3HOUH

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
134
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
total genus 16
structure length 134
sequence length 145
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3houH00
5LMUQ 4DV1Q 1WYDA 4HIDA 1N36Q 1FJGQ 2AWOA 4X65Q 4DV2L 1LTLA 1GVPA 2AHOB 2NN6G 3CP0A 4YCUA 5IE8A 1Z9FA 2N49A 4AQYQ 1PH8A 1QVFA 5IYCG 2WFWA 1FVIA 4IPDA 1VQ8A 3GTMH 1H95A 2E2HH 1QVGA 4YCVA 3G71A 2VNUD 2I5HA 5IP7G 4A4IA 2B29A 4A3JH 3FKIH 1EFWA 3I7FA 4JI1L 2JA7H 4PMWA 3S1QH 2LXJA 3W1BA 3T1YL 1VQMA 2ZJPA 2KHIA 4NXMQ 4LFBL 2UXDL 4QIWE 1R9TH 4IFDG 4DK6C 1HH2P 3BJUA 4B3SQ 4OX9L 2VQEL 3CPFA 1E1OA 1VQCA 3RLOA 4R4TA 1MJEA 2ASBA 2RHQB 1Q86C 2Z0SA 2Z6KC 1X65A 4LFAQ 3SGIA 3RN2A 1K9MC 3H3VI 4GKKL 1SFOH 3OYYA 3H15A 1U5KA 3KDFA 3PIPA 3GTLH 2HHHQ 3RN5A 4Y52H 3FKIG 1DGSA 2D62A 2OCEA 2IX1A 4DK3C 4DR2Q 3E0EA 4PG3A 1QUQB 1WI5A 3W5OA 1YZ6A 3J80i 2NN6I 1RL2A 1XMOQ 4JI7Q 4LF9Q 2JA6H 1HZ9A 4DV6Q 1SR3A 4DR3Q 3HFZB 1G6PA 4DR6Q 1NY4A 1N32L 2K4KA 2VS1A 5AJ3L 4A3CH 1D8LA 1Q12A 3TQYA 2CWAA 2HIXA 4A3LH 3GD7A 4C3JH 1PH9A 4PZ6A 3CW2C 1UE1A 4L5QA 3PIOA 4BBSH 4BY7G 2JA8H 4KHZA 3UE0A 4B3RL 1BBUA 1VQOA 4EQ5A 1KQSA 4JI0Q 3D0FA 5IYBH 3CCMA 1HNXQ 1J6QA 4DR4L 1XTDA 1KHIA 4JBJA 1YITA 2UXBQ 4WJ4A 5ELNA 3K81C 3HOZH 1VQDA 4LF4L 5J3BA 1JE5A 1TWCH 3CCUA 3I4OA 2ZM6Q 2BA0A 5C44H 2PQAA 2NVQH 1I5FA 2A19A 4NXNQ 4TQUS 3HOWH 3BZKA 4A3LG 3FHWA 4JV5Q 1XMQL 1VQNA 3HOUH 5IP9G 4OXPA 4PZ8A 4OO1G 5IYBG 2PMZE 2UU9Q 3DLLA 2CFMA 1EOVA 3PUVA 1YHQA 1HNZL 1IL2A 3KF8B 3NENA 5GAEC 3M7NA 3L7ZC 3M4OH 4DKAC 4NPSA 4X6AH 4YHHL 4LF7Q 1IYJB 3HOZG 4DUYQ 2ZTDA 2NVXH 4O0AA 1KAWA 5C4JH 3S2HH 1GM5A 3EIVA 1WJJA 2Q2TA 5C44G 3HOWG 4R4CA 3M4PA 1CKMA 4DR1L 1J5EL 4BBRG 2NVTH 3HOUG 3STBC 3L2PA 4A3IH 3NBHB 2F3IA 1N34Q 1X3FA 1Q82C 3HKZE 2B3GA 1B8AA 2RHSB 4LF8L 2BA1A 4XTCS 2VUMH 3M85A 4DR7Q 4RG1A 1HJPA 3ICEA 3PSIA 2KCMA 5M3FH 1Q7YC 1SE8A 4DV7L 1Q81C 2OTLA 1SLJA 3KF6A 2CWPA 2Q2UA 1VQ5A 1BBWA 4GN3B 5LMNQ 4HIMA 1HR0L 3PCOB 1V43A 4GKJL 1GD7A 5C0XJ 2R7ZH 4OO1I 1L2FA 4DV5L 4A3IG 4P72A 5JJLA 1X3EA 5IYDG 2AWNA 2MFIA 1JJ2A 3LGJA 1YJNA 3G4SA 2EIFA 3W1GA 3HOXH 4A3EH 3U50C 4JI8Q 4LW1A 1Y1VH 1S3OA 3H0GG 4O2DA 4YCWA 4GLXA 4JI5L 2DUDA 1BVSA 4UPAA 3CF5A 2Q2HA 3NEMA 3OTOQ 2MNAA 4R4IA 1Y1WG 2UUAL 1UEBA 5FLMH 2Y0SE 1XNRL 4BXXH 1OXXK 3HOXG 4P71A 4A3EG 2UUCL 1XNQL 2E5LL 1E7ZA 3CCRA 3J7ZC 4DV4L 4LFCL 4DV0L 3M9BA 5IWAL 1B7YB 3TRZA 1ASYA 1Y1VG 3M4QA 3U4VA 1K73C 3GTGH 3ULLA 2AMCB 2YTYA 3EN2A 1VQBA 1IXRA 2VL6A 4JI4L 2BH2A 2WB1G 1IBLL 1VQ7A 4OWWB 1YI2A 4YWLA 4JI1Q 4YWKA 2OWOA 1Q1EA 1YHBA 1K83H 3HKSA 4APVA 3F2CA 3KLWA 3WWVA 3VDYA 4LFBQ 2UXDQ 4A76A 4YY3L 3J81c 1M1KC 2VQEQ 1N36L 1KC8C 1EQRA 1L1OA 1WFQA 2K50A 3Q8DA 3I55A 4A3KH 1X54A 2FXQA 4AQYL 1E22A 5JEAJ 3T1HL 4DAMA 2R6GA 4GKKQ 4JBMA 4JOIC 3D31A 3J81j 4ALPA 1CKOA 4K0KL 2CKZB 3A5ZB 4JOIA 4AH6A 3CCJA 3F2BA 4HJAA 4A3JG 1VQKA 1I3QH 2JA7G 2Y0SG 1X55A 3MXNB 3S2DH 2JA9A 4DPGA 2R93H 1CSPA 1N8RC 1SMXA 3JAMc 1A63A 4GN5A 2N78A 4POGA 1PH3A 4RMFA 2OQ0A 4NXML 3HOVH 1WCMH 4A3KG 4B3SL 4P75A 3A74A 3BU2A 5AJ3Q 4HJ9A 2ES2A 4JI6L 1ASZA 4LFAL 4A3BH 3S1NH 1PFSA 1I94Q 1IBML 1CKNB 1HNWL 2QEXA 3CCLA 4JBWA 2HHHL 3K8AA 3DM3A 4IFDI 2F4VQ 4B3RQ 4P74A 2K5NA 2B63H 1NTGA 2EXDA 1E3PA 4WJ3M 2JA6G 3S14H 1LM0A 4IJHA 4DV3L 2LSSA 4QY7A 5E7NA 3JC66 1XMOL 4LF9L 1QVCA 4P73A 1GKHA 4XIGS 4DR3L 1PH2A 4X66L 3KYHC 3J80c 2YTXA 3CMAA 1K0RA 4LF4Q 4B3MQ 4NB3A 1VQ6A 4DR6L 4A3BG 4GNXC 3CCVA 4A3CG 5JJKA 1YJWA 1KXLA 1TWFH 3CC4A 4GLAC 4GNXA 4KI0A 4BBSG 3ER0A 2JA8G 1JJCB 1Z47A 3PV0A 3PUXA 4DR5L 2K5VA 4OONA 2OTJA 1CUKA 1HNZQ 2I5MX 4JI0L 2CCZA 3GTJH 4YHHQ 1XJVA 3MEFA 1LYLA 1TWHH 4IJLA 1W2BA 1VQEA 1AE2A 4BY1H 3PO3H 1NBWA 4KHPQ 3GTKH 3F8TA 3U58A 2R7DA 4IO9A 3CQZH 1T9HA 1J5EQ 1VS0A 2NZOA 3KDFB 5LMNW 5M3MH 4NXNL 1L0WA 2PI2A 3UE1A 1UE7A 2Q2IA 3RZOH 1PVOA 2PNHA 3S1RH 2WAQE 4HJ7A 4FDBA 1B70B 4L5TA 2VQFQ 5JEAG 4IOCA 4LF8Q 1N33Q 2H5XA 3I56A 1PH1A 4QJFA 1O7IA 1XPUA 1PH4A 4JYAL 5M5XH 3EBEA 3PO3G 4OWXB 1PV4A 2E2IH 4GN4B 3UDIA 4DUYL 1W3SA 3GTOH 4LWCA 4X64Q 1TWAH 1HR0Q 1VQ9A 1VQFA 1TXYA 4GKJQ 1VQPA 3CD6A 1FL0A 5JJIA 2GVBA 5BR8Q 1K3RA 2ZTCA 4IPGA 4X62L 3CC7A 4LF5Q 2WB1E 2GN5A 1X6OA 1YEZA 4KLKA 4LUOA 1N34L 2D0OA 5GAGC 4LF6L 2VUMG 4JC0A 4BA2I 3TS2A 5K36G 2XGTA 1QZHA 4B3TL 2UUBQ 2BH8A 2JA5H 5IY0A 1JJGA 1A8VA 3ULJA 5M3FG 4JI2Q 5GQOA 4HIOA 4A3GH 4C3IH 2VY3A 4DUZQ 1C9OA 3PUZA 4JI3L 2R7ZG 2WAQG 2PQAB 1PH5A 3I4NH 3AYHB 1IBKL 4GNXB 1U0LA 2KHJA 2I0QA 3ERSX 2E2JH 3GO5A 2OQKA 2UUAQ 1MKHA 2XTIA 2MQHA 2ALYB 5GADC 3AQQA 5M5YH 2EQSA 4QL5A 3KJPA 1QZGA 3J7A5 5DLQE 3RLFA 4DV2Q 2UUCQ 2E5LQ 3S24A 2KENA 3KOJA 5IT9c 3IRBA 2JE6I 4DNIA 4DV0Q 1EUJA 5IWAQ 4DV4Q 1VQLA 4LFCQ 2LXKA 3TS0A 4R1JA 4A3GG 2ZJRA 4GLVB 3PUYA 5C4XH 4A93H 4JI4Q 3CAMA 1NMFA 3AFPA 3NELA 4J15A 1XPRA 1P8LA 3T1YQ 5FLXc 1CSQA 2YYZA 3F1ZA 3TEHB 1KIXA 5FLMG 2YV5A 4HJ8A 4A75A 1OXUA 1S72A 3S17H 1L1OC 4BXXG 4BA1I 1OXTA 3I2ZA 5LMUL 4DV1L 3ZJYC 4OX9Q 1FJGL 4X65L 1IZ6A 1RIPA 2A8VA 3CCSA 1KL9A 1VQ4A 3K0XA 1OTCA 3UDXA 3K7UC 5H1SE 1YIJA 3RR5A 3CMEA 3T1HQ 5C3EH 1X3GA 3UDGA 1X9NA 3KF6B 4A93G 5C4XG 4L5SA 4QQBX 4K0KQ 1HZBA 2IT1A 3I4MH 1SN8A 3JAMi 3RNUA 1PH6A 3F2DA 2IHEA 2NVYH 1UWVA 4UP7A 1M90C 1HZCA 2E8GA 1GO3E 2K75A 5FJ8H 1D7QA 1G51A 1OXVA 1Y14B 3PO2H 3KFUA 4YWMA 1V9PA 2ZTEA 3A5UA 1UE6A 2KBNA 5C0XG 1N32Q 4EX5A 3GTQH 1YNXA 2L15A 5C3EG 3CC2A 3S16H 4JI6Q 4DAYB 1PHJA 1YHAA 4QGUA 3CCQA 1IBMQ 2JK8A 3I4MG 1HNWQ 3TREA 2IY5B 2Z6KA 1YJ9A 2R93G 1I6HH 1JT8A 4OWTB 1OXSC 1PYBA 5HGQA 3G6EA 4BY7H 4DR2L 2N8NA 2NZHA 1E1TA 5FJ8G 2JEAI 3HOVG 3STBD 3E9HA 1WCMG 1JMCA 3PUWA 4DV3Q 1K8AC 3PO2G 4DR4Q 2JJQA 2PI2E 4JI7L 2VZAA 4DV6L 1NE3A 3PF4A 4X66Q 1EYGA 1K8GA 1A62A 1TWGH 1PH7A 3GDEA 3U4ZA 1I94L 1XMQQ 2YU9H 2ATWA 4IOAA 1Q46A 2IHFA 2K14A 4POFA 1NMGA 2B63G 1E24A 4DR5Q 1Q1BA 5IP9H 3CXCA 2JQOA 4AYBE 5GAHC 1EIYB 2F4VL 2HQLA 1KD1C 5C0XI 3L0OA 4MTNA 1HNXL 3M3YH 1KRTA 2QA4A 3G48A 1WOCA 1S40A 3AFQA 1VQIA 2RF4A 1A0IA 2UXBL 5EAYA 1L1OB 2CQOA 4MZ9A 5HY6A 4C2MH 2QGQA 2KCTA 2YTVA 2VW9A 4B3ML 1Q8KA 3A0JA 1AH9A 4DR1Q 1YVCA 2ZM6L 1HR0W 4A3FH 1AE3A 4GOPC 2WP8J 2R7FA 4UP8A 4BBRH 4JV5L 1UE5A 3B6YA 4UY8C 2C35B 2JEBI 1SRUA 4GOPA 3HOYH 2UXCQ 2UU9L 3KJOA 4JYAQ 4LUVA 4JG2A 4IPHA 2I5LX 4HJ5A 1C0AA 2ZJQA 1G291 5ELOA 4MNOA 4BY1G 4DV7Q 4C3HH 4H02A 4LF7L 3FP9A 2A1AA 2K5HA 3PGZA 4IFDJ 4KHPL 1PA6A 1KRSA 1BKBA 4AYBG 2MO1A 5M3MG 4A3FG 1EWIA 4DV5Q 4AIMA 3ULPA 1VQHA 3GTPH 4A3DH 4X62Q 4PZ7A 3HOYG 1I50H 3UDFA 2V1CC 1JB7A 4LF6Q 1VCIA 5IYDH 3CCEA 1HZAA 3PF5A 2VQFL 3K7AH 4B3TQ 1N33L 4LUZA 4DR7L 2UXCL 3K80C 2HT1A 1V1QA 3OW2A 2HIVA 4HIKA 5M5WH 3AEVA 2R92H 1XPOA 1N9WA 2IX0A 3CPWA 1NJIC 2D0PA 1P16A 5LMNL 4X64L 4JI3Q 1VQAA 2K52A 4JI5Q 3H0GH 3H3VH 1IBKQ 2MO0A 4A3DG 1QUQA 2AKWB 5BR8L 1MJCA 4IPCA 4TVAB 3S1MH 1FGUA 3E9IA 4LF5L 3RLNA 2DGYA 1XNRQ 4A3MH 1Y1WH 1EQQA 2JA5G 3RZDH 1XNQQ 1EIFA 1SROA 2N3SA 4LNQA 4R4OA 4R4QA 4GS3A 2UUBL 2R92G 4UP9A 1C7YA 4JI8L 1MIUA 4JI2L 5IYCH 2F52A 1YBYA 3BZCA 3S15H 4Y7NH 1CKNA 1IBLQ 4JCVE 4DUZL 3I4NG 4JBKA 3HKZG 2ID0A 1X56A 2GVAA 1PYSB 1VQGA 4ME3A 5IP7H 3J81i 4L5RC 5GROA 1LUZA 1VQJA 2RCNA 3OTOL 4YY3Q 4GOPB 4A3MG
chains in the Genus database with same CATH superfamily
1FJGQ 4DXGA 1CTMA 3TMEA 1LTLA 1GVPA 2AHOB 3HRZC 5IE8A 3HGBA 3I72A 5IYCG 2Z9HA 3BVZA 1GUSA 2B2YC 2E2HH 4YCVA 2VNUD 5IP7G 1G91A 3V96A 2B2UC 2F0PA 1EFWA 2XIWA 3S1QH 2LXJA 1VQMA 1STNA 2ZJPA 4B3SQ 4OX9L 2EJMA 1E1OA 4R4TA 1BDOA 2I46A 2Z6KC 4KY6A 3H3VI 1O7YA 4GKKL 1SYBA 3NQIA 3E3XA 4DK1A 3RN5A 4Y52H 2D62A 4DXFA 3C3LA 2OCEA 3J80i 3NHHA 1GHKA 1XMOQ 4JI7Q 2VB2X 4LF9Q 4F87A 4DR3Q 1U4MA 2F4IA 1G6PA 4DR6Q 3H09A 1EZ6A 4A3CH 2CWAA 5FO7B 4A3LH 3HKZB 3GD7A 3KBGA 5KIXA 1UE1A 4BBSH 3PIOA 3LWEA 2JA8H 3UE0A 1I4GA 1BBUA 4EQ5A 5IYBH 1J6QA 1YITA 1GXDC 5ELNA 1WTXA 1VQDA 2DJFC 5J3BA 2JN4A 1HUNA 5C44H 4A3LG 1ILQA 1XXGA 4TQUS 1CA6A 5IYBG 5EPKA 3PUVA 3M4OH 1IL2A 5GAEC 3L7ZC 1F9SA 2J7ZA 3D4DA 1IYJB 1PTOF 1YNJD 3S2HH 1EIHA 1Q3LA 2E2HB 5C44G 3DEPA 4A3IH 4OIJA 3MWYW 3NBHB 2SDFA 4UHVA 1Q82C 3AU7A 2B3GA 2O2LD 1B8AA 2BA1A 2VUMH 5KNDA 1K0SA 2B2VC 3K5NA 2KA7A 3ICEA 2PZWA 3PSIA 5M3FH 2XN9C 2CWPA 3BDOA 4H7BA 1BBWA 1K3BC 5LMNQ 2K04A 4KKTA 2L9HA 1SYGA 4N9PA 1L2FA 4A3IG 2PCFB 1CZWA 4R8NA 4P72A 1X3EA 1H9KA 4DNTB 2AWNA 3LGJA 1YJNA 1TY0A 3BDCA 3W1GA 4A3EH 1WD1A 3J7YW 1I4RA 3U50C 1W6KA 4DAVA 5IT9L 2DJGC 4CBVA 2TMPA 2G9HD 2F0SA 3OWEB 1S3OA 3U9SA 4CHTB 3IKJA 2YU9B 1IKLA 2F0NA 3KUPA 3MZ5A 3OTOQ 2UUAL 1UEBA 2PZTA 5FLMH 1OXXK 5CV5A 4A3EG 1M8AA 1CK1A 2UUCL 4HEDA 2E5LL 4DV4L 4EQNA 4FF4A 4KD4A 4LFCL 1RF2D 2AMCB 2YTYA 2E76C 5C44B 1VQBA 4JI4L 2A69D 1IBLL 2K05A 2KOLA 4XYOA 2Z1CA 4KJNA 4YY3L 2K28A 1N36L 1EQRA 1L1OA 2K50A 4A3KH 2WACA 2FXQA 3IFTA 4ULLA 4AQYL 5JEAJ 4I7ZC 2R6GA 4DA2A 4GKKQ 1HA5A 3D31A 2CKZB 3A5ZB 1VQKA 1MSHA 2JA7G 3GTPB 4A3IB 2JA9A 1A63A 1PH3A 4NXML 4A3KG 1NNXA 1EIGA 1Y8PB 4A3BH 1IBML 3KK7A 5I2YA 1D5XC 2HHHL 2F4VQ 4P74A 1X3PA 1NCVA 2CW0D 1LM0A 4IJHA 2LSSA 5FKAC 2EDGA 1QVCA 2K5QA 4XIGS 4X66L 3KYHC 3J80c 3CMAA 3W3AA 4B3MQ 4A3BG 1PRTF 5JPNC 4KI0A 3ER0A 3NWTA 1WTQA 5C5LA 2WIIB 1IHZA 1ICFB 3PV0A 4DR5L 2K5VA 1SEBD 1SYDA 3J81E 2CCZA 3OOCA 3ND9A 5IGFA 4IJLA 1W2BA 3PO3H 2PZUA 4CKEA 2R7DA 2KJXA 5CR3A 1TS3A 5CYUA 2JA7B 1EY5A 5CC4A 3SDZA 1UE7A 1PFBA 3JAME 2WAQE 4HJ7A 1R9TB 2UXCQ 1E2ZA 4L5TA 3I56A 1PH1A 1PH4A 3NWSA 3PO3G 2E2IH 4GN4B 3UDIA 4DUYL 2EJGC 1SFOB 4LWCA 