1GHJA

Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from azotobacter vineland ii, nmr, minimized average structure
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
79
structure length
79
Chain Sequence
AIDIKAPTFPESIADGTVATWHKKPGEAVKRDELIVDIETDKVVMEVLAEADGVIAEIVKNEGDTVLSGELLGKLTEGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E2, THE DIHYDROLIPOAMIDE SUCCINYLTRANSFERASE COMPONENT OF 2-
publication title Solution structure of the lipoyl domain of the 2-oxoglutarate dehydrogenase complex from Azotobacter vinelandii.
pubmed doi rcsb
source organism Azotobacter vinelandii
molecule tags Acyltransferase
total genus 7
structure length 79
sequence length 79
ec nomenclature ec 2.3.1.61: Dihydrolipoyllysine-residue succinyltransferase.
pdb deposition date 1996-01-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ghjA00
3GQBA 3FMCA 1O78A 2DNEA 4KN7C 2L5TA 1B9MA 1OXSC 3CRKC 1PMRA 1H9KA 1IW7D 3QG1A 2A68C 1O7LA 1TKWB 3PUXA 1OXVA 1H9RA 2DNCA 1B9NA 3QJYA 3M85A 1K8OA 1HQMC 1FR3A 3A8IE 1V43A 4OO1H 4GZYC 5K36G 2A69D 1A6XA 1EWHA 1GUNA 2D2CC 4H13C 4JBWA 4BA1I 5KNDA 2YYZA 1SMYC 4RCNA 3KLRA 1ZKOA 3L7ZC 2KA7A 4DNRB 1Q1EA 3M4YA 2EJMA 3PUYA 1CFMA 1YNJC 2NN6G 1VCIA 2E74C 4BA2I 3VR2A 2D5DA 3U9SA 4IFDG 2QF7A 5KNBA 2DN8A 2E75C 1H9SA 3A8JE 2K7VA 3D4RA 3P20A 2Q8IB 3SDZA 3T56B 4XTCS 4I7ZC 1DXMA 3QIAA 1CI3M 5KNCA 2BDOA 2A6HD 3HGBA 1HTPA 1Q1BA 2A6ED 5C0XG 1Y8NB 4DK1A 2BA0A 3D31A 3I73A 1Z6HA 3PUZA 1QJOA 5JEAH 1FYCA 2IT1A 2EJFC 4H44C 4G7ZC 1GJXA 2JEAI 2EDGA 1Q12A 4L8JA 3ND9A 3RLFA 2R6GA 1H9SB 1K8MA 3EQLC 1IW7C 1GUGA 3VR5A 2PNRC 4G7OC 2JE6I 1GHKA 1HPCA 3AB9A 1E2VA 2O5IC 3H94A 3MXUA 5A35A 4H0LC 2B8GA 4DNTB 2EVBA 4KKTA 3T51B 4OO1G 3NE5B 4TKOB 2JXMB 3DXJC 3M7NA 2ZT9C 3T53B 3CRLC 2BA1A 4HR7B 3A7AB 3W3AA 1ZYRC 2BE5C 1H9MA 4KKSA 1G291 2LMCB 3LNNA 3ND8A 1ONLA 2PCFB 4KKUA 3TZUA 1LACA 2AUJD 4LJZC 1I6VC 4XIGS 4JK1C 3BG3A 1IYVA 1DD2A 2B8FA 3MFYA 1H9JA 1VF5C 1Y69U 3WDNA 3OPOA 1OXXK 1CTMA 1HCZA 3BDOA 2AWOA 2A68D 3A8KE 2D62A 2K32A 2CW0C 3LWUA 3VR3A 4DK0A 3IFTA 2O5JC 1Y8OB 1IYUA 2A6HC 4G7HC 5K36H 2A6EC 3OW7A 1GUSA 4KHZA 3N6RA 4KMUC 4PV1C 1Q90A 1LABA 1E2WA 3PUWA 5JEAG 3PUVA 2PPBC 2A69C 2NN6I 3A7LA 4IQZA 1TU2B 1T5EA 4KI0A 2F1MA 4KN4C 1GUOA 2AUKA 3VR6A 3VA7A 2EJGC 1DCZA 2JEBI 1V8QA 1VDZA 3SE0A 2NN6H 3PV0A 1GHJA 1OXUA 1GUTA 3FPPA 5BN4A 1YNNC 1Y8PB 2KCCA 3I4LA 3VR4A 2E76C 4IFDH 4LK1C 1OXTA 3GD7A 4TQUS 2V4DA 2BE5D 1Z7TA 3OOCA 1E2ZA 3I72A 2K33A 3IKJA 1VF7A 5BN5A 4OGQC 5BN3A 1BDOA 5C0XH
chains in the Genus database with same CATH superfamily
4X62L 1DONA 2K5VA 4DR3L 2I5MX 1KDAA 1ILQA 2DNEA 4IPDA 5CYUA 4KLKA 1MI2A 4ZLTF 1S72A 3I70A 1DGSA 2PQAB 2QEXA 1KQSA 4JI8Q 2M9VA 3GTOH 1EY9A 3C3LA 3QJYA 4L6TB 3T1YQ 1PTOC 5DM63 3EFXD 1VMCA 3J81i 4BA1I 4IO9A 4R1JA 3QWNA 1ZKOA 3CMAA 2F3VA 1X32A 2B2TC 4A3FB 4OIKA 1SE2A 4A3CG 4R4QA 3NTIA 1C0AA 1D5ZC 4NXNQ 3J7AV 4GOPB 1XTCD 3HOYG 1KHIA 2ALYB 3QIAA 1MJEA 4UAIA 4ZAIA 4HJ5A 2Q8RE 2E8GA 1A2TA 2M00A 1GM5A 4F8MA 1CKNA 1RIPA 3TRZA 5D3IB 3GTOB 1YJWA 1G8ZD 1SE4A 1CHPD 4J6HA 4TKOB 2QILA 1RL2A 3I56A 3M7NA 2WAQG 3ERQA 4ZK9B 2JA6G 1QZGA 2NZHA 3O13A 5IGCA 1M8AA 2C5CA 1SYCA 4NXML 4XIGS 5CV8A 3H6MA 3OSOA 3BS1A 3CCUA 4BXXG 3WDNA 3MC0B 4JI4Q 4IUQA 1EIHA 4LAAA 2AWOA 1L1OC 2FMCA 5EAYA 3SK8A 1XNQQ 3J80L 4LF7L 1T9HA 2UUAQ 1PZKD 4X65L 3STBD 4KHZA 1WTQA 1HHVA 1YHQA 1A3VA 2Q2IA 1PTOF 4RWSC 4DV2Q 4JI7Q 4IQZA 3VA7A 2WAQB 1CQFA 1WFQA 2JA6B 1AP0A 2NVTB 2WINB 5E4WC 4JI0Q 2P5ZX 2PZWA 2X69A 2K5QA 3C1EA 1ML0D 1XPOA 2NN6H 2B2WC 1AEXA 1GUTA 4RGTA 1QNKA 2RDGA 1GD7A 4CJ0B 1UWVA 3CC2A 1O7ZA 2V4DA 1K8GA 4IFDJ 1ICWA 4X6AH 3QR8A 1L0YB 2EOTA 3TQYA 5IT9L 4GOPC 2XVSA 2NTTA 4RAUC 4GKJQ 4ZKCB 3Q0AA 1BKBA 1HRJA 4LFCL 1YHAA 1VQ5A 5H1SE 5GAHC 3BVGA 1XMQQ 3R2IA 1LTGD 3K5MA 3T16A 2YU9B 4IPCA 1V1PB 1SNOA 2JQOA 4HTHA 1UE7A 3CC4A 4B3SL 5JPMC 3HKZG 4A3IG 2RKSA 1VQMA 3HG9A 4PNYA 4A3LG 4LFBQ 3M4YA 4LF4L 3K6OA 1MHWC 4DK6C 2K01A 3ZYYX 5FO8B 2VQFQ 1VQPA 1X3FA 4HJAA 2DN8A 2PI2E 3H3VC 2LXJA 2F3WA 2A6HD 2O4XA 2Z4HA 1K83H 1Q1BA 3G48A 1I4RA 5IODA 4A3DH 4QIWE 1Z6HA 4KV6A 2IX0A 5KEEA 4JI5Q 4L8JA 3HKZB 2F0TA 1YI2A 1Q81C 1GHKA 1WCMG 1IBLQ 1E2VA 1SFOB 3AEVA 2PMZB 5NUCA 2B8GA 1SRUA 3S1QH 4PZ7A 1B4OA 1HZBA 4OO1G 4C3JG 3TDQA 2R93G 4LF8L 1CKOA 1IZ6A 3IAYA 1NAPA 1CHQD 5IGBA 5A2QE 2H5XA 1VQKA 2NVQH 3BDCA 4JOIA 4X66L 3P7JA 5JOBA 1N36Q 4Y7NB 3K5LA 3U50C 2CW0C 4OXPA 1WCMB 1SR3A 1GUSA 4A3DB 2LSSA 1IXRA 4E6IA 4HIKA 4A3JG 3NXWA 4FF4A 4C3JB 1TU2B 4K14A 2LS01 1BCPD 2OQ0A 4RHRA 2R93B 5CGKA 2NUCA 3ULPA 1LT6D 3PO2G 3R93A 3NTHA 4POFA 2IPKD 3S1QB 2I0QA 5C0XI 5ELCA 4YCVA 3OOCA 3GTLH 4A93G 1A3UA 1SE3A 3S24A 3HP3A 2K5DA 4ODGA 3J81L 3KJPA 2BDNA 4IPHA 1PRTB 1Q46A 3GP7A 1F2ZA 4DR1L 3AU7A 4OONA 1SJHD 2NVQB 3S1MH 3RNUA 1TKWB 1Y1WG 4X64Q 1IYJB 2A73B 3FVQA 2EXZA 1HQMC 2N3SA 3MA2B 3A8IE 4DV7Q 1WTRA 4DV3L 1RHPA 1PFNA 2D2CC 1O7IA 3E3XA 4A93B 1P8LA 4JI6L 1KABA 2KCNA 4RKBA 3R8BA 1VQNA 3MXPA 1HNWL 1BVSA 3A56A 3A8JE 2OXPA 3M4OH 3TP8A 3EJIA 4C56C 4A3EH 2IJ0A 3GTLB 3S16H 5KNCA 1QB5D 3F2BA 4DK1A 3VYSA 4MTKA 4CJ2C 3AFPA 2OCEA 1ENAA 3E5SA 5T1IA 2NB0A 4G7ZC 4H44C 1Q12A 1I3QB 3EQLC 2WB1G 4APVA 5JJLA 4CHTB 3S1MB 4JI2L 1HPCA 1MD2D 1XMOL 2L55A 2X6GA 4H0LC 5CV7A 2AQ1B 3S1RH 3UE1A 4LF9Q 5FJ8G 4YY3L 2V1CC 3HS0C 3QOJA 2MPMA 4ID6A 2Q2HA 4HJ9A 1FD7D 1EYGA 3CPFA 1RJTA 1I4XA 4KKSA 3UDFA 1EYDA 1G291 3ND8A 5IP9G 5JPNC 3MHBA 3JAMi 3Q8DA 2WV6D 3U4VA 1GO3E 2LY7A 3A5ZB 3MXNB 4AQYL 1PRTC 4JYAL 1EFID 1QE6A 3M3YH 2SNSA 3DHQA 3M4OB 2DGYA 1SNMA 2WB1B 5C5LA 2UUCL 2N55A 3S16B 4KHPQ 3G4SA 4RG1A 5I2YA 4BY7G 1LYLA 3N6RA 5I9PA 2MJ8A 1PZJD 1Q90A 2F4VL 4YCUA 5JEAG 1HJPA 1XXGA 2A69C 2NN6I 1YVCA 2C35B 2QKIC 4KN4C 1DOMA 4RGNA 1KC8C 2MFIA 2VZAA 4ZUIA 3HOUH 1IL2A 3HEJA 3TMEA 4FO2A 3X3MA 3RZDB 5HY6A 1IBKL 2JA5G 1PVOA 1K0SA 3E9HA 2FXQA 4B9WA 4RMFA 3S1RB 1KL9A 1AN8A 2RA4A 2B2VA 4NXMQ 1IL8A 1EY6A 2R7DA 4BBRG 4KJOA 4AH6A 1B44D 3WOFA 3KDFB 3GQBA 4BY1G 4QIWB 1RODA 5JJZA 4LF7Q 1Z9FA 1LTRD 1JQYD 4BY7B 3CW2C 2KECA 1OXSC 4LUOA 4X65Q 5IWAQ 1QCBD 3BU2A 3CCRA 3M3YB 4C3HH 1W6KA 3I4MG 3NELA 1F9RA 1FR3A 5FOBB 4GKKQ 1WTWA 3MZ5A 3PO3G 5EGTA 4KD3A 1MGSA 3WOEA 5IYBH 3TEHB 3HZXA 1PH5A 3F8TA 4Q0FA 2EZVA 3DEPA 3NUCA 1HFNA 3K0YA 4WJWA 5EKLA 4K2LA 3HOUB 2L1BA 3NENA 1DOKA 4BY1B 4NXNL 3OW2A 4QMGA 2E74C 4HJ7A 2UXCQ 2AMCB 5E7NA 4LFCQ 5M3FH 4I7ZC 1D6EC 1GUWA 1Q8IA 1R4QB 2B2YA 3I4MB 1PRTF 3ONAB 1SMXA 2NZ1D 1PYSB 3VDYA 3I73A 3PUZA 3X3NA 1GJXA 3PO3B 2L0CA 1C4QA 1S5ED 3FP9A 4C3IG 4DV1L 5EQ0A 4G7OC 2JE6I 1VQHA 1ICFB 1PZID 5IP7G 4C3HB 3HRZC 2EYHA 5C3EG 1STAA 5C4XH 4BBSH 1STGA 4LUVA 1X3GA 4YWMA 1E7ZA 1HA5A 1WD0A 2EYLA 2ZJRA 4DR7Q 4EVOA 3I4NG 3LNNA 3MXGA 4IUTA 5I6WA 2PCFB 4KKUA 1B3AA 1NNXA 4LJZC 4QJFA 1I6VC 2XN9C 1J5EL 1HR0Q 1XNQL 2K03A 5FLMG 1VQ9A 4M1UB 2UUAL 5F2DA 4CJ1B 3IFTA 2KCMA 4WRDA 3HOVG 1ESFA 5K36H 3A74A 4CKCA 5C3EB 4DV2L 4EQNA 5DAUA 2L11A 1EY0A 1F9PA 5CC4A 4K0KL 5ELDA 1BBXC 2PQEA 5M5XH 4XQJA 3I4NB 1TWHH 3PV0A 2CWAA 4DAPA 1GHJA 2KCCA 2ZTEA 4BBSB 4IFDH 4LK1C 4XT3B 1Y14B 5IY0A 1EQTA 1KAWA 2EY2A 4NP5A 4GN5A 2RSOA 4X66Q 3HOVB 1O78A 1NY4A 2ATWA 2VUMG 3EA6A 1XMQL 4JC0A 4R4TA 3GTMB 1EYAA 2A68C 1PHJA 1F2YA 2JA8H 1K8OA 1MJCA 1I4GA 1A63A 2OT2A 3T1HQ 1YJ9A 1SYEA 3DWQA 4A3GG 2JSOA 2YYZA 3U9OA 4RGOS 4LFBL 2QDBA 5C4ZA 4B3ML 3DUZA 2MHVA 3H0GG 4ILWA 1MIUA 3NBHB 2JA7G 3L0OA 1N8RC 3K0XA 2B63H 2EYJA 2F0UA 1LTBD 2VUMB 2K50A 3OWFA 4X3UA 1L0WA 1BNZA 1OTCA 4DV5L 2F0LA 4JI5L 3PMFA 3AMUA 2WKDA 5ELNA 3AFQA 1QUQA 1IBLL 3MWYW 2B2TA 3AYHB 5JVG3 1H9SB 4DV3Q 1PTOD 5IGEA 3JAML 3J80c 1I5FA 1SXTA 2XIWA 3H94A 5HURA 2JA8B 2JA7B 1AFPA 2CWPA 1Q8KA 4JI6Q 4AIMA 1XJVA 3QOLA 1ENFA 1HNWQ 4L5SA 2N88A 5GQOA 2ZXRA 4DV6Q 3NSWA 2AQ3B 1EU4A 1DM0B 4HEDA 2CQAA 1H9JA 1Y1VH 2B63B 4RH6A 2KBNA 3A8KE 2GVBA 3SK4A 1PH8A 1U9RA 2XRQD 4PZ6A 3KBGA 3VR3A 2K28A 4DN4M 1U4LA 5IT9c 1N34Q 5M9OA 1E0BA 2PPBC 1X3PA 4KI0A 2X6LA 3BYTB 5EBCA 2FJ2A 2E5LL 1O7YA 3P75A 1L1OA 3I91A 2MNAA 1K73C 2PZUA 5CV5A 3HOWG 2E2IH 2K33A 2FHTA 4JYAQ 3FMCA 4JV5L 4R4IA 4O2DA 1C9OA 3E0EA 1TT2A 4DFAA 3S14H 1EQVA 2Z9HA 4X64L 4YWKA 1X6OA 1SDFA 5FO7B 3PF5A 3S1NB 4C1NK 3A55A 3M85A 1WYDA 4TRDA 3FDTA 4TVAB 2JP1A 2R92G 5GADC 1IKMA 1J6QA 1LTSD 5C44H 4KY5A 1D5XC 1Q1EA 4A3FG 1A2UA 1I4QA 3TN2A 1TWGH 4K6DA 1CFMA 1CKMA 1VCIA 1JJCB 1S5DD 3U9SA 5IYDG 2Q8IB 3TP6A 1NR4A 3G71A 1PDQA 5FLXL 3TS2A 2OQKA 2BDOA 4UDUC 3HGBA 2RBMA 5C0XG 3MEHA 4J8QA 4K5XA 3OIPA 4O0AA 3S14B 2R92B 1QZHA 3L2PA 4FF3A 2R6GA 3KF8B 1GUGA 1TWAB 4PG3A 5C6AA 1EUJA 4EX5A 2E2HH 4LF9L 2R7ZH 1YNND 4CDEC 3R3OA 1CSQA 