2KHJA

Nmr structure of the domain 6 of the e. coli ribosomal protein s1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
89
structure length
89
Chain Sequence
MFNNWVALNKKGAIVTGKVTAVDAKGATVELADGVEGYLRASEASRDRVEDATLVLSVGDEVEAKFTGVDRKNRAISLSVRAKDEADEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 30S ribosomal protein S1
publication title Probing the relationship between Gram-negative and Gram-positive S1 proteins by sequence analysis
pubmed doi rcsb
source organism Escherichia coli
total genus 9
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2khjA00
1KAWA 3U4VA 1VQGA 3HOUG 3I4NH 4P71A 1VQ5A 3HOZH 4B3SQ 3RLOA 4NXML 2NZHA 3PO2G 2OWOA 4JC0A 3RN5A 3B6YA 2BA1A 1FVIA 3PSIA 4HIMA 3RLFA 5K36G 2JEBI 2JA8G 2VZAA 1W2BA 2JA5G 4GLVB 4KI0A 3S1NH 1CKNA 3CW2C 5FJ8H 3A5UA 2RHQB 3J80i 1SFOH 2JA6H 2UXBL 1BVSA 1GKHA 5C4XG 3S17H 4A3JH 1K8AC 5AJ3L 1PH2A 4B3TQ 4IFDI 4DV3L 3OW2A 1L0WA 4JI8L 1N8RC 4LWCA 5BR8L 3S1RH 2EIFA 3UDXA 2K52A 3TRZA 1VQHA 3BU2A 1IBML 4JBMA 1GM5A 4L5RC 1SRUA 3RLNA 1FJGL 1YHQA 1Z9FA 3CCVA 4Y52H 5HY6A 4KLKA 1JMCA 4JI1Q 4DNIA 1D8LA 2CCZA 2IT1A 3RNUA 2CKZB 4AQYQ 4PZ8A 2Q2UA 2D0PA 5IP9G 1CKMA 2OQKA 1VQ7A 2WB1E 2E5LQ 1XMQL 4DPGA 1L1OA 1I6HH 1D7QA 1QUQA 1XJVA 1TWCH 1KRSA 4C3IH 5HGQA 3CF5A 3KYHC 3KDFA 3HFZB 4DUYL 4C2MH 4DV6L 4RMFA 2UUCL 4NXNL 2AWNA 4ME3A 1IBKL 4A3BG 3G48A 5M5WH 1Q82C 3F2CA 1EYGA 4B3RL 4NXMQ 3FKIG 4P72A 1S40A 4O0AA 2VQFQ 1CKOA 4DAMA 2YTXA 3CAMA 3BZCA 3K7AH 3M4PA 2WFWA 2VNUD 3UDFA 3T1HL 1I50H 4OWTB 1PYBA 5ELNA 4YWKA 4A4IA 4HJ5A 4OWWB 4A3LH 1NMFA 4LFAL 2HIXA 2ATWA 1CUKA 2PNHA 2MO0A 3CCJA 2JEAI 2OCEA 1A0IA 1CSQA 4UY8C 4DR4L 5AJ3Q 3TS0A 4X62L 3G4SA 3HOZG 1VQNA 3VDYA 3KJPA 3CD6A 2K4KA 1E1OA 1N9WA 1P16A 1E1TA 4JI8Q 1X3EA 5BR8Q 1VQPA 3M9BA 2L15A 1PH7A 4OONA 5C0XJ 3TS2A 2AHOB 2KHJA 5EAYA 2N8NA 5C44H 3CCQA 5LMNL 1VQEA 1FJGQ 5M5YH 1LTLA 4C3HH 1YJNA 4JI0L 4BY7G 1Z47A 4JOIC 1KQSA 4GKJL 2K5NA 4JI4Q 4LF9L 3H3VH 2ZJQA 3FP9A 1I94L 4JI6Q 3PO2H 2EQSA 4IFDG 1HNWL 1YIJA 1YI2A 1YJ9A 2K5HA 4IFDJ 1HR0L 3E9IA 3AFQA 4LFBL 1O7IA 1XNRL 1E24A 1N36Q 1KIXA 3HKZE 2R7FA 3HOWG 2JA5H 2OQ0A 3CC7A 3F2BA 1Y1WG 4A3DG 2Y0SG 1QVCA 4DUYQ 2PQAB 1I3QH 4DV6Q 1Y14B 1YHBA 5FLXc 2UUCQ 4NXNQ 2V1CC 1E7ZA 2VL6A 1IBKQ 2AKWB 2I5HA 4B3RQ 1Q86C 4A3KG 3SGIA 1YJWA 1NTGA 4GLXA 1K73C 1VQ8A 3AYHB 4LFCL 2LSSA 2PI2E 5GROA 3H15A 1EFWA 4JI7L 5IP7H 1K3RA 3T1HQ 2GVBA 1YEZA 1PH1A 1RIPA 1U0LA 2ZJRA 2IY5B 4LFAQ 1X56A 2NN6G 4QJFA 3HOVG 4DR4Q 4X62Q 5IP9H 4A3FH 2HHHL 4LF6L 3HOYH 2YV5A 4HJ9A 1XNQL 4X64L 4LF8L 1SE8A 1JT8A 4LUZA 1Q12A 2Z6KA 1NJIC 1N33Q 3DLLA 2YTYA 5LMNQ 5J3BA 2N3SA 4J15A 4XIGS 4JI0Q 1E22A 3L0OA 5IYDG 4POGA 4A3BH 4GKJQ 4LF9Q 3K80C 3CCRA 4DV0L 4AQYL 2UXBQ 4GNXA 1I94Q 2AWOA 4DR1L 5IYCH 1GO3E 3AQQA 4DR5L 4YCVA 1HJPA 4DR6Q 4LFBQ 4X6AH 1XPOA 1XNRQ 3M85A 1PA6A 4KHPL 2NZOA 2UXCL 1OXXK 5C44G 4BY1H 3I4OA 4LF7L 3RZDH 1VQOA 1EQQA 3GTQH 1Q8KA 5IT9c 2IHFA 1YHAA 2WB1G 3UE0A 3NELA 3MXNB 1DGSA 5IE8A 4PZ6A 2VQFL 1JB7A 4YY3Q 2VQEL 1HZBA 2MO1A 2NVQH 1X6OA 4JCVE 2HQLA 4O2DA 4L5SA 3J81i 4R4TA 4JG2A 4LFCQ 3WWVA 5C3EG 3J81j 1LM0A 4JI5L 1L1OC 3GTMH 4JI7Q 4BY7H 3STBD 4OO1G 2R93H 5C0XI 2VS1A 1KD1C 3I2ZA 1CKNB 2ASBA 4YCUA 2MQHA 1KXLA 3PUYA 1PH3A 1C9OA 4OX9L 2B3GA 4R4OA 2ZJPA 2HHHQ 4LF6Q 3GD7A 4GOPB 5GAHC 3HOWH 4LF5Q 1XNQQ 4DK6C 1HZCA 3NEMA 5M5XH 4X64Q 1HH2P 3CCLA 5IYBH 1NMGA 4LF8Q 3CMAA 3KFUA 3S1MH 1Y1WH 4A3DH 2WAQE 4BBSH 3E9HA 5IP7G 2R7DA 3KF6B 3PIOA 3S2DH 1E3PA 4JI4L 4JBKA 1UE5A 3UDGA 2ALYB 4JI6L 1VQFA 2B29A 1OXUA 3S2HH 4POFA 4DV0Q 4IPCA 5GAGC 1BKBA 4A3KH 4DR1Q 4A3FG 4GKKQ 4DR5Q 3PO3H 2OTJA 3HOYG 1N36L 2VY3A 4JI2L 3ERSX 3HKSA 1Y1VH 2BA0A 4KHPQ 1L1OB 1VQCA 1HNZQ 2UXCQ 4LF7Q 4P75A 1G6PA 4YHHQ 5C4JH 1C7YA 3J80c 1Q1BA 1Q7YC 1A8VA 2B63G 3HOVH 3GTPH 5JJLA 3HKZG 1WYDA 3H0GG 4IOAA 1T9HA 5IYCG 4UP7A 5ELOA 4DV7L 4GN3B 2VQEQ 1H95A 1NY4A 3GTLH 4PZ7A 3K0XA 4P74A 4JI5Q 1CSPA 4QGUA 2R92H 4BY1G 1LUZA 5IYDH 1AE2A 2OTLA 2JK8A 2E2JH 2JJQA 1EIFA 4ALPA 2RCNA 3PUXA 5E7NA 5FLMH 3I56A 5JEAG 3JC66 4NPSA 4OX9Q 3A5ZB 1SROA 4DK3C 3PF4A 4PMWA 2MNAA 2RF4A 3OTOL 4HIDA 1UE7A 3D31A 4QQBX 2GVAA 4BA1I 1J5EL 1X9NA 1N33L 1VQ6A 4BXXG 4DV2L 3KOJA 4TVAB 2R93G 4YWLA 2F4VL 1EUJA 1LYLA 3CCEA 2LXKA 1QVGA 1EWIA 3J7ZC 1G51A 2QGQA 1AH9A 1K9MC 2H5XA 4K0KL 3L7ZC 4A3EH 1PH5A 1EQRA 2R6GA 4NB3A 3W1BA 4LF4L 3J7A5 4DR6L 2E2IH 5C3EH 4JI2Q 1WJJA 2Q2IA 2Q2TA 1TWFH 3G71A 1S3OA 1VQBA 1VQ9A 5IYBG 2ZM6L 2Z6KC 1IXRA 3K8AA 3L2PA 4A3IH 3RN2A 4A3MH 4BBSG 2UXDL 4QL5A 1WCMG 3F1ZA 4IPHA 1VQ4A 2N78A 1JJ2A 5M3FG 3AEVA 1IL2A 2EXDA 1VQAA 2XGTA 3A0JA 3STBC 2F52A 4YY3L 3M4QA 4GNXC 1PH4A 4LNQA 1RL2A 4DV7Q 2UUAL 3S16H 2HT1A 5DLQE 3PO3G 1V1QA 4IOCA 4HJ7A 1TXYA 1Y1VG 3PUWA 3ICEA 3GO5A 3PUZA 2D0OA 4LW1A 4GS3A 1Q81C 1SLJA 3D0FA 4OXPA 3U58A 4B3ML 4A3CG 4A93G 3DM3A 5JJKA 4LF5L 3CCMA 4A76A 3OTOQ 1QVFA 2QEXA 4DV5L 1J5EQ 3KF8B 2ZTCA 4DV2Q 3K7UC 1PH6A 1OXSC 3ULLA 4L5TA 2R92G 3PIPA 4A3GG 1ASZA 2B63H 1XTDA 4R4CA 3U4ZA 4UPAA 4DKAC 4DUZL 2E2HH 2BH2A 2F4VQ 5LMUL 3H0GH 2WP8J 4K0KQ 1P8LA 4GNXB 5FLMG 4TQUS 2JA7G 4GKKL 2WAQG 2K75A 3NBHB 3CC4A 2NVTH 1JJCB 3IRBA 4LF4Q 2VUMG 3RZOH 1QZHA 1HNZL 4L5QA 4YHHL 2JE6I 3W1GA 2ZM6Q 4HJ8A 1C0AA 3PUVA 4IPDA 1UWVA 2YYZA 1KC8C 4BA2I 4LUVA 2UXDQ 1PHJA 1Q46A 4GN5A 3PGZA 3GTKH 3GTOH 3GTJH 3CMEA 1MJCA 1W3SA 3G6EA 4A3EG 3CC2A 1EOVA 3CQZH 3PV0A 4P73A 4KHZA 1MIUA 2XTIA 2UUAQ 1GVPA 4BXXH 1XPRA 1PVOA 1N32L 1K8GA 5GAEC 5M3MG 3HOXG 2F3IA 4JBJA 2YTVA 3CCUA 4A3IG 4A3MG 4PG3A 1FGUA 2CQOA 2DGYA 1ASYA 1OTCA 2I0QA 1KHIA 2FXQA 1N34Q 2R7ZG 3KJOA 4B3MQ 3JAMi 1V43A 3ULJA 4DR3L 2NVYH 3I4MH 4OWXB 1SMXA 3OYYA 4DV5Q 2KBNA 4AIMA 2ZTEA 1WCMH 2AMCB 4YWMA 1NE3A 2JA9A 1BBWA 1B7YB 4FDBA 5M3FH 4DUZQ 5LMUQ 4RG1A 4Y7NH 3CCSA 1PH9A 1YITA 4JV5L 3T1YL 5C0XG 3J81c 4R4QA 1QUQB 1IBLL 1TWAH 4GOPA 4GN4B 3KDFB 3TEHB 1A63A 1VQJA 4R1JA 4JI3L 3UDIA 4BBRG 4JYAL 1XMOL 4QIWE 1HNXL 3BJUA 4UP9A 1UE6A 4A3CH 5JJIA 4A93H 2QA4A 1AE3A 3F8TA 3GDEA 3KF6A 1WI5A 3A74A 3JAMc 2CFMA 1VQDA 4DR7L 1A62A 1IYJB 4AYBE 1X3FA 1MKHA 3ULPA 1VQKA 5GADC 4DV4L 4C3JH 1PH8A 4A3GH 4LUOA 1N32Q 1FL0A 2HIVA 5GQOA 2IX0A 3M4OH 2DUDA 4H02A 4APVA 1X3GA 1L2FA 4YCWA 4UP8A 2JA7H 1XPUA 3AFPA 1JJGA 2VUMH 2I5MX 1PYSB 1QZGA 2KCTA 2GN5A 3S15H 3NENA 4DR3Q 3ZJYC 5H1SE 4EQ5A 4MZ9A 3EBEA 1OXTA 2UU9L 3S1QH 2A19A 3EN2A 4GLAC 4X65L 2A8VA 2KENA 1SN8A 3ER0A 1G291 2CWPA 4AH6A 2Q2HA 3T1YQ 4JV5Q 3S14H 3HOXH 5M3MH 3PF5A 3I4NG 3I4MG 4DV3Q 3M7NA 1WFQA 1IBLQ 1J6QA 3S24A 1MJEA 3CP0A 4MNOA 1YBYA 2MFIA 1HZAA 3MEFA 3PCOB 5IWAL 1XMOQ 1IBMQ 4JI3Q 2R7ZH 1X55A 3TREA 3CXCA 1HNXQ 3W5OA 4DR7Q 1JE5A 2CWAA 3HOUH 5FJ8G 2UUBL 1PFSA 4DAYB 4DR2L 2JA6G 4JYAQ 4X66L 4IPGA 1K0RA 4A3JG 3CPFA 1M1KC 2K5VA 2LXJA 1TWHH 2NN6I 2RHSB 1M90C 1B8AA 4DV4Q 2NVXH 4HJAA 1OXVA 2JA8H 1S72A 3FHWA 1N34L 1XMQQ 4DV1L 2JQOA 5C4XH 1EIYB 2PQAA 3EIVA 5LMNW 2I5LX 1K83H 3Q8DA 4B3SL 4IJLA 4EX5A 3I7FA 3E0EA 5JEAJ 1VQLA 4WJ4A 1HZ9A 1UEBA 4IJHA 4BBRH 3RR5A 2PMZE 3UE1A 1KRTA 2E8GA 3U50C 1YNXA 1HR0W 4WJ3M 4QY7A 1YZ6A 2ZTDA 1GD7A 2UU9Q 1WOCA 4JOIA 1R9TH 4X65Q 2D62A 2YU9H 1YVCA 4MTNA 4B3TL 1VS0A 2A1AA 2IHEA 3GTGH 1UE1A 1KL9A 2KHIA 3H3VI 5IY0A 1IZ6A 1V9PA 2ID0A 4XTCS 5IWAQ 4HIKA 1VQIA 1U5KA 2BH8A 3I55A 1X65A 2ES2A 3BZKA 3M3YH 4A3LG 1B70B 4JI1L 3K81C 2N49A 2VW9A 4IO9A 3TQYA 1X54A 4DR2Q 2UUBQ 4OO1I 3FKIH 4X66Q 3F2DA 2PI2A 2Y0SE 3KLWA 1HNWQ 1TWGH 2KCMA 1PV4A 1VCIA 2Z0SA 1NBWA 4GOPC 1HR0Q 2E5LL 1I5FA 3LGJA 1Q1EA 4JBWA 4R4IA 4A75A 2IX1A 1SR3A 4AYBG 2K14A 2K50A 1VQMA 4DV1Q 1BBUA 4HIOA 2C35B 3CPWA
chains in the Genus database with same CATH superfamily
3U4VA 1VQGA 1EYCA 3PQIA 4B3SQ 3RLOA 2E76C 2NZHA 2PQEA 2BA1A 1BCPD 1SEBD 3S1RB 4HIMA 2JA8G 2AQ2B 2M00A 3OPOA 1SFOH 2JA6H 1BVSA 5FOBB 5AJ3L 3MA2B 4R8NA 1N8RC 5BR8L 5A35A 5EBDA 1YHQA 4Y52H 5HY6A 4KLKA 1SXTA 5FO7B 3SE0A 3S15B 4IZ8A 2D0PA 2F0GA 1F9RA 1VQ7A 2WB1E 3K7AB 2KA7A 2XWBB 2EYHA 2NN6H 3KDFA 1B3QA 3KYHC 1KLGD 4C2MH 2UUCL 4NXNL 2AWNA 3BDOA 4A3BG 4BS9A 5M5WH 5EKLA 4P72A 3K5NA 4O0AA 1MHWC 1CKOA 2BDNA 1EY5A 3DWQA 3PIO3 3T1HL 4KY5A 1PYBA 4HJ5A 1FNWA 1ET9A 1SAPA 2XSCA 3CCJA 4DR4L 1A0IA 2TMPA 3TS0A 3VDYA 2PZUA 2K4KA 1N9WA 1X3EA 1VQPA 1PTOC 5C0XJ 3LWUA 5IIFA 2JA8B 5M5YH 4DK1A 2K5NA 3FP9A 2QDBA 1HNWL 2EY1A 2RQXA 1YJ9A 2F0LA 2K5HA 3E9IA 5FKAC 3HKZE 3RD4A 2IWHA 1IKLA 4OO1H 4A3DG 2Y0SG 4LJZC 2O5JC 4IN3A 5ELFA 1L0YB 1E7ZA 4ZK9B 4B3RQ 3K5LA 1X3QA 2DJGC 1YJWA 1S5DD 3DEPA 4GLXA 1VQ8A 3CKIB 2LSSA 1HPCA 2MPMA 5IP7H 2GVBA 1ENFA 1AFPA 2ZJRA 2IY5B 2NB0A 1AZQA 4RHSA 3MWYW 3CRLC 4A3BB 3HOVG 4HCEA 2HHHL 5IP9H 4LF6L 1XNQL 4X64L 3W2DA 1SE8A 1SYDA 3BDLA 3KF8A 3T4AC 5J39A 5J22A 4KV6A 2NTSA 3NBIA 4AQYL 4EGVA 1RDPD 1F9PA 1GO3E 3AQQA 4O42A 1PMRA 3P1HA 1XPOA 1XNRQ 4LK1C 1OXXK 1SYBA 4HAEA 3M4OB 3GTMB 5CORA 3GTQH 1Q8KA 5JEAH 1M8AA 3MXNB 1DGSA 1R4QB 4JCVE 2HQLA 1DJRD 4JG2A 4BY7H 4JI5L 1L1OC 3MXGA 4ZKBB 3I2ZA 2ASBA 4A3DB 1JQYD 1R4PB 2F0OA 2Y0SB 4F88A 4YCUA 3S9WA 2B3GA 4UAIA 5E4XA 4K8JA 3HOWH 4ABNA 1G2SA 5I9PA 3NEMA 2EY2A 4X3UA 4LF8Q 5IYBH 1NMGA 3CMAA 2PZTA 1Y1WH 4BBSH 2A5HA 1KDBA 1I6HB 1GHJA 2A69C 3PIOA 1E3PA 4G57A 3QR8A 4JI6L 1VQFA 2B29A 2WV6D 4WORA 3S2HH 3HOVB 4DR1Q 1CA5A 1B9NA 4A3FG 4DR5Q 3PO3H 3HOYG 4JI2L 3HKSA 1Y1VH 1L1OB 3MC0B 4KD4A 4P75A 1G6PA 4YHHQ 1I50B 1A8VA 2H4OA 1WYDA 3H0GG 4IOAA 1EEFD 1J9OA 5IYCG 5ELOA 3TDQA 2VQEQ 1NY4A 3GTLH 4I7ZC 4DF7A 1DXMA 5IYDH 3UI2A 2JK8A 2JJQA 1EIFA 5BN3A 3EJIA 5E7NA 5FLMH 3NTIA 4OX9Q 3QOJA 3A5ZB 1SROA 3PF4A 3OTOL 