2KHJA

Nmr structure of the domain 6 of the e. coli ribosomal protein s1
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
89
structure length
89
Chain Sequence
MFNNWVALNKKGAIVTGKVTAVDAKGATVELADGVEGYLRASEASRDRVEDATLVLSVGDEVEAKFTGVDRKNRAISLSVRAKDEADEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Probing the relationship between Gram-negative and Gram-positive S1 proteins by sequence analysis
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ribosomal protein
molecule keywords 30S ribosomal protein S1
total genus 9
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2009-04-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00575 S1 S1 RNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2khjA00
4A3KH 4JBKA 4QGUA 1QUQA 2N3SA 3CCVA 3HKZG 3MEFA 4R1JA 1PH1A 4B3ML 2JEBI 1N33L 4RG1A 5M3FH 1VQHA 2KBNA 3FKIG 4L5RC 1PH9A 1PV4A 3I55A 4DV4L 5C4XG 1VQEA 4GS3A 2ID0A 1XNQQ 3CCQA 3NEMA 3CP0A 4A3JH 2KENA 2ALYB 1TXYA 2E2HH 2JEAI 2PQAA 3HFZB 4DV2L 3T1YL 4LF8L 1LM0A 1XPOA 1B7YB 1R9TH 3FP9A 1HNZL 1HR0W 2BA0A 1DGSA 4IFDG 1MIUA 4A4IA 2PQAB 4DPGA 3G6EA 2ZM6L 2CFMA 1Q12A 2JA7H 2Q2IA 5BR8L 1XNRL 1Z47A 2KHJA 2ATWA 4DV2Q 2E8GA 3PF5A 4YWMA 3JC66 4X65L 4LF8Q 3I2ZA 1I94Q 1X55A 2UUAL 2UUBL 1XNQL 1NTGA 3K81C 1NMGA 3L2PA 1Q81C 1MJCA 4LF4Q 1QVFA 3HOZH 4JYAL 3TRZA 2BH8A 2XTIA 2R7ZG 2B3GA 5IYCG 4A3CH 1NMFA 1VQNA 1W3SA 1CKOA 4GOPC 3LGJA 3K8AA 4DK3C 1UE1A 3OW2A 3S1MH 2LXKA 1YIJA 4R4TA 1PH7A 1IBKL 4B3MQ 4LFCL 3M3YH 5JEAG 3KYHC 3GTMH 2CWPA 3J81j 3PO3G 2DUDA 4DAMA 1M1KC 2A19A 2Q2HA 4QJFA 1HH2P 4X66Q 5AJ3Q 4DR7L 3CMEA 4A3EH 2R92G 4KHPQ 3HKSA 1UWVA 4LFAQ 3CPFA 4QY7A 4GLXA 4AQYQ 2VQEL 2IX1A 4OO1I 3E0EA 1EQQA 2F4VQ 2R93G 3M4PA 3KF6B 5C44G 3UDIA 1PH2A 1QZGA 3AFPA 3U4ZA 3DM3A 4L5TA 2OCEA 2WB1E 2LXJA 5AJ3L 2MNAA 4DR7Q 3HOYH 3J7A5 5JEAJ 1L2FA 1IYJB 1PYBA 1V43A 4R4QA 1RIPA 1MKHA 3AQQA 5FLMH 4DR5Q 1KQSA 3HOVG 1YEZA 2UXBQ 3KJPA 4C3IH 2YTVA 1CKNB 4DUZL 1JJGA 3HOVH 1EWIA 4LNQA 2UU9L 3CMAA 1Q82C 1JJCB 3GTQH 5LMUQ 4GKJQ 1K0RA 2LSSA 2CWAA 1L0WA 2E2JH 2YU9H 2UXDQ 1SMXA 5GAHC 4JI5Q 4OONA 4AH6A 4DV0L 2GN5A 1KRTA 4PZ8A 1MJEA 4A3IG 5C4JH 1CSQA 1YITA 4L5SA 1S40A 1OXSC 3PGZA 5LMNQ 2RF4A 5M5YH 1JB7A 3UE0A 1VQ9A 2ZM6Q 1D8LA 5IYDH 2FXQA 1K83H 1ASYA 5E7NA 4AYBE 3CD6A 2PNHA 3ULPA 1HZCA 1VCIA 3GO5A 2QGQA 4LUOA 3UDFA 1N34Q 1E1TA 1HZBA 3GTOH 2JQOA 1AE2A 2ZTDA 4LF9Q 5LMNL 4GN4B 4P71A 4A3DG 1PFSA 4DV4Q 3FKIH 4DKAC 4AYBG 1X54A 1VQGA 4WJ4A 1YVCA 1LUZA 1WCMH 2WAQE 1EIYB 4JI8L 2R93H 1CUKA 1VQIA 2UXDL 1VQKA 4A3KG 2R7DA 4ME3A 5M5XH 3E9HA 2JA8G 3F2BA 3H3VH 4DUZQ 1P8LA 1QUQB 4LF7Q 4WJ3M 4DR6Q 2B29A 4JI0Q 1D7QA 3CCEA 2EIFA 3G4SA 4JI8Q 2I0QA 2VL6A 1W2BA 4KHZA 4YCUA 1OXTA 3IRBA 1UE7A 2GVBA 1WCMG 4DV1Q 5FJ8G 2F4VL 4P75A 4UPAA 4B3TQ 4AQYL 3UDXA 4LF9L 2JA6H 4IFDJ 1SR3A 4JCVE 4JOIC 5IT9c 4DAYB 4X66L 1P16A 4KHPL 3M4QA 2F3IA 2MFIA 2OTLA 2VQFL 5GAEC 3TS0A 3SGIA 4DUYQ 4HIMA 1PH5A 4JI4Q 4GKKQ 3FHWA 1IXRA 2JA9A 1IBML 4B3RL 4POGA 3A74A 3CQZH 4GOPA 3NBHB 1VQLA 2IHFA 2E2IH 2ZJRA 1L1OC 4BBRG 4IJLA 4DV0Q 2B63G 2H5XA 3UE1A 5C3EH 1QZHA 5LMUL 1YHQA 2UUAQ 1H95A 2VW9A 3HOUG 2Q2UA 1VQ6A 5BR8Q 4B3RQ 2KCTA 2PI2E 5M5WH 1HJPA 4OWWB 1WOCA 4DV7Q 5EAYA 3STBC 4DUYL 1Y1WG 2ZJQA 4YY3Q 4DR2L 3H15A 1WFQA 3PUXA 4FDBA 3W1BA 3OYYA 1E3PA 3GD7A 2N78A 4BA1I 2NVQH 2B63H 3H0GG 4YWKA 3STBD 3U50C 1C0AA 3PV0A 1BVSA 2VZAA 3CPWA 1L1OB 3L0OA 5C0XJ 4LFAL 5FJ8H 4BXXG 5GAGC 4MNOA 4A93G 3J80i 4R4IA 4JI1L 4P72A 4GNXB 2JE6I 1LTLA 2K52A 3RZDH 3RZOH 3TS2A 3PUYA 2I5MX 1IBLQ 4KI0A 1KD1C 1JE5A 2OQ0A 3J81c 2AWOA 3GTLH 4DV5L 2RHQB 4HJ5A 1X3EA 4POFA 2MO0A 4JV5Q 1E1OA 4A3CG 1NBWA 3JAMc 3F8TA 1I3QH 4X6AH 1WI5A 4JYAQ 1EOVA 5C44H 4LF4L 1N36Q 2K5VA 2UUBQ 4NXMQ 4KLKA 1Q86C 4Y7NH 3BZCA 1PA6A 1VS0A 2IT1A 3B6YA 3CW2C 5GADC 2K4KA 2VNUD 2YYZA 2JA7G 4DR1Q 4JI0L 3ICEA 1K73C 1VQFA 1QVGA 1XJVA 3U4VA 1PVOA 4PMWA 4MZ9A 4LF5L 4X64Q 1GVPA 4JBMA 4LFBQ 3I4MH 2NZOA 3PUWA 4BY1H 2KHIA 4A93H 2OTJA 5JJIA 1XTDA 3TEHB 2E5LL 1X6OA 4DV6L 3F1ZA 2E5LQ 1K3RA 4DNIA 1KRSA 3RN2A 2K14A 4DK6C 1WYDA 2Z6KC 1CKNA 4X64L 1JT8A 1FVIA 4JC0A 4XTCS 3PCOB 4JBJA 2JA8H 4A3EG 5IYBG 4PG3A 1U5KA 3S2DH 1B8AA 1PH4A 4IFDI 1EQRA 4QL5A 1FGUA 4DR1L 4DR4L 2K5HA 1EUJA 2BA1A 3KF6A 4LF6Q 4K0KL 3GTJH 3AYHB 3OTOQ 2D62A 5IWAQ 4NB3A 2VQEQ 2R6GA 1HR0L 4IPHA 1Z9FA 1HNWQ 3PIOA 3ULJA 4HIDA 3HOZG 4GKJL 1OXVA 4NXNQ 1C7YA 3CAMA 1A8VA 4TQUS 4IJHA 2IY5B 1X56A 5IYBH 2JJQA 1VQDA 1UEBA 2A1AA 2VS1A 4X62Q 1VQAA 1KAWA 3RLNA 1VQPA 1S72A 1N32L 1G291 1YNXA 1Q46A 1Q1BA 4JBWA 4XIGS 4LUVA 4DR5L 5M3MG 1KC8C 1VQ5A 4L5QA 1TWHH 1I6HH 1A0IA 5J3BA 1BKBA 4IOAA 3CCJA 1TWFH 3PO2G 3D0FA 2D0PA 3L7ZC 2ZJPA 1KL9A 2CQOA 2WP8J 1U0LA 1EIFA 5JJKA 1AE3A 2QEXA 4B3SL 2XGTA 3Q8DA 5C4XH 1FJGL 4IPGA 2Y0SG 3PO3H 3J81i 3EIVA 4JI3L 1XNRQ 1YJNA 1IZ6A 1WJJA 5IP9H 4DR3Q 2YTXA 4IPDA 3M9BA 1X3GA 1EFWA 3M7NA 3S16H 4A3LG 4YY3L 4IO9A 4RMFA 4A3GH 1OTCA 1CKMA 3UDGA 2K50A 1Y1VH 3M85A 2EXDA 3GTKH 4A3BH 2RCNA 4EQ5A 1K8AC 2ZTCA 2N49A 2YV5A 4UP7A 5GQOA 5HGQA 1XMQQ 3RN5A 1J5EQ 4DV6Q 4A3IH 3HOXG 1HZ9A 1PH8A 1I50H 1I94L 3K7UC 2NVTH 3EBEA 4MTNA 4GN3B 5IP7H 4X65Q 5C0XI 4HJ7A 1VQ4A 1T9HA 1XMOQ 1L1OA 1VQOA 1N33Q 3U58A 1IBMQ 1G6PA 3S24A 5IP9G 3EN2A 4JI4L 2AMCB 3PUZA 4GOPB 4PZ6A 5LMNW 1NJIC 1N34L 2Z6KA 4ALPA 4DR3L 4LWCA 2R7ZH 1GO3E 2AWNA 3CC4A 3T1YQ 2A8VA 4OXPA 3F2CA 4BA2I 2WB1G 1HZAA 3BU2A 4QQBX 4PZ7A 1SE8A 1SRUA 3KF8B 2DGYA 1YJ9A 1SFOH 1IL2A 4JOIA 1N36L 1K8GA 3S15H 2NVYH 2IX0A 3CF5A 1A62A 3J7ZC 5HY6A 2V1CC 3H3VI 5K36G 1TWGH 1V1QA 3I56A 2R92H 4JV5L 1KHIA 2VY3A 2WAQG 4C3JH 3I4MG 1ASZA 3W1GA 3HOWG 4DR6L 1E22A 5ELNA 4X62L 1Y1WH 1PH3A 1N32Q 4A3JG 2R7FA 3TQYA 4IPCA 1X9NA 2HHHQ 4AIMA 4NXNL 2CKZB 4C3HH 3CCRA 4JI6Q 4OX9Q 4JI1Q 5IYCH 1N9WA 4GLAC 1UE6A 4YWLA 2MO1A 3RLOA 1HNXQ 1K9MC 1B70B 2OQKA 2VUMG 2JA5G 2N8NA 3K80C 1SROA 3KFUA 3F2DA 4GN5A 2K75A 4LUZA 3KLWA 4JG2A 2JK8A 2UUCQ 2ASBA 4LW1A 2UXCL 2UUCL 3ZJYC 1E24A 3T1HL 5ELOA 3ULLA 1IBKQ 3GDEA 2QA4A 4A3FH 1XMOL 3S1NH 1VQBA 2PMZE 3K0XA 4QIWE 2YTYA 3S2HH 1PHJA 1SLJA 1TWCH 1HNXL 3S14H 5IY0A 1XMQL 3AEVA 5C3EG 1GD7A 2I5HA 3NELA 1X3FA 3KJOA 1GM5A 4HJ9A 3GTPH 1BBUA 1Q8KA 3H0GH 1VQMA 4LF5Q 1YBYA 4IOCA 2HHHL 5FLXc 3S17H 3HKZE 4A3MH 4GKKL 4HIKA 4JI2L 4LFCQ 1N8RC 1VQ8A 3HOWH 5IYDG 1HNZQ 1Q7YC 2F52A 2HQLA 3E9IA 4YHHL 2OWOA 4JI7L 4O2DA 1M90C 4BXXH 3CXCA 4BBSG 1Q1EA 1PYSB 4OO1G 2K5NA 1FJGQ 3PUVA 3HOUH 1YHBA 4R4OA 3WWVA 4B3SQ 2I5LX 1JMCA 3BZKA 5JJLA 1XPUA 4DV1L 3NENA 1RL2A 3I4NG 4YCWA 1NE3A 2ES2A 1O7IA 3KDFA 4O0AA 4J15A 3W5OA 4HJ8A 4BBRH 1JJ2A 3M4OH 5M3FG 1YI2A 4YHHQ 4NPSA 4DV5Q 4YCVA 3CCLA 2Y0SE 4BY7G 1V9PA 1IBLL 3AFQA 4JI2Q 4JI7Q 5FLMG 1Y14B 1X65A 1G51A 4Y52H 1AH9A 3G48A 2C35B 2HIXA 3I7FA 4TVAB 3PSIA 4P73A 5C0XG 3CC7A 3ER0A 1J6QA 5IP7G 1HNWL 1PH6A 1HR0Q 1KIXA 2AKWB 1J5EL 1NY4A 1UE5A 2D0OA 1FL0A 1KXLA 4APVA 4GNXA 2BH2A 4LF6L 4K0KQ 4BY1G 2IHEA 4OWXB 4HJAA 4BY7H 2PI2A 4DR4Q 2MQHA 3A5ZB 4EX5A 4A3GG 4DR2Q 5IE8A 4A3FG 2HIVA 2UXCQ 4DV7L 3CCMA 3HOYG 2RHSB 2Q2TA 3K7AH 2HT1A 4JI3Q 3VDYA 3S1QH 4DV3Q 1E7ZA 1S3OA 1YHAA 3I4NH 2AHOB 3A0JA 3S1RH 3DLLA 2NZHA 2CCZA 2NVXH 2KCMA 1OXXK 4A75A 2GVAA 3RNUA 3KOJA 1XPRA 2JA5H 4C2MH 3CCUA 2VUMH 4UP9A 3PO2H 4JI5L 4OX9L 3I4OA 3CCSA 1Y1VG 4LFBL 3KDFB 4A3MG 5M3MH 1I5FA 1YJWA 3PIPA 1C9OA 4DV3L 3T1HQ 4OWTB 1YZ6A 2UU9Q 3PF4A 3TREA 4GNXC 1A63A 3JAMi 2VQFQ 5H1SE 4UY8C 4A3LH 3BJUA 2JA6G 4H02A 3G71A 3D31A 3RLFA 4HIOA 2UXBL 1CSPA 1QVCA 4R4CA 4UP8A 2NN6I 5GROA 1EYGA 2NN6G 1TWAH 4B3TL 5IWAL 4A76A 2WFWA 4NXML 1OXUA 3OTOL 1VQ7A 2Z0SA 2ZTEA 3J80c 4A3DH 3CC2A 2L15A 5DLQE 3HOXH 4GLVB 4JI6L 3GTGH 1BBWA 3MXNB 1SN8A 1VQJA 1VQCA 4P74A 4BBSH 1GKHA 3ERSX 3A5UA 4A3BG 4LF7L 2EQSA 1LYLA 3RR5A
chains in the Genus database with same CATH superfamily
3CHBD 3MEFA 4R1JA 5NUCA 1PH9A 1DCZA 3MTSA 1RTOA 1CHPD 4OIJA 4RA8A 1AP0A 4DAYA 3CCQA 3K6OA 3VA7A 5IT9E 3S1NB 4U68A 4C1NI 5FO8B 2PQAA 3T1YL 1R9TH 1HR0W 2BA0A 3K58A 2B2UA 2ATWA 3MVVA 4NP5A 4RAUC 2UUAL 1VMPA 2UUBL 2FFKB 4NKLA 5F2DA 3FVQA 2K04A 3HZXA 3L2PA 1Q81C 1QVFA 5CV8A 4JYAL 1O78A 3TRZA 3KK7A 2B3GA 1VQNA 1CKOA 4DK3C 3HEJA 1SNQA 1YIJA 4M1UB 1G2TA 5JEAG 4F87A 1DXMA 2CWPA 2DUDA 1QNKA 2A19A 2Q2HA 4X66Q 2R92G 1UWVA 2IX1A 1CZWA 1AZQA 4IUQA 4DAVA 2R93G 5C44G 3BYTB 2F0FA 1PH2A 3BYYB 4L5TA 2OCEA 1C4QA 3HOYH 2BE5C 3J7A5 3MXUA 1YHQA 2UXBQ 3AQQA 1KQSA 3W2DA 3KJPA 4C3IH 1JJGA 1EWIA 3VR6A 1V8QA 3NWTA 1Q82C 1JWMD 4AYBB 1K0RA 2LSSA 4OONA 3ITPA 1KRTA 4QUCA 1YITA 1SJHD 5ELEA 5CV5A 3I4MB 1EU3A 2F0VA 4IALA 3UE0A 3VR2A 3X3MA 5M5YH 5IYDH 4A93B 5I6YA 1ZYRD 1HZCA 4PV1C 5KGUA 1E1TA 3NBHA 3I73A 2JP1A 3JAME 5LMNL 1EQTA 4AYBG 1YVCA 1EIYB 1LT4D 1VQKA 4BWGB 4A3KG 4ME3A 5M5XH 1G91A 1EIGA 3E9HA 3D4WA 3RD4A 3F2BA 2ICEC 2KVMA 4ZYSA 4WJ3M 4A3DB 1TS2A 1JQYD 3BVGA 4TRDA 3VA5A 4HTHA 2I46A 2SNSA 2BE5D 1PTOD 4G57A 3KBXA 2I0QA 1STAA 2SNMA 4KHZA 4YCUA 1S5BD 3MXGA 4B3TQ 3PO3B 4AQYL 3GV3A 5E3FA 3P1HA 4JCVE 4NW2A 5IT9c 2A68C 1P16A 1IYVA 1GOZA 2VQFL 1HTLD 4JI4Q 1BUVT 2ZT9C 3K5OA 1ZEQX 1TKWB 2JA9A 3PIO3 2E2HB 2PZTA 3CQZH 3NBHB 4C56C 3P7JA 2ZJRA 1O80A 4K6DA 1VF5C 5C3EH 5LMUL 1QZHA 5CMDA 3GTKB 1H95A 4HCSA 3KF8A 5M5WH 4MTKA 2ZJQA 4OWWB 5EAYA 3STBC 4DUYL 3DMUA 3OHXC 4FYDA 2NVTB 3OYYA 2IW3A 1ILQA 2PW7A 4X3UA 2IX3A 1SXTA 3STBD 3PV0A 1BVSA 2VZAA 4LFAL 4J8QA 4A93G 4DA2A 3J80i 4JI1L 2PQEA 2CH4A 2ZXOA 2BDOA 4K5WA 1BR9A 3KLSX 4CDDC 3OWFA 3PUYA 1D5MC 1IBLQ 1JE5A 4OIKA 2OQ0A 4RH6A 3J81c 2CH4W 4IUNA 2K33A 2RHQB 3S15B 5J39A 3H3VC 2LS01 1NBWA 4KK7A 