2KHJA

Nmr structure of the domain 6 of the e. coli ribosomal protein s1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
89
structure length
89
Chain Sequence
MFNNWVALNKKGAIVTGKVTAVDAKGATVELADGVEGYLRASEASRDRVEDATLVLSVGDEVEAKFTGVDRKNRAISLSVRAKDEADEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S1
publication title Probing the relationship between Gram-negative and Gram-positive S1 proteins by sequence analysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosomal protein
total genus 9
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2khjA00
1TWFH 2RHSB 3M3YH 4OO1I 3RLNA 3AFPA 1PH6A 4A93H 2MQHA 4BBRH 4GKJL 2HQLA 3AYHB 3T1YQ 3G6EA 1XPOA 2NVXH 3A74A 4JG2A 4O2DA 3RLFA 4JI7L 4LF6Q 3RNUA 1IL2A 4KHZA 4LNQA 2V1CC 1N34L 1MKHA 3MXNB 3W1BA 1VS0A 2HHHQ 2NZOA 4C2MH 2QGQA 4X62L 4DV1L 1XMQQ 2KHIA 4JBKA 4GN3B 4LF5L 3M4OH 1VQGA 4BXXH 4DR7Q 1EQQA 2UXDL 2K5VA 3SGIA 4A3FH 1XPUA 5C4XG 3AQQA 2VUMH 5IWAQ 1VQNA 3AEVA 3KFUA 2UXBQ 5LMNL 5IT9c 2JQOA 1NTGA 2CKZB 1WCMH 1FGUA 1SRUA 5C4JH 4LF6L 3I4NG 2CWPA 2HHHL 2WAQG 2L15A 4A3LG 3G4SA 2UU9Q 3ULPA 4DR7L 1HNWL 1N36Q 4OXPA 4OO1G 3HOZH 2K5NA 3L0OA 5C44H 3EN2A 1M90C 1D8LA 4NXML 5IWAL 1SE8A 1E3PA 2KCTA 2LXKA 1PHJA 3GTLH 2QA4A 2ATWA 3T1HQ 3ZJYC 3S1NH 5ELOA 1HZBA 4JI0L 2D62A 4YCVA 3PIPA 3UE1A 4POGA 3FHWA 4A3KH 3G48A 2PI2A 4KHPQ 3M4PA 1YHQA 1AH9A 3RN5A 1AE2A 4UPAA 2JA6G 4UP8A 1C9OA 1N36L 1IXRA 2ASBA 4LF7Q 2R7ZH 4GN4B 2N3SA 1K9MC 2NVQH 2YYZA 2RCNA 3CQZH 3I55A 1DGSA 2JA9A 2Y0SG 2YTXA 4P73A 4R4TA 2Q2HA 1MJCA 1EWIA 2OQ0A 1YZ6A 4AH6A 5IYCH 5BR8Q 4A3JG 1YI2A 4WJ4A 2ALYB 3EIVA 3UDIA 2Q2IA 4KHPL 5C3EH 5IYDH 1Q8KA 5IE8A 2H5XA 5FLXc 3HOZG 1LTLA 1NBWA 2UUBQ 2VY3A 2I5HA 2C35B 1VQCA 1XJVA 2NVTH 2ZTEA 1K8AC 4H02A 2UUAQ 3CF5A 3KF8B 4BA2I 3KDFA 3CCMA 3CCSA 4BY1H 3MEFA 2KHJA 1BVSA 3PGZA 4LUOA 4A3EH 1GD7A 1YJWA 1GM5A 5LMUL 2JA8H 3F1ZA 1QZHA 2WFWA 3I7FA 1CKNA 2CQOA 2I0QA 4LF9L 4B3RQ 3RLOA 1R9TH 3I4MG 2UUBL 1EUJA 3S1MH 3FP9A 4YWMA 1XNQQ 5GQOA 3AFQA 1OXTA 2UUAL 1VCIA 4JYAQ 1NE3A 1CKMA 3NEMA 5FLMG 4QL5A 2RHQB 3STBD 3S1RH 3CCRA 3BZKA 4NXNQ 3GTOH 4P75A 5IP9G 4NB3A 4OWXB 2HIVA 1VQ5A 2VL6A 3M85A 2AWOA 5AJ3Q 4DV5L 2JK8A 4K0KQ 1VQFA 4YY3Q 3PO3G 1I5FA 2DUDA 2NVYH 2WB1E 3CC4A 3W1GA 1I6HH 4APVA 2DGYA 3I4OA 4QIWE 4YCUA 1X54A 4BY1G 3RR5A 4A3GG 2VNUD 1MJEA 3HOUH 4DR5Q 1PH7A 4JYAL 1A62A 2VW9A 3PUXA 5M5XH 3UDGA 2WP8J 4A3DG 4MTNA 1JMCA 3TRZA 4AQYQ 1UE7A 5H1SE 3PO2G 1VQ7A 4K0KL 3UE0A 2QEXA 1HR0Q 4JV5Q 4YY3L 3CCUA 4L5QA 4DV3L 3KDFB 2UXCQ 3PSIA 2ZJRA 2KBNA 1KL9A 4TVAB 4LFAL 3DM3A 1J6QA 4RMFA 3K7UC 1V43A 5HY6A 3JAMi 4HJ8A 1Q82C 4HIKA 4LF8Q 1PYSB 5FJ8G 5C4XH 4IO9A 1PH5A 1VQKA 1CKNB 4JI8Q 3JAMc 1VQ8A 3UDXA 3S2HH 4BBSH 4LFCQ 4AQYL 3BJUA 1Q12A 1HNXQ 2ZJQA 4PZ8A 1JJ2A 3I4NH 1YVCA 4YWKA 4HJAA 1YIJA 3PUYA 2BA0A 2UXCL 4DV0Q 3J81j 4DV7Q 3HOWG 4LUZA 1P16A 1RL2A 3HOUG 1Y1VG 1HR0W 4X66Q 2F4VQ 1KRSA 2PMZE 3HKSA 3HKZE 4DK6C 2AWNA 2N49A 1GKHA 4A3IG 1KC8C 4GLAC 4A4IA 4JI8L 2EQSA 1YJ9A 1UE5A 3PF5A 4UY8C 4GOPB 1N32Q 4OWTB 3ER0A 1VQDA 1HNXL 4R1JA 1PH3A 4GLXA 3I56A 3KYHC 4GS3A 1C0AA 4JI1Q 1K83H 3JC66 2K52A 1QVGA 4DR6Q 4DV6Q 3S2DH 4EQ5A 5GAGC 5E7NA 5GADC 3A5UA 5EAYA 2E5LQ 1NMFA 2A8VA 4GN5A 2JA6H 1KD1C 4X66L 4GOPC 1FJGQ 5M3MG 2F4VL 3T1YL 4BBSG 3CPWA 2ZM6Q 3D0FA 4JCVE 5DLQE 1V1QA 4JC0A 3HOXG 1L0WA 1HNZQ 4Y52H 3DLLA 1UE1A 1WOCA 4A3JH 2BH8A 2BH2A 2MO0A 3PCOB 4HIOA 1XMQL 1E22A 3EBEA 3UDFA 2ES2A 3ICEA 4JI1L 4GNXA 1G51A 3U50C 4DPGA 5IY0A 3VDYA 3S17H 4DV4Q 2VQFQ 4L5TA 2YTYA 4DV6L 1YHAA 3H3VI 4WJ3M 1HZ9A 2E8GA 1HH2P 3G71A 3CMEA 3FKIG 3H3VH 2UXBL 1PH1A 4OONA 2R7DA 3HOYG 2RF4A 4DUZQ 4GLVB 1K73C 4LUVA 3K0XA 1SFOH 1PVOA 2GN5A 1HNZL 2R7FA 4HIMA 1M1KC 3S1QH 4IPDA 3HOVH 2UU9L 2N8NA 1PH2A 1AE3A 1HZCA 1LYLA 1SR3A 5M5YH 5JEAG 1VQMA 4BY7H 1X3FA 1OTCA 3I4MH 3PUVA 4TQUS 2PI2E 2AKWB 1XTDA 3OTOQ 3J7A5 2ZTCA 3T1HL 2OTJA 3ULJA 1PH4A 1QVFA 1Q86C 5FLMH 4DUZL 1QVCA 5IP9H 4UP9A 2PQAB 4PZ6A 3F2BA 4P72A 5GROA 4JBWA 2F3IA 2Q2UA 2E2HH 3PO3H 4LFBQ 1J5EQ 1B7YB 3GTJH 2FXQA 1VQHA 1XPRA 4LF7L 3A0JA 2CWAA 1UWVA 4IJHA 4A3GH 4MZ9A 4DNIA 4GNXB 5BR8L 2UUCQ 4X6AH 1BKBA 3HOVG 4BA1I 2B63G 4A3DH 3S16H 2D0PA 4BY7G 1E1OA 3PO2H 4XTCS 1LUZA 4XIGS 4PMWA 3RN2A 3L2PA 2E2IH 4R4IA 4LFBL 3KF6A 4GNXC 4JI2Q 2MO1A 2Q2TA 2B3GA 4C3JH 1S3OA 1X65A 2NN6I 3E9HA 5FJ8H 2VQEQ 2EXDA 1I3QH 2ZJPA 1PA6A 3B6YA 2OWOA 4YCWA 4KLKA 3CC7A 2HIXA 4R4OA 4YWLA 2UUCL 2ZTDA 1IBMQ 3RZDH 2CCZA 2JA5G 4A3CG 1TWHH 1Y1WG 4B3RL 1KQSA 1EOVA 4GKKQ 1L1OA 4JBJA 3K8AA 4GOPA 5M5WH 3KJOA 4DUYQ 1XNQL 1VQJA 1G6PA 3HOWH 2IX0A 2KENA 3J80c 1E1TA 1QZGA 1Y1VH 1D7QA 4DAMA 4B3SQ 4LF5Q 2A19A 4NXNL 3GTQH 2N78A 4A3IH 2BA1A 3CAMA 2R6GA 4JI4Q 1CSQA 5ELNA 2YU9H 4OX9Q 5AJ3L 1IBML 4QJFA 4IFDI 4NPSA 3CC2A 2JA7G 2VZAA 1NMGA 2K14A 2IT1A 3E0EA 3NELA 4A3MG 3M7NA 4JI5Q 2XTIA 3U4ZA 5C0XI 4POFA 1ASYA 2R92G 4IOAA 3GDEA 4X64Q 1JB7A 2HT1A 3H0GH 3WWVA 1IBKQ 3CCEA 3PUWA 4DR1Q 2LSSA 4A3LH 4ALPA 3CCJA 4DV2Q 4DR5L 4A3BH 4B3SL 1PYBA 5M3MH 1A0IA 3TS0A 3GTGH 4LF4Q 1FVIA 2NN6G 1OXXK 1H95A 1PV4A 4J15A 4JI4L 3M9BA 3KF6B 3HOXH 1HR0L 3CCLA 4JV5L 5JEAJ 1XNRQ 4C3HH 1GVPA 4IOCA 3S14H 2EIFA 4LF8L 1CSPA 3U4VA 3ERSX 1CUKA 4JOIA 4DV2L 1O7IA 2D0OA 2MFIA 1IZ6A 3FKIH 1X9NA 1PH8A 2JEAI 1L1OB 4B3MQ 4LF4L 4LFCL 5IP7G 3HOYH 2WAQE 3KLWA 4AYBG 4DKAC 1S72A 1E24A 3GD7A 1VQ9A 4JI7Q 3LGJA 4PZ7A 4JI6Q 4IFDG 1VQAA 4DV0L 1XNRL 4DV7L 3H0GG 4QQBX 1YJNA 4L5RC 1N9WA 2PQAA 1EFWA 5C0XG 1IBLQ 4OWWB 1L1OC 3NBHB 4A3BG 1B8AA 2UXDQ 5JJKA 4IPCA 4R4CA 4JI3Q 1JE5A 5M3FG 3GTPH 2A1AA 3K80C 1Z9FA 3PUZA 4B3ML 4P74A 1N32L 4DAYB 4R4QA 1HJPA 5LMNQ 5GAHC 3GTKH 1FL0A 1W3SA 1YEZA 3S24A 4DR2Q 1KIXA 2IHEA 1OXUA 1IYJB 4UP7A 4JI6L 2AHOB 1HZAA 3RZOH 4DR6L 1X6OA 4PG3A 2E5LL 1IBLL 1HNWQ 1TWAH 2Y0SE 1FJGL 4JI3L 3Q8DA 3F8TA 1EIFA 3PIOA 1E7ZA 2OTLA 2ZM6L 4NXMQ 1V9PA 1K3RA 2LXJA 1OXSC 1X3GA 4LW1A 3HKZG 1JJGA 4LWCA 4DR2L 4JI0Q 1G291 1WYDA 4QY7A 2B63H 1TWGH 2Z6KA 3OW2A 4A75A 4DV4L 2VQFL 5LMNW 1X3EA 2CFMA 3KOJA 4YHHQ 1VQIA 2K4KA 1GO3E 3TQYA 4A93G 4BBRG 1VQLA 1C7YA 4HJ7A 1SN8A 1Y14B 1U5KA 5IYBH 4Y7NH 1SLJA 4C3IH 4JOIC 3F2DA 1VQBA 3CPFA 2KCMA 3STBC 1W2BA 1K0RA 4A3CH 2JA5H 1KHIA 4P71A 4EX5A 3TREA 3CXCA 1Y1WH 3J7ZC 1NY4A 1Q46A 1PFSA 4AIMA 1VQEA 1XMOQ 1A63A 1CKOA 4A3FG 1JJCB 2JJQA 3I2ZA 4YHHL 2NZHA 4JBMA 3OTOL 1Q81C 2B29A 2VUMG 1SROA 4L5SA 2I5LX 2JE6I 2E2JH 2OCEA 1WCMG 4QGUA 2R93H 1UE6A 3BZCA 4DK3C 1Z47A 5JJIA 5K36G 1P8LA 5LMUQ 2K75A 1T9HA 2JA7H 1B70B 2ID0A 5GAEC 1X56A 1QUQA 1WI5A 1PH9A 3HFZB 1WFQA 4KI0A 4A3MH 1XMOL 1J5EL 4LF9Q 4HJ9A 1L2FA 3D31A 3CD6A 2R92H 5IYBG 5HGQA 3OYYA 5C44G 1TXYA 4BXXG 2GVBA 1SMXA 4ME3A 4X65Q 1I94Q 2K50A 4A3KG 1VQ4A 3NENA 4IFDJ 3IRBA 3K7AH 3J80i 4DV5Q 1K8GA 1Q7YC 1OXVA 2YV5A 1YITA 1KRTA 5C0XJ 4DR3Q 2Z6KC 4RG1A 3L7ZC 4JI2L 3BU2A 2YTVA 4FDBA 3J81i 2R7ZG 1UEBA 3CW2C 3CCQA 2VQEL 2R93G 3CMAA 4HJ5A 5IYCG 3J81c 2JA8G 4X65L 3GO5A 1KXLA 1I94L 5IP7H 5J3BA 1BBWA 5C3EG 5IYDG 3A5ZB 1NJIC 3TS2A 3U58A 1TWCH 3W5OA 4GKKL 1EQRA 4IPGA 1JT8A 1LM0A 3F2CA 3CCVA 4DUYL 1A8VA 2I5MX 4DR3L 1RIPA 4DV3Q 2XGTA 3ULLA 4A76A 4B3TQ 4LFAQ 1YNXA 2F52A 1N8RC 1VQOA 4HIDA 5M3FH 4IJLA 2JEBI 4A3EG 1Q1BA 4AYBE 1QUQB 4OX9L 3K81C 1U0LA 3H15A 1I50H 3E9IA 2IY5B 4DR4Q 3S15H 3GTMH 1Q1EA 1N33Q 1X55A 2GVAA 4JI5L 3PV0A 3TEHB 2MNAA 1YHBA 3KJPA 1YBYA 4X64L 2IX1A 3M4QA 1WJJA 2OQKA 1IBKL 3PF4A 2WB1G 4DR1L 1VQPA 5JJLA 4IPHA 1MIUA 4B3TL 4MNOA 1S40A 4GKJQ 1EYGA 1BBUA 2VS1A 2AMCB 2IHFA 2Z0SA 4O0AA 2K5HA 1ASZA 4DR4L 1N34Q 1KAWA 3CP0A 1VQ6A 2PNHA 1EIYB 1N33L 4X62Q 4DV1Q
chains in the Genus database with same CATH superfamily
4EQPA 3M3YH 4OO1I 2LKVA 2PZWA 3AFPA 1JWMD 1B50A 4PNYA 4TSSA 3T1YQ 2NVXH 3KLRA 4JG2A 2Z4HA 4KHZA 4ME5A 3MXNB 3W1BA 1VS0A 2NZOA 3ND8A 4X3UA 4C2MH 5KIXA 4DV1L 3M4OH 1EIHA 1H9KA 2K1BA 1AFPA 4A3FH 5EKIA 1XPUA 2M9VA 3P1HA 1PLFA 5IWAQ 1VQNA 3AEVA 3VR2A 2ENBA 1I50B 5LMNL 1D5ZC 1NTGA 1WCMH 4HSVA 1FGUA 3FPUB 5C4JH 3HRZC 1JQYD 2HHHL 3LX0A 2DN8A 4DR7L 4OO1G 3HOZH 5ELDA 1T5EA 2K5NA 3EN2A 1M90C 1AP0A 4NXML 2KCTA 1I4HA 2QA4A 5E4XA 4ZKCB 3ZJYC 4FXDA 4YCVA 1Y8OB 2ZXOA 3MHBA 1F77A 3C3LA 1JC7A 1TWFB 2X69A 1M4VA 4XQJA 4UP8A 4A93B 4GZYC 4WRDA 2ASBA 1V1PA 4DAVA 3QOJA 4GN4B 1O78A 2RCNA 4FF4A 1E2WA 1HXYD 4AH6A 2ALYB 3UDIA 2Q2IA 5IYDH 1PZJD 1EQVA 1Q8KA 4NMZA 5IE8A 3QB3A 3OIQA 2CVRA 2SEBD 1NBWA 2VY3A 2JA6B 5HURA 2C35B 1K8AC 2UUAQ 3KF8B 2JP1A 2A5HA 4BY1H 3MEFA 4RGNA 4A3EH 1S5BD 5KGUA 3SHLA 1WTRA 1QZHA 4XQQA 1J8IA 4B3RQ 3K5MA 3S1MH 3GTLB 2EJGC 1AEXA 3D6WA 3TP7A 5GQOA 1WTOA 3R93A 3J7YW 2RHQB 3CCRA 4P75A 4NB3A 4OL7A 3M85A 1RD9D 2AWOA 4DV5L 1ICWA 2JK8A 4K0KQ 1VQFA 2DUDA 3J7AV 1STAA 2NVYH 3CC4A 2R7ZB 2JYOA 2NVQB 3MXNA 2DGYA 4RGOS 1EY7A 4YCUA 4HMIA 4A3GG 2JA8B 4JYAL 5I6WA 5FOBB 2FMCA 4MTNA 4AQYQ 3R3OA 1BXTA 1A2UA 3K57A 1SMYC 3UE0A 2VB3X 3T4AC 2UXCQ 3KDFB 3VR3A 1ENCA 3JAMi 1PYSB 5C4XH 1VQKA 1FNWA 1CKNB 4JI8Q 3JAMc 3TDQA 4L6TB 4LFCQ 3QR8A 1HNXQ 3PO2B 4PZ8A 1JJ2A 4RWSC 1YIJA 3PUYA 4K5XA 1STEA 3J81j 3W3AA 1J9OA 1HR0W 2F4VQ 1KRSA 3HKZE 4DK6C 2B2UA 1DXMA 1IYVA 2EQSA 3BZDB 4UY8C 3PF5A 1N32Q 3NP8A 1VQDA 2F0NA 4GLXA 1PH3A 4F87A 4JI1Q 4DNTB 2IW3A 5E7NA 2JA6H 3MXUA 2A8VA 1NMFA 3HOUB 1KD1C 4X66L 1FJGQ 1QOHA 3T1YL 4BBSG 3GV6A 1V1QA 2NWGA 3A55A 3KF8A 1SMYD 5FKAC 3IL8A 2MO0A 4HIOA 4C3HG 1E22A 3EBEA 3C1FA 5EGTA 3UDFA 3TRZA 5IY0A 2L9HA 4DV4Q 2YTYA 3A56A 4CJ0B 1HQRD 1CZWA 2R7DA 2RF4A 1K73C 4HAEA 2GN5A 1HNZL 3S1QH 1VF7A 2F0EA 1PH2A 1VQMA 1C48A 1OTCA 3SR1A 1B2TA 1WTXA 2EYPA 