2KHJA

Nmr structure of the domain 6 of the e. coli ribosomal protein s1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
89
structure length
89
Chain Sequence
MFNNWVALNKKGAIVTGKVTAVDAKGATVELADGVEGYLRASEASRDRVEDATLVLSVGDEVEAKFTGVDRKNRAISLSVRAKDEADEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S1
publication title Probing the relationship between Gram-negative and Gram-positive S1 proteins by sequence analysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosomal protein
total genus 9
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2khjA00
3M4PA 3CCJA 4GNXA 4A3EG 3PUXA 2OCEA 5C44H 1PH6A 1B8AA 1N9WA 1EYGA 1SROA 3HOXH 5IP9H 2A8VA 4EX5A 1TXYA 4UP8A 1RL2A 1VQ9A 4LF6Q 2EIFA 3CCMA 3J7A5 1YBYA 4B3RL 2VS1A 4Y52H 4YCVA 3CQZH 1G51A 4BXXG 1YJWA 1AE2A 1VQIA 4L5RC 4DPGA 3J7ZC 1EUJA 2OWOA 2RHQB 4IPDA 1IBLQ 2JA9A 2K5VA 3STBD 4DUYL 1YITA 3H15A 1W2BA 4A3GH 1PVOA 3K8AA 3PUZA 5LMNW 1Y1WG 2Q2IA 4DV1L 1JJ2A 4DV0L 1XMQL 3PCOB 3CCSA 1TWAH 4DV5L 3RLOA 3ULPA 1EIYB 3S1MH 4DR6L 4LFAQ 2E8GA 3G71A 4A3KH 1XPOA 3S17H 5IYCH 1CKOA 1I3QH 4AIMA 1V43A 3PF5A 1TWCH 1JB7A 3FKIH 4H02A 2F52A 2N8NA 2YTVA 1C7YA 4IO9A 1QUQB 1CKNA 3I4NG 4DR5Q 3HOWH 1Q1EA 4A3DH 1ASZA 3G4SA 1VQOA 1PH1A 2ZJQA 4YWLA 3S2HH 1SRUA 2NN6G 3CCVA 1RIPA 4HJ9A 1VQPA 4GN5A 3GTQH 5JEAJ 4DR2L 3S2DH 2CWAA 1VQCA 4C2MH 1G6PA 3J80c 4YHHQ 3ULJA 2ZM6Q 5GAEC 3UDXA 3CPFA 3AFQA 3RZDH 1S40A 2IY5B 2PQAA 3S24A 4UP9A 5M3FH 4HIKA 4P72A 4JI7Q 1I50H 3TRZA 4WJ4A 5FLMG 1QVCA 2JEAI 2R6GA 1X6OA 2FXQA 5J3BA 1QZGA 2AWNA 4B3MQ 1PYBA 4JYAQ 4GKJQ 4JBWA 4JI3Q 3K0XA 4LUVA 4MNOA 1S72A 3PO3G 5C44G 4AQYL 1SMXA 1PHJA 4JI5Q 1HNWQ 5IP9G 4C3JH 4X65L 1EWIA 4L5TA 1BKBA 4IPCA 4YY3Q 1MIUA 1J6QA 3L7ZC 4LF9L 1K83H 3M9BA 2R7DA 1G291 4UPAA 2WB1E 4A4IA 1K8GA 2NZOA 1SN8A 4FDBA 1VQKA 1OXTA 4JI2Q 3TQYA 3S15H 2JA6H 4J15A 2RCNA 3CCEA 3T1YQ 3JAMc 1N33L 1CKMA 1FGUA 1KRSA 3F8TA 3KYHC 4GN3B 3RLNA 5IWAL 4OX9Q 4OO1I 2HIVA 1NBWA 2D0PA 2YYZA 1KRTA 1SR3A 4X64L 2NVYH 1YZ6A 4QGUA 4JBMA 1UE7A 2VQEQ 4LF4Q 4A3KG 5C3EG 4JI0Q 2E5LQ 1FJGQ 2NVQH 1M1KC 1WYDA 3CPWA 4JV5Q 1VQDA 3RR5A 4DV2L 2CQOA 2HHHQ 3H3VI 3FKIG 1XNQQ 3KFUA 3J81i 3K7UC 3G6EA 5EAYA 1OXVA 4DV7L 1Z9FA 2Q2HA 1K8AC 1K3RA 1DGSA 1IBMQ 1HR0W 2ZTCA 1YI2A 1A63A 4LF8Q 1GKHA 3E9IA 2CKZB 4P75A 1IXRA 2R7FA 1CUKA 1VQAA 4YWMA 4DUZQ 4JI4L 3I4MH 3CD6A 1MKHA 1C9OA 1Q81C 4JBKA 2R92H 4JI8Q 3PIPA 4GNXC 2UXBL 3OTOL 1L2FA 1BBWA 3ER0A 1KC8C 1NTGA 1KD1C 3D31A 4A76A 4KHPL 2K14A 4JCVE 1MJEA 2VNUD 2VW9A 5LMUQ 4OWTB 3W5OA 4DV6L 4JI1Q 1X55A 2Q2UA 1EIFA 1XMOL 2WAQG 5ELOA 4IOCA 3S1RH 1XJVA 1IL2A 2RHSB 4GNXB 4AH6A 4DK3C 4HIDA 3HOYG 1NE3A 1GD7A 3E9HA 3NENA 1UEBA 2BH8A 4DV3Q 3GTJH 4LFCL 1TWFH 1XNRL 1AH9A 2UUBQ 4NB3A 4DAMA 2JA5H 2B63H 4A3LH 1L0WA 2HT1A 1VQ7A 1I94L 3KJPA 2UUAQ 1E1OA 3S16H 5GQOA 1IZ6A 4LWCA 2E2JH 4OWXB 5C4XG 3KLWA 1VCIA 2ZJPA 3BZCA 1KQSA 1VQ6A 3G48A 3HOVH 4NXMQ 4POGA 3H0GG 1LM0A 1YJNA 1YEZA 3CXCA 3RNUA 1IBKL 2UXCQ 1VQGA 1A0IA 2IHEA 4JOIA 2PNHA 5LMNL 1N32Q 2IT1A 1PYSB 2KHJA 1B7YB 5C0XJ 2ASBA 4DR4L 4X66L 1Q8KA 4LNQA 5DLQE 3BJUA 2MO1A 3T1HL 2F4VQ 4DR7L 1JT8A 1E3PA 4BBRH 1VQHA 4A3MH 2KCTA 2YTYA 4GN4B 5BR8Q 1VQ5A 3ZJYC 1SE8A 1VQLA 3RN5A 3BU2A 1Y1VG 3GTGH 2E2HH 1BVSA 2D0OA 3RLFA 4A3BH 4C3HH 4DR1Q 1E24A 3KOJA 4LFCQ 1R9TH 2NVTH 3PIOA 3IRBA 3GTPH 1KL9A 5IYBH 5FLXc 4A3JH 4IJHA 4POFA 4HJAA 4GKKQ 3M4QA 1VQBA 3EIVA 1YVCA 2RF4A 1XPRA 1P8LA 4QQBX 2ES2A 1Q46A 3KF6A 2DGYA 2ALYB 2Z0SA 2PQAB 5FJ8G 3KDFA 3CCUA 3HOUH 2NZHA 2VUMH 4R4CA 4A3CH 1X56A 1KAWA 1HNXL 4DAYB 4NXNL 4X6AH 3ULLA 4BBSH 3Q8DA 2K4KA 4B3RQ 3W1BA 2AMCB 2PMZE 3AFPA 4P73A 5HGQA 5JJLA 1VQFA 1HH2P 3FHWA 4YCWA 1J5EL 4PZ8A 2UUCL 4OO1G 4JBJA 4DUYQ 4GLAC 4R4IA 4JI6L 5AJ3L 1I5FA 4LW1A 3HKZE 4DV1Q 1MJCA 3A74A 3PUWA 4PZ6A 4DV0Q 4DV5Q 4A3FH 1XMQQ 2JA5G 4A3LG 1WCMH 4DR6Q 1YHQA 4JG2A 1JMCA 3RN2A 4UY8C 2IX1A 2JA7H 2JA8H 4IOAA 4BY7G 1YHAA 2WB1G 4JC0A 1GVPA 3F2BA 2R93H 4O2DA 3U58A 2BA1A 1X3FA 1PFSA 3HOVG 1WFQA 2CFMA 4L5QA 3HOXG 4YWKA 1LTLA 4LF7L 3CC2A 1N8RC 5JJIA 4KHZA 1PH5A 1HNZL 4OONA 4WJ3M 1VQMA 5C0XG 3I56A 5GAHC 4GOPA 4TVAB 2K50A 5GROA 3TREA 1QUQA 5E7NA 3SGIA 2KCMA 1X3EA 5IT9c 4HJ7A 1VQ4A 1HZ9A 2UU9L 4IFDI 3U4ZA 3F2CA 3CCQA 1VQNA 3I2ZA 3VDYA 2Q2TA 1BBUA 5M3MH 4A3GG 4DR2Q 1A8VA 3JC66 2QA4A 5K36G 2UXDL 4A3BG 2C35B 1YHBA 2LXKA 1OXSC 1VQEA 3OW2A 2OTJA 5IYCG 1HR0L 5IYBG 3GTOH 4B3SL 5IY0A 5M5WH 2ATWA 1UWVA 2JQOA 4BY1H 3B6YA 1NJIC 3M3YH 2XGTA 3GD7A 1PH8A 3PO2H 2WFWA 1N36L 5IP7H 2KBNA 2K5HA 1KHIA 4AQYQ 3HOUG 2NN6I 3M85A 1GO3E 4X62L 3HOZH 1GM5A 3HOWG 1LYLA 4X65Q 1D8LA 4TQUS 4LFBL 4A3DG 1E1TA 1WOCA 3CAMA 5M5YH 4BBSG 2A1AA 1D7QA 4B3TL 4LF5L 4LF9Q 3I4OA 4K0KL 2DUDA 1VS0A 4MTNA 2VQFL 4DKAC 4P74A 3DLLA 1V9PA 2GVBA 2VY3A 4JOIC 3K81C 1JE5A 1N33Q 5IWAQ 1NMFA 3STBC 1PH7A 4L5SA 3L2PA 4IFDJ 5M3FG 4X64Q 1X54A 2JA8G 4DV4L 3GTLH 3WWVA 1HZAA 2JE6I 2ID0A 2MO0A 1PH3A 2YTXA 2R93G 1P16A 4DV2Q 2B3GA 1ASYA 2PI2E 5GADC 3D0FA 1TWGH 4HIMA 3S1NH 1S3OA 3J80i 4DR3L 4DV7Q 3UDIA 2OQKA 3I4NH 4LF6L 2KENA 4LUOA 1PH4A 4P71A 1Q12A 4HIOA 4PZ7A 4JI4Q 4AYBE 1IBLL 4B3TQ 5M3MG 2UXBQ 2JA6G 1U5KA 1WJJA 3OTOQ 3OYYA 4ALPA 2LSSA 1N34L 5IE8A 2A19A 2BH2A 2IX0A 4KHPQ 3U50C 2GVAA 2BA0A 4DV6Q 1XMOQ 1V1QA 3KJOA 1T9HA 1UE6A 3GTKH 1K0RA 5FLMH 1CKNB 1B70B 1Z47A 3KF6B 3W1GA 1AE3A 4OWWB 3A0JA 3KDFB 2B29A 1Q1BA 3NEMA 1VQJA 4KLKA 1C0AA 2Z6KA 1YIJA 4A75A 3A5ZB 3PO2G 1A62A 1XNRQ 3PO3H 5IP7G 1JJGA 1WI5A 3JAMi 2CCZA 3NBHB 1OTCA 3HOZG 1E7ZA 4DR5L 4DR3Q 2JK8A 3K80C 2OTLA 3DM3A 4GLVB 1I94Q 3I4MG 5IYDH 3TS0A 2PI2A 3CMAA 1X9NA 1H95A 1HJPA 1L1OA 4RMFA 2R92G 1QVGA 4IJLA 3UDGA 4IPHA 3CCRA 2HIXA 1K9MC 3J81c 3HKZG 4YHHL 3I7FA 2ZM6L 4A3IH 1IBKQ 1NY4A 3CC4A 5LMNQ 1FVIA 2R7ZH 3GO5A 4IFDG 1E22A 2V1CC 4GOPC 4GLXA 4GS3A 1N34Q 4JI7L 2AKWB 4X66Q 2LXJA 4DR4Q 2L15A 2EXDA 2F3IA 4LUZA 5C3EH 2MQHA 5HY6A 3U4VA 3T1HQ 1PH9A 4B3ML 4DR7Q 4JYAL 4GKJL 2K5NA 2I5HA 4QIWE 1OXUA 1TWHH 2D62A 4MZ9A 4JI3L 3F2DA 1CSQA 2KHIA 4GOPB 2QGQA 4JI5L 3J81j 2B63G 3S14H 1OXXK 1PV4A 2E2IH 1HNWL 2CWPA 2N78A 4YY3L 4PG3A 3PV0A 3CC7A 3MEFA 1X3GA 1VQ8A 3PGZA 2YU9H 5C4JH 3HKSA 3TS2A 3BZKA 1PH2A 4JI2L 2ZTDA 3NELA 4QJFA 3T1YL 2YV5A 1EFWA 2K52A 1HNXQ 3GDEA 2Y0SG 2VQEL 4LF4L 4NXNQ 2EQSA 4JI0L 2E5LL 1FJGL 4BA2I 1JJCB 3L0OA 4BBRG 4JV5L 4A3MG 2I5MX 3HOYH 1J5EQ 5GAGC 1PA6A 2HHHL 5M5XH 2UUCQ 1XNQL 1YJ9A 4DK6C 3M4OH 2MNAA 4JI6Q 4NPSA 5AJ3Q 1IBML 3LGJA 3S1QH 1UE1A 1KXLA 2NVXH 1EQQA 1EQRA 4A3JG 4EQ5A 4LF8L 2Y0SE 3CF5A 3M7NA 1U0LA 1Y14B 3PSIA 3UE1A 5IYDG 3UDFA 4DUZL 2AWOA 5C4XH 4A93H 4JI8L 4A3EH 4HJ8A 3ICEA 1M90C 3EBEA 3H0GH 4LF7Q 1XPUA 2VUMG 4A3CG 4A3IG 4XTCS 1SLJA 3TEHB 1NMGA 1W3SA 1HZCA 5LMUL 1HNZQ 3PUVA 2I5LX 4O0AA 4JI1L 4HJ5A 1Q82C 4OX9L 2R7ZG 4OXPA 5ELNA 4BXXH 1LUZA 2UU9Q 2WP8J 2I0QA 4RG1A 2VL6A 3I55A 4PMWA 4DV3L 2K75A 3HFZB 4QL5A 1KIXA 1Y1WH 1Y1VH 4R1JA 2UUBL 1O7IA 2UXDQ 1QZHA 4A3FG 3AYHB 3AEVA 1WCMG 4R4TA 2JA7G 1SFOH 2UUAL 1HR0Q 2HQLA 4AYBG 2AHOB 1EOVA 2MFIA 3CW2C 3PUYA 2GN5A 4B3SQ 2VZAA 2QEXA 4R4QA 3GTMH 3ERSX 1I6HH 2XTIA 5C0XI 4BA1I 1Q7YC 4NXML 1QVFA 2Z6KC 3AQQA 3A5UA 2N3SA 4QY7A 2H5XA 1N36Q 2UXCL 5JEAG 2JJQA 5FJ8H 1N32L 3F1ZA 4X62Q 1K73C 4Y7NH 2ZTEA 4R4OA 4LFBQ 1FL0A 2N49A 4ME3A 5JJKA 1IYJB 2OQ0A 1L1OC 2F4VL 1HZBA 4LF5Q 2ZJRA 3UE0A 3E0EA 5BR8L 3CMEA 3RZOH 4K0KQ 1UE5A 4APVA 2VQFQ 3CCLA 4UP7A 4XIGS 4DR1L 1Q86C 4YCUA 4KI0A 4LFAL 3CP0A 3EN2A 5H1SE 1YNXA 1L1OB 1XTDA 3FP9A 3K7AH 3KF8B 3MXNB 4IPGA 4DV4Q 1X65A 2JEBI 4GKKL 4DNIA 4BY7H 2IHFA 2WAQE 1CSPA 4BY1G 3H3VH 4C3IH 3PF4A 4A93G
chains in the Genus database with same CATH superfamily
3CCJA 4A3EG 2JA7B 1CI3M 2OCEA 3A8KE 1GUNA 3K6OA 3KLSA 1B8AA 3ND9A 4AYBB 3A7LA 1WTVA 4Z9CB 3A8IE 4PMCA 1VQ9A 4LF6Q 2C9OA 1Q3LA 4HSVA 1AZPA 3CKIB 1VQIA 4DPGA 3J7ZC 1IBLQ 4K5WA 2JA9A 4DUYL 1ZKOA 2I07B 4K5XA 4A3GH 1EOTA 2B2UC 4ZKBB 4DV1L 5L37A 3K5NA 1EIYB 4DR6L 5IGCA 4B9XA 1V43A 1TS5A 4I7AA 1JB7A 4CGYB 1L0XB 3GTOB 2RSNA 1CKNA 1LV9A 4X3TA 3I4NG 2MUYA 4BY1B 1R4QB 1ASZA 1VQOA 1EY4A 2ZJQA 1LTRD 5LHY1 3S2HH 5CV7A 1T5EA 1RIPA 5ELCA 1S5FD 5JEAJ 1EY0A 1VQCA 3QOLA 3J80c 4YHHQ 3CPFA 3TP6A 1MGSA 1YNNC 3OOCA 2PQAA 4CKCA 5M3FH 4HIKA 4JI7Q 4WJ4A 2KQ3A 1PTOB 3OIPA 1D5MC 2R6GA 1X6OA 2AWNA 1PYBA 4JBWA 5I2XA 4Q5VA 3VYRA 3K0XA 1SMXA 5EPLA 1HNWQ 1LO5D 5IP9G 4C3JH 1AFPA 4IPCA 4LK1C 1WTOA 1I6HB 2AQ1B 3NP8A 4A4IA 4IALA 4FDBA 1SN8A 3OWFA 5FO9B 4TKOB 3T4AC 3E3XA 1B3AA 3KYHC 2BCOA 3RLNA 4OO1I 4HTHA 3FVQA 2NVQH 2EJFC 1M1KC 3CPWA 2PCFB 2LS01 2HHHQ 1TS4A 1XNQQ 3J81i 3K7UC 3MWYW 3GTKB 4DV7L 1Z9FA 1IW7C 1K3RA 5I2YA 1DGSA 1HA5A 1PFMA 1HR0W 2K03A 1GKHA 2CKZB 1IXRA 2R7FA 4DUZQ 4JI4L 3I4MH 4JBKA 2R92H 1CM9A 4KY7A 4NW2A 3H6MA 1L2FA 1PRTF 4HMJA 1KC8C 4A76A 2K14A 1MJEA 1GUGA 2Q2UA 4IUPA 4OWTB 4DV6L 4JI1Q 1IL2A 4IOCA 2L1BA 3J7AV 4X3KA 1NE3A 1GD7A 1F2MA 1H9MA 4LFCL 5E4XA 4LMQD 5C3EB 2UUBQ 5I6WA 2JA5H 1TU2B 3FPUB 2O5JC 5DAUA 3FKIB 2G9DA 5GQOA 3W2DA 2E2JH 2KJXA 1V1PB 3S14B 3KLWA 1VCIA 1WTWA 5CBAE 4NXMQ 2DY7A 4F8MA 4U673 3CXCA 2UXCQ 1WTPA 2IHEA 5LMNL 1GXDC 5TSSA 1PYSB 4Q0FA 1B7YB 4X66L 5JAVA 2R3ZA 1RTNA 5DLQE 3O13A 3BJUA 2F4VQ 4DR7L 1E3PA 4BBRH 1VQHA 2F3WA 5BR8Q 4GN4B 3BU2A 2L11A 2D0OA 1Z6HA 4C3HH 4DR1Q 3KOJA 5EKIA 1HQRD 4O42A 1NR2A 5IYBH 1JOKA 4POFA 3S1QB 2DJFC 3BVZA 2NVXB 5FJ8G 3Q0AA 4A3CH 1X56A 1T5XD 5C4XB 4QF4A 3OIQA 4A3EB 2Z9HA 1ZYRC 4PV1C 5JJLA 2PMZE 5HGQA 3EFXD 1J5EL 1PYWD 3CRLC 4DUYQ 4GLAC 4R4IA 4JI6L 1GHKA 4DK1A 1C8CA 4LW1A 4DV1Q 2PW5A 1B9NA 1NR4A 2XNAC 4DR6Q 