3UDGA

Structure of deinococcus radiodurans ssb bound to ssdna
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
231
structure length
211
Chain Sequence
RGMNHVYLIGALARDPELRYTGNGMAVFEATVAGEDRVIGERNLPWYHRVSILGKPAEWQAERNLKGGDAVVVEGTLEYRQWEAPEGGKRSAVNVKALRMEQLGTQPELIQDAGGGVRMSGAMNEVLVLGNVTRDPEIRYTPAGDAVLSLSIAVNENYQRQEKVHYIDATLWRDLAENMKELRKGDPVMIMGRLVNESTRVEATRVEALAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Single-stranded DNA-binding protein
publication title Structure and Cellular Dynamics of Deinococcus radiodurans Single-stranded DNA (ssDNA)-binding Protein (SSB)-DNA Complexes.
pubmed doi rcsb
source organism Deinococcus radiodurans
total genus 42
structure length 211
sequence length 231
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3udgA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3udgA02
4A3KG 2UUCL 4A3CG 3L2PA 5AJ3L 3U50C 4BBRH 4OXPA 4AH6A 5C4XG 3PUWA 4R4CA 3GDEA 2NN6G 2JQOA 3HKSA 1AE2A 5C3EG 5JJIA 1TWAH 2VUMG 4RMFA 1OXUA 2AMCB 2WB1E 3TEHB 1HZCA 3UE1A 2CKZB 2I5LX 4POGA 2AHOB 3J80i 1QZGA 1WYDA 1XMQL 1K73C 3GTGH 3S1QH 4LF4Q 4JCVE 3G6EA 2ZJRA 1IXRA 2IY5B 3S16H 1J5EQ 2K75A 5M3FH 1VCIA 1Q8KA 3I4NG 1GD7A 5GQOA 4A3GG 3FKIG 3ER0A 3PUVA 3F2BA 2DGYA 2CWPA 4C3IH 2JA5H 4X65L 1W3SA 1JJCB 3MXNB 1Q81C 1HNWL 1IL2A 4JI8L 4HJ8A 4JYAL 1VQHA 1YIJA 2VL6A 5GAHC 4A3LH 2KHJA 1M1KC 1OXSC 1CSQA 4C2MH 4NXNQ 4A3FH 1XNQL 3CQZH 3UDXA 4Y52H 2MO1A 5DLQE 2UUAL 3ULJA 4X65Q 3CMAA 4GS3A 4DR3Q 5JJKA 1X3GA 2IHFA 4GKJL 1CKNB 4LWCA 2OQ0A 3PUYA 1YJ9A 1D8LA 4DR6Q 3S1RH 1I3QH 4NPSA 4JBMA 2R92G 5BR8L 4IFDG 1MJCA 1O7IA 3OYYA 4NXMQ 3CCJA 4UY8C 4JI5Q 5IYDH 4JI3L 4BY1H 3H0GH 4QJFA 3DLLA 1S72A 1KAWA 2VQFQ 1X9NA 4LF5L 1UWVA 2UUAQ 1L1OA 2K50A 1UE5A 3UDIA 2N3SA 5FJ8G 1EOVA 2GVAA 4LF8Q 4LFAL 4DV6L 1XMOL 4LFCQ 4A3BG 1TWHH 5GAEC 2F4VQ 4AQYQ 3OTOQ 5IYCH 3PO2H 3CPFA 5LMNQ 2IX1A 4A3DH 4QGUA 3HOUG 4LF9L 2UXDL 1G291 1Q7YC 3K81C 2GN5A 3H15A 1XPOA 4XTCS 3HOXG 1XJVA 2ES2A 3I2ZA 4IPCA 1PHJA 1QVCA 3HOYH 1TWGH 3CC2A 2RCNA 1NMGA 4LF5Q 3GTQH 1X3EA 5IP7G 2F3IA 5C0XI 2VQEL 4A93H 4YWMA 1XMOQ 1IBLQ 4HJ9A 1QUQB 3HOZH 5M3MH 4OWWB 3PF5A 1V9PA 2JJQA 1CKNA 5J3BA 4DUZL 3HOVH 1V43A 4LF9Q 4X64L 2AWNA 4LF7L 1LYLA 3G71A 3RLFA 3I4MH 4B3RL 2WFWA 2KENA 2ZTEA 2PNHA 2A8VA 5C44G 4JI6L 2JA7H 3M4PA 1I5FA 3CF5A 2E5LL 1I50H 1Q1BA 1PV4A 5IYBG 2CQOA 4LW1A 2MNAA 1HR0W 2FXQA 5FLMG 2VW9A 5M5YH 1KD1C 1PH8A 3UDFA 1Y14B 4YCUA 2E2JH 1Q12A 4X62L 4GKKQ 1UE7A 2R6GA 3HFZB 3AFQA 5C4JH 4MTNA 1SFOH 3JC66 2E8GA 3CXCA 3VDYA 3OW2A 4PZ7A 2HT1A 2I5MX 4LFBL 1GO3E 4HIDA 2WP8J 3JAMi 4A3JG 4BXXH 1KHIA 2K5VA 2NZOA 1KRTA 4HJ5A 1FVIA 4JI6Q 2PI2E 2ZTDA 3NEMA 4JI0Q 1VQGA 1SRUA 1X3FA 2VZAA 1HNWQ 3KOJA 1HH2P 4GOPC 2K52A 4K0KQ 4B3SQ 2OQKA 4DUYL 1Y1WH 3M3YH 1SLJA 2EXDA 4DV1L 4A3IG 1EFWA 2MQHA 1VQ8A 1UE6A 2PQAB 2V1CC 4A3KH 3KF6B 4Y7NH 4A3CH 4X62Q 4DAYB 4YWKA 1K8AC 1FJGL 3S1NH 1X6OA 1QUQA 4UP8A 2C35B 4GLAC 3KJPA 3U4VA 4GN4B 2PI2A 1KQSA 1PFSA 2VS1A 2HHHL 4JI2Q 1N36Q 4MZ9A 1SROA 4JBWA 4JI1Q 5IWAL 1N9WA 2UXCL 3Q8DA 1E1TA 4A3EG 1VQDA 4DNIA 1EQQA 1HNXQ 2MO0A 1EWIA 3RR5A 4OX9Q 4JOIC 4TVAB 5JEAG 2NZHA 3I55A 3PUZA 1MKHA 4A75A 4GOPB 1M90C 2Z0SA 1JE5A 1YNXA 4DV7Q 1N32L 2ALYB 2LSSA 2JA6H 3CCSA 3GTJH 4DR2Q 3EBEA 4IPGA 3I4NH 2B63H 4P72A 1H95A 2D0PA 4BA1I 3ERSX 4OO1I 1VQAA 1IBMQ 3RNUA 4YHHQ 2D62A 2LXJA 5IP9G 4IPDA 1VQFA 3K80C 2WAQG 3RN5A 5IWAQ 5IY0A 1N34L 1K8GA 3FHWA 3T1YQ 2UUCQ 2D0OA 1K0RA 3M85A 4KLKA 2K14A 4IOAA 5AJ3Q 1YBYA 2R7DA 5FLXc 2CCZA 3DM3A 3J81c 2N78A 2R7FA 2Q2TA 3KLWA 3KF6A 4XIGS 1K9MC 1IBKL 4BBSG 3W1BA 1UEBA 1X65A 1VQJA 1A63A 1GKHA 1XMQQ 4EQ5A 3F2DA 1HR0L 3K7AH 1OXXK 1JB7A 3CP0A 1Z47A 2AWOA 1X55A 4QL5A 4IO9A 1PH7A 2UU9L 1VQNA 1LM0A 1XTDA 4BBRG 4JI4L 1PH9A 1YHBA 2BA0A 1ASZA 1VQ4A 4A3MH 1NTGA 4YWLA 4DV4L 3U58A 2JA8H 5GADC 1EQRA 5M5WH 3RZOH 1SE8A 2Z6KC 4JI7L 1EIFA 2JEBI 4HJ7A 2AKWB 1PH6A 4JI8Q 1IBKQ 4FDBA 4TQUS 2RF4A 4GLXA 4X66L 1AE3A 5M5XH 3KDFB 1EIYB 4JYAQ 1YHAA 1Q46A 4B3ML 2R7ZH 5M3FG 4A3BH 2UXBL 1Z9FA 1VQMA 4APVA 4OO1G 3CD6A 1EUJA 2ID0A 1YITA 4GNXC 1E24A 1TWFH 3HKZG 3T1HL 1WCMG 1XNQQ 2K5NA 4DR5L 4KHPL 4EX5A 4IPHA 3PIPA 3HOXH 1P16A 4HIOA 4GKJQ 4WJ4A 4JI7Q 1VQ6A 1VQLA 2CFMA 3F2CA 3PO3G 3AQQA 3STBC 3GTKH 2JK8A 4POFA 3ICEA 3E9IA 3M7NA 5BR8Q 2RHQB 1HNZL 1FL0A 1KC8C 4JI3Q 3T1HQ 1K3RA 3AYHB 4DK3C 4JV5L 4DV3L 4X6AH 3KJOA 4YCWA 2NVYH 4R4IA 2K5HA 4LUOA 4HIMA 3PF4A 3HOWG 1A8VA 1HJPA 1BBUA 4LFAQ 1RIPA 4MNOA 4DV6Q 3TRZA 1VQOA 4DR7L 3J7ZC 1S40A 1CUKA 5ELNA 2IX0A 3BZCA 4GLVB 1U0LA 3K8AA 4DKAC 3CPWA 3CCMA 2UXDQ 3KDFA 2ATWA 4QY7A 3M9BA 3SGIA 2UUBL 3CCEA 1GM5A 1WFQA 3H0GG 3CCQA 4BY7H 2EQSA 1OTCA 3BJUA 1YHQA 3L7ZC 5IT9c 2BH2A 2MFIA 1TWCH 2BA1A 2VQEQ 3U4ZA 5IYCG 3PO2G 1JJGA 4A3DG 1KIXA 1E22A 2Z6KA 4GN5A 3S24A 4DUZQ 1YVCA 3B6YA 4L5QA 3ULLA 5H1SE 1VQ9A 4X64Q 4L5RC 4LF7Q 4C3HH 4B3RQ 4RG1A 1BVSA 1E3PA 1D7QA 1OXTA 4LF6L 3GTPH 4JC0A 2E5LQ 2QA4A 3H3VH 2NN6I 3PCOB 1DGSA 1B8AA 4R4QA 1JMCA 1CKMA 3G48A 4JBJA 3HOZG 1SMXA 1MJEA 1X54A 4YCVA 3HOVG 1AH9A 1C0AA 2NVXH 3TREA 1XNRL 5EAYA 5C4XH 3F1ZA 1RL2A 1KRSA 2K4KA 5C0XG 4LFBQ 5C3EH 4NB3A 2JA7G 1MIUA 4OONA 2VUMH 3RLNA 4YY3L 4O2DA 2NVTH 1PYSB 1VQEA 4DV2L 1YEZA 3J80c 4DUYQ 1VQIA 1TXYA 4UP7A 4DV1Q 1B70B 1P8LA 5LMNW 3TS0A 2Y0SG 1NJIC 2ZJQA 1PH5A 1FJGQ 4A3GH 1YJWA 4LUVA 3FKIH 1XNRQ 4UP9A 3D0FA 1C7YA 3I7FA 2JEAI 1Q82C 2KBNA 1NE3A 2DUDA 2HHHQ 3S1MH 4IJLA 2ZM6L 2OTJA 3CCRA 3J7A5 4DV5L 2UXCQ 4BBSH 3GO5A 4IFDJ 4LF4L 4QIWE 4GN3B 4DV2Q 1NMFA 1Q1EA 3AFPA 4JG2A 1J5EL 4JBKA 2N8NA 5E7NA 1L1OC 1R9TH 4PZ8A 2R93H 1X56A 3GTLH 2JE6I 3ZJYC 5LMUL 2PQAA 1I6HH 1BBWA 2YV5A 1E7ZA 4IOCA 4IFDI 1G51A 1Y1VG 2RHSB 2OWOA 2ZM6Q 2EIFA 1N34Q 3I4OA 1VQCA 4DV5Q 2I5HA 1BKBA 1U5KA 2ASBA 3GTOH 2IT1A 4HIKA 2IHEA 3CC4A 3CC7A 2Q2UA 2HIXA 2Y0SE 2R92H 2JA6G 1G6PA 4NXNL 4OWXB 4GOPA 2YTVA 2QEXA 3CCUA 1L1OB 2B63G 1SN8A 1NBWA 3J81j 3MEFA 3CCVA 3RN2A 5LMUQ 1A62A 1WCMH 4HJAA 3S14H 3CMEA 4DR3L 1PYBA 3PSIA 2WAQE 1WJJA 4UPAA 1HR0Q 1HZBA 1WI5A 5FJ8H 1UE1A 3UDGA 3TQYA 2VNUD 1VQBA 2UU9Q 3PUXA 1B7YB 3ULPA 2YU9H 3PO3H 2Q2IA 3J81i 3L0OA 4JI4Q 2JA5G 3HOUH 4B3TL 4NXML 1FGUA 4KHZA 4JI5L 1QVGA 5JJLA 3TS2A 4AIMA 4JOIA 4DV4Q 3I56A 2YTXA 4DAMA 2KHIA 2VQFL 2OTLA 1C9OA 2VY3A 3KF8B 4X66Q 1VQ7A 4LF8L 1I94L 3HOWH 4A3LG 1PH1A 4LFCL 5IP7H 2F4VL 2GVBA 4B3MQ 4AQYL 1LTLA 3OTOL 4AYBG 5LMNL 2UXBQ 4A3FG 4P75A 3RLOA 3KYHC 4ALPA 3CW2C 1K83H 4A3MG 4GNXB 3BZKA 1L0WA 4B3TQ 2HQLA 4DR5Q 4KHPQ 2I0QA 2JA8G 5GAGC 1PVOA 1T9HA 3E0EA 3CCLA 5C44H 3G4SA 2PMZE 3IRBA 4J15A 5IYBH 1YJNA 4DV0L 1QVFA 3UE0A 2R7ZG 1I94Q 1IBLL 5FLMH 3KFUA 3S17H 2R93G 3M4QA 3WWVA 5IYDG 3HKZE 5C0XJ 5HGQA 1S3OA 2H5XA 2Q2HA 1HNZQ 4BY1G 4KI0A 1A0IA 3A0JA 3GD7A 4JV5Q 2ZTCA 4DV3Q 1PH2A 4A3JH 2CWAA 3E9HA 4LUZA 3NENA 5JEAJ 3JAMc 4OWTB 4DR6L 1Q86C 4L5TA 1JJ2A 1IYJB 2L15A 4DK6C 4DR7Q 4DV0Q 3M4OH 3H3VI 3PIOA 1KXLA 4AYBE 3S15H 1NY4A 3W5OA 4A3IH 1PA6A 4GKKL 1XPUA 1KL9A 3A5ZB 2UUBQ 5K36G 4C3JH 3W1GA 1IZ6A 3HOYG 1VS0A 2NVQH 3STBD 1J6QA 3LGJA 3EIVA 2B29A 5IE8A 4ME3A 3AEVA 4BA2I 2A1AA 4DR4L 4WJ3M 4JI0L 4IJHA 4GNXA 1WOCA 4A93G 1SR3A 2LXKA 3RZDH 1CKOA 2A19A 2YYZA 5M3MG 1YI2A 1PH4A 1VQ5A 3GTMH 3FP9A 4H02A 2B3GA 3BU2A 4DR1L 4A3EH 5GROA 4R1JA 4B3SL 1QZHA 4LNQA 1N33L 4K0KL 1JT8A 2XGTA 2ZJPA 1L2FA 2HIVA 1N32Q 5HY6A 3NBHB 2N49A 1XPRA 1VQKA 3I4MG 1VQPA 2BH8A 1YZ6A 4P73A 1ASYA 4BY7G 4P71A 4PG3A 2JA9A 3PGZA 2WB1G 4O0AA 1N8RC 2XTIA 1PH3A 4L5SA 4LF6Q 3D31A 3CAMA 4R4TA 1HZAA 1LUZA 1N36L 4JI2L 4JI1L 4A4IA 4DR4Q 2KCMA 2E2HH 3K7UC 2YTYA 5IP9H 1CSPA 3PV0A 3F8TA 4DPGA 1HNXL 1E1OA 2E2IH 4OX9L 4DR1Q 4QQBX 1W2BA 2QGQA 1V1QA 1N33Q 3K0XA 3NELA 4DV7L 3A5UA 4A76A 4BXXG 1HZ9A 4DR2L 4P74A 1OXVA 3S2DH 2OCEA 1GVPA 3A74A 4R4OA 4PZ6A 1EYGA 1IBML 2KCTA 4YY3Q 4YHHL 3EN2A 1Y1WG 5ELOA 4PMWA 1Y1VH 3T1YL 3S2HH 2F52A
chains in the Genus database with same CATH superfamily
1NCVA 4A3KG 3L2PA 1EY8A 3P20A 3MXPA 5C4HA 1ILPA 3GDEA 2NN6G 3BVZA 1MSGA 2AMCB 5LHY1 2WB1E 3S1NB 3UE1A 5EKKA 3G6JB 3C2PA 2EYFA 2RSOA 1K73C 2F0QA 4LF4Q 3U9OA 3FPUB 4RWSC 2ZJRA 1IXRA 4KN4C 3S16H 2CQAA 3EROA 5G3LF 4F8MA 1G2TA 4FNFA 2PPBC 1WTXA 4CBVA 1H9KA 3MXNB 3I4NB 5C6AA 2XN9C 2F3VA 2K04A 1D1IA 1XX8A 3S1MB 1ET9A 1LTID 1X3QA 1M1KC 4XQJA 1SJED 4A3FH 1G2SA 2DY7A 1SNPA 2IW3A 3UDXA 2UUAL 4IUTA 3SK5A 3CMAA 3ITPA 4FXDA 1EEID 1SE3A 1VMCA 4LWCA 4ODGA 1LABA 2WACA 5E3FA 1YJ9A 1PDQA 5IGCA 3S1RH 1I3QH 2ZXPA 3QOJA 3L3OC 5CV8A 5BR8L 4IFDG 4UY8C 4Z9CB 4QJFA 3DLLA 4LF5L 1L1OA 1VF5C 5FJ8G 4LF8Q 4DV6L 5CV6A 3PIP3 2F0IA 3HOUG 4CKEA 4LF9L 3K59A 3K81C 1Q90A 4XTCS 5ELCA 3EFXD 2OXPA 1TWFB 3CC2A 2EYHA 1A15A 5CV4A 3GTQH 1D6EC 5C0XI 1PTOD 1XMOQ 3PF5A 2JJQA 1SYEA 3DMUA 2QDLA 2A74C 1TR5A 2AWNA 3QOLA 1Y69U 1GUNA 1TKWB 3M4PA 1HR0W 2FXQA 5EPLA 4K8JA 5M5YH 1QG7A 3QB3A 1Y14B 1KDAA 2E2JH 2B2VC 3AFQA 2I5MX 4KHVA 3D4WA 4HIDA 4BXXH 1GUOA 2K5VA 1FVIA 3OIQA 2ZTDA 4GZYC 3A7AB 1VQGA 1RODA 5D3DA 1HH2P 5I6WA 4B3SQ 2OQKA 3BDCA 4A3JB 3M3YH 4A3IG 2MQHA 1VQ8A 4A3KH 4C3HG 4X62Q 4YWKA 3I3CA 3P75A 1X6OA 2K28A 5IGBA 1CHPD 1S5FD 5CV5A 1PFSA 1SROA 4JI1Q 4QCLA 2NTSA 3Q8DA 1JICA 1K28A 1KLUD 2PW7A 4OX9Q 4NMZA 4JOIC 5CC4A 3I55A 2K32A 3P7JA 1F2LA 3RZDB 3A8KE 3V2TA 4DV7Q 5C3XA 2JA6H 3TDQA 3GTJH 4DR2Q 4PNYA 4CDCC 2RSNA 2MGSA 1GUSA 2X6GA 1MD2D 1NAPA 2D62A 5IP9G 1N34L 3K80C 2WAQG 3T1YQ 3JAME 1EU4A 2UUCQ 4ID6A 2D0OA 3VR6A 1TU2B 4KLKA 3TSSA 1LT5D 2R7DA 3NTKA 5FLXc 2K05A 3J81c 2JYOA 1B3QA 1K9MC 1AW7A 2XNAC 1X65A 1VQJA 3MTSA 1HR0L 3F2DA 4WJWA 3S2DB 3CRLC 2Z1CA 2AWOA 