3F8TA 1I3QH 1DOMA 2F0EA 1LTID 1QJOA 1LO5D 3BZCA 2RA4A 2IT1A 3CW2C 3NSWA 2VNUD 2WKCA 4DR1Q 3TZDA 3ICEA 2XWJB 1VQFA 1QVGA 1EYCA 5C4JB 2O5JC 1PVOA 4PMWA 3TDQA 5A2QL 4C3JG 1HA6A 1HTPA 2KHIA 3IFDA 4LMQD 5A35A 2E5LQ 4DNIA 3RN2A 1JCKB 1S5ED 2K14A 1EIHA 1Z6HA 1CKNA 2EJMA 1L0YB 1WCMB 4PMCA 3A55A 4IZ8A 4PG3A 3S2DH 4IFDI 5I9PA 2PW5A 2K5HA 2BA1A 4LJZC 3GTJH 3QR8A 3S17B 2D62A 4A3MB 3I70A 2QEJC 1Y8PB 1EWCA 2MJ8A 4IPHA 4NXNQ 1C7YA 3CAMA 1BXTA 2VXWA 1X56A 5IYBH 2JJQA 1UEBA 1N32L 3RLNA 1GUNA 1G291 2AQ2B 4DR5L 2K5DA 1KC8C 1ML0D 4L5QA 1CFMA 1TWHH 4X3SA 5I2YA 1W6JA 4BBRB 2F0GA 3CCJA 3PO2G 2NYZD 1U0LA 3V05A 1UEAB 4B3SL 2XGTA 3Q8DA 1EY5A 1YNJC 3HP3A 3J80E 1JICA 1XNRQ 5K5PA 1IZ6A 2F0DA 5IP9H 4KN7C 4IPDA 1X3GA 4YY3L 2F0LA 4RMFA 4A3GH 1OTCA 3UDGA 2Q8TA 2EYFA 3H91A 1K8AC 1IW7D 1CQVA 1ILPA 5GQOA 2FJ2A 3RN5A 1F2MA 1J5EQ 1Q8IA 1KLUD 4R8NA 3HOXG 1HZ9A 1PH8A 1PFNA 3K7UC 3K7AB 5IP7H 4HJ7A 3S1QB 1PXUA 1VQOA 5JEAH 3U58A 1N33Q 2I07B 3S24A 3NE5B 3PUZA 1N34L 4FF3A 4XQJA 4ALPA 1EYDA 4LWCA 1GO3E 2AWNA 3T1YQ 2A8VA 3FMCA 1STBA 2K6AA 3BU2A 4QQBX 1J9OA 3E3XA 4PZ7A 1SRUA 3KF8B 1WTVA 1JOKA 4JOIA 3QWNA 1K8GA 2EE1A 2V1CC 1GUOA 1RDPD 1TWGH 1V1QA 4JV5L 1KHIA 2VY3A 1ASZA 3W1GA 5ELNA 1Y1WH 2F0UA 3DEOA 3HRZC 3TQYA 4Y7NB 1HXYD 3TP6A 1KDCA 3BDCA 4C3HH 3NUCA 1N9WA 4GLAC 1Y8OB 1QOHA 4HMJA 2PMZB 2A5HA 1NR2A 4XT3B 2HQEA 2ZXPA 4HCEA 4LUZA 1A2UA 1ENCA 2UXCL 1KTKA 3MXPA 4GZYC 3T51B 1VQBA 1F2ZA 4QIWE 4OL7A 3S2HH 1PHJA 3GP7A 2EJFC 5L37A 1R9TB 1F9PA 3AEVA 1GD7A 1XTCD 1X3FA 2CVRA 3KJOA 1GM5A 4DGZA 3H0GH 1Q8KA 4IOCA 1ZXTA 5FLXc 4GKKL 2X69A 2A68D 2D5DA 3E9IA 4BXXH 2NWGA 3CXCA 1G8ZD 2K5NA 1FJGQ 3PUVA 1STHA 5IGBA 3HOUH 4B3SQ 2M00A 1XPUA 2R61A 4DV1L 4KY6A 4YCWA 1NE3A 1BNZA 3N6RA 3M4OH 3QO2A 4YIJA 4YHHQ 2RKSA 4DV5Q 2EYLA 5LL6S 4HEDA 5CR3A 3G48A 1TS3A 2C35B 3I7FA 3ND9A 3Q0AA 5I6WA 1JWUD 3ER0A 5IP7G 1KXLA 5T1IA 2BH2A 1EY6A 1PTOB 3H6MA 3FRPB 2PI2A 4A3GG 4A3FG 4M8AA 4DV7L 2HT1A 4KKUA 3VDYA 1QILA 1S3OA 3I4NH 5IGEA 4F8MA 2G9HD 2RDGA 3DM1A 2CCZA 2NVXH 3DWAA 4A75A 3A7AB 3RNUA 3NTKA 4ID6A 2VUMH 4ABNA 3PO2H 1K8OA 4DXGA 1YNNC 3MWYW 2EY6A 3GTOB 4LFBL 4RFBA 1DJRD 1YJWA 5BN5A 2Q8RE 5EPKA 4DF7A 1SFOB 1JR0D 3D31A 2UXBL 1SNOA 3FEWX 1CK1A 5GROA 5EBDA 3J80c 1BQQT 2L15A 5DLQE 1IL8A 1SN8A 5FKAC 4BBSH 1GKHA 3A5UA 2VB2X 2PZWA 3EJIA 2EQSA 3ND8A 4OHJA 5DM63 2O5IC 1QUQA 1SE4A 2N3SA 4HSPA 3HKZG 3CCVA 2JEBI 2O4XA 3IKJA 5M3FH 1ZYRC 1DM0B 4DV4L 5C4XG 2ID0A 1XNQQ 5C5LA 4A3JH 1HUNA 2KENA 2E2HH 3HFZB 1MI2A 4CDFC 1MIUA 2PQAB 4F7XA 2ZM6L 2CFMA 1Q12A 2F3VA 1S5FD 1B9MA 4L63B 4DK0A 4DV2Q 4ZKBB 3PF5A 4X65L 3JC66 4LF8Q 2X6LA 3HOWB 4QCLA 4FNFA 2BH8A 5KIXA 2R7ZG 5IYCG 1PFMA 1NMFA 1A6XA 1H9MA 4GOPC 3K8AA 3S1MH 2E2DC 1IBKL 1F9QA 2PO4A 2BOSA 3PO3G 5AJ3Q 4QJFA 3I8ZA 4CKEA 4LFAQ 4GLXA 4AQYQ 2VQEL 1SYBA 4J1MA 3KF6B 3ERQA 1C8CA 1UAPA 3U4ZA 2CQAA 2LXJA 5AJ3L 3OPOA 2Z4IA 3RMHA 1PYBA 1RIPA 1MKHA 5FLMH 3KLRA 3C1EA 1STYA 2K1BA 1JWSD 1EYAA 4LK1C 1JJCB 1GUWA 2E2JH 3SDZA 2JYOA 2GN5A 2K28A 4A3IG 4O1NA 2KJXA 1OXSC 1PLFA 2Z9HA 4F88A 5LMNQ 2RF4A 5M9OA 1JB7A 3EQLC 1SEBD 1K83H 3TP5A 4AYBE 1FYCA 1VCIA 3GO5A 4RKBA 5KYLA 3DHQA 2XRSD 1TS4A 4GN4B 4A3DG 2Q8IB 2XVSA 1DOKA 1PFSA 4DV4Q 3FKIH 3NXWA 1AN8A 2IL8A 3C1FA 2WAQE 5CORA 2R93H 1VQIA 5KYIA 2EOTA 2B8GA 1TWAB 4DUZQ 2XN9C 5DNFA 1FNWA 1D7QA 2Z1CA 3CCEA 3FDTA 2VL6A 3IRBA 2GVBA 1SNMA 2RDHA 3GV6A 4P75A 2RCFA 2JA6H 4JOIC 5E4WC 1IW7C 4DAYB 4KHPL 2DJGC 2F3IA 2MFIA 2OTLA 5GAEC 3QB3A 3TS0A 1PH5A 1WTRA 3TSSA 1IXRA 1IBML 5ELFA 3A74A 5COYA 2QKIC 3H09A 2CW0C 4IJLA 2JA7B 3R3OA 3VR5A 2VW9A 3HOUG 4J6HA 2Q2UA 1VQ6A 2PI2E 2ICIA 1WOCA 4DV7Q 3TMEA 3HOZB 3H15A 1PFBA 1UUPA 1I50B 2OT2A 4ZKCB 1GUGA 5JVH3 1D5ZC 1NAPA 3H0GG 1IHZA 2N88A 5C0XH 2RBMA 3CPWA 3GTMB 1L1OB 5FJ8H 2HD3A 2R7ZB 5GAGC 4MNOA 1JOQA 4R4IA 3D8GA 2PZUA 4P72A 4IURA 2JE6I 1LTLA 3TS2A 3URYA 2KOLA 1LT3D 3SK4A 5CBEE 1KD1C 4XQQA 3GTLH 4CDEC 4WFN3 4DV5L 4HJ5A 2MO0A 1E1OA 1W6KA 5I2XA 4X6AH 1NSNS 3VR3A 1RCVD 4QMGA 5C44H 1GUTA 3KBGA 1N36Q 1RD9D 4NXMQ 3GTQB 2L4NA 1K73C 4X64Q 2A69C 3UI2A 4JBMA 2NZOA 1NNXA 1LTAD 4BY1H 1IKMA 2DNEA 3TEHB 2E5LL 1Q90A 1O7YA 2HDLA 4DV6L 1K3RA 1KRSA 4DK6C 1WYDA 2Z6KC 1EY4A 3PQIA 1JT8A 1FVIA 2F0MA 2L9HA 3PCOB 4JBJA 2JA8H 4A3EG 1U5KA 1B8AA 1PH4A 2P5ZX 5EPLA 3K5LA 1EQRA 5CV9A 3A8JE 1YNND 1A3TA 4L6TB 1LTTD 4K0KL 2KCCA 3OTOQ 4TSSA 4CKBA 1HR0L 3PIOA 3ULJA 4HIDA 3HOZG 1HCZA 4C3IG 1RODA 4TQUS 1Z7TA 4RHSA 3M7GA 3HOUB 1VQDA 1S5DD 2A1AA 4R9WA 5ELBA 1S72A 1KAWA 2DJFC 4B9XA 4LFCQ 4LUVA 5M3MG 1VQ5A 3LNNA 1I6HH 1TWFH 1GXDC 3J80L 2EY5A 2D0PA 1KL9A 1I4PA 3N52A 4HAEA 1EIFA 1AE3A 5IGCA 2XRQD 4JI3L 4RHRA 3S16H 1BCPB 2YTXA 1SMYC 1EFWA 1II3A 1M4VA 1CKMA 2DN8A 1PTOH 1PTOF 2TSSA 5HGQA 1TS5A 1XMQQ 1BO0A 4FF4A 4DV6Q 1KAAA 1CA6A 1H9SA 2OEOA 4CBVA 4MTNA 5C0XI 2SEBD 1VQ4A 2NVQB 3I4NB 3S1RB 1KDAA 1G6PA 1H9SB 2B63B 3GQBA 2NVXB 4JI4L 2AMCB 3CRKC 5LMNW 1F77A 3J81L 4FO2A 2VUMB 1D6EC 1SNDA 3F2CA 3RZDB 2D9UA 4BA2I 1STEA 4TKOB 4IQZA 2NVYH 3CF5A 1LTRD 1A62A 3I56A 5A2QE 4C3JH 3EA6A 3J7AF 4RCOA 1SE2A 1X3QA 4DFAA 1U4RA 4EQNA 1B3QA 2E76C 4NXNL 1B1ZA 1F9RA 1LACA 2CKZB 2RSNA 4AIMA 1F2YA 4EGVA 4RKLA 4YWLA 1UE6A 3RLOA 1V1OA 2JA5G 1UNSA 4RGMA 3SK5A 5M3FB 3KLWA 1NR4A 1ESFA 1NUCA 4LW1A 2EY2A 1E24A 3MAQA 5ELOA 3ULLA 1D2BA 1I4QA 4PMBA 3Q24A 3S1NH 3DXJC 2PMZE 5KRUA 1SLJA 1STNA 2NTTA 2D2CC 5J22A 5C3EG 3G7LA 4HJ9A 3FPPA 1VQMA 5KEEA 3K5MA 3DEPA 4IUPA 1B2TA 1SJED 4H13C 4HIKA 1VQ8A 1EY0A 1Q7YC 3P20A 2F52A 2HQLA 2OWOA 2WINB 4C1NK 4O42A 1PYSB 4OO1G 1YHBA 4R4OA 2I5LX 1JMCA 3OMCA 4Q5VA 2ES2A 3NTHA 3W5OA 1JJ2A 4NPSA 1HUMA 2E74C 3O13A 1IBLL 4JI7Q 5C4XB 3H94A 5C0XG 3CC7A 1HNWL 3HOYB 1PH6A 1JORA 2DNCA 1KIXA 1NY4A 4K0KQ 2WAQB 4XQNA 4A3BB 3M4YA 2IHEA 4OWXB 4BY7H 1HA5A 4EX5A 2J7ZA 4A3IB 3G6JB 1EY8A 1GUSA 4V0BA 4JI3Q 1AFPA 3WDNA 2NZHA 1OXXK 2GVAA 3PMFA 1LV9A 5ELDA 1XPRA 2JA5H 3CCUA 4UP9A 3AU7A 4N9PA 4A3MG 3T1HQ 4DV3L 3PF4A 1MD2D 3TREA 3JAMi 2VQFQ 2JA6G 1DYQA 3G71A 2R93B 1MSHA 1QVCA 3VYRA 2A6HD 3SK6A 4B3TL 2NN6G 2SOBA 4KD3A 1KNAA 2WFWA 2Z6BA 1ET6A 4A76A 4NXML 3OW7A 2B2TA 2K03A 4A3DH 1S5CD 1EOTA 1SBBB 2A6EC 3C2PA 3GTGH 4GLVB 3MXNB 1VQJA 4P74A 3ERSX 4I7AA 5IGDA 1SYGA 4A3BG 1FR3A 4JI7L 4FF2A 4QGUA 5IT9L 5EPJA 1N33L 3MC0B 1VDZA 3LWUA 1VQHA 5BN3A 2KBNA 3FKIG 4L5RC 1PV4A 2KEDA 4Q0FA 2F0SA 1VQEA 4NDXA 3CP0A 1HRJA 1WD1A 2JEAI 4DV2L 4LF8L 2DY7A 1B7YB 3FP9A 3S14B 1DGSA 3G6EA 2JA7H 2DY8A 2Q2IA 1XNRL 1Z47A 3GTPB 1ICWA 2E8GA 2L55A 3I2ZA 1I94Q 1XNQL 1ENFA 1NTGA 2WKDA 3K81C 3E0JA 1MJCA 2XTIA 3D6CA 5LL6X 4A3CH 1B44D 1W3SA 1UE1A 3OW2A 2LXKA 1PH7A 3JAML 4B3MQ 3M3YH 1EEID 3KYHC 1TU2B 2WB1B 5T1GA 3J81j 4DU9A 4FP5D 4KHPQ 4XYQA 1HH2P 2Z8LA 3CMEA 2TMPA 4QY7A 4OO1I 1FD7D 4V190 1HHVA 3E0EA 1EQQA 1H9RA 2F4VQ 3M4PA 5KNDA 3DUZA 3UDIA 3CRLC 3GTLB 1KLGD 1ESRA 1R4QB 1I3QB 5EKIA 5JEAJ 1GHKA 1IYJB 4R4QA 4DR5Q 5C44B 2B2WC 1YEZA 4DN4M 2A6ED 3RUZA 1JB3A 3J81E 4DUZL 1DZ1A 1PMRA 2ZXRA 4LNQA 2YU9H 2CWAA 1YNJD 4JI5Q 3LWEA 2XSCA 4QIWB 2F0QA 5C4JH 1D1KA 5JPNC 2N55A 4L5SA 1S40A 2Y0SB 1AZPA 2QW7A 3NPPA 3TZUA 5CBAE 2FXQA 3CD6A 4I65A 1S4ZA 4LUOA 3UDFA 1HZBA 4KY5A 5D65A 2LMCB 2V4DA 4LF9Q 3HS0C 4P71A 5J1ZA 1TIID 4DKAC 1X54A 2B2UC 1LUZA 1WCMH 1FNVA 4KHVA 2JA8B 4JI8L 1CUKA 2UXDL 2R7DA 4CHTB 1QUQB 4LF7Q 4JI0Q 3HOXB 1LTBD 3MZ5A 1GJXA 3CU7A 3BZDB 1A3UA 3QOLA 5FJ8G 4DV1Q 1SE3A 4ZLTF 1LABA 4UPAA 4KD4A 3UDXA 1TWHB 4IFDJ 1SR3A 3SK8A 1Y69U 3M4QA 4QF4A 4HIMA 3BVMA 4DUYQ 5HGTA 4GKKQ 1CT1D 3FHWA 4N9TA 4RGNA 3FPUB 2J4XA 2F3WA 4GOPA 4KJNA 1VQLA 3MFGA 2VB3X 2IHFA 2E2IH 3TN2A 4BBRG 4DV0Q 3OSOA 1PTOC 1I6VC 1BDOA 4JW0A 3T4AC 5BR8Q 1I4RA 1HJPA 3SXHA 1Y1WG 2LKVA 4DR2L 1WFQA 2PYKA 2KECA 3R93A 2NVQH 5G3LF 2B63H 1C0AA 4JPBW 3L0OA 2FHTA 4BS9A 1HQMC 4BXXG 4A3EB 3BDLA 3RZOH 2K52A 2NZ1D 3RZDH 3OIPA 3KLSA 1X3EA 4POFA 1R4PB 4JV5Q 4FXDA 3JAMc 5C4ZA 3A7LA 1WI5A 1EOVA 2KEEA 4K8IA 4LF4L 4KKSA 1Y1WB 1K0SA 4KLKA 1TY2A 4Y7NH 3HOVB 1PA6A 1VS0A 5ELCA 2CW0D 2K4KA 4PNYA 1FGBD 2A6HC 3NK9A 4JI0L 1STGA 2F0KA 1QWYA 2Z4HA 1XJVA 3U4VA 2HUGA 4LF5L 2PNRC 4MZ9A 2B8FA 4LFBQ 5M5YB 1CZGA 2OTJA 1XTDA 4K6LA 3DWQA 4C3HG 3AMUA 1SYEA 3R2IA 4U673 4X64L 3T56B 4XTCS 4IFDH 5IYBG 4R8IA 2PPBC 1D1IA 5M5XB 1E2ZA 2EYOA 1EUJA 3H0GB 1KDBA 4FVMA 3AYHB 3ZYYX 2F03A 1B4OA 3E5SA 4NB3A 1T5EA 4KV6A 1QB5D 5CV7A 1OXVA 1AW7A 1I4GA 1U4LA 1EY9A 2VS1A 1VQAA 1VQPA 1YNXA 3PO3H 1Q1BA 4JBWA 1CTMA 3M4OB 3EROA 5G3LD 1BKBA 4IOAA 3D0FA 3L7ZC 2ZJPA 2CQOA 5JJKA 1FJGL 4IPGA 1D5XC 2Y0SG 4CKCA 3CQZB 1B50A 4KKTA 1YJNA 1WJJA 4DR3Q 4P2CB 3M7NA 4A3LG 1U4MA 2JSOA 4XT1B 4IO9A 1I4HA 3U9OA 5C3EB 1Y1VH 1LTSD 3I4LA 2RCNA 4A3BH 2ZTCA 5M5WB 4UP7A 4RWSC 1EL0A 2QDBA 1A2TA 4A3IH 1PRTD 3A8IE 2NVTH 1I94L 4OEMB 4ZRZA 2EXZA 4K14A 1VF7A 1IBMQ 1JE4A 5IP9G 1MGSA 4PZ6A 1NJIC 5FO7B 3NQTA 4OXPA 4N8X1 2WB1G 4KY7A 3NP8A 1SE8A 2L1BA 1QG7A 2F1MA 1YJ9A 1SFOH 1IL2A 4ZAIA 3OOCA 4MN3A 4ZK9B 3J7ZC 5HY6A 2B2VC 3H3VI 1RHPA 1TR5A 2QILA 4WRDA 3I4MG 3HOWG 4DR6L 4X62L 5CV4A 1PH3A 4G7HC 3I3CA 3QG1A 1XX8A 4G4KA 1X32A 3CCRA 4JI6Q 4JI1Q 1EWHA 1XYIA 3EFXD 2F0HA 5IYCH 4K8JA 2MO1A 5DM73 1HNXQ 5C3XA 2VUMG 3K80C 3TP7A 3F2DA 4WJWA 1HQRD 2F0TA 2UUCQ 5CYUA 2UUCL 3ZJYC 3T1HL 2B2VA 1IBKQ 3GDEA 3E6ZX 3V96A 4A3FH 4A3JB 1LTGD 3HKZB 2AQ1B 3K0XA 2NN6H 1TWCH 1HNXL 5IY0A 5EKLA 1X3PA 4B9WA 3NELA 3L3OC 5JAVA 2EZVA 2JXMB 4K5VA 2B2YA 3S17H 1V1PB 4A3MH 4NMZA 2HCIA 2F0PA 4JI2L 3HOWH 3HGBA 1HNZQ 1AEXA 2KA7A 4O2DA 4K2LA 1M90C 1RKNA 4BBSG 4KJOA 1PDQA 3WWVA 5JJLA 1CHQD 1RL2A 2KQ3A 1O7LA 4O0AA 4J15A 4HJ8A 5M3FG 3SVMA 2IPKD 1XWEA 3CCLA 2Y0SE 2QF7A 1V9PA 1IKLA 4BY7G 1WTXA 5FLMG 1AH9A 1IYUA 2HIXA 4TVAB 4DAPA 3PSIA 4P73A 4XYOA 4N8FA 5IGFA 5DAUA 2AKWB 2EYMA 1J5EL 2D0OA 1FL0A 4APVA 2ENBA 5IOCA 1ZKOA 3MFYA 3I90A 1B9NA 2KUMA 1WVLA 5I4DA 2E2JB 3A5ZB 2FINB 4WORA 2EYPA 2FMCA 3HOYG 2Q2TA 3K7AH 3S1QH 1E7ZA 1YHAA 4XDXA 3DLLA 5C3WA 4OO1H 1K83B 1LT5D 4ILWA 1SNCA 1PYWD 4LAAA 4JI5L 4OX9L 3I4OA 3CCSA 1Y1VG 3I72A 5HURA 3PIPA 4OWTB 1CQFA 3FKIB 1A63A 2R3ZA 4A3LH 4UY8C 1RTNA 4H02A 3NWSA 1CSPA 2BDNA 1TWGB 4X3TA 2NN6I 5I9OA 2R92B 1EYGA 4G7ZC 1TWAH 1SYFA 1OXUA 1VQ7A 1B53A 2ZTEA 3IL8A 2EJGC 2Z0SA 1SDFA 3OIQA 3CC2A 1BBWA 4C3HB 5LHY1 3IAYA 2IJ0A 5D14A 5BN4A 1LYLA 3SEBA 4A3KH 4JBKA 4FF1A 1A15A 4B3ML 1PH1A 5FLXL 2JA6B 4RG1A 3U9SA 3VYTA 3I55A 4XXEA 1J8IA 4GS3A 1EZ8A 3NEMA 5ISRA 4E6IA 2ALYB 1TXYA 4UHVA 3S2HB 3NHHA 1LM0A 4L8JA 3X3NA 1XPOA 2E2IB 3EVQA 1HNZL 4IFDG 5TSSA 4A4IA 4DPGA 2RSOA 3SE0A 2JN4A 2F4IA 5BR8L 1MHWC 5CC4A 1Y8NB 2KHJA 3W3AA 2LY7A 4YWMA 1TQOA 1X55A 3DWPA 1NMGA 4IUTA 4LF4Q 3HOZH 1XXGA 3HG9A 4MHEA 3LGJA 3MXNA 4R4TA 1HFNA 2G5DA 4LFCL 1E0BA 2F0NA 3J7YW 2F0OA 1B3AA 3GTMH 1A3VA 1KNEA 4DAMA 1M1KC 1O7ZA 4DR7L 2QCPX 1K28A 4A3EH 2H1EA 3HKSA 3CPFA 3RZOB 4H7BA 4ZQ3A 2WIIB 4ZUIA 1RF2D 1QZGA 3AFPA 2RDFA 3DM3A 2MPMA 1T5XD 2WB1E 2MNAA 4IUUA 4DR7Q 5AFWA 4RGOS 5CGKA 1L2FA 1SAPA 1V43A 3HOVG 1QCBD 2YTVA 1CKNB 3HOVH 2UU9L 2EVBA 3CMAA 3GTQH 5LMUQ 4GKJQ 1L0WA 2UXDQ 2F0WA 1SMXA 1BCPF 5GAHC 4AH6A 4DV0L 4ZUJA 5C6AA 4PZ8A 1MJEA 1CSQA 5IGGA 3PGZA 3P75A 2NBFA 1VQ9A 2ZM6Q 4BY1B 1D8LA 2CHBD 1HPCA 1PZKD 2WV6D 1ASYA 5E7NA 2PNHA 3ULPA 5C5MA 4IN3A 2QGQA 4C2MB 3PO2B 4JVZA 2HCCA 1N34Q 3OMGA 3GTOH 5JPMC 2JQOA 1ET9A 1AE2A 2ZTDA 1H9KA 5M3MB 5IODA 1VQGA 4WJ4A 2JA8G 1FNUA 4JK1C 3H3VH 1P8LA 1NCVA 3KUPA 1EU4A 2A74C 5IIFA 4DR6Q 2B29A 4MIUA 4KTAA 5CV6A 4BBSB 2EYHA 2EIFA 3G4SA 4JI8Q 1W2BA 1OXTA 2AQ3B 1UE7A 1WCMG 2F4VL 3A56A 1V1PA 4LF9L 5FO9B 1PZJD 1LLRD 1QNUA 4X66L 5FOBB 1CA5A 3SGIA 1WD0A 3NBIA 4EVOA 3VR4A 4B3RL 4POGA 1OO9B 4DNRB 5JVG3 3S16B 1L1OC 2B63G 1DOLA 2MGSA 3L9AX 2H5XA 2NTSA 1E2WA 3UE1A 2UUAQ 1Y1VB 5DEHA 4K2KA 1PZID 2C5CA 4B3RQ 2KCTA 1MSGA 4YY3Q 5D3DA 3PUXA 1F9SA 4FDBA 3W1BA 1E3PA 3GD7A 2N78A 4BA1I 3S1MB 1BCPD 4CJ0B 1M8AA 4YWKA 3U50C 2RQXA 1BF4A 2H4OA 4HN7A 5C0XJ 2K32A 3MHBA 1WTQA 4GNXB 2EYJA 2MUYA 2K7VA 3WOFA 2I5MX 2K5QA 4KI0A 2AWOA 2A73B 2RVLA 2B2YC 1ENAA 1JC7A 2NVYB 4A3CG 3D4DA 3BDOA 4JYAQ 1EQVA 1E2VA 3A8KE 4C3JB 2K5VA 4H44C 4C3IB 2B2TC 2UUBQ 4ME5A 2K01A 1Q86C 2PCFB 3OWEB 1H9JA 3B6YA 5GADC 3D3RA 3R2TA 2YYZA 3SR1A 2JA7G 2B2WA 1EFID 3QIAA 3K59A 4S3SA 4G7OC 1GVPA 3I4MH 3PUWA 1LT6D 5EGTA 4A93H 5JJIA 1WTWA 1X6OA 4OGQC 3F1ZA 4CJ1B 4X3KA 4EQPA 1EY7A 4A3FB 1K8MA 5KNBA 2G9DA 4JC0A 4QB4A 2J0TD 5KNCA 1TWCB 4CDCC 4QL5A 1FGUA 4DR1L 3ONAB 4UAIA 4DR4L 5E1FA 3K57A 2XIWA 3KF6A 4LF6Q 1L0XB 5EBCA 1SNPA 5IWAQ 2VQEQ 2R6GA 1Z9FA 4FXKC 4GKJL 3QOJA 1HNWQ 5D3IB 1BCPC 1F2LA 1A8VA 1SYCA 4IJHA 1U9RA 3J7AV 4KN4C 2LFNA 2IY5B 2E75C 4X62Q 5K36H 1Q46A 4XIGS 1TT2A 1A0IA 5J3BA 3IFTA 5FK9C 3K5NA 4EQOA 2WP8J 3BG3A 3F2UA 2M9VA 1RJTA 3AB9A 2QEXA 2GA4B 5C4XH 3J81i 3EIVA 1EZ6A 4ODGA 3M9BA 1KABA 3C46A 5C4HA 2F0JA 2L11A 3WOEA 2K50A 3M85A 2NB0A 2EXDA 4HSVA 2L0CA 3TBIB 3GTKH 1U4PA 4EQ5A 2N49A 2YV5A 4RCNA 4BY7B 3Q23A 3VYSA 3S9WA 1I50H 2A69D 2FMMA 3EBEA 4GN3B 4X65Q 1QE6A 1T9HA 4ZCKA 1XMOQ 1L1OA 3EN2A 4GOPB 2Z6KA 4DR3L 5EKKA 1CI3M 2R7ZH 2JA5B 5EQ0A 3CC4A 1SMYD 3LX0A 3Q6SA 1HZAA 2L12A 4CGYB 3MEHA 3PIP3 2DGYA 1N36L 4B08A 3S15H 5FLXE 4UDUC 2IX0A 5K36G 3T13A 1K3BC 2R92H 2WAQG 1TVXA 2QDLA 1E22A 1N32Q 3R8BA 4A3JG 2R7FA 2OXPA 4IPCA 1X9NA 2HHHQ 1EEFD 1SSOA 3Q22A 3GTGB 2EDGA 2F0IA 4OX9Q 2EPBA 2XNAC 3D6WA 1K9MC 1B70B 2OQKA 4A3KB 2N8NA 1WTOA 1SROA 5JOBA 3KFUA 1BBXC 3SHLA 4GN5A 2K75A 4FXGC 4JG2A 1WTHA 2JK8A 2ASBA 1VMCA 5JJZA 4DXFA 4DNTB 4PQXA 2QA4A 3BVZA 1XMOL 1MBYA 2YTYA 3T53B 3S14H 3S2DB 1XMQL 3TP8A 2I5HA 2O2LD 2SDFA 3GTPH 1BBUA 4LF5Q 1YBYA 2HHHL 3GTJB 3HKZE 2K5WA 2OF1A 1N8RC 2M2LA 5IYDG 3I91A 4HMIA 2B39A 4YHHL 4CJ2C 3CKIB 1Q1EA 3MA2B 2MHVA 4KMUC 3M3YB 3BZKA 3NENA 3I4NG 1JOOA 3C3LA 1O7IA 3KDFA 1I6HB 1HFGA 4BBRH 3BS1A 4IUVA 1YI2A 1TWFB 1DONA 3K0YA 4YCVA 2NUCA 2K05A 3AFQA 4RGTA 4JI2Q 2WACA 1Y14B 1X65A 1G51A 4Y52H 1TY0A 1J6QA 4HR7B 1HR0Q 4K5XA 1SYDA 4H0LC 1UE5A 4A3GB 2BCOA 4GNXA 4LF6L 2KHSA 4BY1G 4DR4Q 4HJAA 2YU9B 2MQHA 4DR2Q 2EY1A 2XWBB 5IE8A 2HIVA 2UXCQ 1PRTC 3CCMA 2RHSB 5E4XA 4DV3Q 1G6ZA 1WTPA 2AHOB 3A0JA 3S1RH 3T16A 2KCMA 1I4XA 1ONLA 3KOJA 4C2MH 2AUJD 1C48A 4Z9CB 5EJWA 1GHJA 2L5TA 3KDFB 5M3MH 1I5FA 2UU9Q 1C9OA 1ICFB 1YZ6A 4GNXC 1BOSA 5H1SE 3NTIA 3BJUA 2X6GA 3RLFA 4HIOA 3V2TA 1PRTB 2KCNA 2HDMA 1DD2A 2C9OA 1G2SA 4R4CA 4UP8A 1Q3LA 5IWAL 4ULLA 3QJYA 3OTOL 2AUKA 1PRTF 2MP1A 3HOXH 4JI6L 3NQIA 4OELB 1VQCA 3VYUA 3D4RA 2IWHA 4QUFA 4LF7L 4DK1A 1CM9A 3A54A 3RR5A 4I7ZC
chains in the Genus database with same CATH topology
4A3KH 4JBKA 4QGUA 1QUQA 2N3SA 3CCVA 3HKZG 3MEFA 4R1JA 1PH1A 4B3ML 2JEBI 1N33L 4RG1A 5M3FH 1VQHA 2KBNA 3FKIG 4L5RC 1PH9A 1PV4A 3I55A 4DV4L 5C4XG 1VQEA 4GS3A 2ID0A 1XNQQ 3CCQA 3NEMA 3CP0A 4A3JH 2KENA 2ALYB 1TXYA 2E2HH 2JEAI 2PQAA 3HFZB 4DV2L 3T1YL 4LF8L 1LM0A 1XPOA 1B7YB 1R9TH 3FP9A 1HNZL 1HR0W 2BA0A 1DGSA 4IFDG 1MIUA 4A4IA 2PQAB 4DPGA 3G6EA 2ZM6L 2CFMA 1Q12A 2JA7H 2Q2IA 5BR8L 1XNRL 1Z47A 2KHJA 2ATWA 4DV2Q 2E8GA 3PF5A 4YWMA 3JC66 4X65L 4LF8Q 3I2ZA 1I94Q 1X55A 2UUAL 2UUBL 1XNQL 1NTGA 3K81C 1NMGA 3L2PA 1Q81C 1MJCA 4LF4Q 1QVFA 3HOZH 4JYAL 3TRZA 2BH8A 2XTIA 2R7ZG 2B3GA 5IYCG 4A3CH 1NMFA 1VQNA 1W3SA 1CKOA 4GOPC 3LGJA 3K8AA 4DK3C 1UE1A 3OW2A 3S1MH 2LXKA 1YIJA 4R4TA 1PH7A 1IBKL 4B3MQ 4LFCL 3M3YH 5JEAG 3KYHC 3GTMH 2CWPA 3J81j 3PO3G 2DUDA 4DAMA 1M1KC 2A19A 2Q2HA 4QJFA 1HH2P 4X66Q 5AJ3Q 4DR7L 3CMEA 4A3EH 2R92G 4KHPQ 3HKSA 1UWVA 4LFAQ 3CPFA 4QY7A 4GLXA 4AQYQ 2VQEL 2IX1A 4OO1I 3E0EA 1EQQA 2F4VQ 2R93G 3M4PA 3KF6B 5C44G 3UDIA 1PH2A 1QZGA 3AFPA 3U4ZA 3DM3A 4L5TA 2OCEA 2WB1E 2LXJA 5AJ3L 2MNAA 4DR7Q 3HOYH 3J7A5 5JEAJ 1L2FA 1IYJB 1PYBA 1V43A 4R4QA 1RIPA 1MKHA 3AQQA 5FLMH 4DR5Q 1KQSA 3HOVG 1YEZA 2UXBQ 3KJPA 4C3IH 2YTVA 1CKNB 4DUZL 1JJGA 3HOVH 1EWIA 4LNQA 2UU9L 3CMAA 1Q82C 1JJCB 3GTQH 5LMUQ 4GKJQ 1K0RA 2LSSA 2CWAA 1L0WA 2E2JH 2YU9H 2UXDQ 1SMXA 5GAHC 4JI5Q 4OONA 4AH6A 4DV0L 2GN5A 1KRTA 4PZ8A 1MJEA 4A3IG 5C4JH 1CSQA 1YITA 4L5SA 1S40A 1OXSC 3PGZA 5LMNQ 2RF4A 5M5YH 1JB7A 3UE0A 1VQ9A 2ZM6Q 1D8LA 5IYDH 2FXQA 1K83H 1ASYA 5E7NA 4AYBE 3CD6A 2PNHA 3ULPA 1HZCA 1VCIA 3GO5A 2QGQA 4LUOA 3UDFA 1N34Q 1E1TA 1HZBA 3GTOH 2JQOA 1AE2A 2ZTDA 4LF9Q 5LMNL 4GN4B 4P71A 4A3DG 1PFSA 4DV4Q 3FKIH 4DKAC 4AYBG 1X54A 1VQGA 4WJ4A 1YVCA 1LUZA 1WCMH 2WAQE 1EIYB 4JI8L 2R93H 1CUKA 1VQIA 2UXDL 1VQKA 4A3KG 2R7DA 4ME3A 5M5XH 3E9HA 2JA8G 3F2BA 3H3VH 4DUZQ 1P8LA 1QUQB 4LF7Q 4WJ3M 4DR6Q 2B29A 4JI0Q 1D7QA 3CCEA 2EIFA 3G4SA 4JI8Q 2I0QA 2VL6A 1W2BA 4KHZA 4YCUA 1OXTA 3IRBA 1UE7A 2GVBA 1WCMG 4DV1Q 5FJ8G 2F4VL 4P75A 4UPAA 4B3TQ 4AQYL 3UDXA 4LF9L 2JA6H 4IFDJ 1SR3A 4JCVE 4JOIC 5IT9c 4DAYB 4X66L 1P16A 4KHPL 3M4QA 2F3IA 2MFIA 2OTLA 2VQFL 5GAEC 3TS0A 3SGIA 4DUYQ 4HIMA 1PH5A 4JI4Q 4GKKQ 3FHWA 1IXRA 2JA9A 1IBML 4B3RL 4POGA 3A74A 3CQZH 4GOPA 3NBHB 1VQLA 2IHFA 2E2IH 2ZJRA 1L1OC 4BBRG 4IJLA 4DV0Q 2B63G 2H5XA 3UE1A 5C3EH 1QZHA 5LMUL 1YHQA 2UUAQ 1H95A 2VW9A 3HOUG 2Q2UA 1VQ6A 5BR8Q 4B3RQ 2KCTA 2PI2E 5M5WH 1HJPA 4OWWB 1WOCA 4DV7Q 5EAYA 3STBC 4DUYL 1Y1WG 2ZJQA 4YY3Q 4DR2L 3H15A 1WFQA 3PUXA 4FDBA 3W1BA 3OYYA 1E3PA 3GD7A 2N78A 4BA1I 2NVQH 2B63H 3H0GG 4YWKA 3STBD 3U50C 1C0AA 3PV0A 1BVSA 2VZAA 3CPWA 1L1OB 3L0OA 5C0XJ 4LFAL 5FJ8H 4BXXG 5GAGC 4MNOA 4A93G 3J80i 4R4IA 4JI1L 4P72A 4GNXB 2JE6I 1LTLA 2K52A 3RZDH 3RZOH 3TS2A 3PUYA 2I5MX 1IBLQ 4KI0A 1KD1C 1JE5A 2OQ0A 3J81c 2AWOA 3GTLH 4DV5L 2RHQB 4HJ5A 1X3EA 4POFA 2MO0A 4JV5Q 1E1OA 4A3CG 1NBWA 3JAMc 3F8TA 1I3QH 4X6AH 1WI5A 4JYAQ 1EOVA 5C44H 4LF4L 1N36Q 2K5VA 2UUBQ 4NXMQ 4KLKA 1Q86C 4Y7NH 3BZCA 1PA6A 1VS0A 2IT1A 3B6YA 3CW2C 5GADC 2K4KA 2VNUD 2YYZA 2JA7G 4DR1Q 4JI0L 3ICEA 1K73C 1VQFA 1QVGA 1XJVA 3U4VA 1PVOA 4PMWA 4MZ9A 4LF5L 4X64Q 1GVPA 4JBMA 4LFBQ 3I4MH 2NZOA 3PUWA 4BY1H 2KHIA 4A93H 2OTJA 5JJIA 1XTDA 3TEHB 2E5LL 1X6OA 4DV6L 3F1ZA 2E5LQ 1K3RA 4DNIA 1KRSA 3RN2A 2K14A 4DK6C 1WYDA 2Z6KC 1CKNA 4X64L 1JT8A 1FVIA 4JC0A 4XTCS 3PCOB 4JBJA 2JA8H 4A3EG 5IYBG 4PG3A 1U5KA 3S2DH 1B8AA 1PH4A 4IFDI 1EQRA 4QL5A 1FGUA 4DR1L 4DR4L 2K5HA 1EUJA 2BA1A 3KF6A 4LF6Q 4K0KL 3GTJH 3AYHB 3OTOQ 2D62A 5IWAQ 4NB3A 2VQEQ 2R6GA 1HR0L 4IPHA 1Z9FA 1HNWQ 3PIOA 3ULJA 4HIDA 3HOZG 4GKJL 1OXVA 4NXNQ 1C7YA 3CAMA 1A8VA 4TQUS 4IJHA 2IY5B 1X56A 5IYBH 2JJQA 1VQDA 1UEBA 2A1AA 2VS1A 4X62Q 1VQAA 1KAWA 3RLNA 1VQPA 1S72A 1N32L 1G291 1YNXA 1Q46A 1Q1BA 4JBWA 4XIGS 4LUVA 4DR5L 5M3MG 1KC8C 1VQ5A 4L5QA 1TWHH 1I6HH 1A0IA 5J3BA 1BKBA 4IOAA 3CCJA 1TWFH 3PO2G 3D0FA 2D0PA 3L7ZC 2ZJPA 1KL9A 2CQOA 2WP8J 1U0LA 1EIFA 5JJKA 1AE3A 2QEXA 4B3SL 2XGTA 3Q8DA 5C4XH 1FJGL 4IPGA 2Y0SG 3PO3H 3J81i 3EIVA 4JI3L 1XNRQ 1YJNA 1IZ6A 1WJJA 5IP9H 4DR3Q 2YTXA 4IPDA 3M9BA 1X3GA 1EFWA 3M7NA 3S16H 4A3LG 4YY3L 4IO9A 4RMFA 4A3GH 1OTCA 1CKMA 3UDGA 2K50A 1Y1VH 3M85A 2EXDA 3GTKH 4A3BH 2RCNA 4EQ5A 1K8AC 2ZTCA 2N49A 2YV5A 4UP7A 5GQOA 5HGQA 1XMQQ 3RN5A 1J5EQ 4DV6Q 4A3IH 3HOXG 1HZ9A 1PH8A 1I50H 1I94L 3K7UC 2NVTH 3EBEA 4MTNA 4GN3B 5IP7H 4X65Q 5C0XI 4HJ7A 1VQ4A 1T9HA 1XMOQ 1L1OA 1VQOA 1N33Q 3U58A 1IBMQ 1G6PA 3S24A 5IP9G 3EN2A 4JI4L 2AMCB 3PUZA 4GOPB 4PZ6A 5LMNW 1NJIC 1N34L 2Z6KA 4ALPA 4DR3L 4LWCA 2R7ZH 1GO3E 2AWNA 3CC4A 3T1YQ 2A8VA 4OXPA 3F2CA 