1STHA

Two distinctly different metal binding modes are seen in x-ray crystal structures of staphylococcal nuclease-cobalt(ii)-nucleotide complexes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title X-ray crystal structures of staphylococcal nuclease complexed with the competitive inhibitor cobalt(II) and nucleotide.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sthA00
5CV5A 4R8NA 4MIUA 2EYHA 4K14A 5DAUA 4EQPA 4K6DA 5J22A 2PYKA 3BDCA 3DHQA 4J1MA 3SHLA 1ENCA 1II3A 2F0EA 2F0IA 3E5SA 4WRDA 4RKBA 1A3TA 4B9XA 5I6YA 4K8IA 5CV6A 1SYGA 2WACA 3NUCA 4HMJA 4KD3A 2OF1A 2SOBA 4NMZA 4QB4A 2F0KA 4QMGA 1SYDA 1SYBA 2F0VA 5IGEA 3QOJA 2PW7A 4K5VA 3H6MA 5KIXA 3SK4A 2EYJA 2RDFA 2EY2A 1RKNA 1STAA 3P1HA 3T13A 4QF4A 5J1ZA 2EY6A 4HMIA 4E6IA 5I6WA 5IGDA 4S3SA 1SNDA 4DFAA 4KY7A 2ENBA 1EY8A 2EYLA 1SYEA 4NP5A 1JOQA 1SNOA 4KD4A 1TT2A 2LKVA 4G57A 4HTHA 3BDLA 3MZ5A 1EZ6A 4I65A 4F8MA 2F0NA 2KQ3A 4ZQ3A 4EQOA 1EY9A 1EY7A 3HEJA 3MVVA 3D4DA 3NHHA 5JOBA 1SNMA 4DU9A 4KTAA 3NXWA 5I9PA 5IGFA 3V2TA 5C3XA 2EXZA 4IALA 3TP5A 3EJIA 3NP8A 1TQOA 5E3FA 1F2MA 2RBMA 2OEOA 4K2KA 3DMUA 3C1EA 3ERQA 3EROA 2EY5A 5KEEA 2F0LA 1A3UA 5CV7A 4DGZA 3TP6A 1AEXA 5CR3A 2F3VA 2EY1A 4ME5A 5EKLA 2PZTA 5C5MA 4EQNA 1A3VA 3MEHA 5IGBA 5KRUA 2EYMA 2M00A 4IUNA 5C5LA 1KDAA 2PQEA 2QDBA 3LX0A 4ID6A 5CV8A 2RKSA 3TMEA 2PZWA 5C6AA 3MHBA 2EYFA 2F0FA 3SK6A 1KAAA 4K8JA 4KJNA 3ITPA 1STNA 1JOOA 1STBA 3VA5A 5KYIA 3D4WA 1EQVA 3C1FA 4H7BA 4N9TA 3MXPA 4PMCA 1SNCA 5C4HA 1EY6A 4KV6A 5EKKA 3OMCA 4PNYA 4LAAA 4ODGA 2F0SA 1U9RA 3D6CA 1STYA 5CV4A 5DEHA 1EZ8A 5E1FA 5IODA 1KABA 1TR5A 2OXPA 3QOLA 5K5PA 1STHA 3P75A 5KGUA 3HZXA 1EYAA 2F0TA 1SYFA 2F3WA 2F0DA 4RKLA 2F0HA 1EY5A 4KY6A 1A2TA 1ENAA 1KDBA 1STGA 1JOKA 2F0JA 4N9PA 3RUZA 3TP8A 3U9OA 1NSNS 5HGTA 1F2ZA 2NUCA 3D8GA 1JORA 1A2UA 4ZUIA 5IOCA 2F0PA 4K5XA 5CC4A 3T16A 4IZ8A 4NDXA 4EVOA 3OSOA 1EY0A 1SNQA 2HQEA 2SNMA 3PMFA 3TP7A 3NQTA 3OMGA 4YIJA 5EGTA 2KHSA 5IIFA 3SXHA 2F0WA 2F0QA 2F0UA 5HURA 2EYPA 2PW5A 3S9WA 4DF7A 1KDCA 4KJOA 2F0MA 4ZUJA 5C3WA 1SNPA 5ISRA 4B9WA 4F7XA 4NKLA 4K2LA 4PMBA 3NK9A 1EYDA 3SK5A 1EYCA 5M9OA 4K5WA 5NUCA 3QB3A 5IGGA 5J39A 5JAVA 4TRDA 5KYLA 5I9OA 2F0GA 5C4ZA 3R3OA 3SR1A 3EVQA 1IHZA 4WORA 5CV9A 5F2DA 3SK8A 1EY4A 4OL7A 4KY5A 2SNSA 1SYCA 5IGCA 2EYOA 2O4XA 1F2YA 4KHVA 5CGKA 1NUCA 2F0OA 2PZUA 4J6HA 3OWFA
chains in the Genus database with same CATH superfamily
3E9IA 4P74A 1TWAB 4JK1C 1YBYA 3ERSX 4BY1G 2MNAA 2GN5A 1DGSA 5J22A 5CC4A 2XTIA 3HKSA 3E0EA 5J3BA 3R93A 1PRTC 3VYRA 1GD7A 4DV1Q 1VQ7A 4X6AH 3W5OA 1M1KC 4JI5L 5E4XA 4ILWA 4LWCA 2JA6H 3MEFA 2A5HA 3K5LA 4OWWB 1KNAA 1G2TA 2BDOA 2K1BA 2MJ8A 1D6EC 3F1ZA 3PO3B 1QWYA 3I90A 1UWVA 4RGOS 3SDZA 2K5VA 4JBMA 1N33Q 4TKOB 3R8BA 3TP5A 4H0LC 1YJNA 5BN3A 2FHTA 3ULPA 3K81C 1N8RC 5HY6A 3WOFA 4DV7Q 4KLKA 2IWHA 4L5RC 1HA6A 3VYSA 3HP3A 3MXNB 3MWYW 2LXJA 5CORA 2K5DA 4JOIA 2ASBA 1B9NA 4A3JH 5IE8A 3NENA 5C3EH 2EYFA 1K9MC 1PTOD 2HD3A 1SR3A 3Q8DA 1FJGQ 4G7OC 3S1QH 1ET6A 1HNXQ 4IJHA 4A4IA 2J7ZA 1EY6A 2JA6B 3KK7A 3PIPA 1PDQA 4RH6A 4RGNA 5D3DA 4DV7L 1ILPA 4JOIC 2K75A 3AQQA 1A2TA 5BN5A 3D4RA 4HCSA 4OWTB 5HGTA 1QJOA 1EU3A 1TS4A 4IPHA 1A2UA 4QIWB 2NN6H 5DLQE 4X62L 4UP8A 4NDXA 4QUCA 1TY0A 2B63H 1FJGL 2MPMA 3GV6A 2FFKB 1T5EA 3VA7A 2R61A 4HAEA 4LF8Q 4A3JB 5GROA 2O2LD 5C3EB 3CRKC 2Q2TA 1Q1EA 1Y14B 1JJGA 1EYCA 2CH4A 4K5WA 2V1CC 3D0FA 3S1QB 1SSOA 3EVQA 2QDLA 2K52A 2KECA 4FVMA 3X3MA 1PH9A 3GTJH 1EEFD 1PYWD 1M8AA 2KCCA 1EIFA 4BY1H 4HJ7A 1HFGA 1TVXA 3J7AV 1BBWA 2XGTA 5COYA 1MI2A 2EDGA 1AZPA 1Q8KA 4LF8L 1PYBA 2F52A 3KYHC 2D5DA 1Q86C 2SOBA 1TWCH 2Z8LA 3T56B 4QMGA 2B63B 1TY2A 4RMFA 4BA1I 2RDFA 1HZBA 4AH6A 3S15H 4QF4A 1LTGD 3NBHA 4R9WA 4HJ5A 3K0YA 3RZDH 1JJ2A 1SNOA 1K8AC 4N8X1 2HIXA 1DONA 2CQAA 5M3MG 2L55A 2F0NA 3KLWA 4JI8Q 1LM0A 1BDOA 4OELB 4GLXA 4DN4M 1EOVA 1QG7A 3GTJB 2AWNA 4O1NA 5AFWA 3G48A 4BY1B 1GHKA 4FNFA 1WTWA 4WJWA 3SGIA 1KDAA 4BY7G 4MZ9A 4X66L 3GDEA 1JE4A 2F0FA 3TZDA 1LYLA 3VYUA 1TWCB 1STBA 4JI8L 3U58A 4RA8A 4HJAA 3J7ZC 1VQMA 1J8IA 3S15B 3CRLC 1MJCA 1EZ8A 3RZDB 1TR5A 3VR3A 3IKJA 2QGQA 2F0DA 5I4DA 5JJKA 3M4PA 3HOVG 2Z6KA 1B9MA 2WAQG 4A3CG 2UXBQ 1XMOQ 1FVIA 4R1JA 1XNQQ 2FMCA 2QA4A 1LABA 1YIJA 3ULLA 3IL8A 3GV3A 1VQBA 4GNXB 1QVGA 2EE1A 1LT6D 3PUWA 1VQKA 3BG3A 1QOHA 1F77A 1VQ5A 3AFPA 2Z6KC 5LL6S 3S14H 2A68D 5I9OA 5IY0A 1GM5A 1B70B 4BWGB 2UXBL 3JC66 1ASYA 1JWSD 1H9KA 4KKSA 1K3BC 1VQJA 1B53A 4L63B 1N36Q 2EYOA 2G9DA 2KHJA 5IYCG 4F88A 2K5HA 1IXRA 4J6HA 5IYDG 2EYHA 3KF6A 3KLRA 2V4DA 1YNND 2Q8TA 3S9WA 4ULLA 3CC4A 5JJLA 4GLAC 2DN8A 4IUUA 1LLRD 4HSVA 2K4KA 1JJCB 1HR0W 3CKIB 1EUJA 1NMGA 1BCPC 1HCZA 3T13A 1I6VC 5FO7B 5C4JH 1W3SA 3J7YW 4HIKA 1N36L 4LF6Q 1X3QA 5M3MH 2VY3A 3S14B 1KAWA 4L8JA 4BBRH 1RCVD 3NHHA 5IGFA 3HOWB 3Q6SA 1LTBD 4U68A 3TDQA 3EJIA 3K7UC 1O7ZA 1Q81C 2R92G 2RBMA 1OO9B 3EROA 4GOPA 4XT1B 4XT3B 5CV7A 3I72A 4UP7A 1AEXA 2PNHA 2EY1A 1PH1A 5IWAQ 3MEHA 4BY7H 1ZXTA 3K7AB 3ONAB 1NTGA 4G4KA 1VQ9A 4PMWA 2OT2A 4LF6L 1EFID 1JOOA 2ZT9C 1DZ1A 1HR0Q 1RTNA 1PXUA 4LUOA 4WFN3 4PNYA 5IT9L 3ZYYX 5C4JB 2JA7B 2JXMB 3S2DB 5M3MB 4A3EG 4RFBA 3EA6A 4IPDA 3HOVH 4A3CH 4BBRB 1OXXK 1H9JA 1NSNS 1K0RA 5G3LF 1PTOB 1CFMA 4DK0A 2TSSA 3PIO3 4EVOA 2BA0A 4JI0Q 1SE8A 1KC8C 1G6PA 4IN3A 3HOZG 1F9QA 3U4ZA 2KBNA 3PUVA 4EGVA 4BY7B 2Q8RE 3EFXD 4TQUS 4X65Q 4B9WA 2PI2E 1EQRA 3AFQA 1I4GA 1YHAA 4IUTA 4IUVA 2R6GA 4IUPA 1XPUA 1DJRD 1SMXA 2KEEA 4UPAA 5IYCH 4JI7L 4GN5A 2RHQB 5IYDH 2IHFA 5CGKA 2E74C 3LWEA 1NE3A 1PH8A 1V1PB 1QVFA 4R8NA 1PFSA 5DAUA 1NCVA 1YHBA 3HOVB 1WD1A 4J1MA 1RD9D 2AKWB 4NPSA 1F9PA 4K8IA 3CP0A 3KF8B 4DK1A 1R4QB 2ZJQA 1X9NA 1BNZA 1PZKD 1I6HH 1RKNA 3HOXG 2K33A 2QEJC 1XTCD 2RQXA 1V1QA 4CKBA 1S4ZA 2GVBA 1XX8A 2O5JC 4ZQ3A 1KRTA 1JB3A 4UAIA 4DU9A 1SJHD 3QO2A 2B2WC 4B3TQ 1YJWA 5C3XA 1BR9A 4FF3A 1TQOA 4IO9A 3VR4A 4LJZC 4A3GG 4U673 5FLXc 1VDZA 2JN4A 1UE7A 1HUNA 1RTOA 5EKLA 1PFBA 3BDOA 4LUVA 4RGTA 1X56A 2PQEA 5IYBG 4L6TB 1DOKA 1Y8NB 2NTSA 2QKIC 1VQ4A 2R93H 3NTIA 4JI2L 1KRSA 1VQHA 4KN7C 1I6HB 1N32L 4B3TL 1FNVA 2B2UA 4OGQC 1KIXA 5K36G 2NWGA 4JBJA 4LUZA 4OONA 4A3EH 1X3PA 2BA1A 4RHRA 1KXLA 4QGUA 1SE4A 3AU7A 1SYFA 2HCIA 3A74A 2MO0A 4DUYQ 2XWJB 1U5KA 2KCNA 5C44G 1I94Q 3S1MB 1NR4A 1MHWC 3PF5A 3OIPA 2UUBL 3O13A 4LF5Q 3F8TA 4FP5D 4DAMA 2SNMA 1UEBA 4J15A 3D6WA 2E2HH 3HOZH 2KHSA 2XRSD 1HTPA 3PO2G 3GTQH 2N55A 1VF7A 4X64L 4DV2Q 3H09A 1KLUD 3H94A 1WTRA 4JI1L 3FHWA 2R93B 3EN2A 3ICEA 1J6QA 4DUYL 5JAVA 1I94L 1YNJD 3CF5A 4MHEA 1SXTA 3RN2A 4LF5L 3AEVA 2Z4HA 5C0XG 1HUMA 4A3EB 1QB5D 1LTSD 3R2TA 1K0SA 3HRZC 1AN8A 1LT3D 2NZ1D 4V0BA 3A5UA 1W2BA 2JA5G 4P71A 4RKBA 3NBIA 5FLMG 3NUCA 1HQRD 2RCFA 3PO3G 2C9OA 2E2HB 3HOZB 3HOXH 2N49A 1O7IA 2EIFA 2UXCQ 3DM3A 1TWHH 2WINB 1CTMA 1L0WA 1ZKOA 2JK8A 3STBD 4F8MA 4EQOA 4A76A 2MFIA 2QF7A 1G2SA 3URYA 2F4IA 2KOLA 2E2DC 3W1GA 5ELOA 4A3GH 4B3RL 2EZVA 1MKHA 4OO1G 2RA4A 5GQOA 3D31A 3KBXA 1S5FD 1P16A 2KHIA 5IYBH 4IUNA 1U4LA 2M00A 3S2HH 2RKSA 4IPGA 3C3LA 1WCMG 3MHBA 5M3FG 2UXCL 2NVQH 2A6ED 4DAYA 1PMRA 3VA5A 4K6LA 3FPPA 4H7BA 1SNCA 3HOXB 3OMCA 2EQSA 3DWQA 5K36H 4GNXA 2CHBD 5IODA 2LSSA 3Q0AA 3P75A 1TWHB 3CCEA 4RKLA 4FDBA 5C44H 3OOCA 2Q2HA 5DM63 2CW0D 4DXGA 1JT8A 2QILA 3Q24A 4A3GB 1EWIA 1OXUA 4YIJA 1AE3A 3PO2H 4XQJA 4GNXC 3CD6A 5C0XI 4A3MG 4OX9L 2LMCB 2K01A 4GOPB 4RHSA 2DY8A 4QUFA 4DF7A 1O7YA 4FXDA 2IJ0A 2NVQB 3VDYA 4NKLA 3U50C 2RHSB 4PMBA 1XWEA 2E2JH 1IYVA 2A69D 3PGZA 5C4XG 3SR1A 2BE5C 3N52A 3UDXA 2NN6G 4R4QA 4DV6Q 4MN3A 1PHJA 2VQFQ 1PH2A 3FEWX 1MIUA 5C44B 4R4TA 2ZJRA 2JA5H 2PYKA 3ULJA 2B29A 4WRDA 5FLMH 4LF4L 3CC7A 1RIPA 2K28A 1NR2A 1Q12A 3PO2B 4JI5Q 4X3UA 2EYJA 4OO1I 4RCOA 2HT1A 5I6WA 4WJ4A 1F2LA 4LK1C 4DNTB 3A8KE 4NP5A 5JPMC 4DV6L 2VQFL 1RJTA 2CH4W 3DLLA 2E2JB 3HEJA 3CMAA 1OXVA 4Y52H 1ILQA 1IBKL 1CA6A 3KUPA 2K5WA 4Z9CB 3KFUA 2A1AA 5JEAG 3ERQA 4OO1H 2F0LA 1YJ9A 1WFQA 1W6JA 3MXGA 3NQIA 3GTOH 2I5MX 1Q82C 2EXDA 2KUMA 1JMCA 2JA5B 4ME3A 1WCMH 5M3FH 1EQTA 4IOCA 2H5XA 1SE2A 3NTKA 2JA8G 3NE5B 4CJ1B 1S40A 3D4WA 3VR6A 5GADC 1FGBD 3K59A 1KQSA 3T1HL 5KNDA 2OTLA 1WYDA 1PRTD 1LTRD 1F9RA 4HJ9A 2F0JA 1DXMA 2BDNA 4O42A 1N34L 1PTOC 4ZKCB 2C35B 4X62Q 1RL2A 1LACA 1MGSA 4XXEA 4A3MH 3GTOB 2NN6I 5IIFA 1V1PA 5HURA 3QR8A 1G91A 1E1TA 1WCMB 2Z1CA 3H15A 5M3FB 3KDFB 3GTLB 3M7NA 5C3WA 4DV3Q 1HQMC 5ELDA 1AW7A 3KF8A 5J39A 1VQPA 5C4XH 1ONLA 3KLSX 1IBML 4WORA 1IHZA 3TBIB 3CW2C 3PIP3 1G8ZD 4LFAQ 2KVMA 4PZ6A 4EX5A 2F0OA 2Y0SE 2AHOB 4L5QA 4A3IB 3OW7A 1XNRL 4QY7A 1H9MA 3K8AA 3DHQA 5E4WC 3K5MA 2F0IA 1HNWL 1S5BD 4C2MB 2M2LA 3HOUG 3UDIA 4DK6C 4DV3L 1ENFA 3CPFA 1VQ8A 1PFMA 2QEXA 4I7AA 2YU9H 3I4LA 4DAPA 