1GHJA

Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from azotobacter vineland ii, nmr, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
79
structure length
79
Chain Sequence
AIDIKAPTFPESIADGTVATWHKKPGEAVKRDELIVDIETDKVVMEVLAEADGVIAEIVKNEGDTVLSGELLGKLTEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from Azotobacter vinelandii.
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Acyltransferase
molecule keywords E2, THE DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE COMPONENT OF 2-
total genus 7
structure length 79
sequence length 79
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 1996-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ghjA00
1Y8PB 3DXJC 1GUGA 4OGQC 1GUNA 1HPCA 3A8JE 4TKOB 2JXMB 4G7HC 3PV0A 2DN8A 1QJOA 1ONLA 2R6GA 2A6ED 2BE5C 3VR4A 1H9RA 1ZKOA 4JBWA 2ZT9C 1LABA 3FPPA 2B8GA 1IW7C 1OXTA 2V4DA 3A8IE 3KLRA 3ND9A 4KN7C 5BN5A 3VA7A 3VR6A 2JE6I 3TZUA 2NN6H 1SMYC 3CRKC 4IFDG 1FR3A 1BDOA 1B9NA 2A68C 4KKTA 3T56B 2DNEA 5KNCA 2AUJD 3H94A 4KHZA 4KKSA 2E74C 1IYVA 1V8QA 2BA1A 2CW0C 5KNBA 2AUKA 4HR7B 3L7ZC 1Y8NB 3A7LA 2KA7A 2O5JC 3I72A 1GUTA 4XIGS 3NE5B 3N6RA 4I7ZC 3GD7A 3RLFA 4G7OC 2D2CC 1VF5C 1GJXA 2A69C 2L5TA 3W3AA 2A6EC 4G7ZC 1K8MA 1YNJC 1PMRA 2K32A 3OPOA 3PUVA 4BA1I 4KI0A 2LMCB 5BN4A 3I73A 2JEBI 1TKWB 2EDGA 1Z7TA 3QG1A 2IT1A 2PCFB 4LK1C 4RCNA 1Z6HA 1Q90A 3PUZA 1DD2A 1K8OA 4DNTB 3BG3A 2PPBC 1O7LA 2BDOA 3WDNA 5K36H 5JEAG 4DK0A 2D5DA 1E2VA 3M7NA 1H9MA 2AWOA 1H9KA 2A69D 4JK1C 3VR5A 3MXUA 2D62A 1Y69U 3SE0A 2JEAI 1IW7D 1FYCA 3MFYA 3A8KE 4H13C 3SDZA 1GUOA 3IKJA 1Q12A 3A7AB 4L8JA 2E75C 3PUWA 4PV1C 4H44C 3AB9A 4LJZC 1E2ZA 1IYUA 1VDZA 3LNNA 1ZYRC 4H0LC 5C0XG 4IFDH 2EVBA 3PUXA 3EQLC 4KKUA 1H9SA 3HGBA 3QIAA 4KN4C 3FMCA 3T51B 4OO1H 1O78A 2NN6G 1DCZA 1HTPA 1GUSA 1Y8OB 2NN6I 3GQBA 4DNRB 2B8FA 1TU2B 2BE5D 1EWHA 2YYZA 3I4LA 1CI3M 1DXMA 1OXXK 2EJGC 2EJMA 3BDOA 1E2WA 3D31A 1HCZA 3CRLC 5KNDA 2EJFC 3T53B 5JEAH 1HQMC 3M85A 3D4RA 4XTCS 4IQZA 2A6HD 2E76C 1G291 1V43A 2O5IC 1H9SB 4GZYC 4DK1A 2A68D 2A6HC 1T5EA 1OXVA 3OOCA 3VR2A 3VR3A 1CFMA 1OXUA 2K33A 3U9SA 1Q1BA 1VCIA 1GHKA 4BA2I 3OW7A 2BA0A 4KMUC 1Q1EA 1I6VC 1GHJA 3PUYA 4OO1G 1B9MA 2Q8IB 1VF7A 2QF7A 3QJYA 2F1MA 2PNRC 4TQUS 5K36G 1OXSC 1H9JA 2DNCA 3LWUA 3P20A 1YNNC 5A35A 5BN3A 1A6XA 1CTMA 3M4YA 1LACA 2K7VA 2KCCA 3IFTA 3ND8A 5C0XH
chains in the Genus database with same CATH superfamily
2CH4W 1N33L 2I5HA 2JXMB 2F0TA 1TWGH 3PV0A 4OWTB 4ILWA 5EKIA 2UUCL 2E2HB 2IW3A 2RKSA 5IGFA 4IPGA 2UXBL 4N8FA 4JW0A 4IURA 3TBIB 1HTLD 3IAYA 5IGCA 1TS4A 1XPUA 2SNSA 2A73B 4AYBB 4IUVA 3DLLA 2CW0D 2A68C 3CMEA 1HFGA 3FP9A 1E1OA 2AUJD 5CV7A 4UDUC 3PO2H 4KKSA 5FLXE 4HR7B 4B9WA 3RLFA 1Q86C 4DUZQ 1G8ZD 1KAWA 2Z0SA 3GDEA 5CR3A 5FJ8H 5LMNL 4LK1C 5DEHA 3CC4A 2LSSA 4Y52H 4OO1I 4XDXA 2NVXH 1LT4D 1X54A 1SNMA 3J80i 2D5DA 5ELEA 4LWCA 2Q2HA 3CF5A 3TS2A 2R93G 4J1MA 3A55A 3QR8A 5JAVA 4YY3L 1LT3D 1VQOA 2ZJPA 3ULJA 2E75C 2KCMA 4LF7L 1PTOC 5JJZA 2VW9A 4A3BH 2F3VA 3LWEA 4LUZA 4ME5A 3QIAA 5M5WH 3E9IA 4L5SA 1YHBA 2RSOA 1ML0D 2ALYB 4DNRB 3GTOB 1RL2A 3PF4A 3J80c 2EYJA 3I8ZA 5C0XJ 1WJJA 3CRLC 2B3GA 3UE0A 5AJ3L 3S15H 4CDFC 1DONA 1JWUD 3KYHC 3HZXA 4G4KA 3OOCA 3CXCA 5M3MH 1D2BA 2M2LA 3H15A 2PI2E 4CGYB 1QZGA 1Q8IA 2CFMA 1SNQA 3KF8B 1RJTA 5C4HA 4NXMQ 1OXSC 2PQAB 1PZJD 3K81C 5IT9L 1QOHA 1ICFB 1EOTA 5D65A 5M5YB 4A3DB 3CCUA 4IJHA 3K8AA 2EIFA 1QB5D 4JI5L 4X3TA 5CC4A 2JSOA 4A3JB 1TIID 1II3A 4K8IA 1V9PA 4JI8Q 1CQVA 2DNEA 3A5UA 1E0BA 4POGA 3NBHA 1HR0W 4LNQA 2AWNA 1W2BA 3L7ZC 2ID0A 1WTHA 2RSNA 5KGUA 2ATWA 2JA7H 1UE6A 3S1NB 1TS2A 3N6RA 1SXTA 2GVAA 4GNXB 1LTGD 4PQXA 2BDNA 3S14B 3HKZB 1K8MA 4ULLA 4EX5A 1LTSD 1MBYA 3FPUB 2N78A 2R92H 3NPPA 4A3MH 1K0RA 1LTAD 3AFPA 5IGBA 5K36H 2JA5B 4AH6A 3Q0AA 1WOCA 2YTYA 3I4OA 5J3BA 4IPHA 3GO5A 4JK1C 2A74C 3VR5A 2FXQA 1I4RA 1N34Q 3BZKA 2RDFA 3A8KE 2Y0SE 4L8JA 2NUCA 4H0LC 1WYDA 2F0SA 3MTSA 5EKLA 3GTJB 1DOMA 3V96A 1JCKB 3E5SA 1R9TH 4X62Q 1QVGA 3HGBA 4X62L 4LF5Q 1EEFD 2EXDA 4S3SA 1J6QA 2DUDA 2BE5D 1EIHA 5FLXc 2EJMA 3D31A 3TP6A 3HOVH 4DR3Q 2EJFC 5L37A 3OYYA 4IOCA 1N36L 4GLAC 2R7ZB 3DM1A 1ASZA 2YV5A 1QUQB 2E8GA 1LTRD 1G291 3PCOB 2R92G 1LT5D 2CWAA 1C0AA 4QB4A 5M3FB 3IL8A 4DR1L 4IOAA 2OXPA 3U9SA 3T1HQ 3NEMA 1PTOB 1SYGA 1BBXC 4KMUC 1GHJA 4IJLA 1VQ7A 2F03A 4RHRA 2G5DA 1L0YB 1XTCD 4YWKA 4L5RC 4CBVA 3A0JA 1D1IA 1D8LA 1BKBA 3EVQA 4B3RQ 5H1SE 3MFGA 4LF4Q 4MN3A 1T5XD 4HMIA 1PH5A 4JI1Q 2B39A 2FJ2A 2HQEA 1DZ1A 3KF6B 5CORA 2JA6H 4IFDG 2R93B 2EYLA 2RDHA 4HJ5A 2KOLA 5M5XB 3T4AC 3PO3H 4C2MH 1FNVA 5C3EG 4ZUJA 1EUJA 2EXZA 1YITA 5CV8A 4GOPB 3C46A 5I9PA 3OW2A 4PMWA 3GD7A 3CHBD 4IPCA 5CV5A 1DM0B 2KHSA 1PMRA 3CAMA 1VQDA 4CDEC 4NMZA 2B2WA 1X3EA 4JYAL 5GAEC 4LF7Q 3GTOH 1Q90A 1I6HH 1DD2A 1E3PA 3QOLA 1R9TB 4A3LG 5D3IB 2RVLA 4DAPA 4A3FH 5EQ0A 4HJAA 1RD9D 2ZXPA 1HA6A 4X64Q 4RFBA 4DR1Q 2VS1A 3I4MG 2E2JH 4C3JG 3MAQA 5D14A 5EKKA 1XTDA 3G4SA 1TR5A 4YWMA 5E4WC 3E9HA 1C8CA 4AIMA 4GNXC 1F2LA 4C3HG 3ULPA 3H0GH 1MJCA 5M9OA 2A5HA 4JV5L 4JCVE 1Q7YC 4RA8A 5D3DA 1A0IA 4QJFA 3RN5A 3BVZA 1I50H 2ZM6L 4UAIA 1BXTA 4JI5Q 3AU7A 3I4NG 1YBYA 3PQIA 3GTPB 1W3SA 3D6WA 2Z9HA 2K33A 2R61A 1ESFA 4DR5L 1CA6A 1VCIA 3CQZH 3UDFA 2D9UA 1EZ6A 1GD7A 5E7NA 2B2UA 2F1MA 2OQ0A 1SR3A 2HQLA 3MHBA 4TQUS 3HOWB 1TWAH 3GTLH 4DV3L 4Q0FA 4DR2L 1ZEQX 1VQBA 2LXJA 4XXEA 5CGKA 3DXJC 3U9OA 4OGQC 4FNFA 3A8JE 2E2DC 5AJ3Q 4A3JG 1O7IA 3A54A 1FL0A 2IPKD 3C2PA 3TREA 1LTTD 1HRJA 1SYFA 3H09A 1B50A 3TZUA 3OWEB 1FR3A 3J7AF 3A56A 1D5ZC 1VQCA 4A3GB 1XJVA 4KHZA 3P75A 2F0KA 3A7LA 1GUWA 3I72A 2EY1A 4GN5A 2EYHA 2D2CC 1VF5C 5FLXL 1LO5D 1TS5A 3CQZB 5IP9G 3W3AA 2IHFA 2K14A 4MZ9A 5BN4A 4B3SQ 2VL6A 3BS1A 5EAYA 1Y1WH 3WDNA 1KNEA 2EZVA 1S40A 4J6HA 2MHVA 1G2TA 3J80L 3CCJA 1SYEA 1EYAA 2Z6KC 5IP7G 1SJED 3EIVA 3MFYA 4H13C 3IKJA 3PUWA 1AP0A 1CZWA 4O0AA 4JC0A 4DAVA 2RCNA 3E3XA 2ES2A 1HNWQ 4DV4Q 5LMUQ 1C4QA 1U4LA 1JT8A 4O2DA 2GA4B 3U4ZA 4EQOA 1TU2B 4UP9A 2EYFA 3STBD 3QO2A 4OXPA 1EU4A 2OCEA 3NWTA 1YZ6A 4NKLA 3KLSX 2WIIB 3E0JA 5LMNW 4LFAL 1K3BC 3CC7A 4BY1B 4HN7A 4LF6L 2N55A 1VQLA 3T1YQ 1IXRA 1KDBA 1A3VA 2F0FA 1UE1A 4BXXH 4DUYL 4GNXA 1PZID 3X3NA 3ULLA 2B63H 2EE1A 1FGBD 1JE4A 2K01A 2OWOA 4NDXA 1SE8A 1M4VA 2KCCA 4G57A 4A76A 1A3TA 3DEPA 2UUBQ 4UY8C 1PHJA 2E2IH 1F9PA 3OSOA 3STBC 2SNMA 4UHVA 3VR4A 1STGA 2UUAQ 1RKNA 5LL6X 1RDPD 4DN4M 3J7AV 4XT1B 1K0SA 1BCPC 3P1HA 5LHY1 5J22A 2KENA 2QEJC 2WKCA 1I3QB 4DV7Q 1IYVA 4DV4L 3P7JA 1TY2A 2J0TD 1A15A 3T16A 2UXDL 4XIGS 3HS0C 4QL5A 1NBWA 4A3KH 2WACA 3UE1A 4K2LA 3I56A 2K5QA 4YCVA 4GKKQ 3S24A 2JEBI 3VYUA 5JEAG 3RN2A 5A2QE 4A3BG 2UUBL 3M7NA 1Y1VG 1D5MC 4R4IA 3R93A 3MEHA 2KCTA 4H7BA 4EQNA 5T1GA 1EU3A 1U4RA 3SDZA 2MFIA 4P74A 2X6GA 4X3SA 1VDZA 4RG1A 5FKAC 1V1QA 3PUXA 2JA9A 3MA2B 4K5XA 4RGNA 1K8GA 4BY1G 5IYCH 2XWJB 3I4LA 3NTKA 4HIOA 1RTNA 1G6ZA 1PLFA 1SAPA 4A3KG 4NPSA 3Q8DA 4X66L 1GXDC 2RCFA 3AQQA 4RKLA 2E76C 3KUPA 1GKHA 1WTXA 1H9SB 1U4PA 4RHSA 2D0PA 3H91A 2HIXA 1E24A 1OXUA 2MO1A 3PIP3 3DHQA 3J80E 2K05A 4FF3A 1JMCA 2BA0A 3SR1A 1JJGA 2N49A 2PZWA 5C6AA 1UE7A 3P20A 3J7ZC 2HT1A 4DR7Q 2I5MX 2LFNA 1X3PA 3IFTA 3UI2A 5EBCA 2NVYB 5JEAJ 4FF2A 3M7GA 5M3FH 1HPCA 3ITPA 2Q8TA 5J39A 3QB3A 1FD7D 4LF9Q 2R3ZA 1K28A 1QWYA 3K7AB 2JA8H 1TWFB 1AFPA 1PH3A 4CKBA 4A3DG 1H9RA 4L5QA 2N3SA 1TWCB 4KD4A 1SNPA 4JBWA 2ZT9C 4OX9L 1ESRA 1IW7C 2L12A 3F1ZA 4K5WA 5BN5A 1XNQQ 4HJ8A 2L55A 1STBA 2F4IA 1P16A 1UAPA 2I0QA 1AH9A 1N8RC 4BY7B 1SYBA 3M9BA 4X3UA 4G7OC 4DA2A 5CBAE 3KDFA 2K1BA 1X6OA 4I65A 3GTMB 4KY7A 2JA6B 5KRUA 3HG9A 3ERSX 4IN3A 4DXGA 2NVQH 1NR2A 2K4KA 4C3HB 4JVZA 5JJIA 3BG3A 4GN4B 2PPBC 1O7LA 2RF4A 1CKMA 1S5BD 5C4XG 5C3WA 1NNXA 2AWOA 2A69D 3DUZA 3BVGA 3M4OB 4X65Q 4X3KA 4DV6Q 3H3VI 2MNAA 1I4PA 3H3VC 3U58A 4RCOA 2JA6G 4IFDH 4GOPA 1C9OA 1ENFA 1H9SA 1EFID 1VMCA 4RH6A 1RTOA 4QY7A 1O78A 2NN6G 4MTNA 5I2XA 2QW7A 2DJGC 4FDBA 2NN6I 1HHVA 1JOOA 4A3MB 5FLMH 2ZM6Q 4RGMA 4BY1H 1HQMC 1NUCA 2XN9C 2PQEA 1GO3E 2MQHA 4YIJA 2NVQB 3C1FA 2IX1A 2K75A 2A68D 2A6HC 1S4ZA 1IBML 2QDLA 3MZ5A 2HHHL 1KLGD 1I50B 2FMMA 1UUPA 1B9MA 2XRSD 1Y14B 3TP7A 3TRZA 3NQIA 4L6TB 3FVQA 4X64L 3FDTA 4DV2Q 5JVG3 3RZOB 3ND9A 1D7QA 4XQJA 1NJIC 3W5OA 2UXCQ 2L9HA 2XWBB 2DY7A 3FKIB 3HOVB 2L15A 1ILPA 2K5HA 2R6GA 2Q2IA 2PW5A 3GV3A 2GVBA 3FKIG 2H1EA 4JI3Q 1D1KA 5LMNQ 1LABA 1AEXA 1Q3LA 4DNIA 2ICIA 3CW2C 1XPRA 3BU2A 1OTCA 1EY9A 4I7AA 4OIKA 2EQSA 4LFCL 3AMUA 1BQQT 1PFNA 5JJLA 4YHHQ 2M9VA 4JI7Q 3NELA 2A8VA 4A93G 1EYDA 3MXNB 1UEBA 2ICEC 1X56A 5M5XH 4A3EB 1VMPA 5C3EB 2JP1A 2KHJA 1IBKL 1WCMH 1AW7A 1U9RA 3S1RB 1B2TA 