1GHJA

Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from azotobacter vineland ii, nmr, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
79
structure length
79
Chain Sequence
AIDIKAPTFPESIADGTVATWHKKPGEAVKRDELIVDIETDKVVMEVLAEADGVIAEIVKNEGDTVLSGELLGKLTEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from Azotobacter vinelandii.
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Acyltransferase
molecule keywords E2, THE DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE COMPONENT OF 2-
total genus 7
structure length 79
sequence length 79
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 1996-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ghjA00
2CW0C 3A8JE 5JEAG 2E76C 1K8OA 3P20A 1FR3A 3T53B 1OXUA 1GJXA 1PMRA 3BG3A 3N6RA 5JEAH 2NN6G 3PUYA 3SE0A 2PCFB 3OW7A 2IT1A 1ONLA 3M4YA 3IKJA 3CRLC 3A7LA 2BDOA 3KLRA 4IQZA 4DNTB 1OXXK 5KNDA 3D31A 1GHKA 5KNBA 1SMYC 2BA0A 1GUGA 2K33A 3DXJC 2BE5D 4JK1C 3QG1A 3U9SA 1HTPA 2JXMB 4KKUA 4KI0A 4KKTA 2NN6I 3T51B 4DNRB 1O78A 2R6GA 3I73A 4JBWA 3M85A 1VDZA 3GD7A 1IW7C 3NE5B 3QIAA 3VR6A 1ZYRC 3PUZA 1Y8NB 1Q1EA 2A6HD 1Y8OB 2K7VA 1Z6HA 1Y69U 1LACA 2BA1A 4IFDH 3ND8A 1B9MA 3OOCA 4TQUS 4BA1I 1QJOA 3W3AA 5BN5A 3D4RA 3VA7A 1HQMC 2EJMA 3WDNA 5KNCA 4PV1C 2E74C 4HR7B 1K8MA 1O7LA 2A68D 3I4LA 1V8QA 3SDZA 2QF7A 1DD2A 2A6EC 3PV0A 2B8GA 2D62A 2JEBI 4LJZC 3RLFA 4GZYC 2AUKA 2E75C 3A7AB 1GUSA 4KKSA 2D5DA 1T5EA 1B9NA 4RCNA 4LK1C 3VR5A 5K36H 1VCIA 1H9RA 2DNEA 4TKOB 2B8FA 3EQLC 4DK0A 4I7ZC 5K36G 2ZT9C 2KCCA 3I72A 2Q8IB 2EVBA 3TZUA 1BDOA 4OO1G 4H13C 2A69D 3QJYA 2DNCA 2O5JC 2BE5C 1EWHA 1H9JA 1VF5C 4XIGS 1V43A 3PUWA 1Q1BA 5A35A 4KN7C 1GUNA 1GUTA 2JE6I 1E2ZA 3LWUA 4L8JA 1I6VC 2AUJD 4OGQC 2NN6H 2DN8A 1HCZA 3FMCA 1IW7D 3GQBA 3ND9A 4G7HC 2EDGA 1ZKOA 2F1MA 3T56B 2O5IC 1H9SB 1HPCA 3HGBA 3VR4A 1Q90A 1TKWB 1OXVA 1IYVA 3L7ZC 1FYCA 1CTMA 2LMCB 1DCZA 3A8KE 2A6ED 2JEAI 4KMUC 1CFMA 1H9KA 1E2VA 1TU2B 3A8IE 3PUVA 1Z7TA 3PUXA 3CRKC 1H9SA 3MXUA 1Q12A 1YNJC 4KN4C 1Y8PB 2L5TA 4XTCS 4IFDG 1G291 2A6HC 5C0XH 1VF7A 2AWOA 3H94A 3IFTA 5BN4A 4BA2I 2KA7A 1IYUA 3FPPA 1YNNC 1A6XA 1CI3M 5BN3A 1GHJA 1OXTA 2PNRC 4DK1A 5C0XG 2PPBC 3OPOA 1GUOA 1E2WA 2A68C 2EJGC 4KHZA 4G7ZC 2K32A 2A69C 2D2CC 2EJFC 3AB9A 2YYZA 3VR3A 3VR2A 1DXMA 3LNNA 4H44C 4OO1H 1LABA 4H0LC 3M7NA 2V4DA 4G7OC 1OXSC 3BDOA 3MFYA 1H9MA
chains in the Genus database with same CATH superfamily
4IJHA 2A74C 1O80A 1FR3A 5JJIA 1PYSB 4GN4B 5D3DA 4NKLA 2PCFB 2F0EA 5ISRA 2QEJC 1VMPA 3F8TA 4J6HA 1GUWA 3A7LA 1DJRD 4K5XA 3J80L 4FXGC 4YCVA 5I2XA 2RF4A 4MTNA 2BE5D 1PRTD 5TSSA 4YY3Q 2K52A 1JORA 3S1RH 3GTLB 1MJEA 1PZJD 3SVMA 4OWXB 1E0BA 1HUMA 4BA1I 5ELEA 1E22A 4OWTB 2EJMA 3BU2A 4RGOS 3PIPA 3SDZA 4NMZA 2B29A 2YTXA 3HOWG 1LV9A 3NELA 3Q23A 3PV0A 2JEBI 3S15B 1NJIC 2WB1E 2VUMG 1Z47A 2E75C 3KF8B 4FF3A 1G51A 2XTIA 4A3FG 5G3LF 2E2HB 4JBKA 4ID6A 1LTLA 2AMCB 3HFZB 3L2PA 2JA5H 1CKOA 1PFBA 5C4XG 4JI0L 1A15A 5L37A 3RLNA 2PI2A 5IYCG 1NBWA 1VQ6A 4AYBB 1EZ8A 2R7ZG 5HURA 3JAME 4GNXC 4BY1B 4MTKA 1EY5A 3A56A 1X56A 4IUQA 4IUVA 1BCPC 4C3JB 2F1MA 1I4HA 1KLGD 2HHHL 2AWNA 3NBIA 4A3IG 1WCMG 2HCIA 1X55A 2CHBD 2HHHQ 1RIPA 5C4HA 2LMCB 2Y0SE 1PXUA 3TREA 5JOBA 2F03A 5M3MG 1SMXA 3NTIA 1HNXL 2RDHA 1Y8PB 4IFDG 2DJFC 2UUAQ 1SNQA 1YVCA 5BN4A 3RZOH 5IYDG 2NB0A 3Q0AA 1XTDA 3I4NH 4DV3L 2VY3A 1CQVA 3EFXD 4R9WA 4TRDA 2JA6B 1AW7A 3GTJB 2N78A 5M3FH 4KHPL 3CCLA 1EEFD 2K5NA 4GNXA 2V4DA 2B2TA 4JI8L 1K8OA 2NBFA 2VNUD 3W1GA 3J80i 1CA5A 1X3GA 3BG3A 3K81C 3URYA 2F0GA 2BDNA 4QUFA 5FJ8G 3S16B 1W6KA 5IT9E 3RMHA 4GOPA 4EQNA 1IBLQ 2QA4A 4XQQA 3S17H 1HJPA 1X3FA 1SYCA 2EQSA 1IW7C 3QR8A 1WCMH 4ZLTF 3VYUA 1WTXA 1XPOA 4GOPB 5BN5A 3NEMA 1FL0A 1KDBA 2KHIA 1HQRD 2R7DA 2K5WA 2CH4W 2Q2IA 3NQIA 4F7XA 3S2HH 4C1NK 4FP5D 5HGQA 4KKSA 2FJ2A 3H0GH 1D1IA 2VL6A 2RKSA 1H9RA 3TP5A 3OWFA 3F1ZA 4A93B 4IUPA 2MQHA 2CVRA 2N3SA 4QY7A 2Q8IB 2ZM6L 4BBRG 5BR8L 4RG1A 3S14B 3TQYA 1ET6A 2EYLA 2PO4A 1BXTA 2XWBB 1XNRL 3HOVB 2UXDQ 2B2VC 5C44G 3GTPB 5A35A 4KN7C 1WTVA 1LUZA 3UDIA 4N9TA 1E2ZA 5EBDA 4F8MA 3BYYB 1IW7D 4QB4A 1U5KA 1XMOQ 1N34Q 2UUCL 2KHSA 4TSSA 3RZDB 1G8ZD 1BNZA 1TS4A 1EQVA 3E9HA 1TKWB 4LF7Q 3QO2A 1UEAB 1II3A 4WRDA 1N34L 1SMYD 4RWSC 1ILPA 1YJ9A 1AP0A 2F4IA 2IX0A 4DK6C 1U4LA 1H9KA 3OW2A 1L0YB 2E5LQ 5I6YA 4LF5L 2WB1G 3NWSA 3PGZA 2L0CA 4H02A 1SNDA 1PZID 4CKCA 4WJ4A 4HSPA 4HIOA 5C6AA 1AE2A 1OXTA 3QB3A 5E7NA 3GTQH 1EQQA 1IKMA 4JI7L 4A3GB 4JI5L 1NMFA 3G7LA 3T4AC 2PZWA 3NPPA 5EGTA 3CC4A 3EBEA 4H0LC 1ENFA 3GTJH 1EOTA 3BDOA 1EUJA 4DAYA 5JEAG 3J81c 3CCVA 4HTHA 5EPLA 4RKLA 3VDYA 1STEA 1STYA 1STGA 5DEHA 4C3HB 4DR5Q 2K33A 4JK1C 1Y1WG 4XYOA 1QE6A 4IUTA 1HTPA 2AQ3B 1O78A 3K0YA 1F2LA 4R4TA 3KJPA 3GD7A 3K8AA 2PQAA 4LF7L 1Y8OB 1Z6HA 1ZXTA 2IHEA 2K05A 1YNND 2DJGC 4PNYA 1WCMB 2F0DA 2VW9A 5EPKA 3HOXB 3ERSX 1J9OA 1TXYA 2K75A 3S1NB 3JAML 1G6PA 5JPMC 2N8NA 1Y1VG 2AUKA 3AQQA 4LF6Q 1U4RA 2IWHA 1N33Q 4DR3Q 1KABA 4I7AA 3I4MH 1GXDC 3PO3H 1EL0A 4OONA 4A3FH 4DK0A 2L12A 4ZUIA 3DEPA 1O7ZA 3G6JB 4HJ7A 1CK1A 4K0KQ 5M5YH 1PTOD 4OL7A 2KQ3A 3K5OA 5A2QE 4Z9CB 1EFWA 4B3TQ 3J7AF 1GD7A 1TWFH 2EYFA 1MHWC 3WWVA 3H6MA 4FO2A 1D6EC 4C56C 1A3VA 5DNFA 3M4PA 3G6EA 2LSSA 3K58A 2RHQB 3HKZE 4A3KG 4PG3A 2EYOA 4NXNL 4QMGA 1FYCA 4KTAA 5EAYA 4HIKA 4KMUC 1SNCA 2ZXRA 2WP8J 5C4ZA 5IGCA 4XQNA 1IYUA 1CT1D 2R93H 3Q8DA 5HY6A 2ENBA 5BN3A 2N49A 5I2YA 1A2TA 1JOKA 2A68C 5M5XH 2IX1A 1DYQA 1BUVT 1VQDA 3A5ZB 3T13A 3F2UA 3A8JE 4GNXB 4A3EG 2OEOA 3IFDA 5IE8A 4RHSA 1DOKA 2B2TC 5M5WB 1SROA 4C3JG 3J81L 4LFBL 1W3SA 1VQ8A 3D4DA 3LWEA 1BBUA 1XNQL 1A3UA 5ELOA 2X6LA 4QQBX 1PH5A 3UDGA 2BA0A 1GUGA 1SYGA 1JOQA 5C44B 3U9SA 3E3XA 4FXKC 1EIFA 2O2LD 1HR0Q 1IXRA 1G6ZA 2B63B 1UAPA 2VUMB 1AN8A 2YTVA 4YHHL 4RAUC 2FXQA 4G57A 3WDNA 5KIXA 2F0SA 4LFBQ 5M3MH 4IFDJ 2KCTA 4LJZC 2KOLA 1G2SA 5CYUA 3HOYH 1QOHA 3CQZB 1BQQT 3G71A 1G91A 2OQKA 3I4NG 4A3MH 2D0OA 2RSNA 1YZ6A 1K73C 2OT2A 2D9UA 1U4MA 3NTHA 4JBJA 4OELB 1VQ4A 1EY9A 1XX8A 2JA6H 2LXKA 1D7QA 3S9WA 4CDCC 1XPRA 1H9JA 3EJIA 3FHWA 1WTRA 1HNXQ 2MUYA 2DN8A 1CA6A 1CKNB 2HDLA 5ELBA 2F0TA 1I6HB 4BBSB 3PF5A 2ZJRA 2V1CC 3BDLA 1I50B 2F0FA 3VA5A 5IGDA 3N52A 2G5DA 3SEBA 4DU9A 4A3BG 3BDCA 1TWGB 5CMDA 2GVAA 1WVLA 3NHHA 1EU3A 2L5TA 4P72A 4B3SL 1TY2A 2I07B 2AWOA 4X3KA 2K04A 3CCRA 1PH1A 4WORA 2HIXA 5H1SE 4UHVA 4JI0Q 1FGBD 1D5MC 3STBD 3F2DA 3DEOA 2YYZA 3S2HB 3K5LA 1L2FA 4H44C 2VQFL 3KOJA 5IP7H 1S5DD 3K7UC 2B2YC 3OTOQ 5E4XA 2M2LA 1QCBD 4QGUA 3JAMc 1EU4A 1SLJA 3TMEA 5LMUQ 2NN6G 2WIIB 2NZ1D 4JI3L 4K14A 4DV0Q 1YIJA 1Q3LA 2CH4A 3KLRA 1GHKA 1ZEQX 3S17B 1TWAH 5KYIA 1GM5A 5ELCA 1D5XC 3A74A 3AYHB 5IGBA 4BBSG 1F2MA 1EYGA 4YY3L 2A6HD 3KLWA 4IALA 1PDQA 3OOCA 3HOWH 1KAAA 1QJOA 1KQSA 4JCVE 1HQMC 2KHJA 4GS3A 1JWSD 5KNCA 3H3VC 2E74C 5FLXL 3I4LA 4B3ML 3B6YA 2A6EC 2DY7A 2BOSA 3IRBA 4GZYC 2RCNA 1GUSA 1HFNA 3MAQA 3J7YW 1A2UA 4Q5VA 3LX0A 4K6LA 1N32Q 1B4OA 2MP1A 3CPFA 2HQLA 2F0QA 3I4MG 2ZT9C 1WTPA 4JI1Q 5CV7A 3AU7A 5IYBH 1JMCA 3UDFA 1VQFA 1YI2A 4BBRB 2BE5C 1PRTC 1EWHA 4OX9L 1VF5C 4OIJA 1RTNA 3CAMA 2XRSD 3SK6A 2WKDA 2FMMA 2R7ZH 2NN6H 1HCZA 2WKCA 5COYA 2Y0SG 2P5ZX 1SJHD 2HQEA 4KY6A 1PTOB 2Z6BA 2E2IH 1XJVA 4DV7Q 4EX5A 5D3IB 1SBBB 3RLOA 1IYVA 1F77A 4EQPA 3BVZA 1WTWA 3A54A 1LT5D 4NXMQ 1ENAA 4A3KH 4DUYQ 2DY8A 3PSIA 1G291 2LFNA 1FNVA 4RFBA 3GTGB 4A3DH 4LNQA 4A3MB 4X3TA 1Q82C 3TP8A 4WJ3M 3HOXH 1GHJA 5C0XG 1AZPA 5CGKA 1STAA 5LHY1 4LFAL 1VQAA 1E2WA 3ULJA 1EZ6A 2JA8H 4J8QA 3RD4A 4OEMB 4DR2L 1X3EA 1J5EL 5C4XB 4DAVA 1GO3E 3Q24A 4LF6L 4PMBA 3T53B 1I4RA 1AH9A 4S3SA 4L5TA 4LFCQ 3GTMB 1L1OA 1ONLA 1PTOC 1TQOA 2JYOA 1A0IA 2I5HA 2Z6KA 3I3CA 1I50H 3MFGA 2BDOA 4IQZA 4DV1Q 3MHBA 4ALPA 5C0XJ 4C3HG 4A75A 2E2JH 1ICWA 1I4GA 2NWGA 1V1QA 1L1OB 4JBWA 4APVA 2Q2TA 3PUZA 1IBLL 2EYJA 1YHAA 3Q6SA 2WV6D 3ND8A 4K2KA 4TQUS 1D2BA 2SNSA 1PYBA 3WOEA 4UP9A 4RGNA 3CMAA 2B2WC 1FD7D 1UE5A 5CV5A 1VQOA 4LFCL 4B3TL 1E24A 1HHVA 3PO3B 3MXNB 1CHQD 5J22A 4MIUA 1EY4A 2R93B 2K50A 4MN3A 4DPGA 2A1AA 4R4IA 3CW2C 2EVBA 4UAIA 3SK4A 1PH9A 1K8GA 4IOCA 3U4ZA 4JI4L 3KFUA 1DZ1A 4BBRH 4E6IA 3LWUA 3NP8A 4L8JA 4DAPA 4LF8L 5M5WH 4NP5A 4HJAA 2ASBA 2F0UA 1OXVA 3T16A 2NVXB 3L7ZC 1SEBD 1LTRD 2L9HA 1B1ZA 4DXGA 1C8CA 5G3LD 5FLXc 1WD0A 1TU2B 2RDGA 3C46A 4XT3B 4KN4C 1YNJC 3DM1A 4A3KB 1KLUD 1NR4A 4DV1L 4UP7A 1VQPA 4LUVA 3OWEB 1VF7A 4X66Q 1QWYA 1N36Q 1TWHH 2JP1A 2PNRC 3FEWX 3FDTA 4L6TB 4JYAL 2JJQA 2EJGC 5LMNW 2NZHA 5M3MB 4G7ZC 3ULPA 1RF2D 4A3JG 3FKIH 5GQOA 3O13A 4RGTA 1M90C 1AE3A 2JA7B 5IODA 4K5WA 4JI5Q 5JEAH 2MFIA 4B3MQ 1E7ZA 4JI2Q 4V190 3FP9A 5AFWA 1NR2A 5ELNA 