1Y8NB 4X64Q 3LNNA 5IIFA 3QB3A 2L12A 4IPGA 4X62L 1RHPA 2GN5A 1N34L 4BA2I 1KTKA 1XTCD 5I9PA 2EY6A 3A8IE 3SXHA 4A3BB 5CV8A 1EY4A 4DUZQ 1C8CA 1UEAB 2R7ZG 3AB9A 2PQEA 1U0LA 2KHJA 2E2JH 3DEOA 3T4AC 5FLXL 2UUAQ 2MQHA 1V1PA 5GADC 1JWSD 2EQSA 4JPBW 4DV2Q 2FINB 3RLFA 2UUCQ 2E5LQ 3S24A 3QIAA 4F88A 5IT9c 1STBA 4IUPA 4DV4Q 1VQLA 4NDXA 5ELFA 4LFCQ 2A74C 3C2PA 2LXKA 1TWCB 1E2VA 3HP3A 4R1JA 2I07B 1D1KA 5C4XH 4R9WA 2NB0A 2ENBA 4ZLTF 4JI4Q 4CDCC 1NMFA 4NMZA 1XPRA 3T1YQ 2YYZA 3TEHB 4LK1C 4HJ8A 3PMFA 4A75A 1OXTA 1RIPA 5BN5A 3PO3B 5C3EH 2C9OA 5C4XG 4HTHA 1HZBA 1SN8A 4B08A 2G5DA 4RGNA 2E8GA 5NUCA 4LAAA 4ZKBB 2K75A 4RKLA 1D7QA 5CV9A 3LWUA 3OMGA 3DWQA 4X3TA 3H91A 4YWMA 3A5UA 1DYQA 1UE6A 3GTQH 3I8ZA 5C3EG 5K5PA 1BCPC 1PHJA 3KLSX 4QGUA 1IBMQ 1MBYA 3DHQA 2R7ZB 2ICEC 1DOKA 1LV9A 3G6EA 2XSCA 5I2XA 4DR4Q 3VR3A 1WCMG 1JMCA 1K8AC 3C1EA 3SK8A 3GV6A 1NE3A 1QWYA 2JSOA 4X66Q 4KMUC 3U4ZA 3SVMA 2ATWA 3PQIA 1E24A 4DR5Q 2L11A 3GV3A 2WKDA 3RD4A 3DXJC 4HSVA 4NP5A 1KRTA 3AFQA 2XRSD 3I91A 5ELBA 3V05A 2KCTA 5C4XB 2B2WC 1V1OA 1JOQA 1BR9A 1AE3A 2WP8J 2R7FA 4BBRH 5KGUA 4EGVA 3BDLA 2A6EC 3HOYH 4MHEA 4JG2A 4HJ5A 2I5LX 1WVLA 4BY1G 5HGTA 1S4ZA 3FP9A 2K5HA 5C3EB 3PGZA 4KHPL 1PDQA 3T51B 3N52A 4H0LC 4AYBG 1EWIA 4DV5Q 5FK9C 1QOHA 2EYLA 4A3DH 4X62Q 1ET6A 3HOYG 5DEHA 2F0MA 5I4DA 4N8FA 1WCMB 3EA6A 3PF5A 3K7AH 4S3SA 1CHQD 4DR7L 2EYFA 3LX0A 5M5WH 1KABA 2FMCA 3AEVA 2R92H 2D0PA 1IYUA 1P16A 2QCPX 1VQAA 1R4PB 5I6WA 4JI5Q 2MO0A 4A3DG 3OW7A 5DM63 4IUTA 1MJCA 4TVAB 3S1MH 1PFNA 1RKNA 2IW3A 1Y1WH 1EQQA 1NR2A 2JA5G 3A56A 1EIFA 4RAUC 2K6AA 1ML0D 4GS3A 3K5MA 2R92G 3KBXA 4C3IG 3H3VC 4JI2L 5CV4A 1CKNA 2F0GA 2CVRA 2GVAA 1VQGA 3J81i 5GROA 1VQJA 1B4OA 3QR8A 4ZYSA 1ICWA 5E4WC 1WYDA 3K57A 4HIDA 3GTJB 4IFDH 1F9QA 1TWHB 4Z9CB 1S40A 1M4VA 2NN6G 4BY1B 1PH8A 2ZXOA 4V0BA 1H95A 1JB3A 4IQZA 1DZ1A 4AYBB 2I5HA 5C3WA 1T5XD 1K28A 5KRUA 2B29A 5JPMC 4JI1L 3S1RB 3HOYB 1SNMA 3VR2A 2KHIA 1H9SA 4QIWE 4IFDG 2B2TA 4FXKC 3BJUA 4K8IA 2CQAA 3RLOA 1Q86C 1K9MC 3I70A 3IL8A 3H15A 3PIPA 2J0TD 1GJXA 4PMCA 2F3VA 4A3DB 1HQRD 1EU4A 4M1UB 4DK3C 1TY2A 1CM9A 3NE5B 1YZ6A 4WFN3 5IGEA 2NN6I 2JA5B 5M5WB 2RCFA 2R92B 1U4LA 5C5MA 4C3IB 1UAPA 2M00A 2PO4A 1Q12A 3TQYA 2HIXA 1LTTD 3CW2C 1HHVA 3ND8A 2H1EA 1C4QA 2QDLA 2ZXPA 4JBJA 5EKLA 4WJ4A 1J8IA 4LF4L 2OXPA 2A19A 4NXNQ 3FHWA 3R2TA 2WV6D 1VQNA 5IP9G 3URYA 3S17B 2PMZE 2CFMA 2PW7A 3L9AX 5G3LF 1HNZL 3KF8B 1XYIA 5EGTA 1PTOB 1HA6A 1LTSD 2ZTDA 2NVXH 1GM5A 3CRKC 2Q2TA 4R4CA 1AW7A 2O4XA 4C56C 2NVTH 1VF5C 3L2PA 2F3IA 3M7GA 1T5EA 4EQPA 1EFID 5JVH3 4QMGA 4DR7Q 1F2YA 1BF4A 1HJPA 3S16B 1Q81C 4PV1C 2OTLA 1SXTA 3KF6A 1VQ5A 1QE6A 2C5CA 4MIUA 1HR0L 1B9MA 2HDLA 3PCOB 3MXNA 1I4QA 1GD7A 2F0KA 4XXEA 1SBBB 1JJ2A 3C46A 3L3OC 2EIFA 1ILPA 1FNUA 1Y1VH 2DNCA 1TS4A 2BDOA 1EEFD 3H0GG 1SDFA 4YCWA 2N88A 3C1FA 4CGYB 1KDBA 1RTOA 2Q2HA 3NEMA 4ME5A 1SNPA 2Y0SE 1XNRL 4BXXH 3SK4A 1B2TA 3A7AB 2WKCA 3M9BA 4DV0L 3TRZA 1ASYA 1Y1VG 1D1IA 3M4QA 1K73C 3GTGH 4DN4M 3ULLA 1WTHA 2RVLA 3E5SA 1YI2A 1CHPD 4JI1Q 1Q1EA 1YHBA 3VDYA 2R61A 1ENCA 1WTWA 3KLWA 3WWVA 3J81c 1RODA 1Z6HA 1M1KC 1KC8C 2ZT9C 3I55A 1BXTA 2NVXB 5C0XH 5HURA 1E22A 3VR6A 1PMRA 4HJAA 4I7AA 3S2DH 4JK1C 1I3QH 4PQXA 3MXNB 1X55A 2R93H 4DPGA 3WOEA 1CSPA 1SMXA 3JAMc 2OQ0A 2KEDA 1SNQA 3HOVH 1SE4A 4HMJA 2NZ1D 3H6MA 3J80L 3BU2A 2A6HD 4HJ9A 2ES2A 2K03A 4LFAL 4DNRB 2RQXA 3H0GB 1EEID 1JCKB 2QEXA 3CCLA 1OO9B 3DM3A 2K1BA 4ILWA 2B63H 3MA2B 1LT3D 4A3MB 4WJ3M 4DV3L 4QY7A 3K5OA 3JC66 4V190 4P73A 1NAPA 2BDNA 4JW0A 4LF4Q 1K0RA 4NB3A 3S15B 1KXLA 4Y7NB 4A3CG 1PRTB 5C6AA 5T1GA 1AZPA 4GNXA 4BBSG 2JA8G 1W6JA 3PUXA 2OTJA 4OONA 3T16A 1HNZQ 4JI0L 4U673 1DOMA 1FR3A 1NSNS 3BS1A 1EQTA 1XJVA 1LYLA 3ERQA 1VQEA 2HUGA 4ZAIA 3DWAA 4KTAA 3GTGB 3U58A 3TZUA 4IO9A 3CQZH 1T9HA 5EJWA 2IJ0A 4DGZA 5M3MH 5COYA 1L0WA 3S1QB 1S5FD 1L0XB 1ONLA 3UE1A 3KLRA 3RZOH 2KHSA 4FDBA 2VQFQ 2IWHA 4IOCA 1N33Q 5M5XH 1H9JA 3X3NA 5E4XA 1W3SA 1TWAH 1HR0Q 1TXYA 3P20A 1VQPA 1I3QB 1JOKA 2GA4B 3CC7A 4LF5Q 4CDDC 2X6GA 2D0OA 5JOBA 3EQLC 3MHBA 4JC0A 2VUMG 5ELDA 1Q90A 1QZHA 1JJGA 4IALA 2UUBQ 5IY0A 5M3FG 1SJHD 2F0UA 3I90A 5GQOA 2HDMA 4CJ2C 4WORA 1CFMA 4A3GH 2VY3A 1C9OA 2RDHA 4F8MA 3I4NH 4BBSB 2BE5C 5KYLA 4GNXB 2JA8B 1TS2A 3D4RA 3GO5A 1B50A 2OQKA 1MKHA 1QZGA 3AQQA 5M5YH 4CDEC 4WRDA 5DLQE 3PIP3 4OEMB 4DNIA 2JE6I 4ZRZA 4DV0Q 1GHJA 4A3GG 2X69A 3PUYA 5LHY1 2E74C 1P8LA 5FLMG 3CU7A 3M4OB 5IGBA 5LMUL 4DV1L 3ZJYC 4OX9Q 4H13C 4X65L 2A8VA 3UDXA 3S2HB 3K7UC 2KVMA 3RR5A 1X3GA 3UDGA 1X9NA 2IHEA 1D5ZC 1GO3E 2B2UA 4J6HA 2VUMB 3PO2H 5E3FA 5M5XB 5M3FB 2KBNA 2L15A 5FOBB 3NPPA 3NTHA 1DJRD 4X3SA 5IODA 1YHAA 2JK8A 5ELEA 2IY5B 2Z6KA 4H44C 1TS5A 5JVG3 1JT8A 1TVXA 1QG7A 4OWTB 1OXSC 5HGQA 5DM73 4BY7H 2NZHA 1E1TA 3TP8A 4ZQ3A 3PO2G 4DV3Q 2SNMA 4A3EB 2DNEA 4O1NA 4DV6L 1EYDA 2EYPA 2N55A 1EYGA 2F0IA 4OIKA 1TWGH 2RKSA 3GDEA 4RH6A 3J7AF 2PNRC 5JAVA 1I94L 1NMGA 4C1NK 3Q24A 1EIYB 2HQLA 1KD1C 1U9RA 3L0OA 3M3YH 1HTLD 2QA4A 3G48A 2Q8IB 1VQIA 1A0IA 2UXBL 5EAYA 1L1OB 1NR4A 4MZ9A 4C2MH 2PW5A 5HY6A 2YTVA 2B39A 1Q8KA 2KCNA 3O13A 4RCOA 2ZM6L 2O5IC 1FYCA 3T56B 4QUFA 2CH4A 4JV5L 1ZYRD 2NTSA 4UY8C 2JEBI 4GOPA 1O7ZA 4GZYC 2UU9L 2NTTA 4Q0FA 2IPKD 4A3KB 1G291 4C3HH 2L4NA 1SMYC 4IFDJ 2M2LA 1PA6A 4NKLA 1GUOA 2F0HA 3ULPA 4PZ7A 3NP8A 1VCIA 5IYDH 3CCEA 1HZAA 4LUZA 4KN4C 1II3A 3K80C 2EPBA 3W2DA 1V1QA 4K5VA 4BS9A 4C3HG 4HIKA 2KECA 4FXGC 4U68A 1XPOA 1N9WA 2B2VA 4TSSA 4XQNA 1PYWD 4QIWB 5BR8L 2DGYA 4JVZA 2RA4A 4UDUC 4XT1B 3RZDH 4R4OA 4R4QA 1FGBD 4UP9A 1C7YA 1MIUA 2A5HA 4FF1A 1TWGB 1F2LA 1IBLQ 4JCVE 4JBKA 2ID0A 5EBCA 4L5RC 2WINB 3V2TA 1EYCA 1F9PA 1D6EC 4YY3Q 4GOPB 1O78A 5LMUQ 4DV1Q 1N36Q 4TRDA 4X65Q 1HPCA 1EL0A 4CJ1B 3CP0A 4XQQA 4AQYQ 1JWMD 2N49A 2SEBD 1KAAA 1UNSA 5M9OA 3GTMH 2XVSA 2SNSA 4FVMA 5ELCA 3TSSA 4A3JH 3FKIH 3I7FA 3W1BA 1PTOC 4NXMQ 3SHLA 4LFBL 1KLGD 4DK6C 5KNCA 3MFGA 2VQEL 3CPFA 4C3HB 2E2IB 1HQMC 2EOTA 2ASBA 3OHXC 3SGIA 2QF7A 3OYYA 1U5KA 3KDFA 3GTLH 2HHHQ 3FKIG 1EYAA 2IX1A 1EY8A 4PG3A 1WI5A 4HCEA 3W5OA 5A2QE 2L5TA 1BQQT 1V1PB 3TP5A 2JA6H 1HZ9A 4ZUJA 4DV6Q 4Q5VA 1N32L 2K4KA 5AJ3L 3CHBD 2M9VA 3VYTA 2G9DA 4L5QA 1RTNA 2E2JB 4OL7A 3DWPA 1KQSA 4OO1H 1TKWB 3D0FA 1RCVD 4KJOA 1XTDA 1H9RA 2UXBQ 4O42A 3K81C 2OF1A 1B9NA 1JE5A 3CCUA 1MGSA 3I4OA 2ZM6Q 2BA0A 2NVQH 2PQAA 2MHVA 3BZKA 4JV5Q 1XMQL 3HOUH 3MTSA 4PZ8A 4OO1G 3FVQA 2BE5D 3DLLA 3NSWA 2UU9Q 4I65A 3M7NA 3QO2A 4YHHL 1E0BA 4DUYQ 1A2TA 1ENFA 5A35A 4O0AA 5C4JH 3EIVA 2FFKB 3DUZA 1AN8A 3M4PA 4DR1L 3MC0B 1J5EL 4BBRG 1MD2D 3HOUG 2CHBD 1AZQA 3Q22A 1PXUA 1N34Q 1AP0A 2RBMA 1A3VA 4RG1A 2MPMA 3N6RA 3VYUA 3GTQB 5DNFA 2KCMA 5C3XA 4DV7L 1SLJA 2Q2UA 1B53A 3NTIA 4K2KA 5F2DA 4GKJL 4OO1I 5C0XJ 1ET9A 3CKIB 5JJLA 2RDFA 1X3QA 2LS01 4FF2A 3SEBA 1F2ZA 1SNCA 4XT3B 3HOXH 3D3RA 1JORA 4LW1A 3OPOA 3IFDA 4DAYA 2EY1A 3MFYA 1PFMA 1LT6D 3UI2A 2QW7A 4UPAA 1STYA 3BZDB 3CF5A 2MNAA 4R4IA 1Y1WG 4MN3A 5FO8B 3J81L 1YNJC 3HOXG 1XNQL 1PRTC 3CCRA 3J7ZC 2EVBA 5IWAL 1O80A 3EN2A 1EU3A 2NVQB 1IXRA 2BH2A 4OWWB 4BBRB 1B3AA 4DU9A 3HOUB 4YWKA 5CBAE 3BYYB 1K83H 3F2CA 4APVA 2A68C 2V4DA 2F0LA 5EQ0A 3JAML 4LFBQ 3A55A 2VQEQ 3D6WA 1WFQA 4OELB 4IUUA 2H4OA 1X54A 1A3TA 2JP1A 1BNZA 2Q8TA 4DAMA 4JBMA 2Z4HA 4CJ0B 3J81j 3NXWA 4ALPA 4AH6A 4JOIA 1PZID 4K2LA 1IW7C 1Y69U 3FEWX 4GN5A 4POGA 3K7AB 2KCCA 3MVVA 2DY8A 4B3SL 5AJ3Q 3R93A 1SSOA 4JI6L 4KD3A 3S1NH 1CKNB 1HNWL 4JBWA 1SMYD 3OWFA 4KY7A 4IFDI 4N8X1 3S1MB 4CKBA 2B8FA 1NTGA 2FMMA 2EXDA 1E3PA 1Y1WB 3S14H 5J39A 5E7NA 3HOXB 1XMOL 4LF9L 4KHVA 1F77A 1GKHA 2F0DA 4DR3L 3GQBA 2YTXA 5JJKA 3MXPA 4DR6L 2A69C 4QUCA 5EBDA 4DFAA 1S5ED 3CCVA 4GNXC 4GLAC 5C4HA 5LL6S 1JJCB 3SK5A 2EY2A 4PMBA 2RSNA 2I5MX 1H9SB 2A73B 3I73A 3A54A 4YHHQ 3MEFA 4F7XA 4ZK9B 1NBWA 5ISRA 3GTKH 4KHPQ 1G6ZA 1J5EQ 1VS0A 2NZOA 5D65A 3VR4A 5LMNW 4FNFA 2AQ3B 4K6DA 1K83B 1B70B 1WTRA 2H5XA 1XPUA 1G2TA 1DONA 4JYAL 1R4QB 4RHSA 5K36H 3EBEA 1VMPA 2Q8RE 1KDAA 2EYJA 1PV4A 4RWSC 3TDQA 3VYRA 1GUWA 4RKBA 4GKJQ 2PYKA 3Q0AA 1FL0A 1SYCA 1O7LA 2CW0C 1JR0D 2WB1E 1X6OA 1YEZA 4LUOA 4KLKA 3OIPA 4LF6L 5GAGC 3TS2A 3K6OA 5K36G 3VA7A 1PTOD 2TSSA 2D9UA 4L6TB 1A8VA 3ULJA 4QCLA 4JI2Q 5EKKA 1EY0A 3S1NB 3K0YA 4HN7A 3PUZA 4IURA 2WAQG 1BCPD 1A6XA 3AYHB 1K8MA 2I0QA 3NQTA 3G7LA 1F9RA 2ALYB 2XRQD 3MXGA 2Z6BA 3J7A5 3KJPA 1DOLA 3S14B 1UUPA 4RCNA 4G7ZC 2KENA 3KOJA 3QWNA 1EUJA 4J1MA 5LL6X 1Q8IA 5IWAQ 3TS0A 1DCZA 2VB3X 2ZJRA 4MTKA 3CAMA 1ZXTA 3AFPA 3BVMA 4J15A 2L1BA 2LY7A 2NWGA 1EQVA 3F1ZA 3E0JA 1S72A 1ENAA 3R3OA 2F3WA 1L1OC 4BXXG 3I2ZA 1FD7D 3SE0A 1KL9A 1VQ4A 1OTCA 1YIJA 5H1SE 3GTKB 3KF6B 4L5SA 2D2CC 1Z7TA 2NVTB 3I4MH 5AFWA 4XYQA 1EWCA 2NVYH 1UWVA 5TSSA 1M90C 1HZCA 4KY5A 1ESRA 2RSOA 1Y14B 3FRPB 2A6ED 1VDZA 5IGDA 1V9PA 2ZTEA 3S9WA 5C0XG 2EXZA 4EX5A 4JI6Q 5BN4A 3QOJA 3CCQA 3I4MG 1HNWQ 3TREA 2VXWA 2WAQB 4ODGA 2R93G 3NBHA 4DR2L 3FPUB 2JEAI 3TZDA 3HOVG 4HSPA 1PLFA 2AUKA 3PUWA 3T53B 2PI2E 3E6ZX 3K58A 3PF4A 1Y1VB 2YU9H 4IOAA 5KEEA 2DN8A 2B63G 1XX8A 5FLXE 3CXCA 2F4VL 4AYBE 2KQ3A 1QCBD 5C0XI 4MTNA 1HNXL 1HFGA 2CH4W 1HXYD 2RF4A 2E75C 2CQOA 3K59A 4B3ML 3A0JA 1CQVA 2MJ8A 4A3FH 4GOPC 3B6YA 4P2CB 2C35B 1SRUA 4KK7A 1YNNC 4X3KA 5IOCA 3KJOA 4JYAQ 4LUVA 5CGKA 3FPPA 1C0AA 1WTVA 2ZJQA 2EJFC 4K8JA 5ELOA 4MNOA 3VA5A 1QNUA 4LF7L 2NYZD 2HQEA 1PRTD 1LABA 3I4MB 3TP6A 1HUMA 2MO1A 5M3MG 3S2DB 4A3FG 1GUTA 1A15A 5T1IA 2R93B 2NVYB 4AIMA 1VQHA 3GTPH 2F03A 1BCPF 1I50H 4LF6Q 3HOVB 5J1ZA 5D3DA 2UXCL 3NUCA 1VMCA 1CT1D 