3OPOA 1Q46A 2WAQG 3I73A 1TKWB 4JI1L 5A2QL 4K5VA 4DR5Q 1L2FA 3D6CA 4U68A 4UPAA 4RCNA 2CVRA 3SK6A 4DAMA 4QCLA 5IY0A 2BDOA 3CCEA 2QA4A 2B2VC 2WKDA 2RA4A 4BY7G 3JAMc 3AFQA 2RDGA 2R93H 5IP7H 1TWGB 2TMPA 4OIJA 4NXNQ 1KLUD 1YHQA 4H44C 3CCQA 2NZOA 1CHQD 1BF4A 3CD6A 3I2ZA 3PIOA 3S16H 2F0JA 5IOCA 3EQLC 3L2PA 1B8AA 1C7YA 1F2YA 1HTPA 2HCIA 3TZDA 2ASBA 1CSPA 1RF2D 5I9OA 1S72A 1KAAA 4AQYL 5HY6A 4ZKCB 1XPOA 1MKHA 3DMUA 3T53B 2QILA 4R4QA 2L4NA 4IQZA 1STNA 1VQHA 1YI2A 3HOZG 2DY8A 1K3RA 3VR2A 1CZGA 1XNRQ 5EJWA 2MUYA 4M8AA 3ER0A 4HSVA 3WWVA 4OL7A 5CV9A 1JJ2A 1EL0A 1KNAA 1NTGA 4HJ9A 3C1EA 2R92B 1KRSA 1KD1C 3AYHB 4GLVB 5ELFA 4A3CH 1SMXA 1MGSA 2I46A 3EN2A 3NBHB 3TP8A 3S16B 4K2KA 1YNND 4KK7A 2E5LL 4R4TA 4JG2A 4JI0Q 4GKJQ 1M1KC 4QIWB 5GADC 2HDLA 2F0PA 1UWVA 3PGZA 2XTIA 2B8GA 1CSQA 4HCSA 3FEWX 3I90A 4XYQA 1KIXA 2GN5A 4EQPA 2BOSA 2CQOA 3NENA 1K73C 2AQ1B 4DR3L 4KJOA 1J9OA 5EPLA 4AYBG 1SLJA 1EQTA 1V1PB 1BCPD 2K5DA 2ZXRA 4DUZL 3C3LA 3HOWH 1EQRA 4LW1A 3HKZE 3NE5B 4I7ZC 1CQFA 3VYTA 1GJXA 1HH2P 1B3QA 2EYPA 4BA1I 4R1JA 2LMCB 4OX9Q 5DM63 2VQEQ 2OTLA 1I4HA 2NZ1D 3PUZA 4IPDA 2B2YA 1Y1VB 2K6AA 2VB3X 2C35B 4DV6L 3SXHA 5FO7B 2EY2A 4BBRG 4A3IG 2F0UA 4AYBE 3JAMi 4LF8L 5GROA 4TSSA 5I2YA 1TY0A 1WTRA 1G2SA 1X3GA 2I5LX 4A3JH 2DGYA 3VYRA 1V1OA 4Q5VA 2TSSA 2EVBA 4F88A 4CDCC 3OIQA 1EQVA 1HUMA 1PDQA 2NZHA 4KN4C 3FMCA 4WJWA 4C3JB 5EGTA 1DCZA 1Q81C 2F0GA 1JWMD 4YCWA 4DU9A 2E2HH 2Y0SG 2Z6KA 4TRDA 5NUCA 2JJQA 4XTCS 1EWIA 3HEJA 2JN4A 3HOYH 4DAYB 4DV5L 3M4OH 4OEMB 1OXVA 4KTAA 4CDDC 2J4XA 1CFMA 2NTTA 4PZ7A 1SFOB 2VB2X 1M8AA 3J81L 1NY4A 1SNCA 1Q82C 4DV1L 2HIVA 3D3RA 3KF6A 3LGJA 3LWUA 1ENCA 4KHPL 1DOLA 2K7VA 3ND8A 5FJ8G 2KBNA 1GUGA 1GUNA 4G7HC 1U4MA 2HCCA 4X65L 4PG3A 3R3OA 5EPKA 4JPBW 3B6YA 2ZTDA 4R4CA 2UXBQ 3K6OA 4DV3Q 2JA7G 2UU9Q 2V4DA 4CJ0B 1N33Q 2EYMA 3MEFA 4C3IB 4MHEA 3MVVA 1PA6A 1N32Q 3TDQA 3HKZG 2XRQD 3F2DA 3I55A 2LS01 5C3EH 5C4XH 1CM9A 5T1IA 1ET6A 3KDFB 1SBBB 1PFBA 3K57A 1TWHB 2MGSA 1WTVA 1PH9A 1HA5A 4KY6A 1PYWD 2QEXA 2ZJQA 4KI0A 4P73A 1F2ZA 4B3TL 1HNZQ 2EDGA 3Q23A 3V05A 2AKWB 1JJCB 2J7ZA 3G7LA 3VDYA 2SOBA 3I91A 1K8OA 5CV4A 3A74A 2KEDA 1AZQA 3J81c 3HOXB 1IW7D 1UEAB 2AQ2B 3X3MA 1HNXL 2BH2A 3AB9A 4N9TA 4LFBL 2WFWA 4A3EH 2PMZB 4RWSC 1JR0D 3R2IA 4HCEA 1K83H 1F9SA 4LF6Q 2K5WA 4DXFA 5KEEA 3G6EA 3R8BA 2D0OA 4A3BB 1Y8OB 3GQBA 5CV6A 1PTOH 1VQ9A 4DV7L 2JK8A 2M00A 4IZ8A 1ZXTA 3I4MB 3EA6A 2PO4A 5J1ZA 3HOXG 3CMAA 3DM3A 3TN2A 2N88A 4CHTB 4X66Q 5I6YA 1VS0A 2PMZE 1ZYRD 3UDXA 5IYBG 2I07B 1JORA 3K59A 2IY5B 2WB1B 1G91A 2NB0A 3FKIH 1B1ZA 4DV0L 2F0WA 1HR0L 4WFN3 1VQEA 3S2HH 2UXCL 2F3IA 2K03A 2XSCA 1NR4A 2DNCA 2RQXA 4J8QA 3K5LA 1CTMA 3SVMA 4PMCA 1LACA 1Y8PB 4O42A 1EY7A 2CHBD 4KJNA 4B9XA 3J7YW 1FVIA 3G6JB 3KLWA 2F0EA 3GTKH 2B2WC 1EYCA 1I4GA 4JBMA 1ZKOA 1HZ9A 1QILA 5FO9B 1KL9A 4NW2A 3BYTB 3D0FA 4B3ML 4ME3A 1MHWC 2JE6I 4ZKBB 3PSIA 1EY6A 5M3MG 1SN8A 2H5XA 1A2UA 5I4DA 4BXXG 2O2LD 3F2BA 3PMFA 2F0NA 5ELDA 4PZ6A 2PNHA 1KDCA 4FYDA 2O5JC 1BR9A 1SRUA 2C9OA 3W1GA 3CCLA 2L5TA 3CP0A 1STYA 2A6EC 2SDFA 2K32A 2JA7B 1LLRD 3BDLA 3S2HB 1CUKA 4DR7L 1BCPF 4RKBA 4O1NA 1H95A 4DK6C 1TWFH 2LKVA 3NWSA 3CC2A 4V0BA 2R7ZG 1E2VA 1H9MA 5C44H 1HNWL 3MXPA 3MXUA 2D62A 3K5MA 3HOYB 4IUNA 4JBJA 1CK1A 2VNUD 1VQ4A 1YJNA 2SEBD 4F87A 4CKEA 1E2ZA 4FF1A 1LTLA 2IL8A 2E2IB 3FHWA 2V1CC 3I70A 4X6AH 1KABA 3GTQB 1J8IA 1E22A 1TT2A 1EY5A 3L0OA 4FVMA 4IUQA 4BWGB 4DFAA 1NAPA 5ISRA 2ZJRA 3TP5A 2B8FA 1PH4A 5F2DA 3T1YL 3KK7A 1JB7A 2PZTA 3NUCA 2QGQA 4N8X1 1HCZA 4IFDI 5JEAH 5IWAL 4LMQD 5IWAQ 3CPFA 1TWAB 3GTLB 4ID6A 1XWEA 4ZUIA 2R7FA 2O5IC 3H3VH 1MIUA 5IT9E 4DR4Q 4C3IG 1TVXA 3SK8A 1PTOF 4RAUC 1Q1BA 2Z8LA 4A3KB 4LF9L 2OEOA 2B63G 1MD2D 2O4XA 3DEOA 1I6VC 2PW7A 1VF7A 2QF7A 1EOVA 2PNRC 2BH8A 3H6MA 5BN3A 3J81E 3G71A 2A1AA 2G9DA 3S15B 3M85A 4PMBA 2YU9B 3KJOA 2XNAC 2EY5A 1SYDA 5M3MB 4DV5Q 2UU9L 2DN8A 4LF8Q 3OIPA 2KVMA 2A6ED 3GTGB 5HURA 1XXGA 4QF4A 3K0XA 3CKIB 3NXWA 3W1BA 2VQFL 5IYDH 4C56C 1SROA 2NN6H 3CRKC 1PRTF 1BDOA 1A62A 1B9NA 5DAUA 5M5WB 4B3SL 1TWHH 3PO2G 3NHHA 1SJHD 1JC7A 1SMYD 3HFZB 4DR2Q 2RBMA 4A93B 2XGTA 1DGSA 2L1BA 2RHSB 1IBLQ 1UE5A 2F0VA 4HSPA 3Q24A 1VQNA 4GS3A 2LY7A 3DWAA 1BVSA 1BOSA 1X32A 4ZQ3A 3ZJYC 3NSWA 3D4WA 1HQRD 2EY6A 3OMGA 3CCRA 1Y69U 1YEZA 4ZRZA 4Y7NB 1NE3A 3GTPH 4BBSG 4TVAB 4IO9A 2IX3A 1YJ9A 2RHQB 5CBEE 1CKNA 2MPMA 1SSOA 1GUOA 1K83B 4LJZC 4EQ5A 5C0XI 4A3MG 5C0XG 1V1PA 4P71A 3T1HL 3S17H 1DJRD 4H02A 2G9HD 2F0OA 3T51B 4OO1H 1GUSA 1EZ8A 3SGIA 3Q6SA 4K6LA 2Y0SB 1IL8A 4FP5D 1WCMB 5DNFA 3SK5A 2QDBA 3WOEA 1VQFA 4A3FG 2XVSA 1IBKQ 1EWCA 5M3FG 1VQIA 1BO0A 2HD3A 4LF5L 3TQYA 3BZCA 4R8NA 2EOTA 3S1NH 3PIPA 4C3JH 1R4QB 3NTIA 1FGUA 1PFSA 4DKAC 1XMOQ 5FK9C 4A3GG 1TXYA 1JOQA 2WP8J 4BBRH 4A3IH 3GTGH 1QG7A 3NP8A 4BBSH 3OTOL 5C4JB 1EY4A 1HZBA 5GQOA 4C3HH 4LAAA 1O7ZA 4MIUA 5A35A 3F2CA 4IUUA 3U4VA 2F0IA 1QVCA 2FINB 3M4YA 2NYZD 3RLNA 5C0XH 1XMQL 3K7AH 2JA8B 4TKOB 1TS3A 1SDFA 1N32L 4PNYA 3J81j 2KHIA 1KXLA 2BE5C 3KOJA 2IWHA 4HIMA 3HOWG 2HDMA 1F77A 1UNSA 4AQYQ 4GKJL 3FPPA 4OHJA 3E6ZX 1CA5A 2ZTEA 1RODA 1BNZA 1WTQA 4CJ1B 3HP3A 5TSSA 1HFNA 2JA5G 3L3OC 1AN8A 3MC0B 4ABNA 2CH4A 1YJWA 4JI4Q 3K5OA 1VQGA 5KNBA 2KA7A 3ICEA 5GAGC 1O7YA 4JI8L 2F0DA 2DJFC 1RHPA 2A69C 3G48A 1AE2A 2PZUA 2AQ3B 4U673 4G7ZC 4ZYSA 1BBWA 4LUOA 4BBSB 3QG1A 3S1QB 1X9NA 2B2TA 3SEBA 2E5LQ 1WD0A 1SE4A 4DV0Q 4MNOA 3CPWA 4L5TA 4WRDA 5EPJA 1ILQA 4ALPA 1WVLA 3SE0A 1YNXA 3S2DH 1RIPA 5IODA 4DGZA 4QGUA 1TWCH 2MP1A 3LNNA 4KV6A 1XYIA 2K5NA 1KRTA 3TSSA 5IYBH 5LMUL 5ELNA 3HOYG 1VQJA 4HTHA 2VUMH 4YHHL 4JI7L 1ICWA 5IP9H 4HJ7A 3FRPB 3GTJH 2AMCB 3I7FA 1BBUA 3HOUH 1HXYD 5AFWA 4XQQA 5FLMG 4JI2Q 1IBMQ 2L11A 1OXXK 2Q2UA 5BR8Q 1Y1VH 1QCBD 3RUZA 2JYOA 4K8JA 4LFBQ 1EEID 4LF4L 1STAA 1Z9FA 5C44B 4HAEA 5ELBA 2LXKA 1V43A 1X3QA 3H0GB 1T5EA 1PV4A 3M4QA 3VA5A 4JI4L 3EFXD 2NVTB 1A2TA 1LV9A 5G3LD 1B3AA 3KJPA 1WFQA 3AEVA 1SE3A 4BA2I 1HJPA 1I5FA 2Q2TA 2K5VA 5IE8A 1NMFA 1B44D 3RZOH 2Q8IB 3QJYA 3S1MH 2HHHQ 5HGTA 1HNZL 1LT6D 4B3TQ 3JAME 2NVXB 1S5CD 1NCVA 3CCMA 3ONAB 2HUGA 1ONLA 1WCMG 1AZPA 2E2JB 1XMQQ 4EVOA 3SHLA 2VUMB 1JICA 4DK3C 3JC66 1GOZA 2UUCQ 4QUCA 3VA7A 1F9QA 3HOZB 4JI2L 3VR6A 1LTID 1JWSD 3BYYB 3OWFA 1TQOA 2VXWA 4K14A 4DV2L 3BJUA 5K5PA 1PRTC 4K6DA 1MI2A 2P5ZX 4A93H 2R7ZH 1U0LA 2B63B 5C4ZA 2NWGA 3PIO3 2K04A 4OELB 3M3YB 2F0HA 1K8AC 1L1OC 1ET9A 1I4QA 2FMCA 4B3RL 1E7ZA 1FJGL 2WAQB 4GOPC 4ZAIA 2L0CA 2JA8G 3UDIA 5IYCG 4N9PA 2JQOA 4A4IA 1Z6HA 4A3EG 4NXNL 1XNQL 4DV1Q 4F8MA 1PFMA 5JJKA 3ZYYX 1LUZA 1L0XB 1X65A 1I6HB 3EBEA 2VQEL 1D5XC 1KHIA 4QUFA 3N52A 4JI0L 2WB1G 3KBGA 2WV6D 1GVPA 1STEA 3HOZH 4DPGA 5KIXA 3J81i 3SK4A 4UP7A 4B08A 4C3IH 5M5YH 3K80C 4APVA 3OTOQ 3PO3B 1JOKA 4MTKA 4KHVA 2KCNA 1PH7A 1CKOA 1KDAA 1JE5A 1XNRL 3Q22A 3CU7A 3IRBA 3LX0A 2X6LA 1U5KA 1MSGA 3RD4A 1RCVD 3TS0A 1IBLL 1PH1A 1HZCA 4ZLTF 2F4VQ 1N9WA 5IGGA 5JPMC 4KLKA 3I4NH 2MJ8A 1QZHA 3KFUA 3RLOA 5C5MA 4R9WA 5C4JH 1GHKA 1XX8A 1S3OA 1Q1EA 2AHOB 2ZXOA 3PUYA 2Z6BA 4XT3B 1FJGQ 4IFDJ 2NVYH 1H9JA 1O80A 4IALA 1XMOL 5ELCA 4YWLA 1VQ5A 1LYLA 2Z1CA 1PH2A 1LTBD 2CQAA 1EY0A 2F0LA 1QJOA 4XQNA 5JOBA 4P72A 3D4DA 1L0WA 2K52A 3KLRA 5EBDA 3S1RH 3K7UC 3NTHA 1Q8KA 1SMYC 3I4MH 1X55A 4KKTA 1PYSB 1VQPA 1HUNA 1VQ6A 4DAYA 3F2UA 2E74C 2AUKA 1I94Q 1NMGA 2YTXA 1HR0Q 1WTWA 4LFAQ 4BY7H 5COYA 4Y7NH 3S1QH 5IGEA 1F2MA 1B70B 1M90C 4XYOA 4DF7A 4E6IA 4P75A 4JI6L 2C5CA 2EYOA 2VQFQ 1YNJD 2OTJA 4HMJA 5HGQA 1ASYA 1H9KA 1B4OA 3MXGA 4JBKA 4GN3B 2CCZA 1PRTB 1PH6A 1PXUA 1NSNS 3KLSA 1Q12A 1S5ED 2A19A 3A7AB 2F4VL 2X69A 1IYUA 2EPBA 1W6JA 1L1OB 3HRZC 3R2TA 2KQ3A 2PI2A 3URYA 5GAHC 1A8VA 4QMGA 1EFWA 1P8LA 3W2DA 1CI3M 1BUVT 4R8IA 1B53A 5C44G 3F8TA 1A63A 1GM5A 4FO2A 4UP8A 1QVFA 5C4XB 1R4PB 2KECA 2F3WA 2NVTH 4V190 4QQBX 4A3CG 3RMHA 3BDCA 2MO0A 3T13A 4BS9A 1VQKA 1Y1WB 1DOKA 4POFA 3I3CA 3OW7A 1QNKA 3HOVG 3KBXA 4B3MQ 4ZK9B 1WI5A 3E0EA 2KUMA 3RNUA 1YNNC 2CWPA 5LL6S 3K5NA 4A3FB 1JB3A 1I4XA 1C48A 1J5EQ 2NTSA 4HIKA 1IKMA 1EQQA 3HOXH 4KY5A 1G51A 3OHXC 4HEDA 2BCOA 3MWYW 3GTQH 2ENBA 1FNUA 1YHAA 1IL2A 3QOJA 4GKKL 2B2YC 3ERQA 4C2MB 4CJ2C 3H0GG 3CCSA 3NQTA 3T56B 5KNCA 4KHPQ 3HKSA 3MXNA 4ODGA 4IUTA 3H94A 1BCPB 4WORA 4JI3L 1SYCA 4J15A 3PO2B 1GUTA 4NXML 1I3QH 1PH8A 3CCVA 1IYJB 1EIYB 1WTOA 4R4OA 1Z47A 3IFDA 3V2TA 1YVCA 3KF8A 5G3LF 1SEBD 1Z7TA 4JOIC 2IT1A 2PCFB 5C3XA 1EY8A 4M1UB 2VUMG 4OWXB 2FHTA 2KJXA 2R7DA 4DNTB 1W6KA 1E1TA 5CYUA 4DK0A 3EROA 1S5DD 2OT2A 1EYGA 5I6WA 2VZAA 1FYCA 2H4OA 3NK9A 3L9AX 2YTVA 1JQYD 4QIWE 3RZDB 1MJEA 2IX0A 2PQAA 3M3YH 1F9RA 2K28A 1DYQA 5BR8L 2XIWA 1LM0A 4FXGC 2JA5H 