4A3MB 1B4OA 4I7ZC 1X3GA 3RD4A 1SN8A 1STAA 3M7GA 4UDUC 1BF4A 4LFAL 1R4PB 3HOWG 3PQIA 3MXUA 2DJFC 3K57A 4UP9A 4DR7Q 5EJWA 1GUWA 3OIQA 4GZYC 3BDLA 1EZ6A 1GVPA 1IYUA 5C4XB 1SNMA 4XDXA 4IALA 2CQOA 2PNRC 2UUAQ 5JEAH 1F2MA 1CHQD 1UNSA 1NBWA 1XXGA 1X32A 5FO9B 4HR7B 2L0CA 2J4XA 4Y7NH 1Y1WB 2A6HD 3I91A 4ZLTF 1K83B 1E22A 3OW2A 2PZWA 2JA8H 4HIDA 4R4OA 4DR7L 4X66Q 5M5XH 2MGSA 4K8JA 4KJNA 3ITPA 2JA7G 3J81c 4AIMA 2YU9B 1SFOH 1PTOF 2PO4A 4KV6A 2DNEA 3S1NH 2FINB 3FPUB 4BBRG 1Z9FA 2UUAL 5DEHA 1NMFA 1FL0A 3A56A 1KABA 4ALPA 5C0XJ 4LFBQ 1L0XB 2Q8IB 2R7FA 1CT1D 2NTTA 4JC0A 2ATWA 2R7ZG 2JYOA 3UI2A 1WTVA 2OQ0A 3A8JE 5ELNA 4IZ8A 1S72A 1CM9A 1RHPA 1M90C 2L4NA 3K5NA 5EGTA 1ZYRC 4Y7NB 1TIID 5E7NA 2K14A 3IRBA 3BZDB 3A0JA 3WWVA 2TMPA 2JA8B 1SNPA 5KNBA 4LFBL 5M5WH 3IAYA 5GAHC 5M5XB 4FF2A 1XYIA 3NELA 4FXKC 2JEAI 1CSQA 1SFOB 1KL9A 3R3OA 1EWCA 4DAYB 3S1NB 4QJFA 3ND9A 3CMEA 4YHHQ 3CCRA 4DR2Q 2ZM6Q 1K8MA 5IT9c 4RG1A 1T5XD 1PZID 3HOUH 4B9XA 5BR8L 4Q5VA 4A93G 2K50A 4TVAB 1CUKA 2IL8A 4KD3A 1QNUA 1CKNA 2G5DA 5A35A 5A2QE 2A68C 3I4OA 2F0VA 3FKIH 3NPPA 4JYAQ 2ZTCA 1Q1BA 5EQ0A 3SK4A 2Q2UA 3HOWH 1E2WA 1WVLA 4KY7A 1E2VA 1GUNA 1PLFA 4DR6Q 1WJJA 2FMMA 4YHHL 4DR2L 2LKVA 4G57A 1X6OA 2ZM6L 4A3DH 5M5WB 3MZ5A 4I65A 1YNNC 2KQ3A 4KI0A 2DY7A 4IQZA 1ESRA 2VQEL 3K7AH 4XTCS 2BH2A 3SE0A 3J81L 2YV5A 2HDMA 2EY5A 2WB1E 5HGQA 4JYAL 3JAML 1QILA 5CR3A 3DWPA 3J81j 2PZTA 2B39A 2E8GA 2KJXA 3L3OC 3HOUB 4HIMA 4DR6L 4LF9L 3SK6A 4CJ2C 4P75A 2JA7H 3S2DH 4NB3A 4DR5L 1ET9A 3FKIB 3T1YQ 2HUGA 4ZCKA 5C4HA 3GTKH 3H3VH 3MFGA 1DOLA 1I4QA 1PTOH 1JQYD 5E1FA 1E7ZA 2OXPA 2IX3A 5K5PA 1STHA 3D3RA 2XVSA 3DXJC 4A3DB 1EL0A 3CCVA 2R7ZH 2HHHQ 2FXQA 2ICEC 2NUCA 1OXTA 1IW7C 1JE5A 1BCPD 4K5XA 1N9WA 3NTHA 4APVA 5FO8B 3J80E 3T1YL 2K5NA 4CKCA 2XRQD 3DEPA 3CC2A 4A3LG 2C5CA 2R93G 4C3HG 4A3KH 2EYPA 2PW5A 4GOPC 2RF4A 4K2LA 3SVMA 1EYDA 2Z4IA 4DNRB 3GQBA 2HHHL 3GTKB 4CDEC 4DR4L 4QCLA 4IOAA 1VCIA 2CWPA 5CV9A 2XN9C 5FKAC 1I5FA 2SNSA 3I7FA 1HXYD 3KOJA 4AYBE 2MHVA 3MFYA 2IT1A 4JI7Q 3OWFA 2DNCA 1HTLD 3I4MH 4JW0A 2R7ZB 3K80C 2IX1A 1ML0D 4A93H 4J8QA 1ENCA 2A19A 1HA5A 4CDDC 2JQOA 3VR2A 1R9TH 4QB4A 2B2TA 2WAQE 1HPCA 4B3SL 4RGMA 3QOJA 4B3ML 3L7ZC 1LTTD 4IFDG 3U9SA 4N8FA 1YNXA 1KD1C 1JWUD 4A3KB 2PMZE 3BVZA 4DFAA 4C3IG 1CSPA 1RF2D 3T4AC 2VNUD 3CAMA 4PV1C 5JOBA 1MSGA 3NSWA 3NXWA 3F2CA 2B2TC 5E3FA 4JI3Q 4K2KA 4FO2A 4C1NI 3A54A 3OTOQ 1QVCA 3E6ZX 3H0GG 1D5MC 3TSSA 1CZGA 1Y1VH 3I4MB 4XIGS 2B8FA 4KHPQ 5C5MA 4IURA 5IGBA 1KHIA 4DUZQ 1B8AA 1V8QA 4A93B 1PH4A 2LY7A 3OWEB 5LMNW 5LMUQ 1R9TB 1HFNA 1VQDA 3C1FA 1YITA 3TREA 4JI2Q 5EKKA 2RSNA 3S1MH 1N32Q 5KNCA 4JVZA 1X55A 3L9AX 4JI3L 3OTOL 3QOLA 1GJXA 2MQHA 2IX0A 4YCVA 3KDFA 1EQQA 2OCEA 3BYTB 2ZJPA 4KHPL 3PF4A 2RDHA 2IPKD 3G6EA 4DUZL 2NBFA 3G6JB 2Q2IA 3NWSA 2KCMA 1PH3A 4OEMB 2UUBQ 1Z7TA 1NAPA 5LMUL 1GOZA 3KLSA 5EAYA 4NXMQ 4A3LH 4C3HH 1Y1VB 1H9RA 2UUCQ 2SDFA 1XJVA 2L11A 1KDCA 3KBGA 4DR1Q 4MNOA 5ISRA 4X64Q 3GD7A 3Q22A 3A7LA 5NUCA 4FXGC 4JI1Q 1I4XA 1BKBA 2DJGC 2K5QA 2UU9Q 1EWHA 2WFWA 3I73A 2LXKA 4IFDI 2SEBD 4KY5A 3G71A 1L1OA 4KHVA 1F2YA 1EYGA 4NXML 1U4PA 1IKMA 1AE2A 2B2UC 2VL6A 4IJLA 1A15A 3BDCA 4RCNA 2UUCL 5D14A 2F0EA 3E5SA 4OHJA 4UHVA 4DR1L 1Y69U 1SYGA 5LMNL 1FD7D 1G6ZA 4IFDH 4X3KA 2PW7A 4GKKQ 5KIXA 4OWXB 3W1BA 2UU9L 4C3HB 5J1ZA 2EY6A 1DD2A 4C3IH 4POGA 4GKJL 1SYEA 3ND8A 4A3BB 1FR3A 4BA2I 3U4VA 1X54A 5CBEE 3MVVA 4WJ3M 2EXZA 4DV4Q 3H0GH 2Z9HA 5T1GA 4R8IA 1HZ9A 4B3RQ 4GKKL 4KMUC 3M3YH 4HJ8A 3LX0A 4FF4A 3E3XA 4DPGA 4CDCC 5C6AA 3STBC 1JR0D 1SDFA 2VUMB 3OHXC 5KYIA 3UDGA 1VQ6A 5IP7G 3GTMH 1YVCA 1CKNB 1WTHA 4LAAA 5CV4A 4DV4L 1CI3M 1Q46A 1STYA 4C3IB 1FNUA 4YY3L 2XSCA 1IL8A 1Z6HA 3HZXA 1V43A 2RCNA 1RDPD 1KDBA 4N9PA 3RUZA 2B2VA 1U0LA 2A6EC 3D8GA 3KJPA 1LT5D 1TS3A 5IOCA 2AWOA 2RDGA 4YWLA 4C3JG 5GAEC 1E2ZA 3H0GB 3DM1A 1QE6A 4YWMA 4L5TA 3J81i 2B3GA 4QL5A 1Q7YC 3M3YB 3SXHA 1ZEQX 3JAMi 3I70A 5ELCA 4OX9Q 1WOCA 1JC7A 1EFWA 1UAPA 4F7XA 1SMYC 2B2VC 1Q3LA 2NYZD 2CW0C 3E0JA 3CCJA 4A3IG 5C4ZA 1CQFA 3GTMB 4GN4B 1ASZA 2BOSA 2I07B 4TSSA 1I50H 2D0PA 5A2QL 2D2CC 2A73B 3Q23A 1A3TA 1K8OA 1VQEA 4LF4Q 1AH9A 3DEOA 1QZGA 3HKZE 1AZQA 1AP0A 5CMDA 2O5IC 2RVLA 3MTSA 1VF5C 1YI2A 3H6MA 3X3NA 1B1ZA 1TS5A 4OIJA 1SNDA 2G9HD 1EY8A 2PPBC 3TEHB 1BBXC 1XMQL 4HTHA 1K3RA 2EJFC 1SEBD 2JE6I 1C9OA 3OYYA 3BS1A 1VQIA 1EY9A 1GO3E 2Y0SG 3V2TA 1Y1WG 4CJ0B 1DCZA 1BVSA 5JJZA 1IBKQ 1C7YA 3DMUA 3C1EA 5KEEA 2QCPX 4H44C 3PSIA 4KKUA 2L9HA 1TXYA 1VQNA 3PV0A 4EQNA 1I50B 3QWNA 1MBYA 2EYMA 2EPBA 2QDBA 3G7LA 1WTOA 3RNUA 1J5EQ 1M4VA 3ER0A 1STNA 3T53B 2R7DA 5IP7H 3MC0B 5IP9G 3T1HQ 1NNXA 2PQAB 2F0SA 1S3OA 2BCOA 4JI6Q 4G7HC 2F0HA 4JI4Q 2AMCB 1F2ZA 1UEAB 3J80L 1RODA 2MUYA 4C3JH 1N34Q 1J5EL 4A3FG 3GTLH 4OIKA 1SNQA 1I4HA 2XIWA 3LNNA 3TP7A 1S5ED 1EOTA 1XTDA 2NVXH 1FNWA 4DV0L 4CBVA 4IFDJ 2X69A 1E0BA 5JVG3 4M1UB 1UE5A 2F0MA 1TWGH 3C46A 4JI6L 2WKDA 4JI4L 4YWKA 4A3IH 3BYYB 1KLGD 2K6AA 4TRDA 2AQ2B 3LGJA 3H3VC 2XNAC 3W3AA 1S5CD 1IBMQ 4C2MH 4OL7A 4KHZA 1LT4D 3K0XA 1K8GA 1STEA 1D8LA 1DOMA 2PZUA 1Y8PB 3CCSA 3WOEA 2IW3A 4POFA 4K6DA 4QIWE 1XNRQ 1P8LA 2B2YA 4X3SA 1IL2A 2H4OA 1II3A 3M4QA 4DV1L 4P73A 4C3JB 1HNWQ 5TSSA 3M4YA 2WACA 4NMZA 2NVTH 1SLJA 3B6YA 1O7LA 1SYBA 2H1EA 1GUGA 1MSHA 2NVXB 4K5VA 1C4QA 2MP1A 3R2IA 4HMIA 1D1IA 5D3IB 4BBSG 5DNFA 1TWGB 2B2YC 1QCBD 1IZ6A 1I3QH 1D2BA 1N33L 1Y1WH 4KK7A 2VS1A 4KTAA 4ZK9B 2PI2A 1K83H 3NP8A 2ZXOA 3N6RA 1OTCA 4OXPA 2ZTEA 4CGYB 1BOSA 2F3VA 3FKIG 3MA2B 3BZCA 3GO5A 5KRUA 5M5YH 1L1OB 4XQNA 1A62A 4UY8C 1GUSA 2NVTB 1HNXL 1ESFA 2KCTA 4A3DG 1EQVA 5FK9C 5IP9H 5FOBB 3QJYA 2K04A 1LTAD 3D6CA 4JPBW 5ELFA 4HIOA 2YYZA 1LUZA 4RAUC 5KGUA 3E9HA 5LL6X 2A6HC 2F0TA 2K32A 4XYOA 1I3QB 1WI5A 2WB1G 1PRTF 2Y0SB 1VMCA 2ICIA 1O80A 3A7AB 1JORA 4A3FH 1FYCA 1SE3A 4L5SA 2CCZA 4IPCA 3TS2A 3OSOA 1DYQA 4GLVB 2VB2X 5FJ8G 3P20A 1XPRA 3HFZB 1K28A 4K0KQ 4YCWA 1WTQA 2F0QA 4KN4C 4P72A 5M5YB 2E2IH 1WD0A 3JAMc 3I3CA 1JICA 3I2ZA 2OWOA 5JVH3 4HCEA 3SK5A 3QB3A 5IGGA 4PG3A 3K5OA 5T1IA 1EY4A 1BUVT 5IGCA 1IBLQ 4R4IA 3RMHA 1I4RA 3GTGH 5FLXE 3GP7A 4X3TA 2JA9A 1HNZQ 4K0KL 4XYQA 2F4VQ 1D5XC 2HIVA 5EPLA 2L5TA 3I4NG 4A3FB 5ELBA 2DGYA 1A0IA 1LV9A 4A3KG 4PZ7A 5BR8Q 2OF1A 1H9SB 1PFNA 1CA5A 2ES2A 1ICFB 3VYTA 1SYDA 1LTLA 5CBAE 4BBSH 1D7QA 5IGDA 2GVAA 1LTID 2E2IB 1IBLL 5CYUA 2VZAA 4DAVA 1OXSC 1VQGA 1HNZL 4AYBG 1BQQT 3I56A 2F4VL 3CPWA 2EJMA 3I4MG 1ZYRD 4XQQA 4IUQA 2HCCA 1HHVA 1JWMD 1HH2P 4RWSC 2VQEQ 4MTKA 1B44D 3FRPB 5EBDA 2N78A 1PH5A 3GTGB 1O78A 1B7YB 1G51A 4ME5A 4CDFC 5H1SE 2I0QA 4C1NK 5CV8A 3TMEA 2HDLA 1CK1A 2MO1A 4LF9Q 3CQZH 4JCVE 4C56C 4QQBX 4DR5Q 3SEBA 4A75A 2I5HA 3PUYA 1PYSB 2NVYH 4BBSB 3F2BA 5L37A 2RSOA 2M9VA 4LF7Q 2ALYB 1JB7A 3H3VI 5G3LD 1GUOA 3W2DA 2D9UA 1EY5A 3FP9A 2KENA 1ENAA 1STGA 2ZTDA 1XMOL 1C8CA 4JG2A 1Y1VG 1EIGA 4ZUIA 1XNQL 2F0PA 4FF1A 3T16A 2KEDA 4GS3A 5FJ8H 2WKCA 1W6KA 1WTPA 4O0AA 3J7A5 1BXTA 2AUJD 2WIIB 4JV5Q 1MJEA 4LNQA 4JBWA 4H02A 3MAQA 3M4OH 4LF7L 4PQXA 3S1RH 1PH6A 3CQZB 2K03A 1X65A 4HN7A 4DNIA 3L0OA 3V96A 2YTXA 2NVYB 5F2DA 4DR4Q 1QUQB 2A74C 1SYCA 3S24A 3RR5A 1BO0A 1Q8IA 1VQAA 4MIUA 2WB1B 1YHQA 1UE1A 4JV5L 3I4NH 3SHLA 3I8ZA 5LHY1 3IFTA 1PRTB 5CV6A 4HMJA 3J80i 1XPOA 2VXWA 3BVGA 2F0KA 2L15A 3ZJYC 4A3BG 1C48A 4B3SQ 4B3MQ 4DXFA 3TN2A 3RLFA 4E6IA 4H13C 2N8NA 2CFMA 3M4OB 1IW7D 3S1RB 5JEAJ 2F03A 4EQ5A 5I9PA 4DR3Q 1U4MA 3I55A 4FYDA 1B3AA 1YEZA 2D62A 3AB9A 3PIOA 1CHPD 1V9PA 2PQAA 2VUMG 2KA7A 4DGZA 3PUXA 1D5ZC 5IWAL 4ABNA 1IKLA 3I4NB 3RLOA 5JJIA 2JSOA 2ZXPA 2HQLA 2N88A 1A6XA 1PA6A 1E1OA 3K58A 1HR0L 4CHTB 1A63A 1PH7A 4DR3L 1V1OA 5JPNC 2I46A 1GHJA 1CKMA 2Z6BA 2XWBB 2VB3X 4F87A 2X6LA 2I5LX 2ID0A 4AYBB 4KY6A 4HSPA 3U9OA 1JOKA 4DV5Q 1CQVA 1LO5D 2N3SA 4JI0L 2DUDA 1GUTA 1SRUA 3A8IE 3PMFA 3BU2A 1CZWA 4KKTA 4LFCQ 1BCPF 3VR5A 2WAQB 1HRJA 4M8AA 3OPOA 3M9BA 4X65L 2B2WA 4ZUJA 2X6GA 2PMZB 2E76C 2JEBI 3K6OA 4DV5L 1QZHA 2F0GA 1E3PA 3CCLA 4B08A 3SK8A 3MXNA 3CCMA 1CKOA 1NY4A 1NUCA 2CWAA 3F2UA 3QIAA 4LFCL 1VMPA 2P5ZX 4EQPA 3V05A 3TP8A 3NWTA 4LW1A 4ZYSA 3CCUA 2R92H 2R3ZA 3HG9A 1SBBB 3F2DA 1J9OA 1FGUA 5LMNQ 4A3BH 1U4RA 2CVRA 1HZAA 2BH8A 1PVOA 4CKEA 3UE0A 2E5LQ 1GKHA 3TZUA 5GAGC 2L1BA 2EYLA 4KD4A 3BZKA 1TT2A 4GKJQ 4NW2A 4PZ8A 2VW9A 3D4DA 2ZXRA 3RLNA 4ZRZA 2JJQA 2LFNA 4MTNA 2VUMH 3CHBD 1A3UA 3HOYG 3HGBA 1YNJC 3TP6A 3NBHB 3HKZG 3GTPH 4BXXG 2E5LL 1A3VA 3G4SA 1L1OC 5C5LA 2R92B 1EU4A 2EVBA 4N9TA 3UE1A 3MXPA 1BBUA 1TKWB 3FDTA 1X3FA 2K7VA 3TS0A 2OQKA 1MD2D 1VS0A 2NZHA 4NXNQ 2B8GA 3IFDA 1I4PA 4YY3Q 2J0TD 1SROA 4DA2A 3NEMA 3KJOA 5I2YA 1VQCA 1H95A 2CKZB 4AQYQ 2K05A 4DK3C 3OMGA 2WV6D 3EIVA 3RZOH 3GTPB 1GXDC 4BS9A 5BN4A 4DV2L 1SJED 3J7AF 4NXNL 4P2CB 2F1MA 3EQLC 1NJIC 4V190 3NK9A 5M9OA 3AMUA 3C2PA 3P7JA 5KYLA 1H9SA 3FVQA 1JCKB 1TU2B 3GTQB 2GA4B 1T9HA 5FLXL 1G291 4AQYL 2PCFB 5EPJA 5CV5A 4JBKA 4YCUA 4K14A 1B2TA 5EKIA 1A8VA 1UUPA 5I6YA 2E75C 2IHEA 3A5ZB 2WP8J 4LMQD 5EPKA 2F3IA 3J80c 3J81E 5IGEA 1S5DD 4ZAIA 1IYJB 3RZOB 1BCPB 1KTKA 2EY2A 3P1HA 5AJ3Q 3RN5A 1WTXA 2EOTA 3JAME 2JA6G 3PCOB 5EBCA 3UDFA 4S3SA 2ENBA 1VQFA 3KF6B 1JOQA 1UE6A 1SAPA 3AYHB 3CCQA 4DKAC 1XMQQ 1HZCA 1KNEA 1EY7A 1B50A 2AUKA 1TWFH 3TQYA 3CXCA 2YTVA 1EIHA 2OEOA 3HOYH 3S17H 3BVMA 3EBEA 2A69C 2AQ3B 4BXXH 1HJPA 1SMYD 2AQ1B 5I2XA 1AFPA 5DM73 1K73C 5AJ3L 4Q0FA 3CU7A 1D1KA 2A8VA 2L12A 1L2FA 4A3JG 3S16H 5C3EG 1KAAA 1Z47A 3A55A 1B3QA 4O2DA 2LS01 4PMCA 2UXDQ 2Z0SA 3H91A 3S2HB 3FMCA 5ELEA 4ODGA 1U9RA 1E24A 1PV4A 2OTJA 4GN3B 1C0AA 4G7ZC 1EYAA 2F3WA 1VQOA 1TWAH 1TS2A 2NZOA 3BJUA 5IT9E 1Y8OB 2NB0A 1DM0B 3M85A 1TWFB 5C0XH 2D0OA 4ZKBB 1VQLA 1EY0A 2HQEA 3DUZA 2BE5D 3HOYB 3S17B 1X3EA 3NQTA 2B63G 1QUQA 3L2PA 3HKZB 2JP1A 2UXDL 4R4CA 1PZJD 4DV0Q 4HEDA 5D65A 1F9SA 1L0YB 1QNKA 2F0WA 2F0UA 2QW7A 3WDNA 3QG1A 4KJOA 3TRZA 3PO3H 2IY5B 2FJ2A 3S16B 1Q90A 3DWAA 1EEID 2EJGC 3HS0C 1ICWA 3LWUA 2YTYA 3T51B 1YZ6A 1EIYB 2O4XA 3PUZA 4ID6A
