1GHJA

Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from azotobacter vineland ii, nmr, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
79
structure length
79
Chain Sequence
b'AIDIKAPTFPESIADGTVATWHKKPGEAVKRDELIVDIETDKVVMEVLAEADGVIAEIVKNEGDTVLSGELLGKLTEGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E2, THE DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE COMPONENT OF 2-
publication title Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from Azotobacter vinelandii.
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Acyltransferase
total genus 7
structure length 79
sequence length 79
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 1996-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ghjA00
1E2ZA 4PV1C 2A6HC 2A68C 2NN6I 1H9SB 4DK0A 2EVBA 4OO1G 2JE6I 1E2WA 2IT1A 1Y8PB 1HPCA 2NN6H 3FMCA 2AWOA 3KLRA 3P20A 3SE0A 1GUOA 1TKWB 5BN4A 1H9RA 3M85A 3ND9A 4G7HC 3IKJA 1CFMA 2BA1A 1G291 1HQMC 5KNDA 1ONLA 4LJZC 3MXUA 2O5JC 4OGQC 4OO1H 4DNTB 4KI0A 1Q90A 3VA7A 1B9MA 2L5TA 3A8KE 3H94A 3PV0A 2V4DA 2A6ED 4H0LC 3BDOA 4TKOB 3I4LA 1GHJA 3QJYA 3RLFA 1DXMA 3PUVA 5BN5A 1VF7A 2B8FA 2E74C 3LNNA 3SDZA 2KCCA 5KNCA 2E75C 3NE5B 1OXVA 3D4RA 2F1MA 1A6XA 1ZKOA 1YNNC 1H9SA 1TU2B 2KA7A 3A8JE 3CRKC 3I72A 1PMRA 2JXMB 5A35A 4JBWA 3FPPA 3W3AA 1Q1BA 4KKSA 4HR7B 2PCFB 3HGBA 1HTPA 3A8IE 3MFYA 1BDOA 1QJOA 2QF7A 1CI3M 4XTCS 4BA1I 5K36H 4DNRB 3VR6A 1GHKA 1V43A 3I73A 2CW0C 1Y8NB 2YYZA 1OXSC 2D2CC 1Z7TA 1OXTA 1Q12A 2EJGC 3BG3A 1H9MA 2BE5D 3QIAA 1OXUA 3PUYA 3VR2A 1VDZA 3WDNA 3EQLC 1FYCA 3OW7A 3QG1A 2D62A 4XIGS 4G7ZC 3AB9A 3PUXA 1GUGA 2JEAI 1Z6HA 2Q8IB 2DNEA 1T5EA 1I6VC 1GUNA 2A6EC 1DD2A 2BDOA 4KMUC 4KN7C 1OXXK 4RCNA 1VCIA 3CRLC 4L8JA 1GJXA 3PUWA 1GUSA 1K8MA 1O7LA 3N6RA 1Y8OB 3ND8A 4KKUA 5C0XG 2JEBI 1SMYC 2A69D 2EDGA 2O5IC 1LACA 3OPOA 3GD7A 2B8GA 3VR3A 1IW7D 4G7OC 3M4YA 2AUJD 1LABA 2EJMA 4KKTA 5C0XH 1IYUA 4KHZA 3T56B 1ZYRC 1HCZA 3DXJC 1FR3A 3GQBA 4H13C 2A6HD 4JK1C 4LK1C 1B9NA 2K33A 1Q1EA 3L7ZC 3M7NA 2DNCA 3VR4A 2BE5C 3D31A 1DCZA 1CTMA 1EWHA 2BA0A 2ZT9C 5JEAG 3VR5A 1VF5C 4GZYC 2D5DA 2EJFC 4H44C 4I7ZC 4DK1A 2K7VA 4TQUS 4IQZA 5BN3A 5JEAH 3PUZA 2R6GA 5KNBA 1IYVA 1K8OA 1H9JA 4IFDG 3IFTA 1E2VA 1H9KA 4KN4C 2PNRC 3A7LA 2PPBC 3T51B 2LMCB 3OOCA 2A69C 1Y69U 1V8QA 4BA2I 2E76C 1IW7C 2AUKA 4IFDH 1YNJC 3TZUA 3T53B 2A68D 2DN8A 3A7AB 3LWUA 2K32A 1O78A 1GUTA 2NN6G 3U9SA 5K36G
chains in the Genus database with same CATH superfamily
3S1NB 3S17B 1JICA 3KJPA 4UAIA 5J1ZA 4OWWB 1YHQA 3R3OA 4GLVB 1BQQT 2E2IH 1FJGQ 2K5DA 4X64Q 2R7ZG 1HA5A 1B7YB 1XX8A 2JA8H 3PO2B 2PMZE 1VQLA 4X65L 4KI0A 4DR6L 1PFNA 3EBEA 3Q22A 2Q8RE 3PUVA 4K5WA 4MTNA 1MHWC 1PRTF 4DUZQ 3AMUA 4JI5Q 4LFCL 4P73A 5J22A 1Q7YC 4JBMA 1ENCA 3I72A 4PZ8A 1GXDC 2F0QA 1BCPD 3HOYG 1MI2A 4IJLA 2B63G 4DR1Q 3I4MH 1K3BC 4YIJA 1BBXC 1U0LA 5JEAJ 1AEXA 4IJHA 1UE5A 4LUOA 4N9PA 1WTHA 1XTCD 5DNFA 5BN4A 4A3IH 2AWNA 1JOQA 4Q0FA 1Q81C 2LFNA 4UY8C 1QVFA 3A55A 1IYJB 3TQYA 1I6HB 2XNAC 5IWAQ 3U4VA 1F9RA 1B70B 4DF7A 4L5SA 3LX0A 2MFIA 4LF7L 1EQVA 3EA6A 2A5HA 1JORA 3OPOA 2WKCA 3MFGA 5C6AA 3KF8A 1NTGA 2RA4A 3H91A 1IYUA 5FO7B 1CQVA 1EFID 4A3DB 2UXBQ 1Q3LA 2B39A 1VQNA 3I70A 4JV5Q 2PI2A 2GVBA 3TMEA 3GTLB 3DMUA 2F0VA 4OX9L 2E2HB 1RKNA 1EEID 2EYOA 2K03A 4IURA 2EYLA 4ZAIA 2LXJA 2F3IA 4LF9Q 1R4QB 5IP9H 3L3OC 5C4XB 5ELCA 2LMCB 3X3NA 3S1QB 2IW3A 2K52A 2Q2IA 2MNAA 1TS2A 1UAPA 2LS01 2E76C 4DV7L 3CCVA 1WI5A 4HIKA 4JOIC 2NN6G 1E7ZA 1I4QA 1OO9B 2QEXA 1HNWL 4GOPB 2A68C 4DR2Q 2HIVA 4UDUC 2IPKD 3D3RA 1DOKA 2IWHA 4EVOA 4FXDA 2KUMA 1HNXL 5C5MA 3M85A 4IPGA 1VMPA 1QOHA 2KJXA 1G291 4ZRZA 1KRSA 2F0TA 1A3VA 2LSSA 2PO4A 2CCZA 2B2VA 1V9PA 1EWIA 2RKSA 4A93B 1UE6A 2PQAA 3W1BA 1BUVT 1KHIA 1PXUA 2L15A 1UWVA 3RLFA 5JJZA 1VF7A 5ELFA 3FKIB 4KHPL 2E75C 2YTYA 1GUWA 1TWCB 1A6XA 2KVMA 1A8VA 4DV2L 1VQJA 2IJ0A 5EKLA 1HJPA 3CMEA 1I5FA 2PW7A 2NZHA 1BDOA 1CKMA 3D4WA 4ME3A 1FVIA 3S14B 2OT2A 5K36H 4YHHL 1RL2A 2EYJA 1XNQQ 3OW2A 1E1TA 2D62A 5EQ0A 4LFAL 1YVCA 3AB9A 3STBD 4F88A 1VQCA 1I6VC 1GUNA 4HN7A 3UDXA 1M1KC 3MC0B 3SR1A 5JVH3 3EFXD 4BBRB 3WWVA 5C44H 1SYCA 4DV6Q 2CQOA 4BS9A 2FXQA 2CH4W 4CGYB 4OELB 1HA6A 5E7NA 1PH1A 2CFMA 4E6IA 1A3UA 3A5ZB 3SVMA 3PO2G 1TY0A 1X65A 2F0FA 1S5FD 4C3IH 5EKKA 1PH2A 3GTMB 2XRSD 2N49A 1W2BA 1HR0W 5ELDA 2TSSA 3V96A 3L2PA 4A3KH 4A3MB 2EZVA 4NB3A 2ZT9C 1KXLA 4G4KA 5CV9A 2K7VA 1E3PA 1FGUA 4A3EH 4ABNA 2DY7A 4A3BH 4UP7A 2VQFQ 2UUCQ 5KNBA 2MUYA 3U4ZA 4GN4B 1SLJA 3A74A 4M8AA 5C0XJ 1I3QB 2A68D 1HQRD 4P74A 2F0UA 1CUKA 1M8AA 3HOVB 1X56A 2K5HA 4X65Q 4DR6Q 4RWSC 4TSSA 1QCBD 1PTOB 3BDLA 2VUMH 1RDPD 1XWEA 1H95A 2F3VA 1TWAH 3D6WA 3M4OB 1PA6A 4K14A 3TEHB 3IKJA 1KTKA 3QO2A 3HOXB 4LFCQ 1EY5A 4JVZA 4JI7L 3A8KE 4XT3B 4B3SQ 3CKIB 4A3DG 1TVXA 1X3FA 4PZ7A 3TS2A 1DXMA 4XYQA 1CHPD 2E74C 1VMCA 2RBMA 1EY8A 3D4RA 2QDLA 2K1BA 3VYSA 5E4WC 1RD9D 1F9PA 1I50H 3RR5A 4QUFA 1QZGA 2H1EA 2I0QA 4JW0A 4RGMA 1CI3M 1ICWA 2AHOB 5D3DA 4BY1B 1AN8A 3BVGA 4CJ1B 5C4XG 3BG3A 4ZUIA 1D6EC 1R4PB 3NBHB 4LF7Q 2F0EA 2EPBA 4B9XA 1BR9A 2A6EC 4KMUC 2OCEA 2YU9B 1IZ6A 5JJIA 4R4OA 4OX9Q 2HD3A 1HZ9A 2NWGA 1HH2P 2X69A 4GN3B 1N33L 3K5OA 3RLNA 4B3RL 2NVTB 1DOMA 2XWBB 2PNHA 4RKLA 4A93G 2F0DA 1EQQA 3UI2A 1X54A 5GAEC 3FKIG 1BNZA 2ASBA 1CTMA 2BA0A 3OIQA 4AIMA 5FLMH 1UE7A 2K75A 1VF5C 1HR0L 4AYBB 3G71A 4DV7Q 3GTGH 1JJCB 1IL8A 5C4ZA 4PZ6A 3CXCA 3G6EA 1CKOA 3ZYYX 4DPGA 3K59A 4R4IA 1E2VA 3MEHA 1SNOA 3T51B 5KEEA 2QILA 2C35B 2LKVA 1HNXQ 3VYUA 1L0XB 1IW7C 2RSOA 2G9HD 1YJNA 3M7GA 2UU9L 2F0HA 1TWHB 5E4XA 3M4QA 3J81L 1PH9A 4YWKA 1JWUD 3R8BA 1WOCA 2C5CA 4BBRG 2I46A 3J7ZC 3PIP3 1Y1VH 4P2CB 4FO2A 2P5ZX 2Q8TA 5IT9L 4DAMA 4DUYL 1CFMA 1B50A 2XSCA 1CT1D 3F2UA 4DV2Q 3KF6A 2WKDA 5C4JB 1XPOA 2QCPX 3K0YA 1XJVA 3PIO3 4CKCA 2MJ8A 3T1YL 2EY2A 3HOUH 1S5BD 2K6AA 4GNXB 4YHHQ 3NBIA 3K81C 2M2LA 2R93H 4A3MG 2KA7A 4NMZA 4POGA 2B2VC 5GQOA 4CJ0B 4IALA 4JI8L 1A2UA 3M3YB 3PF5A 1TWGH 3TRZA 2B2UA 4FP5D 2CW0C 3K7AB 1OXSC 5LMNL 3NXWA 3NTIA 3GTPH 3DEPA 4YY3L 3EJIA 1LLRD 4FVMA 1MGSA 1DD2A 1WYDA 3HOVG 1E22A 5M3MH 4F8MA 1RCVD 2BOSA 4HCSA 3J80L 1RHPA 3ND8A 3SEBA 1Q46A 1SMYC 2A69D 1T5XD 2K05A 4R4TA 1PH5A 4X3KA 1KNEA 3HOXG 4KKTA 2AQ3B 3GTOH 5HGTA 1EFWA 5K5PA 3UE1A 4LK1C 5CR3A 2MPMA 1F2YA 1EQTA 2YTVA 4ZUJA 2UXCL 3F1ZA 5ISRA 2D5DA 4RGTA 3AFPA 1SYGA 4PG3A 3HOZH 2UUAL 2R6GA 5BR8L 1N34L 2IY5B 4IFDG 1LTLA 4LF6L 1EY4A 3HOWB 1O80A 4BY1G 3U50C 4GN5A 3OIPA 1KD1C 2JQOA 3I4OA 5IP7H 3A7AB 2RHSB 5AJ3L 3E3XA 1IBKL 3W5OA 4H7BA 3T13A 3S2DH 1SNCA 3BVMA 4JBKA 2B2TA 1TQOA 3E0JA 2ZTDA 5KNDA 1EQRA 1SAPA 1X9NA 4EX5A 1CZWA 3NELA 3H94A 4KY7A 4IUVA 3RZDB 4IUPA 1KAWA 5EBCA 1D5ZC 1JB7A 2BH2A 5FLXL 4A75A 5IGBA 3TDQA 3UDFA 2ZJPA 1VQ5A 1XMOQ 1TXYA 3D6CA 4HSPA 4AYBG 1R9TB 2NVYB 3GV6A 1M90C 2CW0D 2WFWA 4NXNL 4AYBE 1GHKA 4RA8A 1ILQA 4DKAC 4KV6A 5C3EH 3BZKA 1K8GA 3VR2A 3VA5A 3QG1A 1LTBD 3E9IA 3I4MB 1Z6HA 4DAYB 1N33Q 3F8TA 1CZGA 3SK5A 2BDOA 4B3RQ 3HKZE 5FO8B 1PVOA 1NUCA 3TN2A 1IL2A 1DONA 2DJFC 1CKNA 1Z47A 2H4OA 1IBML 3P1HA 1HR0Q 1BCPC 3TP7A 5C0XH 2ENBA 2JA7B 2KCTA 1HCZA 2L1BA 4BWGB 4JK1C 4UPAA 3I3CA 2IX3A 1SE3A 2YTXA 1OTCA 5C4HA 2E8GA 3DLLA 2VZAA 1LV9A 1C7YA 3FEWX 1SFOH 2UU9Q 4K6DA 1C0AA 3EIVA 2K50A 2F0GA 1B1ZA 4FNFA 4R9WA 3FHWA 4LF5L 1EYGA 1YNXA 3TZUA 1IHZA 3BDCA 1ESRA 4CDDC 2GN5A 4LW1A 3D4DA 4RGOS 1JB3A 1LM0A 3O13A 3T1YQ 3NSWA 5IGFA 3I2ZA 1Y8PB 2KEDA 1VQBA 3J7AV 2CQAA 3S15H 4G7HC 1GKHA 4NXML 4R4CA 4PMBA 3EVQA 5C3WA 3VA7A 1A15A 2OXPA 3HG9A 4QMGA 1K73C 4FF1A 4JI8Q 4GKJL 2G9DA 2LY7A 2R7ZH 4WJ4A 2JA9A 4WORA 4JI3L 4OEMB 4N9TA 5LMNQ 1HTLD 1W3SA 4DV1L 5CV6A 4HEDA 2XN9C 3K6OA 4X3SA 3RLOA 4JCVE 1SJED 3VYTA 1ZYRD 2QF7A 3CQZH 3P7JA 4QF4A 5ELBA 3E6ZX 4K0KL 4DNRB 4IO9A 3I73A 3HOWG 5GROA 3HOYH 2BE5D 1EIFA 5I4DA 3K8AA 2B63H 1GVPA 5T1GA 4G7ZC 5IGCA 1GUGA 3BJUA 3C3LA 2Z6BA 4X66L 1WTQA 3HKSA 1K83B 2EE1A 1DM0B 3VDYA 2B2YA 2B2UC 1FD7D 1O7LA 3N6RA 2JA5B 3H6MA 1WD1A 3KYHC 2EDGA 4NW2A 1YIJA 1VS0A 1JWMD 5EPJA 5D14A 3JAME 2UXCQ 1KDBA 1LABA 5CMDA 2PZTA 3RNUA 5ELNA 4A4IA 3S16H 3CU7A 5M5YB 4HAEA 3DUZA 3GQBA 1P16A 1WFQA 5BR8Q 1YI2A 2UUAQ 1Q1EA 4LF6Q 5G3LD 2G5DA 1BVSA 1ESFA 1SNQA 1U4MA 2EYMA 2L9HA 1X32A 4IUUA 1PYWD 4HCEA 5J3BA 2EJFC 2AQ2B 4EGVA 3STBC 1TY2A 1JE5A 3C2PA 3OHXC 3Q0AA 4EQNA 5AJ3Q 2HQEA 2RDFA 1IBKQ 2Q2TA 1PFMA 4C3JH 3F2BA 4WFN3 3V2TA 2K14A 5EAYA 1JE4A 4MZ9A 1IKLA 1ML0D 3TBIB 5DM63 3OSOA 3RN5A 2NVQB 3HFZB 1NY4A 1PRTB 4EQ5A 1GUTA 1SRUA 3I4MG 1BO0A 2EYFA 1LO5D 3GP7A 1SXTA 4CKEA 1WTWA 3PQIA 1W6KA 2A19A 2NN6I 2MHVA 2NZOA 4CJ2C 4A3CH 4RKBA 1MJEA 2NN6H 3KLRA 1TS5A 