1UE7A 3AU7A 1X9NA 2XRSD 4BXXG 4DV2L 4EVOA 1TWFB 1VF5C 4TVAB 1EZ8A 3I4LA 5EPKA 1EWHA 3LWEA 4YWLA 1HUMA 3NWTA 1LYLA 1EIGA 1QVGA 3OWEB 3J7ZC 1AH9A 4K0KL 5IODA 3FVQA 1PH5A 3URYA 1ILPA 5C3EH 4K14A 1KDCA 4A3IH 4A3MH 2ZT9C 4FVMA 1WCMG 1VQ4A 2SNMA 1QE6A 1DOKA 4RKLA 3A0JA 2EXDA 3STBC 1SNMA 1D5MC 2F52A 3FPPA 3M4QA 4YY3L 4LNQA 2NUCA 4A3FB 4DAYA 2UUAL 2IPKD 3EA6A 5DLQE 3VYSA 3HOYB 4IOCA 4LMQD 4Q0FA 2D0OA 4C1NI 1HA6A 1Q81C 2EYOA 3T53B 2F0UA 3D4WA 5C0XH 3CCMA 2K04A 3C2PA 1DM0B 1I4RA 2F0SA 4CBVA 4KK7A 2F0HA 3HZXA 3ULLA 1PH6A 1PLFA 2IJ0A 3G6JB 4OL7A 1Y8NB 4QF4A 5LMUL 2CW0D 5CMDA 1TS4A 4GKKL 5DNFA 3NBHB 1YNJC 2JE6I 3W1GA 5LHY1 1HQRD 1KC8C 1MGSA 3P20A 3PGZA 2I07B 1SMYC 3CMEA 2EJFC 3E0JA 4A3EG 3KBXA 4NDXA 3V96A 1UNSA 1VMPA 3SK8A 3TP8A 5CBEE 1XPRA 1WD0A 5M3MG 2YTVA 1HCZA 1FGUA 2CQOA 1WCMB 2DGYA 4CJ0B 1OTCA 3S2DB 1N34Q 2FXQA 3A55A 3BYTB 4B3MQ 3JAMi 4IALA 4DXFA 2KOLA 2QEJC 3I4MH 3ITPA 2M2LA 5DM63 1B7YB 2SOBA 3HG9A 3MXUA 2F0IA 1ICFB 5EQ0A 1ZYRC 4FYDA 1A3UA 1SE4A 3KDFB 1A63A 2LFNA 4JI3L 3UDIA 4JYAL 4R9WA 2B2VC 4QIWE 1CFMA 4DAVA 3BVZA 4UP9A 1UE6A 1Q90A 5KRUA 3KF6A 1WI5A 3A74A 1STGA 2CFMA 1VQDA 1ICWA 1IYJB 1GUWA 3ULPA 2G9HD 3A7AB 4LUOA 4WJWA 1FL0A 1PH8A 2IX0A 2DUDA 4APVA 4RHRA 4I65A 4YCWA 4B9WA 5E1FA 2L9HA 3S1QB 4A3EB 2VUMH 1PYSB 2B8FA 2F0QA 3S15H 1GXDC 2E2IB 2B2UC 5M3MB 4EQ5A 2N55A 1TY0A 1TVXA 1T5EA 1OXTA 2UU9L 4GLAC 4X65L 1SN8A 3SEBA 3M7NA 2WKCA 3VR2A 1DOLA 4DV3Q 1GOZA 3QIAA 2R7ZH 1DOMA 1X55A 3TP7A 1JOKA 3AMUA 2CWAA 5FJ8G 2UUBL 4RFBA 3MEHA 5CGKA 4X66L 1SNDA 3CPFA 4XQNA 1M90C 4UDUC 1OXVA 2JA8H 2ICIA 4DV1L 1GUNA 4DN4M 1EIYB 2I5LX 1RCVD 1R9TB 4B3SL 4IJLA 4QB4A 5I2YA 2RDGA 1UEBA 4IJHA 3WDNA 1KRTA 3U50C 1YNXA 5C5MA 2BE5C 2CH4W 3KUPA 3R93A 4F87A 4HMJA 5IOCA 1WOCA 1XXGA 3GTKB 3GQBA 4C3IG 1JWSD 1YVCA 4MTNA 1EYAA 5D65A 3M3YB 1KNAA 2A1AA 4N9TA 3MVVA 1IZ6A 1V9PA 1VQIA 2B2TC 1JC7A 2ES2A 1VDZA 1EZ6A 2B2YA 2VW9A 2N49A 3O13A 2KCMA 4Q5VA 4GOPC 3M7GA 1Q1EA 4A75A 4AYBG 2KEDA 2HD3A 2K50A 1VQMA 1M4VA 3J80L 1BBUA 4HIOA 1KAWA 1VQ5A 2DJFC 3MXNA 2MHVA 5CV4A 3I3CA 3RN5A 1FVIA 2XRQD 2PZWA 3DEOA 2E74C 5K36G 2VZAA 1JB3A 4EQOA 5KGUA 5C3XA 3A5UA 5TSSA 1X32A 3S17H 4A3JH 1PH2A 1U4RA 1B50A 4LWCA 4MIUA 5JOBA 1HFNA 5EKKA 3TRZA 1VQHA 3BU2A 1F77A 3RLNA 4ZUJA 4C3IB 4JI1Q 4DNIA 1A3VA 3X3NA 2IT1A 2CKZB 4PZ8A 4ME5A 5ELDA 3T16A 2KCNA 1MSGA 1L1OA 2K28A 4DPGA 4IUQA 1XJVA 1QILA 1I6HH 2HDMA 3QG1A 2L0CA 1AZPA 4RMFA 5ELCA 2Z4IA 4B3RL 3F2CA 1S40A 2VQFQ 2F1MA 1IYVA 3CAMA 5KNCA 1JORA 4RKBA 5D3DA 1DYQA 1I50H 4AYBB 4OWTB 5ELNA 5KEEA 4A3LH 1OO9B 4EQNA 5COYA 2ATWA 3J80E 3SK6A 1CSQA 4UY8C 1Q8IA 4RGTA 3G4SA 3CD6A 3KJPA 1E1OA 4JI8Q 1E1TA 4OONA 2KHJA 5EAYA 3CCQA 4CDDC 3PMFA 1KQSA 1G91A 4PMCA 3H3VH 3PO2H 2EQSA 1Z6HA 3ERQA 3AFQA 3D6CA 1O7IA 5FO8B 2FJ2A 1E24A 1XNRL 1MBYA 1N36Q 5M9OA 2JA5H 2SNSA 3CC7A 2KHSA 3F2BA 5L37A 1QVCA 4DUYQ 2V4DA 2PQAB 1I3QH 4OEMB 1LT5D 5C4ZA 4P2CB 4KKTA 2V1CC 1IBKQ 2BDOA 2AKWB 4C1NK 1ET6A 4A3KG 3P75A 3OSOA 5GROA 3HP3A 1C8CA 1RIPA 1LT4D 1PRTF 1KDAA 4LFAQ 1HTPA 3TBIB 1PZID 4QJFA 1BNZA 2A68C 1T5XD 4X62Q 4A3FH 3FPUB 3HOYH 3V2TA 4HJ9A 1CI3M 3U9OA 4LF8L 1EYDA 1Q12A 2JSOA 1N33Q 2KUMA 5LMNQ 2N3SA 4XIGS 4JI0Q 1E22A 4RCOA 3L0OA 5IGCA 1CQFA 1NSNS 4K2LA 3D3RA 1BR9A 3BZDB 4DK0A 4DR1L 5IYCH 5I2XA 4DR5L 1HJPA 2K05A 4LFBQ 4DA2A 3SDZA 2NZOA 5CV9A 2F03A 1GUTA 2D9UA 1CZGA 4DNTB 4C3HG 4XXEA 1EQQA 5IT9c 2IX3A 1SNPA 2WB1G 4BWGB 1JB7A 2VQEL 1HZBA 2NVQH 1VQ6A 4O2DA 4L5SA 4LFCQ 4JW0A 3PIP3 4JI7Q 4CKEA 1GHKA 1S5ED 1FNVA 5T1IA 3Q6SA 1C9OA 1PH3A 4OX9L 1G2TA 2OXPA 5KNBA 5GAHC 4A3KB 5M5XH 4XQQA 4IFDI 2NTTA 2WAQE 3S2DH 2R7DA 3KF6B 3CU7A 4JI4L 1TWCB 3UDGA 4IUTA 2VB3X 5C4JB 2JP1A 4K8IA 3X3MA 4DNRB 2OTJA 3BDCA 2EOTA 4KHPQ 3VA7A 2UXCQ 3VR3A 1NR4A 3J80c 3GV3A 5BN4A 2B63G 2E2JB 2CHBD 5ELEA 3HKZG 3KLRA 1NCVA 1SNCA 1T9HA 4UP7A 4GN3B 4OIKA 3SK4A 5NUCA 1LT3D 5IGDA 5JPMC 1LTID 4PNYA 4KKSA 4KY6A 1E2VA 4C3HB 1IW7D 1QWYA 3PUXA 3K59A 3V05A 2WB1B 4NPSA 4HIDA 4KHVA 3D31A 4QQBX 2A6HD 1FYCA 1CTMA 3G7LA 3T51B 2R93G 4CDEC 1L0XB 2NZ1D 1EY9A 2B2VA 1EUJA 4RGMA 3CCEA 1EWIA 2QGQA 4A3EH 1I4QA 2R6GA 4DR6L 3W1BA 4JVZA 2E2IH 1Q3LA 2CQAA 3EFXD 3K8AA 2EYPA 4X3SA 1SE2A 3OIPA 3I90A 3L9AX 2B2YC 4ZLTF 3AEVA 2O2LD 2F0DA 1IL2A 2XGTA 1RL2A 4DV7Q 3S16H 1MI2A 1PTOB 2HT1A 2B2UA 3PUWA 2RKSA 1U4MA 2B63B 4CJ2C 1FGBD 3HKZB 4B3ML 3DM3A 1C48A 3K0YA 4LF5L 4A76A 1QVFA 1GUGA 5A2QE 2NVTB 2ZTCA 3RZOB 2R92G 3PIPA 1NNXA 4R4CA 4DKAC 2F4VQ 2E2HH 2BH2A 2WP8J 4TQUS 3GTOB 3GTJB 1JJCB 2K5QA 4LF4Q 1EWCA 3CQZB 2OT2A 3KBGA 4K6DA 1QZHA 1HNZL 4L5QA 1C4QA 1QG7A 2ZM6Q 4HEDA 2R93B 2YYZA 4KKUA 4LUVA 1RD9D 1HFGA 3GTKH 4ZUIA 3G6EA 3H94A 1EOVA 3PV0A 4N8FA 4G7HC 1MIUA 1LT6D 4V0BA 1GVPA 3VYUA 1PVOA 5GAEC 3HOXG 3S1MB 2F3IA 1D2BA 3CCUA 4KY7A 4PG3A 1ENCA 2LMCB 4NW2A 1ASYA 1S5BD 1JWMD 3OIQA 3DXJC 1B3AA 3KJOA 1V43A 1ILQA 4TKOB 3SR1A 2FMCA 1S5CD 3ULJA 3N6RA 2NVYH 3HS0C 1WTOA 2TSSA 1NE3A 2K03A 4OGQC 5M3FH 2B2TA 2PCFB 4Y7NH 3GTPB 1BCPF 2X6LA 4B08A 1EL0A 3NK9A 4G7OC 3KLSA 1O80A 1BOSA 5EKIA 2DY8A 4GOPA 1VQJA 4BBRG 2R92B 1PRTC 3BJUA 4KMUC 4A3CH 1SJHD 4FNFA 4A93H 2WKDA 2A6ED 1AE3A 4IFDG 1SYEA 2ZXPA 1A62A 1V1PB 3NSWA 1X3FA 1LTSD 1PYWD 4A3GH 1N32Q 1CQVA 4FP5D 4H02A 2KQ3A 5D3IB 2WIIB 2JA7H 1XPUA 5FLXL 5CYUA 2I5MX 2KCTA 4DR3Q 3MTSA 3HOXB 1TQOA 4RAUC 4NKLA 2D2CC 1PRTB 2Z9HA 1ZEQX 1B9MA 4L8JA 3M4YA 4PV1C 1B53A 1CZWA 3DUZA 4WRDA 2F0VA 3ER0A 1ENAA 5G3LD 4AH6A 3T1YQ 2Q2HA 3QO2A 4ZAIA 1JOQA 1SYFA 1J6QA 1FNUA 4IUPA 4G4KA 3S24A 1MJEA 1JCKB 2GA4B 1YBYA 2MFIA 1HZAA 1XMOQ 3TREA 3I8ZA 4HMIA 4DR7Q 1PFSA 2JA6G 4IPGA 1K0RA 3EVQA 1K83B 1M1KC 1AW7A 1H9JA 2RHSB 3IKJA 5K36H 4BBRB 1S72A 1KNEA 3J7AF 1LTRD 3H0GB 2PQAA 2XIWA 5LMNW 3Q8DA 4EX5A 3I7FA 1VQLA 4IUUA 4CGYB 4WJ4A 4IUVA 2PMZE 3R2IA 1HR0W 1YNNC 1SE3A 5KYLA 1LTBD 2D62A 2WINB 5FLXE 1JR0D 3T13A 1F2YA 1BBXC 1UE1A 2KECA 1CA6A 5IY0A 4XTCS 4H44C 1U5KA 1X65A 1EY4A 4JI1L 3R8BA 5I6YA 4IO9A 5FO9B 4DR2Q 1HHVA 1K8MA 4JPBW 1HNWQ 1TWGH 3C1EA 1PV4A 2Z0SA 1NBWA 2IX1A 1D6EC 1CHPD 5CV7A 3DM1A 1PZJD 3HOUG 3I4NH 1SFOB 2JA6B 2Z6BA 2OWOA 5C3WA 1TWAB 3RLFA 4XDXA 2JEBI 2G9DA 1W2BA 3Q0AA 1IYUA 5C4XG 1W6JA 4KD3A 3J80i 2XVSA 1GKHA 5JVG3 2DY7A 5KYIA 1JWUD 5IGBA 3K58A 4B3TQ 1L0WA 1GUOA 4JI8L 3S1RH 2K52A 1WD1A 4NMZA 1IBML 3C1FA 1A2TA 3CCVA 4K5XA 5DEHA 1JMCA 3AB9A 4C2MB 3RNUA 4AQYQ 2CH4A 5M5WB 5C5LA 5IP9G 2OQKA 2ICEC 1E0BA 1XMQL 2EPBA 2OF1A 1D7QA 1QUQA 1BXTA 3TSSA 3IFTA 1TWCH 1KRSA 2RDFA 4DUYL 4DGZA 3HFZB 2F0FA 3SHLA 3OMCA 1IBKL 1Q82C 1EU3A 4NXMQ 3FKIG 4QIWB 3NHHA 3BZCA 3K7AH 3M4PA 2WFWA 3BG3A 3UDFA 3BVMA 1F9SA 3LX0A 4YWKA 2P5ZX 1NMFA 4LFAL 5M5YB 2HIXA 1CUKA 2PNHA 2UXBQ 3HOUB 1Y69U 4X62L 3HOZG 2X69A 2NVXB 3TS2A 4RGNA 4RWSC 5LMNL 1VQEA 1FJGQ 4BY7G 1LTLA 4C3HH 2DNCA 4JI0L 4JOIC 5C4XB 3L3OC 2QCPX 1VMCA 2ZJQA 4JI6Q 1KTKA 1YI2A 4IFDJ 2A69D 5JVH3 1HR0L 4LFBL 2O5IC 2EYMA 4RGOS 4U673 1KIXA 3HOWG 4ZYSA 2EZVA 1Y1WG 3RMHA 1Y8OB 5IT9L 4DV6Q 5FLXc 1BCPC 1G8ZD 3SGIA 2L12A 1NTGA 1I4GA 1K73C 3AYHB 4LFCL 5EPJA 2Z8LA 2NYZD 5D14A 3H15A 1EFWA 4JI7L 3FEWX 1X3PA 2J4XA 3HGBA 1BQQT 2VXWA 3VR6A 1B4OA 1PTOH 3FKIB 4V190 4FF1A 1D5XC 5E4WC 3DLLA 4ODGA 5J3BA 4J15A 4TSSA 4A3BH 5IYDG 4GKJQ 1BCPB 4LF9Q 4QUCA 3CCRA 4HR7B 1I94Q 2DNEA 1NAPA 2AWOA 2Q8IB 4DFAA 3HOZB 3J7AV 2SEBD 3J81L 2K01A 3M85A 3NTHA 1PA6A 4KHPL 1TT2A 2UXCL 4OIJA 4HTHA 5C44G 3I4OA 4FXGC 2AUJD 4BY7B 4YIJA 1QOHA 3S1NB 2IHFA 2LY7A 3KLSX 1FD7D 3UE0A 3NELA 5IE8A 3F2UA 4YY3Q 4X3TA 3M4OH 1XTCD 3HOWB 1ML0D 2L11A 3WWVA 5C3EG 3GTMH 2R93H 3STBD 1F9QA 1CKNB 4H13C 1Y1WB 1WTRA 2QILA 2MQHA 1KXLA 5IT9E 1IKMA 2XWJB 2K1BA 3GD7A 1MD2D 4GOPB 5LL6X 4UHVA 1HZCA 3S1MH 1HH2P 3MZ5A 5HURA 4A3DH 3E9HA 4KJOA 4JBKA 1UE5A 2ALYB 1OXUA 4DV0Q 4IPCA 5GAGC 1GJXA 5C6AA 4GKKQ 2ZXOA 3ERSX 3A56A 2BA0A 2PW5A 3GTLB 4LF7Q 4U68A 1S4ZA 1GUSA 1V1OA 1Q7YC 3HOVH 3GTPH 2F0EA 4B9XA 3EROA 1EY6A 4DV7L 1STBA 1V1PA 1F2ZA 3E3XA 1U4PA 1UAPA 5EGTA 1H95A 3J81E 1CSPA 4QGUA 5C44B 2R92H 4BY1G 2F0JA 1AE2A 2OTLA 3NUCA 4GZYC 2RCNA 4HN7A 3JC66 2QF7A 4PMWA 4M8AA 2MNAA 3OMGA 1XX8A 3KOJA 5C3EB 3ND9A 2F4VL 1HRJA 2RSNA 1BO0A 3CRKC 1DD2A 1NUCA 2H5XA 5C4HA 2O4XA 2H1EA 1NR2A 4LF4L 3J7A5 2Q2TA 2Q2IA 1TWFH 2ZM6L 5JPNC 2Z6KC 5IGFA 2MJ8A 3J7YW 4QCLA 4R8IA 4L6TB 2AQ1B 1CK1A 5KNDA 1ZYRD 3DWPA 4GNXC 1O7LA 2JXMB 5E3FA 1PH4A 1HQMC 1JOOA 4L63B 4CJ1B 1V1QA 3ICEA 1QJOA 1EY0A 1XWEA 1SLJA 3OOCA 3U58A 2KCCA 1EOTA 2K33A 3FRPB 1KLUD 2QEXA 1J5EQ 5BN5A 4BY1B 1ASZA 5I4DA 1XTDA 3U4ZA 1SJED 3RZDB 3NP8A 3H0GH 1A6XA 1KAAA 1I4HA 4GNXB 2A73B 4IFDH 2WAQG 4H7BA 3IRBA 2MP1A 2VUMG 2B39A 3A8JE 3MFYA 2B8GA 2PW7A 2HUGA 4YHHL 3ZYYX 2A6EC 1C0AA 4IPDA 4BA2I 1UWVA 2UXDQ 4K5WA 1U4LA 5HGTA 1W3SA 1PXUA 3MXPA 4KHZA 2KJXA 4BXXH 1N32L 3OW7A 1K8GA 3NXWA 5AFWA 1UUPA 2I46A 1EFID 2R7ZG 3VA5A 1LTGD 2K5WA 2R61A 2HCIA 4K6LA 4G7ZC 4DR3L 4OWXB 1SMXA 4DV5Q 2KBNA 2FFKB 4AIMA 1WCMH 4MHEA 4YWMA 1STAA 2L4NA 2RBMA 1BBWA 4FDBA 4DUZQ 2PPBC 1HXYD 3NQIA 4RG1A 1TS5A 1PH9A 2BE5D 3MAQA 3T1YL 1LO5D 3J81c 1K3BC 4R4QA 2L1BA 2XNAC 1QUQB 2JYOA 1TWAH 1WVLA 5T1GA 5CBAE 3QJYA 3TEHB 2MUYA 1XMOL 2K32A 2FHTA 5JJIA 4DR7L 4DAPA 3QOLA 5A2QL 3JAMc 2WAQB 4TRDA 1MKHA 1MSHA 2VUMB 1VQKA 5GADC 3I73A 2HIVA 5I9OA 3NE5B 1EU4A 1X3GA 1L2FA 4MTKA 2F4IA 5EBCA 3AFPA 3A8IE 5H1SE 2CW0C 4MZ9A 3EBEA 3OHXC 3SXHA 3S1QH 2J7ZA 4PMBA 1WTPA 1LACA 2R7ZB 3BYYB 2Q8TA 2A8VA 4ILWA 4JV5Q 3SK5A 3P7JA 5M3MH 1WTHA 1IBLQ 1BUVT 3CHBD 4FF3A 5CR3A 4Z9CB 1HNXQ 2VB2X 1SNOA 3W5OA 1HA5A 3BS1A 3HOUH 4DR2L 1Y8PB 