1PYS B;  1YBY A;  2UUB L;  2F4V Q;  1IBM Q;  5LMN L;  1MJE A;  3CAM A;  1MIU A;  1A63 A;  1CKN A;  4X6A H;  5M5W H;  4JI8 L;  3F2B A;  2ZM6 L;  3RN5 A;  3T1H Q;  4A3K H;  3I55 A;  4Y52 H;  2NVX H;  2I0Q A;  1LTL A;  4YHH Q;  1VQ4 A;  4GKK Q;  3PF5 A;  2UUA L;  3M4Q A;  5JJK A;  5FJ8 G;  4IFD I;  1B8A A;  1N32 L;  5C0X J;  3ZJY C;  4L5S A;  1YJW A;  5GAH C;  3CC7 A;  2CQO A;  4A3F H;  3KJP A;  3CCQ A;  1L2F A;  3PUV A;  3M9B A;  5IYD H;  1PH1 A;  1EIF A;  1VQL A;  4JI3 L;  1WOC A;  4QY7 A;  3STB D;  2EIF A;  3RLF A;  4DV0 Q;  1PA6 A;  4IPH A;  1JJG A;  4Y7N H;  4JI4 L;  2VL6 A;  5EAY A;  2L15 A;  4IOC A;  1CUK A;  5IWA Q;  4R1J A;  1OTC A;  3NEM A;  3CCM A;  4DV5 L;  2RHQ B;  2K5H A;  5GAG C;  2JA6 G;  3S2H H;  2R92 H;  1Z47 A;  2HHH L;  5M3F G;  4H02 A;  3ULP A;  1I94 L;  2LXJ A;  4GOP C;  2R7Z H;  4JV5 Q;  1HNW Q;  1FJG L;  2I5M X;  1A8V A;  1TWC H;  1SN8 A;  3GD7 A;  3W1B A;  1Y1V H;  4YCV A;  4DV7 L;  1K8A C;  3SGI A;  2A1A A;  1HR0 Q;  1VQN A;  1XNR Q;  1QZG A;  4K0K Q;  4HIM A;  4DR2 L;  4YWM A;  3HKS A;  3TS0 A;  1OXT A;  4A93 G;  4YWK A;  4A76 A;  2KEN A;  3PGZ A;  1K83 H;  1E1O A;  4LFC L;  1EIY B;  4JI6 Q;  3TS2 A;  2YTY A;  5IY0 A;  3OTO L;  4POG A;  1GD7 A;  1IXR A;  2AHO B;  4DR3 L;  4LF6 L;  1VQK A;  4A3F G;  3WWV A;  3PUW A;  4DKA C;  3G48 A;  3MXN B;  4BA1 I;  4POF A;  3J81 i;  1N36 Q;  4A3L H;  2UUC L;  4DR4 Q;  4KLK A;  3HOZ G;  2VQE L;  2YU9 H;  2D0P A;  1D8L A;  2MFI A;  2VY3 A;  4LFB Q;  1YZ6 A;  5LMN Q;  2D62 A;  4RG1 A;  1HZC A;  5IP9 H;  1L0W A;  4DV3 L;  4OWX B;  2LXK A;  4A3C H;  3HOW H;  2JJQ A;  2QGQ A;  3T1Y L;  3T1H L;  1C0A A;  2VZA A;  3NEN A;  1GVP A;  1EWI A;  4YHH L;  2JA8 G;  5AJ3 Q;  3UDF A;  2UUA Q;  2EQS A;  1HH2 P;  2R7D A;  5E7N A;  2LSS A;  2VUM G;  1LM0 A;  4DV1 L;  2E2H H;  3HOY G;  2PMZ E;  4OX9 L;  1SR3 A;  1EYG A;  3GTK H;  3UDG A;  3HOX G;  2GVB A;  2K52 A;  4A3B G;  1EUJ A;  4JI5 L;  3CCU A;  3ERS X;  4JI7 Q;  2R92 G;  1V9P A;  1HZB A;  4MTN A;  4IJL A;  1TWH H;  1RL2 A;  2A19 A;  3J7A 5;  1G51 A;  2PI2 A;  3A5Z B;  4OWT B;  3PO3 G;  1LYL A;  1Q1E A;  4JYA Q;  3CCJ A;  1N33 Q;  4JI4 Q;  4DR6 Q;  1P8L A;  2B3G A;  4JCV E;  1KC8 C;  4WJ3 M;  3S16 H;  3ULJ A;  1X3E A;  1VQJ A;  3A0J A;  3HKZ E;  3H15 A;  1SRU A;  4IJH A;  3Q8D A;  1PFS A;  1CKO A;  2B29 A;  4PZ6 A;  4DV6 L;  2Q2U A;  1AE3 A;  3S1M H;  2JE6 I;  3JAM c;  1HNW L;  2ES2 A;  2I5H A;  3G71 A;  1CSP A;  2YTV A;  1QUQ A;  5IP7 G;  4BY1 G;  5J3B A;  1YIT A;  1SLJ A;  1PH6 A;  5M5X H;  4K0K L;  2ZJP A;  1YIJ A;  4BY7 H;  4RMF A;  3HOV H;  3CP0 A;  1S40 A;  4JI8 Q;  3GTQ H;  4TVA B;  3J81 j;  3GTL H;  4OO1 G;  2IHE A;  4HIK A;  1YHQ A;  2OCE A;  1VS0 A;  2Z6K A;  1W2B A;  4JI0 Q;  3W1G A;  4GKK L;  3CF5 A;  1N32 Q;  5JEA J;  3CQZ H;  1EQQ A;  3BJU A;  4NXM Q;  1NBW A;  4O0A A;  4UPA A;  4DR3 Q;  3RZO H;  3G6E A;  1WCM G;  3FKI G;  1FVI A;  3CCV A;  1D7Q A;  5DLQ E;  4C3I H;  1U0L A;  2ZJQ A;  2PQA B;  2KCM A;  3CPF A;  4DR4 L;  3STB C;  1VQF A;  1MKH A;  1UE6 A;  3F2C A;  4YY3 Q;  1YI2 A;  1YEZ A;  1VQ8 A;  3PF4 A;  4BXX H;  3FP9 A;  3KDF B;  1J5E Q;  1XPO A;  2IX1 A;  4P75 A;  1T9H A;  5FLX c;  1UE1 A;  4QQB X;  3L0O A;  3HOY H;  3W5O A;  1K8G A;  1V1Q A;  1TWF H;  4PG3 A;  4DR1 L;  2RCN A;  4JI2 Q;  2JA8 H;  5GQO A;  1I94 Q;  4A3K G;  4OX9 Q;  4KHZ A;  1X55 A;  4JV5 L;  3K7U C;  4GS3 A;  4PZ8 A;  5IYC G;  3K81 C;  4JBW A;  4OO1 I;  1HR0 L;  2NN6 G;  4XTC S;  3PUY A;  2PNH A;  4YCU A;  3S1Q H;  2ATW A;  2CCZ A;  5LMN W;  3NEL A;  4A3L G;  1N9W A;  2WFW A;  1MJC A;  1AE2 A;  3CC2 A;  4LW1 A;  4LFC Q;  4B3M Q;  1FJG Q;  4C3H H;  5HGQ A;  2IHF A;  4APV A;  3I4M H;  1PH4 A;  3KF6 B;  5JJI A;  4EX5 A;  2XGT A;  2VQF Q;  2IT1 A;  1B7Y B;  4DR7 L;  4A3D H;  5C4X H;  1K9M C;  4AIM A;  1BBU A;  3TEH B;  1K73 C;  2N78 A;  1O7I A;  2R93 H;  3GO5 A;  3CMA A;  3PV0 A;  4IPC A;  1VQ6 A;  3PO2 H;  4X66 Q;  5IYB G;  4JBK A;  4LF9 L;  4LWC A;  3ICE A;  4HID A;  4DAM A;  2ALY B;  2BA1 A;  4FDB A;  4JOI A;  4QL5 A;  5FLM G;  1VQ7 A;  1X9N A;  1C7Y A;  2JA5 G;  2QEX A;  3AYH B;  2JQO A;  2OWO A;  1XMO L;  3S15 H;  2NVY H;  3BZK A;  1S72 A;  2JEB I;  4DV1 Q;  5K36 G;  4HJ8 A;  2JA6 H;  3UDI A;  3FHW A;  4LFA L;  2GN5 A;  2H5X A;  4NPS A;  4GKJ L;  1C9O A;  4JI7 L;  1QZH A;  1S3O A;  3FKI H;  4QIW E;  1YJ9 A;  1HNZ Q;  2Q2T A;  1N33 L;  4LUZ A;  5ELO A;  1R9T H;  4A3E H;  4C3J H;  1XMQ L;  3GTG H;  3I4N G;  4X62 Q;  3S1N H;  2Y0S E;  4A3J H;  3HKZ G;  1VQE A;  1JJC B;  5FLM H;  4BBS H;  4JI2 L;  1K3R A;  3A74 A;  5M3M H;  2RF4 A;  2GVA A;  1PH5 A;  1A62 A;  4IO9 A;  1UEB A;  1Z9F A;  2IX0 A;  1IL2 A;  4DK3 C;  4GOP B;  4BA2 I;  1HZA A;  3K8A A;  2NVT H;  3GTO H;  1VQH A;  3G4S A;  3DLL A;  2R93 G;  5BR8 L;  1SE8 A;  3S24 A;  5ELN A;  1HR0 W;  3L2P A;  4DNI A;  3I4N H;  3HOZ H;  2AKW B;  1OXS C;  1VQM A;  1HJP A;  3F1Z A;  4LUO A;  1M90 C;  4ALP A;  1H95 A;  1TWG H;  1YJN A;  2KCT A;  3AEV A;  2R6G A;  4GNX A;  4JI0 L;  4UP8 A;  4WJ4 A;  2NN6 I;  1GO3 E;  4B3M L;  2OTJ A;  1XTD A;  3RLN A;  3H3V I;  1I50 H;  1X65 A;  2VQF L;  1BVS A;  1JMC A;  5C44 G;  2CWP A;  4DR7 Q;  3KF6 A;  2DGY A;  4NXM L;  5C44 H;  2Q2I A;  4AYB G;  1NE3 A;  2E5L Q; 