2A68D 4CDFC 2HIVA 3OW2A 4L8JA 2BOSA 4OGQC 1TIID 2IX0A 2KEEA 4X64L 2QDBA 2EYHA 4KKUA 2B63B 1QUQA 2AKWB 3E9IA 3RLNA 1XNRQ 5JJZA 5E1FA 4UAIA 2K5WA 1IW7D 1SROA 1SAPA 2N3SA 4EVOA 3D6CA 4ABNA 1LLRD 2F0FA 4JI8L 4G7OC 3TP7A 2F52A 1WD0A 1YBYA 3P1HA 1FNWA 5CV7A 1LTAD 4DUZL 3I4NG 5IGCA 2RCNA 1RJTA 3NK9A 4FO2A 2AQ2B 2AWOA 3VR5A 4DV2L 1BUVT 4YCUA 1QVFA 1Z9FA 2WFWA 1FVIA 4IPDA 1VQ8A 3CQZB 1QVGA 2AUJD 3I3CA 5M3MB 3G71A 2B2YA 4A3FB 4A4IA 2JA7H 4XDXA 2EZVA 3RZOB 2R3ZA 4PMWA 1STHA 2LFNA 3T1YL 1CQFA 4ZUIA 2UXDL 3D4WA 1R9TH 1ZEQX 1HH2P 1VF7A 3MEHA 2L55A 2K01A 1VQCA 1MJEA 2LKVA 2RHQB 1KNAA 2Z0SA 1TWAB 1X65A 4LFAQ 3RN2A 1QB5D 4QB4A 1SFOH 3BVGA 1GOZA 1LTGD 1DGSA 3X3MA 1I50B 1X32A 4DR2Q 3E0EA 1CI3M 1QUQB 1EY7A 1RL2A 1SR3A 3HFZB 4A3GB 1NY4A 2VS1A 3H94A 5IGGA 1SYFA 5EKIA 1LTRD 1D8LA 3D8GA 3I4NB 4C3JH 1PH9A 4PZ6A 4BY7G 4K5XA 3TN2A 2AQ1B 4KHZA 4B3RL 1TU2B 1VQOA 4JI0Q 5M5YB 3CCMA 1HNXQ 4DR4L 2O5JC 4YIJA 1KHIA 3OSOA 1BBXC 3BG3A 3HOZH 1MHWC 3DM1A 4IUQA 4HR7B 5I9OA 1MI2A 1TWCH 1STAA 2XWBB 3HOWH 1I5FA 4C3JG 3SR1A 4HCSA 3HS0C 4OXPA 4RGMA 1JC7A 1LTID 1C48A 1B1ZA 1EOVA 1YHQA 2QILA 2Z4IA 3NENA 1FNVA 4DKAC 4NPSA 4X6AH 4LF7Q 3HOZG 4K5WA 1S5CD 1KAWA 2K7VA 1WJJA 3HOWG 1CKMA 2ICIA 3STBC 1X3FA 3HKZE 2BCOA 1JWUD 2MP1A 3PO2B 1J9OA 4LF8L 2RHSB 4XTCS 3M85A 1WTPA 3VYSA 1Q7YC 1SE8A 2RDGA 2F0OA 2D5DA 1G8ZD 4CKCA 4GN3B 4HIMA 1TQOA 1V43A 5BN3A 2R7ZH 4BY7B 4DV5L 5CBEE 3ZYYX 5IYDG 2MFIA 3G4SA 1EY6A 2HCCA 4BWGB 5KNBA 3EVQA 4JI8Q 5CORA 1LT4D 1KNEA 4O2DA 2MUYA 4GLXA 4C3JB 4JI5L 2DUDA 1BVSA 5EPJA 5D14A 4FF3A 3M3YB 3NBIA 1SNDA 4ZKCB 4P71A 1HFNA 1SE2A 4X3UA 1E7ZA 4C2MB 3HOZB 2XNAC 1B7YB 3U4VA 4G7HC 1I4PA 3HOWB 2VL6A 2WB1G 1VQ7A 4YWLA 2OWOA 1V8QA 2B2TC 2F0QA 4E6IA 2F1MA 1JICA 3HKSA 2UXDQ 2Z8LA 2K5DA 4A76A 4M8AA 1STGA 3NTKA 2JXMB 1TR5A 2EE1A 3Q8DA 3PIO3 2FHTA 4IN3A 3T1HL 4JOIC 2DY7A 1CKOA 3MXUA 4K0KL 2PMZB 3CCJA 4FP5D 4A3JG 1EOTA 4ID6A 3F2BA 4KKSA 2Y0SG 4IZ8A 3P75A 1N8RC 3RMHA 2N78A 4RMFA 5I6YA 4B9XA 1WCMH 1STEA 1YNND 4P75A 3A74A 1ASZA 1PFSA 2B8GA 1I94Q 1RD9D 4B9WA 2K33A 2OT2A 3K8AA 4LMQD 1GUGA 4B3RQ 2K5NA 4ZCKA 3DMUA 3CRLC 3WDNA 1A3UA 3RZDB 2JA6G 1MSGA 1SJED 1LACA 1PH2A 5DAUA 1I4XA 5CMDA 3A7LA 1AH9A 1VQ6A 4EQOA 3EROA 1TWFH 1YJWA 3FDTA 2F0JA 3Q23A 1IL8A 3P7JA 3CC4A 1EWHA 2WB1B 1U4RA 2PPBC 1DD2A 1Z47A 2MGSA 1SNOA 1CUKA 4KN7C 3M4YA 5JEAH 1U4PA 3GTJH 4XQJA 1TWHH 1JOOA 1AE2A 4BY1H 3SK6A 3GTMB 3F8TA 4J8QA 4NW2A 1XWEA 3F2UA 3KDFB 2XWJB 4A3JB 3FKIB 4NXNL 2PI2A 2Y0SB 2Q2IA 4IUNA 3EFXD 1PVOA 2PNHA 3S1RH 5J22A 4LF8Q 5JEAG 3ITPA 4QJFA 1O7IA 5C4ZA 1TT2A 3GP7A 3A8KE 4G57A 2A6HC 2KUMA 4OWXB 1RDPD 4DAPA 3GTOH 2NUCA 1VQ9A 3GTLB 1VQFA 1B3QA 3EJIA 3CD6A 5JJIA 2GVBA 5BR8Q 1K3RA 2QKIC 2OEOA 2ZTCA 5CV6A 5G3LD 4KV6A 2JA6B 2ZXRA 2LMCB 2XGTA 4B3TL 2BH8A 2JA5H 4RA8A 3U9OA 3K5LA 3J80E 5KYIA 4HIOA 4C3IH 2HD3A 3J7AV 4JI3L 4QF4A 4FXDA 2PQAB 1PH5A 1IKMA 5L37A 4LJZC 1IBKL 1BOSA 1QJOA 3ERSX 2XTIA 4QL5A 1PZKD 3HZXA 4WJWA 1QNKA 4C1NI 4K14A 3IRBA 1LTBD 1LT5D 2NN6H 3QOLA 1DXMA 4HAEA 2E2DC 4GLVB 1TWFB 4A93H 4TKOB 3NELA 1B44D 1BO0A 2JYOA 5FLXc 1HTPA 1CSQA 4PNYA 1SE3A 3R2IA 1KIXA 2YV5A 1OXUA 3S17H 4BA1I 1FJGL 2SOBA 1AFPA 1IZ6A 1D2BA 1D5MC 3CCSA 3G6JB 3K0XA 1PTOH 5C4JB 1H9MA 2EY5A 2F0TA 4RGTA 3CMEA 3T1HQ 4A93G 2F0VA 1CZGA 2EYOA 1QILA 4QQBX 4K0KQ 2IT1A 3ONAB 3JAMi 3RNUA 1PH6A 3F2DA 2P5ZX 3WOFA 1ESFA 4HMIA 4UP7A 4DK0A 5FJ8H 2IL8A 1G51A 1OXVA 3KF8A 3BYTB 3R8BA 3KFUA 1ZKOA 1N32Q 1WTOA 1YNXA 1HCZA 3CC2A 3S16H 3GTOB 4DAYB 1SYEA 1YJ9A 1I6HH 1KLUD 1PYBA 2N8NA 5FJ8G 2K32A 2QEJC 3OIQA 2IX3A 3STBD 3E9HA 2JJQA 4JI7L 2VZAA 5IT9E 4IUVA 1I4HA 1K8GA 1JQYD 1A62A 1PH7A 3QG1A 4DF7A 1XMQQ 1Q46A 2IHFA 2K14A 3RUZA 3AMUA 4POFA 4RFBA 1Q1BA 5IP9H 3T13A 2JQOA 5GAHC 1JE4A 2J4XA 3OMCA 2F0EA 1WOCA 1S5DD 2NBFA 1S5BD 4RHRA 2QGQA 2VW9A 4A93B 4DR1Q 1YVCA 1K8OA 1HR0W 2B2WA 4UP8A 5FO9B 1UE5A 1DM0B 4R8IA 4K6LA 1I6VC 2FJ2A 4IPHA 4L63B 4DV7Q 1IYVA 4H02A 1CA5A 2X6LA 2A1AA 1KDCA 3A8JE 1KRSA 5EPLA 4OHJA 3QJYA 1BKBA 1BCPB 3HG9A 4G4KA 3FMCA 3UDFA 2V1CC 1Y8OB 1JB7A 5D3IB 5A2QL 2VQFL 4B3TQ 1N33L 3HEJA 1L0YB 2HT1A 4N9TA 4RGOS 3CPWA 1NJIC 2EYMA 1F2MA 5LMNL 4JI3Q 2K52A 3H0GH 3H3VH 1A2UA 2F0WA 1IBKQ 3IAYA 1I6HB 1HRJA 1G2SA 1EY9A 4IPCA 1EZ8A 1FGUA 4LF5L 4FYDA 4A3MH 1LO5D 1XNQQ 3I4LA 3TBIB 3MAQA 4LNQA 1GUNA 2UUBL 2HCIA 2L0CA 1E2WA 5IYCH 3BZCA 3S15H 3KLSA 4Y7NH 1AEXA 3Q6SA 1ZYRC 3HKZG 1X56A 4ME3A 1PYSB 5IP7H 1PZJD 1LUZA 3OTOL 1NUCA 4A3MG
chains in the Genus database with same CATH topology
5LMUQ 4DV1Q 1WYDA 4HIDA 1N36Q 1FJGQ 2AWOA 4X65Q 4DV2L 1LTLA 1GVPA 2AHOB 2NN6G 3CP0A 4YCUA 5IE8A 1Z9FA 2N49A 4AQYQ 1PH8A 1QVFA 5IYCG 2WFWA 1FVIA 4IPDA 1VQ8A 3GTMH 1H95A 2E2HH 1QVGA 4YCVA 3G71A 2VNUD 2I5HA 5IP7G 4A4IA 2B29A 4A3JH 3FKIH 1EFWA 3I7FA 4JI1L 2JA7H 4PMWA 3S1QH 2LXJA 3W1BA 3T1YL 1VQMA 2ZJPA 2KHIA 4NXMQ 4LFBL 2UXDL 4QIWE 1R9TH 4IFDG 4DK6C 1HH2P 3BJUA 4B3SQ 4OX9L 2VQEL 3CPFA 1E1OA 1VQCA 3RLOA 4R4TA 1MJEA 2ASBA 2RHQB 1Q86C 2Z0SA 2Z6KC 1X65A 4LFAQ 3SGIA 3RN2A 1K9MC 3H3VI 4GKKL 1SFOH 3OYYA 3H15A 1U5KA 3KDFA 3PIPA 3GTLH 2HHHQ 3RN5A 4Y52H 3FKIG 1DGSA 2D62A 2OCEA 2IX1A 4DK3C 4DR2Q 3E0EA 4PG3A 1QUQB 1WI5A 3W5OA 1YZ6A 3J80i 2NN6I 1RL2A 1XMOQ 4JI7Q 4LF9Q 2JA6H 1HZ9A 4DV6Q 1SR3A 4DR3Q 3HFZB 1G6PA 4DR6Q 1NY4A 1N32L 2K4KA 2VS1A 5AJ3L 4A3CH 1D8LA 1Q12A 3TQYA 2CWAA 2HIXA 4A3LH 3GD7A 4C3JH 1PH9A 4PZ6A 3CW2C 1UE1A 4L5QA 3PIOA 4BBSH 4BY7G 2JA8H 4KHZA 3UE0A 4B3RL 1BBUA 1VQOA 4EQ5A 1KQSA 4JI0Q 3D0FA 5IYBH 3CCMA 1HNXQ 1J6QA 4DR4L 1XTDA 1KHIA 4JBJA 1YITA 2UXBQ 4WJ4A 5ELNA 3K81C 3HOZH 1VQDA 4LF4L 5J3BA 1JE5A 1TWCH 3CCUA 3I4OA 2ZM6Q 2BA0A 5C44H 2PQAA 2NVQH 1I5FA 2A19A 4NXNQ 4TQUS 3HOWH 3BZKA 4A3LG 3FHWA 4JV5Q 1XMQL 1VQNA 3HOUH 5IP9G 4OXPA 4PZ8A 4OO1G 5IYBG 2PMZE 2UU9Q 3DLLA 2CFMA 1EOVA 3PUVA 1YHQA 1HNZL 1IL2A 3KF8B 3NENA 5GAEC 3M7NA 3L7ZC 3M4OH 4DKAC 4NPSA 4X6AH 4YHHL 4LF7Q 1IYJB 3HOZG 4DUYQ 2ZTDA 2NVXH 4O0AA 1KAWA 5C4JH 3S2HH 1GM5A 3EIVA 1WJJA 2Q2TA 5C44G 3HOWG 4R4CA 3M4PA 1CKMA 4DR1L 1J5EL 4BBRG 2NVTH 3HOUG 3STBC 3L2PA 4A3IH 3NBHB 2F3IA 1N34Q 1X3FA 1Q82C 3HKZE 2B3GA 1B8AA 2RHSB 4LF8L 2BA1A 4XTCS 2VUMH 3M85A 4DR7Q 4RG1A 1HJPA 3ICEA 3PSIA 2KCMA 5M3FH 1Q7YC 1SE8A 4DV7L 1Q81C 2OTLA 1SLJA 3KF6A 2CWPA 2Q2UA 1VQ5A 1BBWA 4GN3B 5LMNQ 4HIMA 1HR0L 3PCOB 1V43A 4GKJL 1GD7A 5C0XJ 2R7ZH 4OO1I 1L2FA 4DV5L 4A3IG 4P72A 5JJLA 1X3EA 5IYDG 2AWNA 2MFIA 1JJ2A 3LGJA 1YJNA 3G4SA 2EIFA 3W1GA 3HOXH 4A3EH 3U50C 4JI8Q 4LW1A 1Y1VH 1S3OA 3H0GG 4O2DA 4YCWA 4GLXA 4JI5L 2DUDA 1BVSA 4UPAA 3CF5A 2Q2HA 3NEMA 3OTOQ 2MNAA 4R4IA 1Y1WG 2UUAL 1UEBA 5FLMH 2Y0SE 1XNRL 4BXXH 1OXXK 3HOXG 4P71A 4A3EG 2UUCL 1XNQL 2E5LL 1E7ZA 3CCRA 3J7ZC 4DV4L 4LFCL 4DV0L 3M9BA 5IWAL 1B7YB 3TRZA 1ASYA 1Y1VG 3M4QA 3U4VA 1K73C 3GTGH 3ULLA 2AMCB 2YTYA 3EN2A 1VQBA 1IXRA 2VL6A 4JI4L 2BH2A 2WB1G 1IBLL 1VQ7A 4OWWB 1YI2A 4YWLA 4JI1Q 4YWKA 2OWOA 1Q1EA 1YHBA 1K83H 3HKSA 4APVA 3F2CA 3KLWA 3WWVA 3VDYA 4LFBQ 2UXDQ 4A76A 4YY3L 3J81c 1M1KC 2VQEQ 1N36L 1KC8C 1EQRA 1L1OA 1WFQA 2K50A 3Q8DA 3I55A 4A3KH 1X54A 2FXQA 4AQYL 1E22A 5JEAJ 3T1HL 4DAMA 2R6GA 4GKKQ 4JBMA 4JOIC 3D31A 3J81j 4ALPA 1CKOA 4K0KL 2CKZB 3A5ZB 4JOIA 4AH6A 3CCJA 3F2BA 4HJAA 4A3JG 1VQKA 1I3QH 2JA7G 2Y0SG 1X55A 3MXNB 3S2DH 2JA9A 4DPGA 2R93H 1CSPA 1N8RC 1SMXA 3JAMc 1A63A 4GN5A 2N78A 4POGA 1PH3A 4RMFA 2OQ0A 4NXML 3HOVH 1WCMH 4A3KG 4B3SL 4P75A 3A74A 3BU2A 5AJ3Q 4HJ9A 2ES2A 4JI6L 1ASZA 4LFAL 4A3BH 3S1NH 1PFSA 1I94Q 1IBML 1CKNB 1HNWL 2QEXA 3CCLA 4JBWA 2HHHL 3K8AA 3DM3A 4IFDI 2F4VQ 4B3RQ 4P74A 2K5NA 2B63H 1NTGA 2EXDA 1E3PA 4WJ3M 2JA6G 3S14H 1LM0A 4IJHA 4DV3L 2LSSA 4QY7A 5E7NA 3JC66 1XMOL 4LF9L 1QVCA 4P73A 1GKHA 4XIGS 4DR3L 1PH2A 4X66L 3KYHC 3J80c 2YTXA 3CMAA 1K0RA 4LF4Q 4B3MQ 4NB3A 1VQ6A 4DR6L 4A3BG 4GNXC 3CCVA 4A3CG 5JJKA 1YJWA 1KXLA 1TWFH 3CC4A 4GLAC 4GNXA 4KI0A 4BBSG 3ER0A 2JA8G 1JJCB 1Z47A 3PV0A 3PUXA 4DR5L 2K5VA 4OONA 2OTJA 1CUKA 1HNZQ 2I5MX 4JI0L 2CCZA 3GTJH 4YHHQ 1XJVA 3MEFA 1LYLA 1TWHH 4IJLA 1W2BA 1VQEA 1AE2A 4BY1H 3PO3H 1NBWA 4KHPQ 3GTKH 3F8TA 3U58A 2R7DA 4IO9A 3CQZH 1T9HA 1J5EQ 1VS0A 2NZOA 3KDFB 5LMNW 5M3MH 4NXNL 1L0WA 2PI2A 3UE1A 1UE7A 2Q2IA 3RZOH 1PVOA 2PNHA 3S1RH 2WAQE 4HJ7A 4FDBA 1B70B 4L5TA 2VQFQ 5JEAG 4IOCA 4LF8Q 1N33Q 2H5XA 3I56A 1PH1A 4QJFA 1O7IA 1XPUA 1PH4A 4JYAL 5M5XH 3EBEA 3PO3G 4OWXB 1PV4A 2E2IH 4GN4B 3UDIA 4DUYL 1W3SA 3GTOH 4LWCA 4X64Q 1TWAH 1HR0Q 1VQ9A 1VQFA 1TXYA 4GKJQ 1VQPA 3CD6A 1FL0A 5JJIA 2GVBA 5BR8Q 1K3RA 2ZTCA 4IPGA 4X62L 3CC7A 4LF5Q 2WB1E 2GN5A 1X6OA 1YEZA 4KLKA 4LUOA 1N34L 2D0OA 5GAGC 4LF6L 2VUMG 4JC0A 4BA2I 3TS2A 5K36G 2XGTA 1QZHA 4B3TL 2UUBQ 2BH8A 2JA5H 5IY0A 1JJGA 1A8VA 3ULJA 5M3FG 4JI2Q 5GQOA 4HIOA 4A3GH 4C3IH 2VY3A 4DUZQ 1C9OA 3PUZA 4JI3L 2R7ZG 2WAQG 2PQAB 1PH5A 3I4NH 3AYHB 1IBKL 4GNXB 1U0LA 2KHJA 2I0QA 3ERSX 2E2JH 3GO5A 2OQKA 2UUAQ 1MKHA 2XTIA 2MQHA 2ALYB 5GADC 3AQQA 5M5YH 2EQSA 4QL5A 3KJPA 1QZGA 3J7A5 5DLQE 3RLFA 4DV2Q 2UUCQ 2E5LQ 3S24A 2KENA 3KOJA 5IT9c 3IRBA 2JE6I 4DNIA 4DV0Q 1EUJA 5IWAQ 4DV4Q 1VQLA 4LFCQ 2LXKA 3TS0A 4R1JA 4A3GG 2ZJRA 4GLVB 3PUYA 5C4XH 4A93H 4JI4Q 3CAMA 1NMFA 3AFPA 3NELA 4J15A 1XPRA 1P8LA 3T1YQ 5FLXc 1CSQA 2YYZA 3F1ZA 3TEHB 1KIXA 5FLMG 2YV5A 4HJ8A 4A75A 1OXUA 1S72A 3S17H 1L1OC 4BXXG 4BA1I 1OXTA 3I2ZA 5LMUL 4DV1L 3ZJYC 4OX9Q 1FJGL 4X65L 1IZ6A 1RIPA 2A8VA 3CCSA 1KL9A 1VQ4A 3K0XA 1OTCA 3UDXA 3K7UC 5H1SE 1YIJA 3RR5A 3CMEA 3T1HQ 5C3EH 1X3GA 3UDGA 1X9NA 3KF6B 4A93G 5C4XG 4L5SA 4QQBX 4K0KQ 