3HOUH

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
134
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 16
structure length 134
sequence length 145
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3houH00
2R7DA 2PQAB 2R93G 3HOWG 3CCUA 2Z6KA 5C44G 2NVTH 2ZM6Q 3K8AA 4DV3L 4IPCA 2UUAL 1Z9FA 5M3MH 4YWLA 1TWFH 2MNAA 1JT8A 1B7YB 1Q1EA 3PO2G 1C0AA 1JMCA 1G291 3K81C 3K7AH 2MQHA 2OTLA 2WAQG 4GS3A 5K36G 3F2CA 4GKKQ 1CSQA 4H02A 4KLKA 1HZBA 5AJ3Q 1UEBA 4KHZA 3ERSX 5IWAQ 4DV0Q 1XPOA 4JI6L 1YBYA 2R93H 3J81i 2R7FA 1Y1WG 2OCEA 3TEHB 1CKOA 4DR2Q 1QUQA 5ELOA 3CQZH 5GAGC 4QL5A 1X3GA 2ES2A 3PO2H 1L2FA 2I5HA 1TXYA 4GN3B 4P75A 3PIPA 3G6EA 4LF7L 3GTQH 4EX5A 3GTGH 3TREA 2NVQH 1Y14B 1K0RA 3HKZG 4A3IH 3PV0A 4LF6L 2QA4A 3PUWA 5C4XG 4JI1Q 3GTOH 3HOXG 1PYBA 4LFAQ 1KRSA 1I5FA 1VS0A 3H0GH 3EIVA 2V1CC 1UE6A 2PQAA 4JI3L 3DM3A 4P74A 4A3JG 4A3EG 1VQBA 4DV5Q 3W1GA 1HNZQ 4JI6Q 3E9HA 4LF8L 1NBWA 1I3QH 3CMEA 3I55A 1WYDA 2B29A 3E0EA 2WB1G 1KRTA 4DK3C 1XPRA 1S40A 3PIOA 1JB7A 4X6AH 2LXJA 2A8VA 5IE8A 4GKJQ 3AFPA 1VQFA 4JBMA 2FXQA 3D0FA 4KI0A 1L0WA 3CCEA 3S2HH 1YJNA 3S1MH 4A3MH 1VQDA 1XPUA 3KF6A 4IFDI 2BH2A 3HKZE 1UE5A 4O0AA 4AH6A 3UE0A 3S1NH 3I2ZA 3WWVA 4DR1L 1N36L 1XNQQ 3M85A 2HHHQ 3CP0A 1LUZA 1KD1C 4NPSA 4YCUA 1I94L 1DGSA 2KCTA 4A3BH 1YITA 1G6PA 3F2DA 4A3LG 1L1OA 5IP9H 3GTPH 1HR0L 3HOVG 3PCOB 4WJ4A 3F1ZA 1GD7A 4JI5L 4UP8A 1SE8A 1N33Q 2D62A 4AIMA 1E22A 4JI8Q 3J80i 5JJLA 1L1OB 1HZAA 4KHPL 3I4OA 2ALYB 4GLVB 1EQQA 5C0XI 3I4NG 1RIPA 2UXCL 1XMQL 4JI7Q 5IYCH 2JA7G 3GTJH 2YU9H 2CWAA 5FLMG 2ZTDA 1CSPA 2KHJA 1XMOQ 4JI0L 1D8LA 1J6QA 5M3FG 1PH4A 1SR3A 3TRZA 3HFZB 2Q2UA 1HNWQ 3CC2A 2WFWA 1VQHA 4X66Q 1JJ2A 1EYGA 1L1OC 1A63A 3GTLH 2GN5A 2F4VQ 4JV5Q 4DV4Q 1IBML 2JA6G 4R4IA 1VQOA 4Y52H 1IYJB 1XMOL 2DUDA 3S17H 4PMWA 1N32Q 2OQKA 3LGJA 4A3GG 5JJKA 2A19A 1WCMH 3AEVA 1T9HA 5BR8L 1I94Q 1HNXL 2UXBL 1P16A 2NN6I 3ER0A 5GQOA 2EQSA 2F3IA 3NENA 4JI2L 4HIOA 5EAYA 2YV5A 1OXXK 1Q1BA 3MXNB 1HH2P 1X3FA 4R1JA 5LMUQ 1Q82C 2AMCB 2ZTCA 3AFQA 5C0XJ 3CC4A 4JI4Q 4UP7A 1C9OA 2F4VL 3PGZA 1PA6A 2HIVA 4GOPC 2XGTA 4POFA 3KLWA 1HZCA 3CXCA 3JC66 2VNUD 3J80c 1ASYA 2CQOA 1AE3A 4XIGS 4BBRG 4OONA 4DR5L 3GD7A 4LFCQ 3HOWH 1JJGA 2I0QA 2JE6I 3EBEA 1OTCA 4YCWA 1QZGA 1SRUA 1U0LA 1LM0A 1CUKA 2EIFA 4HJ9A 4B3MQ 2UUBL 4BY1G 5C3EG 5IP7G 1X6OA 2PI2A 4IJLA 3HOUG 2C35B 4PG3A 4AYBE 2AWNA 1XTDA 1Q86C 4JI4L 4BBSH 1N33L 4DR3L 4DUYQ 3KDFA 3CC7A 1OXUA 1IBMQ 3STBD 3S14H 4K0KQ 2YYZA 1V1QA 4LUOA 1N34Q 1VQAA 1Y1WH 3E9IA 4NXML 2ZJPA 1VQMA 4B3TQ 4DV5L 1HNZL 3M9BA 1VQIA 1O7IA 3CF5A 3S15H 3K0XA 5JJIA 1IBLL 3ULLA 1YI2A 4B3SQ 3RNUA 5AJ3L 1J5EQ 3OYYA 2Z0SA 4DV6Q 1VQLA 4LF9Q 4OWWB 4YHHQ 1XNRQ 4PZ6A 3T1HQ 1VQ4A 3A0JA 4JYAL 3G4SA 3U4VA 4B3TL 4LF7Q 1SN8A 4MNOA 1X56A 4DAYB 3K80C 1PVOA 4A3JH 1GO3E 4A3EH 3L2PA 4GN4B 1EWIA 4DR2L 1VQPA 1NMFA 3T1HL 2JJQA 4A75A 4JYAQ 2IY5B 3D31A 1B70B 5IP9G 3UDGA 1X65A 3Q8DA 1PH6A 4DUYL 3U4ZA 3ULPA 1J5EL 5LMNW 3HOVH 1IBLQ 3I4MH 2UXCQ 4POGA 3J7ZC 1N8RC 4BY7G 2R7ZH 4DR7Q 1E24A 1IXRA 2I5LX 1SFOH 5LMNL 2HIXA 4YY3L 3BZCA 4DV7L 4JBJA 4A3FH 3PSIA 1K8GA 4A3MG 1IL2A 1KQSA 1YJWA 1N34L 3I4NH 1CKNA 3KJOA 2JA7H 5IYCG 1NJIC 5FLMH 1HR0Q 4R4TA 1W2BA 1FJGQ 1KXLA 1ASZA 3RZOH 4ME3A 1QVCA 2R92H 4JOIA 1GVPA 5JEAJ 4YY3Q 4DV7Q 3BJUA 3I7FA 1FGUA 2OQ0A 4OXPA 3ZJYC 4QY7A 3CCVA 4GNXB 4HJ5A 1VQ5A 2KHIA 2Q2IA 4DK6C 4A3LH 4JI0Q 1E1OA 2K4KA 3AYHB 5IWAL 4DV0L 4JI2Q 2CCZA 3NEMA 4LF5L 4A3GH 4MTNA 4L5TA 1X54A 1TWHH 1WCMG 3PO3H 4NXMQ 2IHEA 3FKIG 1EQRA 3A5UA 3GDEA 4UP9A 4LUVA 4APVA 2K52A 3F8TA 4UY8C 4IOCA 4DV4L 4LF4Q 4PZ8A 4DR3Q 2Y0SE 4BA1I 2QEXA 1C7YA 4B3SL 3M3YH 5M3FH 4HIKA 4MZ9A 5HY6A 2BA1A 4X64Q 3PF4A 3IRBA 1RL2A 4HIDA 1N9WA 2NN6G 2UUBQ 1Y1VG 4RG1A 1H95A 5GADC 4QJFA 1LYLA 2K5VA 3J81c 4JI3Q 2YTVA 2HHHL 4LF5Q 1FL0A 4LFCL 3HOYH 1VQKA 1K9MC 4LF4L 4GNXC 4IPHA 4IFDG 2LSSA 4GKKL 1NY4A 4A3KH 2JEAI 4JV5L 2E2JH 3AQQA 4YCVA 1VCIA 3CCSA 3CPFA 1VQJA 1YHAA 1X3EA 5IP7H 3GTMH 1HNWL 4A3CG 4DUZQ 1XJVA 1EUJA 2YTYA 1OXTA 4LF9L 2Q2TA 3FP9A 4A3IG 1BVSA 5C4XH 1MIUA 5HGQA 3RLNA 4DKAC 5IYBG 3G48A 4QQBX 1U5KA 1OXSC 1HNXQ 1EOVA 1D7QA 2ID0A 3M4PA 4PZ7A 2NZHA 5GAHC 2EXDA 1XNQL 1X55A 1B8AA 2JEBI 4LWCA 4DR1Q 1FJGL 1E1TA 4R4CA 1K3RA 2R6GA 3CW2C 4IPGA 1SROA 2VZAA 5LMUL 4P71A 1VQGA 4GLXA 1GM5A 2KENA 1X9NA 5GAEC 4GKJL 4LNQA 4HIMA 2HQLA 3NBHB 1VQ9A 4DR7L 5M5XH 5FLXc 1AH9A 2N3SA 3H15A 1N36Q 1PH7A 4A93H 4YWMA 4DV6L 2VL6A 4LFAL 1NMGA 3HOXH 4L5RC 2KCMA 3H0GG 1WOCA 5M5YH 1A0IA 2ATWA 1AE2A 2RHQB 4X66L 2OTJA 3M4QA 3S24A 2QGQA 3TQYA 1KC8C 4DV2L 4XTCS 2DGYA 3M7NA 2UUCL 2AKWB 4GLAC 2JQOA 4NB3A 3SGIA 2Z6KC 4LUZA 3JAMi 2PMZE 2MFIA 1EIYB 5BR8Q 1UE1A 4FDBA 4HJAA 3S1RH 1V43A 3KF6B 5DLQE 5IYDG 1PH3A 3CD6A 1MKHA 1N32L 2N78A 4A3DH 1K8AC 4DR5Q 2VS1A 4DV3Q 3HOZG 2B63G 1K83H 4LF6Q 4NXNL 2JA5G 1YNXA 1YEZA 4BA2I 4BXXG 4OO1I 2K50A 3I4MG 2A1AA 4P73A 2GVBA 3UDIA 3TS2A 2ZJRA 4BY7H 2WP8J 4R4OA 2B3GA 2CKZB 4C2MH 2F52A 5IY0A 2UUAQ 1KHIA 1JJCB 1A62A 2RCNA 2JA9A 3FKIH 4AQYQ 4IJHA 3ULJA 4A3FG 1Q7YC 1PV4A 4JBKA 2MO0A 4A76A 1JE5A 1V9PA 4BXXH 4HJ7A 2N8NA 2Y0SG 3PUVA 1OXVA 2LXKA 3OW2A 2E2IH 4KHPQ 4OO1G 4DR4Q 4GOPB 3RN5A 3T1YL 2JA8G 1IBKL 2RF4A 1Y1VH 2ZTEA 1UWVA 4HJ8A 4GN5A 1YIJA 3S1QH 1KL9A 4JBWA 4X62L 2KBNA 4DV1L 3S16H 4IPDA 3HOYG 3B6YA 1KAWA 2Q2HA 1SMXA 1YJ9A 4GOPA 1QVFA 2VY3A 4JOIC 4LF8Q 1VQ8A 3STBC 5LMNQ 3A5ZB 1VQCA 4UPAA 2IHFA 1BBWA 5M3MG 2PI2E 3OTOQ 5C4JH 2E5LQ 2OWOA 3PO3G 1Q12A 3CCJA 1Q8KA 3RZDH 2GVAA 1I50H 1WJJA 1XMQQ 1BBUA 1Q81C 4JI7L 4DAMA 4NXNQ 5IYBH 4OWXB 3KFUA 1CKMA 4C3HH 2XTIA 4X65Q 4DV2Q 2MO1A 2YTXA 1K73C 3W5OA 3S2DH 3HKSA 3PUYA 4LW1A 1HR0W 4JI8L 5IT9c 3CCQA 1PFSA 5C3EH 4OX9L 2K5HA 4TVAB 1VQNA 4J15A 5GROA 4YHHL 1VQEA 1XNRL 2AWOA 1PYSB 1TWGH 4DPGA 3U50C 4A3BG 4A3KG 2K14A 2UUCQ 4B3RL 3RR5A 2PNHA 2WAQE 4LFBL 3U58A 2IX1A 4TQUS 1Z47A 1M1KC 1LTLA 1YVCA 4OX9Q 2UXBQ 2NZOA 3L0OA 1EIFA 1PH9A 4JI5Q 1E7ZA 4JI1L 1WFQA 4OWTB 2D0PA 2RHSB 5C0XG 3BU2A 1PH2A 1E3PA 3W1BA 3CCRA 1TWCH 1PH1A 4EQ5A 4JC0A 3MEFA 3KJPA 2I5MX 4BY1H 2JK8A 2WB1E 1SLJA 4B3ML 2E5LL 4JCVE 3T1YQ 3H3VH 1CKNB 3FHWA 3HOUH 4BBSG 5ELNA 3DLLA 3KF8B 1PHJA 2N49A 3UDFA 4QGUA 1MJEA 1UE7A 3CPWA 1S3OA 1TWAH 4DV1Q 3ICEA 3J81j 1NE3A 1KIXA 4AYBG 1WI5A 1NTGA 5IYDH 4A3DG 2H5XA 4A93G 4LFBQ 3HOZH 4DR6Q 2HT1A 3TS0A 3KYHC 3PUXA 2NVXH 1S72A 1M90C 4JG2A 3PUZA 1YHBA 3KDFB 2VQFL 2AHOB 2D0OA 1HJPA 4DUZL 4ALPA 2CWPA 1VQ6A 2E2HH 3F2BA 1VQ7A 3NELA 3JAMc 3GTKH 3RN2A 4IOAA 4X65L 4L5QA 3UE1A 1W3SA 1HZ9A 4DR6L 2BH8A 4K0KL 1I6HH 3L7ZC 3CAMA 1Q46A 3RLFA 2UXDQ 1YHQA 3KOJA 5J3BA 2R7ZG 2K5NA 4P72A 3UDXA 2ZM6L 3CCMA 3BZKA 4C3JH 3H3VI 4O2DA 3RLOA 3K7UC 4B3RQ 4L5SA 2K75A 2B63H 5FJ8G 4A4IA 5M5WH 1QZHA 3A74A 1IZ6A 4C3IH 2JA5H 2ASBA 2VUMH 2IX0A 1BKBA 1FVIA 3EN2A 4IFDJ 2R92G 2VQEQ 3CMAA 1PH8A 2UU9L 4X62Q 4GNXA 4R4QA 3J7A5 3G71A 2UXDL 1A8VA 3GO5A 1IBKQ 3VDYA 2IT1A 1QVGA 4Y7NH 4RMFA 3CCLA 2ZJQA 4QIWE 1G51A 1YZ6A 5FJ8H 1PH5A 3M4OH 1P8LA 1GKHA 2L15A 1MJCA 5E7NA 4YWKA 5JEAG 1QUQB 3PF5A 1R9TH 5C44H 1EFWA 3I56A 2VUMG 4WJ3M 2UU9Q 4DNIA 2E8GA 4AQYL 2VQFQ 2JA8H 2VQEL 2NVYH 3OTOL 2VW9A 4DR4L 4A3CH 4IO9A 2BA0A 4X64L 5H1SE 2CFMA 2JA6H 4BBRH
chains in the Genus database with same CATH superfamily
2R7DA 4DV3L 3CHBD 2UUAL 1Z9FA 2F0GA 1PXUA 1TWFH 2QKIC 3VR5A 1B7YB 3PO2G 1JMCA 4TKOB 4X3UA 1SNDA 4H44C 1LTGD 4DAVA 4GKKQ 3AU7A 4H02A 2JSOA 4TSSA 4KHZA 2OT2A 1Y1WB 1YBYA 2R7FA 2NTSA 5D3IB 1LO5D 1Y1WG 5ELOA 5GAGC 4QL5A 1X3GA 2I5HA 1TXYA 3T56B 3I91A 4ZAIA 3PV0A 3PO3B 1B4OA 1VS0A 3BVZA 3EIVA 1UE6A 1UUPA 1LLRD 2AQ3B 3SHLA 3J81L 3L3OC 4JI6Q 1EZ6A 3Q23A 5EQ0A 3C3LA 1DONA 3CMEA 3SK8A 4ZCKA 3I55A 1WYDA 2B29A 2F1MA 3D6WA 3W2DA 5KNBA 2A8VA 3DUZA 2FXQA 3S2HH 4RGMA 3KF6A 4IFDI 2BH2A 2RSOA 2FMMA 4CHTB 3M4YA 3I2ZA 3WWVA 4DR1L 2PW5A 5DEHA 1XNQQ 2HHHQ 3A7AB 1LUZA 1CA6A 4A3BH 1E2ZA 1G6PA 3KUPA 3I4LA 4Q0FA 2F3VA 1L1OA 3GTPH 1HR0L 4WJ4A 1GD7A 4YIJA 3VYRA 1N33Q 2LS01 1VMCA 4AIMA 1E22A 1HUNA 1VF7A 3FEWX 3J80i 5JJLA 1A3UA 1L1OB 4RA8A 3SEBA 4CJ0B 3I4OA 2ALYB 5C0XI 1RIPA 2UXCL 2JA7G 5IYCH 3GTJH 2A6EC 2F0MA 1J6QA 1PH4A 3NTKA 3GTLH 3FPUB 3R2TA 2F4VQ 2A68C 2JA6G 2A6HC 2EY1A 1KLUD 2DUDA 2J4XA 1STAA 5BR8L 4V0BA 1I94Q 1WTOA 5JOBA 1UNSA 5GQOA 3ER0A 3MFYA 5EAYA 4R1JA 5LMUQ 1Q82C 5I9OA 1X3QA 2Q8IB 5HURA 1GJXA 4POFA 5EKIA 3VR6A 4FP5D 5A2QL 3KLWA 3PMFA 3JC66 1SE3A 2VNUD 5E4WC 1ASYA 3GD7A 1HCZA 4HJ9A 1WTPA 2RCFA 4BY1G 2PI2A 4IJLA 3GTQB 2C35B 2NVQB 4AYBE 1T5XD 1XTDA 3ERQA 4IN3A 4DUYQ 2A73B 1V1QA 4LUOA 1W6JA 5I6YA 1Y1WH 5C6AA 1HNZL 2K03A 1HQMC 1HTPA 4WFN3 3K0XA 1Z6HA 4A3MB 3ULLA 1VDZA 3OIQA 1FNVA 2KCCA 1JC7A 1NR2A 3T1HQ 3A7LA 3A0JA 4ZRZA 3A55A 3U4VA 5C3XA 4LF7Q 4MNOA 4DAYB 1EWIA 4DR2L 1E2VA 1NMFA 4A75A 3T1HL 2IY5B 3D31A 3TSSA 2DY8A 5LMNW 3J7ZC 1TS5A 1N8RC 2AQ2B 2R7ZH 3HOXB 5JJZA 1PRTD 4HR7B 5ELFA 3PSIA 1IL2A 4A3MG 1QCBD 1KQSA 4ZKCB 2EXZA 2PZUA 5FLMH 4R4TA 1FJGQ 1IL8A 3RZOH 2R92H 5JEAJ 1IKLA 1TS2A 4YY3Q 1FGUA 1LTRD 3ZJYC 2GA4B 1VQ5A 2Q2IA 4DK6C 1E1OA 2K4KA 3OW7A 4DV0L 3CQZB 4JI2Q 1Y8OB 4L5TA 1V8QA 4NXMQ 3SR1A 2BCOA 3I4NB 1EQRA 3A5UA 4FF2A 1G8ZD 3KLRA 4PZ8A 1C7YA 4B3SL 4HIKA 3BVGA 2BA1A 2X69A 3I73A 3PF4A 4HIDA 1SBBB 2NN6G 5EPKA 4XT1B 1LYLA 2HHHL 1GUWA 1FL0A 4LFCL 1VQKA 4IPHA 2LSSA 1NY4A 5EPJA 2E2JH 2XRQD 1O80A 3IL8A 5C3WA 2ICEC 1XJVA 4C56C 4LF9L 3A8JE 4BBSB 5JPMC 3FP9A 5C4XH 1DOMA 4DK0A 2HDLA 2ZXOA 3DEOA 3G48A 3IKJA 1OXSC 1D7QA 4PZ7A 5GAHC 5CV8A 2EXDA 2JN4A 