2HCCA 4A3JG 1TS2A 1XYIA 2K5VA 2NN6I 2PO4A 4DV4Q 2NVXH 4RH6A 4HSVA 1W6KA 1I4PA 1RHPA 3FHWA 2Z1CA 3KK7A 1N34L 2JQOA 5C4XH 3TP5A 2IW3A 1E2WA 1JICA 3E0EA 4O1NA 1HZ9A 4C3JG 3UE1A 4N8X1 4N9PA 4WJ3M 1CHQD 1YZ6A 2K6AA 1GD7A 2L5TA 4JOIA 1R9TH 2EVBA 4X3KA 4B3TL 1VS0A 2C5CA 2IHEA 3FDTA 1IL8A 2Q8RE 2QKIC 3QWNA 2ID0A 2E2DC 5IWAQ 4FF4A 4HIKA 1FR3A 3I55A 3M3YH 4ZQ3A 3BZKA 5LL6S 4A3LG 1B70B 2Z4HA 1X54A 5DM73 4OO1I 3FKIH 5JAVA 2Y0SE 5DAUA 3KLWA 1VCIA 1G6ZA 1I5FA 1PFNA 1SYGA 3IFDA 3LGJA 4R4IA 1SR3A 2K14A 1F2LA 5ISRA 4LAAA 2HDLA 4P71A 3HOZH 1H9KA 4NXML 3S17B 3FMCA 4A3JB 3PO2G 3BVGA 4JC0A 3B6YA 4XYOA 3NPPA 3GV6A 3PSIA 4S3SA 1SBBB 4J6HA 1RTNA 2JA5G 4GLVB 4KI0A 3S1NH 1CKNA 3CW2C 5FJ8H 2RHQB 2UXBL 3HEJA 1K8AC 2F3WA 4DV3L 3OW2A 1S5FD 2EIFA 3UDXA 3WOEA 4OELB 4C3JB 4JBMA 4L5RC 3WOFA 1GM5A 4CHTB 2A68D 1SRUA 1FJGL 1I4XA 1O7YA 1Z9FA 3H6MA 5EPLA 3RUZA 1STNA 1LLRD 1D8LA 3SVMA 1AN8A 2CCZA 3H3VC 2Q2UA 1CKMA 2E5LQ 3NQTA 4C3IH 2RSOA 5HGQA 3CF5A 4DV6L 1TY2A 4ME3A 4NP5A 3G48A 1EYGA 3EQLC 2B2WC 4K2KA 3S14B 5KIXA 3E5SA 4DAMA 2YTXA 2LKVA 3IL8A 2VNUD 5J1ZA 4A4IA 4OWWB 1TR5A 1HTLD 2MO0A 2JEAI 2OCEA 4DU9A 5AJ3Q 1PFBA 1VQNA 4QUFA 1P16A 3PO2B 3DMUA 5BR8Q 1TWHB 3M9BA 4M1UB 2L15A 1PH7A 3GP7A 2AHOB 5C44H 2KVMA 2N8NA 5CC4A 1YJNA 2JA5B 1I6VC 1LTTD 1PZKD 1Z47A 2EY5A 4GKJL 4JI4Q 4LF9L 1STYA 2QW7A 1I3QB 1I94L 1LABA 3VR4A 1YIJA 1H9SB 1LV9A 2R7FA 2OQ0A 4HCSA 1WTQA 2FINB 1Y14B 4ULLA 1YHBA 4RCNA 1PDQA 1STEA 2UUCQ 4NXNQ 2VL6A 2YU9B 2I5HA 5CV6A 1Q86C 1E2ZA 4K5VA 2EE1A 3D4RA 3GTGB 5I6WA 1TS3A 3ONAB 4H0LC 2PI2E 3TZDA 1RTOA 3T1HQ 1K3RA 4QMGA 1YEZA 1B2TA 1PH1A 1U0LA 2F0PA 1X56A 2NN6G 4DR4Q 2JN4A 4KTAA 5EJWA 2YV5A 2J0TD 1II3A 1JT8A 4LUZA 2SDFA 2Z6KA 1NJIC 2YTYA 1PFMA 2EJGC 4XT3B 4WFN3 1Z7TA 4POGA 1PTOD 2PMZB 3K80C 4ZKCB 4DV0L 4GNXA 4YCVA 4RA8A 2EJMA 4DR6Q 4X6AH 2E75C 1H9MA 2NVQB 3NWSA 4LF7L 4BY1H 3RZDH 1VQOA 1YHAA 1JE4A 2VQFL 4PZ6A 2MO1A 1TKWB 3K5OA 1X6OA 4FXKC 1ZXTA 4R4TA 3J81i 3J81j 3MHBA 1D1IA 1LM0A 2C9OA 5M5XB 3H91A 4OO1G 5C0XI 2VS1A 1KD1C 3VR5A 3A7LA 4KN4C 3PUYA 2K5DA 4R4OA 3MFGA 3N52A 3R3OA 2ZJPA 2HHHQ 4LF6Q 4JK1C 1O7ZA 4LF5Q 1XNQQ 4DK6C 4X64Q 1EY7A 3KFUA 3CCLA 1WTVA 3K57A 5IP7G 2EYLA 1O78A 4IQZA 2HQEA 4KJNA 4POFA 4IURA 4A3KH 1BKBA 1LTAD 2F0KA 1N36L 1SNQA 2VY3A 3I72A 2G5DA 3VYRA 1VQCA 1HNZQ 1C7YA 5C4JH 4XYQA 1RODA 1CT1D 1Q1BA 1K28A 2F0NA 5JJLA 2EXZA 3H09A 4F8MA 2A74C 5FK9C 4PZ7A 3K0XA 4P74A 5CV5A 4JI5Q 1LUZA 4I7AA 3DWAA 2E2JH 4ID6A 4ALPA 3I56A 3U9SA 5JEAG 3A54A 4DK3C 2LS01 2RF4A 2GVAA 4BA1I 1J5EL 3ND8A 4OHJA 4C56C 2EY6A 3OWFA 4FF2A 1N33L 4DXGA 3Q23A 4J8QA 2LXKA 1G51A 1K9MC 2EDGA 3L7ZC 3D6WA 2NWGA 2X6GA 1EQRA 4NB3A 4JI2Q 1WJJA 3S16B 3G71A 2MGSA 1S3OA 1VQBA 1VQ9A 1CM9A 2RCFA 5IYBG 1IXRA 3L2PA 5G3LF 3RN2A 4BBSG 2UXDL 4QL5A 3F1ZA 4IPHA 2EYJA 2N78A 4KN7C 1JJ2A 3NTKA 5M3FG 3K6OA 1VQAA 2CVRA 3PO3G 1K0SA 1PRTD 4HJ7A 4XQJA 1TXYA 3I70A 4E6IA 1Y1VG 2F0TA 3TP6A 3GO5A 3PUZA 3QB3A 4LW1A 4GS3A 1DCZA 1STHA 3D0FA 4OXPA 1SYCA 2E2HB 4A3CG 3Q22A 1QCBD 4A93G 5JJKA 2N88A 3OTOQ 5CV8A 4DV5L 3KF8B 5JJZA 4DV2Q 3K7UC 1QB5D 1OXSC 4A3GG 4L5TA 4CKBA 1SDFA 3C46A 2B63H 1BDOA 4UPAA 4DUZL 1QNKA 3GTQB 4K0KQ 1P8LA 2RVLA 5FLMG 3A8KE 1D1KA 2JA7G 2K75A 3CC4A 2NVTH 4CDCC 3RZOH 2F0WA 2KEEA 1K8OA 1EEID 4HJ8A 2FMMA 1A3TA 2D5DA 3PUVA 1DONA 1PHJA 1Q46A 4GN5A 1RJTA 3GTOH 3JAML 3GTJH 1MJCA 3CC2A 2BOSA 3CQZH 4P73A 2XTIA 2UUAQ 4EQPA 1IW7C 1H9RA 2NVYB 1PTOF 4JBJA 4A3IG 4BBSB 4A3MG 4F7XA 4PQXA 1UEAB 1U9RA 2A6HC 2I0QA 1KHIA 1B44D 5M3FB 3S2HB 3VYTA 1KABA 4Y7NB 1BF4A 2WACA 2EYFA 3D8GA 2PNRC 1ONLA 3PO3B 3OYYA 1DZ1A 1ESFA 1RKNA 1Y1VB 2ZTEA 2AMCB 3HRZC 1IHZA 2JA9A 5LMUQ 3CCSA 1WTWA 1AP0A 1ESRA 1YITA 4A93B 4JV5L 5C0XG 1YNND 1A15A 1EQTA 1IBLL 2AUKA 4GN4B 4A3GB 1YNJD 4R1JA 4HSPA 5ELBA 1HNXL 4XT1B 5IGGA 1A2UA 2QA4A 3F8TA 3GDEA 4ZCKA 2JA7B 4AYBE 2ENBA 2F0MA 4J1MA 1SMYD 4DV4L 4C3JH 4CDFC 5GQOA 4FXDA 2R3ZA 4UP8A 1EY8A 1JJGA 1V8QA 3JAME 2M9VA 1QZGA 2GN5A 2PYKA 3NENA 3ZJYC 3LNNA 1ZKOA 3TMEA 4A3IB 4A3MB 2A19A 3EN2A 2KENA 1G291 2CWPA 3S14H 3HOXH 3PF5A 5IGEA 3I4NG 3I4MG 1J8IA 3C3LA 1WFQA 3CP0A 2ZXRA 4MNOA 4JI3Q 5IWAL 4JYAQ 1SSOA 3MEFA 3PCOB 1IBMQ 3CXCA 1TIID 2L55A 1JE5A 4DAYB 1VF7A 2OEOA 2B2WA 2LXJA 1HUNA 3IAYA 1TWHH 4FO2A 2RDHA 1B8AA 2IL8A 4HJAA 2DN8A 1H9SA 1EIHA 1XMQQ 1EQVA 3EIVA 1K83H 4IUNA 1F2MA 4ZRZA 3E6ZX 3K5MA 5JEAJ 2F3VA 2QDLA 4BBRH 3RR5A 2NBFA 1RF2D 2E8GA 3Q24A 4QY7A 2ZTDA 1B1ZA 2UU9Q 3TZUA 1QNUA 4X65Q 2YU9H 2RA4A 2XN9C 2BCOA 1D5ZC 3GTGH 1KL9A 2KHIA 3H3VI 5K5PA 1TWGB 3W3AA 1TU2B 4MN3A 2BH8A 3T56B 3I91A 3D4DA 3K81C 2UUBQ 3TQYA 4X66Q 3F2DA 3I4NB 2PI2A 2AQ3B 3I4MB 3DHQA 3TN2A 2K7VA 3NBHA 3R2TA 1HR0Q 2E5LL 4JBWA 1WTXA 4CKCA 1AEXA 4DV1Q 5F2DA 2C35B 3CPWA
chains in the Genus database with same CATH topology
1KAWA 3U4VA 1VQGA 3HOUG 3I4NH 4P71A 1VQ5A 3HOZH 4B3SQ 3RLOA 4NXML 2NZHA 3PO2G 2OWOA 4JC0A 3RN5A 3B6YA 2BA1A 1FVIA 3PSIA 4HIMA 3RLFA 5K36G 2JEBI 2JA8G 2VZAA 1W2BA 2JA5G 4GLVB 4KI0A 3S1NH 1CKNA 3CW2C 5FJ8H 3A5UA 2RHQB 3J80i 1SFOH 2JA6H 2UXBL 1BVSA 1GKHA 5C4XG 3S17H 4A3JH 1K8AC 5AJ3L 1PH2A 4B3TQ 4IFDI 4DV3L 3OW2A 1L0WA 4JI8L 1N8RC 4LWCA 5BR8L 3S1RH 2EIFA 3UDXA 2K52A 3TRZA 1VQHA 3BU2A 1IBML 4JBMA 1GM5A 4L5RC 1SRUA 3RLNA 1FJGL 1YHQA 1Z9FA 3CCVA 4Y52H 5HY6A 4KLKA 1JMCA 4JI1Q 4DNIA 1D8LA 2CCZA 2IT1A 3RNUA 2CKZB 4AQYQ 4PZ8A 2Q2UA 2D0PA 5IP9G 1CKMA 2OQKA 1VQ7A 2WB1E 2E5LQ 1XMQL 4DPGA 1L1OA 1I6HH 1D7QA 1QUQA 1XJVA 1TWCH 1KRSA 4C3IH 5HGQA 3CF5A 3KYHC 3KDFA 3HFZB 4DUYL 4C2MH 4DV6L 4RMFA 2UUCL 4NXNL 2AWNA 4ME3A 1IBKL 4A3BG 3G48A 5M5WH 1Q82C 3F2CA 1EYGA 4B3RL 4NXMQ 3FKIG 4P72A 1S40A 4O0AA 2VQFQ 1CKOA 4DAMA 2YTXA 3CAMA 3BZCA 3K7AH 3M4PA 2WFWA 2VNUD 3UDFA 3T1HL 1I50H 4OWTB 1PYBA 5ELNA 4YWKA 4A4IA 4HJ5A 4OWWB 4A3LH 1NMFA 4LFAL 2HIXA 2ATWA 1CUKA 2PNHA 2MO0A 3CCJA 2JEAI 2OCEA 1A0IA 1CSQA 4UY8C 4DR4L 5AJ3Q 3TS0A 4X62L 3G4SA 3HOZG 1VQNA 3VDYA 3KJPA 3CD6A 2K4KA 1E1OA 1N9WA 1P16A 1E1TA 4JI8Q 1X3EA 5BR8Q 1VQPA 3M9BA 2L15A 1PH7A 4OONA 5C0XJ 3TS2A 2AHOB 2KHJA 5EAYA 2N8NA 5C44H 3CCQA 5LMNL 1VQEA 1FJGQ 5M5YH 1LTLA 4C3HH 1YJNA 4JI0L 4BY7G 1Z47A 4JOIC 1KQSA 4GKJL 2K5NA 4JI4Q 4LF9L 3H3VH 2ZJQA 3FP9A 1I94L 4JI6Q 3PO2H 2EQSA 4IFDG 1HNWL 1YIJA 1YI2A 1YJ9A 2K5HA 4IFDJ 1HR0L 3E9IA 3AFQA 4LFBL 1O7IA 1XNRL 1E24A 1N36Q 1KIXA 3HKZE 2R7FA 3HOWG 2JA5H 2OQ0A 3CC7A 3F2BA 1Y1WG 4A3DG 2Y0SG 1QVCA 4DUYQ 2PQAB 1I3QH 4DV6Q 1Y14B 1YHBA 5FLXc 2UUCQ 4NXNQ 2V1CC 1E7ZA 2VL6A 1IBKQ 2AKWB 2I5HA 4B3RQ 1Q86C 4A3KG 3SGIA 1YJWA 1NTGA 4GLXA 1K73C 1VQ8A 3AYHB 4LFCL 2LSSA 2PI2E 5GROA 3H15A 1EFWA 4JI7L 5IP7H 1K3RA 3T1HQ 2GVBA 1YEZA 1PH1A 1RIPA 1U0LA 2ZJRA 2IY5B 4LFAQ 1X56A 2NN6G 4QJFA 3HOVG 4DR4Q 4X62Q 5IP9H 4A3FH 2HHHL 4LF6L 3HOYH 2YV5A 4HJ9A 1XNQL 4X64L 4LF8L 1SE8A 1JT8A 4LUZA 1Q12A 2Z6KA 1NJIC 1N33Q 3DLLA 2YTYA 5LMNQ 5J3BA 2N3SA 4J15A 4XIGS 4JI0Q 1E22A 3L0OA 5IYDG 4POGA 4A3BH 4GKJQ 4LF9Q 3K80C 3CCRA 4DV0L 4AQYL 2UXBQ 4GNXA 1I94Q 2AWOA 4DR1L 5IYCH 1GO3E 3AQQA 4DR5L 4YCVA 1HJPA 4DR6Q 4LFBQ 4X6AH 1XPOA 1XNRQ 3M85A 1PA6A 4KHPL 2NZOA 2UXCL 1OXXK 5C44G 4BY1H 3I4OA 4LF7L 3RZDH 1VQOA 1EQQA 3GTQH 1Q8KA 5IT9c 2IHFA 1YHAA 2WB1G 3UE0A 3NELA 3MXNB 1DGSA 5IE8A 4PZ6A 2VQFL 1JB7A 4YY3Q 2VQEL 1HZBA 2MO1A 2NVQH 1X6OA 4JCVE 2HQLA 4O2DA 4L5SA 3J81i 4R4TA 4JG2A 4LFCQ 3WWVA 5C3EG 3J81j 1LM0A 4JI5L 1L1OC 3GTMH 4JI7Q 4BY7H 3STBD 4OO1G 2R93H 5C0XI 2VS1A 1KD1C 3I2ZA 1CKNB 2ASBA 4YCUA 2MQHA 1KXLA 3PUYA 1PH3A 1C9OA 4OX9L 2B3GA 4R4OA 2ZJPA 2HHHQ 4LF6Q 3GD7A 4GOPB 5GAHC 3HOWH 4LF5Q 1XNQQ 4DK6C 1HZCA 3NEMA 5M5XH 4X64Q 1HH2P 3CCLA 5IYBH 1NMGA 4LF8Q 3CMAA 3KFUA 3S1MH 1Y1WH 4A3DH 2WAQE 4BBSH 3E9HA 5IP7G 2R7DA 3KF6B 3PIOA 3S2DH 1E3PA 4JI4L 4JBKA 1UE5A 3UDGA 2ALYB 4JI6L 1VQFA 2B29A 1OXUA 3S2HH 4POFA 4DV0Q 4IPCA 5GAGC 1BKBA 4A3KH 4DR1Q 4A3FG 4GKKQ 4DR5Q 3PO3H 2OTJA 3HOYG 1N36L 2VY3A 4JI2L 3ERSX 3HKSA 1Y1VH 2BA0A 4KHPQ 1L1OB 1VQCA 1HNZQ 2UXCQ 4LF7Q 4P75A 1G6PA 4YHHQ 5C4JH 1C7YA 3J80c 1Q1BA 1Q7YC 1A8VA 2B63G 3HOVH 3GTPH 5JJLA 3HKZG 1WYDA 3H0GG 4IOAA 1T9HA 5IYCG 4UP7A 5ELOA 4DV7L 4GN3B 2VQEQ 1H95A 1NY4A 3GTLH 4PZ7A 3K0XA 4P74A 4JI5Q 1CSPA 4QGUA 2R92H 4BY1G 1LUZA 5IYDH 1AE2A 2OTLA 2JK8A 2E2JH 2JJQA 1EIFA 4ALPA 2RCNA 3PUXA 5E7NA 5FLMH 3I56A 5JEAG 3JC66 4NPSA 4OX9Q 3A5ZB 1SROA 4DK3C 3PF4A 4PMWA 2MNAA 2RF4A 3OTOL 4HIDA 1UE7A 3D31A 4QQBX 2GVAA 4BA1I 1J5EL 1X9NA 1N33L 1VQ6A 4BXXG 4DV2L 3KOJA 4TVAB 2R93G 4YWLA 2F4VL 1EUJA 1LYLA 3CCEA 2LXKA 1QVGA 1EWIA 3J7ZC 1G51A 2QGQA 1AH9A 1K9MC 2H5XA 4K0KL 3L7ZC 4A3EH 1PH5A 1EQRA 2R6GA 4NB3A 3W1BA 4LF4L 3J7A5 4DR6L 2E2IH 5C3EH 4JI2Q 1WJJA 2Q2IA 2Q2TA 1TWFH 3G71A 1S3OA 1VQBA 1VQ9A 5IYBG 2ZM6L 2Z6KC 1IXRA 3K8AA 3L2PA 4A3IH 3RN2A 4A3MH 4BBSG 2UXDL 4QL5A 1WCMG 3F1ZA 4IPHA 1VQ4A 2N78A 1JJ2A 5M3FG 3AEVA 1IL2A 2EXDA 1VQAA 2XGTA 3A0JA 3STBC 2F52A 4YY3L 3M4QA 4GNXC 1PH4A 4LNQA 1RL2A 4DV7Q 2UUAL 3S16H 2HT1A 5DLQE 3PO3G 1V1QA 4IOCA 4HJ7A 1TXYA 1Y1VG 3PUWA 3ICEA 3GO5A 3PUZA 2D0OA 4LW1A 4GS3A 1Q81C 1SLJA 3D0FA 4OXPA 3U58A 4B3ML 4A3CG 4A93G 3DM3A 5JJKA 4LF5L 3CCMA 4A76A 3OTOQ 1QVFA 2QEXA 4DV5L 1J5EQ 3KF8B 2ZTCA 4DV2Q 3K7UC 1PH6A 1OXSC 3ULLA 4L5TA 2R92G 3PIPA 4A3GG 1ASZA 2B63H 1XTDA 4R4CA 3U4ZA 4UPAA 4DKAC 4DUZL 2E2HH 2BH2A 2F4VQ 5LMUL 3H0GH 2WP8J 4K0KQ 1P8LA 4GNXB 5FLMG 4TQUS 2JA7G 4GKKL 2WAQG 2K75A 3NBHB 3CC4A 2NVTH 1JJCB 3IRBA 4LF4Q 2VUMG 3RZOH 1QZHA 1HNZL 4L5QA 4YHHL 2JE6I 3W1GA 2ZM6Q 4HJ8A 1C0AA 3PUVA 4IPDA 1UWVA 2YYZA 1KC8C 4BA2I 4LUVA 2UXDQ 1PHJA 1Q46A 4GN5A 3PGZA 3GTKH 