1X55A 4BBSB 1VQNA 1SE4A 2LS01 4BBRG 4JI4L 1FNWA 1ASZA 1FR3A 4A3MH 2QW7A 2RVLA 4ILWA 4YWLA 2IWHA 1SMYD 1SE2A 4JI7L 3NBIA 1PH6A 1IBKQ 4FDBA 4TQUS 5M5XH 3KDFB 1YHAA 5ELFA 4DAVA 1Q46A 1SYBA 4KY5A 4ABNA 5M3FG 1IKLA 1YITA 3S1QB 3A7LA 1XNQQ 4KHPL 2L55A 4HAEA 2ICEC 4G4KA 4EX5A 1QE6A 4HEDA 1KTKA 4WJ4A 3HKZB 1STEA 5FO7B 1FGBD 1KNAA 4C3IB 1VQLA 1UNSA 2QDBA 4M8AA 1HCZA 3GTKH 2EY6A 5LL6S 2L11A 1ICFB 1YNJD 4JI3Q 3PO3B 3KJOA 2L9HA 2NVYH 2OT2A 1SYFA 2EY1A 3HOWG 3BDLA 3CQZB 1RIPA 2EPBA 1I4QA 5FLXL 4LJZC 5KGUA 3KDFA 2ATWA 4QY7A 3SGIA 4JW0A 3H0GG 2EQSA 2F0NA 1PLFA 2BH2A 5IYCG 4A3DG 1KIXA 1E22A 2PZUA 3S24A 4HCSA 3B6YA 4PV1C 2QILA 2HD3A 4C3HH 1RKNA 2FMMA 1PRTD 2RDGA 5M9OA 1D7QA 4RCOA 4YIJA 3PCOB 1DGSA 1B8AA 1JMCA 2PNRC 4RH6A 1AZPA 1X54A 2R3ZA 5FO8B 3HOVG 2F1MA 5KIXA 4V0BA 1SNQA 4NB3A 2JA7G 1SSOA 4IALA 4O2DA 1PYSB 5KNDA 2KQ3A 1YEZA 4NW2A 5ISRA 4HSVA 2WB1B 4RAUC 1DONA 5J1ZA 1PH5A 1FJGQ 4UP9A 1A2TA 3D0FA 3I7FA 4QB4A 1Q82C 5C4JB 2DUDA 3H91A 3S1MH 3NE5B 4FF3A 3J7A5 3N6RA 3GO5A 3NQTA 4EVOA 4U673 4GN3B 4DV2Q 1RTNA 1NMFA 2EJMA 4JG2A 1J5EL 2K5DA 1RTOA 5E7NA 4JBKA 1G91A 2B2TA 4XT1B 1X56A 3C46A 3ZJYC 2PQAA 1PFBA 1O78A 4IOCA 4Y7NB 1JOQA 2KHSA 2OWOA 5FOBB 1VQCA 4OEMB 1BKBA 1U5KA 2IT1A 4HIKA 4NKLA 3CC4A 2Y0SE 1Y1VB 1IHZA 3X3NA 3S2HB 4GOPA 1SN8A 3RN2A 5LMUQ 2Z9HA 1A62A 5JVG3 4N8FA 1I4RA 4I7ZC 3CMEA 3PSIA 2WAQE 4DU9A 1UE1A 3SDZA 1B7YB 3ULPA 2Q2IA 1SNDA 3L0OA 4C3IG 2Z4HA 1QVGA 1PTOC 5C5LA 3NXWA 2G9DA 3I56A 4DAMA 2VQFL 2RCFA 4X66Q 4A3LG 5BN5A 3HOWH 4LFCL 1H9SB 4B3MQ 3OTOL 2UXBQ 1CHQD 3J80E 2EOTA 5EKIA 2HQLA 3NTHA 4DR5Q 2JA8G 1QWYA 3E0EA 3CCLA 4A3FB 4KJNA 3IRBA 5CORA 5KRUA 4J15A 4RKLA 5IYBH 2R7ZG 1IBLL 1HTPA 4ZYSA 3VR2A 4BY1G 4OGQC 3A0JA 1SYCA 2ZTCA 4DNRB 4DV3Q 3LNNA 4A3JH 4LUZA 4XXEA 4N9PA 5JEAJ 3JAMc 1U4RA 3TZUA 4XYOA 4OWTB 1K3BC 2F0TA 1V1OA 1JJ2A 2L15A 4DK6C 3A55A 3R3OA 1KXLA 3PIOA 4AYBE 1NY4A 1ENCA 4GKKL 3V96A 2AQ3B 1B44D 3A5ZB 2B8GA 1H9SA 3AMUA 1IZ6A 3UI2A 1VS0A 5T1IA 1ZKOA 3E6ZX 4R8NA 4WJ3M 3SR1A 1SR3A 3RZDH 2A19A 4S3SA 3BZDB 4H02A 3BU2A 2G5DA 4DR6Q 4ZKCB 3GTQB 2ZJPA 2LY7A 3I4MG 2BH8A 3NP8A 4ZK9B 2VB3X 3Q0AA 2WB1G 4LF6Q 1N36L 1M8AA 3K7UC 2F0EA 4IQZA 3CRKC 4WRDA 3PV0A 3F8TA 4CJ1B 1E1OA 4DR1Q 4B9XA 1W2BA 2QGQA 1TWCB 3I4LA 2A5HA 5I2XA 3S2DH 1GVPA 4RGMA 3K5NA 3EN2A 1Y1WG 5FO9B 5ELOA 2ZXOA 1BUVT 2F52A 4DXGA 1LV9A 1SMYC 3GTPB 1D5XC 3F2UA 3U50C 2XIWA 2JQOA 3HKSA 3JAML 1TWAH 4A3KB 1OXUA 1HZCA 1KDCA 2I5LX 4POGA 5JOBA 2Z4IA 3J80i 1WYDA 1XMQL 1PFNA 3SK4A 3I90A 3S1QH 2VXWA 1S5BD 2IY5B 3I70A 2K75A 4RGTA 4OO1H 3HZXA 3PUVA 4WFN3 3ONAB 4C3IH 3X3MA 1DYQA 4X65L 3ND8A 1PMRA 1B9MA 1LTAD 3GTJB 1YNJC 1H9JA 1HFGA 1MSHA 2CH4W 4HJ8A 4JYAL 3OIPA 1YIJA 1HFNA 5GAHC 2A69D 2B2WA 4A3LH 2AUKA 1BQQT 1UAPA 1PTOH 4C2MH 4L8JA 3CQZH 1DXMA 1R9TB 1B53A 5JJKA 1X3GA 4GKJL 3OWEB 1CKNB 2OQ0A 1OO9B 4DXFA 3D4RA 5JPNC 4K5WA 2KCNA 4EQOA 3VYSA 1MJCA 1LLRD 3OYYA 4NXMQ 3CCJA 4JI5Q 3GTOB 4ZKBB 4BY1H 2K03A 1VMPA 2UUAQ 2K50A 2N3SA 1GJXA 2O2LD 1GHJA 5GAEC 1FNVA 1PRTC 3OSOA 5BN4A 2NWGA 3CPFA 3HG9A 2UXDL 4FYDA 2K5WA 2GN5A 3NSWA 3H15A 1D5MC 3G7LA 2X69A 1TWGH 3HOUB 2RCNA 4LF5Q 3RUZA 3SE0A 2F3IA 2A6EC 2VQEL 2XWBB 4HJ9A 2PQEA 4OWWB 2BDNA 3KBGA 1V9PA 4BS9A 1CKNA 2PZWA 4LF9Q 4LK1C 1D2BA 3I8ZA 1G6ZA 3RLFA 2SDFA 3I4MH 4B3RL 1ENFA 2A8VA 1T5EA 4JI6L 5IGGA 4ZUIA 3CF5A 2E5LL 1HXYD 2NVYB 5FLMG 1KD1C 3UDFA 1AEXA 2R6GA 5C4JH 3JC66 2E8GA 1O7ZA 3OW2A 1TQOA 4HMIA 1SNOA 1FNUA 1EY7A 4LFBL 2RQXA 2JN4A 5CV7A 5EBDA 1KHIA 1HQRD 2SEBD 3VYTA 2VZAA 2N88A 3E5SA 4K0KQ 1Y1WH 1SLJA 4DV1L 4Y7NH 1K8AC 2O5JC 4HTHA 2XWJB 3HGBA 4GN4B 2PI2A 4A3IB 1EOTA 2HHHL 4C3HB 4MZ9A 1Y8PB 5IWAL 1E1TA 1CFMA 1HNXQ 1DM0B 4RGOS 4A75A 3R8BA 1KAAA 1YNXA 2Z8LA 2F0HA 2K1BA 2ALYB 3IL8A 1H95A 4BA1I 2KOLA 1VF7A 2EYOA 1IBMQ 2KECA 2K7VA 3RNUA 2Y0SB 2LXJA 4PQXA 3FHWA 1Q8IA 3TZDA 3W3AA 1K0RA 3P1HA 5KNBA 1K0SA 3TP7A 5AJ3Q 3T4AC 2WAQB 4IUNA 2E2IB 3DM3A 1BCPD 2XVSA 2R7FA 3KLWA 1STAA 3A54A 3W1BA 4I7AA 1UEBA 5ELDA 1OXXK 1V8QA 1TS4A 1Z47A 2UU9L 3LX0A 1PH7A 2NTTA 3HP3A 3D6WA 1XTDA 4X3SA 3DWAA 2RA4A 4KMUC 2B2UC 1NTGA 4DV4L 4O42A 5GADC 1E2ZA 4BBRB 2Z6KC 2DNCA 1EIFA 4CGYB 4HJ7A 2AKWB 3K5OA 4JI8Q 4GLXA 3E3XA 1HA6A 2I46A 5KNCA 4FVMA 3OHXC 1VQMA 4H44C 3A56A 1QNKA 2AUJD 1WCMG 2K5NA 1EY5A 3VR4A 2EYMA 5E1FA 5M3FB 1P16A 4HIOA 4JI7Q 2EYLA 1STNA 3QR8A 3TP5A 2O4XA 3MXNA 3GQBA 3E9IA 4FF1A 3M7NA 3QO2A 5EPJA 2RHQB 4ZAIA 1FL0A 1HNZL 4FO2A 3AYHB 4JV5L 5FK9C 1LTRD 4LUOA 4HIMA 4LFAQ 4MNOA 3MEHA 3TRZA 4RCNA 5D14A 4K2KA 1CUKA 3CPWA 3BZCA 3HOWB 1U0LA 3CCEA 1WD1A 1GM5A 4CKCA 3CCQA 2LMCB 5A2QE 4OELB 3BJUA 1YHQA 2EZVA 4HSPA 3QJYA 1JB3A 3H0GB 1TWCH 4DA2A 3PO2G 2M2LA 4K2LA 5G3LD 2O5IC 4DUZQ 4GN5A 1WTWA 3ULLA 5H1SE 4X64Q 4LF7Q 1TWHB 4DAPA 1ZEQX 3Q22A 1ET6A 1J8IA 3PIO3 4A3DB 1LTGD 3GTPH 3H3VH 2NN6I 4QUFA 4R4QA 3HOZG 4JBJA 1DD2A 1TS2A 4YCVA 1AH9A 1QNUA 4C3JG 1B9NA 1XNRL 4WORA 3J7AF 2NN6H 4QIWB 1STYA 4KD4A 3HOVB 2F0WA 4J8QA 4DUYQ 2JA7B 1VQIA 2DY8A 1TXYA 1B70B 1NJIC 2Y0SG 5EGTA 3NHHA 2L4NA 3URYA 4F7XA 4LUVA 1EWCA 2A69C 2MHVA 4Q0FA 2KBNA 1UEAB 3CCRA 1CZGA 2UXCQ 1SJHD 1HRJA 1F9QA 2F0DA 4LF4L 1HQMC 1JORA 1LT3D 3KBXA 1R9TH 1L1OC 3NWTA 4PZ8A 1EY0A 1U4LA 4KJOA 1E7ZA 1SAPA 1F9PA 5C3WA 4IFDI 4KY7A 2ENBA 2ASBA 3GTOH 3NTIA 1CT1D 2HIXA 4C56C 4E6IA 2IL8A 4IFDH 1G6PA 2B63G 1NBWA 3J81j 1WCMH 3S14H 2EDGA 3W2DA 4ZRZA 4EQNA 1TWAB 4NP5A 3WDNA 5FJ8H 3UDGA 3TQYA 3DEOA 2VNUD 3SVMA 2I07B 3HOUH 3R2TA 4B3TL 1DOLA 2SOBA 2NB0A 5JJLA 1CA6A 3BG3A 1V1PB 1EIHA 1JWUD 2YTXA 1SYGA 2OTLA 3BVMA 1IYUA 2G9HD 3LWEA 3KF8B 4LF8L 1I94L 2PZTA 3T53B 2B2YC 4AYBG 3RLOA 2RDHA 3KYHC 3K7AB 3TN2A 3CW2C 1CK1A 2EYJA 4GNXB 3BZKA 2I0QA 2EJFC 3Q23A 1PTOB 4C2MB 1T9HA 2F0SA 2PMZE 5FKAC 5ELEA 3T13A 4DV0L 2JA8B 3GV6A 3J81L 3RZOB 3M4QA 2GA4B 1ONLA 2SNSA 3VYRA 3SEBA 3ND9A 5BN3A 1C8CA 1A0IA 3GD7A 5C4ZA 2R7ZB 2SNMA 1CA5A 2F3WA 2IX3A 1GUTA 2F0GA 2CWAA 5C5MA 1CQVA 3NENA 1HPCA 4BY1B 4L5TA 4DR7Q 4A3IH 5I2YA 3KF8A 3MZ5A 2UUBQ 1DOKA 4C3JH 3H94A 3HOYG 2NVQH 1J9OA 1EEFD 4OIKA 3LGJA 1WTHA 1STBA 2A1AA 3IFTA 3VA7A 4DR4L 4IJHA 4GNXA 4A93G 1CKOA 2YYZA 5M3MG 4MN3A 2B3GA 1TWGB 2PO4A 4B3SL 1I6VC 4DFAA 2HIVA 2J4XA 1N32Q 1VQKA 2A6ED 1YZ6A 4BY7G 5IODA 4O0AA 2XTIA 3VA5A 3CAMA 3R93A 4JI1L 2D9UA 3I4MB 3LWUA 2YTYA 5IP9H 5E4WC 1BCPC 2E2IH 4OX9L 4X3TA 1V1QA 4KN7C 3K0XA 4DV7L 2QCPX 1LT6D 4DR2L 4P74A 1OXVA 2OCEA 4PZ6A 1E2VA 4YY3Q 1B2TA 1EU3A 3T1YL 1I4PA 4TKOB 2UUCL 1KLGD 2NYZD 3IKJA 2F0KA 3IAYA 1R4PB 4BBRH 4OXPA 5C4XG 2EXZA 1Y1WB 3PUWA 4R4CA 4KD3A 4CKBA 1O7LA 1AE2A 2ZXRA 1QB5D 5C3EG 3WOEA 2VUMG 5JJIA 3TEHB 4P2CB 1PFMA 2NVXB 1QZGA 4N9TA 4CDDC 1LACA 3K57A 1JR0D 5IT9E 3S9WA 3OMGA 5M3FH 4A3GG 1Q8KA 1GD7A 3FKIG 3ER0A 3BYTB 2NZ1D 4KV6A 1JJCB 1IL2A 1VQHA 2VL6A 3OWFA 2OF1A 4G7OC 3MWYW 1GHKA 1LTTD 4NXNQ 1EYDA 1XNQL 5I9OA 3AB9A 2MO1A 1NR2A 2JP1A 4X65Q 4GS3A 4DR3Q 1WTQA 1EZ6A 1WTVA 3GTLB 2HQEA 1D8LA 2B39A 5LL6X 4NPSA 2R92G 5I9PA 4JI3L 3O13A 3H0GH 1W6KA 1S72A 1KAWA 1X9NA 5JJZA 1UE5A 1EOVA 3Q6SA 1SNCA 4A3BG 1TWHH 2F4VQ 2E74C 4AQYQ 3J7YW 5IYCH 5LMNQ 4A3DH 3A8IE 2X6LA 1G291 3MFGA 5IGEA 3MVVA 1XPOA 1F2MA 1ZXTA 2YU9B 1PHJA 2RDFA 5EQ0A 1QVCA 3TP6A 3HOYH 4PMBA 1S5DD 3VR5A 1A2UA 1X3EA 5IP7G 1PZKD 4A93H 2F0UA 1GUWA 1QUQB 5A2QL 3OOCA 5M3MH 1S5CD 1PRTB 2Q8RE 2HDLA 4DNTB 3HOVH 2DN8A 1XXGA 2LFNA 1LYLA 3NWSA 3BDOA 2WFWA 4K6LA 2PNHA 1E0BA 4FP5D 5C44G 2JA7H 2L5TA 1IW7D 1I5FA 4RHRA 1PV4A 1Q1BA 2CQOA 2B2TC 1EWHA 2KEDA 1PH8A 1Q12A 1ESFA 1TVXA 1WTRA 4MTNA 3CXCA 3VDYA 4L63B 3A8JE 2D2CC 1GO3E 1TT2A 1KRTA 4JI6Q 3NEMA 4JI0Q 1X3FA 2WINB 1HNWQ 3KOJA 4GOPC 2K6AA 2K52A 4Q5VA 3HEJA 2EY5A 5NUCA 1EFWA 2FMCA 2V1CC 2E76C 4DAYB 1FJGL 1QUQA 4G7ZC 3M4OB 4GLAC 4RA8A 1KQSA 2VS1A 1K8OA 4JI2Q 2EJGC 4JBWA 1N9WA 4B9WA 4A3EG 1VQDA 5EPKA 4DNIA 1A3VA 1HUMA 5AFWA 2LKVA 5JEAG 2NZHA 2Z0SA 4I65A 1EY6A 3NQIA 3C3LA 3RD4A 3EBEA 4IPGA 1JCKB 4IURA 4P72A 2D0PA 4TSSA 3ERSX 4OO1I 1VQAA 4YHHQ 1K8GA 1VQFA 4CJ0B 5IWAQ 4K6DA 5CGKA 5DM63 4IOAA 1NR4A 1M4VA 2K01A 3BVGA 2CCZA 5EBCA 1HA5A 2Q2TA 4H7BA 1AP0A 4DAYA 4EQ5A 3K7AH 3PQIA 3TMEA 1JB7A 3CP0A 2R93G 4IO9A 1G8ZD 1LM0A 2FJ2A 2P5ZX 1H9MA 5DM73 1VQ4A 1WD0A 4V190 2M9VA 1IL8A 3MHBA 3U58A 2JA8H 1Z6HA 1TY2A 2QF7A 5M5WH 3RZOH 1DOMA 2JEBI 4B08A 2RF4A 4X66L 1AE3A 2EYPA 4B3ML 2R7ZH 2WIIB 1F9RA 1GXDC 2UXBL 4A3BH 1Z9FA 3CD6A 3GTGB 2ID0A 3T1HL 4RKBA 4G57A 4F88A 1JC7A 4DR5L 1CI3M 4IPHA 1VQ6A 1WCMB 3S14B 1YNND 3SHLA 3F2CA 3AQQA 1ZYRD 2HUGA 4M1UB 1Q3LA 5BR8Q 1KC8C 5J22A 1K3RA 4DK3C 4DV3L 4X6AH 4YCWA 4R4IA 3NK9A 2K5HA 4EGVA 1EL0A 4R8IA 1A8VA 1BBUA 3I91A 3MA2B 1DCZA 4DV6Q 4IN3A 1RJTA 3K8AA 3WOFA 3HRZC 1WFQA 1OTCA 3D4DA 3L7ZC 5IT9c 1MHWC 3FRPB 1X32A 1XWEA 2BA1A 3KLRA 2Z6KA 4G7HC 1VQ9A 4L5RC 5EKLA 1NNXA 1ML0D 3PO2B 1JQYD 4KKSA 4LF6L 3M4YA 2TSSA 4JC0A 1NSNS 1PYWD 3CKIB 3G48A 1SMXA 1MJEA 4KK7A 2CH4A 2NVXH 3TREA 3VR3A 5EAYA 3F1ZA 3HOZB 2K4KA 1JE4A 1KRSA 3IFDA 5C0XG 1BOSA 1MIUA 2B2WC 3RLNA 4C3JB 2NVQB 3K6OA 4UHVA 3H6MA 3J80c 4U68A 4JVZA 1X3PA 1B4OA 3MXGA 1U4MA 3TS0A 4IUUA 2PW5A 1YJWA 1XNRQ 4QMGA 1C7YA 2JEAI 2A68D 1SFOB 5I4DA 2ZM6L 2OTJA 4DV5L 4IFDJ 4X3UA 1PTOF 1Q1EA 2WKCA 3AFPA 1EQVA 2N8NA 2R93H 1I4GA 3EVQA 4KTAA 3GTLH 5IT9L 1BBWA 1RHPA 4XQNA 2CHBD 1II3A 2B2VA 2RHSB 1N34Q 2I5HA 2KVMA 5JVH3 3CC7A 2JA6G 3SK8A 2FINB 3CCUA 1L1OB 1ENAA 2OEOA 3CCVA 1F9SA 1AFPA 2Q8TA 1D1KA 3H09A 1SXTA 1HR0Q 4RGNA 1HZBA 2EVBA 2B63B 1U9RA 1VQBA 2YU9H 3PUXA 1BBXC 1IKMA 4JI4Q 3J81i 1B3AA 2JA5G 2ICIA 4NXML 1FGUA 4KHZA 4JI5L 3TS2A 5I6YA 4JOIA 5D3IB 4OIJA 3J80L 