#chains in the Genus database with same CATH topology
 1C8C A;  3KJO A;  1KAW A;  4KI0 A;  1B3A A;  5I6W A;  1YNX A;  4YY3 L;  1B44 D;  3I4O A;  3K7A B;  1B53 A;  4DXF A;  2RCF A;  1S5D D;  2EYM A;  5ISR A;  1JIC A;  4FF4 A;  4DR1 Q;  2K5Q A;  1XMO Q;  4EVO A;  3HOW G;  1EFW A;  1PZJ D;  3U4V A;  1Q7Y C;  3HEJ A;  5C5M A;  1I4Q A;  4A3G G;  3QR8 A;  1JB7 A;  1VQG A;  2I5L X;  3TN2 A;  4A3E B;  3H0G B;  1QCB D;  3HFZ B;  1FL0 A;  1TWH B;  1P16 A;  2ID0 A;  4FXG C;  4J1M A;  4X62 L;  2X6G A;  2ASB A;  4H7B A;  3A7A B;  4X64 L;  4A93 H;  4WJW A;  1HCZ A;  5D3D A;  1JC7 A;  4U68 A;  3U9S A;  3NE5 B;  4P72 A;  1SFO B;  1VDZ A;  4XYO A;  5CV5 A;  1I4P A;  1HZ9 A;  3S1R H;  2QKI C;  1D1I A;  4DPG A;  4DU9 A;  1HHV A;  5BR8 Q;  1UAP A;  2N55 A;  4GLX A;  3GTQ B;  1WTV A;  5M5X B;  3HOZ B;  3H91 A;  4ME3 A;  1W3S A;  4KN7 C;  3CHB D;  4DF7 A;  4NB3 A;  1WCM H;  1I3Q H;  1F9Q A;  4A3D B;  3GV6 A;  2ZT9 C;  5KYL A;  5IOD A;  2DJG C;  2N8N A;  4B3T L;  3HP3 A;  1XNQ L;  4A3G H;  1K0S A;  2G5D A;  2SNS A;  3S1N B;  2WB1 B;  4J15 A;  4C3J B;  2FXQ A;  1VQB A;  4K14 A;  3TRE A;  1J6Q A;  2OT2 A;  4B9W A;  4A3I H;  2IY5 B;  1NTG A;  1ICW A;  5C5L A;  1HQM C;  4GOP A;  2ZXO A;  2F3I A;  5JAV A;  1KAB A;  4UP9 A;  1B50 A;  5BN3 A;  3M85 A;  4KY7 A;  4ULL A;  3A55 A;  3SK4 A;  3R93 A;  1Z7T A;  2HIV A;  4QGU A;  4MZ9 A;  3VR4 A;  3J7Z C;  3H3V H;  1GXD C;  2CWA A;  1EEI D;  1TVX A;  1VQA A;  4QUC A;  3ULL A;  1DOL A;  4X64 Q;  3BYY B;  3PCO B;  1U4P A;  3CW2 C;  4RWS C;  2UU9 Q;  3RZO B;  1MI2 A;  5IGE A;  1K0R A;  1NNX A;  5E4W C;  2B2V C;  2QA4 A;  1KTK A;  5GAD C;  2PO4 A;  4A3M B;  4LK1 C;  4BXX G;  1I4R A;  2RSN A;  3JC6 6;  1SMY C;  1UE5 A;  4HSP A;  1STY A;  4DV2 Q;  1Q8K A;  3GTO B;  2B63 G;  3K58 A;  1EY0 A;  2RDF A;  1SNP A;  4B3T Q;  2JA9 A;  3S16 B;  1XNQ Q;  1E3P A;  2JEA I;  1YNN D;  1KQS A;  5FJ8 H;  1A3V A;  1Y8P B;  5ELB A;  3HGB A;  4B3R Q;  4IFD J;  5C0X I;  4JBM A;  3MWY W;  1X3G A;  4F88 A;  5H1S E;  1LTR D;  4YIJ A;  5LMU L;  1CKN B;  3ER0 A;  4O2D A;  4PZ7 A;  2F0F A;  1XX8 A;  4DR2 Q;  5IP9 G;  1RF2 D;  1TWA H;  2ZTD A;  2BH8 A;  1MSG A;  3S2D H;  3KOJ A;  1QNU A;  2HQL A;  4OIJ A;  4R4Q A;  3C1F A;  4P73 A;  4JI1 Q;  4RGT A;  3T51 B;  3ZYY X;  5HGT A;  4K8I A;  1Q1B A;  2UU9 L;  4R8I A;  3HOU H;  1N8R C;  2VS1 A;  5IOC A;  4DV5 Q;  4GZY C;  4RKB A;  3OW2 A;  3T13 A;  3K5L A;  4YWL A;  4LF8 Q;  5AJ3 L;  1PZK D;  1LTI D;  5KIX A;  4CJ1 B;  4XQN A;  3Q0A A;  1ASY A;  1CQV A;  4BY1 B;  3F2U A;  2KHJ A;  4JI5 Q;  1ENF A;  4JC0 A;  2VNU D;  2WAQ G;  1ONL A;  1JR0 D;  1H9M A;  4DK1 A;  1TS3 A;  5J1Z A;  1QOH A;  2QEJ C;  3TME A;  1ENC A;  3KLW A;  1K8M A;  2FHT A;  2UXB L;  2EYF A;  2F0D A;  4TSS A;  2Q2H A;  4B3R L;  5KNC A;  1HXY D;  1H9S A;  4FF2 A;  1DYQ A;  4KHV A;  3E3X A;  4RCN A;  4CKC A;  2WB1 E;  3TRZ A;  1F2Y A;  1LLR D;  1XWE A;  1STH A;  4PMW A;  3SHL A;  1PYS B;  5EKL A;  3CAM A;  1CKN A;  1NCV A;  4KKU A;  4JI8 L;  1SE3 A;  1STB A;  2KVM A;  2VXW A;  4A3K H;  3I55 A;  1GUG A;  4Y52 H;  1VQ4 A;  4YHH Q;  5CV4 A;  5JJZ A;  5JJK A;  3M4Q A;  2CVR A;  2L12 A;  3S2D B;  3C46 A;  2SEB D;  1JOQ A;  1WTO A;  5IYD H;  2PNR C;  5L37 A;  1IYU A;  3S1Q B;  4DFA A;  3RLF A;  1PA6 A;  1BQQ T;  1TY2 A;  2RA4 A;  4IOC A;  4IUP A;  1STA A;  4DV5 L;  2K5H A;  2JA6 G;  4X3K A;  2R92 H;  1PYW D;  2HHH L;  3ND9 A;  3ULP A;  3Q23 A;  1I94 L;  2A68 D;  2CH4 W;  1I4G A;  1SN8 A;  4DV7 L;  4CKB A;  2A5H A;  2XWB B;  2A1A A;  1ZEQ X;  4F87 A;  2F0U A;  2Y0S B;  2EDG A;  4MIU A;  3SK8 A;  4HTH A;  3HKS A;  1OXT A;  4YWK A;  3D4D A;  4J8Q A;  1E1O A;  4LFC L;  1DON A;  1EU4 A;  2JA6 B;  2EE1 A;  3TS2 A;  1MGS A;  4POG A;  3SVM A;  2M9V A;  2B2Y C;  4DR3 L;  4BA1 I;  2CW0 C;  2O2L D;  2WII B;  2B2T C;  2VQE L;  5IGC A;  2MFI A;  1FYC A;  2VY3 A;  3J81 L;  1Y69 U;  3MC0 B;  3DWQ A;  2G9D A;  3T1Y L;  3GTL B;  1GVP A;  4YHH L;  2MGS A;  1ESR A;  1RTN A;  1CHQ D;  5E7N A;  3FDT A;  3GTK H;  3UDG A;  2GVB A;  1B3Q A;  3CCU A;  4S3S A;  1TR5 A;  3FMC A;  3P1H A;  2R92 G;  1RL2 A;  2A19 A;  3RD4 A;  1G51 A;  2Z1C A;  2R92 B;  3PO3 B;  1LYL A;  1S5B D;  1SYF A;  1F9P A;  3CCJ A;  1G2T A;  2B3G A;  2WV6 D;  3GTK B;  1E0B A;  1KNA A;  3GTP B;  1SRU A;  1TS5 A;  4F7X A;  3QWN A;  3G71 A;  2J4X A;  1YIT A;  1SLJ A;  5C3W A;  4BY7 H;  4E6I A;  3CP0 A;  3K5N A;  3GTQ H;  3VR2 A;  3J81 j;  4OO1 G;  2IHE A;  1YHQ A;  1W2B A;  3PMF A;  2EJG C;  3K5M A;  1XXG A;  2J7Z A;  1N32 Q;  1WVL