3GTOH 3GTJH 3CMEA 1MJCA 1W3SA 3G6EA 4A3EG 3CC2A 1EOVA 3CQZH 3PV0A 4P73A 4KHZA 1MIUA 2XTIA 2UUAQ 1GVPA 4BXXH 1XPRA 1PVOA 1N32L 1K8GA 5GAEC 5M3MG 3HOXG 2F3IA 4JBJA 2YTVA 3CCUA 4A3IG 4A3MG 4PG3A 1FGUA 2CQOA 2DGYA 1ASYA 1OTCA 2I0QA 1KHIA 2FXQA 1N34Q 2R7ZG 3KJOA 4B3MQ 3JAMi 1V43A 3ULJA 4DR3L 2NVYH 3I4MH 4OWXB 1SMXA 3OYYA 4DV5Q 2KBNA 4AIMA 2ZTEA 1WCMH 2AMCB 4YWMA 1NE3A 2JA9A 1BBWA 1B7YB 4FDBA 5M3FH 4DUZQ 5LMUQ 4RG1A 4Y7NH 3CCSA 1PH9A 1YITA 4JV5L 3T1YL 5C0XG 3J81c 4R4QA 1QUQB 1IBLL 1TWAH 4GOPA 4GN4B 3KDFB 3TEHB 1A63A 1VQJA 4R1JA 4JI3L 3UDIA 4BBRG 4JYAL 1XMOL 4QIWE 1HNXL 3BJUA 4UP9A 1UE6A 4A3CH 5JJIA 4A93H 2QA4A 1AE3A 3F8TA 3GDEA 3KF6A 1WI5A 3A74A 3JAMc 2CFMA 1VQDA 4DR7L 1A62A 1IYJB 4AYBE 1X3FA 1MKHA 3ULPA 1VQKA 5GADC 4DV4L 4C3JH 1PH8A 4A3GH 4LUOA 1N32Q 1FL0A 2HIVA 5GQOA 2IX0A 3M4OH 2DUDA 4H02A 4APVA 1X3GA 1L2FA 4YCWA 4UP8A 2JA7H 1XPUA 3AFPA 1JJGA 2VUMH 2I5MX 1PYSB 1QZGA 2KCTA 2GN5A 3S15H 3NENA 4DR3Q 3ZJYC 5H1SE 4EQ5A 4MZ9A 3EBEA 1OXTA 2UU9L 3S1QH 2A19A 3EN2A 4GLAC 4X65L 2A8VA 2KENA 1SN8A 3ER0A 1G291 2CWPA 4AH6A 2Q2HA 3T1YQ 4JV5Q 3S14H 3HOXH 5M3MH 3PF5A 3I4NG 3I4MG 4DV3Q 3M7NA 1WFQA 1IBLQ 1J6QA 3S24A 1MJEA 3CP0A 4MNOA 1YBYA 2MFIA 1HZAA 3MEFA 3PCOB 5IWAL 1XMOQ 1IBMQ 4JI3Q 2R7ZH 1X55A 3TREA 3CXCA 1HNXQ 3W5OA 4DR7Q 1JE5A 2CWAA 3HOUH 5FJ8G 2UUBL 1PFSA 4DAYB 4DR2L 2JA6G 4JYAQ 4X66L 4IPGA 1K0RA 4A3JG 3CPFA 1M1KC 2K5VA 2LXJA 1TWHH 2NN6I 2RHSB 1M90C 1B8AA 4DV4Q 2NVXH 4HJAA 1OXVA 2JA8H 1S72A 3FHWA 1N34L 1XMQQ 4DV1L 2JQOA 5C4XH 1EIYB 2PQAA 3EIVA 5LMNW 2I5LX 1K83H 3Q8DA 4B3SL 4IJLA 4EX5A 3I7FA 3E0EA 5JEAJ 1VQLA 4WJ4A 1HZ9A 1UEBA 4IJHA 4BBRH 3RR5A 2PMZE 3UE1A 1KRTA 2E8GA 3U50C 1YNXA 1HR0W 4WJ3M 4QY7A 1YZ6A 2ZTDA 1GD7A 2UU9Q 1WOCA 4JOIA 1R9TH 4X65Q 2D62A 2YU9H 1YVCA 4MTNA 4B3TL 1VS0A 2A1AA 2IHEA 3GTGH 1UE1A 1KL9A 2KHIA 3H3VI 5IY0A 1IZ6A 1V9PA 2ID0A 4XTCS 5IWAQ 4HIKA 1VQIA 1U5KA 2BH8A 3I55A 1X65A 2ES2A 3BZKA 3M3YH 4A3LG 1B70B 4JI1L 3K81C 2N49A 2VW9A 4IO9A 3TQYA 1X54A 4DR2Q 2UUBQ 4OO1I 3FKIH 4X66Q 3F2DA 2PI2A 2Y0SE 3KLWA 1HNWQ 1TWGH 2KCMA 1PV4A 1VCIA 2Z0SA 1NBWA 4GOPC 1HR0Q 2E5LL 1I5FA 3LGJA 1Q1EA 4JBWA 4R4IA 4A75A 2IX1A 1SR3A 4AYBG 2K14A 2K50A 1VQMA 4DV1Q 1BBUA 4HIOA 2C35B 3CPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAW A;  3U4V A;  1VQG A;  3HOU G;  3I4N H;  4P71 A;  1VQ5 A;  3HOZ H;  4B3S Q;  3RLO A;  4NXM L;  2NZH A;  3PO2 G;  2OWO A;  4JC0 A;  3RN5 A;  3B6Y A;  2BA1 A;  1FVI A;  3PSI A;  4HIM A;  3RLF A;  5K36 G;  2JEB I;  2JA8 G;  2VZA A;  1W2B A;  2JA5 G;  4GLV B;  4KI0 A;  3S1N H;  1CKN A;  3CW2 C;  5FJ8 H;  3A5U A;  2RHQ B;  3J80 i;  1SFO H;  2JA6 H;  2UXB L;  1BVS A;  1GKH A;  5C4X G;  3S17 H;  4A3J H;  1K8A C;  5AJ3 L;  1PH2 A;  4B3T Q;  4IFD I;  4DV3 L;  3OW2 A;  1L0W A;  4JI8 L;  1N8R C;  4LWC A;  5BR8 L;  3S1R H;  2EIF A;  3UDX A;  2K52 A;  3TRZ A;  1VQH A;  3BU2 A;  1IBM L;  4JBM A;  1GM5 A;  4L5R C;  1SRU A;  3RLN A;  1FJG L;  1YHQ A;  1Z9F A;  3CCV A;  4Y52 H;  5HY6 A;  4KLK A;  1JMC A;  4JI1 Q;  4DNI A;  1D8L A;  2CCZ A;  2IT1 A;  3RNU A;  2CKZ B;  4AQY Q;  4PZ8 A;  2Q2U A;  2D0P A;  5IP9 G;  1CKM A;  2OQK A;  1VQ7 A;  2WB1 E;  2E5L Q;  1XMQ L;  4DPG A;  1L1O A;  1I6H H;  1D7Q A;  1QUQ A;  1XJV A;  1TWC H;  1KRS A;  4C3I H;  5HGQ A;  3CF5 A;  3KYH C;  3KDF A;  3HFZ B;  4DUY L;  4C2M H;  4DV6 L;  4RMF A;  2UUC L;  4NXN L;  2AWN A;  4ME3 A;  1IBK L;  4A3B G;  3G48 A;  5M5W H;  1Q82 C;  3F2C A;  1EYG A;  4B3R L;  4NXM Q;  3FKI G;  4P72 A;  1S40 A;  4O0A A;  2VQF Q;  1CKO A;  4DAM A;  2YTX A;  3CAM A;  3BZC A;  3K7A H;  3M4P A;  2WFW A;  2VNU D;  3UDF A;  3T1H L;  1I50 H;  4OWT B;  1PYB A;  5ELN A;  4YWK A;  4A4I A;  4HJ5 A;  4OWW B;  4A3L H;  1NMF A;  4LFA L;  2HIX A;  2ATW A;  1CUK A;  2PNH A;  2MO0 A;  3CCJ A;  2JEA I;  2OCE A;  1A0I A;  1CSQ A;  4UY8 C;  4DR4 L;  5AJ3 Q;  3TS0 A;  4X62 L;  3G4S A;  3HOZ G;  1VQN A;  3VDY A;  3KJP A;  3CD6 A;  2K4K A;  1E1O A;  1N9W A;  1P16 A;  1E1T A;  4JI8 Q;  1X3E A;  5BR8 Q;  1VQP A;  3M9B A;  2L15 A;  1PH7 A;  4OON A;  5C0X J;  3TS2 A;  2AHO B;  2KHJ A;  5EAY A;  2N8N A;  5C44 H;  3CCQ A;  5LMN L;  1VQE A;  1FJG Q;  5M5Y H;  1LTL A;  4C3H H;  1YJN A;  4JI0 L;  4BY7 G;  1Z47 A;  4JOI C;  1KQS A;  4GKJ L;  2K5N A;  4JI4 Q;  4LF9 L;  3H3V H;  2ZJQ A;  3FP9 A;  1I94 L;  4JI6 Q;  3PO2 H;  2EQS A;  4IFD G;  1HNW L;  1YIJ A;  1YI2 A;  1YJ9 A;  2K5H A;  4IFD J;  1HR0 L;  3E9I A;  3AFQ A;  4LFB L;  1O7I A;  1XNR L;  1E24 A;  1N36 Q;  1KIX A;  3HKZ E;  2R7F A;  3HOW G;  2JA5 H;  2OQ0 A;  3CC7 A;  3F2B A;  1Y1W G;  4A3D G;  2Y0S G;  1QVC A;  4DUY Q;  2PQA B;  1I3Q H;  4DV6 Q;  1Y14 B;  1YHB A;  5FLX c;  2UUC Q;  4NXN Q;  2V1C C;  1E7Z A;  2VL6 A;  1IBK Q;  2AKW B;  2I5H A;  4B3R Q;  1Q86 C;  4A3K G;  3SGI A;  1YJW A;  1NTG A;  4GLX A;  1K73 C;  1VQ8 A;  3AYH B;  4LFC L;  2LSS A;  2PI2 E;  5GRO A;  3H15 A;  1EFW A;  4JI7 L;  5IP7 H;  1K3R A;  3T1H Q;  2GVB A;  1YEZ A;  1PH1 A;  1RIP A;  1U0L A;  2ZJR A;  2IY5 B;  4LFA Q;  1X56 A;  2NN6 G;  4QJF A;  3HOV G;  4DR4 Q;  4X62 Q;  5IP9 H;  4A3F H;  2HHH L;  4LF6 L;  3HOY H;  2YV5 A;  4HJ9 A;  1XNQ L;  4X64 L;  4LF8 L;  1SE8 A;  1JT8 A;  4LUZ A;  1Q12 A;  2Z6K A;  1NJI C;  1N33 Q;  3DLL A;  2YTY A;  5LMN Q;  5J3B A;  2N3S A;  4J15 A;  4XIG S;  4JI0 Q;  1E22 A;  3L0O A;  5IYD G;  4POG A;  4A3B H;  4GKJ Q;  4LF9 Q;  3K80 C;  3CCR A;  4DV0 L;  4AQY L;  2UXB Q;  4GNX A;  1I94 Q;  2AWO A;  4DR1 L;  5IYC H;  1GO3 E;  3AQQ A;  4DR5 L;  4YCV A;  1HJP A;  4DR6 Q;  4LFB Q;  4X6A H;  1XPO A;  1XNR Q;  3M85 A;  1PA6 A;  4KHP L;  2NZO A;  2UXC L;  1OXX K;  5C44 G;  4BY1 H;  3I4O A;  4LF7 L;  3RZD H;  1VQO A;  1EQQ A;  3GTQ H;  1Q8K A;  5IT9 c;  2IHF A;  1YHA A;  2WB1 G;  3UE0 A;  3NEL A;  3MXN B;  1DGS A;  5IE8 A;  4PZ6 A;  2VQF L;  1JB7 A;  4YY3 Q;  2VQE L;  1HZB A;  2MO1 A;  2NVQ H;  1X6O A;  4JCV E;  2HQL A;  4O2D A;  4L5S A;  3J81 i;  4R4T A;  4JG2 A;  4LFC Q;  3WWV A;  5C3E G;  3J81 j;  1LM0 A;  4JI5 L;  1L1O C;  3GTM H;  4JI7 Q;  4BY7 H;  3STB D;  4OO1 G;  2R93 H;  5C0X I;  2VS1 A;  1KD1 C;  3I2Z A;  1CKN B;  2ASB A;  4YCU A;  2MQH A;  1KXL A;  3PUY A;  1PH3 A;  1C9O A;  4OX9 L;  2B3G A;  4R4O A;  2ZJP A;  2HHH Q;  4LF6 Q;  3GD7 A;  4GOP B;  5GAH C;  3HOW H;  4LF5 Q;  1XNQ Q;  4DK6 C;  1HZC A;  3NEM A;  5M5X H;  4X64 Q;  1HH2 P;  3CCL A;  5IYB H;  1NMG A;  4LF8 Q;  3CMA A;  3KFU A;  3S1M H;  1Y1W H;  4A3D H;  2WAQ E;  4BBS H;  3E9H A;  5IP7 G;  2R7D A;  3KF6 B;  3PIO A;  3S2D H;  1E3P A;  4JI4 L;  4JBK A;  1UE5 A;  3UDG A;  2ALY B;  4JI6 L;  1VQF A;  2B29 A;  1OXU A;  3S2H H;  4POF A;  4DV0 Q;  4IPC A;  5GAG C;  1BKB A;  4A3K H;  4DR1 Q;  4A3F G;  4GKK Q;  4DR5 Q;  3PO3 H;  2OTJ A;  3HOY G;  1N36 L;  2VY3 A;  4JI2 L;  3ERS X;  3HKS A;  1Y1V H;  2BA0 A;  4KHP Q;  1L1O B;  1VQC A;  1HNZ Q;  2UXC Q;  4LF7 Q;  4P75 A;  1G6P A;  4YHH Q;  5C4J H;  1C7Y A;  3J80 c;  1Q1B A;  1Q7Y C;  1A8V A;  2B63 G;  3HOV H;  3GTP H;  5JJL A;  3HKZ G;  1WYD A;  3H0G G;  4IOA A;  1T9H A;  5IYC G;  4UP7 A;  5ELO A;  4DV7 L;  4GN3 B;  2VQE Q;  1H95 A;  1NY4 A;  3GTL H;  4PZ7 A;  3K0X A;  4P74 A;  4JI5 Q;  1CSP A;  4QGU A;  2R92 H;  4BY1 G;  1LUZ A;  5IYD H;  1AE2 A;  2OTL A;  2JK8 A;  2E2J H;  2JJQ A;  1EIF A;  4ALP A;  2RCN A;  3PUX A;  5E7N A;  5FLM H;  3I56 A;  5JEA G;  3JC6 6;  4NPS A;  4OX9 Q;  3A5Z B;  1SRO A;  4DK3 C;  3PF4 A;  4PMW A;  2MNA A;  2RF4 A;  3OTO L;  4HID A;  1UE7 A;  3D31 A;  4QQB X;  2GVA A;  4BA1 I;  1J5E L;  1X9N A;  1N33 L;  1VQ6 A;  4BXX G;  4DV2 L;  3KOJ A;  4TVA B;  2R93 G;  4YWL A;  2F4V L;  1EUJ A;  1LYL A;  3CCE A;  2LXK A;  1QVG A;  1EWI A;  3J7Z C;  1G51 A;  2QGQ A;  1AH9 A;  1K9M C;  2H5X A;  4K0K L;  3L7Z C;  4A3E H;  1PH5 A;  1EQR A;  2R6G A;  4NB3 A;  3W1B A;  4LF4 L;  3J7A 5;  4DR6 L;  2E2I H;  5C3E H;  4JI2 Q;  1WJJ A;  2Q2I A;  2Q2T A;  1TWF H;  3G71 A;  1S3O A;  1VQB A;  1VQ9 A;  5IYB G;  2ZM6 L;  2Z6K C;  1IXR A;  3K8A A;  3L2P A;  4A3I H;  3RN2 A;  4A3M H;  4BBS G;  2UXD L;  4QL5 A;  1WCM G;  3F1Z A;  4IPH A;  1VQ4 A;  2N78 A;  1JJ2 A;  5M3F G;  3AEV A;  1IL2 A;  2EXD A;  1VQA A;  2XGT A;  3A0J A;  3STB C;  2F52 A;  4YY3 L;  3M4Q A;  4GNX C;  1PH4 A;  4LNQ A;  1RL2 A;  4DV7 Q;  2UUA L;  3S16 H;  2HT1 A;  5DLQ E;  3PO3 G;  1V1Q A;  4IOC A;  4HJ7 A;  1TXY A;  1Y1V G;  3PUW A;  3ICE A;  3GO5 A;  3PUZ A;  2D0O A;  4LW1 A;  4GS3 A;  1Q81 C;  1SLJ A;  3D0F A;  4OXP A;  3U58 A;  4B3M L;  4A3C G;  4A93 G;  3DM3 A;  5JJK A;  4LF5 L;  3CCM A;  4A76 A;  3OTO Q;  1QVF A;  2QEX A;  4DV5 L;  1J5E Q;  3KF8 B;  2ZTC A;  4DV2 Q;  3K7U C;  1PH6 A;  1OXS C;  3ULL A;  4L5T A;  2R92 G;  3PIP A;  4A3G G;  1ASZ A;  2B63 H;  1XTD A;  4R4C A;  3U4Z A;  4UPA A;  4DKA C;  4DUZ L;  2E2H H;  2BH2 A;  2F4V Q;  5LMU L;  3H0G H;  2WP8 J;  4K0K Q;  1P8L A;  4GNX B;  5FLM G;  4TQU S;  2JA7 G;  4GKK L;  2WAQ G;  2K75 A;  3NBH B;  3CC4 A;  2NVT H;  1JJC B;  3IRB A;  4LF4 Q;  2VUM G;  3RZO H;  1QZH A;  1HNZ L;  4L5Q A;  4YHH L;  2JE6 I;  3W1G A;  2ZM6 Q;  4HJ8 A;  1C0A A;  3PUV A;  4IPD A;  1UWV A;  2YYZ A;  1KC8 C;  4BA2 I;  4LUV A;  2UXD Q;  1PHJ A;  1Q46 A;  4GN5 A;  3PGZ A;  3GTK H;  3GTO H;  3GTJ H;  3CME A;  1MJC A;  1W3S A;  3G6E A;  4A3E G;  3CC2 A;  1EOV A;  3CQZ H;  3PV0 A;  4P73 A;  4KHZ A;  1MIU A;  2XTI A;  2UUA