3M4YA 1TS3A 5JVH3 3KBXA 2JXMB 3ITPA 1JB3A 2B3GA 3H09A 1YNJD 1VDZA 3P75A 1KAWA 2CQOA 3CC7A 4BBSH 5IY0A 4IFDH 2UUCQ 1WFQA 1LT4D 1VQ5A 2KUMA 3K0XA 2NTTA 3BVMA 3F2BA 3U4VA 3BS1A 1LTID 3RUZA 1CHPD 2QF7A 4C2MB 2ZJPA 4LWCA 1MSHA 1IBMQ 4I65A 1QZGA 5M3FB 3PF4A 2GA4B 3GV3A 1RKNA 1XNRQ 4POFA 4LK1C 2CW0D 5CV9A 2RDFA 2J7ZA 2MNAA 5C3EG 5C4JH 3RN2A 5D65A 1MGSA 2DGYA 1MKHA 1HTLD 4IFDI 4H13C 3QJYA 3GTKH 3S16H 2VB2X 2ZTDA 3TP7A 4XIGS 5CR3A 1B44D 5E3FA 5DM73 4N8FA 3HOVH 2UXBQ 1GUTA 1A3TA 2LXJA 1K0RA 1TS5A 2PNHA 3HRZC 5IP9H 3CCSA 2KJXA 3KDFA 1F2YA 3TZDA 2HD3A 2RHSB 3V05A 1LT3D 3M9BA 4QIWB 2H1EA 1NNXA 2QDBA 4A3IB 4LF4Q 5FO9B 1F9PA 4CJ0B 2EZVA 1CZGA 4CJ1B 1DCZA 2UXCQ 3J81i 2SNMA 4HIMA 1F9SA 3E0EA 4A3JB 4ZRZA 4MZ9A 4ZKCB 2CWAA 3H0GB 1I94Q 2N55A 5DAUA 5C3WA 3E6ZX 1LM0A 3C1EA 3DWQA 1CI3M 2TSSA 1TWCH 3CHBD 4A3DG 1KNAA 1KRTA 3ULLA 3VYRA 3S15H 1YITA 3GTQB 3VR2A 4U673 3LNNA 4KY7A 1SDFA 4UY8C 5CBEE 3TP6A 4POGA 1PRTB 4LAAA 4NPSA 1OXUA 5IIFA 1O7YA 3OIQA 4KHVA 3SXHA 3C1FA 1CSQA 1S5FD 4R8IA 1VQGA 1TWAB 5AJ3Q 2F52A 3IKJA 5C3EB 3DWAA 4IO9A 2NVXH 2EYPA 4DV2L 5A2QL 2Z4IA 3WOFA 1S5BD 2XGTA 2EOTA 2L1BA 1FNWA 2R7ZB 4QJFA 1G2TA 1A63A 4LF9L 3NE5B 3EIVA 2IW3A 3M3YH 1Q1EA 2R61A 1C0AA 1R4PB 2IJ0A 5FOBB 1EY7A 5JJLA 3ZYYX 2OTLA 2I46A 1NSNS 1C48A 1EQTA 2B2UA 2QCPX 3V96A 4AQYL 4DFAA 4Y7NH 2CFMA 4P71A 1TVXA 3A7AB 4ZQ3A 1JWMD 2K5DA 1X65A 1NMGA 4O1NA 2ATWA 3S1QH 3HOXG 1T5XD 1V1OA 2K03A 4H7BA 1Y14B 3TEHB 5JJZA 4JYAQ 4B08A 4U68A 5GAHC 2JA8B 4BXXH 3DMUA 2O5JC 3H15A 4IUUA 1JR0D 4C1NI 2JA6G 5M9OA 1HH2P 1S4ZA 1I6VC 3LGJA 1KRSA 3ND9A 4Y52H 4OIKA 2EDGA 4HCSA 4KY5A 4X64L 3EROA 1SYDA 2VXWA 1PFMA 1Z9FA 3CKIB 3HGBA 1BR9A 5E1FA 3U50C 1WTQA 2EXDA 2NTSA 3A8KE 2ICEC 3U58A 5IGGA 2ZXPA 1E2VA 2H5XA 3BVGA 3PUXA 1I4XA 3CP0A 1X32A 4CHTB 3AFQA 1C9OA 3S2DB 2E2DC 2AQ1B 2KVMA 3CCMA 1R9TB 1D1KA 1EIYB 2KBNA 4WFN3 2Q2UA 3E0JA 4DR6L 3PCOB 4B3RQ 1MI2A 3GTKB 1EYAA 5C4XH 1PH3A 1LTBD 1D8LA 3FKIG 4EQ5A 4DR7Q 4EGVA 1Q86C 4IPDA 2I5LX 4L63B 2MGSA 4AYBG 1ESRA 2IHFA 3TS2A 1VQCA 4JV5L 2MO0A 2RQXA 2YV5A 4AYBE 4A3IH 3P1HA 4X65L 1CQFA 1V1PB 3CU7A 4A93G 5EPJA 3J7ZC 3GTPH 1BVSA 4KLKA 3C2PA 3PO2G 3D3RA 4KKUA 4EVOA 2F4VQ 2NN6I 3OYYA 4K8JA 5IT9c 1VQKA 4K2LA 4BS9A 1HA6A 4IPHA 3I7FA 1J6QA 4NXNQ 1VQEA 1HZ9A 3G4SA 1PV4A 1LACA 2G9DA 2B2VA 4A3LH 2BA1A 3R2TA 2IY5B 1EY6A 4BY7G 4IZ8A 1TWCB 4GLAC 1ASZA 1Y1VH 3RN5A 1PHJA 5C3XA 1V8QA 4IURA 1Q8KA 2D62A 2F0WA 2F0PA 5T1GA 5JPNC 1DONA 3I91A 4JI4Q 1BCPF 1W6JA 4HEDA 1B50A 1QUQA 2DNEA 1B53A 3CCUA 3TRZA 4K0KL 4B9XA 2B8FA 5IYBG 4I7ZC 3S14H 4C3IB 1DOMA 5FKAC 1TIID 4XQJA 5C3EH 3FKIB 1E1OA 4J15A 4DR3L 1PH2A 3VYSA 2DUDA 4A3GG 1QB5D 4AH6A 1GUNA 1QVCA 5FO7B 2JE6I 3GQBA 1IBKL 1ZYRD 3RZDH 3PIO3 3EA6A 1WJJA 2HDMA 3DHQA 4DR1L 3H3VH 3A55A 2NZOA 2VQEQ 1MJCA 3G48A 1HUNA 4NW2A 3T1HL 1CFMA 2LS01 3NK9A 3D0FA 1CZWA 3HOYB 3CRKC 2ALYB 3IAYA 1BKBA 1I3QB 1EQRA 1SYBA 3J81j 3I56A 5LMNL 1YNNC 3OPOA 3SHLA 1S72A 5I4DA 4HN7A 2LY7A 1RTOA 1M1KC 2XNAC 1PZKD 4EQOA 3M7NA 4GKJQ 2RCFA 1LYLA 2CW0C 3I4MB 2E76C 1VS0A 3OMCA 1M8AA 4A3CG 2PW5A 4G4KA 1HFGA 1HNWL 3N6RA 1F9QA 2K5HA 1I6HH 3JC66 4P74A 3OW7A 2IT1A 4NDXA 4C3HH 4K6DA 1YJNA 5JVG3 3I55A 5IT9L 1X3QA 1NCVA 5KNBA 1S5ED 2ICIA 3DXJC 2L11A 5EKIA 1TWGH 4MNOA 3S1MB 1WD1A 1UE7A 1VQMA 2XVSA 1X9NA 4DV2Q 3S1RB 2OWOA 4DR1Q 3E5SA 3W3AA 1GVPA 4C2MH 5JEAJ 2WAQE 3HOWB 3W1BA 4HR7B 1MIUA 2OTJA 1HZBA 4AIMA 1SE4A 4LUZA 2A73B 2B8GA 4DAMA 4X6AH 3HOUG 1FGUA 3CXCA 4ME5A 5FLMG 4GKKL 4FF2A 1T5EA 1B9NA 1DOLA 4RCNA 3KF6A 4GN3B 3NENA 5LL6S 4X62Q 5C4JB 3BYTB 4KV6A 4B3RL 1XXGA 4DKAC 4JBMA 4OO1G 1HNZQ 1H95A 3FPUB 1SE8A 2NVQB 4WJWA 2PQAB 2AQ2B 1PLFA 4X3UA 3EVQA 4OGQC 2WINB 2BH8A 2PMZE 3GTLH 3SK5A 4OHJA 2CWPA 1JE4A 3A0JA 3H91A 1JC7A 3ONAB 1IKLA 1Q90A 2HCCA 2F0NA 4X64Q 4CKEA 2A19A 2IPKD 2JEAI 4PZ8A 2F4VL 3C3LA 2KEDA 4NB3A 1BBXC 2B63H 1XMQQ 4XTCS 1S40A 4PQXA 3IFTA 3TDQA 2SDFA 2OQ0A 2H4OA 2NYZD 2WACA 3GDEA 3CMEA 4QF4A 5EKKA 4DV4Q 2F0JA 2A5HA 1YNXA 1KDAA 1SYFA 2Q2HA 3GTOB 1NAPA 4P2CB 3KUPA 4KHPQ 4BY1H 1P8LA 2VZAA 1C4QA 2I5MX 1RODA 1WI5A 1IBML 2PZUA 1IL2A 2C5CA 2E2IB 2UUAL 5C44H 1UNSA 5CV6A 3I2ZA 1WOCA 1KC8C 5IWAQ 2JK8A 2Y0SB 4DUYL 1QNKA 3QG1A 1KD1C 4HSVA 4FXDA 4KI0A 4B9WA 3DWPA 1EYCA 1JICA 3TS0A 1HR0L 1I4QA 4HCEA 3S1MH 4PZ6A 4BWGB 1SXTA 5DM63 1OTCA 3HOUB 4X3SA 3R3OA 3CC2A 3KLSX 4A3BB 4GOPC 4DV6Q 2J0TD 4PV1C 2L4NA 3PQIA 5KYLA 1HNWQ 3RLFA 1K0SA 5EJWA 3S1QB 1TT2A 1PFNA 2HIVA 4DF7A 2YTYA 1K9MC 2XN9C 3K7AB 2NVYB 3EQLC 1LLRD 2ZJQA 2E8GA 4ABNA 5LL6X 2SOBA 3STBC 2K6AA 1EIHA 4A3EB 3SGIA 4A4IA 2ZTCA 3D6WA 3Q22A 1KIXA 1VQNA 1Y1WB 3KJOA 1V43A 3OSOA 1XMQL 5IYCH 3ERQA 1BOSA 5F2DA 3CD6A 2BCOA 4L5QA 1SNOA 3U9OA 2O5IC 3TN2A 5FLXE 1YHBA 2N88A 1CTMA 4Q0FA 5GAGC 2EY2A 4KD3A 3P7JA 1MBYA 2C35B 3UI2A 1CKNA 3S2DH 4KJOA 4ZAIA 3MXUA 3X3NA 3HOZG 3GV6A 2CQAA 1IYJB 2Z0SA 2UXBL 1R9TH 5CORA 1NTGA 2B2YA 5C0XH 4A76A 1XNQQ 3NBHA 1I5FA 2JA8G 1RJTA 4DGZA 1N8RC 2F0KA 2IX3A 1BCPB 2A69C 1EY8A 4JG2A 4X62L 1A8VA 3OTOL 2VQFQ 4XYQA 1LTGD 1S3OA 1PH7A 2E2HH 1X6OA 3UE1A 2JA5G 4LMQD 1VQIA 3AEVA 3PUYA 2R7FA 2RBMA 1AFPA 1LO5D 1XTCD 1PH6A 1VQJA 5C5MA 4DNTB 1OXXK 1GKHA 4QCLA 2EXZA 2ZXOA 5FJ8H 1L0XB 3T51B 2QW7A 1QILA 1CSPA 3MEHA 4JPBW 4DNRB 1CKMA 4RGMA 1SE3A 3I73A 3QIAA 4KJNA 4FYDA 4K5VA 2K14A 1J8IA 4BY7B 2M9VA 2F0OA 3SK8A 2KCMA 2FFKB 2A68D 2K01A 2XIWA 4IJLA 1Q8IA 1HXYD 1FJGL 4XDXA 1OO9B 3NXWA 4RCOA 1Q7YC 3M4QA 2EIFA 4HJ5A 2MHVA 4ILWA 4QUCA 3RZOB 2RSOA 1N9WA 4C3IH 3T1YL 2Z4HA 4BXXG 2EY6A 4JI7Q 4OO1I 4QIWE 2KCCA 3J7A5 3OIPA 2NVYH 3HKZG 1I4PA 1BDOA 3KDFB 4DAYB 2Z8LA 4RA8A 1N33L 2A8VA 5ELDA 4O42A 4DXFA 4A3EH 3FRPB 1N36L 1Q1BA 3DLLA 2AKWB 1FVIA 4LF5Q 4DK3C 3TSSA 3D8GA 3KF8A 4C3JH 1A62A 1K28A 4ZKBB 4NXML 4K8IA 3FVQA 3T56B 2R92B 4V0BA 2I0QA 3MVVA 4DV5Q 1UEBA 3MXGA 3RR5A 1M4VA 1V9PA 1I3QH 2WB1B 1Z7TA 4LF8Q 2Z6KC 2VB3X 3KLSA 1UE1A 1L0WA 5IOCA 3I4NB 1EWIA 1TS2A 1B2TA 1SE2A 4O2DA 4RKBA 4A3FB 4CGYB 3M4OH 2EPBA 2YU9B 4P73A 3L3OC 4JI1L 1XYIA 2CKZB 1GUOA 4GLVB 5E4WC 4IOAA 2D2CC 5FLMH 1DGSA 1DXMA 1K3RA 1LABA 3KBGA 4DR2Q 4LUOA 4ZCKA 5J1ZA 1JB7A 3NWTA 4OWWB 1UE6A 3HOVG 3GO5A 4DR6Q 1GJXA 4IN3A 2M00A 4DR4Q 1K8AC 4A93H 2JSOA 3VYTA 4M8AA 1Q46A 4YWMA 5KNDA 2F0IA 1ET9A 1XWEA 2KECA 3MTSA 3K5NA 2NVQH 4GN5A 4R4CA 2R92G 3KK7A 2OF1A 3VR6A 3E9IA 4DV5L 1EEID 2VQEL 3K57A 1B9MA 3M3YB 5CC4A 2VUMH 3J80c 1PRTF 1O7LA 1SFOH 1TR5A 4F87A 5FK9C 3A5UA 5M5XB 4FDBA 1VQHA 2WFWA 2NVTH 1RD9D 4JI8Q 2PW7A 3BZKA 5K36H 5NUCA 4OXPA 4TKOB 1FNUA 3NTKA 3R2IA 1JT8A 1PYWD 2F0VA 3T1YQ 3I72A 4A3GH 4DV3Q 2TMPA 4ZUJA 1MSGA 2D0PA 2DNCA 3OMGA 1JE5A 1NY4A 3K5MA 4ULLA 1E3PA 4YCUA 5IP9G 1I94L 3PO2B 4IUNA 1IZ6A 3HS0C 3FMCA 2WAQB 1PVOA 4JW0A 2MJ8A 1SSOA 1U9RA 1YJWA 4UPAA 2LKVA 1EIGA 4DV7L 1VQ7A 1JCKB 1T9HA 2F3VA 3A8IE 5I9PA 3V2TA 4JVZA 4HAEA 2FMCA 2GN5A 4CJ2C 1Q12A 5IYDH 3QWNA 1TWHB 1S5CD 5K5PA 3R93A 1HNZL 2ES2A 1JOOA 2PPBC 1R4QB 3GTOH 2K32A 2YU9H 4DR7L 2PZTA 5I9OA 1J5EQ 2JA7G 1PA6A 3CCEA 1NE3A 1OXSC 4BA2I 3PO3G 2K5QA 3HKZB 2FINB 5D14A 2VS1A 1X3PA 4ZYSA 1WTOA 4TVAB 4N9PA 2AHOB 4R4OA 5DLQE 1ESFA 3MWYW 1SJED 3J81E 3ZJYC 1QVFA 5M5YB 3M7GA 2EY5A 4DV6L 2J4XA 4YHHQ 4YCWA 4JOIC 5GADC 1HR0W 3MEFA 1KXLA 2E5LL 3D6CA 4DUZQ 2Q8TA 4LF9Q 1XPUA 3QOJA 3MC0B 1YHQA 1QUQB 1K83B 3M85A 1TWFB 2F0MA 2K7VA 5IWAL 1Y69U 5T1IA 1EWCA 1D5ZC 1E1TA 2RVLA 3PIOA 1YBYA 2F0HA 1XMOL 3D4RA 1B3QA 3VA7A 5AJ3L 1ASYA 2F3WA 4XXEA 4DV0L 3S1NH 4DNIA 1K8MA 3BZCA 5LMUL 1PTOF 1WTHA 5C0XI 4A3JH 2F3IA 4PMCA 1AZQA 2UXDL 3CF5A 4YIJA 3DUZA 2R93G 5BR8Q 4UP8A 1CM9A 4DN4M 1F9RA 3H0GG 4DV4L 1O7IA 3TZUA 1B3AA 2K4KA 2QGQA 2A69D 4KK7A 5LMNQ 4X66L 4B3SQ 1LT6D 5CBAE 4AQYQ 3NBHB 3PO2H 4J1MA 2AUJD 3QOLA 4YWLA 1UWVA 3CPWA 2KEEA 3W2DA 2HT1A 3RNUA 1H9SB 3CCQA 3NQTA 4LF4L 4R1JA 1DM0B 1QVGA 1B70B 5JAVA 1SNMA 1C7YA 1ILQA 2A6ED 5KRUA 4IPCA 1U4PA 4PMWA 2X69A 5I6WA 2CCZA 4O0AA 4DUZL 1KTKA 4HMJA 4CDFC 2EYMA 3HOZB 2MO1A 1K3BC 1JJCB 4JI2L 3K80C 3GTGH 4A3DB 1HZCA 1PH4A 1HA5A 4KHZA 3HOYG 2XSCA 4YWKA 3VR3A 4LW1A 4HIDA 2PI2E 3CQZH 1VQBA 3HG9A 1ICFB 1QZHA 3I4OA 4ODGA 4A3MG 1Q81C 4PZ7A 2JA9A 1PMRA 3F2CA 4N8X1 2PMZB 3SE0A 1BBWA 2JN4A 1STBA 2XWJB 4CDEC 1EY0A 1LTTD 1SNPA 2Z1CA 5CV4A 2QDLA 3PIP3 5EBCA 1X54A 2PQEA 5J39A 2B2UC 2RA4A 4L5RC 2UXCL 4A3LG 2R6GA 1MD2D 1WYDA 4BY7H 1RDPD 1PH8A 1Y8NB 3MXPA 4F88A 2R92H 4X65Q 4HMIA 4JV5Q 3KF6B 3I70A 1ENCA 2K1BA 3AFPA 4Y7NB 4FVMA 3L0OA 2GVBA 2K5VA 1P16A 1L1OC 5EQ0A 5KGUA 2NUCA 1GOZA 4DA2A 5M3FG 1EOVA 4GKJL 3VR5A 1VCIA 2EY1A 1W2BA 1SRUA 2BH2A 4RMFA 1STHA 1NUCA 2B2WA 3GTMH 3M4OB 5K36G 4A3CH 3AMUA 3UE0A 2KENA 2PYKA 