1STHA

Two distinctly different metal binding modes are seen in x-ray crystal structures of staphylococcal nuclease-cobalt(ii)-nucleotide complexes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title X-ray crystal structures of staphylococcal nuclease complexed with the competitive inhibitor cobalt(II) and nucleotide.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sthA00
4KY6A 2PZTA 4K5WA 3OWFA 5EKLA 2EYOA 4EQNA 4IZ8A 2F0MA 4ID6A 1A3VA 3C1EA 4J6HA 2M00A 3BDLA 3E5SA 5KRUA 5HGTA 1EYAA 3ERQA 2RKSA 4B9WA 5CC4A 3OMCA 1EZ6A 5NUCA 3TP8A 1SNMA 5KGUA 2NUCA 2EY6A 5F2DA 1KAAA 3NHHA 1SNCA 3NQTA 4ODGA 5EKKA 5J1ZA 4TRDA 1STNA 4DF7A 4DU9A 5HURA 1TR5A 1KDBA 3SXHA 4KD3A 5CV4A 5ISRA 5CR3A 1U9RA 3EJIA 4PNYA 3PMFA 4IUNA 3TP5A 3SK6A 5CV5A 1EQVA 1A3TA 1EY0A 3DHQA 4MIUA 5CV6A 3T13A 4KY5A 1KDAA 2F0JA 5I6WA 4PMCA 2ENBA 2F0DA 5DAUA 3SK5A 4R8NA 1EY6A 4K2LA 5KYLA 5DEHA 1JOQA 1STBA 1SYCA 3HZXA 4B9XA 2OF1A 4HMIA 4EQOA 1EYDA 5JAVA 1EZ8A 2F0VA 4NDXA 2F0TA 4KD4A 4KY7A 4YIJA 1SNQA 4WRDA 3DMUA 2PW5A 3OMGA 5E3FA 4OL7A 3QOJA 4ME5A 5I9PA 4RKBA 2F0SA 2F3WA 5C5MA 4K8IA 2F0NA 5K5PA 5IGBA 2RDFA 2PZUA 5IGGA 1STHA 1SNPA 2EYMA 3P1HA 1JORA 2SNMA 1A2TA 4K5VA 4K2KA 1SYEA 2EYHA 3TP7A 5KYIA 2PQEA 5C4ZA 5EGTA 1EYCA 1AEXA 1SNDA 1SYDA 3VA5A 3D6CA 3HEJA 4K8JA 4S3SA 3S9WA 5CGKA 5J22A 1NSNS 1JOKA 2KQ3A 2O4XA 2QDBA 4J1MA 4I65A 4E6IA 3P75A 1STGA 3SK4A 2PZWA 3NUCA 1IHZA 4NMZA 1F2MA 5JOBA 4NP5A 2RBMA 2WACA 3MZ5A 5C6AA 5IODA 2PYKA 3OSOA 3MVVA 2F0PA 2F3VA 1EY4A 5E1FA 3SHLA 5I6YA 5IGDA 1II3A 3D4WA 4G57A 5CV8A 3NXWA 3C1FA 2EY5A 4ZUIA 4F7XA 5CV9A 4QF4A 1ENAA 5CV7A 5IGFA 3MHBA 3SK8A 2SOBA 2EXZA 4KTAA 2OEOA 5IGEA 5KEEA 4H7BA 2F0IA 4WORA 1A2UA 4N9PA 5IOCA 1A3UA 1RKNA 5M9OA 2EY1A 4IALA 3SR1A 4EVOA 4QMGA 4KJOA 4DFAA 3EROA 3LX0A 4K5XA 1TT2A 1EY8A 3BDCA 3R3OA 4HMJA 3RUZA 2F0KA 2HQEA 1EY5A 4K14A 1STAA 1F2YA 2F0GA 5I9OA 3D8GA 3ITPA 3TMEA 2EYLA 1ENCA 3NK9A 2EYFA 1SNOA 2F0EA 4KV6A 2F0LA 3TP6A 2OXPA 4RKLA 1F2ZA 4HTHA 2KHSA 4F8MA 5C3WA 3NP8A 1SYGA 5C3XA 2EYJA 2F0FA 5C5LA 4DGZA 1SYFA 5IGCA 1STYA 2EYPA 1SYBA 1KABA 1TQOA 3MEHA 1KDCA 3EVQA 4KHVA 4KJNA 4N9TA 1NUCA 2F0WA 2SNSA 3D4DA 3QB3A 4ZQ3A 5C4HA 3T16A 2F0QA 2LKVA 3U9OA 5KIXA 2F0HA 4LAAA 1JOOA 2PW7A 3MXPA 4PMBA 4ZUJA 4EQPA 4K6DA 5J39A 3V2TA 2EY2A 3H6MA 3QOLA 4NKLA 4QB4A 1EY7A 1EY9A 5IIFA 2F0OA 2F0UA
chains in the Genus database with same CATH superfamily
4O2DA 2Y0SE 2CCZA 1DGSA 5KNDA 3W1BA 1PA6A 2ZTDA 4ULLA 1TS2A 3L0OA 1SMYC 4M8AA 2IL8A 4A3KH 4BBRB 3G6JB 3WOFA 2ALYB 2EY6A 1BQQT 1ICWA 2KCNA 2KA7A 2KCTA 3HOXB 4FXDA 1MHWC 4CBVA 5CV5A 5GADC 4L5RC 4GZYC 1I4XA 1VMCA 4GLAC 1LTRD 5H1SE 2UU9L 3K5MA 1EYDA 1PFNA 2K33A 5FJ8H 2OCEA 2K50A 4YIJA 5KNCA 4HIMA 4WRDA 1WTOA 2B2WC 1Q3LA 4OL7A 2QCPX 4ME5A 4GNXB 1G6PA 5LMUQ 4H0LC 2AQ3B 1MI2A 1I4RA 3CQZB 3RLOA 2RQXA 5CORA 3M4YA 4G7HC 4NXMQ 5FO7B 4DUZQ 3S14B 2WAQG 2MQHA 2D5DA 2E2DC 4YCWA 2QKIC 1F2MA 3G7LA 3AB9A 3F2DA 4L63B 2RDGA 5C6AA 2F3VA 1VQLA 1NJIC 1YNNC 3DM3A 4F7XA 1U4RA 3G71A 3OPOA 1O7LA 1PFSA 2A6HC 4H7BA 4DA2A 1BKBA 1A15A 2X6LA 3MA2B 1RIPA 3U50C 3R3OA 1VS0A 4XQJA 2NZOA 1CKNA 4A3EG 2PNHA 4BY7G 4A3FH 2BA0A 3I4NH 1SE4A 3C46A 1D7QA 1X56A 2HCIA 3IRBA 2HDMA 5ELNA 2QW7A 3TP6A 1E1TA 1XMQQ 5IYCG 3M4QA 2AQ1B 4OO1G 3VA7A 1EU4A 2CW0D 2K5HA 4A76A 4LNQA 1VQFA 4A3JG 3T16A 2IY5B 4DR5L 4CHTB 4ZUJA 2CWPA 2UXCQ 3MXUA 4DV3L 4NKLA 4ABNA 4DV2L 4K6LA 4C3HH 2HIXA 4WJWA 4G7ZC 1I4QA 4IZ8A 1S72A 4DR7L 1N32L 4R4QA 3E5SA 4NXNL 3K58A 5C44H 4B9WA 2MO1A 3OMCA 1B3QA 1H9RA 4A3KB 2Z4IA 4UP9A 2UUBQ 3IKJA 5HURA 4KK7A 3HOZG 1CKNB 1IBKQ 3EJIA 2Z8LA 3CPWA 1BNZA 4O1NA 3DHQA 5GAGC 4JI1L 2ASBA 1CM9A 1HTLD 3K59A 4N8FA 2CWAA 2EXDA 1L0WA 1B1ZA 1K28A 1V1QA 4OXPA 2LXJA 4BXXH 4HJ7A 2I46A 1K73C 2E76C 3R2IA 2A8VA 1LTSD 5FLXL 1OXVA 4HAEA 1JWMD 1SMYD 3PO3H 3VYSA 1STHA 1FVIA 1ICFB 1IYJB 1AFPA 2WFWA 1DD2A 3M9BA 4X64L 2Q2TA 1HNXL 3CCLA 2Z6KC 2O4XA 1WCMG 1M90C 2NVQH 5FLXE 3PCOB 2ZTEA 2MUYA 4DV1Q 1ZKOA 5IODA 5A2QL 1HNZQ 4IUUA 4LF8Q 2LSSA 1DCZA 2SEBD 3HFZB 1WJJA 1WTWA 3C1FA 4ZUIA 5LMNW 3LWEA 5M3FH 5IP7H 4APVA 4JC0A 3U58A 4XDXA 4V0BA 1X3EA 4N9PA 4OIKA 4CDDC 4DR6Q 4GOPA 3MXGA 1MGSA 2K05A 1Y1VG 2JEBI 3HKZG 3CF5A 1FNWA 2VUMH 1VQNA 2Y0SG 4A3FB 1IXRA 3I4NB 1ML0D 3W2DA 1L1OC 2NB0A 4CDEC 3HGBA 4DGZA 3BVZA 3FKIG 2EYPA 1KDCA 1WTXA 3PO2G 1ENFA 1JB3A 4LAAA 1RJTA 1UE6A 5GQOA 4DV0L 1NBWA 3GTMB 1VQ7A 2JA6G 2A5HA 1PTOH 1DYQA 1PH7A 4C3HB 5DLQE 1VMPA 5GAHC 1T5XD 2F03A 1QNKA 4G4KA 5BR8Q 1NMFA 3J81L 5AJ3L 4Y7NH 1ZYRD 5C44B 1LTID 3BG3A 1CT1D 5I4DA 4XYOA 4DR4L 5ELBA 3NBHB 5J1ZA 4UP7A 3MEFA 5G3LF 3CCQA 2MHVA 1VQPA 5IP9G 2YTVA 3K7UC 4MIUA 5D65A 1VQEA 2B2YA 4DR1Q 5C4JH 1XPRA 3RN5A 3K0XA 1WCMH 3PUWA 4DAMA 1K8OA 5JAVA 3NEMA 1XXGA 1KXLA 1Q8IA 2JJQA 4AYBB 2EQSA 4QUCA 4C1NI 1X3GA 5LL6S 1X54A 3QOJA 5FOBB 4HCEA 5E7NA 4K8IA 1N34L 5IGBA 4DK3C 3PO3B 4JV5Q 1GM5A 1YJ9A 3GTLH 4HJ9A 1PYBA 4FYDA 1VQOA 4P75A 3TP7A 4CDFC 1KHIA 4DAVA 1MBYA 2IT1A 2ZM6L 3TEHB 5K36H 3A8JE 1VQGA 2I07B 1RHPA 2N3SA 2NTTA 1VQHA 2EIFA 2WINB 5IE8A 2NVQB 1E24A 3PGZA 3BYYB 4FXKC 3W5OA 2E2HB 4IUTA 2F0PA 5IGDA 2VNUD 3D6WA 1JCKB 5M3MG 1GHKA 2EY5A 1U0LA 3M4PA 2PQAA 3A5UA 3R8BA 1EWCA 1A2UA 1ASYA 4JI6L 3UE1A 3I55A 1RL2A 2JSOA 5EBCA 3TN2A 1DZ1A 2L9HA 4DK0A 3TSSA 4KHZA 3EQLC 2JA6H 2NN6G 3VR4A 2R93H 2VB2X 2A68D 1XNRL 4LF5Q 2VUMB 1UAPA 4R1JA 2Q8TA 3Q23A 1IKLA 1SBBB 2I5LX 2EDGA 4HTHA 1UE7A 4JOIC 3PUZA 3VYRA 4PZ8A 3BZKA 2XSCA 3MEHA 4LFCQ 1VF7A 1K3BC 2AWOA 1GXDC 1HQMC 1M8AA 1YNJD 1Z47A 4PMBA 3BDOA 3QOLA 2JA7H 4IPCA 1LUZA 4DV4L 1LACA 3OWFA 5C4XG 4A3BG 1PH4A 2E2IH 1G51A 4B3RL 4NW2A 4C1NK 4Y7NB 1UUPA 2FMCA 3L9AX 3KDFA 1LTBD 1SNCA 3K80C 3SXHA 3KF8B 3NWSA 4UP8A 1JJ2A 1Q46A 4KKSA 5BN4A 4FF4A 1ET6A 1CTMA 3MAQA 5C4JB 3A8IE 2F4VQ 1RD9D 1EY6A 3CCMA 4HIOA 4CKBA 2OF1A 2I0QA 4TVAB 1PRTB 2J0TD 1TWGH 2B8GA 2IWHA 1JQYD 3VR3A 5C3EH 1HCZA 1PRTD 2EJGC 3I70A 4LF6Q 2CH4W 4JW0A 1RTOA 3GTLB 5IYBG 1Q1BA 3OHXC 1WTVA 1Q81C 3HEJA 2RSNA 4S3SA 3S15H 1QNUA 3VR6A 1LM0A 1K8AC 1Y8PB 5LMUL 3GD7A 1IHZA 1IYUA 1EFWA 3CC4A 2WACA 1E3PA 2NVYH 3I2ZA 1JICA 1UE5A 2C5CA 1MSHA 3SHLA 1M1KC 1KIXA 1B4OA 4QF4A 1T9HA 1U4LA 4DUZL 4P72A 1SAPA 4JI0Q 1EEFD 3SK8A 4V190 1TY0A 4RGMA 5C0XG 1Y1WG 2BA1A 4JBJA 4MNOA 1BO0A 1Z9FA 1Z6HA 2NBFA 2DY8A 1YVCA 4H44C 4DV5Q 4A3IH 1YNXA 5LMNQ 2CHBD 4A93B 1CSQA 4JI5Q 3Q8DA 3DEOA 1Q7YC 4A3BH 1VQJA 4KV6A 3UDGA 4HCSA 4QGUA 5ELOA 3GTPB 4IOCA 3RZOH 2R7DA 4PZ7A 1VQ4A 2XIWA 1J8IA 2R92G 1B9NA 1GUOA 1KABA 1YJWA 2SNSA 4L5TA 4LF9Q 4C2MH 2K01A 4F88A 1PH3A 2JA7B 1HNWQ 3CXCA 2BDOA 5IIFA 3BZDB 1C9OA 1XMQL 4BBSB 2VL6A 3A5ZB 2CKZB 1LO5D 4ID6A 3U4VA 4HSPA 2E2IB 1E7ZA 1EU3A 1IW7C 2JA8H 2UXCL 5FLXc 3TP8A 1JWSD 4Q0FA 1R9TH 1TR5A 1EL0A 4IUNA 5HGQA 1NCVA 4GKJQ 4X66Q 3WWVA 4CJ2C 3AYHB 2HCCA 4R8NA 3HOWH 2KCMA 3KLSA 1RCVD 1KC8C 2UUBL 4HJ8A 1JT8A 2DUDA 3V05A 2GN5A 5LL6X 2K6AA 1TWGB 1KLGD 1YIJA 2A6ED 2PW5A 5J3BA 4GNXC 3L3OC 3JC66 4LJZC 1SNPA 3S2DH 2XN9C 2KOLA 5KYIA 4IFDH 3CMAA 1RTNA 2B2TC 4C3JB 1WTHA 4XYQA 4J1MA 2QEXA 3C2PA 1N33Q 3GTKH 3GDEA 3JAMi 1B7YB 1QZGA 5FO9B 4NP5A 1HR0W 4IPHA 4AQYQ 5IYDG 1BUVT 2PYKA 3D3RA 2XRSD 2NVYB 4JI7Q 3HOYH 2R7ZG 4JBWA 4LFAQ 2K4KA 3H3VH 2KBNA 2BE5D 2Q8RE 3MHBA 3N52A 1HA6A 3J7A5 3Q22A 1PYWD 2N78A 4DV1L 1HNZL 4QMGA 1TS3A 4LF8L 4A3IB 3G6EA 2M9VA 1LTLA 3AFPA 1EQTA 3KUPA 1LT4D 3MTSA 3DM1A 2ICIA 1H9JA 1PH6A 3D0FA 3ULPA 1EEID 2RCNA 3WDNA 2F0LA 4DR6L 2PCFB 1LYLA 2CW0C 4Q5VA 4A3DG 3RZOB 5C3XA 2MNAA 3MC0B 4UY8C 3NTHA 5ISRA 1IKMA 1QUQB 3U9OA 1PHJA 4C2MB 3D4RA 2OT2A 1SJED 1X9NA 1WYDA 4TRDA 4CDCC 1C8CA 4A3LG 1L0XB 1SN8A 4O42A 1K9MC 1D6EC 3K5OA 3ERQA 4B3SQ 1WFQA 3H3VI 2JA8B 1W6JA 1SNMA 1HFGA 3X3NA 5EKKA 1STNA 3R2TA 1SRUA 1R9TB 2F1MA 2DJGC 3IFDA 2BDNA 4XQQA 1XJVA 4A3GH 1I3QH 1I4HA 1UWVA 2CVRA 5BR8L 2E2JH 2F0JA 1PH2A 2ENBA 1B3AA 3FP9A 4RA8A 3HOWB 3KJPA 3QIAA 4J15A 4RFBA 4J8QA 5T1IA 3I4MG 5DM73 1AH9A 3E0JA 3BS1A 1PV4A 1HTPA 3VR5A 2WB1E 2K1BA 4DR1L 1B2TA 5K5PA 1HZ9A 2PZUA 4DXGA 1IW7D 4AIMA 1GO3E 3J7AV 4FXGC 4DPGA 3S2DB 3S1RH 2EYHA 1OXXK 2EOTA 3AFQA 3CW2C 3S17H 4GKKQ 2JA5G 2AUJD 2JXMB 4OX9Q 2KEDA 3PIP3 4DK6C 2ZXOA 1ZXTA 3RD4A 3IAYA 1PMRA 3TS0A 4JV5L 2PZWA 1KNAA 3GTKB 1SJHD 4DR2Q 3S1NH 1HA5A 3MXNA 5JOBA 1HHVA 2RBMA 4JBKA 3OSOA 3HOUH 3HOYB 4JYAQ 3KFUA 4IJHA 4P71A 5CV8A 2UUCQ 2VZAA 1ENAA 3CP0A 2N55A 5ELCA 4KTAA 3NTKA 4WFN3 3PSIA 1BDOA 3SR1A 2KHJA 3U9SA 3K6OA 3GTJH 1TT2A 1EY8A 1CUKA 3FPPA 1QE6A 2HQEA 1WD1A 4KKUA 1HFNA 2SDFA 1F2YA 5CYUA 2YYZA 2XGTA 2B2UC 1PVOA 4YHHQ 3DWAA 4QY7A 5COYA 3NTIA 1AP0A 5AFWA 1SYGA 4FVMA 3P7JA 1R4PB 4XT1B 4KHVA 1NUCA 1Q86C 4KI0A 4H13C 4U673 3MXNB 4RHSA 