3HOUH

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
134
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 16
structure length 134
sequence length 145
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3houH00
2R6GA 1VS0A 4P74A 3K81C 1Q8KA 1X3FA 1YBYA 4YCVA 5LMUQ 2UUCL 1N33L 3I4MH 2E5LL 3OYYA 4P75A 1GD7A 3HOUG 1XNRQ 3S15H 1IBLQ 2VL6A 4OX9L 2MFIA 1N34Q 1KRSA 3TS0A 5AJ3Q 1G51A 1HNZL 2Y0SG 4WJ3M 3U4ZA 1B7YB 2QA4A 1JJ2A 5JJKA 1GO3E 4O2DA 5K36G 1JE5A 5GAEC 1X55A 2NVYH 2XGTA 5IYBG 2IX0A 4LFCQ 2NN6G 4QQBX 1YJWA 4JI5L 4A3CH 2JA6G 4JC0A 4QL5A 4GKJL 4LUZA 2R93H 1CKNA 1D7QA 4DV7L 4B3SL 4LF4Q 5FLMH 5M3MG 5C4XG 3HOXH 4QY7A 4X65Q 1IL2A 4IPCA 2PI2A 5C4JH 1I5FA 3OTOL 4B3TQ 1E24A 4DV2L 4JG2A 3CC4A 2R7ZG 4K0KL 4YCWA 4JI6L 5HY6A 3STBD 3KF8B 2JA7H 3M4OH 1IBMQ 4NXNL 3H0GH 5ELNA 1QZHA 3H3VH 4A3JG 3G6EA 1YJNA 1HR0W 1HR0Q 4L5RC 1NBWA 2UUBL 5FLXc 1EFWA 4IFDJ 1XMOL 1UE6A 4LUOA 4C3JH 2L15A 5IYCH 3J81i 2CWAA 3A0JA 2VUMG 3HOZH 2E5LQ 2OWOA 3CCVA 3TEHB 1PVOA 1SN8A 1V9PA 1IBKL 3FP9A 1CKNB 3H0GG 3BU2A 1Y1VG 3RNUA 1WJJA 1I3QH 3KLWA 3DLLA 2AHOB 1J6QA 4DAMA 3CCEA 1PV4A 2Z0SA 1EOVA 1PH1A 3OTOQ 2NVTH 4DR6L 3CPFA 1A62A 1U5KA 1VQGA 2EIFA 4YCUA 1IZ6A 3M9BA 1PH3A 2D0PA 2WAQE 2ZJPA 1QUQA 1X9NA 4P71A 3HOVH 1X3GA 2MNAA 3CCUA 5IP7G 4DV1Q 2PQAA 1QVCA 2NN6I 5C44H 1VQAA 5JEAG 4IPHA 1K8AC 3W5OA 2N8NA 4A76A 3I4NG 2B3GA 2XTIA 1OXVA 3HOYG 4PZ7A 3UE0A 4LFAQ 3NELA 1OTCA 4IJHA 3B6YA 2ES2A 3PUXA 5JJIA 4DK3C 3U4VA 1VQ5A 2JJQA 1O7IA 4QIWE 1W2BA 4GKJQ 4DV7Q 5IT9c 2N78A 3S14H 1VQBA 1YVCA 4A3DG 2KCTA 2C35B 2VQFL 4P72A 3KDFA 4POFA 3HOYH 3F2BA 1UEBA 3ER0A 1KD1C 2JA8G 2PI2E 5GQOA 1K73C 1N34L 3K8AA 2UXBL 3A5ZB 5M3FH 4BBSH 5GAGC 2BA0A 2Q2TA 4DR6Q 1WYDA 3HKZG 2AWOA 2HQLA 1Q81C 1VQKA 4K0KQ 2ZTDA 1Q86C 3E9IA 1PH8A 1SR3A 3A5UA 1L1OB 4LFCL 1X6OA 4AYBE 3F2CA 3E0EA 4R4QA 4DR3Q 3VDYA 1VQ4A 1EQQA 1VQNA 4JV5L 1P8LA 2R93G 1KC8C 2I5LX 3CCSA 1VQOA 1R9TH 1XNQQ 1HJPA 3I55A 3PUVA 3NEMA 1VQ7A 3KFUA 1HZAA 4NXMQ 1BBUA 1JJCB 3W1BA 2KBNA 4DV4Q 2RHQB 1QUQB 1KIXA 1GM5A 3FKIH 1C7YA 1VQ8A 4NPSA 4JOIA 1HNXL 2AWNA 1H95A 2OTJA 4JI8L 1XTDA 4A3MG 3TRZA 2LXKA 3UDFA 1RIPA 3BZKA 4DK6C 1Q1EA 3HOUH 2GN5A 1SRUA 4DNIA 4BA1I 5M3MH 4BXXH 1XNRL 1I50H 2JA5H 1IBKQ 4DV1L 4HIOA 5IE8A 1PH2A 2OTLA 4DR5Q 1FJGQ 1SROA 3CC7A 5IYDG 1A8VA 2A1AA 4L5TA 3PUZA 3L0OA 4XIGS 3ZJYC 3M3YH 3F8TA 4JI0Q 1L1OA 1TXYA 1UE5A 3ULPA 1T9HA 3JAMi 4HIMA 1G291 3M4QA 2B63G 2F52A 1E7ZA 1L1OC 2ZJQA 1PH7A 1EQRA 4LF5L 3H15A 1VQJA 1X54A 1YHAA 3PUYA 4IFDI 4OO1I 1KHIA 1VQMA 1J5EL 4PZ8A 1GKHA 4NXML 4B3TL 1VQ6A 4NB3A 5GADC 2HIVA 5M5WH 4HJ7A 4LF7L 4AYBG 3I4MG 3JC66 5M5XH 4KLKA 2UXBQ 4DKAC 2IHEA 1B70B 4YWLA 1V43A 2Z6KA 2VS1A 1YITA 3HKZE 4UPAA 3PF5A 2JA5G 4KHPQ 1M1KC 1VQFA 3UDIA 3T1HQ 1HR0L 4LF9L 4X66Q 4RMFA 4YWKA 5H1SE 1UE1A 3G71A 1MKHA 3HOXG 1KXLA 1K3RA 3HKSA 1HNWL 3DM3A 2JA8H 3ICEA 3EN2A 1EIFA 3GD7A 3SGIA 3STBC 4GOPA 1HNZQ 3EBEA 3S2HH 4YY3Q 4GLXA 2BH8A 3ULJA 4JI8Q 1BVSA 3AFPA 3S24A 4IPGA 1L0WA 1I6HH 1XPOA 2R92H 1JT8A 3CMEA 3E9HA 4PMWA 4PG3A 1XPRA 4A93H 3G48A 4WJ4A 1Y1WH 1CUKA 1TWAH 2YU9H 4LF5Q 4KHPL 1Q46A 4EQ5A 3PO3H 4GN3B 3MEFA 3RLOA 1GVPA 4MZ9A 1I94Q 4X65L 3I2ZA 4X64L 2F4VQ 4BY7H 5ELOA 2GVAA 2QGQA 3CF5A 3M85A 1HNWQ 1ASZA 2E2IH 1XJVA 2D0OA 5C0XJ 3CCJA 1FJGL 1AE2A 4LNQA 3PO3G 2B29A 2CKZB 1MIUA 4A3FG 1WOCA 2ID0A 4JBKA 3S17H 3MXNB 5GROA 1PA6A 1I94L 2RHSB 3F1ZA 3GTKH 5IYCG 5LMNW 3D0FA 2A19A 1JB7A 2VUMH 2CFMA 4GOPC 1X3EA 4JI2Q 2KCMA 4OWTB 2NZOA 3L2PA 3GTJH 4HJ5A 3LGJA 4RG1A 2JEBI 1J5EQ 4LF6Q 4HJ9A 5DLQE 1C9OA 3PGZA 3W1GA 2I0QA 3GO5A 2LXJA 4YY3L 2F4VL 4JYAQ 1QVGA 1TWCH 1S3OA 3CP0A 1K9MC 1LM0A 2E2JH 4JI7Q 4DR4L 3ERSX 4DUYL 4A3JH 1W3SA 1CKOA 4GNXA 3K0XA 1HH2P 2DUDA 1E1OA 4DR3L 4APVA 4DR1L 2IX1A 3RLNA 2HHHQ 4JV5Q 1L2FA 2JA9A 4GN5A 4MNOA 4A3GH 2NZHA 1WCMG 4IPDA 4DV5L 1XMQQ 4J15A 1TWFH 1PH9A 4OONA 1Q12A 1OXSC 2PMZE 4TQUS 4BY1G 4A3KG 3CPWA 3U50C 3NENA 4EX5A 2YV5A 3KJOA 4GNXC 3M7NA 3AQQA 2YTVA 2E2HH 2ATWA 2HHHL 4UP8A 4JOIC 1B8AA 4DAYB 4DV0Q 5IP9G 1LYLA 1Q7YC 4A93G 2Y0SE 4JI7L 2Q2IA 4A3LH 3UE1A 1YNXA 4X66L 4ME3A 3A74A 2YTYA 4PZ6A 3I56A 4A3IG 2H5XA 3K7UC 3BJUA 1WFQA 2R7FA 4JBMA 3RZOH 3PO2G 2CQOA 3FHWA 4OO1G 1NY4A 4ALPA 5FJ8H 2N49A 1Q1BA 1FGUA 2B63H 1SE8A 4C2MH 1VQDA 3F2DA 4X64Q 2BH2A 4DV3L 3GDEA 2VY3A 1Z9FA 1AE3A 1S40A 4B3RQ 4C3HH 2VW9A 2R7ZH 4JI0L 1N32L 2Q2HA 2UXCL 1WCMH 4AQYQ 2K4KA 3CXCA 2D62A 4R4IA 2AKWB 5FJ8G 1K0RA 3PIPA 3GTPH 4DV6L 5IWAQ 1E1TA 4LFBQ 1YJ9A 2ZTEA 4H02A 3GTGH 4BXXG 3FKIG 3EIVA 4JI1L 3S1NH 3J81j 2HT1A 3K7AH 3RN2A 2VNUD 1IYJB 2VQEQ 1NJIC 4QJFA 4A3MH 5IP9H 1E3PA 4GKKL 4DUYQ 2EQSA 1OXXK 4A75A 4LF7Q 3GTLH 3BZCA 4DV4L 2UUAQ 3S1QH 1D8LA 4GNXB 4DPGA 2F3IA 1FL0A 4A3IH 4B3ML 3GTMH 1ASYA 3AEVA 4LW1A 4BA2I 1PYBA 4DV0L 4IOAA 2K75A 2KHJA 3I4OA 3T1HL 4L5SA 4OWWB 5BR8L 1N32Q 1MJEA 4LF9Q 5IYDH 3IRBA 2QEXA 3RN5A 2DGYA 1YHQA 1EIYB 1YHBA 4LWCA 2Q2UA 1A0IA 3CCRA 1LUZA 5IP7H 5IWAL 5GAHC 1SLJA 4Y52H 1XMQL 1YI2A 1NTGA 2YTXA 3KF6B 5C3EG 4DV2Q 1KQSA 1HZCA 1KL9A 1BKBA 1OXUA 1SFOH 4LF6L 4X6AH 4KI0A 2EXDA 4JI6Q 2RF4A 2R92G 2K5VA 1X56A 3D31A 1LTLA 3J7ZC 3HOWG 4A3BG 3S1MH 3G4SA 3OW2A 1Y1WG 3PIOA 1DGSA 2KHIA 4DR1Q 1EYGA 2PNHA 4L5QA 2UUCQ 3JAMc 3PV0A 4KHZA 2K5HA 3KJPA 4A3CG 5JEAJ 5BR8Q 4X62Q 2OCEA 4R4TA 4R4CA 4DV5Q 3GTQH 3NBHB 1HZBA 1AH9A 1YEZA 4IFDG 4LF8L 2ZM6L 3T1YQ 4A3FH 4JI3Q 4HIKA 2UXCQ 4AQYL 1A63A 1IXRA 2YYZA 5AJ3L 1VQ9A 1MJCA 4POGA 5J3BA 1VQCA 4DV3Q 2JA7G 3Q8DA 3J80i 4A3EG 3CQZH 4JI1Q 1E22A 3J7A5 4DR2L 1PYSB 2AMCB 3RR5A 3CD6A 1U0LA 4OWXB 3CC2A 3U58A 4GOPB 3T1YL 2IT1A 1WI5A 2K5NA 2WAQG 1PH4A 3HFZB 1TWGH 2K50A 4DR7L 4JI4Q 3I7FA 3S1RH 1VQPA 1K83H 4B3MQ 1XPUA 1FVIA 2UU9L 1KRTA 1VQHA 2Z6KC 2PQAB 2R7DA 4JBWA 2JK8A 3ULLA 3AYHB 3HOZG 5E7NA 2I5HA 1CSPA 2NVXH 4AIMA 1TWHH 3RLFA 1UWVA 2FXQA 1NMFA 3M4PA 1C0AA 3S16H 1HZ9A 5IY0A 4DR7Q 2JQOA 4DV6Q 4LFBL 5HGQA 4DR2Q 2CWPA 1PFSA 4X62L 4LUVA 2A8VA 4OXPA 2VQEL 2OQ0A 4QGUA 4OX9Q 3S2DH 1EWIA 3K80C 5C3EH 2WP8J 4XTCS 4GKKQ 4R1JA 4JI4L 2V1CC 2RCNA 4GLVB 4A3GG 5FLMG 1VQLA 3UDXA 1P16A 2UU9Q 1QVFA 4IOCA 3PO2H 3PSIA 4UP9A 1KAWA 3CMAA 3AFQA 4IO9A 4BBRG 1YIJA 5IYBH 4A3LG 2IY5B 1CSQA 4GN4B 1X65A 4JCVE 1PH5A 1EUJA 4JI2L 3KF6A 1Z47A 1PHJA 4B3SQ 4LF4L 2K14A 4O0AA 5C0XG 1XNQL 4HJAA 5JJLA 4YHHL 2UXDQ 3CW2C 3HOWH 3PF4A 2VZAA 3KYHC 1Y1VH 2K52A 2MO0A 1CKMA 4DR4Q 2E8GA 1N36Q 4LF8Q 4TVAB 1QZGA 4JYAL 4YWMA 2HIXA 4JI3L 2BA1A 3CCMA 3UDGA 1VQEA 1N9WA 3PCOB 4BY1H 3KOJA 3CCQA 1YZ6A 5M3FG 4YHHQ 3HOVG 1N33Q 1PH6A 4AH6A 1V1QA 3CCLA 4UP7A 4GLAC 2JEAI 1BBWA 4JBJA 4R4OA 1JJGA 2OQKA 2WB1E 1VQIA 3TQYA 1N36L 1IBLL 2CCZA 3TS2A 2ZM6Q 4DR5L 2JA6H 4GS3A 4DUZL 1K8GA 2UUAL 4BBSG 3RZDH 2GVBA 2ZTCA 3CAMA 5C4XH 5M5YH 2LSSA 3WWVA 1Y14B 2ASBA 3GTOH 4A4IA 3J81c 1S72A 2UUBQ 4HIDA 2MO1A 4MTNA 4P73A 1XMOQ 3J80c 2ZJRA 1JMCA 4UY8C 3TREA 2JE6I 3I4NH 4A3DH 4FDBA 1VCIA 1UE7A 2I5MX 2N3SA 1Q82C 1RL2A 4NXNQ 5LMNQ 1SMXA 2NVQH 2ALYB 4DUZQ 4IJLA 4A3BH 5LMUL 1N8RC 4C3IH 3KDFB 5EAYA 2WFWA 2UXDL 4A3KH 2IHFA 4BBRH 5C0XI 4Y7NH 3H3VI 4BY7G 4B3RL 4LFAL 1OXTA 1IBML 2WB1G 3PUWA 5C44G 1M90C 1NMGA 2KENA 4HJ8A 2MQHA 4A3EH 1HNXQ 4JI5Q 1G6PA 1NE3A 5LMNL 3L7ZC 2VQFQ
chains in the Genus database with same CATH superfamily
4P74A 2UUCL 1X3FA 3GP7A 4L8JA 3PIO3 1GD7A 5EBCA 1IBLQ 3C46A 2VL6A 1G51A 1HNZL 2F03A 5K36G 5GAEC 1I50B 1YJWA 1B4OA 4JC0A 2DJGC 2FMMA 4X65Q 1IL2A 5ISRA 2PI2A 1GUWA 3OTOL 1V1OA 2R7ZG 4K0KL 1F2MA 5DAUA 4LJZC 3FPUB 3RD4A 4A3JG 3H3VH 4A3GB 1HR0Q 2OF1A 1HR0W 1RD9D 4L5RC 2F0EA 4OELB 1ZYRD 3Q23A 1PTOD 5IYCH 1C48A 2VUMG 2A68C 2OWOA 4BY7B 4RKLA 1Y1VG 1WJJA 3DLLA 1J6QA 1JOOA 1H9KA 3SVMA 2M9VA 4YCUA 1BDOA 1U5KA 1SFOB 2D0PA 2ZJPA 2JYOA 1PRTB 1I4PA 2QKIC 4DXFA 4MIUA 3CCUA 2F0GA 4CDFC 3L9AX 1SYCA 3VYUA 1B53A 3SR1A 2DNEA 4ME5A 1K8AC 2A68D 2B3GA 2XTIA 1OXVA 4PZ7A 3UE0A 3NELA 2PZTA 2ES2A 3PUXA 5JJIA 4QIWE 4BBSB 4BBRB 1VQBA 1YVCA 4A3DG 2C35B 5M9OA 4P72A 4J8QA 2K04A 3HOYH 4EQOA 1UEBA 5A2QL 1MSGA 3W3AA 2PI2E 2HUGA 1IL8A 4N8X1 5M3FH 3QOLA 2A73B 2DY7A 1WTRA 2A6EC 3KLSA 4DR6Q 1YNND 2AWOA 2HQLA 3E9IA 4K2LA 1L1OB 3DEOA 4DR3Q 4JV5L 4A3DB 2I5LX 3CCSA 5C4ZA 2KEEA 3TZDA 1VQ7A 1AZQA 4NXMQ 3BVMA 4KY5A 3NWTA 3LWEA 2HCIA 1BF4A 1GM5A 3FKIH 2AWNA 4Z9CB 2RBMA 4KTAA 3HRZC 1RIPA 3MTSA 3VYRA 1NCVA 3DUZA 2JA5H 3P7JA 4DV1L 5IE8A 4DR5Q 1G8ZD 5A35A 2BE5D 1IW7D 2GA4B 1S5ED 3J7YW 5D3DA 2PW7A 1EOTA 2JXMB 3J81E 4IUVA 1TXYA 2WKDA 3ULPA 3T51B 4HIMA 1L1OC 2ZJQA 2WINB 4IFDI 2G9DA 2A6HC 1EL0A 3N6RA 4MHEA 1HQRD 4B3TL 4LF7L 5M5XH 4ZUJA 4DKAC 1B70B 3HG9A 5C4JB 1EY0A 4KHPQ 5CMDA 4RCNA 1JICA 3QB3A 1DJRD 4X3KA 4K6LA 1EQVA 3HKSA 5M5XB 4A93B 3DM3A 2JA8H 4GOPA 3NQIA 4FVMA 4IUNA 3ULJA 4JI8Q 2N55A 1BVSA 5K36H 3S24A 4IPGA 1L0WA 1I6HH 3OPOA 5M5WB 1EYDA 3I4NB 4PMWA 4PG3A 2OT2A 1MHWC 1RTOA 4WJ4A 1Y1WH 1TWAH 2PZUA 4O1NA 3RLOA 4MZ9A 1XYIA 5HURA 1EY5A 4X64L 3FDTA 4BY7H 3R8BA 2RDHA 2WV6D 4BWGB 2RCFA 1EY7A 1I3QB 2E2IH 2D0OA 3CCJA 4FYDA 5JVH3 3Q0AA 1V8QA 2CKZB 1JE4A 2K32A 3TN2A 2ID0A 2NN6H 3S17H 5GROA 4ZK9B 3H0GB 3F1ZA 2NWGA 2I46A 3D0FA 2A19A 4RH6A 5CV6A 2CFMA 1X3EA 4JI2Q 4OWTB 1V1PA 4HJ5A 4IQZA 1J5EQ 4HJ9A 5DLQE 3PGZA 3GO5A 1WTWA 2WB1B 2F4VL 5CGKA 4JI7Q 1TY2A 5EJWA 4DF7A 3HP3A 1B9NA 1CKOA 3K0XA 1HH2P 2FFKB 3G6JB 3RLNA 4MNOA 4A3GH 1QB5D 2PMZB 1WCMG 1PH9A 4OONA 4I7ZC 3C2PA 1OXSC 4TQUS 1ILPA 3K5MA 3CPWA 1GUGA 1EQTA 2NTSA 3AQQA 2ATWA 2HHHL 3NQTA 3S16B 1Q7YC 4A93G 1YNXA 4ME3A 3A74A 1B44D 1PTOH 