3D4WA 3JC66 2A1AA 1X9NA 2CVRA 1G6PA 1VMPA 4QF4A 1XWEA 3HOXH 1SNDA 3W5OA 5LHY1 4N9PA 3HOZH 4P71A 3SGIA 2UU9Q 3BG3A 4LUZA 1TWGB 3CAMA 1WJJA 3Q6SA 1B50A 2VL6A 2D62A 5CV6A 3NBIA 4KHPL 2J7ZA 3G6JB 4DK0A 4UHVA 5ELFA 4DV1Q 1U4RA 4A3KH 3FHWA 3J81c 3OMCA 5HGQA 3A7LA 4M8AA 4UP7A 1HNZQ 4IFDI 3S17H 1JICA 3PSIA 1L2FA 1WTVA 1B70B 2R7ZB 5KYLA 4O1NA 5CBAE 3VYRA 1Z7TA 1J5EQ 3BZKA 1PLFA 2JK8A 1TWCH 3RN2A 3HOXB 1V1PA 3MFGA 1SROA 2OWOA 1EZ6A 2EE1A 3HOZB 2EYPA 4LF6Q 4NB3A 2NZOA 2HQEA 2HIXA 5IWAL 5LMNQ 1JWUD 1EIYB 4YHHL 2CW0D 1AW7A 1HUMA 5M5WH 1H95A 1HR0W 1F77A 2DNCA 4GKKL 4K0KQ 1EOVA 1L0XB 2YTYA 1TY0A 3GTGH 4RFBA 1YBYA 2G5DA 1A6XA 2KJXA 4ZRZA 2IHEA 1A8VA 3VYTA 1PH4A 2Z0SA 2BH2A 2K75A 4DNRB 3S17B 2UXCL 1D2BA 2NN6G 1Q7YC 4U68A 4YWLA 1FNWA 3CQZH 1B3QA 3J7AF 1CKNB 4J1MA 5HGTA 3CHBD 3IL8A 3CC7A 1B53A 4ME5A 1EY7A 1X55A 2RHQB 3W2DA 5E3FA 2IWHA 1NCVA 2Z6KC 3NWTA 4HCEA 1YIJA 2KOLA 1AZPA 1KLUD 2F0VA 1UEAB 2K5NA 4CGYB 5IGFA 4GNXA 4C2MH 5M5WB 1U4PA 1ZEQX 2BOSA 1QOHA 1G91A 4B3MQ 4G4KA 3FPUB 5EPKA 4EGVA 4A3IH 3NE5B 1AZQA 3GTGB 4DR7L 1LT3D 1VQJA 2IX3A 2QA4A 2G9DA 1HR0L 3DM1A 4CDCC 3J81j 2XSCA 5D3DA 2AUJD 1LLRD 4I7AA 1Y69U 1VQ4A 5EBDA 4DGZA 1JMCA 1HTLD 4DV5Q 1TS4A 3CQZB 2D0OA 3I3CA 3H09A 4JG2A 4DA2A 2TMPA 1VQFA 1HUNA 4HCSA 3J80E 3KK7A 1XPRA 4KMUC 4A3DG 4DU9A 1LABA 3PUWA 4LFAQ 4OWXB 1UAPA 1TVXA 1PYWD 1K28A 3EROA 2JEBI 4B3TQ 2K05A 3P1HA 5I2XA 3BYYB 3CD6A 1OXTA 2I5LX 2B39A 2F03A 2FFKB 1ENCA 3PF4A 1PH6A 1W3SA 1W6JA 1PRTD 5IT9E 1K83B 4NKLA 1S5BD 4OHJA 3K7UC 4DPGA 4V190 3T1HL 3PUXA 1OXVA 4DXGA 4HJ8A 4L5QA 4OEMB 1XNRL 3I8ZA 1JWMD 2A69D 4NDXA 2ZXPA 4H13C 3STBC 2E5LQ 1I94L 1GKHA 5E1FA 1I4PA 3L7ZC 3RZOH 2EJMA 3F2CA 4CBVA 1G2TA 3PUYA 2PO4A 3CCVA 1SNCA 1VQBA 4DR6Q 3OMGA 2F0HA 3LWEA 4JV5Q 5KIXA 4P72A 3ERSX 2EY1A 3IFDA 5EPLA 4ZCKA 3E9IA 4PMBA 1UE6A 3NP8A 4QY7A 3L3OC 2GN5A 2LXKA 2O2LD 4L5TA 2XRSD 3AB9A 3F1ZA 4WJ3M 2F0PA 4PZ8A 3Q23A 3FKIH 1EWCA 4ZUJA 3BJUA 2ICEC 1EOTA 2EVBA 1WI5A 3T51B 1LO5D 3SXHA 4DV6L 3MVVA 1MKHA 2KEDA 2NYZD 3OTOQ 2ZT9C 2HCIA 1BCPB 1X56A 3RZOB 1AE3A 1JOOA 2HIVA 3MFYA 3F2DA 4JI1Q 4HMJA 2K04A 1N34L 4A3EG 3LWUA 5JVH3 2N78A 4L63B 2A6HC 3PCOB 3DWAA 1TWFH 1KD1C 4XYOA 1S40A 3FPPA 3FKIB 1YJNA 3PGZA 4DUZL 3I72A 4OIJA 3T13A 5CR3A 3D8GA 4A3EB 4A3BH 2JYOA 5TSSA 3J81E 2A19A 2F0FA 1IW7D 2F0NA 4FNFA 4F88A 1NTGA 4FVMA 2NBFA 5CV9A 4H7BA 1V43A 2F0DA 4ULLA 3S2HH 1EWHA 4LWCA 5EJWA 2RDHA 3H15A 1TS5A 3CF5A 3FRPB 4JOIC 4DR5L 1K3BC 5IE8A 1BCPC 4U673 5GROA 3HOUG 1TWFB 3JAMc 3CKIB 1YNJC 5FO9B 1YZ6A 2HHHQ 2AWNA 2R3ZA 3OIQA 4JI3L 5KNBA 1E24A 1X3QA 2SOBA 1R4PB 4MIUA 3S15H 3KFUA 4YHHQ 2A6ED 2IL8A 2BA0A 1ILPA 2BH8A 2EJFC 3CPWA 4P75A 5JAVA 3VR5A 3KF6A 1B1ZA 4C3HG 5A35A 1D1KA 3GTPH 4PQXA 5LMNW 3K7AH 4KKTA 2N8NA 2BA1A 5IYBG 1ASYA 2UU9L 1W2BA 1QVGA 5EPJA 3CU7A 3PQIA 4R9WA 2F0GA 3LX0A 2XTIA 4K2KA 4R4OA 4BWGB 1XYIA 4FF1A 2L15A 2K32A 5M3FG 3D6CA 4OX9L 5IIFA 4UP8A 1I6HH 1PFMA 2OF1A 2B3GA 1HNZL 4HSPA 2ENBA 3PUVA 2D0PA 3ER0A 3TP5A 1HA6A 5KRUA 1EQRA 1HZCA 2EJGC 1DCZA 4CDDC 4DAYA 3U58A 3GTPB 5C4XG 1QWYA 3U4ZA 5BN4A 4BBSG 1DJRD 2NTSA 3K7AB 1N33Q 1Q82C 1BCPF 1E2ZA 1V1OA 3S2DH 1R9TH 5BR8L 1KNAA 1UE1A 5M3FB 1RF2D 1EFWA 1PH1A 4LF6L 5LMNL 2Y0SE 1TIID 2MGSA 4JBJA 3KLSX 1TQOA 4A3MH 4GLAC 2UXBQ 1VQIA 3UDGA 3KLWA 1YEZA 1VQCA 2ZJPA 3QG1A 3NQIA 4YIJA 1LTLA 4IZ8A 1LTTD 3KYHC 3N52A 2XWJB 5IGGA 1B9NA 1AE2A 3A0JA 1I50H 2SDFA 5FLXc 1BBUA 4GZYC 5K36G 1I6HB 1GUNA 5C4XB 2JN4A 2WIIB 1SMYC 4BS9A 3KLRA 1VQLA 1E1TA 1VQ7A 1S4ZA 1NUCA 3KLSA 2RCNA 3K5OA 1KXLA 4DNIA 2F52A 4OL7A 1FJGQ 4DXFA 2ZXOA 2K5HA 4UY8C 1J9OA 1X3EA 4N8FA 4LNQA 5ELBA 5LL6X 2D5DA 2E2JH 4IFDG 1H9SA 3OYYA 1F9QA 2DJFC 2OEOA 4XTCS 1NE3A 1DXMA 3S2DB 1JT8A 2SEBD 1CI3M 1WTHA 3I2ZA 2NVXH 4FF2A 3D31A 1STHA 2MUYA 1NMGA 2L4NA 3V96A 1KDCA 1XNRQ 5IYCH 3NHHA 3ND9A 5M3MH 4MTNA 1XTDA 1I94Q 2JA8G 5M5XB 2O5IC 1PA6A 2Z8LA 1I50B 3RLNA 1EZ8A 2I07B 5J3BA 3GTKH 1TWHB 1JOKA 1VQOA 1FGBD 4P2CB 4HR7B 4GLXA 4AYBE 2WACA 2ZTDA 1EY4A 1JE4A 4HMIA 5KYIA 1IYVA 3TBIB 1DD2A 1VF5C 1CA5A 2B63G 1HCZA 1YITA 5GAGC 4B3RL 1N32L 4DK3C 4G7HC 4LFAL 2NVXB 1PTOH 4B3TL 1KIXA 1JR0D 3V05A 1SEBD 4K8JA 1QG7A 1V8QA 4FP5D 4LMQD 1FL0A 1LV9A 3VR4A 3DM3A 4TQUS 1Z47A 1SN8A 2KHSA 3IKJA 2WAQE 1M1KC 5AJ3L 4IJLA 3EN2A 1U4MA 1TXYA 2QW7A 3CRKC 1Y1VG 5J1ZA 3Q24A 3PIOA 2IHFA 2HQLA 1BO0A 4X3KA 1STBA 1SNQA 2PW7A 1PH3A 1EEID 1K0RA 2RQXA 4IPGA 4J15A 3C2PA 2RF4A 3T4AC 2PQAA 1D7QA 1HQRD 3CCQA 1K9MC 4DAVA 3D6WA 1PTOB 4DUZQ 4DR6L 4GN3B 4JCVE 4OWTB 3VA5A 4WJ4A 1M4VA 5G3LF 4DUYQ 1Q3LA 1QUQB 1Y1VB 2HCCA 3SVMA 3KOJA 1ESRA 2B2UC 1YNXA 2B2WA 1Y8NB 2A74C 2EYFA 2IX1A 1FYCA 2EY5A 5JEAJ 1CA6A 4GLVB 1NBWA 2EY6A 4GOPA 2F0MA 1U0LA 4CKBA 2ICIA 4DR5Q 2YTVA 1V1QA 3OTOL 3JAME 4NW2A 2PNHA 1BXTA 2KCTA 3GV6A 3W3AA 2BE5C 5C44G 1H9MA 4LF5Q 4XT1B 2Z6KA 2Y0SB 4QQBX 4JI3Q 2E2IB 3ZJYC 1STYA 3OHXC 4JI1L 4EQ5A 1BQQT 1LTAD 3OPOA 3C46A 4R8NA 3EBEA 2Z4IA 4ALPA 2E2DC 1PH7A 1Q86C 3CP0A 3I4OA 4IN3A 1X54A 1L1OB 4PV1C 3PIO3 3K58A 2IY5B 2PZTA 1EY8A 1B2TA 5C44B 4JVZA 2QDLA 4UPAA 4A3CH 5I4DA 3SEBA 5M5YH 2R7ZG 4ABNA 5CV4A 4AYBG 3GD7A 1XPUA 1IBML 4A75A 2J4XA 3HOYH 2F0QA 3NTKA 5BN5A 1EL0A 1NR2A 3NK9A 1LTID 3HOXG 1JE5A 4S3SA 1RD9D 2HD3A 3CCEA 4KHVA 2KENA 3H3VH 3HOZG 2WP8J 4KN7C 4CDFC 4ZQ3A 4OX9Q 2F0SA 4QL5A 1KRTA 3SHLA 1WOCA 1B7YB 1D5MC 2PYKA 4KJNA 4A3KG 4HIDA 2E2HB 4TSSA 3FEWX 5KNDA 1P16A 4JBWA 1JJGA 4AYBB 2L12A 2JA6H 2RDFA 2NVTH 3ICEA 2NVYH 2HHHL 5D65A 4BXXH 4KY7A 4I65A 5BR8Q 5M5YB 2KEEA 1YHBA 4Z9CB 2E75C 3D0FA 3CXCA 2MO0A 3NPPA 2R7FA 3HOYB 4DV0L 5FLXE 1QVFA 1F2LA 1RKNA 1QJOA 2DY8A 4A3KB 3DWPA 1CK1A 2FINB 2OTLA 1K8MA 3RN5A 2YU9H 3CCLA 2F3IA 4JW0A 3EIVA 1JB3A 1JC7A 2VY3A 1S5FD 3GDEA 2DY7A 3T53B 3CRLC 2ZM6L 1GOZA 1ZYRC 5A2QL 2LMCB 3ULLA 2K1BA 3TZUA 1TWCB 2NVYB 1J8IA 1G6ZA 2B8FA 2F0KA 2FMMA 2NWGA 2CH4A 2G9HD 1WTOA 1LT4D 1ASZA 4FXGC 3CCJA 3MAQA 4N9TA 1CUKA 3QB3A 4PMWA 1D1IA 1TS3A 1AH9A 1CQVA 2HDMA 4IURA 1ZXTA 1JJ2A 4K5VA 4DR4Q 2VW9A 4A3LH 4OELB 2F1MA 1GUOA 2AUKA 1BUVT 2LKVA 1SFOH 5CORA 1KTKA 2WB1E 1N33L 1VQ6A 4Y52H 1YNNC 1IHZA 2AHOB 2CCZA 3K59A 3B6YA 5JJKA 1HNXL 3UI2A 3RD4A 1BDOA 3DEOA 2UXBL 4ME3A 4DF7A 4KK7A 4B3RQ 1N32Q 1B9MA 4Y7NH 1PMRA 2PW5A 2MP1A 1WCMH 5FK9C 1CSPA 4ZKBB 3A54A 3E0JA 3OWEB 2AQ2B 4C2MB 4XYQA 4OO1H 1CM9A 4C3JH 1RDPD 4RCNA 2Q2TA 4IUNA 3ULJA 4A3IB 5LL6S 4R8IA 4Q5VA 2R93H 1IKLA 1FJGL 2J0TD 3CCMA 2VB3X 1I4HA 4LW1A 2UXDL 2XGTA 1SNPA 4P73A 5ELEA 4DR2Q 5AJ3Q 3K80C 3TZDA 4GNXB 4P74A 1FNUA 2VB2X 4XXEA 1GXDC 1EU3A 2TSSA 3NEMA 5IGDA 2C9OA 4A3JH 3CCSA 4QB4A 3BVZA 2KQ3A 1PFBA 1PFSA 2PNRC 3PO2H 3MXUA 4X3TA 4H02A 3GTJH 4DNTB 2N49A 2QEJC 1MBYA 5L37A 4A93H 3J7ZC 3M9BA 1YNJD 4MZ9A 4QGUA 1TY2A 1K3RA 1JWSD 1EWIA 3BDOA 2UUBL 5D14A 1VQAA 5AFWA 2F0WA 3W1GA 1Y1WH 2IW3A 4RGMA 4IJHA 1VS0A 1Y8OB 1EYCA 4WORA 1WD1A 1I3QH 1BBWA 3MXNA 1B8AA 5KGUA 1SYFA 2YTXA 4A3JB 5FKAC 1C7YA 3VR6A 2CQOA 2ID0A 5DM73 2VNUD 3MTSA 1VDZA 3PO2B 1S5CD 3FKIG 1OXUA 4V0BA 1Y8PB 2K4KA 3GTJB 3LGJA 4MN3A 2WFWA 1DZ1A 1UEBA 3GO5A 1O80A 4IUPA 3H3VI 1JORA 3H91A 4GNXC 3UDXA 2XWBB 5BN3A 4YCWA 4X3SA 5C0XJ 2EIFA 2QCPX 4B9XA 4X62Q 2JA9A 4DR3Q 3BDLA 4JBKA 2PI2A 1H9KA 1S3OA 2XNAC 4FXDA 3R2TA 2EYOA 1Y1WB 3KDFA 5C5MA 1HH2P 3S9WA 4HIMA 5FJ8H 3M4PA 2R61A 2CFMA 2B29A 1SYDA 2EYMA 1PH9A 3RZDH 1E22A 2KA7A 5IP9H 1A3TA 1QILA 4L5RC 5ELOA 1IBMQ 2KHJA 1HFGA 2F0EA 1NSNS 5C3XA 2ES2A 4DUYL 1VQGA 3J7A5 5LMUL 5J39A 2Z6BA 1M90C 3SDZA 1EQQA 4DV4L 2ZTCA 2K6AA 2CKZB 4POGA 4BY7H 3I55A 4A3BG 1A0IA 5JEAH 2IT1A 1ET9A 4ZYSA 4IALA 4IUUA 1QNUA 4QUCA 3M7GA 2JA5H 3SK6A 3G6EA 4FDBA 3C1FA 1LM0A 2DUDA 1SMYD 3DMUA 1BF4A 2VS1A 2VQEL 1HZ9A 2JXMB 1PYBA 2I5HA 3URYA 4LF5L 4BBRH 3TS0A 2A8VA 3DLLA 2ZJQA 1MSGA 4BY1H 1ONLA 1II3A 4HN7A 5EKKA 3F2UA 2WKCA 4A3BB 1G2SA 2A68D 4DV0Q 2BCOA 3CMEA 4QUFA 3I4MH 1EEFD 4KTAA 2O5JC 3D3RA 2L9HA 4JI8L 3OW7A 3PO3H 1E3PA 4N8X1 1CT1D 3T1YL 3K57A 5GAEC 3S2HB 4PMCA 3G7LA 2JA5B 2ZM6Q 1EIGA 1EY5A 3NWSA 4GN4B 4OWWB 2JJQA 3SK5A 3L9AX 1NJIC 4IOAA 5G3LD 1TR5A 1BOSA 4BBRB 1VF7A 5DLQE 2RSNA 5EKIA 3S15B 1VQDA 4NPSA 1C8CA 3A5UA 1SBBB 3GTQH 1RCVD 4C3IH 1A15A 2M2LA 1LT5D 1O7LA 2VXWA 4OO1I 5JJIA 5IP7H 3D4DA 1H9RA 5C3EH 3UDIA 3PIPA 1HXYD 4RHSA 1FGUA 1WTPA 4CKEA 4B3SQ 3I4NH 5DEHA 3W1BA 1K8AC 2OTJA 3K5NA 1BR9A 3K81C 1NMFA 1HNXQ 3HKSA 1QVCA 4LF4Q 1DOLA 5FLMH 4BA2I 4A76A 3D4RA 2K7VA 2GVAA 3KF6B 3HOVH 1CZGA 4IOCA 3NBHA 4JI4L 3V2TA 2K52A 2A5HA 3GTMH 4HSVA 4HIOA 2JEAI 4A3MG 1F9SA 1KAAA 1KLGD 3RLFA 3GTQB 4C3IB 1IW7C 1RTNA 1STNA 5C4HA 4JI7L 2F0OA 1TS2A 1UE5A 2SNMA 1STEA 4JI0L 1V9PA 2F0JA 2B2UA 3GV3A 2UXDQ 3A7AB 2LFNA 