4IUQA 3H15A 1CZWA 3TZUA 2MP1A 1EY9A 2GVBA 2F0UA 5IGEA 1PH9A 4C3IB 2JE6I 4G7OC 4JK1C 3TS2A 3A7LA 1ZYRC 4LFCL 1MKHA 4DKAC 3DWQA 3T1HQ 5HGTA 1EYAA 4IUPA 2Z6BA 1CQFA 4GS3A 4DK1A 2NUCA 4YY3L 4GOPC 1YHQA 1KAAA 2DNEA 4UPAA 3HOVG 4OWWB 1MIUA 2XNAC 2F52A 2NVTB 4A3GB 3L7ZC 1I3QB 3OIPA 1G2TA 2XTIA 3I7FA 1TVXA 2PMZB 1Y8NB 1DOMA 5I6WA 2E2JB 5DAUA 2Z0SA 4JI8L 3H0GG 4EQOA 1ZEQX 3J80c 1SNQA 1AW7A 4JI3Q 3DMUA 3PUYA 4PV1C 1XMOQ 2DJFC 5E3FA 2I5HA 4EQ5A 4MHEA 2F4VL 1EQRA 1S4ZA 1SMXA 4DV7Q 3S1MH 1TWFH 1P16A 3S1RB 1EYCA 1AEXA 1YJNA 2A73B 4BA1I 1M4VA 3S17B 3ZJYC 4R4IA 2E8GA 5JEAG 4YCUA 1V8QA 3PIPA 1F9QA 4LF6L 5JPNC 3I72A 2CH4A 1P8LA 3S1NB 4X65Q 3PQIA 5E1FA 3PIO3 1BOSA 2AMCB 2UXBQ 4I7ZC 5IT9L 5CV7A 1JC7A 4IQZA 3BU2A 5EBDA 4WJ4A 5IOCA 1A3UA 4EVOA 2A68C 3GTJB 1S5BD 4IPGA 4LF4Q 3NPPA 4JI0L 1GUWA 4A3EH 2EYLA 5IT9E 4BY7H 2OTLA 4B3MQ 2ATWA 4Z9CB 4GN3B 3Q0AA 2EYFA 1XNQQ 4P73A 4HIKA 3GO5A 2MJ8A 2EYJA 1O7ZA 3A56A 2K5QA 1SYFA 5C5LA 4DV5L 3ICEA 5IYCH 1S5CD 1YNJC 4OO1H 3EVQA 3I4OA 1QILA 4JI5L 2IW3A 3T4AC 4A3JH 2PW7A 4X3KA 1EY7A 4RGNA 4HIDA 3M4OH 1EFID 1EIHA 2G9HD 4FO2A 1PTOC 1E22A 2XWBB 3V96A 5A2QE 1YHAA 4RGTA 2BOSA 1BF4A 3RLFA 3C1EA 4J6HA 3K57A 4LF9L 4O0AA 2Z1CA 4DXFA 3HRZC 1EIFA 3W3AA 1C4QA 1HNWL 3NBIA 3NHHA 1LTAD 2XRQD 3UDFA 2WB1G 2KCCA 2IX3A 1YHBA 3M7GA 1K8GA 3HOZH 1XPOA 1Y69U 1EY0A 4BY1G 1SEBD 2NYZD 1GUSA 2F0DA 2J4XA 5D3IB 3SK5A 4ZKBB 1G291 5FKAC 5KYLA 4DNRB 4A3MG 1FJGL 2MO0A 5EAYA 1R4QB 1S3OA 1KQSA 5I2YA 1PRTC 1YZ6A 4RAUC 4GKJL 4X66L 2RDHA 5M5WH 4GOPB 1T5EA 4M1UB 5I2XA 4TQUS 5LHY1 2JYOA 3FVQA 2R6GA 2K04A 4ZYSA 3S1MB 1IBLQ 4I7AA 2N8NA 4K8JA 3JAML 1S5DD 3S9WA 4A93G 2MGSA 3GTOH 3CCRA 4RCNA 3J81E 2D2CC 2QDBA 3KLRA 2XWJB 4E6IA 2AUKA 5CBEE 3P20A 1D5XC 5CBAE 1E2ZA 2GA4B 3MZ5A 1H9SA 3J7AF 1OXTA 2B39A 1NMGA 1II3A 1E1OA 1EYGA 1KNEA 3PIOA 1JWUD 5TSSA 4ZLTF 1EWHA 1U4PA 1V1PA 4IN3A 1N33L 2CQOA 1WTPA 1DONA 4ALPA 4AQYL 4IALA 4BBSG 4DN4M 4FF2A 3TREA 1G8ZD 1Y1VH 4LFAL 2F0GA 5I9OA 4A3EB 2D9UA 3ND9A 4BY7B 2K75A 1SNOA 1EUJA 2F0EA 2Z6KA 3GV3A 2OXPA 4RKLA 1GUGA 1STYA 3ER0A 3FKIH 5M3FB 3D4DA 1PH1A 3PO2H 1D5MC 1L0YB 1XTDA 4A3JB 1FGUA 5J39A 2B63G 1LT3D 3D31A 3M4OB 5GAEC 1UEAB 4MTKA 4LFBQ 4IUVA 2QEJC 1N36Q 2RKSA 4H02A 4R4CA 4HR7B 3UDIA 4BA2I 4DU9A 1GUNA 1WI5A 2OTJA 1KDBA 1L1OA 3HOZB 1C48A 4PNYA 3RLNA 4C3JG 3T13A 5IP9H 1WVLA 4B3SL 2JP1A 4PMCA 4OONA 1PTOB 3SE0A 1JOQA 4DUYL 1DOLA 4B9XA 2A6EC 1PTOD 1YBYA 2PQAB 1O78A 2LMCB 1BR9A 1FR3A 4IJLA 2F0NA 5M5WB 2O2LD 1QOHA 3RN2A 3MFGA 2SNMA 1YITA 4B08A 1YEZA 3QWNA 5C4ZA 2P5ZX 4K0KQ 3HP3A 3TRZA 3CC2A 3GTOB 2X6GA 1O7YA 1WCMB 2FXQA 5JJZA 1VQKA 1X3FA 2JQOA 1TS5A 4A3CG 1XTCD 1Z7TA 2BE5C 3OIQA 4GKKL 4OX9L 5CV9A 3T53B 5M3MH 4DR7Q 4OWTB 2F0IA 3KF6A 1FL0A 1UEBA 4RGOS 2BH2A 1XWEA 2HD3A 2IX0A 3EROA 4AH6A 3KDFB 1PZKD 2ID0A 1D2BA 2NN6H 1KTKA 2UUCL 1Y1VB 1CFMA 2VQFQ 4CKCA 3HKZB 2C9OA 1N8RC 1GVPA 2Y0SB 2PPBC 5DM63 3F8TA 1VQCA 1V1OA 4NXML 1KAWA 1CHQD 4KJNA 4N9TA 4R4OA 1JJCB 4LUOA 3LNNA 2LKVA 5KIXA 4IPDA 3PO2B 3KK7A 3MXPA 2WV6D 3OYYA 4C56C 3AMUA 3PUXA 3TDQA 1HZBA 1VF5C 1NTGA 4KY6A 2JA6B 2QDLA 3CKIB 4CGYB 2R93B 1S5ED 2EYOA 1IBMQ 4DAYA 2J7ZA 5C4XH 4TKOB 4BBRG 1HNXQ 1LLRD 2H4OA 5KGUA 3HOXG 1VQBA 1KD1C 2NVXH 1PXUA 1J5EQ 3A8KE 3M3YH 3TP5A 3SK6A 1EQVA 2OQKA 3T1YQ 3A74A 2NN6I 3LWUA 3F2UA 3Q24A 1HUNA 2ICEC 1QWYA 3HKSA 1QVCA 3A54A 3AEVA 2MPMA 1LTGD 2AHOB 5KNBA 4P74A 3OMGA 3I73A 3UDXA 2D62A 3PUVA 2EYMA 3P1HA 2K14A 3KBGA 1A2TA 1SYEA 4MN3A 5IYBH 2L5TA 4JI3L 1GD7A 4L5QA 4AYBE 4MTNA 5FLMG 2R61A 4DV7L 4NMZA 1H95A 4JI2Q 4DV0Q 1IBKL 2K52A 4RCOA 1C0AA 5C3EB 4CJ1B 3D4WA 4HN7A 3EIVA 5M3MB 5IGFA 3H3VC 4LUVA 3RMHA 1TY2A 2EXZA 2OEOA 1HRJA 3GTQH 3CAMA 2VY3A 5C0XH 4X65L 1Y1WH 3RZDH 4C3IG 2VQEQ 4OELB 3OTOQ 2UXDQ 4XT3B 1EIGA 3S15B 4OEMB 3RUZA 2UXBL 3ZYYX 3WOEA 1ENCA 4R8IA 1PTOF 5IWAQ 4EGVA 5JJIA 4HSVA 1BBWA 2KUMA 2H5XA 1LABA 3STBD 2R92H 4LUZA 3I4LA 1D1KA 1EQQA 4RH6A 3QO2A 1TU2B 4B3ML 2X69A 2F0OA 4FDBA 1PFBA 1NY4A 1I5FA 1ONLA 4DV6Q 3CHBD 2M00A 1OO9B 5C4XB 4A3BB 3J81c 4A3KG 1YI2A 4JI4Q 1AZQA 1B8AA 3QG1A 1E0BA 4UHVA 2N49A 1F9PA 2NVXB 4IFDI 2YTXA 1PRTF 2A74C 1K83H 3M3YB 5JVG3 5EPLA 5CV6A 2QGQA 3R93A 1X32A 3S14H 4YWKA 4X62Q 1STBA 5FJ8G 3E0EA 4HMIA 3F1ZA 3UI2A 2WP8J 4JI6Q 4KD4A 3C3LA 1Q12A 4N8X1 5C0XJ 4IFDJ 5I9PA 2DNCA 2EVBA 1TWHH 4CJ0B 3J7ZC 1A8VA 2K5DA 1I4PA 2B2VA 1IL8A 2KENA 1SYDA 4RMFA 1IL2A 1HZAA 5E4XA 1OXSC 1AZPA 4I65A 4YCVA 3SK4A 4NPSA 1LT5D 2RA4A 1VQ5A 2KJXA 1K3RA 1IBLL 4FNFA 5IYDH 2L15A 2Q2HA 4G57A 3NXWA 2R7ZH 3DXJC 2YU9H 1OXUA 1G91A 3U4ZA 3S16H 4EX5A 3GTQB 1Y1WB 2I5MX 3RZDB 1SE8A 3QR8A 4GNXA 1E2VA 3SEBA 4KHPQ 3BDCA 1KRSA 1QJOA 4A3FG 3I3CA 1CHPD 1Y14B 3RR5A 2DY7A 3I4NG 3D8GA 3ULJA 2B2TA 3K81C 1QB5D 1F2ZA 2FHTA 2KHSA 5C3WA 3SGIA 4WJ3M 3CCEA 2JA9A 2JN4A 2NZHA 4A3DH 3EFXD 4XQNA 2R92B 4ZRZA 2YTYA 1N9WA 3FRPB 2PI2E 3K7AH 3H6MA 4C3HG 3B6YA 3T56B 1FGBD 1GUTA 1O7IA 3CRKC 4PMWA 4A3LH 1A63A 5C44G 1KRTA 1JE4A 1A62A 3H94A 3DUZA 5M5YH 1AE3A 1EZ6A 3CCUA 4A75A 2RSOA 1ILQA 1SXTA 4TSSA 1WTQA 3URYA 1K83B 2C35B 3PMFA 4LF5L 4LFBL 3I91A 2IJ0A 1UNSA 1KDAA 2G5DA 2K32A 1N36L 1D5ZC 2MFIA 4MZ9A 4ZKCB 3NE5B 1SYCA 1NAPA 4L8JA 2K28A 4AYBG 2JEAI 4BXXG 1NR4A 2CQAA 1LV9A 3FMCA 4KY7A 3L2PA 3G48A 3I4MH 5JPMC 5G3LD 3H09A 3PO3G 3J80i 1BVSA 1SDFA 3GQBA 1TWHB 2D0OA 2RDFA 2R7FA 1CK1A 1BXTA 4F87A 1F77A 3CD6A 1JORA 3AU7A 4ZK9B 1NSNS 1VCIA 2JA5H 1DOKA 3P75A 3NUCA 3A0JA 2R3ZA 2Q2IA 5EPJA 1BBXC 1ESRA 2RHSB 4B3TQ 4POGA 4K0KL 5M3FG 3HS0C 4UDUC 2R7ZB 2DN8A 5IP7G 2YU9B 2SOBA 2ES2A 3S16B 4DR3Q 2RVLA 3GTMH 2EY1A 1SROA 3LX0A 1TXYA 1STEA 2V4DA 2L12A 2VUMG 4K14A 1B50A 3Q6SA 3TMEA 1HPCA 1MD2D 2FFKB 2V1CC 4POFA 2A19A 2HHHQ 1JB7A 2AKWB 3HOUB 2B2YC 5A35A 2E75C 1H9KA 2F0FA 2CFMA 2GVAA 4A3DB 1TQOA 4HEDA 1VQDA 2ZXPA 3AQQA 3QB3A 1MJCA 1NR2A 2VQFL 2LS01 4LK1C 2B2WA 1PFMA 1HR0Q 2LFNA 3DLLA 2UUAQ 3OW7A 1PDQA 3K7AB 1TWAH 2TMPA 3KLWA 2PZTA 2RHQB 4K5WA 4L5SA 1CZGA 3S1QH 3OWEB 3VYTA 1JJGA 2F0MA 2QF7A 1KLUD 5M5YB 5EKIA 5CC4A 2K5WA 1ESFA 4ODGA 2WKDA 2B2UA 2HQLA 3VYUA 5LMNL 2YV5A 3HOVH 1U9RA 5D14A 1IBML 2O5JC 1FD7D 2VW9A 1LTTD 5BN3A 3F2BA 1D8LA 4KKTA 1C7YA 3EBEA 3FDTA 1SFOH 3HZXA 1QZHA 1J5EL 3H0GH 4NDXA 1I6HH 2E2HH 1D1IA 1CA6A 3M85A 5ELEA 1V43A 1SE3A 4PG3A 3T1YL 3I4MB 2HIVA 1RODA 3CRLC 2F0SA 1B44D 1I4GA 1JR0D 1RDPD 4KMUC 4LF7Q 1EIYB 2L0CA 2PQEA 4FF1A 2Z4HA 1AE2A 5K36G 2A1AA 1MJEA 1UE1A 3NBHA 1I94Q 3S2HH 2JA5B 2NTSA 4R9WA 5JEAH 1STGA 1QVFA 2PO4A 1JE5A 1U5KA 3NQIA 2ZJQA 1G2SA 2XVSA 2E5LQ 4OO1I 2IX1A 4QIWB 2H1EA 1NE3A 1YNND 2K7VA 1O80A 1X6OA 2RCFA 5EQ0A 1TKWB 1TWFB 4JI2L 1BBUA 4XXEA 2ZJRA 1SLJA 2A6HD 2VB3X 3TZDA 2R93G 4BS9A 4KJOA 3CU7A 4K5XA 4HMJA 1VQ6A 1F9RA 5GROA 1EOVA 2WAQB 2TSSA 1ILPA 1W2BA 3F2CA 3NK9A 3HG9A 1VQMA 1E2WA 4ME3A 2VQEL 5T1GA 2EZVA 4RWSC 3OTOL 3LGJA 2UXDL 1SYBA 3JAME 1A6XA 1JMCA 1BCPC 4HJAA 1CA5A 2F0HA 2JA7G 2A69C 4K6DA 1I6VC 1FNVA 3K5LA 1SE2A 1TWAB 4JI7L 3NELA 2FJ2A 5IWAL 1J6QA 1F9SA 1K0SA 3CCVA 3S1QB 4EQNA 4HJ5A 3TQYA 3E3XA 2OQ0A 1X65A 3BDLA 3KBXA 3KYHC 1PLFA 2UU9Q 4IURA 5JEAJ 1PYSB 3HOVB 3ONAB 3CC7A 4DV6L 1CKOA 1A3TA 1K0RA 2FINB 2HDLA 3E9IA 2NZ1D 1VDZA 4ZAIA 1H9SB 3I8ZA 4BY1H 3SVMA 4JI4L 2Z9HA 4K2LA 1SR3A 5L37A 4JBMA 1SFOB 3BVMA 3T51B 3CCJA 4QQBX 4A3MH 1VQ8A 1VQAA 1EZ8A 1KL9A 2F0VA 3H0GB 1V1PB 1W6KA 5C3EG 4JCVE 1I6HB 4A4IA 3DWPA 4RKBA 5IY0A 5C5MA 3J7YW 4X62L 3FEWX 1CI3M 2PMZE 2HT1A 1HJPA 3E9HA 4X6AH 5EGTA 1SNDA 3TBIB 2EPBA 3BYTB 1W3SA 3MWYW 2AWNA 2EJFC 4A93H 2K5VA 3OW2A 3GTGH 3S2HB 2ZXRA 3KF8A 1Q1EA 3S24A 5CMDA 1VQ9A 3I90A 1OTCA 4IO9A 2EE1A 3GTPH 1Q90A 3NENA 2FMMA 4QUFA 1Q82C 4JPBW 2ZJPA 5KEEA 4QCLA 4Y52H 4BWGB 5M9OA 4YY3Q 4A3IG 3BZCA 4ILWA 1TWCH 1X55A 4DFAA 4CKEA 4BBSH 4FF3A 3PV0A 2IHEA 5JJLA 4DR5Q 3ITPA 1L1OB 2B29A 1HUMA 4RHRA 3PF4A 4DV3Q 4DV2Q 4F8MA 3STBC 4JI8Q 3DEPA 4PZ6A 3ERSX 4KHPL 4LWCA 1HH2P 4ZQ3A 2F0WA 5JJKA 1N32Q 4NXNQ 2L11A 4DR2L 4OHJA 3V2TA 2EY2A 2IHFA 4QB4A 2D0PA 1B53A 2B63H 4JYAL 3OOCA 5EKLA 3SDZA 4NB3A 1A3VA 3BVGA 4JI1Q 3FHWA 2JA8G 5KRUA 3PF5A 3UE0A 4JG2A 5NUCA 1TIID 3GP7A 5F2DA 2B8FA 1WOCA 3NQTA 4DF7A 2PI2A 2EJMA 2Q2UA 1HQRD 4KD3A 1V9PA 5CR3A 1BCPB 4JVZA 2WB1B 3FKIB 1X3QA 2G9DA 2Q8IB 3O13A 4R4TA 3QJYA 4C3JH 1BCPD 4BY1B 3HOWG 1K8MA 4YHHL 1GHJA 4QL5A 2A69D 3VDYA 3J80L 1CSPA 3BJUA 3J81j 4A3MB 5M5XH 2E74C 3H91A 1CKMA 4X64Q 1TS4A 3KF6B 2F3WA 3CCSA 4OIJA 1J9OA 2WKCA 5IGGA 1DM0B 3EA6A 4K2KA 4IFDG 2OWOA 1A0IA 1PH5A 3J80E 4JOIA 3T1HL 2KECA 3GV6A 2BH8A 3CPFA 5CGKA 1JOKA 4KN7C 2KQ3A 3K0YA 3MFYA 1RF2D 3GTGB 5HY6A 4XIGS 3IL8A 4X3UA 3G4SA 5ELDA 3K8AA 2LY7A 4QIWE 3HOYG 5I6YA 1B9MA 1PH8A 3ULLA 2IPKD 4QJFA 4A3CH 4UAIA 2N88A 5IT9c 1PZJD 1HXYD 5EJWA 4GN4B 4DAYB 2DGYA 4WORA 4X3SA 5EPKA 4DNIA 1RKNA 2WAQE 1TWCB 4XTCS 1XMOL 2ZT9C 1WTRA 4B3TL 1H9MA 2L4NA 1XPUA 2F0KA 1EY5A 3IFTA 2QA4A 2VXWA 2B2VC 3A7AB 1I50H 4DR3L 5FO8B 1FJGQ 1GJXA 1MSGA 4OGQC 5IGCA 5E4WC 5C4HA 5AJ3Q 2F0QA 4GLVB 5FK9C 1HZCA 4DR4Q 2KVMA 1QCBD 1GOZA 2BCOA 3KLSX 2HHHL 5BN5A 2B63B 5JVH3 1EOTA 1PZID 2VS1A 1HR0L 2UUAL 3X3MA 3ND8A 4BBRH 4DAPA 4OWXB 1EWIA 2PNRC 2LXKA 3KJOA 4L6TB 3NWTA 3J81i 3I56A 1AN8A 3HOXH 4A3GG 1ET9A 5CV4A 4LMQD 5DNFA 5D3DA 4LF4L 5ELFA 4U68A 4PQXA 4KY5A 3FPUB 1N34Q 1XNQL 1QVGA 1X3PA 3K5NA 5DEHA 1FYCA 2HUGA 1QUQA 4KLKA 4KN4C 1SSOA 2F4IA 3VR2A 3EN2A 1IZ6A 2F0TA 5M5XB 3CMEA 4X3TA 2ZM6Q 3E6ZX 3W1GA 4P2CB 3A55A 2NWGA 1Y8OB 4DNTB 5C0XI 1NNXA 3CQZH 4K5VA 3M7NA 2JK8A 1CQVA 2F3IA 2L55A 3VA5A 3D6CA 1XX8A 4YWMA 1IYVA 3JAMc 2K5NA 4YWLA 1ASZA 2ZTCA 4LW1A 5FLMH 1S5FD 2B3GA 4LF7L 4GLXA 3HOUG 4FP5D 2M2LA 3MVVA 4ZCKA 1DJRD 1EY4A 3N6RA 1QG7A 2K03A 2AQ2B 1F2LA 1I94L 1XNRQ 2KHIA 3NSWA 2RF4A 1B70B 1Q8KA 1GKHA 1LT6D 4C3IH 2L1BA 3RNUA 2E5LL 4GN5A 1BCPF 1STAA 2QILA 1WD0A 1G6ZA 1I50B 1FNUA 4IOAA 4DV4Q 1U4MA 4DUYQ 3NP8A 1L2FA 3KOJA 2NVTH 1XYIA 4B3RQ 1VQIA 4RG1A 1JOOA 2O5IC 2KEEA 1DXMA 4EQPA 1S40A 3HKZE 2WIIB 5J22A
