2KHJA

Nmr structure of the domain 6 of the e. coli ribosomal protein s1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
89
structure length
89
Chain Sequence
MFNNWVALNKKGAIVTGKVTAVDAKGATVELADGVEGYLRASEASRDRVEDATLVLSVGDEVEAKFTGVDRKNRAISLSVRAKDEADEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the relationship between Gram-negative and Gram-positive S1 proteins by sequence analysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosomal protein
molecule keywords 30S ribosomal protein S1
total genus 9
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2khjA00
3RN5A 1YI2A 1JB7A 2R7ZG 2AWNA 4BA1I 4LFCQ 1J6QA 4DV5L 1S40A 2EQSA 2NZHA 4A3BH 4IPDA 3GDEA 2OQKA 3S1NH 3K7AH 4A3LH 1G6PA 2OWOA 3PUWA 2JA8H 2UXBL 3T1HQ 3PO3H 4B3RQ 3A5ZB 5IT9c 3PIPA 4DR5Q 1MKHA 1JJ2A 4DR5L 3GTOH 1J5EQ 3PUVA 2NZOA 3RN2A 4DUYQ 3KF6A 4ALPA 2B3GA 4DR1Q 1OXVA 2Q2HA 4DKAC 4LFBL 4KHPQ 1WFQA 3DM3A 2CKZB 4H02A 4BY1G 3S2DH 4UP9A 1PH8A 2EIFA 1P8LA 4A93G 4GLXA 3DLLA 4A3EG 1VQIA 1VQBA 3F2DA 4IJLA 4IO9A 4OX9Q 2DGYA 2QEXA 4LUZA 4QGUA 3HOUG 2VZAA 2KCTA 2D62A 5C3EH 1A63A 2ZJQA 4DR3L 3ERSX 1OXSC 5GQOA 2GVAA 4PZ8A 3U58A 2E5LL 4A3CH 3M9BA 4PG3A 3JAMi 1VQLA 2QA4A 1X3EA 2OCEA 1BKBA 4BBSG 5JJKA 5IYBH 4DUYL 3HOYG 4Y52H 1KIXA 3GTKH 3PO2G 4LF5L 3CF5A 1A62A 3CD6A 3HOXH 4A3KH 3ULJA 2UXBQ 4X64L 1FL0A 5IYBG 3G71A 4A3MH 2N49A 2HQLA 2R7ZH 4UP8A 4A3DH 3WWVA 3BZCA 2VQEL 3FKIG 1XPOA 2UUCQ 2JA7G 3KYHC 3CAMA 1VQ9A 4DR4L 3KJOA 1I50H 3W1GA 1X56A 1N36Q 4HIKA 3TS0A 2B63H 4BA2I 4DV3L 3E0EA 1YIJA 2CFMA 4HJ5A 1XNQQ 1NMFA 4AYBG 2XTIA 3CCUA 4YWMA 4GOPC 1I94Q 2D0PA 3CC2A 1FVIA 2KBNA 3GD7A 2JK8A 4DR6Q 1JJGA 3CC7A 2VQEQ 4JYAL 2ZTCA 1L2FA 2AKWB 2GN5A 3SGIA 1Q82C 5JJIA 3GTLH 1KHIA 2K14A 4TVAB 5FJ8G 3CCJA 4C3HH 4YY3Q 4R4IA 3F2BA 2B63G 3HOZG 3G48A 3U4VA 2YYZA 4X62Q 4LF5Q 4JI1Q 1KAWA 1X6OA 4X6AH 4X65L 5LMUL 1X55A 2WAQE 2R7FA 4GN3B 3UDFA 4DR2L 1QVFA 4DV2L 1VS0A 4NPSA 4R4OA 1SN8A 1VQGA 3EIVA 2F4VL 4EQ5A 4DV5Q 3ICEA 1XPRA 5IYDH 4A3BG 1E1OA 3J81i 1E1TA 1N9WA 1TWCH 3W5OA 3E9IA 3S16H 4B3SQ 1QZGA 5LMNW 3MXNB 5AJ3Q 1Y1VG 1X54A 2WAQG 3I4OA 4DAMA 2LXKA 3I4NG 1NJIC 3E9HA 4OX9L 1EIFA 4C3IH 4A3FG 3RR5A 1UE7A 1SE8A 1CKOA 2RCNA 3K0XA 3HKZG 5IWAL 4IPCA 4OWWB 4BBRG 2Z6KA 4AIMA 2JA6G 4GKKQ 4JI3L 4KHPL 3K80C 1AE3A 1FJGQ 4L5TA 1SLJA 1B8AA 3M7NA 4A3EH 1IBMQ 3PF4A 1M90C 3RLFA 1UEBA 4A93H 1KL9A 2VUMH 1E3PA 5IP9H 1FJGL 1VQ6A 3D31A 3S17H 3CCMA 2DUDA 3KDFB 3UE1A 1VQHA 5IE8A 1BBUA 1Q1BA 3CCEA 3M85A 5M3FG 2JEAI 1S3OA 2UXDL 4LFCL 1E24A 3GTJH 2BH2A 5GAGC 2ZTEA 1KQSA 4BBRH 2ATWA 5J3BA 2KCMA 3BJUA 1YJ9A 1W3SA 1YBYA 2VNUD 1G291 3EN2A 1VQJA 4IFDI 3TQYA 4JI8L 1LTLA 1HZBA 4JI0Q 1Q8KA 1Z47A 1YJWA 1HZ9A 1PH5A 2OTJA 4JC0A 4JOIA 2E2HH 1NBWA 4DNIA 1VQFA 4FDBA 5GADC 2Q2IA 4Y7NH 3UDGA 4OONA 1Q81C 4IFDG 1JE5A 1C0AA 3CMAA 1XMQQ 1EYGA 2A19A 1IBKL 5IY0A 1N33L 3HOXG 1IYJB 1Q7YC 1MJCA 3CCQA 1R9TH 4R4CA 3LGJA 4LF6L 4JI2L 2V1CC 3F2CA 3B6YA 5M5YH 3T1HL 3RNUA 4GN5A 1IL2A 1QZHA 2GVBA 3PUZA 2ZM6L 1Y14B 2HHHQ 1M1KC 2ID0A 4JI7Q 2PNHA 4OO1I 1PH9A 1WI5A 2NVQH 4DR6L 2UUBL 1X3GA 1TWAH 2HIVA 1MIUA 2E2JH 3W1BA 3J7ZC 2R92G 4DV3Q 1L0WA 3M4OH 2I5HA 3PSIA 2YV5A 1NTGA 1NY4A 2VQFQ 1L1OA 4LFAL 2NVXH 3I55A 1GVPA 1CSPA 4A4IA 4LF9Q 1HNZL 2IX0A 1BVSA 2ES2A 1SRUA 4GNXA 2A8VA 4K0KL 5HGQA 3I4NH 1KXLA 2EXDA 4XIGS 2JE6I 4QL5A 1SR3A 4GS3A 4NB3A 5IYCH 4A3CG 1Y1VH 2Q2UA 4DUZL 4DUZQ 3CC4A 1K8AC 3A74A 3KJPA 4IJHA 4DV6L 2IY5B 4BXXH 2H5XA 4C2MH 3GTGH 4KLKA 3HOWH 1X65A 4WJ4A 1LYLA 3OYYA 1KRSA 5BR8L 1BBWA 4GLAC 1HNZQ 2YU9H 1I5FA 2JEBI 4P74A 3I4MG 2Y0SE 4LFAQ 1WCMG 3PIOA 3M4QA 3STBD 4MNOA 1N32Q 2YTYA 2CQOA 3VDYA 1JJCB 1SROA 1PA6A 3L2PA 3CCVA 1AH9A 4DV0Q 4A75A 1PYSB 4R1JA 1HJPA 5ELNA 1S72A 4RG1A 1A8VA 1E22A 3BU2A 3U4ZA 3ZJYC 2I5MX 3KFUA 4A3JH 3F1ZA 4APVA 1VQAA 2CWPA 2PQAB 2IHEA 1MJEA 2JJQA 2JQOA 4JI6L 2AWOA 3ER0A 4BY1H 1D8LA 1N34L 3TS2A 2MFIA 3J80i 4IFDJ 4YHHQ 1KD1C 1L1OB 4A3FH 1WYDA 4JBWA 1WCMH 3G4SA 2K52A 4DV1Q 3ULPA 3I4MH 1DGSA 4B3RL 2IX1A 3AFQA 4LF6Q 4HIMA 4EX5A 2Z0SA 5M5WH 1YHQA 5JEAJ 1IZ6A 1N34Q 3TEHB 1QVCA 2OQ0A 4JBKA 3IRBA 1PH4A 1E7ZA 1QUQA 1P16A 1UE1A 4DV4Q 2R93H 5HY6A 1UE5A 3PO2H 4A3KG 2IHFA 4J15A 1FGUA 3HFZB 3UE0A 1XNRQ 4GNXC 4LW1A 1PH1A 2I0QA 4OO1G 1Q12A 1UE6A 5IYCG 1HR0Q 3GTQH 3EBEA 3OTOQ 1PHJA 4LUVA 3STBC 4TQUS 4LF8Q 1SMXA 1XNRL 4QJFA 4HIDA 1EIYB 2L15A 1VQ8A 1WOCA 1K8GA 3L7ZC 5BR8Q 3HOZH 1LM0A 1Q46A 4BY7G 2RF4A 3PV0A 4PZ7A 3PGZA 2K75A 4O2DA 2PMZE 1JT8A 1C7YA 3CXCA 1EQRA 4YCVA 3T1YL 3FHWA 4GLVB 1PVOA 1JMCA 2R6GA 3CW2C 1GM5A 2CCZA 3KOJA 3PCOB 4DK6C 3I2ZA 1TXYA 3CCSA 1PH3A 3I56A 3S1MH 4K0KQ 3CPWA 5H1SE 4JG2A 1Y1WH 3CPFA 2UUAQ 3H0GG 5FLXc 1RL2A 4LF9L 4B3TL 4GKJQ 4DV0L 5C0XI 4DK3C 1YHAA 2JA8G 3G6EA 4ME3A 1VQMA 3RZDH 4JI4L 4B3MQ 3RZOH 4GOPA 2WFWA 2UU9Q 2UUAL 5C0XG 3H3VH 3S2HH 1D7QA 5EAYA 2UUBQ 4DV4L 4HJ9A 2HT1A 2ZJPA 3H0GH 3OW2A 4JI5Q 1HNWL 5LMNQ 4KHZA 3CCRA 1RIPA 3FP9A 1EFWA 4C3JH 1XMOL 2R7DA 3M4PA 1Y1WG 3J80c 3J81j 2ZM6Q 5M3FH 1VQ5A 2HHHL 2VY3A 4IOAA 4X65Q 4GOPB 1K83H 4NXNQ 2K50A 4P72A 1Q1EA 4NXNL 4JI2Q 4A3GH 4LFBQ 4X62L 1V1QA 2BH8A 1PH2A 3CMEA 5K36G 3PUXA 3NBHB 4A3JG 1Z9FA 5LMNL 4PMWA 1XMQL 4LNQA 4UY8C 1K9MC 1EUJA 5IP9G 2VUMG 2MO1A 2Z6KC 2VQFL 2QGQA 1V43A 1GD7A 5GAEC 2ASBA 1Q86C 2K4KA 1XJVA 2NN6G 3S24A 3JAMc 1K73C 3FKIH 1CKNB 4JI8Q 2JA7H 4DR7L 2I5LX 1K0RA 3PO3G 3M3YH 1CKNA 4A3DG 4AQYQ 4NXMQ 1L1OC 1PV4A 4A3MG 4DR4Q 3HKZE 2NVYH 1GKHA 2YTVA 2R93G 4BXXG 4DAYB 3KDFA 3RLOA 3ULLA 2F52A 4KI0A 2JA5G 1VQCA 2BA0A 3I7FA 4X64Q 3S1RH 5JJLA 2LSSA 2MNAA 3H3VI 4DV1L 5GROA 5M5XH 4DPGA 1O7IA 4GN4B 4UP7A 3T1YQ 4JI6Q 1U0LA 1VQEA 4JI5L 3S15H 2YTXA 1YEZA 2JA9A 5IWAQ 2PI2A 5C3EG 4JBMA 2VW9A 2WP8J 1WJJA 3NEMA 1ASYA 2AMCB 4B3ML 4DR3Q 5ELOA 4JI4Q 1OXXK 2FXQA 4O0AA 1VQKA 2N78A 5FLMH 3J81c 1N32L 4R4QA 2E8GA 3OTOL 3MEFA 1HR0L 4A3GG 4YCUA 5GAHC 4GKJL 1VQPA 4B3TQ 2AHOB 1YITA 2Q2TA 3HOVH 4JOIC 1SFOH 3CQZH 1VQ4A 1AE2A 2K5VA 2F3IA 2XGTA 3Q8DA 4OXPA 5C4JH 1YNXA 2ZJRA 4QQBX 2UXCL 1ASZA 2A1AA 2HIXA 4AH6A 4YCWA 4HJ7A 1OTCA 4JI7L 3GTPH 5C0XJ 4DV2Q 2F4VQ 5M3MG 3A0JA 2VS1A 4A3IG 3HOWG 4L5RC 3S1QH 5C4XG 2C35B 5LMUQ 1J5EL 5JEAG 2N3SA 1NE3A 1XTDA 4IPHA 2KHIA 4GKKL 2KHJA 1G51A 4HJ8A 1HR0W 4BBSH 4L5SA 2D0OA 4HJAA 3S14H 3CCLA 4JYAQ 2MQHA 3AQQA 2ALYB 4AQYL 4NXML 1TWGH 4DR7Q 5C4XH 4HIOA 2IT1A 4LF8L 2LXJA 1EOVA 4MZ9A 4LUOA 1XNQL 1QVGA 1CKMA 3L0OA 4OWXB 5M3MH 4A3IH 4JV5Q 1PH7A 4QIWE 4R4TA 1NMGA 3PUYA 5DLQE 5IP7H 1N36L 2OTLA 1OXUA 1KRTA 4RMFA 4LF7Q 4QY7A 1VQOA 2RHQB 3JC66 2N8NA 1YZ6A 2VL6A 3D0FA 3NELA 3TRZA 1A0IA 1PYBA 1CUKA 1T9HA 3AFPA 3CP0A 1QUQB 4UPAA 4DV7L 4XTCS 4GNXB 1IXRA 3AEVA 1CSQA 5FLMG 3HOUH 1VQNA 2WB1G 4JBJA 1HZCA 1PH6A 1YJNA 3K8AA 5E7NA 5IP7G 2E2IH 3KF8B 1N8RC 3U50C 4YHHL 1EQQA 2PQAA 4P73A 4YY3L 1IBML 1XMOQ 1HNXL 4A76A 1W2BA 2KENA 1N33Q 1HZAA 1IBKQ 4YWLA 1UWVA 4X66L 4JI3Q 1HNWQ 3KLWA 1X9NA 4LF4Q 1VQ7A 1OXTA 4P71A 2UU9L 1PFSA 1B70B 2NVTH 4JCVE 3UDIA 1I3QH 2K5HA 1K3RA 3GTMH 2JA5H 1U5KA 2ZTDA 1IBLL 3F8TA 1IBLQ 4A3LG 4IPGA 1YHBA 4WJ3M 3UDXA 2PI2E 4B3SL 5IYDG 2UUCL 3HOYH 3A5UA 1H95A 3PF5A 4YWKA 1C9OA 4MTNA 2UXDQ 1I6HH 3GO5A 1B7YB 2MO0A 4OWTB 4X66Q 4LF4L 4DV6Q 3HKSA 2BA1A 1VQDA 4DR1L 4PZ6A 4DR2Q 2R92H 3H15A 4LWCA 1HNXQ 3HOVG 4POFA 1GO3E 1LUZA 4JI1L 2K5NA 2WB1E 3TREA 5FJ8H 3KF6B 5C44G 1KC8C 3BZKA 2NN6I 2RHSB 3NENA 2Y0SG 4L5QA 4IOCA 1VCIA 3K7UC 4DV7Q 2UXCQ 4POGA 3AYHB 2E5LQ 1X3FA 3J7A5 2JA6H 5C44H 1YVCA 4BY7H 1I94L 4LF7L 1V9PA 2B29A 4AYBE 4JI0L 3K81C 1XPUA 4JV5L 2CWAA 4P75A 5AJ3L 1EWIA 1TWHH 1HH2P 1TWFH 3RLNA
chains in the Genus database with same CATH superfamily
1YI2A 3V2TA 1ENAA 2ZXOA 4K5WA 2B39A 3A8IE 2A68D 3K7AH 4FF2A 3QOJA 3T1HQ 2ICEC 2JA8H 4DR5Q 2EY2A 1NNXA 3PUVA 2FINB 2EY5A 3D6CA 3KF6A 1SE2A 2B3GA 1F2LA 2CKZB 1KDBA 1F9QA 4H02A 3S2DH 4K8JA 1PH8A 1P8LA 2D5DA 3X3MA 1EYCA 1ILPA 3NE5B 1VQBA 3F2DA 2DGYA 2Z1CA 3PMFA 2IW3A 2EOTA 2BE5C 2VZAA 3EROA 2ZJQA 4DR3L 1JB3A 3CRLC 2FFKB 5JJZA 4ZAIA 2HCCA 4XDXA 5ELDA 2QA4A 4ME5A 4BBSG 1BKBA 5JJKA 1ZKOA 5IYBH 4DK1A 3CF5A 1ESRA 2XNAC 4A3KH 1ZEQX 1LTGD 4IZ8A 4N9PA 3NP8A 1B3QA 4IFDH 1YNJD 2HQLA 4A3DH 1FR3A 2UUCQ 1TR5A 1JC7A 3CAMA 4CJ0B 4DV3L 3IKJA 3E0EA 1TWFB 4GOPC 4E6IA 2KBNA 4DR6Q 2E2HB 2QW7A 3VR4A 2NB0A 2PW7A 1HQMC 3KLRA 1W6KA 4A3IB 4R4IA 4HCSA 3HOZG 4X6AH 1MHWC 3I3CA 2A68C 1I4QA 3GTQB 3R2IA 4R4OA 1XPRA 2FMMA 1E2WA 2DNEA 3E9IA 4CHTB 2VUMB 4R8IA 1EYDA 3BZDB 3MXNB 1PFNA 3S14B 3VA5A 1YNNC 2Z8LA 3I4NG 1WTOA 2F0KA 1EIFA 1S5CD 4KJOA 4ABNA 1X3QA 4K5VA 4CKEA 1CKOA 3NTKA 4KV6A 2RCNA 3HKZG 5TSSA 3VA7A 1GOZA 4OIKA 4OWWB 2Z6KA 3K6OA 1BCPF 4JI3L 3EVQA 5IT9E 3FMCA 4G7OC 1QE6A 1FJGQ 2XSCA 1SLJA 3M7NA 1SYBA 4A3EH 1IBMQ 4DAYA 1E3PA 2M2LA 3UE1A 5IE8A 1CK1A 1I6HB 1S3OA 4ZLTF 2A6EC 5KYLA 1U4PA 3GTJH 1J8IA 4BBRH 1HA6A 5J3BA 1BCPC 1YBYA 1G291 3TQYA 4JI8L 3I72A 1I3QB 2FMCA 1Q8KA 1HZ9A 1PH5A 2OTJA 2E2HH 4DNIA 4FDBA 2JYOA 5GADC 2A19A 1IYJB 3S1MB 5I9PA 1SE3A 2V1CC 2EJGC 3B6YA 3F2CA 3PUZA 4M8AA 4OO1I 1TWCB 2NVQH 4DR6L 2EYFA 2K5WA 1JWUD 2HIVA 3BDLA 3Q24A 3J7ZC 2R92G 4X3KA 1EZ6A 1U4RA 3CQZB 5IIFA 3M4OH 3P7JA 3PSIA 2K04A 4C3HB 3M3YB 1PXUA 4LF9Q 1HNZL 4IUPA 2IX0A 2B2VA 1BVSA 4K0KL 3C3LA 3I4NH 2EXDA 4XIGS 2JE6I 4A3EB 1Y1VH 1LO5D 5JPMC 3OPOA 4L6TB 1EIGA 2EZVA 4IJHA 1SAPA 1W6JA 1Y8PB 4RCNA 4KLKA 4OIJA 4L63B 2KVMA 2PZTA 3VR5A 1KRSA 1HNZQ 1BBWA 1RF2D 4ZKCB 2QDLA 2SNMA 4RWSC 2F1MA 2JEBI 3K5MA 4QCLA 1SEBD 1WCMG 3PIOA 1N32Q 3STBD 4MNOA 2B8FA 2YTYA 2CQOA 5KYIA 3VDYA 1SROA 