3HOUH

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
134
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transcription,transferase/dna/rna hybrid
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 16
structure length 134
sequence length 145
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3houH00
4DKAC 1YJ9A 3PUZA 4IJLA 5JJLA 1XNRL 1W3SA 3I4NH 1HNWL 3J7A5 4LF8Q 1KXLA 1WOCA 4R4TA 4YHHQ 5E7NA 1K8GA 1UEBA 3PO2G 3L0OA 1PFSA 4JI0Q 2RF4A 2KCTA 1FGUA 2UXDQ 4B3TL 4KHZA 3A5UA 4B3SQ 4HIOA 1KC8C 1VQ8A 1PHJA 1C9OA 2MQHA 2A19A 3NBHB 4LFCQ 1SR3A 4GLAC 4DUZQ 1K8AC 3GTGH 3FKIH 4A3DG 2KHJA 2UUCQ 2QGQA 4OWWB 2D0PA 5H1SE 3AFQA 4K0KQ 2GVBA 2K4KA 2ZTEA 4A3MG 4X64L 1JJGA 3FKIG 4A3DH 5IYCG 5AJ3Q 3M4PA 2R92G 5M3FG 2V1CC 1E1TA 4MZ9A 5K36G 1N8RC 3E9IA 1NBWA 3G71A 4IPHA 3DLLA 4IOCA 4L5RC 1DGSA 4DUYQ 3BJUA 1QZGA 2IX1A 1K83H 1VQBA 4J15A 3EBEA 1TXYA 3M4OH 2JA7G 1Y1WG 3MEFA 3M85A 1QUQB 4DV5Q 1B70B 4JOIC 4A3IH 4LFAL 1PVOA 3KDFA 2VQEQ 4JI2Q 3G4SA 2UUAL 1XPUA 5FLMG 2PQAB 1PH8A 2VNUD 4A3IG 4GKKQ 1IBKQ 1Z47A 3RLNA 2I5HA 1V1QA 3RNUA 4BY1H 2IHEA 3CCJA 3PGZA 4XTCS 1PH6A 4BY7H 2DUDA 3S2DH 3CW2C 4HJ8A 3CMAA 4WJ3M 4P75A 4BY1G 2LSSA 4DR1Q 1E7ZA 1NTGA 3T1YQ 4JI7L 4IPGA 5M3MH 4P72A 1IZ6A 2PI2E 2A8VA 4IJHA 1VCIA 2JA8G 3GTMH 2DGYA 4JI6L 1GD7A 4UY8C 4DR6Q 2CKZB 2KCMA 3PF4A 1HJPA 3KF6A 3KOJA 4DV3Q 4HJAA 4YCWA 3TEHB 4FDBA 4LF7Q 4X66Q 3J81j 1EYGA 1N33Q 1VS0A 1N34Q 3U50C 4LUZA 2OWOA 4DV2L 4HIKA 2UU9L 2OTLA 3J80i 4JBMA 3UDXA 3TS2A 3OYYA 4DV4L 1QUQA 4P71A 4A3LG 3GTLH 3J7ZC 3I2ZA 4YCVA 2Z6KA 2AHOB 1YNXA 1NMFA 4P73A 3GDEA 3AQQA 3M9BA 4B3RQ 4JBWA 4KI0A 4RG1A 3S1QH 1PH9A 4LWCA 4YY3L 4LF6L 4A3GH 3UDIA 5JJIA 3I4OA 1EIYB 2I0QA 1P16A 1SE8A 1VQNA 3CXCA 3K7AH 1YITA 2E5LL 2F4VL 1H95A 5HGQA 2JA7H 2K5VA 4JOIA 3J81c 1VQ4A 1Y14B 3G6EA 2UXCL 4DV7L 1HZBA 1L0WA 1X3EA 4AQYL 4IFDJ 1C0AA 1SRUA 2ZM6L 1BKBA 1W2BA 3HOVG 1J5EQ 1IBMQ 4PZ7A 2VW9A 1CKNA 1TWHH 1JMCA 3S1MH 1TWFH 2BA0A 4R4CA 5IP7H 2HT1A 2WFWA 4DR3Q 3J80c 2JA5G 3U4ZA 5M5WH 4BBRH 3OTOL 2NVTH 1I94L 4ME3A 4DV1L 4IOAA 3RZDH 1IYJB 4MNOA 2R93G 1HZAA 2ES2A 1I5FA 2MO0A 4DNIA 1VQEA 2R7FA 2JA9A 2Q2IA 4LF5L 3OW2A 3ULLA 4POFA 4JI4L 3T1HL 3IRBA 2E2JH 4B3TQ 1B7YB 4A3CG 4YWMA 3HOXH 4DR5Q 2VQFL 3TS0A 1UWVA 2IY5B 2AWNA 5IP9G 1M1KC 2KHIA 1CSPA 2WAQE 4TQUS 3A0JA 3F1ZA 3HOXG 2YU9H 1CSQA 3S2HH 1VQ9A 1K0RA 1CKNB 2NVQH 2LXKA 1JJCB 5AJ3L 3PIPA 4BXXH 1FJGQ 2FXQA 1A0IA 1NE3A 2GVAA 2IX0A 2HHHL 2H5XA 3H3VI 3HKSA 3AYHB 3ER0A 2MNAA 3S16H 4KHPL 4OWXB 3CAMA 3B6YA 4EX5A 4HJ7A 3CCQA 4JI5Q 3HKZG 3M3YH 4HIMA 5FJ8H 4A93G 1A8VA 2B63G 4JI3Q 3HOUG 1KL9A 5LMNQ 4A3GG 2AMCB 3CPWA 2PMZE 1X9NA 4A3FH 4LFAQ 3TREA 1HR0Q 4LUOA 3ULJA 4AIMA 1EFWA 4LF9L 3SGIA 2NVXH 2JEAI 3HOUH 2Y0SG 3STBD 1EQQA 2K14A 1HNWQ 1KQSA 3ZJYC 1NY4A 2WP8J 3AFPA 4YWKA 3MXNB 5C4XH 1SLJA 2PQAA 3CCRA 1KRSA 1YHAA 4JI0L 4OO1G 4P74A 1JB7A 1OXTA 1CKOA 2CWAA 5LMUL 2NN6I 2F52A 4X65Q 1XMQL 1LTLA 4OONA 3U58A 2E2HH 1GKHA 1T9HA 3PUXA 2I5LX 3GTQH 4B3SL 1VQGA 4OXPA 1PYBA 3T1YL 1SN8A 4LFCL 4DAYB 1O7IA 4DPGA 2N78A 4DUZL 3RLOA 1OTCA 2JA5H 1S40A 1HNZL 3CC2A 1KAWA 1X65A 3A5ZB 4DR6L 1Q46A 3KJOA 4QJFA 5C4JH 4LF7L 1PYSB 1YVCA 3GD7A 1N33L 2XGTA 1MKHA 2YTVA 2JJQA 4KHPQ 2YTYA 1S3OA 2HIXA 3K80C 4C3IH 4DV0Q 2JA6G 1LYLA 3K81C 4A3EG 4PZ8A 2VZAA 1QVGA 3I4MH 2N8NA 3PCOB 1VQMA 3PUYA 3RZOH 5IT9c 4JV5L 1FL0A 3I55A 2R6GA 4A3KH 3ICEA 4LF4L 1YHQA 2N3SA 3RLFA 3CCEA 1ASZA 4YWLA 3CCUA 5JJKA 1PH1A 1VQ6A 2K75A 4QY7A 1PH4A 4BXXG 3S15H 4OO1I 4GS3A 3K0XA 1VQCA 3K8AA 3CQZH 3EIVA 1J6QA 1NJIC 2CCZA 2GN5A 4PZ6A 4GKJQ 1WI5A 1XMOL 2F4VQ 1OXSC 1XNQL 4BY7G 3GTPH 3H0GH 4IFDG 3KDFB 5FJ8G 4DR1L 4NXMQ 4L5QA 3RN2A 4JI1Q 3NELA 5GADC 3CCVA 3H0GG 1X6OA 1VQ7A 3L7ZC 4JI6Q 2JA8H 1L2FA 1XPRA 1IBML 4PMWA 3S17H 4DV3L 3G48A 1PH5A 2Z6KC 4OX9L 3NENA 3FHWA 3UE1A 4C3JH 4NXNQ 4GN5A 4GN3B 1N34L 4DR7L 4R4IA 4LFBQ 2ZTDA 4QQBX 1V9PA 2OTJA 1UE1A 1G6PA 1LM0A 1L1OB 1Q8KA 2F3IA 4KLKA 1AE2A 1CUKA 1HZCA 4DV4Q 4GNXB 4HJ9A 1YJWA 1EQRA 1KHIA 1UE6A 2IT1A 3UDFA 4IFDI 1N32L 4BA2I 4JBJA 4R4OA 3TQYA 5IY0A 4B3MQ 4C2MH 5GAGC 5BR8L 1HZ9A 1E3PA 1MJCA 3PF5A 1ASYA 3CC7A 3JAMc 3D0FA 4BBSH 3F2BA 1RIPA 1CKMA 1TWAH 1U0LA 1YHBA 2EXDA 1YIJA 3T1HQ 4L5SA 4AYBE 1XJVA 1BBUA 1X54A 4JC0A 5EAYA 2VQFQ 5M5XH 1EUJA 4LF6Q 1E22A 1VQPA 4IPDA 5JEAG 4ALPA 2YYZA 3H3VH 2OQ0A 2JA6H 3CCMA 4A75A 4IPCA 1V43A 3PIOA 5GROA 4R1JA 3VDYA 2KBNA 3PSIA 2R92H 2JQOA 4A3BG 3J81i 3H15A 2UXCQ 1KD1C 1QVCA 2LXJA 4AQYQ 2RCNA 2E8GA 3W1GA 4A3KG 4GOPA 1S72A 1LUZA 1UE7A 1VQKA 3Q8DA 1E1OA 1HNXQ 5C44G 4JI5L 1D8LA 3HOZH 3HOVH 4GNXA 3TRZA 2WAQG 3HFZB 1I3QH 1IBLL 1RL2A 4XIGS 3PUVA 1U5KA 3ULPA 2EQSA 5C44H 2N49A 3D31A 1K73C 4DR3L 3W5OA 4O0AA 2WB1E 4DK3C 1N36Q 2UUBQ 3HOZG 3OTOQ 1L1OC 2ATWA 1I94Q 3K7UC 1PH3A 2K52A 4DAMA 4UP7A 1SFOH 1Q81C 3CPFA 2R93H 2ZJPA 4DR2L 1GM5A 2Q2TA 4LF5Q 2AKWB 1YEZA 4JI4Q 4DK6C 3KF8B 2Q2HA 2VY3A 3RR5A 1VQLA 2E5LQ 3I4NG 3S24A 4DV6Q 3JAMi 2R7DA 1X3FA 1FVIA 4A3CH 4GN4B 3U4VA 4JYAQ 1HNZQ 4DR4L 1NMGA 5IP9H 5IWAQ 4GOPB 2UXDL 2EIFA 3GTKH 4NPSA 3FP9A 1FJGL 5GQOA 1YZ6A 4PG3A 2HHHQ 2WB1G 5FLXc 3PV0A 1IL2A 3PO3G 2NVYH 2CQOA 1SROA 3GO5A 1WJJA 1VQHA 4A3LH 1X56A 3UE0A 3STBC 1SMXA 1I6HH 1XPOA 4A3MH 3L2PA 4JV5Q 1HR0L 4EQ5A 2OCEA 1BVSA 4LF9Q 4JCVE 1Y1VH 1BBWA 2QA4A 1JJ2A 4WJ4A 4LF4Q 3RN5A 1C7YA 3KLWA 1JE5A 2K50A 4JI8Q 3KF6B 2ZTCA 4GOPC 1Y1WH 1XTDA 1A62A 3BU2A 3CMEA 2UXBL 2E2IH 5LMUQ 4AH6A 3PUWA 2VUMG 4X65L 5GAHC 1XMQQ 4POGA 4GKJL 4X62L 1XNQQ 2MO1A 4LUVA 3S14H 1G51A 5ELOA 5IP7G 4A76A 5M5YH 2VQEL 4NB3A 4JI2L 1HH2P 1XNRQ 2VUMH 1I50H 1VQJA 4LF8L 4JBKA 4A3JH 5C0XG 4YHHL 1IBKL 3CC4A 1WYDA 3I56A 3KYHC 1Q12A 1P8LA 3NEMA 3HOWG 1A63A 2RHSB 3E0EA 4OX9Q 4NXNL 5IYBG 3CP0A 2ZJRA 4O2DA 3LGJA 4DV0L 1VQ5A 1N9WA 2VS1A 4JI7Q 5C3EG 2A1AA 1KRTA 5IYDH 5IYBH 2BH8A 5IE8A 2UUCL 4B3ML 1Q86C 1TWGH 1VQAA 3EN2A 4L5TA 4LW1A 1K9MC 4A3EH 4K0KL 2HQLA 2Q2UA 4QGUA 1WCMG 3HOYH 2B29A 5IYDG 4X64Q 1PV4A 3I4MG 1MJEA 4APVA 1E24A 1VQIA 4X66L 1YJNA 1Q1BA 1MIUA 1PA6A 4BA1I 4Y52H 3HOYG 3F8TA 5J3BA 2XTIA 5JEAJ 4DUYL 1VQFA 1KIXA 4YCUA 1OXVA 3W1BA 4DR7Q 2PNHA 4IO9A 3UDGA 3PO3H 1YI2A 2D0OA 2B63H 2VL6A 1XMOQ 4DV5L 4A93H 2YV5A 4NXML 4HIDA 2UUAQ 4GLXA 2ZJQA 2K5HA 2JE6I 4JI1L 1QVFA 1AE3A 3BZKA 4GKKL 3S1NH 1Y1VG 3GTJH 2CWPA 1HNXL 4YY3Q 4QL5A 4C3HH 3AEVA 1B8AA 3HKZE 1QZHA 2ASBA 2JK8A 4QIWE 2K5NA 4JG2A 1EWIA 3S1RH 4LFBL 4UPAA 1N36L 4OWTB 3WWVA 1D7QA 3PO2H 2IHFA 5C0XJ 1Z9FA 2NN6G 2Y0SE 3CD6A 1N32Q 4AYBG 5C4XG 2JEBI 3DM3A 2B3GA 5BR8Q 4A3JG 1JT8A 1OXXK 1M90C 4LNQA 2NZHA 2BA1A 3E9HA 4H02A 5GAEC 2HIVA 4BBSG 2ALYB 4DV2Q 2UU9Q 3HOWH 2KENA 2MFIA 4X6AH 4BBRG 3CCSA 1X55A 1PH7A 1PH2A 2BH2A 2CFMA 4GLVB 4TVAB 4DV6L 4RMFA 2R7ZG 4DV1Q 4A4IA 4JYAL 1HR0W 2D62A 2I5MX 5HY6A 5IYCH 5C3EH 5M3FH 4GNXC 4DR4Q 4UP9A 2R7ZH 3JC66 5ELNA 2QEXA 2L15A 2OQKA 2NZOA 5IWAL 4HJ5A 2RHQB 3I7FA 5C0XI 1Q7YC 1WCMH 2Z0SA 1R9TH 4A3BH 2PI2A 1GO3E 1L1OA 2AWOA 1TWCH 1K3RA 4B3RL 5DLQE 4DR5L 3GTOH 3F2DA 4R4QA 4MTNA 3CF5A 3CCLA 1IBLQ 1EIFA 5FLMH 1G291 1OXUA 1VQDA 1AH9A 3A74A 2UUBL 3ERSX 1GVPA 1Q1EA 4DV7Q 1VQOA 5LMNW 1Q82C 3M7NA 2YTXA 2ZM6Q 1UE5A 4JI8L 1IXRA 1J5EL 2ID0A 3M4QA 4Y7NH 1YBYA 2UXBQ 4DR2Q 2C35B 3BZCA 4UP8A 4JI3L 1WFQA 3KJPA 4A3FG 3KFUA 5LMNL 5M3MG 1X3GA 4X62Q 1EOVA 3F2CA
chains in the Genus database with same CATH superfamily
3NHHA 2PW5A 1F2LA 3PUZA 3OOCA 1C8CA 1XNRL 3J7A5 2H1EA 4R4TA 1SBBB 1UEBA 3K7AB 4JI0Q 2VB3X 4NMZA 1DOMA 1Q3LA 1SMYC 4B3TL 1L0XB 4A3FB 2JA7B 3NBIA 1K8AC 2SNMA 2JP1A 3FKIH 4A3DG 3DWAA 3MHBA 4A3MG 4X64L 3TP8A 5AJ3Q 3M4PA 4M8AA 5M3FG 4MZ9A 5K36G 2IWHA 4L5RC 2PZUA 2IX1A 1VQBA 4DXGA 3D6WA 1STHA 1NCVA 2CW0C 4A3IH 4OIJA 4QMGA 2DN8A 2CQAA 1AP0A 2VQEQ 2WV6D 3VYRA 3G4SA 5FK9C 5FLMG 1HA6A 3S9WA 1RJTA 4A3IG 2JN4A 5ELDA 1Z47A 3RLNA 5EKLA 1IBKQ 3KLSX 4GKKQ 5EPJA 3RNUA 1G91A 4X3TA 3TDQA 5CV9A 3CCJA 1H9SA 2DUDA 2P5ZX 3S2DH 4IFDH 4HJ8A 2EJMA 2F0KA 2LSSA 1NTGA 4ME5A 2F1MA 5CYUA 5M3MH 1EYCA 4IJHA 1VCIA 3BG3A 2DGYA 2B2TC 2KCMA 1Z6HA 4DV3Q 1SSOA 1K8MA 1ZXTA 1EYGA 2XWBB 1EYAA 4LUZA 4HIKA 4JBMA 3UDXA 3I4NB 4IQZA 1ICFB 5FO7B 3VA5A 4YCVA 3J7YW 2AHOB 1K28A 4Y7NB 4ID6A 1JWMD 4B3RQ 3TZDA 4YY3L 4A3GH 2B2WC 5M9OA 1EIYB 4BBRB 1Y14B 3KF8A 1L0WA 3L9AX 1C0AA 4K8IA 4A3BB 5KGUA 1W2BA 5KRUA 5C4ZA 3G7LA 3S15B 1TS2A 1IBMQ 1JMCA 4DXFA 1TWFH 2F0IA 4IUQA 1I6HB 4DR3Q 1SNPA 5JOBA 4BBRH 1A2UA 4DV1L 1I94L 4IOAA 4J1MA 5C5MA 2HQEA 4J8QA 4F8MA 2F03A 1RF2D 4DNIA 4IUVA 4L8JA 4B3TQ 3P75A 1B7YB 1LLRD 4YWMA 3HOXH 4DR5Q 2VQFL 3WDNA 1M1KC 2KHIA 3KBGA 2R7ZB 4IUTA 2X69A 2YU9H 3K6OA 3NWTA 4DK1A 1ML0D 2LXKA 2NVQH 1GXDC 1CQFA 4ZYSA 1FJGQ 2F0LA 5J22A 4X3KA 1MI2A 1NE3A 2HHHL 2H5XA 3AYHB 4UDUC 4FF4A 4C3HG 2MP1A 4JI3Q 3CPWA 1F77A 5CV5A 4LUOA 3ULJA 1EFWA 3NSWA 1DONA 3STBD 4DK0A 2BE5C 3LX0A 1LTBD 3URYA 1KQSA 2Z4IA 1F9PA 1SLJA 1YHAA 3E6ZX 3P1HA 1STEA 1OXTA 4V190 3S16B 3Q6SA 3QWNA 2JA6B 2I5LX 1KAAA 4OXPA 1HFNA 1SN8A 4DAYB 1O7IA 2N78A 4B08A 4G7HC 1RTOA 2RA4A 1X65A 4X3SA 1Q46A 1TIID 1PYSB 2XGTA 1MKHA 2JJQA 2HIXA 4C3IH 4PZ8A 5FOBB 1DXMA 1KTKA 3EROA 5DAUA 2N8NA 4KJOA 1B9MA 1WTXA 3J80L 2R93B 3P20A 3ONAB 1YHQA 2IL8A 3CCEA 5EPKA 1LO5D 1S5BD 3FVQA 4K2LA 1BCPB 2B2TA 3C1FA 1VQCA 3EIVA 4E6IA 2GN5A 4CGYB 3GTPH 1G2SA 3RN2A 2KECA 2A69C 1HHVA 1PLFA 1ZYRC 3L7ZC 4HSPA 1FGBD 3PMFA 2JA8H 1XPRA 2J4XA 4PMWA 3S17H 5EPLA 3FHWA 1N34L 4DR7L 3V96A 1V9PA 2OTJA 2NN6H 1E2WA 1LM0A 1G6PA 4G7OC 5DM73 2EY6A 5JVH3 1EQRA 1KHIA 2IT1A 1N32L 