2KHJA

Nmr structure of the domain 6 of the e. coli ribosomal protein s1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
89
structure length
89
Chain Sequence
b'MFNNWVALNKKGAIVTGKVTAVDAKGATVELADGVEGYLRASEASRDRVEDATLVLSVGDEVEAKFTGVDRKNRAISLSVRAKDEADEK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S1
publication title Probing the relationship between Gram-negative and Gram-positive S1 proteins by sequence analysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosomal protein
total genus 9
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2khjA00
3PIOA 4A3KH 5LMUQ 2K75A 2KCTA 4JI7Q 4P74A 2QA4A 5EAYA 1Q7YC 3CCRA 5C0XI 3H3VI 3DLLA 3HOYH 4IJLA 3FHWA 5HY6A 3GTPH 2VNUD 2IHFA 4BA1I 3CW2C 3Q8DA 1IXRA 4J15A 1Y1VG 5AJ3L 3NBHB 2VY3A 3S2DH 3A5UA 4L5TA 2ZJQA 2CWAA 2K14A 4BY7G 2R92H 3S2HH 3H0GH 2GN5A 1EUJA 5JEAJ 2JA5G 1N36Q 2OTLA 3OTOQ 3F1ZA 3HKZG 2ASBA 2R93H 1HZCA 5M3FG 4BBSH 5LMUL 2E2JH 2B63G 1YVCA 4C3HH 1I5FA 2I5MX 1UE6A 3WWVA 1X65A 2PQAA 1EIYB 1PHJA 1XPUA 4OX9Q 2UXBQ 4DAYB 1WCMH 3M4QA 1Q8KA 3CC4A 2F52A 2NVQH 4A3FG 4GS3A 1WI5A 1SE8A 2AHOB 5H1SE 5JJIA 1KRSA 4A3GG 1HNXQ 3I4MG 4A3JH 4A3IG 2N3SA 1N9WA 3CC2A 1Q86C 4GKKQ 3ZJYC 3ER0A 3UE1A 1NBWA 5LMNQ 3OTOL 1N36L 4JI6Q 1ASYA 4ALPA 3JAMi 4O0AA 1CKNA 2V1CC 2HIXA 1TWHH 1V1QA 5M5WH 1HR0W 4LF7Q 2OQKA 3CCEA 1VQIA 1X56A 2K50A 4PZ8A 3CCMA 4HJ5A 4OX9L 1J6QA 1IL2A 2UXBL 4NB3A 2K5NA 1BVSA 4DR5Q 1X54A 2ZJPA 4HJ9A 4JOIA 2BA0A 1OXVA 1QUQA 2UUAL 4BA2I 1YNXA 1HNXL 3GTGH 3LGJA 1YZ6A 1PFSA 1PH7A 2IT1A 4A75A 4YWLA 2EIFA 1AE2A 4GKKL 1E1TA 1K73C 3KOJA 4JI1L 5LMNL 1Y1VH 3L7ZC 4JI6L 3CAMA 2YU9H 2YTXA 4BY7H 3PUWA 1SN8A 4QQBX 4OONA 1N8RC 4LF7L 2Q2IA 4R4CA 4HIDA 3GTLH 1GO3E 4JV5Q 4LF6Q 1XPOA 2EXDA 2WB1E 3KF6A 3CMAA 1XTDA 1JMCA 2JA6G 2OTJA 4JBMA 3EN2A 3G6EA 3PUZA 2IX1A 4LFCQ 2PI2A 4XIGS 5C4XG 4IPDA 2Q2UA 2Q2HA 3CCSA 1DGSA 4A3FH 1Y1WG 1PH5A 1IBML 2KENA 4A3KG 4DV3Q 1W2BA 3S1NH 2JE6I 2MO1A 4YCUA 2ZTEA 4DV7Q 1KD1C 2ID0A 1VQ9A 5FLMG 3E0EA 3J80c 1OTCA 4JYAQ 4UY8C 4DKAC 3K7UC 4JV5L 4LF9Q 1EQRA 1TXYA 3L0OA 2E2IH 3A0JA 1UE5A 3KJPA 2NVTH 2NN6I 5GROA 2LSSA 4DK6C 2FXQA 4R4OA 4A3BG 5GAHC 2UUBQ 2LXJA 1VQFA 1YBYA 2KHIA 1ASZA 4R1JA 5ELNA 3K80C 1EQQA 1GM5A 2UU9Q 2F3IA 3DM3A 3H3VH 2N49A 3NELA 2R92G 3H0GG 1V43A 2A8VA 3M4OH 1JJGA 1OXTA 1I3QH 3M4PA 3RLFA 4JBWA 2R93G 2HHHQ 1X3GA 2PMZE 5FLXc 4DV3L 1J5EQ 1E24A 2I5LX 3FKIH 3FP9A 4JI5Q 4TVAB 4DV7L 3BU2A 2AKWB 3UDFA 1KQSA 2E2HH 4JYAL 2WP8J 2R7DA 4IPGA 4LF9L 3U4VA 1RL2A 3M9BA 1GKHA 4DV4Q 2PI2E 4OO1I 3STBC 3M3YH 3GTJH 3I56A 4GOPC 1HR0Q 4WJ4A 2MQHA 1MKHA 2KBNA 2JA6H 5M5XH 4A3JG 4KI0A 3GO5A 5IY0A 2AWNA 1C7YA 2Q2TA 1VQLA 2UU9L 1X3FA 5IWAQ 4GOPA 5JEAG 2UUCQ 4LNQA 4AYBG 4GNXB 4LFBQ 5C4XH 1PH3A 3S1RH 2HHHL 4YWKA 1J5EL 3EBEA 4JI5L 1VQBA 4UP8A 2NZOA 1VQ4A 1Y1WH 4RG1A 1PH4A 1CKMA 1MIUA 2HIVA 4DV2Q 4DR4Q 1KL9A 4B3SQ 4DV4L 1KC8C 1XNRQ 3I4OA 5FLMH 1X6OA 1E22A 2PNHA 1TWCH 2VZAA 1HR0L 1EOVA 1YJWA 3KDFA 3A74A 1I94Q 3CCUA 1Y14B 2UUCL 3L2PA 5IWAL 3OW2A 4R4QA 1JE5A 3CCVA 2NVYH 4QL5A 3HOXH 4A3BH 3AQQA 2JK8A 4LFBL 4PMWA 3VDYA 2B29A 2Y0SE 3MXNB 1L1OB 4LWCA 1N33L 2ZM6Q 3S16H 2VQEQ 1HZBA 2R7FA 1YEZA 2JA7G 2QGQA 1V9PA 3AYHB 2IY5B 4BBRG 1AH9A 3S1MH 4DV2L 3RLNA 4DR4L 3G48A 4B3SL 4PZ6A 4JI7L 3I7FA 3I4NH 2K5HA 4AH6A 2WAQG 1OXXK 1B8AA 4GN4B 1A8VA 4QIWE 4FDBA 5GQOA 4EX5A 1PA6A 3K7AH 1PH2A 1I94L 1VQNA 5IYBH 1VQOA 1W3SA 2YTYA 1EFWA 1K9MC 2BA1A 3J81i 3PF5A 4WJ3M 1KHIA 3TEHB 4C3IH 2ZM6L 2VQEL 3J7A5 1K8GA 4HIOA 1IYJB 3U4ZA 3PF4A 4A3CG 1CKOA 1SRUA 3U58A 1G51A 4KLKA 4HJ7A 3ICEA 1CKNB 3KF8B 3D0FA 4JOIC 3E9IA 5C0XG 3GTOH 3F8TA 2YV5A 4IFDI 2K52A 4JI4Q 3TQYA 5IYDG 3UDIA 4C2MH 4RMFA 3H15A 4GLXA 2AMCB 5ELOA 3HKZE 1A63A 3FKIG 4X6AH 3E9HA 4POFA 4YHHQ 4UPAA 4JI0Q 4DV0Q 1VQMA 1EYGA 3CXCA 5IYCG 3JAMc 1YHQA 2VUMH 4MZ9A 1TWFH 3J81j 2JA7H 3GDEA 4EQ5A 1VQKA 1XNQQ 4BBRH 1Q12A 1VQHA 3PO3G 5IP7H 1BBWA 1KRTA 4AQYQ 2YTVA 1PH9A 4B3TQ 2GVAA 4BXXG 1P16A 4DK3C 1SMXA 3KF6B 2UXCL 4K0KQ 4OWXB 4DR5L 4JI4L 1X55A 4B3RQ 5C44H 2VS1A 5C3EH 2A1AA 3KLWA 4APVA 4QGUA 4YY3Q 3CF5A 3RN5A 5C0XJ 1XPRA 1FGUA 1PH6A 4YHHL 1JJCB 4JI0L 4A3EG 3UE0A 1D7QA 1CSPA 1Z9FA 2D0PA 4DR3Q 3ULPA 2MFIA 1QZHA 4IOCA 3RZOH 2A19A 3I2ZA 4JI2Q 1MJEA 2ATWA 1XMOQ 1LUZA 4YCVA 4DV6Q 1CSQA 1K83H 4JCVE 3ULLA 4LF6L 1XNQL 3J80i 4OWWB 4AQYL 5GADC 4IO9A 4A3CH 1NE3A 2CKZB 1Q82C 4B3TL 2JA9A 5M5YH 3HOXG 4K0KL 4LFCL 3CPWA 3AFPA 3M7NA 1WJJA 3F2CA 4B3RL 4BY1G 4HIMA 2K5VA 4GN5A 3W5OA 2RHQB 3STBD 1PH1A 4YY3L 1NMGA 3CP0A 5IYDH 2R7ZG 2CWPA 2ZTCA 3IRBA 4JI3Q 4A93G 2RCNA 3NENA 4DV5Q 3PUYA 4LW1A 4DR3L 3PV0A 4DR7Q 4PG3A 1VQAA 3I4NG 4R4TA 3G4SA 2ZJRA 2BH2A 4JI2L 1XMOL 1PH8A 3S17H 1KAWA 3HOWG 4ME3A 1IZ6A 3T1YQ 2NVXH 1WOCA 5IYCH 3D31A 1UE7A 3TS2A 5IYBG 4JBKA 2WFWA 2Z0SA 2F4VQ 3PO3H 2UUBL 1A62A 4JI8Q 2B3GA 5IP9H 1Z47A 5BR8Q 1YITA 4BXXH 2D0OA 1QVCA 1FJGQ 4R4IA 1EIFA 1KIXA 4DV5L 4LFAQ 1VQEA 1YIJA 2I5HA 1YHAA 3BZCA 4DR7L 4A4IA 3AEVA 2OCEA 1IBKQ 5FJ8H 2ES2A 4A3EH 1Q1EA 4P75A 3ERSX 3T1YL 1HNZQ 3UDGA 1OXUA 2NN6G 2D62A 4GNXC 3GD7A 2F4VL 1K8AC 1PV4A 1RIPA 1S3OA 1SROA 4JC0A 4JI8L 4DAMA 1FL0A 2KCMA 3U50C 3F2DA 4GNXA 1NJIC 4IJHA 3PUVA 4XTCS 1BBUA 1G291 4JG2A 3PGZA 3KYHC 4LUOA 4BY1H 2VUMG 1FJGL 1WYDA 5M3MH 1B7YB 1SR3A 4X65Q 4PZ7A 4LFAL 4DR6Q 3J7ZC 2MO0A 3AFQA 2JA8G 1B70B 5IP7G 2R7ZH 3PCOB 1IBKL 3RLOA 1LYLA 4NXMQ 2DUDA 4A93H 1HNZL 2CFMA 3GTMH 1N34Q 1XNRL 1PVOA 1TWGH 2JJQA 4OO1G 5C44G 1JT8A 1VQPA 4AYBE 1MJCA 1S40A 1N32Q 1L1OC 3HOWH 5C3EG 3HOVG 1O7IA 2RHSB 4DPGA 1R9TH 4A3DG 2PQAB 1I50H 1L1OA 1UE1A 1NMFA 4DUZQ 1M90C 1PYBA 2NZHA 2XGTA 4TQUS 3HOUH 3MEFA 1BKBA 1T9HA 1HNWQ 5J3BA 2E8GA 1XMQQ 4HJ8A 1L2FA 4X65L 1JJ2A 4DR6L 4KHZA 4DR1Q 4A3MH 3F2BA 4B3MQ 1HZAA 2IHEA 2LXKA 4OWTB 4NXML 3PIPA 2K4KA 1LM0A 1VQDA 4X66Q 1N34L 1S72A 1L0WA 1PYSB 5GAEC 1N32L 4LF4Q 4O2DA 3M85A 1HH2P 2H5XA 2ZTDA 1D8LA 3J81c 2WB1G 4DUZL 2UUAQ 1YI2A 2N8NA 5HGQA 3K81C 5IT9c 1HNWL 1XMQL 1U0LA 1QUQB 2AWOA 3CCLA 4KHPQ 3BJUA 1Q1BA 4JI1Q 2WAQE 4DR1L 5E7NA 3SGIA 4B3ML 3HOZG 4MTNA 4NPSA 1M1KC 4A3LG 5JJLA 2YYZA 4H02A 4X66L 1AE3A 2JA8H 3PO2H 4OXPA 3PSIA 5IP9G 3RN2A 1KXLA 3W1BA 2XTIA 4GLAC 1VQ7A 4L5QA 4HIKA 2I0QA 2ALYB 4LF4L 4YCWA 1VS0A 1H95A 3RNUA 1QZGA 1GVPA 3HOVH 4L5SA 3JC66 1NTGA 2QEXA 1X3EA 2CQOA 2IX0A 2OQ0A 1P8LA 2VQFQ 4DUYQ 3S15H 4Y7NH 1IBMQ 4A3DH 2EQSA 4KHPL 4LF8Q 5FJ8G 2E5LQ 1VQJA 4LUVA 4DV0L 4P73A 3S14H 1TWAH 2RF4A 4GN3B 2GVBA 3BZKA 3CPFA 1SLJA 1IBLQ 1LTLA 3RZDH 1YJ9A 2JA5H 3K0XA 3CCJA 4IPHA 3OYYA 1EWIA 5M3FH 4X62Q 1X9NA 2HQLA 1A0IA 1VQGA 4X64Q 2B63H 3W1GA 2DGYA 1YHBA 1WFQA 4IFDG 1C0AA 3RR5A 1G6PA 5JJKA 1HJPA 3PUXA 5M3MG 4GKJQ 4DUYL 4QJFA 3KFUA 2OWOA 1E1OA 2VQFL 1UEBA 1VCIA 4LF8L 4A3GH 2E5LL 2JQOA 2Z6KC 4JBJA 4DV1Q 1GD7A 1VQ5A 3I4MH 4A3IH 1U5KA 1E7ZA 2UXDQ 2JEBI 2Z6KA 3S24A 3TREA 4DV6L 4DR2Q 1IBLL 4POGA 3HKSA 3HOYG 1UWVA 3KJOA 3HFZB 3HOZH 2HT1A 4A3LH 4X62L 3A5ZB 1E3PA 1FVIA 4X64L 4LF5Q 3HOUG 1QVGA 1XJVA 3T1HQ 1VQ6A 2JEAI 1QVFA 1JB7A 3GTQH 3TRZA 3UDXA 4GKJL 3TS0A 4A3MG 5K36G 1I6HH 5LMNW 5C4JH 4GOPB 4JI3L 1K3RA 4QY7A 3G71A 4IFDJ 4BBSG 2BH8A 3CD6A 4DV1L 1NY4A 1OXSC 1HZ9A 1K0RA 2CCZA 4NXNQ 2VW9A 3S1QH 4DR2L 2UXCQ 2UXDL 2Y0SG 4IPCA 2N78A 4UP9A 5GAGC 1C9OA 4DNIA 1WCMG 4GLVB 4P72A 1YJNA 3GTKH 4LF5L 1SFOH 2KHJA 3NEMA 4YWMA 2VL6A 4C3JH 1Q81C 3CMEA 4IOAA 5IE8A 3T1HL 5BR8L 2L15A 3KDFB 1VQCA 2C35B 5DLQE 4Y52H 1CUKA 5AJ3Q 3I55A 1N33Q 3CC7A 4HJAA 4A76A 4AIMA 1Q46A 3ULJA 4L5RC 2R6GA 4MNOA 3CCQA 4P71A 2MNAA 3PO2G 4LUZA 3EIVA 4NXNL 3CQZH 4UP7A 3B6YA 3K8AA 1VQ8A
chains in the Genus database with same CATH superfamily
4A3KH 4WORA 3SE0A 4XYOA 1Q7YC 1LO5D 1PRTD 4IJLA 5CV8A 1RODA 3TN2A 1BUVT 3S1NB 5AJ3L 2CWAA 1XYIA 2R92H 3NTKA 3S2HH 4CDDC 3K5OA 3FPUB 1N36Q 2OTLA 2NVTB 1EWCA 5M3FG 4BBSH 4PV1C 2EY6A 1YVCA 2BDNA 2I5MX 1UE6A 1X65A 3D3RA 2PQAA 1EIYB 1XPUA 4DAYB 1WCMH 2L1BA 2XN9C 3M4QA 3CC4A 2MJ8A 2NBFA 5JJIA 2F0OA 4A3GG 5D14A 3FKIB 4C1NI 4A3JH 4A3IG 4JVZA 1PTOH 4GKKQ 3CC2A 1Q86C 3ER0A 2KQ3A 1FYCA 3OTOL 1KDBA 3M3YB 4EQNA 1CKNA 5M5WH 1HR0W 2VB2X 2OQKA 1EYAA 2K50A 2UXBL 2P5ZX 4DR5Q 3HEJA 1ZKOA 1X54A 1GXDC 2L12A 1YNXA 4ODGA 4HEDA 1QWYA 4RFBA 4YWLA 4KV6A 1LLRD 1DCZA 4H44C 5LMNL 3L7ZC 3CAMA 4BY7H 2RCFA 5ELFA 1TWCB 4OONA 4JV5Q 3GTLH 1XPOA 2JA6G 3CMAA 4JBMA 3PUZA 4LFCQ 4XIGS 3DM1A 4BY1B 2HQEA 4IPDA 4M1UB 2Q2UA 2Q2HA 1AZQA 3E0JA 1Y1WG 1PH5A 2LMCB 5DM63 3S1NH 1W2BA 2JE6I 3MC0B 4HN7A 1PZJD 3J80L 2B2WC 3J80c 1Y69U 2ENBA 2NVTH 2TSSA 2B2WA 2K5DA 4X3TA 5GROA 3G6JB 2WV6D 3HP3A 3JAME 2FXQA 4R4OA 2LXJA 1PTOD 2C9OA 2KHIA 4R1JA 1K8OA 3K80C 2F3IA 4FF4A 2EYFA 2N49A 2Z9HA 5FLXL 3M4OH 2ICEC 1QNKA 2R93G 4OIKA 5FLXc 4DV3L 1E24A 3FKIH 4WFN3 2PZTA 1PTOF 4Q0FA 4YIJA 1WD1A 3M3YH 4GOPC 4K8IA 1DOMA 1BDOA 1HR0Q 1MKHA 2G5DA 3K59A 4KI0A 4C3IG 3ITPA 2AWNA 5IY0A 2Q2TA 2Z1CA 1VQLA 4GOPA 5JEAG 4EQPA 4NW2A 4X3SA 2VUMB 3MZ5A 3O13A 2JA7B 2B2VC 2DNCA 4YWKA 1J5EL 4BBRB 1Z6HA 4RG1A 1PH4A 2B2VA 2VXWA 2HCCA 1KL9A 4HTHA 1DOKA 4J8QA 4DV4L 2WAQB 1EIGA 5FLMH 3HGBA 1TWCH 4OHJA 1EOVA 3A74A 5CC4A 4A3DB 3CCUA 2UUCL 3CRKC 2QDBA 3OW2A 1PLFA 3CCVA 1KNAA 2M2LA 1N33L 3NQIA 2VQEQ 1HZBA 1YEZA 2RBMA 4I7ZC 4DV2L 3RLNA 4DR4L 5M5YB 3R8BA 2IX3A 2A6ED 1TKWB 2NWGA 4FVMA 4GN4B 4FDBA 1G6ZA 2F3WA 1M4VA 1HRJA 2WB1B 2YTYA 3DMUA 2BA1A 3J81i 1KHIA 1J8IA 2F0UA 4A3CG 1CKOA 1SNOA 3PO3B 1CM9A 1NUCA 5A2QE 4KLKA 3U9SA 1STBA 1CKNB 3KF8B 3QG1A 3E9IA 1STAA 2WACA 1GUSA 5K5PA 1O7ZA 1LTAD 3TQYA 5IT9L 3UDIA 4GLXA 4RMFA 1D1IA 3H15A 