1STHA

Two distinctly different metal binding modes are seen in x-ray crystal structures of staphylococcal nuclease-cobalt(ii)-nucleotide complexes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase (phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title X-ray crystal structures of staphylococcal nuclease complexed with the competitive inhibitor cobalt(II) and nucleotide.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sthA00
1EYAA 4K6DA 4ZUIA 3TP6A 4LAAA 3QB3A 4HMJA 1SYCA 2F0PA 3EJIA 4HTHA 4ME5A 2F0EA 5CR3A 4PMBA 3SHLA 3SK4A 3SK6A 1EZ6A 4KTAA 2F0DA 4NMZA 1KDAA 1KDBA 3NHHA 1A3UA 4TRDA 1EY5A 5J1ZA 2PZUA 1TT2A 5J39A 2M00A 1EY8A 3LX0A 4NDXA 4QF4A 4ZUJA 5M9OA 1EY7A 2EYHA 2WACA 4K2KA 5E3FA 3RUZA 2EXZA 1RKNA 1STAA 2F0QA 2OXPA 1EYCA 1F2MA 3NK9A 1SNMA 3HZXA 4G57A 4K8JA 3SXHA 4DF7A 3MVVA 2QDBA 5NUCA 1ENCA 2PW7A 2EY6A 1NUCA 5CV5A 5CV8A 5IIFA 4K8IA 2F0UA 1EZ8A 1KABA 2EY2A 4J1MA 4B9XA 5I9PA 2EYJA 3OMGA 2F3VA 2F0HA 3OSOA 5CV6A 5JOBA 5HURA 1JOKA 3MHBA 2F0GA 2OF1A 5CGKA 5J22A 3D4WA 3NUCA 3MZ5A 5KYLA 5E1FA 1JOOA 1EY0A 2F0OA 2RKSA 3T16A 1A3TA 1SNPA 4NKLA 2RBMA 3V2TA 3EVQA 2SNSA 4N9TA 1KAAA 3QOJA 5EKKA 4EQPA 2PZTA 3C1FA 2EYFA 5C3WA 5C6AA 5CC4A 3ITPA 4KV6A 5DAUA 1U9RA 2F0FA 2PW5A 4KY6A 4KD3A 4WRDA 5I6WA 4E6IA 4EVOA 5IGGA 5IOCA 1EY9A 2EYPA 2F0JA 2F0VA 1SNOA 5DEHA 1II3A 1A3VA 2LKVA 2SNMA 5KGUA 3TP8A 2OEOA 4KJOA 3TP5A 3TMEA 2PQEA 5JAVA 4J6HA 3HEJA 1JOQA 3QOLA 2EYMA 1KDCA 3VA5A 1SYDA 1EYDA 2PYKA 1EQVA 4QB4A 3C1EA 3D4DA 4EQOA 2F0LA 4MIUA 5HGTA 4EQNA 1STBA 4DGZA 4OL7A 1STYA 1SYEA 1SYGA 2EY5A 5KEEA 3BDCA 5C3XA 5IGFA 1SNCA 4KY5A 3NXWA 3SR1A 3DMUA 3EROA 3OWFA 3PMFA 4PMCA 5C4ZA 1EY4A 2EY1A 1IHZA 2F0TA 4I65A 4K2LA 3ERQA 5IGCA 3NP8A 1JORA 3NQTA 3D8GA 3SK8A 3TP7A 5IGEA 2EYLA 2KQ3A 5C5MA 4KJNA 4DFAA 1TR5A 4HMIA 1A2UA 3MEHA 3H6MA 1A2TA 5IGDA 4K5WA 4KHVA 1SYFA 5CV7A 3SK5A 4IALA 4KD4A 5IGBA 4YIJA 4WORA 2F0WA 1STNA 2RDFA 4IZ8A 5EGTA 1STHA 4RKBA 1AEXA 4ODGA 5CV9A 5K5PA 4KY7A 5KRUA 4F7XA 3E5SA 2F0IA 2SOBA 4RKLA 4QMGA 2F0NA 4H7BA 1ENAA 1SYBA 1STGA 1TQOA 2F0SA 3DHQA 4NP5A 4B9WA 1SNQA 3D6CA 3T13A 4K5XA 5I6YA 5ISRA 2F0MA 3P1HA 2ENBA 2HQEA 3U9OA 4K14A 5F2DA 4F8MA 2O4XA 3S9WA 4R8NA 2PZWA 1F2ZA 1F2YA 4ID6A 4IUNA 4K5VA 4PNYA 3MXPA 5C4HA 2F3WA 1SNDA 4ZQ3A 5KIXA 4DU9A 2KHSA 2F0KA 2NUCA 1NSNS 3R3OA 4N9PA 1EY6A 4S3SA 5EKLA 3BDLA 3OMCA 5KYIA 3P75A 5C5LA 5I9OA 5CV4A 5IODA 2EYOA
chains in the Genus database with same CATH superfamily
1TWGH 2H5XA 4A3GG 1SE2A 4PMBA 3SK4A 1DM0B 3KUPA 1CK1A 3CHBD 2E2IB 3I3CA 1VQGA 2L12A 2UUAL 4LF8Q 3CCQA 3IL8A 1AH9A 1H9SB 3MVVA 4DV7Q 4A3BB 3T56B 1LUZA 2EY6A 2XGTA 3P7JA 4RGMA 1X3EA 1TWFB 1DXMA 3HOYH 1R4PB 3DLLA 2ZT9C 1AE3A 3HKZG 3V05A 5CV6A 4GNXB 3NENA 1WJJA 2WB1E 4APVA 1Y69U 2BCOA 2LY7A 3LWEA 5E1FA 5LMNL 3HOXG 2MO1A 3EVQA 2A68C 3A56A 4DXFA 1I4QA 4GKKL 1X65A 2JA8H 4XDXA 4RA8A 2QEJC 2A6ED 1CSQA 1BKBA 5EAYA 3D4DA 2XSCA 3K5LA 1XWEA 2K75A 2CVRA 4IPCA 1IXRA 4DV4L 4YCVA 2AWNA 1GO3E 4DR6L 2CWAA 5IGCA 2RVLA 3FKIB 4RGNA 1D5MC 1S5DD 1K83H 2RF4A 3MEHA 3KYHC 5C4XH 1A8VA 3KDFB 5M5WH 3J81c 3J7YW 1I94Q 2PMZE 1IZ6A 1BO0A 3K8AA 4YIJA 1STHA 1CTMA 3WDNA 3S17B 4K0KQ 2C35B 2KCMA 2CW0D 1STGA 2FFKB 1WTPA 3J7AF 1D1KA 1VQ5A 4K14A 5IYCH 5FO8B 1DZ1A 1QWYA 1FNWA 1HNXQ 2F03A 4WJ4A 1U5KA 2B39A 4UHVA 4JI3L 5I2XA 4C3JH 3HOYG 4LAAA 3RLNA 5EKIA 3A74A 4O0AA 4DV6L 4X6AH 1VDZA 4CJ0B 5BN3A 2Z0SA 3S15B 1ONLA 1LYLA 2D2CC 2PZUA 4CJ1B 1S40A 5M9OA 1X55A 1HR0Q 1SMYC 1BOSA 1EYCA 1IBKL 4DF7A 3AMUA 2OTLA 3GTQB 4A3BG 4IQZA 3GP7A 4C3HH 3L9AX 4K8IA 1BVSA 2JQOA 2F1MA 2EVBA 3M3YB 2JA7B 1HA5A 1F9RA 1N32L 5KYLA 4P71A 2JP1A 1YVCA 1SNPA 4DR4Q 1S5ED 3VYSA 5EKKA 1LTBD 3QOJA 2L11A 2K52A 4POFA 1VQ4A 1LV9A 2NVXH 2YTXA 2Q8TA 1E0BA 3F1ZA 1XPUA 4M1UB 1KNEA 4DV1Q 3G71A 4BA2I 4CDEC 4F87A 4JI6Q 1GOZA 5D3DA 5C4XG 1UEBA 2ASBA 3PQIA 5J3BA 2F4IA 3S1MB 1MKHA 3VYRA 4OX9L 4JOIC 1IYUA 4DV3Q 4HAEA 1MJEA 1UUPA 4TVAB 1AN8A 1PRTF 1S5BD 3KLSX 5IYCG 1H9KA 2F3IA 1Y1VH 1VCIA 3K7AH 3OHXC 4XIGS 4C3IH 1KIXA 3T51B 2YV5A 4NPSA 2IL8A 4R4IA 4C3JG 2MNAA 3S16H 4MTNA 2F0WA 4KKSA 4FNFA 3FHWA 2RDFA 5EGTA 1TWHH 2NVTH 1X6OA 3PUXA 3IAYA 3TREA 2F0SA 4C2MB 5IT9c 1WD0A 1JCKB 3CC4A 1UE5A 4BY1B 5K36H 2IHEA 1ASZA 4HIKA 4JYAL 5GAEC 1EIFA 4LF6Q 4IN3A 4ZUIA 4A3MH 4HMJA 4UDUC 1FJGQ 3BZDB 1QOHA 1PRTB 3F2UA 2XRQD 2XVSA 4NDXA 1YNJD 3L2PA 3GTKB 5AJ3L 1EFID 4IJLA 2EPBA 1K8GA 1PFSA 4A3JB 3A7AB 2JN4A 3PUZA 4A3FB 4B3RQ 3QO2A 4JI1Q 4F88A 1JMCA 3F2DA 2F0UA 1XXGA 4B9XA 4A3EH 1HNZL 3S1NB 2UXBL 3VDYA 2JA7G 1PH9A 3E9HA 5GADC 3MXNB 1A3TA 1L1OB 3TBIB 3TEHB 4FXDA 4H0LC 1BF4A 2BA1A 5CYUA 3A5ZB 2E2JB 1N34Q 3JAML 3I56A 2Q2TA 1YHBA 2EYPA 2WKCA 4GS3A 4IJHA 1Y1VG 5AFWA 1B50A 1IYJB 4C3IG 5FO9B 4AQYL 1O78A 3HEJA 3U9SA 2JA6B 1FVIA 3NE5B 5HGTA 