3HOUH

Complete rna polymerase ii elongation complex i with a t-u mismatch
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
134
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna/rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of transcription: mismatch-specific fidelity mechanisms and paused RNA polymerase II with frayed RNA.
pubmed doi rcsb
total genus 16
structure length 134
sequence length 145
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3houH00
1OXVA 3AFQA 3FKIG 3H0GG 3L7ZC 4QL5A 4QJFA 2VQFL 4A3EG 3Q8DA 1HR0Q 4IOAA 1E1TA 4YY3L 4GNXA 1CSQA 2E2HH 4DUYQ 2YTXA 2FXQA 2K4KA 1L1OC 3I2ZA 4DV3L 2Y0SG 4YWLA 5BR8L 2F4VQ 4HIDA 4JI3L 1HNXQ 4B3MQ 1E3PA 1HJPA 1Y1VG 1P16A 1EQQA 1XPUA 1SFOH 4JBMA 4WJ3M 4UP8A 2UUAQ 4B3SL 5GAEC 1KQSA 3G4SA 4LUOA 4ALPA 1J5EQ 3PUYA 1VQGA 2BA0A 1Q86C 3DM3A 1BBWA 1NMFA 1KC8C 2ATWA 1EQRA 4DV2Q 4A93G 3M4OH 1VQLA 4YHHL 3AQQA 4LW1A 1OXSC 3M9BA 4UP7A 1FL0A 2NVQH 1H95A 3F2BA 4LNQA 3GTPH 1G6PA 4GOPC 1VQMA 1V43A 2E2IH 4A3BH 4BBSG 4X65Q 3S24A 3CQZH 4JOIA 4DR2Q 4B3TQ 1IL2A 5C0XG 1R9TH 1IBLQ 5IWAL 2Z6KC 2UU9Q 2R7FA 4JI2Q 2UXDL 1KIXA 4BBRH 2WB1E 5E7NA 1X9NA 1SRUA 3EN2A 4YWKA 4A75A 3U4ZA 3FKIH 1GVPA 3H0GH 4A3EH 1N32L 4IO9A 3TRZA 1FJGL 4NXML 5C44G 1PH7A 1L0WA 4JI4L 4OWWB 3S14H 1Q1BA 2VY3A 2ZJQA 1YJ9A 5JJIA 2I5LX 2AWNA 3CCSA 4GOPB 2JEAI 4ME3A 2DGYA 2MFIA 5FJ8G 3I7FA 2A1AA 1I6HH 4AH6A 2OCEA 1QVCA 3U50C 2JE6I 4LF5Q 4RMFA 4X62Q 1Y1VH 2K50A 4UY8C 4DR5L 1CKMA 1VQJA 1W3SA 4R4CA 4LF9L 1VCIA 1XMOL 3NBHB 4UP9A 2F52A 2R7DA 3OTOL 4A3LH 4DR6Q 4PMWA 3AEVA 1VQIA 3KJPA 1V1QA 5GROA 4A93H 4JV5L 4DV4L 2MO0A 4JI5Q 4LF4Q 2Q2IA 3HOXH 3H3VH 1YEZA 1O7IA 3ICEA 4PZ6A 2JA9A 3T1YQ 1T9HA 1Y14B 4BBSH 2UUCQ 3J81j 5FLXc 3PGZA 3CCLA 5IYBH 1PVOA 3E9IA 4NB3A 3KLWA 1LYLA 1WCMG 1TWGH 5DLQE 1PH9A 1D8LA 4LUZA 3M85A 3UE1A 3HKZE 2VS1A 1TWAH 1WFQA 4KHPL 3CPWA 5C44H 3CP0A 4X64L 4DV1L 1B8AA 1IBMQ 2GVAA 1QUQA 4P72A 1N34Q 4DV7Q 2PNHA 2JA8G 4A3IG 1PH5A 4GN5A 5FJ8H 1YJWA 4K0KL 4X6AH 4JYAL 1XNQQ 3AYHB 2B3GA 1YHQA 2ZJPA 2NN6G 3TEHB 2ASBA 3F2CA 1NBWA 4YWMA 3WWVA 3BJUA 1Y1WG 2NVTH 2CQOA 2F3IA 3GTOH 2CWPA 3GDEA 5GADC 2ZTCA 1X56A 1UWVA 2K5NA 4OX9L 1VQCA 2ZM6Q 4O2DA 1PA6A 2CKZB 1Q7YC 1A0IA 2LXKA 3U58A 5IYDG 4JI7L 4EQ5A 1XNRL 2R92G 5J3BA 3STBD 1VQOA 2UXBL 4DAMA 3F2DA 4DV0L 4A3CH 4RG1A 4AQYL 4GKJL 2UUBQ 5LMNL 2OQ0A 5C4XG 1B7YB 2L15A 5IP7G 3M4QA 1WYDA 3F8TA 2RHQB 3K7UC 2IX0A 2LXJA 3J80c 1HZ9A 2GN5A 4LFCL 3I55A 1DGSA 4IPHA 3RN2A 1NMGA 2YV5A 3PO3G 2K14A 3B6YA 5IP9G 3JAMi 1IBKQ 1XMQL 1EIFA 1CKNA 2RCNA 1I94Q 2E2JH 4NXNQ 1HR0L 1VQ5A 2UXCQ 2JEBI 2JA8H 1XPRA 5C3EG 4DUYL 3K81C 1QUQB 4JI0L 2ID0A 4MZ9A 3GTKH 3JC66 3CCRA 2A8VA 4LF6Q 1QVFA 2F4VL 3S1NH 2Q2TA 1TWHH 1CKOA 2XGTA 4KI0A 5M5XH 4HJAA 1Y1WH 3UDFA 1HNXL 4DNIA 2E5LQ 3ULLA 4B3ML 4DR4Q 4JI6Q 3CCVA 4A3JG 2I5MX 3H3VI 1MJEA 3UDXA 2UUAL 3T1HQ 1IYJB 4BXXH 1J5EL 5C0XI 1PH1A 5IYDH 2QGQA 3RLFA 2R92H 4LFBQ 3H15A 2KHJA 4DV2L 4DUZQ 3RNUA 1Q1EA 2NZOA 4QQBX 2KENA 2N78A 2OQKA 2Y0SE 3SGIA 5C4XH 5IP7H 4AIMA 2HHHQ 2NVYH 1G51A 4OONA 4IOCA 4A3DG 5K36G 4KHZA 4B3TL 5IY0A 4HIOA 4DR2L 1SLJA 3G6EA 3NEMA 3CMAA 1IBLL 4LF7Q 4YY3Q 3PO3H 1I5FA 3MXNB 5IP9H 3JAMc 3UE0A 3W5OA 4GN3B 4GNXC 1VQPA 3S15H 4DR1Q 1D7QA 1OXTA 2YTYA 4LF8L 5EAYA 3PUXA 3EBEA 4P73A 5BR8Q 2C35B 4DAYB 1HZCA 4LWCA 4GLXA 5C3EH 1A8VA 1X54A 4JI8Q 4DK6C 1UE1A 3PUWA 4GS3A 4UPAA 1PYBA 1SROA 1C9OA 3TS0A 3CC2A 1KRSA 1SMXA 4IJHA 2K5VA 1X6OA 3KDFB 1JB7A 3S2DH 4A3FG 1S3OA 4LF5L 2BH2A 3S16H 1C0AA 3PF5A 3I56A 3EIVA 4GNXB 4X62L 3K7AH 2D0OA 3S1QH 3D31A 1XJVA 2BA1A 1V9PA 1ASZA 4P75A 1VQFA 4OWTB 5M3MG 4YCUA 3TS2A 4DR3Q 4O0AA 3A5ZB 4AYBG 4DR6L 2R7ZG 2Q2HA 1JJCB 1VQAA 1Q12A 1KXLA 3HFZB 4JOIC 2HT1A 1A63A 4C2MH 1LUZA 2EQSA 4JC0A 4XTCS 4JI5L 1PFSA 1ASYA 4IFDG 1VQHA 3T1YL 4A3DH 1YVCA 1S72A 2RHSB 2MNAA 1KRTA 1HNZL 2UUCL 1N33Q 5LMUL 1YBYA 3CCUA 2AWOA 4NXMQ 1G291 1W2BA 1HZBA 3CC7A 4HIMA 1KHIA 1P8LA 3CMEA 2ALYB 4X66Q 4POGA 1VQ8A 2XTIA 5H1SE 1WJJA 4JCVE 3KYHC 4PZ8A 2QA4A 2K5HA 4LFAQ 5ELNA 4DR5Q 4GLVB 4A76A 3HKSA 1N34L 4L5SA 5AJ3L 4B3RL 4A4IA 1XMOQ 2DUDA 2I5HA 4A3FH 2WFWA 3RR5A 5M5WH 2BH8A 1QVGA 3BZCA 5IT9c 4A3GG 3HKZG 1JE5A 1Q8KA 2WAQG 4DR7Q 1VS0A 1LTLA 2YYZA 3I4OA 1AH9A 4IFDJ 5GAHC 1J6QA 5M3MH 2ZM6L 1PH8A 2AMCB 4R1JA 1M90C 1X65A 2VQEQ 1X3FA 3RLNA 1VQKA 1BKBA 4HJ8A 1GM5A 1X3EA 4OO1G 1C7YA 4WJ4A 4DK3C 4OXPA 4R4OA 4GKKQ 1OTCA 4HJ5A 1HNWQ 1CSPA 1NY4A 2KBNA 2YTVA 3A0JA 4X64Q 2Q2UA 3A5UA 1LM0A 4FDBA 2VNUD 1PH3A 1Z47A 4C3HH 4HIKA 3GTLH 1IBKL 5M3FG 4JYAQ 3L0OA 1IXRA 1K0RA 2RF4A 1WCMH 3CAMA 2QEXA 3K0XA 1I94L 3I4MG 2VL6A 4NXNL 3W1GA 1GD7A 3S17H 3G48A 3RZDH 2WP8J 1K8GA 2UXCL 1VQ4A 1MJCA 5FLMG 1JT8A 2A19A 1EIYB 4NPSA 2JA5G 4OX9Q 2KHIA 1GKHA 3HOUG 3CCEA 1KD1C 3J7ZC 3OW2A 4A3IH 4LF6L 1L1OA 1JMCA 2NVXH 4JI7Q 1YZ6A 5GQOA 3J81i 5IYCG 2UXBQ 4IPGA 2E5LL 1N36Q 2B63G 3CXCA 4DR4L 1UEBA 2PQAA 4TVAB 4JI6L 3I4NG 4GKJQ 1YHAA 2R93G 2H5XA 1FGUA 1SE8A 4IPCA 3RZOH 3T1HL 5M5YH 3VDYA 1I50H 1YNXA 1Q46A 4P74A 4GLAC 4OWXB 3STBC 1Z9FA 4LFBL 4C3IH 1MKHA 4P71A 3KOJA 4DUZL 4IJLA 4APVA 1GO3E 4DV6Q 3CC4A 1EYGA 4BBRG 3PV0A 1BVSA 4A3KG 1NJIC 4QY7A 1MIUA 4JI1Q 2IX1A 1YITA 2D0PA 3TQYA 4BA2I 4IPDA 4GOPA 4A3MG 3PF4A 4DV5Q 4LF7L 3U4VA 4MNOA 2LSSA 1U0LA 2K52A 4X65L 5M3FH 5C4JH 2Z6KA 4DR1L 2VQFQ 4JI0Q 1EFWA 2VUMG 3LGJA 2UU9L 3I4MH 4JI2L 2IHFA 1YIJA 1PV4A 1VQNA 2NZHA 1X3GA 5IE8A 3D0FA 4KLKA 5FLMH 4DV3Q 2IHEA 3K80C 4JI8L 5JJLA 1PH2A 1K3RA 3AFPA 2JA5H 4BY7G 3S1MH 3HOUH 1CKNB 4XIGS 4JI3Q 4Y7NH 1EWIA 1TXYA 1NE3A 4Y52H 4QGUA 3KJOA 3OYYA 4R4TA 3HOWG 2OTJA 3J81c 4L5RC 4JBWA 2N49A 5IYCH 1VQ6A 2Z0SA 4B3SQ 1E22A 1WOCA 1L1OB 2ZTEA 2B63H 3I4NH 1RIPA 2WB1G 3L2PA 3S1RH 4IFDI 3NELA 2R93H 4L5QA 3TREA 2N3SA 1VQ9A 3HOXG 4JBKA 3W1BA 2PQAB 2JQOA 1S40A 2B29A 4A3JH 3HOYG 2IT1A 4DR3L 4YHHQ 2KCMA 2MQHA 3FP9A 2N8NA 3M4PA 4R4IA 1AE3A 1UE7A 2JK8A 3BU2A 4L5TA 5IYBG 2JA7G 1JJGA 4JBJA 4MTNA 3HOZG 3ER0A 3KF8B 2AHOB 4LF8Q 5IWAQ 2HIVA 4A3KH 3PUZA 4BA1I 4PZ7A 1Q81C 1M1KC 1K83H 1QZGA 4LF4L 3S2HH 1VQ7A 2UXDQ 1K8AC 1N33L 2JA6G 5JJKA 3ERSX 4A3MH 2E8GA 1NTGA 1OXXK 1N32Q 1FJGQ 4DKAC 1E1OA 1E7ZA 4X66L 4JI4Q 2VUMH 3KF6A 2JJQA 1PHJA 4AYBE 1AE2A 3ULJA 3M7NA 2NN6I 1IZ6A 4LFAL 4BY7H 2IY5B 3F1ZA 3RN5A 5LMNW 3GO5A 1IBML 3HOWH 2D62A 4DV7L 4LF9Q 1KAWA 5C0XJ 4POFA 1XPOA 1XNQL 3PIPA 1RL2A 2R6GA 4DR7L 3OTOQ 3NENA 4OO1I 4J15A 1YJNA 4A3CG 2I0QA 3HOYH 1YHBA 1Q82C 4JV5Q 4DV4Q 4C3JH 1L2FA 1VQDA 1N9WA 1HNZQ 3MEFA 3E9HA 3PO2G 3RLOA 5LMUQ 2JA7H 1X55A 1HR0W 3J80i 3CCMA 1YI2A 2VQEL 3FHWA 2V1CC 2VW9A 2R7ZH 2KCTA 2OWOA 3HOVG 3HOZH 1PYSB 2CFMA 1EOVA 2AKWB 4BY1G 1UE5A 2WAQE 2JA6H 2UUBL 4GKKL 1HNWL 3ZJYC 4JG2A 1UE6A 4QIWE 5AJ3Q 4B3RQ 4KHPQ 5GAGC 1HZAA 1I3QH 3CCJA 4DV1Q 1TWCH 2ES2A 4H02A 2HQLA 5JEAG 4K0KQ 3GTQH 1B70B 3KF6B 2MO1A 3M3YH 1QZHA 5ELOA 3CPFA 2EXDA 2HIXA 1SN8A 3CF5A 4R4QA 2PMZE 1PH4A 1PH6A 3E0EA 3PIOA 3GTMH 3IRBA 3CW2C 2PI2E 1FVIA 3BZKA 3J7A5 4BXXG 3PSIA 1SR3A 3PUVA 4EX5A 1BBUA 1HH2P 4HJ7A 1K9MC 3ULPA 1N36L 4A3GH 3G71A 3CD6A 1JJ2A 1XNRQ 1CUKA 1E24A 1N8RC 2YU9H 4TQUS 3CCQA 4DV0Q 3DLLA 3PCOB 3PO2H 4AQYQ 4DPGA 5LMNQ 3K8AA 3A74A 2CWAA 1XTDA 1A62A 1OXUA 3HOVH 3GD7A 1K73C 4DV6L 2K75A 4A3BG 3UDIA 5HGQA 4LFCQ 1EUJA 2CCZA 4A3LG 4GN4B 1VQEA 4BY1H 1WI5A 4LUVA 2EIFA 1KL9A 4YCWA 5JEAJ 3GTGH 2PI2A 4HJ9A 4JI1L 3UDGA 1XMQQ 1VQBA 2VZAA 4YCVA 3GTJH 1U5KA 2ZTDA 5HY6A 4PG3A 2ZJRA 4DV5L 2GVBA 2HHHL 3KFUA 2OTLA 1TWFH 3KDFA
chains in the Genus database with same CATH superfamily
3OSOA 3H0GG 3Q8DA 4C3HB 2E2HH 1CSQA 2F0MA 3GTLB 3C1FA 2YTXA 4DV3L 1IKLA 2LKVA 3NTIA 1HPCA 4B3MQ 1HJPA 2F0VA 2B2YC 1SDFA 2F0TA 2JP1A 5KNBA 4WJ3M 2K1BA 4X3KA 3HKZB 5GAEC 4BWGB 4ALPA 2J0TD 2AQ3B 2SEBD 1VQGA 2RSNA 3Q0AA 1VF7A 2NBFA 3DM3A 1EU4A 1STBA 4K8IA 4FYDA 3Q22A 3M9BA 5IODA 5I6YA 4G7ZC 1QJOA 4KMUC 4WJWA 1B50A 4B3TQ 3IAYA 2MGSA 4JOIA 1B9MA 1IBLQ 2UU9Q 2PMZB 4JI2Q 2UXDL 3VYUA 1KIXA 3NWSA 2KA7A 1X9NA 1SE3A 3FKIH 4A3EH 4XYQA 2F0GA 3TRZA 1AN8A 1FJGL 1PH7A 4OWWB 3SE0A 1S5DD 1YJ9A 4GOPB 1F2LA 3R2IA 4ME3A 2DGYA 3SHLA 3OIPA 4ODGA 4XQJA 1Y1VH 2K50A 3S1MB 3HOUB 2O4XA 4Y7NB 3TSSA 4PV1C 3NBHB 3C2PA 2F52A 3OTOL 4PNYA 4DR6Q 1EQTA 2R93B 3S1RB 4A93H 4DV4L 4QF4A 2MO0A 4RGOS 1A2UA 2JA9A 1T9HA 1Y14B 4BBSH 2UUCQ 1B44D 1NAPA 5FLXc 4XYOA 4OL7A 4C3HG 4HMJA 3E9IA 1C8CA 3T51B 1TWGH 1BOSA 2O5IC 2DNEA 5AFWA 4CGYB 3J7AF 3M85A 1EWCA 4KK7A 5A2QE 4KHPL 3CPWA 5C44H 3TBIB 1U4MA 1O78A 4F87A 1PYWD 1PH5A 5FJ8H 2F0FA 4HAEA 4O1NA 3VR4A 2B3GA 3TDQA 2K03A 3WWVA 5IGGA 1SAPA 4XT3B 4OX9L 2B2TA 1VQCA 1DM0B 2WACA 1A0IA 2Z9HA 4EQ5A 4PMBA 2HCCA 4K6DA 4DV0L 1O7YA 2RSOA 1F9PA 4C3JB 5LMNL 2OQ0A 2L15A 3GQBA 2JA7B 2IX0A 4RCNA 3J80c 4CHTB 1DGSA 3PO3G 2K14A 5IP9G 3K5OA 2H4OA 5KRUA 5EBCA 3JAMi 4C1NK 1K28A 4DAYA 2RCNA 5IGFA 2E2JH 1VQ5A 5KGUA 2UXCQ 1SE2A 3K81C 1QUQB 3SDZA 3SK8A 1TS3A 1STNA 1JWMD 2A8VA 1V1PB 1QVFA 1SE4A 1KLUD 1EY9A 2XGTA 1Y1WH 3D4WA 5M5XH 4HJAA 3UDFA 2E5LQ 4DR4Q 3ULLA 5I2YA 1D5MC 2I5MX 3H3VI 3GTMB 3BVZA 2KHSA 2UUAL 4J1MA 4CJ2C 3BVMA 1J5EL 5IYDH 1A15A 2QGQA 5J22A 2KVMA 4A3GB 2KHJA 2SNMA 4RGNA 3BDOA 5G3LD 2YU9B 2KENA 1JB3A 2I07B 4AIMA 1Z6HA 4RFBA 3TN2A 2HHHQ 4A3DG 3V2TA 5K36G 5DNFA 3G6EA 2EPBA 5IGBA 4O42A 4EVOA 4DR1Q 3S15H 1OXTA 1D7QA 3PUXA 2CH4A 4P73A 1NUCA 1RTOA 4X3SA 1I4HA 1U9RA 2QDBA 5C3EH 4JI8Q 1X54A 4UPAA 3D6WA 1I4XA 3S2DH 3FEWX 5EBDA 3EROA 4LF5L 2BH2A 3FRPB 2NTTA 3P7JA 3K7AH 4Q0FA 1ASZA 3V05A 4V0BA 1JCKB 1K8MA 1CFMA 3TS2A 1CZWA 2F3VA 