4IFDI 4BA2I 2SNSA 3TQYA 4B3MQ 5T1GA 5GAGC 5BR8L 3PF5A 1MJCA 2F0PA 3VYUA 3JAMc 3D0FA 3A7LA 4ZRZA 3ZYYX 5FKAC 1U9RA 1YIJA 4L5SA 4AYBE 5LHY1 2JSOA 4JC0A 1WTVA 3FMCA 4LF6Q 1E22A 3J80E 4C3JB 2KBNA 3J81i 1Q90A 1QVCA 1S4ZA 3DUZA 4ZQ3A 3OPOA 2RCNA 3W1GA 4A3KG 1UE7A 2LMCB 1HNXQ 1BQQT 5C44G 4Q5VA 4Q0FA 3HOVH 3AB9A 3TRZA 1QILA 4KY7A 3MAQA 3DEPA 3K5NA 1V1PB 3A55A 5JAVA 2EQSA 3D31A 4DR3L 4DA2A 3OTOQ 1L1OC 2A6HC 1I94Q 3OSOA 2K52A 4DAMA 4UP7A 1SFOH 4MIUA 2ZJPA 4DR2L 2Q2TA 2AKWB 4A3JB 2EJGC 4JI4Q 3VYTA 4NP5A 1SNOA 3RR5A 3P7JA 4ZAIA 2Z8LA 1TQOA 4DAPA 4DR4L 4C1NK 2BOSA 2EIFA 1H9MA 2LFNA 1YZ6A 2HHHQ 5KNBA 3PV0A 1FNUA 2CQOA 3UE0A 1SMXA 1NR4A 5A2QE 1XPOA 1RCVD 5NUCA 3S2HB 1O7LA 1EIGA 1LV9A 1BVSA 4JCVE 4CJ2C 1BBWA 1JE5A 3KF6B 2ZTCA 1XTDA 2E2IH 4AH6A 2PMZB 1TR5A 4UAIA 4X62L 4QUFA 3QJYA 1G51A 4A76A 5M5YH 1I50H 1VQJA 4LF8L 4A3JH 4PQXA 1GUOA 5I9PA 1P8LA 1CK1A 5C0XH 1F9RA 4O2DA 4RGOS 1CFMA 4IZ8A 1STYA 2VS1A 2EDGA 1V1OA 1O7ZA 2BH8A 3MWYW 5IYBH 3BYYB 4B3ML 1ILQA 4LW1A 1K9MC 4A3EH 4K0KL 4QGUA 2RBMA 1LT3D 2B29A 1MSHA 1VQIA 2M00A 3E5SA 1II3A 1EQVA 1MIUA 1DOKA 1UUPA 4BA1I 3HOYG 4QB4A 4Y52H 5J3BA 2XTIA 5JEAJ 4DUYL 1KNEA 3MFGA 4YCUA 5CV4A 2PNHA 1SDFA 4IO9A 3PO3H 2B63H 3A56A 4DV5L 1XMOQ 1B53A 5E3FA 3ND9A 3DWQA 5IT9E 2JE6I 3K5LA 2WB1B 3H3VC 2EYPA 1TS4A 2NWGA 1EEFD 1RD9D 1D2BA 1U4MA 2K5NA 4JG2A 3S1RH 4LFBL 1HQMC 2RSNA 1FD7D 2F0NA 4OWTB 5CV7A 2O2LD 5TSSA 3PO2H 1I6VC 1I3QB 2F0JA 4AYBG 5C4XG 1DJRD 2B3GA 4XQJA 5COYA 4KK7A 3E9HA 3DXJC 1X3QA 2HIVA 4KHVA 4ZUIA 5BN3A 3HOYB 4DV1Q 4K6DA 3RMHA 4A4IA 2D62A 2I5MX 3M4YA 5C3EH 1SE3A 3M7GA 3VR6A 1RTNA 2R7ZH 5ELNA 2QEXA 2NZOA 1I4RA 2Z0SA 2F3VA 1L1OA 5DLQE 2J7ZA 4ZKCB 2YU9B 4R4QA 1BO0A 3QG1A 5LL6X 3WOFA 2K5DA 4KD3A 1NNXA 1IBLQ 1EIFA 3A74A 1Q1EA 3DWPA 1QNUA 3M7NA 1B3AA 2YTXA 2ZM6Q 1IXRA 2KEEA 4DR2Q 5M3MG 2PYKA 1X3GA 3A8KE 3N52A 1EOVA 3F2CA 1YJ9A 4QUCA 4IJLA 3TMEA 1W3SA 4LF8Q 1KXLA 1WOCA 1K8GA 5E7NA 5IOCA 3L0OA 2RF4A 3EQLC 5C44B 3HGBA 3TBIB 3F2UA 1EFID 4KHZA 1KC8C 2BCOA 1A6XA 3NBHB 4LFCQ 1R4QB 2X6LA 2CW0D 4OWWB 5H1SE 3AFQA 1PMRA 2K4KA 1PFNA 5M5YB 1JJGA 1C4QA 2R92G 1WTQA 1GHJA 1N8RC 1WVLA 1YNJC 3DLLA 3LWEA 3BJUA 4J15A 3EBEA 1TXYA 2JA7G 1Y1WG 3MEFA 3T53B 4N8FA 4QIWB 2B2UC 3R2TA 3PIP3 4JI2Q 4RA8A 2F0FA 2EYHA 3KBXA 2I5HA 1V1QA 4P2CB 4BY1H 1DM0B 1Y8OB 3PGZA 3CW2C 2F0WA 4BY1G 2XRQD 4IPGA 4P72A 1LT6D 2PI2E 2DJGC 1Y1WB 2A8VA 1DZ1A 3GTMH 2A73B 1SNMA 4DR6Q 1HJPA 2O5IC 1STGA 4YCWA 3NQIA 4LF7Q 3J81j 1N34Q 4DR7Q 2F0MA 4KHPL 4DV2L 1AZPA 2K32A 3OYYA 1TWCB 4DV4L 1SYEA 1MSGA 4P71A 1HXYD 4A3LG 3LWUA 2A68D 3J7ZC 3I2ZA 4KN7C 3A8IE 2Z6KA 2EJFC 5FO9B 5ELFA 3M9BA 1U4LA 5IIFA 4RG1A 1PH9A 3SR1A 1KDBA 5K36H 2B39A 4LWCA 4IURA 4LF6L 3UDIA 4JK1C 3SK4A 1P16A 3CXCA 3K7AH 1MGSA 3I70A 3J7AV 5HGQA 4JOIA 1XXGA 2O4XA 3H0GB 2R3ZA 4HMJA 4DV7L 4CKEA 2SEBD 1X3EA 3GTJB 1BKBA 2MJ8A 5M5XB 1SEBD 2RDHA 1J5EQ 4PZ7A 1CKNA 1TWHH 3CHBD 1PTOB 4LJZC 2EYOA 3NTHA 4JW0A 3TP6A 2BA0A 2HT1A 3GV6A 2LKVA 2K04A 3J80c 1GUSA 1JWSD 5G3LF 5M5WH 3OTOL 4FF2A 2NVTH 3HOWB 5CV8A 3RZDH 5IGEA 1SYDA 2F0GA 5IGBA 1VQEA 1C48A 2JA9A 2Q2IA 3OW2A 3ULLA 4POFA 3J81E 3T1HL 4JI4L 2NYZD 1MHWC 3JAME 4K6LA 1R9TB 3SDZA 1CSPA 4TQUS 3F1ZA 1CSQA 3S2HH 1CKNB 4DAYA 5AJ3L 1PXUA 5CV6A 2FXQA 1A0IA 2GVAA 3H3VI 3HKSA 1CQVA 4RHSA 2MNAA 2FMCA 4HJ7A 3FRPB 3HKZG 3M3YH 4HIMA 2Q8TA 4A93G 2B63G 4DNTB 1KL9A 4A3GG 2PMZE 4LF9L 3SGIA 2Y0SG 1GHKA 2E74C 3ZJYC 2F4IA 2WP8J 3M3YB 2TSSA 1IW7D 4XYOA 1HFGA 1M4VA 2M2LA 2ZT9C 5LMUL 2EZVA 1XWEA 4A3EB 3MXUA 1SE4A 3TP5A 1PTOH 1PZJD 4LFCL 2Z4HA 2D2CC 2RKSA 1EWHA 4WFN3 2XN9C 1VMCA 3KJOA 2HDMA 4RHRA 3BZDB 2B8GA 4LF7L 1YVCA 3GD7A 5FO8B 2YTVA 1R4PB 4C2MB 4G7ZC 4DV0Q 3K80C 4RKBA 1LYLA 5I6YA 3SVMA 4A3EG 3BVZA 3PCOB 4JV5L 3DMUA 4XQQA 3DEOA 4WORA 1PTOF 1SJHD 1ASZA 3OIPA 3BS1A 1PH1A 1PH4A 2D9UA 4QY7A 4OO1I 3K0XA 4O1NA 3K8AA 4HTHA 4PZ6A 4GKJQ 1XMOL 1UAPA 4NXMQ 4L5QA 1J9OA 2WKCA 1VQ7A 2E2HB 4XT3B 3PQIA 1L2FA 1IBML 3QOJA 2F3WA 2K03A 2Z6KC 3NENA 3PO2B 4LFBQ 1D1IA 3WOEA 5I4DA 2ZTDA 5E4XA 2PO4A 4DV4Q 1YJWA 1X32A 5D65A 1CT1D 1HPCA 4R4OA 4CDEC 5EQ0A 4C2MH 3I8ZA 1L0YB 1TWAH 2EVBA 1VF5C 5EBCA 3T1HQ 3EA6A 1HCZA 5EAYA 5M3FB 2VQFQ 5E1FA 5M5XH 4A3MB 1KDAA 1VQPA 4IPDA 2AQ3B 3SK6A 4ALPA 3GTMB 2OQ0A 4EQPA 3CCMA 4IPCA 5GROA 4XYQA 2A6HD 1TVXA 1STAA 4DFAA 1QWYA 3Q8DA 1E1OA 4WJWA 2ICIA 3HOZH 4GNXA 2WAQG 1WTHA 1AFPA 1IBLL 1RL2A 1U5KA 5EKKA 5C44H 3OWFA 2N49A 1N36Q 2UUBQ 4DK3C 2KCCA 2WB1E 3E0JA 2AUKA 2ATWA 1PH3A 3VR2A 5EJWA 1K83B 5HGTA 3CPFA 2L11A 1GM5A 1YEZA 3KF8B 4C3JG 4DV6Q 3JAMi 4A3CH 1FVIA 4G4KA 2CHBD 5JJZA 4CHTB 1NMGA 5IP9H 4GOPB 4DU9A 3GTKH 2JA8B 5GQOA 1BOSA 3OWEB 4PG3A 2WB1G 2IJ0A 2Z9HA 1IL2A 3GO5A 3STBC 3NTKA 2A74C 4L6TB 4KJNA 1Y8NB 4GZYC 4EQ5A 4LF9Q 2EYLA 5AFWA 3K59A 1JJ2A 4IN3A 2JXMB 4CJ1B 5I9OA 3KLWA 2OT2A 4GOPC 5JVG3 1A62A 3BU2A 2UXBL 1TKWB 5LMUQ 2WIIB 1QE6A 3PUWA 5C6AA 4X65L 5GAHC 3Q24A 4LUVA 3S14B 4NB3A 4JI2L 1HH2P 2VUMH 4N9PA 1WTWA 3D3RA 4JBKA 1CA5A 3I72A 3I56A 2R92B 4IUPA 2OEOA 2DY7A 1SYBA 2RHSB 5G3LD 4ZK9B 2XRSD 5IYBG 4OIKA 1Y1VB 3NE5B 1WTRA 3LGJA 4DV0L 1N9WA 2DNEA 5C3EG 2A1AA 2EYFA 5IE8A 1U4RA 3ND8A 2G5DA 1Q86C 1TWGH 3EN2A 4L5TA 2HQLA 2L5TA 2VUMB 2QDLA 1EOTA 1YJNA 4NW2A 1PA6A 3SHLA 2PZTA 3F8TA 1KABA 5KYLA 1OO9B 3D4WA 1OXVA 3UDGA 3J7AF 4K2KA 4A93H 2PNRC 2KUMA 2OXPA 4K8JA 4NXML 4HIDA 2QEJC 2EYMA 5KNDA 2ZJQA 2FHTA 2K5HA 1QVFA 1AE3A 2CH4A 3BZKA 1VMPA 4FO2A 3GTJH 4HCEA 1EQTA 2FJ2A 4K5VA 1HNXL 4QF4A 3CQZB 4C3HH 3HKZE 1QZHA 3S1MB 2F0UA 2JK8A 1BCPC 3W3AA 1B2TA 1SNQA 1N36L 1PYWD 4IALA 3NPPA 3CD6A 1EWCA 2JEBI 4A3JG 1JT8A 1OXXK 1M90C 2NZHA 2BA1A 4H02A 1BNZA 5GAEC 3C3LA 4BBSG 3HOWH 2UU9Q 5F2DA 2C5CA 4TVAB 2PPBC 1UEAB 3MA2B 4DV6L 4KN4C 5IGDA 3V05A 4GNXC 5IYCH 1I4PA 4DR4Q 3JC66 4HJ5A 2AUJD 2OQKA 2RHQB 3VR4A 3MXPA 5C0XI 1ENCA 1AN8A 2B8FA 3PIO3 3Q23A 2PI2A 4A3BH 3GTOH 2XVSA 3F2DA 3CF5A 2HCIA 1H9KA 5FLMH 1Y8PB 1LTTD 1AH9A 2UUBL 3ERSX 1GVPA 1QB5D 1HRJA 1EY0A 3K5MA 4CJ0B 2E2IB 3UI2A 3MXNA 4F7XA 1QG7A 3MXGA 2UXBQ 2E2DC 3BZCA 4A3FG 1ZKOA 1EIHA 4X62Q 3C46A 2EYJA 2K5QA 4DKAC 1RDPD 1J8IA 5JJLA 3I4NH 2G9HD 2B2YC 2ZXPA 1FGUA 5ELCA 3R8BA 4KD4A 3JAML 1ICWA 4B3SQ 2DNCA 1PHJA 1C9OA 2A19A 3X3MA 4Z9CB 3GTGH 4DUZQ 2KHJA 2QGQA 2L9HA 4K0KQ 5A35A 1B4OA 2GVBA 3E3XA 3T4AC 1TY2A 3K57A 4IOCA 4IPHA 4TKOB 1DGSA 4DUYQ 1K83H 3M4OH 4QCLA 1QUQB 1SYCA 4J6HA 2BDNA 4O42A 3U9SA 4DV5Q 4LFAL 2HCCA 3KUPA 1G6ZA 1XPUA 2WINB 4OL7A 2E75C 2L55A 2ENBA 4KMUC 2F0HA 2MHVA 3CMAA 4WJ3M 4P75A 4DR1Q 2L1BA 3GV3A 5CBEE 4XDXA 5KIXA 1LTID 1QJOA 1GD7A 3HEJA 2PW7A 4R8IA 3PF4A 5FLXE 3TEHB 3GTPB 1N33Q 2Q8RE 3T16A 3U50C 2OWOA 3HRZC 2OTLA 1EEID 5CMDA 4A3DB 3GTLH 3EJIA 3RUZA 1QCBD 3W2DA 1SNDA 1NMFA 3RZOB 1HTPA 3QO2A 4P73A 3GDEA 5IGGA 1TY0A 1I4GA 4HEDA 5DNFA 4KY6A 2EY5A 1PRTF 2EOTA 1EY8A 4G57A 1RODA 4RCNA 1GOZA 2I0QA 1SMYD 1VQNA 2F4VL 1YITA 5I6WA 1TS5A 2A68C 2LS01 1Y69U 2JA7H 2K5VA 1VQ4A 3J81c 3G6EA 1LTGD 1H9SB 1LT4D 4IFDJ 4LAAA 3MTSA 1SRUA 2ZM6L 3HOVG 4FF1A 4RAUC 3M4OB 3SXHA 4ILWA 2WFWA 4IUUA 2Q8IB 4ZUJA 2JA5G 2Y0SB 1EU3A 4ME3A 1IYJB 3CKIB 2KCNA 1HZAA 4ULLA 4A93B 2MO0A 2R7FA 4LF5L 3IRBA 1JCKB 3A7AB 1B9NA 2IY5B 2AWNA 2KA7A 3MEHA 2WAQE 3MFYA 1VQ9A 2E76C 1TWAB 1Z7TA 1CA6A 1LABA 1WCMB 5C3XA 2IX0A 1SFOB 1IW7C 3S16H 3ER0A 4OWXB 4MN3A 3B6YA 4EX5A 4JI5Q 1HQRD 1EU4A 1A8VA 2B2WA 4DGZA 2AMCB 2F0TA 4I65A 4A3FH 1CTMA 4LFAQ 3TREA 4OELB 1VF7A 1EY4A 3OMGA 2K14A 1HNWQ 3EFXD 4KTAA 3AFPA 4YWKA 3MXNB 4OO1G 2PQAA 3CCRA 1KRSA 2K5WA 4P74A 1O7YA 1JB7A 1CKOA 2CWAA 4YIJA 4X65Q 1LTLA 4OONA 3U58A 1GKHA 1T9HA 3PUXA 2K7VA 2ZXRA 4B3SL 3GTQH 1VQGA 5JPMC 2F0VA 5JPNC 2KQ3A 4DUZL 2NTSA 3KLSA 2JA5H 1S40A 4DR6L 4HCSA 3HOXB 2GA4B 2NTTA 4QJFA 5CC4A 5C4JH 5HURA 4OGQC 4KHPQ 1HUNA 2YTYA 5EGTA 2MUYA 2JA6G 3S1QB 1CZGA 5C4XB 2VZAA 2HDLA 3I4MH 5M5WB 3A54A 3PUYA 2G9DA 1FL0A 3TN2A 3ICEA 4LF4L 2N3SA 3RLFA 3I3CA 4YWLA 3VR5A 1VQ6A 3R93A 1KLUD 2RSOA 3CQZH 2NZ1D 4C3HB 2CCZA 1WI5A 4B9XA 1MD2D 1LTAD 1OXSC 1XNQL 3H0GH 4BY7G 3CRLC 3KDFB 4DR1L 2NVQB 4BS9A 3NELA 1GUTA 3CCVA 1V1PA 3H0GG 1D5XC 1X6OA 1PRTB 1ESRA 4FXDA 1JWUD 1D1KA 3EVQA 1STBA 3G48A 4OX9L 4DF7A 4NXNQ 4HMIA 3LNNA 3L3OC 1U4PA 4QQBX 1S5FD 1F2MA 1UE1A 3CU7A 1Q8KA 1CUKA 4HJ9A 1UE6A 4FXGC 3KLRA 3UDFA 2RCFA 4JBJA 3BYTB 5IY0A 1WD0A 1HZ9A 2HD3A 1E3PA 4CBVA 3GTOB 3CC7A 1TWGB 3F2BA 2DJFC 1F2YA 1CKMA 1RIPA 1YHBA 1XJVA 2AQ2B 4RGTA 3GTKB 5ELBA 4I7ZC 1EUJA 4TRDA 3H3VH 2XNAC 2JA6H 1QOHA 4A75A 3PIOA 1V43A 3HOVB 2R92H 4R1JA 3PSIA 3HP3A 4A3BG 3H15A 1KD1C 2PZWA 4ZLTF 4CDCC 3IFDA 1BF4A 3PUVA 2E2HH 3FDTA 3HOZG 1A3UA 1AW7A 4BBSB 1Q81C 2K05A 5A2QL 2R93H 4LF5Q 1S5CD 2FFKB 3I4NG 2Q2HA 2E5LQ 1VQLA 3S24A 2F0SA 1CZWA 2R7DA 1X3FA 1JOQA 1A15A 1CHPD 3FKIB 3IL8A 2K6AA 3D4DA 3S17B 4HAEA 3H91A 5IWAQ 3R2IA 2ZXOA 4NPSA 3I90A 1B1ZA 1O80A 2H4OA 2K28A 3ERQA 1SROA 4A3LH 1VQHA 1X56A 4F87A 4JV5Q 1HR0L 2OCEA 1PRTD 3OIQA 3OMCA 1Y1VH 2HUGA 4WJ4A 3IKJA 3RN5A 1C7YA 4UHVA 5BN4A 2K50A 2L4NA 2QKIC 3HZXA 4JI8Q 1XX8A 4PNYA 4A3KB 1BUVT 2VUMG 4C56C 1NUCA 2SOBA 4MHEA 1XMQQ 4POGA 4GKJL 2MO1A 1SAPA 4C3IB 5L37A 2L0CA 1XNRQ 1WTPA 1TU2B 3BVMA 1B3QA 4YHHL 1BXTA 4FNFA 2XSCA 3KYHC 1IHZA 1Q12A 1YNND 1F9QA 1QNKA 3NEMA 4BWGB 3HOWG 1A63A 5E4WC 2PCFB 3K58A 4OX9Q 1Q8IA 4NXNL 2A5HA 2EY1A 1A3VA 1BR9A 3KK7A 2QDBA 1VQ5A 2VXWA 4PMCA 2UUCL 1M8AA 1WCMG 1NR2A 2F0OA 1PV4A 3HOYH 4APVA 1E24A 3K5OA 4FF3A 4X66L 2V4DA 3NBHA 4CDDC 2D5DA 3GTGB 1VQFA 3N6RA 4K14A 4ZKBB 2L12A 3BVGA 3W1BA 1WTOA 