2RVLA 4JPBW 4WFN3 1JOQA 5C4JH 5I6YA 1ET6A 1R9TB 1SE8A 4LF8Q 3TREA 3I7FA 4JK1C 1WTXA 2H1EA 2VUMH 2H4OA 1F2MA 2CH4W 1OXXK 2I46A 4GKJL 4RA8A 4A3MB 4K6LA 2B2VC 2KUMA 2HDLA 2Z1CA 2YV5A 4DAYB 3SR1A 1UUPA 2A6EC 4K5WA 4A3GH 4DR4L 1D8LA 1RTOA 3RUZA 1XX8A 3KJOA 5ISRA 2ASBA 1T5EA 5IYCG 2KHIA 3H0GH 4XQQA 2JA7H 3AQQA 1CZWA 5M3MG 3PIP3 4K8IA 1SSOA 1UNSA 4IUVA 3J80i 3SE0A 1DYQA 4NMZA 1KNEA 3I4LA 2KVMA 1MSHA 2BE5D 3M4QA 3BZCA 1SYBA 4RCOA 2E2JB 2RCFA 4F87A 2VQFL 2UUBQ 1VQEA 2MQHA 5CMDA 5C4JB 2K5WA 4GS3A 4EQPA 2F0IA 2K14A 2L5TA 3NQTA 3ITPA 1EIFA 3UE0A 5K5PA 2Q2UA 3BZDB 4DR1Q 4RKLA 4EQOA 5I9OA 5M3MB 4XDXA 3RLOA 2MO1A 2B2YC 2RHSB 4A4IA 2Q8TA 1JCKB 4DAMA 1JB7A 1C48A 4A3GB 3TP7A 3GTKB 4F7XA 5T1GA 3H0GB 4FXKC 3TSSA 4MNOA 4C1NI 1FNVA 1SYGA 4DR2L 1PXUA 5IOCA 5COYA 3VR2A 4XQNA 2QF7A 3P20A 3T56B 4MHEA 4JBMA 5E4XA 4B08A 4O42A 2EQSA 1X65A 3IRBA 1HTPA 3K8AA 3RR5A 1N36L 3I90A 2EDGA 2EXDA 3S1NH 5CBEE 1PH2A 1PV4A 4QCLA 4KY6A 1HZAA 3E6ZX 1FVIA 2AKWB 2F4IA 3RMHA 5J22A 1U5KA 1T5XD 1A62A 1LUZA 4JI2Q 1XMOQ 3HOWH 1KRSA 2HT1A 5DNFA 3DXJC 2EPBA 5C3WA 3KF8A 4G57A 4YY3Q 5LMUQ 2Y0SG 1OO9B 1WVLA 3BVMA 3EVQA 1LACA 3HFZB 3QO2A 4DV4Q 4HAEA 4KD4A 1E1OA 1SJED 2GA4B 1CTMA 3KBXA 3VYUA 4AQYQ 1KDBA 4FYDA 3J7YW 1GVPA 1IYUA 1SAPA 2CHBD 2R92H 1G51A 2UUCQ 3WWVA 1E2WA 3Q22A 1TWAH 2DJGC 2F4VQ 2VQEQ 4A3FH 4DV7L 3HKZE 2D9UA 4UP9A 1VQ8A 1N9WA 3KUPA 2QGQA 3MEFA 1IBKQ 2PMZE 2E76C 3HOWB 2HUGA 1ZYRD 4R4CA 5IYDH 4DKAC 1SLJA 4OGQC 5C0XH
chains in the Genus database with same CATH topology
1DONA 1KDAA 1ILQA 2DNEA 5CYUA 1MI2A 4ZLTF 3I70A 2M9VA 1EY9A 3C3LA 3QJYA 4L6TB 1PTOC 5DM63 3EFXD 1VMCA 4BA1I 3QWNA 1ZKOA 2F3VA 1X32A 2B2TC 4A3FB 4OIKA 1SE2A 3NTIA 1D5ZC 3J7AV 1XTCD 3QIAA 4UAIA 4ZAIA 2Q8RE 1A2TA 2M00A 4F8MA 5D3IB 3GTOB 1G8ZD 1SE4A 1CHPD 4J6HA 4TKOB 2QILA 3M7NA 3ERQA 4ZK9B 5IGCA 3O13A 1M8AA 2C5CA 1SYCA 4XIGS 5CV8A 3H6MA 3OSOA 3BS1A 3WDNA 3MC0B 4IUQA 1EIHA 4LAAA 2AWOA 2FMCA 3SK8A 3J80L 1PZKD 4KHZA 1WTQA 1HHVA 1A3VA 1PTOF 4RWSC 4IQZA 3VA7A 2WAQB 1CQFA 2JA6B 1AP0A 2NVTB 2WINB 5E4WC 2PZWA 2X69A 2K5QA 3C1EA 1ML0D 2NN6H 2B2WC 1AEXA 1GUTA 4RGTA 1QNKA 2RDGA 4CJ0B 1O7ZA 2V4DA 4IFDJ 1ICWA 1L0YB 2EOTA 5IT9L 2XVSA 2NTTA 4RAUC 4ZKCB 3Q0AA 1HRJA 3BVGA 3R2IA 1LTGD 3K5MA 3T16A 2YU9B 1V1PB 1SNOA 4HTHA 5JPMC 2RKSA 3HG9A 4PNYA 3M4YA 3K6OA 2K01A 3ZYYX 5FO8B 2DN8A 3H3VC 2F3WA 2A6HD 2O4XA 2Z4HA 1Q1BA 1I4RA 5IODA 1Z6HA 4KV6A 2IX0A 5KEEA 4L8JA 3HKZB 2F0TA 1GHKA 1E2VA 1SFOB 2PMZB 5NUCA 2B8GA 1B4OA 4OO1G 4C3JG 3TDQA 3IAYA 1NAPA 1CHQD 5IGBA 5A2QE 3BDCA 3P7JA 5JOBA 4Y7NB 3K5LA 2CW0C 1WCMB 1GUSA 4A3DB 4E6IA 4FF4A 3NXWA 4C3JB 1TU2B 4K14A 2LS01 1BCPD 4RHRA 2R93B 5CGKA 2NUCA 1LT6D 3R93A 3NTHA 2IPKD 3S1QB 5C0XI 5ELCA 3OOCA 1A3UA 1SE3A 3HP3A 2K5DA 4ODGA 3J81L 2BDNA 1PRTB 3GP7A 1F2ZA 3AU7A 1SJHD 2NVQB 1TKWB 2A73B 3FVQA 2EXZA 1HQMC 3MA2B 3A8IE 1WTRA 1RHPA 1PFNA 2D2CC 4A93B 1KABA 2KCNA 4RKBA 3R8BA 3MXPA 3A56A 3A8JE 2OXPA 3TP8A 3EJIA 4C56C 3GTLB 2IJ0A 5KNCA 1QB5D 4DK1A 3VYSA 4CJ2C 3E5SA 1ENAA 5T1IA 2NB0A 4G7ZC 4H44C 1Q12A 1I3QB 3EQLC 4CHTB 3S1MB 1HPCA 1MD2D 2L55A 2X6GA 4H0LC 5CV7A 2AQ1B 3HS0C 3QOJA 2MPMA 4ID6A 1FD7D 1RJTA 4KKSA 1I4XA 1EYDA 1G291 3ND8A 5JPNC 3MHBA 2WV6D 2LY7A 1PRTC 1EFID 1QE6A 2SNSA 3DHQA 3M4OB 2WB1B 1SNMA 5C5LA 2N55A 3S16B 5I2YA 3N6RA 5I9PA 2MJ8A 1PZJD 1Q90A 5JEAG 1XXGA 2A69C 2NN6I 2QKIC 4KN4C 1DOMA 4RGNA 4ZUIA 3X3MA 3TMEA 3HEJA 4FO2A 3RZDB 4B9WA 3S1RB 1AN8A 2RA4A 2B2VA 1IL8A 1EY6A 4KJOA 1B44D 3WOFA 3GQBA 4QIWB 1RODA 5JJZA 1LTRD 1JQYD 4BY7B 2KECA 1OXSC 1QCBD 3M3YB 1W6KA 1F9RA 1FR3A 5FOBB 1WTWA 3MZ5A 5EGTA 4KD3A 1MGSA 3WOEA 3HZXA 4Q0FA 2EZVA 3DEPA 3NUCA 1HFNA 3K0YA 4WJWA 5EKLA 4K2LA 3HOUB 2L1BA 1DOKA 4BY1B 4QMGA 2E74C 4I7ZC 1D6EC 1GUWA 1Q8IA 1R4QB 2B2YA 3I4MB 1PRTF 3ONAB 2NZ1D 3I73A 3PUZA 3X3NA 1GJXA 3PO3B 2L0CA 1C4QA 1S5ED 4C3IG 5EQ0A 4G7OC 2JE6I 1PZID 4C3HB 2EYHA 3HRZC 1STAA 1STGA 1HA5A 1WD0A 2EYLA 4EVOA 3LNNA 3MXGA 4IUTA 5I6WA 2PCFB 4KKUA 1B3AA 4LJZC 1I6VC 2XN9C 2K03A 4M1UB 5F2DA 4CJ1B 3IFTA 4WRDA 1ESFA 5K36H 4CKCA 5C3EB 4EQNA 5DAUA 2L11A 1EY0A 1F9PA 5CC4A 5ELDA 1BBXC 2PQEA 4XQJA 3I4NB 3PV0A 4DAPA 1GHJA 2KCCA 4BBSB 4IFDH 4LK1C 4XT3B 1EQTA 4NP5A 2EY2A 2RSOA 3HOVB 1O78A 3EA6A 3GTMB 1EYAA 2A68C 1F2YA 1K8OA 1I4GA 2OT2A 1SYEA 3DWQA 2JSOA 2YYZA 3U9OA 4RGOS 2QDBA 5C4ZA 3DUZA 2MHVA 4ILWA 2EYJA 2F0UA 1LTBD 2VUMB 3OWFA 4X3UA 1BNZA 2F0LA 3PMFA 3AMUA 2WKDA 3MWYW 2B2TA 5JVG3 1H9SB 1PTOD 5IGEA 3JAML 5HURA 1SXTA 2XIWA 3H94A 2JA8B 1AFPA 2JA7B 3QOLA 1ENFA 2N88A 2ZXRA 3NSWA 2AQ3B 1EU4A 1DM0B 4HEDA 2CQAA 1H9JA 2B63B 4RH6A 3A8KE 3SK4A 1U9RA 2XRQD 3KBGA 3VR3A 2K28A 4DN4M 1U4LA 5M9OA 1E0BA 2PPBC 1X3PA 4KI0A 2X6LA 3BYTB 5EBCA 2FJ2A 1O7YA 3P75A 3I91A 2PZUA 5CV5A 2K33A 2FHTA 3FMCA 4DFAA 1TT2A 1EQVA 1SDFA 5FO7B 3S1NB 4C1NK 3A55A 3M85A 4TRDA 3FDTA 2JP1A 1IKMA 1LTSD 4KY5A 1D5XC 1Q1EA 1A2UA 1I4QA 3TN2A 4K6DA 1CFMA 1VCIA 1S5DD 3U9SA 2Q8IB 3TP6A 1NR4A 1PDQA 5FLXL 2BDOA 4UDUC 3HGBA 2RBMA 5C0XG 3MEHA 4J8QA 4K5XA 3OIPA 3S14B 2R92B 4FF3A 2R6GA 1GUGA 1TWAB 5C6AA 1YNND 3R3OA 3D4WA 2CVRA 1VMPA 4QF4A 1XWEA 1SNDA 5LHY1 4N9PA 3BG3A 1TWGB 3Q6SA 1B50A 2D62A 5CV6A 3NBIA 2J7ZA 3G6JB 4DK0A 5ELFA 1U4RA 3OMCA 3A7LA 4M8AA 4IFDI 1JICA 1WTVA 2R7ZB 5KYLA 4O1NA 5CBAE 3VYRA 1Z7TA 1PLFA 3HOXB 1V1PA 3MFGA 1EZ6A 2EE1A 3HOZB 2EYPA 2HQEA 1JWUD 2CW0D 1AW7A 1HUMA 1F77A 2DNCA 1L0XB 1TY0A 4RFBA 1A6XA 2KJXA 4ZRZA 3VYTA 4DNRB 3S17B 1D2BA 2NN6G 4U68A 1FNWA 3J7AF 4J1MA 5HGTA 3CHBD 3IL8A 1B53A 4ME5A 1EY7A 3W2DA 5E3FA 2IWHA 1NCVA 3NWTA 4HCEA 2KOLA 1AZPA 1KLUD 2F0VA 1UEAB 5IGFA 4CGYB 5M5WB 1U4PA 1ZEQX 2BOSA 1QOHA 1G91A 4G4KA 3FPUB 5EPKA 4EGVA 3NE5B 1AZQA 3GTGB 1LT3D 2IX3A 2G9DA 3DM1A 2XSCA 5D3DA 2AUJD 1LLRD 1Y69U 5EBDA 4DGZA 1HTLD 1TS4A 3CQZB 3I3CA 3H09A 4DA2A 2TMPA 1HUNA 4HCSA 3J80E 3KK7A 4KMUC 4DU9A 1LABA 3PUWA 1UAPA 1TVXA 1PYWD 3EROA 2JEBI 2K05A 3P1HA 5I2XA 3BYYB 1OXTA 2B39A 2F03A 2FFKB 1ENCA 1W6JA 1PRTD 5IT9E 1K83B 4NKLA 1S5BD 4OHJA 4V190 3PUXA 1OXVA 4DXGA 3I8ZA 1JWMD 2A69D 4NDXA 2ZXPA 4H13C 5E1FA 1I4PA 3L7ZC 2EJMA 4CBVA 1G2TA 3PUYA 2PO4A 1SNCA 3OMGA 2F0HA 3LWEA 5KIXA 2EY1A 3IFDA 5EPLA 4PMBA 3NP8A 3L3OC 2O2LD 2XRSD 3AB9A 2F0PA 3Q23A 1EWCA 4ZUJA 2ICEC 1EOTA 2EVBA 3T51B 1LO5D 3SXHA 3MVVA 2KEDA 2NYZD 2ZT9C 2HCIA 1BCPB 3RZOB 1JOOA 3MFYA 4HMJA 2K04A 3LWUA 5JVH3 4L63B 2A6HC 3DWAA 4XYOA 3FPPA 3FKIB 3I72A 4OIJA 3T13A 5CR3A 3D8GA 4A3EB 2JYOA 5TSSA 3J81E 2F0FA 1IW7D 2F0NA 4FNFA 4F88A 4FVMA 2NBFA 5CV9A 4H7BA 1V43A 2F0DA 4ULLA 1EWHA 5EJWA 2RDHA 1TS5A 3FRPB 1BCPC 4U673 1TWFB 3CKIB 1YNJC 5FO9B 2AWNA 2R3ZA 3OIQA 5KNBA 1X3QA 2SOBA 1R4PB 4MIUA 2A6ED 2IL8A 2BA0A 1ILPA 2EJFC 5JAVA 3VR5A 1B1ZA 4C3HG 5A35A 1D1KA 4PQXA 4KKTA 2BA1A 5EPJA 3CU7A 4R9WA 2F0GA 3LX0A 4K2KA 4BWGB 1XYIA 4FF1A 2K32A 3D6CA 5IIFA 1PFMA 2OF1A 4HSPA 2ENBA 3PUVA 3TP5A 1HA6A 5KRUA 2EJGC 1DCZA 4DAYA 3GTPB 1QWYA 5BN4A 1DJRD 2NTSA 3K7AB 1BCPF 1E2ZA 1V1OA 1KNAA 5M3FB 1RF2D 1TIID 2MGSA 3KLSX 1TQOA 3QG1A 3NQIA 4YIJA 4IZ8A 1LTTD 3N52A 2XWJB 5IGGA 1B9NA 2SDFA 4GZYC 5K36G 1I6HB 1GUNA 5C4XB 4BS9A 2WIIB 1SMYC 3KLRA 1S4ZA 1NUCA 3KLSA 3K5OA 4OL7A 4DXFA 2ZXOA 1J9OA 5ELBA 5LL6X 2D5DA 4IFDG 1H9SA 1F9QA 2OEOA 4XTCS 3S2DB 1DXMA 2SEBD 1CI3M 4FF2A 3D31A 1STHA 2MUYA 2L4NA 3V96A 1KDCA 3NHHA 3ND9A 5M5XB 2O5IC 2Z8LA 1I50B 1EZ8A 2I07B 1TWHB 1JOKA 1FGBD 4P2CB 4HR7B 2WACA 1EY4A 1JE4A 4HMIA 5KYIA 1IYVA 3TBIB 1DD2A 1VF5C 1CA5A 1HCZA 4G7HC 2NVXB 1PTOH 1JR0D 3V05A 1SEBD 4K8JA 1QG7A 1V8QA 4FP5D 4LMQD 1LV9A 3VR4A 4TQUS 1Z47A 2KHSA 3IKJA 1U4MA 3CRKC 5J1ZA 3Q24A 1BO0A 4X3KA 1STBA 1SNQA 2PW7A 1EEID 2RQXA 3C2PA 3T4AC 1HQRD 4DAVA 3D6WA 1PTOB 3VA5A 1M4VA 5G3LF 1Q3LA 1Y1VB 2HCCA 3SVMA 1ESRA 2B2UC 2B2WA 1Y8NB 2A74C 2EYFA 2IX1A 1FYCA 2EY5A 5JEAJ 1CA6A 2EY6A 2F0MA 4CKBA 2ICIA 3JAME 4NW2A 1BXTA 3GV6A 3W3AA 2BE5C 1H9MA 4XT1B 2Y0SB 2E2IB 1STYA 3OHXC 1BQQT 1LTAD 3OPOA 3C46A 4R8NA 2Z4IA 2E2DC 4IN3A 4PV1C 3PIO3 3K58A 2PZTA 1EY8A 1B2TA 5C44B 5I4DA 3SEBA 4ABNA 5CV4A 3GD7A 2J4XA 2F0QA 3NTKA 5BN5A 1EL0A 1NR2A 3NK9A 1LTID 4S3SA 1RD9D 4KHVA 2WP8J 4KN7C 4ZQ3A 2F0SA 3SHLA 1D5MC 2PYKA 4KJNA 2E2HB 4TSSA 3FEWX 5KNDA 4JBWA 4AYBB 2L12A 2RDFA 5D65A 4KY7A 4I65A 5M5YB 2KEEA 4Z9CB 2E75C 3NPPA 3HOYB 5FLXE 1F2LA 1RKNA 1QJOA 2DY8A 4A3KB 3DWPA 1CK1A 2FINB 1K8MA 1JB3A 1JC7A 1S5FD 2DY7A 3T53B 3CRLC 1GOZA 1ZYRC 5A2QL 2LMCB 2K1BA 3TZUA 1TWCB 2NVYB 1J8IA 1G6ZA 2B8FA 2F0KA 2FMMA 2NWGA 2G9HD 1WTOA 1LT4D 4FXGC 3MAQA 4N9TA 3QB3A 4PMWA 1D1IA 1TS3A 1CQVA 2HDMA 4IURA 1ZXTA 4K5VA 2F1MA 1GUOA 2AUKA 1BUVT 2LKVA 5CORA 1KTKA 1YNNC 1IHZA 3K59A 3UI2A 3RD4A 1BDOA 3DEOA 