1PA6A 3CCVA 3BDOA 5CMDA 4R1JA 1S72A 2D9UA 4RG1A 1D1KA 3BU2A 3ZJYC 4A3JH 1RDPD 1RCVD 1VQAA 4ZUIA 4APVA 2JJQA 2CH4W 1N34L 3J80i 3OWFA 4YHHQ 4BWGB 2EY6A 4HIMA 4EX5A 2Z0SA 3URYA 3RMHA 1N34Q 4IUTA 1QVCA 2OQ0A 3D8GA 3IRBA 1QUQA 1EY0A 1UE1A 2F0PA 2F0OA 4DV4Q 2JA8B 3U9OA 1TU2B 2IHFA 1F9RA 4GNXC 4LW1A 1B2TA 1U4MA 4RGTA 5IYCG 1JQYD 1AN8A 1PHJA 1EIYB 2E2IB 4ZQ3A 1QG7A 2HUGA 5BR8Q 3HOZH 1GHJA 2RSNA 1SNDA 2DN8A 1YNND 3PV0A 2K75A 1JT8A 4YCVA 4B08A 3TMEA 2CCZA 1IHZA 4F8MA 3PCOB 1TXYA 3S1MH 3UI2A 3ZYYX 3CPWA 4JG2A 3CPFA 1EY7A 1RL2A 4LF9L 5IGBA 4DV0L 3NQIA 4NW2A 4B3MQ 3RZOH 3A7LA 2Q8IB 2WFWA 4OGQC 3KF8A 3S2HH 4TRDA 2UUBQ 2HT1A 1HNWL 5LMNQ 1EFWA 3FP9A 1XMOL 4FNFA 1Y1WG 5M3FH 2HHHL 3HOWB 5FOBB 2K50A 1Q1EA 4NXNL 5FLXL 4U68A 1V1QA 2EE1A 1PH2A 3CMEA 2F0HA 3NBHB 2OT2A 2QKIC 1K9MC 1KDAA 4CJ2C 5M5YB 5C3EB 4HMJA 2XWBB 4BBRB 1XJVA 2NN6G 3JAMc 3FKIH 1STYA 4JI8Q 2JA7H 4CJ1B 2I5LX 5EPKA 3PO3G 2JN4A 2PO4A 4A3FB 1O7ZA 5DM63 2YTVA 1HA5A 2K1BA 3Q6SA 4BXXG 2F52A 4B9WA 4KD4A 2JA5G 1VQCA 2BA0A 3EFXD 3H3VI 1F9SA 5M5XH 2F0TA 3J80L 4GN4B 5KNDA 4EQNA 4JI6Q 4B9XA 1VQEA 4DK0A 1PZID 2Z9HA 1I50B 4C56C 1DOLA 2PI2A 5IWAQ 3NEMA 1ASYA 2AMCB 1PDQA 5I6WA 2K32A 4O0AA 1VQKA 3RD4A 5G3LF 1N32L 2E8GA 3SK8A 3MEFA 4HMIA 3OTOL 2EJMA 2H1EA 4GKJL 3HOVH 1FNWA 4JOIC 1IYVA 5E4WC 3CQZH 4FXKC 2K5VA 1AEXA 1OO9B 4OL7A 2ZJRA 1YNXA 2HIXA 3WOEA 4AH6A 1EWCA 1OTCA 5IGFA 5C0XJ 4A3IG 2VS1A 4L5RC 3S1QH 5LMUQ 1QNKA 1J5EL 5JEAG 3TDQA 1XTDA 5CV8A 5FLXE 2M9VA 4L5SA 5C0XH 3NBHA 2N88A 4PV1C 2MQHA 3AQQA 4AQYL 1TWGH 3R93A 2L12A 3I4MB 5C4XH 4HIOA 2IT1A 4C3IB 2WACA 2ZT9C 3FKIB 3E6ZX 4A3IH 2JA7B 2E2DC 4JW0A 4QIWE 4R4TA 1NMGA 3VYSA 4LF7Q 1EEID 2B2UA 1WTQA 3DMUA 2EYHA 3N6RA 4QY7A 1MBYA 3NELA 1YZ6A 3D0FA 3TRZA 4A3GB 4UPAA 4XYQA 1QUQB 3GV6A 1QOHA 3QJYA 4A93B 3NQTA 2PNRC 4CDDC 2LY7A 1NR2A 3K8AA 1YJNA 3J7AV 1K28A 4YHHL 1E2VA 1IBML 4P73A 5C4HA 1XMOQ 1N33Q 3K0YA 1CT1D 1UWVA 3KLWA 1VMCA 1D5MC 2EXZA 1OXTA 1A3UA 1PFSA 1B70B 2WV6D 1BDOA 4A3KB 4WFN3 1TS4A 1L0YB 3G6JB 2MHVA 4B3SL 5IYDG 2F0SA 3AMUA 2C9OA 1I6HH 3O13A 4PQXA 3GO5A 1SE4A 5COYA 4DR1L 5CBEE 3H15A 1XYIA 4FYDA 4POFA 1HQRD 2K5NA 3KF6B 2NN6I 2RHSB 1LT3D 2B2YA 4L5QA 3GTMB 3WDNA 4ZK9B 5C44H 3D4WA 1YVCA 4JVZA 1I94L 2NUCA 1V9PA 3HRZC 4JI0L 4H44C 5AJ3L 1TWHH 1I4HA 2KJXA 3R3OA 3T13A 2L11A 1IW7C 5T1IA 2OQKA 1G6PA 4A3LH 1UAPA 4B3RQ 1MKHA 3GTOH 2KEEA 3EJIA 4FVMA 5EBDA 3PIO3 3L9AX 4DUYQ 4DKAC 4LFBL 4KHPQ 1PTOH 1WFQA 3DM3A 4U673 4K6DA 3JAML 1RD9D 2A6HD 3SE0A 3VYRA 4A93G 3OOCA 3KK7A 1XX8A 1RJTA 1BF4A 1AZPA 4IO9A 5K36H 5D14A 3HOUG 4DAVA 2KCTA 1O78A 4C1NI 3MXPA 3ERSX 2K6AA 3TP7A 2GVAA 1I4GA 4PZ8A 2OEOA 4HCEA 3JAMi 1VQLA 4DF7A 2OCEA 3VR2A 5DNFA 3RUZA 4DUYL 2K5QA 5C4ZA 1BBXC 3IFTA 1C48A 2PQEA 5CGKA 3HG9A 2L9HA 5IT9L 5C6AA 5IYBG 3G71A 2N49A 2R7ZH 3BZCA 2VQEL 3CHBD 1VQ9A 3K5OA 4DR4L 3KJOA 2KOLA 3IAYA 2B2VC 1X56A 4BA2I 4FP5D 1B44D 2CFMA 5M3FB 3PIP3 2ENBA 2XTIA 4YWMA 3SR1A 3I4NB 3CC7A 2B2WC 3FRPB 4JYAL 3BYYB 1EFID 1L2FA 2GN5A 4IQZA 3SGIA 4CDFC 4OELB 5FJ8G 4TVAB 1BCPB 1S5BD 4C3HH 4X62Q 4LF5Q 4JI1Q 1PLFA 1TS5A 1TS2A 4X65L 5LMUL 5HGTA 2WAQE 4KKTA 2RVLA 4DV2L 3ICEA 3EIVA 4FO2A 5IYDH 1SYCA 5A35A 2A73B 2Z4HA 3NHHA 4B3SQ 3SK5A 5AJ3Q 1Y1VG 1KLGD 2K33A 1JOQA 2LXKA 4HSPA 1NJIC 4OX9L 4A3FG 4KY7A 4R9WA 4WORA 4BBRG 2JA6G 4GKKQ 1WTPA 1EL0A 3K80C 4WJWA 3DWAA 2KQ3A 3SHLA 4A93H 1KL9A 1A3TA 4F87A 5IP9H 1VQ6A 3HEJA 3MFYA 2DUDA 3CCMA 1PFBA 3CCEA 2JEAI 3M85A 3RZOB 2UXDL 1PTOF 4MTKA 5CV4A 1YJ9A 2VNUD 1JOOA 3EN2A 1VQJA 1LTLA 3DEOA 4IALA 4FF1A 1PMRA 4JI0Q 5C5LA 3UDGA 1JE5A 4YIJA 1MD2D 2K03A 1PTOC 1N33L 1MJCA 3LGJA 1PZKD 3LX0A 4JI2L 3RNUA 4GN5A 1QZHA 2HHHQ 3NWTA 1STBA 1Y14B 1O7YA 1K3BC 3CU7A 2PNHA 1LTAD 1PH9A 1BO0A 5EPJA 3S1NB 1ML0D 3OWEB 2E76C 4HSVA 1ZXTA 1SYEA 1L0WA 4IUUA 3I8ZA 2I5HA 4RA8A 1WTHA 1NTGA 1NY4A 5I6YA 1L1OA 5CYUA 2SOBA 2NVXH 4H13C 3I55A 1GVPA 1CSPA 4RGOS 1JWSD 4GNXA 1RTNA 2A8VA 1KXLA 4PMCA 1G91A 1SR3A 5EGTA 4GS3A 4NB3A 4IUVA 2Q2UA 1R4PB 2MUYA 4MIUA 1K8AC 1LTTD 2IY5B 3VR6A 2CW0D 4FF3A 3AB9A 4DAPA 3HOWH 4WJ4A 1A15A 3OYYA 1Y1WB 1S4ZA 1I5FA 3I4MG 4LFAQ 2K01A 1DZ1A 2PW5A 1BCPD 4DV0Q 3RZDB 1HJPA 5ELNA 1HUMA 4I7ZC 1IL8A 1XXGA 2MP1A 4UAIA 2F0UA 3SVMA 5C44B 2R3ZA 2JQOA 2RQXA 4P2CB 4RFBA 3G4SA 4I65A 4B3RL 1DGSA 4LF6Q 2L55A 2XN9C 1I6VC 1VMPA 4DN4M 2KCCA 1TT2A 1P16A 5HY6A 1UE5A 5BN4A 3GV3A 4A3KG 1FGUA 3HFZB 1B9NA 4HR7B 1XNRQ 4ZYSA 2F3VA 1HR0Q 1HXYD 1KDCA 4LUVA 3MXUA 1J9OA 4TQUS 1SMXA 1TY2A 2L15A 1VQ8A 1WTWA 1WOCA 1WTRA 2K05A 1Q46A 2RF4A 5KEEA 3PGZA 3MA2B 3PQIA 1FNUA 1JMCA 1UEAB 2R6GA 2R93B 4DK6C 3I2ZA 2B2UC 3M4YA 1A2TA 4AYBB 3I56A 3H6MA 4RHRA 3NK9A 1VDZA 3J7YW 3S1QB 1JR0D 4Q5VA 2NVTB 1YHAA 1DYQA 3MTSA 2F0FA 4EQOA 1SSOA 2JA8G 1VQMA 4JI4L 3NPPA 2UU9Q 2UUAL 5C0XG 3Q0AA 1D7QA 4HJ9A 3OW2A 3H0GH 2NZ1D 2GA4B 3HGBA 4BS9A 4IOAA 4GOPB 1K83H 2NVYB 1SNOA 4NXNQ 4P72A 3R8BA 4A3GH 4JI2Q 4X62L 2BH8A 2WKCA 3BG3A 4OEMB 3I73A 5IGDA 5LMNL 4LNQA 4J8QA 1FD7D 3GTGB 5CR3A 4XXEA 1EUJA 3QB3A 2VUMG 2MO1A 2Z6KC 2BE5D 5E1FA 1V43A 2K4KA 4F88A 2Z6BA 4NP5A 1CKNA 1LT4D 4A3MG 3HKZE 1GKHA 2BOSA 2R93G 3NXWA 3ULLA 3RLOA 5JJLA 2JSOA 3I7FA 3S1RH 1EZ8A 2MNAA 2B2WA 4DV1L 5GROA 3MEHA 2PMZB 1HRJA 3T1YQ 3J81E 1U0LA 2P5ZX 4JI5L 1LABA 1D2BA 4I7AA 5C3EG 4JBMA 2VW9A 1M4VA 4LAAA 3VYTA 5C5MA 3QG1A 1KABA 1UUPA 2FXQA 2PZUA 2L5TA 5FLMH 3BVGA 4R4QA 5GAHC 2AHOB 1YITA 1VQ4A 1AE2A 2XGTA 3Q8DA 5M5XB 4OXPA 5C4JH 1BQQT 2J0TD 4HJ7A 3TS2A 3DUZA 4DV2Q 2JP1A 3VR3A 3A0JA 5JVG3 5I2YA 2KHIA 2KHJA 3K7AB 1RTOA 2D0OA 1NUCA 4JYAQ 3HOVB 4K2KA 4MZ9A 4LUOA 1PTOB 2O2LD 4OWXB 4JV5Q 4EGVA 1SNCA 1OXUA 1KRTA 4RMFA 1NCVA 3J81L 1ILQA 1VQOA 1MGSA 2VXWA 3P1HA 3CKIB 1PYBA 1CUKA 4GNXB 1IXRA 1VQNA 1NSNS 3DWPA 5E7NA 1N8RC 3U50C 3ONAB 1TWGB 4A76A 2PCFB 4YWLA 1HNWQ 1X9NA 4LF4Q 1AP0A 2MJ8A 1KNEA 3DHQA 2O5JC 2X69A 2F0JA 3DM1A 1U5KA 2R7ZB 1IBLQ 2B2TA 4WJ3M 3UDXA 1ET6A 2PI2E 5CC4A 1BOSA 2WINB 5IOCA 2UXDQ 2EY1A 3OIQA 1H9MA 4HN7A 2MO0A 4LF4L 4QIWB 4X66Q 4DV6Q 1JWMD 3HKSA 5KRUA 2BA1A 2R92H 4DR2Q 1HHVA 4S3SA 1GO3E 1QNUA 4J6HA 3GTKB 3MFGA 3OHXC 1VCIA 3SEBA 1Z7TA 4POGA 3J7A5 2JA6H 1SYFA 2RA4A 5C4XB 4G7ZC 1TKWB 3K81C 2LFNA 2CWAA 3QOLA 4WRDA 1A6XA 3DWQA 1C0AA 3RN5A 1I4PA 1AW7A 1S40A 1STGA 2EQSA 4A3BH 1B4OA 4IPDA 2XIWA 2OWOA 2UXBL 2QEJC 1GUGA 1O7LA 3PIPA 5DAUA 2O5IC 1JJ2A 2RSOA 1HTPA 1J5EQ 2NZOA 3RN2A 2I07B 4G4KA 2DY7A 1KNAA 2Q2HA 1H9JA 4UP9A 1LTID 1Y8NB 1E0BA 2EIFA 3NWSA 2F0MA 4A3EG 1VQIA 2RCFA 2EYJA 4OX9Q 2J7ZA 2OXPA 4G57A 4LUZA 2D62A 5C3EH 1A63A 4JPBW 3U9SA 1SJED 5GQOA 4XQQA 3U58A 3P20A 3M9BA 1U4LA 1L0XB 1GJXA 1X3EA 2F03A 5JVH3 2EYMA 4Y52H 3PO2G 4LF5L 3J80E 3S1RB 3P75A 3ULJA 2UXBQ 4X64L 1FL0A 1IKMA 1DCZA 3DXJC 4A3MH 4UP8A 3KYHC 1GXDC 2RKSA 1I50H 3I90A 4HIKA 3TS0A 4XT3B 3Q22A 5J22A 4HJ5A 2D0PA 3CC2A 1FVIA 1JJGA 2JK8A 4MHEA 2VQEQ 2D2CC 2AKWB 3GTLH 2CVRA 2K14A 3CCJA 5M3MB 4YY3Q 3A7AB 1KAWA 1X6OA 3H94A 1X55A 4DR2L 1SJHD 3QWNA 1VS0A 4NPSA 5EJWA 1SN8A 1VQGA 1Q3LA 1BXTA 4DV5Q 1E1OA 4QB4A 3W5OA 1QZGA 2X6LA 4K14A 1TWAB 5HURA 1X54A 2HCIA 3I4OA 4DAMA 4BY7B 4C3IH 5JEAH 3RR5A 1UE7A 1SE8A 3C46A 3K0XA 2L4NA 2F4IA 4CKCA 1C8CA 5EPLA 1AE3A 4L5TA 1B8AA 3TP5A 2M00A 3SK6A 3T51B 1M90C 2VUMH 1K8OA 1Q90A 4KD3A 1FJGL 1VQHA 5M3FG 1ESFA 4LFCL 1E24A 2BH2A 2VB3X 1KQSA 1W3SA 5C4JB 5AFWA 4IFDI 1VF5C 1HZBA 3I4LA 2L1BA 1WD1A 2DJFC 1Z47A 4Y7NH 4IFDG 3KBGA 1DOMA 4OONA 3CMAA 1XMQQ 1EYGA 4DU9A 1IBKL 5IY0A 2HDLA 3BVMA 1I4RA 1V1PB 3OMCA 4R4CA 4LF6L 1STHA 5M5YH 1K0SA 3F2UA 2GVBA 1EY5A 1M1KC 5KNCA 2ID0A 3MC0B 4CGYB 1FNVA 3S2DB 3HOUB 2SEBD 2F3WA 4G7HC 5LL6X 2NTSA 2N55A 3SXHA 2KCNA 3H09A 4ID6A 2G5DA 1MIUA 5D3IB 3W1BA 2E2JH 4DV3Q 1SXTA 1EQVA 2YV5A 2A6ED 1BR9A 2VB2X 1DONA 1UNSA 5I9OA 2MGSA 1HTLD 4H0LC 5HGQA 1V1OA 4QL5A 1JICA 4A3CG 3NTHA 1GUNA 4DUZQ 3CC4A 3A74A 2BDOA 3KJPA 2H5XA 3GTGH 4DXGA 4O42A 2QCPX 2HDMA 1X65A 4GLAC 2YU9H 2IJ0A 3HOXB 4R8NA 1JJCB 1AH9A 1EOTA 4A75A 1PYSB 3NSWA 2B2YC 2EDGA 1A8VA 1E22A 3U4ZA 2I5MX 3F1ZA 1SMYD 2IHEA 1MJEA 1LTRD 2RDHA 3E5SA 2G9HD 4JI6L 4ILWA 2AWOA 3ER0A 4BY1H 1D8LA 2MFIA 4RCOA 1KD1C 1L1OB 4A3FH 2F0IA 3OW7A 2K52A 1LT6D 3I4MH 1PTOD 3GTJB 3AFQA 2IX1A 5JEAJ 1IZ6A 4JBKA 2ZXRA 1SNQA 3K59A 1CQVA 4N9TA 5EKIA 4IUQA 3PO2H 3I91A 4J15A 4OO1G 3UE0A 1TS3A 5ISRA 1G2TA 1Q12A 3VYUA 1KTKA 3EBEA 1R4QB 3OTOQ 1DM0B 1FGBD 2F0LA 4LF8Q 3PO3B 3OIPA 4QJFA 4HIDA 3KLSX 1YNJC 1K8GA 4C3HG 3MXNA 5CV6A 3AU7A 4BY7G 2F0GA 1PZJD 2PMZE 1C7YA 3W2DA 4K8IA 3CXCA 5ELBA 1Z6HA 3C1FA 2LKVA 3FHWA 4GLVB 3S2HB 1PVOA 1T5EA 3CW2C 1EEFD 1GM5A 3KOJA 1F9PA 3CCSA 5I2XA 2J4XA 1PH3A 1JORA 5H1SE 5A2QE 1Y1WH 5CV9A 3M4OB 2UUAQ 5FLXc 2PYKA 4GKJQ 1E2ZA 3K58A 2AQ3B 4DK3C 3A56A 2AUKA 3W3AA 3BVZA 3RZDH 1BUVT 2NBFA 3A54A 3TP8A 2ZJPA 4HEDA 4JI5Q 1A2UA 4Q0FA 4XT1B 4CDCC 3M4PA 2A6HC 3J80c 2ZM6Q 3FEWX 2A5HA 2VY3A 4X65Q 3SK4A 1KLUD 1DOKA 4QF4A 5KGUA 3QIAA 2B2TC 4PMWA 4UY8C 1V1PA 1RODA 2F0EA 3PO2B 4C2MB 5IP9G 2VQFL 2QGQA 4K5XA 1GD7A 2CHBD 5GAEC 3L3OC 3H0GB 4PNYA 1K73C 1CKNB 4KK7A 1K0RA 4CBVA 3M3YH 4NXMQ 1L1OC 4DR4Q 2ZXPA 1PFMA 1D6EC 4DAYB 3KDFA 4KI0A 1DD2A 4X64Q 4BY1B 1WTXA 3FVQA 1YEZA 1B50A 2NTTA 2WP8J 4K2LA 1CTMA 4DR3Q 2Q8TA 1OXXK 2KECA 4TSSA 3TBIB 4ZRZA 3Q23A 2N78A 5NUCA 3D3RA 1HR0L 1CZWA 4YCUA 4DA2A 2Q2TA 4IURA 2KEDA 1TQOA 2B8GA 1SFOH 3FDTA 4LMQD 1H9RA 2L0CA 3HOYB 4QQBX 1LV9A 4PMBA 4YCWA 1F2ZA 3FPUB 4LFBQ 2QDBA 5M3MG 3N52A 1NE3A 1CM9A 4IPHA 4A3JB 4M1UB 2KUMA 4FXDA 4GKKL 4HJ8A 1G51A 2PPBC 4BBSH 2RBMA 1MSGA 5C3WA 4HJAA 3S14H 3X3NA 4DR7Q 