4MHEA 4IUVA 1EYCA 2VY3A 3CU7A 3V05A 3D3RA 2GVBA 1LTLA 1A6XA 1IW7C 3DWPA 4X3KA 2DJFC 1K83H 4A3MG 4B3TQ 4KHPQ 4AYBB 1PVOA 3G4SA 3C1EA 2BDOA 2J7ZA 3K5MA 2DNEA 1QVFA 1I94Q 5FLMH 3KFUA 5IGFA 1MI2A 5E4XA 3WWVA 5IYDG 1S3OA 4UAIA 5CYUA 4R9WA 1PH2A 2NUCA 3E9HA 4BWGB 1Q86C 5CBAE 2KJXA 4DV0Q 3HOXB 3M4OH 3H3VI 1W6JA 3W5OA 1SEBD 5K36G 3W1GA 2F0VA 3STBD 1J6QA 2MP1A 5C0XH 2E75C 4ME3A 5IE8A 1Y8NB 1WOCA 4OL7A 1PH4A 3FP9A 3HOYB 4K0KL 1QJOA 4R1JA 4HCEA 1QZHA 3T51B 1N33L 1JT8A 2XGTA 4A93B 5HY6A 3NBHB 2N49A 2R61A 2L0CA 5M3MB 1VQPA 4CHTB 4P73A 1ASYA 4P71A 4F87A 4ZUJA 1PH3A 2B2YA 2KUMA 3D31A 1D5ZC 1LT4D 1LUZA 4DR4Q 1LTSD 2A6HC 1EFID 1CSPA 1HNXL 4BY7B 4ME5A 3TBIB 1E2WA 3FEWX 2MUYA 2C5CA 4XYQA 4DF7A 3NELA 5KEEA 4A76A 1TS5A 1HZ9A 1F2YA 2WV6D 3D6CA 2F0LA 4J1MA 1XYIA 1EYGA 1IBML 2KCTA 1BF4A 4KKTA 4A3CG 1BCPB 5F2DA 5AJ3L 4J6HA 1CZWA 2ZT9C 4AH6A 1BNZA 5CBEE 2IPKD 3RMHA 4K8IA 2CW0D 1O7YA 4RMFA 5IIFA 1F2ZA 2CKZB 3NBHA 2AHOB 2D5DA 5C4XB 3GTGH 4DN4M 3OW7A 5C3EB 4JCVE 2VUMB 3G6EA 5DEHA 1J5EQ 2NVTB 1VCIA 2K33A 4H13C 5GQOA 3I4NG 1HUNA 1YNNC 3F2BA 2DGYA 2CWPA 2JA5H 1ZYRC 1W3SA 1TIID 5A35A 1Q81C 1PRTF 4A3GB 4JI8L 1EY9A 3FKIB 4JK1C 4C1NI 1TY0A 4FF2A 2KHJA 2BE5D 1OXSC 1CSQA 2TMPA 2EY2A 4Y52H 2F0OA 5DLQE 3ULJA 1K8MA 2IHFA 3PUYA 1I6HB 2NBFA 1RCVD 4JBMA 2MPMA 4K14A 3Q24A 1O7IA 5IYDH 2PYKA 2F4IA 4XQQA 2R92B 2XRSD 2VQFQ 1UWVA 1EY4A 1XTCD 3UDIA 1WTOA 2GVAA 3R2IA 3U9SA 4LFAL 3DHQA 1XMOL 5M5WB 4LFCQ 1EQTA 3OTOQ 3PO2H 4MIUA 2IX1A 4QGUA 2J0TD 2HCCA 3CHBD 4ZLTF 3DUZA 5IGDA 5JPMC 3I73A 1Q7YC 1RD9D 1IYVA 3HOXG 1XJVA 4A3BB 2ES2A 5K36H 3I2ZA 4IPCA 3DEPA 4LAAA 1EIGA 4RHSA 1NMGA 1V1PA 1MGSA 1ESRA 3DM1A 4YWMA 1IBLQ 3HOZH 1CQFA 5J3BA 4DUZL 1V43A 4X64L 4LF7L 3G71A 3EQLC 2ZTEA 2KENA 1JOKA 1WTPA 3FVQA 1I50H 4QUCA 4LW1A 5IYBG 2MNAA 2VW9A 4YCUA 5C44B 1A3TA 2A68C 4X62L 4GKKQ 1UE7A 3HFZB 1SFOH 3OMCA 1DZ1A 4PZ7A 2HT1A 1L0XB 3S17B 2KEEA 2WP8J 3KUPA 3JAMi 4A3JG 2L12A 3BYYB 2WKDA 2NZOA 1QILA 4HJ5A 2PI2E 1SRUA 4DUYL 3ERQA 2EXDA 1AN8A 2HCIA 1UE6A 2PQAB 3OPOA 3DWQA 3KF6B 4A3CH 3S1NH 4H0LC 4UP8A 2C35B 3KJPA 3U4VA 3S15B 1SYDA 1JWMD 1HHVA 4K5VA 1SBBB 2N55A 1N36Q 2UXCL 1EZ8A 1EQQA 2MO0A 1EWIA 3RR5A 4GOPB 4TVAB 1PZJD 3EA6A 3PUZA 1MKHA 1M90C 3FDTA 1JE5A 1KDBA 4EQPA 3GTMB 2LSSA 3QIAA 4A3EB 1S4ZA 3CCSA 3I4NH 2B63H 2BOSA 4FF4A 2L1BA 3RN5A 4IPDA 5IY0A 5EJWA 5J39A 4OHJA 3M85A 3KLSX 2K14A 3FPPA 2E2HB 1YBYA 1L0YB 1B50A 2F0PA 2N78A 1UUPA 3KF6A 4XIGS 1IBKL 4BBSG 1STGA 5T1GA 1A63A 1GKHA 1RDPD 1XMQQ 3SXHA 1C4QA 3C1FA 4QL5A 4KKUA 1PH9A 1YHBA 2C9OA 2BA0A 3K58A 3BS1A 4ZCKA 2R93B 1EQRA 1SE8A 1Z7TA 2Q8IB 4JYAQ 1EIYB 1BR9A 3FMCA 4L6TB 4O1NA 5CR3A 1HTLD 3NPPA 4APVA 4OO1G 1EUJA 4GNXC 1E24A 1TWFH 3HKZG 4RFBA 3MAQA 3S16B 2QKIC 3PIPA 3HOXH 2AQ1B 5DAUA 4GKJQ 2CFMA 1I4HA 3PO3G 3STBC 2JK8A 4POFA 5JAVA 3ICEA 3SK6A 2F0JA 3GV3A 3PMFA 5COYA 1GOZA 1B1ZA 3T1HQ 3PF4A 5KYLA 1HJPA 3D8GA 2K5QA 2E2DC 1VQOA 4DR7L 3J7ZC 1S40A 4QF4A 4IUQA 5ELNA 2IX0A 4GLVB 3CCMA 2UXDQ 4DKAC 3N52A 3M9BA 2UUBL 3J7AV 1SNMA 1I3QB 3S1RB 3HS0C 4BY7H 1K83B 4LMQD 4CDFC 3TP8A 4XT3B 2MJ8A 1ICWA 4NDXA 2MFIA 2VQEQ 4MTKA 4K5XA 3U4ZA 4KY6A 5CV9A 2F0MA 1GUGA 1N32L 1YVCA 4L5QA 1BXTA 1MBYA 4B3RQ 2XSCA 4RG1A 1BVSA 1E3PA 1BO0A 1OXTA 2HDMA 2E5LQ 2QA4A 2CW0C 1CKMA 2H4OA 4DGZA 1LO5D 2Z6BA 1C0AA 5KYIA 5C4XH 1RL2A 4LFBQ 2PCFB 5C3EH 4OONA 2VUMH 1I4XA 4DK0A 4YY3L 2NVTH 3QWNA 1VQEA 4IUPA 4PMCA 4DV2L 3AU7A 3MFYA 1STHA 4UP7A 4DV1Q 1P8LA 5LMNW 3GP7A 2ZJQA 4A3GH 5M5YB 1S5ED 1U4PA 3FKIH 3KK7A 2CVRA 2E2JB 2BE5C 1NE3A 2HHHQ 4IJLA 3MXUA 4HR7B 1PXUA 1NUCA 4BBSH 2JSOA 2B8FA 3I72A 4QIWE 3T16A 2DJGC 5DNFA 2KA7A 1DJRD 2A6HD 1SDFA 4FXGC 2JE6I 5LMUL 1KABA 3M3YB 5HGTA 1I6HH 2YV5A 1QOHA 5HURA 1G51A 1Y1VG 3E0JA 2ZM6Q 2EIFA 4CJ2C 1FD7D 1Y8OB 3I4OA 4DV5Q 2IHEA 5CMDA 1QCBD 2F03A 2R92H 2Q2UA 2F0FA 2AQ2B 1WVLA 4NXNL 4OWXB 2M00A 2YTVA 4N8X1 2QEXA 3MEFA 4HJAA 1VDZA 4DR3L 2BCOA 1PYBA 2JA6B 4UPAA 1WJJA 1WI5A 3NUCA 1JWSD 3EJIA 2UU9Q 4ULLA 3PO3H 2PMZB 4XDXA 1H9RA 4IZ8A 4AIMA 1C48A 1TS3A 4DV4Q 4UDUC 3QG1A 2KHIA 2IJ0A 2JA5B 1C9OA 1O80A 1VQ7A 1PH1A 5IP7H 3VYUA 2F4VL 4AQYL 5K5PA 1T5XD 5LMNL 3K5LA 4A3FG 4P75A 4ALPA 2QEJC 1L0WA 4C1NK 3T56B 5GAGC 3L9AX 5C44H 2FHTA 4A3MB 1YJNA 3UE0A 3S17H 1AZQA 4JPBW 5ELBA 2JXMB 3HKZE 5C0XJ 5HGQA 5M5XB 2H5XA 2Q2HA 1HNZQ 1JOOA 1A3UA 4KI0A 3M7GA 1F77A 4JV5Q 1BCPF 5FLXE 3J81E 2EE1A 1FYCA 4DR6L 2B2UA 1IYJB 1R4QB 1LTBD 3S15H 1PA6A 5IOCA 3ZYYX 1XPUA 1KL9A 4HMJA 3GTKB 3EIVA 2VB2X 2B29A 1CTMA 3AEVA 4BA2I 4JI0L 2LXKA 1RF2D 1JJGA 1CM9A 4HN7A 1YI2A 1VQ5A 1PZID 3GTMH 1HNWL 4ZQ3A 4DR1L 5GROA 4A3EH 4LNQA 2KCCA 2FFKB 5L37A 1L2FA 5JEAH 5D65A 1XPRA 4PG3A 4DK1A 2JA9A 3MC0B 3PGZA 1N8RC 4L5SA 3DXJC 4R4TA 1HZAA 4JI2L 1ILQA 4A4IA 1KNEA 2KCMA 2E2HH 4DPGA 3H3VC 1I50B 4QQBX 2A73B 2V4DA 1N33Q 4CDEC 3A5UA 4BXXG 4FXKC 4TRDA 5TSSA 1EYAA 2XRQD 3KLSA 3A74A 4R4OA 1BDOA 2RKSA 4YHHL 2H1EA 3K0YA 4PMWA 1Y1VH 3S2HH 2RBMA
chains in the Genus database with same CATH topology
4A3KG 2UUCL 4A3CG 3L2PA 5AJ3L 3U50C 4BBRH 4OXPA 4AH6A 5C4XG 3PUWA 4R4CA 3GDEA 2NN6G 2JQOA 3HKSA 1AE2A 5C3EG 5JJIA 1TWAH 2VUMG 4RMFA 1OXUA 2AMCB 2WB1E 3TEHB 1HZCA 3UE1A 2CKZB 2I5LX 4POGA 2AHOB 3J80i 1QZGA 1WYDA 1XMQL 1K73C 3GTGH 3S1QH 4LF4Q 4JCVE 3G6EA 2ZJRA 1IXRA 2IY5B 3S16H 1J5EQ 2K75A 5M3FH 1VCIA 1Q8KA 3I4NG 1GD7A 5GQOA 4A3GG 3FKIG 3ER0A 3PUVA 3F2BA 2DGYA 2CWPA 4C3IH 2JA5H 4X65L 1W3SA 1JJCB 3MXNB 1Q81C 1HNWL 1IL2A 4JI8L 4HJ8A 4JYAL 1VQHA 1YIJA 2VL6A 5GAHC 4A3LH 2KHJA 1M1KC 1OXSC 1CSQA 4C2MH 4NXNQ 4A3FH 1XNQL 3CQZH 3UDXA 4Y52H 2MO1A 5DLQE 2UUAL 3ULJA 4X65Q 3CMAA 4GS3A 4DR3Q 5JJKA 1X3GA 2IHFA 4GKJL 1CKNB 4LWCA 2OQ0A 3PUYA 1YJ9A 1D8LA 4DR6Q 3S1RH 1I3QH 4NPSA 4JBMA 2R92G 5BR8L 4IFDG 1MJCA 1O7IA 3OYYA 4NXMQ 3CCJA 4UY8C 4JI5Q 5IYDH 4JI3L 4BY1H 3H0GH 4QJFA 3DLLA 1S72A 1KAWA 2VQFQ 1X9NA 4LF5L 1UWVA 2UUAQ 1L1OA 2K50A 1UE5A 3UDIA 2N3SA 5FJ8G 1EOVA 2GVAA 4LF8Q 4LFAL 4DV6L 1XMOL 4LFCQ 4A3BG 1TWHH 5GAEC 2F4VQ 4AQYQ 3OTOQ 5IYCH 3PO2H 3CPFA 5LMNQ 2IX1A 4A3DH 4QGUA 3HOUG 4LF9L 2UXDL 1G291 1Q7YC 3K81C 2GN5A 3H15A 1XPOA 4XTCS 3HOXG 1XJVA 2ES2A 3I2ZA 4IPCA 1PHJA 1QVCA 3HOYH 1TWGH 3CC2A 2RCNA 1NMGA 4LF5Q 3GTQH 1X3EA 5IP7G 2F3IA 5C0XI 2VQEL 4A93H 4YWMA 1XMOQ 1IBLQ 4HJ9A 1QUQB 3HOZH 5M3MH 4OWWB 3PF5A 1V9PA 2JJQA 1CKNA 5J3BA 4DUZL 3HOVH 1V43A 4LF9Q 4X64L 2AWNA 4LF7L 1LYLA 3G71A 3RLFA 3I4MH 4B3RL 2WFWA 2KENA 2ZTEA 2PNHA 2A8VA 5C44G 4JI6L 2JA7H 3M4PA 1I5FA 3CF5A 2E5LL 1I50H 1Q1BA 1PV4A 5IYBG 2CQOA 4LW1A 2MNAA 1HR0W 2FXQA 5FLMG 2VW9A 5M5YH 1KD1C 1PH8A 3UDFA 1Y14B 4YCUA 2E2JH 1Q12A 4X62L 4GKKQ 1UE7A 2R6GA 3HFZB 3AFQA 5C4JH 4MTNA 1SFOH 3JC66 2E8GA 3CXCA 3VDYA 3OW2A 4PZ7A 2HT1A 2I5MX 4LFBL 1GO3E 4HIDA 2WP8J 3JAMi 4A3JG 4BXXH 1KHIA 2K5VA 2NZOA 1KRTA 4HJ5A 1FVIA 4JI6Q 2PI2E 2ZTDA 3NEMA 4JI0Q 1VQGA 1SRUA 1X3FA 2VZAA 1HNWQ 3KOJA 1HH2P 4GOPC 2K52A 4K0KQ 4B3SQ 2OQKA 4DUYL 1Y1WH 3M3YH 1SLJA 2EXDA 4DV1L 4A3IG 1EFWA 2MQHA 1VQ8A 1UE6A 2PQAB 2V1CC 4A3KH 3KF6B 4Y7NH 4A3CH 4X62Q 4DAYB 4YWKA 1K8AC 1FJGL 3S1NH 1X6OA 1QUQA 4UP8A 2C35B 4GLAC 3KJPA 3U4VA 4GN4B 2PI2A 1KQSA 1PFSA 2VS1A 2HHHL 4JI2Q 1N36Q 4MZ9A 1SROA 4JBWA 4JI1Q 5IWAL 1N9WA 2UXCL 3Q8DA 1E1TA 4A3EG 1VQDA 4DNIA 1EQQA 1HNXQ 2MO0A 1EWIA 3RR5A 4OX9Q 4JOIC 4TVAB 5JEAG 2NZHA 3I55A 3PUZA 1MKHA 4A75A 4GOPB 1M90C 2Z0SA 1JE5A 1YNXA 4DV7Q 1N32L 2ALYB 2LSSA 2JA6H 3CCSA 3GTJH 4DR2Q 3EBEA 4IPGA 3I4NH 2B63H 4P72A 1H95A 2D0PA 4BA1I 3ERSX 4OO1I 1VQAA 1IBMQ 3RNUA 4YHHQ 2D62A 2LXJA 5IP9G 4IPDA 1VQFA 3K80C 2WAQG 3RN5A 5IWAQ 5IY0A 1N34L 1K8GA 3FHWA 3T1YQ 2UUCQ 2D0OA 1K0RA 3M85A 4KLKA 2K14A 4IOAA 5AJ3Q 1YBYA 2R7DA 5FLXc 2CCZA 3DM3A 3J81c 2N78A 2R7FA 2Q2TA 3KLWA 3KF6A 4XIGS 1K9MC 1IBKL 4BBSG 3W1BA 1UEBA 1X65A 1VQJA 1A63A 1GKHA 1XMQQ 4EQ5A 3F2DA 1HR0L 3K7AH 1OXXK 1JB7A 3CP0A 1Z47A 2AWOA 1X55A 4QL5A 4IO9A 1PH7A 2UU9L 1VQNA 1LM0A 1XTDA 4BBRG 4JI4L 1PH9A 1YHBA 2BA0A 1ASZA 1VQ4A 4A3MH 1NTGA 4YWLA 4DV4L 3U58A 2JA8H 5GADC 1EQRA 5M5WH 3RZOH 1SE8A 2Z6KC 4JI7L 1EIFA 2JEBI 4HJ7A 2AKWB 1PH6A 4JI8Q 1IBKQ 4FDBA 4TQUS 2RF4A 4GLXA 4X66L 1AE3A 5M5XH 3KDFB 1EIYB 4JYAQ 1YHAA 1Q46A 4B3ML 2R7ZH 5M3FG 4A3BH 2UXBL 1Z9FA 1VQMA 4APVA 4OO1G 3CD6A 1EUJA 2ID0A 1YITA 4GNXC 1E24A 1TWFH 3HKZG 3T1HL 1WCMG 1XNQQ 2K5NA 4DR5L 4KHPL 4EX5A 4IPHA 3PIPA 3HOXH 1P16A 4HIOA 4GKJQ 4WJ4A 4JI7Q 1VQ6A 1VQLA 2CFMA 3F2CA 3PO3G 3AQQA 3STBC 3GTKH 2JK8A 4POFA 3ICEA 3E9IA 3M7NA 5BR8Q 2RHQB 1HNZL 1FL0A 1KC8C 4JI3Q 3T1HQ 1K3RA 3AYHB 4DK3C 4JV5L 4DV3L 4X6AH 3KJOA 4YCWA 2NVYH 4R4IA 2K5HA 4LUOA 4HIMA 3PF4A 3HOWG 1A8VA 1HJPA 1BBUA 4LFAQ 1RIPA 4MNOA 4DV6Q 3TRZA 1VQOA 4DR7L 3J7ZC 1S40A 1CUKA 5ELNA 2IX0A 3BZCA 4GLVB 1U0LA 3K8AA 4DKAC 3CPWA 3CCMA 2UXDQ 3KDFA 2ATWA 4QY7A 3M9BA 3SGIA 2UUBL 3CCEA 1GM5A 1WFQA 3H0GG 3CCQA 4BY7H 2EQSA 1OTCA 3BJUA 1YHQA 3L7ZC 5IT9c 2BH2A 2MFIA 1TWCH 2BA1A 2VQEQ 3U4ZA 5IYCG 3PO2G 1JJGA 4A3DG 1KIXA 1E22A 2Z6KA 4GN5A 3S24A 4DUZQ 1YVCA 3B6YA 4L5QA 3ULLA 5H1SE 1VQ9A 4X64Q 4L5RC 4LF7Q 4C3HH 4B3RQ 4RG1A 1BVSA 1E3PA 1D7QA 1OXTA 4LF6L 3GTPH 4JC0A 2E5LQ 2QA4A 3H3VH 2NN6I 3PCOB 1DGSA 1B8AA 4R4QA 1JMCA 1CKMA 3G48A 4JBJA 3HOZG 1SMXA 1MJEA 1X54A 4YCVA 3HOVG 1AH9A 1C0AA 2NVXH 3TREA 1XNRL 5EAYA 5C4XH 3F1ZA 1RL2A 1KRSA 2K4KA 5C0XG 4LFBQ 5C3EH 4NB3A 2JA7G 1MIUA 4OONA 2VUMH 3RLNA 4YY3L 4O2DA 2NVTH 1PYSB 1VQEA 4DV2L 1YEZA 3J80c 4DUYQ 1VQIA 1TXYA 4UP7A 4DV1Q 1B70B 1P8LA 5LMNW 3TS0A 2Y0SG 1NJIC 2ZJQA 1PH5A 1FJGQ 4A3GH 1YJWA 4LUVA 3FKIH 1XNRQ 4UP9A 3D0FA 1C7YA 3I7FA 2JEAI 1Q82C 2KBNA 1NE3A 2DUDA 