1STHA

Two distinctly different metal binding modes are seen in x-ray crystal structures of staphylococcal nuclease-cobalt(ii)-nucleotide complexes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title X-ray crystal structures of staphylococcal nuclease complexed with the competitive inhibitor cobalt(II) and nucleotide.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sthA00
3H6MA 2SNMA 3C1EA 2RKSA 5IGDA 1SNQA 2WACA 2EXZA 3MEHA 4PMCA 3SHLA 3SK4A 4K5VA 5CV5A 3TP5A 4K8IA 5E1FA 3OSOA 1SNOA 5CV4A 5E3FA 4KD3A 2F0UA 3QOLA 5DAUA 2OEOA 5JOBA 3DMUA 3EROA 2SNSA 3NXWA 5IODA 1JOQA 4DU9A 3P75A 5KGUA 2EYJA 2M00A 1NSNS 1SNPA 1AEXA 3D4WA 3S9WA 3QOJA 1KAAA 1SYGA 1U9RA 2PQEA 3D4DA 4NKLA 3HZXA 4ZUIA 1EQVA 2F0MA 3NHHA 4HMJA 1SYDA 4TRDA 5CV9A 3SK6A 5C4ZA 5HGTA 1JORA 2HQEA 4ZUJA 2F0VA 2NUCA 5IIFA 4EQNA 1STAA 1EY4A 1RKNA 4ODGA 5IGFA 5NUCA 2EY2A 3BDLA 2OF1A 4HMIA 3QB3A 5KYLA 1EYDA 2EY6A 1A2TA 2F0DA 2KQ3A 2F0JA 4S3SA 1SNDA 2ENBA 5IGGA 3RUZA 4N9TA 2EYMA 4DF7A 2F0KA 3LX0A 5KRUA 1KABA 2RBMA 5C5LA 2F0EA 2O4XA 1STNA 2F0HA 3ITPA 4KV6A 3TP8A 5CGKA 5HURA 3MXPA 4K2LA 3MVVA 5J1ZA 5I9PA 3BDCA 5K5PA 2F0SA 5JAVA 3ERQA 4B9XA 3R3OA 2EYHA 4J6HA 5CV8A 3TMEA 1TT2A 1SYFA 2F3VA 1EY9A 2PYKA 4K6DA 3VA5A 1STYA 5KEEA 4I65A 2LKVA 4YIJA 2F0TA 1IHZA 2EYFA 4K8JA 5CV7A 4B9WA 1II3A 1A3VA 1SNCA 5ISRA 5I6YA 3SR1A 3SK5A 1STBA 4KY7A 3V2TA 3DHQA 4E6IA 5I9OA 1KDBA 2QDBA 5EKLA 2PZTA 4KHVA 5KIXA 1EYCA 5CR3A 3NP8A 3P1HA 3HEJA 4HTHA 5F2DA 1EY0A 2KHSA 5J22A 5CC4A 2F3WA 1ENCA 4K5WA 1EY6A 5C4HA 4DFAA 4KD4A 3OMGA 5M9OA 1EY8A 3D8GA 3TP7A 1TR5A 1STGA 4LAAA 4R8NA 4EQOA 4KY6A 3NQTA 1JOKA 4PMBA 1F2YA 4F7XA 1KDCA 3MZ5A 1SYEA 4J1MA 3NK9A 5J39A 4QMGA 1EY7A 3T16A 4ID6A 4K2KA 4KJOA 1A2UA 1F2MA 4K14A 4RKLA 4RKBA 3C1FA 5I6WA 2F0LA 2F0IA 1ENAA 2F0NA 3EVQA 3T13A 5IGBA 1SYBA 2F0QA 1EYAA 2SOBA 4IALA 4ME5A 1F2ZA 5EGTA 2PZUA 4NMZA 3MHBA 1SYCA 3OWFA 3EJIA 2EYPA 5C3XA 1A3TA 3U9OA 4QF4A 4OL7A 2F0FA 1EY5A 4IZ8A 5DEHA 3PMFA 4EQPA 1JOOA 2F0GA 5IGCA 1KDAA 4N9PA 5EKKA 2EY5A 5IGEA 3E5SA 4KJNA 4KTAA 4NDXA 4K5XA 3SXHA 1EZ8A 5C6AA 1NUCA 2F0PA 1EZ6A 4IUNA 3SK8A 3TP6A 3NUCA 2PW7A 5C3WA 2F0WA 5KYIA 4EVOA 4F8MA 1STHA 4H7BA 4PNYA 2EYLA 4WRDA 4DGZA 2EYOA 2F0OA 4KY5A 1A3UA 1SNMA 4QB4A 2OXPA 3OMCA 5CV6A 4G57A 5C5MA 2EY1A 2PW5A 3D6CA 5IOCA 4MIUA 2RDFA 4WORA 4ZQ3A 1TQOA 2PZWA 4NP5A
chains in the Genus database with same CATH superfamily
2ICEC 2UUCQ 3BYTB 1STEA 1YHAA 4O0AA 3TEHB 1XMOQ 3SK4A 4K5VA 2A19A 4UPAA 4A3DB 1H9RA 2VY3A 2R3ZA 1VDZA 2NWGA 1WTWA 5LMNW 1XTDA 1E24A 4JI7Q 3GDEA 4LF8Q 1UUPA 2KBNA 4CHTB 3BVZA 2F0MA 2RHSB 4RWSC 5CV9A 5ELBA 4DK1A 1Y1WH 2NUCA 2OQ0A 3K7UC 1CKNB 2F0DA 5IGGA 2HD3A 3OPOA 4NPSA 3VR3A 1KABA 4DV2Q 1G6PA 1JJCB 2VQFQ 5I9PA 2R7ZB 1B70B 4LNQA 1O78A 1RJTA 1TT2A 2ZM6L 1SYFA 2KEEA 1VQGA 4R4QA 1IHZA 2AKWB 1QZHA 4CDEC 4H13C 3JAMi 3MTSA 3HOVB 3S17H 4Q5VA 1XPUA 3B6YA 4A75A 1SAPA 2NN6G 1VQNA 1Q3LA 3IFTA 4RMFA 2WAQG 4H44C 3W1BA 3AU7A 4QL5A 1SR3A 4JI4Q 3RLNA 3TDQA 4EX5A 3OHXC 1T5XD 4HIDA 4X62L 3M4PA 2F0QA 5IYBH 4KHPQ 3TQYA 1X3QA 4LK1C 4I7AA 5AFWA 4QF4A 2JJQA 3MXUA 1YVCA 3CC2A 2HDMA 3KDFB 1D8LA 1N33Q 3K0XA 2G5DA 5H1SE 4YCVA 1TS4A 4P71A 1T5EA 3RN5A 2DNCA 3PIP3 4QB4A 2LMCB 1VQLA 5CV6A 1BNZA 3VA7A 5IODA 4A3CG 2R7FA 4C3HB 4DV4L 1X32A 4LWCA 5CV5A 4KKTA 4P74A 3A8KE 4XIGS 1L2FA 1MSGA 2F1MA 5K36H 1E2VA 4IFDJ 3I4MB 2BH8A 3URYA 4OWTB 1H9MA 4JW0A 3ER0A 2I46A 3TREA 2E76C 4DV0Q 5E7NA 4DNIA 1EIFA 3PO2H 1IBLL 2YTYA 2EPBA 2E2JB 4DR1L 5KYLA 2WFWA 4XTCS 4BXXG 2XVSA 1A2TA 5EPJA 1U4LA 4GNXA 1BCPF 1IYJB 4DF7A 4JG2A 3KBGA 4WJ3M 2MO1A 2JN4A 4IQZA 4A3IB 1ET6A 2JA5B 4Z9CB 2EVBA 5J1ZA 1LTLA 1O7LA 4EGVA 1QILA 4QIWE 3LGJA 4PZ6A 5C44H 1WD1A 1AE2A 1N8RC 1ILPA 4ABNA 1HNXL 3T1HL 2UUAL 3PO3G 1A3VA 2VUMB 1WVLA 3PCOB 1ENFA 3QWNA 4OO1G 2K5DA 3Q8DA 3HOUH 1XX8A 1EYCA 3KLRA 3CCRA 2JXMB 3HOZG 5EBCA 4RAUC 4IPGA 3AMUA 3D31A 4TSSA 1EEFD 2B3GA 2UXDL 2AWNA 4GLVB 1JWMD 3PUZA 1HNZL 2MPMA 1SYEA 3T16A 3G6EA 4ID6A 1TU2B 1BBUA 3T13A 5FO7B 2PZUA 2JA8G 3I73A 5C3XA 3BG3A 5CBAE 4A3JB 1NY4A 1NJIC 4U68A 5IGCA 4HJAA 5EKKA 5E4XA 1PFSA 1DCZA 4A3MB 2ZJQA 1QNKA 1I6VC 3ERSX 1HZAA 1LLRD 1YITA 5G3LF 5C3WA 3E9HA 1DOMA 1GD7A 1NE3A 4B3TQ 5FLXE 5D65A 5JPMC 4A3DH 5M3FB 4YHHL 3D6CA 4CKEA 1S5BD 1B53A 2PZWA 4RCOA 2WACA 3G7LA 4KK7A 3G48A 2KCTA 2UU9L 4PV1C 5GQOA 5HGQA 4IJLA 4DR7L 5KNBA 1FYCA 1PTOD 2E2IB 1BDOA 4X3TA 4A3KG 4IFDG 1LTBD 4X64L 3D4DA 5JEAG 4XQJA 1UE7A 1YJWA 3J80i 4B3ML 4LFAL 3CF5A 3UDGA 2A5HA 1WTOA 3GD7A 1RCVD 1EYDA 2LSSA 1PRTD 2K5HA 1B1ZA 2DUDA 5CORA 5LHY1 5FJ8G 3S1RB 1IBKQ 2HHHL 4XQNA 1WTQA 3UDXA 4L6TB 5ELOA 1BCPB 5EPKA 3MXPA 3GTGB 1VQEA 1WCMB 4CKBA 4MN3A 1D2BA 2Q2HA 4UP9A 1XNRL 5EPLA 2B2VA 1QWYA 4K6DA 1DYQA 4JBJA 2K5WA 1C0AA 3G71A 3FVQA 4JI6L 1XTCD 4CDCC 1PH9A 1CZWA 1I50B 4DV5L 2A73B 4PZ7A 1MIUA 2QKIC 3A5UA 2XTIA 1Z47A 1G8ZD 2AWOA 3E0EA 1R4QB 1K83B 3I8ZA 4KD4A 3I55A 3IAYA 4C1NI 2GA4B 4GN5A 3MA2B 1FNWA 3KLWA 1KTKA 3E0JA 3J81L 4QIWB 4F7XA 3D6WA 1A6XA 1NTGA 5J39A 3QR8A 4OWWB 4RKLA 4LUVA 5FK9C 1ZEQX 2NZOA 1BOSA 2RCNA 1Q86C 4QQBX 3UDFA 2WINB 1VMPA 2DNEA 1TWHB 3BYYB 3MFGA 4DAMA 1EY5A 1JWUD 2C5CA 2HCIA 1B9NA 3CPWA 1IYVA 4ULLA 1E7ZA 3M7GA 1G2SA 5C4XB 3AEVA 1NUCA 1SFOH 1V9PA 5A2QL 1STHA 2N3SA 2SDFA 2V4DA 4WRDA 3OW2A 2EQSA 2EYOA 4DGZA 4C3HH 3R2TA 1PH7A 2OXPA 2M9VA 1UEBA 2R7DA 5LMNL 4AQYL 2NVQH 4GKKL 3CKIB 2SNMA 1SNQA 4DR2Q 3DLLA 4DV1L 3ZJYC 5CV4A 5JOBA 3S1QB 1HR0Q 1HTLD 3S15B 2RVLA 3N52A 2WKDA 3SVMA 2K32A 4HIKA 3GTKH 3S16B 1QZGA 1X65A 2I07B 3HKSA 3ZYYX 4LF6L 2A6HD 4ILWA 2ALYB 2AQ1B 4DR7Q 1BKBA 2EY6A 1FD7D 3FKIH 1SBBB 3CPFA 4XYOA 3NBIA 4PQXA 4X64Q 1VQ7A 4CGYB 2SEBD 1WTXA 3TP8A 4A3FH 2GVAA 3NSWA 4DAPA 1I5FA 2XGTA 3BDCA 3H0GH 3LNNA 3BZKA 4LFCL 1TS3A 1CSPA 4DR3L 2C9OA 3U4ZA 2R92G 3I2ZA 4I65A 4OX9L 3M3YH 2TMPA 1II3A 2D5DA 1H95A 1SLJA 3S2DH 4LFBL 1SE4A 1AP0A 2D0OA 4IUQA 1Z7TA 2LXKA 1JJ2A 4NXML 4HTHA 4LF5Q 2KHSA 3RLFA 1Y1WB 4UY8C 5IT9L 1ASZA 4PMWA 1STGA 1YNJC 4LAAA 5CYUA 4JI6Q 4KY6A 3PIO3 2OTJA 1CT1D 3HOXG 4A3JH 1FNVA 5BN4A 4JVZA 1A2UA 3CMEA 3CC7A 2NVTH 2P5ZX 1PH1A 4A3MH 1XWEA 2LXJA 3OWFA 1CSQA 3M4OH 3OYYA 4AYBE 2XSCA 5ELFA 4IZ8A 4WFN3 1JOOA 4CDDC 1ICFB 2F4IA 5DNFA 2JA7H 3NEMA 5M3FH 3J7AV 1LUZA 4LF7Q 4R4CA 1M8AA 4DUZL 3OMCA 2PI2A 1RTNA 4NB3A 3L9AX 2L1BA 5E1FA 4RH6A 2A6EC 4YCUA 3K0YA 3HOYH 5C3EG 2DY7A 3STBD 4UAIA 1Q1EA 1UNSA 4A3BG 1D1KA 5E3FA 3P7JA 1FL0A 2VB2X 4DU9A 4ALPA 1CK1A 3I72A 1SNPA 4X66L 1AEXA 3O13A 5LMNQ 4AQYQ 4NKLA 4TRDA 4GKJQ 2KECA 2Q2IA 1VQDA 1EY4A 1CZGA 3RZOH 1HZCA 2EY2A 3TS0A 1A62A 1CUKA 3FPPA 2F0JA 2VB3X 3PQIA 5M5XH 3LX0A 4UHVA 3T51B 2LFNA 1I6HH 2HUGA 4BWGB 1NBWA 3R2IA 5BN5A 4BY7G 1I50H 1BBWA 2CFMA 3GTLB 4IFDH 1PZKD 1HNWQ 2EYHA 3CD6A 4Y52H 2K1BA 5CV8A 4ZKCB 4X3SA 1I94L 2F3VA 3MAQA 3VA5A 5IWAQ 4JI2L 2PMZE 2F0TA 4GOPA 2PNHA 1SNCA 1QVGA 4YWKA 3PSIA 4YCWA 4DR6Q 3FRPB 3I4NG 1P8LA 5M3MG 1TY2A 1IKLA 1U4PA 4LFCQ 3PO2B 1SE8A 1YI2A 2CW0C 2F3WA 4DR3Q 4Y7NH 3L3OC 2DY8A 3IRBA 4GZYC 1E1OA 2EDGA 1XJVA 2IW3A 2K75A 2EZVA 1V1PB 3KF8A 2PPBC 2NZHA 1FVIA 1V1QA 4DA2A 5I2YA 5IE8A 5IGBA 1PVOA 2HT1A 1SYBA 5EGTA 2FHTA 1NMFA 4A93G 4A3LH 2YYZA 2EYPA 5JJKA 3L7ZC 5C44B 2X69A 4EQPA 4IOAA 2MFIA 4F87A 4N9PA 3LWUA 4X65L 4L63B 3CCUA 1KQSA 5IGEA 4JI8L 1X9NA 2PW7A 3EQLC 1I4GA 3HOUB 4PNYA 5BR8L 1A3UA 4DAYA 1VQ9A 4X3KA 3UDIA 1RODA 3HOWH 2RSNA 1XNQQ 3M4QA 2O5IC 3ULLA 4L5TA 5EBDA 5IGDA 5FLMH 4AYBB 1P16A 3RN2A 3F2UA 3V96A 1K0SA 2E75C 3MXGA 4K8IA 3TZDA 5DM73 1NCVA 1TWFH 1H9SB 3P75A 5KGUA 1C7YA 1GVPA 2BH2A 1TWCB 1KXLA 4JYAL 1S72A 4LF9Q 5ELNA 1SYGA 3KJPA 1IZ6A 1VQ5A 2A68D 2B63G 1FR3A 3SR1A 3QO2A 3SK6A 1QOHA 4B3SQ 1U0LA 3DWPA 1C9OA 1RDPD 2UXBL 1Y14B 1KC8C 4BBSB 2F4VL 3J7AF 1Z9FA 5IYDG 3KLSX 3HS0C 4FP5D 2LS01 2F0EA 5CGKA 4A3GH 2IL8A 1CKMA 1KLUD 4QJFA 4OIKA 4HJ9A 2KJXA 4OELB 3R8BA 5FKAC 1JWSD 2A69C 4ZCKA 2R7ZG 2JQOA 3FMCA 3SDZA 1G51A 3CCJA 4JI1L 5JVH3 4G7OC 3FEWX 2YU9B 1WFQA 3CHBD 4JV5L 2Z6BA 3I91A 5CBEE 2QEJC 1MD2D 1IBML 4JI2Q 1N36L 3HOVG 5LMUQ 2E2HH 1EWCA 3NWTA 1VQMA 1KDCA 2ZXPA 4JC0A 4KJOA 2PMZB 3NTIA 3WDNA 2SOBA 4FNFA 4O2DA 3GTQB 2B29A 2IX3A 1F9QA 1TKWB 3A54A 3PMFA 4MNOA 3NELA 5JJIA 1YIJA 1XPOA 4B3RL 4P75A 4CBVA 3SK8A 2KUMA 3AFQA 2FXQA 1VQCA 3U9SA 1WTRA 4QUCA 1EIYB 2UUBL 4F88A 1HHVA 3NTKA 3K80C 3SEBA 2B8FA 3OTOL 1QG7A 4ZQ3A 1W3SA 4IUUA 3SE0A 3S24A 4K0KL 4JI8Q 4DR4Q 1NR4A 1DJRD 3KUPA 3S9WA 5FO8B 3J81j 3K57A 1FJGQ 3NTHA 1N34L 3C3LA 3U4VA 1TS5A 1BXTA 4ZUJA 2B8GA 2NBFA 1IL8A 2B2YA 4C3IH 1GUOA 3BDLA 3I4MG 1HFGA 4HAEA 2K33A 1WTVA 4GS3A 1B3QA 1SFOB 1KNAA 1ESFA 1SNDA 4IO9A 2OWOA 3GTLH 2F0KA 1CHPD 5KRUA 4A3BH 2XIWA 