1RD9D 3E9HA 4YHHQ 4UPAA 1A2UA 1EYGA 2K5WA 5IGFA 1B53A 1YHQA 3RUZA 2VUMH 2I07B 3J81j 2LFNA 2JA7H 2H4OA 3GDEA 4BBRH 1Q12A 2PMZB 3FRPB 1KRTA 4B3TQ 2NTSA 1QB5D 1SMXA 4K0KQ 4DR5L 5CV6A 4OO1H 3DUZA 4YY3Q 2K5QA 1FGUA 3M4YA 1JJCB 2A68D 3P7JA 4A3EG 4JI0L 4N9TA 1Z9FA 2D0PA 2MFIA 2EE1A 1HCZA 3I2ZA 1MJEA 2ATWA 1EY6A 2TMPA 1XMOQ 1CSQA 3HOYB 2VB3X 4OWWB 5GADC 1I50B 3HOUB 5M5YH 4LFCL 3CPWA 1CA5A 1STNA 2N88A 3STBD 3QJYA 3K6OA 1GUTA 4A3MB 2R7ZG 3TSSA 4JI3Q 2ZTCA 4A93G 1PZID 4LW1A 3PV0A 4TRDA 2CH4A 4R4TA 4DAVA 4JI2L 4ME3A 1IZ6A 1GUOA 5IYCH 5IYBG 4JBKA 5G3LD 2Z0SA 2F4VQ 3PO3H 1ET9A 5EKKA 1A2TA 3ERQA 3BDCA 1WTXA 3HS0C 3CU7A 1CT1D 4R4IA 1IYVA 1STHA 4DR7L 2OCEA 5G3LF 1HNZQ 2KHSA 3UDGA 3C2PA 2NN6G 4GNXC 3EFXD 2QCPX 2QF7A 1U4PA 1K8AC 3J80E 1SROA 4RCOA 4GNXA 1U4MA 4IJHA 2F0LA 1BBUA 3PGZA 3F2UA 4HMIA 1FJGL 1WYDA 4KJNA 1B7YB 3J7ZC 5A35A 3AFQA 2JA8G 4RKLA 1B70B 5KGUA 1IBKL 1XTCD 1CHPD 5M3FB 2CH4W 2KCNA 5JVH3 1N34Q 2JJQA 3BZDB 5C44G 1VQPA 1L1OC 1B3QA 5BN4A 1I50H 1TS3A 3KLRA 1L1OA 4A3GB 4XT3B 3HOUH 1PYBA 1CZGA 1NNXA 3A55A 3VYSA 1T9HA 4A3IB 1XMQQ 5KEEA 4A3MH 3H3VC 1HZAA 1XWEA 1PRTC 2K4KA 3UI2A 4X66Q 4MHEA 1BCPC 4O2DA 4CJ2C 5ELEA 2H5XA 3IL8A 4C56C 4DUZL 2LS01 1EOTA 1U0LA 3VYRA 2MUYA 2A74C 4DR1L 2FMCA 4MTNA 4NPSA 1M1KC 1NR4A 5C4HA 4H02A 1SDFA 3PSIA 3W1BA 2XTIA 5DNFA 1VQ7A 4L5QA 2IW3A 1KLGD 1WTHA 5CORA 5C5MA 1D5ZC 1GVPA 3JC66 1HXYD 2OQ0A 1Y1WB 2VQFQ 1GJXA 3D6CA 4KHPL 4IUUA 4WJWA 4LUVA 3X3MA 4P73A 1AW7A 4ULLA 5HURA 1LABA 3P75A 2XIWA 1NAPA 1IBLQ 3GTPB 1AN8A 5FO9B 5M3FH 4ZYSA 1A0IA 4X64Q 3BDOA 1EYCA 2DGYA 1YHBA 2AUJD 3NE5B 2PZUA 3V96A 4GKJQ 2OWOA 1VCIA 2R93B 4LF8L 4A3GH 2E5LL 4DV1Q 1IW7D 1GD7A 4KMUC 4K2KA 4A3IH 1QILA 1U5KA 2JEBI 2NB0A 3S24A 3TREA 1TY0A 1L0YB 4IQZA 2NVQB 1D2BA 3A5ZB 1DONA 4U673 1BNZA 1MI2A 5EBCA 3BVZA 1JB7A 4KD4A 3TS0A 1JOKA 5LMNW 4JI3L 4QY7A 3G71A 4IFDJ 5FK9C 4RGNA 2FINB 2JSOA 2UXCQ 4IALA 1I4XA 4IPCA 3T56B 4P72A 1LACA 4LF5L 4IOAA 2L15A 1I4HA 2C35B 4C1NK 5AJ3Q 2YU9B 5CV9A 1Q46A 2R6GA 4P71A 4X3KA 4DGZA 4LUZA 1CZWA 3Q24A 4NXNL 1PFNA 3R93A 3NUCA 2FFKB 3QIAA 4ABNA 2QA4A 2K01A 3EQLC 5C0XI 3DLLA 3GTPH 2VNUD 1F9QA 3SK6A 2HD3A 1G8ZD 3CW2C 1SSOA 1Y1VG 1PYWD 3NBHB 2ZJQA 4L5TA 2O5JC 1IHZA 5CBAE 1EUJA 5IGDA 2EY5A 2A5HA 3OTOQ 2R93H 2ZT9C 5LHY1 2B63G 2K04A 5BN5A 3DXJC 2UXBQ 2NVQH 4A3FG 3DEPA 1I3QB 2AHOB 5H1SE 1KRSA 1BCPB 2E75C 3I4MG 2N3SA 2EVBA 1N9WA 1JWUD 1YNND 1TS4A 3ZJYC 5J22A 5JEAH 3UE1A 5LMNQ 4ALPA 1S5BD 4DNTB 5ELCA 4O0AA 5EBDA 3JAMi 2HIXA 1TWHH 1V1QA 3LWEA 1VQIA 1X56A 2BE5C 1VDZA 1SYDA 1J6QA 1IL2A 1BVSA 1X32A 1SMYD 2ZJPA 2MP1A 1QUQA 1SYEA 1PH7A 1YZ6A 3T51B 4HR7B 3VR2A 1E1TA 1K73C 4JI6L 2YU9H 1SN8A 2ZXPA 4HIDA 1GO3E 4LF6Q 2WB1E 4K5VA 1GOZA 1HTLD 2IX1A 2PI2A 3K0YA 5C4XG 3S16B 3T4AC 4KN4C 2R7ZB 2KENA 4DV3Q 4RKBA 2MO1A 1FNWA 1UNSA 2ZTEA 4DNRB 1VQ9A 1OTCA 1JOOA 4ZCKA 5IODA 4DKAC 1EQRA 1TXYA 3L0OA 4DK6C 2IJ0A 3J7AV 2UUBQ 4A3BG 2SNMA 2F0SA 1GM5A 3H3VH 2KJXA 2KA7A 3NELA 2EZVA 1V43A 1DM0B 2ZXRA 3K57A 1I3QH 2PMZE 1J5EQ 1MD2D 5EGTA 3FP9A 2F3VA 2AUKA 4C3HG 4DV7L 3BU2A 5IGCA 1A15A 2WP8J 2R7DA 2JYOA 5CYUA 1EZ6A 1GKHA 3TP7A 4DV4Q 4OO1I 3STBC 3HG9A 2F0JA 2RQXA 3GO5A 2UUCQ 1X3FA 4DXGA 2M00A 4G4KA 3KBXA 1KTKA 4AYBG 1PH3A 3LNNA 1DJRD 2OT2A 4CGYB 2L55A 2HHHL 4ZLTF 4LAAA 5J39A 4JI5L 4UP8A 1VQ4A 1WTVA 4NDXA 1CKMA 1MIUA 2HIVA 3GP7A 3A8KE 4KJOA 4OIJA 3C1FA 3MA2B 4DV2Q 4DR4Q 4V0BA 5EKIA 3I4OA 3RD4A 5C44B 2PNHA 4DU9A 1TIID 3KDFA 3CRLC 1TU2B 2HDLA 1Y14B 1F9RA 3A54A 2JK8A 2EJMA 2B29A 2Y0SE 3S16H 2WINB 1K83B 2KEEA 4FP5D 2B2TC 2RDGA 1SJHD 1V1PA 2EY1A 3MVVA 2Z8LA 3G48A 2B2TA 1D5MC 1F9PA 2FJ2A 1SE3A 1A8VA 5GQOA 4FF2A 1PA6A 5IYBH 1VQOA 4G7HC 4WJ3M 1G2SA 2ZM6L 3S17B 4RHSA 2O5IC 1IYJB 2Q8TA 5I6YA 1G51A 4HJ7A 5EJWA 1BCPF 5I9OA 3D0FA 4ME5A 2NN6H 5IYDG 3SDZA 4IN3A 5ELOA 2B8GA 3TZUA 2F0KA 4POFA 3QO2A 4JI0Q 4DV0Q 5F2DA 4IUTA 3RMHA 1BBWA 1KABA 2YTVA 2GVAA 4BXXG 2UXCL 3VA7A 1H9JA 4JI4L 1TR5A 1C8CA 4ILWA 5C44H 3KLWA 4QGUA 1XPRA 2HDMA 1LT6D 4KTAA 4UHVA 2KCCA 3IKJA 3ULPA 1QZHA 4IOCA 1QNUA 2A19A 4JI2Q 1Z7TA 4H7BA 1LUZA 2F0VA 2E2DC 2Z6BA 1K83H 3I70A 3QOJA 4YCVA 4ZK9B 4DV6Q 3J80i 1R9TB 4LF6L 4AQYL 2CKZB 3OIQA 2MGSA 1TS2A 4ZKBB 3L3OC 4F8MA 1WJJA 1UUPA 2CW0D 5C0XH 1S5FD 4F7XA 3WOFA 1KDCA 4IUPA 1A3UA 4R8IA 1EFID 4DR3L 4DR7Q 1VQAA 3I4NG 2F0EA 4JW0A 3S17H 3HOWG 2PYKA 5D3DA 1WOCA 3L9AX 4FYDA 3WDNA 4HCSA 1B50A 1ESFA 2UUBL 3H94A 5IOCA 1I6VC 1SNCA 4UDUC 4QIWB 2EYLA 1QVCA 1FJGQ 1EIFA 4DV5L 1GUNA 1VQEA 1YIJA 1RKNA 1SE2A 1TT2A 5JJZA 1IBKQ 2ES2A 1Q1EA 4P75A 4F88A 1CK1A 1A6XA 1CI3M 5JAVA 4H0LC 4MIUA 3C1EA 4J6HA 1PV4A 1S3OA 1QOHA 1NJIC 1FL0A 2KCMA 3U50C 5TSSA 3S15B 4UAIA 3PUVA 3TP6A 1G291 2O2LD 4E6IA 3NSWA 3S14B 4LUOA 3KYHC 4BY1H 2F0QA 4LFAL 4PZ7A 1AZPA 2WKDA 5IP7G 2ICIA 5CV7A 3RLOA 1EQVA 2DUDA 1B9MA 2QILA 2B63B 1V1PB 1SYCA 1TVXA 3HOVG 1O7IA 3SK8A 2RHSB 1R9TH 4A3FB 2PQAB 1UE1A 1NMFA 2IL8A 4DUZQ 2NZHA 2XGTA 5JPNC 3I4MB 2E8GA 2OEOA 5E3FA 1GHJA 4DR1Q 1RDPD 3F2BA 1NSNS 4OWTB 1S72A 2D9UA 1PXUA 1N32L 3J81L 3M85A 1HH2P 2XSCA 1D8LA 1Y8NB 3J81c 3U9OA 5KNDA 5IT9c 4GZYC 3CCLA 4KHPQ 3LWUA 4KY5A 1Q1BA 4JI1Q 3HOZG 5JJLA 1AP0A 2YYZA 4C3JB 3ND9A 5IP9G 3RN2A 1SXTA 4HIKA 1V1OA 4RAUC 1VS0A 1H95A 2K03A 5C5LA 2QEXA 1X3EA 2Z4HA 2IX0A 3OW7A 3S15H 4A3DH 3CQZB 1U9RA 1WTPA 2EQSA 1TQOA 1IBMQ 3T16A 5FJ8G 3DWAA 1BQQT 1VQJA 4DV0L 2E5LQ 3PMFA 4LF8Q 3S14H 2RF4A 2E76C 2GVBA 3CPFA 1LTLA 1SMYC 3OYYA 1EWIA 1VQGA 2NVYB 2B63H 4K6DA 4NKLA 4P2CB 4IFDG 4ZQ3A 4ID6A 2F0HA 5M3MG 1Q8IA 4QJFA 5EPJA 1E1OA 2XWBB 2C5CA 2Z6KC 4JBJA 2E2JB 5D3IB 4C3HB 3I4MH 1E7ZA 2Z6KA 2Y0SB 4DV6L 1O7LA 1FD7D 1BR9A 1UWVA 2RVLA 2HT1A 4A3LH 2L11A 4X62L 4LF5Q 1E3PA 1ZYRD 1MSHA 2JXMB 3R2TA 3NPPA 1QVFA 1EY4A 3H91A 4AYBB 2PW5A 1GUWA 4O1NA 1IL8A 5K36G 4GOPB 4DK1A 3MXPA 4BBSG 2BH8A 1HQRD 3CD6A 1ONLA 3MXUA 1NY4A 4DA2A 4NXNQ 5CV4A 2UXDL 4DR2L 2DNEA 5GAGC 1C9OA 1WCMG 1K0SA 5KNBA 1YJNA 3DHQA 2BCOA 2VL6A 4C3JH 3GTGB 3T1HL 3MAQA 3N52A 1A3TA 5DLQE 1CUKA 1EEID 4HJAA 2LY7A 3ULJA 1ENAA 3PO2G 3EIVA 3CQZH 4UP7A 3B6YA 5NUCA 4CDCC 5IGGA 2EJGC 2K75A 5FLXE 4JI7Q 5EAYA 3H3VI 3CCRA 1O7YA 3Q0AA 2AQ1B 3HOYH 5HY6A 3CKIB 2IHFA 4XQNA 2G9HD 3MXNA 5JVG3 5JPMC 2RSNA 1IXRA 4J15A 3EVQA 1GHKA 2K14A 3AB9A 2Z4IA 4BY7G 4KN7C 1H9RA 5JEAJ 2JA5G 4Z9CB 3HKZG 2ASBA 5D65A 1HZCA 1DZ1A 1ET6A 5LMUL 2E2JH 4C3HH 2AQ2B 1I5FA 3K58A 3WWVA 1PHJA 1R4QB 3N6RA 1BBXC 3VR3A 2F52A 4GS3A 1MGSA 3BG3A 2PNRC 1SJED 3GV3A 2E2HB 3A8IE 2F0IA 5AFWA 1GUGA 2HUGA 4JI6Q 3SK4A 3VR6A 1C4QA 1EWHA 3OHXC 4XDXA 1ILPA 3GTJB 3CCEA 2JA6B 3D4DA 1F77A 2CVRA 3R2IA 3J7AF 3CCMA 4HJ5A 4OX9L 3AMUA 3BVGA 4NMZA 4HJ9A 3S1RB 4JOIA 2BA0A 3SEBA 4BA2I 1G2TA 1HNXL 3GTGH 1PFSA 2IT1A 4A75A 2RDFA 1T5XD 3M7GA 4U68A 3KOJA 1JWMD 4JI1L 1X3QA 2E74C 1K28A 3PUWA 3KUPA 1N8RC 4QQBX 4PMCA 2Q2IA 4R4CA 4LF7L 2OTJA 4DK0A 5DAUA 3OWEB 4BWGB 3EN2A 3G6EA 1BXTA 3Q6SA 4LMQD 3MFGA 1IBML 1HA5A 1ML0D 3MHBA 3BYTB 2K28A 3BYYB 4HAEA 1KD1C 4DV7Q 3I4NB 2ID0A 5IT9E 2EYJA 3DEOA 5FLMG 1HUNA 3HOWB 3A0JA 3DWQA 4HCEA 2NN6I 3K7AB 1KDAA 1YBYA 4O42A 1MHWC 4C3IB 5ELNA 1EQQA 5KYIA 2F1MA 3AU7A 3H0GG 4OEMB 4KY7A 2EPBA 4K14A 3QR8A 1OXTA 4JBWA 2HHHQ 3TMEA 2I5LX 4JI5Q 2AKWB 1KQSA 2E2HH 4JYAL 3QOLA 3MWYW 1PTOC 3A7AB 4LF9L 3GTOB 5CV5A 3I3CA 1RL2A 3M9BA 4IUQA 4N8X1 2CW0C 2PI2E 4C2MB 1AEXA 3GTJH 3I56A 4WJ4A 2MQHA 2A69D 2KBNA 2JA6H 2DY7A 2KEDA 2UU9L 1ENCA 1CHQD 3EROA 3FPPA 4LNQA 4GNXB 3TZDA 4H13C 3S1RH 2MHVA 3EBEA 2QEJC 5LL6S 1Y1WH 2A6HD 4ZRZA 3LX0A 1L0XB 2NTTA 1WTOA 1F2YA 1IYUA 1KC8C 1X6OA 1HTPA 2VZAA 1HFNA 2NZ1D 3L2PA 5IWAL 4R4QA 1H9SA 4QL5A 4LFBL 4PMWA 3VDYA 4RH6A 3MXNB 1L1OB 1EIHA 1RTNA 2ZM6Q 3RZOB 2R7FA 2JA7G 2QGQA 2QKIC 1V9PA 1H9MA 1YNJD 3AYHB 4BBRG 1AH9A 2RA4A 5T1IA 5E4XA 4FXDA 4K2LA 4B3SL 4PZ6A 4KK7A 4JI7L 3I4NH 4ZUIA 1SNPA 4AH6A 2WAQG 3D4RA 4M8AA 4FF3A 3MFYA 4QIWE 1PH2A 1I94L 3K7AH 1PRTB 2A73B 1VQNA 2L4NA 3PF5A 4C3IH 4JPBW 3J7A5 4N8FA 4HIOA 2NYZD 3IFTA 2NVXB 3PF4A 3HOZB 1F2LA 2A6EC 1SRUA 3VR5A 3U58A 2L5TA 4DAYA 2EXZA 3ICEA 3GTOH 2YV5A 2K52A 1A3VA 4HMJA 4JI4Q 4C2MH 1ESRA 1EYDA 4N9PA 3JAML 4A3EB 1DYQA 2K1BA 1VQMA 1VF7A 2L9HA 1S5ED 3T13A 5IYCG 3JAMc 4MZ9A 1JR0D 3D4WA 4EQ5A 3PO3G 1Y8PB 5IP7H 3E5SA 4AQYQ 5ELDA 1PH9A 1P16A 4DK3C 4OWXB 1V8QA 1X55A 4EQOA 3K5LA 1NCVA 2VS1A 1WTQA 5M3MB 2A1AA 4FO2A 5C0XJ 1PH6A 2SDFA 4A93B 3UE0A 3D6WA 4DR3Q 4KKUA 3GTMB 1LTID 3TP8A 3I73A 1TWGB 3RZOH 4IUNA 3D8GA 3VA5A 4XYQA 3ULLA 1XNQL 2B39A 4A3CH 4IO9A 4DAPA 1NE3A 3HOXG 3M7NA 1CA6A 4B3RL 2A68C 2K5VA 2RHQB 3H09A 2SOBA 1PFMA 3S2HB 3HRZC 3CP0A 3KLSA 3MXGA 2FMMA 3NXWA 4L63B 2OF1A 3IRBA 2JP1A 2RCNA 4DV5Q 3PUYA 2IWHA 3I4LA 3VR4A 3G4SA 2ZJRA 1M8AA 2XNAC 1PH8A 1EY5A 2NVXH 3HZXA 1EQTA 3TS2A 2WFWA 5FO8B 1Q3LA 1A62A 2RKSA 3PIP3 1LT4D 2K32A 5IP9H 1Z47A 1YITA 3SVMA 5DEHA 2N55A 3W3AA 5LL6X 1KIXA 3TBIB 4LFAQ 1HA6A 2JA8B 2I5HA 1YHAA 3BZCA 3PO2B 5FJ8H 4A3EH 1ZYRC 2EDGA 1D5XC 3T1YL 1QE6A 3GD7A 1RIPA 4J1MA 4JC0A 4JI8L 5C3XA 4DAMA 2KVMA 3F2DA 1MBYA 1S4ZA 4L6TB 5L37A 4G57A 3NTIA 4JG2A 1WTWA 4HSPA 5A2QL 3TP5A 1EEFD 5M3MH 1SR3A 3RZDB 2JA5B 2RDHA 3HKZB 2R7ZH 1LYLA 4A93H 2CFMA 3GTMH 1TWGH 2R3ZA 3A7LA 4K8JA 1JT8A 4AYBE 1MJCA 1S40A 1K8MA 4ZKCB 3NWTA 5C3WA 2EYHA 5C3EG 1EY7A 1N32Q 1C48A 1FGBD 5FKAC 1BCPD 3A56A 1M90C 1RTOA 3MEFA 1BKBA 5T1GA 4HJ8A 1L2FA 4X65L 2R61A 3ONAB 1JJ2A 4DR6L 1SNMA 4KHZA 3TDQA 5K36H 2IHEA 2LXKA 4NXML 1PRTF 1RHPA 2B2UC 3VYUA 1VQDA 1VMCA 1DXMA 4CHTB 2B2UA 1PYSB 4MN3A 4QCLA 1E2VA 4KKSA 1I6HB 1EY0A 1CQFA 2ZTDA 