2LXJA 1EOVA 2TSSA 1CKMA 1JE4A 1QVGA 3L0OA 5M3MH 2DNCA 1PH7A 2OTLA 3PUYA 3OMGA 3TSSA 4KN4C 3IFDA 2N8NA 1A0IA 1T9HA 3CP0A 4K6LA 3AEVA 4DV7L 2XRSD 5FLMG 5J39A 3HOUH 2KA7A 1PH6A 1HZCA 2K28A 4RKLA 2E2IH 3KF8B 2PQAA 3V96A 4YY3L 2E2JB 1W2BA 4X66L 2XWJB 2NVTH 1HPCA 1I3QH 3HS0C 2K5HA 1K3RA 1GUWA 3SDZA 1IBLL 3M7GA 4A3LG 3F8TA 1ENCA 1G2SA 4KJNA 4IN3A 1GUOA 1EWHA 1SFOB 5CBAE 3S9WA 3A5UA 1H95A 3PF5A 1C9OA 4IUNA 2AQ2B 2E74C 2FHTA 1B7YB 3A8JE 1TWHB 2WIIB 4PZ6A 4ZKBB 4LWCA 3HOVG 2BDNA 4JI1L 3TREA 5FJ8H 5C44G 1F2MA 3BZKA 3NENA 2Y0SB 5FK9C 2Y0SG 3K7UC 2UXCQ 3AYHB 3GTOB 1WCMB 4BY7H 1AFPA 3T56B 1SYDA 3KBXA 3QR8A 1XPUA 1DJRD 3HP3A 4XYOA 3MAQA 4P75A 4JV5L 3C1EA 1B9MA 1TWFH 1HH2P 4A3CH 3RLNA 1JB7A 5DM73 5M5WB 2R7ZG 1PRTC 2AWNA 4BA1I 4LFCQ 1J6QA 4DV5L 5BN3A 1LLRD 2NZHA 1NAPA 3GDEA 3S1NH 2BCOA 3PUWA 3PO3H 3A5ZB 5IT9c 2QILA 2EVBA 4DR5L 4UHVA 1H9SA 4ALPA 4DR1Q 1K83B 1OXVA 3ERQA 2A74C 2I46A 4BY1G 1H9KA 2Q8RE 3TZDA 2NVQB 4GLXA 3DLLA 5E3FA 3T53B 4IJLA 4ZCKA 2QEXA 4QGUA 4KY5A 1PRTF 4TKOB 1ENFA 2G9DA 1OXSC 4DXFA 2NVXB 2E5LL 2V4DA 4PG3A 2R92B 2XVSA 1VF7A 4NKLA 3HOYG 4X3UA 1KIXA 1WD0A 2ICIA 3GTKH 2Z4IA 4KTAA 4V0BA 1A62A 3CD6A 4OO1H 3HOXH 4EQPA 1EYAA 5D65A 5EBCA 1QB5D 2CH4A 1RKNA 2CQAA 3EQLC 4HTHA 3GTPB 2MPMA 3WWVA 1XPOA 1EU3A 3FKIG 2JA7G 1ICFB 3J7AF 3W1GA 1N36Q 2B63H 4C3JB 2EJFC 1HFNA 1YIJA 1XNQQ 1NMFA 4AYBG 3CCUA 5EQ0A 1SDFA 1I94Q 1S5ED 1D5XC 1WTVA 3GD7A 2ZTCA 1Q82C 5JJIA 1KHIA 1TVXA 3F2BA 2B63G 1X3PA 3G48A 4RH6A 3U4VA 3EA6A 2YYZA 5I4DA 4XQJA 3ND9A 4GN3B 2R7FA 3UDFA 4KMUC 1II3A 1QVFA 2F4VL 3NTIA 4EQ5A 4A3BG 3J81i 1E1TA 1XTCD 1N9WA 1ET9A 1LTBD 1TWCH 3S16H 3NUCA 5LMNW 1IYUA 2WAQG 1EY8A 2SNSA 5M9OA 3E9HA 1JOKA 2IPKD 3A8KE 2TMPA 5CORA 1ONLA 3CRKC 5IWAL 4IPCA 2K5DA 3HOZB 3R2TA 4AIMA 2EPBA 5IODA 4KHPL 2WAQB 2AUJD 2NN6H 2HQEA 2OF1A 4RHSA 4QMGA 1SYGA 3PF4A 3RLFA 1UEBA 3S17H 1CQFA 3D31A 5C3XA 5FO8B 1STEA 3KDFB 4A3MB 1BBUA 1Q1BA 5CV7A 5FKAC 4C3JG 1QWYA 5GAGC 2ZTEA 1GHKA 4X3TA 1S5DD 2ATWA 2KCMA 1PYWD 1X32A 3BJUA 5CV5A 3TZUA 4F7XA 1YJWA 1AZQA 2NYZD 4JC0A 4JOIA 3TN2A 1NBWA 1G6ZA 1VQFA 1Q81C 2Q2IA 2CW0C 4DNRB 1DXMA 4BBSB 3HOXG 1Q7YC 3CCQA 1R9TH 4XQNA 3HKZB 3BDCA 3T1HL 2F0VA 1TIID 1IL2A 1WVLA 4ODGA 2ZM6L 1PRTB 4KHVA 3A55A 4QUFA 4JI7Q 1EIHA 1SNPA 1WI5A 3D4DA 2WB1B 2UUBL 1LT5D 2A69D 5T1GA 1X3GA 1F77A 1TWAH 1EU4A 4QUCA 4KY6A 2VQFQ 1NR4A 3TP6A 1C4QA 4LFAL 4A4IA 1F2YA 2ES2A 5F2DA 1SRUA 5ELFA 1RHPA 5IYCH 1D5ZC 4DUZL 3KUPA 3GQBA 4DV6L 4BXXH 4RGMA 2XRQD 4C2MH 1LYLA 4DNTB 4LJZC 5BR8L 4ZUJA 4P74A 3MZ5A 2Y0SE 5BN5A 5FO9B 3M4QA 2LS01 3KLSA 1T5XD 3L2PA 1B1ZA 2F0WA 4ULLA 3MVVA 5JOBA 5ELEA 3JAME 3BYTB 4L8JA 2X6GA 3KFUA 2IL8A 2CWPA 2PQAB 1MI2A 4CDEC 4IFDJ 1Q8IA 1WYDA 4JBWA 1WCMH 4X3SA 4DV1Q 3ULPA 1GUSA 2YU9B 2AQ1B 5M5WH 1YHQA 3ND8A 3TEHB 3QO2A 1PH4A 4KN7C 1E7ZA 3S17B 3MXGA 2R93H 1XWEA 3C2PA 2EYOA 1STAA 1EY9A 1PH1A 2I0QA 1UE6A 3D4RA 3GTQH 4RGNA 3STBC 1LTSD 1MSHA 1XNRL 5IGCA 3ITPA 1B3AA 1STNA 3L7ZC 1Y69U 5G3LD 3LWUA 5JAVA 1LM0A 5KNBA 4J1MA 3HZXA 2F0QA 4PZ7A 4O2DA 3H91A 1EQRA 3T1YL 1ZYRD 5LHY1 4UDUC 5DEHA 1SMYC 4K0KQ 2H4OA 3H0GG 1IW7D 4B3TL 2SDFA 5C0XI 3D6WA 1QJOA 2K7VA 1TY0A 2NWGA 4ME3A 3G6EA 1D1IA 5LL6S 4GZYC 4GOPA 1CA6A 1CHQD 1CHPD 3H3VH 5EAYA 1CI3M 5D3DA 4DV4L 4O1NA 2F0NA 4KHZA 3CCRA 1RIPA 4C3JH 2R7DA 4OHJA 3J81j 2LMCB 1VQ5A 4HAEA 1IKLA 1ZYRC 1V8QA 3E3XA 5ELCA 4RAUC 3T4AC 3NBIA 5K36G 3PUXA 4A3JG 1Z9FA 3BS1A 1XMQL 3WOFA 2F0DA 2JA5B 4NMZA 1KAAA 2JA6B 1PRTD 4C1NK 2ASBA 4A3BB 2E75C 2RDGA 1CZGA 1Q86C 3S24A 4DR7L 1Y8OB 4A3DG 4AQYQ 1PV4A 1EY6A 3I70A 2NVYH 2QF7A 4FF4A 2A69C 2LSSA 3LNNA 1CFMA 4DPGA 1O7IA 4UP7A 2HD3A 3K5NA 1GUTA 4RKBA 3S15H 2YTXA 2KHSA 1EQTA 2JA9A 2IX3A 1WJJA 1Y1VB 4B3ML 5ELOA 4JI4Q 5IGGA 3J81c 3DEPA 4A3GG 1HUNA 5A2QL 1VQPA 1BNZA 4B3TQ 2EYLA 4MN3A 4N8FA 5J1ZA 3MWYW 2WKDA 2F3IA 2PZWA 4KKUA 3T16A 1ASZA 2A1AA 2O4XA 5K5PA 3HOWG 3GTPH 4JI7L 4N8X1 1B53A 2F4VQ 5C4XG 1JCKB 2C35B 5EKKA 1I4XA 2N3SA 4DGZA 4CKBA 3LWEA 1HR0W 1HCZA 3OSOA 1R9TB 3CCLA 4NXML 2ALYB 1SNMA 2FJ2A 1M8AA 4JK1C 4LF8L 3K5LA 1XNQL 4DFAA 1S5FD 4V190 5IP7H 1N36L 5DLQE 2R61A 2IWHA 2RHQB 3JC66 2VL6A 3AFPA 2UXCL 4XTCS 1CSQA 1HFGA 2C5CA 4KKSA 2WB1G 4JBJA 4EVOA 1U9RA 2EYPA 3GP7A 5L37A 5IP7G 1LACA 4FXGC 2DJGC 1EQQA 4A3DB 3MHBA 1K8MA 1HNXL 2KENA 1HZAA 1IBKQ 2RDFA 4JI3Q 5KIXA 2DY8A 1QCBD 4C3IG 1VQ7A 2B63B 4P71A 2UU9L 4LK1C 3H3VC 4Z9CB 4JCVE 3UDIA 3FPPA 1CA5A 1G8ZD 3GTMH 2JA5H 2ZTDA 4IPGA 1YHBA 1FYCA 3G7LA 2UUCL 3HOYH 1A3VA 4YWKA 4MTNA 3IL8A 4OWTB 1ICWA 1VQDA 1HNXQ 1EY4A 1LUZA 3V05A 2WB1E 3K57A 1H9SB 1KC8C 3GTLB 4NDXA 5EKLA 4IOCA 4DV7Q 3E0JA 5JPNC 2E5LQ 1X3FA 4Y7NB 1SBBB 5IGEA 3S15B 2JXMB 1O80A 4LF7L 2B29A 4AYBE 5E4XA 5FO7B 1EWIA 4H7BA 1QILA 3S16B
chains in the Genus database with same CATH topology
3RN5A 1YI2A 1JB7A 2R7ZG 2AWNA 4BA1I 4LFCQ 1J6QA 4DV5L 1S40A 2EQSA 2NZHA 4A3BH 4IPDA 3GDEA 2OQKA 3S1NH 3K7AH 4A3LH 1G6PA 2OWOA 3PUWA 2JA8H 2UXBL 3T1HQ 3PO3H 4B3RQ 3A5ZB 5IT9c 3PIPA 4DR5Q 1MKHA 1JJ2A 4DR5L 3GTOH 1J5EQ 3PUVA 2NZOA 3RN2A 4DUYQ 3KF6A 4ALPA 2B3GA 4DR1Q 1OXVA 2Q2HA 4DKAC 4LFBL 4KHPQ 1WFQA 3DM3A 2CKZB 4H02A 4BY1G 3S2DH 4UP9A 1PH8A 2EIFA 1P8LA 4A93G 4GLXA 3DLLA 4A3EG 1VQIA 1VQBA 3F2DA 4IJLA 4IO9A 4OX9Q 2DGYA 2QEXA 4LUZA 4QGUA 3HOUG 2VZAA 2KCTA 2D62A 5C3EH 1A63A 2ZJQA 4DR3L 3ERSX 1OXSC 5GQOA 2GVAA 4PZ8A 3U58A 2E5LL 4A3CH 3M9BA 4PG3A 3JAMi 1VQLA 2QA4A 1X3EA 2OCEA 1BKBA 4BBSG 5JJKA 5IYBH 4DUYL 3HOYG 4Y52H 1KIXA 3GTKH 3PO2G 4LF5L 3CF5A 1A62A 3CD6A 3HOXH 4A3KH 3ULJA 2UXBQ 4X64L 1FL0A 5IYBG 3G71A 4A3MH 2N49A 2HQLA 2R7ZH 4UP8A 4A3DH 3WWVA 3BZCA 2VQEL 3FKIG 1XPOA 2UUCQ 2JA7G 3KYHC 3CAMA 1VQ9A 4DR4L 3KJOA 1I50H 3W1GA 1X56A 1N36Q 4HIKA 3TS0A 2B63H 4BA2I 4DV3L 3E0EA 1YIJA 2CFMA 4HJ5A 1XNQQ 1NMFA 4AYBG 2XTIA 3CCUA 4YWMA 4GOPC 1I94Q 2D0PA 3CC2A 1FVIA 2KBNA 3GD7A 2JK8A 4DR6Q 1JJGA 3CC7A 2VQEQ 4JYAL 2ZTCA 1L2FA 2AKWB 2GN5A 3SGIA 1Q82C 5JJIA 3GTLH 1KHIA 2K14A 4TVAB 5FJ8G 3CCJA 4C3HH 4YY3Q 4R4IA 3F2BA 2B63G 3HOZG 3G48A 3U4VA 2YYZA 4X62Q 4LF5Q 4JI1Q 1KAWA 1X6OA 4X6AH 4X65L 5LMUL 1X55A 2WAQE 2R7FA 4GN3B 3UDFA 4DR2L 1QVFA 4DV2L 1VS0A 4NPSA 4R4OA 1SN8A 1VQGA 3EIVA 2F4VL 4EQ5A 4DV5Q 3ICEA 1XPRA 5IYDH 4A3BG 1E1OA 3J81i 1E1TA 1N9WA 1TWCH 3W5OA 3E9IA 3S16H 4B3SQ 1QZGA 5LMNW 3MXNB 5AJ3Q 1Y1VG 1X54A 2WAQG 3I4OA 4DAMA 2LXKA 3I4NG 1NJIC 3E9HA 4OX9L 1EIFA 4C3IH 4A3FG 3RR5A 1UE7A 1SE8A 1CKOA 2RCNA 3K0XA 3HKZG 5IWAL 4IPCA 4OWWB 4BBRG 2Z6KA 4AIMA 2JA6G 4GKKQ 4JI3L 4KHPL 3K80C 1AE3A 1FJGQ 4L5TA 1SLJA 1B8AA 3M7NA 4A3EH 1IBMQ 3PF4A 1M90C 3RLFA 1UEBA 4A93H 1KL9A 2VUMH 1E3PA 5IP9H 1FJGL 1VQ6A 3D31A 3S17H 3CCMA 2DUDA 3KDFB 3UE1A 1VQHA 5IE8A 1BBUA 1Q1BA 3CCEA 3M85A 5M3FG 2JEAI 1S3OA 2UXDL 4LFCL 1E24A 3GTJH 2BH2A 5GAGC 2ZTEA 1KQSA 4BBRH 2ATWA 5J3BA 2KCMA 3BJUA 1YJ9A 1W3SA 1YBYA 2VNUD 1G291 3EN2A 1VQJA 4IFDI 3TQYA 4JI8L 1LTLA 1HZBA 4JI0Q 1Q8KA 1Z47A 1YJWA 1HZ9A 1PH5A 2OTJA 4JC0A 4JOIA 2E2HH 1NBWA 4DNIA 1VQFA 4FDBA 5GADC 2Q2IA 4Y7NH 3UDGA 4OONA 1Q81C 4IFDG 1JE5A 1C0AA 3CMAA 1XMQQ 1EYGA 2A19A 1IBKL 5IY0A 1N33L 3HOXG 1IYJB 1Q7YC 1MJCA 3CCQA 1R9TH 4R4CA 3LGJA 4LF6L 4JI2L 2V1CC 3F2CA 3B6YA 5M5YH 3T1HL 3RNUA 4GN5A 1IL2A 1QZHA 2GVBA 3PUZA 2ZM6L 1Y14B 2HHHQ 1M1KC 2ID0A 4JI7Q 2PNHA 4OO1I 1PH9A 1WI5A 2NVQH 4DR6L 2UUBL 1X3GA 1TWAH 2HIVA 1MIUA 2E2JH 3W1BA 3J7ZC 2R92G 4DV3Q 1L0WA 3M4OH 2I5HA 3PSIA 2YV5A 1NTGA 1NY4A 2VQFQ 1L1OA 4LFAL 2NVXH 3I55A 1GVPA 1CSPA 4A4IA 4LF9Q 1HNZL 2IX0A 1BVSA 2ES2A 1SRUA 4GNXA 2A8VA 4K0KL 5HGQA 3I4NH 1KXLA 2EXDA 4XIGS 2JE6I 4QL5A 1SR3A 4GS3A 4NB3A 5IYCH 4A3CG 1Y1VH 2Q2UA 4DUZL 4DUZQ 3CC4A 1K8AC 3A74A 3KJPA 4IJHA 4DV6L 2IY5B 4BXXH 2H5XA 4C2MH 3GTGH 4KLKA 3HOWH 1X65A 4WJ4A 1LYLA 3OYYA 1KRSA 5BR8L 1BBWA 4GLAC 1HNZQ 2YU9H 1I5FA 2JEBI 4P74A 3I4MG 2Y0SE 4LFAQ 1WCMG 3PIOA 3M4QA 3STBD 4MNOA 1N32Q 2YTYA 2CQOA 3VDYA 1JJCB 1SROA 1PA6A 3L2PA 3CCVA 1AH9A 4DV0Q 4A75A 1PYSB 4R1JA 1HJPA 5ELNA 1S72A 4RG1A 1A8VA 1E22A 3BU2A 3U4ZA 3ZJYC 2I5MX 3KFUA 4A3JH 3F1ZA 4APVA 1VQAA 2CWPA 2PQAB 2IHEA 1MJEA 2JJQA 2JQOA 4JI6L 2AWOA 3ER0A 4BY1H 1D8LA 1N34L 3TS2A 2MFIA 3J80i 4IFDJ 4YHHQ 1KD1C 1L1OB 4A3FH 1WYDA 4JBWA 1WCMH 3G4SA 2K52A 4DV1Q 3ULPA 3I4MH 1DGSA 4B3RL 2IX1A 3AFQA 4LF6Q 4HIMA 4EX5A 2Z0SA 5M5WH 1YHQA 5JEAJ 1IZ6A 1N34Q 3TEHB 1QVCA 2OQ0A 4JBKA 3IRBA 1PH4A 1E7ZA 1QUQA 1P16A 1UE1A 4DV4Q 2R93H 5HY6A 1UE5A 3PO2H 4A3KG 2IHFA 4J15A 1FGUA 3HFZB 3UE0A 1XNRQ 4GNXC 4LW1A 1PH1A 2I0QA 4OO1G 1Q12A 1UE6A 5IYCG 1HR0Q 3GTQH 3EBEA 3OTOQ 1PHJA 4LUVA 3STBC 4TQUS 4LF8Q 1SMXA 1XNRL 4QJFA 4HIDA 1EIYB 2L15A 1VQ8A 1WOCA 1K8GA 3L7ZC 5BR8Q 3HOZH 1LM0A 1Q46A 4BY7G 2RF4A 3PV0A 4PZ7A 3PGZA 2K75A 4O2DA 2PMZE 1JT8A 1C7YA 3CXCA 1EQRA 4YCVA 3T1YL 3FHWA 4GLVB 1PVOA 1JMCA 2R6GA 3CW2C 1GM5A 2CCZA 3KOJA 3PCOB 4DK6C 3I2ZA 1TXYA 3CCSA 1PH3A 3I56A 3S1MH 4K0KQ 3CPWA 5H1SE 4JG2A 1Y1WH 3CPFA 2UUAQ 3H0GG 5FLXc 1RL2A 4LF9L 4B3TL 4GKJQ 4DV0L 5C0XI 4DK3C 1YHAA 2JA8G 3G6EA 4ME3A 1VQMA 3RZDH 4JI4L 4B3MQ 3RZOH 4GOPA 2WFWA 2UU9Q 2UUAL 5C0XG 3H3VH 3S2HH 1D7QA 5EAYA 2UUBQ 4DV4L 4HJ9A 2HT1A 2ZJPA 3H0GH 3OW2A 4JI5Q 1HNWL 5LMNQ 4KHZA 3CCRA 1RIPA 3FP9A 1EFWA 4C3JH 1XMOL 2R7DA 3M4PA 1Y1WG 3J80c 3J81j 2ZM6Q 5M3FH 1VQ5A 2HHHL 2VY3A 4IOAA 4X65Q 4GOPB 1K83H 4NXNQ 2K50A 4P72A 1Q1EA 4NXNL 4JI2Q 4A3GH 4LFBQ 4X62L 1V1QA 2BH8A 1PH2A 3CMEA 5K36G 3PUXA 3NBHB 4A3JG 1Z9FA 5LMNL 4PMWA 1XMQL 4LNQA 4UY8C 1K9MC 1EUJA 5IP9G 2VUMG 2MO1A 2Z6KC 2VQFL 2QGQA 1V43A 1GD7A 5GAEC 2ASBA 1Q86C 2K4KA 1XJVA 2NN6G 3S24A 