3RLOA 5HURA 2NVQB 4K2LA 3K5MA 5K5PA 1Y1VH 4GLAC 3GTPB 4DR5L 2L5TA 3U58A 4J6HA 4IUTA 5JEAJ 1KIXA 1YJ9A 2K50A 1D7QA 1K8AC 3OWEB 4A3IG 3CCLA 1BVSA 2JA5G 4KLKA 4YIJA 3PUXA 2RHQB 4LMQD 1A0IA 2DJFC 4XYQA 5IYCH 4E6IA 3GTKB 4FDBA 1BCPD 2WV6D 1GUGA 3RR5A 1Q82C 2XRQD 2F03A 1SEBD 3HEJA 5GROA 4GNXB 1VF7A 2HCCA 2R93G 2B2WA 2VUMG 5D14A 3DM1A 1PH2A 1VS0A 1SMYD 1RTOA 1JMCA 4BY7H 2QCPX 3AFPA 3KJOA 2ID0A 2Z6KC 3FKIB 1F2YA 3W3AA 3DEOA 3MZ5A 4C3JH 1U5KA 1AH9A 3J80L 1QCBD 4FVMA 4BY1H 4A3FB 3C1FA 4C2MH 3I4LA 3H0GB 3TSSA 2NVXH 2UXCL 5DLQE 4DK0A 1YBYA 1K8GA 1XMQL 4O42A 1O7ZA 1B8AA 3TN2A 5M3MH 3HP3A 4LW1A 3M3YB 3EIVA 2Y0SE 3G4SA 1OXSC 2ZM6Q 3S2DB 5IP7G 3CCEA 2JA6H 4MTKA 1GXDC 1GKHA 4EVOA 5KNDA 2J4XA 1PXUA 2WIIB 1Q7YC 1GUTA 3A55A 2QILA 1HQMC 1JE5A 1GUWA 3S2HH 1TWCH 3MXNA 3MXNB 3M9BA 3OSOA 4DUYL 2F0UA 2OEOA 3HKZE 3DMUA 3T1YL 2NVTB 4A3EG 2HIVA 2AUKA 4POFA 3PO3B 2NB0A 2M00A 4YWLA 3M4OB 4BBSH 3OTOQ 4X62Q 2L15A 3JAMc 3OIPA 3HOZB 5IGFA 2JA7B 3NBHA 4DV3L 3QB3A 1F9PA 1IL2A 4BBRG 4QUFA 3BU2A 4N9TA 2EYMA 4JBMA 4JI3L 4HIMA 5C5LA 4LJZC 5M5WH 4DK3C 3KYHC 1LO5D 3HOYB 2JA8B 1I3QH 4HJ8A 2B63H 1DZ1A 2K03A 1KHIA 4H0LC 2YU9H 1LTID 2WB1G 4JI0L 1S5DD 4K8JA 4B9WA 4DV4Q 5ISRA 3JAME 1PZJD 3PIPA 3DHQA 2JK8A 5L37A 4FF3A 4R4IA 1ZYRC 1YEZA 1ESRA 1S40A 1CTMA 2K52A 1VQFA 3BVGA 1QUQA 1PTOF 1ENCA 3RZOB 1PFBA 1TR5A 2B39A 4JPBW 2CWPA 4K6LA 1U4RA 3GTQH 1IBLQ 2NN6I 2VL6A 5M5XB 3CCQA 4DR1Q 1S3OA 1Y8PB 1AFPA 1XYIA 4K2KA 1I6HB 1F9SA 1SE3A 3EVQA 2F0NA 4AH6A 4ME5A 1HJPA 1ML0D 3A7LA 1XXGA 1A3TA 3U9OA 4IURA 1YHBA 2N8NA 5DEHA 4OONA 1G91A 1HFNA 1WI5A 2F0GA 2JEAI 3J7YW 2EJMA 4KTAA 2VNUD 1MGSA 2Z4IA 4IUNA 1Q12A 3G6JB 1HNXQ 4TKOB 5BN3A 3T1HQ 2UUAQ 4POGA 4H7BA 1LTSD 1N9WA 2EYLA 2UXCQ 3GTOH 5ELDA 3KF6A 2Q8IB 3H91A 2FJ2A 4Y7NB 2XWBB 3QIAA 2RF4A 1KRTA 5C4XG 1OXTA 1V8QA 4R4OA 2PI2E 5C0XG 3F2DA 2VQEL 2L4NA 1VQ6A 4KKSA 3MEHA 1MI2A 3OOCA 1D5XC 2UXDQ 2RSOA 1HNZQ 5KNCA 1EOTA 2Y0SB 3K5OA 3CMAA 3FHWA 3IKJA 4OGQC 1CQVA 2NN6H 1PFNA 3QOJA 1T9HA 1H9JA 3HZXA 1EFID 3H09A 1JORA 5ELCA 1EWHA 3LWEA 5IY0A 3VR4A 2Q2TA 5GAEC 4EQ5A 1SXTA 3T1YQ 3GTPH 2RDHA 1EU4A 4GNXC 3ONAB 1X3FA 2RA4A 1STNA 2B2WC 3HOWB 1GO3E 1PFMA 4APVA 3HKZB 2YTXA 2QA4A 4P2CB 2M2LA 3X3NA 4FXDA 4IUVA 3AB9A 4YHHQ 2XNAC 5D3DA 1IW7C 1TWFB 2EXDA 2LKVA 4UDUC 1K0RA 1KNEA 4U673 2UU9Q 4HSVA 4A4IA 5T1GA 3WOEA 3QG1A 4J8QA 1LTTD 3PUYA 4A3CH 1K28A 5KIXA 3BZDB 3GO5A 5J22A 2A1AA 5M9OA 1N32L 1GM5A 2I5MX 4V0BA 4LFAQ 3AYHB 1LTRD 1EEID 4B3MQ 2IT1A 3NQTA 1PTOB 2QW7A 1Y1WG 4QMGA 4H02A 2J7ZA 2ZT9C 4A3GB 1JR0D 3GV6A 2HHHQ 2MHVA 1AW7A 2OCEA 1R9TH 1F2ZA 1QVFA 1TWAB 1DXMA 4BXXH 4RFBA 2NZ1D 1JB3A 1J6QA 2MUYA 4IPDA 1QNUA 1XNRQ 4RGTA 1VQAA 2R61A 4DNTB 5GAHC 5ELEA 1E0BA 1CA5A 3PF5A 1UE5A 5EKIA 4DV5Q 4FF1A 2OTLA 1J5EL 1X3GA 2QF7A 4XT1B 2PW5A 2WKCA 3BVMA 3S14H 3PO3H 2E2HB 4L8JA 2EJGC 5I2XA 4OO1H 4HIOA 2CKZB 3I90A 2E5LL 1AZPA 2A8VA 1SSOA 3EA6A 2CQOA 2Z1CA 3NXWA 1JOQA 3HOZH 2H1EA 1J8IA 2JP1A 3A56A 1HQRD 4NXNL 4UP7A 4IFDI 4ZUIA 1TS2A 3UE0A 4P72A 2BCOA 1OO9B 4EQNA 5IYBG 1RKNA 1EU3A 4DV6L 2OQKA 2K05A 2KEDA 4DK6C 3K8AA 3CXCA 1M1KC 3NQIA 5AJ3L 2JA8H 1PLFA 1WYDA 2VZAA 4ZAIA 1QB5D 4TVAB 1DOKA 4DN4M 1UEAB 3N6RA 3T56B 4A3EH 4GKKQ 2B2VC 1EY9A 4WJWA 2ZJPA 1STYA 4JOIA 5E4WC 4DV1Q 4CJ0B 4KY7A 2Z4HA 3VR6A 5CR3A 4L5SA 1EUJA 3CCVA 5F2DA 2GN5A 1YHQA 2UUCL 3DXJC 4RGNA 5K36G 4C3IB 3I3CA 2A74C 4R8NA 2K04A 1NNXA 2PQAA 4A3KH 4LF6Q 1GHKA 1RD9D 2HDLA 2PQAB 2BE5C 3PO2G 2D9UA 5JEAH 4A3BB 1F2MA 4RKBA 4JI7L 3H94A 4LF8L 2AQ3B 3EFXD 1Y1VB 1HA6A 4GOPB 1VQKA 2NTTA 1K3BC 5FJ8H 1B9MA 2OT2A 4P73A 4R9WA 4DV2L 2ZTEA 4FYDA 4OX9Q 5C44G 5KYIA 2L11A 2VQFL 1WTPA 1SNMA 4CJ1B 2ASBA 4LFBQ 5JJLA 1PYBA 3K81C 5C5MA 3KF8B 4OHJA 4YWMA 3VYTA 4NXMQ 1PH3A 1ZYRD 3H6MA 4BY7B 2PO4A 3HOUG 1LTGD 3CP0A 4C3JB 3TS2A 3D4RA 3TP5A 1ILQA 4O1NA 1EOVA 1FNUA 3GQBA 4KD3A 4OIJA 4BY1B 4C2MB 1S5ED 5T1IA 4B08A 3J81c 2VS1A 1B4OA 1HCZA 2NVXB 1TWGH 3CRKC 2FINB 4AYBG 4HJ5A 2WP8J 1E1TA 1Y8OB 3KLSA 1I4HA 4HMJA 5M3MB 5FLXL 1SYDA 1BO0A 1B3AA 1MHWC 3T4AC 4XT3B 2MJ8A 2Q2UA 5EQ0A 4DAYB 3PIOA 4JI4L 2JA6B 2WAQE 4CKCA 4S3SA 3S1NB 2CH4W 2AQ2B 1VCIA 1Q8KA 4KHPL 1KAWA 2H4OA 4YY3L 4NXNQ 1JJGA 4XDXA 3EBEA 4KV6A 2KOLA 1PH6A 1PTOC 4AIMA 4BA2I 4DUZQ 3U50C 4A93B 3S2HB 4X3UA 3J81E 1N33L 1VF5C 4A3DG 3MFYA 1GUSA 5KEEA 1LT3D 3IL8A 5CV7A 1KL9A 1NR2A 2DJGC 4DV7L 1STBA 3V2TA 1LABA 3F2BA 3K58A 2RQXA 1F2LA 5EKLA 1PTOH 4KHVA 5HY6A 1PRTC 1EY0A 4X66Q 5CC4A 4CJ2C 2VW9A 1AE3A 3OMGA 3ULPA 1EY8A 3H15A 4L5RC 3FPUB 1TWAH 1JOKA 2AMCB 4I7ZC 4PMBA 4TQUS 5A2QE 3NWSA 2ZTDA 1L0XB 1I4RA 3CU7A 5M5WB 1LT6D 3RMHA 1A63A 3BZCA 1RHPA 4DV0L 2KCMA 3DM3A 1I3QB 1Y69U 5JVG3 2B63B 4OL7A 2BDNA 3F8TA 1B44D 4RA8A 1U4MA 1I94Q 4HSPA 3MWYW 1LM0A 4OEMB 2KHIA 3TP6A 1EZ6A 2B2TA 4L5QA 1IW7D 1NMGA 1SJED 4ZLTF 1K8MA 2KENA 2F0OA 4KY5A 2Q8RE 3AQQA 1GOZA 1TXYA 2E74C 1CKNA 2R92H 5JPNC 1SN8A 2RKSA 1Z6HA 5FOBB 2I5LX 4PMCA 1X54A 2PNRC 5IT9c 2EE1A 2QGQA 1Q81C 4LUOA 1PH4A 1I4XA 1YJNA 1D6EC 1B50A 4DPGA 1L0WA 1WD0A 3SGIA 3QJYA 2K14A 1BBXC 5HGTA 2X6LA 3A7AB 1GUNA 4ZRZA 3HOXH 4JOIC 2EJFC 5NUCA 1VQOA 1G2TA 4FXGC 3M4YA 1JICA 4X65Q 2X6GA 1HRJA 4KI0A 5LL6X 2K5NA 3CRLC 3BDOA 3GTOB 3RZDH 3ITPA 3GTMB 1YNJD 5IT9E 1OXVA 3NE5B 5BR8Q 3PUWA 4XQQA 4DXFA 3ERQA 1E2ZA 4C3HG 2PYKA 2RDGA 3GP7A 2CQAA 4YY3Q 1UWVA 4LUZA 4GOPC 5I6YA 4B3TL 2A6HC 3KK7A 1RIPA 1K73C 1PV4A 4WJ4A 2WAQB 1KDBA 3KDFA 2E8GA 5C3EH 3NP8A 3S1MH 4JYAQ 2K5QA 4MTNA 2CH4A 2JEBI 4RHRA 3TP7A 1FGBD 2TSSA 3Q6SA 3T53B 1B2TA 2KA7A 3V05A 2HQLA 3TBIB 1VQBA 4J1MA 2J0TD 3VYUA 3GTJH 2UXBQ 2XRSD 4DV7Q 5GAGC 2D2CC 2F4VQ 3CQZH 2A6ED 2F0LA 1JE4A 3FKIG 1O7YA 1V1OA 3K7AB 4RG1A 3L2PA 3RNUA 2F0FA 4A3FG 2CHBD 2EY5A 2WB1E 3E5SA 2EOTA 3H0GG 5I4DA 1EQTA 1IBKL 1LT5D 4MZ9A 1SMXA 1SROA 4OXPA 4RGOS 1D5MC 1TIID 4PG3A 1VQHA 2MGSA 4F8MA 1PH5A 3HGBA 1C48A 3K6OA 1IKMA 1E22A 4JI1Q 2D0PA 5M5YB 4NP5A 4GLXA 4M1UB 3CCSA 4JV5Q 2ZJRA 1SDFA 4KMUC 2EXZA 2MQHA 1SJHD 3I4NH 1UE1A 2CWAA 1IBMQ 2EIFA 4IPCA 1N36Q 2NTSA 1YNNC 2Z0SA 3EROA 3NENA 1DONA 1R9TB 1GHJA 2EYJA 1CQFA 2BE5D 1EIHA 1W2BA 3A8IE 3GV3A 5EAYA 1U9RA 4A3JG 3S1NH 4V190 2C35B 1EQVA 5C4ZA 5A35A 2K28A 2HQEA 4N8X1 1BQQT 4IJHA 3KOJA 5IIFA 4A3MG 2R93B 4ODGA 2E2DC 1LYLA 2IJ0A 3Q23A 2NYZD 3NPPA 5C0XJ 2KQ3A 2ZXOA 2BA0A 4A93H 3RUZA 1CKOA 4B3RQ 2CW0D 1CFMA 3STBC 2O4XA 2JA7G 2N49A 3E3XA 5M3FG 4MHEA 3S14B 5FLXc 2K6AA 2UUBQ 2NVYB 5G3LD 1ZXTA 1DOLA 1B7YB 1JCKB 1H9KA 2KCCA 4K0KQ 1TVXA 2BDOA 5CMDA 3HOYG 3M7NA 1DD2A 3A0JA 1UE6A 3NBHB 1EQQA 1AN8A 2PZTA 2JA9A 2L55A 4K5WA 3K59A 1EY6A 4DR2L 3D8GA 2L9HA 1LACA 1N34Q 3E6ZX 3TZUA 4JI5L 3WWVA 2B2TC 1VQ4A 3DWQA 1HR0L 1WJJA 4XXEA 3CW2C 1A15A 1PA6A 2DN8A 1F77A 2F0IA 4A3EB 1WCMG 2H5XA 3KFUA 2ZTCA 3Q22A 1W6KA 2K4KA 1FGUA 5IYDH 2IHFA 4DR5Q 1X3PA 1ET9A 1M4VA 1K9MC 1EQRA 1VQJA 3SXHA 2MNAA 1QUQB 2F0PA 5IP9G 1IYUA 4BBRB 5GADC 1XPRA 3F1ZA 1K3RA 3OW7A 2G9DA 3I70A 3ND9A 4KN4C 1IXRA 2EY1A 5IOCA 4JBWA 4MIUA 2IX0A 4WORA 1TQOA 2R7ZH 4FXKC 4A3KB 3WOFA 4QGUA 1I4QA 2F3IA 1PRTF 2I0QA 2QDLA 3HRZC 1SNOA 3QOLA 3J7ZC 4A76A 1SE2A 3J7A5 2SNSA 2WB1B 1OXXK 4LF5L 1NSNS 1Q46A 3D4WA 3KBXA 5C4JB 2PQEA 3RD4A 1MJEA 3HOVH 3I7FA 1G6ZA 2A69D 3VYSA 4FF2A 2F0VA 2Y0SG 1STAA 2JYOA 1CHQD 1XMQQ 3GTMH 2ZXRA 3KF6B 4A3LG 4HMIA 2B2YC 4R4TA 4ZK9B 3ULJA 4HR7B 5D3IB 1F9RA 2RCFA 5DM63 2N88A 4FF4A 2Z9HA 2XWJB 1MKHA 2B2UA 2F0HA 1EYGA 4KKUA 5JAVA 1MBYA 2IHEA 2MO0A 1D5ZC 2ICIA 1L1OA 3UI2A 3HOWG 2A68C 1L1OB 3HKZG 2KHJA 5FO9B 2DGYA 4HCSA 4DKAC 4LF7L 1TWGB 2FMMA 3W5OA 1EWIA 3PV0A 5FLMG 4DUYQ 1KRSA 1WTHA 1ICWA 1VMCA 1R4PB 2QDBA 3K5NA 3TRZA 1NAPA 1JT8A 3Q0AA 2K7VA 3FDTA 4RGMA 4EQOA 1QVCA 3C2PA 3UE1A 3K7AH 4DV3Q 1VQPA 1PHJA 4QY7A 5J3BA 2HIXA 1EFWA 1PMRA 4JI3Q 1EL0A 4GKJL 1SYCA 3I4MH 2KVMA 1HA5A 1HZ9A 4JI5Q 4G4KA 1EIGA 3MC0B 2YV5A 4OO1I 4A3GG 4DAVA 1RF2D 3EN2A 5M5YH 1QJOA 2E2JH 1CA6A 1E3PA 1X56A 4JI0Q 1Y8NB 3HFZB 1LV9A 1RL2A 1X55A 3A74A 1HNWL 1GJXA 4G57A 1HUNA 2O2LD 4A3IH 2RDFA 2JA5H 4BS9A 1C4QA 3P20A 5IWAL 5EJWA 1X3EA 1DGSA 1SRUA 1A8VA 2GVBA 4G7HC 1HH2P 4DR6L 5DAUA 1PRTB 1HTPA 2R93H 1AZQA 1M90C 2VUMH 1LT4D 3CCMA 3J81i 2K5VA 3MEFA 1KAAA 3J80c 4DNRB 3D0FA 1HPCA 1L0YB 4HJ7A 2IX1A 3VR2A 2OF1A 4RCNA 4OWXB 1O80A 2CCZA 1HZBA 2ENBA 2KCNA 2NVYH 1I4PA 1V43A 2R92B 1CM9A 3MVVA 4PZ8A 2F0SA 2L12A 1JQYD 3TMEA 5IP7H 1KD1C 1Q1BA 3DUZA 3FP9A 3X3MA 2VQEQ 1C8CA 3J80E 3D3RA 4CDFC 4RHSA 4N8FA 4GN3B 1MJCA 4X6AH 1G291 4ZKBB 3SK5A 1E2WA 1YNND 2O5JC 3JC66 3PUVA 1VQ8A 1XNQL 3HOXB 1PDQA 3OIQA 3H3VI 4DXGA 1WOCA 3L0OA 3PGZA 3PF4A 4LF4L 3VYRA 3S17B 1HUMA 2Q8TA 3VR5A 3NK9A 3RZDB 1EY7A 1J9OA 1KLGD 3CC4A 4C3IG 4LF9L 3IFDA 3Q24A 2E2IH 2BOSA 3W2DA 1EYAA 4JBKA 3MHBA 2D62A 4B3SL 3EJIA 1PYWD 1YZ6A 4BBRH 3ND8A 4ME3A 3HG9A 5COYA 1VQIA 1BCPC 5TSSA 1KDAA 1ASYA 1D1IA 4J15A 1Y1VG 1JC7A 4K5XA 2XN9C 3F2CA 1YNXA 5C6AA 1XMOL 2PCFB 3A8JE 4HN7A 4ZYSA 4R8IA 4QCLA 4GN4B 4R1JA 3H3VC 1TY0A 1SMYC 2F0WA 5C3EB 3S1RH 3I56A 3S1MB 1OTCA 3DEPA 5IYCG 3GTGH 4C56C 1WCMH 1Q90A 1ZKOA 2FMCA 4C1NK 3C1EA 3K5LA 1S5CD 2FFKB 1N32Q 4BA1I 3SHLA 5C0XI 4UP8A 1O7IA 3GTJB 5C4JH 3H3VH 3R93A 2B2UC 3CQZB 1HR0W 1UAPA 2K01A 1BUVT 4IUPA 2G9HD 5IP9H 4C3JG 1X6OA 2IWHA 3A5ZB 1LTAD 2AUJD 1L1OC 4M8AA 1PYSB 3NHHA 4BY1G 2V1CC 2ATWA 4IPHA 5LMUL 1K83H 2ES2A 3M85A 1ONLA 4KHZA 1JB7A 4G7ZC 2RBMA 2AHOB 4JCVE 3ICEA 2L0CA 2VXWA 4IOCA 1CI3M 2JA6G 4JK1C 4B9XA 1J5EQ 1V1PA 3R3OA 4FO2A 1PH8A 1TWHH 4HEDA 3I4NB 3CAMA 2I5HA 3BJUA 1K8OA 1DM0B 2EYFA 4IN3A 1Q8IA 2MP1A 5C4XH 2LY7A 5I9OA 2N55A 5C0XH 2E5LQ 2QEXA 4NW2A 2IPKD 2BA1A 3P1HA 2IY5B 1HXYD 3C46A 5C4HA 4DFAA 2Z8LA 1PZID 1BR9A 3BS1A 4BBSG 2Z6KA 4DR4L 1QE6A 5JJZA 2R6GA 3W1GA 4DV6Q 3DWAA 4HCEA 4K14A 5I6WA 5AJ3Q 3S1QH 1ENAA 3VDYA 2YTVA 1FJGL 3JAML 4IALA 3S15H 4NMZA 1BF4A 3S16H 4LF4Q 1W6JA 5LL6S 4KN7C 1H9SA 2CVRA 2JSOA 4KJNA 4Q0FA 4NDXA 1EZ8A 2F52A 1S5FD 1MSHA 3NUCA 3E9IA 1OXUA 3I4OA 2JE6I 1S4ZA 2N78A