3M4OB 2UUAQ 2N8NA 5HGQA 3K81C 1HFGA 1HNWL 1QUQB 2AWOA 2I46A 2K33A 5E7NA 4B3ML 3URYA 3KF8A 2PZWA 2D5DA 4X3UA 1AE3A 2JA8H 3PO2H 5DM73 2I0QA 4LF4L 2ALYB 4R9WA 4S3SA 3RNUA 4IZ8A 1UAPA 1X3PA 4L5SA 3SK5A 4QUCA 5EPLA 4CDEC 2PCFB 1STGA 3BZKA 2EOTA 3RZDH 1YJ9A 2JA5H 2K05A 4IPHA 5I6WA 4X62Q 1X9NA 1O78A 1CFMA 3W1GA 1J9OA 4OELB 3S2DB 3RR5A 5JJKA 3H0GB 4DUYL 4DF7A 1TS5A 1BO0A 2JQOA 3OOCA 4QMGA 3A8JE 5ISRA 1AFPA 3KLSX 4K5XA 4KD3A 1I4PA 4DR2Q 2UXDQ 5EQ0A 3HKSA 2J0TD 1LT3D 3V05A 1FVIA 1SAPA 1QVGA 1XJVA 3T1HQ 2DJGC 3TRZA 3UDXA 1IW7C 1BF4A 3CHBD 1I6HH 1LT5D 4B08A 4I65A 1OXSC 1HHVA 1HZ9A 5J1ZA 2M9VA 3NHHA 4XQJA 2VW9A 2N78A 3SR1A 5C4ZA 5EKLA 3V2TA 4KKTA 2KHJA 4G7ZC 1Q81C 3FEWX 3X3NA 3KDFB 1VQCA 1Y1VB 4DXFA 3I90A 4AIMA 3P1HA 2MNAA 5I9PA 4XXEA 3T53B 3K8AA 3PIOA 5LMUQ 2A69C 2KCTA 4P74A 3NQTA 2WKCA 3FHWA 3KBGA 1E0BA 4BA1I 2A6HC 3Q8DA 3FMCA 2VY3A 3S2DH 1ICFB 3A5UA 3H0GH 2GN5A 2E2IB 1LTGD 1F9SA 3F1ZA 1B3AA 1JCKB 2EYOA 2F0NA 4OX9Q 1Q8KA 4CKCA 3OMCA 1DOLA 1WI5A 1SE8A 4WRDA 4RGMA 2BDOA 1KLUD 2BE5D 1YNJC 1OO9B 1HNXQ 3KK7A 1II3A 4BS9A 3NTHA 1NBWA 1N36L 1ASYA 4TSSA 3R3OA 2V1CC 4LF7Q 4RGOS 1LTTD 1XX8A 5M5XB 4RGTA 4PZ8A 5EPKA 4RWSC 4NB3A 2K5NA 5KRUA 3OIPA 5C4XB 4XQQA 1YNNC 1OXVA 1PDQA 2UUAL 2LKVA 1LTRD 3LGJA 2MPMA 2EIFA 1AE2A 4GKKL 1SYGA 1S5DD 3FVQA 4EGVA 1Y1VH 4CKBA 2YTXA 2AQ3B 1B9NA 3H6MA 1I4QA 1SEBD 2EXDA 1JMCA 3KF6A 1XTDA 2J4XA 4A3BB 3HOXB 1FR3A 3PIO3 1DD2A 1ENFA 1B2TA 3OMGA 2EJFC 2XRQD 2NUCA 4B9WA 3CCSA 2SEBD 1DGSA 4A3FH 3S1MB 1ILQA 4CJ1B 4K6LA 4FF1A 4A3KG 1WD0A 4YCUA 2OXPA 4L8JA 4JYAQ 3E0EA 4UY8C 3K7UC 4JV5L 4LF9Q 1HPCA 3FDTA 5I2XA 2E2IH 1UE5A 3KJPA 5CGKA 2DJFC 1R4PB 1SNQA 2LSSA 5GAHC 1VQFA 1G91A 1ASZA 2UU9Q 3DM3A 2X6LA 2R92G 2A8VA 3SXHA 1JJGA 3M4PA 3RLFA 1X3GA 4TVAB 3Q23A 2ZXOA 3UDFA 4IPGA 4RHRA 1H9KA 3U4VA 2EYPA 4B9XA 4OGQC 1RJTA 5M5XH 4A3JG 3BDLA 1C7YA 5IWAQ 4FXGC 4LFBQ 1LTBD 5C4XH 1TWFB 1VQBA 2NZOA 2XVSA 1PMRA 1KNEA 1E2WA 1RCVD 4B3SQ 2O4XA 2F0WA 1EU3A 3I8ZA 1XNRQ 1E22A 5C3EB 1HR0L 1YJWA 1I94Q 3IFDA 1JE5A 2NVYH 4A3BH 2F0PA 3HOXH 3AQQA 2EY2A 4LWCA 4RA8A 2IY5B 2DN8A 3S1MH 1W6KA 3I7FA 1I4GA 2K5HA 1OXXK 4V190 1B8AA 2PPBC 2J7ZA 4EX5A 2X6GA 1JQYD 3G7LA 2XRSD 3I91A 3NBHA 1W3SA 1EFWA 1K9MC 3C3LA 1CQVA 3TEHB 2VQEL 1JOQA 2Q8RE 1K8GA 4LK1C 3U4ZA 3BVMA 1EY8A 4JOIC 5ELBA 5C0XG 5FOBB 3F8TA 4IFDI 1U4RA 4PNYA 2XWJB 5JOBA 4XT1B 3J7YW 2AMCB 3HKZE 1A63A 3FKIG 4X6AH 2HCIA 1KAAA 3IAYA 3CXCA 2G9DA 3SHLA 1B4OA 1D1KA 5CR3A 1TWFH 5E1FA 1VQKA 4JK1C 2JN4A 1VQHA 3ZYYX 1XNQQ 5HGTA 3OWFA 3EJIA 1WTRA 2KOLA 3KF6B 4IURA 5CMDA 3OSOA 4B3RQ 5C3EH 4APVA 3RN5A 2H1EA 3CF5A 3NK9A 1NR2A 4EVOA 4YHHL 4ZAIA 3K5MA 3J81E 1D7QA 1CSPA 1JICA 1U4LA 3NP8A 1ICWA 1IKMA 5IIFA 1MSGA 4JCVE 1STYA 2F0TA 1RF2D 2Q8IB 1Q82C 4B3TL 2JA9A 5KYLA 4K0KL 1B44D 3AFPA 3F2CA 3BS1A 4BY1G 4HIMA 4GN5A 2PW7A 3W5OA 1I4RA 1PH1A 4YY3L 1TY2A 1NMGA 4FXKC 5IYDH 2CWPA 1HUMA 3NENA 1SYFA 5I4DA 4PG3A 2BH2A 1D6EC 5FO7B 5E4WC 1XMOL 1KAWA 3T1YQ 3D31A 1UE7A 4OL7A 4F87A 4JI8Q 4TKOB 2B3GA 4RCNA 5I2YA 4FNFA 5BR8Q 4BXXH 1QG7A 2D0OA 4CJ0B 1CTMA 4MTKA 4IUVA 5BN3A 3E3XA 1TWHB 1ZEQX 2F0FA 2QDLA 4A4IA 4KY6A 3MTSA 3AEVA 2CHBD 3ERSX 1SE4A 2SNSA 5IGBA 1OXUA 4CDFC 2D62A 2V4DA 1EY9A 2F4VL 1E2ZA 3HOVB 4LJZC 1BOSA 4Y7NB 4PQXA 4XTCS 1TWAB 3EA6A 2VUMG 2K7VA 2KUMA 4X65Q 5KIXA 1EL0A 4DR6Q 2MO0A 4QF4A 3PCOB 4NXMQ 1HNZL 2F03A 2D2CC 1XNRL 2DY8A 4OO1G 1PVOA 4DN4M 1IKLA 3HOWH 4CBVA 1WVLA 4DPGA 4A3DG 1K3BC 1JB3A 1FNVA 4TQUS 4Q5VA 3QWNA 1HNWQ 5J3BA 2PO4A 1EU4A 4K5WA 1F2ZA 1ZXTA 4B3MQ 3Q22A 2F0MA 1PFBA 3PIPA 1LM0A 2QW7A 4I7AA 1N34L 3DWPA 2X69A 3ND8A 1L0WA 3P20A 3GQBA 5COYA 2L0CA 1LTSD 5GAEC 3GTQB 4LF4Q 4QB4A 5KNCA 4KHVA 5C4JB 2WB1G 1YI2A 1PZKD 2IPKD 2B2YC 2BOSA 1XMQL 1JWSD 3S1QB 4NP5A 3BJUA 2WAQE 1SYBA 2B2YA 1Q90A 3SGIA 1SNDA 2EYMA 4HSVA 3GTKB 2F4IA 4A3LG 1SFOB 4X66L 1T5EA 1JORA 3NBIA 2B8FA 4OXPA 1KXLA 2PQEA 4GLAC 1S5CD 4YCWA 1FNUA 4DFAA 3MEHA 5M9OA 1QZGA 3E6ZX 3HOVH 1NTGA 4DUYQ 1HQMC 2CQOA 3W2DA 1P8LA 4Y7NH 2FHTA 1JE4A 1VMPA 4A3KB 1TWAH 4GN3B 3WOEA 1SLJA 4C3JG 1JC7A 3K0XA 3PQIA 3CCJA 2HQLA 2F0GA 1WFQA 1C0AA 1G6PA 1HJPA 3PUXA 2R92B 3KFUA 2VQFL 1UEBA 4ZUJA 4BBSB 3GV6A 3VYTA 1VQ5A 2K6AA 4G7OC 2WIIB 1IBLL 2KECA 4POGA 1UEAB 1WCMB 4QUFA 3HOYG 3KJOA 3HFZB 3HOZH 5CBEE 1LV9A 4X64L 3HOUG 1EZ8A 4A3JB 1VQ6A 2JEAI 3C46A 1PTOB 1SBBB 5IGEA 4PMBA 3GTQH 4GKJL 1Y8OB 4A3MG 3NWSA 2CQAA 5C4JH 1K3RA 1W6JA 2F0DA 4DV1L 5M5WB 1K0RA 5C6AA 2CCZA 3S1QH 1STEA 2RSOA 2Y0SG 4UP9A 4DNIA 4GLVB 3GTKH 1QJOA 3S9WA 1SFOH 3QB3A 1XXGA 3NEMA 4YWMA 3K5NA 3CMEA 4CKEA 5IE8A 1QCBD 5BR8L 2GA4B 4Y52H 4IFDH 3OPOA 3I55A 1N33Q 1F2MA 3CC7A 1O80A 1H9SB 4BY7B 4A76A 4L5RC 1VF5C 3GTLB 4MNOA 3CCQA 4R8NA 3I72A 1B1ZA 1VQ8A
chains in the Genus database with same CATH topology
3PIOA 4A3KH 5LMUQ 2K75A 2KCTA 4JI7Q 4P74A 2QA4A 5EAYA 1Q7YC 3CCRA 5C0XI 3H3VI 3DLLA 3HOYH 4IJLA 3FHWA 5HY6A 3GTPH 2VNUD 2IHFA 4BA1I 3CW2C 3Q8DA 1IXRA 4J15A 1Y1VG 5AJ3L 3NBHB 2VY3A 3S2DH 3A5UA 4L5TA 2ZJQA 2CWAA 2K14A 4BY7G 2R92H 3S2HH 3H0GH 2GN5A 1EUJA 5JEAJ 2JA5G 1N36Q 2OTLA 3OTOQ 3F1ZA 3HKZG 2ASBA 2R93H 1HZCA 5M3FG 4BBSH 5LMUL 2E2JH 2B63G 1YVCA 4C3HH 1I5FA 2I5MX 1UE6A 3WWVA 1X65A 2PQAA 1EIYB 1PHJA 1XPUA 4OX9Q 2UXBQ 4DAYB 1WCMH 3M4QA 1Q8KA 3CC4A 2F52A 2NVQH 4A3FG 4GS3A 1WI5A 1SE8A 2AHOB 5H1SE 5JJIA 1KRSA 4A3GG 1HNXQ 3I4MG 4A3JH 4A3IG 2N3SA 1N9WA 3CC2A 1Q86C 4GKKQ 3ZJYC 3ER0A 3UE1A 1NBWA 5LMNQ 3OTOL 1N36L 4JI6Q 1ASYA 4ALPA 3JAMi 4O0AA 1CKNA 2V1CC 2HIXA 1TWHH 1V1QA 5M5WH 1HR0W 4LF7Q 2OQKA 3CCEA 1VQIA 1X56A 2K50A 4PZ8A 3CCMA 4HJ5A 4OX9L 1J6QA 1IL2A 2UXBL 4NB3A 2K5NA 1BVSA 4DR5Q 1X54A 2ZJPA 4HJ9A 4JOIA 2BA0A 1OXVA 1QUQA 2UUAL 4BA2I 1YNXA 1HNXL 3GTGH 3LGJA 1YZ6A 1PFSA 1PH7A 2IT1A 4A75A 4YWLA 2EIFA 1AE2A 4GKKL 1E1TA 1K73C 3KOJA 4JI1L 5LMNL 1Y1VH 3L7ZC 4JI6L 3CAMA 2YU9H 2YTXA 4BY7H 3PUWA 1SN8A 4QQBX 4OONA 1N8RC 4LF7L 2Q2IA 4R4CA 4HIDA 3GTLH 1GO3E 4JV5Q 4LF6Q 1XPOA 2EXDA 2WB1E 3KF6A 3CMAA 1XTDA 1JMCA 2JA6G 2OTJA 4JBMA 3EN2A 3G6EA 3PUZA 2IX1A 4LFCQ 2PI2A 4XIGS 5C4XG 4IPDA 2Q2UA 2Q2HA 3CCSA 1DGSA 4A3FH 1Y1WG 1PH5A 1IBML 2KENA 4A3KG 4DV3Q 1W2BA 3S1NH 2JE6I 2MO1A 4YCUA 2ZTEA 4DV7Q 1KD1C 2ID0A 1VQ9A 5FLMG 3E0EA 3J80c 1OTCA 4JYAQ 4UY8C 4DKAC 3K7UC 4JV5L 4LF9Q 1EQRA 1TXYA 3L0OA 2E2IH 3A0JA 1UE5A 3KJPA 2NVTH 2NN6I 5GROA 2LSSA 4DK6C 2FXQA 4R4OA 4A3BG 5GAHC 2UUBQ 2LXJA 1VQFA 1YBYA 2KHIA 1ASZA 4R1JA 5ELNA 3K80C 1EQQA 1GM5A 2UU9Q 2F3IA 3DM3A 3H3VH 2N49A 3NELA 2R92G 3H0GG 1V43A 2A8VA 3M4OH 1JJGA 1OXTA 1I3QH 3M4PA 3RLFA 4JBWA 2R93G 2HHHQ 1X3GA 2PMZE 5FLXc 4DV3L 1J5EQ 1E24A 2I5LX 3FKIH 3FP9A 4JI5Q 4TVAB 4DV7L 3BU2A 2AKWB 3UDFA 1KQSA 2E2HH 4JYAL 2WP8J 2R7DA 4IPGA 4LF9L 3U4VA 1RL2A 3M9BA 1GKHA 4DV4Q 2PI2E 4OO1I 3STBC 3M3YH 3GTJH 3I56A 4GOPC 1HR0Q 4WJ4A 2MQHA 1MKHA 2KBNA 2JA6H 5M5XH 4A3JG 4KI0A 3GO5A 5IY0A 2AWNA 1C7YA 2Q2TA 1VQLA 2UU9L 1X3FA 5IWAQ 4GOPA 5JEAG 2UUCQ 4LNQA 4AYBG 4GNXB 4LFBQ 5C4XH 1PH3A 3S1RH 2HHHL 4YWKA 1J5EL 3EBEA 4JI5L 1VQBA 4UP8A 2NZOA 1VQ4A 1Y1WH 4RG1A 1PH4A 1CKMA 1MIUA 2HIVA 4DV2Q 4DR4Q 1KL9A 4B3SQ 4DV4L 1KC8C 1XNRQ 3I4OA 5FLMH 1X6OA 1E22A 2PNHA 1TWCH 2VZAA 1HR0L 1EOVA 1YJWA 3KDFA 3A74A 1I94Q 3CCUA 1Y14B 2UUCL 3L2PA 5IWAL 3OW2A 4R4QA 1JE5A 3CCVA 2NVYH 4QL5A 3HOXH 4A3BH 3AQQA 2JK8A 4LFBL 4PMWA 3VDYA 2B29A 2Y0SE 3MXNB 1L1OB 4LWCA 1N33L 2ZM6Q 3S16H 2VQEQ 1HZBA 2R7FA 1YEZA 2JA7G 2QGQA 1V9PA 3AYHB 2IY5B 4BBRG 1AH9A 3S1MH 4DV2L 3RLNA 4DR4L 3G48A 4B3SL 4PZ6A 4JI7L 3I7FA 3I4NH 2K5HA 4AH6A 2WAQG 1OXXK 1B8AA 4GN4B 1A8VA 4QIWE 4FDBA 5GQOA 4EX5A 1PA6A 3K7AH 1PH2A 1I94L 1VQNA 5IYBH 1VQOA 1W3SA 2YTYA 1EFWA 1K9MC 2BA1A 3J81i 3PF5A 4WJ3M 1KHIA 3TEHB 4C3IH 2ZM6L 2VQEL 3J7A5 1K8GA 4HIOA 1IYJB 3U4ZA 3PF4A 4A3CG 1CKOA 1SRUA 3U58A 1G51A 4KLKA 4HJ7A 3ICEA 1CKNB 3KF8B 3D0FA 4JOIC 3E9IA 5C0XG 3GTOH 3F8TA 2YV5A 4IFDI 2K52A 4JI4Q 3TQYA 5IYDG 3UDIA 4C2MH 4RMFA 3H15A 4GLXA 2AMCB 5ELOA 3HKZE 1A63A 3FKIG 4X6AH 3E9HA 4POFA 4YHHQ 4UPAA 4JI0Q 4DV0Q 1VQMA 1EYGA 3CXCA 5IYCG 3JAMc 1YHQA 2VUMH 4MZ9A 1TWFH 3J81j 2JA7H 3GDEA 4EQ5A 1VQKA 1XNQQ 4BBRH 1Q12A 1VQHA 3PO3G 5IP7H 1BBWA 1KRTA 4AQYQ 2YTVA 1PH9A 4B3TQ 2GVAA 4BXXG 1P16A 4DK3C 1SMXA 3KF6B 2UXCL 4K0KQ 4OWXB 4DR5L 4JI4L 1X55A 4B3RQ 5C44H 2VS1A 5C3EH 2A1AA 3KLWA 4APVA 4QGUA 4YY3Q 3CF5A 3RN5A 5C0XJ 1XPRA 1FGUA 1PH6A 4YHHL 1JJCB 4JI0L 4A3EG 3UE0A 1D7QA 1CSPA 1Z9FA 2D0PA 4DR3Q 3ULPA 2MFIA 1QZHA 4IOCA 3RZOH 2A19A 3I2ZA 4JI2Q 1MJEA 2ATWA 1XMOQ 1LUZA 4YCVA 4DV6Q 1CSQA 1K83H 4JCVE 3ULLA 4LF6L 1XNQL 3J80i 4OWWB 4AQYL 5GADC 4IO9A 4A3CH 1NE3A 2CKZB 1Q82C 4B3TL 2JA9A 5M5YH 3HOXG 4K0KL 4LFCL 3CPWA 3AFPA 3M7NA 1WJJA 3F2CA 4B3RL 4BY1G 4HIMA 2K5VA 4GN5A 3W5OA 2RHQB 3STBD 1PH1A 4YY3L 1NMGA 3CP0A 5IYDH 2R7ZG 2CWPA 2ZTCA 3IRBA 4JI3Q 4A93G 2RCNA 3NENA 4DV5Q 3PUYA 4LW1A 4DR3L 3PV0A 4DR7Q 4PG3A 1VQAA 3I4NG 4R4TA 3G4SA 2ZJRA 2BH2A 4JI2L 1XMOL 1PH8A 3S17H 1KAWA 3HOWG 4ME3A 1IZ6A 3T1YQ 2NVXH 1WOCA 5IYCH 3D31A 1UE7A 3TS2A 5IYBG 4JBKA 2WFWA 2Z0SA 2F4VQ 3PO3H 2UUBL 1A62A 4JI8Q 2B3GA 5IP9H 1Z47A 5BR8Q 1YITA 4BXXH 2D0OA 1QVCA 1FJGQ 4R4IA 1EIFA 1KIXA 4DV5L 4LFAQ 1VQEA 1YIJA 2I5HA 1YHAA 3BZCA 4DR7L 4A4IA 3AEVA 2OCEA 1IBKQ 5FJ8H 2ES2A 4A3EH 1Q1EA 4P75A 3ERSX 3T1YL 1HNZQ 3UDGA 1OXUA 2NN6G 2D62A 4GNXC 3GD7A 2F4VL 1K8AC 1PV4A 1RIPA 1S3OA 1SROA 4JC0A 4JI8L 4DAMA 1FL0A 2KCMA 3U50C 3F2DA 4GNXA 1NJIC 4IJHA 3PUVA 4XTCS 1BBUA 1G291 4JG2A 3PGZA 3KYHC 4LUOA 4BY1H 2VUMG 1FJGL 1WYDA 5M3MH 1B7YB 1SR3A 4X65Q 4PZ7A 4LFAL 4DR6Q 3J7ZC 2MO0A 