2Q2HA 3JAML 1QWYA 1KLGD 1LUZA 2ICEC 3Q6SA 3MAQA 1SNCA 1G2TA 5FO9B 1KRTA 1TKWB 1XWEA 2AWOA 3CCUA 1G291 2E2IB 4X66Q 2XTIA 3KYHC 5D3IB 1HTPA 5CV5A 3OW7A 5ELNA 4B08A 2WKDA 1N34L 5AJ3L 4B3RL 3OWEB 1QB5D 4U68A 2B2UA 4A3GG 5M5WH 5IT9c 2L0CA 1Q8KA 3H3VC 1YNND 4KD3A 1JICA 1WTXA 5M3MH 3MXGA 4N9PA 1CHPD 2VQEQ 1X3FA 1BKBA 2QILA 1I4RA 1GM5A 1NCVA 3T56B 2F0JA 2B2VA 4MTKA 4DK3C 3FPPA 3OWFA 2YTVA 2Q2UA 2KBNA 1SYFA 3A5UA 4FDBA 2VNUD 1Z47A 4C3HH 3GTLH 1SSOA 1HXYD 4NXNL 3W1GA 2PYKA 3G48A 3K59A 3HEJA 1TT2A 3PQIA 5FLMG 2A19A 1EIYB 1LTAD 2JA5G 4OX9Q 2ZXRA 1GKHA 1YNNC 4RWSC 5C5LA 3CCEA 3NQIA 4LF6L 3KLSX 4OEMB 3J81i 5IYCG 4IPGA 4PMCA 1IW7C 1STGA 2PQAA 2RDHA 2FFKB 2H5XA 4IPCA 5JOBA 3W3AA 2KOLA 1GUWA 2SOBA 4OWXB 4GLAC 5C3WA 1ILPA 4APVA 3T16A 3CC4A 3JAME 1BVSA 3H09A 4A3KG 1Y69U 1RCVD 4BA2I 4IZ8A 4A3MG 4LF7L 4ZK9B 2LSSA 4CKBA 4X65L 1EFWA 3LGJA 1VQNA 1SBBB 1XX8A 1Z7TA 5FO7B 3LWEA 3AFPA 3S1MH 3HOUH 3OMGA 2JA8B 2G9DA 4Y7NH 3AMUA 3KJOA 4R4TA 1GHKA 2N49A 2EYLA 2EYHA 1WTOA 2R93H 3S1RH 3NBIA 4L5QA 4NMZA 2MP1A 4JBKA 2B29A 2IT1A 4DR3L 1A2TA 4I65A 1EEID 2RA4A 1ONLA 1UE7A 5CV9A 2R92B 1GUSA 3BU2A 5L37A 5LHY1 2XNAC 1A3TA 3I91A 2HIVA 3PUZA 4BA1I 3NHHA 4PZ7A 4LF4L 1QZGA 1K8AC 3LWUA 1Y8NB 1NTGA 1WTQA 1E1OA 1E7ZA 3J81L 4JI4Q 1MHWC 3TP8A 1JE4A 2NN6I 3F1ZA 4I7AA 1TR5A 3GO5A 1IBML 2D62A 5EKKA 1XPOA 4DR7L 4J15A 1YJNA 3S1QB 2E76C 4C3JH 5CV7A 2TSSA 3R93A 4HCEA 2JA7H 4IUTA 1YI2A 2IPKD 4IALA 3HOVG 1PYSB 2AUKA 2AKWB 4BY1G 1EL0A 3ZYYX 1HNWL 5JVG3 3L9AX 2ZT9C 2XRSD 1UEAB 5AJ3Q 4B3RQ 3AB9A 1LT5D 4BBSB 2PW5A 4XQQA 1XXGA 4OGQC 5I4DA 3CPFA 2PMZE 4NKLA 3E0EA 3GTMH 1HTLD 1ZEQX 1C4QA 3KBGA 3J7A5 4A3FB 4EX5A 3PUVA 1BBUA 4A3GH 3CD6A 1JJ2A 4HCSA 4DK0A 1BCPC 1O7LA 3OMCA 2YU9H 1FNUA 2EY2A 1QILA 3A74A 2IW3A 1XTDA 4AYBB 1OXUA 3GD7A 4DV6L 3WOFA 1CHQD 5HGQA 2MHVA 4FNFA 1FNWA 1KL9A 2EIFA 4HJ9A 4JI1L 1EZ6A 1LTSD 1XMQQ 1VQBA 1W6KA 2PNRC 1U5KA 4DV5L 4QB4A 1BXTA 1A6XA 3MC0B 3DXJC 3KDFA 3I8ZA 1OXVA 3FKIG 4A3EG 4LMQD 2VQFL 4IOAA 3GV6A 3E0JA 4YY3L 4DUYQ 1L1OC 2F0IA 2VXWA 1DXMA 2F4VQ 2XIWA 4JI3L 1SMYC 2A5HA 1Y1VG 2D9UA 1XPUA 4DK1A 2RCFA 1X32A 5EPJA 3BDLA 4UP8A 4KKSA 2BA0A 1GUGA 2ATWA 1EQRA 4IUQA 3PIP3 4DV2Q 2K7VA 3CHBD 4A93G 1VQLA 3BVGA 3DWQA 1HA5A 4YHHL 5JJZA 4LW1A 1OXSC 5M5YB 4ZUIA 1QNUA 4BBSG 1V43A 2E2IH 4X65Q 3S24A 4DR2Q 4C1NI 5IWAL 2R7FA 3LX0A 5DEHA 2F3WA 1PRTF 4RCOA 3ND9A 5E7NA 3EN2A 1ENFA 2M9VA 3OHXC 4NXML 5C44G 1L0WA 1Q1BA 3CKIB 3TZDA 1EY8A 5M3FB 5JJIA 5DM63 2I5LX 1GHJA 5FJ8G 3I7FA 4S3SA 2OCEA 1QVCA 1RKNA 2J7ZA 4RMFA 1RJTA 3MXPA 3D4DA 1W6JA 2K04A 4X62Q 4UY8C 2A74C 3FMCA 5IGDA 1VQJA 4R4CA 4LF9L 1VCIA 3RD4A 2XSCA 4HN7A 2F0EA 2E74C 3I4NB 4PMWA 4JV5L 2KECA 4K5VA 3A8IE 4JI5Q 4JPBW 2Q2IA 4LF4Q 2DJFC 4A3JB 4PZ6A 3T1YQ 2EOTA 2G9HD 3J81j 3PGZA 4ZAIA 4DA2A 1SNOA 3DUZA 3NK9A 5DLQE 4LUZA 2VS1A 4CDEC 4X64L 1IBMQ 1QUQA 3WDNA 2PNHA 2VUMB 4K0KL 1VF5C 5EPKA 1V1PA 1LT6D 3TEHB 4DF7A 4G57A 3F2CA 1NBWA 1Y1WG 2ASBA 4BY7B 2CQOA 3QJYA 2CWPA 3HOWB 3ERQA 2CKZB 1Q7YC 2LXKA 5I6WA 5IYDG 1WTPA 5J3BA 1VQOA 2UXBL 4DAMA 3QB3A 3HOYB 3D8GA 4RG1A 1B7YB 4RAUC 5CV8A 3F8TA 5A35A 3KK7A 3I55A 4CDDC 3HOZB 2YV5A 5FOBB 3B6YA 1IBKQ 2K28A 2MPMA 1EIFA 5KYLA 2JA6B 3I4LA 4KKTA 3TP7A 4B9WA 5DM73 1HR0L 2JA8H 1I3QB 1LTTD 5C3EG 2RDFA 2ICIA 2X6GA 1K0SA 1B9NA 4MZ9A 3JC66 2L12A 4C56C 2Q2TA 1CKOA 2HUGA 1HNXL 1LTBD 3CCVA 4A3JG 1Q90A 1YNJD 1PZJD 3UDXA 5HGTA 1IYJB 2R92H 5CC4A 2MUYA 3H15A 1I4PA 1PTOC 1DYQA 2NZOA 5ELFA 4QQBX 1EZ8A 2OQKA 5IP7H 1STAA 4H13C 3T13A 3PO2B 3NWTA 1G51A 4L63B 1A3VA 3NEMA 1M8AA 4YY3Q 1I5FA 3MXNB 3JAMc 1VQPA 4GNXC 3GTGB 4LF8L 4HSVA 1PLFA 2C35B 4G7HC 1EOTA 2XWBB 1U4PA 4UDUC 1TWFB 4GLXA 4RGTA 1BDOA 3PUWA 4IJHA 4DNRB 1X6OA 1YNJC 3KDFB 4JW0A 4Z9CB 2CHBD 2EZVA 3EIVA 2D0OA 3S1QH 2EY6A 1V9PA 2KQ3A 5M3MG 3M4YA 1SFOB 1JOKA 3A5ZB 3FPUB 1WD0A 1RODA 2Q8RE 4F7XA 2K32A 3R8BA 1CA6A 3C3LA 4DU9A 1B1ZA 1YVCA 2RHSB 1HNZL 1N33Q 1RTNA 5LMUL 4NXMQ 3RMHA 4FO2A 3BYTB 5LL6S 1DOMA 2EJMA 1R9TB 4MHEA 2EVBA 4HIMA 5ELBA 3CMEA 3T53B 2NTSA 1H9JA 4BBRB 4JCVE 4DFAA 5ISRA 5D65A 1NR4A 4LFAQ 4GLVB 4A76A 4L5SA 3I72A 1K8OA 3S14B 1LT3D 2DUDA 1SYGA 2I5HA 4A3FH 5EJWA 2Y0SB 1QVGA 3H6MA 1I6HB 3HKZG 2HDLA 1VS0A 1VMPA 5NUCA 4IFDJ 5GAHC 2ZM6L 1PH8A 1ZYRD 2DY8A 2L5TA 1TS4A 3ND8A 1F9QA 1KTKA 1K3BC 4RA8A 1VQKA 1B53A 4HJ8A 4WJ4A 5BN3A 1UUPA 3SK4A 1OTCA 3I73A 4X64Q 3A0JA 1AZPA 3EA6A 5FO8B 1IXRA 2RF4A 1I94L 1F2YA 2VL6A 2FHTA 1GD7A 4B9XA 1TWAB 4ZUJA 2H1EA 2WP8J 1VQ4A 1JT8A 4NPSA 3HOUG 1KD1C 3J7ZC 4DXFA 1D1IA 4KY5A 4HTHA 2UXBQ 1DJRD 1TQOA 2NVTB 4JI6L 2R93G 1EWHA 1ZYRC 1YHAA 1S5ED 1FGUA 2CVRA 3Q23A 2B2YA 3T1HL 5M5YH 3VR2A 4U673 1YNXA 1TU2B 2Z4IA 2DJGC 4LFBL 5E4WC 3C46A 4DUZL 4IJLA 4HSPA 3EVQA 5IGCA 4OO1H 1EYGA 4BBRG 3PV0A 1BCPB 1V8QA 5CV6A 2EXZA 4KN4C 4UHVA 1YITA 1DD2A 4CKEA 1RDPD 5M3FH 4P2CB 4UAIA 4I7ZC 1ICFB 1LTGD 4EGVA 5IE8A 3D0FA 1VDZA 2K6AA 4KLKA 4DV3Q 2IHEA 3LNNA 3K80C 5JJLA 1PH2A 2JN4A 4XIGS 1EWIA 4QGUA 5KEEA 3S9WA 3J81c 3GTKB 4L5RC 4A3LG 4H44C 1WOCA 1L1OB 1TWHB 2K5DA 3I4NH 2KUMA 2QEJC 2F0PA 2BDOA 1VQ9A 4ILWA 5FK9C 4A3JH 2PO4A 2B2WC 4C3JG 2KCMA 1AE3A 5IYBG 2JA7G 1LACA 3HZXA 1H9SB 4JBJA 4MTNA 4H0LC 4LF8Q 2AHOB 3D3RA 1EY5A 5C4XB 3SK5A 3X3NA 1Q81C 4EQNA 2UXDQ 3TP6A 4OELB 1FJGQ 5EKLA 2VUMH 2KCNA 4RHRA 4ZCKA 1QCBD 4AYBE 2ZXPA 3ULJA 3M7NA 2C9OA 1IZ6A 3DWPA 4BY7H 3RN5A 1SXTA 5LMNW 3U9OA 3HOWH 1SYDA 4DV7L 4LJZC 4EQOA 4V190 1QNKA 3S16B 5DAUA 3OTOQ 4A3CG 5T1GA 1X3PA 3HOYH 1Q82C 1PRTD 4DV4Q 1BQQT 1L2FA 1HNZQ 1TS2A 3E9HA 2EYFA 5LMUQ 2BE5D 4K5WA 3J80i 3CCMA 3NSWA 4X3UA 2V1CC 1LLRD 3I90A 3HOZH 3MXUA 2HD3A 5K5PA 5F2DA 4K5XA 1GXDC 2AUJD 1UE5A 5C4HA 2JA6H 4GKKL 3A7LA 2NUCA 4JG2A 1UE6A 4FVMA 4KHPQ 1I3QH 4H02A 2HQLA 3KF6B 1D6EC 2M00A 4KHVA 2EXDA 3CF5A 1KNEA 1Y8OB 2Z6BA 1PH6A 5FLXL 2XWJB 3A55A 1KAAA 1GUNA 3BZKA 1PRTC 2K5QA 4K14A 4PQXA 3PSIA 1SR3A 1J8IA 3NXWA 4HJ7A 1K9MC 3ULPA 1N36L 4R8NA 1HQMC 2BE5C 1E24A 4TQUS 4DV0Q 3PCOB 3PO2H 1CT1D 3CU7A 4DPGA 5LMNQ 3K8AA 2X69A 2CWAA 2QCPX 3J7AV 4QCLA 1GOZA 4XT1B 1F2MA 1PVOA 2CCZA 1VQEA 1WI5A 1HUNA 5JEAJ 3GTGH 3CRLC 4CBVA 3UDGA 4YCVA 2ZTDA 4RH6A 5HY6A 3QWNA 2GVBA 1TWFH 3L7ZC 4QJFA 4QL5A 1D2BA 2WIIB 1WCMB 3I2ZA 1JOQA 1HFNA 1SJHD 3RZDB 3BDCA 4IUNA 3QIAA 5BN5A 1SFOH 4JBMA 1T5EA 3MFYA 2UUAQ 4B3SL 1KQSA 5CR3A 3G4SA 4LUOA 2WAQB 1J5EQ 3PUYA 1Q86C 4HMIA 4KTAA 1LO5D 4UP7A 3F2BA 1PXUA 4C3IB 2WINB 1L0XB 4GOPC 3C1EA 1VQMA 1R9TH 1PTOB 3KLRA 2Z6KC 5C5MA 4CDCC 4BBRH 5EGTA 2DNCA 4FF1A 2AQ2B 1GVPA 2VB3X 2K33A 1N32L 3S14H 5C4JB 2ZJQA 5IIFA 1KDAA 3VYSA 2JEAI 3I4MB 2MFIA 2KEDA 2A1AA 1I6HH 3U50C 2JE6I 4LF5Q 3K5NA 1XYIA 1CKMA 1RF2D 1W3SA 1F2ZA 3PIO3 5I9OA 1E2VA 5FLXE 2B63B 4A3LH 4KJNA 1E2ZA 1VQIA 3AEVA 3KJPA 1V1QA 3I3CA 1GUOA 3R3OA 1YEZA 1O7IA 2L11A 2HCIA 2V4DA 5C0XH 5IYBH 3CCLA 5EPLA 1WD1A 3MEHA 4NB3A 3KLWA 1IL8A 1WCMG 4HR7B 4K2KA 1D8LA 1G8ZD 3UE1A 3HKZE 1TWAH 1B2TA 2QKIC 1BBXC 2E75C 3CP0A 2XVSA 4DV1L 1N34Q 2JA8G 4DV7Q 1CA5A 4G4KA 1YJWA 4X6AH 4JYAL 2Q8IB 4TSSA 1YHQA 2F0QA 1C48A 5E3FA 2NVTH 4YWMA 3BJUA 1ILQA 4CJ1B 3GDEA 1B3AA 1X56A 1LTRD 1UWVA 1E0BA 2F4IA 4O2DA 3J80E 1PA6A 2A6ED 2EJGC 2RDGA 2WB1B 4JI7L 1XNRL 3SXHA 2R92G 1Q8IA 3STBD 5C3XA 2F0NA 4A3CH 2Z4HA 4AQYL 1ENAA 4ZKBB 5IP7G 2K5WA 1TIID 3K7UC 3NPPA 1HZ9A 2GN5A 2PZWA 3MXNA 4LFCL 4IPHA 3RN2A 1SNQA 5IT9L 2R7ZB 1E2WA 1JWUD 1CKNA 2LFNA 5JPMC 5CV4A 4NXNQ 4BS9A 2DY7A 2O2LD 3MWYW 4WRDA 4JI0L 3GTKH 1FR3A 3GTQB 3CCRA 4LF6Q 1ENCA 1TWHH 4KI0A 3VR6A 1EY4A 2A6EC 4DNIA 4B3ML 2FMCA 1RHPA 4N8FA 3A7AB 3KF8A 2I46A 3SVMA 1FNVA 3RNUA 1Q1EA 3MHBA 1DOKA 5C4XH 2Y0SE 3MA2B 1G2SA 1QE6A 4IOCA 4OONA 2F0LA 4KHZA 4B3TL 5IY0A 2F0DA 1IBLL 4LF7Q 3VA5A 4FXGC 2B39A 1AEXA 3K0YA 1I4QA 1HZCA 1X3QA 4LWCA 5COYA 1A8VA 1HCZA 4DK6C 3MZ5A 1PYBA 2K5VA 1PFBA 1JB7A 2DN8A 4A3FG 1S3OA 3S16H 2IX3A 3P1HA 1I6VC 5JVH3 1I4GA 1PDQA 3D31A 2BA1A 4FF2A 4JVZA 4OWTB 3GV3A 2SDFA 4X3TA 4DR3Q 4O0AA 1U4LA 4AYBG 4DR6L 2R7ZG 1JJCB 1KXLA 2EY1A 3EQLC 3MFGA 4JOIC 3VYTA 2EQSA 4ABNA 1PFSA 1STYA 3M4OB 4DAVA 4QUFA 2NVQB 2UUCL 3GTPB 1YBYA 4A3BB 3CQZB 1HZBA 1P8LA 2ALYB 5IT9E 1VQ8A 3G6JB 1V1OA 3H0GB 2EJFC 1KDBA 4R8IA 3IL8A 3A8KE 2WFWA 4IUVA 3RR5A 1JQYD 1JE5A 4DR7Q 4WFN3 3I4OA 1J6QA 2F0KA 1WTHA 2OF1A 2AMCB 1S5FD 1M90C 3H94A 1X65A 3RLNA 5I2XA 3E5SA 4IFDH 1X3EA 4OO1G 3N52A 5CGKA 4HEDA 1C7YA 3HOXB 3ITPA 2Q8TA 3U9SA 1VMCA 4OXPA 4R4OA 4J8QA 4HJ5A 1HNWQ 1NY4A 2EYJA 1LM0A 4KV6A 1EYCA 3QOLA 1NNXA 1PH3A 1H9MA 5M3FG 3L0OA 2OEOA 1K0RA 3CAMA 1WCMH 4JYAQ 2QEXA 3K0XA 2PW7A 4TKOB 3RZDH 1AP0A 2UXCL 3MVVA 1MJCA 5CORA 3M7GA 2KHIA 2QDLA 3QO2A 2B2TC 2HQEA 5CBAE 1L1OA 4JI7Q 1YZ6A 5GQOA 3UI2A 2E5LL 4DR4L 3N6RA 4TVAB 3I4NG 1SYCA 3GTOB 4GZYC 4P74A 1F9SA 1Q46A 1H9SA 1M4VA 4C3IH 4ZLTF 1ICWA 1GO3E 4DV6Q 1PTOH 3R2TA 4L6TB 1SYEA 1NJIC 4JI1Q 1MIUA 1WTVA 2D0PA 3TQYA 4IPDA 4DV5Q 2K52A 2L4NA 5C4JH 4DR1L 2VQFQ 4JI0Q 2VUMG 3I4MH 2A73B 2IHFA 1IYUA 1KABA 3AU7A 1YIJA 2NZHA 1PV4A 2SNSA 1EIGA 2KEEA 4JI8L 1MSGA 3DEOA 4BY7G 1K3RA 1CKNB 3E3XA 4JI3Q 2KCCA 1WVLA 2OTJA 3OYYA 3HOWG 4JBWA 3S1NB 2Z0SA 2B63H 2ZTEA 1JOOA 2Z8LA 1RIPA 2FJ2A 1IHZA 3TZUA 2N3SA 3HOXG 3W1BA 2JQOA 1S40A 3HOYG 3HG9A 4ME5A 4YHHQ 2MQHA 3M4PA 4R4IA 4L5TA 1WTWA 2A69D 3DHQA 3HOZG 3VR3A 3ER0A 3KF8B 5IWAQ 3KUPA 3NUCA 4N8X1 2N55A 1M1KC 1NSNS 5JAVA 1AZQA 2JA6G 1BCPF 1PZID 2NVYB 3ERSX 4XXEA 4Q5VA 1OXXK 2FMMA 2NWGA 1J9OA 4EQPA 3PO3B 4OHJA 4X66L 5C4ZA 3KF6A 2JJQA 1MBYA 5KNDA 5M9OA 2RVLA 4FP5D 4IUUA 4RKBA 1IKMA 3I70A 5T1IA 1SYBA 2BCOA 