2B2WA 4Z9CB 4K14A 1QVFA 1Q86C 5DEHA 4ZK9B 4UP9A 5IP9H 4PZ6A 2F3IA 2Q2UA 2E2HH 4UAIA 1HHVA 1PRTF 3GTJH 1XPRA 5COYA 3A0JA 1SE2A 4MZ9A 3PIO3 4GNXB 3GTKB 4X6AH 4A3DH 5FK9C 4BA1I 4I65A 4RAUC 3PO2H 4XTCS 1K8MA 1CHQD 4S3SA 4RFBA 1S3OA 4XYOA 3E9HA 4YIJA 2HD3A 5FJ8H 1SFOB 2OWOA 5C5MA 4KLKA 2HIXA 1IBMQ 4UHVA 5M5YB 4BY7B 4B3RL 1KQSA 3NWSA 3K8AA 3KJOA 1VQJA 1G6PA 3HOWH 4KY7A 1U4LA 1Y1VH 4DAMA 3AMUA 2A19A 2BA1A 1O7ZA 2PO4A 4JI4Q 2YU9H 4QJFA 3NELA 3M7NA 5C0XI 1ONLA 3GDEA 1JB7A 4RHRA 4A3GB 2FHTA 1WVLA 4DV2Q 3V05A 3ZYYX 5M3MH 3S16B 3U9OA 3KF6B 4FXGC 1LTBD 3CCLA 4ULLA 4BS9A 2BE5C 1TVXA 2F0OA 3SVMA 3S14H 1CSPA 1I3QB 2PCFB 4JOIA 1X9NA 3MA2B 2JEAI 4B3MQ 1SE4A 4LFCL 4DF7A 4AYBG 2AQ1B 4DKAC 1E24A 5KNCA 4JI7Q 4PZ7A 5M5WB 1XNRL 1BQQT 2RVLA 1N9WA 5JEAH 5C0XG 1IBLQ 5LHY1 1L1OC 1ZXTA 2UXDQ 4TRDA 1ILPA 1JE5A 1TY0A 3K0YA 2F0KA 2LS01 1Z7TA 1Z9FA 3EROA 2RKSA 5D3DA 1N32L 1K3BC 2OF1A 3GTKH 1W3SA 1HA5A 1IYJB 2QILA 3E3XA 1B3QA 1HZAA 2AHOB 2I46A 5CV4A 2EY6A 4X3KA 2V4DA 2Y0SE 3WDNA 1FJGL 3Q8DA 2KEEA 5M3FB 1E7ZA 1K3RA 1X3GA 4LWCA 4QY7A 3OSOA 1MSGA 5ELCA 4A75A 4DV4L 1SAPA 2CFMA 2F0HA 1S5CD 2K4KA 1TS5A 3TQYA 1C7YA 2EY5A 5IGGA 1D6EC 1FNUA 1SLJA 3Q23A 1SJED 2PYKA 3F2DA 1VQBA 1RDPD 2KCMA 1NAPA 1Q90A 4A3CH 1KHIA 4P71A 4EX5A 2A6ED 2PQEA 1Y1WH 3J7ZC 4F88A 1NY4A 1Q46A 1PFSA 4A3FG 1JJCB 4YHHL 3GTPB 3ND9A 1Q81C 2B29A 2M2LA 2GA4B 2E2JH 3QOLA 2OCEA 5I9OA 1WCMG 2NYZD 4QGUA 4KD4A 1UE6A 3MEHA 1MHWC 2K75A 5LL6X 1G6ZA 2ID0A 1PH9A 4N9TA 1WFQA 4HJ9A 1L2FA 1DOMA 3OYYA 1KLGD 4ME3A 3H94A 2AUKA 1PTOB 5CORA 2K50A 3NENA 1PFBA 3BU2A 2YTVA 3J81i 3CW2C 3CMAA 4HJ5A 1B9NA 3J81c 1KXLA 3I70A 2KVMA 4A3KB 1RTNA 3ERQA 5IYDG 3W5OA 2OEOA 4B9WA 3LWUA 1ESRA 1JT8A 2H1EA 2RCFA 3CCVA 3RUZA 4DV3Q 2XGTA 1I4XA 4A76A 4M1UB 2QF7A 3RD4A 2R93B 4HIDA 5M3FH 4IJLA 2JEBI 4A3EG 1Q1BA 4AYBE 2VB2X 3I8ZA 1HFNA 3H15A 2IY5B 3VYSA 1PZKD 2ZT9C 3Q0AA 1N33Q 4IZ8A 3PV0A 2MNAA 1UNSA 3KJPA 2HQEA 1YBYA 5JOBA 3BVGA 2K05A 3PF4A 1PMRA 2F0GA 3VR5A 1VQPA 4IPHA 1MIUA 3KK7A 1VF5C 4O42A 2IPKD 2IHFA 2CW0C 2SNMA 1HA6A 4QUFA 4DR4L 3JAME 4ZAIA 3BYTB 4DV1Q 1R9TB 5I2YA 2AQ2B 1TR5A 3L3OC 3RLNA 2MQHA 1X3QA 4BBRH 2HCCA 4GKJL 3GTOB 1DYQA 4QIWB 3H6MA 3RLFA 1ESFA 1TWCB 4JI7L 3RNUA 4LNQA 1N34L 1MKHA 2RSNA 2HHHQ 4X62L 1F9PA 3DWAA 4DR7Q 4GN3B 2J4XA 3KLSA 1EQQA 2UXDL 1JR0D 1EY4A 2F0DA 5C4XG 2VUMH 1D5MC 1KNAA 2AUJD 4HMJA 5IT9c 2JQOA 2CKZB 1SRUA 4LF6L 2O4XA 3VA5A 2CWPA 2WAQG 3TP6A 1EFID 1A3UA 2N55A 4OXPA 5F2DA 2B2VA 5CV6A 1E3PA 2LXKA 1F2YA 2CW0D 2D5DA 4XDXA 3S1NH 5ELOA 2D62A 3PIPA 4ODGA 2D9UA 4ZCKA 3UE1A 4A3KH 3M4PA 1YHQA 2XRQD 1JCKB 2MPMA 1AE2A 2JA6G 1KDCA 1IXRA 2TSSA 3LWEA 2EE1A 2N3SA 4K6LA 3I55A 2JA9A 3I72A 2YTXA 3L9AX 4P73A 4R4TA 1K8GA 1HFGA 1MJCA 1YZ6A 2HCIA 3TZUA 1YI2A 4C2MB 3M4OB 4RH6A 4KHPL 2H5XA 5FLXc 4J1MA 2I5HA 4IURA 1XJVA 5T1IA 2A69C 3FRPB 4ZQ3A 3CF5A 1WCMB 5C4JB 3CCSA 3PGZA 1JICA 1GD7A 3S17B 2CQOA 4R8IA 3RLOA 3T13A 1R9TH 3HOZB 2UUBL 1EUJA 1XNQQ 2RDFA 4ZUJA 4K6DA 4OIKA 4JYAQ 1CKMA 3NEMA 3HP3A 4NXNQ 3STBD 3GTOH 2RA4A 5IP9G 5CV9A 2VL6A 1V1PB 5E3FA 1I5FA 3BDLA 1RF2D 3G6JB 3I4MB 2O5JC 1I6HH 2F3VA 3I4OA 2BDOA 2XIWA 3BDOA 1MJEA 5CMDA 4DR5Q 1PH7A 1A62A 1DM0B 5M5XH 4A3DG 2WP8J 1UE7A 5H1SE 3PO2G 4Q0FA 2QEXA 4JV5Q 2HDLA 2PW7A 3CCUA 4L5QA 4DV3L 2PZUA 3SE0A 2KBNA 2QW7A 4TVAB 2A69D 3DM3A 4RMFA 4FO2A 4HJ8A 1V43A 1Q82C 4BY1B 2MHVA 3QIAA 5FJ8G 1EEID 4TKOB 1YNNC 3UDXA 3S2HH 2HDMA 2RBMA 1Q12A 3BJUA 5C4ZA 2ZJQA 1WTWA 4YWKA 4DXFA 3S1MB 2L11A 5BN4A 4UDUC 3HOWG 3BYYB 3HOUG 1Y1VG 2G9HD 4X66Q 1SJHD 3Q6SA 2N49A 4ZKBB 1KC8C 1SNCA 4GLAC 4A4IA 3EFXD 1YJ9A 2F0VA 1UE5A 4FXKC 4OWTB 5E1FA 2NVYB 3KBGA 3KYHC 4GS3A 1AN8A 1QVGA 4DR6Q 1C8CA 1A2TA 5GAGC 2E5LQ 4GN5A 5M3MG 3P20A 1GUWA 1B53A 1BO0A 4CBVA 4C56C 4JCVE 5DLQE 2KCNA 3WOEA 1HNZQ 2QCPX 1G8ZD 1UE1A 1WOCA 4C1NK 1F9RA 4WJWA 4L63B 3U50C 1STNA 3M4YA 2FJ2A 4DPGA 2VQFQ 3S17H 4WJ3M 1HZ9A 5C4XB 1ET6A 3CMEA 2F0QA 1O80A 1YNND 3H3VH 1PH1A 1HCZA 3KBXA 2J0TD 3HOXB 1PVOA 2X6GA 2WAQB 1M1KC 3HOVH 2N8NA 2E2DC 5CV7A 1LYLA 1SR3A 1E2ZA 5JEAG 4WFN3 5I2XA 3PUVA 3I4MH 1O7YA 2PI2E 1XTDA 2M00A 3FKIB 3ULJA 5FLMH 1LTSD 1QVCA 4KN4C 2MGSA 4OHJA 3PO3H 1DCZA 5IGCA 4JK1C 2O5IC 1HUMA 1BKBA 2K6AA 2B2YC 2OT2A 4BY7G 1FR3A 1H9RA 4PMWA 4OEMB 3OW7A 2QDBA 1XWEA 4R4IA 4LFBL 1FD7D 4PV1C 4GNXC 1FGBD 2MO1A 3OMGA 3NK9A 3DEOA 3V96A 1PA6A 2KOLA 2LY7A 2ZJPA 1F9QA 2UUCL 3S1QB 4R4OA 4YWLA 4A3CG 2ZTDA 3RZDH 5ISRA 1Y1WG 1BDOA 3IFTA 4JBJA 1HRJA 1XNQL 4EVOA 2KECA 2N88A 3J80c 4N9PA 4QB4A 5KYIA 1D7QA 4Y7NB 4NXNL 3GTQH 3CAMA 5JPMC 2F0UA 3DHQA 1CSQA 5ELNA 4KKUA 2E2HB 2IT1A 2K5DA 2XSCA 3GTJB 2WV6D 4DAYA 1CZGA 2XTIA 3MZ5A 4KHVA 4IOAA 3H0GH 4RGMA 2LSSA 3SDZA 3OIPA 4DR5L 4A3BH 4B3SL 1PYBA 3BDCA 3J81L 4A3DB 1QWYA 1OXXK 1H95A 1PV4A 1W6KA 3M9BA 3T56B 3HOXH 3C46A 4JV5L 1XNRQ 1GVPA 3A54A 3SK8A 5KEEA 1EY5A 2SOBA 5JJZA 3S9WA 3U4VA 1CUKA 1PH8A 1O7IA 3FKIH 1GUNA 2JSOA 3HOYH 3R8BA 4MIUA 5A2QL 1VQ9A 5EJWA 2SNSA 1SNMA 1II3A 3HOWB 1YJNA 4QQBX 4MN3A 4OWWB 1IW7C 1Y1VB 1ILQA 2K28A 3NBHB 4IPCA 4DK0A 5M3FG 5EBDA 2A1AA 3K80C 2YU9B 1S5FD 4P74A 4B08A 1HJPA 3I73A 1YEZA 2LFNA 3I91A 2L4NA 2IHEA 1OXUA 2F0MA 4UP7A 2E74C 5J22A 4CDEC 3RZOH 3MVVA 4DR6L 4PG3A 3K5OA 2K33A 2E5LL 1HNWQ 2AQ3B 5M3MB 1QNUA 4JI3L 1X32A 3PQIA 1D1IA 2B8FA 4DXGA 2CH4W 1OXSC 4LW1A 1S5ED 1JJGA 3SK4A 4JI0Q 3GTMB 3A7AB 2ICIA 1EOTA 2Z6KA 1LT3D 3S14B 5K36H 1H9JA 2VQFL 5LMNW 3KOJA 4YHHQ 3HS0C 4BBRG 4KJOA 1SN8A 1A15A 1S4ZA 1Y14B 2I07B 1E0BA 4Y7NH 5IT9L 4C3IH 3ITPA 3CPFA 1AZPA 1JOKA 1EIGA 3X3NA 3TREA 3CXCA 1A63A 3DWPA 1IW7D 1I4QA 1JE4A 2JJQA 2NZHA 3E0JA 4DFAA 2VUMG 4ZLTF 3CRLC 1GJXA 5BN3A 5CC4A 3K5LA 4RGTA 1STHA 4M8AA 4K8JA 1Z47A 5JJIA 1P8LA 1QE6A 4G57A 1B70B 2Q8IB 5GAEC 1QUQA 3HFZB 4KI0A 5IYBG 5HGQA 3TMEA 1G2TA 4DAPA 1BCPB 2NN6H 4A3KG 1XXGA 1VQ4A 4IFDJ 3IRBA 5FLXL 4RG1A 2EYOA 1TS3A 4R9WA 4FDBA 3FMCA 1PTOC 1UEBA 2K01A 2R93G 3NBHA 1FNVA 1I94L 1Y1WB 1BBWA 3IAYA 5DAUA 1EQRA 5KRUA 4FF1A 1STBA 1ZYRC 2I5MX 1RIPA 3BG3A 3ULLA 3EJIA 2E2JB 4LFAQ 3UI2A 1RKNA 3PMFA 5C6AA 3FPPA 3D4DA 3K81C 3VYUA 4DR4Q 4JW0A 1E2VA 3GTMH 3TEHB 3M4QA 2OQKA 2WB1G 2F0SA 4GKJQ 2K5WA 2VS1A 3DEPA 4NW2A 2DNCA 2Z0SA 1TQOA 2F0IA 1LTTD 2K5HA 1N34Q 2F0FA 4IQZA 3CP0A 2PNHA 1EIYB 4X62Q 1EL0A 1QILA 5G3LF 1CHPD 1PTOD 1YNJC 1PH6A 2MJ8A 1MGSA 2HQLA 3AYHB 4OO1H 3G6EA 4CJ2C 1XPOA 2DJFC 4LF6Q 1UAPA 4CKEA 5CBAE 4LF5L 1ZYRD 3MWYW 2KHIA 1VQGA 2EYMA 2A68C 2B2TC 2EDGA 4EQOA 1X3PA 3AQQA 3KFUA 3QJYA 1K8OA 4JVZA 2BE5D 1SSOA 2L15A 3G4SA 2UU9Q 1HNWL 4G7ZC 3BS1A 3OWEB 3L0OA 4BXXH 1D8LA 2NZ1D 1SE8A 1PHJA 1D5XC 2PMZB 2ATWA 2Z9HA 5IIFA 1HZBA 3VR4A 3GQBA 4JI0L 4RKLA 3FHWA 3I4NB 2EY1A 4KHPQ 2A74C 5KNDA 1IL8A 2FMMA 4IUQA 1EY0A 3RN5A 1C9OA 4RKBA 4BBRB 1N36L 4LF7Q 5IYCH 1EWIA 2QKIC 5BR8Q 1CQFA 3EIVA 1EWHA 1F2ZA 3TN2A 2RDGA 1EY8A 1AW7A 3HOZG 1LTLA 2A68D 2UUBQ 2NVTH 1VQCA 2VUMB 2ZTEA 3D3RA 4HCSA 2DNEA 5DNFA 4G4KA 2CQAA 2KHJA 4KD3A 1YJWA 3LNNA 1U4RA 3OMCA 5EPLA 4C1NI 4L8JA 4QUCA 4BWGB 2WFWA 1SXTA 3I7FA 1CM9A 1KLUD 3I4MG 1GUSA 4CHTB 5J39A 4HEDA 1Y8PB 1OXTA 3AFQA 3NXWA 3S1NB 5FLMG 4QL5A 3S1RH 3BZKA 3MXGA 2XWBB 4OWXB 1VQ5A 5AJ3Q 2F1MA 3PO3G 1CTMA 3A7LA 1F2MA 1LT4D 2WB1E 3W1GA 2ZXPA 4APVA 1PYWD 4QIWE 4BY1G 1X54A 3RR5A 2VNUD 1EZ8A 2EJFC 3K58A 1T5XD 2VW9A 3PUXA 2JN4A 4IUPA 4OGQC 1BR9A 2F4IA 3AB9A 1JMCA 1ENAA 1Q8IA 4CKBA 1HR0Q 4YY3L 4DGZA 3QO2A 2ICEC 4DU9A 1KL9A 4LFAL 1J6QA 3K7UC 3OOCA 4KV6A 5HY6A 3J80L 4LF8Q 1D1KA 4HIKA 1GXDC 1BBXC 3NTKA 4BBSH 3I4NH 4KTAA 4P2CB 2PPBC 1SYBA 2L0CA 4HJAA 5C5LA 4DV0Q 2WB1B 4LUZA 1P16A 1RL2A 2AWNA 5KYLA 1GKHA 2VXWA 5AFWA 1ML0D 1EU3A 3MFYA 4GOPB 2TMPA 3ER0A 2RDHA 2L55A 4KKTA 1DD2A 3I56A 1RODA 2KA7A 1I6HB 1K83H 2K52A 5EKKA 3S2DH 4EQ5A 1CFMA 5GADC 5EAYA 1LO5D 1I4RA 2QEJC 4H44C 4JPBW 5M5XB 5BN5A 2XWJB 2EJMA 3CPWA 2ZM6Q 1WTVA 4JC0A 3HOXG 2KEDA 4Y52H 3DLLA 4A3JH 2BH2A 2ES2A 2NBFA 3OHXC 4DV6L 4L5TA 3G71A 3TP5A 3FKIG 3RMHA 3S2HB 4OONA 3HOYG 5FO8B 1LLRD 4N8FA 3K0XA 1LTRD 1KNEA 1HQMC 2UU9L 4X3TA 1HZCA 1DOLA 3C1EA 1X3FA 4B9XA 4H13C 4TQUS 2AKWB 5G3LD 3OTOQ 2K7VA 5I4DA 4HCEA 2OTJA 2B2UC 4DUZL 4LAAA 2PQAB 1PRTB 3MTSA 4P72A 5GROA 3F2BA 2RQXA 1C4QA 1IKLA 3T53B 4LFBQ 3NTHA 3D8GA 1J5EQ 2FXQA 4LF7L 1R4QB 3CRKC 4FF3A 4IJHA 1K0SA 2WIIB 4DNIA 5BR8L 2UUCQ 3F2UA 3ONAB 5IGBA 1NUCA 4R8NA 2D0PA 2F3WA 1LUZA 2XN9C 3D4RA 4XIGS 3E6ZX 4I7AA 4J6HA 3KUPA 1SYCA 2HUGA 1RJTA 2Q2TA 2Z4IA 4JI2Q 2B3GA 4C3JH 4C3IG 2NN6I 2VQEQ 3B6YA 4K5WA 4HTHA 3KLSX 3HOVB 2CCZA 1TWHH 2Q8TA 1L1OA 4GOPA 4KY6A 2IX0A 1U9RA 1E1TA 1L0XB 4B3SQ 2N78A 3CKIB 4A3IH 2R6GA 5T1GA 5AJ3L 1WTPA 2B2WC 1G2SA 4NPSA 3CC2A 3PO3B 1NMGA 2K14A 3E0EA 4JI5Q 4Q5VA 1ZEQX 4POFA 3K5NA 2L12A 1O7LA 4QCLA 4X64Q 3NTIA 3CCEA 4FF2A 1OO9B 2IWHA 4DR1Q 4A3LH 3CCJA 1PXUA 3TS0A 1A0IA 1UEAB 1FVIA 2NN6G 4PMBA 2KHSA 1Y69U 1SYFA 1HR0L 4MTKA 5JVH3 4A3MB 5EPJA 4LF8L 2L1BA 3I4LA 3ERSX 2A73B 2D0OA 1IZ6A 2MFIA 4HN7A 3RZDB 4LF4L 1SYEA 1VMPA 2WAQE 3A8KE 3KLWA 4LK1C 1F2LA 4DNRB 1DONA 1GUGA 3LGJA 2IL8A 4DV0L 4L5RC 4IUUA 2PQAA 1B8AA 1V8QA 4R4CA 4JI3Q 3GTQB 5ELFA 1R4PB 4CKCA 4DAYB 5GAHC 1FL0A 3G7LA 4PQXA 4JI6L 1X6OA 3H0GB 5D14A 4CJ1B 2FINB 2XNAC 4A3BB 1TWAH 3F8TA 3DWQA 1EIFA 2RSOA 3NQIA 3PIOA 2OTLA 2ZM6L 4RA8A 3HKZG 4ID6A 4DR2L 1G291 1WYDA 2B63H 1TWGH 5KNBA 3OW2A 5L37A 1M8AA 1B1ZA 2EYFA 4ZUIA 4FNFA 2EOTA 1SEBD 4IUVA 1VQIA 5CV5A 4CDFC 2DY8A 2LMCB 2Q8RE 4CGYB 5ELEA 1TKWB 3P7JA 3T16A 5IGEA 4ZYSA 4HJ7A 1VQLA 1U5KA 4PMCA 2A6HC 3HOYB 2EVBA 1A6XA 4JOIC 5CV8A 1W2BA 1K0RA 