3JAMc 1K73C 3FKIH 1CKNB 4JI8Q 2JA7H 4DR7L 2I5LX 1K0RA 3PO3G 3M3YH 1CKNA 4A3DG 4AQYQ 4NXMQ 1L1OC 1PV4A 4A3MG 4DR4Q 3HKZE 2NVYH 1GKHA 2YTVA 2R93G 4BXXG 4DAYB 3KDFA 3RLOA 3ULLA 2F52A 4KI0A 2JA5G 1VQCA 2BA0A 3I7FA 4X64Q 3S1RH 5JJLA 2LSSA 2MNAA 3H3VI 4DV1L 5GROA 5M5XH 4DPGA 1O7IA 4GN4B 4UP7A 3T1YQ 4JI6Q 1U0LA 1VQEA 4JI5L 3S15H 2YTXA 1YEZA 2JA9A 5IWAQ 2PI2A 5C3EG 4JBMA 2VW9A 2WP8J 1WJJA 3NEMA 1ASYA 2AMCB 4B3ML 4DR3Q 5ELOA 4JI4Q 1OXXK 2FXQA 4O0AA 1VQKA 2N78A 5FLMH 3J81c 1N32L 4R4QA 2E8GA 3OTOL 3MEFA 1HR0L 4A3GG 4YCUA 5GAHC 4GKJL 1VQPA 4B3TQ 2AHOB 1YITA 2Q2TA 3HOVH 4JOIC 1SFOH 3CQZH 1VQ4A 1AE2A 2K5VA 2F3IA 2XGTA 3Q8DA 4OXPA 5C4JH 1YNXA 2ZJRA 4QQBX 2UXCL 1ASZA 2A1AA 2HIXA 4AH6A 4YCWA 4HJ7A 1OTCA 4JI7L 3GTPH 5C0XJ 4DV2Q 2F4VQ 5M3MG 3A0JA 2VS1A 4A3IG 3HOWG 4L5RC 3S1QH 5C4XG 2C35B 5LMUQ 1J5EL 5JEAG 2N3SA 1NE3A 1XTDA 4IPHA 2KHIA 4GKKL 2KHJA 1G51A 4HJ8A 1HR0W 4BBSH 4L5SA 2D0OA 4HJAA 3S14H 3CCLA 4JYAQ 2MQHA 3AQQA 2ALYB 4AQYL 4NXML 1TWGH 4DR7Q 5C4XH 4HIOA 2IT1A 4LF8L 2LXJA 1EOVA 4MZ9A 4LUOA 1XNQL 1QVGA 1CKMA 3L0OA 4OWXB 5M3MH 4A3IH 4JV5Q 1PH7A 4QIWE 4R4TA 1NMGA 3PUYA 5DLQE 5IP7H 1N36L 2OTLA 1OXUA 1KRTA 4RMFA 4LF7Q 4QY7A 1VQOA 2RHQB 3JC66 2N8NA 1YZ6A 2VL6A 3D0FA 3NELA 3TRZA 1A0IA 1PYBA 1CUKA 1T9HA 3AFPA 3CP0A 1QUQB 4UPAA 4DV7L 4XTCS 4GNXB 1IXRA 3AEVA 1CSQA 5FLMG 3HOUH 1VQNA 2WB1G 4JBJA 1HZCA 1PH6A 1YJNA 3K8AA 5E7NA 5IP7G 2E2IH 3KF8B 1N8RC 3U50C 4YHHL 1EQQA 2PQAA 4P73A 4YY3L 1IBML 1XMOQ 1HNXL 4A76A 1W2BA 2KENA 1N33Q 1HZAA 1IBKQ 4YWLA 1UWVA 4X66L 4JI3Q 1HNWQ 3KLWA 1X9NA 4LF4Q 1VQ7A 1OXTA 4P71A 2UU9L 1PFSA 1B70B 2NVTH 4JCVE 3UDIA 1I3QH 2K5HA 1K3RA 3GTMH 2JA5H 1U5KA 2ZTDA 1IBLL 3F8TA 1IBLQ 4A3LG 4IPGA 1YHBA 4WJ3M 3UDXA 2PI2E 4B3SL 5IYDG 2UUCL 3HOYH 3A5UA 1H95A 3PF5A 4YWKA 1C9OA 4MTNA 2UXDQ 1I6HH 3GO5A 1B7YB 2MO0A 4OWTB 4X66Q 4LF4L 4DV6Q 3HKSA 2BA1A 1VQDA 4DR1L 4PZ6A 4DR2Q 2R92H 3H15A 4LWCA 1HNXQ 3HOVG 4POFA 1GO3E 1LUZA 4JI1L 2K5NA 2WB1E 3TREA 5FJ8H 3KF6B 5C44G 1KC8C 3BZKA 2NN6I 2RHSB 3NENA 2Y0SG 4L5QA 4IOCA 1VCIA 3K7UC 4DV7Q 2UXCQ 4POGA 3AYHB 2E5LQ 1X3FA 3J7A5 2JA6H 5C44H 1YVCA 4BY7H 1I94L 4LF7L 1V9PA 2B29A 4AYBE 4JI0L 3K81C 1XPUA 4JV5L 2CWAA 4P75A 5AJ3L 1EWIA 1TWHH 1HH2P 1TWFH 3RLNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN5 A;  1YI2 A;  1JB7 A;  2R7Z G;  2AWN A;  4BA1 I;  4LFC Q;  1J6Q A;  4DV5 L;  1S40 A;  2EQS A;  2NZH A;  4A3B H;  4IPD A;  3GDE A;  2OQK A;  3S1N H;  3K7A H;  4A3L H;  1G6P A;  2OWO A;  3PUW A;  2JA8 H;  2UXB L;  3T1H Q;  3PO3 H;  4B3R Q;  3A5Z B;  5IT9 c;  3PIP A;  4DR5 Q;  1MKH A;  1JJ2 A;  4DR5 L;  3GTO H;  1J5E Q;  3PUV A;  2NZO A;  3RN2 A;  4DUY Q;  3KF6 A;  4ALP A;  2B3G A;  4DR1 Q;  1OXV A;  2Q2H A;  4DKA C;  4LFB L;  4KHP Q;  1WFQ A;  3DM3 A;  2CKZ B;  4H02 A;  4BY1 G;  3S2D H;  4UP9 A;  1PH8 A;  2EIF A;  1P8L A;  4A93 G;  4GLX A;  3DLL A;  4A3E G;  1VQI A;  1VQB A;  3F2D A;  4IJL A;  4IO9 A;  4OX9 Q;  2DGY A;  2QEX A;  4LUZ A;  4QGU A;  3HOU G;  2VZA A;  2KCT A;  2D62 A;  5C3E H;  1A63 A;  2ZJQ A;  4DR3 L;  3ERS X;  1OXS C;  5GQO A;  2GVA A;  4PZ8 A;  3U58 A;  2E5L L;  4A3C H;  3M9B A;  4PG3 A;  3JAM i;  1VQL A;  2QA4 A;  1X3E A;  2OCE A;  1BKB A;  4BBS G;  5JJK A;  5IYB H;  4DUY L;  3HOY G;  4Y52 H;  1KIX A;  3GTK H;  3PO2 G;  4LF5 L;  3CF5 A;  1A62 A;  3CD6 A;  3HOX H;  4A3K H;  3ULJ A;  2UXB Q;  4X64 L;  1FL0 A;  5IYB G;  3G71 A;  4A3M H;  2N49 A;  2HQL A;  2R7Z H;  4UP8 A;  4A3D H;  3WWV A;  3BZC A;  2VQE L;  3FKI G;  1XPO A;  2UUC Q;  2JA7 G;  3KYH C;  3CAM A;  1VQ9 A;  4DR4 L;  3KJO A;  1I50 H;  3W1G A;  1X56 A;  1N36 Q;  4HIK A;  3TS0 A;  2B63 H;  4BA2 I;  4DV3 L;  3E0E A;  1YIJ A;  2CFM A;  4HJ5 A;  1XNQ Q;  1NMF A;  4AYB G;  2XTI A;  3CCU A;  4YWM A;  4GOP C;  1I94 Q;  2D0P A;  3CC2 A;  1FVI A;  2KBN A;  3GD7 A;  2JK8 A;  4DR6 Q;  1JJG A;  3CC7 A;  2VQE Q;  4JYA L;  2ZTC A;  1L2F A;  2AKW B;  2GN5 A;  3SGI A;  1Q82 C;  5JJI A;  3GTL H;  1KHI A;  2K14 A;  4TVA B;  5FJ8 G;  3CCJ A;  4C3H H;  4YY3 Q;  4R4I A;  3F2B A;  2B63 G;  3HOZ G;  3G48 A;  3U4V A;  2YYZ A;  4X62 Q;  4LF5 Q;  4JI1 Q;  1KAW A;  1X6O A;  4X6A H;  4X65 L;  5LMU L;  1X55 A;  2WAQ E;  2R7F A;  4GN3 B;  3UDF A;  4DR2 L;  1QVF A;  4DV2 L;  1VS0 A;  4NPS A;  4R4O A;  1SN8 A;  1VQG A;  3EIV A;  2F4V L;  4EQ5 A;  4DV5 Q;  3ICE A;  1XPR A;  5IYD H;  4A3B G;  1E1O A;  3J81 i;  1E1T A;  1N9W A;  1TWC H;  3W5O A;  3E9I A;  3S16 H;  4B3S Q;  1QZG A;  5LMN W;  3MXN B;  5AJ3 Q;  1Y1V G;  1X54 A;  2WAQ G;  3I4O A;  4DAM A;  2LXK A;  3I4N G;  1NJI C;  3E9H A;  4OX9 L;  1EIF A;  4C3I H;  4A3F G;  3RR5 A;  1UE7 A;  1SE8 A;  1CKO A;  2RCN A;  3K0X A;  3HKZ G;  5IWA L;  4IPC A;  4OWW B;  4BBR G;  2Z6K A;  4AIM A;  2JA6 G;  4GKK Q;  4JI3 L;  4KHP L;  3K80 C;  1AE3 A;  1FJG Q;  4L5T A;  1SLJ A;  1B8A A;  3M7N A;  4A3E H;  1IBM Q;  3PF4 A;  1M90 C;  3RLF A;  1UEB A;  4A93 H;  1KL9 A;  2VUM H;  1E3P A;  5IP9 H;  1FJG L;  1VQ6 A;  3D31 A;  3S17 H;  3CCM A;  2DUD A;  3KDF B;  3UE1 A;  1VQH A;  5IE8 A;  1BBU A;  1Q1B A;  3CCE A;  3M85 A;  5M3F G;  2JEA I;  1S3O A;  2UXD L;  4LFC L;  1E24 A;  3GTJ H;  2BH2 A;  5GAG C;  2ZTE A;  1KQS A;  4BBR H;  2ATW A;  5J3B A;  2KCM A;  3BJU A;  1YJ9 A;  1W3S A;  1YBY A;  2VNU D;  1G29 1;  3EN2 A;  1VQJ A;  4IFD I;  3TQY A;  4JI8 L;  1LTL A;  1HZB A;  4JI0 Q;  1Q8K A;  1Z47 A;  1YJW A;  1HZ9 A;  1PH5 A;  2OTJ A;  4JC0 A;  4JOI A;  2E2H H;  1NBW A;  4DNI A;  1VQF A;  4FDB A;  5GAD C;  2Q2I A;  4Y7N H;  3UDG A;  4OON A;  1Q81 C;  4IFD G;  1JE5 A;  1C0A A;  3CMA A;  1XMQ Q;  1EYG A;  2A19 A;  1IBK L;  5IY0 A;  1N33 L;  3HOX G;  1IYJ B;  1Q7Y C;  1MJC A;  3CCQ A;  1R9T H;  4R4C A;  3LGJ A;  4LF6 L;  4JI2 L;  2V1C C;  3F2C A;  3B6Y A;  5M5Y H;  3T1H L;  3RNU A;  4GN5 A;  1IL2 A;  1QZH A;  2GVB A;  3PUZ A;  2ZM6 L;  1Y14 B;  2HHH Q;  1M1K C;  2ID0 A;  4JI7 Q;  2PNH A;  4OO1 I;  1PH9 A;  1WI5 A;  2NVQ H;  4DR6 L;  2UUB L;  1X3G A;  1TWA H;  2HIV A;  1MIU A;  2E2J H;  3W1B A;  3J7Z C;  2R92 G;  4DV3 Q;  1L0W A;  3M4O H;  2I5H A;  3PSI A;  2YV5 A;  1NTG A;  1NY4 A;  2VQF Q;  1L1O A;  4LFA L;  2NVX H;  3I55 A;  1GVP A;  1CSP A;  4A4I A;  4LF9 Q;  1HNZ L;  2IX0 A;  1BVS A;  2ES2 A;  1SRU A;  4GNX A;  2A8V A;  4K0K L;  5HGQ A;  3I4N H;  1KXL A;  2EXD A;  4XIG S;  2JE6 I;  4QL5 A;  1SR3 A;  4GS3 A;  4NB3 A;  5IYC H;  4A3C G;  1Y1V H;  2Q2U A;  4DUZ L;  4DUZ Q;  3CC4 A;  1K8A C;  3A74 A;  3KJP A;  4IJH A;  4DV6 L;  2IY5 B;  4BXX H;  2H5X A;  4C2M H;  3GTG H;  4KLK A;  3HOW H;  1X65 A;  4WJ4 A;  1LYL A;  3OYY A;  1KRS A;  5BR8 L;  1BBW A;  4GLA C;  1HNZ Q;  2YU9 H;  1I5F A;  2JEB I;  4P74 A;  3I4M G;  2Y0S E;  4LFA Q;  1WCM G;  3PIO A;  3M4Q A;  3STB D;  4MNO A;  1N32 Q;  2YTY A;  2CQO A;  3VDY A;  1JJC B;  1SRO A;  1PA6 A;  3L2P A;  3CCV A;  1AH9 A;  4DV0 Q;  4A75 A;  1PYS B;  4R1J A;  1HJP A;  5ELN A;  1S72 A;  4RG1 A;  1A8V A;  1E22 A;  3BU2 A;  3U4Z A;  3ZJY C;  2I5M X;  3KFU A;  4A3J H;  3F1Z A;  4APV A;  1VQA A;  2CWP A;  2PQA B;  2IHE A;  1MJE A;  2JJQ A;  2JQO A;  4JI6 L;  2AWO A;  3ER0 A;  4BY1 H;  1D8L A;  1N34 L;  3TS2 A;  2MFI A;  3J80 i;  4IFD J;  4YHH Q;  1KD1 C;  1L1O B;  4A3F H;  1WYD A;  4JBW A;  1WCM H;  3G4S A;  2K52 A;  4DV1 Q;  3ULP A;  3I4M H;  1DGS A;  4B3R L;  2IX1 A;  3AFQ A;  4LF6 Q;  4HIM A;  4EX5 A;  2Z0S A;  5M5W H;  1YHQ A;  5JEA J;  1IZ6 A;  1N34 Q;  3TEH B;  1QVC A;  2OQ0 A;  4JBK A;  3IRB A;  1PH4 A;  1E7Z A;  1QUQ A;  1P16 A;  1UE1 A;  4DV4 Q;  2R93 H;  5HY6 A;  1UE5 A;  3PO2 H;  4A3K G;  2IHF A;  4J15 A;  1FGU A;  3HFZ B;  3UE0 A;  1XNR Q;  4GNX C;  4LW1 A;  1PH1 A;  2I0Q A;  4OO1 G;  1Q12 A;  1UE6 A;  5IYC G;  1HR0 Q;  3GTQ H;  3EBE A;  3OTO Q;  1PHJ A;  4LUV A;  3STB C;  4TQU S;  4LF8 Q;  1SMX A;  1XNR L;  4QJF A;  4HID A;  1EIY B;  2L15 A;  1VQ8 A;  1WOC A;  1K8G A;  3L7Z C;  5BR8 Q;  3HOZ H;  1LM0 A;  1Q46 A;  4BY7 G;  2RF4 A;  3PV0 A;  4PZ7 A;  3PGZ A;  2K75 A;  4O2D A;  2PMZ E;  1JT8 A;  1C7Y A;  3CXC A;  1EQR A;  4YCV A;  3T1Y L;  3FHW A;  4GLV B;  1PVO A;  1JMC A;  2R6G A;  3CW2 C;  1GM5 A;  2CCZ A;  3KOJ A;  3PCO B;  4DK6 C;  3I2Z A;  1TXY A;  3CCS A;  1PH3 A;  3I56 A;  3S1M H;  4K0K Q;  3CPW A;  5H1S E;  4JG2 A;  1Y1W H;  3CPF A;  2UUA Q;  3H0G G;  5FLX c;  1RL2 A;  4LF9 L;  4B3T L;  4GKJ Q;  4DV0 L;  5C0X I;  4DK3 C;  1YHA A;  2JA8 G;  3G6E A;  4ME3 A;  1VQM A;  3RZD H;  4JI4 L;  4B3M Q;  3RZO H;  4GOP A;  2WFW A;  2UU9 Q;  2UUA L;  5C0X G;  3H3V H;  3S2H H;  1D7Q A;  5EAY A;  2UUB Q;  4DV4 L;  4HJ9 A;  2HT1 A;  2ZJP A;  3H0G H;  3OW2 A;  4JI5 Q;  1HNW L;  5LMN Q;  4KHZ A;  3CCR A;  1RIP A;  3FP9 A;  1EFW A;  4C3J H;  1XMO L;  2R7D A;  3M4P A;  1Y1W G;  3J80 c;  3J81 j;  2ZM6 Q;  5M3F H;  1VQ5 A;  2HHH L;  2VY3 A;  4IOA A;  4X65 Q;  4GOP B;  1K83 H;  4NXN Q;  2K50 A;  4P72 A;  1Q1E A;  4NXN L;  4JI2 Q;  4A3G H;  4LFB Q;  4X62 L;  1V1Q A;  2BH8 A;  1PH2 A;  3CME A;  5K36 G;  3PUX A;  3NBH B;  4A3J G;  1Z9F A;  5LMN L;  4PMW A;  1XMQ L;  4LNQ A;  4UY8 C;  1K9M C;  1EUJ A;  5IP9 G;  2VUM G;  2MO1 A;  2Z6K C;  2VQF L;  2QGQ A;  1V43 A;  1GD7 A;  5GAE C;  2ASB A;  1Q86 C;  2K4K A;  1XJV A;  2NN6 G;  3S24 A;  3JAM c;  1K73 C;  3FKI H;  1CKN B;  4JI8 Q;  2JA7 H;  4DR7 L;  2I5L X;  1K0R A;  3PO3 G;  3M3Y H;  1CKN A;  4A3D G;  4AQY Q;  4NXM Q;  1L1O C;  