1I4RA 3RZDB 4V0BA 1DD2A 3CCMA 1STYA 1F9PA 4BY7B 5C3XA 3NXWA 4IFDG 2NTSA 4I65A 3EFXD 1YJ9A 3SK8A 1AZPA 4IUPA 2RHQB 4LMQD 1N33L 1I3QH 2VXWA 4QJFA 4OO1H 1ET6A 5D3IB 2E8GA 4B08A 4Y7NB 4A3MG 2F4VQ 1ML0D 3QG1A 2ZXRA 4NXMQ 4AIMA 5C0XH 4FXKC 3E5SA 1H95A 3PSIA 4H7BA 1WTQA 4JI5Q 1NJIC 3I4MH 3GQBA 1HZCA 5IYDG 2PNHA 4BY1G 1VQLA 5E7NA 3MXPA 3VR6A 2PI2A 5C4HA 2UUCQ 2LMCB 2QDLA 4N8X1 4JOIA 4X64Q 4HJ7A 3OTOQ 5GQOA 1DONA 3J80L 4K6LA 3H3VC 4XT3B 1D8LA 1CSPA 1HZAA 1FNVA 1PRTC 2K5WA 4HTHA 3TS0A 2DJGC 2KCTA 3KDFA 2F0DA 1VS0A 3MWYW 1GJXA 3GTOB 4KMUC 1AFPA 3E0EA 3C2PA 4K8JA 3N52A 4A3JG 1W2BA 2AKWB 1ENCA 2ZJPA 2JXMB 2FINB 4A3FG 4DK0A 5CV8A 5IIFA 4LF4Q 4J1MA 4LUZA 4FF3A 4HJ8A 4LF9Q 1L1OC 4JPBW 4TKOB 3UDGA 2F0OA 3Q22A 3GD7A 4B3TL 4A3LH 1VQHA 1GUNA 4FYDA 3LGJA 1KAAA 4DNRB 4R8IA 1HQRD 1HNWQ 4J8QA 3PUYA 2F0VA 3NELA 3GTJH 1SNOA 1JWSD 5C3EH 3CRKC 1CA5A 1LM0A 1Q12A 4IUVA 1Q7YC 3RR5A 5M3MB 1XMOQ 1BUVT 4BBSB 2VB3X 1A62A 4A3DH 1PH1A 4NXNL 5LMNW 3EIVA 2K05A 2ES2A 1W3SA 1IBMQ 2EY5A 3UI2A 5C0XG 4BY7G 3GTPH 1U4PA 4DV0L 3HOVB 1HH2P 1IHZA 1WD1A 4QIWB 3CRLC 4DAPA 1KRTA 2WAQE 3U58A 1U0LA 3IFTA 3F2BA 4U673 3PIO3 4CGYB 4A93H 4KJNA 1I4XA 4PV1C 2VW9A 2CCZA 1K0SA 1H9MA 1SE3A 1FR3A 4XTCS 4FF4A 3HOWB 1B2TA 4KHVA 1HUMA 1K3RA 4B3ML 1JT8A 2A1AA 5M3FB 1VQDA 1VQCA 2A6EC 3H15A 4RKBA 5HGQA 2AMCB 3JAME 2D62A 3HOUB 3K80C 2KENA 3VR5A 2F0NA 3RLFA 3UDXA 3EA6A 3K5MA 4NP5A 1IYVA 3U9OA 2O4XA 4ID6A 2DUDA 2VQEQ 4GN4B 2WIIB 1T9HA 2IJ0A 5M5XB 1YJWA 4RFBA 2Z4IA 3OMCA 1EEID 5C5LA 3TSSA 2ZJQA 1T5XD 4LFCQ 1HJPA 5A2QL 2K03A 3AEVA 3PUVA 4J15A 2AWOA 2K5HA 4JBJA 1R4QB 2WAQG 4KHPL 2I07B 2JA5B 2CKZB 2R92B 1SN8A 5E4WC 1KDBA 1EY5A 1PDQA 4IO9A 1H9JA 1MSHA 1G2SA 4ZUJA 4OO1I 2EYHA 3NTIA 4K2KA 2CW0C 1HA6A 1LTTD 4O1NA 1YEZA 5C0XI 2I5HA 5ELOA 1E2WA 2N55A 3OOCA 3I4NH 3M7GA 1XTDA 5C3EG 1JJ2A 1E22A 1Y14B 2R93B 2EQSA 3F8TA 1DCZA 4A3DG 2OF1A 3S14B 4HEDA 1PH7A 2B2WC 2H1EA 2DGYA 4L5SA 1RTOA 4HJ9A 4DR1Q 2Z8LA 5GAHC 4YWLA 1ZYRC 3J80E 3NTHA 1S72A 4EVOA 1XX8A 2SDFA 4QGUA 1I6HH 1N9WA 4A93G 2K6AA 2QCPX 1PVOA 2NBFA 3ONAB 3DWAA 4A3GH 4A76A 4MIUA 2E76C 2UU9Q 4EQNA 4LUVA 1JQYD 2D9UA 4DV5Q 4U68A 4HIOA 1QNUA 1HZBA 1S3OA 3FP9A 1O7IA 3BS1A 2QKIC 4IUTA 3M4OB 1L1OA 3MEFA 1IW7D 4X65Q 2Z4HA 1A2TA 2K01A 3HOWG 1TWAB 5IGDA 3GTGB 3DEPA 1YJNA 1UE7A 3K59A 1K73C 1Y8PB 4ODGA 3C3LA 4XYOA 5C44B 3K5OA 2E2HH 3M4PA 2Q2UA 1XNRQ 4XQJA 2VQFQ 3I70A 3DM3A 3HKSA 3J81j 2PZWA 5EJWA 2XIWA 1I50H 1VQNA 1NNXA 5KIXA 3I8ZA 1PTOH 5C4JB 1QZGA 4RCNA 1FGUA 4JI0L 2BDOA 1BQQT 4DR2Q 2EYOA 1TY0A 4MNOA 3TP6A 1Y8OB 1X54A 4O2DA 4CDDC 2JA5G 4RHRA 2R92G 5FOBB 4G7HC 4GLAC 1D2BA 1KDAA 1A63A 1XNQL 1X9NA 1LACA 1J5EL 1I4PA 2OXPA 1RKNA 4QMGA 5JEAG 1SDFA 3CQZH 3KLRA 3TZUA 4DUZL 1HCZA 5GAGC 4HIMA 3AFQA 3QIAA 1I94L 1SEBD 5CV5A 1Y1WH 3PUWA 1SE8A 2UXCQ 1C7YA 2MHVA 1EZ8A 1JWUD 2DNEA 3VA7A 1F2LA 3T1HL 1FD7D 1UAPA 2EXDA 4R4TA 2NTTA 4Q5VA 3PO2H 3S24A 4NKLA 4N9TA 1HFNA 1Z9FA 1YNND 1HNXL 4RGOS 5ELDA 3QWNA 1MI2A 5JJIA 2HIXA 4ZAIA 4E6IA 1UE6A 5I6WA 1YNJC 1BBWA 2MP1A 3J81E 4A3KB 1KRSA 3DXJC 3H0GH 2BE5C 4IPDA 4YWKA 1KTKA 1JJGA 4A75A 1KDCA 4FVMA 2HD3A 3VYUA 4DNIA 3C1EA 2F0LA 4G7ZC 1AP0A 5CORA 3G48A 3FMCA 3G6EA 2E2IH 2Q8RE 5C4ZA 1E24A 3KBXA 4MZ9A 1A0IA 4DK6C 2EY1A 3IKJA 3NQTA 3MXUA 2B2WA 2B2VA 1VQPA 3PIP3 2BA0A 1G51A 4JC0A 4ZKBB 1DJRD 5DM73 1Q1EA 4A3BH 4DFAA 2ZM6Q 3HOZB 1VQ7A 1TWFH 1G91A 2JEBI 4X3SA 1SROA 1HHVA 1KHIA 4DR4L 1GHJA 4JI2Q 2O5JC 5CV9A 2ZTEA 1FNUA 3GTLB 1NY4A 2HHHL 1I5FA 1K8OA 1SYBA 1OTCA 1PYBA 1SSOA 1X3GA 2LSSA 1WTOA 4R8NA 4YY3Q 1QZHA 3RMHA 1VQFA 4FXGC 2GVAA 1Y1WG 4OWXB 2SEBD 1ZXTA 5C0XJ 3A0JA 5FLXE 4ME5A 2JYOA 4AH6A 4B9WA 1B44D 5L37A 1JJCB 3FRPB 3PO2G 1RODA 4HN7A 2UUBQ 1ZKOA 3CCSA 1V1QA 2Q2HA 3KF6B 4ZLTF 2TSSA 3FKIH 2K32A 5IE8A 3H0GG 5I4DA 4DK3C 4YCWA 1KABA 1SRUA 5LL6S 3PCOB 1AE2A 2RDGA 2A5HA 2F0GA 3D31A 3MHBA 5DM63 1MGSA 2E74C 2X69A 3S17H 1HRJA 4HJAA 2N49A 1VQIA 3BJUA 4EQPA 2N88A 1GKHA 1GUSA 2EYFA 4CBVA 3HRZC 2OT2A 1C0AA 1O7ZA 4HR7B 1I6VC 1LT4D 4JCVE 2UUAQ 3R2IA 2AUJD 1IBLL 4A3KG 1II3A 2B29A 2OEOA 4KJOA 4FDBA 2HQLA 4A3IB 1GM5A 2PQEA 1FJGL 4J6HA 2KEEA 5JPMC 3STBD 3I91A 4QB4A 3H91A 3K7UC 5IT9E 2I0QA 3S15H 1MIUA 1M1KC 4P74A 4PMCA 4OONA 1PH3A 1TWCB 1WI5A 3MFGA 1XMQQ 5CMDA 4B3RL 4R9WA 4QQBX 3WOEA 1XPRA 1QCBD 5D14A 3T1YQ 3GTQH 3K0YA 2NN6H 3HOZG 1SLJA 3RZOB 1CKOA 3M3YH 2MUYA 2JA7H 2K5DA 4PZ7A 3D4RA 2L1BA 1AEXA 5K5PA 1V1OA 3CPWA 4DR3L 1QE6A 2MJ8A 2SOBA 1N34L 2L5TA 5ELEA 2PO4A 1SNQA 1CHQD 2JJQA 1OXSC 2WV6D 1CKNB 3SE0A 4DV4Q 3FKIG 5A35A 4X66L 4DAMA 3PO3B 1NSNS 4N9PA 1EY6A 1VQOA 1BBUA 5D65A 1EYAA 1SXTA 2KCNA 3F2CA 2F0PA 3S1MH 3GTMB 2F0EA 3N6RA 3TRZA 1RIPA 1QG7A 2D5DA 1QVGA 4IFDH 3LX0A 4LF7L 3LNNA 1GUWA 3RUZA 4G57A 3Q6SA 1SNMA 1QVCA 1Q8KA 4GKJQ 1EL0A 4ILWA 5EBCA 2F4VL 