3ND9A 2YV5A 4IUQA 4BXXG 3PO3B 4X6AH 5EKIA 2H5XA 1PTOD 1NE3A 2NVXB 1AH9A 2JA7G 1I4GA 3ERSX 1MSHA 2MO0A 4DAPA 1GHJA 5JPMC 4DXGA 1D2BA 4LWCA 2R7FA 2EY1A 4XQJA 4DV5L 4WJ3M 3ONAB 4RG1A 2B2TC 2K5NA 1NSNS 1V1PB 2Q2HA 5H1SE 1JT8A 4A76A 3FPPA 2EY6A 5CYUA 2PCFB 2SDFA 1ET6A 1RTOA 1CHQD 4DR3L 5ELEA 3RN2A 1S40A 2ATWA 3QWNA 4LF4L 4BA1I 3ICEA 1PH4A 1NMGA 1Y8NB 1EZ6A 2RQXA 1EU3A 1SEBD 3EQLC 3GTJH 1EWCA 1IBMQ 4K5XA 2M00A 3HRZC 1XPRA 4L5TA 1MKHA 1BCPF 2XGTA 4KJOA 5EBDA 2OEOA 2AQ1B 4IOAA 5IYBH 4A3LG 3PUWA 1GUSA 1B44D 4HIOA 2JEBI 3Q6SA 5I6WA 2O5IC 3S1NH 4IOCA 1YNJD 1Y1WB 3S17H 5DM73 3OMGA 2IX0A 3OTOL 1VQ8A 3S1MB 3PO2H 2K01A 3G48A 3VR5A 4LF5Q 4Y52H 3J7AF 5L37A 1AZQA 5LL6X 4IPCA 4IQZA 4IZ8A 1WTOA 2IX1A 3I4NB 1HFNA 1WCMH 4NDXA 2OTJA 3MHBA 4OIJA 4A3JB 1W6JA 4JI1L 2F0SA 1G2TA 1B53A 1PZKD 3GTGB 2UUBL 1SE2A 4HJ9A 2Z6KA 1STEA 3BS1A 4NXMQ 3MZ5A 2JA6B 5K36G 3U58A 1JOKA 4A3FH 5IOCA 2EVBA 1LT6D 4GKJQ 4OO1G 2JE6I 4DR5L 2IT1A 1S72A 4JI3Q 1EUJA 2HIXA 4UP8A 2JA5G 1H9RA 3URYA 1C8CA 4C1NK 4TRDA 4DV1Q 4DK3C 1I6HH 4DNTB 5M5XB 3PSIA 1B9MA 3TP5A 2PQEA 1D1IA 1PLFA 3HS0C 3KLWA 4K0KQ 2TMPA 3JC66 2QDBA 2I07B 4CDFC 2FINB 3CPFA 2PYKA 4QUCA 1V1PA 2HUGA 4GOPA 4A3DH 4JI0L 2IHFA 4JBWA 5CC4A 3QR8A 4X66Q 4DN4M 1IXRA 4LMQD 3R93A 1FNVA 1RF2D 1KC8C 1XPUA 1U4RA 3X3MA 4Y7NH 2N88A 3SK4A 2R93B 1OXTA 1H9MA 2K04A 1VQFA 4XXEA 3FP9A 4X3UA 1K8AC 1VQ4A 4OONA 3J81c 5C4XH 1YEZA 2DY8A 5JJLA 5JAVA 3S1QH 5KYIA 3RUZA 3Q24A 1D1KA 2QKIC 4RCNA 1N9WA 4P75A 1Y8OB 1YJ9A 3J81i 1C9OA 2X6GA 2B8GA 1EL0A 5LMNW 1UEBA 4G7OC 2K28A 3PO3G 3FDTA 2D9UA 4J8QA 3CCLA 5DAUA 5KGUA 4RHSA 5FJ8G 3M7NA 5EPLA 2J0TD 2B2YC 4P72A 1PFBA 1N8RC 2E5LL 1HFGA 1XMQL 2XRQD 4NKLA 5EGTA 2ZJRA 4A93H 4H44C 2F0WA 4AQYL 3DWPA 1CA5A 4H02A 1U5KA 3KBXA 5KRUA 1NCVA 3CCSA 3FKIH 2ICIA 4C3HB 1TWCH 1QZHA 4N8X1 2PNRC 1AW7A 4CHTB 3FVQA 1MBYA 2A69C 1Y69U 1X3GA 1HZBA 1EIGA 1JCKB 1PV4A 1L1OB 1PH6A 4MHEA 3S14H 1VQDA 1Q86C 3HZXA 1HUMA 4DR4L 2FMMA 4OXPA 4O2DA 1QNUA 3J80c 3AU7A 2D0OA 2RVLA 4DK0A 4DV3L 1E2WA 1UE1A 3H15A 3FMCA 3SE0A 1AE2A 5C3XA 2IL8A 1MSGA 3J80i 4DV5Q 2FMCA 2O5JC 4QIWE 4KHVA 3K57A 1HNWQ 1LTID 4KD3A 4BBRH 1DGSA 4MNOA 1Y1WG 2WINB 4DR3Q 3I56A 4UHVA 4LF4Q 3HKZB 2N3SA 3LNNA 5KNCA 3GTKB 5D65A 3K7UC 1QVCA 2VW9A 3TP6A 3NHHA 5HGQA 1SDFA 3CD6A 3GTMH 2E2JB 4HR7B 1VQEA 3GTQB 3MFYA 4KHPQ 4BY7B 1EEFD 1QJOA 4XTCS 2JN4A 4A3MH 3I4NG 4JPBW 1D7QA 3KJOA 4A3JG 2FFKB 3S2HH 1JWSD 4IN3A 1FGBD 3QIAA 2KHIA 1XTDA 3OW7A 2OTLA 4K6LA 5FKAC 4GKKL 1A3TA 2GA4B 1A2TA 1ZEQX 2N55A 1NJIC 2V1CC 1SE8A 1EYAA 2FHTA 4OL7A 4CDCC 2JA6G 1ZXTA 2K4KA 1OXXK 1QUQB 1VCIA 3OTOQ 1HZCA 3CRLC 4QGUA 1NAPA 4KKUA 2L55A 4LFAQ 1I3QH 2R7DA 1N36L 4DFAA 3NK9A 1B3AA 3SK6A 5IGEA 3S1RB 4BBSB 3H3VI 1PTOH 4KHZA 2BCOA 4IUNA 3NBHA 3DXJC 3NQIA 3M4OH 2QW7A 5FLXc 3KLSA 1G91A 1KDCA 2ZTCA 2SEBD 3HOXH 3DM1A 4JI1Q 5JEAG 2WB1E 4J6HA 2UUBQ 2JSOA 5M5WB 3J7A5 4K2KA 2K5QA 3T1HL 3RMHA 1K8OA 1CA6A 1H9JA 1F77A 2ID0A 4DR5Q 4IFDI 3D0FA 2R93G 1LUZA 2GVAA 3R2TA 1LTAD 4XT1B 3ZJYC 3I55A 3HEJA 4A3GB 1YNND 3A54A 4IFDH 3DHQA 5DLQE 3GDEA 3CC4A 3MEFA 1FJGL 4BY1H 1VQOA 5HY6A 4KY6A 3F2DA 4PV1C 4JYAL 1H9SB 3FRPB 1A62A 4ZK9B 5NUCA 2O4XA 4L5RC 5GAGC 1BBUA 3TP8A 1IBLL 2VB2X 2BA1A 4DAVA 2Z6KC 2BDNA 2OQ0A 2YU9H 4JI5L 4HTHA 1Q90A 2EQSA 3QB3A 3K0XA 4FF2A 4C2MB 3I4LA 4DR1L 1DOLA 2R92H 1FNWA 4JI7Q 4TVAB 2NVTH 4KKSA 3RZOB 1HHVA 1CK1A 1ENFA 4C3HG 2F0NA 3QOJA 1O7IA 5M3FH 3WDNA 2SNMA 3KK7A 4XIGS 4GOPC 3PUXA 2E2IB 1NR2A 4GNXA 3W1GA 2HQLA 3EROA 4HIMA 3G6JB 1KAAA 3KDFB 1QUQA 2PW5A 2JA8B 4F87A 4DA2A 4YCUA 5GADC 3J80E 3H0GH 2ICEC 5CV4A 1F9QA 2E5LQ 1VQMA 1XMQQ 1TWHH 2R61A 1QB5D 1J5EL 4AQYQ 1YHBA 2XVSA 2I5MX 1ZYRC 4X3TA 4KK7A 3HKZG 5A2QE 2BE5C 2WACA 5C4JH 3I91A 4GZYC 4I7ZC 1YHAA 3KFUA 4A3IB 4R8NA 1QVGA 1KLUD 4C56C 3DWQA 4DR4Q 3PUZA 4QY7A 4BY7G 2FJ2A 4KN4C 1H9KA 2JJQA 4DV3Q 1EYDA 2KHJA 3TZDA 4O0AA 2XIWA 4MTKA 4RCOA 3LGJA 3M3YH 1V1OA 5LHY1 4FXGC 2ZTEA 3K7AH 1VQHA 1RJTA 2F0LA 4C3JB 5IYDG 1T9HA 2RDGA 4ZQ3A 1CSQA 1PRTD 1SNPA 1SYFA 3CCRA 3MA2B 5FOBB 4JI2L 5IYCH 1SMXA 2OQKA 3MWYW 5ELOA 1HXYD 1L0WA 4BBSG 1DZ1A 3MXPA 1RIPA 2A1AA 2V4DA 4TKOB 2WAQB 2B8FA 1I4HA 4YCWA 4DUYQ 2KCMA 3N52A 3HP3A 1SBBB 5GAHC 3A8JE 1WTVA 4GKKQ 1TS4A 1Q8IA 3K58A 3ULLA 3JAML 3K5NA 1A0IA 3KF8B 1VQ6A 5D3IB 1QWYA 2YYZA 4OHJA 1Z7TA 1Q12A 2QGQA 1TWFH 1VDZA 3I7FA 2ZXRA 4ALPA 1PH3A 1N36Q 1ASZA 4A3GG 1QG7A 1PTOC 3HOWH 3KOJA 3ULJA 3B6YA 1T5EA 4KN7C 4XYOA 2SNSA 5C5LA 4DV0L 3NTHA 4YY3Q 4LNQA 4I65A 1N32L 1L0YB 3T1HQ 3J81j 2A6HD 1BXTA 1CSPA 1WD0A 1S4ZA 3L7ZC 4DK6C 2VB3X 3T4AC 3TS0A 2DNCA 4FXKC 2VQFL 4DAYA 1EWHA 1PDQA 3BVZA 2AKWB 1IKMA 1SJHD 2ES2A 5JJKA 3RZDH 3G7LA 4PMWA 1ASYA 4TQUS 2C9OA 1VQGA 1WJJA 3VYRA 4XQNA 4JYAQ 3A7LA 1BOSA 1KDAA 3FPUB 1R9TH 1D5XC 3R2IA 1HRJA 2NVYH 4QB4A 2R3ZA 2PQAB 2EXDA 1IBLQ 5C44B 4DGZA 1YNJC 3T53B 3LWUA 1N34Q 1AFPA 1SNDA 1WCMB 2OF1A 3CP0A 2EYHA 4B3ML 1G51A 2JA8G 4B3SL 1WTXA 4C3IB 2F0PA 1L1OC 1FNUA 4B3TL 3U9OA 2KHSA 4A3KB 4LF8L 3MVVA 2Z9HA 4A3FB 2IHEA 1KNAA 3BZCA 2J7ZA 3NENA 1J8IA 4A3EB 4BXXH 3SDZA 4LAAA 4A3BB 1EY0A 3NE5B 2L4NA 3NUCA 2JA7H 3J7YW 1MIUA 3IRBA 1LTSD 1PMRA 2XWJB 4LUVA 2O2LD 1HTPA 1M4VA 1S5DD 3I8ZA 4A3IG 4K5VA 1EYCA 4V190 3AFQA 3VR6A 4CBVA 2ZM6L 1V43A 2Z8LA 1PH8A 4GS3A 2D2CC 2EJGC 1S5ED 1Z9FA 3NQTA 1YJWA 1PHJA 4NXNQ 2VUMB 1TWAB 1QNKA 4IFDJ 2M9VA 2JEAI 1J5EQ 2RCFA 1BBWA 4Y7NB 4DR7L 4C3JG 1XNRL 3PF4A 3MXGA 3DWAA 3Q23A 3CCEA 4G57A 1E24A 1GOZA 1LACA 1TR5A 3L9AX 1FL0A 1XXGA 5IGDA 3VR3A 5AFWA 4A3LH 5LMUL 3S24A 2EJMA 4GNXC 2ZXOA 4Z9CB 3SHLA 2CVRA 3V05A 1EIYB 3D8GA 1DJRD 4H13C 1NBWA 1I50B 2K33A 4A3CG 5KYLA 2EIFA 2WAQG 2Z4HA 4IPHA 4KLKA 5FO9B 3VR4A 1NR4A 2HDLA 2MQHA 4POFA 1EIHA 5IP9G 1KABA 4L6TB 2WAQE 1STNA 2L0CA 4QIWB 5J39A 2RHQB 1K9MC 3PMFA 2Z1CA 2HDMA 2ALYB 3IFTA 2MP1A 1EOVA 5COYA 2PPBC 5I2YA 4BA2I 5G3LF 4Q5VA 3K5MA 5F2DA 1S3OA 4FDBA 4JI2Q 4L63B 1Q8KA 2DN8A 2JP1A 5DEHA 4WRDA 2A74C 1SNMA 4DXFA 3ULPA 2EXZA 2RDHA 4ME5A 4ZKBB 2N8NA 2PI2E 1ENAA 3NTKA 4OO1I 1K83H 4IPDA 4LJZC 2F0OA 1AZPA 5CV7A 2F0JA 4OO1H 1JR0D 2F0KA 2VNUD 3PV0A 1SYEA 2JA5H 4RAUC 1D8LA 5IYBG 3GO5A 1AP0A 1G2SA 1BCPB 1CQFA 2KCCA 5IODA 2MGSA 4HJAA 1OXVA 2CHBD 4DV4L 3RD4A 1AE3A 4O42A 4QCLA 1TU2B 5M5YH 2ZJQA 3CRKC 1Y14B 4HJ5A 4ZLTF 4K8JA 4L5QA 2Z0SA 4X62L 1STYA 3KUPA 1PTOF 4ID6A 3WOFA 1LTGD 1VQ9A 2NBFA 1A63A 4DV0Q 3PUYA 1RTNA 4YWLA 2E2DC 1JC7A 3MTSA 4XQQA 2WB1B 1Y1VB 5C44G 1I4XA 1STHA 1N32Q 2DNEA 1WCMG 2XTIA 4QJFA 1HNZL 3S2HB 2NVQH 1GJXA 5I2XA 3CAMA 1KL9A 1MD2D 2OWOA 4I7AA 3HOUB 4EQPA 4C3IG 3GTLH 4JI6L 2X6LA 2PZWA 2E2HH 4A3KG 1YITA 3K80C 4DU9A 3UDGA 3WOEA 4A3FG 1FR3A 2NTTA 4OIKA 5KIXA 2WV6D 1UUPA 1NNXA 4A3EG 4RHRA 3PO3H 3D31A 3SXHA 3UDIA 1TWGB 4A3BG 2NVXH 3A0JA 4ILWA 3CCUA 1ICFB 2KQ3A 5LL6S 2HCCA 5FJ8H 2VQEL 2AMCB 1U9RA 3NWSA 5IT9c 3GTPB 3PGZA 2UXDL 3PCOB 1IYVA 4J1MA 1WTPA 1G6ZA 1QE6A 4B3MQ 4PQXA 5M9OA 3S9WA 3KF6B 4XDXA 2F3WA 5M3MB 5I6YA 3CF5A 4RH6A 1HUNA 4B3TQ 3W2DA 3BU2A 3KLSX 2VUMG 2K32A 1PYSB 2VS1A 3U9SA 4LF8Q 2NB0A 1STBA 1KRTA 3GTOB 1KQSA 1E1OA 4F7XA 1F2LA 3M9BA 1B2TA 1GUOA 1TKWB 5I9OA 1PZID 3CC2A 1F9SA 1J6QA 3H09A 1XMOL 2L5TA 2DGYA 1MJCA 1B8AA 4CDEC 5BN5A 3TSSA 5CBAE 2ZM6Q 2F4VL 1K28A 3HOZB 3K5LA 3OWEB 1Y1WH 2CWAA 1GO3E 4RMFA 1YNNC 2VY3A 1LTTD 2CH4A 1D5MC 2DJGC 3C1EA 2F0IA 5JPNC 2B3GA 3S1MH 2NZ1D 2CWPA 2WIIB 3OYYA 2R92B 4DR7Q 1XNRQ 1B4OA 1STAA 1O7YA 1V1QA 4LFBL 4EQOA 1KLGD 1K3RA 1OXUA 1XYIA 1VQKA 1ET9A 3S2DB 5CV8A 3OWFA 3I4NH 3CHBD 5FK9C 5LMUQ 4A3JH 1E0BA 5E3FA 1I4PA 2K5WA 4DNIA 4S3SA 4KD4A 1X3QA 5M3FB 4L8JA 1K8MA 2I5HA 2EOTA 1UNSA 2JA6H 1I94L 3GD7A 1TS3A 5EPKA 3M4YA 2LXKA 2AUJD 1B3QA 2B2WA 1YBYA 2ZXPA 2I5LX 4JBJA 5FLMG 3H0GB 3GV3A 2DUDA 3ERQA 3E9HA 3E0EA 4B9WA 5M5XH 2Y0SB 3NWTA 3BYTB 3NEMA 2RSNA 2JYOA 5C3EB 1CM9A 3AEVA 3PIPA 1X3EA 5BN3A 2HHHL 4R1JA 3C46A 5JEAH 2RF4A 3HOVH 2F4IA 3OOCA 2CKZB 4R8IA 4HIDA 4P71A 3IFDA 3PIOA 3H3VH 3CW2C 2WB1G 1Y1VG 4JI4L 4KJNA 1LTRD 2BH8A 2B29A 4HSVA 2Z4IA 1X3PA 3P20A 1JQYD 3HOUG 3A56A 4DV4Q 1LYLA 2NUCA 3MXUA 1II3A 1JMCA 4WJWA 1LT4D 1L1OA 2A6ED 4X62Q 4H0LC 1UEAB 2NTSA 4N8FA 1SFOB 4HJ8A 1P8LA 5E1FA 1F2MA 4X64L 5IY0A 3J81E 1I4RA 4GLXA 4HJ7A 1C48A 4AH6A 1KIXA 1J9OA 1DYQA 1Q1BA 2WP8J 3HGBA 4HMIA 1CKNB 3L0OA 4QQBX 1JJ2A 5IE8A 1Q82C 1SROA 5IT9E 1EY9A 2RCNA 3P75A 1PRTC 1HNZQ 3OMCA 4DUZL 4JI0Q 3BYYB 2L11A 3IAYA 3A5UA 1FYCA 5M3MG 3UE0A 2F52A 2F03A 4JI6Q 4C3HH 1QILA 5A2QL 3E5SA 2Q8IB 3S15B 1GM5A 3SK8A 1EY7A 3DEOA 5TSSA 3CCJA 3I90A 1TWFB 4OWTB 2A8VA 2PMZB 4APVA 2R7ZB 3CPWA 1IW7D 1BF4A 2VXWA 3AYHB 4ZKCB 2J4XA 2VQEQ 3T56B 2N78A 5IWAL 2UXDQ 