chains in the Genus database with same CATH topology
5KNDA 4ULLA 1TS2A 1SMYC 4M8AA 2IL8A 4BBRB 3G6JB 3WOFA 2EY6A 1BQQT 1ICWA 2KCNA 2KA7A 3HOXB 4FXDA 4CBVA 5CV5A 4GZYC 1I4XA 1VMCA 1LTRD 3K5MA 1EYDA 1PFNA 2K33A 4YIJA 5KNCA 4WRDA 1WTOA 2B2WC 1Q3LA 4OL7A 2QCPX 4ME5A 4H0LC 2AQ3B 1MI2A 1I4RA 3CQZB 2RQXA 5CORA 3M4YA 4G7HC 5FO7B 3S14B 2D5DA 2E2DC 2QKIC 1F2MA 3G7LA 3AB9A 4L63B 2RDGA 5C6AA 2F3VA 1YNNC 4F7XA 1U4RA 3OPOA 1O7LA 2A6HC 4H7BA 4DA2A 1A15A 2X6LA 3MA2B 3R3OA 4XQJA 2BA0A 1SE4A 3C46A 2HCIA 2HDMA 3TP6A 2AQ1B 4OO1G 3VA7A 1EU4A 2CW0D 3T16A 4CHTB 4ZUJA 3MXUA 4NKLA 4ABNA 4K6LA 4WJWA 4G7ZC 1I4QA 4IZ8A 3E5SA 3K58A 4B9WA 3OMCA 1H9RA 4A3KB 2Z4IA 3IKJA 5HURA 4KK7A 3EJIA 2Z8LA 1BNZA 4O1NA 3DHQA 1CM9A 1HTLD 3K59A 1B1ZA 2I46A 2E76C 3R2IA 1LTSD 5FLXL 1OXVA 4HAEA 1JWMD 1SMYD 3VYSA 1STHA 1AFPA 1DD2A 2O4XA 5FLXE 2MUYA 1ZKOA 5IODA 5A2QL 4IUUA 1DCZA 2SEBD 1WTWA 3C1FA 4ZUIA 3LWEA 4XDXA 4V0BA 4N9PA 4OIKA 3MXGA 1MGSA 2K05A 2JEBI 1FNWA 4A3FB 3I4NB 1ML0D 3W2DA 2NB0A 3HGBA 4DGZA 3BVZA 2EYPA 1KDCA 1WTXA 1ENFA 1JB3A 4LAAA 1RJTA 3GTMB 2A5HA 1PTOH 1DYQA 4C3HB 1VMPA 1T5XD 2F03A 1QNKA 4G4KA 3J81L 1ZYRD 5C44B 1LTID 3BG3A 1CT1D 5I4DA 4XYOA 5ELBA 5J1ZA 5G3LF 2MHVA 4MIUA 5D65A 2B2YA 3PUWA 1K8OA 5JAVA 1XXGA 1Q8IA 4AYBB 4QUCA 4C1NI 5LL6S 3QOJA 5FOBB 4HCEA 4K8IA 5IGBA 3PO3B 4FYDA 3TP7A 4DAVA 1MBYA 2IT1A 5K36H 3A8JE 2I07B 1RHPA 2NTTA 2WINB 2NVQB 3BYYB 4FXKC 2E2HB 4IUTA 2F0PA 5IGDA 2VNUD 3D6WA 1JCKB 1GHKA 2EY5A 3R8BA 1EWCA 1A2UA 5EBCA 2JSOA 3TN2A 1DZ1A 2L9HA 4DK0A 3TSSA 4KHZA 3EQLC 2NN6G 3VR4A 2VB2X 2A68D 2VUMB 1UAPA 2Q8TA 3Q23A 1IKLA 1SBBB 2EDGA 4HTHA 3PUZA 3VYRA 2XSCA 3MEHA 1VF7A 2AWOA 1GXDC 1HQMC 1M8AA 1YNJD 1Z47A 4PMBA 3BDOA 3QOLA 1LACA 3OWFA 4NW2A 4C1NK 4Y7NB 1UUPA 2FMCA 3L9AX 1LTBD 1SNCA 3SXHA 3NWSA 4KKSA 5BN4A 4FF4A 1ET6A 1CTMA 3MAQA 5C4JB 3A8IE 1RD9D 1EY6A 4CKBA 2OF1A 1PRTB 2J0TD 2B8GA 2IWHA 1JQYD 3VR3A 1HCZA 1PRTD 2EJGC 3I70A 1RTOA 3GTLB 1Q1BA 3OHXC 1WTVA 3HEJA 2RSNA 4S3SA 1QNUA 3VR6A 1Y8PB 3GD7A 1IHZA 1IYUA 2WACA 1JICA 2C5CA 1MSHA 3SHLA 1B4OA 4QF4A 1U4LA 1SAPA 4V190 1EEFD 3SK8A 1TY0A 4RGMA 5C0XG 2BA1A 1BO0A 1Z6HA 2NBFA 2DY8A 4H44C 2CHBD 4A93B 3DEOA 4KV6A 4HCSA 3GTPB 2XIWA 1J8IA 1B9NA 1GUOA 1KABA 2SNSA 2K01A 4F88A 2JA7B 2BDOA 5IIFA 3BZDB 4BBSB 1LO5D 4ID6A 4HSPA 2E2IB 1EU3A 1IW7C 3TP8A 1JWSD 4Q0FA 1TR5A 1EL0A 4IUNA 1NCVA 4CJ2C 2HCCA 4R8NA 3KLSA 1RCVD 3V05A 5LL6X 2K6AA 1TWGB 1KLGD 2A6ED 2PW5A 3L3OC 4LJZC 1SNPA 2XN9C 2KOLA 5KYIA 4IFDH 1RTNA 2B2TC 4C3JB 4XYQA 4J1MA 3C2PA 5FO9B 4NP5A 1BUVT 2PYKA 3D3RA 2XRSD 2NVYB 4JBWA 2BE5D 2Q8RE 3MHBA 3N52A 1HA6A 3Q22A 1PYWD 4QMGA 1TS3A 4A3IB 2M9VA 1EQTA 3KUPA 1LT4D 3MTSA 3DM1A 2ICIA 1H9JA 1EEID 3WDNA 2F0LA 2PCFB 2CW0C 4Q5VA 3RZOB 5C3XA 3MC0B 3NTHA 5ISRA 1IKMA 3U9OA 4C2MB 3D4RA 2OT2A 1SJED 4TRDA 1C8CA 1L0XB 4O42A 1D6EC 3K5OA 3ERQA 2JA8B 1W6JA 1SNMA 1HFGA 3X3NA 5EKKA 1STNA 3R2TA 1R9TB 2F1MA 3IFDA 2BDNA 4XQQA 1I4HA 2CVRA 2F0JA 2ENBA 1B3AA 4RA8A 3HOWB 3QIAA 4RFBA 4J8QA 5T1IA 5DM73 3E0JA 3BS1A 1HTPA 3VR5A 2K1BA 1B2TA 5K5PA 2PZUA 4DXGA 1IW7D 3J7AV 4FXGC 3S2DB 2EYHA 1OXXK 2EOTA 2AUJD 2JXMB 2KEDA 3PIP3 2ZXOA 1ZXTA 3RD4A 3IAYA 1PMRA 2PZWA 1KNAA 3GTKB 1SJHD 1HA5A 3MXNA 5JOBA 1HHVA 2RBMA 3OSOA 3HOYB 5CV8A 1ENAA 2N55A 5ELCA 4KTAA 3NTKA 4WFN3 1BDOA 3SR1A 3U9SA 3K6OA 1TT2A 1EY8A 3FPPA 1QE6A 2HQEA 1WD1A 4KKUA 1HFNA 2SDFA 1F2YA 5CYUA 2YYZA 2B2UC 3DWAA 5COYA 3NTIA 1AP0A 5AFWA 1SYGA 4FVMA 3P7JA 1R4PB 4XT1B 4KHVA 1NUCA 4KI0A 4H13C 4U673 4RHSA 4IUQA 1CZWA 3TZUA 2MP1A 1EY9A 2F0UA 5IGEA 4C3IB 2JE6I 4G7OC 4JK1C 3A7LA 1ZYRC 3DWQA 5HGTA 1EYAA 4IUPA 1CQFA 4DK1A 2NUCA 1KAAA 2DNEA 2XNAC 2NVTB 4A3GB 3L7ZC 1I3QB 3OIPA 1G2TA 1TVXA 2PMZB 1Y8NB 1DOMA 5I6WA 2E2JB 5DAUA 4EQOA 1ZEQX 1SNQA 1AW7A 3DMUA 3PUYA 4PV1C 5E3FA 4MHEA 1S4ZA 3S1RB 1EYCA 1AEXA 2A73B 4BA1I 1M4VA 3S17B 5JEAG 1V8QA 1F9QA 5JPNC 3I72A 3S1NB 5E1FA 3PIO3 1BOSA 4I7ZC 5IT9L 5CV7A 1JC7A 4IQZA 5EBDA 5IOCA 1A3UA 4EVOA 2A68C 3GTJB 1S5BD 3NPPA 1GUWA 5IT9E 2EYLA 4Z9CB 3Q0AA 2EYFA 3GO5A 2MJ8A 2EYJA 1O7ZA 3A56A 2K5QA 1SYFA 5C5LA 1S5CD 1YNJC 4OO1H 3EVQA 1QILA 2IW3A 3T4AC 2PW7A 4X3KA 1EY7A 4RGNA 1EIHA 1EFID 2G9HD 4FO2A 1PTOC 3V96A 2XWBB 5A2QE 4RGTA 2BOSA 1BF4A 3RLFA 3C1EA 4J6HA 3K57A 2Z1CA 4DXFA 3HRZC 3W3AA 1C4QA 3NBIA 3NHHA 1LTAD 2XRQD 2IX3A 2KCCA 3M7GA 1Y69U 1EY0A 1SEBD 2NYZD 1GUSA 2F0DA 2J4XA 5D3IB 3SK5A 4ZKBB 1G291 5FKAC 5KYLA 4DNRB 1R4QB 5I2YA 1PRTC 4RAUC 2RDHA 1T5EA 4M1UB 5I2XA 4TQUS 5LHY1 2JYOA 3FVQA 2R6GA 2K04A 4ZYSA 3S1MB 4K8JA 3JAML 1S5DD 3S9WA 2MGSA 4RCNA 3J81E 2D2CC 2QDBA 3KLRA 2XWJB 4E6IA 2AUKA 5CBEE 3P20A 1D5XC 5CBAE 1E2ZA 2GA4B 3MZ5A 1H9SA 3J7AF 1OXTA 2B39A 1II3A 1KNEA 1JWUD 5TSSA 4ZLTF 1EWHA 1U4PA 1V1PA 4IN3A 1WTPA 1DONA 4IALA 4DN4M 4FF2A 1G8ZD 2F0GA 5I9OA 4A3EB 2D9UA 3ND9A 4BY7B 1SNOA 3GV3A 2F0EA 2OXPA 4RKLA 1STYA 1GUGA 5M3FB 3D4DA 1D5MC 1L0YB 4A3JB 5J39A 1LT3D 3D31A 3M4OB 1UEAB 4IUVA 2QEJC 2RKSA 4HR7B 4BA2I 4DU9A 1GUNA 1KDBA 3HOZB 1C48A 4PNYA 4C3JG 3T13A 1WVLA 2JP1A 4PMCA 1PTOB 3SE0A 1JOQA 1DOLA 4B9XA 2A6EC 1PTOD 1O78A 2LMCB 1BR9A 1FR3A 2F0NA 5M5WB 2O2LD 1QOHA 3MFGA 2SNMA 4B08A 3QWNA 5C4ZA 3HP3A 3GTOB 2X6GA 1O7YA 1WCMB 5JJZA 1TS5A 1XTCD 1Z7TA 2BE5C 3OIQA 5CV9A 3T53B 2F0IA 4RGOS 1XWEA 2IX0A 3EROA 1PZKD 2ID0A 1D2BA 2NN6H 1KTKA 1Y1VB 1CFMA 4CKCA 3HKZB 2C9OA 2Y0SB 2PPBC 5DM63 1V1OA 1CHQD 4KJNA 4N9TA 3LNNA 2LKVA 5KIXA 3PO2B 3KK7A 3MXPA 2WV6D 4C56C 3AMUA 3PUXA 3TDQA 1VF5C 4KY6A 2JA6B 4CGYB 3CKIB 2R93B 1S5ED 2EYOA 4DAYA 2J7ZA 4TKOB 1LLRD 2H4OA 5KGUA 1PXUA 3A8KE 3TP5A 3SK6A 1EQVA 2NN6I 3LWUA 3F2UA 3Q24A 1HUNA 2ICEC 1QWYA 3A54A 2MPMA 1LTGD 5KNBA 3OMGA 3I73A 2D62A 3PUVA 2EYMA 3P1HA 3KBGA 1A2TA 1SYEA 4MN3A 2L5TA 2R61A 4NMZA 4RCOA 5C3EB 4CJ1B 3D4WA 4HN7A 5M3MB 5IGFA 3H3VC 3RMHA 1TY2A 2EXZA 2OEOA 1HRJA 5C0XH 4C3IG 4XT3B 1EIGA 3S15B 3RUZA 3ZYYX 3WOEA 1ENCA 4R8IA 1PTOF 4EGVA 4HSVA 2KUMA 1LABA 3I4LA 1D1KA 4RH6A 3QO2A 1TU2B 2X69A 2F0OA 1PFBA 1ONLA 3CHBD 2M00A 1OO9B 5C4XB 4A3BB 1AZQA 3QG1A 1E0BA 1F9PA 2NVXB 4IFDI 1PRTF 2A74C 3M3YB 5JVG3 5EPLA 5CV6A 3R93A 1X32A 1STBA 4HMIA 3UI2A 2WP8J 4KD4A 3C3LA 1Q12A 5C0XJ 4IFDJ 5I9PA 2DNCA 2EVBA 4CJ0B 2K5DA 1I4PA 2B2VA 1IL8A 1SYDA 5E4XA 1OXSC 1AZPA 4I65A 3SK4A 1LT5D 2RA4A 2KJXA 4FNFA 4G57A 3NXWA 3DXJC 1OXUA 1G91A 3GTQB 1Y1WB 3RZDB 1E2VA 3SEBA 3BDCA 1QJOA 3I3CA 1CHPD 2DY7A 3D8GA 2B2TA 1QB5D 1F2ZA 2FHTA 2KHSA 5C3WA 3EFXD 4XQNA 2R92B 4ZRZA 3FRPB 3H6MA 4C3HG 3T56B 1FGBD 1GUTA 3CRKC 4PMWA 1JE4A 3H94A 3DUZA 1EZ6A 2RSOA 1ILQA 1SXTA 4TSSA 1WTQA 3URYA 1K83B 3PMFA 3I91A 2IJ0A 1UNSA 1KDAA 2K32A 1D5ZC 4ZKCB 3NE5B 1SYCA 1NAPA 4L8JA 2K28A 2JEAI 1NR4A 2CQAA 1LV9A 3FMCA 4KY7A 5JPMC 5G3LD 3H09A 1SDFA 3GQBA 1TWHB 2RDFA 1CK1A 1BXTA 4F87A 1F77A 1JORA 3AU7A 4ZK9B 1NSNS 1VCIA 1DOKA 3P75A 3NUCA 2R3ZA 5EPJA 1BBXC 1ESRA 3HS0C 4UDUC 2R7ZB 2DN8A 2YU9B 2SOBA 3S16B 2RVLA 2EY1A 3LX0A 1STEA 2V4DA 2L12A 4K14A 1B50A 3Q6SA 3TMEA 1HPCA 1MD2D 2FFKB 3HOUB 2B2YC 5A35A 2E75C 1H9KA 2F0FA 4A3DB 1TQOA 4HEDA 2ZXPA 3QB3A 1NR2A 2LS01 4LK1C 2B2WA 1PFMA 2LFNA 3OW7A 1PDQA 3K7AB 2TMPA 2PZTA 4K5WA 1CZGA 3OWEB 3VYTA 2F0MA 2QF7A 1KLUD 5M5YB 5EKIA 5CC4A 2K5WA 1ESFA 4ODGA 2WKDA 2B2UA 3VYUA 1U9RA 5D14A 2O5JC 1FD7D 1LTTD 5BN3A 4KKTA 3FDTA 3HZXA 4NDXA 1D1IA 1CA6A 3M85A 5ELEA 1V43A 1SE3A 3I4MB 1RODA 3CRLC 2F0SA 1B44D 1I4GA 1JR0D 1RDPD 4KMUC 2L0CA 2PQEA 4FF1A 2Z4HA 5K36G 3NBHA 2JA5B 