Q;  1GVP A;  4BXX H;  1XPR A;  1PVO A;  1N32 L;  1K8G A;  5GAE C;  5M3M G;  3HOX G;  2F3I A;  4JBJ A;  2YTV A;  3CCU A;  4A3I G;  4A3M G;  4PG3 A;  1FGU A;  2CQO A;  2DGY A;  1ASY A;  1OTC A;  2I0Q A;  1KHI A;  2FXQ A;  1N34 Q;  2R7Z G;  3KJO A;  4B3M Q;  3JAM i;  1V43 A;  3ULJ A;  4DR3 L;  2NVY H;  3I4M H;  4OWX B;  1SMX A;  3OYY A;  4DV5 Q;  2KBN A;  4AIM A;  2ZTE A;  1WCM H;  2AMC B;  4YWM A;  1NE3 A;  2JA9 A;  1BBW A;  1B7Y B;  4FDB A;  5M3F H;  4DUZ Q;  5LMU Q;  4RG1 A;  4Y7N H;  3CCS A;  1PH9 A;  1YIT A;  4JV5 L;  3T1Y L;  5C0X G;  3J81 c;  4R4Q A;  1QUQ B;  1IBL L;  1TWA H;  4GOP A;  4GN4 B;  3KDF B;  3TEH B;  1A63 A;  1VQJ A;  4R1J A;  4JI3 L;  3UDI A;  4BBR G;  4JYA L;  1XMO L;  4QIW E;  1HNX L;  3BJU A;  4UP9 A;  1UE6 A;  4A3C H;  5JJI A;  4A93 H;  2QA4 A;  1AE3 A;  3F8T A;  3GDE A;  3KF6 A;  1WI5 A;  3A74 A;  3JAM c;  2CFM A;  1VQD A;  4DR7 L;  1A62 A;  1IYJ B;  4AYB E;  1X3F A;  1MKH A;  3ULP A;  1VQK A;  5GAD C;  4DV4 L;  4C3J H;  1PH8 A;  4A3G H;  4LUO A;  1N32 Q;  1FL0 A;  2HIV A;  5GQO A;  2IX0 A;  3M4O H;  2DUD A;  4H02 A;  4APV A;  1X3G A;  1L2F A;  4YCW A;  4UP8 A;  2JA7 H;  1XPU A;  3AFP A;  1JJG A;  2VUM H;  2I5M X;  1PYS B;  1QZG A;  2KCT A;  2GN5 A;  3S15 H;  3NEN A;  4DR3 Q;  3ZJY C;  5H1S E;  4EQ5 A;  4MZ9 A;  3EBE A;  1OXT A;  2UU9 L;  3S1Q H;  2A19 A;  3EN2 A;  4GLA C;  4X65 L;  2A8V A;  2KEN A;  1SN8 A;  3ER0 A;  1G29 1;  2CWP A;  4AH6 A;  2Q2H A;  3T1Y Q;  4JV5 Q;  3S14 H;  3HOX H;  5M3M H;  3PF5 A;  3I4N G;  3I4M G;  4DV3 Q;  3M7N A;  1WFQ A;  1IBL Q;  1J6Q A;  3S24 A;  1MJE A;  3CP0 A;  4MNO A;  1YBY A;  2MFI A;  1HZA A;  3MEF A;  3PCO B;  5IWA L;  1XMO Q;  1IBM Q;  4JI3 Q;  2R7Z H;  1X55 A;  3TRE A;  3CXC A;  1HNX Q;  3W5O A;  4DR7 Q;  1JE5 A;  2CWA A;  3HOU H;  5FJ8 G;  2UUB L;  1PFS A;  4DAY B;  4DR2 L;  2JA6 G;  4JYA Q;  4X66 L;  4IPG A;  1K0R A;  4A3J G;  3CPF A;  1M1K C;  2K5V A;  2LXJ A;  1TWH H;  2NN6 I;  2RHS B;  1M90 C;  1B8A A;  4DV4 Q;  2NVX H;  4HJA A;  1OXV A;  2JA8 H;  1S72 A;  3FHW A;  1N34 L;  1XMQ Q;  4DV1 L;  2JQO A;  5C4X H;  1EIY B;  2PQA A;  3EIV A;  5LMN W;  2I5L X;  1K83 H;  3Q8D A;  4B3S L;  4IJL A;  4EX5 A;  3I7F A;  3E0E A;  5JEA J;  1VQL A;  4WJ4 A;  1HZ9 A;  1UEB A;  4IJH A;  4BBR H;  3RR5 A;  2PMZ E;  3UE1 A;  1KRT A;  2E8G A;  3U50 C;  1YNX A;  1HR0 W;  4WJ3 M;  4QY7 A;  1YZ6 A;  2ZTD A;  1GD7 A;  2UU9 Q;  1WOC A;  4JOI A;  1R9T H;  4X65 Q;  2D62 A;  2YU9 H;  1YVC A;  4MTN A;  4B3T L;  1VS0 A;  2A1A A;  2IHE A;  3GTG H;  1UE1 A;  1KL9 A;  2KHI A;  3H3V I;  5IY0 A;  1IZ6 A;  1V9P A;  2ID0 A;  4XTC S;  5IWA Q;  4HIK A;  1VQI A;  1U5K A;  2BH8 A;  3I55 A;  1X65 A;  2ES2 A;  3BZK A;  3M3Y H;  4A3L G;  1B70 B;  4JI1 L;  3K81 C;  2N49 A;  2VW9 A;  4IO9 A;  3TQY A;  1X54 A;  4DR2 Q;  2UUB Q;  4OO1 I;  3FKI H;  4X66 Q;  3F2D A;  2PI2 A;  2Y0S E;  3KLW A;  1HNW Q;  1TWG H;  2KCM A;  1PV4 A;  1VCI A;  2Z0S A;  1NBW A;  4GOP C;  1HR0 Q;  2E5L L;  1I5F A;  3LGJ A;  1Q1E A;  4JBW A;  4R4I A;  4A75 A;  2IX1 A;  1SR3 A;  4AYB G;  2K14 A;  2K50 A;  1VQM A;  4DV1 Q;  1BBU A;  4HIO A;  2C35 B;  3CPW A; 
#chains in the Genus database with same CATH topology
 3U4V A;  1VQG A;  1EYC A;  3PQI A;  4B3S Q;  3RLO A;  2E76 C;  2NZH A;  2PQE A;  2BA1 A;  1BCP D;  1SEB D;  3S1R B;  4HIM A;  2JA8 G;  2AQ2 B;  2M00 A;  3OPO A;  1SFO H;  2JA6 H;  1BVS A;  5FOB B;  5AJ3 L;  3MA2 B;  4R8N A;  1N8R C;  5BR8 L;  5A35 A;  5EBD A;  1YHQ A;  4Y52 H;  5HY6 A;  4KLK A;  1SXT A;  5FO7 B;  3SE0 A;  3S15 B;  4IZ8 A;  2D0P A;  2F0G A;  1F9R A;  1VQ7 A;  2WB1 E;  3K7A B;  2KA7 A;  2XWB B;  2EYH A;  2NN6 H;  3KDF A;  1B3Q A;  3KYH C;  1KLG D;  4C2M H;  2UUC L;  4NXN L;  2AWN A;  3BDO A;  4A3B G;  4BS9 A;  5M5W H;  5EKL A;  4P72 A;  3K5N A;  4O0A A;  1MHW C;  1CKO A;  2BDN A;  1EY5 A;  3DWQ A;  3PIO 3;  3T1H L;  4KY5 A;  1PYB A;  4HJ5 A;  1FNW A;  1ET9 A;  1SAP A;  2XSC A;  3CCJ A;  4DR4 L;  1A0I A;  2TMP A;  3TS0 A;  3VDY A;  2PZU A;  2K4K A;  1N9W A;  1X3E A;  1VQP A;  1PTO C;  5C0X J;  3LWU A;  5IIF A;  2JA8 B;  5M5Y H;  4DK1 A;  2K5N A;  3FP9 A;  2QDB A;  1HNW L;  2EY1 A;  2RQX A;  1YJ9 A;  2F0L A;  2K5H A;  3E9I A;  5FKA C;  3HKZ E;  3RD4 A;  2IWH A;  1IKL A;  4OO1 H;  4A3D G;  2Y0S G;  4LJZ C;  2O5J C;  4IN3 A;  5ELF A;  1L0Y B;  1E7Z A;  4ZK9 B;  4B3R Q;  3K5L A;  1X3Q A;  2DJG C;  1YJW A;  1S5D D;  3DEP A;  4GLX A;  1VQ8 A;  3CKI B;  2LSS A;  1HPC A;  2MPM A;  5IP7 H;  2GVB A;  1ENF A;  1AFP A;  2ZJR A;  2IY5 B;  2NB0 A;  1AZQ A;  4RHS A;  3MWY W;  3CRL C;  4A3B B;  3HOV G;  4HCE A;  2HHH L;  5IP9 H;  4LF6 L;  1XNQ L;  4X64 L;  3W2D A;  1SE8 A;  1SYD A;  3BDL A;  3KF8 A;  3T4A C;  5J39 A;  5J22 A;  4KV6 A;  2NTS A;  3NBI A;  4AQY L;  4EGV A;  1RDP D;  1F9P A;  1GO3 E;  3AQQ A;  4O42 A;  1PMR A;  3P1H A;  1XPO A;  1XNR Q;  4LK1 C;  1OXX K;  1SYB A;  4HAE A;  3M4O B;  3GTM B;  5COR A;  3GTQ H;  1Q8K A;  5JEA H;  1M8A A;  3MXN B;  1DGS A;  1R4Q B;  4JCV E;  2HQL A;  1DJR D;  4JG2 A;  4BY7 H;  4JI5 L;  1L1O C;  3MXG A;  4ZKB B;  3I2Z A;  2ASB A;  4A3D B;  1JQY D;  1R4P B;  2F0O A;  2Y0S B;  4F88 A;  4YCU A;  3S9W A;  2B3G A;  4UAI A;  5E4X A;  4K8J A;  3HOW H;  4ABN A;  1G2S A;  5I9P A;  3NEM A;  2EY2 A;  4X3U A;  4LF8 Q;  5IYB H;  1NMG A;  3CMA A;  2PZT A;  1Y1W H;  4BBS H;  2A5H A;  1KDB A;  1I6H B;  1GHJ A;  2A69 C;  3PIO A;  1E3P A;  4G57 A;  3QR8 A;  4JI6 L;  1VQF A;  2B29 A;  2WV6 D;  4WOR A;  3S2H H;  3HOV B;  4DR1 Q;  1CA5 A;  1B9N A;  4A3F G;  4DR5 Q;  3PO3 H;  3HOY G;  4JI2 L;  3HKS A;  1Y1V H;  1L1O B;  3MC0 B;  4KD4 A;  4P75 A;  1G6P A;  4YHH Q;  1I50 B;  1A8V A;  2H4O A;  1WYD A;  3H0G G;  4IOA A;  1EEF D;  1J9O A;  5IYC G;  5ELO A;  3TDQ A;  2VQE Q;  1NY4 A;  3GTL H;  4I7Z C;  4DF7 A;  1DXM A;  5IYD H;  3UI2 A;  2JK8 A;  2JJQ A;  1EIF A;  5BN3 A;  3EJI A;  5E7N A;  5FLM H;  3NTI A;  4OX9 Q;  3QOJ A;  3A5Z B;  1SRO A;  3PF4 A;  3OTO L;  1UE7 A;  3AU7 A;  1X9N A;  2XRS D;  4BXX G;  4DV2 L;  4EVO A;  1TWF B;  1VF5 C;  4TVA B;  1EZ8 A;  3I4L A;  5EPK A;  1EWH A;  3LWE A;  4YWL A;  1HUM A;  3NWT A;  1LYL A;  1EIG A;  1QVG A;  3OWE B;  3J7Z C;  1AH9 A;  4K0K L;  5IOD A;  3FVQ A;  1PH5 A;  3URY A;  1ILP A;  5C3E H;  4K14 A;  1KDC A;  4A3I H;  4A3M H;  2ZT9 C;  4FVM A;  1WCM G;  1VQ4 A;  2SNM A;  1QE6 A;  1DOK A;  4RKL A;  3A0J A;  2EXD A;  3STB C;  1SNM A;  1D5M C;  2F52 A;  3FPP A;  3M4Q A;  4YY3 L;  4LNQ A;  2NUC A;  4A3F B;  4DAY A;  2UUA L;  2IPK D;  3EA6 A;  5DLQ E;  3VYS A;  3HOY B;  4IOC A;  4LMQ D;  4Q0F A;  2D0O A;  4C1N I;  1HA6 A;  1Q81 C;  2EYO A;  3T53 B;  2F0U A;  3D4W A;  5C0X H;  3CCM A;  2K04 A;  3C2P A;  1DM0 B;  1I4R A;  2F0S A;  4CBV A;  4KK7 A;  2F0H A;  3HZX A;  3ULL A;  1PH6 A;  1PLF A;  2IJ0 A;  3G6J B;  4OL7 A;  1Y8N B;  4QF4 A;  5LMU L;  2CW0 D;  5CMD A;  1TS4 A;  4GKK L;  5DNF A;  3NBH B;  1YNJ C;  2JE6 I;  3W1G A;  5LHY 1;  1HQR D;  1KC8 C;  1MGS A;  3P20 A;  3PGZ A;  2I07 B;  1SMY C;  3CME A;  2EJF C;  3E0J A;  4A3E G;  3KBX A;  4NDX A;  3V96 A;  1UNS A;  1VMP A;  3SK8 A;  3TP8 A;  5CBE E;  1XPR A;  1WD0 A;  5M3M G;  2YTV A;  1HCZ A;  1FGU A;  2CQO A;  1WCM B;  2DGY A;  4CJ0 B;  1OTC A;  3S2D B;  1N34 Q;  2FXQ A;  3A55 A;  3BYT B;  4B3M Q;  3JAM i;  4IAL A;  4DXF A;  2KOL A;  2QEJ C;  3I4M H;  3ITP A;  2M2L A;  5DM6 3;  1B7Y B;  2SOB A;  3HG9 A;  3MXU A;  2F0I A;  1ICF B;  5EQ0 A;  1ZYR C;  4FYD A;  1A3U A;  1SE4 A;  3KDF B;  1A63 A;  2LFN A;  4JI3 L;  3UDI A;  4JYA L;  4R9W A;  2B2V C;  4QIW E;  1CFM A;  4DAV A;  3BVZ A;  4UP9 A;  1UE6 A;  1Q90 A;  5KRU A;  3KF6 A;  1WI5 A;  3A74 A;  1STG A;  2CFM A;  1VQD A;  1ICW A;  1IYJ B;  1GUW A;  3ULP A;  2G9H D;  3A7A B;  4LUO A;  4WJW A;  1FL0 A;  1PH8 A;  2IX0 A;  2DUD A;  4APV A;  4RHR A;  4I65 A;  4YCW A;  4B9W A;  5E1F A;  2L9H A;  3S1Q B;  4A3E B;  2VUM H;  1PYS B;  2B8F A;  2F0Q A;  3S15 H;  1GXD C;  2E2I B;  2B2U C;  5M3M B;  4EQ5 A;  2N55 A;  1TY0 A;  1TVX A;  1T5E A;  1OXT A;  2UU9 L;  4GLA C;  4X65 L;  1SN8 A;  3SEB A;  3M7N A;  2WKC A;  3VR2 A;  1DOL A;  4DV3 Q;  1GOZ A;  3QIA A;  2R7Z H;  1DOM A;  1X55 A;  3TP7 A;  1JOK A;  3AMU A;  2CWA A;  5FJ8 G;  2UUB L;  4RFB A;  3MEH A;  5CGK A;  4X66 L;  1SND A;  3CPF A;  4XQN A;  1M90 C;  4UDU C;  1OXV A;  2JA8 H;  2ICI A;  4DV1 L;  1GUN A;  4DN4 M;  1EIY B;  2I5L X;  1RCV D;  1R9T B;  4B3S L;  4IJL A;  4QB4 A;  5I2Y A;  2RDG A;  1UEB A;  4IJH A;  3WDN A;  1KRT A;  3U50 C;  1YNX A;  5C5M A;  2BE5 C;  2CH4 W;  3KUP A;  3R93 A;  4F87 A;  4HMJ A;  5IOC A;  1WOC A;  1XXG A;  3GTK B;  3GQB A;  4C3I G;  1JWS D;  1YVC A;  4MTN A;  1EYA A;  5D65 A;  3M3Y B;  1KNA A;  2A1A A;  4N9T A;  3MVV A;  1IZ6 A;  1V9P A;  1VQI A;  2B2T C;  1JC7 A;  2ES2 A;  1VDZ A;  1EZ6 A;  2B2Y A;  2VW9 A;  2N49 A;  3O13 A;  2KCM A;  4Q5V A;  4GOP C;  3M7G A;  1Q1E A;  4A75 A;  4AYB G;  2KED A;  2HD3 A;  2K50 A;  1VQM A;  1M4V A;  3J80 L;  1BBU A;  4HIO A;  1KAW A;  1VQ5 A;  2DJF C;  3MXN A;  2MHV A;  5CV4 A;  3I3C A;  3RN5 A;  1FVI A;  2XRQ D;  2PZW A;  3DEO A;  2E74 C;  5K36 G;  2VZA A;  1JB3 A;  4EQO A;  5KGU A;  5C3X A;  3A5U A;  5TSS A;  1X32 A;  3S17 H;  4A3J H;  1PH2 A;  1U4R A;  1B50 A;  4LWC A;  4MIU A;  5JOB A;  1HFN A;  5EKK A;  3TRZ A;  1VQH A;  