chains in the Genus database with same CATH topology
2ICEC 3BYTB 1STEA 3SK4A 4K5VA 4A3DB 1H9RA 2R3ZA 1VDZA 2NWGA 1WTWA 1UUPA 4CHTB 3BVZA 2F0MA 4RWSC 5CV9A 5ELBA 4DK1A 2NUCA 2F0DA 5IGGA 3OPOA 3VR3A 1KABA 5I9PA 2R7ZB 1O78A 1RJTA 1TT2A 1SYFA 2KEEA 1IHZA 4H13C 3MTSA 3HOVB 4Q5VA 1SAPA 2NN6G 1Q3LA 3IFTA 4H44C 3AU7A 3TDQA 3OHXC 1T5XD 2F0QA 1X3QA 4LK1C 5AFWA 4QF4A 3MXUA 2HDMA 1TS4A 1T5EA 2DNCA 3PIP3 4QB4A 2LMCB 5CV6A 1BNZA 3VA7A 5IODA 4C3HB 1X32A 5CV5A 4KKTA 3A8KE 4XIGS 1MSGA 2F1MA 5K36H 1E2VA 4IFDJ 3I4MB 3URYA 1H9MA 2I46A 2E76C 2EPBA 2E2JB 5KYLA 4XTCS 2XVSA 1A2TA 5EPJA 1U4LA 1BCPF 4DF7A 3KBGA 4IQZA 4A3IB 1ET6A 2JA5B 4Z9CB 2EVBA 5J1ZA 1O7LA 4EGVA 1QILA 1WD1A 1ILPA 4ABNA 2VUMB 1A3VA 1WVLA 1ENFA 3QWNA 4OO1G 2K5DA 1XX8A 1EYCA 3KLRA 2JXMB 5EBCA 4RAUC 3AMUA 3D31A 4TSSA 1EEFD 2AWNA 1JWMD 3PUZA 2MPMA 1SYEA 3T16A 4ID6A 1TU2B 3T13A 5FO7B 2PZUA 3I73A 5C3XA 3BG3A 5CBAE 4A3JB 4U68A 5IGCA 5EKKA 5E4XA 1DCZA 4A3MB 1QNKA 1I6VC 1LLRD 5G3LF 5C3WA 1DOMA 5FLXE 5D65A 5JPMC 5M3FB 3D6CA 4CKEA 1S5BD 1B53A 2PZWA 4RCOA 2WACA 3G7LA 4KK7A 4PV1C 5KNBA 1FYCA 1PTOD 2E2IB 1BDOA 4X3TA 4IFDG 1LTBD 3D4DA 5JEAG 4XQJA 2A5HA 1WTOA 3GD7A 1RCVD 1EYDA 1PRTD 1B1ZA 5CORA 3S1RB 5LHY1 4XQNA 1WTQA 4L6TB 1BCPB 5EPKA 3MXPA 3GTGB 1WCMB 4CKBA 4MN3A 1D2BA 5EPLA 2B2VA 1QWYA 4K6DA 1DYQA 2K5WA 3FVQA 1XTCD 1CZWA 1I50B 2A73B 2QKIC 1Z47A 1G8ZD 2AWOA 1R4QB 1K83B 3I8ZA 4KD4A 3IAYA 4C1NI 2GA4B 3MA2B 1FNWA 1KTKA 3E0JA 3J81L 4QIWB 4F7XA 3D6WA 1A6XA 5J39A 4RKLA 5FK9C 1ZEQX 1BOSA 2WINB 1VMPA 2DNEA 1TWHB 3BYYB 3MFGA 1EY5A 1JWUD 2C5CA 2HCIA 1B9NA 1IYVA 4ULLA 3M7GA 1G2SA 5C4XB 1NUCA 5A2QL 1STHA 2SDFA 2V4DA 4WRDA 4DGZA 2EYOA 3R2TA 2OXPA 2M9VA 3CKIB 2SNMA 1SNQA 5CV4A 5JOBA 3S1QB 1HTLD 3S15B 2RVLA 3N52A 2WKDA 3SVMA 2K32A 3S16B 2I07B 3ZYYX 2A6HD 4ILWA 2AQ1B 2EY6A 1FD7D 1SBBB 4XYOA 3NBIA 4PQXA 4CGYB 2SEBD 1WTXA 3TP8A 3NSWA 4DAPA 3BDCA 3LNNA 1TS3A 2C9OA 4I65A 2TMPA 1II3A 2D5DA 1SE4A 1AP0A 4IUQA 1Z7TA 4HTHA 2KHSA 3RLFA 1Y1WB 5IT9L 4PMWA 1STGA 1YNJC 4LAAA 5CYUA 4KY6A 3PIO3 1CT1D 1FNVA 5BN4A 1A2UA 1XWEA 3OWFA 2XSCA 5ELFA 4IZ8A 4WFN3 1JOOA 2F4IA 5DNFA 3J7AV 1M8AA 3OMCA 1RTNA 3L9AX 5E1FA 2L1BA 4RH6A 2A6EC 3K0YA 2DY7A 4UAIA 1Q1EA 1UNSA 1D1KA 5E3FA 3P7JA 2VB2X 4DU9A 1CK1A 3I72A 1SNPA 1AEXA 3O13A 4NKLA 4TRDA 2KECA 1EY4A 1CZGA 2EY2A 3FPPA 2F0JA 2VB3X 3LX0A 3T51B 2LFNA 2HUGA 4BWGB 3R2IA 5BN5A 4IFDH 3GTLB 1PZKD 2EYHA 2K1BA 5CV8A 4ZKCB 4X3SA 2F3VA 3MAQA 3VA5A 2F0TA 1SNCA 3FRPB 1TY2A 1IKLA 1U4PA 3PO2B 2CW0C 2F3WA 3L3OC 2DY8A 4GZYC 2EDGA 2IW3A 2EZVA 1V1PB 3KF8A 2PPBC 4DA2A 5I2YA 5IGBA 1SYBA 5EGTA 2FHTA 2YYZA 2EYPA 3L7ZC 5C44B 2X69A 4EQPA 4F87A 4N9PA 3LWUA 4L63B 5IGEA 2PW7A 3EQLC 1I4GA 3HOUB 4PNYA 1A3UA 4DAYA 4X3KA 1RODA 2RSNA 2O5IC 5EBDA 5IGDA 4AYBB 3F2UA 3V96A 2E75C 3MXGA 4K8IA 3TZDA 5DM73 1NCVA 1H9SB 3P75A 5KGUA 1TWCB 1SYGA 2A68D 1FR3A 3SR1A 3QO2A 3SK6A 1QOHA 3DWPA 1RDPD 4BBSB 3J7AF 3KLSX 3HS0C 4FP5D 2LS01 2F0EA 5CGKA 2IL8A 1KLUD 4OIKA 2KJXA 3R8BA 5FKAC 1JWSD 2A69C 3FMCA 3SDZA 5JVH3 4G7OC 3FEWX 2YU9B 3CHBD 3I91A 5CBEE 2QEJC 1MD2D 1EWCA 3NWTA 1KDCA 2ZXPA 4KJOA 2PMZB 3NTIA 3WDNA 2SOBA 4FNFA 3GTQB 2IX3A 1F9QA 1TKWB 3A54A 3PMFA 4CBVA 3SK8A 2KUMA 3U9SA 1WTRA 4QUCA 4F88A 1HHVA 3NTKA 3SEBA 2B8FA 1QG7A 4ZQ3A 4IUUA 3SE0A 1NR4A 1DJRD 3KUPA 3S9WA 5FO8B 3K57A 3NTHA 3C3LA 1TS5A 1BXTA 4ZUJA 2B8GA 2NBFA 1IL8A 2B2YA 1GUOA 3BDLA 1HFGA 4HAEA 2K33A 1WTVA 1SFOB 1KNAA 1ESFA 1SNDA 2F0KA 1CHPD 5KRUA 2XIWA 5HURA 2NVQB 4K2LA 3K5MA 5K5PA 3GTPB 2L5TA 4J6HA 4IUTA 5JEAJ 3OWEB 4YIJA 3PUXA 4LMQD 4XYQA 4E6IA 3GTKB 1BCPD 2WV6D 1GUGA 2XRQD 2F03A 1SEBD 3HEJA 1VF7A 2HCCA 2B2WA 5D14A 3DM1A 1SMYD 1RTOA 2QCPX 2ID0A 3FKIB 1F2YA 3DEOA 3W3AA 3MZ5A 3J80L 1QCBD 4FVMA 4A3FB 3C1FA 3I4LA 3H0GB 3TSSA 4DK0A 4O42A 1O7ZA 3TN2A 3HP3A 3M3YB 1OXSC 3S2DB 1GXDC 5KNDA 4EVOA 2J4XA 1PXUA 2WIIB 1GUTA 3A55A 2QILA 1HQMC 1GUWA 3MXNA 3OSOA 2F0UA 2OEOA 3DMUA 2NVTB 2AUKA 3PO3B 2NB0A 2M00A 3M4OB 3OIPA 3HOZB 5IGFA 2JA7B 3NBHA 3QB3A 1F9PA 4QUFA 4N9TA 2EYMA 5C5LA 4LJZC 1LO5D 3HOYB 2JA8B 1DZ1A 2K03A 4H0LC 1LTID 1S5DD 4K8JA 4B9WA 5ISRA 3JAME 1PZJD 3DHQA 4FF3A 1ZYRC 1ESRA 1CTMA 3BVGA 1PTOF 1ENCA 3RZOB 1PFBA 1TR5A 2B39A 4K6LA 1U4RA 2NN6I 5M5XB 1Y8PB 1AFPA 1XYIA 4K2KA 1I6HB 1F9SA 1SE3A 3EVQA 2F0NA 4ME5A 1ML0D 3A7LA 1XXGA 1A3TA 3U9OA 4IURA 5DEHA 1G91A 1HFNA 2F0GA 2JEAI 3J7YW 2EJMA 4KTAA 2VNUD 1MGSA 2Z4IA 4IUNA 1Q12A 3G6JB 4TKOB 5BN3A 4H7BA 1LTSD 2EYLA 5ELDA 2Q8IB 3H91A 2FJ2A 4Y7NB 2XWBB 3QIAA 1OXTA 1V8QA 5C0XG 2L4NA 4KKSA 3MEHA 1MI2A 3OOCA 1D5XC 2RSOA 5KNCA 1EOTA 2Y0SB 3K5OA 4OGQC 3IKJA 1CQVA 2NN6H 1PFNA 3QOJA 1H9JA 3HZXA 1EFID 3H09A 1JORA 5ELCA 1EWHA 3LWEA 3VR4A 1SXTA 2RDHA 1EU4A 3ONAB 2RA4A 1STNA 2B2WC 3HOWB 1PFMA 3HKZB 4P2CB 2M2LA 3X3NA 4FXDA 4IUVA 3AB9A 2XNAC 5D3DA 1IW7C 1TWFB 2LKVA 4UDUC 1KNEA 4U673 4HSVA 5T1GA 3WOEA 3QG1A 4J8QA 1LTTD 3PUYA 5KIXA 3BZDB 3GO5A 5J22A 5M9OA 4V0BA 1LTRD 1EEID 2IT1A 3NQTA 1PTOB 4QMGA 2J7ZA 2ZT9C 4A3GB 1JR0D 3GV6A 2MHVA 1AW7A 1F2ZA 1TWAB 1DXMA 4RFBA 2NZ1D 1JB3A 2MUYA 1QNUA 4RGTA 2R61A 4DNTB 5ELEA 1E0BA 1CA5A 5EKIA 4FF1A 4XT1B 2QF7A 2PW5A 2WKCA 3BVMA 2E2HB 4L8JA 2EJGC 5I2XA 4OO1H 3I90A 1AZPA 1JOQA 1SSOA 3EA6A 2Z1CA 3NXWA 2H1EA 1J8IA 2JP1A 3A56A 1HQRD 4IFDI 4ZUIA 1TS2A 2BCOA 1OO9B 4EQNA 1RKNA 1EU3A 2K05A 2KEDA 3NQIA 1PLFA 4ZAIA 1QB5D 1DOKA 4DN4M 1UEAB 3N6RA 3T56B 2B2VC 1EY9A 4WJWA 1STYA 5E4WC 4CJ0B 4KY7A 2Z4HA 3VR6A 5CR3A 5F2DA 3DXJC 4RGNA 5K36G 4C3IB 3I3CA 2A74C 4R8NA 2K04A 1GHKA 1RD9D 2HDLA 2BE5C 2D9UA 5JEAH 4A3BB 1F2MA 4RKBA 3H94A 2AQ3B 3EFXD 1Y1VB 1HA6A 2NTTA 1B9MA 2OT2A 4R9WA 4FYDA 5KYIA 2L11A 1WTPA 1SNMA 4CJ1B 5C5MA 4OHJA 3VYTA 1ZYRD 3H6MA 4BY7B 2PO4A 1LTGD 4C3JB 3D4RA 3TP5A 1ILQA 4O1NA 4OIJA 1FNUA 3GQBA 4KD3A 4BY1B 4C2MB 1S5ED 5T1IA 4B08A 1B4OA 1HCZA 2NVXB 3CRKC 2FINB 2WP8J 1Y8OB 3KLSA 1I4HA 4HMJA 5M3MB 5FLXL 1SYDA 1BO0A 1B3AA 3T4AC 4XT3B 2MJ8A 5EQ0A 2JA6B 4CKCA 4S3SA 3S1NB 2AQ2B 1VCIA 2H4OA 4XDXA 4KV6A 2KOLA 1PTOC 4BA2I 4A93B 3S2HB 4X3UA 3J81E 1VF5C 3MFYA 1GUSA 5KEEA 1LT3D 3IL8A 5CV7A 1NR2A 1STBA 3V2TA 1LABA 3K58A 2RQXA 1F2LA 5EKLA 1PTOH 4KHVA 1PRTC 1EY0A 5CC4A 4CJ2C 3OMGA 1EY8A 3FPUB 1JOKA 4I7ZC 4PMBA 4TQUS 5A2QE 3NWSA 1L0XB 1I4RA 3CU7A 5M5WB 1LT6D 3RMHA 1RHPA 1I3QB 1Y69U 5JVG3 2B63B 4OL7A 2BDNA 1B44D 4RA8A 1U4MA 4HSPA 3MWYW 3TP6A 1EZ6A 2B2TA 4ZLTF 1IW7D 1SJED 1K8MA 2F0OA 4KY5A 2Q8RE 1GOZA 2E74C 5JPNC 2RKSA 1Z6HA 5FOBB 4PMCA 2PNRC 2EE1A 1I4XA 1D6EC 1B50A 1WD0A 3QJYA 1BBXC 5HGTA 2X6LA 3A7AB 1GUNA 4ZRZA 2EJFC 5NUCA 1G2TA 4FXGC 3M4YA 1JICA 2X6GA 1HRJA 4KI0A 5LL6X 3CRLC 3BDOA 3GTOB 3ITPA 3GTMB 1YNJD 5IT9E 1OXVA 3NE5B 3PUWA 4XQQA 4DXFA 3ERQA 1E2ZA 4C3HG 2PYKA 2RDGA 3GP7A 2CQAA 5I6YA 2A6HC 3KK7A 2WAQB 1KDBA 3NP8A 2K5QA 2JEBI 4RHRA 3TP7A 1FGBD 2TSSA 3Q6SA 3T53B 1B2TA 3V05A 2KA7A 3TBIB 4J1MA 2J0TD 3VYUA 2XRSD 2D2CC 2A6ED 2F0LA 1JE4A 1O7YA 1V1OA 3K7AB 2F0FA 2CHBD 2EY5A 3E5SA 5I4DA 2EOTA 1EQTA 1LT5D 4RGOS 1D5MC 1TIID 2MGSA 4F8MA 3HGBA 1C48A 3K6OA 1IKMA 5M5YB 4NP5A 4M1UB 1SDFA 4KMUC 2EXZA 1SJHD 2NTSA 1YNNC 3EROA 1DONA 1R9TB 1GHJA 2EYJA 1CQFA 2BE5D 1EIHA 3A8IE 3GV3A 1U9RA 4V190 1EQVA 5C4ZA 5A35A 2K28A 2HQEA 1BQQT 5IIFA 2R93B 4ODGA 2E2DC 2IJ0A 3Q23A 2NYZD 3NPPA 5C0XJ 2KQ3A 2ZXOA 2BA0A 3RUZA 2CW0D 1CFMA 2O4XA 4MHEA 3S14B 2K6AA 2NVYB 5G3LD 1ZXTA 1DOLA 1JCKB 1H9KA 2KCCA 1TVXA 2BDOA 5CMDA 3M7NA 1DD2A 1AN8A 2PZTA 2L55A 