4PZ6A 5C3WA 1STBA 4JBMA 3RZOH 4OO1G 2CQOA 1CQFA 1NY4A 1FGUA 3QIAA 2B63H 3I8ZA 4C2MH 1LT5D 1VQDA 2X6GA 3H3VC 5E4WC 4JI0L 1WTHA 1N32L 3MZ5A 5JAVA 3CXCA 2O4XA 1W6KA 4KMUC 3GTPH 4CDDC 1E1TA 4H02A 3FKIG 1JR0D 3MXPA 1IYJB 2XSCA 2EY1A 4KKSA 5C5MA 2F0NA 3C1EA 1EU3A 4LF7Q 2A74C 3TZUA 3GTOB 5C0XH 4B3ML 1H9SA 3AEVA 1F2YA 2M00A 3I4OA 3T1HL 4OWWB 5BR8L 1EWCA 3ERQA 2F0FA 2NYZD 2DGYA 5BN5A 1EY8A 2F3VA 5D65A 1FYCA 2O5IC 4HR7B 2XWJB 1XMQL 4DV2Q 1VF7A 3FMCA 1KQSA 1HFGA 3PIP3 4K5WA 2MJ8A 1FR3A 2K5VA 4H0LC 1LTLA 1PMRA 3HOWG 3NWSA 2NUCA 3OW2A 3CRLC 3KF8A 3M7GA 1I4GA 2KHIA 3WOFA 2UUCQ 4A3CG 1SE2A 1LTRD 4OO1H 2OXPA 5JPNC 1SNDA 4X62Q 1BR9A 4R4CA 1BBXC 2A6HD 1K0SA 4M1UB 1AFPA 2ZM6L 1GUNA 2E75C 3IKJA 3OHXC 5KEEA 4HIKA 1B50A 5J1ZA 3M4OB 2B2YC 1VQCA 4CKBA 1S5CD 3J80i 2K33A 1QE6A 4A3BB 3J7A5 1HA5A 5HGTA 1S4ZA 2LFNA 3MHBA 3F2UA 4UHVA 3C3LA 1NR4A 3I7FA 4Y7NB 1KRTA 4IURA 4UAIA 4XYQA 4Q0FA 2EPBA 4LMQD 3J80E 1TWHH 1UWVA 3I70A 4KHVA 1C0AA 3SK5A 5JVG3 3HOYB 2JQOA 2NVTB 3W2DA 5CV9A 3S2DH 1GJXA 2VQEL 2WP8J 1HUNA 4GLVB 1SEBD 2J0TD 1LLRD 3PO2H 3PSIA 2F1MA 1YNNC 5C44B 1QILA 1BNZA 3HOVB 4A3LG 2Y0SB 4KV6A 3OWFA 4JCVE 1PH5A 1EY4A 1D2BA 1GHKA 1QNKA 3GTKB 3CQZB 1C4QA 4HJAA 5JJLA 4K8JA 1TR5A 2UXDQ 3PF4A 2VZAA 3KYHC 3MXUA 4KN4C 2E8GA 1KLGD 1LTSD 3MWYW 4YWMA 1BCPB 5KNCA 3UDGA 1NUCA 4V190 4BY1H 3CCQA 4EGVA 4C56C 1STHA 4RCOA 1N33Q 3HOVG 3T4AC 1V1QA 3CCLA 4UP7A 3BDOA 1JJGA 1JCKB 4R4OA 2CCZA 2ZM6Q 1AP0A 2JA6H 4DUZL 2F0OA 1K8GA 1EIHA 2Q8RE 5C4XH 2ZTCA 3DWQA 3CAMA 4F8MA 2EY2A 3J81c 1S72A 2XVSA 4HIDA 2MO1A 4UY8C 5CV5A 3HOUB 2I5MX 1II3A 1Q82C 4ZQ3A 1SMXA 4IUUA 1FNUA 1F9RA 4X3TA 4DUZQ 5LMUL 1N8RC 5EAYA 4A3KH 5C6AA 2IHFA 4BBRH 5C0XI 4B3RL 1J9OA 1IBML 4HJ8A 4A3EH 4JI5Q 5LMNL 1O78A 3L7ZC 1F77A 4YCVA 5EKKA 3K81C 1Q8KA 1YBYA 3I4MH 4A3EB 3OYYA 4P75A 3TBIB 4B9XA 3S15H 4IFDH 1TWGB 1NR2A 1SNOA 1G2TA 1HXYD 1N34Q 1K3BC 1TWFB 1KLUD 5DM73 5AJ3Q 2Y0SG 3K58A 3U4ZA 1B7YB 2F0DA 5TSSA 4B9WA 3A7LA 4PV1C 2JA5B 1X55A 1F2LA 1CFMA 4A3CH 3OIPA 2JA6G 4QL5A 1PYWD 1CZGA 2R93H 1CKNA 2QW7A 1D7QA 5FLMH 5M3MG 3H94A 2Z1CA 2Z9HA 4DGZA 4B3TQ 1E24A 2KOLA 2EYPA 5CV4A 3H6MA 3TMEA 3M4OH 5HY6A 4H44C 1WTXA 4C3JB 5T1GA 1QZHA 4KKTA 5DM63 2E2DC 1LV9A 3K0YA 2UUBL 5FLXc 1EFWA 1HHVA 1YNJD 1UE6A 2EJMA 3J81i 3A0JA 5LHY1 4RA8A 3CCVA 1SN8A 1IBKL 4HMIA 3FP9A 1G2SA 3RNUA 3KBXA 1PV4A 2Z0SA 3CPFA 1VQGA 4IALA 1MI2A 3M9BA 1PH3A 4FF4A 4P71A 3HOVH 1X3GA 2CW0D 2KQ3A 2EXZA 1EFID 1VQAA 1K8OA 1EEID 4XQQA 1LT4D 1K8MA 3B6YA 4RHSA 2SOBA 2K5DA 2JJQA 1AW7A 5IT9c 2N78A 1STNA 1IYUA 2VQFL 2L5TA 5ELBA 2RSNA 2NVYB 4FO2A 2JA8G 2CW0C 1N34L 2UXBL 3A5ZB 4A3FB 2BA0A 4C3HG 3HKZG 1VQKA 1STEA 2DNCA 1SR3A 2XIWA 3OWEB 3E0EA 1M4VA 1VQNA 3VDYA 1WD0A 5KNBA 1KC8C 1VQOA 1R9TH 2BCOA 3I55A 4EQPA 2B2WA 5G3LF 3R2IA 2E2IB 1PFMA 5I2XA 1BBUA 1JJCB 4XYOA 2K1BA 1QUQB 1HTPA 1VQ8A 4JOIA 2B8GA 5E3FA 3R93A 2OTJA 4JI8L 1XTDA 5KIXA 3T53B 4A3MG 1BXTA 1Q8IA 1EZ6A 3VYSA 3BZKA 3EROA 1PFNA 1RTNA 4DK6C 2GN5A 4DNIA 4BA1I 4F7XA 4FNFA 5M3MH 3I90A 1I50H 1KABA 4BXXH 1IBKQ 2LMCB 2OTLA 1PH2A 2QDLA 1FJGQ 3D8GA 3CC7A 1A8VA 5IGBA 4JPBW 3L0OA 4XIGS 3F8TA 4JI0Q 3GTGB 4PMCA 3NHHA 3M4QA 1RHPA 5KRUA 1PH7A 3ZYYX 2F0MA 4LF5L 4A3MB 1X54A 1YHAA 3PUYA 2L0CA 1VQMA 4GZYC 2FJ2A 4ID6A 5M5WH 1LO5D 2IPKD 2VXWA 3JC66 3SE0A 2IHEA 1YITA 4TRDA 1VQFA 3T1HQ 3P1HA 4G57A 3K57A 2K5QA 2PW5A 2WKCA 3X3NA 3HOXG 1K3RA 1KXLA 5JJZA 4IUQA 1CT1D 3GD7A 3BZDB 3NPPA 3S2HH 5NUCA 4YY3Q 1TT2A 1EU4A 1XPOA 4CHTB 2R92H 1XPRA 4N9PA 1EWHA 1H9JA 2EYOA 1CUKA 2YU9H 4GN3B 3MEFA 1KNAA 5D3IB 3I2ZA 4KJOA 2XRSD 2RA4A 4R8IA 3IFDA 3SHLA 2FMCA 2QGQA 1Q90A 5G3LD 1ASZA 2VB2X 2DY8A 1RDPD 3PO3G 1TU2B 3K7AB 3GTJB 2RHSB 3T56B 1JB7A 5A2QE 2F0LA 4FP5D 3L2PA 3KLRA 1B9MA 4M8AA 4LF6Q 1PZID 2LXJA 3J7AV 5CBEE 1S3OA 4F87A 4A3JH 1W3SA 4K5XA 4CJ0B 3NTKA 4ZKCB 2I07B 3IL8A 4G7ZC 1GUSA 3OIQA 1L2FA 2CQAA 4GN5A 4DV5L 4J15A 3IFTA 1SYEA 1XX8A 2K6AA 1Q12A 2PMZE 2JP1A 2HDMA 4L63B 3U50C 4O42A 4EX5A 4GNXC 1ET9A 1NNXA 4DAVA 4DAYB 1B8AA 3UI2A 5IP9G 2K5WA 5KGUA 4A3LH 3UE1A 1KDCA 4RGNA 4A3IG 2H5XA 4P2CB 1WFQA 2R7FA 4ZYSA 2IX3A 3PO2G 2B2TC 2EY5A 5FJ8H 2EZVA 3CRKC 2DN8A 4DR4L 3F2DA 4X64Q 4DV3L 2VY3A 1JC7A 5FLXL 4B3RQ 2VW9A 2R7ZH 2Q2HA 2L12A 1WCMH 4AQYQ 3HGBA 3EA6A 4R4IA 5EPKA 3GTQB 3VR5A 1K83B 2QEJC 4DV6L 3HOZB 4LFBQ 2ZTEA 2B39A 4QB4A 3GTGH 4BXXG 3EIVA 1SMYC 1NJIC 3A8JE 1D6EC 1QWYA 2A5HA 4A3MH 5IP9H 1E3PA 1OXXK 4HEDA 5EKIA 2TMPA 3BZCA 3I72A 4DV4L 4PNYA 3S1QH 4RGOS 4GNXB 4NMZA 2F3IA 1FL0A 1XWEA 4LK1C 3KK7A 4DV0L 2K75A 5EBDA 2Z4HA 5I6YA 3IRBA 1MGSA 5JOBA 1A0IA 1V1PB 5GAHC 2F0WA 2KA7A 5C3EG 4LF6L 1KL9A 1SFOH 1BKBA 1OXUA 4KD3A 4WFN3 3P20A 4X6AH 1SDFA 1X56A 3J7ZC 3S1MH 3G4SA 1Y1WG 1E2VA 2PNHA 3DEPA 4C3JG 5FLXE 1HRJA 4DV5Q 2EYFA 1S5FD 1NAPA 4LF8L 2MGSA 4JI3Q 2UXCQ 4AQYL 2YYZA 5AJ3L 4POGA 1MJCA 2TSSA 5J3BA 5DEHA 1HUMA 2B2YA 3URYA 1RJTA 1ZXTA 4CDEC 5FOBB 1PYSB 5IT9L 3E6ZX 4GOPB 2K5NA 1WI5A 2F0IA 4U68A 4DR7L 2BE5C 4JI4Q 2IL8A 3S1RH 1XPUA 4FF2A 4V0BA 2PQAB 3EVQA 4JBWA 3A8KE 3H09A 3ULLA 3VYTA 2QCPX 5E7NA 2I5HA 1CSPA 2NVQB 2PNRC 2K03A 3RLFA 4AYBB 4KN7C 3M4PA 3S16H 1HZ9A 4DR7Q 2F0JA 5HGQA 1A3TA 1PRTD 4OXPA 5LL6S 4OX9Q 2CH4A 2Z8LA 1QNUA 3K80C 4XTCS 4H13C 4N9TA 3S9WA 2V1CC 2RCNA 2UU9Q 1BO0A 1QVFA 1IKMA 4IOCA 3V2TA 4BBRG 5IYBH 1E0BA 2IY5B 2F0HA 4QUCA 4RGTA 3O13A 1TS2A 4NP5A 4B3SQ 1PDQA 5C0XG 1ML0D 3J7AF 4LAAA 4YHHL 1SNQA 1T5XD 3CW2C 2B2VA 4DR4Q 2FHTA 1CKMA 4G7HC 1PTOC 1DZ1A 1N36Q 2JA7B 4TVAB 4R9WA 4K14A 4JYAL 2HIXA 2NBFA 1QJOA 3TP5A 4G4KA 1N9WA 3PCOB 3KOJA 1WD1A 3PO3B 4YHHQ 1PH6A 2NZ1D 5CORA 2QILA 2JEAI 4JBJA 1GXDC 1H9RA 2OQKA 1N36L 5IGGA 2IJ0A 2R61A 3CU7A 5CV7A 1K28A 4DR5L 4GS3A 4BBSG 3RZDH 2G9HD 2LSSA 1KNEA 3RUZA 1MD2D 5I9OA 4A4IA 1QOHA 3S1RB 1DONA 1XMOQ 1RCVD 3HOXB 3I4NH 1Y8NB 4A3DH 4FDBA 1D1IA 1VCIA 1VDZA 2N3SA 2SDFA 1RL2A 3NXWA 2ALYB 4C1NK 2LKVA 2UXDL 2WFWA 2EE1A 3VA5A 1J8IA 3H3VI 4BY7G 1EEFD 3TP8A 3GTLB 4H7BA 1G91A 5F2DA 3S1QB 2EYMA 1M90C 2L4NA 3TSSA 4XQNA 1HNXQ 4DAYA 1IW7C 3A55A 2AUKA 3DWPA 1LTID 2R6GA 5LMUQ 3QR8A 1N33L 1SMYD 2E5LL 3HOUG 1JB3A 1SYDA 3TS0A 1D1KA 2RSOA 5C3XA 5JJKA 1XXGA 1CHPD 1GO3E 3ND9A 1JE5A 2B2UA 1A2TA 3NSWA 4C1NI 3EQLC 2XGTA 2IX0A 4LFCQ 2J4XA 2NN6G 1WTQA 4QQBX 4GKJL 1U4LA 4B3SL 5C4XG 1JWSD 1F9PA 2Z4IA 4IPCA 1SNMA 5IODA 5C4JH 3CC4A 1UAPA 1B3AA 2PYKA 3VR4A 4YCWA 4ZAIA 3ND8A 4S3SA 3STBD 4JI6L 2A6ED 3DXJC 4XQJA 2E76C 3JAME 3G6EA 1YJNA 1EZ8A 1NBWA 4ZCKA 4Y52H 1B3QA 3PO2B 3HOZH 3TEHB 3H0GG 1L0YB 1I3QH 3KLWA 1H9MA 2F0TA 2AHOB 3LWUA 3CCEA 1S5BD 5EQ0A 1H9SB 1A62A 1ESFA 1U4RA 2BDNA 2EIFA 1HCZA 2WAQE 4A3IB 1EY6A 5FO9B 1X9NA 1TWAB 1EY9A 2MNAA 4DK1A 1QVCA 2A69D 4JVZA 4DFAA 5JEAG 4IPHA 3S2HB 3D4RA 4A76A 1LACA 3I4NG 4HSVA 2AUJD 4ZKBB 1Z6HA 1CZWA 1OTCA 1D5ZC 4IJHA 3E5SA 4DK3C 3U4VA 1SJED 4GKJQ 3SK4A 4DV7Q 3S14H 3KDFA 1STYA 4OIKA 3ER0A 5EGTA 3MXGA 4RAUC 4HN7A 5GQOA 1Y69U 1SJHD 2WIIB 4K5VA 2L9HA 2CVRA 4BBSH 3ITPA 5GAGC 1Q81C 4K0KQ 2ZTDA 3BYYB 5M3MB 1SNPA 3X3MA 5J22A 2VUMB 2ENBA 3QWNA 4R4QA 2R93G 2CH4W 3PUVA 3NEMA 3KFUA 4ZLTF 3W1BA 2KBNA 3QOJA 4FF1A 2RHQB 5CBAE 5COYA 1A6XA 4NPSA 1HNXL 1DM0B 2KUMA 1H95A 1R4QB 5E4XA 4KK7A 1UUPA 4IUPA 4X3SA 4BY1B 1CHQD 1XNRL 2IW3A 2R93B 4KKUA 4BS9A 4HIOA 1A3UA 1DD2A 1SROA 1WVLA 5IYDG 2PCFB 3P75A 4CDCC 3PUZA 3M3YH 4XT3B 1T9HA 4KD4A 1G291 2B63G 1E7ZA 1SYGA 1PFBA 3MA2B 4F88A 1ICWA 1VQJA 1TS4A 2WACA 1KHIA 2L11A 1PRTC 4PZ8A 1GKHA 2X69A 4NXML 1VQ6A 5GADC 3A8IE 1U9RA 1SYFA 4AYBG 3I4MG 4KY7A 1O7ZA 4KLKA 1V43A 2VS1A 1SBBB 3PF5A 2RVLA 1M1KC 2SEBD 3FPPA 2JA8B 1PLFA 4X66Q 4RMFA 5H1SE 4N8FA 4DNTB 1UE1A 3G71A 1MKHA 3R2TA 3ICEA 2XWBB 5IGDA 1WCMB 2D9UA 3STBC 1HNZQ 2R7ZB 3EBEA 1AN8A 4WJWA 1SNCA 3AFPA 1HQMC 1JT8A 1PZKD 3E9HA 5BN3A 4A93H 3G48A 1LTBD 4FXGC 2KCCA 4KHPL 1Q46A 4HMJA 4DXGA 4EQ5A 1GVPA 1F9QA 3G7LA 4X65L 5K5PA 1I94Q 3S17B 3R3OA 5ELDA 2MUYA 2F4VQ 5ELOA 2AQ3B 4A3JB 1TIID 1JORA 2GVAA 3M85A 1HNWQ 4FXKC 1XJVA 2Q8IB 1AE2A 2B29A 4A3FG 1MIUA 1WOCA 1PA6A 1I94L 1YNJC 3V05A 3MC0B 3C1FA 5I6WA 4RHRA 4ULLA 1I4XA 3TDQA 1W6JA 3LGJA 2DJFC 2ZXOA 2JEBI 5C4XB 2I0QA 1C9OA 4WRDA 1I6VC 4JYAQ 1QVGA 1TWCH 3CP0A 1STGA 2EVBA 3OOCA 4UDUC 1AZPA 1RF2D 3K6OA 4RWSC 4GNXA 2DUDA 1E1OA 2IX1A 1TKWB 3D3RA 1JWUD 2R92B 2JA9A 1QCBD 4IPDA 1XMQQ 1TWFH 3CKIB 2F0KA 4Q5VA 2YU9B 2EJGC 3OW7A 4C3IG 1WTOA 1T5EA 1X32A 3NENA 3KJOA 5CC4A 3M7NA 2YTVA 4UP8A 4JOIC 1LYLA 3BVGA 3L3OC 3D4DA 4JI7L 2Q2IA 4X66L 2YTYA 3I56A 1B1ZA 3K7UC 3FHWA 4NW2A 4MN3A 5IIFA 2M2LA 2BH2A 3GDEA 1Z9FA 1AE3A 1S40A 3T16A 5M5YB 2UXCL 2K4KA 2D62A 2AKWB 3OSOA 3Q24A 2O2LD 2LY7A 1FGBD 3KLSX 2HT1A 1NSNS 3HEJA 2O5JC 4GKKL 3VR6A 2EY6A 4DUYQ 4A75A 3S1MB 2EYLA 1ENAA 1D8LA 1WTPA 3GTMH 1CTMA 3GQBA 3BVZA 1A3VA 5IGFA 1ENCA 1IYVA 4DNRB 4LW1A 1MJEA 2QEXA 3RN5A 2Q2UA 1CI3M 1ENFA 3CCRA 4XDXA 5IWAL 5JPMC 2KEDA 3MFGA 1O80A 1STAA 1HZCA 2R3ZA 4KI0A 2R92G 3Q6SA 2HQEA 3PIOA 3JAMc 4KHZA 2K5HA 2L1BA 3E0JA 3KJPA 5BR8Q 3GTQH 2OCEA 4R4TA 1TQOA 3NBHB 1HZBA 5CR3A 4IFDG 4A3FH 3A54A 1HA6A 1IXRA 1BOSA 1VQ9A 3QJYA 1Z7TA 4DV3Q 3EJIA 4A3EG 1AEXA 2N88A 1E22A 1Y8OB 4DAPA 2AMCB 3U9SA 3CC2A 1PH4A 1Y1WB 3NE5B 2K01A 2K50A 4B08A 3Q22A 1X3QA 2E74C 4I65A 1ZKOA 1FVIA 2UU9L 3EFXD 2R7DA 2JK8A 3A56A 1U4PA 1EYAA 3HOZG 2NVXH 3DHQA 2FXQA 4OIJA 4YIJA 1LT6D 4DV6Q 4LFBL 4NKLA 2E2HB 4K6DA 4K2KA 1QG7A 2CWPA 3VR3A 4DR2Q 4X62L 2OQ0A 2V4DA 3KUPA 1SAPA 1BCPF 1EWIA 1TWHB 5C3EH 1D5XC 4GKKQ 4R1JA 2XRQD 1A15A 1KDAA 4A3GG 3TP6A 