1PV4 A;  4A3M G;  4DR4 Q;  3HKZ E;  2NVY H;  1GKH A;  2YTV A;  2R93 G;  4BXX G;  4DAY B;  3KDF A;  3RLO A;  3ULL A;  2F52 A;  4KI0 A;  2JA5 G;  1VQC A;  2BA0 A;  3I7F A;  4X64 Q;  3S1R H;  5JJL A;  2LSS A;  2MNA A;  3H3V I;  4DV1 L;  5GRO A;  5M5X H;  4DPG A;  1O7I A;  4GN4 B;  4UP7 A;  3T1Y Q;  4JI6 Q;  1U0L A;  1VQE A;  4JI5 L;  3S15 H;  2YTX A;  1YEZ A;  2JA9 A;  5IWA Q;  2PI2 A;  5C3E G;  4JBM A;  2VW9 A;  2WP8 J;  1WJJ A;  3NEM A;  1ASY A;  2AMC B;  4B3M L;  4DR3 Q;  5ELO A;  4JI4 Q;  1OXX K;  2FXQ A;  4O0A A;  1VQK A;  2N78 A;  5FLM H;  3J81 c;  1N32 L;  4R4Q A;  2E8G A;  3OTO L;  3MEF A;  1HR0 L;  4A3G G;  4YCU A;  5GAH C;  4GKJ L;  1VQP A;  4B3T Q;  2AHO B;  1YIT A;  2Q2T A;  3HOV H;  4JOI C;  1SFO H;  3CQZ H;  1VQ4 A;  1AE2 A;  2K5V A;  2F3I A;  2XGT A;  3Q8D A;  4OXP A;  5C4J H;  1YNX A;  2ZJR A;  4QQB X;  2UXC L;  1ASZ A;  2A1A A;  2HIX A;  4AH6 A;  4YCW A;  4HJ7 A;  1OTC A;  4JI7 L;  3GTP H;  5C0X J;  4DV2 Q;  2F4V Q;  5M3M G;  3A0J A;  2VS1 A;  4A3I G;  3HOW G;  4L5R C;  3S1Q H;  5C4X G;  2C35 B;  5LMU Q;  1J5E L;  5JEA G;  2N3S A;  1NE3 A;  1XTD A;  4IPH A;  2KHI A;  4GKK L;  2KHJ A;  1G51 A;  4HJ8 A;  1HR0 W;  4BBS H;  4L5S A;  2D0O A;  4HJA A;  3S14 H;  3CCL A;  4JYA Q;  2MQH A;  3AQQ A;  2ALY B;  4AQY L;  4NXM L;  1TWG H;  4DR7 Q;  5C4X H;  4HIO A;  2IT1 A;  4LF8 L;  2LXJ A;  1EOV A;  4MZ9 A;  4LUO A;  1XNQ L;  1QVG A;  1CKM A;  3L0O A;  4OWX B;  5M3M H;  4A3I H;  4JV5 Q;  1PH7 A;  4QIW E;  4R4T A;  1NMG A;  3PUY A;  5DLQ E;  5IP7 H;  1N36 L;  2OTL A;  1OXU A;  1KRT A;  4RMF A;  4LF7 Q;  4QY7 A;  1VQO A;  2RHQ B;  3JC6 6;  2N8N A;  1YZ6 A;  2VL6 A;  3D0F A;  3NEL A;  3TRZ A;  1A0I A;  1PYB A;  1CUK A;  1T9H A;  3AFP A;  3CP0 A;  1QUQ B;  4UPA A;  4DV7 L;  4XTC S;  4GNX B;  1IXR A;  3AEV A;  1CSQ A;  5FLM G;  3HOU H;  1VQN A;  2WB1 G;  4JBJ A;  1HZC A;  1PH6 A;  1YJN A;  3K8A A;  5E7N A;  5IP7 G;  2E2I H;  3KF8 B;  1N8R C;  3U50 C;  4YHH L;  1EQQ A;  2PQA A;  4P73 A;  4YY3 L;  1IBM L;  1XMO Q;  1HNX L;  4A76 A;  1W2B A;  2KEN A;  1N33 Q;  1HZA A;  1IBK Q;  4YWL A;  1UWV A;  4X66 L;  4JI3 Q;  1HNW Q;  3KLW A;  1X9N A;  4LF4 Q;  1VQ7 A;  1OXT A;  4P71 A;  2UU9 L;  1PFS A;  1B70 B;  2NVT H;  4JCV E;  3UDI A;  1I3Q H;  2K5H A;  1K3R A;  3GTM H;  2JA5 H;  1U5K A;  2ZTD A;  1IBL L;  3F8T A;  1IBL Q;  4A3L G;  4IPG A;  1YHB A;  4WJ3 M;  3UDX A;  2PI2 E;  4B3S L;  5IYD G;  2UUC L;  3HOY H;  3A5U A;  1H95 A;  3PF5 A;  4YWK A;  1C9O A;  4MTN A;  2UXD Q;  1I6H H;  3GO5 A;  1B7Y B;  2MO0 A;  4OWT B;  4X66 Q;  4LF4 L;  4DV6 Q;  3HKS A;  2BA1 A;  1VQD A;  4DR1 L;  4PZ6 A;  4DR2 Q;  2R92 H;  3H15 A;  4LWC A;  1HNX Q;  3HOV G;  4POF A;  1GO3 E;  1LUZ A;  4JI1 L;  2K5N A;  2WB1 E;  3TRE A;  5FJ8 H;  3KF6 B;  5C44 G;  1KC8 C;  3BZK A;  2NN6 I;  2RHS B;  3NEN A;  2Y0S G;  4L5Q A;  4IOC A;  1VCI A;  3K7U C;  4DV7 Q;  2UXC Q;  4POG A;  3AYH B;  2E5L Q;  1X3F A;  3J7A 5;  2JA6 H;  5C44 H;  1YVC A;  4BY7 H;  1I94 L;  4LF7 L;  1V9P A;  2B29 A;  4AYB E;  4JI0 L;  3K81 C;  1XPU A;  4JV5 L;  2CWA A;  4P75 A;  5AJ3 L;  1EWI A;  1TWH H;  1HH2 P;  1TWF H;  3RLN A; 
#chains in the Genus database with same CATH topology
 1YI2 A;  3V2T A;  1ENA A;  2ZXO A;  4K5W A;  2B39 A;  3A8I E;  2A68 D;  3K7A H;  4FF2 A;  3QOJ A;  3T1H Q;  2ICE C;  2JA8 H;  4DR5 Q;  2EY2 A;  1NNX A;  3PUV A;  2FIN B;  2EY5 A;  3D6C A;  3KF6 A;  1SE2 A;  2B3G A;  1F2L A;  2CKZ B;  1KDB A;  1F9Q A;  4H02 A;  3S2D H;  4K8J A;  1PH8 A;  1P8L A;  2D5D A;  3X3M A;  1EYC A;  1ILP A;  3NE5 B;  1VQB A;  3F2D A;  2DGY A;  2Z1C A;  3PMF A;  2IW3 A;  2EOT A;  2BE5 C;  2VZA A;  3ERO A;  2ZJQ A;  4DR3 L;  1JB3 A;  3CRL C;  2FFK B;  5JJZ A;  4ZAI A;  2HCC A;  4XDX A;  5ELD A;  2QA4 A;  4ME5 A;  4BBS G;  1BKB A;  5JJK A;  1ZKO A;  5IYB H;  4DK1 A;  3CF5 A;  1ESR A;  2XNA C;  4A3K H;  1ZEQ X;  1LTG D;  4IZ8 A;  4N9P A;  3NP8 A;  1B3Q A;  4IFD H;  1YNJ D;  2HQL A;  4A3D H;  1FR3 A;  2UUC Q;  1TR5 A;  1JC7 A;  3CAM A;  4CJ0 B;  4DV3 L;  3IKJ A;  3E0E A;  1TWF B;  4GOP C;  4E6I A;  2KBN A;  4DR6 Q;  2E2H B;  2QW7 A;  3VR4 A;  2NB0 A;  2PW7 A;  1HQM C;  3KLR A;  1W6K A;  4A3I B;  4R4I A;  4HCS A;  3HOZ G;  4X6A H;  1MHW C;  3I3C A;  2A68 C;  1I4Q A;  3GTQ B;  3R2I A;  4R4O A;  1XPR A;  2FMM A;  1E2W A;  2DNE A;  3E9I A;  4CHT B;  2VUM B;  4R8I A;  1EYD A;  3BZD B;  3MXN B;  1PFN A;  3S14 B;  3VA5 A;  1YNN C;  2Z8L A;  3I4N G;  1WTO A;  2F0K A;  1EIF A;  1S5C D;  4KJO A;  4ABN A;  1X3Q A;  4K5V A;  4CKE A;  1CKO A;  3NTK A;  4KV6 A;  2RCN A;  3HKZ G;  5TSS A;  3VA7 A;  1GOZ A;  4OIK A;  4OWW B;  2Z6K A;  3K6O A;  1BCP F;  4JI3 L;  3EVQ A;  5IT9 E;  3FMC A;  4G7O C;  1QE6 A;  1FJG Q;  2XSC A;  1SLJ A;  3M7N A;  1SYB A;  4A3E H;  1IBM Q;  4DAY A;  1E3P A;  2M2L A;  3UE1 A;  5IE8 A;  1CK1 A;  1I6H B;  1S3O A;  4ZLT F;  2A6E C;  5KYL A;  1U4P A;  3GTJ H;  1J8I A;  4BBR H;  1HA6 A;  5J3B A;  1BCP C;  1YBY A;  1G29 1;  3TQY A;  4JI8 L;  3I72 A;  1I3Q B;  2FMC A;  1Q8K A;  1HZ9 A;  1PH5 A;  2OTJ A;  2E2H H;  4DNI A;  4FDB A;  2JYO A;  5GAD C;  2A19 A;  1IYJ B;  3S1M B;  5I9P A;  1SE3 A;  2V1C C;  2EJG C;  3B6Y A;  3F2C A;  3PUZ A;  4M8A A;  4OO1 I;  1TWC B;  2NVQ H;  4DR6 L;  2EYF A;  2K5W A;  1JWU D;  2HIV A;  3BDL A;  3Q24 A;  3J7Z C;  2R92 G;  4X3K A;  1EZ6 A;  1U4R A;  3CQZ B;  5IIF A;  3M4O H;  3P7J A;  3PSI A;  2K04 A;  4C3H B;  3M3Y B;  1PXU A;  4LF9 Q;  1HNZ L;  4IUP A;  2IX0 A;  2B2V A;  1BVS A;  4K0K L;  3C3L A;  3I4N H;  2EXD A;  4XIG S;  2JE6 I;  4A3E B;  1Y1V H;  1LO5 D;  5JPM C;  3OPO A;  4L6T B;  1EIG A;  2EZV A;  4IJH A;  1SAP A;  1W6J A;  1Y8P B;  4RCN A;  4KLK A;  4OIJ A;  4L63 B;  2KVM A;  2PZT A;  3VR5 A;  1KRS A;  1HNZ Q;  1BBW A;  1RF2 D;  4ZKC B;  2QDL A;  2SNM A;  4RWS C;  2F1M A;  2JEB I;  3K5M A;  4QCL A;  1SEB D;  1WCM G;  3PIO A;  1N32 Q;  3STB D;  4MNO A;  2B8F A;  2YTY A;  2CQO A;  5KYI A;  3VDY A;  1SRO A;  1PA6 A;  3CCV A;  3BDO A;  5CMD A;  4R1J A;  1S72 A;  2D9U A;  4RG1 A;  1D1K A;  3BU2 A;  3ZJY C;  4A3J H;  1RDP D;  1RCV D;  1VQA A;  4ZUI A;  4APV A;  2JJQ A;  2CH4 W;  1N34 L;  3J80 i;  3OWF A;  4YHH Q;  4BWG B;  2EY6 A;  4HIM A;  4EX5 A;  2Z0S A;  3URY A;  3RMH A;  1N34 Q;  4IUT A;  1QVC A;  2OQ0 A;  3D8G A;  3IRB A;  1QUQ A;  1EY0 A;  1UE1 A;  2F0P A;  2F0O A;  4DV4 Q;  2JA8 B;  3U9O A;  1TU2 B;  2IHF A;  1F9R A;  4GNX C;  4LW1 A;  1B2T A;  1U4M A;  4RGT A;  5IYC G;  1JQY D;  1AN8 A;  1PHJ A;  1EIY B;  2E2I B;  4ZQ3 A;  1QG7 A;  2HUG A;  5BR8 Q;  3HOZ H;  1GHJ A;  2RSN A;  1SND A;  2DN8 A;  1YNN D;  3PV0 A;  2K75 A;  1JT8 A;  4YCV A;  4B08 A;  3TME A;  2CCZ A;  1IHZ A;  4F8M A;  3PCO B;  1TXY A;  3S1M H;  3UI2 A;  3ZYY X;  3CPW A;  4JG2 A;  3CPF A;  1EY7 A;  1RL2 A;  4LF9 L;  5IGB A;  4DV0 L;  3NQI A;  4NW2 A;  4B3M Q;  3RZO H;  3A7L A;  2Q8I B;  2WFW A;  4OGQ C;  3KF8 A;  3S2H H;  4TRD A;  2UUB Q;  2HT1 A;  1HNW L;  5LMN Q;  1EFW A;  3FP9 A;  1XMO L;  4FNF A;  1Y1W G;  5M3F H;  2HHH L;  3HOW B;  5FOB B;  2K50 A;  1Q1E A;  4NXN L;  5FLX L;  4U68 A;  1V1Q A;  2EE1 A;  1PH2 A;  3CME A;  2F0H A;  3NBH B;  2OT2 A;  2QKI C;  1K9M C;  1KDA A;  4CJ2 C;  5M5Y B;  5C3E B;  4HMJ A;  2XWB B;  4BBR B;  1XJV A;  2NN6 G;  3JAM c;  3FKI H;  1STY A;  4JI8 Q;  2JA7 H;  4CJ1 B;  2I5L X;  5EPK A;  3PO3 G;  2JN4 A;  2PO4 A;  4A3F B;  1O7Z A;  5DM6 3;  2YTV A;  1HA5 A;  2K1B A;  3Q6S A;  4BXX G;  2F52 A;  4B9W A;  4KD4 A;  2JA5 G;  1VQC A;  2BA0 A;  3EFX D;  3H3V I;  1F9S A;  5M5X H;  2F0T A;  3J80 L;  4GN4 B;  5KND A;  4EQN A;  4JI6 Q;  4B9X A;  1VQE A;  4DK0 A;  1PZI D;  2Z9H A;  1I50 B;  4C56 C;  1DOL A;  2PI2 A;  5IWA Q;  3NEM A;  1ASY A;  2AMC B;  1PDQ A;  5I6W A;  2K32 A;  4O0A A;  1VQK A;  3RD4 A;  5G3L F;  1N32 L;  2E8G A;  3SK8 A;  3MEF A;  4HMI A;  3OTO L;  2EJM A;  2H1E A;  4GKJ L;  3HOV H;  1FNW A;  4JOI C;  1IYV A;  5E4W C;  3CQZ H;  4FXK C;  2K5V A;  1AEX A;  1OO9 B;  4OL7 A;  2ZJR A;  1YNX A;  2HIX A;  3WOE A;  4AH6 A;  1EWC A;  1OTC A;  5IGF A;  5C0X J;  4A3I G;  2VS1 A;  4L5R C;  3S1Q H;  5LMU Q;  1QNK A;  1J5E L;  5JEA G;  3TDQ A;  1XTD A;  5CV8 A;  5FLX E;  2M9V A;  4L5S A;  5C0X H;  3NBH A;  2N88 A;  4PV1 C;  2MQH A;  3AQQ A;  4AQY L;  1TWG H;  3R93 A;  2L12 A;  3I4M B;  5C4X H;  4HIO A;  2IT1 A;  4C3I B;  2WAC A;  2ZT9 C;  3FKI B;  3E6Z X;  4A3I H;  2JA7 B;  2E2D C;  4JW0 A;  4QIW E;  4R4T A;  1NMG A;  3VYS A;  4LF7 Q;  1EEI D;  2B2U A;  1WTQ A;  3DMU A;  2EYH A;  3N6R A;  4QY7 A;  1MBY A;  3NEL A;  1YZ6 A;  3D0F A;  3TRZ A;  4A3G B;  4UPA A;  4XYQ A;  1QUQ B;  3GV6 A;  1QOH A;  3QJY A;  4A93 B;  3NQT A;  2PNR C;  4CDD C;  2LY7 A;  1NR2 A;  3K8A A;  1YJN A;  3J7A V;  1K28 A;  4YHH L;  1E2V A;  1IBM L;  4P73 A;  5C4H A;  1XMO Q;  1N33 Q;  3K0Y A;  1CT1 D;  1UWV A;  3KLW A;  1VMC A;  1D5M C;  2EXZ A;  1OXT A;  1A3U A;  1PFS A;  1B70 B;  2WV6 D;  1BDO A;  4A3K B;  4WFN 3;  1TS4 A;  1L0Y B;  3G6J B;  2MHV A;  4B3S L;  5IYD G;  2F0S A;  3AMU A;  2C9O A;  1I6H H;  3O13 A;  4PQX A;  3GO5 A;  1SE4 A;  5COY A;  4DR1 L;  5CBE E;  3H15 A;  1XYI A;  4FYD A;  4POF A;  1HQR D;  2K5N A;  3KF6 B;  2NN6 I;  2RHS B;  1LT3 D;  2B2Y A;  4L5Q A;  3GTM B;  3WDN A;  4ZK9 B;  5C44 H;  3D4W A;  1YVC A;  4JVZ A;  1I94 L;  2NUC A;  1V9P