2HHHQ 3S1MH 4IJLA 2ZM6L 2OTJA 3CCRA 3J7A5 4DV5L 2UXCQ 4BBSH 3GO5A 4IFDJ 4LF4L 4QIWE 4GN3B 4DV2Q 1NMFA 1Q1EA 3AFPA 4JG2A 1J5EL 4JBKA 2N8NA 5E7NA 1L1OC 1R9TH 4PZ8A 2R93H 1X56A 3GTLH 2JE6I 3ZJYC 5LMUL 2PQAA 1I6HH 1BBWA 2YV5A 1E7ZA 4IOCA 4IFDI 1G51A 1Y1VG 2RHSB 2OWOA 2ZM6Q 2EIFA 1N34Q 3I4OA 1VQCA 4DV5Q 2I5HA 1BKBA 1U5KA 2ASBA 3GTOH 2IT1A 4HIKA 2IHEA 3CC4A 3CC7A 2Q2UA 2HIXA 2Y0SE 2R92H 2JA6G 1G6PA 4NXNL 4OWXB 4GOPA 2YTVA 2QEXA 3CCUA 1L1OB 2B63G 1SN8A 1NBWA 3J81j 3MEFA 3CCVA 3RN2A 5LMUQ 1A62A 1WCMH 4HJAA 3S14H 3CMEA 4DR3L 1PYBA 3PSIA 2WAQE 1WJJA 4UPAA 1HR0Q 1HZBA 1WI5A 5FJ8H 1UE1A 3UDGA 3TQYA 2VNUD 1VQBA 2UU9Q 3PUXA 1B7YB 3ULPA 2YU9H 3PO3H 2Q2IA 3J81i 3L0OA 4JI4Q 2JA5G 3HOUH 4B3TL 4NXML 1FGUA 4KHZA 4JI5L 1QVGA 5JJLA 3TS2A 4AIMA 4JOIA 4DV4Q 3I56A 2YTXA 4DAMA 2KHIA 2VQFL 2OTLA 1C9OA 2VY3A 3KF8B 4X66Q 1VQ7A 4LF8L 1I94L 3HOWH 4A3LG 1PH1A 4LFCL 5IP7H 2F4VL 2GVBA 4B3MQ 4AQYL 1LTLA 3OTOL 4AYBG 5LMNL 2UXBQ 4A3FG 4P75A 3RLOA 3KYHC 4ALPA 3CW2C 1K83H 4A3MG 4GNXB 3BZKA 1L0WA 4B3TQ 2HQLA 4DR5Q 4KHPQ 2I0QA 2JA8G 5GAGC 1PVOA 1T9HA 3E0EA 3CCLA 5C44H 3G4SA 2PMZE 3IRBA 4J15A 5IYBH 1YJNA 4DV0L 1QVFA 3UE0A 2R7ZG 1I94Q 1IBLL 5FLMH 3KFUA 3S17H 2R93G 3M4QA 3WWVA 5IYDG 3HKZE 5C0XJ 5HGQA 1S3OA 2H5XA 2Q2HA 1HNZQ 4BY1G 4KI0A 1A0IA 3A0JA 3GD7A 4JV5Q 2ZTCA 4DV3Q 1PH2A 4A3JH 2CWAA 3E9HA 4LUZA 3NENA 5JEAJ 3JAMc 4OWTB 4DR6L 1Q86C 4L5TA 1JJ2A 1IYJB 2L15A 4DK6C 4DR7Q 4DV0Q 3M4OH 3H3VI 3PIOA 1KXLA 4AYBE 3S15H 1NY4A 3W5OA 4A3IH 1PA6A 4GKKL 1XPUA 1KL9A 3A5ZB 2UUBQ 5K36G 4C3JH 3W1GA 1IZ6A 3HOYG 1VS0A 2NVQH 3STBD 1J6QA 3LGJA 3EIVA 2B29A 5IE8A 4ME3A 3AEVA 4BA2I 2A1AA 4DR4L 4WJ3M 4JI0L 4IJHA 4GNXA 1WOCA 4A93G 1SR3A 2LXKA 3RZDH 1CKOA 2A19A 2YYZA 5M3MG 1YI2A 1PH4A 1VQ5A 3GTMH 3FP9A 4H02A 2B3GA 3BU2A 4DR1L 4A3EH 5GROA 4R1JA 4B3SL 1QZHA 4LNQA 1N33L 4K0KL 1JT8A 2XGTA 2ZJPA 1L2FA 2HIVA 1N32Q 5HY6A 3NBHB 2N49A 1XPRA 1VQKA 3I4MG 1VQPA 2BH8A 1YZ6A 4P73A 1ASYA 4BY7G 4P71A 4PG3A 2JA9A 3PGZA 2WB1G 4O0AA 1N8RC 2XTIA 1PH3A 4L5SA 4LF6Q 3D31A 3CAMA 4R4TA 1HZAA 1LUZA 1N36L 4JI2L 4JI1L 4A4IA 4DR4Q 2KCMA 2E2HH 3K7UC 2YTYA 5IP9H 1CSPA 3PV0A 3F8TA 4DPGA 1HNXL 1E1OA 2E2IH 4OX9L 4DR1Q 4QQBX 1W2BA 2QGQA 1V1QA 1N33Q 3K0XA 3NELA 4DV7L 3A5UA 4A76A 4BXXG 1HZ9A 4DR2L 4P74A 1OXVA 3S2DH 2OCEA 1GVPA 3A74A 4R4OA 4PZ6A 1EYGA 1IBML 2KCTA 4YY3Q 4YHHL 3EN2A 1Y1WG 5ELOA 4PMWA 1Y1VH 3T1YL 3S2HH 2F52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3K G;  2UUC L;  4A3C G;  3L2P A;  5AJ3 L;  3U50 C;  4BBR H;  4OXP A;  4AH6 A;  5C4X G;  3PUW A;  4R4C A;  3GDE A;  2NN6 G;  2JQO A;  3HKS A;  1AE2 A;  5C3E G;  5JJI A;  1TWA H;  2VUM G;  4RMF A;  1OXU A;  2AMC B;  2WB1 E;  3TEH B;  1HZC A;  3UE1 A;  2CKZ B;  2I5L X;  4POG A;  2AHO B;  3J80 i;  1QZG A;  1WYD A;  1XMQ L;  1K73 C;  3GTG H;  3S1Q H;  4LF4 Q;  4JCV E;  3G6E A;  2ZJR A;  1IXR A;  2IY5 B;  3S16 H;  1J5E Q;  2K75 A;  5M3F H;  1VCI A;  1Q8K A;  3I4N G;  1GD7 A;  5GQO A;  4A3G G;  3FKI G;  3ER0 A;  3PUV A;  3F2B A;  2DGY A;  2CWP A;  4C3I H;  2JA5 H;  4X65 L;  1W3S A;  1JJC B;  3MXN B;  1Q81 C;  1HNW L;  1IL2 A;  4JI8 L;  4HJ8 A;  4JYA L;  1VQH A;  1YIJ A;  2VL6 A;  5GAH C;  4A3L H;  2KHJ A;  1M1K C;  1OXS C;  1CSQ A;  4C2M H;  4NXN Q;  4A3F H;  1XNQ L;  3CQZ H;  3UDX A;  4Y52 H;  2MO1 A;  5DLQ E;  2UUA L;  3ULJ A;  4X65 Q;  3CMA A;  4GS3 A;  4DR3 Q;  5JJK A;  1X3G A;  2IHF A;  4GKJ L;  1CKN B;  4LWC A;  2OQ0 A;  3PUY A;  1YJ9 A;  1D8L A;  4DR6 Q;  3S1R H;  1I3Q H;  4NPS A;  4JBM A;  2R92 G;  5BR8 L;  4IFD G;  1MJC A;  1O7I A;  3OYY A;  4NXM Q;  3CCJ A;  4UY8 C;  4JI5 Q;  5IYD H;  4JI3 L;  4BY1 H;  3H0G H;  4QJF A;  3DLL A;  1S72 A;  1KAW A;  2VQF Q;  1X9N A;  4LF5 L;  1UWV A;  2UUA Q;  1L1O A;  2K50 A;  1UE5 A;  3UDI A;  2N3S A;  5FJ8 G;  1EOV A;  2GVA A;  4LF8 Q;  4LFA L;  4DV6 L;  1XMO L;  4LFC Q;  4A3B G;  1TWH H;  5GAE C;  2F4V Q;  4AQY Q;  3OTO Q;  5IYC H;  3PO2 H;  3CPF A;  5LMN Q;  2IX1 A;  4A3D H;  4QGU A;  3HOU G;  4LF9 L;  2UXD L;  1G29 1;  1Q7Y C;  3K81 C;  2GN5 A;  3H15 A;  1XPO A;  4XTC S;  3HOX G;  1XJV A;  2ES2 A;  3I2Z A;  4IPC A;  1PHJ A;  1QVC A;  3HOY H;  1TWG H;  3CC2 A;  2RCN A;  1NMG A;  4LF5 Q;  3GTQ H;  1X3E A;  5IP7 G;  2F3I A;  5C0X I;  2VQE L;  4A93 H;  4YWM A;  1XMO Q;  1IBL Q;  4HJ9 A;  1QUQ B;  3HOZ H;  5M3M H;  4OWW B;  3PF5 A;  1V9P A;  2JJQ A;  1CKN A;  5J3B A;  4DUZ L;  3HOV H;  1V43 A;  4LF9 Q;  4X64 L;  2AWN A;  4LF7 L;  1LYL A;  3G71 A;  3RLF A;  3I4M H;  4B3R L;  2WFW A;  2KEN A;  2ZTE A;  2PNH A;  2A8V A;  5C44 G;  4JI6 L;  2JA7 H;  3M4P A;  1I5F A;  3CF5 A;  2E5L L;  1I50 H;  1Q1B A;  1PV4 A;  5IYB G;  2CQO A;  4LW1 A;  2MNA A;  1HR0 W;  2FXQ A;  5FLM G;  2VW9 A;  5M5Y H;  1KD1 C;  1PH8 A;  3UDF A;  1Y14 B;  4YCU A;  2E2J H;  1Q12 A;  4X62 L;  4GKK Q;  1UE7 A;  2R6G A;  3HFZ B;  3AFQ A;  5C4J H;  4MTN A;  1SFO H;  3JC6 6;  2E8G A;  3CXC A;  3VDY A;  3OW2 A;  4PZ7 A;  2HT1 A;  2I5M X;  4LFB L;  1GO3 E;  4HID A;  2WP8 J;  3JAM i;  4A3J G;  4BXX H;  1KHI A;  2K5V A;  2NZO A;  1KRT A;  4HJ5 A;  1FVI A;  4JI6 Q;  2PI2 E;  2ZTD A;  3NEM A;  4JI0 Q;  1VQG A;  1SRU A;  1X3F A;  2VZA A;  1HNW Q;  3KOJ A;  1HH2 P;  4GOP C;  2K52 A;  4K0K Q;  4B3S Q;  2OQK A;  4DUY L;  1Y1W H;  3M3Y H;  1SLJ A;  2EXD A;  4DV1 L;  4A3I G;  1EFW A;  2MQH A;  1VQ8 A;  1UE6 A;  2PQA B;  2V1C C;  4A3K H;  3KF6 B;  4Y7N H;  4A3C H;  4X62 Q;  4DAY B;  4YWK A;  1K8A C;  1FJG L;  3S1N H;  1X6O A;  1QUQ A;  4UP8 A;  2C35 B;  4GLA C;  3KJP A;  3U4V A;  4GN4 B;  2PI2 A;  1KQS A;  1PFS A;  2VS1 A;  2HHH L;  4JI2 Q;  1N36 Q;  4MZ9 A;  1SRO A;  4JBW A;  4JI1 Q;  5IWA L;  1N9W A;  2UXC L;  3Q8D A;  1E1T A;  4A3E G;  1VQD A;  4DNI A;  1EQQ A;  1HNX Q;  2MO0 A;  1EWI A;  3RR5 A;  4OX9 Q;  4JOI C;  4TVA B;  5JEA G;  2NZH A;  3I55 A;  3PUZ A;  1MKH A;  4A75 A;  4GOP B;  1M90 C;  2Z0S A;  1JE5 A;  1YNX A;  4DV7 Q;  1N32 L;  2ALY B;  2LSS A;  2JA6 H;  3CCS A;  3GTJ H;  4DR2 Q;  3EBE A;  4IPG A;  3I4N H;  2B63 H;  4P72 A;  1H95 A;  2D0P A;  4BA1 I;  3ERS X;  4OO1 I;  1VQA A;  1IBM Q;  3RNU A;  4YHH Q;  2D62 A;  2LXJ A;  5IP9 G;  4IPD A;  1VQF A;  3K80 C;  2WAQ G;  3RN5 A;  5IWA Q;  5IY0 A;  1N34 L;  1K8G A;  3FHW A;  3T1Y Q;  2UUC Q;  2D0O A;  1K0R A;  3M85 A;  4KLK A;  2K14 A;  4IOA A;  5AJ3 Q;  1YBY A;  2R7D A;  5FLX c;  2CCZ A;  3DM3 A;  3J81 c;  2N78 A;  2R7F A;  2Q2T A;  3KLW A;  3KF6 A;  4XIG S;  1K9M C;  1IBK L;  4BBS G;  3W1B A;  1UEB A;  1X65 A;  1VQJ A;  1A63 A;  1GKH A;  1XMQ Q;  4EQ5 A;  3F2D A;  1HR0 L;  3K7A H;  1OXX K;  1JB7 A;  3CP0 A;  1Z47 A;  2AWO A;  1X55 A;  4QL5 A;  4IO9 A;  1PH7 A;  2UU9 L;  1VQN A;  1LM0 A;  1XTD A;  4BBR G;  4JI4 L;  1PH9 A;  1YHB A;  2BA0 A;  1ASZ A;  1VQ4 A;  4A3M H;  1NTG A;  4YWL A;  4DV4 L;  3U58 A;  2JA8 H;  5GAD C;  1EQR A;  5M5W H;  3RZO H;  1SE8 A;  2Z6K C;  4JI7 L;  1EIF A;  2JEB I;  4HJ7 A;  2AKW B;  1PH6 A;  4JI8 Q;  1IBK Q;  4FDB A;  4TQU S;  2RF4 A;  4GLX A;  4X66 L;  1AE3 A;  5M5X H;  3KDF B;  1EIY B;  4JYA Q;  1YHA A;  1Q46 A;  4B3M L;  2R7Z H;  5M3F G;  4A3B H;  2UXB L;  1Z9F A;  1VQM A;  4APV A;  4OO1 G;  3CD6 A;  1EUJ A;  2ID0 A;  1YIT A;  4GNX C;  1E24 A;  1TWF H;  3HKZ G;  3T1H L;  1WCM G;  1XNQ Q;  2K5N A;  4DR5 L;  4KHP L;  4EX5 A;  4IPH A;  3PIP A;  3HOX H;  1P16 A;  4HIO A;  4GKJ Q;  4WJ4 A;  4JI7 Q;  1VQ6 A;  1VQL A;  2CFM A;  3F2C A;  3PO3 G;  3AQQ A;  3STB C;  3GTK H;  2JK8 A;  4POF A;  3ICE A;  3E9I A;  3M7N A;  5BR8 Q;  2RHQ B;  1HNZ L;  1FL0 A;  1KC8 C;  4JI3 Q;  3T1H Q;  1K3R A;  3AYH B;  4DK3 C;  4JV5 L;  4DV3 L;  4X6A H;  3KJO A;  4YCW A;  2NVY H;  4R4I A;  2K5H A;  4LUO A;  4HIM A;  3PF4 A;  3HOW G;  1A8V A;  1HJP A;  1BBU A;  4LFA Q;  1RIP A;  4MNO A;  4DV6 Q;  3TRZ A;  1VQO A;  4DR7 L;  3J7Z C;  1S40 A;  1CUK A;  5ELN A;  2IX0 A;  3BZC A;  4GLV B;  1U0L A;  3K8A A;  4DKA C;  3CPW A;  3CCM A;  2UXD Q;  3KDF A;  2ATW A;  4QY7 A;  3M9B A;  3SGI A;  2UUB L;  3CCE A;  1GM5 A;  1WFQ A;  3H0G G;  3CCQ A;  4BY7 H;  2EQS A;  1OTC A;  3BJU A;  1YHQ A;  3L7Z C;  5IT9 c;  2BH2 A;  2MFI A;  1TWC H;  2BA1 A;  2VQE Q;  3U4Z A;  5IYC G;  3PO2 G;  1JJG A;  4A3D G;  1KIX A;  1E22 A;  2Z6K A;  4GN5 A;  3S24 A;  4DUZ Q;  1YVC A;  3B6Y A;  4L5Q A;  3ULL A;  5H1S E;  1VQ9 A;  4X64 Q;  4L5R C;  4LF7 Q;  4C3H H;  4B3R Q;  4RG1 A;  1BVS A;  1E3P A;  1D7Q A;  1OXT A;  4LF6 L;  3GTP H;  4JC0 A;  2E5L Q;  2QA4 A;  3H3V H;  2NN6 I;  3PCO B;  1DGS A;  1B8A A;  4R4Q A;  1JMC A;  1CKM A;  3G48 A;  4JBJ A;  3HOZ G;  1SMX A;  1MJE A;  1X54 A;  4YCV A;  3HOV G;  1AH9 A;  1C0A A;  2NVX H;  3TRE A;  1XNR L;  5EAY A;  5C4X H;  3F1Z A;  1RL2 A;  1KRS A;  2K4K A;  5C0X G;  4LFB Q;  5C3E H;  4NB3 A;  2JA7 G;  1MIU A;  4OON A;  2VUM H;  3RLN A;  4YY3 L;  4O2D A;  2NVT H;  1PYS B;  1VQE A;  4DV2 L;  1YEZ A;  3J80 c;  4DUY Q;  1VQI A;  1TXY A;  4UP7 A;  4DV1 Q;  1B70 B;  1P8L A;  5LMN W;  3TS0 A;  2Y0S G;  1NJI C;  2ZJQ A;  1PH5 A;  1FJG Q;  4A3G H;  1YJW A;  4LUV A;  3FKI H;  1XNR Q;  4UP9 A;  3D0F A;  1C7Y A;  3I7F A;  2JEA I;  1Q82 C;  2KBN A;  1NE3 A;  2DUD A;  2HHH Q;  3S1M H;  4IJL A;  2ZM6 L;  2OTJ A;  3CCR A;  3J7A 5;  4DV5 L;  2UXC Q;  4BBS H;  3GO5 A;  4IFD J;  4LF4 L;  4QIW E;  4GN3 B;  4DV2 Q;  1NMF A;  1Q1E A;  3AFP A;  4JG2 A;  1J5E L;  4JBK A;  2N8N A;  5E7N A;  1L1O C;  1R9T H;  4PZ8 A;  2R93 H;  