1GHJA

Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from azotobacter vineland ii, nmr, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
79
structure length
79
Chain Sequence
AIDIKAPTFPESIADGTVATWHKKPGEAVKRDELIVDIETDKVVMEVLAEADGVIAEIVKNEGDTVLSGELLGKLTEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acyltransferase
molecule keywords E2, THE DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE COMPONENT OF 2-
publication title Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from Azotobacter vinelandii.
pubmed doi rcsb
source organism Azotobacter vinelandii
total genus 7
structure length 79
sequence length 79
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 1996-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ghjA00
1TU2B 2NN6H 2BA1A 3I4LA 1Q12A 3PV0A 1GUTA 3PUVA 1HQMC 4G7ZC 2A6EC 2PNRC 1B9MA 3VA7A 1Q90A 2KCCA 2A6ED 2EDGA 3VR3A 4OO1H 1BDOA 1ZKOA 3M4YA 2D2CC 2F1MA 2K32A 1QJOA 3SDZA 2QF7A 5KNDA 4KI0A 5K36G 5C0XH 2DN8A 1IW7D 2BE5D 2O5JC 1I6VC 3A7LA 3D31A 4KHZA 2A6HC 4L8JA 3AB9A 3ND8A 2E75C 1O78A 1H9MA 2D5DA 1H9JA 1ONLA 5JEAG 2EJGC 3PUZA 3QIAA 3T53B 1DXMA 3BDOA 1A6XA 1H9SB 1DCZA 3CRKC 3VR2A 2IT1A 1Y69U 1Z6HA 1E2VA 1IYUA 4KN4C 4TKOB 5BN4A 3P20A 3PUYA 1H9SA 2AUKA 2AUJD 3ND9A 4IFDH 1K8MA 1Y8OB 1OXUA 3PUXA 1V8QA 1YNNC 1DD2A 5KNCA 2LMCB 4H13C 3L7ZC 4JBWA 1IW7C 2BE5C 2E76C 1CI3M 2V4DA 4LK1C 1Y8NB 3KLRA 1ZYRC 1GJXA 2EJFC 1Z7TA 1HCZA 2A69C 4G7HC 2B8FA 3A7AB 1PMRA 2A69D 2D62A 1TKWB 4OGQC 2A68D 2JEAI 3FMCA 1GHJA 3IKJA 3N6RA 4IQZA 3TZUA 2KA7A 2R6GA 1GHKA 3T51B 1E2WA 4H0LC 3HGBA 3BG3A 3PUWA 1IYVA 1VF5C 2K7VA 4RCNA 1E2ZA 3T56B 5KNBA 5K36H 3M7NA 3A8IE 4GZYC 4XTCS 1B9NA 1YNJC 2PCFB 3QJYA 3GQBA 3M85A 2YYZA 1GUGA 4DK1A 1O7LA 4KKUA 3VR6A 1OXSC 3RLFA 1T5EA 4KMUC 5JEAH 3OOCA 1Y8PB 2L5TA 2NN6I 1VF7A 5A35A 1H9KA 1VDZA 1LACA 1OXXK 3A8JE 3VR4A 4OO1G 1Q1EA 2DNEA 3NE5B 3OW7A 1V43A 2JEBI 2EVBA 2A68C 1HTPA 1H9RA 2Q8IB 4BA1I 1Q1BA 4BA2I 3FPPA 2JE6I 2CW0C 1CTMA 1EWHA 1GUSA 1OXTA 3GD7A 4PV1C 3IFTA 3LWUA 3I72A 4I7ZC 2EJMA 3A8KE 3VR5A 2O5IC 4DNRB 3OPOA 2JXMB 4DNTB 3D4RA 4KN7C 1OXVA 4G7OC 3W3AA 4KKTA 3MFYA 3MXUA 2B8GA 2AWOA 1GUOA 3EQLC 3DXJC 3U9SA 5BN5A 2PPBC 2NN6G 2K33A 3QG1A 5BN3A 1GUNA 4TQUS 2E74C 1FYCA 3CRLC 4LJZC 4IFDG 1CFMA 2A6HD 2ZT9C 4H44C 1SMYC 3WDNA 4KKSA 3LNNA 4JK1C 1FR3A 2BDOA 3I73A 4HR7B 1HPCA 4XIGS 3SE0A 2BA0A 3H94A 1K8OA 4DK0A 5C0XG 1G291 1VCIA 2DNCA 1LABA
chains in the Genus database with same CATH superfamily
1ILQA 5KIXA 1BCPF 5C0XI 3E0JA 1HA5A 1HQMC 3PO2B 1WCMB 2E2IH 4BBRH 4N9PA 4OO1H 2VZAA 4JI3Q 4OWTB 2FXQA 3IAYA 2WV6D 5IGBA 3LWEA 1I6VC 1SYDA 5IIFA 4DAMA 1H9JA 1KD1C 2JYOA 2K5WA 3FPUB 4NB3A 4MIUA 1EYAA 1L1OB 1BXTA 4GKKQ 2NVTB 2UUAL 1YNJD 2UU9Q 2R92B 1V8QA 4HSVA 4J6HA 4DAYA 4JV5Q 2OCEA 2HQLA 4IZ8A 2GVBA 2BE5C 2E76C 3FVQA 3RZOB 4A3KH 1Z9FA 5M5XH 1VQCA 2GN5A 2K5VA 1GKHA 1ZYRC 1B53A 1GD7A 5IP9G 1EOVA 2LXJA 2V1CC 2Q8TA 3TMEA 4RGTA 3FMCA 3WWVA 1V1OA 3VYUA 1KC8C 2R93B 2CW0D 1TWAH 4DXGA 2PMZB 2AMCB 4UDUC 3M4PA 3S1NB 1MHWC 5DNFA 5GAHC 1X6OA 3HKZE 1Y1VG 3CHBD 5E7NA 2A74C 5E4WC 2I5HA 2Z4HA 2UUCL 2ZTCA 1HR0L 3PIPA 4BY1B 4KV6A 1EQTA 1I4PA 4IJHA 1XJVA 1VQHA 2Y0SG 4DV3L 1YJNA 5IYBG 1TWFB 3OSOA 3NTIA 4MN3A 1JB3A 1EWIA 1PFNA 3BU2A 1I94L 5T1IA 1RDPD 4IUPA 1X54A 2UUAQ 1AEXA 3S14B 1CSPA 3RD4A 3M4OH 3K81C 1RL2A 1PH3A 4M8AA 2WFWA 4GLVB 1XNRL 2ICEC 3ULPA 1LYLA 2RF4A 1FYCA 1LTGD 1WTWA 1AP0A 2F0IA 1BBUA 4IFDI 4TVAB 2B63H 4FF2A 5C4XH 2BA1A 3NQTA 4IUVA 3SXHA 4X3UA 4R1JA 1UEBA 2N8NA 1EU4A 3AYHB 1O7ZA 2EYLA 3H6MA 1HR0Q 2QF7A 4A3EB 4A76A 4KI0A 5I6YA 1WOCA 1CKNA 3CU7A 4DV3Q 3K7UC 4JI8L 3L0OA 3A56A 3I4MG 1A62A 4BBSG 1I3QH 5CV9A 4EQOA 1TWCB 3QWNA 4A3IG 1KIXA 4RHSA 3HOXH 3G48A 2UXCL 4C3IB 1C7YA 1JR0D 1L0YB 1VQKA 4KN4C 4FP5D 2HDLA 3CCQA 3FKIG 1PFSA 1ENCA 1M1KC 1EY4A 1QOHA 1QVCA 2G9HD 2KBNA 4HIKA 1XNRQ 1KL9A 3I90A 1IW7C 5ELFA 1SAPA 5M3FB 1CSQA 1IL8A 4DV5L 1EY0A 3DWPA 2QDLA 3OWEB 1ESFA 3IKJA 1PH2A 5IGGA 1IBML 5E1FA 1KTKA 3R2IA 1VF5C 1F9QA 4LF5L 2I07B 5IY0A 3B6YA 2PCFB 5C5LA 2YYZA 3S16H 1O7LA 1Q86C 1L1OA 2DJGC 3RLFA 3L2PA 3HOVB 4ID6A 4KMUC 1E1OA 3RN2A 5FLMG 1TWGH 1SMYD 1S72A 4LF7Q 3AEVA 2UXCQ 4PV1C 1BNZA 1ICFB 1GUSA 3S17H 4JI7Q 3D4RA 3S24A 5C44H 4FO2A 4EX5A 4N8X1 4LF4L 2BOSA 4QGUA 5I9PA 2MP1A 2F0VA 4CKCA 3K0XA 3K5NA 4A3BG 3UE0A 3WOFA 3ITPA 2PZTA 1JICA 1KAWA 1L0WA 1VQEA 1VQ5A 4O1NA 3A0JA 3SE0A 2Z4IA 4BBRB 1IBMQ 5JJKA 4XQJA 1EY5A 5C0XG 4LF5Q 1NJIC 1QUQA 1Q12A 2FFKB 1QNUA 4HIOA 2NWGA 5I2XA 3VR3A 3I3CA 3E5SA 4DUYL 2JSOA 3CCJA 1EY9A 1S3OA 5DAUA 3EN2A 3K80C 4O42A 1VMPA 5FO8B 4FF1A 2IHEA 5EBCA 4PZ7A 4B9XA 5DM63 1BVSA 1DXMA 5IWAL 5CBEE 1JC7A 4RG1A 2IT1A 4LUVA 4A3KB 1U4LA 4XT1B 2XIWA 2JA9A 3TP8A 2EXDA 4AYBG 3Q24A 4LF4Q 4K8JA 4NXNL 1SNQA 1KRSA 1SR3A 1A63A 4Q0FA 4I65A 1C4QA 1TWAB 1RF2D 4QIWB 1CA5A 1NAPA 1ML0D 2A69C 1YNXA 2A68D 4OXPA 3J81j 1X3PA 4DPGA 4IQZA 1K3RA 3T51B 3CP0A 1IYVA 2CWPA 2F0JA 4KHVA 3T56B 1PH7A 1Q8IA 2VQEL 2K5QA 3OWFA 4PMBA 5IT9L 4DUYQ 3J7ZC 1VQJA 5IP9H 4AH6A 1L1OC 1BCPC 3Q0AA 1XMQQ 3HOWH 3CQZH 1Y8PB 4KJNA 3GTLB 4HTHA 3Q8DA 2K6AA 2F0GA 3M4OB 2R3ZA 1DOLA 2Q8IB 5IWAQ 5FK9C 5F2DA 2DY7A 1B7YB 3FPPA 4RKBA 3E9HA 3UDFA 4K6LA 4NXNQ 2I5LX 3DUZA 3BS1A 1J6QA 2F0QA 3MXUA 1TS2A 2EY6A 4K5WA 2F4IA 2X6GA 2XWJB 4LAAA 2WAQG 3CCRA 2B63B 1HZCA 5C4XB 4B9WA 1GVPA 2H4OA 3VYSA 3A5ZB 3D4WA 3DM1A 3H09A 1LO5D 4IFDG 3RMHA 2EXZA 1X32A 3V96A 3AFQA 4WRDA 5G3LD 1VCIA 1TY0A 3KFUA 2NUCA 5AFWA 2F0TA 4DKAC 1ENFA 2VQEQ 2N3SA 4DV2Q 4AQYL 4K6DA 1BDOA 3EFXD 4WJ3M 2D2CC 4ZKCB 1BOSA 5KNDA 3HOXB 1B1ZA 3NBHB 2BE5D 4KHZA 1HNWL 1ZYRD 1Y1WH 1B44D 2NVQH 3H3VC 1PRTF 3SHLA 3GV6A 4ME5A 4BS9A 3L3OC 3KF8A 3PIP3 1SYFA 4JI5L 3W2DA 1LLRD 2XNAC 4NXML 2HHHL 3HKSA 4BBSH 3NWSA 1OXUA 1N33Q 1AFPA 4YWMA 1HUNA 3H15A 2LMCB 2XRQD 3U9OA 2IX3A 4A3IH 2KCMA 2TMPA 1GJXA 1Z7TA 1I4HA 1EY6A 1KDCA 4UP7A 1FNVA 3HKZG 4BY7G 2ICIA 3CC2A 3S16B 2R6GA 1EFID 1KQSA 3ONAB 3HFZB 1EWCA 4JI2Q 3K8AA 4GNXB 5LMNL 1TWGB 3GTPH 1MD2D 1FGBD 3KYHC 1ET9A 4M1UB 2WB1B 1WD1A 1XYIA 3UDIA 1YIJA 1PA6A 2JA8G 3S1QH 2VB3X 2ZXOA 2SDFA 1KNAA 3DEOA 2CH4A 3S17B 3OTOL 3A8JE 3BDCA 5C44B 1XTCD 3P7JA 4A3MH 2Z9HA 1S5FD 4YIJA 3HOZH 3CMAA 3I72A 2R7ZG 4ODGA 1UWVA 4NXMQ 5EKIA 3EIVA 3TEHB 2QEXA 2F03A 2HHHQ 3U4VA 1KABA 4HIDA 2EY2A 2NN6G 4A93H 4A4IA 1LTRD 2L9HA 4IO9A 3D3RA 4GLAC 4B3SL 5FJ8H 1OO9B 1U4RA 4K14A 2CWAA 1AE3A 1NBWA 1JJGA 4X3TA 4X64L 4HSPA 5LMNQ 3PV0A 1GUTA 4DR6L 4RGMA 4MTNA 4X6AH 4OWWB 5KGUA 4P71A 1HNZL 3T4AC 1VQ4A 3SDZA 5CMDA 2BH8A 4CKBA 5C0XH 4NPSA 5ELNA 1IW7D 1XX8A 2OQ0A 3J7AF 2YTXA 4X66L 1VQLA 4WFN3 3AB9A 3ND8A 5LL6X 2TSSA 5GROA 1MI2A 2L4NA 1V9PA 2QKIC 4CKEA 1JWSD 2F0UA 5JEAG 2R7DA 4OWXB 2CKZB 2XWBB 2PMZE 4DAYB 1UEAB 1B70B 4L5RC 3DEPA 4K5VA 2EYHA 4HMIA 3PSIA 3UDXA 2LS01 4DAVA 1HXYD 2N78A 3KF6A 4OEMB 4YCUA 3MXGA 4ZQ3A 1IL2A 2EYPA 1LT5D 2EJFC 4IPDA 2F0DA 4X65L 4G7HC 2Z6BA 1WTQA 3A7AB 2KCTA 2K5DA 2K75A 4R4OA 3FP9A 4XT3B 1ET6A 2RHSB 4DR6Q 2PO4A 3SGIA 1E24A 3HOWB 3CQZB 2CCZA 2XTIA 3S1MH 4RHRA 1HNZQ 1VQ8A 3KLSX 2JA6B 3PO3G 2VQFQ 1C0AA 1MBYA 1PYSB 2K50A 4HN7A 1X3GA 2PZWA 4X66Q 4J8QA 2YV5A 3A5UA 1SEBD 1JT8A 3CF5A 1IYJB 2N49A 1PVOA 3K5MA 3NE5B 4A3DG 4ZAIA 3K57A 4QCLA 3QOJA 1IKMA 5C3EG 3VR5A 3OPOA 2VUMH 3NBIA 5LHY1 2VL6A 4R4CA 1A2TA 2YTVA 2X6LA 3CD6A 2B2YA 4NDXA 5BN3A 1XTDA 4FYDA 4LJZC 1QVGA 5M3MH 3Q23A 3J80L 2RCFA 2WKDA 2D9UA 4RGOS 4QUCA 1DM0B 1E22A 4OL7A 2XRSD 4ZCKA 1G291 1EEID 2KOLA 1EU3A 5J1ZA 3G7LA 1XPRA 1FNWA 3CCLA 2WP8J 4MNOA 5ELBA 2JA5G 1S5CD 2DUDA 1PH1A 3I4NB 5IYDG 1Y1WB 1CKNB 4AIMA 3M4YA 3KBGA 2BCOA 1EFWA 5JAVA 5IE8A 2K03A 3GTMH 4IFDJ 4L5SA 1O78A 3ER0A 3VYRA 3LX0A 1EY8A 3O13A 4ZLTF 3H0GH 4LWCA 3GTOH 1EL0A 1HFNA 3VR2A 4A3IB 1ASZA 2FJ2A 1IYUA 2Q2HA 3GTKH 4IOCA 2C5CA 1Y8OB 1O80A 1CKOA 4DR4L 3ICEA 1CK1A 1YNNC 2K14A 3L9AX 1BCPD 4UP8A 4LFAL 1QWYA 1VQFA 4C3HH 1W2BA 1A8VA 1QZGA 2WIIB 2M00A 4LNQA 1SNCA 3GTPB 3C1EA 3W1GA 1U4MA 1I50H 2RHQB 4ULLA 4XYQA 3URYA 4DV4L 1ICWA 3S1QB 3NWTA 2ZJQA 4F88A 5KNBA 2JP1A 2UXDL 4OELB 1BCPB 2H1EA 4LF6L 1SDFA 3M85A 2AQ3B 4A3MB 2ES2A 1HRJA 3ULLA 2KVMA 2NZ1D 4JPBW 4DN4M 3HOZB 3H3VI 2OEOA 3I91A 4BXXG 1B4OA 3I7FA 4V0BA 4KLKA 1JOOA 4GN3B 5FO9B 2ZM6Q 1K83H 4IPGA 2EZVA 1B3AA 5C3WA 3J81L 4A93B 1WTRA 1JE5A 3BVZA 1KLUD 3IFTA 4Y7NB 1HR0W 2JA8H 2UXBL 4J15A 1F2MA 1WD0A 3E3XA 2KUMA 4DR4Q 1PRTC 2PQAA 1Q82C 1I4XA 1YEZA 3MXPA 1EQRA 4LMQD 2WKCA 5DEHA 3CCMA 4C56C 2VB2X 4GNXC 2B2YC 5JJZA 1CHPD 4KKSA 4R9WA 4DV4Q 1QUQB 5EGTA 1VQPA 1STAA 2Z8LA 2NN6H 2NYZD 1O7IA 4LUZA 4JI1L 3F2UA 2UXDQ 3CPFA 2HIXA 