3BU2 A;  1F77 A;  3RLN A;  4ZUJ A;  4C3I B;  4JI1 Q;  4DNI A;  1A3V A;  3X3N A;  2IT1 A;  2CKZ B;  4PZ8 A;  4ME5 A;  5ELD A;  3T16 A;  2KCN A;  1MSG A;  1L1O A;  2K28 A;  4DPG A;  4IUQ A;  1XJV A;  1QIL A;  1I6H H;  2HDM A;  3QG1 A;  2L0C A;  1AZP A;  4RMF A;  5ELC A;  2Z4I A;  4B3R L;  3F2C A;  1S40 A;  2VQF Q;  2F1M A;  1IYV A;  3CAM A;  5KNC A;  1JOR A;  4RKB A;  5D3D A;  1DYQ A;  1I50 H;  4AYB B;  4OWT B;  5ELN A;  5KEE A;  4A3L H;  1OO9 B;  4EQN A;  5COY A;  2ATW A;  3J80 E;  3SK6 A;  1CSQ A;  4UY8 C;  1Q8I A;  4RGT A;  3G4S A;  3CD6 A;  3KJP A;  1E1O A;  4JI8 Q;  1E1T A;  4OON A;  2KHJ A;  5EAY A;  3CCQ A;  4CDD C;  3PMF A;  1KQS A;  1G91 A;  4PMC A;  3H3V H;  3PO2 H;  2EQS A;  1Z6H A;  3ERQ A;  3AFQ A;  3D6C A;  1O7I A;  5FO8 B;  2FJ2 A;  1E24 A;  1XNR L;  1MBY A;  1N36 Q;  5M9O A;  2JA5 H;  2SNS A;  3CC7 A;  2KHS A;  3F2B A;  5L37 A;  1QVC A;  4DUY Q;  2V4D A;  2PQA B;  1I3Q H;  4OEM B;  1LT5 D;  5C4Z A;  4P2C B;  4KKT A;  2V1C C;  1IBK Q;  2BDO A;  2AKW B;  4C1N K;  1ET6 A;  4A3K G;  3P75 A;  3OSO A;  5GRO A;  3HP3 A;  1C8C A;  1RIP A;  1LT4 D;  1PRT F;  1KDA A;  4LFA Q;  1HTP A;  3TBI B;  1PZI D;  4QJF A;  1BNZ A;  2A68 C;  1T5X D;  4X62 Q;  4A3F H;  3FPU B;  3HOY H;  3V2T A;  4HJ9 A;  1CI3 M;  3U9O A;  4LF8 L;  1EYD A;  1Q12 A;  2JSO A;  1N33 Q;  2KUM A;  5LMN Q;  2N3S A;  4XIG S;  4JI0 Q;  1E22 A;  4RCO A;  3L0O A;  5IGC A;  1CQF A;  1NSN S;  4K2L A;  3D3R A;  1BR9 A;  3BZD B;  4DK0 A;  4DR1 L;  5IYC H;  5I2X A;  4DR5 L;  1HJP A;  2K05 A;  4LFB Q;  4DA2 A;  3SDZ A;  2NZO A;  5CV9 A;  2F03 A;  1GUT A;  2D9U A;  1CZG A;  4DNT B;  4C3H G;  4XXE A;  1EQQ A;  5IT9 c;  2IX3 A;  1SNP A;  2WB1 G;  4BWG B;  1JB7 A;  2VQE L;  1HZB A;  2NVQ H;  1VQ6 A;  4O2D A;  4L5S A;  4LFC Q;  4JW0 A;  3PIP 3;  4JI7 Q;  4CKE A;  1GHK A;  1S5E D;  1FNV A;  5T1I A;  3Q6S A;  1C9O A;  1PH3 A;  4OX9 L;  1G2T A;  2OXP A;  5KNB A;  5GAH C;  4A3K B;  5M5X H;  4XQQ A;  4IFD I;  2NTT A;  2WAQ E;  3S2D H;  2R7D A;  3KF6 B;  3CU7 A;  4JI4 L;  1TWC B;  3UDG A;  4IUT A;  2VB3 X;  5C4J B;  2JP1 A;  4K8I A;  3X3M A;  4DNR B;  2OTJ A;  3BDC A;  2EOT A;  4KHP Q;  3VA7 A;  2UXC Q;  3VR3 A;  1NR4 A;  3J80 c;  3GV3 A;  5BN4 A;  2B63 G;  2E2J B;  2CHB D;  5ELE A;  3HKZ G;  3KLR A;  1NCV A;  1SNC A;  1T9H A;  4UP7 A;  4GN3 B;  4OIK A;  3SK4 A;  5NUC A;  1LT3 D;  5IGD A;  5JPM C;  1LTI D;  4PNY A;  4KKS A;  4KY6 A;  1E2V A;  4C3H B;  1IW7 D;  1QWY A;  3PUX A;  3K59 A;  3V05 A;  2WB1 B;  4NPS A;  4HID A;  4KHV A;  3D31 A;  4QQB X;  2A6H D;  1FYC A;  1CTM A;  3G7L A;  3T51 B;  2R93 G;  4CDE C;  1L0X B;  2NZ1 D;  1EY9 A;  2B2V A;  1EUJ A;  4RGM A;  3CCE A;  1EWI A;  2QGQ A;  4A3E H;  1I4Q A;  2R6G A;  4DR6 L;  3W1B A;  4JVZ A;  2E2I H;  1Q3L A;  2CQA A;  3EFX D;  3K8A A;  2EYP A;  4X3S A;  1SE2 A;  3OIP A;  3I90 A;  3L9A X;  2B2Y C;  4ZLT F;  3AEV A;  2O2L D;  2F0D A;  1IL2 A;  2XGT A;  1RL2 A;  4DV7 Q;  3S16 H;  1MI2 A;  1PTO B;  2HT1 A;  2B2U A;  3PUW A;  2RKS A;  1U4M A;  2B63 B;  4CJ2 C;  1FGB D;  3HKZ B;  4B3M L;  3DM3 A;  1C48 A;  3K0Y A;  4LF5 L;  4A76 A;  1QVF A;  1GUG A;  5A2Q E;  2NVT B;  2ZTC A;  3RZO B;  2R92 G;  3PIP A;  1NNX A;  4R4C A;  4DKA C;  2F4V Q;  2E2H H;  2BH2 A;  2WP8 J;  4TQU S;  3GTO B;  3GTJ B;  1JJC B;  2K5Q A;  4LF4 Q;  1EWC A;  3CQZ B;  2OT2 A;  3KBG A;  4K6D A;  1QZH A;  1HNZ L;  4L5Q A;  1C4Q A;  1QG7 A;  2ZM6 Q;  4HED A;  2R93 B;  2YYZ A;  4KKU A;  4LUV A;  1RD9 D;  1HFG A;  3GTK H;  4ZUI A;  3G6E A;  3H94 A;  1EOV A;  3PV0 A;  4N8F A;  4G7H C;  1MIU A;  1LT6 D;  4V0B A;  1GVP A;  3VYU A;  1PVO A;  5GAE C;  3HOX G;  3S1M B;  2F3I A;  1D2B A;  3CCU A;  4KY7 A;  4PG3 A;  1ENC A;  2LMC B;  4NW2 A;  1ASY A;  1S5B D;  1JWM D;  3OIQ A;  3DXJ C;  1B3A A;  3KJO A;  1V43 A;  1ILQ A;  4TKO B;  3SR1 A;  2FMC A;  1S5C D;  3ULJ A;  3N6R A;  2NVY H;  3HS0 C;  1WTO A;  2TSS A;  1NE3 A;  2K03 A;  4OGQ C;  5M3F H;  2B2T A;  2PCF B;  4Y7N H;  3GTP B;  1BCP F;  2X6L A;  4B08 A;  1EL0 A;  3NK9 A;  4G7O C;  3KLS A;  1O80 A;  1BOS A;  5EKI A;  2DY8 A;  4GOP A;  1VQJ A;  4BBR G;  2R92 B;  1PRT C;  3BJU A;  4KMU C;  4A3C H;  1SJH D;  4FNF A;  4A93 H;  2WKD A;  2A6E D;  1AE3 A;  4IFD G;  1SYE A;  2ZXP A;  1A62 A;  1V1P B;  3NSW A;  1X3F A;  1LTS D;  1PYW D;  4A3G H;  1N32 Q;  1CQV A;  4FP5 D;  4H02 A;  2KQ3 A;  5D3I B;  2WII B;  2JA7 H;  1XPU A;  5FLX L;  5CYU A;  2I5M X;  2KCT A;  4DR3 Q;  3MTS A;  3HOX B;  1TQO A;  4RAU C;  4NKL A;  2D2C C;  1PRT B;  2Z9H A;  1ZEQ X;  1B9M A;  4L8J A;  3M4Y A;  4PV1 C;  1B53 A;  1CZW A;  3DUZ A;  4WRD A;  2F0V A;  3ER0 A;  1ENA A;  5G3L D;  4AH6 A;  3T1Y Q;  2Q2H A;  3QO2 A;  4ZAI A;  1JOQ A;  1SYF A;  1J6Q A;  1FNU A;  4IUP A;  4G4K A;  3S24 A;  1MJE A;  1JCK B;  2GA4 B;  1YBY A;  2MFI A;  1HZA A;  1XMO Q;  3TRE A;  3I8Z A;  4HMI A;  4DR7 Q;  1PFS A;  2JA6 G;  4IPG A;  1K0R A;  3EVQ A;  1K83 B;  1M1K C;  1AW7 A;  1H9J A;  2RHS B;  3IKJ A;  5K36 H;  4BBR B;  1S72 A;  1KNE A;  3J7A F;  1LTR D;  3H0G B;  2PQA A;  2XIW A;  5LMN W;  3Q8D A;  4EX5 A;  3I7F A;  1VQL A;  4IUU A;  4CGY B;  4WJ4 A;  4IUV A;  2PMZ E;  3R2I A;  1HR0 W;  1YNN C;  1SE3 A;  5KYL A;  1LTB D;  2D62 A;  2WIN B;  5FLX E;  1JR0 D;  3T13 A;  1F2Y A;  1BBX C;  1UE1 A;  2KEC A;  1CA6 A;  5IY0 A;  4XTC S;  4H44 C;  1U5K A;  1X65 A;  1EY4 A;  4JI1 L;  3R8B A;  5I6Y A;  4IO9 A;  5FO9 B;  4DR2 Q;  1HHV A;  1K8M A;  4JPB W;  1HNW Q;  1TWG H;  3C1E A;  1PV4 A;  2Z0S A;  1NBW A;  2IX1 A;  1D6E C;  1CHP D;  5CV7 A;  3DM1 A;  1PZJ D;  3HOU G;  3I4N H;  1SFO B;  2JA6 B;  2Z6B A;  2OWO A;  5C3W A;  1TWA B;  3RLF A;  4XDX A;  2JEB I;  2G9D A;  1W2B A;  3Q0A A;  1IYU A;  5C4X G;  1W6J A;  4KD3 A;  3J80 i;  2XVS A;  1GKH A;  5JVG 3;  2DY7 A;  5KYI A;  1JWU D;  5IGB A;  3K58 A;  4B3T Q;  1L0W A;  1GUO A;  4JI8 L;  3S1R H;  2K52 A;  1WD1 A;  4NMZ A;  1IBM L;  3C1F A;  1A2T A;  3CCV A;  4K5X A;  5DEH A;  1JMC A;  3AB9 A;  4C2M B;  3RNU A;  4AQY Q;  2CH4 A;  5M5W B;  5C5L A;  5IP9 G;  2OQK A;  2ICE C;  1E0B A;  1XMQ L;  2EPB A;  2OF1 A;  1D7Q A;  1QUQ A;  1BXT A;  3TSS A;  3IFT A;  1TWC H;  1KRS A;  2RDF A;  4DUY L;  4DGZ A;  3HFZ B;  2F0F A;  3SHL A;  3OMC A;  1IBK L;  1Q82 C;  1EU3 A;  4NXM Q;  3FKI G;  4QIW B;  3NHH A;  3BZC A;  3K7A H;  3M4P A;  2WFW A;  3BG3 A;  3UDF A;  3BVM A;  1F9S A;  3LX0 A;  4YWK A;  2P5Z X;  1NMF A;  4LFA L;  5M5Y B;  2HIX A;  1CUK A;  2PNH A;  2UXB Q;  3HOU B;  1Y69 U;  4X62 L;  3HOZ G;  2X69 A;  2NVX B;  3TS2 A;  4RGN A;  4RWS C;  5LMN L;  1VQE A;  1FJG Q;  4BY7 G;  1LTL A;  4C3H H;  2DNC A;  4JI0 L;  4JOI C;  5C4X B;  3L3O C;  2QCP X;  1VMC A;  2ZJQ A;  4JI6 Q;  1KTK A;  1YI2 A;  4IFD J;  2A69 D;  5JVH 3;  1HR0 L;  4LFB L;  2O5I C;  2EYM A;  4RGO S;  4U67 3;  1KIX A;  3HOW G;  4ZYS A;  2EZV A;  1Y1W G;  3RMH A;  1Y8O B;  5IT9 L;  4DV6 Q;  5FLX c;  1BCP C;  1G8Z D;  3SGI A;  2L12 A;  1NTG A;  1I4G A;  1K73 C;  3AYH B;  4LFC L;  5EPJ A;  2Z8L A;  2NYZ D;  5D14 A;  3H15 A;  1EFW A;  4JI7 L;  3FEW X;  1X3P A;  2J4X A;  3HGB A;  1BQQ T;  2VXW A;  3VR6 A;  1B4O A;  1PTO H;  3FKI B;  4V19 0;  4FF1 A;  1D5X C;  5E4W C;  3DLL A;  4ODG A;  5J3B A;  4J15 A;  4TSS A;  4A3B H;  5IYD G;  4GKJ Q;  1BCP B;  4LF9 Q;  4QUC A;  3CCR A;  4HR7 B;  1I94 Q;  2DNE A;  1NAP A;  2AWO A;  2Q8I B;  4DFA A;  3HOZ B;  3J7A V;  2SEB D;  3J81 L;  2K01 A;  3M85 A;  3NTH A;  1PA6 A;  4KHP L;  1TT2 A;  2UXC L;  4OIJ A;  4HTH A;  5C44 G;  3I4O A;  4FXG C;  2AUJ D;  4BY7 B;  4YIJ A;  1QOH A;  3S1N B;  2IHF A;  2LY7 A;  3KLS X;  1FD7 D;  3UE0 A;  3NEL A;  5IE8 A;  3F2U A;  4YY3 Q;  4X3T A;  3M4O H;  1XTC D;  3HOW B;  1ML0 D;  2L11 A;  3WWV A;  5C3E G;  3GTM H;  2R93 H;  3STB D;  1F9Q A;  1CKN B;  4H13 C;  1Y1W B;  1WTR A;  2QIL A;  2MQH A;  1KXL A;  5IT9 E;  1IKM A;  2XWJ B;  2K1B A;  3GD7 A;  1MD2 D;  4GOP B;  5LL6 X;  4UHV A;  1HZC A;  3S1M H;  1HH2 P;  3MZ5 A;  5HUR A;  4A3D H;  3E9H A;  4KJO A;  4JBK A;  1UE5 A;  2ALY B;  1OXU A;  4DV0 Q;  4IPC A;  5GAG C;  1GJX A;  5C6A A;  4GKK Q;  2ZXO A;  3ERS X;  3A56 A;  2BA0 A;  2PW5 A;  3GTL B;  4LF7 Q;  4U68 A;  1S4Z A;  1GUS A;  1V1O A;  1Q7Y C;  3HOV H;  3GTP H;  2F0E A;  4B9X A;  3ERO A;  1EY6 A;  4DV7 L;  1STB A;  1V1P A;  1F2Z A;  3E3X A;  1U4P A;  1UAP A;  5EGT A;  1H95 A;  3J81 E;  1CSP A;  4QGU A;  5C44 B;  2R92 H;  4BY1 G;  2F0J A;  1AE2 A;  2OTL A;  3NUC A;  4GZY C;  2RCN A;  4HN7 A;  3JC6 6;  2QF7 A;  4PMW A;  4M8A A;  2MNA A;  3OMG A;  1XX8 A;  3KOJ A;  5C3E B;  3ND9 A;  2F4V L;  1HRJ A;  2RSN A;  1BO0 A;  3CRK C;  1DD2 A;  1NUC A;  2H5X A;  5C4H A;  2O4X A;  2H1E A;  1NR2 A;  4LF4 L;  3J7A 5;  2Q2T A;  2Q2I A;  1TWF H;  2ZM6 L;  5JPN C;  2Z6K C;  5IGF A;  2MJ8 A;  3J7Y W;  4QCL A;  4R8I A;  4L6T B;  2AQ1 B;  1CK1 A;  5KND A;  1ZYR D;  3DWP A;  4GNX C;  1O7L A;  2JXM B;  5E3F A;  1PH4 A;  1HQM C;  1JOO A;  4L63 B;  4CJ1 B;  1V1Q A;  3ICE A;  1QJO A;  1EY0 A;  1XWE A;  1SLJ A;  3OOC A;  3U58 A;  2KCC A;  1EOT A;  2K33 A;  3FRP B;  1KLU D;  2QEX A;  1J5E Q;  5BN5 A;  4BY1 B;  1ASZ A;  5I4D A;  1XTD A;  3U4Z A;  1SJE D;  3RZD B;  3NP8 A;  3H0G H;  1A6X A;  1KAA A;  1I4H A;  4GNX B;  2A73 B;  4IFD H;  2WAQ G;  4H7B A;  3IRB A;  2MP1 A;  2VUM G;  2B39 A;  3A8J E;  3MFY A;  2B8G