5ELCA 4HSPA 1EIGA 3CMAA 2EYHA 4IO9A 1I4HA 1CSQA 1FD7D 1X65A 5LL6X 1CK1A 4R8NA 1EUJA 4JI2L 4EVOA 1PHJA 1Z47A 4LF4L 2K14A 4O0AA 3K5OA 3HOWH 1Y1VH 2K52A 4OGQC 3FKIB 1E2ZA 1QZGA 2H4OA 4JI3L 1CA5A 3HKZB 3CCMA 3MEHA 2ICEC 1VQEA 5ELEA 2RDFA 4G7OC 4AH6A 2B2TA 1IBLL 1TS5A 2SNMA 1GOZA 4C2MB 2UUAL 1GUTA 3BDCA 5M5YH 3GTOH 2ASBA 2F0UA 2RQXA 4CJ1B 2UUBQ 4P73A 3J80c 4KY6A 2ZJRA 3TREA 3AMUA 4CGYB 2B2UC 1UE7A 4NXNQ 2AQ1B 2LS01 2SNSA 2NVXB 2HDLA 4IJLA 1BQQT 1PXUA 2P5ZX 3S14B 2KJXA 5T1IA 4LFAL 1OXTA 2F0SA 3J80L 5C44G 1RKNA 4DA2A 1NMGA 2KENA 1SSOA 2MQHA 4CKCA 4A3KB 3WDNA 1F2ZA 5FO8B 1VS0A 4U673 1LTAD 1ONLA 1XNRQ 1PTOB 2KCNA 4OX9L 2A69C 2MFIA 1CQVA 1KRSA 1BCPD 4WJ3M 2QA4A 2QDBA 1JJ2A 4O2DA 3U9OA 3HOWB 5IT9E 3H91A 2NVYH 5IYBG 3BDLA 4JI5L 5E1FA 4LUZA 4QF4A 4DV7L 4LF4Q 5KYLA 3HOXH 4QY7A 1I5FA 4DV2L 4JG2A 2CHBD 5DNFA 4EQNA 2JA7H 3FRPB 1HTLD 3KF8B 1IBMQ 1KAAA 4NXNL 3H0GH 5ELNA 1ICFB 1Y8PB 2KHSA 1LTGD 4IFDJ 4XT1B 1XMOL 4LUOA 4C3JH 2L15A 2CWAA 2HD3A 2E5LQ 1HFNA 1PVOA 1V9PA 1CKNB 2B2VC 3BU2A 1GHJA 4DAMA 1SE4A 2QF7A 1EOVA 4JW0A 3OTOQ 1PH1A 2NVTH 4DR6L 1LT3D 4ZRZA 1IZ6A 2F3WA 3GTMB 2EOTA 1I4QA 1QUQA 1VMCA 1MBYA 4NDXA 5IP7G 4DV1Q 2PQAA 2NN6I 1ET6A 5C44H 4X3UA 1MSHA 1RODA 2N8NA 3W5OA 3HOYG 1I6HB 4LFAQ 3DM1A 1E2WA 3FEWX 1VQ5A 1O7IA 1W2BA 3HZXA 3V96A 4RFBA 2XN9C 2KCTA 1JWMD 2C9OA 4POFA 3NUCA 3F2BA 5IOCA 2J7ZA 3GV6A 1KD1C 1K73C 4DU9A 3K8AA 4C3IB 1KDBA 1XTCD 2F0QA 5AFWA 2Q2TA 1WYDA 4HTHA 1Q86C 1PH8A 3A5UA 4I7AA 4LFCL 1X6OA 4AYBE 3F2CA 1TVXA 1VQ4A 1EQQA 1DYQA 1P8LA 2RKSA 1XNQQ 3N52A 1HJPA 1FNWA 3TP7A 1HZAA 4JK1C 4OEMB 2L55A 1ZYRC 4DV4Q 1VF5C 1KIXA 4ILWA 1C7YA 4OHJA 3SK6A 3J81L 1Q3LA 2LXKA 3TRZA 3UDFA 1Q1EA 3HOUH 1SRUA 4ZUIA 3D4WA 3MXNA 1OO9B 4HCSA 1TWCB 3T13A 4L5TA 2A1AA 3LNNA 5ELFA 3ZJYC 1L1OA 1UE5A 5CYUA 2RDGA 5BN4A 3JAMi 3VR2A 3NTHA 2F52A 4QMGA 1EQRA 5EPLA 3H15A 4WORA 2G5DA 3OMCA 3RMHA 2C5CA 4OO1I 5IGEA 1J5EL 2Z6BA 4NB3A 2HIVA 4HJ7A 1DOKA 5EKLA 2UXBQ 2D2CC 2EDGA 4YWLA 2Z6KA 3JAML 5IGCA 4OL7A 1EYCA 3HKZE 4UPAA 2JA5G 4CKEA 1LABA 3UDIA 1HR0L 4LF9L 3VA7A 5KNDA 2IWHA 2B63B 4YWKA 3RZOB 4IN3A 1ILQA 2AQ2B 2BDOA 3OMGA 1HNWL 5J39A 3EN2A 3AU7A 1EIFA 3SGIA 1D5MC 1C8CA 4GLXA 2BH8A 2JA6B 4J6HA 3CMEA 3PMFA 2X6LA 4PMBA 2JN4A 1JQYD 4LF5Q 5KYIA 3PO3H 5FK9C 3SEBA 2ZT9C 3NBHA 1FNVA 3SK8A 3RZDB 3WOEA 3CF5A 1IHZA 5C0XJ 1TY0A 3CHBD 1FJGL 1WTVA 4LNQA 4JBKA 3MXNB 3GTKH 5IYCG 5LMNW 2VUMH 4FXDA 1S5DD 4GOPC 2KCMA 2NZOA 3GTJH 2MHVA 4RG1A 3E3XA 2HCCA 2K7VA 3W1GA 4IZ8A 4YY3L 1CM9A 1K9MC 1DXMA 1LM0A 2E2JH 1GUOA 3ERSX 1VMPA 4DUYL 5JEAH 1L0XB 5CV8A 4APVA 3KBGA 3I91A 4DR1L 4DR3L 2HHHQ 1U4MA 4JV5Q 1LTTD 2NZHA 3PQIA 2KECA 3I3CA 3I4LA 3D6WA 4BY1G 2D5DA 2MPMA 1KTKA 4A3KG 2YV5A 3K59A 2E2HH 4DV0Q 1SE3A 4PQXA 2Y0SE 2Q8TA 2KVMA 2NB0A 3BJUA 3D6CA 4C3HB 4ALPA 2N49A 1Q1BA 2JSOA 3M4YA 1B2TA 5C4HA 1SE8A 2K28A 3BYTB 4C3HH 2BOSA 4J1MA 4TSSA 5L37A 2XNAC 1A2UA 1UNSA 5FJ8G 1K0RA 3PIPA 3I4MB 5IWAQ 1R4PB 1YJ9A 1PRTF 5FKAC 3S1NH 4JI1L 3J81j 3K7AH 3RN2A 2VNUD 4KJNA 1UEAB 2VQEQ 3HS0C 4FF3A 4QJFA 1BCPC 1DOLA 2EQSA 3GTLH 3A7AB 3I73A 2UUAQ 4DPGA 4A3IH 1ASYA 4BA2I 1PYBA 4IOAA 2KHJA 4L5SA 2F0VA 5EPJA 1N32Q 2H1EA 4LF9Q 2ZXPA 3NBIA 5IYDH 4IUTA 1YHQA 1SXTA 1EIYB 1YHBA 4LWCA 2E2JB 4CBVA 1LUZA 1JOKA 5IP7H 2VB3X 1SLJA 2ICIA 3DWAA 1YI2A 1NTGA 2YTXA 3KF6B 4QUFA 1SYBA 2F0PA 2EXDA 4JI6Q 2RF4A 4QIWB 3D31A 4A3BG 2NTTA 4HAEA 1DGSA 4DR1Q 1EYGA 2B2WC 4L5QA 3PV0A 1I4RA 2OEOA 5JEAJ 1AH9A 1YEZA 3GTPB 3QO2A 5M3FB 3T1YQ 1A63A 1G6ZA 1PZJD 5I9PA 2JA7G 3Q8DA 3CQZH 2ZXRA 1JOQA 4JI1Q 4TKOB 4DR2L 3RR5A 4ABNA 3CD6A 1U0LA 1BUVT 4OWXB 3U58A 5I2YA 3T1YL 2IT1A 4RGMA 2WAQG 3HFZB 1TWGH 4XXEA 2EYJA 3QG1A 4B3MQ 1VQPA 1K83H 3BS1A 1VQHA 2Z6KC 3AYHB 3K5LA 4ODGA 2K05A 4AIMA 2PZWA 1NMFA 5IY0A 3DMUA 2F4IA 4HCEA 3NTIA 4MTKA 1PFSA 1HPCA 3FVQA 3MAQA 4LUVA 2A8VA 5C5LA 4QGUA 3ONAB 4JI4L 5FLMG 1VQLA 3UDXA 1P16A 4QCLA 4UP9A 1KAWA 1ESRA 3AFQA 1YIJA 4GN4B 3NK9A 1M8AA 3KF6A 1XNQL 4DK0A 3SDZA 3MFYA 2PPBC 2MO0A 3M3YB 1DOMA 5D14A 4LF8Q 1ZEQX 3S2DB 4K8IA 2BA1A 4DN4M 4RKBA 2EJFC 1TS3A 1PTOF 5M3FG 1YZ6A 3BG3A 3K5NA 1IKLA 4GLAC 1BBWA 2WB1E 1VQIA 3NP8A 3TQYA 3TS2A 2PO4A 4E6IA 1O7LA 3S1NB 2GVBA 3AB9A 3WWVA 1Y14B 2B8FA 1CA6A 2WAQB 1Y1VB 5C3EB 5FO7B 3LX0A 4CJ2C 4MTNA 1JMCA 3GV3A 3S15B 5I4DA 2JE6I 2MP1A 2PQEA 5LMNQ 2NVQH 2FINB 1X3PA 4A3BH 4C3IH 3KDFB 1O7YA 1DCZA 3MVVA 4Y7NH 2WB1G 3PUWA 4L6TB 1G6PA 1NE3A 3IAYA 3SXHA 1F9SA 2VQFQ 1R9TB
chains in the Genus database with same CATH topology
2R6GA 1VS0A 4P74A 3K81C 1Q8KA 1X3FA 1YBYA 4YCVA 5LMUQ 2UUCL 1N33L 3I4MH 2E5LL 3OYYA 4P75A 1GD7A 3HOUG 1XNRQ 3S15H 1IBLQ 2VL6A 4OX9L 2MFIA 1N34Q 1KRSA 3TS0A 5AJ3Q 1G51A 1HNZL 2Y0SG 4WJ3M 3U4ZA 1B7YB 2QA4A 1JJ2A 5JJKA 1GO3E 4O2DA 5K36G 1JE5A 5GAEC 1X55A 2NVYH 2XGTA 5IYBG 2IX0A 4LFCQ 2NN6G 4QQBX 1YJWA 4JI5L 4A3CH 2JA6G 4JC0A 4QL5A 4GKJL 4LUZA 2R93H 1CKNA 1D7QA 4DV7L 4B3SL 4LF4Q 5FLMH 5M3MG 5C4XG 3HOXH 4QY7A 4X65Q 1IL2A 4IPCA 2PI2A 5C4JH 1I5FA 3OTOL 4B3TQ 1E24A 4DV2L 4JG2A 3CC4A 2R7ZG 4K0KL 4YCWA 4JI6L 5HY6A 3STBD 3KF8B 2JA7H 3M4OH 1IBMQ 4NXNL 3H0GH 5ELNA 1QZHA 3H3VH 4A3JG 3G6EA 1YJNA 1HR0W 1HR0Q 4L5RC 1NBWA 2UUBL 5FLXc 1EFWA 4IFDJ 1XMOL 1UE6A 4LUOA 4C3JH 2L15A 5IYCH 3J81i 2CWAA 3A0JA 2VUMG 3HOZH 2E5LQ 2OWOA 3CCVA 3TEHB 1PVOA 1SN8A 1V9PA 1IBKL 3FP9A 1CKNB 3H0GG 3BU2A 1Y1VG 3RNUA 1WJJA 1I3QH 3KLWA 3DLLA 2AHOB 1J6QA 4DAMA 3CCEA 1PV4A 2Z0SA 1EOVA 1PH1A 3OTOQ 2NVTH 4DR6L 3CPFA 1A62A 1U5KA 1VQGA 2EIFA 4YCUA 1IZ6A 3M9BA 1PH3A 2D0PA 2WAQE 2ZJPA 1QUQA 1X9NA 4P71A 3HOVH 1X3GA 2MNAA 3CCUA 5IP7G 4DV1Q 2PQAA 1QVCA 2NN6I 5C44H 1VQAA 5JEAG 4IPHA 1K8AC 3W5OA 2N8NA 4A76A 3I4NG 2B3GA 2XTIA 1OXVA 3HOYG 4PZ7A 3UE0A 4LFAQ 3NELA 1OTCA 4IJHA 3B6YA 2ES2A 3PUXA 5JJIA 4DK3C 3U4VA 1VQ5A 2JJQA 1O7IA 4QIWE 1W2BA 4GKJQ 4DV7Q 5IT9c 2N78A 3S14H 1VQBA 1YVCA 4A3DG 2KCTA 2C35B 2VQFL 4P72A 3KDFA 4POFA 3HOYH 3F2BA 1UEBA 3ER0A 1KD1C 2JA8G 2PI2E 5GQOA 1K73C 1N34L 3K8AA 2UXBL 3A5ZB 5M3FH 4BBSH 5GAGC 2BA0A 2Q2TA 4DR6Q 1WYDA 3HKZG 2AWOA 2HQLA 1Q81C 1VQKA 4K0KQ 2ZTDA 1Q86C 3E9IA 1PH8A 1SR3A 3A5UA 1L1OB 4LFCL 1X6OA 4AYBE 3F2CA 3E0EA 4R4QA 4DR3Q 3VDYA 1VQ4A 1EQQA 1VQNA 4JV5L 1P8LA 2R93G 1KC8C 2I5LX 3CCSA 1VQOA 1R9TH 1XNQQ 1HJPA 3I55A 3PUVA 3NEMA 1VQ7A 3KFUA 1HZAA 4NXMQ 1BBUA 1JJCB 3W1BA 2KBNA 4DV4Q 2RHQB 1QUQB 1KIXA 1GM5A 3FKIH 1C7YA 1VQ8A 4NPSA 4JOIA 1HNXL 2AWNA 1H95A 2OTJA 4JI8L 1XTDA 4A3MG 3TRZA 2LXKA 3UDFA 1RIPA 3BZKA 4DK6C 1Q1EA 3HOUH 2GN5A 1SRUA 4DNIA 4BA1I 5M3MH 4BXXH 1XNRL 1I50H 2JA5H 1IBKQ 4DV1L 4HIOA 5IE8A 1PH2A 2OTLA 4DR5Q 1FJGQ 1SROA 3CC7A 5IYDG 1A8VA 2A1AA 4L5TA 3PUZA 3L0OA 4XIGS 3ZJYC 3M3YH 3F8TA 4JI0Q 1L1OA 1TXYA 1UE5A 3ULPA 1T9HA 3JAMi 4HIMA 1G291 3M4QA 2B63G 2F52A 1E7ZA 1L1OC 2ZJQA 1PH7A 1EQRA 4LF5L 3H15A 1VQJA 1X54A 1YHAA 3PUYA 4IFDI 4OO1I 1KHIA 1VQMA 1J5EL 4PZ8A 1GKHA 4NXML 4B3TL 1VQ6A 4NB3A 5GADC 2HIVA 5M5WH 4HJ7A 4LF7L 4AYBG 3I4MG 3JC66 5M5XH 4KLKA 2UXBQ 4DKAC 2IHEA 1B70B 4YWLA 1V43A 2Z6KA 2VS1A 1YITA 3HKZE 4UPAA 3PF5A 2JA5G 4KHPQ 1M1KC 1VQFA 3UDIA 3T1HQ 1HR0L 4LF9L 4X66Q 4RMFA 4YWKA 5H1SE 1UE1A 3G71A 1MKHA 3HOXG 1KXLA 1K3RA 3HKSA 1HNWL 3DM3A 2JA8H 3ICEA 3EN2A 1EIFA 3GD7A 3SGIA 3STBC 4GOPA 1HNZQ 3EBEA 3S2HH 4YY3Q 4GLXA 2BH8A 3ULJA 4JI8Q 1BVSA 3AFPA 3S24A 4IPGA 1L0WA 1I6HH 1XPOA 2R92H 1JT8A 3CMEA 3E9HA 4PMWA 4PG3A 1XPRA 4A93H 3G48A 4WJ4A 1Y1WH 1CUKA 1TWAH 2YU9H 4LF5Q 4KHPL 1Q46A 4EQ5A 3PO3H 4GN3B 3MEFA 3RLOA 1GVPA 4MZ9A 1I94Q 4X65L 3I2ZA 4X64L 2F4VQ 4BY7H 5ELOA 2GVAA 2QGQA 3CF5A 3M85A 1HNWQ 1ASZA 2E2IH 1XJVA 2D0OA 5C0XJ 3CCJA 1FJGL 1AE2A 4LNQA 3PO3G 2B29A 2CKZB 1MIUA 4A3FG 1WOCA 2ID0A 4JBKA 3S17H 3MXNB 5GROA 1PA6A 1I94L 2RHSB 3F1ZA 3GTKH 5IYCG 5LMNW 3D0FA 2A19A 1JB7A 2VUMH 2CFMA 4GOPC 1X3EA 4JI2Q 2KCMA 4OWTB 2NZOA 3L2PA 3GTJH 4HJ5A 3LGJA 4RG1A 2JEBI 1J5EQ 4LF6Q 4HJ9A 5DLQE 1C9OA 3PGZA 3W1GA 2I0QA 3GO5A 2LXJA 4YY3L 2F4VL 4JYAQ 1QVGA 1TWCH 1S3OA 3CP0A 1K9MC 1LM0A 2E2JH 4JI7Q 4DR4L 3ERSX 4DUYL 4A3JH 1W3SA 1CKOA 4GNXA 3K0XA 1HH2P 2DUDA 1E1OA 4DR3L 4APVA 4DR1L 2IX1A 3RLNA 2HHHQ 4JV5Q 1L2FA 2JA9A 4GN5A 4MNOA 4A3GH 2NZHA 1WCMG 4IPDA 4DV5L 1XMQQ 4J15A 1TWFH 1PH9A 4OONA 1Q12A 1OXSC 2PMZE 4TQUS 4BY1G 4A3KG 3CPWA 3U50C 3NENA 4EX5A 2YV5A 3KJOA 4GNXC 3M7NA 3AQQA 2YTVA 2E2HH 2ATWA 2HHHL 4UP8A 4JOIC 1B8AA 4DAYB 4DV0Q 5IP9G 1LYLA 1Q7YC 4A93G 2Y0SE 4JI7L 2Q2IA 4A3LH 3UE1A 1YNXA 4X66L 4ME3A 3A74A 2YTYA 4PZ6A 3I56A 4A3IG 2H5XA 3K7UC 3BJUA 1WFQA 2R7FA 4JBMA 3RZOH 3PO2G 2CQOA 3FHWA 4OO1G 1NY4A 4ALPA 5FJ8H 2N49A 1Q1BA 1FGUA 2B63H 1SE8A 4C2MH 1VQDA 3F2DA 4X64Q 2BH2A 4DV3L 3GDEA 2VY3A 1Z9FA 1AE3A 1S40A 4B3RQ 4C3HH 2VW9A 2R7ZH 4JI0L 1N32L 2Q2HA 2UXCL 1WCMH 4AQYQ 2K4KA 3CXCA 2D62A 4R4IA 2AKWB 5FJ8G 1K0RA 3PIPA 3GTPH 4DV6L 5IWAQ 1E1TA 4LFBQ 1YJ9A 2ZTEA 4H02A 3GTGH 4BXXG 3FKIG 3EIVA 4JI1L 3S1NH 3J81j 2HT1A 3K7AH 3RN2A 2VNUD 1IYJB 2VQEQ 1NJIC 4QJFA 4A3MH 5IP9H 1E3PA 4GKKL 4DUYQ 2EQSA 1OXXK 4A75A 4LF7Q 3GTLH 3BZCA 4DV4L 2UUAQ 3S1QH 1D8LA 4GNXB 4DPGA 2F3IA 1FL0A 4A3IH 4B3ML 3GTMH 1ASYA 3AEVA 4LW1A 4BA2I 1PYBA 4DV0L 4IOAA 2K75A 2KHJA 3I4OA 3T1HL 4L5SA 4OWWB 5BR8L 1N32Q 1MJEA 4LF9Q 5IYDH 3IRBA 2QEXA 3RN5A 2DGYA 1YHQA 1EIYB 1YHBA 4LWCA 2Q2UA 1A0IA 3CCRA 1LUZA 5IP7H 5IWAL 5GAHC 1SLJA 4Y52H 1XMQL 1YI2A 1NTGA 2YTXA 3KF6B 5C3EG 4DV2Q 1KQSA 1HZCA 1KL9A 1BKBA 1OXUA 1SFOH 4LF6L 4X6AH 4KI0A 2EXDA 4JI6Q 2RF4A 2R92G 2K5VA 1X56A 3D31A 1LTLA 3J7ZC 3HOWG 4A3BG 3S1MH 3G4SA 3OW2A 