5D14A 3HOYG 2RVLA 1SNOA 1LT4D 3UI2A 4B3ML 3IFDA 1Q90A 4EGVA 3HOUH 5JJIA 2A6ED 2KEDA 2KCNA 1K0SA 2PI2E 4JBKA 1QNKA 5KYIA 2E75C 3D6WA 2GVAA 3KJPA 4LF8L 1P8LA 1S40A 2PZUA 1CZGA 2JK8A 3P1HA 3PQIA 1STYA 2CQAA 1LTID 1CT1D 2UUCQ 1EYGA 4TRDA 4KTAA 1Q7YC 3PUXA 2NVYH 5A2QE 1ESRA 5ISRA 3M3YH 1HZ9A 3L7ZC 1YI2A 2G9DA 1Y8NB 3S1MB 1Q46A 3MXNA 5IYCH 4OGQC 1KNEA 5IT9E 5JEAJ 3TZUA 1JWMD 4DV7L 4JI1Q 2RCNA 3DHQA 4RA8A 1M90C 3ERSX 1I94Q 2Q2IA 3HGBA 1J8IA 4B3MQ 1RHPA 2K4KA 5C4JH 2IPKD 3FHWA 1SE3A 2NTTA 4P75A 3HP3A 4IUTA 3CCVA 1EOTA 1F9PA 5L37A 3S2DB 2L5TA 2RQXA 3GTQH 4LF8Q 2VUMB 5DM73 1CZWA 3GTGB 2DNEA 1X3QA 4GOPA 1SN8A 1I6HB 3GO5A 4OO1I 2KHSA 1D5MC 3WOEA 3G71A 1CQFA 2L55A 1E7ZA 4DNRB 1WCMG 2O5IC 3PO2G 5M3MB 5C5MA 3CC4A 2XN9C 1I4QA 1GUOA 3RZDB 4O2DA 4A3CG 1G91A 3X3MA 5HGTA 5CYUA 4JI8Q 4LF9L 5C3EH 4QUFA 5IGEA 1RODA 2SNMA 4A3JB 3TRZA 1D5XC 3LNNA 4GLXA 2JA7H 4DV7Q 4HR7B 2BA0A 1A2UA 3H94A 4YHHL 4CDEC 4LUOA 1EZ6A 4PZ6A 2R92G 5K5PA 4G7ZC 3VA7A 3MWYW 1EUJA 1N36L 1ZKOA 3BYTB 3H0GB 1F77A 2IY5B 3GTOB 5K36G 2KHJA 5JPMC 1TXYA 4DV5Q 2I46A 5GAGC 3KF8B 4P72A 1H9MA 3R2TA 4A3LG 5I6WA 2E2IB 2F0WA 1HQRD 1UE7A 2MQHA 4HEDA 3BDOA 1X9NA 5I2YA 5LL6S 4C3JH 2UUBL 1E2VA 3TREA 4U673 4C3HB 1VQOA 3T1HL 3QO2A 4BY1G 5EBDA 2G5DA 3HRZC 1I50B 5E4XA 1CM9A 1UAPA 3E0EA 4LF9Q 3SK8A 1F9RA 3GP7A 2SOBA 2B39A 2V4DA 1F2ZA 2WB1E 1JWUD 4FVMA 1N9WA 4YHHQ 4DR5L 1PMRA 3K5LA 1K8AC 2F52A 1PTOF 1KLGD 1PDQA 3BG3A 4G57A 4QF4A 1EYDA 1JMCA 2BDNA 4RCNA 4HJ5A 3GTJH 5M5XB 1GOZA 1I4GA 1DGSA 1QG7A 1TS4A 4MZ9A 4X3KA 2AWNA 2LXKA 1TR5A 3QB3A 1K83B 2ID0A 4ME3A 2MGSA 5EJWA 5I9OA 1OXSC 1IKLA 4JI6L 3D4DA 1OXXK 1VQMA 3J80i 4GOPC 2HD3A 5A2QL 4K0KL 2UUBQ 2JN4A 1JB7A 1C8CA 3A55A 3FDTA 3NQIA 3T1HQ 4OHJA 2JJQA 4KN7C 4BXXH 4A3EG 4Q5VA 4ALPA 4R8IA 5BN5A 3DXJC 3U9SA 3D6CA 2Z6KA 4PMCA 2DJFC 2OQKA 3JAMi 2VW9A 3KBXA 2BH2A 2OF1A 4DA2A 2F0NA 3S2HH 3HOUB 4CDCC 4K5XA 4C3IG 4DK0A 1Y1VH 1II3A 1VQNA 4UP9A 1G6ZA 1VMCA 1EIGA 3SR1A 1IBKL 5FOBB 3PUVA 2K05A 1SYGA 1PXUA 4PMWA 4KK7A 4QMGA 5IYBH 4QY7A 1YNND 1VQDA 4JI6Q 3SEBA 5IT9c 5M3FG 2AHOB 1D2BA 1X55A 2A6HC 1ASYA 4WORA 3NUCA 2E2JH 3CKIB 1G51A 3HOYH 4K0KQ 1ONLA 5EQ0A 2VNUD 1F2YA 2A73B 1LTLA 3PUZA 2NVYB 5CR3A 3M3YB 1EZ8A 1SE8A 2RSOA 2A19A 2LSSA 4KY5A 4NMZA 1NCVA 5GQOA 1FGUA 1U5KA 2B2UA 2P5ZX 1I3QB 3KF6B 3HOVG 3I4OA 2HCCA 4BWGB 4LFCL 3NSWA 4QQBX 3OIPA 1YHAA 3KLRA 5C4JB 1UE6A 3K7AH 5KYLA 2HUGA 1IBKQ 2YTYA 2F0LA 1NMGA 1JJ2A 1YHBA 3J81i 3GTQB 3NHHA 4RMFA 1B9NA 1E3PA 1IHZA 1PRTD 2KENA 3I4MH 2B2TA 5ELDA 5D65A 1KDBA 2VS1A 3E9IA 1W6KA 4NKLA 2DY8A 1VDZA 3SK5A 4BBRG 4KHPL 4OO1G 1HZBA 1FJGL 1FVIA 3FKIH 3I8ZA 5LMNW 3RLOA 2EIFA 5CV7A 3TP6A 2E2DC 1PRTB 4X62L 4GKJL 3LWUA 2DGYA 1K0RA 2F3IA 3NK9A 1QE6A 3TQYA 4AQYQ 1J5EL 4DK3C 3J80E 1I5FA 1OXVA 2JA7B 4LFCQ 1TS3A 1E0BA 1RCVD 1SYBA 2AWOA 4RGNA 2Z6KC 3VA5A 3K6OA 3A54A 3K58A 2M2LA 1WVLA 1HNWQ 1D1IA 1EEFD 1D6EC 4UPAA 1SYCA 3NTHA 4K2KA 4XIGS 2J4XA 4A3KG 3SK6A 2D5DA 4K8IA 3JAME 4HIMA 4C1NI 4JI5Q 2QDBA 4R4TA 1XMOL 3G6JB 1ENAA 5FLMH 1S4ZA 2F1MA 1C48A 3BZCA 3QOLA 4IOAA 4KHPQ 1Q81C 3A7LA 1BBXC 4C3JB 1Y14B 1VQ9A 2PW5A 1FJGQ 1YZ6A 1MJEA 5CV4A 4DUZL 1SBBB 2Z0SA 4OX9L 1VQ7A 5KRUA 4X62Q 4GKJQ 4ZUJA 5AJ3L 4GS3A 5J22A 2LFNA 4G4KA 3UE1A 1XXGA 3PUYA 1H9SA 1X65A 4L63B 2ZJPA 3ND9A 4A3BH 2SEBD 2B2UC 4RWSC 1NUCA 4A3LH 1HFGA 4XYOA 1BQQT 4A75A 3OTOQ 1G2SA 3GTJB 1PYBA 4IN3A 3FEWX 4XQQA 4BY1H 1XMOQ 2NZOA 4FNFA 3PUWA 4S3SA 2F3VA 4B3RL 1CUKA 3NENA 3CCEA 1PHJA 2B63G 1QZHA 3U4ZA 5C4XG 2K04A 3F8TA 4TSSA 1NNXA 2XGTA 3QJYA 1WTPA 1A0IA 4RAUC 3J81E 1LTTD 1SJED 4DK6C 1CQVA 1VF7A 1LACA 4B3SQ 5C4ZA 2K1BA 4OX9Q 4PG3A 1H9RA 2J7ZA 5AJ3Q 2IX0A 4LW1A 4NP5A 3M7GA 1EYCA 4YWLA 4X64Q 2PQAB 3F2CA 4QJFA 1VQGA 2ZTEA 1WTXA 2F0MA 1S5BD 3S2HB 2A8VA 1EY7A 3HOXG 3F2BA 5FLXL 1Y1VB 3TSSA 1BKBA 1LUZA 1R4QB 4DFAA 2C9OA 1NMFA 4HJ9A 5KEEA 1TWHH 1V1PB 3J7A5 1MSHA 1ZXTA 4UY8C 2Y0SB 4IALA 4N9TA 1PH4A 2L15A 3J7YW 4QB4A 4DR3L 1JJCB 3P20A 1V1QA 3TN2A 1YJWA 1O7YA 1K28A 5CV5A 3MAQA 1PV4A 1NR2A 1SE4A 2E2JB 2PW7A 1XPOA 2OTLA 3VYTA 5BR8L 1PTOC 4IUUA 1PH8A 4XDXA 1BBWA 3RR5A 5FLXc 2O5JC 1KXLA 4X65Q 2LKVA 1MIUA 2EYOA 1SMXA 2F0SA 1DYQA 4JG2A 1VQAA 1IBLL 4P74A 4A3FG 2EJGC 2RDGA 2O4XA 1A6XA 3MZ5A 1STEA 1HHVA 3F1ZA 5CBAE 2QA4A 3U58A 1AE2A 2E2HH 2B29A 1RTOA 4IFDH 2WB1G 2MJ8A 2NVQB 3JAML 5JVH3 4KD3A 4JI3L 1HNXL 3P75A 3MXNB 4CJ0B 3G6EA 2CHBD 1SNMA 5J3BA 4EVOA 3HG9A 5C44G 3T13A 1UE1A 1JE4A 2A69D 3J80c 3I4MB 3PMFA 4BBSB 4OONA 3N6RA 2EPBA 1XNQL 1HZAA 1PFBA 1LT3D 4JW0A 2CFMA 4GKKL 2EY5A 2EQSA 2J0TD 3FRPB 3FKIB 4JYAL 3CMEA 4IUNA 3CCUA 4Z9CB 4EQPA 4JV5L 1PYWD 3JAMc 4JBJA 2F0HA 4GOPB 2QILA 4NW2A 1QVFA 4BA2I 2C35B 1OXTA 3VDYA 3TZDA 3MEFA 2EJMA 4JBMA 4F8MA 4A3GG 1WTVA 1CKMA 1N8RC 3PCOB 5EAYA 3W3AA 4KKTA 1HNXQ 1HTLD 2B8GA 4Y52H 2KEEA 1JCKB 3MA2B 1MSGA 3QG1A 5ELCA 1GUNA 1SXTA 4R4QA 4TQUS 4BY7H 2A6HD 3PIOA 3D8GA 3DWAA 2XSCA 1PZID 1FR3A 2E5LL 1K8OA 1XNQQ 1YBYA 4KJOA 3I4LA 3BVGA 1LM0A 3EROA 4JYAQ 1BO0A 2KQ3A 2EDGA 2QGQA 2JQOA 1E1TA 1PFMA 2NB0A 4LFAQ 2DN8A 4RKLA 3D31A 1PTOH 4WJWA 1MGSA 4L8JA 4F7XA 2R7ZH 2N55A 4A3BB 4DV1L 3HOWG 3C2PA 1EIFA 2I5MX 3MFGA 3IL8A 1V1PA 1YVCA 3NPPA 5EKKA 4PNYA 3DLLA 2JA6G 2L12A 1Z6HA 1JQYD 3J81c 4TKOB 1SRUA 5HY6A 2AUKA 4LF6Q 4FXGC 1STNA 2IW3A 1DD2A 1W3SA 4JBWA 1RKNA 3C1FA 5GADC 1TVXA 3BDLA 4DAPA 3NP8A 2E5LQ 1YITA 3HZXA 1HJPA 2D62A 4QIWE 3K0YA 2JEAI 3OHXC 1A15A 3Q22A 2F0FA 2MUYA 5DLQE 2F0EA 3GTLH 1BF4A 3AQQA 2UXBQ 3S9WA 5C4HA 1L2FA 1VQBA 2L11A 2E8GA 1B2TA 1G8ZD 4AYBB 3AFPA 2RDHA 3BJUA 3KDFA 4DNIA 3KLWA 1RD9D 5JEAH 1JOQA 1SNPA 1EQVA 4JI4L 1SJHD 4ZKBB 4DV1Q 3TS2A 4HCEA 1LTBD 2EVBA 1GM5A 4L5QA 3EVQA 4C1NK 4B3TL 1D1KA 1A3UA 2EYJA 1F9SA 3EJIA 2XVSA 4ZUIA 4F87A 3I4NG 5C3XA 1Y1WG 3OYYA 2YU9H 3LGJA 2OTJA 2AKWB 1TWHB 1DOMA 2D0PA 1BUVT 2I0QA 2PPBC 4P73A 4YY3L 3D0FA 3PF5A 2ZTDA 3K5OA 1GXDC 1Z47A 5CGKA 4HJAA 3OIQA 1P16A 4JK1C 2RKSA 1PZKD 3V05A 5JPNC 1R9TH 3PO3H 4LF7L 1LABA 1RIPA 2H5XA 2QEJC 3KJOA 1AZPA 1X3EA 1VS0A 4JI7L 4L5TA 2PNRC 1B9MA 4E6IA 1S5ED 3S1RH 2MPMA 2R7FA 4A3DH 4JI4Q 2E2HB 4J1MA 2WAQB 4CDFC 3BZKA 2ASBA 1R4PB 4B3TQ 1K73C 5C6AA 3AMUA 3C3LA 4JOIA 4HJ8A 4DU9A 3CRKC 3EBEA 4PQXA 1RTNA 5ELEA 3GTMB 2CVRA 5IP7G 3TDQA 4A3MG 3R3OA 2Q2TA 3T16A 4YY3Q 3HOZG 1K8MA 3CC7A 1LV9A 1KRTA 4XQNA 1AN8A 4A3FH 3STBC 4FDBA 1TT2A 4RFBA 1PH6A 1JOKA 3HS0C 1HCZA 2NTSA 2B8FA 2L1BA 4ZRZA 1H95A 3GTKB 4A93G 1SROA 1TKWB 2JA5H 3C46A 2R93G 2PNHA 2ZXPA 5IYDH 2CQOA 2KA7A 1E2WA 4UAIA 1X56A 5E3FA 3GV3A 3MHBA 5FJ8G 4L6TB 4ZYSA 1TY2A 4HAEA 3A8IE 3S15H 4GZYC 1YJ9A 2ALYB 1U0LA 4DV0L 3KK7A 3BZDB 2ZXRA 2Z1CA 2F4VL 2CH4W 2B2VA 2NN6I 1H9KA 2NVXH 1X3FA 4WJ4A 3DWQA 1SSOA 2RDFA 2JEBI 1T9HA 4H02A 4BA1I 2X69A 1EWHA 3GD7A 3VR4A 4BY7B 3HKZB 3A8KE 4POFA 5IGDA 3W5OA 1N36Q 1KAAA 2D0OA 2Q2UA 3PF4A 1PTOD 3TBIB 2K33A 4EQNA 1SNDA 2LY7A 3CRLC 1XMQL 1OTCA 1CFMA 2AQ1B 2JA8B 3WDNA 4A3GH 2AQ2B 3G4SA 2BDOA 1GUWA 1HPCA 4PZ8A 4FF4A 2B2WA 2Q8RE 1STGA 2DNCA 2F0OA 5IGFA 3NTKA 1N34L 3GDEA 1PTOB 1MJCA 1T5XD 2MHVA 1VQIA 2MO1A 2R7ZB 1WJJA 2OT2A 4DV0Q 1MKHA 1SFOH 2F4VQ 3W1BA 1JORA 4DV6L 1RJTA 1VQ6A 1HA6A 1EQQA 4DR5Q 3ULJA 4B08A 5M5YH 3DMUA 3QIAA 1H9SB 1DCZA 4IPCA 4JOIC 5FO7B 1A3VA 2F0KA 1K3BC 2EOTA 2A1AA 2RSNA 4YCWA 4DF7A 4H7BA 4DV2L 1J9OA 4JI0L 1PZJD 3NXWA 3CCSA 2N88A 2IX1A 1KDAA 4H13C 2HDMA 4HCSA 2VUMG 2L0CA 2JA6H 1C9OA 1TIID 1FD7D 1STBA 2EYFA 4U68A 4FXDA 2IJ0A 1N34Q 5M3MG 4H0LC 4CJ1B 2FMMA 4C2MH 2EYMA 3HEJA 2K7VA 1E2ZA 3PIO3 3N52A 1LT6D 1YNJC 3M9BA 2FHTA 2O2LD 4DV6Q 5EPKA 3VR6A 3KUPA 5G3LF 5M5WH 2VY3A 3M4QA 1EIYB 1N33L 4A3JG 4ZK9B 2YU9B 2B2VC 2IWHA 4ABNA 4APVA 5M9OA 3CW2C 1Q3LA 2K28A 1STHA 4EQ5A 2Y0SE 5FLXE 2CW0C 4I7ZC 1K9MC 2HCIA 4JI0Q 4JI2L 1U4PA 2K52A 3H0GG 4G7OC 1NE3A 3MFYA 3J7AV 1R9TB 1UNSA 2KHIA 3PO3B 3ERQA 5D3DA 2PYKA 3ZJYC 2WINB 4KD4A 4HJ7A 3R8BA 3U50C 4CDDC 3I4NH 4YCVA 5CV8A 5JOBA 1BR9A 3OMGA 4ILWA 1Q8KA 3S1RB 5TSSA 2B2WC 5CORA 4A3DB 4C3HG 1CHQD 4KY6A 2GA4B 4DR1L 3R93A 5D3IB 4DR2L 5C3EB 2A6EC 3DM3A 4CHTB 2KCCA 5CC4A 2A5HA 3RLNA 3K59A 1G6PA 1QJOA 5GAEC 2RBMA 4OIJA 4N8FA 3PO2H 2QW7A 1WCMH 4IJLA 4CBVA 5LMUL 3RN5A 1AH9A 3T53B 4MHEA 4GN4B 5T1GA 4A3FB 4I7AA 4A3CH 1DONA 2NZHA 2JA5B 1LTAD 1D8LA 1I4RA 5EPLA 1N32L 1M8AA 3NELA 1D7QA 1CI3M 4LK1C 5J39A 2PI2A 1UUPA 3S15B 1B3QA 2NVTH 1IXRA 4DGZA 1XWEA 5IP7H 2R92H 1KHIA 2FMCA 1YHQA 1AW7A 1GHJA 4R4IA 4P2CB 2QCPX 4YWKA 1GHKA 1SLJA 4DR1Q 1NSNS 3X3NA 1XPUA 3RZOH 1EIHA 1NTGA 4DR2Q 1J5EQ 5JVG3 2NVXB 5K36H 1AZQA 3M7NA 1DJRD 4FXKC 5EKLA 3QR8A 5COYA 3GQBA 1GUGA 4KKUA 2R93H 1GO3E 3TP5A 4Y7NH 1T5EA 3S1NH 3OOCA 3TP7A 