2NTSA 4R9WA 5JEAH 1STGA 2PO4A 3NQIA 1G2SA 2XVSA 4OO1I 2IX1A 4QIWB 2H1EA 1YNND 2K7VA 1O80A 5EQ0A 1TKWB 1TWFB 4XXEA 2A6HD 2VB3X 3TZDA 4BS9A 4KJOA 3CU7A 4K5XA 4HMJA 1F9RA 2WAQB 2TSSA 1ILPA 3NK9A 3HG9A 1E2WA 5T1GA 2EZVA 4RWSC 1SYBA 3JAME 1A6XA 1BCPC 1CA5A 2F0HA 2A69C 4K6DA 1I6VC 1FNVA 3K5LA 1SE2A 1TWAB 2FJ2A 1F9SA 3S1QB 4EQNA 3BDLA 3KBXA 1PLFA 4IURA 5JEAJ 3HOVB 3ONAB 1A3TA 2FINB 2HDLA 2NZ1D 1VDZA 4ZAIA 1H9SB 3I8ZA 3SVMA 4K2LA 1SFOB 3BVMA 3T51B 1EZ8A 2F0VA 3H0GB 1V1PB 1W6KA 1I6HB 3DWPA 4RKBA 5C5MA 3J7YW 3FEWX 1CI3M 5EGTA 1SNDA 3TBIB 2EPBA 3BYTB 3MWYW 2AWNA 2EJFC 3S2HB 2ZXRA 3KF8A 1Q1EA 5CMDA 3I90A 2EE1A 1Q90A 2FMMA 4QUFA 5KEEA 4QCLA 4BWGB 5M9OA 4ILWA 4DFAA 4CKEA 4FF3A 3PV0A 3ITPA 1HUMA 4RHRA 4F8MA 3DEPA 4ZQ3A 2F0WA 2L11A 4OHJA 3V2TA 2EY2A 4QB4A 1B53A 3OOCA 5EKLA 3SDZA 1A3VA 3BVGA 5KRUA 5NUCA 1TIID 3GP7A 5F2DA 2B8FA 4DF7A 3NQTA 2EJMA 1HQRD 4KD3A 5CR3A 1BCPB 2WB1B 3FKIB 1X3QA 2G9DA 2Q8IB 3O13A 3QJYA 1BCPD 4BY1B 1K8MA 1GHJA 2A69D 3J80L 4A3MB 2E74C 3H91A 1TS4A 2F3WA 4OIJA 1J9OA 2WKCA 5IGGA 1DM0B 3EA6A 4K2KA 4IFDG 3J80E 2KECA 3GV6A 5CGKA 1JOKA 4KN7C 2KQ3A 3K0YA 3MFYA 1RF2D 3GTGB 4XIGS 3IL8A 4X3UA 5ELDA 2LY7A 5I6YA 1B9MA 2IPKD 4UAIA 2N88A 1PZJD 1HXYD 5EJWA 4WORA 5EPKA 4X3SA 1RKNA 1TWCB 4XTCS 2ZT9C 1WTRA 1H9MA 2L4NA 2F0KA 1EY5A 3IFTA 2VXWA 2B2VC 3A7AB 5FO8B 1GJXA 1MSGA 5IGCA 4OGQC 5E4WC 5C4HA 2F0QA 5FK9C 2KVMA 1QCBD 1GOZA 2BCOA 3KLSX 5BN5A 2B63B 5JVH3 1EOTA 1PZID 3X3MA 3ND8A 4DAPA 2PNRC 4L6TB 3NWTA 1AN8A 1ET9A 5CV4A 4LMQD 5DNFA 5D3DA 5ELFA 4U68A 4PQXA 4KY5A 3FPUB 1X3PA 3K5NA 5DEHA 1FYCA 2HUGA 4KN4C 1SSOA 2F4IA 3VR2A 2F0TA 5M5XB 4X3TA 3E6ZX 4P2CB 3A55A 2NWGA 1Y8OB 4DNTB 5C0XI 4K5VA 3M7NA 2L55A 1CQVA 3VA5A 3D6CA 1XX8A 1IYVA 1S5FD 4FP5D 2M2LA 3MVVA 1DJRD 1EY4A 3N6RA 1QG7A 2K03A 2AQ2B 1F2LA 3NSWA 1LT6D 2L1BA 1BCPF 1STAA 2QILA 1WD0A 1G6ZA 1I50B 1FNUA 1U4MA 3NP8A 1XYIA 1JOOA 2O5IC 2KEEA 1DXMA 4EQPA 2WIIB 5J22A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KY6 A;  2PZT A;  4K5W A;  3OWF A;  5EKL A;  2EYO A;  4EQN A;  4IZ8 A;  2F0M A;  4ID6 A;  1A3V A;  3C1E A;  4J6H A;  2M00 A;  3BDL A;  3E5S A;  5KRU A;  5HGT A;  1EYA A;  3ERQ A;  2RKS A;  4B9W A;  5CC4 A;  3OMC A;  1EZ6 A;  5NUC A;  3TP8 A;  1SNM A;  5KGU A;  2NUC A;  2EY6 A;  5F2D A;  1KAA A;  3NHH A;  1SNC A;  3NQT A;  4ODG A;  5EKK A;  5J1Z A;  4TRD A;  1STN A;  4DF7 A;  4DU9 A;  5HUR A;  1TR5 A;  1KDB A;  3SXH A;  4KD3 A;  5CV4 A;  5ISR A;  5CR3 A;  1U9R A;  3EJI A;  4PNY A;  3PMF A;  4IUN A;  3TP5 A;  3SK6 A;  5CV5 A;  1EQV A;  1A3T A;  1EY0 A;  3DHQ A;  4MIU A;  5CV6 A;  3T13 A;  4KY5 A;  1KDA A;  2F0J A;  5I6W A;  4PMC A;  2ENB A;  2F0D A;  5DAU A;  3SK5 A;  4R8N A;  1EY6 A;  4K2L A;  5KYL A;  5DEH A;  1JOQ A;  1STB A;  1SYC A;  3HZX A;  4B9X A;  2OF1 A;  4HMI A;  4EQO A;  1EYD A;  5JAV A;  1EZ8 A;  2F0V A;  4NDX A;  2F0T A;  4KD4 A;  4KY7 A;  4YIJ A;  1SNQ A;  4WRD A;  3DMU A;  2PW5 A;  3OMG A;  5E3F A;  4OL7 A;  3QOJ A;  4ME5 A;  5I9P A;  4RKB A;  2F0S A;  2F3W A;  5C5M A;  4K8I A;  2F0N A;  5K5P A;  5IGB A;  2RDF A;  2PZU A;  5IGG A;  1STH A;  1SNP A;  2EYM A;  3P1H A;  1JOR A;  2SNM A;  1A2T A;  4K5V A;  4K2K A;  1SYE A;  2EYH A;  3TP7 A;  5KYI A;  2PQE A;  5C4Z A;  5EGT A;  1EYC A;  1AEX A;  1SND A;  1SYD A;  3VA5 A;  3D6C A;  3HEJ A;  4K8J A;  4S3S A;  3S9W A;  5CGK A;  5J22 A;  1NSN S;  1JOK A;  2KQ3 A;  2O4X A;  2QDB A;  4J1M A;  4I65 A;  4E6I A;  3P75 A;  1STG A;  3SK4 A;  2PZW A;  3NUC A;  1IHZ A;  4NMZ A;  1F2M A;  5JOB A;  4NP5 A;  2RBM A;  2WAC A;  3MZ5 A;  5C6A A;  5IOD A;  2PYK A;  3OSO A;  3MVV A;  2F0P A;  2F3V A;  1EY4 A;  5E1F A;  3SHL A;  5I6Y A;  5IGD A;  1II3 A;  3D4W A;  4G57 A;  5CV8 A;  3NXW A;  3C1F A;  2EY5 A;  4ZUI A;  4F7X A;  5CV9 A;  4QF4 A;  1ENA A;  5CV7 A;  5IGF A;  3MHB A;  3SK8 A;  2SOB A;  2EXZ A;  4KTA A;  2OEO A;  5IGE A;  5KEE A;  4H7B A;  2F0I A;  4WOR A;  1A2U A;  4N9P A;  5IOC A;  1A3U A;  1RKN A;  5M9O A;  2EY1 A;  4IAL A;  3SR1 A;  4EVO A;  4QMG A;  4KJO A;  4DFA A;  3ERO A;  3LX0 A;  4K5X A;  1TT2 A;  1EY8 A;  3BDC A;  3R3O A;  4HMJ A;  3RUZ A;  2F0K A;  2HQE A;  1EY5 A;  4K14 A;  1STA A;  1F2Y A;  2F0G A;  5I9O A;  3D8G A;  3ITP A;  3TME A;  2EYL A;  1ENC A;  3NK9 A;  2EYF A;  1SNO A;  2F0E A;  4KV6 A;  2F0L A;  3TP6 A;  2OXP A;  4RKL A;  1F2Z A;  4HTH A;  2KHS A;  4F8M A;  5C3W A;  3NP8 A;  1SYG A;  5C3X A;  2EYJ A;  2F0F A;  5C5L A;  4DGZ A;  1SYF A;  5IGC A;  1STY A;  2EYP A;  1SYB A;  1KAB A;  1TQO A;  3MEH A;  1KDC A;  3EVQ A;  4KHV A;  4KJN A;  4N9T A;  1NUC A;  2F0W A;  2SNS A;  3D4D A;  3QB3 A;  4ZQ3 A;  5C4H A;  3T16 A;  2F0Q A;  2LKV A;  3U9O A;  5KIX A;  2F0H A;  4LAA A;  1JOO A;  2PW7 A;  3MXP A;  4PMB A;  4ZUJ A;  4EQP A;  4K6D A;  5J39 A;  3V2T A;  2EY2 A;  3H6M A;  3QOL A;  4NKL A;  4QB4 A;  1EY7 A;  1EY9 A;  5IIF A;  2F0O A;  2F0U A; 
#chains in the Genus database with same CATH topology
 4O2D A;  2Y0S E;  2CCZ A;  1DGS A;  5KND A;  3W1B A;  1PA6 A;  2ZTD A;  4ULL A;  1TS2 A;  3L0O A;  1SMY C;  4M8A A;  2IL8 A;  4A3K H;  4BBR B;  3G6J B;  3WOF A;  2ALY B;  2EY6 A;  1BQQ T;  1ICW A;  2KCN A;  2KA7 A;  2KCT A;  3HOX B;  4FXD A;  1MHW C;  4CBV A;  5CV5 A;  5GAD C;  4L5R C;  4GZY C;  1I4X A;  1VMC A;  4GLA C;  1LTR D;  5H1S E;  2UU9 L;  3K5M A;  1EYD A;  1PFN A;  2K33 A;  5FJ8 H;  2OCE A;  2K50 A;  4YIJ A;  5KNC A;  4HIM A;  4WRD A;  1WTO A;  2B2W C;  1Q3L A;  4OL7 A;  2QCP X;  4ME5 A;  4GNX B;  1G6P A;  5LMU Q;  4H0L C;  2AQ3 B;  1MI2 A;  1I4R A;  3CQZ B;  3RLO A;  2RQX A;  5COR A;  3M4Y A;  4G7H C;  4NXM Q;  5FO7 B;  4DUZ Q;  3S14 B;  2WAQ G;  2MQH A;  2D5D A;  2E2D C;  4YCW A;  2QKI C;  1F2M A;  3G7L A;  3AB9 A;  3F2D A;  4L63 B;  2RDG A;  5C6A A;  2F3V A;  1VQL A;  1NJI C;  1YNN C;  3DM3 A;  4F7X A;  1U4R A;  3G71 A;  3OPO A;  1O7L A;  1PFS A;  2A6H C;  4H7B A;  4DA2 A;  1BKB A;  1A15 A;  2X6L A;  3MA2 B;  1RIP A;  3U50 C;  3R3O A;  1VS0 A;  4XQJ A;  2NZO A;  1CKN A;  4A3E G;  2PNH A;  4BY7 G;  4A3F H;  2BA0 A;  3I4N H;  1SE4 A;  3C46 A;  1D7Q A;  1X56 A;  2HCI A;  3IRB A;  2HDM A;  5ELN A;  2QW7 A;  3TP6 A;  1E1T A;  1XMQ Q;  5IYC G;  3M4Q A;  2AQ1 B;  4OO1 G;  3VA7 A;  1EU4 A;  2CW0 D;  2K5H A;  4A76 A;  4LNQ A;  1VQF A;  4A3J G;  3T16 A;  2IY5 B;  4DR5 L;  4CHT B;  4ZUJ A;  2CWP A;  2UXC Q;  3MXU A;  4DV3 L;  4NKL A;  4ABN A;  4DV2 L;  4K6L A;  4C3H H;  2HIX A;  4WJW A;  4G7Z C;  1I4Q A;  4IZ8 A;  1S72 A;  4DR7 L;  1N32 L;  4R4Q A;  3E5S A;  4NXN L;  3K58 A;  5C44 H;  4B9W A;  2MO1 A;  3OMC A;  1B3Q A;  1H9R A;  4A3K B;  2Z4I A;  4UP9 A;  2UUB Q;  3IKJ A;  5HUR A;  4KK7 A;  3HOZ G;  1CKN B;  1IBK Q;  3EJI A;  2Z8L A;  3CPW A;  1BNZ A;  4O1N A;  3DHQ A;  5GAG C;  4JI1 L;  2ASB A;  1CM9 A;  1HTL D;  3K59 A;  4N8F A;  2CWA A;  2EXD A;  1L0W A;  1B1Z A;  1K28 A;  1V1Q A;  4OXP A;  2LXJ A;  4BXX H;  4HJ7 A;  2I46 A;  1K73 C;  2E76 C;  3R2I A;  2A8V A;  1LTS D;  5FLX L;  1OXV A;  4HAE A;  1JWM D;  1SMY D;  3PO3 H;  3VYS A;  1STH A;  1FVI A;  1ICF B;  1IYJ B;  1AFP A;  2WFW A;  1DD2 A;  3M9B A;  4X64 L;  2Q2T A;  1HNX L;  3CCL A;  2Z6K C;  2O4X A;  1WCM G;  1M90 C;  2NVQ H;  5FLX E;  3PCO B;  2ZTE A;  2MUY A;  4DV1 Q;  1ZKO A;  5IOD A;  5A2Q L;  1HNZ Q;  4IUU A;  4LF8 Q;  2LSS A;  1DCZ A;  2SEB D;  3HFZ B;  1WJJ A;  1WTW A;  3C1F A;  4ZUI A;  5LMN W;  3LWE A;  5M3F H;  5IP7 H;  4APV A;  4JC0 A;  3U58 A;  4XDX A;  4V0B A;  1X3E A;  4N9P A;  4OIK A;  4CDD C;  4DR6 Q;  4GOP A;  3MXG A;  1MGS A;  2K05 A;  1Y1V G;  2JEB I;  3HKZ G;  3CF5 A;  1FNW A;  2VUM H;  1VQN A;  2Y0S G;  4A3F B;  1IXR A;  3I4N B;  1ML0 D;  3W2D A;  1L1O C;  2NB0 A;  4CDE C;  3HGB A;  4DGZ A;  3BVZ A;  3FKI G;  2EYP A;  1KDC A;  1WTX A;  3PO2 G;  1ENF A;  1JB3 A;  4LAA A;  1RJT A;  1UE6 A;  5GQO A;  4DV0 L;  1NBW A;  3GTM B;  1VQ7 A;  2JA6 G;  2A5H A;  1PTO H;  1DYQ A;  1PH7 A;  4C3H B;  5DLQ E;  1VMP A;  5GAH C;  1T5X D;  2F03 A;  1QNK A;  4G4K A;  5BR8 Q;  1NMF A;  3J81 L;  5AJ3 L;  4Y7N H;  1ZYR D;  5C44 B;  1LTI D;  3BG3 A;  1CT1 D;  5I4D A;  4XYO A;  4DR4 L;  5ELB A;  3NBH B;  5J1Z A;  4UP7 A;  3MEF A;  5G3L F;  3CCQ A;  2MHV A;  1VQP A;  5IP9 G;  2YTV A;  3K7U C;  4MIU A;  5D65 A;  1VQE A;  2B2Y A;  4DR1 Q;  5C4J H;  1XPR A;  3RN5 A;  3K0X A;  1WCM H;  3PUW A;  4DAM A;  1K8O A;  5JAV A;  3NEM A;  1XXG A;  1KXL A;  1Q8I A;  2JJQ A;  4AYB B;  2EQS A;  4QUC A;  4C1N I;  1X3G A;  5LL6 S;  1X54 A;  3QOJ A;  5FOB B;  4HCE A;  5E7N A;  4K8I