3AFQA 2JA8G 1B70B 5IP7G 2R7ZH 3PCOB 1IBKL 3RLOA 1LYLA 4NXMQ 2DUDA 4A93H 1HNZL 2CFMA 3GTMH 1N34Q 1XNRL 1PVOA 1TWGH 2JJQA 4OO1G 5C44G 1JT8A 1VQPA 4AYBE 1MJCA 1S40A 1N32Q 1L1OC 3HOWH 5C3EG 3HOVG 1O7IA 2RHSB 4DPGA 1R9TH 4A3DG 2PQAB 1I50H 1L1OA 1UE1A 1NMFA 4DUZQ 1M90C 1PYBA 2NZHA 2XGTA 4TQUS 3HOUH 3MEFA 1BKBA 1T9HA 1HNWQ 5J3BA 2E8GA 1XMQQ 4HJ8A 1L2FA 4X65L 1JJ2A 4DR6L 4KHZA 4DR1Q 4A3MH 3F2BA 4B3MQ 1HZAA 2IHEA 2LXKA 4OWTB 4NXML 3PIPA 2K4KA 1LM0A 1VQDA 4X66Q 1N34L 1S72A 1L0WA 1PYSB 5GAEC 1N32L 4LF4Q 4O2DA 3M85A 1HH2P 2H5XA 2ZTDA 1D8LA 3J81c 2WB1G 4DUZL 2UUAQ 1YI2A 2N8NA 5HGQA 3K81C 5IT9c 1HNWL 1XMQL 1U0LA 1QUQB 2AWOA 3CCLA 4KHPQ 3BJUA 1Q1BA 4JI1Q 2WAQE 4DR1L 5E7NA 3SGIA 4B3ML 3HOZG 4MTNA 4NPSA 1M1KC 4A3LG 5JJLA 2YYZA 4H02A 4X66L 1AE3A 2JA8H 3PO2H 4OXPA 3PSIA 5IP9G 3RN2A 1KXLA 3W1BA 2XTIA 4GLAC 1VQ7A 4L5QA 4HIKA 2I0QA 2ALYB 4LF4L 4YCWA 1VS0A 1H95A 3RNUA 1QZGA 1GVPA 3HOVH 4L5SA 3JC66 1NTGA 2QEXA 1X3EA 2CQOA 2IX0A 2OQ0A 1P8LA 2VQFQ 4DUYQ 3S15H 4Y7NH 1IBMQ 4A3DH 2EQSA 4KHPL 4LF8Q 5FJ8G 2E5LQ 1VQJA 4LUVA 4DV0L 4P73A 3S14H 1TWAH 2RF4A 4GN3B 2GVBA 3BZKA 3CPFA 1SLJA 1IBLQ 1LTLA 3RZDH 1YJ9A 2JA5H 3K0XA 3CCJA 4IPHA 3OYYA 1EWIA 5M3FH 4X62Q 1X9NA 2HQLA 1A0IA 1VQGA 4X64Q 2B63H 3W1GA 2DGYA 1YHBA 1WFQA 4IFDG 1C0AA 3RR5A 1G6PA 5JJKA 1HJPA 3PUXA 5M3MG 4GKJQ 4DUYL 4QJFA 3KFUA 2OWOA 1E1OA 2VQFL 1UEBA 1VCIA 4LF8L 4A3GH 2E5LL 2JQOA 2Z6KC 4JBJA 4DV1Q 1GD7A 1VQ5A 3I4MH 4A3IH 1U5KA 1E7ZA 2UXDQ 2JEBI 2Z6KA 3S24A 3TREA 4DV6L 4DR2Q 1IBLL 4POGA 3HKSA 3HOYG 1UWVA 3KJOA 3HFZB 3HOZH 2HT1A 4A3LH 4X62L 3A5ZB 1E3PA 1FVIA 4X64L 4LF5Q 3HOUG 1QVGA 1XJVA 3T1HQ 1VQ6A 2JEAI 1QVFA 1JB7A 3GTQH 3TRZA 3UDXA 4GKJL 3TS0A 4A3MG 5K36G 1I6HH 5LMNW 5C4JH 4GOPB 4JI3L 1K3RA 4QY7A 3G71A 4IFDJ 4BBSG 2BH8A 3CD6A 4DV1L 1NY4A 1OXSC 1HZ9A 1K0RA 2CCZA 4NXNQ 2VW9A 3S1QH 4DR2L 2UXCQ 2UXDL 2Y0SG 4IPCA 2N78A 4UP9A 5GAGC 1C9OA 4DNIA 1WCMG 4GLVB 4P72A 1YJNA 3GTKH 4LF5L 1SFOH 2KHJA 3NEMA 4YWMA 2VL6A 4C3JH 1Q81C 3CMEA 4IOAA 5IE8A 3T1HL 5BR8L 2L15A 3KDFB 1VQCA 2C35B 5DLQE 4Y52H 1CUKA 5AJ3Q 3I55A 1N33Q 3CC7A 4HJAA 4A76A 4AIMA 1Q46A 3ULJA 4L5RC 2R6GA 4MNOA 3CCQA 4P71A 2MNAA 3PO2G 4LUZA 3EIVA 4NXNL 3CQZH 4UP7A 3B6YA 3K8AA 1VQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PIO A;  4A3K H;  5LMU Q;  2K75 A;  2KCT A;  4JI7 Q;  4P74 A;  2QA4 A;  5EAY A;  1Q7Y C;  3CCR A;  5C0X I;  3H3V I;  3DLL A;  3HOY H;  4IJL A;  3FHW A;  5HY6 A;  3GTP H;  2VNU D;  2IHF A;  4BA1 I;  3CW2 C;  3Q8D A;  1IXR A;  4J15 A;  1Y1V G;  5AJ3 L;  3NBH B;  2VY3 A;  3S2D H;  3A5U A;  4L5T A;  2ZJQ A;  2CWA A;  2K14 A;  4BY7 G;  2R92 H;  3S2H H;  3H0G H;  2GN5 A;  1EUJ A;  5JEA J;  2JA5 G;  1N36 Q;  2OTL A;  3OTO Q;  3F1Z A;  3HKZ G;  2ASB A;  2R93 H;  1HZC A;  5M3F G;  4BBS H;  5LMU L;  2E2J H;  2B63 G;  1YVC A;  4C3H H;  1I5F A;  2I5M X;  1UE6 A;  3WWV A;  1X65 A;  2PQA A;  1EIY B;  1PHJ A;  1XPU A;  4OX9 Q;  2UXB Q;  4DAY B;  1WCM H;  3M4Q A;  1Q8K A;  3CC4 A;  2F52 A;  2NVQ H;  4A3F G;  4GS3 A;  1WI5 A;  1SE8 A;  2AHO B;  5H1S E;  5JJI A;  1KRS A;  4A3G G;  1HNX Q;  3I4M G;  4A3J H;  4A3I G;  2N3S A;  1N9W A;  3CC2 A;  1Q86 C;  4GKK Q;  3ZJY C;  3ER0 A;  3UE1 A;  1NBW A;  5LMN Q;  3OTO L;  1N36 L;  4JI6 Q;  1ASY A;  4ALP A;  3JAM i;  4O0A A;  1CKN A;  2V1C C;  2HIX A;  1TWH H;  1V1Q A;  5M5W H;  1HR0 W;  4LF7 Q;  2OQK A;  3CCE A;  1VQI A;  1X56 A;  2K50 A;  4PZ8 A;  3CCM A;  4HJ5 A;  4OX9 L;  1J6Q A;  1IL2 A;  2UXB L;  4NB3 A;  2K5N A;  1BVS A;  4DR5 Q;  1X54 A;  2ZJP A;  4HJ9 A;  4JOI A;  2BA0 A;  1OXV A;  1QUQ A;  2UUA L;  4BA2 I;  1YNX A;  1HNX L;  3GTG H;  3LGJ A;  1YZ6 A;  1PFS A;  1PH7 A;  2IT1 A;  4A75 A;  4YWL A;  2EIF A;  1AE2 A;  4GKK L;  1E1T A;  1K73 C;  3KOJ A;  4JI1 L;  5LMN L;  1Y1V H;  3L7Z C;  4JI6 L;  3CAM A;  2YU9 H;  2YTX A;  4BY7 H;  3PUW A;  1SN8 A;  4QQB X;  4OON A;  1N8R C;  4LF7 L;  2Q2I A;  4R4C A;  4HID A;  3GTL H;  1GO3 E;  4JV5 Q;  4LF6 Q;  1XPO A;  2EXD A;  2WB1 E;  3KF6 A;  3CMA A;  1XTD A;  1JMC A;  2JA6 G;  2OTJ A;  4JBM A;  3EN2 A;  3G6E A;  3PUZ A;  2IX1 A;  4LFC Q;  2PI2 A;  4XIG S;  5C4X G;  4IPD A;  2Q2U A;  2Q2H A;  3CCS A;  1DGS A;  4A3F H;  1Y1W G;  1PH5 A;  1IBM L;  2KEN A;  4A3K G;  4DV3 Q;  1W2B A;  3S1N H;  2JE6 I;  2MO1 A;  4YCU A;  2ZTE A;  4DV7 Q;  1KD1 C;  2ID0 A;  1VQ9 A;  5FLM G;  3E0E A;  3J80 c;  1OTC A;  4JYA Q;  4UY8 C;  4DKA C;  3K7U C;  4JV5 L;  4LF9 Q;  1EQR A;  1TXY A;  3L0O A;  2E2I H;  3A0J A;  1UE5 A;  3KJP A;  2NVT H;  2NN6 I;  5GRO A;  2LSS A;  4DK6 C;  2FXQ A;  4R4O A;  4A3B G;  5GAH C;  2UUB Q;  2LXJ A;  1VQF A;  1YBY A;  2KHI A;  1ASZ A;  4R1J A;  5ELN A;  3K80 C;  1EQQ A;  1GM5 A;  2UU9 Q;  2F3I A;  3DM3 A;  3H3V H;  2N49 A;  3NEL A;  2R92 G;  3H0G G;  1V43 A;  2A8V A;  3M4O H;  1JJG A;  1OXT A;  1I3Q H;  3M4P A;  3RLF A;  4JBW A;  2R93 G;  2HHH Q;  1X3G A;  2PMZ E;  5FLX c;  4DV3 L;  1J5E Q;  1E24 A;  2I5L X;  3FKI H;  3FP9 A;  4JI5 Q;  4TVA B;  4DV7 L;  3BU2 A;  2AKW B;  3UDF A;  1KQS A;  2E2H H;  4JYA L;  2WP8 J;  2R7D A;  4IPG A;  4LF9 L;  3U4V A;  1RL2 A;  3M9B A;  1GKH A;  4DV4 Q;  2PI2 E;  4OO1 I;  3STB C;  3M3Y H;  3GTJ H;  3I56 A;  4GOP C;  1HR0 Q;  4WJ4 A;  2MQH A;  1MKH A;  2KBN A;  2JA6 H;  5M5X H;  4A3J G;  4KI0 A;  3GO5 A;  5IY0 A;  2AWN A;  1C7Y A;  2Q2T A;  1VQL A;  2UU9 L;  1X3F A;  5IWA Q;  4GOP A;  5JEA G;  2UUC Q;  4LNQ A;  4AYB G;  4GNX B;  4LFB Q;  5C4X H;  1PH3 A;  3S1R H;  2HHH L;  4YWK A;  1J5E L;  3EBE A;  4JI5 L;  1VQB A;  4UP8 A;  2NZO A;  1VQ4 A;  1Y1W H;  4RG1 A;  1PH4 A;  1CKM A;  1MIU A;  2HIV A;  4DV2 Q;  4DR4 Q;  1KL9 A;  4B3S Q;  4DV4 L;  1KC8 C;  1XNR Q;  3I4O A;  5FLM H;  1X6O A;  1E22 A;  2PNH A;  1TWC H;  2VZA A;  1HR0 L;  1EOV A;  1YJW A;  3KDF A;  3A74 A;  1I94 Q;  3CCU A;  1Y14 B;  2UUC L;  3L2P A;  5IWA L;  3OW2 A;  4R4Q A;  1JE5 A;  3CCV A;  2NVY H;  4QL5 A;  3HOX H;  4A3B H;  3AQQ A;  2JK8 A;  4LFB L;  4PMW A;  3VDY A;  2B29 A;  2Y0S E;  3MXN B;  1L1O B;  4LWC A;  1N33 L;  2ZM6 Q;  3S16 H;  2VQE Q;  1HZB A;  2R7F A;  1YEZ A;  2JA7 G;  2QGQ A;  1V9P A;  3AYH B;  2IY5 B;  4BBR G;  1AH9 A;  3S1M H;  4DV2 L;  3RLN A;  4DR4 L;  3G48 A;  4B3S L;  4PZ6 A;  4JI7 L;  3I7F A;  3I4N H;  2K5H A;  4AH6 A;  2WAQ G;  1OXX K;  1B8A A;  4GN4 B;  1A8V A;  4QIW E;  4FDB A;  5GQO A;  4EX5 A;  1PA6 A;  3K7A H;  1PH2 A;  1I94 L;  1VQN A;  5IYB H;  1VQO A;  1W3S A;  2YTY A;  1EFW A;  1K9M C;  2BA1 A;  3J81 i;  3PF5 A;  4WJ3 M;  1KHI A;  3TEH B;  4C3I H;  2ZM6 L;  2VQE L;  3J7A 5;  1K8G A;  4HIO A;  1IYJ B;  3U4Z A;  3PF4 A;  4A3C G;  1CKO A;  1SRU A;  3U58 A;  1G51 A;  4KLK A;  4HJ7 A;  3ICE A;  1CKN B;  3KF8 B;  3D0F A;  4JOI C;  3E9I A;  5C0X G;  3GTO H;  3F8T A;  2YV5 A;  4IFD I;  2K52 A;  4JI4 Q;  3TQY A;  5IYD G;  3UDI A;  4C2M H;  4RMF A;  3H15 A;  4GLX A;  2AMC B;  5ELO A;  3HKZ E;  1A63 A;  3FKI G;  4X6A H;  3E9H A;  4POF A;  4YHH Q;  4UPA A;  4JI0 Q;  4DV0 Q;  1VQM A;  1EYG A;  3CXC A;  5IYC G;  3JAM c;  1YHQ A;  2VUM H;  4MZ9 A;  1TWF H;  3J81 j;  2JA7 H;  3GDE A;  4EQ5 A;  1VQK A;  1XNQ Q;  4BBR H;  1Q12 A;  1VQH A;  3PO3 G;  5IP7 H;  1BBW A;  1KRT A;  4AQY Q;  2YTV A;  1PH9 A;  4B3T Q;  2GVA A;  4BXX G;  1P16 A;  4DK3 C;  1SMX A;  3KF6 B;  2UXC L;  4K0K Q;  4OWX B;  4DR5 L;  4JI4 L;  1X55 A;  4B3R Q;  5C44 H;  2VS1 A;  5C3E H;  2A1A A;  3KLW A;  4APV A;  4QGU A;  4YY3 Q;  3CF5 A;  3RN5 A;  5C0X J;  1XPR A;  1FGU A;  1PH6 A;  4YHH L;  1JJC B;  4JI0 L;  4A3E G;  3UE0 A;  1D7Q A;  1CSP A;  1Z9F A;  2D0P A;  4DR3 Q;  3ULP A;  2MFI A;  1QZH A;  4IOC A;  3RZO H;  2A19 A;  3I2Z A;  4JI2 Q;  1MJE A;  2ATW A;  1XMO Q;  1LUZ A;  4YCV A;  4DV6 Q;  1CSQ A;  1K83 H;  4JCV E;  3ULL A;  4LF6 L;  1XNQ L;  3J80 i;  4OWW B;  4AQY L;  5GAD C;  4IO9 A;  4A3C H;  1NE3 A;  2CKZ B;  1Q82 C;  4B3T L;  2JA9 A;  5M5Y H;  3HOX G;  4K0K L;  4LFC L;  3CPW A;  3AFP A;  3M7N A;  1WJJ A;  3F2C A;  4B3R L;  4BY1 G;  4HIM A;  2K5V A;  4GN5 A;  3W5O A;  2RHQ B;  3STB D;  1PH1 A;  4YY3 L;  1NMG A;  3CP0 A;  5IYD H;  2R7Z G;  2CWP A;  2ZTC A;  3IRB A;  4JI3 Q;  4A93 G;  2RCN A;  3NEN A;  4DV5 Q;  3PUY A;  4LW1 A;  4DR3 L;  3PV0 A;  4DR7 Q;  4PG3 A;  1VQA A;  3I4N G;  4R4T A;  3G4S A;  2ZJR A;  2BH2 A;  4JI2 L;  1XMO L;  1PH8 A;  3S17 H;  1KAW A;  3HOW G;  4ME3 A;  1IZ6 A;  3T1Y Q;  2NVX H;  1WOC A;  5IYC H;  3D31 A;  1UE7 A;  3TS2 A;  5IYB G;  4JBK A;  2WFW A;  2Z0S A;  2F4V Q;  3PO3 H;  2UUB L;  1A62 A;  4JI8 Q;  2B3G A;  5IP9 H;  1Z47 A;  5BR8 Q;  1YIT A;  4BXX H;  2D0O A;  1QVC A;  1FJG Q;  4R4I A;  1EIF A;  1KIX A;  4DV5 L;  4LFA Q;  1VQE A;  1YIJ A;  2I5H A;  1YHA A;  3BZC A;  4DR7 L;  4A4I A;  3AEV A;  2OCE A;  1IBK Q;  5FJ8 H;  2ES2 A;  4A3E H;  1Q1E A;  4P75 A;  3ERS X;  3T1Y L;  1HNZ Q;  3UDG A;  1OXU A;  2NN6 G;  2D62 A;  4GNX C;  3GD7 A;  2F4V L;  1K8A C;  1PV4 A;  1RIP A;  1S3O A;  1SRO A;  4JC0 A;  4JI8 L;  4DAM A;  1FL0 A;  2KCM A;  3U50 C;  3F2D A;  4GNX A;  1NJI C;  4IJH A;  3PUV A;  4XTC S;  1BBU A;  1G29 1;  4JG2 A;  3PGZ A;  3KYH C;  4LUO A;  4BY1 H;  2VUM G;  1FJG L;  1WYD A;  5M3M H;  1B7Y B;  1SR3 A;  4X65 Q;  4PZ7 A;  4LFA L;  4DR6 Q;  3J7Z C;  2MO0 A;  3AFQ A;  2JA8 G;  1B70 B;  5IP7 G;  2R7Z H;  3PCO B;  1IBK L;  3RLO A;  1LYL A;  4NXM Q;  2DUD A;  4A93 H;  1HNZ L;  2CFM A;  3GTM