A;  3LX0 A;  1NBW A;  3TP5 A;  4DR3 Q;  1FVI A;  3D6W A;  4R8N A;  5DLQ E;  4C3I H;  2NYZ D;  1I6V C;  2PQA B;  2KCM A;  3STB C;  1UE6 A;  3F2C A;  4YY3 Q;  5TSS A;  1VQ8 A;  3KDF B;  5FLX c;  2F3V A;  4BBS B;  3L0O A;  1RCV D;  2DNE A;  1KDB A;  4DR1 L;  2HCC A;  4KKS A;  5DEH A;  4A3K G;  4JV5 L;  4V0B A;  1BXT A;  4GS3 A;  3DXJ C;  1HR0 L;  4YCU A;  1EY7 A;  3S1Q H;  1EOT A;  5C0X H;  5IGD A;  4A3L G;  1N9W A;  2WFW A;  3I4M H;  4M1U B;  4BWG B;  2AQ2 B;  3VYR A;  5BN4 A;  1FNW A;  3DHQ A;  4PV1 C;  3J80 L;  3CMA A;  5J39 A;  2SOB A;  1AN8 A;  4IPC A;  3MAQ A;  1VQ6 A;  4N9T A;  4LWC A;  4HID A;  4NMZ A;  4DAM A;  5I9O A;  4FDB A;  3I4N B;  5FLM G;  4FXD A;  5F2D A;  3EA6 A;  3NBI A;  2PW7 A;  3BS1 A;  3QG1 A;  2JP1 A;  4DV1 Q;  4HJ8 A;  3OIP A;  1NUC A;  4LFA L;  3BYT B;  4NPS A;  1C9O A;  1DOM A;  2MPM A;  1G6Z A;  1QZH A;  3Q22 A;  3FKI H;  4QIW E;  5CBE E;  3DUZ A;  4LUZ A;  5G3L D;  1R9T H;  2F0L A;  3BG3 A;  1VQE A;  2F3W A;  4Y7N B;  5FLM H;  3HKZ B;  4M8A A;  1GUO A;  2F0H A;  5EKI A;  5T1G A;  5M3M H;  3J81 E;  1PH5 A;  1EYA A;  1Z9F A;  2EJF C;  4DK3 C;  3NSW A;  2R93 G;  4DNI A;  4OL7 A;  1M90 C;  1OXS C;  1HJP A;  3F1Z A;  1PRT D;  1TWG H;  1YJN A;  2F0M A;  4UP8 A;  1A3T A;  2B2Y A;  3GV3 A;  2OTJ A;  1LTT D;  1XTD A;  3OWE B;  3RLN A;  1YNN C;  3H3V I;  1HRJ A;  1FGB D;  4PQX A;  3TZU A;  1JMC A;  1AFP A;  1NE3 A;  3UI2 A;  5ELE A;  1WI5 A;  2OQ0 A;  4R4O A;  1I4H A;  1J5E L;  3UDX A;  4EQ5 A;  2AWO A;  4A3I G;  1QVF A;  1VCI A;  2K5N A;  4IUQ A;  5BN5 A;  4A3C G;  5M5Y H;  4DV2 L;  3PUZ A;  2K50 A;  4LFA Q;  2F0K A;  1WD1 A;  4RGO S;  3NPP A;  1Q46 A;  1PHJ A;  5CC4 A;  4P2C B;  3GTP H;  4K2K A;  5IT9 L;  3OMC A;  3T56 B;  3KF8 A;  5KRU A;  1IKM A;  2BA0 A;  3E5S A;  1SYE A;  1EY6 A;  1SSO A;  2WAC A;  4DXG A;  5LMU Q;  2PPB C;  2JA5 H;  1SJE D;  5M9O A;  3M7N A;  1AZP A;  2K1B A;  4H44 C;  2VUM B;  1X56 A;  1UE7 A;  3CCS A;  4LF9 Q;  1KIX A;  1DD2 A;  4ID6 A;  4QMG A;  1Y1W G;  4KY6 A;  4JI1 L;  4C3H B;  1ML0 D;  3S17 H;  3CU7 A;  5C4X G;  2L55 A;  2KED A;  3EIV A;  2RHS B;  4IPG A;  2KEE A;  3OW7 A;  2KUM A;  1CKM A;  4K5V A;  3RZD H;  4IPD A;  4HJA A;  4LF8 L;  5EPL A;  3NP8 A;  1XMQ Q;  3CCR A;  3M4P A;  1ICF B;  4BY1 H;  5I2Y A;  1KD1 C;  4QB4 A;  1QE6 A;  3NWT A;  1I4X A;  1JJ2 A;  5E1F A;  1L1O A;  4ABN A;  3D8G A;  2XWJ B;  3EBE A;  4NXN L;  2MQH A;  2K5V A;  4HIO A;  2F1M A;  2HD3 A;  1X54 A;  1PH3 A;  2E2I H;  4ZYS A;  3FVQ A;  2UXB Q;  3BZC A;  2A6H D;  1XPR A;  2XVS A;  4OWW B;  2NVY B;  2RBM A;  1ENA A;  4O42 A;  5C3X A;  2XRS D;  3D31 A;  3NQT A;  3RR5 A;  4DNT B;  1PTO C;  5CYU A;  5C44 B;  5DAU A;  1TWA B;  1EZ8 A;  4A3K B;  2MNA A;  1TS2 A;  5DM6 3;  2B2W C;  1IBK Q;  1PMR A;  4GLA C;  2A69 C;  1SND A;  3H0G G;  3IRB A;  1NR4 A;  5LL6 S;  4HED A;  2A69 D;  2WAQ E;  4LMQ D;  4MNO A;  5IT9 c;  3KF8 B;  3WOF A;  3U4Z A;  1YHB A;  3SXH A;  1VMP A;  1BBW A;  4RHR A;  2UXC L;  2X6L A;  4QF4 A;  4UP7 A;  2HHH Q;  2NZ1 D;  2B2T A;  1AZQ A;  1A0I A;  3PO3 H;  2A6H C;  4BBR H;  4DV4 L;  2B2V A;  4DV7 Q;  1Y14 B;  3Q24 A;  2NZO A;  1IBM L;  2MJ8 A;  2V1C C;  1UWV A;  1VQC A;  3OYY A;  1PDQ A;  5CV8 A;  5C4J H;  3DMU A;  3AMU A;  4NXN Q;  1L1O B;  4J6H A;  3DM3 A;  4X65 L;  5FO9 B;  1U5K A;  2CKZ B;  2JK8 A;  4RAU C;  4NW2 A;  4A3E G;  3AQQ A;  1PH9 A;  1D6E C;  3PIP A;  3CME A;  2VQE Q;  3FPP A;  1EY4 A;  2RVL A;  5IGG A;  5IGB A;  3AFP A;  4LNQ A;  2O5I C;  1JQY D;  2OXP A;  2SDF A;  1XPU A;  3T1Y Q;  1Y1W H;  3RN2 A;  5M3M G;  4CDF C;  4L8J A;  3JAM i;  5JVH 3;  1GUN A;  3NBH A;  2OQK A;  4UDU C;  3HOU G;  4CKE A;  1I6H B;  1A15 A;  1EIG A;  4K2L A;  2K75 A;  2CFM A;  1EQV A;  2EYJ A;  2ZTC A;  3E0E A;  4JW0 A;  2KOL A;  1WYD A;  3FRP B;  4LJZ C;  2P5Z X;  2F0O A;  2Z6B A;  4GN4 B;  5GAE C;  3HOY B;  2R7F A;  1MBY A;  1KRT A;  3VYU A;  3KDF A;  5D65 A;  1DGS A;  3MTS A;  1V1P B;  5EPJ A;  1NJI C;  1CT1 D;  1Y1V G;  1YHA A;  4HJ9 A;  4DAY B;  5C0X G;  4DV4 Q;  1STE A;  1PXU A;  4EQN A;  2KHI A;  1SAP A;  2UUB L;  1IBM Q;  5LMN L;  1D1K A;  1MIU A;  4X6A H;  3F2B A;  2HDM A;  4CDE C;  3BDC A;  2F4I A;  4HMI A;  1HA6 A;  3PF5 A;  2UUA L;  5FJ8 G;  1N32 L;  3ZJY C;  4I65 A;  3S1M B;  1PRT F;  3CC7 A;  4OEM B;  4A3F H;  3KJP A;  3CCQ A;  3V2T A;  2BCO A;  4JI3 L;  1Y1V B;  1KNE A;  4QY7 A;  1EL0 A;  2EPB A;  2EIF A;  2B8G A;  2QCP X;  1ZYR D;  3C2P A;  2L15 A;  1CK1 A;  4A3J B;  4R1J A;  3QOJ A;  1OTC A;  3NEM A;  2KQ3 A;  4BBR B;  3CCM A;  5JVG 3;  2RHQ B;  2K03 A;  3SE0 A;  1T5X D;  1Z47 A;  4PNY A;  3EVQ A;  1TWF B;  5M3F G;  4PMB A;  4H02 A;  2NBF A;  4JV5 Q;  4QCL A;  3ONA B;  3AU7 A;  5EJW A;  4IUV A;  4B9X A;  1FJG L;  3W1B A;  2H4O A;  4YCV A;  3SGI A;  1XNR Q;  1HR0 Q;  4K0K Q;  4RHS A;  3FEW X;  1AEX A;  5CGK A;  3A8J E;  4A93 G;  1WTR A;  4A76 A;  3TDQ A;  4XQQ A;  4V19 0;  1J9O A;  1K83 H;  3CQZ B;  2TMP A;  3MXU A;  2YTY A;  5COY A;  3OTO L;  2PYK A;  4A3L H;  4F8M A;  5CV9 A;  2Z9H A;  1ET9 A;  5KYI A;  1SE4 A;  2KJX A;  5LMN Q;  2F0G A;  3NXW A;  5IP9 H;  1L0W A;  4A3C H;  2LXK A;  2QGQ A;  1PTO H;  1DM0 B;  2UUA Q;  2VUM G;  2R7D A;  2LSS A;  2M2L A;  4DV1 L;  1GHK A;  2PMZ E;  1PLF A;  1SR3 A;  2K52 A;  1MHW C;  1TWH H;  3PO3 G;  2PI2 A;  3A5Z B;  4OWT B;  2MP1 A;  3C1E A;  1Q1E A;  4JYA Q;  4KKT A;  2JA7 B;  1P8L A;  2XN9 C;  3PQI A;  1LTS D;  1PFS A;  1CKO A;  4Q5V A;  4X3S A;  1WTQ A;  3D4W A;  3I72 A;  4WRD A;  2I5H A;  5T1I A;  3T4A C;  5IP7 G;  1QUQ A;  3VR6 A;  4BY1 G;  1EIH A;  1PH6 A;  4K0K L;  2ZJP A;  3I90 A;  4RMF A;  3HOV H;  4ILW A;  1CZG A;  4TVA B;  3C3L A;  1TII D;  4DN4 M;  3HOW B;  4HIK A;  2EJM A;  1I50 B;  1U4M A;  3JAM L;  4GKK L;  1EFI D;  4FNF A;  3CQZ H;  3X3N A;  3VA7 A;  2LKV A;  3RZO H;  3W2D A;  3FKI G;  3CCV A;  2R93 B;  2EXZ A;  1U0L A;  2FMC A;  5I9P A;  3PIO 3;  1RKN A;  2R61 A;  2QIL A;  1VQF A;  1YEZ A;  3PF4 A;  3P75 A;  4WFN 3;  1J5E Q;  4ZCK A;  4P75 A;  2IX1 A;  3ERO A;  1H9S B;  1V1Q A;  2JA8 H;  4C2M B;  3QO2 A;  5COR A;  1UUP A;  2ICI A;  1HUM A;  2JXM B;  3LNN A;  2RSO A;  1K28 A;  2KHS A;  1DXM A;  1QJO A;  2JYO A;  3NEL A;  5M5Y B;  3CC2 A;  2Q8T A;  1Q8I A;  3JAM E;  5JJI A;  2IHF A;  3KF6 B;  1Z6H A;  4EX5 A;  2K6A A;  3U9O A;  3TP8 A;  1QB5 D;  2FFK B;  3BVG A;  3I3C A;  5C4X H;  4AIM A;  1BBU A;  2MHV A;  1YNJ D;  1K73 C;  2N78 A;  2R93 H;  4A3B B;  1LT4 D;  3H3V C;  3PV0 A;  4RGN A;  5A2Q E;  1TKW B;  3MXG A;  4X66 Q;  4LF9 L;  3QOL A;  3ICE A;  2JA5 B;  4QL5 A;  1VQ7 A;  2PZW A;  1EEF D;  5KNB A;  2IL8 A;  1B9N A;  2OWO A;  4H0L C;  1JWU D;  3S15 H;  3S1R B;  2JA6 H;  2BE5 D;  4K5X A;  4DAP A;  1EYC A;  4GKJ L;  4JI7 L;  5D14 A;  4IUT A;  1YJ9 A;  1SNM A;  4K6L A;  4OHJ A;  2Q2T A;  1N33 L;  1FD7 D;  5ELO A;  1SBB B;  1XMQ L;  1EQT A;  4CGY B;  3S1N H;  4IQZ A;  2Y0S E;  1JJC B;  4N8X 1;  2RF4 A;  1A62 A;  4HCS A;  3WOE A;  1UEB A;  1IL2 A;  1CTM A;  4GOP B;  4BA2 I;  1HZA A;  1WCM B;  1VQH A;  5G3L F;  3DLL A;  2K01 A;  2IX3 A;  1PFN A;  3S24 A;  3BVZ A;  1HA5 A;  1O7L A;  3L2P A;  3HOZ H;  1BCP F;  2AKW B;  3EJI A;  1VQM A;  4ALP A;  3V96 A;  4WJ4 A;  4OEL B;  5D3I B;  5KND A;  4JI0 L;  2LFN A;  1I50 H;  1Y8N B;  1QG7 A;  1X65 A;  2V4D A;  1BVS A;  2CWP A;  3KF6 A;  2DGY A;  3SEB A;  1WJJ A;  4ZAI A;  5C3E B;  1F2L A;  3R8B A;  4R4T A;  5C3E G;  3HOX H;  2Z0S A;  1XYI A;  2BH2 A;  2DNC A;  4X66 L;  1FNV A;  1IBK L;  2WP8 J;  4IUR A;  4NDX A;  4C1N K;  1KLG D;  1PVO A;  4JOI C;  3CCE A;  3M4O B;  1C48 A;  4TQU S;  2A8V A;  1I5F A;  3CPW A;  1XJV A;  2E2J B;  2DUD A;  4BBR G;  3GTJ H;  4R9W A;  3KYH C;  2UXD Q;  5K5P A;  1PTO D;  4GKJ Q;  3VA5 A;  1DJR D;  3FKI B;  3PIO A;  3I8Z A;  3PUX A;  1TU2 B;  4N9P A;  3L9A X;  2UXC Q;  4L5Q A;  4B3S Q;  3OHX C;  5CV6 A;  1VQP A;  1PFM A;  1II3 A;  5ELD A;  2VB3 X;  4AQY Q;  1SE2 A;  2Y0S G;  1LTG D;  3DWA A;  3NHH A;  2ICE C;  2OTL A;  2WKC A;  2K28 A;  3MZ5 A;  3L3O C;  4MTK A;  2C9O A;  3S15 B;  3HOX B;  2FMM A;  4ME5 A;  2CQA A;  3I4L A;  3O13 A;  4X65 Q;  1VQ9 A;  1EY9 A;  5C3E H;  4L5R C;  1KL9 A;  4DA2 A;  3K0X A;  2NVT B;  5I6Y A;  5HY6 A;  2YYZ A;  2AMC B;  1SNO A;  4IN3 A;  1E2V A;  3RNU A;  3S14 H;  3AB9 A;  3P20 A;  3Q6S A;  3MXP A;  1A2U A;  1TWC B;  4LUV A;  1GM5 A;  4CJ0 B;  3IFD A;  5IP7 H;  3ITP A;  2RKS A;  3VYS A;  2UXD L;  1I6H H;  1QVC A;  1PH7 A;  2L4N A;  1BCP D;  1HFN A;  4KMU C;  3GDE A;  5A2Q L;  1BO0 A;  1L1O C;  1M1K C;  2K5W A;  4EQP A;  3CXC A;  4B3S L;  3J81 c;  5HUR A;  2D0O A;  2XIW A;  1G8Z D;  1LV9 A;  1HTL D;  4AQY L;  1Q82 C;  3E9H A;  2WAQ B;  1YVC A;  1FR3 A;  2EOT A;  2UUB Q;  4XIG S;  4NKL A;  3A56 A;  2VUM H;  1C4Q A;  3MVV A;  2WKD A;  5C4J B;  1NY4 A;  2NZH A;  3IFT A;  3HOV G;  4OXP A;  2DJF C;  2E2D C;  3HOV B;  3IKJ A;  4K5W A;  4G7Z C;  1SDF A;  4GN3 B;  3TP6 A;  1HUN A;  1Q12 A;  4DUY Q;  1GUS A;  4A3J G;  4JI3 Q;  4ZRZ A;  1JWM D;  4A93 B;  1WFQ A;  2I07 B;  1F2M A;  1RIP A;  1SNQ A;  1TS4 A;  4LF4 L;  3S2H B;  2L11 A;  2Z4H A;  4KHP L;  2B8F A;  3G6J B;  4IUU A;  4R4C A;  4DUZ Q;  2HUG A;  4A3G B;  4OGQ C;  1H9K A;  1LTA D;  4C2M H;  1IYV A;  1VQ5 A;  1U4L A;  4ZUJ A;  3PSI A;  1I3Q B;  3SR1 A;  1FJG Q;  3BU2 A;  1BKB A;  1XNR L;  2BDO A;  1OXU A;  3TZD A;  3EN2 A;  3MEH A;  5M3F H;  3D0F A;  4Q0F A;  1SYG A;  4IFD G;  2K5D A;  3MEF A;  3UE0 A;  5JEA G;  2NTT A;  2EXD A;  3E9I A;  3OTO Q;  2O4X A;  3KUP A;  1GHJ A;  1E2Z A;  2K4K A;  4ZLT F;  2VB2 X;  3W3A A;  2B2U A;  2XSC A;  3A8I E;  1SMX A;  2D5D A;  4GLV B;  1K3B C;  3U50 C;  4FO2 A;  2EY2 A;  3MXN A;  3H0G H;  4AYB E;  5I4D A;  1SFO H;  1GKH A;  1JOR A;  1OXV A;  3KK7 A;  5JJL A;  1BDO A;  4CJ2 C;  3TQY A;  1X3F A;  4HJ7 A;  1G6P A;  