1QNUA 1VMCA 1KDCA 4GKKQ 2FHTA 1HZAA 3PUWA 2E2JB 1F2ZA 1RHPA 1JJGA 2QKIC 3NSWA 3UDXA 4RHRA 3BZDB 3T1HQ 2EE1A 2KCNA 1U0LA 2JQOA 2L15A 3S24A 4GLXA 2R3ZA 3HKSA 3NUCA 1JJ2A 1IHZA 4XT1B 2Z9HA 4JC0A 1IBKQ 4CDDC 1V1PA 4UDUC 1JQYD 1H9SA 3IL8A 4DR5L 2SEBD 2QEXA 2ID0A 2ZTEA 5KEEA 1PFSA 2A6HC 2KA7A 3HOZH 3HEJA 1B8AA 4DR4L 1ML0D 2ZM6Q 3R8BA 3HZXA 4DK1A 5HGTA 3ICEA 2L55A 4R4QA 2C9OA 3ER0A 3AB9A 2EJFC 1BF4A 4OO1H 5GROA 2NVTB 1TY0A 1N32L 2OXPA 3DM3A 4G7OC 3MFYA 2O4XA 2K28A 3P20A 2JA7H 3MA2B 1FJGQ 3MXNA 4QL5A 1RCVD 2F0LA 1AEXA 4JOIA 3X3MA 3HP3A 1SYEA 3GP7A 3CRLC 3D31A 1SMYC 3OHXC 5C5LA 5EKLA 2G9HD 4KKTA 1B7YB 4JI6Q 4L5SA 5JJKA 1JWUD 1ZYRC 4P75A 1BCPD 4R8NA 4CKBA 2B63G 3JAMi 4HJ8A 1QG7A 1Y1VB 2B39A 1EFID 1SFOB 1UUPA 4HJ9A 3W5OA 3HOUH 1IL8A 4CBVA 1SAPA 3EN2A 1DD2A 1LTSD 2UU9L 1VQLA 1CUKA 3I8ZA 1HRJA 4RH6A 1KNEA 4OX9Q 4C3IG 2D5DA 5ELFA 3D4WA 1SR3A 2IL8A 2JA5B 4FF1A 2UUBL 3K59A 2UUBQ 4LFAQ 3TBIB 4M1UB 1KHIA 3PMFA 5J3BA 1BO0A 5IGEA 3MZ5A 2Q8RE 3J7AV 1SN8A 3BJUA 1STNA 5IGFA 5CV8A 4FNFA 3K6OA 2UU9Q 1Y1WH 2HUGA 1PTOH 2X6GA 4G7HC 1ZKOA 4ME3A 2XRQD 2WAQG 5FO8B 1HPCA 5GAEC 3VR4A 4A3BH 2OCEA 3I90A 4JI6L 3J80E 3PUVA 1K83H 1YEZA 2QILA 3KYHC 1EYDA 1LTAD 3SR1A 3H94A 4ZK9B 4MHEA 3FPPA 4JI3Q 1VQ9A 3K7AH 3L9AX 1A6XA 4FF4A 2EYHA 5IP7G 4BY1G 1KL9A 3H3VI 1RL2A 3CCJA 2MPMA 4KD4A 4IPGA 1H9MA
chains in the Genus database with same CATH topology
2A74C 1O80A 1FR3A 5D3DA 4NKLA 2PCFB 2F0EA 5ISRA 2QEJC 1VMPA 4J6HA 1GUWA 3A7LA 1DJRD 4K5XA 3J80L 4FXGC 5I2XA 2BE5D 1PRTD 5TSSA 1JORA 3GTLB 1PZJD 3SVMA 1E0BA 1HUMA 4BA1I 5ELEA 2EJMA 4RGOS 3SDZA 4NMZA 1LV9A 3Q23A 3PV0A 2JEBI 3S15B 1Z47A 2E75C 4FF3A 5G3LF 2E2HB 4ID6A 1PFBA 1A15A 4AYBB 1EZ8A 5HURA 3JAME 4BY1B 1EY5A 3A56A 4IUQA 4IUVA 1BCPC 4C3JB 2F1MA 1I4HA 1KLGD 2AWNA 3NBIA 2HCIA 2CHBD 5C4HA 2LMCB 1PXUA 5JOBA 2F03A 3NTIA 2RDHA 1Y8PB 4IFDG 1SNQA 5BN4A 2NB0A 3Q0AA 1CQVA 3EFXD 4R9WA 4TRDA 2JA6B 1AW7A 3GTJB 1EEFD 2V4DA 2B2TA 1K8OA 2NBFA 2VNUD 1CA5A 3BG3A 3URYA 2F0GA 2BDNA 4QUFA 3S16B 1W6KA 5IT9E 3RMHA 4EQNA 4XQQA 1SYCA 1IW7C 4ZLTF 3VYUA 1WTXA 5BN5A 1KDBA 1HQRD 2K5WA 3NQIA 4F7XA 4C1NK 4FP5D 4KKSA 2FJ2A 1D1IA 2RKSA 1H9RA 3TP5A 3OWFA 4A93B 4IUPA 2CVRA 2Q8IB 3S14B 1ET6A 2EYLA 2PO4A 1BXTA 2XWBB 3HOVB 2B2VC 3GTPB 5A35A 4KN7C 1WTVA 4N9TA 1E2ZA 5EBDA 4F8MA 3BYYB 1IW7D 4QB4A 2KHSA 4TSSA 3RZDB 1G8ZD 1BNZA 1TS4A 1EQVA 1TKWB 3QO2A 1UEAB 1II3A 4WRDA 1SMYD 4RWSC 1ILPA 1AP0A 2F4IA 2IX0A 1U4LA 1H9KA 1L0YB 5I6YA 3NWSA 2L0CA 1SNDA 1PZID 4CKCA 4HSPA 5C6AA 1OXTA 3QB3A 1IKMA 4A3GB 3G7LA 3T4AC 2PZWA 3NPPA 5EGTA 4H0LC 1ENFA 1EOTA 3BDOA 4DAYA 5JEAG 4HTHA 5EPLA 4RKLA 1STEA 1STYA 1STGA 5DEHA 4C3HB 2K33A 4JK1C 4XYOA 1QE6A 4IUTA 1HTPA 2AQ3B 1O78A 3K0YA 1F2LA 3GD7A 1Y8OB 1Z6HA 1ZXTA 2K05A 1YNND 4PNYA 1WCMB 2F0DA 5EPKA 3HOXB 1J9OA 3S1NB 3JAML 5JPMC 2AUKA 1U4RA 2IWHA 1KABA 1GXDC 1EL0A 4DK0A 2L12A 4ZUIA 3DEPA 1O7ZA 3G6JB 1CK1A 1PTOD 4OL7A 2KQ3A 3K5OA 5A2QE 4Z9CB 3J7AF 2EYFA 3H6MA 1D6EC 4FO2A 4C56C 1A3VA 5DNFA 3K58A 2EYOA 4QMGA 1FYCA 4KTAA 4KMUC 1SNCA 2ZXRA 2WP8J 5C4ZA 5IGCA 4XQNA 1IYUA 1CT1D 2ENBA 5BN3A 5I2YA 1A2TA 1JOKA 2A68C 2IX1A 1DYQA 1BUVT 3T13A 3F2UA 3A8JE 2OEOA 3IFDA 4RHSA 1DOKA 2B2TC 5M5WB 4C3JG 3J81L 3D4DA 3LWEA 1A3UA 2X6LA 2BA0A 1GUGA 1SYGA 1JOQA 5C44B 3U9SA 4FXKC 2O2LD 1G6ZA 2B63B 1UAPA 2VUMB 1AN8A 4RAUC 4G57A 3WDNA 5KIXA 2F0SA 4IFDJ 4LJZC 2KOLA 1G2SA 5CYUA 1QOHA 3CQZB 1BQQT 1G91A 2RSNA 2OT2A 2D9UA 1U4MA 3NTHA 1EY9A 1XX8A 3S9WA 1H9JA 3EJIA 1WTRA 2MUYA 2DN8A 1CA6A 2HDLA 5ELBA 2F0TA 1I6HB 4BBSB 3BDLA 1I50B 2F0FA 3VA5A 5IGDA 3N52A 3SEBA 4DU9A 3BDCA 1TWGB 5CMDA 1WVLA 3NHHA 1EU3A 2L5TA 1TY2A 2I07B 2AWOA 4X3KA 2K04A 4WORA 1FGBD 1D5MC 3DEOA 2YYZA 3S2HB 3K5LA 4H44C 1S5DD 2B2YC 5E4XA 2M2LA 1QCBD 1EU4A 3TMEA 2NN6G 2WIIB 2NZ1D 4K14A 1Q3LA 3KLRA 1GHKA 1ZEQX 3S17B 5KYIA 5ELCA 1D5XC 5IGBA 1F2MA 2A6HD 4IALA 1PDQA 3OOCA 1KAAA 1QJOA 1HQMC 1JWSD 5KNCA 3H3VC 2E74C 5FLXL 3I4LA 2A6EC 2DY7A 2BOSA 4GZYC 1GUSA 1HFNA 3MAQA 3J7YW 1A2UA 4Q5VA 3LX0A 4K6LA 1B4OA 2MP1A 2F0QA 2ZT9C 1WTPA 5CV7A 3AU7A 4BBRB 2BE5C 1PRTC 1EWHA 1VF5C 4OIJA 1RTNA 2XRSD 3SK6A 2WKDA 2FMMA 2NN6H 1HCZA 2WKCA 5COYA 1SJHD 2HQEA 4KY6A 1PTOB 5D3IB 1SBBB 1IYVA 1F77A 4EQPA 3BVZA 1WTWA 3A54A 1LT5D 1ENAA 2DY8A 1G291 2LFNA 1FNVA 4RFBA 3GTGB 4A3MB 4X3TA 3TP8A 1GHJA 5C0XG 1AZPA 5CGKA 1STAA 5LHY1 1E2WA 1EZ6A 4J8QA 3RD4A 5C4XB 4DAVA 3Q24A 4PMBA 3T53B 1I4RA 4S3SA 3GTMB 1ONLA 1PTOC 1TQOA 2JYOA 3I3CA 3MFGA 2BDOA 4IQZA 3MHBA 5C0XJ 4C3HG 1ICWA 1I4GA 2NWGA 4JBWA 3PUZA 2EYJA 3Q6SA 2WV6D 3ND8A 4K2KA 4TQUS 1D2BA 2SNSA 3WOEA 4RGNA 2B2WC 1FD7D 5CV5A 1HHVA 3PO3B 1CHQD 5J22A 4MIUA 1EY4A 2R93B 4MN3A 2EVBA 4UAIA 3SK4A 1DZ1A 4E6IA 3LWUA 3NP8A 4L8JA 4DAPA 4NP5A 2F0UA 1OXVA 3T16A 2NVXB 3L7ZC 1SEBD 1LTRD 2L9HA 1B1ZA 4DXGA 1C8CA 5G3LD 1WD0A 1TU2B 2RDGA 3C46A 4XT3B 4KN4C 1YNJC 3DM1A 4A3KB 1KLUD 1NR4A 3OWEB 1VF7A 1QWYA 2JP1A 2PNRC 3FEWX 3FDTA 4L6TB 2EJGC 5M3MB 4G7ZC 1RF2D 3O13A 4RGTA 2JA7B 5IODA 4K5WA 5JEAH 4V190 5AFWA 1NR2A 3M4YA 1TS3A 5JVH3 3KBXA 2JXMB 3ITPA 1JB3A 3H09A 1YNJD 1VDZA 3P75A 4IFDH 1LT4D 2KUMA 2NTTA 3BVMA 3BS1A 1LTID 3RUZA 1CHPD 2QF7A 4C2MB 1MSHA 4I65A 5M3FB 2GA4B 3GV3A 1RKNA 4LK1C 2CW0D 5CV9A 2RDFA 2J7ZA 5D65A 1MGSA 1HTLD 4IFDI 4H13C 3QJYA 2VB2X 3TP7A 4XIGS 5CR3A 1B44D 5E3FA 5DM73 1GUTA 1A3TA 1TS5A 3HRZC 2KJXA 1F2YA 3TZDA 3V05A 1LT3D 4QIWB 2H1EA 2QDBA 4A3IB 5FO9B 1F9PA 4CJ0B 2EZVA 1CZGA 4CJ1B 1DCZA 2SNMA 1F9SA 4A3JB 4ZRZA 4ZKCB 3H0GB 2N55A 5DAUA 5C3WA 3E6ZX 3C1EA 3DWQA 1CI3M 2TSSA 3CHBD 1KNAA 3VYRA 3GTQB 3VR2A 4U673 3LNNA 4KY7A 1SDFA 5CBEE 3TP6A 1PRTB 4LAAA 1OXUA 5IIFA 1O7YA 3OIQA 4KHVA 3SXHA 3C1FA 1S5FD 4R8IA 1TWAB 3IKJA 5C3EB 3DWAA 2EYPA 5A2QL 2Z4IA 3WOFA 1S5BD 2EOTA 2L1BA 1FNWA 2R7ZB 1G2TA 3NE5B 2IW3A 1Q1EA 2R61A 1R4PB 2IJ0A 5FOBB 1EY7A 3ZYYX 2I46A 1NSNS 1C48A 1EQTA 2B2UA 2QCPX 3V96A 4DFAA 1TVXA 3A7AB 4ZQ3A 1JWMD 2K5DA 4O1NA 1T5XD 1V1OA 2K03A 4H7BA 5JJZA 4B08A 4U68A 2JA8B 3DMUA 2O5JC 4IUUA 1JR0D 4C1NI 5M9OA 1S4ZA 1I6VC 3ND9A 4OIKA 2EDGA 4HCSA 4KY5A 3EROA 1SYDA 2VXWA 1PFMA 3CKIB 3HGBA 1BR9A 5E1FA 1WTQA 2NTSA 3A8KE 2ICEC 5IGGA 2ZXPA 1E2VA 3BVGA 3PUXA 1I4XA 4CHTB 1X32A 3S2DB 2E2DC 2AQ1B 2KVMA 1R9TB 1D1KA 4WFN3 3E0JA 1MI2A 3GTKB 1EYAA 1LTBD 4EGVA 4L63B 2MGSA 1ESRA 2RQXA 3P1HA 1CQFA 1V1PB 3CU7A 5EPJA 3C2PA 3D3RA 4KKUA 4EVOA 2NN6I 4K8JA 4K2LA 4BS9A 1HA6A 1LACA 2G9DA 2B2VA 2BA1A 3R2TA 1EY6A 4IZ8A 1TWCB 5C3XA 1V8QA 4IURA 2D62A 2F0WA 2F0PA 5T1GA 5JPNC 1DONA 3I91A 1BCPF 1W6JA 4HEDA 1B50A 2DNEA 1B53A 4B9XA 2B8FA 4I7ZC 4C3IB 1DOMA 5FKAC 1TIID 4XQJA 3FKIB 3VYSA 1QB5D 1GUNA 5FO7B 2JE6I 3GQBA 1ZYRD 3PIO3 3EA6A 2HDMA 3DHQA 3A55A 1HUNA 4NW2A 1CFMA 2LS01 3NK9A 1CZWA 3HOYB 3CRKC 3IAYA 1I3QB 1SYBA 1YNNC 3OPOA 3SHLA 5I4DA 4HN7A 2LY7A 1RTOA 2XNAC 1PZKD 4EQOA 3M7NA 2CW0C 3I4MB 2E76C 3OMCA 1M8AA 2PW5A 4G4KA 1HFGA 3N6RA 1F9QA 3OW7A 2IT1A 4NDXA 4K6DA 5JVG3 5IT9L 1X3QA 1NCVA 5KNBA 1S5ED 2ICIA 3DXJC 2L11A 5EKIA 3S1MB 1WD1A 2XVSA 3S1RB 3E5SA 3W3AA 5JEAJ 3HOWB 4HR7B 1SE4A 2A73B 2B8GA 4ME5A 4FF2A 1T5EA 1B9NA 1DOLA 4RCNA 5LL6S 5C4JB 3BYTB 4KV6A 1XXGA 4OO1G 3FPUB 2NVQB 4WJWA 2AQ2B 1PLFA 4X3UA 3EVQA 4OGQC 2WINB 3SK5A 4OHJA 1JE4A 3H91A 1JC7A 3ONAB 1IKLA 1Q90A 2HCCA 2F0NA 4CKEA 2IPKD 2JEAI 3C3LA 2KEDA 1BBXC 4XTCS 4PQXA 3IFTA 3TDQA 2SDFA 2H4OA 2NYZD 2WACA 4QF4A 5EKKA 2F0JA 2A5HA 1KDAA 1SYFA 3GTOB 1NAPA 4P2CB 3KUPA 1C4QA 1RODA 2PZUA 2C5CA 2E2IB 1UNSA 5CV6A 2Y0SB 1QNKA 3QG1A 4HSVA 4FXDA 4KI0A 4B9WA 3DWPA 1EYCA 1JICA 1I4QA 4HCEA 4BWGB 1SXTA 5DM63 3HOUB 4X3SA 3R3OA 3KLSX 4A3BB 2J0TD 4PV1C 2L4NA 5KYLA 3RLFA 5EJWA 3S1QB 1TT2A 1PFNA 4DF7A 2XN9C 3K7AB 2NVYB 3EQLC 1LLRD 4ABNA 5LL6X 2SOBA 1EIHA 2K6AA 4A3EB 3D6WA 3Q22A 1Y1WB 1V43A 3OSOA 3ERQA 1BOSA 5F2DA 2BCOA 1SNOA 3U9OA 2O5IC 3TN2A 5FLXE 2N88A 1CTMA 4Q0FA 2EY2A 4KD3A 3P7JA 1MBYA 3UI2A 4KJOA 4ZAIA 3MXUA 3X3NA 3GV6A 2CQAA 5CORA 2B2YA 5C0XH 3NBHA 1RJTA 4DGZA 2F0KA 2IX3A 1BCPB 2A69C 1EY8A 4XYQA 1LTGD 4LMQD 3PUYA 2RBMA 1AFPA 1LO5D 1XTCD 5C5MA 4DNTB 1OXXK 4QCLA 2EXZA 2ZXOA 1L0XB 3T51B 4DNRB 1QILA 3MEHA 4RGMA 1SE3A 3I73A 3QIAA 4KJNA 4FYDA 4K5VA 1J8IA 4BY7B 2M9VA 2F0OA 3SK8A 2FFKB 2A68D 2K01A 2XIWA 1Q8IA 1HXYD 4XDXA 1OO9B 3NXWA 4RCOA 2MHVA 4ILWA 4QUCA 3RZOB 2RSOA 2Z4HA 2EY6A 4OO1I 2KCCA 3OIPA 1I4PA 1BDOA 2Z8LA 4RA8A 5ELDA 4O42A 4DXFA 3FRPB 1Q1BA 3TSSA 3D8GA 3KF8A 4ZKBB 4K8IA 3FVQA 3T56B 2R92B 4V0BA 3MVVA 3MXGA 1M4VA 2WB1B 1Z7TA 2VB3X 3KLSA 5IOCA 3I4NB 1TS2A 1B2TA 1SE2A 4RKBA 4A3FB 4CGYB 2EPBA 2YU9B 3L3OC 1XYIA 1GUOA 5E4WC 2D2CC 1DXMA 1LABA 3KBGA 5J1ZA 3NWTA 3GO5A 