1B9NA 3ER0A 5CV5A 4OWXB 2HT1A 2K5VA 3MXNB 3CQZB 1BKBA 3KBGA 3HOZG 4C1NI 2VL6A 5IGGA 3HOYB 4DK1A 1X6OA 1S5CD 4JOIA 3JAMc 2B63B 3F2CA 3BZDB 2UXBL 1LT3D 4UP9A 3C1FA 3GTKH 1NMFA 4JV5L 2EYPA 2KEEA 5CBEE 5IP7G 4K8IA 4YWMA 2R92G 3SGIA 2PZUA 3JAMi 2E2JH 2D0PA 3GTQH 1ILPA 5CORA 2HCIA 4BY7H 2EY5A 4RFBA 3T16A 4LF9L 1E2ZA 3NPPA 2A6HC 3IL8A 3AQQA 4HMJA 3S16B 4KY5A 5M3FG 1EU4A 1VQIA 2KENA 4YCVA 1RODA 1HPCA 2AWOA 2F4VQ 2QEJC 1F2ZA 2A73B 1SYDA 3M4PA 5IYDH 1HQMC 4NP5A 1G6PA 1ONLA 4JG2A 1GD7A 4OGQC 4DR2L 2SOBA 4JC0A 3H0GG 3BDOA 3QJYA 1YZ6A 4O1NA 2QA4A 4PMCA 1G8ZD 5CGKA 3S1RH 1HZAA 1STGA 1VQPA 1VQ7A 4BBSH 1SMYD 4LFBQ 4V0BA 2F1MA 4ODGA 4U68A 1ZKOA 1X55A 1H9SA 4QL5A 4GLAC 5A35A 2Y0SG 2JXMB 4NPSA 3EN2A 3W3AA 4RGNA 5C3EG 3A8IE 3CC7A 1SYBA 5C0XI 3G4SA 4LUZA 3QOLA 2Y0SE 4K2LA 4J15A 3TREA 4ZYSA 5M5WH 4R4QA 5EJWA 2Q2UA 4FF3A 1L2FA 2MO1A 1U4PA 4B08A 2NYZD 2JK8A 4MIUA 1EOTA 1LT5D 1I94Q 1SN8A 5T1IA 5FLXE 1SE4A 5I9PA 5IIFA 4KTAA 3NP8A 1TT2A 3CMAA 2KOLA 1JOOA 5C0XG 1XNQL 4A3GH 2KECA 1K0SA 2KCNA 5JVG3 4CKBA 2KBNA 1SR3A 3DM3A 1C4QA 1EY6A 1TIID 3MAQA 4M1UB 5HURA 2F0MA 4FF4A 4PNYA 2HHHQ 1PH7A 4DV6L 1PYBA 3MXNA 3LWEA 1DCZA 1PFSA 1U4LA 3KDFA 3ITPA 5IYCG 3H3VC 4FYDA 1SSOA 1O7ZA 4C2MH 3Q8DA 4ZCKA 2B2WC 1EZ8A 3CCMA 5JOBA 4IUTA 1VQAA 4JI4Q 1WVLA 3GTJB 1WTRA 1PZJD 4ULLA 1K0RA 1V8QA 3RZOH 4U673 2AUKA 2L12A 1JJGA 1O78A 4MN3A 3CCQA 2UUCL
chains in the Genus database with same CATH topology
3S1NB 3S17B 1JICA 4UAIA 5J1ZA 3R3OA 1BQQT 2K5DA 1HA5A 1XX8A 3PO2B 4KI0A 1PFNA 3Q22A 2Q8RE 3PUVA 4K5WA 1PRTF 3AMUA 5J22A 1ENCA 3I72A 1GXDC 2F0QA 1BCPD 1MI2A 4YIJA 1BBXC 5JEAJ 1AEXA 4N9PA 1XTCD 5DNFA 5BN4A 2AWNA 1JOQA 4Q0FA 2LFNA 3A55A 1I6HB 2XNAC 1F9RA 4DF7A 3LX0A 1EQVA 3EA6A 2A5HA 1JORA 3OPOA 2WKCA 3MFGA 5C6AA 3KF8A 2RA4A 3H91A 1IYUA 5FO7B 1CQVA 1EFID 4A3DB 1Q3LA 2B39A 3I70A 3GTLB 3TMEA 3DMUA 2F0VA 2E2HB 1RKNA 1EEID 2EYOA 2K03A 4IURA 2EYLA 4ZAIA 1R4QB 3L3OC 5C4XB 5ELCA 2LMCB 3X3NA 3S1QB 2IW3A 1TS2A 1UAPA 2LS01 2E76C 2NN6G 1I4QA 1OO9B 2A68C 4UDUC 2IPKD 3D3RA 1DOKA 2IWHA 4EVOA 4FXDA 2KUMA 5C5MA 3M85A 1VMPA 1QOHA 2KJXA 1G291 4ZRZA 2F0TA 1A3VA 2PO4A 2B2VA 2RKSA 4A93B 1BUVT 1PXUA 3RLFA 5JJZA 1VF7A 5ELFA 3FKIB 2E75C 1GUWA 1TWCB 1A6XA 2KVMA 2IJ0A 5EKLA 2PW7A 1BDOA 3D4WA 3S14B 2OT2A 5K36H 2EYJA 2D62A 5EQ0A 3AB9A 4F88A 4HN7A 1I6VC 1GUNA 3MC0B 3SR1A 5JVH3 3EFXD 4BBRB 1SYCA 4BS9A 4CGYB 1HA6A 4E6IA 1A3UA 3SVMA 1TY0A 2F0FA 1S5FD 5EKKA 3GTMB 2XRSD 5ELDA 2TSSA 3V96A 4A3MB 2EZVA 2ZT9C 4G4KA 5CV9A 2K7VA 4ABNA 2DY7A 5KNBA 2MUYA 4M8AA 5C0XJ 1I3QB 2A68D 1HQRD 2F0UA 3HOVB 1M8AA 4RWSC 4TSSA 1QCBD 1PTOB 3BDLA 1RDPD 1XWEA 2F3VA 3D6WA 3M4OB 4K14A 3IKJA 1KTKA 3QO2A 3HOXB 1EY5A 3A8KE 4XT3B 3CKIB 1TVXA 1DXMA 4XYQA 1CHPD 2E74C 1VMCA 2RBMA 1EY8A 3D4RA 2K1BA 3VYSA 5E4WC 1RD9D 1F9PA 4QUFA 2H1EA 4RGMA 1CI3M 1ICWA 5D3DA 4BY1B 1AN8A 3BVGA 4CJ1B 3BG3A 4ZUIA 1D6EC 1R4PB 2F0EA 2EPBA 4B9XA 1BR9A 2A6EC 4KMUC 2YU9B 2NWGA 2X69A 3K5OA 2NVTB 1DOMA 2XWBB 4RKLA 2F0DA 3UI2A 1BNZA 1CTMA 2BA0A 3OIQA 1VF5C 4AYBB 5C4ZA 1IL8A 3ZYYX 3K59A 1E2VA 3MEHA 1SNOA 3T51B 5KEEA 2QILA 2LKVA 3VYUA 1L0XB 1IW7C 2RSOA 2G9HD 3M7GA 2F0HA 1TWHB 5E4XA 3J81L 1JWUD 3R8BA 3PIP3 2C5CA 2I46A 4P2CB 4FO2A 2Q8TA 5IT9L 1CFMA 1B50A 2XSCA 1CT1D 3F2UA 2WKDA 5C4JB 2QCPX 3K0YA 3PIO3 4CKCA 2MJ8A 2EY2A 1S5BD 2K6AA 3NBIA 2M2LA 2KA7A 4NMZA 4CJ0B 2B2VC 4IALA 1A2UA 3M3YB 2B2UA 4FP5D 2CW0C 3K7AB 1OXSC 3NXWA 3NTIA 3DEPA 3EJIA 1LLRD 4FVMA 1MGSA 1DD2A 4F8MA 1RCVD 2BOSA 4HCSA 3J80L 1RHPA 3ND8A 3SEBA 1SMYC 2A69D 1T5XD 2K05A 4X3KA 1KNEA 4KKTA 2AQ3B 5HGTA 5K5PA 4LK1C 5CR3A 2MPMA 1F2YA 1EQTA 4ZUJA 5ISRA 2D5DA 4RGTA 1SYGA 2R6GA 4IFDG 3HOWB 1EY4A 1O80A 3OIPA 3A7AB 4H7BA 3T13A 1SNCA 3BVMA 2B2TA 1TQOA 3E0JA 5KNDA 1SAPA 1CZWA 3H94A 4KY7A 4IUVA 3RZDB 4IUPA 5EBCA 1D5ZC 5FLXL 5IGBA 3TDQA 3D6CA 4HSPA 1R9TB 2NVYB 3GV6A 2CW0D 1GHKA 4RA8A 1ILQA 4KV6A 3VR2A 3VA5A 3QG1A 1LTBD 3I4MB 1Z6HA 1CZGA 3SK5A 2BDOA 5FO8B 1NUCA 3TN2A 1DONA 1Z47A 2H4OA 3P1HA 1BCPC 3TP7A 5C0XH 2ENBA 2JA7B 1HCZA 2L1BA 4BWGB 4JK1C 3I3CA 2IX3A 1SE3A 5C4HA 1LV9A 3FEWX 4K6DA 2F0GA 1B1ZA 4FNFA 4R9WA 3TZUA 1IHZA 3BDCA 1ESRA 3D4DA 4RGOS 1JB3A 3O13A 3NSWA 5IGFA 1Y8PB 2KEDA 3J7AV 2CQAA 4G7HC 4PMBA 3EVQA 5C3WA 3VA7A 1A15A 2OXPA 3HG9A 4QMGA 4FF1A 2G9DA 2LY7A 4WORA 4N9TA 1HTLD 5CV6A 4HEDA 2XN9C 3K6OA 4X3SA 1SJED 3VYTA 1ZYRD 2QF7A 4QF4A 3P7JA 5ELBA 3E6ZX 4DNRB 3I73A 2BE5D 5I4DA 5T1GA 4G7ZC 5IGCA 1GUGA 3C3LA 1WTQA 1K83B 2EE1A 1DM0B 2B2YA 2B2UC 1FD7D 1O7LA 3N6RA 2JA5B 3H6MA 1WD1A 2EDGA 4NW2A 1JWMD 5EPJA 5D14A 3JAME 1KDBA 1LABA 5CMDA 2PZTA 3CU7A 5M5YB 4HAEA 3DUZA 3GQBA 1Q1EA 5G3LD 1ESFA 1SNQA 1U4MA 2EYMA 2L9HA 1X32A 4IUUA 1PYWD 4HCEA 2EJFC 2AQ2B 4EGVA 1TY2A 3C2PA 3OHXC 3Q0AA 4EQNA 2HQEA 2RDFA 1PFMA 4WFN3 3V2TA 1JE4A 1IKLA 1ML0D 3TBIB 5DM63 3OSOA 2NVQB 1PRTB 1GUTA 1BO0A 2EYFA 1LO5D 3GP7A 1SXTA 4CKEA 1WTWA 1W6KA 2NN6I 2MHVA 4CJ2C 4RKBA 2NN6H 3KLRA 1TS5A 3ND9A 4IUQA 3PO3B 5EKIA 1PTOD 2NVXB 1I4GA 1MSHA 4DAPA 1GHJA 5JPMC 4DXGA 1D2BA 2EY1A 4XQJA 3ONAB 2B2TC 1NSNS 1V1PB 3FPPA 2EY6A 5CYUA 2PCFB 2SDFA 1ET6A 1RTOA 1CHQD 5ELEA 3QWNA 4BA1I 1Y8NB 1EZ6A 2RQXA 1EU3A 1SEBD 3EQLC 1EWCA 4K5XA 2M00A 3HRZC 1BCPF 4KJOA 5EBDA 2OEOA 2AQ1B 3PUWA 1GUSA 1B44D 2JEBI 3Q6SA 5I6WA 2O5IC 1YNJD 1Y1WB 5DM73 3OMGA 2IX0A 3S1MB 2K01A 3VR5A 3J7AF 1AZQA 5LL6X 4IQZA 4IZ8A 1WTOA 2IX1A 3I4NB 1HFNA 4NDXA 3MHBA 4OIJA 4A3JB 1W6JA 2F0SA 1G2TA 1B53A 1PZKD 3GTGB 1SE2A 1STEA 3BS1A 3MZ5A 2JA6B 5K36G 1JOKA 5IOCA 2EVBA 1LT6D 4OO1G 2JE6I 2IT1A 1H9RA 3URYA 1C8CA 4C1NK 4TRDA 4DNTB 5M5XB 1B9MA 3TP5A 2PQEA 1D1IA 1PLFA 3HS0C 2TMPA 2QDBA 2I07B 2FINB 2PYKA 4QUCA 1V1PA 2HUGA 4JBWA 5CC4A 4DN4M 4LMQD 3R93A 1FNVA 1RF2D 1U4RA 3X3MA 2R93B 2N88A 3SK4A 1OXTA 1H9MA 2K04A 4XXEA 4X3UA 2DY8A 5JAVA 5KYIA 3RUZA 3Q24A 1D1KA 2QKIC 4RCNA 1Y8OB 2X6GA 2B8GA 1EL0A 4G7OC 2K28A 3FDTA 2D9UA 4J8QA 5DAUA 5KGUA 4RHSA 3M7NA 5EPLA 2J0TD 2B2YC 1PFBA 1HFGA 2XRQD 4NKLA 5EGTA 4H44C 2F0WA 3DWPA 1CA5A 3KBXA 5KRUA 1NCVA 2ICIA 4C3HB 2PNRC 1AW7A 4CHTB 3FVQA 1MBYA 2A69C 1Y69U 1EIGA 1JCKB 4MHEA 3HZXA 1HUMA 2FMMA 1QNUA 3AU7A 2RVLA 4DK0A 1E2WA 3FMCA 3SE0A 5C3XA 2IL8A 1MSGA 2FMCA 2O5JC 4KHVA 3K57A 1LTID 4KD3A 2WINB 3HKZB 3LNNA 5KNCA 3GTKB 5D65A 3TP6A 3NHHA 1SDFA 2E2JB 4HR7B 3GTQB 3MFYA 4BY7B 1EEFD 1QJOA 4XTCS 2FFKB 1JWSD 4IN3A 1FGBD 3QIAA 3OW7A 4K6LA 5FKAC 1A3TA 2GA4B 1A2TA 1ZEQX 2N55A 4OL7A 2FHTA 1EYAA 1ZXTA 1OXXK 1VCIA 3CRLC 1NAPA 4KKUA 2L55A 4DFAA 3NK9A 1B3AA 3SK6A 5IGEA 3S1RB 4BBSB 1PTOH 4KHZA 2BCOA 4IUNA 3NBHA 3DXJC 3NQIA 3KLSA 1G91A 1KDCA 2SEBD 3DM1A 5JEAG 4J6HA 2JSOA 5M5WB 4K2KA 2K5QA 3RMHA 1K8OA 1CA6A 1H9JA 1F77A 2ID0A 4IFDI 3R2TA 1LTAD 4XT1B 3HEJA 4A3GB 1YNND 3A54A 4IFDH 3DHQA 4KY6A 4PV1C 1H9SB 3FRPB 4ZK9B 5NUCA 2O4XA 3TP8A 2VB2X 2BA1A 4DAVA 2BDNA 4HTHA 1Q90A 3QB3A 4FF2A 4C2MB 3I4LA 1DOLA 1FNWA 4KKSA 3RZOB 1HHVA 1CK1A 1ENFA 4C3HG 2F0NA 3QOJA 3WDNA 2SNMA 3KK7A 4XIGS 3PUXA 2E2IB 1NR2A 3EROA 3G6JB 1KAAA 2PW5A 2JA8B 4F87A 4DA2A 3J80E 2ICEC 5CV4A 1F9QA 2R61A 1QB5D 2XVSA 1ZYRC 4X3TA 4KK7A 5A2QE 2BE5C 2WACA 3I91A 4GZYC 4I7ZC 4A3IB 4R8NA 1KLUD 4C56C 3DWQA 3PUZA 2FJ2A 4KN4C 1H9KA 1EYDA 3TZDA 2XIWA 4RCOA 1V1OA 5LHY1 4FXGC 1RJTA 2F0LA 4C3JB 2RDGA 4ZQ3A 1PRTD 1SNPA 1SYFA 3MA2B 5FOBB 3MWYW 1HXYD 1DZ1A 3MXPA 2V4DA 4TKOB 2WAQB 2B8FA 1I4HA 3N52A 3HP3A 1SBBB 3A8JE 1WTVA 1TS4A 1Q8IA 3K58A 3JAML 3K5NA 5D3IB 1QWYA 2YYZA 4OHJA 1Z7TA 1Q12A 1VDZA 2ZXRA 1QG7A 1PTOC 1T5EA 4KN7C 4XYOA 2SNSA 5C5LA 3NTHA 4I65A 1L0YB 2A6HD 1BXTA 1WD0A 1S4ZA 3L7ZC 2VB3X 3T4AC 2DNCA 4FXKC 4DAYA 1EWHA 1PDQA 3BVZA 1IKMA 1SJHD 3G7LA 4PMWA 4TQUS 2C9OA 3VYRA 4XQNA 3A7LA 1BOSA 1KDAA 3FPUB 1D5XC 3R2IA 1HRJA 4QB4A 2R3ZA 5C44B 4DGZA 1YNJC 3T53B 3LWUA 1AFPA 1SNDA 1WCMB 2OF1A 2EYHA 1WTXA 4C3IB 2F0PA 1FNUA 3U9OA 2KHSA 4A3KB 3MVVA 4A3FB 1KNAA 2J7ZA 1J8IA 4A3EB 3SDZA 4LAAA 4A3BB 1EY0A 2L4NA 3NE5B 3NUCA 3J7YW 1LTSD 1PMRA 2XWJB 2O2LD 1HTPA 1M4VA 1S5DD 3I8ZA 4K5VA 1EYCA 4V190 3VR6A 4CBVA 1V43A 2Z8LA 2D2CC 2EJGC 1S5ED 3NQTA 2VUMB 1TWAB 1QNKA 4IFDJ 2M9VA 2JEAI 4Y7NB 4C3JG 3MXGA 3DWAA 3Q23A 4G57A 1GOZA 1LACA 1TR5A 3L9AX 1XXGA 5IGDA 3VR3A 5AFWA 2EJMA 2ZXOA 4Z9CB 3SHLA 2CVRA 3V05A 3D8GA 1DJRD 4H13C 1I50B 2K33A 5KYLA 2Z4HA 5FO9B 3VR4A 1NR4A 2HDLA 1EIHA 1KABA 4L6TB 1STNA 2L0CA 4QIWB 5J39A 3PMFA 2Z1CA 2HDMA 3IFTA 2MP1A 5COYA 2PPBC 5I2YA 4BA2I 5G3LF 4Q5VA 3K5MA 5F2DA 4L63B 2DN8A 2JP1A 5DEHA 4WRDA 2A74C 1SNMA 4DXFA 2EXZA 2RDHA 4ME5A 4ZKBB 1ENAA 3NTKA 4OO1I 4LJZC 2F0OA 1AZPA 5CV7A 2F0JA 4OO1H 1JR0D 2F0KA 2VNUD 3PV0A 1SYEA 4RAUC 3GO5A 1AP0A 1G2SA 