chains in the Genus database with same CATH topology
1TWAB 4JK1C 5J22A 5CC4A 3R93A 1PRTC 3VYRA 5E4XA 4ILWA 2A5HA 3K5LA 1KNAA 1G2TA 2BDOA 2K1BA 2MJ8A 1D6EC 3PO3B 1QWYA 3I90A 4RGOS 3SDZA 4TKOB 3R8BA 3TP5A 4H0LC 5BN3A 2FHTA 3WOFA 2IWHA 1HA6A 3VYSA 3HP3A 3MWYW 5CORA 2K5DA 1B9NA 2EYFA 1PTOD 4G7OC 1ET6A 2J7ZA 1EY6A 2JA6B 3KK7A 1PDQA 4RH6A 4RGNA 5D3DA 1ILPA 1A2TA 5BN5A 3D4RA 4HCSA 5HGTA 1QJOA 1EU3A 1TS4A 1A2UA 4QIWB 2NN6H 4NDXA 4QUCA 1TY0A 2MPMA 3GV6A 2FFKB 1T5EA 3VA7A 2R61A 4HAEA 4A3JB 2O2LD 5C3EB 3CRKC 1Q1EA 1EYCA 4K5WA 3S1QB 1SSOA 3EVQA 2KECA 4FVMA 3X3MA 1EEFD 1PYWD 1M8AA 2KCCA 1HFGA 1TVXA 3J7AV 5COYA 1MI2A 2EDGA 1AZPA 2D5DA 2SOBA 2Z8LA 3T56B 4QMGA 2B63B 1TY2A 4BA1I 2RDFA 4QF4A 1LTGD 3NBHA 4R9WA 3K0YA 1SNOA 1DONA 2CQAA 2L55A 2F0NA 1BDOA 4DN4M 1QG7A 3GTJB 2AWNA 4O1NA 5AFWA 4BY1B 1GHKA 4FNFA 1WTWA 4WJWA 1KDAA 1JE4A 2F0FA 3TZDA 3VYUA 1TWCB 1STBA 4RA8A 1J8IA 3S15B 3CRLC 1EZ8A 3RZDB 1TR5A 3VR3A 3IKJA 2F0DA 5I4DA 1B9MA 2FMCA 1LABA 3IL8A 3GV3A 2EE1A 1LT6D 3PUWA 3BG3A 1QOHA 1F77A 5LL6S 2A68D 5I9OA 4BWGB 1JWSD 1H9KA 4KKSA 1B53A 4L63B 2EYOA 2G9DA 4F88A 4J6HA 2EYHA 3KLRA 2V4DA 1YNND 2Q8TA 3S9WA 4ULLA 2DN8A 4IUUA 1LLRD 4HSVA 3CKIB 1BCPC 1HCZA 3T13A 1I6VC 5FO7B 3J7YW 1X3QA 3S14B 4L8JA 1RCVD 3NHHA 5IGFA 3HOWB 3Q6SA 1LTBD 4U68A 3TDQA 3EJIA 1O7ZA 2RBMA 1OO9B 3EROA 4XT1B 4XT3B 5CV7A 3I72A 1AEXA 2EY1A 3MEHA 1ZXTA 3K7AB 3ONAB 4G4KA 4PMWA 2OT2A 1EFID 1JOOA 2ZT9C 1DZ1A 1RTNA 1PXUA 4WFN3 4PNYA 5IT9L 3ZYYX 5C4JB 2JA7B 2JXMB 3S2DB 5M3MB 4RFBA 3EA6A 4BBRB 1OXXK 1H9JA 1NSNS 5G3LF 1PTOB 1CFMA 4DK0A 2TSSA 3PIO3 4EVOA 2BA0A 4IN3A 1F9QA 3PUVA 4EGVA 4BY7B 2Q8RE 3EFXD 4TQUS 4B9WA 1I4GA 4IUTA 4IUVA 2R6GA 4IUPA 1DJRD 2KEEA 5CGKA 2E74C 3LWEA 1V1PB 4R8NA 5DAUA 1NCVA 3HOVB 1WD1A 4J1MA 1RD9D 1F9PA 4K8IA 4DK1A 1R4QB 1BNZA 1PZKD 1RKNA 2K33A 2QEJC 1XTCD 2RQXA 4CKBA 1S4ZA 1XX8A 2O5JC 4ZQ3A 1JB3A 4UAIA 4DU9A 1SJHD 3QO2A 2B2WC 5C3XA 1BR9A 4FF3A 1TQOA 3VR4A 4LJZC 4U673 1VDZA 1HUNA 1RTOA 5EKLA 1PFBA 3BDOA 4RGTA 2PQEA 4L6TB 1DOKA 1Y8NB 2NTSA 2QKIC 3NTIA 4KN7C 1I6HB 1FNVA 2B2UA 4OGQC 5K36G 2NWGA 1X3PA 4RHRA 2BA1A 1SE4A 1SYFA 2HCIA 3AU7A 2KCNA 2XWJB 3S1MB 1NR4A 3OIPA 3O13A 4FP5D 2SNMA 3D6WA 2KHSA 2XRSD 1HTPA 2N55A 1VF7A 3H09A 1KLUD 3H94A 1WTRA 2R93B 5JAVA 1YNJD 4MHEA 1SXTA 2Z4HA 5C0XG 1HUMA 4A3EB 1QB5D 1LTSD 3R2TA 3HRZC 1AN8A 1LT3D 2NZ1D 4V0BA 4RKBA 3NBIA 3NUCA 1HQRD 2C9OA 2E2HB 3HOZB 2WINB 1CTMA 1ZKOA 4F8MA 4EQOA 2QF7A 1G2SA 3URYA 2F4IA 2KOLA 2E2DC 2EZVA 4OO1G 2RA4A 3D31A 3KBXA 1S5FD 4IUNA 1U4LA 2M00A 2RKSA 3C3LA 3MHBA 2A6ED 4DAYA 1PMRA 3VA5A 4K6LA 3FPPA 4H7BA 1SNCA 3HOXB 3OMCA 3DWQA 5K36H 2CHBD 5IODA 3Q0AA 3P75A 1TWHB 4RKLA 3OOCA 5DM63 2CW0D 4DXGA 2QILA 3Q24A 4A3GB 1OXUA 4YIJA 4XQJA 5C0XI 2LMCB 2K01A 4RHSA 2DY8A 4QUFA 4DF7A 1O7YA 4FXDA 2IJ0A 2NVQB 4NKLA 4PMBA 1XWEA 1IYVA 2A69D 3SR1A 2BE5C 3N52A 2NN6G 4MN3A 3FEWX 5C44B 2PYKA 4WRDA 2K28A 1NR2A 1Q12A 3PO2B 4X3UA 2EYJA 4OO1I 4RCOA 5I6WA 1F2LA 4LK1C 4DNTB 3A8KE 4NP5A 5JPMC 1RJTA 2E2JB 3HEJA 1OXVA 1ILQA 1CA6A 3KUPA 2K5WA 4Z9CB 5JEAG 3ERQA 4OO1H 2F0LA 1W6JA 3MXGA 3NQIA 2KUMA 2JA5B 1EQTA 1SE2A 3NTKA 3NE5B 4CJ1B 3D4WA 3VR6A 1FGBD 3K59A 5KNDA 1PRTD 1LTRD 1F9RA 2F0JA 1DXMA 2BDNA 4O42A 1PTOC 4ZKCB 1LACA 1MGSA 4XXEA 3GTOB 2NN6I 5IIFA 1V1PA 5HURA 1G91A 1WCMB 2Z1CA 5M3FB 3GTLB 3M7NA 5C3WA 1HQMC 5ELDA 1AW7A 3KF8A 5J39A 1ONLA 3KLSX 4WORA 1IHZA 3TBIB 3PIP3 1G8ZD 2KVMA 2F0OA 4A3IB 3OW7A 1H9MA 3DHQA 5E4WC 3K5MA 2F0IA 1S5BD 4C2MB 2M2LA 1ENFA 1PFMA 3I4LA 4DAPA 4A3MB 1B4OA 4I7ZC 3RD4A 1STAA 3M7GA 4UDUC 1BF4A 1R4PB 3MXUA 3K57A 1GUWA 5EJWA 3OIQA 4GZYC 3BDLA 1EZ6A 1IYUA 5C4XB 1SNMA 4XDXA 4IALA 2PNRC 5JEAH 1F2MA 1CHQD 1UNSA 1XXGA 1X32A 5FO9B 4HR7B 2L0CA 2J4XA 1Y1WB 2A6HD 3I91A 4ZLTF 1K83B 2PZWA 2MGSA 4K8JA 4KJNA 3ITPA 2YU9B 1PTOF 2PO4A 4KV6A 2DNEA 2FINB 3FPUB 5DEHA 3A56A 1KABA 5C0XJ 1L0XB 2Q8IB 1CT1D 2NTTA 2JYOA 3UI2A 1WTVA 3A8JE 4IZ8A 1CM9A 1RHPA 2L4NA 3K5NA 5EGTA 1ZYRC 4Y7NB 1TIID 3BZDB 2TMPA 2JA8B 1SNPA 5KNBA 3IAYA 5M5XB 4FF2A 1XYIA 4FXKC 2JEAI 1SFOB 3R3OA 1EWCA 3S1NB 3ND9A 1K8MA 1T5XD 1PZID 4B9XA 4Q5VA 4KD3A 2IL8A 5A35A 1QNUA 5A2QE 2A68C 2F0VA 3NPPA 1Q1BA 5EQ0A 3SK4A 1E2WA 1WVLA 4KY7A 1E2VA 1GUNA 1PLFA 2FMMA 2LKVA 4G57A 5M5WB 3MZ5A 4I65A 1YNNC 2KQ3A 4KI0A 2DY7A 4IQZA 1ESRA 4XTCS 3SE0A 3J81L 2HDMA 2EY5A 3JAML 1QILA 5CR3A 3DWPA 2PZTA 2B39A 2KJXA 3L3OC 3HOUB 3SK6A 4CJ2C 1ET9A 3FKIB 2HUGA 5C4HA 3MFGA 1DOLA 1I4QA 1PTOH 1JQYD 5E1FA 2OXPA 2IX3A 5K5PA 1STHA 3D3RA 2XVSA 3DXJC 4A3DB 1EL0A 2ICEC 2NUCA 1OXTA 1IW7C 1BCPD 4K5XA 3NTHA 5FO8B 3J80E 4CKCA 2XRQD 3DEPA 2C5CA 4C3HG 2EYPA 2PW5A 4K2LA 3SVMA 1EYDA 2Z4IA 4DNRB 3GQBA 3GTKB 4QCLA 1VCIA 5CV9A 2XN9C 5FKAC 2SNSA 1HXYD 2MHVA 3MFYA 2IT1A 3OWFA 2DNCA 1HTLD 2R7ZB 2IX1A 1ML0D 4J8QA 1ENCA 1HA5A 3VR2A 4QB4A 2B2TA 1HPCA 4RGMA 3QOJA 3L7ZC 1LTTD 4IFDG 3U9SA 1JWUD 4A3KB 3BVZA 4DFAA 4C3IG 1RF2D 3T4AC 2VNUD 4PV1C 5JOBA 1MSGA 3NSWA 3NXWA 2B2TC 5E3FA 4K2KA 4FO2A 4C1NI 3A54A 3E6ZX 1D5MC 3TSSA 1CZGA 3I4MB 4XIGS 2B8FA 5C5MA 4IURA 5IGBA 1V8QA 4A93B 2LY7A 3OWEB 1R9TB 1HFNA 3C1FA 5EKKA 2RSNA 5KNCA 3L9AX 3QOLA 1GJXA 2IX0A 3BYTB 2RDHA 2IPKD 2NBFA 3G6JB 3NWSA 1Z7TA 1NAPA 1GOZA 3KLSA 1Y1VB 1H9RA 2SDFA 2L11A 1KDCA 3KBGA 5ISRA 3GD7A 3Q22A 3A7LA 5NUCA 4FXGC 1I4XA 2K5QA 1EWHA 3I73A 4IFDI 2SEBD 4KY5A 4KHVA 1F2YA 1U4PA 1IKMA 2B2UC 1A15A 3BDCA 4RCNA 5D14A 2F0EA 3E5SA 4OHJA 1Y69U 1SYGA 1FD7D 1G6ZA 4IFDH 4X3KA 2PW7A 5KIXA 4C3HB 5J1ZA 2EY6A 1DD2A 1SYEA 3ND8A 4A3BB 1FR3A 4BA2I 5CBEE 3MVVA 2EXZA 5T1GA 4R8IA 4KMUC 3LX0A 4FF4A 5C6AA 1JR0D 1SDFA 2VUMB 3OHXC 5KYIA 4LAAA 5CV4A 1CI3M 1STYA 4C3IB 1FNUA 2XSCA 1IL8A 1Z6HA 3HZXA 1V43A 1RDPD 1KDBA 4N9PA 3RUZA 2B2VA 2A6EC 3D8GA 1LT5D 1TS3A 5IOCA 2AWOA 2RDGA 4C3JG 1E2ZA 3H0GB 3DM1A 1QE6A 3M3YB 3SXHA 1ZEQX 3I70A 5ELCA 1JC7A 1UAPA 4F7XA 1SMYC 2B2VC 1Q3LA 2NYZD 2CW0C 3E0JA 5C4ZA 1CQFA 3GTMB 2BOSA 2I07B 4TSSA 5A2QL 2D2CC 2A73B 3Q23A 1A3TA 1K8OA 3DEOA 1AZQA 1AP0A 5CMDA 2O5IC 2RVLA 3MTSA 1VF5C 3H6MA 3X3NA 1B1ZA 1TS5A 4OIJA 1SNDA 2G9HD 1EY8A 2PPBC 1BBXC 4HTHA 2EJFC 1SEBD 2JE6I 3BS1A 1EY9A 3V2TA 4CJ0B 1DCZA 5JJZA 3DMUA 3C1EA 5KEEA 2QCPX 4H44C 4KKUA 2L9HA 3PV0A 4EQNA 1I50B 3QWNA 1MBYA 2EYMA 2EPBA 2QDBA 3G7LA 1WTOA 1M4VA 1STNA 3T53B 3MC0B 2F0SA 2BCOA 4G7HC 2F0HA 1F2ZA 1UEAB 3J80L 1RODA 2MUYA 4OIKA 1SNQA 1I4HA 2XIWA 3LNNA 3TP7A 1S5ED 1EOTA 1FNWA 4CBVA 4IFDJ 2X69A 1E0BA 5JVG3 4M1UB 2F0MA 3C46A 2WKDA 3BYYB 1KLGD 2K6AA 4TRDA 2AQ2B 3H3VC 2XNAC 3W3AA 1S5CD 4OL7A 4KHZA 1LT4D 1STEA 1DOMA 2PZUA 1Y8PB 3WOEA 2IW3A 4K6DA 2B2YA 4X3SA 2H4OA 1II3A 4C3JB 5TSSA 3M4YA 2WACA 4NMZA 1O7LA 1SYBA 2H1EA 1GUGA 1MSHA 2NVXB 4K5VA 1C4QA 2MP1A 3R2IA 4HMIA 1D1IA 5D3IB 5DNFA 1TWGB 2B2YC 1QCBD 1D2BA 4KK7A 4KTAA 4ZK9B 3NP8A 2ZXOA 3N6RA 4CGYB 1BOSA 2F3VA 3MA2B 3GO5A 5KRUA 4XQNA 1GUSA 2NVTB 1ESFA 1EQVA 5FK9C 5FOBB 3QJYA 2K04A 1LTAD 3D6CA 5ELFA 2YYZA 4RAUC 5KGUA 5LL6X 2A6HC 2F0TA 2K32A 4XYOA 1I3QB 1PRTF 2Y0SB 1VMCA 2ICIA 1O80A 3A7AB 1JORA 1FYCA 1SE3A 3OSOA 1DYQA 2VB2X 3P20A 1WTQA 2F0QA 4KN4C 5M5YB 1WD0A 3I3CA 1JICA 5JVH3 4HCEA 3SK5A 3QB3A 5IGGA 3K5OA 5T1IA 1EY4A 1BUVT 5IGCA 3RMHA 1I4RA 5FLXE 3GP7A 4X3TA 4XYQA 1D5XC 5EPLA 2L5TA 4A3FB 5ELBA 1LV9A 2OF1A 1H9SB 1PFNA 1CA5A 3VYTA 1SYDA 5CBAE 5IGDA 1LTID 2E2IB 5CYUA 4DAVA 1OXSC 1BQQT 2EJMA 1ZYRD 4XQQA 4IUQA 2HCCA 1HHVA 1JWMD 4RWSC 1B44D 3FRPB 5EBDA 3GTGB 1O78A 