2JA5H 2K03A 4N8X1 1H9MA 4AIMA 1VQEA 5M9OA 1TY2A 3OTOL 4L5SA 1LTGD 1DZ1A 5CGKA 1NR4A 3RZOB 4E6IA 5JPNC 5LMUQ 1T9HA 3VYTA 1CQVA 2P5ZX 2JA7H 1X56A 1J5EL 1WI5A 4LF9Q 1XMOL 4A3MH 3D31A 3CU7A 2MUYA 2R92H 3CD6A 2IX3A 1TXYA 4BXXG 1SMXA 1DOKA 3DUZA 3CHBD 2X6LA 1IKMA 4XXEA 1I94Q 1W6JA 1EEFD 4F8MA 1H9SA 2EYJA 1KTKA 3K7AH 1PTOF 3QWNA 3J80i 2XRSD 3R2IA 3PIP3 1OXVA 2KQ3A 1YITA 1KRTA 5C0XJ 1BCPC 4JI2L 4I7ZC 4RHSA 5C44B 1Y8NB 2A6HD 4KK7A 4K2KA 4C3IB 2VQEL 3CCQA 3VR6A 3MXPA 5IYCG 4X65L 3GO5A 5IP7H 3J81E 2EYLA 3NWTA 3A5ZB 4XT1B 3U58A 4IPGA 4IFDH 1A8VA 4DR3L 2ZXRA 1YNXA 2O2LD 3CQZB 1VQOA 1PFMA 1QUQB 1EYAA 4KN7C 1I50H 3E9IA 5C3EB 2GVAA 3C2PA 4JI5L 5A2QE 3VYRA 1HUNA 1GUTA 1YHBA 3SXHA 4X64L 4H0LC 1I4GA 4DR1L 5JJLA 4B3TL 3MFGA 4MNOA 1WTQA 1EYGA 1BBUA 1D2BA 2AMCB 4OIJA 4O0AA 3U9SA 1TT2A 1BF4A 1G91A 1KAWA 2CH4A 4LF5Q 4XYQA 1BCPD 1TWFH 2KCCA 2RHSB 4FP5D 2K5QA 4CDCC 4A93H 4XT3B 3O13A 4F7XA 5ELBA 1NSNS 3A74A 4O2DA 4NP5A 2WKDA 1IL2A 3IKJA 1UUPA 2V1CC 5IOCA 2QGQA 1KDAA 1XMQQ 4JBKA 1SNOA 5DM73 4KMUC 2K5VA 3SGIA 5CYUA 2D2CC 2UXBQ 1MD2D 5IT9E 1LABA 3I4NG 3HEJA 3ULPA 1N36Q 3GV3A 1WD0A 3D4WA 5C44H 3GTLH 5IWAL 3HKZB 1QB5D 1QJOA 3SK6A 3T1HQ 4POGA 4EGVA 3G48A 2PI2A 1XYIA 3NPPA 4UPAA 1I6VC 4V190 2R7ZH 1ICFB 1K9MC 2NVQH 2YYZA 3CQZH 1DGSA 2Y0SG 1EYDA 2Q2HA 2XVSA 2OQ0A 2JA8H 4A3JG 4WJ4A 2H4OA 2B39A 1B3AA 1CI3M 5C3EH 3OWFA 2BDNA 4IN3A 5FLXE 1B9MA 3TZDA 4H02A 4BA2I 1LV9A 4HSPA 3KDFA 3CCMA 1SNPA 1CA5A 5C3XA 1BVSA 4LUOA 1RCVD 1MSHA 1GM5A 5LMUL 3F1ZA 2PW5A 1CKNA 2I0QA 4LF9L 4NKLA 3X3MA 5IODA 4J8QA 5D3IB 3FP9A 4YWMA 2UUAL 2K04A 3DMUA 1VCIA 1NE3A 4IUNA 1QCBD 2B2VC 4K2LA 2HIVA 3HZXA 1GUOA 3DM1A 4YY3Q 3EA6A 5EPKA 1VMCA 1SDFA 2EXZA 5I6YA 3HOUH 1VDZA 2F0LA 4QMGA 4KJNA 2E75C 3UDGA 1EY6A 2NTTA 5EKLA 2BOSA 1SE3A 1VQ7A 4K0KL 2F0PA 2NVTB 1NR2A 1B44D 3PSIA 1CA6A 1GHJA 1XX8A 2ZJRA 1LTAD 4C3JG 1CK1A 3SEBA 2R61A 2SDFA 3BVMA 4IO9A 1PH5A 1VQ8A 2K32A 4AQYL 4FYDA 1RTOA 3MAQA 4DK1A 1YVCA 2E2IB 3HGBA 3W2DA 2UXCL 2BA0A 3M7GA 2Z8LA 4DV7Q 2PMZE 3HKSA 3S1RB 1WTHA 4A3IG 1A3TA 4JI8L 1LTID 2EZVA 1HNXL 3K59A 1I4PA 2WINB 4R1JA 3URYA 1C0AA 3NSWA 3JC66 1EWCA 4DV6Q 1JWUD 2A6EC 1NNXA 3A5UA 4A3LG 1TS4A 2F4VL 4GOPC 2NB0A 2B2YA 1HTLD 1HTPA 3FVQA 3D0FA 4FVMA 1L0WA 1SNDA 2BH8A 3PCOB 1ENFA 1XMQL 3ICEA 2MP1A 4JI1L 4GNXA 1G51A 3VDYA 1AH9A 3H3VI 1YHAA 3SK5A 3DXJC 4ABNA 2E8GA 1HH2P 3GTGB 2UXBL 4BBSB 5TSSA 4DUZQ 4GLVB 4LUVA 1SFOH 2R7FA 4HIMA 2F0JA 4IPDA 5I9PA 4C3HB 2B8GA 1AE3A 1YNJD 5M5YH 4BY7H 4K8IA 5FO7B 3J7A5 1PZID 3Q22A 2ZTCA 3T1HL 1PH4A 2KJXA 1K83B 1U4MA 1GOZA 4JBWA 3S2DB 2KUMA 4X3SA 1B7YB 3NE5B 1VQHA 1EZ6A 2Z1CA 3IFDA 2CWAA 1UWVA 2Y0SB 1U4PA 4A3GH 1PRTC 4A3JB 4KY5A 3MC0B 4U68A 3TBIB 3HOVG 1STYA 2B63G 3S16H 1E1OA 2Z6BA 3RN2A 1RHPA 3L2PA 1WD1A 1ZKOA 2E2IH 3OPOA 3KF6A 4O1NA 5D65A 1Z6HA 5A35A 1LT6D 1SNQA 3TP8A 1X65A 2EXDA 1F9SA 1I3QH 4ZRZA 4YCWA 3CC7A 2JA5G 2G5DA 1TU2B 3H3VC 1EOVA 4GKKQ 5IGFA 5M5WH 1AZQA 4DUYQ 2KENA 1QZGA 3T51B 3I3CA 1MBYA 3J80E 4OX9Q 1IBML 4IFDI 2JA7G 2VZAA 3I90A 4A3MG 2F0TA 3U4ZA 4XQNA 1ASYA 2R92G 5FO9B 2HT1A 3WWVA 1IBKQ 1V1OA 3PUWA 4ALPA 5C4HA 1PRTD 3P75A 3QG1A 1LT5D 3GTGH 2F03A 4LF4Q 4J15A 2EYHA 4JI4L 1EQTA 4V0BA 3FDTA 5JEAJ 4C3HH 2PZTA 4C3JB 1KAAA 3VA7A 4IUTA 4IOCA 2EIFA 2FFKB 5EBCA 4DV2L 1L1OB 5IP7G 1TWHB 5J1ZA 1TS2A 1S72A 3GD7A 4JI6Q 4IFDG 1VQAA 3N6RA 3H0GG 4HR7B 4DV7L 1MI2A 1EFWA 5JJKA 4H7BA 4A3BG 2JXMB 4A3IB 3GTPH 2NTSA 4RCNA 5DM63 1QG7A 3PUZA 2C5CA 4B3ML 1JORA 4R4QA 2CHBD 3JAML 5LMNQ 3S24A 4DR2Q 1KIXA 4AYBB 4LJZC 4U673 1BNZA 2DJGC 4CDDC 5JAVA 1IHZA 5CR3A 1IBLL 5E4WC 2WACA 1ET9A 4NXMQ 1V9PA 2LXJA 3D6CA 1XTCD 3S15B 2E76C 4ILWA 1PTOH 1SBBB 3EVQA 1SYGA 3V2TA 1X3EA 3A8IE 1HPCA 1JB3A 1GO3E 4A93G 1BOSA 3NUCA 1Q3LA 4DN4M 4OELB 5IYBH 1S5DD 1JOQA 4WORA 3STBC 4IALA 2IJ0A 4MHEA 2J7ZA 3M3YB 1XMOQ 1CKOA 3I2ZA 1EU4A 4JBMA 1NCVA 3E5SA 1SROA 4EQNA 2I5LX 2JE6I 4NDXA 4G7HC 2DY7A 2C9OA 2NVXB 5LL6S 2R93H 5CBEE 1K28A 1L0YB 3BZCA 3GP7A 4DA2A 4DK3C 3BVZA 5K36G 2F0WA 4KKSA 2QDLA 1B4OA 1TWAB 1GHKA 4A3FB 5C44G 1BUVT 1STGA 2GVBA 4K5VA 4X65Q 2NUCA 2B63B 1BCPF 1TWGB 3FEWX 3NBIA 3NHHA 3Q24A 4DV5Q 1KDBA 4LMQD 1IYUA 1Q7YC 3NQTA 2YV5A 4DR3Q 2Z6KC 3L7ZC 2G9DA 1PFNA 2R7ZG 2BCOA 3AU7A 4G7OC 2JA8G 5HGTA 3H91A 3J7AF 2JA5B 5J3BA 3N52A 3TSSA 5C3EG 1NJIC 5EQ0A 5C3WA 3TS2A 4GKKL 1TWCH 3WOFA 1LM0A 2B2TA 3F2CA 4DUYL 1CT1D 1PDQA 1QNKA 5C0XH 4B3TQ 2F52A 1N8RC 2OXPA 2PNRC 5NUCA 2EY2A 1A3VA 4OX9L 1U0LA 1EY9A 5K5PA 2JA7B 1TIID 4QF4A 3S15H 1JOOA 1Q1EA 1X55A 2WKCA 1SYDA 5JVG3 2R92B 1KABA 2L5TA 2IX1A 1WJJA 1JWSD 1IBKL 2EPBA 1DJRD 3EQLC 1S40A 1H9SB 3H09A 3K6OA 3R2TA 4A3EB 2R3ZA 3K7AB 1FYCA 1LACA 4RCOA 1ASZA 1EYCA 5IGDA 1VQ6A 3A8JE 1N33L 3HG9A
chains in the Genus database with same CATH topology
1TWFH 2RHSB 3M3YH 4OO1I 3RLNA 3AFPA 1PH6A 4A93H 2MQHA 4BBRH 4GKJL 2HQLA 3AYHB 3T1YQ 3G6EA 1XPOA 2NVXH 3A74A 4JG2A 4O2DA 3RLFA 4JI7L 4LF6Q 3RNUA 1IL2A 4KHZA 4LNQA 2V1CC 1N34L 1MKHA 3MXNB 3W1BA 1VS0A 2HHHQ 2NZOA 4C2MH 2QGQA 4X62L 4DV1L 1XMQQ 2KHIA 4JBKA 4GN3B 4LF5L 3M4OH 1VQGA 4BXXH 4DR7Q 1EQQA 2UXDL 2K5VA 3SGIA 4A3FH 1XPUA 5C4XG 3AQQA 2VUMH 5IWAQ 1VQNA 3AEVA 3KFUA 2UXBQ 5LMNL 5IT9c 2JQOA 1NTGA 2CKZB 1WCMH 1FGUA 1SRUA 5C4JH 4LF6L 3I4NG 2CWPA 2HHHL 2WAQG 2L15A 4A3LG 3G4SA 2UU9Q 3ULPA 4DR7L 1HNWL 1N36Q 4OXPA 4OO1G 3HOZH 2K5NA 3L0OA 5C44H 3EN2A 1M90C 1D8LA 4NXML 5IWAL 1SE8A 1E3PA 2KCTA 2LXKA 1PHJA 3GTLH 2QA4A 2ATWA 3T1HQ 3ZJYC 3S1NH 5ELOA 1HZBA 4JI0L 2D62A 4YCVA 3PIPA 3UE1A 4POGA 3FHWA 4A3KH 3G48A 2PI2A 4KHPQ 3M4PA 1YHQA 1AH9A 3RN5A 1AE2A 4UPAA 2JA6G 4UP8A 1C9OA 1N36L 1IXRA 2ASBA 4LF7Q 2R7ZH 4GN4B 2N3SA 1K9MC 2NVQH 2YYZA 2RCNA 3CQZH 3I55A 1DGSA 2JA9A 2Y0SG 2YTXA 4P73A 4R4TA 2Q2HA 1MJCA 1EWIA 2OQ0A 1YZ6A 4AH6A 5IYCH 5BR8Q 4A3JG 1YI2A 4WJ4A 2ALYB 3EIVA 3UDIA 2Q2IA 4KHPL 5C3EH 5IYDH 1Q8KA 5IE8A 2H5XA 5FLXc 3HOZG 1LTLA 1NBWA 2UUBQ 2VY3A 2I5HA 2C35B 1VQCA 1XJVA 2NVTH 2ZTEA 1K8AC 4H02A 2UUAQ 3CF5A 3KF8B 4BA2I 3KDFA 3CCMA 3CCSA 4BY1H 3MEFA 2KHJA 1BVSA 3PGZA 4LUOA 4A3EH 1GD7A 1YJWA 1GM5A 5LMUL 2JA8H 3F1ZA 1QZHA 2WFWA 3I7FA 1CKNA 2CQOA 2I0QA 4LF9L 4B3RQ 3RLOA 1R9TH 3I4MG 2UUBL 1EUJA 3S1MH 3FP9A 4YWMA 1XNQQ 5GQOA 3AFQA 1OXTA 2UUAL 1VCIA 4JYAQ 1NE3A 1CKMA 3NEMA 5FLMG 4QL5A 2RHQB 3STBD 3S1RH 3CCRA 3BZKA 4NXNQ 3GTOH 4P75A 5IP9G 4NB3A 4OWXB 2HIVA 1VQ5A 2VL6A 3M85A 2AWOA 5AJ3Q 4DV5L 2JK8A 4K0KQ 1VQFA 4YY3Q 3PO3G 1I5FA 2DUDA 2NVYH 2WB1E 3CC4A 3W1GA 1I6HH 4APVA 2DGYA 3I4OA 4QIWE 4YCUA 1X54A 4BY1G 3RR5A 4A3GG 2VNUD 1MJEA 3HOUH 4DR5Q 1PH7A 4JYAL 1A62A 2VW9A 3PUXA 5M5XH 3UDGA 2WP8J 4A3DG 4MTNA 1JMCA 3TRZA 4AQYQ 1UE7A 5H1SE 3PO2G 1VQ7A 4K0KL 3UE0A 2QEXA 1HR0Q 4JV5Q 4YY3L 3CCUA 4L5QA 4DV3L 3KDFB 2UXCQ 3PSIA 2ZJRA 2KBNA 1KL9A 4TVAB 4LFAL 3DM3A 1J6QA 4RMFA 3K7UC 1V43A 5HY6A 3JAMi 4HJ8A 1Q82C 4HIKA 4LF8Q 1PYSB 5FJ8G 5C4XH 4IO9A 1PH5A 1VQKA 1CKNB 4JI8Q 3JAMc 1VQ8A 3UDXA 3S2HH 4BBSH 4LFCQ 4AQYL 3BJUA 1Q12A 1HNXQ 2ZJQA 4PZ8A 1JJ2A 3I4NH 1YVCA 4YWKA 4HJAA 1YIJA 3PUYA 2BA0A 2UXCL 4DV0Q 3J81j 4DV7Q 3HOWG 4LUZA 1P16A 1RL2A 3HOUG 1Y1VG 1HR0W 4X66Q 2F4VQ 1KRSA 2PMZE 3HKSA 3HKZE 4DK6C 2AWNA 2N49A 1GKHA 4A3IG 1KC8C 4GLAC 4A4IA 4JI8L 2EQSA 1YJ9A 1UE5A 3PF5A 4UY8C 4GOPB 1N32Q 4OWTB 3ER0A 1VQDA 1HNXL 4R1JA 1PH3A 4GLXA 3I56A 3KYHC 4GS3A 1C0AA 4JI1Q 1K83H 3JC66 2K52A 1QVGA 4DR6Q 4DV6Q 3S2DH 4EQ5A 5GAGC 5E7NA 5GADC 3A5UA 5EAYA 2E5LQ 1NMFA 2A8VA 4GN5A 2JA6H 1KD1C 4X66L 4GOPC 1FJGQ 5M3MG 2F4VL 3T1YL 4BBSG 3CPWA 2ZM6Q 3D0FA 4JCVE 5DLQE 1V1QA 4JC0A 3HOXG 1L0WA 1HNZQ 4Y52H 3DLLA 1UE1A 1WOCA 4A3JH 2BH8A 2BH2A 2MO0A 3PCOB 4HIOA 1XMQL 1E22A 3EBEA 3UDFA 2ES2A 3ICEA 4JI1L 4GNXA 1G51A 3U50C 4DPGA 5IY0A 3VDYA 3S17H 4DV4Q 2VQFQ 4L5TA 2YTYA 4DV6L 1YHAA 3H3VI 4WJ3M 1HZ9A 2E8GA 1HH2P 3G71A 3CMEA 3FKIG 3H3VH 2UXBL 1PH1A 4OONA 2R7DA 3HOYG 2RF4A 4DUZQ 4GLVB 1K73C 4LUVA 3K0XA 1SFOH 1PVOA 2GN5A 1HNZL 2R7FA 4HIMA 1M1KC 3S1QH 4IPDA 3HOVH 2UU9L 2N8NA 1PH2A 1AE3A 1HZCA 1LYLA 1SR3A 5M5YH 5JEAG 1VQMA 4BY7H 1X3FA 1OTCA 3I4MH 3PUVA 4TQUS 2PI2E 2AKWB 1XTDA 3OTOQ 3J7A5 2ZTCA 3T1HL 2OTJA 3ULJA 1PH4A 1QVFA 1Q86C 5FLMH 4DUZL 1QVCA 5IP9H 4UP9A 2PQAB 4PZ6A 3F2BA 4P72A 5GROA 4JBWA 2F3IA 2Q2UA 2E2HH 3PO3H 4LFBQ 1J5EQ 1B7YB 3GTJH 2FXQA 1VQHA 1XPRA 4LF7L 3A0JA 2CWAA 1UWVA 4IJHA 4A3GH 4MZ9A 4DNIA 4GNXB 5BR8L 2UUCQ 4X6AH 1BKBA 3HOVG 4BA1I 2B63G 4A3DH 3S16H 2D0PA 4BY7G 1E1OA 3PO2H 4XTCS 1LUZA 4XIGS 4PMWA 3RN2A 3L2PA 2E2IH 4R4IA 4LFBL 3KF6A 4GNXC 4JI2Q 2MO1A 2Q2TA 2B3GA 4C3JH 1S3OA 1X65A 2NN6I 3E9HA 5FJ8H 2VQEQ 2EXDA 1I3QH 2ZJPA 1PA6A 3B6YA 2OWOA 4YCWA 4KLKA 3CC7A 2HIXA 4R4OA 4YWLA 2UUCL 2ZTDA 1IBMQ 3RZDH 2CCZA 2JA5G 4A3CG 1TWHH 1Y1WG 4B3RL 1KQSA 1EOVA 4GKKQ 1L1OA 4JBJA 3K8AA 4GOPA 5M5WH 3KJOA 4DUYQ 1XNQL 1VQJA 1G6PA 3HOWH 2IX0A 2KENA 3J80c 1E1TA 1QZGA 1Y1VH 1D7QA 4DAMA 4B3SQ 4LF5Q 2A19A 4NXNL 3GTQH 2N78A 4A3IH 2BA1A 3CAMA 2R6GA 4JI4Q 1CSQA 5ELNA 2YU9H 4OX9Q 5AJ3L 1IBML 4QJFA 4IFDI 4NPSA 3CC2A 2JA7G 2VZAA 1NMGA 2K14A 2IT1A 3E0EA 3NELA 4A3MG 3M7NA 4JI5Q 2XTIA 3U4ZA 5C0XI 4POFA 1ASYA 2R92G 4IOAA 3GDEA 4X64Q 1JB7A 2HT1A 3H0GH 3WWVA 1IBKQ 3CCEA 3PUWA 4DR1Q 2LSSA 4A3LH 4ALPA 3CCJA 4DV2Q 4DR5L 4A3BH 4B3SL 1PYBA 5M3MH 1A0IA 3TS0A 3GTGH 4LF4Q 1FVIA 2NN6G 1OXXK 1H95A 1PV4A 4J15A 4JI4L 3M9BA 3KF6B 3HOXH 1HR0L 3CCLA 4JV5L 5JEAJ 1XNRQ 4C3HH 1GVPA 4IOCA 3S14H 2EIFA 4LF8L 1CSPA 3U4VA 3ERSX 1CUKA 4JOIA 4DV2L 1O7IA 2D0OA 2MFIA 1IZ6A 3FKIH 1X9NA 1PH8A 2JEAI 1L1OB 4B3MQ 4LF4L 4LFCL 5IP7G 3HOYH 2WAQE 3KLWA 