4CHTB 1YHQA 4IOAA 3RN2A 1YHAA 4C3IG 1UNSA 3F2BA 2R93H 1IKLA 3U58A 5A35A 5C6AA 1PFSA 4LF7L 1N8RC 1HNZL 4OONA 4WJ3M 1JC7A 5C0XG 5JPMC 3MXUA 4GOPA 2K50A 2BOSA 4KN4C 3SGIA 5IT9c 1S5DD 2KA7A 1HZ9A 4IFDI 3CCQA 1BBUA 4DFAA 5M3MH 3I90A 1AZQA 1RCVD 2LXKA 3OW2A 1H9KA 4B3SL 2ATWA 3BDLA 2EJGC 3M3YH 3K57A 3PO2H 3GD7A 2Q8IB 4NKLA 4PNYA 1KHIA 1GO3E 4X62L 2E74C 5JPNC 4I65A 1LYLA 2CW0D 2LFNA 2FFKB 3LWEA 1WOCA 2QDBA 3CAMA 5M5YH 2A1AA 3HOXB 4LF5L 2DUDA 3M7GA 1PZID 2VQFL 4DKAC 2BDOA 5C5MA 1F9QA 4RHSA 1V9PA 3CQZB 2VY3A 3K81C 1JE5A 3EA6A 3A56A 1NMFA 1SNCA 5EQ0A 1X54A 2JA8G 4DV4L 4YIJA 1STNA 2MO0A 1PH3A 4KK7A 3Q22A 2B3GA 3P75A 2ZXPA 5GADC 3D0FA 4HIMA 3BG3A 3J80i 4DV7Q 2IL8A 1KDAA 2B2VA 3I4NH 4LUOA 4UDUC 3AB9A 4HIOA 4JI4Q 3VYSA 3HOUB 3HOWB 2NB0A 4B3TQ 1LT3D 1VMCA 4KD3A 2JA6G 2AQ2B 4ALPA 3IFDA 2EVBA 1SYGA 2LSSA 5ELFA 4DV6Q 1NNXA 3KJOA 1T9HA 2K6AA 1B70B 1Z47A 1BOSA 2HCCA 4XYQA 1AE3A 3W1GA 1QE6A 1Q1BA 3NEMA 1VQJA 1C4QA 1A62A 1KLUD 1JJGA 2AUJD 2EY5A 5CV8A 4DR5L 2JK8A 3K80C 3DM3A 5IYDH 3TS0A 4EQNA 1L1OA 1H9SB 3KF8A 1QVGA 1ET6A 3HKZG 3NXWA 2A6ED 1NY4A 2GA4B 5LMNQ 2V1CC 4GOPC 1PRTC 1HPCA 4GS3A 1N34Q 2AKWB 4X66Q 4K6LA 2L15A 2EYOA 4DR7Q 2NVYB 1OXUA 1QG7A 3F2DA 5F2DA 2KHIA 4JI5L 2B63G 1PV4A 1VF7A 2CWPA 1ILPA 4YY3L 5FK9C 5I6YA 3TS2A 5ELDA 2PMZB 3T1YL 2K7VA 1E0BA 1FJGL 4BA2I 1B1ZA 1ONLA 3BVMA 1NCVA 1J5EQ 2K01A 3S1RB 4JI6Q 2MPMA 1STAA 2KCCA 3LGJA 1UE1A 5G3LD 3L3OC 1Y14B 3A8JE 3UDFA 1Y8PB 3T16A 1ENFA 3URYA 3IAYA 2L4NA 2XVSA 4HJ8A 2VB3X 4LJZC 3S16B 3EBEA 4LF7Q 1A15A 4XTCS 3TEHB 1NMGA 2B2VC 1HNZQ 2I5LX 1Q82C 4HJ5A 4OXPA 2F0MA 2J7ZA 4BXXH 3JAME 2EY1A 1LUZA 2PPBC 2WP8J 1IYUA 1YNND 3HFZB 1Y1WH 4R1JA 1O7IA 5D14A 2G9HD 2ICIA 3AEVA 3EROA 4R4TA 4A3MB 2JA7G 3K5MA 1W6JA 2UUAL 4AYBG 1GUSA 1U4PA 1JWSD 3PUYA 2MFIA 4B3SQ 3ERSX 4HAEA 3FMCA 4NP5A 3GTPB 1F2LA 4A3JB 1DYQA 2H5XA 4FO2A 5HGTA 2E76C 1S5CD 5FJ8H 2SOBA 4X62Q 1K73C 1KLGD 3DMUA 4R4OA 1G2TA 2N49A 1IYJB 1L1OC 1HZBA 1ML0D 4LF5Q 2RDHA 3G7LA 4APVA 2VQFQ 4G57A 2IW3A 3MEHA 3QO2A 5H1SE 3FP9A 3MC0B 3K7AH 2Z4IA 3MXNB 4DV4Q 4K5VA 3OSOA 4GKKL 5JOBA 2WAQE 1CSPA 4BY1G 3H3VH 4C3IH 1QJOA 1WCMB 3M4PA 2JA8B 2F0TA 2RKSA 2SNSA 1EYAA 1DJRD 4H0LC 1EYGA 1KDBA 3A7AB 2TSSA 2A8VA 1O80A 4EX5A 4JW0A 1RL2A 1WD1A 3J7A5 2EIFA 3CCMA 5C0XH 3A55A 3D4WA 4WORA 1YJWA 1AE2A 2DJGC 5EBDA 1EUJA 2RHQB 4IPDA 1IKMA 3MVVA 1DXMA 3H15A 1W2BA 1PVOA 5J1ZA 3A54A 1LT6D 2Q2IA 3PCOB 3CCSA 3ULPA 5M9OA 3VR5A 4LFAQ 1XPOA 4A3KH 4RHRA 1GHJA 4FYDA 1TWCH 4MIUA 1JQYD 4H02A 2YTVA 4IO9A 5M5WB 5CORA 2N88A 4DR5Q 1V8QA 3NSWA 4MTKA 2DY8A 2JSOA 5C3XA 2NN6G 3TP7A 3CCVA 4XDXA 1VQPA 3E5SA 2A69D 3GTQH 3S2DH 4DR2L 2F4IA 4K8IA 5GAEC 4ID6A 3AFQA 4MN3A 3RZDH 5ELBA 3S24A 4UP9A 4P72A 1I50H 5CBEE 1QVCA 2JEAI 2FXQA 5J3BA 1QZGA 4EQOA 1SNPA 1S72A 5C44G 2XN9C 4JI5Q 5A2QE 4X65L 1U4RA 4L5TA 4YY3Q 1TWGB 1SSOA 1AEXA 3IL8A 1Y8NB 1RF2D 1K83H 3C3LA 2OXPA 2NZOA 1LTAD 1OXTA 3R3OA 1ICFB 3S15H 1ZYRD 2JA6H 3T1YQ 1CKMA 1FD7D 4JBMA 1JB3A 5C3EG 1LTSD 1FJGQ 3C2PA 1MSGA 4HEDA 1WYDA 3DUZA 2F0JA 3FKIG 3I73A 5EAYA 1K8AC 1G2SA 3GP7A 1A63A 3E9IA 1CUKA 1VQAA 5IODA 2DNEA 4DF7A 2UXBL 3OTOL 4WFN3 1BBWA 5NUCA 4KHPL 1ESFA 4JCVE 2VW9A 3W5OA 5ELOA 1XJVA 1CZGA 1ET9A 3NTHA 4GNXB 2WINB 4BS9A 3KUPA 3E9HA 2B2YA 2EYJA 1XNRL 1KDCA 2WIIB 1LABA 5J22A 2B63H 1L0WA 2HT1A 3P1HA 5FO7B 3KJPA 2UUAQ 3Q6SA 4LWCA 1K8MA 5C4XG 1OO9B 2ZJPA 1KQSA 1BCPB 4POGA 1A6XA 3CRKC 3D4RA 1A0IA 2YU9B 4KKSA 5C4JB 2IT1A 5C0XJ 4DR4L 1PFBA 3R93A 1TR5A 2RCFA 1Q8KA 4LNQA 3HEJA 3T1HL 1CFMA 1CQVA 1JT8A 1FR3A 1SE8A 4EGVA 4M1UB 1BVSA 2WAQB 2E2HH 5K36H 1ENAA 3DEPA 2D9UA 2RDFA 4QCLA 3M4YA 3HOYB 3M4OB 1QILA 1TS2A 4IJHA 4HJAA 1BF4A 4GKKQ 5BN4A 4IUQA 1XPRA 4CJ1B 3KF6A 1TY0A 2Z0SA 3CCUA 2QDLA 3KDFA 3R2TA 2J0TD 1JWUD 3NBHA 4H44C 4BBSH 2K4KA 3W1BA 2AMCB 2E2DC 4ZLTF 3FHWA 4YCWA 4PZ8A 5COYA 3NQTA 4OO1G 4HN7A 4CJ0B 4KD4A 1MJCA 3PUWA 4PZ6A 2NVQB 4A3LG 4JG2A 1JMCA 2IX1A 2JA7H 1O7ZA 4ILWA 1GVPA 2BA1A 1I4GA 3HOVG 1WFQA 3VR3A 1IHZA 3HOXG 1LTLA 3TP8A 3LWUA 4TVAB 4E6IA 4HJ7A 4TRDA 1JORA 2O2LD 1PRTD 1VMPA 3VYUA 4DR2Q 1I6VC 3JC66 4RWSC 1BCPF 1M8AA 4KKTA 4A3BG 1YHBA 1Y69U 3RZOB 1VQEA 3H3VC 1HR0L 3GTOH 3T53B 5IY0A 1UWVA 2JQOA 3MZ5A 4BY1H 2B2YC 4LAAA 1NJIC 2XGTA 2WFWA 3TSSA 2KBNA 3RMHA 5FOBB 4BY7B 2F0DA 1SE3A 3H94A 5KIXA 3HOUG 5KNCA 3Q24A 1BXTA 3HOWG 3VR2A 4X65Q 1F77A 5C44B 1ICWA 1D7QA 2ZXOA 4B3TL 3I4OA 1TIID 3P20A 1Y8OB 3DLLA 3NWSA 2GVBA 2J4XA 3L2PA 2PYKA 3X3NA 1MHWC 1F9SA 4DNRB 1KAAA 1HZAA 2ID0A 4C3HB 1TWAB 3D8GA 1BQQT 4HMIA 2F0NA 4ZCKA 3S17B 5HURA 1I3QB 1Q90A 3UDIA 4KV6A 3V05A 1PTOF 1A3UA 1EY6A 2NN6H 4P2CB 1DCZA 1YNJD 2UXBQ 3OTOQ 4A3DB 1G8ZD 3SK8A 2EY6A 4WRDA 2A69C 1N34L 4KHPQ 2IX0A 2HDLA 3U50C 4FNFA 1MBYA 1AP0A 4C2MB 3GTKH 3OMGA 3ERQA 5CGKA 4KLKA 5D65A 1YIJA 4A75A 3P7JA 1XNRQ 3FEWX 5IP7G 1WI5A 1OTCA 3HOZG 4DR3Q 4EVOA 2MJ8A 4GLVB 1B44D 2PI2A 1HUNA 1X9NA 4N8FA 1SYDA 4RMFA 1K9MC 4R8NA 4FF3A 2AQ3B 3I7FA 2ZM6L 1EWHA 4IURA 4EQPA 1FVIA 2R7ZH 4IFDG 2B2WA 4GLXA 2FHTA 4DR4Q 5M3MB 2EXDA 4LUZA 5C3EH 3U4VA 2K1BA 4M8AA 3T1HQ 1PH9A 4JYAL 3X3MA 2I5HA 3D4DA 2D62A 1D1IA 4JI3L 5E4WC 2F0KA 3S14H 2N78A 2RBMA 5FLXL 3RUZA 1D6EC 3LNNA 4XT3B 3BZKA 2KOLA 2M9VA 4JI2L 1X3QA 1A2TA 4IZ8A 4CDCC 2HCIA 1EFWA 5DM73 4DXFA 1SNQA 2E5LL 1JJCB 2F0VA 3MXGA 3K58A 4A3MG 5K5PA 1YJ9A 2MNAA 2BE5D 4DN4M 1IBML 1HFGA 4ZUJA 3S1QH 3DWQA 2NVXH 1EQQA 4A3JG 3GTJB 4K6DA 4F87A 4LF8L 1WVLA 1TWFB 3HG9A 1U0LA 4NMZA 5C4XH 2PZTA 4A3EH 4KJOA 3NTIA 5KNDA 3ICEA 3SR1A 1S5ED 4O1NA 4A3IG 3U9OA 1W3SA 1GUTA 1DD2A 1HZCA 5LMUL 2EZVA 3OMCA 4IUUA 3HOVB 3KLRA 5DEHA 2F0LA 2K5DA 4RG1A 3I55A 3JAML 4DV3L 2JP1A 3ND8A 4QL5A 1QNKA 3QOJA 3TZUA 2OF1A 1WCMG 1HR0Q 1B9MA 3GTGB 4A3BB 3CW2C 2X69A 2FINB 1SE2A 2QEXA 2XSCA 4R4QA 2NVTB 2QKIC 5C0XI 4WJWA 2N3SA 1EFID 5JEAG 1FNWA 3F1ZA 4FXGC 5KEEA 4Y7NH 1FL0A 5JJKA 5KYLA 3BYYB 1SNDA 5C5LA 2VUMB 3E0EA 3U9SA 3FPPA 1UE5A 3KLSX 4XIGS 4YCUA 4LFAL 3D6CA 1GUWA 2B2WC 4KY6A 3DHQA 5CV6A 4S3SA 4XQNA 1X65A 3NWTA 1CTMA 4DNIA 1CK1A 4RA8A 4A3FB 4K8JA 1SXTA 4A93G 1JOQA 1RD9D 4XT1B 4RGTA 1PH6A 1N9WA 4DXGA 1SROA 3HOXH 2QEJC 5IP9H 1D5ZC 1EEID 4ODGA 1UEAB 2LKVA 2NYZD 5CV9A 1MI2A 1YBYA 4B3RL 2VS1A 4RCOA 3CQZH 3R2IA 4YCVA 1LTTD 4L5RC 3I91A 3STBD 1V1PA 5IGGA 3K8AA 3PUZA 3S1MH 3RLOA 1FYCA 2CVRA 5IGEA 3G71A 3G6JB 1MD2D 1CKOA 2DN8A 3PF5A 1HHVA 3L9AX 5FLXE 4R9WA 3QWNA 1QUQB 2V4DA 2DNCA 1TY2A 5DNFA 3HOWH 1Q1EA 3D6WA 4HSPA 4YWLA 1SRUA 3HOZB 4C1NI 4GZYC 1II3A 1S5BD 1PTOC 3NUCA 1U9RA 4HR7B 3ULJA 2ZM6Q 1WTQA 3UDXA 1ZXTA 1DZ1A 2BDNA 3TRZA 5FLMG 5T1IA 4JYAQ 1F9PA 4V190 4JI3Q 4MNOA 1STYA 1EY5A 1QNUA 3TP5A 2H4OA 5A2QL 2KHSA 1LACA 4UPAA 2WB1E 2F0SA 3MHBA 4J1MA 4JI2Q 3TQYA 1FGBD 1IL8A 4UHVA 3CCEA 3JAMc 1N33L 1RTOA 1FGUA 3F8TA 1YNJC 2X6LA 1NBWA 2YYZA 1KRTA 3DEOA 4QGUA 2NVYH 1YZ6A 3HZXA 2ZT9C 1UE7A 2E5LQ 1HA6A 1VQDA 2D2CC 1JCKB 3G6EA 1OXVA 2JXMB 1IBMQ 4IUNA 3T51B 1B53A 2WKDA 2ZTCA 1YI2A 4RGOS 3H91A 4LF8Q 5AFWA 4P75A 3TN2A 3PO3B 4YWMA 1SDFA 3CD6A 1MKHA 1CA6A 1JOOA 3BS1A 3PIPA 4N8X1 4G7HC 1NTGA 2K05A 3IKJA 1XYIA 1VF5C 5LMUQ 1SYEA 1X55A 1EIFA 5EPJA 2WAQG 2E75C 1XMOL 3S1RH 1K8OA 4A3IB 4OELB 3HOYG 2Z6BA 4RKLA 3V96A 2B8FA 1UEBA 2BH8A 4DV3Q 4ZRZA 3BVGA 2HUGA 4NB3A 1QOHA 1RHPA 2QW7A 1VQ7A 1TWHB 3GQBA 5KNBA 3S16H 4OWXB 2XWJB 2E2IB 1J9OA 1YJNA 1IBKL 3RNUA 1VQGA 4JOIA 2PNHA 1SNOA 1K28A 4L63B 4I7ZC 3BZDB 3IFTA 2EOTA 2CHBD 1A2UA 5BN5A 4A3MH 2YTYA 3W3AA 1VQ5A 3ZJYC 1AN8A 3RN5A 1SE4A 3RLFA 3QG1A 4QB4A 1R9TH 3PIOA 3IRBA 2BE5C 5M5XB 3GTPH 1KL9A 1RKNA 4A3JH 3SK4A 1XXGA 3EIVA 1P8LA 4R8IA 2ES2A 2EDGA 1Q46A 2DGYA 2PQAB 2RA4A 3AU7A 4A93B 1HNXL 1D1KA 4NXNL 4DAYB 3ULLA 4ZK9B 5IGDA 3J81E 3Q23A 4X6AH 4F7XA 4B3RQ 3H0GB 3S15B 1VQFA 1PZJD 4JBJA 1H9SA 2B8GA 4N9TA 1EYDA 2F0OA 2I46A 2F0UA 2JA5G 1HRJA 1WCMH 2JA8H 4UY8C 1JICA 2K5QA 1H9JA 4BY7G 1Y1VB 4JC0A 3QIAA 1CHQD 4ZAIA 4O2DA 1ZEQX 1X3FA 2F0FA 1SFOB 2FJ2A 1HTLD 2CFMA 1VDZA 4YWKA 1E2ZA 1TQOA 3GTMB 1KABA 4DNTB 1PH5A 5JJIA 2F0PA 4RKBA 5GAHC 3TREA 1QUQA 5FKAC 2UU9L 2HQEA 3U4ZA 3F2CA 3CHBD 1VQNA 4K2KA 3VDYA 1O78A 1Z7TA 5EKLA 4KJNA 1WD0A 5T1GA 1A8VA 1SMYC 3J80L 4C3HG 3I72A 1A3TA 1OXSC 2OTJA 5IYCG 5CR3A 5IYBG 1EWCA 5M5WH 2EY2A 1LTBD 1KNAA 4J8QA 4IQZA 1PLFA 3SHLA 1N36L 1NUCA 2WB1B 3OW7A 2NN6I 3M85A 1D8LA 1RODA 4TQUS 4A3DG 1FNVA 1EU4A 3HGBA 5ELEA 3TBIB 4K0KL 1VS0A 5C4HA 3DWPA 5KGUA 1KNEA 3J7AF 3WOEA 4JOIC 4ZYSA 1N33Q 3STBC 4L5SA 4IFDJ 5EKKA 4A3GB 2O4XA 3GTLH 3WWVA 1ILQA 2JE6I 2YTXA 2R93G 1ASYA 2MGSA 1TWGH 4ZQ3A 3S1NH 4DR3L 3EVQA 4HCSA 2F3VA 4XQJA 4KY5A 1SNMA 4RGNA 1ENCA 1B4OA 1MSHA 2NTSA 4OGQC 5M3MG 1U5KA 1WJJA 2ENBA 1PFNA 3S2HB 5IE8A 2A19A 2VB2X 2BA0A 1XMOQ 1V1QA 2EPBA 4JVZA 1UE6A 1K0RA 5FLMH 2EYLA 4K2LA 4PQXA 4OWWB 3A0JA 5M3FB 2Z6KA 3PO2G 3A5ZB 3EJIA 3NE5B 3JAMi 2KEEA 1E7ZA 3WDNA 1HJPA 3MFYA 2Z8LA 4B08A 3MXNA 3VR6A 4IJLA 4C3JB 3UDGA 4IPHA 1IBKQ 3NBIA 3CC4A 1I4RA 2XWBB 1E22A 2EXZA 2QF7A 2L9HA 4B3ML 4GKJL 3TZDA 1BCPD 3LX0A 4QIWE 2KEDA 1CSQA 3VA5A 4GOPB 1PRTB 1TKWB 3J81j 2WKCA 1OXXK 4H13C 2WV6D 5JVG3 4PG3A 3PV0A 3CC7A 1U4MA 2Z1CA 3MEFA 1X3GA 2X6GA 1VQ8A 1NSNS 2YU9H 4DK0A 5C4JH 4RCNA 1PH2A 1H9RA 4QJFA 3I3CA 3I4MB 1CA5A 3DXJC 3N6RA 4ZKCB 2R92B 2KUMA 2A68C 1TS3A 1HNXQ 3SK5A 2VQEL 4LF4L 4NXNQ 5CYUA 2EQSA 4JI0L 3J80E 2L12A 1WTHA 1WTRA 1S4ZA 4JV5L 3HOYH 4DAYA 5GAGC 3M4OH 2F0WA 1DOMA 1RJTA 3SE0A 4DK6C 1PXUA 3BDCA 1SBBB 2EJMA 1F2ZA 4FP5D 1ESRA 1EQRA 3K5OA 4X3SA 2HDMA 3M7NA 3UE1A 5IYDG 4V0BA 3VR4A 2H1EA 2AWOA 2JA5B 1QWYA 1SYFA 