4BA2I 2WB1G 1HZAA 3BU2A 4QQBX 4PZ7A 1SE8A 1SRUA 3KF8B 2DGYA 1YJ9A 1SFOH 1IL2A 4JOIA 1N36L 1K8GA 3S15H 2NVYH 2IX0A 3CF5A 1A62A 3J7ZC 5HY6A 2V1CC 3H3VI 5K36G 1TWGH 1V1QA 3I56A 2R92H 4JV5L 1KHIA 2VY3A 2WAQG 4C3JH 3I4MG 1ASZA 3W1GA 3HOWG 4DR6L 1E22A 5ELNA 4X62L 1Y1WH 1PH3A 1N32Q 4A3JG 2R7FA 3TQYA 4IPCA 1X9NA 2HHHQ 4AIMA 4NXNL 2CKZB 4C3HH 3CCRA 4JI6Q 4OX9Q 4JI1Q 5IYCH 1N9WA 4GLAC 1UE6A 4YWLA 2MO1A 3RLOA 1HNXQ 1K9MC 1B70B 2OQKA 2VUMG 2JA5G 2N8NA 3K80C 1SROA 3KFUA 3F2DA 4GN5A 2K75A 4LUZA 3KLWA 4JG2A 2JK8A 2UUCQ 2ASBA 4LW1A 2UXCL 2UUCL 3ZJYC 1E24A 3T1HL 5ELOA 3ULLA 1IBKQ 3GDEA 2QA4A 4A3FH 1XMOL 3S1NH 1VQBA 2PMZE 3K0XA 4QIWE 2YTYA 3S2HH 1PHJA 1SLJA 1TWCH 1HNXL 3S14H 5IY0A 1XMQL 3AEVA 5C3EG 1GD7A 2I5HA 3NELA 1X3FA 3KJOA 1GM5A 4HJ9A 3GTPH 1BBUA 1Q8KA 3H0GH 1VQMA 4LF5Q 1YBYA 4IOCA 2HHHL 5FLXc 3S17H 3HKZE 4A3MH 4GKKL 4HIKA 4JI2L 4LFCQ 1N8RC 1VQ8A 3HOWH 5IYDG 1HNZQ 1Q7YC 2F52A 2HQLA 3E9IA 4YHHL 2OWOA 4JI7L 4O2DA 1M90C 4BXXH 3CXCA 4BBSG 1Q1EA 1PYSB 4OO1G 2K5NA 1FJGQ 3PUVA 3HOUH 1YHBA 4R4OA 3WWVA 4B3SQ 2I5LX 1JMCA 3BZKA 5JJLA 1XPUA 4DV1L 3NENA 1RL2A 3I4NG 4YCWA 1NE3A 2ES2A 1O7IA 3KDFA 4O0AA 4J15A 3W5OA 4HJ8A 4BBRH 1JJ2A 3M4OH 5M3FG 1YI2A 4YHHQ 4NPSA 4DV5Q 4YCVA 3CCLA 2Y0SE 4BY7G 1V9PA 1IBLL 3AFQA 4JI2Q 4JI7Q 5FLMG 1Y14B 1X65A 1G51A 4Y52H 1AH9A 3G48A 2C35B 2HIXA 3I7FA 4TVAB 3PSIA 4P73A 5C0XG 3CC7A 3ER0A 1J6QA 5IP7G 1HNWL 1PH6A 1HR0Q 1KIXA 2AKWB 1J5EL 1NY4A 1UE5A 2D0OA 1FL0A 1KXLA 4APVA 4GNXA 2BH2A 4LF6L 4K0KQ 4BY1G 2IHEA 4OWXB 4HJAA 4BY7H 2PI2A 4DR4Q 2MQHA 3A5ZB 4EX5A 4A3GG 4DR2Q 5IE8A 4A3FG 2HIVA 2UXCQ 4DV7L 3CCMA 3HOYG 2RHSB 2Q2TA 3K7AH 2HT1A 4JI3Q 3VDYA 3S1QH 4DV3Q 1E7ZA 1S3OA 1YHAA 3I4NH 2AHOB 3A0JA 3S1RH 3DLLA 2NZHA 2CCZA 2NVXH 2KCMA 1OXXK 4A75A 2GVAA 3RNUA 3KOJA 1XPRA 2JA5H 4C2MH 3CCUA 2VUMH 4UP9A 3PO2H 4JI5L 4OX9L 3I4OA 3CCSA 1Y1VG 4LFBL 3KDFB 4A3MG 5M3MH 1I5FA 1YJWA 3PIPA 1C9OA 4DV3L 3T1HQ 4OWTB 1YZ6A 2UU9Q 3PF4A 3TREA 4GNXC 1A63A 3JAMi 2VQFQ 5H1SE 4UY8C 4A3LH 3BJUA 2JA6G 4H02A 3G71A 3D31A 3RLFA 4HIOA 2UXBL 1CSPA 1QVCA 4R4CA 4UP8A 2NN6I 5GROA 1EYGA 2NN6G 1TWAH 4B3TL 5IWAL 4A76A 2WFWA 4NXML 1OXUA 3OTOL 1VQ7A 2Z0SA 2ZTEA 3J80c 4A3DH 3CC2A 2L15A 5DLQE 3HOXH 4GLVB 4JI6L 3GTGH 1BBWA 3MXNB 1SN8A 1VQJA 1VQCA 4P74A 4BBSH 1GKHA 3ERSX 3A5UA 4A3BG 4LF7L 2EQSA 1LYLA 3RR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3K H;  4JBK A;  4QGU A;  1QUQ A;  2N3S A;  3CCV A;  3HKZ G;  3MEF A;  4R1J A;  1PH1 A;  4B3M L;  2JEB I;  1N33 L;  4RG1 A;  5M3F H;  1VQH A;  2KBN A;  3FKI G;  4L5R C;  1PH9 A;  1PV4 A;  3I55 A;  4DV4 L;  5C4X G;  1VQE A;  4GS3 A;  2ID0 A;  1XNQ Q;  3CCQ A;  3NEM A;  3CP0 A;  4A3J H;  2KEN A;  2ALY B;  1TXY A;  2E2H H;  2JEA I;  2PQA A;  3HFZ B;  4DV2 L;  3T1Y L;  4LF8 L;  1LM0 A;  1XPO A;  1B7Y B;  1R9T H;  3FP9 A;  1HNZ L;  1HR0 W;  2BA0 A;  1DGS A;  4IFD G;  1MIU A;  4A4I A;  2PQA B;  4DPG A;  3G6E A;  2ZM6 L;  2CFM A;  1Q12 A;  2JA7 H;  2Q2I A;  5BR8 L;  1XNR L;  1Z47 A;  2KHJ A;  2ATW A;  4DV2 Q;  2E8G A;  3PF5 A;  4YWM A;  3JC6 6;  4X65 L;  4LF8 Q;  3I2Z A;  1I94 Q;  1X55 A;  2UUA L;  2UUB L;  1XNQ L;  1NTG A;  3K81 C;  1NMG A;  3L2P A;  1Q81 C;  1MJC A;  4LF4 Q;  1QVF A;  3HOZ H;  4JYA L;  3TRZ A;  2BH8 A;  2XTI A;  2R7Z G;  2B3G A;  5IYC G;  4A3C H;  1NMF A;  1VQN A;  1W3S A;  1CKO A;  4GOP C;  3LGJ A;  3K8A A;  4DK3 C;  1UE1 A;  3OW2 A;  3S1M H;  2LXK A;  1YIJ A;  4R4T A;  1PH7 A;  1IBK L;  4B3M Q;  4LFC L;  3M3Y H;  5JEA G;  3KYH C;  3GTM H;  2CWP A;  3J81 j;  3PO3 G;  2DUD A;  4DAM A;  1M1K C;  2A19 A;  2Q2H A;  4QJF A;  1HH2 P;  4X66 Q;  5AJ3 Q;  4DR7 L;  3CME A;  4A3E H;  2R92 G;  4KHP Q;  3HKS A;  1UWV A;  4LFA Q;  3CPF A;  4QY7 A;  4GLX A;  4AQY Q;  2VQE L;  2IX1 A;  4OO1 I;  3E0E A;  1EQQ A;  2F4V Q;  2R93 G;  3M4P A;  3KF6 B;  5C44 G;  3UDI A;  1PH2 A;  1QZG A;  3AFP A;  3U4Z A;  3DM3 A;  4L5T A;  2OCE A;  2WB1 E;  2LXJ A;  5AJ3 L;  2MNA A;  4DR7 Q;  3HOY H;  3J7A 5;  5JEA J;  1L2F A;  1IYJ B;  1PYB A;  1V43 A;  4R4Q A;  1RIP A;  1MKH A;  3AQQ A;  5FLM H;  4DR5 Q;  1KQS A;  3HOV G;  1YEZ A;  2UXB Q;  3KJP A;  4C3I H;  2YTV A;  1CKN B;  4DUZ L;  1JJG A;  3HOV H;  1EWI A;  4LNQ A;  2UU9 L;  3CMA A;  1Q82 C;  1JJC B;  3GTQ H;  5LMU Q;  4GKJ Q;  1K0R A;  2LSS A;  2CWA A;  1L0W A;  2E2J H;  2YU9 H;  2UXD Q;  1SMX A;  5GAH C;  4JI5 Q;  4OON A;  4AH6 A;  4DV0 L;  2GN5 A;  1KRT A;  4PZ8 A;  1MJE A;  4A3I G;  5C4J H;  1CSQ A;  1YIT A;  4L5S A;  1S40 A;  1OXS C;  3PGZ A;  5LMN Q;  2RF4 A;  5M5Y H;  1JB7 A;  3UE0 A;  1VQ9 A;  2ZM6 Q;  1D8L A;  5IYD H;  2FXQ A;  1K83 H;  1ASY A;  5E7N A;  4AYB E;  3CD6 A;  2PNH A;  3ULP A;  1HZC A;  1VCI A;  3GO5 A;  2QGQ A;  4LUO A;  3UDF A;  1N34 Q;  1E1T A;  1HZB A;  3GTO H;  2JQO A;  1AE2 A;  2ZTD A;  4LF9 Q;  5LMN L;  4GN4 B;  4P71 A;  4A3D G;  1PFS A;  4DV4 Q;  3FKI H;  4DKA C;  4AYB G;  1X54 A;  1VQG A;  4WJ4 A;  1YVC A;  1LUZ A;  1WCM H;  2WAQ E;  1EIY B;  4JI8 L;  2R93 H;  1CUK A;  1VQI A;  2UXD L;  1VQK A;  4A3K G;  2R7D A;  4ME3 A;  5M5X H;  3E9H A;  2JA8 G;  3F2B A;  3H3V H;  4DUZ Q;  1P8L A;  1QUQ B;  4LF7 Q;  4WJ3 M;  4DR6 Q;  2B29 A;  4JI0 Q;  1D7Q A;  3CCE A;  2EIF A;  3G4S A;  4JI8 Q;  2I0Q A;  2VL6 A;  1W2B A;  4KHZ A;  4YCU A;  1OXT A;  3IRB A;  1UE7 A;  2GVB A;  1WCM G;  4DV1 Q;  5FJ8 G;  2F4V L;  4P75 A;  4UPA A;  4B3T Q;  4AQY L;  3UDX A;  4LF9 L;  2JA6 H;  4IFD J;  1SR3 A;  4JCV E;  4JOI C;  5IT9 c;  4DAY B;  4X66 L;  1P16 A;  4KHP L;  3M4Q A;  2F3I A;  2MFI A;  2OTL A;  2VQF L;  5GAE C;  3TS0 A;  3SGI A;  4DUY Q;  4HIM A;  1PH5 A;  4JI4 Q;  4GKK Q;  3FHW A;  1IXR A;  2JA9 A;  1IBM L;  4B3R L;  4POG A;  3A74 A;  3CQZ H;  4GOP A;  3NBH B;  1VQL A;  2IHF A;  2E2I H;  2ZJR A;  1L1O C;  4BBR G;  4IJL A;  4DV0 Q;  2B63 G;  2H5X A;  3UE1 A;  5C3E H;  1QZH A;  5LMU L;  1YHQ A;  2UUA Q;  1H95 A;  2VW9 A;  3HOU G;  2Q2U A;  1VQ6 A;  5BR8 Q;  4B3R Q;  2KCT A;  2PI2 E;  5M5W H;  1HJP A;  4OWW B;  1WOC A;  4DV7 Q;  5EAY A;  3STB C;  4DUY L;  1Y1W G;  2ZJQ A;  4YY3 Q;  4DR2 L;  3H15 A;  1WFQ A;  3PUX A;  4FDB A;  3W1B A;  3OYY A;  1E3P A;  3GD7 A;  2N78 A;  4BA1 I;  2NVQ H;  2B63 H;  3H0G G;  4YWK A;  3STB D;  3U50 C;  1C0A A;  3PV0 A;  1BVS A;  2VZA A;  3CPW A;  1L1O B;  3L0O A;  5C0X J;  4LFA L;  5FJ8 H;  4BXX G;  5GAG C;  4MNO A;  4A93 G;  3J80 i;  4R4I A;  4JI1 L;  4P72 A;  4GNX B;  2JE6 I;  1LTL A;  2K52 A;  3RZD H;  3RZO H;  3TS2 A;  3PUY A;  2I5M X;  1IBL Q;  4KI0 A;  1KD1 C;  1JE5 A;  2OQ0 A;  3J81 c;  2AWO A;  3GTL H;  4DV5 L;  2RHQ B;  4HJ5 A;  1X3E A;  4POF A;  2MO0 A;  4JV5 Q;  1E1O A;  4A3C G;  1NBW A;  3JAM c;  3F8T A;  1I3Q H;  4X6A H;  1WI5 A;  4JYA Q;  1EOV A;  5C44 H;  4LF4 L;  1N36 Q;  2K5V A;  2UUB Q;  4NXM Q;  4KLK A;  1Q86 C;  4Y7N H;  3BZC A;  1PA6 A;  1VS0 A;  2IT1 A;  3B6Y A;  3CW2 C;  5GAD C;  2K4K A;  2VNU D;  2YYZ A;  2JA7 G;  4DR1 Q;  4JI0 L;  3ICE A;  1K73 C;  1VQF A;  1QVG A;  1XJV A;  3U4V A;  1PVO A;  4PMW A;  4MZ9 A;  4LF5 L;  4X64 Q;  1GVP A;  4JBM A;  4LFB Q;  3I4M H;  2NZO A;  3PUW A;  4BY1 H;  2KHI A;  4A93 H;  2OTJ A;  5JJI A;  1XTD A;  3TEH B;  2E5L L;  1X6O A;  4DV6 L;  3F1Z A;  2E5L Q;  1K3R A;  4DNI A;  1KRS A;  3RN2 A;  2K14 A;  4DK6 C;  1WYD A;  2Z6K C;  1CKN A;  4X64 L;  1JT8 A;  1FVI A;  4JC0 A;  4XTC S;  3PCO B;  4JBJ A;  2JA8 H;  4A3E G;  5IYB G;  4PG3 A;  1U5K A;  3S2D H;  1B8A A;  1PH4 A;  4IFD I;  1EQR A;  4QL5 A;  1FGU A;  4DR1 L;  4DR4 L;  2K5H A;  1EUJ A;  2BA1 A;  3KF6 A;  4LF6 Q;  4K0K L;  3GTJ H;  3AYH B;  3OTO Q;  2D62 A;  5IWA Q;  4NB3 A;  2VQE Q;  2R6G A;  1HR0 L;  4IPH A;  1Z9F A;  1HNW Q;  3PIO A;  3ULJ A;  4HID A;  3HOZ G;  4GKJ L;  1OXV A;  4NXN Q;  1C7Y A;  3CAM A;  1A8V A;  4TQU S;  4IJH A;  2IY5 B;  1X56 A;  5IYB H;  2JJQ A;  1VQD A;  1UEB A;  2A1A A;  2VS1 A;  4X62 Q;  1VQA A;  1KAW A;  3RLN A;  1VQP A;  1S72 A;  1N32 L;  1G29 1;  1YNX A;  1Q46 A;  1Q1B A;  4JBW A;  4XIG S;  4LUV A;  4DR5 L;  5M3M G;  1KC8 C;  1VQ5 A;  4L5Q A;  1TWH H;  1I6H H;  1A0I A;  5J3B A;  1BKB A;  4IOA A;  3CCJ A;  1TWF H;  3PO2 G;  3D0F A;  2D0P A;  3L7Z C;  2ZJP A;  1KL9 A;  2CQO A;  2WP8 J;  1U0L A;  1EIF A;  5JJK A;  1AE3 A;  2QEX A;  4B3S L;  2XGT A;  3Q8D A;  5C4X H;  1FJG L;  4IPG A;  2Y0S G;  3PO3 H;  3J81 i;  3EIV A;  4JI3 L;  1XNR Q;  1YJN A;  1IZ6 A;  1WJJ A;  5IP9 H;  4DR3 Q;  2YTX A;  4IPD A;  3M9B A;  1X3G A;  1EFW A;  3M7N A;  3S16 H;  4A3L G;  4YY3 L;  4IO9 A;  4RMF A;  4A3G H;  1OTC A;  1CKM A;  3UDG A;  2K50 A;  1Y1V H;  3M85 A;  2EXD A;  3GTK H;  4A3B H;  2RCN A;  4EQ5 A;  1K8A C;  2ZTC A;  2N49 A;  2YV5 A;  4UP7 A;  5GQO A;  5HGQ A;  1XMQ Q;  3RN5 A;  1J5E Q;  4DV6 Q;  4A3I H;  3HOX G;  1HZ9 A;  1PH8 A;  1I50 H;  1I94 L;  3K7U C;  2NVT H;  3EBE A;  4MTN A;  4GN3 B;  5IP7 H;  4X65 Q;  5C0X I;  4HJ7 A;  1VQ4 A;  1T9H A;  1XMO Q;  1L1O A;  1VQO A;  1N33 Q;  3U58 A;  1IBM Q;  1G6P A;  3S24 A;  5IP9 G;  3EN2 A;  4JI4 L;  2AMC B;  3PUZ A;  4GOP B;  4PZ6 A;  5LMN W;  1NJI C;  1N34 L;  2Z6K A;  4ALP A;  4DR3 L;  4LWC A;  2R7Z H;  1GO3 E;  2AWN A;  3CC4 A;  3T1Y Q;  2A8V A;  4OXP A;  3F2C A;  4BA2 I;  2WB1 G;  1HZA A;  3BU2 A;  4QQB X;  4PZ7 A;  1SE8 A;  1SRU A;  3KF8 B;  2DGY A;  1YJ9 A;  1SFO H;  1IL2 A;  4JOI A;  1N36 L;  1K8G A;  3S15 H;  2NVY H;  2IX0 A;  3CF5 A;  1A62 A;  3J7Z C;  5HY6 A;  