1BCPB 1CQFA 2KCCA 5IODA 2MGSA 1OXVA 2CHBD 3RD4A 4O42A 4QCLA 1TU2B 3CRKC 4ZLTF 4K8JA 1STYA 3KUPA 1PTOF 4ID6A 3WOFA 1LTGD 2NBFA 3PUYA 1RTNA 2E2DC 1JC7A 3MTSA 4XQQA 2WB1B 1Y1VB 1I4XA 1STHA 2DNEA 3S2HB 1GJXA 5I2XA 1MD2D 3HOUB 4EQPA 4C3IG 2X6LA 2PZWA 4DU9A 3WOEA 1FR3A 2NTTA 4OIKA 5KIXA 2WV6D 1UUPA 4RHRA 3D31A 3SXHA 1TWGB 4ILWA 2KQ3A 5LL6S 2HCCA 3NWSA 1U9RA 3GTPB 1IYVA 4J1MA 1WTPA 1G6ZA 1QE6A 4PQXA 5M9OA 3S9WA 4XDXA 2F3WA 5M3MB 5I6YA 4RH6A 1HUNA 3W2DA 3KLSX 2K32A 3U9SA 2NB0A 1STBA 3GTOB 4F7XA 1F2LA 1B2TA 1GUOA 1TKWB 5I9OA 1PZID 1F9SA 3H09A 2L5TA 5BN5A 3TSSA 5CBAE 3HOZB 3K5LA 3OWEB 1YNNC 1LTTD 3C1EA 1D5MC 2F0IA 5JPNC 2NZ1D 2WIIB 2R92B 1B4OA 1STAA 1O7YA 4EQOA 1KLGD 1OXUA 1XYIA 1ET9A 3S2DB 5CV8A 3OWFA 3CHBD 5FK9C 1E0BA 5E3FA 1I4PA 2K5WA 4S3SA 4KD4A 1X3QA 5M3FB 4L8JA 1K8MA 2EOTA 1UNSA 3GD7A 1TS3A 5EPKA 3M4YA 2AUJD 2B2WA 2ZXPA 3H0GB 3GV3A 3ERQA 4B9WA 2Y0SB 3NWTA 3BYTB 2RSNA 2JYOA 5C3EB 1CM9A 5BN3A 3C46A 5JEAH 2F4IA 3OOCA 4R8IA 3IFDA 4KJNA 1LTRD 4HSVA 2Z4IA 1X3PA 3P20A 1JQYD 3A56A 2NUCA 3MXUA 1II3A 4WJWA 1LT4D 2A6ED 4H0LC 1UEAB 2NTSA 1SFOB 5E1FA 1F2MA 3J81E 1I4RA 1C48A 1J9OA 1DYQA 1Q1BA 2WP8J 3HGBA 4HMIA 5IT9E 1EY9A 3P75A 1PRTC 3OMCA 3BYYB 2L11A 3IAYA 1FYCA 2F03A 1QILA 5A2QL 3E5SA 2Q8IB 3S15B 3SK8A 1EY7A 3DEOA 5TSSA 3I90A 1TWFB 2PMZB 2R7ZB 1IW7D 1BF4A 2VXWA 4ZKCB 2J4XA 3T56B 1B9NA 5CV5A 3CQZB 3KBGA 4C1NI 5IGGA 3HOYB 4DK1A 1S5CD 2B63B 3BZDB 1LT3D 3C1FA 2EYPA 2KEEA 5CBEE 4K8IA 2PZUA 1ILPA 5CORA 2HCIA 2EY5A 4RFBA 3T16A 1E2ZA 3NPPA 2A6HC 3IL8A 4HMJA 3S16B 4KY5A 1EU4A 1RODA 1HPCA 2AWOA 2QEJC 1F2ZA 2A73B 1SYDA 1HQMC 4NP5A 1ONLA 4OGQC 2SOBA 3BDOA 3QJYA 4O1NA 4PMCA 1G8ZD 5CGKA 1STGA 1SMYD 4V0BA 2F1MA 4ODGA 4U68A 1ZKOA 1H9SA 5A35A 2JXMB 3W3AA 4RGNA 3A8IE 1SYBA 5C0XI 3QOLA 4K2LA 4ZYSA 5EJWA 4FF3A 1U4PA 4B08A 2NYZD 4MIUA 1EOTA 1LT5D 5T1IA 5FLXE 1SE4A 5I9PA 5IIFA 4KTAA 3NP8A 1TT2A 2KOLA 1JOOA 5C0XG 2KECA 2KCNA 5JVG3 4CKBA 1C4QA 1EY6A 1TIID 3MAQA 4M1UB 5HURA 2F0MA 4FF4A 4PNYA 3MXNA 3LWEA 1DCZA 1U4LA 3ITPA 3H3VC 4FYDA 1SSOA 1O7ZA 2B2WC 1EZ8A 5JOBA 4IUTA 1WVLA 3GTJB 1WTRA 1PZJD 4ULLA 1V8QA 4U673 2AUKA 2L12A 1O78A 4MN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E2Z A;  4PV1 C;  2A6H C;  2A68 C;  2NN6 I;  1H9S B;  4DK0 A;  2EVB A;  4OO1 G;  2JE6 I;  1E2W A;  2IT1 A;  1Y8P B;  1HPC A;  2NN6 H;  3FMC A;  2AWO A;  3KLR A;  3P20 A;  3SE0 A;  1GUO A;  1TKW B;  5BN4 A;  1H9R A;  3M85 A;  3ND9 A;  4G7H C;  3IKJ A;  1CFM A;  2BA1 A;  1G29 1;  1HQM C;  5KND A;  1ONL A;  4LJZ C;  3MXU A;  2O5J C;  4OGQ C;  4OO1 H;  4DNT B;  4KI0 A;  1Q90 A;  3VA7 A;  1B9M A;  2L5T A;  3A8K E;  3H94 A;  3PV0 A;  2V4D A;  2A6E D;  4H0L C;  3BDO A;  4TKO B;  3I4L A;  1GHJ A;  3QJY A;  3RLF A;  1DXM A;  3PUV A;  5BN5 A;  1VF7 A;  2B8F A;  2E74 C;  3LNN A;  3SDZ A;  2KCC A;  5KNC A;  2E75 C;  3NE5 B;  1OXV A;  3D4R A;  2F1M A;  1A6X A;  1ZKO A;  1YNN C;  1H9S A;  1TU2 B;  2KA7 A;  3A8J E;  3CRK C;  3I72 A;  1PMR A;  2JXM B;  5A35 A;  4JBW A;  3FPP A;  3W3A A;  1Q1B A;  4KKS A;  4HR7 B;  2PCF B;  3HGB A;  1HTP A;  3A8I E;  3MFY A;  1BDO A;  1QJO A;  2QF7 A;  1CI3 M;  4XTC S;  4BA1 I;  5K36 H;  4DNR B;  3VR6 A;  1GHK A;  1V43 A;  3I73 A;  2CW0 C;  1Y8N B;  2YYZ A;  1OXS C;  2D2C C;  1Z7T A;  1OXT A;  1Q12 A;  2EJG C;  3BG3 A;  1H9M A;  2BE5 D;  3QIA A;  1OXU A;  3PUY A;  3VR2 A;  1VDZ A;  3WDN A;  3EQL C;  1FYC A;  3OW7 A;  3QG1 A;  2D62 A;  4XIG S;  4G7Z C;  3AB9 A;  3PUX A;  1GUG A;  2JEA I;  1Z6H A;  2Q8I B;  2DNE A;  1T5E A;  1I6V C;  1GUN A;  2A6E C;  1DD2 A;  2BDO A;  4KMU C;  4KN7 C;  1OXX K;  4RCN A;  1VCI A;  3CRL C;  4L8J A;  1GJX A;  3PUW A;  1GUS A;  1K8M A;  1O7L A;  3N6R A;  1Y8O B;  3ND8 A;  4KKU A;  5C0X G;  2JEB I;  1SMY C;  2A69 D;  2EDG A;  2O5I C;  1LAC A;  3OPO A;  3GD7 A;  2B8G A;  3VR3 A;  1IW7 D;  4G7O C;  3M4Y A;  2AUJ D;  1LAB A;  2EJM A;  4KKT A;  5C0X H;  1IYU A;  4KHZ A;  3T56 B;  1ZYR C;  1HCZ A;  3DXJ C;  1FR3 A;  3GQB A;  4H13 C;  2A6H D;  4JK1 C;  4LK1 C;  1B9N A;  2K33 A;  1Q1E A;  3L7Z C;  3M7N A;  2DNC A;  3VR4 A;  2BE5 C;  3D31 A;  1DCZ A;  1CTM A;  1EWH A;  2BA0 A;  2ZT9 C;  5JEA G;  3VR5 A;  1VF5 C;  4GZY C;  2D5D A;  2EJF C;  4H44 C;  4I7Z C;  4DK1 A;  2K7V A;  4TQU S;  4IQZ A;  5BN3 A;  5JEA H;  3PUZ A;  2R6G A;  5KNB A;  1IYV A;  1K8O A;  1H9J A;  4IFD G;  3IFT A;  1E2V A;  1H9K A;  4KN4 C;  2PNR C;  3A7L A;  2PPB C;  3T51 B;  2LMC B;  3OOC A;  2A69 C;  1Y69 U;  1V8Q A;  4BA2 I;  2E76 C;  1IW7 C;  2AUK A;  4IFD H;  1YNJ C;  3TZU A;  3T53 B;  2A68 D;  2DN8 A;  3A7A B;  3LWU A;  2K32 A;  1O78 A;  1GUT A;  2NN6 G;  3U9S A;  5K36 G; 
#chains in the Genus database with same CATH topology
 3S1N B;  3S17 B;  1JIC A;  3KJP A;  4UAI A;  5J1Z A;  4OWW B;  1YHQ A;  3R3O A;  4GLV B;  1BQQ T;  2E2I H;  1FJG Q;  2K5D A;  4X64 Q;  2R7Z G;  1HA5 A;  1B7Y B;  1XX8 A;  2JA8 H;  3PO2 B;  2PMZ E;  1VQL A;  4X65 L;  4KI0 A;  4DR6 L;  1PFN A;  3EBE A;  3Q22 A;  2Q8R E;  3PUV A;  4K5W A;  4MTN A;  1MHW C;  1PRT F;  4DUZ Q;  3AMU A;  4JI5 Q;  4LFC L;  4P73 A;  5J22 A;  1Q7Y C;  4JBM A;  1ENC A;  3I72 A;  4PZ8 A;  1GXD C;  2F0Q A;  1BCP D;  3HOY G;  1MI2 A;  4IJL A;  2B63 G;  4DR1 Q;  3I4M H;  1K3B C;  4YIJ A;  1BBX C;  1U0L A;  5JEA J;  1AEX A;  4IJH A;  1UE5 A;  4LUO A;  4N9P A;  1WTH A;  1XTC D;  5DNF A;  5BN4 A;  4A3I H;  2AWN A;  1JOQ A;  4Q0F A;  1Q81 C;  2LFN A;  4UY8 C;  1QVF A;  3A55 A;  1IYJ B;  3TQY A;  1I6H B;  2XNA C;  5IWA Q;  3U4V A;  1F9R A;  1B70 B;  4DF7 A;  4L5S A;  3LX0 A;  2MFI A;  4LF7 L;  1EQV A;  3EA6 A;  2A5H A;  1JOR A;  3OPO A;  2WKC A;  3MFG A;  5C6A A;  3KF8 A;  1NTG A;  2RA4 A;  3H91 A;  1IYU A;  5FO7 B;  1CQV A;  1EFI D;  4A3D B;  2UXB Q;  1Q3L A;  2B39 A;  1VQN A;  3I70 A;  4JV5 Q;  2PI2 A;  2GVB A;  3TME A;  3GTL B;  3DMU A;  2F0V A;  4OX9 L;  2E2H B;  1RKN A;  1EEI D;  2EYO A;  2K03 A;  4IUR A;  2EYL A;  4ZAI A;  2LXJ A;  2F3I A;  4LF9 Q;  1R4Q B;  5IP9 H;  3L3O C;  5C4X B;  5ELC A;  2LMC B;  3X3N A;  3S1Q B;  2IW3 A;  2K52 A;  2Q2I A;  2MNA A;  1TS2 A;  1UAP A;  2LS0 1;  2E76 C;  4DV7 L;  3CCV A;  1WI5 A;  4HIK A;  4JOI C;  2NN6 G;  1E7Z A;  1I4Q A;  1OO9 B;  2QEX A;  1HNW L;  4GOP B;  2A68 C;  4DR2 Q;  2HIV A;  4UDU C;  2IPK D;  3D3R A;  1DOK A;  2IWH A;  4EVO A;  4FXD A;  2KUM A;  1HNX L;  5C5M A;  3M85 A;  4IPG A;  1VMP A;  1QOH A;  2KJX A;  1G29 1;  4ZRZ A;  1KRS A;  2F0T A;  1A3V A;  2LSS A;  2PO4 A;  2CCZ A;  2B2V A;  1V9P A;  1EWI A;  2RKS A;  4A93 B;  1UE6 A;  2PQA A;  3W1B A;  1BUV T;  1KHI A;  1PXU A;  2L15 A;  1UWV A;  3RLF A;  5JJZ A;  1VF7 A;  5ELF A;  3FKI B;  4KHP L;  2E75 C;  2YTY A;  1GUW A;  1TWC B;  1A6X A;  2KVM A;  1A8V A;  4DV2 L;  1VQJ A;  2IJ0 A;  5EKL A;  1HJP A;  3CME A;  1I5F A;  2PW7 A;  2NZH A;  1BDO A;  1CKM A;  3D4W A;  4ME3 A;  1FVI A;  3S14 B;  2OT2 A;  5K36 H;  4YHH L;  1RL2 A;  2EYJ A;  1XNQ Q;  3OW2 A;  1E1T A;  2D62 A;  5EQ0 A;  4LFA L;  1YVC A;  3AB9 A;  3STB D;  4F88 A;  1VQC A;  1I6V C;  1GUN A;  4HN7 A;  3UDX A;  1M1K C;  3MC0 B;  3SR1 A;  5JVH 3;  3EFX D;  4BBR B;  3WWV A;  5C44 H;  1SYC A;  4DV6 Q;  2CQO A;  4BS9 A;  2FXQ A;  2CH4 W;  4CGY B;  4OEL B;  1HA6 A;  5E7N A;  1PH1 A;  2CFM A;  4E6I A;  1A3U A;  3A5Z B;  3SVM A;  3PO2 G;  1TY0 A;  1X65 A;  2F0F A;  1S5F D;  4C3I H;  5EKK A;  1PH2 A;  3GTM B;  2XRS D;  2N49 A;  1W2B A;  1HR0 W;  5ELD A;  2TSS A;  3V96 A;  3L2P A;  4A3K H;  4A3M B;  2EZV A;  4NB3 A;  2ZT9 C;  1KXL A;  4G4K A;  5CV9 A;  2K7V A;  1E3P A;  1FGU A;  4A3E H;  4ABN A;  2DY7 A;  4A3B H;  4UP7 A;  2VQF Q;  2UUC Q;  5KNB A;  2MUY A;  3U4Z A;  4GN4 B;  1SLJ A;  3A74 A;  4M8A A;  5C0X J;  1I3Q B;  2A68 D;  1HQR D;  4P74 A;  2F0U A;  1CUK A;  1M8A A;  3HOV B;  1X56 A;  2K5H A;  4X65 Q;  4DR6 Q;  4RWS C;  4TSS A;  1QCB D;  1PTO B;  3BDL A;  2VUM H;  1RDP D;  1XWE A;  1H95 A;  2F3V A;  1TWA H;  3D6W A;  3M4O B;  1PA6 A;  4K14 A;  3TEH B;  3IKJ A;  1KTK A;  3QO2 A;  3HOX B;  4LFC Q;  1EY5 A;  4JVZ A;  4JI7 L;  3A8K E;  4XT3 B;  4B3S Q;  3CKI B;  4A3D G;  1TVX A;  1X3F A;  4PZ7 A;  3TS2 A;  1DXM A;  4XYQ A;  1CHP D;  2E74 C;  1VMC A;  2RBM A;  1EY8 A;  3D4R A;  2QDL A;  2K1B A;  3VYS A;  5E4W C;  1RD9 D;  1F9P A;  1I50 H;  3RR5 A;  4QUF A;  1QZG A;  2H1E A;  2I0Q A;  4JW0 A;  4RGM A;  1CI3 M;  1ICW A;  2AHO B;  5D3D A;  4BY1 B;  1AN8 A;  3BVG A;  4CJ1 B;  5C4X G;  3BG3 A;  4ZUI A;  1D6E C;  1R4P B;  3NBH B;  4LF7 