4JI8L 1M90C 1V1OA 2EYHA 2VUMG 1XPUA 2E2JB 1SLJA 1SJHD 4OX9L 1PTOD 5IT9L 1XTCD 2P5ZX 4CKEA 4OEMB 2UU9Q 4TSSA 1C48A 3FDTA 1PTOH 2K32A 3K5LA 2Y0SB 1KIXA 4QUCA 2NWGA 1QZHA 4A3FG 4BBRB 2OEOA 3CU7A 1I4XA 2QCPX 2AHOB 3S9WA 2VZAA 3GV3A 3OPOA 1B50A 2RDGA 4KN7C 1I6HH 3MAQA 1EIGA 4BA1I 1QVFA 1HXYD 2Z6KC 3A5UA 3PIP3 1N36Q 1EQVA 2RSOA 5LL6S 1N32L 4XQQA 2ZTEA 3BYTB 1UAPA 4PMBA 2O5IC 4U68A 4ME3A 2F1MA 4DA2A 3UI2A 2ZJRA 3UE0A 3CMEA 3RZOH 4K0KQ 2EYPA 5C4ZA 2R7ZB 4UP7A 5D3DA 1SAPA 1Q86C 2IWHA 2AUKA 4KI0A 3CP0A 1L1OB 1PZKD 3KF8B 5EGTA 2JEBI 4BY7H 3HS0C 2CH4A 3K0YA 2PNRC 1K3BC 1G91A 4GNXA 3PUXA 5C44H 1X32A 2PZWA 2R93B 2F0QA 1TXYA 4UP8A 3TMEA 3K59A 5E3FA 4Y52H 1G51A 5KRUA 4BXXG 3TDQA 2JYOA 2OWOA 4DAVA 4QQBX 2K5VA 3PMFA 2M00A 1YITA 4NDXA 1HTPA 5LMNW 1Y1WG 4IUTA 2NBFA 1JJ2A 4DV0L 1XMQL 4DV5L 1TWAH 1B2TA 2NUCA 2E8GA 4OHJA 3S17H 3PIO3 1DOKA 2CQAA 5IYCH 2L5TA 2WACA 1I3QH 4AIMA 3MA2B 5DM63 4N9PA 3FKIH 3QR8A 1EYCA 2F52A 2TMPA 2PW7A 2N8NA 2JN4A 2MP1A 5IIFA 1C7YA 3M3YB 3PO2B 3MXPA 4A3DH 3G4SA 1PH1A 1BO0A 1U4LA 4HJ9A 4OIJA 4GN5A 4J6HA 2CWAA 2EYFA 4C2MH 1G6PA 5M5YB 2XRSD 5J39A 4QIWB 1S40A 2IY5B 4CDDC 4L6TB 3VYTA 2L55A 2B39A 4B3MQ 4GKJQ 1FNUA 1EQTA 3MFGA 4LUVA 3PO3G 4AQYL 1PHJA 1AW7A 1I4QA 1EWIA 2A74C 1BKBA 3ITPA 1UUPA 1MIUA 1J6QA 2HD3A 4KHVA 2PQEA 3L7ZC 4LF9L 3M9BA 2R7DA 1G291 1VQKA 1K8GA 3I4NB 1CT1D 4OL7A 2LY7A 4Y7NB 2N55A 4J15A 2RCNA 5IT9E 1KRSA 4GN3B 5IWAL 3J7YW 1IYVA 2HIVA 1XX8A 2D0PA 4X64L 1SR3A 1KTKA 2VQEQ 4LF4Q 4A3KG 4RGMA 4JI0Q 2VXWA 2NTTA 1EU3A 5D3IB 5EBCA 4JV5Q 3RR5A 4DV2L 3F2UA 2CQOA 1K0SA 3H3VI 4XXEA 3KFUA 2Q2HA 5LL6X 2FMCA 3RD4A 2G5DA 5JVH3 3C46A 4KTAA 1R4PB 1JR0D 3DM1A 2XRQD 1C9OA 1Q81C 2EYMA 5CV4A 4JI8Q 4GNXC 1EY7A 5JJZA 4ZUIA 4FXDA 1HFNA 3ER0A 1E2WA 1LTGD 1KD1C 3D31A 2VNUD 4OX9Q 1SMYD 3OHXC 2RHSB 4AH6A 4H7BA 1HQMC 1M4VA 3T56B 4DK3C 4HIDA 4OO1H 3NENA 1XWEA 3S1MB 2F0HA 3GTJH 3D3RA 1TWFH 1AH9A 2K33A 2A6HD 4DAMA 1BCPC 4A3LH 2CH4W 1EY8A 3SVMA 1I94L 4FF2A 3N52A 4RH6A 1E1OA 1IZ6A 1SJED 3E0JA 3DWAA 3BZCA 1LT5D 1VQ6A 1PMRA 3G48A 3HOVH 3I4LA 4ABNA 3H0GG 1LM0A 1YEZA 3E6ZX 2F0GA 1G6ZA 2ICEC 1N32Q 3HP3A 2R61A 1STEA 2KHJA 3VA7A 2ASBA 1F9RA 5CC4A 3C1EA 2MO1A 1CHPD 2IPKD 4CDFC 3AMUA 2KCTA 1VQLA 2SNMA 4G7ZC 4G4KA 1Y1VG 3GTGH 3BDOA 4A3BH 1E24A 1STBA 4LFCQ 3NK9A 2NVTH 5FLXc 2F03A 3M4QA 1VQBA 1YVCA 1L0YB 2F0EA 2RF4A 4KKUA 1D5XC 1O7LA 4L8JA 2ALYB 3HOUH 1PDQA 4MHEA 2NZHA 2VUMH 4R4CA 1KAWA 1EL0A 1JWMD 3Q8DA 3AFPA 4P73A 5BN3A 3NTKA 3J81L 1HH2P 4DGZA 2A73B 2UUCL 4HCEA 2XIWA 1X3PA 2K04A 5AJ3L 1I5FA 3HKZE 4F88A 5I9PA 3A74A 1CQFA 4DV0Q 4DV5Q 4A3FH 1XMQQ 1Y1WB 2WB1G 3QB3A 2SDFA 4L5QA 1SYBA 3CC2A 1EZ8A 4KHZA 4ME5A 1VQMA 3I56A 2IX3A 1SYCA 5GROA 2LMCB 2KVMA 5E7NA 2KCMA 1X3EA 1VQ4A 3I2ZA 2Q2TA 4A3GG 1BDOA 3KBGA 4FXKC 2QA4A 5K36G 2UXDL 4CKBA 3ZYYX 2C35B 3I70A 5EJWA 3B6YA 1A3VA 1BUVT 3K7AB 1PH8A 5IP7H 2K5HA 5IGFA 4AQYQ 3HOZH 4C3IB 1EEFD 1GM5A 1QCBD 1HCZA 4LFBL 2IJ0A 4K14A 4CJ2C 1E1TA 4BBSG 4LF9Q 4UAIA 3WOFA 1NAPA 2A68D 4MTNA 2FMMA 1O7YA 1DM0B 4P74A 4RFBA 1GOZA 5IWAQ 1PH7A 4IFDH 2F0IA 4X3UA 5M3FG 4X64Q 5G3LF 3SEBA 3MTSA 1P16A 4DV2Q 3H09A 2PI2E 4B9WA 1R9TB 4A3KB 2B2TA 1S3OA 5FO8B 1STGA 4C3JG 1TWCB 2OQKA 4LF6L 2KENA 1PH4A 4P71A 1Q12A 4PZ7A 5CMDA 4AYBE 2Q8TA 1IBLL 3OYYA 3FRPB 2BH2A 2K28A 2GVAA 3GTQB 3S2DB 1JE4A 2QILA 2PO4A 2M2LA 3NQIA 1CKNB 3KF6B 5KYIA 3KDFB 1IW7D 2B29A 3RZDB 4DU9A 4G7OC 1C0AA 1I50B 2MHVA 3PO3H 1BNZA 2CCZA 3NBHB 5C3WA 2OTLA 2D5DA 1I94Q 3I4MG 3CMAA 1H95A 3KBXA 1GUOA 2R92G 3CCRA 2HIXA 3J81c 1E2VA 4YHHL 4A3IH 1K83B 5E1FA 5IGBA 3GO5A 4JI7L 1W6KA 2LXJA 2JA6B 2F3IA 2MQHA 5HY6A 4XYOA 2K5NA 1TWHH 4JPBW 4MZ9A 5IOCA 2QGQA 1HNWL 2E2IH 4C1NK 1D2BA 3PGZA 5I9OA 3HKSA 2CW0C 5ISRA 1HUMA 1CZWA 1SEBD 2ZTDA 3SXHA 1STHA 3NELA 4CDEC 5JEAH 2B2UA 2L0CA 3GV6A 2YV5A 2K52A 3NHHA 2OT2A 3GDEA 3KK7A 2Y0SG 1F2YA 3HKZB 1DONA 3L0OA 4BBRG 3SDZA 2I5MX 1Q8IA 1PA6A 2HHHL 3OWEB 5M5XH 2UUCQ 1XNQL 1LLRD 4NPSA 4QUFA 5AJ3Q 3GTLB 1GJXA 1EY9A 3C1FA 1KXLA 2A6HC 4EQ5A 1DOLA 2Y0SE 1I4HA 3CF5A 4ULLA 3PSIA 4DUZL 3S1NB 3V2TA 2B63B 4A93H 4IUVA 4CBVA 2B2TC 3H0GH 4A3CG 3PQIA 3T13A 3PUVA 4O0AA 4JI1L 2R7ZG 1EZ6A 2RVLA 4DAPA 5ELNA 2RQXA 1LTID 1J8IA 2I0QA 2VL6A 4PMWA 2SEBD 2K75A 1BR9A 3ONAB 1Y1VH 2UUBL 1BBXC 5EPKA 2UXDQ 3I8ZA 3AYHB 1SFOH 3R8BA 1RDPD 1I4PA 2HQLA 2K5WA 2E2HB 1EOVA 2ZXRA 2GN5A 1LT4D 2EE1A 3GTMH 3QJYA 2XTIA 1Q7YC 4NXML 3AQQA 3HRZC 4QY7A 2UXCL 4RAUC 2JJQA 1B3QA 2NZ1D 4BWGB 4LFBQ 1QB5D 4FF1A 4FVMA 2OQ0A 2A6EC 4C56C 2F4VL 5CV5A 2C5CA 4QMGA 5BR8L 2Z4HA 1WTXA 2KCNA 3CCLA 4BBSB 4DR1L 2Q8RE 3SK6A 4OIKA 3NPPA 3EN2A 2KECA 1YNXA 5I4DA 1XTDA 4IPGA 4KMUC 1TT2A 2A5HA 3EQLC 4IN3A 4JK1C 4FF4A 2IHFA 1EIHA 3PF4A 1TVXA 2PZUA
chains in the Genus database with same CATH topology
3M4PA 3CCJA 4GNXA 4A3EG 3PUXA 2OCEA 5C44H 1PH6A 1B8AA 1N9WA 1EYGA 1SROA 3HOXH 5IP9H 2A8VA 4EX5A 1TXYA 4UP8A 1RL2A 1VQ9A 4LF6Q 2EIFA 3CCMA 3J7A5 1YBYA 4B3RL 2VS1A 4Y52H 4YCVA 3CQZH 1G51A 4BXXG 1YJWA 1AE2A 1VQIA 4L5RC 4DPGA 3J7ZC 1EUJA 2OWOA 2RHQB 4IPDA 1IBLQ 2JA9A 2K5VA 3STBD 4DUYL 1YITA 3H15A 1W2BA 4A3GH 1PVOA 3K8AA 3PUZA 5LMNW 1Y1WG 2Q2IA 4DV1L 1JJ2A 4DV0L 1XMQL 3PCOB 3CCSA 1TWAH 4DV5L 3RLOA 3ULPA 1EIYB 3S1MH 4DR6L 4LFAQ 2E8GA 3G71A 4A3KH 1XPOA 3S17H 5IYCH 1CKOA 1I3QH 4AIMA 1V43A 3PF5A 1TWCH 1JB7A 3FKIH 4H02A 2F52A 2N8NA 2YTVA 1C7YA 4IO9A 1QUQB 1CKNA 3I4NG 4DR5Q 3HOWH 1Q1EA 4A3DH 1ASZA 3G4SA 1VQOA 1PH1A 2ZJQA 4YWLA 3S2HH 1SRUA 2NN6G 3CCVA 1RIPA 4HJ9A 1VQPA 4GN5A 3GTQH 5JEAJ 4DR2L 3S2DH 2CWAA 1VQCA 4C2MH 1G6PA 3J80c 4YHHQ 3ULJA 2ZM6Q 5GAEC 3UDXA 3CPFA 3AFQA 3RZDH 1S40A 2IY5B 2PQAA 3S24A 4UP9A 5M3FH 4HIKA 4P72A 4JI7Q 1I50H 3TRZA 4WJ4A 5FLMG 1QVCA 2JEAI 2R6GA 1X6OA 2FXQA 5J3BA 1QZGA 2AWNA 4B3MQ 1PYBA 4JYAQ 4GKJQ 4JBWA 4JI3Q 3K0XA 4LUVA 4MNOA 1S72A 3PO3G 5C44G 4AQYL 1SMXA 1PHJA 4JI5Q 1HNWQ 5IP9G 4C3JH 4X65L 1EWIA 4L5TA 1BKBA 4IPCA 4YY3Q 1MIUA 1J6QA 3L7ZC 4LF9L 1K83H 3M9BA 2R7DA 1G291 4UPAA 2WB1E 4A4IA 1K8GA 2NZOA 1SN8A 4FDBA 1VQKA 1OXTA 4JI2Q 3TQYA 3S15H 2JA6H 4J15A 2RCNA 3CCEA 3T1YQ 3JAMc 1N33L 1CKMA 1FGUA 1KRSA 3F8TA 3KYHC 4GN3B 3RLNA 5IWAL 4OX9Q 4OO1I 2HIVA 1NBWA 2D0PA 2YYZA 1KRTA 1SR3A 4X64L 2NVYH 1YZ6A 4QGUA 4JBMA 1UE7A 2VQEQ 4LF4Q 4A3KG 5C3EG 4JI0Q 2E5LQ 1FJGQ 2NVQH 1M1KC 1WYDA 3CPWA 4JV5Q 1VQDA 3RR5A 4DV2L 2CQOA 2HHHQ 3H3VI 3FKIG 1XNQQ 3KFUA 3J81i 3K7UC 3G6EA 5EAYA 1OXVA 4DV7L 1Z9FA 2Q2HA 1K8AC 1K3RA 1DGSA 1IBMQ 1HR0W 2ZTCA 1YI2A 1A63A 4LF8Q 1GKHA 3E9IA 2CKZB 4P75A 1IXRA 2R7FA 1CUKA 1VQAA 4YWMA 4DUZQ 4JI4L 3I4MH 3CD6A 1MKHA 1C9OA 1Q81C 4JBKA 2R92H 4JI8Q 3PIPA 4GNXC 2UXBL 3OTOL 1L2FA 1BBWA 3ER0A 1KC8C 1NTGA 1KD1C 3D31A 4A76A 4KHPL 2K14A 4JCVE 1MJEA 2VNUD 2VW9A 5LMUQ 4OWTB 3W5OA 4DV6L 4JI1Q 1X55A 2Q2UA 1EIFA 1XMOL 2WAQG 5ELOA 4IOCA 3S1RH 1XJVA 1IL2A 2RHSB 4GNXB 4AH6A 4DK3C 4HIDA 3HOYG 1NE3A 1GD7A 3E9HA 3NENA 1UEBA 2BH8A 4DV3Q 3GTJH 4LFCL 1TWFH 1XNRL 1AH9A 2UUBQ 4NB3A 4DAMA 2JA5H 2B63H 4A3LH 1L0WA 2HT1A 1VQ7A 1I94L 3KJPA 2UUAQ 1E1OA 3S16H 5GQOA 1IZ6A 4LWCA 2E2JH 4OWXB 5C4XG 3KLWA 1VCIA 2ZJPA 3BZCA 1KQSA 1VQ6A 3G48A 3HOVH 4NXMQ 4POGA 3H0GG 1LM0A 1YJNA 1YEZA 3CXCA 3RNUA 1IBKL 2UXCQ 1VQGA 1A0IA 2IHEA 4JOIA 2PNHA 5LMNL 1N32Q 2IT1A 1PYSB 2KHJA 1B7YB 5C0XJ 2ASBA 4DR4L 4X66L 1Q8KA 4LNQA 5DLQE 3BJUA 2MO1A 3T1HL 2F4VQ 4DR7L 1JT8A 1E3PA 4BBRH 1VQHA 4A3MH 2KCTA 2YTYA 4GN4B 5BR8Q 1VQ5A 3ZJYC 1SE8A 1VQLA 3RN5A 3BU2A 1Y1VG 3GTGH 2E2HH 1BVSA 2D0OA 3RLFA 4A3BH 4C3HH 4DR1Q 1E24A 3KOJA 4LFCQ 1R9TH 2NVTH 3PIOA 3IRBA 3GTPH 1KL9A 5IYBH 5FLXc 4A3JH 4IJHA 4POFA 4HJAA 4GKKQ 3M4QA 1VQBA 3EIVA 1YVCA 2RF4A 1XPRA 1P8LA 4QQBX 2ES2A 1Q46A 3KF6A 2DGYA 2ALYB 2Z0SA 2PQAB 5FJ8G 3KDFA 3CCUA 3HOUH 2NZHA 2VUMH 4R4CA 4A3CH 1X56A 1KAWA 1HNXL 4DAYB 4NXNL 4X6AH 3ULLA 4BBSH 3Q8DA 2K4KA 4B3RQ 3W1BA 2AMCB 2PMZE 3AFPA 4P73A 5HGQA 5JJLA 1VQFA 1HH2P 3FHWA 4YCWA 1J5EL 4PZ8A 2UUCL 4OO1G 4JBJA 4DUYQ 4GLAC 4R4IA 4JI6L 5AJ3L 1I5FA 4LW1A 3HKZE 4DV1Q 1MJCA 3A74A 3PUWA 4PZ6A 4DV0Q 4DV5Q 4A3FH 1XMQQ 2JA5G 4A3LG 1WCMH 4DR6Q 1YHQA 4JG2A 1JMCA 3RN2A 4UY8C 2IX1A 2JA7H 2JA8H 4IOAA 4BY7G 1YHAA 2WB1G 4JC0A 1GVPA 3F2BA 2R93H 4O2DA 3U58A 2BA1A 1X3FA 1PFSA 3HOVG 1WFQA 2CFMA 4L5QA 3HOXG 4YWKA 1LTLA 4LF7L 3CC2A 1N8RC 5JJIA 4KHZA 1PH5A 1HNZL 4OONA 4WJ3M 1VQMA 5C0XG 3I56A 5GAHC 4GOPA 4TVAB 2K50A 5GROA 3TREA 1QUQA 5E7NA 3SGIA 2KCMA 1X3EA 5IT9c 4HJ7A 1VQ4A 1HZ9A 2UU9L 4IFDI 3U4ZA 3F2CA 3CCQA 1VQNA 3I2ZA 3VDYA 2Q2TA 1BBUA 5M3MH 4A3GG 4DR2Q 1A8VA 3JC66 2QA4A 5K36G 2UXDL 4A3BG 2C35B 1YHBA 2LXKA 1OXSC 1VQEA 3OW2A 2OTJA 5IYCG 1HR0L 5IYBG 3GTOH 4B3SL 5IY0A 5M5WH 2ATWA 1UWVA 2JQOA 4BY1H 3B6YA 1NJIC 3M3YH 2XGTA 3GD7A 1PH8A 3PO2H 2WFWA 1N36L 5IP7H 2KBNA 2K5HA 1KHIA 4AQYQ 3HOUG 2NN6I 3M85A 1GO3E 4X62L 3HOZH 1GM5A 3HOWG 1LYLA 4X65Q 1D8LA 4TQUS 4LFBL 4A3DG 1E1TA 1WOCA 3CAMA 5M5YH 4BBSG 2A1AA 1D7QA 4B3TL 4LF5L 4LF9Q 3I4OA 4K0KL 2DUDA 1VS0A 4MTNA 2VQFL 4DKAC 4P74A 3DLLA 1V9PA 2GVBA 2VY3A 4JOIC 3K81C 1JE5A 1N33Q 5IWAQ 1NMFA 3STBC 1PH7A 4L5SA 3L2PA 4IFDJ 5M3FG 4X64Q 1X54A 2JA8G 4DV4L 3GTLH 3WWVA 1HZAA 2JE6I 2ID0A 2MO0A 1PH3A 2YTXA 2R93G 1P16A 4DV2Q 2B3GA 1ASYA 2PI2E 5GADC 3D0FA 1TWGH 4HIMA 3S1NH 1S3OA 3J80i 4DR3L 4DV7Q 3UDIA 2OQKA 3I4NH 4LF6L 2KENA 4LUOA 1PH4A 4P71A 1Q12A 4HIOA 4PZ7A 4JI4Q 4AYBE 1IBLL 4B3TQ 5M3MG 2UXBQ 2JA6G 1U5KA 1WJJA 3OTOQ 3OYYA 4ALPA 2LSSA 1N34L 5IE8A 2A19A 2BH2A 2IX0A 4KHPQ 3U50C 2GVAA 2BA0A 4DV6Q 1XMOQ 1V1QA 3KJOA 1T9HA 1UE6A 3GTKH 1K0RA 5FLMH 1CKNB 1B70B 1Z47A 