1X56 A;  3GTL H;  2JE6 I;  3ZJY C;  5LMU L;  2PQA A;  1I6H H;  1BBW A;  2YV5 A;  1E7Z A;  4IOC A;  4IFD I;  1G51 A;  1Y1V G;  2RHS B;  2OWO A;  2ZM6 Q;  2EIF A;  1N34 Q;  3I4O A;  1VQC A;  4DV5 Q;  2I5H A;  1BKB A;  1U5K A;  2ASB A;  3GTO H;  2IT1 A;  4HIK A;  2IHE A;  3CC4 A;  3CC7 A;  2Q2U A;  2HIX A;  2Y0S E;  2R92 H;  2JA6 G;  1G6P A;  4NXN L;  4OWX B;  4GOP A;  2YTV A;  2QEX A;  3CCU A;  1L1O B;  2B63 G;  1SN8 A;  1NBW A;  3J81 j;  3MEF A;  3CCV A;  3RN2 A;  5LMU Q;  1A62 A;  1WCM H;  4HJA A;  3S14 H;  3CME A;  4DR3 L;  1PYB A;  3PSI A;  2WAQ E;  1WJJ A;  4UPA A;  1HR0 Q;  1HZB A;  1WI5 A;  5FJ8 H;  1UE1 A;  3UDG A;  3TQY A;  2VNU D;  1VQB A;  2UU9 Q;  3PUX A;  1B7Y B;  3ULP A;  2YU9 H;  3PO3 H;  2Q2I A;  3J81 i;  3L0O A;  4JI4 Q;  2JA5 G;  3HOU H;  4B3T L;  4NXM L;  1FGU A;  4KHZ A;  4JI5 L;  1QVG A;  5JJL A;  3TS2 A;  4AIM A;  4JOI A;  4DV4 Q;  3I56 A;  2YTX A;  4DAM A;  2KHI A;  2VQF L;  2OTL A;  1C9O A;  2VY3 A;  3KF8 B;  4X66 Q;  1VQ7 A;  4LF8 L;  1I94 L;  3HOW H;  4A3L G;  1PH1 A;  4LFC L;  5IP7 H;  2F4V L;  2GVB A;  4B3M Q;  4AQY L;  1LTL A;  3OTO L;  4AYB G;  5LMN L;  2UXB Q;  4A3F G;  4P75 A;  3RLO A;  3KYH C;  4ALP A;  3CW2 C;  1K83 H;  4A3M G;  4GNX B;  3BZK A;  1L0W A;  4B3T Q;  2HQL A;  4DR5 Q;  4KHP Q;  2I0Q A;  2JA8 G;  5GAG C;  1PVO A;  1T9H A;  3E0E A;  3CCL A;  5C44 H;  3G4S A;  2PMZ E;  3IRB A;  4J15 A;  5IYB H;  1YJN A;  4DV0 L;  1QVF A;  3UE0 A;  2R7Z G;  1I94 Q;  1IBL L;  5FLM H;  3KFU A;  3S17 H;  2R93 G;  3M4Q A;  3WWV A;  5IYD G;  3HKZ E;  5C0X J;  5HGQ A;  1S3O A;  2H5X A;  2Q2H A;  1HNZ Q;  4BY1 G;  4KI0 A;  1A0I A;  3A0J A;  3GD7 A;  4JV5 Q;  2ZTC A;  4DV3 Q;  1PH2 A;  4A3J H;  2CWA A;  3E9H A;  4LUZ A;  3NEN A;  5JEA J;  3JAM c;  4OWT B;  4DR6 L;  1Q86 C;  4L5T A;  1JJ2 A;  1IYJ B;  2L15 A;  4DK6 C;  4DR7 Q;  4DV0 Q;  3M4O H;  3H3V I;  3PIO A;  1KXL A;  4AYB E;  3S15 H;  1NY4 A;  3W5O A;  4A3I H;  1PA6 A;  4GKK L;  1XPU A;  1KL9 A;  3A5Z B;  2UUB Q;  5K36 G;  4C3J H;  3W1G A;  1IZ6 A;  3HOY G;  1VS0 A;  2NVQ H;  3STB D;  1J6Q A;  3LGJ A;  3EIV A;  2B29 A;  5IE8 A;  4ME3 A;  3AEV A;  4BA2 I;  2A1A A;  4DR4 L;  4WJ3 M;  4JI0 L;  4IJH A;  4GNX A;  1WOC A;  4A93 G;  1SR3 A;  2LXK A;  3RZD H;  1CKO A;  2A19 A;  2YYZ A;  5M3M G;  1YI2 A;  1PH4 A;  1VQ5 A;  3GTM H;  3FP9 A;  4H02 A;  2B3G A;  3BU2 A;  4DR1 L;  4A3E H;  5GRO A;  4R1J A;  4B3S L;  1QZH A;  4LNQ A;  1N33 L;  4K0K L;  1JT8 A;  2XGT A;  2ZJP A;  1L2F A;  2HIV A;  1N32 Q;  5HY6 A;  3NBH B;  2N49 A;  1XPR A;  1VQK A;  3I4M G;  1VQP A;  2BH8 A;  1YZ6 A;  4P73 A;  1ASY A;  4BY7 G;  4P71 A;  4PG3 A;  2JA9 A;  3PGZ A;  2WB1 G;  4O0A A;  1N8R C;  2XTI A;  1PH3 A;  4L5S A;  4LF6 Q;  3D31 A;  3CAM A;  4R4T A;  1HZA A;  1LUZ A;  1N36 L;  4JI2 L;  4JI1 L;  4A4I A;  4DR4 Q;  2KCM A;  2E2H H;  3K7U C;  2YTY A;  5IP9 H;  1CSP A;  3PV0 A;  3F8T A;  4DPG A;  1HNX L;  1E1O A;  2E2I H;  4OX9 L;  4DR1 Q;  4QQB X;  1W2B A;  2QGQ A;  1V1Q A;  1N33 Q;  3K0X A;  3NEL A;  4DV7 L;  3A5U A;  4A76 A;  4BXX G;  1HZ9 A;  4DR2 L;  4P74 A;  1OXV A;  3S2D H;  2OCE A;  1GVP A;  3A74 A;  4R4O A;  4PZ6 A;  1EYG A;  1IBM L;  2KCT A;  4YY3 Q;  4YHH L;  3EN2 A;  1Y1W G;  5ELO A;  4PMW A;  1Y1V H;  3T1Y L;  3S2H H;  2F52 A; 
#chains in the Genus database with same CATH topology
 1NCV A;  4A3K G;  3L2P A;  1EY8 A;  3P20 A;  3MXP A;  5C4H A;  1ILP A;  3GDE A;  2NN6 G;  3BVZ A;  1MSG A;  2AMC B;  5LHY 1;  2WB1 E;  3S1N B;  3UE1 A;  5EKK A;  3G6J B;  3C2P A;  2EYF A;  2RSO A;  1K73 C;  2F0Q A;  4LF4 Q;  3U9O A;  3FPU B;  4RWS C;  2ZJR A;  1IXR A;  4KN4 C;  3S16 H;  2CQA A;  3ERO A;  5G3L F;  4F8M A;  1G2T A;  4FNF A;  2PPB C;  1WTX A;  4CBV A;  1H9K A;  3MXN B;  3I4N B;  5C6A A;  2XN9 C;  2F3V A;  2K04 A;  1D1I A;  1XX8 A;  3S1M B;  1ET9 A;  1LTI D;  1X3Q A;  1M1K C;  4XQJ A;  1SJE D;  4A3F H;  1G2S A;  2DY7 A;  1SNP A;  2IW3 A;  3UDX A;  2UUA L;  4IUT A;  3SK5 A;  3CMA A;  3ITP A;  4FXD A;  1EEI D;  1SE3 A;  1VMC A;  4LWC A;  4ODG A;  1LAB A;  2WAC A;  5E3F A;  1YJ9 A;  1PDQ A;  5IGC A;  3S1R H;  1I3Q H;  2ZXP A;  3QOJ A;  3L3O C;  5CV8 A;  5BR8 L;  4IFD G;  4UY8 C;  4Z9C B;  4QJF A;  3DLL A;  4LF5 L;  1L1O A;  1VF5 C;  5FJ8 G;  4LF8 Q;  4DV6 L;  5CV6 A;  3PIP 3;  2F0I A;  3HOU G;  4CKE A;  4LF9 L;  3K59 A;  3K81 C;  1Q90 A;  4XTC S;  5ELC A;  3EFX D;  2OXP A;  1TWF B;  3CC2 A;  2EYH A;  1A15 A;  5CV4 A;  3GTQ H;  1D6E C;  5C0X I;  1PTO D;  1XMO Q;  3PF5 A;  2JJQ A;  1SYE A;  3DMU A;  2QDL A;  2A74 C;  1TR5 A;  2AWN A;  3QOL A;  1Y69 U;  1GUN A;  1TKW B;  3M4P A;  1HR0 W;  2FXQ A;  5EPL A;  4K8J A;  5M5Y H;  1QG7 A;  3QB3 A;  1Y14 B;  1KDA A;  2E2J H;  2B2V C;  3AFQ A;  2I5M X;  4KHV A;  3D4W A;  4HID A;  4BXX H;  1GUO A;  2K5V A;  1FVI A;  3OIQ A;  2ZTD A;  4GZY C;  3A7A B;  1VQG A;  1ROD A;  5D3D A;  1HH2 P;  5I6W A;  4B3S Q;  2OQK A;  3BDC A;  4A3J B;  3M3Y H;  4A3I G;  2MQH A;  1VQ8 A;  4A3K H;  4C3H G;  4X62 Q;  4YWK A;  3I3C A;  3P75 A;  1X6O A;  2K28 A;  5IGB A;  1CHP D;  1S5F D;  5CV5 A;  1PFS A;  1SRO A;  4JI1 Q;  4QCL A;  2NTS A;  3Q8D A;  1JIC A;  1K28 A;  1KLU D;  2PW7 A;  4OX9 Q;  4NMZ A;  4JOI C;  5CC4 A;  3I55 A;  2K32 A;  3P7J A;  1F2L A;  3RZD B;  3A8K E;  3V2T A;  4DV7 Q;  5C3X A;  2JA6 H;  3TDQ A;  3GTJ H;  4DR2 Q;  4PNY A;  4CDC C;  2RSN A;  2MGS A;  1GUS A;  2X6G A;  1MD2 D;  1NAP A;  2D62 A;  5IP9 G;  1N34 L;  3K80 C;  2WAQ G;  3T1Y Q;  3JAM E;  1EU4 A;  2UUC Q;  4ID6 A;  2D0O A;  3VR6 A;  1TU2 B;  4KLK A;  3TSS A;  1LT5 D;  2R7D A;  3NTK A;  5FLX c;  2K05 A;  3J81 c;  2JYO A;  1B3Q A;  1K9M C;  1AW7 A;  2XNA C;  1X65 A;  1VQJ A;  3MTS A;  1HR0 L;  3F2D A;  4WJW A;  3S2D B;  3CRL C;  2Z1C A;  2AWO A;  1X55 A;  4BBS B;  1VQN A;  1SE4 A;  2LS0 1;  4BBR G;  4JI4 L;  1FNW A;  1ASZ A;  1FR3 A;  4A3M H;  2QW7 A;  2RVL A;  4ILW A;  4YWL A;  2IWH A;  1SMY D;  1SE2 A;  4JI7 L;  3NBI A;  1PH6 A;  1IBK Q;  4FDB A;  4TQU S;  5M5X H;  3KDF B;  1YHA A;  5ELF A;  4DAV A;  1Q46 A;  1SYB A;  4KY5 A;  4ABN A;  5M3F G;  1IKL A;  1YIT A;  3S1Q B;  3A7L A;  1XNQ Q;  4KHP L;  2L55 A;  4HAE A;  2ICE C;  4G4K A;  4EX5 A;  1QE6 A;  4HED A;  1KTK A;  4WJ4 A;  3HKZ B;  1STE A;  5FO7 B;  1FGB D;  1KNA A;  4C3I B;  1VQL A;  1UNS A;  2QDB A;  4M8A A;  1HCZ A;  3GTK H;  2EY6 A;  5LL6 S;  2L11 A;  1ICF B;  1YNJ D;  4JI3 Q;  3PO3 B;  3KJO A;  2L9H A;  2NVY H;  2OT2 A;  1SYF A;  2EY1 A;  3HOW G;  3BDL A;  3CQZ B;  1RIP A;  2EPB A;  1I4Q A;  5FLX L;  4LJZ C;  5KGU A;  3KDF A;  2ATW A;  4QY7 A;  3SGI A;  4JW0 A;  3H0G G;  2EQS A;  2F0N A;  1PLF A;  2BH2 A;  5IYC G;  4A3D G;  1KIX A;  1E22 A;  2PZU A;  3S24 A;  4HCS A;  3B6Y A;  4PV1 C;  2QIL A;  2HD3 A;  4C3H H;  1RKN A;  2FMM A;  1PRT D;  2RDG A;  5M9O A;  1D7Q A;  4RCO A;  4YIJ A;  3PCO B;  1DGS A;  1B8A A;  1JMC A;  2PNR C;  4RH6 A;  1AZP A;  1X54 A;  2R3Z A;  5FO8 B;  3HOV G;  2F1M A;  5KIX A;  4V0B A;  1SNQ A;  4NB3 A;  2JA7 G;  1SSO A;  4IAL A;  4O2D A;  1PYS B;  5KND A;  2KQ3 A;  1YEZ A;  4NW2 A;  5ISR A;  4HSV A;  2WB1 B;  4RAU C;  1DON A;  5J1Z A;  1PH5 A;  1FJG Q;  4UP9 A;  1A2T A;  3D0F A;  3I7F A;  4QB4 A;  1Q82 C;  5C4J B;  2DUD A;  3H91 A;  3S1M H;  3NE5 B;  4FF3 A;  3J7A 5;  3N6R A;  3GO5 A;  3NQT A;  4EVO A;  4U67 3;  4GN3 B;  4DV2 Q;  1RTN A;  1NMF A;  2EJM A;  4JG2 A;  1J5E L;  2K5D A;  1RTO A;  5E7N A;  4JBK A;  1G91 A;  2B2T A;  4XT1 B;  1X56 A;  3C46 A;  3ZJY C;  2PQA A;  1PFB A;  1O78 A;  4IOC A;  4Y7N B;  1JOQ A;  2KHS A;  2OWO A;  5FOB B;  1VQC A;  4OEM B;  1BKB A;  1U5K A;  2IT1 A;  4HIK A;  4NKL A;  3CC4 A;  2Y0S E;  1Y1V B;  1IHZ A;  3X3N A;  3S2H B;  4GOP A;  1SN8 A;  3RN2 A;  5LMU Q;  2Z9H A;  1A62 A;  5JVG 3;  4N8F A;  1I4R A;  4I7Z C;  3CME A;  3PSI A;  2WAQ E;  4DU9 A;  1UE1 A;  3SDZ A;  1B7Y B;  3ULP A;  2Q2I A;  1SND A;  3L0O A;  4C3I G;  2Z4H A;  1QVG A;  1PTO C;  5C5L A;  3NXW A;  2G9D A;  3I56 A;  4DAM A;  2VQF L;  2RCF A;  4X66 Q;  4A3L G;  5BN5 A;  3HOW H;  4LFC L;  1H9S B;  4B3M Q;  3OTO L;  2UXB Q;  1CHQ D;  3J80 E;  2EOT A;  5EKI A;  2HQL A;  3NTH A;  4DR5 Q;  2JA8 G;  1QWY A;  3E0E A;  3CCL A;  4A3F B;  4KJN A;  3IRB A;  5COR A;  5KRU A;  4J15 A;  4RKL A;  5IYB H;  2R7Z G;  1IBL L;  1HTP A;  4ZYS A;  3VR2 A;  4BY1 G;  4OGQ C;  3A0J A;  1SYC A;  2ZTC A;  4DNR B;  4DV3 Q;  3LNN A;  4A3J H;  4LUZ A;  4XXE A;  4N9P A;  5JEA J;  3JAM c;  1U4R A;  3TZU A;  4XYO A;  4OWT B;  1K3B C;  2F0T A;  1V1O A;  1JJ2 A;  2L15 A;  4DK6 C;  3A55 A;  3R3O A;  1KXL A;  3PIO A;  4AYB E;  1NY4 A;  1ENC A;  4GKK L;  3V96 A;  2AQ3 B;  1B44 D;  3A5Z B;  2B8G A;  1H9S A;  3AMU A;  1IZ6 A;  3UI2 A;  1VS0 A;  5T1I A;  1ZKO A;  3E6Z X;  4R8N A;  4WJ3 M;  3SR1 A;  1SR3 A;  3RZD H;  2A19 A;  4S3S A;  3BZD B;  4H02 A;  3BU2 A;  2G5D A;  4DR6 Q;  4ZKC B;  3GTQ B;  2ZJP A;  2LY7 A;  3I4M G;  2BH8 A;  3NP8 A;  4ZK9 B;  2VB3 X;  3Q0A A;  2WB1 G;  4LF6 Q;  1N36 L;  1M8A A;  3K7U C;  2F0E A;  4IQZ A;  3CRK C;  4WRD A;  3PV0 A;  3F8T A;  4CJ1 B;  1E1O A;  4DR1 Q;  4B9X A;  1W2B A;  2QGQ A;  1TWC B;  3I4L A;  2A5H A;  5I2X A;  3S2D H;  1GVP A;  4RGM A;  3K5N A;  3EN2 A;  1Y1W G;  5FO9 B;  5ELO A;  2ZXO A;  1BUV T;  2F52 A;  4DXG A;  1LV9 A;  1SMY C;  3GTP B;  1D5X C;  3F2U A;  3U50 C;  2XIW A;  2JQO A;  3HKS A;  3JAM L;  1TWA