A;  2PW7 A;  2HUG A;  4YHH L;  3ZYY X;  2A6E C;  1C0A A;  4IPD A;  4BA2 I;  1UWV A;  2UXD Q;  4K5W A;  1U4L A;  5HGT A;  1W3S A;  1PXU A;  3MXP A;  4KHZ A;  2KJX A;  4BXX H;  1N32 L;  3OW7 A;  1K8G A;  3NXW A;  5AFW A;  1UUP A;  2I46 A;  1EFI D;  2R7Z G;  3VA5 A;  1LTG D;  2K5W A;  2R61 A;  2HCI A;  4K6L A;  4G7Z C;  4DR3 L;  4OWX B;  1SMX A;  4DV5 Q;  2KBN A;  2FFK B;  4AIM A;  1WCM H;  4MHE A;  4YWM A;  1STA A;  2L4N A;  2RBM A;  1BBW A;  4FDB A;  4DUZ Q;  2PPB C;  1HXY D;  3NQI A;  4RG1 A;  1TS5 A;  1PH9 A;  2BE5 D;  3MAQ A;  3T1Y L;  1LO5 D;  3J81 c;  1K3B C;  4R4Q A;  2L1B A;  2XNA C;  1QUQ B;  2JYO A;  1TWA H;  1WVL A;  5T1G A;  5CBA E;  3QJY A;  3TEH B;  2MUY A;  1XMO L;  2K32 A;  2FHT A;  5JJI A;  4DR7 L;  4DAP A;  3QOL A;  5A2Q L;  3JAM c;  2WAQ B;  4TRD A;  1MKH A;  1MSH A;  2VUM B;  1VQK A;  5GAD C;  3I73 A;  2HIV A;  5I9O A;  3NE5 B;  1EU4 A;  1X3G A;  1L2F A;  4MTK A;  2F4I A;  5EBC A;  3AFP A;  3A8I E;  5H1S E;  2CW0 C;  4MZ9 A;  3EBE A;  3OHX C;  3SXH A;  3S1Q H;  2J7Z A;  4PMB A;  1WTP A;  1LAC A;  2R7Z B;  3BYY B;  2Q8T A;  2A8V A;  4ILW A;  4JV5 Q;  3SK5 A;  3P7J A;  5M3M H;  1WTH A;  1IBL Q;  1BUV T;  3CHB D;  4FF3 A;  5CR3 A;  4Z9C B;  1HNX Q;  2VB2 X;  1SNO A;  3W5O A;  1HA5 A;  3BS1 A;  3HOU H;  4DR2 L;  1Y8P B;  2HCC A;  4A3J G;  1TS2 A;  1XYI A;  2K5V A;  2NN6 I;  2PO4 A;  4DV4 Q;  2NVX H;  4RH6 A;  4HSV A;  1W6K A;  1I4P A;  1RHP A;  3FHW A;  2Z1C A;  3KK7 A;  1N34 L;  2JQO A;  5C4X H;  3TP5 A;  2IW3 A;  1E2W A;  1JIC A;  3E0E A;  4O1N A;  1HZ9 A;  4C3J G;  3UE1 A;  4N8X 1;  4N9P A;  4WJ3 M;  1CHQ D;  1YZ6 A;  2K6A A;  1GD7 A;  2L5T A;  4JOI A;  1R9T H;  2EVB A;  4X3K A;  4B3T L;  1VS0 A;  2C5C A;  2IHE A;  3FDT A;  1IL8 A;  2Q8R E;  2QKI C;  3QWN A;  2ID0 A;  2E2D C;  5IWA Q;  4FF4 A;  4HIK A;  1FR3 A;  3I55 A;  3M3Y H;  4ZQ3 A;  3BZK A;  5LL6 S;  4A3L G;  1B70 B;  2Z4H A;  1X54 A;  5DM7 3;  4OO1 I;  3FKI H;  5JAV A;  2Y0S E;  5DAU A;  3KLW A;  1VCI A;  1G6Z A;  1I5F A;  1PFN A;  1SYG A;  3IFD A;  3LGJ A;  4R4I A;  1SR3 A;  2K14 A;  1F2L A;  5ISR A;  4LAA A;  2HDL A;  4P71 A;  3HOZ H;  1H9K A;  4NXM L;  3S17 B;  3FMC A;  4A3J B;  3PO2 G;  3BVG A;  4JC0 A;  3B6Y A;  4XYO A;  3NPP A;  3GV6 A;  3PSI A;  4S3S A;  1SBB B;  4J6H A;  1RTN A;  2JA5 G;  4GLV B;  4KI0 A;  3S1N H;  1CKN A;  3CW2 C;  5FJ8 H;  2RHQ B;  2UXB L;  3HEJ A;  1K8A C;  2F3W A;  4DV3 L;  3OW2 A;  1S5F D;  2EIF A;  3UDX A;  3WOE A;  4OEL B;  4C3J B;  4JBM A;  4L5R C;  3WOF A;  1GM5 A;  4CHT B;  2A68 D;  1SRU A;  1FJG L;  1I4X A;  1O7Y A;  1Z9F A;  3H6M A;  5EPL A;  3RUZ A;  1STN A;  1LLR D;  1D8L A;  3SVM A;  1AN8 A;  2CCZ A;  3H3V C;  2Q2U A;  1CKM A;  2E5L Q;  3NQT A;  4C3I H;  2RSO A;  5HGQ A;  3CF5 A;  4DV6 L;  1TY2 A;  4ME3 A;  4NP5 A;  3G48 A;  1EYG A;  3EQL C;  2B2W C;  4K2K A;  3S14 B;  5KIX A;  3E5S A;  4DAM A;  2YTX A;  2LKV A;  3IL8 A;  2VNU D;  5J1Z A;  4A4I A;  4OWW B;  1TR5 A;  1HTL D;  2MO0 A;  2JEA I;  2OCE A;  4DU9 A;  5AJ3 Q;  1PFB A;  1VQN A;  4QUF A;  1P16 A;  3PO2 B;  3DMU A;  5BR8 Q;  1TWH B;  3M9B A;  4M1U B;  2L15 A;  1PH7 A;  3GP7 A;  2AHO B;  5C44 H;  2KVM A;  2N8N A;  5CC4 A;  1YJN A;  2JA5 B;  1I6V C;  1LTT D;  1PZK D;  1Z47 A;  2EY5 A;  4GKJ L;  4JI4 Q;  4LF9 L;  1STY A;  2QW7 A;  1I3Q B;  1I94 L;  1LAB A;  3VR4 A;  1YIJ A;  1H9S B;  1LV9 A;  2R7F A;  2OQ0 A;  4HCS A;  1WTQ A;  2FIN B;  1Y14 B;  4ULL A;  1YHB A;  4RCN A;  1PDQ A;  1STE A;  2UUC Q;  4NXN Q;  2VL6 A;  2YU9 B;  2I5H A;  5CV6 A;  1Q86 C;  1E2Z A;  4K5V A;  2EE1 A;  3D4R A;  3GTG B;  5I6W A;  1TS3 A;  3ONA B;  4H0L C;  2PI2 E;  3TZD A;  1RTO A;  3T1H Q;  1K3R A;  4QMG A;  1YEZ A;  1B2T A;  1PH1 A;  1U0L A;  2F0P A;  1X56 A;  2NN6 G;  4DR4 Q;  2JN4 A;  4KTA A;  5EJW A;  2YV5 A;  2J0T D;  1II3 A;  1JT8 A;  4LUZ A;  2SDF A;  2Z6K A;  1NJI C;  2YTY A;  1PFM A;  2EJG C;  4XT3 B;  4WFN 3;  1Z7T A;  4POG A;  1PTO D;  2PMZ B;  3K80 C;  4ZKC B;  4DV0 L;  4GNX A;  4YCV A;  4RA8 A;  2EJM A;  4DR6 Q;  4X6A H;  2E75 C;  1H9M A;  2NVQ B;  3NWS A;  4LF7 L;  4BY1 H;  3RZD H;  1VQO A;  1YHA A;  1JE4 A;  2VQF L;  4PZ6 A;  2MO1 A;  1TKW B;  3K5O A;  1X6O A;  4FXK C;  1ZXT A;  4R4T A;  3J81 i;  3J81 j;  3MHB A;  1D1I A;  1LM0 A;  2C9O A;  5M5X B;  3H91 A;  4OO1 G;  5C0X I;  2VS1 A;  1KD1 C;  3VR5 A;  3A7L A;  4KN4 C;  3PUY A;  2K5D A;  4R4O A;  3MFG A;  3N52 A;  3R3O A;  2ZJP A;  2HHH Q;  4LF6 Q;  4JK1 C;  1O7Z A;  4LF5 Q;  1XNQ Q;  4DK6 C;  4X64 Q;  1EY7 A;  3KFU A;  3CCL A;  1WTV A;  3K57 A;  5IP7 G;  2EYL A;  1O78 A;  4IQZ A;  2HQE A;  4KJN A;  4POF A;  4IUR A;  4A3K H;  1BKB A;  1LTA D;  2F0K A;  1N36 L;  1SNQ A;  2VY3 A;  3I72 A;  2G5D A;  3VYR A;  1VQC A;  1HNZ Q;  1C7Y A;  5C4J H;  4XYQ A;  1ROD A;  1CT1 D;  1Q1B A;  1K28 A;  2F0N A;  5JJL A;  2EXZ A;  3H09 A;  4F8M A;  2A74 C;  5FK9 C;  4PZ7 A;  3K0X A;  4P74 A;  5CV5 A;  4JI5 Q;  1LUZ A;  4I7A A;  3DWA A;  2E2J H;  4ID6 A;  4ALP A;  3I56 A;  3U9S A;  5JEA G;  3A54 A;  4DK3 C;  2LS0 1;  2RF4 A;  2GVA A;  4BA1 I;  1J5E L;  3ND8 A;  4OHJ A;  4C56 C;  2EY6 A;  3OWF A;  4FF2 A;  1N33 L;  4DXG A;  3Q23 A;  4J8Q A;  2LXK A;  1G51 A;  1K9M C;  2EDG A;  3L7Z C;  3D6W A;  2NWG A;  2X6G A;  1EQR A;  4NB3 A;  4JI2 Q;  1WJJ A;  3S16 B;  3G71 A;  2MGS A;  1S3O A;  1VQB A;  1VQ9 A;  1CM9 A;  2RCF A;  5IYB G;  1IXR A;  3L2P A;  5G3L F;  3RN2 A;  4BBS G;  2UXD L;  4QL5 A;  3F1Z A;  4IPH A;  2EYJ A;  2N78 A;  4KN7 C;  1JJ2 A;  3NTK A;  5M3F G;  3K6O A;  1VQA A;  2CVR A;  3PO3 G;  1K0S A;  1PRT D;  4HJ7 A;  4XQJ A;  1TXY A;  3I70 A;  4E6I A;  1Y1V G;  2F0T A;  3TP6 A;  3GO5 A;  3PUZ A;  3QB3 A;  4LW1 A;  4GS3 A;  1DCZ A;  1STH A;  3D0F A;  4OXP A;  1SYC A;  2E2H B;  4A3C G;  3Q22 A;  1QCB D;  4A93 G;  5JJK A;  2N88 A;  3OTO Q;  5CV8 A;  4DV5 L;  3KF8 B;  5JJZ A;  4DV2 Q;  3K7U C;  1QB5 D;  1OXS C;  4A3G G;  4L5T A;  4CKB A;  1SDF A;  3C46 A;  2B63 H;  1BDO A;  4UPA A;  4DUZ L;  1QNK A;  3GTQ B;  4K0K Q;  1P8L A;  2RVL A;  5FLM G;  3A8K E;  1D1K A;  2JA7 G;  2K75 A;  3CC4 A;  2NVT H;  4CDC C;  3RZO H;  2F0W A;  2KEE A;  1K8O A;  1EEI D;  4HJ8 A;  2FMM A;  1A3T A;  2D5D A;  3PUV A;  1DON A;  1PHJ A;  1Q46 A;  4GN5 A;  1RJT A;  3GTO H;  3JAM L;  3GTJ H;  1MJC A;  3CC2 A;  2BOS A;  3CQZ H;  4P73 A;  2XTI A;  2UUA Q;  4EQP A;  1IW7 C;  1H9R A;  2NVY B;  1PTO F;  4JBJ A;  4A3I G;  4BBS B;  4A3M G;  4F7X A;  4PQX A;  1UEA B;  1U9R A;  2A6H C;  2I0Q A;  1KHI A;  1B44 D;  5M3F B;  3S2H B;  3VYT A;  1KAB A;  4Y7N B;  1BF4 A;  2WAC A;  2EYF A;  3D8G A;  2PNR C;  1ONL A;  3PO3 B;  3OYY A;  1DZ1 A;  1ESF A;  1RKN A;  1Y1V B;  2ZTE A;  2AMC B;  3HRZ C;  1IHZ A;  2JA9 A;  5LMU Q;  3CCS A;  1WTW A;  1AP0 A;  1ESR A;  1YIT A;  4A93 B;  4JV5 L;  5C0X G;  1YNN D;  1A15 A;  1EQT A;  1IBL L;  2AUK A;  4GN4 B;  4A3G B;  1YNJ D;  4R1J A;  4HSP A;  5ELB A;  1HNX L;  4XT1 B;  5IGG A;  1A2U A;  2QA4 A;  3F8T A;  3GDE A;  4ZCK A;  2JA7 B;  4AYB E;  2ENB A;  2F0M A;  4J1M A;  1SMY D;  4DV4 L;  4C3J H;  4CDF C;  5GQO A;  4FXD A;  2R3Z A;  4UP8 A;  1EY8 A;  1JJG A;  1V8Q A;  3JAM E;  2M9V A;  1QZG A;  2GN5 A;  2PYK A;  3NEN A;  3ZJY C;  3LNN A;  1ZKO A;  3TME A;  4A3I B;  4A3M B;  2A19 A;  3EN2 A;  2KEN A;  1G29 1;  2CWP A;  3S14 H;  3HOX H;  3PF5 A;  5IGE A;  3I4N G;  3I4M G;  1J8I A;  3C3L A;  1WFQ A;  3CP0 A;  2ZXR A;  4MNO A;  4JI3 Q;  5IWA L;  4JYA Q;  1SSO A;  3MEF A;  3PCO B;  1IBM Q;  3CXC A;  1TII D;  2L55 A;  1JE5 A;  4DAY B;  1VF7 A;  2OEO A;  2B2W A;  2LXJ A;  1HUN A;  3IAY A;  1TWH H;  4FO2 A;  2RDH A;  1B8A A;  2IL8 A;  4HJA A;  2DN8 A;  1H9S A;  1EIH A;  1XMQ Q;  1EQV A;  3EIV A;  1K83 H;  4IUN A;  1F2M A;  4ZRZ A;  3E6Z X;  3K5M A;  5JEA J;  2F3V A;  2QDL A;  4BBR H;  3RR5 A;  2NBF A;  1RF2 D;  2E8G A;  3Q24 A;  4QY7 A;  2ZTD A;  1B1Z A;  2UU9 Q;  3TZU A;  1QNU A;  4X65 Q;  2YU9 H;  2RA4 A;  2XN9 C;  2BCO A;  1D5Z C;  3GTG H;  1KL9 A;  2KHI A;  3H3V I;  5K5P A;  1TWG B;  3W3A A;  1TU2 B;  4MN3 A;  2BH8 A;  3T56 B;  3I91 A;  3D4D A;  3K81 C;  2UUB Q;  3TQY A;  4X66 Q;  3F2D A;  3I4N B;  2PI2 A;  2AQ3 B;  3I4M B;  3DHQ A;  3TN2 A;  2K7V A;  3NBH A;  3R2T A;  1HR0 Q;  2E5L L;  4JBW A;  1WTX A;  4CKC A;  1AEX A;  4DV1 Q;  5F2D A;  2C35 B;  3CPW A; 
#chains in the Genus database with same CATH homology