4FP5D 4NXML 4ZKCB 4JI3Q 3OMGA 2F0HA 3OSOA 1BCPD 1NBWA 3M4YA 5J22A 2A19A 3KJPA 4KI0A 1UWVA 3MZ5A 5ELBA 4KLKA 4I7ZC 4QY7A 1WCMB 4C2MH 5CC4A 2UUCL 1JB7A 4KD3A 3U4ZA 5IYDH 1EU4A 3OTOL 4BY1H 1EY9A 2XTIA 2SNMA 1LTID 2KEDA 2I5LX 4UP8A 2NN6G 3TP5A 1RD9D 4YHHL 1SMXA 4A3IG 4X62L 3TMEA 5JAVA 1JOQA 1WOCA 3QOLA 1MBYA 3VYTA 5LHY1 1DOLA 4Y52H 2PYKA 1VQ9A 3HP3A 1PFNA 3AU7A 4JBWA 1TXYA 3CCEA 1RF2D 1SYGA 3H3VH 3S1RB 2I5MX 1SNCA 2KOLA 1KLUD 1SR3A 4X3UA 5JEAJ 1N32Q 5BN5A 2C5CA 3HFZB 4BXXG 3GTKH 4NB3A 1LTSD 1XYIA 4A3JH 4CHTB 4A3FH 4RMFA 2IT1A 3CXCA 2ZTCA 3O13A 3S1NH 4CDCC 2OQKA 1XJVA 2DY7A 1DYQA 2EJFC 2G9HD 4ULLA 4KY7A 5KRUA 3S2HB 1PTOD 4JI4Q 1KAWA 2KJXA 4K5XA 1VF5C 2E2JH 3ICEA 2HDLA 3OIPA 1F2ZA 1F2YA 1PMRA 4JV5L 1Q86C 4UPAA 2NVQB 2EDGA 1XMOL 5KYIA 1IW7C 1EWCA 1OXVA 2A6HC 2NZHA 2JA6H 1IBML 5I9PA 1VQ6A 4OIJA 2OCEA 1R9TB 3RZDH 4B3SL 2NN6I 4JBMA 2VB2X 4BY7H 4C1NI 4YCUA 4JI8Q 1KXLA 4UP9A 1WYDA 1EEFD 3SDZA 4HCSA 1KC8C 4OIKA 3FVQA 4R4CA 4OWTB 4WJWA 4JYAQ 3W3AA 3M85A 5JOBA 1F9QA 1VF7A 4Y7NH 5CGKA 3A8KE 3NQIA 4GZYC 4JK1C 3AYHB 4LFAL 4AYBB 3P20A 2VQEL 1MD2D 4KV6A 1Q81C 2PW5A 2ATWA 1PZID 2R7ZB 4WRDA 1D6EC 1PZKD 5KGUA 4LFCL 3KF6A 5AJ3Q 4FO2A 4IFDI 1GUTA 3RNUA 1TKWB 5JJLA 3EBEA 3KLSA 1OXXK 1BXTA 2QGQA 2X6LA 1X3QA 5EQ0A 4QUCA 2L55A 4R4OA 2UXBQ 1B70B 1SMYD 5COYA 1K28A 2G9DA 1HTPA 3SR1A 3EROA 1D1IA 3GTOH 2YYZA 4LF5L 3NP8A 1RCVD 4BA1I 1YNNC 3FDTA 4RGTA 2N78A 1BNZA 3G6JB 3OYYA 1A2UA 4ZRZA 3Q8DA 2N8NA 1B7YB 2JE6I 1PH8A 2WKDA 3K58A 2JA6G 1E2ZA 2HCCA 1RHPA 1HR0W 1QNKA 4DR1L 2NVYB 1WTRA 2R6GA 5ELFA 1HTLD 3U50C 2Q2IA 3DM1A 1TQOA 1B4OA 2BOSA 3T13A 1TIID 4RH6A 1VQBA 1J9OA 3KFUA 3S9WA 3OPOA 5HY6A 3HG9A 4P75A 4Z9CB 1WTWA 2IHFA 1SNDA 3KF8A 1EQRA 4MN3A 2KHSA 3RN2A 3R3OA 2DNCA 3NWSA 2Z6KC 2UU9L 1Q82C 3S2DB 5M3MH 1YI2A 3J7A5 4DV5L 4BBSH 2XNAC 3URYA 1Q46A 2QW7A 5CR3A 3SHLA 2R3ZA 1EFWA 1Z47A 4HSVA 1EZ6A 1LTAD 3ULLA 3E0JA 4CKEA 3HOVH 1E1TA 1EIHA 2B8FA 2M2LA 4X65L 3A8JE 4IUQA 2IX3A 1F2MA 2ICIA 2CFMA 3SXHA 5JJZA 5FJ8G 1C8CA 2QDBA 5NUCA 4ZCKA 1EQTA 5KNBA 1BCPF 1S4ZA 1CKNA 1GD7A 1VQJA 3HOWH 2EY2A 1L0XB 4DUYQ 5JJKA 2M9VA 2EYJA 2K5QA 5M3FH 1Y8NB 1D5XC 3T16A 2VQFL 3HOUH 1EOTA 2IX0A 2SNSA 4DR5Q 2CH4A 1U9RA 2MPMA 2O2LD 2MO0A 5IWAL 3CC7A 1X32A 5IGGA 2F0JA 3SEBA 1A3VA 2AQ1B 4DR2L 4KN4C 1X3FA 1ESRA 2L9HA 1NMFA 5M5XH 4UY8C 2VUMB 4QIWE 1T5EA 3K5NA 1WVLA 4DPGA 1F9SA 1EYDA 1STBA 3IRBA 3NBHA 4DGZA 2JA5H 2R92H 1NE3A 1LTRD 1QUQA 1PYWD 1B3QA 3T4AC 3I73A 1DOMA 1VQEA 2V1CC 2QILA 1KLGD 3TP7A 5JEAH 3R8BA 2R7DA 2Y0SB 3PF5A 4DR7L 1PH5A 1Z6HA 4GLXA 2RSNA 5M3MG 4H02A 2R93H 3S1QB 4IALA 4BBRB 4BBSG 2PPBC 3S14H 1TS3A 3STBC 1EYGA 3T53B 5DLQE 4LF8L 3D3RA 1HZ9A 3HOVG 1IKMA 3SVMA 3CAMA 4DV7L 3KBGA 4UAIA 3KLWA 2EOTA 3A54A 4PNYA 4ALPA 2L0CA 3B6YA 2YU9B 1ET9A 1UE1A 1G6ZA 4HJ5A 2K4KA 1E2VA 2E5LQ 1DGSA 4JG2A 1GXDC 2IPKD 3P75A 2DJFC 3UDIA 3HKZB 1M8AA 4M8AA 4G4KA 3CF5A 5M3FG 4B3MQ 3HOXB 4NMZA 3OW2A 4L6TB 2ALYB 3HOUG 2NWGA 1E3PA 2NZOA 1N8RC 1EY8A 1CI3M 3NPPA 1HPCA 4RAUC 3M4OH 4GOPC 2EE1A 4P2CB 3KJOA 2V4DA 3RD4A 1UEAB 2B63B 1ZEQX 3MFYA 1CA6A 1EWHA 5T1GA 1TWAH 3GTGH 1TS5A 3NEMA 3NTKA 3ULJA 1KL9A 5FKAC 1V9PA 3WWVA 2B2YC 4DNTB 1WTHA 3BDOA 1YBYA 2EIFA 3L3OC 5EPJA 1OXUA 3NUCA 2B2TC 4IFDJ 1E1OA 1YITA 4KHPQ 5C44H 2Z6KA 1TS4A 3W1BA 2PZTA 1B53A 4YY3L 2GN5A 1SFOB 4EX5A 2JEAI 4CJ2C 2XRSD 2WB1B 5C4JH 2VNUD 2WFWA 5IYBG 1PRTD 2VUMG 3MTSA 3RLOA 5FLMG 1YIJA 2J4XA 5M5YB 1TWGB 2R93G 4K0KL 3A5UA 2UUBL 4NW2A 4XQQA 2ZJRA 4ABNA 1QJOA 1BCPC 1YZ6A 2IX1A 3TQYA 3DMUA 3PMFA 1ILPA 2F0TA 2B2UC 4PMWA 2UXDQ 3A7LA 1JORA 3X3MA 3X3NA 1EU3A 5A2QE 3AFPA 5G3LD 1PA6A 2BH2A 4R1JA 1LTGD 3HOYB 3SK5A 4BBRG 1STNA 4CKBA 4IZ8A 2K5NA 1EQQA 2L4NA 1MSGA 2KVMA 2H4OA 3J7ZC 2ID0A 4XXEA 5CBAE 4WJ3M 3R93A 2B3GA 1X3PA 3ND9A 4RKLA 1HR0L 3H94A 4DV2Q 1EIGA 2YTVA 5I6YA 4A3CH 2F0MA 3P1HA 1HFGA 5CBEE 4JI7Q 2PMZB 4IUNA 5H1SE 3UDFA 1FL0A 2HCIA 4A3KH 3R2TA 3UE0A 5IP9G 2JA8B 4KK7A 3BDLA 2IWHA 1NMGA 3KK7A 2IY5B 5IODA 1PFBA 4K6DA 5ELCA 3CC2A 3QB3A 3V96A 3SK6A 3ULPA 4LFBQ 1VMCA 1XMQL 1SJHD 3CCJA 1V43A 4DK1A 5J1ZA 1B1ZA 1N36Q 1JB3A 4BWGB 5C44G 3T1YL 4DV1L 3LWUA 2IW3A 1PTOC 5E3FA 1PFMA 2EXZA 1IKLA 4XT1B 3K6OA 3FEWX 1A6XA 1I4GA 4JI6L 3PGZA 3BYTB 4L5TA 1K83B 1A15A 1NR2A 3PV0A 2B63G 1K8AC 3HOZH 5C4XB 2KCCA 1QB5D 5M5WB 5JVG3 4IURA 4XQNA 4C56C 3BZKA 1PZJD 4JI0Q 2KHIA 4DV3L 1CUKA 1L2FA 1JOOA 2ZXPA 3GTLH 5LMUQ 3V2TA 3DUZA 1EWIA 4LK1C 1O7YA 5C6AA 1NR4A 4H44C 5BR8Q 1XNQQ 5IOCA 1J5EQ 1J8IA 1M90C 1CZWA 2WB1G 4PZ8A 5DEHA 1ILQA 4DUZQ 4C3JB 4L5RC 2EJGC 3C46A 2Z9HA 4GOPA 4DKAC 4IUUA 1ASYA 3TN2A 2A69D 3W1GA 3CCRA 3T1HQ 3D6WA 1RTNA 1PH4A 1B3AA 3NWTA 1GUGA 4GKJL 3ERQA 2B2YA 3VR3A 4OGQC 2AQ2B 3CMEA 3D0FA 4A3CG 3D8GA 2J7ZA 5EPKA 2CQOA 2KBNA 3BVMA 4L63B 2B2TA 4LF6L 4C3HB 1K9MC 2LFNA 