4XDXA 1KNAA 4LF9Q 1KAWA 4POFA 1XNQL 3PIPA 1RL2A 3NENA 3NP8A 5CYUA 4OO1I 2A69C 1STHA 1YHBA 4JV5Q 2K05A 1L0YB 1N9WA 3MEFA 3PO2G 2VB2X 1S5BD 4WORA 1HR0W 1SEBD 3WOEA 2VQEL 1U4RA 2R7ZH 2KCTA 2MJ8A 2CQAA 2CFMA 4C2MB 1EOVA 4ID6A 1SJED 1CM9A 2WAQE 2UUBL 4A3DB 3ZJYC 3K5MA 1MGSA 3PMFA 5GAGC 1HZAA 3CCJA 1TY0A 2P5ZX 2ES2A 3EFXD 1DCZA 2B2UC 4K0KQ 3BZDB 3GTQH 3HGBA 2MO1A 1QZHA 3FVQA 5ELOA 4N9TA 4KY7A 4R4QA 3X3MA 4ZYSA 1PMRA 3IRBA 3CW2C 2PI2E 1FVIA 4BXXG 1HHVA 1HH2P 1BF4A 2D5DA 3G71A 2F0OA 4MIUA 3CCQA 5EKIA 4OIKA 3DLLA 5KNCA 2JXMB 2PCFB 2B2VC 3D4RA 1A62A 2E2DC 4CDFC 3V96A 3A56A 1EUJA 4GN4B 3VA7A 4LUVA 4NW2A 1CI3M 1GJXA 2QF7A 2PI2A 2FINB 1SNDA 2RKSA 3CRKC 4PG3A 2ZJRA 3KFUA 3AFQA 5TSSA 1HR0Q 2CH4W 3T4AC 1E1TA 5JEAH 4GNXA 1AFPA 1FGBD 2FXQA 2K4KA 1CTMA 2Y0SG 2HDMA 4YWLA 5BR8L 3S17B 3L3OC 4HIDA 1HNXQ 1E3PA 4MN3A 1P16A 1EQQA 4A3IB 2NVXB 5KIXA 1LV9A 1ML0D 3D6CA 1KC8C 1BBWA 1NMFA 4QIWB 3J7YW 5ELCA 3M4OH 4FF4A 1STEA 3AQQA 3RZOB 1EEFD 1FL0A 2NVQH 1I50B 1H95A 4LNQA 3GTPH 1H9KA 1G6PA 4A3BH 1H9RA 5FKAC 5JPNC 3CQZH 1IL2A 5C0XG 2AQ1B 2N88A 4CJ0B 2WB1E 1SRUA 4YWKA 1S4ZA 2Z1CA 4A75A 2G5DA 3U4ZA 3H0GH 4IO9A 4JI4L 1BO0A 2VY3A 3OOCA 2AWNA 3CCSA 4LAAA 4JK1C 1T5XD 4AH6A 1R4QB 1A3UA 2JA5B 4DR5L 2ENBA 1XMOL 1EIHA 4UP9A 2R7DA 4FXDA 1CQFA 5CBEE 4DGZA 5GROA 2A68D 3HOXH 1II3A 3H3VH 3ICEA 4G7OC 3ONAB 1Y8PB 1JORA 1LYLA 4A3KB 3VR5A 1PH9A 1PTOF 3S2HB 1K83B 4ZKCB 4A3MB 1WTRA 1WFQA 1CK1A 1B8AA 2GVAA 5IGEA 4P72A 4RKLA 4A3IG 4GN5A 1JWSD 1QG7A 1HFGA 1XNQQ 3AYHB 3OPOA 2ZJPA 2NN6G 2F0UA 1KDCA 2F3IA 3EJIA 3GTOH 4RHSA 5GADC 2ZTCA 4IUPA 2K5NA 1IW7D 2WKCA 2A68C 2ZM6Q 2NZ1D 4KN7C 2M2LA 3U58A 2L9HA 3F2DA 1MD2D 3P75A 4GKJL 2UUBQ 4YIJA 5C4XG 1TVXA 1TY2A 1WYDA 3M4QA 2RHQB 1D5XC 4F8MA 2LXJA 1NR2A 1NMGA 2QW7A 2JYOA 1BR9A 1EU3A 1XMQL 1I94Q 3A54A 2JEBI 1XPRA 1XTCD 1TWCB 4NP5A 4DUYL 2C5CA 4FXKC 1BNZA 2ID0A 3K5LA 1ZKOA 3S1NH 2F4VL 1EFID 3M3YB 1QOHA 2B8FA 4ZRZA 2XRQD 2EY5A 1UAPA 1EQVA 4JI6Q 4RGMA 1MJEA 1SNPA 3J80L 3T1HQ 2XN9C 4BXXH 5C0XI 1O7ZA 1PH1A 3RLFA 4LFBQ 2O5JC 4K8JA 4DV2L 4DUZQ 2NB0A 3A8JE 2N78A 3SGIA 3DEPA 2F0SA 2B2WA 2NVYH 1D5ZC 3HOVB 4DR2L 4HIOA 1SLJA 3CMAA 3PO3H 5ELDA 3BS1A 5IP9H 4BY1B 3UE0A 3W5OA 4GN3B 2YTYA 1ESRA 5EAYA 3EBEA 5BR8Q 1B3QA 1PFMA 1DONA 3GTJB 4DAYB 4KJOA 1AW7A 3NQTA 1UE1A 4GS3A 3TS0A 1SROA 1C9OA 3DMUA 3CC2A 1KRSA 1SMXA 3F2UA 2E2HB 4QUCA 4LK1C 1C0AA 3PF5A 3I56A 2OXPA 4GNXB 4X62L 1LT4D 2NYZD 1XJVA 2F0HA 2A6HD 4DNTB 4P75A 1VQFA 4H7BA 1DOLA 4YCUA 1D1KA 1OO9B 1UNSA 5D3DA 1VQAA 1Q12A 2R3ZA 4ZQ3A 1ESFA 3HFZB 2HT1A 1A63A 2BOSA 4C2MH 4XTCS 4JC0A 4JI5L 5C6AA 1ASYA 4IFDG 1VQHA 3NTHA 3T1YL 1DZ1A 4A3DH 1S72A 2MNAA 5CMDA 5K36H 4IURA 4QMGA 1Q3LA 2F1MA 3K57A 3IFTA 1W2BA 3HRZC 3CC7A 3H91A 1KHIA 4POGA 5H1SE 1WJJA 4PZ8A 1HA6A 1B4OA 1EYDA 2K5HA 4M1UB 2QA4A 3FKIB 4A3EB 1F9RA 4DR5Q 5KYIA 3HKSA 4A4IA 1XMOQ 2A6HC 3SK6A 2BH8A 3BZCA 2ZXOA 2WAQG 2BDNA 1LTLA 2YYZA 1Y1VB 1AH9A 1GUTA 3W2DA 1BUVT 1BCPD 2PPBC 4R1JA 2CW0D 3IKJA 3QOJA 4C3IG 4A93B 4GKKQ 1CSPA 2EYMA 2JSOA 4HIKA 1LTID 5G3LF 1IBKL 1TWGB 4IQZA 3I4MG 4K6LA 3S17H 1K8GA 5C44B 4FF3A 3DWAA 1TS5A 1EY7A 3VYRA 2PZUA 3OW2A 4A3IH 3QG1A 1SMYD 1JMCA 2NVXH 2WV6D 2OT2A 2CW0C 1EYAA 1N36Q 3CXCA 2B63G 2LS01 2NN6H 1UEBA 4GKJQ 1SE8A 4J6HA 1O80A 2X6LA 1JC7A 3RZOH 3VDYA 1I50H 3STBC 1ET9A 1Z9FA 1MKHA 4P71A 1RD9D 3KOJA 1EY6A 2K01A 3DM1A 3E6ZX 3IFDA 3BG3A 2GA4B 5J1ZA 4QY7A 2IX1A 3BYYB 2IJ0A 4GOPA 3PF4A 3U4VA 1FD7D 4MNOA 1U0LA 2Z6KA 3J81E 2UU9L 4JI2L 2IWHA 4E6IA 1JR0D 1X3GA 5FLMH 2E2JB 3NBHA 2JA5H 1PZKD 3HP3A 4Y52H 1IYVA 1TXYA 1NE3A 1G91A 3FDTA 5J39A 5IYCH 1VQ6A 2PQEA 4B3SQ 1E22A 1LABA 1Y1WB 2WB1G 1S5CD 3L2PA 5M5XB 4IFDI 3NELA 3TREA 3KBXA 2RQXA 2PQAB 4OIJA 3NE5B 1EY0A 3FP9A 2N8NA 2JK8A 4XQNA 1JJGA 1HUMA 4DXGA 4A3KH 3S2HH 1K83H 1VQ7A 1N33L 5JJKA 4A3MH 3P20A 2E8GA 1N32Q 3TP5A 1PFNA 4DKAC 2EDGA 3G7LA 1FYCA 3O13A 3S15B 5E1FA 1PHJA 1AE2A 1HQRD 4IN3A 2EYPA 4LFAL 2IY5B 5HURA 5C3EB 1HRJA 4NDXA 2PZTA 3Q24A 3SEBA 3S2DB 5C0XJ 4KD4A 2R6GA 4KKUA 3K7AB 5D14A 2I0QA 5I9PA 1VQDA 2LY7A 5BN4A 2B8GA 4ULLA 2EE1A 3RLOA 1X55A 4M8AA 1F77A 3K58A 3GP7A 3FHWA 3K6OA 2VW9A 2OWOA 2F0WA 3OIQA 5LL6X 3SR1A 4K2LA 3KLSA 1MI2A 5ELEA 4DN4M 3MTSA 4QIWE 1SNMA 1ET6A 2D2CC 4DV1Q 1TWCH 5JEAG 4CKCA 1B70B 1CQVA 3M3YH 4KY6A 3RUZA 2HIXA 1SN8A 4F88A 1PH4A 3PIOA 5IOCA 2TMPA 1ZXTA 2KJXA 5M5WB 2R61A 4TRDA 1XNRQ 2F03A 1CUKA 2L1BA 3NTKA 1N8RC 1PTOD 5M3MB 3TMEA 3QR8A 4AQYQ 1R4PB 3HOVH 2J4XA 1K73C 2K75A 4A3BG 3UDIA 4LFCQ 1G6ZA 1PRTB 5E4XA 2RBMA 4DAPA 4BY1H 2L55A 2EYOA 4YCWA 3HS0C 5A2QL 3URYA 2IL8A 5EQ0A 1CZGA 2VZAA 3GTJH 4L8JA 4R9WA 1MSHA 2HHHL 2OTLA 2LMCB
chains in the Genus database with same CATH topology
1OXVA 3AFQA 3FKIG 3H0GG 3L7ZC 4QL5A 4QJFA 2VQFL 4A3EG 3Q8DA 1HR0Q 4IOAA 1E1TA 4YY3L 4GNXA 1CSQA 2E2HH 4DUYQ 2YTXA 2FXQA 2K4KA 1L1OC 3I2ZA 4DV3L 2Y0SG 4YWLA 5BR8L 2F4VQ 4HIDA 4JI3L 1HNXQ 4B3MQ 1E3PA 1HJPA 1Y1VG 1P16A 1EQQA 1XPUA 1SFOH 4JBMA 4WJ3M 4UP8A 2UUAQ 4B3SL 5GAEC 1KQSA 3G4SA 4LUOA 4ALPA 1J5EQ 3PUYA 1VQGA 2BA0A 1Q86C 3DM3A 1BBWA 1NMFA 1KC8C 2ATWA 1EQRA 4DV2Q 4A93G 3M4OH 1VQLA 4YHHL 3AQQA 4LW1A 1OXSC 3M9BA 4UP7A 1FL0A 2NVQH 1H95A 3F2BA 4LNQA 3GTPH 1G6PA 4GOPC 1VQMA 1V43A 2E2IH 4A3BH 4BBSG 4X65Q 3S24A 3CQZH 4JOIA 4DR2Q 4B3TQ 1IL2A 5C0XG 1R9TH 1IBLQ 5IWAL 2Z6KC 2UU9Q 2R7FA 4JI2Q 2UXDL 1KIXA 4BBRH 2WB1E 5E7NA 1X9NA 1SRUA 3EN2A 4YWKA 4A75A 3U4ZA 3FKIH 1GVPA 3H0GH 4A3EH 1N32L 4IO9A 3TRZA 1FJGL 4NXML 5C44G 1PH7A 1L0WA 4JI4L 4OWWB 3S14H 1Q1BA 2VY3A 2ZJQA 1YJ9A 5JJIA 2I5LX 2AWNA 3CCSA 4GOPB 2JEAI 4ME3A 2DGYA 2MFIA 5FJ8G 3I7FA 2A1AA 1I6HH 4AH6A 2OCEA 1QVCA 3U50C 2JE6I 4LF5Q 4RMFA 4X62Q 1Y1VH 2K50A 4UY8C 4DR5L 1CKMA 1VQJA 1W3SA 4R4CA 4LF9L 1VCIA 1XMOL 3NBHB 4UP9A 2F52A 2R7DA 3OTOL 4A3LH 4DR6Q 4PMWA 3AEVA 1VQIA 3KJPA 1V1QA 5GROA 4A93H 4JV5L 4DV4L 2MO0A 4JI5Q 4LF4Q 2Q2IA 3HOXH 3H3VH 1YEZA 1O7IA 3ICEA 4PZ6A 2JA9A 3T1YQ 1T9HA 1Y14B 4BBSH 2UUCQ 3J81j 5FLXc 3PGZA 3CCLA 5IYBH 1PVOA 3E9IA 4NB3A 3KLWA 1LYLA 1WCMG 1TWGH 5DLQE 1PH9A 1D8LA 4LUZA 3M85A 3UE1A 3HKZE 2VS1A 1TWAH 1WFQA 4KHPL 3CPWA 5C44H 3CP0A 4X64L 4DV1L 1B8AA 1IBMQ 2GVAA 1QUQA 4P72A 1N34Q 4DV7Q 2PNHA 2JA8G 4A3IG 1PH5A 4GN5A 5FJ8H 1YJWA 4K0KL 4X6AH 4JYAL 1XNQQ 3AYHB 2B3GA 1YHQA 2ZJPA 2NN6G 3TEHB 2ASBA 3F2CA 1NBWA 4YWMA 3WWVA 3BJUA 1Y1WG 2NVTH 2CQOA 2F3IA 3GTOH 2CWPA 3GDEA 5GADC 2ZTCA 1X56A 1UWVA 2K5NA 4OX9L 1VQCA 2ZM6Q 4O2DA 1PA6A 2CKZB 1Q7YC 1A0IA 2LXKA 3U58A 5IYDG 4JI7L 4EQ5A 1XNRL 2R92G 5J3BA 3STBD 1VQOA 2UXBL 4DAMA 3F2DA 4DV0L 4A3CH 4RG1A 4AQYL 4GKJL 2UUBQ 5LMNL 2OQ0A 5C4XG 1B7YB 2L15A 5IP7G 3M4QA 1WYDA 3F8TA 2RHQB 3K7UC 2IX0A 2LXJA 3J80c 1HZ9A 2GN5A 4LFCL 3I55A 1DGSA 4IPHA 3RN2A 1NMGA 2YV5A 3PO3G 2K14A 3B6YA 5IP9G 3JAMi 1IBKQ 1XMQL 1EIFA 1CKNA 2RCNA 1I94Q 2E2JH 4NXNQ 1HR0L 1VQ5A 2UXCQ 2JEBI 2JA8H 1XPRA 5C3EG 4DUYL 3K81C 1QUQB 4JI0L 2ID0A 4MZ9A 3GTKH 3JC66 3CCRA 2A8VA 4LF6Q 1QVFA 2F4VL 3S1NH 2Q2TA 1TWHH 1CKOA 2XGTA 4KI0A 5M5XH 4HJAA 1Y1WH 3UDFA 1HNXL 4DNIA 2E5LQ 3ULLA 4B3ML 4DR4Q 4JI6Q 3CCVA 4A3JG 2I5MX 3H3VI 1MJEA 3UDXA 2UUAL 3T1HQ 1IYJB 4BXXH 1J5EL 5C0XI 1PH1A 5IYDH 2QGQA 3RLFA 2R92H 4LFBQ 3H15A 2KHJA 4DV2L 4DUZQ 3RNUA 1Q1EA 2NZOA 4QQBX 2KENA 2N78A 2OQKA 2Y0SE 3SGIA 5C4XH 5IP7H 4AIMA 2HHHQ 2NVYH 1G51A 4OONA 4IOCA 4A3DG 5K36G 4KHZA 4B3TL 5IY0A 4HIOA 4DR2L 1SLJA 3G6EA 3NEMA 3CMAA 1IBLL 4LF7Q 4YY3Q 3PO3H 1I5FA 3MXNB 5IP9H 3JAMc 3UE0A 3W5OA 4GN3B 4GNXC 1VQPA 3S15H 4DR1Q 1D7QA 1OXTA 2YTYA 4LF8L 5EAYA 3PUXA 3EBEA 4P73A 5BR8Q 2C35B 4DAYB 1HZCA 4LWCA 4GLXA 5C3EH 1A8VA 1X54A 4JI8Q 4DK6C 1UE1A 3PUWA 4GS3A 4UPAA 1PYBA 1SROA 1C9OA 3TS0A 3CC2A 1KRSA 1SMXA 4IJHA 2K5VA 1X6OA 3KDFB 1JB7A 3S2DH 4A3FG 1S3OA 4LF5L 2BH2A 3S16H 1C0AA 3PF5A 3I56A 3EIVA 4GNXB 4X62L 3K7AH 2D0OA 3S1QH 3D31A 1XJVA 2BA1A 1V9PA 1ASZA 4P75A 1VQFA 4OWTB 5M3MG 4YCUA 3TS2A 4DR3Q 4O0AA 3A5ZB 4AYBG 4DR6L 2R7ZG 2Q2HA 1JJCB 1VQAA 1Q12A 1KXLA 3HFZB 4JOIC 2HT1A 1A63A 4C2MH 1LUZA 2EQSA 4JC0A 4XTCS 4JI5L 1PFSA 1ASYA 4IFDG 1VQHA 3T1YL 4A3DH 1YVCA 1S72A 2RHSB 2MNAA 1KRTA 1HNZL 2UUCL 1N33Q 5LMUL 1YBYA 3CCUA 2AWOA 4NXMQ 1G291 1W2BA 1HZBA 3CC7A 4HIMA 1KHIA 1P8LA 3CMEA 2ALYB 4X66Q 4POGA 1VQ8A 2XTIA 5H1SE 1WJJA 4JCVE 3KYHC 4PZ8A 2QA4A 2K5HA 4LFAQ 5ELNA 4DR5Q 4GLVB 4A76A 3HKSA 1N34L 4L5SA 5AJ3L 4B3RL 4A4IA 1XMOQ 2DUDA 2I5HA 4A3FH 2WFWA 3RR5A 5M5WH 2BH8A 1QVGA 3BZCA 5IT9c 4A3GG 3HKZG 1JE5A 1Q8KA 2WAQG 4DR7Q 1VS0A 1LTLA 2YYZA 3I4OA 1AH9A 4IFDJ 5GAHC 1J6QA 5M3MH 2ZM6L 1PH8A 2AMCB 4R1JA 1M90C 1X65A 2VQEQ 1X3FA 3RLNA 1VQKA 1BKBA 4HJ8A 1GM5A 1X3EA 4OO1G 1C7YA 4WJ4A 4DK3C 4OXPA 4R4OA 4GKKQ 1OTCA 4HJ5A 1HNWQ 1CSPA 1NY4A 2KBNA 2YTVA 3A0JA 4X64Q 2Q2UA 3A5UA 1LM0A 4FDBA 2VNUD 1PH3A 1Z47A 4C3HH 4HIKA 3GTLH 1IBKL 5M3FG 4JYAQ 3L0OA 1IXRA 1K0RA 2RF4A 1WCMH 3CAMA 2QEXA 3K0XA 1I94L 3I4MG 2VL6A 4NXNL 3W1GA 1GD7A 3S17H 3G48A 3RZDH 2WP8J 1K8GA 2UXCL 1VQ4A 1MJCA 5FLMG 1JT8A 2A19A 1EIYB 4NPSA 2JA5G 4OX9Q 2KHIA 1GKHA 3HOUG 3CCEA 1KD1C 3J7ZC 3OW2A 4A3IH 4LF6L 1L1OA 1JMCA 2NVXH 4JI7Q 1YZ6A 5GQOA 3J81i 5IYCG 2UXBQ 4IPGA 2E5LL 1N36Q 2B63G 3CXCA 4DR4L 1UEBA 2PQAA 4TVAB 4JI6L 3I4NG 4GKJQ 1YHAA 2R93G 2H5XA 1FGUA 1SE8A 4IPCA 3RZOH 3T1HL 5M5YH 3VDYA 1I50H 1YNXA 1Q46A 4P74A 4GLAC 4OWXB 3STBC 1Z9FA 4LFBL 4C3IH 1MKHA 4P71A 3KOJA 4DUZL 4IJLA 4APVA 1GO3E 4DV6Q 3CC4A 1EYGA 4BBRG 3PV0A 1BVSA 4A3KG 1NJIC 4QY7A 1MIUA 4JI1Q 2IX1A 1YITA 2D0PA 3TQYA 4BA2I 4IPDA 4GOPA 4A3MG 3PF4A 4DV5Q 4LF7L 3U4VA 4MNOA 2LSSA 