1HZBA 2IT1A 3I4MH 1SN8A 3JAMi 3RNUA 1PH6A 3F2DA 2IHEA 2NVYH 1UWVA 4UP7A 1M90C 1HZCA 2E8GA 1GO3E 2K75A 5FJ8H 1D7QA 1G51A 1OXVA 1Y14B 3PO2H 3KFUA 4YWMA 1V9PA 2ZTEA 3A5UA 1UE6A 2KBNA 5C0XG 1N32Q 4EX5A 3GTQH 1YNXA 2L15A 5C3EG 3CC2A 3S16H 4JI6Q 4DAYB 1PHJA 1YHAA 4QGUA 3CCQA 1IBMQ 2JK8A 3I4MG 1HNWQ 3TREA 2IY5B 2Z6KA 1YJ9A 2R93G 1I6HH 1JT8A 4OWTB 1OXSC 1PYBA 5HGQA 3G6EA 4BY7H 4DR2L 2N8NA 2NZHA 1E1TA 5FJ8G 2JEAI 3HOVG 3STBD 3E9HA 1WCMG 1JMCA 3PUWA 4DV3Q 1K8AC 3PO2G 4DR4Q 2JJQA 2PI2E 4JI7L 2VZAA 4DV6L 1NE3A 3PF4A 4X66Q 1EYGA 1K8GA 1A62A 1TWGH 1PH7A 3GDEA 3U4ZA 1I94L 1XMQQ 2YU9H 2ATWA 4IOAA 1Q46A 2IHFA 2K14A 4POFA 1NMGA 2B63G 1E24A 4DR5Q 1Q1BA 5IP9H 3CXCA 2JQOA 4AYBE 5GAHC 1EIYB 2F4VL 2HQLA 1KD1C 5C0XI 3L0OA 4MTNA 1HNXL 3M3YH 1KRTA 2QA4A 3G48A 1WOCA 1S40A 3AFQA 1VQIA 2RF4A 1A0IA 2UXBL 5EAYA 1L1OB 2CQOA 4MZ9A 5HY6A 4C2MH 2QGQA 2KCTA 2YTVA 2VW9A 4B3ML 1Q8KA 3A0JA 1AH9A 4DR1Q 1YVCA 2ZM6L 1HR0W 4A3FH 1AE3A 4GOPC 2WP8J 2R7FA 4UP8A 4BBRH 4JV5L 1UE5A 3B6YA 4UY8C 2C35B 2JEBI 1SRUA 4GOPA 3HOYH 2UXCQ 2UU9L 3KJOA 4JYAQ 4LUVA 4JG2A 4IPHA 2I5LX 4HJ5A 1C0AA 2ZJQA 1G291 5ELOA 4MNOA 4BY1G 4DV7Q 4C3HH 4H02A 4LF7L 3FP9A 2A1AA 2K5HA 3PGZA 4IFDJ 4KHPL 1PA6A 1KRSA 1BKBA 4AYBG 2MO1A 5M3MG 4A3FG 1EWIA 4DV5Q 4AIMA 3ULPA 1VQHA 3GTPH 4A3DH 4X62Q 4PZ7A 3HOYG 1I50H 3UDFA 2V1CC 1JB7A 4LF6Q 1VCIA 5IYDH 3CCEA 1HZAA 3PF5A 2VQFL 3K7AH 4B3TQ 1N33L 4LUZA 4DR7L 2UXCL 3K80C 2HT1A 1V1QA 3OW2A 2HIVA 4HIKA 5M5WH 3AEVA 2R92H 1XPOA 1N9WA 2IX0A 3CPWA 1NJIC 2D0PA 1P16A 5LMNL 4X64L 4JI3Q 1VQAA 2K52A 4JI5Q 3H0GH 3H3VH 1IBKQ 2MO0A 4A3DG 1QUQA 2AKWB 5BR8L 1MJCA 4IPCA 4TVAB 3S1MH 1FGUA 3E9IA 4LF5L 3RLNA 2DGYA 1XNRQ 4A3MH 1Y1WH 1EQQA 2JA5G 3RZDH 1XNQQ 1EIFA 1SROA 2N3SA 4LNQA 4R4OA 4R4QA 4GS3A 2UUBL 2R92G 4UP9A 1C7YA 4JI8L 1MIUA 4JI2L 5IYCH 2F52A 1YBYA 3BZCA 3S15H 4Y7NH 1CKNA 1IBLQ 4JCVE 4DUZL 3I4NG 4JBKA 3HKZG 2ID0A 1X56A 2GVAA 1PYSB 1VQGA 4ME3A 5IP7H 3J81i 4L5RC 5GROA 1LUZA 1VQJA 2RCNA 3OTOL 4YY3Q 4GOPB 4A3MG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LMU Q;  4DV1 Q;  1WYD A;  4HID A;  1N36 Q;  1FJG Q;  2AWO A;  4X65 Q;  4DV2 L;  1LTL A;  1GVP A;  2AHO B;  2NN6 G;  3CP0 A;  4YCU A;  5IE8 A;  1Z9F A;  2N49 A;  4AQY Q;  1PH8 A;  1QVF A;  5IYC G;  2WFW A;  1FVI A;  4IPD A;  1VQ8 A;  3GTM H;  1H95 A;  2E2H H;  1QVG A;  4YCV A;  3G71 A;  2VNU D;  2I5H A;  5IP7 G;  4A4I A;  2B29 A;  4A3J H;  3FKI H;  1EFW A;  3I7F A;  4JI1 L;  2JA7 H;  4PMW A;  3S1Q H;  2LXJ A;  3W1B A;  3T1Y L;  1VQM A;  2ZJP A;  2KHI A;  4NXM Q;  4LFB L;  2UXD L;  4QIW E;  1R9T H;  4IFD G;  4DK6 C;  1HH2 P;  3BJU A;  4B3S Q;  4OX9 L;  2VQE L;  3CPF A;  1E1O A;  1VQC A;  3RLO A;  4R4T A;  1MJE A;  2ASB A;  2RHQ B;  1Q86 C;  2Z0S A;  2Z6K C;  1X65 A;  4LFA Q;  3SGI A;  3RN2 A;  1K9M C;  3H3V I;  4GKK L;  1SFO H;  3OYY A;  3H15 A;  1U5K A;  3KDF A;  3PIP A;  3GTL H;  2HHH Q;  3RN5 A;  4Y52 H;  3FKI G;  1DGS A;  2D62 A;  2OCE A;  2IX1 A;  4DK3 C;  4DR2 Q;  3E0E A;  4PG3 A;  1QUQ B;  1WI5 A;  3W5O A;  1YZ6 A;  3J80 i;  2NN6 I;  1RL2 A;  1XMO Q;  4JI7 Q;  4LF9 Q;  2JA6 H;  1HZ9 A;  4DV6 Q;  1SR3 A;  4DR3 Q;  3HFZ B;  1G6P A;  4DR6 Q;  1NY4 A;  1N32 L;  2K4K A;  2VS1 A;  5AJ3 L;  4A3C H;  1D8L A;  1Q12 A;  3TQY A;  2CWA A;  2HIX A;  4A3L H;  3GD7 A;  4C3J H;  1PH9 A;  4PZ6 A;  3CW2 C;  1UE1 A;  4L5Q A;  3PIO A;  4BBS H;  4BY7 G;  2JA8 H;  4KHZ A;  3UE0 A;  4B3R L;  1BBU A;  1VQO A;  4EQ5 A;  1KQS A;  4JI0 Q;  3D0F A;  5IYB H;  3CCM A;  1HNX Q;  1J6Q A;  4DR4 L;  1XTD A;  1KHI A;  4JBJ A;  1YIT A;  2UXB Q;  4WJ4 A;  5ELN A;  3K81 C;  3HOZ H;  1VQD A;  4LF4 L;  5J3B A;  1JE5 A;  1TWC H;  3CCU A;  3I4O A;  2ZM6 Q;  2BA0 A;  5C44 H;  2PQA A;  2NVQ H;  1I5F A;  2A19 A;  4NXN Q;  4TQU S;  3HOW H;  3BZK A;  4A3L G;  3FHW A;  4JV5 Q;  1XMQ L;  1VQN A;  3HOU H;  5IP9 G;  4OXP A;  4PZ8 A;  4OO1 G;  5IYB G;  2PMZ E;  2UU9 Q;  3DLL A;  2CFM A;  1EOV A;  3PUV A;  1YHQ A;  1HNZ L;  1IL2 A;  3KF8 B;  3NEN A;  5GAE C;  3M7N A;  3L7Z C;  3M4O H;  4DKA C;  4NPS A;  4X6A H;  4YHH L;  4LF7 Q;  1IYJ B;  3HOZ G;  4DUY Q;  2ZTD A;  2NVX H;  4O0A A;  1KAW A;  5C4J H;  3S2H H;  1GM5 A;  3EIV A;  1WJJ A;  2Q2T A;  5C44 G;  3HOW G;  4R4C A;  3M4P A;  1CKM A;  4DR1 L;  1J5E L;  4BBR G;  2NVT H;  3HOU G;  3STB C;  3L2P A;  4A3I H;  3NBH B;  2F3I A;  1N34 Q;  1X3F A;  1Q82 C;  3HKZ E;  2B3G A;  1B8A A;  2RHS B;  4LF8 L;  2BA1 A;  4XTC S;  2VUM H;  3M85 A;  4DR7 Q;  4RG1 A;  1HJP A;  3ICE A;  3PSI A;  2KCM A;  5M3F H;  1Q7Y C;  1SE8 A;  4DV7 L;  1Q81 C;  2OTL A;  1SLJ A;  3KF6 A;  2CWP A;  2Q2U A;  1VQ5 A;  1BBW A;  4GN3 B;  5LMN Q;  4HIM A;  1HR0 L;  3PCO B;  1V43 A;  4GKJ L;  1GD7 A;  5C0X J;  2R7Z H;  4OO1 I;  1L2F A;  4DV5 L;  4A3I G;  4P72 A;  5JJL A;  1X3E A;  5IYD G;  2AWN A;  2MFI A;  1JJ2 A;  3LGJ A;  1YJN A;  3G4S A;  2EIF A;  3W1G A;  3HOX H;  4A3E H;  3U50 C;  4JI8 Q;  4LW1 A;  1Y1V H;  1S3O A;  3H0G G;  4O2D A;  4YCW A;  4GLX A;  4JI5 L;  2DUD A;  1BVS A;  4UPA A;  3CF5 A;  2Q2H A;  3NEM A;  3OTO Q;  2MNA A;  4R4I A;  1Y1W G;  2UUA L;  1UEB A;  5FLM H;  2Y0S E;  1XNR L;  4BXX H;  1OXX K;  3HOX G;  4P71 A;  4A3E G;  2UUC L;  1XNQ L;  2E5L L;  1E7Z A;  3CCR A;  3J7Z C;  4DV4 L;  4LFC L;  4DV0 L;  3M9B A;  5IWA L;  1B7Y B;  3TRZ A;  1ASY A;  1Y1V G;  3M4Q A;  3U4V A;  1K73 C;  3GTG H;  3ULL A;  2AMC B;  2YTY A;  3EN2 A;  1VQB A;  1IXR A;  2VL6 A;  4JI4 L;  2BH2 A;  2WB1 G;  1IBL L;  1VQ7 A;  4OWW B;  1YI2 A;  4YWL A;  4JI1 Q;  4YWK A;  2OWO A;  1Q1E A;  1YHB A;  1K83 H;  3HKS A;  4APV A;  3F2C A;  3KLW A;  3WWV A;  3VDY A;  4LFB Q;  2UXD Q;  4A76 A;  4YY3 L;  3J81 c;  1M1K C;  2VQE Q;  1N36 L;  1KC8 C;  1EQR A;  1L1O A;  1WFQ A;  2K50 A;  3Q8D A;  3I55 A;  4A3K H;  1X54 A;  2FXQ A;  4AQY L;  1E22 A;  5JEA J;  3T1H L;  4DAM A;  2R6G A;  4GKK Q;  4JBM A;  4JOI C;  3D31 A;  3J81 j;  4ALP A;  1CKO A;  4K0K L;  2CKZ B;  3A5Z B;  4JOI A;  4AH6 A;  3CCJ A;  3F2B A;  4HJA A;  4A3J G;  1VQK A;  1I3Q H;  2JA7 G;  2Y0S G;  1X55 A;  3MXN B;  3S2D H;  2JA9 A;  4DPG A;  2R93 H;  1CSP A;  1N8R C;  1SMX A;  3JAM c;  1A63 A;  4GN5 A;  2N78 A;  4POG A;  1PH3 A;  4RMF A;  2OQ0 A;  4NXM L;  3HOV H;  1WCM H;  4A3K G;  4B3S L;  4P75 A;  3A74 A;  3BU2 A;  5AJ3 Q;  4HJ9 A;  2ES2 A;  4JI6 L;  1ASZ A;  4LFA L;  4A3B H;  3S1N H;  1PFS A;  1I94 Q;  1IBM L;  1CKN B;  1HNW L;  2QEX A;  3CCL A;  4JBW A;  2HHH L;  3K8A A;  3DM3 A;  4IFD I;  2F4V Q;  4B3R Q;  4P74 A;  2K5N A;  2B63 H;  1NTG A;  2EXD A;  1E3P A;  4WJ3 M;  2JA6 G;  3S14 H;  1LM0 A;  4IJH A;  4DV3 L;  2LSS A;  4QY7 A;  5E7N A;  3JC6 6;  1XMO L;  4LF9 L;  1QVC A;  4P73 A;  1GKH A;  4XIG S;  4DR3 L;  1PH2 A;  4X66 L;  3KYH C;  3J80 c;  2YTX A;  3CMA A;  1K0R A;  4LF4 Q;  4B3M Q;  4NB3 A;  1VQ6 A;  4DR6 L;  4A3B G;  4GNX C;  3CCV A;  4A3C G;  5JJK A;  1YJW A;  1KXL A;  1TWF H;  3CC4 A;  4GLA C;  4GNX A;  4KI0 A;  4BBS G;  3ER0 A;  2JA8 G;  1JJC B;  1Z47 A;  3PV0 A;  3PUX A;  4DR5 L;  2K5V A;  4OON A;  2OTJ A;  1CUK A;  1HNZ Q;  2I5M X;  4JI0 L;  2CCZ A;  3GTJ H;  4YHH Q;  1XJV A;  3MEF A;  1LYL A;  1TWH H;  4IJL A;  1W2B A;  1VQE A;  1AE2 A;  4BY1 H;  3PO3 H;  1NBW A;  4KHP Q;  3GTK H;  3F8T A;  3U58 A;  2R7D A;  4IO9 A;  3CQZ H;  1T9H A;  1J5E Q;  1VS0 A;  2NZO A;  3KDF B;  5LMN W;  5M3M H;  4NXN L;  1L0W A;  2PI2 A;  3UE1 A;  1UE7 A;  2Q2I A;  3RZO H;  1PVO A;  2PNH A;  3S1R H;  2WAQ E;  4HJ7 A;  4FDB A;  1B70 B;  4L5T A;  2VQF Q;  5JEA G;  4IOC A;  4LF8 Q;  1N33 Q;  2H5X A;  3I56 A;  1PH1 A;  4QJF A;  1O7I A;  1XPU A;  1PH4 A;  4JYA L;  5M5X H;  3EBE A;  3PO3 G;  4OWX B;  1PV4 A;  2E2I H;  4GN4 B;  3UDI A;  4DUY L;  1W3S A;  3GTO H;  4LWC A;  4X64 Q;  1TWA H;  1HR0 Q;  1VQ9 A;  1VQF A;  1TXY A;  4GKJ Q;  1VQP A;  3CD6 A;  1FL0 A;  5JJI A;  2GVB A;  5BR8 Q;  1K3R A;  2ZTC A;  4IPG A;  4X62 L;  3CC7 A;  4LF5 Q;  2WB1 E;  2GN5 A;  1X6O A;  1YEZ A;  4KLK A;  4LUO A;  1N34 L;  2D0O A;  5GAG C;  4LF6 L;  2VUM G;  4JC0 A;  4BA2 I;  3TS2 A;  5K36 G;  2XGT A;  1QZH A;  4B3T L;  2UUB Q;  2BH8 A;  2JA5 H;  5IY0 A;  1JJG A;  1A8V A;  3ULJ A;  5M3F G;  4JI2 Q;  5GQO A;  4HIO A;  4A3G H;  4C3I H;  2VY3 A;  4DUZ Q;  1C9O A;  3PUZ A;  4JI3 L;  2R7Z G;  2WAQ G;  2PQA B;  1PH5 A;  3I4N H;  3AYH B;  1IBK L;  4GNX B;  1U0L A;  2KHJ A;  2I0Q A;  3ERS X;  2E2J H;  3GO5 A;  2OQK A;  2UUA Q;  1MKH A;  2XTI A;  2MQH A;  2ALY B;  5GAD C;  3AQQ A;  5M5Y H;  2EQS A;  4QL5 A;  3KJP A;  1QZG A;  3J7A 5;  5DLQ E;  3RLF A;  4DV2 Q;  2UUC Q;  2E5L Q;  3S24 A;  2KEN A;  3KOJ A;  5IT9 c;  3IRB A;  2JE6 I;  4DNI A;  4DV0 Q;  1EUJ A;  5IWA Q;  4DV4 Q;  1VQL A;  4LFC Q;  2LXK A;  3TS0 A;  4R1J A;  4A3G G;  2ZJR A;  4GLV B;  3PUY A;  5C4X H;  4A93 H;  4JI4 Q;  3CAM A;  1NMF A;  3AFP A;  3NEL A;  4J15 A;  1XPR A;  1P8L A;  3T1Y Q;  5FLX c;  1CSQ A;  2YYZ A;  3F1Z A;  3TEH B;  1KIX A;  5FLM G;  2YV5 A;  4HJ8 A;  4A75 A;  1OXU A;  1S72 A;  3S17 H;  1L1O C;  4BXX G;  4BA1 I;  1OXT A;  3I2Z A;  5LMU L;  4DV1 L;  3ZJY C;  4OX9 Q;  1FJG L;  4X65 L;  1IZ6 A;  1RIP A;  2A8V A;  3CCS A;  1KL9 A;  1VQ4 A;  3K0X A;  1OTC A;  3UDX A;  3K7U C;  5H1S E;  1YIJ A;  3RR5 A;  3CME A;  3T1H Q;  5C3E H;  1X3G A;  3UDG A;  1X9N A;  3KF6 B;  4A93 G;  5C4X G;  4L5S A;  4QQB X;  