1GJXA 4IN3A 2M00A 2JSOA 3VYTA 4M8AA 5KNDA 2F0IA 1ET9A 1XWEA 2KECA 3MTSA 3K5NA 3KK7A 2OF1A 3VR6A 1EEID 3K57A 1B9MA 3M3YB 5CC4A 1PRTF 1O7LA 1TR5A 4F87A 5FK9C 5M5XB 1RD9D 2PW7A 5K36H 5NUCA 4TKOB 1FNUA 3NTKA 3R2IA 1PYWD 2F0VA 3I72A 2TMPA 4ZUJA 1MSGA 2DNCA 3OMGA 3K5MA 4ULLA 3PO2B 4IUNA 3HS0C 3FMCA 2WAQB 2MJ8A 1SSOA 1U9RA 2LKVA 1EIGA 1JCKB 2F3VA 3A8IE 5I9PA 3V2TA 4HAEA 2FMCA 4CJ2C 1Q12A 3QWNA 1TWHB 1S5CD 5K5PA 3R93A 1JOOA 2PPBC 1R4QB 2K32A 2PZTA 5I9OA 1OXSC 4BA2I 2K5QA 3HKZB 2FINB 5D14A 1X3PA 4ZYSA 1WTOA 4N9PA 3J81E 1ESFA 3MWYW 1SJED 5M5YB 3M7GA 2EY5A 2J4XA 3D6CA 2Q8TA 3QOJA 3MC0B 1K83B 3M85A 1TWFB 2F0MA 2K7VA 1Y69U 5T1IA 1EWCA 1D5ZC 2RVLA 2F0HA 3D4RA 3VA7A 2F3WA 4XXEA 1K8MA 1PTOF 5C0XI 4PMCA 1AZQA 4YIJA 3DUZA 1CM9A 4DN4M 1F9RA 3TZUA 1B3AA 4KK7A 2A69D 1LT6D 5CBAE 4J1MA 2AUJD 3QOLA 2KEEA 3W2DA 1H9SB 3NQTA 1DM0B 5JAVA 1SNMA 1ILQA 2A6ED 5KRUA 1U4PA 4PMWA 2X69A 5I6WA 1KTKA 4HMJA 2EYMA 3HOZB 4A3DB 1HA5A 4KHZA 2XSCA 3VR3A 3HG9A 4ODGA 1PMRA 2PMZB 3SE0A 1STBA 2XWJB 1EY0A 1LTTD 1SNPA 2Z1CA 5CV4A 3PIP3 5EBCA 5J39A 2PQEA 2B2UC 2RA4A 2R6GA 1MD2D 1RDPD 1Y8NB 3MXPA 4F88A 4HMIA 3I70A 1ENCA 2K1BA 4Y7NB 4FVMA 5EQ0A 5KGUA 2NUCA 1GOZA 4DA2A 3VR5A 1VCIA 2EY1A 1STHA 1NUCA 2B2WA 3M4OB 5K36G 3AMUA 2PYKA 1QNUA 1VMCA 1KDCA 2FHTA 3PUWA 2E2JB 1F2ZA 1RHPA 2QKIC 3NSWA 4RHRA 3BZDB 2EE1A 2KCNA 2R3ZA 3NUCA 1IHZA 4XT1B 1V1PA 4UDUC 1JQYD 1H9SA 3IL8A 2SEBD 2ID0A 5KEEA 2A6HC 2KA7A 3HEJA 1ML0D 3R8BA 3HZXA 4DK1A 5HGTA 2L55A 2C9OA 3AB9A 2EJFC 1BF4A 4OO1H 2NVTB 1TY0A 2OXPA 4G7OC 3MFYA 2O4XA 2K28A 3P20A 3MA2B 3MXNA 1RCVD 2F0LA 1AEXA 3X3MA 3HP3A 1SYEA 3GP7A 3CRLC 3D31A 1SMYC 3OHXC 5C5LA 5EKLA 2G9HD 4KKTA 1JWUD 1ZYRC 1BCPD 4R8NA 4CKBA 1QG7A 1Y1VB 2B39A 1EFID 1SFOB 1UUPA 1IL8A 4CBVA 1SAPA 1DD2A 1LTSD 3I8ZA 1HRJA 4RH6A 1KNEA 4C3IG 2D5DA 5ELFA 3D4WA 2IL8A 2JA5B 4FF1A 3K59A 3TBIB 4M1UB 3PMFA 1BO0A 5IGEA 3MZ5A 2Q8RE 3J7AV 1STNA 5IGFA 5CV8A 4FNFA 3K6OA 2HUGA 1PTOH 2X6GA 4G7HC 1ZKOA 2XRQD 5FO8B 1HPCA 3VR4A 3I90A 3J80E 3PUVA 2QILA 1EYDA 1LTAD 3SR1A 3H94A 4ZK9B 4MHEA 3FPPA 1A6XA 3L9AX 4FF4A 2EYHA 2MPMA 4KD4A 1H9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CW0 C;  3A8J E;  5JEA G;  2E76 C;  1K8O A;  3P20 A;  1FR3 A;  3T53 B;  1OXU A;  1GJX A;  1PMR A;  3BG3 A;  3N6R A;  5JEA H;  2NN6 G;  3PUY A;  3SE0 A;  2PCF B;  3OW7 A;  2IT1 A;  1ONL A;  3M4Y A;  3IKJ A;  3CRL C;  3A7L A;  2BDO A;  3KLR A;  4IQZ A;  4DNT B;  1OXX K;  5KND A;  3D31 A;  1GHK A;  5KNB A;  1SMY C;  2BA0 A;  1GUG A;  2K33 A;  3DXJ C;  2BE5 D;  4JK1 C;  3QG1 A;  3U9S A;  1HTP A;  2JXM B;  4KKU A;  4KI0 A;  4KKT A;  2NN6 I;  3T51 B;  4DNR B;  1O78 A;  2R6G A;  3I73 A;  4JBW A;  3M85 A;  1VDZ A;  3GD7 A;  1IW7 C;  3NE5 B;  3QIA A;  3VR6 A;  1ZYR C;  3PUZ A;  1Y8N B;  1Q1E A;  2A6H D;  1Y8O B;  2K7V A;  1Z6H A;  1Y69 U;  1LAC A;  2BA1 A;  4IFD H;  3ND8 A;  1B9M A;  3OOC A;  4TQU S;  4BA1 I;  1QJO A;  3W3A A;  5BN5 A;  3D4R A;  3VA7 A;  1HQM C;  2EJM A;  3WDN A;  5KNC A;  4PV1 C;  2E74 C;  4HR7 B;  1K8M A;  1O7L A;  2A68 D;  3I4L A;  1V8Q A;  3SDZ A;  2QF7 A;  1DD2 A;  2A6E C;  3PV0 A;  2B8G A;  2D62 A;  2JEB I;  4LJZ C;  3RLF A;  4GZY C;  2AUK A;  2E75 C;  3A7A B;  1GUS A;  4KKS A;  2D5D A;  1T5E A;  1B9N A;  4RCN A;  4LK1 C;  3VR5 A;  5K36 H;  1VCI A;  1H9R A;  2DNE A;  4TKO B;  2B8F A;  3EQL C;  4DK0 A;  4I7Z C;  5K36 G;  2ZT9 C;  2KCC A;  3I72 A;  2Q8I B;  2EVB A;  3TZU A;  1BDO A;  4OO1 G;  4H13 C;  2A69 D;  3QJY A;  2DNC A;  2O5J C;  2BE5 C;  1EWH A;  1H9J A;  1VF5 C;  4XIG S;  1V43 A;  3PUW A;  1Q1B A;  5A35 A;  4KN7 C;  1GUN A;  1GUT A;  2JE6 I;  1E2Z A;  3LWU A;  4L8J A;  1I6V C;  2AUJ D;  4OGQ C;  2NN6 H;  2DN8 A;  1HCZ A;  3FMC A;  1IW7 D;  3GQB A;  3ND9 A;  4G7H C;  2EDG A;  1ZKO A;  2F1M A;  3T56 B;  2O5I C;  1H9S B;  1HPC A;  3HGB A;  3VR4 A;  1Q90 A;  1TKW B;  1OXV A;  1IYV A;  3L7Z C;  1FYC A;  1CTM A;  2LMC B;  1DCZ A;  3A8K E;  2A6E D;  2JEA I;  4KMU C;  1CFM A;  1H9K A;  1E2V A;  1TU2 B;  3A8I E;  3PUV A;  1Z7T A;  3PUX A;  3CRK C;  1H9S A;  3MXU A;  1Q12 A;  1YNJ C;  4KN4 C;  1Y8P B;  2L5T A;  4XTC S;  4IFD G;  1G29 1;  2A6H C;  5C0X H;  1VF7 A;  2AWO A;  3H94 A;  3IFT A;  5BN4 A;  4BA2 I;  2KA7 A;  1IYU A;  3FPP A;  1YNN C;  1A6X A;  1CI3 M;  5BN3 A;  1GHJ A;  1OXT A;  2PNR C;  4DK1 A;  5C0X G;  2PPB C;  3OPO A;  1GUO A;  1E2W A;  2A68 C;  2EJG C;  4KHZ A;  4G7Z C;  2K32 A;  2A69 C;  2D2C C;  2EJF C;  3AB9 A;  2YYZ A;  3VR3 A;  3VR2 A;  1DXM A;  3LNN A;  4H44 C;  4OO1 H;  1LAB A;  4H0L C;  3M7N A;  2V4D A;  4G7O C;  1OXS C;  3BDO A;  3MFY A;  1H9M A; 
#chains in the Genus database with same CATH topology
 4IJH A;  2A74 C;  1O80 A;  1FR3 A;  5JJI A;  1PYS B;  4GN4 B;  5D3D A;  4NKL A;  2PCF B;  2F0E A;  5ISR A;  2QEJ C;  1VMP A;  3F8T A;  4J6H A;  1GUW A;  3A7L A;  1DJR D;  4K5X A;  3J80 L;  4FXG C;  4YCV A;  5I2X A;  2RF4 A;  4MTN A;  2BE5 D;  1PRT D;  5TSS A;  4YY3 Q;  2K52 A;  1JOR A;  3S1R H;  3GTL B;  1MJE A;  1PZJ D;  3SVM A;  4OWX B;  1E0B A;  1HUM A;  4BA1 I;  5ELE A;  1E22 A;  4OWT B;  2EJM A;  3BU2 A;  4RGO S;  3PIP A;  3SDZ A;  4NMZ A;  2B29 A;  2YTX A;  3HOW G;  1LV9 A;  3NEL A;  3Q23 A;  3PV0 A;  2JEB I;  3S15 B;  1NJI C;  2WB1 E;  2VUM G;  1Z47 A;  2E75 C;  3KF8 B;  4FF3 A;  1G51 A;  2XTI A;  4A3F G;  5G3L F;  2E2H B;  4JBK A;  4ID6 A;  1LTL A;  2AMC B;  3HFZ B;  3L2P A;  2JA5 H;  1CKO A;  1PFB A;  5C4X G;  4JI0 L;  1A15 A;  5L37 A;  3RLN A;  2PI2 A;  5IYC G;  1NBW A;  1VQ6 A;  4AYB B;  1EZ8 A;  2R7Z G;  5HUR A;  3JAM E;  4GNX C;  4BY1 B;  4MTK A;  1EY5 A;  3A56 A;  1X56 A;  4IUQ A;  4IUV A;  1BCP C;  4C3J B;  2F1M A;  1I4H A;  1KLG D;  2HHH L;  2AWN A;  3NBI A;  4A3I G;  1WCM G;  2HCI A;  1X55 A;  2CHB D;  2HHH Q;  1RIP A;  5C4H A;  2LMC B;  2Y0S E;  1PXU A;  3TRE A;  5JOB A;  2F03 A;  5M3M G;  1SMX A;  3NTI A;  1HNX L;  2RDH A;  1Y8P B;  4IFD G;  2DJF C;  2UUA Q;  1SNQ A;  1YVC A;  5BN4 A;  3RZO H;  5IYD G;  2NB0 A;  3Q0A A;  1XTD A;  3I4N H;  4DV3 L;  2VY3 A;  1CQV A;  3EFX D;  4R9W A;  4TRD A;  2JA6 B;  1AW7 A;  3GTJ B;  2N78 A;  5M3F H;  4KHP L;  3CCL A;  1EEF D;  2K5N A;  4GNX A;  2V4D A;  2B2T A;  4JI8 L;  1K8O A;  2NBF A;  2VNU D;  3W1G A;  3J80 i;  1CA5 A;  1X3G A;  3BG3 A;  3K81 C;  3URY A;  2F0G A;  2BDN A;  4QUF A;  5FJ8 G;  3S16 B;  1W6K A;  5IT9 E;  3RMH A;  4GOP A;  4EQN A;  1IBL Q;  2QA4 A;  4XQQ A;  3S17 H;  1HJP A;  1X3F A;  1SYC A;  2EQS A;  1IW7 C;  3QR8 A;  1WCM H;  4ZLT F;  3VYU A;  1WTX A;  1XPO A;  4GOP B;  5BN5 A;  3NEM A;  1FL0 A;  1KDB A;  2KHI A;  1HQR D;  2R7D A;  2K5W A;  2CH4 W;  2Q2I A;  3NQI A;  4F7X A;  3S2H H;  4C1N K;  4FP5 D;  5HGQ A;  4KKS A;  2FJ2 A;  3H0G H;  1D1I A;  2VL6 A;  2RKS A;  1H9R A;  3TP5 A;  3OWF A;  3F1Z A;  4A93 B;  4IUP A;  2MQH A;  2CVR A;  2N3S A;  4QY7 A;  2Q8I B;  2ZM6 L;  4BBR G;  5BR8 L;  4RG1 A;  3S14 B;  3TQY A;  1ET6 A;  2EYL A;  2PO4 A;  1BXT A;  2XWB B;  1XNR L;  3HOV B;  2UXD Q;  2B2V C;  5C44 G;  3GTP B;  5A35 A;  4KN7 C;  1WTV A;  1LUZ A;  3UDI A;  4N9T A;  1E2Z A;  5EBD A;  4F8M A;  3BYY B;  1IW7 D;  4QB4 A;  1U5K A;  1XMO Q;  1N34 Q;  2UUC L;  2KHS A;  4TSS A;  3RZD B;  1G8Z D;  1BNZ A;  1TS4 A;  1EQV A;  3E9H A;  1TKW B;  4LF7 Q;  3QO2 A;  1UEA B;  1II3 A;  4WRD A;  1N34 L;  1SMY D;  4RWS C;  1ILP A;  1YJ9 A;  1AP0 A;  2F4I A;  2IX0 A;  4DK6 C;  1U4L A;  1H9K A;  3OW2 A;  1L0Y B;  2E5L Q;  5I6Y A;  4LF5 L;  2WB1 G;  3NWS A;  3PGZ A;  2L0C A;  4H02 A;  1SND A;  1PZI D;  4CKC A;  4WJ4 A;  4HSP A;  4HIO A;  5C6A A;  1AE2 A;  1OXT A;  3QB3 A;  5E7N A;  3GTQ H;  1EQQ A;  1IKM A;  4JI7 L;  4A3G B;  4JI5 L;  1NMF A;  3G7L A;  3T4A C;  2PZW A;  3NPP A;  5EGT A;  3CC4 A;  3EBE A;  4H0L C;  1ENF A;  3GTJ H;  1EOT A;  3BDO A;  1EUJ A;  4DAY A;  5JEA G;  3J81 c;  3CCV A;  4HTH A;  5EPL A;  4RKL A;  3VDY A;  1STE A;  1STY A;  1STG A;  5DEH A;  4C3H B;  4DR5 Q;  2K33 A;  4JK1 C;  1Y1W G;  4XYO A;  1QE6 A;  4IUT A;  1HTP A;  2AQ3 B;  1O78 A;  3K0Y A;  1F2L A;  4R4T A;  3KJP A;  3GD7 A;  3K8A A;  2PQA A;  4LF7 L;  1Y8O B;  1Z6H A;  1ZXT A;  2IHE A;  2K05 A;  1YNN D;  2DJG C;  4PNY A;  1WCM B;  2F0D A;  2VW9 A;  5EPK A;  3HOX B;  3ERS X;  1J9O A;  1TXY A;  2K75 A;  3S1N B;  3JAM L;  1G6P A;  5JPM C;  2N8N A;  1Y1V G;  2AUK A;  3AQQ A;  4LF6 Q;  1U4R A;  2IWH A;  1N33 Q;  4DR3 Q;  1KAB A;  4I7A A;  3I4M H;  1GXD C;  3PO3 H;  1EL0 A;  4OON A;  4A3F H;  4DK0 A;  