Q;  2F0E A;  2EPB A;  4B9X A;  1BR9 A;  2A6E C;  4KMU C;  2OCE A;  2YU9 B;  1IZ6 A;  5JJI A;  4R4O A;  4OX9 Q;  2HD3 A;  1HZ9 A;  2NWG A;  1HH2 P;  2X69 A;  4GN3 B;  1N33 L;  3K5O A;  3RLN A;  4B3R L;  2NVT B;  1DOM A;  2XWB B;  2PNH A;  4RKL A;  4A93 G;  2F0D A;  1EQQ A;  3UI2 A;  1X54 A;  5GAE C;  3FKI G;  1BNZ A;  2ASB A;  1CTM A;  2BA0 A;  3OIQ A;  4AIM A;  5FLM H;  1UE7 A;  2K75 A;  1VF5 C;  1HR0 L;  4AYB B;  3G71 A;  4DV7 Q;  3GTG H;  1JJC B;  1IL8 A;  5C4Z A;  4PZ6 A;  3CXC A;  3G6E A;  1CKO A;  3ZYY X;  4DPG A;  3K59 A;  4R4I A;  1E2V A;  3MEH A;  1SNO A;  3T51 B;  5KEE A;  2QIL A;  2C35 B;  2LKV A;  1HNX Q;  3VYU A;  1L0X B;  1IW7 C;  2RSO A;  2G9H D;  1YJN A;  3M7G A;  2UU9 L;  2F0H A;  1TWH B;  5E4X A;  3M4Q A;  3J81 L;  1PH9 A;  4YWK A;  1JWU D;  3R8B A;  1WOC A;  2C5C A;  4BBR G;  2I46 A;  3J7Z C;  3PIP 3;  1Y1V H;  4P2C B;  4FO2 A;  2P5Z X;  2Q8T A;  5IT9 L;  4DAM A;  4DUY L;  1CFM A;  1B50 A;  2XSC A;  1CT1 D;  3F2U A;  4DV2 Q;  3KF6 A;  2WKD A;  5C4J B;  1XPO A;  2QCP X;  3K0Y A;  1XJV A;  3PIO 3;  4CKC A;  2MJ8 A;  3T1Y L;  2EY2 A;  3HOU H;  1S5B D;  2K6A A;  4GNX B;  4YHH Q;  3NBI A;  3K81 C;  2M2L A;  2R93 H;  4A3M G;  2KA7 A;  4NMZ A;  4POG A;  2B2V C;  5GQO A;  4CJ0 B;  4IAL A;  4JI8 L;  1A2U A;  3M3Y B;  3PF5 A;  1TWG H;  3TRZ A;  2B2U A;  4FP5 D;  2CW0 C;  3K7A B;  1OXS C;  5LMN L;  3NXW A;  3NTI A;  3GTP H;  3DEP A;  4YY3 L;  3EJI A;  1LLR D;  4FVM A;  1MGS A;  1DD2 A;  1WYD A;  3HOV G;  1E22 A;  5M3M H;  4F8M A;  1RCV D;  2BOS A;  4HCS A;  3J80 L;  1RHP A;  3ND8 A;  3SEB A;  1Q46 A;  1SMY C;  2A69 D;  1T5X D;  2K05 A;  4R4T A;  1PH5 A;  4X3K A;  1KNE A;  3HOX G;  4KKT A;  2AQ3 B;  3GTO H;  5HGT A;  1EFW A;  5K5P A;  3UE1 A;  4LK1 C;  5CR3 A;  2MPM A;  1F2Y A;  1EQT A;  2YTV A;  4ZUJ A;  2UXC L;  3F1Z A;  5ISR A;  2D5D A;  4RGT A;  3AFP A;  1SYG A;  4PG3 A;  3HOZ H;  2UUA L;  2R6G A;  5BR8 L;  1N34 L;  2IY5 B;  4IFD G;  1LTL A;  4LF6 L;  1EY4 A;  3HOW B;  1O80 A;  4BY1 G;  3U50 C;  4GN5 A;  3OIP A;  1KD1 C;  2JQO A;  3I4O A;  5IP7 H;  3A7A B;  2RHS B;  5AJ3 L;  3E3X A;  1IBK L;  3W5O A;  4H7B A;  3T13 A;  3S2D H;  1SNC A;  3BVM A;  4JBK A;  2B2T A;  1TQO A;  3E0J A;  2ZTD A;  5KND A;  1EQR A;  1SAP A;  1X9N A;  4EX5 A;  1CZW A;  3NEL A;  3H94 A;  4KY7 A;  4IUV A;  3RZD B;  4IUP A;  1KAW A;  5EBC A;  1D5Z C;  1JB7 A;  2BH2 A;  5FLX L;  4A75 A;  5IGB A;  3TDQ A;  3UDF A;  2ZJP A;  1VQ5 A;  1XMO Q;  1TXY A;  3D6C A;  4HSP A;  4AYB G;  1R9T B;  2NVY B;  3GV6 A;  1M90 C;  2CW0 D;  2WFW A;  4NXN L;  4AYB E;  1GHK A;  4RA8 A;  1ILQ A;  4DKA C;  4KV6 A;  5C3E H;  3BZK A;  1K8G A;  3VR2 A;  3VA5 A;  3QG1 A;  1LTB D;  3E9I A;  3I4M B;  1Z6H A;  4DAY B;  1N33 Q;  3F8T A;  1CZG A;  3SK5 A;  2BDO A;  4B3R Q;  3HKZ E;  5FO8 B;  1PVO A;  1NUC A;  3TN2 A;  1IL2 A;  1DON A;  2DJF C;  1CKN A;  1Z47 A;  2H4O A;  1IBM L;  3P1H A;  1HR0 Q;  1BCP C;  3TP7 A;  5C0X H;  2ENB A;  2JA7 B;  2KCT A;  1HCZ A;  2L1B A;  4BWG B;  4JK1 C;  4UPA A;  3I3C A;  2IX3 A;  1SE3 A;  2YTX A;  1OTC A;  5C4H A;  2E8G A;  3DLL A;  2VZA A;  1LV9 A;  1C7Y A;  3FEW X;  1SFO H;  2UU9 Q;  4K6D A;  1C0A A;  3EIV A;  2K50 A;  2F0G A;  1B1Z A;  4FNF A;  4R9W A;  3FHW A;  4LF5 L;  1EYG A;  1YNX A;  3TZU A;  1IHZ A;  3BDC A;  1ESR A;  4CDD C;  2GN5 A;  4LW1 A;  3D4D A;  4RGO S;  1JB3 A;  1LM0 A;  3O13 A;  3T1Y Q;  3NSW A;  5IGF A;  3I2Z A;  1Y8P B;  2KED A;  1VQB A;  3J7A V;  2CQA A;  3S15 H;  4G7H C;  1GKH A;  4NXM L;  4R4C A;  4PMB A;  3EVQ A;  5C3W A;  3VA7 A;  1A15 A;  2OXP A;  3HG9 A;  4QMG A;  1K73 C;  4FF1 A;  4JI8 Q;  4GKJ L;  2G9D A;  2LY7 A;  2R7Z H;  4WJ4 A;  2JA9 A;  4WOR A;  4JI3 L;  4OEM B;  4N9T A;  5LMN Q;  1HTL D;  1W3S A;  4DV1 L;  5CV6 A;  4HED A;  2XN9 C;  3K6O A;  4X3S A;  3RLO A;  4JCV E;  1SJE D;  3VYT A;  1ZYR D;  2QF7 A;  3CQZ H;  3P7J A;  4QF4 A;  5ELB A;  3E6Z X;  4K0K L;  4DNR B;  4IO9 A;  3I73 A;  3HOW G;  5GRO A;  3HOY H;  2BE5 D;  1EIF A;  5I4D A;  3K8A A;  2B63 H;  1GVP A;  5T1G A;  4G7Z C;  5IGC A;  1GUG A;  3BJU A;  3C3L A;  2Z6B A;  4X66 L;  1WTQ A;  3HKS A;  1K83 B;  2EE1 A;  1DM0 B;  3VDY A;  2B2Y A;  2B2U C;  1FD7 D;  1O7L A;  3N6R A;  2JA5 B;  3H6M A;  1WD1 A;  3KYH C;  2EDG A;  4NW2 A;  1YIJ A;  1VS0 A;  1JWM D;  5EPJ A;  5D14 A;  3JAM E;  2UXC Q;  1KDB A;  1LAB A;  5CMD A;  2PZT A;  3RNU A;  5ELN A;  4A4I A;  3S16 H;  3CU7 A;  5M5Y B;  4HAE A;  3DUZ A;  3GQB A;  1P16 A;  1WFQ A;  5BR8 Q;  1YI2 A;  2UUA Q;  1Q1E A;  4LF6 Q;  5G3L D;  2G5D A;  1BVS A;  1ESF A;  1SNQ A;  1U4M A;  2EYM A;  2L9H A;  1X32 A;  4IUU A;  1PYW D;  4HCE A;  5J3B A;  2EJF C;  2AQ2 B;  4EGV A;  3STB C;  1TY2 A;  1JE5 A;  3C2P A;  3OHX C;  3Q0A A;  4EQN A;  5AJ3 Q;  2HQE A;  2RDF A;  1IBK Q;  2Q2T A;  1PFM A;  4C3J H;  3F2B A;  4WFN 3;  3V2T A;  2K14 A;  5EAY A;  1JE4 A;  4MZ9 A;  1IKL A;  1ML0 D;  3TBI B;  5DM6 3;  3OSO A;  3RN5 A;  2NVQ B;  3HFZ B;  1NY4 A;  1PRT B;  4EQ5 A;  1GUT A;  1SRU A;  3I4M G;  1BO0 A;  2EYF A;  1LO5 D;  3GP7 A;  1SXT A;  4CKE A;  1WTW A;  3PQI A;  1W6K A;  2A19 A;  2NN6 I;  2MHV A;  2NZO A;  4CJ2 C;  4A3C H;  4RKB A;  1MJE A;  2NN6 H;  3KLR A;  1TS5 A;  3ND9 A;  2YV5 A;  4IUQ A;  4BXX G;  3PO3 B;  4X6A H;  5EKI A;  2H5X A;  1PTO D;  1NE3 A;  2NVX B;  1AH9 A;  2JA7 G;  1I4G A;  3ERS X;  1MSH A;  2MO0 A;  4DAP A;  1GHJ A;  5JPM C;  4DXG A;  1D2B A;  4LWC A;  2R7F A;  2EY1 A;  4XQJ A;  4DV5 L;  4WJ3 M;  3ONA B;  4RG1 A;  2B2T C;  2K5N A;  1NSN S;  1V1P B;  2Q2H A;  5H1S E;  1JT8 A;  4A76 A;  3FPP A;  2EY6 A;  5CYU A;  2PCF B;  2SDF A;  1ET6 A;  1RTO A;  1CHQ D;  4DR3 L;  5ELE A;  3RN2 A;  1S40 A;  2ATW A;  3QWN A;  4LF4 L;  4BA1 I;  3ICE A;  1PH4 A;  1NMG A;  1Y8N B;  1EZ6 A;  2RQX A;  1EU3 A;  1SEB D;  3EQL C;  3GTJ H;  1EWC A;  1IBM Q;  4K5X A;  2M00 A;  3HRZ C;  1XPR A;  4L5T A;  1MKH A;  1BCP F;  2XGT A;  4KJO A;  5EBD A;  2OEO A;  2AQ1 B;  4IOA A;  5IYB H;  4A3L G;  3PUW A;  1GUS A;  1B44 D;  4HIO A;  2JEB I;  3Q6S A;  5I6W A;  2O5I C;  3S1N H;  4IOC A;  1YNJ D;  1Y1W B;  3S17 H;  5DM7 3;  3OMG A;  2IX0 A;  3OTO L;  1VQ8 A;  3S1M B;  3PO2 H;  2K01 A;  3G48 A;  3VR5 A;  4LF5 Q;  4Y52 H;  3J7A F;  5L37 A;  1AZQ A;  5LL6 X;  4IPC A;  4IQZ A;  4IZ8 A;  1WTO A;  2IX1 A;  3I4N B;  1HFN A;  1WCM H;  4NDX A;  2OTJ A;  3MHB A;  4OIJ A;  4A3J B;  1W6J A;  4JI1 L;  2F0S A;  1G2T A;  1B53 A;  1PZK D;  3GTG B;  2UUB L;  1SE2 A;  4HJ9 A;  2Z6K A;  1STE A;  3BS1 A;  4NXM Q;  3MZ5 A;  2JA6 B;  5K36 G;  3U58 A;  1JOK A;  4A3F H;  5IOC A;  2EVB A;  1LT6 D;  4GKJ Q;  4OO1 G;  2JE6 I;  4DR5 L;  2IT1 A;  1S72 A;  4JI3 Q;  1EUJ A;  2HIX A;  4UP8 A;  2JA5 G;  1H9R A;  3URY A;  1C8C A;  4C1N K;  4TRD A;  4DV1 Q;  4DK3 C;  1I6H H;  4DNT B;  5M5X B;  3PSI A;  1B9M A;  3TP5 A;  2PQE A;  1D1I A;  1PLF A;  3HS0 C;  3KLW A;  4K0K Q;  2TMP A;  3JC6 6;  2QDB A;  2I07 B;  4CDF C;  2FIN B;  3CPF A;  2PYK A;  4QUC A;  1V1P A;  2HUG A;  4GOP A;  4A3D H;  4JI0 L;  2IHF A;  4JBW A;  5CC4 A;  3QR8 A;  4X66 Q;  4DN4 M;  1IXR A;  4LMQ D;  3R93 A;  1FNV A;  1RF2 D;  1KC8 C;  1XPU A;  1U4R A;  3X3M A;  4Y7N H;  2N88 A;  3SK4 A;  2R93 B;  1OXT A;  1H9M A;  2K04 A;  1VQF A;  4XXE A;  3FP9 A;  4X3U A;  1K8A C;  1VQ4 A;  4OON A;  3J81 c;  5C4X H;  1YEZ A;  2DY8 A;  5JJL A;  5JAV A;  3S1Q H;  5KYI A;  3RUZ A;  3Q24 A;  1D1K A;  2QKI C;  4RCN A;  1N9W A;  4P75 A;  1Y8O B;  1YJ9 A;  3J81 i;  1C9O A;  2X6G A;  2B8G A;  1EL0 A;  5LMN W;  1UEB A;  4G7O C;  2K28 A;  3PO3 G;  3FDT A;  2D9U A;  4J8Q A;  3CCL A;  5DAU A;  5KGU A;  4RHS A;  5FJ8 G;  3M7N A;  5EPL A;  2J0T D;  2B2Y C;  4P72 A;  1PFB A;  1N8R C;  2E5L L;  1HFG A;  1XMQ L;  2XRQ D;  4NKL A;  5EGT A;  2ZJR A;  4A93 H;  4H44 C;  2F0W A;  4AQY L;  3DWP A;  1CA5 A;  4H02 A;  1U5K A;  3KBX A;  5KRU A;  1NCV A;  3CCS A;  3FKI H;  2ICI A;  4C3H B;  1TWC H;  1QZH A;  4N8X 1;  2PNR C;  1AW7 A;  4CHT B;  3FVQ A;  1MBY A;  2A69 C;  1Y69 U;  1X3G A;  1HZB A;  1EIG A;  1JCK B;  1PV4 A;  1L1O B;  1PH6 A;  4MHE A;  3S14 H;  1VQD A;  1Q86 C;  3HZX A;  1HUM A;  4DR4 L;  2FMM A;  4OXP A;  4O2D A;  1QNU A;  3J80 c;  3AU7 A;  2D0O A;  2RVL A;  4DK0 A;  4DV3 L;  1E2W A;  1UE1 A;  3H15 A;  3FMC A;  3SE0 A;  1AE2 A;  5C3X A;  2IL8 A;  1MSG A;  3J80 i;  4DV5 Q;  2FMC A;  2O5J C;  4QIW E;  4KHV A;  3K57 A;  1HNW Q;  1LTI D;  4KD3 A;  4BBR H;  1DGS A;  4MNO A;  1Y1W G;  2WIN