4AYBG 4DKAC 1S72A 1E24A 3GD7A 1VQ9A 4JI7Q 3LGJA 4PZ7A 4JI6Q 4IFDG 1VQAA 4DV0L 1XNRL 4DV7L 3H0GG 4QQBX 1YJNA 4L5RC 1N9WA 2PQAA 1EFWA 5C0XG 1IBLQ 4OWWB 1L1OC 3NBHB 4A3BG 1B8AA 2UXDQ 5JJKA 4IPCA 4R4CA 4JI3Q 1JE5A 5M3FG 3GTPH 2A1AA 3K80C 1Z9FA 3PUZA 4B3ML 4P74A 1N32L 4DAYB 4R4QA 1HJPA 5LMNQ 5GAHC 3GTKH 1FL0A 1W3SA 1YEZA 3S24A 4DR2Q 1KIXA 2IHEA 1OXUA 1IYJB 4UP7A 4JI6L 2AHOB 1HZAA 3RZOH 4DR6L 1X6OA 4PG3A 2E5LL 1IBLL 1HNWQ 1TWAH 2Y0SE 1FJGL 4JI3L 3Q8DA 3F8TA 1EIFA 3PIOA 1E7ZA 2OTLA 2ZM6L 4NXMQ 1V9PA 1K3RA 2LXJA 1OXSC 1X3GA 4LW1A 3HKZG 1JJGA 4LWCA 4DR2L 4JI0Q 1G291 1WYDA 4QY7A 2B63H 1TWGH 2Z6KA 3OW2A 4A75A 4DV4L 2VQFL 5LMNW 1X3EA 2CFMA 3KOJA 4YHHQ 1VQIA 2K4KA 1GO3E 3TQYA 4A93G 4BBRG 1VQLA 1C7YA 4HJ7A 1SN8A 1Y14B 1U5KA 5IYBH 4Y7NH 1SLJA 4C3IH 4JOIC 3F2DA 1VQBA 3CPFA 2KCMA 3STBC 1W2BA 1K0RA 4A3CH 2JA5H 1KHIA 4P71A 4EX5A 3TREA 3CXCA 1Y1WH 3J7ZC 1NY4A 1Q46A 1PFSA 4AIMA 1VQEA 1XMOQ 1A63A 1CKOA 4A3FG 1JJCB 2JJQA 3I2ZA 4YHHL 2NZHA 4JBMA 3OTOL 1Q81C 2B29A 2VUMG 1SROA 4L5SA 2I5LX 2JE6I 2E2JH 2OCEA 1WCMG 4QGUA 2R93H 1UE6A 3BZCA 4DK3C 1Z47A 5JJIA 5K36G 1P8LA 5LMUQ 2K75A 1T9HA 2JA7H 1B70B 2ID0A 5GAEC 1X56A 1QUQA 1WI5A 1PH9A 3HFZB 1WFQA 4KI0A 4A3MH 1XMOL 1J5EL 4LF9Q 4HJ9A 1L2FA 3D31A 3CD6A 2R92H 5IYBG 5HGQA 3OYYA 5C44G 1TXYA 4BXXG 2GVBA 1SMXA 4ME3A 4X65Q 1I94Q 2K50A 4A3KG 1VQ4A 3NENA 4IFDJ 3IRBA 3K7AH 3J80i 4DV5Q 1K8GA 1Q7YC 1OXVA 2YV5A 1YITA 1KRTA 5C0XJ 4DR3Q 2Z6KC 4RG1A 3L7ZC 4JI2L 3BU2A 2YTVA 4FDBA 3J81i 2R7ZG 1UEBA 3CW2C 3CCQA 2VQEL 2R93G 3CMAA 4HJ5A 5IYCG 3J81c 2JA8G 4X65L 3GO5A 1KXLA 1I94L 5IP7H 5J3BA 1BBWA 5C3EG 5IYDG 3A5ZB 1NJIC 3TS2A 3U58A 1TWCH 3W5OA 4GKKL 1EQRA 4IPGA 1JT8A 1LM0A 3F2CA 3CCVA 4DUYL 1A8VA 2I5MX 4DR3L 1RIPA 4DV3Q 2XGTA 3ULLA 4A76A 4B3TQ 4LFAQ 1YNXA 2F52A 1N8RC 1VQOA 4HIDA 5M3FH 4IJLA 2JEBI 4A3EG 1Q1BA 4AYBE 1QUQB 4OX9L 3K81C 1U0LA 3H15A 1I50H 3E9IA 2IY5B 4DR4Q 3S15H 3GTMH 1Q1EA 1N33Q 1X55A 2GVAA 4JI5L 3PV0A 3TEHB 2MNAA 1YHBA 3KJPA 1YBYA 4X64L 2IX1A 3M4QA 1WJJA 2OQKA 1IBKL 3PF4A 2WB1G 4DR1L 1VQPA 5JJLA 4IPHA 1MIUA 4B3TL 4MNOA 1S40A 4GKJQ 1EYGA 1BBUA 2VS1A 2AMCB 2IHFA 2Z0SA 4O0AA 2K5HA 1ASZA 4DR4L 1N34Q 1KAWA 3CP0A 1VQ6A 2PNHA 1EIYB 1N33L 4X62Q 4DV1Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWF H;  2RHS B;  3M3Y H;  4OO1 I;  3RLN A;  3AFP A;  1PH6 A;  4A93 H;  2MQH A;  4BBR H;  4GKJ L;  2HQL A;  3AYH B;  3T1Y Q;  3G6E A;  1XPO A;  2NVX H;  3A74 A;  4JG2 A;  4O2D A;  3RLF A;  4JI7 L;  4LF6 Q;  3RNU A;  1IL2 A;  4KHZ A;  4LNQ A;  2V1C C;  1N34 L;  1MKH A;  3MXN B;  3W1B A;  1VS0 A;  2HHH Q;  2NZO A;  4C2M H;  2QGQ A;  4X62 L;  4DV1 L;  1XMQ Q;  2KHI A;  4JBK A;  4GN3 B;  4LF5 L;  3M4O H;  1VQG A;  4BXX H;  4DR7 Q;  1EQQ A;  2UXD L;  2K5V A;  3SGI A;  4A3F H;  1XPU A;  5C4X G;  3AQQ A;  2VUM H;  5IWA Q;  1VQN A;  3AEV A;  3KFU A;  2UXB Q;  5LMN L;  5IT9 c;  2JQO A;  1NTG A;  2CKZ B;  1WCM H;  1FGU A;  1SRU A;  5C4J H;  4LF6 L;  3I4N G;  2CWP A;  2HHH L;  2WAQ G;  2L15 A;  4A3L G;  3G4S A;  2UU9 Q;  3ULP A;  4DR7 L;  1HNW L;  1N36 Q;  4OXP A;  4OO1 G;  3HOZ H;  2K5N A;  3L0O A;  5C44 H;  3EN2 A;  1M90 C;  1D8L A;  4NXM L;  5IWA L;  1SE8 A;  1E3P A;  2KCT A;  2LXK A;  1PHJ A;  3GTL H;  2QA4 A;  2ATW A;  3T1H Q;  3ZJY C;  3S1N H;  5ELO A;  1HZB A;  4JI0 L;  2D62 A;  4YCV A;  3PIP A;  3UE1 A;  4POG A;  3FHW A;  4A3K H;  3G48 A;  2PI2 A;  4KHP Q;  3M4P A;  1YHQ A;  1AH9 A;  3RN5 A;  1AE2 A;  4UPA A;  2JA6 G;  4UP8 A;  1C9O A;  1N36 L;  1IXR A;  2ASB A;  4LF7 Q;  2R7Z H;  4GN4 B;  2N3S A;  1K9M C;  2NVQ H;  2YYZ A;  2RCN A;  3CQZ H;  3I55 A;  1DGS A;  2JA9 A;  2Y0S G;  2YTX A;  4P73 A;  4R4T A;  2Q2H A;  1MJC A;  1EWI A;  2OQ0 A;  1YZ6 A;  4AH6 A;  5IYC H;  5BR8 Q;  4A3J G;  1YI2 A;  4WJ4 A;  2ALY B;  3EIV A;  3UDI A;  2Q2I A;  4KHP L;  5C3E H;  5IYD H;  1Q8K A;  5IE8 A;  2H5X A;  5FLX c;  3HOZ G;  1LTL A;  1NBW A;  2UUB Q;  2VY3 A;  2I5H A;  2C35 B;  1VQC A;  1XJV A;  2NVT H;  2ZTE A;  1K8A C;  4H02 A;  2UUA Q;  3CF5 A;  3KF8 B;  4BA2 I;  3KDF A;  3CCM A;  3CCS A;  4BY1 H;  3MEF A;  2KHJ A;  1BVS A;  3PGZ A;  4LUO A;  4A3E H;  1GD7 A;  1YJW A;  1GM5 A;  5LMU L;  2JA8 H;  3F1Z A;  1QZH A;  2WFW A;  3I7F A;  1CKN A;  2CQO A;  2I0Q A;  4LF9 L;  4B3R Q;  3RLO A;  1R9T H;  3I4M G;  2UUB L;  1EUJ A;  3S1M H;  3FP9 A;  4YWM A;  1XNQ Q;  5GQO A;  3AFQ A;  1OXT A;  2UUA L;  1VCI A;  4JYA Q;  1NE3 A;  1CKM A;  3NEM A;  5FLM G;  4QL5 A;  2RHQ B;  3STB D;  3S1R H;  3CCR A;  3BZK A;  4NXN Q;  3GTO H;  4P75 A;  5IP9 G;  4NB3 A;  4OWX B;  2HIV A;  1VQ5 A;  2VL6 A;  3M85 A;  2AWO A;  5AJ3 Q;  4DV5 L;  2JK8 A;  4K0K Q;  1VQF A;  4YY3 Q;  3PO3 G;  1I5F A;  2DUD A;  2NVY H;  2WB1 E;  3CC4 A;  3W1G A;  1I6H H;  4APV A;  2DGY A;  3I4O A;  4QIW E;  4YCU A;  1X54 A;  4BY1 G;  3RR5 A;  4A3G G;  2VNU D;  1MJE A;  3HOU H;  4DR5 Q;  1PH7 A;  4JYA L;  1A62 A;  2VW9 A;  3PUX A;  5M5X H;  3UDG A;  2WP8 J;  4A3D G;  4MTN A;  1JMC A;  3TRZ A;  4AQY Q;  1UE7 A;  5H1S E;  3PO2 G;  1VQ7 A;  4K0K L;  3UE0 A;  2QEX A;  1HR0 Q;  4JV5 Q;  4YY3 L;  3CCU A;  4L5Q A;  4DV3 L;  3KDF B;  2UXC Q;  3PSI A;  2ZJR A;  2KBN A;  1KL9 A;  4TVA B;  4LFA L;  3DM3 A;  1J6Q A;  4RMF A;  3K7U C;  1V43 A;  5HY6 A;  3JAM i;  4HJ8 A;  1Q82 C;  4HIK A;  4LF8 Q;  1PYS B;  5FJ8 G;  5C4X H;  4IO9 A;  1PH5 A;  1VQK A;  1CKN B;  4JI8 Q;  3JAM c;  1VQ8 A;  3UDX A;  3S2H H;  4BBS H;  4LFC Q;  4AQY L;  3BJU A;  1Q12 A;  1HNX Q;  2ZJQ A;  4PZ8 A;  1JJ2 A;  3I4N H;  1YVC A;  4YWK A;  4HJA A;  1YIJ A;  3PUY A;  2BA0 A;  2UXC L;  4DV0 Q;  3J81 j;  4DV7 Q;  3HOW G;  4LUZ A;  1P16 A;  1RL2 A;  3HOU G;  1Y1V G;  1HR0 W;  4X66 Q;  2F4V Q;  1KRS A;  2PMZ E;  3HKS A;  3HKZ E;  4DK6 C;  2AWN A;  2N49 A;  1GKH A;  4A3I G;  1KC8 C;  4GLA C;  4A4I A;  4JI8 L;  2EQS A;  1YJ9 A;  1UE5 A;  3PF5 A;  4UY8 C;  4GOP B;  1N32 Q;  4OWT B;  3ER0 A;  1VQD A;  1HNX L;  4R1J A;  1PH3 A;  4GLX A;  3I56 A;  3KYH C;  4GS3 A;  1C0A A;  4JI1 Q;  1K83 H;  3JC6 6;  2K52 A;  1QVG A;  4DR6 Q;  4DV6 Q;  3S2D H;  4EQ5 A;  5GAG C;  5E7N A;  5GAD C;  3A5U A;  5EAY A;  2E5L Q;  1NMF A;  2A8V A;  4GN5 A;  2JA6 H;  1KD1 C;  4X66 L;  4GOP C;  1FJG Q;  5M3M G;  2F4V L;  3T1Y L;  4BBS G;  3CPW A;  2ZM6 Q;  3D0F A;  4JCV E;  5DLQ E;  1V1Q A;  4JC0 A;  3HOX G;  1L0W A;  1HNZ Q;  4Y52 H;  3DLL A;  1UE1 A;  1WOC A;  4A3J H;  2BH8 A;  2BH2 A;  2MO0 A;  3PCO B;  4HIO A;  1XMQ L;  1E22 A;  3EBE A;  3UDF A;  2ES2 A;  3ICE A;  4JI1 L;  4GNX A;  1G51 A;  3U50 C;  4DPG A;  5IY0 A;  3VDY A;  3S17 H;  4DV4 Q;  2VQF Q;  4L5T A;  2YTY A;  4DV6 L;  1YHA A;  3H3V I;  4WJ3 M;  1HZ9 A;  2E8G A;  1HH2 P;  3G71 A;  3CME A;  3FKI G;  3H3V H;  2UXB L;  1PH1 A;  4OON A;  2R7D A;  3HOY G;  2RF4 A;  4DUZ Q;  4GLV B;  1K73 C;  4LUV A;  3K0X A;  1SFO H;  1PVO A;  2GN5 A;  1HNZ L;  2R7F A;  4HIM A;  1M1K C;  3S1Q H;  4IPD A;  3HOV H;  2UU9 L;  2N8N A;  1PH2 A;  1AE3 A;  1HZC A;  1LYL A;  1SR3 A;  5M5Y H;  5JEA G;  1VQM A;  4BY7 H;  1X3F A;  1OTC A;  3I4M H;  3PUV A;  4TQU S;  2PI2 E;  2AKW B;  1XTD A;  3OTO Q;  3J7A 5;  2ZTC A;  3T1H L;  2OTJ A;  3ULJ A;  1PH4 A;  1QVF A;  1Q86 C;  5FLM H;  4DUZ L;  1QVC A;  5IP9 H;  4UP9 A;  2PQA B;  4PZ6 A;  3F2B A;  4P72 A;  5GRO A;  4JBW A;  2F3I A;  2Q2U A;  2E2H H;  3PO3 H;  4LFB Q;  1J5E Q;  1B7Y B;  3GTJ H;  2FXQ A;  1VQH A;  1XPR A;  4LF7 L;  3A0J A;  2CWA A;  1UWV A;  4IJH A;  4A3G H;  4MZ9 A;  4DNI A;  4GNX B;  5BR8 L;  2UUC Q;  4X6A H;  1BKB A;  3HOV G;  4BA1 I;  2B63 G;  4A3D H;  3S16 H;  2D0P A;  4BY7 G;  1E1O A;  3PO2 H;  4XTC S;  1LUZ A;  4XIG S;  4PMW A;  3RN2 A;  3L2P A;  2E2I H;  4R4I A;  4LFB L;  3KF6 A;  4GNX C;  4JI2 Q;  2MO1 A;  2Q2T A;  2B3G A;  4C3J H;  1S3O A;  1X65 A;  2NN6 I;  3E9H A;  5FJ8 H;  2VQE Q;  2EXD A;  1I3Q H;  2ZJP A;  1PA6 A;  3B6Y A;  2OWO A;  4YCW A;  4KLK A;  3CC7 A;  2HIX A;  4R4O A;  4YWL A;  2UUC L;  2ZTD A;  1IBM Q;  3RZD H;  2CCZ A;  2JA5 G;  4A3C G;  1TWH H;  1Y1W G;  4B3R L;  1KQS A;  1EOV A;  4GKK Q;  1L1O A;  4JBJ A;  3K8A A;  4GOP A;  5M5W H;  3KJO A;  4DUY Q;  1XNQ L;  1VQJ A;  1G6P A;  3HOW H;  2IX0 A;  2KEN A;  3J80 c;  1E1T A;  1QZG A;  1Y1V H;  1D7Q A;  4DAM A;  4B3S Q;  4LF5 Q;  2A19 A;  4NXN L;  3GTQ H;  2N78 A;  4A3I H;  2BA1 A;  3CAM A;  2R6G A;  4JI4 Q;  1CSQ A;  5ELN A;  2YU9 H;  4OX9 Q;  5AJ3 L;  1IBM L;  4QJF A;  4IFD I;  4NPS A;  3CC2 A;  2JA7 G;  2VZA A;  1NMG A;  2K14 A;  2IT1 A;  3E0E A;  3NEL A;  4A3M G;  3M7N A;  4JI5 Q;  2XTI A;  3U4Z A;  5C0X I;  4POF A;  1ASY A;  2R92 G;  4IOA A;  3GDE A;  4X64 Q;  1JB7 A;  2HT1 A;  3H0G H;  3WWV A;  1IBK Q;  3CCE A;  3PUW A;  4DR1 Q;  2LSS A;  4A3L H;  4ALP A;  3CCJ A;  4DV2 Q;  4DR5 L;  4A3B H;  4B3S L;  1PYB A;  5M3M H;  1A0I A;  3TS0 A;  3GTG H;  4LF4 Q;  1FVI A;  2NN6 G;  1OXX K;  1H95 A;  1PV4 A;  4J15 A;  4JI4 L;  3M9B A;  3KF6 B;  3HOX H;  1HR0 L;  3CCL A;  4JV5 L;  5JEA J;  1XNR Q;  4C3H H;  1GVP A;  4IOC A;  3S14 H;  2EIF A;  4LF8 L;  1CSP A;  3U4V A;  3ERS X;  1CUK A;  4JOI A;  4DV2 L;  1O7I A;  2D0O A;  2MFI A;  1IZ6 A;  3FKI H;  1X9N A;  1PH8 A;  2JEA I;  1L1O B;  4B3M Q;  4LF4 L;  4LFC L;  5IP7 G;  3HOY H;  2WAQ E;  3KLW A;  4AYB G;  4DKA C;  1S72 A;  1E24 A;  3GD7 A;  1VQ9 A;  4JI7 Q;  3LGJ A;  4PZ7 A;  4JI6 Q;  4IFD G;  1VQA A;  4DV0 L;  1XNR L;  4DV7 L;  