2L12 A;  4ZUI A;  3DEP A;  1O7Z A;  3G6J B;  4HJ7 A;  1CK1 A;  4K0K Q;  5M5Y H;  1PTO D;  4OL7 A;  2KQ3 A;  3K5O A;  5A2Q E;  4Z9C B;  1EFW A;  4B3T Q;  3J7A F;  1GD7 A;  1TWF H;  2EYF A;  1MHW C;  3WWV A;  3H6M A;  4FO2 A;  1D6E C;  4C56 C;  1A3V A;  5DNF A;  3M4P A;  3G6E A;  2LSS A;  3K58 A;  2RHQ B;  3HKZ E;  4A3K G;  4PG3 A;  2EYO A;  4NXN L;  4QMG A;  1FYC A;  4KTA A;  5EAY A;  4HIK A;  4KMU C;  1SNC A;  2ZXR A;  2WP8 J;  5C4Z A;  5IGC A;  4XQN A;  1IYU A;  1CT1 D;  2R93 H;  3Q8D A;  5HY6 A;  2ENB A;  5BN3 A;  2N49 A;  5I2Y A;  1A2T A;  1JOK A;  2A68 C;  5M5X H;  2IX1 A;  1DYQ A;  1BUV T;  1VQD A;  3A5Z B;  3T13 A;  3F2U A;  3A8J E;  4GNX B;  4A3E G;  2OEO A;  3IFD A;  5IE8 A;  4RHS A;  1DOK A;  2B2T C;  5M5W B;  1SRO A;  4C3J G;  3J81 L;  4LFB L;  1W3S A;  1VQ8 A;  3D4D A;  3LWE A;  1BBU A;  1XNQ L;  1A3U A;  5ELO A;  2X6L A;  4QQB X;  1PH5 A;  3UDG A;  2BA0 A;  1GUG A;  1SYG A;  1JOQ A;  5C44 B;  3U9S A;  3E3X A;  4FXK C;  1EIF A;  2O2L D;  1HR0 Q;  1IXR A;  1G6Z A;  2B63 B;  1UAP A;  2VUM B;  1AN8 A;  2YTV A;  4YHH L;  4RAU C;  2FXQ A;  4G57 A;  3WDN A;  5KIX A;  2F0S A;  4LFB Q;  5M3M H;  4IFD J;  2KCT A;  4LJZ C;  2KOL A;  1G2S A;  5CYU A;  3HOY H;  1QOH A;  3CQZ B;  1BQQ T;  3G71 A;  1G91 A;  2OQK A;  3I4N G;  4A3M H;  2D0O A;  2RSN A;  1YZ6 A;  1K73 C;  2OT2 A;  2D9U A;  1U4M A;  3NTH A;  4JBJ A;  4OEL B;  1VQ4 A;  1EY9 A;  1XX8 A;  2JA6 H;  2LXK A;  1D7Q A;  3S9W A;  4CDC C;  1XPR A;  1H9J A;  3EJI A;  3FHW A;  1WTR A;  1HNX Q;  2MUY A;  2DN8 A;  1CA6 A;  1CKN B;  2HDL A;  5ELB A;  2F0T A;  1I6H B;  4BBS B;  3PF5 A;  2ZJR A;  2V1C C;  3BDL A;  1I50 B;  2F0F A;  3VA5 A;  5IGD A;  3N52 A;  2G5D A;  3SEB A;  4DU9 A;  4A3B G;  3BDC A;  1TWG B;  5CMD A;  2GVA A;  1WVL A;  3NHH A;  1EU3 A;  2L5T A;  4P72 A;  4B3S L;  1TY2 A;  2I07 B;  2AWO A;  4X3K A;  2K04 A;  3CCR A;  1PH1 A;  4WOR A;  2HIX A;  5H1S E;  4UHV A;  4JI0 Q;  1FGB D;  1D5M C;  3STB D;  3F2D A;  3DEO A;  2YYZ A;  3S2H B;  3K5L A;  1L2F A;  4H44 C;  2VQF L;  3KOJ A;  5IP7 H;  1S5D D;  3K7U C;  2B2Y C;  3OTO Q;  5E4X A;  2M2L A;  1QCB D;  4QGU A;  3JAM c;  1EU4 A;  1SLJ A;  3TME A;  5LMU Q;  2NN6 G;  2WII B;  2NZ1 D;  4JI3 L;  4K14 A;  4DV0 Q;  1YIJ A;  1Q3L A;  2CH4 A;  3KLR A;  1GHK A;  1ZEQ X;  3S17 B;  1TWA H;  5KYI A;  1GM5 A;  5ELC A;  1D5X C;  3A74 A;  3AYH B;  5IGB A;  4BBS G;  1F2M A;  1EYG A;  4YY3 L;  2A6H D;  3KLW A;  4IAL A;  1PDQ A;  3OOC A;  3HOW H;  1KAA A;  1QJO A;  1KQS A;  4JCV E;  1HQM C;  2KHJ A;  4GS3 A;  1JWS D;  5KNC A;  3H3V C;  2E74 C;  5FLX L;  3I4L A;  4B3M L;  3B6Y A;  2A6E C;  2DY7 A;  2BOS A;  3IRB A;  4GZY C;  2RCN A;  1GUS A;  1HFN A;  3MAQ A;  3J7Y W;  1A2U A;  4Q5V A;  3LX0 A;  4K6L A;  1N32 Q;  1B4O A;  2MP1 A;  3CPF A;  2HQL A;  2F0Q A;  3I4M G;  2ZT9 C;  1WTP A;  4JI1 Q;  5CV7 A;  3AU7 A;  5IYB H;  1JMC A;  3UDF A;  1VQF A;  1YI2 A;  4BBR B;  2BE5 C;  1PRT C;  1EWH A;  4OX9 L;  1VF5 C;  4OIJ A;  1RTN A;  3CAM A;  2XRS D;  3SK6 A;  2WKD A;  2FMM A;  2R7Z H;  2NN6 H;  1HCZ A;  2WKC A;  5COY A;  2Y0S G;  2P5Z X;  1SJH D;  2HQE A;  4KY6 A;  1PTO B;  2Z6B A;  2E2I H;  1XJV A;  4DV7 Q;  4EX5 A;  5D3I B;  1SBB B;  3RLO A;  1IYV A;  1F77 A;  4EQP A;  3BVZ A;  1WTW A;  3A54 A;  1LT5 D;  4NXM Q;  1ENA A;  4A3K H;  4DUY Q;  2DY8 A;  3PSI A;  1G29 1;  2LFN A;  1FNV A;  4RFB A;  3GTG B;  4A3D H;  4LNQ A;  4A3M B;  4X3T A;  1Q82 C;  3TP8 A;  4WJ3 M;  3HOX H;  1GHJ A;  5C0X G;  1AZP A;  5CGK A;  1STA A;  5LHY 1;  4LFA L;  1VQA A;  1E2W A;  3ULJ A;  1EZ6 A;  2JA8 H;  4J8Q A;  3RD4 A;  4OEM B;  4DR2 L;  1X3E A;  1J5E L;  5C4X B;  4DAV A;  1GO3 E;  3Q24 A;  4LF6 L;  4PMB A;  3T53 B;  1I4R A;  1AH9 A;  4S3S A;  4L5T A;  4LFC Q;  3GTM B;  1L1O A;  1ONL A;  1PTO C;  1TQO A;  2JYO A;  1A0I A;  2I5H A;  2Z6K A;  3I3C A;  1I50 H;  3MFG A;  2BDO A;  4IQZ A;  4DV1 Q;  3MHB A;  4ALP A;  5C0X J;  4C3H G;  4A75 A;  2E2J H;  1ICW A;  1I4G A;  2NWG A;  1V1Q A;  1L1O B;  4JBW A;  4APV A;  2Q2T A;  3PUZ A;  1IBL L;  2EYJ A;  1YHA A;  3Q6S A;  2WV6 D;  3ND8 A;  4K2K A;  4TQU S;  1D2B A;  2SNS A;  1PYB A;  3WOE A;  4UP9 A;  4RGN A;  3CMA A;  2B2W C;  1FD7 D;  1UE5 A;  5CV5 A;  1VQO A;  4LFC L;  4B3T L;  1E24 A;  1HHV A;  3PO3 B;  3MXN B;  1CHQ D;  5J22 A;  4MIU A;  1EY4 A;  2R93 B;  2K50 A;  4MN3 A;  4DPG A;  2A1A A;  4R4I A;  3CW2 C;  2EVB A;  4UAI A;  3SK4 A;  1PH9 A;  1K8G A;  4IOC A;  3U4Z A;  4JI4 L;  3KFU A;  1DZ1 A;  4BBR H;  4E6I A;  3LWU A;  3NP8 A;  4L8J A;  4DAP A;  4LF8 L;  5M5W H;  4NP5 A;  4HJA A;  2ASB A;  2F0U A;  1OXV A;  3T16 A;  2NVX B;  3L7Z C;  1SEB D;  1LTR D;  2L9H A;  1B1Z A;  4DXG A;  1C8C A;  5G3L D;  5FLX c;  1WD0 A;  1TU2 B;  2RDG A;  3C46 A;  4XT3 B;  4KN4 C;  1YNJ C;  3DM1 A;  4A3K B;  1KLU D;  1NR4 A;  4DV1 L;  4UP7 A;  1VQP A;  4LUV A;  3OWE B;  1VF7 A;  4X66 Q;  1QWY A;  1N36 Q;  1TWH H;  2JP1 A;  2PNR C;  3FEW X;  3FDT A;  4L6T B;  4JYA L;  2JJQ A;  2EJG C;  5LMN W;  2NZH A;  5M3M B;  4G7Z C;  3ULP A;  1RF2 D;  4A3J G;  3FKI H;  5GQO A;  3O13 A;  4RGT A;  1M90 C;  1AE3 A;  2JA7 B;  5IOD A;  4K5W A;  4JI5 Q;  5JEA H;  2MFI A;  4B3M Q;  1E7Z A;  4JI2 Q;  4V19 0;  3FP9 A;  5AFW A;  1NR2 A;  5ELN A;  3M4Y A;  1TS3 A;  5JVH 3;  3KBX A;  2JXM B;  3ITP A;  1JB3 A;  2B3G A;  3H09 A;  1YNJ D;  1VDZ A;  3P75 A;  1KAW A;  2CQO A;  3CC7 A;  4BBS H;  5IY0 A;  4IFD H;  2UUC Q;  1WFQ A;  1LT4 D;  1VQ5 A;  2KUM A;  3K0X A;  2NTT A;  3BVM A;  3F2B A;  3U4V A;  3BS1 A;  1LTI D;  3RUZ A;  1CHP D;  2QF7 A;  4C2M B;  2ZJP A;  4LWC A;  1MSH A;  1IBM Q;  4I65 A;  1QZG A;  5M3F B;  3PF4 A;  2GA4 B;  3GV3 A;  1RKN A;  1XNR Q;  4POF A;  4LK1 C;  2CW0 D;  5CV9 A;  2RDF A;  2J7Z A;  2MNA A;  5C3E G;  5C4J H;  3RN2 A;  5D65 A;  1MGS A;  2DGY A;  1MKH A;  1HTL D;  4IFD I;  4H13 C;  3QJY A;  3GTK H;  3S16 H;  2VB2 X;  2ZTD A;  3TP7 A;  4XIG S;  5CR3 A;  1B44 D;  5E3F A;  5DM7 3;  4N8F A;  3HOV H;  2UXB Q;  1GUT A;  1A3T A;  2LXJ A;  1K0R A;  1TS5 A;  2PNH A;  3HRZ C;  5IP9 H;  3CCS A;  2KJX A;  3KDF A;  1F2Y A;  3TZD A;  2HD3 A;  2RHS B;  3V05 A;  1LT3 D;  3M9B A;  4QIW B;  2H1E A;  1NNX A;  2QDB A;  4A3I B;  4LF4 Q;  5FO9 B;  1F9P A;  4CJ0 B;  2EZV A;  1CZG A;  4CJ1 B;  1DCZ A;  2UXC Q;  3J81 i;  2SNM A;  4HIM A;  1F9S A;  3E0E A;  4A3J B;  4ZRZ A;  4MZ9 A;  4ZKC B;  2CWA A;  3H0G B;  1I94 Q;  2N55 A;  5DAU A;  5C3W A;  3E6Z X;  1LM0 A;  3C1E A;  3DWQ A;  1CI3 M;  2TSS A;  1TWC H;  3CHB D;  4A3D G;  1KNA A;  1KRT A;  3ULL A;  3VYR A;  3S15 H;  1YIT A;  3GTQ B;  3VR2 A;  4U67 3;  3LNN A;  4KY7 A;  1SDF A;  4UY8 C;  5CBE E;  3TP6 A;  4POG A;  1PRT B;  4LAA A;  4NPS A;  1OXU A;  5IIF A;  1O7Y A;  3OIQ A;  4KHV A;  3SXH A;  3C1F A;  1CSQ A;  1S5F D;  4R8I A;  1VQG A;  1TWA B;  5AJ3 Q;  2F52 A;  3IKJ A;  5C3E B;  3DWA A;  4IO9 A;  2NVX H;  2EYP A;  4DV2 L;  5A2Q L;  2Z4I A;  3WOF A;  1S5B D;  2XGT A;  2EOT A;  2L1B A;  1FNW A;  2R7Z B;  4QJF A;  1G2T A;  1A63 A;  4LF9 L;  3NE5 B;  3EIV A;  2IW3 A;  3M3Y H;  1Q1E A;  2R61 A;  1C0A A;  1R4P B;  2IJ0 A;  5FOB B;  1EY7 A;  5JJL A;  3ZYY X;  2OTL A;  2I46 A;  1NSN S;  1C48 A;  1EQT A;  2B2U A;  2QCP X;  3V96 A;  4AQY L;  4DFA A;  4Y7N H;  2CFM A;  4P71 A;  1TVX A;  3A7A B;  4ZQ3 A;  1JWM D;  2K5D A;  1X65 A;  1NMG A;  4O1N A;  2ATW A;  3S1Q H;  3HOX G;  1T5X D;  1V1O A;  2K03 A;  4H7B A;  1Y14 B;  3TEH B;  5JJZ A;  4JYA Q;  4B08 A;  4U68 A;  5GAH C;  2JA8 B;  4BXX H;  3DMU A;  2O5J C;  3H15 A;  4IUU A;  1JR0 D;  4C1N I;  2JA6 G;  5M9O A;  1HH2 P;  1S4Z A;  1I6V C;  3LGJ A;  1KRS A;  3ND9 A;  4Y52 H;  4OIK A;  2EDG A;  4HCS A;  4KY5 A;  4X64 L;  3ERO A;  1SYD A;  2VXW A;  1PFM A;  1Z9F A;  3CKI B;  3HGB A;  1BR9 A;  5E1F A;  3U50 C;  1WTQ A;  2EXD A;  2NTS A;  3A8K E;  2ICE C;  3U58 A;  5IGG A;  2ZXP A;  1E2V A;  2H5X A;  3BVG A;  3PUX A;  1I4X A;  3CP0 A;  1X32 A;  4CHT B;  3AFQ A;  1C9O A;  3S2D B;  2E2D C;  2AQ1 B;  2KVM A;  3CCM A;  1R9T B;  1D1K A;  1EIY B;  2KBN A;  4WFN 3;  2Q2U A;  3E0J A;  4DR6 L;  3PCO B;  4B3R Q;  1MI2 A;  3GTK B;  1EYA A;  5C4X H;  1PH3 A;  1LTB D;  1D8L A;  3FKI G;  4EQ5 A;  4DR7 Q;  4EGV A;  1Q86 C;  4IPD A;  2I5L X;  4L63 B;  2MGS A;  4AYB G;  1ESR A;  2IHF A;  3TS2 A;  1VQC A;  4JV5 L;  2MO0 A;  2RQX A;  2YV5 A;  4AYB E;  4A3I H;  3P1H A;  4X65 L;  1CQF A;  1V1P B;  3CU7 A;  4A93 G;  5EPJ A;  3J7Z C;  3GTP H;  