1L0XB 5A35A 3HOUG 3SVMA 1B8AA 4K2LA 1Q1EA 5EPJA 5LMUQ 4JVZA 3T1YL 2JE6I 3EA6A 1CTMA 4POGA 2SNSA 4R8NA 4DXFA 1U9RA 5CV6A 3ZYYX 1UE5A 4A3GB 2IHFA 1TWFH 1SE2A 1QILA 3CXCA 4IURA 4RCOA 4O0AA 1N32Q 2VQFL 1TS5A 3EQLC 1B50A 3BVMA 4JC0A 2B2TC 2IL8A 1WI5A 2VXWA 1K8GA 1M4VA 1ZEQX 4H44C 3E6ZX 1SMYC 3A74A 4JCVE 4DUZQ 3S14H 4FF3A 3I73A 5C0XJ 1SFOB 3H3VH 1TU2B 1S5DD 2EY1A 5IYCG 1G2TA 3IRBA 5ELOA 5M5YB 3H91A 2PQEA 4DR7L 2K32A 2FINB 3STBD 5IOCA 1HH2P 1NY4A 2MO0A 3NBHA 4QL5A 3T1YQ 1WTHA 2HIVA 4A3EH 4B3RQ 4CJ2C 1Y69U 2K5NA 5HURA 5BN4A 3CPWA 3I56A 2AUJD 2RA4A 1WFQA 1PH5A 3CAMA 3RNUA 4LFBL 5JJLA 1DOKA 2KECA 3HOYB 2F0PA 1TWCH 4AYBE 2OXPA 4OIKA 5KNCA 4IPHA 3PGZA 4C3IH 2MNAA 1PH9A 2B3GA 4C2MB 4UHVA 2F3WA 1WTOA 5H1SE 3SK4A 1CA6A 2M9VA 2ATWA 2HQEA 3KOJA 3MTSA 5IGCA 3S2DH 5NUCA 5I4DA 1TQOA 4XXEA 5M5WB 2MFIA 3Q6SA 4V190 3KDFB 2JA7G 5M3FH 3TS0A 3GTGH 4MTKA 5HGQA 4DR7Q 4XTCS 1I6HH 2NBFA 1LTSD 1FNUA 4HMJA 1ILPA 4GNXA 4DK1A 3K7AB 2OWOA 4GN5A 3MC0B 3OW7A 3I70A 1V43A 3OMCA 2EE1A 2A68C 1HTPA 3MVVA 1D5ZC 4DR3Q 3I2ZA 3UDGA 3RZDH 1Q1BA 2WACA 1DZ1A 3HOVH 3BYYB 1NR4A 2ENBA 3V2TA 3KLSA 1W6JA 2JXMB 4DNTB 5IODA 3OW2A 4A3JH 3MEHA 4IUQA 4LFBQ 3RUZA 5BR8Q 2HT1A 1A3TA 2K01A 2ZJRA 4C3JG 2UU9L 1QB5D 4X3SA 1QCBD 2E74C 3I55A 1HUMA 2R61A 1IZ6A 1PLFA 1WYDA 2WAQE 1SYEA 2ZT9C 3NEMA 5FKAC 3JC66 3F2DA 1IBLQ 4CGYB 2K5HA 1F2LA 3AU7A 4RH6A 2ZM6L 1FL0A 2KJXA 4KY7A
chains in the Genus database with same CATH topology
1ILQA 5KIXA 1BCPF 5C0XI 3E0JA 1HA5A 1HQMC 3PO2B 1WCMB 4N9PA 4OO1H 3IAYA 2WV6D 5IGBA 3LWEA 1I6VC 1SYDA 5IIFA 1H9JA 2JYOA 2K5WA 3FPUB 4MIUA 1EYAA 1BXTA 2NVTB 1YNJD 2R92B 1V8QA 4HSVA 4J6HA 4DAYA 4IZ8A 3FVQA 2BE5C 2E76C 3RZOB 1ZYRC 1B53A 2Q8TA 3TMEA 4RGTA 3FMCA 1V1OA 3VYUA 2R93B 2CW0D 4DXGA 2PMZB 4UDUC 3S1NB 5DNFA 3CHBD 2A74C 5E4WC 2Z4HA 4BY1B 4KV6A 1EQTA 1I4PA 1TWFB 3OSOA 3NTIA 4MN3A 1JB3A 1PFNA 5T1IA 1RDPD 4IUPA 1AEXA 3S14B 3RD4A 4M8AA 2ICEC 1FYCA 1LTGD 1WTWA 1AP0A 2F0IA 4IFDI 4FF2A 2BA1A 3NQTA 4IUVA 3SXHA 4X3UA 1EU4A 1O7ZA 2EYLA 3H6MA 2QF7A 4A3EB 4KI0A 5I6YA 3CU7A 3A56A 5CV9A 4EQOA 1TWCB 3QWNA 4RHSA 4C3IB 1JR0D 1L0YB 4KN4C 4FP5D 2HDLA 1ENCA 1EY4A 1QOHA 2G9HD 3I90A 1IW7C 5ELFA 1SAPA 5M3FB 1IL8A 1EY0A 3DWPA 3OWEB 1ESFA 3IKJA 5IGGA 5E1FA 1KTKA 3R2IA 1VF5C 1F9QA 2I07B 2PCFB 5C5LA 2YYZA 1O7LA 3RLFA 3HOVB 4ID6A 4KMUC 1SMYD 4PV1C 1BNZA 1GUSA 3D4RA 4FO2A 2BOSA 5I9PA 2MP1A 2F0VA 4CKCA 3K5NA 3WOFA 3ITPA 2PZTA 1JICA 4O1NA 4BBRB 3SE0A 2Z4IA 4XQJA 1EY5A 5C0XG 1Q12A 2FFKB 1QNUA 2NWGA 5I2XA 3VR3A 3I3CA 3E5SA 2JSOA 1EY9A 5DAUA 4O42A 1VMPA 5FO8B 4FF1A 5EBCA 4B9XA 5DM63 1DXMA 5CBEE 1JC7A 2IT1A 4A3KB 1U4LA 4XT1B 2XIWA 3TP8A 3Q24A 4K8JA 1SNQA 4Q0FA 4I65A 1C4QA 1TWAB 1RF2D 4QIWB 1CA5A 1NAPA 1ML0D 2A69C 2A68D 1X3PA 4IQZA 3T51B 1IYVA 2F0JA 4KHVA 3T56B 1Q8IA 2K5QA 3OWFA 4PMBA 5IT9L 1BCPC 3Q0AA 1Y8PB 4KJNA 3GTLB 4HTHA 2K6AA 2F0GA 3M4OB 2R3ZA 1DOLA 2Q8IB 5FK9C 5F2DA 2DY7A 3FPPA 4RKBA 4K6LA 3DUZA 3BS1A 2F0QA 3MXUA 4K5WA 1TS2A 2EY6A 2F4IA 2X6GA 2XWJB 4LAAA 2B63B 5C4XB 4B9WA 2H4OA 3VYSA 3D4WA 3DM1A 3H09A 1LO5D 4IFDG 3RMHA 2EXZA 1X32A 3V96A 4WRDA 5G3LD 1VCIA 1TY0A 2NUCA 5AFWA 2F0TA 1ENFA 4K6DA 1BDOA 3EFXD 2D2CC 4ZKCB 1BOSA 5KNDA 3HOXB 1B1ZA 2BE5D 4KHZA 1ZYRD 1B44D 3H3VC 1PRTF 3SHLA 3GV6A 4ME5A 4BS9A 3L3OC 3KF8A 3PIP3 1SYFA 3W2DA 1LLRD 2XNAC 3NWSA 1OXUA 1AFPA 1HUNA 2LMCB 2XRQD 3U9OA 2IX3A 2TMPA 1GJXA 1Z7TA 1I4HA 1EY6A 1KDCA 1FNVA 2ICIA 3S16B 2R6GA 1EFID 3ONAB 1EWCA 1TWGB 1MD2D 1FGBD 1ET9A 4M1UB 2WB1B 1WD1A 1XYIA 2VB3X 2ZXOA 2SDFA 1KNAA 3DEOA 3S17B 3A8JE 3BDCA 5C44B 1XTCD 3P7JA 1S5FD 4YIJA 3I72A 4ODGA 5EKIA 2F03A 1KABA 2EY2A 2NN6G 1LTRD 2L9HA 3D3RA 1OO9B 1U4RA 4K14A 4X3TA 4HSPA 3PV0A 1GUTA 4RGMA 5KGUA 3T4AC 3SDZA 5CMDA 4CKBA 5C0XH 1IW7D 1XX8A 3J7AF 4WFN3 3AB9A 3ND8A 5LL6X 2TSSA 1MI2A 2L4NA 2QKIC 4CKEA 1JWSD 2F0UA 5JEAG 2XWBB 1UEAB 3DEPA 4K5VA 2EYHA 4HMIA 2LS01 4DAVA 1HXYD 3MXGA 4ZQ3A 2EYPA 1LT5D 2EJFC 2F0DA 1WTQA 4G7HC 3A7AB 2K5DA 4XT3B 1ET6A 2PO4A 3HOWB 3CQZB 4RHRA 3KLSX 2JA6B 1MBYA 4HN7A 2PZWA 4J8QA 1SEBD 3K5MA 3NE5B 4ZAIA 3K57A 4QCLA 3QOJA 1IKMA 3VR5A 3OPOA 3NBIA 5LHY1 1A2TA 2X6LA 2B2YA 4NDXA 5BN3A 4FYDA 4LJZC 3Q23A 3J80L 2WKDA 2D9UA 4RGOS 4QUCA 1DM0B 4OL7A 2XRSD 1G291 1EEID 2KOLA 1EU3A 5J1ZA 3G7LA 1FNWA 2WP8J 5ELBA 1S5CD 3I4NB 1Y1WB 3M4YA 3KBGA 2BCOA 5JAVA 2K03A 4IFDJ 1O78A 3VYRA 3LX0A 1EY8A 3O13A 4ZLTF 1EL0A 1HFNA 3VR2A 4A3IB 2FJ2A 1IYUA 2C5CA 1Y8OB 1O80A 1CK1A 1YNNC 3L9AX 1BCPD 1QWYA 2WIIB 2M00A 1SNCA 3GTPB 3C1EA 1U4MA 4ULLA 4XYQA 3URYA 1ICWA 3S1QB 3NWTA 4F88A 5KNBA 2JP1A 1BCPB 2H1EA 1SDFA 3M85A 2AQ3B 4A3MB 1HRJA 3HOZB 2KVMA 2NZ1D 4DN4M 2OEOA 3I91A 1B4OA 4V0BA 1JOOA 5FO9B 2EZVA 1B3AA 5C3WA 3J81L 4A93B 1WTRA 3BVZA 1KLUD 3IFTA 4Y7NB 1F2MA 1WD0A 2KUMA 1PRTC 1I4XA 3MXPA 4LMQD 5DEHA 2WKCA 4C56C 2VB2X 2B2YC 5JJZA 1CHPD 4KKSA 4R9WA 5EGTA 1STAA 2Z8LA 2NN6H 2NYZD 3F2UA 5D14A 2RVLA 1SNOA 1LT4D 3UI2A 3IFDA 1Q90A 4EGVA 2A6ED 2KEDA 2KCNA 1QNKA 5KYIA 2E75C 3D6WA 2PZUA 1CZGA 3P1HA 1STYA 2CQAA 1LTID 1CT1D 4TRDA 4KTAA 3PUXA 5A2QE 1ESRA 5ISRA 3L7ZC 2G9DA 1Y8NB 3S1MB 3MXNA 4OGQC 1KNEA 5IT9E 3TZUA 5JEAJ 1JWMD 3DHQA 4RA8A 1J8IA 3HGBA 1RHPA 2IPKD 1SE3A 2NTTA 3HP3A 4IUTA 1EOTA 1F9PA 3S2DB 2L5TA 2RQXA 2VUMB 5DM73 1CZWA 3GTGB 2DNEA 1X3QA 1I6HB 3GO5A 4OO1I 2KHSA 1D5MC 3WOEA 1CQFA 2L55A 2O5IC 4DNRB 5M3MB 5C5MA 2XN9C 1I4QA 1GUOA 3RZDB 1G91A 3X3MA 5HGTA 5CYUA 4QUFA 5IGEA 1RODA 2SNMA 4A3JB 1D5XC 3LNNA 4HR7B 2BA0A 1A2UA 3H94A 1EZ6A 5K5PA 4G7ZC 3VA7A 3MWYW 1ZKOA 3BYTB 3H0GB 1F77A 3GTOB 5K36G 5JPMC 2I46A 1H9MA 3R2TA 5I6WA 2E2IB 2F0WA 1HQRD 4HEDA 3BDOA 5I2YA 5LL6S 1E2VA 4U673 4C3HB 3QO2A 5EBDA 3HRZC 1I50B 5E4XA 1CM9A 1UAPA 3SK8A 1F9RA 3GP7A 2SOBA 2B39A 2V4DA 1F2ZA 1JWUD 4FVMA 1PMRA 3K5LA 1PTOF 1KLGD 1PDQA 3BG3A 4G57A 4QF4A 1EYDA 2BDNA 4RCNA 5M5XB 1GOZA 1I4GA 1QG7A 1TS4A 4X3KA 2AWNA 1TR5A 3QB3A 1K83B 2ID0A 2MGSA 5EJWA 5I9OA 1OXSC 1IKLA 3D4DA 1OXXK 5A2QL 1C8CA 3A55A 3FDTA 3NQIA 4OHJA 4KN7C 4Q5VA 4R8IA 5BN5A 3DXJC 3U9SA 3D6CA 4PMCA 3KBXA 2OF1A 4DA2A 2F0NA 3HOUB 4K5XA 4C3IG 4DK0A 1II3A 1G6ZA 1VMCA 1EIGA 3SR1A 5FOBB 3PUVA 2K05A 1SYGA 1PXUA 4PMWA 4KK7A 4QMGA 1YNND 3SEBA 1D2BA 2A6HC 4WORA 3NUCA 3CKIB 1ONLA 5EQ0A 2VNUD 1F2YA 2A73B 3PUZA 2NVYB 5CR3A 3M3YB 1EZ8A 2RSOA 4KY5A 4NMZA 1NCVA 2B2UA 1I3QB 2HCCA 4BWGB 3NSWA 3OIPA 3KLRA 5C4JB 5KYLA 2HUGA 2F0LA 3GTQB 3NHHA 1B9NA 1IHZA 1PRTD 2B2TA 5ELDA 5D65A 1KDBA 1W6KA 4NKLA 2DY8A 1VDZA 3SK5A 4OO1G 3I8ZA 5CV7A 3TP6A 2E2DC 1PRTB 3LWUA 3NK9A 1QE6A 3J80E 1OXVA 2JA7B 1TS3A 1E0BA 1RCVD 1SYBA 2AWOA 4RGNA 3VA5A 3K6OA 3A54A 3K58A 2M2LA 1WVLA 1D1IA 1EEFD 1D6EC 1SYCA 3NTHA 4K2KA 4XIGS 2J4XA 3SK6A 2D5DA 4K8IA 3JAME 4C1NI 2QDBA 3G6JB 1ENAA 1S4ZA 2F1MA 1C48A 3QOLA 3A7LA 1BBXC 4C3JB 2PW5A 5CV4A 1SBBB 5KRUA 4ZUJA 5J22A 2LFNA 4G4KA 1XXGA 3PUYA 1H9SA 4L63B 3ND9A 2SEBD 2B2UC 4RWSC 1NUCA 1HFGA 4XYOA 1BQQT 1G2SA 3GTJB 4IN3A 3FEWX 4XQQA 4FNFA 3PUWA 4S3SA 2F3VA 2K04A 4TSSA 1WTPA 3QJYA 4RAUC 3J81E 1LTTD 1SJED 1CQVA 1VF7A 1LACA 5C4ZA 2K1BA 1H9RA 2J7ZA 2IX0A 4NP5A 3M7GA 1EYCA 1WTXA 2F0MA 1S5BD 3S2HB 1EY7A 5FLXL 1Y1VB 3TSSA 1R4QB 4DFAA 2C9OA 5KEEA 1V1PB 1MSHA 1ZXTA 2Y0SB 4IALA 4N9TA 3J7YW 4QB4A 3P20A 3TN2A 1O7YA 5CV5A 3MAQA 1NR2A 1SE4A 2E2JB 2PW7A 3VYTA 1PTOC 4IUUA 4XDXA 2O5JC 2LKVA 2EYOA 2F0SA 1DYQA 2EJGC 2RDGA 2O4XA 1A6XA 3MZ5A 1STEA 1HHVA 5CBAE 1RTOA 4IFDH 2MJ8A 2NVQB 3JAML 5JVH3 4KD3A 3P75A 4CJ0B 2CHBD 1SNMA 4EVOA 3HG9A 3T13A 1JE4A 2A69D 3I4MB 3PMFA 4BBSB 3N6RA 2EPBA 1PFBA 1LT3D 2EY5A 2J0TD 3FRPB 3FKIB 4IUNA 4Z9CB 4EQPA 1PYWD 2F0HA 2QILA 4NW2A 4BA2I 1OXTA 3TZDA 2EJMA 4F8MA 1WTVA 3W3AA 4KKTA 1HTLD 2B8GA 2KEEA 1JCKB 3MA2B 1MSGA 3QG1A 5ELCA 1GUNA 1SXTA 4TQUS 2A6HD 3D8GA 3DWAA 2XSCA 1PZID 1FR3A 1K8OA 4KJOA 3I4LA 3BVGA 3EROA 1BO0A 2KQ3A 2EDGA 1PFMA 2NB0A 2DN8A 4RKLA 3D31A 1PTOH 4WJWA 1MGSA 4L8JA 4F7XA 2N55A 4A3BB 3C2PA 3MFGA 3IL8A 1V1PA 3NPPA 5EKKA 4PNYA 2L12A 1Z6HA 1JQYD 4TKOB 2AUKA 4FXGC 1STNA 2IW3A 1DD2A 4JBWA 1RKNA 3C1FA 1TVXA 3BDLA 4DAPA 3NP8A 3HZXA 2D62A 3K0YA 2JEAI 3OHXC 1A15A 3Q22A 2F0FA 2MUYA 2F0EA 1BF4A 3S9WA 5C4HA 2L11A 1B2TA 1G8ZD 4AYBB 2RDHA 1RD9D 5JEAH 1JOQA 1SNPA 1EQVA 1SJHD 4ZKBB 4HCEA 1LTBD 2EVBA 4C1NK 3EVQA 1D1KA 1A3UA 2EYJA 1F9SA 3EJIA 2XVSA 4ZUIA 4F87A 5C3XA 1TWHB 1DOMA 1BUVT 2PPBC 3K5OA 1GXDC 1Z47A 5CGKA 3OIQA 4JK1C 2RKSA 1PZKD 3V05A 5JPNC 1LABA 2QEJC 1AZPA 2PNRC 1B9MA 4E6IA 1S5ED 2MPMA 2E2HB 4J1MA 2WAQB 1R4PB 5C6AA 3AMUA 3C3LA 4DU9A 3CRKC 4PQXA 1RTNA 5ELEA 3GTMB 2CVRA 3TDQA 3R3OA 3T16A 1K8MA 1LV9A 4XQNA 1AN8A 1TT2A 4RFBA 1JOKA 3HS0C 1HCZA 2NTSA 