4K0K Q;  1HZB A;  2IT1 A;  3I4M H;  1SN8 A;  3JAM i;  3RNU A;  1PH6 A;  3F2D A;  2IHE A;  2NVY H;  1UWV A;  4UP7 A;  1M90 C;  1HZC A;  2E8G A;  1GO3 E;  2K75 A;  5FJ8 H;  1D7Q A;  1G51 A;  1OXV A;  1Y14 B;  3PO2 H;  3KFU A;  4YWM A;  1V9P A;  2ZTE A;  3A5U A;  1UE6 A;  2KBN A;  5C0X G;  1N32 Q;  4EX5 A;  3GTQ H;  1YNX A;  2L15 A;  5C3E G;  3CC2 A;  3S16 H;  4JI6 Q;  4DAY B;  1PHJ A;  1YHA A;  4QGU A;  3CCQ A;  1IBM Q;  2JK8 A;  3I4M G;  1HNW Q;  3TRE A;  2IY5 B;  2Z6K A;  1YJ9 A;  2R93 G;  1I6H H;  1JT8 A;  4OWT B;  1OXS C;  1PYB A;  5HGQ A;  3G6E A;  4BY7 H;  4DR2 L;  2N8N A;  2NZH A;  1E1T A;  5FJ8 G;  2JEA I;  3HOV G;  3STB D;  3E9H A;  1WCM G;  1JMC A;  3PUW A;  4DV3 Q;  1K8A C;  3PO2 G;  4DR4 Q;  2JJQ A;  2PI2 E;  4JI7 L;  2VZA A;  4DV6 L;  1NE3 A;  3PF4 A;  4X66 Q;  1EYG A;  1K8G A;  1A62 A;  1TWG H;  1PH7 A;  3GDE A;  3U4Z A;  1I94 L;  1XMQ Q;  2YU9 H;  2ATW A;  4IOA A;  1Q46 A;  2IHF A;  2K14 A;  4POF A;  1NMG A;  2B63 G;  1E24 A;  4DR5 Q;  1Q1B A;  5IP9 H;  3CXC A;  2JQO A;  4AYB E;  5GAH C;  1EIY B;  2F4V L;  2HQL A;  1KD1 C;  5C0X I;  3L0O A;  4MTN A;  1HNX L;  3M3Y H;  1KRT A;  2QA4 A;  3G48 A;  1WOC A;  1S40 A;  3AFQ A;  1VQI A;  2RF4 A;  1A0I A;  2UXB L;  5EAY A;  1L1O B;  2CQO A;  4MZ9 A;  5HY6 A;  4C2M H;  2QGQ A;  2KCT A;  2YTV A;  2VW9 A;  4B3M L;  1Q8K A;  3A0J A;  1AH9 A;  4DR1 Q;  1YVC A;  2ZM6 L;  1HR0 W;  4A3F H;  1AE3 A;  4GOP C;  2WP8 J;  2R7F A;  4UP8 A;  4BBR H;  4JV5 L;  1UE5 A;  3B6Y A;  4UY8 C;  2C35 B;  2JEB I;  1SRU A;  4GOP A;  3HOY H;  2UXC Q;  2UU9 L;  3KJO A;  4JYA Q;  4LUV A;  4JG2 A;  4IPH A;  2I5L X;  4HJ5 A;  1C0A A;  2ZJQ A;  1G29 1;  5ELO A;  4MNO A;  4BY1 G;  4DV7 Q;  4C3H H;  4H02 A;  4LF7 L;  3FP9 A;  2A1A A;  2K5H A;  3PGZ A;  4IFD J;  4KHP L;  1PA6 A;  1KRS A;  1BKB A;  4AYB G;  2MO1 A;  5M3M G;  4A3F G;  1EWI A;  4DV5 Q;  4AIM A;  3ULP A;  1VQH A;  3GTP H;  4A3D H;  4X62 Q;  4PZ7 A;  3HOY G;  1I50 H;  3UDF A;  2V1C C;  1JB7 A;  4LF6 Q;  1VCI A;  5IYD H;  3CCE A;  1HZA A;  3PF5 A;  2VQF L;  3K7A H;  4B3T Q;  1N33 L;  4LUZ A;  4DR7 L;  2UXC L;  3K80 C;  2HT1 A;  1V1Q A;  3OW2 A;  2HIV A;  4HIK A;  5M5W H;  3AEV A;  2R92 H;  1XPO A;  1N9W A;  2IX0 A;  3CPW A;  1NJI C;  2D0P A;  1P16 A;  5LMN L;  4X64 L;  4JI3 Q;  1VQA A;  2K52 A;  4JI5 Q;  3H0G H;  3H3V H;  1IBK Q;  2MO0 A;  4A3D G;  1QUQ A;  2AKW B;  5BR8 L;  1MJC A;  4IPC A;  4TVA B;  3S1M H;  1FGU A;  3E9I A;  4LF5 L;  3RLN A;  2DGY A;  1XNR Q;  4A3M H;  1Y1W H;  1EQQ A;  2JA5 G;  3RZD H;  1XNQ Q;  1EIF A;  1SRO A;  2N3S A;  4LNQ A;  4R4O A;  4R4Q A;  4GS3 A;  2UUB L;  2R92 G;  4UP9 A;  1C7Y A;  4JI8 L;  1MIU A;  4JI2 L;  5IYC H;  2F52 A;  1YBY A;  3BZC A;  3S15 H;  4Y7N H;  1CKN A;  1IBL Q;  4JCV E;  4DUZ L;  3I4N G;  4JBK A;  3HKZ G;  2ID0 A;  1X56 A;  2GVA A;  1PYS B;  1VQG A;  4ME3 A;  5IP7 H;  3J81 i;  4L5R C;  5GRO A;  1LUZ A;  1VQJ A;  2RCN A;  3OTO L;  4YY3 Q;  4GOP B;  4A3M G; 
#chains in the Genus database with same CATH topology
 1FJG Q;  4DXG A;  1CTM A;  3TME A;  1LTL A;  1GVP A;  2AHO B;  3HRZ C;  5IE8 A;  3HGB A;  3I72 A;  5IYC G;  2Z9H A;  3BVZ A;  1GUS A;  2B2Y C;  2E2H H;  4YCV A;  2VNU D;  5IP7 G;  1G91 A;  3V96 A;  2B2U C;  2F0P A;  1EFW A;  2XIW A;  3S1Q H;  2LXJ A;  1VQM A;  1STN A;  2ZJP A;  4B3S Q;  4OX9 L;  2EJM A;  1E1O A;  4R4T A;  1BDO A;  2I46 A;  2Z6K C;  4KY6 A;  3H3V I;  1O7Y A;  4GKK L;  1SYB A;  3NQI A;  3E3X A;  4DK1 A;  3RN5 A;  4Y52 H;  2D62 A;  4DXF A;  3C3L A;  2OCE A;  3J80 i;  3NHH A;  1GHK A;  1XMO Q;  4JI7 Q;  2VB2 X;  4LF9 Q;  4F87 A;  4DR3 Q;  1U4M A;  2F4I A;  1G6P A;  4DR6 Q;  3H09 A;  1EZ6 A;  4A3C H;  2CWA A;  5FO7 B;  4A3L H;  3HKZ B;  3GD7 A;  3KBG A;  5KIX A;  1UE1 A;  4BBS H;  3PIO A;  3LWE A;  2JA8 H;  3UE0 A;  1I4G A;  1BBU A;  4EQ5 A;  5IYB H;  1J6Q A;  1YIT A;  1GXD C;  5ELN A;  1WTX A;  1VQD A;  2DJF C;  5J3B A;  2JN4 A;  1HUN A;  5C44 H;  4A3L G;  1ILQ A;  1XXG A;  4TQU S;  1CA6 A;  5IYB G;  5EPK A;  3PUV A;  3M4O H;  1IL2 A;  5GAE C;  3L7Z C;  1F9S A;  2J7Z A;  3D4D A;  1IYJ B;  1PTO F;  1YNJ D;  3S2H H;  1EIH A;  1Q3L A;  2E2H B;  5C44 G;  3DEP A;  4A3I H;  4OIJ A;  3MWY W;  3NBH B;  2SDF A;  4UHV A;  1Q82 C;  3AU7 A;  2B3G A;  2O2L D;  1B8A A;  2BA1 A;  2VUM H;  5KND A;  1K0S A;  2B2V C;  3K5N A;  2KA7 A;  3ICE A;  2PZW A;  3PSI A;  5M3F H;  2XN9 C;  2CWP A;  3BDO A;  4H7B A;  1BBW A;  1K3B C;  5LMN Q;  2K04 A;  4KKT A;  2L9H A;  1SYG A;  4N9P A;  1L2F A;  4A3I G;  2PCF B;  1CZW A;  4R8N A;  4P72 A;  1X3E A;  1H9K A;  4DNT B;  2AWN A;  3LGJ A;  1YJN A;  1TY0 A;  3BDC A;  3W1G A;  4A3E H;  1WD1 A;  3J7Y W;  1I4R A;  3U50 C;  1W6K A;  4DAV A;  5IT9 L;  2DJG C;  4CBV A;  2TMP A;  2G9H D;  2F0S A;  3OWE B;  1S3O A;  3U9S A;  4CHT B;  3IKJ A;  2YU9 B;  1IKL A;  2F0N A;  3KUP A;  3MZ5 A;  3OTO Q;  2UUA L;  1UEB A;  2PZT A;  5FLM H;  1OXX K;  5CV5 A;  4A3E G;  1M8A A;  1CK1 A;  2UUC L;  4HED A;  2E5L L;  4DV4 L;  4EQN A;  4FF4 A;  4KD4 A;  4LFC L;  1RF2 D;  2AMC B;  2YTY A;  2E76 C;  5C44 B;  1VQB A;  4JI4 L;  2A69 D;  1IBL L;  2K05 A;  2KOL A;  4XYO A;  2Z1C A;  4KJN A;  4YY3 L;  2K28 A;  1N36 L;  1EQR A;  1L1O A;  2K50 A;  4A3K H;  2WAC A;  2FXQ A;  3IFT A;  4ULL A;  4AQY L;  5JEA J;  4I7Z C;  2R6G A;  4DA2 A;  4GKK Q;  1HA5 A;  3D31 A;  2CKZ B;  3A5Z B;  1VQK A;  1MSH A;  2JA7 G;  3GTP B;  4A3I B;  2JA9 A;  1A63 A;  1PH3 A;  4NXM L;  4A3K G;  1NNX A;  1EIG A;  1Y8P B;  4A3B H;  1IBM L;  3KK7 A;  5I2Y A;  1D5X C;  2HHH L;  2F4V Q;  4P74 A;  1X3P A;  1NCV A;  2CW0 D;  1LM0 A;  4IJH A;  2LSS A;  5FKA C;  2EDG A;  1QVC A;  2K5Q A;  4XIG S;  4X66 L;  3KYH C;  3J80 c;  3CMA A;  3W3A A;  4B3M Q;  4A3B G;  1PRT F;  5JPN C;  4KI0 A;  3ER0 A;  3NWT A;  1WTQ A;  5C5L A;  2WII B;  1IHZ A;  1ICF B;  3PV0 A;  4DR5 L;  2K5V A;  1SEB D;  1SYD A;  3J81 E;  2CCZ A;  3OOC A;  3ND9 A;  5IGF A;  4IJL A;  1W2B A;  3PO3 H;  2PZU A;  4CKE A;  2R7D A;  2KJX A;  5CR3 A;  1TS3 A;  5CYU A;  2JA7 B;  1EY5 A;  5CC4 A;  3SDZ A;  1UE7 A;  1PFB A;  3JAM E;  2WAQ E;  4HJ7 A;  1R9T B;  2UXC Q;  1E2Z A;  4L5T A;  3I56 A;  1PH1 A;  1PH4 A;  3NWS A;  3PO3 G;  2E2I H;  4GN4 B;  3UDI A;  4DUY L;  2EJG C;  1SFO B;  4LWC A;  1Y8N B;  4X64 Q;  3LNN A;  5IIF A;  3QB3 A;  2L12 A;  4IPG A;  4X62 L;  1RHP A;  2GN5 A;  1N34 L;  4BA2 I;  1KTK A;  1XTC D;  5I9P A;  2EY6 A;  3A8I E;  3SXH A;  4A3B B;  5CV8 A;  1EY4 A;  4DUZ Q;  1C8C A;  1UEA B;  2R7Z G;  3AB9 A;  2PQE A;  1U0L A;  2KHJ A;  2E2J H;  3DEO A;  3T4A C;  5FLX L;  2UUA Q;  2MQH A;  1V1P A;  5GAD C;  1JWS D;  2EQS A;  4JPB W;  4DV2 Q;  2FIN B;  3RLF A;  2UUC Q;  2E5L Q;  3S24 A;  3QIA A;  4F88 A;  5IT9 c;  1STB A;  4IUP A;  4DV4 Q;  1VQL A;  4NDX A;  5ELF A;  4LFC Q;  2A74 C;  3C2P A;  2LXK A;  1TWC B;  1E2V A;  3HP3 A;  4R1J A;  2I07 B;  1D1K A;  5C4X H;  4R9W A;  2NB0 A;  2ENB A;  4ZLT F;  4JI4 Q;  4CDC C;  1NMF A;  4NMZ A;  1XPR A;  3T1Y Q;  2YYZ A;  3TEH B;  4LK1 C;  4HJ8 A;  3PMF A;  4A75 A;  1OXT A;  1RIP A;  5BN5 A;  3PO3 B;  5C3E H;  2C9O A;  5C4X G;  4HTH A;  1HZB A;  1SN8 A;  4B08 A;  2G5D A;  4RGN A;  2E8G A;  5NUC A;  4LAA A;  4ZKB B;  2K75 A;  4RKL A;  1D7Q A;  5CV9 A;  3LWU A;  3OMG A;  3DWQ A;  4X3T A;  3H91 A;  4YWM A;  3A5U A;  1DYQ A;  1UE6 A;  3GTQ H;  3I8Z A;  5C3E G;  5K5P A;  1BCP C;  1PHJ A;  3KLS X;  4QGU A;  1IBM Q;  1MBY A;  3DHQ A;  2R7Z B;  2ICE C;  1DOK A;  1LV9 A;  3G6E A;  2XSC A;  5I2X A;  4DR4 Q;  3VR3 A;  1WCM G;  1JMC A;  1K8A C;  3C1E A;  3SK8 A;  3GV6 A;  1NE3 A;  1QWY A;  2JSO A;  4X66 Q;  4KMU C;  3U4Z A;  3SVM A;  2ATW A;  3PQI A;  1E24 A;  4DR5 Q;  2L11 A;  3GV3 A;  2WKD A;  3RD4 A;  3DXJ C;  4HSV A;  4NP5 A;  1KRT A;  3AFQ A;  2XRS D;  3I91 A;  5ELB A;  3V05 A;  2KCT A;  5C4X B;  2B2W C;  1V1O A;  1JOQ A;  1BR9 A;  1AE3 A;  2WP8 J;  2R7F A;  4BBR H;  5KGU A;  4EGV A;  3BDL A;  2A6E C;  3HOY H;  4MHE A;  4JG2 A;  4HJ5 A;  2I5L X;  1WVL A;  4BY1 G;  5HGT A;  1S4Z A;  3FP9 A;  2K5H A;  5C3E B;  3PGZ A;  4KHP L;  1PDQ A;  3T51 B;  3N52 A;  4H0L C;  4AYB G;  1EWI A;  4DV5 Q;  5FK9 C;  1QOH A;  2EYL A;  4A3D H;  4X62 Q;  1ET6 A;  3HOY G;  5DEH A;  2F0M A;  5I4D A;  4N8F A;  1WCM B;  3EA6 A;  3PF5 A;  3K7A H;  4S3S A;  1CHQ D;  4DR7 L;  2EYF A;  3LX0 A;  5M5W H;  1KAB A;  2FMC A;  3AEV A;  2R92 H;  2D0P A;  1IYU A;  1P16 A;  2QCP X;  1VQA A;  1R4P B;  5I6W A;  4JI5 Q;  2MO0 A;  4A3D G;  3OW7 A;  5DM6 3;  4IUT A;  1MJC A;  4TVA B;  3S1M H;  1PFN A;  1RKN A;  2IW3 A;  1Y1W H;  1EQQ A;  1NR2 A;  2JA5 G;  3A56 A;  1EIF A;  4RAU C;  2K6A A;  1ML0 D;  4GS3 A;  3K5M A;  2R92 G;  3KBX A;  4C3I G;  3H3V C;  4JI2 L;  5CV4 A;  1CKN A;  2F0G A;  2CVR A;  2GVA A;  1VQG A;  3J81 i;  5GRO A;  1VQJ A;  1B4O A;  3QR8 A;  4ZYS A;  1ICW A;  5E4W C;  1WYD A;  3K57 A;  4HID A;  3GTJ B;  4IFD H;  1F9Q A;  1TWH B;  4Z9C B;  1S40 A;  1M4V A;  2NN6 G;  4BY1 B;  1PH8 A;  2ZXO A;  4V0B A;  1H95 A;  1JB3 A;  4IQZ A;  1DZ1 A;  4AYB B;  2I5H A;  5C3W A;  1T5X D;  1K28 A;  5KRU A;  2B29 A;  5JPM C;  4JI1 L;  3S1R B;  3HOY B;  1SNM A;  3VR2 A;  2KHI A;  1H9S A;  4QIW E;  4IFD G;  2B2T A;  4FXK C;  3BJU A;  4K8I A;  2CQA A;  3RLO A;  1Q86 C;  1K9M C;  3I70 A;  3IL8 A;  