4I7AA 2PI2E 4K5WA 2Z1CA 4OXPA 2KA7A 2C9OA 1I4HA 1SAPA 3JAMi 3OIQA 1HXYD 5I2YA 1ZYRD 2P5ZX 5FO7B 1OO9B 4ME3A 4RG1A 1MJCA 3NSWA 1ENAA 3E6ZX 2NVXB 4UP7A 5LMNQ 4F8MA 2ENBA 2PQAB 1PLFA 3KF8B 4LNQA 1S5FD 4JI1L 1W6JA 3M4QA 3J7AV 4ZYSA 4DU9A 2JA8G 2NUCA 3K57A 1LT3D 4GNXC 4A3IH 2B2UA 4GKKQ 5LL6X 2AHOB 1FYCA 1B8AA 4OHJA 4O42A 5FLXc 2AUKA 1Q3LA 2M00A 5J39A 2EJMA 1TWCH 1LT5D 4BXXH 2WACA 2HHHQ 2RCFA 1K3BC 5ELNA 1PH6A 2LXKA 4DR6Q 1Y1VB 4DAVA 4POGA 2PW7A 3K7AB 4L5QA 4A4IA 4C3IB 4JW0A 4G7OC 3RZOH 4FF2A 2AQ3B 3BU2A 1C9OA 5HURA 1BBXC 1JOKA 3S16B 4EQ5A 4JI4L 3MC0B 1TWHB 1CM9A 1V1PB 2NVTB 3G4SA 3CU7A 2E75C 3C1FA 2RSOA 3J80i 1P16A 2F0FA 4KY6A 2K50A 2XWBB 3TDQA 2D0PA 2NB0A 4DA2A 3PO3H 3Q0AA 2BDNA 2N3SA 3NBHB 4C1NK 1SYDA 3CW2C 1PV4A 4JI8L 4A3MB 1QUQB 1D7QA 4IOCA 3L0OA 3TZDA 3GTMH 4L8JA 4P72A 4JI5L 1O7LA 1LT6D 5GROA 1L0WA 3OWFA 1FGBD 4DV6Q 5G3LF 5KNDA 3DEOA 1TVXA 4K2LA 1VQMA 5IGEA 1VMPA 1Q90A 3ZJYC 2HIVA 1NCVA 3FPUB 4X64L 2KQ3A 4C3HG 1IBKQ 1IBLQ 4LJZC 1XTCD 4A3EB 5CV7A 1JE4A 3BG3A 3I72A 1RL2A 1CHPD 3CD6A 2K28A 1WTVA 4Q0FA 2JSOA 2CQAA 4F7XA 1WCMH 2B8GA 3HGBA 3K0XA 3GDEA 1TY2A 2BE5D 1EIYB 2RA4A 4LF4L 4WFN3 1SBBB 1CQFA 4ZQ3A 1EUJA 1O80A 2FXQA 3ER0A 4LF9L 1KQSA 5I9OA 2ZXOA 1C4QA 2KECA 1NAPA 1IL2A 2VS1A 1JICA 1YNXA 2A68D 4KTAA 1DOKA 3S1RH 2RQXA 4HIDA 2E2DC 1KNAA 1TT2A 3AQQA 4DAYB 1HNWL 4DR3Q 1ICFB 4OX9Q 2F0QA 3K81C 3NK9A 1CT1D 3HZXA 2QEXA 1BR9A 1I3QB 3E9IA 1RJTA 3PO3G 1H9SA 4X66Q 1YHQA 2HDMA 4RWSC 3QR8A 1GVPA 2D0OA 5BN4A 2XN9C 3A55A 3D4WA 1B9MA 3EN2A 1WTXA 4QUFA 1EY0A 3S2HH 2K1BA 4GNXA 2YTYA 3M7NA 4DXGA 1X56A 3I4MB 3ITPA 5DAUA 2K5VA 3J81i 4LF7Q 5K36G 5TSSA 2LKVA 2NVQH 4MHEA 1CKMA 2PCFB 3IFDA 2LS01 4IPHA 1LTLA 2JK8A 1W6KA 2BH8A 1R9TH 3BVZA 1YHAA 2O5IC 3MXGA 3SGIA 4GN3B 1Q1BA 1WCMG 1CFMA 1EY4A 1EOVA 5DNFA 3JC66 4OELB 1B9NA 3PIOA 1M4VA 2EYLA 5FJ8H 4DUYL 3OWEB 4RHSA 3GV6A 4HMIA 1XPOA 3H6MA 4A3EG 4HSPA 3E3XA 4YHHQ 1SYFA 1Z7TA 2MFIA 4KD4A 5IGBA 3GV3A 4X62Q 1JR0D 1VQKA 5IY0A 4WORA 4ZK9B 2WAQB 4OEMB 1HNZQ 3MA2B 4DR5L 2F0IA 2FMMA 4R4QA 3D6CA 1U4RA 5ISRA 2HQEA 5F2DA 2R7ZH 2QF7A 4HCEA 3HS0C 4GN5A 2FHTA 3GTJB 3L7ZC 4XYQA 5C3EB 2I46A 5EKLA 1AZQA 5CV4A 4CDFC 4MTKA 4A3DB 3CCVA 4AQYQ 3EJIA 3ND8A 3AB9A 4BS9A 1SE4A 1CQVA 3BYYB 3GTPB 2DY8A 1A3UA 2F52A 4TRDA 1G2TA 4QF4A 1LLRD 1G291 1STAA 4LW1A 2G5DA 2ICEC 3A8IE 2Q8IB 1K8MA 1ICWA 2J0TD 3H3VI 4A93B 2EZVA 2PQAA 4AYBE 2WINB 3H09A 4P73A 4QL5A 2QA4A 4JV5Q 1E7ZA 4N8FA 1N33Q 4OO1G 2F3VA 1JWMD 3UE1A 4PG3A 2OWOA 2VL6A 2NVYH 3BZCA 1GHKA 4X3KA 4B3SQ 1BDOA 2Z6BA 3I4MG 2HUGA 2E5LL 1IL8A 3ERSX 4X3TA 3I90A 3CPFA 4LWCA 4GOPB 3EQLC 4PZ6A 2OTJA 3S2DH 5EPLA 1TS2A 3KOJA 2NYZD 2RDHA 1S5CD 4OL7A 1L0YB 4PQXA 5IGFA 1XNRL 3W5OA 2JA9A 4KHZA 4AYBG 1RDPD 2VY3A 1NTGA 1V1PA 4LFAQ 1ENFA 2R7ZG 2K7VA 3I7FA 5C5MA 1TU2B 1TR5A 3I4NB 3BVGA 2HT1A 1CZGA 2CH4W 3J81L 4KN7C 2K04A 2KHJA 2WP8J 2OQ0A 2RHSB 4A3LG 2A8VA 2VZAA 4IOAA 2A69C 3DWPA 3CCLA 1Q8IA 4DN4M 4B3TQ 1BCPB 1J6QA 2UXCL 2DN8A 4LF5Q 1I6HB 1WFQA 2F0KA 5IYBH 1P8LA 3M9BA 4S3SA 2VUMH 4QCLA 5FLMH 5KNCA 4RCOA 3ZYYX 1AW7A 1U4MA 4A3GB 1PTOF 1PXUA 2CWPA 2GVBA 1ESFA 2B2VC 1SYCA 4OWWB 3QJYA 1K0RA 1HUNA 2UXDL 3NHHA 1KD1C 4NXNQ 1G8ZD 3W2DA 1STEA 5IP7H 3CKIB 3TS2A 3I4LA 1EY7A 2X6GA 4LUOA 3JAMc 4JBKA 3MAQA 4CKCA 4DV0Q 1JC7A 4TSSA 2FJ2A 1NUCA 3WOFA 1UNSA 3DWQA 4FF1A 3S1QH 4BBRH 2MQHA 3G7LA 1H9RA 3VR4A 1PH2A 1VQAA 3Q23A 4DV2L 1D5ZC 2R61A 3RN5A 2RKSA 1VQ8A 4JI7L 2RBMA 4JVZA 2E2HB 5EBDA 2CHBD 4KKTA 3NBIA 5C3WA 5FLXL 2XWJB 3MXNA 5JVH3 3Q24A 4H13C 1F77A 4V190 2PNRC 2A6HD 5E4XA 4DAYA 3I55A 2ZM6L 1I50B 3CMAA 1U4LA 4TQUS 2YU9H 1QVFA 1PTOB 1HQMC 1V8QA 3TP8A 5IP9H 2RCNA 3OW7A 1QILA 2TMPA 1JE5A 2A74C 2EYMA 4YWMA 4LFBL 2ZTDA 3VA5A 4JI2L 1G6PA 4EQOA 1EQVA 3GO5A 1N36L 2Y0SE 1MHWC 3U4VA 5KEEA 1SYEA 3HOXH 2A73B 2MGSA 3BDCA 4IPGA 4KY5A 1SJED 2L15A 2R7FA 3I4OA 1OXTA 1C48A 3VR2A 3PIPA 3CQZB 5T1IA 1Y1WB 3I4NG 5IWAQ 2B63H 3J80c 2K14A 5JPNC 5LMUL 1LABA 3PO2B 4GLVB 1PHJA 5BR8L 5FK9C 5IT9L 1GUOA 3DHQA 3HKZE 5IP7G 1SFOH 3FPPA 3I2ZA 1LO5D 2FMCA 2LXJA 4K5VA 2KUMA 2F3WA 1PYSB 2Y0SG 3H0GB 4KKUA 2NZ1D 3PF4A 2GA4B 3CP0A 3CCUA 4DR7Q 4EGVA 2K33A 5M5YH
chains in the Genus database with same CATH topology