2V1C C;  3H3V I;  5K36 G;  1TWG H;  1V1Q A;  3I56 A;  2R92 H;  4JV5 L;  1KHI A;  2VY3 A;  2WAQ G;  4C3J H;  3I4M G;  1ASZ A;  3W1G A;  3HOW G;  4DR6 L;  1E22 A;  5ELN A;  4X62 L;  1Y1W H;  1PH3 A;  1N32 Q;  4A3J G;  2R7F A;  3TQY A;  4IPC A;  1X9N A;  2HHH Q;  4AIM A;  4NXN L;  2CKZ B;  4C3H H;  3CCR A;  4JI6 Q;  4OX9 Q;  4JI1 Q;  5IYC H;  1N9W A;  4GLA C;  1UE6 A;  4YWL A;  2MO1 A;  3RLO A;  1HNX Q;  1K9M C;  1B70 B;  2OQK A;  2VUM G;  2JA5 G;  2N8N A;  3K80 C;  1SRO A;  3KFU A;  3F2D A;  4GN5 A;  2K75 A;  4LUZ A;  3KLW A;  4JG2 A;  2JK8 A;  2UUC Q;  2ASB A;  4LW1 A;  2UXC L;  2UUC L;  3ZJY C;  1E24 A;  3T1H L;  5ELO A;  3ULL A;  1IBK Q;  3GDE A;  2QA4 A;  4A3F H;  1XMO L;  3S1N H;  1VQB A;  2PMZ E;  3K0X A;  4QIW E;  2YTY A;  3S2H H;  1PHJ A;  1SLJ A;  1TWC H;  1HNX L;  3S14 H;  5IY0 A;  1XMQ L;  3AEV A;  5C3E G;  1GD7 A;  2I5H A;  3NEL A;  1X3F A;  3KJO A;  1GM5 A;  4HJ9 A;  3GTP H;  1BBU A;  1Q8K A;  3H0G H;  1VQM A;  4LF5 Q;  1YBY A;  4IOC A;  2HHH L;  5FLX c;  3S17 H;  3HKZ E;  4A3M H;  4GKK L;  4HIK A;  4JI2 L;  4LFC Q;  1N8R C;  1VQ8 A;  3HOW H;  5IYD G;  1HNZ Q;  1Q7Y C;  2F52 A;  2HQL A;  3E9I A;  4YHH L;  2OWO A;  4JI7 L;  4O2D A;  1M90 C;  4BXX H;  3CXC A;  4BBS G;  1Q1E A;  1PYS B;  4OO1 G;  2K5N A;  1FJG Q;  3PUV A;  3HOU H;  1YHB A;  4R4O A;  3WWV A;  4B3S Q;  2I5L X;  1JMC A;  3BZK A;  5JJL A;  1XPU A;  4DV1 L;  3NEN A;  1RL2 A;  3I4N G;  4YCW A;  1NE3 A;  2ES2 A;  1O7I A;  3KDF A;  4O0A A;  4J15 A;  3W5O A;  4HJ8 A;  4BBR H;  1JJ2 A;  3M4O H;  5M3F G;  1YI2 A;  4YHH Q;  4NPS A;  4DV5 Q;  4YCV A;  3CCL A;  2Y0S E;  4BY7 G;  1V9P A;  1IBL L;  3AFQ A;  4JI2 Q;  4JI7 Q;  5FLM G;  1Y14 B;  1X65 A;  1G51 A;  4Y52 H;  1AH9 A;  3G48 A;  2C35 B;  2HIX A;  3I7F A;  4TVA B;  3PSI A;  4P73 A;  5C0X G;  3CC7 A;  3ER0 A;  1J6Q A;  5IP7 G;  1HNW L;  1PH6 A;  1HR0 Q;  1KIX A;  2AKW B;  1J5E L;  1NY4 A;  1UE5 A;  2D0O A;  1FL0 A;  1KXL A;  4APV A;  4GNX A;  2BH2 A;  4LF6 L;  4K0K Q;  4BY1 G;  2IHE A;  4OWX B;  4HJA A;  4BY7 H;  2PI2 A;  4DR4 Q;  2MQH A;  3A5Z B;  4EX5 A;  4A3G G;  4DR2 Q;  5IE8 A;  4A3F G;  2HIV A;  2UXC Q;  4DV7 L;  3CCM A;  3HOY G;  2RHS B;  2Q2T A;  3K7A H;  2HT1 A;  4JI3 Q;  3VDY A;  3S1Q H;  4DV3 Q;  1E7Z A;  1S3O A;  1YHA A;  3I4N H;  2AHO B;  3A0J A;  3S1R H;  3DLL A;  2NZH A;  2CCZ A;  2NVX H;  2KCM A;  1OXX K;  4A75 A;  2GVA A;  3RNU A;  3KOJ A;  1XPR A;  2JA5 H;  4C2M H;  3CCU A;  2VUM H;  4UP9 A;  3PO2 H;  4JI5 L;  4OX9 L;  3I4O A;  3CCS A;  1Y1V G;  4LFB L;  3KDF B;  4A3M G;  5M3M H;  1I5F A;  1YJW A;  3PIP A;  1C9O A;  4DV3 L;  3T1H Q;  4OWT B;  1YZ6 A;  2UU9 Q;  3PF4 A;  3TRE A;  4GNX C;  1A63 A;  3JAM i;  2VQF Q;  5H1S E;  4UY8 C;  4A3L H;  3BJU A;  2JA6 G;  4H02 A;  3G71 A;  3D31 A;  3RLF A;  4HIO A;  2UXB L;  1CSP A;  1QVC A;  4R4C A;  4UP8 A;  2NN6 I;  5GRO A;  1EYG A;  2NN6 G;  1TWA H;  4B3T L;  5IWA L;  4A76 A;  2WFW A;  4NXM L;  1OXU A;  3OTO L;  1VQ7 A;  2Z0S A;  2ZTE A;  3J80 c;  4A3D H;  3CC2 A;  2L15 A;  5DLQ E;  3HOX H;  4GLV B;  4JI6 L;  3GTG H;  1BBW A;  3MXN B;  1SN8 A;  1VQJ A;  1VQC A;  4P74 A;  4BBS H;  1GKH A;  3ERS X;  3A5U A;  4A3B G;  4LF7 L;  2EQS A;  1LYL A;  3RR5 A; 
#chains in the Genus database with same CATH topology
 3CHB D;  3MEF A;  4R1J A;  5NUC A;  1PH9 A;  1DCZ A;  3MTS A;  1RTO A;  1CHP D;  4OIJ A;  4RA8 A;  1AP0 A;  4DAY A;  3CCQ A;  3K6O A;  3VA7 A;  5IT9 E;  3S1N B;  4U68 A;  4C1N I;  5FO8 B;  2PQA A;  3T1Y L;  1R9T H;  1HR0 W;  2BA0 A;  3K58 A;  2B2U A;  2ATW A;  3MVV A;  4NP5 A;  4RAU C;  2UUA L;  1VMP A;  2UUB L;  2FFK B;  4NKL A;  5F2D A;  3FVQ A;  2K04 A;  3HZX A;  3L2P A;  1Q81 C;  1QVF A;  5CV8 A;  4JYA L;  1O78 A;  3TRZ A;  3KK7 A;  2B3G A;  1VQN A;  1CKO A;  4DK3 C;  3HEJ A;  1SNQ A;  1YIJ A;  4M1U B;  1G2T A;  5JEA G;  4F87 A;  1DXM A;  2CWP A;  2DUD A;  1QNK A;  2A19 A;  2Q2H A;  4X66 Q;  2R92 G;  1UWV A;  2IX1 A;  1CZW A;  1AZQ A;  4IUQ A;  4DAV A;  2R93 G;  5C44 G;  3BYT B;  2F0F A;  1PH2 A;  3BYY B;  4L5T A;  2OCE A;  1C4Q A;  3HOY H;  2BE5 C;  3J7A 5;  3MXU A;  1YHQ A;  2UXB Q;  3AQQ A;  1KQS A;  3W2D A;  3KJP A;  4C3I H;  1JJG A;  1EWI A;  3VR6 A;  1V8Q A;  3NWT A;  1Q82 C;  1JWM D;  4AYB B;  1K0R A;  2LSS A;  4OON A;  3ITP A;  1KRT A;  4QUC A;  1YIT A;  1SJH D;  5ELE A;  5CV5 A;  3I4M B;  1EU3 A;  2F0V A;  4IAL A;  3UE0 A;  3VR2 A;  3X3M A;  5M5Y H;  5IYD H;  4A93 B;  5I6Y A;  1ZYR D;  1HZC A;  4PV1 C;  5KGU A;  1E1T A;  3NBH A;  3I73 A;  2JP1 A;  3JAM E;  5LMN L;  1EQT A;  4AYB G;  1YVC A;  1EIY B;  1LT4 D;  1VQK A;  4BWG B;  4A3K G;  4ME3 A;  5M5X H;  1G91 A;  1EIG A;  3E9H A;  3D4W A;  3RD4 A;  3F2B A;  2ICE C;  2KVM A;  4ZYS A;  4WJ3 M;  4A3D B;  1TS2 A;  1JQY D;  3BVG A;  4TRD A;  3VA5 A;  4HTH A;  2I46 A;  2SNS A;  2BE5 D;  1PTO D;  4G57 A;  3KBX A;  2I0Q A;  1STA A;  2SNM A;  4KHZ A;  4YCU A;  1S5B D;  3MXG A;  4B3T Q;  3PO3 B;  4AQY L;  3GV3 A;  5E3F A;  3P1H A;  4JCV E;  4NW2 A;  5IT9 c;  2A68 C;  1P16 A;  1IYV A;  1GOZ A;  2VQF L;  1HTL D;  4JI4 Q;  1BUV T;  2ZT9 C;  3K5O A;  1ZEQ X;  1TKW B;  2JA9 A;  3PIO 3;  2E2H B;  2PZT A;  3CQZ H;  3NBH B;  4C56 C;  3P7J A;  2ZJR A;  1O80 A;  4K6D A;  1VF5 C;  5C3E H;  5LMU L;  1QZH A;  5CMD A;  3GTK B;  1H95 A;  4HCS A;  3KF8 A;  5M5W H;  4MTK A;  2ZJQ A;  4OWW B;  5EAY A;  3STB C;  4DUY L;  3DMU A;  3OHX C;  4FYD A;  2NVT B;  3OYY A;  2IW3 A;  1ILQ A;  2PW7 A;  4X3U A;  2IX3 A;  1SXT A;  3STB D;  3PV0 A;  1BVS A;  2VZA A;  4LFA L;  4J8Q A;  4A93 G;  4DA2 A;  3J80 i;  4JI1 L;  2PQE A;  2CH4 A;  2ZXO A;  2BDO A;  4K5W A;  1BR9 A;  3KLS X;  4CDD C;  3OWF A;  3PUY A;  1D5M C;  1IBL Q;  1JE5 A;  4OIK A;  2OQ0 A;  4RH6 A;  3J81 c;  2CH4 W;  4IUN A;  2K33 A;  2RHQ B;  3S15 B;  5J39 A;  3H3V C;  2LS0 1;  1NBW A;  4KK7 A;  3F8T A;  1I3Q H;  1DOM A;  2F0E A;  1LTI D;  1QJO A;  1LO5 D;  3BZC A;  2RA4 A;  2IT1 A;  3CW2 C;  3NSW A;  2VNU D;  2WKC A;  4DR1 Q;  3TZD A;  3ICE A;  2XWJ B;  1VQF A;  1QVG A;  1EYC A;  5C4J B;  2O5J C;  1PVO A;  4PMW A;  3TDQ A;  5A2Q L;  4C3J G;  1HA6 A;  1HTP A;  2KHI A;  3IFD A;  4LMQ D;  5A35 A;  2E5L Q;  4DNI A;  3RN2 A;  1JCK B;  1S5E D;  2K14 A;  1EIH A;  1Z6H A;  1CKN A;  2EJM A;  1L0Y B;  1WCM B;  4PMC A;  3A55 A;  4IZ8 A;  4PG3 A;  3S2D H;  4IFD I;  5I9P A;  2PW5 A;  2K5H A;  2BA1 A;  4LJZ C;  3GTJ H;  3QR8 A;  3S17 B;  2D62 A;  4A3M B;  3I70 A;  2QEJ C;  1Y8P B;  1EWC A;  2MJ8 A;  4IPH A;  4NXN Q;  1C7Y A;  3CAM A;  1BXT A;  2VXW A;  1X56 A;  5IYB H;  2JJQ A;  1UEB A;  1N32 L;  3RLN A;  1GUN A;  1G29 1;  2AQ2 B;  4DR5 L;  2K5D A;  1KC8 C;  1ML0 D;  4L5Q A;  1CFM A;  1TWH H;  4X3S A;  5I2Y A;  1W6J A;  4BBR B;  2F0G A;  3CCJ A;  3PO2 G;  2NYZ D;  1U0L A;  3V05 A;  1UEA B;  4B3S L;  2XGT A;  3Q8D A;  1EY5 A;  1YNJ C;  3HP3 A;  3J80 E;  1JIC A;  1XNR Q;  5K5P A;  1IZ6 A;  2F0D A;  5IP9 H;  4KN7 C;  4IPD A;  1X3G A;  4YY3 L;  2F0L A;  4RMF A;  4A3G H;  1OTC A;  3UDG A;  2Q8T A;  2EYF A;  3H91 A;  1K8A C;  1IW7 D;  1CQV A;  1ILP A;  5GQO A;  2FJ2 A;  3RN5 A;  1F2M A;  1J5E Q;  1Q8I A;  1KLU D;  4R8N A;  3HOX G;  1HZ9 A;  1PH8 A;  1PFN A;  3K7U C;  3K7A B;  5IP7 H;  4HJ7 A;  3S1Q B;  1PXU A;  1VQO A;  5JEA H;  3U58 A;  1N33 Q;  2I07 B;  3S24 A;  3NE5 B;  3PUZ A;  1N34 L;  4FF3 A;  4XQJ A;  4ALP A;  1EYD A;  4LWC A;  1GO3 E;  2AWN A;  3T1Y Q;  2A8V A;  3FMC A;  1STB A;  2K6A A;  3BU2 A;  4QQB X;  1J9O A;  3E3X A;  4PZ7 A;  1SRU A;  3KF8 B;  1WTV A;  1JOK A;  4JOI A;  3QWN A;  1K8G A;  2EE1 A;  2V1C C;  1GUO A;  1RDP D;  1TWG H;  1V1Q A;  4JV5 L;  1KHI A;  2VY3 A;  1ASZ A;  3W1G A;  5ELN A;  1Y1W H;  2F0U A;  3DEO A;  3HRZ C;  3TQY A;  4Y7N B;  1HXY D;  3TP6 A;  1KDC A;  3BDC A;  4C3H H;  3NUC A;  1N9W A;  4GLA C;  1Y8O B;  1QOH A;  4HMJ A;  2PMZ B;  2A5H A;  1NR2 A;  4XT3 B;  2HQE A;  2ZXP A;  4HCE A;  4LUZ A;  1A2U A;  1ENC A;  2UXC L;  1KTK A;  3MXP A;  4GZY C;  3T51 B;  1VQB A;  1F2Z A;  4QIW E;  4OL7 A;  3S2H H;  1PHJ A;  3GP7 A;  2EJF C;  5L37 A;  1R9T B;  1F9P A;  3AEV A;  1GD7 A;  1XTC D;  1X3F A;  2CVR A;  3KJO A;  1GM5 A;  4DGZ A;  3H0G H;  1Q8K A;  4IOC A;  1ZXT A;  5FLX c;  4GKK L;  2X69 A;  2A68 D;  2D5D A;  3E9I A;  4BXX H;  2NWG A;  3CXC A;  1G8Z D;  2K5N A;  1FJG Q;  3PUV A;  1STH A;  5IGB A;  3HOU H;  4B3S Q;  2M00 A;  1XPU A;  2R61 A;  4DV1 L;  4KY6 A;  4YCW A;  1NE3 A;  1BNZ A;  3N6R A;  3M4O H;  3QO2 A;  4YIJ A;  4YHH Q;  2RKS A;  4DV5 Q;  2EYL A;  5LL6 S;  4HED A;  5CR3 A;  3G48 A;  1TS3 A;  2C35 B;  3I7F A;  3ND9 A;  3Q0A A;  5I6W A;  1JWU D;  3ER0 A;  5IP7 G;  1KXL A;  5T1I A;  2BH2 A;  1EY6 A;  1PTO B;  3H6M A;  3FRP B;  2PI2 A;  4A3G G;  4A3F G;  4M8A A;  4DV7 L;  2HT1 A;  4KKU A;  3VDY A;  1QIL A;  1S3O A;  3I4N H;  5IGE A;  4F8M A;  2G9H D;  2RDG A;  3DM1 A;  2CCZ A;  2NVX H;  3DWA A;  4A75 A;  3A7A B;  3RNU A;  3NTK A;  4ID6 A;  2VUM H;  4ABN A;  3PO2 H;  1K8O A;  4DXG A;  1YNN C;  3MWY W;  2EY6 A;  3GTO B;  4LFB L;  4RFB A;  1DJR D;  1YJW A;  5BN5 A;  2Q8R E;  5EPK A;  4DF7 A;  1SFO B;  1JR0 D;  3D31 A;  2UXB L;  1SNO A;  3FEW X;  1CK1 A;  5GRO A;  5EBD A;  3J80 c;  1BQQ T;  2L15 A;  5DLQ E;  1IL8 A;  1SN8 A;  5FKA C;  4BBS H;  1GKH A;  3A5U A;  2VB2 X;  2PZW A;  3EJI A;  2EQS A;  3ND8 A;  4OHJ A;  5DM6 3;  2O5I C;  