4ME5A 4C1NK 5CV8A 3TMEA 2HDLA 1CK1A 4C56C 3SEBA 3PUYA 4BBSB 2RSOA 2M9VA 5G3LD 1GUOA 3W2DA 2D9UA 1EY5A 1ENAA 1STGA 1C8CA 1EIGA 4ZUIA 2F0PA 4FF1A 3T16A 2KEDA 2WKCA 1W6KA 1WTPA 1BXTA 2AUJD 2WIIB 4JBWA 3MAQA 4PQXA 3CQZB 2K03A 4HN7A 3V96A 2NVYB 5F2DA 2A74C 1SYCA 1Q8IA 1BO0A 4MIUA 2WB1B 3SHLA 3I8ZA 5LHY1 3IFTA 1PRTB 5CV6A 4HMJA 2VXWA 3BVGA 2F0KA 1C48A 4DXFA 3TN2A 3RLFA 4E6IA 4H13C 3M4OB 1IW7D 3S1RB 5JEAJ 2F03A 5I9PA 1U4MA 4FYDA 1B3AA 2D62A 3AB9A 1CHPD 2KA7A 4DGZA 3PUXA 1D5ZC 4ABNA 1IKLA 3I4NB 2JSOA 2ZXPA 2N88A 1A6XA 3K58A 4CHTB 1V1OA 5JPNC 2I46A 1GHJA 2XWBB 2VB3X 4F87A 2X6LA 2ID0A 4AYBB 4KY6A 4HSPA 3U9OA 1JOKA 1CQVA 1LO5D 1GUTA 3A8IE 3PMFA 1CZWA 4KKTA 1BCPF 3VR5A 2WAQB 1HRJA 4M8AA 3OPOA 2B2WA 4ZUJA 2X6GA 2PMZB 2E76C 2JEBI 3K6OA 2F0GA 4B08A 3SK8A 3MXNA 1NUCA 3QIAA 3F2UA 1VMPA 4EQPA 3V05A 3TP8A 3NWTA 4ZYSA 2R3ZA 3HG9A 1SBBB 1J9OA 1U4RA 2CVRA 4CKEA 3TZUA 2L1BA 2EYLA 4KD4A 1TT2A 4NW2A 3D4DA 2ZXRA 4ZRZA 2LFNA 3CHBD 1A3UA 3HGBA 1YNJC 3TP6A 1A3VA 5C5LA 2R92B 1EU4A 2EVBA 4N9TA 3MXPA 1TKWB 3FDTA 2K7VA 1MD2D 2B8GA 3IFDA 1I4PA 2J0TD 4DA2A 5I2YA 2K05A 3OMGA 2WV6D 3GTPB 1GXDC 4BS9A 5BN4A 1SJED 3J7AF 4P2CB 2F1MA 3EQLC 4V190 3NK9A 5M9OA 3AMUA 3C2PA 3P7JA 5KYLA 1H9SA 3FVQA 1JCKB 1TU2B 3GTQB 2GA4B 5FLXL 1G291 2PCFB 5EPJA 5CV5A 4K14A 1B2TA 5EKIA 1UUPA 5I6YA 2E75C 2WP8J 4LMQD 5EPKA 3J81E 5IGEA 1S5DD 4ZAIA 3RZOB 1BCPB 1KTKA 2EY2A 3P1HA 1WTXA 2EOTA 3JAME 5EBCA 4S3SA 2ENBA 1JOQA 1SAPA 1KNEA 1EY7A 1B50A 2AUKA 1EIHA 2OEOA 3BVMA 2A69C 2AQ3B 1SMYD 2AQ1B 5I2XA 1AFPA 5DM73 4Q0FA 3CU7A 1D1KA 2L12A 1KAAA 1Z47A 3A55A 2LS01 4PMCA 3H91A 3S2HB 3FMCA 5ELEA 4ODGA 1U9RA 4G7ZC 1EYAA 2F3WA 1TS2A 5IT9E 1Y8OB 2NB0A 1DM0B 3M85A 1TWFB 5C0XH 4ZKBB 1EY0A 2HQEA 3DUZA 2BE5D 3HOYB 3S17B 3NQTA 3HKZB 2JP1A 1PZJD 4HEDA 5D65A 1F9SA 1L0YB 1QNKA 2F0WA 2F0UA 3WDNA 3QG1A 4KJOA 2FJ2A 3S16B 1Q90A 3DWAA 1EEID 2EJGC 3HS0C 1ICWA 3LWUA 3T51B 2O4XA 3PUZA 4ID6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CV5 A;  4R8N A;  4MIU A;  2EYH A;  4K14 A;  5DAU A;  4EQP A;  4K6D A;  5J22 A;  2PYK A;  3BDC A;  3DHQ A;  4J1M A;  3SHL A;  1ENC A;  1II3 A;  2F0E A;  2F0I A;  3E5S A;  4WRD A;  4RKB A;  1A3T A;  4B9X A;  5I6Y A;  4K8I A;  5CV6 A;  1SYG A;  2WAC A;  3NUC A;  4HMJ A;  4KD3 A;  2OF1 A;  2SOB A;  4NMZ A;  4QB4 A;  2F0K A;  4QMG A;  1SYD A;  1SYB A;  2F0V A;  5IGE A;  3QOJ A;  2PW7 A;  4K5V A;  3H6M A;  5KIX A;  3SK4 A;  2EYJ A;  2RDF A;  2EY2 A;  1RKN A;  1STA A;  3P1H A;  3T13 A;  4QF4 A;  5J1Z A;  2EY6 A;  4HMI A;  4E6I A;  5I6W A;  5IGD A;  4S3S A;  1SND A;  4DFA A;  4KY7 A;  2ENB A;  1EY8 A;  2EYL A;  1SYE A;  4NP5 A;  1JOQ A;  1SNO A;  4KD4 A;  1TT2 A;  2LKV A;  4G57 A;  4HTH A;  3BDL A;  3MZ5 A;  1EZ6 A;  4I65 A;  4F8M A;  2F0N A;  2KQ3 A;  4ZQ3 A;  4EQO A;  1EY9 A;  1EY7 A;  3HEJ A;  3MVV A;  3D4D A;  3NHH A;  5JOB A;  1SNM A;  4DU9 A;  4KTA A;  3NXW A;  5I9P A;  5IGF A;  3V2T A;  5C3X A;  2EXZ A;  4IAL A;  3TP5 A;  3EJI A;  3NP8 A;  1TQO A;  5E3F A;  1F2M A;  2RBM A;  2OEO A;  4K2K A;  3DMU A;  3C1E A;  3ERQ A;  3ERO A;  2EY5 A;  5KEE A;  2F0L A;  1A3U A;  5CV7 A;  4DGZ A;  3TP6 A;  1AEX A;  5CR3 A;  2F3V A;  2EY1 A;  4ME5 A;  5EKL A;  2PZT A;  5C5M A;  4EQN A;  1A3V A;  3MEH A;  5IGB A;  5KRU A;  2EYM A;  2M00 A;  4IUN A;  5C5L A;  1KDA A;  2PQE A;  2QDB A;  3LX0 A;  4ID6 A;  5CV8 A;  2RKS A;  3TME A;  2PZW A;  5C6A A;  3MHB A;  2EYF A;  2F0F A;  3SK6 A;  1KAA A;  4K8J A;  4KJN A;  3ITP A;  1STN A;  1JOO A;  1STB A;  3VA5 A;  5KYI A;  3D4W A;  1EQV A;  3C1F A;  4H7B A;  4N9T A;  3MXP A;  4PMC A;  1SNC A;  5C4H A;  1EY6 A;  4KV6 A;  5EKK A;  3OMC A;  4PNY A;  4LAA A;  4ODG A;  2F0S A;  1U9R A;  3D6C A;  1STY A;  5CV4 A;  5DEH A;  1EZ8 A;  5E1F A;  5IOD A;  1KAB A;  1TR5 A;  2OXP A;  3QOL A;  5K5P A;  1STH A;  3P75 A;  5KGU A;  3HZX A;  1EYA A;  2F0T A;  1SYF A;  2F3W A;  2F0D A;  4RKL A;  2F0H A;  1EY5 A;  4KY6 A;  1A2T A;  1ENA A;  1KDB A;  1STG A;  1JOK A;  2F0J A;  4N9P A;  3RUZ A;  3TP8 A;  3U9O A;  1NSN S;  5HGT A;  1F2Z A;  2NUC A;  3D8G A;  1JOR A;  1A2U A;  4ZUI A;  5IOC A;  2F0P A;  4K5X A;  5CC4 A;  3T16 A;  4IZ8 A;  4NDX A;  4EVO A;  3OSO A;  1EY0 A;  1SNQ A;  2HQE A;  2SNM A;  3PMF A;  3TP7 A;  3NQT A;  3OMG A;  4YIJ A;  5EGT A;  2KHS A;  5IIF A;  3SXH A;  2F0W A;  2F0Q A;  2F0U A;  5HUR A;  2EYP A;  2PW5 A;  3S9W A;  4DF7 A;  1KDC A;  4KJO A;  2F0M A;  4ZUJ A;  5C3W A;  1SNP A;  5ISR A;  4B9W A;  4F7X A;  4NKL A;  4K2L A;  4PMB A;  3NK9 A;  1EYD A;  3SK5 A;  1EYC A;  5M9O A;  4K5W A;  5NUC A;  3QB3 A;  5IGG A;  5J39 A;  5JAV A;  4TRD A;  5KYL A;  5I9O A;  2F0G A;  5C4Z A;  3R3O A;  3SR1 A;  3EVQ A;  1IHZ A;  4WOR A;  5CV9 A;  5F2D A;  3SK8 A;  1EY4 A;  4OL7 A;  4KY5 A;  2SNS A;  1SYC A;  5IGC A;  2EYO A;  2O4X A;  1F2Y A;  4KHV A;  5CGK A;  1NUC A;  2F0O A;  2PZU A;  4J6H A;  3OWF A; 
#chains in the Genus database with same CATH topology
 3E9I A;  4P74 A;  1TWA B;  4JK1 C;  1YBY A;  3ERS X;  4BY1 G;  2MNA A;  2GN5 A;  1DGS A;  5J22 A;  5CC4 A;  2XTI A;  3HKS A;  3E0E A;  5J3B A;  3R93 A;  1PRT C;  3VYR A;  1GD7 A;  4DV1 Q;  1VQ7 A;  4X6A H;  3W5O A;  1M1K C;  4JI5 L;  5E4X A;  4ILW A;  4LWC A;  2JA6 H;  3MEF A;  2A5H A;  3K5L A;  4OWW B;  1KNA A;  1G2T A;  2BDO A;  2K1B A;  2MJ8 A;  1D6E C;  3F1Z A;  3PO3 B;  1QWY A;  3I90 A;  1UWV A;  4RGO S;  3SDZ A;  2K5V A;  4JBM A;  1N33 Q;  4TKO B;  3R8B A;  3TP5 A;  4H0L C;  1YJN A;  5BN3 A;  2FHT A;  3ULP A;  3K81 C;  1N8R C;  5HY6 A;  3WOF A;  4DV7 Q;  4KLK A;  2IWH A;  4L5R C;  1HA6 A;  3VYS A;  3HP3 A;  3MXN B;  3MWY W;  2LXJ A;  5COR A;  2K5D A;  4JOI A;  2ASB A;  1B9N A;  4A3J H;  5IE8 A;  3NEN A;  5C3E H;  2EYF A;  1K9M C;  1PTO D;  2HD3 A;  1SR3 A;  3Q8D A;  1FJG Q;  4G7O C;  3S1Q H;  1ET6 A;  1HNX Q;  4IJH A;  4A4I A;  2J7Z A;  1EY6 A;  2JA6 B;  3KK7 A;  3PIP A;  1PDQ A;  4RH6 A;  4RGN A;  5D3D A;  4DV7 L;  1ILP A;  4JOI C;  2K75 A;  3AQQ A;  1A2T A;  5BN5 A;  3D4R A;  4HCS A;  4OWT B;  5HGT A;  1QJO A;  1EU3 A;  1TS4 A;  4IPH A;  1A2U A;  4QIW B;  2NN6 H;  5DLQ E;  4X62 L;  4UP8 A;  4NDX A;  4QUC A;  1TY0 A;  2B63 H;  1FJG L;  2MPM A;  3GV6 A;  2FFK B;  1T5E A;  3VA7 A;  2R61 A;  4HAE A;  4LF8 Q;  4A3J B;  5GRO A;  2O2L D;  5C3E B;  3CRK C;  2Q2T A;  1Q1E A;  1Y14 B;  1JJG A;  1EYC A;  2CH4 A;  4K5W A;  2V1C C;  3D0F A;  3S1Q B;  1SSO A;  3EVQ A;  2QDL A;  2K52 A;  2KEC A;  4FVM A;  3X3M A;  1PH9 A;  3GTJ H;  1EEF D;  1PYW D;  1M8A A;  2KCC A;  1EIF A;  4BY1 H;  4HJ7 A;  1HFG A;  1TVX A;  3J7A V;  1BBW A;  2XGT A;  5COY A;  1MI2 A;  2EDG A;  1AZP A;  1Q8K A;  4LF8 L;  1PYB A;  2F52 A;  3KYH C;  2D5D A;  1Q86 C;  2SOB A;  1TWC H;  2Z8L A;  3T56 B;  4QMG A;  2B63 B;  1TY2 A;  4RMF A;  4BA1 I;  2RDF A;  1HZB A;  4AH6 A;  3S15 H;  4QF4 A;  1LTG D;  3NBH A;  4R9W A;  4HJ5 A;  3K0Y A;  3RZD H;  1JJ2 A;  1SNO A;  1K8A C;  4N8X 1;  2HIX A;  1DON A;  2CQA A;  5M3M G;  2L55 A;  2F0N A;  3KLW A;  4JI8 Q;  1LM0 A;  1BDO A;  4OEL B;  4GLX A;  4DN4 M;  1EOV A;  1QG7 A;  3GTJ B;  2AWN A;  4O1N A;  5AFW A;  3G48 A;  4BY1 B;  1GHK A;  4FNF A;  1WTW A;  4WJW A;  3SGI A;  1KDA A;  4BY7 G;  4MZ9 A;  4X66 L;  3GDE A;  1JE4 A;  2F0F A;  3TZD A;  1LYL A;  3VYU A;  1TWC B;  1STB A;  4JI8 L;  3U58 A;  4RA8 A;  4HJA A;  3J7Z C;  1VQM A;  1J8I A;  3S15 B;  3CRL C;  1MJC A;  1EZ8 A;  3RZD B;  1TR5 A;  3VR3 A;  3IKJ A;  2QGQ A;  2F0D A;  5I4D A;  5JJK A;  3M4P A;  3HOV G;  2Z6K A;  1B9M A;  2WAQ G;  4A3C G;  2UXB Q;  1XMO Q;  1FVI A;  4R1J A;  1XNQ Q;  2FMC A;  2QA4 A;  1LAB A;  1YIJ A;  3ULL A;  3IL8 A;  3GV3 A;  1VQB A;  4GNX B;  1QVG A;  2EE1 A;  1LT6 D;  3PUW A;  1VQK A;  3BG3 A;  1QOH A;  1F77 A;  1VQ5 A;  3AFP A;  2Z6K C;  5LL6 S;  3S14 H;  2A68 D;  5I9O A;  5IY0 A;  1GM5 A;  1B70 B;  4BWG B;  2UXB L;  3JC6 6;  1ASY A;  1JWS D;  1H9K A;  4KKS A;  1K3B C;  1VQJ A;  1B53 A;  4L63 B;  1N36 Q;  2EYO A;  2G9D A;  2KHJ A;  5IYC G;  4F88 A;  2K5H A;  1IXR A;  4J6H A;  5IYD G;  2EYH A;  3KF6 A;  3KLR A;  2V4D A;  1YNN D;  2Q8T A;  3S9W A;  4ULL A;  3CC4 A;  5JJL A;  4GLA C;  2DN8 A;  4IUU A;  1LLR D;  4HSV A;  2K4K A;  1JJC B;  1HR0 W;  3CKI B;  1EUJ A;  1NMG A;  1BCP C;  1HCZ A;  3T13 A;  1I6V C;  5FO7 B;  5C4J H;  1W3S A;  3J7Y W;  4HIK A;  1N36 L;  4LF6 Q;  1X3Q A;  5M3M H;  2VY3 A;  3S14 B;  1KAW A;  4L8J A;  4BBR H;  1RCV D;  3NHH A;  5IGF A;  3HOW B;  3Q6S A;  1LTB D;  4U68 A;  3TDQ A;  3EJI A;  3K7U C;  1O7Z A;  1Q81 C;  2R92 