1F2ZA 2D0OA 2QF7A 2VL6A 3SK8A 3C1EA 3FPPA 2UUAQ 4JI1L 2KOLA 3S1NH 2KEDA 2XIWA 3QOLA 1B8AA 2A6EC 2ICEC 2ASBA 4QIWE 1EWIA 2TMPA 1EY9A 1X3PA 1SNCA 4UPAA 4A3GB 3WWVA 1D7QA 2B63B 5C0XJ 3RD4A 3BDOA 1I4HA 4LMQD 2EY2A 2QW7A 4LNQA 1I4QA 2KENA 4BBRG 1A2TA 1D5ZC 1X55A 3NUCA 1PH7A 2BH2A 1T5XD 3HS0C 1TWFB 4XQNA 4FYDA 1ZYRD 1HR0W 4U68A 5M3FH 4UP9A 2WAQB 5JEAH 1EYDA 5IWAL 3I7FA 3QB3A 1WCMH 1GO3E 4WRDA 4MTNA 5I2YA 3CCLA 1ONLA 2B2UA 1OXUA 1VQDA 1S5DD 4N9TA 5C4HA 5D14A 4B9WA 1VQOA 5LMNW 5IGFA 5C4JB 4CKCA 1UE5A 2ID0A 5J1ZA 3M4QA 2KJXA 4Y7NH 1YBYA 4EQNA 1E0BA 2N55A 4UP8A 1WFQA 4RCOA 1JQYD 3FEWX 3KJPA 1PTOC 3KFUA 2E5LL 3GTQB 3IFTA 4EVOA 5D3DA 1HNWL 4YHHQ 4H44C 3PO2G 1PFSA 3T13A 2KCTA 2UXDQ 5C3EB 3A5UA 4HIOA 1VQ8A 1PDQA 2MQHA 5C5LA 3NQTA 1SR3A 4GLAC 4FXKC 2UUCQ 5C3WA 2D0PA 4FP5D 5LL6S 3S2DB 2ZTEA 5DM63 3FKIG 4A3DH 5IYCG 3D8GA 1JOOA 1SE2A 2V1CC 1E1TA 1D5MC 3E9IA 1NBWA 3G71A 2FINB 1QZGA 1EY7A 1K8OA 1G8ZD 1XTCD 2BE5D 5EBDA 1TWHB 1V8QA 4RH6A 3M85A 1SXTA 2M9VA 1B70B 4JOIC 1PVOA 1ZEQX 3KDFA 4MTKA 1DD2A 2UUAL 1GUGA 1PH8A 2PQAB 4H13C 2IPKD 4PMBA 2BDOA 2VNUD 1H9JA 4U673 3CRKC 2X6GA 4EGVA 2IHEA 4XTCS 1PH6A 3TP7A 4BY7H 3QIAA 1PFBA 3PO3B 1K0SA 1E7ZA 3GQBA 1VDZA 3T1YQ 4JI7L 1IZ6A 2JA8G 1IKMA 4JI6L 4BY7B 4UY8C 2CKZB 3KF6A 3KOJA 4HJAA 1S5ED 4FDBA 3C2PA 2K33A 2IX3A 4X66Q 4JPBW 1VS0A 2UU9L 3J80i 2JYOA 3TS2A 1JORA 1ENAA 1QUQA 1ET9A 3GP7A 4IUNA 1BCPF 3O13A 3H94A 3T56B 4N8X1 2K1BA 2VB2X 4H0LC 4HR7B 1GUNA 1YNXA 1SYFA 3NWSA 3AQQA 2RVLA 5DEHA 4JBWA 4KI0A 3S1QH 1ILPA 2A69D 4CKBA 1EY6A 2J0TD 4R9WA 1FNWA 5JJIA 3I4OA 1SE8A 2NVTB 1H95A 1GJXA 2I46A 2UXCL 4NDXA 4OO1H 5IODA 1HZBA 1G2TA 4AQYL 3H09A 2VW9A 1GUWA 4KKTA 3S1MH 3MC0B 2F0QA 4R4CA 5IP7H 4R8NA 1STNA 1AEXA 4DNRB 1A3TA 1E2VA 3U4ZA 1EL0A 4MNOA 2R93G 2QILA 4DN4M 2ES2A 1BDOA 1I5FA 2A6ED 2DY8A 3TSSA 2E2JH 2MGSA 4A3CG 2C9OA 1PZID 3TS0A 1UWVA 2O5JC 2Z1CA 5ISRA 5IP9G 4NKLA 1IKLA 3A0JA 2Z6BA 3HOXG 1K0RA 3H6MA 3S1NB 1JJCB 2B2VC 3PIPA 4BXXH 1FYCA 2EE1A 3CAMA 1I50B 1PZKD 4L63B 3CCQA 1HTLD 5FJ8H 5IGCA 1T5EA 3G6JB 3HOUG 3HG9A 5LMNQ 4C1NI 1X9NA 4HN7A 1HR0Q 1JOKA 4S3SA 4AIMA 2NVXH 2JEAI 1I4XA 3HOUH 1EQQA 1LTSD 1NY4A 3NXWA 4KY5A 1IL8A 5C4XH 4JI0L 1LTRD 2RQXA 2EPBA 2NN6I 2OF1A 2F52A 1XMQL 2RDFA 3VA7A 1PYBA 1TT2A 3T1YL 4DPGA 3RLOA 1OTCA 1HNZL 3CC2A 1CM9A 1KAWA 3A5ZB 1NSNS 3HOZB 1N33L 2SDFA 1CI3M 1IYUA 3D6CA 1YNNC 4F88A 1S3OA 3K81C 4HSVA 1QVGA 4FVMA 1VQMA 1ET6A 4LK1C 2PQEA 3RZOH 5IT9c 3R3OA 4X3UA 3I55A 1B50A 3AMUA 2R6GA 4A3KH 3MVVA 5JJKA 3CCUA 2K75A 4BXXG 3D4RA 3S15H 3SK5A 4GS3A 5KNCA 1J6QA 1NJIC 3HKZB 2F4VQ 4IFDG 5FJ8G 4KKSA 1KNAA 5IT9L 2EXZA 4JI1Q 3TZUA 5GADC 4JI6Q 5CGKA 4DV3L 1PH5A 4DAVA 1SJED 1JE4A 4M1UB 3UE1A 4C3JH 4GN5A 4GN3B 1XYIA 4R4IA 5KYIA 2F3IA 1L1OB 4JVZA 4KLKA 5KEEA 1AE2A 1HZCA 4GNXB 1UNSA 5T1IA 3Q0AA 1RHPA 1ASYA 4BBSH 3FPUB 2EXDA 1U0LA 5CR3A 4K5WA 2F0EA 1H9RA 1BBUA 1X54A 1WD1A 1DCZA 3OHXC 1K3BC 5JEAG 1LACA 2YYZA 1D6EC 5K5PA 1HUMA 2NB0A 1BBXC 3VDYA 2MPMA 2UXCQ 2JQOA 2N88A 2LXJA 4AQYQ 2E8GA 1S72A 2AQ1B 4GOPA 1SYGA 1LUZA 1VQKA 4ODGA 4V0BA 4PV1C 4JI5L 1D8LA 3HFZB 4RGMA 1I3QH 3T51B 4XT1B 4XIGS 3ULPA 1E2ZA 1K73C 3W5OA 4O0AA 4A3IB 3I73A 3S1RB 3K7UC 3DM1A 1PFMA 3NTIA 1MBYA 1YNJD 2WACA 2NVYB 3V2TA 2B2VA 3NP8A 4DK6C 2VY3A 1FNVA 4I7AA 5J39A 2I07B 1JICA 4GN4B 1O78A 3U4VA 4JYAQ 1HNZQ 1W6KA 4OEMB 3AU7A 2UXDL 4ZCKA 1BCPD 3FP9A 1FJGL 2KHSA 5FLXc 1KLGD 4XXEA 1DYQA 3PO3G 2NVYH 1WJJA 3DHQA 1I6HH 4TSSA 4A3MH 3L2PA 2QA4A 2R61A 1IYVA 1ESFA 4LF4Q 3OW7A 4OHJA 1JB3A 2QCPX 1EZ6A 3IAYA 1LT5D 1Y1WH 3CMEA 5BN5A 4RWSC 3J81L 1ENFA 5EKIA 1XNQQ 2CH4W 3S14H 5ELOA 3SEBA 5IP7G 2VQEL 3RZDB 1PRTC 2K01A 5C0XG 2LY7A 1IBKL 3CC4A 1WYDA 4KKUA 3I4LA 1B44D 3E0EA 2JA5B 3K0YA 1DOLA 1AZQA 3CP0A 4H7BA 2ZJRA 4JI7Q 3NK9A 2F0DA 1KRTA 5IYDH 3X3NA 4C3IG 1VQAA 1HA5A 2E2JB 2Q2UA 4RKLA 2IW3A 5IYDG 3I4MG 4X64Q 1MJEA 3Q22A 3I91A 5CBAE 1FR3A 1Q1BA 3BDLA 2NVXB 4ABNA 2WKDA 5D3IB 4KV6A 1EY5A 5M3MB 1KIXA 4CDFC 3I4MB 1YI2A 3SE0A 3VYSA 1EZ8A 2YV5A 5ELEA 4GLXA 3ITPA 4GKKL 1Y1VG 1JR0D 2CWPA 3MZ5A 1CHQD 2NBFA 4YY3Q 4QL5A 3AEVA 2CVRA 5FLXL 1NAPA 2IHFA 1N32Q 1Z9FA 2NN6G 2Y0SE 2B2YA 3A8JE 2FMMA 3DM3A 5BR8Q 1W6JA 2NUCA 5CORA 2RDGA 1F9SA 2KVMA 2ALYB 4DV2Q 4X6AH 2MFIA 3BDCA 3CCSA 1PH2A 1KDCA 2CFMA 4GLVB 2R7ZG 4RMFA 1RKNA 4JYAL 5HY6A 3U9OA 4RGNA 2L15A 4K5XA 4AYBB 1Q7YC 1R9TH 3VR3A 2AWOA 1TWCH 1K3RA 4B3RL 4DR5L 1JC7A 1PTOD 4EQOA 1G291 2XWJB 4DV7Q 3HOUB 1TS3A 1Q82C 4RFBA 1J5EL 4JI8L 5I2XA 2C35B 4JI3L 3GTLB 3QR8A 5LMNL 4BY1B
chains in the Genus database with same CATH topology
4DKAC 1YJ9A 3PUZA 4IJLA 5JJLA 1XNRL 1W3SA 3I4NH 1HNWL 3J7A5 4LF8Q 1KXLA 1WOCA 4R4TA 4YHHQ 5E7NA 1K8GA 1UEBA 3PO2G 3L0OA 1PFSA 4JI0Q 2RF4A 2KCTA 1FGUA 2UXDQ 4B3TL 4KHZA 3A5UA 4B3SQ 4HIOA 1KC8C 1VQ8A 1PHJA 1C9OA 2MQHA 2A19A 3NBHB 4LFCQ 1SR3A 4GLAC 4DUZQ 1K8AC 3GTGH 3FKIH 4A3DG 2KHJA 2UUCQ 2QGQA 4OWWB 2D0PA 5H1SE 3AFQA 4K0KQ 2GVBA 2K4KA 2ZTEA 4A3MG 4X64L 1JJGA 3FKIG 4A3DH 5IYCG 5AJ3Q 3M4PA 2R92G 5M3FG 2V1CC 1E1TA 4MZ9A 5K36G 1N8RC 3E9IA 1NBWA 3G71A 4IPHA 3DLLA 4IOCA 4L5RC 1DGSA 4DUYQ 3BJUA 1QZGA 2IX1A 1K83H 1VQBA 4J15A 3EBEA 1TXYA 3M4OH 2JA7G 1Y1WG 3MEFA 3M85A 1QUQB 4DV5Q 1B70B 4JOIC 4A3IH 4LFAL 1PVOA 3KDFA 2VQEQ 4JI2Q 3G4SA 2UUAL 1XPUA 5FLMG 2PQAB 1PH8A 2VNUD 4A3IG 4GKKQ 1IBKQ 1Z47A 3RLNA 2I5HA 1V1QA 3RNUA 4BY1H 2IHEA 3CCJA 3PGZA 4XTCS 1PH6A 4BY7H 2DUDA 3S2DH 3CW2C 4HJ8A 3CMAA 4WJ3M 4P75A 4BY1G 2LSSA 4DR1Q 1E7ZA 1NTGA 3T1YQ 4JI7L 4IPGA 5M3MH 4P72A 1IZ6A 2PI2E 2A8VA 4IJHA 1VCIA 2JA8G 3GTMH 2DGYA 4JI6L 1GD7A 4UY8C 4DR6Q 2CKZB 2KCMA 3PF4A 1HJPA 3KF6A 3KOJA 4DV3Q 4HJAA 4YCWA 3TEHB 4FDBA 4LF7Q 4X66Q 3J81j 1EYGA 1N33Q 1VS0A 1N34Q 3U50C 4LUZA 2OWOA 4DV2L 4HIKA 2UU9L 2OTLA 3J80i 4JBMA 3UDXA 3TS2A 3OYYA 4DV4L 1QUQA 4P71A 4A3LG 3GTLH 3J7ZC 3I2ZA 4YCVA 2Z6KA 2AHOB 1YNXA 1NMFA 4P73A 3GDEA 3AQQA 3M9BA 4B3RQ 4JBWA 4KI0A 4RG1A 3S1QH 1PH9A 4LWCA 4YY3L 4LF6L 4A3GH 3UDIA 5JJIA 3I4OA 1EIYB 2I0QA 1P16A 1SE8A 1VQNA 3CXCA 3K7AH 1YITA 2E5LL 2F4VL 1H95A 5HGQA 2JA7H 2K5VA 4JOIA 3J81c 1VQ4A 1Y14B 3G6EA 2UXCL 4DV7L 1HZBA 1L0WA 1X3EA 4AQYL 4IFDJ 1C0AA 1SRUA 2ZM6L 1BKBA 1W2BA 3HOVG 1J5EQ 1IBMQ 4PZ7A 2VW9A 1CKNA 1TWHH 1JMCA 3S1MH 1TWFH 2BA0A 4R4CA 5IP7H 2HT1A 2WFWA 4DR3Q 3J80c 2JA5G 3U4ZA 5M5WH 4BBRH 3OTOL 2NVTH 1I94L 4ME3A 4DV1L 4IOAA 3RZDH 1IYJB 4MNOA 2R93G 1HZAA 2ES2A 1I5FA 2MO0A 4DNIA 1VQEA 2R7FA 2JA9A 2Q2IA 4LF5L 3OW2A 3ULLA 4POFA 4JI4L 3T1HL 3IRBA 2E2JH 4B3TQ 1B7YB 4A3CG 4YWMA 3HOXH 4DR5Q 2VQFL 3TS0A 1UWVA 2IY5B 2AWNA 5IP9G 1M1KC 2KHIA 1CSPA 2WAQE 4TQUS 3A0JA 3F1ZA 3HOXG 2YU9H 1CSQA 3S2HH 1VQ9A 1K0RA 1CKNB 2NVQH 2LXKA 1JJCB 5AJ3L 3PIPA 4BXXH 1FJGQ 2FXQA 1A0IA 1NE3A 2GVAA 2IX0A 2HHHL 2H5XA 3H3VI 3HKSA 3AYHB 3ER0A 2MNAA 3S16H 4KHPL 4OWXB 3CAMA 3B6YA 4EX5A 4HJ7A 3CCQA 4JI5Q 3HKZG 3M3YH 4HIMA 5FJ8H 4A93G 1A8VA 2B63G 4JI3Q 3HOUG 1KL9A 5LMNQ 4A3GG 2AMCB 3CPWA 2PMZE 1X9NA 4A3FH 4LFAQ 3TREA 1HR0Q 4LUOA 3ULJA 4AIMA 1EFWA 4LF9L 3SGIA 2NVXH 2JEAI 3HOUH 2Y0SG 3STBD 1EQQA 2K14A 1HNWQ 1KQSA 3ZJYC 1NY4A 2WP8J 3AFPA 4YWKA 3MXNB 5C4XH 1SLJA 2PQAA 3CCRA 1KRSA 1YHAA 4JI0L 4OO1G 4P74A 1JB7A 1OXTA 1CKOA 2CWAA 5LMUL 2NN6I 2F52A 4X65Q 1XMQL 1LTLA 4OONA 3U58A 2E2HH 1GKHA 1T9HA 3PUXA 2I5LX 3GTQH 4B3SL 1VQGA 4OXPA 1PYBA 3T1YL 1SN8A 4LFCL 4DAYB 1O7IA 4DPGA 2N78A 4DUZL 3RLOA 1OTCA 2JA5H 1S40A 1HNZL 3CC2A 1KAWA 1X65A 3A5ZB 4DR6L 1Q46A 3KJOA 4QJFA 5C4JH 4LF7L 1PYSB 1YVCA 3GD7A 1N33L 2XGTA 1MKHA 2YTVA 2JJQA 4KHPQ 2YTYA 1S3OA 2HIXA 3K80C 4C3IH 4DV0Q 2JA6G 1LYLA 3K81C 4A3EG 4PZ8A 2VZAA 1QVGA 3I4MH 2N8NA 3PCOB 1VQMA 3PUYA 3RZOH 5IT9c 4JV5L 1FL0A 3I55A 2R6GA 4A3KH 3ICEA 4LF4L 1YHQA 2N3SA 3RLFA 3CCEA 1ASZA 4YWLA 3CCUA 5JJKA 1PH1A 1VQ6A 2K75A 4QY7A 1PH4A 4BXXG 3S15H 4OO1I 4GS3A 3K0XA 1VQCA 3K8AA 3CQZH 3EIVA 1J6QA 1NJIC 2CCZA 2GN5A 4PZ6A 4GKJQ 1WI5A 1XMOL 2F4VQ 1OXSC 1XNQL 4BY7G 3GTPH 3H0GH 4IFDG 3KDFB 5FJ8G 4DR1L 4NXMQ 4L5QA 3RN2A 4JI1Q 3NELA 5GADC 3CCVA 3H0GG 1X6OA 1VQ7A 3L7ZC 4JI6Q 2JA8H 1L2FA 1XPRA 1IBML 4PMWA 3S17H 4DV3L 3G48A 1PH5A 2Z6KC 4OX9L 3NENA 3FHWA 3UE1A 4C3JH 4NXNQ 4GN5A 4GN3B 1N34L 4DR7L 4R4IA 4LFBQ 2ZTDA 4QQBX 1V9PA 2OTJA 1UE1A 1G6PA 1LM0A 1L1OB 1Q8KA 2F3IA 4KLKA 1AE2A 1CUKA 1HZCA 4DV4Q 4GNXB 4HJ9A 1YJWA 1EQRA 1KHIA 1UE6A 2IT1A 3UDFA 4IFDI 1N32L 4BA2I 4JBJA 4R4OA 3TQYA 5IY0A 4B3MQ 4C2MH 5GAGC 5BR8L 1HZ9A 1E3PA 1MJCA 3PF5A 1ASYA 3CC7A 3JAMc 3D0FA 4BBSH 3F2BA 1RIPA 1CKMA 1TWAH 1U0LA 1YHBA 2EXDA 1YIJA 3T1HQ 4L5SA 4AYBE 1XJVA 1BBUA 1X54A 4JC0A 5EAYA 2VQFQ 5M5XH 1EUJA 4LF6Q 1E22A 1VQPA 4IPDA 5JEAG 4ALPA 2YYZA 3H3VH 2OQ0A 2JA6H 3CCMA 4A75A 4IPCA 1V43A 3PIOA 5GROA 4R1JA 3VDYA 2KBNA 3PSIA 2R92H 2JQOA 4A3BG 3J81i 3H15A 2UXCQ 1KD1C 1QVCA 2LXJA 4AQYQ 2RCNA 2E8GA 3W1GA 4A3KG 4GOPA 1S72A 1LUZA 1UE7A 1VQKA 3Q8DA 1E1OA 1HNXQ 5C44G 4JI5L 1D8LA 3HOZH 3HOVH 4GNXA 3TRZA 2WAQG 3HFZB 1I3QH 1IBLL 1RL2A 4XIGS 3PUVA 1U5KA 3ULPA 2EQSA 5C44H 2N49A 3D31A 1K73C 4DR3L 3W5OA 4O0AA 2WB1E 4DK3C 1N36Q 2UUBQ 3HOZG 3OTOQ 1L1OC 2ATWA 1I94Q 3K7UC 1PH3A 2K52A 4DAMA 4UP7A 1SFOH 1Q81C 3CPFA 2R93H 2ZJPA 4DR2L 1GM5A 2Q2TA 4LF5Q 2AKWB 1YEZA 4JI4Q 4DK6C 3KF8B 2Q2HA 2VY3A 3RR5A 1VQLA 2E5LQ 3I4NG 3S24A 4DV6Q 3JAMi 2R7DA 1X3FA 1FVIA 4A3CH 4GN4B 3U4VA 4JYAQ 1HNZQ 4DR4L 1NMGA 5IP9H 5IWAQ 4GOPB 2UXDL 2EIFA 3GTKH 4NPSA 3FP9A 1FJGL 5GQOA 1YZ6A 4PG3A 2HHHQ 2WB1G 5FLXc 3PV0A 1IL2A 3PO3G 2NVYH 2CQOA 1SROA 3GO5A 1WJJA 1VQHA 4A3LH 1X56A 3UE0A 3STBC 1SMXA 