A;  1N34 L;  5IGB A;  4DK3 C;  3PO3 B;  4JV5 Q;  1GM5 A;  1YJ9 A;  3GTL H;  4HJ9 A;  1PYB A;  4FYD A;  1VQO A;  4P75 A;  3TP7 A;  4CDF C;  1KHI A;  4DAV A;  1MBY A;  2IT1 A;  2ZM6 L;  3TEH B;  5K36 H;  3A8J E;  1VQG A;  2I07 B;  1RHP A;  2N3S A;  2NTT A;  1VQH A;  2EIF A;  2WIN B;  5IE8 A;  2NVQ B;  1E24 A;  3PGZ A;  3BYY B;  4FXK C;  3W5O A;  2E2H B;  4IUT A;  2F0P A;  5IGD A;  2VNU D;  3D6W A;  1JCK B;  5M3M G;  1GHK A;  2EY5 A;  1U0L A;  3M4P A;  2PQA A;  3A5U A;  3R8B A;  1EWC A;  1A2U A;  1ASY A;  4JI6 L;  3UE1 A;  3I55 A;  1RL2 A;  2JSO A;  5EBC A;  3TN2 A;  1DZ1 A;  2L9H A;  4DK0 A;  3TSS A;  4KHZ A;  3EQL C;  2JA6 H;  2NN6 G;  3VR4 A;  2R93 H;  2VB2 X;  2A68 D;  1XNR L;  4LF5 Q;  2VUM B;  1UAP A;  4R1J A;  2Q8T A;  3Q23 A;  1IKL A;  1SBB B;  2I5L X;  2EDG A;  4HTH A;  1UE7 A;  4JOI C;  3PUZ A;  3VYR A;  4PZ8 A;  3BZK A;  2XSC A;  3MEH A;  4LFC Q;  1VF7 A;  1K3B C;  2AWO A;  1GXD C;  1HQM C;  1M8A A;  1YNJ D;  1Z47 A;  4PMB A;  3BDO A;  3QOL A;  2JA7 H;  4IPC A;  1LUZ A;  4DV4 L;  1LAC A;  3OWF A;  5C4X G;  4A3B G;  1PH4 A;  2E2I H;  1G51 A;  4B3R L;  4NW2 A;  4C1N K;  4Y7N B;  1UUP A;  2FMC A;  3L9A X;  3KDF A;  1LTB D;  1SNC A;  3K80 C;  3SXH A;  3KF8 B;  3NWS A;  4UP8 A;  1JJ2 A;  1Q46 A;  4KKS A;  5BN4 A;  4FF4 A;  1ET6 A;  1CTM A;  3MAQ A;  5C4J B;  3A8I E;  2F4V Q;  1RD9 D;  1EY6 A;  3CCM A;  4HIO A;  4CKB A;  2OF1 A;  2I0Q A;  4TVA B;  1PRT B;  2J0T D;  1TWG H;  2B8G A;  2IWH A;  1JQY D;  3VR3 A;  5C3E H;  1HCZ A;  1PRT D;  2EJG C;  3I70 A;  4LF6 Q;  2CH4 W;  4JW0 A;  1RTO A;  3GTL B;  5IYB G;  1Q1B A;  3OHX C;  1WTV A;  1Q81 C;  3HEJ A;  2RSN A;  4S3S A;  3S15 H;  1QNU A;  3VR6 A;  1LM0 A;  1K8A C;  1Y8P B;  5LMU L;  3GD7 A;  1IHZ A;  1IYU A;  1EFW A;  3CC4 A;  2WAC A;  1E3P A;  2NVY H;  3I2Z A;  1JIC A;  1UE5 A;  2C5C A;  1MSH A;  3SHL A;  1M1K C;  1KIX A;  1B4O A;  4QF4 A;  1T9H A;  1U4L A;  4DUZ L;  4P72 A;  1SAP A;  4JI0 Q;  1EEF D;  3SK8 A;  4V19 0;  1TY0 A;  4RGM A;  5C0X G;  1Y1W G;  2BA1 A;  4JBJ A;  4MNO A;  1BO0 A;  1Z9F A;  1Z6H A;  2NBF A;  2DY8 A;  1YVC A;  4H44 C;  4DV5 Q;  4A3I H;  1YNX A;  5LMN Q;  2CHB D;  4A93 B;  1CSQ A;  4JI5 Q;  3Q8D A;  3DEO A;  1Q7Y C;  4A3B H;  1VQJ A;  4KV6 A;  3UDG A;  4HCS A;  4QGU A;  5ELO A;  3GTP B;  4IOC A;  3RZO H;  2R7D A;  4PZ7 A;  1VQ4 A;  2XIW A;  1J8I A;  2R92 G;  1B9N A;  1GUO A;  1KAB A;  1YJW A;  2SNS A;  4L5T A;  4LF9 Q;  4C2M H;  2K01 A;  4F88 A;  1PH3 A;  2JA7 B;  1HNW Q;  3CXC A;  2BDO A;  5IIF A;  3BZD B;  1C9O A;  1XMQ L;  4BBS B;  2VL6 A;  3A5Z B;  2CKZ B;  1LO5 D;  4ID6 A;  3U4V A;  4HSP A;  2E2I B;  1E7Z A;  1EU3 A;  1IW7 C;  2JA8 H;  2UXC L;  5FLX c;  3TP8 A;  1JWS D;  4Q0F A;  1R9T H;  1TR5 A;  1EL0 A;  4IUN A;  5HGQ A;  1NCV A;  4GKJ Q;  4X66 Q;  3WWV A;  4CJ2 C;  3AYH B;  2HCC A;  4R8N A;  3HOW H;  2KCM A;  3KLS A;  1RCV D;  1KC8 C;  2UUB L;  4HJ8 A;  1JT8 A;  2DUD A;  3V05 A;  2GN5 A;  5LL6 X;  2K6A A;  1TWG B;  1KLG D;  1YIJ A;  2A6E D;  2PW5 A;  5J3B A;  4GNX C;  3L3O C;  3JC6 6;  4LJZ C;  1SNP A;  3S2D H;  2XN9 C;  2KOL A;  5KYI A;  4IFD H;  3CMA A;  1RTN A;  2B2T C;  4C3J B;  1WTH A;  4XYQ A;  4J1M A;  2QEX A;  3C2P A;  1N33 Q;  3GTK H;  3GDE A;  3JAM i;  1B7Y B;  1QZG A;  5FO9 B;  4NP5 A;  1HR0 W;  4IPH A;  4AQY Q;  5IYD G;  1BUV T;  2PYK A;  3D3R A;  2XRS D;  2NVY B;  4JI7 Q;  3HOY H;  2R7Z G;  4JBW A;  4LFA Q;  2K4K A;  3H3V H;  2KBN A;  2BE5 D;  2Q8R E;  3MHB A;  3N52 A;  1HA6 A;  3J7A 5;  3Q22 A;  1PYW D;  2N78 A;  4DV1 L;  1HNZ L;  4QMG A;  1TS3 A;  4LF8 L;  4A3I B;  3G6E A;  2M9V A;  1LTL A;  3AFP A;  1EQT A;  3KUP A;  1LT4 D;  3MTS A;  3DM1 A;  2ICI A;  1H9J A;  1PH6 A;  3D0F A;  3ULP A;  1EEI D;  2RCN A;  3WDN A;  2F0L A;  4DR6 L;  2PCF B;  1LYL A;  2CW0 C;  4Q5V A;  4A3D G;  3RZO B;  5C3X A;  2MNA A;  3MC0 B;  4UY8 C;  3NTH A;  5ISR A;  1IKM A;  1QUQ B;  3U9O A;  1PHJ A;  4C2M B;  3D4R A;  2OT2 A;  1SJE D;  1X9N A;  1WYD A;  4TRD A;  4CDC C;  1C8C A;  4A3L G;  1L0X B;  1SN8 A;  4O42 A;  1K9M C;  1D6E C;  3K5O A;  3ERQ A;  4B3S Q;  1WFQ A;  3H3V I;  2JA8 B;  1W6J A;  1SNM A;  1HFG A;  3X3N A;  5EKK A;  1STN A;  3R2T A;  1SRU A;  1R9T B;  2F1M A;  2DJG C;  3IFD A;  2BDN A;  4XQQ A;  1XJV A;  4A3G H;  1I3Q H;  1I4H A;  1UWV A;  2CVR A;  5BR8 L;  2E2J H;  2F0J A;  1PH2 A;  2ENB A;  1B3A A;  3FP9 A;  4RA8 A;  3HOW B;  3KJP A;  3QIA A;  4J15 A;  4RFB A;  4J8Q A;  5T1I A;  3I4M G;  5DM7 3;  1AH9 A;  3E0J A;  3BS1 A;  1PV4 A;  1HTP A;  3VR5 A;  2WB1 E;  2K1B A;  4DR1 L;  1B2T A;  5K5P A;  1HZ9 A;  2PZU A;  4DXG A;  1IW7 D;  4AIM A;  1GO3 E;  3J7A V;  4FXG C;  4DPG A;  3S2D B;  3S1R H;  2EYH A;  1OXX K;  2EOT A;  3AFQ A;  3CW2 C;  3S17 H;  4GKK Q;  2JA5 G;  2AUJ D;  2JXM B;  4OX9 Q;  2KED A;  3PIP 3;  4DK6 C;  2ZXO A;  1ZXT A;  3RD4 A;  3IAY A;  1PMR A;  3TS0 A;  4JV5 L;  2PZW A;  1KNA A;  3GTK B;  1SJH D;  4DR2 Q;  3S1N H;  1HA5 A;  3MXN A;  5JOB A;  1HHV A;  2RBM A;  4JBK A;  3OSO A;  3HOU H;  3HOY B;  4JYA Q;  3KFU A;  4IJH A;  4P71 A;  5CV8 A;  2UUC Q;  2VZA A;  1ENA A;  3CP0 A;  2N55 A;  5ELC A;  4KTA A;  3NTK A;  4WFN 3;  3PSI A;  1BDO A;  3SR1 A;  2KHJ A;  3U9S A;  3K6O A;  3GTJ H;  1TT2 A;  1EY8 A;  1CUK A;  3FPP A;  1QE6 A;  2HQE A;  1WD1 A;  4KKU A;  1HFN A;  2SDF A;  1F2Y A;  5CYU A;  2YYZ A;  2XGT A;  2B2U C;  1PVO A;  4YHH Q;  3DWA A;  4QY7 A;  5COY A;  3NTI A;  1AP0 A;  5AFW A;  1SYG A;  4FVM A;  3P7J A;  1R4P B;  4XT1 B;  4KHV A;  1NUC A;  1Q86 C;  4KI0 A;  4H13 C;  4U67 3;  3MXN B;  4RHS A;  4IUQ A;  3H15 A;  1CZW A;  3TZU A;  2MP1 A;  1EY9 A;  2GVB A;  2F0U A;  5IGE A;  1PH9 A;  4C3I B;  2JE6 I;  4G7O C;  4JK1 C;  3TS2 A;  3A7L A;  1ZYR C;  4LFC L;  1MKH A;  4DKA C;  3DWQ A;  3T1H Q;  5HGT A;  1EYA A;  4IUP A;  2Z6B A;  1CQF A;  4GS3 A;  4DK1 A;  2NUC A;  4YY3 L;  4GOP C;  1YHQ A;  1KAA A;  2DNE A;  4UPA A;  3HOV G;  4OWW B;  1MIU A;  2XNA C;  2F52 A;  2NVT B;  4A3G B;  3L7Z C;  1I3Q B;  3OIP A;  1G2T A;  2XTI A;  3I7F A;  1TVX A;  2PMZ B;  1Y8N B;  1DOM A;  5I6W A;  2E2J B;  5DAU A;  2Z0S A;  4JI8 L;  3H0G G;  4EQO A;  1ZEQ X;  3J80 c;  1SNQ A;  1AW7 A;  4JI3 Q;  3DMU A;  3PUY A;  4PV1 C;  1XMO Q;  2DJF C;  5E3F A;  2I5H A;  4EQ5 A;  4MHE A;  2F4V L;  1EQR A;  1S4Z A;  1SMX A;  4DV7 Q;  3S1M H;  1TWF H;  1P16 A;  3S1R B;  1EYC A;  1AEX A;  1YJN A;  2A73 B;  4BA1 I;  1M4V A;  3S17 B;  3ZJY C;  4R4I A;  2E8G A;  5JEA G;  4YCU A;  1V8Q A;  3PIP A;  1F9Q A;  4LF6 L;  5JPN C;  3I72 A;  2CH4 A;  1P8L A;  3S1N B;  4X65 Q;  3PQI A;  5E1F A;  3PIO 3;  1BOS A;  2AMC B;  2UXB Q;  4I7Z C;  5IT9 L;  5CV7 A;  1JC7 A;  4IQZ A;  3BU2 A;  5EBD A;  4WJ4 A;  5IOC A;  1A3U A;  4EVO A;  2A68 C;  3GTJ B;  1S5B D;  4IPG A;  4LF4 Q;  3NPP A;  4JI0 L;  1GUW A;  4A3E H;  2EYL A;  5IT9 E;  4BY7 H;  2OTL A;  4B3M Q;  2ATW A;  4Z9C B;  4GN3 B;  3Q0A A;  2EYF A;  1XNQ Q;  4P73 A;  4HIK A;  3GO5 A;  2MJ8 A;  2EYJ A;  1O7Z A;  3A56 A;  2K5Q A;  1SYF A;  5C5L A;  4DV5 L;  3ICE A;  5IYC H;  1S5C D;  1YNJ C;  4OO1 H;  3EVQ A;  3I4O A;  1QIL A;  4JI5 L;  2IW3 A;  3T4A C;  4A3J H;  2PW7 A;  4X3K A;  1EY7 A;  4RGN A;  4HID A;  3M4O H;  1EFI D;  1EIH A;  2G9H D;  4FO2 A;  1PTO C;  1E22 A;  2XWB B;  3V96 A;  5A2Q E;  1YHA A;  4RGT A;  2BOS A;  1BF4 A;  3RLF A;  3C1E A;  4J6H A;  3K57 A;  4LF9 L;  4O0A A;  2Z1C A;  4DXF A;  3HRZ C;  1EIF A;  3W3A A;  1C4Q A;  1HNW L;  3NBI A;  3NHH A;  1LTA D;  2XRQ D;  3UDF A;  2WB1 G;  2KCC A;  2IX3 A;  1YHB A;  3M7G A;  1K8G A;  3HOZ H;  1XPO A;  1Y69 U;  1EY0 A;  4BY1 G;  1SEB D;  2NYZ D;  1GUS A;  2F0D A;  2J4X A;  5D3I B;  3SK5 A;  4ZKB B;  1G29 1;  5FKA C;  5KYL A;  4DNR B;  4A3M G;  1FJG L;  2MO0 A;  5EAY A;  1R4Q B;  1S3O A;  1KQS A;  5I2Y A;  1PRT C;  1YZ6 A;  4RAU C;  4GKJ L;  4X66 L;  2RDH A;  5M5W H;  4GOP B;  1T5E A;  4M1U B;  5I2X A;  4TQU S;  5LHY 1;  2JYO A;  3FVQ A;  2R6G A;  2K04 A;  4ZYS A;  3S1M B;  1IBL Q;  4I7A A;  2N8N A;  4K8J A;  3JAM L;  1S5D D;  3S9W A;  4A93 G;  2MGS A;  3GTO H;  3CCR A;  4RCN A;  3J81 E;  2D2C C;  2QDB A;  3KLR A;  2XWJ B;  4E6I A;  2AUK A;  5CBE E;  3P20 A;  1D5X C;  5CBA E;  1E2Z A;  2GA4 B;  3MZ5 A;  1H9S A;  3J7A F;  1OXT A;  2B39 A;  1NMG A;  1II3 A;  1E1O A;  1EYG A;  1KNE A;  3PIO A;  1JWU D;  5TSS A;  4ZLT F;  1EWH A;  1U4P A;  1V1P A;  4IN3 A;  1N33 L;  2CQO A;  1WTP A;  1DON A;  4ALP A;  4AQY L;  4IAL A;  4BBS G;  4DN4 M;  4FF2 A;  3TRE A;  1G8Z D;  1Y1V