1Y1WG 3PIOA 1DGSA 2KHIA 4DR1Q 1EYGA 2PNHA 4L5QA 2UUCQ 3JAMc 3PV0A 4KHZA 2K5HA 3KJPA 4A3CG 5JEAJ 5BR8Q 4X62Q 2OCEA 4R4TA 4R4CA 4DV5Q 3GTQH 3NBHB 1HZBA 1AH9A 1YEZA 4IFDG 4LF8L 2ZM6L 3T1YQ 4A3FH 4JI3Q 4HIKA 2UXCQ 4AQYL 1A63A 1IXRA 2YYZA 5AJ3L 1VQ9A 1MJCA 4POGA 5J3BA 1VQCA 4DV3Q 2JA7G 3Q8DA 3J80i 4A3EG 3CQZH 4JI1Q 1E22A 3J7A5 4DR2L 1PYSB 2AMCB 3RR5A 3CD6A 1U0LA 4OWXB 3CC2A 3U58A 4GOPB 3T1YL 2IT1A 1WI5A 2K5NA 2WAQG 1PH4A 3HFZB 1TWGH 2K50A 4DR7L 4JI4Q 3I7FA 3S1RH 1VQPA 1K83H 4B3MQ 1XPUA 1FVIA 2UU9L 1KRTA 1VQHA 2Z6KC 2PQAB 2R7DA 4JBWA 2JK8A 3ULLA 3AYHB 3HOZG 5E7NA 2I5HA 1CSPA 2NVXH 4AIMA 1TWHH 3RLFA 1UWVA 2FXQA 1NMFA 3M4PA 1C0AA 3S16H 1HZ9A 5IY0A 4DR7Q 2JQOA 4DV6Q 4LFBL 5HGQA 4DR2Q 2CWPA 1PFSA 4X62L 4LUVA 2A8VA 4OXPA 2VQEL 2OQ0A 4QGUA 4OX9Q 3S2DH 1EWIA 3K80C 5C3EH 2WP8J 4XTCS 4GKKQ 4R1JA 4JI4L 2V1CC 2RCNA 4GLVB 4A3GG 5FLMG 1VQLA 3UDXA 1P16A 2UU9Q 1QVFA 4IOCA 3PO2H 3PSIA 4UP9A 1KAWA 3CMAA 3AFQA 4IO9A 4BBRG 1YIJA 5IYBH 4A3LG 2IY5B 1CSQA 4GN4B 1X65A 4JCVE 1PH5A 1EUJA 4JI2L 3KF6A 1Z47A 1PHJA 4B3SQ 4LF4L 2K14A 4O0AA 5C0XG 1XNQL 4HJAA 5JJLA 4YHHL 2UXDQ 3CW2C 3HOWH 3PF4A 2VZAA 3KYHC 1Y1VH 2K52A 2MO0A 1CKMA 4DR4Q 2E8GA 1N36Q 4LF8Q 4TVAB 1QZGA 4JYAL 4YWMA 2HIXA 4JI3L 2BA1A 3CCMA 3UDGA 1VQEA 1N9WA 3PCOB 4BY1H 3KOJA 3CCQA 1YZ6A 5M3FG 4YHHQ 3HOVG 1N33Q 1PH6A 4AH6A 1V1QA 3CCLA 4UP7A 4GLAC 2JEAI 1BBWA 4JBJA 4R4OA 1JJGA 2OQKA 2WB1E 1VQIA 3TQYA 1N36L 1IBLL 2CCZA 3TS2A 2ZM6Q 4DR5L 2JA6H 4GS3A 4DUZL 1K8GA 2UUAL 4BBSG 3RZDH 2GVBA 2ZTCA 3CAMA 5C4XH 5M5YH 2LSSA 3WWVA 1Y14B 2ASBA 3GTOH 4A4IA 3J81c 1S72A 2UUBQ 4HIDA 2MO1A 4MTNA 4P73A 1XMOQ 3J80c 2ZJRA 1JMCA 4UY8C 3TREA 2JE6I 3I4NH 4A3DH 4FDBA 1VCIA 1UE7A 2I5MX 2N3SA 1Q82C 1RL2A 4NXNQ 5LMNQ 1SMXA 2NVQH 2ALYB 4DUZQ 4IJLA 4A3BH 5LMUL 1N8RC 4C3IH 3KDFB 5EAYA 2WFWA 2UXDL 4A3KH 2IHFA 4BBRH 5C0XI 4Y7NH 3H3VI 4BY7G 4B3RL 4LFAL 1OXTA 1IBML 2WB1G 3PUWA 5C44G 1M90C 1NMGA 2KENA 4HJ8A 2MQHA 4A3EH 1HNXQ 4JI5Q 1G6PA 1NE3A 5LMNL 3L7ZC 2VQFQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R6G A;  1VS0 A;  4P74 A;  3K81 C;  1Q8K A;  1X3F A;  1YBY A;  4YCV A;  5LMU Q;  2UUC L;  1N33 L;  3I4M H;  2E5L L;  3OYY A;  4P75 A;  1GD7 A;  3HOU G;  1XNR Q;  3S15 H;  1IBL Q;  2VL6 A;  4OX9 L;  2MFI A;  1N34 Q;  1KRS A;  3TS0 A;  5AJ3 Q;  1G51 A;  1HNZ L;  2Y0S G;  4WJ3 M;  3U4Z A;  1B7Y B;  2QA4 A;  1JJ2 A;  5JJK A;  1GO3 E;  4O2D A;  5K36 G;  1JE5 A;  5GAE C;  1X55 A;  2NVY H;  2XGT A;  5IYB G;  2IX0 A;  4LFC Q;  2NN6 G;  4QQB X;  1YJW A;  4JI5 L;  4A3C H;  2JA6 G;  4JC0 A;  4QL5 A;  4GKJ L;  4LUZ A;  2R93 H;  1CKN A;  1D7Q A;  4DV7 L;  4B3S L;  4LF4 Q;  5FLM H;  5M3M G;  5C4X G;  3HOX H;  4QY7 A;  4X65 Q;  1IL2 A;  4IPC A;  2PI2 A;  5C4J H;  1I5F A;  3OTO L;  4B3T Q;  1E24 A;  4DV2 L;  4JG2 A;  3CC4 A;  2R7Z G;  4K0K L;  4YCW A;  4JI6 L;  5HY6 A;  3STB D;  3KF8 B;  2JA7 H;  3M4O H;  1IBM Q;  4NXN L;  3H0G H;  5ELN A;  1QZH A;  3H3V H;  4A3J G;  3G6E A;  1YJN A;  1HR0 W;  1HR0 Q;  4L5R C;  1NBW A;  2UUB L;  5FLX c;  1EFW A;  4IFD J;  1XMO L;  1UE6 A;  4LUO A;  4C3J H;  2L15 A;  5IYC H;  3J81 i;  2CWA A;  3A0J A;  2VUM G;  3HOZ H;  2E5L Q;  2OWO A;  3CCV A;  3TEH B;  1PVO A;  1SN8 A;  1V9P A;  1IBK L;  3FP9 A;  1CKN B;  3H0G G;  3BU2 A;  1Y1V G;  3RNU A;  1WJJ A;  1I3Q H;  3KLW A;  3DLL A;  2AHO B;  1J6Q A;  4DAM A;  3CCE A;  1PV4 A;  2Z0S A;  1EOV A;  1PH1 A;  3OTO Q;  2NVT H;  4DR6 L;  3CPF A;  1A62 A;  1U5K A;  1VQG A;  2EIF A;  4YCU A;  1IZ6 A;  3M9B A;  1PH3 A;  2D0P A;  2WAQ E;  2ZJP A;  1QUQ A;  1X9N A;  4P71 A;  3HOV H;  1X3G A;  2MNA A;  3CCU A;  5IP7 G;  4DV1 Q;  2PQA A;  1QVC A;  2NN6 I;  5C44 H;  1VQA A;  5JEA G;  4IPH A;  1K8A C;  3W5O A;  2N8N A;  4A76 A;  3I4N G;  2B3G A;  2XTI A;  1OXV A;  3HOY G;  4PZ7 A;  3UE0 A;  4LFA Q;  3NEL A;  1OTC A;  4IJH A;  3B6Y A;  2ES2 A;  3PUX A;  5JJI A;  4DK3 C;  3U4V A;  1VQ5 A;  2JJQ A;  1O7I A;  4QIW E;  1W2B A;  4GKJ Q;  4DV7 Q;  5IT9 c;  2N78 A;  3S14 H;  1VQB A;  1YVC A;  4A3D G;  2KCT A;  2C35 B;  2VQF L;  4P72 A;  3KDF A;  4POF A;  3HOY H;  3F2B A;  1UEB A;  3ER0 A;  1KD1 C;  2JA8 G;  2PI2 E;  5GQO A;  1K73 C;  1N34 L;  3K8A A;  2UXB L;  3A5Z B;  5M3F H;  4BBS H;  5GAG C;  2BA0 A;  2Q2T A;  4DR6 Q;  1WYD A;  3HKZ G;  2AWO A;  2HQL A;  1Q81 C;  1VQK A;  4K0K Q;  2ZTD A;  1Q86 C;  3E9I A;  1PH8 A;  1SR3 A;  3A5U A;  1L1O B;  4LFC L;  1X6O A;  4AYB E;  3F2C A;  3E0E A;  4R4Q A;  4DR3 Q;  3VDY A;  1VQ4 A;  1EQQ A;  1VQN A;  4JV5 L;  1P8L A;  2R93 G;  1KC8 C;  2I5L X;  3CCS A;  1VQO A;  1R9T H;  1XNQ Q;  1HJP A;  3I55 A;  3PUV A;  3NEM A;  1VQ7 A;  3KFU A;  1HZA A;  4NXM Q;  1BBU A;  1JJC B;  3W1B A;  2KBN A;  4DV4 Q;  2RHQ B;  1QUQ B;  1KIX A;  1GM5 A;  3FKI H;  1C7Y A;  1VQ8 A;  4NPS A;  4JOI A;  1HNX L;  2AWN A;  1H95 A;  2OTJ A;  4JI8 L;  1XTD A;  4A3M G;  3TRZ A;  2LXK A;  3UDF A;  1RIP A;  3BZK A;  4DK6 C;  1Q1E A;  3HOU H;  2GN5 A;  1SRU A;  4DNI A;  4BA1 I;  5M3M H;  4BXX H;  1XNR L;  1I50 H;  2JA5 H;  1IBK Q;  4DV1 L;  4HIO A;  5IE8 A;  1PH2 A;  2OTL A;  4DR5 Q;  1FJG Q;  1SRO A;  3CC7 A;  5IYD G;  1A8V A;  2A1A A;  4L5T A;  3PUZ A;  3L0O A;  4XIG S;  3ZJY C;  3M3Y H;  3F8T A;  4JI0 Q;  1L1O A;  1TXY A;  1UE5 A;  3ULP A;  1T9H A;  3JAM i;  4HIM A;  1G29 1;  3M4Q A;  2B63 G;  2F52 A;  1E7Z A;  1L1O C;  2ZJQ A;  1PH7 A;  1EQR A;  4LF5 L;  3H15 A;  1VQJ A;  1X54 A;  1YHA A;  3PUY A;  4IFD I;  4OO1 I;  1KHI A;  1VQM A;  1J5E L;  4PZ8 A;  1GKH A;  4NXM L;  4B3T L;  1VQ6 A;  4NB3 A;  5GAD C;  2HIV A;  5M5W H;  4HJ7 A;  4LF7 L;  4AYB G;  3I4M G;  3JC6 6;  5M5X H;  4KLK A;  2UXB Q;  4DKA C;  2IHE A;  1B70 B;  4YWL A;  1V43 A;  2Z6K A;  2VS1 A;  1YIT A;  3HKZ E;  4UPA A;  3PF5 A;  2JA5 G;  4KHP Q;  1M1K C;  1VQF A;  3UDI A;  3T1H Q;  1HR0 L;  4LF9 L;  4X66 Q;  4RMF A;  4YWK A;  5H1S E;  1UE1 A;  3G71 A;  1MKH A;  3HOX G;  1KXL A;  1K3R A;  3HKS A;  1HNW L;  3DM3 A;  2JA8 H;  3ICE A;  3EN2 A;  1EIF A;  3GD7 A;  3SGI A;  3STB C;  4GOP A;  1HNZ Q;  3EBE A;  3S2H H;  4YY3 Q;  4GLX A;  2BH8 A;  3ULJ A;  4JI8 Q;  1BVS A;  3AFP A;  3S24 A;  4IPG A;  1L0W A;  1I6H H;  1XPO A;  2R92 H;  1JT8 A;  3CME A;  3E9H A;  4PMW A;  4PG3 A;  1XPR A;  4A93 H;  3G48 A;  4WJ4 A;  1Y1W H;  1CUK A;  1TWA H;  2YU9 H;  4LF5 Q;  4KHP L;  1Q46 A;  4EQ5 A;  3PO3 H;  4GN3 B;  3MEF A;  3RLO A;  1GVP A;  4MZ9 A;  1I94 Q;  4X65 L;  3I2Z A;  4X64 L;  2F4V Q;  4BY7 H;  5ELO A;  2GVA A;  2QGQ A;  3CF5 A;  3M85 A;  1HNW Q;  1ASZ A;  2E2I H;  1XJV A;  2D0O A;  5C0X J;  3CCJ A;  1FJG L;  1AE2 A;  4LNQ A;  3PO3 G;  2B29 A;  2CKZ B;  1MIU A;  4A3F G;  1WOC A;  2ID0 A;  4JBK A;  3S17 H;  3MXN B;  5GRO A;  1PA6 A;  1I94 L;  2RHS B;  3F1Z A;  3GTK H;  5IYC G;  5LMN W;  3D0F A;  2A19 A;  1JB7 A;  2VUM H;  2CFM A;  4GOP C;  1X3E A;  4JI2 Q;  2KCM A;  4OWT B;  2NZO A;  3L2P A;  3GTJ H;  4HJ5 A;  3LGJ A;  4RG1 A;  2JEB I;  1J5E Q;  4LF6 Q;  4HJ9 A;  5DLQ E;  1C9O A;  3PGZ A;  3W1G A;  2I0Q A;  3GO5 A;  2LXJ A;  4YY3 L;  2F4V L;  4JYA Q;  1QVG A;  1TWC H;  1S3O A;  3CP0 A;  1K9M C;  1LM0 A;  2E2J H;  4JI7 Q;  4DR4 L;  3ERS X;  4DUY L;  4A3J H;  1W3S A;  1CKO A;  4GNX A;  3K0X A;  1HH2 P;  2DUD A;  1E1O A;  4DR3 L;  4APV A;  4DR1 L;  2IX1 A;  3RLN A;  2HHH Q;  4JV5 Q;  1L2F A;  2JA9 A;  4GN5 A;  4MNO A;  4A3G H;  2NZH A;  1WCM G;  4IPD A;  4DV5 L;  1XMQ Q;  4J15 A;  1TWF H;  1PH9 A;  4OON A;  1Q12 A;  1OXS C;  2PMZ E;  4TQU S;  4BY1 G;  4A3K G;  3CPW A;  3U50 C;  3NEN A;  4EX5 A;  2YV5 A;  3KJO A;  4GNX C;  3M7N A;  3AQQ A;  2YTV A;  2E2H H;  2ATW A;  2HHH L;  4UP8 A;  4JOI C;  1B8A A;  4DAY B;  4DV0 Q;  5IP9 G;  1LYL A;  1Q7Y C;  4A93 G;  2Y0S E;  4JI7 L;  2Q2I A;  4A3L H;  3UE1 A;  1YNX A;  4X66 L;  4ME3 A;  3A74 A;  2YTY A;  4PZ6 A;  3I56 A;  4A3I G;  2H5X A;  3K7U C;  3BJU A;  1WFQ A;  2R7F A;  4JBM A;  3RZO H;  3PO2 G;  2CQO A;  3FHW A;  4OO1 G;  1NY4 A;  4ALP A;  5FJ8 H;  2N49 A;  1Q1B A;  1FGU A;  2B63 H;  1SE8 A;  4C2M H;  1VQD A;  3F2D A;  4X64 Q;  2BH2 A;  4DV3 L;  3GDE A;  2VY3 A;  1Z9F A;  1AE3 A;  1S40 A;  4B3R Q;  4C3H H;  2VW9 A;  2R7Z H;  4JI0 L;  1N32 L;  2Q2H A;  2UXC L;  1WCM H;  4AQY Q;  2K4K A;  3CXC A;  2D62 A;  4R4I A;  2AKW B;  5FJ8 G;  1K0R A;  3PIP A;  3GTP H;  4DV6 L;  5IWA Q;  1E1T A;  4LFB Q;  1YJ9 A;  2ZTE A;  4H02 A;  3GTG H;  4BXX G;  3FKI G;  3EIV A;  4JI1 L;  3S1N H;  3J81 j;  2HT1 A;  3K7A H;  3RN2 A;  2VNU D;  1IYJ B;  2VQE Q;  1NJI C;  4QJF A;  4A3M H;  5IP9 H;  1E3P A;  4GKK L;  4DUY Q;  2EQS A;  1OXX K;  4A75 A;  4LF7 Q;  3GTL H;  3BZC A;  4DV4 L;  2UUA Q;  3S1Q H;  1D8L A;  4GNX B;  4DPG A;  2F3I A;  1FL0 A;  4A3I H;  4B3M L;  3GTM H;  1ASY A;  3AEV A;  4LW1 A;  4BA2 I;  1PYB A;  4DV0 L;  4IOA A;  2K75 A;  2KHJ A;  3I4O A;  3T1H L;  4L5S A;  4OWW B;  5BR8 L;  1N32 Q;  1MJE A;  4LF9 Q;  5IYD H;  3IRB A;  2QEX A;  3RN5 A;  2DGY A;  1YHQ A;  1EIY B;  1YHB A;  4LWC A;  2Q2U A;  1A0I A;  3CCR A;  1LUZ A;  5IP7 H;  5IWA L;  5GAH C;  1SLJ A;  4Y52 H;  1XMQ L;  1YI2 A;  1NTG A;  2YTX A;  3KF6 B;  5C3E G;  4DV2 Q;  1KQS A;  1HZC A;  1KL9 A;  1BKB A;  1OXU A;  1SFO H;  4LF6 L;  4X6A H;  4KI0 A;  2EXD A;  4JI6 Q;  2RF4 A;  2R92 G;  2K5V A;  1X56 A;  3D31 A;  1LTL A;  3J7Z C;  3HOW G;  4A3B G;  3S1M H;  3G4S