1U0LA 2K52A 4X65L 5M3FH 5C4JH 2Z6KA 4DR1L 2VQFQ 4JI0Q 1EFWA 2VUMG 3LGJA 2UU9L 3I4MH 4JI2L 2IHFA 1YIJA 1PV4A 1VQNA 2NZHA 1X3GA 5IE8A 3D0FA 4KLKA 5FLMH 4DV3Q 2IHEA 3K80C 4JI8L 5JJLA 1PH2A 1K3RA 3AFPA 2JA5H 4BY7G 3S1MH 3HOUH 1CKNB 4XIGS 4JI3Q 4Y7NH 1EWIA 1TXYA 1NE3A 4Y52H 4QGUA 3KJOA 3OYYA 4R4TA 3HOWG 2OTJA 3J81c 4L5RC 4JBWA 2N49A 5IYCH 1VQ6A 2Z0SA 4B3SQ 1E22A 1WOCA 1L1OB 2ZTEA 2B63H 3I4NH 1RIPA 2WB1G 3L2PA 3S1RH 4IFDI 3NELA 2R93H 4L5QA 3TREA 2N3SA 1VQ9A 3HOXG 4JBKA 3W1BA 2PQAB 2JQOA 1S40A 2B29A 4A3JH 3HOYG 2IT1A 4DR3L 4YHHQ 2KCMA 2MQHA 3FP9A 2N8NA 3M4PA 4R4IA 1AE3A 1UE7A 2JK8A 3BU2A 4L5TA 5IYBG 2JA7G 1JJGA 4JBJA 4MTNA 3HOZG 3ER0A 3KF8B 2AHOB 4LF8Q 5IWAQ 2HIVA 4A3KH 3PUZA 4BA1I 4PZ7A 1Q81C 1M1KC 1K83H 1QZGA 4LF4L 3S2HH 1VQ7A 2UXDQ 1K8AC 1N33L 2JA6G 5JJKA 3ERSX 4A3MH 2E8GA 1NTGA 1OXXK 1N32Q 1FJGQ 4DKAC 1E1OA 1E7ZA 4X66L 4JI4Q 2VUMH 3KF6A 2JJQA 1PHJA 4AYBE 1AE2A 3ULJA 3M7NA 2NN6I 1IZ6A 4LFAL 4BY7H 2IY5B 3F1ZA 3RN5A 5LMNW 3GO5A 1IBML 3HOWH 2D62A 4DV7L 4LF9Q 1KAWA 5C0XJ 4POFA 1XPOA 1XNQL 3PIPA 1RL2A 2R6GA 4DR7L 3OTOQ 3NENA 4OO1I 4J15A 1YJNA 4A3CG 2I0QA 3HOYH 1YHBA 1Q82C 4JV5Q 4DV4Q 4C3JH 1L2FA 1VQDA 1N9WA 1HNZQ 3MEFA 3E9HA 3PO2G 3RLOA 5LMUQ 2JA7H 1X55A 1HR0W 3J80i 3CCMA 1YI2A 2VQEL 3FHWA 2V1CC 2VW9A 2R7ZH 2KCTA 2OWOA 3HOVG 3HOZH 1PYSB 2CFMA 1EOVA 2AKWB 4BY1G 1UE5A 2WAQE 2JA6H 2UUBL 4GKKL 1HNWL 3ZJYC 4JG2A 1UE6A 4QIWE 5AJ3Q 4B3RQ 4KHPQ 5GAGC 1HZAA 1I3QH 3CCJA 4DV1Q 1TWCH 2ES2A 4H02A 2HQLA 5JEAG 4K0KQ 3GTQH 1B70B 3KF6B 2MO1A 3M3YH 1QZHA 5ELOA 3CPFA 2EXDA 2HIXA 1SN8A 3CF5A 4R4QA 2PMZE 1PH4A 1PH6A 3E0EA 3PIOA 3GTMH 3IRBA 3CW2C 2PI2E 1FVIA 3BZKA 3J7A5 4BXXG 3PSIA 1SR3A 3PUVA 4EX5A 1BBUA 1HH2P 4HJ7A 1K9MC 3ULPA 1N36L 4A3GH 3G71A 3CD6A 1JJ2A 1XNRQ 1CUKA 1E24A 1N8RC 2YU9H 4TQUS 3CCQA 4DV0Q 3DLLA 3PCOB 3PO2H 4AQYQ 4DPGA 5LMNQ 3K8AA 3A74A 2CWAA 1XTDA 1A62A 1OXUA 3HOVH 3GD7A 1K73C 4DV6L 2K75A 4A3BG 3UDIA 5HGQA 4LFCQ 1EUJA 2CCZA 4A3LG 4GN4B 1VQEA 4BY1H 1WI5A 4LUVA 2EIFA 1KL9A 4YCWA 5JEAJ 3GTGH 2PI2A 4HJ9A 4JI1L 3UDGA 1XMQQ 1VQBA 2VZAA 4YCVA 3GTJH 1U5KA 2ZTDA 5HY6A 4PG3A 2ZJRA 4DV5L 2GVBA 2HHHL 3KFUA 2OTLA 1TWFH 3KDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXV A;  3AFQ A;  3FKI G;  3H0G G;  3L7Z C;  4QL5 A;  4QJF A;  2VQF L;  4A3E G;  3Q8D A;  1HR0 Q;  4IOA A;  1E1T A;  4YY3 L;  4GNX A;  1CSQ A;  2E2H H;  4DUY Q;  2YTX A;  2FXQ A;  2K4K A;  1L1O C;  3I2Z A;  4DV3 L;  2Y0S G;  4YWL A;  5BR8 L;  2F4V Q;  4HID A;  4JI3 L;  1HNX Q;  4B3M Q;  1E3P A;  1HJP A;  1Y1V G;  1P16 A;  1EQQ A;  1XPU A;  1SFO H;  4JBM A;  4WJ3 M;  4UP8 A;  2UUA Q;  4B3S L;  5GAE C;  1KQS A;  3G4S A;  4LUO A;  4ALP A;  1J5E Q;  3PUY A;  1VQG A;  2BA0 A;  1Q86 C;  3DM3 A;  1BBW A;  1NMF A;  1KC8 C;  2ATW A;  1EQR A;  4DV2 Q;  4A93 G;  3M4O H;  1VQL A;  4YHH L;  3AQQ A;  4LW1 A;  1OXS C;  3M9B A;  4UP7 A;  1FL0 A;  2NVQ H;  1H95 A;  3F2B A;  4LNQ A;  3GTP H;  1G6P A;  4GOP C;  1VQM A;  1V43 A;  2E2I H;  4A3B H;  4BBS G;  4X65 Q;  3S24 A;  3CQZ H;  4JOI A;  4DR2 Q;  4B3T Q;  1IL2 A;  5C0X G;  1R9T H;  1IBL Q;  5IWA L;  2Z6K C;  2UU9 Q;  2R7F A;  4JI2 Q;  2UXD L;  1KIX A;  4BBR H;  2WB1 E;  5E7N A;  1X9N A;  1SRU A;  3EN2 A;  4YWK A;  4A75 A;  3U4Z A;  3FKI H;  1GVP A;  3H0G H;  4A3E H;  1N32 L;  4IO9 A;  3TRZ A;  1FJG L;  4NXM L;  5C44 G;  1PH7 A;  1L0W A;  4JI4 L;  4OWW B;  3S14 H;  1Q1B A;  2VY3 A;  2ZJQ A;  1YJ9 A;  5JJI A;  2I5L X;  2AWN A;  3CCS A;  4GOP B;  2JEA I;  4ME3 A;  2DGY A;  2MFI A;  5FJ8 G;  3I7F A;  2A1A A;  1I6H H;  4AH6 A;  2OCE A;  1QVC A;  3U50 C;  2JE6 I;  4LF5 Q;  4RMF A;  4X62 Q;  1Y1V H;  2K50 A;  4UY8 C;  4DR5 L;  1CKM A;  1VQJ A;  1W3S A;  4R4C A;  4LF9 L;  1VCI A;  1XMO L;  3NBH B;  4UP9 A;  2F52 A;  2R7D A;  3OTO L;  4A3L H;  4DR6 Q;  4PMW A;  3AEV A;  1VQI A;  3KJP A;  1V1Q A;  5GRO A;  4A93 H;  4JV5 L;  4DV4 L;  2MO0 A;  4JI5 Q;  4LF4 Q;  2Q2I A;  3HOX H;  3H3V H;  1YEZ A;  1O7I A;  3ICE A;  4PZ6 A;  2JA9 A;  3T1Y Q;  1T9H A;  1Y14 B;  4BBS H;  2UUC Q;  3J81 j;  5FLX c;  3PGZ A;  3CCL A;  5IYB H;  1PVO A;  3E9I A;  4NB3 A;  3KLW A;  1LYL A;  1WCM G;  1TWG H;  5DLQ E;  1PH9 A;  1D8L A;  4LUZ A;  3M85 A;  3UE1 A;  3HKZ E;  2VS1 A;  1TWA H;  1WFQ A;  4KHP L;  3CPW A;  5C44 H;  3CP0 A;  4X64 L;  4DV1 L;  1B8A A;  1IBM Q;  2GVA A;  1QUQ A;  4P72 A;  1N34 Q;  4DV7 Q;  2PNH A;  2JA8 G;  4A3I G;  1PH5 A;  4GN5 A;  5FJ8 H;  1YJW A;  4K0K L;  4X6A H;  4JYA L;  1XNQ Q;  3AYH B;  2B3G A;  1YHQ A;  2ZJP A;  2NN6 G;  3TEH B;  2ASB A;  3F2C A;  1NBW A;  4YWM A;  3WWV A;  3BJU A;  1Y1W G;  2NVT H;  2CQO A;  2F3I A;  3GTO H;  2CWP A;  3GDE A;  5GAD C;  2ZTC A;  1X56 A;  1UWV A;  2K5N A;  4OX9 L;  1VQC A;  2ZM6 Q;  4O2D A;  1PA6 A;  2CKZ B;  1Q7Y C;  1A0I A;  2LXK A;  3U58 A;  5IYD G;  4JI7 L;  4EQ5 A;  1XNR L;  2R92 G;  5J3B A;  3STB D;  1VQO A;  2UXB L;  4DAM A;  3F2D A;  4DV0 L;  4A3C H;  4RG1 A;  4AQY L;  4GKJ L;  2UUB Q;  5LMN L;  2OQ0 A;  5C4X G;  1B7Y B;  2L15 A;  5IP7 G;  3M4Q A;  1WYD A;  3F8T A;  2RHQ B;  3K7U C;  2IX0 A;  2LXJ A;  3J80 c;  1HZ9 A;  2GN5 A;  4LFC L;  3I55 A;  1DGS A;  4IPH A;  3RN2 A;  1NMG A;  2YV5 A;  3PO3 G;  2K14 A;  3B6Y A;  5IP9 G;  3JAM i;  1IBK Q;  1XMQ L;  1EIF A;  1CKN A;  2RCN A;  1I94 Q;  2E2J H;  4NXN Q;  1HR0 L;  1VQ5 A;  2UXC Q;  2JEB I;  2JA8 H;  1XPR A;  5C3E G;  4DUY L;  3K81 C;  1QUQ B;  4JI0 L;  2ID0 A;  4MZ9 A;  3GTK H;  3JC6 6;  3CCR A;  2A8V A;  4LF6 Q;  1QVF A;  2F4V L;  3S1N H;  2Q2T A;  1TWH H;  1CKO A;  2XGT A;  4KI0 A;  5M5X H;  4HJA A;  1Y1W H;  3UDF A;  1HNX L;  4DNI A;  2E5L Q;  3ULL A;  4B3M L;  4DR4 Q;  4JI6 Q;  3CCV A;  4A3J G;  2I5M X;  3H3V I;  1MJE A;  3UDX A;  2UUA L;  3T1H Q;  1IYJ B;  4BXX H;  1J5E L;  5C0X I;  1PH1 A;  5IYD H;  2QGQ A;  3RLF A;  2R92 H;  4LFB Q;  3H15 A;  2KHJ A;  4DV2 L;  4DUZ Q;  3RNU A;  1Q1E A;  2NZO A;  4QQB X;  2KEN A;  2N78 A;  2OQK A;  2Y0S E;  3SGI A;  5C4X H;  5IP7 H;  4AIM A;  2HHH Q;  2NVY H;  1G51 A;  4OON A;  4IOC A;  4A3D G;  5K36 G;  4KHZ A;  4B3T L;  5IY0 A;  4HIO A;  4DR2 L;  1SLJ A;  3G6E A;  3NEM A;  3CMA A;  1IBL L;  4LF7 Q;  4YY3 Q;  3PO3 H;  1I5F A;  3MXN B;  5IP9 H;  3JAM c;  3UE0 A;  3W5O A;  4GN3 B;  4GNX C;  1VQP A;  3S15 H;  4DR1 Q;  1D7Q A;  1OXT A;  2YTY A;  4LF8 L;  5EAY A;  3PUX A;  3EBE A;  4P73 A;  5BR8 Q;  2C35 B;  4DAY B;  1HZC A;  4LWC A;  4GLX A;  5C3E H;  1A8V A;  1X54 A;  4JI8 Q;  4DK6 C;  1UE1 A;  3PUW A;  4GS3 A;  4UPA A;  1PYB A;  1SRO A;  1C9O A;  3TS0 A;  3CC2 A;  1KRS A;  1SMX A;  4IJH A;  2K5V A;  1X6O A;  3KDF B;  1JB7 A;  3S2D H;  4A3F G;  1S3O A;  4LF5 L;  2BH2 A;  3S16 H;  1C0A A;  3PF5 A;  3I56 A;  3EIV A;  4GNX B;  4X62 L;  3K7A H;  2D0O A;  3S1Q H;  3D31 A;  1XJV A;  2BA1 A;  1V9P A;  1ASZ A;  4P75 A;  1VQF A;  4OWT B;  5M3M G;  4YCU A;  3TS2 A;  4DR3 Q;  4O0A A;  3A5Z B;  4AYB G;  4DR6 L;  2R7Z G;  2Q2H A;  1JJC B;  1VQA A;  1Q12 A;  1KXL A;  3HFZ B;  4JOI C;  2HT1 A;  1A63 A;  4C2M H;  1LUZ A;  2EQS A;  4JC0 A;  4XTC S;  4JI5 L;  1PFS A;  1ASY A;  4IFD G;  1VQH A;  3T1Y L;  4A3D H;  1YVC A;  1S72 A;  2RHS B;  2MNA A;  1KRT A;  1HNZ L;  2UUC L;  1N33 Q;  5LMU L;  1YBY A;  3CCU A;  2AWO A;  4NXM Q;  1G29 1;  1W2B A;  1HZB A;  3CC7 A;  4HIM A;  1KHI A;  1P8L A;  3CME A;  2ALY B;  4X66 Q;  4POG A;  1VQ8 A;  2XTI A;  5H1S E;  1WJJ A;  4JCV E;  3KYH C;  4PZ8 A;  2QA4 A;  2K5H A;  4LFA Q;  5ELN A;  4DR5 Q;  4GLV B;  4A76 A;  3HKS A;  1N34 L;  4L5S A;  5AJ3 L;  4B3R L;  4A4I A;  1XMO Q;  2DUD A;  2I5H A;  4A3F H;  2WFW A;  3RR5 A;  5M5W H;  2BH8 A;  1QVG A;  3BZC A;  5IT9 c;  4A3G G;  3HKZ G;  1JE5 A;  1Q8K A;  2WAQ G;  4DR7 Q;  1VS0 A;  1LTL A;  2YYZ A;  3I4O A;  1AH9 A;  4IFD J;  5GAH C;  1J6Q A;  5M3M H;  2ZM6 L;  1PH8 A;  2AMC B;  4R1J A;  1M90 C;  1X65 A;  2VQE Q;  1X3F A;  3RLN A;  1VQK A;  1BKB A;  4HJ8 A;  1GM5 A;  1X3E A;  4OO1 G;  1C7Y A;  4WJ4 A;  4DK3 C;  4OXP A;  4R4O A;  4GKK Q;  1OTC A;  4HJ5 A;  1HNW Q;  1CSP A;  1NY4 A;  2KBN A;  2YTV A;  3A0J A;  4X64 Q;  2Q2U A;  3A5U A;  1LM0 A;  4FDB A;  2VNU D;  1PH3 A;  1Z47 A;  4C3H H;  4HIK A;  3GTL H;  1IBK L;  5M3F G;  4JYA Q;  3L0O A;  1IXR A;  1K0R A;  2RF4 A;  1WCM H;  3CAM A;  2QEX A;  3K0X A;  1I94 L;  3I4M G;  2VL6 A;  4NXN L;  3W1G A;  1GD7 A;  3S17 H;  3G48 A;  3RZD H;  2WP8 J;  1K8G A;  2UXC L;  1VQ4 A;  1MJC A;  5FLM G;  1JT8 A;  2A19 A;  1EIY B;  4NPS A;  2JA5 G;  4OX9 Q;  2KHI A;  1GKH A;  3HOU G;  3CCE A;  1KD1 C;  3J7Z C;  3OW2 A;  4A3I H;  4LF6 L;  1L1O A;  1JMC A;  2NVX H;  4JI7 Q;  1YZ6 A;  5GQO A;  3J81 i;  5IYC G;  2UXB Q;  4IPG A;  2E5L L;  1N36 Q;  2B63 G;  3CXC A;  4DR4 L;  1UEB A;  2PQA A;  4TVA B;  4JI6 L;  3I4N G;  4GKJ Q;  1YHA A;  2R93 G;  2H5X A;  1FGU A;  1SE8 A;  4IPC A;  3RZO H;  3T1H L;  5M5Y H;  3VDY A;  1I50 H;  1YNX A;  1Q46 A;  4P74 A;  4GLA C;  4OWX B;  3STB C;  1Z9F A;  4LFB L;  4C3I H;  1MKH A;  4P71 A;  3KOJ A;  4DUZ L;  4IJL A;  4APV A;  1GO3 E;  4DV6 Q;  3CC4 A;  1EYG A;  4BBR G;  3PV0 A;  1BVS A;  4A3K G;  1NJI C;  4QY7 A;  1MIU A;  4JI1 Q;  2IX1 A;  1YIT A;  2D0P A;  3TQY A;  4BA2 I;  4IPD A;  4GOP A;  4A3M G;  3PF4 A;  4DV5 Q;  4LF7 L;  3U4V A;  4MNO A;  2LSS A;  1U0L A;  2K52 A;  4X65 L;  5M3F H;  5C4J H;  2Z6K A;  4DR1 L;  2VQF Q;  4JI0 Q;  1EFW A;  2VUM