1BVS A;  4KLK A;  3C2P A;  3PO2 G;  3D3R A;  4KKU A;  4EVO A;  2F4V Q;  2NN6 I;  3OYY A;  4K8J A;  5IT9 c;  1VQK A;  4K2L A;  4BS9 A;  1HA6 A;  4IPH A;  3I7F A;  1J6Q A;  4NXN Q;  1VQE A;  1HZ9 A;  3G4S A;  1PV4 A;  1LAC A;  2G9D A;  2B2V A;  4A3L H;  2BA1 A;  3R2T A;  2IY5 B;  1EY6 A;  4BY7 G;  4IZ8 A;  1TWC B;  4GLA C;  1ASZ A;  1Y1V H;  3RN5 A;  1PHJ A;  5C3X A;  1V8Q A;  4IUR A;  1Q8K A;  2D62 A;  2F0W A;  2F0P A;  5T1G A;  5JPN C;  1DON A;  3I91 A;  4JI4 Q;  1BCP F;  1W6J A;  4HED A;  1B50 A;  1QUQ A;  2DNE A;  1B53 A;  3CCU A;  3TRZ A;  4K0K L;  4B9X A;  2B8F A;  5IYB G;  4I7Z C;  3S14 H;  4C3I B;  1DOM A;  5FKA C;  1TII D;  4XQJ A;  5C3E H;  3FKI B;  1E1O A;  4J15 A;  4DR3 L;  1PH2 A;  3VYS A;  2DUD A;  4A3G G;  1QB5 D;  4AH6 A;  1GUN A;  1QVC A;  5FO7 B;  2JE6 I;  3GQB A;  1IBK L;  1ZYR D;  3RZD H;  3PIO 3;  3EA6 A;  1WJJ A;  2HDM A;  3DHQ A;  4DR1 L;  3H3V H;  3A55 A;  2NZO A;  2VQE Q;  1MJC A;  3G48 A;  1HUN A;  4NW2 A;  3T1H L;  1CFM A;  2LS0 1;  3NK9 A;  3D0F A;  1CZW A;  3HOY B;  3CRK C;  2ALY B;  3IAY A;  1BKB A;  1I3Q B;  1EQR A;  1SYB A;  3J81 j;  3I56 A;  5LMN L;  1YNN C;  3OPO A;  3SHL A;  1S72 A;  5I4D A;  4HN7 A;  2LY7 A;  1RTO A;  1M1K C;  2XNA C;  1PZK D;  4EQO A;  3M7N A;  4GKJ Q;  2RCF A;  1LYL A;  2CW0 C;  3I4M B;  2E76 C;  1VS0 A;  3OMC A;  1M8A A;  4A3C G;  2PW5 A;  4G4K A;  1HFG A;  1HNW L;  3N6R A;  1F9Q A;  2K5H A;  1I6H H;  3JC6 6;  4P74 A;  3OW7 A;  2IT1 A;  4NDX A;  4C3H H;  4K6D A;  1YJN A;  5JVG 3;  3I55 A;  5IT9 L;  1X3Q A;  1NCV A;  5KNB A;  1S5E D;  2ICI A;  3DXJ C;  2L11 A;  5EKI A;  1TWG H;  4MNO A;  3S1M B;  1WD1 A;  1UE7 A;  1VQM A;  2XVS A;  1X9N A;  4DV2 Q;  3S1R B;  2OWO A;  4DR1 Q;  3E5S A;  3W3A A;  1GVP A;  4C2M H;  5JEA J;  2WAQ E;  3HOW B;  3W1B A;  4HR7 B;  1MIU A;  2OTJ A;  1HZB A;  4AIM A;  1SE4 A;  4LUZ A;  2A73 B;  2B8G A;  4DAM A;  4X6A H;  3HOU G;  1FGU A;  3CXC A;  4ME5 A;  5FLM G;  4GKK L;  4FF2 A;  1T5E A;  1B9N A;  1DOL A;  4RCN A;  3KF6 A;  4GN3 B;  3NEN A;  5LL6 S;  4X62 Q;  5C4J B;  3BYT B;  4KV6 A;  4B3R L;  1XXG A;  4DKA C;  4JBM A;  4OO1 G;  1HNZ Q;  1H95 A;  3FPU B;  1SE8 A;  2NVQ B;  4WJW A;  2PQA B;  2AQ2 B;  1PLF A;  4X3U A;  3EVQ A;  4OGQ C;  2WIN B;  2BH8 A;  2PMZ E;  3GTL H;  3SK5 A;  4OHJ A;  2CWP A;  1JE4 A;  3A0J A;  3H91 A;  1JC7 A;  3ONA B;  1IKL A;  1Q90 A;  2HCC A;  2F0N A;  4X64 Q;  4CKE A;  2A19 A;  2IPK D;  2JEA I;  4PZ8 A;  2F4V L;  3C3L A;  2KED A;  4NB3 A;  1BBX C;  2B63 H;  1XMQ Q;  4XTC S;  1S40 A;  4PQX A;  3IFT A;  3TDQ A;  2SDF A;  2OQ0 A;  2H4O A;  2NYZ D;  2WAC A;  3GDE A;  3CME A;  4QF4 A;  5EKK A;  4DV4 Q;  2F0J A;  2A5H A;  1YNX A;  1KDA A;  1SYF A;  2Q2H A;  3GTO B;  1NAP A;  4P2C B;  3KUP A;  4KHP Q;  4BY1 H;  1P8L A;  2VZA A;  1C4Q A;  2I5M X;  1ROD A;  1WI5 A;  1IBM L;  2PZU A;  1IL2 A;  2C5C A;  2E2I B;  2UUA L;  5C44 H;  1UNS A;  5CV6 A;  3I2Z A;  1WOC A;  1KC8 C;  5IWA Q;  2JK8 A;  2Y0S B;  4DUY L;  1QNK A;  3QG1 A;  1KD1 C;  4HSV A;  4FXD A;  4KI0 A;  4B9W A;  3DWP A;  1EYC A;  1JIC A;  3TS0 A;  1HR0 L;  1I4Q A;  4HCE A;  3S1M H;  4PZ6 A;  4BWG B;  1SXT A;  5DM6 3;  1OTC A;  3HOU B;  4X3S A;  3R3O A;  3CC2 A;  3KLS X;  4A3B B;  4GOP C;  4DV6 Q;  2J0T D;  4PV1 C;  2L4N A;  3PQI A;  5KYL A;  1HNW Q;  3RLF A;  1K0S A;  5EJW A;  3S1Q B;  1TT2 A;  1PFN A;  2HIV A;  4DF7 A;  2YTY A;  1K9M C;  2XN9 C;  3K7A B;  2NVY B;  3EQL C;  1LLR D;  2ZJQ A;  2E8G A;  4ABN A;  5LL6 X;  2SOB A;  3STB C;  2K6A A;  1EIH A;  4A3E B;  3SGI A;  4A4I A;  2ZTC A;  3D6W A;  3Q22 A;  1KIX A;  1VQN A;  1Y1W B;  3KJO A;  1V43 A;  3OSO A;  1XMQ L;  5IYC H;  3ERQ A;  1BOS A;  5F2D A;  3CD6 A;  2BCO A;  4L5Q A;  1SNO A;  3U9O A;  2O5I C;  3TN2 A;  5FLX E;  1YHB A;  2N88 A;  1CTM A;  4Q0F A;  5GAG C;  2EY2 A;  4KD3 A;  3P7J A;  1MBY A;  2C35 B;  3UI2 A;  1CKN A;  3S2D H;  4KJO A;  4ZAI A;  3MXU A;  3X3N A;  3HOZ G;  3GV6 A;  2CQA A;  1IYJ B;  2Z0S A;  2UXB L;  1R9T H;  5COR A;  1NTG A;  2B2Y A;  5C0X H;  4A76 A;  1XNQ Q;  3NBH A;  1I5F A;  2JA8 G;  1RJT A;  4DGZ A;  1N8R C;  2F0K A;  2IX3 A;  1BCP B;  2A69 C;  1EY8 A;  4JG2 A;  4X62 L;  1A8V A;  3OTO L;  2VQF Q;  4XYQ A;  1LTG D;  1S3O A;  1PH7 A;  2E2H H;  1X6O A;  3UE1 A;  2JA5 G;  4LMQ D;  1VQI A;  3AEV A;  3PUY A;  2R7F A;  2RBM A;  1AFP A;  1LO5 D;  1XTC D;  1PH6 A;  1VQJ A;  5C5M A;  4DNT B;  1OXX K;  1GKH A;  4QCL A;  2EXZ A;  2ZXO A;  5FJ8 H;  1L0X B;  3T51 B;  2QW7 A;  1QIL A;  1CSP A;  3MEH A;  4JPB W;  4DNR B;  1CKM A;  4RGM A;  1SE3 A;  3I73 A;  3QIA A;  4KJN A;  4FYD A;  4K5V A;  2K14 A;  1J8I A;  4BY7 B;  2M9V A;  2F0O A;  3SK8 A;  2KCM A;  2FFK B;  2A68 D;  2K01 A;  2XIW A;  4IJL A;  1Q8I A;  1HXY D;  1FJG L;  4XDX A;  1OO9 B;  3NXW A;  4RCO A;  1Q7Y C;  3M4Q A;  2EIF A;  4HJ5 A;  2MHV A;  4ILW A;  4QUC A;  3RZO B;  2RSO A;  1N9W A;  4C3I H;  3T1Y L;  2Z4H A;  4BXX G;  2EY6 A;  4JI7 Q;  4OO1 I;  4QIW E;  2KCC A;  3J7A 5;  3OIP A;  2NVY H;  3HKZ G;  1I4P A;  1BDO A;  3KDF B;  4DAY B;  2Z8L A;  4RA8 A;  1N33 L;  2A8V A;  5ELD A;  4O42 A;  4DXF A;  4A3E H;  3FRP B;  1N36 L;  1Q1B A;  3DLL A;  2AKW B;  1FVI A;  4LF5 Q;  4DK3 C;  3TSS A;  3D8G A;  3KF8 A;  4C3J H;  1A62 A;  1K28 A;  4ZKB B;  4NXM L;  4K8I A;  3FVQ A;  3T56 B;  2R92 B;  4V0B A;  2I0Q A;  3MVV A;  4DV5 Q;  1UEB A;  3MXG A;  3RR5 A;  1M4V A;  1V9P A;  1I3Q H;  2WB1 B;  1Z7T A;  4LF8 Q;  2Z6K C;  2VB3 X;  3KLS A;  1UE1 A;  1L0W A;  5IOC A;  3I4N B;  1EWI A;  1TS2 A;  1B2T A;  1SE2 A;  4O2D A;  4RKB A;  4A3F B;  4CGY B;  3M4O H;  2EPB A;  2YU9 B;  4P73 A;  3L3O C;  4JI1 L;  1XYI A;  2CKZ B;  1GUO A;  4GLV B;  5E4W C;  4IOA A;  2D2C C;  5FLM H;  1DGS A;  1DXM A;  1K3R A;  1LAB A;  3KBG A;  4DR2 Q;  4LUO A;  4ZCK A;  5J1Z A;  1JB7 A;  3NWT A;  4OWW B;  1UE6 A;  3HOV G;  3GO5 A;  4DR6 Q;  1GJX A;  4IN3 A;  2M00 A;  4DR4 Q;  1K8A C;  4A93 H;  2JSO A;  3VYT A;  4M8A A;  1Q46 A;  4YWM A;  5KND A;  2F0I A;  1ET9 A;  1XWE A;  2KEC A;  3MTS A;  3K5N A;  2NVQ H;  4GN5 A;  4R4C A;  2R92 G;  3KK7 A;  2OF1 A;  3VR6 A;  3E9I A;  4DV5 L;  1EEI D;  2VQE L;  3K57 A;  1B9M A;  3M3Y B;  5CC4 A;  2VUM H;  3J80 c;  1PRT F;  1O7L A;  1SFO H;  1TR5 A;  4F87 A;  5FK9 C;  3A5U A;  5M5X B;  4FDB A;  1VQH A;  2WFW A;  2NVT H;  1RD9 D;  4JI8 Q;  2PW7 A;  3BZK A;  5K36 H;  5NUC A;  4OXP A;  4TKO B;  1FNU A;  3NTK A;  3R2I A;  1JT8 A;  1PYW D;  2F0V A;  3T1Y Q;  3I72 A;  4A3G H;  4DV3 Q;  2TMP A;  4ZUJ A;  1MSG A;  2D0P A;  2DNC A;  3OMG A;  1JE5 A;  1NY4 A;  3K5M A;  4ULL A;  1E3P A;  4YCU A;  5IP9 G;  1I94 L;  3PO2 B;  4IUN A;  1IZ6 A;  3HS0 C;  3FMC A;  2WAQ B;  1PVO A;  4JW0 A;  2MJ8 A;  1SSO A;  1U9R A;  1YJW A;  4UPA A;  2LKV A;  1EIG A;  4DV7 L;  1VQ7 A;  1JCK B;  1T9H A;  2F3V A;  3A8I E;  5I9P A;  3V2T A;  4JVZ A;  4HAE A;  2FMC A;  2GN5 A;  4CJ2 C;  1Q12 A;  5IYD H;  3QWN A;  1TWH B;  1S5C D;  5K5P A;  3R93 A;  1HNZ L;  2ES2 A;  1JOO A;  2PPB C;  1R4Q B;  3GTO H;  2K32 A;  2YU9 H;  4DR7 L;  2PZT A;  5I9O A;  1J5E Q;  2JA7 G;  1PA6 A;  3CCE A;  1NE3 A;  1OXS C;  4BA2 I;  3PO3 G;  2K5Q A;  3HKZ B;  2FIN B;  5D14 A;  2VS1 A;  1X3P A;  4ZYS A;  1WTO A;  4TVA B;  4N9P A;  2AHO B;  4R4O A;  5DLQ E;  1ESF A;  3MWY W;  1SJE D;  3J81 E;  3ZJY C;  1QVF A;  5M5Y B;  3M7G A;  2EY5 A;  4DV6 L;  2J4X A;  4YHH Q;  4YCW A;  4JOI C;  5GAD C;  1HR0 W;  3MEF A;  1KXL A;  2E5L L;  3D6C A;  4DUZ Q;  2Q8T A;  4LF9 Q;  1XPU A;  3QOJ A;  3MC0 B;  1YHQ A;  1QUQ B;  1K83 B;  3M85 A;  1TWF B;  2F0M A;  2K7V A;  5IWA L;  1Y69 U;  5T1I A;  1EWC A;  1D5Z C;  1E1T A;  2RVL A;  3PIO A;  1YBY A;  2F0H A;  1XMO L;  3D4R A;  1B3Q A;  3VA7 A;  5AJ3 L;  1ASY A;  2F3W A;  4XXE A;  4DV0 L;  3S1N H;  4DNI A;  1K8M A;  3BZC A;  5LMU L;  1PTO F;  1WTH A;  5C0X I;  4A3J H;  2F3I A;  4PMC A;  1AZQ A;  2UXD L;  3CF5 A;  4YIJ A;  3DUZ A;  2R93 G;  5BR8 Q;  4UP8 A;  1CM9 A;  4DN4 M;  1F9R A;  3H0G G;  4DV4 L;  1O7I A;  3TZU A;  1B3A A;  2K4K A;  2QGQ A;  2A69 D;  4KK7 A;  5LMN Q;  4X66 L;  4B3S Q;  1LT6 D;  5CBA E;  4AQY Q;  3NBH B;  3PO2 H;  4J1M A;  2AUJ D;  3QOL A;  4YWL A;  1UWV A;  3CPW A;  2KEE A;  3W2D A;  2HT1 A;  3RNU A;  1H9S B;  3CCQ A;  3NQT A;  4LF4 L;  4R1J A;  1DM0 B;  1QVG A;  1B70 B;  5JAV A;  1SNM A;  1C7Y A;  1ILQ A;  2A6E D;  5KRU A;  4IPC A;  1U4P A;  4PMW A;  2X69 A;  5I6W A;  2CCZ A;  4O0A A;  4DUZ L;  1KTK