G;  2RBM A;  1OO9 B;  3ERO A;  4GOP A;  4XT1 B;  4XT3 B;  5CV7 A;  3I72 A;  4UP7 A;  1AEX A;  2PNH A;  2EY1 A;  1PH1 A;  5IWA Q;  3MEH A;  4BY7 H;  1ZXT A;  3K7A B;  3ONA B;  1NTG A;  4G4K A;  1VQ9 A;  4PMW A;  2OT2 A;  4LF6 L;  1EFI D;  1JOO A;  2ZT9 C;  1DZ1 A;  1HR0 Q;  1RTN A;  1PXU A;  4LUO A;  4WFN 3;  4PNY A;  5IT9 L;  3ZYY X;  5C4J B;  2JA7 B;  2JXM B;  3S2D B;  5M3M B;  4A3E G;  4RFB A;  3EA6 A;  4IPD A;  3HOV H;  4A3C H;  4BBR B;  1OXX K;  1H9J A;  1NSN S;  1K0R A;  5G3L F;  1PTO B;  1CFM A;  4DK0 A;  2TSS A;  3PIO 3;  4EVO A;  2BA0 A;  4JI0 Q;  1SE8 A;  1KC8 C;  1G6P A;  4IN3 A;  3HOZ G;  1F9Q A;  3U4Z A;  2KBN A;  3PUV A;  4EGV A;  4BY7 B;  2Q8R E;  3EFX D;  4TQU S;  4X65 Q;  4B9W A;  2PI2 E;  1EQR A;  3AFQ A;  1I4G A;  1YHA A;  4IUT A;  4IUV A;  2R6G A;  4IUP A;  1XPU A;  1DJR D;  1SMX A;  2KEE A;  4UPA A;  5IYC H;  4JI7 L;  4GN5 A;  2RHQ B;  5IYD H;  2IHF A;  5CGK A;  2E74 C;  3LWE A;  1NE3 A;  1PH8 A;  1V1P B;  1QVF A;  4R8N A;  1PFS A;  5DAU A;  1NCV A;  1YHB A;  3HOV B;  1WD1 A;  4J1M A;  1RD9 D;  2AKW B;  4NPS A;  1F9P A;  4K8I A;  3CP0 A;  3KF8 B;  4DK1 A;  1R4Q B;  2ZJQ A;  1X9N A;  1BNZ A;  1PZK D;  1I6H H;  1RKN A;  3HOX G;  2K33 A;  2QEJ C;  1XTC D;  2RQX A;  1V1Q A;  4CKB A;  1S4Z A;  2GVB A;  1XX8 A;  2O5J C;  4ZQ3 A;  1KRT A;  1JB3 A;  4UAI A;  4DU9 A;  1SJH D;  3QO2 A;  2B2W C;  4B3T Q;  1YJW A;  5C3X A;  1BR9 A;  4FF3 A;  1TQO A;  4IO9 A;  3VR4 A;  4LJZ C;  4A3G G;  4U67 3;  5FLX c;  1VDZ A;  2JN4 A;  1UE7 A;  1HUN A;  1RTO A;  5EKL A;  1PFB A;  3BDO A;  4LUV A;  4RGT A;  1X56 A;  2PQE A;  5IYB G;  4L6T B;  1DOK A;  1Y8N B;  2NTS A;  2QKI C;  1VQ4 A;  2R93 H;  3NTI A;  4JI2 L;  1KRS A;  1VQH A;  4KN7 C;  1I6H B;  1N32 L;  4B3T L;  1FNV A;  2B2U A;  4OGQ C;  1KIX A;  5K36 G;  2NWG A;  4JBJ A;  4LUZ A;  4OON A;  4A3E H;  1X3P A;  2BA1 A;  4RHR A;  1KXL A;  4QGU A;  1SE4 A;  3AU7 A;  1SYF A;  2HCI A;  3A74 A;  2MO0 A;  4DUY Q;  2XWJ B;  1U5K A;  2KCN A;  5C44 G;  1I94 Q;  3S1M B;  1NR4 A;  1MHW C;  3PF5 A;  3OIP A;  2UUB L;  3O13 A;  4LF5 Q;  3F8T A;  4FP5 D;  4DAM A;  2SNM A;  1UEB A;  4J15 A;  3D6W A;  2E2H H;  3HOZ H;  2KHS A;  2XRS D;  1HTP A;  3PO2 G;  3GTQ H;  2N55 A;  1VF7 A;  4X64 L;  4DV2 Q;  3H09 A;  1KLU D;  3H94 A;  1WTR A;  4JI1 L;  3FHW A;  2R93 B;  3EN2 A;  3ICE A;  1J6Q A;  4DUY L;  5JAV A;  1I94 L;  1YNJ D;  3CF5 A;  4MHE A;  1SXT A;  3RN2 A;  4LF5 L;  3AEV A;  2Z4H A;  5C0X G;  1HUM A;  4A3E B;  1QB5 D;  1LTS D;  3R2T A;  1K0S A;  3HRZ C;  1AN8 A;  1LT3 D;  2NZ1 D;  4V0B A;  3A5U A;  1W2B A;  2JA5 G;  4P71 A;  4RKB A;  3NBI A;  5FLM G;  3NUC A;  1HQR D;  2RCF A;  3PO3 G;  2C9O A;  2E2H B;  3HOZ B;  3HOX H;  2N49 A;  1O7I A;  2EIF A;  2UXC Q;  3DM3 A;  1TWH H;  2WIN B;  1CTM A;  1L0W A;  1ZKO A;  2JK8 A;  3STB D;  4F8M A;  4EQO A;  4A76 A;  2MFI A;  2QF7 A;  1G2S A;  3URY A;  2F4I A;  2KOL A;  2E2D C;  3W1G A;  5ELO A;  4A3G H;  4B3R L;  2EZV A;  1MKH A;  4OO1 G;  2RA4 A;  5GQO A;  3D31 A;  3KBX A;  1S5F D;  1P16 A;  2KHI A;  5IYB H;  4IUN A;  1U4L A;  2M00 A;  3S2H H;  2RKS A;  4IPG A;  3C3L A;  1WCM G;  3MHB A;  5M3F G;  2UXC L;  2NVQ H;  2A6E D;  4DAY A;  1PMR A;  3VA5 A;  4K6L A;  3FPP A;  4H7B A;  1SNC A;  3HOX B;  3OMC A;  2EQS A;  3DWQ A;  5K36 H;  4GNX A;  2CHB D;  5IOD A;  2LSS A;  3Q0A A;  3P75 A;  1TWH B;  3CCE A;  4RKL A;  4FDB A;  5C44 H;  3OOC A;  2Q2H A;  5DM6 3;  2CW0 D;  4DXG A;  1JT8 A;  2QIL A;  3Q24 A;  4A3G B;  1EWI A;  1OXU A;  4YIJ A;  1AE3 A;  3PO2 H;  4XQJ A;  4GNX C;  3CD6 A;  5C0X I;  4A3M G;  4OX9 L;  2LMC B;  2K01 A;  4GOP B;  4RHS A;  2DY8 A;  4QUF A;  4DF7 A;  1O7Y A;  4FXD A;  2IJ0 A;  2NVQ B;  3VDY A;  4NKL A;  3U50 C;  2RHS B;  4PMB A;  1XWE A;  2E2J H;  1IYV A;  2A69 D;  3PGZ A;  5C4X G;  3SR1 A;  2BE5 C;  3N52 A;  3UDX A;  2NN6 G;  4R4Q A;  4DV6 Q;  4MN3 A;  1PHJ A;  2VQF Q;  1PH2 A;  3FEW X;  1MIU A;  5C44 B;  4R4T A;  2ZJR A;  2JA5 H;  2PYK A;  3ULJ A;  2B29 A;  4WRD A;  5FLM H;  4LF4 L;  3CC7 A;  1RIP A;  2K28 A;  1NR2 A;  1Q12 A;  3PO2 B;  4JI5 Q;  4X3U A;  2EYJ A;  4OO1 I;  4RCO A;  2HT1 A;  5I6W A;  4WJ4 A;  1F2L A;  4LK1 C;  4DNT B;  3A8K E;  4NP5 A;  5JPM C;  4DV6 L;  2VQF L;  1RJT A;  2CH4 W;  3DLL A;  2E2J B;  3HEJ A;  3CMA A;  1OXV A;  4Y52 H;  1ILQ A;  1IBK L;  1CA6 A;  3KUP A;  2K5W A;  4Z9C B;  3KFU A;  2A1A A;  5JEA G;  3ERQ A;  4OO1 H;  2F0L A;  1YJ9 A;  1WFQ A;  1W6J A;  3MXG A;  3NQI A;  3GTO H;  2I5M X;  1Q82 C;  2EXD A;  2KUM A;  1JMC A;  2JA5 B;  4ME3 A;  1WCM H;  5M3F H;  1EQT A;  4IOC A;  2H5X A;  1SE2 A;  3NTK A;  2JA8 G;  3NE5 B;  4CJ1 B;  1S40 A;  3D4W A;  3VR6 A;  5GAD C;  1FGB D;  3K59 A;  1KQS A;  3T1H L;  5KND A;  2OTL A;  1WYD A;  1PRT D;  1LTR D;  1F9R A;  4HJ9 A;  2F0J A;  1DXM A;  2BDN A;  4O42 A;  1N34 L;  1PTO C;  4ZKC B;  2C35 B;  4X62 Q;  1RL2 A;  1LAC A;  1MGS A;  4XXE A;  4A3M H;  3GTO B;  2NN6 I;  5IIF A;  1V1P A;  5HUR A;  3QR8 A;  1G91 A;  1E1T A;  1WCM B;  2Z1C A;  3H15 A;  5M3F B;  3KDF B;  3GTL B;  3M7N A;  5C3W A;  4DV3 Q;  1HQM C;  5ELD A;  1AW7 A;  3KF8 A;  5J39 A;  1VQP A;  5C4X H;  1ONL A;  3KLS X;  1IBM L;  4WOR A;  1IHZ A;  3TBI B;  3CW2 C;  3PIP 3;  1G8Z D;  4LFA Q;  2KVM A;  4PZ6 A;  4EX5 A;  2F0O A;  2Y0S E;  2AHO B;  4L5Q A;  4A3I B;  3OW7 A;  1XNR L;  4QY7 A;  1H9M A;  3K8A A;  3DHQ A;  5E4W C;  3K5M A;  2F0I A;  1HNW L;  1S5B D;  4C2M B;  2M2L A;  3HOU G;  3UDI A;  4DK6 C;  4DV3 L;  1ENF A;  3CPF A;  1VQ8 A;  1PFM A;  2QEX A;  4I7A A;  2YU9 H;  3I4L A;  4DAP A;  4A3M B;  1B4O A;  4I7Z C;  1X3G A;  3RD4 A;  1SN8 A;  1STA A;  3M7G A;  4UDU C;  1BF4 A;  4LFA L;  1R4P B;  3HOW G;  3PQI A;  3MXU A;  2DJF C;  3K57 A;  4UP9 A;  4DR7 Q;  5EJW A;  1GUW A;  3OIQ A;  4GZY C;  3BDL A;  1EZ6 A;  1GVP A;  1IYU A;  5C4X B;  1SNM A;  4XDX A;  4IAL A;  2CQO A;  2PNR C;  2UUA Q;  5JEA H;  1F2M A;  1CHQ D;  1UNS A;  1NBW A;  1XXG A;  1X32 A;  5FO9 B;  4HR7 B;  2L0C A;  2J4X A;  4Y7N H;  1Y1W B;  2A6H D;  3I91 A;  4ZLT F;  1K83 B;  1E22 A;  3OW2 A;  2PZW A;  2JA8 H;  4HID A;  4R4O A;  4DR7 L;  4X66 Q;  5M5X H;  2MGS A;  4K8J A;  4KJN A;  3ITP A;  2JA7 G;  3J81 c;  4AIM A;  2YU9 B;  1SFO H;  1PTO F;  2PO4 A;  4KV6 A;  2DNE A;  3S1N H;  2FIN B;  3FPU B;  4BBR G;  1Z9F A;  2UUA L;  5DEH A;  1NMF A;  1FL0 A;  3A56 A;  1KAB A;  4ALP A;  5C0X J;  4LFB Q;  1L0X B;  2Q8I B;  2R7F A;  1CT1 D;  2NTT A;  4JC0 A;  2ATW A;  2R7Z G;  2JYO A;  3UI2 A;  1WTV A;  2OQ0 A;  3A8J E;  5ELN A;  4IZ8 A;  1S72 A;  1CM9 A;  1RHP A;  1M90 C;  2L4N A;  3K5N A;  5EGT A;  1ZYR C;  4Y7N B;  1TII D;  5E7N A;  2K14 A;  3IRB A;  3BZD B;  3A0J A;  3WWV A;  2TMP A;  2JA8 B;  1SNP A;  5KNB A;  4LFB L;  5M5W H;  3IAY A;  5GAH C;  5M5X B;  4FF2 A;  1XYI A;  3NEL A;  4FXK C;  2JEA I;  1CSQ A;  1SFO B;  1KL9 A;  3R3O A;  1EWC A;  4DAY B;  3S1N B;  4QJF A;  3ND9 A;  3CME A;  4YHH Q;  3CCR A;  4DR2 Q;  2ZM6 Q;  1K8M A;  5IT9 c;  4RG1 A;  1T5X D;  1PZI D;  3HOU H;  4B9X A;  5BR8 L;  4Q5V A;  4A93 G;  2K50 A;  4TVA B;  1CUK A;  2IL8 A;  4KD3 A;  1QNU A;  1CKN A;  2G5D A;  5A35 A;  5A2Q E;  2A68 C;  3I4O A;  2F0V A;  3FKI H;  3NPP A;  4JYA Q;  2ZTC A;  1Q1B A;  5EQ0 A;  3SK4 A;  2Q2U A;  3HOW H;  1E2W A;  1WVL A;  4KY7 A;  1E2V A;  1GUN A;  1PLF A;  4DR6 Q;  1WJJ A;  2FMM A;  4YHH L;  4DR2 L;  2LKV A;  4G57 A;  1X6O A;  2ZM6 L;  4A3D H;  5M5W B;  3MZ5 A;  4I65 A;  1YNN C;  2KQ3 A;  4KI0 A;  2DY7 A;  4IQZ A;  1ESR A;  2VQE L;  3K7A H;  4XTC S;  2BH2 A;  3SE0 A;  3J81 L;  2YV5 A;  2HDM A;  2EY5 A;  2WB1 E;  5HGQ A;  4JYA L;  3JAM L;  1QIL A;  5CR3 A;  3DWP A;  3J81 j;  2PZT A;  2B39 A;  2E8G A;  2KJX A;  3L3O C;  3HOU B;  4HIM A;  4DR6 L;  4LF9 L;  3SK6 A;  4CJ2 C;  4P75 A;  2JA7 H;  3S2D H;  4NB3 A;  4DR5 L;  1ET9 A;  3FKI B;  3T1Y Q;  2HUG A;  4ZCK A;  5C4H A;  3GTK H;  3H3V H;  3MFG A;  1DOL A;  1I4Q A;  1PTO H;  1JQY D;  5E1F A;  1E7Z A;  2OXP A;  2IX3 A;  5K5P A;  1STH A;  3D3R A;  2XVS A;  3DXJ C;  4A3D B;  1EL0 A;  3CCV A;  2R7Z H;  2HHH Q;  2FXQ A;  2ICE C;  2NUC A;  1OXT A;  1IW7 C;  1JE5 A;  1BCP D;  4K5X A;  1N9W A;  3NTH A;  4APV A;  5FO8 B;  3J80 E;  3T1Y L;  2K5N A;  4CKC A;  2XRQ D;  3DEP A;  3CC2 A;  4A3L G;  2C5C A;  2R93 G;  4C3H G;  4A3K H;  2EYP A;  2PW5 A;  4GOP C;  2RF4 A;  4K2L A;  3SVM A;  1EYD A;  2Z4I A;  4DNR B;  3GQB A;  2HHH L;  3GTK B;  4CDE C;  4DR4 L;  4QCL A;  4IOA A;  1VCI A;  2CWP A;  5CV9 A;  2XN9 C;  