A;  3HRZ C;  4JI0 L;  4H44 C;  5AJ3 L;  1TWH H;  1I4H A;  2KJX A;  3R3O A;  3T13 A;  2L11 A;  1IW7 C;  5T1I A;  2OQK A;  1G6P A;  4A3L H;  1UAP A;  4B3R Q;  1MKH A;  3GTO H;  2KEE A;  3EJI A;  4FVM A;  5EBD A;  3PIO 3;  3L9A X;  4DUY Q;  4DKA C;  4LFB L;  4KHP Q;  1PTO H;  1WFQ A;  3DM3 A;  4U67 3;  4K6D A;  3JAM L;  1RD9 D;  2A6H D;  3SE0 A;  3VYR A;  4A93 G;  3OOC A;  3KK7 A;  1XX8 A;  1RJT A;  1BF4 A;  1AZP A;  4IO9 A;  5K36 H;  5D14 A;  3HOU G;  4DAV A;  2KCT A;  1O78 A;  4C1N I;  3MXP A;  3ERS X;  2K6A A;  3TP7 A;  2GVA A;  1I4G A;  4PZ8 A;  2OEO A;  4HCE A;  3JAM i;  1VQL A;  4DF7 A;  2OCE A;  3VR2 A;  5DNF A;  3RUZ A;  4DUY L;  2K5Q A;  5C4Z A;  1BBX C;  3IFT A;  1C48 A;  2PQE A;  5CGK A;  3HG9 A;  2L9H A;  5IT9 L;  5C6A A;  5IYB G;  3G71 A;  2N49 A;  2R7Z H;  3BZC A;  2VQE L;  3CHB D;  1VQ9 A;  3K5O A;  4DR4 L;  3KJO A;  2KOL A;  3IAY A;  2B2V C;  1X56 A;  4BA2 I;  4FP5 D;  1B44 D;  2CFM A;  5M3F B;  3PIP 3;  2ENB A;  2XTI A;  4YWM A;  3SR1 A;  3I4N B;  3CC7 A;  2B2W C;  3FRP B;  4JYA L;  3BYY B;  1EFI D;  1L2F A;  2GN5 A;  4IQZ A;  3SGI A;  4CDF C;  4OEL B;  5FJ8 G;  4TVA B;  1BCP B;  1S5B D;  4C3H H;  4X62 Q;  4LF5 Q;  4JI1 Q;  1PLF A;  1TS5 A;  1TS2 A;  4X65 L;  5LMU L;  5HGT A;  2WAQ E;  4KKT A;  2RVL A;  4DV2 L;  3ICE A;  3EIV A;  4FO2 A;  5IYD H;  1SYC A;  5A35 A;  2A73 B;  2Z4H A;  3NHH A;  4B3S Q;  3SK5 A;  5AJ3 Q;  1Y1V G;  1KLG D;  2K33 A;  1JOQ A;  2LXK A;  4HSP A;  1NJI C;  4OX9 L;  4A3F G;  4KY7 A;  4R9W A;  4WOR A;  4BBR G;  2JA6 G;  4GKK Q;  1WTP A;  1EL0 A;  3K80 C;  4WJW A;  3DWA A;  2KQ3 A;  3SHL A;  4A93 H;  1KL9 A;  1A3T A;  4F87 A;  5IP9 H;  1VQ6 A;  3HEJ A;  3MFY A;  2DUD A;  3CCM A;  1PFB A;  3CCE A;  2JEA I;  3M85 A;  3RZO B;  2UXD L;  1PTO F;  4MTK A;  5CV4 A;  1YJ9 A;  2VNU D;  1JOO A;  3EN2 A;  1VQJ A;  1LTL A;  3DEO A;  4IAL A;  4FF1 A;  1PMR A;  4JI0 Q;  5C5L A;  3UDG A;  1JE5 A;  4YIJ A;  1MD2 D;  2K03 A;  1PTO C;  1N33 L;  1MJC A;  3LGJ A;  1PZK D;  3LX0 A;  4JI2 L;  3RNU A;  4GN5 A;  1QZH A;  2HHH Q;  3NWT A;  1STB A;  1Y14 B;  1O7Y A;  1K3B C;  3CU7 A;  2PNH A;  1LTA D;  1PH9 A;  1BO0 A;  5EPJ A;  3S1N B;  1ML0 D;  3OWE B;  2E76 C;  4HSV A;  1ZXT A;  1SYE A;  1L0W A;  4IUU A;  3I8Z A;  2I5H A;  4RA8 A;  1WTH A;  1NTG A;  1NY4 A;  5I6Y A;  1L1O A;  5CYU A;  2SOB A;  2NVX H;  4H13 C;  3I55 A;  1GVP A;  1CSP A;  4RGO S;  1JWS D;  4GNX A;  1RTN A;  2A8V A;  1KXL A;  4PMC A;  1G91 A;  1SR3 A;  5EGT A;  4GS3 A;  4NB3 A;  4IUV A;  2Q2U A;  1R4P B;  2MUY A;  4MIU A;  1K8A C;  1LTT D;  2IY5 B;  3VR6 A;  2CW0 D;  4FF3 A;  3AB9 A;  4DAP A;  3HOW H;  4WJ4 A;  1A15 A;  3OYY A;  1Y1W B;  1S4Z A;  1I5F A;  3I4M G;  4LFA Q;  2K01 A;  1DZ1 A;  2PW5 A;  1BCP D;  4DV0 Q;  3RZD B;  1HJP A;  5ELN A;  1HUM A;  4I7Z C;  1IL8 A;  1XXG A;  2MP1 A;  4UAI A;  2F0U A;  3SVM A;  5C44 B;  2R3Z A;  2JQO A;  2RQX A;  4P2C B;  4RFB A;  3G4S A;  4I65 A;  4B3R L;  1DGS A;  4LF6 Q;  2L55 A;  2XN9 C;  1I6V C;  1VMP A;  4DN4 M;  2KCC A;  1TT2 A;  1P16 A;  5HY6 A;  1UE5 A;  5BN4 A;  3GV3 A;  4A3K G;  1FGU A;  3HFZ B;  1B9N A;  4HR7 B;  1XNR Q;  4ZYS A;  2F3V A;  1HR0 Q;  1HXY D;  1KDC A;  4LUV A;  3MXU A;  1J9O A;  4TQU S;  1SMX A;  1TY2 A;  2L15 A;  1VQ8 A;  1WTW A;  1WOC A;  1WTR A;  2K05 A;  1Q46 A;  2RF4 A;  5KEE A;  3PGZ A;  3MA2 B;  3PQI A;  1FNU A;  1JMC A;  1UEA B;  2R6G A;  2R93 B;  4DK6 C;  3I2Z A;  2B2U C;  3M4Y A;  1A2T A;  4AYB B;  3I56 A;  3H6M A;  4RHR A;  3NK9 A;  1VDZ A;  3J7Y W;  3S1Q B;  1JR0 D;  4Q5V A;  2NVT B;  1YHA A;  1DYQ A;  3MTS A;  2F0F A;  4EQO A;  1SSO A;  2JA8 G;  1VQM A;  4JI4 L;  3NPP A;  2UU9 Q;  2UUA L;  5C0X G;  3Q0A A;  1D7Q A;  4HJ9 A;  3OW2 A;  3H0G H;  2NZ1 D;  2GA4 B;  3HGB A;  4BS9 A;  4IOA A;  4GOP B;  1K83 H;  2NVY B;  1SNO A;  4NXN Q;  4P72 A;  3R8B A;  4A3G H;  4JI2 Q;  4X62 L;  2BH8 A;  2WKC A;  3BG3 A;  4OEM B;  3I73 A;  5IGD A;  5LMN L;  4LNQ A;  4J8Q A;  1FD7 D;  3GTG B;  5CR3 A;  4XXE A;  1EUJ A;  3QB3 A;  2VUM G;  2MO1 A;  2Z6K C;  2BE5 D;  5E1F A;  1V43 A;  2K4K A;  4F88 A;  2Z6B A;  4NP5 A;  1CKN A;  1LT4 D;  4A3M G;  3HKZ E;  1GKH A;  2BOS A;  2R93 G;  3NXW A;  3ULL A;  3RLO A;  5JJL A;  2JSO A;  3I7F A;  3S1R H;  1EZ8 A;  2MNA A;  2B2W A;  4DV1 L;  5GRO A;  3MEH A;  2PMZ B;  1HRJ A;  3T1Y Q;  3J81 E;  1U0L A;  2P5Z X;  4JI5 L;  1LAB A;  1D2B A;  4I7A A;  5C3E G;  4JBM A;  2VW9 A;  1M4V A;  4LAA A;  3VYT A;  5C5M A;  3QG1 A;  1KAB A;  1UUP A;  2FXQ A;  2PZU A;  2L5T A;  5FLM H;  3BVG A;  4R4Q A;  5GAH C;  2AHO B;  1YIT A;  1VQ4 A;  1AE2 A;  2XGT A;  3Q8D A;  5M5X B;  4OXP A;  5C4J H;  1BQQ T;  2J0T D;  4HJ7 A;  3TS2 A;  3DUZ A;  4DV2 Q;  2JP1 A;  3VR3 A;  3A0J A;  5JVG 3;  5I2Y A;  2KHI A;  2KHJ A;  3K7A B;  1RTO A;  2D0O A;  1NUC A;  4JYA Q;  3HOV B;  4K2K A;  4MZ9 A;  4LUO A;  1PTO B;  2O2L D;  4OWX B;  4JV5 Q;  4EGV A;  1SNC A;  1OXU A;  1KRT A;  4RMF A;  1NCV A;  3J81 L;  1ILQ A;  1VQO A;  1MGS A;  2VXW A;  3P1H A;  3CKI B;  1PYB A;  1CUK A;  4GNX B;  1IXR A;  1VQN A;  1NSN S;  3DWP A;  5E7N A;  1N8R C;  3U50 C;  3ONA B;  1TWG B;  4A76 A;  2PCF B;  4YWL A;  1HNW Q;  1X9N A;  4LF4 Q;  1AP0 A;  2MJ8 A;  1KNE A;  3DHQ A;  2O5J C;  2X69 A;  2F0J A;  3DM1 A;  1U5K A;  2R7Z B;  1IBL Q;  2B2T A;  4WJ3 M;  3UDX A;  1ET6 A;  2PI2 E;  5CC4 A;  1BOS A;  2WIN B;  5IOC A;  2UXD Q;  2EY1 A;  3OIQ A;  1H9M A;  4HN7 A;  2MO0 A;  4LF4 L;  4QIW B;  4X66 Q;  4DV6 Q;  1JWM D;  3HKS A;  5KRU A;  2BA1 A;  2R92 H;  4DR2 Q;  1HHV A;  4S3S A;  1GO3 E;  1QNU A;  4J6H A;  3GTK B;  3MFG A;  3OHX C;  1VCI A;  3SEB A;  1Z7T A;  4POG A;  3J7A 5;  2JA6 H;  1SYF A;  2RA4 A;  5C4X B;  4G7Z C;  1TKW B;  3K81 C;  2LFN A;  2CWA A;  3QOL A;  4WRD A;  1A6X A;  3DWQ A;  1C0A A;  3RN5 A;  1I4P A;  1AW7 A;  1S40 A;  1STG A;  2EQS A;  4A3B H;  1B4O A;  4IPD A;  2XIW A;  2OWO A;  2UXB L;  2QEJ C;  1GUG A;  1O7L A;  3PIP A;  5DAU A;  2O5I C;  1JJ2 A;  2RSO A;  1HTP A;  1J5E Q;  2NZO A;  3RN2 A;  2I07 B;  4G4K A;  2DY7 A;  1KNA A;  2Q2H A;  1H9J A;  4UP9 A;  1LTI D;  1Y8N B;  1E0B A;  2EIF A;  3NWS A;  2F0M A;  4A3E G;  1VQI A;  2RCF A;  2EYJ A;  4OX9 Q;  2J7Z A;  2OXP A;  4G57 A;  4LUZ A;  2D62 A;  5C3E H;  1A63 A;  4JPB W;  3U9S A;  1SJE D;  5GQO A;  4XQQ A;  3U58 A;  3P20 A;  3M9B A;  1U4L A;  1L0X B;  1GJX A;  1X3E A;  2F03 A;  5JVH 3;  2EYM A;  4Y52 H;  3PO2 G;  4LF5 L;  3J80 E;  3S1R B;  3P75 A;  3ULJ A;  2UXB Q;  4X64 L;  1FL0 A;  1IKM A;  1DCZ A;  3DXJ C;  4A3M H;  4UP8 A;  3KYH C;  1GXD C;  2RKS A;  1I50 H;  3I90 A;  4HIK A;  3TS0 A;  4XT3 B;  3Q22 A;  5J22 A;  4HJ5 A;  2D0P A;  3CC2 A;  1FVI A;  1JJG A;  2JK8 A;  4MHE A;  2VQE Q;  2D2C C;  2AKW B;  3GTL H;  2CVR A;  2K14 A;  3CCJ A;  5M3M B;  4YY3 Q;  3A7A B;  1KAW A;  1X6O A;  3H94 A;  1X55 A;  4DR2 L;  1SJH D;  3QWN A;  1VS0 A;  4NPS A;  5EJW A;  1SN8 A;  1VQG A;  1Q3L A;  1BXT A;  4DV5 Q;  1E1O A;  4QB4 A;  3W5O A;  1QZG A;  2X6L A;  4K14 A;  1TWA B;  5HUR A;  1X54 A;  2HCI A;  3I4O A;  4DAM A;  4BY7 B;  4C3I H;  5JEA H;  3RR5 A;  1UE7 A;  1SE8 A;  3C46 A;  3K0X A;  2L4N A;  2F4I A;  4CKC A;  1C8C A;  5EPL A;  1AE3 A;  4L5T A;  1B8A A;  3TP5 A;  2M00 A;  3SK6 A;  3T51 B;  1M90 C;  2VUM H;  1K8O A;  1Q90 A;  4KD3 A;  1FJG L;  1VQH A;  5M3F G;  1ESF A;  4LFC L;  1E24 A;  2BH2 A;  2VB3 X;  1KQS A;  1W3S A;  5C4J B;  5AFW A;  4IFD I;  1VF5 C;  1HZB A;  3I4L A;  2L1B A;  1WD1 A;  2DJF C;  1Z47 A;  4Y7N H;  4IFD G;  3KBG A;  1DOM A;  4OON A;  3CMA A;  1XMQ Q;  1EYG A;  4DU9 A;  1IBK L;  5IY0 A;  2HDL A;  3BVM A;  1I4R A;  1V1P B;  3OMC A;  4R4C A;  4LF6 L;  1STH A;  5M5Y H;  1K0S A;  3F2U A;  2GVB A;  1EY5 A;  1M1K C;  5KNC A;  2ID0 A;  3MC0 B;  4CGY B;  1FNV A;  3S2D B;  3HOU B;  2SEB D;  2F3W A;  4G7H C;  5LL6 X;  2NTS A;  2N55 A;  3SXH A;  2KCN A;  3H09 A;  4ID6 A;  2G5D A;  1MIU A;  5D3I B;  3W1B A;  2E2J H;  4DV3 Q;  1SXT A;  1EQV A;  2YV5 A;  2A6E D;  1BR9 A;  2VB2 X;  1DON A;  1UNS A;  5I9O A;  2MGS A;  1HTL D;  4H0L C;  5HGQ A;  1V1O A;  4QL5 A;  1JIC A;  4A3C G;  3NTH A;  1GUN A;  4DUZ Q;  3CC4 A;  3A74 A;  2BDO A;  3KJP A;  2H5X A;  3GTG H;  4DXG A;  4O42 A;  2QCP X;  2HDM A;  1X65 A;  4GLA C;  2YU9 H;  2IJ0 A;  3HOX B;  4R8N A;  1JJC B;  1AH9 A;  1EOT A;  4A75 A;  1PYS B;  3NSW A;  2B2Y C;  2EDG A;  1A8V A;  1E22 A;  3U4Z A;  2I5M X;  3F1Z A;  1SMY D;  2IHE A;  1MJE A;  1LTR D;  2RDH A;  3E5S A;  2G9H D;  4JI6 L;  4ILW A;  2AWO A;  3ER0 A;  4BY1 H;  1D8L A;  2MFI A;  4RCO A;  1KD1 C;  1L1O B;  4A3F H;  2F0I A;  3OW7 A;  2K52 A;  1LT6 D;  3I4M H;  1PTO D;  3GTJ B;  3AFQ A;  2IX1 A;  5JEA J;  1IZ6 A;  4JBK A;  2ZXR A;  1SNQ A;  3K59 A;  1CQV A;  4N9T A;  5EKI A;  4IUQ A;  3PO2 H;  3I91 A;  4J15 A;  4OO1 G;  3UE0 A;  1TS3 A;  5ISR A;  1G2T A;  1Q12 A;  3VYU A;  1KTK A;  3EBE A;  1R4Q B;  3OTO Q;  1DM0 B;  1FGB D;  2F0L A;  4LF8 Q;  3PO3 B;  3OIP A;  4QJF A;  4HID A;  3KLS X;  1YNJ C;  1K8G A;  4C3H G;  3MXN A;  5CV6 A;  3AU7 A;  4BY7 G;  2F0G A;  1PZJ D;  2PMZ E;  1C7Y A;  3W2D A;  4K8I A;  3CXC A;  5ELB A;  1Z6H A;  3C1F A;  2LKV A;  3FHW A;  4GLV B;  3S2H B;  1PVO A;  1T5E A;  3CW2 C;  1EEF D;  1GM5 A;  3KOJ A;  1F9P A;  3CCS A;  5I2X A;  2J4X A;  1PH3 A;  1JOR A;  5H1S E;  5A2Q E;  1Y1W H;  5CV9 