3H15 A;  3PIP A;  2J0T D;  1GJX A;  4PMC A;  2F3V A;  4A3D B;  1HQR D;  1EU4 A;  4M1U B;  4DK3 C;  1TY2 A;  1CM9 A;  3NE5 B;  1YZ6 A;  4WFN 3;  5IGE A;  2NN6 I;  2JA5 B;  5M5W B;  2RCF A;  2R92 B;  1U4L A;  5C5M A;  4C3I B;  1UAP A;  2M00 A;  2PO4 A;  1Q12 A;  3TQY A;  2HIX A;  1LTT D;  3CW2 C;  1HHV A;  3ND8 A;  2H1E A;  1C4Q A;  2QDL A;  2ZXP A;  4JBJ A;  5EKL A;  4WJ4 A;  1J8I A;  4LF4 L;  2OXP A;  2A19 A;  4NXN Q;  3FHW A;  3R2T A;  2WV6 D;  1VQN A;  5IP9 G;  3URY A;  3S17 B;  2PMZ E;  2CFM A;  2PW7 A;  3L9A X;  5G3L F;  1HNZ L;  3KF8 B;  1XYI A;  5EGT A;  1PTO B;  1HA6 A;  1LTS D;  2ZTD A;  2NVX H;  1GM5 A;  3CRK C;  2Q2T A;  4R4C A;  1AW7 A;  2O4X A;  4C56 C;  2NVT H;  1VF5 C;  3L2P A;  2F3I A;  3M7G A;  1T5E A;  4EQP A;  1EFI D;  5JVH 3;  4QMG A;  4DR7 Q;  1F2Y A;  1BF4 A;  1HJP A;  3S16 B;  1Q81 C;  4PV1 C;  2OTL A;  1SXT A;  3KF6 A;  1VQ5 A;  1QE6 A;  2C5C A;  4MIU A;  1HR0 L;  1B9M A;  2HDL A;  3PCO B;  3MXN A;  1I4Q A;  1GD7 A;  2F0K A;  4XXE A;  1SBB B;  1JJ2 A;  3C46 A;  3L3O C;  2EIF A;  1ILP A;  1FNU A;  1Y1V H;  2DNC A;  1TS4 A;  2BDO A;  1EEF D;  3H0G G;  1SDF A;  4YCW A;  2N88 A;  3C1F A;  4CGY B;  1KDB A;  1RTO A;  2Q2H A;  3NEM A;  4ME5 A;  1SNP A;  2Y0S E;  1XNR L;  4BXX H;  3SK4 A;  1B2T A;  3A7A B;  2WKC A;  3M9B A;  4DV0 L;  3TRZ A;  1ASY A;  1Y1V G;  1D1I A;  3M4Q A;  1K73 C;  3GTG H;  4DN4 M;  3ULL A;  1WTH A;  2RVL A;  3E5S A;  1YI2 A;  1CHP D;  4JI1 Q;  1Q1E A;  1YHB A;  3VDY A;  2R61 A;  1ENC A;  1WTW A;  3KLW A;  3WWV A;  3J81 c;  1ROD A;  1Z6H A;  1M1K C;  1KC8 C;  2ZT9 C;  3I55 A;  1BXT A;  2NVX B;  5C0X H;  5HUR A;  1E22 A;  3VR6 A;  1PMR A;  4HJA A;  4I7A A;  3S2D H;  4JK1 C;  1I3Q H;  4PQX A;  3MXN B;  1X55 A;  2R93 H;  4DPG A;  3WOE A;  1CSP A;  1SMX A;  3JAM c;  2OQ0 A;  2KED A;  1SNQ A;  3HOV H;  1SE4 A;  4HMJ A;  2NZ1 D;  3H6M A;  3J80 L;  3BU2 A;  2A6H D;  4HJ9 A;  2ES2 A;  2K03 A;  4LFA L;  4DNR B;  2RQX A;  3H0G B;  1EEI D;  1JCK B;  2QEX A;  3CCL A;  1OO9 B;  3DM3 A;  2K1B A;  4ILW A;  2B63 H;  3MA2 B;  1LT3 D;  4A3M B;  4WJ3 M;  4DV3 L;  4QY7 A;  3K5O A;  3JC6 6;  4V19 0;  4P73 A;  1NAP A;  2BDN A;  4JW0 A;  4LF4 Q;  1K0R A;  4NB3 A;  3S15 B;  1KXL A;  4Y7N B;  4A3C G;  1PRT B;  5C6A A;  5T1G A;  1AZP A;  4GNX A;  4BBS G;  2JA8 G;  1W6J A;  3PUX A;  2OTJ A;  4OON A;  3T16 A;  1HNZ Q;  4JI0 L;  4U67 3;  1DOM A;  1FR3 A;  1NSN S;  3BS1 A;  1EQT A;  1XJV A;  1LYL A;  3ERQ A;  1VQE A;  2HUG A;  4ZAI A;  3DWA A;  4KTA A;  3GTG B;  3U58 A;  3TZU A;  4IO9 A;  3CQZ H;  1T9H A;  5EJW A;  2IJ0 A;  4DGZ A;  5M3M H;  5COY A;  1L0W A;  3S1Q B;  1S5F D;  1L0X B;  1ONL A;  3UE1 A;  3KLR A;  3RZO H;  2KHS A;  4FDB A;  2VQF Q;  2IWH A;  4IOC A;  1N33 Q;  5M5X H;  1H9J A;  3X3N A;  5E4X A;  1W3S A;  1TWA H;  1HR0 Q;  1TXY A;  3P20 A;  1VQP A;  1I3Q B;  1JOK A;  2GA4 B;  3CC7 A;  4LF5 Q;  4CDD C;  2X6G A;  2D0O A;  5JOB A;  3EQL C;  3MHB A;  4JC0 A;  2VUM G;  5ELD A;  1Q90 A;  1QZH A;  1JJG A;  4IAL A;  2UUB Q;  5IY0 A;  5M3F G;  1SJH D;  2F0U A;  3I90 A;  5GQO A;  2HDM A;  4CJ2 C;  4WOR A;  1CFM A;  4A3G H;  2VY3 A;  1C9O A;  2RDH A;  4F8M A;  3I4N H;  4BBS B;  2BE5 C;  5KYL A;  4GNX B;  2JA8 B;  1TS2 A;  3D4R A;  3GO5 A;  1B50 A;  2OQK A;  1MKH A;  1QZG A;  3AQQ A;  5M5Y H;  4CDE C;  4WRD A;  5DLQ E;  3PIP 3;  4OEM B;  4DNI A;  2JE6 I;  4ZRZ A;  4DV0 Q;  1GHJ A;  4A3G G;  2X69 A;  3PUY A;  5LHY 1;  2E74 C;  1P8L A;  5FLM G;  3CU7 A;  3M4O B;  5IGB A;  5LMU L;  4DV1 L;  3ZJY C;  4OX9 Q;  4H13 C;  4X65 L;  2A8V A;  3UDX A;  3S2H B;  3K7U C;  2KVM A;  3RR5 A;  1X3G A;  3UDG A;  1X9N A;  2IHE A;  1D5Z C;  1GO3 E;  2B2U A;  4J6H A;  2VUM B;  3PO2 H;  5E3F A;  5M5X B;  5M3F B;  2KBN A;  2L15 A;  5FOB B;  3NPP A;  3NTH A;  1DJR D;  4X3S A;  5IOD A;  1YHA A;  2JK8 A;  5ELE A;  2IY5 B;  2Z6K A;  4H44 C;  1TS5 A;  5JVG 3;  1JT8 A;  1TVX A;  1QG7 A;  4OWT B;  1OXS C;  5HGQ A;  5DM7 3;  4BY7 H;  2NZH A;  1E1T A;  3TP8 A;  4ZQ3 A;  3PO2 G;  4DV3 Q;  2SNM A;  4A3E B;  2DNE A;  4O1N A;  4DV6 L;  1EYD A;  2EYP A;  2N55 A;  1EYG A;  2F0I A;  4OIK A;  1TWG H;  2RKS A;  3GDE A;  4RH6 A;  3J7A F;  2PNR C;  5JAV A;  1I94 L;  1NMG A;  4C1N K;  3Q24 A;  1EIY B;  2HQL A;  1KD1 C;  1U9R A;  3L0O A;  3M3Y H;  1HTL D;  2QA4 A;  3G48 A;  2Q8I B;  1VQI A;  1A0I A;  2UXB L;  5EAY A;  1L1O B;  1NR4 A;  4MZ9 A;  4C2M H;  2PW5 A;  5HY6 A;  2YTV A;  2B39 A;  1Q8K A;  2KCN A;  3O13 A;  4RCO A;  2ZM6 L;  2O5I C;  1FYC A;  3T56 B;  4QUF A;  2CH4 A;  4JV5 L;  1ZYR D;  2NTS A;  4UY8 C;  2JEB I;  4GOP A;  1O7Z A;  4GZY C;  2UU9 L;  2NTT A;  4Q0F A;  2IPK D;  4A3K B;  1G29 1;  4C3H H;  2L4N A;  1SMY C;  4IFD J;  2M2L A;  1PA6 A;  4NKL A;  1GUO A;  2F0H A;  3ULP A;  4PZ7 A;  3NP8 A;  1VCI A;  5IYD H;  3CCE A;  1HZA A;  4LUZ A;  4KN4 C;  1II3 A;  3K80 C;  2EPB A;  3W2D A;  1V1Q A;  4K5V A;  4BS9 A;  4C3H G;  4HIK A;  2KEC A;  4FXG C;  4U68 A;  1XPO A;  1N9W A;  2B2V A;  4TSS A;  4XQN A;  1PYW D;  4QIW B;  5BR8 L;  2DGY A;  4JVZ A;  2RA4 A;  4UDU C;  4XT1 B;  3RZD H;  4R4O A;  4R4Q A;  1FGB D;  4UP9 A;  1C7Y A;  1MIU A;  2A5H A;  4FF1 A;  1TWG B;  1F2L A;  1IBL Q;  4JCV E;  4JBK A;  2ID0 A;  5EBC A;  4L5R C;  2WIN B;  3V2T A;  1EYC A;  1F9P A;  1D6E C;  4YY3 Q;  4GOP B;  1O78 A;  5LMU Q;  4DV1 Q;  1N36 Q;  4TRD A;  4X65 Q;  1HPC A;  1EL0 A;  4CJ1 B;  3CP0 A;  4XQQ A;  4AQY Q;  1JWM D;  2N49 A;  2SEB D;  1KAA A;  1UNS A;  5M9O A;  3GTM H;  2XVS A;  2SNS A;  4FVM A;  5ELC A;  3TSS A;  4A3J H;  3FKI H;  3I7F A;  3W1B A;  1PTO C;  4NXM Q;  3SHL A;  4LFB L;  1KLG D;  4DK6 C;  5KNC A;  3MFG A;  2VQE L;  3CPF A;  4C3H B;  2E2I B;  1HQM C;  2EOT A;  2ASB A;  3OHX C;  3SGI A;  2QF7 A;  3OYY A;  1U5K A;  3KDF A;  3GTL H;  2HHH Q;  3FKI G;  1EYA A;  2IX1 A;  1EY8 A;  4PG3 A;  1WI5 A;  4HCE A;  3W5O A;  5A2Q E;  2L5T A;  1BQQ T;  1V1P B;  3TP5 A;  2JA6 H;  1HZ9 A;  4ZUJ A;  4DV6 Q;  4Q5V A;  1N32 L;  2K4K A;  5AJ3 L;  3CHB D;  2M9V A;  3VYT A;  2G9D A;  4L5Q A;  1RTN A;  2E2J B;  4OL7 A;  3DWP A;  1KQS A;  4OO1 H;  1TKW B;  3D0F A;  1RCV D;  4KJO A;  1XTD A;  1H9R A;  2UXB Q;  4O42 A;  3K81 C;  2OF1 A;  1B9N A;  1JE5 A;  3CCU A;  1MGS A;  3I4O A;  2ZM6 Q;  2BA0 A;  2NVQ H;  2PQA A;  2MHV A;  3BZK A;  4JV5 Q;  1XMQ L;  3HOU H;  3MTS A;  4PZ8 A;  4OO1 G;  3FVQ A;  2BE5 D;  3DLL A;  3NSW A;  2UU9 Q;  4I65 A;  3M7N A;  3QO2 A;  4YHH L;  1E0B A;  4DUY Q;  1A2T A;  1ENF A;  5A35 A;  4O0A A;  5C4J H;  3EIV A;  2FFK B;  3DUZ A;  1AN8 A;  3M4P A;  4DR1 L;  3MC0 B;  1J5E L;  4BBR G;  1MD2 D;  3HOU G;  2CHB D;  1AZQ A;  3Q22 A;  1PXU A;  1N34 Q;  1AP0 A;  2RBM A;  1A3V A;  4RG1 A;  2MPM A;  3N6R A;  3VYU A;  3GTQ B;  5DNF A;  2KCM A;  5C3X A;  4DV7 L;  1SLJ A;  2Q2U A;  1B53 A;  3NTI A;  4K2K A;  5F2D A;  4GKJ L;  4OO1 I;  5C0X J;  1ET9 A;  3CKI B;  5JJL A;  2RDF A;  1X3Q A;  2LS0 1;  4FF2 A;  3SEB A;  1F2Z A;  1SNC A;  4XT3 B;  3HOX H;  3D3R A;  1JOR A;  4LW1 A;  3OPO A;  3IFD A;  4DAY A;  2EY1 A;  3MFY A;  1PFM A;  1LT6 D;  3UI2 A;  2QW7 A;  4UPA A;  1STY A;  3BZD B;  3CF5 A;  2MNA A;  4R4I A;  1Y1W G;  4MN3 A;  5FO8 B;  3J81 L;  1YNJ C;  3HOX G;  1XNQ L;  1PRT C;  3CCR A;  3J7Z C;  2EVB A;  5IWA L;  1O80 A;  3EN2 A;  1EU3 A;  2NVQ B;  1IXR A;  2BH2 A;  4OWW B;  4BBR B;  1B3A A;  4DU9 A;  3HOU B;  4YWK A;  5CBA E;  3BYY B;  1K83 H;  3F2C A;  4APV A;  2A68 C;  2V4D A;  2F0L A;  5EQ0 A;  3JAM L;  4LFB Q;  3A55 A;  2VQE Q;  3D6W A;  1WFQ A;  4OEL B;  4IUU A;  2H4O A;  1X54 A;  1A3T A;  2JP1 A;  1BNZ A;  2Q8T A;  4DAM A;  4JBM A;  2Z4H A;  4CJ0 B;  3J81 j;  3NXW A;  4ALP A;  4AH6 A;  4JOI A;  1PZI D;  4K2L A;  1IW7 C;  1Y69 U;  3FEW X;  4GN5 A;  4POG A;  3K7A B;  2KCC A;  3MVV A;  2DY8 A;  4B3S L;  5AJ3 Q;  3R93 A;  1SSO A;  4JI6 L;  4KD3 A;  3S1N H;  1CKN B;  1HNW L;  4JBW A;  1SMY D;  3OWF A;  4KY7 A;  4IFD I;  4N8X 1;  3S1M B;  4CKB A;  2B8F A;  1NTG A;  2FMM A;  2EXD A;  1E3P A;  1Y1W B;  3S14 H;  5J39 A;  5E7N A;  3HOX B;  1XMO L;  4LF9 L;  4KHV A;  1F77 A;  1GKH A;  2F0D A;  4DR3 L;  3GQB A;  2YTX A;  5JJK A;  3MXP A;  4DR6 L;  2A69 C;  4QUC A;  5EBD A;  4DFA A;  1S5E D;  3CCV A;  4GNX C;  4GLA C;  5C4H A;  5LL6 S;  1JJC B;  3SK5 A;  2EY2 A;  4PMB A;  2RSN A;  2I5M X;  1H9S B;  2A73 B;  3I73 A;  3A54 A;  4YHH Q;  3MEF A;  4F7X A;  4ZK9 B;  1NBW A;  5ISR A;  3GTK H;  4KHP Q;  1G6Z A;  1J5E Q;  1VS0 A;  2NZO A;  5D65 A;  3VR4 A;  5LMN W;  4FNF A;  2AQ3 B;  4K6D A;  1K83 B;  1B70 B;  1WTR A;  2H5X A;  1XPU A;  1G2T A;  1DON A;  4JYA L;  1R4Q B;  4RHS A;  5K36 H;  3EBE A;  1VMP A;  2Q8R E;  1KDA A;  2EYJ A;  1PV4 A;  4RWS C;  3TDQ A;  3VYR A;  1GUW A;  4RKB A;  4GKJ Q;  2PYK A;  3Q0A A;  1FL0 A;  1SYC A;  1O7L A;  2CW0 C;  1JR0 D;  2WB1 E;  1X6O A;  1YEZ A;  4LUO A;  4KLK A;  3OIP A;  4LF6 L;  5GAG C;  3TS2 A;  3K6O A;  5K36 G;  3VA7 A;  1PTO D;  2TSS A;  2D9U A;  4L6T B;  1A8V A;  3ULJ A;  4QCL A;  4JI2 Q;  5EKK A;  1EY0 A;  3S1N B;  3K0Y A;  4HN7 A;  3PUZ A;  4IUR A;  2WAQ G;  1BCP D;  1A6X A;  3AYH B;  1K8M A;  2I0Q A;  3NQT A;  3G7L A;  1F9R A;  2ALY B;  2XRQ D;  3MXG A;  2Z6B A;  3J7A 5;  3KJP A;  1DOL A;  3S14 B;  1UUP A;  4RCN A;  4G7Z C;  2KEN A;  3KOJ A;  3QWN A;  