3H0G G;  4QQB X;  1YJN A;  4L5R C;  1N9W A;  2PQA A;  1EFW A;  5C0X G;  1IBL Q;  4OWW B;  1L1O C;  3NBH B;  4A3B G;  1B8A A;  2UXD Q;  5JJK A;  4IPC A;  4R4C A;  4JI3 Q;  1JE5 A;  5M3F G;  3GTP H;  2A1A A;  3K80 C;  1Z9F A;  3PUZ A;  4B3M L;  4P74 A;  1N32 L;  4DAY B;  4R4Q A;  1HJP A;  5LMN Q;  5GAH C;  3GTK H;  1FL0 A;  1W3S A;  1YEZ A;  3S24 A;  4DR2 Q;  1KIX A;  2IHE A;  1OXU A;  1IYJ B;  4UP7 A;  4JI6 L;  2AHO B;  1HZA A;  3RZO H;  4DR6 L;  1X6O A;  4PG3 A;  2E5L L;  1IBL L;  1HNW Q;  1TWA H;  2Y0S E;  1FJG L;  4JI3 L;  3Q8D A;  3F8T A;  1EIF A;  3PIO A;  1E7Z A;  2OTL A;  2ZM6 L;  4NXM Q;  1V9P A;  1K3R A;  2LXJ A;  1OXS C;  1X3G A;  4LW1 A;  3HKZ G;  1JJG A;  4LWC A;  4DR2 L;  4JI0 Q;  1G29 1;  1WYD A;  4QY7 A;  2B63 H;  1TWG H;  2Z6K A;  3OW2 A;  4A75 A;  4DV4 L;  2VQF L;  5LMN W;  1X3E A;  2CFM A;  3KOJ A;  4YHH Q;  1VQI A;  2K4K A;  1GO3 E;  3TQY A;  4A93 G;  4BBR G;  1VQL A;  1C7Y A;  4HJ7 A;  1SN8 A;  1Y14 B;  1U5K A;  5IYB H;  4Y7N H;  1SLJ A;  4C3I H;  4JOI C;  3F2D A;  1VQB A;  3CPF A;  2KCM A;  3STB C;  1W2B A;  1K0R A;  4A3C H;  2JA5 H;  1KHI A;  4P71 A;  4EX5 A;  3TRE A;  3CXC A;  1Y1W H;  3J7Z C;  1NY4 A;  1Q46 A;  1PFS A;  4AIM A;  1VQE A;  1XMO Q;  1A63 A;  1CKO A;  4A3F G;  1JJC B;  2JJQ A;  3I2Z A;  4YHH L;  2NZH A;  4JBM A;  3OTO L;  1Q81 C;  2B29 A;  2VUM G;  1SRO A;  4L5S A;  2I5L X;  2JE6 I;  2E2J H;  2OCE A;  1WCM G;  4QGU A;  2R93 H;  1UE6 A;  3BZC A;  4DK3 C;  1Z47 A;  5JJI A;  5K36 G;  1P8L A;  5LMU Q;  2K75 A;  1T9H A;  2JA7 H;  1B70 B;  2ID0 A;  5GAE C;  1X56 A;  1QUQ A;  1WI5 A;  1PH9 A;  3HFZ B;  1WFQ A;  4KI0 A;  4A3M H;  1XMO L;  1J5E L;  4LF9 Q;  4HJ9 A;  1L2F A;  3D31 A;  3CD6 A;  2R92 H;  5IYB G;  5HGQ A;  3OYY A;  5C44 G;  1TXY A;  4BXX G;  2GVB A;  1SMX A;  4ME3 A;  4X65 Q;  1I94 Q;  2K50 A;  4A3K G;  1VQ4 A;  3NEN A;  4IFD J;  3IRB A;  3K7A H;  3J80 i;  4DV5 Q;  1K8G A;  1Q7Y C;  1OXV A;  2YV5 A;  1YIT A;  1KRT A;  5C0X J;  4DR3 Q;  2Z6K C;  4RG1 A;  3L7Z C;  4JI2 L;  3BU2 A;  2YTV A;  4FDB A;  3J81 i;  2R7Z G;  1UEB A;  3CW2 C;  3CCQ A;  2VQE L;  2R93 G;  3CMA A;  4HJ5 A;  5IYC G;  3J81 c;  2JA8 G;  4X65 L;  3GO5 A;  1KXL A;  1I94 L;  5IP7 H;  5J3B A;  1BBW A;  5C3E G;  5IYD G;  3A5Z B;  1NJI C;  3TS2 A;  3U58 A;  1TWC H;  3W5O A;  4GKK L;  1EQR A;  4IPG A;  1JT8 A;  1LM0 A;  3F2C A;  3CCV A;  4DUY L;  1A8V A;  2I5M X;  4DR3 L;  1RIP A;  4DV3 Q;  2XGT A;  3ULL A;  4A76 A;  4B3T Q;  4LFA Q;  1YNX A;  2F52 A;  1N8R C;  1VQO A;  4HID A;  5M3F H;  4IJL A;  2JEB I;  4A3E G;  1Q1B A;  4AYB E;  1QUQ B;  4OX9 L;  3K81 C;  1U0L A;  3H15 A;  1I50 H;  3E9I A;  2IY5 B;  4DR4 Q;  3S15 H;  3GTM H;  1Q1E A;  1N33 Q;  1X55 A;  2GVA A;  4JI5 L;  3PV0 A;  3TEH B;  2MNA A;  1YHB A;  3KJP A;  1YBY A;  4X64 L;  2IX1 A;  3M4Q A;  1WJJ A;  2OQK A;  1IBK L;  3PF4 A;  2WB1 G;  4DR1 L;  1VQP A;  5JJL A;  4IPH A;  1MIU A;  4B3T L;  4MNO A;  1S40 A;  4GKJ Q;  1EYG A;  1BBU A;  2VS1 A;  2AMC B;  2IHF A;  2Z0S A;  4O0A A;  2K5H A;  1ASZ A;  4DR4 L;  1N34 Q;  1KAW A;  3CP0 A;  1VQ6 A;  2PNH A;  1EIY B;  1N33 L;  4X62 Q;  4DV1 Q; 
#chains in the Genus database with same CATH topology
 4EQP A;  3M3Y H;  4OO1 I;  2LKV A;  2PZW A;  3AFP A;  1JWM D;  1B50 A;  4PNY A;  4TSS A;  3T1Y Q;  2NVX H;  3KLR A;  4JG2 A;  2Z4H A;  4KHZ A;  4ME5 A;  3MXN B;  3W1B A;  1VS0 A;  2NZO A;  3ND8 A;  4X3U A;  4C2M H;  5KIX A;  4DV1 L;  3M4O H;  1EIH A;  1H9K A;  2K1B A;  1AFP A;  4A3F H;  5EKI A;  1XPU A;  2M9V A;  3P1H A;  1PLF A;  5IWA Q;  1VQN A;  3AEV A;  3VR2 A;  2ENB A;  1I50 B;  5LMN L;  1D5Z C;  1NTG A;  1WCM H;  4HSV A;  1FGU A;  3FPU B;  5C4J H;  3HRZ C;  1JQY D;  2HHH L;  3LX0 A;  2DN8 A;  4DR7 L;  4OO1 G;  3HOZ H;  5ELD A;  1T5E A;  2K5N A;  3EN2 A;  1M90 C;  1AP0 A;  4NXM L;  2KCT A;  1I4H A;  2QA4 A;  5E4X A;  4ZKC B;  3ZJY C;  4FXD A;  4YCV A;  1Y8O B;  2ZXO A;  3MHB A;  1F77 A;  3C3L A;  1JC7 A;  1TWF B;  2X69 A;  1M4V A;  4XQJ A;  4UP8 A;  4A93 B;  4GZY C;  4WRD A;  2ASB A;  1V1P A;  4DAV A;  3QOJ A;  4GN4 B;  1O78 A;  2RCN A;  4FF4 A;  1E2W A;  1HXY D;  4AH6 A;  2ALY B;  3UDI A;  2Q2I A;  5IYD H;  1PZJ D;  1EQV A;  1Q8K A;  4NMZ A;  5IE8 A;  3QB3 A;  3OIQ A;  2CVR A;  2SEB D;  1NBW A;  2VY3 A;  2JA6 B;  5HUR A;  2C35 B;  1K8A C;  2UUA Q;  3KF8 B;  2JP1 A;  2A5H A;  4BY1 H;  3MEF A;  4RGN A;  4A3E H;  1S5B D;  5KGU A;  3SHL A;  1WTR A;  1QZH A;  4XQQ A;  1J8I A;  4B3R Q;  3K5M A;  3S1M H;  3GTL B;  2EJG C;  1AEX A;  3D6W A;  3TP7 A;  5GQO A;  1WTO A;  3R93 A;  3J7Y W;  2RHQ B;  3CCR A;  4P75 A;  4NB3 A;  4OL7 A;  3M85 A;  1RD9 D;  2AWO A;  4DV5 L;  1ICW A;  2JK8 A;  4K0K Q;  1VQF A;  2DUD A;  3J7A V;  1STA A;  2NVY H;  3CC4 A;  2R7Z B;  2JYO A;  2NVQ B;  3MXN A;  2DGY A;  4RGO S;  1EY7 A;  4YCU A;  4HMI A;  4A3G G;  2JA8 B;  4JYA L;  5I6W A;  5FOB B;  2FMC A;  4MTN A;  4AQY Q;  3R3O A;  1BXT A;  1A2U A;  3K57 A;  1SMY C;  3UE0 A;  2VB3 X;  3T4A C;  2UXC Q;  3KDF B;  3VR3 A;  1ENC A;  3JAM i;  1PYS B;  5C4X H;  1VQK A;  1FNW A;  1CKN B;  4JI8 Q;  3JAM c;  3TDQ A;  4L6T B;  4LFC Q;  3QR8 A;  1HNX Q;  3PO2 B;  4PZ8 A;  1JJ2 A;  4RWS C;  1YIJ A;  3PUY A;  4K5X A;  1STE A;  3J81 j;  3W3A A;  1J9O A;  1HR0 W;  2F4V Q;  1KRS A;  3HKZ E;  4DK6 C;  2B2U A;  1DXM A;  1IYV A;  2EQS A;  3BZD B;  4UY8 C;  3PF5 A;  1N32 Q;  3NP8 A;  1VQD A;  2F0N A;  4GLX A;  1PH3 A;  4F87 A;  4JI1 Q;  4DNT B;  2IW3 A;  5E7N A;  2JA6 H;  3MXU A;  2A8V A;  1NMF A;  3HOU B;  1KD1 C;  4X66 L;  1FJG Q;  1QOH A;  3T1Y L;  4BBS G;  3GV6 A;  1V1Q A;  2NWG A;  3A55 A;  3KF8 A;  1SMY D;  5FKA C;  3IL8 A;  2MO0 A;  4HIO A;  4C3H G;  1E22 A;  3EBE A;  3C1F A;  5EGT A;  3UDF A;  3TRZ A;  5IY0 A;  2L9H A;  4DV4 Q;  2YTY A;  3A56 A;  4CJ0 B;  1HQR D;  1CZW A;  2R7D A;  2RF4 A;  1K73 C;  4HAE A;  2GN5 A;  1HNZ L;  3S1Q H;  1VF7 A;  2F0E A;  1PH2 A;  1VQM A;  1C48 A;  1OTC A;  3SR1 A;  1B2T A;  1WTX A;  2EYP A;  2B2W A;  4Z9C B;  4K14 A;  1QVF A;  1Q86 C;  5DEH A;  4ZK9 B;  4UP9 A;  5IP9 H;  4PZ6 A;  2F3I A;  2Q2U A;  2E2H H;  4UAI A;  1HHV A;  1PRT F;  3GTJ H;  1XPR A;  5COY A;  3A0J A;  1SE2 A;  4MZ9 A;  3PIO 3;  4GNX B;  3GTK B;  4X6A H;  4A3D H;  5FK9 C;  4BA1 I;  4I65 A;  4RAU C;  3PO2 H;  4XTC S;  1K8M A;  1CHQ D;  4S3S A;  4RFB A;  1S3O A;  4XYO A;  3E9H A;  4YIJ A;  2HD3 A;  5FJ8 H;  1SFO B;  2OWO A;  5C5M A;  4KLK A;  2HIX A;  1IBM Q;  4UHV A;  5M5Y B;  4BY7 B;  4B3R L;  1KQS A;  3NWS A;  3K8A A;  3KJO A;  1VQJ A;  1G6P A;  3HOW H;  4KY7 A;  1U4L A;  1Y1V H;  4DAM A;  3AMU A;  2A19 A;  2BA1 A;  1O7Z A;  2PO4 A;  4JI4 Q;  2YU9 H;  4QJF A;  3NEL A;  3M7N A;  5C0X I;  1ONL A;  3GDE A;  1JB7 A;  4RHR A;  4A3G B;  2FHT A;  1WVL A;  4DV2 Q;  3V05 A;  3ZYY X;  5M3M H;  3S16 B;  3U9O A;  3KF6 B;  4FXG C;  1LTB D;  3CCL A;  4ULL A;  4BS9 A;  2BE5 C;  1TVX A;  2F0O A;  3SVM A;  3S14 H;  1CSP A;  1I3Q B;  2PCF B;  4JOI A;  1X9N A;  3MA2 B;  2JEA I;  4B3M Q;  1SE4 A;  4LFC L;  4DF7 A;  4AYB G;  2AQ1 B;  4DKA C;  1E24 A;  5KNC A;  4JI7 Q;  4PZ7 A;  5M5W B;  1XNR L;  1BQQ T;  2RVL A;  1N9W A;  5JEA H;  5C0X G;  1IBL Q;  5LHY 1;  1L1O C;  1ZXT A;  2UXD Q;  4TRD A;  1ILP A;  1JE5 A;  1TY0 A;  3K0Y A;  2F0K A;  2LS0 1;  1Z7T A;  1Z9F A;  3ERO A;  2RKS A;  5D3D A;  1N32 L;  1K3B C;  2OF1 A;  3GTK H;  1W3S A;  1HA5 A;  1IYJ B;  2QIL A;  3E3X A;  1B3Q A;  1HZA A;  2AHO B;  2I46 A;  5CV4 A;  2EY6 A;  4X3K A;  2V4D A;  2Y0S E;  3WDN A;  1FJG L;  3Q8D A;  2KEE A;  5M3F B;  1E7Z A;  1K3R A;  1X3G A;  4LWC A;  4QY7 A;  3OSO A;  1MSG A;  5ELC A;  4A75 A;  4DV4 L;  1SAP A;  2CFM A;  2F0H A;  1S5C D;  2K4K A;  1TS5 A;  3TQY A;  1C7Y A;  2EY5 A;  5IGG A;  1D6E C;  1FNU A;  1SLJ A;  3Q23 A;  1SJE D;  2PYK A;  3F2D A;  1VQB A;  1RDP D;  2KCM A;  1NAP A;  1Q90 A;  4A3C H;  1KHI A;  4P71 A;  4EX5 A;  2A6E D;  2PQE A;  1Y1W H;  3J7Z C;  4F88 A;  1NY4 A;  1Q46 A;  1PFS A;  4A3F G;  1JJC B;  4YHH L;  3GTP B;  3ND9 A;  1Q81 C;  2B29 A;  2M2L A;  2GA4 B;  2E2J H;  3QOL A;  2OCE A;  5I9O A;  1WCM G;  2NYZ D;  4QGU A;  4KD4 A;  1UE6 A;  3MEH A;  1MHW C;  2K75 A;  5LL6 X;  1G6Z A;  2ID0 A;  1PH9 A;  4N9T A;  1WFQ A;  4HJ9 A;  1L2F A;  1DOM A;  3OYY A;  1KLG D;  4ME3 A;  3H94 A;  2AUK A;  1PTO B;  5COR A;  2K50 A;  3NEN A;  1PFB A;  3BU2 A;  2YTV A;  3J81 i;  3CW2 C;  3CMA A;  4HJ5 A;  1B9N A;  3J81 c;  1KXL A;  3I70 A;  2KVM A;  4A3K B;  1RTN A;  3ERQ A;  5IYD G;  3W5O A;  2OEO A;  4B9W A;  3LWU A;  1ESR A;  1JT8 A;  2H1E A;  2RCF A;  3CCV A;  3RUZ A;  4DV3 Q;  2XGT A;  1I4X A;  4A76 A;  4M1U B;  2QF7 A;  3RD4 A;  2R93 B;  4HID A;  5M3F H;  4IJL A;  2JEB I;  4A3E G;  1Q1B A;  4AYB E;  2VB2 X;  3I8Z A;  1HFN A;  3H15 A;  2IY5 B;  3VYS A;  1PZK D;  2ZT9 C;  3Q0A A;  1N33 Q;  4IZ8 A;  3PV0 A;  2MNA A;  1UNS A;  3KJP A;  2HQE A;  1YBY A;  5JOB A;  3BVG A;  2K05 A;  3PF4 A;  1PMR A;  2F0G A;  3VR5 A;  1VQP A;  4IPH A;  1MIU A;  3KK7 A;  1VF5 C;  4O42 A;  2IPK D;  2IHF A;  2CW0 C;  2SNM A;  1HA6 A;  4QUF A;  4DR4 L;  3JAM E;  4ZAI A;  3BYT B;  4DV1 Q;  1R9T B;  5I2Y A;  2AQ2 B;  1TR5 A;  3L3O C;  3RLN A;  2MQH A;  1X3Q A;  4BBR H;  2HCC A;  4GKJ L;  3GTO B;  1DYQ A;  4QIW B;  3H6M A;  3RLF A;  1ESF A;  1TWC B;  4JI7 L;  3RNU A;  4LNQ A;  1N34 L;  1MKH A;  2RSN A;  2HHH Q;  4X62 L;  1F9P A;  3DWA A;  4DR7 Q;  4GN3 B;  2J4X A;  3KLS A;  1EQQ A;  2UXD L;  1JR0 D;  1EY4 A;  2F0D A;  5C4X G;  2VUM H;  1D5M C;  1KNA A;  2AUJ D;  4HMJ A;  5IT9 c;  2JQO A;  2CKZ B;  1SRU A;  4LF6 L;  2O4X A;  3VA5 A;  2CWP A;  2WAQ G;  3TP6 A;  1EFI D;  1A3U A;  2N55 A;  4OXP A;  5F2D A;  2B2V A;  5CV6 A;  1E3P A;  2LXK A;  1F2Y A;  2CW0 D;  2D5D A;  4XDX A;  3S1N H;  5ELO A;  2D62 A;  3PIP A;  4ODG A;  2D9U A;  4ZCK A;  3UE1 A;  4A3K H;  3M4P A;  1YHQ A;  2XRQ D;  1JCK B;  2MPM A;  1AE2 A;  2JA6 G;  1KDC A;  1IXR A;  2TSS A;  3LWE A;  2EE1 A;  2N3S A;  4K6L A;  3I55 A;  2JA9 A;  3I72 A;  2YTX A;  3L9A X;  4P73 A;  4R4T A;  1K8G A;  1HFG A;  1MJC A;  1YZ6 A;  2HCI A;  3TZU A;  1YI2 A;  4C2M B;  3M4O B;  4RH6 A;  4KHP L;  2H5X A;  5FLX c;  4J1M A;  2I5H A;  4IUR A;  1XJV A;  5T1I A;  2A69 C;  3FRP B;  4ZQ3 A;  3CF5 A;  1WCM B;  5C4J B;  3CCS A;  3PGZ A;  1JIC A;  1GD7 A;  3S17 B;  2CQO A;  4R8I A;  3RLO A;  3T13 A;  1R9T H;  3HOZ B;  2UUB L;  1EUJ A;  1XNQ Q;  2RDF A;  4ZUJ A;  4K6D A;  4OIK A;  4JYA Q;  1CKM A;  3NEM A;  3HP3 A;  4NXN Q;  3STB D;  3GTO H;  2RA4 A;  5IP9 G;  5CV9 A;  2VL6 A;  1V1P B;  5E3F A;  1I5F A;  3BDL A;  1RF2 D;  3G6J B;  3I4M B;  2O5J C;  1I6H H;  2F3V A;  3I4O A;  2BDO A;  2XIW A;  3BDO A;  1MJE A;  5CMD A;  4DR5 Q;  1PH7 A;  1A62 A;  1DM0 B;  5M5X H;  4A3D G;  2WP8 J;  1UE7 A;  5H1S E;  3PO2 G;  4Q0F A;  2QEX A;  4JV5 Q;  2HDL A;  2PW7 A;  3CCU A;  4L5Q A;  4DV3 L;  2PZU A;  3SE0 A;  2KBN A;  2QW7 A;  4TVA B;  2A69 D;  3DM3 A;  4RMF A;  4FO2 A;  4HJ8 A;  1V43 A;  1Q82 C;  4BY1 B;  2MHV A;  3QIA A;  5FJ8 G;  1EEI D;  4TKO B;  1YNN C;  3UDX A;  3S2H H;  2HDM A;  2RBM A;  1Q12 A;  3BJU A;  5C4Z A;  2ZJQ A;  1WTW A;  4YWK A;  4DXF A;  3S1M B;  2L11 A;  5BN4 A;  4UDU C;  3HOW G;  3BYY B;  3HOU G;  1Y1V G;  2G9H D;  4X66 Q;  1SJH D;  3Q6S A;  2N49 A;  4ZKB B;  1KC8 C;  1SNC A;  4GLA C;  4A4I A;  3EFX D;  1YJ9 A;  2F0V A;  1UE5 A;  4FXK C;  4OWT B;  5E1F A;  2NVY B;  3KBG A;  3KYH C;  4GS3 A;  1AN8 A;  1QVG A;  4DR6 Q;  1C8C A;  1A2T A;  5GAG C;  2E5L Q;  4GN5 A;  5M3M G;  3P20 A;  1GUW A;  1B53 A;  1BO0 A;  4CBV A;  4C56 C;  4JCV E;  5DLQ E;  2KCN A;  3WOE A;  1HNZ Q;  2QCP X;  1G8Z D;  1UE1 A;  1WOC A;  4C1N K;  1F9R A;  4WJW A;  4L63 B;  3U50 C;  1STN A;  3M4Y A;  2FJ2 A;  4DPG A;  2VQF Q;  3S17 H;  4WJ3 M;  1HZ9 A;  5C4X B;  1ET6 A;  3CME A;  2F0Q A;  1O80 A;  1YNN D;  3H3V H;  1PH1 A;  1HCZ A;  3KBX A;  2J0T D;  3HOX B;  1PVO A;  2X6G A;  2WAQ B;  1M1K C;  3HOV H;  2N8N A;  2E2D C;  5CV7 A;  1LYL A;  1SR3 A;  1E2Z A;  5JEA G;  4WFN 3;  5I2X A;  3PUV A;  3I4M H;  1O7Y A;  2PI2 E;  1XTD A;  2M00 A;  3FKI B;  3ULJ A;  5FLM H;  1LTS D;  1QVC A;  4KN4 C;  2MGS A;  4OHJ A;  3PO3 H;  1DCZ A;  5IGC A;  4JK1 C;  2O5I C;  1HUM A;  1BKB A;  2K6A A;  2B2Y C;  2OT2 A;  4BY7 G;  1FR3 A;  1H9R A;  4PMW A;  4OEM B;  3OW7 A;  2QDB A;  1XWE A;  4R4I A;  4LFB L;  1FD7 D;  4PV1 C;  4GNX C;  1FGB D;  2MO1 A;  3OMG A;  3NK9 A;  3DEO A;  3V96 A;  1PA6 A;  2KOL A;  2LY7 A;  2ZJP A;  1F9Q A;  2UUC L;  3S1Q B;  4R4O A;  4YWL A;  4A3C G;  2ZTD A;  3RZD H;  5ISR A;  1Y1W G;  1BDO A;  3IFT A;  4JBJ A;  1HRJ A;  1XNQ L;  4EVO A;  2KEC A;  2N88 A;  3J80 c;  4N9P A;  4QB4 A;  5KYI A;  1D7Q A;  4Y7N B;  4NXN L;  3GTQ H;  3CAM A;  5JPM C;  2F0U A;  3DHQ A;  1CSQ A;  5ELN A;  4KKU A;  2E2H B;  2IT1 A;  2K5D A;  2XSC A;  3GTJ B;  2WV6 D;  4DAY A;  1CZG A;  2XTI A;  3MZ5 A;  4KHV A;  4IOA A;  3H0G H;  4RGM A;  2LSS A;  3SDZ A;  3OIP A;  4DR5 L;  4A3B H;  4B3S L;  1PYB A;  3BDC A;  3J81 L;  4A3D B;  1QWY A;  1OXX K;  1H95 A;  1PV4 A;  1W6K A;  3M9B A;  3T56 B;  3HOX H;  3C46 A;  4JV5 L;  1XNR Q;  1GVP A;  3A54 A;  3SK8 A;  5KEE A;  1EY5 A;  2SOB A;  5JJZ A;  3S9W A;  3U4V A;  1CUK A;  1PH8 A;  1O7I A;  3FKI H;  1GUN A;  2JSO A;  3HOY H;  3R8B A;  4MIU A;  5A2Q L;  1VQ9 A;  5EJW A;  2SNS A;  1SNM A;  1II3 A;  3HOW B;  1YJN A;  4QQB X;  4MN3 A;  4OWW B;  1IW7 C;  1Y1V B;  1ILQ A;  2K28 A;  3NBH B;  4IPC A;  4DK0 A;  5M3F G;  5EBD A;  2A1A A;  3K80 C;  2YU9 B;  1S5F D;  4P74 A;  4B08 A;  1HJP A;  3I73 A;  1YEZ A;  2LFN A;  3I91 A;  2L4N A;  2IHE A;  1OXU A;  2F0M A;  4UP7 A;  2E74 C;  5J22 A;  4CDE C;  3RZO H;  3MVV A;  4DR6 L;  4PG3 A;  3K5O A;  2K33 A;  2E5L L;  1HNW Q;  2AQ3 B;  5M3M B;  1QNU A;  4JI3 L;  1X32 A;  3PQI A;  1D1I A;  2B8F A;  4DXG A;  2CH4 W;  1OXS C;  4LW1 A;  1S5E D;  1JJG A;  3SK4 A;  4JI0 Q;  3GTM B;  3A7A B;  2ICI A;  1EOT A;  2Z6K A;  1LT3 D;  3S14 B;  5K36 H;  1H9J A;  2VQF L;  5LMN W;  3KOJ A;  4YHH Q;  3HS0 C;  4BBR G;  4KJO A;  1SN8 A;  1A15 A;  1S4Z A;  1Y14 B;  2I07 B;  1E0B A;  4Y7N H;  5IT9 L;  4C3I H;  3ITP A;  3CPF A;  1AZP A;  1JOK A;  1EIG A;  3X3N A;  3TRE A;  3CXC A;  1A63 A;  3DWP A;  1IW7 D;  1I4Q A;  1JE4 A;  2JJQ A;  2NZH A;  3E0J A;  4DFA A;  2VUM G;  4ZLT F;  3CRL C;  1GJX A;  5BN3 A;  5CC4 A;  3K5L A;  4RGT A;  1STH A;  4M8A A;  4K8J A;  1Z47 A;  5JJI A;  1P8L A;  1QE6 A;  4G57 A;  1B70 B;  2Q8I B;  5GAE C;  1QUQ A;  3HFZ B;  4KI0 A;  5IYB G;  5HGQ A;  3TME A;  1G2T A;  4DAP A;  1BCP B;  2NN6 H;  4A3K G;  1XXG A;  1VQ4 A;  4IFD J;  3IRB A;  5FLX L;  4RG1 A;  2EYO A;  1TS3 A;  4R9W A;  4FDB A;  3FMC A;  1PTO C;  1UEB A;  2K01 A;  2R93 G;  3NBH A;  1FNV A;  1I94 L;  1Y1W B;  1BBW A;  3IAY A;  5DAU A;  1EQR A;  5KRU A;  4FF1 A;  1STB A;  1ZYR C;  2I5M X;  1RIP A;  3BG3 A;  3ULL A;  3EJI A;  2E2J B;  4LFA Q;  3UI2 A;  1RKN A;  3PMF A;  5C6A A;  3FPP A;  3D4D A;  3K81 C;  3VYU A;  4DR4 Q;  4JW0 A;  1E2V A;  3GTM H;  3TEH B;  3M4Q A;  2OQK A;  2WB1 G;  2F0S A;  4GKJ Q;  2K5W A;  2VS1 A;  3DEP A;  4NW2 A;  2DNC A;  2Z0S A;  1TQO A;  2F0I A;  1LTT D;  2K5H A;  1N34 Q;  2F0F A;  4IQZ A;  3CP0 A;  2PNH A;  1EIY B;  4X62 Q;  1EL0 A;  1QIL A;  5G3L F;  1CHP D;  1PTO D;  1YNJ C;  1PH6 A;  2MJ8 A;  1MGS A;  2HQL A;  3AYH B;  4OO1 H;  3G6E A;  4CJ2 C;  1XPO A;  2DJF C;  4LF6 Q;  1UAP A;  4CKE A;  5CBA E;  4LF5 L;  1ZYR D;  3MWY W;  2KHI A;  1VQG A;  2EYM A;  2A68 C;  2B2T C;  2EDG A;  4EQO A;  1X3P A;  3AQQ A;  3KFU A;  3QJY A;  1K8O A;  4JVZ A;  2BE5 D;  1SSO A;  2L15 A;  3G4S A;  2UU9 Q;  1HNW L;  4G7Z C;  3BS1 A;  3OWE B;  3L0O A;  4BXX H;  1D8L A;  2NZ1 D;  1SE8 A;  1PHJ A;  1D5X C;  2PMZ B;  2ATW A;  2Z9H A;  5IIF A;  1HZB A;  3VR4 A;  3GQB A;  4JI0 L;  4RKL A;  3FHW A;  3I4N B;  2EY1 A;  4KHP Q;  2A74 C;  5KND A;  1IL8 A;  2FMM A;  4IUQ A;  1EY0 A;  3RN5 A;  1C9O A;  4RKB A;  4BBR B;  1N36 L;  4LF7 Q;  5IYC H;  1EWI A;  2QKI C;  5BR8 Q;  1CQF A;  3EIV A;  1EWH A;  1F2Z A;  3TN2 A;  2RDG A;  1EY8 A;  1AW7 A;  3HOZ G;  1LTL A;  2A68 D;  2UUB Q;  2NVT H;  1VQC A;  2VUM B;  2ZTE A;  3D3R A;  4HCS A;  2DNE A;  5DNF A;  4G4K A;  2CQA A;  2KHJ A;  4KD3 A;  1YJW A;  3LNN A;  1U4R A;  3OMC A;  5EPL A;  4C1N I;  4L8J A;  4QUC A;  4BWG B;  2WFW A;  1SXT A;  3I7F A;  1CM9 A;  1KLU D;  3I4M G;  1GUS A;  4CHT B;  5J39 A;  4HED A;  1Y8P B;  1OXT A;  3AFQ A;  3NXW A;  3S1N B;  5FLM G;  4QL5 A;  3S1R H;  3BZK A;  3MXG A;  2XWB B;  4OWX B;  1VQ5 A;  5AJ3 Q;  2F1M A;  3PO3 G;  1CTM A;  3A7L A;  1F2M A;  1LT4 D;  2WB1 E;  3W1G A;  2ZXP A;  4APV A;  1PYW D;  4QIW E;  4BY1 G;  1X54 A;  3RR5 A;  2VNU D;  1EZ8 A;  2EJF C;  3K58 A;  1T5X D;  2VW9 A;  3PUX A;  2JN4 A;  4IUP A;  4OGQ C;  1BR9 A;  2F4I A;  3AB9 A;  1JMC A;  1ENA A;  1Q8I A;  4CKB A;  1HR0 Q;  4YY3 L;  4DGZ A;  3QO2 A;  2ICE C;  4DU9 A;  1KL9 A;  4LFA L;  1J6Q A;  3K7U C;  3OOC A;  4KV6 A;  5HY6 A;  3J80 L;  4LF8 Q;  1D1K A;  4HIK A;  1GXD C;  1BBX C;  3NTK A;  4BBS H;  3I4N H;  4KTA A;  4P2C B;  2PPB C;  1SYB A;  2L0C A;  4HJA A;  5C5L A;  4DV0 Q;  2WB1 B;  4LUZ A;  1P16 A;  1RL2 A;  2AWN A;  5KYL A;  1GKH A;  2VXW A;  5AFW A;  1ML0 D;  1EU3 A;  3MFY A;  4GOP B;  2TMP A;  3ER0 A;  2RDH A;  2L55 A;  4KKT A;  1DD2 A;  3I56 A;  1ROD A;  2KA7 A;  1I6H B;  1K83 H;  2K52 A;  5EKK A;  3S2D H;  4EQ5 A;  1CFM A;  5GAD C;  5EAY A;  1LO5 D;  1I4R A;  2QEJ C;  4H44 C;  4JPB W;  5M5X B;  5BN5 A;  2XWJ B;  2EJM A;  3CPW A;  2ZM6 Q;  1WTV A;  4JC0 A;  3HOX G;  2KED A;  4Y52 H;  3DLL A;  4A3J H;  2BH2 A;  2ES2 A;  2NBF A;  3OHX C;  4DV6 L;  4L5T A;  3G71 A;  3TP5 A;  3FKI G;  3RMH A;  3S2H B;  4OON A;  3HOY G;  5FO8 B;  1LLR D;  4N8F A;  3K0X A;  1LTR D;  1KNE A;  1HQM C;  2UU9 L;  4X3T A;  1HZC A;  1DOL A;  3C1E A;  1X3F A;  4B9X A;  4H13 C;  4TQU S;  2AKW B;  5G3L D;  3OTO Q;  2K7V A;  5I4D A;  4HCE A;  2OTJ A;  2B2U C;  4DUZ L;  4LAA A;  2PQA B;  1PRT B;  3MTS A;  4P72 A;  5GRO A;  3F2B A;  2RQX A;  1C4Q A;  1IKL A;  3T53 B;  4LFB Q;  3NTH A;  3D8G A;  1J5E Q;  2FXQ A;  4LF7 L;  1R4Q B;  3CRK C;  4FF3 A;  4IJH A;  1K0S A;  2WII B;  4DNI A;  5BR8 L;  2UUC Q;  3F2U A;  3ONA B;  5IGB A;  1NUC A;  4R8N A;  2D0P A;  2F3W A;  1LUZ A;  2XN9 C;  3D4R A;  4XIG S;  3E6Z X;  4I7A A;  4J6H A;  3KUP A;  1SYC A;  2HUG A;  1RJT A;  2Q2T A;  2Z4I A;  4JI2 Q;  2B3G A;  4C3J H;  4C3I G;  2NN6 I;  2VQE Q;  3B6Y A;  4K5W A;  4HTH A;  3KLS X;  3HOV B;  2CCZ A;  1TWH H;  2Q8T A;  1L1O A;  4GOP A;  4KY6 A;  2IX0 A;  1U9R A;  1E1T A;  1L0X B;  4B3S Q;  2N78 A;  3CKI B;  4A3I H;  2R6G A;  5T1G A;  5AJ3 L;  1WTP A;  2B2W C;  