A;  4HMJ A;  4CDF C;  2EYM A;  3HOZ B;  2MO1 A;  1K3B C;  1JJC B;  4JI2 L;  3K80 C;  3GTG H;  4A3D B;  1HZC A;  1PH4 A;  1HA5 A;  4KHZ A;  3HOY G;  2XSC A;  4YWK A;  3VR3 A;  4LW1 A;  4HID A;  2PI2 E;  3CQZ H;  1VQB A;  3HG9 A;  1ICF B;  1QZH A;  3I4O A;  4ODG A;  4A3M G;  1Q81 C;  4PZ7 A;  2JA9 A;  1PMR A;  3F2C A;  4N8X 1;  2PMZ B;  3SE0 A;  1BBW A;  2JN4 A;  1STB A;  2XWJ B;  4CDE C;  1EY0 A;  1LTT D;  1SNP A;  2Z1C A;  5CV4 A;  2QDL A;  3PIP 3;  5EBC A;  1X54 A;  2PQE A;  5J39 A;  2B2U C;  2RA4 A;  4L5R C;  2UXC L;  4A3L G;  2R6G A;  1MD2 D;  1WYD A;  4BY7 H;  1RDP D;  1PH8 A;  1Y8N B;  3MXP A;  4F88 A;  2R92 H;  4X65 Q;  4HMI A;  4JV5 Q;  3KF6 B;  3I70 A;  1ENC A;  2K1B A;  3AFP A;  4Y7N B;  4FVM A;  3L0O A;  2GVB A;  2K5V A;  1P16 A;  1L1O C;  5EQ0 A;  5KGU A;  2NUC A;  1GOZ A;  4DA2 A;  5M3F G;  1EOV A;  4GKJ L;  3VR5 A;  1VCI A;  2EY1 A;  1W2B A;  1SRU A;  2BH2 A;  4RMF A;  1STH A;  1NUC A;  2B2W A;  3GTM H;  3M4O B;  5K36 G;  4A3C H;  3AMU A;  3UE0 A;  2KEN A;  2PYK A;  1QNU A;  1VMC A;  1KDC A;  4GKK Q;  2FHT A;  1HZA A;  3PUW A;  2E2J B;  1F2Z A;  1RHP A;  1JJG A;  2QKI C;  3NSW A;  3UDX A;  4RHR A;  3BZD B;  3T1H Q;  2EE1 A;  2KCN A;  1U0L A;  2JQO A;  2L15 A;  3S24 A;  4GLX A;  2R3Z A;  3HKS A;  3NUC A;  1JJ2 A;  1IHZ A;  4XT1 B;  2Z9H A;  4JC0 A;  1IBK Q;  4CDD C;  1V1P A;  4UDU C;  1JQY D;  1H9S A;  3IL8 A;  4DR5 L;  2SEB D;  2QEX A;  2ID0 A;  2ZTE A;  5KEE A;  1PFS A;  2A6H C;  2KA7 A;  3HOZ H;  3HEJ A;  1B8A A;  4DR4 L;  1ML0 D;  2ZM6 Q;  3R8B A;  3HZX A;  4DK1 A;  5HGT A;  3ICE A;  2L55 A;  4R4Q A;  2C9O A;  3ER0 A;  3AB9 A;  2EJF C;  1BF4 A;  4OO1 H;  5GRO A;  2NVT B;  1TY0 A;  1N32 L;  2OXP A;  3DM3 A;  4G7O C;  3MFY A;  2O4X A;  2K28 A;  3P20 A;  2JA7 H;  3MA2 B;  1FJG Q;  3MXN A;  4QL5 A;  1RCV D;  2F0L A;  1AEX A;  4JOI A;  3X3M A;  3HP3 A;  1SYE A;  3GP7 A;  3CRL C;  3D31 A;  1SMY C;  3OHX C;  5C5L A;  5EKL A;  2G9H D;  4KKT A;  1B7Y B;  4JI6 Q;  4L5S A;  5JJK A;  1JWU D;  1ZYR C;  4P75 A;  1BCP D;  4R8N A;  4CKB A;  2B63 G;  3JAM i;  4HJ8 A;  1QG7 A;  1Y1V B;  2B39 A;  1EFI D;  1SFO B;  1UUP A;  4HJ9 A;  3W5O A;  3HOU H;  1IL8 A;  4CBV A;  1SAP A;  3EN2 A;  1DD2 A;  1LTS D;  2UU9 L;  1VQL A;  1CUK A;  3I8Z A;  1HRJ A;  4RH6 A;  1KNE A;  4OX9 Q;  4C3I G;  2D5D A;  5ELF A;  3D4W A;  1SR3 A;  2IL8 A;  2JA5 B;  4FF1 A;  2UUB L;  3K59 A;  2UUB Q;  4LFA Q;  3TBI B;  4M1U B;  1KHI A;  3PMF A;  5J3B A;  1BO0 A;  5IGE A;  3MZ5 A;  2Q8R E;  3J7A V;  1SN8 A;  3BJU A;  1STN A;  5IGF A;  5CV8 A;  4FNF A;  3K6O A;  2UU9 Q;  1Y1W H;  2HUG A;  1PTO H;  2X6G A;  4G7H C;  1ZKO A;  4ME3 A;  2XRQ D;  2WAQ G;  5FO8 B;  1HPC A;  5GAE C;  3VR4 A;  4A3B H;  2OCE A;  3I90 A;  4JI6 L;  3J80 E;  3PUV A;  1K83 H;  1YEZ A;  2QIL A;  3KYH C;  1EYD A;  1LTA D;  3SR1 A;  3H94 A;  4ZK9 B;  4MHE A;  3FPP A;  4JI3 Q;  1VQ9 A;  3K7A H;  3L9A X;  1A6X A;  4FF4 A;  2EYH A;  5IP7 G;  4BY1 G;  1KL9 A;  3H3V I;  1RL2 A;  3CCJ A;  2MPM A;  4KD4 A;  4IPG A;  1H9M A; 
#chains in the Genus database with same CATH homology
 2A74 C;  1O80 A;  1FR3 A;  5D3D A;  4NKL A;  2PCF B;  2F0E A;  5ISR A;  2QEJ C;  1VMP A;  4J6H A;  1GUW A;  3A7L A;  1DJR D;  4K5X A;  3J80 L;  4FXG C;  5I2X A;  2BE5 D;  1PRT D;  5TSS A;  1JOR A;  3GTL B;  1PZJ D;  3SVM A;  1E0B A;  1HUM A;  4BA1 I;  5ELE A;  2EJM A;  4RGO S;  3SDZ A;  4NMZ A;  1LV9 A;  3Q23 A;  3PV0 A;  2JEB I;  3S15 B;  1Z47 A;  2E75 C;  4FF3 A;  5G3L F;  2E2H B;  4ID6 A;  1PFB A;  1A15 A;  4AYB B;  1EZ8 A;  5HUR A;  3JAM E;  4BY1 B;  1EY5 A;  3A56 A;  4IUQ A;  4IUV A;  1BCP C;  4C3J B;  2F1M A;  1I4H A;  1KLG D;  2AWN A;  3NBI A;  2HCI A;  2CHB D;  5C4H A;  2LMC B;  1PXU A;  5JOB A;  2F03 A;  3NTI A;  2RDH A;  1Y8P B;  4IFD G;  1SNQ A;  5BN4 A;  2NB0 A;  3Q0A A;  1CQV A;  3EFX D;  4R9W A;  4TRD A;  2JA6 B;  1AW7 A;  3GTJ B;  1EEF D;  2V4D A;  2B2T A;  1K8O A;  2NBF A;  2VNU D;  1CA5 A;  3BG3 A;  3URY A;  2F0G A;  2BDN A;  4QUF A;  3S16 B;  1W6K A;  5IT9 E;  3RMH A;  4EQN A;  4XQQ A;  1SYC A;  1IW7 C;  4ZLT F;  3VYU A;  1WTX A;  5BN5 A;  1KDB A;  1HQR D;  2K5W A;  3NQI A;  4F7X A;  4C1N K;  4FP5 D;  4KKS A;  2FJ2 A;  1D1I A;  2RKS A;  1H9R A;  3TP5 A;  3OWF A;  4A93 B;  4IUP A;  2CVR A;  2Q8I B;  3S14 B;  1ET6 A;  2EYL A;  2PO4 A;  1BXT A;  2XWB B;  3HOV B;  2B2V C;  3GTP B;  5A35 A;  4KN7 C;  1WTV A;  4N9T A;  1E2Z A;  5EBD A;  4F8M A;  3BYY B;  1IW7 D;  4QB4 A;  2KHS A;  4TSS A;  3RZD B;  1G8Z D;  1BNZ A;  1TS4 A;  1EQV A;  1TKW B;  3QO2 A;  1UEA B;  1II3 A;  4WRD A;  1SMY D;  4RWS C;  1ILP A;  1AP0 A;  2F4I A;  2IX0 A;  1U4L A;  1H9K A;  1L0Y B;  5I6Y A;  3NWS A;  2L0C A;  1SND A;  1PZI D;  4CKC A;  4HSP A;  5C6A A;  1OXT A;  3QB3 A;  1IKM A;  4A3G B;  3G7L A;  3T4A C;  2PZW A;  3NPP A;  5EGT A;  4H0L C;  1ENF A;  1EOT A;  3BDO A;  4DAY A;  5JEA G;  4HTH A;  5EPL A;  4RKL A;  1STE A;  1STY A;  1STG A;  5DEH A;  4C3H B;  2K33 A;  4JK1 C;  4XYO A;  1QE6 A;  4IUT A;  1HTP A;  2AQ3 B;  1O78 A;  3K0Y A;  1F2L A;  3GD7 A;  1Y8O B;  1Z6H A;  1ZXT A;  2K05 A;  1YNN D;  4PNY A;  1WCM B;  2F0D A;  5EPK A;  3HOX B;  1J9O A;  3S1N B;  3JAM L;  5JPM C;  2AUK A;  1U4R A;  2IWH A;  1KAB A;  1GXD C;  1EL0 A;  4DK0 A;  2L12 A;  4ZUI A;  3DEP A;  1O7Z A;  3G6J B;  1CK1 A;  1PTO D;  4OL7 A;  2KQ3 A;  3K5O A;  5A2Q E;  4Z9C B;  3J7A F;  2EYF A;  3H6M A;  1D6E C;  4FO2 A;  4C56 C;  1A3V A;  5DNF A;  3K58 A;  2EYO A;  4QMG A;  1FYC A;  4KTA A;  4KMU C;  1SNC A;  2ZXR A;  2WP8 J;  5C4Z A;  5IGC A;  4XQN A;  1IYU A;  1CT1 D;  2ENB A;  5BN3 A;  5I2Y A;  1A2T A;  1JOK A;  2A68 C;  2IX1 A;  1DYQ A;  1BUV T;  3T13 A;  3F2U A;  3A8J E;  2OEO A;  3IFD A;  4RHS A;  1DOK A;  2B2T C;  5M5W B;  4C3J G;  3J81 L;  3D4D A;  3LWE A;  1A3U A;  2X6L A;  2BA0 A;  1GUG A;  1SYG A;  1JOQ A;  5C44 B;  3U9S A;  4FXK C;  2O2L D;  1G6Z A;  2B63 B;  1UAP A;  2VUM B;  1AN8 A;  4RAU C;  4G57 A;  3WDN A;  5KIX A;  2F0S A;  4IFD J;  4LJZ C;  2KOL A;  1G2S A;  5CYU A;  1QOH A;  3CQZ B;  1BQQ T;  1G91 A;  2RSN A;  2OT2 A;  2D9U A;  1U4M A;  3NTH A;  1EY9 A;  1XX8 A;  3S9W A;  1H9J A;  3EJI A;  1WTR A;  2MUY A;  2DN8 A;  1CA6 A;  2HDL A;  5ELB A;  2F0T A;  1I6H B;  4BBS B;  3BDL A;  1I50 B;  2F0F A;  3VA5 A;  5IGD A;  3N52 A;  3SEB A;  4DU9 A;  3BDC A;  1TWG B;  5CMD A;  1WVL A;  3NHH A;  1EU3 A;  2L5T A;  1TY2 A;  2I07 B;  2AWO A;  4X3K A;  2K04 A;  4WOR A;  1FGB D;  1D5M C;  3DEO A;  2YYZ A;  3S2H B;  3K5L A;  4H44 C;  1S5D D;  2B2Y C;  5E4X A;  2M2L A;  1QCB D;  1EU4 A;  3TME A;  2NN6 G;  2WII B;  2NZ1 D;  4K14 A;  1Q3L A;  3KLR A;  1GHK A;  1ZEQ X;  3S17 B;  5KYI A;  5ELC A;  1D5X C;  5IGB A;  1F2M A;  2A6H D;  4IAL A;  1PDQ A;  3OOC A;  1KAA A;  1QJO A;  1HQM C;  1JWS D;  5KNC A;  3H3V C;  2E74 C;  5FLX L;  3I4L A;  2A6E C;  2DY7 A;  2BOS A;  4GZY C;  1GUS A;  1HFN A;  3MAQ A;  3J7Y W;  1A2U A;  4Q5V A;  3LX0 A;  4K6L A;  1B4O A;  2MP1 A;  2F0Q A;  2ZT9 C;  1WTP A;  5CV7 A;  3AU7 A;  4BBR B;  2BE5 C;  1PRT C;  1EWH A;  1VF5 C;  4OIJ A;  1RTN A;  2XRS D;  3SK6 A;  2WKD A;  2FMM A;  2NN6 H;  1HCZ A;  2WKC A;  5COY A;  1SJH D;  2HQE A;  4KY6 A;  1PTO B;  5D3I B;  1SBB B;  1IYV A;  1F77 A;  4EQP A;  3BVZ A;  1WTW A;  3A54 A;  1LT5 D;  1ENA A;  2DY8 A;  1G29 1;  2LFN A;  1FNV A;  4RFB A;  3GTG B;  4A3M B;  4X3T A;  3TP8 A;  1GHJ A;  5C0X G;  1AZP A;  5CGK A;  1STA A;  5LHY 1;  1E2W A;  1EZ6 A;  4J8Q A;  3RD4 A;  5C4X B;  4DAV A;  3Q24 A;  4PMB A;  3T53 B;  1I4R A;  4S3S A;  3GTM B;  1ONL A;  1PTO C;  1TQO A;  2JYO A;  3I3C A;  3MFG A;  2BDO A;  4IQZ A;  3MHB A;  5C0X J;  4C3H G;  1ICW A;  1I4G A;  2NWG A;  4JBW A;  3PUZ A;  2EYJ A;  3Q6S A;  2WV6 D;  3ND8 A;  4K2K A;  4TQU S;  1D2B A;  2SNS A;  3WOE A;  4RGN A;  2B2W C;  1FD7 D;  5CV5 A;  1HHV A;  3PO3 B;  1CHQ D;  5J22 A;  4MIU A;  1EY4 A;  2R93 B;  4MN3 A;  2EVB A;  4UAI A;  3SK4 A;  1DZ1 A;  4E6I A;  3LWU A;  3NP8 A;  4L8J A;  4DAP A;  4NP5 A;  2F0U A;  1OXV A;  3T16 A;  2NVX B;  3L7Z C;  1SEB D;  1LTR D;  2L9H A;  1B1Z A;  4DXG A;  1C8C A;  5G3L D;  1WD0 A;  1TU2 B;  2RDG A;  3C46 A;  4XT3 B;  4KN4 C;  1YNJ C;  3DM1 A;  4A3K B;  1KLU D;  1NR4 A;  3OWE B;  1VF7 A;  1QWY A;  2JP1 A;  2PNR C;  3FEW X;  3FDT A;  4L6T B;  2EJG C;  5M3M B;  4G7Z C;  1RF2 D;  3O13 A;  4RGT A;  2JA7 B;  5IOD A;  4K5W A;  5JEA H;  4V19 0;  5AFW A;  1NR2 A;  3M4Y