4MHE A;  4DUY L;  5IYB H;  3PO2 G;  2MUY A;  3GTJ B;  3I2Z A;  2E2J H;  2F0T A;  4JYA L;  4UHV A;  4JG2 A;  4LF5 Q;  4GN5 A;  2JA7 H;  1SYB A;  1VQI A;  4A3D G;  4KHP Q;  2F52 A;  5CR3 A;  1QNK A;  4DUZ L;  2PI2 E;  4XXE A;  3IL8 A;  3VR3 A;  1LAC A;  2H1E A;  2KA7 A;  1VQD A;  2F0E A;  4LF6 Q;  3T16 A;  2N3S A;  1Q86 C;  2F4V Q;  3WDN A;  1F9R A;  1MJE A;  5M5W B;  1B2T A;  1A63 A;  5M5W H;  2ZM6 L;  2NVX H;  2L1B A;  2PQE A;  1X3Q A;  4GKK Q;  4ZUI A;  2RQX A;  3I4M B;  2K33 A;  1PFB A;  1S5F D;  2CQO A;  2G9H D;  3K5O A;  4FF3 A;  1SMY D;  3M9B A;  1VQL A;  1WOC A;  4RA8 A;  3STB D;  4XYQ A;  2HDL A;  1GUT A;  1CFM A;  2BOS A;  4IPH A;  1MSH A;  5EAY A;  3RUZ A;  4KK7 A;  1CUK A;  5IWA Q;  1O78 A;  5DNF A;  1VF5 C;  3GTM B;  4CHT B;  3S2H H;  4WOR A;  4HMJ A;  1JB3 A;  3RZD B;  2OEO A;  1F77 A;  1STN A;  2LXJ A;  3KBG A;  1HNW Q;  3D6C A;  1K8A C;  3G7L A;  1Y1V H;  2E74 C;  4RH6 A;  2IJ0 A;  4HIM A;  1SEB D;  1EYD A;  4HN7 A;  4YWM A;  3TS0 A;  3S17 B;  3MHB A;  1TQO A;  2KEN A;  3OIQ A;  1LTB D;  4I7A A;  1EIY B;  4PMC A;  5IIF A;  3QB3 A;  1RTO A;  5IY0 A;  2LY7 A;  1JOO A;  2EYO A;  4RCO A;  1IXR A;  2AHO B;  4LF6 L;  4O1N A;  3LWE A;  3MXN B;  2F0N A;  1VF7 A;  4DR4 Q;  3HOZ G;  2YU9 H;  2D0P A;  1FNU A;  1W6K A;  4LFB Q;  1YZ6 A;  4RG1 A;  4DV3 L;  4OWX B;  3HOW H;  2EY6 A;  2JJQ A;  1M4V A;  4DNR B;  1TWG B;  4G7O C;  2BE5 C;  3UDF A;  1BR9 A;  2EQS A;  1HH2 P;  2DY7 A;  2E76 C;  5EBD A;  5CV7 A;  3HOY G;  3CKI B;  1NSN S;  1S4Z A;  3ERS X;  4JI7 Q;  4HCE A;  4IJL A;  4I7Z C;  3SK6 A;  1N33 Q;  4DR6 Q;  4C3H G;  3OMG A;  4WJ3 M;  3I91 A;  5EPK A;  3ULJ A;  1VQJ A;  2TSS A;  3A0J A;  2JA8 B;  3HKZ E;  3H15 A;  1GOZ A;  2IPK D;  4PZ6 A;  4DV6 L;  2Q2U A;  1AE3 A;  3JAM c;  1HNW L;  3J80 E;  2YTV A;  2E2H B;  1JCK B;  5J3B A;  2NWG A;  1WD0 A;  5M5X H;  2FJ2 A;  1S40 A;  3K57 A;  3SK5 A;  1D5X C;  2A68 C;  2LS0 1;  4XQJ A;  2K7V A;  1VS0 A;  2Z6K A;  4JI0 Q;  3CF5 A;  3HS0 C;  2QW7 A;  3MA2 B;  1JWS D;  3DM1 A;  4O0A A;  2HQE A;  4UPA A;  1KAA A;  4DR4 L;  2D9U A;  1MKH A;  2C5C A;  1YI2 A;  4LFB L;  3FP9 A;  1UE1 A;  4QQB X;  4A3I B;  1K8G A;  3CRL C;  2RCN A;  4JI2 Q;  4G7H C;  1V8Q A;  5GQO A;  5AFW A;  4K8J A;  3V05 A;  4KHZ A;  1LAB A;  1HQR D;  2F0W A;  2J0T D;  3DWP A;  4G57 A;  2R7Z B;  3K7U C;  4PZ8 A;  3K81 C;  3M3Y B;  2PNH A;  2ATW A;  2CCZ A;  3OSO A;  2A73 B;  1IHZ A;  1C0A A;  4B3M Q;  1V1O A;  4APV A;  1PH4 A;  5CBA E;  3E0J A;  2VQF Q;  3J7A V;  5FOB B;  2IT1 A;  1B7Y B;  1K9M C;  2B39 A;  2NN6 H;  3TEH B;  3J7Y W;  1BOS A;  3DEP A;  1L0Y B;  2EY5 A;  1H9J A;  2Z4I A;  3OWF A;  3PO2 H;  1B4O A;  2BA1 A;  4JOI A;  4KJN A;  1X9N A;  5FLX E;  1C7Y A;  2QEX A;  3AYH B;  3CRK C;  4KV6 A;  1Q90 A;  2NVY H;  1S72 A;  2JEB I;  3E6Z X;  3FHW A;  2N88 A;  2H5X A;  2E2I B;  1IW7 C;  1S3O A;  2L5T A;  4K6D A;  5JPN C;  3D4R A;  1EY5 A;  1EWC A;  3X3M A;  3M7G A;  2DN8 A;  3HRZ C;  4A3J H;  3HKZ G;  1EZ6 A;  1SYC A;  4BBS H;  1YNJ C;  4JI2 L;  1K3R A;  3A74 A;  3PIP 3;  4JK1 C;  3H6M A;  3GTO H;  3G4S A;  1EY8 A;  4U67 3;  5ELN A;  3D3R A;  1U9R A;  1G2S A;  1JE4 A;  1H95 A;  1NR2 A;  2R6G A;  2IWH A;  3KLS A;  2NN6 I;  1GO3 E;  4FXK C;  4UAI A;  4B3M L;  5IGF A;  1PRT B;  4L63 B;  2VQF L;  1BCP B;  5C44 G;  2HCI A;  4NXM L;  1VQN A;  4AYB G;  2E5L Q;  2KCN A;  4IFD H;  5IYC H;  1BUV T;  1EQR A;  4A3B H;  1E24 A;  1WTX A;  1KHI A;  3K80 C;  1E1T A;  5IT9 E;  3KFU A;  1TXY A;  4A3M G;  3BDO A;  3QIA A;  4BY7 G;  5EGT A;  3GQB A;  1BNZ A;  4BBS G;  4JBJ A;  3J80 i;  1O80 A;  1U4R A;  1OXX K;  4QJF A;  3TSS A;  1HNX Q;  2YV5 A;  4LF4 Q;  3KLR A;  1Q3L A;  4TRD A;  5IE8 A;  2Q8R E;  1Y1W B;  2F0S A;  1PRT C;  5C4Z A;  1EU3 A;  2EVB A;  4YCW A;  2B63 H;  1PV4 A;  4ZQ3 A;  3N52 A;  2EYP A;  1B9M A;  3NBH B;  4AH6 A;  3F2D A;  1DZ1 A;  1ROD A;  4GNX C;  2MO0 A;  1JT8 A;  1O7Z A;  4C3J G;  4DR5 L;  3VR5 A;  1NMG A;  1ESF A;  3A7L A;  3L7Z C;  3MFY A;  4P74 A;  1RJT A;  1KDC A;  1E22 A;  3TP7 A;  1SYD A;  1Y8O B;  1CQF A;  5CMD A;  2E5L L;  5NUC A;  1HNZ L;  4B08 A;  5M3M B;  3AFQ A;  3NTK A;  1CA5 A;  2WB1 G;  3LWU A;  1AP0 A;  1IZ6 A;  5GRO A;  1N34 L;  2B2W A;  2L0C A;  2C35 B;  4OON A;  1HTP A;  5FLX L;  3J7A F;  4DK0 A;  2HIX A;  1PYB A;  1IYJ B;  4GNX B;  4LF5 L;  2VW9 A;  1PZI D;  2Z6K C;  1HNX L;  1QVG A;  3I56 A;  4HAE A;  4TKO B;  3I4M G;  4IUN A;  3CCL A;  4A4I A;  1KXL A;  1NAP A;  2LMC B;  3NK9 A;  2K32 A;  1KRS A;  3K7A H;  2JA7 G;  5IYD G;  1EWH A;  1V1P A;  1PH2 A;  1BF4 A;  2AWN A;  3GP7 A;  2F4V L;  3BDL A;  1EOV A;  4RFB A;  4P71 A;  4C56 C;  4ZKC B;  1ZKO A;  4RGM A;  2ZXP A;  1IBL Q;  1G91 A;  2ZM6 Q;  5JPM C;  5M3F B;  1TT2 A;  2R7Z G;  2E8G A;  1SRO A;  1MD2 D;  1ZYR C;  4DGZ A;  4DR5 Q;  3A5U A;  1CA6 A;  3EFX D;  4DK6 C;  3J80 c;  4LF7 L;  4BY7 B;  3R3O A;  