4DF7A 4KK7A 1B9MA 1PMRA 2PW5A 2MP1A 5FK9C 4ZKBB 3A54A 3E0JA 3OWEB 2AQ2B 4C2MB 4XYQA 4OO1H 1CM9A 1RDPD 4RCNA 4IUNA 4A3IB 5LL6S 4R8IA 4Q5VA 1IKLA 2J0TD 2VB3X 1I4HA 1SNPA 5ELEA 3TZDA 1FNUA 2VB2X 4XXEA 1GXDC 1EU3A 2TSSA 5IGDA 2C9OA 4QB4A 3BVZA 2KQ3A 1PFBA 2PNRC 3MXUA 4X3TA 4DNTB 2QEJC 1MBYA 1YNJD 1TY2A 1JWSD 3BDOA 5D14A 5AFWA 2F0WA 2IW3A 4RGMA 1Y8OB 1EYCA 4WORA 1WD1A 3MXNA 5KGUA 1SYFA 4A3JB 5FKAC 3VR6A 2ID0A 5DM73 2VNUD 3MTSA 1VDZA 3PO2B 1S5CD 1OXUA 4V0BA 1Y8PB 3GTJB 4MN3A 1DZ1A 3GO5A 1O80A 4IUPA 1JORA 3H91A 2XWBB 5BN3A 4X3SA 5C0XJ 2QCPX 4B9XA 3BDLA 1H9KA 2XNAC 4FXDA 3R2TA 2EYOA 1Y1WB 5C5MA 3S9WA 2R61A 1SYDA 2EYMA 2KA7A 1A3TA 1QILA 1HFGA 2F0EA 1NSNS 5C3XA 5J39A 3SDZA 2K6AA 5JEAH 2IT1A 1ET9A 4ZYSA 4IALA 4IUUA 1QNUA 4QUCA 3M7GA 3SK6A 3C1FA 1SMYD 3DMUA 1BF4A 2JXMB 3URYA 1MSGA 1ONLA 1II3A 4HN7A 5EKKA 3F2UA 2WKCA 4A3BB 1G2SA 2A68D 2BCOA 4QUFA 1EEFD 4KTAA 2O5JC 3D3RA 2L9HA 3OW7A 1CT1D 3K57A 3S2HB 4PMCA 3G7LA 2JA5B 1EIGA 1EY5A 3NWSA 3SK5A 3L9AX 5G3LD 1TR5A 1BOSA 4BBRB 1VF7A 2RSNA 5EKIA 3S15B 1C8CA 1SBBB 1RCVD 1A15A 2M2LA 1LT5D 1O7LA 2VXWA 4OO1I 3D4DA 1H9RA 1HXYD 4RHSA 1WTPA 4CKEA 5DEHA 3K5NA 1BR9A 1DOLA 4BA2I 3D4RA 2K7VA 1CZGA 3NBHA 3V2TA 2A5HA 4HSVA 2JEAI 1F9SA 1KAAA 1KLGD 3RLFA 3GTQB 4C3IB 1IW7C 1RTNA 1STNA 5C4HA 2F0OA 1TS2A 2SNMA 1STEA 2F0JA 2B2UA 3GV3A 3A7AB 2LFNA 2RVLA 4WFN3 1JOQA 5I6YA 1ET6A 1R9TB 1WTXA 4JK1C 2H1EA 2H4OA 1F2MA 1OXXK 2I46A 4RA8A 4A3MB 4K6LA 2B2VC 2KUMA 2HDLA 2Z1CA 3SR1A 1UUPA 2A6EC 4K5WA 1RTOA 3RUZA 1XX8A 5ISRA 1T5EA 4XQQA 1CZWA 3PIP3 4K8IA 1SSOA 1UNSA 4IUVA 3SE0A 1DYQA 4NMZA 1KNEA 3I4LA 2KVMA 1MSHA 2BE5D 1SYBA 4RCOA 2E2JB 4F87A 5CMDA 5C4JB 2K5WA 4EQPA 2F0IA 2L5TA 3NQTA 3ITPA 5K5PA 3BZDB 4RKLA 4EQOA 5I9OA 5M3MB 4XDXA 2B2YC 2Q8TA 1JCKB 4A3GB 1C48A 3TP7A 3GTKB 4F7XA 5T1GA 3H0GB 4FXKC 3TSSA 4C1NI 1FNVA 1SYGA 1PXUA 5IOCA 5COYA 3VR2A 4XQNA 2QF7A 3P20A 3T56B 4MHEA 5E4XA 4B08A 4O42A 1HTPA 3I90A 2EDGA 5CBEE 4QCLA 4KY6A 3E6ZX 2F4IA 3RMHA 5J22A 1T5XD 5DNFA 3DXJC 2EPBA 5C3WA 3KF8A 4G57A 1OO9B 1WVLA 3BVMA 3EVQA 1LACA 3QO2A 4HAEA 4KD4A 1SJED 2GA4B 1CTMA 3KBXA 3VYUA 1KDBA 4FYDA 3J7YW 1IYUA 1SAPA 2CHBD 1E2WA 3Q22A 2D9UA 3KUPA 2E76C 3HOWB 2HUGA 1ZYRD 4OGQC 5C0XH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GQB A;  3FMC A;  1O78 A;  2DNE A;  4KN7 C;  2L5T A;  1B9M A;  1OXS C;  3CRK C;  1PMR A;  1H9K A;  1IW7 D;  3QG1 A;  2A68 C;  1O7L A;  1TKW B;  3PUX A;  1OXV A;  1H9R A;  2DNC A;  1B9N A;  3QJY A;  3M85 A;  1K8O A;  1HQM C;  1FR3 A;  3A8I E;  1V43 A;  4OO1 H;  4GZY C;  5K36 G;  2A69 D;  1A6X A;  1EWH A;  1GUN A;  2D2C C;  4H13 C;  4JBW A;  4BA1 I;  5KND A;  2YYZ A;  1SMY C;  4RCN A;  3KLR A;  1ZKO A;  3L7Z C;  2KA7 A;  4DNR B;  1Q1E A;  3M4Y A;  2EJM A;  3PUY A;  1CFM A;  1YNJ C;  2NN6 G;  1VCI A;  2E74 C;  4BA2 I;  3VR2 A;  2D5D A;  3U9S A;  4IFD G;  2QF7 A;  5KNB A;  2DN8 A;  2E75 C;  1H9S A;  3A8J E;  2K7V A;  3D4R A;  3P20 A;  2Q8I B;  3SDZ A;  3T56 B;  4XTC S;  4I7Z C;  1DXM A;  3QIA A;  1CI3 M;  5KNC A;  2BDO A;  2A6H D;  3HGB A;  1HTP A;  1Q1B A;  2A6E D;  5C0X G;  1Y8N B;  4DK1 A;  2BA0 A;  3D31 A;  3I73 A;  1Z6H A;  3PUZ A;  1QJO A;  5JEA H;  1FYC A;  2IT1 A;  2EJF C;  4H44 C;  4G7Z C;  1GJX A;  2JEA I;  2EDG A;  1Q12 A;  4L8J A;  3ND9 A;  3RLF A;  2R6G A;  1H9S B;  1K8M A;  3EQL C;  1IW7 C;  1GUG A;  3VR5 A;  2PNR C;  4G7O C;  2JE6 I;  1GHK A;  1HPC A;  3AB9 A;  1E2V A;  2O5I C;  3H94 A;  3MXU A;  5A35 A;  4H0L C;  2B8G A;  4DNT B;  2EVB A;  4KKT A;  3T51 B;  4OO1 G;  3NE5 B;  4TKO B;  2JXM B;  3DXJ C;  3M7N A;  2ZT9 C;  3T53 B;  3CRL C;  2BA1 A;  4HR7 B;  3A7A B;  3W3A A;  1ZYR C;  2BE5 C;  1H9M A;  4KKS A;  1G29 1;  2LMC B;  3LNN A;  3ND8 A;  1ONL A;  2PCF B;  4KKU A;  3TZU A;  1LAC A;  2AUJ D;  4LJZ C;  1I6V C;  4XIG S;  4JK1 C;  3BG3 A;  1IYV A;  1DD2 A;  2B8F A;  3MFY A;  1H9J A;  1VF5 C;  1Y69 U;  3WDN A;  3OPO A;  1OXX K;  1CTM A;  1HCZ A;  3BDO A;  2AWO A;  2A68 D;  3A8K E;  2D62 A;  2K32 A;  2CW0 C;  3LWU A;  3VR3 A;  4DK0 A;  3IFT A;  2O5J C;  1Y8O B;  1IYU A;  2A6H C;  4G7H C;  5K36 H;  2A6E C;  3OW7 A;  1GUS A;  4KHZ A;  3N6R A;  4KMU C;  4PV1 C;  1Q90 A;  1LAB A;  1E2W A;  3PUW A;  5JEA G;  3PUV A;  2PPB C;  2A69 C;  2NN6 I;  3A7L A;  4IQZ A;  1TU2 B;  1T5E A;  4KI0 A;  2F1M A;  4KN4 C;  1GUO A;  2AUK A;  3VR6 A;  3VA7 A;  2EJG C;  1DCZ A;  2JEB I;  1V8Q A;  1VDZ A;  3SE0 A;  2NN6 H;  3PV0 A;  1GHJ A;  1OXU A;  1GUT A;  3FPP A;  5BN4 A;  1YNN C;  1Y8P B;  2KCC A;  3I4L A;  3VR4 A;  2E76 C;  4IFD H;  4LK1 C;  1OXT A;  3GD7 A;  4TQU S;  2V4D A;  2BE5 D;  1Z7T A;  3OOC A;  1E2Z A;  3I72 A;  2K33 A;  3IKJ A;  1VF7 A;  5BN5 A;  4OGQ C;  5BN3 A;  1BDO A;  5C0X H; 
#chains in the Genus database with same CATH topology
 4X62 L;  1DON A;  2K5V A;  4DR3 L;  2I5M X;  1KDA A;  1ILQ A;  2DNE A;  4IPD A;  5CYU A;  4KLK A;  1MI2 A;  4ZLT F;  1S72 A;  3I70 A;  1DGS A;  2PQA B;  2QEX A;  1KQS A;  4JI8 Q;  2M9V A;  3GTO H;  1EY9 A;  3C3L A;  3QJY A;  4L6T B;  3T1Y Q;  1PTO C;  5DM6 3;  3EFX D;  1VMC A;  3J81 i;  4BA1 I;  4IO9 A;  4R1J A;  3QWN A;  1ZKO A;  3CMA A;  2F3V A;  1X32 A;  2B2T C;  4A3F B;  4OIK A;  1SE2 A;  4A3C G;  4R4Q A;  3NTI A;  1C0A A;  1D5Z C;  4NXN Q;  3J7A V;  4GOP B;  1XTC D;  3HOY G;  1KHI A;  2ALY B;  3QIA A;  1MJE A;  4UAI A;  4ZAI A;  4HJ5 A;  2Q8R E;  2E8G A;  1A2T A;  2M00 A;  1GM5 A;  4F8M A;  1CKN A;  1RIP A;  3TRZ A;  5D3I B;  3GTO B;  1YJW A;  1G8Z D;  1SE4 A;  1CHP D;  4J6H A;  4TKO B;  2QIL A;  1RL2 A;  3I56 A;  3M7N A;  2WAQ G;  3ERQ A;  4ZK9 B;  2JA6 G;  1QZG A;  2NZH A;  3O13 A;  5IGC A;  1M8A A;  2C5C A;  1SYC A;  4NXM L;  4XIG S;  5CV8 A;  3H6M A;  3OSO A;  3BS1 A;  3CCU A;  4BXX G;  3WDN A;  3MC0 B;  4JI4 Q;  4IUQ A;  1EIH A;  4LAA A;  2AWO A;  1L1O C;  2FMC A;  5EAY A;  3SK8 A;  1XNQ Q;  3J80 L;  4LF7 L;  1T9H A;  2UUA Q;  1PZK D;  4X65 L;  3STB D;  4KHZ A;  1WTQ A;  1HHV A;  1YHQ A;  1A3V A;  2Q2I A;  1PTO F;  4RWS C;  4DV2 Q;  4JI7 Q;  4IQZ A;  3VA7 A;  2WAQ B;  1CQF A;  1WFQ A;  2JA6 B;  1AP0 A;  2NVT B;  2WIN B;  5E4W C;  4JI0 Q;  2P5Z X;  2PZW A;  2X69 A;  2K5Q A;  3C1E A;  1ML0 D;  1XPO A;  2NN6 H;  2B2W C;  1AEX A;  1GUT A;  4RGT A;  1QNK A;  2RDG A;  1GD7 A;  4CJ0 B;  1UWV A;  3CC2 A;  1O7Z A;  2V4D A;  1K8G A;  4IFD J;  1ICW A;  4X6A H;  3QR8 A;  1L0Y B;  2EOT A;  3TQY A;  5IT9 L;  4GOP C;  2XVS A;  2NTT A;  4RAU C;  4GKJ Q;  4ZKC B;  3Q0A A;  1BKB A;  1HRJ A;  4LFC L;  1YHA A;  1VQ5 A;  5H1S E;  5GAH C;  3BVG A;  1XMQ Q;  3R2I A;  1LTG D;  3K5M A;  3T16 A;  2YU9 B;  4IPC A;  1V1P B;  1SNO A;  2JQO A;  4HTH A;  1UE7 A;  3CC4 A;  4B3S L;  5JPM C;  3HKZ G;  4A3I G;  2RKS A;  1VQM A;  3HG9 A;  4PNY A;  4A3L G;  4LFB Q;  3M4Y A;  4LF4 L;  3K6O A;  1MHW C;  4DK6 C;  2K01 A;  3ZYY X;  5FO8 B;  2VQF Q;  1VQP A;  1X3F A;  4HJA A;  2DN8 A;  2PI2 E;  3H3V C;  2LXJ A;  2F3W A;  2A6H D;  2O4X A;  2Z4H A;  1K83 H;  1Q1B A;  3G48 A;  1I4R A;  5IOD A;  4A3D H;  4QIW E;  1Z6H A;  4KV6 A;  2IX0 A;  5KEE A;  4JI5 Q;  4L8J A;  3HKZ B;  2F0T A;  1YI2 A;  1Q81 C;  1GHK A;  1WCM G;  1IBL Q;  1E2V A;  1SFO B;  3AEV A;  2PMZ B;  5NUC A;  2B8G A;  1SRU A;  3S1Q H;  4PZ7 A;  1B4O A;  1HZB A;  4OO1 G;  4C3J G;  3TDQ A;  2R93 G;  4LF8 L;  1CKO A;  1IZ6 A;  3IAY A;  1NAP A;  1CHQ D;  5IGB A;  5A2Q E;  2H5X A;  1VQK A;  2NVQ H;  3BDC A;  4JOI A;  4X66 L;  3P7J A;  5JOB A;  1N36 Q;  4Y7N B;  3K5L A;  3U50 C;  2CW0 C;  4OXP A;  1WCM B;  1SR3 A;  1GUS A;  4A3D B;  2LSS A;  1IXR A;  4E6I A;  4HIK A;  4A3J G;  3NXW A;  4FF4 A;  4C3J B;  1TU2 B;  4K14 A;  2LS0 1;  1BCP D;  2OQ0 A;  4RHR A;  2R93 B;  5CGK A;  2NUC A;  3ULP A;  1LT6 D;  3PO2 G;  3R93 A;  3NTH A;  4POF A;  2IPK D;  3S1Q B;  2I0Q A;  5C0X I;  5ELC A;  4YCV A;  3OOC A;  3GTL H;  4A93 G;  1A3U A;  1SE3 A;  3S24 A;  3HP3 A;  2K5D A;  4ODG A;  3J81 L;  3KJP A;  2BDN A;  4IPH A;  1PRT B;  1Q46 A;  3GP7 A;  1F2Z A;  4DR1 L;  3AU7 A;  4OON A;  1SJH D;  2NVQ B;  3S1M H;  3RNU A;  1TKW B;  1Y1W G;  4X64 Q;  1IYJ B;  2A73 B;  3FVQ A;  2EXZ A;  1HQM C;  2N3S A;  3MA2 B;  3A8I E;  4DV7 Q;  1WTR A;  4DV3 L;  1RHP A;  1PFN A;  2D2C C;  1O7I A;  3E3X A;  4A93 B;  1P8L A;  4JI6 L;  1KAB A;  2KCN A;  4RKB A;  3R8B A;  1VQN A;  3MXP A;  1HNW L;  1BVS A;  3A56 A;  3A8J E;  2OXP A;  3M4O H;  3TP8 A;  3EJI A;  4C56 C;  4A3E H;  2IJ0 A;  3GTL B;  3S16 H;  5KNC A;  1QB5 D;  3F2B A;  4DK1 A;  3VYS A;  4MTK A;  4CJ2 C;  3AFP A;  2OCE A;  1ENA A;  3E5S A;  5T1I A;  2NB0 A;  4G7Z C;  4H44 C;  1Q12 A;  1I3Q B;  3EQL C;  2WB1 G;  4APV A;  5JJL A;  4CHT B;  3S1M B;  4JI2 L;  1HPC A;  1MD2 D;  1XMO L;  2L55 A;  2X6G A;  4H0L C;  5CV7 A;  2AQ1 B;  3S1R H;  3UE1 A;  4LF9 Q;  5FJ8 G;  4YY3 L;  2V1C C;  3HS0 C;  3QOJ A;  2MPM A;  4ID6 A;  2Q2H A;  4HJ9 A;  1FD7 D;  1EYG A;  3CPF A;  1RJT A;  1I4X A;  4KKS A;  3UDF A;  1EYD A;  1G29 1;  3ND8 A;  5IP9 G;  5JPN C;  3MHB A;  3JAM i;  3Q8D A;  2WV6 D;  3U4V A;  1GO3 E;  2LY7 A;  3A5Z B;  3MXN B;  4AQY L;  1PRT C;  4JYA L;  1EFI D;  1QE6 A;  3M3Y H;  2SNS A;  3DHQ A;  3M4O B;  2DGY A;  1SNM A;  2WB1 B;  5C5L A;  2UUC L;  2N55 A;  3S16 B;  4KHP Q;  3G4S A;  4RG1 A;  5I2Y A;  4BY7 G;  1LYL A;  3N6R A;  5I9P A;  2MJ8 A;  1PZJ D;  1Q90 A;  2F4V L;  4YCU A;  5JEA G;  1HJP A;  1XXG A;  2A69 C;  2NN6 I;  1YVC A;  2C35 B;  2QKI C;  4KN4 C;  1DOM A;  4RGN A;  1KC8 C;  2MFI A;  2VZA A;  4ZUI A;  3HOU H;  1IL2 A;  3HEJ A;  3TME A;  4FO2 A;  3X3M A;  3RZD B;  5HY6 A;  1IBK L;  2JA5 G;  1PVO A;  1K0S A;  3E9H A;  2FXQ A;  4B9W A;  4RMF A;  3S1R B;  1KL9 A;  1AN8 A;  2RA4 A;  2B2V A;  4NXM Q;  1IL8 A;  1EY6 A;  2R7D A;  4BBR G;  4KJO A;  4AH6 A;  1B44 D;  3WOF A;  3KDF B;  3GQB A;  4BY1 G;  4QIW B;  1ROD A;  5JJZ A;  4LF7 Q;  1Z9F A;  1LTR D;  1JQY D;  4BY7 B;  3CW2 C;  2KEC A;  1OXS C;  4LUO A;  4X65 Q;  5IWA Q;  1QCB D;  3BU2 A;  3CCR A;  3M3Y B;  4C3H H;  1W6K A;  3I4M G;  3NEL A;  1F9R A;  1FR3 A;  5FOB B;  4GKK Q;  1WTW A;  3MZ5 A;  3PO3 G;  5EGT A;  4KD3 A;  1MGS A;  3WOE A;  5IYB H;  3TEH B;  3HZX A;  1PH5 A;  3F8T A;  4Q0F A;  2EZV A;  3DEP A;  3NUC A;  1HFN A;  3K0Y A;  4WJW A;  5EKL A;  4K2L A;  3HOU B;  2L1B A;  3NEN A;  1DOK A;  4BY1 B;  4NXN L;  3OW2 A;  4QMG A;  2E74 C;  4HJ7 A;  2UXC Q;  2AMC B;  5E7N A;  4LFC Q;  5M3F H;  4I7Z C;  1D6E C;  1GUW A;  1Q8I A;  1R4Q B;  2B2Y A;  3I4M B;  1PRT F;  3ONA B;  1SMX A;  2NZ1 D;  1PYS B;  3VDY A;  3I73 A;  3PUZ A;  3X3N A;  1GJX A;  3PO3 B;  2L0C A;  1C4Q A;  1S5E D;  3FP9 A;  4C3I G;  4DV1 L;  5EQ0 A;  4G7O C;  2JE6 I;  1VQH A;  1ICF B;  1PZI D;  5IP7 G;  4C3H B;  3HRZ C;  2EYH A;  5C3E G;  1STA A;  5C4X H;  4BBS H;  1STG A;  4LUV A;  1X3G A;  4YWM A;  1E7Z A;  1HA5 A;  1WD0 A;  2EYL A;  2ZJR A;  4DR7 Q;  4EVO A;  3I4N G;  3LNN A;  3MXG A;  4IUT A;  5I6W A;  2PCF B;  4KKU A;  1B3A A;  1NNX A;  4LJZ C;  4QJF A;  1I6V C;  2XN9 C;  1J5E L;  1HR0 Q;  1XNQ L;  2K03 A;  5FLM G;  1VQ9 A;  4M1U B;  2UUA L;  5F2D A;  4CJ1 B;  3IFT A;  2KCM A;  4WRD A;  3HOV G;  1ESF A;  5K36 H;  3A74 A;  4CKC A;  5C3E B;  4DV2 L;  4EQN A;  5DAU A;  2L11 A;  1EY0 A;  1F9P A;  5CC4 A;  4K0K L;  5ELD A;  1BBX C;  2PQE A;  5M5X H;  4XQJ A;  3I4N B;  1TWH H;  3PV0 A;  2CWA A;  4DAP A;  1GHJ A;  2KCC A;  2ZTE A;  4BBS B;  4IFD H;  4LK1 C;  4XT3 B;  1Y14 B;  5IY0 A;  1EQT A;  1KAW A;  2EY2 A;  4NP5 A;  4GN5 A;  2RSO A;  4X66 Q;  3HOV B;  1O78 A;  1NY4 A;  2ATW A;  2VUM G;  3EA6 A;  1XMQ L;  4JC0 A;  4R4T A;  3GTM B;  1EYA A;  2A68 C;  1PHJ A;  1F2Y A;  2JA8 H;  1K8O A;  1MJC A;  1I4G A;  1A63 A;  2OT2 A;  3T1H Q;  1YJ9 A;  1SYE A;  3DWQ A;  4A3G G;  2JSO A;  2YYZ A;  3U9O A;  4RGO S;  4LFB L;  2QDB A;  5C4Z A;  4B3M L;  3DUZ A;  2MHV A;  3H0G G;  4ILW A;  1MIU A;  3NBH B;  2JA7 G;  3L0O A;  1N8R C;  3K0X A;  2B63 H;  2EYJ A;  2F0U A;  1LTB D;  2VUM B;  2K50 A;  3OWF A;  4X3U A;  1L0W A;  1BNZ A;  1OTC A;  4DV5 L;  2F0L A;  4JI5 L;  3PMF A;  3AMU A;  2WKD A;  5ELN A;  3AFQ A;  1QUQ A;  1IBL L;  3MWY W;  2B2T A;  3AYH B;  5JVG 3;  1H9S B;  4DV3 Q;  1PTO D;  5IGE A;  3JAM L;  3J80 c;  1I5F A;  1SXT A;  2XIW A;  3H94 A;  5HUR A;  2JA8 B;  2JA7 B;  1AFP A;  2CWP A;  1Q8K A;  4JI6 Q;  4AIM A;  1XJV A;  3QOL A;  1ENF A;  1HNW Q;  4L5S A;  2N88 A;  5GQO A;  2ZXR A;  4DV6 Q;  3NSW A;  2AQ3 B;  1EU4 A;  1DM0 B;  4HED A;  2CQA A;  1H9J A;  1Y1V H;  2B63 B;  4RH6 A;  2KBN A;  3A8K E;  2GVB A;  3SK4 A;  1PH8 A;  1U9R A;  2XRQ D;  4PZ6 A;  3KBG A;  3VR3 A;  2K28 A;  4DN4 M;  1U4L A;  5IT9 c;  1N34 Q;  5M9O A;  1E0B A;  2PPB C;  1X3P A;  4KI0 A;  2X6L A;  3BYT B;  5EBC A;  2FJ2 A;  2E5L L;  1O7Y A;  3P75 A;  1L1O A;  3I91 A;  2MNA A;  1K73 C;  2PZU A;  5CV5 A;  3HOW G;  2E2I H;  2K33 A;  2FHT A;  4JYA Q;  3FMC A;  4JV5 L;  4R4I A;  4O2D A;  1C9O A;  3E0E A;  1TT2 A;  4DFA A;  3S14 H;  1EQV A;  2Z9H A;  4X64 L;  4YWK A;  1X6O A;  1SDF A;  5FO7 B;  3PF5 A;  3S1N B;  4C1N K;  3A55 A;  3M85 A;  1WYD A;  4TRD A;  3FDT A;  4TVA B;  2JP1 A;  2R92 G;  5GAD C;  1IKM A;  1J6Q A;  1LTS D;  5C44 H;  4KY5 A;  1D5X C;  1Q1E A;  4A3F G;  1A2U A;  1I4Q A;  3TN2 A;  1TWG H;  4K6D A;  1CFM A;  1CKM A;  1VCI A;  1JJC B;  1S5D D;  3U9S A;  5IYD G;  2Q8I B;  3TP6 A;  1NR4 A;  3G71 A;  1PDQ A;  5FLX L;  3TS2 A;  2OQK A;  2BDO A;  4UDU C;  3HGB A;  2RBM A;  5C0X G;  3MEH A;  4J8Q A;  4K5X A;  3OIP A;  4O0A A;  3S14 B;  2R92 B;  1QZH A;  3L2P A;  4FF3 A;  2R6G A;  3KF8 B;  1GUG A;  1TWA B;  4PG3 A;  5C6A A;  1EUJ A;  4EX5 A;  2E2H H;  4LF9 L;  2R7Z H;  1YNN D;  4CDE C;  3R3O A;  1CSQ A;  3D4W A;  3JC6 6;  2A1A A;  1X9N A;  2CVR A;  1G6P A;  1VMP A;  4QF4 A;  1XWE A;  3HOX H;  1SND A;  3W5O A;  5LHY 1;  4N9P A;  3HOZ H;  4P71 A;  3SGI A;  2UU9 Q;  3BG3 A;  4LUZ A;  1TWG B;  3CAM A;  1WJJ A;  3Q6S A;  1B50 A;  2VL6 A;  2D62 A;  5CV6 A;  3NBI A;  4KHP L;  2J7Z A;  3G6J B;  4DK0 A;  4UHV A;  5ELF A;  4DV1 Q;  1U4R A;  4A3K H;  3FHW A;  3J81 c;  3OMC A;  5HGQ A;  3A7L A;  4M8A A;  4UP7 A;  1HNZ Q;  4IFD I;  3S17 H;  1JIC A;  3PSI A;  1L2F A;  1WTV A;  1B70 B;  2R7Z B;  5KYL A;  4O1N A;  5CBA E;  3VYR A;  1Z7T A;  1J5E Q;  3BZK A;  1PLF A;  2JK8 A;  1TWC H;  3RN2 A;  3HOX B;  1V1P A;  3MFG A;  1SRO A;  2OWO A;  1EZ6 A;  2EE1 A;  3HOZ B;  2EYP A;  4LF6 Q;  4NB3 A;  2NZO A;  2HQE A;  2HIX A;  5IWA L;  5LMN Q;  1JWU D;  1EIY B;  4YHH L;  2CW0 D;  1AW7 A;  1HUM A;  5M5W H;  1H95 A;  1HR0 W;  1F77 A;  2DNC A;  4GKK L;  4K0K Q;  1EOV A;  1L0X B;  2YTY A;  1TY0 A;  3GTG H;  4RFB A;  1YBY A;  2G5D A;  1A6X A;  2KJX A;  4ZRZ A;  2IHE A;  1A8V A;  3VYT A;  1PH4 A;  2Z0S A;  2BH2 A;  2K75 A;  4DNR B;  3S17 B;  2UXC L;  1D2B A;  2NN6 G;  1Q7Y C;  4U68 A;  4YWL A;  1FNW A;  3CQZ H;  1B3Q A;  3J7A F;  1CKN B;  4J1M A;  5HGT A;  3CHB D;  3IL8 A;  3CC7 A;  1B53 A;  4ME5 A;  1EY7 A;  1X55 A;  2RHQ B;  3W2D A;  5E3F A;  2IWH A;  1NCV A;  2Z6K C;  3NWT A;  4HCE A;  1YIJ A;  2KOL A;  1AZP A;  1KLU D;  2F0V A;  1UEA B;  2K5N A;  4CGY B;  5IGF A;  4GNX A;  4C2M H;  5M5W B;  1U4P A;  1ZEQ X;  2BOS A;  1QOH A;  1G91 A;  4B3M Q;  4G4K A;  3FPU B;  5EPK A;  4EGV A;  4A3I H;  3NE5 B;  1AZQ A;  3GTG B;  4DR7 L;  1LT3 D;  1VQJ A;  2IX3 A;  2QA4 A;  2G9D A;  1HR0 L;  3DM1 A;  4CDC C;  3J81 j;  2XSC A;  5D3D A;  2AUJ D;  1LLR D;  4I7A A;  1Y69 U;  1VQ4 A;  5EBD A;  4DGZ A;  1JMC A;  1HTL D;  4DV5 Q;  1TS4 A;  3CQZ B;  2D0O A;  3I3C A;  3H09 A;  4JG2 A;  4DA2 A;  2TMP A;  1VQF A;  1HUN A;  4HCS A;  3J80 E;  3KK7 A;  1XPR A;  4KMU C;  4A3D G;  4DU9 A;  1LAB A;  3PUW A;  4LFA Q;  4OWX B;  1UAP A;  1TVX A;  1PYW D;  1K28 A;  3ERO A;  2JEB I;  4B3T Q;  2K05 A;  3P1H A;  5I2X A;  3BYY B;  3CD6 A;  1OXT A;  2I5L X;  2B39 A;  2F03 A;  2FFK B;  1ENC A;  3PF4 A;  1PH6 A;  1W3S A;  1W6J A;  1PRT D;  5IT9 E;  1K83 B;  4NKL A;  1S5B D;  4OHJ A;  3K7U C;  4DPG A;  4V19 0;  3T1H L;  3PUX A;  1OXV A;  4DXG A;  4HJ8 A;  4L5Q A;  4OEM B;  1XNR L;  3I8Z A;  1JWM D;  2A69 D;  4NDX A;  2ZXP A;  4H13 C;  3STB C;  2E5L Q;  1I94 L;  1GKH A;  5E1F A;  1I4P A;  3L7Z C;  3RZO H;  2EJM A;  3F2C A;  4CBV A;  1G2T A;  3PUY A;  2PO4 A;  3CCV A;  1SNC A;  1VQB A;  4DR6 Q;  3OMG A;  2F0H A;  3LWE A;  4JV5 Q;  5KIX A;  4P72 A;  3ERS X;  2EY1 A;  3IFD A;  5EPL A;  4ZCK A;  3E9I A;  4PMB A;  1UE6 A;  3NP8 A;  4QY7 A;  3L3O C;  2GN5 A;  2LXK A;  2O2L D;  4L5T A;  2XRS D;  3AB9 A;  3F1Z A;  4WJ3 M;  2F0P A;  4PZ8 A;  3Q23 A;  3FKI H;  1EWC A;  4ZUJ A;  3BJU A;  2ICE C;  1EOT A;  2EVB A;  1WI5 A;  3T51 B;  1LO5 D;  3SXH A;  4DV6 L;  3MVV A;  1MKH A;  2KED A;  2NYZ D;  3OTO Q;  2ZT9 C;  2HCI A;  1BCP B;  1X56 A;  3RZO B;  1AE3 A;  1JOO A;  2HIV A;  3MFY A;  3F2D A;  4JI1 Q;  4HMJ A;  2K04 A;  1N34 L;  4A3E G;  3LWU A;  5JVH 3;  2N78 A;  4L63 B;  2A6H C;  3PCO B;  3DWA A;  1TWF H;  1KD1 C;  4XYO A;  1S40 A;  3FPP A;  3FKI B;  1YJN A;  3PGZ A;  4DUZ L;  3I72 A;  4OIJ A;  3T13 A;  5CR3 A;  3D8G A;  4A3E B;  4A3B H;  2JYO A;  5TSS A;  3J81 E;  2A19 A;  2F0F A;  1IW7 D;  2F0N A;  4FNF A;  4F88 A;  1NTG A;  4FVM A;  2NBF A;  5CV9 A;  4H7B A;  1V43 A;  2F0D A;  4ULL A;  3S2H H;  1EWH A;  4LWC A;  5EJW A;  2RDH A;  3H15 A;  1TS5 A;  3CF5 A;  3FRP B;  4JOI C;  4DR5 L;  1K3B C;  5IE8 A;  1BCP C;  4U67 3;  5GRO A;  3HOU G;  1TWF B;  3JAM c;  3CKI B;  1YNJ C;  5FO9 B;  1YZ6 A;  2HHH Q;  2AWN A;  2R3Z A;  3OIQ A;  4JI3 L;  5KNB A;  1E24 A;  1X3Q A;  2SOB A;  1R4P B;  4MIU A;  3S15 H;  3KFU A;  4YHH Q;  2A6E D;  2IL8 A;  2BA0 A;  1ILP A;  2BH8 A;  2EJF C;  3CPW A;  4P75 A;  5JAV A;  3VR5 A;  3KF6 A;  1B1Z A;  4C3H G;  5A35 A;  1D1K A;  3GTP H;  4PQX A;  5LMN W;  3K7A H;  4KKT A;  2N8N A;  2BA1 A;  5IYB G;  1ASY A;  2UU9 L;  1W2B A;  1QVG A;  5EPJ A;  3CU7 A;  3PQI A;  4R9W A;  2F0G A;  3LX0 A;  2XTI A;  4K2K A;  4R4O A;  4BWG B;  1XYI A;  4FF1 A;  2L15 A;  2K32 A;  5M3F G;  3D6C A;  4OX9 L;  5IIF A;  4UP8 A;  1I6H H;  1PFM A;  2OF1 A;  2B3G A;  1HNZ L;  4HSP A;  2ENB A;  3PUV A;  2D0P A;  3ER0 A;  3TP5 A;  1HA6 A;  5KRU A;  1EQR A;  1HZC A;  2EJG C;  1DCZ A;  4CDD C;  4DAY A;  3U58 A;  3GTP B;  5C4X G;  1QWY A;  3U4Z A;  5BN4 A;  4BBS G;  1DJR D;  2NTS A;  3K7A B;  1N33 Q;  1Q82 C;  1BCP F;  1E2Z A;  1V1O A;  3S2D H;  1R9T H;  5BR8 L;  1KNA A;  1UE1 A;  5M3F B;  1RF2 D;  1EFW A;  1PH1 A;  4LF6 L;  5LMN L;  2Y0S E;  1TII D;  2MGS A;  4JBJ A;  3KLS X;  1TQO A;  4A3M H;  4GLA C;  2UXB Q;  1VQI A;  3UDG A;  3KLW A;  1YEZ A;  1VQC A;  2ZJP A;  3QG1 A;  3NQI A;  4YIJ A;  1LTL A;  4IZ8 A;  1LTT D;  3KYH C;  3N52 A;  2XWJ B;  5IGG A;  1B9N A;  1AE2 A;  3A0J A;  1I50 H;  2SDF A;  5FLX c;  1BBU A;  4GZY C;  5K36 G;  1I6H B;  1GUN A;  5C4X B;  2JN4 A;  2WII B;  1SMY C;  4BS9 A;  3KLR A;  1VQL A;  1E1T A;  1VQ7 A;  1S4Z A;  1NUC A;  3KLS A;  2RCN A;  3K5O A;  1KXL A;  4DNI A;  2F52 A;  4OL7 A;  1FJG Q;  4DXF A;  2ZXO A;  2K5H A;  4UY8 C;  1J9O A;  1X3E A;  4N8F A;  4LNQ A;  5ELB A;  5LL6 X;  2D5D A;  2E2J H;  4IFD G;  1H9S A;  3OYY A;  1F9Q A;  2DJF C;  2OEO A;  4XTC S;  1NE3 A;  1DXM A;  3S2D B;  1JT8 A;  2SEB D;  1CI3 M;  1WTH A;  3I2Z A;  2NVX H;  4FF2 A;  3D31 A;  1STH A;  2MUY A;  1NMG A;  2L4N A;  3V96 A;  1KDC A;  1XNR Q;  5IYC H;  3NHH A;  3ND9 A;  5M3M H;  4MTN A;  1XTD A;  1I94 Q;  2JA8 G;  5M5X B;  2O5I C;  1PA6 A;  2Z8L A;  1I50 B;  3RLN A;  1EZ8 A;  2I07 B;  5J3B A;  3GTK H;  1TWH B;  1JOK A;  1VQO A;  1FGB D;  4P2C B;  4HR7 B;  4GLX A;  4AYB E;  2WAC A;  2ZTD A;  1EY4 A;  1JE4 A;  4HMI A;  5KYI A;  1IYV A;  3TBI B;  1DD2 A;  1VF5 C;  1CA5 A;  2B63 G;  1HCZ A;  1YIT A;  5GAG C;  4B3R L;  1N32 L;  4DK3 C;  4G7H C;  4LFA L;  2NVX B;  1PTO H;  4B3T L;  1KIX A;  1JR0 D;  3V05 A;  1SEB D;  4K8J A;  1QG7 A;  1V8Q A;  4FP5 D;  4LMQ D;  1FL0 A;  1LV9 A;  3VR4 A;  3DM3 A;  4TQU S;  1Z47 A;  1SN8 A;  2KHS A;  3IKJ A;  2WAQ E;  1M1K C;  5AJ3 L;  4IJL A;  3EN2 A;  1U4M A;  1TXY A;  2QW7 A;  3CRK C;  1Y1V G;  5J1Z A;  3Q24 A;  3PIO A;  2IHF A;  2HQL A;  1BO0 A;  4X3K A;  1STB A;  1SNQ A;  2PW7 A;  1PH3 A;  1EEI D;  1K0R A;  2RQX A;  4IPG A;  4J15 A;  3C2P A;  2RF4 A;  3T4A C;  2PQA A;  1D7Q A;  1HQR D;  3CCQ A;  1K9M C;  4DAV A;  3D6W A;  1PTO B;  4DUZ Q;  4DR6 L;  4GN3 B;  4JCV E;  4OWT B;  3VA5 A;  4WJ4 A;  1M4V A;  5G3L F;  4DUY Q;  1Q3L A;  1QUQ B;  1Y1V B;  2HCC A;  3SVM A;  3KOJ A;  1ESR A;  2B2U C;  1YNX A;  2B2W A;  1Y8N B;  2A74 C;  2EYF A;  2IX1 A;  1FYC A;  2EY5 A;  5JEA J;  1CA6 A;  4GLV B;  1NBW A;  2EY6 A;  4GOP A;  2F0M A;  1U0L A;  4CKB A;  2ICI A;  4DR5 Q;  2YTV A;  1V1Q A;  3OTO L;  3JAM E;  4NW2 A;  2PNH A;  1BXT A;  2KCT A;  3GV6 A;  3W3A A;  2BE5 C;  5C44 G;  1H9M A;  4LF5 Q;  4XT1 B;  2Z6K A;  2Y0S B;  4QQB X;  4JI3 Q;  2E2I B;  3ZJY C;  1STY A;  3OHX C;  4JI1 L;  4EQ5 A;  1BQQ T;  1LTA D;  3OPO A;  3C46 A;  4R8N A;  3EBE A;  2Z4I A;  4ALP A;  2E2D C;  1PH7 A;  1Q86 C;  3CP0 A;  3I4O A;  4IN3 A;  1X54 A;  1L1O B;  4PV1 C;  3PIO 3;  3K58 A;  2IY5 B;  2PZT A;  1EY8 A;  1B2T A;  5C44 B;  4JVZ A;  2QDL A;  4UPA A;  4A3C H;  5I4D A;  3SEB A;  5M5Y H;  2R7Z G;  4ABN A;  5CV4 A;  4AYB G;  3GD7 A;  1XPU A;  1IBM L;  4A75 A;  2J4X A;  3HOY H;  2F0Q A;  3NTK A;  5BN5 A;  1EL0 A;  1NR2 A;  3NK9 A;  1LTI D;  3HOX G;  1JE5 A;  4S3S A;  1RD9 D;  2HD3 A;  3CCE A;  4KHV A;  2KEN A;  3H3V H;  3HOZ G;  2WP8 J;  4KN7 C;  4CDF C;  4ZQ3 A;  4OX9 Q;  2F0S A;  4QL5 A;  1KRT A;  3SHL A;  1WOC A;  1B7Y B;  1D5M C;  2PYK A;  4KJN A;  4A3K G;  4HID A;  2E2H B;  4TSS A;  3FEW X;  5KND A;  1P16 A;  4JBW A;  1JJG A;  4AYB B;  2L12 A;  2JA6 H;  2RDF A;  2NVT H;  3ICE A;  2NVY H;  2HHH L;  5D65 A;  4BXX H;  4KY7 A;  4I65 A;  5BR8 Q;  5M5Y B;  2KEE A;  1YHB A;  4Z9C B;  2E75 C;  3D0F A;  3CXC A;  2MO0 A;  3NPP A;  2R7F A;  3HOY B;  4DV0 L;  5FLX E;  1QVF A;  1F2L A;  1RKN A;  1QJO A;  2DY8 A;  4A3K B;  3DWP A;  1CK1 A;  2FIN B;  2OTL A;  1K8M A;  3RN5 A;  2YU9 H;  3CCL A;  2F3I A;  4JW0 A;  3EIV A;  1JB3 A;  1JC7 A;  2VY3 A;  1S5F D;  3GDE A;  2DY7 A;  3T53 B;  3CRL C;  2ZM6 L;  1GOZ A;  1ZYR C;  5A2Q L;  2LMC B;  3ULL A;  2K1B A;  3TZU A;  1TWC B;  2NVY B;  1J8I A;  1G6Z A;  2B8F A;  2F0K A;  2FMM A;  2NWG A;  2CH4 A;  2G9H D;  1WTO A;  1LT4 D;  1ASZ A;  4FXG C;  3CCJ A;  3MAQ A;  4N9T A;  1CUK A;  3QB3 A;  4PMW A;  1D1I A;  1TS3 A;  1AH9 A;  1CQV A;  2HDM A;  4IUR A;  1ZXT A;  1JJ2 A;  4K5V A;  4DR4 Q;  2VW9 A;  4A3L H;  4OEL B;  2F1M A;  1GUO A;  2AUK A;  1BUV T;  2LKV A;  1SFO H;  5COR A;  1KTK A;  2WB1 E;  1N33 L;  1VQ6 A;  4Y52 H;  1YNN C;  1IHZ A;  2AHO B;  2CCZ A;  3K59 A;  3B6Y A;  5JJK A;  1HNX L;  3UI2 A;  3RD4 A;  1BDO A;  3DEO A;  2UXB L;  4ME3 A;  4DF7 A;  4KK7 A;  4B3R Q;  1N32 Q;  1B9M A;  4Y7N H;  1PMR A;  2PW5 A;  2MP1 A;  1WCM H;  5FK9 C;  1CSP A;  4ZKB B;  3A54 A;  3E0J A;  3OWE B;  2AQ2 B;  4C2M B;  4XYQ A;  4OO1 H;  1CM9 A;  4C3J H;  1RDP D;  4RCN A;  2Q2T A;  4IUN A;  3ULJ A;  4A3I B;  5LL6 S;  4R8I A;  4Q5V A;  2R93 H;  1IKL A;  1FJG L;  2J0T D;  3CCM A;  2VB3 X;  1I4H A;  4LW1 A;  2UXD L;  2XGT A;  1SNP A;  4P73 A;  5ELE A;  4DR2 Q;  5AJ3 Q;  3K80 C;  3TZD A;  4GNX B;  4P74 A;  1FNU A;  2VB2 X;  4XXE A;  1GXD C;  1EU3 A;  2TSS A;  3NEM A;  5IGD A;  2C9O A;  4A3J H;  3CCS A;  4QB4 A;  3BVZ A;  2KQ3 A;  1PFB A;  1PFS A;  2PNR C;  3PO2 H;  3MXU A;  4X3T A;  4H02 A;  3GTJ H;  4DNT B;  2N49 A;  2QEJ C;  1MBY A;  5L37 A;  4A93 H;  3J7Z C;  3M9B A;  1YNJ D;  4MZ9 A;  4QGU A;  1TY2 A;  1K3R A;  1JWS D;  1EWI A;  3BDO A;  2UUB L;  5D14 A;  1VQA A;  5AFW A;  2F0W A;  3W1G A;  1Y1W H;  2IW3 A;  4RGM A;  4IJH A;  1VS0 A;  1Y8O B;  1EYC A;  4WOR A;  1WD1 A;  1I3Q H;  1BBW A;  3MXN A;  1B8A A;  5KGU A;  1SYF A;  2YTX A;  4A3J B;  5FKA C;  1C7Y A;  3VR6 A;  2CQO A;  2ID0 A;  5DM7 3;  2VNU D;  3MTS A;  1VDZ A;  3PO2 B;  1S5C D;  3FKI G;  1OXU A;  4V0B A;  1Y8P B;  2K4K A;  3GTJ B;  3LGJ A;  4MN3 A;  2WFW A;  1DZ1 A;  1UEB A;  3GO5 A;  1O80 A;  4IUP A;  3H3V I;  1JOR A;  3H91 A;  4GNX C;  3UDX A;  2XWB B;  5BN3 A;  4YCW A;  4X3S A;  5C0X J;  2EIF A;  2QCP X;  4B9X A;  4X62 Q;  2JA9 A;  4DR3 Q;  3BDL A;  4JBK A;  2PI2 A;  1H9K A;  1S3O A;  2XNA C;  4FXD A;  3R2T A;  2EYO A;  1Y1W B;  3KDF A;  5C5M A;  1HH2 P;  3S9W A;  4HIM A;  5FJ8 H;  3M4P A;  2R61 A;  2CFM A;  2B29 A;  1SYD A;  2EYM A;  1PH9 A;  3RZD H;  1E22 A;  2KA7 A;  5IP9 H;  1A3T A;  1QIL A;  4L5R C;  5ELO A;  1IBM Q;  2KHJ A;  1HFG A;  2F0E A;  1NSN S;  5C3X A;  2ES2 A;  4DUY L;  1VQG A;  3J7A 5;  5LMU L;  5J39 A;  2Z6B A;  1M90 C;  3SDZ A;  1EQQ A;  4DV4 L;  2ZTC A;  2K6A A;  2CKZ B;  4POG A;  4BY7 H;  3I55 A;  4A3B G;  1A0I A;  5JEA H;  2IT1 A;  1ET9 A;  4ZYS A;  4IAL A;  4IUU A;  1QNU A;  4QUC A;  3M7G A;  2JA5 H;  3SK6 A;  3G6E A;  4FDB A;  3C1F A;  1LM0 A;  2DUD A;  1SMY D;  3DMU A;  1BF4 A;  2VS1 A;  2VQE L;  1HZ9 A;  2JXM B;  1PYB A;  2I5H A;  3URY A;  4LF5 L;  4BBR H;  3TS0 A;  2A8V A;  3DLL A;  2ZJQ A;  1MSG A;  4BY1 H;  1ONL A;  1II3 A;  4HN7 A;  5EKK A;  3F2U A;  2WKC A;  4A3B B;  1G2S A;  2A68 D;  4DV0 Q;  2BCO A;  3CME A;  4QUF A;  3I4M H;  1EEF D;  4KTA A;  2O5J C;  3D3R A;  2L9H A;  4JI8 L;  3OW7 A;  3PO3 H;  1E3P A;  4N8X 1;  1CT1 D;  3T1Y L;  3K57 A;  5GAE C;  3S2H B;  4PMC A;  3G7L A;  2JA5 B;  2ZM6 Q;  1EIG A;  1EY5 A;  3NWS A;  4GN4 B;  4OWW B;  2JJQ A;  3SK5 A;  3L9A X;  1NJI C;  4IOA