1QUQ A;  1SE4 A;  2N3S A;  4HSP A;  3HKZ G;  3CCV A;  2JEB I;  2O4X A;  3IKJ A;  5M3F H;  1ZYR C;  1DM0 B;  4DV4 L;  5C4X G;  2ID0 A;  1XNQ Q;  5C5L A;  4A3J H;  1HUN A;  2KEN A;  2E2H H;  3HFZ B;  1MI2 A;  4CDF C;  1MIU A;  2PQA B;  4F7X A;  2ZM6 L;  2CFM A;  1Q12 A;  2F3V A;  1S5F D;  1B9M A;  4L63 B;  4DK0 A;  4DV2 Q;  4ZKB B;  3PF5 A;  4X65 L;  3JC6 6;  4LF8 Q;  2X6L A;  3HOW B;  4QCL A;  4FNF A;  2BH8 A;  5KIX A;  2R7Z G;  5IYC G;  1PFM A;  1NMF A;  1A6X A;  1H9M A;  4GOP C;  3K8A A;  3S1M H;  2E2D C;  1IBK L;  1F9Q A;  2PO4 A;  2BOS A;  3PO3 G;  5AJ3 Q;  4QJF A;  3I8Z A;  4CKE A;  4LFA Q;  4GLX A;  4AQY Q;  2VQE L;  1SYB A;  4J1M A;  3KF6 B;  3ERQ A;  1C8C A;  1UAP A;  3U4Z A;  2CQA A;  2LXJ A;  5AJ3 L;  3OPO A;  2Z4I A;  3RMH A;  1PYB A;  1RIP A;  1MKH A;  5FLM H;  3KLR A;  3C1E A;  1STY A;  2K1B A;  1JWS D;  1EYA A;  4LK1 C;  1JJC B;  1GUW A;  2E2J H;  3SDZ A;  2JYO A;  2GN5 A;  2K28 A;  4A3I G;  4O1N A;  2KJX A;  1OXS C;  1PLF A;  2Z9H A;  4F88 A;  5LMN Q;  2RF4 A;  5M9O A;  1JB7 A;  3EQL C;  1SEB D;  1K83 H;  3TP5 A;  4AYB E;  1FYC A;  1VCI A;  3GO5 A;  4RKB A;  5KYL A;  3DHQ A;  2XRS D;  1TS4 A;  4GN4 B;  4A3D G;  2Q8I B;  2XVS A;  1DOK A;  1PFS A;  4DV4 Q;  3FKI H;  3NXW A;  1AN8 A;  2IL8 A;  3C1F A;  2WAQ E;  5COR A;  2R93 H;  1VQI A;  5KYI A;  2EOT A;  2B8G A;  1TWA B;  4DUZ Q;  2XN9 C;  5DNF A;  1FNW A;  1D7Q A;  2Z1C A;  3CCE A;  3FDT A;  2VL6 A;  3IRB A;  2GVB A;  1SNM A;  2RDH A;  3GV6 A;  4P75 A;  2RCF A;  2JA6 H;  4JOI C;  5E4W C;  1IW7 C;  4DAY B;  4KHP L;  2DJG C;  2F3I A;  2MFI A;  2OTL A;  5GAE C;  3QB3 A;  3TS0 A;  1PH5 A;  1WTR A;  3TSS A;  1IXR A;  1IBM L;  5ELF A;  3A74 A;  5COY A;  2QKI C;  3H09 A;  2CW0 C;  4IJL A;  2JA7 B;  3R3O A;  3VR5 A;  2VW9 A;  3HOU G;  4J6H A;  2Q2U A;  1VQ6 A;  2PI2 E;  2ICI A;  1WOC A;  4DV7 Q;  3TME A;  3HOZ B;  3H15 A;  1PFB A;  1UUP A;  1I50 B;  2OT2 A;  4ZKC B;  1GUG A;  5JVH 3;  1D5Z C;  1NAP A;  3H0G G;  1IHZ A;  2N88 A;  5C0X H;  2RBM A;  3CPW A;  3GTM B;  1L1O B;  5FJ8 H;  2HD3 A;  2R7Z B;  5GAG C;  4MNO A;  1JOQ A;  4R4I A;  3D8G A;  2PZU A;  4P72 A;  4IUR A;  2JE6 I;  1LTL A;  3TS2 A;  3URY A;  2KOL A;  1LT3 D;  3SK4 A;  5CBE E;  1KD1 C;  4XQQ A;  3GTL H;  4CDE C;  4WFN 3;  4DV5 L;  4HJ5 A;  2MO0 A;  1E1O A;  1W6K A;  5I2X A;  4X6A H;  1NSN S;  3VR3 A;  1RCV D;  4QMG A;  5C44 H;  1GUT A;  3KBG A;  1N36 Q;  1RD9 D;  4NXM Q;  3GTQ B;  2L4N A;  1K73 C;  4X64 Q;  2A69 C;  3UI2 A;  4JBM A;  2NZO A;  1NNX A;  1LTA D;  4BY1 H;  1IKM A;  2DNE A;  3TEH B;  2E5L L;  1Q90 A;  1O7Y A;  2HDL A;  4DV6 L;  1K3R A;  1KRS A;  4DK6 C;  1WYD A;  2Z6K C;  1EY4 A;  3PQI A;  1JT8 A;  1FVI A;  2F0M A;  2L9H A;  3PCO B;  4JBJ A;  2JA8 H;  4A3E G;  1U5K A;  1B8A A;  1PH4 A;  2P5Z X;  5EPL A;  3K5L A;  1EQR A;  5CV9 A;  3A8J E;  1YNN D;  1A3T A;  4L6T B;  1LTT D;  4K0K L;  2KCC A;  3OTO Q;  4TSS A;  4CKB A;  1HR0 L;  3PIO A;  3ULJ A;  4HID A;  3HOZ G;  1HCZ A;  4C3I G;  1ROD A;  4TQU S;  1Z7T A;  4RHS A;  3M7G A;  3HOU B;  1VQD A;  1S5D D;  2A1A A;  4R9W A;  5ELB A;  1S72 A;  1KAW A;  2DJF C;  4B9X A;  4LFC Q;  4LUV A;  5M3M G;  1VQ5 A;  3LNN A;  1I6H H;  1TWF H;  1GXD C;  3J80 L;  2EY5 A;  2D0P A;  1KL9 A;  1I4P A;  3N52 A;  4HAE A;  1EIF A;  1AE3 A;  5IGC A;  2XRQ D;  4JI3 L;  4RHR A;  3S16 H;  1BCP B;  2YTX A;  1SMY C;  1EFW A;  1II3 A;  1M4V A;  1CKM A;  2DN8 A;  1PTO H;  1PTO F;  2TSS A;  5HGQ A;  1TS5 A;  1XMQ Q;  1BO0 A;  4FF4 A;  4DV6 Q;  1KAA A;  1CA6 A;  1H9S A;  2OEO A;  4CBV A;  4MTN A;  5C0X I;  2SEB D;  1VQ4 A;  2NVQ B;  3I4N B;  3S1R B;  1KDA A;  1G6P A;  1H9S B;  2B63 B;  3GQB A;  2NVX B;  4JI4 L;  2AMC B;  3CRK C;  5LMN W;  1F77 A;  3J81 L;  4FO2 A;  2VUM B;  1D6E C;  1SND A;  3F2C A;  3RZD B;  2D9U A;  4BA2 I;  1STE A;  4TKO B;  4IQZ A;  2NVY H;  3CF5 A;  1LTR D;  1A62 A;  3I56 A;  5A2Q E;  4C3J H;  3EA6 A;  3J7A F;  4RCO A;  1SE2 A;  1X3Q A;  4DFA A;  1U4R A;  4EQN A;  1B3Q A;  2E76 C;  4NXN L;  1B1Z A;  1F9R A;  1LAC A;  2CKZ B;  2RSN A;  4AIM A;  1F2Y A;  4EGV A;  4RKL A;  4YWL A;  1UE6 A;  3RLO A;  1V1O A;  2JA5 G;  1UNS A;  4RGM A;  3SK5 A;  5M3F B;  3KLW A;  1NR4 A;  1ESF A;  1NUC A;  4LW1 A;  2EY2 A;  1E24 A;  3MAQ A;  5ELO A;  3ULL A;  1D2B A;  1I4Q A;  4PMB A;  3Q24 A;  3S1N H;  3DXJ C;  2PMZ E;  5KRU A;  1SLJ A;  1STN A;  2NTT A;  2D2C C;  5J22 A;  5C3E G;  3G7L A;  4HJ9 A;  3FPP A;  1VQM A;  5KEE A;  3K5M A;  3DEP A;  4IUP A;  1B2T A;  1SJE D;  4H13 C;  4HIK A;  1VQ8 A;  1EY0 A;  1Q7Y C;  3P20 A;  2F52 A;  2HQL A;  2OWO A;  2WIN B;  4C1N K;  4O42 A;  1PYS B;  4OO1 G;  1YHB A;  4R4O A;  2I5L X;  1JMC A;  3OMC A;  4Q5V A;  2ES2 A;  3NTH A;  3W5O A;  1JJ2 A;  4NPS A;  1HUM A;  2E74 C;  3O13 A;  1IBL L;  4JI7 Q;  5C4X B;  3H94 A;  5C0X G;  3CC7 A;  1HNW L;  3HOY B;  1PH6 A;  1JOR A;  2DNC A;  1KIX A;  1NY4 A;  4K0K Q;  2WAQ B;  4XQN A;  4A3B B;  3M4Y A;  2IHE A;  4OWX B;  4BY7 H;  1HA5 A;  4EX5 A;  2J7Z A;  4A3I B;  3G6J B;  1EY8 A;  1GUS A;  4V0B A;  4JI3 Q;  1AFP A;  3WDN A;  2NZH A;  1OXX K;  2GVA A;  3PMF A;  1LV9 A;  5ELD A;  1XPR A;  2JA5 H;  3CCU A;  4UP9 A;  3AU7 A;  4N9P A;  4A3M G;  3T1H Q;  4DV3 L;  3PF4 A;  1MD2 D;  3TRE A;  3JAM i;  2VQF Q;  2JA6 G;  1DYQ A;  3G71 A;  2R93 B;  1MSH A;  1QVC A;  3VYR A;  2A6H D;  3SK6 A;  4B3T L;  2NN6 G;  2SOB A;  4KD3 A;  1KNA A;  2WFW A;  2Z6B A;  1ET6 A;  4A76 A;  4NXM L;  3OW7 A;  2B2T A;  2K03 A;  4A3D H;  1S5C D;  1EOT A;  1SBB B;  2A6E C;  3C2P A;  3GTG H;  4GLV B;  3MXN B;  1VQJ A;  4P74 A;  3ERS X;  4I7A A;  5IGD A;  1SYG A;  4A3B G;  1FR3 A;  4JI7 L;  4FF2 A;  4QGU A;  5IT9 L;  5EPJ A;  1N33 L;  3MC0 B;  1VDZ A;  3LWU A;  1VQH A;  5BN3 A;  2KBN A;  3FKI G;  4L5R C;  1PV4 A;  2KED A;  4Q0F A;  2F0S A;  1VQE A;  4NDX A;  3CP0 A;  1HRJ A;  1WD1 A;  2JEA I;  4DV2 L;  4LF8 L;  2DY7 A;  1B7Y B;  3FP9 A;  3S14 B;  1DGS A;  3G6E A;  2JA7 H;  2DY8 A;  2Q2I A;  1XNR L;  1Z47 A;  3GTP B;  1ICW A;  2E8G A;  2L55 A;  3I2Z A;  1I94 Q;  1XNQ L;  1ENF A;  1NTG A;  2WKD A;  3K81 C;  3E0J A;  1MJC A;  2XTI A;  3D6C A;  5LL6 X;  4A3C H;  1B44 D;  1W3S A;  1UE1 A;  3OW2 A;  2LXK A;  1PH7 A;  3JAM L;  4B3M Q;  3M3Y H;  1EEI D;  3KYH C;  1TU2 B;  2WB1 B;  5T1G A;  3J81 j;  4DU9 A;  4FP5 D;  4KHP Q;  4XYQ A;  1HH2 P;  2Z8L A;  3CME A;  2TMP A;  4QY7 A;  4OO1 I;  1FD7 D;  4V19 0;  1HHV A;  3E0E A;  1EQQ A;  1H9R A;  2F4V Q;  3M4P A;  5KND A;  3DUZ A;  3UDI A;  3CRL C;  3GTL B;  1KLG D;  1ESR A;  1R4Q B;  1I3Q B;  5EKI A;  5JEA J;  1GHK A;  1IYJ B;  4R4Q A;  4DR5 Q;  5C44 B;  2B2W C;  1YEZ A;  4DN4 M;  2A6E D;  3RUZ A;  1JB3 A;  3J81 E;  4DUZ L;  1DZ1 A;  1PMR A;  2ZXR A;  4LNQ A;  2YU9 H;  2CWA A;  1YNJ D;  4JI5 Q;  3LWE A;  2XSC A;  4QIW B;  2F0Q A;  5C4J H;  1D1K A;  5JPN C;  2N55 A;  4L5S A;  1S40 A;  2Y0S B;  1AZP A;  2QW7 A;  3NPP A;  3TZU A;  5CBA E;  2FXQ A;  3CD6 A;  4I65 A;  1S4Z A;  4LUO A;  3UDF A;  1HZB A;  4KY5 A;  5D65 A;  2LMC B;  2V4D A;  4LF9 Q;  3HS0 C;  4P71 A;  5J1Z A;  1TII D;  4DKA C;  1X54 A;  2B2U C;  1LUZ A;  1WCM H;  1FNV A;  4KHV A;  2JA8 B;  4JI8 L;  1CUK A;  2UXD L;  2R7D A;  4CHT B;  1QUQ B;  4LF7 Q;  4JI0 Q;  3HOX B;  1LTB D;  3MZ5 A;  1GJX A;  3CU7 A;  3BZD B;  1A3U A;  3QOL A;  5FJ8 G;  4DV1 Q;  1SE3 A;  4ZLT F;  1LAB A;  4UPA A;  4KD4 A;  3UDX A;  1TWH B;  4IFD J;  1SR3 A;  3SK8 A;  1Y69 U;  3M4Q A;  4QF4 A;  4HIM A;  3BVM A;  4DUY Q;  5HGT A;  4GKK Q;  1CT1 D;  3FHW A;  4N9T A;  4RGN A;  3FPU B;  2J4X A;  2F3W A;  4GOP A;  4KJN A;  1VQL A;  3MFG A;  2VB3 X;  2IHF A;  2E2I H;  3TN2 A;  4BBR G;  4DV0 Q;  3OSO A;  1PTO C;  1I6V C;  1BDO A;  4JW0 A;  3T4A C;  5BR8 Q;  1I4R A;  1HJP A;  3SXH A;  1Y1W G;  2LKV A;  4DR2 L;  1WFQ A;  2PYK A;  2KEC A;  3R93 A;  2NVQ H;  5G3L F;  2B63 H;  1C0A A;  4JPB W;  3L0O A;  2FHT A;  4BS9 A;  1HQM C;  4BXX G;  4A3E B;  3BDL A;  3RZO H;  2K52 A;  2NZ1 D;  3RZD H;  3OIP A;  3KLS A;  1X3E A;  4POF A;  1R4P B;  4JV5 Q;  4FXD A;  3JAM c;  5C4Z A;  3A7L A;  1WI5 A;  1EOV A;  2KEE A;  4K8I A;  4LF4 L;  4KKS A;  1Y1W B;  1K0S A;  4KLK A;  1TY2 A;  4Y7N H;  3HOV B;  1PA6 A;  1VS0 A;  5ELC A;  2CW0 D;  2K4K A;  4PNY A;  1FGB D;  2A6H C;  3NK9 A;  4JI0 L;  1STG A;  2F0K A;  1QWY A;  2Z4H A;  1XJV A;  3U4V A;  2HUG A;  4LF5 L;  2PNR C;  4MZ9 A;  2B8F A;  4LFB Q;  5M5Y B;  1CZG A;  2OTJ A;  1XTD A;  4K6L A;  3DWQ A;  4C3H G;  3AMU A;  1SYE A;  3R2I A;  4U67 3;  4X64 L;  3T56 B;  4XTC S;  4IFD H;  5IYB G;  4R8I A;  2PPB C;  1D1I A;  5M5X B;  1E2Z A;  2EYO A;  1EUJ A;  3H0G B;  1KDB A;  4FVM A;  3AYH B;  3ZYY X;  2F03 A;  1B4O A;  3E5S A;  4NB3 A;  1T5E A;  4KV6 A;  1QB5 D;  5CV7 A;  1OXV A;  1AW7 A;  1I4G A;  1U4L A;  1EY9 A;  2VS1 A;  1VQA A;  1VQP A;  1YNX A;  3PO3 H;  1Q1B A;  4JBW A;  1CTM A;  3M4O B;  3ERO A;  5G3L D;  1BKB A;  4IOA A;  3D0F A;  3L7Z C;  2ZJP A;  2CQO A;  5JJK A;  1FJG L;  4IPG A;  1D5X C;  2Y0S G;  4CKC A;  3CQZ B;  1B50 A;  4KKT A;  1YJN A;  1WJJ A;  4DR3 Q;  4P2C B;  3M7N A;  4A3L G;  1U4M A;  2JSO A;  4XT1 B;  4IO9 A;  1I4H A;  3U9O A;  5C3E B;  1Y1V H;  1LTS D;  3I4L A;  2RCN A;  4A3B H;  2ZTC A;  5M5W B;  4UP7 A;  4RWS C;  1EL0 A;  2QDB A;  1A2T A;  4A3I H;  1PRT D;  3A8I E;  2NVT H;  1I94 L;  4OEM B;  4ZRZ A;  2EXZ A;  4K14 A;  1VF7 A;  1IBM Q;  1JE4 A;  5IP9 G;  1MGS A;  4PZ6 A;  1NJI C;  5FO7 B;  3NQT A;  4OXP A;  4N8X 1;  2WB1 G;  4KY7 A;  3NP8 A;  1SE8 A;  2L1B A;  1QG7 A;  2F1M A;  1YJ9 A;  1SFO H;  1IL2 A;  4ZAI A;  3OOC A;  4MN3 A;  4ZK9 B;  3J7Z C;  5HY6 A;  2B2V C;  3H3V I;  1RHP A;  1TR5 A;  2QIL A;  4WRD A;  3I4M G;  3HOW G;  4DR6 L;  4X62 L;  5CV4 A;  1PH3 A;  4G7H C;  3I3C A;  3QG1 A;  1XX8 A;  4G4K A;  1X32 A;  3CCR A;  4JI6 Q;  4JI1 Q;  1EWH A;  1XYI A;  3EFX D;  2F0H A;  5IYC H;  4K8J A;  2MO1 A;  5DM7 3;  1HNX Q;  5C3X A;  2VUM G;  3K80 C;  3TP7 A;  3F2D A;  4WJW A;  1HQR D;  2F0T A;  2UUC Q;  5CYU A;  2UUC L;  3ZJY C;  3T1H L;  2B2V A;  1IBK Q;  3GDE A;  3E6Z X;  3V96 A;  4A3F H;  4A3J B;  1LTG D;  3HKZ B;  2AQ1 B;  3K0X A;  2NN6 H;  1TWC H;  1HNX L;  5IY0 A;  5EKL A;  1X3P A;  4B9W A;  3NEL A;  3L3O C;  5JAV A;  2EZV A;  2JXM B;  4K5V A;  2B2Y A;  3S17 H;  1V1P B;  4A3M H;  4NMZ A;  2HCI A;  2F0P A;  4JI2 L;  3HOW H;  3HGB A;  1HNZ Q;  1AEX A;  2KA7 A;  4O2D A;  4K2L A;  1M90 C;  1RKN A;  4BBS G;  4KJO A;  1PDQ A;  3WWV A;  5JJL A;  1CHQ D;  1RL2 A;  2KQ3 A;  1O7L A;  4O0A A;  4J15 A;  4HJ8 A;  5M3F G;  3SVM A;  2IPK D;  1XWE A;  3CCL A;  2Y0S E;  2QF7 A;  1V9P A;  1IKL A;  4BY7 G;  1WTX A;  5FLM G;  1AH9 A;  1IYU A;  2HIX A;  4TVA B;  4DAP A;  3PSI A;  4P73 A;  4XYO A;  4N8F A;  5IGF A;  5DAU A;  2AKW B;  2EYM A;  1J5E L;  2D0O A;  1FL0 A;  4APV A;  2ENB A;  5IOC A;  1ZKO A;  3MFY A;  3I90 A;  1B9N A;  2KUM A;  1WVL A;  5I4D A;  2E2J B;  3A5Z B;  2FIN B;  4WOR A;  2EYP A;  2FMC A;  3HOY G;  2Q2T A;  3K7A H;  3S1Q H;  1E7Z A;  1YHA A;  4XDX A;  3DLL A;  5C3W A;  4OO1 H;  1K83 B;  1LT5 D;  4ILW A;  1SNC A;  1PYW D;  4LAA A;  4JI5 L;  4OX9 L;  3I4O A;  3CCS A;  1Y1V G;  3I72 A;  5HUR A;  3PIP A;  4OWT B;  1CQF A;  3FKI B;  1A63 A;  2R3Z A;  4A3L H;  4UY8 C;  1RTN A;  4H02 A;  3NWS A;  1CSP A;  2BDN A;  1TWG B;  4X3T A;  2NN6 I;  5I9O A;  2R92 B;  1EYG A;  4G7Z C;  1TWA H;  1SYF A;  1OXU A;  1VQ7 A;  1B53 A;  2ZTE A;  3IL8 A;  2EJG C;  2Z0S A;  1SDF A;  3OIQ A;  3CC2 A;  1BBW A;  4C3H B;  5LHY 1;  3IAY A;  2IJ0 A;  5D14 A;  5BN4 A;  1LYL A;  3SEB A;  4A3K H;  4JBK A;  4FF1 A;  1A15 A;  4B3M L;  1PH1 A;  5FLX L;  2JA6 B;  4RG1 A;  3U9S A;  3VYT A;  3I55 A;  4XXE A;  1J8I A;  4GS3 A;  1EZ8 A;  3NEM A;  5ISR A;  4E6I A;  2ALY B;  1TXY A;  4UHV A;  3S2H B;  3NHH A;  1LM0 A;  4L8J A;  3X3N A;  1XPO A;  2E2I B;  3EVQ A;  1HNZ L;  4IFD G;  5TSS A;  4A4I A;  4DPG A;  2RSO A;  3SE0 A;  2JN4 A;  2F4I A;  5BR8 L;  1MHW C;  5CC4 A;  1Y8N B;  2KHJ A;  3W3A A;  2LY7 A;  4YWM A;  1TQO A;  1X55 A;  3DWP A;  1NMG A;  4IUT A;  4LF4 Q;  3HOZ H;  1XXG A;  3HG9 A;  4MHE A;  3LGJ A;  3MXN A;  4R4T A;  1HFN A;  2G5D A;  4LFC L;  1E0B A;  2F0N A;  3J7Y W;  2F0O A;  1B3A A;  3GTM H;  1A3V A;  1KNE A;  4DAM A;  1M1K C;  1O7Z A;  4DR7 L;  2QCP X;  1K28 A;  4A3E H;  2H1E A;  3HKS A;  3CPF A;  3RZO B;  4H7B A;  4ZQ3 A;  2WII B;  4ZUI A;  1RF2 D;  1QZG A;  3AFP A;  2RDF A;  3DM3 A;  2MPM A;  1T5X D;  2WB1 E;  2MNA A;  4IUU A;  4DR7 Q;  5AFW A;  4RGO S;  5CGK A;  1L2F A;  1SAP A;  1V43 A;  3HOV G;  1QCB D;  2YTV A;  1CKN B;  3HOV H;  2UU9 L;  2EVB A;  3CMA A;  3GTQ H;  5LMU Q;  4GKJ Q;  1L0W A;  2UXD Q;  2F0W A;  1SMX A;  1BCP F;  5GAH C;  4AH6 A;  4DV0 L;  4ZUJ A;  5C6A A;  4PZ8 A;  1MJE A;  1CSQ A;  5IGG A;  3PGZ A;  3P75 A;  2NBF A;  1VQ9 A;  2ZM6 Q;  4BY1 B;  1D8L A;  2CHB D;  1HPC A;  1PZK D;  2WV6 D;  1ASY A;  5E7N A;  2PNH A;  3ULP A;  5C5M A;  4IN3 A;  2QGQ A;  4C2M B;  3PO2 B;  4JVZ A;  2HCC A;  1N34 Q;  3OMG A;  3GTO H;  5JPM C;  2JQO A;  1ET9 A;  1AE2 A;  2ZTD A;  1H9K A;  5M3M B;  5IOD A;  1VQG A;  4WJ4 A;  2JA8 G;  1FNU A;  4JK1 C;  3H3V H;  1P8L A;  1NCV A;  3KUP A;  1EU4 A;  2A74 C;  5IIF A;  4DR6 Q;  2B29 A;  4MIU A;  4KTA A;  5CV6 A;  4BBS B;  2EYH A;  2EIF A;  3G4S A;  4JI8 Q;  1W2B A;  1OXT A;  2AQ3 B;  1UE7 A;  1WCM G;  2F4V L;  3A56 A;  1V1P A;  4LF9 L;  5FO9 B;  1PZJ D;  1LLR D;  1QNU A;  4X66 L;  5FOB B;  1CA5 A;  3SGI A;  1WD0 A;  3NBI A;  4EVO A;  3VR4 A;  4B3R L;  4POG A;  1OO9 B;  4DNR B;  5JVG 3;  3S16 B;  1L1O C;  2B63 G;  1DOL A;  2MGS A;  3L9A X;  2H5X A;  2NTS A;  1E2W A;  3UE1 A;  2UUA Q;  1Y1V B;  5DEH A;  4K2K A;  1PZI D;  2C5C A;  4B3R Q;  2KCT A;  1MSG A;  4YY3 Q;  5D3D A;  3PUX A;  1F9S A;  4FDB A;  3W1B A;  1E3P A;  3GD7 A;  2N78 A;  4BA1 I;  3S1M B;  1BCP D;  4CJ0 B;  1M8A A;  4YWK A;  3U50 C;  2RQX A;  1BF4 A;  2H4O A;  4HN7 A;  5C0X J;  2K32 A;  3MHB A;  1WTQ A;  4GNX B;  2EYJ A;  2MUY A;  2K7V A;  3WOF A;  2I5M X;  2K5Q A;  4KI0 A;  2AWO A;  2A73 B;  2RVL A;  2B2Y C;  1ENA A;  1JC7 A;  2NVY B;  4A3C G;  3D4D A;  3BDO A;  4JYA Q;  1EQV A;  1E2V A;  3A8K E;  4C3J B;  2K5V A;  4H44 C;  4C3I B;  2B2T C;  2UUB Q;  4ME5 A;  2K01 A;  1Q86 C;  2PCF B;  3OWE B;  1H9J A;  3B6Y A;  5GAD C;  3D3R A;  3R2T A;  2YYZ A;  3SR1 A;  2JA7 G;  2B2W A;  1EFI D;  3QIA A;  3K59 A;  4S3S A;  4G7O C;  1GVP A;  3I4M H;  3PUW A;  1LT6 D;  5EGT A;  4A93 H;  5JJI A;  1WTW A;  1X6O A;  4OGQ C;  3F1Z A;  4CJ1 B;  4X3K A;  4EQP A;  1EY7 A;  4A3F B;  1K8M A;  5KNB A;  2G9D A;  4JC0 A;  4QB4 A;  2J0T D;  5KNC A;  1TWC B;  4CDC C;  4QL5 A;  1FGU A;  4DR1 L;  3ONA B;  4UAI A;  4DR4 L;  5E1F A;  3K57 A;  2XIW A;  3KF6 A;  4LF6 Q;  1L0X B;  5EBC A;  1SNP A;  5IWA Q;  2VQE Q;  2R6G A;  1Z9F A;  4FXK C;  4GKJ L;  3QOJ A;  1HNW Q;  5D3I B;  1BCP C;  1F2L A;  1A8V A;  1SYC A;  4IJH A;  1U9R A;  3J7A V;  4KN4 C;  2LFN A;  2IY5 B;  2E75 C;  4X62 Q;  5K36 H;  1Q46 A;  4XIG S;  1TT2 A;  1A0I A;  5J3B A;  3IFT A;  5FK9 C;  3K5N A;  4EQO A;  2WP8 J;  3BG3 A;  3F2U A;  2M9V A;  1RJT A;  3AB9 A;  2QEX A;  2GA4 B;  5C4X H;  3J81 i;  3EIV A;  1EZ6 A;  4ODG A;  3M9B A;  1KAB A;  3C46 A;  5C4H A;  2F0J A;  2L11 A;  3WOE A;  2K50 A;  3M85 A;  2NB0 A;  2EXD A;  4HSV A;  2L0C A;  3TBI B;  3GTK H;  1U4P A;  4EQ5 A;  2N49 A;  2YV5 A;  4RCN A;  4BY7 B;  3Q23 A;  3VYS A;  3S9W A;  1I50 H;  2A69 D;  2FMM A;  3EBE A;  4GN3 B;  4X65 Q;  1QE6 A;  1T9H A;  4ZCK A;  1XMO Q;  1L1O A;  3EN2 A;  4GOP B;  2Z6K A;  4DR3 L;  5EKK A;  1CI3 M;  2R7Z H;  2JA5 B;  5EQ0 A;  3CC4 A;  1SMY D;  3LX0 A;  3Q6S A;  1HZA A;  2L12 A;  4CGY B;  3MEH A;  3PIP 3;  2DGY A;  1N36 L;  4B08 A;  3S15 H;  5FLX E;  4UDU C;  2IX0 A;  5K36 G;  3T13 A;  1K3B C;  2R92 H;  2WAQ G;  1TVX A;  2QDL A;  1E22 A;  1N32 Q;  3R8B A;  4A3J G;  2R7F A;  2OXP A;  4IPC A;  1X9N A;  2HHH Q;  1EEF D;  1SSO A;  3Q22 A;  3GTG B;  2EDG A;  2F0I A;  4OX9 Q;  2EPB A;  2XNA C;  3D6W A;  1K9M C;  1B70 B;  2OQK A;  4A3K B;  2N8N A;  1WTO A;  1SRO A;  5JOB A;  3KFU A;  1BBX C;  3SHL A;  4GN5 A;  2K75 A;  4FXG C;  4JG2 A;  1WTH A;  2JK8 A;  2ASB A;  1VMC A;  5JJZ A;  4DXF A;  4DNT B;  4PQX A;  2QA4 A;  3BVZ A;  1XMO L;  1MBY A;  2YTY A;  3T53 B;  3S14 H;  3S2D B;  1XMQ L;  3TP8 A;  2I5H A;  2O2L D;  2SDF A;  3GTP H;  1BBU A;  4LF5 Q;  1YBY A;  2HHH L;  3GTJ B;  3HKZ E;  2K5W A;  2OF1 A;  1N8R C;  2M2L A;  5IYD G;  3I91 A;  4HMI A;  2B39 A;  4YHH L;  4CJ2 C;  3CKI B;  1Q1E A;  3MA2 B;  2MHV A;  4KMU C;  3M3Y B;  3BZK A;  3NEN A;  3I4N G;  1JOO A;  3C3L A;  1O7I A;  3KDF A;  1I6H B;  1HFG A;  4BBR H;  3BS1 A;  4IUV A;  1YI2 A;  1TWF B;  1DON A;  3K0Y A;  4YCV A;  2NUC A;  2K05 A;  3AFQ A;  4RGT A;  4JI2 Q;  2WAC A;  1Y14 B;  1X65 A;  1G51 A;  4Y52 H;  1TY0 A;  1J6Q A;  4HR7 B;  1HR0 Q;  4K5X A;  1SYD A;  4H0L C;  1UE5 A;  4A3G B;  2BCO A;  4GNX A;  4LF6 L;  2KHS A;  4BY1 G;  4DR4 Q;  4HJA A;  2YU9 B;  2MQH A;  4DR2 Q;  2EY1 A;  2XWB B;  5IE8 A;  2HIV A;  2UXC Q;  1PRT C;  3CCM A;  2RHS B;  5E4X A;  4DV3 Q;  1G6Z A;  1WTP A;  2AHO B;  3A0J A;  3S1R H;  3T16 A;  2KCM A;  1I4X A;  1ONL A;  3KOJ A;  4C2M H;  2AUJ D;  1C48 A;  4Z9C B;  5EJW A;  1GHJ A;  2L5T A;  3KDF B;  5M3M H;  1I5F A;  2UU9 Q;  1C9O A;  1ICF B;  1YZ6 A;  4GNX C;  1BOS A;  5H1S E;  3NTI A;  3BJU A;  2X6G A;  3RLF A;  4HIO A;  3V2T A;  1PRT B;  2KCN A;  2HDM A;  1DD2 A;  2C9O A;  1G2S A;  4R4C A;  4UP8 A;  1Q3L A;  5IWA L;  4ULL A;  3QJY A;  3OTO L;  2AUK A;  1PRT F;  2MP1 A;  3HOX H;  4JI6 L;  3NQI A;  4OEL B;  1VQC A;  3VYU A;  3D4R A;  2IWH A;  4QUF A;  4LF7 L;  4DK1 A;  1CM9 A;  3A54 A;  3RR5 A;  4I7Z C; 
#chains in the Genus database with same CATH homology