1I6HH 1XPOA 4A3MH 3L2PA 4JV5Q 1HR0L 4EQ5A 2OCEA 1BVSA 4LF9Q 4JCVE 1Y1VH 1BBWA 2QA4A 1JJ2A 4WJ4A 4LF4Q 3RN5A 1C7YA 3KLWA 1JE5A 2K50A 4JI8Q 3KF6B 2ZTCA 4GOPC 1Y1WH 1XTDA 1A62A 3BU2A 3CMEA 2UXBL 2E2IH 5LMUQ 4AH6A 3PUWA 2VUMG 4X65L 5GAHC 1XMQQ 4POGA 4GKJL 4X62L 1XNQQ 2MO1A 4LUVA 3S14H 1G51A 5ELOA 5IP7G 4A76A 5M5YH 2VQEL 4NB3A 4JI2L 1HH2P 1XNRQ 2VUMH 1I50H 1VQJA 4LF8L 4JBKA 4A3JH 5C0XG 4YHHL 1IBKL 3CC4A 1WYDA 3I56A 3KYHC 1Q12A 1P8LA 3NEMA 3HOWG 1A63A 2RHSB 3E0EA 4OX9Q 4NXNL 5IYBG 3CP0A 2ZJRA 4O2DA 3LGJA 4DV0L 1VQ5A 1N9WA 2VS1A 4JI7Q 5C3EG 2A1AA 1KRTA 5IYDH 5IYBH 2BH8A 5IE8A 2UUCL 4B3ML 1Q86C 1TWGH 1VQAA 3EN2A 4L5TA 4LW1A 1K9MC 4A3EH 4K0KL 2HQLA 2Q2UA 4QGUA 1WCMG 3HOYH 2B29A 5IYDG 4X64Q 1PV4A 3I4MG 1MJEA 4APVA 1E24A 1VQIA 4X66L 1YJNA 1Q1BA 1MIUA 1PA6A 4BA1I 4Y52H 3HOYG 3F8TA 5J3BA 2XTIA 5JEAJ 4DUYL 1VQFA 1KIXA 4YCUA 1OXVA 3W1BA 4DR7Q 2PNHA 4IO9A 3UDGA 3PO3H 1YI2A 2D0OA 2B63H 2VL6A 1XMOQ 4DV5L 4A93H 2YV5A 4NXML 4HIDA 2UUAQ 4GLXA 2ZJQA 2K5HA 2JE6I 4JI1L 1QVFA 1AE3A 3BZKA 4GKKL 3S1NH 1Y1VG 3GTJH 2CWPA 1HNXL 4YY3Q 4QL5A 4C3HH 3AEVA 1B8AA 3HKZE 1QZHA 2ASBA 2JK8A 4QIWE 2K5NA 4JG2A 1EWIA 3S1RH 4LFBL 4UPAA 1N36L 4OWTB 3WWVA 1D7QA 3PO2H 2IHFA 5C0XJ 1Z9FA 2NN6G 2Y0SE 3CD6A 1N32Q 4AYBG 5C4XG 2JEBI 3DM3A 2B3GA 5BR8Q 4A3JG 1JT8A 1OXXK 1M90C 4LNQA 2NZHA 2BA1A 3E9HA 4H02A 5GAEC 2HIVA 4BBSG 2ALYB 4DV2Q 2UU9Q 3HOWH 2KENA 2MFIA 4X6AH 4BBRG 3CCSA 1X55A 1PH7A 1PH2A 2BH2A 2CFMA 4GLVB 4TVAB 4DV6L 4RMFA 2R7ZG 4DV1Q 4A4IA 4JYAL 1HR0W 2D62A 2I5MX 5HY6A 5IYCH 5C3EH 5M3FH 4GNXC 4DR4Q 4UP9A 2R7ZH 3JC66 5ELNA 2QEXA 2L15A 2OQKA 2NZOA 5IWAL 4HJ5A 2RHQB 3I7FA 5C0XI 1Q7YC 1WCMH 2Z0SA 1R9TH 4A3BH 2PI2A 1GO3E 1L1OA 2AWOA 1TWCH 1K3RA 4B3RL 5DLQE 4DR5L 3GTOH 3F2DA 4R4QA 4MTNA 3CF5A 3CCLA 1IBLQ 1EIFA 5FLMH 1G291 1OXUA 1VQDA 1AH9A 3A74A 2UUBL 3ERSX 1GVPA 1Q1EA 4DV7Q 1VQOA 5LMNW 1Q82C 3M7NA 2YTXA 2ZM6Q 1UE5A 4JI8L 1IXRA 1J5EL 2ID0A 3M4QA 4Y7NH 1YBYA 2UXBQ 4DR2Q 2C35B 3BZCA 4UP8A 4JI3L 1WFQA 3KJPA 4A3FG 3KFUA 5LMNL 5M3MG 1X3GA 4X62Q 1EOVA 3F2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DKA C;  1YJ9 A;  3PUZ A;  4IJL A;  5JJL A;  1XNR L;  1W3S A;  3I4N H;  1HNW L;  3J7A 5;  4LF8 Q;  1KXL A;  1WOC A;  4R4T A;  4YHH Q;  5E7N A;  1K8G A;  1UEB A;  3PO2 G;  3L0O A;  1PFS A;  4JI0 Q;  2RF4 A;  2KCT A;  1FGU A;  2UXD Q;  4B3T L;  4KHZ A;  3A5U A;  4B3S Q;  4HIO A;  1KC8 C;  1VQ8 A;  1PHJ A;  1C9O A;  2MQH A;  2A19 A;  3NBH B;  4LFC Q;  1SR3 A;  4GLA C;  4DUZ Q;  1K8A C;  3GTG H;  3FKI H;  4A3D G;  2KHJ A;  2UUC Q;  2QGQ A;  4OWW B;  2D0P A;  5H1S E;  3AFQ A;  4K0K Q;  2GVB A;  2K4K A;  2ZTE A;  4A3M G;  4X64 L;  1JJG A;  3FKI G;  4A3D H;  5IYC G;  5AJ3 Q;  3M4P A;  2R92 G;  5M3F G;  2V1C C;  1E1T A;  4MZ9 A;  5K36 G;  1N8R C;  3E9I A;  1NBW A;  3G71 A;  4IPH A;  3DLL A;  4IOC A;  4L5R C;  1DGS A;  4DUY Q;  3BJU A;  1QZG A;  2IX1 A;  1K83 H;  1VQB A;  4J15 A;  3EBE A;  1TXY A;  3M4O H;  2JA7 G;  1Y1W G;  3MEF A;  3M85 A;  1QUQ B;  4DV5 Q;  1B70 B;  4JOI C;  4A3I H;  4LFA L;  1PVO A;  3KDF A;  2VQE Q;  4JI2 Q;  3G4S A;  2UUA L;  1XPU A;  5FLM G;  2PQA B;  1PH8 A;  2VNU D;  4A3I G;  4GKK Q;  1IBK Q;  1Z47 A;  3RLN A;  2I5H A;  1V1Q A;  3RNU A;  4BY1 H;  2IHE A;  3CCJ A;  3PGZ A;  4XTC S;  1PH6 A;  4BY7 H;  2DUD A;  3S2D H;  3CW2 C;  4HJ8 A;  3CMA A;  4WJ3 M;  4P75 A;  4BY1 G;  2LSS A;  4DR1 Q;  1E7Z A;  1NTG A;  3T1Y Q;  4JI7 L;  4IPG A;  5M3M H;  4P72 A;  1IZ6 A;  2PI2 E;  2A8V A;  4IJH A;  1VCI A;  2JA8 G;  3GTM H;  2DGY A;  4JI6 L;  1GD7 A;  4UY8 C;  4DR6 Q;  2CKZ B;  2KCM A;  3PF4 A;  1HJP A;  3KF6 A;  3KOJ A;  4DV3 Q;  4HJA A;  4YCW A;  3TEH B;  4FDB A;  4LF7 Q;  4X66 Q;  3J81 j;  1EYG A;  1N33 Q;  1VS0 A;  1N34 Q;  3U50 C;  4LUZ A;  2OWO A;  4DV2 L;  4HIK A;  2UU9 L;  2OTL A;  3J80 i;  4JBM A;  3UDX A;  3TS2 A;  3OYY A;  4DV4 L;  1QUQ A;  4P71 A;  4A3L G;  3GTL H;  3J7Z C;  3I2Z A;  4YCV A;  2Z6K A;  2AHO B;  1YNX A;  1NMF A;  4P73 A;  3GDE A;  3AQQ A;  3M9B A;  4B3R Q;  4JBW A;  4KI0 A;  4RG1 A;  3S1Q H;  1PH9 A;  4LWC A;  4YY3 L;  4LF6 L;  4A3G H;  3UDI A;  5JJI A;  3I4O A;  1EIY B;  2I0Q A;  1P16 A;  1SE8 A;  1VQN A;  3CXC A;  3K7A H;  1YIT A;  2E5L L;  2F4V L;  1H95 A;  5HGQ A;  2JA7 H;  2K5V A;  4JOI A;  3J81 c;  1VQ4 A;  1Y14 B;  3G6E A;  2UXC L;  4DV7 L;  1HZB A;  1L0W A;  1X3E A;  4AQY L;  4IFD J;  1C0A A;  1SRU A;  2ZM6 L;  1BKB A;  1W2B A;  3HOV G;  1J5E Q;  1IBM Q;  4PZ7 A;  2VW9 A;  1CKN A;  1TWH H;  1JMC A;  3S1M H;  1TWF H;  2BA0 A;  4R4C A;  5IP7 H;  2HT1 A;  2WFW A;  4DR3 Q;  3J80 c;  2JA5 G;  3U4Z A;  5M5W H;  4BBR H;  3OTO L;  2NVT H;  1I94 L;  4ME3 A;  4DV1 L;  4IOA A;  3RZD H;  1IYJ B;  4MNO A;  2R93 G;  1HZA A;  2ES2 A;  1I5F A;  2MO0 A;  4DNI A;  1VQE A;  2R7F A;  2JA9 A;  2Q2I A;  4LF5 L;  3OW2 A;  3ULL A;  4POF A;  4JI4 L;  3T1H L;  3IRB A;  2E2J H;  4B3T Q;  1B7Y B;  4A3C G;  4YWM A;  3HOX H;  4DR5 Q;  2VQF L;  3TS0 A;  1UWV A;  2IY5 B;  2AWN A;  5IP9 G;  1M1K C;  2KHI A;  1CSP A;  2WAQ E;  4TQU S;  3A0J A;  3F1Z A;  3HOX G;  2YU9 H;  1CSQ A;  3S2H H;  1VQ9 A;  1K0R A;  1CKN B;  2NVQ H;  2LXK A;  1JJC B;  5AJ3 L;  3PIP A;  4BXX H;  1FJG Q;  2FXQ A;  1A0I A;  1NE3 A;  2GVA A;  2IX0 A;  2HHH L;  2H5X A;  3H3V I;  3HKS A;  3AYH B;  3ER0 A;  2MNA A;  3S16 H;  4KHP L;  4OWX B;  3CAM A;  3B6Y A;  4EX5 A;  4HJ7 A;  3CCQ A;  4JI5 Q;  3HKZ G;  3M3Y H;  4HIM A;  5FJ8 H;  4A93 G;  1A8V A;  2B63 G;  4JI3 Q;  3HOU G;  1KL9 A;  5LMN Q;  4A3G G;  2AMC B;  3CPW A;  2PMZ E;  1X9N A;  4A3F H;  4LFA Q;  3TRE A;  1HR0 Q;  4LUO A;  3ULJ A;  4AIM A;  1EFW A;  4LF9 L;  3SGI A;  2NVX H;  2JEA I;  3HOU H;  2Y0S G;  3STB D;  1EQQ A;  2K14 A;  1HNW Q;  1KQS A;  3ZJY C;  1NY4 A;  2WP8 J;  3AFP A;  4YWK A;  3MXN B;  5C4X H;  1SLJ A;  2PQA A;  3CCR A;  1KRS A;  1YHA A;  4JI0 L;  4OO1 G;  4P74 A;  1JB7 A;  1OXT A;  1CKO A;  2CWA A;  5LMU L;  2NN6 I;  2F52 A;  4X65 Q;  1XMQ L;  1LTL A;  4OON A;  3U58 A;  2E2H H;  1GKH A;  1T9H A;  3PUX A;  2I5L X;  3GTQ H;  4B3S L;  1VQG A;  4OXP A;  1PYB A;  3T1Y L;  1SN8 A;  4LFC L;  4DAY B;  1O7I A;  4DPG A;  2N78 A;  4DUZ L;  3RLO A;  1OTC A;  2JA5 H;  1S40 A;  1HNZ L;  3CC2 A;  1KAW A;  1X65 A;  3A5Z B;  4DR6 L;  1Q46 A;  3KJO A;  4QJF A;  5C4J H;  4LF7 L;  1PYS B;  1YVC A;  3GD7 A;  1N33 L;  2XGT A;  1MKH A;  2YTV A;  2JJQ A;  4KHP Q;  2YTY A;  1S3O A;  2HIX A;  3K80 C;  4C3I H;  4DV0 Q;  2JA6 G;  1LYL A;  3K81 C;  4A3E G;  4PZ8 A;  2VZA A;  1QVG A;  3I4M H;  2N8N A;  3PCO B;  1VQM A;  3PUY A;  3RZO H;  5IT9 c;  4JV5 L;  1FL0 A;  3I55 A;  2R6G A;  4A3K H;  3ICE A;  4LF4 L;  1YHQ A;  2N3S A;  3RLF A;  3CCE A;  1ASZ A;  4YWL A;  3CCU A;  5JJK A;  1PH1 A;  1VQ6 A;  2K75 A;  4QY7 A;  1PH4 A;  4BXX G;  3S15 H;  4OO1 I;  4GS3 A;  3K0X A;  1VQC A;  3K8A A;  3CQZ H;  3EIV A;  1J6Q A;  1NJI C;  2CCZ A;  2GN5 A;  4PZ6 A;  4GKJ Q;  1WI5 A;  1XMO L;  2F4V Q;  1OXS C;  1XNQ L;  4BY7 G;  3GTP H;  3H0G H;  4IFD G;  3KDF B;  5FJ8 G;  4DR1 L;  4NXM Q;  4L5Q A;  3RN2 A;  4JI1 Q;  3NEL A;  5GAD C;  3CCV A;  3H0G G;  1X6O A;  1VQ7 A;  3L7Z C;  4JI6 Q;  2JA8 H;  1L2F A;  1XPR A;  1IBM L;  4PMW A;  3S17 H;  4DV3 L;  3G48 A;  1PH5 A;  2Z6K C;  4OX9 L;  3NEN A;  3FHW A;  3UE1 A;  4C3J H;  4NXN Q;  4GN5 A;  4GN3 B;  1N34 L;  4DR7 L;  4R4I A;  4LFB Q;  2ZTD A;  4QQB X;  1V9P A;  2OTJ A;  1UE1 A;  1G6P A;  1LM0 A;  1L1O B;  1Q8K A;  2F3I A;  4KLK A;  1AE2 A;  1CUK A;  1HZC A;  4DV4 Q;  4GNX B;  4HJ9 A;  1YJW A;  1EQR A;  1KHI A;  1UE6 A;  2IT1 A;  3UDF A;  4IFD I;  1N32 L;  4BA2 I;  4JBJ A;  4R4O A;  3TQY A;  5IY0 A;  4B3M Q;  4C2M H;  5GAG C;  5BR8 L;  1HZ9 A;  1E3P A;  1MJC A;  3PF5 A;  1ASY A;  3CC7 A;  3JAM c;  3D0F A;  4BBS H;  3F2B A;  1RIP A;  1CKM A;  1TWA H;  1U0L A;  1YHB A;  2EXD A;  1YIJ A;  3T1H Q;  4L5S A;  4AYB E;  1XJV A;  1BBU A;  1X54 A;  4JC0 A;  5EAY A;  2VQF Q;  5M5X H;  1EUJ A;  4LF6 Q;  1E22 A;  1VQP A;  4IPD A;  5JEA G;  4ALP A;  2YYZ A;  3H3V H;  2OQ0 A;  2JA6 H;  3CCM A;  4A75 A;  4IPC A;  1V43 A;  3PIO A;  5GRO A;  4R1J A;  3VDY A;  2KBN A;  3PSI A;  2R92 H;  2JQO A;  4A3B G;  3J81 i;  3H15 A;  2UXC Q;  1KD1 C;  1QVC A;  2LXJ A;  4AQY Q;  2RCN A;  2E8G A;  3W1G A;  4A3K G;  4GOP A;  1S72 A;  1LUZ A;  1UE7 A;  1VQK A;  3Q8D A;  1E1O A;  1HNX Q;  5C44 G;  4JI5 L;  1D8L A;  3HOZ H;  3HOV H;  4GNX A;  3TRZ A;  2WAQ G;  3HFZ B;  1I3Q H;  1IBL L;  1RL2 A;  4XIG S;  3PUV A;  1U5K A;  3ULP A;  2EQS A;  5C44 H;  2N49 A;  3D31 A;  1K73 C;  4DR3 L;  3W5O A;  4O0A A;  2WB1 E;  4DK3 C;  1N36 Q;  2UUB Q;  3HOZ G;  3OTO Q;  1L1O C;  2ATW A;  1I94 Q;  3K7U C;  1PH3 A;  2K52 A;  4DAM A;  4UP7 A;  1SFO H;  1Q81 C;  3CPF A;  2R93 H;  2ZJP A;  4DR2 L;  1GM5 A;  2Q2T A;  4LF5 Q;  2AKW B;  1YEZ A;  4JI4 Q;  4DK6 C;  3KF8 B;  2Q2H A;  2VY3 A;  3RR5 A;  1VQL A;  2E5L Q;  3I4N G;  3S24 A;  4DV6 Q;  3JAM i;  2R7D A;  1X3F A;  1FVI A;  4A3C H;  4GN4 B;  3U4V A;  4JYA Q;  1HNZ Q;  4DR4 L;  1NMG A;  5IP9 H;  5IWA Q;  4GOP B;  2UXD L;  2EIF A;  3GTK H;  4NPS A;  3FP9 A;  1FJG L;  5GQO A;  1YZ6 A;  4PG3 A;  2HHH Q;  2WB1 G;  5FLX c;  3PV0 A;  1IL2 A;  3PO3 G;  2NVY H;  2CQO A;  1SRO A;  3GO5 A;  1WJJ A;  1VQH A;  4A3L H;  1X56 A;  3UE0 A;  3STB C;  1SMX A;  1I6H H;  1XPO A;  4A3M