3KF6B 3W1GA 1AE3A 4OWWB 3A0JA 3KDFB 2B29A 1Q1BA 3NEMA 1VQJA 4KLKA 1C0AA 2Z6KA 1YIJA 4A75A 3A5ZB 3PO2G 1A62A 1XNRQ 3PO3H 5IP7G 1JJGA 1WI5A 3JAMi 2CCZA 3NBHB 1OTCA 3HOZG 1E7ZA 4DR5L 4DR3Q 2JK8A 3K80C 2OTLA 3DM3A 4GLVB 1I94Q 3I4MG 5IYDH 3TS0A 2PI2A 3CMAA 1X9NA 1H95A 1HJPA 1L1OA 4RMFA 2R92G 1QVGA 4IJLA 3UDGA 4IPHA 3CCRA 2HIXA 1K9MC 3J81c 3HKZG 4YHHL 3I7FA 2ZM6L 4A3IH 1IBKQ 1NY4A 3CC4A 5LMNQ 1FVIA 2R7ZH 3GO5A 4IFDG 1E22A 2V1CC 4GOPC 4GLXA 4GS3A 1N34Q 4JI7L 2AKWB 4X66Q 2LXJA 4DR4Q 2L15A 2EXDA 2F3IA 4LUZA 5C3EH 2MQHA 5HY6A 3U4VA 3T1HQ 1PH9A 4B3ML 4DR7Q 4JYAL 4GKJL 2K5NA 2I5HA 4QIWE 1OXUA 1TWHH 2D62A 4MZ9A 4JI3L 3F2DA 1CSQA 2KHIA 4GOPB 2QGQA 4JI5L 3J81j 2B63G 3S14H 1OXXK 1PV4A 2E2IH 1HNWL 2CWPA 2N78A 4YY3L 4PG3A 3PV0A 3CC7A 3MEFA 1X3GA 1VQ8A 3PGZA 2YU9H 5C4JH 3HKSA 3TS2A 3BZKA 1PH2A 4JI2L 2ZTDA 3NELA 4QJFA 3T1YL 2YV5A 1EFWA 2K52A 1HNXQ 3GDEA 2Y0SG 2VQEL 4LF4L 4NXNQ 2EQSA 4JI0L 2E5LL 1FJGL 4BA2I 1JJCB 3L0OA 4BBRG 4JV5L 4A3MG 2I5MX 3HOYH 1J5EQ 5GAGC 1PA6A 2HHHL 5M5XH 2UUCQ 1XNQL 1YJ9A 4DK6C 3M4OH 2MNAA 4JI6Q 4NPSA 5AJ3Q 1IBML 3LGJA 3S1QH 1UE1A 1KXLA 2NVXH 1EQQA 1EQRA 4A3JG 4EQ5A 4LF8L 2Y0SE 3CF5A 3M7NA 1U0LA 1Y14B 3PSIA 3UE1A 5IYDG 3UDFA 4DUZL 2AWOA 5C4XH 4A93H 4JI8L 4A3EH 4HJ8A 3ICEA 1M90C 3EBEA 3H0GH 4LF7Q 1XPUA 2VUMG 4A3CG 4A3IG 4XTCS 1SLJA 3TEHB 1NMGA 1W3SA 1HZCA 5LMUL 1HNZQ 3PUVA 2I5LX 4O0AA 4JI1L 4HJ5A 1Q82C 4OX9L 2R7ZG 4OXPA 5ELNA 4BXXH 1LUZA 2UU9Q 2WP8J 2I0QA 4RG1A 2VL6A 3I55A 4PMWA 4DV3L 2K75A 3HFZB 4QL5A 1KIXA 1Y1WH 1Y1VH 4R1JA 2UUBL 1O7IA 2UXDQ 1QZHA 4A3FG 3AYHB 3AEVA 1WCMG 4R4TA 2JA7G 1SFOH 2UUAL 1HR0Q 2HQLA 4AYBG 2AHOB 1EOVA 2MFIA 3CW2C 3PUYA 2GN5A 4B3SQ 2VZAA 2QEXA 4R4QA 3GTMH 3ERSX 1I6HH 2XTIA 5C0XI 4BA1I 1Q7YC 4NXML 1QVFA 2Z6KC 3AQQA 3A5UA 2N3SA 4QY7A 2H5XA 1N36Q 2UXCL 5JEAG 2JJQA 5FJ8H 1N32L 3F1ZA 4X62Q 1K73C 4Y7NH 2ZTEA 4R4OA 4LFBQ 1FL0A 2N49A 4ME3A 5JJKA 1IYJB 2OQ0A 1L1OC 2F4VL 1HZBA 4LF5Q 2ZJRA 3UE0A 3E0EA 5BR8L 3CMEA 3RZOH 4K0KQ 1UE5A 4APVA 2VQFQ 3CCLA 4UP7A 4XIGS 4DR1L 1Q86C 4YCUA 4KI0A 4LFAL 3CP0A 3EN2A 5H1SE 1YNXA 1L1OB 1XTDA 3FP9A 3K7AH 3KF8B 3MXNB 4IPGA 4DV4Q 1X65A 2JEBI 4GKKL 4DNIA 4BY7H 2IHFA 2WAQE 1CSPA 4BY1G 3H3VH 4C3IH 3PF4A 4A93G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4P A;  3CCJ A;  4GNX A;  4A3E G;  3PUX A;  2OCE A;  5C44 H;  1PH6 A;  1B8A A;  1N9W A;  1EYG A;  1SRO A;  3HOX H;  5IP9 H;  2A8V A;  4EX5 A;  1TXY A;  4UP8 A;  1RL2 A;  1VQ9 A;  4LF6 Q;  2EIF A;  3CCM A;  3J7A 5;  1YBY A;  4B3R L;  2VS1 A;  4Y52 H;  4YCV A;  3CQZ H;  1G51 A;  4BXX G;  1YJW A;  1AE2 A;  1VQI A;  4L5R C;  4DPG A;  3J7Z C;  1EUJ A;  2OWO A;  2RHQ B;  4IPD A;  1IBL Q;  2JA9 A;  2K5V A;  3STB D;  4DUY L;  1YIT A;  3H15 A;  1W2B A;  4A3G H;  1PVO A;  3K8A A;  3PUZ A;  5LMN W;  1Y1W G;  2Q2I A;  4DV1 L;  1JJ2 A;  4DV0 L;  1XMQ L;  3PCO B;  3CCS A;  1TWA H;  4DV5 L;  3RLO A;  3ULP A;  1EIY B;  3S1M H;  4DR6 L;  4LFA Q;  2E8G A;  3G71 A;  4A3K H;  1XPO A;  3S17 H;  5IYC H;  1CKO A;  1I3Q H;  4AIM A;  1V43 A;  3PF5 A;  1TWC H;  1JB7 A;  3FKI H;  4H02 A;  2F52 A;  2N8N A;  2YTV A;  1C7Y A;  4IO9 A;  1QUQ B;  1CKN A;  3I4N G;  4DR5 Q;  3HOW H;  1Q1E A;  4A3D H;  1ASZ A;  3G4S A;  1VQO A;  1PH1 A;  2ZJQ A;  4YWL A;  3S2H H;  1SRU A;  2NN6 G;  3CCV A;  1RIP A;  4HJ9 A;  1VQP A;  4GN5 A;  3GTQ H;  5JEA J;  4DR2 L;  3S2D H;  2CWA A;  1VQC A;  4C2M H;  1G6P A;  3J80 c;  4YHH Q;  3ULJ A;  2ZM6 Q;  5GAE C;  3UDX A;  3CPF A;  3AFQ A;  3RZD H;  1S40 A;  2IY5 B;  2PQA A;  3S24 A;  4UP9 A;  5M3F H;  4HIK A;  4P72 A;  4JI7 Q;  1I50 H;  3TRZ A;  4WJ4 A;  5FLM G;  1QVC A;  2JEA I;  2R6G A;  1X6O A;  2FXQ A;  5J3B A;  1QZG A;  2AWN A;  4B3M Q;  1PYB A;  4JYA Q;  4GKJ Q;  4JBW A;  4JI3 Q;  3K0X A;  4LUV A;  4MNO A;  1S72 A;  3PO3 G;  5C44 G;  4AQY L;  1SMX A;  1PHJ A;  4JI5 Q;  1HNW Q;  5IP9 G;  4C3J H;  4X65 L;  1EWI A;  4L5T A;  1BKB A;  4IPC A;  4YY3 Q;  1MIU A;  1J6Q A;  3L7Z C;  4LF9 L;  1K83 H;  3M9B A;  2R7D A;  1G29 1;  4UPA A;  2WB1 E;  4A4I A;  1K8G A;  2NZO A;  1SN8 A;  4FDB A;  1VQK A;  1OXT A;  4JI2 Q;  3TQY A;  3S15 H;  2JA6 H;  4J15 A;  2RCN A;  3CCE A;  3T1Y Q;  3JAM c;  1N33 L;  1CKM A;  1FGU A;  1KRS A;  3F8T A;  3KYH C;  4GN3 B;  3RLN A;  5IWA L;  4OX9 Q;  4OO1 I;  2HIV A;  1NBW A;  2D0P A;  2YYZ A;  1KRT A;  1SR3 A;  4X64 L;  2NVY H;  1YZ6 A;  4QGU A;  4JBM A;  1UE7 A;  2VQE Q;  4LF4 Q;  4A3K G;  5C3E G;  4JI0 Q;  2E5L Q;  1FJG Q;  2NVQ H;  1M1K C;  1WYD A;  3CPW A;  4JV5 Q;  1VQD A;  3RR5 A;  4DV2 L;  2CQO A;  2HHH Q;  3H3V I;  3FKI G;  1XNQ Q;  3KFU A;  3J81 i;  3K7U C;  3G6E A;  5EAY A;  1OXV A;  4DV7 L;  1Z9F A;  2Q2H A;  1K8A C;  1K3R A;  1DGS A;  1IBM Q;  1HR0 W;  2ZTC A;  1YI2 A;  1A63 A;  4LF8 Q;  1GKH A;  3E9I A;  2CKZ B;  4P75 A;  1IXR A;  2R7F A;  1CUK A;  1VQA A;  4YWM A;  4DUZ Q;  4JI4 L;  3I4M H;  3CD6 A;  1MKH A;  1C9O A;  1Q81 C;  4JBK A;  2R92 H;  4JI8 Q;  3PIP A;  4GNX C;  2UXB L;  3OTO L;  1L2F A;  1BBW A;  3ER0 A;  1KC8 C;  1NTG A;  1KD1 C;  3D31 A;  4A76 A;  4KHP L;  2K14 A;  4JCV E;  1MJE A;  2VNU D;  2VW9 A;  5LMU Q;  4OWT B;  3W5O A;  4DV6 L;  4JI1 Q;  1X55 A;  2Q2U A;  1EIF A;  1XMO L;  2WAQ G;  5ELO A;  4IOC A;  3S1R H;  1XJV A;  1IL2 A;  2RHS B;  4GNX B;  4AH6 A;  4DK3 C;  4HID A;  3HOY G;  1NE3 A;  1GD7 A;  3E9H A;  3NEN A;  1UEB A;  2BH8 A;  4DV3 Q;  3GTJ H;  4LFC L;  1TWF H;  1XNR L;  1AH9 A;  2UUB Q;  4NB3 A;  4DAM A;  2JA5 H;  2B63 H;  4A3L H;  1L0W A;  2HT1 A;  1VQ7 A;  1I94 L;  3KJP A;  2UUA Q;  1E1O A;  3S16 H;  5GQO A;  1IZ6 A;  4LWC A;  2E2J H;  4OWX B;  5C4X G;  3KLW A;  1VCI A;  2ZJP A;  3BZC A;  1KQS A;  1VQ6 A;  3G48 A;  3HOV H;  4NXM Q;  4POG A;  3H0G G;  1LM0 A;  1YJN A;  1YEZ A;  3CXC A;  3RNU A;  1IBK L;  2UXC Q;  1VQG A;  1A0I A;  2IHE A;  4JOI A;  2PNH A;  5LMN L;  1N32 Q;  2IT1 A;  1PYS B;  2KHJ A;  1B7Y B;  5C0X J;  2ASB A;  4DR4 L;  4X66 L;  1Q8K A;  4LNQ A;  5DLQ E;  3BJU A;  2MO1 A;  3T1H L;  2F4V Q;  4DR7 L;  1JT8 A;  1E3P A;  4BBR H;  1VQH A;  4A3M H;  2KCT A;  2YTY A;  4GN4 B;  5BR8 Q;  1VQ5 A;  3ZJY C;  1SE8 A;  1VQL A;  3RN5 A;  3BU2 A;  1Y1V G;  3GTG H;  2E2H H;  1BVS A;  2D0O A;  3RLF A;  4A3B H;  4C3H H;  4DR1 Q;  1E24 A;  3KOJ A;  4LFC Q;  1R9T H;  2NVT H;  3PIO A;  3IRB A;  3GTP H;  1KL9 A;  5IYB H;  5FLX c;  4A3J H;  4IJH A;  4POF A;  4HJA A;  4GKK Q;  3M4Q A;  1VQB A;  3EIV A;  1YVC A;  2RF4 A;  1XPR A;  1P8L A;  4QQB X;  2ES2 A;  1Q46 A;  3KF6 A;  2DGY A;  2ALY B;  2Z0S A;  2PQA B;  5FJ8 G;  3KDF A;  3CCU A;  3HOU H;  2NZH A;  2VUM H;  4R4C A;  4A3C H;  1X56 A;  1KAW A;  1HNX L;  4DAY B;  4NXN L;  4X6A H;  3ULL A;  4BBS H;  3Q8D A;  2K4K A;  4B3R Q;  3W1B A;  2AMC B;  2PMZ E;  3AFP A;  4P73 A;  5HGQ A;  5JJL A;  1VQF A;  1HH2 P;  3FHW A;  4YCW A;  1J5E L;  4PZ8 A;  2UUC L;  4OO1 G;  4JBJ A;  4DUY Q;  4GLA C;  4R4I A;  4JI6 L;  5AJ3 L;  1I5F A;  4LW1 A;  3HKZ E;  4DV1 Q;  1MJC A;  3A74 A;  3PUW A;  4PZ6 A;  4DV0 Q;  4DV5 Q;  4A3F H;  1XMQ Q;  2JA5 G;  4A3L G;  1WCM H;  4DR6 Q;  1YHQ A;  4JG2 A;  1JMC A;  3RN2 A;  4UY8 C;  2IX1 A;  2JA7 H;  2JA8 H;  4IOA A;  4BY7 G;  1YHA A;  2WB1 G;  4JC0 A;  1GVP A;  3F2B A;  2R93 H;  4O2D A;  3U58 A;  2BA1 A;  1X3F A;  1PFS A;  3HOV G;  1WFQ A;  2CFM A;  4L5Q A;  3HOX G;  4YWK A;  1LTL A;  4LF7 L;  3CC2 A;  1N8R C;  5JJI A;  4KHZ A;  1PH5 A;  1HNZ L;  4OON A;  4WJ3 M;  1VQM A;  5C0X G;  3I56 A;  5GAH C;  4GOP A;  4TVA B;  2K50 A;  5GRO A;  3TRE A;  1QUQ A;  5E7N A;  3SGI A;  2KCM A;  1X3E A;  5IT9 c;  4HJ7 A;  1VQ4 A;  1HZ9 A;  2UU9 L;  4IFD I;  3U4Z A;  3F2C A;  3CCQ A;  1VQN A;  3I2Z A;  3VDY A;  2Q2T A;  1BBU A;  5M3M H;  4A3G G;  4DR2 Q;  1A8V A;  3JC6 6;  2QA4 A;  5K36 G;  2UXD L;  4A3B G;  2C35 B;  1YHB A;  2LXK A;  1OXS C;  1VQE A;  3OW2 A;  2OTJ A;  5IYC G;  1HR0 L;  5IYB G;  3GTO H;  4B3S L;  5IY0 A;  5M5W H;  2ATW A;  1UWV A;  2JQO A;  4BY1 H;  3B6Y A;  1NJI C;  3M3Y H;  2XGT A;  3GD7 A;  1PH8 A;  3PO2 H;  2WFW A;  1N36 L;  5IP7 H;  2KBN A;  2K5H A;  1KHI A;  4AQY Q;  3HOU G;  2NN6 I;  3M85 A;  1GO3 E;  4X62 L;  3HOZ H;  1GM5 A;  3HOW G;  1LYL A;  4X65 Q;  1D8L A;  4TQU S;  4LFB L;  4A3D G;  1E1T A;  1WOC A;  3CAM A;  5M5Y H;  4BBS G;  2A1A A;  1D7Q A;  4B3T L;  4LF5 L;  4LF9 Q;  3I4O A;  4K0K L;  2DUD A;  1VS0 A;  4MTN A;  2VQF L;  4DKA C;  4P74 A;  3DLL A;  1V9P A;  2GVB A;  2VY3 A;  4JOI C;  3K81 C;  1JE5 A;  1N33 Q;  5IWA Q;  1NMF A;  3STB C;  1PH7 A;  4L5S A;  3L2P A;  4IFD J;  5M3F G;  4X64 Q;  1X54 A;  2JA8 G;  4DV4 L;  3GTL H;  3WWV A;  1HZA A;  2JE6 I;  2ID0 A;  2MO0 A;  1PH3 A;  2YTX A;  2R93 G;  1P16 A;  4DV2 Q;  2B3G A;  1ASY A;  2PI2 E;  5GAD C;  3D0F A;  1TWG H;  4HIM A;  3S1N H;  1S3O A;  3J80 i;  4DR3 L;  4DV7 Q;  3UDI A;  2OQK A;  3I4N H;  4LF6 L;  2KEN A;  4LUO A;  1PH4 A;  4P71 A;  1Q12 A;  4HIO A;  4PZ7 A;  4JI4 Q;  4AYB E;  1IBL L;  4B3T Q;  5M3M G;  2UXB Q;  2JA6 G;  1U5K A;  1WJJ A;  3OTO Q;  3OYY A;  4ALP A;  2LSS A;  1N34 L;  5IE8 A;  2A19 A;  2BH2 A;  2IX0 A;  4KHP Q;  3U50 C;  2GVA A;  2BA0 A;  4DV6 Q;  1XMO Q;  1V1Q A;  3KJO A;  1T9H A;  1UE6 A;  3GTK H;  1K0R A;  5FLM H;  1CKN B;  1B70 B;  1Z47 A;  3KF6 B;  3W1G A;  1AE3 A;  4OWW B;  3A0J A;  3KDF B;  2B29 A;  1Q1B A;  3NEM A;  1VQJ A;  4KLK A;  1C0A A;  2Z6K A;  1YIJ A;  4A75 A;  