4Y7NB 2MGSA 1B3QA 1EY0A 1S5DD 5ISRA 2K28A 3KBXA 2HQLA 1STEA 4DR7L 1LT5D 3TP8A 1BR9A 3H15A 1PH7A 3DEPA 2MPMA 2QW7A 1SFOB 2WKDA 1CZWA 2RHQB 5EJWA 4X66L 5J1ZA 3DWQA 4DV2L 2DGYA 5KRUA 3QIAA 4LMQD 2AKWB 4CDDC 1SMYC 2KHSA 3JAMi 1STGA 1EIYB 3SXHA 2O5IC 2L12A 4HJAA 1V43A 3W3AA 4WJWA 3RZDB 4RCOA 3S16B 4S3SA 2JA5G 1GHJA 3MHBA 1TQOA 4BXXG 1YNNC 4CJ2C 2A1AA 4P73A 2GVBA 2QDLA 1SE4A 5FO7B 3RD4A 4BY7H 3VR3A 2DY7A 3DWPA 2PZWA 2F0WA 4R4OA 1JOKA 4E6IA 3QJYA 1A62A 3FKIH 4KKTA 4IJHA 4N9PA 4JBKA 4A76A 1QJOA 4K8JA 4BY1B 1Q3LA 5JEAH 3OW2A 1OXVA 2E2IH 4KHPQ 1SYFA 5IGFA 4DR4Q 3T1YL 3TZDA 5IGBA 2ICIA 1YIJA 1UWVA 4HJ8A 1KL9A 1Y69U 2X6LA 4IPDA 4DXGA 1EZ8A 4R9WA 3HOYG 2Q2HA 4IFDH 2XNAC 4LF8Q 5I9PA 1MD2D 3OMCA 2F0DA 3TDQA 3VR2A 3OTOQ 2OWOA 5C4JH 3F2UA 4IUPA 3O13A 2GVAA 4A3BB 1WJJA 3T53B 1XMQQ 1Q81C 4C3HH 5I2YA 5I2XA 1K73C 4DV2Q 2MO1A 2YTXA 5KYLA 3PUYA 1HR0W 4OX9L 1SMYD 1B9NA 2Z4HA 1STNA 2PCFB 2AWOA 5IOCA 2FINB 2MHVA 4HTHA 3P1HA 2LMCB 2IX1A 1M1KC 1LTLA 1CT1D 1RD9D 1EIFA 2F3WA 1MHWC 4JI5Q 1E7ZA 5HGTA 1WFQA 1F2MA 1PTOB 3DWAA 3BZDB 1PH1A 1D1KA 2E75C 4EQ5A 2KOLA 1S5CD 1MSGA 1KNAA 2E5LL 1XWEA 4JCVE 3FHWA 3HOUH 1ENAA 4HCEA 1IKMA 1PHJA 4C2MB 1LTAD 1V1PB 1A3VA 4L63B 5M5YB 1CFMA 2NYZD 3K0YA 2Y0SB 1WI5A 3A8KE 4A3DG 2PPBC 4R8NA 2HT1A 4FF1A 1EIGA 5CGKA 2NVXH 3PUZA 3KDFB 5M3FB 1AP0A 2D0OA 1HJPA 4DUZL 2E2HH 2KECA 1U4RA 2BDOA 3VYTA 1TWAB 1SXTA 5I6WA 1TWCB 3T16A 1D5ZC 3UDXA 4QMGA 1RKNA 2ZM6L 4C3JH 3CCMA 3H3VI 4B3RQ 2FFKB 4K2LA 4A4IA 3AMUA 3VYSA 1FVIA 1D5MC 2RSNA 1PRTB 2NVTB 2UU9L 3NSWA 1F2YA 2E74C 1R4PB 2O4XA 2DJFC 3GO5A 1QVGA 2Z4IA 2ZJQA 1D1IA 1GKHA 2L15A 5JEAG 3X3NA 5C44H 3BDCA 2E2JB 4WJ3M 5ELBA 1DD2A 2NVYH 2VW9A 3OSOA 1ZKOA 2B2UC 1SYEA 1LV9A 3HOWG 3CCUA 2Z6KA 3CKIB 5C44G 5M3MH 4YWLA 2MNAA 1J8IA 1C0AA 2VXWA 3FMCA 3CRKC 3I8ZA 1K3BC 5K36G 1H9JA 2F0HA 3F2CA 1CSQA 1II3A 4KLKA 3K5NA 1HZBA 1HFNA 3DHQA 5IWAQ 4JI6L 2BE5C 2OCEA 1DCZA 4QIWB 3PO2H 4GN3B 3G6EA 1DOKA 1EOTA 3JAME 3TREA 2NVQH 1Y14B 4A3IH 4LF6L 2Q8RE 3OMGA 3PUWA 2QA4A 3GTKB 1PYBA 2PZTA 3H0GH 2IJ0A 2V1CC 2M9VA 4JI3L 2TSSA 4A3IB 4DV5Q 3W1GA 1JE4A 1J9OA 1A15A 3MWYW 1NBWA 3E0EA 1XPRA 1EFID 4DK3C 4X6AH 3PIOA 1JB7A 2LXJA 3KBGA 2DJGC 5CV5A 1L0WA 2R61A 3S1MH 4A3MH 1PMRA 1VQDA 3HKZE 4I7AA 1UE5A 4O0AA 1BOSA 2EY2A 1FD7D 3I4MB 4NPSA 4YCUA 1I94L 1DGSA 3RUZA 1YITA 3FVQA 2XVSA 5IP9H 1H9MA 1FGBD 2K1BA 2NVYB 3ONAB 1PDQA 3OOCA 2F0KA 3F1ZA 1CZGA 1TWHB 4KTAA 1SE8A 4JI8Q 3M4OB 4KHPL 2TMPA 1EQQA 3I4NG 3J7YW 4NDXA 2YU9H 5FLMG 2ZTDA 1CSPA 2KHJA 1D8LA 3RZOB 3CC2A 5LL6X 1JB3A 2K32A 2MP1A 2WFWA 1H9SA 3R3OA 1B3AA 1VQHA 4CBVA 4FO2A 3TP7A 2GN5A 4JV5Q 4DV4Q 1KDAA 2HCIA 1IBML 1ONLA 4O1NA 3S17H 1G6ZA 3K5MA 3AEVA 1T9HA 2CHBD 3I3CA 1P16A 1LT4D 2F3IA 3NENA 2YV5A 1PTOF 1Q1BA 1C4QA 5IODA 3CC4A 1PA6A 2NN6H 2Z9HA 4ZLTF 1AZPA 1XXGA 1MBYA 1EYCA 3E3XA 2CQOA 5CORA 4LFCQ 3HOWH 2SDFA 2I0QA 4P2CB 5LL6S 1QZGA 1SRUA 1U0LA 1LM0A 1CUKA 3C46A 5IGGA 4BBSH 4JI4L 3K5OA 3HOUB 1MSHA 4HMIA 2EYLA 5E3FA 1WTRA 1OXUA 1IBMQ 3S14H 5FO9B 3NQIA 5IGEA 1N34Q 4CDFC 3N6RA 1C48A 3E9IA 2KA7A 4NXML 1B9MA 4DV5L 3M9BA 2B63B 1VQIA 1O7IA 3CF5A 5JJIA 2E2HB 1IBLL 1SNOA 3OYYA 2Z0SA 4DV6Q 4OWWB 4LF9Q 4YHHQ 1XNRQ 4JYAL 5K5PA 4G7ZC 4B3TL 1SN8A 2B2WC 1X56A 1PVOA 1GO3E 4A3EH 3L2PA 4GN4B 4ZK9B 1J5EL 3ULPA 3U4ZA 3HOVH 2JA8B 2CW0C 5C5LA 5IT9E 1NR4A 2EOTA 3NP8A 1W6KA 5BN5A 4POGA 2PNRC 1WTHA 4FNFA 4BY7G 3S17B 2D9UA 1SFOH 1HA5A 1I6VC 2VB2X 2A6ED 5J22A 3S15B 1ESRA 1YJWA 3HRZC 3KJOA 3QB3A 4L6TB 3D4DA 3I72A 1GVPA 3MZ5A 2N55A 2WIIB 3I7FA 4OXPA 3CCVA 3EQLC 4GNXB 4HJ5A 3GTLB 2EYHA 2Z8LA 4JI0Q 3AYHB 5C3EB 1IYVA 4LF5L 1WCMG 2G9DA 2F0IA 1EEFD 3GDEA 4LUVA 2K52A 4BA1I 2QEXA 1LTID 3NBIA 4H7BA 3M3YH 4MZ9A 3IRBA 1RL2A 4EQPA 4A3KB 2NVXB 2L0CA 2B2TC 1H95A 2K5VA 4LF5Q 1F2ZA 5ELDA 4LF4L 1LT6D 2K6AA 4J1MA 1FNUA 3CPFA 1VQJA 1YHAA 1I4QA 4OELB 5IP7H 1CI3M 3GTMH 1HNWL 2L4NA 4DUZQ 3TP6A 4FVMA 4EQNA 4A3JB 4IUNA 3RLNA 4J8QA 5G3LD 1NUCA 2JEBI 4LWCA 4LJZC 4R4CA 1CQVA 2R6GA 3CW2C 4QB4A 2VZAA 3DMUA 4K2KA 1VQGA 4JK1C 5GAEC 4GKJL 4HIMA 1O7YA 5M5XH 4DNRB 3I90A 5FLXc 1I50B 2RDFA 4XQJA 4DV6L 4CDCC 1VMPA 4NP5A 2VL6A 1NMGA 3HOXH 4L5RC 4LAAA 2WINB 2KCMA 4X3TA 1WOCA 2B2YA 1AE2A 2NZ1D 1A2TA 2P5ZX 2Q8TA 4QUFA 1KC8C 2B2VA 3V96A 3EJIA 4NB3A 2F0OA 2EYJA 5EGTA 2PMZE 5BR8Q 2LFNA 2EYPA 1UE1A 2R3ZA 3NUCA 3S1RH 3KF6B 1B1ZA 1PH3A 1RTNA 5IYDG 5D65A 4A3DH 3GTGB 1K8AC 5E1FA 4DV3Q 1BCPB 5FLXE 3A54A 1EY7A 3I4MG 1LABA 3UDIA 1D5XC 3GTOB 4A3BG 2EY5A 2B3GA 5IY0A 1JJCB 2RCNA 5FK9C 4A3FB 1S4ZA 1JE5A 1V9PA 1C8CA 4BXXH 2Y0SG 4XYOA 3G7LA 1FNWA 4WORA 4FXDA 1RODA 2G5DA 2RF4A 2K01A 4GN5A 5JVH3 4JBWA 4X62L 3AB9A 1SDFA 2KBNA 3S16H 1ILPA 3B6YA 1SMXA 2EJGC 3H6MA 1BDOA 2VY3A 2J7ZA 1VQ8A 2HDMA 5LMNQ 3V05A 5M3MG 2IHFA 1BBWA 4DNTB 5A35A 3EA6A 3RZDH 1SNQA 2ZXRA 3E0JA 1I50H 5IYBH 1TY0A 3W5OA 3S2DH 2UXBL 4JI8L 1VQNA 1X3PA 2F0TA 5C3EH 1G91A 1V1PA 1PYSB 4KK7A 1PZJD 2XIWA 3U50C 4AYBB 4F87A 1EY4A 4J6HA 4TRDA 1ET6A 1GUNA 2WV6D 4LFBL 4TQUS 1Z47A 5M5WB 2UXBQ 2NZOA 1KAAA 1PH9A 3R93A 2A5HA 4DF7A 4OWTB 1U4PA 1MI2A 5COYA 5FKAC 3KF8A 1TR5A 3MEFA 5DM73 1H9KA 2I5MX 2R93B 1RTOA 1HTLD 3T1YQ 1CKNB 5EKKA 3H3VH 3D4WA 3NK9A 3J7AV 5M9OA 3DLLA 3KF8B 3MVVA 4QGUA 1MJEA 2KUMA 1HQRD 1UE7A 1OO9B 1S3OA 1TWAH 3ICEA 1BO0A 1K8MA 1EWHA 5JPNC 4G57A 2B2TA 1PFMA 5D3DA 3S14B 1SNMA 3PUXA 1S72A 2WB1B 1S5BD 1BXTA 1YHBA 4PMCA 1I3QB 5CBEE 2QF7A 3NELA 1WTQA 5KNDA 2CQAA 4IOAA 1LACA 1KNEA 2F0FA 3UE1A 2F0VA 3HS0C 4ZUIA 5M5XB 1HZ9A 5T1GA 4K0KL 1I6HH 3CAMA 4H13C 2F4IA 3HOWB 1YHQA 3KOJA 2R7ZG 1H9RA 2A69C 1A6XA 1EY6A 3K6OA 4O2DA 3K7UC 1CK1A 4UAIA 5FJ8G 5M5WH 3A74A 1IZ6A 2VUMH 1BKBA 1WTXA 3EN2A 2HUGA 3ITPA 2EYOA 1PH8A 3CMAA 2R92G 3GQBA 1FR3A 1JOQA 3MXGA 3G71A 3Q6SA 1IBKQ 4CKEA 2IT1A 3T51B 1STHA 4Y7NH 3M4OH 2JYOA 5KEEA 1ENFA 5E7NA 3PF5A 2VUMG 1R9TH 3SK4A 1NSNS 2UU9Q 2V4DA 2JA8H 2VQFQ 2MJ8A 4N8FA 2X6GA 4IO9A 2FHTA 5H1SE 4A3EB 2CFMA 2JA6H 1L0YB 2R93G 4DU9A 1D6EC 3LWUA 4KY6A 2PW7A 2NVTH 2ZM6Q 3K8AA 3NTHA 4IPCA 4ID6A 3URYA 1JT8A 1Q1EA 1F77A 3SK6A 1G291 3K81C 3K7AH 4ABNA 3BDOA 4GS3A 4HSVA 5FO8B 1EYDA 3H09A 1AFPA 1UEBA 5EPLA 3TEHB 1CKOA 4DR2Q 3D6CA 5KYIA 2ES2A 1GUTA 1K83B 1L2FA 4P75A 3PIPA 1E2WA 4LF7L 3NBHA 5KGUA 1F2LA 1JWUD 4LFAQ 1KRSA 2PQAA 1AZQA 2QDBA 4P74A 2K33A 1VQBA 4A3EG 2F0QA 1HNZQ 4RHSA 3TBIB 3VA7A 3E9HA 4LF8L 1KTKA 4ZUJA 5M3MB 1KRTA 4PQXA 5IE8A 3K58A 4GKJQ 3AFPA 4JBMA 4KI0A 5CBAE 2D5DA 1XPUA 1STYA 1BCPC 4OIJA 4OGQC 3UE0A 2H4OA 3TP5A 1N36L 1IW7D 4KKUA 1KD1C 2HCCA 2KCTA 3K59A 1I4PA 3NTIA 4DN4M 3F2DA 4XQNA 4HMJA 3HOVG 3KLSA 1ICFB 3PCOB 2HD3A 4RKBA 4UP8A 1CHPD 4DA2A 2D62A 1GUGA 2CH4A 3X3MA 1BUVT 1DXMA 2B2VC 3K5LA 3QOJA 1GUOA 1XMQL 1B2TA 2CWAA 5L37A 2PO4A 3TRZA 3HFZB 1BBXC 4FXGC 4X66Q 1JJ2A 1EYGA 1A63A 3HOYB 3OIPA 4Y52H 4OO1H 1SNCA 2OQKA 3LGJA 1PFNA 1WCMH 5DAUA 2JA7B 3R8BA 1NNXA 3HOZB 1A2UA 2NN6I 1TS4A 1SYCA 1OXXK 1WCMB 1HH2P 1X3FA 3MXNB 1CA5A 1B50A 2ZTCA 4JI4Q 1C9OA 5IGCA 1R9TB 3BG3A 3PGZA 2JA5B 2G9HD 1HZCA 2F0EA 1HXYD 3J80c 1AE3A 1I4GA 4XIGS 4BBRG 4OONA 1EU4A 2JE6I 1OTCA 4B3MQ 2EIFA 3EFXD 3A56A 5FOBB 5IP7G 2EE1A 4PG3A 2AWNA 4KY7A 1F9QA 2RVLA 3FRPB 1QWYA 3CC7A 2EZVA 1GUSA 4K0KQ 1F9SA 2YYZA 4I7ZC 1VQAA 4B3TQ 2B8GA 2CH4W 3NQTA 1TWGB 3S1NB 3S15H 3T4AC 1YI2A 3WDNA 5AFWA 5BN4A 5AJ3L 3RNUA 4B3SQ 1VQ4A 5IT9L 3HGBA 1XYIA 2K04A 3K80C 4OIKA 1VQPA 2IX3A 3Q8DA 1PH6A 3TZUA 3I4MH 3NPPA 3GV6A 3P75A 2VUMB 3R2IA 1IXRA 3T13A 2HIXA 3OWEB 4YY3L 2YU9B 4DXFA 1K8GA 4BWGB 2JA7H 1ILQA 4IALA 1NJIC 1X32A 4RGNA 3BVMA 1KXLA 5J39A 4ME3A 2NB0A 1EY8A 4NKLA 3LX0A 3BJUA 1ZXTA 2WKCA 2L55A 2OQ0A 1T5EA 2KHIA 5IWAL 2CCZA 3NEMA 1JORA 4A3GH 1BNZA 3SDZA 3CU7A 1X54A 1QNKA 2H1EA 1S5ED 2IHEA 3FKIG 2ENBA 3P20A 5A2QE 4UP9A 4UY8C 3F8TA 5CYUA 4DV4L 4IOCA 4LF4Q 4DR3Q 2Y0SE 4B9XA 1VF5C 1N9WA 2KQ3A 2UUBQ 1HFGA 5GADC 4QJFA 4JI3Q 3J81c 2YTVA 5C5MA 3HOYH 1K9MC 4IFDG 4GKKL 2FJ2A 2ZXPA 3AQQA 1VCIA 3IFDA 1B44D 2QEJC 4A3CG 1EUJA 2YTYA 2Q2TA 1BVSA 1Y8PB 4DKAC 2AQ1B 5IYBG 2F03A 4MIUA 4XYQA 1HNXQ 1I6HB 2ID0A 5D14A 3M4PA 2LKVA 2NZHA 2BOSA 4PV1C 2IL8A 1E1TA 2C9OA 1K3RA 3NWTA 1SROA 4IPGA 5LMUL 1RF2D 1RDPD 4V190 3SK5A 2OXPA 1CQFA 1VQ9A 3HOVB 4RKLA 1AH9A 1N36Q 1CTMA 1E0BA 4A3DB 3C1FA 1SE2A 3A8IE 4JPBW 5C4JB 1F9RA 3H0GG 4KKSA 1A0IA 2ATWA 1BF4A 2QGQA 2KVMA 2QILA 1JR0D 1JCKB 4XTCS 5T1IA 4CDEC 1JICA 1WTWA 2JQOA 4QUCA 4JVZA 5KIXA 1EEID 5DLQE 1MKHA 4A93B 1N32L 2PYKA 1TIID 2BE5D 3J81E 3H3VC 4KMUC 1DZ1A 1K83H 3N52A 1LTTD 1SYDA 1YNXA 4BA2I 4OO1I 1UEAB 1BCPD 3TS2A 1RCVD 1CHQD 4C2MH 2CKZB 1KHIA 3SVMA 1PV4A 4A3FG 3JAML 4AQYQ 3E5SA 3ULJA 1Q7YC 4ODGA 1U4MA 1YNJD 2XWBB 2K7VA 1F9PA 3CRLC 4BY7B 4HJ7A 2N8NA 2LXKA 5BN3A 4GOPB 3RN5A 2JA8G 1Y1VH 2ZTEA 2XWJB 3S1QH 4KN7C 2L5TA 1KAWA 4K6LA 2VB3X 5CV7A 4GOPA 2KEEA 2Z6BA 5E4XA 3ND9A 3BS1A 3A5ZB 1VQCA 2PI2E 2E5LQ 3PO3G 4KHVA 1Q12A 2A69D 3MA2B 2IPKD 1Q8KA 2M2LA 4QCLA 4NXNQ 3MTSA 2KCNA 4X65Q 3HKSA 3J7AF 1RHPA 3CCQA 1PFSA 1K28A 3GP7A 2K5HA 4TVAB 2NTTA 4J15A 5EBCA 1H9SB 1VQEA 1I4RA 1TWGH 5C0XH 4PNYA 2RQXA 2K14A 2UUCQ 1TY2A 3RR5A 3H91A 4UDUC 1EQTA 1YVCA 3BYYB 4OX9Q 2BDNA 2DNCA 4OEMB 5CV6A 4JI1L 2D0PA 2RHSB 5C0XG 3BU2A 1PH2A 1E3PA 3W1BA 4EGVA 3E6ZX 3KJPA 4RWSC 3LNNA 4F8MA 3RMHA 4BY1H 2JK8A 1SLJA 4B3ML 1EL0A 2CVRA 4DAYA 1M4VA 5ELNA 2N49A 3CPWA 1NAPA 3HZXA 3S2DB 3OHXC 1PYWD 2RA4A 3D4RA 3J81j 1NE3A 2SEBD 4C1NI 1KIXA 3QR8A 4K8IA 1NTGA 4RFBA 4A93G 1ICWA 3HOZH 4DR6Q 3TS0A 2SNSA 3KYHC 1HA6A 5EKLA 