H;  3L2P A;  4JV5 Q;  1HR0 L;  4EQ5 A;  2OCE A;  1BVS A;  4LF9 Q;  4JCV E;  1Y1V H;  1BBW A;  2QA4 A;  1JJ2 A;  4WJ4 A;  4LF4 Q;  3RN5 A;  1C7Y A;  3KLW A;  1JE5 A;  2K50 A;  4JI8 Q;  3KF6 B;  2ZTC A;  4GOP C;  1Y1W H;  1XTD A;  1A62 A;  3BU2 A;  3CME A;  2UXB L;  2E2I H;  5LMU Q;  4AH6 A;  3PUW A;  2VUM G;  4X65 L;  5GAH C;  1XMQ Q;  4POG A;  4GKJ L;  4X62 L;  1XNQ Q;  2MO1 A;  4LUV A;  3S14 H;  1G51 A;  5ELO A;  5IP7 G;  4A76 A;  5M5Y H;  2VQE L;  4NB3 A;  4JI2 L;  1HH2 P;  1XNR Q;  2VUM H;  1I50 H;  1VQJ A;  4LF8 L;  4JBK A;  4A3J H;  5C0X G;  4YHH L;  1IBK L;  3CC4 A;  1WYD A;  3I56 A;  3KYH C;  1Q12 A;  1P8L A;  3NEM A;  3HOW G;  1A63 A;  2RHS B;  3E0E A;  4OX9 Q;  4NXN L;  5IYB G;  3CP0 A;  2ZJR A;  4O2D A;  3LGJ A;  4DV0 L;  1VQ5 A;  1N9W A;  2VS1 A;  4JI7 Q;  5C3E G;  2A1A A;  1KRT A;  5IYD H;  5IYB H;  2BH8 A;  5IE8 A;  2UUC L;  4B3M L;  1Q86 C;  1TWG H;  1VQA A;  3EN2 A;  4L5T A;  4LW1 A;  1K9M C;  4A3E H;  4K0K L;  2HQL A;  2Q2U A;  4QGU A;  1WCM G;  3HOY H;  2B29 A;  5IYD G;  4X64 Q;  1PV4 A;  3I4M G;  1MJE A;  4APV A;  1E24 A;  1VQI A;  4X66 L;  1YJN A;  1Q1B A;  1MIU A;  1PA6 A;  4BA1 I;  4Y52 H;  3HOY G;  3F8T A;  5J3B A;  2XTI A;  5JEA J;  4DUY L;  1VQF A;  1KIX A;  4YCU A;  1OXV A;  3W1B A;  4DR7 Q;  2PNH A;  4IO9 A;  3UDG A;  3PO3 H;  1YI2 A;  2D0O A;  2B63 H;  2VL6 A;  1XMO Q;  4DV5 L;  4A93 H;  2YV5 A;  4NXM L;  4HID A;  2UUA Q;  4GLX A;  2ZJQ A;  2K5H A;  2JE6 I;  4JI1 L;  1QVF A;  1AE3 A;  3BZK A;  4GKK L;  3S1N H;  1Y1V G;  3GTJ H;  2CWP A;  1HNX L;  4YY3 Q;  4QL5 A;  4C3H H;  3AEV A;  1B8A A;  3HKZ E;  1QZH A;  2ASB A;  2JK8 A;  4QIW E;  2K5N A;  4JG2 A;  1EWI A;  3S1R H;  4LFB L;  4UPA A;  1N36 L;  4OWT B;  3WWV A;  1D7Q A;  3PO2 H;  2IHF A;  5C0X J;  1Z9F A;  2NN6 G;  2Y0S E;  3CD6 A;  1N32 Q;  4AYB G;  5C4X G;  2JEB I;  3DM3 A;  2B3G A;  5BR8 Q;  4A3J G;  1JT8 A;  1OXX K;  1M90 C;  4LNQ A;  2NZH A;  2BA1 A;  3E9H A;  4H02 A;  5GAE C;  2HIV A;  4BBS G;  2ALY B;  4DV2 Q;  2UU9 Q;  3HOW H;  2KEN A;  2MFI A;  4X6A H;  4BBR G;  3CCS A;  1X55 A;  1PH7 A;  1PH2 A;  2BH2 A;  2CFM A;  4GLV B;  4TVA B;  4DV6 L;  4RMF A;  2R7Z G;  4DV1 Q;  4A4I A;  4JYA L;  1HR0 W;  2D62 A;  2I5M X;  5HY6 A;  5IYC H;  5C3E H;  5M3F H;  4GNX C;  4DR4 Q;  4UP9 A;  2R7Z H;  3JC6 6;  5ELN A;  2QEX A;  2L15 A;  2OQK A;  2NZO A;  5IWA L;  4HJ5 A;  2RHQ B;  3I7F A;  5C0X I;  1Q7Y C;  1WCM H;  2Z0S A;  1R9T H;  4A3B H;  2PI2 A;  1GO3 E;  1L1O A;  2AWO A;  1TWC H;  1K3R A;  4B3R L;  5DLQ E;  4DR5 L;  3GTO H;  3F2D A;  4R4Q A;  4MTN A;  3CF5 A;  3CCL A;  1IBL Q;  1EIF A;  5FLM H;  1G29 1;  1OXU A;  1VQD A;  1AH9 A;  3A74 A;  2UUB L;  3ERS X;  1GVP A;  1Q1E A;  4DV7 Q;  1VQO A;  5LMN W;  1Q82 C;  3M7N A;  2YTX A;  2ZM6 Q;  1UE5 A;  4JI8 L;  1IXR A;  1J5E L;  2ID0 A;  3M4Q A;  4Y7N H;  1YBY A;  2UXB Q;  4DR2 Q;  2C35 B;  3BZC A;  4UP8 A;  4JI3 L;  1WFQ A;  3KJP A;  4A3F G;  3KFU A;  5LMN L;  5M3M G;  1X3G A;  4X62 Q;  1EOV A;  3F2C A; 
#chains in the Genus database with same CATH topology
 3NHH A;  2PW5 A;  1F2L A;  3PUZ A;  3OOC A;  1C8C A;  1XNR L;  3J7A 5;  2H1E A;  4R4T A;  1SBB B;  1UEB A;  3K7A B;  4JI0 Q;  2VB3 X;  4NMZ A;  1DOM A;  1Q3L A;  1SMY C;  4B3T L;  1L0X B;  4A3F B;  2JA7 B;  3NBI A;  1K8A C;  2SNM A;  2JP1 A;  3FKI H;  4A3D G;  3DWA A;  3MHB A;  4A3M G;  4X64 L;  3TP8 A;  5AJ3 Q;  3M4P A;  4M8A A;  5M3F G;  4MZ9 A;  5K36 G;  2IWH A;  4L5R C;  2PZU A;  2IX1 A;  1VQB A;  4DXG A;  3D6W A;  1STH A;  1NCV A;  2CW0 C;  4A3I H;  4OIJ A;  4QMG A;  2DN8 A;  2CQA A;  1AP0 A;  2VQE Q;  2WV6 D;  3VYR A;  3G4S A;  5FK9 C;  5FLM G;  1HA6 A;  3S9W A;  1RJT A;  4A3I G;  2JN4 A;  5ELD A;  1Z47 A;  3RLN A;  5EKL A;  1IBK Q;  3KLS X;  4GKK Q;  5EPJ A;  3RNU A;  1G91 A;  4X3T A;  3TDQ A;  5CV9 A;  3CCJ A;  1H9S A;  2DUD A;  2P5Z X;  3S2D H;  4IFD H;  4HJ8 A;  2EJM A;  2F0K A;  2LSS A;  1NTG A;  4ME5 A;  2F1M A;  5CYU A;  5M3M H;  1EYC A;  4IJH A;  1VCI A;  3BG3 A;  2DGY A;  2B2T C;  2KCM A;  1Z6H A;  4DV3 Q;  1SSO A;  1K8M A;  1ZXT A;  1EYG A;  2XWB B;  1EYA A;  4LUZ A;  4HIK A;  4JBM A;  3UDX A;  3I4N B;  4IQZ A;  1ICF B;  5FO7 B;  3VA5 A;  4YCV A;  3J7Y W;  2AHO B;  1K28 A;  4Y7N B;  4ID6 A;  1JWM D;  4B3R Q;  3TZD A;  4YY3 L;  4A3G H;  2B2W C;  5M9O A;  1EIY B;  4BBR B;  1Y14 B;  3KF8 A;  1L0W A;  3L9A X;  1C0A A;  4K8I A;  4A3B B;  5KGU A;  1W2B A;  5KRU A;  5C4Z A;  3G7L A;  3S15 B;  1TS2 A;  1IBM Q;  1JMC A;  4DXF A;  1TWF H;  2F0I A;  4IUQ A;  1I6H B;  4DR3 Q;  1SNP A;  5JOB A;  4BBR H;  1A2U A;  4DV1 L;  1I94 L;  4IOA A;  4J1M A;  5C5M A;  2HQE A;  4J8Q A;  4F8M A;  2F03 A;  1RF2 D;  4DNI A;  4IUV A;  4L8J A;  4B3T Q;  3P75 A;  1B7Y B;  1LLR D;  4YWM A;  3HOX H;  4DR5 Q;  2VQF L;  3WDN A;  1M1K C;  2KHI A;  3KBG A;  2R7Z B;  4IUT A;  2X69 A;  2YU9 H;  3K6O A;  3NWT A;  4DK1 A;  1ML0 D;  2LXK A;  2NVQ H;  1GXD C;  1CQF A;  4ZYS A;  1FJG Q;  2F0L A;  5J22 A;  4X3K A;  1MI2 A;  1NE3 A;  2HHH L;  2H5X A;  3AYH B;  4UDU C;  4FF4 A;  4C3H G;  2MP1 A;  4JI3 Q;  3CPW A;  1F77 A;  5CV5 A;  4LUO A;  3ULJ A;  1EFW A;  3NSW A;  1DON A;  3STB D;  4DK0 A;  2BE5 C;  3LX0 A;  1LTB D;  3URY A;  1KQS A;  2Z4I A;  1F9P A;  1SLJ A;  1YHA A;  3E6Z X;  3P1H A;  1STE A;  1OXT A;  4V19 0;  3S16 B;  3Q6S A;  3QWN A;  2JA6 B;  2I5L X;  1KAA A;  4OXP A;  1HFN A;  1SN8 A;  4DAY B;  1O7I A;  2N78 A;  4B08 A;  4G7H C;  1RTO A;  2RA4 A;  1X65 A;  4X3S A;  1Q46 A;  1TII D;  1PYS B;  2XGT A;  1MKH A;  2JJQ A;  2HIX A;  4C3I H;  4PZ8 A;  5FOB B;  1DXM A;  1KTK A;  3ERO A;  5DAU A;  2N8N A;  4KJO A;  1B9M A;  1WTX A;  3J80 L;  2R93 B;  3P20 A;  3ONA B;  1YHQ A;  2IL8 A;  3CCE A;  5EPK A;  1LO5 D;  1S5B D;  3FVQ A;  4K2L A;  1BCP B;  2B2T A;  3C1F A;  1VQC A;  3EIV A;  4E6I A;  2GN5 A;  4CGY B;  3GTP H;  1G2S A;  3RN2 A;  2KEC A;  2A69 C;  1HHV A;  1PLF A;  1ZYR C;  3L7Z C;  4HSP A;  1FGB D;  3PMF A;  2JA8 H;  1XPR A;  2J4X A;  4PMW A;  3S17 H;  5EPL A;  3FHW A;  1N34 L;  4DR7 L;  3V96 A;  1V9P A;  2OTJ A;  2NN6 H;  1E2W A;  1LM0 A;  1G6P A;  4G7O C;  5DM7 3;  2EY6 A;  5JVH 3;  1EQR A;  1KHI A;  2IT1 A;  1N32 L;  4IFD I;  4BA2 I;  2SNS A;  3TQY A;  4B3M Q;  5T1G A;  5GAG C;  5BR8 L;  3PF5 A;  1MJC A;  2F0P A;  3VYU A;  3JAM c;  3D0F A;  3A7L A;  4ZRZ A;  3ZYY X;  5FKA C;  1U9R A;  1YIJ A;  4L5S A;  4AYB E;  5LHY 1;  2JSO A;  4JC0 A;  1WTV A;  3FMC A;  4LF6 Q;  1E22 A;  3J80 E;  4C3J B;  2KBN A;  3J81 i;  1Q90 A;  1QVC A;  1S4Z A;  3DUZ A;  4ZQ3 A;  3OPO A;  2RCN A;  3W1G A;  4A3K G;  1UE7 A;  2LMC B;  1HNX Q;  1BQQ T;  5C44 G;  4Q5V A;  4Q0F A;  3HOV H;  3AB9 A;  3TRZ A;  1QIL A;  4KY7 A;  3MAQ A;  3DEP A;  3K5N A;  1V1P B;  3A55 A;  5JAV A;  2EQS A;  3D31 A;  4DR3 L;  4DA2 A;  3OTO Q;  1L1O C;  2A6H C;  1I94 Q;  3OSO A;  2K52 A;  4DAM A;  4UP7 A;  1SFO H;  4MIU A;  2ZJP A;  4DR2 L;  2Q2T A;  2AKW B;  4A3J B;  2EJG C;  4JI4 Q;  3VYT A;  4NP5 A;  1SNO A;  3RR5 A;  3P7J A;  4ZAI A;  2Z8L A;  1TQO A;  4DAP A;  4DR4 L;  4C1N K;  2BOS A;  2EIF A;  1H9M A;  2LFN A;  1YZ6 A;  2HHH Q;  5KNB A;  3PV0 A;  1FNU A;  2CQO A;  3UE0 A;  1SMX A;  1NR4 A;  5A2Q E;  1XPO A;  1RCV D;  5NUC A;  3S2H B;  1O7L A;  1EIG A;  1LV9 A;  1BVS A;  4JCV E;  4CJ2 C;  1BBW A;  1JE5 A;  3KF6 B;  2ZTC A;  1XTD A;  2E2I H;  4AH6 A;  2PMZ B;  1TR5 A;  4UAI A;  4X62 L;  4QUF A;  3QJY A;  1G51 A;  4A76 A;  5M5Y H;  1I50 H;  1VQJ A;  4LF8 L;  4A3J H;  4PQX A;  1GUO A;  5I9P A;  1P8L A;  1CK1 A;  5C0X H;  1F9R A;  4O2D A;  4RGO S;  1CFM A;  4IZ8 A;  1STY A;  2VS1 A;  2EDG A;  1V1O A;  1O7Z A;  2BH8 A;  3MWY W;  5IYB H;  3BYY B;  4B3M L;  1ILQ A;  4LW1 A;  1K9M C;  4A3E H;  4K0K L;  4QGU A;  2RBM A;  1LT3 D;  2B29 A;  1MSH A;  1VQI A;  2M00 A;  3E5S A;  1II3 A;  1EQV A;  1MIU A;  1DOK A;  1UUP A;  4BA1 I;  3HOY G;  4QB4 A;  4Y52 H;  5J3B A;  2XTI A;  5JEA J;  4DUY L;  1KNE A;  3MFG A;  4YCU A;  5CV4 A;  2PNH A;  1SDF A;  4IO9 A;  3PO3 H;  2B63 H;  3A56 A;  4DV5 L;  1XMO Q;  1B53 A;  5E3F A;  3ND9 A;  3DWQ A;  5IT9 E;  2JE6 I;  3K5L A;  2WB1 B;  3H3V C;  2EYP A;  1TS4 A;  2NWG A;  1EEF D;  1RD9 D;  1D2B A;  1U4M A;  2K5N A;  4JG2 A;  3S1R H;  4LFB L;  1HQM C;  2RSN A;  1FD7 D;  2F0N A;  4OWT B;  5CV7 A;  2O2L D;  5TSS A;  3PO2 H;  1I6V C;  1I3Q B;  2F0J A;  4AYB G;  5C4X G;  1DJR D;  2B3G A;  4XQJ A;  5COY A;  4KK7 A;  3E9H A;  3DXJ C;  1X3Q A;  2HIV A;  4KHV A;  4ZUI A;  5BN3 A;  3HOY B;  4DV1 Q;  4K6D A;  3RMH A;  4A4I A;  2D62 A;  2I5M X;  3M4Y A;  5C3E H;  1SE3 A;  3M7G A;  3VR6 A;  1RTN A;  2R7Z H;  5ELN A;  2QEX A;  2NZO A;  1I4R A;  2Z0S A;  2F3V A;  1L1O A;  5DLQ E;  2J7Z A;  4ZKC B;  2YU9 B;  4R4Q A;  1BO0 A;  3QG1 A;  5LL6 X;  3WOF A;  2K5D A;  4KD3 A;  1NNX A;  1IBL Q;  1EIF A;  3A74 A;  1Q1E A;  3DWP A;  1QNU A;  3M7N A;  1B3A A;  2YTX A;  2ZM6 Q;  1IXR A;  2KEE A;  4DR2 Q;  5M3M G;  2PYK A;  1X3G A;  3A8K E;  3N52 A;  1EOV A;  3F2C A;  1YJ9 A;  4QUC A;  4IJL A;  3TME A;  1W3S A;  4LF8 Q;  1KXL A;  1WOC A;  1K8G A;  5E7N A;  5IOC A;  3L0O A;  2RF4 A;  3EQL C;  5C44 B;  3HGB A;  3TBI B;  3F2U A;  1EFI D;  4KHZ A;  1KC8 C;  2BCO A;  1A6X A;  3NBH B;  4LFC Q;  1R4Q B;  2X6L A;  2CW0 D;  4OWW B;  5H1S E;  3AFQ A;  1PMR