5JPNC 4DR4L 1KTKA 2B2UC 5IGDA 3S17B 2K50A 2IJ0A 1T9HA 5ELOA 1HZAA 1EWHA 5DLQE 3S2DB 4YY3Q 4GLXA 3K0YA 1VQ8A 1E2WA 4NP5A 3I4NB 4FXKC 5KNDA 4LUVA 3VYSA 3PO3G 4OONA 1A3UA 2A6HD 4OWWB 4P2CB 4RMFA 1QE6A 3JAML 4GZYC 4DK1A 3VR3A 2QKIC 2WINB 1OO9B 4ZCKA 3DWQA 5FO8B 2B29A 3NBIA 3U50C 5FOBB 1IHZA 5E3FA 2NBFA 4C1NK 1YIJA 4OO1G 1CHPD 3GP7A 2UXDQ 5CMDA 2ZTCA 1A6XA 1ENAA 1PVOA 1STHA 3OMCA 1WD1A 4A3LH 4F7XA 4IUPA 4DUYQ 4KD3A 2CKZB 3TMEA 4A3DH 2F0MA 3A8IE 1OXTA 4A3GH 1S5FD 4KN7C 1X3FA 4EGVA 3S1MB 1MSHA 3J7A5 3A5ZB 1IZ6A 1QNUA 1CKNB 4RGOS 1B7YB 2F52A 1V8QA 2BA1A 2CW0C 1G6PA 1Y8NB 4CKCA 1IKLA 1WTPA 2OQKA 3RR5A 3S9WA 1KQSA 4DR6L 5DM73 1N36Q 4C1NI 4BBRB 4A3IB 1YNJC 3PUVA 3WOFA 2VY3A 4HIDA 3RZDH 2QCPX 1EIFA 3EJIA 2IHEA 1QUQA 3S14H 3GTMH 1CT1D 1SE2A 5IT9c 3M4PA 2WB1E 4K0KQ 3BVMA 4PZ8A 5IIFA 5E1FA 1PYBA 1PZKD 5C5LA 4JV5Q 2JEAI 4RGTA 3HOUG 3TEHB 1J5EL 2F0QA 4JI6Q 3PF5A 4L63B 4PV1C 2YU9H 1N34L 2WAQE 1ZYRC 1PRTD 4FXDA 4KKUA 3DWPA 1SNOA 4NB3A 4JOIA 1SNDA 1EIGA 2Z4HA 4WJ4A 2B2TC 5KYLA 3GV6A 1I94L 2YYZA 1DXMA 2B2VA 2EJGC 3BDOA 2N8NA 2UUAL 1K9MC 3HOUB 5E4XA 1AE3A 3D4RA 1D6EC 1HNXQ 4FF4A 4JYAQ 1VQMA 2Z4IA 3BZDB 1PTOD 4K0KL 1KC8C 2OF1A 4A75A 4Z9CB 2PYKA 4WJ3M 5IYDG 3UDGA 3GTKB 5KYIA 2FFKB 3O13A 1SFOH 2Q8RE 4DR6Q 1VQAA 5K36G 3QWNA 3K58A 5JVH3 3D8GA 1FNWA 1L1OA 4YCUA 4LFCQ 2KEEA 1Y1WG
chains in the Genus database with same CATH topology
2JXMB 2F0TA 3PV0A 4ILWA 5EKIA 2E2HB 2IW3A 2RKSA 5IGFA 4IURA 3TBIB 1HTLD 3IAYA 5IGCA 1TS4A 2SNSA 2A73B 4AYBB 4IUVA 2CW0D 2A68C 1HFGA 2AUJD 5CV7A 4UDUC 4KKSA 5FLXE 4HR7B 4B9WA 3RLFA 1G8ZD 5CR3A 4LK1C 5DEHA 4OO1I 4XDXA 1LT4D 1SNMA 2D5DA 5ELEA 4J1MA 3A55A 5JAVA 1LT3D 2E75C 1PTOC 5JJZA 2F3VA 3LWEA 4ME5A 3QIAA 2RSOA 1ML0D 4DNRB 3GTOB 2EYJA 3I8ZA 5C0XJ 3CRLC 1DONA 1JWUD 3HZXA 4G4KA 3OOCA 1D2BA 2M2LA 4CGYB 1Q8IA 1SNQA 1RJTA 5C4HA 1OXSC 1PZJD 5IT9L 1QOHA 1EOTA 5D65A 5M5YB 4A3DB 1QB5D 4X3TA 5CC4A 2JSOA 4A3JB 1TIID 1II3A 4K8IA 1CQVA 2DNEA 1E0BA 3NBHA 2AWNA 3L7ZC 2ID0A 2RSNA 5KGUA 3S1NB 1TS2A 3N6RA 1SXTA 1LTGD 4PQXA 2BDNA 3S14B 3HKZB 1K8MA 4ULLA 1LTSD 1MBYA 3FPUB 3NPPA 1LTAD 5IGBA 5K36H 2JA5B 3Q0AA 3GO5A 4JK1C 2A74C 3VR5A 1I4RA 2RDFA 3A8KE 4L8JA 2NUCA 4H0LC 2F0SA 5EKLA 3MTSA 3GTJB 1DOMA 3V96A 1JCKB 3E5SA 3HGBA 1EEFD 4S3SA 2BE5D 1EIHA 2EJMA 3D31A 3TP6A 2EJFC 2R7ZB 3DM1A 1LTRD 1G291 1LT5D 4QB4A 5M3FB 3IL8A 2OXPA 3U9SA 1PTOB 1SYGA 1BBXC 4KMUC 1GHJA 2F03A 4RHRA 1L0YB 1XTCD 4CBVA 1D1IA 3EVQA 3MFGA 4MN3A 1T5XD 4HMIA 2B39A 2FJ2A 2HQEA 1DZ1A 5CORA 4IFDG 2R93B 2EYLA 2RDHA 2KOLA 5M5XB 3T4AC 1FNVA 4ZUJA 2EXZA 5CV8A 3C46A 5I9PA 4PMWA 3GD7A 3CHBD 5CV5A 1DM0B 2KHSA 1PMRA 4NMZA 2B2WA 1Q90A 1DD2A 3QOLA 1R9TB 5D3IB 2RVLA 4DAPA 5EQ0A 1RD9D 2ZXPA 1HA6A 4RFBA 4C3JG 3MAQA 5D14A 5EKKA 1TR5A 5E4WC 1C8CA 1F2LA 4C3HG 5M9OA 2A5HA 4RA8A 5D3DA 3BVZA 4UAIA 1BXTA 3AU7A 3GTPB 3D6WA 2K33A 2R61A 1ESFA 1CA6A 1VCIA 2D9UA 1EZ6A 2B2UA 2F1MA 4TQUS 3MHBA 3HOWB 4Q0FA 1ZEQX 5CGKA 4XXEA 3DXJC 3U9OA 4OGQC 4FNFA 3A8JE 2E2DC 3A54A 2IPKD 3C2PA 1LTTD 1HRJA 1SYFA 3H09A 1B50A 3TZUA 3OWEB 1FR3A 3J7AF 3A56A 1D5ZC 4A3GB 4KHZA 3P75A 2F0KA 3A7LA 1GUWA 3I72A 2EY1A 2EYHA 2D2CC 1VF5C 5FLXL 1LO5D 1TS5A 3CQZB 3W3AA 5BN4A 3BS1A 3WDNA 1KNEA 2EZVA 4J6HA 2MHVA 1G2TA 3J80L 1SYEA 1EYAA 1SJED 3MFYA 4H13C 3IKJA 3PUWA 1AP0A 1CZWA 4DAVA 1C4QA 1U4LA 2GA4B 4EQOA 1TU2B 2EYFA 3QO2A 1EU4A 3NWTA 4NKLA 3KLSX 2WIIB 3E0JA 4BY1B 4HN7A 2N55A 1KDBA 1A3VA 2F0FA 1PZID 3X3NA 2EE1A 1FGBD 1JE4A 2K01A 4NDXA 1M4VA 2KCCA 4G57A 1A3TA 3DEPA 1F9PA 3OSOA 2SNMA 3VR4A 1STGA 1RKNA 5LL6X 1RDPD 4DN4M 3J7AV 4XT1B 1BCPC 3P1HA 5LHY1 5J22A 2QEJC 2WKCA 1I3QB 1IYVA 3P7JA 1TY2A 2J0TD 1A15A 3T16A 4XIGS 3HS0C 2WACA 4K2LA 2K5QA 2JEBI 3VYUA 5JEAG 5A2QE 3M7NA 1D5MC 3R93A 3MEHA 4H7BA 4EQNA 5T1GA 1EU3A 1U4RA 3SDZA 2X6GA 4X3SA 1VDZA 5FKAC 3PUXA 3MA2B 4K5XA 4RGNA 2XWJB 3I4LA 3NTKA 1RTNA 1G6ZA 1PLFA 1SAPA 1GXDC 4RKLA 2E76C 3KUPA 1WTXA 1H9SB 1U4PA 4RHSA 3H91A 1OXUA 3PIP3 3DHQA 3J80E 2K05A 4FF3A 2BA0A 3SR1A 2PZWA 5C6AA 3P20A 2LFNA 1X3PA 3IFTA 3UI2A 5EBCA 2NVYB 5JEAJ 4FF2A 3M7GA 1HPCA 3ITPA 2Q8TA 5J39A 3QB3A 1FD7D 2R3ZA 1QWYA 3K7AB 1AFPA 1TWFB 4CKBA 1H9RA 1TWCB 4KD4A 1SNPA 4JBWA 2ZT9C 1ESRA 1IW7C 2L12A 4K5WA 5BN5A 2L55A 1STBA 2F4IA 1UAPA 4BY7B 1SYBA 4X3UA 4G7OC 4DA2A 5CBAE 2K1BA 3GTMB 4I65A 4KY7A 2JA6B 5KRUA 3HG9A 4IN3A 4DXGA 1NR2A 4C3HB 3BG3A 2PPBC 1O7LA 1S5BD 5C3WA 2AWOA 2A69D 3DUZA 3BVGA 3M4OB 4X3KA 1I4PA 3H3VC 4RCOA 4IFDH 1ENFA 1H9SA 1EFID 1VMCA 4RH6A 1RTOA 1O78A 2NN6G 5I2XA 2NN6I 1HHVA 1JOOA 4A3MB 4RGMA 1HQMC 1NUCA 2XN9C 2PQEA 4YIJA 2NVQB 3C1FA 2IX1A 2A68D 2A6HC 1S4ZA 3MZ5A 1KLGD 1I50B 2FMMA 1UUPA 1B9MA 2XRSD 3TP7A 3NQIA 4L6TB 3FVQA 3FDTA 5JVG3 3RZOB 3ND9A 4XQJA 2L9HA 2XWBB 2DY7A 3FKIB 3HOVB 1ILPA 2R6GA 2PW5A 3GV3A 2H1EA 1D1KA 1LABA 1AEXA 1Q3LA 2ICIA 1EY9A 4OIKA 3AMUA 1BQQT 1PFNA 2M9VA 1EYDA 2ICEC 4A3EB 1VMPA 5C3EB 2JP1A 1AW7A 1U9RA 3S1RB 1B2TA 3OPOA 3I73A 1TKWB 5A2QL 4K5VA 3D6CA 4U68A 4RCNA 2CVRA 3SK6A 4QCLA 2BDOA 2B2VC 2WKDA 2RA4A 2RDGA 1TWGB 2TMPA 4OIJA 1KLUD 4H44C 1CHQD 1BF4A 2F0JA 5IOCA 3EQLC 1F2YA 1HTPA 2HCIA 3TZDA 1RF2D 5I9OA 1KAAA 4ZKCB 3DMUA 3T53B 2QILA 2L4NA 4IQZA 1STNA 2DY8A 3VR2A 1CZGA 5EJWA 2MUYA 4M8AA 4HSVA 4OL7A 5CV9A 1EL0A 1KNAA 3C1EA 2R92B 5ELFA 1MGSA 2I46A 3TP8A 3S16B 4K2KA 1YNND 4KK7A 4QIWB 2HDLA 2F0PA 2B8GA 4HCSA 3FEWX 3I90A 4XYQA 4EQPA 2BOSA 2AQ1B 4KJOA 1J9OA 5EPLA 1EQTA 1V1PB 1BCPD 2K5DA 2ZXRA 3C3LA 3NE5B 4I7ZC 1CQFA 3VYTA 1GJXA 2EYPA 4BA1I 2LMCB 5DM63 1I4HA 2NZ1D 3PUZA 2B2YA 1Y1VB 2K6AA 2VB3X 3SXHA 5FO7B 2EY2A 2F0UA 4TSSA 5I2YA 1TY0A 1WTRA 1G2SA 3VYRA 1V1OA 4Q5VA 2TSSA 2EVBA 4F88A 3OIQA 1EQVA 1HUMA 1PDQA 4KN4C 3FMCA 4WJWA 4C3JB 5EGTA 1DCZA 2F0GA 1JWMD 4DU9A 4TRDA 5NUCA 4XTCS 3HEJA 1OXVA 4KTAA 2J4XA 1CFMA 2NTTA 1SFOB 2VB2X 1M8AA 3J81L 1SNCA 3D3RA 3LWUA 1ENCA 1DOLA 2K7VA 3ND8A 1GUGA 1GUNA 4G7HC 1U4MA 2HCCA 3R3OA 5EPKA 3K6OA 2V4DA 4CJ0B 2EYMA 4C3IB 4MHEA 3MVVA 3TDQA 2XRQD 2LS01 1CM9A 5T1IA 1ET6A 1SBBB 1PFBA 3K57A 1TWHB 2MGSA 1WTVA 1HA5A 4KY6A 1PYWD 4KI0A 1F2ZA 2EDGA 3Q23A 3V05A 2J7ZA 3G7LA 2SOBA 3I91A 1K8OA 5CV4A 2KEDA 1AZQA 3HOXB 1IW7D 1UEAB 2AQ2B 3X3MA 3AB9A 4N9TA 2PMZB 4RWSC 1JR0D 3R2IA 4HCEA 1F9SA 2K5WA 4DXFA 5KEEA 3R8BA 4A3BB 1Y8OB 3GQBA 5CV6A 1PTOH 2M00A 4IZ8A 1ZXTA 3I4MB 3EA6A 2PO4A 5J1ZA 3TN2A 2N88A 4CHTB 5I6YA 1ZYRD 2I07B 1JORA 3K59A 2WB1B 1G91A 2NB0A 1B1ZA 2F0WA 4WFN3 2K03A 2XSCA 1NR4A 2DNCA 2RQXA 4J8QA 3K5LA 1CTMA 3SVMA 4PMCA 1LACA 1Y8PB 4O42A 1EY7A 2CHBD 4KJNA 4B9XA 3J7YW 3G6JB 2F0EA 2B2WC 1EYCA 1I4GA 1ZKOA 1QILA 5FO9B 4NW2A 3BYTB 2JE6I 4ZKBB 1EY6A 1A2UA 5I4DA 2O2LD 3PMFA 2F0NA 5ELDA 1KDCA 4FYDA 2O5JC 1BR9A 2C9OA 2L5TA 1STYA 2A6EC 2SDFA 2K32A 2JA7B 1LLRD 3BDLA 3S2HB 1BCPF 4RKBA 4O1NA 2LKVA 3NWSA 4V0BA 1E2VA 1H9MA 3MXPA 3MXUA 2D62A 3K5MA 3HOYB 4IUNA 1CK1A 2VNUD 2SEBD 4F87A 4CKEA 1E2ZA 4FF1A 2IL8A 2E2IB 3I70A 1KABA 3GTQB 1J8IA 1TT2A 1EY5A 4IUQA 4FVMA 4BWGB 4DFAA 1NAPA 5ISRA 3TP5A 2B8FA 5F2DA 3KK7A 2PZTA 3NUCA 1HCZA 4IFDI 5JEAH 4LMQD 1TWAB 3GTLB 4ID6A 1XWEA 4ZUIA 2O5IC 5IT9E 4C3IG 1TVXA 3SK8A 1PTOF 4RAUC 1Q1BA 2Z8LA 4A3KB 2OEOA 1MD2D 2O4XA 3DEOA 1I6VC 2PW7A 1VF7A 2QF7A 2PNRC 3H6MA 5BN3A 3J81E 2G9DA 3S15B 3M85A 4PMBA 2YU9B 2XNAC 2EY5A 1SYDA 5M3MB 2DN8A 3OIPA 2KVMA 3GTGB 2A6ED 5HURA 1XXGA 4QF4A 3CKIB 3NXWA 4C56C 2NN6H 3CRKC 1PRTF 1BDOA 1B9NA 5DAUA 5M5WB 3NHHA 1SJHD 1JC7A 1SMYD 2RBMA 4A93B 2L1BA 2F0VA 4HSPA 3Q24A 2LY7A 3DWAA 1BOSA 1X32A 4ZQ3A 3NSWA 3D4WA 1HQRD 2EY6A 3OMGA 1Y69U 4ZRZA 4Y7NB 2IX3A 5CBEE 2MPMA 1SSOA 1GUOA 1K83B 4LJZC 5C0XI 5C0XG 1V1PA 1DJRD 2G9HD 2F0OA 3T51B 4OO1H 1GUSA 1EZ8A 3Q6SA 4K6LA 2Y0SB 1IL8A 4FP5D 1WCMB 5DNFA 3SK5A 2QDBA 3WOEA 2XVSA 1EWCA 1BO0A 4R8NA 2EOTA 1R4QB 3NTIA 5FK9C 1JOQA 2WP8J 1QG7A 3NP8A 5C4JB 1EY4A 4LAAA 1O7ZA 4MIUA 5A35A 4IUUA 2F0IA 2FINB 3M4YA 2NYZD 5C0XH 2JA8B 4TKOB 1TS3A 1SDFA 4PNYA 2BE5C 2IWHA 2HDMA 1F77A 1UNSA 3FPPA 4OHJA 3E6ZX 1CA5A 1RODA 1BNZA 1WTQA 4CJ1B 3HP3A 5TSSA 1HFNA 3L3OC 1AN8A 3MC0B 4ABNA 3K5OA 5KNBA 2KA7A 1O7YA 2F0DA 1RHPA 2A69C 2PZUA 2AQ3B 4U673 4G7ZC 4ZYSA 4BBSB 3QG1A 3S1QB 2B2TA 3SEBA 1WD0A 1SE4A 4WRDA 5EPJA 1ILQA 1WVLA 3SE0A 5IODA 4DGZA 2MP1A 3LNNA 4KV6A 1XYIA 3TSSA 4HTHA 1ICWA 3FRPB 1HXYD 5AFWA 4XQQA 2L11A 1OXXK 1QCBD 3RUZA 2JYOA 4K8JA 1EEID 1STAA 5C44B 4HAEA 5ELBA 1V43A 1X3QA 3H0GB 1T5EA 3VA5A 3EFXD 2NVTB 1A2TA 1LV9A 5G3LD 1B3AA 1SE3A 4BA2I 1B44D 2Q8IB 3QJYA 5HGTA 1LT6D 3JAME 2NVXB 1S5CD 1NCVA 3ONAB 2HUGA 1ONLA 1AZPA 2E2JB 2VUMB 4EVOA 3SHLA 1JICA 1GOZA 4QUCA 3VA7A 1F9QA 3HOZB 3VR6A 1LTID 1JWSD 3BYYB 