 1KAW A;  3U4V A;  1VQG A;  3HOU G;  3I4N H;  4P71 A;  1VQ5 A;  3HOZ H;  4B3S Q;  3RLO A;  4NXM L;  2NZH A;  3PO2 G;  2OWO A;  4JC0 A;  3RN5 A;  3B6Y A;  2BA1 A;  1FVI A;  3PSI A;  4HIM A;  3RLF A;  5K36 G;  2JEB I;  2JA8 G;  2VZA A;  1W2B A;  2JA5 G;  4GLV B;  4KI0 A;  3S1N H;  1CKN A;  3CW2 C;  5FJ8 H;  3A5U A;  2RHQ B;  3J80 i;  1SFO H;  2JA6 H;  2UXB L;  1BVS A;  1GKH A;  5C4X G;  3S17 H;  4A3J H;  1K8A C;  5AJ3 L;  1PH2 A;  4B3T Q;  4IFD I;  4DV3 L;  3OW2 A;  1L0W A;  4JI8 L;  1N8R C;  4LWC A;  5BR8 L;  3S1R H;  2EIF A;  3UDX A;  2K52 A;  3TRZ A;  1VQH A;  3BU2 A;  1IBM L;  4JBM A;  1GM5 A;  4L5R C;  1SRU A;  3RLN A;  1FJG L;  1YHQ A;  1Z9F A;  3CCV A;  4Y52 H;  5HY6 A;  4KLK A;  1JMC A;  4JI1 Q;  4DNI A;  1D8L A;  2CCZ A;  2IT1 A;  3RNU A;  2CKZ B;  4AQY Q;  4PZ8 A;  2Q2U A;  2D0P A;  5IP9 G;  1CKM A;  2OQK A;  1VQ7 A;  2WB1 E;  2E5L Q;  1XMQ L;  4DPG A;  1L1O A;  1I6H H;  1D7Q A;  1QUQ A;  1XJV A;  1TWC H;  1KRS A;  4C3I H;  5HGQ A;  3CF5 A;  3KYH C;  3KDF A;  3HFZ B;  4DUY L;  4C2M H;  4DV6 L;  4RMF A;  2UUC L;  4NXN L;  2AWN A;  4ME3 A;  1IBK L;  4A3B G;  3G48 A;  5M5W H;  1Q82 C;  3F2C A;  1EYG A;  4B3R L;  4NXM Q;  3FKI G;  4P72 A;  1S40 A;  4O0A A;  2VQF Q;  1CKO A;  4DAM A;  2YTX A;  3CAM A;  3BZC A;  3K7A H;  3M4P A;  2WFW A;  2VNU D;  3UDF A;  3T1H L;  1I50 H;  4OWT B;  1PYB A;  5ELN A;  4YWK A;  4A4I A;  4HJ5 A;  4OWW B;  4A3L H;  1NMF A;  4LFA L;  2HIX A;  2ATW A;  1CUK A;  2PNH A;  2MO0 A;  3CCJ A;  2JEA I;  2OCE A;  1A0I A;  1CSQ A;  4UY8 C;  4DR4 L;  5AJ3 Q;  3TS0 A;  4X62 L;  3G4S A;  3HOZ G;  1VQN A;  3VDY A;  3KJP A;  3CD6 A;  2K4K A;  1E1O A;  1N9W A;  1P16 A;  1E1T A;  4JI8 Q;  1X3E A;  5BR8 Q;  1VQP A;  3M9B A;  2L15 A;  1PH7 A;  4OON A;  5C0X J;  3TS2 A;  2AHO B;  2KHJ A;  5EAY A;  2N8N A;  5C44 H;  3CCQ A;  5LMN L;  1VQE A;  1FJG Q;  5M5Y H;  1LTL A;  4C3H H;  1YJN A;  4JI0 L;  4BY7 G;  1Z47 A;  4JOI C;  1KQS A;  4GKJ L;  2K5N A;  4JI4 Q;  4LF9 L;  3H3V H;  2ZJQ A;  3FP9 A;  1I94 L;  4JI6 Q;  3PO2 H;  2EQS A;  4IFD G;  1HNW L;  1YIJ A;  1YI2 A;  1YJ9 A;  2K5H A;  4IFD J;  1HR0 L;  3E9I A;  3AFQ A;  4LFB L;  1O7I A;  1XNR L;  1E24 A;  1N36 Q;  1KIX A;  3HKZ E;  2R7F A;  3HOW G;  2JA5 H;  2OQ0 A;  3CC7 A;  3F2B A;  1Y1W G;  4A3D G;  2Y0S G;  1QVC A;  4DUY Q;  2PQA B;  1I3Q H;  4DV6 Q;  1Y14 B;  1YHB A;  5FLX c;  2UUC Q;  4NXN Q;  2V1C C;  1E7Z A;  2VL6 A;  1IBK Q;  2AKW B;  2I5H A;  4B3R Q;  1Q86 C;  4A3K G;  3SGI A;  1YJW A;  1NTG A;  4GLX A;  1K73 C;  1VQ8 A;  3AYH B;  4LFC L;  2LSS A;  2PI2 E;  5GRO A;  3H15 A;  1EFW A;  4JI7 L;  5IP7 H;  1K3R A;  3T1H Q;  2GVB A;  1YEZ A;  1PH1 A;  1RIP A;  1U0L A;  2ZJR A;  2IY5 B;  4LFA Q;  1X56 A;  2NN6 G;  4QJF A;  3HOV G;  4DR4 Q;  4X62 Q;  5IP9 H;  4A3F H;  2HHH L;  4LF6 L;  3HOY H;  2YV5 A;  4HJ9 A;  1XNQ L;  4X64 L;  4LF8 L;  1SE8 A;  1JT8 A;  4LUZ A;  1Q12 A;  2Z6K A;  1NJI C;  1N33 Q;  3DLL A;  2YTY A;  5LMN Q;  5J3B A;  2N3S A;  4J15 A;  4XIG S;  4JI0 Q;  1E22 A;  3L0O A;  5IYD G;  4POG A;  4A3B H;  4GKJ Q;  4LF9 Q;  3K80 C;  3CCR A;  4DV0 L;  4AQY L;  2UXB Q;  4GNX A;  1I94 Q;  2AWO A;  4DR1 L;  5IYC H;  1GO3 E;  3AQQ A;  4DR5 L;  4YCV A;  1HJP A;  4DR6 Q;  4LFB Q;  4X6A H;  1XPO A;  1XNR Q;  3M85 A;  1PA6 A;  4KHP L;  2NZO A;  2UXC L;  1OXX K;  5C44 G;  4BY1 H;  3I4O A;  4LF7 L;  3RZD H;  1VQO A;  1EQQ A;  3GTQ H;  1Q8K A;  5IT9 c;  2IHF A;  1YHA A;  2WB1 G;  3UE0 A;  3NEL A;  3MXN B;  1DGS A;  5IE8 A;  4PZ6 A;  2VQF L;  1JB7 A;  4YY3 Q;  2VQE L;  1HZB A;  2MO1 A;  2NVQ H;  1X6O A;  4JCV E;  2HQL A;  4O2D A;  4L5S A;  3J81 i;  4R4T A;  4JG2 A;  4LFC Q;  3WWV A;  5C3E G;  3J81 j;  1LM0 A;  4JI5 L;  1L1O C;  3GTM H;  4JI7 Q;  4BY7 H;  3STB D;  4OO1 G;  2R93 H;  5C0X I;  2VS1 A;  1KD1 C;  3I2Z A;  1CKN B;  2ASB A;  4YCU A;  2MQH A;  1KXL A;  3PUY A;  1PH3 A;  1C9O A;  4OX9 L;  2B3G A;  4R4O A;  2ZJP A;  2HHH Q;  4LF6 Q;  3GD7 A;  4GOP B;  5GAH C;  3HOW H;  4LF5 Q;  1XNQ Q;  4DK6 C;  1HZC A;  3NEM A;  5M5X H;  4X64 Q;  1HH2 P;  3CCL A;  5IYB H;  1NMG A;  4LF8 Q;  3CMA A;  3KFU A;  3S1M H;  1Y1W H;  4A3D H;  2WAQ E;  4BBS H;  3E9H A;  5IP7 G;  2R7D A;  3KF6 B;  3PIO A;  3S2D H;  1E3P A;  4JI4 L;  4JBK A;  1UE5 A;  3UDG A;  2ALY B;  4JI6 L;  1VQF A;  2B29 A;  1OXU A;  3S2H H;  4POF A;  4DV0 Q;  4IPC A;  5GAG C;  1BKB A;  4A3K H;  4DR1 Q;  4A3F G;  4GKK Q;  4DR5 Q;  3PO3 H;  2OTJ A;  3HOY G;  1N36 L;  2VY3 A;  4JI2 L;  3ERS X;  3HKS A;  1Y1V H;  2BA0 A;  4KHP Q;  1L1O B;  1VQC A;  1HNZ Q;  2UXC Q;  4LF7 Q;  4P75 A;  1G6P A;  4YHH Q;  5C4J H;  1C7Y A;  3J80 c;  1Q1B A;  1Q7Y C;  1A8V A;  2B63 G;  3HOV H;  3GTP H;  5JJL A;  3HKZ G;  1WYD A;  3H0G G;  4IOA A;  1T9H A;  5IYC G;  4UP7 A;  5ELO A;  4DV7 L;  4GN3 B;  2VQE Q;  1H95 A;  1NY4 A;  3GTL H;  4PZ7 A;  3K0X A;  4P74 A;  4JI5 Q;  1CSP A;  4QGU A;  2R92 H;  4BY1 G;  1LUZ A;  5IYD H;  1AE2 A;  2OTL A;  2JK8 A;  2E2J H;  2JJQ A;  1EIF A;  4ALP A;  2RCN A;  3PUX A;  5E7N A;  5FLM H;  3I56 A;  5JEA G;  3JC6 6;  4NPS A;  4OX9 Q;  3A5Z B;  1SRO A;  4DK3 C;  3PF4 A;  4PMW A;  2MNA A;  2RF4 A;  3OTO L;  4HID A;  1UE7 A;  3D31 A;  4QQB X;  2GVA A;  4BA1 I;  1J5E L;  1X9N A;  1N33 L;  1VQ6 A;  4BXX G;  4DV2 L;  3KOJ A;  4TVA B;  2R93 G;  4YWL A;  2F4V L;  1EUJ A;  1LYL A;  3CCE A;  2LXK A;  1QVG A;  1EWI A;  3J7Z C;  1G51 A;  2QGQ A;  1AH9 A;  1K9M C;  2H5X A;  4K0K L;  3L7Z C;  4A3E H;  1PH5 A;  1EQR A;  2R6G A;  4NB3 A;  3W1B A;  4LF4 L;  3J7A 5;  4DR6 L;  2E2I H;  5C3E H;  4JI2 Q;  1WJJ A;  2Q2I A;  2Q2T A;  1TWF H;  3G71 A;  1S3O A;  1VQB A;  1VQ9 A;  5IYB G;  2ZM6 L;  2Z6K C;  1IXR A;  3K8A A;  3L2P A;  4A3I H;  3RN2 A;  4A3M H;  4BBS G;  2UXD L;  4QL5 A;  1WCM G;  3F1Z A;  4IPH A;  1VQ4 A;  2N78 A;  1JJ2 A;  5M3F G;  3AEV A;  1IL2 A;  2EXD A;  1VQA A;  2XGT A;  3A0J A;  3STB C;  2F52 A;  4YY3 L;  3M4Q A;  4GNX C;  1PH4 A;  4LNQ A;  1RL2 A;  4DV7 Q;  2UUA L;  3S16 H;  2HT1 A;  5DLQ E;  3PO3 G;  1V1Q A;  4IOC A;  4HJ7 A;  1TXY A;  1Y1V G;  3PUW A;  3ICE A;  3GO5 A;  3PUZ A;  2D0O A;  4LW1 A;  4GS3 A;  1Q81 C;  1SLJ A;  3D0F A;  4OXP A;  3U58 A;  4B3M L;  4A3C G;  4A93 G;  3DM3 A;  5JJK A;  4LF5 L;  3CCM A;  4A76 A;  3OTO Q;  1QVF A;  2QEX A;  4DV5 L;  1J5E Q;  3KF8 B;  2ZTC A;  4DV2 Q;  3K7U C;  1PH6 A;  1OXS C;  3ULL A;  4L5T A;  2R92 G;  3PIP A;  4A3G G;  1ASZ A;  2B63 H;  1XTD A;  4R4C A;  3U4Z A;  4UPA A;  4DKA C;  4DUZ L;  2E2H H;  2BH2 A;  2F4V Q;  5LMU L;  3H0G H;  2WP8 J;  4K0K Q;  1P8L A;  4GNX B;  5FLM G;  4TQU S;  2JA7 G;  4GKK L;  2WAQ G;  2K75 A;  3NBH B;  3CC4 A;  2NVT H;  1JJC B;  3IRB A;  4LF4 Q;  2VUM G;  3RZO H;  1QZH A;  1HNZ L;  4L5Q A;  4YHH L;  2JE6 I;  3W1G A;  2ZM6 Q;  4HJ8 A;  1C0A A;  3PUV A;  4IPD A;  1UWV A;  2YYZ A;  1KC8 C;  4BA2 I;  4LUV A;  2UXD Q;  1PHJ A;  1Q46 A;  4GN5 A;  3PGZ A;  3GTK H;  3GTO H;  3GTJ H;  3CME A;  1MJC A;  1W3S A;  3G6E A;  4A3E G;  3CC2 A;  1EOV A;  3CQZ H;  3PV0 A;  4P73 A;  4KHZ A;  1MIU A;  2XTI A;  2UUA Q;  1GVP A;  4BXX H;  1XPR A;  1PVO A;  1N32 L;  1K8G A;  5GAE C;  5M3M G;  3HOX G;  2F3I A;  4JBJ A;  2YTV A;  3CCU A;  4A3I G;  4A3M G;  4PG3 A;  1FGU A;  2CQO A;  2DGY A;  1ASY A;  1OTC A;  2I0Q A;  1KHI A;  2FXQ A;  1N34 Q;  2R7Z G;  3KJO A;  4B3M Q;  3JAM i;  1V43 A;  3ULJ A;  4DR3 L;  2NVY H;  3I4M H;  4OWX B;  1SMX A;  3OYY A;  4DV5 Q;  2KBN A;  4AIM A;  2ZTE A;  1WCM H;  2AMC B;  4YWM A;  1NE3 A;  2JA9 A;  1BBW A;  1B7Y B;  4FDB A;  5M3F H;  4DUZ Q;  5LMU Q;  4RG1 A;  4Y7N H;  3CCS A;  1PH9 A;  1YIT A;  4JV5 L;  3T1Y L;  5C0X G;  3J81 c;  4R4Q A;  1QUQ B;  1IBL L;  1TWA H;  4GOP A;  4GN4 B;  3KDF B;  3TEH B;  1A63 A;  1VQJ A;  4R1J A;  4JI3 L;  3UDI A;  4BBR G;  4JYA L;  1XMO L;  4QIW E;  1HNX L;  3BJU A;  4UP9 A;  1UE6 A;  4A3C H;  5JJI A;  4A93 H;  2QA4 A;  1AE3 A;  3F8T A;  3GDE A;  3KF6 A;  1WI5 A;  3A74 A;  3JAM c;  2CFM A;  1VQD A;  4DR7 L;  1A62 A;  1IYJ B;  4AYB E;  1X3F A;  1MKH A;  3ULP A;  1VQK A;  5GAD C;  4DV4 L;  4C3J H;  1PH8 A;  4A3G H;  4LUO A;  1N32 Q;  1FL0 A;  2HIV A;  5GQO A;  2IX0 A;  3M4O H;  2DUD A;  4H02 A;  4APV A;  1X3G A;  1L2F A;  4YCW A;  4UP8 A;  2JA7 H;  1XPU A;  3AFP A;  1JJG A;  2VUM H;  2I5M X;  1PYS B;  1QZG A;  2KCT A;  2GN5 A;  3S15 H;  3NEN A;  4DR3 Q;  3ZJY C;  5H1S E;  4EQ5 A;  4MZ9 A;  3EBE A;  1OXT A;  2UU9 L;  3S1Q H;  2A19 A;  3EN2 A;  4GLA C;  4X65 L;  2A8V A;  2KEN A;  1SN8 A;  3ER0 A;  1G29 1;  2CWP A;  4AH6 A;  2Q2H A;  3T1Y Q;  4JV5 Q;  3S14 H;  3HOX H;  5M3M H;  3PF5 A;  3I4N G;  3I4M G;  4DV3 Q;  3M7N A;  1WFQ A;  1IBL Q;  1J6Q A;  3S24 A;  1MJE A;  3CP0 A;  4MNO A;  1YBY A;  2MFI A;  1HZA A;  3MEF A;  3PCO B;  5IWA L;  1XMO Q;  1IBM Q;  4JI3 Q;  2R7Z H;  1X55 A;  3TRE A;  3CXC A;  1HNX Q;  3W5O A;  4DR7 Q;  1JE5 A;  2CWA A;  3HOU H;  5FJ8 G;  2UUB L;  1PFS A;  4DAY B;  4DR2 L;  2JA6 G;  4JYA Q;  4X66 L;  4IPG A;  1K0R A;  4A3J G;  3CPF A;  1M1K C;  2K5V A;  2LXJ A;  1TWH H;  2NN6 I;  2RHS B;  1M90 C;  1B8A A;  4DV4 Q;  2NVX H;  4HJA A;  1OXV A;  2JA8 H;  1S72 A;  3FHW A;  1N34 L;  1XMQ Q;  4DV1 L;  2JQO A;  5C4X H;  1EIY B;  2PQA A;  3EIV A;  5LMN W;  2I5L X;  1K83 H;  3Q8D A;  4B3S L;  4IJL A;  4EX5 A;  3I7F A;  3E0E A;  5JEA J;  1VQL A;  4WJ4 A;  1HZ9 A;  1UEB A;  4IJH A;  4BBR H;  3RR5 A;  2PMZ E;  3UE1 A;  1KRT A;  2E8G A;  3U50 C;  1YNX A;  1HR0 W;  4WJ3 M;  4QY7 A;  1YZ6 A;  2ZTD A;  1GD7 A;  2UU9 Q;  1WOC A;  4JOI A;  1R9T H;  4X65 Q;  2D62 A;  2YU9 H;  1YVC A;  4MTN A;  4B3T L;  1VS0 A;  2A1A A;  2IHE A;  3GTG H;  1UE1 A;  1KL9 A;  2KHI A;  3H3V I;  5IY0 A;  1IZ6 A;  1V9P A;  2ID0 A;  4XTC S;  5IWA Q;  4HIK A;  1VQI A;  1U5K A;  2BH8 A;  3I55 A;  1X65 A;  2ES2 A;  3BZK A;  3M3Y H;  4A3L G;  1B70 B;  4JI1 L;  3K81 C;  2N49 A;  2VW9 A;  4IO9 A;  3TQY A;  1X54 A;  4DR2 Q;  2UUB Q;  4OO1 I;  3FKI H;  4X66 Q;  3F2D A;  2PI2 A;  2Y0S E;  3KLW A;  1HNW Q;  1TWG H;  2KCM A;  1PV4 A;  1VCI A;  2Z0S A;  1NBW A;  4GOP C;  1HR0 Q;  2E5L L;  1I5F A;  3LGJ A;  1Q1E A;  4JBW A;  4R4I A;  4A75 A;  2IX1 A;  1SR3 A;  4AYB G;  2K14 A;  2K50 A;  1VQM A;  4DV1 Q;  1BBU A;  4HIO A;  2C35 B;  3CPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...