H;  4LFA L;  2F0G A;  5I9O A;  4A3E B;  2D9U A;  3ND9 A;  4BY7 B;  2K75 A;  1SNO A;  1EUJ A;  2F0E A;  2Z6K A;  3GV3 A;  2OXP A;  4RKL A;  1GUG A;  1STY A;  3ER0 A;  3FKI H;  5M3F B;  3D4D A;  1PH1 A;  3PO2 H;  1D5M C;  1L0Y B;  1XTD A;  4A3J B;  1FGU A;  5J39 A;  2B63 G;  1LT3 D;  3D31 A;  3M4O B;  5GAE C;  1UEA B;  4MTK A;  4LFB Q;  4IUV A;  2QEJ C;  1N36 Q;  2RKS A;  4H02 A;  4R4C A;  4HR7 B;  3UDI A;  4BA2 I;  4DU9 A;  1GUN A;  1WI5 A;  2OTJ A;  1KDB A;  1L1O A;  3HOZ B;  1C48 A;  4PNY A;  3RLN A;  4C3J G;  3T13 A;  5IP9 H;  1WVL A;  4B3S L;  2JP1 A;  4PMC A;  4OON A;  1PTO B;  3SE0 A;  1JOQ A;  4DUY L;  1DOL A;  4B9X A;  2A6E C;  1PTO D;  1YBY A;  2PQA B;  1O78 A;  2LMC B;  1BR9 A;  1FR3 A;  4IJL A;  2F0N A;  5M5W B;  2O2L D;  1QOH A;  3RN2 A;  3MFG A;  2SNM A;  1YIT A;  4B08 A;  1YEZ A;  3QWN A;  5C4Z A;  2P5Z X;  4K0K Q;  3HP3 A;  3TRZ A;  3CC2 A;  3GTO B;  2X6G A;  1O7Y A;  1WCM B;  2FXQ A;  5JJZ A;  1VQK A;  1X3F A;  2JQO A;  1TS5 A;  4A3C G;  1XTC D;  1Z7T A;  2BE5 C;  3OIQ A;  4GKK L;  4OX9 L;  5CV9 A;  3T53 B;  5M3M H;  4DR7 Q;  4OWT B;  2F0I A;  3KF6 A;  1FL0 A;  1UEB A;  4RGO S;  2BH2 A;  1XWE A;  2HD3 A;  2IX0 A;  3ERO A;  4AH6 A;  3KDF B;  1PZK D;  2ID0 A;  1D2B A;  2NN6 H;  1KTK A;  2UUC L;  1Y1V B;  1CFM A;  2VQF Q;  4CKC A;  3HKZ B;  2C9O A;  1N8R C;  1GVP A;  2Y0S B;  2PPB C;  5DM6 3;  3F8T A;  1VQC A;  1V1O A;  4NXM L;  1KAW A;  1CHQ D;  4KJN A;  4N9T A;  4R4O A;  1JJC B;  4LUO A;  3LNN A;  2LKV A;  5KIX A;  4IPD A;  3PO2 B;  3KK7 A;  3MXP A;  2WV6 D;  3OYY A;  4C56 C;  3AMU A;  3PUX A;  3TDQ A;  1HZB A;  1VF5 C;  1NTG A;  4KY6 A;  2JA6 B;  2QDL A;  3CKI B;  4CGY B;  2R93 B;  1S5E D;  2EYO A;  1IBM Q;  4DAY A;  2J7Z A;  5C4X H;  4TKO B;  4BBR G;  1HNX Q;  1LLR D;  2H4O A;  5KGU A;  3HOX G;  1VQB A;  1KD1 C;  2NVX H;  1PXU A;  1J5E Q;  3A8K E;  3M3Y H;  3TP5 A;  3SK6 A;  1EQV A;  2OQK A;  3T1Y Q;  3A74 A;  2NN6 I;  3LWU A;  3F2U A;  3Q24 A;  1HUN A;  2ICE C;  1QWY A;  3HKS A;  1QVC A;  3A54 A;  3AEV A;  2MPM A;  1LTG D;  2AHO B;  5KNB A;  4P74 A;  3OMG A;  3I73 A;  3UDX A;  2D62 A;  3PUV A;  2EYM A;  3P1H A;  2K14 A;  3KBG A;  1A2T A;  1SYE A;  4MN3 A;  5IYB H;  2L5T A;  4JI3 L;  1GD7 A;  4L5Q A;  4AYB E;  4MTN A;  5FLM G;  2R61 A;  4DV7 L;  4NMZ A;  1H95 A;  4JI2 Q;  4DV0 Q;  1IBK L;  2K52 A;  4RCO A;  1C0A A;  5C3E B;  4CJ1 B;  3D4W A;  4HN7 A;  3EIV A;  5M3M B;  5IGF A;  3H3V C;  4LUV A;  3RMH A;  1TY2 A;  2EXZ A;  2OEO A;  1HRJ A;  3GTQ H;  3CAM A;  2VY3 A;  5C0X H;  4X65 L;  1Y1W H;  3RZD H;  4C3I G;  2VQE Q;  4OEL B;  3OTO Q;  2UXD Q;  4XT3 B;  1EIG A;  3S15 B;  4OEM B;  3RUZ A;  2UXB L;  3ZYY X;  3WOE A;  1ENC A;  4R8I A;  1PTO F;  5IWA Q;  4EGV A;  5JJI A;  4HSV A;  1BBW A;  2KUM A;  2H5X A;  1LAB A;  3STB D;  2R92 H;  4LUZ A;  3I4L A;  1D1K A;  1EQQ A;  4RH6 A;  3QO2 A;  1TU2 B;  4B3M L;  2X69 A;  2F0O A;  4FDB A;  1PFB A;  1NY4 A;  1I5F A;  1ONL A;  4DV6 Q;  3CHB D;  2M00 A;  1OO9 B;  5C4X B;  4A3B B;  3J81 c;  4A3K G;  1YI2 A;  4JI4 Q;  1AZQ A;  1B8A A;  3QG1 A;  1E0B A;  4UHV A;  2N49 A;  1F9P A;  2NVX B;  4IFD I;  2YTX A;  1PRT F;  2A74 C;  1K83 H;  3M3Y B;  5JVG 3;  5EPL A;  5CV6 A;  2QGQ A;  3R93 A;  1X32 A;  3S14 H;  4YWK A;  4X62 Q;  1STB A;  5FJ8 G;  3E0E A;  4HMI A;  3F1Z A;  3UI2 A;  2WP8 J;  4JI6 Q;  4KD4 A;  3C3L A;  1Q12 A;  4N8X 1;  5C0X J;  4IFD J;  5I9P A;  2DNC A;  2EVB A;  1TWH H;  4CJ0 B;  3J7Z C;  1A8V A;  2K5D A;  1I4P A;  2B2V A;  1IL8 A;  2KEN A;  1SYD A;  4RMF A;  1IL2 A;  1HZA A;  5E4X A;  1OXS C;  1AZP A;  4I65 A;  4YCV A;  3SK4 A;  4NPS A;  1LT5 D;  2RA4 A;  1VQ5 A;  2KJX A;  1K3R A;  1IBL L;  4FNF A;  5IYD H;  2L15 A;  2Q2H A;  4G57 A;  3NXW A;  2R7Z H;  3DXJ C;  2YU9 H;  1OXU A;  1G91 A;  3U4Z A;  3S16 H;  4EX5 A;  3GTQ B;  1Y1W B;  2I5M X;  3RZD B;  1SE8 A;  3QR8 A;  4GNX A;  1E2V A;  3SEB A;  4KHP Q;  3BDC A;  1KRS A;  1QJO A;  4A3F G;  3I3C A;  1CHP D;  1Y14 B;  3RR5 A;  2DY7 A;  3I4N G;  3D8G A;  3ULJ A;  2B2T A;  3K81 C;  1QB5 D;  1F2Z A;  2FHT A;  2KHS A;  5C3W A;  3SGI A;  4WJ3 M;  3CCE A;  2JA9 A;  2JN4 A;  2NZH A;  4A3D H;  3EFX D;  4XQN A;  2R92 B;  4ZRZ A;  2YTY A;  1N9W A;  3FRP B;  2PI2 E;  3K7A H;  3H6M A;  4C3H G;  3B6Y A;  3T56 B;  1FGB D;  1GUT A;  1O7I A;  3CRK C;  4PMW A;  4A3L H;  1A63 A;  5C44 G;  1KRT A;  1JE4 A;  1A62 A;  3H94 A;  3DUZ A;  5M5Y H;  1AE3 A;  1EZ6 A;  3CCU A;  4A75 A;  2RSO A;  1ILQ A;  1SXT A;  4TSS A;  1WTQ A;  3URY A;  1K83 B;  2C35 B;  3PMF A;  4LF5 L;  4LFB L;  3I91 A;  2IJ0 A;  1UNS A;  1KDA A;  2G5D A;  2K32 A;  1N36 L;  1D5Z C;  2MFI A;  4MZ9 A;  4ZKC B;  3NE5 B;  1SYC A;  1NAP A;  4L8J A;  2K28 A;  4AYB G;  2JEA I;  4BXX G;  1NR4 A;  2CQA A;  1LV9 A;  3FMC A;  4KY7 A;  3L2P A;  3G48 A;  3I4M H;  5JPM C;  5G3L D;  3H09 A;  3PO3 G;  3J80 i;  1BVS A;  1SDF A;  3GQB A;  1TWH B;  2D0O A;  2RDF A;  2R7F A;  1CK1 A;  1BXT A;  4F87 A;  1F77 A;  3CD6 A;  1JOR A;  3AU7 A;  4ZK9 B;  1NSN S;  1VCI A;  2JA5 H;  1DOK A;  3P75 A;  3NUC A;  3A0J A;  2R3Z A;  2Q2I A;  5EPJ A;  1BBX C;  1ESR A;  2RHS B;  4B3T Q;  4POG A;  4K0K L;  5M3F G;  3HS0 C;  4UDU C;  2R7Z B;  2DN8 A;  5IP7 G;  2YU9 B;  2SOB A;  2ES2 A;  3S16 B;  4DR3 Q;  2RVL A;  3GTM H;  2EY1 A;  1SRO A;  3LX0 A;  1TXY A;  1STE A;  2V4D A;  2L12 A;  2VUM G;  4K14 A;  1B50 A;  3Q6S A;  3TME A;  1HPC A;  1MD2 D;  2FFK B;  2V1C C;  4POF A;  2A19 A;  2HHH Q;  1JB7 A;  2AKW B;  3HOU B;  2B2Y C;  5A35 A;  2E75 C;  1H9K A;  2F0F A;  2CFM A;  2GVA A;  4A3D B;  1TQO A;  4HED A;  1VQD A;  2ZXP A;  3AQQ A;  3QB3 A;  1MJC A;  1NR2 A;  2VQF L;  2LS0 1;  4LK1 C;  2B2W A;  1PFM A;  1HR0 Q;  2LFN A;  3DLL A;  2UUA Q;  3OW7 A;  1PDQ A;  3K7A B;  1TWA H;  2TMP A;  3KLW A;  2PZT A;  2RHQ B;  4K5W A;  4L5S A;  1CZG A;  3S1Q H;  3OWE B;  3VYT A;  1JJG A;  2F0M A;  2QF7 A;  1KLU D;  5M5Y B;  5EKI A;  5CC4 A;  2K5W A;  1ESF A;  4ODG A;  2WKD A;  2B2U A;  2HQL A;  3VYU A;  5LMN L;  2YV5 A;  3HOV H;  1U9R A;  5D14 A;  1IBM L;  2O5J C;  1FD7 D;  2VW9 A;  1LTT D;  5BN3 A;  3F2B A;  1D8L A;  4KKT A;  1C7Y A;  3EBE A;  3FDT A;  1SFO H;  3HZX A;  1QZH A;  1J5E L;  3H0G H;  4NDX A;  1I6H H;  2E2H H;  1D1I A;  1CA6 A;  3M85 A;  5ELE A;  1V43 A;  1SE3 A;  4PG3 A;  3T1Y L;  3I4M B;  2HIV A;  1ROD A;  3CRL C;  2F0S A;  1B44 D;  1I4G A;  1JR0 D;  1RDP D;  4KMU C;  4LF7 Q;  1EIY B;  2L0C A;  2PQE A;  4FF1 A;  2Z4H A;  1AE2 A;  5K36 G;  2A1A A;  1MJE A;  1UE1 A;  3NBH A;  1I94 Q;  3S2H H;  2JA5 B;  2NTS A;  4R9W A;  5JEA H;  1STG A;  1QVF A;  2PO4 A;  1JE5 A;  1U5K A;  3NQI A;  2ZJQ A;  1G2S A;  2XVS A;  2E5L Q;  4OO1 I;  2IX1 A;  4QIW B;  2H1E A;  1NE3 A;  1YNN D;  2K7V A;  1O80 A;  1X6O A;  2RCF A;  5EQ0 A;  1TKW B;  1TWF B;  4JI2 L;  1BBU A;  4XXE A;  2ZJR A;  1SLJ A;  2A6H D;  2VB3 X;  3TZD A;  2R93 G;  4BS9 A;  4KJO A;  3CU7 A;  4K5X A;  4HMJ A;  1VQ6 A;  1F9R A;  5GRO A;  1EOV A;  2WAQ B;  2TSS A;  1ILP A;  1W2B A;  3F2C A;  3NK9 A;  3HG9 A;  1VQM A;  1E2W A;  4ME3 A;  2VQE L;  5T1G A;  2EZV A;  4RWS C;  3OTO L;  3LGJ A;  2UXD L;  1SYB A;  3JAM E;  1A6X A;  1JMC A;  1BCP C;  4HJA A;  1CA5 A;  2F0H A;  2JA7 G;  2A69 C;  4K6D A;  1I6V C;  1FNV A;  3K5L A;  1SE2 A;  1TWA B;  4JI7 L;  3NEL A;  2FJ2 A;  5IWA L;  1J6Q A;  1F9S A;  1K0S A;  3CCV A;  3S1Q B;  4EQN A;  4HJ5 A;  3TQY A;  3E3X A;  2OQ0 A;  1X65 A;  3BDL A;  3KBX A;  3KYH C;  1PLF A;  2UU9 Q;  4IUR A;  5JEA J;  1PYS B;  3HOV B;  3ONA B;  3CC7 A;  4DV6 L;  1CKO A;  1A3T A;  1K0R A;  2FIN B;  2HDL A;  3E9I A;  2NZ1 D;  1VDZ A;  4ZAI A;  1H9S B;  3I8Z A;  4BY1 H;  3SVM A;  4JI4 L;  2Z9H A;  4K2L A;  1SR3 A;  5L37 A;  4JBM A;  1SFO B;  3BVM A;  3T51 B;  3CCJ A;  4QQB X;  4A3M H;  1VQ8 A;  1VQA A;  1EZ8 A;  1KL9 A;  2F0V A;  3H0G B;  1V1P B;  1W6K A;  5C3E G;  4JCV E;  1I6H B;  4A4I A;  3DWP A;  4RKB A;  5IY0 A;  5C5M A;  3J7Y W;  4X62 L;  3FEW X;  1CI3 M;  2PMZ E;  2HT1 A;  1HJP A;  3E9H A;  4X6A H;  5EGT A;  1SND A;  3TBI B;  2EPB A;  3BYT B;  1W3S A;  3MWY W;  2AWN A;  2EJF C;  4A93 H;  2K5V A;  3OW2 A;  3GTG H;  3S2H B;  2ZXR A;  3KF8 A;  1Q1E A;  3S24 A;  5CMD A;  1VQ9 A;  3I90 A;  1OTC A;  4IO9 A;  2EE1 A;  3GTP H;  1Q90 A;  3NEN A;  2FMM A;  4QUF A;  1Q82 C;  4JPB W;  2ZJP A;  5KEE A;  4QCL A;  4Y52 H;  4BWG B;  5M9O A;  4YY3 Q;  4A3I G;  3BZC A;  4ILW A;  1TWC H;  1X55 A;  4DFA A;  4CKE A;  4BBS H;  4FF3 A;  3PV0 A;  2IHE A;  5JJL A;  