5FKA C;  1I5F A;  2SNS A;  3I7F A;  1HXY D;  3KOJ A;  4AYB E;  2MHV A;  3MFY A;  2IT1 A;  4JI7 Q;  3OWF A;  2DNC A;  1HTL D;  3I4M H;  4JW0 A;  2R7Z B;  3K80 C;  2IX1 A;  1ML0 D;  4A93 H;  4J8Q A;  1ENC A;  2A19 A;  1HA5 A;  4CDD C;  2JQO A;  3VR2 A;  1R9T H;  4QB4 A;  2B2T A;  2WAQ E;  1HPC A;  4B3S L;  4RGM A;  3QOJ A;  4B3M L;  3L7Z C;  1LTT D;  4IFD G;  3U9S A;  4N8F A;  1YNX A;  1KD1 C;  1JWU D;  4A3K B;  2PMZ E;  3BVZ A;  4DFA A;  4C3I G;  1CSP A;  1RF2 D;  3T4A C;  2VNU D;  3CAM A;  4PV1 C;  5JOB A;  1MSG A;  3NSW A;  3NXW A;  3F2C A;  2B2T C;  5E3F A;  4JI3 Q;  4K2K A;  4FO2 A;  4C1N I;  3A54 A;  3OTO Q;  1QVC A;  3E6Z X;  3H0G G;  1D5M C;  3TSS A;  1CZG A;  1Y1V H;  3I4M B;  4XIG S;  2B8F A;  4KHP Q;  5C5M A;  4IUR A;  5IGB A;  1KHI A;  4DUZ Q;  1B8A A;  1V8Q A;  4A93 B;  1PH4 A;  2LY7 A;  3OWE B;  5LMN W;  5LMU Q;  1R9T B;  1HFN A;  1VQD A;  3C1F A;  1YIT A;  3TRE A;  4JI2 Q;  5EKK A;  2RSN A;  3S1M H;  1N32 Q;  5KNC A;  4JVZ A;  1X55 A;  3L9A X;  4JI3 L;  3OTO L;  3QOL A;  1GJX A;  2MQH A;  2IX0 A;  4YCV A;  3KDF A;  1EQQ A;  2OCE A;  3BYT B;  2ZJP A;  4KHP L;  3PF4 A;  2RDH A;  2IPK D;  3G6E A;  4DUZ L;  2NBF A;  3G6J B;  2Q2I A;  3NWS A;  2KCM A;  1PH3 A;  4OEM B;  2UUB Q;  1Z7T A;  1NAP A;  5LMU L;  1GOZ A;  3KLS A;  5EAY A;  4NXM Q;  4A3L H;  4C3H H;  1Y1V B;  1H9R A;  2UUC Q;  2SDF A;  1XJV A;  2L11 A;  1KDC A;  3KBG A;  4DR1 Q;  4MNO A;  5ISR A;  4X64 Q;  3GD7 A;  3Q22 A;  3A7L A;  5NUC A;  4FXG C;  4JI1 Q;  1I4X A;  1BKB A;  2DJG C;  2K5Q A;  2UU9 Q;  1EWH A;  2WFW A;  3I73 A;  2LXK A;  4IFD I;  2SEB D;  4KY5 A;  3G71 A;  1L1O A;  4KHV A;  1F2Y A;  1EYG A;  4NXM L;  1U4P A;  1IKM A;  1AE2 A;  2B2U C;  2VL6 A;  4IJL A;  1A15 A;  3BDC A;  4RCN A;  2UUC L;  5D14 A;  2F0E A;  3E5S A;  4OHJ A;  4UHV A;  4DR1 L;  1Y69 U;  1SYG A;  5LMN L;  1FD7 D;  1G6Z A;  4IFD H;  4X3K A;  2PW7 A;  4GKK Q;  5KIX A;  4OWX B;  3W1B A;  2UU9 L;  4C3H B;  5J1Z A;  2EY6 A;  1DD2 A;  4C3I H;  4POG A;  4GKJ L;  1SYE A;  3ND8 A;  4A3B B;  1FR3 A;  4BA2 I;  3U4V A;  1X54 A;  5CBE E;  3MVV A;  4WJ3 M;  2EXZ A;  4DV4 Q;  3H0G H;  2Z9H A;  5T1G A;  4R8I A;  1HZ9 A;  4B3R Q;  4GKK L;  4KMU C;  3M3Y H;  4HJ8 A;  3LX0 A;  4FF4 A;  3E3X A;  4DPG A;  4CDC C;  5C6A A;  3STB C;  1JR0 D;  1SDF A;  2VUM B;  3OHX C;  5KYI A;  3UDG A;  1VQ6 A;  5IP7 G;  3GTM H;  1YVC A;  1CKN B;  1WTH A;  4LAA A;  5CV4 A;  4DV4 L;  1CI3 M;  1Q46 A;  1STY A;  4C3I B;  1FNU A;  4YY3 L;  2XSC A;  1IL8 A;  1Z6H A;  3HZX A;  1V43 A;  2RCN A;  1RDP D;  1KDB A;  4N9P A;  3RUZ A;  2B2V A;  1U0L A;  2A6E C;  3D8G A;  3KJP A;  1LT5 D;  1TS3 A;  5IOC A;  2AWO A;  2RDG A;  4YWL A;  4C3J G;  5GAE C;  1E2Z A;  3H0G B;  3DM1 A;  1QE6 A;  4YWM A;  4L5T A;  3J81 i;  2B3G A;  4QL5 A;  1Q7Y C;  3M3Y B;  3SXH A;  1ZEQ X;  3JAM i;  3I70 A;  5ELC A;  4OX9 Q;  1WOC A;  1JC7 A;  1EFW A;  1UAP A;  4F7X A;  1SMY C;  2B2V C;  1Q3L A;  2NYZ D;  2CW0 C;  3E0J A;  3CCJ A;  4A3I G;  5C4Z A;  1CQF A;  3GTM B;  4GN4 B;  1ASZ A;  2BOS A;  2I07 B;  4TSS A;  1I50 H;  2D0P A;  5A2Q L;  2D2C C;  2A73 B;  3Q23 A;  1A3T A;  1K8O A;  1VQE A;  4LF4 Q;  1AH9 A;  3DEO A;  1QZG A;  3HKZ E;  1AZQ A;  1AP0 A;  5CMD A;  2O5I C;  2RVL A;  3MTS A;  1VF5 C;  1YI2 A;  3H6M A;  3X3N A;  1B1Z A;  1TS5 A;  4OIJ A;  1SND A;  2G9H D;  1EY8 A;  2PPB C;  3TEH B;  1BBX C;  1XMQ L;  4HTH A;  1K3R A;  2EJF C;  1SEB D;  2JE6 I;  1C9O A;  3OYY A;  3BS1 A;  1VQI A;  1EY9 A;  1GO3 E;  2Y0S G;  3V2T A;  1Y1W G;  4CJ0 B;  1DCZ A;  1BVS A;  5JJZ A;  1IBK Q;  1C7Y A;  3DMU A;  3C1E A;  5KEE A;  2QCP X;  4H44 C;  3PSI A;  4KKU A;  2L9H A;  1TXY A;  1VQN A;  3PV0 A;  4EQN A;  1I50 B;  3QWN A;  1MBY A;  2EYM A;  2EPB A;  2QDB A;  3G7L A;  1WTO A;  3RNU A;  1J5E Q;  1M4V A;  3ER0 A;  1STN A;  3T53 B;  2R7D A;  5IP7 H;  3MC0 B;  5IP9 G;  3T1H Q;  1NNX A;  2PQA B;  2F0S A;  1S3O A;  2BCO A;  4JI6 Q;  4G7H C;  2F0H A;  4JI4 Q;  2AMC B;  1F2Z A;  1UEA B;  3J80 L;  1ROD A;  2MUY A;  4C3J H;  1N34 Q;  1J5E L;  4A3F G;  3GTL H;  4OIK A;  1SNQ A;  1I4H A;  2XIW A;  3LNN A;  3TP7 A;  1S5E D;  1EOT A;  1XTD A;  2NVX H;  1FNW A;  4DV0 L;  4CBV A;  4IFD J;  2X69 A;  1E0B A;  5JVG 3;  4M1U B;  1UE5 A;  2F0M A;  1TWG H;  3C46 A;  4JI6 L;  2WKD A;  4JI4 L;  4YWK A;  4A3I H;  3BYY B;  1KLG D;  2K6A A;  4TRD A;  2AQ2 B;  3LGJ A;  3H3V C;  2XNA C;  3W3A A;  1S5C D;  1IBM Q;  4C2M H;  4OL7 A;  4KHZ A;  1LT4 D;  3K0X A;  1K8G A;  1STE A;  1D8L A;  1DOM A;  2PZU A;  1Y8P B;  3CCS A;  3WOE A;  2IW3 A;  4POF A;  4K6D A;  4QIW E;  1XNR Q;  1P8L A;  2B2Y A;  4X3S A;  1IL2 A;  2H4O A;  1II3 A;  3M4Q A;  4DV1 L;  4P73 A;  4C3J B;  1HNW Q;  5TSS A;  3M4Y A;  2WAC A;  4NMZ A;  2NVT H;  1SLJ A;  3B6Y A;  1O7L A;  1SYB A;  2H1E A;  1GUG A;  1MSH A;  2NVX B;  4K5V A;  1C4Q A;  2MP1 A;  3R2I A;  4HMI A;  1D1I A;  5D3I B;  4BBS G;  5DNF A;  1TWG B;  2B2Y C;  1QCB D;  1IZ6 A;  1I3Q H;  1D2B A;  1N33 L;  1Y1W H;  4KK7 A;  2VS1 A;  4KTA A;  4ZK9 B;  2PI2 A;  1K83 H;  3NP8 A;  2ZXO A;  3N6R A;  1OTC A;  4OXP A;  2ZTE A;  4CGY B;  1BOS A;  2F3V A;  3FKI G;  3MA2 B;  3BZC A;  3GO5 A;  5KRU A;  5M5Y H;  1L1O B;  4XQN A;  1A62 A;  4UY8 C;  1GUS A;  2NVT B;  1HNX L;  1ESF A;  2KCT A;  4A3D G;  1EQV A;  5FK9 C;  5IP9 H;  5FOB B;  3QJY A;  2K04 A;  1LTA D;  3D6C A;  4JPB W;  5ELF A;  4HIO A;  2YYZ A;  1LUZ A;  4RAU C;  5KGU A;  3E9H A;  5LL6 X;  2A6H C;  2F0T A;  2K32 A;  4XYO A;  1I3Q B;  1WI5 A;  2WB1 G;  1PRT F;  2Y0S B;  1VMC A;  2ICI A;  1O80 A;  3A7A B;  1JOR A;  4A3F H;  1FYC A;  1SE3 A;  4L5S A;  2CCZ A;  4IPC A;  3TS2 A;  3OSO A;  1DYQ A;  4GLV B;  2VB2 X;  5FJ8 G;  3P20 A;  1XPR A;  3HFZ B;  1K28 A;  4K0K Q;  4YCW A;  1WTQ A;  2F0Q A;  4KN4 C;  4P72 A;  5M5Y B;  2E2I H;  1WD0 A;  3JAM c;  3I3C A;  1JIC A;  3I2Z A;  2OWO A;  5JVH 3;  4HCE A;  3SK5 A;  3QB3 A;  5IGG A;  4PG3 A;  3K5O A;  5T1I A;  1EY4 A;  1BUV T;  5IGC A;  1IBL Q;  4R4I A;  3RMH A;  1I4R A;  3GTG H;  5FLX E;  3GP7 A;  4X3T A;  2JA9 A;  1HNZ Q;  4K0K L;  4XYQ A;  2F4V Q;  1D5X C;  2HIV A;  5EPL A;  2L5T A;  3I4N G;  4A3F B;  5ELB A;  2DGY A;  1A0I A;  1LV9 A;  4A3K G;  4PZ7 A;  5BR8 Q;  2OF1 A;  1H9S B;  1PFN A;  1CA5 A;  2ES2 A;  1ICF B;  3VYT A;  1SYD A;  1LTL A;  5CBA E;  4BBS H;  1D7Q A;  5IGD A;  2GVA A;  1LTI D;  2E2I B;  1IBL L;  5CYU A;  2VZA A;  4DAV A;  1OXS C;  1VQG A;  1HNZ L;  4AYB G;  1BQQ T;  3I56 A;  2F4V L;  3CPW A;  2EJM A;  3I4M G;  1ZYR D;  4XQQ A;  4IUQ A;  2HCC A;  1HHV A;  1JWM D;  1HH2 P;  4RWS C;  2VQE Q;  4MTK A;  1B44 D;  3FRP B;  5EBD A;  2N78 A;  1PH5 A;  3GTG B;  1O78 A;  1B7Y B;  1G51 A;  4ME5 A;  4CDF C;  5H1S E;  2I0Q A;  4C1N K;  5CV8 A;  3TME A;  2HDL A;  1CK1 A;  2MO1 A;  4LF9 Q;  3CQZ H;  4JCV E;  4C56 C;  4QQB X;  4DR5 Q;  3SEB A;  4A75 A;  2I5H A;  3PUY A;  1PYS B;  2NVY H;  4BBS B;  3F2B A;  5L37 A;  2RSO A;  2M9V A;  4LF7 Q;  2ALY B;  1JB7 A;  3H3V I;  5G3L D;  1GUO A;  3W2D A;  2D9U A;  1EY5 A;  3FP9 A;  2KEN A;  1ENA A;  1STG A;  2ZTD A;  1XMO L;  1C8C A;  4JG2 A;  1Y1V G;  1EIG A;  4ZUI A;  1XNQ L;  2F0P A;  4FF1 A;  3T16 A;  2KED A;  4GS3 A;  5FJ8 H;  2WKC A;  1W6K A;  1WTP A;  4O0A A;  3J7A 5;  1BXT A;  2AUJ D;  2WII B;  4JV5 Q;  1MJE A;  4LNQ A;  4JBW A;  4H02 A;  3MAQ A;  3M4O H;  4LF7 L;  4PQX A;  3S1R H;  1PH6 A;  3CQZ B;  2K03 A;  1X65 A;  4HN7 A;  4DNI A;  3L0O A;  3V96 A;  2YTX A;  2NVY B;  5F2D A;  4DR4 Q;  1QUQ B;  2A74 C;  1SYC A;  3S24 A;  3RR5 A;  1BO0 A;  1Q8I A;  1VQA A;  4MIU A;  2WB1 B;  1YHQ A;  1UE1 A;  4JV5 L;  3I4N H;  3SHL A;  3I8Z A;  5LHY 1;  3IFT A;  1PRT B;  5CV6 A;  4HMJ A;  3J80 i;  1XPO A;  2VXW A;  3BVG A;  2F0K A;  2L15 A;  3ZJY C;  4A3B G;  1C48 A;  4B3S Q;  4B3M Q;  4DXF A;  3TN2 A;  3RLF A;  4E6I A;  4H13 C;  2N8N A;  2CFM A;  3M4O B;  1IW7 D;  3S1R B;  5JEA J;  2F03 A;  4EQ5 A;  5I9P A;  4DR3 Q;  1U4M A;  3I55 A;  4FYD A;  1B3A A;  1YEZ A;  2D62 A;  3AB9 A;  3PIO A;  1CHP D;  1V9P A;  2PQA A;  2VUM G;  2KA7 A;  4DGZ A;  3PUX A;  1D5Z C;  5IWA L;  4ABN A;  1IKL A;  3I4N B;  3RLO A;  5JJI A;  2JSO A;  2ZXP A;  2HQL A;  2N88 A;  1A6X A;  1PA6 A;  1E1O A;  3K58 A;  1HR0 L;  4CHT B;  1A63 A;  1PH7 A;  4DR3 L;  1V1O A;  5JPN C;  2I46 A;  1GHJ A;  1CKM A;  2Z6B A;  2XWB B;  2VB3 X;  4F87 A;  2X6L A;  2I5L X;  2ID0 A;  4AYB B;  4KY6 A;  4HSP A;  3U9O A;  1JOK A;  4DV5 Q;  1CQV A;  1LO5 D;  2N3S A;  4JI0 L;  2DUD A;  1GUT A;  