B;  4DR3 Q;  3I56 A;  4UHV A;  4LF4 Q;  3HKZ B;  2N3S A;  3LNN A;  5KNC A;  3GTK B;  5D65 A;  3K7U C;  1QVC A;  2VW9 A;  3TP6 A;  3NHH A;  5HGQ A;  1SDF A;  3CD6 A;  3GTM H;  2E2J B;  4HR7 B;  1VQE A;  3GTQ B;  3MFY A;  4KHP Q;  4BY7 B;  1EEF D;  1QJO A;  4XTC S;  2JN4 A;  4A3M H;  3I4N G;  4JPB W;  1D7Q A;  3KJO A;  4A3J G;  2FFK B;  3S2H H;  1JWS D;  4IN3 A;  1FGB D;  3QIA A;  2KHI A;  1XTD A;  3OW7 A;  2OTL A;  4K6L A;  5FKA C;  4GKK L;  1A3T A;  2GA4 B;  1A2T A;  1ZEQ X;  2N55 A;  1NJI C;  2V1C C;  1SE8 A;  1EYA A;  2FHT A;  4OL7 A;  4CDC C;  2JA6 G;  1ZXT A;  2K4K A;  1OXX K;  1QUQ B;  1VCI A;  3OTO Q;  1HZC A;  3CRL C;  4QGU A;  1NAP A;  4KKU A;  2L55 A;  4LFA Q;  1I3Q H;  2R7D A;  1N36 L;  4DFA A;  3NK9 A;  1B3A A;  3SK6 A;  5IGE A;  3S1R B;  4BBS B;  3H3V I;  1PTO H;  4KHZ A;  2BCO A;  4IUN A;  3NBH A;  3DXJ C;  3NQI A;  3M4O H;  2QW7 A;  5FLX c;  3KLS A;  1G91 A;  1KDC A;  2ZTC A;  2SEB D;  3HOX H;  3DM1 A;  4JI1 Q;  5JEA G;  2WB1 E;  4J6H A;  2UUB Q;  2JSO A;  5M5W B;  3J7A 5;  4K2K A;  2K5Q A;  3T1H L;  3RMH A;  1K8O A;  1CA6 A;  1H9J A;  1F77 A;  2ID0 A;  4DR5 Q;  4IFD I;  3D0F A;  2R93 G;  1LUZ A;  2GVA A;  3R2T A;  1LTA D;  4XT1 B;  3ZJY C;  3I55 A;  3HEJ A;  4A3G B;  1YNN D;  3A54 A;  4IFD H;  3DHQ A;  5DLQ E;  3GDE A;  3CC4 A;  3MEF A;  1FJG L;  4BY1 H;  1VQO A;  5HY6 A;  4KY6 A;  3F2D A;  4PV1 C;  4JYA L;  1H9S B;  3FRP B;  1A62 A;  4ZK9 B;  5NUC A;  2O4X A;  4L5R C;  5GAG C;  1BBU A;  3TP8 A;  1IBL L;  2VB2 X;  2BA1 A;  4DAV A;  2Z6K C;  2BDN A;  2OQ0 A;  2YU9 H;  4JI5 L;  4HTH A;  1Q90 A;  2EQS A;  3QB3 A;  3K0X A;  4FF2 A;  4C2M B;  3I4L A;  4DR1 L;  1DOL A;  2R92 H;  1FNW A;  4JI7 Q;  4TVA B;  2NVT H;  4KKS A;  3RZO B;  1HHV A;  1CK1 A;  1ENF A;  4C3H G;  2F0N A;  3QOJ A;  1O7I A;  5M3F H;  3WDN A;  2SNM A;  3KK7 A;  4XIG S;  4GOP C;  3PUX A;  2E2I B;  1NR2 A;  4GNX A;  3W1G A;  2HQL A;  3ERO A;  4HIM A;  3G6J B;  1KAA A;  3KDF B;  1QUQ A;  2PW5 A;  2JA8 B;  4F87 A;  4DA2 A;  4YCU A;  5GAD C;  3J80 E;  3H0G H;  2ICE C;  5CV4 A;  1F9Q A;  2E5L Q;  1VQM A;  1XMQ Q;  1TWH H;  2R61 A;  1QB5 D;  1J5E L;  4AQY Q;  1YHB A;  2XVS A;  2I5M X;  1ZYR C;  4X3T A;  4KK7 A;  3HKZ G;  5A2Q E;  2BE5 C;  2WAC A;  5C4J H;  3I91 A;  4GZY C;  4I7Z C;  1YHA A;  3KFU A;  4A3I B;  4R8N A;  1QVG A;  1KLU D;  4C56 C;  3DWQ A;  4DR4 Q;  3PUZ A;  4QY7 A;  4BY7 G;  2FJ2 A;  4KN4 C;  1H9K A;  2JJQ A;  4DV3 Q;  1EYD A;  2KHJ A;  3TZD A;  4O0A A;  2XIW A;  4MTK A;  4RCO A;  3LGJ A;  3M3Y H;  1V1O A;  5LHY 1;  4FXG C;  2ZTE A;  3K7A H;  1VQH A;  1RJT A;  2F0L A;  4C3J B;  5IYD G;  1T9H A;  2RDG A;  4ZQ3 A;  1CSQ A;  1PRT D;  1SNP A;  1SYF A;  3CCR A;  3MA2 B;  5FOB B;  4JI2 L;  5IYC H;  1SMX A;  2OQK A;  3MWY W;  5ELO A;  1HXY D;  1L0W A;  4BBS G;  1DZ1 A;  3MXP A;  1RIP A;  2A1A A;  2V4D A;  4TKO B;  2WAQ B;  2B8F A;  1I4H A;  4YCW A;  4DUY Q;  2KCM A;  3N52 A;  3HP3 A;  1SBB B;  5GAH C;  3A8J E;  1WTV A;  4GKK Q;  1TS4 A;  1Q8I A;  3K58 A;  3ULL A;  3JAM L;  3K5N A;  1A0I A;  3KF8 B;  1VQ6 A;  5D3I B;  1QWY A;  2YYZ A;  4OHJ A;  1Z7T A;  1Q12 A;  2QGQ A;  1TWF H;  1VDZ A;  3I7F A;  2ZXR A;  4ALP A;  1PH3 A;  1N36 Q;  1ASZ A;  4A3G G;  1QG7 A;  1PTO C;  3HOW H;  3KOJ A;  3ULJ A;  3B6Y A;  1T5E A;  4KN7 C;  4XYO A;  2SNS A;  5C5L A;  4DV0 L;  3NTH A;  4YY3 Q;  4LNQ A;  4I65 A;  1N32 L;  1L0Y B;  3T1H Q;  3J81 j;  2A6H D;  1BXT A;  1CSP A;  1WD0 A;  1S4Z A;  3L7Z C;  4DK6 C;  2VB3 X;  3T4A C;  3TS0 A;  2DNC A;  4FXK C;  2VQF L;  4DAY A;  1EWH A;  1PDQ A;  3BVZ A;  2AKW B;  1IKM A;  1SJH D;  2ES2 A;  5JJK A;  3RZD H;  3G7L A;  4PMW A;  1ASY A;  4TQU S;  2C9O A;  1VQG A;  1WJJ A;  3VYR A;  4XQN A;  4JYA Q;  3A7L A;  1BOS A;  1KDA A;  3FPU B;  1R9T H;  1D5X C;  3R2I A;  1HRJ A;  2NVY H;  4QB4 A;  2R3Z A;  2PQA B;  2EXD A;  1IBL Q;  5C44 B;  4DGZ A;  1YNJ C;  3T53 B;  3LWU A;  1N34 Q;  1AFP A;  1SND A;  1WCM B;  2OF1 A;  3CP0 A;  2EYH A;  4B3M L;  1G51 A;  2JA8 G;  4B3S L;  1WTX A;  4C3I B;  2F0P A;  1L1O C;  1FNU A;  4B3T L;  3U9O A;  2KHS A;  4A3K B;  4LF8 L;  3MVV A;  2Z9H A;  4A3F B;  2IHE A;  1KNA A;  3BZC A;  2J7Z A;  3NEN A;  1J8I A;  4A3E B;  4BXX H;  3SDZ A;  4LAA A;  4A3B B;  1EY0 A;  3NE5 B;  2L4N A;  3NUC A;  2JA7 H;  3J7Y W;  1MIU A;  3IRB A;  1LTS D;  1PMR A;  2XWJ B;  4LUV A;  2O2L D;  1HTP A;  1M4V A;  1S5D D;  3I8Z A;  4A3I G;  4K5V A;  1EYC A;  4V19 0;  3AFQ A;  3VR6 A;  4CBV A;  2ZM6 L;  1V43 A;  2Z8L A;  1PH8 A;  4GS3 A;  2D2C C;  2EJG C;  1S5E D;  1Z9F A;  3NQT A;  1YJW A;  1PHJ A;  4NXN Q;  2VUM B;  1TWA B;  1QNK A;  4IFD J;  2M9V A;  2JEA I;  1J5E Q;  2RCF A;  1BBW A;  4Y7N B;  4DR7 L;  4C3J G;  1XNR L;  3PF4 A;  3MXG A;  3DWA A;  3Q23 A;  3CCE A;  4G57 A;  1E24 A;  1GOZ A;  1LAC A;  1TR5 A;  3L9A X;  1FL0 A;  1XXG A;  5IGD A;  3VR3 A;  5AFW A;  4A3L H;  5LMU L;  3S24 A;  2EJM A;  4GNX C;  2ZXO A;  4Z9C B;  3SHL A;  2CVR A;  3V05 A;  1EIY B;  3D8G A;  1DJR D;  4H13 C;  1NBW A;  1I50 B;  2K33 A;  4A3C G;  5KYL A;  2EIF A;  2WAQ G;  2Z4H A;  4IPH A;  4KLK A;  5FO9 B;  3VR4 A;  1NR4 A;  2HDL A;  2MQH A;  4POF A;  1EIH A;  5IP9 G;  1KAB A;  4L6T B;  2WAQ E;  1STN A;  2L0C A;  4QIW B;  5J39 A;  2RHQ B;  1K9M C;  3PMF A;  2Z1C A;  2HDM A;  2ALY B;  3IFT A;  2MP1 A;  1EOV A;  5COY A;  2PPB C;  5I2Y A;  4BA2 I;  5G3L F;  4Q5V A;  3K5M A;  5F2D A;  1S3O A;  4FDB A;  4JI2 Q;  4L63 B;  1Q8K A;  2DN8 A;  2JP1 A;  5DEH A;  4WRD A;  2A74 C;  1SNM A;  4DXF A;  3ULP A;  2EXZ A;  2RDH A;  4ME5 A;  4ZKB B;  2N8N A;  2PI2 E;  1ENA A;  3NTK A;  4OO1 I;  1K83 H;  4IPD A;  4LJZ C;  2F0O A;  1AZP A;  5CV7 A;  2F0J A;  4OO1 H;  1JR0 D;  2F0K A;  2VNU D;  3PV0 A;  1SYE A;  2JA5 H;  4RAU C;  1D8L A;  5IYB G;  3GO5 A;  1AP0 A;  1G2S A;  1BCP B;  1CQF A;  2KCC A;  5IOD A;  2MGS A;  4HJA A;  1OXV A;  2CHB D;  4DV4 L;  3RD4 A;  1AE3 A;  4O42 A;  4QCL A;  1TU2 B;  5M5Y H;  2ZJQ A;  3CRK C;  1Y14 B;  4HJ5 A;  4ZLT F;  4K8J A;  4L5Q A;  2Z0S A;  4X62 L;  1STY A;  3KUP A;  1PTO F;  4ID6 A;  3WOF A;  1LTG D;  1VQ9 A;  2NBF A;  1A63 A;  4DV0 Q;  3PUY A;  1RTN A;  4YWL A;  2E2D C;  1JC7 A;  3MTS A;  4XQQ A;  2WB1 B;  1Y1V B;  5C44 G;  1I4X A;  1STH A;  1N32 Q;  2DNE A;  1WCM G;  2XTI A;  4QJF A;  1HNZ L;  3S2H B;  2NVQ H;  1GJX A;  5I2X A;  3CAM A;  1KL9 A;  1MD2 D;  2OWO A;  4I7A A;  3HOU B;  4EQP A;  4C3I G;  3GTL H;  4JI6 L;  2X6L A;  2PZW A;  2E2H H;  4A3K G;  1YIT A;  3K80 C;  4DU9 A;  3UDG A;  3WOE A;  4A3F G;  1FR3 A;  2NTT A;  4OIK A;  5KIX A;  2WV6 D;  1UUP A;  1NNX A;  4A3E G;  4RHR A;  3PO3 H;  3D31 A;  3SXH A;  3UDI A;  1TWG B;  4A3B G;  2NVX H;  3A0J A;  4ILW A;  3CCU A;  1ICF B;  2KQ3 A;  5LL6 S;  2HCC A;  5FJ8 H;  2VQE L;  2AMC B;  1U9R A;  3NWS A;  5IT9 c;  3GTP B;  3PGZ A;  2UXD L;  3PCO B;  1IYV A;  4J1M A;  1WTP A;  1G6Z A;  1QE6 A;  4B3M Q;  4PQX A;  5M9O A;  3S9W A;  3KF6 B;  4XDX A;  2F3W A;  5M3M B;  5I6Y A;  3CF5 A;  4RH6 A;  1HUN A;  4B3T Q;  3W2D A;  3BU2 A;  3KLS X;  2VUM G;  2K32 A;  1PYS B;  2VS1 A;  3U9S A;  4LF8 Q;  2NB0 A;  1STB A;  1KRT A;  3GTO B;  1KQS A;  1E1O A;  4F7X A;  1F2L A;  3M9B A;  1B2T A;  1GUO A;  1TKW B;  5I9O A;  1PZI D;  3CC2 A;  1F9S A;  1J6Q A;  3H09 A;  1XMO L;  2L5T A;  2DGY A;  1MJC A;  1B8A A;  4CDE C;  5BN5 A;  3TSS A;  5CBA E;  2ZM6 Q;  2F4V L;  1K28 A;  3HOZ B;  3K5L A;  3OWE B;  1Y1W H;  2CWA A;  1GO3 E;  4RMF A;  1YNN C;  2VY3 A;  1LTT D;  2CH4 A;  1D5M C;  2DJG C;  3C1E A;  2F0I A;  5JPN C;  2B3G A;  3S1M H;  2NZ1 D;  2CWP A;  2WII B;  3OYY A;  2R92 B;  4DR7 Q;  1XNR Q;  1B4O A;  1STA A;  1O7Y A;  1V1Q A;  4LFB L;  4EQO A;  1KLG D;  1K3R A;  1OXU A;  1XYI A;  1VQK A;  1ET9 A;  3S2D B;  5CV8 A;  3OWF A;  3I4N H;  3CHB D;  5FK9 C;  5LMU Q;  4A3J H;  1E0B A;  5E3F A;  1I4P A;  2K5W A;  4DNI A;  4S3S A;  4KD4 A;  1X3Q A;  5M3F B;  4L8J A;  1K8M A;  2I5H A;  2EOT A;  1UNS A;  2JA6 H;  1I94 L;  3GD7 A;  1TS3 A;  5EPK A;  3M4Y A;  2LXK A;  2AUJ D;  1B3Q A;  2B2W A;  1YBY A;  2ZXP A;  2I5L X;  4JBJ A;  5FLM G;  3H0G B;  3GV3 A;  2DUD A;  3ERQ A;  3E9H A;  3E0E A;  4B9W A;  5M5X H;  2Y0S B;  3NWT A;  3BYT B;  3NEM A;  2RSN A;  2JYO A;  5C3E B;  1CM9 A;  3AEV A;  3PIP A;  1X3E A;  5BN3 A;  2HHH L;  4R1J A;  3C46 A;  5JEA H;  2RF4 A;  3HOV H;  2F4I A;  3OOC A;  2CKZ B;  4R8I A;  4HID A;  4P71 A;  3IFD A;  3PIO A;  3H3V H;  3CW2 C;  2WB1 G;  