4DR5 Q;  3ITP A;  1L1O B;  2B29 A;  1HUM A;  4RHR A;  3PF4 A;  4DV3 Q;  4DV2 Q;  4F8M A;  3STB C;  4JI8 Q;  3DEP A;  4PZ6 A;  3ERS X;  4KHP L;  4LWC A;  1HH2 P;  4ZQ3 A;  2F0W A;  5JJK A;  1N32 Q;  4NXN Q;  2L11 A;  4DR2 L;  4OHJ A;  3V2T A;  2EY2 A;  2IHF A;  4QB4 A;  2D0P A;  1B53 A;  2B63 H;  4JYA L;  3OOC A;  5EKL A;  3SDZ A;  4NB3 A;  1A3V A;  3BVG A;  4JI1 Q;  3FHW A;  2JA8 G;  5KRU A;  3PF5 A;  3UE0 A;  4JG2 A;  5NUC A;  1TII D;  3GP7 A;  5F2D A;  2B8F A;  1WOC A;  3NQT A;  4DF7 A;  2PI2 A;  2EJM A;  2Q2U A;  1HQR D;  4KD3 A;  1V9P A;  5CR3 A;  1BCP B;  4JVZ A;  2WB1 B;  3FKI B;  1X3Q A;  2G9D A;  2Q8I B;  3O13 A;  4R4T A;  3QJY A;  4C3J H;  1BCP D;  4BY1 B;  3HOW G;  1K8M A;  4YHH L;  1GHJ A;  4QL5 A;  2A69 D;  3VDY A;  3J80 L;  1CSP A;  3BJU A;  3J81 j;  4A3M B;  5M5X H;  2E74 C;  3H91 A;  1CKM A;  4X64 Q;  1TS4 A;  3KF6 B;  2F3W A;  3CCS A;  4OIJ A;  1J9O A;  2WKC A;  5IGG A;  1DM0 B;  3EA6 A;  4K2K A;  4IFD G;  2OWO A;  1A0I A;  1PH5 A;  3J80 E;  4JOI A;  3T1H L;  2KEC A;  3GV6 A;  2BH8 A;  3CPF A;  5CGK A;  1JOK A;  4KN7 C;  2KQ3 A;  3K0Y A;  3MFY A;  1RF2 D;  3GTG B;  5HY6 A;  4XIG S;  3IL8 A;  4X3U A;  3G4S A;  5ELD A;  3K8A A;  2LY7 A;  4QIW E;  3HOY G;  5I6Y A;  1B9M A;  1PH8 A;  3ULL A;  2IPK D;  4QJF A;  4A3C H;  4UAI A;  2N88 A;  5IT9 c;  1PZJ D;  1HXY D;  5EJW A;  4GN4 B;  4DAY B;  2DGY A;  4WOR A;  4X3S A;  5EPK A;  4DNI A;  1RKN A;  2WAQ E;  1TWC B;  4XTC S;  1XMO L;  2ZT9 C;  1WTR A;  4B3T L;  1H9M A;  2L4N A;  1XPU A;  2F0K A;  1EY5 A;  3IFT A;  2QA4 A;  2VXW A;  2B2V C;  3A7A B;  1I50 H;  4DR3 L;  5FO8 B;  1FJG Q;  1GJX A;  1MSG A;  4OGQ C;  5IGC A;  5E4W C;  5C4H A;  5AJ3 Q;  2F0Q A;  4GLV B;  5FK9 C;  1HZC A;  4DR4 Q;  2KVM A;  1QCB D;  1GOZ A;  2BCO A;  3KLS X;  2HHH L;  5BN5 A;  2B63 B;  5JVH 3;  1EOT A;  1PZI D;  2VS1 A;  1HR0 L;  2UUA L;  3X3M A;  3ND8 A;  4BBR H;  4DAP A;  4OWX B;  1EWI A;  2PNR C;  2LXK A;  3KJO A;  4L6T B;  3NWT A;  3J81 i;  3I56 A;  1AN8 A;  3HOX H;  4A3G G;  1ET9 A;  5CV4 A;  4LMQ D;  5DNF A;  5D3D A;  4LF4 L;  5ELF A;  4U68 A;  4PQX A;  4KY5 A;  3FPU B;  1N34 Q;  1XNQ L;  1QVG A;  1X3P A;  3K5N A;  5DEH A;  1FYC A;  2HUG A;  1QUQ A;  4KLK A;  4KN4 C;  1SSO A;  2F4I A;  3VR2 A;  3EN2 A;  1IZ6 A;  2F0T A;  5M5X B;  3CME A;  4X3T A;  2ZM6 Q;  3E6Z X;  3W1G A;  4P2C B;  3A55 A;  2NWG A;  1Y8O B;  4DNT B;  5C0X I;  1NNX A;  3CQZ H;  4K5V A;  3M7N A;  2JK8 A;  1CQV A;  2F3I A;  2L55 A;  3VA5 A;  3D6C A;  1XX8 A;  4YWM A;  1IYV A;  3JAM c;  2K5N A;  4YWL A;  1ASZ A;  2ZTC A;  4LW1 A;  5FLM H;  1S5F D;  2B3G A;  4LF7 L;  4GLX A;  3HOU G;  4FP5 D;  2M2L A;  3MVV A;  4ZCK A;  1DJR D;  1EY4 A;  3N6R A;  1QG7 A;  2K03 A;  2AQ2 B;  1F2L A;  1I94 L;  1XNR Q;  2KHI A;  3NSW A;  2RF4 A;  1B70 B;  1Q8K A;  1GKH A;  1LT6 D;  4C3I H;  2L1B A;  3RNU A;  2E5L L;  4GN5 A;  1BCP F;  1STA A;  2QIL A;  1WD0 A;  1G6Z A;  1I50 B;  1FNU A;  4IOA A;  4DV4 Q;  1U4M A;  4DUY Q;  3NP8 A;  1L2F A;  3KOJ A;  2NVT H;  1XYI A;  4B3R Q;  1VQI A;  4RG1 A;  1JOO A;  2O5I C;  2KEE A;  1DXM A;  4EQP A;  1S40 A;  3HKZ E;  2WII B;  5J22 A; 
#chains in the Genus database with same CATH homology
 5KND A;  4ULL A;  1TS2 A;  1SMY C;  4M8A A;  2IL8 A;  4BBR B;  3G6J B;  3WOF A;  2EY6 A;  1BQQ T;  1ICW A;  2KCN A;  2KA7 A;  3HOX B;  4FXD A;  4CBV A;  5CV5 A;  4GZY C;  1I4X A;  1VMC A;  1LTR D;  3K5M A;  1EYD A;  1PFN A;  2K33 A;  4YIJ A;  5KNC A;  4WRD A;  1WTO A;  2B2W C;  1Q3L A;  4OL7 A;  2QCP X;  4ME5 A;  4H0L C;  2AQ3 B;  1MI2 A;  1I4R A;  3CQZ B;  2RQX A;  5COR A;  3M4Y A;  4G7H C;  5FO7 B;  3S14 B;  2D5D A;  2E2D C;  2QKI C;  1F2M A;  3G7L A;  3AB9 A;  4L63 B;  2RDG A;  5C6A A;  2F3V A;  1YNN C;  4F7X A;  1U4R A;  3OPO A;  1O7L A;  2A6H C;  4H7B A;  4DA2 A;  1A15 A;  2X6L A;  3MA2 B;  3R3O A;  4XQJ A;  2BA0 A;  1SE4 A;  3C46 A;  2HCI A;  2HDM A;  3TP6 A;  2AQ1 B;  4OO1 G;  3VA7 A;  1EU4 A;  2CW0 D;  3T16 A;  4CHT B;  4ZUJ A;  3MXU A;  4NKL A;  4ABN A;  4K6L A;  4WJW A;  4G7Z C;  1I4Q A;  4IZ8 A;  3E5S A;  3K58 A;  4B9W A;  3OMC A;  1H9R A;  4A3K B;  2Z4I A;  3IKJ A;  5HUR A;  4KK7 A;  3EJI A;  2Z8L A;  1BNZ A;  4O1N A;  3DHQ A;  1CM9 A;  1HTL D;  3K59 A;  1B1Z A;  2I46 A;  2E76 C;  3R2I A;  1LTS D;  5FLX L;  1OXV A;  4HAE A;  1JWM D;  1SMY D;  3VYS A;  1STH A;  1AFP A;  1DD2 A;  2O4X A;  5FLX E;  2MUY A;  1ZKO A;  5IOD A;  5A2Q L;  4IUU A;  1DCZ A;  2SEB D;  1WTW A;  3C1F A;  4ZUI A;  3LWE A;  4XDX A;  4V0B A;  4N9P A;  4OIK A;  3MXG A;  1MGS A;  2K05 A;  2JEB I;  1FNW A;  4A3F B;  3I4N B;  1ML0 D;  3W2D A;  2NB0 A;  3HGB A;  4DGZ A;  3BVZ A;  2EYP A;  1KDC A;  1WTX A;  1ENF A;  1JB3 A;  4LAA A;  1RJT A;  3GTM B;  2A5H A;  1PTO H;  1DYQ A;  4C3H B;  1VMP A;  1T5X D;  2F03 A;  1QNK A;  4G4K A;  3J81 L;  1ZYR D;  5C44 B;  1LTI D;  3BG3 A;  1CT1 D;  5I4D A;  4XYO A;  5ELB A;  5J1Z A;  5G3L F;  2MHV A;  4MIU A;  5D65 A;  2B2Y A;  3PUW A;  1K8O A;  5JAV A;  1XXG A;  1Q8I A;  4AYB B;  4QUC A;  4C1N I;  5LL6 S;  3QOJ A;  5FOB B;  4HCE A;  4K8I A;  5IGB A;  3PO3 B;  4FYD A;  3TP7 A;  4DAV A;  1MBY A;  2IT1 A;  5K36 H;  3A8J E;  2I07 B;  1RHP A;  2NTT A;  2WIN B;  2NVQ B;  3BYY B;  4FXK C;  2E2H B;  4IUT A;  2F0P A;  5IGD A;  2VNU D;  3D6W A;  1JCK B;  1GHK A;  2EY5 A;  3R8B A;  1EWC A;  1A2U A;  5EBC A;  2JSO A;  3TN2 A;  1DZ1 A;  2L9H A;  4DK0 A;  3TSS A;  4KHZ A;  3EQL C;  2NN6 G;  3VR4 A;  2VB2 X;  2A68 D;  2VUM B;  1UAP A;  2Q8T A;  3Q23 A;  1IKL A;  1SBB B;  2EDG A;  4HTH A;  3PUZ A;  3VYR A;  2XSC A;  3MEH A;  1VF7 A;  2AWO A;  1GXD C;  1HQM C;  1M8A A;  1YNJ D;  1Z47 A;  4PMB A;  3BDO A;  3QOL A;  1LAC A;  3OWF A;  4NW2 A;  4C1N K;  4Y7N B;  1UUP A;  2FMC A;  3L9A X;  1LTB D;  1SNC A;  3SXH A;  3NWS A;  4KKS A;  5BN4 A;  4FF4 A;  1ET6 A;  1CTM A;  3MAQ A;  5C4J B;  3A8I E;  1RD9 D;  1EY6 A;  4CKB A;  2OF1 A;  1PRT B;  2J0T D;  2B8G A;  2IWH A;  1JQY D;  3VR3 A;  1HCZ A;  1PRT D;  2EJG C;  3I70 A;  1RTO A;  3GTL B;  1Q1B A;  3OHX C;  1WTV A;  3HEJ A;  2RSN A;  4S3S A;  1QNU A;  3VR6 A;  1Y8P B;  3GD7 A;  1IHZ A;  1IYU A;  2WAC A;  1JIC A;  2C5C A;  1MSH A;  3SHL A;  1B4O A;  4QF4 A;  1U4L A;  1SAP A;  4V19 0;  1EEF D;  3SK8 A;  1TY0 A;  4RGM A;  5C0X G;  2BA1 A;  1BO0 A;  1Z6H A;  2NBF A;  2DY8 A;  4H44 C;  2CHB D;  4A93 B;  3DEO A;  4KV6 A;  4HCS A;  3GTP B;  2XIW A;  1J8I A;  1B9N A;  1GUO A;  1KAB A;  2SNS A;  2K01 A;  4F88 A;  2JA7 B;  2BDO A;  5IIF A;  3BZD B;  4BBS B;  1LO5 D;  4ID6 A;  4HSP A;  2E2I B;  1EU3 A;  1IW7 C;  3TP8 A;  1JWS D;  4Q0F A;  1TR5 A;  1EL0 A;  4IUN A;  1NCV A;  4CJ2 C;  2HCC A;  4R8N A;  3KLS A;  1RCV D;  3V05 A;  5LL6 X;  2K6A A;  1TWG B;  1KLG D;  2A6E D;  2PW5 A;  3L3O C;  4LJZ C;  1SNP A;  2XN9 C;  2KOL A;  5KYI A;  4IFD H;  1RTN A;  2B2T C;  4C3J B;  4XYQ A;  4J1M A;  3C2P A;  5FO9 B;  4NP5 A;  1BUV T;  2PYK A;  3D3R A;  2XRS D;  2NVY B;  4JBW A;  2BE5 D;  2Q8R E;  3MHB A;  3N52 A;  1HA6 A;  3Q22 A;  1PYW D;  4QMG A;  1TS3 A;  4A3I B;  2M9V A;  1EQT A;  3KUP A;  1LT4 D;  3MTS A;  3DM1 A;  2ICI A;  1H9J A;  1EEI D;  3WDN A;  2F0L A;  2PCF B;  2CW0 C;  4Q5V A;  3RZO B;  5C3X A;  3MC0 B;  3NTH A;  5ISR A;  1IKM A;  3U9O A;  4C2M B;  3D4R A;  2OT2 A;  1SJE D;  4TRD A;  1C8C A;  1L0X B;  4O42 A;  1D6E C;  3K5O A;  3ERQ A;  2JA8 B;  1W6J A;  1SNM A;  1HFG A;  3X3N A;  5EKK A;  1STN A;  3R2T A;  1R9T B;  2F1M A;  3IFD A;  2BDN A;  4XQQ A;  1I4H A;  2CVR A;  2F0J A;  2ENB A;  1B3A A;  4RA8 A;  3HOW B;  3QIA A;  4RFB A;  4J8Q A;  5T1I A;  5DM7 3;  3E0J A;  3BS1 A;  1HTP A;  3VR5 A;  2K1B A;  1B2T A;  5K5P A;  2PZU A;  4DXG A;  1IW7 D;  3J7A V;  4FXG C;  3S2D B;  2EYH A;  1OXX K;  2EOT A;  2AUJ D;  2JXM B;  2KED A;  3PIP 3;  2ZXO A;  1ZXT A;  3RD4 A;  3IAY A;  1PMR A;  2PZW A;  1KNA A;  3GTK B;  1SJH D;  1HA5 A;  3MXN A;  5JOB A;  1HHV A;  2RBM A;  3OSO A;  3HOY B;  5CV8 A;  1ENA A;  2N55 A;  5ELC A;  4KTA A;  3NTK A;  4WFN 3;  1BDO A;  3SR1 A;  3U9S A;  3K6O A;  1TT2 A;  1EY8 A;  3FPP A;  1QE6 A;  2HQE A;  1WD1 A;  4KKU A;  1HFN A;  2SDF A;  1F2Y A;  5CYU A;  2YYZ A;  2B2U C;  3DWA A;  5COY A;  3NTI A;  1AP0 A;  5AFW A;  1SYG A;  4FVM A;  3P7J A;  1R4P B;  4XT1 B;  4KHV A;  1NUC A;  4KI0 A;  4H13 C;  4U67 3;  4RHS A;  4IUQ A;  1CZW A;  3TZU A;  2MP1 A;  1EY9 A;  2F0U A;  5IGE A;  4C3I B;  2JE6 I;  4G7O C;  4JK1 C;  3A7L A;  1ZYR C;  3DWQ A;  5HGT A;  1EYA A;  4IUP A;  1CQF A;  