1EWCA 2L11A 2EYMA 2EY6A 1G2TA 3VA5A 1SEBD 2SOBA 2AHOB 1YNJC 1VQ6A 3F2BA 4RH6A 3GTKH 4G7OC 3RN2A 4FF3A 4X65L 4Q5VA 4L5QA 4DR6L 2BH8A 2UXDQ 1G2SA 1EQVA 4C3IB 5J3BA 2C5CA 3PQIA 4P72A 2KEDA 3BZKA 2M00A 4CKBA 4L5SA 3D8GA 1QZHA 4C3IH 2IX0A 2VQEQ 4GNXA 2E2DC 4R4QA 4RGOS 2UXDL 1A8VA 3MXPA 4U68A 2ZT9C 1AW7A 4RMFA 3CCLA 4QIWE 1PTOC 3SE0A 3D3RA 2EVBA 5FJ8H 1PH5A 2XRSD 3ZYYX 4C3IG 2F0NA 3I56A 4HAEA 4H0LC 4DNIA 2E8GA 4AQYL 4DR4L 1KDBA 2SNMA 2RDHA 2BA0A 4RHRA 3BDLA 5LHY1 4BBRH 2PQAB 1O78A 1BCPF 3HEJA 2EYFA 2MQHA 2OTLA 2WAQG 3IFTA 1PTOD 3VR4A 5AJ3Q 2R93H 4DV0Q 3ERSX 4XT3B 1XPOA 1GXDC 3J81i 1AN8A 1QUQA 3CQZH 1PLFA 3GTPB 4QF4A 1QG7A 3GTQH 4EX5A 3GTGH 1K0RA 3HKZG 5C4XG 1SJHD 4IUQA 4JI1Q 1QOHA 3HOXG 3GTOH 1I5FA 4R8IA 3DM3A 4RCNA 4A3JG 2AUJD 4KV6A 1EY9A 1ZYRC 1I3QH 1YNND 2DNEA 2WB1G 1S40A 4IQZA 4ZYSA 1VQFA 2Z1CA 3D0FA 5CV4A 1RJTA 3CCEA 1YJNA 5CC4A 4AH6A 4B9WA 3S1NH 2L9HA 3L9AX 1U9RA 4EVOA 1KABA 3M85A 3CP0A 2EDGA 1QE6A 4A3LG 1PZKD 3Q22A 3FDTA 4JI5L 4U673 2E2IB 2OEOA 2IW3A 4IUTA 1HZAA 2A6HD 4RAUC 4GLVB 3MXNA 1IYUA 4JI7Q 4DAPA 3QWNA 1XMOQ 3KLSX 4JI0L 1XTCD 4IURA 5M3FG 1SR3A 4A3GB 2Q2UA 1HNWQ 3EVQA 5TSSA 1DOLA 2LY7A 1L1OC 2EJMA 2RKSA 3S2HB 2K05A 2I07B 4R4IA 1VQOA 1IYJB 1S5FD 1XMOL 4PMWA 5IGDA 1N32Q 4A3GG 5JJKA 2A19A 1GHKA 1WTVA 1HNXL 3K7AB 4JI2L 2EQSA 1SYGA 4HIOA 3MFGA 3M7GA 2AMCB 3AFQA 5C0XJ 4UP7A 4RGTA 2F4VL 1SYBA 2HIVA 4GOPC 2XGTA 2K5DA 4HSPA 3MXUA 1DJRD 3CXCA 3K57A 1ZYRD 1TU2B 2WACA 4DR5L 4KJNA 4LK1C 1JJGA 4C3HG 3EBEA 2CW0D 1JOOA 4WRDA 4YCWA 1WVLA 2UUBL 2RBMA 5C3EG 1X6OA 1PZID 3HOUG 1ET9A 1Q86C 1N33L 4DR3L 1Y1VB 3H94A 3KDFA 3STBD 4EQOA 5C4ZA 1QILA 2ZJPA 4UHVA 1VQMA 2OF1A 4ME5A 4GZYC 2E76C 1VQLA 1J5EQ 1LTSD 2B2WA 4N8X1 1Q90A 4I65A 4PZ6A 3UI2A 2K5WA 3G4SA 2A68D 1XX8A 1HHVA 1JWSD 2KJXA 1WD0A 3HKZB 4A3JH 4DGZA 4JYAQ 2JJQA 3UDGA 1B70B 3GV3A 5IP9G 1X65A 1I4XA 4DUYL 4HEDA 3NE5B 1IBLQ 2F0SA 3MAQA 2UXCQ 4G7HC 1MGSA 1KDCA 1E24A 2I5LX 4DR7Q 5LMNL 4DV7L 3BZCA 3GTJB 2B2UA 2PQEA 4JBJA 4A3FH 5DNFA 4G4KA 4M1UB 5JAVA 4X3KA 3NWSA 1N34L 1CKNA 3I4NH 5IYCG 2B39A 4Z9CB 1HR0Q 1W2BA 1ASZA 1QVCA 5DM63 4JOIA 2L1BA 3OWFA 2N88A 4DV7Q 5NUCA 3U9SA 3FKIB 1Q8IA 4QY7A 4A3LH 1L0XB 4DK1A 4OL7A 4KY5A 1DYQA 1ENCA 3IAYA 5C4HA 4MTNA 1O7ZA 4K14A 1TWHH 1V1OA 4MN3A 3HG9A 3PO3H 2IWHA 2B8FA 4ZKBB 1SAPA 4APVA 3QG1A 1LT3D 3EROA 4XXEA 1O7LA 5M3FH 5HY6A 1R4QB 4X64Q 1HPCA 1Y1VG 4RG1A 2O5JC 5K36H 3GTMB 5IIFA 4GNXC 3S1QB 1NCVA 3G6JB 4A3KH 2JEAI 4JV5L 4YCVA 4BS9A 1TT2A 4C1NK 4C3HB 3CCSA 1EYAA 4KJOA 5ELEA 1X3EA 4HN7A 2I46A 4JW0A 1OXTA 2O2LD 4L8JA 4A3IG 5HGQA 1MIUA 3QOLA 3J80L 4NW2A 1B53A 4N9TA 4KD4A 4QQBX 1U5KA 1EOVA 1M8AA 4ILWA 1XNQL 1X55A 1B8AA 5EBDA 4DR1Q 1FJGL 4B08A 4C3JB 1JQYD 4P71A 4GLXA 1GM5A 1TWFB 2KENA 1X9NA 4LNQA 3NBHB 1CM9A 2N3SA 4A93H 1ZEQX 4YWMA 3S1MB 5ELCA 2R7ZB 4LFAL 5G3LF 4OHJA 1ML0D 5M5YH 4XQQA 4BBRB 2HQEA 1K0SA 2OTJA 3M4QA 3S24A 3TQYA 2F0PA 3I70A 2NWGA 4IUVA 3M7NA 3S1RB 4F7XA 2UUCL 4GLAC 3SGIA 1LTBD 2Z6KC 4LUZA 3C2PA 2MFIA 2AUKA 1U4LA 5CV9A 3CD6A 4FDBA 1TS3A 5CR3A 2N78A 2XN9C 4K5XA 4DR5Q 2VS1A 1SSOA 3C1EA 3HOZG 2B63G 4LF6Q 4NXNL 4CKCA 1YEZA 2JP1A 2K50A 2A74C 3HP3A 2ZJRA 2WP8J 1EY5A 2UUAQ 2F52A 2EJFC 1KLGD 2JA9A 5F2DA 1HRJA 1Y8NB 1I4HA 2MO0A 4DFAA 3PO2B 1ESFA 1HUMA 4FF4A 2NBFA 4OO1G 3PUVA 2B2YC 5KNCA 1GOZA 1IBKL 3TMEA 4DV1L 4F88A 1SNPA 1YJ9A 1QVFA 4ZQ3A 1FYCA 4JOIC 3WOEA 3STBC 5C44B 1EU3A 2D2CC 4UPAA 2MUYA 3MEHA 5C4XB 1PRTF 5CMDA 1BQQT 4HCSA 3CCJA 2JXMB 5JVG3 4KD3A 4FYDA 3TN2A 4JI7L 1BBUA 4DAMA 4OWXB 3KFUA 1CKMA 3PIP3 2XTIA 3Q0AA 4K5VA 3M3YB 4LW1A 3ND8A 5IT9c 1DM0B 3QO2A 3VYUA 2WAQB 5GROA 4YHHL 2F0JA 1XNRL 1QNUA 2DN8A 3FPPA 4DPGA 3NHHA 4A3KG 3LWEA 4B3RL 2PNHA 2WAQE 3U58A 2QCPX 5I4DA 2FMCA 4X3SA 4MHEA 3L0OA 4CGYB 3MC0B 2F0LA 3CCRA 1TWCH 3KK7A 3H0GB 4JC0A 1IW7C 1SJED 3DM1A 3J80E 2J0TD 2WB1E 1JWMD 1K8OA 4BBSG 4IZ8A 3UDFA 4IUUA 4K6DA 4DV1Q 4AYBG 2JA6B 5IYDH 2EPBA 2H5XA 4LFBQ 4FXKC 1WD1A 4MTKA 3WOFA 1M90C 4JG2A 4KN4C 3S9WA 3U9OA 1PFBA 2RDGA 2VQFL 4NMZA 4ALPA 1TVXA 2CWPA 1VQ7A 4C3JG 3JAMc 1PTOH 3DXJC 2K5QA 1Z7TA 1AEXA 1W3SA 1UAPA 4K5WA 2F0UA 4M8AA 3L7ZC 1Q46A 3P7JA 3RLFA 4O42A 1D2BA 2K5NA 1QB5D 3OPOA 3RLOA 2K75A 2B63H 4XDXA 2JA5H 2ASBA 1EIHA 2XSCA 2R92B 2NUCA 4IFDJ 5FLXL 4X62Q 3J7A5 1TKWB 3BYTB 3VDYA 3Q24A 3PIO3 1G51A 1YZ6A 4PMBA 1A3TA 1IHZA 1P8LA 4YWKA 1MJCA 1QUQB 1EFWA 3NXWA 4CJ1B 4ULLA 1PRTC 2VQEL 3OTOL 4A3CH 3V2TA 4X64L 1STBA 2PMZB
chains in the Genus database with same CATH topology
2R7DA 2PQAB 2R93G 3HOWG 3CCUA 2Z6KA 5C44G 2NVTH 2ZM6Q 3K8AA 4DV3L 4IPCA 2UUAL 1Z9FA 5M3MH 4YWLA 1TWFH 2MNAA 1JT8A 1B7YB 1Q1EA 3PO2G 1C0AA 1JMCA 1G291 3K81C 3K7AH 2MQHA 2OTLA 2WAQG 4GS3A 5K36G 3F2CA 4GKKQ 1CSQA 4H02A 4KLKA 1HZBA 5AJ3Q 1UEBA 4KHZA 3ERSX 5IWAQ 4DV0Q 1XPOA 4JI6L 1YBYA 2R93H 3J81i 2R7FA 1Y1WG 2OCEA 3TEHB 1CKOA 4DR2Q 1QUQA 5ELOA 3CQZH 5GAGC 4QL5A 1X3GA 2ES2A 3PO2H 1L2FA 2I5HA 1TXYA 4GN3B 4P75A 3PIPA 3G6EA 4LF7L 3GTQH 4EX5A 3GTGH 3TREA 2NVQH 1Y14B 1K0RA 3HKZG 4A3IH 3PV0A 4LF6L 2QA4A 3PUWA 5C4XG 4JI1Q 3GTOH 3HOXG 1PYBA 4LFAQ 1KRSA 1I5FA 1VS0A 3H0GH 3EIVA 2V1CC 1UE6A 2PQAA 4JI3L 3DM3A 4P74A 4A3JG 4A3EG 1VQBA 4DV5Q 3W1GA 1HNZQ 4JI6Q 3E9HA 4LF8L 1NBWA 1I3QH 3CMEA 3I55A 1WYDA 2B29A 3E0EA 2WB1G 1KRTA 4DK3C 1XPRA 1S40A 3PIOA 1JB7A 4X6AH 2LXJA 2A8VA 5IE8A 4GKJQ 3AFPA 1VQFA 4JBMA 2FXQA 3D0FA 4KI0A 1L0WA 3CCEA 3S2HH 1YJNA 3S1MH 4A3MH 1VQDA 1XPUA 3KF6A 4IFDI 2BH2A 3HKZE 1UE5A 4O0AA 4AH6A 3UE0A 3S1NH 3I2ZA 3WWVA 4DR1L 1N36L 1XNQQ 3M85A 2HHHQ 3CP0A 1LUZA 1KD1C 4NPSA 4YCUA 1I94L 1DGSA 2KCTA 4A3BH 1YITA 1G6PA 3F2DA 4A3LG 1L1OA 5IP9H 3GTPH 1HR0L 3HOVG 3PCOB 4WJ4A 3F1ZA 1GD7A 4JI5L 4UP8A 1SE8A 1N33Q 2D62A 4AIMA 1E22A 4JI8Q 3J80i 5JJLA 1L1OB 1HZAA 4KHPL 3I4OA 2ALYB 4GLVB 1EQQA 5C0XI 3I4NG 1RIPA 2UXCL 1XMQL 4JI7Q 5IYCH 2JA7G 3GTJH 2YU9H 2CWAA 5FLMG 2ZTDA 1CSPA 2KHJA 1XMOQ 4JI0L 1D8LA 1J6QA 5M3FG 1PH4A 1SR3A 3TRZA 3HFZB 2Q2UA 1HNWQ 3CC2A 2WFWA 1VQHA 4X66Q 1JJ2A 1EYGA 1L1OC 1A63A 3GTLH 2GN5A 2F4VQ 4JV5Q 4DV4Q 1IBML 2JA6G 4R4IA 1VQOA 4Y52H 1IYJB 1XMOL 2DUDA 3S17H 4PMWA 1N32Q 2OQKA 3LGJA 4A3GG 5JJKA 2A19A 1WCMH 3AEVA 1T9HA 5BR8L 1I94Q 1HNXL 2UXBL 1P16A 2NN6I 3ER0A 5GQOA 2EQSA 2F3IA 3NENA 4JI2L 4HIOA 5EAYA 2YV5A 1OXXK 1Q1BA 3MXNB 1HH2P 1X3FA 4R1JA 5LMUQ 1Q82C 2AMCB 2ZTCA 3AFQA 5C0XJ 3CC4A 4JI4Q 4UP7A 1C9OA 2F4VL 3PGZA 1PA6A 2HIVA 4GOPC 2XGTA 4POFA 3KLWA 1HZCA 3CXCA 3JC66 2VNUD 3J80c 1ASYA 2CQOA 1AE3A 4XIGS 4BBRG 4OONA 4DR5L 3GD7A 4LFCQ 3HOWH 1JJGA 2I0QA 2JE6I 3EBEA 1OTCA 4YCWA 1QZGA 1SRUA 1U0LA 1LM0A 1CUKA 2EIFA 4HJ9A 4B3MQ 2UUBL 4BY1G 5C3EG 5IP7G 1X6OA 2PI2A 4IJLA 3HOUG 2C35B 4PG3A 4AYBE 2AWNA 1XTDA 1Q86C 4JI4L 4BBSH 1N33L 4DR3L 4DUYQ 3KDFA 3CC7A 1OXUA 1IBMQ 3STBD 3S14H 4K0KQ 2YYZA 1V1QA 4LUOA 1N34Q 1VQAA 1Y1WH 3E9IA 4NXML 2ZJPA 1VQMA 4B3TQ 4DV5L 1HNZL 3M9BA 1VQIA 1O7IA 3CF5A 3S15H 3K0XA 5JJIA 1IBLL 3ULLA 1YI2A 4B3SQ 3RNUA 5AJ3L 1J5EQ 3OYYA 2Z0SA 4DV6Q 1VQLA 4LF9Q 4OWWB 4YHHQ 1XNRQ 4PZ6A 3T1HQ 1VQ4A 3A0JA 4JYAL 3G4SA 3U4VA 4B3TL 4LF7Q 1SN8A 4MNOA 1X56A 4DAYB 3K80C 1PVOA 4A3JH 1GO3E 4A3EH 3L2PA 4GN4B 1EWIA 4DR2L 1VQPA 1NMFA 3T1HL 2JJQA 4A75A 4JYAQ 2IY5B 3D31A 1B70B 5IP9G 3UDGA 1X65A 3Q8DA 1PH6A 4DUYL 3U4ZA 3ULPA 1J5EL 5LMNW 3HOVH 1IBLQ 3I4MH 2UXCQ 4POGA 3J7ZC 1N8RC 4BY7G 2R7ZH 4DR7Q 1E24A 1IXRA 2I5LX 1SFOH 5LMNL 2HIXA 4YY3L 3BZCA 4DV7L 4JBJA 4A3FH 3PSIA 1K8GA 4A3MG 1IL2A 1KQSA 1YJWA 1N34L 3I4NH 1CKNA 3KJOA 2JA7H 5IYCG 1NJIC 5FLMH 1HR0Q 4R4TA 1W2BA 1FJGQ 1KXLA 1ASZA 3RZOH 4ME3A 1QVCA 2R92H 4JOIA 1GVPA 5JEAJ 4YY3Q 4DV7Q 3BJUA 3I7FA 1FGUA 2OQ0A 4OXPA 3ZJYC 4QY7A 3CCVA 4GNXB 4HJ5A 1VQ5A 2KHIA 2Q2IA 4DK6C 4A3LH 4JI0Q 1E1OA 2K4KA 3AYHB 5IWAL 4DV0L 4JI2Q 2CCZA 3NEMA 4LF5L 4A3GH 4MTNA 4L5TA 1X54A 1TWHH 1WCMG 3PO3H 4NXMQ 2IHEA 3FKIG 1EQRA 3A5UA 3GDEA 4UP9A 4LUVA 4APVA 2K52A 3F8TA 4UY8C 4IOCA 4DV4L 4LF4Q 4PZ8A 4DR3Q 2Y0SE 4BA1I 2QEXA 1C7YA 4B3SL 3M3YH 5M3FH 4HIKA 4MZ9A 5HY6A 2BA1A 4X64Q 3PF4A 3IRBA 1RL2A 4HIDA 1N9WA 2NN6G 2UUBQ 1Y1VG 4RG1A 1H95A 5GADC 4QJFA 1LYLA 2K5VA 3J81c 4JI3Q 2YTVA 2HHHL 4LF5Q 1FL0A 4LFCL 3HOYH 1VQKA 1K9MC 4LF4L 4GNXC 4IPHA 4IFDG 2LSSA 4GKKL 1NY4A 4A3KH 2JEAI 4JV5L 2E2JH 3AQQA 4YCVA 1VCIA 3CCSA 3CPFA 1VQJA 1YHAA 1X3EA 5IP7H 3GTMH 1HNWL 4A3CG 4DUZQ 1XJVA 1EUJA 2YTYA 1OXTA 4LF9L 2Q2TA 3FP9A 4A3IG 1BVSA 5C4XH 1MIUA 5HGQA 3RLNA 4DKAC 5IYBG 3G48A 4QQBX 1U5KA 1OXSC 1HNXQ 1EOVA 1D7QA 2ID0A 3M4PA 4PZ7A 2NZHA 5GAHC 2EXDA 1XNQL 1X55A 1B8AA 2JEBI 4LWCA 4DR1Q 1FJGL 1E1TA 4R4CA 1K3RA 2R6GA 3CW2C 4IPGA 1SROA 2VZAA 5LMUL 4P71A 1VQGA 4GLXA 1GM5A 2KENA 1X9NA 5GAEC 4GKJL 4LNQA 4HIMA 2HQLA 3NBHB 1VQ9A 4DR7L 5M5XH 5FLXc 1AH9A 2N3SA 3H15A 1N36Q 1PH7A 4A93H 4YWMA 4DV6L 2VL6A 4LFAL 1NMGA 3HOXH 4L5RC 2KCMA 3H0GG 1WOCA 5M5YH 1A0IA 2ATWA 1AE2A 2RHQB 4X66L 2OTJA 3M4QA 3S24A 2QGQA 3TQYA 1KC8C 4DV2L 4XTCS 2DGYA 3M7NA 2UUCL 2AKWB 4GLAC 2JQOA 4NB3A 3SGIA 2Z6KC 4LUZA 3JAMi 2PMZE 2MFIA 1EIYB 5BR8Q 1UE1A 4FDBA 4HJAA 3S1RH 1V43A 3KF6B 5DLQE 5IYDG 1PH3A 3CD6A 1MKHA 1N32L 2N78A 4A3DH 1K8AC 4DR5Q 2VS1A 4DV3Q 3HOZG 2B63G 1K83H 4LF6Q 4NXNL 2JA5G 1YNXA 1YEZA 4BA2I 4BXXG 4OO1I 2K50A 3I4MG 2A1AA 4P73A 2GVBA 3UDIA 3TS2A 2ZJRA 4BY7H 2WP8J 4R4OA 2B3GA 2CKZB 4C2MH 2F52A 5IY0A 2UUAQ 1KHIA 1JJCB 1A62A 2RCNA 2JA9A 3FKIH 4AQYQ 4IJHA 3ULJA 4A3FG 1Q7YC 1PV4A 4JBKA 2MO0A 4A76A 1JE5A 1V9PA 4BXXH 4HJ7A 2N8NA 2Y0SG 3PUVA 1OXVA 2LXKA 3OW2A 2E2IH 4KHPQ 4OO1G 4DR4Q 4GOPB 