3A5Z B;  3PO2 G;  1A62 A;  1XNR Q;  3PO3 H;  5IP7 G;  1JJG A;  1WI5 A;  3JAM i;  2CCZ A;  3NBH B;  1OTC A;  3HOZ G;  1E7Z A;  4DR5 L;  4DR3 Q;  2JK8 A;  3K80 C;  2OTL A;  3DM3 A;  4GLV B;  1I94 Q;  3I4M G;  5IYD H;  3TS0 A;  2PI2 A;  3CMA A;  1X9N A;  1H95 A;  1HJP A;  1L1O A;  4RMF A;  2R92 G;  1QVG A;  4IJL A;  3UDG A;  4IPH A;  3CCR A;  2HIX A;  1K9M C;  3J81 c;  3HKZ G;  4YHH L;  3I7F A;  2ZM6 L;  4A3I H;  1IBK Q;  1NY4 A;  3CC4 A;  5LMN Q;  1FVI A;  2R7Z H;  3GO5 A;  4IFD G;  1E22 A;  2V1C C;  4GOP C;  4GLX A;  4GS3 A;  1N34 Q;  4JI7 L;  2AKW B;  4X66 Q;  2LXJ A;  4DR4 Q;  2L15 A;  2EXD A;  2F3I A;  4LUZ A;  5C3E H;  2MQH A;  5HY6 A;  3U4V A;  3T1H Q;  1PH9 A;  4B3M L;  4DR7 Q;  4JYA L;  4GKJ L;  2K5N A;  2I5H A;  4QIW E;  1OXU A;  1TWH H;  2D62 A;  4MZ9 A;  4JI3 L;  3F2D A;  1CSQ A;  2KHI A;  4GOP B;  2QGQ A;  4JI5 L;  3J81 j;  2B63 G;  3S14 H;  1OXX K;  1PV4 A;  2E2I H;  1HNW L;  2CWP A;  2N78 A;  4YY3 L;  4PG3 A;  3PV0 A;  3CC7 A;  3MEF A;  1X3G A;  1VQ8 A;  3PGZ A;  2YU9 H;  5C4J H;  3HKS A;  3TS2 A;  3BZK A;  1PH2 A;  4JI2 L;  2ZTD A;  3NEL A;  4QJF A;  3T1Y L;  2YV5 A;  1EFW A;  2K52 A;  1HNX Q;  3GDE A;  2Y0S G;  2VQE L;  4LF4 L;  4NXN Q;  2EQS A;  4JI0 L;  2E5L L;  1FJG L;  4BA2 I;  1JJC B;  3L0O A;  4BBR G;  4JV5 L;  4A3M G;  2I5M X;  3HOY H;  1J5E Q;  5GAG C;  1PA6 A;  2HHH L;  5M5X H;  2UUC Q;  1XNQ L;  1YJ9 A;  4DK6 C;  3M4O H;  2MNA A;  4JI6 Q;  4NPS A;  5AJ3 Q;  1IBM L;  3LGJ A;  3S1Q H;  1UE1 A;  1KXL A;  2NVX H;  1EQQ A;  1EQR A;  4A3J G;  4EQ5 A;  4LF8 L;  2Y0S E;  3CF5 A;  3M7N A;  1U0L A;  1Y14 B;  3PSI A;  3UE1 A;  5IYD G;  3UDF A;  4DUZ L;  2AWO A;  5C4X H;  4A93 H;  4JI8 L;  4A3E H;  4HJ8 A;  3ICE A;  1M90 C;  3EBE A;  3H0G H;  4LF7 Q;  1XPU A;  2VUM G;  4A3C G;  4A3I G;  4XTC S;  1SLJ A;  3TEH B;  1NMG A;  1W3S A;  1HZC A;  5LMU L;  1HNZ Q;  3PUV A;  2I5L X;  4O0A A;  4JI1 L;  4HJ5 A;  1Q82 C;  4OX9 L;  2R7Z G;  4OXP A;  5ELN A;  4BXX H;  1LUZ A;  2UU9 Q;  2WP8 J;  2I0Q A;  4RG1 A;  2VL6 A;  3I55 A;  4PMW A;  4DV3 L;  2K75 A;  3HFZ B;  4QL5 A;  1KIX A;  1Y1W H;  1Y1V H;  4R1J A;  2UUB L;  1O7I A;  2UXD Q;  1QZH A;  4A3F G;  3AYH B;  3AEV A;  1WCM G;  4R4T A;  2JA7 G;  1SFO H;  2UUA L;  1HR0 Q;  2HQL A;  4AYB G;  2AHO B;  1EOV A;  2MFI A;  3CW2 C;  3PUY A;  2GN5 A;  4B3S Q;  2VZA A;  2QEX A;  4R4Q A;  3GTM H;  3ERS X;  1I6H H;  2XTI A;  5C0X I;  4BA1 I;  1Q7Y C;  4NXM L;  1QVF A;  2Z6K C;  3AQQ A;  3A5U A;  2N3S A;  4QY7 A;  2H5X A;  1N36 Q;  2UXC L;  5JEA G;  2JJQ A;  5FJ8 H;  1N32 L;  3F1Z A;  4X62 Q;  1K73 C;  4Y7N H;  2ZTE A;  4R4O A;  4LFB Q;  1FL0 A;  2N49 A;  4ME3 A;  5JJK A;  1IYJ B;  2OQ0 A;  1L1O C;  2F4V L;  1HZB A;  4LF5 Q;  2ZJR A;  3UE0 A;  3E0E A;  5BR8 L;  3CME A;  3RZO H;  4K0K Q;  1UE5 A;  4APV A;  2VQF Q;  3CCL A;  4UP7 A;  4XIG S;  4DR1 L;  1Q86 C;  4YCU A;  4KI0 A;  4LFA L;  3CP0 A;  3EN2 A;  5H1S E;  1YNX A;  1L1O B;  1XTD A;  3FP9 A;  3K7A H;  3KF8 B;  3MXN B;  4IPG A;  4DV4 Q;  1X65 A;  2JEB I;  4GKK L;  4DNI A;  4BY7 H;  2IHF A;  2WAQ E;  1CSP A;  4BY1 G;  3H3V H;  4C3I H;  3PF4 A;  4A93 G; 
#chains in the Genus database with same CATH topology
 3CCJ A;  4A3E G;  2JA7 B;  1CI3 M;  2OCE A;  3A8K E;  1GUN A;  3K6O A;  3KLS A;  1B8A A;  3ND9 A;  4AYB B;  3A7L A;  1WTV A;  4Z9C B;  3A8I E;  4PMC A;  1VQ9 A;  4LF6 Q;  2C9O A;  1Q3L A;  4HSV A;  1AZP A;  3CKI B;  1VQI A;  4DPG A;  3J7Z C;  1IBL Q;  4K5W A;  2JA9 A;  4DUY L;  1ZKO A;  2I07 B;  4K5X A;  4A3G H;  1EOT A;  2B2U C;  4ZKB B;  4DV1 L;  5L37 A;  3K5N A;  1EIY B;  4DR6 L;  5IGC A;  4B9X A;  1V43 A;  1TS5 A;  4I7A A;  1JB7 A;  4CGY B;  1L0X B;  3GTO B;  2RSN A;  1CKN A;  1LV9 A;  4X3T A;  3I4N G;  2MUY A;  4BY1 B;  1R4Q B;  1ASZ A;  1VQO A;  1EY4 A;  2ZJQ A;  1LTR D;  5LHY 1;  3S2H H;  5CV7 A;  1T5E A;  1RIP A;  5ELC A;  1S5F D;  5JEA J;  1EY0 A;  1VQC A;  3QOL A;  3J80 c;  4YHH Q;  3CPF A;  3TP6 A;  1MGS A;  1YNN C;  3OOC A;  2PQA A;  4CKC A;  5M3F H;  4HIK A;  4JI7 Q;  4WJ4 A;  2KQ3 A;  1PTO B;  3OIP A;  1D5M C;  2R6G A;  1X6O A;  2AWN A;  1PYB A;  4JBW A;  5I2X A;  4Q5V A;  3VYR A;  3K0X A;  1SMX A;  5EPL A;  1HNW Q;  1LO5 D;  5IP9 G;  4C3J H;  1AFP A;  4IPC A;  4LK1 C;  1WTO A;  1I6H B;  2AQ1 B;  3NP8 A;  4A4I A;  4IAL A;  4FDB A;  1SN8 A;  3OWF A;  5FO9 B;  4TKO B;  3T4A C;  3E3X A;  1B3A A;  3KYH C;  2BCO A;  3RLN A;  4OO1 I;  4HTH A;  3FVQ A;  2NVQ H;  2EJF C;  1M1K C;  3CPW A;  2PCF B;  2LS0 1;  2HHH Q;  1TS4 A;  1XNQ Q;  3J81 i;  3K7U C;  3MWY W;  3GTK B;  4DV7 L;  1Z9F A;  1IW7 C;  1K3R A;  5I2Y A;  1DGS A;  1HA5 A;  1PFM A;  1HR0 W;  2K03 A;  1GKH A;  2CKZ B;  1IXR A;  2R7F A;  4DUZ Q;  4JI4 L;  3I4M H;  4JBK A;  2R92 H;  1CM9 A;  4KY7 A;  4NW2 A;  3H6M A;  1L2F A;  1PRT F;  4HMJ A;  1KC8 C;  4A76 A;  2K14 A;  1MJE A;  1GUG A;  2Q2U A;  4IUP A;  4OWT B;  4DV6 L;  4JI1 Q;  1IL2 A;  4IOC A;  2L1B A;  3J7A V;  4X3K A;  1NE3 A;  1GD7 A;  1F2M A;  1H9M A;  4LFC L;  5E4X A;  4LMQ D;  5C3E B;  2UUB Q;  5I6W A;  2JA5 H;  1TU2 B;  3FPU B;  2O5J C;  5DAU A;  3FKI B;  2G9D A;  5GQO A;  3W2D A;  2E2J H;  2KJX A;  1V1P B;  3S14 B;  3KLW A;  1VCI A;  1WTW A;  5CBA E;  4NXM Q;  2DY7 A;  4F8M A;  4U67 3;  3CXC A;  2UXC Q;  1WTP A;  2IHE A;  5LMN L;  1GXD C;  5TSS A;  1PYS B;  4Q0F A;  1B7Y B;  4X66 L;  5JAV A;  2R3Z A;  1RTN A;  5DLQ E;  3O13 A;  3BJU A;  2F4V Q;  4DR7 L;  1E3P A;  4BBR H;  1VQH A;  2F3W A;  5BR8 Q;  4GN4 B;  3BU2 A;  2L11 A;  2D0O A;  1Z6H A;  4C3H H;  4DR1 Q;  3KOJ A;  5EKI A;  1HQR D;  4O42 A;  1NR2 A;  5IYB H;  1JOK A;  4POF A;  3S1Q B;  2DJF C;  3BVZ A;  2NVX B;  5FJ8 G;  3Q0A A;  4A3C H;  1X56 A;  1T5X D;  5C4X B;  4QF4 A;  3OIQ A;  4A3E B;  2Z9H A;  1ZYR C;  4PV1 C;  5JJL A;  2PMZ E;  5HGQ A;  3EFX D;  1J5E L;  1PYW D;  3CRL C;  4DUY Q;  4GLA C;  4R4I A;  4JI6 L;  1GHK A;  4DK1 A;  1C8C A;  4LW1 A;  4DV1 Q;  2PW5 A;  1B9N A;  1NR4 A;  2XNA C;  4DR6 Q;  4CHT B;  1YHQ A;  4IOA A;  3RN2 A;  1YHA A;  4C3I G;  1UNS A;  3F2B A;  2R93 H;  1IKL A;  3U58 A;  5A35 A;  5C6A A;  1PFS A;  4LF7 L;  1N8R C;  1HNZ L;  4OON A;  4WJ3 M;  1JC7 A;  5C0X G;  5JPM C;  3MXU A;  4GOP A;  2K50 A;  2BOS A;  4KN4 C;  3SGI A;  5IT9 c;  1S5D D;  2KA7 A;  1HZ9 A;  4IFD I;  3CCQ A;  1BBU A;  4DFA A;  5M3M H;  3I90 A;  1AZQ A;  1RCV D;  2LXK A;  3OW2 A;  1H9K A;  4B3S L;  2ATW A;  3BDL A;  2EJG C;  3M3Y H;  3K57 A;  3PO2 H;  3GD7 A;  2Q8I B;  4NKL A;  4PNY A;  1KHI A;  1GO3 E;  4X62 L;  2E74 C;  5JPN C;  4I65 A;  1LYL A;  2CW0 D;  2LFN A;  2FFK B;  3LWE A;  1WOC A;  2QDB A;  3CAM A;  5M5Y H;  2A1A A;  3HOX B;  4LF5 L;  2DUD A;  3M7G A;  1PZI D;  2VQF L;  4DKA C;  2BDO A;  5C5M A;  1F9Q A;  4RHS A;  1V9P A;  3CQZ B;  2VY3 A;  3K81 C;  1JE5 A;  3EA6 A;  3A56 A;  1NMF A;  1SNC A;  5EQ0 A;  1X54 A;  2JA8 G;  4DV4 L;  4YIJ A;  1STN A;  2MO0 A;  1PH3 A;  4KK7 A;  3Q22 A;  2B3G A;  3P75 A;  2ZXP A;  5GAD C;  3D0F A;  4HIM A;  3BG3 A;  3J80 i;  4DV7 Q;  2IL8 A;  1KDA A;  2B2V A;  3I4N H;  4LUO A;  4UDU C;  3AB9 A;  4HIO A;  4JI4 Q;  3VYS A;  3HOU B;  3HOW B;  2NB0 A;  4B3T Q;  1LT3 D;  1VMC A;  4KD3 A;  2JA6 G;  2AQ2 B;  4ALP A;  3IFD A;  2EVB A;  1SYG A;  2LSS A;  5ELF A;  4DV6 Q;  1NNX A;  3KJO A;  1T9H A;  2K6A A;  1B70 B;  1Z47 A;  1BOS A;  2HCC A;  4XYQ A;  1AE3 A;  3W1G A;  1QE6 A;  1Q1B A;  3NEM A;  1VQJ A;  1C4Q A;  1A62 A;  1KLU D;  1JJG A;  2AUJ D;  2EY5 A;  5CV8 A;  4DR5 L;  2JK8 A;  3K80 C;  3DM3 A;  5IYD H;  3TS0 A;  4EQN A;  1L1O A;  1H9S B;  3KF8 A;  1QVG A;  1ET6 A;  3HKZ G;  3NXW A;  2A6E D;  1NY4 A;  2GA4 B;  5LMN Q;  2V1C C;  4GOP C;  1PRT C;  1HPC A;  4GS3 A;  1N34 Q;  2AKW B;  4X66 Q;  4K6L A;  2L15 A;  2EYO A;  4DR7 Q;  2NVY B;  1OXU A;  1QG7 A;  3F2D A;  5F2D A;  2KHI A;  4JI5 L;  2B63 G;  1PV4 A;  1VF7 A;  2CWP A;  1ILP A;  4YY3 L;  5FK9 C;  5I6Y A;  3TS2 A;  5ELD A;  2PMZ B;  3T1Y L;  2K7V A;  1E0B A;  1FJG L;  4BA2 I;  1B1Z A;  1ONL A;  3BVM A;  1NCV A;  1J5E Q;  2K01 A;  3S1R B;  4JI6 Q;  2MPM A;  1STA A;  2KCC A;  3LGJ A;  1UE1 A;  5G3L D;  3L3O C;  1Y14 B;  3A8J E;  3UDF A;  1Y8P B;  3T16 A;  1ENF A;  3URY A;  3IAY A;  2L4N A;  2XVS A;  4HJ8 A;  2VB3 X;  4LJZ C;  3S16 B;  3EBE A;  4LF7 Q;  1A15 A;  4XTC S;  3TEH B;  1NMG A;  2B2V C;  1HNZ Q;  2I5L X;  1Q82 C;  4HJ5 A;  4OXP A;  2F0M A;  2J7Z A;  4BXX H;  3JAM E;  2EY1 A;  1LUZ A;  2PPB C;  2WP8 J;  1IYU A;  1YNN D;  3HFZ B;  1Y1W H;  4R1J A;  1O7I A;  5D14 A;  2G9H D;  2ICI A;  3AEV A;  3ERO A;  4R4T A;  4A3M B;  2JA7 G;  3K5M A;  1W6J A;  2UUA L;  4AYB G;  1GUS A;  1U4P A;  1JWS D;  3PUY A;  2MFI A;  4B3S Q;  3ERS X;  4HAE A;  3FMC A;  4NP5 A;  3GTP B;  1F2L A;  4A3J B;  1DYQ A;  2H5X A;  4FO2 A;  5HGT A;  2E76 C;  1S5C D;  5FJ8 H;  2SOB A;  4X62 Q;  1K73 C;  1KLG D;  3DMU A;  4R4O A;  1G2T A;  2N49 A;  1IYJ B;  1L1O C;  1HZB A;  1ML0 D;  4LF5 Q;  2RDH A;  3G7L A;  4APV A;  2VQF Q;  4G57 A;  2IW3 A;  3MEH A;  3QO2 A;  5H1S E;  3FP9 A;  3MC0 B;  3K7A H;  2Z4I A;  3MXN B;  4DV4 Q;  4K5V A;  3OSO A;  4GKK L;  5JOB A;  2WAQ E;  1CSP A;  4BY1 G;  3H3V H;  4C3I H;  1QJO A;  1WCM B;  3M4P A;  2JA8 B;  2F0T A;  2RKS A;  2SNS A;  1EYA A;  1DJR D;  4H0L C;  1EYG A;  1KDB A;  3A7A B;  2TSS A;  2A8V A;  1O80 A;  4EX5 A;  4JW0 