G;  3LGJ A;  2UU9 L;  3I4M H;  4JI2 L;  2IHF A;  1YIJ A;  1PV4 A;  1VQN A;  2NZH A;  1X3G A;  5IE8 A;  3D0F A;  4KLK A;  5FLM H;  4DV3 Q;  2IHE A;  3K80 C;  4JI8 L;  5JJL A;  1PH2 A;  1K3R A;  3AFP A;  2JA5 H;  4BY7 G;  3S1M H;  3HOU H;  1CKN B;  4XIG S;  4JI3 Q;  4Y7N H;  1EWI A;  1TXY A;  1NE3 A;  4Y52 H;  4QGU A;  3KJO A;  3OYY A;  4R4T A;  3HOW G;  2OTJ A;  3J81 c;  4L5R C;  4JBW A;  2N49 A;  5IYC H;  1VQ6 A;  2Z0S A;  4B3S Q;  1E22 A;  1WOC A;  1L1O B;  2ZTE A;  2B63 H;  3I4N H;  1RIP A;  2WB1 G;  3L2P A;  3S1R H;  4IFD I;  3NEL A;  2R93 H;  4L5Q A;  3TRE A;  2N3S A;  1VQ9 A;  3HOX G;  4JBK A;  3W1B A;  2PQA B;  2JQO A;  1S40 A;  2B29 A;  4A3J H;  3HOY G;  2IT1 A;  4DR3 L;  4YHH Q;  2KCM A;  2MQH A;  3FP9 A;  2N8N A;  3M4P A;  4R4I A;  1AE3 A;  1UE7 A;  2JK8 A;  3BU2 A;  4L5T A;  5IYB G;  2JA7 G;  1JJG A;  4JBJ A;  4MTN A;  3HOZ G;  3ER0 A;  3KF8 B;  2AHO B;  4LF8 Q;  5IWA Q;  2HIV A;  4A3K H;  3PUZ A;  4BA1 I;  4PZ7 A;  1Q81 C;  1M1K C;  1K83 H;  1QZG A;  4LF4 L;  3S2H H;  1VQ7 A;  2UXD Q;  1K8A C;  1N33 L;  2JA6 G;  5JJK A;  3ERS X;  4A3M H;  2E8G A;  1NTG A;  1OXX K;  1N32 Q;  1FJG Q;  4DKA C;  1E1O A;  1E7Z A;  4X66 L;  4JI4 Q;  2VUM H;  3KF6 A;  2JJQ A;  1PHJ A;  4AYB E;  1AE2 A;  3ULJ A;  3M7N A;  2NN6 I;  1IZ6 A;  4LFA L;  4BY7 H;  2IY5 B;  3F1Z A;  3RN5 A;  5LMN W;  3GO5 A;  1IBM L;  3HOW H;  2D62 A;  4DV7 L;  4LF9 Q;  1KAW A;  5C0X J;  4POF A;  1XPO A;  1XNQ L;  3PIP A;  1RL2 A;  2R6G A;  4DR7 L;  3OTO Q;  3NEN A;  4OO1 I;  4J15 A;  1YJN A;  4A3C G;  2I0Q A;  3HOY H;  1YHB A;  1Q82 C;  4JV5 Q;  4DV4 Q;  4C3J H;  1L2F A;  1VQD A;  1N9W A;  1HNZ Q;  3MEF A;  3E9H A;  3PO2 G;  3RLO A;  5LMU Q;  2JA7 H;  1X55 A;  1HR0 W;  3J80 i;  3CCM A;  1YI2 A;  2VQE L;  3FHW A;  2V1C C;  2VW9 A;  2R7Z H;  2KCT A;  2OWO A;  3HOV G;  3HOZ H;  1PYS B;  2CFM A;  1EOV A;  2AKW B;  4BY1 G;  1UE5 A;  2WAQ E;  2JA6 H;  2UUB L;  4GKK L;  1HNW L;  3ZJY C;  4JG2 A;  1UE6 A;  4QIW E;  5AJ3 Q;  4B3R Q;  4KHP Q;  5GAG C;  1HZA A;  1I3Q H;  3CCJ A;  4DV1 Q;  1TWC H;  2ES2 A;  4H02 A;  2HQL A;  5JEA G;  4K0K Q;  3GTQ H;  1B70 B;  3KF6 B;  2MO1 A;  3M3Y H;  1QZH A;  5ELO A;  3CPF A;  2EXD A;  2HIX A;  1SN8 A;  3CF5 A;  4R4Q A;  2PMZ E;  1PH4 A;  1PH6 A;  3E0E A;  3PIO A;  3GTM H;  3IRB A;  3CW2 C;  2PI2 E;  1FVI A;  3BZK A;  3J7A 5;  4BXX G;  3PSI A;  1SR3 A;  3PUV A;  4EX5 A;  1BBU A;  1HH2 P;  4HJ7 A;  1K9M C;  3ULP A;  1N36 L;  4A3G H;  3G71 A;  3CD6 A;  1JJ2 A;  1XNR Q;  1CUK A;  1E24 A;  1N8R C;  2YU9 H;  4TQU S;  3CCQ A;  4DV0 Q;  3DLL A;  3PCO B;  3PO2 H;  4AQY Q;  4DPG A;  5LMN Q;  3K8A A;  3A74 A;  2CWA A;  1XTD A;  1A62 A;  1OXU A;  3HOV H;  3GD7 A;  1K73 C;  4DV6 L;  2K75 A;  4A3B G;  3UDI A;  5HGQ A;  4LFC Q;  1EUJ A;  2CCZ A;  4A3L G;  4GN4 B;  1VQE A;  4BY1 H;  1WI5 A;  4LUV A;  2EIF A;  1KL9 A;  4YCW A;  5JEA J;  3GTG H;  2PI2 A;  4HJ9 A;  4JI1 L;  3UDG A;  1XMQ Q;  1VQB A;  2VZA A;  4YCV A;  3GTJ H;  1U5K A;  2ZTD A;  5HY6 A;  4PG3 A;  2ZJR A;  4DV5 L;  2GVB A;  2HHH L;  3KFU A;  2OTL A;  1TWF H;  3KDF A; 
#chains in the Genus database with same CATH topology
 3OSO A;  3H0G G;  3Q8D A;  4C3H B;  2E2H H;  1CSQ A;  2F0M A;  3GTL B;  3C1F A;  2YTX A;  4DV3 L;  1IKL A;  2LKV A;  3NTI A;  1HPC A;  4B3M Q;  1HJP A;  2F0V A;  2B2Y C;  1SDF A;  2F0T A;  2JP1 A;  5KNB A;  4WJ3 M;  2K1B A;  4X3K A;  3HKZ B;  5GAE C;  4BWG B;  4ALP A;  2J0T D;  2AQ3 B;  2SEB D;  1VQG A;  2RSN A;  3Q0A A;  1VF7 A;  2NBF A;  3DM3 A;  1EU4 A;  1STB A;  4K8I A;  4FYD A;  3Q22 A;  3M9B A;  5IOD A;  5I6Y A;  4G7Z C;  1QJO A;  4KMU C;  4WJW A;  1B50 A;  4B3T Q;  3IAY A;  2MGS A;  4JOI A;  1B9M A;  1IBL Q;  2UU9 Q;  2PMZ B;  4JI2 Q;  2UXD L;  3VYU A;  1KIX A;  3NWS A;  2KA7 A;  1X9N A;  1SE3 A;  3FKI H;  4A3E H;  4XYQ A;  2F0G A;  3TRZ A;  1AN8 A;  1FJG L;  1PH7 A;  4OWW B;  3SE0 A;  1S5D D;  1YJ9 A;  4GOP B;  1F2L A;  3R2I A;  4ME3 A;  2DGY A;  3SHL A;  3OIP A;  4ODG A;  4XQJ A;  1Y1V H;  2K50 A;  3S1M B;  3HOU B;  2O4X A;  4Y7N B;  3TSS A;  4PV1 C;  3NBH B;  3C2P A;  2F52 A;  3OTO L;  4PNY A;  4DR6 Q;  1EQT A;  2R93 B;  3S1R B;  4A93 H;  4DV4 L;  4QF4 A;  2MO0 A;  4RGO S;  1A2U A;  2JA9 A;  1T9H A;  1Y14 B;  4BBS H;  2UUC Q;  1B44 D;  1NAP A;  5FLX c;  4XYO A;  4OL7 A;  4C3H G;  4HMJ A;  3E9I A;  1C8C A;  3T51 B;  1TWG H;  1BOS A;  2O5I C;  2DNE A;  5AFW A;  4CGY B;  3J7A F;  3M85 A;  1EWC A;  4KK7 A;  5A2Q E;  4KHP L;  3CPW A;  5C44 H;  3TBI B;  1U4M A;  1O78 A;  4F87 A;  1PYW D;  1PH5 A;  5FJ8 H;  2F0F A;  4HAE A;  4O1N A;  3VR4 A;  2B3G A;  3TDQ A;  2K03 A;  3WWV A;  5IGG A;  1SAP A;  4XT3 B;  4OX9 L;  2B2T A;  1VQC A;  1DM0 B;  2WAC A;  1A0I A;  2Z9H A;  4EQ5 A;  4PMB A;  2HCC A;  4K6D A;  4DV0 L;  1O7Y A;  2RSO A;  1F9P A;  4C3J B;  5LMN L;  2OQ0 A;  2L15 A;  3GQB A;  2JA7 B;  2IX0 A;  4RCN A;  3J80 c;  4CHT B;  1DGS A;  3PO3 G;  2K14 A;  5IP9 G;  3K5O A;  2H4O A;  5KRU A;  5EBC A;  3JAM i;  4C1N K;  1K28 A;  4DAY A;  2RCN A;  5IGF A;  2E2J H;  1VQ5 A;  5KGU A;  2UXC Q;  1SE2 A;  3K81 C;  1QUQ B;  3SDZ A;  3SK8 A;  1TS3 A;  1STN A;  1JWM D;  2A8V A;  1V1P B;  1QVF A;  1SE4 A;  1KLU D;  1EY9 A;  2XGT A;  1Y1W H;  3D4W A;  5M5X H;  4HJA A;  3UDF A;  2E5L Q;  4DR4 Q;  3ULL A;  5I2Y A;  1D5M C;  2I5M X;  3H3V I;  3GTM B;  3BVZ A;  2KHS A;  2UUA L;  4J1M A;  4CJ2 C;  3BVM A;  1J5E L;  5IYD H;  1A15 A;  2QGQ A;  5J22 A;  2KVM A;  4A3G B;  2KHJ A;  2SNM A;  4RGN A;  3BDO A;  5G3L D;  2YU9 B;  2KEN A;  1JB3 A;  2I07 B;  4AIM A;  1Z6H A;  4RFB A;  3TN2 A;  2HHH Q;  4A3D G;  3V2T A;  5K36 G;  5DNF A;  3G6E A;  2EPB A;  5IGB A;  4O42 A;  4EVO A;  4DR1 Q;  3S15 H;  1OXT A;  1D7Q A;  3PUX A;  2CH4 A;  4P73 A;  1NUC A;  1RTO A;  4X3S A;  1I4H A;  1U9R A;  2QDB A;  5C3E H;  4JI8 Q;  1X54 A;  4UPA A;  3D6W A;  1I4X A;  3S2D H;  3FEW X;  5EBD A;  3ERO A;  4LF5 L;  2BH2 A;  3FRP B;  2NTT A;  3P7J A;  3K7A H;  4Q0F A;  1ASZ A;  3V05 A;  4V0B A;  1JCK B;  1K8M A;  1CFM A;  3TS2 A;  1CZW A;  2F3V A;  2Q2H A;  3JAM L;  1QWY A;  1KLG D;  1LUZ A;  2ICE C;  3Q6S A;  3MAQ A;  1SNC A;  1G2T A;  5FO9 B;  1KRT A;  1TKW B;  1XWE A;  2AWO A;  3CCU A;  1G29 1;  2E2I B;  4X66 Q;  2XTI A;  3KYH C;  5D3I B;  1HTP A;  5CV5 A;  3OW7 A;  5ELN A;  4B08 A;  2WKD A;  1N34 L;  5AJ3 L;  4B3R L;  3OWE B;  1QB5 D;  4U68 A;  2B2U A;  4A3G G;  5M5W H;  5IT9 c;  2L0C A;  1Q8K A;  3H3V C;  1YNN D;  4KD3 A;  1JIC A;  1WTX A;  5M3M H;  3MXG A;  4N9P A;  1CHP D;  2VQE Q;  1X3F A;  1BKB A;  2QIL A;  1I4R A;  1GM5 A;  1NCV A;  3T56 B;  2F0J A;  2B2V A;  4MTK A;  4DK3 C;  3FPP A;  3OWF A;  2YTV A;  2Q2U A;  2KBN A;  1SYF A;  3A5U A;  4FDB A;  2VNU D;  1Z47 A;  4C3H H;  3GTL H;  1SSO A;  1HXY D;  4NXN L;  3W1G A;  2PYK A;  3G48 A;  3K59 A;  3HEJ A;  1TT2 A;  3PQI A;  5FLM G;  2A19 A;  1EIY B;  1LTA D;  2JA5 G;  4OX9 Q;  2ZXR A;  1GKH A;  1YNN C;  4RWS C;  5C5L A;  3CCE A;  3NQI A;  4LF6 L;  3KLS X;  4OEM B;  3J81 i;  5IYC G;  4IPG A;  4PMC A;  1IW7 C;  1STG A;  2PQA A;  2RDH A;  2FFK B;  2H5X A;  4IPC A;  5JOB A;  3W3A A;  2KOL A;  1GUW A;  2SOB A;  4OWX B;  4GLA C;  5C3W A;  1ILP A;  4APV A;  3T16 A;  3CC4 A;  3JAM E;  1BVS A;  3H09 A;  4A3K G;  1Y69 U;  1RCV D;  4BA2 I;  4IZ8 A;  4A3M G;  4LF7 L;  4ZK9 B;  2LSS A;  4CKB A;  4X65 L;  1EFW A;  3LGJ A;  1VQN A;  1SBB B;  1XX8 A;  1Z7T A;  5FO7 B;  3LWE A;  3AFP A;  3S1M H;  3HOU H;  3OMG A;  2JA8 B;  2G9D A;  4Y7N H;  3AMU A;  3KJO A;  4R4T A;  1GHK A;  2N49 A;  2EYL A;  2EYH A;  1WTO A;  2R93 H;  3S1R H;  3NBI A;  4L5Q A;  4NMZ A;  2MP1 A;  4JBK A;  2B29 A;  2IT1 A;  4DR3 L;  1A2T A;  4I65 A;  1EEI D;  2RA4 A;  1ONL A;  1UE7 A;  5CV9 A;  2R92 B;  1GUS A;  3BU2 A;  5L37 A;  5LHY 1;  2XNA C;  1A3T A;  3I91 A;  2HIV A;  3PUZ A;  4BA1 I;  3NHH A;  4PZ7 A;  4LF4 L;  1QZG A;  1K8A C;  3LWU A;  1Y8N B;  1NTG A;  1WTQ A;  1E1O A;  1E7Z A;  3J81 L;  4JI4 Q;  1MHW C;  3TP8 A;  1JE4 A;  2NN6 I;  3F1Z A;  4I7A A;  1TR5 A;  3GO5 A;  1IBM L;  2D62 A;  5EKK A;  1XPO A;  4DR7 L;  4J15 A;  1YJN A;  3S1Q B;  2E76 C;  4C3J H;  5CV7 A;  2TSS A;  3R93 A;  4HCE A;  2JA7 H;  4IUT A;  1YI2 A;  2IPK D;  4IAL A;  3HOV G;  1PYS B;  2AUK A;  2AKW B;  4BY1 G;  1EL0 A;  3ZYY X;  1HNW L;  5JVG 3;  3L9A X;  2ZT9 C;  2XRS D;  1UEA B;  5AJ3 Q;  4B3R Q;  3AB9 A;  1LT5 D;  4BBS B;  2PW5 A;  4XQQ A;  1XXG A;  4OGQ C;  5I4D A;  3CPF A;  2PMZ E;  4NKL A;  3E0E A;  3GTM H;  1HTL D;  1ZEQ X;  1C4Q A;  3KBG A;  3J7A 5;  4A3F B;  4EX5 A;  3PUV A;  1BBU A;  4A3G H;  3CD6 A;  1JJ2 A;  4HCS A;  4DK0 A;  1BCP C;  1O7L A;  3OMC A;  2YU9 H;  1FNU A;  2EY2 A;  1QIL A;  3A74 A;  2IW3 A;  1XTD A;  4AYB B;  1OXU A;  3GD7 A;  4DV6 L;  3WOF A;  1CHQ D;  5HGQ A;  2MHV A;  4FNF A;  1FNW A;  1KL9 A;  2EIF A;  4HJ9 A;  4JI1 L;  1EZ6 A;  1LTS D;  1XMQ Q;  1VQB A;  1W6K A;  2PNR C;  1U5K A;  4DV5 L;  4QB4 A;  1BXT A;  1A6X A;  3MC0 B;  3DXJ C;  3KDF A;  3I8Z A;  1OXV A;  3FKI G;  4A3E G;  4LMQ D;  2VQF L;  4IOA A;  3GV6 A;  3E0J A;  4YY3 L;  4DUY Q;  1L1O C;  2F0I A;  2VXW A;  1DXM A;  2F4V Q;  2XIW A;  4JI3 L;  1SMY C;  2A5H A;  1Y1V G;  2D9U A;  1XPU A;  4DK1 A;  2RCF A;  1X32 A;  5EPJ A;  3BDL A;  4UP8 A;  4KKS A;  2BA0 A;  1GUG A;  2ATW A;  1EQR A;  4IUQ A;  