1Y1V G;  4JI4 L;  4KJN A;  1LTR D;  2BH8 A;  2B29 A;  4HSV A;  2Z4I A;  1X3P A;  3P20 A;  1JQY D;  3HOU G;  3A56 A;  4DV4 Q;  1LYL A;  2NUC A;  3MXU A;  1II3 A;  1JMC A;  4WJW A;  1LT4 D;  1L1O A;  2A6E D;  4X62 Q;  4H0L C;  1UEA B;  2NTS A;  4N8F A;  1SFO B;  4HJ8 A;  1P8L A;  5E1F A;  1F2M A;  4X64 L;  5IY0 A;  3J81 E;  1I4R A;  4GLX A;  4HJ7 A;  1C48 A;  4AH6 A;  1KIX A;  1J9O A;  1DYQ A;  1Q1B A;  2WP8 J;  3HGB A;  4HMI A;  1CKN B;  3L0O A;  4QQB X;  1JJ2 A;  5IE8 A;  1Q82 C;  1SRO A;  5IT9 E;  1EY9 A;  2RCN A;  3P75 A;  1PRT C;  1HNZ Q;  3OMC A;  4DUZ L;  4JI0 Q;  3BYY B;  2L11 A;  3IAY A;  3A5U A;  1FYC A;  5M3M G;  3UE0 A;  2F52 A;  2F03 A;  4JI6 Q;  4C3H H;  1QIL A;  5A2Q L;  3E5S A;  2Q8I B;  3S15 B;  1GM5 A;  3SK8 A;  1EY7 A;  3DEO A;  5TSS A;  3CCJ A;  3I90 A;  1TWF B;  4OWT B;  2A8V A;  2PMZ B;  4APV A;  2R7Z B;  3CPW A;  1IW7 D;  1BF4 A;  2VXW A;  3AYH B;  4ZKC B;  2J4X A;  2VQE Q;  3T56 B;  2N78 A;  5IWA L;  2UXD Q;  1B9N A;  3ER0 A;  5CV5 A;  4OWX B;  2HT1 A;  2K5V A;  3MXN B;  3CQZ B;  1BKB A;  3KBG A;  3HOZ G;  4C1N I;  2VL6 A;  5IGG A;  3HOY B;  4DK1 A;  1X6O A;  1S5C D;  4JOI A;  3JAM c;  2B63 B;  3F2C A;  3BZD B;  2UXB L;  1LT3 D;  4UP9 A;  3C1F A;  3GTK H;  1NMF A;  4JV5 L;  2EYP A;  2KEE A;  5CBE E;  5IP7 G;  4K8I A;  4YWM A;  2R92 G;  3SGI A;  2PZU A;  3JAM i;  2E2J H;  2D0P A;  3GTQ H;  1ILP A;  5COR A;  2HCI A;  4BY7 H;  2EY5 A;  4RFB A;  3T16 A;  4LF9 L;  1E2Z A;  3NPP A;  2A6H C;  3IL8 A;  3AQQ A;  4HMJ A;  3S16 B;  4KY5 A;  5M3F G;  1EU4 A;  1VQI A;  2KEN A;  4YCV A;  1ROD A;  1HPC A;  2AWO A;  2F4V Q;  2QEJ C;  1F2Z A;  2A73 B;  1SYD A;  3M4P A;  5IYD H;  1HQM C;  4NP5 A;  1G6P A;  1ONL A;  4JG2 A;  1GD7 A;  4OGQ C;  4DR2 L;  2SOB A;  4JC0 A;  3H0G G;  3BDO A;  3QJY A;  1YZ6 A;  4O1N A;  2QA4 A;  4PMC A;  1G8Z D;  5CGK A;  3S1R H;  1HZA A;  1STG A;  1VQP A;  1VQ7 A;  4BBS H;  1SMY D;  4LFB Q;  4V0B A;  2F1M A;  4ODG A;  4U68 A;  1ZKO A;  1X55 A;  1H9S A;  4QL5 A;  4GLA C;  5A35 A;  2Y0S G;  2JXM B;  4NPS A;  3EN2 A;  3W3A A;  4RGN A;  5C3E G;  3A8I E;  3CC7 A;  1SYB A;  5C0X I;  3G4S A;  4LUZ A;  3QOL A;  2Y0S E;  4K2L A;  4J15 A;  3TRE A;  4ZYS A;  5M5W H;  4R4Q A;  5EJW A;  2Q2U A;  4FF3 A;  1L2F A;  2MO1 A;  1U4P A;  4B08 A;  2NYZ D;  2JK8 A;  4MIU A;  1EOT A;  1LT5 D;  1I94 Q;  1SN8 A;  5T1I A;  5FLX E;  1SE4 A;  5I9P A;  5IIF A;  4KTA A;  3NP8 A;  1TT2 A;  3CMA A;  2KOL A;  1JOO A;  5C0X G;  1XNQ L;  4A3G H;  2KEC A;  1K0S A;  2KCN A;  5JVG 3;  4CKB A;  2KBN A;  1SR3 A;  3DM3 A;  1C4Q A;  1EY6 A;  1TII D;  3MAQ A;  4M1U B;  5HUR A;  2F0M A;  4FF4 A;  4PNY A;  2HHH Q;  1PH7 A;  4DV6 L;  1PYB A;  3MXN A;  3LWE A;  1DCZ A;  1PFS A;  1U4L A;  3KDF A;  3ITP A;  5IYC G;  3H3V C;  4FYD A;  1SSO A;  1O7Z A;  4C2M H;  3Q8D A;  4ZCK A;  2B2W C;  1EZ8 A;  3CCM A;  5JOB A;  4IUT A;  1VQA A;  4JI4 Q;  1WVL A;  3GTJ B;  1WTR A;  1PZJ D;  4ULL A;  1K0R A;  1V8Q A;  3RZO H;  4U67 3;  2AUK A;  2L12 A;  1JJG A;  1O78 A;  4MN3 A;  3CCQ A;  2UUC L; 
#chains in the Genus database with same CATH homology
 3S1N B;  3S17 B;  1JIC A;  4UAI A;  5J1Z A;  3R3O A;  1BQQ T;  2K5D A;  1HA5 A;  1XX8 A;  3PO2 B;  4KI0 A;  1PFN A;  3Q22 A;  2Q8R E;  3PUV A;  4K5W A;  1PRT F;  3AMU A;  5J22 A;  1ENC A;  3I72 A;  1GXD C;  2F0Q A;  1BCP D;  1MI2 A;  4YIJ A;  1BBX C;  5JEA J;  1AEX A;  4N9P A;  1XTC D;  5DNF A;  5BN4 A;  2AWN A;  1JOQ A;  4Q0F A;  2LFN A;  3A55 A;  1I6H B;  2XNA C;  1F9R A;  4DF7 A;  3LX0 A;  1EQV A;  3EA6 A;  2A5H A;  1JOR A;  3OPO A;  2WKC A;  3MFG A;  5C6A A;  3KF8 A;  2RA4 A;  3H91 A;  1IYU A;  5FO7 B;  1CQV A;  1EFI D;  4A3D B;  1Q3L A;  2B39 A;  3I70 A;  3GTL B;  3TME A;  3DMU A;  2F0V A;  2E2H B;  1RKN A;  1EEI D;  2EYO A;  2K03 A;  4IUR A;  2EYL A;  4ZAI A;  1R4Q B;  3L3O C;  5C4X B;  5ELC A;  2LMC B;  3X3N A;  3S1Q B;  2IW3 A;  1TS2 A;  1UAP A;  2LS0 1;  2E76 C;  2NN6 G;  1I4Q A;  1OO9 B;  2A68 C;  4UDU C;  2IPK D;  3D3R A;  1DOK A;  2IWH A;  4EVO A;  4FXD A;  2KUM A;  5C5M A;  3M85 A;  1VMP A;  1QOH A;  2KJX A;  1G29 1;  4ZRZ A;  2F0T A;  1A3V A;  2PO4 A;  2B2V A;  2RKS A;  4A93 B;  1BUV T;  1PXU A;  3RLF A;  5JJZ A;  1VF7 A;  5ELF A;  3FKI B;  2E75 C;  1GUW A;  1TWC B;  1A6X A;  2KVM A;  2IJ0 A;  5EKL A;  2PW7 A;  1BDO A;  3D4W A;  3S14 B;  2OT2 A;  5K36 H;  2EYJ A;  2D62 A;  5EQ0 A;  3AB9 A;  4F88 A;  4HN7 A;  1I6V C;  1GUN A;  3MC0 B;  3SR1 A;  5JVH 3;  3EFX D;  4BBR B;  1SYC A;  4BS9 A;  4CGY B;  1HA6 A;  4E6I A;  1A3U A;  3SVM A;  1TY0 A;  2F0F A;  1S5F D;  5EKK A;  3GTM B;  2XRS D;  5ELD A;  2TSS A;  3V96 A;  4A3M B;  2EZV A;  2ZT9 C;  4G4K A;  5CV9 A;  2K7V A;  4ABN A;  2DY7 A;  5KNB A;  2MUY A;  4M8A A;  5C0X J;  1I3Q B;  2A68 D;  1HQR D;  2F0U A;  3HOV B;  1M8A A;  4RWS C;  4TSS A;  1QCB D;  1PTO B;  3BDL A;  1RDP D;  1XWE A;  2F3V A;  3D6W A;  3M4O B;  4K14 A;  3IKJ A;  1KTK A;  3QO2 A;  3HOX B;  1EY5 A;  3A8K E;  4XT3 B;  3CKI B;  1TVX A;  1DXM A;  4XYQ A;  1CHP D;  2E74 C;  1VMC A;  2RBM A;  1EY8 A;  3D4R A;  2K1B A;  3VYS A;  5E4W C;  1RD9 D;  1F9P A;  4QUF A;  2H1E A;  4RGM A;  1CI3 M;  1ICW A;  5D3D A;  4BY1 B;  1AN8 A;  3BVG A;  4CJ1 B;  3BG3 A;  4ZUI A;  1D6E C;  1R4P B;  2F0E A;  2EPB A;  4B9X A;  1BR9 A;  2A6E C;  4KMU C;  2YU9 B;  2NWG A;  2X69 A;  3K5O A;  2NVT B;  1DOM A;  2XWB B;  4RKL A;  2F0D A;  3UI2 A;  1BNZ A;  1CTM A;  2BA0 A;  3OIQ A;  1VF5 C;  4AYB B;  5C4Z A;  1IL8 A;  3ZYY X;  3K59 A;  1E2V A;  3MEH A;  1SNO A;  3T51 B;  5KEE A;  2QIL A;  2LKV A;  3VYU A;  1L0X B;  1IW7 C;  2RSO A;  2G9H D;  3M7G A;  2F0H A;  1TWH B;  5E4X A;  3J81 L;  1JWU D;  3R8B A;  3PIP 3;  2C5C A;  2I46 A;  4P2C B;  4FO2 A;  2Q8T A;  5IT9 L;  1CFM A;  1B50 A;  2XSC A;  1CT1 D;  3F2U A;  2WKD A;  5C4J B;  2QCP X;  3K0Y A;  3PIO 3;  4CKC A;  2MJ8 A;  2EY2 A;  1S5B D;  2K6A A;  3NBI A;  2M2L A;  2KA7 A;  4NMZ A;  4CJ0 B;  2B2V C;  4IAL A;  1A2U A;  3M3Y B;  2B2U A;  4FP5 D;  2CW0 C;  3K7A B;  1OXS C;  3NXW A;  3NTI A;  3DEP A;  3EJI A;  1LLR D;  4FVM A;  1MGS A;  1DD2 A;  4F8M A;  1RCV D;  2BOS A;  4HCS A;  3J80 L;  1RHP A;  3ND8 A;  3SEB A;  1SMY C;  2A69 D;  1T5X D;  2K05 A;  4X3K A;  1KNE A;  4KKT A;  2AQ3 B;  5HGT A;  5K5P A;  4LK1 C;  5CR3 A;  2MPM A;  1F2Y A;  1EQT A;  4ZUJ A;  5ISR A;  2D5D A;  4RGT A;  1SYG A;  2R6G A;  4IFD G;  3HOW B;  1EY4 A;  1O80 A;  3OIP A;  3A7A B;  4H7B A;  3T13 A;  1SNC A;  3BVM A;  2B2T A;  1TQO A;  3E0J A;  5KND A;  1SAP A;  1CZW A;  3H94 A;  4KY7 A;  4IUV A;  3RZD B;  4IUP A;  5EBC A;  1D5Z C;  5FLX L;  5IGB A;  3TDQ A;  3D6C A;  4HSP A;  1R9T B;  2NVY B;  3GV6 A;  2CW0 D;  1GHK A;  4RA8 A;  1ILQ A;  4KV6 A;  3VR2 A;  3VA5 A;  3QG1 A;  1LTB D;  3I4M B;  1Z6H A;  1CZG A;  3SK5 A;  2BDO A;  5FO8 B;  1NUC A;  3TN2 A;  1DON A;  1Z47 A;  2H4O A;  3P1H A;  1BCP C;  3TP7 A;  5C0X H;  2ENB A;  2JA7 B;  1HCZ A;  2L1B A;  4BWG B;  4JK1 C;  3I3C A;  2IX3 A;  1SE3 A;  5C4H A;  1LV9 A;  3FEW X;  4K6D A;  2F0G A;  1B1Z A;  4FNF A;  4R9W A;  3TZU A;  1IHZ A;  3BDC A;  1ESR A;  3D4D A;  4RGO S;  1JB3 A;  3O13 A;  3NSW A;  5IGF A;  1Y8P B;  2KED A;  3J7A V;  2CQA A;  4G7H C;  4PMB A;  3EVQ A;  5C3W A;  3VA7 A;  1A15 A;  2OXP A;  3HG9 A;  4QMG A;  4FF1 A;  2G9D A;  2LY7 A;  4WOR A;  4N9T A;  1HTL D;  5CV6 A;  4HED A;  2XN9 C;  3K6O A;  4X3S A;  1SJE D;  3VYT A;  1ZYR D;  2QF7 A;  4QF4 A;  3P7J A;  5ELB A;  3E6Z X;  4DNR B;  3I73 A;  2BE5 D;  5I4D A;  5T1G A;  4G7Z C;  5IGC A;  1GUG A;  3C3L A;  1WTQ A;  1K83 B;  2EE1 A;  1DM0 B;  2B2Y A;  2B2U C;  1FD7 D;  1O7L A;  3N6R A;  2JA5 B;  3H6M A;  1WD1 A;  2EDG A;  4NW2 A;  1JWM D;  5EPJ A;  5D14 A;  3JAM E;  1KDB A;  1LAB A;  5CMD A;  2PZT A;  3CU7 A;  5M5Y B;  4HAE A;  3DUZ A;  3GQB A;  1Q1E A;  5G3L D;  1ESF A;  1SNQ A;  1U4M A;  2EYM A;  2L9H A;  1X32 A;  4IUU A;  1PYW D;  4HCE A;  2EJF C;  2AQ2 B;  4EGV A;  1TY2 A;  3C2P A;  3OHX C;  3Q0A A;  4EQN A;  2HQE A;  2RDF A;  1PFM A;  4WFN 3;  3V2T A;  1JE4 A;  1IKL A;  1ML0 D;  3TBI B;  5DM6 3;  3OSO A;  2NVQ B;  1PRT B;  1GUT A;  1BO0 A;  2EYF A;  1LO5 D;  3GP7 A;  1SXT A;  4CKE A;  1WTW A;  1W6K A;  2NN6 I;  2MHV A;  4CJ2 C;  4RKB A;  2NN6 H;  3KLR A;  1TS5 A;  3ND9 A;  4IUQ A;  3PO3 B;  5EKI A;  1PTO D;  2NVX B;  1I4G A;  1MSH A;  4DAP A;  1GHJ A;  5JPM C;  4DXG A;  1D2B A;  2EY1 A;  4XQJ A;  3ONA B;  2B2T C;  1NSN S;  1V1P B;  