H;  4A3K B;  1OXU A;  1HZC A;  1KDC A;  2I5L X;  4POG A;  5JOB A;  2Z4I A;  3J80 i;  1WYD A;  1XMQ L;  1PFN A;  3SK4 A;  3I90 A;  3S1Q H;  2VXW A;  1S5B D;  2IY5 B;  3I70 A;  2K75 A;  4RGT A;  4OO1 H;  3HZX A;  3PUV A;  4WFN 3;  3ONA B;  4C3I H;  3X3M A;  1DYQ A;  4X65 L;  3ND8 A;  1PMR A;  1B9M A;  1LTA D;  3GTJ B;  1YNJ C;  1H9J A;  1HFG A;  1MSH A;  2CH4 W;  4HJ8 A;  4JYA L;  3OIP A;  1YIJ A;  1HFN A;  5GAH C;  2A69 D;  2B2W A;  4A3L H;  2AUK A;  1BQQ T;  1UAP A;  1PTO H;  4C2M H;  4L8J A;  3CQZ H;  1DXM A;  1R9T B;  1B53 A;  5JJK A;  1X3G A;  4GKJ L;  3OWE B;  1CKN B;  2OQ0 A;  1OO9 B;  4DXF A;  3D4R A;  5JPN C;  4K5W A;  2KCN A;  4EQO A;  3VYS A;  1MJC A;  1LLR D;  3OYY A;  4NXM Q;  3CCJ A;  4JI5 Q;  3GTO B;  4ZKB B;  4BY1 H;  2K03 A;  1VMP A;  2UUA Q;  2K50 A;  2N3S A;  1GJX A;  2O2L D;  1GHJ A;  5GAE C;  1FNV A;  1PRT C;  3OSO A;  5BN4 A;  2NWG A;  3CPF A;  3HG9 A;  2UXD L;  4FYD A;  2K5W A;  2GN5 A;  3NSW A;  3H15 A;  1D5M C;  3G7L A;  2X69 A;  1TWG H;  3HOU B;  2RCN A;  4LF5 Q;  3RUZ A;  3SE0 A;  2F3I A;  2A6E C;  2VQE L;  2XWB B;  4HJ9 A;  2PQE A;  4OWW B;  2BDN A;  3KBG A;  1V9P A;  4BS9 A;  1CKN A;  2PZW A;  4LF9 Q;  4LK1 C;  1D2B A;  3I8Z A;  1G6Z A;  3RLF A;  2SDF A;  3I4M H;  4B3R L;  1ENF A;  2A8V A;  1T5E A;  4JI6 L;  5IGG A;  4ZUI A;  3CF5 A;  2E5L L;  1HXY D;  2NVY B;  5FLM G;  1KD1 C;  3UDF A;  1AEX A;  2R6G A;  5C4J H;  3JC6 6;  2E8G A;  1O7Z A;  3OW2 A;  1TQO A;  4HMI A;  1SNO A;  1FNU A;  1EY7 A;  4LFB L;  2RQX A;  2JN4 A;  5CV7 A;  5EBD A;  1KHI A;  1HQR D;  2SEB D;  3VYT A;  2VZA A;  2N88 A;  3E5S A;  4K0K Q;  1Y1W H;  1SLJ A;  4DV1 L;  4Y7N H;  1K8A C;  2O5J C;  4HTH A;  2XWJ B;  3HGB A;  4GN4 B;  2PI2 A;  4A3I B;  1EOT A;  2HHH L;  4C3H B;  4MZ9 A;  1Y8P B;  5IWA L;  1E1T A;  1CFM A;  1HNX Q;  1DM0 B;  4RGO S;  4A75 A;  3R8B A;  1KAA A;  1YNX A;  2Z8L A;  2F0H A;  2K1B A;  2ALY B;  3IL8 A;  1H95 A;  4BA1 I;  2KOL A;  1VF7 A;  2EYO A;  1IBM Q;  2KEC A;  2K7V A;  3RNU A;  2Y0S B;  2LXJ A;  4PQX A;  3FHW A;  1Q8I A;  3TZD A;  3W3A A;  1K0R A;  3P1H A;  5KNB A;  1K0S A;  3TP7 A;  5AJ3 Q;  3T4A C;  2WAQ B;  4IUN A;  2E2I B;  3DM3 A;  1BCP D;  2XVS A;  2R7F A;  3KLW A;  1STA A;  3A54 A;  3W1B A;  4I7A A;  1UEB A;  5ELD A;  1OXX K;  1V8Q A;  1TS4 A;  1Z47 A;  2UU9 L;  3LX0 A;  1PH7 A;  2NTT A;  3HP3 A;  3D6W A;  1XTD A;  4X3S A;  3DWA A;  2RA4 A;  4KMU C;  2B2U C;  1NTG A;  4DV4 L;  4O42 A;  5GAD C;  1E2Z A;  4BBR B;  2Z6K C;  2DNC A;  1EIF A;  4CGY B;  4HJ7 A;  2AKW B;  3K5O A;  4JI8 Q;  4GLX A;  3E3X A;  1HA6 A;  2I46 A;  5KNC A;  4FVM A;  3OHX C;  1VQM A;  4H44 C;  3A56 A;  1QNK A;  2AUJ D;  1WCM G;  2K5N A;  1EY5 A;  3VR4 A;  2EYM A;  5E1F A;  5M3F B;  1P16 A;  4HIO A;  4JI7 Q;  2EYL A;  1STN A;  3QR8 A;  3TP5 A;  2O4X A;  3MXN A;  3GQB A;  3E9I A;  4FF1 A;  3M7N A;  3QO2 A;  5EPJ A;  2RHQ B;  4ZAI A;  1FL0 A;  1HNZ L;  4FO2 A;  3AYH B;  4JV5 L;  5FK9 C;  1LTR D;  4LUO A;  4HIM A;  4LFA Q;  4MNO A;  3MEH A;  3TRZ A;  4RCN A;  5D14 A;  4K2K A;  1CUK A;  3CPW A;  3BZC A;  3HOW B;  1U0L A;  3CCE A;  1WD1 A;  1GM5 A;  4CKC A;  3CCQ A;  2LMC B;  5A2Q E;  4OEL B;  3BJU A;  1YHQ A;  2EZV A;  4HSP A;  3QJY A;  1JB3 A;  3H0G B;  1TWC H;  4DA2 A;  3PO2 G;  2M2L A;  4K2L A;  5G3L D;  2O5I C;  4DUZ Q;  4GN5 A;  1WTW A;  3ULL A;  5H1S E;  4X64 Q;  4LF7 Q;  1TWH B;  4DAP A;  1ZEQ X;  3Q22 A;  1ET6 A;  1J8I A;  3PIO 3;  4A3D B;  1LTG D;  3GTP H;  3H3V H;  2NN6 I;  4QUF A;  4R4Q A;  3HOZ G;  4JBJ A;  1DD2 A;  1TS2 A;  4YCV A;  1AH9 A;  1QNU A;  4C3J G;  1B9N A;  1XNR L;  4WOR A;  3J7A F;  2NN6 H;  4QIW B;  1STY A;  4KD4 A;  3HOV B;  2F0W A;  4J8Q A;  4DUY Q;  2JA7 B;  1VQI A;  2DY8 A;  1TXY A;  1B70 B;  1NJI C;  2Y0S G;  5EGT A;  3NHH A;  2L4N A;  3URY A;  4F7X A;  4LUV A;  1EWC A;  2A69 C;  2MHV A;  4Q0F A;  2KBN A;  1UEA B;  3CCR A;  1CZG A;  2UXC Q;  1SJH D;  1HRJ A;  1F9Q A;  2F0D A;  4LF4 L;  1HQM C;  1JOR A;  1LT3 D;  3KBX A;  1R9T H;  1L1O C;  3NWT A;  4PZ8 A;  1EY0 A;  1U4L A;  4KJO A;  1E7Z A;  1SAP A;  1F9P A;  5C3W A;  4IFD I;  4KY7 A;  2ENB A;  2ASB A;  3GTO H;  3NTI A;  1CT1 D;  2HIX A;  4C56 C;  4E6I A;  2IL8 A;  4IFD H;  1G6P A;  2B63 G;  1NBW A;  3J81 j;  1WCM H;  3S14 H;  2EDG A;  3W2D A;  4ZRZ A;  4EQN A;  1TWA B;  4NP5 A;  3WDN A;  5FJ8 H;  3UDG A;  3TQY A;  3DEO A;  2VNU D;  3SVM A;  2I07 B;  3HOU H;  3R2T A;  4B3T L;  1DOL A;  2SOB A;  2NB0 A;  5JJL A;  1CA6 A;  3BG3 A;  1V1P B;  1EIH A;  1JWU D;  2YTX A;  1SYG A;  2OTL A;  3BVM A;  1IYU A;  2G9H D;  3LWE A;  3KF8 B;  4LF8 L;  1I94 L;  2PZT A;  3T53 B;  2B2Y C;  4AYB G;  3RLO A;  2RDH A;  3KYH C;  3K7A B;  3TN2 A;  3CW2 C;  1CK1 A;  2EYJ A;  4GNX B;  3BZK A;  2I0Q A;  2EJF C;  3Q23 A;  1PTO B;  4C2M B;  1T9H A;  2F0S A;  2PMZ E;  5FKA C;  5ELE A;  3T13 A;  4DV0 L;  2JA8 B;  3GV6 A;  3J81 L;  3RZO B;  3M4Q A;  2GA4 B;  1ONL A;  2SNS A;  3VYR A;  3SEB A;  3ND9 A;  5BN3 A;  1C8C A;  1A0I A;  3GD7 A;  5C4Z A;  2R7Z B;  2SNM A;  1CA5 A;  2F3W A;  2IX3 A;  1GUT A;  2F0G A;  2CWA A;  5C5M A;  1CQV A;  3NEN A;  1HPC A;  4BY1 B;  4L5T A;  4DR7 Q;  4A3I H;  5I2Y A;  3KF8 A;  3MZ5 A;  2UUB Q;  1DOK A;  4C3J H;  3H94 A;  3HOY G;  2NVQ H;  1J9O A;  1EEF D;  4OIK A;  3LGJ A;  1WTH A;  1STB A;  2A1A A;  3IFT A;  3VA7 A;  4DR4 L;  4IJH A;  4GNX A;  4A93 G;  1CKO A;  2YYZ A;  5M3M G;  4MN3 A;  2B3G A;  1TWG B;  2PO4 A;  4B3S L;  1I6V C;  4DFA A;  2HIV A;  2J4X A;  1N32 Q;  1VQK A;  2A6E D;  1YZ6 A;  4BY7 G;  5IOD A;  4O0A A;  2XTI A;  3VA5 A;  3CAM A;  3R93 A;  4JI1 L;  2D9U A;  3I4M B;  3LWU A;  2YTY A;  5IP9 H;  5E4W C;  1BCP C;  2E2I H;  4OX9 L;  4X3T A;  1V1Q A;  4KN7 C;  3K0X A;  4DV7 L;  2QCP X;  1LT6 D;  4DR2 L;  4P74 A;  1OXV A;  2OCE A;  4PZ6 A;  1E2V A;  4YY3 Q;  1B2T A;  1EU3 A;  3T1Y L;  1I4P A;  4TKO B;  2UUC L;  1KLG D;  2NYZ D;  3IKJ A;  2F0K A;  3IAY A;  1R4P B;  4BBR H;  4OXP A;  5C4X G;  2EXZ A;  1Y1W B;  3PUW A;  4R4C A;  4KD3 A;  4CKB A;  1O7L A;  1AE2 A;  2ZXR A;  1QB5 D;  5C3E G;  3WOE A;  2VUM G;  5JJI A;  3TEH B;  4P2C B;  1PFM A;  2NVX B;  1QZG A;  4N9T A;  4CDD C;  1LAC A;  3K57 A;  1JR0 D;  5IT9 E;  3S9W A;  3OMG A;  5M3F H;  4A3G G;  1Q8K A;  1GD7 A;  3FKI G;  3ER0 A;  3BYT B;  2NZ1 D;  4KV6 A;  1JJC B;  1IL2 A;  1VQH A;  2VL6 A;  3OWF A;  2OF1 A;  4G7O C;  3MWY W;  1GHK A;  1LTT D;  4NXN Q;  1EYD A;  1XNQ L;  5I9O A;  3AB9 A;  2MO1 A;  1NR2 A;  2JP1 A;  4X65 Q;  4GS3 A;  4DR3 Q;  1WTQ A;  1EZ6 A;  1WTV A;  3GTL B;  2HQE A;  1D8L A;  2B39 A;  5LL6 X;  4NPS A;  2R92 G;  5I9P A;  4JI3 L;  3O13 A;  3H0G H;  1W6K A;  1S72 A;  1KAW A;  1X9N A;  5JJZ A;  1UE5 A;  1EOV A;  3Q6S A;  1SNC A;  4A3B G;  1TWH H;  2F4V Q;  2E74 C;  4AQY Q;  3J7Y W;  5IYC H;  5LMN Q;  4A3D H;  3A8I E;  2X6L A;  1G29 1;  3MFG A;  5IGE A;  3MVV A;  1XPO A;  1F2M A;  1ZXT A;  2YU9 B;  1PHJ A;  2RDF A;  5EQ0 A;  1QVC A;  3TP6 A;  3HOY H;  4PMB A;  1S5D D;  3VR5 A;  1A2U A;  1X3E A;  5IP7 G;  1PZK D;  4A93 H;  2F0U A;  1GUW A;  1QUQ B;  5A2Q L;  3OOC A;  5M3M H;  1S5C D;  1PRT B;  2Q8R E;  2HDL A;  4DNT B;  3HOV H;  2DN8 A;  1XXG A;  2LFN A;  1LYL A;  3NWS A;  3BDO A;  2WFW A;  4K6L A;  2PNH A;  1E0B A;  4FP5 D;  5C44 G;  2JA7 H;  2L5T A;  1IW7 D;  1I5F A;  4RHR A;  1PV4 A;  1Q1B A;  2CQO A;  2B2T C;  1EWH A;  2KED A;  1PH8 A;  1Q12 A;  1ESF A;  1TVX A;  1WTR A;  4MTN A;  3CXC A;  3VDY A;  4L63 B;  3A8J E;  2D2C C;  1GO3 E;  1TT2 A;  1KRT A;  4JI6 Q;  3NEM A;  4JI0 Q;  1X3F A;  2WIN B;  1HNW Q;  3KOJ A;  4GOP C;  2K6A A;  2K52 A;  4Q5V A;  3HEJ A;  2EY5 A;  5NUC A;  1EFW A;  2FMC A;  2V1C C;  2E76 C;  4DAY B;  1FJG L;  1QUQ A;  4G7Z C;  3M4O B;  4GLA C;  4RA8 A;  1KQS A;  2VS1 A;  1K8O A;  4JI2 Q;  2EJG C;  4JBW A;  1N9W A;  4B9W A;  4A3E G;  1VQD A;  5EPK A;  4DNI A;  1A3V A;  1HUM A;  5AFW A;  2LKV A;  5JEA G;  2NZH A;  2Z0S A;  4I65 A;  1EY6 A;  3NQI A;  3C3L A;  3RD4 A;  3EBE A;  4IPG A;  1JCK B;  4IUR A;  4P72 A;  2D0P A;  4TSS A;  3ERS X;  4OO1 I;  1VQA A;  4YHH Q;  1K8G A;  1VQF A;  4CJ0 B;  5IWA Q;  4K6D A;  5CGK A;  5DM6 3;  4IOA A;  1NR4 A;  1M4V A;  2K01 A;  3BVG A;  2CCZ A;  5EBC A;  1HA5 A;  2Q2T A;  4H7B A;  1AP0 A;  4DAY A;  4EQ5 A;  3K7A H;  3PQI A;  3TME A;  1JB7 A;  3CP0 A;  2R93 G;  4IO9 A;  1G8Z D;  1LM0 A;  2FJ2 A;  2P5Z X;  1H9M A;  5DM7 3;  1VQ4 A;  1WD0 A;  4V19 0;  2M9V A;  1IL8 A;  3MHB A;  3U58 A;  2JA8 H;  1Z6H A;  1TY2 A;  2QF7 A;  5M5W H;  3RZO H;  1DOM A;  2JEB I;  4B08 A;  2RF4 A;  4X66 L;  1AE3 A;  2EYP A;  4B3M L;  2R7Z H;  2WII B;  1F9R A;  1GXD C;  2UXB L;  4A3B H;  1Z9F A;  3CD6 A;  3GTG B;  2ID0 A;  3T1H L;  4RKB A;  4G57 A;  4F88 A;  1JC7 A;  4DR5 L;  1CI3 M;  4IPH A;  1VQ6 A;  1WCM B;  3S14 B;  1YNN D;  3SHL A;  3F2C A;  3AQQ A;  1ZYR D;  2HUG A;  4M1U B;  1Q3L A;  5BR8 Q;  1KC8 C;  5J22 A;  1K3R A;  4DK3 C;  4DV3 L;  4X6A H;  4YCW A;  4R4I A;  3NK9 A;  2K5H A;  4EGV A;  1EL0 A;  4R8I A;  1A8V A;  1BBU A;  3I91 A;  3MA2 B;  1DCZ A;  4DV6 Q;  4IN3 A;  1RJT A;  3K8A A;  3WOF A;  3HRZ C;  1WFQ A;  1OTC A;  3D4D A;  3L7Z C;  5IT9 c;  1MHW C;  3FRP B;  1X32 A;  1XWE A;  2BA1 A;  3KLR A;  2Z6K A;  4G7H C;  1VQ9 A;  4L5R C;  5EKL A;  1NNX A;  1ML0 D;  3PO2 B;  1JQY D;  4KKS A;  4LF6 L;  3M4Y A;  2TSS A;  4JC0 A;  1NSN