3OWFA 1TQOA 2VXWA 4K14A 5K5PA 1PRTC 4K6DA 1MI2A 2B63B 5C4ZA 2NWGA 3PIO3 2K04A 3M3YB 2F0HA 1ET9A 1I4QA 2FMCA 2WAQB 4ZAIA 2L0CA 4N9PA 1Z6HA 4F8MA 1PFMA 3ZYYX 1L0XB 1I6HB 1D5XC 4QUFA 3N52A 3KBGA 2WV6D 1STEA 5KIXA 3SK4A 4B08A 3PO3B 1JOKA 4KHVA 2KCNA 1KDAA 3Q22A 3CU7A 3LX0A 2X6LA 1MSGA 3RD4A 1RCVD 4ZLTF 5IGGA 5JPMC 2MJ8A 5C5MA 4R9WA 1GHKA 1XX8A 1Q1EA 2ZXOA 3PUYA 4XT3B 4IFDJ 1H9JA 1O80A 4IALA 5ELCA 2Z1CA 1LTBD 2CQAA 1EY0A 2F0LA 1QJOA 4XQNA 5JOBA 3D4DA 3KLRA 5EBDA 3NTHA 1SMYC 4KKTA 1HUNA 4DAYA 3F2UA 2E74C 2AUKA 1WTWA 5COYA 5IGEA 1F2MA 4XYOA 4DF7A 4E6IA 2C5CA 2EYOA 1YNJD 4HMJA 1H9KA 1B4OA 3MXGA 1PRTB 1PXUA 1NSNS 3KLSA 1Q12A 1S5ED 3A7AB 2X69A 1IYUA 2EPBA 1W6JA 3HRZC 3R2TA 2KQ3A 3URYA 4QMGA 3W2DA 1CI3M 1BUVT 4R8IA 1B53A 4FO2A 5C4XB 1R4PB 2KECA 2F3WA 4V190 3RMHA 3BDCA 3T13A 4BS9A 1Y1WB 1DOKA 3I3CA 3OW7A 1QNKA 3KBXA 4ZK9B 2KUMA 1YNNC 5LL6S 3K5NA 4A3FB 1JB3A 1I4XA 1C48A 2NTSA 1IKMA 4KY5A 3OHXC 2BCOA 3MWYW 4HEDA 2ENBA 1FNUA 3QOJA 2B2YC 3ERQA 4C2MB 4CJ2C 3NQTA 3T56B 5KNCA 3MXNA 4ODGA 4IUTA 3H94A 1BCPB 4WORA 1SYCA 3PO2B 1GUTA 1WTOA 1Z47A 3IFDA 3V2TA 3KF8A 5G3LF 1SEBD 1Z7TA 2IT1A 2PCFB 5C3XA 1EY8A 4M1UB 2FHTA 2KJXA 4DNTB 1W6KA 5CYUA 4DK0A 3EROA 1S5DD 2OT2A 5I6WA 1FYCA 2H4OA 3NK9A 3L9AX 1JQYD 3RZDB 2IX0A 1F9RA 2K28A 1DYQA 2XIWA 4FXGC 5JPNC 1KTKA 2B2UC 5IGDA 3S17B 2IJ0A 1EWHA 3S2DB 3K0YA 1E2WA 4NP5A 3I4NB 4FXKC 5KNDA 3VYSA 1A3UA 2A6HD 4P2CB 3JAML 1QE6A 4GZYC 4DK1A 3VR3A 2QKIC 2WINB 1OO9B 3DWQA 5FO8B 3NBIA 5FOBB 1IHZA 5E3FA 2NBFA 4C1NK 4OO1G 1CHPD 3GP7A 5CMDA 1A6XA 1ENAA 1STHA 3OMCA 1WD1A 4F7XA 4IUPA 4KD3A 3TMEA 2F0MA 3A8IE 1OXTA 1S5FD 4KN7C 4EGVA 3S1MB 1MSHA 1QNUA 4RGOS 1V8QA 2BA1A 2CW0C 1Y8NB 4CKCA 1IKLA 1WTPA 3S9WA 5DM73 4C1NI 4A3IB 4BBRB 1YNJC 3PUVA 3WOFA 2QCPX 3EJIA 1CT1D 1SE2A 3BVMA 5IIFA 5E1FA 1PZKD 5C5LA 2JEAI 4RGTA 2F0QA 4L63B 4PV1C 1ZYRC 1PRTD 4FXDA 4KKUA 3DWPA 1SNOA 1SNDA 1EIGA 2Z4HA 2B2TC 5KYLA 3GV6A 2YYZA 1DXMA 2B2VA 2EJGC 3BDOA 3HOUB 5E4XA 3D4RA 1D6EC 4FF4A 2Z4IA 3BZDB 1PTOD 2OF1A 4Z9CB 2PYKA 3GTKB 5KYIA 2FFKB 3O13A 2Q8RE 5K36G 3QWNA 3K58A 5JVH3 3D8GA 1FNWA 2KEEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y8P B;  3DXJ C;  1GUG A;  4OGQ C;  1GUN A;  1HPC A;  3A8J E;  4TKO B;  2JXM B;  4G7H C;  3PV0 A;  2DN8 A;  1QJO A;  1ONL A;  2R6G A;  2A6E D;  2BE5 C;  3VR4 A;  1H9R A;  1ZKO A;  4JBW A;  2ZT9 C;  1LAB A;  3FPP A;  2B8G A;  1IW7 C;  1OXT A;  2V4D A;  3A8I E;  3KLR A;  3ND9 A;  4KN7 C;  5BN5 A;  3VA7 A;  3VR6 A;  2JE6 I;  3TZU A;  2NN6 H;  1SMY C;  3CRK C;  4IFD G;  1FR3 A;  1BDO A;  1B9N A;  2A68 C;  4KKT A;  3T56 B;  2DNE A;  5KNC A;  2AUJ D;  3H94 A;  4KHZ A;  4KKS A;  2E74 C;  1IYV A;  1V8Q A;  2BA1 A;  2CW0 C;  5KNB A;  2AUK A;  4HR7 B;  3L7Z C;  1Y8N B;  3A7L A;  2KA7 A;  2O5J C;  3I72 A;  1GUT A;  4XIG S;  3NE5 B;  3N6R A;  4I7Z C;  3GD7 A;  3RLF A;  4G7O C;  2D2C C;  1VF5 C;  1GJX A;  2A69 C;  2L5T A;  3W3A A;  2A6E C;  4G7Z C;  1K8M A;  1YNJ C;  1PMR A;  2K32 A;  3OPO A;  3PUV A;  4BA1 I;  4KI0 A;  2LMC B;  5BN4 A;  3I73 A;  2JEB I;  1TKW B;  2EDG A;  1Z7T A;  3QG1 A;  2IT1 A;  2PCF B;  4LK1 C;  4RCN A;  1Z6H A;  1Q90 A;  3PUZ A;  1DD2 A;  1K8O A;  4DNT B;  3BG3 A;  2PPB C;  1O7L A;  2BDO A;  3WDN A;  5K36 H;  5JEA G;  4DK0 A;  2D5D A;  1E2V A;  3M7N A;  1H9M A;  2AWO A;  1H9K A;  2A69 D;  4JK1 C;  3VR5 A;  3MXU A;  2D62 A;  1Y69 U;  3SE0 A;  2JEA I;  1IW7 D;  1FYC A;  3MFY A;  3A8K E;  4H13 C;  3SDZ A;  1GUO A;  3IKJ A;  1Q12 A;  3A7A B;  4L8J A;  2E75 C;  3PUW A;  4PV1 C;  4H44 C;  3AB9 A;  4LJZ C;  1E2Z A;  1IYU A;  1VDZ A;  3LNN A;  1ZYR C;  4H0L C;  5C0X G;  4IFD H;  2EVB A;  3PUX A;  3EQL C;  4KKU A;  1H9S A;  3HGB A;  3QIA A;  4KN4 C;  3FMC A;  3T51 B;  4OO1 H;  1O78 A;  2NN6 G;  1DCZ A;  1HTP A;  1GUS A;  1Y8O B;  2NN6 I;  3GQB A;  4DNR B;  2B8F A;  1TU2 B;  2BE5 D;  1EWH A;  2YYZ A;  3I4L A;  1CI3 M;  1DXM A;  1OXX K;  2EJG C;  2EJM A;  3BDO A;  1E2W A;  3D31 A;  1HCZ A;  3CRL C;  5KND A;  2EJF C;  3T53 B;  5JEA H;  1HQM C;  3M85 A;  3D4R A;  4XTC S;  4IQZ A;  2A6H D;  2E76 C;  1G29 1;  1V43 A;  2O5I C;  1H9S B;  4GZY C;  4DK1 A;  2A68 D;  2A6H C;  1T5E A;  1OXV A;  3OOC A;  3VR2 A;  3VR3 A;  1CFM A;  1OXU A;  2K33 A;  3U9S A;  1Q1B A;  1VCI A;  1GHK A;  4BA2 I;  3OW7 A;  2BA0 A;  4KMU C;  1Q1E A;  1I6V C;  1GHJ A;  3PUY A;  4OO1 G;  1B9M A;  2Q8I B;  1VF7 A;  2QF7 A;  3QJY A;  2F1M A;  2PNR C;  4TQU S;  5K36 G;  1OXS C;  1H9J A;  2DNC A;  3LWU A;  3P20 A;  1YNN C;  5A35 A;  5BN3 A;  1A6X A;  1CTM A;  3M4Y A;  1LAC A;  2K7V A;  2KCC A;  3IFT A;  3ND8 A;  5C0X H; 
#chains in the Genus database with same CATH topology
 2CH4 W;  1N33 L;  2I5H A;  2JXM B;  2F0T A;  1TWG H;  3PV0 A;  4OWT B;  4ILW A;  5EKI A;  2UUC L;  2E2H B;  2IW3 A;  2RKS A;  5IGF A;  4IPG A;  2UXB L;  4N8F A;  4JW0 A;  4IUR A;  3TBI B;  1HTL D;  3IAY A;  5IGC A;  1TS4 A;  1XPU A;  2SNS A;  2A73 B;  4AYB B;  4IUV A;  3DLL A;  2CW0 D;  2A68 C;  3CME A;  1HFG A;  3FP9 A;  1E1O A;  2AUJ D;  5CV7 A;  4UDU C;  3PO2 H;  4KKS A;  5FLX E;  4HR7 B;  4B9W A;  3RLF A;  1Q86 C;  4DUZ Q;  1G8Z D;  1KAW A;  2Z0S A;  3GDE A;  5CR3 A;  5FJ8 H;  5LMN L;  4LK1 C;  5DEH A;  3CC4 A;  2LSS A;  4Y52 H;  4OO1 I;  4XDX A;  2NVX H;  1LT4 D;  1X54 A;  1SNM A;  3J80 i;  2D5D A;  5ELE A;  4LWC A;  2Q2H A;  3CF5 A;  3TS2 A;  2R93 G;  4J1M A;  3A55 A;  3QR8 A;  5JAV A;  4YY3 L;  1LT3 D;  1VQO A;  2ZJP A;  3ULJ A;  2E75 C;  2KCM A;  4LF7 L;  1PTO C;  5JJZ A;  2VW9 A;  4A3B H;  2F3V A;  3LWE A;  4LUZ A;  4ME5 A;  3QIA A;  5M5W H;  3E9I A;  4L5S A;  1YHB A;  2RSO A;  1ML0 D;  2ALY B;  4DNR B;  3GTO B;  1RL2 A;  3PF4 A;  3J80 c;  2EYJ A;  3I8Z A;  5C0X J;  1WJJ A;  3CRL C;  2B3G A;  3UE0 A;  5AJ3 L;  3S15 H;  4CDF C;  1DON A;  1JWU D;  3KYH C;  3HZX A;  4G4K A;  3OOC A;  3CXC A;  5M3M H;  1D2B A;  2M2L A;  3H15 A;  2PI2 E;  4CGY B;  1QZG A;  1Q8I A;  2CFM A;  1SNQ A;  3KF8 B;  1RJT A;  5C4H A;  4NXM Q;  1OXS C;  2PQA B;  1PZJ D;  3K81 C;  5IT9 L;  1QOH A;  1ICF B;  1EOT A;  5D65 A;  5M5Y B;  4A3D B;  3CCU A;  4IJH A;  3K8A A;  2EIF A;  1QB5 D;  4JI5 L;  4X3T A;  5CC4 A;  2JSO A;  4A3J B;  1TII D;  1II3 A;  4K8I A;  1V9P A;  4JI8 Q;  1CQV A;  2DNE A;  3A5U A;  1E0B A;  4POG A;  3NBH A;  1HR0 W;  4LNQ A;  2AWN A;  1W2B A;  3L7Z C;  2ID0 A;  1WTH A;  2RSN A;  5KGU A;  2ATW A;  2JA7 H;  1UE6 A;  3S1N B;  1TS2 A;  3N6R A;  1SXT A;  2GVA A;  4GNX B;  1LTG D;  4PQX A;  2BDN A;  3S14 B;  3HKZ B;  1K8M A;  4ULL A;  4EX5 A;  1LTS D;  1MBY A;  3FPU B;  2N78 A;  2R92 H;  3NPP A;  4A3M H;  1K0R A;  1LTA D;  3AFP A;  5IGB A;  5K36 H;  2JA5 B;  4AH6 A;  3Q0A A;  1WOC A;  2YTY A;  3I4O A;  5J3B A;  4IPH A;  3GO5 A;  4JK1 C;  2A74 C;  3VR5 A;  2FXQ A;  1I4R A;  1N34 Q;  3BZK A;  2RDF A;  3A8K E;  2Y0S E;  4L8J A;  2NUC A;  4H0L C;  1WYD A;  2F0S A;  3MTS A;  5EKL A;  3GTJ B;  1DOM A;  3V96 A;  1JCK B;  3E5S A;  1R9T H;  4X62 Q;  1QVG A;  3HGB A;  4X62 L;  4LF5 Q;  1EEF D;  2EXD A;  4S3S A;  1J6Q A;  2DUD A;  2BE5 D;  1EIH A;  5FLX c;  2EJM A;  3D31 A;  3TP6 A;  3HOV H;  4DR3 Q;  2EJF C;  5L37 A;  3OYY A;  4IOC A;  1N36 L;  4GLA C;  2R7Z B;  3DM1 A;  1ASZ A;  2YV5 A;  1QUQ B;  2E8G A;  1LTR D;  1G29 1;  3PCO B;  2R92 G;  1LT5 D;  2CWA A;  1C0A A;  4QB4 A;  5M3F B;  3IL8 A;  4DR1 L;  4IOA A;  2OXP A;  3U9S A;  3T1H Q;  3NEM A;  1PTO B;  1SYG A;  1BBX C;  4KMU C;  1GHJ A;  4IJL A;  1VQ7 A;  2F03 A;  4RHR A;  2G5D A;  1L0Y B;  1XTC D;  4YWK A;  4L5R C;  4CBV A;  3A0J A;  1D1I A;  1D8L A;  1BKB A;  3EVQ A;  4B3R Q;  5H1S E;  3MFG A;  4LF4 Q;  4MN3 A;  1T5X D;  4HMI A;  1PH5 A;  4JI1 Q;  2B39 A;  2FJ2 A;  2HQE A;  1DZ1 A;  3KF6 B;  5COR A;  2JA6 H;  4IFD G;  2R93 B;  2EYL A;  2RDH A;  4HJ5 A;  2KOL A;  5M5X B;  3T4A C;  3PO3 H;  4C2M H;  1FNV A;  5C3E G;  4ZUJ A;  1EUJ A;  2EXZ A;  1YIT A;  5CV8 A;  4GOP B;  3C46 A;  5I9P A;  3OW2 A;  4PMW A;  3GD7 A;  3CHB D;  4IPC A;  5CV5 A;  1DM0 B;  2KHS A;  1PMR A;  3CAM A;  1VQD A;  4CDE C;  4NMZ A;  2B2W A;  1X3E A;  4JYA L;  5GAE C;  4LF7 Q;  3GTO H;  1Q90 A;  1I6H H;  1DD2 A;  1E3P A;  3QOL A;  1R9T B;  4A3L G;  5D3I B;  2RVL A;  4DAP A;  4A3F H;  5EQ0 A;  4HJA A;  1RD9 D;  2ZXP A;  1HA6 A;  4X64 Q;  4RFB A;  4DR1 Q;  2VS1 A;  3I4M G;  2E2J H;  4C3J G;  3MAQ A;  5D14 A;  5EKK A;  1XTD A;  3G4S A;  1TR5 A;  4YWM A;  5E4W C;  3E9H A;  1C8C A;  4AIM A;  4GNX C;  1F2L A;  4C3H G;  3ULP A;  