3FPP A;  2EY6 A;  5CYU A;  2PCF B;  2SDF A;  1ET6 A;  1RTO A;  1CHQ D;  5ELE A;  3QWN A;  4BA1 I;  1Y8N B;  1EZ6 A;  2RQX A;  1EU3 A;  1SEB D;  3EQL C;  1EWC A;  4K5X A;  2M00 A;  3HRZ C;  1BCP F;  4KJO A;  5EBD A;  2OEO A;  2AQ1 B;  3PUW A;  1GUS A;  1B44 D;  2JEB I;  3Q6S A;  5I6W A;  2O5I C;  1YNJ D;  1Y1W B;  5DM7 3;  3OMG A;  2IX0 A;  3S1M B;  2K01 A;  3VR5 A;  3J7A F;  1AZQ A;  5LL6 X;  4IQZ A;  4IZ8 A;  1WTO A;  2IX1 A;  3I4N B;  1HFN A;  4NDX A;  3MHB A;  4OIJ A;  4A3J B;  1W6J A;  2F0S A;  1G2T A;  1B53 A;  1PZK D;  3GTG B;  1SE2 A;  1STE A;  3BS1 A;  3MZ5 A;  2JA6 B;  5K36 G;  1JOK A;  5IOC A;  2EVB A;  1LT6 D;  4OO1 G;  2JE6 I;  2IT1 A;  1H9R A;  3URY A;  1C8C A;  4C1N K;  4TRD A;  4DNT B;  5M5X B;  1B9M A;  3TP5 A;  2PQE A;  1D1I A;  1PLF A;  3HS0 C;  2TMP A;  2QDB A;  2I07 B;  2FIN B;  2PYK A;  4QUC A;  1V1P A;  2HUG A;  4JBW A;  5CC4 A;  4DN4 M;  4LMQ D;  3R93 A;  1FNV A;  1RF2 D;  1U4R A;  3X3M A;  2R93 B;  2N88 A;  3SK4 A;  1OXT A;  1H9M A;  2K04 A;  4XXE A;  4X3U A;  2DY8 A;  5JAV A;  5KYI A;  3RUZ A;  3Q24 A;  1D1K A;  2QKI C;  4RCN A;  1Y8O B;  2X6G A;  2B8G A;  1EL0 A;  4G7O C;  2K28 A;  3FDT A;  2D9U A;  4J8Q A;  5DAU A;  5KGU A;  4RHS A;  3M7N A;  5EPL A;  2J0T D;  2B2Y C;  1PFB A;  1HFG A;  2XRQ D;  4NKL A;  5EGT A;  4H44 C;  2F0W A;  3DWP A;  1CA5 A;  3KBX A;  5KRU A;  1NCV A;  2ICI A;  4C3H B;  2PNR C;  1AW7 A;  4CHT B;  3FVQ A;  1MBY A;  2A69 C;  1Y69 U;  1EIG A;  1JCK B;  4MHE A;  3HZX A;  1HUM A;  2FMM A;  1QNU A;  3AU7 A;  2RVL A;  4DK0 A;  1E2W A;  3FMC A;  3SE0 A;  5C3X A;  2IL8 A;  1MSG A;  2FMC A;  2O5J C;  4KHV A;  3K57 A;  1LTI D;  4KD3 A;  2WIN B;  3HKZ B;  3LNN A;  5KNC A;  3GTK B;  5D65 A;  3TP6 A;  3NHH A;  1SDF A;  2E2J B;  4HR7 B;  3GTQ B;  3MFY A;  4BY7 B;  1EEF D;  1QJO A;  4XTC S;  2FFK B;  1JWS D;  4IN3 A;  1FGB D;  3QIA A;  3OW7 A;  4K6L A;  5FKA C;  1A3T A;  2GA4 B;  1A2T A;  1ZEQ X;  2N55 A;  4OL7 A;  2FHT A;  1EYA A;  1ZXT A;  1OXX K;  1VCI A;  3CRL C;  1NAP A;  4KKU A;  2L55 A;  4DFA A;  3NK9 A;  1B3A A;  3SK6 A;  5IGE A;  3S1R B;  4BBS B;  1PTO H;  4KHZ A;  2BCO A;  4IUN A;  3NBH A;  3DXJ C;  3NQI A;  3KLS A;  1G91 A;  1KDC A;  2SEB D;  3DM1 A;  5JEA G;  4J6H A;  2JSO A;  5M5W B;  4K2K A;  2K5Q A;  3RMH A;  1K8O A;  1CA6 A;  1H9J A;  1F77 A;  2ID0 A;  4IFD I;  3R2T A;  1LTA D;  4XT1 B;  3HEJ A;  4A3G B;  1YNN D;  3A54 A;  4IFD H;  3DHQ A;  4KY6 A;  4PV1 C;  1H9S B;  3FRP B;  4ZK9 B;  5NUC A;  2O4X A;  3TP8 A;  2VB2 X;  2BA1 A;  4DAV A;  2BDN A;  4HTH A;  1Q90 A;  3QB3 A;  4FF2 A;  4C2M B;  3I4L A;  1DOL A;  1FNW A;  4KKS A;  3RZO B;  1HHV A;  1CK1 A;  1ENF A;  4C3H G;  2F0N A;  3QOJ A;  3WDN A;  2SNM A;  3KK7 A;  4XIG S;  3PUX A;  2E2I B;  1NR2 A;  3ERO A;  3G6J B;  1KAA A;  2PW5 A;  2JA8 B;  4F87 A;  4DA2 A;  3J80 E;  2ICE C;  5CV4 A;  1F9Q A;  2R61 A;  1QB5 D;  2XVS A;  1ZYR C;  4X3T A;  4KK7 A;  5A2Q E;  2BE5 C;  2WAC A;  3I91 A;  4GZY C;  4I7Z C;  4A3I B;  4R8N A;  1KLU D;  4C56 C;  3DWQ A;  3PUZ A;  2FJ2 A;  4KN4 C;  1H9K A;  1EYD A;  3TZD A;  2XIW A;  4RCO A;  1V1O A;  5LHY 1;  4FXG C;  1RJT A;  2F0L A;  4C3J B;  2RDG A;  4ZQ3 A;  1PRT D;  1SNP A;  1SYF A;  3MA2 B;  5FOB B;  3MWY W;  1HXY D;  1DZ1 A;  3MXP A;  2V4D A;  4TKO B;  2WAQ B;  2B8F A;  1I4H A;  3N52 A;  3HP3 A;  1SBB B;  3A8J E;  1WTV A;  1TS4 A;  1Q8I A;  3K58 A;  3JAM L;  3K5N A;  5D3I B;  1QWY A;  2YYZ A;  4OHJ A;  1Z7T A;  1Q12 A;  1VDZ A;  2ZXR A;  1QG7 A;  1PTO C;  1T5E A;  4KN7 C;  4XYO A;  2SNS A;  5C5L A;  3NTH A;  4I65 A;  1L0Y B;  2A6H D;  1BXT A;  1WD0 A;  1S4Z A;  3L7Z C;  2VB3 X;  3T4A C;  2DNC A;  4FXK C;  4DAY A;  1EWH A;  1PDQ A;  3BVZ A;  1IKM A;  1SJH D;  3G7L A;  4PMW A;  4TQU S;  2C9O A;  3VYR A;  4XQN A;  3A7L A;  1BOS A;  1KDA A;  3FPU B;  1D5X C;  3R2I A;  1HRJ A;  4QB4 A;  2R3Z A;  5C44 B;  4DGZ A;  1YNJ C;  3T53 B;  3LWU A;  1AFP A;  1SND A;  1WCM B;  2OF1 A;  2EYH A;  1WTX A;  4C3I B;  2F0P A;  1FNU A;  3U9O A;  2KHS A;  4A3K B;  3MVV A;  4A3F B;  1KNA A;  2J7Z A;  1J8I A;  4A3E B;  3SDZ A;  4LAA A;  4A3B B;  1EY0 A;  2L4N A;  3NE5 B;  3NUC A;  3J7Y W;  1LTS D;  1PMR A;  2XWJ B;  2O2L D;  1HTP A;  1M4V A;  1S5D D;  3I8Z A;  4K5V A;  1EYC A;  4V19 0;  3VR6 A;  4CBV A;  1V43 A;  2Z8L A;  2D2C C;  2EJG C;  1S5E D;  3NQT A;  2VUM B;  1TWA B;  1QNK A;  4IFD J;  2M9V A;  2JEA I;  4Y7N B;  4C3J G;  3MXG A;  3DWA A;  3Q23 A;  4G57 A;  1GOZ A;  1LAC A;  1TR5 A;  3L9A X;  1XXG A;  5IGD A;  3VR3 A;  5AFW A;  2EJM A;  2ZXO A;  4Z9C B;  3SHL A;  2CVR A;  3V05 A;  3D8G A;  1DJR D;  4H13 C;  1I50 B;  2K33 A;  5KYL A;  2Z4H A;  5FO9 B;  3VR4 A;  1NR4 A;  2HDL A;  1EIH A;  1KAB A;  4L6T B;  1STN A;  2L0C A;  4QIW B;  5J39 A;  3PMF A;  2Z1C A;  2HDM A;  3IFT A;  2MP1 A;  5COY A;  2PPB C;  5I2Y A;  4BA2 I;  5G3L F;  4Q5V A;  3K5M A;  5F2D A;  4L63 B;  2DN8 A;  2JP1 A;  5DEH A;  4WRD A;  2A74 C;  1SNM A;  4DXF A;  2EXZ A;  2RDH A;  4ME5 A;  4ZKB B;  1ENA A;  3NTK A;  4OO1 I;  4LJZ C;  2F0O A;  1AZP A;  5CV7 A;  2F0J A;  4OO1 H;  1JR0 D;  2F0K A;  2VNU D;  3PV0 A;  1SYE A;  4RAU C;  3GO5 A;  1AP0 A;  1G2S A;  1BCP B;  1CQF A;  2KCC A;  5IOD A;  2MGS A;  1OXV A;  2CHB D;  3RD4 A;  4O42 A;  4QCL A;  1TU2 B;  3CRK C;  4ZLT F;  4K8J A;  1STY A;  3KUP A;  1PTO F;  4ID6 A;  3WOF A;  1LTG D;  2NBF A;  3PUY A;  1RTN A;  2E2D C;  1JC7 A;  3MTS A;  4XQQ A;  2WB1 B;  1Y1V B;  1I4X A;  1STH A;  2DNE A;  3S2H B;  1GJX A;  5I2X A;  1MD2 D;  3HOU B;  4EQP A;  4C3I G;  2X6L A;  2PZW A;  4DU9 A;  3WOE A;  1FR3 A;  2NTT A;  4OIK A;  5KIX A;  2WV6 D;  1UUP A;  4RHR A;  3D31 A;  3SXH A;  1TWG B;  4ILW A;  2KQ3 A;  5LL6 S;  2HCC A;  3NWS A;  1U9R A;  3GTP B;  1IYV A;  4J1M A;  1WTP A;  1G6Z A;  1QE6 A;  4PQX A;  5M9O A;  3S9W A;  4XDX A;  2F3W A;  5M3M B;  5I6Y A;  4RH6 A;  1HUN A;  3W2D A;  3KLS X;  2K32 A;  3U9S A;  2NB0 A;  1STB A;  3GTO B;  4F7X A;  1F2L A;  1B2T A;  1GUO A;  1TKW B;  5I9O A;  1PZI D;  1F9S A;  3H09 A;  2L5T A;  5BN5 A;  3TSS A;  5CBA E;  3HOZ B;  3K5L A;  3OWE B;  1YNN C;  1LTT D;  3C1E A;  1D5M C;  2F0I A;  5JPN C;  2NZ1 D;  2WII B;  2R92 B;  1B4O A;  1STA A;  1O7Y A;  4EQO A;  1KLG D;  1OXU A;  1XYI A;  1ET9 A;  3S2D B;  5CV8 A;  3OWF A;  3CHB D;  5FK9 C;  1E0B A;  5E3F A;  1I4P A;  2K5W A;  4S3S A;  4KD4 A;  1X3Q A;  5M3F B;  4L8J A;  1K8M A;  2EOT A;  1UNS A;  3GD7 A;  1TS3 A;  5EPK A;  3M4Y A;  2AUJ D;  2B2W A;  2ZXP A;  3H0G B;  3GV3 A;  3ERQ A;  4B9W A;  2Y0S B;  3NWT A;  3BYT B;  2RSN A;  2JYO A;  5C3E B;  1CM9 A;  5BN3 A;  3C46 A;  5JEA H;  2F4I A;  3OOC A;  4R8I A;  3IFD A;  4KJN A;  1LTR D;  4HSV A;  2Z4I A;  1X3P A;  3P20 A;  1JQY D;  3A56 A;  2NUC A;  3MXU A;  1II3 A;  4WJW A;  1LT4 D;  2A6E D;  4H0L C;  1UEA B;  2NTS A;  1SFO B;  5E1F A;  1F2M A;  3J81 E;  1I4R A;  1C48 A;  1J9O A;  1DYQ A;  1Q1B A;  2WP8 J;  3HGB A;  4HMI A;  5IT9 E;  1EY9 A;  3P75 A;  1PRT C;  3OMC A;  3BYY B;  2L11 A;  3IAY A;  1FYC A;  2F03 A;  1QIL A;  5A2Q L;  3E5S A;  2Q8I B;  3S15 B;  3SK8 A;  1EY7 A;  3DEO A;  5TSS A;  3I90 A;  1TWF B;  2PMZ B;  2R7Z B;  1IW7 D;  1BF4 A;  2VXW A;  4ZKC B;  2J4X A;  3T56 B;  1B9N A;  5CV5 A;  3CQZ B;  3KBG A;  4C1N I;  5IGG A;  3HOY B;  4DK1 A;  1S5C D;  2B63 B;  3BZD B;  1LT3 D;  3C1F A;  2EYP A;  2KEE A;  5CBE E;  4K8I A;  2PZU A;  1ILP A;  5COR A;  2HCI A;  2EY5 A;  4RFB A;  3T16 A;  1E2Z A;  3NPP A;  2A6H C;  3IL8 A;  4HMJ A;  3S16 B;  4KY5 A;  1EU4 A;  1ROD A;  1HPC A;  2AWO A;  2QEJ C;  1F2Z A;  2A73 B;  1SYD A;  1HQM C;  4NP5 A;  1ONL A;  4OGQ C;  2SOB A;  3BDO A;  3QJY A;  4O1N A;  4PMC A;  1G8Z D;  5CGK A;  1STG A;  1SMY D;  4V0B A;  2F1M A;  4ODG A;  4U68 A;  1ZKO A;  1H9S A;  5A35 A;  2JXM B;  3W3A A;  4RGN A;  3A8I E;  1SYB A;  5C0X I;  3QOL A;  4K2L A;  4ZYS A;  5EJW A;  4FF3 A;  1U4P A;  4B08 A;  2NYZ D;  4MIU A;  1EOT A;  1LT5 D;  5T1I A;  5FLX E;  1SE4 A;  5I9P A;  5IIF A;  4KTA A;  3NP8 A;  1TT2 A;  2KOL A;  1JOO A;  5C0X G;  2KEC A;  2KCN A;  5JVG 3;  4CKB A;  1C4Q A;  1EY6 A;  1TII D;  3MAQ A;  4M1U B;  5HUR A;  2F0M A;  4FF4 A;  4PNY A;  3MXN A;  3LWE A;  1DCZ A;  1U4L A;  3ITP A;  3H3V C;  4FYD A;  1SSO A;  1O7Z A;  2B2W C;  1EZ8 A;  5JOB A;  4IUT A;  1WVL A;  3GTJ B;  1WTR A;  1PZJ D;  4ULL A;  1V8Q A;  4U67 3;  2AUK A;  2L12 A;  1O78 A;  4MN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...