A;  3M4O B;  2UUA Q;  5FLX c;  2PYK A;  4GKJ Q;  1E2Z A;  3K58 A;  2AQ3 B;  4DK3 C;  3A56 A;  2AUK A;  3W3A A;  3BVZ A;  3RZD H;  1BUV T;  2NBF A;  3A54 A;  3TP8 A;  2ZJP A;  4HED A;  4JI5 Q;  1A2U A;  4Q0F A;  4XT1 B;  4CDC C;  3M4P A;  2A6H C;  3J80 c;  2ZM6 Q;  3FEW X;  2A5H A;  2VY3 A;  4X65 Q;  3SK4 A;  1KLU D;  1DOK A;  4QF4 A;  5KGU A;  3QIA A;  2B2T C;  4PMW A;  4UY8 C;  1V1P A;  1ROD A;  2F0E A;  3PO2 B;  4C2M B;  5IP9 G;  2VQF L;  2QGQ A;  4K5X A;  1GD7 A;  2CHB D;  5GAE C;  3L3O C;  3H0G B;  4PNY A;  1K73 C;  1CKN B;  4KK7 A;  1K0R A;  4CBV A;  3M3Y H;  4NXM Q;  1L1O C;  4DR4 Q;  2ZXP A;  1PFM A;  1D6E C;  4DAY B;  3KDF A;  4KI0 A;  1DD2 A;  4X64 Q;  4BY1 B;  1WTX A;  3FVQ A;  1YEZ A;  1B50 A;  2NTT A;  2WP8 J;  4K2L A;  1CTM A;  4DR3 Q;  2Q8T A;  1OXX K;  2KEC A;  4TSS A;  3TBI B;  4ZRZ A;  3Q23 A;  2N78 A;  5NUC A;  3D3R A;  1HR0 L;  1CZW A;  4YCU A;  4DA2 A;  2Q2T A;  4IUR A;  2KED A;  1TQO A;  2B8G A;  1SFO H;  3FDT A;  4LMQ D;  1H9R A;  2L0C A;  3HOY B;  4QQB X;  1LV9 A;  4PMB A;  4YCW A;  1F2Z A;  3FPU B;  4LFB Q;  2QDB A;  5M3M G;  3N52 A;  1NE3 A;  1CM9 A;  4IPH A;  4A3J B;  4M1U B;  2KUM A;  4FXD A;  4GKK L;  4HJ8 A;  1G51 A;  2PPB C;  4BBS H;  2RBM A;  1MSG A;  5C3W A;  4HJA A;  3S14 H;  3X3N A;  4DR7 Q;  2LXJ A;  1EOV A;  2TSS A;  1CKM A;  1JE4 A;  1QVG A;  3L0O A;  5M3M H;  2DNC A;  1PH7 A;  2OTL A;  3PUY A;  3OMG A;  3TSS A;  4KN4 C;  3IFD A;  2N8N A;  1A0I A;  1T9H A;  3CP0 A;  4K6L A;  3AEV A;  4DV7 L;  2XRS D;  5FLM G;  5J39 A;  3HOU H;  2KA7 A;  1PH6 A;  1HZC A;  2K28 A;  4RKL A;  2E2I H;  3KF8 B;  2PQA A;  3V96 A;  4YY3 L;  2E2J B;  1W2B A;  4X66 L;  2XWJ B;  2NVT H;  1HPC A;  1I3Q H;  3HS0 C;  2K5H A;  1K3R A;  1GUW A;  3SDZ A;  1IBL L;  3M7G A;  4A3L G;  3F8T A;  1ENC A;  1G2S A;  4KJN A;  4IN3 A;  1GUO A;  1EWH A;  1SFO B;  5CBA E;  3S9W A;  3A5U A;  1H95 A;  3PF5 A;  1C9O A;  4IUN A;  2AQ2 B;  2E74 C;  2FHT A;  1B7Y B;  3A8J E;  1TWH B;  2WII B;  4PZ6 A;  4ZKB B;  4LWC A;  3HOV G;  2BDN A;  4JI1 L;  3TRE A;  5FJ8 H;  5C44 G;  1F2M A;  3BZK A;  3NEN A;  2Y0S B;  5FK9 C;  2Y0S G;  3K7U C;  2UXC Q;  3AYH B;  3GTO B;  1WCM B;  4BY7 H;  1AFP A;  3T56 B;  1SYD A;  3KBX A;  3QR8 A;  1XPU A;  1DJR D;  3HP3 A;  4XYO A;  3MAQ A;  4P75 A;  4JV5 L;  3C1E A;  1B9M A;  1TWF H;  1HH2 P;  4A3C H;  3RLN A;  1JB7 A;  5DM7 3;  5M5W B;  2R7Z G;  1PRT C;  2AWN A;  4BA1 I;  4LFC Q;  1J6Q A;  4DV5 L;  5BN3 A;  1LLR D;  2NZH A;  1NAP A;  3GDE A;  3S1N H;  2BCO A;  3PUW A;  3PO3 H;  3A5Z B;  5IT9 c;  2QIL A;  2EVB A;  4DR5 L;  4UHV A;  1H9S A;  4ALP A;  4DR1 Q;  1K83 B;  1OXV A;  3ERQ A;  2A74 C;  2I46 A;  4BY1 G;  1H9K A;  2Q8R E;  3TZD A;  2NVQ B;  4GLX A;  3DLL A;  5E3F A;  3T53 B;  4IJL A;  4ZCK A;  2QEX A;  4QGU A;  4KY5 A;  1PRT F;  4TKO B;  1ENF A;  2G9D A;  1OXS C;  4DXF A;  2NVX B;  2E5L L;  2V4D A;  4PG3 A;  2R92 B;  2XVS A;  1VF7 A;  4NKL A;  3HOY G;  4X3U A;  1KIX A;  1WD0 A;  2ICI A;  3GTK H;  2Z4I A;  4KTA A;  4V0B A;  1A62 A;  3CD6 A;  4OO1 H;  3HOX H;  4EQP A;  1EYA A;  5D65 A;  5EBC A;  1QB5 D;  2CH4 A;  1RKN A;  2CQA A;  3EQL C;  4HTH A;  3GTP B;  2MPM A;  3WWV A;  1XPO A;  1EU3 A;  3FKI G;  2JA7 G;  1ICF B;  3J7A F;  3W1G A;  1N36 Q;  2B63 H;  4C3J B;  2EJF C;  1HFN A;  1YIJ A;  1XNQ Q;  1NMF A;  4AYB G;  3CCU A;  5EQ0 A;  1SDF A;  1I94 Q;  1S5E D;  1D5X C;  1WTV A;  3GD7 A;  2ZTC A;  1Q82 C;  5JJI A;  1KHI A;  1TVX A;  3F2B A;  2B63 G;  1X3P A;  3G48 A;  4RH6 A;  3U4V A;  3EA6 A;  2YYZ A;  5I4D A;  4XQJ A;  3ND9 A;  4GN3 B;  2R7F A;  3UDF A;  4KMU C;  1II3 A;  1QVF A;  2F4V L;  3NTI A;  4EQ5 A;  4A3B G;  3J81 i;  1E1T A;  1XTC D;  1N9W A;  1ET9 A;  1LTB D;  1TWC H;  3S16 H;  3NUC A;  5LMN W;  1IYU A;  2WAQ G;  1EY8 A;  2SNS A;  5M9O A;  3E9H A;  1JOK A;  2IPK D;  3A8K E;  2TMP A;  5COR A;  1ONL A;  3CRK C;  5IWA L;  4IPC A;  2K5D A;  3HOZ B;  3R2T A;  4AIM A;  2EPB A;  5IOD A;  4KHP L;  2WAQ B;  2AUJ D;  2NN6 H;  2HQE A;  2OF1 A;  4RHS A;  4QMG A;  1SYG A;  3PF4 A;  3RLF A;  1UEB A;  3S17 H;  1CQF A;  3D31 A;  5C3X A;  5FO8 B;  1STE A;  3KDF B;  4A3M B;  1BBU A;  1Q1B A;  5CV7 A;  5FKA C;  4C3J G;  1QWY A;  5GAG C;  2ZTE A;  1GHK A;  4X3T A;  1S5D D;  2ATW A;  2KCM A;  1PYW D;  1X32 A;  3BJU A;  5CV5 A;  3TZU A;  4F7X A;  1YJW A;  1AZQ A;  2NYZ D;  4JC0 A;  4JOI A;  3TN2 A;  1NBW A;  1G6Z A;  1VQF A;  1Q81 C;  2Q2I A;  2CW0 C;  4DNR B;  1DXM A;  4BBS B;  3HOX G;  1Q7Y C;  3CCQ A;  1R9T H;  4XQN A;  3HKZ B;  3BDC A;  3T1H L;  2F0V A;  1TII D;  1IL2 A;  1WVL A;  4ODG A;  2ZM6 L;  1PRT B;  4KHV A;  3A55 A;  4QUF A;  4JI7 Q;  1EIH A;  1SNP A;  1WI5 A;  3D4D A;  2WB1 B;  2UUB L;  1LT5 D;  2A69 D;  5T1G A;  1X3G A;  1F77 A;  1TWA H;  1EU4 A;  4QUC A;  4KY6 A;  2VQF Q;  1NR4 A;  3TP6 A;  1C4Q A;  4LFA L;  4A4I A;  1F2Y A;  2ES2 A;  5F2D A;  1SRU A;  5ELF A;  1RHP A;  5IYC H;  1D5Z C;  4DUZ L;  3KUP A;  3GQB A;  4DV6 L;  4BXX H;  4RGM A;  2XRQ D;  4C2M H;  1LYL A;  4DNT B;  4LJZ C;  5BR8 L;  4ZUJ A;  4P74 A;  3MZ5 A;  2Y0S E;  5BN5 A;  5FO9 B;  3M4Q A;  2LS0 1;  3KLS A;  1T5X D;  3L2P A;  1B1Z A;  2F0W A;  4ULL A;  3MVV A;  5JOB A;  5ELE A;  3JAM E;  3BYT B;  4L8J A;  2X6G A;  3KFU A;  2IL8 A;  2CWP A;  2PQA B;  1MI2 A;  4CDE C;  4IFD J;  1Q8I A;  1WYD A;  4JBW A;  1WCM H;  4X3S A;  4DV1 Q;  3ULP A;  1GUS A;  2YU9 B;  2AQ1 B;  5M5W H;  1YHQ A;  3ND8 A;  3TEH B;  3QO2 A;  1PH4 A;  4KN7 C;  1E7Z A;  3S17 B;  3MXG A;  2R93 H;  1XWE A;  3C2P A;  2EYO A;  1STA A;  1EY9 A;  1PH1 A;  2I0Q A;  1UE6 A;  3D4R A;  3GTQ H;  4RGN A;  3STB C;  1LTS D;  1MSH A;  1XNR L;  5IGC A;  3ITP A;  1B3A A;  1STN A;  3L7Z C;  1Y69 U;  5G3L D;  3LWU A;  5JAV A;  1LM0 A;  5KNB A;  4J1M A;  3HZX A;  2F0Q A;  4PZ7 A;  4O2D A;  3H91 A;  1EQR A;  3T1Y L;  1ZYR D;  5LHY 1;  4UDU C;  5DEH A;  1SMY C;  4K0K Q;  2H4O A;  3H0G G;  1IW7 D;  4B3T L;  2SDF A;  5C0X I;  3D6W A;  1QJO A;  2K7V A;  1TY0 A;  2NWG A;  4ME3 A;  3G6E A;  1D1I A;  5LL6 S;  4GZY C;  4GOP A;  1CA6 A;  1CHQ D;  1CHP D;  3H3V H;  5EAY A;  1CI3 M;  5D3D A;  4DV4 L;  4O1N A;  2F0N A;  4KHZ A;  3CCR A;  1RIP A;  4C3J H;  2R7D A;  4OHJ A;  3J81 j;  2LMC B;  1VQ5 A;  4HAE A;  1IKL A;  1ZYR C;  1V8Q A;  3E3X A;  5ELC A;  4RAU C;  3T4A C;  3NBI A;  5K36 G;  3PUX A;  4A3J G;  1Z9F A;  3BS1 A;  1XMQ L;  3WOF A;  2F0D A;  2JA5 B;  4NMZ A;  1KAA A;  2JA6 B;  1PRT D;  4C1N K;  2ASB A;  4A3B B;  2E75 C;  2RDG A;  1CZG A;  1Q86 C;  3S24 A;  4DR7 L;  1Y8O B;  4A3D G;  4AQY Q;  1PV4 A;  1EY6 A;  3I70 A;  2NVY H;  2QF7 A;  4FF4 A;  2A69 C;  2LSS A;  3LNN A;  1CFM A;  4DPG A;  1O7I A;  4UP7 A;  2HD3 A;  3K5N A;  1GUT A;  4RKB A;  3S15 H;  2YTX A;  2KHS A;  1EQT A;  2JA9 A;  2IX3 A;  1WJJ A;  1Y1V B;  4B3M L;  5ELO A;  4JI4 Q;  5IGG A;  3J81 c;  3DEP A;  4A3G G;  1HUN A;  5A2Q L;  1VQP A;  1BNZ A;  4B3T Q;  2EYL A;  4MN3 A;  4N8F A;  5J1Z A;  3MWY W;  2WKD A;  2F3I A;  2PZW A;  4KKU A;  3T16 A;  1ASZ A;  2A1A A;  2O4X A;  5K5P A;  3HOW G;  3GTP H;  4JI7 L;  4N8X 1;  1B53 A;  2F4V Q;  5C4X G;  1JCK B;  2C35 B;  5EKK A;  1I4X A;  2N3S A;  4DGZ A;  4CKB A;  3LWE A;  1HR0 W;  1HCZ A;  3OSO A;  1R9T B;  3CCL A;  4NXM L;  2ALY B;  1SNM A;  2FJ2 A;  1M8A A;  4JK1 C;  4LF8 L;  3K5L A;  1XNQ L;  4DFA A;  1S5F D;  4V19 0;  5IP7 H;  1N36 L;  5DLQ E;  2R61 A;  2IWH A;  2RHQ B;  3JC6 6;  2VL6 A;  3AFP A;  2UXC L;  4XTC S;  1CSQ A;  1HFG A;  2C5C A;  4KKS A;  2WB1 G;  4JBJ A;  4EVO A;  1U9R A;  2EYP A;  3GP7 A;  5L37 A;  5IP7 G;  1LAC A;  4FXG C;  2DJG C;  1EQQ A;  4A3D B;  3MHB A;  1K8M A;  1HNX L;  2KEN A;  1HZA A;  1IBK Q;  2RDF A;  4JI3 Q;  5KIX A;  2DY8 A;  1QCB D;  4C3I G;  1VQ7 A;  2B63 B;  4P71 A;  2UU9 L;  4LK1 C;  3H3V C;  4Z9C B;  4JCV E;  3UDI A;  3FPP A;  1CA5 A;  1G8Z D;  3GTM H;  2JA5 H;  2ZTD A;  4IPG A;  1YHB A;  1FYC A;  3G7L A;  2UUC L;  3HOY H;  1A3V A;  4YWK A;  4MTN A;  3IL8 A;  4OWT B;  1ICW A;  1VQD A;  1HNX Q;  1EY4 A;  1LUZ A;  3V05 A;  2WB1 E;  3K57 A;  1H9S B;  1KC8 C;  3GTL B;  4NDX A;  5EKL A;  4IOC A;  4DV7 Q;  3E0J A;  5JPN C;  2E5L Q;  1X3F A;  4Y7N B;  1SBB B;  5IGE A;  3S15 B;  2JXM B;  1O80 A;  4LF7 L;  2B29 A;  4AYB E;  5E4X A;  5FO7 B;  1EWI A;  4H7B A;  1QIL A;  3S16 B; 
#chains in the Genus database with same CATH homology