A;  3OW2 A;  1Y1W G;  3PIO A;  1DGS A;  2KHI A;  4DR1 Q;  1EYG A;  2PNH A;  4L5Q A;  2UUC Q;  3JAM c;  3PV0 A;  4KHZ A;  2K5H A;  3KJP A;  4A3C G;  5JEA J;  5BR8 Q;  4X62 Q;  2OCE A;  4R4T A;  4R4C A;  4DV5 Q;  3GTQ H;  3NBH B;  1HZB A;  1AH9 A;  1YEZ A;  4IFD G;  4LF8 L;  2ZM6 L;  3T1Y Q;  4A3F H;  4JI3 Q;  4HIK A;  2UXC Q;  4AQY L;  1A63 A;  1IXR A;  2YYZ A;  5AJ3 L;  1VQ9 A;  1MJC A;  4POG A;  5J3B A;  1VQC A;  4DV3 Q;  2JA7 G;  3Q8D A;  3J80 i;  4A3E G;  3CQZ H;  4JI1 Q;  1E22 A;  3J7A 5;  4DR2 L;  1PYS B;  2AMC B;  3RR5 A;  3CD6 A;  1U0L A;  4OWX B;  3CC2 A;  3U58 A;  4GOP B;  3T1Y L;  2IT1 A;  1WI5 A;  2K5N A;  2WAQ G;  1PH4 A;  3HFZ B;  1TWG H;  2K50 A;  4DR7 L;  4JI4 Q;  3I7F A;  3S1R H;  1VQP A;  1K83 H;  4B3M Q;  1XPU A;  1FVI A;  2UU9 L;  1KRT A;  1VQH A;  2Z6K C;  2PQA B;  2R7D A;  4JBW A;  2JK8 A;  3ULL A;  3AYH B;  3HOZ G;  5E7N A;  2I5H A;  1CSP A;  2NVX H;  4AIM A;  1TWH H;  3RLF A;  1UWV A;  2FXQ A;  1NMF A;  3M4P A;  1C0A A;  3S16 H;  1HZ9 A;  5IY0 A;  4DR7 Q;  2JQO A;  4DV6 Q;  4LFB L;  5HGQ A;  4DR2 Q;  2CWP A;  1PFS A;  4X62 L;  4LUV A;  2A8V A;  4OXP A;  2VQE L;  2OQ0 A;  4QGU A;  4OX9 Q;  3S2D H;  1EWI A;  3K80 C;  5C3E H;  2WP8 J;  4XTC S;  4GKK Q;  4R1J A;  4JI4 L;  2V1C C;  2RCN A;  4GLV B;  4A3G G;  5FLM G;  1VQL A;  3UDX A;  1P16 A;  2UU9 Q;  1QVF A;  4IOC A;  3PO2 H;  3PSI A;  4UP9 A;  1KAW A;  3CMA A;  3AFQ A;  4IO9 A;  4BBR G;  1YIJ A;  5IYB H;  4A3L G;  2IY5 B;  1CSQ A;  4GN4 B;  1X65 A;  4JCV E;  1PH5 A;  1EUJ A;  4JI2 L;  3KF6 A;  1Z47 A;  1PHJ A;  4B3S Q;  4LF4 L;  2K14 A;  4O0A A;  5C0X G;  1XNQ L;  4HJA A;  5JJL A;  4YHH L;  2UXD Q;  3CW2 C;  3HOW H;  3PF4 A;  2VZA A;  3KYH C;  1Y1V H;  2K52 A;  2MO0 A;  1CKM A;  4DR4 Q;  2E8G A;  1N36 Q;  4LF8 Q;  4TVA B;  1QZG A;  4JYA L;  4YWM A;  2HIX A;  4JI3 L;  2BA1 A;  3CCM A;  3UDG A;  1VQE A;  1N9W A;  3PCO B;  4BY1 H;  3KOJ A;  3CCQ A;  1YZ6 A;  5M3F G;  4YHH Q;  3HOV G;  1N33 Q;  1PH6 A;  4AH6 A;  1V1Q A;  3CCL A;  4UP7 A;  4GLA C;  2JEA I;  1BBW A;  4JBJ A;  4R4O A;  1JJG A;  2OQK A;  2WB1 E;  1VQI A;  3TQY A;  1N36 L;  1IBL L;  2CCZ A;  3TS2 A;  2ZM6 Q;  4DR5 L;  2JA6 H;  4GS3 A;  4DUZ L;  1K8G A;  2UUA L;  4BBS G;  3RZD H;  2GVB A;  2ZTC A;  3CAM A;  5C4X H;  5M5Y H;  2LSS A;  3WWV A;  1Y14 B;  2ASB A;  3GTO H;  4A4I A;  3J81 c;  1S72 A;  2UUB Q;  4HID A;  2MO1 A;  4MTN A;  4P73 A;  1XMO Q;  3J80 c;  2ZJR A;  1JMC A;  4UY8 C;  3TRE A;  2JE6 I;  3I4N H;  4A3D H;  4FDB A;  1VCI A;  1UE7 A;  2I5M X;  2N3S A;  1Q82 C;  1RL2 A;  4NXN Q;  5LMN Q;  1SMX A;  2NVQ H;  2ALY B;  4DUZ Q;  4IJL A;  4A3B H;  5LMU L;  1N8R C;  4C3I H;  3KDF B;  5EAY A;  2WFW A;  2UXD L;  4A3K H;  2IHF A;  4BBR H;  5C0X I;  4Y7N H;  3H3V I;  4BY7 G;  4B3R L;  4LFA L;  1OXT A;  1IBM L;  2WB1 G;  3PUW A;  5C44 G;  1M90 C;  1NMG A;  2KEN A;  4HJ8 A;  2MQH A;  4A3E H;  1HNX Q;  4JI5 Q;  1G6P A;  1NE3 A;  5LMN L;  3L7Z C;  2VQF Q; 
#chains in the Genus database with same CATH topology
 4P74 A;  2UUC L;  1X3F A;  3GP7 A;  4L8J A;  3PIO 3;  1GD7 A;  5EBC A;  1IBL Q;  3C46 A;  2VL6 A;  1G51 A;  1HNZ L;  2F03 A;  5K36 G;  5GAE C;  1I50 B;  1YJW A;  1B4O A;  4JC0 A;  2DJG C;  2FMM A;  4X65 Q;  1IL2 A;  5ISR A;  2PI2 A;  1GUW A;  3OTO L;  1V1O A;  2R7Z G;  4K0K L;  1F2M A;  5DAU A;  4LJZ C;  3FPU B;  3RD4 A;  4A3J G;  3H3V H;  4A3G B;  1HR0 Q;  2OF1 A;  1HR0 W;  1RD9 D;  4L5R C;  2F0E A;  4OEL B;  1ZYR D;  3Q23 A;  1PTO D;  5IYC H;  1C48 A;  2VUM G;  2A68 C;  2OWO A;  4BY7 B;  4RKL A;  1Y1V G;  1WJJ A;  3DLL A;  1J6Q A;  1JOO A;  1H9K A;  3SVM A;  2M9V A;  4YCU A;  1BDO A;  1U5K A;  1SFO B;  2D0P A;  2ZJP A;  2JYO A;  1PRT B;  1I4P A;  2QKI C;  4DXF A;  4MIU A;  3CCU A;  2F0G A;  4CDF C;  3L9A X;  1SYC A;  3VYU A;  1B53 A;  3SR1 A;  2DNE A;  4ME5 A;  1K8A C;  2A68 D;  2B3G A;  2XTI A;  1OXV A;  4PZ7 A;  3UE0 A;  3NEL A;  2PZT A;  2ES2 A;  3PUX A;  5JJI A;  4QIW E;  4BBS B;  4BBR B;  1VQB A;  1YVC A;  4A3D G;  2C35 B;  5M9O A;  4P72 A;  4J8Q A;  2K04 A;  3HOY H;  4EQO A;  1UEB A;  5A2Q L;  1MSG A;  3W3A A;  2PI2 E;  2HUG A;  1IL8 A;  4N8X 1;  5M3F H;  3QOL A;  2A73 B;  2DY7 A;  1WTR A;  2A6E C;  3KLS A;  4DR6 Q;  1YNN D;  2AWO A;  2HQL A;  3E9I A;  4K2L A;  1L1O B;  3DEO A;  4DR3 Q;  4JV5 L;  4A3D B;  2I5L X;  3CCS A;  5C4Z A;  2KEE A;  3TZD A;  1VQ7 A;  1AZQ A;  4NXM Q;  3BVM A;  4KY5 A;  3NWT A;  3LWE A;  2HCI A;  1BF4 A;  1GM5 A;  3FKI H;  2AWN A;  4Z9C B;  2RBM A;  4KTA A;  3HRZ C;  1RIP A;  3MTS A;  3VYR A;  1NCV A;  3DUZ A;  2JA5 H;  3P7J A;  4DV1 L;  5IE8 A;  4DR5 Q;  1G8Z D;  5A35 A;  2BE5 D;  1IW7 D;  2GA4 B;  1S5E D;  3J7Y W;  5D3D A;  2PW7 A;  1EOT A;  2JXM B;  3J81 E;  4IUV A;  1TXY A;  2WKD A;  3ULP A;  3T51 B;  4HIM A;  1L1O C;  2ZJQ A;  2WIN B;  4IFD I;  2G9D A;  2A6H C;  1EL0 A;  3N6R A;  4MHE A;  1HQR D;  4B3T L;  4LF7 L;  5M5X H;  4ZUJ A;  4DKA C;  1B70 B;  3HG9 A;  5C4J B;  1EY0 A;  4KHP Q;  5CMD A;  4RCN A;  1JIC A;  3QB3 A;  1DJR D;  4X3K A;  4K6L A;  1EQV A;  3HKS A;  5M5X B;  4A93 B;  3DM3 A;  2JA8 H;  4GOP A;  3NQI A;  4FVM A;  4IUN A;  3ULJ A;  4JI8 Q;  2N55 A;  1BVS A;  5K36 H;  3S24 A;  4IPG A;  1L0W A;  1I6H H;  3OPO A;  5M5W B;  1EYD A;  3I4N B;  4PMW A;  4PG3 A;  2OT2 A;  1MHW C;  1RTO A;  4WJ4 A;  1Y1W H;  1TWA H;  2PZU A;  4O1N A;  3RLO A;  4MZ9 A;  1XYI A;  5HUR A;  1EY5 A;  4X64 L;  3FDT A;  4BY7 H;  3R8B A;  2RDH A;  2WV6 D;  4BWG B;  2RCF A;  1EY7 A;  1I3Q B;  2E2I H;  2D0O A;  3CCJ A;  4FYD A;  5JVH 3;  3Q0A A;  1V8Q A;  2CKZ B;  1JE4 A;  2K32 A;  3TN2 A;  2ID0 A;  2NN6 H;  3S17 H;  5GRO A;  4ZK9 B;  3H0G B;  3F1Z A;  2NWG A;  2I46 A;  3D0F A;  2A19 A;  4RH6 A;  5CV6 A;  2CFM A;  1X3E A;  4JI2 Q;  4OWT B;  1V1P A;  4HJ5 A;  4IQZ A;  1J5E Q;  4HJ9 A;  5DLQ E;  3PGZ A;  3GO5 A;  1WTW A;  2WB1 B;  2F4V L;  5CGK A;  4JI7 Q;  1TY2 A;  5EJW A;  4DF7 A;  3HP3 A;  1B9N A;  1CKO A;  3K0X A;  1HH2 P;  2FFK B;  3G6J B;  3RLN A;  4MNO A;  4A3G H;  1QB5 D;  2PMZ B;  1WCM G;  1PH9 A;  4OON A;  4I7Z C;  3C2P A;  1OXS C;  4TQU S;  1ILP A;  3K5M A;  3CPW A;  1GUG A;  1EQT A;  2NTS A;  3AQQ A;  2ATW A;  2HHH L;  3NQT A;  3S16 B;  1Q7Y C;  4A93 G;  1YNX A;  4ME3 A;  3A74 A;  1B44 D;  1PTO H;  4PZ6 A;  5C3W A;  1STB A;  4JBM A;  3RZO H;  4OO1 G;  2CQO A;  1CQF A;  1NY4 A;  1FGU A;  3QIA A;  2B63 H;  3I8Z A;  4C2M H;  1LT5 D;  1VQD A;  2X6G A;  3H3V C;  5E4W C;  4JI0 L;  1WTH A;  1N32 L;  3MZ5 A;  5JAV A;  3CXC A;  2O4X A;  1W6K A;  4KMU C;  3GTP H;  4CDD C;  1E1T A;  4H02 A;  3FKI G;  1JR0 D;  3MXP A;  1IYJ B;  2XSC A;  2EY1 A;  4KKS A;  5C5M A;  2F0N A;  3C1E A;  1EU3 A;  4LF7 Q;  2A74 C;  3TZU A;  3GTO B;  5C0X H;  4B3M L;  1H9S A;  3AEV A;  1F2Y A;  2M00 A;  3I4O A;  3T1H L;  4OWW B;  5BR8 L;  1EWC A;  3ERQ A;  2F0F A;  2NYZ D;  2DGY A;  5BN5 A;  1EY8 A;  2F3V A;  5D65 A;  1FYC A;  2O5I C;  4HR7 B;  2XWJ B;  1XMQ L;  4DV2 Q;  1VF7 A;  3FMC A;  1KQS A;  1HFG A;  3PIP 3;  4K5W A;  2MJ8 A;  1FR3 A;  2K5V A;  4H0L C;  1LTL A;  1PMR A;  3HOW G;  3NWS A;  2NUC A;  3OW2 A;  3CRL C;  3KF8 A;  3M7G A;  1I4G A;  2KHI A;  3WOF A;  2UUC Q;  4A3C G;  1SE2 A;  1LTR D;  4OO1 H;  2OXP A;  5JPN C;  1SND A;  4X62 Q;  1BR9 A;  4R4C A;  1BBX C;  2A6H D;  1K0S A;  4M1U B;  1AFP A;  2ZM6 L;  1GUN A;  2E75 C;  3IKJ A;  3OHX C;  5KEE A;  4HIK A;  1B50 A;  5J1Z A;  3M4O B;  2B2Y C;  1VQC A;  4CKB A;  1S5C D;  3J80 i;  2K33 A;  1QE6 A;  4A3B B;  3J7A 5;  1HA5 A;  5HGT A;  1S4Z A;  2LFN A;  3MHB A;  3F2U A;  4UHV A;  3C3L A;  1NR4 A;  3I7F A;  4Y7N B;  1KRT A;  4IUR A;  4UAI A;  4XYQ A;  4Q0F A;  2EPB A;  4LMQ D;  3J80 E;  1TWH H;  1UWV A;  3I70 A;  4KHV A;  1C0A A;  3SK5 A;  5JVG 3;  3HOY B;  2JQO A;  2NVT B;  3W2D A;  5CV9 A;  3S2D H;  1GJX A;  2VQE L;  2WP8 J;  1HUN A;  4GLV B;  1SEB D;  2J0T D;  1LLR D;  3PO2 H;  3PSI A;  2F1M A;  1YNN C;  5C44 B;  1QIL A;  1BNZ A;  3HOV B;  4A3L G;  2Y0S B;  4KV6 A;  3OWF A;  4JCV E;  1PH5 A;  1EY4 A;  1D2B A;  1GHK A;  1QNK A;  3GTK B;  3CQZ B;  1C4Q A;  4HJA A;  5JJL A;  4K8J A;  1TR5 A;  2UXD Q;  3PF4 A;  2VZA A;  3KYH C;  3MXU A;  4KN4 C;  2E8G A;  1KLG D;  1LTS D;  3MWY W;  4YWM A;  1BCP B;  5KNC A;  3UDG A;  1NUC A;  4V19 0;  4BY1 H;  3CCQ A;  4EGV A;  4C56 C;  1STH A;  4RCO A;  1N33 Q;  3HOV G;  3T4A C;  1V1Q A;  3CCL A;  4UP7 A;  3BDO A;  1JJG A;  1JCK B;  4R4O A;  2CCZ A;  2ZM6 Q;  1AP0 A;  2JA6 H;  4DUZ L;  2F0O A;  1K8G A;  1EIH A;  2Q8R E;  5C4X H;  2ZTC A;  3DWQ A;  3CAM A;  4F8M A;  2EY2 A;  3J81 c;  1S72 A;  2XVS A;  4HID A;  2MO1 A;  4UY8 C;  5CV5 A;  3HOU B;  2I5M X;  1II3 A;  1Q82 C;  4ZQ3 A;  1SMX A;  4IUU A;  1FNU A;  1F9R A;  4X3T A;  4DUZ Q;  5LMU L;  1N8R C;  5EAY A;  4A3K H;  5C6A A;  2IHF A;  4BBR H;  5C0X I;  4B3R L;  1J9O A;  1IBM L;  4HJ8 A;  4A3E H;  4JI5 Q;  5LMN L;  1O78 A;  3L7Z C;  1F77 A;  4YCV A;  5EKK A;  3K81 C;  1Q8K A;  1YBY A;  3I4M H;  4A3E B;  3OYY A;  4P75 A;  3TBI B;  4B9X A;  3S15 H;  4IFD H;  1TWG B;  1NR2 A;  1SNO A;  1G2T A;  1HXY D;  1N34 Q;  1K3B C;  1TWF B;  1KLU D;  5DM7 3;  5AJ3 Q;  2Y0S G;  3K58 A;  3U4Z A;  1B7Y B;  2F0D A;  5TSS A;  4B9W A;  3A7L A;  4PV1 C;  2JA5 B;  1X55 A;  1F2L A;  1CFM A;  4A3C H;  3OIP