1EUJ A;  4J1M A;  5LL6 X;  1Q8I A;  5IWA Q;  3TS0 A;  1DCZ A;  2VB3 X;  2ZJR A;  4MTK A;  3CAM A;  1ZXT A;  3AFP A;  3BVM A;  4J15 A;  2L1B A;  2LY7 A;  2NWG A;  1EQV A;  3F1Z A;  3E0J A;  1S72 A;  1ENA A;  3R3O A;  2F3W A;  1L1O C;  4BXX G;  3I2Z A;  1FD7 D;  3SE0 A;  1KL9 A;  1VQ4 A;  1OTC A;  1YIJ A;  5H1S E;  3GTK B;  3KF6 B;  4L5S A;  2D2C C;  1Z7T A;  2NVT B;  3I4M H;  5AFW A;  4XYQ A;  1EWC A;  2NVY H;  1UWV A;  5TSS A;  1M90 C;  1HZC A;  4KY5 A;  1ESR A;  2RSO A;  1Y14 B;  3FRP B;  2A6E D;  1VDZ A;  5IGD A;  1V9P A;  2ZTE A;  3S9W A;  5C0X G;  2EXZ A;  4EX5 A;  4JI6 Q;  5BN4 A;  3QOJ A;  3CCQ A;  3I4M G;  1HNW Q;  3TRE A;  2VXW A;  2WAQ B;  4ODG A;  2R93 G;  3NBH A;  4DR2 L;  3FPU B;  2JEA I;  3TZD A;  3HOV G;  4HSP A;  1PLF A;  2AUK A;  3PUW A;  3T53 B;  2PI2 E;  3E6Z X;  3K58 A;  3PF4 A;  1Y1V B;  2YU9 H;  4IOA A;  5KEE A;  2DN8 A;  2B63 G;  1XX8 A;  5FLX E;  3CXC A;  2F4V L;  4AYB E;  2KQ3 A;  1QCB D;  5C0X I;  4MTN A;  1HNX L;  1HFG A;  2CH4 W;  1HXY D;  2RF4 A;  2E75 C;  2CQO A;  3K59 A;  4B3M L;  3A0J A;  1CQV A;  2MJ8 A;  4A3F H;  4GOP C;  3B6Y A;  4P2C B;  2C35 B;  1SRU A;  4KK7 A;  1YNN C;  4X3K A;  5IOC A;  3KJO A;  4JYA Q;  4LUV A;  5CGK A;  3FPP A;  1C0A A;  1WTV A;  2ZJQ A;  2EJF C;  4K8J A;  5ELO A;  4MNO A;  3VA5 A;  1QNU A;  4LF7 L;  2NYZ D;  2HQE A;  1PRT D;  1LAB A;  3I4M B;  3TP6 A;  1HUM A;  2MO1 A;  5M3M G;  3S2D B;  4A3F G;  1GUT A;  1A15 A;  5T1I A;  2R93 B;  2NVY B;  4AIM A;  1VQH A;  3GTP H;  2F03 A;  1BCP F;  1I50 H;  4LF6 Q;  3HOV B;  5J1Z A;  5D3D A;  2UXC L;  3NUC A;  1VMC A;  1CT1 D;  2A68 D;  4CDF C;  2HIV A;  3OW2 A;  4L8J A;  2BOS A;  4OGQ C;  1TII D;  2IX0 A;  2KEE A;  4X64 L;  2QDB A;  2EYH A;  4KKU A;  2B63 B;  1QUQ A;  2AKW B;  3E9I A;  3RLN A;  1XNR Q;  5JJZ A;  5E1F A;  4UAI A;  2K5W A;  1IW7 D;  1SRO A;  1SAP A;  2N3S A;  4EVO A;  3D6C A;  4ABN A;  1LLR D;  2F0F A;  4JI8 L;  4G7O C;  3TP7 A;  2F52 A;  1WD0 A;  1YBY A;  3P1H A;  1FNW A;  5CV7 A;  1LTA D;  4DUZ L;  3I4N G;  5IGC A;  2RCN A;  1RJT A;  3NK9 A;  4FO2 A;  2AQ2 B;  2AWO A;  3VR5 A;  4DV2 L;  1BUV T;  4YCU A;  1QVF A;  1Z9F A;  2WFW A;  1FVI A;  4IPD A;  1VQ8 A;  3CQZ B;  1QVG A;  2AUJ D;  3I3C A;  5M3M B;  3G71 A;  2B2Y A;  4A3F B;  4A4I A;  2JA7 H;  4XDX A;  2EZV A;  3RZO B;  2R3Z A;  4PMW A;  1STH A;  2LFN A;  3T1Y L;  1CQF A;  4ZUI A;  2UXD L;  3D4W A;  1R9T H;  1ZEQ X;  1HH2 P;  1VF7 A;  3MEH A;  2L55 A;  2K01 A;  1VQC A;  1MJE A;  2LKV A;  2RHQ B;  1KNA A;  2Z0S A;  1TWA B;  1X65 A;  4LFA Q;  3RN2 A;  1QB5 D;  4QB4 A;  1SFO H;  3BVG A;  1GOZ A;  1LTG D;  1DGS A;  3X3M A;  1I50 B;  1X32 A;  4DR2 Q;  3E0E A;  1CI3 M;  1QUQ B;  1EY7 A;  1RL2 A;  1SR3 A;  3HFZ B;  4A3G B;  1NY4 A;  2VS1 A;  3H94 A;  5IGG A;  1SYF A;  5EKI A;  1LTR D;  1D8L A;  3D8G A;  3I4N B;  4C3J H;  1PH9 A;  4PZ6 A;  4BY7 G;  4K5X A;  3TN2 A;  2AQ1 B;  4KHZ A;  4B3R L;  1TU2 B;  1VQO A;  4JI0 Q;  5M5Y B;  3CCM A;  1HNX Q;  4DR4 L;  2O5J C;  4YIJ A;  1KHI A;  3OSO A;  1BBX C;  3BG3 A;  3HOZ H;  1MHW C;  3DM1 A;  4IUQ A;  4HR7 B;  5I9O A;  1MI2 A;  1TWC H;  1STA A;  2XWB B;  3HOW H;  1I5F A;  4C3J G;  3SR1 A;  4HCS A;  3HS0 C;  4OXP A;  4RGM A;  1JC7 A;  1LTI D;  1C48 A;  1B1Z A;  1EOV A;  1YHQ A;  2QIL A;  2Z4I A;  3NEN A;  1FNV A;  4DKA C;  4NPS A;  4X6A H;  4LF7 Q;  3HOZ G;  4K5W A;  1S5C D;  1KAW A;  2K7V A;  1WJJ A;  3HOW G;  1CKM A;  2ICI A;  3STB C;  1X3F A;  3HKZ E;  2BCO A;  1JWU D;  2MP1 A;  3PO2 B;  1J9O A;  4LF8 L;  2RHS B;  4XTC S;  3M85 A;  1WTP A;  3VYS A;  1Q7Y C;  1SE8 A;  2RDG A;  2F0O A;  2D5D A;  1G8Z D;  4CKC A;  4GN3 B;  4HIM A;  1TQO A;  1V43 A;  5BN3 A;  2R7Z H;  4BY7 B;  4DV5 L;  5CBE E;  3ZYY X;  5IYD G;  2MFI A;  3G4S A;  1EY6 A;  2HCC A;  4BWG B;  5KNB A;  3EVQ A;  4JI8 Q;  5COR A;  1LT4 D;  1KNE A;  4O2D A;  2MUY A;  4GLX A;  4C3J B;  4JI5 L;  2DUD A;  1BVS A;  5EPJ A;  5D14 A;  4FF3 A;  3M3Y B;  3NBI A;  1SND A;  4ZKC B;  4P71 A;  1HFN A;  1SE2 A;  4X3U A;  1E7Z A;  4C2M B;  3HOZ B;  2XNA C;  1B7Y B;  3U4V A;  4G7H C;  1I4P A;  3HOW B;  2VL6 A;  2WB1 G;  1VQ7 A;  4YWL A;  2OWO A;  1V8Q A;  2B2T C;  2F0Q A;  4E6I A;  2F1M A;  1JIC A;  3HKS A;  2UXD Q;  2Z8L A;  2K5D A;  4A76 A;  4M8A A;  1STG A;  3NTK A;  2JXM B;  1TR5 A;  2EE1 A;  3Q8D A;  3PIO 3;  2FHT A;  4IN3 A;  3T1H L;  4JOI C;  2DY7 A;  1CKO A;  3MXU A;  4K0K L;  2PMZ B;  3CCJ A;  4FP5 D;  4A3J G;  1EOT A;  4ID6 A;  3F2B A;  4KKS A;  2Y0S G;  4IZ8 A;  3P75 A;  1N8R C;  3RMH A;  2N78 A;  4RMF A;  5I6Y A;  4B9X A;  1WCM H;  1STE A;  1YNN D;  4P75 A;  3A74 A;  1ASZ A;  1PFS A;  2B8G A;  1I94 Q;  1RD9 D;  4B9W A;  2K33 A;  2OT2 A;  3K8A A;  4LMQ D;  1GUG A;  4B3R Q;  2K5N A;  4ZCK A;  3DMU A;  3CRL C;  3WDN A;  1A3U A;  3RZD B;  2JA6 G;  1MSG A;  1SJE D;  1LAC A;  1PH2 A;  5DAU A;  1I4X A;  5CMD A;  3A7L A;  1AH9 A;  1VQ6 A;  4EQO A;  3ERO A;  1TWF H;  1YJW A;  3FDT A;  2F0J A;  3Q23 A;  1IL8 A;  3P7J A;  3CC4 A;  1EWH A;  2WB1 B;  1U4R A;  2PPB C;  1DD2 A;  1Z47 A;  2MGS A;  1SNO A;  1CUK A;  4KN7 C;  3M4Y A;  5JEA H;  1U4P A;  3GTJ H;  4XQJ A;  1TWH H;  1JOO A;  1AE2 A;  4BY1 H;  3SK6 A;  3GTM B;  3F8T A;  4J8Q A;  4NW2 A;  1XWE A;  3F2U A;  3KDF B;  2XWJ B;  4A3J B;  3FKI B;  4NXN L;  2PI2 A;  2Y0S B;  2Q2I A;  4IUN A;  3EFX D;  1PVO A;  2PNH A;  3S1R H;  5J22 A;  4LF8 Q;  5JEA G;  3ITP A;  4QJF A;  1O7I A;  5C4Z A;  1TT2 A;  3GP7 A;  3A8K E;  4G57 A;  2A6H C;  2KUM A;  4OWX B;  1RDP D;  4DAP A;  3GTO H;  2NUC A;  1VQ9 A;  3GTL B;  1VQF A;  1B3Q A;  3EJI A;  3CD6 A;  5JJI A;  2GVB A;  5BR8 Q;  1K3R A;  2QKI C;  2OEO A;  2ZTC A;  5CV6 A;  5G3L D;  4KV6 A;  2JA6 B;  2ZXR A;  2LMC B;  2XGT A;  4B3T L;  2BH8 A;  2JA5 H;  4RA8 A;  3U9O A;  3K5L A;  3J80 E;  5KYI A;  4HIO A;  4C3I H;  2HD3 A;  3J7A V;  4JI3 L;  4QF4 A;  4FXD A;  2PQA B;  1PH5 A;  1IKM A;  5L37 A;  4LJZ C;  1IBK L;  1BOS A;  1QJO A;  3ERS X;  2XTI A;  4QL5 A;  1PZK D;  3HZX A;  4WJW A;  1QNK A;  4C1N I;  4K14 A;  3IRB A;  1LTB D;  1LT5 D;  2NN6 H;  3QOL A;  1DXM A;  4HAE A;  2E2D C;  4GLV B;  1TWF B;  4A93 H;  4TKO B;  3NEL A;  1B44 D;  1BO0 A;  2JYO A;  5FLX c;  1HTP A;  1CSQ A;  4PNY A;  1SE3 A;  3R2I A;  1KIX A;  2YV5 A;  1OXU A;  3S17 H;  4BA1 I;  1FJG L;  2SOB A;  1AFP A;  1IZ6 A;  1D2B A;  1D5M C;  3CCS A;  3G6J B;  3K0X A;  1PTO H;  5C4J B;  1H9M A;  2EY5 A;  2F0T A;  4RGT A;  3CME A;  3T1H Q;  4A93 G;  2F0V A;  1CZG A;  2EYO A;  1QIL A;  4QQB X;  4K0K Q;  2IT1 A;  3ONA B;  3JAM i;  3RNU A;  1PH6 A;  3F2D A;  2P5Z X;  3WOF A;  1ESF A;  4HMI A;  4UP7 A;  4DK0 A;  5FJ8 H;  2IL8 A;  1G51 A;  1OXV A;  3KF8 A;  3BYT B;  3R8B A;  3KFU A;  1ZKO A;  1N32 Q;  1WTO A;  1YNX A;  1HCZ A;  3CC2 A;  3S16 H;  3GTO B;  4DAY B;  1SYE A;  1YJ9 A;  1I6H H;  1KLU D;  1PYB A;  2N8N A;  5FJ8 G;  2K32 A;  2QEJ C;  3OIQ A;  2IX3 A;  3STB D;  3E9H A;  2JJQ A;  4JI7 L;  2VZA A;  5IT9 E;  4IUV A;  1I4H A;  1K8G A;  1JQY D;  1A62 A;  1PH7 A;  3QG1 A;  4DF7 A;  1XMQ Q;  1Q46 A;  2IHF A;  2K14 A;  3RUZ A;  3AMU A;  4POF A;  4RFB A;  1Q1B A;  5IP9 H;  3T13 A;  2JQO A;  5GAH C;  1JE4 A;  2J4X A;  3OMC A;  2F0E A;  1WOC A;  1S5D D;  2NBF A;  1S5B D;  4RHR A;  2QGQ A;  2VW9 A;  4A93 B;  4DR1 Q;  1YVC A;  1K8O A;  1HR0 W;  2B2W A;  4UP8 A;  5FO9 B;  1UE5 A;  1DM0 B;  4R8I A;  4K6L A;  1I6V C;  2FJ2 A;  4IPH A;  4L63 B;  4DV7 Q;  1IYV A;  4H02 A;  1CA5 A;  2X6L A;  2A1A A;  1KDC A;  3A8J E;  1KRS A;  5EPL A;  4OHJ A;  3QJY A;  1BKB A;  1BCP B;  3HG9 A;  4G4K A;  3FMC A;  3UDF A;  2V1C C;  1Y8O B;  1JB7 A;  5D3I B;  5A2Q L;  2VQF L;  4B3T Q;  1N33 L;  3HEJ A;  1L0Y B;  2HT1 A;  4N9T A;  4RGO S;  3CPW A;  1NJI C;  2EYM A;  1F2M A;  5LMN L;  4JI3 Q;  2K52 A;  3H0G H;  3H3V H;  1A2U A;  2F0W A;  1IBK Q;  3IAY A;  1I6H B;  1HRJ A;  1G2S A;  1EY9 A;  4IPC A;  1EZ8 A;  1FGU A;  4LF5 L;  4FYD A;  4A3M H;  1LO5 D;  1XNQ Q;  3I4L A;  3TBI B;  3MAQ A;  4LNQ A;  1GUN A;  2UUB L;  2HCI A;  2L0C A;  1E2W A;  5IYC H;  3BZC A;  3S15 H;  3KLS A;  4Y7N H;  1AEX A;  3Q6S A;  1ZYR C;  3HKZ G;  1X56 A;  4ME3 A;  1PYS B;  5IP7 H;  1PZJ D;  1LUZ A;  3OTO L;  1NUC A;  4A3M G; 
#chains in the Genus database with same CATH homology