2B8FA 2L1BA 4ZRZA 3GTKB 1TKWB 3C46A 2ZXPA 2KA7A 1E2WA 4UAIA 5E3FA 3GV3A 3MHBA 4L6TB 4ZYSA 1TY2A 4HAEA 3A8IE 4GZYC 3KK7A 3BZDB 2ZXRA 2Z1CA 2B2VA 2NN6I 1H9KA 3DWQA 1SSOA 2RDFA 2JEBI 4BA1I 2X69A 1EWHA 3GD7A 3VR4A 4BY7B 3HKZB 3A8KE 5IGDA 1KAAA 1PTOD 3TBIB 2K33A 4EQNA 1SNDA 2LY7A 3CRLC 1CFMA 2AQ1B 2JA8B 3WDNA 2AQ2B 2BDOA 1GUWA 1HPCA 4FF4A 2B2WA 2Q8RE 1STGA 2DNCA 2F0OA 5IGFA 3NTKA 1PTOB 1T5XD 2MHVA 2R7ZB 2OT2A 1JORA 1RJTA 1HA6A 4B08A 3DMUA 3QIAA 1H9SB 1DCZA 5FO7B 1A3VA 2F0KA 2EOTA 2RSNA 4DF7A 4H7BA 1J9OA 1PZJD 3NXWA 2N88A 2IX1A 1KDAA 4H13C 2HDMA 4HCSA 2L0CA 1TIID 1FD7D 1STBA 2EYFA 4U68A 4FXDA 2IJ0A 4H0LC 4CJ1B 2FMMA 2EYMA 3HEJA 2K7VA 1E2ZA 3PIO3 3N52A 1LT6D 1YNJC 2FHTA 2O2LD 5EPKA 3VR6A 3KUPA 5G3LF 4ZK9B 2YU9B 2B2VC 2IWHA 4ABNA 5M9OA 1Q3LA 2K28A 1STHA 5FLXE 2CW0C 4I7ZC 2HCIA 1U4PA 4G7OC 3MFYA 3J7AV 1R9TB 1UNSA 3PO3B 3ERQA 5D3DA 2PYKA 2WINB 4KD4A 3R8BA 5CV8A 5JOBA 1BR9A 3OMGA 4ILWA 3S1RB 5TSSA 2B2WC 5CORA 4A3DB 4C3HG 1CHQD 4KY6A 2GA4B 3R93A 5D3IB 5C3EB 2A6EC 4CHTB 2KCCA 5CC4A 2A5HA 3K59A 1QJOA 2RBMA 4OIJA 4CBVA 3T53B 4MHEA 5T1GA 4A3FB 1DONA 2JA5B 1LTAD 1I4RA 5EPLA 1M8AA 1CI3M 4LK1C 5J39A 1UUPA 3S15B 4DGZA 1XWEA 2FMCA 1AW7A 1GHJA 4P2CB 2QCPX 1GHKA 1NSNS 3X3NA 1EIHA 5JVG3 2NVXB 5K36H 1AZQA 3M7NA 1DJRD 4FXKC 5EKLA 5COYA 3GQBA 1GUGA 4KKUA 3TP5A 1T5EA 3OOCA 3TP7A 1L0XB 5A35A 3SVMA 4K2LA 1Q1EA 5EPJA 2JE6I 3EA6A 1CTMA 2SNSA 4R8NA 4DXFA 1U9RA 5CV6A 3ZYYX 4A3GB 1SE2A 1QILA 4IURA 4RCOA 1TS5A 3EQLC 1B50A 3BVMA 2B2TC 2IL8A 2VXWA 1M4VA 1ZEQX 4H44C 3E6ZX 1SMYC 4FF3A 3I73A 5C0XJ 1SFOB 1TU2B 1S5DD 2EY1A 1G2TA 5M5YB 3H91A 2PQEA 2K32A 2FINB 5IOCA 3NBHA 4CJ2C 1Y69U 5HURA 5BN4A 2AUJD 2RA4A 1DOKA 2KECA 3HOYB 2F0PA 2OXPA 4OIKA 5KNCA 4C2MB 2F3WA 1WTOA 3SK4A 1CA6A 2M9VA 2HQEA 3MTSA 5IGCA 5NUCA 5I4DA 1TQOA 4XXEA 5M5WB 3Q6SA 4V190 4XTCS 2NBFA 1LTSD 1FNUA 4HMJA 1ILPA 4DK1A 3K7AB 3MC0B 3OW7A 3I70A 1V43A 3OMCA 2EE1A 2A68C 1HTPA 3MVVA 1D5ZC 1Q1BA 2WACA 1DZ1A 3BYYB 1NR4A 2ENBA 3V2TA 3KLSA 1W6JA 2JXMB 4DNTB 5IODA 3MEHA 4IUQA 3RUZA 1A3TA 2K01A 4C3JG 1QB5D 4X3SA 1QCBD 2E74C 1HUMA 2R61A 2ZT9C 1PLFA 1SYEA 5FKAC 4CGYB 1F2LA 3AU7A 4RH6A 2KJXA 4KY7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TU2 B;  2NN6 H;  2BA1 A;  3I4L A;  1Q12 A;  3PV0 A;  1GUT A;  3PUV A;  1HQM C;  4G7Z C;  2A6E C;  2PNR C;  1B9M A;  3VA7 A;  1Q90 A;  2KCC A;  2A6E D;  2EDG A;  3VR3 A;  4OO1 H;  1BDO A;  1ZKO A;  3M4Y A;  2D2C C;  2F1M A;  2K32 A;  1QJO A;  3SDZ A;  2QF7 A;  5KND A;  4KI0 A;  5K36 G;  5C0X H;  2DN8 A;  1IW7 D;  2BE5 D;  2O5J C;  1I6V C;  3A7L A;  3D31 A;  4KHZ A;  2A6H C;  4L8J A;  3AB9 A;  3ND8 A;  2E75 C;  1O78 A;  1H9M A;  2D5D A;  1H9J A;  1ONL A;  5JEA G;  2EJG C;  3PUZ A;  3QIA A;  3T53 B;  1DXM A;  3BDO A;  1A6X A;  1H9S B;  1DCZ A;  3CRK C;  3VR2 A;  2IT1 A;  1Y69 U;  1Z6H A;  1E2V A;  1IYU A;  4KN4 C;  4TKO B;  5BN4 A;  3P20 A;  3PUY A;  1H9S A;  2AUK A;  2AUJ D;  3ND9 A;  4IFD H;  1K8M A;  1Y8O B;  1OXU A;  3PUX A;  1V8Q A;  1YNN C;  1DD2 A;  5KNC A;  2LMC B;  4H13 C;  3L7Z C;  4JBW A;  1IW7 C;  2BE5 C;  2E76 C;  1CI3 M;  2V4D A;  4LK1 C;  1Y8N B;  3KLR A;  1ZYR C;  1GJX A;  2EJF C;  1Z7T A;  1HCZ A;  2A69 C;  4G7H C;  2B8F A;  3A7A B;  1PMR A;  2A69 D;  2D62 A;  1TKW B;  4OGQ C;  2A68 D;  2JEA I;  3FMC A;  1GHJ A;  3IKJ A;  3N6R A;  4IQZ A;  3TZU A;  2KA7 A;  2R6G A;  1GHK A;  3T51 B;  1E2W A;  4H0L C;  3HGB A;  3BG3 A;  3PUW A;  1IYV A;  1VF5 C;  2K7V A;  4RCN A;  1E2Z A;  3T56 B;  5KNB A;  5K36 H;  3M7N A;  3A8I E;  4GZY C;  4XTC S;  1B9N A;  1YNJ C;  2PCF B;  3QJY A;  3GQB A;  3M85 A;  2YYZ A;  1GUG A;  4DK1 A;  1O7L A;  4KKU A;  3VR6 A;  1OXS C;  3RLF A;  1T5E A;  4KMU C;  5JEA H;  3OOC A;  1Y8P B;  2L5T A;  2NN6 I;  1VF7 A;  5A35 A;  1H9K A;  1VDZ A;  1LAC A;  1OXX K;  3A8J E;  3VR4 A;  4OO1 G;  1Q1E A;  2DNE A;  3NE5 B;  3OW7 A;  1V43 A;  2JEB I;  2EVB A;  2A68 C;  1HTP A;  1H9R A;  2Q8I B;  4BA1 I;  1Q1B A;  4BA2 I;  3FPP A;  2JE6 I;  2CW0 C;  1CTM A;  1EWH A;  1GUS A;  1OXT A;  3GD7 A;  4PV1 C;  3IFT A;  3LWU A;  3I72 A;  4I7Z C;  2EJM A;  3A8K E;  3VR5 A;  2O5I C;  4DNR B;  3OPO A;  2JXM B;  4DNT B;  3D4R A;  4KN7 C;  1OXV A;  4G7O C;  3W3A A;  4KKT A;  3MFY A;  3MXU A;  2B8G A;  2AWO A;  1GUO A;  3EQL C;  3DXJ C;  3U9S A;  5BN5 A;  2PPB C;  2NN6 G;  2K33 A;  3QG1 A;  5BN3 A;  1GUN A;  4TQU S;  2E74 C;  1FYC A;  3CRL C;  4LJZ C;  4IFD G;  1CFM A;  2A6H D;  2ZT9 C;  4H44 C;  1SMY C;  3WDN A;  4KKS A;  3LNN A;  4JK1 C;  1FR3 A;  2BDO A;  3I73 A;  4HR7 B;  1HPC A;  4XIG S;  3SE0 A;  2BA0 A;  3H94 A;  1K8O A;  4DK0 A;  5C0X G;  1G29 1;  1VCI A;  2DNC A;  1LAB A; 
#chains in the Genus database with same CATH topology
 1ILQ A;  5KIX A;  1BCP F;  5C0X I;  3E0J A;  1HA5 A;  1HQM C;  3PO2 B;  1WCM B;  2E2I H;  4BBR H;  4N9P A;  4OO1 H;  2VZA A;  4JI3 Q;  4OWT B;  2FXQ A;  3IAY A;  2WV6 D;  5IGB A;  3LWE A;  1I6V C;  1SYD A;  5IIF A;  4DAM A;  1H9J A;  1KD1 C;  2JYO A;  2K5W A;  3FPU B;  4NB3 A;  4MIU A;  1EYA A;  1L1O B;  1BXT A;  4GKK Q;  2NVT B;  2UUA L;  1YNJ D;  2UU9 Q;  2R92 B;  1V8Q A;  4HSV A;  4J6H A;  4DAY A;  4JV5 Q;  2OCE A;  2HQL A;  4IZ8 A;  2GVB A;  2BE5 C;  2E76 C;  3FVQ A;  3RZO B;  4A3K H;  1Z9F A;  5M5X H;  1VQC A;  2GN5 A;  2K5V A;  1GKH A;  1ZYR C;  1B53 A;  1GD7 A;  5IP9 G;  1EOV A;  2LXJ A;  2V1C C;  2Q8T A;  3TME A;  4RGT A;  3FMC A;  3WWV A;  1V1O A;  3VYU A;  1KC8 C;  2R93 B;  2CW0 D;  1TWA H;  4DXG A;  2PMZ B;  2AMC B;  4UDU C;  3M4P A;  3S1N B;  1MHW C;  5DNF A;  5GAH C;  1X6O A;  3HKZ E;  1Y1V G;  3CHB D;  5E7N A;  2A74 C;  5E4W C;  2I5H A;  2Z4H A;  2UUC L;  2ZTC A;  1HR0 L;  3PIP A;  4BY1 B;  4KV6 A;  1EQT A;  1I4P A;  4IJH A;  1XJV A;  1VQH A;  2Y0S G;  4DV3 L;  1YJN A;  5IYB G;  1TWF B;  3OSO A;  3NTI A;  4MN3 A;  1JB3 A;  1EWI A;  1PFN A;  3BU2 A;  1I94 L;  5T1I A;  1RDP D;  4IUP A;  1X54 A;  2UUA Q;  1AEX A;  3S14 B;  1CSP A;  3RD4 A;  3M4O H;  3K81 C;  1RL2 A;  1PH3 A;  4M8A A;  2WFW A;  4GLV B;  1XNR L;  2ICE C;  3ULP A;  1LYL A;  2RF4 A;  1FYC A;  1LTG D;  1WTW A;  1AP0 A;  2F0I A;  1BBU A;  4IFD I;  4TVA B;  2B63 H;  4FF2 A;  5C4X H;  2BA1 A;  3NQT A;  4IUV A;  3SXH A;  4X3U A;  4R1J A;  1UEB A;  2N8N A;  1EU4 A;  3AYH B;  1O7Z A;  2EYL A;  3H6M A;  1HR0 Q;  2QF7 A;  4A3E B;  4A76 A;  4KI0 A;  5I6Y A;  1WOC A;  1CKN A;  3CU7 A;  4DV3 Q;  3K7U C;  4JI8 L;  3L0O A;  3A56 A;  3I4M G;  1A62 A;  4BBS G;  1I3Q H;  5CV9 A;  4EQO A;  1TWC B;  3QWN A;  4A3I G;  1KIX A;  4RHS A;  3HOX H;  3G48 A;  2UXC L;  4C3I B;  1C7Y A;  1JR0 D;  1L0Y B;  1VQK A;  4KN4 C;  4FP5 D;  2HDL A;  3CCQ A;  3FKI G;  1PFS A;  1ENC A;  1M1K C;  1EY4 A;  1QOH A;  1QVC A;  2G9H D;  2KBN A;  4HIK A;  1XNR Q;  1KL9 A;  3I90 A;  1IW7 C;  5ELF A;  1SAP A;  5M3F B;  1CSQ A;  1IL8 A;  4DV5 L;  1EY0 A;  3DWP A;  2QDL A;  3OWE B;  1ESF A;  3IKJ A;  1PH2 A;  5IGG A;  1IBM L;  5E1F A;  1KTK A;  3R2I A;  1VF5 C;  1F9Q A;  4LF5 L;  2I07 B;  5IY0 A;  3B6Y A;  2PCF B;  5C5L A;  2YYZ A;  3S16 H;  1O7L A;  1Q86 C;  1L1O A;  2DJG C;  3RLF A;  3L2P A;  3HOV B;  4ID6 A;  4KMU C;  1E1O A;  3RN2 A;  5FLM G;  1TWG H;  1SMY D;  1S72 A;  4LF7 Q;  3AEV A;  2UXC Q;  4PV1 C;  1BNZ A;  1ICF B;  1GUS A;  3S17 H;  4JI7 Q;  3D4R A;  3S24 A;  5C44 H;  4FO2 A;  4EX5 A;  4N8X 1;  4LF4 L;  2BOS A;  4QGU A;  5I9P A;  2MP1 A;  2F0V A;  4CKC A;  3K0X A;  3K5N A;  4A3B G;  3UE0 A;  3WOF A;  3ITP A;  2PZT A;  1JIC A;  1KAW A;  1L0W A;  1VQE A;  1VQ5 A;  4O1N A;  3A0J A;  3SE0 A;  2Z4I A;  4BBR B;  1IBM Q;  5JJK A;  4XQJ A;  1EY5 A;  5C0X G;  4LF5 Q;  1NJI C;  1QUQ A;  1Q12 A;  2FFK B;  1QNU A;  4HIO A;  2NWG A;  5I2X A;  3VR3 A;  3I3C A;  3E5S A;  4DUY L;  2JSO A;  3CCJ A;  1EY9 A;  1S3O A;  5DAU A;  3EN2 A;  3K80 C;  4O42 A;  1VMP A;  5FO8 B;  4FF1 A;  2IHE A;  5EBC A;  4PZ7 A;  4B9X A;  5DM6 3;  1BVS A;  1DXM A;  5IWA L;  5CBE E;  1JC7 A;  4RG1 A;  2IT1 A;  4LUV A;  4A3K B;  1U4L A;  4XT1 B;  2XIW A;  2JA9 A;  3TP8 A;  2EXD A;  4AYB G;  3Q24 A;  4LF4 Q;  4K8J A;  4NXN L;  1SNQ A;  1KRS A;  1SR3 A;  1A63 A;  4Q0F A;  4I65 A;  1C4Q A;  1TWA B;  1RF2 D;  4QIW B;  1CA5 A;  1NAP A;  1ML0 D;  2A69 C;  1YNX A;  2A68 D;  4OXP A;  3J81 j;  1X3P A;  4DPG A;  4IQZ A;  1K3R A;  3T51 B;  3CP0 A;  1IYV A;  2CWP A;  2F0J A;  4KHV A;  3T56 B;  1PH7 A;  1Q8I A;  2VQE L;  2K5Q A;  3OWF A;  4PMB A;  5IT9 L;  4DUY Q;  3J7Z C;  1VQJ A;  5IP9 H;  4AH6 A;  1L1O C;  