4K5WA 3K59A 1EY6A 3D8GA 2L9HA 1LACA 3E6ZX 3TZUA 2B2TC 3DWQA 4XXEA 1A15A 2DN8A 1F77A 2F0IA 4A3EB 3Q22A 1W6KA 1X3PA 1ET9A 1M4VA 3SXHA 2F0PA 1IYUA 4BBRB 3OW7A 2G9DA 3I70A 3ND9A 4KN4C 2EY1A 5IOCA 4JBWA 4MIUA 2IX0A 4WORA 1TQOA 4FXKC 4A3KB 3WOFA 1I4QA 1PRTF 3HRZC 1SNOA 3QOLA 1SE2A 2SNSA 2WB1B 1OXXK 1NSNS 3D4WA 3KBXA 5C4JB 2PQEA 3RD4A 1G6ZA 2A69D 3VYSA 4FF2A 2F0VA 1STAA 2JYOA 1CHQD 2ZXRA 4HMIA 2B2YC 4ZK9B 4HR7B 5D3IB 1F9RA 5DM63 2N88A 4FF4A 2XWJB 2B2UA 2F0HA 4KKUA 5JAVA 1MBYA 1D5ZC 2ICIA 3UI2A 2A68C 5FO9B 4HCSA 1TWGB 2FMMA 3PV0A 1ICWA 1VMCA 1R4PB 2QDBA 3K5NA 1NAPA 3Q0AA 2K7VA 3FDTA 4RGMA 4EQOA 3C2PA 1PMRA 1EL0A 1SYCA 2KVMA 1HA5A 4G4KA 1EIGA 3MC0B 4OO1I 4DAVA 1RF2D 1QJOA 1CA6A 1Y8NB 1LV9A 1GJXA 4G57A 1HUNA 2O2LD 2RDFA 4BS9A 1C4QA 3P20A 5EJWA 4G7HC 5DAUA 1PRTB 1HTPA 1AZQA 1LT4D 1KAAA 4DNRB 1HPCA 1L0YB 2IX1A 3VR2A 2OF1A 4RCNA 1O80A 2ENBA 2KCNA 1I4PA 1V43A 2R92B 1CM9A 3MVVA 2F0SA 2L12A 1JQYD 3TMEA 1Q1BA 3DUZA 3X3MA 1C8CA 3J80E 3D3RA 4RHSA 1G291 4ZKBB 3SK5A 1E2WA 1YNND 2O5JC 3PUVA 3HOXB 1PDQA 3OIQA 4DXGA 3VYRA 3S17B 3VR5A 1HUMA 2Q8TA 3NK9A 3RZDB 1EY7A 1J9OA 1KLGD 4C3IG 3IFDA 3Q24A 2BOSA 3W2DA 1EYAA 3MHBA 2D62A 3EJIA 1PYWD 3ND8A 5COYA 3HG9A 1BCPC 5TSSA 1KDAA 1D1IA 1JC7A 4K5XA 2XN9C 5C6AA 2PCFB 3A8JE 4HN7A 4ZYSA 4R8IA 4QCLA 3H3VC 1TY0A 1SMYC 2F0WA 5C3EB 3S1MB 3DEPA 4C56C 1Q90A 1ZKOA 2FMCA 4C1NK 3C1EA 3K5LA 1S5CD 2FFKB 4BA1I 3SHLA 5C0XI 3GTJB 3R93A 2B2UC 3CQZB 1UAPA 2K01A 1BUVT 4IUPA 2G9HD 4C3JG 2IWHA 1LTAD 2AUJD 4M8AA 3NHHA 3M85A 1ONLA 4KHZA 4G7ZC 2RBMA 2L0CA 2VXWA 1CI3M 4JK1C 4B9XA 1V1PA 3R3OA 4FO2A 4HEDA 3I4NB 1K8OA 1DM0B 2EYFA 4IN3A 1Q8IA 2MP1A 2LY7A 5I9OA 2N55A 5C0XH 4NW2A 2IPKD 2BA1A 3P1HA 1HXYD 3C46A 5C4HA 4DFAA 2Z8LA 1PZID 1BR9A 3BS1A 1QE6A 5JJZA 2R6GA 3DWAA 4HCEA 4K14A 5I6WA 1ENAA 3JAML 4IALA 4NMZA 1BF4A 1W6JA 5LL6S 4KN7C 1H9SA 2CVRA 2JSOA 4KJNA 4Q0FA 4NDXA 1EZ8A 1S5FD 1MSHA 3NUCA 1OXUA 2JE6I 1S4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H6M A;  2SNM A;  3C1E A;  2RKS A;  5IGD A;  1SNQ A;  2WAC A;  2EXZ A;  3MEH A;  4PMC A;  3SHL A;  3SK4 A;  4K5V A;  5CV5 A;  3TP5 A;  4K8I A;  5E1F A;  3OSO A;  1SNO A;  5CV4 A;  5E3F A;  4KD3 A;  2F0U A;  3QOL A;  5DAU A;  2OEO A;  5JOB A;  3DMU A;  3ERO A;  2SNS A;  3NXW A;  5IOD A;  1JOQ A;  4DU9 A;  3P75 A;  5KGU A;  2EYJ A;  2M00 A;  1NSN S;  1SNP A;  1AEX A;  3D4W A;  3S9W A;  3QOJ A;  1KAA A;  1SYG A;  1U9R A;  2PQE A;  3D4D A;  4NKL A;  3HZX A;  4ZUI A;  1EQV A;  2F0M A;  3NHH A;  4HMJ A;  1SYD A;  4TRD A;  5CV9 A;  3SK6 A;  5C4Z A;  5HGT A;  1JOR A;  2HQE A;  4ZUJ A;  2F0V A;  2NUC A;  5IIF A;  4EQN A;  1STA A;  1EY4 A;  1RKN A;  4ODG A;  5IGF A;  5NUC A;  2EY2 A;  3BDL A;  2OF1 A;  4HMI A;  3QB3 A;  5KYL A;  1EYD A;  2EY6 A;  1A2T A;  2F0D A;  2KQ3 A;  2F0J A;  4S3S A;  1SND A;  2ENB A;  5IGG A;  3RUZ A;  4N9T A;  2EYM A;  4DF7 A;  2F0K A;  3LX0 A;  5KRU A;  1KAB A;  2RBM A;  5C5L A;  2F0E A;  2O4X A;  1STN A;  2F0H A;  3ITP A;  4KV6 A;  3TP8 A;  5CGK A;  5HUR A;  3MXP A;  4K2L A;  3MVV A;  5J1Z A;  5I9P A;  3BDC A;  5K5P A;  2F0S A;  5JAV A;  3ERQ A;  4B9X A;  3R3O A;  2EYH A;  4J6H A;  5CV8 A;  3TME A;  1TT2 A;  1SYF A;  2F3V A;  1EY9 A;  2PYK A;  4K6D A;  3VA5 A;  1STY A;  5KEE A;  4I65 A;  2LKV A;  4YIJ A;  2F0T A;  1IHZ A;  2EYF A;  4K8J A;  5CV7 A;  4B9W A;  1II3 A;  1A3V A;  1SNC A;  5ISR A;  5I6Y A;  3SR1 A;  3SK5 A;  1STB A;  4KY7 A;  3V2T A;  3DHQ A;  4E6I A;  5I9O A;  1KDB A;  2QDB A;  5EKL A;  2PZT A;  4KHV A;  5KIX A;  1EYC A;  5CR3 A;  3NP8 A;  3P1H A;  3HEJ A;  4HTH A;  5F2D A;  1EY0 A;  2KHS A;  5J22 A;  5CC4 A;  2F3W A;  1ENC A;  4K5W A;  1EY6 A;  5C4H A;  4DFA A;  4KD4 A;  3OMG A;  5M9O A;  1EY8 A;  3D8G A;  3TP7 A;  1TR5 A;  1STG A;  4LAA A;  4R8N A;  4EQO A;  4KY6 A;  3NQT A;  1JOK A;  4PMB A;  1F2Y A;  4F7X A;  1KDC A;  3MZ5 A;  1SYE A;  4J1M A;  3NK9 A;  5J39 A;  4QMG A;  1EY7 A;  3T16 A;  4ID6 A;  4K2K A;  4KJO A;  1A2U A;  1F2M A;  4K14 A;  4RKL A;  4RKB A;  3C1F A;  5I6W A;  2F0L A;  2F0I A;  1ENA A;  2F0N A;  3EVQ A;  3T13 A;  5IGB A;  1SYB A;  2F0Q A;  1EYA A;  2SOB A;  4IAL A;  4ME5 A;  1F2Z A;  5EGT A;  2PZU A;  4NMZ A;  3MHB A;  1SYC A;  3OWF A;  3EJI A;  2EYP A;  5C3X A;  1A3T A;  3U9O A;  4QF4 A;  4OL7 A;  2F0F A;  1EY5 A;  4IZ8 A;  5DEH A;  3PMF A;  4EQP A;  1JOO A;  2F0G A;  5IGC A;  1KDA A;  4N9P A;  5EKK A;  2EY5 A;  5IGE A;  3E5S A;  4KJN A;  4KTA A;  4NDX A;  4K5X A;  3SXH A;  1EZ8 A;  5C6A A;  1NUC A;  2F0P A;  1EZ6 A;  4IUN A;  3SK8 A;  3TP6 A;  3NUC A;  2PW7 A;  5C3W A;  2F0W A;  5KYI A;  4EVO A;  4F8M A;  1STH A;  4H7B A;  4PNY A;  2EYL A;  4WRD A;  4DGZ A;  2EYO A;  2F0O A;  4KY5 A;  1A3U A;  1SNM A;  4QB4 A;  2OXP A;  3OMC A;  5CV6 A;  4G57 A;  5C5M A;  2EY1 A;  2PW5 A;  3D6C A;  5IOC A;  4MIU A;  2RDF A;  4WOR A;  4ZQ3 A;  1TQO A;  2PZW A;  4NP5 A; 
#chains in the Genus database with same CATH topology
 2ICE C;  2UUC Q;  3BYT B;  1STE A;  1YHA A;  4O0A A;  3TEH B;  1XMO Q;  3SK4 A;  4K5V A;  2A19 A;  4UPA A;  4A3D B;  1H9R A;  2VY3 A;  2R3Z A;  1VDZ A;  2NWG A;  1WTW A;  5LMN W;  1XTD A;  1E24 A;  4JI7 Q;  3GDE A;  4LF8 Q;  1UUP A;  2KBN A;  4CHT B;  3BVZ A;  2F0M A;  2RHS B;  4RWS C;  5CV9 A;  5ELB A;  4DK1 A;  1Y1W H;  2NUC A;  2OQ0 A;  3K7U C;  1CKN B;  2F0D A;  5IGG A;  2HD3 A;  3OPO A;  4NPS A;  3VR3 A;  1KAB A;  4DV2 Q;  1G6P A;  1JJC B;  2VQF Q;  5I9P A;  2R7Z B;  1B70 B;  4LNQ A;  1O78 A;  1RJT A;  1TT2 A;  2ZM6 L;  1SYF A;  2KEE A;  1VQG A;  4R4Q A;  1IHZ A;  2AKW B;  1QZH A;  4CDE C;  4H13 C;  3JAM i;  3MTS A;  3HOV B;  3S17 H;  4Q5V A;  1XPU A;  3B6Y A;  4A75 A;  1SAP A;  2NN6 G;  1VQN A;  1Q3L A;  3IFT A;  4RMF A;  2WAQ G;  4H44 C;  3W1B A;  3AU7 A;  4QL5 A;  1SR3 A;  4JI4 Q;  3RLN A;  3TDQ A;  4EX5 A;  3OHX C;  1T5X D;  4HID A;  4X62 L;  3M4P A;  2F0Q A;  5IYB H;  4KHP Q;  3TQY A;  1X3Q A;  4LK1 C;  4I7A A;  5AFW A;  4QF4 A;  2JJQ A;  3MXU A;  1YVC A;  3CC2 A;  2HDM A;  3KDF B;  1D8L A;  1N33 Q;  3K0X A;  2G5D A;  5H1S E;  4YCV A;  1TS4 A;  4P71 A;  1T5E A;  3RN5 A;  2DNC A;  3PIP 3;  4QB4 A;  2LMC B;  1VQL A;  5CV6 A;  1BNZ A;  3VA7 A;  5IOD A;  4A3C G;  2R7F A;  4C3H B;  4DV4 L;  1X32 A;  4LWC A;  5CV5 A;  4KKT A;  4P74 A;  3A8K E;  4XIG S;  1L2F A;  1MSG A;  2F1M A;  5K36 H;  1E2V A;  4IFD J;  3I4M B;  2BH8 A;  3URY A;  4OWT B;  1H9M A;  4JW0 A;  3ER0 A;  2I46 A;  3TRE A;  2E76 C;  4DV0 Q;  5E7N A;  4DNI A;  1EIF A;  3PO2 H;  1IBL L;  2YTY A;  2EPB A;  2E2J B;  4DR1 L;  5KYL A;  2WFW A;  4XTC S;  4BXX G;  2XVS A;  1A2T A;  5EPJ A;  1U4L A;  4GNX A;  1BCP F;  1IYJ B;  4DF7 A;  4JG2 A;  3KBG A;  4WJ3 M;  2MO1 A;  2JN4 A;  4IQZ A;  4A3I B;  1ET6 A;  2JA5 B;  4Z9C B;  2EVB A;  5J1Z A;  1LTL A;  1O7L A;  4EGV A;  1QIL A;  4QIW E;  3LGJ A;  4PZ6 A;  5C44 H;  1WD1 A;  1AE2 A;  1N8R C;  1ILP A;  4ABN A;  1HNX L;  3T1H L;  2UUA L;  3PO3 G;  1A3V A;  2VUM B;  1WVL A;  3PCO B;  1ENF A;  3QWN A;  4OO1 G;  2K5D A;  3Q8D A;  3HOU H;  1XX8 A;  1EYC A;  3KLR A;  3CCR A;  2JXM B;  3HOZ G;  5EBC A;  4RAU C;  4IPG A;  3AMU A;  3D31 A;  4TSS A;  1EEF D;  2B3G A;  2UXD L;  2AWN A;  4GLV B;  1JWM D;  3PUZ A;  1HNZ L;  2MPM A;  1SYE A;  3T16 A;  3G6E A;  4ID6 A;  1TU2 B;  1BBU A;  3T13 A;  5FO7 B;  2PZU A;  2JA8 G;  3I73 A;  5C3X A;  3BG3 A;  5CBA E;  4A3J B;  1NY4 A;  1NJI C;  4U68 A;  5IGC A;  4HJA A;  5EKK A;  5E4X A;  1PFS A;  1DCZ A;  4A3M B;  2ZJQ A;  1QNK A;  1I6V C;  3ERS X;  1HZA A;  1LLR D;  1YIT A;  5G3L F;  5C3W A;  3E9H A;  1DOM A;  1GD7 A;  1NE3 A;  4B3T Q;  5FLX E;  5D65 A;  5JPM C;  4A3D H;  5M3F B;  4YHH L;  3D6C A;  4CKE A;  1S5B D;  1B53 A;  2PZW A;  4RCO A;  2WAC A;  3G7L A;  4KK7 A;  3G48 A;  2KCT A;  2UU9 L;  4PV1 C;  5GQO A;  5HGQ A;  4IJL A;  4DR7 L;  5KNB A;  1FYC A;  1PTO D;  2E2I B;  1BDO A;  4X3T A;  4A3K G;  4IFD G;  1LTB D;  4X64 L;  3D4D A;  5JEA G;  4XQJ A;  1UE7 A;  1YJW A;  3J80 i;  4B3M L;  4LFA L;  3CF5 A;  3UDG A;  2A5H A;  1WTO A;  3GD7 A;  1RCV D;  1EYD A;  2LSS A;  1PRT D;  2K5H A;  1B1Z A;  2DUD A;  5COR A;  5LHY 1;  5FJ8 G;  3S1R B;  1IBK Q;  2HHH L;  4XQN A;  1WTQ A;  3UDX A;  4L6T B;  5ELO A;  1BCP B;  5EPK A;  3MXP A;  3GTG B;  1VQE A;  1WCM B;  4CKB A;  4MN3 A;  1D2B A;  2Q2H A;  4UP9 A;  1XNR L;  5EPL A;  2B2V A;  1QWY A;  4K6D A;  1DYQ A;  4JBJ A;  2K5W A;  1C0A A;  3G71 A;  3FVQ A;  4JI6 L;  1XTC D;  4CDC C;  1PH9 A;  1CZW A;  1I50 B;  4DV5 L;  2A73 B;  4PZ7 A;  1MIU A;  2QKI