A;  2K4K A;  1PFN A;  5M5Y B;  1JJG A;  1C4Q A;  2R92 G;  1WTQ A;  1GHJ A;  1N8R C;  1WVL A;  1YNJ C;  3DLL A;  3LWE A;  3BJU A;  4J15 A;  3EBE A;  1TXY A;  2JA7 G;  1Y1W G;  3MEF A;  3T53 B;  4N8F A;  4QIW B;  2B2U C;  3R2T A;  3PIP 3;  4JI2 Q;  4RA8 A;  2F0F A;  2EYH A;  3KBX A;  2I5H A;  1V1Q A;  4P2C B;  4BY1 H;  1DM0 B;  1Y8O B;  3PGZ A;  3CW2 C;  2F0W A;  4BY1 G;  2XRQ D;  4IPG A;  4P72 A;  1LT6 D;  2PI2 E;  2DJG C;  1Y1W B;  2A8V A;  1DZ1 A;  3GTM H;  2A73 B;  1SNM A;  4DR6 Q;  1HJP A;  2O5I C;  1STG A;  4YCW A;  3NQI A;  4LF7 Q;  3J81 j;  1N34 Q;  4DR7 Q;  2F0M A;  4KHP L;  4DV2 L;  1AZP A;  2K32 A;  3OYY A;  1TWC B;  4DV4 L;  1SYE A;  1MSG A;  4P71 A;  1HXY D;  4A3L G;  3LWU A;  2A68 D;  3J7Z C;  3I2Z A;  4KN7 C;  3A8I E;  2Z6K A;  2EJF C;  5FO9 B;  5ELF A;  3M9B A;  1U4L A;  5IIF A;  4RG1 A;  1PH9 A;  3SR1 A;  1KDB A;  5K36 H;  2B39 A;  4LWC A;  4IUR A;  4LF6 L;  3UDI A;  4JK1 C;  3SK4 A;  1P16 A;  3CXC A;  3K7A H;  1MGS A;  3I70 A;  3J7A V;  5HGQ A;  4JOI A;  1XXG A;  2O4X A;  3H0G B;  2R3Z A;  4HMJ A;  4DV7 L;  4CKE A;  2SEB D;  1X3E A;  3GTJ B;  1BKB A;  2MJ8 A;  5M5X B;  1SEB D;  2RDH A;  1J5E Q;  4PZ7 A;  1CKN A;  1TWH H;  3CHB D;  1PTO B;  4LJZ C;  2EYO A;  3NTH A;  4JW0 A;  3TP6 A;  2BA0 A;  2HT1 A;  3GV6 A;  2LKV A;  2K04 A;  3J80 c;  1GUS A;  1JWS D;  5G3L F;  5M5W H;  3OTO L;  4FF2 A;  2NVT H;  3HOW B;  5CV8 A;  3RZD H;  5IGE A;  1SYD A;  2F0G A;  5IGB A;  1VQE A;  1C48 A;  2JA9 A;  2Q2I A;  3OW2 A;  3ULL A;  4POF A;  3J81 E;  3T1H L;  4JI4 L;  2NYZ D;  1MHW C;  3JAM E;  4K6L A;  1R9T B;  3SDZ A;  1CSP A;  4TQU S;  3F1Z A;  1CSQ A;  3S2H H;  1CKN B;  4DAY A;  5AJ3 L;  1PXU A;  5CV6 A;  2FXQ A;  1A0I A;  2GVA A;  3H3V I;  3HKS A;  1CQV A;  4RHS A;  2MNA A;  2FMC A;  4HJ7 A;  3FRP B;  3HKZ G;  3M3Y H;  4HIM A;  2Q8T A;  4A93 G;  2B63 G;  4DNT B;  1KL9 A;  4A3G G;  2PMZ E;  4LF9 L;  3SGI A;  2Y0S G;  1GHK A;  2E74 C;  3ZJY C;  2F4I A;  2WP8 J;  3M3Y B;  2TSS A;  1IW7 D;  4XYO A;  1HFG A;  1M4V A;  2M2L A;  2ZT9 C;  5LMU L;  2EZV A;  1XWE A;  4A3E B;  3MXU A;  1SE4 A;  3TP5 A;  1PTO H;  1PZJ D;  4LFC L;  2Z4H A;  2D2C C;  2RKS A;  1EWH A;  4WFN 3;  2XN9 C;  1VMC A;  3KJO A;  2HDM A;  4RHR A;  3BZD B;  2B8G A;  4LF7 L;  1YVC A;  3GD7 A;  5FO8 B;  2YTV A;  1R4P B;  4C2M B;  4G7Z C;  4DV0 Q;  3K80 C;  4RKB A;  1LYL A;  5I6Y A;  3SVM A;  4A3E G;  3BVZ A;  3PCO B;  4JV5 L;  3DMU A;  4XQQ A;  3DEO A;  4WOR A;  1PTO F;  1SJH D;  1ASZ A;  3OIP A;  3BS1 A;  1PH1 A;  1PH4 A;  2D9U A;  4QY7 A;  4OO1 I;  3K0X A;  4O1N A;  3K8A A;  4HTH A;  4PZ6 A;  4GKJ Q;  1XMO L;  1UAP A;  4NXM Q;  4L5Q A;  1J9O A;  2WKC A;  1VQ7 A;  2E2H B;  4XT3 B;  3PQI A;  1L2F A;  1IBM L;  3QOJ A;  2F3W A;  2K03 A;  2Z6K C;  3NEN A;  3PO2 B;  4LFB Q;  1D1I A;  3WOE A;  5I4D A;  2ZTD A;  5E4X A;  2PO4 A;  4DV4 Q;  1YJW A;  1X32 A;  5D65 A;  1CT1 D;  1HPC A;  4R4O A;  4CDE C;  5EQ0 A;  4C2M H;  3I8Z A;  1L0Y B;  1TWA H;  2EVB A;  1VF5 C;  5EBC A;  3T1H Q;  3EA6 A;  1HCZ A;  5EAY A;  5M3F B;  2VQF Q;  5E1F A;  5M5X H;  4A3M B;  1KDA A;  1VQP A;  4IPD A;  2AQ3 B;  3SK6 A;  4ALP A;  3GTM B;  2OQ0 A;  4EQP A;  3CCM A;  4IPC A;  5GRO A;  4XYQ A;  2A6H D;  1TVX A;  1STA A;  4DFA A;  1QWY A;  3Q8D A;  1E1O A;  4WJW A;  2ICI A;  3HOZ H;  4GNX A;  2WAQ G;  1WTH A;  1AFP A;  1IBL L;  1RL2 A;  1U5K A;  5EKK A;  5C44 H;  3OWF A;  2N49 A;  1N36 Q;  2UUB Q;  4DK3 C;  2KCC A;  2WB1 E;  3E0J A;  2AUK A;  2ATW A;  1PH3 A;  3VR2 A;  5EJW A;  1K83 B;  5HGT A;  3CPF A;  2L11 A;  1GM5 A;  1YEZ A;  3KF8 B;  4C3J G;  4DV6 Q;  3JAM i;  4A3C H;  1FVI A;  4G4K A;  2CHB D;  5JJZ A;  4CHT B;  1NMG A;  5IP9 H;  4GOP B;  4DU9 A;  3GTK H;  2JA8 B;  5GQO A;  1BOS A;  3OWE B;  4PG3 A;  2WB1 G;  2IJ0 A;  2Z9H A;  1IL2 A;  3GO5 A;  3STB C;  3NTK A;  2A74 C;  4L6T B;  4KJN A;  1Y8N B;  4GZY C;  4EQ5 A;  4LF9 Q;  2EYL A;  5AFW A;  3K59 A;  1JJ2 A;  4IN3 A;  2JXM B;  4CJ1 B;  5I9O A;  3KLW A;  2OT2 A;  4GOP C;  5JVG 3;  1A62 A;  3BU2 A;  2UXB L;  1TKW B;  5LMU Q;  2WII B;  1QE6 A;  3PUW A;  5C6A A;  4X65 L;  5GAH C;  3Q24 A;  4LUV A;  3S14 B;  4NB3 A;  4JI2 L;  1HH2 P;  2VUM H;  4N9P A;  1WTW A;  3D3R A;  4JBK A;  1CA5 A;  3I72 A;  3I56 A;  2R92 B;  4IUP A;  2OEO A;  2DY7 A;  1SYB A;  2RHS B;  5G3L D;  4ZK9 B;  2XRS D;  5IYB G;  4OIK A;  1Y1V B;  3NE5 B;  1WTR A;  3LGJ A;  4DV0 L;  1N9W A;  2DNE A;  5C3E G;  2A1A A;  2EYF A;  5IE8 A;  1U4R A;  3ND8 A;  2G5D A;  1Q86 C;  1TWG H;  3EN2 A;  4L5T A;  2HQL A;  2L5T A;  2VUM B;  2QDL A;  1EOT A;  1YJN A;  4NW2 A;  1PA6 A;  3SHL A;  2PZT A;  3F8T A;  1KAB A;  5KYL A;  1OO9 B;  3D4W A;  1OXV A;  3UDG A;  3J7A F;  4K2K A;  4A93 H;  2PNR C;  2KUM A;  2OXP A;  4K8J A;  4NXM L;  4HID A;  2QEJ C;  2EYM A;  5KND A;  2ZJQ A;  2FHT A;  2K5H A;  1QVF A;  1AE3 A;  2CH4 A;  3BZK A;  1VMP A;  4FO2 A;  3GTJ H;  4HCE A;  1EQT A;  2FJ2 A;  4K5V A;  1HNX L;  4QF4 A;  3CQZ B;  4C3H H;  3HKZ E;  1QZH A;  3S1M B;  2F0U A;  2JK8 A;  1BCP C;  3W3A A;  1B2T A;  1SNQ A;  1N36 L;  1PYW D;  4IAL A;  3NPP A;  3CD6 A;  1EWC A;  2JEB I;  4A3J G;  1JT8 A;  1OXX K;  1M90 C;  2NZH A;  2BA1 A;  4H02 A;  1BNZ A;  5GAE C;  3C3L A;  4BBS G;  3HOW H;  2UU9 Q;  5F2D A;  2C5C A;  4TVA B;  2PPB C;  1UEA B;  3MA2 B;  4DV6 L;  4KN4 C;  5IGD A;  3V05 A;  4GNX C;  5IYC H;  1I4P A;  4DR4 Q;  3JC6 6;  4HJ5 A;  2AUJ D;  2OQK A;  2RHQ B;  3VR4 A;  3MXP A;  5C0X I;  1ENC A;  1AN8 A;  2B8F A;  3PIO 3;  3Q23 A;  2PI2 A;  4A3B H;  3GTO H;  2XVS A;  3F2D A;  3CF5 A;  2HCI A;  1H9K A;  5FLM H;  1Y8P B;  1LTT D;  1AH9 A;  2UUB L;  3ERS X;  1GVP A;  1QB5 D;  1HRJ A;  1EY0 A;  3K5M A;  4CJ0 B;  2E2I B;  3UI2 A;  3MXN A;  4F7X A;  1QG7 A;  3MXG A;  2UXB Q;  2E2D C;  3BZC A;  4A3F G;  1ZKO A;  1EIH A;  4X62 Q;  3C46 A;  2EYJ A;  2K5Q A;  4DKA C;  1RDP D;  1J8I A;  5JJL A;  3I4N H;  2G9H D;  2B2Y C;  2ZXP A;  1FGU A;  5ELC A;  3R8B A;  4KD4 A;  3JAM L;  1ICW A;  4B3S Q;  2DNC A;  1PHJ A;  1C9O A;  2A19 A;  3X3M A;  4Z9C B;  3GTG H;  4DUZ Q;  2KHJ A;  2QGQ A;  2L9H A;  4K0K Q;  5A35 A;  1B4O A;  2GVB A;  3E3X A;  3T4A C;  1TY2 A;  3K57 A;  4IOC A;  4IPH A;  4TKO B;  1DGS A;  4DUY Q;  1K83 H;  3M4O H;  4QCL A;  1QUQ B;  1SYC A;  4J6H A;  2BDN A;  4O42 A;  3U9S A;  4DV5 Q;  4LFA L;  2HCC A;  3KUP A;  1G6Z A;  1XPU A;  2WIN B;  4OL7 A;  2E75 C;  2L55 A;  2ENB A;  4KMU C;  2F0H A;  2MHV A;  3CMA A;  4WJ3 M;  4P75 A;  4DR1 Q;  2L1B A;  3GV3 A;  5CBE E;  4XDX A;  5KIX A;  1LTI D;  1QJO A;  1GD7 A;  3HEJ A;  2PW7 A;  4R8I A;  3PF4 A;  5FLX E;  3TEH B;  3GTP B;  1N33 Q;  2Q8R E;  3T16 A;  3U50 C;  2OWO A;  3HRZ C;  2OTL A;  1EEI D;  5CMD A;  4A3D B;  3GTL H;  3EJI A;  3RUZ A;  1QCB D;  3W2D A;  1SND A;  1NMF A;  3RZO B;  1HTP A;  3QO2 A;  4P73 A;  3GDE A;  5IGG A;  1TY0 A;  1I4G A;  4HED A;  5DNF A;  4KY6 A;  2EY5 A;  1PRT F;  2EOT A;  1EY8 A;  4G57 A;  1ROD A;  4RCN A;  1GOZ A;  2I0Q A;  1SMY D;  1VQN A;  2F4V L;  1YIT A;  5I6W A;  1TS5 A;  2A68 C;  2LS0 1;  1Y69 U;  2JA7 H;  2K5V A;  1VQ4 A;  3J81 c;  3G6E A;  1LTG D;  1H9S B;  1LT4 D;  4IFD J;  4LAA A;  3MTS A;  1SRU A;  2ZM6 L;  3HOV G;  4FF1 A;  4RAU C;  3M4O B;  3SXH A;  4ILW A;  2WFW A;  4IUU A;  2Q8I B;  4ZUJ A;  2JA5 G;  2Y0S B;  1EU3 A;  4ME3 A;  1IYJ B;  3CKI B;  2KCN A;  1HZA A;  4ULL A;  4A93 B;  2MO0 A;  2R7F A;  4LF5 L;  3IRB A;  1JCK B;  3A7A B;  1B9N A;  2IY5 B;  2AWN A;  2KA7 A;  3MEH A;  2WAQ E;  3MFY A;  1VQ9 A;  2E76 C;  1TWA B;  1Z7T A;  1CA6 A;  1LAB A;  1WCM B;  5C3X A;  2IX0 A;  1SFO B;  1IW7 C;  3S16 H;  3ER0 A;  4OWX B;  4MN3 A;  3B6Y A;  4EX5 A;  4JI5 Q;  1HQR D;  1EU4 A;  1A8V A;  2B2W A;  4DGZ A;  2AMC B;  2F0T A;  4I65 A;  4A3F H;  1CTM A;  4LFA Q;  3TRE A;  4OEL B;  1VF7 A;  1EY4 A;  3OMG A;  2K14 A;  1HNW Q;  3EFX D;  4KTA A;  3AFP A;  4YWK A;  3MXN B;  4OO1 G;  2PQA A;  3CCR A;  1KRS A;  2K5W A;  4P74 A;  1O7Y A;  1JB7 A;  1CKO A;  2CWA A;  4YIJ A;  4X65 Q;  1LTL A;  4OON A;  3U58 A;  1GKH A;  1T9H A;  3PUX A;  2K7V A;  2ZXR A;  4B3S L;  3GTQ H;  1VQG A;  5JPM C;  2F0V A;  5JPN C;  2KQ3 A;  4DUZ L;  2NTS A;  3KLS A;  2JA5 H;  1S40 A;  4DR6 L;  4HCS A;  3HOX B;  2GA4 B;  2NTT A;  4QJF A;  5CC4 A;  5C4J H;  5HUR A;  4OGQ C;  4KHP Q;  1HUN A;  2YTY A;  5EGT A;  2MUY A;  2JA6 G;  3S1Q B;  1CZG A;  5C4X B;  2VZA A;  2HDL A;  3I4M H;  5M5W B;  3A54 A;  3PUY A;  2G9D A;  1FL0 A;  3TN2 A;  3ICE A;  4LF4 L;  2N3S A;  3RLF A;  3I3C A;  4YWL A;  3VR5 A;  1VQ6 A;  3R93 A;  1KLU D;  2RSO A;  3CQZ H;  2NZ1 D;  4C3H B;  2CCZ A;  1WI5 A;  4B9X A;  1MD2 D;  1LTA D;  1OXS C;  1XNQ L;  3H0G H;  4BY7 G;  3CRL C;  3KDF B;  4DR1 L;  2NVQ B;  4BS9 A;  3NEL A;  1GUT A;  3CCV A;  1V1P A;  3H0G G;  1D5X C;  1X6O A;  1PRT B;  1ESR A;  4FXD A;  1JWU D;  1D1K A;  3EVQ A;  1STB A;  3G48 A;  4OX9 L;  4DF7 A;  4NXN Q;  4HMI A;  3LNN A;  3L3O C;  1U4P A;  4QQB X;  1S5F D;  1F2M A;  1UE1 A;  3CU7 A;  1Q8K A;  1CUK A;  4HJ9 A;  1UE6 A;  4FXG C;  3KLR A;  3UDF A;  2RCF A;  4JBJ A;  3BYT B;  5IY0 A;  1WD0 A;  1HZ9 A;  2HD3 A;  1E3P A;  4CBV A;  3GTO B;  3CC7 A;  1TWG B;  3F2B A;  2DJF C;  1F2Y A;  1CKM A;  1RIP A;  1YHB A;  1XJV A;  2AQ2 B;  4RGT A;  3GTK B;  5ELB A;  4I7Z C;  1EUJ A;  4TRD A;  3H3V H;  2XNA C;  2JA6 H;  1QOH A;  4A75 A;  3PIO A;  1V43 A;  3HOV B;  2R92 H;  4R1J A;  3PSI A;  3HP3 A;  4A3B G;  3H15 A;  1KD1 C;  2PZW A;  4ZLT F;  4CDC C;  3IFD A;  1BF4 A;  3PUV A;  2E2H H;  3FDT A;  3HOZ G;  1A3U A;  1AW7 A;  4BBS B;  1Q81 C;  2K05 A;  5A2Q L;  2R93 H;  4LF5 Q;  1S5C D;  2FFK B;  3I4N G;  2Q2H A;  2E5L Q;  1VQL A;  3S24 A;  2F0S A;  1CZW A;  2R7D A;  1X3F A;  1JOQ A;  1A15 A;  1CHP D;  3FKI B;  3IL8 A;  2K6A A;  3D4D A;  3S17 B;  4HAE A;  3H91 A;  5IWA Q;  3R2I A;  2ZXO A;  4NPS A;  3I90 A;  1B1Z A;  1O80 A;  2H4O A;  2K28 A;  3ERQ A;  1SRO A;  4A3L H;  1VQH A;  1X56 A;  4F87 A;  4JV5 Q;  1HR0 L;  2OCE A;  1PRT D;  3OIQ A;  3OMC A;  1Y1V H;  2HUG A;  4WJ4 A;  3IKJ A;  3RN5 A;  1C7Y A;  4UHV A;  5BN4 A;  2K50 A;  2L4N A;  2QKI C;  3HZX A;  4JI8 Q;  1XX8 A;  4PNY A;  4A3K B;  1BUV T;  2VUM G;  4C56 C;  1NUC A;  2SOB A;  4MHE A;  1XMQ Q;  4POG A;  4GKJ L;  2MO1 A;  1SAP A;  4C3I B;  5L37 A;  2L0C A;  1XNR Q;  1WTP A;  1TU2 B;  3BVM A;  1B3Q A;  4YHH L;  1BXT A;  4FNF A;  2XSC A;  3KYH C;  1IHZ A;  1Q12 A;  1YNN D;  1F9Q A;  1QNK A;  3NEM A;  4BWG B;  3HOW G;  1A63 A;  5E4W C;  2PCF B;  3K58 A;  4OX9 Q;  1Q8I A;  4NXN L;  2A5H A;  2EY1 A;  1A3V A;  1BR9 A;  3KK7 A;  2QDB A;  1VQ5 A;  2VXW A;  4PMC A;  2UUC L;  1M8A A;  1WCM G;  1NR2 A;  2F0O A;  1PV4 A;  3HOY H;  4APV A;  1E24 A;  3K5O A;  4FF3 A;  4X66 L;  2V4D A;  3NBH A;  4CDD C;  2D5D A;  3GTG B;  1VQF A;  3N6R A;  4K14 A;  4ZKB B;  2L12 A;  3BVG A;  3W1B A;  1WTO A;  1F2Z A;  2D0O A;  2QF7 A;  2VL6 A;  3SK8 A;  3C1E A;  3FPP A;  2UUA Q;  4JI1 L;  2KOL A;  3S1N H;  2KED A;  2XIW A;  3QOL A;  1B8A A;  2A6E C;  2ICE C;  2ASB A;  4QIW E;  1EWI A;  2TMP A;  1EY9 A;  1X3P A;  1SNC A;  4UPA A;  4A3G B;  3WWV A;  1D7Q A;  2B63 B;  5C0X J;  3RD4 A;  3BDO A;  1I4H A;  4LMQ D;  2EY2 A;  2QW7 A;  4LNQ A;  1I4Q A;  2KEN A;  4BBR G;  1A2T A;  1D5Z C;  1X55 A;  3NUC A;  1PH7 A;  2BH2 A;  1T5X D;  3HS0 C;  1TWF B;  4XQN A;  4FYD A;  1ZYR D;  1HR0 W;  4U68 A;  5M3F H;  4UP9 A;  2WAQ B;  5JEA H;  1EYD A;  5IWA L;  3I7F A;  3QB3 A;  1WCM H;  1GO3 E;  4WRD A;  4MTN A;  5I2Y A;  3CCL A;  1ONL A;  2B2U A;  1OXU A;  1VQD A;  1S5D D;  4N9T A;  5C4H A;  5D14 A;  4B9W A;  1VQO A;  5LMN W;  5IGF A;  5C4J B;  4CKC A;  1UE5 A;  2ID0 A;  5J1Z A;  3M4Q A;  2KJX A;  4Y7N H;  1YBY A;  4EQN A;  1E0B A;  2N55 A;  4UP8 A;  1WFQ A;  4RCO A;  1JQY D;  3FEW X;  3KJP A;  1PTO C;  3KFU A;  2E5L L;  3GTQ B;  3IFT A;  4EVO A;  5D3D A;  1HNW L;  4YHH Q;  4H44 C;  3PO2 G;  1PFS A;  3T13 A;  2KCT A;  2UXD Q;  5C3E B;  3A5U A;  4HIO A;  1VQ8 A;  1PDQ A;  2MQH A;  5C5L A;  3NQT A;  1SR3 A;  4GLA C;  4FXK C;  2UUC Q;  5C3W A;  2D0P A;  4FP5 D;  5LL6 S;  3S2D B;  2ZTE A;  5DM6 3;  3FKI G;  4A3D H;  5IYC G;  3D8G A;  1JOO A;  1SE2 A;  2V1C C;  1E1T A;  1D5M C;  3E9I A;  1NBW A;  3G71 A;  2FIN B;  1QZG A;  1EY7 A;  1K8O A;  1G8Z D;  1XTC D;  2BE5 D;  5EBD A;  1TWH B;  1V8Q A;  4RH6 A;  3M85 A;  1SXT A;  2M9V A;  1B70 B;  4JOI C;  1PVO A;  1ZEQ X;  3KDF A;  4MTK A;  1DD2 A;  2UUA L;  1GUG A;  1PH8 A;  2PQA B;  4H13 C;  2IPK D;  4PMB A;  2BDO A;  2VNU D;  1H9J A;  4U67 3;  3CRK C;  2X6G A;  4EGV A;  2IHE A;  4XTC S;  1PH6 A;  3TP7 A;  4BY7 H;  3QIA A;  1PFB A;  3PO3 B;  1K0S A;  1E7Z A;  3GQB A;  1VDZ A;  3T1Y Q;  4JI7 L;  1IZ6 A;  2JA8 G;  1IKM A;  4JI6 L;  4BY7 B;  4UY8 C;  2CKZ B;  3KF6 A;  3KOJ A;  4HJA A;  1S5E D;  4FDB A;  3C2P A;  2K33 A;  2IX3 A;  4X66 Q;  4JPB W;  1VS0 A;  2UU9 L;  3J80 i;  2JYO A;  3TS2 A;  1JOR A;  1ENA A;  1QUQ A;  1ET9 A;  3GP7 A;  4IUN A;  1BCP F;  3O13 A;  3H94 A;  3T56 B;  4N8X 1;  2K1B A;  2VB2 X;  4H0L C;  4HR7 B;  1GUN A;  1YNX A;  1SYF A;  3NWS A;  3AQQ A;  2RVL A;  5DEH A;  4JBW A;  4KI0 A;  3S1Q H;  1ILP A;  2A69 D;  4CKB A;  1EY6 A;  2J0T D;  4R9W A;  1FNW A;  5JJI A;  3I4O A;  1SE8 A;  2NVT B;  1H95 A;  1GJX A;  2I46 A;  2UXC L;  4NDX A;  4OO1 H;  5IOD A;  1HZB A;  1G2T A;  4AQY L;  3H09 A;  2VW9 A;  1GUW A;  4KKT A;  3S1M H;  3MC0 B;  2F0Q A;  4R4C A;  5IP7 H;  4R8N A;  1STN A;  1AEX A;  4DNR B;  1A3T A;  1E2V A;  3U4Z A;  1EL0 A;  4MNO A;  2R93 G;  2QIL A;  4DN4 M;  2ES2 A;  1BDO A;  1I5F A;  2A6E D;  2DY8 A;  3TSS A;  2E2J H;  2MGS A;  4A3C G;  2C9O A;  1PZI D;  3TS0 A;  1UWV A;  2O5J C;  2Z1C A;  5ISR A;  5IP9 G;  4NKL A;  1IKL A;  3A0J A;  2Z6B A;  3HOX G;  1K0R A;  3H6M A;  3S1N B;  1JJC B;  2B2V C;  3PIP A;  4BXX H;  1FYC A;  2EE1 A;  3CAM A;  1I50 B;  1PZK D;  4L63 B;  3CCQ A;  1HTL D;  5FJ8 H;  5IGC A;  1T5E A;  3G6J B;  3HOU G;  3HG9 A;  5LMN Q;  4C1N I;  1X9N A;  4HN7 A;  1HR0 Q;  1JOK A;  4S3S A;  4AIM A;  2NVX H;  2JEA I;  1I4X A;  3HOU H;  1EQQ A;  1LTS D;  1NY4 A;  3NXW A;  4KY5 A;  1IL8 A;  5C4X H;  4JI0 L;  1LTR D;  2RQX A;  2EPB A;  2NN6 I;  2OF1 A;  2F52 A;  1XMQ L;  2RDF A;  3VA7 A;  1PYB A;  1TT2 A;  3T1Y L;  4DPG A;  3RLO A;  1OTC A;  1HNZ L;  3CC2 A;  1CM9 A;  1KAW A;  3A5Z B;  1NSN S;  3HOZ B;  1N33 L;  2SDF A;  1CI3 M;  1IYU A;  3D6C A;  1YNN C;  4F88 A;  1S3O A;  3K81 C;  4HSV A;  1QVG A;  4FVM A;  1VQM A;  1ET6 A;  4LK1 C;  2PQE A;  3RZO H;  5IT9 c;  3R3O A;  4X3U A;  3I55 A;  1B50 A;  3AMU A;  2R6G A;  4A3K H;  3MVV A;  5JJK A;  3CCU A;  2K75 A;  4BXX G;  3D4R A;  3S15 H;  3SK5 A;  4GS3 A;  5KNC A;  1J6Q A;  1NJI C;  3HKZ B;  2F4V Q;  4IFD G;  5FJ8 G;  4KKS A;  1KNA A;  5IT9 L;  2EXZ A;  4JI1 Q;  3TZU A;  5GAD C;  4JI6 Q;  5CGK A;  4DV3 L;  1PH5 A;  4DAV A;  1SJE D;  1JE4 A;  4M1U B;  3UE1 A;  4C3J H;  4GN5 A;  4GN3 B;  1XYI A;  4R4I A;  5KYI A;  2F3I A;  1L1O B;  4JVZ A;  4KLK A;  5KEE A;  1AE2 A;  1HZC A;  4GNX B;  1UNS A;  5T1I A;  3Q0A A;  1RHP A;  1ASY A;  4BBS H;  3FPU B;  2EXD A;  1U0L A;  5CR3 A;  4K5W A;  2F0E A;  1H9R A;  1BBU A;  1X54 A;  1WD1 A;  1DCZ A;  3OHX C;  1K3B C;  5JEA G;  1LAC A;  2YYZ A;  1D6E C;  5K5P A;  1HUM A;  2NB0 A;  1BBX C;  3VDY A;  2MPM A;  2UXC Q;  2JQO A;  2N88 A;  2LXJ A;  4AQY Q;  2E8G A;  1S72 A;  2AQ1 B;  4GOP A;  1SYG A;  1LUZ A;  1VQK A;  4ODG A;  4V0B A;  4PV1 C;  4JI5 L;  1D8L A;  3HFZ B;  4RGM A;  1I3Q H;  3T51 B;  4XT1 B;  4XIG S;  3ULP A;  1E2Z A;  1K73 C;  3W5O A;  4O0A A;  4A3I B;  3I73 A;  3S1R B;  3K7U C;  3DM1 A;  1PFM A;  3NTI A;  1MBY A;  1YNJ D;  2WAC A;  2NVY B;  3V2T A;  2B2V A;  3NP8 A;  4DK6 C;  2VY3 A;  1FNV A;  4I7A A;  5J39 A;  2I07 B;  1JIC A;  4GN4 B;  1O78 A;  3U4V A;  4JYA Q;  1HNZ Q;  1W6K A;  4OEM B;  3AU7 A;  2UXD L;  4ZCK A;  1BCP D;  3FP9 A;  1FJG L;  2KHS A;  5FLX c;  1KLG D;  4XXE A;  1DYQ A;  3PO3 G;  2NVY H;  1WJJ A;  3DHQ A;  1I6H H;  4TSS A;  4A3M H;  3L2P A;  2QA4 A;  2R61 A;  1IYV A;  1ESF A;  4LF4 Q;  3OW7 A;  4OHJ A;  1JB3 A;  2QCP X;  1EZ6 A;  3IAY A;  1LT5 D;  1Y1W H;  3CME A;  5BN5 A;  4RWS C;  3J81 L;  1ENF A;  5EKI A;  1XNQ Q;  2CH4 W;  3S14 H;  5ELO A;  3SEB A;  5IP7 G;  2VQE L;  3RZD B;  1PRT C;  2K01 A;  5C0X G;  2LY7 A;  1IBK L;  3CC4 A;  1WYD A;  4KKU A;  3I4L A;  1B44 D;  3E0E A;  2JA5 B;  3K0Y A;  1DOL A;  1AZQ A;  3CP0 A;  4H7B A;  2ZJR A;  4JI7 Q;  3NK9 A;  2F0D A;  1KRT A;  5IYD H;  3X3N A;  4C3I G;  1VQA A;  1HA5 A;  2E2J B;  2Q2U A;  4RKL A;  2IW3 A;  5IYD G;  3I4M G;  4X64 Q;  1MJE A;  3Q22 A;  3I91 A;  5CBA E;  1FR3 A;  1Q1B A;  3BDL A;  2NVX B;  4ABN A;  2WKD A;  5D3I B;  4KV6 A;  1EY5 A;  5M3M B;  1KIX A;  4CDF C;  3I4M B;  1YI2 A;  3SE0 A;  3VYS A;  1EZ8 A;  2YV5 A;  5ELE A;  4GLX A;  3ITP A;  4GKK L;  1Y1V G;  1JR0 D;  2CWP A;  3MZ5 A;  1CHQ D;  2NBF A;  4YY3 Q;  4QL5 A;  3AEV A;  2CVR A;  5FLX L;  1NAP A;  2IHF A;  1N32 Q;  1Z9F A;  2NN6 G;  2Y0S E;  2B2Y A;  3A8J E;  2FMM A;  3DM3 A;  5BR8 Q;  1W6J A;  2NUC A;  5COR A;  2RDG A;  1F9S A;  2KVM A;  2ALY B;  4DV2 Q;  4X6A H;  2MFI A;  3BDC A;  3CCS A;  1PH2 A;  1KDC A;  2CFM A;  4GLV B;  2R7Z G;  4RMF A;  1RKN A;  4JYA L;  5HY6 A;  3U9O A;  4RGN A;  2L15 A;  4K5X A;  4AYB B;  1Q7Y C;  1R9T H;  3VR3 A;  2AWO A;  1TWC H;  1K3R A;  4B3R L;  4DR5 L;  1JC7 A;  1PTO D;  4EQO A;  1G29 1;  2XWJ B;  4DV7 Q;  3HOU B;  1TS3 A;  1Q82 C;  4RFB A;  1J5E L;  4JI8 L;  5I2X A;  2C35 B;  4JI3 L;  3GTL B;  3QR8 A;  5LMN L;  4BY1 B; 
#chains in the Genus database with same CATH homology