H;  1N34 Q;  1XNR L;  1PVO A;  1TWG H;  2JJQ A;  4OO1 G;  5C44 G;  1JT8 A;  1VQP A;  4AYB E;  1MJC A;  1S40 A;  1N32 Q;  1L1O C;  3HOW H;  5C3E G;  3HOV G;  1O7I A;  2RHS B;  4DPG A;  1R9T H;  4A3D G;  2PQA B;  1I50 H;  1L1O A;  1UE1 A;  1NMF A;  4DUZ Q;  1M90 C;  1PYB A;  2NZH A;  2XGT A;  4TQU S;  3HOU H;  3MEF A;  1BKB A;  1T9H A;  1HNW Q;  5J3B A;  2E8G A;  1XMQ Q;  4HJ8 A;  1L2F A;  4X65 L;  1JJ2 A;  4DR6 L;  4KHZ A;  4DR1 Q;  4A3M H;  3F2B A;  4B3M Q;  1HZA A;  2IHE A;  2LXK A;  4OWT B;  4NXM L;  3PIP A;  2K4K A;  1LM0 A;  1VQD A;  4X66 Q;  1N34 L;  1S72 A;  1L0W A;  1PYS B;  5GAE C;  1N32 L;  4LF4 Q;  4O2D A;  3M85 A;  1HH2 P;  2H5X A;  2ZTD A;  1D8L A;  3J81 c;  2WB1 G;  4DUZ L;  2UUA Q;  1YI2 A;  2N8N A;  5HGQ A;  3K81 C;  5IT9 c;  1HNW L;  1XMQ L;  1U0L A;  1QUQ B;  2AWO A;  3CCL A;  4KHP Q;  3BJU A;  1Q1B A;  4JI1 Q;  2WAQ E;  4DR1 L;  5E7N A;  3SGI A;  4B3M L;  3HOZ G;  4MTN A;  4NPS A;  1M1K C;  4A3L G;  5JJL A;  2YYZ A;  4H02 A;  4X66 L;  1AE3 A;  2JA8 H;  3PO2 H;  4OXP A;  3PSI A;  5IP9 G;  3RN2 A;  1KXL A;  3W1B A;  2XTI A;  4GLA C;  1VQ7 A;  4L5Q A;  4HIK A;  2I0Q A;  2ALY B;  4LF4 L;  4YCW A;  1VS0 A;  1H95 A;  3RNU A;  1QZG A;  1GVP A;  3HOV H;  4L5S A;  3JC6 6;  1NTG A;  2QEX A;  1X3E A;  2CQO A;  2IX0 A;  2OQ0 A;  1P8L A;  2VQF Q;  4DUY Q;  3S15 H;  4Y7N H;  1IBM Q;  4A3D H;  2EQS A;  4KHP L;  4LF8 Q;  5FJ8 G;  2E5L Q;  1VQJ A;  4LUV A;  4DV0 L;  4P73 A;  3S14 H;  1TWA H;  2RF4 A;  4GN3 B;  2GVB A;  3BZK A;  3CPF A;  1SLJ A;  1IBL Q;  1LTL A;  3RZD H;  1YJ9 A;  2JA5 H;  3K0X A;  3CCJ A;  4IPH A;  3OYY A;  1EWI A;  5M3F H;  4X62 Q;  1X9N A;  2HQL A;  1A0I A;  1VQG A;  4X64 Q;  2B63 H;  3W1G A;  2DGY A;  1YHB A;  1WFQ A;  4IFD G;  1C0A A;  3RR5 A;  1G6P A;  5JJK A;  1HJP A;  3PUX A;  5M3M G;  4GKJ Q;  4DUY L;  4QJF A;  3KFU A;  2OWO A;  1E1O A;  2VQF L;  1UEB A;  1VCI A;  4LF8 L;  4A3G H;  2E5L L;  2JQO A;  2Z6K C;  4JBJ A;  4DV1 Q;  1GD7 A;  1VQ5 A;  3I4M H;  4A3I H;  1U5K A;  1E7Z A;  2UXD Q;  2JEB I;  2Z6K A;  3S24 A;  3TRE A;  4DV6 L;  4DR2 Q;  1IBL L;  4POG A;  3HKS A;  3HOY G;  1UWV A;  3KJO A;  3HFZ B;  3HOZ H;  2HT1 A;  4A3L H;  4X62 L;  3A5Z B;  1E3P A;  1FVI A;  4X64 L;  4LF5 Q;  3HOU G;  1QVG A;  1XJV A;  3T1H Q;  1VQ6 A;  2JEA I;  1QVF A;  1JB7 A;  3GTQ H;  3TRZ A;  3UDX A;  4GKJ L;  3TS0 A;  4A3M G;  5K36 G;  1I6H H;  5LMN W;  5C4J H;  4GOP B;  4JI3 L;  1K3R A;  4QY7 A;  3G71 A;  4IFD J;  4BBS G;  2BH8 A;  3CD6 A;  4DV1 L;  1NY4 A;  1OXS C;  1HZ9 A;  1K0R A;  2CCZ A;  4NXN Q;  2VW9 A;  3S1Q H;  4DR2 L;  2UXC Q;  2UXD L;  2Y0S G;  4IPC A;  2N78 A;  4UP9 A;  5GAG C;  1C9O A;  4DNI A;  1WCM G;  4GLV B;  4P72 A;  1YJN A;  3GTK H;  4LF5 L;  1SFO H;  2KHJ A;  3NEM A;  4YWM A;  2VL6 A;  4C3J H;  1Q81 C;  3CME A;  4IOA A;  5IE8 A;  3T1H L;  5BR8 L;  2L15 A;  3KDF B;  1VQC A;  2C35 B;  5DLQ E;  4Y52 H;  1CUK A;  5AJ3 Q;  3I55 A;  1N33 Q;  3CC7 A;  4HJA A;  4A76 A;  4AIM A;  1Q46 A;  3ULJ A;  4L5R C;  2R6G A;  4MNO A;  3CCQ A;  4P71 A;  2MNA A;  3PO2 G;  4LUZ A;  3EIV A;  4NXN L;  3CQZ H;  4UP7 A;  3B6Y A;  3K8A A;  1VQ8 A; 
#chains in the Genus database with same CATH topology
 4A3K H;  4WOR A;  3SE0 A;  4XYO A;  1Q7Y C;  1LO5 D;  1PRT D;  4IJL A;  5CV8 A;  1ROD A;  3TN2 A;  1BUV T;  3S1N B;  5AJ3 L;  2CWA A;  1XYI A;  2R92 H;  3NTK A;  3S2H H;  4CDD C;  3K5O A;  3FPU B;  1N36 Q;  2OTL A;  2NVT B;  1EWC A;  5M3F G;  4BBS H;  4PV1 C;  2EY6 A;  1YVC A;  2BDN A;  2I5M X;  1UE6 A;  1X65 A;  3D3R A;  2PQA A;  1EIY B;  1XPU A;  4DAY B;  1WCM H;  2L1B A;  2XN9 C;  3M4Q A;  3CC4 A;  2MJ8 A;  2NBF A;  5JJI A;  2F0O A;  4A3G G;  5D14 A;  3FKI B;  4C1N I;  4A3J H;  4A3I G;  4JVZ A;  1PTO H;  4GKK Q;  3CC2 A;  1Q86 C;  3ER0 A;  2KQ3 A;  1FYC A;  3OTO L;  1KDB A;  3M3Y B;  4EQN A;  1CKN A;  5M5W H;  1HR0 W;  2VB2 X;  2OQK A;  1EYA A;  2K50 A;  2UXB L;  2P5Z X;  4DR5 Q;  3HEJ A;  1ZKO A;  1X54 A;  1GXD C;  2L12 A;  1YNX A;  4ODG A;  4HED A;  1QWY A;  4RFB A;  4YWL A;  4KV6 A;  1LLR D;  1DCZ A;  4H44 C;  5LMN L;  3L7Z C;  3CAM A;  4BY7 H;  2RCF A;  5ELF A;  1TWC B;  4OON A;  4JV5 Q;  3GTL H;  1XPO A;  2JA6 G;  3CMA A;  4JBM A;  3PUZ A;  4LFC Q;  4XIG S;  3DM1 A;  4BY1 B;  2HQE A;  4IPD A;  4M1U B;  2Q2U A;  2Q2H A;  1AZQ A;  3E0J A;  1Y1W G;  1PH5 A;  2LMC B;  5DM6 3;  3S1N H;  1W2B A;  2JE6 I;  3MC0 B;  4HN7 A;  1PZJ D;  3J80 L;  2B2W C;  3J80 c;  1Y69 U;  2ENB A;  2NVT H;  2TSS A;  2B2W A;  2K5D A;  4X3T A;  5GRO A;  3G6J B;  2WV6 D;  3HP3 A;  3JAM E;  2FXQ A;  4R4O A;  2LXJ A;  1PTO D;  2C9O A;  2KHI A;  4R1J A;  1K8O A;  3K80 C;  2F3I A;  4FF4 A;  2EYF A;  2N49 A;  2Z9H A;  5FLX L;  3M4O H;  2ICE C;  1QNK A;  2R93 G;  4OIK A;  5FLX c;  4DV3 L;  1E24 A;  3FKI H;  4WFN 3;  2PZT A;  1PTO F;  4Q0F A;  4YIJ A;  1WD1 A;  3M3Y H;  4GOP C;  4K8I A;  1DOM A;  1BDO A;  1HR0 Q;  1MKH A;  2G5D A;  3K59 A;  4KI0 A;  4C3I G;  3ITP A;  2AWN A;  5IY0 A;  2Q2T A;  2Z1C A;  1VQL A;  4GOP A;  5JEA G;  4EQP A;  4NW2 A;  4X3S A;  2VUM B;  3MZ5 A;  3O13 A;  2JA7 B;  2B2V C;  2DNC A;  4YWK A;  1J5E L;  4BBR B;  1Z6H A;  4RG1 A;  1PH4 A;  2B2V A;  2VXW A;  2HCC A;  1KL9 A;  4HTH A;  1DOK A;  4J8Q A;  4DV4 L;  2WAQ B;  1EIG A;  5FLM H;  3HGB A;  1TWC H;  4OHJ A;  1EOV A;  3A74 A;  5CC4 A;  4A3D B;  3CCU A;  2UUC L;  3CRK C;  2QDB A;  3OW2 A;  1PLF A;  3CCV A;  1KNA A;  2M2L A;  1N33 L;  3NQI A;  2VQE Q;  1HZB A;  1YEZ A;  2RBM A;  4I7Z C;  4DV2 L;  3RLN A;  4DR4 L;  5M5Y B;  3R8B A;  2IX3 A;  2A6E D;  1TKW B;  2NWG A;  4FVM A;  4GN4 B;  4FDB A;  1G6Z A;  2F3W A;  1M4V A;  1HRJ A;  2WB1 B;  2YTY A;  3DMU A;  2BA1 A;  3J81 i;  1KHI A;  1J8I A;  2F0U A;  4A3C G;  1CKO A;  1SNO A;  3PO3 B;  1CM9 A;  1NUC A;  5A2Q E;  4KLK A;  3U9S A;  1STB A;  1CKN B;  3KF8 B;  3QG1 A;  3E9I A;  1STA A;  2WAC A;  1GUS A;  5K5P A;  1O7Z A;  1LTA D;  3TQY A;  5IT9 L;  3UDI A;  4GLX A;  4RMF A;  1D1I A;  3H15 A;  1RD9 D;  3E9H A;  4YHH Q;  4UPA A;  1A2U A;  1EYG A;  2K5W A;  5IGF A;  1B53 A;  1YHQ A;  3RUZ A;  2VUM H;  2I07 B;  3J81 j;  2LFN A;  2JA7 H;  2H4O A;  3GDE A;  4BBR H;  1Q12 A;  2PMZ B;  3FRP B;  1KRT A;  4B3T Q;  2NTS A;  1QB5 D;  1SMX A;  4K0K Q;  4DR5 L;  5CV6 A;  4OO1 H;  3DUZ A;  4YY3 Q;  2K5Q A;  1FGU A;  3M4Y A;  1JJC B;  2A68 D;  3P7J A;  4A3E G;  4JI0 L;  4N9T A;  1Z9F A;  2D0P A;  2MFI A;  2EE1 A;  1HCZ A;  3I2Z A;  1MJE A;  2ATW A;  1EY6 A;  2TMP A;  1XMO Q;  1CSQ A;  3HOY B;  2VB3 X;  4OWW B;  5GAD C;  1I50 B;  3HOU B;  5M5Y H;  4LFC L;  3CPW A;  1CA5 A;  1STN A;  2N88 A;  3STB D;  3QJY A;  3K6O A;  1GUT A;  4A3M B;  2R7Z G;  3TSS A;  4JI3 Q;  2ZTC A;  4A93 G;  1PZI D;  4LW1 A;  3PV0 A;  4TRD A;  2CH4 A;  4R4T A;  4DAV A;  4JI2 L;  4ME3 A;  1IZ6 A;  1GUO A;  5IYC H;  5IYB G;  4JBK A;  5G3L D;  2Z0S A;  2F4V Q;  3PO3 H;  1ET9 A;  5EKK A;  1A2T A;  3ERQ A;  3BDC A;  1WTX A;  3HS0 C;  3CU7 A;  1CT1 D;  4R4I A;  1IYV A;  1STH A;  4DR7 L;  2OCE A;  5G3L F;  1HNZ Q;  2KHS A;  3UDG A;  3C2P A;  2NN6 G;  4GNX C;  3EFX D;  2QCP X;  2QF7 A;  1U4P A;  1K8A C;  3J80 E;  1SRO A;  4RCO A;  4GNX A;  1U4M A;  4IJH A;  2F0L A;  1BBU A;  3PGZ A;  3F2U A;  4HMI A;  1FJG L;  1WYD A;  4KJN A;  1B7Y B;  3J7Z C;  5A35 A;  3AFQ A;  2JA8 G;  4RKL A;  1B70 B;  5KGU A;  1IBK L;  1XTC D;  1CHP D;  5M3F B;  2CH4 W;  2KCN A;  5JVH 3;  1N34 Q;  2JJQ A;  3BZD B;  5C44 G;  1VQP A;  1L1O C;  1B3Q A;  5BN4 A;  1I50 H;  1TS3 A;  3KLR A;  1L1O A;  4A3G B;  4XT3 B;  3HOU H;  1PYB A;  1CZG A;  1NNX A;  3A55 A;  3VYS A;  1T9H A;  4A3I B;  1XMQ Q;  5KEE A;  4A3M H;  3H3V C;  1HZA A;  1XWE A;  1PRT C;  2K4K A;  3UI2 A;  4X66 Q;  4MHE A;  1BCP C;  4O2D A;  4CJ2 C;  5ELE A;  2H5X A;  3IL8 A;  4C56 C;  4DUZ L;  2LS0 1;  1EOT A;  1U0L A;  3VYR A;  2MUY A;  2A74 C;  4DR1 L;  2FMC A;  4MTN A;  4NPS A;  1M1K C;  1NR4 A;  5C4H A;  4H02 A;  1SDF A;  3PSI A;  3W1B A;  2XTI A;  5DNF A;  1VQ7 A;  4L5Q A;  2IW3 A;  1KLG D;  1WTH A;  5COR A;  5C5M A;  1D5Z C;  1GVP A;  3JC6 6;  1HXY D;  2OQ0 A;  1Y1W B;  2VQF Q;  1GJX A;  3D6C A;  4KHP L;  4IUU A;  4WJW A;  4LUV A;  3X3M A;  4P73 A;  1AW7 A;  4ULL A;  5HUR A;  1LAB A;  3P75 A;  2XIW A;  1NAP A;  1IBL Q;  3GTP B;  1AN8 A;  5FO9 B;  5M3F H;  4ZYS A;  1A0I A;  4X64 Q;  3BDO A;  1EYC A;  2DGY A;  1YHB A;  2AUJ D;  3NE5 B;  2PZU A;  3V96 A;  4GKJ Q;  2OWO A;  1VCI A;  2R93 B;  4LF8 L;  4A3G H;  2E5L L;  4DV1 Q;  1IW7 D;  1GD7 A;  4KMU C;  4K2K A;  4A3I H;  1QIL A;  1U5K A;  2JEB I;  2NB0 A;  3S24 A;  3TRE A;  1TY0 A;  1L0Y B;  4IQZ A;  2NVQ B;  1D2B A;  3A5Z B;  1DON A;  4U67 3;  1BNZ A;  1MI2 A;  5EBC A;  3BVZ A;  1JB7 A;  4KD4 A;  3TS0 A;  1JOK A;  5LMN W;  4JI3 L;  4QY7 A;  3G71 A;  4IFD J;  5FK9 C;  4RGN A;  2FIN B;  2JSO A;  2UXC Q;  4IAL A;  1I4X A;  4IPC A;  3T56 B;  4P72 A;  1LAC A;  4LF5 L;  4IOA A;  2L15 A;  1I4H A;  2C35 B;  4C1N K;  5AJ3 Q;  2YU9 B;  5CV9 A;  1Q46 A;  2R6G A;  4P71 A;  4X3K A;  4DGZ A;  4LUZ A;  1CZW A;  3Q24 A;  4NXN L;  1PFN A;  3R93 A;  3NUC A;  2FFK B;  3QIA A;  4ABN A;  2QA4 A;  2K01 A;  3EQL C;  5C0X I;  3DLL A;  3GTP H;  2VNU D;  1F9Q A;  3SK6 A;  2HD3 A;  1G8Z D;  3CW2 C;  1SSO A;  1Y1V G;  1PYW D;  3NBH B;  2ZJQ A;  4L5T A;  2O5J C;  1IHZ A;  5CBA E;  1EUJ A;  