1G2S A;  4NPS A;  3CC2 A;  3PO3 B;  1NMG A;  2K14 A;  3E0E A;  4JI5 Q;  4Q5V A;  1ZEQ X;  4POF A;  3K5N A;  2L12 A;  1O7L A;  4QCL A;  4X64 Q;  3NTI A;  3CCE A;  4FF2 A;  1OO9 B;  2IWH A;  4DR1 Q;  4A3L H;  3CCJ A;  1PXU A;  3TS0 A;  1A0I A;  1UEA B;  1FVI A;  2NN6 G;  4PMB A;  2KHS A;  1Y69 U;  1SYF A;  1HR0 L;  4MTK A;  5JVH 3;  4A3M B;  5EPJ A;  4LF8 L;  2L1B A;  3I4L A;  3ERS X;  2A73 B;  2D0O A;  1IZ6 A;  2MFI A;  4HN7 A;  3RZD B;  4LF4 L;  1SYE A;  1VMP A;  2WAQ E;  3A8K E;  3KLW A;  4LK1 C;  1F2L A;  4DNR B;  1DON A;  1GUG A;  3LGJ A;  2IL8 A;  4DV0 L;  4L5R C;  4IUU A;  2PQA A;  1B8A A;  1V8Q A;  4R4C A;  4JI3 Q;  3GTQ B;  5ELF A;  1R4P B;  4CKC A;  4DAY B;  5GAH C;  1FL0 A;  3G7L A;  4PQX A;  4JI6 L;  1X6O A;  3H0G B;  5D14 A;  4CJ1 B;  2FIN B;  2XNA C;  4A3B B;  1TWA H;  3F8T A;  3DWQ A;  1EIF A;  2RSO A;  3NQI A;  3PIO A;  2OTL A;  2ZM6 L;  4RA8 A;  3HKZ G;  4ID6 A;  4DR2 L;  1G29 1;  1WYD A;  2B63 H;  1TWG H;  5KNB A;  3OW2 A;  5L37 A;  1M8A A;  1B1Z A;  2EYF A;  4ZUI A;  4FNF A;  2EOT A;  1SEB D;  4IUV A;  1VQI A;  5CV5 A;  4CDF C;  2DY8 A;  2LMC B;  2Q8R E;  4CGY B;  5ELE A;  1TKW B;  3P7J A;  3T16 A;  5IGE A;  4ZYS A;  4HJ7 A;  1VQL A;  1U5K A;  4PMC A;  2A6H C;  3HOY B;  2EVB A;  1A6X A;  4JOI C;  5CV8 A;  1W2B A;  1K0R A;  2JA5 H;  2K03 A;  4N8X 1;  1H9M A;  4AIM A;  1VQE A;  5M9O A;  1TY2 A;  3OTO L;  4L5S A;  1LTG D;  1DZ1 A;  5CGK A;  1NR4 A;  3RZO B;  4E6I A;  5JPN C;  5LMU Q;  1T9H A;  3VYT A;  1CQV A;  2P5Z X;  2JA7 H;  1X56 A;  1J5E L;  1WI5 A;  4LF9 Q;  1XMO L;  4A3M H;  3D31 A;  3CU7 A;  2MUY A;  2R92 H;  3CD6 A;  2IX3 A;  1TXY A;  4BXX G;  1SMX A;  1DOK A;  3DUZ A;  3CHB D;  2X6L A;  1IKM A;  4XXE A;  1I94 Q;  1W6J A;  1EEF D;  4F8M A;  1H9S A;  2EYJ A;  1KTK A;  3K7A H;  1PTO F;  3QWN A;  3J80 i;  2XRS D;  3R2I A;  3PIP 3;  1OXV A;  2KQ3 A;  1YIT A;  1KRT A;  5C0X J;  1BCP C;  4JI2 L;  4I7Z C;  4RHS A;  5C44 B;  1Y8N B;  2A6H D;  4KK7 A;  4K2K A;  4C3I B;  2VQE L;  3CCQ A;  3VR6 A;  3MXP A;  5IYC G;  4X65 L;  3GO5 A;  5IP7 H;  3J81 E;  2EYL A;  3NWT A;  3A5Z B;  4XT1 B;  3U58 A;  4IPG A;  4IFD H;  1A8V A;  4DR3 L;  2ZXR A;  1YNX A;  2O2L D;  3CQZ B;  1VQO A;  1PFM A;  1QUQ B;  1EYA A;  4KN7 C;  1I50 H;  3E9I A;  5C3E B;  2GVA A;  3C2P A;  4JI5 L;  5A2Q E;  3VYR A;  1HUN A;  1GUT A;  1YHB A;  3SXH A;  4X64 L;  4H0L C;  1I4G A;  4DR1 L;  5JJL A;  4B3T L;  3MFG A;  4MNO A;  1WTQ A;  1EYG A;  1BBU A;  1D2B A;  2AMC B;  4OIJ A;  4O0A A;  3U9S A;  1TT2 A;  1BF4 A;  1G91 A;  1KAW A;  2CH4 A;  4LF5 Q;  4XYQ A;  1BCP D;  1TWF H;  2KCC A;  2RHS B;  4FP5 D;  2K5Q A;  4CDC C;  4A93 H;  4XT3 B;  3O13 A;  4F7X A;  5ELB A;  1NSN S;  3A74 A;  4O2D A;  4NP5 A;  2WKD A;  1IL2 A;  3IKJ A;  1UUP A;  2V1C C;  5IOC A;  2QGQ A;  1KDA A;  1XMQ Q;  4JBK A;  1SNO A;  5DM7 3;  4KMU C;  2K5V A;  3SGI A;  5CYU A;  2D2C C;  2UXB Q;  1MD2 D;  5IT9 E;  1LAB A;  3I4N G;  3HEJ A;  3ULP A;  1N36 Q;  3GV3 A;  1WD0 A;  3D4W A;  5C44 H;  3GTL H;  5IWA L;  3HKZ B;  1QB5 D;  1QJO A;  3SK6 A;  3T1H Q;  4POG A;  4EGV A;  3G48 A;  2PI2 A;  1XYI A;  3NPP A;  4UPA A;  1I6V C;  4V19 0;  2R7Z H;  1ICF B;  1K9M C;  2NVQ H;  2YYZ A;  3CQZ H;  1DGS A;  2Y0S G;  1EYD A;  2Q2H A;  2XVS A;  2OQ0 A;  2JA8 H;  4A3J G;  4WJ4 A;  2H4O A;  2B39 A;  1B3A A;  1CI3 M;  5C3E H;  3OWF A;  2BDN A;  4IN3 A;  5FLX E;  1B9M A;  3TZD A;  4H02 A;  4BA2 I;  1LV9 A;  4HSP A;  3KDF A;  3CCM A;  1SNP A;  1CA5 A;  5C3X A;  1BVS A;  4LUO A;  1RCV D;  1MSH A;  1GM5 A;  5LMU L;  3F1Z A;  2PW5 A;  1CKN A;  2I0Q A;  4LF9 L;  4NKL A;  3X3M A;  5IOD A;  4J8Q A;  5D3I B;  3FP9 A;  4YWM A;  2UUA L;  2K04 A;  3DMU A;  1VCI A;  1NE3 A;  4IUN A;  1QCB D;  2B2V C;  4K2L A;  2HIV A;  3HZX A;  1GUO A;  3DM1 A;  4YY3 Q;  3EA6 A;  5EPK A;  1VMC A;  1SDF A;  2EXZ A;  5I6Y A;  3HOU H;  1VDZ A;  2F0L A;  4QMG A;  4KJN A;  2E75 C;  3UDG A;  1EY6 A;  2NTT A;  5EKL A;  2BOS A;  1SE3 A;  1VQ7 A;  4K0K L;  2F0P A;  2NVT B;  1NR2 A;  1B44 D;  3PSI A;  1CA6 A;  1GHJ A;  1XX8 A;  2ZJR A;  1LTA D;  4C3J G;  1CK1 A;  3SEB A;  2R61 A;  2SDF A;  3BVM A;  4IO9 A;  1PH5 A;  1VQ8 A;  2K32 A;  4AQY L;  4FYD A;  1RTO A;  3MAQ A;  4DK1 A;  1YVC A;  2E2I B;  3HGB A;  3W2D A;  2UXC L;  2BA0 A;  3M7G A;  2Z8L A;  4DV7 Q;  2PMZ E;  3HKS A;  3S1R B;  1WTH A;  4A3I G;  1A3T A;  4JI8 L;  1LTI D;  2EZV A;  1HNX L;  3K59 A;  1I4P A;  2WIN B;  4R1J A;  3URY A;  1C0A A;  3NSW A;  3JC6 6;  1EWC A;  4DV6 Q;  1JWU D;  2A6E C;  1NNX A;  3A5U A;  4A3L G;  1TS4 A;  2F4V L;  4GOP C;  2NB0 A;  2B2Y A;  1HTL D;  1HTP A;  3FVQ A;  3D0F A;  4FVM A;  1L0W A;  1SND A;  2BH8 A;  3PCO B;  1ENF A;  1XMQ L;  3ICE A;  2MP1 A;  4JI1 L;  4GNX A;  1G51 A;  3VDY A;  1AH9 A;  3H3V I;  1YHA A;  3SK5 A;  3DXJ C;  4ABN A;  2E8G A;  1HH2 P;  3GTG B;  2UXB L;  4BBS B;  5TSS A;  4DUZ Q;  4GLV B;  4LUV A;  1SFO H;  2R7F A;  4HIM A;  2F0J A;  4IPD A;  5I9P A;  4C3H B;  2B8G A;  1AE3 A;  1YNJ D;  5M5Y H;  4BY7 H;  4K8I A;  5FO7 B;  3J7A 5;  1PZI D;  3Q22 A;  2ZTC A;  3T1H L;  1PH4 A;  2KJX A;  1K83 B;  1U4M A;  1GOZ A;  4JBW A;  3S2D B;  2KUM A;  4X3S A;  1B7Y B;  3NE5 B;  1VQH A;  1EZ6 A;  2Z1C A;  3IFD A;  2CWA A;  1UWV A;  2Y0S B;  1U4P A;  4A3G H;  1PRT C;  4A3J B;  4KY5 A;  3MC0 B;  4U68 A;  3TBI B;  3HOV G;  1STY A;  2B63 G;  3S16 H;  1E1O A;  2Z6B A;  3RN2 A;  1RHP A;  3L2P A;  1WD1 A;  1ZKO A;  2E2I H;  3OPO A;  3KF6 A;  4O1N A;  5D65 A;  1Z6H A;  5A35 A;  1LT6 D;  1SNQ A;  3TP8 A;  1X65 A;  2EXD A;  1F9S A;  1I3Q H;  4ZRZ A;  4YCW A;  3CC7 A;  2JA5 G;  2G5D A;  1TU2 B;  3H3V C;  1EOV A;  4GKK Q;  5IGF A;  5M5W H;  1AZQ A;  4DUY Q;  2KEN A;  1QZG A;  3T51 B;  3I3C A;  1MBY A;  3J80 E;  4OX9 Q;  1IBM L;  4IFD I;  2JA7 G;  2VZA A;  3I90 A;  4A3M G;  2F0T A;  3U4Z A;  4XQN A;  1ASY A;  2R92 G;  5FO9 B;  2HT1 A;  3WWV A;  1IBK Q;  1V1O A;  3PUW A;  4ALP A;  5C4H A;  1PRT D;  3P75 A;  3QG1 A;  1LT5 D;  3GTG H;  2F03 A;  4LF4 Q;  4J15 A;  2EYH A;  4JI4 L;  1EQT A;  4V0B A;  3FDT A;  5JEA J;  4C3H H;  2PZT A;  4C3J B;  1KAA A;  3VA7 A;  4IUT A;  4IOC A;  2EIF A;  2FFK B;  5EBC A;  4DV2 L;  1L1O B;  5IP7 G;  1TWH B;  5J1Z A;  1TS2 A;  1S72 A;  3GD7 A;  4JI6 Q;  4IFD G;  1VQA A;  3N6R A;  3H0G G;  4HR7 B;  4DV7 L;  1MI2 A;  1EFW A;  5JJK A;  4H7B A;  4A3B G;  2JXM B;  4A3I B;  3GTP H;  2NTS A;  4RCN A;  5DM6 3;  1QG7 A;  3PUZ A;  2C5C A;  4B3M L;  1JOR A;  4R4Q A;  2CHB D;  3JAM L;  5LMN Q;  3S24 A;  4DR2 Q;  1KIX A;  4AYB B;  4LJZ C;  4U67 3;  1BNZ A;  2DJG C;  4CDD C;  5JAV A;  1IHZ A;  5CR3 A;  1IBL L;  5E4W C;  2WAC A;  1ET9 A;  4NXM Q;  1V9P A;  2LXJ A;  3D6C A;  1XTC D;  3S15 B;  2E76 C;  4ILW A;  1PTO H;  1SBB B;  3EVQ A;  1SYG A;  3V2T A;  1X3E A;  3A8I E;  1HPC A;  1JB3 A;  1GO3 E;  4A93 G;  1BOS A;  3NUC A;  1Q3L A;  4DN4 M;  4OEL B;  5IYB H;  1S5D D;  1JOQ A;  4WOR A;  3STB C;  4IAL A;  2IJ0 A;  4MHE A;  2J7Z A;  3M3Y B;  1XMO Q;  1CKO A;  3I2Z A;  1EU4 A;  4JBM A;  1NCV A;  3E5S A;  1SRO A;  4EQN A;  2I5L X;  2JE6 I;  4NDX A;  4G7H C;  2DY7 A;  2C9O A;  2NVX B;  5LL6 S;  2R93 H;  5CBE E;  1K28 A;  1L0Y B;  3BZC A;  3GP7 A;  4DA2 A;  4DK3 C;  3BVZ A;  5K36 G;  2F0W A;  4KKS A;  2QDL A;  1B4O A;  1TWA B;  1GHK A;  4A3F B;  5C44 G;  1BUV T;  1STG A;  2GVB A;  4K5V A;  4X65 Q;  2NUC A;  2B63 B;  1BCP F;  1TWG B;  3FEW X;  3NBI A;  3NHH A;  3Q24 A;  4DV5 Q;  1KDB A;  4LMQ D;  1IYU A;  1Q7Y C;  3NQT A;  2YV5 A;  4DR3 Q;  2Z6K C;  3L7Z C;  2G9D A;  1PFN A;  2R7Z G;  2BCO A;  3AU7 A;  4G7O C;  2JA8 G;  5HGT A;  3H91 A;  3J7A F;  2JA5 B;  5J3B A;  3N52 A;  3TSS A;  5C3E G;  1NJI C;  5EQ0 A;  5C3W A;  3TS2 A;  4GKK L;  1TWC H;  3WOF A;  1LM0 A;  2B2T A;  3F2C A;  4DUY L;  1CT1 D;  1PDQ A;  1QNK A;  5C0X H;  4B3T Q;  2F52 A;  1N8R C;  2OXP A;  2PNR C;  5NUC A;  2EY2 A;  1A3V A;  4OX9 L;  1U0L A;  1EY9 A;  5K5P A;  2JA7 B;  1TII D;  4QF4 A;  3S15 H;  1JOO A;  1Q1E A;  1X55 A;  2WKC A;  1SYD A;  5JVG 3;  2R92 B;  1KAB A;  2L5T A;  2IX1 A;  1WJJ A;  1JWS D;  1IBK L;  2EPB A;  1DJR D;  3EQL C;  1S40 A;  1H9S B;  3H09 A;  3K6O A;  3R2T A;  4A3E B;  2R3Z A;  3K7A B;  1FYC A;  1LAC A;  4RCO A;  1ASZ A;  1EYC A;  5IGD A;  1VQ6 A;  3A8J E;  1N33 L;  3HG9 A; 
#chains in the Genus database with same CATH homology