 4DKA C;  1YJ9 A;  3PUZ A;  4IJL A;  5JJL A;  1XNR L;  1W3S A;  3I4N H;  1HNW L;  3J7A 5;  4LF8 Q;  1KXL A;  1WOC A;  4R4T A;  4YHH Q;  5E7N A;  1K8G A;  1UEB A;  3PO2 G;  3L0O A;  1PFS A;  4JI0 Q;  2RF4 A;  2KCT A;  1FGU A;  2UXD Q;  4B3T L;  4KHZ A;  3A5U A;  4B3S Q;  4HIO A;  1KC8 C;  1VQ8 A;  1PHJ A;  1C9O A;  2MQH A;  2A19 A;  3NBH B;  4LFC Q;  1SR3 A;  4GLA C;  4DUZ Q;  1K8A C;  3GTG H;  3FKI H;  4A3D G;  2KHJ A;  2UUC Q;  2QGQ A;  4OWW B;  2D0P A;  5H1S E;  3AFQ A;  4K0K Q;  2GVB A;  2K4K A;  2ZTE A;  4A3M G;  4X64 L;  1JJG A;  3FKI G;  4A3D H;  5IYC G;  5AJ3 Q;  3M4P A;  2R92 G;  5M3F G;  2V1C C;  1E1T A;  4MZ9 A;  5K36 G;  1N8R C;  3E9I A;  1NBW A;  3G71 A;  4IPH A;  3DLL A;  4IOC A;  4L5R C;  1DGS A;  4DUY Q;  3BJU A;  1QZG A;  2IX1 A;  1K83 H;  1VQB A;  4J15 A;  3EBE A;  1TXY A;  3M4O H;  2JA7 G;  1Y1W G;  3MEF A;  3M85 A;  1QUQ B;  4DV5 Q;  1B70 B;  4JOI C;  4A3I H;  4LFA L;  1PVO A;  3KDF A;  2VQE Q;  4JI2 Q;  3G4S A;  2UUA L;  1XPU A;  5FLM G;  2PQA B;  1PH8 A;  2VNU D;  4A3I G;  4GKK Q;  1IBK Q;  1Z47 A;  3RLN A;  2I5H A;  1V1Q A;  3RNU A;  4BY1 H;  2IHE A;  3CCJ A;  3PGZ A;  4XTC S;  1PH6 A;  4BY7 H;  2DUD A;  3S2D H;  3CW2 C;  4HJ8 A;  3CMA A;  4WJ3 M;  4P75 A;  4BY1 G;  2LSS A;  4DR1 Q;  1E7Z A;  1NTG A;  3T1Y Q;  4JI7 L;  4IPG A;  5M3M H;  4P72 A;  1IZ6 A;  2PI2 E;  2A8V A;  4IJH A;  1VCI A;  2JA8 G;  3GTM H;  2DGY A;  4JI6 L;  1GD7 A;  4UY8 C;  4DR6 Q;  2CKZ B;  2KCM A;  3PF4 A;  1HJP A;  3KF6 A;  3KOJ A;  4DV3 Q;  4HJA A;  4YCW A;  3TEH B;  4FDB A;  4LF7 Q;  4X66 Q;  3J81 j;  1EYG A;  1N33 Q;  1VS0 A;  1N34 Q;  3U50 C;  4LUZ A;  2OWO A;  4DV2 L;  4HIK A;  2UU9 L;  2OTL A;  3J80 i;  4JBM A;  3UDX A;  3TS2 A;  3OYY A;  4DV4 L;  1QUQ A;  4P71 A;  4A3L G;  3GTL H;  3J7Z C;  3I2Z A;  4YCV A;  2Z6K A;  2AHO B;  1YNX A;  1NMF A;  4P73 A;  3GDE A;  3AQQ A;  3M9B A;  4B3R Q;  4JBW A;  4KI0 A;  4RG1 A;  3S1Q H;  1PH9 A;  4LWC A;  4YY3 L;  4LF6 L;  4A3G H;  3UDI A;  5JJI A;  3I4O A;  1EIY B;  2I0Q A;  1P16 A;  1SE8 A;  1VQN A;  3CXC A;  3K7A H;  1YIT A;  2E5L L;  2F4V L;  1H95 A;  5HGQ A;  2JA7 H;  2K5V A;  4JOI A;  3J81 c;  1VQ4 A;  1Y14 B;  3G6E A;  2UXC L;  4DV7 L;  1HZB A;  1L0W A;  1X3E A;  4AQY L;  4IFD J;  1C0A A;  1SRU A;  2ZM6 L;  1BKB A;  1W2B A;  3HOV G;  1J5E Q;  1IBM Q;  4PZ7 A;  2VW9 A;  1CKN A;  1TWH H;  1JMC A;  3S1M H;  1TWF H;  2BA0 A;  4R4C A;  5IP7 H;  2HT1 A;  2WFW A;  4DR3 Q;  3J80 c;  2JA5 G;  3U4Z A;  5M5W H;  4BBR H;  3OTO L;  2NVT H;  1I94 L;  4ME3 A;  4DV1 L;  4IOA A;  3RZD H;  1IYJ B;  4MNO A;  2R93 G;  1HZA A;  2ES2 A;  1I5F A;  2MO0 A;  4DNI A;  1VQE A;  2R7F A;  2JA9 A;  2Q2I A;  4LF5 L;  3OW2 A;  3ULL A;  4POF A;  4JI4 L;  3T1H L;  3IRB A;  2E2J H;  4B3T Q;  1B7Y B;  4A3C G;  4YWM A;  3HOX H;  4DR5 Q;  2VQF L;  3TS0 A;  1UWV A;  2IY5 B;  2AWN A;  5IP9 G;  1M1K C;  2KHI A;  1CSP A;  2WAQ E;  4TQU S;  3A0J A;  3F1Z A;  3HOX G;  2YU9 H;  1CSQ A;  3S2H H;  1VQ9 A;  1K0R A;  1CKN B;  2NVQ H;  2LXK A;  1JJC B;  5AJ3 L;  3PIP A;  4BXX H;  1FJG Q;  2FXQ A;  1A0I A;  1NE3 A;  2GVA A;  2IX0 A;  2HHH L;  2H5X A;  3H3V I;  3HKS A;  3AYH B;  3ER0 A;  2MNA A;  3S16 H;  4KHP L;  4OWX B;  3CAM A;  3B6Y A;  4EX5 A;  4HJ7 A;  3CCQ A;  4JI5 Q;  3HKZ G;  3M3Y H;  4HIM A;  5FJ8 H;  4A93 G;  1A8V A;  2B63 G;  4JI3 Q;  3HOU G;  1KL9 A;  5LMN Q;  4A3G G;  2AMC B;  3CPW A;  2PMZ E;  1X9N A;  4A3F H;  4LFA Q;  3TRE A;  1HR0 Q;  4LUO A;  3ULJ A;  4AIM A;  1EFW A;  4LF9 L;  3SGI A;  2NVX H;  2JEA I;  3HOU H;  2Y0S G;  3STB D;  1EQQ A;  2K14 A;  1HNW Q;  1KQS A;  3ZJY C;  1NY4 A;  2WP8 J;  3AFP A;  4YWK A;  3MXN B;  5C4X H;  1SLJ A;  2PQA A;  3CCR A;  1KRS A;  1YHA A;  4JI0 L;  4OO1 G;  4P74 A;  1JB7 A;  1OXT A;  1CKO A;  2CWA A;  5LMU L;  2NN6 I;  2F52 A;  4X65 Q;  1XMQ L;  1LTL A;  4OON A;  3U58 A;  2E2H H;  1GKH A;  1T9H A;  3PUX A;  2I5L X;  3GTQ H;  4B3S L;  1VQG A;  4OXP A;  1PYB A;  3T1Y L;  1SN8 A;  4LFC L;  4DAY B;  1O7I A;  4DPG A;  2N78 A;  4DUZ L;  3RLO A;  1OTC A;  2JA5 H;  1S40 A;  1HNZ L;  3CC2 A;  1KAW A;  1X65 A;  3A5Z B;  4DR6 L;  1Q46 A;  3KJO A;  4QJF A;  5C4J H;  4LF7 L;  1PYS B;  1YVC A;  3GD7 A;  1N33 L;  2XGT A;  1MKH A;  2YTV A;  2JJQ A;  4KHP Q;  2YTY A;  1S3O A;  2HIX A;  3K80 C;  4C3I H;  4DV0 Q;  2JA6 G;  1LYL A;  3K81 C;  4A3E G;  4PZ8 A;  2VZA A;  1QVG A;  3I4M H;  2N8N A;  3PCO B;  1VQM A;  3PUY A;  3RZO H;  5IT9 c;  4JV5 L;  1FL0 A;  3I55 A;  2R6G A;  4A3K H;  3ICE A;  4LF4 L;  1YHQ A;  2N3S A;  3RLF A;  3CCE A;  1ASZ A;  4YWL A;  3CCU A;  5JJK A;  1PH1 A;  1VQ6 A;  2K75 A;  4QY7 A;  1PH4 A;  4BXX G;  3S15 H;  4OO1 I;  4GS3 A;  3K0X A;  1VQC A;  3K8A A;  3CQZ H;  3EIV A;  1J6Q A;  1NJI C;  2CCZ A;  2GN5 A;  4PZ6 A;  4GKJ Q;  1WI5 A;  1XMO L;  2F4V Q;  1OXS C;  1XNQ L;  4BY7 G;  3GTP H;  3H0G H;  4IFD G;  3KDF B;  5FJ8 G;  4DR1 L;  4NXM Q;  4L5Q A;  3RN2 A;  4JI1 Q;  3NEL A;  5GAD C;  3CCV A;  3H0G G;  1X6O A;  1VQ7 A;  3L7Z C;  4JI6 Q;  2JA8 H;  1L2F A;  1XPR A;  1IBM L;  4PMW A;  3S17 H;  4DV3 L;  3G48 A;  1PH5 A;  2Z6K C;  4OX9 L;  3NEN A;  3FHW A;  3UE1 A;  4C3J H;  4NXN Q;  4GN5 A;  4GN3 B;  1N34 L;  4DR7 L;  4R4I A;  4LFB Q;  2ZTD A;  4QQB X;  1V9P A;  2OTJ A;  1UE1 A;  1G6P A;  1LM0 A;  1L1O B;  1Q8K A;  2F3I A;  4KLK A;  1AE2 A;  1CUK A;  1HZC A;  4DV4 Q;  4GNX B;  4HJ9 A;  1YJW A;  1EQR A;  1KHI A;  1UE6 A;  2IT1 A;  3UDF A;  4IFD I;  1N32 L;  4BA2 I;  4JBJ A;  4R4O A;  3TQY A;  5IY0 A;  4B3M Q;  4C2M H;  5GAG C;  5BR8 L;  1HZ9 A;  1E3P A;  1MJC A;  3PF5 A;  1ASY A;  3CC7 A;  3JAM c;  3D0F A;  4BBS H;  3F2B A;  1RIP A;  1CKM A;  1TWA H;  1U0L A;  1YHB A;  2EXD A;  1YIJ A;  3T1H Q;  4L5S A;  4AYB E;  1XJV A;  1BBU A;  1X54 A;  4JC0 A;  5EAY A;  2VQF Q;  5M5X H;  1EUJ A;  4LF6 Q;  1E22 A;  1VQP A;  4IPD A;  5JEA G;  4ALP A;  2YYZ A;  3H3V H;  2OQ0 A;  2JA6 H;  3CCM A;  4A75 A;  4IPC A;  1V43 A;  3PIO A;  5GRO A;  4R1J A;  3VDY A;  2KBN A;  3PSI A;  2R92 H;  2JQO A;  4A3B G;  3J81 i;  3H15 A;  2UXC Q;  1KD1 C;  1QVC A;  2LXJ A;  4AQY Q;  2RCN A;  2E8G A;  3W1G A;  4A3K G;  4GOP A;  1S72 A;  1LUZ A;  1UE7 A;  1VQK A;  3Q8D A;  1E1O A;  1HNX Q;  5C44 G;  4JI5 L;  1D8L A;  3HOZ H;  3HOV H;  4GNX A;  3TRZ A;  2WAQ G;  3HFZ B;  1I3Q H;  1IBL L;  1RL2 A;  4XIG S;  3PUV A;  1U5K A;  3ULP A;  2EQS A;  5C44 H;  2N49 A;  3D31 A;  1K73 C;  4DR3 L;  3W5O A;  4O0A A;  2WB1 E;  4DK3 C;  1N36 Q;  2UUB Q;  3HOZ G;  3OTO Q;  1L1O C;  2ATW A;  1I94 Q;  3K7U C;  1PH3 A;  2K52 A;  4DAM A;  4UP7 A;  1SFO H;  1Q81 C;  3CPF A;  2R93 H;  2ZJP A;  4DR2 L;  1GM5 A;  2Q2T A;  4LF5 Q;  2AKW B;  1YEZ A;  4JI4 Q;  4DK6 C;  3KF8 B;  2Q2H A;  2VY3 A;  3RR5 A;  1VQL A;  2E5L Q;  3I4N G;  3S24 A;  4DV6 Q;  3JAM i;  2R7D A;  1X3F A;  1FVI A;  4A3C H;  4GN4 B;  3U4V A;  4JYA Q;  1HNZ Q;  4DR4 L;  1NMG A;  5IP9 H;  5IWA Q;  4GOP B;  2UXD L;  2EIF A;  3GTK H;  4NPS A;  3FP9 A;  1FJG L;  5GQO A;  1YZ6 A;  4PG3 A;  2HHH Q;  2WB1 G;  5FLX c;  3PV0 A;  1IL2 A;  3PO3 G;  2NVY H;  2CQO A;  1SRO A;  3GO5 A;  1WJJ A;  1VQH A;  4A3L H;  1X56 A;  3UE0 A;  3STB C;  1SMX A;  1I6H H;  1XPO A;  4A3M H;  3L2P A;  4JV5 Q;  1HR0 L;  4EQ5 A;  2OCE A;  1BVS A;  4LF9 Q;  4JCV E;  1Y1V H;  1BBW A;  2QA4 A;  1JJ2 A;  4WJ4 A;  4LF4 Q;  3RN5 A;  1C7Y A;  3KLW A;  1JE5 A;  2K50 A;  4JI8 Q;  3KF6 B;  2ZTC A;  4GOP C;  1Y1W H;  1XTD A;  1A62 A;  3BU2 A;  3CME A;  2UXB L;  2E2I H;  5LMU Q;  4AH6 A;  3PUW A;  2VUM G;  4X65 L;  5GAH C;  1XMQ Q;  4POG A;  4GKJ L;  4X62 L;  1XNQ Q;  2MO1 A;  4LUV A;  3S14 H;  1G51 A;  5ELO A;  5IP7 G;  4A76 A;  5M5Y H;  2VQE L;  4NB3 A;  4JI2 L;  1HH2 P;  1XNR Q;  2VUM H;  1I50 H;  1VQJ A;  4LF8 L;  4JBK A;  4A3J H;  5C0X G;  4YHH L;  1IBK L;  3CC4 A;  1WYD A;  3I56 A;  3KYH C;  1Q12 A;  1P8L A;  3NEM A;  3HOW G;  1A63 A;  2RHS B;  3E0E A;  4OX9 Q;  4NXN L;  5IYB G;  3CP0 A;  2ZJR A;  4O2D A;  3LGJ A;  4DV0 L;  1VQ5 A;  1N9W A;  2VS1 A;  4JI7 Q;  5C3E G;  2A1A A;  1KRT A;  5IYD H;  5IYB H;  2BH8 A;  5IE8 A;  2UUC L;  4B3M L;  1Q86 C;  1TWG H;  1VQA A;  3EN2 A;  4L5T A;  4LW1 A;  1K9M C;  4A3E H;  4K0K L;  2HQL A;  2Q2U A;  4QGU A;  1WCM G;  3HOY H;  2B29 A;  5IYD G;  4X64 Q;  1PV4 A;  3I4M G;  1MJE A;  4APV A;  1E24 A;  1VQI A;  4X66 L;  1YJN A;  1Q1B A;  1MIU A;  1PA6 A;  4BA1 I;  4Y52 H;  3HOY G;  3F8T A;  5J3B A;  2XTI A;  5JEA J;  4DUY L;  1VQF A;  1KIX A;  4YCU A;  1OXV A;  3W1B A;  4DR7 Q;  2PNH A;  4IO9 A;  3UDG A;  3PO3 H;  1YI2 A;  2D0O A;  2B63 H;  2VL6 A;  1XMO Q;  4DV5 L;  4A93 H;  2YV5 A;  4NXM L;  4HID A;  2UUA Q;  4GLX A;  2ZJQ A;  2K5H A;  2JE6 I;  4JI1 L;  1QVF A;  1AE3 A;  3BZK A;  4GKK L;  3S1N H;  1Y1V G;  3GTJ H;  2CWP A;  1HNX L;  4YY3 Q;  4QL5 A;  4C3H H;  3AEV A;  1B8A A;  3HKZ E;  1QZH A;  2ASB A;  2JK8 A;  4QIW E;  2K5N A;  4JG2 A;  1EWI A;  3S1R H;  4LFB L;  4UPA A;  1N36 L;  4OWT B;  3WWV A;  1D7Q A;  3PO2 H;  2IHF A;  5C0X J;  1Z9F A;  2NN6 G;  2Y0S E;  3CD6 A;  1N32 Q;  4AYB G;  5C4X G;  2JEB I;  3DM3 A;  2B3G A;  5BR8 Q;  4A3J G;  1JT8 A;  1OXX K;  1M90 C;  4LNQ A;  2NZH A;  2BA1 A;  3E9H A;  4H02 A;  5GAE C;  2HIV A;  4BBS G;  2ALY B;  4DV2 Q;  2UU9 Q;  3HOW H;  2KEN A;  2MFI A;  4X6A H;  4BBR G;  3CCS A;  1X55 A;  1PH7 A;  1PH2 A;  2BH2 A;  2CFM A;  4GLV B;  4TVA B;  4DV6 L;  4RMF A;  2R7Z G;  4DV1 Q;  4A4I A;  4JYA L;  1HR0 W;  2D62 A;  2I5M X;  5HY6 A;  5IYC H;  5C3E H;  5M3F H;  4GNX C;  4DR4 Q;  4UP9 A;  2R7Z H;  3JC6 6;  5ELN A;  2QEX A;  2L15 A;  2OQK A;  2NZO A;  5IWA L;  4HJ5 A;  2RHQ B;  3I7F A;  5C0X I;  1Q7Y C;  1WCM H;  2Z0S A;  1R9T H;  4A3B H;  2PI2 A;  1GO3 E;  1L1O A;  2AWO A;  1TWC H;  1K3R A;  4B3R L;  5DLQ E;  4DR5 L;  3GTO H;  3F2D A;  4R4Q A;  4MTN A;  3CF5 A;  3CCL A;  1IBL Q;  1EIF A;  5FLM H;  1G29 1;  1OXU A;  1VQD A;  1AH9 A;  3A74 A;  2UUB L;  3ERS X;  1GVP A;  1Q1E A;  4DV7 Q;  1VQO A;  5LMN W;  1Q82 C;  3M7N A;  2YTX A;  2ZM6 Q;  1UE5 A;  4JI8 L;  1IXR A;  1J5E L;  2ID0 A;  3M4Q A;  4Y7N H;  1YBY A;  2UXB Q;  4DR2 Q;  2C35 B;  3BZC A;  4UP8 A;  4JI3 L;  1WFQ A;  3KJP A;  4A3F G;  3KFU A;  5LMN L;  5M3M G;  1X3G A;  4X62 Q;  1EOV A;  3F2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...