A;  1RL2 A;  1WD1 A;  3J7A 5;  2EIF A;  3CCM A;  5C0X H;  3A55 A;  3D4W A;  4WOR A;  1YJW A;  1AE2 A;  2DJG C;  5EBD A;  1EUJ A;  2RHQ B;  4IPD A;  1IKM A;  3MVV A;  1DXM A;  3H15 A;  1W2B A;  1PVO A;  5J1Z A;  3A54 A;  1LT6 D;  2Q2I A;  3PCO B;  3CCS A;  3ULP A;  5M9O A;  3VR5 A;  4LFA Q;  1XPO A;  4A3K H;  4RHR A;  1GHJ A;  4FYD A;  1TWC H;  4MIU A;  1JQY D;  4H02 A;  2YTV A;  4IO9 A;  5M5W B;  5COR A;  2N88 A;  4DR5 Q;  1V8Q A;  3NSW A;  4MTK A;  2DY8 A;  2JSO A;  5C3X A;  2NN6 G;  3TP7 A;  3CCV A;  4XDX A;  1VQP A;  3E5S A;  2A69 D;  3GTQ H;  3S2D H;  4DR2 L;  2F4I A;  4K8I A;  5GAE C;  4ID6 A;  3AFQ A;  4MN3 A;  3RZD H;  5ELB A;  3S24 A;  4UP9 A;  4P72 A;  1I50 H;  5CBE E;  1QVC A;  2JEA I;  2FXQ A;  5J3B A;  1QZG A;  4EQO A;  1SNP A;  1S72 A;  5C44 G;  2XN9 C;  4JI5 Q;  5A2Q E;  4X65 L;  1U4R A;  4L5T A;  4YY3 Q;  1TWG B;  1SSO A;  1AEX A;  3IL8 A;  1Y8N B;  1RF2 D;  1K83 H;  3C3L A;  2OXP A;  2NZO A;  1LTA D;  1OXT A;  3R3O A;  1ICF B;  3S15 H;  1ZYR D;  2JA6 H;  3T1Y Q;  1CKM A;  1FD7 D;  4JBM A;  1JB3 A;  5C3E G;  1LTS D;  1FJG Q;  3C2P A;  1MSG A;  4HED A;  1WYD A;  3DUZ A;  2F0J A;  3FKI G;  3I73 A;  5EAY A;  1K8A C;  1G2S A;  3GP7 A;  1A63 A;  3E9I A;  1CUK A;  1VQA A;  5IOD A;  2DNE A;  4DF7 A;  2UXB L;  3OTO L;  4WFN 3;  1BBW A;  5NUC A;  4KHP L;  1ESF A;  4JCV E;  2VW9 A;  3W5O A;  5ELO A;  1XJV A;  1CZG A;  1ET9 A;  3NTH A;  4GNX B;  2WIN B;  4BS9 A;  3KUP A;  3E9H A;  2B2Y A;  2EYJ A;  1XNR L;  1KDC A;  2WII B;  1LAB A;  5J22 A;  2B63 H;  1L0W A;  2HT1 A;  3P1H A;  5FO7 B;  3KJP A;  2UUA Q;  3Q6S A;  4LWC A;  1K8M A;  5C4X G;  1OO9 B;  2ZJP A;  1KQS A;  1BCP B;  4POG A;  1A6X A;  3CRK C;  3D4R A;  1A0I A;  2YU9 B;  4KKS A;  5C4J B;  2IT1 A;  5C0X J;  4DR4 L;  1PFB A;  3R93 A;  1TR5 A;  2RCF A;  1Q8K A;  4LNQ A;  3HEJ A;  3T1H L;  1CFM A;  1CQV A;  1JT8 A;  1FR3 A;  1SE8 A;  4EGV A;  4M1U B;  1BVS A;  2WAQ B;  2E2H H;  5K36 H;  1ENA A;  3DEP A;  2D9U A;  2RDF A;  4QCL A;  3M4Y A;  3HOY B;  3M4O B;  1QIL A;  1TS2 A;  4IJH A;  4HJA A;  1BF4 A;  4GKK Q;  5BN4 A;  4IUQ A;  1XPR A;  4CJ1 B;  3KF6 A;  1TY0 A;  2Z0S A;  3CCU A;  2QDL A;  3KDF A;  3R2T A;  2J0T D;  1JWU D;  3NBH A;  4H44 C;  4BBS H;  2K4K A;  3W1B A;  2AMC B;  2E2D C;  4ZLT F;  3FHW A;  4YCW A;  4PZ8 A;  5COY A;  3NQT A;  4OO1 G;  4HN7 A;  4CJ0 B;  4KD4 A;  1MJC A;  3PUW A;  4PZ6 A;  2NVQ B;  4A3L G;  4JG2 A;  1JMC A;  2IX1 A;  2JA7 H;  1O7Z A;  4ILW A;  1GVP A;  2BA1 A;  1I4G A;  3HOV G;  1WFQ A;  3VR3 A;  1IHZ A;  3HOX G;  1LTL A;  3TP8 A;  3LWU A;  4TVA B;  4E6I A;  4HJ7 A;  4TRD A;  1JOR A;  2O2L D;  1PRT D;  1VMP A;  3VYU A;  4DR2 Q;  1I6V C;  3JC6 6;  4RWS C;  1BCP F;  1M8A A;  4KKT A;  4A3B G;  1YHB A;  1Y69 U;  3RZO B;  1VQE A;  3H3V C;  1HR0 L;  3GTO H;  3T53 B;  5IY0 A;  1UWV A;  2JQO A;  3MZ5 A;  4BY1 H;  2B2Y C;  4LAA A;  1NJI C;  2XGT A;  2WFW A;  3TSS A;  2KBN A;  3RMH A;  5FOB B;  4BY7 B;  2F0D A;  1SE3 A;  3H94 A;  5KIX A;  3HOU G;  5KNC A;  3Q24 A;  1BXT A;  3HOW G;  3VR2 A;  4X65 Q;  1F77 A;  5C44 B;  1ICW A;  1D7Q A;  2ZXO A;  4B3T L;  3I4O A;  1TII D;  3P20 A;  1Y8O B;  3DLL A;  3NWS A;  2GVB A;  2J4X A;  3L2P A;  2PYK A;  3X3N A;  1MHW C;  1F9S A;  4DNR B;  1KAA A;  1HZA A;  2ID0 A;  4C3H B;  1TWA B;  3D8G A;  1BQQ T;  4HMI A;  2F0N A;  4ZCK A;  3S17 B;  5HUR A;  1I3Q B;  1Q90 A;  3UDI A;  4KV6 A;  3V05 A;  1PTO F;  1A3U A;  1EY6 A;  2NN6 H;  4P2C B;  1DCZ A;  1YNJ D;  2UXB Q;  3OTO Q;  4A3D B;  1G8Z D;  3SK8 A;  2EY6 A;  4WRD A;  2A69 C;  1N34 L;  4KHP Q;  2IX0 A;  2HDL A;  3U50 C;  4FNF A;  1MBY A;  1AP0 A;  4C2M B;  3GTK H;  3OMG A;  3ERQ A;  5CGK A;  4KLK A;  5D65 A;  1YIJ A;  4A75 A;  3P7J A;  1XNR Q;  3FEW X;  5IP7 G;  1WI5 A;  1OTC A;  3HOZ G;  4DR3 Q;  4EVO A;  2MJ8 A;  4GLV B;  1B44 D;  2PI2 A;  1HUN A;  1X9N A;  4N8F A;  1SYD A;  4RMF A;  1K9M C;  4R8N A;  4FF3 A;  2AQ3 B;  3I7F A;  2ZM6 L;  1EWH A;  4IUR A;  4EQP A;  1FVI A;  2R7Z H;  4IFD G;  2B2W A;  4GLX A;  2FHT A;  4DR4 Q;  5M3M B;  2EXD A;  4LUZ A;  5C3E H;  3U4V A;  2K1B A;  4M8A A;  3T1H Q;  1PH9 A;  4JYA L;  3X3M A;  2I5H A;  3D4D A;  2D62 A;  1D1I A;  4JI3 L;  5E4W C;  2F0K A;  3S14 H;  2N78 A;  2RBM A;  5FLX L;  3RUZ A;  1D6E C;  3LNN A;  4XT3 B;  3BZK A;  2KOL A;  2M9V A;  4JI2 L;  1X3Q A;  1A2T A;  4IZ8 A;  4CDC C;  2HCI A;  1EFW A;  5DM7 3;  4DXF A;  1SNQ A;  2E5L L;  1JJC B;  2F0V A;  3MXG A;  3K58 A;  4A3M G;  5K5P A;  1YJ9 A;  2MNA A;  2BE5 D;  4DN4 M;  1IBM L;  1HFG A;  4ZUJ A;  3S1Q H;  3DWQ A;  2NVX H;  1EQQ A;  4A3J G;  3GTJ B;  4K6D A;  4F87 A;  4LF8 L;  1WVL A;  1TWF B;  3HG9 A;  1U0L A;  4NMZ A;  5C4X H;  2PZT A;  4A3E H;  4KJO A;  3NTI A;  5KND A;  3ICE A;  3SR1 A;  1S5E D;  4O1N A;  4A3I G;  3U9O A;  1W3S A;  1GUT A;  1DD2 A;  1HZC A;  5LMU L;  2EZV A;  3OMC A;  4IUU A;  3HOV B;  3KLR A;  5DEH A;  2F0L A;  2K5D A;  4RG1 A;  3I55 A;  3JAM L;  4DV3 L;  2JP1 A;  3ND8 A;  4QL5 A;  1QNK A;  3QOJ A;  3TZU A;  2OF1 A;  1WCM G;  1HR0 Q;  1B9M A;  3GTG B;  4A3B B;  3CW2 C;  2X69 A;  2FIN B;  1SE2 A;  2QEX A;  2XSC A;  4R4Q A;  2NVT B;  2QKI C;  5C0X I;  4WJW A;  2N3S A;  1EFI D;  5JEA G;  1FNW A;  3F1Z A;  4FXG C;  5KEE A;  4Y7N H;  1FL0 A;  5JJK A;  5KYL A;  3BYY B;  1SND A;  5C5L A;  2VUM B;  3E0E A;  3U9S A;  3FPP A;  1UE5 A;  3KLS X;  4XIG S;  4YCU A;  4LFA L;  3D6C A;  1GUW A;  2B2W C;  4KY6 A;  3DHQ A;  5CV6 A;  4S3S A;  4XQN A;  1X65 A;  3NWT A;  1CTM A;  4DNI A;  1CK1 A;  4RA8 A;  4A3F B;  4K8J A;  1SXT A;  4A93 G;  1JOQ A;  1RD9 D;  4XT1 B;  4RGT A;  1PH6 A;  1N9W A;  4DXG A;  1SRO A;  3HOX H;  2QEJ C;  5IP9 H;  1D5Z C;  1EEI D;  4ODG A;  1UEA B;  2LKV A;  2NYZ D;  5CV9 A;  1MI2 A;  1YBY A;  4B3R L;  2VS1 A;  4RCO A;  3CQZ H;  3R2I A;  4YCV A;  1LTT D;  4L5R C;  3I91 A;  3STB D;  1V1P A;  5IGG A;  3K8A A;  3PUZ A;  3S1M H;  3RLO A;  1FYC A;  2CVR A;  5IGE A;  3G71 A;  3G6J B;  1MD2 D;  1CKO A;  2DN8 A;  3PF5 A;  1HHV A;  3L9A X;  5FLX E;  4R9W A;  3QWN A;  1QUQ B;  2V4D A;  2DNC A;  1TY2 A;  5DNF A;  3HOW H;  1Q1E A;  3D6W A;  4HSP A;  4YWL A;  1SRU A;  3HOZ B;  4C1N I;  4GZY C;  1II3 A;  1S5B D;  1PTO C;  3NUC A;  1U9R A;  4HR7 B;  3ULJ A;  2ZM6 Q;  1WTQ A;  3UDX A;  1ZXT A;  1DZ1 A;  2BDN A;  3TRZ A;  5FLM G;  5T1I A;  4JYA Q;  1F9P A;  4V19 0;  4JI3 Q;  4MNO A;  1STY A;  1EY5 A;  1QNU A;  3TP5 A;  2H4O A;  5A2Q L;  2KHS A;  1LAC A;  4UPA A;  2WB1 E;  2F0S A;  3MHB A;  4J1M A;  4JI2 Q;  3TQY A;  1FGB D;  1IL8 A;  4UHV A;  3CCE A;  3JAM c;  1N33 L;  1RTO A;  1FGU A;  3F8T A;  1YNJ C;  2X6L A;  1NBW A;  2YYZ A;  1KRT A;  3DEO A;  4QGU A;  2NVY H;  1YZ6 A;  3HZX A;  2ZT9 C;  1UE7 A;  2E5L Q;  1HA6 A;  1VQD A;  2D2C C;  1JCK B;  3G6E A;  1OXV A;  2JXM B;  1IBM Q;  4IUN A;  3T51 B;  1B53 A;  2WKD A;  2ZTC A;  1YI2 A;  4RGO S;  3H91 A;  4LF8 Q;  5AFW A;  4P75 A;  3TN2 A;  3PO3 B;  4YWM A;  1SDF A;  3CD6 A;  1MKH A;  1CA6 A;  1JOO A;  3BS1 A;  3PIP A;  4N8X 1;  4G7H C;  1NTG A;  2K05 A;  3IKJ A;  1XYI A;  1VF5 C;  5LMU Q;  1SYE A;  1X55 A;  1EIF A;  5EPJ A;  2WAQ G;  2E75 C;  1XMO L;  3S1R H;  1K8O A;  4A3I B;  4OEL B;  3HOY G;  2Z6B A;  4RKL A;  3V96 A;  2B8F A;  1UEB A;  2BH8 A;  4DV3 Q;  4ZRZ A;  3BVG A;  2HUG A;  4NB3 A;  1QOH A;  1RHP A;  2QW7 A;  1VQ7 A;  1TWH B;  3GQB A;  5KNB A;  3S16 H;  4OWX B;  2XWJ B;  2E2I B;  1J9O A;  1YJN A;  1IBK L;  3RNU A;  1VQG A;  4JOI A;  2PNH A;  1SNO A;  1K28 A;  4L63 B;  4I7Z C;  3BZD B;  3IFT A;  2EOT A;  2CHB D;  1A2U A;  5BN5 A;  4A3M H;  2YTY A;  3W3A A;  1VQ5 A;  3ZJY C;  1AN8 A;  3RN5 A;  1SE4 A;  3RLF A;  3QG1 A;  4QB4 A;  1R9T H;  3PIO A;  3IRB A;  2BE5 C;  5M5X B;  3GTP H;  1KL9 A;  1RKN A;  4A3J H;  3SK4 A;  1XXG A;  3EIV A;  1P8L A;  4R8I A;  2ES2 A;  2EDG A;  1Q46 A;  2DGY A;  2PQA B;  2RA4 A;  3AU7 A;  4A93 B;  1HNX L;  1D1K A;  4NXN L;  4DAY B;  3ULL A;  4ZK9 B;  5IGD A;  3J81 E;  3Q23 A;  4X6A H;  4F7X A;  4B3R Q;  3H0G B;  3S15 B;  1VQF A;  1PZJ D;  4JBJ A;  1H9S A;  2B8G A;  4N9T A;  1EYD A;  2F0O A;  2I46 A;  2F0U A;  2JA5 G;  1HRJ A;  1WCM H;  2JA8 H;  4UY8 C;  1JIC A;  2K5Q A;  1H9J A;  4BY7 G;  1Y1V B;  4JC0 A;  3QIA A;  1CHQ D;  4ZAI A;  4O2D A;  1ZEQ X;  1X3F A;  2F0F A;  1SFO B;  2FJ2 A;  1HTL D;  2CFM A;  1VDZ A;  4YWK A;  1E2Z A;  1TQO A;  3GTM B;  1KAB A;  4DNT B;  1PH5 A;  5JJI A;  2F0P A;  4RKB A;  5GAH C;  3TRE A;  1QUQ A;  5FKA C;  2UU9 L;  2HQE A;  3U4Z A;  3F2C A;  3CHB D;  1VQN A;  4K2K A;  3VDY A;  1O78 A;  1Z7T A;  5EKL A;  4KJN A;  1WD0 A;  5T1G A;  1A8V A;  1SMY C;  3J80 L;  4C3H G;  3I72 A;  1A3T A;  1OXS C;  2OTJ A;  5IYC G;  5CR3 A;  5IYB G;  1EWC A;  5M5W H;  2EY2 A;  1LTB D;  1KNA A;  4J8Q A;  4IQZ A;  1PLF A;  3SHL A;  1N36 L;  1NUC A;  2WB1 B;  3OW7 A;  2NN6 I;  3M85 A;  1D8L A;  1ROD A;  4TQU S;  4A3D G;  1FNV A;  1EU4 A;  3HGB A;  5ELE A;  3TBI B;  4K0K L;  1VS0 A;  5C4H A;  3DWP A;  5KGU A;  1KNE A;  3J7A F;  3WOE A;  4JOI C;  4ZYS A;  1N33 Q;  3STB C;  4L5S A;  4IFD J;  5EKK A;  4A3G B;  2O4X A;  3GTL H;  3WWV A;  1ILQ A;  2JE6 I;  2YTX A;  2R93 G;  1ASY A;  2MGS A;  1TWG H;  4ZQ3 A;  3S1N H;  4DR3 L;  3EVQ A;  4HCS A;  2F3V A;  4XQJ A;  4KY5 A;  1SNM A;  4RGN A;  1ENC A;  1B4O A;  1MSH A;  2NTS A;  4OGQ C;  