1SE2A 4PMBA 3SK4A 1DM0B 3KUPA 1CK1A 3CHBD 2E2IB 3I3CA 2L12A 3IL8A 1H9SB 3MVVA 4A3BB 3T56B 2EY6A 3P7JA 4RGMA 1TWFB 1DXMA 1R4PB 2ZT9C 3V05A 5CV6A 1Y69U 2BCOA 2LY7A 3LWEA 5E1FA 3EVQA 2A68C 3A56A 4DXFA 1I4QA 4XDXA 4RA8A 2QEJC 2A6ED 3D4DA 2XSCA 3K5LA 1XWEA 2CVRA 2AWNA 5IGCA 2RVLA 3FKIB 4RGNA 1D5MC 1S5DD 3MEHA 3J7YW 1BO0A 4YIJA 1STHA 1CTMA 3WDNA 3S17B 2CW0D 1STGA 2FFKB 1WTPA 3J7AF 1D1KA 4K14A 5FO8B 1DZ1A 1QWYA 1FNWA 2F03A 2B39A 5I2XA 4LAAA 5EKIA 1VDZA 4CJ0B 5BN3A 3S15B 1ONLA 2D2CC 2PZUA 4CJ1B 5M9OA 1SMYC 1BOSA 1EYCA 4DF7A 3AMUA 3GTQB 4IQZA 3GP7A 3L9AX 4K8IA 2F1MA 2EVBA 3M3YB 2JA7B 1HA5A 1F9RA 5KYLA 2JP1A 1SNPA 1S5ED 3VYSA 5EKKA 1LTBD 3QOJA 2L11A 1LV9A 2Q8TA 1E0BA 4M1UB 1KNEA 4BA2I 4F87A 1GOZA 5D3DA 2F4IA 3S1MB 3VYRA 1IYUA 4HAEA 1UUPA 1AN8A 1PRTF 1S5BD 3KLSX 1H9KA 1VCIA 3OHXC 4XIGS 3T51B 2IL8A 4C3JG 2F0WA 4KKSA 4FNFA 2RDFA 5EGTA 3PUXA 3IAYA 2F0SA 4C2MB 1WD0A 1JCKB 4BY1B 5K36H 4IN3A 4ZUIA 4HMJA 4UDUC 3BZDB 1QOHA 1PRTB 3F2UA 2XRQD 2XVSA 4NDXA 1YNJD 3GTKB 1EFID 2EPBA 4A3JB 3A7AB 3PUZA 4A3FB 3QO2A 4F88A 2F0UA 1XXGA 4B9XA 3S1NB 1A3TA 3TBIB 4FXDA 4H0LC 1BF4A 2BA1A 5CYUA 2E2JB 3JAML 2EYPA 2WKCA 5AFWA 1B50A 4C3IG 5FO9B 1O78A 3HEJA 3U9SA 2JA6B 3NE5B 5HGTA 1I4RA 3RZDB 4V0BA 1DD2A 1STYA 1F9PA 4BY7B 5C3XA 3NXWA 4IFDG 2NTSA 4I65A 3EFXD 3SK8A 1AZPA 4IUPA 4LMQD 2VXWA 4OO1H 1ET6A 5D3IB 4B08A 4Y7NB 1ML0D 3QG1A 2ZXRA 5C0XH 4FXKC 3E5SA 4H7BA 1WTQA 3GQBA 3MXPA 3VR6A 5C4HA 2LMCB 1DONA 3J80L 4K6LA 3H3VC 4XT3B 1FNVA 1PRTC 2K5WA 4HTHA 2F0DA 3MWYW 1GJXA 3GTOB 4KMUC 1AFPA 3C2PA 4K8JA 3N52A 1ENCA 2JXMB 2FINB 4DK0A 5CV8A 5IIFA 4J1MA 4FF3A 4TKOB 2F0OA 3Q22A 3GD7A 1GUNA 4FYDA 1KAAA 4DNRB 4R8IA 1HQRD 4J8QA 3PUYA 2F0VA 1SNOA 1JWSD 3CRKC 1CA5A 1Q12A 4IUVA 5M3MB 1BUVT 4BBSB 2VB3X 2K05A 2EY5A 3UI2A 5C0XG 1U4PA 3HOVB 1IHZA 1WD1A 4QIWB 3CRLC 4DAPA 3IFTA 4U673 3PIO3 4CGYB 4KJNA 1I4XA 4PV1C 1H9MA 1SE3A 1FR3A 4XTCS 4FF4A 3HOWB 1B2TA 4KHVA 1HUMA 5M3FB 2A6EC 4RKBA 3JAME 2D62A 3HOUB 3VR5A 2F0NA 3RLFA 3EA6A 3K5MA 4NP5A 1IYVA 3U9OA 2O4XA 4ID6A 2WIIB 2IJ0A 5M5XB 4RFBA 2Z4IA 3OMCA 1EEID 5C5LA 3TSSA 1T5XD 5A2QL 2K03A 3PUVA 2AWOA 1R4QB 2I07B 2JA5B 2R92B 5E4WC 1KDBA 1EY5A 1PDQA 1H9JA 1MSHA 1G2SA 4ZUJA 4OO1I 2EYHA 3NTIA 4K2KA 2CW0C 1HA6A 1LTTD 4O1NA 5C0XI 1E2WA 2N55A 3OOCA 3M7GA 2R93B 1DCZA 3S14B 2OF1A 4HEDA 2B2WC 2H1EA 1RTOA 2Z8LA 1ZYRC 3J80E 3NTHA 4EVOA 1XX8A 2SDFA 2K6AA 2QCPX 2NBFA 3ONAB 3DWAA 4MIUA 2E76C 4EQNA 1JQYD 2D9UA 4U68A 1QNUA 3BS1A 2QKIC 4IUTA 3M4OB 1IW7D 2Z4HA 1A2TA 2K01A 1TWAB 5IGDA 3GTGB 3DEPA 3K59A 1Y8PB 4ODGA 3C3LA 4XYOA 5C44B 3K5OA 4XQJA 3I70A 2PZWA 5EJWA 2XIWA 5KIXA 3I8ZA 1PTOH 5C4JB 4RCNA 2BDOA 1BQQT 2EYOA 1TY0A 3TP6A 1Y8OB 4RHRA 5FOBB 4G7HC 1D2BA 1KDAA 1LACA 1I4PA 2OXPA 1RKNA 4QMGA 5JEAG 1SDFA 3KLRA 3TZUA 1HCZA 3QIAA 1SEBD 5CV5A 3PUWA 2MHVA 1EZ8A 1JWUD 2DNEA 3VA7A 1F2LA 1FD7D 1UAPA 2NTTA 4Q5VA 4NKLA 4N9TA 1HFNA 1YNND 4RGOS 5ELDA 3QWNA 1MI2A 4ZAIA 4E6IA 5I6WA 3J81E 1YNJC 2MP1A 4A3KB 3DXJC 2BE5C 1KTKA 1KDCA 4FVMA 3VYUA 3C1EA 2F0LA 4G7ZC 1AP0A 5CORA 3FMCA 2Q8RE 5C4ZA 3KBXA 2EY1A 3IKJA 3NQTA 3MXUA 2B2WA 2B2VA 3PIP3 2BA0A 4ZKBB 1DJRD 5DM73 1Q1EA 4DFAA 3HOZB 1G91A 2JEBI 4X3SA 1HHVA 1GHJA 2O5JC 5CV9A 1FNUA 3GTLB 1K8OA 1SYBA 1SSOA 1WTOA 4R8NA 3RMHA 4FXGC 2SEBD 1ZXTA 5C0XJ 5FLXE 4ME5A 2JYOA 4B9WA 1B44D 3FRPB 1RODA 4HN7A 1ZKOA 4ZLTF 2TSSA 2K32A 5I4DA 1KABA 5LL6S 2RDGA 2A5HA 2F0GA 3D31A 3MHBA 5DM63 1MGSA 2E74C 2X69A 1HRJA 4EQPA 2N88A 1GUSA 2EYFA 4CBVA 3HRZC 2OT2A 1O7ZA 4HR7B 1I6VC 1LT4D 3R2IA 2AUJD 1II3A 2OEOA 4KJOA 4A3IB 2PQEA 4J6HA 2KEEA 5JPMC 3I91A 4QB4A 3H91A 5IT9E 4PMCA 1TWCB 3MFGA 5CMDA 4R9WA 3WOEA 1QCBD 5D14A 3K0YA 2NN6H 3RZOB 2MUYA 2K5DA 3D4RA 2L1BA 1AEXA 5K5PA 1V1OA 1QE6A 2MJ8A 2SOBA 2L5TA 5ELEA 2PO4A 1SNQA 1CHQD 1OXSC 2WV6D 3SE0A 5A35A 3PO3B 1NSNS 4N9PA 1EY6A 5D65A 1EYAA 1SXTA 2KCNA 2F0PA 3GTMB 2F0EA 3N6RA 1QG7A 2D5DA 4IFDH 3LX0A 3LNNA 1GUWA 3RUZA 4G57A 3Q6SA 1SNMA 1EL0A 4ILWA 5EBCA 4FP5D 4ZKCB 3OMGA 2F0HA 3OSOA 1BCPD 3M4YA 5J22A 4KI0A 3MZ5A 5ELBA 4I7ZC 1WCMB 5CC4A 4KD3A 1EU4A 1EY9A 2SNMA 1LTID 2KEDA 2NN6G 3TP5A 1RD9D 3TMEA 5JAVA 1JOQA 3QOLA 1MBYA 3VYTA 5LHY1 1DOLA 2PYKA 3HP3A 1PFNA 3AU7A 4JBWA 1RF2D 1SYGA 3S1RB 1SNCA 2KOLA 1KLUD 4X3UA 5JEAJ 5BN5A 2C5CA 1LTSD 1XYIA 4CHTB 2IT1A 3O13A 2DY7A 1DYQA 2EJFC 2G9HD 4ULLA 4KY7A 5KRUA 3S2HB 1PTOD 2KJXA 4K5XA 1VF5C 2HDLA 3OIPA 1F2ZA 1F2YA 1PMRA 2NVQB 2EDGA 5KYIA 1IW7C 1EWCA 1OXVA 2A6HC 5I9PA 4OIJA 1R9TB 2NN6I 2VB2X 4C1NI 1EEFD 3SDZA 4HCSA 4OIKA 3FVQA 4WJWA 3W3AA 3M85A 5JOBA 1F9QA 1VF7A 5CGKA 3A8KE 3NQIA 4GZYC 4JK1C 4AYBB 3P20A 1MD2D 4KV6A 2PW5A 2R7ZB 1PZID 4WRDA 1D6EC 1PZKD 5KGUA 4FO2A 4IFDI 1GUTA 1TKWB 3KLSA 1OXXK 1BXTA 2X6LA 1X3QA 5EQ0A 4QUCA 2L55A 1SMYD 5COYA 2G9DA 1HTPA 3SR1A 3EROA 1D1IA 2YYZA 3NP8A 1RCVD 4BA1I 1YNNC 3FDTA 4RGTA 1BNZA 3G6JB 1A2UA 4ZRZA 2JE6I 2WKDA 3K58A 1E2ZA 2HCCA 1RHPA 1QNKA 2NVYB 1WTRA 2R6GA 5ELFA 1HTLD 3DM1A 1TQOA 1B4OA 2BOSA 3T13A 1TIID 4RH6A 1J9OA 3S9WA 3OPOA 3HG9A 1WTWA 4Z9CB 1SNDA 3KF8A 4MN3A 2KHSA 3R3OA 2DNCA 3NWSA 3S2DB 2XNAC 3URYA 5CR3A 3SHLA 2R3ZA 1Z47A 4HSVA 1EZ6A 1LTAD 3E0JA 4CKEA 1EIHA 2B8FA 2M2LA 3A8JE 4IUQA 2IX3A 1F2MA 2ICIA 3SXHA 5JJZA 1C8CA 2QDBA 5NUCA 1EQTA 5KNBA 1BCPF 1S4ZA 2EY2A 1L0XB 2M9VA 2EYJA 2K5QA 1Y8NB 1D5XC 3T16A 1EOTA 2IX0A 2SNSA 1U9RA 2MPMA 2O2LD 1X32A 5IGGA 2F0JA 3SEBA 