1BCP C;  3Q0A A;  1XMQ Q;  3HOW H;  3CQZ H;  1Y8P B;  4KJN A;  3GTL B;  4HTH A;  3Q8D A;  2K6A A;  2F0G A;  3M4O B;  2R3Z A;  1DOL A;  2Q8I B;  5IWA Q;  5FK9 C;  5F2D A;  2DY7 A;  1B7Y B;  3FPP A;  4RKB A;  3E9H A;  3UDF A;  4K6L A;  4NXN Q;  2I5L X;  3DUZ A;  3BS1 A;  1J6Q A;  2F0Q A;  3MXU A;  1TS2 A;  2EY6 A;  4K5W A;  2F4I A;  2X6G A;  2XWJ B;  4LAA A;  2WAQ G;  3CCR A;  2B63 B;  1HZC A;  5C4X B;  4B9W A;  1GVP A;  2H4O A;  3VYS A;  3A5Z B;  3D4W A;  3DM1 A;  3H09 A;  1LO5 D;  4IFD G;  3RMH A;  2EXZ A;  1X32 A;  3V96 A;  3AFQ A;  4WRD A;  5G3L D;  1VCI A;  1TY0 A;  3KFU A;  2NUC A;  5AFW A;  2F0T A;  4DKA C;  1ENF A;  2VQE Q;  2N3S A;  4DV2 Q;  4AQY L;  4K6D A;  1BDO A;  3EFX D;  4WJ3 M;  2D2C C;  4ZKC B;  1BOS A;  5KND A;  3HOX B;  1B1Z A;  3NBH B;  2BE5 D;  4KHZ A;  1HNW L;  1ZYR D;  1Y1W H;  1B44 D;  2NVQ H;  3H3V C;  1PRT F;  3SHL A;  3GV6 A;  4ME5 A;  4BS9 A;  3L3O C;  3KF8 A;  3PIP 3;  1SYF A;  4JI5 L;  3W2D A;  1LLR D;  2XNA C;  4NXM L;  2HHH L;  3HKS A;  4BBS H;  3NWS A;  1OXU A;  1N33 Q;  1AFP A;  4YWM A;  1HUN A;  3H15 A;  2LMC B;  2XRQ D;  3U9O A;  2IX3 A;  4A3I H;  2KCM A;  2TMP A;  1GJX A;  1Z7T A;  1I4H A;  1EY6 A;  1KDC A;  4UP7 A;  1FNV A;  3HKZ G;  4BY7 G;  2ICI A;  3CC2 A;  3S16 B;  2R6G A;  1EFI D;  1KQS A;  3ONA B;  3HFZ B;  1EWC A;  4JI2 Q;  3K8A A;  4GNX B;  5LMN L;  1TWG B;  3GTP H;  1MD2 D;  1FGB D;  3KYH C;  1ET9 A;  4M1U B;  2WB1 B;  1WD1 A;  1XYI A;  3UDI A;  1YIJ A;  1PA6 A;  2JA8 G;  3S1Q H;  2VB3 X;  2ZXO A;  2SDF A;  1KNA A;  3DEO A;  2CH4 A;  3S17 B;  3OTO L;  3A8J E;  3BDC A;  5C44 B;  1XTC D;  3P7J A;  4A3M H;  2Z9H A;  1S5F D;  4YIJ A;  3HOZ H;  3CMA A;  3I72 A;  2R7Z G;  4ODG A;  1UWV A;  4NXM Q;  5EKI A;  3EIV A;  3TEH B;  2QEX A;  2F03 A;  2HHH Q;  3U4V A;  1KAB A;  4HID A;  2EY2 A;  2NN6 G;  4A93 H;  4A4I A;  1LTR D;  2L9H A;  4IO9 A;  3D3R A;  4GLA C;  4B3S L;  5FJ8 H;  1OO9 B;  1U4R A;  4K14 A;  2CWA A;  1AE3 A;  1NBW A;  1JJG A;  4X3T A;  4X64 L;  4HSP A;  5LMN Q;  3PV0 A;  1GUT A;  4DR6 L;  4RGM A;  4MTN A;  4X6A H;  4OWW B;  5KGU A;  4P71 A;  1HNZ L;  3T4A C;  1VQ4 A;  3SDZ A;  5CMD A;  2BH8 A;  4CKB A;  5C0X H;  4NPS A;  5ELN A;  1IW7 D;  1XX8 A;  2OQ0 A;  3J7A F;  2YTX A;  4X66 L;  1VQL A;  4WFN 3;  3AB9 A;  3ND8 A;  5LL6 X;  2TSS A;  5GRO A;  1MI2 A;  2L4N A;  1V9P A;  2QKI C;  4CKE A;  1JWS D;  2F0U A;  5JEA G;  2R7D A;  4OWX B;  2CKZ B;  2XWB B;  2PMZ E;  4DAY B;  1UEA B;  1B70 B;  4L5R C;  3DEP A;  4K5V A;  2EYH A;  4HMI A;  3PSI A;  3UDX A;  2LS0 1;  4DAV A;  1HXY D;  2N78 A;  3KF6 A;  4OEM B;  4YCU A;  3MXG A;  4ZQ3 A;  1IL2 A;  2EYP A;  1LT5 D;  2EJF C;  4IPD A;  2F0D A;  4X65 L;  4G7H C;  2Z6B A;  1WTQ A;  3A7A B;  2KCT A;  2K5D A;  2K75 A;  4R4O A;  3FP9 A;  4XT3 B;  1ET6 A;  2RHS B;  4DR6 Q;  2PO4 A;  3SGI A;  1E24 A;  3HOW B;  3CQZ B;  2CCZ A;  2XTI A;  3S1M H;  4RHR A;  1HNZ Q;  1VQ8 A;  3KLS X;  2JA6 B;  3PO3 G;  2VQF Q;  1C0A A;  1MBY A;  1PYS B;  2K50 A;  4HN7 A;  1X3G A;  2PZW A;  4X66 Q;  4J8Q A;  2YV5 A;  3A5U A;  1SEB D;  1JT8 A;  3CF5 A;  1IYJ B;  2N49 A;  1PVO A;  3K5M A;  3NE5 B;  4A3D G;  4ZAI A;  3K57 A;  4QCL A;  3QOJ A;  1IKM A;  5C3E G;  3VR5 A;  3OPO A;  2VUM H;  3NBI A;  5LHY 1;  2VL6 A;  4R4C A;  1A2T A;  2YTV A;  2X6L A;  3CD6 A;  2B2Y A;  4NDX A;  5BN3 A;  1XTD A;  4FYD A;  4LJZ C;  1QVG A;  5M3M H;  3Q23 A;  3J80 L;  2RCF A;  2WKD A;  2D9U A;  4RGO S;  4QUC A;  1DM0 B;  1E22 A;  4OL7 A;  2XRS D;  4ZCK A;  1G29 1;  1EEI D;  2KOL A;  1EU3 A;  5J1Z A;  3G7L A;  1XPR A;  1FNW A;  3CCL A;  2WP8 J;  4MNO A;  5ELB A;  2JA5 G;  1S5C D;  2DUD A;  1PH1 A;  3I4N B;  5IYD G;  1Y1W B;  1CKN B;  4AIM A;  3M4Y A;  3KBG A;  2BCO A;  1EFW A;  5JAV A;  5IE8 A;  2K03 A;  3GTM H;  4IFD J;  4L5S A;  1O78 A;  3ER0 A;  3VYR A;  3LX0 A;  1EY8 A;  3O13 A;  4ZLT F;  3H0G H;  4LWC A;  3GTO H;  1EL0 A;  1HFN A;  3VR2 A;  4A3I B;  1ASZ A;  2FJ2 A;  1IYU A;  2Q2H A;  3GTK H;  4IOC A;  2C5C A;  1Y8O B;  1O80 A;  1CKO A;  4DR4 L;  3ICE A;  1CK1 A;  1YNN C;  2K14 A;  3L9A X;  1BCP D;  4UP8 A;  4LFA L;  1QWY A;  1VQF A;  4C3H H;  1W2B A;  1A8V A;  1QZG A;  2WII B;  2M00 A;  4LNQ A;  1SNC A;  3GTP B;  3C1E A;  3W1G A;  1U4M A;  1I50 H;  2RHQ B;  4ULL A;  4XYQ A;  3URY A;  4DV4 L;  1ICW A;  3S1Q B;  3NWT A;  2ZJQ A;  4F88 A;  5KNB A;  2JP1 A;  2UXD L;  4OEL B;  1BCP B;  2H1E A;  4LF6 L;  1SDF A;  3M85 A;  2AQ3 B;  4A3M B;  2ES2 A;  1HRJ A;  3ULL A;  2KVM A;  2NZ1 D;  4JPB W;  4DN4 M;  3HOZ B;  3H3V I;  2OEO A;  3I91 A;  4BXX G;  1B4O A;  3I7F A;  4V0B A;  4KLK A;  1JOO A;  4GN3 B;  5FO9 B;  2ZM6 Q;  1K83 H;  4IPG A;  2EZV A;  1B3A A;  5C3W A;  3J81 L;  4A93 B;  1WTR A;  1JE5 A;  3BVZ A;  1KLU D;  3IFT A;  4Y7N B;  1HR0 W;  2JA8 H;  2UXB L;  4J15 A;  1F2M A;  1WD0 A;  3E3X A;  2KUM A;  4DR4 Q;  1PRT C;  2PQA A;  1Q82 C;  1I4X A;  1YEZ A;  3MXP A;  1EQR A;  4LMQ D;  2WKC A;  5DEH A;  3CCM A;  4C56 C;  2VB2 X;  4GNX C;  2B2Y C;  5JJZ A;  1CHP D;  4KKS A;  4R9W A;  4DV4 Q;  1QUQ B;  5EGT A;  1VQP A;  1STA A;  2Z8L A;  2NN6 H;  2NYZ D;  1O7I A;  4LUZ A;  4JI1 L;  3F2U A;  2UXD Q;  3CPF A;  2HIX A;  5D14 A;  3HOY G;  2RVL A;  1SNO A;  1LT4 D;  3UI2 A;  4B3M L;  3IFD A;  1Q90 A;  4EGV A;  3HOU H;  5JJI A;  2A6E D;  2KED A;  2KCN A;  1K0S A;  2PI2 E;  4JBK A;  1QNK A;  5KYI A;  2E75 C;  3D6W A;  2GVA A;  3KJP A;  4LF8 L;  1P8L A;  1S40 A;  2PZU A;  1CZG A;  2JK8 A;  3P1H A;  3PQI A;  1STY A;  2CQA A;  1LTI D;  1CT1 D;  2UUC Q;  1EYG A;  4TRD A;  4KTA A;  1Q7Y C;  3PUX A;  2NVY H;  5A2Q E;  1ESR A;  5ISR A;  3M3Y H;  1HZ9 A;  3L7Z C;  1YI2 A;  2G9D A;  1Y8N B;  3S1M B;  1Q46 A;  3MXN A;  5IYC H;  4OGQ C;  1KNE A;  5IT9 E;  5JEA J;  3TZU A;  1JWM D;  4DV7 L;  4JI1 Q;  2RCN A;  3DHQ A;  4RA8 A;  1M90 C;  3ERS X;  1I94 Q;  2Q2I A;  3HGB A;  1J8I A;  4B3M Q;  1RHP A;  2K4K A;  5C4J H;  2IPK D;  3FHW A;  1SE3 A;  2NTT A;  4P75 A;  3HP3 A;  4IUT A;  3CCV A;  1EOT A;  1F9P A;  5L37 A;  3S2D B;  2L5T A;  2RQX A;  3GTQ H;  4LF8 Q;  2VUM B;  5DM7 3;  1CZW A;  3GTG B;  2DNE A;  1X3Q A;  4GOP A;  1SN8 A;  1I6H B;  3GO5 A;  4OO1 I;  2KHS A;  1D5M C;  3WOE A;  3G71 A;  1CQF A;  2L55 A;  1E7Z A;  4DNR B;  1WCM G;  2O5I C;  3PO2 G;  5M3M B;  5C5M A;  3CC4 A;  2XN9 C;  1I4Q A;  1GUO A;  3RZD B;  4O2D A;  4A3C G;  1G91 A;  3X3M A;  5HGT A;  5CYU A;  4JI8 Q;  4LF9 L;  5C3E H;  4QUF A;  5IGE A;  1ROD A;  2SNM A;  4A3J B;  3TRZ A;  1D5X C;  3LNN A;  4GLX A;  2JA7 H;  4DV7 Q;  4HR7 B;  2BA0 A;  1A2U A;  3H94 A;  4YHH L;  4CDE C;  4LUO A;  1EZ6 A;  4PZ6 A;  2R92 G;  5K5P A;  4G7Z C;  3VA7 A;  3MWY W;  1EUJ A;  1N36 L;  1ZKO A;  3BYT B;  3H0G B;  1F77 A;  2IY5 B;  3GTO B;  5K36 G;  2KHJ A;  5JPM C;  1TXY A;  4DV5 Q;  2I46 A;  5GAG C;  3KF8 B;  4P72 A;  1H9M A;  3R2T A;  4A3L G;  5I6W A;  2E2I B;  2F0W A;  1HQR D;  1UE7 A;  2MQH A;  4HED A;  3BDO A;  1X9N A;  5I2Y A;  5LL6 S;  4C3J H;  2UUB L;  1E2V A;  3TRE A;  4U67 3;  4C3H B;  1VQO A;  3T1H L;  3QO2 A;  4BY1 G;  5EBD A;  2G5D A;  3HRZ C;  1I50 B;  5E4X A;  1CM9 A;  1UAP A;  3E0E A;  4LF9 Q;  3SK8 A;  1F9R A;  3GP7 A;  2SOB A;  2B39 A;  2V4D A;  1F2Z A;  2WB1 E;  1JWU D;  4FVM A;  1N9W A;  4YHH Q;  4DR5 L;  1PMR A;  3K5L A;  1K8A C;  2F52 A;  1PTO F;  1KLG D;  1PDQ A;  3BG3 A;  4G57 A;  4QF4 A;  1EYD A;  1JMC A;  2BDN A;  4RCN A;  4HJ5 A;  3GTJ H;  5M5X B;  1GOZ A;  1I4G A;  1DGS A;  1QG7 A;  1TS4 A;  4MZ9 A;  4X3K A;  2AWN A;  2LXK A;  1TR5 A;  3QB3 A;  1K83 B;  2ID0 A;  4ME3 A;  2MGS A;  5EJW A;  5I9O A;  1OXS C;  1IKL A;  4JI6 L;  3D4D A;  1OXX K;  1VQM A;  3J80 i;  4GOP C;  2HD3 A;  5A2Q L;  4K0K L;  2UUB Q;  2JN4 A;  1JB7 A;  1C8C A;  3A55 A;  3FDT A;  3NQI A;  3T1H Q;  4OHJ A;  2JJQ A;  4KN7 C;  4BXX H;  4A3E G;  4Q5V A;  4ALP A;  4R8I A;  5BN5 A;  3DXJ C;  3U9S A;  3D6C A;  2Z6K A;  4PMC A;  2DJF C;  2OQK A;  3JAM i;  2VW9 A;  3KBX A;  2BH2 A;  2OF1 A;  4DA2 A;  2F0N A;  3S2H H;  3HOU B;  4CDC C;  4K5X A;  4C3I G;  4DK0 A;  1Y1V H;  1II3 A;  1VQN A;  4UP9 A;  1G6Z A;  1VMC A;  1EIG A;  3SR1 A;  1IBK L;  5FOB B;  3PUV A;  2K05 A;  1SYG A;  1PXU A;  4PMW A;  4KK7 A;  4QMG A;  5IYB H;  4QY7 A;  1YNN D;  1VQD A;  4JI6 Q;  3SEB A;  5IT9 c;  5M3F G;  2AHO B;  1D2B A;  1X55 A;  2A6H C;  1ASY A;  4WOR A;  3NUC A;  2E2J H;  3CKI B;  1G51 A;  3HOY H;  4K0K Q;  1ONL A;  5EQ0 A;  2VNU D;  1F2Y A;  2A73 B;  