A;  2JA6 G;  4QL5 A;  1PYW D;  1CZG A;  2R93 H;  1CKN A;  2QW7 A;  1D7Q A;  5FLM H;  5M3M G;  3H94 A;  2Z1C A;  2Z9H A;  4DGZ A;  4B3T Q;  1E24 A;  2KOL A;  2EYP A;  5CV4 A;  3H6M A;  3TME A;  3M4O H;  5HY6 A;  4H44 C;  1WTX A;  4C3J B;  5T1G A;  1QZH A;  4KKT A;  5DM6 3;  2E2D C;  1LV9 A;  3K0Y A;  2UUB L;  5FLX c;  1EFW A;  1HHV A;  1YNJ D;  1UE6 A;  2EJM A;  3J81 i;  3A0J A;  5LHY 1;  4RA8 A;  3CCV A;  1SN8 A;  1IBK L;  4HMI A;  3FP9 A;  1G2S A;  3RNU A;  3KBX A;  1PV4 A;  2Z0S A;  3CPF A;  1VQG A;  4IAL A;  1MI2 A;  3M9B A;  1PH3 A;  4FF4 A;  4P71 A;  3HOV H;  1X3G A;  2CW0 D;  2KQ3 A;  2EXZ A;  1EFI D;  1VQA A;  1K8O A;  1EEI D;  4XQQ A;  1LT4 D;  1K8M A;  3B6Y A;  4RHS A;  2SOB A;  2K5D A;  2JJQ A;  1AW7 A;  5IT9 c;  2N78 A;  1STN A;  1IYU A;  2VQF L;  2L5T A;  5ELB A;  2RSN A;  2NVY B;  4FO2 A;  2JA8 G;  2CW0 C;  1N34 L;  2UXB L;  3A5Z B;  4A3F B;  2BA0 A;  4C3H G;  3HKZ G;  1VQK A;  1STE A;  2DNC A;  1SR3 A;  2XIW A;  3OWE B;  3E0E A;  1M4V A;  1VQN A;  3VDY A;  1WD0 A;  5KNB A;  1KC8 C;  1VQO A;  1R9T H;  2BCO A;  3I55 A;  4EQP A;  2B2W A;  5G3L F;  3R2I A;  2E2I B;  1PFM A;  5I2X A;  1BBU A;  1JJC B;  4XYO A;  2K1B A;  1QUQ B;  1HTP A;  1VQ8 A;  4JOI A;  2B8G A;  5E3F A;  3R93 A;  2OTJ A;  4JI8 L;  1XTD A;  5KIX A;  3T53 B;  4A3M G;  1BXT A;  1Q8I A;  1EZ6 A;  3VYS A;  3BZK A;  3ERO A;  1PFN A;  1RTN A;  4DK6 C;  2GN5 A;  4DNI A;  4BA1 I;  4F7X A;  4FNF A;  5M3M H;  3I90 A;  1I50 H;  1KAB A;  4BXX H;  1IBK Q;  2LMC B;  2OTL A;  1PH2 A;  2QDL A;  1FJG Q;  3D8G A;  3CC7 A;  1A8V A;  5IGB A;  4JPB W;  3L0O A;  4XIG S;  3F8T A;  4JI0 Q;  3GTG B;  4PMC A;  3NHH A;  3M4Q A;  1RHP A;  5KRU A;  1PH7 A;  3ZYY X;  2F0M A;  4LF5 L;  4A3M B;  1X54 A;  1YHA A;  3PUY A;  2L0C A;  1VQM A;  4GZY C;  2FJ2 A;  4ID6 A;  5M5W H;  1LO5 D;  2IPK D;  2VXW A;  3JC6 6;  3SE0 A;  2IHE A;  1YIT A;  4TRD A;  1VQF A;  3T1H Q;  3P1H A;  4G57 A;  3K57 A;  2K5Q A;  2PW5 A;  2WKC A;  3X3N A;  3HOX G;  1K3R A;  1KXL A;  5JJZ A;  4IUQ A;  1CT1 D;  3GD7 A;  3BZD B;  3NPP A;  3S2H H;  5NUC A;  4YY3 Q;  1TT2 A;  1EU4 A;  1XPO A;  4CHT B;  2R92 H;  1XPR A;  4N9P A;  1EWH A;  1H9J A;  2EYO A;  1CUK A;  2YU9 H;  4GN3 B;  3MEF A;  1KNA A;  5D3I B;  3I2Z A;  4KJO A;  2XRS D;  2RA4 A;  4R8I A;  3IFD A;  3SHL A;  2FMC A;  2QGQ A;  1Q90 A;  5G3L D;  1ASZ A;  2VB2 X;  2DY8 A;  1RDP D;  3PO3 G;  1TU2 B;  3K7A B;  3GTJ B;  2RHS B;  3T56 B;  1JB7 A;  5A2Q E;  2F0L A;  4FP5 D;  3L2P A;  3KLR A;  1B9M A;  4M8A A;  4LF6 Q;  1PZI D;  2LXJ A;  3J7A V;  5CBE E;  1S3O A;  4F87 A;  4A3J H;  1W3S A;  4K5X A;  4CJ0 B;  3NTK A;  4ZKC B;  2I07 B;  3IL8 A;  4G7Z C;  1GUS A;  3OIQ A;  1L2F A;  2CQA A;  4GN5 A;  4DV5 L;  4J15 A;  3IFT A;  1SYE A;  1XX8 A;  2K6A A;  1Q12 A;  2PMZ E;  2JP1 A;  2HDM A;  4L63 B;  3U50 C;  4O42 A;  4EX5 A;  4GNX C;  1ET9 A;  1NNX A;  4DAV A;  4DAY B;  1B8A A;  3UI2 A;  5IP9 G;  2K5W A;  5KGU A;  4A3L H;  3UE1 A;  1KDC A;  4RGN A;  4A3I G;  2H5X A;  4P2C B;  1WFQ A;  2R7F A;  4ZYS A;  2IX3 A;  3PO2 G;  2B2T C;  2EY5 A;  5FJ8 H;  2EZV A;  3CRK C;  2DN8 A;  4DR4 L;  3F2D A;  4X64 Q;  4DV3 L;  2VY3 A;  1JC7 A;  5FLX L;  4B3R Q;  2VW9 A;  2R7Z H;  2Q2H A;  2L12 A;  1WCM H;  4AQY Q;  3HGB A;  3EA6 A;  4R4I A;  5EPK A;  3GTQ B;  3VR5 A;  1K83 B;  2QEJ C;  4DV6 L;  3HOZ B;  4LFB Q;  2ZTE A;  2B39 A;  4QB4 A;  3GTG H;  4BXX G;  3EIV A;  1SMY C;  1NJI C;  3A8J E;  1D6E C;  1QWY A;  2A5H A;  4A3M H;  5IP9 H;  1E3P A;  1OXX K;  4HED A;  5EKI A;  2TMP A;  3BZC A;  3I72 A;  4DV4 L;  4PNY A;  3S1Q H;  4RGO S;  4GNX B;  4NMZ A;  2F3I A;  1FL0 A;  1XWE A;  4LK1 C;  3KK7 A;  4DV0 L;  2K75 A;  5EBD A;  2Z4H A;  5I6Y A;  3IRB A;  1MGS A;  5JOB A;  1A0I A;  1V1P B;  5GAH C;  2F0W A;  2KA7 A;  5C3E G;  4LF6 L;  1KL9 A;  1SFO H;  1BKB A;  1OXU A;  4KD3 A;  4WFN 3;  3P20 A;  4X6A H;  1SDF A;  1X56 A;  3J7Z C;  3S1M H;  3G4S A;  1Y1W G;  1E2V A;  2PNH A;  3DEP A;  4C3J G;  5FLX E;  1HRJ A;  4DV5 Q;  2EYF A;  1S5F D;  1NAP A;  4LF8 L;  2MGS A;  4JI3 Q;  2UXC Q;  4AQY L;  2YYZ A;  5AJ3 L;  4POG A;  1MJC A;  2TSS A;  5J3B A;  5DEH A;  1HUM A;  2B2Y A;  3URY A;  1RJT A;  1ZXT A;  4CDE C;  5FOB B;  1PYS B;  5IT9 L;  3E6Z X;  4GOP B;  2K5N A;  1WI5 A;  2F0I A;  4U68 A;  4DR7 L;  2BE5 C;  4JI4 Q;  2IL8 A;  3S1R H;  1XPU A;  4FF2 A;  4V0B A;  2PQA B;  3EVQ A;  4JBW A;  3A8K E;  3H09 A;  3ULL A;  3VYT A;  2QCP X;  5E7N A;  2I5H A;  1CSP A;  2NVQ B;  2PNR C;  2K03 A;  3RLF A;  4AYB B;  4KN7 C;  3M4P A;  3S16 H;  1HZ9 A;  4DR7 Q;  2F0J A;  5HGQ A;  1A3T A;  1PRT D;  4OXP A;  5LL6 S;  4OX9 Q;  2CH4 A;  2Z8L A;  1QNU A;  3K80 C;  4XTC S;  4H13 C;  4N9T A;  3S9W A;  2V1C C;  2RCN A;  2UU9 Q;  1BO0 A;  1QVF A;  1IKM A;  4IOC A;  3V2T A;  4BBR G;  5IYB H;  1E0B A;  2IY5 B;  2F0H A;  4QUC A;  4RGT A;  3O13 A;  1TS2 A;  4NP5 A;  4B3S Q;  1PDQ A;  5C0X G;  1ML0 D;  3J7A F;  4LAA A;  4YHH L;  1SNQ A;  1T5X D;  3CW2 C;  2B2V A;  4DR4 Q;  2FHT A;  1CKM A;  4G7H C;  1PTO C;  1DZ1 A;  1N36 Q;  2JA7 B;  4TVA B;  4R9W A;  4K14 A;  4JYA L;  2HIX A;  2NBF A;  1QJO A;  3TP5 A;  4G4K A;  1N9W A;  3PCO B;  3KOJ A;  1WD1 A;  3PO3 B;  4YHH Q;  1PH6 A;  2NZ1 D;  5COR A;  2QIL A;  2JEA I;  4JBJ A;  1GXD C;  1H9R A;  2OQK A;  1N36 L;  5IGG A;  2IJ0 A;  2R61 A;  3CU7 A;  5CV7 A;  1K28 A;  4DR5 L;  4GS3 A;  4BBS G;  3RZD H;  2G9H D;  2LSS A;  1KNE A;  3RUZ A;  1MD2 D;  5I9O A;  4A4I A;  1QOH A;  3S1R B;  1DON A;  1XMO Q;  1RCV D;  3HOX B;  3I4N H;  1Y8N B;  4A3D H;  4FDB A;  1D1I A;  1VCI A;  1VDZ A;  2N3S A;  2SDF A;  1RL2 A;  3NXW A;  2ALY B;  4C1N K;  2LKV A;  2UXD L;  2WFW A;  2EE1 A;  3VA5 A;  1J8I A;  3H3V I;  4BY7 G;  1EEF D;  3TP8 A;  3GTL B;  4H7B A;  1G91 A;  5F2D A;  3S1Q B;  2EYM A;  1M90 C;  2L4N A;  3TSS A;  4XQN A;  1HNX Q;  4DAY A;  1IW7 C;  3A55 A;  2AUK A;  3DWP A;  1LTI D;  2R6G A;  5LMU Q;  3QR8 A;  1N33 L;  1SMY D;  2E5L L;  3HOU G;  1JB3 A;  1SYD A;  3TS0 A;  1D1K A;  2RSO A;  5C3X A;  5JJK A;  1XXG A;  1CHP D;  1GO3 E;  3ND9 A;  1JE5 A;  2B2U A;  1A2T A;  3NSW A;  4C1N I;  3EQL C;  2XGT A;  2IX0 A;  4LFC Q;  2J4X A;  2NN6 G;  1WTQ A;  4QQB X;  4GKJ L;  1U4L A;  4B3S L;  5C4X G;  1JWS D;  1F9P A;  2Z4I A;  4IPC A;  1SNM A;  5IOD A;  5C4J H;  3CC4 A;  1UAP A;  1B3A A;  2PYK A;  3VR4 A;  4YCW A;  4ZAI A;  3ND8 A;  4S3S A;  3STB D;  4JI6 L;  2A6E D;  3DXJ C;  4XQJ A;  2E76 C;  3JAM E;  3G6E A;  1YJN A;  1EZ8 A;  1NBW A;  4ZCK A;  4Y52 H;  1B3Q A;  3PO2 B;  3HOZ H;  3TEH B;  3H0G G;  1L0Y B;  1I3Q H;  3KLW A;  1H9M A;  2F0T A;  2AHO B;  3LWU A;  3CCE A;  1S5B D;  5EQ0 A;  1H9S B;  1A62 A;  1ESF A;  1U4R A;  2BDN A;  2EIF A;  1HCZ A;  2WAQ E;  4A3I B;  1EY6 A;  5FO9 B;  1X9N A;  1TWA B;  1EY9 A;  2MNA A;  4DK1 A;  1QVC A;  2A69 D;  4JVZ A;  4DFA A;  5JEA G;  4IPH A;  3S2H B;  3D4R A;  4A76 A;  1LAC A;  3I4N G;  4HSV A;  2AUJ D;  4ZKB B;  1Z6H A;  1CZW A;  1OTC A;  1D5Z C;  4IJH A;  3E5S A;  4DK3 C;  3U4V A;  1SJE D;  4GKJ Q;  3SK4 A;  4DV7 Q;  3S14 H;  3KDF A;  1STY A;  4OIK A;  3ER0 A;  5EGT A;  3MXG A;  4RAU C;  4HN7 A;  5GQO A;  1Y69 U;  1SJH D;  2WII B;  4K5V A;  2L9H A;  2CVR A;  4BBS H;  3ITP A;  5GAG C;  1Q81 C;  4K0K Q;  2ZTD A;  3BYY B;  5M3M B;  1SNP A;  3X3M A;  5J22 A;  2VUM B;  2ENB A;  3QWN A;  4R4Q A;  2R93 G;  2CH4 W;  3PUV A;  3NEM A;  3KFU A;  4ZLT F;  3W1B A;  2KBN A;  3QOJ A;  4FF1 A;  2RHQ B;  5CBA E;  5COY A;  1A6X A;  4NPS A;  1HNX L;  1DM0 B;  2KUM A;  1H95 A;  1R4Q B;  5E4X A;  4KK7 A;  1UUP A;  4IUP A;  4X3S A;  4BY1 B;  1CHQ D;  1XNR L;  2IW3 A;  2R93 B;  4KKU A;  4BS9 A;  4HIO A;  1A3U A;  1DD2 A;  1SRO A;  1WVL A;  5IYD G;  2PCF B;  3P75 A;  4CDC C;  3PUZ A;  3M3Y H;  4XT3 B;  1T9H A;  4KD4 A;  1G29 1;  2B63 G;  1E7Z A;  1SYG A;  1PFB A;  3MA2 B;  4F88 A;  1ICW A;  1VQJ A;  1TS4 A;  2WAC A;  1KHI A;  2L11 A;  1PRT C;  4PZ8 A;  1GKH A;  2X69 A;  4NXM L;  1VQ6 A;  5GAD C;  3A8I E;  1U9R A;  1SYF A;  4AYB G;  3I4M G;  4KY7 A;  1O7Z A;  4KLK A;  1V43 A;  2VS1 A;  1SBB B;  3PF5 A;  2RVL A;  1M1K C;  2SEB D;  3FPP A;  2JA8 B;  1PLF A;  4X66 Q;  4RMF A;  5H1S E;  4N8F A;  4DNT B;  1UE1 A;  3G71 A;  1MKH A;  3R2T A;  3ICE A;  2XWB B;  5IGD A;  1WCM B;  2D9U A;  3STB C;  1HNZ Q;  2R7Z B;  3EBE A;  1AN8 A;  4WJW A;  1SNC A;  3AFP A;  1HQM C;  1JT8 A;  1PZK D;  3E9H A;  5BN3 A;  4A93 H;  3G48 A;  1LTB D;  4FXG C;  2KCC A;  4KHP L;  1Q46 A;  4HMJ A;  4DXG A;  4EQ5 A;  1GVP A;  1F9Q A;  3G7L A;  4X65 L;  5K5P A;  1I94 Q;  3S17 B;  3R3O A;  5ELD A;  2MUY A;  2F4V Q;  5ELO A;  2AQ3 B;  4A3J B;  1TII D;  1JOR A;  2GVA A;  3M85 A;  1HNW Q;  4FXK C;  1XJV A;  2Q8I B;  1AE2 A;  2B29 A;  4A3F G;  1MIU A;  1WOC A;  1PA6 A;  1I94 L;  1YNJ C;  3V05 A;  3MC0 B;  3C1F A;  5I6W A;  4RHR A;  4ULL A;  1I4X A;  3TDQ A;  1W6J A;  3LGJ A;  2DJF C;  2ZXO A;  2JEB I;  5C4X B;  2I0Q A;  1C9O A;  4WRD A;  1I6V C;  4JYA Q;  1QVG A;  1TWC H;  3CP0 A;  1STG A;  2EVB A;  3OOC A;  4UDU C;  1AZP A;  1RF2 D;  3K6O A;  4RWS C;  4GNX A;  2DUD A;  1E1O A;  2IX1 A;  1TKW B;  3D3R A;  1JWU D;  2R92 B;  2JA9 A;  1QCB D;  4IPD A;  1XMQ Q;  1TWF H;  3CKI B;  2F0K A;  4Q5V A;  2YU9 B;  2EJG C;  3OW7 A;  4C3I G;  1WTO A;  