 5LMU Q;  4DV1 Q;  1WYD A;  4HID A;  1N36 Q;  1FJG Q;  2AWO A;  4X65 Q;  4DV2 L;  1LTL A;  1GVP A;  2AHO B;  2NN6 G;  3CP0 A;  4YCU A;  5IE8 A;  1Z9F A;  2N49 A;  4AQY Q;  1PH8 A;  1QVF A;  5IYC G;  2WFW A;  1FVI A;  4IPD A;  1VQ8 A;  3GTM H;  1H95 A;  2E2H H;  1QVG A;  4YCV A;  3G71 A;  2VNU D;  2I5H A;  5IP7 G;  4A4I A;  2B29 A;  4A3J H;  3FKI H;  1EFW A;  3I7F A;  4JI1 L;  2JA7 H;  4PMW A;  3S1Q H;  2LXJ A;  3W1B A;  3T1Y L;  1VQM A;  2ZJP A;  2KHI A;  4NXM Q;  4LFB L;  2UXD L;  4QIW E;  1R9T H;  4IFD G;  4DK6 C;  1HH2 P;  3BJU A;  4B3S Q;  4OX9 L;  2VQE L;  3CPF A;  1E1O A;  1VQC A;  3RLO A;  4R4T A;  1MJE A;  2ASB A;  2RHQ B;  1Q86 C;  2Z0S A;  2Z6K C;  1X65 A;  4LFA Q;  3SGI A;  3RN2 A;  1K9M C;  3H3V I;  4GKK L;  1SFO H;  3OYY A;  3H15 A;  1U5K A;  3KDF A;  3PIP A;  3GTL H;  2HHH Q;  3RN5 A;  4Y52 H;  3FKI G;  1DGS A;  2D62 A;  2OCE A;  2IX1 A;  4DK3 C;  4DR2 Q;  3E0E A;  4PG3 A;  1QUQ B;  1WI5 A;  3W5O A;  1YZ6 A;  3J80 i;  2NN6 I;  1RL2 A;  1XMO Q;  4JI7 Q;  4LF9 Q;  2JA6 H;  1HZ9 A;  4DV6 Q;  1SR3 A;  4DR3 Q;  3HFZ B;  1G6P A;  4DR6 Q;  1NY4 A;  1N32 L;  2K4K A;  2VS1 A;  5AJ3 L;  4A3C H;  1D8L A;  1Q12 A;  3TQY A;  2CWA A;  2HIX A;  4A3L H;  3GD7 A;  4C3J H;  1PH9 A;  4PZ6 A;  3CW2 C;  1UE1 A;  4L5Q A;  3PIO A;  4BBS H;  4BY7 G;  2JA8 H;  4KHZ A;  3UE0 A;  4B3R L;  1BBU A;  1VQO A;  4EQ5 A;  1KQS A;  4JI0 Q;  3D0F A;  5IYB H;  3CCM A;  1HNX Q;  1J6Q A;  4DR4 L;  1XTD A;  1KHI A;  4JBJ A;  1YIT A;  2UXB Q;  4WJ4 A;  5ELN A;  3K81 C;  3HOZ H;  1VQD A;  4LF4 L;  5J3B A;  1JE5 A;  1TWC H;  3CCU A;  3I4O A;  2ZM6 Q;  2BA0 A;  5C44 H;  2PQA A;  2NVQ H;  1I5F A;  2A19 A;  4NXN Q;  4TQU S;  3HOW H;  3BZK A;  4A3L G;  3FHW A;  4JV5 Q;  1XMQ L;  1VQN A;  3HOU H;  5IP9 G;  4OXP A;  4PZ8 A;  4OO1 G;  5IYB G;  2PMZ E;  2UU9 Q;  3DLL A;  2CFM A;  1EOV A;  3PUV A;  1YHQ A;  1HNZ L;  1IL2 A;  3KF8 B;  3NEN A;  5GAE C;  3M7N A;  3L7Z C;  3M4O H;  4DKA C;  4NPS A;  4X6A H;  4YHH L;  4LF7 Q;  1IYJ B;  3HOZ G;  4DUY Q;  2ZTD A;  2NVX H;  4O0A A;  1KAW A;  5C4J H;  3S2H H;  1GM5 A;  3EIV A;  1WJJ A;  2Q2T A;  5C44 G;  3HOW G;  4R4C A;  3M4P A;  1CKM A;  4DR1 L;  1J5E L;  4BBR G;  2NVT H;  3HOU G;  3STB C;  3L2P A;  4A3I H;  3NBH B;  2F3I A;  1N34 Q;  1X3F A;  1Q82 C;  3HKZ E;  2B3G A;  1B8A A;  2RHS B;  4LF8 L;  2BA1 A;  4XTC S;  2VUM H;  3M85 A;  4DR7 Q;  4RG1 A;  1HJP A;  3ICE A;  3PSI A;  2KCM A;  5M3F H;  1Q7Y C;  1SE8 A;  4DV7 L;  1Q81 C;  2OTL A;  1SLJ A;  3KF6 A;  2CWP A;  2Q2U A;  1VQ5 A;  1BBW A;  4GN3 B;  5LMN Q;  4HIM A;  1HR0 L;  3PCO B;  1V43 A;  4GKJ L;  1GD7 A;  5C0X J;  2R7Z H;  4OO1 I;  1L2F A;  4DV5 L;  4A3I G;  4P72 A;  5JJL A;  1X3E A;  5IYD G;  2AWN A;  2MFI A;  1JJ2 A;  3LGJ A;  1YJN A;  3G4S A;  2EIF A;  3W1G A;  3HOX H;  4A3E H;  3U50 C;  4JI8 Q;  4LW1 A;  1Y1V H;  1S3O A;  3H0G G;  4O2D A;  4YCW A;  4GLX A;  4JI5 L;  2DUD A;  1BVS A;  4UPA A;  3CF5 A;  2Q2H A;  3NEM A;  3OTO Q;  2MNA A;  4R4I A;  1Y1W G;  2UUA L;  1UEB A;  5FLM H;  2Y0S E;  1XNR L;  4BXX H;  1OXX K;  3HOX G;  4P71 A;  4A3E G;  2UUC L;  1XNQ L;  2E5L L;  1E7Z A;  3CCR A;  3J7Z C;  4DV4 L;  4LFC L;  4DV0 L;  3M9B A;  5IWA L;  1B7Y B;  3TRZ A;  1ASY A;  1Y1V G;  3M4Q A;  3U4V A;  1K73 C;  3GTG H;  3ULL A;  2AMC B;  2YTY A;  3EN2 A;  1VQB A;  1IXR A;  2VL6 A;  4JI4 L;  2BH2 A;  2WB1 G;  1IBL L;  1VQ7 A;  4OWW B;  1YI2 A;  4YWL A;  4JI1 Q;  4YWK A;  2OWO A;  1Q1E A;  1YHB A;  1K83 H;  3HKS A;  4APV A;  3F2C A;  3KLW A;  3WWV A;  3VDY A;  4LFB Q;  2UXD Q;  4A76 A;  4YY3 L;  3J81 c;  1M1K C;  2VQE Q;  1N36 L;  1KC8 C;  1EQR A;  1L1O A;  1WFQ A;  2K50 A;  3Q8D A;  3I55 A;  4A3K H;  1X54 A;  2FXQ A;  4AQY L;  1E22 A;  5JEA J;  3T1H L;  4DAM A;  2R6G A;  4GKK Q;  4JBM A;  4JOI C;  3D31 A;  3J81 j;  4ALP A;  1CKO A;  4K0K L;  2CKZ B;  3A5Z B;  4JOI A;  4AH6 A;  3CCJ A;  3F2B A;  4HJA A;  4A3J G;  1VQK A;  1I3Q H;  2JA7 G;  2Y0S G;  1X55 A;  3MXN B;  3S2D H;  2JA9 A;  4DPG A;  2R93 H;  1CSP A;  1N8R C;  1SMX A;  3JAM c;  1A63 A;  4GN5 A;  2N78 A;  4POG A;  1PH3 A;  4RMF A;  2OQ0 A;  4NXM L;  3HOV H;  1WCM H;  4A3K G;  4B3S L;  4P75 A;  3A74 A;  3BU2 A;  5AJ3 Q;  4HJ9 A;  2ES2 A;  4JI6 L;  1ASZ A;  4LFA L;  4A3B H;  3S1N H;  1PFS A;  1I94 Q;  1IBM L;  1CKN B;  1HNW L;  2QEX A;  3CCL A;  4JBW A;  2HHH L;  3K8A A;  3DM3 A;  4IFD I;  2F4V Q;  4B3R Q;  4P74 A;  2K5N A;  2B63 H;  1NTG A;  2EXD A;  1E3P A;  4WJ3 M;  2JA6 G;  3S14 H;  1LM0 A;  4IJH A;  4DV3 L;  2LSS A;  4QY7 A;  5E7N A;  3JC6 6;  1XMO L;  4LF9 L;  1QVC A;  4P73 A;  1GKH A;  4XIG S;  4DR3 L;  1PH2 A;  4X66 L;  3KYH C;  3J80 c;  2YTX A;  3CMA A;  1K0R A;  4LF4 Q;  4B3M Q;  4NB3 A;  1VQ6 A;  4DR6 L;  4A3B G;  4GNX C;  3CCV A;  4A3C G;  5JJK A;  1YJW A;  1KXL A;  1TWF H;  3CC4 A;  4GLA C;  4GNX A;  4KI0 A;  4BBS G;  3ER0 A;  2JA8 G;  1JJC B;  1Z47 A;  3PV0 A;  3PUX A;  4DR5 L;  2K5V A;  4OON A;  2OTJ A;  1CUK A;  1HNZ Q;  2I5M X;  4JI0 L;  2CCZ A;  3GTJ H;  4YHH Q;  1XJV A;  3MEF A;  1LYL A;  1TWH H;  4IJL A;  1W2B A;  1VQE A;  1AE2 A;  4BY1 H;  3PO3 H;  1NBW A;  4KHP Q;  3GTK H;  3F8T A;  3U58 A;  2R7D A;  4IO9 A;  3CQZ H;  1T9H A;  1J5E Q;  1VS0 A;  2NZO A;  3KDF B;  5LMN W;  5M3M H;  4NXN L;  1L0W A;  2PI2 A;  3UE1 A;  1UE7 A;  2Q2I A;  3RZO H;  1PVO A;  2PNH A;  3S1R H;  2WAQ E;  4HJ7 A;  4FDB A;  1B70 B;  4L5T A;  2VQF Q;  5JEA G;  4IOC A;  4LF8 Q;  1N33 Q;  2H5X A;  3I56 A;  1PH1 A;  4QJF A;  1O7I A;  1XPU A;  1PH4 A;  4JYA L;  5M5X H;  3EBE A;  3PO3 G;  4OWX B;  1PV4 A;  2E2I H;  4GN4 B;  3UDI A;  4DUY L;  1W3S A;  3GTO H;  4LWC A;  4X64 Q;  1TWA H;  1HR0 Q;  1VQ9 A;  1VQF A;  1TXY A;  4GKJ Q;  1VQP A;  3CD6 A;  1FL0 A;  5JJI A;  2GVB A;  5BR8 Q;  1K3R A;  2ZTC A;  4IPG A;  4X62 L;  3CC7 A;  4LF5 Q;  2WB1 E;  2GN5 A;  1X6O A;  1YEZ A;  4KLK A;  4LUO A;  1N34 L;  2D0O A;  5GAG C;  4LF6 L;  2VUM G;  4JC0 A;  4BA2 I;  3TS2 A;  5K36 G;  2XGT A;  1QZH A;  4B3T L;  2UUB Q;  2BH8 A;  2JA5 H;  5IY0 A;  1JJG A;  1A8V A;  3ULJ A;  5M3F G;  4JI2 Q;  5GQO A;  4HIO A;  4A3G H;  4C3I H;  2VY3 A;  4DUZ Q;  1C9O A;  3PUZ A;  4JI3 L;  2R7Z G;  2WAQ G;  2PQA B;  1PH5 A;  3I4N H;  3AYH B;  1IBK L;  4GNX B;  1U0L A;  2KHJ A;  2I0Q A;  3ERS X;  2E2J H;  3GO5 A;  2OQK A;  2UUA Q;  1MKH A;  2XTI A;  2MQH A;  2ALY B;  5GAD C;  3AQQ A;  5M5Y H;  2EQS A;  4QL5 A;  3KJP A;  1QZG A;  3J7A 5;  5DLQ E;  3RLF A;  4DV2 Q;  2UUC Q;  2E5L Q;  3S24 A;  2KEN A;  3KOJ A;  5IT9 c;  3IRB A;  2JE6 I;  4DNI A;  4DV0 Q;  1EUJ A;  5IWA Q;  4DV4 Q;  1VQL A;  4LFC Q;  2LXK A;  3TS0 A;  4R1J A;  4A3G G;  2ZJR A;  4GLV B;  3PUY A;  5C4X H;  4A93 H;  4JI4 Q;  3CAM A;  1NMF A;  3AFP A;  3NEL A;  4J15 A;  1XPR A;  1P8L A;  3T1Y Q;  5FLX c;  1CSQ A;  2YYZ A;  3F1Z A;  3TEH B;  1KIX A;  5FLM G;  2YV5 A;  4HJ8 A;  4A75 A;  1OXU A;  1S72 A;  3S17 H;  1L1O C;  4BXX G;  4BA1 I;  1OXT A;  3I2Z A;  5LMU L;  4DV1 L;  3ZJY C;  4OX9 Q;  1FJG L;  4X65 L;  1IZ6 A;  1RIP A;  2A8V A;  3CCS A;  1KL9 A;  1VQ4 A;  3K0X A;  1OTC A;  3UDX A;  3K7U C;  5H1S E;  1YIJ A;  3RR5 A;  3CME A;  3T1H Q;  5C3E H;  1X3G A;  3UDG A;  1X9N A;  3KF6 B;  4A93 G;  5C4X G;  4L5S A;  4QQB X;  4K0K Q;  1HZB A;  2IT1 A;  3I4M H;  1SN8 A;  3JAM i;  3RNU A;  1PH6 A;  3F2D A;  2IHE A;  2NVY H;  1UWV A;  4UP7 A;  1M90 C;  1HZC A;  2E8G A;  1GO3 E;  2K75 A;  5FJ8 H;  1D7Q A;  1G51 A;  1OXV A;  1Y14 B;  3PO2 H;  3KFU A;  4YWM A;  1V9P A;  2ZTE A;  3A5U A;  1UE6 A;  2KBN A;  5C0X G;  1N32 Q;  4EX5 A;  3GTQ H;  1YNX A;  2L15 A;  5C3E G;  3CC2 A;  3S16 H;  4JI6 Q;  4DAY B;  1PHJ A;  1YHA A;  4QGU A;  3CCQ A;  1IBM Q;  2JK8 A;  3I4M G;  1HNW Q;  3TRE A;  2IY5 B;  2Z6K A;  1YJ9 A;  2R93 G;  1I6H H;  1JT8 A;  4OWT B;  1OXS C;  1PYB A;  5HGQ A;  3G6E A;  4BY7 H;  4DR2 L;  2N8N A;  2NZH A;  1E1T A;  5FJ8 G;  2JEA I;  3HOV G;  3STB D;  3E9H A;  1WCM G;  1JMC A;  3PUW A;  4DV3 Q;  1K8A C;  3PO2 G;  4DR4 Q;  2JJQ A;  2PI2 E;  4JI7 L;  2VZA A;  4DV6 L;  1NE3 A;  3PF4 A;  4X66 Q;  1EYG A;  1K8G A;  1A62 A;  1TWG H;  1PH7 A;  3GDE A;  3U4Z A;  1I94 L;  1XMQ Q;  2YU9 H;  2ATW A;  4IOA A;  1Q46 A;  2IHF A;  2K14 A;  4POF A;  1NMG A;  2B63 G;  1E24 A;  4DR5 Q;  1Q1B A;  5IP9 H;  3CXC A;  2JQO A;  4AYB E;  5GAH C;  1EIY B;  2F4V L;  2HQL A;  1KD1 C;  5C0X I;  3L0O A;  4MTN A;  1HNX L;  3M3Y H;  1KRT A;  2QA4 A;  3G48 A;  1WOC A;  1S40 A;  3AFQ A;  1VQI A;  2RF4 A;  1A0I A;  2UXB L;  5EAY A;  1L1O B;  2CQO A;  4MZ9 A;  5HY6 A;  4C2M H;  2QGQ A;  2KCT A;  2YTV A;  2VW9 A;  4B3M L;  1Q8K A;  3A0J A;  1AH9 A;  4DR1 Q;  1YVC A;  2ZM6 L;  1HR0 W;  4A3F H;  1AE3 A;  4GOP C;  2WP8 J;  2R7F A;  4UP8 A;  4BBR H;  4JV5 L;  1UE5 A;  3B6Y A;  4UY8 C;  2C35 B;  2JEB I;  1SRU A;  4GOP A;  3HOY H;  2UXC Q;  2UU9 L;  3KJO A;  4JYA Q;  4LUV A;  4JG2 A;  4IPH A;  2I5L X;  4HJ5 A;  1C0A A;  2ZJQ A;  1G29 1;  5ELO A;  4MNO A;  4BY1 G;  4DV7 Q;  4C3H H;  4H02 A;  4LF7 L;  3FP9 A;  2A1A A;  2K5H A;  3PGZ A;  4IFD J;  4KHP L;  1PA6 A;  1KRS A;  1BKB A;  4AYB G;  2MO1 A;  5M3M G;  4A3F G;  1EWI A;  4DV5 Q;  4AIM A;  3ULP A;  1VQH A;  3GTP H;  4A3D H;  4X62 Q;  4PZ7 A;  3HOY G;  1I50 H;  3UDF A;  2V1C C;  1JB7 A;  4LF6 Q;  1VCI A;  5IYD H;  3CCE A;  1HZA A;  3PF5 A;  2VQF L;  3K7A H;  4B3T Q;  1N33 L;  4LUZ A;  4DR7 L;  2UXC L;  3K80 C;  2HT1 A;  1V1Q A;  3OW2 A;  2HIV A;  4HIK A;  5M5W H;  3AEV A;  2R92 H;  1XPO A;  1N9W A;  2IX0 A;  3CPW A;  1NJI C;  2D0P A;  1P16 A;  5LMN L;  4X64 L;  4JI3 Q;  1VQA A;  2K52 A;  4JI5 Q;  3H0G H;  3H3V H;  1IBK Q;  2MO0 A;  4A3D G;  1QUQ A;  2AKW B;  5BR8 L;  1MJC A;  4IPC A;  4TVA B;  3S1M H;  1FGU A;  3E9I A;  4LF5 L;  3RLN A;  2DGY A;  1XNR Q;  4A3M H;  1Y1W H;  1EQQ A;  2JA5 G;  3RZD H;  1XNQ Q;  1EIF A;  1SRO A;  2N3S A;  4LNQ A;  4R4O A;  4R4Q A;  4GS3 A;  2UUB L;  2R92 G;  4UP9 A;  1C7Y A;  4JI8 L;  1MIU A;  4JI2 L;  5IYC H;  2F52 A;  1YBY A;  3BZC A;  3S15 H;  4Y7N H;  1CKN A;  1IBL Q;  4JCV E;  4DUZ L;  3I4N G;  4JBK A;  3HKZ G;  2ID0 A;  1X56 A;  2GVA A;  1PYS B;  1VQG A;  4ME3 A;  5IP7 H;  3J81 i;  4L5R C;  5GRO A;  1LUZ A;  1VQJ A;  2RCN A;  3OTO L;  4YY3 Q;  4GOP B;  4A3M G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...