A;  5G3L D;  1TR5 A;  1BOS A;  4BBR B;  1VF7 A;  5DLQ E;  2RSN A;  5EKI A;  3S15 B;  1VQD A;  4NPS A;  1C8C A;  3A5U A;  1SBB B;  3GTQ H;  1RCV D;  4C3I H;  1A15 A;  2M2L A;  1LT5 D;  1O7L A;  2VXW A;  4OO1 I;  5JJI A;  5IP7 H;  3D4D A;  1H9R A;  5C3E H;  3UDI A;  3PIP A;  1HXY D;  4RHS A;  1FGU A;  1WTP A;  4CKE A;  4B3S Q;  3I4N H;  5DEH A;  3W1B A;  1K8A C;  2OTJ A;  3K5N A;  1BR9 A;  3K81 C;  1NMF A;  1HNX Q;  3HKS A;  1QVC A;  4LF4 Q;  1DOL A;  5FLM H;  4BA2 I;  4A76 A;  3D4R A;  2K7V A;  2GVA A;  3KF6 B;  3HOV H;  1CZG A;  4IOC A;  3NBH A;  4JI4 L;  3V2T A;  2K52 A;  2A5H A;  3GTM H;  4HSV A;  4HIO A;  2JEA I;  4A3M G;  1F9S A;  1KAA A;  1KLG D;  3RLF A;  3GTQ B;  4C3I B;  1IW7 C;  1RTN A;  1STN A;  5C4H A;  4JI7 L;  2F0O A;  1TS2 A;  1UE5 A;  2SNM A;  1STE A;  4JI0 L;  1V9P A;  2F0J A;  2B2U A;  3GV3 A;  2UXD Q;  3A7A B;  2LFN A;  2RVL A;  4JPB W;  4WFN 3;  1JOQ A;  5C4J H;  5I6Y A;  1ET6 A;  1R9T B;  1SE8 A;  4LF8 Q;  3TRE A;  3I7F A;  4JK1 C;  1WTX A;  2H1E A;  2VUM H;  2H4O A;  1F2M A;  2CH4 W;  1OXX K;  2I46 A;  4GKJ L;  4RA8 A;  4A3M B;  4K6L A;  2B2V C;  2KUM A;  2HDL A;  2Z1C A;  2YV5 A;  4DAY B;  3SR1 A;  1UUP A;  2A6E C;  4K5W A;  4A3G H;  4DR4 L;  1D8L A;  1RTO A;  3RUZ A;  1XX8 A;  3KJO A;  5ISR A;  2ASB A;  1T5E A;  5IYC G;  2KHI A;  3H0G H;  4XQQ A;  2JA7 H;  3AQQ A;  1CZW A;  5M3M G;  3PIP 3;  4K8I A;  1SSO A;  1UNS A;  4IUV A;  3J80 i;  3SE0 A;  1DYQ A;  4NMZ A;  1KNE A;  3I4L A;  2KVM A;  1MSH A;  2BE5 D;  3M4Q A;  3BZC A;  1SYB A;  4RCO A;  2E2J B;  2RCF A;  4F87 A;  2VQF L;  2UUB Q;  1VQE A;  2MQH A;  5CMD A;  5C4J B;  2K5W A;  4GS3 A;  4EQP A;  2F0I A;  2K14 A;  2L5T A;  3NQT A;  3ITP A;  1EIF A;  3UE0 A;  5K5P A;  2Q2U A;  3BZD B;  4DR1 Q;  4RKL A;  4EQO A;  5I9O A;  5M3M B;  4XDX A;  3RLO A;  2MO1 A;  2B2Y C;  2RHS B;  4A4I A;  2Q8T A;  1JCK B;  4DAM A;  1JB7 A;  1C48 A;  4A3G B;  3TP7 A;  3GTK B;  4F7X A;  5T1G A;  3H0G B;  4FXK C;  3TSS A;  4MNO A;  4C1N I;  1FNV A;  1SYG A;  4DR2 L;  1PXU A;  5IOC A;  5COY A;  3VR2 A;  4XQN A;  2QF7 A;  3P20 A;  3T56 B;  4MHE A;  4JBM A;  5E4X A;  4B08 A;  4O42 A;  2EQS A;  1X65 A;  3IRB A;  1HTP A;  3K8A A;  3RR5 A;  1N36 L;  3I90 A;  2EDG A;  2EXD A;  3S1N H;  5CBE E;  1PH2 A;  1PV4 A;  4QCL A;  4KY6 A;  1HZA A;  3E6Z X;  1FVI A;  2AKW B;  2F4I A;  3RMH A;  5J22 A;  1U5K A;  1T5X D;  1A62 A;  1LUZ A;  4JI2 Q;  1XMO Q;  3HOW H;  1KRS A;  2HT1 A;  5DNF A;  3DXJ C;  2EPB A;  5C3W A;  3KF8 A;  4G57 A;  4YY3 Q;  5LMU Q;  2Y0S G;  1OO9 B;  1WVL A;  3BVM A;  3EVQ A;  1LAC A;  3HFZ B;  3QO2 A;  4DV4 Q;  4HAE A;  4KD4 A;  1E1O A;  1SJE D;  2GA4 B;  1CTM A;  3KBX A;  3VYU A;  4AQY Q;  1KDB A;  4FYD A;  3J7Y W;  1GVP A;  1IYU A;  1SAP A;  2CHB D;  2R92 H;  1G51 A;  2UUC Q;  3WWV A;  1E2W A;  3Q22 A;  1TWA H;  2DJG C;  2F4V Q;  2VQE Q;  4A3F H;  4DV7 L;  3HKZ E;  2D9U A;  4UP9 A;  1VQ8 A;  1N9W A;  3KUP A;  2QGQ A;  3MEF A;  1IBK Q;  2PMZ E;  2E76 C;  3HOW B;  2HUG A;  1ZYR D;  4R4C A;  5IYD H;  4DKA C;  1SLJ A;  4OGQ C;  5C0X H; 
#chains in the Genus database with same CATH homology
 1DON A;  1KDA A;  1ILQ A;  2DNE A;  5CYU A;  1MI2 A;  4ZLT F;  3I70 A;  2M9V A;  1EY9 A;  3C3L A;  3QJY A;  4L6T B;  1PTO C;  5DM6 3;  3EFX D;  1VMC A;  4BA1 I;  3QWN A;  1ZKO A;  2F3V A;  1X32 A;  2B2T C;  4A3F B;  4OIK A;  1SE2 A;  3NTI A;  1D5Z C;  3J7A V;  1XTC D;  3QIA A;  4UAI A;  4ZAI A;  2Q8R E;  1A2T A;  2M00 A;  4F8M A;  5D3I B;  3GTO B;  1G8Z D;  1SE4 A;  1CHP D;  4J6H A;  4TKO B;  2QIL A;  3M7N A;  3ERQ A;  4ZK9 B;  5IGC A;  3O13 A;  1M8A A;  2C5C A;  1SYC A;  4XIG S;  5CV8 A;  3H6M A;  3OSO A;  3BS1 A;  3WDN A;  3MC0 B;  4IUQ A;  1EIH A;  4LAA A;  2AWO A;  2FMC A;  3SK8 A;  3J80 L;  1PZK D;  4KHZ A;  1WTQ A;  1HHV A;  1A3V A;  1PTO F;  4RWS C;  4IQZ A;  3VA7 A;  2WAQ B;  1CQF A;  2JA6 B;  1AP0 A;  2NVT B;  2WIN B;  5E4W C;  2PZW A;  2X69 A;  2K5Q A;  3C1E A;  1ML0 D;  2NN6 H;  2B2W C;  1AEX A;  1GUT A;  4RGT A;  1QNK A;  2RDG A;  4CJ0 B;  1O7Z A;  2V4D A;  4IFD J;  1ICW A;  1L0Y B;  2EOT A;  5IT9 L;  2XVS A;  2NTT A;  4RAU C;  4ZKC B;  3Q0A A;  1HRJ A;  3BVG A;  3R2I A;  1LTG D;  3K5M A;  3T16 A;  2YU9 B;  1V1P B;  1SNO A;  4HTH A;  5JPM C;  2RKS A;  3HG9 A;  4PNY A;  3M4Y A;  3K6O A;  2K01 A;  3ZYY X;  5FO8 B;  2DN8 A;  3H3V C;  2F3W A;  2A6H D;  2O4X A;  2Z4H A;  1Q1B A;  1I4R A;  5IOD A;  1Z6H A;  4KV6 A;  2IX0 A;  5KEE A;  4L8J A;  3HKZ B;  2F0T A;  1GHK A;  1E2V A;  1SFO B;  2PMZ B;  5NUC A;  2B8G A;  1B4O A;  4OO1 G;  4C3J G;  3TDQ A;  3IAY A;  1NAP A;  1CHQ D;  5IGB A;  5A2Q E;  3BDC A;  3P7J A;  5JOB A;  4Y7N B;  3K5L A;  2CW0 C;  1WCM B;  1GUS A;  4A3D B;  4E6I A;  4FF4 A;  3NXW A;  4C3J B;  1TU2 B;  4K14 A;  2LS0 1;  1BCP D;  4RHR A;  2R93 B;  5CGK A;  2NUC A;  1LT6 D;  3R93 A;  3NTH A;  2IPK D;  3S1Q B;  5C0X I;  5ELC A;  3OOC A;  1A3U A;  1SE3 A;  3HP3 A;  2K5D A;  4ODG A;  3J81 L;  2BDN A;  1PRT B;  3GP7 A;  1F2Z A;  3AU7 A;  1SJH D;  2NVQ B;  1TKW B;  2A73 B;  3FVQ A;  2EXZ A;  1HQM C;  3MA2 B;  3A8I E;  1WTR A;  1RHP A;  1PFN A;  2D2C C;  4A93 B;  1KAB A;  2KCN A;  4RKB A;  3R8B A;  3MXP A;  3A56 A;  3A8J E;  2OXP A;  3TP8 A;  3EJI A;  4C56 C;  3GTL B;  2IJ0 A;  5KNC A;  1QB5 D;  4DK1 A;  3VYS A;  4CJ2 C;  3E5S A;  1ENA A;  5T1I A;  2NB0 A;  4G7Z C;  4H44 C;  1Q12 A;  1I3Q B;  3EQL C;  4CHT B;  3S1M B;  1HPC A;  1MD2 D;  2L55 A;  2X6G A;  4H0L C;  5CV7 A;  2AQ1 B;  3HS0 C;  3QOJ A;  2MPM A;  4ID6 A;  1FD7 D;  1RJT A;  4KKS A;  1I4X A;  1EYD A;  1G29 1;  3ND8 A;  5JPN C;  3MHB A;  2WV6 D;  2LY7 A;  1PRT C;  1EFI D;  1QE6 A;  2SNS A;  3DHQ A;  3M4O B;  2WB1 B;  1SNM A;  5C5L A;  2N55 A;  3S16 B;  5I2Y A;  3N6R A;  5I9P A;  2MJ8 A;  1PZJ D;  1Q90 A;  5JEA G;  1XXG A;  2A69 C;  2NN6 I;  2QKI C;  4KN4 C;  1DOM A;  4RGN A;  4ZUI A;  3X3M A;  3TME A;  3HEJ A;  4FO2 A;  3RZD B;  4B9W A;  3S1R B;  1AN8 A;  2RA4 A;  2B2V A;  1IL8 A;  1EY6 A;  4KJO A;  1B44 D;  3WOF A;  3GQB A;  4QIW B;  1ROD A;  5JJZ A;  1LTR D;  1JQY D;  4BY7 B;  2KEC A;  1OXS C;  1QCB D;  3M3Y B;  1W6K A;  1F9R A;  1FR3 A;  5FOB B;  1WTW A;  3MZ5 A;  5EGT A;  4KD3 A;  1MGS A;  3WOE A;  3HZX A;  4Q0F A;  2EZV A;  3DEP A;  3NUC A;  1HFN A;  3K0Y A;  4WJW A;  5EKL A;  4K2L A;  3HOU B;  2L1B A;  1DOK A;  4BY1 B;  4QMG A;  2E74 C;  4I7Z C;  1D6E C;  1GUW A;  1Q8I A;  1R4Q B;  2B2Y A;  3I4M B;  1PRT F;  3ONA B;  2NZ1 D;  3I73 A;  3PUZ A;  3X3N A;  1GJX A;  3PO3 B;  2L0C A;  1C4Q A;  1S5E D;  4C3I G;  5EQ0 A;  4G7O C;  2JE6 I;  1PZI D;  4C3H B;  2EYH A;  3HRZ C;  1STA A;  1STG A;  1HA5 A;  1WD0 A;  2EYL A;  4EVO A;  3LNN A;  3MXG A;  4IUT A;  5I6W A;  2PCF B;  4KKU A;  1B3A A;  4LJZ C;  1I6V C;  2XN9 C;  2K03 A;  4M1U B;  5F2D A;  4CJ1 B;  3IFT A;  4WRD A;  1ESF A;  5K36 H;  4CKC A;  5C3E B;  4EQN A;  5DAU A;  2L11 A;  1EY0 A;  1F9P A;  5CC4 A;  5ELD A;  1BBX C;  2PQE A;  4XQJ A;  3I4N B;  3PV0 A;  4DAP A;  1GHJ A;  2KCC A;  4BBS B;  4IFD H;  4LK1 C;  4XT3 B;  1EQT A;  4NP5 A;  2EY2 A;  2RSO A;  3HOV B;  1O78 A;  3EA6 A;  3GTM B;  1EYA A;  2A68 C;  1F2Y A;  1K8O A;  1I4G A;  2OT2 A;  1SYE A;  3DWQ A;  2JSO A;  2YYZ A;  3U9O A;  4RGO S;  2QDB A;  5C4Z A;  3DUZ A;  2MHV A;  4ILW A;  2EYJ A;  2F0U A;  1LTB D;  2VUM B;  3OWF A;  4X3U A;  1BNZ A;  2F0L A;  3PMF A;  3AMU A;  2WKD A;  3MWY W;  2B2T A;  5JVG 3;  1H9S B;  1PTO D;  5IGE A;  3JAM L;  5HUR A;  1SXT A;  2XIW A;  3H94 A;  2JA8 B;  1AFP A;  2JA7 B;  3QOL A;  1ENF A;  2N88 A;  2ZXR A;  3NSW A;  2AQ3 B;  1EU4 A;  1DM0 B;  4HED A;  2CQA A;  1H9J A;  2B63 B;  4RH6 A;  3A8K E;  3SK4 A;  1U9R A;  2XRQ D;  3KBG A;  3VR3 A;  2K28 A;  4DN4 M;  1U4L A;  5M9O A;  1E0B A;  2PPB C;  1X3P A;  4KI0 A;  2X6L A;  3BYT B;  5EBC A;  2FJ2 A;  1O7Y A;  3P75 A;  3I91 A;  2PZU A;  5CV5 A;  2K33 A;  2FHT A;  3FMC A;  4DFA A;  1TT2 A;  1EQV A;  1SDF A;  5FO7 B;  3S1N B;  4C1N K;  3A55 A;  3M85 A;  4TRD A;  3FDT A;  2JP1 A;  1IKM A;  1LTS D;  4KY5 A;  1D5X C;  1Q1E A;  1A2U A;  1I4Q A;  3TN2 A;  4K6D A;  1CFM A;  1VCI A;  1S5D D;  3U9S A;  2Q8I B;  3TP6 A;  1NR4 A;  1PDQ A;  5FLX L;  2BDO A;  4UDU C;  3HGB A;  2RBM A;  5C0X G;  3MEH A;  4J8Q A;  4K5X A;  3OIP A;  3S14 B;  2R92 B;  4FF3 A;  2R6G A;  1GUG A;  1TWA B;  5C6A A;  1YNN D;  3R3O A;  3D4W A;  2CVR A;  1VMP A;  4QF4 A;  1XWE A;  1SND A;  5LHY 1;  4N9P A;  3BG3 A;  1TWG B;  3Q6S