1T5E A;  1X32 A;  3NEN A;  3KJO A;  5CC4 A;  3M7N A;  2YTV A;  4UP8 A;  4JOI C;  1LYL A;  3BVG A;  3L3O C;  3D4D A;  4JI7 L;  2Q2I A;  4X66 L;  2YTY A;  3I56 A;  1B1Z A;  3K7U C;  3FHW A;  4NW2 A;  4MN3 A;  5IIF A;  2M2L A;  2BH2 A;  3GDE A;  1Z9F A;  1AE3 A;  1S40 A;  3T16 A;  5M5Y B;  2UXC L;  2K4K A;  2D62 A;  2AKW B;  3OSO A;  3Q24 A;  2O2L D;  2LY7 A;  1FGB D;  3KLS X;  2HT1 A;  1NSN S;  3HEJ A;  2O5J C;  4GKK L;  3VR6 A;  2EY6 A;  4DUY Q;  4A75 A;  3S1M B;  2EYL A;  1ENA A;  1D8L A;  1WTP A;  3GTM H;  1CTM A;  3GQB A;  3BVZ A;  1A3V A;  5IGF A;  1ENC A;  1IYV A;  4DNR B;  4LW1 A;  1MJE A;  2QEX A;  3RN5 A;  2Q2U A;  1CI3 M;  1ENF A;  3CCR A;  4XDX A;  5IWA L;  5JPM C;  2KED A;  3MFG A;  1O80 A;  1STA A;  1HZC A;  2R3Z A;  4KI0 A;  2R92 G;  3Q6S A;  2HQE A;  3PIO A;  3JAM c;  4KHZ A;  2K5H A;  2L1B A;  3E0J A;  3KJP A;  5BR8 Q;  3GTQ H;  2OCE A;  4R4T A;  1TQO A;  3NBH B;  1HZB A;  5CR3 A;  4IFD G;  4A3F H;  3A54 A;  1HA6 A;  1IXR A;  1BOS A;  1VQ9 A;  3QJY A;  1Z7T A;  4DV3 Q;  3EJI A;  4A3E G;  1AEX A;  2N88 A;  1E22 A;  1Y8O B;  4DAP A;  2AMC B;  3U9S A;  3CC2 A;  1PH4 A;  1Y1W B;  3NE5 B;  2K01 A;  2K50 A;  4B08 A;  3Q22 A;  1X3Q A;  2E74 C;  4I65 A;  1ZKO A;  1FVI A;  2UU9 L;  3EFX D;  2R7D A;  2JK8 A;  3A56 A;  1U4P A;  1EYA A;  3HOZ G;  2NVX H;  3DHQ A;  2FXQ A;  4OIJ A;  4YIJ A;  1LT6 D;  4DV6 Q;  4LFB L;  4NKL A;  2E2H B;  4K6D A;  4K2K A;  1QG7 A;  2CWP A;  3VR3 A;  4DR2 Q;  4X62 L;  2OQ0 A;  2V4D A;  3KUP A;  1SAP A;  1BCP F;  1EWI A;  1TWH B;  5C3E H;  1D5X C;  4GKK Q;  4R1J A;  2XRQ D;  1A15 A;  1KDA A;  4A3G G;  3TP6 A;  5ELC A;  4HSP A;  1EIG A;  3CMA A;  2EYH A;  4IO9 A;  1I4H A;  1CSQ A;  1FD7 D;  1X65 A;  5LL6 X;  1CK1 A;  4R8N A;  1EUJ A;  4JI2 L;  4EVO A;  1PHJ A;  1Z47 A;  4LF4 L;  2K14 A;  4O0A A;  3K5O A;  3HOW H;  1Y1V H;  2K52 A;  4OGQ C;  3FKI B;  1E2Z A;  1QZG A;  2H4O A;  4JI3 L;  1CA5 A;  3HKZ B;  3CCM A;  3MEH A;  2ICE C;  1VQE A;  5ELE A;  2RDF A;  4G7O C;  4AH6 A;  2B2T A;  1IBL L;  1TS5 A;  2SNM A;  1GOZ A;  4C2M B;  2UUA L;  1GUT A;  3BDC A;  5M5Y H;  3GTO H;  2ASB A;  2F0U A;  2RQX A;  4CJ1 B;  2UUB Q;  4P73 A;  3J80 c;  4KY6 A;  2ZJR A;  3TRE A;  3AMU A;  4CGY B;  2B2U C;  1UE7 A;  4NXN Q;  2AQ1 B;  2LS0 1;  2SNS A;  2NVX B;  2HDL A;  4IJL A;  1BQQ T;  1PXU A;  2P5Z X;  3S14 B;  2KJX A;  5T1I A;  4LFA L;  1OXT A;  2F0S A;  3J80 L;  5C44 G;  1RKN A;  4DA2 A;  1NMG A;  2KEN A;  1SSO A;  2MQH A;  4CKC A;  4A3K B;  3WDN A;  1F2Z A;  5FO8 B;  1VS0 A;  4U67 3;  1LTA D;  1ONL A;  1XNR Q;  1PTO B;  2KCN A;  4OX9 L;  2A69 C;  2MFI A;  1CQV A;  1KRS A;  1BCP D;  4WJ3 M;  2QA4 A;  2QDB A;  1JJ2 A;  4O2D A;  3U9O A;  3HOW B;  5IT9 E;  3H91 A;  2NVY H;  5IYB G;  3BDL A;  4JI5 L;  5E1F A;  4LUZ A;  4QF4 A;  4DV7 L;  4LF4 Q;  5KYL A;  3HOX H;  4QY7 A;  1I5F A;  4DV2 L;  4JG2 A;  2CHB D;  5DNF A;  4EQN A;  2JA7 H;  3FRP B;  1HTL D;  3KF8 B;  1IBM Q;  1KAA A;  4NXN L;  3H0G H;  5ELN A;  1ICF B;  1Y8P B;  2KHS A;  1LTG D;  4IFD J;  4XT1 B;  1XMO L;  4LUO A;  4C3J H;  2L15 A;  2CWA A;  2HD3 A;  2E5L Q;  1HFN A;  1PVO A;  1V9P A;  1CKN B;  2B2V C;  3BU2 A;  1GHJ A;  4DAM A;  1SE4 A;  2QF7 A;  1EOV A;  4JW0 A;  3OTO Q;  1PH1 A;  2NVT H;  4DR6 L;  1LT3 D;  4ZRZ A;  1IZ6 A;  2F3W A;  3GTM B;  2EOT A;  1I4Q A;  1QUQ A;  1VMC A;  1MBY A;  4NDX A;  5IP7 G;  4DV1 Q;  2PQA A;  2NN6 I;  1ET6 A;  5C44 H;  4X3U A;  1MSH A;  1ROD A;  2N8N A;  3W5O A;  3HOY G;  1I6H B;  4LFA Q;  3DM1 A;  1E2W A;  3FEW X;  1VQ5 A;  1O7I A;  1W2B A;  3HZX A;  3V96 A;  4RFB A;  2XN9 C;  2KCT A;  1JWM D;  2C9O A;  4POF A;  3NUC A;  3F2B A;  5IOC A;  2J7Z A;  3GV6 A;  1KD1 C;  1K73 C;  4DU9 A;  3K8A A;  4C3I B;  1KDB A;  1XTC D;  2F0Q A;  5AFW A;  2Q2T A;  1WYD A;  4HTH A;  1Q86 C;  1PH8 A;  3A5U A;  4I7A A;  4LFC L;  1X6O A;  4AYB E;  3F2C A;  1TVX A;  1VQ4 A;  1EQQ A;  1DYQ A;  1P8L A;  2RKS A;  1XNQ Q;  3N52 A;  1HJP A;  1FNW A;  3TP7 A;  1HZA A;  4JK1 C;  4OEM B;  2L55 A;  1ZYR C;  4DV4 Q;  1VF5 C;  1KIX A;  4ILW A;  1C7Y A;  4OHJ A;  3SK6 A;  3J81 L;  1Q3L A;  2LXK A;  3TRZ A;  3UDF A;  1Q1E A;  3HOU H;  1SRU A;  4ZUI A;  3D4W A;  3MXN A;  1OO9 B;  4HCS A;  1TWC B;  3T13 A;  4L5T A;  2A1A A;  3LNN A;  5ELF A;  3ZJY C;  1L1O A;  1UE5 A;  5CYU A;  2RDG A;  5BN4 A;  3JAM i;  3VR2 A;  3NTH A;  2F52 A;  4QMG A;  1EQR A;  5EPL A;  3H15 A;  4WOR A;  2G5D A;  3OMC A;  3RMH A;  2C5C A;  4OO1 I;  5IGE A;  1J5E L;  2Z6B A;  4NB3 A;  2HIV A;  4HJ7 A;  1DOK A;  5EKL A;  2UXB Q;  2D2C C;  2EDG A;  4YWL A;  2Z6K A;  3JAM L;  5IGC A;  4OL7 A;  1EYC A;  3HKZ E;  4UPA A;  2JA5 G;  4CKE A;  1LAB A;  3UDI A;  1HR0 L;  4LF9 L;  3VA7 A;  5KND A;  2IWH A;  2B63 B;  4YWK A;  3RZO B;  4IN3 A;  1ILQ A;  2AQ2 B;  2BDO A;  3OMG A;  1HNW L;  5J39 A;  3EN2 A;  3AU7 A;  1EIF A;  3SGI A;  1D5M C;  1C8C A;  4GLX A;  2BH8 A;  2JA6 B;  4J6H A;  3CME A;  3PMF A;  2X6L A;  4PMB A;  2JN4 A;  1JQY D;  4LF5 Q;  5KYI A;  3PO3 H;  5FK9 C;  3SEB A;  2ZT9 C;  3NBH A;  1FNV A;  3SK8 A;  3RZD B;  3WOE A;  3CF5 A;  1IHZ A;  5C0X J;  1TY0 A;  3CHB D;  1FJG L;  1WTV A;  4LNQ A;  4JBK A;  3MXN B;  3GTK H;  5IYC G;  5LMN W;  2VUM H;  4FXD A;  1S5D D;  4GOP C;  2KCM A;  2NZO A;  3GTJ H;  2MHV A;  4RG1 A;  3E3X A;  2HCC A;  2K7V A;  3W1G A;  4IZ8 A;  4YY3 L;  1CM9 A;  1K9M C;  1DXM A;  1LM0 A;  2E2J H;  1GUO A;  3ERS X;  1VMP A;  4DUY L;  5JEA H;  1L0X B;  5CV8 A;  4APV A;  3KBG A;  3I91 A;  4DR1 L;  4DR3 L;  2HHH Q;  1U4M A;  4JV5 Q;  1LTT D;  2NZH A;  3PQI A;  2KEC A;  3I3C A;  3I4L A;  3D6W A;  4BY1 G;  2D5D A;  2MPM A;  1KTK A;  4A3K G;  2YV5 A;  3K59 A;  2E2H H;  4DV0 Q;  1SE3 A;  4PQX A;  2Y0S E;  2Q8T A;  2KVM A;  2NB0 A;  3BJU A;  3D6C A;  4C3H B;  4ALP A;  2N49 A;  1Q1B A;  2JSO A;  3M4Y A;  1B2T A;  5C4H A;  1SE8 A;  2K28 A;  3BYT B;  4C3H H;  2BOS A;  4J1M A;  4TSS A;  5L37 A;  2XNA C;  1A2U A;  1UNS A;  5FJ8 G;  1K0R A;  3PIP A;  3I4M B;  5IWA Q;  1R4P B;  1YJ9 A;  1PRT F;  5FKA C;  3S1N H;  4JI1 L;  3J81 j;  3K7A H;  3RN2 A;  2VNU D;  4KJN A;  1UEA B;  2VQE Q;  3HS0 C;  4FF3 A;  4QJF A;  1BCP C;  1DOL A;  2EQS A;  3GTL H;  3A7A B;  3I73 A;  2UUA Q;  4DPG A;  4A3I H;  1ASY A;  4BA2 I;  1PYB A;  4IOA A;  2KHJ A;  4L5S A;  2F0V A;  5EPJ A;  1N32 Q;  2H1E A;  4LF9 Q;  2ZXP A;  3NBI A;  5IYD H;  4IUT A;  1YHQ A;  1SXT A;  1EIY B;  1YHB A;  4LWC A;  2E2J B;  4CBV A;  1LUZ A;  1JOK A;  5IP7 H;  2VB3 X;  1SLJ A;  2ICI A;  3DWA A;  1YI2 A;  1NTG A;  2YTX A;  3KF6 B;  4QUF A;  1SYB A;  2F0P A;  2EXD A;  4JI6 Q;  2RF4 A;  4QIW B;  3D31 A;  4A3B G;  2NTT A;  4HAE A;  1DGS A;  4DR1 Q;  1EYG A;  2B2W C;  4L5Q A;  3PV0 A;  1I4R A;  2OEO A;  5JEA J;  1AH9 A;  1YEZ A;  3GTP B;  3QO2 A;  5M3F B;  3T1Y Q;  1A63 A;  1G6Z A;  1PZJ D;  5I9P A;  2JA7 G;  3Q8D A;  3CQZ H;  2ZXR A;  1JOQ A;  4JI1 Q;  4TKO B;  4DR2 L;  3RR5 A;  4ABN A;  3CD6 A;  1U0L A;  1BUV T;  4OWX B;  3U58 A;  5I2Y A;  3T1Y L;  2IT1 A;  4RGM A;  2WAQ G;  3HFZ B;  1TWG H;  4XXE A;  2EYJ A;  3QG1 A;  4B3M Q;  1VQP A;  1K83 H;  3BS1 A;  1VQH A;  2Z6K C;  3AYH B;  3K5L A;  4ODG A;  2K05 A;  4AIM A;  2PZW A;  1NMF A;  5IY0 A;  3DMU A;  2F4I A;  4HCE A;  3NTI A;  4MTK A;  1PFS A;  1HPC A;  3FVQ A;  3MAQ A;  4LUV A;  2A8V A;  5C5L A;  4QGU A;  3ONA B;  4JI4 L;  5FLM G;  1VQL A;  3UDX A;  1P16 A;  4QCL A;  4UP9 A;  1KAW A;  1ESR A;  3AFQ A;  1YIJ A;  4GN4 B;  3NK9 A;  1M8A A;  3KF6 A;  1XNQ L;  4DK0 A;  3SDZ A;  3MFY A;  2PPB C;  2MO0 A;  3M3Y B;  1DOM A;  5D14 A;  4LF8 Q;  1ZEQ X;  3S2D B;  4K8I A;  2BA1 A;  4DN4 M;  4RKB A;  2EJF C;  1TS3 A;  1PTO F;  5M3F G;  1YZ6 A;  3BG3 A;  3K5N A;  1IKL A;  4GLA C;  1BBW A;  2WB1 E;  1VQI A;  3NP8 A;  3TQY A;  3TS2 A;  2PO4 A;  4E6I A;  1O7L A;  3S1N B;  2GVB A;  3AB9 A;  3WWV A;  1Y14 B;  2B8F A;  1CA6 A;  2WAQ B;  1Y1V B;  5C3E B;  5FO7 B;  3LX0 A;  4CJ2 C;  4MTN A;  1JMC A;  3GV3 A;  3S15 B;  5I4D A;  2JE6 I;  2MP1 A;  2PQE A;  5LMN Q;  2NVQ H;  2FIN B;  1X3P A;  4A3B H;  4C3I H;  3KDF B;  1O7Y A;  1DCZ A;  3MVV A;  4Y7N H;  2WB1 G;  3PUW A;  4L6T B;  1G6P A;  1NE3 A;  3IAY A;  3SXH A;  1F9S A;  2VQF Q;  1R9T B; 
#chains in the Genus database with same CATH homology