1LTL A;  3PUZ A;  2NVY B;  5CR3 A;  3M3Y B;  1EZ8 A;  1SE8 A;  2RSO A;  2A19 A;  2LSS A;  4KY5 A;  4NMZ A;  1NCV A;  5GQO A;  1FGU A;  1U5K A;  2B2U A;  2P5Z X;  1I3Q B;  3KF6 B;  3HOV G;  3I4O A;  2HCC A;  4BWG B;  4LFC L;  3NSW A;  4QQB X;  3OIP A;  1YHA A;  3KLR A;  5C4J B;  1UE6 A;  3K7A H;  5KYL A;  2HUG A;  1IBK Q;  2YTY A;  2F0L A;  1NMG A;  1JJ2 A;  1YHB A;  3J81 i;  3GTQ B;  3NHH A;  4RMF A;  1B9N A;  1E3P A;  1IHZ A;  1PRT D;  2KEN A;  3I4M H;  2B2T A;  5ELD A;  5D65 A;  1KDB A;  2VS1 A;  3E9I A;  1W6K A;  4NKL A;  2DY8 A;  1VDZ A;  3SK5 A;  4BBR G;  4KHP L;  4OO1 G;  1HZB A;  1FJG L;  1FVI A;  3FKI H;  3I8Z A;  5LMN W;  3RLO A;  2EIF A;  5CV7 A;  3TP6 A;  2E2D C;  1PRT B;  4X62 L;  4GKJ L;  3LWU A;  2DGY A;  1K0R A;  2F3I A;  3NK9 A;  1QE6 A;  3TQY A;  4AQY Q;  1J5E L;  4DK3 C;  3J80 E;  1I5F A;  1OXV A;  2JA7 B;  4LFC Q;  1TS3 A;  1E0B A;  1RCV D;  1SYB A;  2AWO A;  4RGN A;  2Z6K C;  3VA5 A;  3K6O A;  3A54 A;  3K58 A;  2M2L A;  1WVL A;  1HNW Q;  1D1I A;  1EEF D;  1D6E C;  4UPA A;  1SYC A;  3NTH A;  4K2K A;  4XIG S;  2J4X A;  4A3K G;  3SK6 A;  2D5D A;  4K8I A;  3JAM E;  4HIM A;  4C1N I;  4JI5 Q;  2QDB A;  4R4T A;  1XMO L;  3G6J B;  1ENA A;  5FLM H;  1S4Z A;  2F1M A;  1C48 A;  3BZC A;  3QOL A;  4IOA A;  4KHP Q;  1Q81 C;  3A7L A;  1BBX C;  4C3J B;  1Y14 B;  1VQ9 A;  2PW5 A;  1FJG Q;  1YZ6 A;  1MJE A;  5CV4 A;  4DUZ L;  1SBB B;  2Z0S A;  4OX9 L;  1VQ7 A;  5KRU A;  4X62 Q;  4GKJ Q;  4ZUJ A;  5AJ3 L;  4GS3 A;  5J22 A;  2LFN A;  4G4K A;  3UE1 A;  1XXG A;  3PUY A;  1H9S A;  1X65 A;  4L63 B;  2ZJP A;  3ND9 A;  4A3B H;  2SEB D;  2B2U C;  4RWS C;  1NUC A;  4A3L H;  1HFG A;  4XYO A;  1BQQ T;  4A75 A;  3OTO Q;  1G2S A;  3GTJ B;  1PYB A;  4IN3 A;  3FEW X;  4XQQ A;  4BY1 H;  1XMO Q;  2NZO A;  4FNF A;  3PUW A;  4S3S A;  2F3V A;  4B3R L;  1CUK A;  3NEN A;  3CCE A;  1PHJ A;  2B63 G;  1QZH A;  3U4Z A;  5C4X G;  2K04 A;  3F8T A;  4TSS A;  1NNX A;  2XGT A;  3QJY A;  1WTP A;  1A0I A;  4RAU C;  3J81 E;  1LTT D;  1SJE D;  4DK6 C;  1CQV A;  1VF7 A;  1LAC A;  4B3S Q;  5C4Z A;  2K1B A;  4OX9 Q;  4PG3 A;  1H9R A;  2J7Z A;  5AJ3 Q;  2IX0 A;  4LW1 A;  4NP5 A;  3M7G A;  1EYC A;  4YWL A;  4X64 Q;  2PQA B;  3F2C A;  4QJF A;  1VQG A;  2ZTE A;  1WTX A;  2F0M A;  1S5B D;  3S2H B;  2A8V A;  1EY7 A;  3HOX G;  3F2B A;  5FLX L;  1Y1V B;  3TSS A;  1BKB A;  1LUZ A;  1R4Q B;  4DFA A;  2C9O A;  1NMF A;  4HJ9 A;  5KEE A;  1TWH H;  1V1P B;  3J7A 5;  1MSH A;  1ZXT A;  4UY8 C;  2Y0S B;  4IAL A;  4N9T A;  1PH4 A;  2L15 A;  3J7Y W;  4QB4 A;  4DR3 L;  1JJC B;  3P20 A;  1V1Q A;  3TN2 A;  1YJW A;  1O7Y A;  1K28 A;  5CV5 A;  3MAQ A;  1PV4 A;  1NR2 A;  1SE4 A;  2E2J B;  2PW7 A;  1XPO A;  2OTL A;  3VYT A;  5BR8 L;  1PTO C;  4IUU A;  1PH8 A;  4XDX A;  1BBW A;  3RR5 A;  5FLX c;  2O5J C;  1KXL A;  4X65 Q;  2LKV A;  1MIU A;  2EYO A;  1SMX A;  2F0S A;  1DYQ A;  4JG2 A;  1VQA A;  1IBL L;  4P74 A;  4A3F G;  2EJG C;  2RDG A;  2O4X A;  1A6X A;  3MZ5 A;  1STE A;  1HHV A;  3F1Z A;  5CBA E;  2QA4 A;  3U58 A;  1AE2 A;  2E2H H;  2B29 A;  1RTO A;  4IFD H;  2WB1 G;  2MJ8 A;  2NVQ B;  3JAM L;  5JVH 3;  4KD3 A;  4JI3 L;  1HNX L;  3P75 A;  3MXN B;  4CJ0 B;  3G6E A;  2CHB D;  1SNM A;  5J3B A;  4EVO A;  3HG9 A;  5C44 G;  3T13 A;  1UE1 A;  1JE4 A;  2A69 D;  3J80 c;  3I4M B;  3PMF A;  4BBS B;  4OON A;  3N6R A;  2EPB A;  1XNQ L;  1HZA A;  1PFB A;  1LT3 D;  4JW0 A;  2CFM A;  4GKK L;  2EY5 A;  2EQS A;  2J0T D;  3FRP B;  3FKI B;  4JYA L;  3CME A;  4IUN A;  3CCU A;  4Z9C B;  4EQP A;  4JV5 L;  1PYW D;  3JAM c;  4JBJ A;  2F0H A;  4GOP B;  2QIL A;  4NW2 A;  1QVF A;  4BA2 I;  2C35 B;  1OXT A;  3VDY A;  3TZD A;  3MEF A;  2EJM A;  4JBM A;  4F8M A;  4A3G G;  1WTV A;  1CKM A;  1N8R C;  3PCO B;  5EAY A;  3W3A A;  4KKT A;  1HNX Q;  1HTL D;  2B8G A;  4Y52 H;  2KEE A;  1JCK B;  3MA2 B;  1MSG A;  3QG1 A;  5ELC A;  1GUN A;  1SXT A;  4R4Q A;  4TQU S;  4BY7 H;  2A6H D;  3PIO A;  3D8G A;  3DWA A;  2XSC A;  1PZI D;  1FR3 A;  2E5L L;  1K8O A;  1XNQ Q;  1YBY A;  4KJO A;  3I4L A;  3BVG A;  1LM0 A;  3ERO A;  4JYA Q;  1BO0 A;  2KQ3 A;  2EDG A;  2QGQ A;  2JQO A;  1E1T A;  1PFM A;  2NB0 A;  4LFA Q;  2DN8 A;  4RKL A;  3D31 A;  1PTO H;  4WJW A;  1MGS A;  4L8J A;  4F7X A;  2R7Z H;  2N55 A;  4A3B B;  4DV1 L;  3HOW G;  3C2P A;  1EIF A;  2I5M X;  3MFG A;  3IL8 A;  1V1P A;  1YVC A;  3NPP A;  5EKK A;  4PNY A;  3DLL A;  2JA6 G;  2L12 A;  1Z6H A;  1JQY D;  3J81 c;  4TKO B;  1SRU A;  5HY6 A;  2AUK A;  4LF6 Q;  4FXG C;  1STN A;  2IW3 A;  1DD2 A;  1W3S A;  4JBW A;  1RKN A;  3C1F A;  5GAD C;  1TVX A;  3BDL A;  4DAP A;  3NP8 A;  2E5L Q;  1YIT A;  3HZX A;  1HJP A;  2D62 A;  4QIW E;  3K0Y A;  2JEA I;  3OHX C;  1A15 A;  3Q22 A;  2F0F A;  2MUY A;  5DLQ E;  2F0E A;  3GTL H;  1BF4 A;  3AQQ A;  2UXB Q;  3S9W A;  5C4H A;  1L2F A;  1VQB A;  2L11 A;  2E8G A;  1B2T A;  1G8Z D;  4AYB B;  3AFP A;  2RDH A;  3BJU A;  3KDF A;  4DNI A;  3KLW A;  1RD9 D;  5JEA H;  1JOQ A;  1SNP A;  1EQV A;  4JI4 L;  1SJH D;  4ZKB B;  4DV1 Q;  3TS2 A;  4HCE A;  1LTB D;  2EVB A;  1GM5 A;  4L5Q A;  3EVQ A;  4C1N K;  4B3T L;  1D1K A;  1A3U A;  2EYJ A;  1F9S A;  3EJI A;  2XVS A;  4ZUI A;  4F87 A;  3I4N G;  5C3X A;  1Y1W G;  3OYY A;  2YU9 H;  3LGJ A;  2OTJ A;  2AKW B;  1TWH B;  1DOM A;  2D0P A;  1BUV T;  2I0Q A;  2PPB C;  4P73 A;  4YY3 L;  3D0F A;  3PF5 A;  2ZTD A;  3K5O A;  1GXD C;  1Z47 A;  5CGK A;  4HJA A;  3OIQ A;  1P16 A;  4JK1 C;  2RKS A;  1PZK D;  3V05 A;  5JPN C;  1R9T H;  3PO3 H;  4LF7 L;  1LAB A;  1RIP A;  2H5X A;  2QEJ C;  3KJO A;  1AZP A;  1X3E A;  1VS0 A;  4JI7 L;  4L5T A;  2PNR C;  1B9M A;  4E6I A;  1S5E D;  3S1R H;  2MPM A;  2R7F A;  4A3D H;  4JI4 Q;  2E2H B;  4J1M A;  2WAQ B;  4CDF C;  3BZK A;  2ASB A;  1R4P B;  4B3T Q;  1K73 C;  5C6A A;  3AMU A;  3C3L A;  4JOI A;  4HJ8 A;  4DU9 A;  3CRK C;  3EBE A;  4PQX A;  1RTN A;  5ELE A;  3GTM B;  2CVR A;  5IP7 G;  3TDQ A;  4A3M G;  3R3O A;  2Q2T A;  3T16 A;  4YY3 Q;  3HOZ G;  1K8M A;  3CC7 A;  1LV9 A;  1KRT A;  4XQN A;  1AN8 A;  4A3F H;  3STB C;  4FDB A;  1TT2 A;  4RFB A;  1PH6 A;  1JOK A;  3HS0 C;  1HCZ A;  2NTS A;  2B8F A;  2L1B A;  4ZRZ A;  1H95 A;  3GTK B;  4A93 G;  1SRO A;  1TKW B;  2JA5 H;  3C46 A;  2R93 G;  2PNH A;  2ZXP A;  5IYD H;  2CQO A;  2KA7 A;  1E2W A;  4UAI A;  1X56 A;  5E3F A;  3GV3 A;  3MHB A;  5FJ8 G;  4L6T B;  4ZYS A;  1TY2 A;  4HAE A;  3A8I E;  3S15 H;  4GZY C;  1YJ9 A;  2ALY B;  1U0L A;  4DV0 L;  3KK7 A;  3BZD B;  2ZXR A;  2Z1C A;  2F4V L;  2CH4 W;  2B2V A;  2NN6 I;  1H9K A;  2NVX H;  1X3F A;  4WJ4 A;  3DWQ A;  1SSO A;  2RDF A;  2JEB I;  1T9H A;  4H02 A;  4BA1 I;  2X69 A;  1EWH A;  3GD7 A;  3VR4 A;  4BY7 B;  3HKZ B;  3A8K E;  4POF A;  5IGD A;  3W5O A;  1N36 Q;  1KAA A;  2D0O A;  2Q2U A;  3PF4 A;  1PTO D;  3TBI B;  2K33 A;  4EQN A;  1SND A;  2LY7 A;  3CRL C;  1XMQ L;  1OTC A;  1CFM A;  2AQ1 B;  2JA8 B;  3WDN A;  4A3G H;  2AQ2 B;  3G4S A;  2BDO A;  1GUW A;  1HPC A;  4PZ8 A;  4FF4 A;  2B2W A;  2Q8R E;  1STG A;  2DNC A;  2F0O A;  5IGF A;  3NTK A;  1N34 L;  3GDE A;  1PTO B;  1MJC A;  1T5X D;  2MHV A;  1VQI A;  2MO1 A;  2R7Z B;  1WJJ A;  2OT2 A;  4DV0 Q;  1MKH A;  1SFO H;  2F4V Q;  3W1B A;  1JOR A;  4DV6 L;  1RJT A;  1VQ6 A;  1HA6 A;  1EQQ A;  4DR5 Q;  3ULJ A;  4B08 A;  5M5Y H;  3DMU A;  3QIA A;  1H9S B;  1DCZ A;  4IPC A;  4JOI C;  5FO7 B;  1A3V A;  2F0K A;  1K3B C;  2EOT A;  2A1A A;  2RSN A;  4YCW A;  4DF7 A;  4H7B A;  4DV2 L;  1J9O A;  4JI0 L;  1PZJ D;  3NXW A;  3CCS A;  2N88 A;  2IX1 A;  1KDA A;  4H13 C;  2HDM A;  4HCS A;  2VUM G;  2L0C A;  2JA6 H;  1C9O A;  1TII D;  1FD7 D;  1STB A;  2EYF A;  4U68 A;  4FXD A;  2IJ0 A;  1N34 Q;  5M3M G;  4H0L C;  4CJ1 B;  2FMM A;  4C2M H;  2EYM A;  3HEJ A;  2K7V A;  1E2Z A;  3PIO 3;  3N52 A;  1LT6 D;  1YNJ C;  3M9B A;  2FHT A;  2O2L D;  4DV6 Q;  5EPK A;  3VR6 A;  3KUP A;  5G3L F;  5M5W H;  2VY3 A;  3M4Q A;  1EIY B;  1N33 L;  4A3J G;  4ZK9 B;  2YU9 B;  2B2V C;  2IWH A;  4ABN A;  4APV A;  5M9O A;  3CW2 C;  1Q3L A;  2K28 A;  1STH A;  4EQ5 A;  2Y0S E;  5FLX E;  2CW0 C;  4I7Z C;  1K9M C;  2HCI A;  4JI0 Q;  4JI2 L;  1U4P A;  2K52 A;  3H0G G;  4G7O C;  1NE3 A;  3MFY A;  3J7A V;  1R9T B;  1UNS A;  2KHI A;  3PO3 B;  3ERQ A;  5D3D A;  2PYK A;  3ZJY C;  2WIN B;  4KD4 A;  4HJ7 A;  3R8B A;  3U50 C;  4CDD C;  3I4N H;  4YCV A;  5CV8 A;  5JOB A;  1BR9 A;  3OMG A;  4ILW A;  1Q8K A;  3S1R B;  5TSS A;  2B2W C;  5COR A;  4A3D B;  