5M3M G;  1U5K A;  1WJJ A;  2ENB A;  1PFN A;  3S2H B;  5IE8 A;  2A19 A;  2VB2 X;  2BA0 A;  1XMO Q;  1V1Q A;  2EPB A;  4JVZ A;  1UE6 A;  1K0R A;  5FLM H;  2EYL A;  4K2L A;  4PQX A;  4OWW B;  3A0J A;  5M3F B;  2Z6K A;  3PO2 G;  3A5Z B;  3EJI A;  3NE5 B;  3JAM i;  2KEE A;  1E7Z A;  3WDN A;  1HJP A;  3MFY A;  2Z8L A;  4B08 A;  3MXN A;  3VR6 A;  4IJL A;  4C3J B;  3UDG A;  4IPH A;  1IBK Q;  3NBI A;  3CC4 A;  1I4R A;  2XWB B;  1E22 A;  2EXZ A;  2QF7 A;  2L9H A;  4B3M L;  4GKJ L;  3TZD A;  1BCP D;  3LX0 A;  4QIW E;  2KED A;  1CSQ A;  3VA5 A;  4GOP B;  1PRT B;  1TKW B;  3J81 j;  2WKC A;  1OXX K;  4H13 C;  2WV6 D;  5JVG 3;  4PG3 A;  3PV0 A;  3CC7 A;  1U4M A;  2Z1C A;  3MEF A;  1X3G A;  2X6G A;  1VQ8 A;  1NSN S;  2YU9 H;  4DK0 A;  5C4J H;  4RCN A;  1PH2 A;  1H9R A;  4QJF A;  3I3C A;  3I4M B;  1CA5 A;  3DXJ C;  3N6R A;  4ZKC B;  2R92 B;  2KUM A;  2A68 C;  1TS3 A;  1HNX Q;  3SK5 A;  2VQE L;  4LF4 L;  4NXN Q;  5CYU A;  2EQS A;  4JI0 L;  3J80 E;  2L12 A;  1WTH A;  1WTR A;  1S4Z A;  4JV5 L;  3HOY H;  4DAY A;  5GAG C;  3M4O H;  2F0W A;  1DOM A;  1RJT A;  3SE0 A;  4DK6 C;  1PXU A;  3BDC A;  1SBB B;  2EJM A;  1F2Z A;  4FP5 D;  1ESR A;  1EQR A;  3K5O A;  4X3S A;  2HDM A;  3M7N A;  3UE1 A;  5IYD G;  4V0B A;  3VR4 A;  2H1E A;  2AWO A;  2JA5 B;  1QWY A;  1SYF A;  4JI8 L;  1M90 C;  1V1O A;  2EYH A;  2VUM G;  1XPU A;  2E2J B;  1SLJ A;  1SJH D;  4OX9 L;  1PTO D;  5IT9 L;  1XTC D;  2P5Z X;  4CKE A;  4OEM B;  2UU9 Q;  4TSS A;  1C48 A;  3FDT A;  1PTO H;  2K32 A;  3K5L A;  2Y0S B;  1KIX A;  4QUC A;  2NWG A;  1QZH A;  4A3F G;  4BBR B;  2OEO A;  3CU7 A;  1I4X A;  2QCP X;  2AHO B;  3S9W A;  2VZA A;  3GV3 A;  3OPO A;  1B50 A;  2RDG A;  4KN7 C;  1I6H H;  3MAQ A;  1EIG A;  4BA1 I;  1QVF A;  1HXY D;  2Z6K C;  3A5U A;  3PIP 3;  1N36 Q;  1EQV A;  2RSO A;  5LL6 S;  1N32 L;  4XQQ A;  2ZTE A;  3BYT B;  1UAP A;  4PMB A;  2O5I C;  4U68 A;  4ME3 A;  2F1M A;  4DA2 A;  3UI2 A;  2ZJR A;  3UE0 A;  3CME A;  3RZO H;  4K0K Q;  2EYP A;  5C4Z A;  2R7Z B;  4UP7 A;  5D3D A;  1SAP A;  1Q86 C;  2IWH A;  2AUK A;  4KI0 A;  3CP0 A;  1L1O B;  1PZK D;  3KF8 B;  5EGT A;  2JEB I;  4BY7 H;  3HS0 C;  2CH4 A;  3K0Y A;  2PNR C;  1K3B C;  1G91 A;  4GNX A;  3PUX A;  5C44 H;  1X32 A;  2PZW A;  2R93 B;  2F0Q A;  1TXY A;  4UP8 A;  3TME A;  3K59 A;  5E3F A;  4Y52 H;  1G51 A;  5KRU A;  4BXX G;  3TDQ A;  2JYO A;  2OWO A;  4DAV A;  4QQB X;  2K5V A;  3PMF A;  2M00 A;  1YIT A;  4NDX A;  1HTP A;  5LMN W;  1Y1W G;  4IUT A;  2NBF A;  1JJ2 A;  4DV0 L;  1XMQ L;  4DV5 L;  1TWA H;  1B2T A;  2NUC A;  2E8G A;  4OHJ A;  3S17 H;  3PIO 3;  1DOK A;  2CQA A;  5IYC H;  2L5T A;  2WAC A;  1I3Q H;  4AIM A;  3MA2 B;  5DM6 3;  4N9P A;  3FKI H;  3QR8 A;  1EYC A;  2F52 A;  2TMP A;  2PW7 A;  2N8N A;  2JN4 A;  2MP1 A;  5IIF A;  1C7Y A;  3M3Y B;  3PO2 B;  3MXP A;  4A3D H;  3G4S A;  1PH1 A;  1BO0 A;  1U4L A;  4HJ9 A;  4OIJ A;  4GN5 A;  4J6H A;  2CWA A;  2EYF A;  4C2M H;  1G6P A;  5M5Y B;  2XRS D;  5J39 A;  4QIW B;  1S40 A;  2IY5 B;  4CDD C;  4L6T B;  3VYT A;  2L55 A;  2B39 A;  4B3M Q;  4GKJ Q;  1FNU A;  1EQT A;  3MFG A;  4LUV A;  3PO3 G;  4AQY L;  1PHJ A;  1AW7 A;  1I4Q A;  1EWI A;  2A74 C;  1BKB A;  3ITP A;  1UUP A;  1MIU A;  1J6Q A;  2HD3 A;  4KHV A;  2PQE A;  3L7Z C;  4LF9 L;  3M9B A;  2R7D A;  1G29 1;  1VQK A;  1K8G A;  3I4N B;  1CT1 D;  4OL7 A;  2LY7 A;  4Y7N B;  2N55 A;  4J15 A;  2RCN A;  5IT9 E;  1KRS A;  4GN3 B;  5IWA L;  3J7Y W;  1IYV A;  2HIV A;  1XX8 A;  2D0P A;  4X64 L;  1SR3 A;  1KTK A;  2VQE Q;  4LF4 Q;  4A3K G;  4RGM A;  4JI0 Q;  2VXW A;  2NTT A;  1EU3 A;  5D3I B;  5EBC A;  4JV5 Q;  3RR5 A;  4DV2 L;  3F2U A;  2CQO A;  1K0S A;  3H3V I;  4XXE A;  3KFU A;  2Q2H A;  5LL6 X;  2FMC A;  3RD4 A;  2G5D A;  5JVH 3;  3C46 A;  4KTA A;  1R4P B;  1JR0 D;  3DM1 A;  2XRQ D;  1C9O A;  1Q81 C;  2EYM A;  5CV4 A;  4JI8 Q;  4GNX C;  1EY7 A;  5JJZ A;  4ZUI A;  4FXD A;  1HFN A;  3ER0 A;  1E2W A;  1LTG D;  1KD1 C;  3D31 A;  2VNU D;  4OX9 Q;  1SMY D;  3OHX C;  2RHS B;  4AH6 A;  4H7B A;  1HQM C;  1M4V A;  3T56 B;  4DK3 C;  4HID A;  4OO1 H;  3NEN A;  1XWE A;  3S1M B;  2F0H A;  3GTJ H;  3D3R A;  1TWF H;  1AH9 A;  2K33 A;  2A6H D;  4DAM A;  1BCP C;  4A3L H;  2CH4 W;  1EY8 A;  3SVM A;  1I94 L;  4FF2 A;  3N52 A;  4RH6 A;  1E1O A;  1IZ6 A;  1SJE D;  3E0J A;  3DWA A;  3BZC A;  1LT5 D;  1VQ6 A;  1PMR A;  3G48 A;  3HOV H;  3I4L A;  4ABN A;  3H0G G;  1LM0 A;  1YEZ A;  3E6Z X;  2F0G A;  1G6Z A;  2ICE C;  1N32 Q;  3HP3 A;  2R61 A;  1STE A;  2KHJ A;  3VA7 A;  2ASB A;  1F9R A;  5CC4 A;  3C1E A;  2MO1 A;  1CHP D;  2IPK D;  4CDF C;  3AMU A;  2KCT A;  1VQL A;  2SNM A;  4G7Z C;  4G4K A;  1Y1V G;  3GTG H;  3BDO A;  4A3B H;  1E24 A;  1STB A;  4LFC Q;  3NK9 A;  2NVT H;  5FLX c;  2F03 A;  3M4Q A;  1VQB A;  1YVC A;  1L0Y B;  2F0E A;  2RF4 A;  4KKU A;  1D5X C;  1O7L A;  4L8J A;  2ALY B;  3HOU H;  1PDQ A;  4MHE A;  2NZH A;  2VUM H;  4R4C A;  1KAW A;  1EL0 A;  1JWM D;  3Q8D A;  3AFP A;  4P73 A;  5BN3 A;  3NTK A;  3J81 L;  1HH2 P;  4DGZ A;  2A73 B;  2UUC L;  4HCE A;  2XIW A;  1X3P A;  2K04 A;  5AJ3 L;  1I5F A;  3HKZ E;  4F88 A;  5I9P A;  3A74 A;  1CQF A;  4DV0 Q;  4DV5 Q;  4A3F H;  1XMQ Q;  1Y1W B;  2WB1 G;  3QB3 A;  2SDF A;  4L5Q A;  1SYB A;  3CC2 A;  1EZ8 A;  4KHZ A;  4ME5 A;  1VQM A;  3I56 A;  2IX3 A;  1SYC A;  5GRO A;  2LMC B;  2KVM A;  5E7N A;  2KCM A;  1X3E A;  1VQ4 A;  3I2Z A;  2Q2T A;  4A3G G;  1BDO A;  3KBG A;  4FXK C;  2QA4 A;  5K36 G;  2UXD L;  4CKB A;  3ZYY X;  2C35 B;  3I70 A;  5EJW A;  3B6Y A;  1A3V A;  1BUV T;  3K7A B;  1PH8 A;  5IP7 H;  2K5H A;  5IGF A;  4AQY Q;  3HOZ H;  4C3I B;  1EEF D;  1GM5 A;  1QCB D;  1HCZ A;  4LFB L;  2IJ0 A;  4K14 A;  4CJ2 C;  1E1T A;  4BBS G;  4LF9 Q;  4UAI A;  3WOF A;  1NAP A;  2A68 D;  4MTN A;  2FMM A;  1O7Y A;  1DM0 B;  4P74 A;  4RFB A;  1GOZ A;  5IWA Q;  1PH7 A;  4IFD H;  2F0I A;  4X3U A;  5M3F G;  4X64 Q;  5G3L F;  3SEB A;  3MTS A;  1P16 A;  4DV2 Q;  3H09 A;  2PI2 E;  4B9W A;  1R9T B;  4A3K B;  2B2T A;  1S3O A;  5FO8 B;  1STG A;  4C3J G;  1TWC B;  2OQK A;  4LF6 L;  2KEN A;  1PH4 A;  4P71 A;  1Q12 A;  4PZ7 A;  5CMD A;  4AYB E;  2Q8T A;  1IBL L;  3OYY A;  3FRP B;  2BH2 A;  2K28 A;  2GVA A;  3GTQ B;  3S2D B;  1JE4 A;  2QIL A;  2PO4 A;  2M2L A;  3NQI A;  1CKN B;  3KF6 B;  5KYI A;  3KDF B;  1IW7 D;  2B29 A;  3RZD B;  4DU9 A;  4G7O C;  1C0A A;  1I50 B;  2MHV A;  3PO3 H;  1BNZ A;  2CCZ A;  3NBH B;  5C3W A;  2OTL A;  2D5D A;  1I94 Q;  3I4M G;  3CMA A;  1H95 A;  3KBX A;  1GUO A;  2R92 G;  3CCR A;  2HIX A;  3J81 c;  1E2V A;  4YHH L;  4A3I H;  1K83 B;  5E1F A;  5IGB A;  3GO5 A;  4JI7 L;  1W6K A;  2LXJ A;  2JA6 B;  2F3I A;  2MQH A;  5HY6 A;  4XYO A;  2K5N A;  1TWH H;  4JPB W;  4MZ9 A;  5IOC A;  2QGQ A;  1HNW L;  2E2I H;  4C1N K;  1D2B A;  3PGZ A;  5I9O A;  3HKS A;  2CW0 C;  5ISR A;  1HUM A;  1CZW A;  1SEB D;  2ZTD A;  3SXH A;  1STH A;  3NEL A;  4CDE C;  5JEA H;  2B2U A;  2L0C A;  3GV6 A;  2YV5 A;  2K52 A;  3NHH A;  2OT2 A;  3GDE A;  3KK7 A;  2Y0S G;  1F2Y A;  3HKZ B;  1DON A;  3L0O A;  4BBR G;  3SDZ A;  2I5M X;  1Q8I A;  1PA6 A;  2HHH L;  3OWE B;  5M5X H;  2UUC Q;  1XNQ L;  1LLR D;  4NPS A;  4QUF A;  5AJ3 Q;  3GTL B;  1GJX A;  1EY9 A;  3C1F A;  1KXL A;  2A6H C;  4EQ5 A;  1DOL A;  2Y0S E;  1I4H A;  3CF5 A;  4ULL A;  3PSI A;  4DUZ L;  3S1N B;  3V2T A;  2B63 B;  4A93 H;  4IUV A;  4CBV A;  2B2T C;  3H0G H;  4A3C G;  3PQI A;  3T13 A;  3PUV A;  4O0A A;  4JI1 L;  2R7Z G;  1EZ6 A;  2RVL A;  4DAP A;  5ELN A;  2RQX A;  1LTI D;  1J8I A;  2I0Q A;  2VL6 A;  4PMW A;  2SEB D;  2K75 A;  1BR9 A;  3ONA B;  1Y1V H;  2UUB L;  1BBX C;  5EPK A;  2UXD Q;  3I8Z A;  3AYH B;  1SFO H;  3R8B A;  1RDP D;  1I4P A;  2HQL A;  2K5W A;  2E2H B;  1EOV A;  2ZXR A;  2GN5 A;  1LT4 D;  2EE1 A;  3GTM H;  3QJY A;  2XTI A;  1Q7Y C;  4NXM L;  3AQQ A;  3HRZ C;  4QY7 A;  2UXC L;  4RAU C;  2JJQ A;  1B3Q A;  2NZ1 D;  4BWG B;  4LFB Q;  1QB5 D;  4FF1 A;  4FVM A;  2OQ0 A;  2A6E C;  4C56 C;  2F4V L;  5CV5 A;  2C5C A;  4QMG A;  5BR8 L;  2Z4H A;  1WTX A;  2KCN A;  3CCL A;  4BBS B;  4DR1 L;  2Q8R E;  3SK6 A;  4OIK A;  3NPP A;  3EN2 A;  2KEC A;  1YNX A;  5I4D A;  1XTD A;  4IPG A;  4KMU C;  1TT2 A;  2A5H A;  3EQL C;  4IN3 A;  4JK1 C;  4FF4 A;  2IHF A;  1EIH A;  3PF4 A;  1TVX A;  2PZU A; 
#chains in the Genus database with same CATH homology