1SRU A;  3A8I E;  3PMF A;  3BU2 A;  1CZW A;  4KKT A;  4LFC Q;  1BCP F;  3VR5 A;  2WAQ B;  1HRJ A;  4M8A A;  3OPO A;  3M9B A;  4X65 L;  2B2W A;  4ZUJ A;  2X6G A;  2PMZ B;  2E76 C;  2JEB I;  3K6O A;  4DV5 L;  1QZH A;  2F0G A;  1E3P A;  3CCL A;  4B08 A;  3SK8 A;  3MXN A;  3CCM A;  1CKO A;  1NY4 A;  1NUC A;  2CWA A;  3F2U A;  3QIA A;  4LFC L;  1VMP A;  2P5Z X;  4EQP A;  3V05 A;  3TP8 A;  3NWT A;  4LW1 A;  4ZYS A;  3CCU A;  2R92 H;  2R3Z A;  3HG9 A;  1SBB B;  3F2D A;  1J9O A;  1FGU A;  5LMN Q;  4A3B H;  1U4R A;  2CVR A;  1HZA A;  2BH8 A;  1PVO A;  4CKE A;  3UE0 A;  2E5L Q;  1GKH A;  3TZU A;  5GAG C;  2L1B A;  2EYL A;  4KD4 A;  3BZK A;  1TT2 A;  4GKJ Q;  4NW2 A;  4PZ8 A;  2VW9 A;  3D4D A;  2ZXR A;  3RLN A;  4ZRZ A;  2JJQ A;  2LFN A;  4MTN A;  2VUM H;  3CHB D;  1A3U A;  3HOY G;  3HGB A;  1YNJ C;  3TP6 A;  3NBH B;  3HKZ G;  3GTP H;  4BXX G;  2E5L L;  1A3V A;  3G4S A;  1L1O C;  5C5L A;  2R92 B;  1EU4 A;  2EVB A;  4N9T A;  3UE1 A;  3MXP A;  1BBU A;  1TKW B;  3FDT A;  1X3F A;  2K7V A;  3TS0 A;  2OQK A;  1MD2 D;  1VS0 A;  2NZH A;  4NXN Q;  2B8G A;  3IFD A;  1I4P A;  4YY3 Q;  2J0T D;  1SRO A;  4DA2 A;  3NEM A;  3KJO A;  5I2Y A;  1VQC A;  1H95 A;  2CKZ B;  4AQY Q;  2K05 A;  4DK3 C;  3OMG A;  2WV6 D;  3EIV A;  3RZO H;  3GTP B;  1GXD C;  4BS9 A;  5BN4 A;  4DV2 L;  1SJE D;  3J7A F;  4NXN L;  4P2C B;  2F1M A;  3EQL C;  1NJI C;  4V19 0;  3NK9 A;  5M9O A;  3AMU A;  3C2P A;  3P7J A;  5KYL A;  1H9S A;  3FVQ A;  1JCK B;  1TU2 B;  3GTQ B;  2GA4 B;  1T9H A;  5FLX L;  1G29 1;  4AQY L;  2PCF B;  5EPJ A;  5CV5 A;  4JBK A;  4YCU A;  4K14 A;  1B2T A;  5EKI A;  1A8V A;  1UUP A;  5I6Y A;  2E75 C;  2IHE A;  3A5Z B;  2WP8 J;  4LMQ D;  5EPK A;  2F3I A;  3J80 c;  3J81 E;  5IGE A;  1S5D D;  4ZAI A;  1IYJ B;  3RZO B;  1BCP B;  1KTK A;  2EY2 A;  3P1H A;  5AJ3 Q;  3RN5 A;  1WTX A;  2EOT A;  3JAM E;  2JA6 G;  3PCO B;  5EBC A;  3UDF A;  4S3S A;  2ENB A;  1VQF A;  3KF6 B;  1JOQ A;  1UE6 A;  1SAP A;  3AYH B;  3CCQ A;  4DKA C;  1XMQ Q;  1HZC A;  1KNE A;  1EY7 A;  1B50 A;  2AUK A;  1TWF H;  3TQY A;  3CXC A;  2YTV A;  1EIH A;  2OEO A;  3HOY H;  3S17 H;  3BVM A;  3EBE A;  2A69 C;  2AQ3 B;  4BXX H;  1HJP A;  1SMY D;  2AQ1 B;  5I2X A;  1AFP A;  5DM7 3;  1K73 C;  5AJ3 L;  4Q0F A;  3CU7 A;  1D1K A;  2A8V A;  2L12 A;  1L2F A;  4A3J G;  3S16 H;  5C3E G;  1KAA A;  1Z47 A;  3A55 A;  1B3Q A;  4O2D A;  2LS0 1;  4PMC A;  2UXD Q;  2Z0S A;  3H91 A;  3S2H B;  3FMC A;  5ELE A;  4ODG A;  1U9R A;  1E24 A;  1PV4 A;  2OTJ A;  4GN3 B;  1C0A A;  4G7Z C;  1EYA A;  2F3W A;  1VQO A;  1TWA H;  1TS2 A;  2NZO A;  3BJU A;  5IT9 E;  1Y8O B;  2NB0 A;  1DM0 B;  3M85 A;  1TWF B;  5C0X H;  2D0O A;  4ZKB B;  1VQL A;  1EY0 A;  2HQE A;  3DUZ A;  2BE5 D;  3HOY B;  3S17 B;  1X3E A;  3NQT A;  2B63 G;  1QUQ A;  3L2P A;  3HKZ B;  2JP1 A;  2UXD L;  4R4C A;  1PZJ D;  4DV0 Q;  4HED A;  5D65 A;  1F9S A;  1L0Y B;  1QNK A;  2F0W A;  2F0U A;  2QW7 A;  3WDN A;  3QG1 A;  4KJO A;  3TRZ A;  3PO3 H;  2IY5 B;  2FJ2 A;  3S16 B;  1Q90 A;  3DWA A;  1EEI D;  2EJG C;  3HS0 C;  1ICW A;  3LWU A;  2YTY A;  3T51 B;  1YZ6 A;  1EIY B;  2O4X A;  3PUZ A;  4ID6 A; 
#chains in the Genus database with same CATH homology
 1TWA B;  4JK1 C;  5J22 A;  5CC4 A;  3R93 A;  1PRT C;  3VYR A;  5E4X A;  4ILW A;  2A5H A;  3K5L A;  1KNA A;  1G2T A;  2BDO A;  2K1B A;  2MJ8 A;  1D6E C;  3PO3 B;  1QWY A;  3I90 A;  4RGO S;  3SDZ A;  4TKO B;  3R8B A;  3TP5 A;  4H0L C;  5BN3 A;  2FHT A;  3WOF A;  2IWH A;  1HA6 A;  3VYS A;  3HP3 A;  3MWY W;  5COR A;  2K5D A;  1B9N A;  2EYF A;  1PTO D;  4G7O C;  1ET6 A;  2J7Z A;  1EY6 A;  2JA6 B;  3KK7 A;  1PDQ A;  4RH6 A;  4RGN A;  5D3D A;  1ILP A;  1A2T A;  5BN5 A;  3D4R A;  4HCS A;  5HGT A;  1QJO A;  1EU3 A;  1TS4 A;  1A2U A;  4QIW B;  2NN6 H;  4NDX A;  4QUC A;  1TY0 A;  2MPM A;  3GV6 A;  2FFK B;  1T5E A;  3VA7 A;  2R61 A;  4HAE A;  4A3J B;  2O2L D;  5C3E B;  3CRK C;  1Q1E A;  1EYC A;  4K5W A;  3S1Q B;  1SSO A;  3EVQ A;  2KEC A;  4FVM A;  3X3M A;  1EEF D;  1PYW D;  1M8A A;  2KCC A;  1HFG A;  1TVX A;  3J7A V;  5COY A;  1MI2 A;  2EDG A;  1AZP A;  2D5D A;  2SOB A;  2Z8L A;  3T56 B;  4QMG A;  2B63 B;  1TY2 A;  4BA1 I;  2RDF A;  4QF4 A;  1LTG D;  3NBH A;  4R9W A;  3K0Y A;  1SNO A;  1DON A;  2CQA A;  2L55 A;  2F0N A;  1BDO A;  4DN4 M;  1QG7 A;  3GTJ B;  2AWN A;  4O1N A;  5AFW A;  4BY1 B;  1GHK A;  4FNF A;  1WTW A;  4WJW A;  1KDA A;  1JE4 A;  2F0F A;  3TZD A;  3VYU A;  1TWC B;  1STB A;  4RA8 A;  1J8I A;  3S15 B;  3CRL C;  1EZ8 A;  3RZD B;  1TR5 A;  3VR3 A;  3IKJ A;  2F0D A;  5I4D A;  1B9M A;  2FMC A;  1LAB A;  3IL8 A;  3GV3 A;  2EE1 A;  1LT6 D;  3PUW A;  3BG3 A;  1QOH A;  1F77 A;  5LL6 S;  2A68 D;  5I9O A;  4BWG B;  1JWS D;  1H9K A;  4KKS A;  1B53 A;  4L63 B;  2EYO A;  2G9D A;  4F88 A;  4J6H A;  2EYH A;  3KLR A;  2V4D A;  1YNN D;  2Q8T A;  3S9W A;  4ULL A;  2DN8 A;  4IUU A;  1LLR D;  4HSV A;  3CKI B;  1BCP C;  1HCZ A;  3T13 A;  1I6V C;  5FO7 B;  3J7Y W;  1X3Q A;  3S14 B;  4L8J A;  1RCV D;  3NHH A;  5IGF A;  3HOW B;  3Q6S A;  1LTB D;  4U68 A;  3TDQ A;  3EJI A;  1O7Z A;  2RBM A;  1OO9 B;  3ERO A;  4XT1 B;  4XT3 B;  5CV7 A;  3I72 A;  1AEX A;  2EY1 A;  3MEH A;  1ZXT A;  3K7A B;  3ONA B;  4G4K A;  4PMW A;  2OT2 A;  1EFI D;  1JOO A;  2ZT9 C;  1DZ1 A;  1RTN A;  1PXU A;  4WFN 3;  4PNY A;  5IT9 L;  3ZYY X;  5C4J B;  2JA7 B;  2JXM B;  3S2D B;  5M3M B;  4RFB A;  3EA6 A;  4BBR B;  1OXX K;  1H9J A;  1NSN S;  5G3L F;  1PTO B;  1CFM A;  4DK0 A;  2TSS A;  3PIO 3;  4EVO A;  2BA0 A;  4IN3 A;  1F9Q A;  3PUV A;  4EGV A;  4BY7 B;  2Q8R E;  3EFX D;  4TQU S;  4B9W A;  1I4G A;  4IUT A;  4IUV A;  2R6G A;  4IUP A;  1DJR D;  2KEE A;  5CGK A;  2E74 C;  3LWE A;  1V1P B;  4R8N A;  5DAU A;  1NCV A;  3HOV B;  1WD1 A;  4J1M A;  1RD9 D;  1F9P A;  4K8I A;  4DK1 A;  1R4Q B;  1BNZ A;  1PZK D;  1RKN A;  2K33 A;  2QEJ C;  1XTC D;  2RQX A;  4CKB A;  1S4Z A;  1XX8 A;  2O5J C;  4ZQ3 A;  1JB3 A;  4UAI A;  4DU9 A;  1SJH D;  3QO2 A;  2B2W C;  5C3X A;  1BR9 A;  4FF3 A;  1TQO A;  3VR4 A;  4LJZ C;  4U67 3;  1VDZ A;  1HUN A;  1RTO A;  5EKL A;  1PFB A;  3BDO A;  4RGT A;  2PQE A;  4L6T B;  1DOK A;  1Y8N B;  2NTS A;  2QKI C;  3NTI A;  4KN7 C;  1I6H B;  1FNV A;  2B2U A;  4OGQ C;  5K36 G;  2NWG A;  1X3P A;  4RHR A;  2BA1 A;  1SE4 A;  1SYF A;  2HCI A;  3AU7 A;  2KCN A;  2XWJ B;  3S1M B;  1NR4 A;  3OIP A;  3O13 A;  4FP5 D;  2SNM A;  3D6W A;  2KHS A;  2XRS D;  1HTP A;  2N55 A;  1VF7 A;  3H09 A;  1KLU D;  3H94 A;  1WTR A;  2R93 B;  5JAV A;  1YNJ D;  4MHE A;  1SXT A;  2Z4H A;  5C0X G;  1HUM A;  4A3E B;  1QB5 D;  1LTS D;  3R2T A;  3HRZ C;  1AN8 A;  1LT3 D;  2NZ1 D;  4V0B A;  4RKB A;  3NBI A;  3NUC A;  1HQR D;  2C9O A;  2E2H B;  3HOZ B;  2WIN B;  1CTM A;  1ZKO A;  4F8M A;  4EQO A;  2QF7 A;  1G2S A;  3URY A;  2F4I A;  2KOL A;  2E2D C;  2EZV A;  4OO1 G;  2RA4 A;  3D31 A;  3KBX A;  1S5F D;  4IUN A;  1U4L A;  2M00 A;  2RKS A;  3C3L A;  3MHB A;  2A6E D;  4DAY A;  1PMR A;  3VA5 A;  4K6L A;  3FPP A;  4H7B A;  1SNC A;  3HOX B;  3OMC A;  3DWQ A;  5K36 H;  2CHB D;  5IOD A;  3Q0A A;  3P75 A;  1TWH B;  4RKL A;  3OOC A;  5DM6 3;  2CW0 D;  4DXG A;  2QIL A;  3Q24 A;  4A3G B;  1OXU A;  4YIJ A;  4XQJ A;  5C0X I;  2LMC B;  2K01 A;  4RHS A;  2DY8 A;  4QUF A;  4DF7 A;  1O7Y A;  4FXD A;  2IJ0 A;  2NVQ B;  4NKL A;  4PMB A;  1XWE A;  1IYV A;  2A69 D;  3SR1 A;  2BE5 C;  3N52 A;  2NN6 G;  4MN3 A;  3FEW X;  5C44 B;  2PYK A;  4WRD A;  2K28 A;  1NR2 A;  1Q12 A;  3PO2 B;  4X3U A;  2EYJ A;  4OO1 I;  4RCO A;  5I6W A;  1F2L A;  4LK1 C;  4DNT B;  3A8K E;  4NP5 A;  5JPM C;  1RJT A;  2E2J B;  3HEJ A;  1OXV A;  1ILQ A;  1CA6 A;  3KUP A;  2K5W A;  4Z9C B;  5JEA G;  3ERQ A;  4OO1 H;  2F0L A;  1W6J A;  3MXG A;  3NQI A;  2KUM A;  2JA5 B;  1EQT A;  1SE2 A;  3NTK A;  3NE5 B;  4CJ1 B;  3D4W A;  3VR6 A;  1FGB D;  3K59 A;  5KND A;  1PRT D;  1LTR D;  1F9R A;  2F0J A;  1DXM A;  2BDN A;  4O42 A;  1PTO C;  4ZKC B;  1LAC A;  1MGS A;  4XXE A;  3GTO B;  2NN6 I;  5IIF A;  1V1P A;  5HUR A;  1G91 A;  1WCM B;  2Z1C A;  5M3F B;  3GTL B;  3M7N A;  5C3W A;  1HQM C;  5ELD A;  1AW7 A;  3KF8 A;  5J39 A;  1ONL A;  3KLS X;  4WOR A;  1IHZ A;  3TBI B;  3PIP 3;  1G8Z D;  2KVM A;  2F0O A;  4A3I B;  3OW7 A;  1H9M A;  3DHQ A;  5E4W C;  3K5M A;  2F0I A;  1S5B D;  4C2M B;  2M2L A;  1ENF A;  1PFM A;  3I4L A;  4DAP A;  4A3M B;  1B4O A;  4I7Z C;  3RD4 A;  1STA A;  3M7G A;  4UDU C;  1BF4 A;  1R4P B;  3MXU A;  3K57 A;  1GUW A;  5EJW A;  3OIQ A;  4GZY C;  