S;  1PYW D;  3CKI B;  3G48 A;  1SMX A;  1MJE A;  4KK7 A;  2CH4 A;  2NVX H;  3TRE A;  3VR3 A;  5EAY A;  3F1Z A;  3HOZ B;  2K4K A;  1JE4 A;  1KRS A;  3IFD A;  5C0X G;  1BOS A;  1MIU A;  2B2W C;  3RLN A;  4C3J B;  2NVQ B;  3K6O A;  4UHV A;  3H6M A;  3J80 c;  4U68 A;  4JVZ A;  1X3P A;  1B4O A;  3MXG A;  1U4M A;  3TS0 A;  4IUU A;  2PW5 A;  1YJW A;  1XNR Q;  4QMG A;  1C7Y A;  2JEA I;  2A68 D;  1SFO B;  5I4D A;  2ZM6 L;  2OTJ A;  4DV5 L;  4IFD J;  4X3U A;  1PTO F;  1Q1E A;  2WKC A;  3AFP A;  1EQV A;  2N8N A;  2R93 H;  1I4G A;  3EVQ A;  4KTA A;  3GTL H;  5IT9 L;  1BBW A;  1RHP A;  4XQN A;  2CHB D;  1II3 A;  2B2V A;  2RHS B;  1N34 Q;  2I5H A;  2KVM A;  5JVH 3;  3CC7 A;  2JA6 G;  3SK8 A;  2FIN B;  3CCU A;  1L1O B;  1ENA A;  2OEO A;  3CCV A;  1F9S A;  1AFP A;  2Q8T A;  1D1K A;  3H09 A;  1SXT A;  1HR0 Q;  4RGN A;  1HZB A;  2EVB A;  2B63 B;  1U9R A;  1VQB A;  2YU9 H;  3PUX A;  1BBX C;  1IKM A;  4JI4 Q;  3J81 i;  1B3A A;  2JA5 G;  2ICI A;  4NXM L;  1FGU A;  4KHZ A;  4JI5 L;  3TS2 A;  5I6Y A;  4JOI A;  5D3I B;  4OIJ A;  3J80 L;  4MHE A;  4IUV A;  1EYC A;  2VY3 A;  3CU7 A;  3V05 A;  3D3R A;  2GVB A;  1LTL A;  1A6X A;  1IW7 C;  3DWP A;  4X3K A;  2DJF C;  1K83 H;  4A3M G;  4B3T Q;  4KHP Q;  4AYB B;  1PVO A;  3G4S A;  3C1E A;  2BDO A;  2J7Z A;  3K5M A;  2DNE A;  1QVF A;  1I94 Q;  5FLM H;  3KFU A;  5IGF A;  1MI2 A;  5E4X A;  3WWV A;  5IYD G;  1S3O A;  4UAI A;  5CYU A;  4R9W A;  1PH2 A;  2NUC A;  3E9H A;  4BWG B;  1Q86 C;  5CBA E;  2KJX A;  4DV0 Q;  3HOX B;  3M4O H;  3H3V I;  1W6J A;  3W5O A;  1SEB D;  5K36 G;  3W1G A;  2F0V A;  3STB D;  1J6Q A;  2MP1 A;  5C0X H;  2E75 C;  4ME3 A;  5IE8 A;  1Y8N B;  1WOC A;  4OL7 A;  1PH4 A;  3FP9 A;  3HOY B;  4K0K L;  1QJO A;  4R1J A;  4HCE A;  1QZH A;  3T51 B;  1N33 L;  1JT8 A;  2XGT A;  4A93 B;  5HY6 A;  3NBH B;  2N49 A;  2R61 A;  2L0C A;  5M3M B;  1VQP A;  4CHT B;  4P73 A;  1ASY A;  4P71 A;  4F87 A;  4ZUJ A;  1PH3 A;  2B2Y A;  2KUM A;  3D31 A;  1D5Z C;  1LT4 D;  1LUZ A;  4DR4 Q;  1LTS D;  2A6H C;  1EFI D;  1CSP A;  1HNX L;  4BY7 B;  4ME5 A;  3TBI B;  1E2W A;  3FEW X;  2MUY A;  2C5C A;  4XYQ A;  4DF7 A;  3NEL A;  5KEE A;  4A76 A;  1TS5 A;  1HZ9 A;  1F2Y A;  2WV6 D;  3D6C A;  2F0L A;  4J1M A;  1XYI A;  1EYG A;  1IBM L;  2KCT A;  1BF4 A;  4KKT A;  4A3C G;  1BCP B;  5F2D A;  5AJ3 L;  4J6H A;  1CZW A;  2ZT9 C;  4AH6 A;  1BNZ A;  5CBE E;  2IPK D;  3RMH A;  4K8I A;  2CW0 D;  1O7Y A;  4RMF A;  5IIF A;  1F2Z A;  2CKZ B;  3NBH A;  2AHO B;  2D5D A;  5C4X B;  3GTG H;  4DN4 M;  3OW7 A;  5C3E B;  4JCV E;  2VUM B;  3G6E A;  5DEH A;  1J5E Q;  2NVT B;  1VCI A;  2K33 A;  4H13 C;  5GQO A;  3I4N G;  1HUN A;  1YNN C;  3F2B A;  2DGY A;  2CWP A;  2JA5 H;  1ZYR C;  1W3S A;  1TII D;  5A35 A;  1Q81 C;  1PRT F;  4A3G B;  4JI8 L;  1EY9 A;  3FKI B;  4JK1 C;  4C1N I;  1TY0 A;  4FF2 A;  2KHJ A;  2BE5 D;  1OXS C;  1CSQ A;  2TMP A;  2EY2 A;  4Y52 H;  2F0O A;  5DLQ E;  3ULJ A;  1K8M A;  2IHF A;  3PUY A;  1I6H B;  2NBF A;  1RCV D;  4JBM A;  2MPM A;  4K14 A;  3Q24 A;  1O7I A;  5IYD H;  2PYK A;  2F4I A;  4XQQ A;  2R92 B;  2XRS D;  2VQF Q;  1UWV A;  1EY4 A;  1XTC D;  3UDI A;  1WTO A;  2GVA A;  3R2I A;  3U9S A;  4LFA L;  3DHQ A;  1XMO L;  5M5W B;  4LFC Q;  1EQT A;  3OTO Q;  3PO2 H;  4MIU A;  2IX1 A;  4QGU A;  2J0T D;  2HCC A;  3CHB D;  4ZLT F;  3DUZ A;  5IGD A;  5JPM C;  3I73 A;  1Q7Y C;  1RD9 D;  1IYV A;  3HOX G;  1XJV A;  4A3B B;  2ES2 A;  5K36 H;  3I2Z A;  4IPC A;  3DEP A;  4LAA A;  1EIG A;  4RHS A;  1NMG A;  1V1P A;  1MGS A;  1ESR A;  3DM1 A;  4YWM A;  1IBL Q;  3HOZ H;  1CQF A;  5J3B A;  4DUZ L;  1V43 A;  4X64 L;  4LF7 L;  3G71 A;  3EQL C;  2ZTE A;  2KEN A;  1JOK A;  1WTP A;  3FVQ A;  1I50 H;  4QUC A;  4LW1 A;  5IYB G;  2MNA A;  2VW9 A;  4YCU A;  5C44 B;  1A3T A;  2A68 C;  4X62 L;  4GKK Q;  1UE7 A;  3HFZ B;  1SFO H;  3OMC A;  1DZ1 A;  4PZ7 A;  2HT1 A;  1L0X B;  3S17 B;  2KEE A;  2WP8 J;  3KUP A;  3JAM i;  4A3J G;  2L12 A;  3BYY B;  2WKD A;  2NZO A;  1QIL A;  4HJ5 A;  2PI2 E;  1SRU A;  4DUY L;  3ERQ A;  2EXD A;  1AN8 A;  2HCI A;  1UE6 A;  2PQA B;  3OPO A;  3DWQ A;  3KF6 B;  4A3C H;  3S1N H;  4H0L C;  4UP8 A;  2C35 B;  3KJP A;  3U4V A;  3S15 B;  1SYD A;  1JWM D;  1HHV A;  4K5V A;  1SBB B;  2N55 A;  1N36 Q;  2UXC L;  1EZ8 A;  1EQQ A;  2MO0 A;  1EWI A;  3RR5 A;  4GOP B;  4TVA B;  1PZJ D;  3EA6 A;  3PUZ A;  1MKH A;  1M90 C;  3FDT A;  1JE5 A;  1KDB A;  4EQP A;  3GTM B;  2LSS A;  3QIA A;  4A3E B;  1S4Z A;  3CCS A;  3I4N H;  2B63 H;  2BOS A;  4FF4 A;  2L1B A;  3RN5 A;  4IPD A;  5IY0 A;  5EJW A;  5J39 A;  4OHJ A;  3M85 A;  3KLS X;  2K14 A;  3FPP A;  2E2H B;  1YBY A;  1L0Y B;  1B50 A;  2F0P A;  2N78 A;  1UUP A;  3KF6 A;  4XIG S;  1IBK L;  4BBS G;  1STG A;  5T1G A;  1A63 A;  1GKH A;  1RDP D;  1XMQ Q;  3SXH A;  1C4Q A;  3C1F A;  4QL5 A;  4KKU A;  1PH9 A;  1YHB A;  2C9O A;  2BA0 A;  3K58 A;  3BS1 A;  4ZCK A;  2R93 B;  1EQR A;  1SE8 A;  1Z7T A;  2Q8I B;  4JYA Q;  1EIY B;  1BR9 A;  3FMC A;  4L6T B;  4O1N A;  5CR3 A;  1HTL D;  3NPP A;  4APV A;  4OO1 G;  1EUJ A;  4GNX C;  1E24 A;  1TWF H;  3HKZ G;  4RFB A;  3MAQ A;  3S16 B;  2QKI C;  3PIP A;  3HOX H;  2AQ1 B;  5DAU A;  4GKJ Q;  2CFM A;  1I4H A;  3PO3 G;  3STB C;  2JK8 A;  4POF A;  5JAV A;  3ICE A;  3SK6 A;  2F0J A;  3GV3 A;  3PMF A;  5COY A;  1GOZ A;  1B1Z A;  3T1H Q;  3PF4 A;  5KYL A;  1HJP A;  3D8G A;  2K5Q A;  2E2D C;  1VQO A;  4DR7 L;  3J7Z C;  1S40 A;  4QF4 A;  4IUQ A;  5ELN A;  2IX0 A;  4GLV B;  3CCM A;  2UXD Q;  4DKA C;  3N52 A;  3M9B A;  2UUB L;  3J7A V;  1SNM A;  1I3Q B;  3S1R B;  3HS0 C;  4BY7 H;  1K83 B;  4LMQ D;  4CDF C;  3TP8 A;  4XT3 B;  2MJ8 A;  1ICW A;  4NDX A;  2MFI A;  2VQE Q;  4MTK A;  4K5X A;  3U4Z A;  4KY6 A;  5CV9 A;  2F0M A;  1GUG A;  1N32 L;  1YVC A;  4L5Q A;  1BXT A;  1MBY A;  4B3R Q;  2XSC A;  4RG1 A;  1BVS A;  1E3P A;  1BO0 A;  1OXT A;  2HDM A;  2E5L Q;  2QA4 A;  2CW0 C;  1CKM A;  2H4O A;  4DGZ A;  1LO5 D;  2Z6B A;  1C0A A;  5KYI A;  5C4X H;  1RL2 A;  4LFB Q;  2PCF B;  5C3E H;  4OON A;  2VUM H;  1I4X A;  4DK0 A;  4YY3 L;  2NVT H;  3QWN A;  1VQE A;  4IUP A;  4PMC A;  4DV2 L;  3AU7 A;  3MFY A;  1STH A;  4UP7 A;  4DV1 Q;  1P8L A;  5LMN W;  3GP7 A;  2ZJQ A;  4A3G H;  5M5Y B;  1S5E D;  1U4P A;  3FKI H;  3KK7 A;  2CVR A;  2E2J B;  2BE5 C;  1NE3 A;  2HHH Q;  4IJL A;  3MXU A;  4HR7 B;  1PXU A;  1NUC A;  4BBS H;  2JSO A;  2B8F A;  3I72 A;  4QIW E;  3T16 A;  2DJG C;  5DNF A;  2KA7 A;  1DJR D;  2A6H D;  1SDF A;  4FXG C;  2JE6 I;  5LMU L;  1KAB A;  3M3Y B;  5HGT A;  1I6H H;  2YV5 A;  1QOH A;  5HUR A;  1G51 A;  1Y1V G;  3E0J A;  2ZM6 Q;  2EIF A;  4CJ2 C;  1FD7 D;  1Y8O B;  3I4O A;  4DV5 Q;  2IHE A;  5CMD A;  1QCB D;  2F03 A;  2R92 H;  2Q2U A;  2F0F A;  2AQ2 B;  1WVL A;  4NXN L;  4OWX B;  2M00 A;  2YTV A;  4N8X 1;  2QEX A;  3MEF A;  4HJA A;  1VDZ A;  4DR3 L;  2BCO A;  1PYB A;  2JA6 B;  4UPA A;  1WJJ A;  1WI5 A;  3NUC A;  1JWS D;  3EJI A;  2UU9 Q;  4ULL A;  3PO3 H;  2PMZ B;  4XDX A;  1H9R A;  4IZ8 A;  4AIM A;  1C48 A;  1TS3 A;  4DV4 Q;  4UDU C;  3QG1 A;  2KHI A;  2IJ0 A;  2JA5 B;  1C9O A;  1O80 A;  1VQ7 A;  1PH1 A;  5IP7 H;  3VYU A;  2F4V L;  4AQY L;  5K5P A;  1T5X D;  5LMN L;  3K5L A;  4A3F G;  4P75 A;  4ALP A;  2QEJ C;  1L0W A;  4C1N K;  3T56 B;  5GAG C;  3L9A X;  5C44 H;  2FHT A;  4A3M B;  1YJN A;  3UE0 A;  3S17 H;  1AZQ A;  4JPB W;  5ELB A;  2JXM B;  3HKZ E;  5C0X J;  5HGQ A;  5M5X B;  2H5X A;  2Q2H A;  1HNZ Q;  1JOO A;  1A3U A;  4KI0 A;  3M7G A;  1F77 A;  4JV5 Q;  1BCP F;  5FLX E;  3J81 E;  2EE1 A;  1FYC A;  4DR6 L;  2B2U A;  1IYJ B;  1R4Q B;  1LTB D;  3S15 H;  1PA6 A;  5IOC A;  3ZYY X;  1XPU A;  1KL9 A;  4HMJ A;  3GTK B;  3EIV A;  2VB2 X;  2B29 A;  1CTM A;  3AEV A;  4BA2 I;  4JI0 L;  2LXK A;  1RF2 D;  1JJG A;  1CM9 A;  4HN7 A;  1YI2 A;  1VQ5 A;  1PZI D;  3GTM H;  1HNW L;  4ZQ3 A;  4DR1 L;  5GRO A;  4A3E H;  4LNQ A;  2KCC A;  2FFK B;  5L37 A;  1L2F A;  5JEA H;  5D65 A;  1XPR A;  4PG3 A;  4DK1 A;  2JA9 A;  3MC0 B;  3PGZ A;  1N8R C;  4L5S A;  3DXJ C;  4R4T A;  1HZA A;  4JI2 L;  1ILQ A;  4A4I A;  1KNE A;  2KCM A;  2E2H H;  4DPG A;  3H3V C;  1I50 B;  4QQB X;  2A73 B;  2V4D A;  1N33 Q;  4CDE C;  3A5U A;  4BXX G;  4FXK C;  4TRD A;  5TSS A;  1EYA A;  2XRQ D;  3KLS A;  3A74 A;  4R4O A;  1BDO A;  2RKS A;  4YHH L;  2H1E A;  3K0Y A;  4PMW A;  1Y1V H;  3S2H H;  2RBM A; 
#chains in the Genus database with same CATH homology