 1TWF H;  2RHS B;  3M3Y H;  4OO1 I;  3RLN A;  3AFP A;  1PH6 A;  4A93 H;  2MQH A;  4BBR H;  4GKJ L;  2HQL A;  3AYH B;  3T1Y Q;  3G6E A;  1XPO A;  2NVX H;  3A74 A;  4JG2 A;  4O2D A;  3RLF A;  4JI7 L;  4LF6 Q;  3RNU A;  1IL2 A;  4KHZ A;  4LNQ A;  2V1C C;  1N34 L;  1MKH A;  3MXN B;  3W1B A;  1VS0 A;  2HHH Q;  2NZO A;  4C2M H;  2QGQ A;  4X62 L;  4DV1 L;  1XMQ Q;  2KHI A;  4JBK A;  4GN3 B;  4LF5 L;  3M4O H;  1VQG A;  4BXX H;  4DR7 Q;  1EQQ A;  2UXD L;  2K5V A;  3SGI A;  4A3F H;  1XPU A;  5C4X G;  3AQQ A;  2VUM H;  5IWA Q;  1VQN A;  3AEV A;  3KFU A;  2UXB Q;  5LMN L;  5IT9 c;  2JQO A;  1NTG A;  2CKZ B;  1WCM H;  1FGU A;  1SRU A;  5C4J H;  4LF6 L;  3I4N G;  2CWP A;  2HHH L;  2WAQ G;  2L15 A;  4A3L G;  3G4S A;  2UU9 Q;  3ULP A;  4DR7 L;  1HNW L;  1N36 Q;  4OXP A;  4OO1 G;  3HOZ H;  2K5N A;  3L0O A;  5C44 H;  3EN2 A;  1M90 C;  1D8L A;  4NXM L;  5IWA L;  1SE8 A;  1E3P A;  2KCT A;  2LXK A;  1PHJ A;  3GTL H;  2QA4 A;  2ATW A;  3T1H Q;  3ZJY C;  3S1N H;  5ELO A;  1HZB A;  4JI0 L;  2D62 A;  4YCV A;  3PIP A;  3UE1 A;  4POG A;  3FHW A;  4A3K H;  3G48 A;  2PI2 A;  4KHP Q;  3M4P A;  1YHQ A;  1AH9 A;  3RN5 A;  1AE2 A;  4UPA A;  2JA6 G;  4UP8 A;  1C9O A;  1N36 L;  1IXR A;  2ASB A;  4LF7 Q;  2R7Z H;  4GN4 B;  2N3S A;  1K9M C;  2NVQ H;  2YYZ A;  2RCN A;  3CQZ H;  3I55 A;  1DGS A;  2JA9 A;  2Y0S G;  2YTX A;  4P73 A;  4R4T A;  2Q2H A;  1MJC A;  1EWI A;  2OQ0 A;  1YZ6 A;  4AH6 A;  5IYC H;  5BR8 Q;  4A3J G;  1YI2 A;  4WJ4 A;  2ALY B;  3EIV A;  3UDI A;  2Q2I A;  4KHP L;  5C3E H;  5IYD H;  1Q8K A;  5IE8 A;  2H5X A;  5FLX c;  3HOZ G;  1LTL A;  1NBW A;  2UUB Q;  2VY3 A;  2I5H A;  2C35 B;  1VQC A;  1XJV A;  2NVT H;  2ZTE A;  1K8A C;  4H02 A;  2UUA Q;  3CF5 A;  3KF8 B;  4BA2 I;  3KDF A;  3CCM A;  3CCS A;  4BY1 H;  3MEF A;  2KHJ A;  1BVS A;  3PGZ A;  4LUO A;  4A3E H;  1GD7 A;  1YJW A;  1GM5 A;  5LMU L;  2JA8 H;  3F1Z A;  1QZH A;  2WFW A;  3I7F A;  1CKN A;  2CQO A;  2I0Q A;  4LF9 L;  4B3R Q;  3RLO A;  1R9T H;  3I4M G;  2UUB L;  1EUJ A;  3S1M H;  3FP9 A;  4YWM A;  1XNQ Q;  5GQO A;  3AFQ A;  1OXT A;  2UUA L;  1VCI A;  4JYA Q;  1NE3 A;  1CKM A;  3NEM A;  5FLM G;  4QL5 A;  2RHQ B;  3STB D;  3S1R H;  3CCR A;  3BZK A;  4NXN Q;  3GTO H;  4P75 A;  5IP9 G;  4NB3 A;  4OWX B;  2HIV A;  1VQ5 A;  2VL6 A;  3M85 A;  2AWO A;  5AJ3 Q;  4DV5 L;  2JK8 A;  4K0K Q;  1VQF A;  4YY3 Q;  3PO3 G;  1I5F A;  2DUD A;  2NVY H;  2WB1 E;  3CC4 A;  3W1G A;  1I6H H;  4APV A;  2DGY A;  3I4O A;  4QIW E;  4YCU A;  1X54 A;  4BY1 G;  3RR5 A;  4A3G G;  2VNU D;  1MJE A;  3HOU H;  4DR5 Q;  1PH7 A;  4JYA L;  1A62 A;  2VW9 A;  3PUX A;  5M5X H;  3UDG A;  2WP8 J;  4A3D G;  4MTN A;  1JMC A;  3TRZ A;  4AQY Q;  1UE7 A;  5H1S E;  3PO2 G;  1VQ7 A;  4K0K L;  3UE0 A;  2QEX A;  1HR0 Q;  4JV5 Q;  4YY3 L;  3CCU A;  4L5Q A;  4DV3 L;  3KDF B;  2UXC Q;  3PSI A;  2ZJR A;  2KBN A;  1KL9 A;  4TVA B;  4LFA L;  3DM3 A;  1J6Q A;  4RMF A;  3K7U C;  1V43 A;  5HY6 A;  3JAM i;  4HJ8 A;  1Q82 C;  4HIK A;  4LF8 Q;  1PYS B;  5FJ8 G;  5C4X H;  4IO9 A;  1PH5 A;  1VQK A;  1CKN B;  4JI8 Q;  3JAM c;  1VQ8 A;  3UDX A;  3S2H H;  4BBS H;  4LFC Q;  4AQY L;  3BJU A;  1Q12 A;  1HNX Q;  2ZJQ A;  4PZ8 A;  1JJ2 A;  3I4N H;  1YVC A;  4YWK A;  4HJA A;  1YIJ A;  3PUY A;  2BA0 A;  2UXC L;  4DV0 Q;  3J81 j;  4DV7 Q;  3HOW G;  4LUZ A;  1P16 A;  1RL2 A;  3HOU G;  1Y1V G;  1HR0 W;  4X66 Q;  2F4V Q;  1KRS A;  2PMZ E;  3HKS A;  3HKZ E;  4DK6 C;  2AWN A;  2N49 A;  1GKH A;  4A3I G;  1KC8 C;  4GLA C;  4A4I A;  4JI8 L;  2EQS A;  1YJ9 A;  1UE5 A;  3PF5 A;  4UY8 C;  4GOP B;  1N32 Q;  4OWT B;  3ER0 A;  1VQD A;  1HNX L;  4R1J A;  1PH3 A;  4GLX A;  3I56 A;  3KYH C;  4GS3 A;  1C0A A;  4JI1 Q;  1K83 H;  3JC6 6;  2K52 A;  1QVG A;  4DR6 Q;  4DV6 Q;  3S2D H;  4EQ5 A;  5GAG C;  5E7N A;  5GAD C;  3A5U A;  5EAY A;  2E5L Q;  1NMF A;  2A8V A;  4GN5 A;  2JA6 H;  1KD1 C;  4X66 L;  4GOP C;  1FJG Q;  5M3M G;  2F4V L;  3T1Y L;  4BBS G;  3CPW A;  2ZM6 Q;  3D0F A;  4JCV E;  5DLQ E;  1V1Q A;  4JC0 A;  3HOX G;  1L0W A;  1HNZ Q;  4Y52 H;  3DLL A;  1UE1 A;  1WOC A;  4A3J H;  2BH8 A;  2BH2 A;  2MO0 A;  3PCO B;  4HIO A;  1XMQ L;  1E22 A;  3EBE A;  3UDF A;  2ES2 A;  3ICE A;  4JI1 L;  4GNX A;  1G51 A;  3U50 C;  4DPG A;  5IY0 A;  3VDY A;  3S17 H;  4DV4 Q;  2VQF Q;  4L5T A;  2YTY A;  4DV6 L;  1YHA A;  3H3V I;  4WJ3 M;  1HZ9 A;  2E8G A;  1HH2 P;  3G71 A;  3CME A;  3FKI G;  3H3V H;  2UXB L;  1PH1 A;  4OON A;  2R7D A;  3HOY G;  2RF4 A;  4DUZ Q;  4GLV B;  1K73 C;  4LUV A;  3K0X A;  1SFO H;  1PVO A;  2GN5 A;  1HNZ L;  2R7F A;  4HIM A;  1M1K C;  3S1Q H;  4IPD A;  3HOV H;  2UU9 L;  2N8N A;  1PH2 A;  1AE3 A;  1HZC A;  1LYL A;  1SR3 A;  5M5Y H;  5JEA G;  1VQM A;  4BY7 H;  1X3F A;  1OTC A;  3I4M H;  3PUV A;  4TQU S;  2PI2 E;  2AKW B;  1XTD A;  3OTO Q;  3J7A 5;  2ZTC A;  3T1H L;  2OTJ A;  3ULJ A;  1PH4 A;  1QVF A;  1Q86 C;  5FLM H;  4DUZ L;  1QVC A;  5IP9 H;  4UP9 A;  2PQA B;  4PZ6 A;  3F2B A;  4P72 A;  5GRO A;  4JBW A;  2F3I A;  2Q2U A;  2E2H H;  3PO3 H;  4LFB Q;  1J5E Q;  1B7Y B;  3GTJ H;  2FXQ A;  1VQH A;  1XPR A;  4LF7 L;  3A0J A;  2CWA A;  1UWV A;  4IJH A;  4A3G H;  4MZ9 A;  4DNI A;  4GNX B;  5BR8 L;  2UUC Q;  4X6A H;  1BKB A;  3HOV G;  4BA1 I;  2B63 G;  4A3D H;  3S16 H;  2D0P A;  4BY7 G;  1E1O A;  3PO2 H;  4XTC S;  1LUZ A;  4XIG S;  4PMW A;  3RN2 A;  3L2P A;  2E2I H;  4R4I A;  4LFB L;  3KF6 A;  4GNX C;  4JI2 Q;  2MO1 A;  2Q2T A;  2B3G A;  4C3J H;  1S3O A;  1X65 A;  2NN6 I;  3E9H A;  5FJ8 H;  2VQE Q;  2EXD A;  1I3Q H;  2ZJP A;  1PA6 A;  3B6Y A;  2OWO A;  4YCW A;  4KLK A;  3CC7 A;  2HIX A;  4R4O A;  4YWL A;  2UUC L;  2ZTD A;  1IBM Q;  3RZD H;  2CCZ A;  2JA5 G;  4A3C G;  1TWH H;  1Y1W G;  4B3R L;  1KQS A;  1EOV A;  4GKK Q;  1L1O A;  4JBJ A;  3K8A A;  4GOP A;  5M5W H;  3KJO A;  4DUY Q;  1XNQ L;  1VQJ A;  1G6P A;  3HOW H;  2IX0 A;  2KEN A;  3J80 c;  1E1T A;  1QZG A;  1Y1V H;  1D7Q A;  4DAM A;  4B3S Q;  4LF5 Q;  2A19 A;  4NXN L;  3GTQ H;  2N78 A;  4A3I H;  2BA1 A;  3CAM A;  2R6G A;  4JI4 Q;  1CSQ A;  5ELN A;  2YU9 H;  4OX9 Q;  5AJ3 L;  1IBM L;  4QJF A;  4IFD I;  4NPS A;  3CC2 A;  2JA7 G;  2VZA A;  1NMG A;  2K14 A;  2IT1 A;  3E0E A;  3NEL A;  4A3M G;  3M7N A;  4JI5 Q;  2XTI A;  3U4Z A;  5C0X I;  4POF A;  1ASY A;  2R92 G;  4IOA A;  3GDE A;  4X64 Q;  1JB7 A;  2HT1 A;  3H0G H;  3WWV A;  1IBK Q;  3CCE A;  3PUW A;  4DR1 Q;  2LSS A;  4A3L H;  4ALP A;  3CCJ A;  4DV2 Q;  4DR5 L;  4A3B H;  4B3S L;  1PYB A;  5M3M H;  1A0I A;  3TS0 A;  3GTG H;  4LF4 Q;  1FVI A;  2NN6 G;  1OXX K;  1H95 A;  1PV4 A;  4J15 A;  4JI4 L;  3M9B A;  3KF6 B;  3HOX H;  1HR0 L;  3CCL A;  4JV5 L;  5JEA J;  1XNR Q;  4C3H H;  1GVP A;  4IOC A;  3S14 H;  2EIF A;  4LF8 L;  1CSP A;  3U4V A;  3ERS X;  1CUK A;  4JOI A;  4DV2 L;  1O7I A;  2D0O A;  2MFI A;  1IZ6 A;  3FKI H;  1X9N A;  1PH8 A;  2JEA I;  1L1O B;  4B3M Q;  4LF4 L;  4LFC L;  5IP7 G;  3HOY H;  2WAQ E;  3KLW A;  4AYB G;  4DKA C;  1S72 A;  1E24 A;  3GD7 A;  1VQ9 A;  4JI7 Q;  3LGJ A;  4PZ7 A;  4JI6 Q;  4IFD G;  1VQA A;  4DV0 L;  1XNR L;  4DV7 L;  3H0G G;  4QQB X;  1YJN A;  4L5R C;  1N9W A;  2PQA A;  1EFW A;  5C0X G;  1IBL Q;  4OWW B;  1L1O C;  3NBH B;  4A3B G;  1B8A A;  2UXD Q;  5JJK A;  4IPC A;  4R4C A;  4JI3 Q;  1JE5 A;  5M3F G;  3GTP H;  2A1A A;  3K80 C;  1Z9F A;  3PUZ A;  4B3M L;  4P74 A;  1N32 L;  4DAY B;  4R4Q A;  1HJP A;  5LMN Q;  5GAH C;  3GTK H;  1FL0 A;  1W3S A;  1YEZ A;  3S24 A;  4DR2 Q;  1KIX A;  2IHE A;  1OXU A;  1IYJ B;  4UP7 A;  4JI6 L;  2AHO B;  1HZA A;  3RZO H;  4DR6 L;  1X6O A;  4PG3 A;  2E5L L;  1IBL L;  1HNW Q;  1TWA H;  2Y0S E;  1FJG L;  4JI3 L;  3Q8D A;  3F8T A;  1EIF A;  3PIO A;  1E7Z A;  2OTL A;  2ZM6 L;  4NXM Q;  1V9P A;  1K3R A;  2LXJ A;  1OXS C;  1X3G A;  4LW1 A;  3HKZ G;  1JJG A;  4LWC A;  4DR2 L;  4JI0 Q;  1G29 1;  1WYD A;  4QY7 A;  2B63 H;  1TWG H;  2Z6K A;  3OW2 A;  4A75 A;  4DV4 L;  2VQF L;  5LMN W;  1X3E A;  2CFM A;  3KOJ A;  4YHH Q;  1VQI A;  2K4K A;  1GO3 E;  3TQY A;  4A93 G;  4BBR G;  1VQL A;  1C7Y A;  4HJ7 A;  1SN8 A;  1Y14 B;  1U5K A;  5IYB H;  4Y7N H;  1SLJ A;  4C3I H;  4JOI C;  3F2D A;  1VQB A;  3CPF A;  2KCM A;  3STB C;  1W2B A;  1K0R A;  4A3C H;  2JA5 H;  1KHI A;  4P71 A;  4EX5 A;  3TRE A;  3CXC A;  1Y1W H;  3J7Z C;  1NY4 A;  1Q46 A;  1PFS A;  4AIM A;  1VQE A;  1XMO Q;  1A63 A;  1CKO A;  4A3F G;  1JJC B;  2JJQ A;  3I2Z A;  4YHH L;  2NZH A;  4JBM A;  3OTO L;  1Q81 C;  2B29 A;  2VUM G;  1SRO A;  4L5S A;  2I5L X;  2JE6 I;  2E2J H;  2OCE A;  1WCM G;  4QGU A;  2R93 H;  1UE6 A;  3BZC A;  4DK3 C;  1Z47 A;  5JJI A;  5K36 G;  1P8L A;  5LMU Q;  2K75 A;  1T9H A;  2JA7 H;  1B70 B;  2ID0 A;  5GAE C;  1X56 A;  1QUQ A;  1WI5 A;  1PH9 A;  3HFZ B;  1WFQ A;  4KI0 A;  4A3M H;  1XMO L;  1J5E L;  4LF9 Q;  4HJ9 A;  1L2F A;  3D31 A;  3CD6 A;  2R92 H;  5IYB G;  5HGQ A;  3OYY A;  5C44 G;  1TXY A;  4BXX G;  2GVB A;  1SMX A;  4ME3 A;  4X65 Q;  1I94 Q;  2K50 A;  4A3K G;  1VQ4 A;  3NEN A;  4IFD J;  3IRB A;  3K7A H;  3J80 i;  4DV5 Q;  1K8G A;  1Q7Y C;  1OXV A;  2YV5 A;  1YIT A;  1KRT A;  5C0X J;  4DR3 Q;  2Z6K C;  4RG1 A;  3L7Z C;  4JI2 L;  3BU2 A;  2YTV A;  4FDB A;  3J81 i;  2R7Z G;  1UEB A;  3CW2 C;  3CCQ A;  2VQE L;  2R93 G;  3CMA A;  4HJ5 A;  5IYC G;  3J81 c;  2JA8 G;  4X65 L;  3GO5 A;  1KXL A;  1I94 L;  5IP7 H;  5J3B A;  1BBW A;  5C3E G;  5IYD G;  3A5Z B;  1NJI C;  3TS2 A;  3U58 A;  1TWC H;  3W5O A;  4GKK L;  1EQR A;  4IPG A;  1JT8 A;  1LM0 A;  3F2C A;  3CCV A;  4DUY L;  1A8V A;  2I5M X;  4DR3 L;  1RIP A;  4DV3 Q;  2XGT A;  3ULL A;  4A76 A;  4B3T Q;  4LFA Q;  1YNX A;  2F52 A;  1N8R C;  1VQO A;  4HID A;  5M3F H;  4IJL A;  2JEB I;  4A3E G;  1Q1B A;  4AYB E;  1QUQ B;  4OX9 L;  3K81 C;  1U0L A;  3H15 A;  1I50 H;  3E9I A;  2IY5 B;  4DR4 Q;  3S15 H;  3GTM H;  1Q1E A;  1N33 Q;  1X55 A;  2GVA A;  4JI5 L;  3PV0 A;  3TEH B;  2MNA A;  1YHB A;  3KJP A;  1YBY A;  4X64 L;  2IX1 A;  3M4Q A;  1WJJ A;  2OQK A;  1IBK L;  3PF4 A;  2WB1 G;  4DR1 L;  1VQP A;  5JJL A;  4IPH A;  1MIU A;  4B3T L;  4MNO A;  1S40 A;  4GKJ Q;  1EYG A;  1BBU A;  2VS1 A;  2AMC B;  2IHF A;  2Z0S A;  4O0A A;  2K5H A;  1ASZ A;  4DR4 L;  1N34 Q;  1KAW A;  3CP0 A;  1VQ6 A;  2PNH A;  1EIY B;  1N33 L;  4X62 Q;  4DV1 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...