C;  3A5U A;  2XTI A;  1Z47 A;  1G8Z D;  2AWO A;  3E0E A;  1R4Q B;  1K83 B;  3I8Z A;  4KD4 A;  3I55 A;  3IAY A;  4C1N I;  2GA4 B;  4GN5 A;  3MA2 B;  1FNW A;  3KLW A;  1KTK A;  3E0J A;  3J81 L;  4QIW B;  4F7X A;  3D6W A;  1A6X A;  1NTG A;  5J39 A;  3QR8 A;  4OWW B;  4RKL A;  4LUV A;  5FK9 C;  1ZEQ X;  2NZO A;  1BOS A;  2RCN A;  1Q86 C;  4QQB X;  3UDF A;  2WIN B;  1VMP A;  2DNE A;  1TWH B;  3BYY B;  3MFG A;  4DAM A;  1EY5 A;  1JWU D;  2C5C A;  2HCI A;  1B9N A;  3CPW A;  1IYV A;  4ULL A;  1E7Z A;  3M7G A;  1G2S A;  5C4X B;  3AEV A;  1NUC A;  1SFO H;  1V9P A;  5A2Q L;  1STH A;  2N3S A;  2SDF A;  2V4D A;  4WRD A;  3OW2 A;  2EQS A;  2EYO A;  4DGZ A;  4C3H H;  3R2T A;  1PH7 A;  2OXP A;  2M9V A;  1UEB A;  2R7D A;  5LMN L;  4AQY L;  2NVQ H;  4GKK L;  3CKI B;  2SNM A;  1SNQ A;  4DR2 Q;  3DLL A;  4DV1 L;  3ZJY C;  5CV4 A;  5JOB A;  3S1Q B;  1HR0 Q;  1HTL D;  3S15 B;  2RVL A;  3N52 A;  2WKD A;  3SVM A;  2K32 A;  4HIK A;  3GTK H;  3S16 B;  1QZG A;  1X65 A;  2I07 B;  3HKS A;  3ZYY X;  4LF6 L;  2A6H D;  4ILW A;  2ALY B;  2AQ1 B;  4DR7 Q;  1BKB A;  2EY6 A;  1FD7 D;  3FKI H;  1SBB B;  3CPF A;  4XYO A;  3NBI A;  4PQX A;  4X64 Q;  1VQ7 A;  4CGY B;  2SEB D;  1WTX A;  3TP8 A;  4A3F H;  2GVA A;  3NSW A;  4DAP A;  1I5F A;  2XGT A;  3BDC A;  3H0G H;  3LNN A;  3BZK A;  4LFC L;  1TS3 A;  1CSP A;  4DR3 L;  2C9O A;  3U4Z A;  2R92 G;  3I2Z A;  4I65 A;  4OX9 L;  3M3Y H;  2TMP A;  1II3 A;  2D5D A;  1H95 A;  1SLJ A;  3S2D H;  4LFB L;  1SE4 A;  1AP0 A;  2D0O A;  4IUQ A;  1Z7T A;  2LXK A;  1JJ2 A;  4NXM L;  4HTH A;  4LF5 Q;  2KHS A;  3RLF A;  1Y1W B;  4UY8 C;  5IT9 L;  1ASZ A;  4PMW A;  1STG A;  1YNJ C;  4LAA A;  5CYU A;  4JI6 Q;  4KY6 A;  3PIO 3;  2OTJ A;  1CT1 D;  3HOX G;  4A3J H;  1FNV A;  5BN4 A;  4JVZ A;  1A2U A;  3CME A;  3CC7 A;  2NVT H;  2P5Z X;  1PH1 A;  4A3M H;  1XWE A;  2LXJ A;  3OWF A;  1CSQ A;  3M4O H;  3OYY A;  4AYB E;  2XSC A;  5ELF A;  4IZ8 A;  4WFN 3;  1JOO A;  4CDD C;  1ICF B;  2F4I A;  5DNF A;  2JA7 H;  3NEM A;  5M3F H;  3J7A V;  1LUZ A;  4LF7 Q;  4R4C A;  1M8A A;  4DUZ L;  3OMC A;  2PI2 A;  1RTN A;  4NB3 A;  3L9A X;  2L1B A;  5E1F A;  4RH6 A;  2A6E C;  4YCU A;  3K0Y A;  3HOY H;  5C3E G;  2DY7 A;  3STB D;  4UAI A;  1Q1E A;  1UNS A;  4A3B G;  1D1K A;  5E3F A;  3P7J A;  1FL0 A;  2VB2 X;  4DU9 A;  4ALP A;  1CK1 A;  3I72 A;  1SNP A;  4X66 L;  1AEX A;  3O13 A;  5LMN Q;  4AQY Q;  4NKL A;  4TRD A;  4GKJ Q;  2KEC A;  2Q2I A;  1VQD A;  1EY4 A;  1CZG A;  3RZO H;  1HZC A;  2EY2 A;  3TS0 A;  1A62 A;  1CUK A;  3FPP A;  2F0J A;  2VB3 X;  3PQI A;  5M5X H;  3LX0 A;  4UHV A;  3T51 B;  2LFN A;  1I6H H;  2HUG A;  4BWG B;  1NBW A;  3R2I A;  5BN5 A;  4BY7 G;  1I50 H;  1BBW A;  2CFM A;  3GTL B;  4IFD H;  1PZK D;  1HNW Q;  2EYH A;  3CD6 A;  4Y52 H;  2K1B A;  5CV8 A;  4ZKC B;  4X3S A;  1I94 L;  2F3V A;  3MAQ A;  3VA5 A;  5IWA Q;  4JI2 L;  2PMZ E;  2F0T A;  4GOP A;  2PNH A;  1SNC A;  1QVG A;  4YWK A;  3PSI A;  4YCW A;  4DR6 Q;  3FRP B;  3I4N G;  1P8L A;  5M3M G;  1TY2 A;  1IKL A;  1U4P A;  4LFC Q;  3PO2 B;  1SE8 A;  1YI2 A;  2CW0 C;  2F3W A;  4DR3 Q;  4Y7N H;  3L3O C;  2DY8 A;  3IRB A;  4GZY C;  1E1O A;  2EDG A;  1XJV A;  2IW3 A;  2K75 A;  2EZV A;  1V1P B;  3KF8 A;  2PPB C;  2NZH A;  1FVI A;  1V1Q A;  4DA2 A;  5I2Y A;  5IE8 A;  5IGB A;  1PVO A;  2HT1 A;  1SYB A;  5EGT A;  2FHT A;  1NMF A;  4A93 G;  4A3L H;  2YYZ A;  2EYP A;  5JJK A;  3L7Z C;  5C44 B;  2X69 A;  4EQP A;  4IOA A;  2MFI A;  4F87 A;  4N9P A;  3LWU A;  4X65 L;  4L63 B;  3CCU A;  1KQS A;  5IGE A;  4JI8 L;  1X9N A;  2PW7 A;  3EQL C;  1I4G A;  3HOU B;  4PNY A;  5BR8 L;  1A3U A;  4DAY A;  1VQ9 A;  4X3K A;  3UDI A;  1ROD A;  3HOW H;  2RSN A;  1XNQ Q;  3M4Q A;  2O5I C;  3ULL A;  4L5T A;  5EBD A;  5IGD A;  5FLM H;  4AYB B;  1P16 A;  3RN2 A;  3F2U A;  3V96 A;  1K0S A;  2E75 C;  3MXG A;  4K8I A;  3TZD A;  5DM7 3;  1NCV A;  1TWF H;  1H9S B;  3P75 A;  5KGU A;  1C7Y A;  1GVP A;  2BH2 A;  1TWC B;  1KXL A;  4JYA L;  1S72 A;  4LF9 Q;  5ELN A;  1SYG A;  3KJP A;  1IZ6 A;  1VQ5 A;  2A68 D;  2B63 G;  1FR3 A;  3SR1 A;  3QO2 A;  3SK6 A;  1QOH A;  4B3S Q;  1U0L A;  3DWP A;  1C9O A;  1RDP D;  2UXB L;  1Y14 B;  1KC8 C;  4BBS B;  2F4V L;  3J7A F;  1Z9F A;  5IYD G;  3KLS X;  3HS0 C;  4FP5 D;  2LS0 1;  2F0E A;  5CGK A;  4A3G H;  2IL8 A;  1CKM A;  1KLU D;  4QJF A;  4OIK A;  4HJ9 A;  2KJX A;  4OEL B;  3R8B A;  5FKA C;  1JWS D;  2A69 C;  4ZCK A;  2R7Z G;  2JQO A;  3FMC A;  3SDZ A;  1G51 A;  3CCJ A;  4JI1 L;  5JVH 3;  4G7O C;  3FEW X;  2YU9 B;  1WFQ A;  3CHB D;  4JV5 L;  2Z6B A;  3I91 A;  5CBE E;  2QEJ C;  1MD2 D;  1IBM L;  4JI2 Q;  1N36 L;  3HOV G;  5LMU Q;  2E2H H;  1EWC A;  3NWT A;  1VQM A;  1KDC A;  2ZXP A;  4JC0 A;  4KJO A;  2PMZ B;  3NTI A;  3WDN A;  2SOB A;  4FNF A;  4O2D A;  3GTQ B;  2B29 A;  2IX3 A;  1F9Q A;  1TKW B;  3A54 A;  3PMF A;  4MNO A;  3NEL A;  5JJI A;  1YIJ A;  1XPO A;  4B3R L;  4P75 A;  4CBV A;  3SK8 A;  2KUM A;  3AFQ A;  2FXQ A;  1VQC A;  3U9S A;  1WTR A;  4QUC A;  1EIY B;  2UUB L;  4F88 A;  1HHV A;  3NTK A;  3K80 C;  3SEB A;  2B8F A;  3OTO L;  1QG7 A;  4ZQ3 A;  1W3S A;  4IUU A;  3SE0 A;  3S24 A;  4K0K L;  4JI8 Q;  4DR4 Q;  1NR4 A;  1DJR D;  3KUP A;  3S9W A;  5FO8 B;  3J81 j;  3K57 A;  1FJG Q;  3NTH A;  1N34 L;  3C3L A;  3U4V A;  1TS5 A;  1BXT A;  4ZUJ A;  2B8G A;  2NBF A;  1IL8 A;  2B2Y A;  4C3I H;  1GUO A;  3BDL A;  3I4M G;  1HFG A;  4HAE A;  2K33 A;  1WTV A;  4GS3 A;  1B3Q A;  1SFO B;  1KNA A;  1ESF A;  1SND A;  4IO9 A;  2OWO A;  3GTL H;  2F0K A;  1CHP D;  5KRU A;  4A3B H;  2XIW A;  3RLO A;  5HUR A;  2NVQ B;  4K2L A;  3K5M A;  5K5P A;  1Y1V H;  4GLA C;  3GTP B;  4DR5 L;  2L5T A;  3U58 A;  4J6H A;  4IUT A;  5JEA J;  1KIX A;  1YJ9 A;  2K50 A;  1D7Q A;  1K8A C;  3OWE B;  4A3I G;  3CCL A;  1BVS A;  2JA5 G;  4KLK A;  4YIJ A;  3PUX A;  2RHQ B;  4LMQ D;  1A0I A;  2DJF C;  4XYQ A;  5IYC H;  4E6I A;  3GTK B;  4FDB A;  1BCP D;  2WV6 D;  1GUG A;  3RR5 A;  1Q82 C;  2XRQ D;  2F03 A;  1SEB D;  3HEJ A;  5GRO A;  4GNX B;  1VF7 A;  2HCC A;  2R93 G;  2B2W A;  2VUM G;  5D14 A;  3DM1 A;  1PH2 A;  1VS0 A;  1SMY D;  1RTO A;  1JMC A;  4BY7 H;  2QCP X;  3AFP A;  3KJO A;  2ID0 A;  2Z6K C;  3FKI B;  1F2Y A;  3W3A A;  3DEO A;  3MZ5 A;  4C3J H;  1U5K A;  1AH9 A;  3J80 L;  1QCB D;  4FVM A;  4BY1 H;  4A3F B;  3C1F A;  4C2M H;  3I4L A;  3H0G B;  3TSS A;  2NVX H;  2UXC L;  5DLQ E;  4DK0 A;  1YBY A;  1K8G A;  1XMQ L;  4O42 A;  1O7Z A;  1B8A A;  3TN2 A;  5M3M H;  3HP3 A;  4LW1 A;  3M3Y B;  3EIV A;  2Y0S E;  3G4S A;  1OXS C;  2ZM6 Q;  3S2D B;  5IP7 G;  3CCE A;  2JA6 H;  4MTK A;  1GXD C;  1GKH A;  4EVO A;  5KND A;  2J4X A;  1PXU A;  2WII B;  1Q7Y C;  1GUT A;  3A55 A;  2QIL A;  1HQM C;  1JE5 A;  1GUW A;  3S2H H;  1TWC H;  3MXN A;  3MXN B;  3M9B A;  3OSO A;  4DUY L;  2F0U A;  2OEO A;  3HKZ E;  3DMU A;  3T1Y L;  2NVT B;  4A3E G;  2HIV A;  2AUK A;  4POF A;  3PO3 B;  2NB0 A;  2M00 A;  4YWL A;  3M4O B;  4BBS H;  3OTO Q;  4X62 Q;  2L15 A;  3JAM c;  3OIP A;  3HOZ B;  5IGF A;  2JA7 B;  3NBH A;  4DV3 L;  3QB3 A;  1F9P A;  1IL2 A;  4BBR G;  4QUF A;  3BU2 A;  4N9T A;  2EYM A;  4JBM A;  4JI3 L;  4HIM A;  5C5L A;  4LJZ C;  5M5W H;  4DK3 C;  3KYH C;  1LO5 D;  3HOY B;  2JA8 B;  1I3Q H;  4HJ8 A;  2B63 H;  1DZ1 A;  2K03 A;  1KHI A;  4H0L C;  2YU9 H;  1LTI D;  2WB1 G;  4JI0 L;  1S5D D;  4K8J A;  4B9W A;  4DV4 Q;  5ISR A;  3JAM E;  1PZJ D;  3PIP A;  3DHQ A;  2JK8 A;  5L37 A;  4FF3 A;  4R4I A;  1ZYR C;  1YEZ A;  1ESR A;  1S40 A;  1CTM A;  2K52 A;  1VQF A;  3BVG A;  1QUQ A;  1PTO F;  1ENC A;  3RZO B;  1PFB A;  1TR5 A;  2B39 A;  4JPB W;  2CWP A;  4K6L A;  1U4R A;  3GTQ H;  1IBL Q;  2NN6 I;  2VL6 A;  5M5X B;  3CCQ A;  4DR1 Q;  1S3O A;  1Y8P B;  1AFP A;  1XYI A;  4K2K A;  1I6H B;  1F9S A;  1SE3 A;  3EVQ A;  2F0N A;  4AH6 A;  4ME5 A;  1HJP A;  1ML0 D;  3A7L A;  1XXG A;  1A3T A;  3U9O A;  4IUR A;  1YHB A;  2N8N A;  5DEH A;  4OON A;  1G91 A;  1HFN A;  1WI5 A;  2F0G A;  2JEA I;  3J7Y W;  2EJM A;  4KTA A;  2VNU D;  1MGS A;  2Z4I A;  4IUN A;  1Q12 A;  3G6J B;  1HNX Q;  4TKO B;  5BN3 A;  3T1H Q;  2UUA Q;  4POG A;  4H7B A;  1LTS D;  1N9W A;  2EYL A;  2UXC Q;  3GTO H;  5ELD A;  3KF6 A;  2Q8I B;  3H91 A;  2FJ2 A;  4Y7N B;  2XWB B;  3QIA A;  2RF4 A;  1KRT A;  5C4X G;  1OXT A;  1V8Q A;  4R4O A;  2PI2 E;  5C0X G;  3F2D A;  2VQE L;  2L4N A;  1VQ6 A;  4KKS A;  3MEH A;  1MI2 A;  3OOC A;  1D5X C;  2UXD Q;  2RSO A;  1HNZ Q;  5KNC A;  1EOT A;  2Y0S B;  3K5O A;  3CMA A;  