3PIP 3;  4DV2 Q;  2K7V A;  3CHB D;  4A93 G;  1VQL A;  3BVG A;  3DWQ A;  1HA5 A;  4YHH L;  5JJZ A;  4LW1 A;  1OXS C;  5M5Y B;  4ZUI A;  1QNU A;  4BBS G;  1V43 A;  2E2I H;  4X65 Q;  3S24 A;  4DR2 Q;  4C1N I;  5IWA L;  2R7F A;  3LX0 A;  5DEH A;  2F3W A;  1PRT F;  4RCO A;  3ND9 A;  5E7N A;  3EN2 A;  1ENF A;  2M9V A;  3OHX C;  4NXM L;  5C44 G;  1L0W A;  1Q1B A;  3CKI B;  3TZD A;  1EY8 A;  5M3F B;  5JJI A;  5DM6 3;  2I5L X;  1GHJ A;  5FJ8 G;  3I7F A;  4S3S A;  2OCE A;  1QVC A;  1RKN A;  2J7Z A;  4RMF A;  1RJT A;  3MXP A;  3D4D A;  1W6J A;  2K04 A;  4X62 Q;  4UY8 C;  2A74 C;  3FMC A;  5IGD A;  1VQJ A;  4R4C A;  4LF9 L;  1VCI A;  3RD4 A;  2XSC A;  4HN7 A;  2F0E A;  2E74 C;  3I4N B;  4PMW A;  4JV5 L;  2KEC A;  4K5V A;  3A8I E;  4JI5 Q;  4JPB W;  2Q2I A;  4LF4 Q;  2DJF C;  4A3J B;  4PZ6 A;  3T1Y Q;  2EOT A;  2G9H D;  3J81 j;  3PGZ A;  4ZAI A;  4DA2 A;  1SNO A;  3DUZ A;  3NK9 A;  5DLQ E;  4LUZ A;  2VS1 A;  4CDE C;  4X64 L;  1IBM Q;  1QUQ A;  3WDN A;  2PNH A;  2VUM B;  4K0K L;  1VF5 C;  5EPK A;  1V1P A;  1LT6 D;  3TEH B;  4DF7 A;  4G57 A;  3F2C A;  1NBW A;  1Y1W G;  2ASB A;  4BY7 B;  2CQO A;  3QJY A;  2CWP A;  3HOW B;  3ERQ A;  2CKZ B;  1Q7Y C;  2LXK A;  5I6W A;  5IYD G;  1WTP A;  5J3B A;  1VQO A;  2UXB L;  4DAM A;  3QB3 A;  3HOY B;  3D8G A;  4RG1 A;  1B7Y B;  4RAU C;  5CV8 A;  3F8T A;  5A35 A;  3KK7 A;  3I55 A;  4CDD C;  3HOZ B;  2YV5 A;  5FOB B;  3B6Y A;  1IBK Q;  2K28 A;  2MPM A;  1EIF A;  5KYL A;  2JA6 B;  3I4L A;  4KKT A;  3TP7 A;  4B9W A;  5DM7 3;  1HR0 L;  2JA8 H;  1I3Q B;  1LTT D;  5C3E G;  2RDF A;  2ICI A;  2X6G A;  1K0S A;  1B9N A;  4MZ9 A;  3JC6 6;  2L12 A;  4C56 C;  2Q2T A;  1CKO A;  2HUG A;  1HNX L;  1LTB D;  3CCV A;  4A3J G;  1Q90 A;  1YNJ D;  1PZJ D;  3UDX A;  5HGT A;  1IYJ B;  2R92 H;  5CC4 A;  2MUY A;  3H15 A;  1I4P A;  1PTO C;  1DYQ A;  2NZO A;  5ELF A;  4QQB X;  1EZ8 A;  2OQK A;  5IP7 H;  1STA A;  4H13 C;  3T13 A;  3PO2 B;  3NWT A;  1G51 A;  4L63 B;  1A3V A;  3NEM A;  1M8A A;  4YY3 Q;  1I5F A;  3MXN B;  3JAM c;  1VQP A;  4GNX C;  3GTG B;  4LF8 L;  4HSV A;  1PLF A;  2C35 B;  4G7H C;  1EOT A;  2XWB B;  1U4P A;  4UDU C;  1TWF B;  4GLX A;  4RGT A;  1BDO A;  3PUW A;  4IJH A;  4DNR B;  1X6O A;  1YNJ C;  3KDF B;  4JW0 A;  4Z9C B;  2CHB D;  2EZV A;  3EIV A;  2D0O A;  3S1Q H;  2EY6 A;  1V9P A;  2KQ3 A;  5M3M G;  3M4Y A;  1SFO B;  1JOK A;  3A5Z B;  3FPU B;  1WD0 A;  1ROD A;  2Q8R E;  4F7X A;  2K32 A;  3R8B A;  1CA6 A;  3C3L A;  4DU9 A;  1B1Z A;  1YVC A;  2RHS B;  1HNZ L;  1N33 Q;  1RTN A;  5LMU L;  4NXM Q;  3RMH A;  4FO2 A;  3BYT B;  5LL6 S;  1DOM A;  2EJM A;  1R9T B;  4MHE A;  2EVB A;  4HIM A;  5ELB A;  3CME A;  3T53 B;  2NTS A;  1H9J A;  4BBR B;  4JCV E;  4DFA A;  5ISR A;  5D65 A;  1NR4 A;  4LFA Q;  4GLV B;  4A76 A;  4L5S A;  3I72 A;  1K8O A;  3S14 B;  1LT3 D;  2DUD A;  1SYG A;  2I5H A;  4A3F H;  5EJW A;  2Y0S B;  1QVG A;  3H6M A;  1I6H B;  3HKZ G;  2HDL A;  1VS0 A;  1VMP A;  5NUC A;  4IFD J;  5GAH C;  2ZM6 L;  1PH8 A;  1ZYR D;  2DY8 A;  2L5T A;  1TS4 A;  3ND8 A;  1F9Q A;  1KTK A;  1K3B C;  4RA8 A;  1VQK A;  1B53 A;  4HJ8 A;  4WJ4 A;  5BN3 A;  1UUP A;  3SK4 A;  1OTC A;  3I73 A;  4X64 Q;  3A0J A;  1AZP A;  3EA6 A;  5FO8 B;  1IXR A;  2RF4 A;  1I94 L;  1F2Y A;  2VL6 A;  2FHT A;  1GD7 A;  4B9X A;  1TWA B;  4ZUJ A;  2H1E A;  2WP8 J;  1VQ4 A;  1JT8 A;  4NPS A;  3HOU G;  1KD1 C;  3J7Z C;  4DXF A;  1D1I A;  4KY5 A;  4HTH A;  2UXB Q;  1DJR D;  1TQO A;  2NVT B;  4JI6 L;  2R93 G;  1EWH A;  1ZYR C;  1YHA A;  1S5E D;  1FGU A;  2CVR A;  3Q23 A;  2B2Y A;  3T1H L;  5M5Y H;  3VR2 A;  4U67 3;  1YNX A;  1TU2 B;  2Z4I A;  2DJG C;  4LFB L;  5E4W C;  3C46 A;  4DUZ L;  4IJL A;  4HSP A;  3EVQ A;  5IGC A;  4OO1 H;  1EYG A;  4BBR G;  3PV0 A;  1BCP B;  1V8Q A;  5CV6 A;  2EXZ A;  4KN4 C;  4UHV A;  1YIT A;  1DD2 A;  4CKE A;  1RDP D;  5M3F H;  4P2C B;  4UAI A;  4I7Z C;  1ICF B;  1LTG D;  4EGV A;  5IE8 A;  3D0F A;  1VDZ A;  2K6A A;  4KLK A;  4DV3 Q;  2IHE A;  3LNN A;  3K80 C;  5JJL A;  1PH2 A;  2JN4 A;  4XIG S;  1EWI A;  4QGU A;  5KEE A;  3S9W A;  3J81 c;  3GTK B;  4L5R C;  4A3L G;  4H44 C;  1WOC A;  1L1O B;  1TWH B;  2K5D A;  3I4N H;  2KUM A;  2QEJ C;  2F0P A;  2BDO A;  1VQ9 A;  4ILW A;  5FK9 C;  4A3J H;  2PO4 A;  2B2W C;  4C3J G;  2KCM A;  1AE3 A;  5IYB G;  2JA7 G;  1LAC A;  3HZX A;  1H9S B;  4JBJ A;  4MTN A;  4H0L C;  4LF8 Q;  2AHO B;  3D3R A;  1EY5 A;  5C4X B;  3SK5 A;  3X3N A;  1Q81 C;  4EQN A;  2UXD Q;  3TP6 A;  4OEL B;  1FJG Q;  5EKL A;  2VUM H;  2KCN A;  4RHR A;  4ZCK A;  1QCB D;  4AYB E;  2ZXP A;  3ULJ A;  3M7N A;  2C9O A;  1IZ6 A;  3DWP A;  4BY7 H;  3RN5 A;  1SXT A;  5LMN W;  3U9O A;  3HOW H;  1SYD A;  4DV7 L;  4LJZ C;  4EQO A;  4V19 0;  1QNK A;  3S16 B;  5DAU A;  3OTO Q;  4A3C G;  5T1G A;  1X3P A;  3HOY H;  1Q82 C;  1PRT D;  4DV4 Q;  1BQQ T;  1L2F A;  1HNZ Q;  1TS2 A;  3E9H A;  2EYF A;  5LMU Q;  2BE5 D;  4K5W A;  3J80 i;  3CCM A;  3NSW A;  4X3U A;  2V1C C;  1LLR D;  3I90 A;  3HOZ H;  3MXU A;  2HD3 A;  5K5P A;  5F2D A;  4K5X A;  1GXD C;  2AUJ D;  1UE5 A;  5C4H A;  2JA6 H;  4GKK L;  3A7L A;  2NUC A;  4JG2 A;  1UE6 A;  4FVM A;  4KHP Q;  1I3Q H;  4H02 A;  2HQL A;  3KF6 B;  1D6E C;  2M00 A;  4KHV A;  2EXD A;  3CF5 A;  1KNE A;  1Y8O B;  2Z6B A;  1PH6 A;  5FLX L;  2XWJ B;  3A55 A;  1KAA A;  1GUN A;  3BZK A;  1PRT C;  2K5Q A;  4K14 A;  4PQX A;  3PSI A;  1SR3 A;  1J8I A;  3NXW A;  4HJ7 A;  1K9M C;  3ULP A;  1N36 L;  4R8N A;  1HQM C;  2BE5 C;  1E24 A;  4TQU S;  4DV0 Q;  3PCO B;  3PO2 H;  1CT1 D;  3CU7 A;  4DPG A;  5LMN Q;  3K8A A;  2X69 A;  2CWA A;  2QCP X;  3J7A V;  4QCL A;  1GOZ A;  4XT1 B;  1F2M A;  1PVO A;  2CCZ A;  1VQE A;  1WI5 A;  1HUN A;  5JEA J;  3GTG H;  3CRL C;  4CBV A;  3UDG A;  4YCV A;  2ZTD A;  4RH6 A;  5HY6 A;  3QWN A;  2GVB A;  1TWF H;  3L7Z C;  4QJF A;  4QL5 A;  1D2B A;  2WII B;  1WCM B;  3I2Z A;  1JOQ A;  1HFN A;  1SJH D;  3RZD B;  3BDC A;  4IUN A;  3QIA A;  5BN5 A;  1SFO H;  4JBM A;  1T5E A;  3MFY A;  2UUA Q;  4B3S L;  1KQS A;  5CR3 A;  3G4S A;  4LUO A;  2WAQ B;  1J5E Q;  3PUY A;  1Q86 C;  4HMI A;  4KTA A;  1LO5 D;  4UP7 A;  3F2B A;  1PXU A;  4C3I B;  2WIN B;  1L0X B;  4GOP C;  3C1E A;  1VQM A;  1R9T H;  1PTO B;  3KLR A;  2Z6K C;  5C5M A;  4CDC C;  4BBR H;  5EGT A;  2DNC A;  4FF1 A;  2AQ2 B;  1GVP A;  2VB3 X;  2K33 A;  1N32 L;  3S14 H;  5C4J B;  2ZJQ A;  5IIF A;  1KDA A;  3VYS A;  2JEA I;  3I4M B;  2MFI A;  2KED A;  2A1A A;  1I6H H;  3U50 C;  2JE6 I;  4LF5 Q;  3K5N A;  1XYI A;  1CKM A;  1RF2 D;  1W3S A;  1F2Z A;  3PIO 3;  5I9O A;  1E2V A;  5FLX E;  2B63 B;  4A3L H;  4KJN A;  1E2Z A;  1VQI A;  3AEV A;  3KJP A;  1V1Q A;  3I3C A;  1GUO A;  3R3O A;  1YEZ A;  1O7I A;  2L11 A;  2HCI A;  2V4D A;  5C0X H;  5IYB H;  3CCL A;  5EPL A;  1WD1 A;  3MEH A;  4NB3 A;  3KLW A;  1IL8 A;  1WCM G;  4HR7 B;  4K2K A;  1D8L A;  1G8Z D;  3UE1 A;  3HKZ E;  1TWA H;  1B2T A;  2QKI C;  1BBX C;  2E75 C;  3CP0 A;  2XVS A;  4DV1 L;  1N34 Q;  2JA8 G;  4DV7 Q;  1CA5 A;  4G4K A;  1YJW A;  4X6A H;  4JYA L;  2Q8I B;  4TSS A;  1YHQ A;  2F0Q A;  1C48 A;  5E3F A;  2NVT H;  4YWM A;  3BJU A;  1ILQ A;  4CJ1 B;  3GDE A;  1B3A A;  1X56 A;  1LTR D;  1UWV A;  1E0B A;  2F4I A;  4O2D A;  3J80 E;  1PA6 A;  2A6E D;  2EJG C;  2RDG A;  2WB1 B;  4JI7 L;  1XNR L;  3SXH A;  2R92 G;  1Q8I A;  3STB D;  5C3X A;  2F0N A;  4A3C H;  2Z4H A;  4AQY L;  1ENA A;  4ZKB B;  5IP7 G;  2K5W A;  1TII D;  3K7U C;  3NPP A;  1HZ9 A;  2GN5 A;  2PZW A;  3MXN A;  4LFC L;  4IPH A;  3RN2 A;  1SNQ A;  5IT9 L;  2R7Z B;  1E2W A;  1JWU D;  1CKN A;  2LFN A;  5JPM C;  5CV4 A;  4NXN Q;  4BS9 A;  2DY7 A;  2O2L D;  3MWY W;  4WRD A;  4JI0 L;  3GTK H;  1FR3 A;  3GTQ B;  3CCR A;  4LF6 Q;  1ENC A;  1TWH H;  4KI0 A;  3VR6 A;  1EY4 A;  2A6E C;  4DNI A;  4B3M L;  2FMC A;  1RHP A;  4N8F A;  3A7A B;  3KF8 A;  2I46 A;  3SVM A;  1FNV A;  3RNU A;  1Q1E A;  3MHB A;  1DOK A;  5C4X H;  2Y0S E;  3MA2 B;  1G2S A;  1QE6 A;  4IOC A;  4OON A;  2F0L A;  4KHZ A;  4B3T L;  5IY0 A;  2F0D A;  1IBL L;  4LF7 Q;  3VA5 A;  4FXG C;  2B39 A;  1AEX A;  3K0Y A;  1I4Q A;  1HZC A;  1X3Q A;  4LWC A;  5COY A;  1A8V A;  1HCZ A;  4DK6 C;  3MZ5 A;  1PYB A;  2K5V A;  1PFB A;  1JB7 A;  2DN8 A;  4A3F G;  1S3O A;  3S16 H;  2IX3 A;  3P1H A;  1I6V C;  5JVH 3;  1I4G A;  1PDQ A;  3D31 A;  2BA1 A;  4FF2 A;  4JVZ A;  4OWT B;  3GV3 A;  2SDF A;  4X3T A;  4DR3 Q;  4O0A A;  1U4L A;  4AYB G;  4DR6 L;  2R7Z G;  1JJC B;  1KXL A;  2EY1 A;  3EQL C;  3MFG A;  4JOI C;  3VYT A;  2EQS A;  4ABN A;  1PFS A;  1STY A;  3M4O B;  4DAV A;  4QUF A;  2NVQ B;  2UUC L;  3GTP B;  1YBY A;  4A3B B;  3CQZ B;  1HZB A;  1P8L A;  2ALY B;  5IT9 E;  1VQ8 A;  3G6J B;  1V1O A;  3H0G B;  2EJF C;  1KDB A;  4R8I A;  3IL8 A;  3A8K E;  2WFW A;  4IUV A;  3RR5 A;  1JQY D;  1JE5 A;  4DR7 Q;  4WFN 3;  3I4O A;  1J6Q A;  2F0K A;  1WTH A;  2OF1 A;  2AMC B;  1S5F D;  1M90 C;  3H94 A;  1X65 A;  3RLN A;  5I2X A;  3E5S A;  4IFD H;  1X3E A;  4OO1 G;  3N52 A;  5CGK A;  4HED A;  1C7Y A;  3HOX B;  3ITP A;  2Q8T A;  3U9S A;  1VMC A;  4OXP A;  4R4O A;  4J8Q A;  4HJ5 A;  1HNW Q;  1NY4 A;  2EYJ A;  1LM0 A;  4KV6 A;  1EYC A;  3QOL A;  1NNX A;  1PH3 A;  1H9M A;  5M3F G;  3L0O A;  2OEO A;  1K0R A;  3CAM A;  1WCM H;  4JYA Q;  2QEX A;  3K0X A;  2PW7 A;  4TKO B;  3RZD H;  