3H0G H;  1MJC A;  5M9O A;  2A5H A;  4JV5 L;  4JCV E;  1Q7Y C;  4RA8 A;  5D3D A;  1A0I A;  4QJF A;  3RN5 A;  3BVZ A;  1I50 H;  2ZM6 L;  4UAI A;  1BXT A;  4JI5 Q;  3AU7 A;  3I4N G;  1YBY A;  3PQI A;  3GTP B;  1W3S A;  3D6W A;  2Z9H A;  2K33 A;  2R61 A;  1ESF A;  4DR5 L;  1CA6 A;  1VCI A;  3CQZ H;  3UDF A;  2D9U A;  1EZ6 A;  1GD7 A;  5E7N A;  2B2U A;  2F1M A;  2OQ0 A;  1SR3 A;  2HQL A;  3MHB A;  4TQU S;  3HOW B;  1TWA H;  3GTL H;  4DV3 L;  4Q0F A;  4DR2 L;  1ZEQ X;  1VQB A;  2LXJ A;  4XXE A;  5CGK A;  3DXJ C;  3U9O A;  4OGQ C;  4FNF A;  3A8J E;  2E2D C;  5AJ3 Q;  4A3J G;  1O7I A;  3A54 A;  1FL0 A;  2IPK D;  3C2P A;  3TRE A;  1LTT D;  1HRJ A;  1SYF A;  3H09 A;  1B50 A;  3TZU A;  3OWE B;  1FR3 A;  3J7A F;  3A56 A;  1D5Z C;  1VQC A;  4A3G B;  1XJV A;  4KHZ A;  3P75 A;  2F0K A;  3A7L A;  1GUW A;  3I72 A;  2EY1 A;  4GN5 A;  2EYH A;  2D2C C;  1VF5 C;  5FLX L;  1LO5 D;  1TS5 A;  3CQZ B;  5IP9 G;  3W3A A;  2IHF A;  2K14 A;  4MZ9 A;  5BN4 A;  4B3S Q;  2VL6 A;  3BS1 A;  5EAY A;  1Y1W H;  3WDN A;  1KNE A;  2EZV A;  1S40 A;  4J6H A;  2MHV A;  1G2T A;  3J80 L;  3CCJ A;  1SYE A;  1EYA A;  2Z6K C;  5IP7 G;  1SJE D;  3EIV A;  3MFY A;  4H13 C;  3IKJ A;  3PUW A;  1AP0 A;  1CZW A;  4O0A A;  4JC0 A;  4DAV A;  2RCN A;  3E3X A;  2ES2 A;  1HNW Q;  4DV4 Q;  5LMU Q;  1C4Q A;  1U4L A;  1JT8 A;  4O2D A;  2GA4 B;  3U4Z A;  4EQO A;  1TU2 B;  4UP9 A;  2EYF A;  3STB D;  3QO2 A;  4OXP A;  1EU4 A;  2OCE A;  3NWT A;  1YZ6 A;  4NKL A;  3KLS X;  2WII B;  3E0J A;  5LMN W;  4LFA L;  1K3B C;  3CC7 A;  4BY1 B;  4HN7 A;  4LF6 L;  2N55 A;  1VQL A;  3T1Y Q;  1IXR A;  1KDB A;  1A3V A;  2F0F A;  1UE1 A;  4BXX H;  4DUY L;  4GNX A;  1PZI D;  3X3N A;  3ULL A;  2B63 H;  2EE1 A;  1FGB D;  1JE4 A;  2K01 A;  2OWO A;  4NDX A;  1SE8 A;  1M4V A;  2KCC A;  4G57 A;  4A76 A;  1A3T A;  3DEP A;  2UUB Q;  4UY8 C;  1PHJ A;  2E2I H;  1F9P A;  3OSO A;  3STB C;  2SNM A;  4UHV A;  3VR4 A;  1STG A;  2UUA Q;  1RKN A;  5LL6 X;  1RDP D;  4DN4 M;  3J7A V;  4XT1 B;  1K0S A;  1BCP C;  3P1H A;  5LHY 1;  5J22 A;  2KEN A;  2QEJ C;  2WKC A;  1I3Q B;  4DV7 Q;  1IYV A;  4DV4 L;  3P7J A;  1TY2 A;  2J0T D;  1A15 A;  3T16 A;  2UXD L;  4XIG S;  3HS0 C;  4QL5 A;  1NBW A;  4A3K H;  2WAC A;  3UE1 A;  4K2L A;  3I56 A;  2K5Q A;  4YCV A;  4GKK Q;  3S24 A;  2JEB I;  3VYU A;  5JEA G;  3RN2 A;  5A2Q E;  4A3B G;  2UUB L;  3M7N A;  1Y1V G;  1D5M C;  4R4I A;  3R93 A;  3MEH A;  2KCT A;  4H7B A;  4EQN A;  5T1G A;  1EU3 A;  1U4R A;  3SDZ A;  2MFI A;  4P74 A;  2X6G A;  4X3S A;  1VDZ A;  4RG1 A;  5FKA C;  1V1Q A;  3PUX A;  2JA9 A;  3MA2 B;  4K5X A;  4RGN A;  1K8G A;  4BY1 G;  5IYC H;  2XWJ B;  3I4L A;  3NTK A;  4HIO A;  1RTN A;  1G6Z A;  1PLF A;  1SAP A;  4A3K G;  4NPS A;  3Q8D A;  4X66 L;  1GXD C;  2RCF A;  3AQQ A;  4RKL A;  2E76 C;  3KUP A;  1GKH A;  1WTX A;  1H9S B;  1U4P A;  4RHS A;  2D0P A;  3H91 A;  2HIX A;  1E24 A;  1OXU A;  2MO1 A;  3PIP 3;  3DHQ A;  3J80 E;  2K05 A;  4FF3 A;  1JMC A;  2BA0 A;  3SR1 A;  1JJG A;  2N49 A;  2PZW A;  5C6A A;  1UE7 A;  3P20 A;  3J7Z C;  2HT1 A;  4DR7 Q;  2I5M X;  2LFN A;  1X3P A;  3IFT A;  3UI2 A;  5EBC A;  2NVY B;  5JEA J;  4FF2 A;  3M7G A;  5M3F H;  1HPC A;  3ITP A;  2Q8T A;  5J39 A;  3QB3 A;  1FD7 D;  4LF9 Q;  2R3Z A;  1K28 A;  1QWY A;  3K7A B;  2JA8 H;  1TWF B;  1AFP A;  1PH3 A;  4CKB A;  4A3D G;  1H9R A;  4L5Q A;  2N3S A;  1TWC B;  4KD4 A;  1SNP A;  4JBW A;  2ZT9 C;  4OX9 L;  1ESR A;  1IW7 C;  2L12 A;  3F1Z A;  4K5W A;  5BN5 A;  1XNQ Q;  4HJ8 A;  2L55 A;  1STB A;  2F4I A;  1P16 A;  1UAP A;  2I0Q A;  1AH9 A;  1N8R C;  4BY7 B;  1SYB A;  3M9B A;  4X3U A;  4G7O C;  4DA2 A;  5CBA E;  3KDF A;  2K1B A;  1X6O A;  4I65 A;  3GTM B;  4KY7 A;  2JA6 B;  5KRU A;  3HG9 A;  3ERS X;  4IN3 A;  4DXG A;  2NVQ H;  1NR2 A;  2K4K A;  4C3H B;  4JVZ A;  5JJI A;  3BG3 A;  4GN4 B;  2PPB C;  1O7L A;  2RF4 A;  1CKM A;  1S5B D;  5C4X G;  5C3W A;  1NNX A;  2AWO A;  2A69 D;  3DUZ A;  3BVG A;  3M4O B;  4X65 Q;  4X3K A;  4DV6 Q;  3H3V I;  2MNA A;  1I4P A;  3H3V C;  3U58 A;  4RCO A;  2JA6 G;  4IFD H;  4GOP A;  1C9O A;  1ENF A;  1H9S A;  1EFI D;  1VMC A;  4RH6 A;  1RTO A;  4QY7 A;  1O78 A;  2NN6 G;  4MTN A;  5I2X A;  2QW7 A;  2DJG C;  4FDB A;  2NN6 I;  1HHV A;  1JOO A;  4A3M B;  5FLM H;  2ZM6 Q;  4RGM A;  4BY1 H;  1HQM C;  1NUC A;  2XN9 C;  2PQE A;  1GO3 E;  2MQH A;  4YIJ A;  2NVQ B;  3C1F A;  2IX1 A;  2K75 A;  2A68 D;  2A6H C;  1S4Z A;  1IBM L;  2QDL A;  3MZ5 A;  2HHH L;  1KLG D;  1I50 B;  2FMM A;  1UUP A;  1B9M A;  2XRS D;  1Y14 B;  3TP7 A;  3TRZ A;  3NQI A;  4L6T B;  3FVQ A;  4X64 L;  3FDT A;  4DV2 Q;  5JVG 3;  3RZO B;  3ND9 A;  1D7Q A;  4XQJ A;  1NJI C;  3W5O A;  2UXC Q;  2L9H A;  2XWB B;  2DY7 A;  3FKI B;  3HOV B;  2L15 A;  1ILP A;  2K5H A;  2R6G A;  2Q2I A;  2PW5 A;  3GV3 A;  2GVB A;  3FKI G;  2H1E A;  4JI3 Q;  1D1K A;  5LMN Q;  1LAB A;  1AEX A;  1Q3L A;  4DNI A;  2ICI A;  3CW2 C;  1XPR A;  3BU2 A;  1OTC A;  1EY9 A;  4I7A A;  4OIK A;  2EQS A;  4LFC L;  3AMU A;  1BQQ T;  1PFN A;  5JJL A;  4YHH Q;  2M9V A;  4JI7 Q;  3NEL A;  2A8V A;  4A93 G;  1EYD A;  3MXN B;  1UEB A;  2ICE C;  1X56 A;  5M5X H;  4A3E B;  1VMP A;  5C3E B;  2JP1 A;  2KHJ A;  1IBK L;  1WCM H;  1AW7 A;  1U9R A;  3S1R B;  1B2T A;  3OPO A;  1Q46 A;  2WAQ G;  3I73 A;  1TKW B;  4JI1 L;  5A2Q L;  4K5V A;  4DR5 Q;  1L2F A;  3D6C A;  4U68 A;  4UPA A;  4RCN A;  2CVR A;  3SK6 A;  4DAM A;  4QCL A;  5IY0 A;  2BDO A;  3CCE A;  2QA4 A;  2B2V C;  2WKD A;  2RA4 A;  4BY7 G;  3JAM c;  3AFQ A;  2RDG A;  2R93 H;  5IP7 H;  1TWG B;  2TMP A;  4OIJ A;  4NXN Q;  1KLU D;  1YHQ A;  4H44 C;  3CCQ A;  2NZO A;  1CHQ D;  1BF4 A;  3CD6 A;  3I2Z A;  3PIO A;  3S16 H;  2F0J A;  5IOC A;  3EQL C;  3L2P A;  1B8A A;  1C7Y A;  1F2Y A;  1HTP A;  2HCI A;  3TZD A;  2ASB A;  1CSP A;  1RF2 D;  5I9O A;  1S72 A;  1KAA A;  4AQY L;  5HY6 A;  4ZKC B;  1XPO A;  1MKH A;  3DMU A;  3T53 B;  2QIL A;  4R4Q A;  2L4N A;  4IQZ A;  1STN A;  1VQH A;  1YI2 A;  3HOZ G;  2DY8 A;  1K3R A;  3VR2 A;  1CZG A;  1XNR Q;  5EJW A;  2MUY A;  4M8A A;  3ER0 A;  4HSV A;  3WWV A;  4OL7 A;  5CV9 A;  1JJ2 A;  1EL0 A;  1KNA A;  1NTG A;  4HJ9 A;  3C1E A;  2R92 B;  1KRS A;  1KD1 C;  3AYH B;  4GLV B;  5ELF A;  4A3C H;  1SMX A;  1MGS A;  2I46 A;  3EN2 A;  3NBH B;  3TP8 A;  3S16 B;  4K2K A;  1YNN D;  4KK7 A;  2E5L L;  4R4T A;  4JG2 A;  4JI0 Q;  4GKJ Q;  1M1K C;  4QIW B;  5GAD C;  2HDL A;  2F0P A;  1UWV A;  3PGZ A;  2XTI A;  2B8G A;  1CSQ A;  4HCS A;  3FEW X;  3I90 A;  4XYQ A;  1KIX A;  2GN5 A;  4EQP A;  2BOS A;  2CQO A;  3NEN A;  1K73 C;  2AQ1 B;  4DR3 L;  4KJO A;  1J9O A;  5EPL A;  4AYB G;  1SLJ A;  1EQT A;  1V1P B;  1BCP D;  2K5D A;  2ZXR A;  4DUZ L;  3C3L A;  3HOW H;  1EQR A;  4LW1 A;  3HKZ E;  3NE5 B;  4I7Z C;  1CQF A;  3VYT A;  1GJX A;  1HH2 P;  1B3Q A;  2EYP A;  4BA1 I;  4R1J A;  2LMC B;  4OX9 Q;  5DM6 3;  2VQE Q;  2OTL A;  1I4H A;  2NZ1 D;  3PUZ A;  4IPD A;  2B2Y A;  1Y1V B;  2K6A A;  2VB3 X;  2C35 B;  4DV6 L;  3SXH A;  5FO7 B;  2EY2 A;  4BBR G;  4A3I G;  2F0U A;  4AYB E;  3JAM i;  4LF8 L;  5GRO A;  4TSS A;  5I2Y A;  1TY0 A;  1WTR A;  1G2S A;  1X3G A;  2I5L X;  4A3J H;  2DGY A;  3VYR A;  1V1O A;  4Q5V A;  2TSS A;  2EVB A;  4F88 A;  4CDC C;  3OIQ A;  1EQV A;  1HUM A;  1PDQ A;  2NZH A;  4KN4 C;  3FMC A;  4WJW A;  4C3J B;  5EGT A;  1DCZ A;  1Q81 C;  2F0G A;  1JWM D;  4YCW A;  4DU9 A;  2E2H H;  2Y0S G;  2Z6K A;  4TRD A;  5NUC A;  2JJQ A;  4XTC S;  1EWI A;  3HEJ A;  2JN4 A;  3HOY H;  4DAY B;  4DV5 L;  3M4O H;  4OEM B;  1OXV A;  4KTA A;  4CDD C;  2J4X A;  1CFM A;  2NTT A;  4PZ7 A;  1SFO B;  2VB2 X;  1M8A A;  3J81 L;  1NY4 A;  1SNC A;  1Q82 C;  4DV1 L;  2HIV A;  3D3R A;  3KF6 A;  3LGJ A;  3LWU A;  1ENC A;  4KHP L;  1DOL A;  2K7V A;  3ND8 A;  5FJ8 G;  2KBN A;  1GUG A;  1GUN A;  4G7H C;  1U4M A;  2HCC A;  4X65 L;  4PG3 A;  3R3O A;  5EPK A;  4JPB W;  3B6Y A;  2ZTD A;  4R4C A;  2UXB Q;  3K6O A;  4DV3 Q;  2JA7 G;  2UU9 Q;  2V4D A;  4CJ0 B;  1N33 Q;  2EYM A;  3MEF A;  4C3I B;  4MHE A;  3MVV A;  1PA6 A;  1N32 Q;  3TDQ A;  3HKZ G;  2XRQ D;  3F2D A;  3I55 A;  2LS0 1;  5C3E H;  5C4X H;  1CM9 A;  5T1I A;  1ET6 A;  3KDF B;  1SBB B;  1PFB A;  3K57 A;  1TWH B;  2MGS A;  1WTV A;  1PH9 A;  1HA5 A;  4KY6 A;  1PYW D;  2QEX A;  2ZJQ A;  4KI0 A;  4P73 A;  1F2Z A;  4B3T L;  1HNZ Q;  2EDG A;  3Q23 A;  3V05 A;  2AKW B;  1JJC B;  2J7Z A;  3G7L A;  3VDY A;  2SOB A;  3I91 A;  1K8O A;  5CV4 A;  