 4A3K H;  4JBK A;  4QGU A;  1QUQ A;  2N3S A;  3CCV A;  3HKZ G;  3MEF A;  4R1J A;  1PH1 A;  4B3M L;  2JEB I;  1N33 L;  4RG1 A;  5M3F H;  1VQH A;  2KBN A;  3FKI G;  4L5R C;  1PH9 A;  1PV4 A;  3I55 A;  4DV4 L;  5C4X G;  1VQE A;  4GS3 A;  2ID0 A;  1XNQ Q;  3CCQ A;  3NEM A;  3CP0 A;  4A3J H;  2KEN A;  2ALY B;  1TXY A;  2E2H H;  2JEA I;  2PQA A;  3HFZ B;  4DV2 L;  3T1Y L;  4LF8 L;  1LM0 A;  1XPO A;  1B7Y B;  1R9T H;  3FP9 A;  1HNZ L;  1HR0 W;  2BA0 A;  1DGS A;  4IFD G;  1MIU A;  4A4I A;  2PQA B;  4DPG A;  3G6E A;  2ZM6 L;  2CFM A;  1Q12 A;  2JA7 H;  2Q2I A;  5BR8 L;  1XNR L;  1Z47 A;  2KHJ A;  2ATW A;  4DV2 Q;  2E8G A;  3PF5 A;  4YWM A;  3JC6 6;  4X65 L;  4LF8 Q;  3I2Z A;  1I94 Q;  1X55 A;  2UUA L;  2UUB L;  1XNQ L;  1NTG A;  3K81 C;  1NMG A;  3L2P A;  1Q81 C;  1MJC A;  4LF4 Q;  1QVF A;  3HOZ H;  4JYA L;  3TRZ A;  2BH8 A;  2XTI A;  2R7Z G;  2B3G A;  5IYC G;  4A3C H;  1NMF A;  1VQN A;  1W3S A;  1CKO A;  4GOP C;  3LGJ A;  3K8A A;  4DK3 C;  1UE1 A;  3OW2 A;  3S1M H;  2LXK A;  1YIJ A;  4R4T A;  1PH7 A;  1IBK L;  4B3M Q;  4LFC L;  3M3Y H;  5JEA G;  3KYH C;  3GTM H;  2CWP A;  3J81 j;  3PO3 G;  2DUD A;  4DAM A;  1M1K C;  2A19 A;  2Q2H A;  4QJF A;  1HH2 P;  4X66 Q;  5AJ3 Q;  4DR7 L;  3CME A;  4A3E H;  2R92 G;  4KHP Q;  3HKS A;  1UWV A;  4LFA Q;  3CPF A;  4QY7 A;  4GLX A;  4AQY Q;  2VQE L;  2IX1 A;  4OO1 I;  3E0E A;  1EQQ A;  2F4V Q;  2R93 G;  3M4P A;  3KF6 B;  5C44 G;  3UDI A;  1PH2 A;  1QZG A;  3AFP A;  3U4Z A;  3DM3 A;  4L5T A;  2OCE A;  2WB1 E;  2LXJ A;  5AJ3 L;  2MNA A;  4DR7 Q;  3HOY H;  3J7A 5;  5JEA J;  1L2F A;  1IYJ B;  1PYB A;  1V43 A;  4R4Q A;  1RIP A;  1MKH A;  3AQQ A;  5FLM H;  4DR5 Q;  1KQS A;  3HOV G;  1YEZ A;  2UXB Q;  3KJP A;  4C3I H;  2YTV A;  1CKN B;  4DUZ L;  1JJG A;  3HOV H;  1EWI A;  4LNQ A;  2UU9 L;  3CMA A;  1Q82 C;  1JJC B;  3GTQ H;  5LMU Q;  4GKJ Q;  1K0R A;  2LSS A;  2CWA A;  1L0W A;  2E2J H;  2YU9 H;  2UXD Q;  1SMX A;  5GAH C;  4JI5 Q;  4OON A;  4AH6 A;  4DV0 L;  2GN5 A;  1KRT A;  4PZ8 A;  1MJE A;  4A3I G;  5C4J H;  1CSQ A;  1YIT A;  4L5S A;  1S40 A;  1OXS C;  3PGZ A;  5LMN Q;  2RF4 A;  5M5Y H;  1JB7 A;  3UE0 A;  1VQ9 A;  2ZM6 Q;  1D8L A;  5IYD H;  2FXQ A;  1K83 H;  1ASY A;  5E7N A;  4AYB E;  3CD6 A;  2PNH A;  3ULP A;  1HZC A;  1VCI A;  3GO5 A;  2QGQ A;  4LUO A;  3UDF A;  1N34 Q;  1E1T A;  1HZB A;  3GTO H;  2JQO A;  1AE2 A;  2ZTD A;  4LF9 Q;  5LMN L;  4GN4 B;  4P71 A;  4A3D G;  1PFS A;  4DV4 Q;  3FKI H;  4DKA C;  4AYB G;  1X54 A;  1VQG A;  4WJ4 A;  1YVC A;  1LUZ A;  1WCM H;  2WAQ E;  1EIY B;  4JI8 L;  2R93 H;  1CUK A;  1VQI A;  2UXD L;  1VQK A;  4A3K G;  2R7D A;  4ME3 A;  5M5X H;  3E9H A;  2JA8 G;  3F2B A;  3H3V H;  4DUZ Q;  1P8L A;  1QUQ B;  4LF7 Q;  4WJ3 M;  4DR6 Q;  2B29 A;  4JI0 Q;  1D7Q A;  3CCE A;  2EIF A;  3G4S A;  4JI8 Q;  2I0Q A;  2VL6 A;  1W2B A;  4KHZ A;  4YCU A;  1OXT A;  3IRB A;  1UE7 A;  2GVB A;  1WCM G;  4DV1 Q;  5FJ8 G;  2F4V L;  4P75 A;  4UPA A;  4B3T Q;  4AQY L;  3UDX A;  4LF9 L;  2JA6 H;  4IFD J;  1SR3 A;  4JCV E;  4JOI C;  5IT9 c;  4DAY B;  4X66 L;  1P16 A;  4KHP L;  3M4Q A;  2F3I A;  2MFI A;  2OTL A;  2VQF L;  5GAE C;  3TS0 A;  3SGI A;  4DUY Q;  4HIM A;  1PH5 A;  4JI4 Q;  4GKK Q;  3FHW A;  1IXR A;  2JA9 A;  1IBM L;  4B3R L;  4POG A;  3A74 A;  3CQZ H;  4GOP A;  3NBH B;  1VQL A;  2IHF A;  2E2I H;  2ZJR A;  1L1O C;  4BBR G;  4IJL A;  4DV0 Q;  2B63 G;  2H5X A;  3UE1 A;  5C3E H;  1QZH A;  5LMU L;  1YHQ A;  2UUA Q;  1H95 A;  2VW9 A;  3HOU G;  2Q2U A;  1VQ6 A;  5BR8 Q;  4B3R Q;  2KCT A;  2PI2 E;  5M5W H;  1HJP A;  4OWW B;  1WOC A;  4DV7 Q;  5EAY A;  3STB C;  4DUY L;  1Y1W G;  2ZJQ A;  4YY3 Q;  4DR2 L;  3H15 A;  1WFQ A;  3PUX A;  4FDB A;  3W1B A;  3OYY A;  1E3P A;  3GD7 A;  2N78 A;  4BA1 I;  2NVQ H;  2B63 H;  3H0G G;  4YWK A;  3STB D;  3U50 C;  1C0A A;  3PV0 A;  1BVS A;  2VZA A;  3CPW A;  1L1O B;  3L0O A;  5C0X J;  4LFA L;  5FJ8 H;  4BXX G;  5GAG C;  4MNO A;  4A93 G;  3J80 i;  4R4I A;  4JI1 L;  4P72 A;  4GNX B;  2JE6 I;  1LTL A;  2K52 A;  3RZD H;  3RZO H;  3TS2 A;  3PUY A;  2I5M X;  1IBL Q;  4KI0 A;  1KD1 C;  1JE5 A;  2OQ0 A;  3J81 c;  2AWO A;  3GTL H;  4DV5 L;  2RHQ B;  4HJ5 A;  1X3E A;  4POF A;  2MO0 A;  4JV5 Q;  1E1O A;  4A3C G;  1NBW A;  3JAM c;  3F8T A;  1I3Q H;  4X6A H;  1WI5 A;  4JYA Q;  1EOV A;  5C44 H;  4LF4 L;  1N36 Q;  2K5V A;  2UUB Q;  4NXM Q;  4KLK A;  1Q86 C;  4Y7N H;  3BZC A;  1PA6 A;  1VS0 A;  2IT1 A;  3B6Y A;  3CW2 C;  5GAD C;  2K4K A;  2VNU D;  2YYZ A;  2JA7 G;  4DR1 Q;  4JI0 L;  3ICE A;  1K73 C;  1VQF A;  1QVG A;  1XJV A;  3U4V A;  1PVO A;  4PMW A;  4MZ9 A;  4LF5 L;  4X64 Q;  1GVP A;  4JBM A;  4LFB Q;  3I4M H;  2NZO A;  3PUW A;  4BY1 H;  2KHI A;  4A93 H;  2OTJ A;  5JJI A;  1XTD A;  3TEH B;  2E5L L;  1X6O A;  4DV6 L;  3F1Z A;  2E5L Q;  1K3R A;  4DNI A;  1KRS A;  3RN2 A;  2K14 A;  4DK6 C;  1WYD A;  2Z6K C;  1CKN A;  4X64 L;  1JT8 A;  1FVI A;  4JC0 A;  4XTC S;  3PCO B;  4JBJ A;  2JA8 H;  4A3E G;  5IYB G;  4PG3 A;  1U5K A;  3S2D H;  1B8A A;  1PH4 A;  4IFD I;  1EQR A;  4QL5 A;  1FGU A;  4DR1 L;  4DR4 L;  2K5H A;  1EUJ A;  2BA1 A;  3KF6 A;  4LF6 Q;  4K0K L;  3GTJ H;  3AYH B;  3OTO Q;  2D62 A;  5IWA Q;  4NB3 A;  2VQE Q;  2R6G A;  1HR0 L;  4IPH A;  1Z9F A;  1HNW Q;  3PIO A;  3ULJ A;  4HID A;  3HOZ G;  4GKJ L;  1OXV A;  4NXN Q;  1C7Y A;  3CAM A;  1A8V A;  4TQU S;  4IJH A;  2IY5 B;  1X56 A;  5IYB H;  2JJQ A;  1VQD A;  1UEB A;  2A1A A;  2VS1 A;  4X62 Q;  1VQA A;  1KAW A;  3RLN A;  1VQP A;  1S72 A;  1N32 L;  1G29 1;  1YNX A;  1Q46 A;  1Q1B A;  4JBW A;  4XIG S;  4LUV A;  4DR5 L;  5M3M G;  1KC8 C;  1VQ5 A;  4L5Q A;  1TWH H;  1I6H H;  1A0I A;  5J3B A;  1BKB A;  4IOA A;  3CCJ A;  1TWF H;  3PO2 G;  3D0F A;  2D0P A;  3L7Z C;  2ZJP A;  1KL9 A;  2CQO A;  2WP8 J;  1U0L A;  1EIF A;  5JJK A;  1AE3 A;  2QEX A;  4B3S L;  2XGT A;  3Q8D A;  5C4X H;  1FJG L;  4IPG A;  2Y0S G;  3PO3 H;  3J81 i;  3EIV A;  4JI3 L;  1XNR Q;  1YJN A;  1IZ6 A;  1WJJ A;  5IP9 H;  4DR3 Q;  2YTX A;  4IPD A;  3M9B A;  1X3G A;  1EFW A;  3M7N A;  3S16 H;  4A3L G;  4YY3 L;  4IO9 A;  4RMF A;  4A3G H;  1OTC A;  1CKM A;  3UDG A;  2K50 A;  1Y1V H;  3M85 A;  2EXD A;  3GTK H;  4A3B H;  2RCN A;  4EQ5 A;  1K8A C;  2ZTC A;  2N49 A;  2YV5 A;  4UP7 A;  5GQO A;  5HGQ A;  1XMQ Q;  3RN5 A;  1J5E Q;  4DV6 Q;  4A3I H;  3HOX G;  1HZ9 A;  1PH8 A;  1I50 H;  1I94 L;  3K7U C;  2NVT H;  3EBE A;  4MTN A;  4GN3 B;  5IP7 H;  4X65 Q;  5C0X I;  4HJ7 A;  1VQ4 A;  1T9H A;  1XMO Q;  1L1O A;  1VQO A;  1N33 Q;  3U58 A;  1IBM Q;  1G6P A;  3S24 A;  5IP9 G;  3EN2 A;  4JI4 L;  2AMC B;  3PUZ A;  4GOP B;  4PZ6 A;  5LMN W;  1NJI C;  1N34 L;  2Z6K A;  4ALP A;  4DR3 L;  4LWC A;  2R7Z H;  1GO3 E;  2AWN A;  3CC4 A;  3T1Y Q;  2A8V A;  4OXP A;  3F2C A;  4BA2 I;  2WB1 G;  1HZA A;  3BU2 A;  4QQB X;  4PZ7 A;  1SE8 A;  1SRU A;  3KF8 B;  2DGY A;  1YJ9 A;  1SFO H;  1IL2 A;  4JOI A;  1N36 L;  1K8G A;  3S15 H;  2NVY H;  2IX0 A;  3CF5 A;  1A62 A;  3J7Z C;  5HY6 A;  2V1C C;  3H3V I;  5K36 G;  1TWG H;  1V1Q A;  3I56 A;  2R92 H;  4JV5 L;  1KHI A;  2VY3 A;  2WAQ G;  4C3J H;  3I4M G;  1ASZ A;  3W1G A;  3HOW G;  4DR6 L;  1E22 A;  5ELN A;  4X62 L;  1Y1W H;  1PH3 A;  1N32 Q;  4A3J G;  2R7F A;  3TQY A;  4IPC A;  1X9N A;  2HHH Q;  4AIM A;  4NXN L;  2CKZ B;  4C3H H;  3CCR A;  4JI6 Q;  4OX9 Q;  4JI1 Q;  5IYC H;  1N9W A;  4GLA C;  1UE6 A;  4YWL A;  2MO1 A;  3RLO A;  1HNX Q;  1K9M C;  1B70 B;  2OQK A;  2VUM G;  2JA5 G;  2N8N A;  3K80 C;  1SRO A;  3KFU A;  3F2D A;  4GN5 A;  2K75 A;  4LUZ A;  3KLW A;  4JG2 A;  2JK8 A;  2UUC Q;  2ASB A;  4LW1 A;  2UXC L;  2UUC L;  3ZJY C;  1E24 A;  3T1H L;  5ELO A;  3ULL A;  1IBK Q;  3GDE A;  2QA4 A;  4A3F H;  1XMO L;  3S1N H;  1VQB A;  2PMZ E;  3K0X A;  4QIW E;  2YTY A;  3S2H H;  1PHJ A;  1SLJ A;  1TWC H;  1HNX L;  3S14 H;  5IY0 A;  1XMQ L;  3AEV A;  5C3E G;  1GD7 A;  2I5H A;  3NEL A;  1X3F A;  3KJO A;  1GM5 A;  4HJ9 A;  3GTP H;  1BBU A;  1Q8K A;  3H0G H;  1VQM A;  4LF5 Q;  1YBY A;  4IOC A;  2HHH L;  5FLX c;  3S17 H;  3HKZ E;  4A3M H;  4GKK L;  4HIK A;  4JI2 L;  4LFC Q;  1N8R C;  1VQ8 A;  3HOW H;  5IYD G;  1HNZ Q;  1Q7Y C;  2F52 A;  2HQL A;  3E9I A;  4YHH L;  2OWO A;  4JI7 L;  4O2D A;  1M90 C;  4BXX H;  3CXC A;  4BBS G;  1Q1E A;  1PYS B;  4OO1 G;  2K5N A;  1FJG Q;  3PUV A;  3HOU H;  1YHB A;  4R4O A;  3WWV A;  4B3S Q;  2I5L X;  1JMC A;  3BZK A;  5JJL A;  1XPU A;  4DV1 L;  3NEN A;  1RL2 A;  3I4N G;  4YCW A;  1NE3 A;  2ES2 A;  1O7I A;  3KDF A;  4O0A A;  4J15 A;  3W5O A;  4HJ8 A;  4BBR H;  1JJ2 A;  3M4O H;  5M3F G;  1YI2 A;  4YHH Q;  4NPS A;  4DV5 Q;  4YCV A;  3CCL A;  2Y0S E;  4BY7 G;  1V9P A;  1IBL L;  3AFQ A;  4JI2 Q;  4JI7 Q;  5FLM G;  1Y14 B;  1X65 A;  1G51 A;  4Y52 H;  1AH9 A;  3G48 A;  2C35 B;  2HIX A;  3I7F A;  4TVA B;  3PSI A;  4P73 A;  5C0X G;  3CC7 A;  3ER0 A;  1J6Q A;  5IP7 G;  1HNW L;  1PH6 A;  1HR0 Q;  1KIX A;  2AKW B;  1J5E L;  1NY4 A;  1UE5 A;  2D0O A;  1FL0 A;  1KXL A;  4APV A;  4GNX A;  2BH2 A;  4LF6 L;  4K0K Q;  4BY1 G;  2IHE A;  4OWX B;  4HJA A;  4BY7 H;  2PI2 A;  4DR4 Q;  2MQH A;  3A5Z B;  4EX5 A;  4A3G G;  4DR2 Q;  5IE8 A;  4A3F G;  2HIV A;  2UXC Q;  4DV7 L;  3CCM A;  3HOY G;  2RHS B;  2Q2T A;  3K7A H;  2HT1 A;  4JI3 Q;  3VDY A;  3S1Q H;  4DV3 Q;  1E7Z A;  1S3O A;  1YHA A;  3I4N H;  2AHO B;  3A0J A;  3S1R H;  3DLL A;  2NZH A;  2CCZ A;  2NVX H;  2KCM A;  1OXX K;  4A75 A;  2GVA A;  3RNU A;  3KOJ A;  1XPR A;  2JA5 H;  4C2M H;  3CCU A;  2VUM H;  4UP9 A;  3PO2 H;  4JI5 L;  4OX9 L;  3I4O A;  3CCS A;  1Y1V G;  4LFB L;  3KDF B;  4A3M G;  5M3M H;  1I5F A;  1YJW A;  3PIP A;  1C9O A;  4DV3 L;  3T1H Q;  4OWT B;  1YZ6 A;  2UU9 Q;  3PF4 A;  3TRE A;  4GNX C;  1A63 A;  3JAM i;  2VQF Q;  5H1S E;  4UY8 C;  4A3L H;  3BJU A;  2JA6 G;  4H02 A;  3G71 A;  3D31 A;  3RLF A;  4HIO A;  2UXB L;  1CSP A;  1QVC A;  4R4C A;  4UP8 A;  2NN6 I;  5GRO A;  1EYG A;  2NN6 G;  1TWA H;  4B3T L;  5IWA L;  4A76 A;  2WFW A;  4NXM L;  1OXU A;  3OTO L;  1VQ7 A;  2Z0S A;  2ZTE A;  3J80 c;  4A3D H;  3CC2 A;  2L15 A;  5DLQ E;  3HOX H;  4GLV B;  4JI6 L;  3GTG H;  1BBW A;  3MXN B;  1SN8 A;  1VQJ A;  1VQC A;  4P74 A;  4BBS H;  1GKH A;  3ERS X;  3A5U A;  4A3B G;  4LF7 L;  2EQS A;  1LYL A;  3RR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...