5IGD A;  2EY5 A;  2A5H A;  3OTO Q;  2R93 H;  2ZT9 C;  5LHY 1;  2B63 G;  2K04 A;  5BN5 A;  3DXJ C;  2UXB Q;  2NVQ H;  4A3F G;  3DEP A;  1I3Q B;  2AHO B;  5H1S E;  1KRS A;  1BCP B;  2E75 C;  3I4M G;  2N3S A;  2EVB A;  1N9W A;  1JWU D;  1YNN D;  1TS4 A;  3ZJY C;  5J22 A;  5JEA H;  3UE1 A;  5LMN Q;  4ALP A;  1S5B D;  4DNT B;  5ELC A;  4O0A A;  5EBD A;  3JAM i;  2HIX A;  1TWH H;  1V1Q A;  3LWE A;  1VQI A;  1X56 A;  2BE5 C;  1VDZ A;  1SYD A;  1J6Q A;  1IL2 A;  1BVS A;  1X32 A;  1SMY D;  2ZJP A;  2MP1 A;  1QUQ A;  1SYE A;  1PH7 A;  1YZ6 A;  3T51 B;  4HR7 B;  3VR2 A;  1E1T A;  1K73 C;  4JI6 L;  2YU9 H;  1SN8 A;  2ZXP A;  4HID A;  1GO3 E;  4LF6 Q;  2WB1 E;  4K5V A;  1GOZ A;  1HTL D;  2IX1 A;  2PI2 A;  3K0Y A;  5C4X G;  3S16 B;  3T4A C;  4KN4 C;  2R7Z B;  2KEN A;  4DV3 Q;  4RKB A;  2MO1 A;  1FNW A;  1UNS A;  2ZTE A;  4DNR B;  1VQ9 A;  1OTC A;  1JOO A;  4ZCK A;  5IOD A;  4DKA C;  1EQR A;  1TXY A;  3L0O A;  4DK6 C;  2IJ0 A;  3J7A V;  2UUB Q;  4A3B G;  2SNM A;  2F0S A;  1GM5 A;  3H3V H;  2KJX A;  2KA7 A;  3NEL A;  2EZV A;  1V43 A;  1DM0 B;  2ZXR A;  3K57 A;  1I3Q H;  2PMZ E;  1J5E Q;  1MD2 D;  5EGT A;  3FP9 A;  2F3V A;  2AUK A;  4C3H G;  4DV7 L;  3BU2 A;  5IGC A;  1A15 A;  2WP8 J;  2R7D A;  2JYO A;  5CYU A;  1EZ6 A;  1GKH A;  3TP7 A;  4DV4 Q;  4OO1 I;  3STB C;  3HG9 A;  2F0J A;  2RQX A;  3GO5 A;  2UUC Q;  1X3F A;  4DXG A;  2M00 A;  4G4K A;  3KBX A;  1KTK A;  4AYB G;  1PH3 A;  3LNN A;  1DJR D;  2OT2 A;  4CGY B;  2L55 A;  2HHH L;  4ZLT F;  4LAA A;  5J39 A;  4JI5 L;  4UP8 A;  1VQ4 A;  1WTV A;  4NDX A;  1CKM A;  1MIU A;  2HIV A;  3GP7 A;  3A8K E;  4KJO A;  4OIJ A;  3C1F A;  3MA2 B;  4DV2 Q;  4DR4 Q;  4V0B A;  5EKI A;  3I4O A;  3RD4 A;  5C44 B;  2PNH A;  4DU9 A;  1TII D;  3KDF A;  3CRL C;  1TU2 B;  2HDL A;  1Y14 B;  1F9R A;  3A54 A;  2JK8 A;  2EJM A;  2B29 A;  2Y0S E;  3S16 H;  2WIN B;  1K83 B;  2KEE A;  4FP5 D;  2B2T C;  2RDG A;  1SJH D;  1V1P A;  2EY1 A;  3MVV A;  2Z8L A;  3G48 A;  2B2T A;  1D5M C;  1F9P A;  2FJ2 A;  1SE3 A;  1A8V A;  5GQO A;  4FF2 A;  1PA6 A;  5IYB H;  1VQO A;  4G7H C;  4WJ3 M;  1G2S A;  2ZM6 L;  3S17 B;  4RHS A;  2O5I C;  1IYJ B;  2Q8T A;  5I6Y A;  1G51 A;  4HJ7 A;  5EJW A;  1BCP F;  5I9O A;  3D0F A;  4ME5 A;  2NN6 H;  5IYD G;  3SDZ A;  4IN3 A;  5ELO A;  2B8G A;  3TZU A;  2F0K A;  4POF A;  3QO2 A;  4JI0 Q;  4DV0 Q;  5F2D A;  4IUT A;  3RMH A;  1BBW A;  1KAB A;  2YTV A;  2GVA A;  4BXX G;  2UXC L;  3VA7 A;  1H9J A;  4JI4 L;  1TR5 A;  1C8C A;  4ILW A;  5C44 H;  3KLW A;  4QGU A;  1XPR A;  2HDM A;  1LT6 D;  4KTA A;  4UHV A;  2KCC A;  3IKJ A;  3ULP A;  1QZH A;  4IOC A;  1QNU A;  2A19 A;  4JI2 Q;  1Z7T A;  4H7B A;  1LUZ A;  2F0V A;  2E2D C;  2Z6B A;  1K83 H;  3I70 A;  3QOJ A;  4YCV A;  4ZK9 B;  4DV6 Q;  3J80 i;  1R9T B;  4LF6 L;  4AQY L;  2CKZ B;  3OIQ A;  2MGS A;  1TS2 A;  4ZKB B;  3L3O C;  4F8M A;  1WJJ A;  1UUP A;  2CW0 D;  5C0X H;  1S5F D;  4F7X A;  3WOF A;  1KDC A;  4IUP A;  1A3U A;  4R8I A;  1EFI D;  4DR3 L;  4DR7 Q;  1VQA A;  3I4N G;  2F0E A;  4JW0 A;  3S17 H;  3HOW G;  2PYK A;  5D3D A;  1WOC A;  3L9A X;  4FYD A;  3WDN A;  4HCS A;  1B50 A;  1ESF A;  2UUB L;  3H94 A;  5IOC A;  1I6V C;  1SNC A;  4UDU C;  4QIW B;  2EYL A;  1QVC A;  1FJG Q;  1EIF A;  4DV5 L;  1GUN A;  1VQE A;  1YIJ A;  1RKN A;  1SE2 A;  1TT2 A;  5JJZ A;  1IBK Q;  2ES2 A;  1Q1E A;  4P75 A;  4F88 A;  1CK1 A;  1A6X A;  1CI3 M;  5JAV A;  4H0L C;  4MIU A;  3C1E A;  4J6H A;  1PV4 A;  1S3O A;  1QOH A;  1NJI C;  1FL0 A;  2KCM A;  3U50 C;  5TSS A;  3S15 B;  4UAI A;  3PUV A;  3TP6 A;  1G29 1;  2O2L D;  4E6I A;  3NSW A;  3S14 B;  4LUO A;  3KYH C;  4BY1 H;  2F0Q A;  4LFA L;  4PZ7 A;  1AZP A;  2WKD A;  5IP7 G;  2ICI A;  5CV7 A;  3RLO A;  1EQV A;  2DUD A;  1B9M A;  2QIL A;  2B63 B;  1V1P B;  1SYC A;  1TVX A;  3HOV G;  1O7I A;  3SK8 A;  2RHS B;  1R9T H;  4A3F B;  2PQA B;  1UE1 A;  1NMF A;  2IL8 A;  4DUZ Q;  2NZH A;  2XGT A;  5JPN C;  3I4M B;  2E8G A;  2OEO A;  5E3F A;  1GHJ A;  4DR1 Q;  1RDP D;  3F2B A;  1NSN S;  4OWT B;  1S72 A;  2D9U A;  1PXU A;  1N32 L;  3J81 L;  3M85 A;  1HH2 P;  2XSC A;  1D8L A;  1Y8N B;  3J81 c;  3U9O A;  5KND A;  5IT9 c;  4GZY C;  3CCL A;  4KHP Q;  3LWU A;  4KY5 A;  1Q1B A;  4JI1 Q;  3HOZ G;  5JJL A;  1AP0 A;  2YYZ A;  4C3J B;  3ND9 A;  5IP9 G;  3RN2 A;  1SXT A;  4HIK A;  1V1O A;  4RAU C;  1VS0 A;  1H95 A;  2K03 A;  5C5L A;  2QEX A;  1X3E A;  2Z4H A;  2IX0 A;  3OW7 A;  3S15 H;  4A3D H;  3CQZ B;  1U9R A;  1WTP A;  2EQS A;  1TQO A;  1IBM Q;  3T16 A;  5FJ8 G;  3DWA A;  1BQQ T;  1VQJ A;  4DV0 L;  2E5L Q;  3PMF A;  4LF8 Q;  3S14 H;  2RF4 A;  2E76 C;  2GVB A;  3CPF A;  1LTL A;  1SMY C;  3OYY A;  1EWI A;  1VQG A;  2NVY B;  2B63 H;  4K6D A;  4NKL A;  4P2C B;  4IFD G;  4ZQ3 A;  4ID6 A;  2F0H A;  5M3M G;  1Q8I A;  4QJF A;  5EPJ A;  1E1O A;  2XWB B;  2C5C A;  2Z6K C;  4JBJ A;  2E2J B;  5D3I B;  4C3H B;  3I4M H;  1E7Z A;  2Z6K A;  2Y0S B;  4DV6 L;  1O7L A;  1FD7 D;  1BR9 A;  1UWV A;  2RVL A;  2HT1 A;  4A3L H;  2L11 A;  4X62 L;  4LF5 Q;  1E3P A;  1ZYR D;  1MSH A;  2JXM B;  3R2T A;  3NPP A;  1QVF A;  1EY4 A;  3H91 A;  4AYB B;  2PW5 A;  1GUW A;  4O1N A;  1IL8 A;  5K36 G;  4GOP B;  4DK1 A;  3MXP A;  4BBS G;  2BH8 A;  1HQR D;  3CD6 A;  1ONL A;  3MXU A;  1NY4 A;  4DA2 A;  4NXN Q;  5CV4 A;  2UXD L;  4DR2 L;  2DNE A;  5GAG C;  1C9O A;  1WCM G;  1K0S A;  5KNB A;  1YJN A;  3DHQ A;  2BCO A;  2VL6 A;  4C3J H;  3GTG B;  3T1H L;  3MAQ A;  3N52 A;  1A3T A;  5DLQ E;  1CUK A;  1EEI D;  4HJA A;  2LY7 A;  3ULJ A;  1ENA A;  3PO2 G;  3EIV A;  3CQZ H;  4UP7 A;  3B6Y A;  5NUC A;  4CDC C;  5IGG A;  2EJG C;  2K75 A;  5FLX E;  4JI7 Q;  5EAY A;  3H3V I;  3CCR A;  1O7Y A;  3Q0A A;  2AQ1 B;  3HOY H;  5HY6 A;  3CKI B;  2IHF A;  4XQN A;  2G9H D;  3MXN A;  5JVG 3;  5JPM C;  2RSN A;  1IXR A;  4J15 A;  3EVQ A;  1GHK A;  2K14 A;  3AB9 A;  2Z4I A;  4BY7 G;  4KN7 C;  1H9R A;  5JEA J;  2JA5 G;  4Z9C B;  3HKZ G;  2ASB A;  5D65 A;  1HZC A;  1DZ1 A;  1ET6 A;  5LMU L;  2E2J H;  4C3H H;  2AQ2 B;  1I5F A;  3K58 A;  3WWV A;  1PHJ A;  1R4Q B;  3N6R A;  1BBX C;  3VR3 A;  2F52 A;  4GS3 A;  1MGS A;  3BG3 A;  2PNR C;  1SJE D;  3GV3 A;  2E2H B;  3A8I E;  2F0I A;  5AFW A;  1GUG A;  2HUG A;  4JI6 Q;  3SK4 A;  3VR6 A;  1C4Q A;  1EWH A;  3OHX C;  4XDX A;  1ILP A;  3GTJ B;  3CCE A;  2JA6 B;  3D4D A;  1F77 A;  2CVR A;  3R2I A;  3J7A F;  3CCM A;  4HJ5 A;  4OX9 L;  3AMU A;  3BVG A;  4NMZ A;  4HJ9 A;  3S1R B;  4JOI A;  2BA0 A;  3SEB A;  4BA2 I;  1G2T A;  1HNX L;  3GTG H;  1PFS A;  2IT1 A;  4A75 A;  2RDF A;  1T5X D;  3M7G A;  4U68 A;  3KOJ A;  1JWM D;  4JI1 L;  1X3Q A;  2E74 C;  1K28 A;  3PUW A;  3KUP A;  1N8R C;  4QQB X;  4PMC A;  2Q2I A;  4R4C A;  4LF7 L;  2OTJ A;  4DK0 A;  5DAU A;  3OWE B;  4BWG B;  3EN2 A;  3G6E A;  1BXT A;  3Q6S A;  4LMQ D;  3MFG A;  1IBM L;  1HA5 A;  1ML0 D;  3MHB A;  3BYT B;  2K28 A;  3BYY B;  4HAE A;  1KD1 C;  4DV7 Q;  3I4N B;  2ID0 A;  5IT9 E;  2EYJ A;  3DEO A;  5FLM G;  1HUN A;  3HOW B;  3A0J A;  3DWQ A;  4HCE A;  2NN6 I;  3K7A B;  1KDA A;  1YBY A;  4O42 A;  1MHW C;  4C3I B;  5ELN A;  1EQQ A;  5KYI A;  2F1M A;  3AU7 A;  3H0G G;  4OEM B;  4KY7 A;  2EPB A;  4K14 A;  3QR8 A;  1OXT A;  4JBW A;  2HHH Q;  3TME A;  2I5L X;  4JI5 Q;  2AKW B;  1KQS A;  2E2H H;  4JYA L;  3QOL A;  3MWY W;  1PTO C;  3A7A B;  4LF9 L;  3GTO B;  5CV5 A;  3I3C A;  1RL2 A;  3M9B A;  4IUQ A;  4N8X 1;  2CW0 C;  2PI2 E;  4C2M B;  1AEX A;  3GTJ H;  3I56 A;  4WJ4 A;  2MQH A;  2A69 D;  2KBN A;  2JA6 H;  2DY7 A;  2KED A;  2UU9 L;  1ENC A;  1CHQ D;  3ERO A;  3FPP A;  4LNQ A;  4GNX B;  3TZD A;  4H13 C;  3S1R H;  2MHV A;  3EBE A;  2QEJ C;  5LL6 S;  1Y1W H;  2A6H D;  4ZRZ A;  3LX0 A;  1L0X B;  2NTT A;  1WTO A;  1F2Y A;  1IYU A;  1KC8 C;  1X6O A;  1HTP A;  2VZA A;  1HFN A;  2NZ1 D;  3L2P A;  5IWA L;  4R4Q A;  1H9S A;  4QL5 A;  4LFB L;  4PMW A;  3VDY A;  4RH6 A;  3MXN B;  1L1O B;  1EIH A;  1RTN A;  2ZM6 Q;  3RZO B;  2R7F A;  2JA7 G;  2QGQ A;  2QKI C;  1V9P A;  1H9M A;  1YNJ D;  3AYH B;  4BBR G;  1AH9 A;  2RA4 A;  5T1I A;  5E4X A;  4FXD A;  4K2L A;  4B3S L;  4PZ6 A;  4KK7 A;  4JI7 L;  3I4N H;  4ZUI A;  1SNP A;  4AH6 A;  2WAQ G;  3D4R A;  4M8A A;  4FF3 A;  3MFY A;  4QIW E;  1PH2 A;  1I94 L;  3K7A H;  1PRT B;  2A73 B;  1VQN A;  2L4N A;  3PF5 A;  4C3I H;  4JPB W;  3J7A 5;  4N8F A;  4HIO A;  2NYZ D;  3IFT A;  2NVX B;  3PF4 A;  3HOZ B;  1F2L A;  2A6E C;  1SRU A;  3VR5 A;  3U58 A;  2L5T A;  4DAY A;  2EXZ A;  3ICE A;  3GTO H;  2YV5 A;  2K52 A;  1A3V A;  4HMJ A;  4JI4 Q;  4C2M H;  1ESR A;  1EYD A;  4N9P A;  3JAM L;  4A3E B;  1DYQ A;  2K1B A;  1VQM A;  1VF7 A;  2L9H A;  1S5E D;  3T13 A;  5IYC G;  3JAM c;  4MZ9 A;  1JR0 D;  3D4W A;  4EQ5 A;  3PO3 G;  1Y8P B;  5IP7 H;  3E5S A;  4AQY Q;  5ELD A;  1PH9 A;  1P16 A;  4DK3 C;  4OWX B;  1V8Q A;  1X55 A;  4EQO A;  3K5L A;  1NCV A;  2VS1 A;  1WTQ A;  5M3M B;  2A1A A;  4FO2 A;  5C0X J;  1PH6 A;  2SDF A;  4A93 B;  3UE0 A;  3D6W A;  4DR3 Q;  4KKU A;  3GTM B;  1LTI D;  3TP8 A;  3I73 A;  1TWG B;  3RZO H;  4IUN A;  3D8G A;  3VA5 A;  4XYQ A;  3ULL A;  1XNQ L;  2B39 A;  4A3C H;  4IO9 A;  4DAP A;  1NE3 A;  3HOX G;  3M7N A;  1CA6 A;  4B3R L;  2A68 C;  2K5V A;  2RHQ B;  3H09 A;  2SOB A;  1PFM A;  3S2H B;  3HRZ C;  3CP0 A;  3KLS A;  3MXG A;  2FMM A;  3NXW A;  4L63 B;  2OF1 A;  3IRB A;  2JP1 A;  2RCN A;  4DV5 Q;  3PUY A;  2IWH A;  3I4L A;  3VR4 A;  3G4S A;  2ZJR A;  1M8A A;  2XNA C;  1PH8 A;  1EY5 A;  2NVX H;  3HZX A;  1EQT A;  3TS2 A;  2WFW A;  5FO8 B;  1Q3L A;  1A62 A;  2RKS A;  3PIP 3;  1LT4 D;  2K32 A;  5IP9 H;  1Z47 A;  1YIT A;  3SVM A;  5DEH A;  2N55 A;  3W3A A;  5LL6 X;  1KIX A;  3TBI B;  4LFA Q;  1HA6 A;  2JA8 B;  2I5H A;  1YHA A;  3BZC A;  3PO2 B;  5FJ8 H;  4A3E H;  1ZYR C;  2EDG A;  1D5X C;  3T1Y L;  1QE6 A;  3GD7 A;  1RIP A;  4J1M A;  4JC0 A;  4JI8 L;  5C3X A;  4DAM A;  2KVM A;  3F2D A;  1MBY A;  1S4Z A;  4L6T B;  5L37 A;  4G57 A;  3NTI A;  4JG2 A;  1WTW A;  4HSP A;  5A2Q L;  3TP5 A;  1EEF D;  5M3M H;  1SR3 A;  3RZD B;  2JA5 B;  2RDH A;  3HKZ B;  2R7Z H;  1LYL A;  4A93 H;  2CFM A;  3GTM H;  1TWG H;  2R3Z A;  3A7L A;  4K8J A;  1JT8 A;  4AYB E;  1MJC A;  1S40 A;  1K8M A;  4ZKC B;  3NWT A;  5C3W A;  2EYH A;  5C3E G;  1EY7 A;  1N32 Q;  1C48 A;  1FGB D;  5FKA C;  1BCP D;  3A56 A;  1M90 C;  1RTO A;  3MEF A;  1BKB A;  5T1G A;  4HJ8 A;  1L2F A;  4X65 L;  2R61 A;  3ONA B;  1JJ2 A;  4DR6 L;  1SNM A;  4KHZ A;  3TDQ A;  5K36 H;  2IHE A;  2LXK A;  4NXM L;  1PRT F;  1RHP A;  2B2U C;  3VYU A;  1VQD A;  1VMC A;  1DXM A;  4CHT B;  2B2U A;  1PYS B;  4MN3 A;  4QCL A;  1E2V A;  4KKS A;  1I6H B;  1EY0 A;  1CQF A;  2ZTD A;  3M4O B;  2UUA Q;  2N8N A;  5HGQ A;  3K81 C;  1HFG A;  1HNW L;  1QUQ B;  2AWO A;  2I46 A;  2K33 A;  5E7N A;  4B3M L;  3URY A;  3KF8 A;  2PZW A;  2D5D A;  4X3U A;  1AE3 A;  2JA8 H;  3PO2 H;  5DM7 3;  2I0Q A;  4LF4 L;  2ALY B;  4R9W A;  4S3S A;  3RNU A;  4IZ8 A;  1UAP A;  1X3P A;  4L5S A;  3SK5 A;  4QUC A;  5EPL A;  4CDE C;  2PCF B;  1STG A;  3BZK A;  2EOT A;  3RZD H;  1YJ9 A;  2JA5 H;  2K05 A;  4IPH A;  5I6W A;  4X62 Q;  1X9N A;  1O78 A;  1CFM A;  3W1G A;  1J9O A;  4OEL B;  3S2D B;  3RR5 A;  5JJK A;  3H0G B;  4DUY L;  4DF7 A;  1TS5 A;  1BO0 A;  2JQO A;  3OOC A;  4QMG A;  3A8J E;  5ISR A;  1AFP A;  3KLS X;  4K5X A;  4KD3 A;  1I4P A;  4DR2 Q;  2UXD Q;  5EQ0 A;  3HKS A;  2J0T D;  1LT3 D;  3V05 A;  1FVI A;  1SAP A;  1QVG A;  1XJV A;  3T1H Q;  2DJG C;  3TRZ A;  3UDX A;  1IW7 C;  1BF4 A;  3CHB D;  1I6H H;  1LT5 D;  4B08 A;  4I65 A;  1OXS C;  1HHV A;  1HZ9 A;  5J1Z A;  2M9V A;  3NHH A;  4XQJ A;  2VW9 A;  2N78 A;  3SR1 A;  5C4Z A;  5EKL A;  3V2T A;  4KKT A;  2KHJ A;  4G7Z C;  1Q81 C;  3FEW X;  3X3N A;  3KDF B;  1VQC A;  1Y1V B;  4DXF A;  3I90 A;  4AIM A;  3P1H A;  2MNA A;  5I9P A;  4XXE A;  3T53 B;  3K8A A;  3PIO A;  5LMU Q;  2A69 C;  2KCT A;  4P74 A;  3NQT A;  2WKC A;  3FHW A;  3KBG A;  1E0B A;  4BA1 I;  2A6H C;  3Q8D A;  3FMC A;  2VY3 A;  3S2D H;  1ICF B;  3A5U A;  3H0G H;  2GN5 A;  2E2I B;  1LTG D;  1F9S A;  3F1Z A;  1B3A A;  1JCK B;  2EYO A;  2F0N A;  4OX9 Q;  1Q8K A;  4CKC A;  3OMC A;  1DOL A;  1WI5 A;  1SE8 A;  4WRD A;  4RGM A;  2BDO A;  1KLU D;  2BE5 D;  1YNJ C;  1OO9 B;  1HNX Q;  3KK7 A;  1II3 A;  4BS9 A;  3NTH A;  1NBW A;  1N36 L;  1ASY A;  4TSS A;  3R3O A;  2V1C C;  4LF7 Q;  4RGO S;  1LTT D;  1XX8 A;  5M5X B;  4RGT A;  4PZ8 A;  5EPK A;  4RWS C;  4NB3 A;  2K5N A;  5KRU A;  3OIP A;  5C4X B;  4XQQ A;  1YNN C;  1OXV A;  1PDQ A;  2UUA L;  2LKV A;  1LTR D;  3LGJ A;  2MPM A;  2EIF A;  1AE2 A;  4GKK L;  1SYG A;  1S5D D;  3FVQ A;  4EGV A;  1Y1V H;  4CKB A;  2YTX A;  2AQ3 B;  1B9N A;  3H6M A;  1I4Q A;  1SEB D;  2EXD A;  1JMC A;  3KF6 A;  1XTD A;  2J4X A;  4A3B B;  3HOX B;  1FR3 A;  3PIO 3;  1DD2 A;  1ENF A;  1B2T A;  3OMG A;  2EJF C;  2XRQ D;  2NUC A;  4B9W A;  3CCS A;  2SEB D;  1DGS A;  4A3F H;  3S1M B;  1ILQ A;  4CJ1 B;  4K6L A;  4FF1 A;  4A3K G;  1WD0 A;  4YCU A;  2OXP A;  4L8J A;  4JYA Q;  3E0E A;  4UY8 C;  3K7U C;  4JV5 L;  4LF9 Q;  1HPC A;  3FDT A;  5I2X A;  2E2I H;  1UE5 A;  3KJP A;  5CGK A;  2DJF C;  1R4P B;  1SNQ A;  2LSS A;  5GAH C;  1VQF A;  1G91 A;  1ASZ A;  2UU9 Q;  3DM3 A;  2X6L A;  2R92 G;  2A8V A;  3SXH A;  1JJG A;  3M4P A;  3RLF A;  1X3G A;  4TVA B;  3Q23 A;  2ZXO A;  3UDF A;  4IPG A;  4RHR A;  1H9K A;  3U4V A;  2EYP A;  4B9X A;  4OGQ C;  1RJT A;  5M5X H;  4A3J G;  3BDL A;  1C7Y A;  5IWA Q;  4FXG C;  4LFB Q;  1LTB D;  5C4X H;  1TWF B;  1VQB A;  2NZO A;  2XVS A;  1PMR A;  1KNE A;  1E2W A;  1RCV D;  4B3S Q;  2O4X A;  2F0W A;  1EU3 A;  3I8Z A;  1XNR Q;  1E22 A;  5C3E B;  1HR0 L;  1YJW A;  1I94 Q;  3IFD A;  1JE5 A;  2NVY H;  4A3B H;  2F0P A;  3HOX H;  3AQQ A;  2EY2 A;  4LWC A;  4RA8 A;  2IY5 B;  2DN8 A;  3S1M H;  1W6K A;  3I7F A;  1I4G A;  2K5H A;  1OXX K;  4V19 0;  1B8A A;  2PPB C;  2J7Z A;  4EX5 A;  2X6G A;  1JQY D;  3G7L A;  2XRS D;  3I91 A;  3NBH A;  1W3S A;  1EFW A;  1K9M C;  3C3L A;  1CQV A;  3TEH B;  2VQE L;  1JOQ A;  2Q8R E;  1K8G A;  4LK1 C;  3U4Z A;  3BVM A;  1EY8 A;  4JOI C;  5ELB A;  5C0X G;  5FOB B;  3F8T A;  4IFD I;  1U4R A;  4PNY A;  2XWJ B;  5JOB A;  4XT1 B;  3J7Y W;  2AMC B;  3HKZ E;  1A63 A;  3FKI G;  4X6A H;  2HCI A;  1KAA A;  3IAY A;  3CXC A;  2G9D A;  3SHL A;  1B4O A;  1D1K A;  5CR3 A;  1TWF H;  5E1F A;  1VQK A;  4JK1 C;  2JN4 A;  1VQH A;  3ZYY X;  1XNQ Q;  5HGT A;  3OWF A;  3EJI A;  1WTR A;  2KOL A;  3KF6 B;  4IUR A;  5CMD A;  3OSO A;  4B3R Q;  5C3E H;  4APV A;  3RN5 A;  2H1E A;  3CF5 A;  3NK9 A;  1NR2 A;  4EVO A;  4YHH L;  4ZAI A;  3K5M A;  3J81 E;  1D7Q A;  1CSP A;  1JIC A;  1U4L A;  3NP8 A;  1ICW A;  1IKM A;  5IIF A;  1MSG A;  4JCV E;  1STY A;  2F0T A;  1RF2 D;  2Q8I B;  1Q82 C;  4B3T L;  2JA9 A;  5KYL A;  4K0K L;  1B44 D;  3AFP A;  3F2C A;  3BS1 A;  4BY1 G;  4HIM A;  4GN5 A;  2PW7 A;  3W5O A;  1I4R A;  1PH1 A;  4YY3 L;  1TY2 A;  1NMG A;  4FXK C;  5IYD H;  2CWP A;  1HUM A;  3NEN A;  1SYF A;  5I4D A;  4PG3 A;  2BH2 A;  1D6E C;  5FO7 B;  5E4W C;  1XMO L;  1KAW A;  3T1Y Q;  3D31 A;  1UE7 A;  4OL7 A;  4F87 A;  4JI8 Q;  4TKO B;  2B3G A;  4RCN A;  5I2Y A;  4FNF A;  5BR8 Q;  4BXX H;  1QG7 A;  2D0O A;  4CJ0 B;  1CTM A;  4MTK A;  4IUV A;  5BN3 A;  3E3X A;  1TWH B;  1ZEQ X;  2F0F A;  2QDL A;  4A4I A;  4KY6 A;  3MTS A;  3AEV A;  2CHB D;  3ERS X;  1SE4 A;  2SNS A;  5IGB A;  1OXU A;  4CDF C;  2D62 A;  2V4D A;  1EY9 A;  2F4V L;  1E2Z A;  3HOV B;  4LJZ C;  1BOS A;  4Y7N B;  4PQX A;  4XTC S;  1TWA B;  3EA6 A;  2VUM G;  2K7V A;  2KUM A;  4X65 Q;  5KIX A;  1EL0 A;  4DR6 Q;  2MO0 A;  4QF4 A;  3PCO B;  4NXM Q;  1HNZ L;  2F03 A;  2D2C C;  1XNR L;  2DY8 A;  4OO1 G;  1PVO A;  4DN4 M;  1IKL A;  3HOW H;  4CBV A;  1WVL A;  4DPG A;  4A3D G;  1K3B C;  1JB3 A;  1FNV A;  4TQU S;  4Q5V A;  3QWN A;  1HNW Q;  5J3B A;  2PO4 A;  1EU4 A;  4K5W A;  1F2Z A;  1ZXT A;  4B3M Q;  3Q22 A;  2F0M A;  1PFB A;  3PIP A;  1LM0 A;  2QW7 A;  4I7A A;  1N34 L;  3DWP A;  2X69 A;  3ND8 A;  1L0W A;  3P20 A;  3GQB A;  5COY A;  2L0C A;  1LTS D;  5GAE C;  3GTQ B;  4LF4 Q;  4QB4 A;  5KNC A;  4KHV A;  5C4J B;  2WB1 G;  1YI2 A;  1PZK D;  2IPK D;  2B2Y C;  2BOS A;  1XMQ L;  1JWS D;  3S1Q B;  4NP5 A;  3BJU A;  2WAQ E;  1SYB A;  2B2Y A;  1Q90 A;  3SGI A;  1SND A;  2EYM A;  4HSV A;  3GTK B;  2F4I A;  4A3L G;  1SFO B;  4X66 L;  1T5E A;  1JOR A;  3NBI A;  2B8F A;  4OXP A;  1KXL A;  2PQE A;  4GLA C;  1S5C D;  4YCW A;  1FNU A;  4DFA A;  3MEH A;  5M9O A;  1QZG A;  3E6Z X;  3HOV H;  1NTG A;  4DUY Q;  1HQM C;  2CQO A;  3W2D A;  1P8L A;  4Y7N H;  2FHT A;  1JE4 A;  1VMP A;  4A3K B;  1TWA H;  4GN3 B;  3WOE A;  1SLJ A;  4C3J G;  1JC7 A;  3K0X A;  3PQI A;  3CCJ A;  2HQL A;  2F0G A;  1WFQ A;  1C0A A;  1G6P A;  1HJP A;  3PUX A;  2R92 B;  3KFU A;  2VQF L;  1UEB A;  4ZUJ A;  4BBS B;  3GV6 A;  3VYT A;  1VQ5 A;  2K6A A;  4G7O C;  2WII B;  1IBL L;  2KEC A;  4POG A;  1UEA B;  1WCM B;  4QUF A;  3HOY G;  3KJO A;  3HFZ B;  3HOZ H;  5CBE E;  1LV9 A;  4X64 L;  3HOU G;  1EZ8 A;  4A3J B;  1VQ6 A;  2JEA I;  3C46 A;  1PTO B;  1SBB B;  5IGE A;  4PMB A;  3GTQ H;  4GKJ L;  1Y8O B;  4A3M G;  3NWS A;  2CQA A;  5C4J H;  1K3R A;  1W6J A;  2F0D A;  4DV1 L;  5M5W B;  1K0R A;  5C6A A;  2CCZ A;  3S1Q H;  1STE A;  2RSO A;  2Y0S G;  4UP9 A;  4DNI A;  4GLV B;  3GTK H;  1QJO A;  3S9W A;  1SFO H;  3QB3 A;  1XXG A;  3NEM A;  4YWM A;  3K5N A;  3CME A;  4CKE A;  5IE8 A;  1QCB D;  5BR8 L;  2GA4 B;  4Y52 H;  4IFD H;  3OPO A;  3I55 A;  1N33 Q;  1F2M A;  3CC7 A;  1O80 A;  1H9S B;  4BY7 B;  4A76 A;  4L5R C;  1VF5 C;  3GTL B;  4MNO A;  3CCQ A;  4R8N A;  3I72 A;  1B1Z A;  1VQ8 A; 
#chains in the Genus database with same CATH homology