3A74 A;  2KED A;  1AZQ A;  3J81 c;  3HOX B;  1IW7 D;  1UEA B;  2AQ2 B;  3X3M A;  1HNX L;  2BH2 A;  3AB9 A;  4N9T A;  4LFB L;  2WFW A;  4A3E H;  2PMZ B;  4RWS C;  1JR0 D;  3R2I A;  4HCE A;  1K83 H;  1F9S A;  4LF6 Q;  2K5W A;  4DXF A;  5KEE A;  3G6E A;  3R8B A;  2D0O A;  4A3B B;  1Y8O B;  3GQB A;  5CV6 A;  1PTO H;  1VQ9 A;  4DV7 L;  2JK8 A;  2M00 A;  4IZ8 A;  1ZXT A;  3I4M B;  3EA6 A;  2PO4 A;  5J1Z A;  3HOX G;  3CMA A;  3DM3 A;  3TN2 A;  2N88 A;  4CHT B;  4X66 Q;  5I6Y A;  1VS0 A;  2PMZ E;  1ZYR D;  3UDX A;  5IYB G;  2I07 B;  1JOR A;  3K59 A;  2IY5 B;  2WB1 B;  1G91 A;  2NB0 A;  3FKI H;  1B1Z A;  4DV0 L;  2F0W A;  1HR0 L;  4WFN 3;  1VQE A;  3S2H H;  2UXC L;  2F3I A;  2K03 A;  2XSC A;  1NR4 A;  2DNC A;  2RQX A;  4J8Q A;  3K5L A;  1CTM A;  3SVM A;  4PMC A;  1LAC A;  1Y8P B;  4O42 A;  1EY7 A;  2CHB D;  4KJN A;  4B9X A;  3J7Y W;  1FVI A;  3G6J B;  3KLW A;  2F0E A;  3GTK H;  2B2W C;  1EYC A;  1I4G A;  4JBM A;  1ZKO A;  1HZ9 A;  1QIL A;  5FO9 B;  1KL9 A;  4NW2 A;  3BYT B;  3D0F A;  4B3M L;  4ME3 A;  1MHW C;  2JE6 I;  4ZKB B;  3PSI A;  1EY6 A;  5M3M G;  1SN8 A;  2H5X A;  1A2U A;  5I4D A;  4BXX G;  2O2L D;  3F2B A;  3PMF A;  2F0N A;  5ELD A;  4PZ6 A;  2PNH A;  1KDC A;  4FYD A;  2O5J C;  1BR9 A;  1SRU A;  2C9O A;  3W1G A;  3CCL A;  2L5T A;  3CP0 A;  1STY A;  2A6E C;  2SDF A;  2K32 A;  2JA7 B;  1LLR D;  3BDL A;  3S2H B;  1CUK A;  4DR7 L;  1BCP F;  4RKB A;  4O1N A;  1H95 A;  4DK6 C;  1TWF H;  2LKV A;  3NWS A;  3CC2 A;  4V0B A;  2R7Z G;  1E2V A;  1H9M A;  5C44 H;  1HNW L;  3MXP A;  3MXU A;  2D62 A;  3K5M A;  3HOY B;  4IUN A;  4JBJ A;  1CK1 A;  2VNU D;  1VQ4 A;  1YJN A;  2SEB D;  4F87 A;  4CKE A;  1E2Z A;  4FF1 A;  1LTL A;  2IL8 A;  2E2I B;  3FHW A;  2V1C C;  3I70 A;  4X6A H;  1KAB A;  3GTQ B;  1J8I A;  1E22 A;  1TT2 A;  1EY5 A;  3L0O A;  4FVM A;  4IUQ A;  4BWG B;  4DFA A;  1NAP A;  5ISR A;  2ZJR A;  3TP5 A;  2B8F A;  1PH4 A;  5F2D A;  3T1Y L;  3KK7 A;  1JB7 A;  2PZT A;  3NUC A;  2QGQ A;  4N8X 1;  1HCZ A;  4IFD I;  5JEA H;  5IWA L;  4LMQ D;  5IWA Q;  3CPF A;  1TWA B;  3GTL B;  4ID6 A;  1XWE A;  4ZUI A;  2R7F A;  2O5I C;  3H3V H;  1MIU A;  5IT9 E;  4DR4 Q;  4C3I G;  1TVX A;  3SK8 A;  1PTO F;  4RAU C;  1Q1B A;  2Z8L A;  4A3K B;  4LF9 L;  2OEO A;  2B63 G;  1MD2 D;  2O4X A;  3DEO A;  1I6V C;  2PW7 A;  1VF7 A;  2QF7 A;  1EOV A;  2PNR C;  2BH8 A;  3H6M A;  5BN3 A;  3J81 E;  3G71 A;  2A1A A;  2G9D A;  3S15 B;  3M85 A;  4PMB A;  2YU9 B;  3KJO A;  2XNA C;  2EY5 A;  1SYD A;  5M3M B;  4DV5 Q;  2UU9 L;  2DN8 A;  4LF8 Q;  3OIP A;  2KVM A;  2A6E D;  3GTG B;  5HUR A;  1XXG A;  4QF4 A;  3K0X A;  3CKI B;  3NXW A;  3W1B A;  2VQF L;  5IYD H;  4C56 C;  1SRO A;  2NN6 H;  3CRK C;  1PRT F;  1BDO A;  1A62 A;  1B9N A;  5DAU A;  5M5W B;  4B3S L;  1TWH H;  3PO2 G;  3NHH A;  1SJH D;  1JC7 A;  1SMY D;  3HFZ B;  4DR2 Q;  2RBM A;  4A93 B;  2XGT A;  1DGS A;  2L1B A;  2RHS B;  1IBL Q;  1UE5 A;  2F0V A;  4HSP A;  3Q24 A;  1VQN A;  4GS3 A;  2LY7 A;  3DWA A;  1BVS A;  1BOS A;  1X32 A;  4ZQ3 A;  3ZJY C;  3NSW A;  3D4W A;  1HQR D;  2EY6 A;  3OMG A;  3CCR A;  1Y69 U;  1YEZ A;  4ZRZ A;  4Y7N B;  1NE3 A;  3GTP H;  4BBS G;  4TVA B;  4IO9 A;  2IX3 A;  1YJ9 A;  2RHQ B;  5CBE E;  1CKN A;  2MPM A;  1SSO A;  1GUO A;  1K83 B;  4LJZ C;  4EQ5 A;  5C0X I;  4A3M G;  5C0X G;  1V1P A;  4P71 A;  3T1H L;  3S17 H;  1DJR D;  4H02 A;  2G9H D;  2F0O A;  3T51 B;  4OO1 H;  1GUS A;  1EZ8 A;  3SGI A;  3Q6S A;  4K6L A;  2Y0S B;  1IL8 A;  4FP5 D;  1WCM B;  5DNF A;  3SK5 A;  2QDB A;  3WOE A;  1VQF A;  4A3F G;  2XVS A;  1IBK Q;  1EWC A;  5M3F G;  1VQI A;  1BO0 A;  2HD3 A;  4LF5 L;  3TQY A;  3BZC A;  4R8N A;  2EOT A;  3S1N H;  3PIP A;  4C3J H;  1R4Q B;  3NTI A;  1FGU A;  1PFS A;  4DKA C;  1XMO Q;  5FK9 C;  4A3G G;  1TXY A;  1JOQ A;  2WP8 J;  4BBR H;  4A3I H;  3GTG H;  1QG7 A;  3NP8 A;  4BBS H;  3OTO L;  5C4J B;  1EY4 A;  1HZB A;  5GQO A;  4C3H H;  4LAA A;  1O7Z A;  4MIU A;  5A35 A;  3F2C A;  4IUU A;  3U4V A;  2F0I A;  1QVC A;  2FIN B;  3M4Y A;  2NYZ D;  3RLN A;  5C0X H;  1XMQ L;  3K7A H;  2JA8 B;  4TKO B;  1TS3 A;  1SDF A;  1N32 L;  4PNY A;  3J81 j;  2KHI A;  1KXL A;  2BE5 C;  3KOJ A;  2IWH A;  4HIM A;  3HOW G;  2HDM A;  1F77 A;  1UNS A;  4AQY Q;  4GKJ L;  3FPP A;  4OHJ A;  3E6Z X;  1CA5 A;  2ZTE A;  1ROD A;  1BNZ A;  1WTQ A;  4CJ1 B;  3HP3 A;  5TSS A;  1HFN A;  2JA5 G;  3L3O C;  1AN8 A;  3MC0 B;  4ABN A;  2CH4 A;  1YJW A;  4JI4 Q;  3K5O A;  1VQG A;  5KNB A;  2KA7 A;  3ICE A;  5GAG C;  1O7Y A;  4JI8 L;  2F0D A;  2DJF C;  1RHP A;  2A69 C;  3G48 A;  1AE2 A;  2PZU A;  2AQ3 B;  4U67 3;  4G7Z C;  4ZYS A;  1BBW A;  4LUO A;  4BBS B;  3QG1 A;  3S1Q B;  1X9N A;  2B2T A;  3SEB A;  2E5L Q;  1WD0 A;  1SE4 A;  4DV0 Q;  4MNO A;  3CPW A;  4L5T A;  4WRD A;  5EPJ A;  1ILQ A;  4ALP A;  1WVL A;  3SE0 A;  1YNX A;  3S2D H;  1RIP A;  5IOD A;  4DGZ A;  4QGU A;  1TWC H;  2MP1 A;  3LNN A;  4KV6 A;  1XYI A;  2K5N A;  1KRT A;  3TSS A;  5IYB H;  5LMU L;  5ELN A;  3HOY G;  1VQJ A;  4HTH A;  2VUM H;  4YHH L;  4JI7 L;  1ICW A;  5IP9 H;  4HJ7 A;  3FRP B;  3GTJ H;  2AMC B;  3I7F A;  1BBU A;  3HOU H;  1HXY D;  5AFW A;  4XQQ A;  5FLM G;  4JI2 Q;  1IBM Q;  2L11 A;  1OXX K;  2Q2U A;  5BR8 Q;  1Y1V H;  1QCB D;  3RUZ A;  2JYO A;  4K8J A;  4LFB Q;  1EEI D;  4LF4 L;  1STA A;  1Z9F A;  5C44 B;  4HAE A;  5ELB A;  2LXK A;  1V43 A;  1X3Q A;  3H0G B;  1T5E A;  1PV4 A;  3M4Q A;  3VA5 A;  4JI4 L;  3EFX D;  2NVT B;  1A2T A;  1LV9 A;  5G3L D;  1B3A A;  3KJP A;  1WFQ A;  3AEV A;  1SE3 A;  4BA2 I;  1HJP A;  1I5F A;  2Q2T A;  2K5V A;  5IE8 A;  1NMF A;  1B44 D;  3RZO H;  2Q8I B;  3QJY A;  3S1M H;  2HHH Q;  5HGT A;  1HNZ L;  1LT6 D;  4B3T Q;  3JAM E;  2NVX B;  1S5C D;  1NCV A;  3CCM A;  3ONA B;  2HUG A;  1ONL A;  1WCM G;  1AZP A;  2E2J B;  1XMQ Q;  4EVO A;  3SHL A;  2VUM B;  1JIC A;  4DK3 C;  3JC6 6;  1GOZ A;  2UUC Q;  4QUC A;  3VA7 A;  1F9Q A;  3HOZ B;  4JI2 L;  3VR6 A;  1LTI D;  1JWS D;  3BYY B;  3OWF A;  1TQO A;  2VXW A;  4K14 A;  4DV2 L;  3BJU A;  5K5P A;  1PRT C;  4K6D A;  1MI2 A;  2P5Z X;  4A93 H;  2R7Z H;  1U0L A;  2B63 B;  5C4Z A;  2NWG A;  3PIO 3;  2K04 A;  4OEL B;  3M3Y B;  2F0H A;  1K8A C;  1L1O C;  1ET9 A;  1I4Q A;  2FMC A;  4B3R L;  1E7Z A;  1FJG L;  2WAQ B;  4GOP C;  4ZAI A;  2L0C A;  2JA8 G;  3UDI A;  5IYC G;  4N9P A;  2JQO A;  4A4I A;  1Z6H A;  4A3E G;  4NXN L;  1XNQ L;  4DV1 Q;  4F8M A;  1PFM A;  5JJK A;  3ZYY X;  1LUZ A;  1L0X B;  1X65 A;  1I6H B;  3EBE A;  2VQE L;  1D5X C;  1KHI A;  4QUF A;  3N52 A;  4JI0 L;  2WB1 G;  3KBG A;  2WV6 D;  1GVP A;  1STE A;  3HOZ H;  4DPG A;  5KIX A;  3J81 i;  3SK4 A;  4UP7 A;  4B08 A;  4C3I H;  5M5Y H;  3K80 C;  4APV A;  3OTO Q;  3PO3 B;  1JOK A;  4MTK A;  4KHV A;  2KCN A;  1PH7 A;  1CKO A;  1KDA A;  1JE5 A;  1XNR L;  3Q22 A;  3CU7 A;  3IRB A;  3LX0 A;  2X6L A;  1U5K A;  1MSG A;  3RD4 A;  1RCV D;  3TS0 A;  1IBL L;  1PH1 A;  1HZC A;  4ZLT F;  2F4V Q;  1N9W A;  5IGG A;  5JPM C;  4KLK A;  3I4N H;  2MJ8 A;  1QZH A;  3KFU A;  3RLO A;  5C5M A;  4R9W A;  5C4J H;  1GHK A;  1XX8 A;  1S3O A;  1Q1E A;  2AHO B;  2ZXO A;  3PUY A;  2Z6B A;  4XT3 B;  1FJG Q;  4IFD J;  2NVY H;  1H9J A;  1O80 A;  4IAL A;  1XMO L;  5ELC A;  4YWL A;  1VQ5 A;  1LYL A;  2Z1C A;  1PH2 A;  1LTB D;  2CQA A;  1EY0 A;  2F0L A;  1QJO A;  4XQN A;  5JOB A;  4P72 A;  3D4D A;  1L0W A;  2K52 A;  3KLR A;  5EBD A;  3S1R H;  3K7U C;  3NTH A;  1Q8K A;  1SMY C;  3I4M H;  1X55 A;  4KKT A;  1PYS B;  1VQP A;  1HUN A;  1VQ6 A;  4DAY A;  3F2U A;  2E74 C;  2AUK A;  1I94 Q;  1NMG A;  2YTX A;  1HR0 Q;  1WTW A;  4LFA Q;  4BY7 H;  5COY A;  4Y7N H;  3S1Q H;  5IGE A;  1F2M A;  1B70 B;  1M90 C;  4XYO A;  4DF7 A;  4E6I A;  4P75 A;  4JI6 L;  2C5C A;  2EYO A;  2VQF Q;  1YNJ D;  2OTJ A;  4HMJ A;  5HGQ A;  1ASY A;  1H9K A;  1B4O A;  3MXG A;  4JBK A;  4GN3 B;  2CCZ A;  1PRT B;  1PH6 A;  1PXU A;  1NSN S;  3KLS A;  1Q12 A;  1S5E D;  2A19 A;  3A7A B;  2F4V L;  2X69 A;  1IYU A;  2EPB A;  1W6J A;  1L1O B;  3HRZ C;  3R2T A;  2KQ3 A;  2PI2 A;  3URY A;  5GAH C;  1A8V A;  4QMG A;  1EFW A;  1P8L A;  3W2D A;  1CI3 M;  1BUV T;  4R8I A;  1B53 A;  5C44 G;  3F8T A;  1A63 A;  1GM5 A;  4FO2 A;  4UP8 A;  1QVF A;  5C4X B;  1R4P B;  2KEC A;  2F3W A;  2NVT H;  4V19 0;  4QQB X;  4A3C G;  3RMH A;  3BDC A;  2MO0 A;  3T13 A;  4BS9 A;  1VQK A;  1Y1W B;  1DOK A;  4POF A;  3I3C A;  3OW7 A;  1QNK A;  3HOV G;  3KBX A;  4B3M Q;  4ZK9 B;  1WI5 A;  