3RN5A 3T1YL 2JA8G 1IBKL 2RF4A 1Y1VH 2ZTEA 1UWVA 4HJ8A 4GN5A 1YIJA 3S1QH 1KL9A 4JBWA 4X62L 2KBNA 4DV1L 3S16H 4IPDA 3HOYG 3B6YA 1KAWA 2Q2HA 1SMXA 1YJ9A 4GOPA 1QVFA 2VY3A 4JOIC 4LF8Q 1VQ8A 3STBC 5LMNQ 3A5ZB 1VQCA 4UPAA 2IHFA 1BBWA 5M3MG 2PI2E 3OTOQ 5C4JH 2E5LQ 2OWOA 3PO3G 1Q12A 3CCJA 1Q8KA 3RZDH 2GVAA 1I50H 1WJJA 1XMQQ 1BBUA 1Q81C 4JI7L 4DAMA 4NXNQ 5IYBH 4OWXB 3KFUA 1CKMA 4C3HH 2XTIA 4X65Q 4DV2Q 2MO1A 2YTXA 1K73C 3W5OA 3S2DH 3HKSA 3PUYA 4LW1A 1HR0W 4JI8L 5IT9c 3CCQA 1PFSA 5C3EH 4OX9L 2K5HA 4TVAB 1VQNA 4J15A 5GROA 4YHHL 1VQEA 1XNRL 2AWOA 1PYSB 1TWGH 4DPGA 3U50C 4A3BG 4A3KG 2K14A 2UUCQ 4B3RL 3RR5A 2PNHA 2WAQE 4LFBL 3U58A 2IX1A 4TQUS 1Z47A 1M1KC 1LTLA 1YVCA 4OX9Q 2UXBQ 2NZOA 3L0OA 1EIFA 1PH9A 4JI5Q 1E7ZA 4JI1L 1WFQA 4OWTB 2D0PA 2RHSB 5C0XG 3BU2A 1PH2A 1E3PA 3W1BA 3CCRA 1TWCH 1PH1A 4EQ5A 4JC0A 3MEFA 3KJPA 2I5MX 4BY1H 2JK8A 2WB1E 1SLJA 4B3ML 2E5LL 4JCVE 3T1YQ 3H3VH 1CKNB 3FHWA 3HOUH 4BBSG 5ELNA 3DLLA 3KF8B 1PHJA 2N49A 3UDFA 4QGUA 1MJEA 1UE7A 3CPWA 1S3OA 1TWAH 4DV1Q 3ICEA 3J81j 1NE3A 1KIXA 4AYBG 1WI5A 1NTGA 5IYDH 4A3DG 2H5XA 4A93G 4LFBQ 3HOZH 4DR6Q 2HT1A 3TS0A 3KYHC 3PUXA 2NVXH 1S72A 1M90C 4JG2A 3PUZA 1YHBA 3KDFB 2VQFL 2AHOB 2D0OA 1HJPA 4DUZL 4ALPA 2CWPA 1VQ6A 2E2HH 3F2BA 1VQ7A 3NELA 3JAMc 3GTKH 3RN2A 4IOAA 4X65L 4L5QA 3UE1A 1W3SA 1HZ9A 4DR6L 2BH8A 4K0KL 1I6HH 3L7ZC 3CAMA 1Q46A 3RLFA 2UXDQ 1YHQA 3KOJA 5J3BA 2R7ZG 2K5NA 4P72A 3UDXA 2ZM6L 3CCMA 3BZKA 4C3JH 3H3VI 4O2DA 3RLOA 3K7UC 4B3RQ 4L5SA 2K75A 2B63H 5FJ8G 4A4IA 5M5WH 1QZHA 3A74A 1IZ6A 4C3IH 2JA5H 2ASBA 2VUMH 2IX0A 1BKBA 1FVIA 3EN2A 4IFDJ 2R92G 2VQEQ 3CMAA 1PH8A 2UU9L 4X62Q 4GNXA 4R4QA 3J7A5 3G71A 2UXDL 1A8VA 3GO5A 1IBKQ 3VDYA 2IT1A 1QVGA 4Y7NH 4RMFA 3CCLA 2ZJQA 4QIWE 1G51A 1YZ6A 5FJ8H 1PH5A 3M4OH 1P8LA 1GKHA 2L15A 1MJCA 5E7NA 4YWKA 5JEAG 1QUQB 3PF5A 1R9TH 5C44H 1EFWA 3I56A 2VUMG 4WJ3M 2UU9Q 4DNIA 2E8GA 4AQYL 2VQFQ 2JA8H 2VQEL 2NVYH 3OTOL 2VW9A 4DR4L 4A3CH 4IO9A 2BA0A 4X64L 5H1SE 2CFMA 2JA6H 4BBRH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R7D A;  2PQA B;  2R93 G;  3HOW G;  3CCU A;  2Z6K A;  5C44 G;  2NVT H;  2ZM6 Q;  3K8A A;  4DV3 L;  4IPC A;  2UUA L;  1Z9F A;  5M3M H;  4YWL A;  1TWF H;  2MNA A;  1JT8 A;  1B7Y B;  1Q1E A;  3PO2 G;  1C0A A;  1JMC A;  1G29 1;  3K81 C;  3K7A H;  2MQH A;  2OTL A;  2WAQ G;  4GS3 A;  5K36 G;  3F2C A;  4GKK Q;  1CSQ A;  4H02 A;  4KLK A;  1HZB A;  5AJ3 Q;  1UEB A;  4KHZ A;  3ERS X;  5IWA Q;  4DV0 Q;  1XPO A;  4JI6 L;  1YBY A;  2R93 H;  3J81 i;  2R7F A;  1Y1W G;  2OCE A;  3TEH B;  1CKO A;  4DR2 Q;  1QUQ A;  5ELO A;  3CQZ H;  5GAG C;  4QL5 A;  1X3G A;  2ES2 A;  3PO2 H;  1L2F A;  2I5H A;  1TXY A;  4GN3 B;  4P75 A;  3PIP A;  3G6E A;  4LF7 L;  3GTQ H;  4EX5 A;  3GTG H;  3TRE A;  2NVQ H;  1Y14 B;  1K0R A;  3HKZ G;  4A3I H;  3PV0 A;  4LF6 L;  2QA4 A;  3PUW A;  5C4X G;  4JI1 Q;  3GTO H;  3HOX G;  1PYB A;  4LFA Q;  1KRS A;  1I5F A;  1VS0 A;  3H0G H;  3EIV A;  2V1C C;  1UE6 A;  2PQA A;  4JI3 L;  3DM3 A;  4P74 A;  4A3J G;  4A3E G;  1VQB A;  4DV5 Q;  3W1G A;  1HNZ Q;  4JI6 Q;  3E9H A;  4LF8 L;  1NBW A;  1I3Q H;  3CME A;  3I55 A;  1WYD A;  2B29 A;  3E0E A;  2WB1 G;  1KRT A;  4DK3 C;  1XPR A;  1S40 A;  3PIO A;  1JB7 A;  4X6A H;  2LXJ A;  2A8V A;  5IE8 A;  4GKJ Q;  3AFP A;  1VQF A;  4JBM A;  2FXQ A;  3D0F A;  4KI0 A;  1L0W A;  3CCE A;  3S2H H;  1YJN A;  3S1M H;  4A3M H;  1VQD A;  1XPU A;  3KF6 A;  4IFD I;  2BH2 A;  3HKZ E;  1UE5 A;  4O0A A;  4AH6 A;  3UE0 A;  3S1N H;  3I2Z A;  3WWV A;  4DR1 L;  1N36 L;  1XNQ Q;  3M85 A;  2HHH Q;  3CP0 A;  1LUZ A;  1KD1 C;  4NPS A;  4YCU A;  1I94 L;  1DGS A;  2KCT A;  4A3B H;  1YIT A;  1G6P A;  3F2D A;  4A3L G;  1L1O A;  5IP9 H;  3GTP H;  1HR0 L;  3HOV G;  3PCO B;  4WJ4 A;  3F1Z A;  1GD7 A;  4JI5 L;  4UP8 A;  1SE8 A;  1N33 Q;  2D62 A;  4AIM A;  1E22 A;  4JI8 Q;  3J80 i;  5JJL A;  1L1O B;  1HZA A;  4KHP L;  3I4O A;  2ALY B;  4GLV B;  1EQQ A;  5C0X I;  3I4N G;  1RIP A;  2UXC L;  1XMQ L;  4JI7 Q;  5IYC H;  2JA7 G;  3GTJ H;  2YU9 H;  2CWA A;  5FLM G;  2ZTD A;  1CSP A;  2KHJ A;  1XMO Q;  4JI0 L;  1D8L A;  1J6Q A;  5M3F G;  1PH4 A;  1SR3 A;  3TRZ A;  3HFZ B;  2Q2U A;  1HNW Q;  3CC2 A;  2WFW A;  1VQH A;  4X66 Q;  1JJ2 A;  1EYG A;  1L1O C;  1A63 A;  3GTL H;  2GN5 A;  2F4V Q;  4JV5 Q;  4DV4 Q;  1IBM L;  2JA6 G;  4R4I A;  1VQO A;  4Y52 H;  1IYJ B;  1XMO L;  2DUD A;  3S17 H;  4PMW A;  1N32 Q;  2OQK A;  3LGJ A;  4A3G G;  5JJK A;  2A19 A;  1WCM H;  3AEV A;  1T9H A;  5BR8 L;  1I94 Q;  1HNX L;  2UXB L;  1P16 A;  2NN6 I;  3ER0 A;  5GQO A;  2EQS A;  2F3I A;  3NEN A;  4JI2 L;  4HIO A;  5EAY A;  2YV5 A;  1OXX K;  1Q1B A;  3MXN B;  1HH2 P;  1X3F A;  4R1J A;  5LMU Q;  1Q82 C;  2AMC B;  2ZTC A;  3AFQ A;  5C0X J;  3CC4 A;  4JI4 Q;  4UP7 A;  1C9O A;  2F4V L;  3PGZ A;  1PA6 A;  2HIV A;  4GOP C;  2XGT A;  4POF A;  3KLW A;  1HZC A;  3CXC A;  3JC6 6;  2VNU D;  3J80 c;  1ASY A;  2CQO A;  1AE3 A;  4XIG S;  4BBR G;  4OON A;  4DR5 L;  3GD7 A;  4LFC Q;  3HOW H;  1JJG A;  2I0Q A;  2JE6 I;  3EBE A;  1OTC A;  4YCW A;  1QZG A;  1SRU A;  1U0L A;  1LM0 A;  1CUK A;  2EIF A;  4HJ9 A;  4B3M Q;  2UUB L;  4BY1 G;  5C3E G;  5IP7 G;  1X6O A;  2PI2 A;  4IJL A;  3HOU G;  2C35 B;  4PG3 A;  4AYB E;  2AWN A;  1XTD A;  1Q86 C;  4JI4 L;  4BBS H;  1N33 L;  4DR3 L;  4DUY Q;  3KDF A;  3CC7 A;  1OXU A;  1IBM Q;  3STB D;  3S14 H;  4K0K Q;  2YYZ A;  1V1Q A;  4LUO A;  1N34 Q;  1VQA A;  1Y1W H;  3E9I A;  4NXM L;  2ZJP A;  1VQM A;  4B3T Q;  4DV5 L;  1HNZ L;  3M9B A;  1VQI A;  1O7I A;  3CF5 A;  3S15 H;  3K0X A;  5JJI A;  1IBL L;  3ULL A;  1YI2 A;  4B3S Q;  3RNU A;  5AJ3 L;  1J5E Q;  3OYY A;  2Z0S A;  4DV6 Q;  1VQL A;  4LF9 Q;  4OWW B;  4YHH Q;  1XNR Q;  4PZ6 A;  3T1H Q;  1VQ4 A;  3A0J A;  4JYA L;  3G4S A;  3U4V A;  4B3T L;  4LF7 Q;  1SN8 A;  4MNO A;  1X56 A;  4DAY B;  3K80 C;  1PVO A;  4A3J H;  1GO3 E;  4A3E H;  3L2P A;  4GN4 B;  1EWI A;  4DR2 L;  1VQP A;  1NMF A;  3T1H L;  2JJQ A;  4A75 A;  4JYA Q;  2IY5 B;  3D31 A;  1B70 B;  5IP9 G;  3UDG A;  1X65 A;  3Q8D A;  1PH6 A;  4DUY L;  3U4Z A;  3ULP A;  1J5E L;  5LMN W;  3HOV H;  1IBL Q;  3I4M H;  2UXC Q;  4POG A;  3J7Z C;  1N8R C;  4BY7 G;  2R7Z H;  4DR7 Q;  1E24 A;  1IXR A;  2I5L X;  1SFO H;  5LMN L;  2HIX A;  4YY3 L;  3BZC A;  4DV7 L;  4JBJ A;  4A3F H;  3PSI A;  1K8G A;  4A3M G;  1IL2 A;  1KQS A;  1YJW A;  1N34 L;  3I4N H;  1CKN A;  3KJO A;  2JA7 H;  5IYC G;  1NJI C;  5FLM H;  1HR0 Q;  4R4T A;  1W2B A;  1FJG Q;  1KXL A;  1ASZ A;  3RZO H;  4ME3 A;  1QVC A;  2R92 H;  4JOI A;  1GVP A;  5JEA J;  4YY3 Q;  4DV7 Q;  3BJU A;  3I7F A;  1FGU A;  2OQ0 A;  4OXP A;  3ZJY C;  4QY7 A;  3CCV A;  4GNX B;  4HJ5 A;  1VQ5 A;  2KHI A;  2Q2I A;  4DK6 C;  4A3L H;  4JI0 Q;  1E1O A;  2K4K A;  3AYH B;  5IWA L;  4DV0 L;  4JI2 Q;  2CCZ A;  3NEM A;  4LF5 L;  4A3G H;  4MTN A;  4L5T A;  1X54 A;  1TWH H;  1WCM G;  3PO3 H;  4NXM Q;  2IHE A;  3FKI G;  1EQR A;  3A5U A;  3GDE A;  4UP9 A;  4LUV A;  4APV A;  2K52 A;  3F8T A;  4UY8 C;  4IOC A;  4DV4 L;  4LF4 Q;  4PZ8 A;  4DR3 Q;  2Y0S E;  4BA1 I;  2QEX A;  1C7Y A;  4B3S L;  3M3Y H;  5M3F H;  4HIK A;  4MZ9 A;  5HY6 A;  2BA1 A;  4X64 Q;  3PF4 A;  3IRB A;  1RL2 A;  4HID A;  1N9W A;  2NN6 G;  2UUB Q;  1Y1V G;  4RG1 A;  1H95 A;  5GAD C;  4QJF A;  1LYL A;  2K5V A;  3J81 c;  4JI3 Q;  2YTV A;  2HHH L;  4LF5 Q;  1FL0 A;  4LFC L;  3HOY H;  1VQK A;  1K9M C;  4LF4 L;  4GNX C;  4IPH A;  4IFD G;  2LSS A;  4GKK L;  1NY4 A;  4A3K H;  2JEA I;  4JV5 L;  2E2J H;  3AQQ A;  4YCV A;  1VCI A;  3CCS A;  3CPF A;  1VQJ A;  1YHA A;  1X3E A;  5IP7 H;  3GTM H;  1HNW L;  4A3C G;  4DUZ Q;  1XJV A;  1EUJ A;  2YTY A;  1OXT A;  4LF9 L;  2Q2T A;  3FP9 A;  4A3I G;  1BVS A;  5C4X H;  1MIU A;  5HGQ A;  3RLN A;  4DKA C;  5IYB G;  3G48 A;  4QQB X;  1U5K A;  1OXS C;  1HNX Q;  1EOV A;  1D7Q A;  2ID0 A;  3M4P A;  4PZ7 A;  2NZH A;  5GAH C;  2EXD A;  1XNQ L;  1X55 A;  1B8A A;  2JEB I;  4LWC A;  4DR1 Q;  1FJG L;  1E1T A;  4R4C A;  1K3R A;  2R6G A;  3CW2 C;  4IPG A;  1SRO A;  2VZA A;  5LMU L;  4P71 A;  1VQG A;  4GLX A;  1GM5 A;  2KEN A;  1X9N A;  5GAE C;  4GKJ L;  4LNQ A;  4HIM A;  2HQL A;  3NBH B;  1VQ9 A;  4DR7 L;  5M5X H;  5FLX c;  1AH9 A;  2N3S A;  3H15 A;  1N36 Q;  1PH7 A;  4A93 H;  4YWM A;  4DV6 L;  2VL6 A;  4LFA L;  1NMG A;  3HOX H;  4L5R C;  2KCM A;  3H0G G;  1WOC A;  5M5Y H;  1A0I A;  2ATW A;  1AE2 A;  2RHQ B;  4X66 L;  2OTJ A;  3M4Q A;  3S24 A;  2QGQ A;  3TQY A;  1KC8 C;  4DV2 L;  4XTC S;  2DGY A;  3M7N A;  2UUC L;  2AKW B;  4GLA C;  2JQO A;  4NB3 A;  3SGI A;  2Z6K C;  4LUZ A;  3JAM i;  2PMZ E;  2MFI A;  1EIY B;  5BR8 Q;  1UE1 A;  4FDB A;  4HJA A;  3S1R H;  1V43 A;  3KF6 B;  5DLQ E;  5IYD G;  1PH3 A;  3CD6 A;  1MKH A;  1N32 L;  2N78 A;  4A3D H;  1K8A C;  4DR5 Q;  2VS1 A;  4DV3 Q;  3HOZ G;  2B63 G;  1K83 H;  4LF6 Q;  4NXN L;  2JA5 G;  1YNX A;  1YEZ A;  4BA2 I;  4BXX G;  4OO1 I;  2K50 A;  3I4M G;  2A1A A;  4P73 A;  2GVB A;  3UDI A;  3TS2 A;  2ZJR A;  4BY7 H;  2WP8 J;  4R4O A;  2B3G A;  2CKZ B;  4C2M H;  2F52 A;  5IY0 A;  2UUA Q;  1KHI A;  1JJC B;  1A62 A;  2RCN A;  2JA9 A;  3FKI H;  4AQY Q;  4IJH A;  3ULJ A;  4A3F G;  1Q7Y C;  1PV4 A;  4JBK A;  2MO0 A;  4A76 A;  1JE5 A;  1V9P A;  4BXX H;  4HJ7 A;  2N8N A;  2Y0S G;  3PUV A;  1OXV A;  2LXK A;  3OW2 A;  2E2I H;  4KHP Q;  4OO1 G;  