3SDZ A;  2MO1 A;  2CHB D;  3KLS X;  2WIN B;  4NP5 A;  4OIK A;  2NB0 A;  2KCC A;  3GTG B;  3F8T A;  2B63 B;  1DOK A;  3CD6 A;  2XTI A;  2R3Z A;  5IWA L;  3BZD B;  4AYB B;  4HJ5 A;  2KBN A;  3M3Y H;  3RLO A;  2EZV A;  4N8F A;  1D5M C;  2N49 A;  2PZU A;  1R4Q B;  3I7F A;  2DY8 A;  4IOA A;  4Z9C B;  5J22 A;  4KD3 A;  3NQI A;  5JEA H;  4A75 A;  2BDN A;  4XDX A;  3M4O H;  1N34 Q;  4JPB W;  2CH4 A;  3H94 A;  1E7Z A;  4A3M H;  1PTO B;  3URY A;  4CDC C;  1CI3 M;  2YTX A;  2K05 A;  5DM7 3;  4A3F B;  1A6X A;  4C3I B;  2F0J A;  2K14 A;  1PH8 A;  1AW7 A;  4IAL A;  4C3I G;  2NVQ H;  5C4H A;  5FKA C;  1Q81 C;  1VQO A;  3CC4 A;  4R4I A;  4JVZ A;  4DAV A;  2JSO A;  3VDY A;  4UY8 C;  3BVM A;  1V43 A;  5E3F A;  4DV0 L;  2F0I A;  4H13 C;  3UE1 A;  1X6O A;  1QUQ B;  4DV3 Q;  5C4X B;  1IBL L;  2HT1 A;  3B6Y A;  3NTI A;  1G29 1;  1AH9 A;  5LHY 1;  1FGU A;  2Q8I B;  1S5C D;  1HFG A;  1NMF A;  3NWS A;  4LF7 Q;  3U58 A;  5I2X A;  1CSQ A;  2CW0 D;  2QDL A;  1HPC A;  2ZJR A;  2E75 C;  3OOC A;  2Z8L A;  1JE5 A;  4DR6 L;  2I46 A;  4L5T A;  1LUZ A;  3GTM H;  1B70 B;  2X69 A;  1R4P B;  4JI6 L;  1L0X B;  1ASZ A;  3S14 B;  3I73 A;  2ZTE A;  3LGJ A;  2PQA A;  5EBC A;  2F0Q A;  3I70 A;  4DV6 Q;  1N36 L;  5FO8 B;  2UUC Q;  5A35 A;  3IAY A;  1YBY A;  2F0V A;  1X32 A;  1IL8 A;  3RN5 A;  3T1H Q;  2I0Q A;  1LTL A;  4RKL A;  1LT3 D;  4IFD I;  1B8A A;  5C0X J;  4L5S A;  1YJW A;  5GAH C;  2PCF B;  2EYL A;  2KEC A;  5ELF A;  1L2F A;  3PUV A;  1PH1 A;  1EIF A;  4FVM A;  4DV0 Q;  1RHP A;  4KN4 C;  3ERQ A;  4Y7N H;  4JI4 L;  2VL6 A;  1JJG A;  1H9R A;  1X3P A;  4HSV A;  1WTW A;  4L6T B;  5GAG C;  4G4K A;  2O5J C;  2B2U C;  4GOP C;  2R7Z H;  3QJY A;  4HR7 B;  2AQ1 B;  1A8V A;  1TWC H;  1XTC D;  3GD7 A;  2I5M X;  4XT1 B;  1QWY A;  2AUK A;  1QZG A;  1W6J A;  2ZXR A;  1ILQ A;  1GUW A;  4DR2 L;  1UNS A;  1SJH D;  3PGZ A;  1KLU D;  4JI6 Q;  1DCZ A;  4FP5 D;  2K04 A;  2NVQ B;  1GD7 A;  1VQK A;  4A3F G;  3WWV A;  1RDP D;  3PUW A;  4DKA C;  3G48 A;  3J81 i;  2RDG A;  1N36 Q;  2UUC L;  1CHP D;  2NVX B;  1UEA B;  2OF1 A;  4KLK A;  1D8L A;  3PO2 B;  1F9S A;  2D62 A;  1HZC A;  4OO1 H;  2A6E C;  2PZT A;  2M00 A;  3TBI B;  1STG A;  2GA4 B;  3T1H L;  3VYT A;  2VZA A;  3NEN A;  4C1N I;  4ZK9 B;  1EWI A;  3K0Y A;  2JA8 G;  5AJ3 Q;  2D2C C;  1K83 B;  1LM0 A;  3K59 A;  3M4Y A;  2E2H H;  2F03 A;  5LL6 X;  4OX9 L;  1E2W A;  1EYG A;  1D2B A;  3HOX G;  2RDH A;  5EKK A;  4A3B G;  2A6E D;  1EUJ A;  4JI5 L;  4EQO A;  1V9P A;  1HZB A;  4MTN A;  1A3U A;  1BBX C;  3J7A 5;  2NTS A;  4X3T A;  4KJO A;  2SNM A;  4JI4 Q;  2QDB A;  4JCV E;  1SNC A;  1KC8 C;  1CM9 A;  1LO5 D;  3S16 H;  1X3E A;  3N6R A;  4FF1 A;  1WTH A;  4IJH A;  3Q8D A;  1ET6 A;  2B29 A;  5FK9 C;  1PTO F;  1VMC A;  2JE6 I;  5FO7 B;  2ENB A;  2ES2 A;  3S1M H;  5EQ0 A;  1CSP A;  1D5Z C;  3R2T A;  1WTP A;  4X3U A;  1YIJ A;  3DEO A;  4JI8 Q;  3HOU B;  3GTL H;  3KBX A;  5JOB A;  2OCE A;  3W1G A;  3H09 A;  5ELC A;  4XT3 B;  4ODG A;  2YU9 B;  1EQQ A;  3BJU A;  1GJX A;  3OPO A;  4NXM Q;  2A74 C;  3G6E A;  1WCM G;  1LT5 D;  1D7Q A;  2ZJQ A;  3CPF A;  2FIN B;  4MN3 A;  3NTH A;  3A54 A;  1F2Z A;  4BXX H;  5K36 H;  1XPO A;  1T9H A;  3EQL C;  3HOY H;  3W5O A;  4QIW B;  1TWF H;  4PG3 A;  3P7J A;  2PMZ B;  1S5E D;  1IKL A;  4DAY A;  1I94 Q;  4OX9 Q;  3T53 B;  1X55 A;  5KGU A;  1J8I A;  1OO9 B;  5IYC G;  1A2T A;  4JBW A;  1O7Y A;  4OO1 I;  2NN6 G;  4XTC S;  3PUY A;  5LMN W;  1SXT A;  1MJC A;  1AE2 A;  2JN4 A;  4KTA A;  4LW1 A;  1RD9 D;  4LFC Q;  2EYH A;  4C3H H;  3ND8 A;  4CDD C;  5HGQ A;  4BS9 A;  2XGT A;  1M8A A;  4DR7 L;  4A3D H;  1BCP C;  4QUF A;  2PW5 A;  5C6A A;  1O7I A;  1KDA A;  1B1Z A;  3FPU B;  3GO5 A;  3RMH A;  2AQ3 B;  5IYB G;  4JBK A;  4FYD A;  1TY0 A;  1ZXT A;  2ALY B;  3S9W A;  2XRQ D;  2NUC A;  2JA5 G;  2IW3 A;  5E4X A;  3NUC A;  4LAA A;  2JQO A;  1IW7 D;  1XMO L;  1ILP A;  1LT6 D;  3BZK A;  5K36 G;  3UDI A;  2GN5 A;  4EGV A;  1JOK A;  1HNZ Q;  2F0P A;  1R9T B;  4ZKB B;  3A8K E;  4A3E H;  4C3J H;  1K8O A;  4IZ8 A;  3GTG H;  1T5E A;  4X62 Q;  3I4N G;  2XNA C;  5KEE A;  2QF7 A;  2GVA A;  4IO9 A;  4KY5 A;  2IX0 A;  3K6O A;  3K8A A;  2NVT H;  2L9H A;  5BR8 L;  1SE8 A;  1CZW A;  2AUJ D;  1HR0 W;  3HG9 A;  3I4N H;  1QIL A;  4LUO A;  3MFG A;  3AEV A;  2KCT A;  4KD4 A;  4GNX A;  4CBV A;  3HZX A;  3R2I A;  4DR7 Q;  2EY1 A;  5C44 H;  2Q2I A;  4POF A;  5JEA J; 
#chains in the Genus database with same CATH homology