3BDL A;  1EZ6 A;  1IYU A;  5C4X B;  1SNM A;  4XDX A;  4IAL A;  2PNR C;  5JEA H;  1F2M A;  1CHQ D;  1UNS A;  1XXG A;  1X32 A;  5FO9 B;  4HR7 B;  2L0C A;  2J4X A;  1Y1W B;  2A6H D;  3I91 A;  4ZLT F;  1K83 B;  2PZW A;  2MGS A;  4K8J A;  4KJN A;  3ITP A;  2YU9 B;  1PTO F;  2PO4 A;  4KV6 A;  2DNE A;  2FIN B;  3FPU B;  5DEH A;  3A56 A;  1KAB A;  5C0X J;  1L0X B;  2Q8I B;  1CT1 D;  2NTT A;  2JYO A;  3UI2 A;  1WTV A;  3A8J E;  4IZ8 A;  1CM9 A;  1RHP A;  2L4N A;  3K5N A;  5EGT A;  1ZYR C;  4Y7N B;  1TII D;  3BZD B;  2TMP A;  2JA8 B;  1SNP A;  5KNB A;  3IAY A;  5M5X B;  4FF2 A;  1XYI A;  4FXK C;  2JEA I;  1SFO B;  3R3O A;  1EWC A;  3S1N B;  3ND9 A;  1K8M A;  1T5X D;  1PZI D;  4B9X A;  4Q5V A;  4KD3 A;  2IL8 A;  5A35 A;  1QNU A;  5A2Q E;  2A68 C;  2F0V A;  3NPP A;  1Q1B A;  5EQ0 A;  3SK4 A;  1E2W A;  1WVL A;  4KY7 A;  1E2V A;  1GUN A;  1PLF A;  2FMM A;  2LKV A;  4G57 A;  5M5W B;  3MZ5 A;  4I65 A;  1YNN C;  2KQ3 A;  4KI0 A;  2DY7 A;  4IQZ A;  1ESR A;  4XTC S;  3SE0 A;  3J81 L;  2HDM A;  2EY5 A;  3JAM L;  1QIL A;  5CR3 A;  3DWP A;  2PZT A;  2B39 A;  2KJX A;  3L3O C;  3HOU B;  3SK6 A;  4CJ2 C;  1ET9 A;  3FKI B;  2HUG A;  5C4H A;  3MFG A;  1DOL A;  1I4Q A;  1PTO H;  1JQY D;  5E1F A;  2OXP A;  2IX3 A;  5K5P A;  1STH A;  3D3R A;  2XVS A;  3DXJ C;  4A3D B;  1EL0 A;  2ICE C;  2NUC A;  1OXT A;  1IW7 C;  1BCP D;  4K5X A;  3NTH A;  5FO8 B;  3J80 E;  4CKC A;  2XRQ D;  3DEP A;  2C5C A;  4C3H G;  2EYP A;  2PW5 A;  4K2L A;  3SVM A;  1EYD A;  2Z4I A;  4DNR B;  3GQB A;  3GTK B;  4QCL A;  1VCI A;  5CV9 A;  2XN9 C;  5FKA C;  2SNS A;  1HXY D;  2MHV A;  3MFY A;  2IT1 A;  3OWF A;  2DNC A;  1HTL D;  2R7Z B;  2IX1 A;  1ML0 D;  4J8Q A;  1ENC A;  1HA5 A;  3VR2 A;  4QB4 A;  2B2T A;  1HPC A;  4RGM A;  3QOJ A;  3L7Z C;  1LTT D;  4IFD G;  3U9S A;  1JWU D;  4A3K B;  3BVZ A;  4DFA A;  4C3I G;  1RF2 D;  3T4A C;  2VNU D;  4PV1 C;  5JOB A;  1MSG A;  3NSW A;  3NXW A;  2B2T C;  5E3F A;  4K2K A;  4FO2 A;  4C1N I;  3A54 A;  3E6Z X;  1D5M C;  3TSS A;  1CZG A;  3I4M B;  4XIG S;  2B8F A;  5C5M A;  4IUR A;  5IGB A;  1V8Q A;  4A93 B;  2LY7 A;  3OWE B;  1R9T B;  1HFN A;  3C1F A;  5EKK A;  2RSN A;  5KNC A;  3L9A X;  3QOL A;  1GJX A;  2IX0 A;  3BYT B;  2RDH A;  2IPK D;  2NBF A;  3G6J B;  3NWS A;  1Z7T A;  1NAP A;  1GOZ A;  3KLS A;  1Y1V B;  1H9R A;  2SDF A;  2L11 A;  1KDC A;  3KBG A;  5ISR A;  3GD7 A;  3Q22 A;  3A7L A;  5NUC A;  4FXG C;  1I4X A;  2K5Q A;  1EWH A;  3I73 A;  4IFD I;  2SEB D;  4KY5 A;  4KHV A;  1F2Y A;  1U4P A;  1IKM A;  2B2U C;  1A15 A;  3BDC A;  4RCN A;  5D14 A;  2F0E A;  3E5S A;  4OHJ A;  1Y69 U;  1SYG A;  1FD7 D;  1G6Z A;  4IFD H;  4X3K A;  2PW7 A;  5KIX A;  4C3H B;  5J1Z A;  2EY6 A;  1DD2 A;  1SYE A;  3ND8 A;  4A3B B;  1FR3 A;  4BA2 I;  5CBE E;  3MVV A;  2EXZ A;  5T1G A;  4R8I A;  4KMU C;  3LX0 A;  4FF4 A;  5C6A A;  1JR0 D;  1SDF A;  2VUM B;  3OHX C;  5KYI A;  4LAA A;  5CV4 A;  1CI3 M;  1STY A;  4C3I B;  1FNU A;  2XSC A;  1IL8 A;  1Z6H A;  3HZX A;  1V43 A;  1RDP D;  1KDB A;  4N9P A;  3RUZ A;  2B2V A;  2A6E C;  3D8G A;  1LT5 D;  1TS3 A;  5IOC A;  2AWO A;  2RDG A;  4C3J G;  1E2Z A;  3H0G B;  3DM1 A;  1QE6 A;  3M3Y B;  3SXH A;  1ZEQ X;  3I70 A;  5ELC A;  1JC7 A;  1UAP A;  4F7X A;  1SMY C;  2B2V C;  1Q3L A;  2NYZ D;  2CW0 C;  3E0J A;  5C4Z A;  1CQF A;  3GTM B;  2BOS A;  2I07 B;  4TSS A;  5A2Q L;  2D2C C;  2A73 B;  3Q23 A;  1A3T A;  1K8O A;  3DEO A;  1AZQ A;  1AP0 A;  5CMD A;  2O5I C;  2RVL A;  3MTS A;  1VF5 C;  3H6M A;  3X3N A;  1B1Z A;  1TS5 A;  4OIJ A;  1SND A;  2G9H D;  1EY8 A;  2PPB C;  1BBX C;  4HTH A;  2EJF C;  1SEB D;  2JE6 I;  3BS1 A;  1EY9 A;  3V2T A;  4CJ0 B;  1DCZ A;  5JJZ A;  3DMU A;  3C1E A;  5KEE A;  2QCP X;  4H44 C;  4KKU A;  2L9H A;  3PV0 A;  4EQN A;  1I50 B;  3QWN A;  1MBY A;  2EYM A;  2EPB A;  2QDB A;  3G7L A;  1WTO A;  1M4V A;  1STN A;  3T53 B;  3MC0 B;  2F0S A;  2BCO A;  4G7H C;  2F0H A;  1F2Z A;  1UEA B;  3J80 L;  1ROD A;  2MUY A;  4OIK A;  1SNQ A;  1I4H A;  2XIW A;  3LNN A;  3TP7 A;  1S5E D;  1EOT A;  1FNW A;  4CBV A;  4IFD J;  2X69 A;  1E0B A;  5JVG 3;  4M1U B;  2F0M A;  3C46 A;  2WKD A;  3BYY B;  1KLG D;  2K6A A;  4TRD A;  2AQ2 B;  3H3V C;  2XNA C;  3W3A A;  1S5C D;  4OL7 A;  4KHZ A;  1LT4 D;  1STE A;  1DOM A;  2PZU A;  1Y8P B;  3WOE A;  2IW3 A;  4K6D A;  2B2Y A;  4X3S A;  2H4O A;  1II3 A;  4C3J B;  5TSS A;  3M4Y A;  2WAC A;  4NMZ A;  1O7L A;  1SYB A;  2H1E A;  1GUG A;  1MSH A;  2NVX B;  4K5V A;  1C4Q A;  2MP1 A;  3R2I A;  4HMI A;  1D1I A;  5D3I B;  5DNF A;  1TWG B;  2B2Y C;  1QCB D;  1D2B A;  4KK7 A;  4KTA A;  4ZK9 B;  3NP8 A;  2ZXO A;  3N6R A;  4CGY B;  1BOS A;  2F3V A;  3MA2 B;  3GO5 A;  5KRU A;  4XQN A;  1GUS A;  2NVT B;  1ESF A;  1EQV A;  5FK9 C;  5FOB B;  3QJY A;  2K04 A;  1LTA D;  3D6C A;  5ELF A;  2YYZ A;  4RAU C;  5KGU A;  5LL6 X;  2A6H C;  2F0T A;  2K32 A;  4XYO A;  1I3Q B;  1PRT F;  2Y0S B;  1VMC A;  2ICI A;  1O80 A;  3A7A B;  1JOR A;  1FYC A;  1SE3 A;  3OSO A;  1DYQ A;  2VB2 X;  3P20 A;  1WTQ A;  2F0Q A;  4KN4 C;  5M5Y B;  1WD0 A;  3I3C A;  1JIC A;  5JVH 3;  4HCE A;  3SK5 A;  3QB3 A;  5IGG A;  3K5O A;  5T1I A;  1EY4 A;  1BUV T;  5IGC A;  3RMH A;  1I4R A;  5FLX E;  3GP7 A;  4X3T A;  4XYQ A;  1D5X C;  5EPL A;  2L5T A;  4A3F B;  5ELB A;  1LV9 A;  2OF1 A;  1H9S B;  1PFN A;  1CA5 A;  3VYT A;  1SYD A;  5CBA E;  5IGD A;  1LTI D;  2E2I B;  5CYU A;  4DAV A;  1OXS C;  1BQQ T;  2EJM A;  1ZYR D;  4XQQ A;  4IUQ A;  2HCC A;  1HHV A;  1JWM D;  4RWS C;  1B44 D;  3FRP B;  5EBD A;  3GTG B;  1O78 A;  4ME5 A;  4C1N K;  5CV8 A;  3TME A;  2HDL A;  1CK1 A;  4C56 C;  3SEB A;  3PUY A;  4BBS B;  2RSO A;  2M9V A;  5G3L D;  1GUO A;  3W2D A;  2D9U A;  1EY5 A;  1ENA A;  1STG A;  1C8C A;  1EIG A;  4ZUI A;  2F0P A;  4FF1 A;  3T16 A;  2KED A;  2WKC A;  1W6K A;  1WTP A;  1BXT A;  2AUJ D;  2WII B;  4JBW A;  3MAQ A;  4PQX A;  3CQZ B;  2K03 A;  4HN7 A;  3V96 A;  2NVY B;  5F2D A;  2A74 C;  1SYC A;  1Q8I A;  1BO0 A;  4MIU A;  2WB1 B;  3SHL A;  3I8Z A;  5LHY 1;  3IFT A;  1PRT B;  5CV6 A;  4HMJ A;  2VXW A;  3BVG A;  2F0K A;  1C48 A;  4DXF A;  3TN2 A;  3RLF A;  4E6I A;  4H13 C;  3M4O B;  1IW7 D;  3S1R B;  5JEA J;  2F03 A;  5I9P A;  1U4M A;  4FYD A;  1B3A A;  2D62 A;  3AB9 A;  1CHP D;  2KA7 A;  4DGZ A;  3PUX A;  1D5Z C;  4ABN A;  1IKL A;  3I4N B;  2JSO A;  2ZXP A;  2N88 A;  1A6X A;  3K58 A;  4CHT B;  1V1O A;  5JPN C;  2I46 A;  1GHJ A;  2XWB B;  2VB3 X;  4F87 A;  2X6L A;  2ID0 A;  4AYB B;  4KY6 A;  4HSP A;  3U9O A;  1JOK A;  1CQV A;  1LO5 D;  1GUT A;  3A8I E;  3PMF A;  1CZW A;  4KKT A;  1BCP F;  3VR5 A;  2WAQ B;  1HRJ A;  4M8A A;  3OPO A;  2B2W A;  4ZUJ A;  2X6G A;  2PMZ B;  2E76 C;  2JEB I;  3K6O A;  2F0G A;  4B08 A;  3SK8 A;  3MXN A;  1NUC A;  3QIA A;  3F2U A;  1VMP A;  4EQP A;  3V05 A;  3TP8 A;  3NWT A;  4ZYS A;  2R3Z A;  3HG9 A;  1SBB B;  1J9O A;  1U4R A;  2CVR A;  4CKE A;  3TZU A;  2L1B A;  2EYL A;  4KD4 A;  1TT2 A;  4NW2 A;  3D4D A;  2ZXR A;  4ZRZ A;  2LFN A;  3CHB D;  1A3U A;  3HGB A;  1YNJ C;  3TP6 A;  1A3V A;  5C5L A;  2R92 B;  1EU4 A;  2EVB A;  4N9T A;  3MXP A;  1TKW B;  3FDT A;  2K7V A;  1MD2 D;  2B8G A;  3IFD A;  1I4P A;  2J0T D;  4DA2 A;  5I2Y A;  2K05 A;  3OMG A;  2WV6 D;  3GTP B;  1GXD C;  4BS9 A;  5BN4 A;  1SJE D;  3J7A F;  4P2C B;  2F1M A;  3EQL C;  4V19 0;  3NK9 A;  5M9O A;  3AMU A;  3C2P A;  3P7J A;  5KYL A;  1H9S A;  3FVQ A;  1JCK B;  1TU2 B;  3GTQ B;  2GA4 B;  5FLX L;  1G29 1;  2PCF B;  5EPJ A;  5CV5 A;  4K14 A;  1B2T A;  5EKI A;  1UUP A;  5I6Y A;  2E75 C;  2WP8 J;  4LMQ D;  5EPK A;  3J81 E;  5IGE A;  1S5D D;  4ZAI A;  3RZO B;  1BCP B;  1KTK A;  2EY2 A;  3P1H A;  1WTX A;  2EOT A;  3JAM E;  5EBC A;  4S3S A;  2ENB A;  1JOQ A;  1SAP A;  1KNE A;  1EY7 A;  1B50 A;  2AUK A;  1EIH A;  2OEO A;  3BVM A;  2A69 C;  2AQ3 B;  1SMY D;  2AQ1 B;  5I2X A;  1AFP A;  5DM7 3;  4Q0F A;  3CU7 A;  1D1K A;  2L12 A;  1KAA A;  1Z47 A;  3A55 A;  2LS0 1;  4PMC A;  3H91 A;  3S2H B;  3FMC A;  5ELE A;  4ODG A;  1U9R A;  4G7Z C;  1EYA A;  2F3W A;  1TS2 A;  5IT9 E;  1Y8O B;  2NB0 A;  1DM0 B;  3M85 A;  1TWF B;  5C0X H;  4ZKB B;  1EY0 A;  2HQE A;  3DUZ A;  2BE5 D;  3HOY B;  3S17 B;  3NQT A;  3HKZ B;  2JP1 A;  1PZJ D;  4HED A;  5D65 A;  1F9S A;  1L0Y B;  1QNK A;  2F0W A;  2F0U A;  3WDN A;  3QG1 A;  4KJO A;  2FJ2 A;  3S16 B;  1Q90 A;  3DWA A;  1EEI D;  2EJG C;  3HS0 C;  1ICW A;  3LWU A;  3T51 B;  2O4X A;  3PUZ A;  4ID6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...