4DR4 Q;  4GOP B;  3RN5 A;  3T1Y L;  2JA8 G;  1IBK L;  2RF4 A;  1Y1V H;  2ZTE A;  1UWV A;  4HJ8 A;  4GN5 A;  1YIJ A;  3S1Q H;  1KL9 A;  4JBW A;  4X62 L;  2KBN A;  4DV1 L;  3S16 H;  4IPD A;  3HOY G;  3B6Y A;  1KAW A;  2Q2H A;  1SMX A;  1YJ9 A;  4GOP A;  1QVF A;  2VY3 A;  4JOI C;  4LF8 Q;  1VQ8 A;  3STB C;  5LMN Q;  3A5Z B;  1VQC A;  4UPA A;  2IHF A;  1BBW A;  5M3M G;  2PI2 E;  3OTO Q;  5C4J H;  2E5L Q;  2OWO A;  3PO3 G;  1Q12 A;  3CCJ A;  1Q8K A;  3RZD H;  2GVA A;  1I50 H;  1WJJ A;  1XMQ Q;  1BBU A;  1Q81 C;  4JI7 L;  4DAM A;  4NXN Q;  5IYB H;  4OWX B;  3KFU A;  1CKM A;  4C3H H;  2XTI A;  4X65 Q;  4DV2 Q;  2MO1 A;  2YTX A;  1K73 C;  3W5O A;  3S2D H;  3HKS A;  3PUY A;  4LW1 A;  1HR0 W;  4JI8 L;  5IT9 c;  3CCQ A;  1PFS A;  5C3E H;  4OX9 L;  2K5H A;  4TVA B;  1VQN A;  4J15 A;  5GRO A;  4YHH L;  1VQE A;  1XNR L;  2AWO A;  1PYS B;  1TWG H;  4DPG A;  3U50 C;  4A3B G;  4A3K G;  2K14 A;  2UUC Q;  4B3R L;  3RR5 A;  2PNH A;  2WAQ E;  4LFB L;  3U58 A;  2IX1 A;  4TQU S;  1Z47 A;  1M1K C;  1LTL A;  1YVC A;  4OX9 Q;  2UXB Q;  2NZO A;  3L0O A;  1EIF A;  1PH9 A;  4JI5 Q;  1E7Z A;  4JI1 L;  1WFQ A;  4OWT B;  2D0P A;  2RHS B;  5C0X G;  3BU2 A;  1PH2 A;  1E3P A;  3W1B A;  3CCR A;  1TWC H;  1PH1 A;  4EQ5 A;  4JC0 A;  3MEF A;  3KJP A;  2I5M X;  4BY1 H;  2JK8 A;  2WB1 E;  1SLJ A;  4B3M L;  2E5L L;  4JCV E;  3T1Y Q;  3H3V H;  1CKN B;  3FHW A;  3HOU H;  4BBS G;  5ELN A;  3DLL A;  3KF8 B;  1PHJ A;  2N49 A;  3UDF A;  4QGU A;  1MJE A;  1UE7 A;  3CPW A;  1S3O A;  1TWA H;  4DV1 Q;  3ICE A;  3J81 j;  1NE3 A;  1KIX A;  4AYB G;  1WI5 A;  1NTG A;  5IYD H;  4A3D G;  2H5X A;  4A93 G;  4LFB Q;  3HOZ H;  4DR6 Q;  2HT1 A;  3TS0 A;  3KYH C;  3PUX A;  2NVX H;  1S72 A;  1M90 C;  4JG2 A;  3PUZ A;  1YHB A;  3KDF B;  2VQF L;  2AHO B;  2D0O A;  1HJP A;  4DUZ L;  4ALP A;  2CWP A;  1VQ6 A;  2E2H H;  3F2B A;  1VQ7 A;  3NEL A;  3JAM c;  3GTK H;  3RN2 A;  4IOA A;  4X65 L;  4L5Q A;  3UE1 A;  1W3S A;  1HZ9 A;  4DR6 L;  2BH8 A;  4K0K L;  1I6H H;  3L7Z C;  3CAM A;  1Q46 A;  3RLF A;  2UXD Q;  1YHQ A;  3KOJ A;  5J3B A;  2R7Z G;  2K5N A;  4P72 A;  3UDX A;  2ZM6 L;  3CCM A;  3BZK A;  4C3J H;  3H3V I;  4O2D A;  3RLO A;  3K7U C;  4B3R Q;  4L5S A;  2K75 A;  2B63 H;  5FJ8 G;  4A4I A;  5M5W H;  1QZH A;  3A74 A;  1IZ6 A;  4C3I H;  2JA5 H;  2ASB A;  2VUM H;  2IX0 A;  1BKB A;  1FVI A;  3EN2 A;  4IFD J;  2R92 G;  2VQE Q;  3CMA A;  1PH8 A;  2UU9 L;  4X62 Q;  4GNX A;  4R4Q A;  3J7A 5;  3G71 A;  2UXD L;  1A8V A;  3GO5 A;  1IBK Q;  3VDY A;  2IT1 A;  1QVG A;  4Y7N H;  4RMF A;  3CCL A;  2ZJQ A;  4QIW E;  1G51 A;  1YZ6 A;  5FJ8 H;  1PH5 A;  3M4O H;  1P8L A;  1GKH A;  2L15 A;  1MJC A;  5E7N A;  4YWK A;  5JEA G;  1QUQ B;  3PF5 A;  1R9T H;  5C44 H;  1EFW A;  3I56 A;  2VUM G;  4WJ3 M;  2UU9 Q;  4DNI A;  2E8G A;  4AQY L;  2VQF Q;  2JA8 H;  2VQE L;  2NVY H;  3OTO L;  2VW9 A;  4DR4 L;  4A3C H;  4IO9 A;  2BA0 A;  4X64 L;  5H1S E;  2CFM A;  2JA6 H;  4BBR H; 
#chains in the Genus database with same CATH topology
 2R7D A;  4DV3 L;  3CHB D;  2UUA L;  1Z9F A;  2F0G A;  1PXU A;  1TWF H;  2QKI C;  3VR5 A;  1B7Y B;  3PO2 G;  1JMC A;  4TKO B;  4X3U A;  1SND A;  4H44 C;  1LTG D;  4DAV A;  4GKK Q;  3AU7 A;  4H02 A;  2JSO A;  4TSS A;  4KHZ A;  2OT2 A;  1Y1W B;  1YBY A;  2R7F A;  2NTS A;  5D3I B;  1LO5 D;  1Y1W G;  5ELO A;  5GAG C;  4QL5 A;  1X3G A;  2I5H A;  1TXY A;  3T56 B;  3I91 A;  4ZAI A;  3PV0 A;  3PO3 B;  1B4O A;  1VS0 A;  3BVZ A;  3EIV A;  1UE6 A;  1UUP A;  1LLR D;  2AQ3 B;  3SHL A;  3J81 L;  3L3O C;  4JI6 Q;  1EZ6 A;  3Q23 A;  5EQ0 A;  3C3L A;  1DON A;  3CME A;  3SK8 A;  4ZCK A;  3I55 A;  1WYD A;  2B29 A;  2F1M A;  3D6W A;  3W2D A;  5KNB A;  2A8V A;  3DUZ A;  2FXQ A;  3S2H H;  4RGM A;  3KF6 A;  4IFD I;  2BH2 A;  2RSO A;  2FMM A;  4CHT B;  3M4Y A;  3I2Z A;  3WWV A;  4DR1 L;  2PW5 A;  5DEH A;  1XNQ Q;  2HHH Q;  3A7A B;  1LUZ A;  1CA6 A;  4A3B H;  1E2Z A;  1G6P A;  3KUP A;  3I4L A;  4Q0F A;  2F3V A;  1L1O A;  3GTP H;  1HR0 L;  4WJ4 A;  1GD7 A;  4YIJ A;  3VYR A;  1N33 Q;  2LS0 1;  1VMC A;  4AIM A;  1E22 A;  1HUN A;  1VF7 A;  3FEW X;  3J80 i;  5JJL A;  1A3U A;  1L1O B;  4RA8 A;  3SEB A;  4CJ0 B;  3I4O A;  2ALY B;  5C0X I;  1RIP A;  2UXC L;  2JA7 G;  5IYC H;  3GTJ H;  2A6E C;  2F0M A;  1J6Q A;  1PH4 A;  3NTK A;  3GTL H;  3FPU B;  3R2T A;  2F4V Q;  2A68 C;  2JA6 G;  2A6H C;  2EY1 A;  1KLU D;  2DUD A;  2J4X A;  1STA A;  5BR8 L;  4V0B A;  1I94 Q;  1WTO A;  5JOB A;  1UNS A;  5GQO A;  3ER0 A;  3MFY A;  5EAY A;  4R1J A;  5LMU Q;  1Q82 C;  5I9O A;  1X3Q A;  2Q8I B;  5HUR A;  1GJX A;  4POF A;  5EKI A;  3VR6 A;  4FP5 D;  5A2Q L;  3KLW A;  3PMF A;  3JC6 6;  1SE3 A;  2VNU D;  5E4W C;  1ASY A;  3GD7 A;  1HCZ A;  4HJ9 A;  1WTP A;  2RCF A;  4BY1 G;  2PI2 A;  4IJL A;  3GTQ B;  2C35 B;  2NVQ B;  4AYB E;  1T5X D;  1XTD A;  3ERQ A;  4IN3 A;  4DUY Q;  2A73 B;  1V1Q A;  4LUO A;  1W6J A;  5I6Y A;  1Y1W H;  5C6A A;  1HNZ L;  2K03 A;  1HQM C;  1HTP A;  4WFN 3;  3K0X A;  1Z6H A;  4A3M B;  3ULL A;  1VDZ A;  3OIQ A;  1FNV A;  2KCC A;  1JC7 A;  1NR2 A;  3T1H Q;  3A7L A;  3A0J A;  4ZRZ A;  3A55 A;  3U4V A;  5C3X A;  4LF7 Q;  4MNO A;  4DAY B;  1EWI A;  4DR2 L;  1E2V A;  1NMF A;  4A75 A;  3T1H L;  2IY5 B;  3D31 A;  3TSS A;  2DY8 A;  5LMN W;  3J7Z C;  1TS5 A;  1N8R C;  2AQ2 B;  2R7Z H;  3HOX B;  5JJZ A;  1PRT D;  4HR7 B;  5ELF A;  3PSI A;  1IL2 A;  4A3M G;  1QCB D;  1KQS A;  4ZKC B;  2EXZ A;  2PZU A;  5FLM H;  4R4T A;  1FJG Q;  1IL8 A;  3RZO H;  2R92 H;  5JEA J;  1IKL A;  1TS2 A;  4YY3 Q;  1FGU A;  1LTR D;  3ZJY C;  2GA4 B;  1VQ5 A;  2Q2I A;  4DK6 C;  1E1O A;  2K4K A;  3OW7 A;  4DV0 L;  3CQZ B;  4JI2 Q;  1Y8O B;  4L5T A;  1V8Q A;  4NXM Q;  3SR1 A;  2BCO A;  3I4N B;  1EQR A;  3A5U A;  4FF2 A;  1G8Z D;  3KLR A;  4PZ8 A;  1C7Y A;  4B3S L;  4HIK A;  3BVG A;  2BA1 A;  2X69 A;  3I73 A;  3PF4 A;  4HID A;  1SBB B;  2NN6 G;  5EPK A;  4XT1 B;  1LYL A;  2HHH L;  1GUW A;  1FL0 A;  4LFC L;  1VQK A;  4IPH A;  2LSS A;  1NY4 A;  5EPJ A;  2E2J H;  2XRQ D;  1O80 A;  3IL8 A;  5C3W A;  2ICE C;  1XJV A;  4C56 C;  4LF9 L;  3A8J E;  4BBS B;  5JPM C;  3FP9 A;  5C4X H;  1DOM A;  4DK0 A;  2HDL A;  2ZXO A;  3DEO A;  3G48 A;  3IKJ A;  1OXS C;  1D7Q A;  4PZ7 A;  5GAH C;  5CV8 A;  2EXD A;  2JN4 A;  4Y7N B;  2MGS A;  1B3Q A;  1EY0 A;  1S5D D;  5ISR A;  2K28 A;  3KBX A;  2HQL A;  1STE A;  4DR7 L;  1LT5 D;  3TP8 A;  1BR9 A;  3H15 A;  1PH7 A;  3DEP A;  2MPM A;  2QW7 A;  1SFO B;  2WKD A;  1CZW A;  2RHQ B;  5EJW A;  4X66 L;  5J1Z A;  3DWQ A;  4DV2 L;  2DGY A;  5KRU A;  3QIA A;  4LMQ D;  2AKW B;  4CDD C;  1SMY C;  2KHS A;  3JAM i;  1STG A;  1EIY B;  3SXH A;  2O5I C;  2L12 A;  4HJA A;  1V43 A;  3W3A A;  4WJW A;  3RZD B;  4RCO A;  3S16 B;  4S3S A;  2JA5 G;  1GHJ A;  3MHB A;  1TQO A;  4BXX G;  1YNN C;  4CJ2 C;  2A1A A;  4P73 A;  2GVB A;  2QDL A;  1SE4 A;  5FO7 B;  3RD4 A;  4BY7 H;  3VR3 A;  2DY7 A;  3DWP A;  2PZW A;  2F0W A;  4R4O A;  1JOK A;  4E6I A;  3QJY A;  1A62 A;  3FKI H;  4KKT A;  4IJH A;  4N9P A;  4JBK A;  4A76 A;  1QJO A;  4K8J A;  4BY1 B;  1Q3L A;  5JEA H;  3OW2 A;  1OXV A;  2E2I H;  4KHP Q;  1SYF A;  5IGF A;  4DR4 Q;  3T1Y L;  3TZD A;  5IGB A;  2ICI A;  1YIJ A;  1UWV A;  4HJ8 A;  1KL9 A;  1Y69 U;  2X6L A;  4IPD A;  4DXG A;  1EZ8 A;  4R9W A;  3HOY G;  2Q2H A;  4IFD H;  2XNA C;  4LF8 Q;  5I9P A;  1MD2 D;  3OMC A;  2F0D A;  3TDQ A;  3VR2 A;  3OTO Q;  2OWO A;  5C4J H;  3F2U A;  4IUP A;  3O13 A;  2GVA A;  4A3B B;  1WJJ A;  3T53 B;  1XMQ Q;  1Q81 C;  4C3H H;  5I2Y A;  5I2X A;  1K73 C;  4DV2 Q;  2MO1 A;  2YTX A;  5KYL A;  3PUY A;  1HR0 W;  4OX9 L;  1SMY D;  1B9N A;  2Z4H A;  1STN A;  2PCF B;  2AWO A;  5IOC A;  2FIN B;  2MHV A;  4HTH A;  3P1H A;  2LMC B;  2IX1 A;  1M1K C;  1LTL A;  1CT1 D;  1RD9 D;  1EIF A;  2F3W A;  1MHW C;  4JI5 Q;  1E7Z A;  5HGT A;  1WFQ A;  1F2M A;  1PTO B;  3DWA A;  3BZD B;  1PH1 A;  1D1K A;  2E75 C;  4EQ5 A;  2KOL A;  1S5C D;  1MSG A;  1KNA A;  2E5L L;  1XWE A;  4JCV E;  3FHW A;  3HOU H;  1ENA A;  4HCE A;  1IKM A;  1PHJ A;  4C2M B;  1LTA D;  1V1P B;  1A3V A;  4L63 B;  5M5Y B;  1CFM A;  2NYZ D;  3K0Y A;  2Y0S B;  1WI5 A;  3A8K E;  4A3D G;  2PPB C;  4R8N A;  2HT1 A;  4FF1 A;  1EIG A;  5CGK A;  2NVX H;  3PUZ A;  3KDF B;  5M3F B;  1AP0 A;  2D0O A;  1HJP A;  4DUZ L;  2E2H H;  2KEC A;  1U4R A;  2BDO A;  3VYT A;  1TWA B;  1SXT A;  5I6W A;  1TWC B;  3T16 A;  1D5Z C;  3UDX A;  4QMG A;  1RKN A;  2ZM6 L;  4C3J H;  3CCM A;  3H3V I;  4B3R Q;  2FFK B;  4K2L A;  4A4I A;  3AMU A;  3VYS A;  1FVI A;  1D5M C;  2RSN A;  1PRT B;  2NVT B;  2UU9 L;  3NSW A;  1F2Y A;  2E74 C;  1R4P B;  2O4X A;  2DJF C;  3GO5 A;  1QVG A;  2Z4I A;  2ZJQ A;  1D1I A;  1GKH A;  2L15 A;  5JEA G;  3X3N A;  5C44 H;  3BDC A;  2E2J B;  4WJ3 M;  5ELB A;  1DD2 A;  2NVY H;  2VW9 A;  3OSO A;  1ZKO A;  2B2U C;  1SYE A;  1LV9 A;  3HOW G;  3CCU A;  2Z6K A;  3CKI B;  5C44 G;  5M3M H;  4YWL A;  2MNA A;  1J8I A;  1C0A A;  2VXW A;  3FMC A;  3CRK C;  3I8Z A;  1K3B C;  5K36 G;  1H9J A;  2F0H A;  3F2C A;  1CSQ A;  1II3 A;  4KLK A;  3K5N A;  1HZB A;  1HFN A;  3DHQ A;  5IWA Q;  4JI6 L;  2BE5 C;  2OCE A;  1DCZ A;  4QIW B;  3PO2 H;  4GN3 B;  3G6E A;  1DOK A;  1EOT A;  3JAM E;  3TRE A;  2NVQ H;  1Y14 B;  4A3I H;  4LF6 L;  2Q8R E;  3OMG