 2R6G A;  1VS0 A;  4P74 A;  3K81 C;  1Q8K A;  1X3F A;  1YBY A;  4YCV A;  5LMU Q;  2UUC L;  1N33 L;  3I4M H;  2E5L L;  3OYY A;  4P75 A;  1GD7 A;  3HOU G;  1XNR Q;  3S15 H;  1IBL Q;  2VL6 A;  4OX9 L;  2MFI A;  1N34 Q;  1KRS A;  3TS0 A;  5AJ3 Q;  1G51 A;  1HNZ L;  2Y0S G;  4WJ3 M;  3U4Z A;  1B7Y B;  2QA4 A;  1JJ2 A;  5JJK A;  1GO3 E;  4O2D A;  5K36 G;  1JE5 A;  5GAE C;  1X55 A;  2NVY H;  2XGT A;  5IYB G;  2IX0 A;  4LFC Q;  2NN6 G;  4QQB X;  1YJW A;  4JI5 L;  4A3C H;  2JA6 G;  4JC0 A;  4QL5 A;  4GKJ L;  4LUZ A;  2R93 H;  1CKN A;  1D7Q A;  4DV7 L;  4B3S L;  4LF4 Q;  5FLM H;  5M3M G;  5C4X G;  3HOX H;  4QY7 A;  4X65 Q;  1IL2 A;  4IPC A;  2PI2 A;  5C4J H;  1I5F A;  3OTO L;  4B3T Q;  1E24 A;  4DV2 L;  4JG2 A;  3CC4 A;  2R7Z G;  4K0K L;  4YCW A;  4JI6 L;  5HY6 A;  3STB D;  3KF8 B;  2JA7 H;  3M4O H;  1IBM Q;  4NXN L;  3H0G H;  5ELN A;  1QZH A;  3H3V H;  4A3J G;  3G6E A;  1YJN A;  1HR0 W;  1HR0 Q;  4L5R C;  1NBW A;  2UUB L;  5FLX c;  1EFW A;  4IFD J;  1XMO L;  1UE6 A;  4LUO A;  4C3J H;  2L15 A;  5IYC H;  3J81 i;  2CWA A;  3A0J A;  2VUM G;  3HOZ H;  2E5L Q;  2OWO A;  3CCV A;  3TEH B;  1PVO A;  1SN8 A;  1V9P A;  1IBK L;  3FP9 A;  1CKN B;  3H0G G;  3BU2 A;  1Y1V G;  3RNU A;  1WJJ A;  1I3Q H;  3KLW A;  3DLL A;  2AHO B;  1J6Q A;  4DAM A;  3CCE A;  1PV4 A;  2Z0S A;  1EOV A;  1PH1 A;  3OTO Q;  2NVT H;  4DR6 L;  3CPF A;  1A62 A;  1U5K A;  1VQG A;  2EIF A;  4YCU A;  1IZ6 A;  3M9B A;  1PH3 A;  2D0P A;  2WAQ E;  2ZJP A;  1QUQ A;  1X9N A;  4P71 A;  3HOV H;  1X3G A;  2MNA A;  3CCU A;  5IP7 G;  4DV1 Q;  2PQA A;  1QVC A;  2NN6 I;  5C44 H;  1VQA A;  5JEA G;  4IPH A;  1K8A C;  3W5O A;  2N8N A;  4A76 A;  3I4N G;  2B3G A;  2XTI A;  1OXV A;  3HOY G;  4PZ7 A;  3UE0 A;  4LFA Q;  3NEL A;  1OTC A;  4IJH A;  3B6Y A;  2ES2 A;  3PUX A;  5JJI A;  4DK3 C;  3U4V A;  1VQ5 A;  2JJQ A;  1O7I A;  4QIW E;  1W2B A;  4GKJ Q;  4DV7 Q;  5IT9 c;  2N78 A;  3S14 H;  1VQB A;  1YVC A;  4A3D G;  2KCT A;  2C35 B;  2VQF L;  4P72 A;  3KDF A;  4POF A;  3HOY H;  3F2B A;  1UEB A;  3ER0 A;  1KD1 C;  2JA8 G;  2PI2 E;  5GQO A;  1K73 C;  1N34 L;  3K8A A;  2UXB L;  3A5Z B;  5M3F H;  4BBS H;  5GAG C;  2BA0 A;  2Q2T A;  4DR6 Q;  1WYD A;  3HKZ G;  2AWO A;  2HQL A;  1Q81 C;  1VQK A;  4K0K Q;  2ZTD A;  1Q86 C;  3E9I A;  1PH8 A;  1SR3 A;  3A5U A;  1L1O B;  4LFC L;  1X6O A;  4AYB E;  3F2C A;  3E0E A;  4R4Q A;  4DR3 Q;  3VDY A;  1VQ4 A;  1EQQ A;  1VQN A;  4JV5 L;  1P8L A;  2R93 G;  1KC8 C;  2I5L X;  3CCS A;  1VQO A;  1R9T H;  1XNQ Q;  1HJP A;  3I55 A;  3PUV A;  3NEM A;  1VQ7 A;  3KFU A;  1HZA A;  4NXM Q;  1BBU A;  1JJC B;  3W1B A;  2KBN A;  4DV4 Q;  2RHQ B;  1QUQ B;  1KIX A;  1GM5 A;  3FKI H;  1C7Y A;  1VQ8 A;  4NPS A;  4JOI A;  1HNX L;  2AWN A;  1H95 A;  2OTJ A;  4JI8 L;  1XTD A;  4A3M G;  3TRZ A;  2LXK A;  3UDF A;  1RIP A;  3BZK A;  4DK6 C;  1Q1E A;  3HOU H;  2GN5 A;  1SRU A;  4DNI A;  4BA1 I;  5M3M H;  4BXX H;  1XNR L;  1I50 H;  2JA5 H;  1IBK Q;  4DV1 L;  4HIO A;  5IE8 A;  1PH2 A;  2OTL A;  4DR5 Q;  1FJG Q;  1SRO A;  3CC7 A;  5IYD G;  1A8V A;  2A1A A;  4L5T A;  3PUZ A;  3L0O A;  4XIG S;  3ZJY C;  3M3Y H;  3F8T A;  4JI0 Q;  1L1O A;  1TXY A;  1UE5 A;  3ULP A;  1T9H A;  3JAM i;  4HIM A;  1G29 1;  3M4Q A;  2B63 G;  2F52 A;  1E7Z A;  1L1O C;  2ZJQ A;  1PH7 A;  1EQR A;  4LF5 L;  3H15 A;  1VQJ A;  1X54 A;  1YHA A;  3PUY A;  4IFD I;  4OO1 I;  1KHI A;  1VQM A;  1J5E L;  4PZ8 A;  1GKH A;  4NXM L;  4B3T L;  1VQ6 A;  4NB3 A;  5GAD C;  2HIV A;  5M5W H;  4HJ7 A;  4LF7 L;  4AYB G;  3I4M G;  3JC6 6;  5M5X H;  4KLK A;  2UXB Q;  4DKA C;  2IHE A;  1B70 B;  4YWL A;  1V43 A;  2Z6K A;  2VS1 A;  1YIT A;  3HKZ E;  4UPA A;  3PF5 A;  2JA5 G;  4KHP Q;  1M1K C;  1VQF A;  3UDI A;  3T1H Q;  1HR0 L;  4LF9 L;  4X66 Q;  4RMF A;  4YWK A;  5H1S E;  1UE1 A;  3G71 A;  1MKH A;  3HOX G;  1KXL A;  1K3R A;  3HKS A;  1HNW L;  3DM3 A;  2JA8 H;  3ICE A;  3EN2 A;  1EIF A;  3GD7 A;  3SGI A;  3STB C;  4GOP A;  1HNZ Q;  3EBE A;  3S2H H;  4YY3 Q;  4GLX A;  2BH8 A;  3ULJ A;  4JI8 Q;  1BVS A;  3AFP A;  3S24 A;  4IPG A;  1L0W A;  1I6H H;  1XPO A;  2R92 H;  1JT8 A;  3CME A;  3E9H A;  4PMW A;  4PG3 A;  1XPR A;  4A93 H;  3G48 A;  4WJ4 A;  1Y1W H;  1CUK A;  1TWA H;  2YU9 H;  4LF5 Q;  4KHP L;  1Q46 A;  4EQ5 A;  3PO3 H;  4GN3 B;  3MEF A;  3RLO A;  1GVP A;  4MZ9 A;  1I94 Q;  4X65 L;  3I2Z A;  4X64 L;  2F4V Q;  4BY7 H;  5ELO A;  2GVA A;  2QGQ A;  3CF5 A;  3M85 A;  1HNW Q;  1ASZ A;  2E2I H;  1XJV A;  2D0O A;  5C0X J;  3CCJ A;  1FJG L;  1AE2 A;  4LNQ A;  3PO3 G;  2B29 A;  2CKZ B;  1MIU A;  4A3F G;  1WOC A;  2ID0 A;  4JBK A;  3S17 H;  3MXN B;  5GRO A;  1PA6 A;  1I94 L;  2RHS B;  3F1Z A;  3GTK H;  5IYC G;  5LMN W;  3D0F A;  2A19 A;  1JB7 A;  2VUM H;  2CFM A;  4GOP C;  1X3E A;  4JI2 Q;  2KCM A;  4OWT B;  2NZO A;  3L2P A;  3GTJ H;  4HJ5 A;  3LGJ A;  4RG1 A;  2JEB I;  1J5E Q;  4LF6 Q;  4HJ9 A;  5DLQ E;  1C9O A;  3PGZ A;  3W1G A;  2I0Q A;  3GO5 A;  2LXJ A;  4YY3 L;  2F4V L;  4JYA Q;  1QVG A;  1TWC H;  1S3O A;  3CP0 A;  1K9M C;  1LM0 A;  2E2J H;  4JI7 Q;  4DR4 L;  3ERS X;  4DUY L;  4A3J H;  1W3S A;  1CKO A;  4GNX A;  3K0X A;  1HH2 P;  2DUD A;  1E1O A;  4DR3 L;  4APV A;  4DR1 L;  2IX1 A;  3RLN A;  2HHH Q;  4JV5 Q;  1L2F A;  2JA9 A;  4GN5 A;  4MNO A;  4A3G H;  2NZH A;  1WCM G;  4IPD A;  4DV5 L;  1XMQ Q;  4J15 A;  1TWF H;  1PH9 A;  4OON A;  1Q12 A;  1OXS C;  2PMZ E;  4TQU S;  4BY1 G;  4A3K G;  3CPW A;  3U50 C;  3NEN A;  4EX5 A;  2YV5 A;  3KJO A;  4GNX C;  3M7N A;  3AQQ A;  2YTV A;  2E2H H;  2ATW A;  2HHH L;  4UP8 A;  4JOI C;  1B8A A;  4DAY B;  4DV0 Q;  5IP9 G;  1LYL A;  1Q7Y C;  4A93 G;  2Y0S E;  4JI7 L;  2Q2I A;  4A3L H;  3UE1 A;  1YNX A;  4X66 L;  4ME3 A;  3A74 A;  2YTY A;  4PZ6 A;  3I56 A;  4A3I G;  2H5X A;  3K7U C;  3BJU A;  1WFQ A;  2R7F A;  4JBM A;  3RZO H;  3PO2 G;  2CQO A;  3FHW A;  4OO1 G;  1NY4 A;  4ALP A;  5FJ8 H;  2N49 A;  1Q1B A;  1FGU A;  2B63 H;  1SE8 A;  4C2M H;  1VQD A;  3F2D A;  4X64 Q;  2BH2 A;  4DV3 L;  3GDE A;  2VY3 A;  1Z9F A;  1AE3 A;  1S40 A;  4B3R Q;  4C3H H;  2VW9 A;  2R7Z H;  4JI0 L;  1N32 L;  2Q2H A;  2UXC L;  1WCM H;  4AQY Q;  2K4K A;  3CXC A;  2D62 A;  4R4I A;  2AKW B;  5FJ8 G;  1K0R A;  3PIP A;  3GTP H;  4DV6 L;  5IWA Q;  1E1T A;  4LFB Q;  1YJ9 A;  2ZTE A;  4H02 A;  3GTG H;  4BXX G;  3FKI G;  3EIV A;  4JI1 L;  3S1N H;  3J81 j;  2HT1 A;  3K7A H;  3RN2 A;  2VNU D;  1IYJ B;  2VQE Q;  1NJI C;  4QJF A;  4A3M H;  5IP9 H;  1E3P A;  4GKK L;  4DUY Q;  2EQS A;  1OXX K;  4A75 A;  4LF7 Q;  3GTL H;  3BZC A;  4DV4 L;  2UUA Q;  3S1Q H;  1D8L A;  4GNX B;  4DPG A;  2F3I A;  1FL0 A;  4A3I H;  4B3M L;  3GTM H;  1ASY A;  3AEV A;  4LW1 A;  4BA2 I;  1PYB A;  4DV0 L;  4IOA A;  2K75 A;  2KHJ A;  3I4O A;  3T1H L;  4L5S A;  4OWW B;  5BR8 L;  1N32 Q;  1MJE A;  4LF9 Q;  5IYD H;  3IRB A;  2QEX A;  3RN5 A;  2DGY A;  1YHQ A;  1EIY B;  1YHB A;  4LWC A;  2Q2U A;  1A0I A;  3CCR A;  1LUZ A;  5IP7 H;  5IWA L;  5GAH C;  1SLJ A;  4Y52 H;  1XMQ L;  1YI2 A;  1NTG A;  2YTX A;  3KF6 B;  5C3E G;  4DV2 Q;  1KQS A;  1HZC A;  1KL9 A;  1BKB A;  1OXU A;  1SFO H;  4LF6 L;  4X6A H;  4KI0 A;  2EXD A;  4JI6 Q;  2RF4 A;  2R92 G;  2K5V A;  1X56 A;  3D31 A;  1LTL A;  3J7Z C;  3HOW G;  4A3B G;  3S1M H;  3G4S A;  3OW2 A;  1Y1W G;  3PIO A;  1DGS A;  2KHI A;  4DR1 Q;  1EYG A;  2PNH A;  4L5Q A;  2UUC Q;  3JAM c;  3PV0 A;  4KHZ A;  2K5H A;  3KJP A;  4A3C G;  5JEA J;  5BR8 Q;  4X62 Q;  2OCE A;  4R4T A;  4R4C A;  4DV5 Q;  3GTQ H;  3NBH B;  1HZB A;  1AH9 A;  1YEZ A;  4IFD G;  4LF8 L;  2ZM6 L;  3T1Y Q;  4A3F H;  4JI3 Q;  4HIK A;  2UXC Q;  4AQY L;  1A63 A;  1IXR A;  2YYZ A;  5AJ3 L;  1VQ9 A;  1MJC A;  4POG A;  5J3B A;  1VQC A;  4DV3 Q;  2JA7 G;  3Q8D A;  3J80 i;  4A3E G;  3CQZ H;  4JI1 Q;  1E22 A;  3J7A 5;  4DR2 L;  1PYS B;  2AMC B;  3RR5 A;  3CD6 A;  1U0L A;  4OWX B;  3CC2 A;  3U58 A;  4GOP B;  3T1Y L;  2IT1 A;  1WI5 A;  2K5N A;  2WAQ G;  1PH4 A;  3HFZ B;  1TWG H;  2K50 A;  4DR7 L;  4JI4 Q;  3I7F A;  3S1R H;  1VQP A;  1K83 H;  4B3M Q;  1XPU A;  1FVI A;  2UU9 L;  1KRT A;  1VQH A;  2Z6K C;  2PQA B;  2R7D A;  4JBW A;  2JK8 A;  3ULL A;  3AYH B;  3HOZ G;  5E7N A;  2I5H A;  1CSP A;  2NVX H;  4AIM A;  1TWH H;  3RLF A;  1UWV A;  2FXQ A;  1NMF A;  3M4P A;  1C0A A;  3S16 H;  1HZ9 A;  5IY0 A;  4DR7 Q;  2JQO A;  4DV6 Q;  4LFB L;  5HGQ A;  4DR2 Q;  2CWP A;  1PFS A;  4X62 L;  4LUV A;  2A8V A;  4OXP A;  2VQE L;  2OQ0 A;  4QGU A;  4OX9 Q;  3S2D H;  1EWI A;  3K80 C;  5C3E H;  2WP8 J;  4XTC S;  4GKK Q;  4R1J A;  4JI4 L;  2V1C C;  2RCN A;  4GLV B;  4A3G G;  5FLM G;  1VQL A;  3UDX A;  1P16 A;  2UU9 Q;  1QVF A;  4IOC A;  3PO2 H;  3PSI A;  4UP9 A;  1KAW A;  3CMA A;  3AFQ A;  4IO9 A;  4BBR G;  1YIJ A;  5IYB H;  4A3L G;  2IY5 B;  1CSQ A;  4GN4 B;  1X65 A;  4JCV E;  1PH5 A;  1EUJ A;  4JI2 L;  3KF6 A;  1Z47 A;  1PHJ A;  4B3S Q;  4LF4 L;  2K14 A;  4O0A A;  5C0X G;  1XNQ L;  4HJA A;  5JJL A;  4YHH L;  2UXD Q;  3CW2 C;  3HOW H;  3PF4 A;  2VZA A;  3KYH C;  1Y1V H;  2K52 A;  2MO0 A;  1CKM A;  4DR4 Q;  2E8G A;  1N36 Q;  4LF8 Q;  4TVA B;  1QZG A;  4JYA L;  4YWM A;  2HIX A;  4JI3 L;  2BA1 A;  3CCM A;  3UDG A;  1VQE A;  1N9W A;  3PCO B;  4BY1 H;  3KOJ A;  3CCQ A;  1YZ6 A;  5M3F G;  4YHH Q;  3HOV G;  1N33 Q;  1PH6 A;  4AH6 A;  1V1Q A;  3CCL A;  4UP7 A;  4GLA C;  2JEA I;  1BBW A;  4JBJ A;  4R4O A;  1JJG A;  2OQK A;  2WB1 E;  1VQI A;  3TQY A;  1N36 L;  1IBL L;  2CCZ A;  3TS2 A;  2ZM6 Q;  4DR5 L;  2JA6 H;  4GS3 A;  4DUZ L;  1K8G A;  2UUA L;  4BBS G;  3RZD H;  2GVB A;  2ZTC A;  3CAM A;  5C4X H;  5M5Y H;  2LSS A;  3WWV A;  1Y14 B;  2ASB A;  3GTO H;  4A4I A;  3J81 c;  1S72 A;  2UUB Q;  4HID A;  2MO1 A;  4MTN A;  4P73 A;  1XMO Q;  3J80 c;  2ZJR A;  1JMC A;  4UY8 C;  3TRE A;  2JE6 I;  3I4N H;  4A3D H;  4FDB A;  1VCI A;  1UE7 A;  2I5M X;  2N3S A;  1Q82 C;  1RL2 A;  4NXN Q;  5LMN Q;  1SMX A;  2NVQ H;  2ALY B;  4DUZ Q;  4IJL A;  4A3B H;  5LMU L;  1N8R C;  4C3I H;  3KDF B;  5EAY A;  2WFW A;  2UXD L;  4A3K H;  2IHF A;  4BBR H;  5C0X I;  4Y7N H;  3H3V I;  4BY7 G;  4B3R L;  4LFA L;  1OXT A;  1IBM L;  2WB1 G;  3PUW A;  5C44 G;  1M90 C;  1NMG A;  2KEN A;  4HJ8 A;  2MQH A;  4A3E H;  1HNX Q;  4JI5 Q;  1G6P A;  1NE3 A;  5LMN L;  3L7Z C;  2VQF Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...