4DK1 A;  2NUC A;  1KAA A;  2DNE A;  2XNA C;  2NVT B;  4A3G B;  3L7Z C;  1I3Q B;  3OIP A;  1G2T A;  1TVX A;  2PMZ B;  1Y8N B;  1DOM A;  5I6W A;  2E2J B;  5DAU A;  4EQO A;  1ZEQ X;  1SNQ A;  1AW7 A;  3DMU A;  3PUY A;  4PV1 C;  5E3F A;  4MHE A;  1S4Z A;  3S1R B;  1EYC A;  1AEX A;  2A73 B;  4BA1 I;  1M4V A;  3S17 B;  5JEA G;  1V8Q A;  1F9Q A;  5JPN C;  3I72 A;  3S1N B;  5E1F A;  3PIO 3;  1BOS A;  4I7Z C;  5IT9 L;  5CV7 A;  1JC7 A;  4IQZ A;  5EBD A;  5IOC A;  1A3U A;  4EVO A;  2A68 C;  3GTJ B;  1S5B D;  3NPP A;  1GUW A;  5IT9 E;  2EYL A;  4Z9C B;  3Q0A A;  2EYF A;  3GO5 A;  2MJ8 A;  2EYJ A;  1O7Z A;  3A56 A;  2K5Q A;  1SYF A;  5C5L A;  1S5C D;  1YNJ C;  4OO1 H;  3EVQ A;  1QIL A;  2IW3 A;  3T4A C;  2PW7 A;  4X3K A;  1EY7 A;  4RGN A;  1EIH A;  1EFI D;  2G9H D;  4FO2 A;  1PTO C;  3V96 A;  2XWB B;  5A2Q E;  4RGT A;  2BOS A;  1BF4 A;  3RLF A;  3C1E A;  4J6H A;  3K57 A;  2Z1C A;  4DXF A;  3HRZ C;  3W3A A;  1C4Q A;  3NBI A;  3NHH A;  1LTA D;  2XRQ D;  2IX3 A;  2KCC A;  3M7G A;  1Y69 U;  1EY0 A;  1SEB D;  2NYZ D;  1GUS A;  2F0D A;  2J4X A;  5D3I B;  3SK5 A;  4ZKB B;  1G29 1;  5FKA C;  5KYL A;  4DNR B;  1R4Q B;  5I2Y A;  1PRT C;  4RAU C;  2RDH A;  1T5E A;  4M1U B;  5I2X A;  4TQU S;  5LHY 1;  2JYO A;  3FVQ A;  2R6G A;  2K04 A;  4ZYS A;  3S1M B;  4K8J A;  3JAM L;  1S5D D;  3S9W A;  2MGS A;  4RCN A;  3J81 E;  2D2C C;  2QDB A;  3KLR A;  2XWJ B;  4E6I A;  2AUK A;  5CBE E;  3P20 A;  1D5X C;  5CBA E;  1E2Z A;  2GA4 B;  3MZ5 A;  1H9S A;  3J7A F;  1OXT A;  2B39 A;  1II3 A;  1KNE A;  1JWU D;  5TSS A;  4ZLT F;  1EWH A;  1U4P A;  1V1P A;  4IN3 A;  1WTP A;  1DON A;  4IAL A;  4DN4 M;  4FF2 A;  1G8Z D;  2F0G A;  5I9O A;  4A3E B;  2D9U A;  3ND9 A;  4BY7 B;  1SNO A;  3GV3 A;  2F0E A;  2OXP A;  4RKL A;  1STY A;  1GUG A;  5M3F B;  3D4D A;  1D5M C;  1L0Y B;  4A3J B;  5J39 A;  1LT3 D;  3D31 A;  3M4O B;  1UEA B;  4IUV A;  2QEJ C;  2RKS A;  4HR7 B;  4BA2 I;  4DU9 A;  1GUN A;  1KDB A;  3HOZ B;  1C48 A;  4PNY A;  4C3J G;  3T13 A;  1WVL A;  2JP1 A;  4PMC A;  1PTO B;  3SE0 A;  1JOQ A;  1DOL A;  4B9X A;  2A6E C;  1PTO D;  1O78 A;  2LMC B;  1BR9 A;  1FR3 A;  2F0N A;  5M5W B;  2O2L D;  1QOH A;  3MFG A;  2SNM A;  4B08 A;  3QWN A;  5C4Z A;  3HP3 A;  3GTO B;  2X6G A;  1O7Y A;  1WCM B;  5JJZ A;  1TS5 A;  1XTC D;  1Z7T A;  2BE5 C;  3OIQ A;  5CV9 A;  3T53 B;  2F0I A;  4RGO S;  1XWE A;  2IX0 A;  3ERO A;  1PZK D;  2ID0 A;  1D2B A;  2NN6 H;  1KTK A;  1Y1V B;  1CFM A;  4CKC A;  3HKZ B;  2C9O A;  2Y0S B;  2PPB C;  5DM6 3;  1V1O A;  1CHQ D;  4KJN A;  4N9T A;  3LNN A;  2LKV A;  5KIX A;  3PO2 B;  3KK7 A;  3MXP A;  2WV6 D;  4C56 C;  3AMU A;  3PUX A;  3TDQ A;  1VF5 C;  4KY6 A;  2JA6 B;  4CGY B;  3CKI B;  2R93 B;  1S5E D;  2EYO A;  4DAY A;  2J7Z A;  4TKO B;  1LLR D;  2H4O A;  5KGU A;  1PXU A;  3A8K E;  3TP5 A;  3SK6 A;  1EQV A;  2NN6 I;  3LWU A;  3F2U A;  3Q24 A;  1HUN A;  2ICE C;  1QWY A;  3A54 A;  2MPM A;  1LTG D;  5KNB A;  3OMG A;  3I73 A;  2D62 A;  3PUV A;  2EYM A;  3P1H A;  3KBG A;  1A2T A;  1SYE A;  4MN3 A;  2L5T A;  2R61 A;  4NMZ A;  4RCO A;  5C3E B;  4CJ1 B;  3D4W A;  4HN7 A;  5M3M B;  5IGF A;  3H3V C;  3RMH A;  1TY2 A;  2EXZ A;  2OEO A;  1HRJ A;  5C0X H;  4C3I G;  4XT3 B;  1EIG A;  3S15 B;  3RUZ A;  3ZYY X;  3WOE A;  1ENC A;  4R8I A;  1PTO F;  4EGV A;  4HSV A;  2KUM A;  1LAB A;  3I4L A;  1D1K A;  4RH6 A;  3QO2 A;  1TU2 B;  2X69 A;  2F0O A;  1PFB A;  1ONL A;  3CHB D;  2M00 A;  1OO9 B;  5C4X B;  4A3B B;  1AZQ A;  3QG1 A;  1E0B A;  1F9P A;  2NVX B;  4IFD I;  1PRT F;  2A74 C;  3M3Y B;  5JVG 3;  5EPL A;  5CV6 A;  3R93 A;  1X32 A;  1STB A;  4HMI A;  3UI2 A;  2WP8 J;  4KD4 A;  3C3L A;  1Q12 A;  5C0X J;  4IFD J;  5I9P A;  2DNC A;  2EVB A;  4CJ0 B;  2K5D A;  1I4P A;  2B2V A;  1IL8 A;  1SYD A;  5E4X A;  1OXS C;  1AZP A;  4I65 A;  3SK4 A;  1LT5 D;  2RA4 A;  2KJX A;  4FNF A;  4G57 A;  3NXW A;  3DXJ C;  1OXU A;  1G91 A;  3GTQ B;  1Y1W B;  3RZD B;  1E2V A;  3SEB A;  3BDC A;  1QJO A;  3I3C A;  1CHP D;  2DY7 A;  3D8G A;  2B2T A;  1QB5 D;  1F2Z A;  2FHT A;  2KHS A;  5C3W A;  3EFX D;  4XQN A;  2R92 B;  4ZRZ A;  3FRP B;  3H6M A;  4C3H G;  3T56 B;  1FGB D;  1GUT A;  3CRK C;  4PMW A;  1JE4 A;  3H94 A;  3DUZ A;  1EZ6 A;  2RSO A;  1ILQ A;  1SXT A;  4TSS A;  1WTQ A;  3URY A;  1K83 B;  3PMF A;  3I91 A;  2IJ0 A;  1UNS A;  1KDA A;  2K32 A;  1D5Z C;  4ZKC B;  3NE5 B;  1SYC A;  1NAP A;  4L8J A;  2K28 A;  2JEA I;  1NR4 A;  2CQA A;  1LV9 A;  3FMC A;  4KY7 A;  5JPM C;  5G3L D;  3H09 A;  1SDF A;  3GQB A;  1TWH B;  2RDF A;  1CK1 A;  1BXT A;  4F87 A;  1F77 A;  1JOR A;  3AU7 A;  4ZK9 B;  1NSN S;  1VCI A;  1DOK A;  3P75 A;  3NUC A;  2R3Z A;  5EPJ A;  1BBX C;  1ESR A;  3HS0 C;  4UDU C;  2R7Z B;  2DN8 A;  2YU9 B;  2SOB A;  3S16 B;  2RVL A;  2EY1 A;  3LX0 A;  1STE A;  2V4D A;  2L12 A;  4K14 A;  1B50 A;  3Q6S A;  3TME A;  1HPC A;  1MD2 D;  2FFK B;  3HOU B;  2B2Y C;  5A35 A;  2E75 C;  1H9K A;  2F0F A;  4A3D B;  1TQO A;  4HED A;  2ZXP A;  3QB3 A;  1NR2 A;  2LS0 1;  4LK1 C;  2B2W A;  1PFM A;  2LFN A;  3OW7 A;  1PDQ A;  3K7A B;  2TMP A;  2PZT A;  4K5W A;  1CZG A;  3OWE B;  3VYT A;  2F0M A;  2QF7 A;  1KLU D;  5M5Y B;  5EKI A;  5CC4 A;  2K5W A;  1ESF A;  4ODG A;  2WKD A;  2B2U A;  3VYU A;  1U9R A;  5D14 A;  2O5J C;  1FD7 D;  1LTT D;  5BN3 A;  4KKT A;  3FDT A;  3HZX A;  4NDX A;  1D1I A;  1CA6 A;  3M85 A;  5ELE A;  1V43 A;  1SE3 A;  3I4M B;  1ROD A;  3CRL C;  2F0S A;  1B44 D;  1I4G A;  1JR0 D;  1RDP D;  4KMU C;  2L0C A;  2PQE A;  4FF1 A;  2Z4H A;  5K36 G;  3NBH A;  2JA5 B;  2NTS A;  4R9W A;  5JEA H;  1STG A;  2PO4 A;  3NQI A;  1G2S A;  2XVS A;  4OO1 I;  2IX1 A;  4QIW B;  2H1E A;  1YNN D;  2K7V A;  1O80 A;  5EQ0 A;  1TKW B;  1TWF B;  4XXE A;  2A6H D;  2VB3 X;  3TZD A;  4BS9 A;  4KJO A;  3CU7 A;  4K5X A;  4HMJ A;  1F9R A;  2WAQ B;  2TSS A;  1ILP A;  3NK9 A;  3HG9 A;  1E2W A;  5T1G A;  2EZV A;  4RWS C;  1SYB A;  3JAM E;  1A6X A;  1BCP C;  1CA5 A;  2F0H A;  2A69 C;  4K6D A;  1I6V C;  1FNV A;  3K5L A;  1SE2 A;  1TWA B;  2FJ2 A;  1F9S A;  3S1Q B;  4EQN A;  3BDL A;  3KBX A;  1PLF A;  4IUR A;  5JEA J;  3HOV B;  3ONA B;  1A3T A;  2FIN B;  2HDL A;  2NZ1 D;  1VDZ A;  4ZAI A;  1H9S B;  3I8Z A;  3SVM A;  4K2L A;  1SFO B;  3BVM A;  3T51 B;  1EZ8 A;  2F0V A;  3H0G B;  1V1P B;  1W6K A;  1I6H B;  3DWP A;  4RKB A;  5C5M A;  3J7Y W;  3FEW X;  1CI3 M;  5EGT A;  1SND A;  3TBI B;  2EPB A;  3BYT B;  3MWY W;  2AWN A;  2EJF C;  3S2H B;  2ZXR A;  3KF8 A;  1Q1E A;  5CMD A;  3I90 A;  2EE1 A;  1Q90 A;  2FMM A;  4QUF A;  5KEE A;  4QCL A;  4BWG B;  5M9O A;  4ILW A;  4DFA A;  4CKE A;  4FF3 A;  3PV0 A;  3ITP A;  1HUM A;  4RHR A;  4F8M A;  3DEP A;  4ZQ3 A;  2F0W A;  2L11 A;  4OHJ A;  3V2T A;  2EY2 A;  4QB4 A;  1B53 A;  3OOC A;  5EKL A;  3SDZ A;  1A3V A;  3BVG A;  5KRU A;  5NUC A;  1TII D;  3GP7 A;  5F2D A;  2B8F A;  4DF7 A;  3NQT A;  2EJM A;  1HQR D;  4KD3 A;  5CR3 A;  1BCP B;  2WB1 B;  3FKI B;  1X3Q A;  2G9D A;  2Q8I B;  3O13 A;  3QJY A;  1BCP D;  4BY1 B;  1K8M A;  1GHJ A;  2A69 D;  3J80 L;  4A3M B;  2E74 C;  3H91 A;  1TS4 A;  2F3W A;  4OIJ A;  1J9O A;  2WKC A;  5IGG A;  1DM0 B;  3EA6 A;  4K2K A;  4IFD G;  3J80 E;  2KEC A;  3GV6 A;  5CGK A;  1JOK A;  4KN7 C;  2KQ3 A;  3K0Y A;  3MFY A;  1RF2 D;  3GTG B;  4XIG S;  3IL8 A;  4X3U A;  5ELD A;  2LY7 A;  5I6Y A;  1B9M A;  2IPK D;  4UAI A;  2N88 A;  1PZJ D;  1HXY D;  5EJW A;  4WOR A;  5EPK A;  4X3S A;  1RKN A;  1TWC B;  4XTC S;  2ZT9 C;  1WTR A;  1H9M A;  2L4N A;  2F0K A;  1EY5 A;  3IFT A;  2VXW A;  2B2V C;  3A7A B;  5FO8 B;  1GJX A;  1MSG A;  5IGC A;  4OGQ C;  5E4W C;  5C4H A;  2F0Q A;  5FK9 C;  2KVM A;  1QCB D;  1GOZ A;  2BCO A;  3KLS X;  5BN5 A;  2B63 B;  5JVH 3;  1EOT A;  1PZI D;  3X3M A;  3ND8 A;  4DAP A;  2PNR C;  4L6T B;  3NWT A;  1AN8 A;  1ET9 A;  5CV4 A;  4LMQ D;  5DNF A;  5D3D A;  5ELF A;  4U68 A;  4PQX A;  4KY5 A;  3FPU B;  1X3P A;  3K5N A;  5DEH A;  1FYC A;  2HUG A;  4KN4 C;  1SSO A;  2F4I A;  3VR2 A;  2F0T A;  5M5X B;  4X3T A;  3E6Z X;  4P2C B;  3A55 A;  2NWG A;  1Y8O B;  4DNT B;  5C0X I;  4K5V A;  3M7N A;  2L55 A;  1CQV A;  3VA5 A;  3D6C A;  1XX8 A;  1IYV A;  1S5F D;  4FP5 D;  2M2L A;  3MVV A;  1DJR D;  1EY4 A;  3N6R A;  1QG7 A;  2K03 A;  2AQ2 B;  1F2L A;  3NSW A;  1LT6 D;  2L1B A;  1BCP F;  1STA A;  2QIL A;  1WD0 A;  1G6Z A;  1I50 B;  1FNU A;  1U4M A;  3NP8 A;  1XYI A;  1JOO A;  2O5I C;  2KEE A;  1DXM A;  4EQP A;  2WII B;  5J22 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...