A;  3PUW A;  2QA4 A;  3GTK B;  1PYB A;  2PZT A;  3H0G H;  2IJ0 A;  2V1C C;  2M9V A;  4JI3 L;  2TSS A;  4A3I B;  4DV5 Q;  3W1G A;  1JE4 A;  1J9O A;  1A15 A;  3MWY W;  1NBW A;  3E0E A;  1XPR A;  1EFI D;  4DK3 C;  4X6A H;  3PIO A;  1JB7 A;  2LXJ A;  3KBG A;  2DJG C;  5CV5 A;  1L0W A;  2R61 A;  3S1M H;  4A3M H;  1PMR A;  1VQD A;  3HKZ E;  4I7A A;  1UE5 A;  4O0A A;  1BOS A;  2EY2 A;  1FD7 D;  3I4M B;  4NPS A;  4YCU A;  1I94 L;  1DGS A;  3RUZ A;  1YIT A;  3FVQ A;  2XVS A;  5IP9 H;  1H9M A;  1FGB D;  2K1B A;  2NVY B;  3ONA B;  1PDQ A;  3OOC A;  2F0K A;  3F1Z A;  1CZG A;  1TWH B;  4KTA A;  1SE8 A;  4JI8 Q;  3M4O B;  4KHP L;  2TMP A;  1EQQ A;  3I4N G;  3J7Y W;  4NDX A;  2YU9 H;  5FLM G;  2ZTD A;  1CSP A;  2KHJ A;  1D8L A;  3RZO B;  3CC2 A;  5LL6 X;  1JB3 A;  2K32 A;  2MP1 A;  2WFW A;  1H9S A;  3R3O A;  1B3A A;  1VQH A;  4CBV A;  4FO2 A;  3TP7 A;  2GN5 A;  4JV5 Q;  4DV4 Q;  1KDA A;  2HCI A;  1IBM L;  1ONL A;  4O1N A;  3S17 H;  1G6Z A;  3K5M A;  3AEV A;  1T9H A;  2CHB D;  3I3C A;  1P16 A;  1LT4 D;  2F3I A;  3NEN A;  2YV5 A;  1PTO F;  1Q1B A;  1C4Q A;  5IOD A;  3CC4 A;  1PA6 A;  2NN6 H;  2Z9H A;  4ZLT F;  1AZP A;  1XXG A;  1MBY A;  1EYC A;  3E3X A;  2CQO A;  5COR A;  4LFC Q;  3HOW H;  2SDF A;  2I0Q A;  4P2C B;  5LL6 S;  1QZG A;  1SRU A;  1U0L A;  1LM0 A;  1CUK A;  3C46 A;  5IGG A;  4BBS H;  4JI4 L;  3K5O A;  3HOU B;  1MSH A;  4HMI A;  2EYL A;  5E3F A;  1WTR A;  1OXU A;  1IBM Q;  3S14 H;  5FO9 B;  3NQI A;  5IGE A;  1N34 Q;  4CDF C;  3N6R A;  1C48 A;  3E9I A;  2KA7 A;  4NXM L;  1B9M A;  4DV5 L;  3M9B A;  2B63 B;  1VQI A;  1O7I A;  3CF5 A;  5JJI A;  2E2H B;  1IBL L;  1SNO A;  3OYY A;  2Z0S A;  4DV6 Q;  4OWW B;  4LF9 Q;  4YHH Q;  1XNR Q;  4JYA L;  5K5P A;  4G7Z C;  4B3T L;  1SN8 A;  2B2W C;  1X56 A;  1PVO A;  1GO3 E;  4A3E H;  3L2P A;  4GN4 B;  4ZK9 B;  1J5E L;  3ULP A;  3U4Z A;  3HOV H;  2JA8 B;  2CW0 C;  5C5L A;  5IT9 E;  1NR4 A;  2EOT A;  3NP8 A;  1W6K A;  5BN5 A;  4POG A;  2PNR C;  1WTH A;  4FNF A;  4BY7 G;  3S17 B;  2D9U A;  1SFO H;  1HA5 A;  1I6V C;  2VB2 X;  2A6E D;  5J22 A;  3S15 B;  1ESR A;  1YJW A;  3HRZ C;  3KJO A;  3QB3 A;  4L6T B;  3D4D A;  3I72 A;  1GVP A;  3MZ5 A;  2N55 A;  2WII B;  3I7F A;  4OXP A;  3CCV A;  3EQL C;  4GNX B;  4HJ5 A;  3GTL B;  2EYH A;  2Z8L A;  4JI0 Q;  3AYH B;  5C3E B;  1IYV A;  4LF5 L;  1WCM G;  2G9D A;  2F0I A;  1EEF D;  3GDE A;  4LUV A;  2K52 A;  4BA1 I;  2QEX A;  1LTI D;  3NBI A;  4H7B A;  3M3Y H;  4MZ9 A;  3IRB A;  1RL2 A;  4EQP A;  4A3K B;  2NVX B;  2L0C A;  2B2T C;  1H95 A;  2K5V A;  4LF5 Q;  1F2Z A;  5ELD A;  4LF4 L;  1LT6 D;  2K6A A;  4J1M A;  1FNU A;  3CPF A;  1VQJ A;  1YHA A;  1I4Q A;  4OEL B;  5IP7 H;  1CI3 M;  3GTM H;  1HNW L;  2L4N A;  4DUZ Q;  3TP6 A;  4FVM A;  4EQN A;  4A3J B;  4IUN A;  3RLN A;  4J8Q A;  5G3L D;  1NUC A;  2JEB I;  4LWC A;  4LJZ C;  4R4C A;  1CQV A;  2R6G A;  3CW2 C;  4QB4 A;  2VZA A;  3DMU A;  4K2K A;  1VQG A;  4JK1 C;  5GAE C;  4GKJ L;  4HIM A;  1O7Y A;  5M5X H;  4DNR B;  3I90 A;  5FLX c;  1I50 B;  2RDF A;  4XQJ A;  4DV6 L;  4CDC C;  1VMP A;  4NP5 A;  2VL6 A;  1NMG A;  3HOX H;  4L5R C;  4LAA A;  2WIN B;  2KCM A;  4X3T A;  1WOC A;  2B2Y A;  1AE2 A;  2NZ1 D;  1A2T A;  2P5Z X;  2Q8T A;  4QUF A;  1KC8 C;  2B2V A;  3V96 A;  3EJI A;  4NB3 A;  2F0O A;  2EYJ A;  5EGT A;  2PMZ E;  5BR8 Q;  2LFN A;  2EYP A;  1UE1 A;  2R3Z A;  3NUC A;  3S1R H;  3KF6 B;  1B1Z A;  1PH3 A;  1RTN A;  5IYD G;  5D65 A;  4A3D H;  3GTG B;  1K8A C;  5E1F A;  4DV3 Q;  1BCP B;  5FLX E;  3A54 A;  1EY7 A;  3I4M G;  1LAB A;  3UDI A;  1D5X C;  3GTO B;  4A3B G;  2EY5 A;  2B3G A;  5IY0 A;  1JJC B;  2RCN A;  5FK9 C;  4A3F B;  1S4Z A;  1JE5 A;  1V9P A;  1C8C A;  4BXX H;  2Y0S G;  4XYO A;  3G7L A;  1FNW A;  4WOR A;  4FXD A;  1ROD A;  2G5D A;  2RF4 A;  2K01 A;  4GN5 A;  5JVH 3;  4JBW A;  4X62 L;  3AB9 A;  1SDF A;  2KBN A;  3S16 H;  1ILP A;  3B6Y A;  1SMX A;  2EJG C;  3H6M A;  1BDO A;  2VY3 A;  2J7Z A;  1VQ8 A;  2HDM A;  5LMN Q;  3V05 A;  5M3M G;  2IHF A;  1BBW A;  4DNT B;  5A35 A;  3EA6 A;  3RZD H;  1SNQ A;  2ZXR A;  3E0J A;  1I50 H;  5IYB H;  1TY0 A;  3W5O A;  3S2D H;  2UXB L;  4JI8 L;  1VQN A;  1X3P A;  2F0T A;  5C3E H;  1G91 A;  1V1P A;  1PYS B;  4KK7 A;  1PZJ D;  2XIW A;  3U50 C;  4AYB B;  4F87 A;  1EY4 A;  4J6H A;  4TRD A;  1ET6 A;  1GUN A;  2WV6 D;  4LFB L;  4TQU S;  1Z47 A;  5M5W B;  2UXB Q;  2NZO A;  1KAA A;  1PH9 A;  3R93 A;  2A5H A;  4DF7 A;  4OWT B;  1U4P A;  1MI2 A;  5COY A;  5FKA C;  3KF8 A;  1TR5 A;  3MEF A;  5DM7 3;  1H9K A;  2I5M X;  2R93 B;  1RTO A;  1HTL D;  3T1Y Q;  1CKN B;  5EKK A;  3H3V H;  3D4W A;  3NK9 A;  3J7A V;  5M9O A;  3DLL A;  3KF8 B;  3MVV A;  4QGU A;  1MJE A;  2KUM A;  1HQR D;  1UE7 A;  1OO9 B;  1S3O A;  1TWA H;  3ICE A;  1BO0 A;  1K8M A;  1EWH A;  5JPN C;  4G57 A;  2B2T A;  1PFM A;  5D3D A;  3S14 B;  1SNM A;  3PUX A;  1S72 A;  2WB1 B;  1S5B D;  1BXT A;  1YHB A;  4PMC A;  1I3Q B;  5CBE E;  2QF7 A;  3NEL A;  1WTQ A;  5KND A;  2CQA A;  4IOA A;  1LAC A;  1KNE A;  2F0F A;  3UE1 A;  2F0V A;  3HS0 C;  4ZUI A;  5M5X B;  1HZ9 A;  5T1G A;  4K0K L;  1I6H H;  3CAM A;  4H13 C;  2F4I A;  3HOW B;  1YHQ A;  3KOJ A;  2R7Z G;  1H9R A;  2A69 C;  1A6X A;  1EY6 A;  3K6O A;  4O2D A;  3K7U C;  1CK1 A;  4UAI A;  5FJ8 G;  5M5W H;  3A74 A;  1IZ6 A;  2VUM H;  1BKB A;  1WTX A;  3EN2 A;  2HUG A;  3ITP A;  2EYO A;  1PH8 A;  3CMA A;  2R92 G;  3GQB A;  1FR3 A;  1JOQ A;  3MXG A;  3G71 A;  3Q6S A;  1IBK Q;  4CKE A;  2IT1 A;  3T51 B;  1STH A;  4Y7N H;  3M4O H;  2JYO A;  5KEE A;  1ENF A;  5E7N A;  3PF5 A;  2VUM G;  1R9T H;  3SK4 A;  1NSN S;  2UU9 Q;  2V4D A;  2JA8 H;  2VQF Q;  2MJ8 A;  4N8F A;  2X6G A;  4IO9 A;  2FHT A;  5H1S E;  4A3E B;  2CFM A;  2JA6 H;  1L0Y B;  2R93 G;  4DU9 A;  1D6E C;  3LWU A;  4KY6 A;  2PW7 A;  2NVT H;  2ZM6 Q;  3K8A A;  3NTH A;  4IPC A;  4ID6 A;  3URY A;  1JT8 A;  1Q1E A;  1F77 A;  3SK6 A;  1G29 1;  3K81 C;  3K7A H;  4ABN A;  3BDO A;  4GS3 A;  4HSV A;  5FO8 B;  1EYD A;  3H09 A;  1AFP A;  1UEB A;  5EPL A;  3TEH B;  1CKO A;  4DR2 Q;  3D6C A;  5KYI A;  2ES2 A;  1GUT A;  1K83 B;  1L2F A;  4P75 A;  3PIP A;  1E2W A;  4LF7 L;  3NBH A;  5KGU A;  1F2L A;  1JWU D;  4LFA Q;  1KRS A;  2PQA A;  1AZQ A;  2QDB A;  4P74 A;  2K33 A;  1VQB A;  4A3E G;  2F0Q A;  1HNZ Q;  4RHS A;  3TBI B;  3VA7 A;  3E9H A;  4LF8 L;  1KTK A;  4ZUJ A;  5M3M B;  1KRT A;  4PQX A;  5IE8 A;  3K58 A;  4GKJ Q;  3AFP A;  4JBM A;  4KI0 A;  5CBA E;  2D5D A;  1XPU A;  1STY A;  1BCP C;  4OIJ A;  4OGQ C;  3UE0 A;  2H4O A;  3TP5 A;  1N36 L;  1IW7 D;  4KKU A;  1KD1 C;  2HCC A;  2KCT A;  3K59 A;  1I4P A;  3NTI A;  4DN4 M;  3F2D A;  4XQN A;  4HMJ A;  3HOV G;  3KLS A;  1ICF B;  3PCO B;  2HD3 A;  4RKB A;  4UP8 A;  1CHP D;  4DA2 A;  2D62 A;  1GUG A;  2CH4 A;  3X3M A;  1BUV T;  1DXM A;  2B2V C;  3K5L A;  3QOJ A;  1GUO A;  1XMQ L;  1B2T A;  2CWA A;  5L37 A;  2PO4 A;  3TRZ A;  3HFZ B;  1BBX C;  4FXG C;  4X66 Q;  1JJ2 A;  1EYG A;  1A63 A;  3HOY B;  3OIP A;  4Y52 H;  4OO1 H;  1SNC A;  2OQK A;  3LGJ A;  1PFN A;  1WCM H;  5DAU A;  2JA7 B;  3R8B A;  1NNX A;  3HOZ B;  1A2U A;  2NN6 I;  1TS4 A;  1SYC A;  1OXX K;  1WCM B;  1HH2 P;  1X3F A;  3MXN B;  1CA5 A;  1B50 A;  2ZTC A;  4JI4 Q;  1C9O A;  5IGC A;  1R9T B;  3BG3 A;  3PGZ A;  2JA5 B;  2G9H D;  1HZC A;  2F0E A;  1HXY D;  3J80 c;  1AE3 A;  1I4G A;  4XIG S;  4BBR G;  4OON A;  1EU4 A;  2JE6 I;  1OTC A;  4B3M Q;  2EIF A;  3EFX D;  3A56 A;  5FOB B;  5IP7 G;  2EE1 A;  4PG3 A;  2AWN A;  4KY7 A;  1F9Q A;  2RVL A;  3FRP B;  1QWY A;  3CC7 A;  2EZV A;  1GUS A;  4K0K Q;  1F9S A;  2YYZ A;  4I7Z C;  1VQA A;  4B3T Q;  2B8G A;  2CH4 W;  3NQT A;  1TWG B;  3S1N B;  3S15 H;  3T4A C;  1YI2 A;  3WDN A;  5AFW A;  5BN4 A;  5AJ3 L;  3RNU A;  4B3S Q;  1VQ4 A;  5IT9 L;  3HGB A;  1XYI A;  2K04 A;  3K80 C;  4OIK A;  1VQP A;  2IX3 A;  3Q8D A;  1PH6 A;  3TZU A;  3I4M H;  3NPP A;  3GV6 A;  3P75 A;  2VUM B;  3R2I A;  1IXR A;  3T13 A;  2HIX A;  3OWE B;  4YY3 L;  2YU9 B;  4DXF A;  1K8G A;  4BWG B;  2JA7 H;  1ILQ A;  4IAL A;  1NJI C;  1X32 A;  4RGN A;  3BVM A;  1KXL A;  5J39 A;  4ME3 A;  2NB0 A;  1EY8 A;  4NKL A;  3LX0 A;  3BJU A;  1ZXT A;  2WKC A;  2L55 A;  2OQ0 A;  1T5E A;  2KHI A;  5IWA L;  2CCZ A;  3NEM A;  1JOR A;  4A3G H;  1BNZ A;  3SDZ A;  3CU7 A;  1X54 A;  1QNK A;  2H1E A;  1S5E D;  2IHE A;  3FKI G;  2ENB A;  3P20 A;  5A2Q E;  4UP9 A;  4UY8 C;  3F8T A;  5CYU A;  4DV4 L;  4IOC A;  4LF4 Q;  4DR3 Q;  2Y0S E;  4B9X A;  1VF5 C;  1N9W A;  2KQ3 A;  2UUB Q;  1HFG A;  5GAD C;  4QJF A;  4JI3 Q;  3J81 c;  2YTV A;  5C5M A;  3HOY H;  1K9M C;  4IFD G;  4GKK L;  2FJ2 A;  2ZXP A;  3AQQ A;  1VCI A;  3IFD A;  1B44 D;  2QEJ C;  4A3C G;  1EUJ A;  2YTY A;  2Q2T A;  1BVS A;  1Y8P B;  4DKA C;  2AQ1 B;  5IYB G;  2F03 A;  4MIU A;  4XYQ A;  1HNX Q;  1I6H B;  2ID0 A;  5D14 A;  3M4P A;  2LKV A;  2NZH A;  2BOS A;  4PV1 C;  2IL8 A;  1E1T A;  2C9O A;  1K3R A;  3NWT A;  1SRO A;  4IPG A;  5LMU L;  1RF2 D;  1RDP D;  4V19 0;  3SK5 A;  2OXP A;  1CQF A;  1VQ9 A;  3HOV B;  4RKL A;  1AH9 A;  1N36 Q;  1CTM A;  1E0B A;  4A3D B;  3C1F A;  1SE2 A;  3A8I E;  4JPB W;  5C4J B;  1F9R A;  3H0G G;  4KKS A;  1A0I A;  2ATW A;  1BF4 A;  2QGQ A;  2KVM A;  2QIL A;  1JR0 D;  1JCK B;  4XTC S;  5T1I A;  4CDE