3E0E A;  2KUM A;  3RNU A;  1YNN C;  2CWP A;  5LL6 S;  3K5N A;  4A3F B;  1JB3 A;  1I4X A;  1C48 A;  1J5E Q;  2NTS A;  4HIK A;  1IKM A;  1EQQ A;  3HOX H;  4KY5 A;  1G51 A;  3OHX C;  4HED A;  2BCO A;  3MWY W;  3GTQ H;  2ENB A;  1FNU A;  1YHA A;  1IL2 A;  3QOJ A;  4GKK L;  2B2Y C;  3ERQ A;  4C2M B;  4CJ2 C;  3H0G G;  3CCS A;  3NQT A;  3T56 B;  5KNC A;  4KHP Q;  3HKS A;  3MXN A;  4ODG A;  4IUT A;  3H94 A;  1BCP B;  4WOR A;  4JI3 L;  1SYC A;  4J15 A;  3PO2 B;  1GUT A;  4NXM L;  1I3Q H;  1PH8 A;  3CCV A;  1IYJ B;  1EIY B;  1WTO A;  4R4O A;  1Z47 A;  3IFD A;  3V2T A;  1YVC A;  3KF8 A;  5G3L F;  1SEB D;  1Z7T A;  4JOI C;  2IT1 A;  2PCF B;  5C3X A;  1EY8 A;  4M1U B;  2VUM G;  4OWX B;  2FHT A;  2KJX A;  2R7D A;  4DNT B;  1W6K A;  1E1T A;  5CYU A;  4DK0 A;  3ERO A;  1S5D D;  2OT2 A;  1EYG A;  5I6W A;  2VZA A;  1FYC A;  2H4O A;  3NK9 A;  3L9A X;  2YTV A;  1JQY D;  4QIW E;  3RZD B;  1MJE A;  2IX0 A;  2PQA A;  3M3Y H;  1F9R A;  2K28 A;  1DYQ A;  5BR8 L;  2XIW A;  1LM0 A;  4FXG C;  2JA5 H;  5JPN C;  4DR4 L;  1KTK A;  2B2U C;  5IGD A;  3S17 B;  2K50 A;  2IJ0 A;  1T9H A;  5ELO A;  1HZA A;  1EWH A;  5DLQ E;  3S2D B;  4YY3 Q;  4GLX A;  3K0Y A;  1VQ8 A;  1E2W A;  4NP5 A;  3I4N B;  4FXK C;  5KND A;  4LUV A;  3VYS A;  3PO3 G;  4OON A;  1A3U A;  2A6H D;  4OWW B;  4P2C B;  4RMF A;  1QE6 A;  3JAM L;  4GZY C;  4DK1 A;  3VR3 A;  2QKI C;  2WIN B;  1OO9 B;  4ZCK A;  3DWQ A;  5FO8 B;  2B29 A;  3NBI A;  3U50 C;  5FOB B;  1IHZ A;  5E3F A;  2NBF A;  4C1N K;  1YIJ A;  4OO1 G;  1CHP D;  3GP7 A;  2UXD Q;  5CMD A;  2ZTC A;  1A6X A;  1ENA A;  1PVO A;  1STH A;  3OMC A;  1WD1 A;  4A3L H;  4F7X A;  4IUP A;  4DUY Q;  4KD3 A;  2CKZ B;  3TME A;  4A3D H;  2F0M A;  3A8I E;  1OXT A;  4A3G H;  1S5F D;  4KN7 C;  1X3F A;  4EGV A;  3S1M B;  1MSH A;  3J7A 5;  3A5Z B;  1IZ6 A;  1QNU A;  1CKN B;  4RGO S;  1B7Y B;  2F52 A;  1V8Q A;  2BA1 A;  2CW0 C;  1G6P A;  1Y8N B;  4CKC A;  1IKL A;  1WTP A;  2OQK A;  3RR5 A;  3S9W A;  1KQS A;  4DR6 L;  5DM7 3;  1N36 Q;  4C1N I;  4BBR B;  4A3I B;  1YNJ C;  3PUV A;  3WOF A;  2VY3 A;  4HID A;  3RZD H;  2QCP X;  1EIF A;  3EJI A;  2IHE A;  1QUQ A;  3S14 H;  3GTM H;  1CT1 D;  1SE2 A;  5IT9 c;  3M4P A;  2WB1 E;  4K0K Q;  3BVM A;  4PZ8 A;  5IIF A;  5E1F A;  1PYB A;  1PZK D;  5C5L A;  4JV5 Q;  2JEA I;  4RGT A;  3HOU G;  3TEH B;  1J5E L;  2F0Q A;  4JI6 Q;  3PF5 A;  4L63 B;  4PV1 C;  2YU9 H;  1N34 L;  2WAQ E;  1ZYR C;  1PRT D;  4FXD A;  4KKU A;  3DWP A;  1SNO A;  4NB3 A;  4JOI A;  1SND A;  1EIG A;  2Z4H A;  4WJ4 A;  2B2T C;  5KYL A;  3GV6 A;  1I94 L;  2YYZ A;  1DXM A;  2B2V A;  2EJG C;  3BDO A;  2N8N A;  2UUA L;  1K9M C;  3HOU B;  5E4X A;  1AE3 A;  3D4R A;  1D6E C;  1HNX Q;  4FF4 A;  4JYA Q;  1VQM A;  2Z4I A;  3BZD B;  1PTO D;  4K0K L;  1KC8 C;  2OF1 A;  4A75 A;  4Z9C B;  2PYK A;  4WJ3 M;  5IYD G;  3UDG A;  3GTK B;  5KYI A;  2FFK B;  3O13 A;  1SFO H;  2Q8R E;  4DR6 Q;  1VQA A;  5K36 G;  3QWN A;  3K58 A;  5JVH 3;  3D8G A;  1FNW A;  1L1O A;  4YCU A;  4LFC Q;  2KEE A;  1Y1W G; 
#chains in the Genus database with same CATH homology
 2JXM B;  2F0T A;  3PV0 A;  4ILW A;  5EKI A;  2E2H B;  2IW3 A;  2RKS A;  5IGF A;  4IUR A;  3TBI B;  1HTL D;  3IAY A;  5IGC A;  1TS4 A;  2SNS A;  2A73 B;  4AYB B;  4IUV A;  2CW0 D;  2A68 C;  1HFG A;  2AUJ D;  5CV7 A;  4UDU C;  4KKS A;  5FLX E;  4HR7 B;  4B9W A;  3RLF A;  1G8Z D;  5CR3 A;  4LK1 C;  5DEH A;  4OO1 I;  4XDX A;  1LT4 D;  1SNM A;  2D5D A;  5ELE A;  4J1M A;  3A55 A;  5JAV A;  1LT3 D;  2E75 C;  1PTO C;  5JJZ A;  2F3V A;  3LWE A;  4ME5 A;  3QIA A;  2RSO A;  1ML0 D;  4DNR B;  3GTO B;  2EYJ A;  3I8Z A;  5C0X J;  3CRL C;  1DON A;  1JWU D;  3HZX A;  4G4K A;  3OOC A;  1D2B A;  2M2L A;  4CGY B;  1Q8I A;  1SNQ A;  1RJT A;  5C4H A;  1OXS C;  1PZJ D;  5IT9 L;  1QOH A;  1EOT A;  5D65 A;  5M5Y B;  4A3D B;  1QB5 D;  4X3T A;  5CC4 A;  2JSO A;  4A3J B;  1TII D;  1II3 A;  4K8I A;  1CQV A;  2DNE A;  1E0B A;  3NBH A;  2AWN A;  3L7Z C;  2ID0 A;  2RSN A;  5KGU A;  3S1N B;  1TS2 A;  3N6R A;  1SXT A;  1LTG D;  4PQX A;  2BDN A;  3S14 B;  3HKZ B;  1K8M A;  4ULL A;  1LTS D;  1MBY A;  3FPU B;  3NPP A;  1LTA D;  5IGB A;  5K36 H;  2JA5 B;  3Q0A A;  3GO5 A;  4JK1 C;  2A74 C;  3VR5 A;  1I4R A;  2RDF A;  3A8K E;  4L8J A;  2NUC A;  4H0L C;  2F0S A;  5EKL A;  3MTS A;  3GTJ B;  1DOM A;  3V96 A;  1JCK B;  3E5S A;  3HGB A;  1EEF D;  4S3S A;  2BE5 D;  1EIH A;  2EJM A;  3D31 A;  3TP6 A;  2EJF C;  2R7Z B;  3DM1 A;  1LTR D;  1G29 1;  1LT5 D;  4QB4 A;  5M3F B;  3IL8 A;  2OXP A;  3U9S A;  1PTO B;  1SYG A;  1BBX C;  4KMU C;  1GHJ A;  2F03 A;  4RHR A;  1L0Y B;  1XTC D;  4CBV A;  1D1I A;  3EVQ A;  3MFG A;  4MN3 A;  1T5X D;  4HMI A;  2B39 A;  2FJ2 A;  2HQE A;  1DZ1 A;  5COR A;  4IFD G;  2R93 B;  2EYL A;  2RDH A;  2KOL A;  5M5X B;  3T4A C;  1FNV A;  4ZUJ A;  2EXZ A;  5CV8 A;  3C46 A;  5I9P A;  4PMW A;  3GD7 A;  3CHB D;  5CV5 A;  1DM0 B;  2KHS A;  1PMR A;  4NMZ A;  2B2W A;  1Q90 A;  1DD2 A;  3QOL A;  1R9T B;  5D3I B;  2RVL A;  4DAP A;  5EQ0 A;  1RD9 D;  2ZXP A;  1HA6 A;  4RFB A;  4C3J G;  3MAQ A;  5D14 A;  5EKK A;  1TR5 A;  5E4W C;  1C8C A;  1F2L A;  4C3H G;  5M9O A;  2A5H A;  4RA8 A;  5D3D A;  3BVZ A;  4UAI A;  1BXT A;  3AU7 A;  3GTP B;  3D6W A;  2K33 A;  2R61 A;  1ESF A;  1CA6 A;  1VCI A;  2D9U A;  1EZ6 A;  2B2U A;  2F1M A;  4TQU S;  3MHB A;  3HOW B;  4Q0F A;  1ZEQ X;  5CGK A;  4XXE A;  3DXJ C;  3U9O A;  4OGQ C;  4FNF A;  3A8J E;  2E2D C;  3A54 A;  2IPK D;  3C2P A;  1LTT D;  1HRJ A;  1SYF A;  3H09 A;  1B50 A;  3TZU A;  3OWE B;  1FR3 A;  3J7A F;  3A56 A;  1D5Z C;  4A3G B;  4KHZ A;  3P75 A;  2F0K A;  3A7L A;  1GUW A;  3I72 A;  2EY1 A;  2EYH A;  2D2C C;  1VF5 C;  5FLX L;  1LO5 D;  1TS5 A;  3CQZ B;  3W3A A;  5BN4 A;  3BS1 A;  3WDN A;  1KNE A;  2EZV A;  4J6H A;  2MHV A;  1G2T A;  3J80 L;  1SYE A;  1EYA A;  1SJE D;  3MFY A;  4H13 C;  3IKJ A;  3PUW A;  1AP0 A;  1CZW A;  4DAV A;  1C4Q A;  1U4L A;  2GA4 B;  4EQO A;  1TU2 B;  2EYF A;  3QO2 A;  1EU4 A;  3NWT A;  4NKL A;  3KLS X;  2WII B;  3E0J A;  4BY1 B;  4HN7 A;  2N55 A;  1KDB A;  1A3V A;  2F0F A;  1PZI D;  3X3N A;  2EE1 A;  1FGB D;  1JE4 A;  2K01 A;  4NDX A;  1M4V A;  2KCC A;  4G57 A;  1A3T A;  3DEP A;  1F9P A;  3OSO A;  2SNM A;  3VR4 A;  1STG A;  1RKN A;  5LL6 X;  1RDP D;  4DN4 M;  3J7A V;  4XT1 B;  1BCP C;  3P1H A;  5LHY 1;  5J22 A;  2QEJ C;  2WKC A;  1I3Q B;  1IYV A;  3P7J A;  1TY2 A;  2J0T D;  1A15 A;  3T16 A;  4XIG S;  3HS0 C;  2WAC A;  4K2L A;  2K5Q A;  2JEB I;  3VYU A;  5JEA G;  5A2Q E;  3M7N A;  1D5M C;  3R93 A;  3MEH A;  4H7B A;  4EQN A;  5T1G A;  1EU3 A;  1U4R A;  3SDZ A;  2X6G A;  4X3S A;  1VDZ A;  5FKA C;  3PUX A;  3MA2 B;  4K5X A;  4RGN A;  2XWJ B;  3I4L A;  3NTK A;  1RTN A;  1G6Z A;  1PLF A;  1SAP A;  1GXD C;  4RKL A;  2E76 C;  3KUP A;  1WTX A;  1H9S B;  1U4P A;  4RHS A;  3H91 A;  1OXU A;  3PIP 3;  3DHQ A;  3J80 E;  2K05 A;  4FF3 A;  2BA0 A;  3SR1 A;  2PZW A;  5C6A A;  3P20 A;  2LFN A;  1X3P A;  3IFT A;  3UI2 A;  5EBC A;  2NVY B;  5JEA J;  4FF2 A;  3M7G A;  1HPC A;  3ITP A;  2Q8T A;  5J39 A;  3QB3 A;  1FD7 D;  2R3Z A;  1QWY A;  3K7A B;  1AFP A;  1TWF B;  4CKB A;  1H9R A;  1TWC B;  4KD4 A;  1SNP A;  4JBW A;  2ZT9 C;  1ESR A;  1IW7 C;  2L12 A;  4K5W A;  5BN5 A;  2L55 A;  1STB A;  2F4I A;  1UAP A;  4BY7 B;  1SYB A;  4X3U A;  4G7O C;  4DA2 A;  5CBA E;  2K1B A;  3GTM B;  4I65 A;  4KY7 A;  2JA6 B;  5KRU A;  3HG9 A;  4IN3 A;  4DXG A;  1NR2 A;  4C3H B;  3BG3 A;  2PPB C;  1O7L A;  1S5B D;  5C3W A;  2AWO A;  2A69 D;  3DUZ A;  3BVG A;  3M4O B;  4X3K A;  1I4P A;  3H3V C;  4RCO A;  4IFD H;  1ENF A;  1H9S A;  1EFI D;  1VMC A;  4RH6 A;  1RTO A;  1O78 A;  2NN6 G;  5I2X A;  2NN6 I;  1HHV A;  1JOO A;  4A3M B;  4RGM A;  1HQM C;  1NUC A;  2XN9 C;  2PQE A;  4YIJ A;  2NVQ B;  3C1F A;  2IX1 A;  2A68 D;  2A6H C;  1S4Z A;  3MZ5 A;  1KLG D;  1I50 B;  2FMM A;  1UUP A;  1B9M A;  2XRS D;  3TP7 A;  3NQI A;  4L6T B;  3FVQ A;  3FDT A;  5JVG 3;  3RZO B;  3ND9 A;  4XQJ A;  2L9H A;  2XWB B;  2DY7 A;  3FKI B;  3HOV B;  1ILP A;  2R6G A;  2PW5 A;  3GV3 A;  2H1E A;  1D1K A;  1LAB A;  1AEX A;  1Q3L A;  2ICI A;  1EY9 A;  4OIK A;  3AMU A;  1BQQ T;  1PFN A;  2M9V A;  1EYD A;  2ICE C;  4A3E B;  1VMP A;  5C3E B;  2JP1 A;  1AW7 A;  1U9R A;  3S1R B;  1B2T A;  3OPO A;  3I73 A;  1TKW B;  5A2Q L;  4K5V A;  3D6C A;  4U68 A;  4RCN A;  2CVR A;  3SK6 A;  4QCL A;  2BDO A;  2B2V C;  2WKD A;  2RA4 