A;  1B50 A;  2D62 A;  5CV6 A;  3NBI A;  2J7Z A;  3G6J B;  4DK0 A;  5ELF A;  1U4R A;  3OMC A;  3A7L A;  4M8A A;  4IFD I;  1JIC A;  1WTV A;  2R7Z B;  5KYL A;  4O1N A;  5CBA E;  3VYR A;  1Z7T A;  1PLF A;  3HOX B;  1V1P A;  3MFG A;  1EZ6 A;  2EE1 A;  3HOZ B;  2EYP A;  2HQE A;  1JWU D;  2CW0 D;  1AW7 A;  1HUM A;  1F77 A;  2DNC A;  1L0X B;  1TY0 A;  4RFB A;  1A6X A;  2KJX A;  4ZRZ A;  3VYT A;  4DNR B;  3S17 B;  1D2B A;  2NN6 G;  4U68 A;  1FNW A;  3J7A F;  4J1M A;  5HGT A;  3CHB D;  3IL8 A;  1B53 A;  4ME5 A;  1EY7 A;  3W2D A;  5E3F A;  2IWH A;  1NCV A;  3NWT A;  4HCE A;  2KOL A;  1AZP A;  1KLU D;  2F0V A;  1UEA B;  5IGF A;  4CGY B;  5M5W B;  1U4P A;  1ZEQ X;  2BOS A;  1QOH A;  1G91 A;  4G4K A;  3FPU B;  5EPK A;  4EGV A;  3NE5 B;  1AZQ A;  3GTG B;  1LT3 D;  2IX3 A;  2G9D A;  3DM1 A;  2XSC A;  5D3D A;  2AUJ D;  1LLR D;  1Y69 U;  5EBD A;  4DGZ A;  1HTL D;  1TS4 A;  3CQZ B;  3I3C A;  3H09 A;  4DA2 A;  2TMP A;  1HUN A;  4HCS A;  3J80 E;  3KK7 A;  4KMU C;  4DU9 A;  1LAB A;  3PUW A;  1UAP A;  1TVX A;  1PYW D;  3ERO A;  2JEB I;  2K05 A;  3P1H A;  5I2X A;  3BYY B;  1OXT A;  2B39 A;  2F03 A;  2FFK B;  1ENC A;  1W6J A;  1PRT D;  5IT9 E;  1K83 B;  4NKL A;  1S5B D;  4OHJ A;  4V19 0;  3PUX A;  1OXV A;  4DXG A;  3I8Z A;  1JWM D;  2A69 D;  4NDX A;  2ZXP A;  4H13 C;  5E1F A;  1I4P A;  3L7Z C;  2EJM A;  4CBV A;  1G2T A;  3PUY A;  2PO4 A;  1SNC A;  3OMG A;  2F0H A;  3LWE A;  5KIX A;  2EY1 A;  3IFD A;  5EPL A;  4PMB A;  3NP8 A;  3L3O C;  2O2L D;  2XRS D;  3AB9 A;  2F0P A;  3Q23 A;  1EWC A;  4ZUJ A;  2ICE C;  1EOT A;  2EVB A;  3T51 B;  1LO5 D;  3SXH A;  3MVV A;  2KED A;  2NYZ D;  2ZT9 C;  2HCI A;  1BCP B;  3RZO B;  1JOO A;  3MFY A;  4HMJ A;  2K04 A;  3LWU A;  5JVH 3;  4L63 B;  2A6H C;  3DWA A;  4XYO A;  3FPP A;  3FKI B;  3I72 A;  4OIJ A;  3T13 A;  5CR3 A;  3D8G A;  4A3E B;  2JYO A;  5TSS A;  3J81 E;  2F0F A;  1IW7 D;  2F0N A;  4FNF A;  4F88 A;  4FVM A;  2NBF A;  5CV9 A;  4H7B A;  1V43 A;  2F0D A;  4ULL A;  1EWH A;  5EJW A;  2RDH A;  1TS5 A;  3FRP B;  1BCP C;  4U67 3;  1TWF B;  3CKI B;  1YNJ C;  5FO9 B;  2AWN A;  2R3Z A;  3OIQ A;  5KNB A;  1X3Q A;  2SOB A;  1R4P B;  4MIU A;  2A6E D;  2IL8 A;  2BA0 A;  1ILP A;  2EJF C;  5JAV A;  3VR5 A;  1B1Z A;  4C3H G;  5A35 A;  1D1K A;  4PQX A;  4KKT A;  2BA1 A;  5EPJ A;  3CU7 A;  4R9W A;  2F0G A;  3LX0 A;  4K2K A;  4BWG B;  1XYI A;  4FF1 A;  2K32 A;  3D6C A;  5IIF A;  1PFM A;  2OF1 A;  4HSP A;  2ENB A;  3PUV A;  3TP5 A;  1HA6 A;  5KRU A;  2EJG C;  1DCZ A;  4DAY A;  3GTP B;  1QWY A;  5BN4 A;  1DJR D;  2NTS A;  3K7A B;  1BCP F;  1E2Z A;  1V1O A;  1KNA A;  5M3F B;  1RF2 D;  1TII D;  2MGS A;  3KLS X;  1TQO A;  3QG1 A;  3NQI A;  4YIJ A;  4IZ8 A;  1LTT D;  3N52 A;  2XWJ B;  5IGG A;  1B9N A;  2SDF A;  4GZY C;  5K36 G;  1I6H B;  1GUN A;  5C4X B;  4BS9 A;  2WII B;  1SMY C;  3KLR A;  1S4Z A;  1NUC A;  3KLS A;  3K5O A;  4OL7 A;  4DXF A;  2ZXO A;  1J9O A;  5ELB A;  5LL6 X;  2D5D A;  4IFD G;  1H9S A;  1F9Q A;  2OEO A;  4XTC S;  3S2D B;  1DXM A;  2SEB D;  1CI3 M;  4FF2 A;  3D31 A;  1STH A;  2MUY A;  2L4N A;  3V96 A;  1KDC A;  3NHH A;  3ND9 A;  5M5X B;  2O5I C;  2Z8L A;  1I50 B;  1EZ8 A;  2I07 B;  1TWH B;  1JOK A;  1FGB D;  4P2C B;  4HR7 B;  2WAC A;  1EY4 A;  1JE4 A;  4HMI A;  5KYI A;  1IYV A;  3TBI B;  1DD2 A;  1VF5 C;  1CA5 A;  1HCZ A;  4G7H C;  2NVX B;  1PTO H;  1JR0 D;  3V05 A;  1SEB D;  4K8J A;  1QG7 A;  1V8Q A;  4FP5 D;  4LMQ D;  1LV9 A;  3VR4 A;  4TQU S;  1Z47 A;  2KHS A;  3IKJ A;  1U4M A;  3CRK C;  5J1Z A;  3Q24 A;  1BO0 A;  4X3K A;  1STB A;  1SNQ A;  2PW7 A;  1EEI D;  2RQX A;  3C2P A;  3T4A C;  1HQR D;  4DAV A;  3D6W A;  1PTO B;  3VA5 A;  1M4V A;  5G3L F;  1Q3L A;  1Y1V B;  2HCC A;  3SVM A;  1ESR A;  2B2U C;  2B2W A;  1Y8N B;  2A74 C;  2EYF A;  2IX1 A;  1FYC A;  2EY5 A;  5JEA J;  1CA6 A;  2EY6 A;  2F0M A;  4CKB A;  2ICI A;  3JAM E;  4NW2 A;  1BXT A;  3GV6 A;  3W3A A;  2BE5 C;  1H9M A;  4XT1 B;  2Y0S B;  2E2I B;  1STY A;  3OHX C;  1BQQ T;  1LTA D;  3OPO A;  3C46 A;  4R8N A;  2Z4I A;  2E2D C;  4IN3 A;  4PV1 C;  3PIO 3;  3K58 A;  2PZT A;  1EY8 A;  1B2T A;  5C44 B;  5I4D A;  3SEB A;  4ABN A;  5CV4 A;  3GD7 A;  2J4X A;  2F0Q A;  3NTK A;  5BN5 A;  1EL0 A;  1NR2 A;  3NK9 A;  1LTI D;  4S3S A;  1RD9 D;  4KHV A;  2WP8 J;  4KN7 C;  4ZQ3 A;  2F0S A;  3SHL A;  1D5M C;  2PYK A;  4KJN A;  2E2H B;  4TSS A;  3FEW X;  5KND A;  4JBW A;  4AYB B;  2L12 A;  2RDF A;  5D65 A;  4KY7 A;  4I65 A;  5M5Y B;  2KEE A;  4Z9C B;  2E75 C;  3NPP A;  3HOY B;  5FLX E;  1F2L A;  1RKN A;  1QJO A;  2DY8 A;  4A3K B;  3DWP A;  1CK1 A;  2FIN B;  1K8M A;  1JB3 A;  1JC7 A;  1S5F D;  2DY7 A;  3T53 B;  3CRL C;  1GOZ A;  1ZYR C;  5A2Q L;  2LMC B;  2K1B A;  3TZU A;  1TWC B;  2NVY B;  1J8I A;  1G6Z A;  2B8F A;  2F0K A;  2FMM A;  2NWG A;  2G9H D;  1WTO A;  1LT4 D;  4FXG C;  3MAQ A;  4N9T A;  3QB3 A;  4PMW A;  1D1I A;  1TS3 A;  1CQV A;  2HDM A;  4IUR A;  1ZXT A;  4K5V A;  2F1M A;  1GUO A;  2AUK A;  1BUV T;  2LKV A;  5COR A;  1KTK A;  1YNN C;  1IHZ A;  3K59 A;  3UI2 A;  3RD4 A;  1BDO A;  3DEO A;  4DF7 A;  4KK7 A;  1B9M A;  1PMR A;  2PW5 A;  2MP1 A;  5FK9 C;  4ZKB B;  3A54 A;  3E0J A;  3OWE B;  2AQ2 B;  4C2M B;  4XYQ A;  4OO1 H;  1CM9 A;  1RDP D;  4RCN A;  4IUN A;  4A3I B;  5LL6 S;  4R8I A;  4Q5V A;  1IKL A;  2J0T D;  2VB3 X;  1I4H A;  1SNP A;  5ELE A;  3TZD A;  1FNU A;  2VB2 X;  4XXE A;  1GXD C;  1EU3 A;  2TSS A;  5IGD A;  2C9O A;  4QB4 A;  3BVZ A;  2KQ3 A;  1PFB A;  2PNR C;  3MXU A;  4X3T A;  4DNT B;  2QEJ C;  1MBY A;  1YNJ D;  1TY2 A;  1JWS D;  3BDO A;  5D14 A;  5AFW A;  2F0W A;  2IW3 A;  4RGM A;  1Y8O B;  1EYC A;  4WOR A;  1WD1 A;  3MXN A;  5KGU A;  1SYF A;  4A3J B;  5FKA C;  3VR6 A;  2ID0 A;  5DM7 3;  2VNU D;  3MTS A;  1VDZ A;  3PO2 B;  1S5C D;  1OXU A;  4V0B A;  1Y8P B;  3GTJ B;  4MN3 A;  1DZ1 A;  3GO5 A;  1O80 A;  4IUP A;  1JOR A;  3H91 A;  2XWB B;  5BN3 A;  4X3S A;  5C0X J;  2QCP X;  4B9X A;  3BDL A;  1H9K A;  2XNA C;  4FXD A;  3R2T A;  2EYO A;  1Y1W B;  5C5M A;  3S9W A;  2R61 A;  1SYD A;  2EYM A;  2KA7 A;  1A3T A;  1QIL A;  1HFG A;  2F0E A;  1NSN S;  5C3X A;  5J39 A;  3SDZ A;  2K6A A;  5JEA H;  2IT1 A;  1ET9 A;  4ZYS A;  4IAL A;  4IUU A;  1QNU A;  4QUC A;  3M7G A;  3SK6 A;  3C1F A;  1SMY D;  3DMU A;  1BF4 A;  2JXM B;  3URY A;  1MSG A;  1ONL A;  1II3 A;  4HN7 A;  5EKK A;  3F2U A;  2WKC A;  4A3B B;  1G2S A;  2A68 D;  2BCO A;  4QUF A;  1EEF D;  4KTA A;  2O5J C;  3D3R A;  2L9H A;  3OW7 A;  1CT1 D;  3K57 A;  3S2H B;  4PMC A;  3G7L A;  2JA5 B;  1EIG A;  1EY5 A;  3NWS A;  3SK5 A;  3L9A X;  5G3L D;  1TR5 A;  1BOS A;  4BBR B;  1VF7 A;  2RSN A;  5EKI A;  3S15 B;  1C8C A;  1SBB B;  1RCV D;  1A15 A;  2M2L A;  1LT5 D;  1O7L A;  2VXW A;  4OO1 I;  3D4D A;  1H9R A;  1HXY D;  4RHS A;  1WTP A;  4CKE A;  5DEH A;  3K5N A;  1BR9 A;  1DOL A;  4BA2 I;  3D4R A;  2K7V A;  1CZG A;  3NBH A;  3V2T A;  2A5H A;  4HSV A;  2JEA I;  1F9S A;  1KAA A;  1KLG D;  3RLF A;  3GTQ B;  4C3I B;  1IW7 C;  1RTN A;  1STN A;  5C4H A;  2F0O A;  1TS2 A;  2SNM A;  1STE A;  2F0J A;  2B2U A;  3GV3 A;  3A7A B;  2LFN A;  2RVL A;  4WFN 3;  1JOQ A;  5I6Y A;  1ET6 A;  1R9T B;  1WTX A;  4JK1 C;  2H1E A;  2H4O A;  1F2M A;  1OXX K;  2I46 A;  4RA8 A;  4A3M B;  4K6L A;  2B2V C;  2KUM A;  2HDL A;  2Z1C A;  3SR1 A;  1UUP A;  2A6E C;  4K5W A;  1RTO A;  3RUZ A;  1XX8 A;  5ISR A;  1T5E A;  4XQQ A;  1CZW A;  3PIP 3;  4K8I A;  1SSO A;  1UNS A;  4IUV A;  3SE0 A;  1DYQ A;  4NMZ A;  1KNE A;  3I4L A;  2KVM A;  1MSH A;  2BE5 D;  1SYB A;  4RCO A;  2E2J B;  4F87 A;  5CMD A;  5C4J B;  2K5W A;  4EQP A;  2F0I A;  2L5T A;  3NQT A;  3ITP A;  5K5P A;  3BZD B;  4RKL A;  4EQO A;  5I9O A;  5M3M B;  4XDX A;  2B2Y C;  2Q8T A;  1JCK B;  4A3G B;  1C48 A;  3TP7 A;  3GTK B;  4F7X A;  5T1G A;  3H0G B;  4FXK C;  3TSS A;  4C1N I;  1FNV A;  1SYG A;  1PXU A;  5IOC A;  5COY A;  3VR2 A;  4XQN A;  2QF7 A;  3P20 A;  3T56 B;  4MHE A;  5E4X A;  4B08 A;  4O42 A;  1HTP A;  3I90 A;  2EDG A;  5CBE E;  4QCL A;  4KY6 A;  3E6Z X;  2F4I A;  3RMH A;  5J22 A;  1T5X D;  5DNF A;  3DXJ C;  2EPB A;  5C3W A;  3KF8 A;  4G57 A;  1OO9 B;  1WVL A;  3BVM A;  3EVQ A;  1LAC A;  3QO2 A;  4HAE A;  4KD4 A;  1SJE D;  2GA4 B;  1CTM A;  3KBX A;  3VYU A;  1KDB A;  4FYD A;  3J7Y W;  1IYU A;  1SAP A;  2CHB D;  1E2W A;  3Q22 A;  2D9U A;  3KUP A;  2E76 C;  3HOW B;  2HUG A;  1ZYR D;  4OGQ C;  5C0X H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...