 3M4P A;  3CCJ A;  4GNX A;  4A3E G;  3PUX A;  2OCE A;  5C44 H;  1PH6 A;  1B8A A;  1N9W A;  1EYG A;  1SRO A;  3HOX H;  5IP9 H;  2A8V A;  4EX5 A;  1TXY A;  4UP8 A;  1RL2 A;  1VQ9 A;  4LF6 Q;  2EIF A;  3CCM A;  3J7A 5;  1YBY A;  4B3R L;  2VS1 A;  4Y52 H;  4YCV A;  3CQZ H;  1G51 A;  4BXX G;  1YJW A;  1AE2 A;  1VQI A;  4L5R C;  4DPG A;  3J7Z C;  1EUJ A;  2OWO A;  2RHQ B;  4IPD A;  1IBL Q;  2JA9 A;  2K5V A;  3STB D;  4DUY L;  1YIT A;  3H15 A;  1W2B A;  4A3G H;  1PVO A;  3K8A A;  3PUZ A;  5LMN W;  1Y1W G;  2Q2I A;  4DV1 L;  1JJ2 A;  4DV0 L;  1XMQ L;  3PCO B;  3CCS A;  1TWA H;  4DV5 L;  3RLO A;  3ULP A;  1EIY B;  3S1M H;  4DR6 L;  4LFA Q;  2E8G A;  3G71 A;  4A3K H;  1XPO A;  3S17 H;  5IYC H;  1CKO A;  1I3Q H;  4AIM A;  1V43 A;  3PF5 A;  1TWC H;  1JB7 A;  3FKI H;  4H02 A;  2F52 A;  2N8N A;  2YTV A;  1C7Y A;  4IO9 A;  1QUQ B;  1CKN A;  3I4N G;  4DR5 Q;  3HOW H;  1Q1E A;  4A3D H;  1ASZ A;  3G4S A;  1VQO A;  1PH1 A;  2ZJQ A;  4YWL A;  3S2H H;  1SRU A;  2NN6 G;  3CCV A;  1RIP A;  4HJ9 A;  1VQP A;  4GN5 A;  3GTQ H;  5JEA J;  4DR2 L;  3S2D H;  2CWA A;  1VQC A;  4C2M H;  1G6P A;  3J80 c;  4YHH Q;  3ULJ A;  2ZM6 Q;  5GAE C;  3UDX A;  3CPF A;  3AFQ A;  3RZD H;  1S40 A;  2IY5 B;  2PQA A;  3S24 A;  4UP9 A;  5M3F H;  4HIK A;  4P72 A;  4JI7 Q;  1I50 H;  3TRZ A;  4WJ4 A;  5FLM G;  1QVC A;  2JEA I;  2R6G A;  1X6O A;  2FXQ A;  5J3B A;  1QZG A;  2AWN A;  4B3M Q;  1PYB A;  4JYA Q;  4GKJ Q;  4JBW A;  4JI3 Q;  3K0X A;  4LUV A;  4MNO A;  1S72 A;  3PO3 G;  5C44 G;  4AQY L;  1SMX A;  1PHJ A;  4JI5 Q;  1HNW Q;  5IP9 G;  4C3J H;  4X65 L;  1EWI A;  4L5T A;  1BKB A;  4IPC A;  4YY3 Q;  1MIU A;  1J6Q A;  3L7Z C;  4LF9 L;  1K83 H;  3M9B A;  2R7D A;  1G29 1;  4UPA A;  2WB1 E;  4A4I A;  1K8G A;  2NZO A;  1SN8 A;  4FDB A;  1VQK A;  1OXT A;  4JI2 Q;  3TQY A;  3S15 H;  2JA6 H;  4J15 A;  2RCN A;  3CCE A;  3T1Y Q;  3JAM c;  1N33 L;  1CKM A;  1FGU A;  1KRS A;  3F8T A;  3KYH C;  4GN3 B;  3RLN A;  5IWA L;  4OX9 Q;  4OO1 I;  2HIV A;  1NBW A;  2D0P A;  2YYZ A;  1KRT A;  1SR3 A;  4X64 L;  2NVY H;  1YZ6 A;  4QGU A;  4JBM A;  1UE7 A;  2VQE Q;  4LF4 Q;  4A3K G;  5C3E G;  4JI0 Q;  2E5L Q;  1FJG Q;  2NVQ H;  1M1K C;  1WYD A;  3CPW A;  4JV5 Q;  1VQD A;  3RR5 A;  4DV2 L;  2CQO A;  2HHH Q;  3H3V I;  3FKI G;  1XNQ Q;  3KFU A;  3J81 i;  3K7U C;  3G6E A;  5EAY A;  1OXV A;  4DV7 L;  1Z9F A;  2Q2H A;  1K8A C;  1K3R A;  1DGS A;  1IBM Q;  1HR0 W;  2ZTC A;  1YI2 A;  1A63 A;  4LF8 Q;  1GKH A;  3E9I A;  2CKZ B;  4P75 A;  1IXR A;  2R7F A;  1CUK A;  1VQA A;  4YWM A;  4DUZ Q;  4JI4 L;  3I4M H;  3CD6 A;  1MKH A;  1C9O A;  1Q81 C;  4JBK A;  2R92 H;  4JI8 Q;  3PIP A;  4GNX C;  2UXB L;  3OTO L;  1L2F A;  1BBW A;  3ER0 A;  1KC8 C;  1NTG A;  1KD1 C;  3D31 A;  4A76 A;  4KHP L;  2K14 A;  4JCV E;  1MJE A;  2VNU D;  2VW9 A;  5LMU Q;  4OWT B;  3W5O A;  4DV6 L;  4JI1 Q;  1X55 A;  2Q2U A;  1EIF A;  1XMO L;  2WAQ G;  5ELO A;  4IOC A;  3S1R H;  1XJV A;  1IL2 A;  2RHS B;  4GNX B;  4AH6 A;  4DK3 C;  4HID A;  3HOY G;  1NE3 A;  1GD7 A;  3E9H A;  3NEN A;  1UEB A;  2BH8 A;  4DV3 Q;  3GTJ H;  4LFC L;  1TWF H;  1XNR L;  1AH9 A;  2UUB Q;  4NB3 A;  4DAM A;  2JA5 H;  2B63 H;  4A3L H;  1L0W A;  2HT1 A;  1VQ7 A;  1I94 L;  3KJP A;  2UUA Q;  1E1O A;  3S16 H;  5GQO A;  1IZ6 A;  4LWC A;  2E2J H;  4OWX B;  5C4X G;  3KLW A;  1VCI A;  2ZJP A;  3BZC A;  1KQS A;  1VQ6 A;  3G48 A;  3HOV H;  4NXM Q;  4POG A;  3H0G G;  1LM0 A;  1YJN A;  1YEZ A;  3CXC A;  3RNU A;  1IBK L;  2UXC Q;  1VQG A;  1A0I A;  2IHE A;  4JOI A;  2PNH A;  5LMN L;  1N32 Q;  2IT1 A;  1PYS B;  2KHJ A;  1B7Y B;  5C0X J;  2ASB A;  4DR4 L;  4X66 L;  1Q8K A;  4LNQ A;  5DLQ E;  3BJU A;  2MO1 A;  3T1H L;  2F4V Q;  4DR7 L;  1JT8 A;  1E3P A;  4BBR H;  1VQH A;  4A3M H;  2KCT A;  2YTY A;  4GN4 B;  5BR8 Q;  1VQ5 A;  3ZJY C;  1SE8 A;  1VQL A;  3RN5 A;  3BU2 A;  1Y1V G;  3GTG H;  2E2H H;  1BVS A;  2D0O A;  3RLF A;  4A3B H;  4C3H H;  4DR1 Q;  1E24 A;  3KOJ A;  4LFC Q;  1R9T H;  2NVT H;  3PIO A;  3IRB A;  3GTP H;  1KL9 A;  5IYB H;  5FLX c;  4A3J H;  4IJH A;  4POF A;  4HJA A;  4GKK Q;  3M4Q A;  1VQB A;  3EIV A;  1YVC A;  2RF4 A;  1XPR A;  1P8L A;  4QQB X;  2ES2 A;  1Q46 A;  3KF6 A;  2DGY A;  2ALY B;  2Z0S A;  2PQA B;  5FJ8 G;  3KDF A;  3CCU A;  3HOU H;  2NZH A;  2VUM H;  4R4C A;  4A3C H;  1X56 A;  1KAW A;  1HNX L;  4DAY B;  4NXN L;  4X6A H;  3ULL A;  4BBS H;  3Q8D A;  2K4K A;  4B3R Q;  3W1B A;  2AMC B;  2PMZ E;  3AFP A;  4P73 A;  5HGQ A;  5JJL A;  1VQF A;  1HH2 P;  3FHW A;  4YCW A;  1J5E L;  4PZ8 A;  2UUC L;  4OO1 G;  4JBJ A;  4DUY Q;  4GLA C;  4R4I A;  4JI6 L;  5AJ3 L;  1I5F A;  4LW1 A;  3HKZ E;  4DV1 Q;  1MJC A;  3A74 A;  3PUW A;  4PZ6 A;  4DV0 Q;  4DV5 Q;  4A3F H;  1XMQ Q;  2JA5 G;  4A3L G;  1WCM H;  4DR6 Q;  1YHQ A;  4JG2 A;  1JMC A;  3RN2 A;  4UY8 C;  2IX1 A;  2JA7 H;  2JA8 H;  4IOA A;  4BY7 G;  1YHA A;  2WB1 G;  4JC0 A;  1GVP A;  3F2B A;  2R93 H;  4O2D A;  3U58 A;  2BA1 A;  1X3F A;  1PFS A;  3HOV G;  1WFQ A;  2CFM A;  4L5Q A;  3HOX G;  4YWK A;  1LTL A;  4LF7 L;  3CC2 A;  1N8R C;  5JJI A;  4KHZ A;  1PH5 A;  1HNZ L;  4OON A;  4WJ3 M;  1VQM A;  5C0X G;  3I56 A;  5GAH C;  4GOP A;  4TVA B;  2K50 A;  5GRO A;  3TRE A;  1QUQ A;  5E7N A;  3SGI A;  2KCM A;  1X3E A;  5IT9 c;  4HJ7 A;  1VQ4 A;  1HZ9 A;  2UU9 L;  4IFD I;  3U4Z A;  3F2C A;  3CCQ A;  1VQN A;  3I2Z A;  3VDY A;  2Q2T A;  1BBU A;  5M3M H;  4A3G G;  4DR2 Q;  1A8V A;  3JC6 6;  2QA4 A;  5K36 G;  2UXD L;  4A3B G;  2C35 B;  1YHB A;  2LXK A;  1OXS C;  1VQE A;  3OW2 A;  2OTJ A;  5IYC G;  1HR0 L;  5IYB G;  3GTO H;  4B3S L;  5IY0 A;  5M5W H;  2ATW A;  1UWV A;  2JQO A;  4BY1 H;  3B6Y A;  1NJI C;  3M3Y H;  2XGT A;  3GD7 A;  1PH8 A;  3PO2 H;  2WFW A;  1N36 L;  5IP7 H;  2KBN A;  2K5H A;  1KHI A;  4AQY Q;  3HOU G;  2NN6 I;  3M85 A;  1GO3 E;  4X62 L;  3HOZ H;  1GM5 A;  3HOW G;  1LYL A;  4X65 Q;  1D8L A;  4TQU S;  4LFB L;  4A3D G;  1E1T A;  1WOC A;  3CAM A;  5M5Y H;  4BBS G;  2A1A A;  1D7Q A;  4B3T L;  4LF5 L;  4LF9 Q;  3I4O A;  4K0K L;  2DUD A;  1VS0 A;  4MTN A;  2VQF L;  4DKA C;  4P74 A;  3DLL A;  1V9P A;  2GVB A;  2VY3 A;  4JOI C;  3K81 C;  1JE5 A;  1N33 Q;  5IWA Q;  1NMF A;  3STB C;  1PH7 A;  4L5S A;  3L2P A;  4IFD J;  5M3F G;  4X64 Q;  1X54 A;  2JA8 G;  4DV4 L;  3GTL H;  3WWV A;  1HZA A;  2JE6 I;  2ID0 A;  2MO0 A;  1PH3 A;  2YTX A;  2R93 G;  1P16 A;  4DV2 Q;  2B3G A;  1ASY A;  2PI2 E;  5GAD C;  3D0F A;  1TWG H;  4HIM A;  3S1N H;  1S3O A;  3J80 i;  4DR3 L;  4DV7 Q;  3UDI A;  2OQK A;  3I4N H;  4LF6 L;  2KEN A;  4LUO A;  1PH4 A;  4P71 A;  1Q12 A;  4HIO A;  4PZ7 A;  4JI4 Q;  4AYB E;  1IBL L;  4B3T Q;  5M3M G;  2UXB Q;  2JA6 G;  1U5K A;  1WJJ A;  3OTO Q;  3OYY A;  4ALP A;  2LSS A;  1N34 L;  5IE8 A;  2A19 A;  2BH2 A;  2IX0 A;  4KHP Q;  3U50 C;  2GVA A;  2BA0 A;  4DV6 Q;  1XMO Q;  1V1Q A;  3KJO A;  1T9H A;  1UE6 A;  3GTK H;  1K0R A;  5FLM H;  1CKN B;  1B70 B;  1Z47 A;  3KF6 B;  3W1G A;  1AE3 A;  4OWW B;  3A0J A;  3KDF B;  2B29 A;  1Q1B A;  3NEM A;  1VQJ A;  4KLK A;  1C0A A;  2Z6K A;  1YIJ A;  4A75 A;  3A5Z B;  3PO2 G;  1A62 A;  1XNR Q;  3PO3 H;  5IP7 G;  1JJG A;  1WI5 A;  3JAM i;  2CCZ A;  3NBH B;  1OTC A;  3HOZ G;  1E7Z A;  4DR5 L;  4DR3 Q;  2JK8 A;  3K80 C;  2OTL A;  3DM3 A;  4GLV B;  1I94 Q;  3I4M G;  5IYD H;  3TS0 A;  2PI2 A;  3CMA A;  1X9N A;  1H95 A;  1HJP A;  1L1O A;  4RMF A;  2R92 G;  1QVG A;  4IJL A;  3UDG A;  4IPH A;  3CCR A;  2HIX A;  1K9M C;  3J81 c;  3HKZ G;  4YHH L;  3I7F A;  2ZM6 L;  4A3I H;  1IBK Q;  1NY4 A;  3CC4 A;  5LMN Q;  1FVI A;  2R7Z H;  3GO5 A;  4IFD G;  1E22 A;  2V1C C;  4GOP C;  4GLX A;  4GS3 A;  1N34 Q;  4JI7 L;  2AKW B;  4X66 Q;  2LXJ A;  4DR4 Q;  2L15 A;  2EXD A;  2F3I A;  4LUZ A;  5C3E H;  2MQH A;  5HY6 A;  3U4V A;  3T1H Q;  1PH9 A;  4B3M L;  4DR7 Q;  4JYA L;  4GKJ L;  2K5N A;  2I5H A;  4QIW E;  1OXU A;  1TWH H;  2D62 A;  4MZ9 A;  4JI3 L;  3F2D A;  1CSQ A;  2KHI A;  4GOP B;  2QGQ A;  4JI5 L;  3J81 j;  2B63 G;  3S14 H;  1OXX K;  1PV4 A;  2E2I H;  1HNW L;  2CWP A;  2N78 A;  4YY3 L;  4PG3 A;  3PV0 A;  3CC7 A;  3MEF A;  1X3G A;  1VQ8 A;  3PGZ A;  2YU9 H;  5C4J H;  3HKS A;  3TS2 A;  3BZK A;  1PH2 A;  4JI2 L;  2ZTD A;  3NEL A;  4QJF A;  3T1Y L;  2YV5 A;  1EFW A;  2K52 A;  1HNX Q;  3GDE A;  2Y0S G;  2VQE L;  4LF4 L;  4NXN Q;  2EQS A;  4JI0 L;  2E5L L;  1FJG L;  4BA2 I;  1JJC B;  3L0O A;  4BBR G;  4JV5 L;  4A3M G;  2I5M X;  3HOY H;  1J5E Q;  5GAG C;  1PA6 A;  2HHH L;  5M5X H;  2UUC Q;  1XNQ L;  1YJ9 A;  4DK6 C;  3M4O H;  2MNA A;  4JI6 Q;  4NPS A;  5AJ3 Q;  1IBM L;  3LGJ A;  3S1Q H;  1UE1 A;  1KXL A;  2NVX H;  1EQQ A;  1EQR A;  4A3J G;  4EQ5 A;  4LF8 L;  2Y0S E;  3CF5 A;  3M7N A;  1U0L A;  1Y14 B;  3PSI A;  3UE1 A;  5IYD G;  3UDF A;  4DUZ L;  2AWO A;  5C4X H;  4A93 H;  4JI8 L;  4A3E H;  4HJ8 A;  3ICE A;  1M90 C;  3EBE A;  3H0G H;  4LF7 Q;  1XPU A;  2VUM G;  4A3C G;  4A3I G;  4XTC S;  1SLJ A;  3TEH B;  1NMG A;  1W3S A;  1HZC A;  5LMU L;  1HNZ Q;  3PUV A;  2I5L X;  4O0A A;  4JI1 L;  4HJ5 A;  1Q82 C;  4OX9 L;  2R7Z G;  4OXP A;  5ELN A;  4BXX H;  1LUZ A;  2UU9 Q;  2WP8 J;  2I0Q A;  4RG1 A;  2VL6 A;  3I55 A;  4PMW A;  4DV3 L;  2K75 A;  3HFZ B;  4QL5 A;  1KIX A;  1Y1W H;  1Y1V H;  4R1J A;  2UUB L;  1O7I A;  2UXD Q;  1QZH A;  4A3F G;  3AYH B;  3AEV A;  1WCM G;  4R4T A;  2JA7 G;  1SFO H;  2UUA L;  1HR0 Q;  2HQL A;  4AYB G;  2AHO B;  1EOV A;  2MFI A;  3CW2 C;  3PUY A;  2GN5 A;  4B3S Q;  2VZA A;  2QEX A;  4R4Q A;  3GTM H;  3ERS X;  1I6H H;  2XTI A;  5C0X I;  4BA1 I;  1Q7Y C;  4NXM L;  1QVF A;  2Z6K C;  3AQQ A;  3A5U A;  2N3S A;  4QY7 A;  2H5X A;  1N36 Q;  2UXC L;  5JEA G;  2JJQ A;  5FJ8 H;  1N32 L;  3F1Z A;  4X62 Q;  1K73 C;  4Y7N H;  2ZTE A;  4R4O A;  4LFB Q;  1FL0 A;  2N49 A;  4ME3 A;  5JJK A;  1IYJ B;  2OQ0 A;  1L1O C;  2F4V L;  1HZB A;  4LF5 Q;  2ZJR A;  3UE0 A;  3E0E A;  5BR8 L;  3CME A;  3RZO H;  4K0K Q;  1UE5 A;  4APV A;  2VQF Q;  3CCL A;  4UP7 A;  4XIG S;  4DR1 L;  1Q86 C;  4YCU A;  4KI0 A;  4LFA L;  3CP0 A;  3EN2 A;  5H1S E;  1YNX A;  1L1O B;  1XTD A;  3FP9 A;  3K7A H;  3KF8 B;  3MXN B;  4IPG A;  4DV4 Q;  1X65 A;  2JEB I;  4GKK L;  4DNI A;  4BY7 H;  2IHF A;  2WAQ E;  1CSP A;  4BY1 G;  3H3V H;  4C3I H;  3PF4 A;  4A93 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...