A;  1TS3 A;  5JVH 3;  3KBX A;  2JXM B;  3ITP A;  1JB3 A;  3H09 A;  1YNJ D;  1VDZ A;  3P75 A;  4IFD H;  1LT4 D;  2KUM A;  2NTT A;  3BVM A;  3BS1 A;  1LTI D;  3RUZ A;  1CHP D;  2QF7 A;  4C2M B;  1MSH A;  4I65 A;  5M3F B;  2GA4 B;  3GV3 A;  1RKN A;  4LK1 C;  2CW0 D;  5CV9 A;  2RDF A;  2J7Z A;  5D65 A;  1MGS A;  1HTL D;  4IFD I;  4H13 C;  3QJY A;  2VB2 X;  3TP7 A;  4XIG S;  5CR3 A;  1B44 D;  5E3F A;  5DM7 3;  1GUT A;  1A3T A;  1TS5 A;  3HRZ C;  2KJX A;  1F2Y A;  3TZD A;  3V05 A;  1LT3 D;  4QIW B;  2H1E A;  2QDB A;  4A3I B;  5FO9 B;  1F9P A;  4CJ0 B;  2EZV A;  1CZG A;  4CJ1 B;  1DCZ A;  2SNM A;  1F9S A;  4A3J B;  4ZRZ A;  4ZKC B;  3H0G B;  2N55 A;  5DAU A;  5C3W A;  3E6Z X;  3C1E A;  3DWQ A;  1CI3 M;  2TSS A;  3CHB D;  1KNA A;  3VYR A;  3GTQ B;  3VR2 A;  4U67 3;  3LNN A;  4KY7 A;  1SDF A;  5CBE E;  3TP6 A;  1PRT B;  4LAA A;  1OXU A;  5IIF A;  1O7Y A;  3OIQ A;  4KHV A;  3SXH A;  3C1F A;  1S5F D;  4R8I A;  1TWA B;  3IKJ A;  5C3E B;  3DWA A;  2EYP A;  5A2Q L;  2Z4I A;  3WOF A;  1S5B D;  2EOT A;  2L1B A;  1FNW A;  2R7Z B;  1G2T A;  3NE5 B;  2IW3 A;  1Q1E A;  2R61 A;  1R4P B;  2IJ0 A;  5FOB B;  1EY7 A;  3ZYY X;  2I46 A;  1NSN S;  1C48 A;  1EQT A;  2B2U A;  2QCP X;  3V96 A;  4DFA A;  1TVX A;  3A7A B;  4ZQ3 A;  1JWM D;  2K5D A;  4O1N A;  1T5X D;  1V1O A;  2K03 A;  4H7B A;  5JJZ A;  4B08 A;  4U68 A;  2JA8 B;  3DMU A;  2O5J C;  4IUU A;  1JR0 D;  4C1N I;  5M9O A;  1S4Z A;  1I6V C;  3ND9 A;  4OIK A;  2EDG A;  4HCS A;  4KY5 A;  3ERO A;  1SYD A;  2VXW A;  1PFM A;  3CKI B;  3HGB A;  1BR9 A;  5E1F A;  1WTQ A;  2NTS A;  3A8K E;  2ICE C;  5IGG A;  2ZXP A;  1E2V A;  3BVG A;  3PUX A;  1I4X A;  4CHT B;  1X32 A;  3S2D B;  2E2D C;  2AQ1 B;  2KVM A;  1R9T B;  1D1K A;  4WFN 3;  3E0J A;  1MI2 A;  3GTK B;  1EYA A;  1LTB D;  4EGV A;  4L63 B;  2MGS A;  1ESR A;  2RQX A;  3P1H A;  1CQF A;  1V1P B;  3CU7 A;  5EPJ A;  3C2P A;  3D3R A;  4KKU A;  4EVO A;  2NN6 I;  4K8J A;  4K2L A;  4BS9 A;  1HA6 A;  1LAC A;  2G9D A;  2B2V A;  2BA1 A;  3R2T A;  1EY6 A;  4IZ8 A;  1TWC B;  5C3X A;  1V8Q A;  4IUR A;  2D62 A;  2F0W A;  2F0P A;  5T1G A;  5JPN C;  1DON A;  3I91 A;  1BCP F;  1W6J A;  4HED A;  1B50 A;  2DNE A;  1B53 A;  4B9X A;  2B8F A;  4I7Z C;  4C3I B;  1DOM A;  5FKA C;  1TII D;  4XQJ A;  3FKI B;  3VYS A;  1QB5 D;  1GUN A;  5FO7 B;  2JE6 I;  3GQB A;  1ZYR D;  3PIO 3;  3EA6 A;  2HDM A;  3DHQ A;  3A55 A;  1HUN A;  4NW2 A;  1CFM A;  2LS0 1;  3NK9 A;  1CZW A;  3HOY B;  3CRK C;  3IAY A;  1I3Q B;  1SYB A;  1YNN C;  3OPO A;  3SHL A;  5I4D A;  4HN7 A;  2LY7 A;  1RTO A;  2XNA C;  1PZK D;  4EQO A;  3M7N A;  2CW0 C;  3I4M B;  2E76 C;  3OMC A;  1M8A A;  2PW5 A;  4G4K A;  1HFG A;  3N6R A;  1F9Q A;  3OW7 A;  2IT1 A;  4NDX A;  4K6D A;  5JVG 3;  5IT9 L;  1X3Q A;  1NCV A;  5KNB A;  1S5E D;  2ICI A;  3DXJ C;  2L11 A;  5EKI A;  3S1M B;  1WD1 A;  2XVS A;  3S1R B;  3E5S A;  3W3A A;  5JEA J;  3HOW B;  4HR7 B;  1SE4 A;  2A73 B;  2B8G A;  4ME5 A;  4FF2 A;  1T5E A;  1B9N A;  1DOL A;  4RCN A;  5LL6 S;  5C4J B;  3BYT B;  4KV6 A;  1XXG A;  4OO1 G;  3FPU B;  2NVQ B;  4WJW A;  2AQ2 B;  1PLF A;  4X3U A;  3EVQ A;  4OGQ C;  2WIN B;  3SK5 A;  4OHJ A;  1JE4 A;  3H91 A;  1JC7 A;  3ONA B;  1IKL A;  1Q90 A;  2HCC A;  2F0N A;  4CKE A;  2IPK D;  2JEA I;  3C3L A;  2KED A;  1BBX C;  4XTC S;  4PQX A;  3IFT A;  3TDQ A;  2SDF A;  2H4O A;  2NYZ D;  2WAC A;  4QF4 A;  5EKK A;  2F0J A;  2A5H A;  1KDA A;  1SYF A;  3GTO B;  1NAP A;  4P2C B;  3KUP A;  1C4Q A;  1ROD A;  2PZU A;  2C5C A;  2E2I B;  1UNS A;  5CV6 A;  2Y0S B;  1QNK A;  3QG1 A;  4HSV A;  4FXD A;  4KI0 A;  4B9W A;  3DWP A;  1EYC A;  1JIC A;  1I4Q A;  4HCE A;  4BWG B;  1SXT A;  5DM6 3;  3HOU B;  4X3S A;  3R3O A;  3KLS X;  4A3B B;  2J0T D;  4PV1 C;  2L4N A;  5KYL A;  3RLF A;  5EJW A;  3S1Q B;  1TT2 A;  1PFN A;  4DF7 A;  2XN9 C;  3K7A B;  2NVY B;  3EQL C;  1LLR D;  4ABN A;  5LL6 X;  2SOB A;  1EIH A;  2K6A A;  4A3E B;  3D6W A;  3Q22 A;  1Y1W B;  1V43 A;  3OSO A;  3ERQ A;  1BOS A;  5F2D A;  2BCO A;  1SNO A;  3U9O A;  2O5I C;  3TN2 A;  5FLX E;  2N88 A;  1CTM A;  4Q0F A;  2EY2 A;  4KD3 A;  3P7J A;  1MBY A;  3UI2 A;  4KJO A;  4ZAI A;  3MXU A;  3X3N A;  3GV6 A;  2CQA A;  5COR A;  2B2Y A;  5C0X H;  3NBH A;  1RJT A;  4DGZ A;  2F0K A;  2IX3 A;  1BCP B;  2A69 C;  1EY8 A;  4XYQ A;  1LTG D;  4LMQ D;  3PUY A;  2RBM A;  1AFP A;  1LO5 D;  1XTC D;  5C5M A;  4DNT B;  1OXX K;  4QCL A;  2EXZ A;  2ZXO A;  1L0X B;  3T51 B;  4DNR B;  1QIL A;  3MEH A;  4RGM A;  1SE3 A;  3I73 A;  3QIA A;  4KJN A;  4FYD A;  4K5V A;  1J8I A;  4BY7 B;  2M9V A;  2F0O A;  3SK8 A;  2FFK B;  2A68 D;  2K01 A;  2XIW A;  1Q8I A;  1HXY D;  4XDX A;  1OO9 B;  3NXW A;  4RCO A;  2MHV A;  4ILW A;  4QUC A;  3RZO B;  2RSO A;  2Z4H A;  2EY6 A;  4OO1 I;  2KCC A;  3OIP A;  1I4P A;  1BDO A;  2Z8L A;  4RA8 A;  5ELD A;  4O42 A;  4DXF A;  3FRP B;  1Q1B A;  3TSS A;  3D8G A;  3KF8 A;  4ZKB B;  4K8I A;  3FVQ A;  3T56 B;  2R92 B;  4V0B A;  3MVV A;  3MXG A;  1M4V A;  2WB1 B;  1Z7T A;  2VB3 X;  3KLS A;  5IOC A;  3I4N B;  1TS2 A;  1B2T A;  1SE2 A;  4RKB A;  4A3F B;  4CGY B;  2EPB A;  2YU9 B;  3L3O C;  1XYI A;  1GUO A;  5E4W C;  2D2C C;  1DXM A;  1LAB A;  3KBG A;  5J1Z A;  3NWT A;  3GO5 A;  1GJX A;  4IN3 A;  2M00 A;  2JSO A;  3VYT A;  4M8A A;  5KND A;  2F0I A;  1ET9 A;  1XWE A;  2KEC A;  3MTS A;  3K5N A;  3KK7 A;  2OF1 A;  3VR6 A;  1EEI D;  3K57 A;  1B9M A;  3M3Y B;  5CC4 A;  1PRT F;  1O7L A;  1TR5 A;  4F87 A;  5FK9 C;  5M5X B;  1RD9 D;  2PW7 A;  5K36 H;  5NUC A;  4TKO B;  1FNU A;  3NTK A;  3R2I A;  1PYW D;  2F0V A;  3I72 A;  2TMP A;  4ZUJ A;  1MSG A;  2DNC A;  3OMG A;  3K5M A;  4ULL A;  3PO2 B;  4IUN A;  3HS0 C;  3FMC A;  2WAQ B;  2MJ8 A;  1SSO A;  1U9R A;  2LKV A;  1EIG A;  1JCK B;  2F3V A;  3A8I E;  5I9P A;  3V2T A;  4HAE A;  2FMC A;  4CJ2 C;  1Q12 A;  3QWN A;  1TWH B;  1S5C D;  5K5P A;  3R93 A;  1JOO A;  2PPB C;  1R4Q B;  2K32 A;  2PZT A;  5I9O A;  1OXS C;  4BA2 I;  2K5Q A;  3HKZ B;  2FIN B;  5D14 A;  1X3P A;  4ZYS A;  1WTO A;  4N9P A;  3J81 E;  1ESF A;  3MWY W;  1SJE D;  5M5Y B;  3M7G A;  2EY5 A;  2J4X A;  3D6C A;  2Q8T A;  3QOJ A;  3MC0 B;  1K83 B;  3M85 A;  1TWF B;  2F0M A;  2K7V A;  1Y69 U;  5T1I A;  1EWC A;  1D5Z C;  2RVL A;  2F0H A;  3D4R A;  3VA7 A;  2F3W A;  4XXE A;  1K8M A;  1PTO F;  5C0X I;  4PMC A;  1AZQ A;  4YIJ A;  3DUZ A;  1CM9 A;  4DN4 M;  1F9R A;  3TZU A;  1B3A A;  4KK7 A;  2A69 D;  1LT6 D;  5CBA E;  4J1M A;  2AUJ D;  3QOL A;  2KEE A;  3W2D A;  1H9S B;  3NQT A;  1DM0 B;  5JAV A;  1SNM A;  1ILQ A;  2A6E D;  5KRU A;  1U4P A;  4PMW A;  2X69 A;  5I6W A;  1KTK A;  4HMJ A;  2EYM A;  3HOZ B;  4A3D B;  1HA5 A;  4KHZ A;  2XSC A;  3VR3 A;  3HG9 A;  4ODG A;  1PMR A;  2PMZ B;  3SE0 A;  1STB A;  2XWJ B;  1EY0 A;  1LTT D;  1SNP A;  2Z1C A;  5CV4 A;  3PIP 3;  5EBC A;  5J39 A;  2PQE A;  2B2U C;  2RA4 A;  2R6G A;  1MD2 D;  1RDP D;  1Y8N B;  3MXP A;  4F88 A;  4HMI A;  3I70 A;  1ENC A;  2K1B A;  4Y7N B;  4FVM A;  5EQ0 A;  5KGU A;  2NUC A;  1GOZ A;  4DA2 A;  3VR5 A;  1VCI A;  2EY1 A;  1STH A;  1NUC A;  2B2W A;  3M4O B;  5K36 G;  3AMU A;  2PYK A;  1QNU A;  1VMC A;  1KDC A;  2FHT A;  3PUW A;  2E2J B;  1F2Z A;  1RHP A;  2QKI C;  3NSW A;  4RHR A;  3BZD B;  2EE1 A;  2KCN A;  2R3Z A;  3NUC A;  1IHZ A;  4XT1 B;  1V1P A;  4UDU C;  1JQY D;  1H9S A;  3IL8 A;  2SEB D;  2ID0 A;  5KEE A;  2A6H C;  2KA7 A;  3HEJ A;  1ML0 D;  3R8B A;  3HZX A;  4DK1 A;  5HGT A;  2L55 A;  2C9O A;  3AB9 A;  2EJF C;  1BF4 A;  4OO1 H;  2NVT B;  1TY0 A;  2OXP A;  4G7O C;  3MFY A;  2O4X A;  2K28 A;  3P20 A;  3MA2 B;  3MXN A;  1RCV D;  2F0L A;  1AEX A;  3X3M A;  3HP3 A;  1SYE A;  3GP7 A;  3CRL C;  3D31 A;  1SMY C;  3OHX C;  5C5L A;  5EKL A;  2G9H D;  4KKT A;  1JWU D;  1ZYR C;  1BCP D;  4R8N A;  4CKB A;  1QG7 A;  1Y1V B;  2B39 A;  1EFI D;  1SFO B;  1UUP A;  1IL8 A;  4CBV A;  1SAP A;  1DD2 A;  1LTS D;  3I8Z A;  1HRJ A;  4RH6 A;  1KNE A;  4C3I G;  2D5D A;  5ELF A;  3D4W A;  2IL8 A;  2JA5 B;  4FF1 A;  3K59 A;  3TBI B;  4M1U B;  3PMF A;  1BO0 A;  5IGE A;  3MZ5 A;  2Q8R E;  3J7A V;  1STN A;  5IGF A;  5CV8 A;  4FNF A;  3K6O A;  2HUG A;  1PTO H;  2X6G A;  4G7H C;  1ZKO A;  2XRQ D;  5FO8 B;  1HPC A;  3VR4 A;  3I90 A;  3J80 E;  3PUV A;  2QIL A;  1EYD A;  1LTA D;  3SR1 A;  3H94 A;  4ZK9 B;  4MHE A;  3FPP A;  1A6X A;  3L9A X;  4FF4 A;  2EYH A;  2MPM A;  4KD4 A;  1H9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...