3FHW A;  3IKJ A;  4OGQ C;  1CQV A;  2NN6 H;  1PFN A;  3QOJ A;  1T9H A;  1H9J A;  3HZX A;  1EFI D;  3H09 A;  1JOR A;  5ELC A;  1EWH A;  3LWE A;  5IY0 A;  3VR4 A;  2Q2T A;  5GAE C;  4EQ5 A;  1SXT A;  3T1Y Q;  3GTP H;  2RDH A;  1EU4 A;  4GNX C;  3ONA B;  1X3F A;  2RA4 A;  1STN A;  2B2W C;  3HOW B;  1GO3 E;  1PFM A;  4APV A;  3HKZ B;  2YTX A;  2QA4 A;  4P2C B;  2M2L A;  3X3N A;  4FXD A;  4IUV A;  3AB9 A;  4YHH Q;  2XNA C;  5D3D A;  1IW7 C;  1TWF B;  2EXD A;  2LKV A;  4UDU C;  1K0R A;  1KNE A;  4U67 3;  2UU9 Q;  4HSV A;  4A4I A;  5T1G A;  3WOE A;  3QG1 A;  4J8Q A;  1LTT D;  3PUY A;  4A3C H;  1K28 A;  5KIX A;  3BZD B;  3GO5 A;  5J22 A;  2A1A A;  5M9O A;  1N32 L;  1GM5 A;  2I5M X;  4V0B A;  4LFA Q;  3AYH B;  1LTR D;  1EEI D;  4B3M Q;  2IT1 A;  3NQT A;  1PTO B;  2QW7 A;  1Y1W G;  4QMG A;  4H02 A;  2J7Z A;  2ZT9 C;  4A3G B;  1JR0 D;  3GV6 A;  2HHH Q;  2MHV A;  1AW7 A;  2OCE A;  1R9T H;  1F2Z A;  1QVF A;  1TWA B;  1DXM A;  4BXX H;  4RFB A;  2NZ1 D;  1JB3 A;  1J6Q A;  2MUY A;  4IPD A;  1QNU A;  1XNR Q;  4RGT A;  1VQA A;  2R61 A;  4DNT B;  5GAH C;  5ELE A;  1E0B A;  1CA5 A;  3PF5 A;  1UE5 A;  5EKI A;  4DV5 Q;  4FF1 A;  2OTL A;  1J5E L;  1X3G A;  2QF7 A;  4XT1 B;  2PW5 A;  2WKC A;  3BVM A;  3S14 H;  3PO3 H;  2E2H B;  4L8J A;  2EJG C;  5I2X A;  4OO1 H;  4HIO A;  2CKZ B;  3I90 A;  2E5L L;  1AZP A;  2A8V A;  1SSO A;  3EA6 A;  2CQO A;  2Z1C A;  3NXW A;  1JOQ A;  3HOZ H;  2H1E A;  1J8I A;  2JP1 A;  3A56 A;  1HQR D;  4NXN L;  4UP7 A;  4IFD I;  4ZUI A;  1TS2 A;  3UE0 A;  4P72 A;  2BCO A;  1OO9 B;  4EQN A;  5IYB G;  1RKN A;  1EU3 A;  4DV6 L;  2OQK A;  2K05 A;  2KED A;  4DK6 C;  3K8A A;  3CXC A;  1M1K C;  3NQI A;  5AJ3 L;  2JA8 H;  1PLF A;  1WYD A;  2VZA A;  4ZAI A;  1QB5 D;  4TVA B;  1DOK A;  4DN4 M;  1UEA B;  3N6R A;  3T56 B;  4A3E H;  4GKK Q;  2B2V C;  1EY9 A;  4WJW A;  2ZJP A;  1STY A;  4JOI A;  5E4W C;  4DV1 Q;  4CJ0 B;  4KY7 A;  2Z4H A;  3VR6 A;  5CR3 A;  4L5S A;  1EUJ A;  3CCV A;  5F2D A;  2GN5 A;  1YHQ A;  2UUC L;  3DXJ C;  4RGN A;  5K36 G;  4C3I B;  3I3C A;  2A74 C;  4R8N A;  2K04 A;  1NNX A;  2PQA A;  4A3K H;  4LF6 Q;  1GHK A;  1RD9 D;  2HDL A;  2PQA B;  2BE5 C;  3PO2 G;  2D9U A;  5JEA H;  4A3B B;  1F2M A;  4RKB A;  4JI7 L;  3H94 A;  4LF8 L;  2AQ3 B;  3EFX D;  1Y1V B;  1HA6 A;  4GOP B;  1VQK A;  2NTT A;  1K3B C;  5FJ8 H;  1B9M A;  2OT2 A;  4P73 A;  4R9W A;  4DV2 L;  2ZTE A;  4FYD A;  4OX9 Q;  5C44 G;  5KYI A;  2L11 A;  2VQF L;  1WTP A;  1SNM A;  4CJ1 B;  2ASB A;  4LFB Q;  5JJL A;  1PYB A;  3K81 C;  5C5M A;  3KF8 B;  4OHJ A;  4YWM A;  3VYT A;  4NXM Q;  1PH3 A;  1ZYR D;  3H6M A;  4BY7 B;  2PO4 A;  3HOU G;  1LTG D;  3CP0 A;  4C3J B;  3TS2 A;  3D4R A;  3TP5 A;  1ILQ A;  4O1N A;  1EOV A;  1FNU A;  3GQB A;  4KD3 A;  4OIJ A;  4BY1 B;  4C2M B;  1S5E D;  5T1I A;  4B08 A;  3J81 c;  2VS1 A;  1B4O A;  1HCZ A;  2NVX B;  1TWG H;  3CRK C;  2FIN B;  4AYB G;  4HJ5 A;  2WP8 J;  1E1T A;  1Y8O B;  3KLS A;  1I4H A;  4HMJ A;  5M3M B;  5FLX L;  1SYD A;  1BO0 A;  1B3A A;  1MHW C;  3T4A C;  4XT3 B;  2MJ8 A;  2Q2U A;  5EQ0 A;  4DAY B;  3PIO A;  4JI4 L;  2JA6 B;  2WAQ E;  4CKC A;  4S3S A;  3S1N B;  2CH4 W;  2AQ2 B;  1VCI A;  1Q8K A;  4KHP L;  1KAW A;  2H4O A;  4YY3 L;  4NXN Q;  1JJG A;  4XDX A;  3EBE A;  4KV6 A;  2KOL A;  1PH6 A;  1PTO C;  4AIM A;  4BA2 I;  4DUZ Q;  3U50 C;  4A93 B;  3S2H B;  4X3U A;  3J81 E;  1N33 L;  1VF5 C;  4A3D G;  3MFY A;  1GUS A;  5KEE A;  1LT3 D;  3IL8 A;  5CV7 A;  1KL9 A;  1NR2 A;  2DJG C;  4DV7 L;  1STB A;  3V2T A;  1LAB A;  3F2B A;  3K58 A;  2RQX A;  1F2L A;  5EKL A;  1PTO H;  4KHV A;  5HY6 A;  1PRT C;  1EY0 A;  4X66 Q;  5CC4 A;  4CJ2 C;  2VW9 A;  1AE3 A;  3OMG A;  3ULP A;  1EY8 A;  3H15 A;  4L5R C;  3FPU B;  1TWA H;  1JOK A;  2AMC B;  4I7Z C;  4PMB A;  4TQU S;  5A2Q E;  3NWS A;  2ZTD A;  1L0X B;  1I4R A;  3CU7 A;  5M5W B;  1LT6 D;  3RMH A;  1A63 A;  3BZC A;  1RHP A;  4DV0 L;  2KCM A;  3DM3 A;  1I3Q B;  1Y69 U;  5JVG 3;  2B63 B;  4OL7 A;  2BDN A;  3F8T A;  1B44 D;  4RA8 A;  1U4M A;  1I94 Q;  4HSP A;  3MWY W;  1LM0 A;  4OEM B;  2KHI A;  3TP6 A;  1EZ6 A;  2B2T A;  4L5Q A;  1IW7 D;  1NMG A;  1SJE D;  4ZLT F;  1K8M A;  2KEN A;  2F0O A;  4KY5 A;  2Q8R E;  3AQQ A;  1GOZ A;  1TXY A;  2E74 C;  1CKN A;  2R92 H;  5JPN C;  1SN8 A;  2RKS A;  1Z6H A;  5FOB B;  2I5L X;  4PMC A;  1X54 A;  2PNR C;  5IT9 c;  2EE1 A;  2QGQ A;  1Q81 C;  4LUO A;  1PH4 A;  1I4X A;  1YJN A;  1D6E C;  1B50 A;  4DPG A;  1L0W A;  1WD0 A;  3SGI A;  3QJY A;  2K14 A;  1BBX C;  5HGT A;  2X6L A;  3A7A B;  1GUN A;  4ZRZ A;  3HOX H;  4JOI C;  2EJF C;  5NUC A;  1VQO A;  1G2T A;  4FXG C;  3M4Y A;  1JIC A;  4X65 Q;  2X6G A;  1HRJ A;  4KI0 A;  5LL6 X;  2K5N A;  3CRL C;  3BDO A;  3GTO B;  3RZD H;  3ITP A;  3GTM B;  1YNJ D;  5IT9 E;  1OXV A;  3NE5 B;  5BR8 Q;  3PUW A;  4XQQ A;  4DXF A;  3ERQ A;  1E2Z A;  4C3H G;  2PYK A;  2RDG A;  3GP7 A;  2CQA A;  4YY3 Q;  1UWV A;  4LUZ A;  4GOP C;  5I6Y A;  4B3T L;  2A6H C;  3KK7 A;  1RIP A;  1K73 C;  1PV4 A;  4WJ4 A;  2WAQ B;  1KDB A;  3KDF A;  2E8G A;  5C3E H;  3NP8 A;  3S1M H;  4JYA Q;  2K5Q A;  4MTN A;  2CH4 A;  2JEB I;  4RHR A;  3TP7 A;  1FGB D;  2TSS A;  3Q6S A;  3T53 B;  1B2T A;  2KA7 A;  3V05 A;  2HQL A;  3TBI B;  1VQB A;  4J1M A;  2J0T D;  3VYU A;  3GTJ H;  2UXB Q;  2XRS D;  4DV7 Q;  5GAG C;  2D2C C;  2F4V Q;  3CQZ H;  2A6E D;  2F0L A;  1JE4 A;  3FKI G;  1O7Y A;  1V1O A;  3K7A B;  4RG1 A;  3L2P A;  3RNU A;  2F0F A;  4A3F G;  2CHB D;  2EY5 A;  2WB1 E;  3E5S A;  2EOT A;  3H0G G;  5I4D A;  1EQT A;  1IBK L;  1LT5 D;  4MZ9 A;  1SMX A;  1SRO A;  4OXP A;  4RGO S;  1D5M C;  1TII D;  4PG3 A;  1VQH A;  2MGS A;  4F8M A;  1PH5 A;  3HGB A;  1C48 A;  3K6O A;  1IKM A;  1E22 A;  4JI1 Q;  2D0P A;  5M5Y B;  4NP5 A;  4GLX A;  4M1U B;  3CCS A;  4JV5 Q;  2ZJR A;  1SDF A;  4KMU C;  2EXZ A;  2MQH A;  1SJH D;  3I4N H;  1UE1 A;  2CWA A;  1IBM Q;  2EIF A;  4IPC A;  1N36 Q;  2NTS A;  1YNN C;  2Z0S A;  3ERO A;  3NEN A;  1DON A;  1R9T B;  1GHJ A;  2EYJ A;  1CQF A;  2BE5 D;  1EIH A;  1W2B A;  3A8I E;  3GV3 A;  5EAY A;  1U9R A;  4A3J G;  3S1N H;  4V19 0;  2C35 B;  1EQV A;  5C4Z A;  5A35 A;  2K28 A;  2HQE A;  4N8X 1;  1BQQ T;  4IJH A;  3KOJ A;  5IIF A;  4A3M G;  2R93 B;  4ODG A;  2E2D C;  1LYL A;  2IJ0 A;  3Q23 A;  2NYZ D;  3NPP A;  5C0X J;  2KQ3 A;  2ZXO A;  2BA0 A;  4A93 H;  3RUZ A;  1CKO A;  4B3R Q;  2CW0 D;  1CFM A;  3STB C;  2O4X A;  2JA7 G;  2N49 A;  3E3X A;  5M3F G;  4MHE A;  3S14 B;  5FLX c;  2K6A A;  2UUB Q;  2NVY B;  5G3L D;  1ZXT A;  1DOL A;  1B7Y B;  1JCK B;  1H9K A;  2KCC A;  4K0K Q;  1TVX A;  2BDO A;  5CMD A;  3HOY G;  3M7N A;  1DD2 A;  3A0J A;  1UE6 A;  3NBH B;  1EQQ A;  1AN8 A;  2PZT A;  2JA9 A;  2L55 A;  4K5W A;  3K59 A;  1EY6 A;  4DR2 L;  3D8G A;  2L9H A;  1LAC A;  1N34 Q;  3E6Z X;  3TZU A;  4JI5 L;  3WWV A;  2B2T C;  1VQ4 A;  3DWQ A;  1HR0 L;  1WJJ A;  4XXE A;  3CW2 C;  1A15 A;  1PA6 A;  2DN8 A;  1F77 A;  2F0I A;  4A3E B;  1WCM G;  2H5X A;  3KFU A;  2ZTC A;  3Q22 A;  1W6K A;  2K4K A;  1FGU A;  5IYD H;  2IHF A;  4DR5 Q;  1X3P A;  1ET9 A;  1M4V A;  1K9M C;  1EQR A;  1VQJ A;  3SXH A;  2MNA A;  1QUQ B;  2F0P A;  5IP9 G;  1IYU A;  4BBR B;  5GAD C;  1XPR A;  3F1Z A;  1K3R A;  3OW7 A;  2G9D A;  3I70 A;  3ND9 A;  4KN4 C;  1IXR A;  2EY1 A;  5IOC A;  4JBW A;  4MIU A;  2IX0 A;  4WOR A;  1TQO A;  2R7Z H;  4FXK C;  4A3K B;  3WOF A;  4QGU A;  1I4Q A;  2F3I A;  1PRT F;  2I0Q A;  2QDL A;  3HRZ C;  1SNO A;  3QOL A;  3J7Z C;  4A76 A;  1SE2 A;  3J7A 5;  2SNS A;  2WB1 B;  1OXX K;  4LF5 L;  1NSN S;  1Q46 A;  3D4W A;  3KBX A;  5C4J B;  2PQE A;  3RD4 A;  1MJE A;  3HOV H;  3I7F A;  1G6Z A;  2A69 D;  3VYS A;  4FF2 A;  2F0V A;  2Y0S G;  1STA A;  2JYO A;  1CHQ D;  1XMQ Q;  3GTM H;  2ZXR A;  3KF6 B;  4A3L G;  4HMI A;  2B2Y C;  4R4T A;  4ZK9 B;  3ULJ A;  4HR7 B;  5D3I B;  1F9R A;  2RCF A;  5DM6 3;  2N88 A;  4FF4 A;  2Z9H A;  2XWJ B;  1MKH A;  2B2U A;  2F0H A;  1EYG A;  4KKU A;  5JAV A;  1MBY A;  2IHE A;  2MO0 A;  1D5Z C;  2ICI A;  1L1O A;  3UI2 A;  3HOW G;  2A68 C;  1L1O B;  3HKZ G;  2KHJ A;  5FO9 B;  2DGY A;  4HCS A;  4DKA C;  4LF7 L;  1TWG B;  2FMM A;  3W5O A;  1EWI A;  3PV0 A;  5FLM G;  4DUY Q;  1KRS A;  1WTH A;  1ICW A;  1VMC A;  1R4P B;  2QDB A;  3K5N A;  3TRZ A;  1NAP A;  1JT8 A;  3Q0A A;  2K7V A;  3FDT A;  4RGM A;  4EQO A;  1QVC A;  3C2P A;  3UE1 A;  3K7A H;  4DV3 Q;  1VQP A;  1PHJ A;  4QY7 A;  5J3B A;  2HIX A;  1EFW A;  1PMR A;  4JI3 Q;  1EL0 A;  4GKJ L;  1SYC A;  