C;  1JIC A;  1WTW A;  2JQO A;  4QUC A;  4JVZ A;  5KIX A;  1EEI D;  5DLQ E;  1MKH A;  4A93 B;  1N32 L;  2PYK A;  1TII D;  2BE5 D;  3J81 E;  3H3V C;  4KMU C;  1DZ1 A;  1K83 H;  3N52 A;  1LTT D;  1SYD A;  1YNX A;  4BA2 I;  4OO1 I;  1UEA B;  1BCP D;  3TS2 A;  1RCV D;  1CHQ D;  4C2M H;  2CKZ B;  1KHI A;  3SVM A;  1PV4 A;  4A3F G;  3JAM L;  4AQY Q;  3E5S A;  3ULJ A;  1Q7Y C;  4ODG A;  1U4M A;  1YNJ D;  2XWB B;  2K7V A;  1F9P A;  3CRL C;  4BY7 B;  4HJ7 A;  2N8N A;  2LXK A;  5BN3 A;  4GOP B;  3RN5 A;  2JA8 G;  1Y1V H;  2ZTE A;  2XWJ B;  3S1Q H;  4KN7 C;  2L5T A;  1KAW A;  4K6L A;  2VB3 X;  5CV7 A;  4GOP A;  2KEE A;  2Z6B A;  5E4X A;  3ND9 A;  3BS1 A;  3A5Z B;  1VQC A;  2PI2 E;  2E5L Q;  3PO3 G;  4KHV A;  1Q12 A;  2A69 D;  3MA2 B;  2IPK D;  1Q8K A;  2M2L A;  4QCL A;  4NXN Q;  3MTS A;  2KCN A;  4X65 Q;  3HKS A;  3J7A F;  1RHP A;  3CCQ A;  1PFS A;  1K28 A;  3GP7 A;  2K5H A;  4TVA B;  2NTT A;  4J15 A;  5EBC A;  1H9S B;  1VQE A;  1I4R A;  1TWG H;  5C0X H;  4PNY A;  2RQX A;  2K14 A;  2UUC Q;  1TY2 A;  3RR5 A;  3H91 A;  4UDU C;  1EQT A;  1YVC A;  3BYY B;  4OX9 Q;  2BDN A;  2DNC A;  4OEM B;  5CV6 A;  4JI1 L;  2D0P A;  2RHS B;  5C0X G;  3BU2 A;  1PH2 A;  1E3P A;  3W1B A;  4EGV A;  3E6Z X;  3KJP A;  4RWS C;  3LNN A;  4F8M A;  3RMH A;  4BY1 H;  2JK8 A;  1SLJ A;  4B3M L;  1EL0 A;  2CVR A;  4DAY A;  1M4V A;  5ELN A;  2N49 A;  3CPW A;  1NAP A;  3HZX A;  3S2D B;  3OHX C;  1PYW D;  2RA4 A;  3D4R A;  3J81 j;  1NE3 A;  2SEB D;  4C1N I;  1KIX A;  3QR8 A;  4K8I A;  1NTG A;  4RFB A;  4A93 G;  1ICW A;  3HOZ H;  4DR6 Q;  3TS0 A;  2SNS A;  3KYH C;  1HA6 A;  5EKL A;  1EWC A;  2L11 A;  2EYM A;  2EY6 A;  1G2T A;  3VA5 A;  1SEB D;  2SOB A;  2AHO B;  1YNJ C;  1VQ6 A;  3F2B A;  4RH6 A;  3GTK H;  4G7O C;  3RN2 A;  4FF3 A;  4X65 L;  4Q5V A;  4L5Q A;  4DR6 L;  2BH8 A;  2UXD Q;  1G2S A;  1EQV A;  4C3I B;  5J3B A;  2C5C A;  3PQI A;  4P72 A;  2KED A;  3BZK A;  2M00 A;  4CKB A;  4L5S A;  3D8G A;  1QZH A;  4C3I H;  2IX0 A;  2VQE Q;  4GNX A;  2E2D C;  4R4Q A;  4RGO S;  2UXD L;  1A8V A;  3MXP A;  4U68 A;  2ZT9 C;  1AW7 A;  4RMF A;  3CCL A;  4QIW E;  1PTO C;  3SE0 A;  3D3R A;  2EVB A;  5FJ8 H;  1PH5 A;  2XRS D;  3ZYY X;  4C3I G;  2F0N A;  3I56 A;  4HAE A;  4H0L C;  4DNI A;  2E8G A;  4AQY L;  4DR4 L;  1KDB A;  2SNM A;  2RDH A;  2BA0 A;  4RHR A;  3BDL A;  5LHY 1;  4BBR H;  2PQA B;  1O78 A;  1BCP F;  3HEJ A;  2EYF A;  2MQH A;  2OTL A;  2WAQ G;  3IFT A;  1PTO D;  3VR4 A;  5AJ3 Q;  2R93 H;  4DV0 Q;  3ERS X;  4XT3 B;  1XPO A;  1GXD C;  3J81 i;  1AN8 A;  1QUQ A;  3CQZ H;  1PLF A;  3GTP B;  4QF4 A;  1QG7 A;  3GTQ H;  4EX5 A;  3GTG H;  1K0R A;  3HKZ G;  5C4X G;  1SJH D;  4IUQ A;  4JI1 Q;  1QOH A;  3HOX G;  3GTO H;  1I5F A;  4R8I A;  3DM3 A;  4RCN A;  4A3J G;  2AUJ D;  4KV6 A;  1EY9 A;  1ZYR C;  1I3Q H;  1YNN D;  2DNE A;  2WB1 G;  1S40 A;  4IQZ A;  4ZYS A;  1VQF A;  2Z1C A;  3D0F A;  5CV4 A;  1RJT A;  3CCE A;  1YJN A;  5CC4 A;  4AH6 A;  4B9W A;  3S1N H;  2L9H A;  3L9A X;  1U9R A;  4EVO A;  1KAB A;  3M85 A;  3CP0 A;  2EDG A;  1QE6 A;  4A3L G;  1PZK D;  3Q22 A;  3FDT A;  4JI5 L;  4U67 3;  2E2I B;  2OEO A;  2IW3 A;  4IUT A;  1HZA A;  2A6H D;  4RAU C;  4GLV B;  3MXN A;  1IYU A;  4JI7 Q;  4DAP A;  3QWN A;  1XMO Q;  3KLS X;  4JI0 L;  1XTC D;  4IUR A;  5M3F G;  1SR3 A;  4A3G B;  2Q2U A;  1HNW Q;  3EVQ A;  5TSS A;  1DOL A;  2LY7 A;  1L1O C;  2EJM A;  2RKS A;  3S2H B;  2K05 A;  2I07 B;  4R4I A;  1VQO A;  1IYJ B;  1S5F D;  1XMO L;  4PMW A;  5IGD A;  1N32 Q;  4A3G G;  5JJK A;  2A19 A;  1GHK A;  1WTV A;  1HNX L;  3K7A B;  4JI2 L;  2EQS A;  1SYG A;  4HIO A;  3MFG A;  3M7G A;  2AMC B;  3AFQ A;  5C0X J;  4UP7 A;  4RGT A;  2F4V L;  1SYB A;  2HIV A;  4GOP C;  2XGT A;  2K5D A;  4HSP A;  3MXU A;  1DJR D;  3CXC A;  3K57 A;  1ZYR D;  1TU2 B;  2WAC A;  4DR5 L;  4KJN A;  4LK1 C;  1JJG A;  4C3H G;  3EBE A;  2CW0 D;  1JOO A;  4WRD A;  4YCW A;  1WVL A;  2UUB L;  2RBM A;  5C3E G;  1X6O A;  1PZI D;  3HOU G;  1ET9 A;  1Q86 C;  1N33 L;  4DR3 L;  1Y1V B;  3H94 A;  3KDF A;  3STB D;  4EQO A;  5C4Z A;  1QIL A;  2ZJP A;  4UHV A;  1VQM A;  2OF1 A;  4ME5 A;  4GZY C;  2E76 C;  1VQL A;  1J5E Q;  1LTS D;  2B2W A;  4N8X 1;  1Q90 A;  4I65 A;  4PZ6 A;  3UI2 A;  2K5W A;  3G4S A;  2A68 D;  1XX8 A;  1HHV A;  1JWS D;  2KJX A;  1WD0 A;  3HKZ B;  4A3J H;  4DGZ A;  4JYA Q;  2JJQ A;  3UDG A;  1B70 B;  3GV3 A;  5IP9 G;  1X65 A;  1I4X A;  4DUY L;  4HED A;  3NE5 B;  1IBL Q;  2F0S A;  3MAQ A;  2UXC Q;  4G7H C;  1MGS A;  1KDC A;  1E24 A;  2I5L X;  4DR7 Q;  5LMN L;  4DV7 L;  3BZC A;  3GTJ B;  2B2U A;  2PQE A;  4JBJ A;  4A3F H;  5DNF A;  4G4K A;  4M1U B;  5JAV A;  4X3K A;  3NWS A;  1N34 L;  1CKN A;  3I4N H;  5IYC G;  2B39 A;  4Z9C B;  1HR0 Q;  1W2B A;  1ASZ A;  1QVC A;  5DM6 3;  4JOI A;  2L1B A;  3OWF A;  2N88 A;  4DV7 Q;  5NUC A;  3U9S A;  3FKI B;  1Q8I A;  4QY7 A;  4A3L H;  1L0X B;  4DK1 A;  4OL7 A;  4KY5 A;  1DYQ A;  1ENC A;  3IAY A;  5C4H A;  4MTN A;  1O7Z A;  4K14 A;  1TWH H;  1V1O A;  4MN3 A;  3HG9 A;  3PO3 H;  2IWH A;  2B8F A;  4ZKB B;  1SAP A;  4APV A;  3QG1 A;  1LT3 D;  3ERO A;  4XXE A;  1O7L A;  5M3F H;  5HY6 A;  1R4Q B;  4X64 Q;  1HPC A;  1Y1V G;  4RG1 A;  2O5J C;  5K36 H;  3GTM B;  5IIF A;  4GNX C;  3S1Q B;  1NCV A;  3G6J B;  4A3K H;  2JEA I;  4JV5 L;  4YCV A;  4BS9 A;  1TT2 A;  4C1N K;  4C3H B;  3CCS A;  1EYA A;  4KJO A;  5ELE A;  1X3E A;  4HN7 A;  2I46 A;  4JW0 A;  1OXT A;  2O2L D;  4L8J A;  4A3I G;  5HGQ A;  1MIU A;  3QOL A;  3J80 L;  4NW2 A;  1B53 A;  4N9T A;  4KD4 A;  4QQB X;  1U5K A;  1EOV A;  1M8A A;  4ILW A;  1XNQ L;  1X55 A;  1B8A A;  5EBD A;  4DR1 Q;  1FJG L;  4B08 A;  4C3J B;  1JQY D;  4P71 A;  4GLX A;  1GM5 A;  1TWF B;  2KEN A;  1X9N A;  4LNQ A;  3NBH B;  1CM9 A;  2N3S A;  4A93 H;  1ZEQ X;  4YWM A;  3S1M B;  5ELC A;  2R7Z B;  4LFA L;  5G3L F;  4OHJ A;  1ML0 D;  5M5Y H;  4XQQ A;  4BBR B;  2HQE A;  1K0S A;  2OTJ A;  3M4Q A;  3S24 A;  3TQY A;  2F0P A;  3I70 A;  2NWG A;  4IUV A;  3M7N A;  3S1R B;  4F7X A;  2UUC L;  4GLA C;  3SGI A;  1LTB D;  2Z6K C;  4LUZ A;  3C2P A;  2MFI A;  2AUK A;  1U4L A;  5CV9 A;  3CD6 A;  4FDB A;  1TS3 A;  5CR3 A;  2N78 A;  2XN9 C;  4K5X A;  4DR5 Q;  2VS1 A;  1SSO A;  3C1E A;  3HOZ G;  2B63 G;  4LF6 Q;  4NXN L;  4CKC A;  1YEZ A;  2JP1 A;  2K50 A;  2A74 C;  3HP3 A;  2ZJR A;  2WP8 J;  1EY5 A;  2UUA Q;  2F52 A;  2EJF C;  1KLG D;  2JA9 A;  5F2D A;  1HRJ A;  1Y8N B;  1I4H A;  2MO0 A;  4DFA A;  3PO2 B;  1ESF A;  1HUM A;  4FF4 A;  2NBF A;  4OO1 G;  3PUV A;  2B2Y C;  5KNC A;  1GOZ A;  1IBK L;  3TME A;  4DV1 L;  4F88 A;  1SNP A;  1YJ9 A;  1QVF A;  4ZQ3 A;  1FYC A;  4JOI C;  3WOE A;  3STB C;  5C44 B;  1EU3 A;  2D2C C;  4UPA A;  2MUY A;  3MEH A;  5C4X B;  1PRT F;  5CMD A;  1BQQ T;  4HCS A;  3CCJ A;  2JXM B;  5JVG 3;  4KD3 A;  4FYD A;  3TN2 A;  4JI7 L;  1BBU A;  4DAM A;  4OWX B;  3KFU A;  1CKM A;  3PIP 3;  2XTI A;  3Q0A A;  4K5V A;  3M3Y B;  4LW1 A;  3ND8 A;  5IT9 c;  1DM0 B;  3QO2 A;  3VYU A;  2WAQ B;  5GRO A;  4YHH L;  2F0J A;  1XNR L;  1QNU A;  2DN8 A;  3FPP A;  4DPG A;  3NHH A;  4A3K G;  3LWE A;  4B3R L;  2PNH A;  2WAQ E;  3U58 A;  2QCP X;  5I4D A;  2FMC A;  4X3S A;  4MHE A;  3L0O A;  4CGY B;  3MC0 B;  2F0L A;  3CCR A;  1TWC H;  3KK7 A;  3H0G B;  4JC0 A;  1IW7 C;  1SJE D;  3DM1 A;  3J80 E;  2J0T D;  2WB1 E;  1JWM D;  1K8O A;  4BBS G;  4IZ8 A;  3UDF A;  4IUU A;  4K6D A;  4DV1 Q;  4AYB G;  2JA6 B;  5IYD H;  2EPB A;  2H5X A;  4LFB Q;  4FXK C;  1WD1 A;  4MTK A;  3WOF A;  1M90 C;  4JG2 A;  4KN4 C;  3S9W A;  3U9O A;  1PFB A;  2RDG A;  2VQF L;  4NMZ A;  4ALP A;  1TVX A;  2CWP A;  1VQ7 A;  4C3J G;  3JAM c;  1PTO H;  3DXJ C;  2K5Q A;  1Z7T A;  1AEX A;  1W3S A;  1UAP A;  4K5W A;  2F0U A;  4M8A A;  3L7Z C;  1Q46 A;  3P7J A;  3RLF A;  4O42 A;  1D2B A;  2K5N A;  1QB5 D;  3OPO A;  3RLO A;  2K75 A;  2B63 H;  4XDX A;  2JA5 H;  2ASB A;  1EIH A;  2XSC A;  2R92 B;  2NUC A;  4IFD J;  5FLX L;  4X62 Q;  3J7A 5;  1TKW B;  3BYT B;  3VDY A;  3Q24 A;  3PIO 3;  1G51 A;  1YZ6 A;  4PMB A;  1A3T A;  1IHZ A;  1P8L A;  4YWK A;  1MJC A;  1QUQ B;  1EFW A;  3NXW A;  4CJ1 B;  4ULL A;  1PRT C;  2VQE L;  3OTO L;  4A3C H;  3V2T A;  4X64 L;  1STB A;  2PMZ B; 
#chains in the Genus database with same CATH homology