4C3H G;  1CHQ D;  4KY6 A;  2GA4 B;  4DR1 L;  3R93 A;  5D3I B;  4DR2 L;  5C3E B;  2A6E C;  3DM3 A;  4CHT B;  2KCC A;  5CC4 A;  2A5H A;  3RLN A;  3K59 A;  1G6P A;  1QJO A;  5GAE C;  2RBM A;  4OIJ A;  4N8F A;  3PO2 H;  2QW7 A;  1WCM H;  4IJL A;  4CBV A;  5LMU L;  3RN5 A;  1AH9 A;  3T53 B;  4MHE A;  4GN4 B;  5T1G A;  4A3F B;  4I7A A;  4A3C H;  1DON A;  2NZH A;  2JA5 B;  1LTA D;  1D8L A;  1I4R A;  5EPL A;  1N32 L;  1M8A A;  3NEL A;  1D7Q A;  1CI3 M;  4LK1 C;  5J39 A;  2PI2 A;  1UUP A;  3S15 B;  1B3Q A;  2NVT H;  1IXR A;  4DGZ A;  1XWE A;  5IP7 H;  2R92 H;  1KHI A;  2FMC A;  1YHQ A;  1AW7 A;  1GHJ A;  4R4I A;  4P2C B;  2QCP X;  4YWK A;  1GHK A;  1SLJ A;  4DR1 Q;  1NSN S;  3X3N A;  1XPU A;  3RZO H;  1EIH A;  1NTG A;  4DR2 Q;  1J5E Q;  5JVG 3;  2NVX B;  5K36 H;  1AZQ A;  3M7N A;  1DJR D;  4FXK C;  5EKL A;  3QR8 A;  5COY A;  3GQB A;  1GUG A;  4KKU A;  2R93 H;  1GO3 E;  3TP5 A;  4Y7N H;  1T5E A;  3S1N H;  3OOC A;  3TP7 A;  1L0X B;  5A35 A;  3HOU G;  3SVM A;  1B8A A;  4K2L A;  1Q1E A;  5EPJ A;  5LMU Q;  4JVZ A;  3T1Y L;  2JE6 I;  3EA6 A;  1CTM A;  4POG A;  2SNS A;  4R8N A;  4DXF A;  1U9R A;  5CV6 A;  3ZYY X;  1UE5 A;  4A3G B;  2IHF A;  1TWF H;  1SE2 A;  1QIL A;  3CXC A;  4IUR A;  4RCO A;  4O0A A;  1N32 Q;  2VQF L;  1TS5 A;  3EQL C;  1B50 A;  3BVM A;  4JC0 A;  2B2T C;  2IL8 A;  1WI5 A;  2VXW A;  1K8G A;  1M4V A;  1ZEQ X;  4H44 C;  3E6Z X;  1SMY C;  3A74 A;  4JCV E;  4DUZ Q;  3S14 H;  4FF3 A;  3I73 A;  5C0X J;  1SFO B;  3H3V H;  1TU2 B;  1S5D D;  2EY1 A;  5IYC G;  1G2T A;  3IRB A;  5ELO A;  5M5Y B;  3H91 A;  2PQE A;  4DR7 L;  2K32 A;  2FIN B;  3STB D;  5IOC A;  1HH2 P;  1NY4 A;  2MO0 A;  3NBH A;  4QL5 A;  3T1Y Q;  1WTH A;  2HIV A;  4A3E H;  4B3R Q;  4CJ2 C;  1Y69 U;  2K5N A;  5HUR A;  5BN4 A;  3CPW A;  3I56 A;  2AUJ D;  2RA4 A;  1WFQ A;  1PH5 A;  3CAM A;  3RNU A;  4LFB L;  5JJL A;  1DOK A;  2KEC A;  3HOY B;  2F0P A;  1TWC H;  4AYB E;  2OXP A;  4OIK A;  5KNC A;  4IPH A;  3PGZ A;  4C3I H;  2MNA A;  1PH9 A;  2B3G A;  4C2M B;  4UHV A;  2F3W A;  1WTO A;  5H1S E;  3SK4 A;  1CA6 A;  2M9V A;  2ATW A;  2HQE A;  3KOJ A;  3MTS A;  5IGC A;  3S2D H;  5NUC A;  5I4D A;  1TQO A;  4XXE A;  5M5W B;  2MFI A;  3Q6S A;  4V19 0;  3KDF B;  2JA7 G;  5M3F H;  3TS0 A;  3GTG H;  4MTK A;  5HGQ A;  4DR7 Q;  4XTC S;  1I6H H;  2NBF A;  1LTS D;  1FNU A;  4HMJ A;  1ILP A;  4GNX A;  4DK1 A;  3K7A B;  2OWO A;  4GN5 A;  3MC0 B;  3OW7 A;  3I70 A;  1V43 A;  3OMC A;  2EE1 A;  2A68 C;  1HTP A;  3MVV A;  1D5Z C;  4DR3 Q;  3I2Z A;  3UDG A;  3RZD H;  1Q1B A;  2WAC A;  1DZ1 A;  3HOV H;  3BYY B;  1NR4 A;  2ENB A;  3V2T A;  3KLS A;  1W6J A;  2JXM B;  4DNT B;  5IOD A;  3OW2 A;  4A3J H;  3MEH A;  4IUQ A;  4LFB Q;  3RUZ A;  5BR8 Q;  2HT1 A;  1A3T A;  2K01 A;  2ZJR A;  4C3J G;  2UU9 L;  1QB5 D;  4X3S A;  1QCB D;  2E74 C;  3I55 A;  1HUM A;  2R61 A;  1IZ6 A;  1PLF A;  1WYD A;  2WAQ E;  1SYE A;  2ZT9 C;  3NEM A;  5FKA C;  3JC6 6;  3F2D A;  1IBL Q;  4CGY B;  2K5H A;  1F2L A;  3AU7 A;  4RH6 A;  2ZM6 L;  1FL0 A;  2KJX A;  4KY7 A; 
#chains in the Genus database with same CATH homology
 1ILQ A;  5KIX A;  1BCP F;  5C0X I;  3E0J A;  1HA5 A;  1HQM C;  3PO2 B;  1WCM B;  4N9P A;  4OO1 H;  3IAY A;  2WV6 D;  5IGB A;  3LWE A;  1I6V C;  1SYD A;  5IIF A;  1H9J A;  2JYO A;  2K5W A;  3FPU B;  4MIU A;  1EYA A;  1BXT A;  2NVT B;  1YNJ D;  2R92 B;  1V8Q A;  4HSV A;  4J6H A;  4DAY A;  4IZ8 A;  3FVQ A;  2BE5 C;  2E76 C;  3RZO B;  1ZYR C;  1B53 A;  2Q8T A;  3TME A;  4RGT A;  3FMC A;  1V1O A;  3VYU A;  2R93 B;  2CW0 D;  4DXG A;  2PMZ B;  4UDU C;  3S1N B;  5DNF A;  3CHB D;  2A74 C;  5E4W C;  2Z4H A;  4BY1 B;  4KV6 A;  1EQT A;  1I4P A;  1TWF B;  3OSO A;  3NTI A;  4MN3 A;  1JB3 A;  1PFN A;  5T1I A;  1RDP D;  4IUP A;  1AEX A;  3S14 B;  3RD4 A;  4M8A A;  2ICE C;  1FYC A;  1LTG D;  1WTW A;  1AP0 A;  2F0I A;  4IFD I;  4FF2 A;  2BA1 A;  3NQT A;  4IUV A;  3SXH A;  4X3U A;  1EU4 A;  1O7Z A;  2EYL A;  3H6M A;  2QF7 A;  4A3E B;  4KI0 A;  5I6Y A;  3CU7 A;  3A56 A;  5CV9 A;  4EQO A;  1TWC B;  3QWN A;  4RHS A;  4C3I B;  1JR0 D;  1L0Y B;  4KN4 C;  4FP5 D;  2HDL A;  1ENC A;  1EY4 A;  1QOH A;  2G9H D;  3I90 A;  1IW7 C;  5ELF A;  1SAP A;  5M3F B;  1IL8 A;  1EY0 A;  3DWP A;  3OWE B;  1ESF A;  3IKJ A;  5IGG A;  5E1F A;  1KTK A;  3R2I A;  1VF5 C;  1F9Q A;  2I07 B;  2PCF B;  5C5L A;  2YYZ A;  1O7L A;  3RLF A;  3HOV B;  4ID6 A;  4KMU C;  1SMY D;  4PV1 C;  1BNZ A;  1GUS A;  3D4R A;  4FO2 A;  2BOS A;  5I9P A;  2MP1 A;  2F0V A;  4CKC A;  3K5N A;  3WOF A;  3ITP A;  2PZT A;  1JIC A;  4O1N A;  4BBR B;  3SE0 A;  2Z4I A;  4XQJ A;  1EY5 A;  5C0X G;  1Q12 A;  2FFK B;  1QNU A;  2NWG A;  5I2X A;  3VR3 A;  3I3C A;  3E5S A;  2JSO A;  1EY9 A;  5DAU A;  4O42 A;  1VMP A;  5FO8 B;  4FF1 A;  5EBC A;  4B9X A;  5DM6 3;  1DXM A;  5CBE E;  1JC7 A;  2IT1 A;  4A3K B;  1U4L A;  4XT1 B;  2XIW A;  3TP8 A;  3Q24 A;  4K8J A;  1SNQ A;  4Q0F A;  4I65 A;  1C4Q A;  1TWA B;  1RF2 D;  4QIW B;  1CA5 A;  1NAP A;  1ML0 D;  2A69 C;  2A68 D;  1X3P A;  4IQZ A;  3T51 B;  1IYV A;  2F0J A;  4KHV A;  3T56 B;  1Q8I A;  2K5Q A;  3OWF A;  4PMB A;  5IT9 L;  1BCP C;  3Q0A A;  1Y8P B;  4KJN A;  3GTL B;  4HTH A;  2K6A A;  2F0G A;  3M4O B;  2R3Z A;  1DOL A;  2Q8I B;  5FK9 C;  5F2D A;  2DY7 A;  3FPP A;  4RKB A;  4K6L A;  3DUZ A;  3BS1 A;  2F0Q A;  3MXU A;  4K5W A;  1TS2 A;  2EY6 A;  2F4I A;  2X6G A;  2XWJ B;  4LAA A;  2B63 B;  5C4X B;  4B9W A;  2H4O A;  3VYS A;  3D4W A;  3DM1 A;  3H09 A;  1LO5 D;  4IFD G;  3RMH A;  2EXZ A;  1X32 A;  3V96 A;  4WRD A;  5G3L D;  1VCI A;  1TY0 A;  2NUC A;  5AFW A;  2F0T A;  1ENF A;  4K6D A;  1BDO A;  3EFX D;  2D2C C;  4ZKC B;  1BOS A;  5KND A;  3HOX B;  1B1Z A;  2BE5 D;  4KHZ A;  1ZYR D;  1B44 D;  3H3V C;  1PRT F;  3SHL A;  3GV6 A;  4ME5 A;  4BS9 A;  3L3O C;  3KF8 A;  3PIP 3;  1SYF A;  3W2D A;  1LLR D;  2XNA C;  3NWS A;  1OXU A;  1AFP A;  1HUN A;  2LMC B;  2XRQ D;  3U9O A;  2IX3 A;  2TMP A;  1GJX A;  1Z7T A;  1I4H A;  1EY6 A;  1KDC A;  1FNV A;  2ICI A;  3S16 B;  2R6G A;  1EFI D;  3ONA B;  1EWC A;  1TWG B;  1MD2 D;  1FGB D;  1ET9 A;  4M1U B;  2WB1 B;  1WD1 A;  1XYI A;  2VB3 X;  2ZXO A;  2SDF A;  1KNA A;  3DEO A;  3S17 B;  3A8J E;  3BDC A;  5C44 B;  1XTC D;  3P7J A;  1S5F D;  4YIJ A;  3I72 A;  4ODG A;  5EKI A;  2F03 A;  1KAB A;  2EY2 A;  2NN6 G;  1LTR D;  2L9H A;  3D3R A;  1OO9 B;  1U4R A;  4K14 A;  4X3T A;  4HSP A;  3PV0 A;  1GUT A;  4RGM A;  5KGU A;  3T4A C;  3SDZ A;  5CMD A;  4CKB A;  5C0X H;  1IW7 D;  1XX8 A;  3J7A F;  4WFN 3;  3AB9 A;  3ND8 A;  5LL6 X;  2TSS A;  1MI2 A;  2L4N A;  2QKI C;  4CKE A;  1JWS D;  2F0U A;  5JEA G;  2XWB B;  1UEA B;  3DEP A;  4K5V A;  2EYH A;  4HMI A;  2LS0 1;  4DAV A;  1HXY D;  3MXG A;  4ZQ3 A;  2EYP A;  1LT5 D;  2EJF C;  2F0D A;  1WTQ A;  4G7H C;  3A7A B;  2K5D A;  4XT3 B;  1ET6 A;  2PO4 A;  3HOW B;  3CQZ B;  4RHR A;  3KLS X;  2JA6 B;  1MBY A;  4HN7 A;  2PZW A;  4J8Q A;  1SEB D;  3K5M A;  3NE5 B;  4ZAI A;  3K57 A;  4QCL A;  3QOJ A;  1IKM A;  3VR5 A;  3OPO A;  3NBI A;  5LHY 1;  1A2T A;  2X6L A;  2B2Y A;  4NDX A;  5BN3 A;  4FYD A;  4LJZ C;  3Q23 A;  3J80 L;  2WKD A;  2D9U A;  4RGO S;  4QUC A;  1DM0 B;  4OL7 A;  2XRS D;  1G29 1;  1EEI D;  2KOL A;  1EU3 A;  5J1Z A;  3G7L A;  1FNW A;  2WP8 J;  5ELB A;  1S5C D;  3I4N B;  1Y1W B;  3M4Y A;  3KBG A;  2BCO A;  5JAV A;  2K03 A;  4IFD J;  1O78 A;  3VYR A;  3LX0 A;  1EY8 A;  3O13 A;  4ZLT F;  1EL0 A;  1HFN A;  3VR2 A;  4A3I B;  2FJ2 A;  1IYU A;  2C5C A;  1Y8O B;  1O80 A;  1CK1 A;  1YNN C;  3L9A X;  1BCP D;  1QWY A;  2WII B;  2M00 A;  1SNC A;  3GTP B;  3C1E A;  1U4M A;  4ULL A;  4XYQ A;  3URY A;  1ICW A;  3S1Q B;  3NWT A;  4F88 A;  5KNB A;  2JP1 A;  1BCP B;  2H1E A;  1SDF A;  3M85 A;  2AQ3 B;  4A3M B;  1HRJ A;  3HOZ B;  2KVM A;  2NZ1 D;  4DN4 M;  2OEO A;  3I91 A;  1B4O A;  4V0B A;  1JOO A;  5FO9 B;  2EZV A;  1B3A A;  5C3W A;  3J81 L;  4A93 B;  1WTR A;  3BVZ A;  1KLU D;  3IFT A;  4Y7N B;  1F2M A;  1WD0 A;  2KUM A;  1PRT C;  1I4X A;  3MXP A;  4LMQ D;  5DEH A;  2WKC A;  4C56 C;  2VB2 X;  2B2Y C;  5JJZ A;  1CHP D;  4KKS A;  4R9W A;  5EGT A;  1STA A;  2Z8L A;  2NN6 H;  2NYZ D;  3F2U A;  5D14 A;  2RVL A;  1SNO A;  1LT4 D;  3UI2 A;  3IFD A;  1Q90 A;  4EGV A;  2A6E D;  2KED A;  2KCN A;  1QNK A;  5KYI A;  2E75 C;  3D6W A;  2PZU A;  1CZG A;  3P1H A;  1STY A;  2CQA A;  1LTI D;  1CT1 D;  4TRD A;  4KTA A;  3PUX A;  5A2Q E;  1ESR A;  5ISR A;  3L7Z