 4A3K G;  2UUC L;  4A3C G;  3L2P A;  5AJ3 L;  3U50 C;  4BBR H;  4OXP A;  4AH6 A;  5C4X G;  3PUW A;  4R4C A;  3GDE A;  2NN6 G;  2JQO A;  3HKS A;  1AE2 A;  5C3E G;  5JJI A;  1TWA H;  2VUM G;  4RMF A;  1OXU A;  2AMC B;  2WB1 E;  3TEH B;  1HZC A;  3UE1 A;  2CKZ B;  2I5L X;  4POG A;  2AHO B;  3J80 i;  1QZG A;  1WYD A;  1XMQ L;  1K73 C;  3GTG H;  3S1Q H;  4LF4 Q;  4JCV E;  3G6E A;  2ZJR A;  1IXR A;  2IY5 B;  3S16 H;  1J5E Q;  2K75 A;  5M3F H;  1VCI A;  1Q8K A;  3I4N G;  1GD7 A;  5GQO A;  4A3G G;  3FKI G;  3ER0 A;  3PUV A;  3F2B A;  2DGY A;  2CWP A;  4C3I H;  2JA5 H;  4X65 L;  1W3S A;  1JJC B;  3MXN B;  1Q81 C;  1HNW L;  1IL2 A;  4JI8 L;  4HJ8 A;  4JYA L;  1VQH A;  1YIJ A;  2VL6 A;  5GAH C;  4A3L H;  2KHJ A;  1M1K C;  1OXS C;  1CSQ A;  4C2M H;  4NXN Q;  4A3F H;  1XNQ L;  3CQZ H;  3UDX A;  4Y52 H;  2MO1 A;  5DLQ E;  2UUA L;  3ULJ A;  4X65 Q;  3CMA A;  4GS3 A;  4DR3 Q;  5JJK A;  1X3G A;  2IHF A;  4GKJ L;  1CKN B;  4LWC A;  2OQ0 A;  3PUY A;  1YJ9 A;  1D8L A;  4DR6 Q;  3S1R H;  1I3Q H;  4NPS A;  4JBM A;  2R92 G;  5BR8 L;  4IFD G;  1MJC A;  1O7I A;  3OYY A;  4NXM Q;  3CCJ A;  4UY8 C;  4JI5 Q;  5IYD H;  4JI3 L;  4BY1 H;  3H0G H;  4QJF A;  3DLL A;  1S72 A;  1KAW A;  2VQF Q;  1X9N A;  4LF5 L;  1UWV A;  2UUA Q;  1L1O A;  2K50 A;  1UE5 A;  3UDI A;  2N3S A;  5FJ8 G;  1EOV A;  2GVA A;  4LF8 Q;  4LFA L;  4DV6 L;  1XMO L;  4LFC Q;  4A3B G;  1TWH H;  5GAE C;  2F4V Q;  4AQY Q;  3OTO Q;  5IYC H;  3PO2 H;  3CPF A;  5LMN Q;  2IX1 A;  4A3D H;  4QGU A;  3HOU G;  4LF9 L;  2UXD L;  1G29 1;  1Q7Y C;  3K81 C;  2GN5 A;  3H15 A;  1XPO A;  4XTC S;  3HOX G;  1XJV A;  2ES2 A;  3I2Z A;  4IPC A;  1PHJ A;  1QVC A;  3HOY H;  1TWG H;  3CC2 A;  2RCN A;  1NMG A;  4LF5 Q;  3GTQ H;  1X3E A;  5IP7 G;  2F3I A;  5C0X I;  2VQE L;  4A93 H;  4YWM A;  1XMO Q;  1IBL Q;  4HJ9 A;  1QUQ B;  3HOZ H;  5M3M H;  4OWW B;  3PF5 A;  1V9P A;  2JJQ A;  1CKN A;  5J3B A;  4DUZ L;  3HOV H;  1V43 A;  4LF9 Q;  4X64 L;  2AWN A;  4LF7 L;  1LYL A;  3G71 A;  3RLF A;  3I4M H;  4B3R L;  2WFW A;  2KEN A;  2ZTE A;  2PNH A;  2A8V A;  5C44 G;  4JI6 L;  2JA7 H;  3M4P A;  1I5F A;  3CF5 A;  2E5L L;  1I50 H;  1Q1B A;  1PV4 A;  5IYB G;  2CQO A;  4LW1 A;  2MNA A;  1HR0 W;  2FXQ A;  5FLM G;  2VW9 A;  5M5Y H;  1KD1 C;  1PH8 A;  3UDF A;  1Y14 B;  4YCU A;  2E2J H;  1Q12 A;  4X62 L;  4GKK Q;  1UE7 A;  2R6G A;  3HFZ B;  3AFQ A;  5C4J H;  4MTN A;  1SFO H;  3JC6 6;  2E8G A;  3CXC A;  3VDY A;  3OW2 A;  4PZ7 A;  2HT1 A;  2I5M X;  4LFB L;  1GO3 E;  4HID A;  2WP8 J;  3JAM i;  4A3J G;  4BXX H;  1KHI A;  2K5V A;  2NZO A;  1KRT A;  4HJ5 A;  1FVI A;  4JI6 Q;  2PI2 E;  2ZTD A;  3NEM A;  4JI0 Q;  1VQG A;  1SRU A;  1X3F A;  2VZA A;  1HNW Q;  3KOJ A;  1HH2 P;  4GOP C;  2K52 A;  4K0K Q;  4B3S Q;  2OQK A;  4DUY L;  1Y1W H;  3M3Y H;  1SLJ A;  2EXD A;  4DV1 L;  4A3I G;  1EFW A;  2MQH A;  1VQ8 A;  1UE6 A;  2PQA B;  2V1C C;  4A3K H;  3KF6 B;  4Y7N H;  4A3C H;  4X62 Q;  4DAY B;  4YWK A;  1K8A C;  1FJG L;  3S1N H;  1X6O A;  1QUQ A;  4UP8 A;  2C35 B;  4GLA C;  3KJP A;  3U4V A;  4GN4 B;  2PI2 A;  1KQS A;  1PFS A;  2VS1 A;  2HHH L;  4JI2 Q;  1N36 Q;  4MZ9 A;  1SRO A;  4JBW A;  4JI1 Q;  5IWA L;  1N9W A;  2UXC L;  3Q8D A;  1E1T A;  4A3E G;  1VQD A;  4DNI A;  1EQQ A;  1HNX Q;  2MO0 A;  1EWI A;  3RR5 A;  4OX9 Q;  4JOI C;  4TVA B;  5JEA G;  2NZH A;  3I55 A;  3PUZ A;  1MKH A;  4A75 A;  4GOP B;  1M90 C;  2Z0S A;  1JE5 A;  1YNX A;  4DV7 Q;  1N32 L;  2ALY B;  2LSS A;  2JA6 H;  3CCS A;  3GTJ H;  4DR2 Q;  3EBE A;  4IPG A;  3I4N H;  2B63 H;  4P72 A;  1H95 A;  2D0P A;  4BA1 I;  3ERS X;  4OO1 I;  1VQA A;  1IBM Q;  3RNU A;  4YHH Q;  2D62 A;  2LXJ A;  5IP9 G;  4IPD A;  1VQF A;  3K80 C;  2WAQ G;  3RN5 A;  5IWA Q;  5IY0 A;  1N34 L;  1K8G A;  3FHW A;  3T1Y Q;  2UUC Q;  2D0O A;  1K0R A;  3M85 A;  4KLK A;  2K14 A;  4IOA A;  5AJ3 Q;  1YBY A;  2R7D A;  5FLX c;  2CCZ A;  3DM3 A;  3J81 c;  2N78 A;  2R7F A;  2Q2T A;  3KLW A;  3KF6 A;  4XIG S;  1K9M C;  1IBK L;  4BBS G;  3W1B A;  1UEB A;  1X65 A;  1VQJ A;  1A63 A;  1GKH A;  1XMQ Q;  4EQ5 A;  3F2D A;  1HR0 L;  3K7A H;  1OXX K;  1JB7 A;  3CP0 A;  1Z47 A;  2AWO A;  1X55 A;  4QL5 A;  4IO9 A;  1PH7 A;  2UU9 L;  1VQN A;  1LM0 A;  1XTD A;  4BBR G;  4JI4 L;  1PH9 A;  1YHB A;  2BA0 A;  1ASZ A;  1VQ4 A;  4A3M H;  1NTG A;  4YWL A;  4DV4 L;  3U58 A;  2JA8 H;  5GAD C;  1EQR A;  5M5W H;  3RZO H;  1SE8 A;  2Z6K C;  4JI7 L;  1EIF A;  2JEB I;  4HJ7 A;  2AKW B;  1PH6 A;  4JI8 Q;  1IBK Q;  4FDB A;  4TQU S;  2RF4 A;  4GLX A;  4X66 L;  1AE3 A;  5M5X H;  3KDF B;  1EIY B;  4JYA Q;  1YHA A;  1Q46 A;  4B3M L;  2R7Z H;  5M3F G;  4A3B H;  2UXB L;  1Z9F A;  1VQM A;  4APV A;  4OO1 G;  3CD6 A;  1EUJ A;  2ID0 A;  1YIT A;  4GNX C;  1E24 A;  1TWF H;  3HKZ G;  3T1H L;  1WCM G;  1XNQ Q;  2K5N A;  4DR5 L;  4KHP L;  4EX5 A;  4IPH A;  3PIP A;  3HOX H;  1P16 A;  4HIO A;  4GKJ Q;  4WJ4 A;  4JI7 Q;  1VQ6 A;  1VQL A;  2CFM A;  3F2C A;  3PO3 G;  3AQQ A;  3STB C;  3GTK H;  2JK8 A;  4POF A;  3ICE A;  3E9I A;  3M7N A;  5BR8 Q;  2RHQ B;  1HNZ L;  1FL0 A;  1KC8 C;  4JI3 Q;  3T1H Q;  1K3R A;  3AYH B;  4DK3 C;  4JV5 L;  4DV3 L;  4X6A H;  3KJO A;  4YCW A;  2NVY H;  4R4I A;  2K5H A;  4LUO A;  4HIM A;  3PF4 A;  3HOW G;  1A8V A;  1HJP A;  1BBU A;  4LFA Q;  1RIP A;  4MNO A;  4DV6 Q;  3TRZ A;  1VQO A;  4DR7 L;  3J7Z C;  1S40 A;  1CUK A;  5ELN A;  2IX0 A;  3BZC A;  4GLV B;  1U0L A;  3K8A A;  4DKA C;  3CPW A;  3CCM A;  2UXD Q;  3KDF A;  2ATW A;  4QY7 A;  3M9B A;  3SGI A;  2UUB L;  3CCE A;  1GM5 A;  1WFQ A;  3H0G G;  3CCQ A;  4BY7 H;  2EQS A;  1OTC A;  3BJU A;  1YHQ A;  3L7Z C;  5IT9 c;  2BH2 A;  2MFI A;  1TWC H;  2BA1 A;  2VQE Q;  3U4Z A;  5IYC G;  3PO2 G;  1JJG A;  4A3D G;  1KIX A;  1E22 A;  2Z6K A;  4GN5 A;  3S24 A;  4DUZ Q;  1YVC A;  3B6Y A;  4L5Q A;  3ULL A;  5H1S E;  1VQ9 A;  4X64 Q;  4L5R C;  4LF7 Q;  4C3H H;  4B3R Q;  4RG1 A;  1BVS A;  1E3P A;  1D7Q A;  1OXT A;  4LF6 L;  3GTP H;  4JC0 A;  2E5L Q;  2QA4 A;  3H3V H;  2NN6 I;  3PCO B;  1DGS A;  1B8A A;  4R4Q A;  1JMC A;  1CKM A;  3G48 A;  4JBJ A;  3HOZ G;  1SMX A;  1MJE A;  1X54 A;  4YCV A;  3HOV G;  1AH9 A;  1C0A A;  2NVX H;  3TRE A;  1XNR L;  5EAY A;  5C4X H;  3F1Z A;  1RL2 A;  1KRS A;  2K4K A;  5C0X G;  4LFB Q;  5C3E H;  4NB3 A;  2JA7 G;  1MIU A;  4OON A;  2VUM H;  3RLN A;  4YY3 L;  4O2D A;  2NVT H;  1PYS B;  1VQE A;  4DV2 L;  1YEZ A;  3J80 c;  4DUY Q;  1VQI A;  1TXY A;  4UP7 A;  4DV1 Q;  1B70 B;  1P8L A;  5LMN W;  3TS0 A;  2Y0S G;  1NJI C;  2ZJQ A;  1PH5 A;  1FJG Q;  4A3G H;  1YJW A;  4LUV A;  3FKI H;  1XNR Q;  4UP9 A;  3D0F A;  1C7Y A;  3I7F A;  2JEA I;  1Q82 C;  2KBN A;  1NE3 A;  2DUD A;  2HHH Q;  3S1M H;  4IJL A;  2ZM6 L;  2OTJ A;  3CCR A;  3J7A 5;  4DV5 L;  2UXC Q;  4BBS H;  3GO5 A;  4IFD J;  4LF4 L;  4QIW E;  4GN3 B;  4DV2 Q;  1NMF A;  1Q1E A;  3AFP A;  4JG2 A;  1J5E L;  4JBK A;  2N8N A;  5E7N A;  1L1O C;  1R9T H;  4PZ8 A;  2R93 H;  1X56 A;  3GTL H;  2JE6 I;  3ZJY C;  5LMU L;  2PQA A;  1I6H H;  1BBW A;  2YV5 A;  1E7Z A;  4IOC A;  4IFD I;  1G51 A;  1Y1V G;  2RHS B;  2OWO A;  2ZM6 Q;  2EIF A;  1N34 Q;  3I4O A;  1VQC A;  4DV5 Q;  2I5H A;  1BKB A;  1U5K A;  2ASB A;  3GTO H;  2IT1 A;  4HIK A;  2IHE A;  3CC4 A;  3CC7 A;  2Q2U A;  2HIX A;  2Y0S E;  2R92 H;  2JA6 G;  1G6P A;  4NXN L;  4OWX B;  4GOP A;  2YTV A;  2QEX A;  3CCU A;  1L1O B;  2B63 G;  1SN8 A;  1NBW A;  3J81 j;  3MEF A;  3CCV A;  3RN2 A;  5LMU Q;  1A62 A;  1WCM H;  4HJA A;  3S14 H;  3CME A;  4DR3 L;  1PYB A;  3PSI A;  2WAQ E;  1WJJ A;  4UPA A;  1HR0 Q;  1HZB A;  1WI5 A;  5FJ8 H;  1UE1 A;  3UDG A;  3TQY A;  2VNU D;  1VQB A;  2UU9 Q;  3PUX A;  1B7Y B;  3ULP A;  2YU9 H;  3PO3 H;  2Q2I A;  3J81 i;  3L0O A;  4JI4 Q;  2JA5 G;  3HOU H;  4B3T L;  4NXM L;  1FGU A;  4KHZ A;  4JI5 L;  1QVG A;  5JJL A;  3TS2 A;  4AIM A;  4JOI A;  4DV4 Q;  3I56 A;  2YTX A;  4DAM A;  2KHI A;  2VQF L;  2OTL A;  1C9O A;  2VY3 A;  3KF8 B;  4X66 Q;  1VQ7 A;  4LF8 L;  1I94 L;  3HOW H;  4A3L G;  1PH1 A;  4LFC L;  5IP7 H;  2F4V L;  2GVB A;  4B3M Q;  4AQY L;  1LTL A;  3OTO L;  4AYB G;  5LMN L;  2UXB Q;  4A3F G;  4P75 A;  3RLO A;  3KYH C;  4ALP A;  3CW2 C;  1K83 H;  4A3M G;  4GNX B;  3BZK A;  1L0W A;  4B3T Q;  2HQL A;  4DR5 Q;  4KHP Q;  2I0Q A;  2JA8 G;  5GAG C;  1PVO A;  1T9H A;  3E0E A;  3CCL A;  5C44 H;  3G4S A;  2PMZ E;  3IRB A;  4J15 A;  5IYB H;  1YJN A;  4DV0 L;  1QVF A;  3UE0 A;  2R7Z G;  1I94 Q;  1IBL L;  5FLM H;  3KFU A;  3S17 H;  2R93 G;  3M4Q A;  3WWV A;  5IYD G;  3HKZ E;  5C0X J;  5HGQ A;  1S3O A;  2H5X A;  2Q2H A;  1HNZ Q;  4BY1 G;  4KI0 A;  1A0I A;  3A0J A;  3GD7 A;  4JV5 Q;  2ZTC A;  4DV3 Q;  1PH2 A;  4A3J H;  2CWA A;  3E9H A;  4LUZ A;  3NEN A;  5JEA J;  3JAM c;  4OWT B;  4DR6 L;  1Q86 C;  4L5T A;  1JJ2 A;  1IYJ B;  2L15 A;  4DK6 C;  4DR7 Q;  4DV0 Q;  3M4O H;  3H3V I;  3PIO A;  1KXL A;  4AYB E;  3S15 H;  1NY4 A;  3W5O A;  4A3I H;  1PA6 A;  4GKK L;  1XPU A;  1KL9 A;  3A5Z B;  2UUB Q;  5K36 G;  4C3J H;  3W1G A;  1IZ6 A;  3HOY G;  1VS0 A;  2NVQ H;  3STB D;  1J6Q A;  3LGJ A;  3EIV A;  2B29 A;  5IE8 A;  4ME3 A;  3AEV A;  4BA2 I;  2A1A A;  4DR4 L;  4WJ3 M;  4JI0 L;  4IJH A;  4GNX A;  1WOC A;  4A93 G;  1SR3 A;  2LXK A;  3RZD H;  1CKO A;  2A19 A;  2YYZ A;  5M3M G;  1YI2 A;  1PH4 A;  1VQ5 A;  3GTM H;  3FP9 A;  4H02 A;  2B3G A;  3BU2 A;  4DR1 L;  4A3E H;  5GRO A;  4R1J A;  4B3S L;  1QZH A;  4LNQ A;  1N33 L;  4K0K L;  1JT8 A;  2XGT A;  2ZJP A;  1L2F A;  2HIV A;  1N32 Q;  5HY6 A;  3NBH B;  2N49 A;  1XPR A;  1VQK A;  3I4M G;  1VQP A;  2BH8 A;  1YZ6 A;  4P73 A;  1ASY A;  4BY7 G;  4P71 A;  4PG3 A;  2JA9 A;  3PGZ A;  2WB1 G;  4O0A A;  1N8R C;  2XTI A;  1PH3 A;  4L5S A;  4LF6 Q;  3D31 A;  3CAM A;  4R4T A;  1HZA A;  1LUZ A;  1N36 L;  4JI2 L;  4JI1 L;  4A4I A;  4DR4 Q;  2KCM A;  2E2H H;  3K7U C;  2YTY A;  5IP9 H;  1CSP A;  3PV0 A;  3F8T A;  4DPG A;  1HNX L;  1E1O A;  2E2I H;  4OX9 L;  4DR1 Q;  4QQB X;  1W2B A;  2QGQ A;  1V1Q A;  1N33 Q;  3K0X A;  3NEL A;  4DV7 L;  3A5U A;  4A76 A;  4BXX G;  1HZ9 A;  4DR2 L;  4P74 A;  1OXV A;  3S2D H;  2OCE A;  1GVP A;  3A74 A;  4R4O A;  4PZ6 A;  1EYG A;  1IBM L;  2KCT A;  4YY3 Q;  4YHH L;  3EN2 A;  1Y1W G;  5ELO A;  4PMW A;  1Y1V H;  3T1Y L;  3S2H H;  2F52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...