 2R7D A;  2PQA B;  2R93 G;  3HOW G;  3CCU A;  2Z6K A;  5C44 G;  2NVT H;  2ZM6 Q;  3K8A A;  4DV3 L;  4IPC A;  2UUA L;  1Z9F A;  5M3M H;  4YWL A;  1TWF H;  2MNA A;  1JT8 A;  1B7Y B;  1Q1E A;  3PO2 G;  1C0A A;  1JMC A;  1G29 1;  3K81 C;  3K7A H;  2MQH A;  2OTL A;  2WAQ G;  4GS3 A;  5K36 G;  3F2C A;  4GKK Q;  1CSQ A;  4H02 A;  4KLK A;  1HZB A;  5AJ3 Q;  1UEB A;  4KHZ A;  3ERS X;  5IWA Q;  4DV0 Q;  1XPO A;  4JI6 L;  1YBY A;  2R93 H;  3J81 i;  2R7F A;  1Y1W G;  2OCE A;  3TEH B;  1CKO A;  4DR2 Q;  1QUQ A;  5ELO A;  3CQZ H;  5GAG C;  4QL5 A;  1X3G A;  2ES2 A;  3PO2 H;  1L2F A;  2I5H A;  1TXY A;  4GN3 B;  4P75 A;  3PIP A;  3G6E A;  4LF7 L;  3GTQ H;  4EX5 A;  3GTG H;  3TRE A;  2NVQ H;  1Y14 B;  1K0R A;  3HKZ G;  4A3I H;  3PV0 A;  4LF6 L;  2QA4 A;  3PUW A;  5C4X G;  4JI1 Q;  3GTO H;  3HOX G;  1PYB A;  4LFA Q;  1KRS A;  1I5F A;  1VS0 A;  3H0G H;  3EIV A;  2V1C C;  1UE6 A;  2PQA A;  4JI3 L;  3DM3 A;  4P74 A;  4A3J G;  4A3E G;  1VQB A;  4DV5 Q;  3W1G A;  1HNZ Q;  4JI6 Q;  3E9H A;  4LF8 L;  1NBW A;  1I3Q H;  3CME A;  3I55 A;  1WYD A;  2B29 A;  3E0E A;  2WB1 G;  1KRT A;  4DK3 C;  1XPR A;  1S40 A;  3PIO A;  1JB7 A;  4X6A H;  2LXJ A;  2A8V A;  5IE8 A;  4GKJ Q;  3AFP A;  1VQF A;  4JBM A;  2FXQ A;  3D0F A;  4KI0 A;  1L0W A;  3CCE A;  3S2H H;  1YJN A;  3S1M H;  4A3M H;  1VQD A;  1XPU A;  3KF6 A;  4IFD I;  2BH2 A;  3HKZ E;  1UE5 A;  4O0A A;  4AH6 A;  3UE0 A;  3S1N H;  3I2Z A;  3WWV A;  4DR1 L;  1N36 L;  1XNQ Q;  3M85 A;  2HHH Q;  3CP0 A;  1LUZ A;  1KD1 C;  4NPS A;  4YCU A;  1I94 L;  1DGS A;  2KCT A;  4A3B H;  1YIT A;  1G6P A;  3F2D A;  4A3L G;  1L1O A;  5IP9 H;  3GTP H;  1HR0 L;  3HOV G;  3PCO B;  4WJ4 A;  3F1Z A;  1GD7 A;  4JI5 L;  4UP8 A;  1SE8 A;  1N33 Q;  2D62 A;  4AIM A;  1E22 A;  4JI8 Q;  3J80 i;  5JJL A;  1L1O B;  1HZA A;  4KHP L;  3I4O A;  2ALY B;  4GLV B;  1EQQ A;  5C0X I;  3I4N G;  1RIP A;  2UXC L;  1XMQ L;  4JI7 Q;  5IYC H;  2JA7 G;  3GTJ H;  2YU9 H;  2CWA A;  5FLM G;  2ZTD A;  1CSP A;  2KHJ A;  1XMO Q;  4JI0 L;  1D8L A;  1J6Q A;  5M3F G;  1PH4 A;  1SR3 A;  3TRZ A;  3HFZ B;  2Q2U A;  1HNW Q;  3CC2 A;  2WFW A;  1VQH A;  4X66 Q;  1JJ2 A;  1EYG A;  1L1O C;  1A63 A;  3GTL H;  2GN5 A;  2F4V Q;  4JV5 Q;  4DV4 Q;  1IBM L;  2JA6 G;  4R4I A;  1VQO A;  4Y52 H;  1IYJ B;  1XMO L;  2DUD A;  3S17 H;  4PMW A;  1N32 Q;  2OQK A;  3LGJ A;  4A3G G;  5JJK A;  2A19 A;  1WCM H;  3AEV A;  1T9H A;  5BR8 L;  1I94 Q;  1HNX L;  2UXB L;  1P16 A;  2NN6 I;  3ER0 A;  5GQO A;  2EQS A;  2F3I A;  3NEN A;  4JI2 L;  4HIO A;  5EAY A;  2YV5 A;  1OXX K;  1Q1B A;  3MXN B;  1HH2 P;  1X3F A;  4R1J A;  5LMU Q;  1Q82 C;  2AMC B;  2ZTC A;  3AFQ A;  5C0X J;  3CC4 A;  4JI4 Q;  4UP7 A;  1C9O A;  2F4V L;  3PGZ A;  1PA6 A;  2HIV A;  4GOP C;  2XGT A;  4POF A;  3KLW A;  1HZC A;  3CXC A;  3JC6 6;  2VNU D;  3J80 c;  1ASY A;  2CQO A;  1AE3 A;  4XIG S;  4BBR G;  4OON A;  4DR5 L;  3GD7 A;  4LFC Q;  3HOW H;  1JJG A;  2I0Q A;  2JE6 I;  3EBE A;  1OTC A;  4YCW A;  1QZG A;  1SRU A;  1U0L A;  1LM0 A;  1CUK A;  2EIF A;  4HJ9 A;  4B3M Q;  2UUB L;  4BY1 G;  5C3E G;  5IP7 G;  1X6O A;  2PI2 A;  4IJL A;  3HOU G;  2C35 B;  4PG3 A;  4AYB E;  2AWN A;  1XTD A;  1Q86 C;  4JI4 L;  4BBS H;  1N33 L;  4DR3 L;  4DUY Q;  3KDF A;  3CC7 A;  1OXU A;  1IBM Q;  3STB D;  3S14 H;  4K0K Q;  2YYZ A;  1V1Q A;  4LUO A;  1N34 Q;  1VQA A;  1Y1W H;  3E9I A;  4NXM L;  2ZJP A;  1VQM A;  4B3T Q;  4DV5 L;  1HNZ L;  3M9B A;  1VQI A;  1O7I A;  3CF5 A;  3S15 H;  3K0X A;  5JJI A;  1IBL L;  3ULL A;  1YI2 A;  4B3S Q;  3RNU A;  5AJ3 L;  1J5E Q;  3OYY A;  2Z0S A;  4DV6 Q;  1VQL A;  4LF9 Q;  4OWW B;  4YHH Q;  1XNR Q;  4PZ6 A;  3T1H Q;  1VQ4 A;  3A0J A;  4JYA L;  3G4S A;  3U4V A;  4B3T L;  4LF7 Q;  1SN8 A;  4MNO A;  1X56 A;  4DAY B;  3K80 C;  1PVO A;  4A3J H;  1GO3 E;  4A3E H;  3L2P A;  4GN4 B;  1EWI A;  4DR2 L;  1VQP A;  1NMF A;  3T1H L;  2JJQ A;  4A75 A;  4JYA Q;  2IY5 B;  3D31 A;  1B70 B;  5IP9 G;  3UDG A;  1X65 A;  3Q8D A;  1PH6 A;  4DUY L;  3U4Z A;  3ULP A;  1J5E L;  5LMN W;  3HOV H;  1IBL Q;  3I4M H;  2UXC Q;  4POG A;  3J7Z C;  1N8R C;  4BY7 G;  2R7Z H;  4DR7 Q;  1E24 A;  1IXR A;  2I5L X;  1SFO H;  5LMN L;  2HIX A;  4YY3 L;  3BZC A;  4DV7 L;  4JBJ A;  4A3F H;  3PSI A;  1K8G A;  4A3M G;  1IL2 A;  1KQS A;  1YJW A;  1N34 L;  3I4N H;  1CKN A;  3KJO A;  2JA7 H;  5IYC G;  1NJI C;  5FLM H;  1HR0 Q;  4R4T A;  1W2B A;  1FJG Q;  1KXL A;  1ASZ A;  3RZO H;  4ME3 A;  1QVC A;  2R92 H;  4JOI A;  1GVP A;  5JEA J;  4YY3 Q;  4DV7 Q;  3BJU A;  3I7F A;  1FGU A;  2OQ0 A;  4OXP A;  3ZJY C;  4QY7 A;  3CCV A;  4GNX B;  4HJ5 A;  1VQ5 A;  2KHI A;  2Q2I A;  4DK6 C;  4A3L H;  4JI0 Q;  1E1O A;  2K4K A;  3AYH B;  5IWA L;  4DV0 L;  4JI2 Q;  2CCZ A;  3NEM A;  4LF5 L;  4A3G H;  4MTN A;  4L5T A;  1X54 A;  1TWH H;  1WCM G;  3PO3 H;  4NXM Q;  2IHE A;  3FKI G;  1EQR A;  3A5U A;  3GDE A;  4UP9 A;  4LUV A;  4APV A;  2K52 A;  3F8T A;  4UY8 C;  4IOC A;  4DV4 L;  4LF4 Q;  4PZ8 A;  4DR3 Q;  2Y0S E;  4BA1 I;  2QEX A;  1C7Y A;  4B3S L;  3M3Y H;  5M3F H;  4HIK A;  4MZ9 A;  5HY6 A;  2BA1 A;  4X64 Q;  3PF4 A;  3IRB A;  1RL2 A;  4HID A;  1N9W A;  2NN6 G;  2UUB Q;  1Y1V G;  4RG1 A;  1H95 A;  5GAD C;  4QJF A;  1LYL A;  2K5V A;  3J81 c;  4JI3 Q;  2YTV A;  2HHH L;  4LF5 Q;  1FL0 A;  4LFC L;  3HOY H;  1VQK A;  1K9M C;  4LF4 L;  4GNX C;  4IPH A;  4IFD G;  2LSS A;  4GKK L;  1NY4 A;  4A3K H;  2JEA I;  4JV5 L;  2E2J H;  3AQQ A;  4YCV A;  1VCI A;  3CCS A;  3CPF A;  1VQJ A;  1YHA A;  1X3E A;  5IP7 H;  3GTM H;  1HNW L;  4A3C G;  4DUZ Q;  1XJV A;  1EUJ A;  2YTY A;  1OXT A;  4LF9 L;  2Q2T A;  3FP9 A;  4A3I G;  1BVS A;  5C4X H;  1MIU A;  5HGQ A;  3RLN A;  4DKA C;  5IYB G;  3G48 A;  4QQB X;  1U5K A;  1OXS C;  1HNX Q;  1EOV A;  1D7Q A;  2ID0 A;  3M4P A;  4PZ7 A;  2NZH A;  5GAH C;  2EXD A;  1XNQ L;  1X55 A;  1B8A A;  2JEB I;  4LWC A;  4DR1 Q;  1FJG L;  1E1T A;  4R4C A;  1K3R A;  2R6G A;  3CW2 C;  4IPG A;  1SRO A;  2VZA A;  5LMU L;  4P71 A;  1VQG A;  4GLX A;  1GM5 A;  2KEN A;  1X9N A;  5GAE C;  4GKJ L;  4LNQ A;  4HIM A;  2HQL A;  3NBH B;  1VQ9 A;  4DR7 L;  5M5X H;  5FLX c;  1AH9 A;  2N3S A;  3H15 A;  1N36 Q;  1PH7 A;  4A93 H;  4YWM A;  4DV6 L;  2VL6 A;  4LFA L;  1NMG A;  3HOX H;  4L5R C;  2KCM A;  3H0G G;  1WOC A;  5M5Y H;  1A0I A;  2ATW A;  1AE2 A;  2RHQ B;  4X66 L;  2OTJ A;  3M4Q A;  3S24 A;  2QGQ A;  3TQY A;  1KC8 C;  4DV2 L;  4XTC S;  2DGY A;  3M7N A;  2UUC L;  2AKW B;  4GLA C;  2JQO A;  4NB3 A;  3SGI A;  2Z6K C;  4LUZ A;  3JAM i;  2PMZ E;  2MFI A;  1EIY B;  5BR8 Q;  1UE1 A;  4FDB A;  4HJA A;  3S1R H;  1V43 A;  3KF6 B;  5DLQ E;  5IYD G;  1PH3 A;  3CD6 A;  1MKH A;  1N32 L;  2N78 A;  4A3D H;  1K8A C;  4DR5 Q;  2VS1 A;  4DV3 Q;  3HOZ G;  2B63 G;  1K83 H;  4LF6 Q;  4NXN L;  2JA5 G;  1YNX A;  1YEZ A;  4BA2 I;  4BXX G;  4OO1 I;  2K50 A;  3I4M G;  2A1A A;  4P73 A;  2GVB A;  3UDI A;  3TS2 A;  2ZJR A;  4BY7 H;  2WP8 J;  4R4O A;  2B3G A;  2CKZ B;  4C2M H;  2F52 A;  5IY0 A;  2UUA Q;  1KHI A;  1JJC B;  1A62 A;  2RCN A;  2JA9 A;  3FKI H;  4AQY Q;  4IJH A;  3ULJ A;  4A3F G;  1Q7Y C;  1PV4 A;  4JBK A;  2MO0 A;  4A76 A;  1JE5 A;  1V9P A;  4BXX H;  4HJ7 A;  2N8N A;  2Y0S G;  3PUV A;  1OXV A;  2LXK A;  3OW2 A;  2E2I H;  4KHP Q;  4OO1 G;  4DR4 Q;  4GOP B;  3RN5 A;  3T1Y L;  2JA8 G;  1IBK L;  2RF4 A;  1Y1V H;  2ZTE A;  1UWV A;  4HJ8 A;  4GN5 A;  1YIJ A;  3S1Q H;  1KL9 A;  4JBW A;  4X62 L;  2KBN A;  4DV1 L;  3S16 H;  4IPD A;  3HOY G;  3B6Y A;  1KAW A;  2Q2H A;  1SMX A;  1YJ9 A;  4GOP A;  1QVF A;  2VY3 A;  4JOI C;  4LF8 Q;  1VQ8 A;  3STB C;  5LMN Q;  3A5Z B;  1VQC A;  4UPA A;  2IHF A;  1BBW A;  5M3M G;  2PI2 E;  3OTO Q;  5C4J H;  2E5L Q;  2OWO A;  3PO3 G;  1Q12 A;  3CCJ A;  1Q8K A;  3RZD H;  2GVA A;  1I50 H;  1WJJ A;  1XMQ Q;  1BBU A;  1Q81 C;  4JI7 L;  4DAM A;  4NXN Q;  5IYB H;  4OWX B;  3KFU A;  1CKM A;  4C3H H;  2XTI A;  4X65 Q;  4DV2 Q;  2MO1 A;  2YTX A;  1K73 C;  3W5O A;  3S2D H;  3HKS A;  3PUY A;  4LW1 A;  1HR0 W;  4JI8 L;  5IT9 c;  3CCQ A;  1PFS A;  5C3E H;  4OX9 L;  2K5H A;  4TVA B;  1VQN A;  4J15 A;  5GRO A;  4YHH L;  1VQE A;  1XNR L;  2AWO A;  1PYS B;  1TWG H;  4DPG A;  3U50 C;  4A3B G;  4A3K G;  2K14 A;  2UUC Q;  4B3R L;  3RR5 A;  2PNH A;  2WAQ E;  4LFB L;  3U58 A;  2IX1 A;  4TQU S;  1Z47 A;  1M1K C;  1LTL A;  1YVC A;  4OX9 Q;  2UXB Q;  2NZO A;  3L0O A;  1EIF A;  1PH9 A;  4JI5 Q;  1E7Z A;  4JI1 L;  1WFQ A;  4OWT B;  2D0P A;  2RHS B;  5C0X G;  3BU2 A;  1PH2 A;  1E3P A;  3W1B A;  3CCR A;  1TWC H;  1PH1 A;  4EQ5 A;  4JC0 A;  3MEF A;  3KJP A;  2I5M X;  4BY1 H;  2JK8 A;  2WB1 E;  1SLJ A;  4B3M L;  2E5L L;  4JCV E;  3T1Y Q;  3H3V H;  1CKN B;  3FHW A;  3HOU H;  4BBS G;  5ELN A;  3DLL A;  3KF8 B;  1PHJ A;  2N49 A;  3UDF A;  4QGU A;  1MJE A;  1UE7 A;  3CPW A;  1S3O A;  1TWA H;  4DV1 Q;  3ICE A;  3J81 j;  1NE3 A;  1KIX A;  4AYB G;  1WI5 A;  1NTG A;  5IYD H;  4A3D G;  2H5X A;  4A93 G;  4LFB Q;  3HOZ H;  4DR6 Q;  2HT1 A;  3TS0 A;  3KYH C;  3PUX A;  2NVX H;  1S72 A;  1M90 C;  4JG2 A;  3PUZ A;  1YHB A;  3KDF B;  2VQF L;  2AHO B;  2D0O A;  1HJP A;  4DUZ L;  4ALP A;  2CWP A;  1VQ6 A;  2E2H H;  3F2B A;  1VQ7 A;  3NEL A;  3JAM c;  3GTK H;  3RN2 A;  4IOA A;  4X65 L;  4L5Q A;  3UE1 A;  1W3S A;  1HZ9 A;  4DR6 L;  2BH8 A;  4K0K L;  1I6H H;  3L7Z C;  3CAM A;  1Q46 A;  3RLF A;  2UXD Q;  1YHQ A;  3KOJ A;  5J3B A;  2R7Z G;  2K5N A;  4P72 A;  3UDX A;  2ZM6 L;  3CCM A;  3BZK A;  4C3J H;  3H3V I;  4O2D A;  3RLO A;  3K7U C;  4B3R Q;  4L5S A;  2K75 A;  2B63 H;  5FJ8 G;  4A4I A;  5M5W H;  1QZH A;  3A74 A;  1IZ6 A;  4C3I H;  2JA5 H;  2ASB A;  2VUM H;  2IX0 A;  1BKB A;  1FVI A;  3EN2 A;  4IFD J;  2R92 G;  2VQE Q;  3CMA A;  1PH8 A;  2UU9 L;  4X62 Q;  4GNX A;  4R4Q A;  3J7A 5;  3G71 A;  2UXD L;  1A8V A;  3GO5 A;  1IBK Q;  3VDY A;  2IT1 A;  1QVG A;  4Y7N H;  4RMF A;  3CCL A;  2ZJQ A;  4QIW E;  1G51 A;  1YZ6 A;  5FJ8 H;  1PH5 A;  3M4O H;  1P8L A;  1GKH A;  2L15 A;  1MJC A;  5E7N A;  4YWK A;  5JEA G;  1QUQ B;  3PF5 A;  1R9T H;  5C44 H;  1EFW A;  3I56 A;  2VUM G;  4WJ3 M;  2UU9 Q;  4DNI A;  2E8G A;  4AQY L;  2VQF Q;  2JA8 H;  2VQE L;  2NVY H;  3OTO L;  2VW9 A;  4DR4 L;  4A3C H;  4IO9 A;  2BA0 A;  4X64 L;  5H1S E;  2CFM A;  2JA6 H;  4BBR H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...