1A3VA 2AQ1B 4KN4C 1ESRA 2L9HA 2VUMB 1T5EA 3K5NA 1WVLA 1F9SA 1EYDA 1STBA 3NBHA 4DGZA 1LTRD 1PYWD 3T4AC 3I73A 1DOMA 2QILA 1KLGD 3TP7A 5JEAH 3R8BA 2Y0SB 1Z6HA 2RSNA 3S1QB 4IALA 4BBRB 2PPBC 1TS3A 3T53B 3D3RA 1IKMA 3SVMA 3KBGA 4UAIA 2EOTA 3A54A 4PNYA 2L0CA 2YU9B 1ET9A 1G6ZA 1E2VA 1GXDC 2IPKD 3P75A 3HKZB 1M8AA 4M8AA 4G4KA 3HOXB 4NMZA 4L6TB 2NWGA 1EY8A 1CI3M 3NPPA 1HPCA 4RAUC 2EE1A 4P2CB 2V4DA 3RD4A 1UEAB 2B63B 1ZEQX 3MFYA 1CA6A 1EWHA 5T1GA 1TS5A 3NTKA 5FKAC 4DNTB 2B2YC 3BDOA 3L3OC 5EPJA 1OXUA 3NUCA 2B2TC 4IFDJ 1TS4A 2PZTA 1B53A 1SFOB 2JEAI 4CJ2C 2XRSD 2WB1B 2VNUD 1PRTD 3MTSA 2J4XA 5M5YB 1TWGB 4NW2A 4XQQA 4ABNA 1QJOA 1BCPC 2IX1A 3DMUA 3PMFA 1ILPA 2F0TA 2B2UC 4PMWA 3A7LA 1JORA 3X3MA 3X3NA 1EU3A 5A2QE 5G3LD 1LTGD 3HOYB 3SK5A 1STNA 4CKBA 4IZ8A 2L4NA 1MSGA 2KVMA 2H4OA 2ID0A 4XXEA 5CBAE 3R93A 1X3PA 3ND9A 4RKLA 3H94A 1EIGA 5I6YA 2F0MA 3P1HA 1HFGA 5CBEE 2PMZB 4IUNA 2HCIA 3R2TA 2JA8B 4KK7A 3BDLA 2IWHA 3KK7A 5IODA 5ELCA 1PFBA 4K6DA 3QB3A 3V96A 3SK6A 1VMCA 1SJHD 1V43A 4DK1A 5J1ZA 1B1ZA 1JB3A 4BWGB 3LWUA 2IW3A 1PTOC 5E3FA 1PFMA 2EXZA 1IKLA 4XT1B 3K6OA 3FEWX 1A6XA 1I4GA 3BYTB 1K83B 1A15A 1NR2A 3PV0A 5C4XB 2KCCA 1QB5D 5M5WB 5JVG3 4IURA 4XQNA 4C56C 1PZJD 1JOOA 2ZXPA 3V2TA 3DUZA 4LK1C 1O7YA 5C6AA 1NR4A 4H44C 5IOCA 1J8IA 1CZWA 5DEHA 1ILQA 4C3JB 2EJGC 3C46A 4IUUA 3TN2A 2A69D 3D6WA 1RTNA 1B3AA 3NWTA 1GUGA 3ERQA 2B2YA 3VR3A 4OGQC 2AQ2B 3D8GA 2J7ZA 5EPKA 3BVMA 4L63B 2B2TA 4C3HB 2LFNA 4K5WA 2Z1CA 2KA7A 2C9OA 1I4HA 1SAPA 3OIQA 1HXYD 5I2YA 1ZYRD 5FO7B 1OO9B 3NSWA 1ENAA 3E6ZX 2NVXB 4F8MA 2ENBA 1PLFA 1S5FD 1W6JA 3J7AV 4ZYSA 4DU9A 2NUCA 3K57A 1LT3D 2B2UA 5LL6X 1FYCA 4OHJA 4O42A 2AUKA 1Q3LA 2M00A 5J39A 2EJMA 1LT5D 2WACA 1Y1VB 4DAVA 2PW7A 3K7AB 4C3IB 4G7OC 4FF2A 2AQ3B 5HURA 1BBXC 1JOKA 3S16B 3MC0B 1TWHB 1CM9A 1V1PB 2NVTB 3CU7A 2E75C 3C1FA 2RSOA 2F0FA 4KY6A 2XWBB 3TDQA 2NB0A 4DA2A 3Q0AA 2BDNA 4C1NK 1SYDA 4A3MB 3TZDA 4L8JA 1O7LA 1LT6D 3OWFA 1FGBD 5G3LF 5KNDA 3DEOA 1TVXA 4K2LA 5IGEA 1VMPA 1Q90A 3FPUB 1NCVA 2KQ3A 4C3HG 4LJZC 1XTCD 4A3EB 5CV7A 1JE4A 3BG3A 3I72A 1CHPD 2K28A 1WTVA 4Q0FA 2JSOA 2CQAA 4F7XA 2B8GA 3HGBA 1TY2A 2BE5D 2RA4A 4WFN3 1SBBB 1CQFA 4ZQ3A 1O80A 5I9OA 2ZXOA 1C4QA 2KECA 1NAPA 1JICA 2A68D 4KTAA 1DOKA 2RQXA 2E2DC 1KNAA 1TT2A 2F0QA 3NK9A 1CT1D 3HZXA 1BR9A 1I3QB 1RJTA 1H9SA 2HDMA 4RWSC 5BN4A 2XN9C 3A55A 3D4WA 1B9MA 1WTXA 4QUFA 1EY0A 2K1BA 3M7NA 4DXGA 3I4MB 3ITPA 5DAUA 5K36G 5TSSA 2LKVA 4MHEA 2PCFB 3IFDA 2LS01 1W6KA 3BVZA 2O5IC 3MXGA 1Q1BA 1CFMA 1EY4A 5DNFA 1B9NA 1M4VA 2EYLA 3OWEB 4RHSA 3GV6A 4HMIA 3H6MA 4HSPA 1SYFA 1Z7TA 5IGBA 4KD4A 3GV3A 1JR0D 4WORA 4ZK9B 2WAQB 3MA2B 2F0IA 2FMMA 3D6CA 1U4RA 5ISRA 2HQEA 5F2DA 2QF7A 4HCEA 3HS0C 2FHTA 3GTJB 3L7ZC 4XYQA 5C3EB 2I46A 5EKLA 1AZQA 5CV4A 4A3DB 3EJIA 3ND8A 3AB9A 4BS9A 1SE4A 1CQVA 3BYYB 3GTPB 2DY8A 1A3UA 4TRDA 1G2TA 4QF4A 1LLRD 1G291 1STAA 2ICEC 3A8IE 2Q8IB 1K8MA 1ICWA 2J0TD 4A93B 2EZVA 2WINB 3H09A 4OO1G 2F3VA 1JWMD 1GHKA 4X3KA 1BDOA 2HUGA 1IL8A 4X3TA 3I90A 3EQLC 5EPLA 1TS2A 2NYZD 2RDHA 1S5CD 4OL7A 1L0YB 4PQXA 5IGFA 4KHZA 1RDPD 1V1PA 1ENFA 2K7VA 5C5MA 1TU2B 1TR5A 3I4NB 3BVGA 1CZGA 3J81L 4KN7C 2K04A 2WP8J 2A69C 3DWPA 1Q8IA 4DN4M 1BCPB 2DN8A 1I6HB 2F0KA 4S3SA 4QCLA 5KNCA 4RCOA 3ZYYX 1AW7A 1U4MA 4A3GB 1PTOF 1PXUA 1ESFA 2B2VC 1SYCA 3QJYA 1HUNA 3NHHA 1G8ZD 3W2DA 1STEA 3CKIB 3I4LA 1EY7A 2X6GA 3MAQA 4CKCA 1JC7A 4TSSA 2FJ2A 1NUCA 3WOFA 1UNSA 3DWQA 4FF1A 3G7LA 1H9RA 3VR4A 3Q23A 1D5ZC 2R61A 2RKSA 2RBMA 2E2HB 5EBDA 2CHBD 4KKTA 3NBIA 5C3WA 5FLXL 2XWJB 3MXNA 5JVH3 3Q24A 4H13C 1F77A 4V190 2PNRC 2A6HD 5E4XA 4DAYA 1I50B 1U4LA 4TQUS 1PTOB 1HQMC 1V8QA 3TP8A 3OW7A 1QILA 2TMPA 2A74C 2EYMA 3VA5A 4EQOA 1EQVA 3GO5A 5KEEA 1SYEA 2A73B 2MGSA 3BDCA 4KY5A 1SJED 1OXTA 1C48A 3VR2A 3CQZB 5T1IA 1Y1WB 5JPNC 1LABA 3PO2B 5FK9C 5IT9L 1GUOA 3DHQA 3FPPA 1LO5D 2FMCA 4K5VA 2KUMA 2F3WA 3H0GB 4KKUA 2NZ1D 2GA4B 4EGVA 2K33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EYA A;  4K6D A;  4ZUI A;  3TP6 A;  4LAA A;  3QB3 A;  4HMJ A;  1SYC A;  2F0P A;  3EJI A;  4HTH A;  4ME5 A;  2F0E A;  5CR3 A;  4PMB A;  3SHL A;  3SK4 A;  3SK6 A;  1EZ6 A;  4KTA A;  2F0D A;  4NMZ A;  1KDA A;  1KDB A;  3NHH A;  1A3U A;  4TRD A;  1EY5 A;  5J1Z A;  2PZU A;  1TT2 A;  5J39 A;  2M00 A;  1EY8 A;  3LX0 A;  4NDX A;  4QF4 A;  4ZUJ A;  5M9O A;  1EY7 A;  2EYH A;  2WAC A;  4K2K A;  5E3F A;  3RUZ A;  2EXZ A;  1RKN A;  1STA A;  2F0Q A;  2OXP A;  1EYC A;  1F2M A;  3NK9 A;  1SNM A;  3HZX A;  4G57 A;  4K8J A;  3SXH A;  4DF7 A;  3MVV A;  2QDB A;  5NUC A;  1ENC A;  2PW7 A;  2EY6 A;  1NUC A;  5CV5 A;  5CV8 A;  5IIF A;  4K8I A;  2F0U A;  1EZ8 A;  1KAB A;  2EY2 A;  4J1M A;  4B9X A;  5I9P A;  2EYJ A;  3OMG A;  2F3V A;  2F0H A;  3OSO A;  5CV6 A;  5JOB A;  5HUR A;  1JOK A;  