3I4M H;  2KVM A;  1HA5 A;  1HZ9 A;  4JI5 Q;  4G4K A;  1EIG A;  3MC0 B;  2YV5 A;  4OO1 I;  4A3G G;  4DAV A;  1RF2 D;  3EN2 A;  5M5Y H;  1QJO A;  2E2J H;  1CA6 A;  1E3P A;  1X56 A;  4JI0 Q;  1Y8N B;  3HFZ B;  1LV9 A;  1RL2 A;  1X55 A;  3A74 A;  1HNW L;  1GJX A;  4G57 A;  1HUN A;  2O2L D;  4A3I H;  2RDF A;  2JA5 H;  4BS9 A;  1C4Q A;  3P20 A;  5IWA L;  5EJW A;  1X3E A;  1DGS A;  1SRU A;  1A8V A;  2GVB A;  4G7H C;  1HH2 P;  4DR6 L;  5DAU A;  1PRT B;  1HTP A;  2R93 H;  1AZQ A;  1M90 C;  2VUM H;  1LT4 D;  3CCM A;  3J81 i;  2K5V A;  3MEF A;  1KAA A;  3J80 c;  4DNR B;  3D0F A;  1HPC A;  1L0Y B;  4HJ7 A;  2IX1 A;  3VR2 A;  2OF1 A;  4RCN A;  4OWX B;  1O80 A;  2CCZ A;  1HZB A;  2ENB A;  2KCN A;  2NVY H;  1I4P A;  1V43 A;  2R92 B;  1CM9 A;  3MVV A;  4PZ8 A;  2F0S A;  2L12 A;  1JQY D;  3TME A;  5IP7 H;  1KD1 C;  1Q1B A;  3DUZ A;  3FP9 A;  3X3M A;  2VQE Q;  1C8C A;  3J80 E;  3D3R A;  4CDF C;  4RHS A;  4N8F A;  4GN3 B;  1MJC A;  4X6A H;  1G29 1;  4ZKB B;  3SK5 A;  1E2W A;  1YNN D;  2O5J C;  3JC6 6;  3PUV A;  1VQ8 A;  1XNQ L;  3HOX B;  1PDQ A;  3OIQ A;  3H3V I;  4DXG A;  1WOC A;  3L0O A;  3PGZ A;  3PF4 A;  4LF4 L;  3VYR A;  3S17 B;  1HUM A;  2Q8T A;  3VR5 A;  3NK9 A;  3RZD B;  1EY7 A;  1J9O A;  1KLG D;  3CC4 A;  4C3I G;  4LF9 L;  3IFD A;  3Q24 A;  2E2I H;  2BOS A;  3W2D A;  1EYA A;  4JBK A;  3MHB A;  2D62 A;  4B3S L;  3EJI A;  1PYW D;  1YZ6 A;  4BBR H;  3ND8 A;  4ME3 A;  3HG9 A;  5COY A;  1VQI A;  1BCP C;  5TSS A;  1KDA A;  1ASY A;  1D1I A;  4J15 A;  1Y1V G;  1JC7 A;  4K5X A;  2XN9 C;  3F2C A;  1YNX A;  5C6A A;  1XMO L;  2PCF B;  3A8J E;  4HN7 A;  4ZYS A;  4R8I A;  4QCL A;  4GN4 B;  4R1J A;  3H3V C;  1TY0 A;  1SMY C;  2F0W A;  5C3E B;  3S1R H;  3I56 A;  3S1M B;  1OTC A;  3DEP A;  5IYC G;  3GTG H;  4C56 C;  1WCM H;  1Q90 A;  1ZKO A;  2FMC A;  4C1N K;  3C1E A;  3K5L A;  1S5C D;  2FFK B;  1N32 Q;  4BA1 I;  3SHL A;  5C0X I;  4UP8 A;  1O7I A;  3GTJ B;  5C4J H;  3H3V H;  3R93 A;  2B2U C;  3CQZ B;  1HR0 W;  1UAP A;  2K01 A;  1BUV T;  4IUP A;  2G9H D;  5IP9 H;  4C3J G;  1X6O A;  2IWH A;  3A5Z B;  1LTA D;  2AUJ D;  1L1O C;  4M8A A;  1PYS B;  3NHH A;  4BY1 G;  2V1C C;  2ATW A;  4IPH A;  5LMU L;  1K83 H;  2ES2 A;  3M85 A;  1ONL A;  4KHZ A;  1JB7 A;  4G7Z C;  2RBM A;  2AHO B;  4JCV E;  3ICE A;  2L0C A;  2VXW A;  4IOC A;  1CI3 M;  2JA6 G;  4JK1 C;  4B9X A;  1J5E Q;  1V1P A;  3R3O A;  4FO2 A;  1PH8 A;  1TWH H;  4HED A;  3I4N B;  3CAM A;  2I5H A;  3BJU A;  1K8O A;  1DM0 B;  2EYF A;  4IN3 A;  1Q8I A;  2MP1 A;  5C4X H;  2LY7 A;  5I9O A;  2N55 A;  5C0X H;  2E5L Q;  2QEX A;  4NW2 A;  2IPK D;  2BA1 A;  3P1H A;  2IY5 B;  1HXY D;  3C46 A;  5C4H A;  4DFA A;  2Z8L A;  1PZI D;  1BR9 A;  3BS1 A;  4BBS G;  2Z6K A;  4DR4 L;  1QE6 A;  5JJZ A;  2R6G A;  3W1G A;  4DV6 Q;  3DWA A;  4HCE A;  4K14 A;  5I6W A;  5AJ3 Q;  3S1Q H;  1ENA A;  3VDY A;  2YTV A;  1FJG L;  3JAM L;  4IAL A;  3S15 H;  4NMZ A;  1BF4 A;  3S16 H;  4LF4 Q;  1W6J A;  5LL6 S;  4KN7 C;  1H9S A;  2CVR A;  2JSO A;  4KJN A;  4Q0F A;  4NDX A;  1EZ8 A;  2F52 A;  1S5F D;  1MSH A;  3NUC A;  3E9I A;  1OXU A;  3I4O A;  2JE6 I;  1S4Z A;  2N78 A; 
#chains in the Genus database with same CATH homology
 2ICE C;  3BYT B;  1STE A;  3SK4 A;  4K5V A;  4A3D B;  1H9R A;  2R3Z A;  1VDZ A;  2NWG A;  1WTW A;  1UUP A;  4CHT B;  3BVZ A;  2F0M A;  4RWS C;  5CV9 A;  5ELB A;  4DK1 A;  2NUC A;  2F0D A;  5IGG A;  3OPO A;  3VR3 A;  1KAB A;  5I9P A;  2R7Z B;  1O78 A;  1RJT A;  1TT2 A;  1SYF A;  2KEE A;  1IHZ A;  4H13 C;  3MTS A;  3HOV B;  4Q5V A;  1SAP A;  2NN6 G;  1Q3L A;  3IFT A;  4H44 C;  3AU7 A;  3TDQ A;  3OHX C;  1T5X D;  2F0Q A;  1X3Q A;  4LK1 C;  5AFW A;  4QF4 A;  3MXU A;  2HDM A;  1TS4 A;  1T5E A;  2DNC A;  3PIP 3;  4QB4 A;  2LMC B;  5CV6 A;  1BNZ A;  3VA7 A;  5IOD A;  4C3H B;  1X32 A;  5CV5 A;  4KKT A;  3A8K E;  4XIG S;  1MSG A;  2F1M A;  5K36 H;  1E2V A;  4IFD J;  3I4M B;  3URY A;  1H9M A;  2I46 A;  2E76 C;  2EPB A;  2E2J B;  5KYL A;  4XTC S;  2XVS A;  1A2T A;  5EPJ A;  1U4L A;  1BCP F;  4DF7 A;  3KBG A;  4IQZ A;  4A3I B;  1ET6 A;  2JA5 B;  4Z9C B;  2EVB A;  5J1Z A;  1O7L A;  4EGV A;  1QIL A;  1WD1 A;  1ILP A;  4ABN A;  2VUM B;  1A3V A;  1WVL A;  1ENF A;  3QWN A;  4OO1 G;  2K5D A;  1XX8 A;  1EYC A;  3KLR A;  2JXM B;  5EBC A;  4RAU C;  3AMU A;  3D31 A;  4TSS A;  1EEF D;  2AWN A;  1JWM D;  3PUZ A;  2MPM A;  1SYE A;  3T16 A;  4ID6 A;  1TU2 B;  3T13 A;  5FO7 B;  2PZU A;  3I73 A;  5C3X A;  3BG3 A;  5CBA E;  4A3J B;  4U68 A;  5IGC A;  5EKK A;  5E4X A;  1DCZ A;  4A3M B;  1QNK A;  1I6V C;  1LLR D;  5G3L F;  5C3W A;  1DOM A;  5FLX E;  5D65 A;  5JPM C;  5M3F B;  3D6C A;  4CKE A;  1S5B D;  1B53 A;  2PZW A;  4RCO A;  2WAC A;  3G7L A;  4KK7 A;  4PV1 C;  5KNB A;  1FYC A;  1PTO D;  2E2I B;  1BDO A;  4X3T A;  4IFD G;  1LTB D;  3D4D A;  5JEA G;  4XQJ A;  2A5H A;  1WTO A;  3GD7 A;  1RCV D;  1EYD A;  1PRT D;  1B1Z A;  5COR A;  3S1R B;  5LHY 1;  4XQN A;  1WTQ A;  4L6T B;  1BCP B;  5EPK A;  3MXP A;  3GTG B;  1WCM B;  4CKB A;  4MN3 A;  1D2B A;  5EPL A;  2B2V A;  1QWY A;  4K6D A;  1DYQ A;  2K5W A;  3FVQ A;  1XTC D;  1CZW A;  1I50 B;  2A73 B;  2QKI C;  1Z47 A;  1G8Z D;  2AWO A;  1R4Q B;  1K83 B;  3I8Z A;  4KD4 A;  3IAY A;  4C1N I;  2GA4 B;  3MA2 B;  1FNW A;  1KTK A;  3E0J A;  3J81 L;  4QIW B;  4F7X A;  3D6W A;  1A6X A;  5J39 A;  4RKL A;  5FK9 C;  1ZEQ X;  1BOS A;  2WIN B;  1VMP A;  2DNE A;  1TWH B;  3BYY B;  3MFG A;  1EY5 A;  1JWU D;  2C5C A;  2HCI A;  1B9N A;  1IYV A;  4ULL A;  3M7G A;  1G2S A;  5C4X B;  1NUC A;  5A2Q L;  1STH A;  2SDF A;  2V4D A;  4WRD A;  4DGZ A;  2EYO A;  3R2T A;  2OXP A;  2M9V A;  3CKI B;  2SNM A;  1SNQ A;  5CV4 A;  5JOB A;  3S1Q B;  1HTL D;  3S15 B;  2RVL A;  3N52 A;  2WKD A;  3SVM A;  2K32 A;  3S16 B;  2I07 B;  3ZYY X;  2A6H D;  4ILW A;  2AQ1 B;  2EY6 A;  1FD7 D;  1SBB B;  4XYO A;  3NBI A;  4PQX A;  4CGY B;  2SEB D;  1WTX A;  3TP8 A;  3NSW A;  4DAP A;  3BDC A;  3LNN A;  1TS3 A;  2C9O A;  4I65 A;  2TMP A;  1II3 A;  2D5D A;  1SE4 A;  1AP0 A;  4IUQ A;  1Z7T A;  4HTH A;  2KHS A;  3RLF A;  1Y1W B;  5IT9 L;  4PMW A;  1STG A;  1YNJ C;  4LAA A;  5CYU A;  4KY6 A;  3PIO 3;  1CT1 D;  1FNV A;  5BN4 A;  1A2U A;  1XWE A;  3OWF A;  2XSC A;  5ELF A;  4IZ8 A;  4WFN 3;  1JOO A;  2F4I A;  5DNF A;  3J7A V;  1M8A A;  3OMC A;  1RTN A;  3L9A X;  5E1F A;  2L1B A;  4RH6 A;  2A6E C;  3K0Y A;  2DY7 A;  4UAI A;  1Q1E A;  1UNS A;  1D1K A;  5E3F A;  3P7J A;  2VB2 X;  4DU9 A;  1CK1 A;  3I72 A;  1SNP A;  1AEX A;  3O13 A;  4NKL A;  4TRD A;  2KEC A;  1EY4 A;  1CZG A;  2EY2 A;  3FPP A;  2F0J A;  2VB3 X;  3LX0 A;  3T51 B;  2LFN A;  2HUG A;  4BWG B;  3R2I A;  5BN5 A;  4IFD H;  3GTL B;  1PZK D;  2EYH A;  2K1B A;  5CV8 A;  4ZKC B;  4X3S A;  2F3V A;  3MAQ A;  3VA5 A;  2F0T A;  1SNC A;  3FRP B;  1TY2 A;  1IKL A;  1U4P A;  3PO2 B;  2CW0 C;  2F3W A;  3L3O C;  2DY8 A;  4GZY C;  2EDG A;  2IW3 A;  2EZV A;  1V1P B;  3KF8 A;  2PPB C;  4DA2 A;  5I2Y A;  5IGB A;  1SYB A;  5EGT A;  2FHT A;  2YYZ A;  2EYP A;  3L7Z C;  5C44 B;  2X69 A;  4EQP A;  4F87 A;  4N9P A;  3LWU A;  4L63 B;  5IGE A;  2PW7 A;  3EQL C;  1I4G A;  3HOU B;  4PNY A;  1A3U A;  4DAY A;  4X3K A;  1ROD A;  2RSN A;  2O5I C;  5EBD A;  5IGD A;  4AYB B;  3F2U A;  3V96 A;  2E75 C;  3MXG A;  4K8I A;  3TZD A;  5DM7 3;  1NCV A;  1H9S B;  3P75 A;  5KGU A;  1TWC B;  1SYG A;  2A68 D;  1FR3 A;  3SR1 A;  3QO2 A;  3SK6 A;  1QOH A;  3DWP A;  1RDP D;  4BBS B;  3J7A F;  3KLS X;  3HS0 C;  4FP5 D;  2LS0 1;  2F0E A;  5CGK A;  2IL8 A;  1KLU D;  4OIK A;  2KJX A;  3R8B A;  5FKA C;  1JWS D;  2A69 C;  3FMC A;  3SDZ A;  5JVH 3;  4G7O C;  3FEW X;  2YU9 B;  3CHB D;  3I91 A;  5CBE E;  2QEJ C;  1MD2 D;  1EWC A;  3NWT A;  1KDC A;  2ZXP A;  4KJO A;  2PMZ B;  3NTI A;  3WDN A;  2SOB A;  4FNF A;  3GTQ B;  2IX3 A;  1F9Q A;  1TKW B;  3A54 A;  3PMF A;  4CBV A;  3SK8 A;  2KUM A;  3U9S A;  1WTR A;  4QUC A;  4F88 A;  1HHV A;  3NTK A;  3SEB A;  2B8F A;  1QG7 A;  4ZQ3 A;  4IUU A;  3SE0 A;  1NR4 A;  1DJR D;  3KUP A;  3S9W A;  5FO8 B;  3K57 A;  3NTH A;  3C3L A;  1TS5 A;  1BXT A;  4ZUJ A;  2B8G A;  2NBF A;  1IL8 A;  2B2Y A;  1GUO A;  3BDL A;  1HFG A;  4HAE A;  2K33 A;  1WTV A;  1SFO B;  1KNA A;  1ESF A;  1SND A;  2F0K A;  1CHP D;  5KRU A;  2XIW A;  5HUR A;  2NVQ B;  4K2L A;  3K5M A;  5K5P A;  3GTP B;  2L5T A;  4J6H A;  4IUT A;  5JEA J;  3OWE B;  4YIJ A;  3PUX A;  4LMQ D;  4XYQ A;  4E6I A;  3GTK B;  1BCP D;  2WV6 D;  1GUG A;  2XRQ D;  2F03 A;  1SEB