C;  2G9D A;  1Y8N B;  3S1M B;  3MXN A;  4OGQ C;  1KNE A;  5IT9 E;  3TZU A;  5JEA J;  1JWM D;  3DHQ A;  4RA8 A;  1J8I A;  3HGB A;  1RHP A;  2IPK D;  1SE3 A;  2NTT A;  3HP3 A;  4IUT A;  1EOT A;  1F9P A;  3S2D B;  2L5T A;  2RQX A;  2VUM B;  5DM7 3;  1CZW A;  3GTG B;  2DNE A;  1X3Q A;  1I6H B;  3GO5 A;  4OO1 I;  2KHS A;  1D5M C;  3WOE A;  1CQF A;  2L55 A;  2O5I C;  4DNR B;  5M3M B;  5C5M A;  2XN9 C;  1I4Q A;  1GUO A;  3RZD B;  1G91 A;  3X3M A;  5HGT A;  5CYU A;  4QUF A;  5IGE A;  1ROD A;  2SNM A;  4A3J B;  1D5X C;  3LNN A;  4HR7 B;  2BA0 A;  1A2U A;  3H94 A;  1EZ6 A;  5K5P A;  4G7Z C;  3VA7 A;  3MWY W;  1ZKO A;  3BYT B;  3H0G B;  1F77 A;  3GTO B;  5K36 G;  5JPM C;  2I46 A;  1H9M A;  3R2T A;  5I6W A;  2E2I B;  2F0W A;  1HQR D;  4HED A;  3BDO A;  5I2Y A;  5LL6 S;  1E2V A;  4U67 3;  4C3H B;  3QO2 A;  5EBD A;  3HRZ C;  1I50 B;  5E4X A;  1CM9 A;  1UAP A;  3SK8 A;  1F9R A;  3GP7 A;  2SOB A;  2B39 A;  2V4D A;  1F2Z A;  1JWU D;  4FVM A;  1PMR A;  3K5L A;  1PTO F;  1KLG D;  1PDQ A;  3BG3 A;  4G57 A;  4QF4 A;  1EYD A;  2BDN A;  4RCN A;  5M5X B;  1GOZ A;  1I4G A;  1QG7 A;  1TS4 A;  4X3K A;  2AWN A;  1TR5 A;  3QB3 A;  1K83 B;  2ID0 A;  2MGS A;  5EJW A;  5I9O A;  1OXS C;  1IKL A;  3D4D A;  1OXX K;  5A2Q L;  1C8C A;  3A55 A;  3FDT A;  3NQI A;  4OHJ A;  4KN7 C;  4Q5V A;  4R8I A;  5BN5 A;  3DXJ C;  3U9S A;  3D6C A;  4PMC A;  3KBX A;  2OF1 A;  4DA2 A;  2F0N A;  3HOU B;  4K5X A;  4C3I G;  4DK0 A;  1II3 A;  1G6Z A;  1VMC A;  1EIG A;  3SR1 A;  5FOB B;  3PUV A;  2K05 A;  1SYG A;  1PXU A;  4PMW A;  4KK7 A;  4QMG A;  1YNN D;  3SEB A;  1D2B A;  2A6H C;  4WOR A;  3NUC A;  3CKI B;  1ONL A;  5EQ0 A;  2VNU D;  1F2Y A;  2A73 B;  3PUZ A;  2NVY B;  5CR3 A;  3M3Y B;  1EZ8 A;  2RSO A;  4KY5 A;  4NMZ A;  1NCV A;  2B2U A;  1I3Q B;  2HCC A;  4BWG B;  3NSW A;  3OIP A;  3KLR A;  5C4J B;  5KYL A;  2HUG A;  2F0L A;  3GTQ B;  3NHH A;  1B9N A;  1IHZ A;  1PRT D;  2B2T A;  5ELD A;  5D65 A;  1KDB A;  1W6K A;  4NKL A;  2DY8 A;  1VDZ A;  3SK5 A;  4OO1 G;  3I8Z A;  5CV7 A;  3TP6 A;  2E2D C;  1PRT B;  3LWU A;  3NK9 A;  1QE6 A;  3J80 E;  1OXV A;  2JA7 B;  1TS3 A;  1E0B A;  1RCV D;  1SYB A;  2AWO A;  4RGN A;  3VA5 A;  3K6O A;  3A54 A;  3K58 A;  2M2L A;  1WVL A;  1D1I A;  1EEF D;  1D6E C;  1SYC A;  3NTH A;  4K2K A;  4XIG S;  2J4X A;  3SK6 A;  2D5D A;  4K8I A;  3JAM E;  4C1N I;  2QDB A;  3G6J B;  1ENA A;  1S4Z A;  2F1M A;  1C48 A;  3QOL A;  3A7L A;  1BBX C;  4C3J B;  2PW5 A;  5CV4 A;  1SBB B;  5KRU A;  4ZUJ A;  5J22 A;  2LFN A;  4G4K A;  1XXG A;  3PUY A;  1H9S A;  4L63 B;  3ND9 A;  2SEB D;  2B2U C;  4RWS C;  1NUC A;  1HFG A;  4XYO A;  1BQQ T;  1G2S A;  3GTJ B;  4IN3 A;  3FEW X;  4XQQ A;  4FNF A;  3PUW A;  4S3S A;  2F3V A;  2K04 A;  4TSS A;  1WTP A;  3QJY A;  4RAU C;  3J81 E;  1LTT D;  1SJE D;  1CQV A;  1VF7 A;  1LAC A;  5C4Z A;  2K1B A;  1H9R A;  2J7Z A;  2IX0 A;  4NP5 A;  3M7G A;  1EYC A;  1WTX A;  2F0M A;  1S5B D;  3S2H B;  1EY7 A;  5FLX L;  1Y1V B;  3TSS A;  1R4Q B;  4DFA A;  2C9O A;  5KEE A;  1V1P B;  1MSH A;  1ZXT A;  2Y0S B;  4IAL A;  4N9T A;  3J7Y W;  4QB4 A;  3P20 A;  3TN2 A;  1O7Y A;  5CV5 A;  3MAQ A;  1NR2 A;  1SE4 A;  2E2J B;  2PW7 A;  3VYT A;  1PTO C;  4IUU A;  4XDX A;  2O5J C;  2LKV A;  2EYO A;  2F0S A;  1DYQ A;  2EJG C;  2RDG A;  2O4X A;  1A6X A;  3MZ5 A;  1STE A;  1HHV A;  5CBA E;  1RTO A;  4IFD H;  2MJ8 A;  2NVQ B;  3JAM L;  5JVH 3;  4KD3 A;  3P75 A;  4CJ0 B;  2CHB D;  1SNM A;  4EVO A;  3HG9 A;  3T13 A;  1JE4 A;  2A69 D;  3I4M B;  3PMF A;  4BBS B;  3N6R A;  2EPB A;  1PFB A;  1LT3 D;  2EY5 A;  2J0T D;  3FRP B;  3FKI B;  4IUN A;  4Z9C B;  4EQP A;  1PYW D;  2F0H A;  2QIL A;  4NW2 A;  4BA2 I;  1OXT A;  3TZD A;  2EJM A;  4F8M A;  1WTV A;  3W3A A;  4KKT A;  1HTL D;  2B8G A;  2KEE A;  1JCK B;  3MA2 B;  1MSG A;  3QG1 A;  5ELC A;  1GUN A;  1SXT A;  4TQU S;  2A6H D;  3D8G A;  3DWA A;  2XSC A;  1PZI D;  1FR3 A;  1K8O A;  4KJO A;  3I4L A;  3BVG A;  3ERO A;  1BO0 A;  2KQ3 A;  2EDG A;  1PFM A;  2NB0 A;  2DN8 A;  4RKL A;  3D31 A;  1PTO H;  4WJW A;  1MGS A;  4L8J A;  4F7X A;  2N55 A;  4A3B B;  3C2P A;  3MFG A;  3IL8 A;  1V1P A;  3NPP A;  5EKK A;  4PNY A;  2L12 A;  1Z6H A;  1JQY D;  4TKO B;  2AUK A;  4FXG C;  1STN A;  2IW3 A;  1DD2 A;  4JBW A;  1RKN A;  3C1F A;  1TVX A;  3BDL A;  4DAP A;  3NP8 A;  3HZX A;  2D62 A;  3K0Y A;  2JEA I;  3OHX C;  1A15 A;  3Q22 A;  2F0F A;  2MUY A;  2F0E A;  1BF4 A;  3S9W A;  5C4H A;  2L11 A;  1B2T A;  1G8Z D;  4AYB B;  2RDH A;  1RD9 D;  5JEA H;  1JOQ A;  1SNP A;  1EQV A;  1SJH D;  4ZKB B;  4HCE A;  1LTB D;  2EVB A;  4C1N K;  3EVQ A;  1D1K A;  1A3U A;  2EYJ A;  1F9S A;  3EJI A;  2XVS A;  4ZUI A;  4F87 A;  5C3X A;  1TWH B;  1DOM A;  1BUV T;  2PPB C;  3K5O A;  1GXD C;  1Z47 A;  5CGK A;  3OIQ A;  4JK1 C;  2RKS A;  1PZK D;  3V05 A;  5JPN C;  1LAB A;  2QEJ C;  1AZP A;  2PNR C;  1B9M A;  4E6I A;  1S5E D;  2MPM A;  2E2H B;  4J1M A;  2WAQ B;  1R4P B;  5C6A A;  3AMU A;  3C3L A;  4DU9 A;  3CRK C;  4PQX A;  1RTN A;  5ELE A;  3GTM B;  2CVR A;  3TDQ A;  3R3O A;  3T16 A;  1K8M A;  1LV9 A;  4XQN A;  1AN8 A;  1TT2 A;  4RFB A;  1JOK A;  3HS0 C;  1HCZ A;  2NTS A;  2B8F A;  2L1B A;  4ZRZ A;  3GTK B;  1TKW B;  3C46 A;  2ZXP A;  2KA7 A;  1E2W A;  4UAI A;  5E3F A;  3GV3 A;  3MHB A;  4L6T B;  4ZYS A;  1TY2 A;  4HAE A;  3A8I E;  4GZY C;  3KK7 A;  3BZD B;  2ZXR A;  2Z1C A;  2B2V A;  2NN6 I;  1H9K A;  3DWQ A;  1SSO A;  2RDF A;  2JEB I;  4BA1 I;  2X69 A;  1EWH A;  3GD7 A;  3VR4 A;  4BY7 B;  3HKZ B;  3A8K E;  5IGD A;  1KAA A;  1PTO D;  3TBI B;  2K33 A;  4EQN A;  1SND A;  2LY7 A;  3CRL C;  1CFM A;  2AQ1 B;  2JA8 B;  3WDN A;  2AQ2 B;  2BDO A;  1GUW A;  1HPC A;  4FF4 A;  2B2W A;  2Q8R E;  1STG A;  2DNC A;  2F0O A;  5IGF A;  3NTK A;  1PTO B;  1T5X D;  2MHV A;  2R7Z B;  2OT2 A;  1JOR A;  1RJT A;  1HA6 A;  4B08 A;  3DMU A;  3QIA A;  1H9S B;  1DCZ A;  5FO7 B;  1A3V A;  2F0K A;  2EOT A;  2RSN A;  4DF7 A;  4H7B A;  1J9O A;  1PZJ D;  3NXW A;  2N88 A;  2IX1 A;  1KDA A;  4H13 C;  2HDM A;  4HCS A;  2L0C A;  1TII D;  1FD7 D;  1STB A;  2EYF A;  4U68 A;  4FXD A;  2IJ0 A;  4H0L C;  4CJ1 B;  2FMM A;  2EYM A;  3HEJ A;  2K7V A;  1E2Z A;  3PIO 3;  3N52 A;  1LT6 D;  1YNJ C;  2FHT A;  2O2L D;  5EPK A;  3VR6 A;  3KUP A;  5G3L F;  4ZK9 B;  2YU9 B;  2B2V C;  2IWH A;  4ABN A;  5M9O A;  1Q3L A;  2K28 A;  1STH A;  5FLX E;  2CW0 C;  4I7Z C;  2HCI A;  1U4P A;  4G7O C;  3MFY A;  3J7A V;  1R9T B;  1UNS A;  3PO3 B;  3ERQ A;  5D3D A;  2PYK A;  2WIN B;  4KD4 A;  3R8B A;  5CV8 A;  5JOB A;  1BR9 A;  3OMG A;  4ILW A;  3S1R B;  5TSS A;  2B2W C;  5COR A;  4A3D B;  4C3H G;  1CHQ D;  4KY6 A;  2GA4 B;  3R93 A;  5D3I B;  5C3E B;  2A6E C;  4CHT B;  2KCC A;  5CC4 A;  2A5H A;  3K59 A;  1QJO A;  2RBM A;  4OIJ A;  4CBV A;  3T53 B;  4MHE A;  5T1G A;  4A3F B;  1DON A;  2JA5 B;  1LTA D;  1I4R A;  5EPL A;  1M8A A;  1CI3 M;  4LK1 C;  5J39 A;  1UUP A;  3S15 B;  4DGZ A;  1XWE A;  2FMC A;  1AW7 A;  1GHJ A;  4P2C B;  2QCP X;  1GHK A;  1NSN S;  3X3N A;  1EIH A;  5JVG 3;  2NVX B;  5K36 H;  1AZQ A;  3M7N A;  1DJR D;  4FXK C;  5EKL A;  5COY A;  3GQB A;  1GUG A;  4KKU A;  3TP5 A;  1T5E A;  3OOC A;  3TP7 A;  1L0X B;  5A35 A;  3SVM A;  4K2L A;  1Q1E A;  5EPJ A;  2JE6 I;  3EA6 A;  1CTM A;  2SNS A;  4R8N A;  4DXF A;  1U9R A;  5CV6 A;  3ZYY X;  4A3G B;  1SE2 A;  1QIL A;  4IUR A;  4RCO A;  1TS5 A;  3EQL C;  1B50 A;  3BVM A;  2B2T C;  2IL8 A;  2VXW A;  1M4V A;  1ZEQ X;  4H44 C;  3E6Z X;  1SMY C;  4FF3 A;  3I73 A;  5C0X J;  1SFO B;  1TU2 B;  1S5D D;  2EY1 A;  1G2T A;  5M5Y B;  3H91 A;  2PQE A;  2K32 A;  2FIN B;  5IOC A;  3NBH A;  4CJ2 C;  1Y69 U;  5HUR A;  5BN4 A;  2AUJ D;  2RA4 A;  1DOK A;  2KEC A;  3HOY B;  2F0P A;  2OXP A;  4OIK A;  5KNC A;  4C2M B;  2F3W A;  1WTO A;  3SK4 A;  1CA6 A;  2M9V A;  2HQE A;  3MTS A;  5IGC A;  5NUC A;  5I4D A;  1TQO A;  4XXE A;  5M5W B;  3Q6S A;  4V19 0;  4XTC S;  2NBF A;  1LTS D;  1FNU A;  4HMJ A;  1ILP A;  4DK1 A;  3K7A B;  3MC0 B;  3OW7 A;  3I70 A;  1V43 A;  3OMC A;  2EE1 A;  2A68 C;  1HTP A;  3MVV A;  1D5Z C;  1Q1B A;  2WAC A;  1DZ1 A;  3BYY B;  1NR4 A;  2ENB A;  3V2T A;  3KLS A;  1W6J A;  2JXM B;  4DNT B;  5IOD A;  3MEH A;  4IUQ A;  3RUZ A;  1A3T A;  2K01 A;  4C3J G;  1QB5 D;  4X3S A;  1QCB D;  2E74 C;  1HUM A;  2R61 A;  2ZT9 C;  1PLF A;  1SYE A;  5FKA C;  4CGY B;  1F2L A;  3AU7 A;  4RH6 A;  2KJX A;  4KY7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...