3MHB A;  2F0G A;  2OF1 A;  5CGK A;  5J22 A;  3D4W A;  3NUC A;  3MZ5 A;  5KYL A;  5E1F A;  1JOO A;  1EY0 A;  2F0O A;  2RKS A;  3T16 A;  1A3T A;  1SNP A;  4NKL A;  2RBM A;  3V2T A;  3EVQ A;  2SNS A;  4N9T A;  1KAA A;  3QOJ A;  5EKK A;  4EQP A;  2PZT A;  3C1F A;  2EYF A;  5C3W A;  5C6A A;  5CC4 A;  3ITP A;  4KV6 A;  5DAU A;  1U9R A;  2F0F A;  2PW5 A;  4KY6 A;  4KD3 A;  4WRD A;  5I6W A;  4E6I A;  4EVO A;  5IGG A;  5IOC A;  1EY9 A;  2EYP A;  2F0J A;  2F0V A;  1SNO A;  5DEH A;  1II3 A;  1A3V A;  2LKV A;  2SNM A;  5KGU A;  3TP8 A;  2OEO A;  4KJO A;  3TP5 A;  3TME A;  2PQE A;  5JAV A;  4J6H A;  3HEJ A;  1JOQ A;  3QOL A;  2EYM A;  1KDC A;  3VA5 A;  1SYD A;  1EYD A;  2PYK A;  1EQV A;  4QB4 A;  3C1E A;  3D4D A;  4EQO A;  2F0L A;  4MIU A;  5HGT A;  4EQN A;  1STB A;  4DGZ A;  4OL7 A;  1STY A;  1SYE A;  1SYG A;  2EY5 A;  5KEE A;  3BDC A;  5C3X A;  5IGF A;  1SNC A;  4KY5 A;  3NXW A;  3SR1 A;  3DMU A;  3ERO A;  3OWF A;  3PMF A;  4PMC A;  5C4Z A;  1EY4 A;  2EY1 A;  1IHZ A;  2F0T A;  4I65 A;  4K2L A;  3ERQ A;  5IGC A;  3NP8 A;  1JOR A;  3NQT A;  3D8G A;  3SK8 A;  3TP7 A;  5IGE A;  2EYL A;  2KQ3 A;  5C5M A;  4KJN A;  4DFA A;  1TR5 A;  4HMI A;  1A2U A;  3MEH A;  3H6M A;  1A2T A;  5IGD A;  4K5W A;  4KHV A;  1SYF A;  5CV7 A;  3SK5 A;  4IAL A;  4KD4 A;  5IGB A;  4YIJ A;  4WOR A;  2F0W A;  1STN A;  2RDF A;  4IZ8 A;  5EGT A;  1STH A;  4RKB A;  1AEX A;  4ODG A;  5CV9 A;  5K5P A;  4KY7 A;  5KRU A;  4F7X A;  3E5S A;  2F0I A;  2SOB A;  4RKL A;  4QMG A;  2F0N A;  4H7B A;  1ENA A;  1SYB A;  1STG A;  1TQO A;  2F0S A;  3DHQ A;  4NP5 A;  4B9W A;  1SNQ A;  3D6C A;  3T13 A;  4K5X A;  5I6Y A;  5ISR A;  2F0M A;  3P1H A;  2ENB A;  2HQE A;  3U9O A;  4K14 A;  5F2D A;  4F8M A;  2O4X A;  3S9W A;  4R8N A;  2PZW A;  1F2Z A;  1F2Y A;  4ID6 A;  4IUN A;  4K5V A;  4PNY A;  3MXP A;  5C4H A;  2F3W A;  1SND A;  4ZQ3 A;  5KIX A;  4DU9 A;  2KHS A;  2F0K A;  2NUC A;  1NSN S;  3R3O A;  4N9P A;  1EY6 A;  4S3S A;  5EKL A;  3BDL A;  3OMC A;  5KYI A;  3P75 A;  5C5L A;  5I9O A;  5CV4 A;  5IOD A;  2EYO A; 
#chains in the Genus database with same CATH topology
 1TWG H;  2H5X A;  4A3G G;  1SE2 A;  4PMB A;  3SK4 A;  1DM0 B;  3KUP A;  1CK1 A;  3CHB D;  2E2I B;  3I3C A;  1VQG A;  2L12 A;  2UUA L;  4LF8 Q;  3CCQ A;  3IL8 A;  1AH9 A;  1H9S B;  3MVV A;  4DV7 Q;  4A3B B;  3T56 B;  1LUZ A;  2EY6 A;  2XGT A;  3P7J A;  4RGM A;  1X3E A;  1TWF B;  1DXM A;  3HOY H;  1R4P B;  3DLL A;  2ZT9 C;  1AE3 A;  3HKZ G;  3V05 A;  5CV6 A;  4GNX B;  3NEN A;  1WJJ A;  2WB1 E;  4APV A;  1Y69 U;  2BCO A;  2LY7 A;  3LWE A;  5E1F A;  5LMN L;  3HOX G;  2MO1 A;  3EVQ A;  2A68 C;  3A56 A;  4DXF A;  1I4Q A;  4GKK L;  1X65 A;  2JA8 H;  4XDX A;  4RA8 A;  2QEJ C;  2A6E D;  1CSQ A;  1BKB A;  5EAY A;  3D4D A;  2XSC A;  3K5L A;  1XWE A;  2K75 A;  2CVR A;  4IPC A;  1IXR A;  4DV4 L;  4YCV A;  2AWN A;  1GO3 E;  4DR6 L;  2CWA A;  5IGC A;  2RVL A;  3FKI B;  4RGN A;  1D5M C;  1S5D D;  1K83 H;  2RF4 A;  3MEH A;  3KYH C;  5C4X H;  1A8V A;  3KDF B;  5M5W H;  3J81 c;  3J7Y W;  1I94 Q;  2PMZ E;  1IZ6 A;  1BO0 A;  3K8A A;  4YIJ A;  1STH A;  1CTM A;  3WDN A;  3S17 B;  4K0K Q;  2C35 B;  2KCM A;  2CW0 D;  1STG A;  2FFK B;  1WTP A;  3J7A F;  1D1K A;  1VQ5 A;  4K14 A;  5IYC H;  5FO8 B;  1DZ1 A;  1QWY A;  1FNW A;  1HNX Q;  2F03 A;  4WJ4 A;  1U5K A;  2B39 A;  4UHV A;  4JI3 L;  5I2X A;  4C3J H;  3HOY G;  4LAA A;  3RLN A;  5EKI A;  3A74 A;  4O0A A;  4DV6 L;  4X6A H;  1VDZ A;  4CJ0 B;  5BN3 A;  2Z0S A;  3S15 B;  1ONL A;  1LYL A;  2D2C C;  2PZU A;  4CJ1 B;  1S40 A;  5M9O A;  1X55 A;  1HR0 Q;  1SMY C;  1BOS A;  1EYC A;  1IBK L;  4DF7 A;  3AMU A;  2OTL A;  3GTQ B;  4A3B G;  4IQZ A;  3GP7 A;  4C3H H;  3L9A X;  4K8I A;  1BVS A;  2JQO A;  2F1M A;  2EVB A;  3M3Y B;  2JA7 B;  1HA5 A;  1F9R A;  1N32 L;  5KYL A;  4P71 A;  2JP1 A;  1YVC A;  1SNP A;  4DR4 Q;  1S5E D;  3VYS A;  5EKK A;  1LTB D;  3QOJ A;  2L11 A;  2K52 A;  4POF A;  1VQ4 A;  1LV9 A;  2NVX H;  2YTX A;  2Q8T A;  1E0B A;  3F1Z A;  1XPU A;  4M1U B;  1KNE A;  4DV1 Q;  3G71 A;  4BA2 I;  4CDE C;  4F87 A;  4JI6 Q;  1GOZ A;  5D3D A;  5C4X G;  1UEB A;  2ASB A;  3PQI A;  5J3B A;  2F4I A;  3S1M B;  1MKH A;  3VYR A;  4OX9 L;  4JOI C;  1IYU A;  4DV3 Q;  4HAE A;  1MJE A;  1UUP A;  4TVA B;  1AN8 A;  1PRT F;  1S5B D;  3KLS X;  5IYC G;  1H9K A;  2F3I A;  1Y1V H;  1VCI A;  3K7A H;  3OHX C;  4XIG S;  4C3I H;  1KIX A;  3T51 B;  2YV5 A;  4NPS A;  2IL8 A;  4R4I A;  4C3J G;  2MNA A;  3S16 H;  4MTN A;  2F0W A;  4KKS A;  4FNF A;  3FHW A;  2RDF A;  5EGT A;  1TWH H;  2NVT H;  1X6O A;  3PUX A;  3IAY A;  3TRE A;  2F0S A;  4C2M B;  5IT9 c;  1WD0 A;  1JCK B;  3CC4 A;  1UE5 A;  4BY1 B;  5K36 H;  2IHE A;  