 5C3E G;  4R4T A;  3KJO A;  5IYC H;  1KAW A;  1EQR A;  4KI0 A;  1WI5 A;  4A3B H;  1E24 A;  1YNX A;  2Z0S A;  3HOX H;  1KHI A;  3K80 C;  1E1T A;  2OQ0 A;  3I4O A;  4R4O A;  4YY3 L;  2BH2 A;  4X66 L;  3KFU A;  1J5E L;  1IBK L;  2WP8 J;  1TXY A;  4A3M G;  1PVO A;  4JOI C;  3CCE A;  3UDX A;  4BY7 G;  4TQU S;  4EQ5 A;  2AWO A;  4DR1 Q;  4A3I G;  1QVF A;  1I5F A;  3CPW A;  1XMO Q;  2A8V A;  1VCI A;  2K5N A;  1XJV A;  3HOW G;  4BBS G;  2DUD A;  4BBR G;  4A3C G;  4JBJ A;  5M5Y H;  3GTJ H;  4DV2 L;  3PUZ A;  3KYH C;  3J80 i;  1EFW A;  2K50 A;  2UXD Q;  4LFA Q;  3U4V A;  1Q7Y C;  1Q46 A;  4GKJ Q;  1PHJ A;  1WJJ A;  1OXX K;  3GTP H;  4QJF A;  1HNX Q;  2YV5 A;  4LF4 Q;  4A3G G;  3PIO A;  1JB7 A;  3PUX A;  1VQG A;  2I5L X;  5IE8 A;  2UXC Q;  4L5Q A;  4B3S Q;  3HFZ B;  1FL0 A;  1P16 A;  2BA0 A;  2ID0 A;  1VQP A;  4YCW A;  4X62 L;  2ASB A;  2B63 H;  1PV4 A;  4X64 L;  4AQY Q;  4A93 H;  2Y0S G;  5LMU Q;  4P72 A;  2OTL A;  2JA5 H;  3M7N A;  1X56 A;  1HZ9 A;  3S1R H;  3NBH B;  4AH6 A;  4DPG A;  3F2D A;  1UE7 A;  5BR8 Q;  3CCS A;  4LF9 Q;  4X65 Q;  1KIX A;  4GNX C;  1VQ9 A;  2MO0 A;  1JT8 A;  4GLX A;  1Y1W G;  4DR5 L;  5C3E H;  4L5R C;  1KL9 A;  1NMG A;  4ME3 A;  1W3S A;  4JI1 L;  3L7Z C;  4P74 A;  3S17 H;  3K0X A;  5C4X G;  4NB3 A;  1WCM H;  1I3Q H;  1E22 A;  3EIV A;  2E5L L;  5HY6 A;  2YYZ A;  2RHS B;  4IPG A;  1HNZ L;  2AMC B;  2N8N A;  4B3T L;  1XNQ L;  4A3G H;  1CKM A;  3RNU A;  3RZD H;  3AFQ A;  3S14 H;  4IPD A;  4HJA A;  2WB1 G;  4LF8 L;  1XMQ Q;  3CCR A;  4J15 A;  2FXQ A;  1VQB A;  1IZ6 A;  5GRO A;  3M4P A;  4LUV A;  1N34 L;  1GM5 A;  3TRE A;  1J6Q A;  4BY1 H;  5IP7 H;  1KD1 C;  4A3I H;  2C35 B;  2IY5 B;  1NTG A;  4OON A;  4GOP A;  1JJ2 A;  2F3I A;  2UXD L;  1I6H H;  1QVC A;  1PH7 A;  2HIX A;  1L1O A;  4UP9 A;  1PYB A;  1IYJ B;  4GNX B;  4LF5 L;  2VW9 A;  2Z6K C;  3M85 A;  1HNX L;  3EBE A;  3GDE A;  4NXN L;  2MQH A;  2K5V A;  3I56 A;  4HIO A;  1QVG A;  3I4M G;  1L1O C;  1M1K C;  2HIV A;  3CCL A;  4A4I A;  1KXL A;  1X54 A;  4QGU A;  1PH3 A;  3CXC A;  4MZ9 A;  3J7Z C;  2E2I H;  3J81 c;  4B3S L;  3H3V H;  2UXB Q;  2D0O A;  3BZC A;  1KRS A;  2CWA A;  1XPR A;  1VQA A;  3ULL A;  3K7A H;  4OWW B;  1Q82 C;  4X64 Q;  5IYD G;  4AQY L;  3PCO B;  2JA7 G;  3E9H A;  3CW2 C;  1YVC A;  1PH2 A;  2UU9 Q;  3D31 A;  2AWN A;  3RR5 A;  2UUB Q;  2F4V L;  1EOV A;  4XIG S;  4P71 A;  2VUM H;  1IBL Q;  2ZM6 Q;  1K0R A;  1NY4 A;  2MNA A;  2R7Z G;  2NZH A;  2E8G A;  1SRO A;  1IBK Q;  4GLA C;  2QA4 A;  3HOV G;  4OXP A;  5GAD C;  3A5U A;  4DR5 Q;  3IRB A;  3H0G G;  4BXX G;  4DK6 C;  4LF7 L;  3J80 c;  3JC6 6;  4GN3 B;  1UE5 A;  1Q12 A;  4DUY Q;  4DV2 Q;  2MO1 A;  2WAQ E;  1Q8K A;  4A3J G;  4JI3 Q;  4MNO A;  5IT9 c;  3KF8 B;  2B63 G;  3U4Z A;  1WFQ A;  1YHB A;  3F8T A;  1RIP A;  4LF4 L;  3CD6 A;  2XTI A;  5IWA L;  4B3T Q;  2JA9 A;  4KHP L;  4HJ5 A;  4R4C A;  2KBN A;  1XNQ Q;  4DUZ Q;  3M3Y H;  1BBW A;  1E3P A;  3RLO A;  2JEA I;  2UXC L;  4UP7 A;  2N49 A;  1KQS A;  3I7F A;  2HHH Q;  5FJ8 H;  4IOA A;  4B3R Q;  4IFD J;  4C2M H;  5C0X I;  1A0I A;  4A75 A;  3PO3 H;  1VQ5 A;  3M4O H;  1N34 Q;  4JBM A;  3PSI A;  4BBR H;  1X3G A;  1E7Z A;  3BU2 A;  1BKB A;  5H1S E;  5LMU L;  4DV4 L;  4A3M H;  1CKN B;  3ER0 A;  1Y14 B;  4DV7 Q;  1XNR L;  2NZO A;  4O2D A;  1IBM L;  1OXU A;  3EN2 A;  4PZ7 A;  2V1C C;  1UWV A;  1VQC A;  3OYY A;  4DR2 Q;  5C4J H;  5IP9 G;  5M3F H;  3D0F A;  2YTX A;  1TWA H;  4NXN Q;  1L1O B;  4IFD G;  3DM3 A;  4X65 L;  3MEF A;  2ZTD A;  3UE0 A;  5JEA G;  2BH8 A;  1U5K A;  2EXD A;  1PH8 A;  2K14 A;  3E9I A;  2CKZ B;  2JK8 A;  3OTO Q;  3KOJ A;  2NVQ H;  3S2D H;  2HQL A;  1Q81 C;  2K4K A;  1VQO A;  4R4Q A;  4A3E G;  3AQQ A;  4R4I A;  4P73 A;  3CC4 A;  4JI1 Q;  1PH9 A;  3PIP A;  3CME A;  3VDY A;  4UY8 C;  1V43 A;  4DV0 L;  2VQE Q;  1Q1B A;  1SMX A;  2UU9 L;  3UE1 A;  4GLV B;  3AFP A;  3U50 C;  1X6O A;  1QUQ B;  4LNQ A;  1N8R C;  3HOU H;  4DV3 Q;  2VS1 A;  1XPU A;  1IBL L;  3T1Y Q;  4DV5 Q;  2HT1 A;  3H0G H;  3B6Y A;  4AYB E;  3OW2 A;  1SFO H;  1G29 1;  1Y1W H;  1GKH A;  4YWL A;  3RN2 A;  4LF8 Q;  1FGU A;  1AH9 A;  5M3M G;  5AJ3 L;  1OXV A;  5JJL A;  1NMF A;  3TQY A;  3JAM i;  1X3F A;  1ASY A;  4LF7 Q;  3U58 A;  2KHJ A;  2OQK A;  4HJ7 A;  4JI5 Q;  1CSQ A;  1G6P A;  4DUY L;  5IYB H;  3HOU G;  3PO2 G;  4JC0 A;  2VNU D;  2WAQ G;  2ZJR A;  3I2Z A;  2K75 A;  2E2J H;  2CFM A;  4JYA L;  4JG2 A;  4LF5 Q;  4GN5 A;  1JE5 A;  2JA7 H;  4DR6 L;  3E0E A;  1VQI A;  2ZTC A;  1WYD A;  4L5T A;  4A3D G;  4KHP Q;  1LUZ A;  2F52 A;  3GTM H;  1B70 B;  4DUZ L;  2PI2 E;  4JI6 L;  3KLW A;  4GN4 B;  5GAE C;  1ASZ A;  2R7F A;  1KRT A;  2UXB L;  4LFB L;  2Q2H A;  2ZTE A;  1VQD A;  3KDF A;  4B3R L;  1DGS A;  3LGJ A;  4LF6 Q;  2PQA A;  1NJI C;  3TRZ A;  2WB1 E;  4DV6 Q;  1Y1V G;  1YHA A;  4HJ9 A;  4DAY B;  1N36 L;  2N3S A;  5C0X G;  2UUC Q;  4PMW A;  4DV4 Q;  1Q86 C;  2KHI A;  1PYS B;  1YBY A;  2UUB L;  2F4V Q;  1IBM Q;  5LMN L;  1MJE A;  3CAM A;  1MIU A;  1A63 A;  1CKN A;  4X6A H;  5M5W H;  4JI8 L;  3F2B A;  2ZM6 L;  3RN5 A;  3T1H Q;  4A3K H;  3I55 A;  4Y52 H;  2NVX H;  2I0Q A;  1LTL A;  4YHH Q;  1VQ4 A;  4GKK Q;  3PF5 A;  2UUA L;  3M4Q A;  5JJK A;  5FJ8 G;  4IFD I;  1B8A A;  1N32 L;  5C0X J;  3ZJY C;  4L5S A;  1YJW A;  5GAH C;  3CC7 A;  2CQO A;  4A3F H;  3KJP