1AP0 A;  2UXC L;  3MVV A;  1MJC A;  5COR A;  3M7G A;  2KHI A;  2QDL A;  3QO2 A;  2B2T C;  2HQE A;  5CBA E;  1L1O A;  4JI7 Q;  1YZ6 A;  5GQO A;  3UI2 A;  2E5L L;  4DR4 L;  3N6R A;  4TVA B;  3I4N G;  1SYC A;  3GTO B;  4GZY C;  4P74 A;  1F9S A;  1Q46 A;  1H9S A;  1M4V A;  4C3I H;  4ZLT F;  1ICW A;  1GO3 E;  4DV6 Q;  1PTO H;  3R2T A;  4L6T B;  1SYE A;  1NJI C;  4JI1 Q;  1MIU A;  1WTV A;  2D0P A;  3TQY A;  4IPD A;  4DV5 Q;  2K52 A;  2L4N A;  5C4J H;  4DR1 L;  2VQF Q;  4JI0 Q;  2VUM G;  3I4M H;  2A73 B;  2IHF A;  1IYU A;  1KAB A;  3AU7 A;  1YIJ A;  2NZH A;  1PV4 A;  2SNS A;  1EIG A;  2KEE A;  4JI8 L;  1MSG A;  3DEO A;  4BY7 G;  1K3R A;  1CKN B;  3E3X A;  4JI3 Q;  2KCC A;  1WVL A;  2OTJ A;  3OYY A;  3HOW G;  4JBW A;  3S1N B;  2Z0S A;  2B63 H;  2ZTE A;  1JOO A;  2Z8L A;  1RIP A;  2FJ2 A;  1IHZ A;  3TZU A;  2N3S A;  3HOX G;  3W1B A;  2JQO A;  1S40 A;  3HOY G;  3HG9 A;  4ME5 A;  4YHH Q;  2MQH A;  3M4P A;  4R4I A;  4L5T A;  1WTW A;  2A69 D;  3DHQ A;  3HOZ G;  3VR3 A;  3ER0 A;  3KF8 B;  5IWA Q;  3KUP A;  3NUC A;  4N8X 1;  2N55 A;  1M1K C;  1NSN S;  5JAV A;  1AZQ A;  2JA6 G;  1BCP F;  1PZI D;  2NVY B;  3ERS X;  4XXE A;  4Q5V A;  1OXX K;  2FMM A;  2NWG A;  1J9O A;  4EQP A;  3PO3 B;  4OHJ A;  4X66 L;  5C4Z A;  3KF6 A;  2JJQ A;  1MBY A;  5KND A;  5M9O A;  2RVL A;  4FP5 D;  4IUU A;  4RKB A;  1IKM A;  3I70 A;  5T1I A;  1SYB A;  2BCO A;  4XDX A;  1KNA A;  4LF9 Q;  1KAW A;  4POF A;  1XNQ L;  3PIP A;  1RL2 A;  3NEN A;  3NP8 A;  5CYU A;  4OO1 I;  2A69 C;  1STH A;  1YHB A;  4JV5 Q;  2K05 A;  1L0Y B;  1N9W A;  3MEF A;  3PO2 G;  2VB2 X;  1S5B D;  4WOR A;  1HR0 W;  1SEB D;  3WOE A;  2VQE L;  1U4R A;  2R7Z H;  2KCT A;  2MJ8 A;  2CQA A;  2CFM A;  4C2M B;  1EOV A;  4ID6 A;  1SJE D;  1CM9 A;  2WAQ E;  2UUB L;  4A3D B;  3ZJY C;  3K5M A;  1MGS A;  3PMF A;  5GAG C;  1HZA A;  3CCJ A;  1TY0 A;  2P5Z X;  2ES2 A;  3EFX D;  1DCZ A;  2B2U C;  4K0K Q;  3BZD B;  3GTQ H;  3HGB A;  2MO1 A;  1QZH A;  3FVQ A;  5ELO A;  4N9T A;  4KY7 A;  4R4Q A;  3X3M A;  4ZYS A;  1PMR A;  3IRB A;  3CW2 C;  2PI2 E;  1FVI A;  4BXX G;  1HHV A;  1HH2 P;  1BF4 A;  2D5D A;  3G71 A;  2F0O A;  4MIU A;  3CCQ A;  5EKI A;  4OIK A;  3DLL A;  5KNC A;  2JXM B;  2PCF B;  2B2V C;  3D4R A;  1A62 A;  2E2D C;  4CDF C;  3V96 A;  3A56 A;  1EUJ A;  4GN4 B;  3VA7 A;  4LUV A;  4NW2 A;  1CI3 M;  1GJX A;  2QF7 A;  2PI2 A;  2FIN B;  1SND A;  2RKS A;  3CRK C;  4PG3 A;  2ZJR A;  3KFU A;  3AFQ A;  5TSS A;  1HR0 Q;  2CH4 W;  3T4A C;  1E1T A;  5JEA H;  4GNX A;  1AFP A;  1FGB D;  2FXQ A;  2K4K A;  1CTM A;  2Y0S G;  2HDM A;  4YWL A;  5BR8 L;  3S17 B;  3L3O C;  4HID A;  1HNX Q;  1E3P A;  4MN3 A;  1P16 A;  1EQQ A;  4A3I B;  2NVX B;  5KIX A;  1LV9 A;  1ML0 D;  3D6C A;  1KC8 C;  1BBW A;  1NMF A;  4QIW B;  3J7Y W;  5ELC A;  3M4O H;  4FF4 A;  1STE A;  3AQQ A;  3RZO B;  1EEF D;  1FL0 A;  2NVQ H;  1I50 B;  1H95 A;  4LNQ A;  3GTP H;  1H9K A;  1G6P A;  4A3B H;  1H9R A;  5FKA C;  5JPN C;  3CQZ H;  1IL2 A;  5C0X G;  2AQ1 B;  2N88 A;  4CJ0 B;  2WB1 E;  1SRU A;  4YWK A;  1S4Z A;  2Z1C A;  4A75 A;  2G5D A;  3U4Z A;  3H0G H;  4IO9 A;  4JI4 L;  1BO0 A;  2VY3 A;  3OOC A;  2AWN A;  3CCS A;  4LAA A;  4JK1 C;  1T5X D;  4AH6 A;  1R4Q B;  1A3U A;  2JA5 B;  4DR5 L;  2ENB A;  1XMO L;  1EIH A;  4UP9 A;  2R7D A;  4FXD A;  1CQF A;  5CBE E;  4DGZ A;  5GRO A;  2A68 D;  3HOX H;  1II3 A;  3H3V H;  3ICE A;  4G7O C;  3ONA B;  1Y8P B;  1JOR A;  1LYL A;  4A3K B;  3VR5 A;  1PH9 A;  1PTO F;  3S2H B;  1K83 B;  4ZKC B;  4A3M B;  1WTR A;  1WFQ A;  1CK1 A;  1B8A A;  2GVA A;  5IGE A;  4P72 A;  4RKL A;  4A3I G;  4GN5 A;  1JWS D;  1QG7 A;  1HFG A;  1XNQ Q;  3AYH B;  3OPO A;  2ZJP A;  2NN6 G;  2F0U A;  1KDC A;  2F3I A;  3EJI A;  3GTO H;  4RHS A;  5GAD C;  2ZTC A;  4IUP A;  2K5N A;  1IW7 D;  2WKC A;  2A68 C;  2ZM6 Q;  2NZ1 D;  4KN7 C;  2M2L A;  3U58 A;  2L9H A;  3F2D A;  1MD2 D;  3P75 A;  4GKJ L;  2UUB Q;  4YIJ A;  5C4X G;  1TVX A;  1TY2 A;  1WYD A;  3M4Q A;  2RHQ B;  1D5X C;  4F8M A;  2LXJ A;  1NR2 A;  1NMG A;  2QW7 A;  2JYO A;  1BR9 A;  1EU3 A;  1XMQ L;  1I94 Q;  3A54 A;  2JEB I;  1XPR A;  1XTC D;  1TWC B;  4NP5 A;  4DUY L;  2C5C A;  4FXK C;  1BNZ A;  2ID0 A;  3K5L A;  1ZKO A;  3S1N H;  2F4V L;  1EFI D;  3M3Y B;  1QOH A;  2B8F A;  4ZRZ A;  2XRQ D;  2EY5 A;  1UAP A;  1EQV A;  4JI6 Q;  4RGM A;  1MJE A;  1SNP A;  3J80 L;  3T1H Q;  2XN9 C;  4BXX H;  5C0X I;  1O7Z A;  1PH1 A;  3RLF A;  4LFB Q;  2O5J C;  4K8J A;  4DV2 L;  4DUZ Q;  2NB0 A;  3A8J E;  2N78 A;  3SGI A;  3DEP A;  2F0S A;  2B2W A;  2NVY H;  1D5Z C;  3HOV B;  4DR2 L;  4HIO A;  1SLJ A;  3CMA A;  3PO3 H;  5ELD A;  3BS1 A;  5IP9 H;  4BY1 B;  3UE0 A;  3W5O A;  4GN3 B;  2YTY A;  1ESR A;  5EAY A;  3EBE A;  5BR8 Q;  1B3Q A;  1PFM A;  1DON A;  3GTJ B;  4DAY B;  4KJO A;  1AW7 A;  3NQT A;  1UE1 A;  4GS3 A;  3TS0 A;  1SRO A;  1C9O A;  3DMU A;  3CC2 A;  1KRS A;  1SMX A;  3F2U A;  2E2H B;  4QUC A;  4LK1 C;  1C0A A;  3PF5 A;  3I56 A;  2OXP A;  4GNX B;  4X62 L;  1LT4 D;  2NYZ D;  1XJV A;  2F0H A;  2A6H D;  4DNT B;  4P75 A;  1VQF A;  4H7B A;  1DOL A;  4YCU A;  1D1K A;  1OO9 B;  1UNS A;  5D3D A;  1VQA A;  1Q12 A;  2R3Z A;  4ZQ3 A;  1ESF A;  3HFZ B;  2HT1 A;  1A63 A;  2BOS A;  4C2M H;  4XTC S;  4JC0 A;  4JI5 L;  5C6A A;  1ASY A;  4IFD G;  1VQH A;  3NTH A;  3T1Y L;  1DZ1 A;  4A3D H;  1S72 A;  2MNA A;  5CMD A;  5K36 H;  4IUR A;  4QMG A;  1Q3L A;  2F1M A;  3K57 A;  3IFT A;  1W2B A;  3HRZ C;  3CC7 A;  3H91 A;  1KHI A;  4POG A;  5H1S E;  1WJJ A;  4PZ8 A;  1HA6 A;  1B4O A;  1EYD A;  2K5H A;  4M1U B;  2QA4 A;  3FKI B;  4A3E B;  1F9R A;  4DR5 Q;  5KYI A;  3HKS A;  4A4I A;  1XMO Q;  2A6H C;  3SK6 A;  2BH8 A;  3BZC A;  2ZXO A;  2WAQ G;  2BDN A;  1LTL A;  2YYZ A;  1Y1V B;  1AH9 A;  1GUT A;  3W2D A;  1BUV T;  1BCP D;  2PPB C;  4R1J A;  2CW0 D;  3IKJ A;  3QOJ A;  4C3I G;  4A93 B;  4GKK Q;  1CSP A;  2EYM A;  2JSO A;  4HIK A;  1LTI D;  5G3L F;  1IBK L;  1TWG B;  4IQZ A;  3I4M G;  4K6L A;  3S17 H;  1K8G A;  5C44 B;  4FF3 A;  3DWA A;  1TS5 A;  1EY7 A;  3VYR A;  2PZU A;  3OW2 A;  4A3I H;  3QG1 A;  1SMY D;  1JMC A;  2NVX H;  2WV6 D;  2OT2 A;  2CW0 C;  1EYA A;  1N36 Q;  3CXC A;  2B63 G;  2LS0 1;  2NN6 H;  1UEB A;  4GKJ Q;  1SE8 A;  4J6H A;  1O80 A;  2X6L A;  1JC7 A;  3RZO H;  3VDY A;  1I50 H;  3STB C;  1ET9 A;  1Z9F A;  1MKH A;  4P71 A;  1RD9 D;  3KOJ A;  1EY6 A;  2K01 A;  3DM1 A;  3E6Z X;  3IFD A;  3BG3 A;  2GA4 B;  5J1Z A;  4QY7 A;  2IX1 A;  3BYY B;  2IJ0 A;  4GOP A;  3PF4 A;  3U4V A;  1FD7 D;  4MNO A;  1U0L A;  2Z6K A;  3J81 E;  2UU9 L;  4JI2 L;  2IWH A;  4E6I A;  1JR0 D;  1X3G A;  5FLM H;  2E2J B;  3NBH A;  2JA5 H;  1PZK D;  3HP3 A;  4Y52 H;  1IYV A;  1TXY A;  1NE3 A;  1G91 A;  3FDT A;  5J39 A;  5IYC H;  1VQ6 A;  2PQE A;  4B3S Q;  1E22 A;  1LAB A;  1Y1W B;  2WB1 G;  1S5C D;  3L2P A;  5M5X B;  4IFD I;  3NEL A;  3TRE A;  3KBX A;  2RQX A;  2PQA B;  4OIJ A;  3NE5 B;  1EY0 A;  3FP9 A;  2N8N A;  2JK8 A;  4XQN A;  1JJG A;  1HUM A;  4DXG A;  4A3K H;  3S2H H;  1K83 H;  1VQ7 A;  1N33 L;  5JJK A;  4A3M H;  3P20 A;  2E8G A;  1N32 Q;  3TP5 A;  1PFN A;  4DKA C;  2EDG A;  3G7L A;  1FYC A;  3O13 A;  3S15 B;  5E1F A;  1PHJ A;  1AE2 A;  1HQR D;  4IN3 A;  2EYP A;  4LFA L;  2IY5 B;  5HUR A;  5C3E B;  1HRJ A;  4NDX A;  2PZT A;  3Q24 A;  3SEB A;  3S2D B;  5C0X J;  4KD4 A;  2R6G A;  4KKU A;  3K7A B;  5D14 A;  2I0Q A;  5I9P A;  1VQD A;  2LY7 A;  5BN4 A;  2B8G A;  4ULL A;  2EE1 A;  3RLO A;  1X55 A;  4M8A A;  1F77 A;  3K58 A;  3GP7 A;  3FHW A;  3K6O A;  2VW9 A;  2OWO A;  2F0W A;  3OIQ A;  5LL6 X;  3SR1 A;  4K2L A;  3KLS A;  1MI2 A;  5ELE A;  4DN4 M;  3MTS A;  4QIW E;  1SNM A;  1ET6 A;  2D2C C;  4DV1 Q;  1TWC H;  5JEA G;  4CKC A;  1B70 B;  1CQV A;  3M3Y H;  4KY6 A;  3RUZ A;  2HIX A;  1SN8 A;  4F88 A;  1PH4 A;  3PIO A;  5IOC A;  2TMP A;  1ZXT A;  2KJX A;  5M5W B;  2R61 A;  4TRD A;  1XNR Q;  2F03 A;  1CUK A;  2L1B A;  3NTK A;  1N8R C;  1PTO D;  5M3M B;  3TME A;  3QR8 A;  4AQY Q;  1R4P B;  3HOV H;  2J4X A;  1K73 C;  2K75 A;  4A3B G;  3UDI A;  4LFC Q;  1G6Z A;  1PRT B;  5E4X A;  2RBM A;  4DAP A;  4BY1 H;  2L55 A;  2EYO A;  4YCW A;  3HS0 C;  5A2Q L;  3URY A;  2IL8 A;  5EQ0 A;  1CZG A;  2VZA A;  3GTJ H;  4L8J A;  4R9W A;  1MSH A;  2HHH L;  2OTL A;  2LMC B; 
#chains in the Genus database with same CATH homology