D;  3HEJ A;  1VF7 A;  2HCC A;  2B2W A;  5D14 A;  3DM1 A;  1SMY D;  1RTO A;  2QCP X;  2ID0 A;  3FKI B;  1F2Y A;  3DEO A;  3W3A A;  3MZ5 A;  3J80 L;  1QCB D;  4FVM A;  4A3F B;  3C1F A;  3I4L A;  3H0G B;  3TSS A;  4DK0 A;  4O42 A;  1O7Z A;  3TN2 A;  3HP3 A;  3M3Y B;  1OXS C;  3S2D B;  1GXD C;  5KND A;  4EVO A;  2J4X A;  1PXU A;  2WII B;  1GUT A;  3A55 A;  2QIL A;  1HQM C;  1GUW A;  3MXN A;  3OSO A;  2F0U A;  2OEO A;  3DMU A;  2NVT B;  2AUK A;  3PO3 B;  2NB0 A;  2M00 A;  3M4O B;  3OIP A;  3HOZ B;  5IGF A;  2JA7 B;  3NBH A;  3QB3 A;  1F9P A;  4QUF A;  4N9T A;  2EYM A;  5C5L A;  4LJZ C;  1LO5 D;  3HOY B;  2JA8 B;  1DZ1 A;  2K03 A;  4H0L C;  1LTI D;  1S5D D;  4K8J A;  4B9W A;  5ISR A;  3JAM E;  1PZJ D;  3DHQ A;  4FF3 A;  1ZYR C;  1ESR A;  1CTM A;  3BVG A;  1PTO F;  1ENC A;  3RZO B;  1PFB A;  1TR5 A;  2B39 A;  4K6L A;  1U4R A;  2NN6 I;  5M5X B;  1Y8P B;  1AFP A;  1XYI A;  4K2K A;  1I6H B;  1F9S A;  1SE3 A;  3EVQ A;  2F0N A;  4ME5 A;  1ML0 D;  3A7L A;  1XXG A;  1A3T A;  3U9O A;  4IUR A;  5DEH A;  1G91 A;  1HFN A;  2F0G A;  2JEA I;  3J7Y W;  2EJM A;  4KTA A;  2VNU D;  1MGS A;  2Z4I A;  4IUN A;  1Q12 A;  3G6J B;  4TKO B;  5BN3 A;  4H7B A;  1LTS D;  2EYL A;  5ELD A;  2Q8I B;  3H91 A;  2FJ2 A;  4Y7N B;  2XWB B;  3QIA A;  1OXT A;  1V8Q A;  5C0X G;  2L4N A;  4KKS A;  3MEH A;  1MI2 A;  3OOC A;  1D5X C;  2RSO A;  5KNC A;  1EOT A;  2Y0S B;  3K5O A;  4OGQ C;  3IKJ A;  1CQV A;  2NN6 H;  1PFN A;  3QOJ A;  1H9J A;  3HZX A;  1EFI D;  3H09 A;  1JOR A;  5ELC A;  1EWH A;  3LWE A;  3VR4 A;  1SXT A;  2RDH A;  1EU4 A;  3ONA B;  2RA4 A;  1STN A;  2B2W C;  3HOW B;  1PFM A;  3HKZ B;  4P2C B;  2M2L A;  3X3N A;  4FXD A;  4IUV A;  3AB9 A;  2XNA C;  5D3D A;  1IW7 C;  1TWF B;  2LKV A;  4UDU C;  1KNE A;  4U67 3;  4HSV A;  5T1G A;  3WOE A;  3QG1 A;  4J8Q A;  1LTT D;  3PUY A;  5KIX A;  3BZD B;  3GO5 A;  5J22 A;  5M9O A;  4V0B A;  1LTR D;  1EEI D;  2IT1 A;  3NQT A;  1PTO B;  4QMG A;  2J7Z A;  2ZT9 C;  4A3G B;  1JR0 D;  3GV6 A;  2MHV A;  1AW7 A;  1F2Z A;  1TWA B;  1DXM A;  4RFB A;  2NZ1 D;  1JB3 A;  2MUY A;  1QNU A;  4RGT A;  2R61 A;  4DNT B;  5ELE A;  1E0B A;  1CA5 A;  5EKI A;  4FF1 A;  4XT1 B;  2QF7 A;  2PW5 A;  2WKC A;  3BVM A;  2E2H B;  4L8J A;  2EJG C;  5I2X A;  4OO1 H;  3I90 A;  1AZP A;  1JOQ A;  1SSO A;  3EA6 A;  2Z1C A;  3NXW A;  2H1E A;  1J8I A;  2JP1 A;  3A56 A;  1HQR D;  4IFD I;  4ZUI A;  1TS2 A;  2BCO A;  1OO9 B;  4EQN A;  1RKN A;  1EU3 A;  2K05 A;  2KED A;  3NQI A;  1PLF A;  4ZAI A;  1QB5 D;  1DOK A;  4DN4 M;  1UEA B;  3N6R A;  3T56 B;  2B2V C;  1EY9 A;  4WJW A;  1STY A;  5E4W C;  4CJ0 B;  4KY7 A;  2Z4H A;  3VR6 A;  5CR3 A;  5F2D A;  3DXJ C;  4RGN A;  5K36 G;  4C3I B;  3I3C A;  2A74 C;  4R8N A;  2K04 A;  1GHK A;  1RD9 D;  2HDL A;  2BE5 C;  2D9U A;  5JEA H;  4A3B B;  1F2M A;  4RKB A;  3H94 A;  2AQ3 B;  3EFX D;  1Y1V B;  1HA6 A;  2NTT A;  1B9M A;  2OT2 A;  4R9W A;  4FYD A;  5KYI A;  2L11 A;  1WTP A;  1SNM A;  4CJ1 B;  5C5M A;  4OHJ A;  3VYT A;  1ZYR D;  3H6M A;  4BY7 B;  2PO4 A;  1LTG D;  4C3J B;  3D4R A;  3TP5 A;  1ILQ A;  4O1N A;  4OIJ A;  1FNU A;  3GQB A;  4KD3 A;  4BY1 B;  4C2M B;  1S5E D;  5T1I A;  4B08 A;  1B4O A;  1HCZ A;  2NVX B;  3CRK C;  2FIN B;  2WP8 J;  1Y8O B;  3KLS A;  1I4H A;  4HMJ A;  5M3M B;  5FLX L;  1SYD A;  1BO0 A;  1B3A A;  3T4A C;  4XT3 B;  2MJ8 A;  5EQ0 A;  2JA6 B;  4CKC A;  4S3S A;  3S1N B;  2AQ2 B;  1VCI A;  2H4O A;  4XDX A;  4KV6 A;  2KOL A;  1PTO C;  4BA2 I;  4A93 B;  3S2H B;  4X3U A;  3J81 E;  1VF5 C;  3MFY A;  1GUS A;  5KEE A;  1LT3 D;  3IL8 A;  5CV7 A;  1NR2 A;  1STB A;  3V2T A;  1LAB A;  3K58 A;  2RQX A;  1F2L A;  5EKL A;  1PTO H;  4KHV A;  1PRT C;  1EY0 A;  5CC4 A;  4CJ2 C;  3OMG A;  1EY8 A;  3FPU B;  1JOK A;  4I7Z C;  4PMB A;  4TQU S;  5A2Q E;  3NWS A;  1L0X B;  1I4R A;  3CU7 A;  5M5W B;  1LT6 D;  3RMH A;  1RHP A;  1I3Q B;  1Y69 U;  5JVG 3;  2B63 B;  4OL7 A;  2BDN A;  1B44 D;  4RA8 A;  1U4M A;  4HSP A;  3MWY W;  3TP6 A;  1EZ6 A;  2B2T A;  4ZLT F;  1IW7 D;  1SJE D;  1K8M A;  2F0O A;  4KY5 A;  2Q8R E;  1GOZ A;  2E74 C;  5JPN C;  2RKS A;  1Z6H A;  5FOB B;  4PMC A;  2PNR C;  2EE1 A;  1I4X A;  1D6E C;  1B50 A;  1WD0 A;  3QJY A;  1BBX C;  5HGT A;  2X6L A;  3A7A B;  1GUN A;  4ZRZ A;  2EJF C;  5NUC A;  1G2T A;  4FXG C;  3M4Y A;  1JIC A;  2X6G A;  1HRJ A;  4KI0 A;  5LL6 X;  3CRL C;  3BDO A;  3GTO B;  3ITP A;  3GTM B;  1YNJ D;  5IT9 E;  1OXV A;  3NE5 B;  3PUW A;  4XQQ A;  4DXF A;  3ERQ A;  1E2Z A;  4C3H G;  2PYK A;  2RDG A;  3GP7 A;  2CQA A;  5I6Y A;  2A6H C;  3KK7 A;  2WAQ B;  1KDB A;  3NP8 A;  2K5Q A;  2JEB I;  4RHR A;  3TP7 A;  1FGB D;  2TSS A;  3Q6S A;  3T53 B;  1B2T A;  3V05 A;  2KA7 A;  3TBI B;  4J1M A;  2J0T D;  3VYU A;  2XRS D;  2D2C C;  2A6E D;  2F0L A;  1JE4 A;  1O7Y A;  1V1O A;  3K7A B;  2F0F A;  2CHB D;  2EY5 A;  3E5S A;  5I4D A;  2EOT A;  1EQT A;  1LT5 D;  4RGO S;  1D5M C;  1TII D;  2MGS A;  4F8M A;  3HGB A;  1C48 A;  3K6O A;  1IKM A;  5M5Y B;  4NP5 A;  4M1U B;  1SDF A;  4KMU C;  2EXZ A;  1SJH D;  2NTS A;  1YNN C;  3ERO A;  1DON A;  1R9T B;  1GHJ A;  2EYJ A;  1CQF A;  2BE5 D;  1EIH A;  3A8I E;  3GV3 A;  1U9R A;  4V19 0;  1EQV A;  5C4Z A;  5A35 A;  2K28 A;  2HQE A;  1BQQ T;  5IIF A;  2R93 B;  4ODG A;  2E2D C;  2IJ0 A;  3Q23 A;  2NYZ D;  3NPP A;  5C0X J;  2KQ3 A;  2ZXO A;  2BA0 A;  3RUZ A;  2CW0 D;  1CFM A;  2O4X A;  4MHE A;  3S14 B;  2K6A A;  2NVY B;  5G3L D;  1ZXT A;  1DOL A;  1JCK B;  1H9K A;  2KCC A;  1TVX A;  2BDO A;  5CMD A;  3M7N A;  1DD2 A;  1AN8 A;  2PZT A;  2L55 A;  4K5W A;  3K59 A;  1EY6 A;  3D8G A;  2L9H A;  1LAC A;  3E6Z X;  3TZU A;  2B2T C;  3DWQ A;  4XXE A;  1A15 A;  2DN8 A;  1F77 A;  2F0I A;  4A3E B;  3Q22 A;  1W6K A;  1X3P A;  1ET9 A;  1M4V A;  3SXH A;  2F0P A;  1IYU A;  4BBR B;  3OW7 A;  2G9D A;  3I70 A;  3ND9 A;  4KN4 C;  2EY1 A;  5IOC A;  4JBW A;  4MIU A;  2IX0 A;  4WOR A;  1TQO A;  4FXK C;  4A3K B;  3WOF A;  1I4Q A;  1PRT F;  3HRZ C;  1SNO A;  3QOL A;  1SE2 A;  2SNS A;  2WB1 B;  1OXX K;  1NSN S;  3D4W A;  3KBX A;  5C4J B;  2PQE A;  3RD4 A;  1G6Z A;  2A69 D;  3VYS A;  4FF2 A;  2F0V A;  1STA A;  2JYO A;  1CHQ D;  2ZXR A;  4HMI A;  2B2Y C;  4ZK9 B;  4HR7 B;  5D3I B;  1F9R A;  5DM6 3;  2N88 A;  4FF4 A;  2XWJ B;  2B2U A;  2F0H A;  4KKU A;  5JAV A;  1MBY A;  1D5Z C;  2ICI A;  3UI2 A;  2A68 C;  5FO9 B;  4HCS A;  1TWG B;  2FMM A;  3PV0 A;  1ICW A;  1VMC A;  1R4P B;  2QDB A;  3K5N A;  1NAP A;  3Q0A A;  2K7V A;  3FDT A;  4RGM A;  4EQO A;  3C2P A;  1PMR A;  1EL0 A;  1SYC A;  2KVM A;  1HA5 A;  4G4K A;  1EIG A;  3MC0 B;  4OO1 I;  4DAV A;  1RF2 D;  1QJO A;  1CA6 A;  1Y8N B;  1LV9 A;  1GJX A;  4G57 A;  1HUN A;  2O2L D;  2RDF A;  4BS9 A;  1C4Q A;  3P20 A;  5EJW A;  4G7H C;  5DAU A;  1PRT B;  1HTP A;  1AZQ A;  1LT4 D;  1KAA A;  4DNR B;  1HPC A;  1L0Y B;  2IX1 A;  3VR2 A;  2OF1 A;  4RCN A;  1O80 A;  2ENB A;  2KCN A;  1I4P A;  1V43 A;  2R92 B;  1CM9 A;  3MVV A;  2F0S A;  2L12 A;  1JQY D;  3TME A;  1Q1B A;  3DUZ A;  3X3M A;  1C8C A;  3J80 E;  3D3R A;  4RHS A;  1G29 1;  4ZKB B;  3SK5 A;  1E2W A;  1YNN D;  2O5J C;  3PUV A;  3HOX B;  1PDQ A;  3OIQ A;  4DXG A;  3VYR A;  3S17 B;  3VR5 A;  1HUM A;  2Q8T A;  3NK9 A;  3RZD B;  1EY7 A;  1J9O A;  1KLG D;  4C3I G;  3IFD A;  3Q24 A;  2BOS A;  3W2D A;  1EYA A;  3MHB A;  2D62 A;  3EJI A;  1PYW D;  3ND8 A;  5COY A;  3HG9 A;  1BCP C;  5TSS A;  1KDA A;  1D1I A;  1JC7 A;  4K5X A;  2XN9 C;  5C6A A;  2PCF B;  3A8J E;  4HN7 A;  4ZYS A;  4R8I A;  4QCL A;  3H3V C;  1TY0 A;  1SMY C;  2F0W A;  5C3E B;  3S1M B;  3DEP A;  4C56 C;  1Q90 A;  1ZKO A;  2FMC A;  4C1N K;  3C1E A;  3K5L A;  1S5C D;  2FFK B;  4BA1 I;  3SHL A;  5C0X I;  3GTJ B;  3R93 A;  2B2U C;  3CQZ B;  1UAP A;  2K01 A;  1BUV T;  4IUP A;  2G9H D;  4C3J G;  2IWH A;  1LTA D;  2AUJ D;  4M8A A;  3NHH A;  3M85 A;  1ONL A;  4KHZ A;  4G7Z C;  2RBM A;  2L0C A;  2VXW A;  1CI3 M;  4JK1 C;  4B9X A;  1V1P A;  3R3O A;  4FO2 A;  4HED A;  3I4N B;  1K8O A;  1DM0 B;  2EYF A;  4IN3 A;  1Q8I A;  2MP1 A;  2LY7 A;  5I9O A;  2N55 A;  5C0X H;  4NW2 A;  2IPK D;  2BA1 A;  3P1H A;  1HXY D;  3C46 A;  5C4H A;  4DFA A;  2Z8L A;  1PZI D;  1BR9 A;  3BS1 A;  1QE6 A;  5JJZ A;  2R6G A;  3DWA A;  4HCE A;  4K14 A;  5I6W A;  1ENA A;  3JAM L;  4IAL A;  4NMZ A;  1BF4 A;  1W6J A;  5LL6 S;  4KN7 C;  1H9S A;  2CVR A;  2JSO A;  4KJN A;  4Q0F A;  4NDX A;  1EZ8 A;  1S5F D;  1MSH A;  3NUC A;  1OXU A;  2JE6 I;  1S4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...