A;  2RDG A;  1TWG B;  2TMP A;  4OIJ A;  1KLU D;  4H44 C;  1CHQ D;  1BF4 A;  2F0J A;  5IOC A;  3EQL C;  1F2Y A;  1HTP A;  2HCI A;  3TZD A;  1RF2 D;  5I9O A;  1KAA A;  4ZKC B;  3DMU A;  3T53 B;  2QIL A;  2L4N A;  4IQZ A;  1STN A;  2DY8 A;  3VR2 A;  1CZG A;  5EJW A;  2MUY A;  4M8A A;  4HSV A;  4OL7 A;  5CV9 A;  1EL0 A;  1KNA A;  3C1E A;  2R92 B;  5ELF A;  1MGS A;  2I46 A;  3TP8 A;  3S16 B;  4K2K A;  1YNN D;  4KK7 A;  4QIW B;  2HDL A;  2F0P A;  2B8G A;  4HCS A;  3FEW X;  3I90 A;  4XYQ A;  4EQP A;  2BOS A;  2AQ1 B;  4KJO A;  1J9O A;  5EPL A;  1EQT A;  1V1P B;  1BCP D;  2K5D A;  2ZXR A;  3C3L A;  3NE5 B;  4I7Z C;  1CQF A;  3VYT A;  1GJX A;  2EYP A;  4BA1 I;  2LMC B;  5DM6 3;  1I4H A;  2NZ1 D;  3PUZ A;  2B2Y A;  1Y1V B;  2K6A A;  2VB3 X;  3SXH A;  5FO7 B;  2EY2 A;  2F0U A;  4TSS A;  5I2Y A;  1TY0 A;  1WTR A;  1G2S A;  3VYR A;  1V1O A;  4Q5V A;  2TSS A;  2EVB A;  4F88 A;  3OIQ A;  1EQV A;  1HUM A;  1PDQ A;  4KN4 C;  3FMC A;  4WJW A;  4C3J B;  5EGT A;  1DCZ A;  2F0G A;  1JWM D;  4DU9 A;  4TRD A;  5NUC A;  4XTC S;  3HEJ A;  1OXV A;  4KTA A;  2J4X A;  1CFM A;  2NTT A;  1SFO B;  2VB2 X;  1M8A A;  3J81 L;  1SNC A;  3D3R A;  3LWU A;  1ENC A;  1DOL A;  2K7V A;  3ND8 A;  1GUG A;  1GUN A;  4G7H C;  1U4M A;  2HCC A;  3R3O A;  5EPK A;  3K6O A;  2V4D A;  4CJ0 B;  2EYM A;  4C3I B;  4MHE A;  3MVV A;  3TDQ A;  2XRQ D;  2LS0 1;  1CM9 A;  5T1I A;  1ET6 A;  1SBB B;  1PFB A;  3K57 A;  1TWH B;  2MGS A;  1WTV A;  1HA5 A;  4KY6 A;  1PYW D;  4KI0 A;  1F2Z A;  2EDG A;  3Q23 A;  3V05 A;  2J7Z A;  3G7L A;  2SOB A;  3I91 A;  1K8O A;  5CV4 A;  2KED A;  1AZQ A;  3HOX B;  1IW7 D;  1UEA B;  2AQ2 B;  3X3M A;  3AB9 A;  4N9T A;  2PMZ B;  4RWS C;  1JR0 D;  3R2I A;  4HCE A;  1F9S A;  2K5W A;  4DXF A;  5KEE A;  3R8B A;  4A3B B;  1Y8O B;  3GQB A;  5CV6 A;  1PTO H;  2M00 A;  4IZ8 A;  1ZXT A;  3I4M B;  3EA6 A;  2PO4 A;  5J1Z A;  3TN2 A;  2N88 A;  4CHT B;  5I6Y A;  1ZYR D;  2I07 B;  1JOR A;  3K59 A;  2WB1 B;  1G91 A;  2NB0 A;  1B1Z A;  2F0W A;  4WFN 3;  2K03 A;  2XSC A;  1NR4 A;  2DNC A;  2RQX A;  4J8Q A;  3K5L A;  1CTM A;  3SVM A;  4PMC A;  1LAC A;  1Y8P B;  4O42 A;  1EY7 A;  2CHB D;  4KJN A;  4B9X A;  3J7Y W;  3G6J B;  2F0E A;  2B2W C;  1EYC A;  1I4G A;  1ZKO A;  1QIL A;  5FO9 B;  4NW2 A;  3BYT B;  2JE6 I;  4ZKB B;  1EY6 A;  1A2U A;  5I4D A;  2O2L D;  3PMF A;  2F0N A;  5ELD A;  1KDC A;  4FYD A;  2O5J C;  1BR9 A;  2C9O A;  2L5T A;  1STY A;  2A6E C;  2SDF A;  2K32 A;  2JA7 B;  1LLR D;  3BDL A;  3S2H B;  1BCP F;  4RKB A;  4O1N A;  2LKV A;  3NWS A;  4V0B A;  1E2V A;  1H9M A;  3MXP A;  3MXU A;  2D62 A;  3K5M A;  3HOY B;  4IUN A;  1CK1 A;  2VNU D;  2SEB D;  4F87 A;  4CKE A;  1E2Z A;  4FF1 A;  2IL8 A;  2E2I B;  3I70 A;  1KAB A;  3GTQ B;  1J8I A;  1TT2 A;  1EY5 A;  4IUQ A;  4FVM A;  4BWG B;  4DFA A;  1NAP A;  5ISR A;  3TP5 A;  2B8F A;  5F2D A;  3KK7 A;  2PZT A;  3NUC A;  1HCZ A;  4IFD I;  5JEA H;  4LMQ D;  1TWA B;  3GTL B;  4ID6 A;  1XWE A;  4ZUI A;  2O5I C;  5IT9 E;  4C3I G;  1TVX A;  3SK8 A;  1PTO F;  4RAU C;  1Q1B A;  2Z8L A;  4A3K B;  2OEO A;  1MD2 D;  2O4X A;  3DEO A;  1I6V C;  2PW7 A;  1VF7 A;  2QF7 A;  2PNR C;  3H6M A;  5BN3 A;  3J81 E;  2G9D A;  3S15 B;  3M85 A;  4PMB A;  2YU9 B;  2XNA C;  2EY5 A;  1SYD A;  5M3M B;  2DN8 A;  3OIP A;  2KVM A;  3GTG B;  2A6E D;  5HUR A;  1XXG A;  4QF4 A;  3CKI B;  3NXW A;  4C56 C;  2NN6 H;  3CRK C;  1PRT F;  1BDO A;  1B9N A;  5DAU A;  5M5W B;  3NHH A;  1SJH D;  1JC7 A;  1SMY D;  2RBM A;  4A93 B;  2L1B A;  2F0V A;  4HSP A;  3Q24 A;  2LY7 A;  3DWA A;  1BOS A;  1X32 A;  4ZQ3 A;  3NSW A;  3D4W A;  1HQR D;  2EY6 A;  3OMG A;  1Y69 U;  4ZRZ A;  4Y7N B;  2IX3 A;  5CBE E;  2MPM A;  1SSO A;  1GUO A;  1K83 B;  4LJZ C;  5C0X I;  5C0X G;  1V1P A;  1DJR D;  2G9H D;  2F0O A;  3T51 B;  4OO1 H;  1GUS A;  1EZ8 A;  3Q6S A;  4K6L A;  2Y0S B;  1IL8 A;  4FP5 D;  1WCM B;  5DNF A;  3SK5 A;  2QDB A;  3WOE A;  2XVS A;  1EWC A;  1BO0 A;  4R8N A;  2EOT A;  1R4Q B;  3NTI A;  5FK9 C;  1JOQ A;  2WP8 J;  1QG7 A;  3NP8 A;  5C4J B;  1EY4 A;  4LAA A;  1O7Z A;  4MIU A;  5A35 A;  4IUU A;  2F0I A;  2FIN B;  3M4Y A;  2NYZ D;  5C0X H;  2JA8 B;  4TKO B;  1TS3 A;  1SDF A;  4PNY A;  2BE5 C;  2IWH A;  2HDM A;  1F77 A;  1UNS A;  3FPP A;  4OHJ A;  3E6Z X;  1CA5 A;  1ROD A;  1BNZ A;  1WTQ A;  4CJ1 B;  3HP3 A;  5TSS A;  1HFN A;  3L3O C;  1AN8 A;  3MC0 B;  4ABN A;  3K5O A;  5KNB A;  2KA7 A;  1O7Y A;  2F0D A;  1RHP A;  2A69 C;  2PZU A;  2AQ3 B;  4U67 3;  4G7Z C;  4ZYS A;  4BBS B;  3QG1 A;  3S1Q B;  2B2T A;  3SEB A;  1WD0 A;  1SE4 A;  4WRD A;  5EPJ A;  1ILQ A;  1WVL A;  3SE0 A;  5IOD A;  4DGZ A;  2MP1 A;  3LNN A;  4KV6 A;  1XYI A;  3TSS A;  4HTH A;  1ICW A;  3FRP B;  1HXY D;  5AFW A;  4XQQ A;  2L11 A;  1OXX K;  1QCB D;  3RUZ A;  2JYO A;  4K8J A;  1EEI D;  1STA A;  5C44 B;  4HAE A;  5ELB A;  1V43 A;  1X3Q A;  3H0G B;  1T5E A;  3VA5 A;  3EFX D;  2NVT B;  1A2T A;  1LV9 A;  5G3L D;  1B3A A;  1SE3 A;  4BA2 I;  1B44 D;  2Q8I B;  3QJY A;  5HGT A;  1LT6 D;  3JAM E;  2NVX B;  1S5C D;  1NCV A;  3ONA B;  2HUG A;  1ONL A;  1AZP A;  2E2J B;  2VUM B;  4EVO A;  3SHL A;  1JIC A;  1GOZ A;  4QUC A;  3VA7 A;  1F9Q A;  3HOZ B;  3VR6 A;  1LTI D;  1JWS D;  3BYY B;  3OWF A;  1TQO A;  2VXW A;  4K14 A;  5K5P A;  1PRT C;  4K6D A;  1MI2 A;  2B63 B;  5C4Z A;  2NWG A;  3PIO 3;  2K04 A;  3M3Y B;  2F0H A;  1ET9 A;  1I4Q A;  2FMC A;  2WAQ B;  4ZAI A;  2L0C A;  4N9P A;  1Z6H A;  4F8M A;  1PFM A;  3ZYY X;  1L0X B;  1I6H B;  1D5X C;  4QUF A;  3N52 A;  3KBG A;  2WV6 D;  1STE A;  5KIX A;  3SK4 A;  4B08 A;  3PO3 B;  1JOK A;  4KHV A;  2KCN A;  1KDA A;  3Q22 A;  3CU7 A;  3LX0 A;  2X6L A;  1MSG A;  3RD4 A;  1RCV D;  4ZLT F;  5IGG A;  5JPM C;  2MJ8 A;  5C5M A;  4R9W A;  1GHK A;  1XX8 A;  1Q1E A;  2ZXO A;  3PUY A;  4XT3 B;  4IFD J;  1H9J A;  1O80 A;  4IAL A;  5ELC A;  2Z1C A;  1LTB D;  2CQA A;  1EY0 A;  2F0L A;  1QJO A;  4XQN A;  5JOB A;  3D4D A;  3KLR A;  5EBD A;  3NTH A;  1SMY C;  4KKT A;  1HUN A;  4DAY A;  3F2U A;  2E74 C;  2AUK A;  1WTW A;  5COY A;  5IGE A;  1F2M A;  4XYO A;  4DF7 A;  4E6I A;  2C5C A;  2EYO A;  1YNJ D;  4HMJ A;  1H9K A;  1B4O A;  3MXG A;  1PRT B;  1PXU A;  1NSN S;  3KLS A;  1Q12 A;  1S5E D;  3A7A B;  2X69 A;  1IYU A;  2EPB A;  1W6J A;  3HRZ C;  3R2T A;  2KQ3 A;  3URY A;  4QMG A;  3W2D A;  1CI3 M;  1BUV T;  4R8I A;  1B53 A;  4FO2 A;  5C4X B;  1R4P B;  2KEC A;  2F3W A;  4V19 0;  3RMH A;  3BDC A;  3T13 A;  4BS9 A;  1Y1W B;  1DOK A;  3I3C A;  3OW7 A;  1QNK A;  3KBX A;  4ZK9 B;  2KUM A;  1YNN C;  5LL6 S;  3K5N A;  4A3F B;  1JB3 A;  1I4X A;  1C48 A;  2NTS A;  1IKM A;  4KY5 A;  3OHX C;  2BCO A;  3MWY W;  4HED A;  2ENB A;  1FNU A;  3QOJ A;  2B2Y C;  3ERQ A;  4C2M B;  4CJ2 C;  3NQT A;  3T56 B;  5KNC A;  3MXN A;  4ODG A;  4IUT A;  3H94 A;  1BCP B;  4WOR A;  1SYC A;  3PO2 B;  1GUT A;  1WTO A;  1Z47 A;  3IFD A;  3V2T A;  3KF8 A;  5G3L F;  1SEB D;  1Z7T A;  2IT1 A;  2PCF B;  5C3X A;  1EY8 A;  4M1U B;  2FHT A;  2KJX A;  4DNT B;  1W6K A;  5CYU A;  4DK0 A;  3ERO A;  1S5D D;  2OT2 A;  5I6W A;  1FYC A;  2H4O A;  3NK9 A;  3L9A X;  1JQY D;  3RZD B;  2IX0 A;  1F9R A;  2K28 A;  1DYQ A;  2XIW A;  4FXG C;  5JPN C;  1KTK A;  2B2U C;  5IGD A;  3S17 B;  2IJ0 A;  1EWH A;  3S2D B;  3K0Y A;  1E2W A;  4NP5 A;  3I4N B;  4FXK C;  5KND A;  3VYS A;  1A3U A;  2A6H D;  4P2C B;  3JAM L;  1QE6 A;  4GZY C;  4DK1 A;  3VR3 A;  2QKI C;  2WIN B;  1OO9 B;  3DWQ A;  5FO8 B;  3NBI A;  5FOB B;  1IHZ A;  5E3F A;  2NBF A;  4C1N K;  4OO1 G;  1CHP D;  3GP7 A;  5CMD A;  1A6X A;  1ENA A;  1STH A;  3OMC A;  1WD1 A;  4F7X A;  4IUP A;  4KD3 A;  3TME A;  2F0M A;  3A8I E;  1OXT A;  1S5F D;  4KN7 C;  4EGV A;  3S1M B;  1MSH A;  1QNU A;  4RGO S;  1V8Q A;  2BA1 A;  2CW0 C;  1Y8N B;  4CKC A;  1IKL A;  1WTP A;  3S9W A;  5DM7 3;  4C1N I;  4A3I B;  4BBR B;  1YNJ C;  3PUV A;  3WOF A;  2QCP X;  3EJI A;  1CT1 D;  1SE2 A;  3BVM A;  5IIF A;  5E1F A;  1PZK D;  5C5L A;  2JEA I;  4RGT A;  2F0Q A;  4L63 B;  4PV1 C;  1ZYR C;  1PRT D;  4FXD A;  4KKU A;  3DWP A;  1SNO A;  1SND A;  1EIG A;  2Z4H A;  2B2T C;  5KYL A;  3GV6 A;  2YYZ A;  1DXM A;  2B2V A;  2EJG C;  3BDO A;  3HOU B;  5E4X A;  3D4R A;  1D6E C;  4FF4 A;  2Z4I A;  3BZD B;  1PTO D;  2OF1 A;  4Z9C B;  2PYK A;  3GTK B;  5KYI A;  2FFK B;  3O13 A;  2Q8R E;  5K36 G;  3QWN A;  3K58 A;  5JVH 3;  3D8G A;  1FNW A;  2KEE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...