 1OXV A;  3AFQ A;  3FKI G;  3H0G G;  3L7Z C;  4QL5 A;  4QJF A;  2VQF L;  4A3E G;  3Q8D A;  1HR0 Q;  4IOA A;  1E1T A;  4YY3 L;  4GNX A;  1CSQ A;  2E2H H;  4DUY Q;  2YTX A;  2FXQ A;  2K4K A;  1L1O C;  3I2Z A;  4DV3 L;  2Y0S G;  4YWL A;  5BR8 L;  2F4V Q;  4HID A;  4JI3 L;  1HNX Q;  4B3M Q;  1E3P A;  1HJP A;  1Y1V G;  1P16 A;  1EQQ A;  1XPU A;  1SFO H;  4JBM A;  4WJ3 M;  4UP8 A;  2UUA Q;  4B3S L;  5GAE C;  1KQS A;  3G4S A;  4LUO A;  4ALP A;  1J5E Q;  3PUY A;  1VQG A;  2BA0 A;  1Q86 C;  3DM3 A;  1BBW A;  1NMF A;  1KC8 C;  2ATW A;  1EQR A;  4DV2 Q;  4A93 G;  3M4O H;  1VQL A;  4YHH L;  3AQQ A;  4LW1 A;  1OXS C;  3M9B A;  4UP7 A;  1FL0 A;  2NVQ H;  1H95 A;  3F2B A;  4LNQ A;  3GTP H;  1G6P A;  4GOP C;  1VQM A;  1V43 A;  2E2I H;  4A3B H;  4BBS G;  4X65 Q;  3S24 A;  3CQZ H;  4JOI A;  4DR2 Q;  4B3T Q;  1IL2 A;  5C0X G;  1R9T H;  1IBL Q;  5IWA L;  2Z6K C;  2UU9 Q;  2R7F A;  4JI2 Q;  2UXD L;  1KIX A;  4BBR H;  2WB1 E;  5E7N A;  1X9N A;  1SRU A;  3EN2 A;  4YWK A;  4A75 A;  3U4Z A;  3FKI H;  1GVP A;  3H0G H;  4A3E H;  1N32 L;  4IO9 A;  3TRZ A;  1FJG L;  4NXM L;  5C44 G;  1PH7 A;  1L0W A;  4JI4 L;  4OWW B;  3S14 H;  1Q1B A;  2VY3 A;  2ZJQ A;  1YJ9 A;  5JJI A;  2I5L X;  2AWN A;  3CCS A;  4GOP B;  2JEA I;  4ME3 A;  2DGY A;  2MFI A;  5FJ8 G;  3I7F A;  2A1A A;  1I6H H;  4AH6 A;  2OCE A;  1QVC A;  3U50 C;  2JE6 I;  4LF5 Q;  4RMF A;  4X62 Q;  1Y1V H;  2K50 A;  4UY8 C;  4DR5 L;  1CKM A;  1VQJ A;  1W3S A;  4R4C A;  4LF9 L;  1VCI A;  1XMO L;  3NBH B;  4UP9 A;  2F52 A;  2R7D A;  3OTO L;  4A3L H;  4DR6 Q;  4PMW A;  3AEV A;  1VQI A;  3KJP A;  1V1Q A;  5GRO A;  4A93 H;  4JV5 L;  4DV4 L;  2MO0 A;  4JI5 Q;  4LF4 Q;  2Q2I A;  3HOX H;  3H3V H;  1YEZ A;  1O7I A;  3ICE A;  4PZ6 A;  2JA9 A;  3T1Y Q;  1T9H A;  1Y14 B;  4BBS H;  2UUC Q;  3J81 j;  5FLX c;  3PGZ A;  3CCL A;  5IYB H;  1PVO A;  3E9I A;  4NB3 A;  3KLW A;  1LYL A;  1WCM G;  1TWG H;  5DLQ E;  1PH9 A;  1D8L A;  4LUZ A;  3M85 A;  3UE1 A;  3HKZ E;  2VS1 A;  1TWA H;  1WFQ A;  4KHP L;  3CPW A;  5C44 H;  3CP0 A;  4X64 L;  4DV1 L;  1B8A A;  1IBM Q;  2GVA A;  1QUQ A;  4P72 A;  1N34 Q;  4DV7 Q;  2PNH A;  2JA8 G;  4A3I G;  1PH5 A;  4GN5 A;  5FJ8 H;  1YJW A;  4K0K L;  4X6A H;  4JYA L;  1XNQ Q;  3AYH B;  2B3G A;  1YHQ A;  2ZJP A;  2NN6 G;  3TEH B;  2ASB A;  3F2C A;  1NBW A;  4YWM A;  3WWV A;  3BJU A;  1Y1W G;  2NVT H;  2CQO A;  2F3I A;  3GTO H;  2CWP A;  3GDE A;  5GAD C;  2ZTC A;  1X56 A;  1UWV A;  2K5N A;  4OX9 L;  1VQC A;  2ZM6 Q;  4O2D A;  1PA6 A;  2CKZ B;  1Q7Y C;  1A0I A;  2LXK A;  3U58 A;  5IYD G;  4JI7 L;  4EQ5 A;  1XNR L;  2R92 G;  5J3B A;  3STB D;  1VQO A;  2UXB L;  4DAM A;  3F2D A;  4DV0 L;  4A3C H;  4RG1 A;  4AQY L;  4GKJ L;  2UUB Q;  5LMN L;  2OQ0 A;  5C4X G;  1B7Y B;  2L15 A;  5IP7 G;  3M4Q A;  1WYD A;  3F8T A;  2RHQ B;  3K7U C;  2IX0 A;  2LXJ A;  3J80 c;  1HZ9 A;  2GN5 A;  4LFC L;  3I55 A;  1DGS A;  4IPH A;  3RN2 A;  1NMG A;  2YV5 A;  3PO3 G;  2K14 A;  3B6Y A;  5IP9 G;  3JAM i;  1IBK Q;  1XMQ L;  1EIF A;  1CKN A;  2RCN A;  1I94 Q;  2E2J H;  4NXN Q;  1HR0 L;  1VQ5 A;  2UXC Q;  2JEB I;  2JA8 H;  1XPR A;  5C3E G;  4DUY L;  3K81 C;  1QUQ B;  4JI0 L;  2ID0 A;  4MZ9 A;  3GTK H;  3JC6 6;  3CCR A;  2A8V A;  4LF6 Q;  1QVF A;  2F4V L;  3S1N H;  2Q2T A;  1TWH H;  1CKO A;  2XGT A;  4KI0 A;  5M5X H;  4HJA A;  1Y1W H;  3UDF A;  1HNX L;  4DNI A;  2E5L Q;  3ULL A;  4B3M L;  4DR4 Q;  4JI6 Q;  3CCV A;  4A3J G;  2I5M X;  3H3V I;  1MJE A;  3UDX A;  2UUA L;  3T1H Q;  1IYJ B;  4BXX H;  1J5E L;  5C0X I;  1PH1 A;  5IYD H;  2QGQ A;  3RLF A;  2R92 H;  4LFB Q;  3H15 A;  2KHJ A;  4DV2 L;  4DUZ Q;  3RNU A;  1Q1E A;  2NZO A;  4QQB X;  2KEN A;  2N78 A;  2OQK A;  2Y0S E;  3SGI A;  5C4X H;  5IP7 H;  4AIM A;  2HHH Q;  2NVY H;  1G51 A;  4OON A;  4IOC A;  4A3D G;  5K36 G;  4KHZ A;  4B3T L;  5IY0 A;  4HIO A;  4DR2 L;  1SLJ A;  3G6E A;  3NEM A;  3CMA A;  1IBL L;  4LF7 Q;  4YY3 Q;  3PO3 H;  1I5F A;  3MXN B;  5IP9 H;  3JAM c;  3UE0 A;  3W5O A;  4GN3 B;  4GNX C;  1VQP A;  3S15 H;  4DR1 Q;  1D7Q A;  1OXT A;  2YTY A;  4LF8 L;  5EAY A;  3PUX A;  3EBE A;  4P73 A;  5BR8 Q;  2C35 B;  4DAY B;  1HZC A;  4LWC A;  4GLX A;  5C3E H;  1A8V A;  1X54 A;  4JI8 Q;  4DK6 C;  1UE1 A;  3PUW A;  4GS3 A;  4UPA A;  1PYB A;  1SRO A;  1C9O A;  3TS0 A;  3CC2 A;  1KRS A;  1SMX A;  4IJH A;  2K5V A;  1X6O A;  3KDF B;  1JB7 A;  3S2D H;  4A3F G;  1S3O A;  4LF5 L;  2BH2 A;  3S16 H;  1C0A A;  3PF5 A;  3I56 A;  3EIV A;  4GNX B;  4X62 L;  3K7A H;  2D0O A;  3S1Q H;  3D31 A;  1XJV A;  2BA1 A;  1V9P A;  1ASZ A;  4P75 A;  1VQF A;  4OWT B;  5M3M G;  4YCU A;  3TS2 A;  4DR3 Q;  4O0A A;  3A5Z B;  4AYB G;  4DR6 L;  2R7Z G;  2Q2H A;  1JJC B;  1VQA A;  1Q12 A;  1KXL A;  3HFZ B;  4JOI C;  2HT1 A;  1A63 A;  4C2M H;  1LUZ A;  2EQS A;  4JC0 A;  4XTC S;  4JI5 L;  1PFS A;  1ASY A;  4IFD G;  1VQH A;  3T1Y L;  4A3D H;  1YVC A;  1S72 A;  2RHS B;  2MNA A;  1KRT A;  1HNZ L;  2UUC L;  1N33 Q;  5LMU L;  1YBY A;  3CCU A;  2AWO A;  4NXM Q;  1G29 1;  1W2B A;  1HZB A;  3CC7 A;  4HIM A;  1KHI A;  1P8L A;  3CME A;  2ALY B;  4X66 Q;  4POG A;  1VQ8 A;  2XTI A;  5H1S E;  1WJJ A;  4JCV E;  3KYH C;  4PZ8 A;  2QA4 A;  2K5H A;  4LFA Q;  5ELN A;  4DR5 Q;  4GLV B;  4A76 A;  3HKS A;  1N34 L;  4L5S A;  5AJ3 L;  4B3R L;  4A4I A;  1XMO Q;  2DUD A;  2I5H A;  4A3F H;  2WFW A;  3RR5 A;  5M5W H;  2BH8 A;  1QVG A;  3BZC A;  5IT9 c;  4A3G G;  3HKZ G;  1JE5 A;  1Q8K A;  2WAQ G;  4DR7 Q;  1VS0 A;  1LTL A;  2YYZ A;  3I4O A;  1AH9 A;  4IFD J;  5GAH C;  1J6Q A;  5M3M H;  2ZM6 L;  1PH8 A;  2AMC B;  4R1J A;  1M90 C;  1X65 A;  2VQE Q;  1X3F A;  3RLN A;  1VQK A;  1BKB A;  4HJ8 A;  1GM5 A;  1X3E A;  4OO1 G;  1C7Y A;  4WJ4 A;  4DK3 C;  4OXP A;  4R4O A;  4GKK Q;  1OTC A;  4HJ5 A;  1HNW Q;  1CSP A;  1NY4 A;  2KBN A;  2YTV A;  3A0J A;  4X64 Q;  2Q2U A;  3A5U A;  1LM0 A;  4FDB A;  2VNU D;  1PH3 A;  1Z47 A;  4C3H H;  4HIK A;  3GTL H;  1IBK L;  5M3F G;  4JYA Q;  3L0O A;  1IXR A;  1K0R A;  2RF4 A;  1WCM H;  3CAM A;  2QEX A;  3K0X A;  1I94 L;  3I4M G;  2VL6 A;  4NXN L;  3W1G A;  1GD7 A;  3S17 H;  3G48 A;  3RZD H;  2WP8 J;  1K8G A;  2UXC L;  1VQ4 A;  1MJC A;  5FLM G;  1JT8 A;  2A19 A;  1EIY B;  4NPS A;  2JA5 G;  4OX9 Q;  2KHI A;  1GKH A;  3HOU G;  3CCE A;  1KD1 C;  3J7Z C;  3OW2 A;  4A3I H;  4LF6 L;  1L1O A;  1JMC A;  2NVX H;  4JI7 Q;  1YZ6 A;  5GQO A;  3J81 i;  5IYC G;  2UXB Q;  4IPG A;  2E5L L;  1N36 Q;  2B63 G;  3CXC A;  4DR4 L;  1UEB A;  2PQA A;  4TVA B;  4JI6 L;  3I4N G;  4GKJ Q;  1YHA A;  2R93 G;  2H5X A;  1FGU A;  1SE8 A;  4IPC A;  3RZO H;  3T1H L;  5M5Y H;  3VDY A;  1I50 H;  1YNX A;  1Q46 A;  4P74 A;  4GLA C;  4OWX B;  3STB C;  1Z9F A;  4LFB L;  4C3I H;  1MKH A;  4P71 A;  3KOJ A;  4DUZ L;  4IJL A;  4APV A;  1GO3 E;  4DV6 Q;  3CC4 A;  1EYG A;  4BBR G;  3PV0 A;  1BVS A;  4A3K G;  1NJI C;  4QY7 A;  1MIU A;  4JI1 Q;  2IX1 A;  1YIT A;  2D0P A;  3TQY A;  4BA2 I;  4IPD A;  4GOP A;  4A3M G;  3PF4 A;  4DV5 Q;  4LF7 L;  3U4V A;  4MNO A;  2LSS A;  1U0L A;  2K52 A;  4X65 L;  5M3F H;  5C4J H;  2Z6K A;  4DR1 L;  2VQF Q;  4JI0 Q;  1EFW A;  2VUM G;  3LGJ A;  2UU9 L;  3I4M H;  4JI2 L;  2IHF A;  1YIJ A;  1PV4 A;  1VQN A;  2NZH A;  1X3G A;  5IE8 A;  3D0F A;  4KLK A;  5FLM H;  4DV3 Q;  2IHE A;  3K80 C;  4JI8 L;  5JJL A;  1PH2 A;  1K3R A;  3AFP A;  2JA5 H;  4BY7 G;  3S1M H;  3HOU H;  1CKN B;  4XIG S;  4JI3 Q;  4Y7N H;  1EWI A;  1TXY A;  1NE3 A;  4Y52 H;  4QGU A;  3KJO A;  3OYY A;  4R4T A;  3HOW G;  2OTJ A;  3J81 c;  4L5R C;  4JBW A;  2N49 A;  5IYC H;  1VQ6 A;  2Z0S A;  4B3S Q;  1E22 A;  1WOC A;  1L1O B;  2ZTE A;  2B63 H;  3I4N H;  1RIP A;  2WB1 G;  3L2P A;  3S1R H;  4IFD I;  3NEL A;  2R93 H;  4L5Q A;  3TRE A;  2N3S A;  1VQ9 A;  3HOX G;  4JBK A;  3W1B A;  2PQA B;  2JQO A;  1S40 A;  2B29 A;  4A3J H;  3HOY G;  2IT1 A;  4DR3 L;  4YHH Q;  2KCM A;  2MQH A;  3FP9 A;  2N8N A;  3M4P A;  4R4I A;  1AE3 A;  1UE7 A;  2JK8 A;  3BU2 A;  4L5T A;  5IYB G;  2JA7 G;  1JJG A;  4JBJ A;  4MTN A;  3HOZ G;  3ER0 A;  3KF8 B;  2AHO B;  4LF8 Q;  5IWA Q;  2HIV A;  4A3K H;  3PUZ A;  4BA1 I;  4PZ7 A;  1Q81 C;  1M1K C;  1K83 H;  1QZG A;  4LF4 L;  3S2H H;  1VQ7 A;  2UXD Q;  1K8A C;  1N33 L;  2JA6 G;  5JJK A;  3ERS X;  4A3M H;  2E8G A;  1NTG A;  1OXX K;  1N32 Q;  1FJG Q;  4DKA C;  1E1O A;  1E7Z A;  4X66 L;  4JI4 Q;  2VUM H;  3KF6 A;  2JJQ A;  1PHJ A;  4AYB E;  1AE2 A;  3ULJ A;  3M7N A;  2NN6 I;  1IZ6 A;  4LFA L;  4BY7 H;  2IY5 B;  3F1Z A;  3RN5 A;  5LMN W;  3GO5 A;  1IBM L;  3HOW H;  2D62 A;  4DV7 L;  4LF9 Q;  1KAW A;  5C0X J;  4POF A;  1XPO A;  1XNQ L;  3PIP A;  1RL2 A;  2R6G A;  4DR7 L;  3OTO Q;  3NEN A;  4OO1 I;  4J15 A;  1YJN A;  4A3C G;  2I0Q A;  3HOY H;  1YHB A;  1Q82 C;  4JV5 Q;  4DV4 Q;  4C3J H;  1L2F A;  1VQD A;  1N9W A;  1HNZ Q;  3MEF A;  3E9H A;  3PO2 G;  3RLO A;  5LMU Q;  2JA7 H;  1X55 A;  1HR0 W;  3J80 i;  3CCM A;  1YI2 A;  2VQE L;  3FHW A;  2V1C C;  2VW9 A;  2R7Z H;  2KCT A;  2OWO A;  3HOV G;  3HOZ H;  1PYS B;  2CFM A;  1EOV A;  2AKW B;  4BY1 G;  1UE5 A;  2WAQ E;  2JA6 H;  2UUB L;  4GKK L;  1HNW L;  3ZJY C;  4JG2 A;  1UE6 A;  4QIW E;  5AJ3 Q;  4B3R Q;  4KHP Q;  5GAG C;  1HZA A;  1I3Q H;  3CCJ A;  4DV1 Q;  1TWC H;  2ES2 A;  4H02 A;  2HQL A;  5JEA G;  4K0K Q;  3GTQ H;  1B70 B;  3KF6 B;  2MO1 A;  3M3Y H;  1QZH A;  5ELO A;  3CPF A;  2EXD A;  2HIX A;  1SN8 A;  3CF5 A;  4R4Q A;  2PMZ E;  1PH4 A;  1PH6 A;  3E0E A;  3PIO A;  3GTM H;  3IRB A;  3CW2 C;  2PI2 E;  1FVI A;  3BZK A;  3J7A 5;  4BXX G;  3PSI A;  1SR3 A;  3PUV A;  4EX5 A;  1BBU A;  1HH2 P;  4HJ7 A;  1K9M C;  3ULP A;  1N36 L;  4A3G H;  3G71 A;  3CD6 A;  1JJ2 A;  1XNR Q;  1CUK A;  1E24 A;  1N8R C;  2YU9 H;  4TQU S;  3CCQ A;  4DV0 Q;  3DLL A;  3PCO B;  3PO2 H;  4AQY Q;  4DPG A;  5LMN Q;  3K8A A;  3A74 A;  2CWA A;  1XTD A;  1A62 A;  1OXU A;  3HOV H;  3GD7 A;  1K73 C;  4DV6 L;  2K75 A;  4A3B G;  3UDI A;  5HGQ A;  4LFC Q;  1EUJ A;  2CCZ A;  4A3L G;  4GN4 B;  1VQE A;  4BY1 H;  1WI5 A;  4LUV A;  2EIF A;  1KL9 A;  4YCW A;  5JEA J;  3GTG H;  2PI2 A;  4HJ9 A;  4JI1 L;  3UDG A;  1XMQ Q;  1VQB A;  2VZA A;  4YCV A;  3GTJ H;  1U5K A;  2ZTD A;  5HY6 A;  4PG3 A;  2ZJR A;  4DV5 L;  2GVB A;  2HHH L;  3KFU A;  2OTL A;  1TWF H;  3KDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...