 3RN5 A;  1YI2 A;  1JB7 A;  2R7Z G;  2AWN A;  4BA1 I;  4LFC Q;  1J6Q A;  4DV5 L;  1S40 A;  2EQS A;  2NZH A;  4A3B H;  4IPD A;  3GDE A;  2OQK A;  3S1N H;  3K7A H;  4A3L H;  1G6P A;  2OWO A;  3PUW A;  2JA8 H;  2UXB L;  3T1H Q;  3PO3 H;  4B3R Q;  3A5Z B;  5IT9 c;  3PIP A;  4DR5 Q;  1MKH A;  1JJ2 A;  4DR5 L;  3GTO H;  1J5E Q;  3PUV A;  2NZO A;  3RN2 A;  4DUY Q;  3KF6 A;  4ALP A;  2B3G A;  4DR1 Q;  1OXV A;  2Q2H A;  4DKA C;  4LFB L;  4KHP Q;  1WFQ A;  3DM3 A;  2CKZ B;  4H02 A;  4BY1 G;  3S2D H;  4UP9 A;  1PH8 A;  2EIF A;  1P8L A;  4A93 G;  4GLX A;  3DLL A;  4A3E G;  1VQI A;  1VQB A;  3F2D A;  4IJL A;  4IO9 A;  4OX9 Q;  2DGY A;  2QEX A;  4LUZ A;  4QGU A;  3HOU G;  2VZA A;  2KCT A;  2D62 A;  5C3E H;  1A63 A;  2ZJQ A;  4DR3 L;  3ERS X;  1OXS C;  5GQO A;  2GVA A;  4PZ8 A;  3U58 A;  2E5L L;  4A3C H;  3M9B A;  4PG3 A;  3JAM i;  1VQL A;  2QA4 A;  1X3E A;  2OCE A;  1BKB A;  4BBS G;  5JJK A;  5IYB H;  4DUY L;  3HOY G;  4Y52 H;  1KIX A;  3GTK H;  3PO2 G;  4LF5 L;  3CF5 A;  1A62 A;  3CD6 A;  3HOX H;  4A3K H;  3ULJ A;  2UXB Q;  4X64 L;  1FL0 A;  5IYB G;  3G71 A;  4A3M H;  2N49 A;  2HQL A;  2R7Z H;  4UP8 A;  4A3D H;  3WWV A;  3BZC A;  2VQE L;  3FKI G;  1XPO A;  2UUC Q;  2JA7 G;  3KYH C;  3CAM A;  1VQ9 A;  4DR4 L;  3KJO A;  1I50 H;  3W1G A;  1X56 A;  1N36 Q;  4HIK A;  3TS0 A;  2B63 H;  4BA2 I;  4DV3 L;  3E0E A;  1YIJ A;  2CFM A;  4HJ5 A;  1XNQ Q;  1NMF A;  4AYB G;  2XTI A;  3CCU A;  4YWM A;  4GOP C;  1I94 Q;  2D0P A;  3CC2 A;  1FVI A;  2KBN A;  3GD7 A;  2JK8 A;  4DR6 Q;  1JJG A;  3CC7 A;  2VQE Q;  4JYA L;  2ZTC A;  1L2F A;  2AKW B;  2GN5 A;  3SGI A;  1Q82 C;  5JJI A;  3GTL H;  1KHI A;  2K14 A;  4TVA B;  5FJ8 G;  3CCJ A;  4C3H H;  4YY3 Q;  4R4I A;  3F2B A;  2B63 G;  3HOZ G;  3G48 A;  3U4V A;  2YYZ A;  4X62 Q;  4LF5 Q;  4JI1 Q;  1KAW A;  1X6O A;  4X6A H;  4X65 L;  5LMU L;  1X55 A;  2WAQ E;  2R7F A;  4GN3 B;  3UDF A;  4DR2 L;  1QVF A;  4DV2 L;  1VS0 A;  4NPS A;  4R4O A;  1SN8 A;  1VQG A;  3EIV A;  2F4V L;  4EQ5 A;  4DV5 Q;  3ICE A;  1XPR A;  5IYD H;  4A3B G;  1E1O A;  3J81 i;  1E1T A;  1N9W A;  1TWC H;  3W5O A;  3E9I A;  3S16 H;  4B3S Q;  1QZG A;  5LMN W;  3MXN B;  5AJ3 Q;  1Y1V G;  1X54 A;  2WAQ G;  3I4O A;  4DAM A;  2LXK A;  3I4N G;  1NJI C;  3E9H A;  4OX9 L;  1EIF A;  4C3I H;  4A3F G;  3RR5 A;  1UE7 A;  1SE8 A;  1CKO A;  2RCN A;  3K0X A;  3HKZ G;  5IWA L;  4IPC A;  4OWW B;  4BBR G;  2Z6K A;  4AIM A;  2JA6 G;  4GKK Q;  4JI3 L;  4KHP L;  3K80 C;  1AE3 A;  1FJG Q;  4L5T A;  1SLJ A;  1B8A A;  3M7N A;  4A3E H;  1IBM Q;  3PF4 A;  1M90 C;  3RLF A;  1UEB A;  4A93 H;  1KL9 A;  2VUM H;  1E3P A;  5IP9 H;  1FJG L;  1VQ6 A;  3D31 A;  3S17 H;  3CCM A;  2DUD A;  3KDF B;  3UE1 A;  1VQH A;  5IE8 A;  1BBU A;  1Q1B A;  3CCE A;  3M85 A;  5M3F G;  2JEA I;  1S3O A;  2UXD L;  4LFC L;  1E24 A;  3GTJ H;  2BH2 A;  5GAG C;  2ZTE A;  1KQS A;  4BBR H;  2ATW A;  5J3B A;  2KCM A;  3BJU A;  1YJ9 A;  1W3S A;  1YBY A;  2VNU D;  1G29 1;  3EN2 A;  1VQJ A;  4IFD I;  3TQY A;  4JI8 L;  1LTL A;  1HZB A;  4JI0 Q;  1Q8K A;  1Z47 A;  1YJW A;  1HZ9 A;  1PH5 A;  2OTJ A;  4JC0 A;  4JOI A;  2E2H H;  1NBW A;  4DNI A;  1VQF A;  4FDB A;  5GAD C;  2Q2I A;  4Y7N H;  3UDG A;  4OON A;  1Q81 C;  4IFD G;  1JE5 A;  1C0A A;  3CMA A;  1XMQ Q;  1EYG A;  2A19 A;  1IBK L;  5IY0 A;  1N33 L;  3HOX G;  1IYJ B;  1Q7Y C;  1MJC A;  3CCQ A;  1R9T H;  4R4C A;  3LGJ A;  4LF6 L;  4JI2 L;  2V1C C;  3F2C A;  3B6Y A;  5M5Y H;  3T1H L;  3RNU A;  4GN5 A;  1IL2 A;  1QZH A;  2GVB A;  3PUZ A;  2ZM6 L;  1Y14 B;  2HHH Q;  1M1K C;  2ID0 A;  4JI7 Q;  2PNH A;  4OO1 I;  1PH9 A;  1WI5 A;  2NVQ H;  4DR6 L;  2UUB L;  1X3G A;  1TWA H;  2HIV A;  1MIU A;  2E2J H;  3W1B A;  3J7Z C;  2R92 G;  4DV3 Q;  1L0W A;  3M4O H;  2I5H A;  3PSI A;  2YV5 A;  1NTG A;  1NY4 A;  2VQF Q;  1L1O A;  4LFA L;  2NVX H;  3I55 A;  1GVP A;  1CSP A;  4A4I A;  4LF9 Q;  1HNZ L;  2IX0 A;  1BVS A;  2ES2 A;  1SRU A;  4GNX A;  2A8V A;  4K0K L;  5HGQ A;  3I4N H;  1KXL A;  2EXD A;  4XIG S;  2JE6 I;  4QL5 A;  1SR3 A;  4GS3 A;  4NB3 A;  5IYC H;  4A3C G;  1Y1V H;  2Q2U A;  4DUZ L;  4DUZ Q;  3CC4 A;  1K8A C;  3A74 A;  3KJP A;  4IJH A;  4DV6 L;  2IY5 B;  4BXX H;  2H5X A;  4C2M H;  3GTG H;  4KLK A;  3HOW H;  1X65 A;  4WJ4 A;  1LYL A;  3OYY A;  1KRS A;  5BR8 L;  1BBW A;  4GLA C;  1HNZ Q;  2YU9 H;  1I5F A;  2JEB I;  4P74 A;  3I4M G;  2Y0S E;  4LFA Q;  1WCM G;  3PIO A;  3M4Q A;  3STB D;  4MNO A;  1N32 Q;  2YTY A;  2CQO A;  3VDY A;  1JJC B;  1SRO A;  1PA6 A;  3L2P A;  3CCV A;  1AH9 A;  4DV0 Q;  4A75 A;  1PYS B;  4R1J A;  1HJP A;  5ELN A;  1S72 A;  4RG1 A;  1A8V A;  1E22 A;  3BU2 A;  3U4Z A;  3ZJY C;  2I5M X;  3KFU A;  4A3J H;  3F1Z A;  4APV A;  1VQA A;  2CWP A;  2PQA B;  2IHE A;  1MJE A;  2JJQ A;  2JQO A;  4JI6 L;  2AWO A;  3ER0 A;  4BY1 H;  1D8L A;  1N34 L;  3TS2 A;  2MFI A;  3J80 i;  4IFD J;  4YHH Q;  1KD1 C;  1L1O B;  4A3F H;  1WYD A;  4JBW A;  1WCM H;  3G4S A;  2K52 A;  4DV1 Q;  3ULP A;  3I4M H;  1DGS A;  4B3R L;  2IX1 A;  3AFQ A;  4LF6 Q;  4HIM A;  4EX5 A;  2Z0S A;  5M5W H;  1YHQ A;  5JEA J;  1IZ6 A;  1N34 Q;  3TEH B;  1QVC A;  2OQ0 A;  4JBK A;  3IRB A;  1PH4 A;  1E7Z A;  1QUQ A;  1P16 A;  1UE1 A;  4DV4 Q;  2R93 H;  5HY6 A;  1UE5 A;  3PO2 H;  4A3K G;  2IHF A;  4J15 A;  1FGU A;  3HFZ B;  3UE0 A;  1XNR Q;  4GNX C;  4LW1 A;  1PH1 A;  2I0Q A;  4OO1 G;  1Q12 A;  1UE6 A;  5IYC G;  1HR0 Q;  3GTQ H;  3EBE A;  3OTO Q;  1PHJ A;  4LUV A;  3STB C;  4TQU S;  4LF8 Q;  1SMX A;  1XNR L;  4QJF A;  4HID A;  1EIY B;  2L15 A;  1VQ8 A;  1WOC A;  1K8G A;  3L7Z C;  5BR8 Q;  3HOZ H;  1LM0 A;  1Q46 A;  4BY7 G;  2RF4 A;  3PV0 A;  4PZ7 A;  3PGZ A;  2K75 A;  4O2D A;  2PMZ E;  1JT8 A;  1C7Y A;  3CXC A;  1EQR A;  4YCV A;  3T1Y L;  3FHW A;  4GLV B;  1PVO A;  1JMC A;  2R6G A;  3CW2 C;  1GM5 A;  2CCZ A;  3KOJ A;  3PCO B;  4DK6 C;  3I2Z A;  1TXY A;  3CCS A;  1PH3 A;  3I56 A;  3S1M H;  4K0K Q;  3CPW A;  5H1S E;  4JG2 A;  1Y1W H;  3CPF A;  2UUA Q;  3H0G G;  5FLX c;  1RL2 A;  4LF9 L;  4B3T L;  4GKJ Q;  4DV0 L;  5C0X I;  4DK3 C;  1YHA A;  2JA8 G;  3G6E A;  4ME3 A;  1VQM A;  3RZD H;  4JI4 L;  4B3M Q;  3RZO H;  4GOP A;  2WFW A;  2UU9 Q;  2UUA L;  5C0X G;  3H3V H;  3S2H H;  1D7Q A;  5EAY A;  2UUB Q;  4DV4 L;  4HJ9 A;  2HT1 A;  2ZJP A;  3H0G H;  3OW2 A;  4JI5 Q;  1HNW L;  5LMN Q;  4KHZ A;  3CCR A;  1RIP A;  3FP9 A;  1EFW A;  4C3J H;  1XMO L;  2R7D A;  3M4P A;  1Y1W G;  3J80 c;  3J81 j;  2ZM6 Q;  5M3F H;  1VQ5 A;  2HHH L;  2VY3 A;  4IOA A;  4X65 Q;  4GOP B;  1K83 H;  4NXN Q;  2K50 A;  4P72 A;  1Q1E A;  4NXN L;  4JI2 Q;  4A3G H;  4LFB Q;  4X62 L;  1V1Q A;  2BH8 A;  1PH2 A;  3CME A;  5K36 G;  3PUX A;  3NBH B;  4A3J G;  1Z9F A;  5LMN L;  4PMW A;  1XMQ L;  4LNQ A;  4UY8 C;  1K9M C;  1EUJ A;  5IP9 G;  2VUM G;  2MO1 A;  2Z6K C;  2VQF L;  2QGQ A;  1V43 A;  1GD7 A;  5GAE C;  2ASB A;  1Q86 C;  2K4K A;  1XJV A;  2NN6 G;  3S24 A;  3JAM c;  1K73 C;  3FKI H;  1CKN B;  4JI8 Q;  2JA7 H;  4DR7 L;  2I5L X;  1K0R A;  3PO3 G;  3M3Y H;  1CKN A;  4A3D G;  4AQY Q;  4NXM Q;  1L1O C;  1PV4 A;  4A3M G;  4DR4 Q;  3HKZ E;  2NVY H;  1GKH A;  2YTV A;  2R93 G;  4BXX G;  4DAY B;  3KDF A;  3RLO A;  3ULL A;  2F52 A;  4KI0 A;  2JA5 G;  1VQC A;  2BA0 A;  3I7F A;  4X64 Q;  3S1R H;  5JJL A;  2LSS A;  2MNA A;  3H3V I;  4DV1 L;  5GRO A;  5M5X H;  4DPG A;  1O7I A;  4GN4 B;  4UP7 A;  3T1Y Q;  4JI6 Q;  1U0L A;  1VQE A;  4JI5 L;  3S15 H;  2YTX A;  1YEZ A;  2JA9 A;  5IWA Q;  2PI2 A;  5C3E G;  4JBM A;  2VW9 A;  2WP8 J;  1WJJ A;  3NEM A;  1ASY A;  2AMC B;  4B3M L;  4DR3 Q;  5ELO A;  4JI4 Q;  1OXX K;  2FXQ A;  4O0A A;  1VQK A;  2N78 A;  5FLM H;  3J81 c;  1N32 L;  4R4Q A;  2E8G A;  3OTO L;  3MEF A;  1HR0 L;  4A3G G;  4YCU A;  5GAH C;  4GKJ L;  1VQP A;  4B3T Q;  2AHO B;  1YIT A;  2Q2T A;  3HOV H;  4JOI C;  1SFO H;  3CQZ H;  1VQ4 A;  1AE2 A;  2K5V A;  2F3I A;  2XGT A;  3Q8D A;  4OXP A;  5C4J H;  1YNX A;  2ZJR A;  4QQB X;  2UXC L;  1ASZ A;  2A1A A;  2HIX A;  4AH6 A;  4YCW A;  4HJ7 A;  1OTC A;  4JI7 L;  3GTP H;  5C0X J;  4DV2 Q;  2F4V Q;  5M3M G;  3A0J A;  2VS1 A;  4A3I G;  3HOW G;  4L5R C;  3S1Q H;  5C4X G;  2C35 B;  5LMU Q;  1J5E L;  5JEA G;  2N3S A;  1NE3 A;  1XTD A;  4IPH A;  2KHI A;  4GKK L;  2KHJ A;  1G51 A;  4HJ8 A;  1HR0 W;  4BBS H;  4L5S A;  2D0O A;  4HJA A;  3S14 H;  3CCL A;  4JYA Q;  2MQH A;  3AQQ A;  2ALY B;  4AQY L;  4NXM L;  1TWG H;  4DR7 Q;  5C4X H;  4HIO A;  2IT1 A;  4LF8 L;  2LXJ A;  1EOV A;  4MZ9 A;  4LUO A;  1XNQ L;  1QVG A;  1CKM A;  3L0O A;  4OWX B;  5M3M H;  4A3I H;  4JV5 Q;  1PH7 A;  4QIW E;  4R4T A;  1NMG A;  3PUY A;  5DLQ E;  5IP7 H;  1N36 L;  2OTL A;  1OXU A;  1KRT A;  4RMF A;  4LF7 Q;  4QY7 A;  1VQO A;  2RHQ B;  3JC6 6;  2N8N A;  1YZ6 A;  2VL6 A;  3D0F A;  3NEL A;  3TRZ A;  1A0I A;  1PYB A;  1CUK A;  1T9H A;  3AFP A;  3CP0 A;  1QUQ B;  4UPA A;  4DV7 L;  4XTC S;  4GNX B;  1IXR A;  3AEV A;  1CSQ A;  5FLM G;  3HOU H;  1VQN A;  2WB1 G;  4JBJ A;  1HZC A;  1PH6 A;  1YJN A;  3K8A A;  5E7N A;  5IP7 G;  2E2I H;  3KF8 B;  1N8R C;  3U50 C;  4YHH L;  1EQQ A;  2PQA A;  4P73 A;  4YY3 L;  1IBM L;  1XMO Q;  1HNX L;  4A76 A;  1W2B A;  2KEN A;  1N33 Q;  1HZA A;  1IBK Q;  4YWL A;  1UWV A;  4X66 L;  4JI3 Q;  1HNW Q;  3KLW A;  1X9N A;  4LF4 Q;  1VQ7 A;  1OXT A;  4P71 A;  2UU9 L;  1PFS A;  1B70 B;  2NVT H;  4JCV E;  3UDI A;  1I3Q H;  2K5H A;  1K3R A;  3GTM H;  2JA5 H;  1U5K A;  2ZTD A;  1IBL L;  3F8T A;  1IBL Q;  4A3L G;  4IPG A;  1YHB A;  4WJ3 M;  3UDX A;  2PI2 E;  4B3S L;  5IYD G;  2UUC L;  3HOY H;  3A5U A;  1H95 A;  3PF5 A;  4YWK A;  1C9O A;  4MTN A;  2UXD Q;  1I6H H;  3GO5 A;  1B7Y B;  2MO0 A;  4OWT B;  4X66 Q;  4LF4 L;  4DV6 Q;  3HKS A;  2BA1 A;  1VQD A;  4DR1 L;  4PZ6 A;  4DR2 Q;  2R92 H;  3H15 A;  4LWC A;  1HNX Q;  3HOV G;  4POF A;  1GO3 E;  1LUZ A;  4JI1 L;  2K5N A;  2WB1 E;  3TRE A;  5FJ8 H;  3KF6 B;  5C44 G;  1KC8 C;  3BZK A;  2NN6 I;  2RHS B;  3NEN A;  2Y0S G;  4L5Q A;  4IOC A;  1VCI A;  3K7U C;  4DV7 Q;  2UXC Q;  4POG A;  3AYH B;  2E5L Q;  1X3F A;  3J7A 5;  2JA6 H;  5C44 H;  1YVC A;  4BY7 H;  1I94 L;  4LF7 L;  1V9P A;  2B29 A;  4AYB E;  4JI0 L;  3K81 C;  1XPU A;  4JV5 L;  2CWA A;  4P75 A;  5AJ3 L;  1EWI A;  1TWH H;  1HH2 P;  1TWF H;  3RLN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...