 3PIO A;  4A3K H;  5LMU Q;  2K75 A;  2KCT A;  4JI7 Q;  4P74 A;  2QA4 A;  5EAY A;  1Q7Y C;  3CCR A;  5C0X I;  3H3V I;  3DLL A;  3HOY H;  4IJL A;  3FHW A;  5HY6 A;  3GTP H;  2VNU D;  2IHF A;  4BA1 I;  3CW2 C;  3Q8D A;  1IXR A;  4J15 A;  1Y1V G;  5AJ3 L;  3NBH B;  2VY3 A;  3S2D H;  3A5U A;  4L5T A;  2ZJQ A;  2CWA A;  2K14 A;  4BY7 G;  2R92 H;  3S2H H;  3H0G H;  2GN5 A;  1EUJ A;  5JEA J;  2JA5 G;  1N36 Q;  2OTL A;  3OTO Q;  3F1Z A;  3HKZ G;  2ASB A;  2R93 H;  1HZC A;  5M3F G;  4BBS H;  5LMU L;  2E2J H;  2B63 G;  1YVC A;  4C3H H;  1I5F A;  2I5M X;  1UE6 A;  3WWV A;  1X65 A;  2PQA A;  1EIY B;  1PHJ A;  1XPU A;  4OX9 Q;  2UXB Q;  4DAY B;  1WCM H;  3M4Q A;  1Q8K A;  3CC4 A;  2F52 A;  2NVQ H;  4A3F G;  4GS3 A;  1WI5 A;  1SE8 A;  2AHO B;  5H1S E;  5JJI A;  1KRS A;  4A3G G;  1HNX Q;  3I4M G;  4A3J H;  4A3I G;  2N3S A;  1N9W A;  3CC2 A;  1Q86 C;  4GKK Q;  3ZJY C;  3ER0 A;  3UE1 A;  1NBW A;  5LMN Q;  3OTO L;  1N36 L;  4JI6 Q;  1ASY A;  4ALP A;  3JAM i;  4O0A A;  1CKN A;  2V1C C;  2HIX A;  1TWH H;  1V1Q A;  5M5W H;  1HR0 W;  4LF7 Q;  2OQK A;  3CCE A;  1VQI A;  1X56 A;  2K50 A;  4PZ8 A;  3CCM A;  4HJ5 A;  4OX9 L;  1J6Q A;  1IL2 A;  2UXB L;  4NB3 A;  2K5N A;  1BVS A;  4DR5 Q;  1X54 A;  2ZJP A;  4HJ9 A;  4JOI A;  2BA0 A;  1OXV A;  1QUQ A;  2UUA L;  4BA2 I;  1YNX A;  1HNX L;  3GTG H;  3LGJ A;  1YZ6 A;  1PFS A;  1PH7 A;  2IT1 A;  4A75 A;  4YWL A;  2EIF A;  1AE2 A;  4GKK L;  1E1T A;  1K73 C;  3KOJ A;  4JI1 L;  5LMN L;  1Y1V H;  3L7Z C;  4JI6 L;  3CAM A;  2YU9 H;  2YTX A;  4BY7 H;  3PUW A;  1SN8 A;  4QQB X;  4OON A;  1N8R C;  4LF7 L;  2Q2I A;  4R4C A;  4HID A;  3GTL H;  1GO3 E;  4JV5 Q;  4LF6 Q;  1XPO A;  2EXD A;  2WB1 E;  3KF6 A;  3CMA A;  1XTD A;  1JMC A;  2JA6 G;  2OTJ A;  4JBM A;  3EN2 A;  3G6E A;  3PUZ A;  2IX1 A;  4LFC Q;  2PI2 A;  4XIG S;  5C4X G;  4IPD A;  2Q2U A;  2Q2H A;  3CCS A;  1DGS A;  4A3F H;  1Y1W G;  1PH5 A;  1IBM L;  2KEN A;  4A3K G;  4DV3 Q;  1W2B A;  3S1N H;  2JE6 I;  2MO1 A;  4YCU A;  2ZTE A;  4DV7 Q;  1KD1 C;  2ID0 A;  1VQ9 A;  5FLM G;  3E0E A;  3J80 c;  1OTC A;  4JYA Q;  4UY8 C;  4DKA C;  3K7U C;  4JV5 L;  4LF9 Q;  1EQR A;  1TXY A;  3L0O A;  2E2I H;  3A0J A;  1UE5 A;  3KJP A;  2NVT H;  2NN6 I;  5GRO A;  2LSS A;  4DK6 C;  2FXQ A;  4R4O A;  4A3B G;  5GAH C;  2UUB Q;  2LXJ A;  1VQF A;  1YBY A;  2KHI A;  1ASZ A;  4R1J A;  5ELN A;  3K80 C;  1EQQ A;  1GM5 A;  2UU9 Q;  2F3I A;  3DM3 A;  3H3V H;  2N49 A;  3NEL A;  2R92 G;  3H0G G;  1V43 A;  2A8V A;  3M4O H;  1JJG A;  1OXT A;  1I3Q H;  3M4P A;  3RLF A;  4JBW A;  2R93 G;  2HHH Q;  1X3G A;  2PMZ E;  5FLX c;  4DV3 L;  1J5E Q;  1E24 A;  2I5L X;  3FKI H;  3FP9 A;  4JI5 Q;  4TVA B;  4DV7 L;  3BU2 A;  2AKW B;  3UDF A;  1KQS A;  2E2H H;  4JYA L;  2WP8 J;  2R7D A;  4IPG A;  4LF9 L;  3U4V A;  1RL2 A;  3M9B A;  1GKH A;  4DV4 Q;  2PI2 E;  4OO1 I;  3STB C;  3M3Y H;  3GTJ H;  3I56 A;  4GOP C;  1HR0 Q;  4WJ4 A;  2MQH A;  1MKH A;  2KBN A;  2JA6 H;  5M5X H;  4A3J G;  4KI0 A;  3GO5 A;  5IY0 A;  2AWN A;  1C7Y A;  2Q2T A;  1VQL A;  2UU9 L;  1X3F A;  5IWA Q;  4GOP A;  5JEA G;  2UUC Q;  4LNQ A;  4AYB G;  4GNX B;  4LFB Q;  5C4X H;  1PH3 A;  3S1R H;  2HHH L;  4YWK A;  1J5E L;  3EBE A;  4JI5 L;  1VQB A;  4UP8 A;  2NZO A;  1VQ4 A;  1Y1W H;  4RG1 A;  1PH4 A;  1CKM A;  1MIU A;  2HIV A;  4DV2 Q;  4DR4 Q;  1KL9 A;  4B3S Q;  4DV4 L;  1KC8 C;  1XNR Q;  3I4O A;  5FLM H;  1X6O A;  1E22 A;  2PNH A;  1TWC H;  2VZA A;  1HR0 L;  1EOV A;  1YJW A;  3KDF A;  3A74 A;  1I94 Q;  3CCU A;  1Y14 B;  2UUC L;  3L2P A;  5IWA L;  3OW2 A;  4R4Q A;  1JE5 A;  3CCV A;  2NVY H;  4QL5 A;  3HOX H;  4A3B H;  3AQQ A;  2JK8 A;  4LFB L;  4PMW A;  3VDY A;  2B29 A;  2Y0S E;  3MXN B;  1L1O B;  4LWC A;  1N33 L;  2ZM6 Q;  3S16 H;  2VQE Q;  1HZB A;  2R7F A;  1YEZ A;  2JA7 G;  2QGQ A;  1V9P A;  3AYH B;  2IY5 B;  4BBR G;  1AH9 A;  3S1M H;  4DV2 L;  3RLN A;  4DR4 L;  3G48 A;  4B3S L;  4PZ6 A;  4JI7 L;  3I7F A;  3I4N H;  2K5H A;  4AH6 A;  2WAQ G;  1OXX K;  1B8A A;  4GN4 B;  1A8V A;  4QIW E;  4FDB A;  5GQO A;  4EX5 A;  1PA6 A;  3K7A H;  1PH2 A;  1I94 L;  1VQN A;  5IYB H;  1VQO A;  1W3S A;  2YTY A;  1EFW A;  1K9M C;  2BA1 A;  3J81 i;  3PF5 A;  4WJ3 M;  1KHI A;  3TEH B;  4C3I H;  2ZM6 L;  2VQE L;  3J7A 5;  1K8G A;  4HIO A;  1IYJ B;  3U4Z A;  3PF4 A;  4A3C G;  1CKO A;  1SRU A;  3U58 A;  1G51 A;  4KLK A;  4HJ7 A;  3ICE A;  1CKN B;  3KF8 B;  3D0F A;  4JOI C;  3E9I A;  5C0X G;  3GTO H;  3F8T A;  2YV5 A;  4IFD I;  2K52 A;  4JI4 Q;  3TQY A;  5IYD G;  3UDI A;  4C2M H;  4RMF A;  3H15 A;  4GLX A;  2AMC B;  5ELO A;  3HKZ E;  1A63 A;  3FKI G;  4X6A H;  3E9H A;  4POF A;  4YHH Q;  4UPA A;  4JI0 Q;  4DV0 Q;  1VQM A;  1EYG A;  3CXC A;  5IYC G;  3JAM c;  1YHQ A;  2VUM H;  4MZ9 A;  1TWF H;  3J81 j;  2JA7 H;  3GDE A;  4EQ5 A;  1VQK A;  1XNQ Q;  4BBR H;  1Q12 A;  1VQH A;  3PO3 G;  5IP7 H;  1BBW A;  1KRT A;  4AQY Q;  2YTV A;  1PH9 A;  4B3T Q;  2GVA A;  4BXX G;  1P16 A;  4DK3 C;  1SMX A;  3KF6 B;  2UXC L;  4K0K Q;  4OWX B;  4DR5 L;  4JI4 L;  1X55 A;  4B3R Q;  5C44 H;  2VS1 A;  5C3E H;  2A1A A;  3KLW A;  4APV A;  4QGU A;  4YY3 Q;  3CF5 A;  3RN5 A;  5C0X J;  1XPR A;  1FGU A;  1PH6 A;  4YHH L;  1JJC B;  4JI0 L;  4A3E G;  3UE0 A;  1D7Q A;  1CSP A;  1Z9F A;  2D0P A;  4DR3 Q;  3ULP A;  2MFI A;  1QZH A;  4IOC A;  3RZO H;  2A19 A;  3I2Z A;  4JI2 Q;  1MJE A;  2ATW A;  1XMO Q;  1LUZ A;  4YCV A;  4DV6 Q;  1CSQ A;  1K83 H;  4JCV E;  3ULL A;  4LF6 L;  1XNQ L;  3J80 i;  4OWW B;  4AQY L;  5GAD C;  4IO9 A;  4A3C H;  1NE3 A;  2CKZ B;  1Q82 C;  4B3T L;  2JA9 A;  5M5Y H;  3HOX G;  4K0K L;  4LFC L;  3CPW A;  3AFP A;  3M7N A;  1WJJ A;  3F2C A;  4B3R L;  4BY1 G;  4HIM A;  2K5V A;  4GN5 A;  3W5O A;  2RHQ B;  3STB D;  1PH1 A;  4YY3 L;  1NMG A;  3CP0 A;  5IYD H;  2R7Z G;  2CWP A;  2ZTC A;  3IRB A;  4JI3 Q;  4A93 G;  2RCN A;  3NEN A;  4DV5 Q;  3PUY A;  4LW1 A;  4DR3 L;  3PV0 A;  4DR7 Q;  4PG3 A;  1VQA A;  3I4N G;  4R4T A;  3G4S A;  2ZJR A;  2BH2 A;  4JI2 L;  1XMO L;  1PH8 A;  3S17 H;  1KAW A;  3HOW G;  4ME3 A;  1IZ6 A;  3T1Y Q;  2NVX H;  1WOC A;  5IYC H;  3D31 A;  1UE7 A;  3TS2 A;  5IYB G;  4JBK A;  2WFW A;  2Z0S A;  2F4V Q;  3PO3 H;  2UUB L;  1A62 A;  4JI8 Q;  2B3G A;  5IP9 H;  1Z47 A;  5BR8 Q;  1YIT A;  4BXX H;  2D0O A;  1QVC A;  1FJG Q;  4R4I A;  1EIF A;  1KIX A;  4DV5 L;  4LFA Q;  1VQE A;  1YIJ A;  2I5H A;  1YHA A;  3BZC A;  4DR7 L;  4A4I A;  3AEV A;  2OCE A;  1IBK Q;  5FJ8 H;  2ES2 A;  4A3E H;  1Q1E A;  4P75 A;  3ERS X;  3T1Y L;  1HNZ Q;  3UDG A;  1OXU A;  2NN6 G;  2D62 A;  4GNX C;  3GD7 A;  2F4V L;  1K8A C;  1PV4 A;  1RIP A;  1S3O A;  1SRO A;  4JC0 A;  4JI8 L;  4DAM A;  1FL0 A;  2KCM A;  3U50 C;  3F2D A;  4GNX A;  1NJI C;  4IJH A;  3PUV A;  4XTC S;  1BBU A;  1G29 1;  4JG2 A;  3PGZ A;  3KYH C;  4LUO A;  4BY1 H;  2VUM G;  1FJG L;  1WYD A;  5M3M H;  1B7Y B;  1SR3 A;  4X65 Q;  4PZ7 A;  4LFA L;  4DR6 Q;  3J7Z C;  2MO0 A;  3AFQ A;  2JA8 G;  1B70 B;  5IP7 G;  2R7Z H;  3PCO B;  1IBK L;  3RLO A;  1LYL A;  4NXM Q;  2DUD A;  4A93 H;  1HNZ L;  2CFM A;  3GTM H;  1N34 Q;  1XNR L;  1PVO A;  1TWG H;  2JJQ A;  4OO1 G;  5C44 G;  1JT8 A;  1VQP A;  4AYB E;  1MJC A;  1S40 A;  1N32 Q;  1L1O C;  3HOW H;  5C3E G;  3HOV G;  1O7I A;  2RHS B;  4DPG A;  1R9T H;  4A3D G;  2PQA B;  1I50 H;  1L1O A;  1UE1 A;  1NMF A;  4DUZ Q;  1M90 C;  1PYB A;  2NZH A;  2XGT A;  4TQU S;  3HOU H;  3MEF A;  1BKB A;  1T9H A;  1HNW Q;  5J3B A;  2E8G A;  1XMQ Q;  4HJ8 A;  1L2F A;  4X65 L;  1JJ2 A;  4DR6 L;  4KHZ A;  4DR1 Q;  4A3M H;  3F2B A;  4B3M Q;  1HZA A;  2IHE A;  2LXK A;  4OWT B;  4NXM L;  3PIP A;  2K4K A;  1LM0 A;  1VQD A;  4X66 Q;  1N34 L;  1S72 A;  1L0W A;  1PYS B;  5GAE C;  1N32 L;  4LF4 Q;  4O2D A;  3M85 A;  1HH2 P;  2H5X A;  2ZTD A;  1D8L A;  3J81 c;  2WB1 G;  4DUZ L;  2UUA Q;  1YI2 A;  2N8N A;  5HGQ A;  3K81 C;  5IT9 c;  1HNW L;  1XMQ L;  1U0L A;  1QUQ B;  2AWO A;  3CCL A;  4KHP Q;  3BJU A;  1Q1B A;  4JI1 Q;  2WAQ E;  4DR1 L;  5E7N A;  3SGI A;  4B3M L;  3HOZ G;  4MTN A;  4NPS A;  1M1K C;  4A3L G;  5JJL A;  2YYZ A;  4H02 A;  4X66 L;  1AE3 A;  2JA8 H;  3PO2 H;  4OXP A;  3PSI A;  5IP9 G;  3RN2 A;  1KXL A;  3W1B A;  2XTI A;  4GLA C;  1VQ7 A;  4L5Q A;  4HIK A;  2I0Q A;  2ALY B;  4LF4 L;  4YCW A;  1VS0 A;  1H95 A;  3RNU A;  1QZG A;  1GVP A;  3HOV H;  4L5S A;  3JC6 6;  1NTG A;  2QEX A;  1X3E A;  2CQO A;  2IX0 A;  2OQ0 A;  1P8L A;  2VQF Q;  4DUY Q;  3S15 H;  4Y7N H;  1IBM Q;  4A3D H;  2EQS A;  4KHP L;  4LF8 Q;  5FJ8 G;  2E5L Q;  1VQJ A;  4LUV A;  4DV0 L;  4P73 A;  3S14 H;  1TWA H;  2RF4 A;  4GN3 B;  2GVB A;  3BZK A;  3CPF A;  1SLJ A;  1IBL Q;  1LTL A;  3RZD H;  1YJ9 A;  2JA5 H;  3K0X A;  3CCJ A;  4IPH A;  3OYY A;  1EWI A;  5M3F H;  4X62 Q;  1X9N A;  2HQL A;  1A0I A;  1VQG A;  4X64 Q;  2B63 H;  3W1G A;  2DGY A;  1YHB A;  1WFQ A;  4IFD G;  1C0A A;  3RR5 A;  1G6P A;  5JJK A;  1HJP A;  3PUX A;  5M3M G;  4GKJ Q;  4DUY L;  4QJF A;  3KFU A;  2OWO A;  1E1O A;  2VQF L;  1UEB A;  1VCI A;  4LF8 L;  4A3G H;  2E5L L;  2JQO A;  2Z6K C;  4JBJ A;  4DV1 Q;  1GD7 A;  1VQ5 A;  3I4M H;  4A3I H;  1U5K A;  1E7Z A;  2UXD Q;  2JEB I;  2Z6K A;  3S24 A;  3TRE A;  4DV6 L;  4DR2 Q;  1IBL L;  4POG A;  3HKS A;  3HOY G;  1UWV A;  3KJO A;  3HFZ B;  3HOZ H;  2HT1 A;  4A3L H;  4X62 L;  3A5Z B;  1E3P A;  1FVI A;  4X64 L;  4LF5 Q;  3HOU G;  1QVG A;  1XJV A;  3T1H Q;  1VQ6 A;  2JEA I;  1QVF A;  1JB7 A;  3GTQ H;  3TRZ A;  3UDX A;  4GKJ L;  3TS0 A;  4A3M G;  5K36 G;  1I6H H;  5LMN W;  5C4J H;  4GOP B;  4JI3 L;  1K3R A;  4QY7 A;  3G71 A;  4IFD J;  4BBS G;  2BH8 A;  3CD6 A;  4DV1 L;  1NY4 A;  1OXS C;  1HZ9 A;  1K0R A;  2CCZ A;  4NXN Q;  2VW9 A;  3S1Q H;  4DR2 L;  2UXC Q;  2UXD L;  2Y0S G;  4IPC A;  2N78 A;  4UP9 A;  5GAG C;  1C9O A;  4DNI A;  1WCM G;  4GLV B;  4P72 A;  1YJN A;  3GTK H;  4LF5 L;  1SFO H;  2KHJ A;  3NEM A;  4YWM A;  2VL6 A;  4C3J H;  1Q81 C;  3CME A;  4IOA A;  5IE8 A;  3T1H L;  5BR8 L;  2L15 A;  3KDF B;  1VQC A;  2C35 B;  5DLQ E;  4Y52 H;  1CUK A;  5AJ3 Q;  3I55 A;  1N33 Q;  3CC7 A;  4HJA A;  4A76 A;  4AIM A;  1Q46 A;  3ULJ A;  4L5R C;  2R6G A;  4MNO A;  3CCQ A;  4P71 A;  2MNA A;  3PO2 G;  4LUZ A;  3EIV A;  4NXN L;  3CQZ H;  4UP7 A;  3B6Y A;  3K8A A;  1VQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...