A;  3CCQ A;  1L2F A;  3PUV A;  3M9B A;  5IYD H;  1PH1 A;  1EIF A;  1VQL A;  4JI3 L;  1WOC A;  4QY7 A;  3STB D;  2EIF A;  3RLF A;  4DV0 Q;  1PA6 A;  4IPH A;  1JJG A;  4Y7N H;  4JI4 L;  2VL6 A;  5EAY A;  2L15 A;  4IOC A;  1CUK A;  5IWA Q;  4R1J A;  1OTC A;  3NEM A;  3CCM A;  4DV5 L;  2RHQ B;  2K5H A;  5GAG C;  2JA6 G;  3S2H H;  2R92 H;  1Z47 A;  2HHH L;  5M3F G;  4H02 A;  3ULP A;  1I94 L;  2LXJ A;  4GOP C;  2R7Z H;  4JV5 Q;  1HNW Q;  1FJG L;  2I5M X;  1A8V A;  1TWC H;  1SN8 A;  3GD7 A;  3W1B A;  1Y1V H;  4YCV A;  4DV7 L;  1K8A C;  3SGI A;  2A1A A;  1HR0 Q;  1VQN A;  1XNR Q;  1QZG A;  4K0K Q;  4HIM A;  4DR2 L;  4YWM A;  3HKS A;  3TS0 A;  1OXT A;  4A93 G;  4YWK A;  4A76 A;  2KEN A;  3PGZ A;  1K83 H;  1E1O A;  4LFC L;  1EIY B;  4JI6 Q;  3TS2 A;  2YTY A;  5IY0 A;  3OTO L;  4POG A;  1GD7 A;  1IXR A;  2AHO B;  4DR3 L;  4LF6 L;  1VQK A;  4A3F G;  3WWV A;  3PUW A;  4DKA C;  3G48 A;  3MXN B;  4BA1 I;  4POF A;  3J81 i;  1N36 Q;  4A3L H;  2UUC L;  4DR4 Q;  4KLK A;  3HOZ G;  2VQE L;  2YU9 H;  2D0P A;  1D8L A;  2MFI A;  2VY3 A;  4LFB Q;  1YZ6 A;  5LMN Q;  2D62 A;  4RG1 A;  1HZC A;  5IP9 H;  1L0W A;  4DV3 L;  4OWX B;  2LXK A;  4A3C H;  3HOW H;  2JJQ A;  2QGQ A;  3T1Y L;  3T1H L;  1C0A A;  2VZA A;  3NEN A;  1GVP A;  1EWI A;  4YHH L;  2JA8 G;  5AJ3 Q;  3UDF A;  2UUA Q;  2EQS A;  1HH2 P;  2R7D A;  5E7N A;  2LSS A;  2VUM G;  1LM0 A;  4DV1 L;  2E2H H;  3HOY G;  2PMZ E;  4OX9 L;  1SR3 A;  1EYG A;  3GTK H;  3UDG A;  3HOX G;  2GVB A;  2K52 A;  4A3B G;  1EUJ A;  4JI5 L;  3CCU A;  3ERS X;  4JI7 Q;  2R92 G;  1V9P A;  1HZB A;  4MTN A;  4IJL A;  1TWH H;  1RL2 A;  2A19 A;  3J7A 5;  1G51 A;  2PI2 A;  3A5Z B;  4OWT B;  3PO3 G;  1LYL A;  1Q1E A;  4JYA Q;  3CCJ A;  1N33 Q;  4JI4 Q;  4DR6 Q;  1P8L A;  2B3G A;  4JCV E;  1KC8 C;  4WJ3 M;  3S16 H;  3ULJ A;  1X3E A;  1VQJ A;  3A0J A;  3HKZ E;  3H15 A;  1SRU A;  4IJH A;  3Q8D A;  1PFS A;  1CKO A;  2B29 A;  4PZ6 A;  4DV6 L;  2Q2U A;  1AE3 A;  3S1M H;  2JE6 I;  3JAM c;  1HNW L;  2ES2 A;  2I5H A;  3G71 A;  1CSP A;  2YTV A;  1QUQ A;  5IP7 G;  4BY1 G;  5J3B A;  1YIT A;  1SLJ A;  1PH6 A;  5M5X H;  4K0K L;  2ZJP A;  1YIJ A;  4BY7 H;  4RMF A;  3HOV H;  3CP0 A;  1S40 A;  4JI8 Q;  3GTQ H;  4TVA B;  3J81 j;  3GTL H;  4OO1 G;  2IHE A;  4HIK A;  1YHQ A;  2OCE A;  1VS0 A;  2Z6K A;  1W2B A;  4JI0 Q;  3W1G A;  4GKK L;  3CF5 A;  1N32 Q;  5JEA J;  3CQZ H;  1EQQ A;  3BJU A;  4NXM Q;  1NBW A;  4O0A A;  4UPA A;  4DR3 Q;  3RZO H;  3G6E A;  1WCM G;  3FKI G;  1FVI A;  3CCV A;  1D7Q A;  5DLQ E;  4C3I H;  1U0L A;  2ZJQ A;  2PQA B;  2KCM A;  3CPF A;  4DR4 L;  3STB C;  1VQF A;  1MKH A;  1UE6 A;  3F2C A;  4YY3 Q;  1YI2 A;  1YEZ A;  1VQ8 A;  3PF4 A;  4BXX H;  3FP9 A;  3KDF B;  1J5E Q;  1XPO A;  2IX1 A;  4P75 A;  1T9H A;  5FLX c;  1UE1 A;  4QQB X;  3L0O A;  3HOY H;  3W5O A;  1K8G A;  1V1Q A;  1TWF H;  4PG3 A;  4DR1 L;  2RCN A;  4JI2 Q;  2JA8 H;  5GQO A;  1I94 Q;  4A3K G;  4OX9 Q;  4KHZ A;  1X55 A;  4JV5 L;  3K7U C;  4GS3 A;  4PZ8 A;  5IYC G;  3K81 C;  4JBW A;  4OO1 I;  1HR0 L;  2NN6 G;  4XTC S;  3PUY A;  2PNH A;  4YCU A;  3S1Q H;  2ATW A;  2CCZ A;  5LMN W;  3NEL A;  4A3L G;  1N9W A;  2WFW A;  1MJC A;  1AE2 A;  3CC2 A;  4LW1 A;  4LFC Q;  4B3M Q;  1FJG Q;  4C3H H;  5HGQ A;  2IHF A;  4APV A;  3I4M H;  1PH4 A;  3KF6 B;  5JJI A;  4EX5 A;  2XGT A;  2VQF Q;  2IT1 A;  1B7Y B;  4DR7 L;  4A3D H;  5C4X H;  1K9M C;  4AIM A;  1BBU A;  3TEH B;  1K73 C;  2N78 A;  1O7I A;  2R93 H;  3GO5 A;  3CMA A;  3PV0 A;  4IPC A;  1VQ6 A;  3PO2 H;  4X66 Q;  5IYB G;  4JBK A;  4LF9 L;  4LWC A;  3ICE A;  4HID A;  4DAM A;  2ALY B;  2BA1 A;  4FDB A;  4JOI A;  4QL5 A;  5FLM G;  1VQ7 A;  1X9N A;  1C7Y A;  2JA5 G;  2QEX A;  3AYH B;  2JQO A;  2OWO A;  1XMO L;  3S15 H;  2NVY H;  3BZK A;  1S72 A;  2JEB I;  4DV1 Q;  5K36 G;  4HJ8 A;  2JA6 H;  3UDI A;  3FHW A;  4LFA L;  2GN5 A;  2H5X A;  4NPS A;  4GKJ L;  1C9O A;  4JI7 L;  1QZH A;  1S3O A;  3FKI H;  4QIW E;  1YJ9 A;  1HNZ Q;  2Q2T A;  1N33 L;  4LUZ A;  5ELO A;  1R9T H;  4A3E H;  4C3J H;  1XMQ L;  3GTG H;  3I4N G;  4X62 Q;  3S1N H;  2Y0S E;  4A3J H;  3HKZ G;  1VQE A;  1JJC B;  5FLM H;  4BBS H;  4JI2 L;  1K3R A;  3A74 A;  5M3M H;  2RF4 A;  2GVA A;  1PH5 A;  1A62 A;  4IO9 A;  1UEB A;  1Z9F A;  2IX0 A;  1IL2 A;  4DK3 C;  4GOP B;  4BA2 I;  1HZA A;  3K8A A;  2NVT H;  3GTO H;  1VQH A;  3G4S A;  3DLL A;  2R93 G;  5BR8 L;  1SE8 A;  3S24 A;  5ELN A;  1HR0 W;  3L2P A;  4DNI A;  3I4N H;  3HOZ H;  2AKW B;  1OXS C;  1VQM A;  1HJP A;  3F1Z A;  4LUO A;  1M90 C;  4ALP A;  1H95 A;  1TWG H;  1YJN A;  2KCT A;  3AEV A;  2R6G A;  4GNX A;  4JI0 L;  4UP8 A;  4WJ4 A;  2NN6 I;  1GO3 E;  4B3M L;  2OTJ A;  1XTD A;  3RLN A;  3H3V I;  1I50 H;  1X65 A;  2VQF L;  1BVS A;  1JMC A;  5C44 G;  2CWP A;  4DR7 Q;  3KF6 A;  2DGY A;  4NXM L;  5C44 H;  2Q2I A;  4AYB G;  1NE3 A;  2E5L Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...