1ASZ A;  4HIK A;  4JYA L;  5GAE C;  1EIF A;  4LF6 Q;  4IN3 A;  4ZUI A;  4A3M H;  4HMJ A;  4UDU C;  1FJG Q;  3BZD B;  1QOH A;  1PRT B;  3F2U A;  2XRQ D;  2XVS A;  4NDX A;  1YNJ D;  3L2P A;  3GTK B;  5AJ3 L;  1EFI D;  4IJL A;  2EPB A;  1K8G A;  1PFS A;  4A3J B;  3A7A B;  2JN4 A;  3PUZ A;  4A3F B;  4B3R Q;  3QO2 A;  4JI1 Q;  4F88 A;  1JMC A;  3F2D A;  2F0U A;  1XXG A;  4B9X A;  4A3E H;  1HNZ L;  3S1N B;  2UXB L;  3VDY A;  2JA7 G;  1PH9 A;  3E9H A;  5GAD C;  3MXN B;  1A3T A;  1L1O B;  3TBI B;  3TEH B;  4FXD A;  4H0L C;  1BF4 A;  2BA1 A;  5CYU A;  3A5Z B;  2E2J B;  1N34 Q;  3JAM L;  3I56 A;  2Q2T A;  1YHB A;  2EYP A;  2WKC A;  4GS3 A;  4IJH A;  1Y1V G;  5AFW A;  1B50 A;  1IYJ B;  4C3I G;  5FO9 B;  4AQY L;  1O78 A;  3HEJ A;  3U9S A;  2JA6 B;  1FVI A;  3NE5 B;  5HGT A;  1I4R A;  3RZD B;  4V0B A;  1DD2 A;  3CCM A;  1STY A;  1F9P A;  4BY7 B;  5C3X A;  3NXW A;  4IFD G;  2NTS A;  4I65 A;  3EFX D;  1YJ9 A;  3SK8 A;  1AZP A;  4IUP A;  2RHQ B;  4LMQ D;  1N33 L;  1I3Q H;  2VXW A;  4QJF A;  4OO1 H;  1ET6 A;  5D3I B;  2E8G A;  4B08 A;  4Y7N B;  4A3M G;  2F4V Q;  1ML0 D;  3QG1 A;  2ZXR A;  4NXM Q;  4AIM A;  5C0X H;  4FXK C;  3E5S A;  1H95 A;  3PSI A;  4H7B A;  1WTQ A;  4JI5 Q;  1NJI C;  3I4M H;  3GQB A;  1HZC A;  5IYD G;  2PNH A;  4BY1 G;  1VQL A;  5E7N A;  3MXP A;  3VR6 A;  2PI2 A;  5C4H A;  2UUC Q;  2LMC B;  2QDL A;  4N8X 1;  4JOI A;  4X64 Q;  4HJ7 A;  3OTO Q;  5GQO A;  1DON A;  3J80 L;  4K6L A;  3H3V C;  4XT3 B;  1D8L A;  1CSP A;  1HZA A;  1FNV A;  1PRT C;  2K5W A;  4HTH A;  3TS0 A;  2DJG C;  2KCT A;  3KDF A;  2F0D A;  1VS0 A;  3MWY W;  1GJX A;  3GTO B;  4KMU C;  1AFP A;  3E0E A;  3C2P A;  4K8J A;  3N52 A;  4A3J G;  1W2B A;  2AKW B;  1ENC A;  2ZJP A;  2JXM B;  2FIN B;  4A3F G;  4DK0 A;  5CV8 A;  5IIF A;  4LF4 Q;  4J1M A;  4LUZ A;  4FF3 A;  4HJ8 A;  4LF9 Q;  1L1O C;  4JPB W;  4TKO B;  3UDG A;  2F0O A;  3Q22 A;  3GD7 A;  4B3T L;  4A3L H;  1VQH A;  1GUN A;  4FYD A;  3LGJ A;  1KAA A;  4DNR B;  4R8I A;  1HQR D;  1HNW Q;  4J8Q A;  3PUY A;  2F0V A;  3NEL A;  3GTJ H;  1SNO A;  1JWS D;  5C3E H;  3CRK C;  1CA5 A;  1LM0 A;  1Q12 A;  4IUV A;  1Q7Y C;  3RR5 A;  5M3M B;  1XMO Q;  1BUV T;  4BBS B;  2VB3 X;  1A62 A;  4A3D H;  1PH1 A;  4NXN L;  5LMN W;  3EIV A;  2K05 A;  2ES2 A;  1W3S A;  1IBM Q;  2EY5 A;  3UI2 A;  5C0X G;  4BY7 G;  3GTP H;  1U4P A;  4DV0 L;  3HOV B;  1HH2 P;  1IHZ A;  1WD1 A;  4QIW B;  3CRL C;  4DAP A;  1KRT A;  2WAQ E;  3U58 A;  1U0L A;  3IFT A;  3F2B A;  4U67 3;  3PIO 3;  4CGY B;  4A93 H;  4KJN A;  1I4X A;  4PV1 C;  2VW9 A;  2CCZ A;  1K0S A;  1H9M A;  1SE3 A;  1FR3 A;  4XTC S;  4FF4 A;  3HOW B;  1B2T A;  4KHV A;  1HUM A;  1K3R A;  4B3M L;  1JT8 A;  2A1A A;  5M3F B;  1VQD A;  1VQC A;  2A6E C;  3H15 A;  4RKB A;  5HGQ A;  2AMC B;  3JAM E;  2D62 A;  3HOU B;  3K80 C;  2KEN A;  3VR5 A;  2F0N A;  3RLF A;  3UDX A;  3EA6 A;  3K5M A;  4NP5 A;  1IYV A;  3U9O A;  2O4X A;  4ID6 A;  2DUD A;  2VQE Q;  4GN4 B;  2WII B;  1T9H A;  2IJ0 A;  5M5X B;  1YJW A;  4RFB A;  2Z4I A;  3OMC A;  1EEI D;  5C5L A;  3TSS A;  2ZJQ A;  1T5X D;  4LFC Q;  1HJP A;  5A2Q L;  2K03 A;  3AEV A;  3PUV A;  4J15 A;  2AWO A;  2K5H A;  4JBJ A;  1R4Q B;  2WAQ G;  4KHP L;  2I07 B;  2JA5 B;  2CKZ B;  2R92 B;  1SN8 A;  5E4W C;  1KDB A;  1EY5 A;  1PDQ A;  4IO9 A;  1H9J A;  1MSH A;  1G2S A;  4ZUJ A;  4OO1 I;  2EYH A;  3NTI A;  4K2K A;  2CW0 C;  1HA6 A;  1LTT D;  4O1N A;  1YEZ A;  5C0X I;  2I5H A;  5ELO A;  1E2W A;  2N55 A;  3OOC A;  3I4N H;  3M7G A;  1XTD A;  5C3E G;  1JJ2 A;  1E22 A;  1Y14 B;  2R93 B;  2EQS A;  3F8T A;  1DCZ A;  4A3D G;  2OF1 A;  3S14 B;  4HED A;  1PH7 A;  2B2W C;  2H1E A;  2DGY A;  4L5S A;  1RTO A;  4HJ9 A;  4DR1 Q;  2Z8L A;  5GAH C;  4YWL A;  1ZYR C;  3J80 E;  3NTH A;  1S72 A;  4EVO A;  1XX8 A;  2SDF A;  4QGU A;  1I6H H;  1N9W A;  4A93 G;  2K6A A;  2QCP X;  1PVO A;  2NBF A;  3ONA B;  3DWA A;  4A3G H;  4A76 A;  4MIU A;  2E76 C;  2UU9 Q;  4EQN A;  4LUV A;  1JQY D;  2D9U A;  4DV5 Q;  4U68 A;  4HIO A;  1QNU A;  1HZB A;  1S3O A;  3FP9 A;  1O7I A;  3BS1 A;  2QKI C;  4IUT A;  3M4O B;  1L1O A;  3MEF A;  1IW7 D;  4X65 Q;  2Z4H A;  1A2T A;  2K01 A;  3HOW G;  1TWA B;  5IGD A;  3GTG B;  3DEP A;  1YJN A;  1UE7 A;  3K59 A;  1K73 C;  1Y8P B;  4ODG A;  3C3L A;  4XYO A;  5C44 B;  3K5O A;  2E2H H;  3M4P A;  2Q2U A;  1XNR Q;  4XQJ A;  2VQF Q;  3I70 A;  3DM3 A;  3HKS A;  3J81 j;  2PZW A;  5EJW A;  2XIW A;  1I50 H;  1VQN A;  1NNX A;  5KIX A;  3I8Z A;  1PTO H;  5C4J B;  1QZG A;  4RCN A;  1FGU A;  4JI0 L;  2BDO A;  1BQQ T;  4DR2 Q;  2EYO A;  1TY0 A;  4MNO A;  3TP6 A;  1Y8O B;  1X54 A;  4O2D A;  4CDD C;  2JA5 G;  4RHR A;  2R92 G;  5FOB B;  4G7H C;  4GLA C;  1D2B A;  1KDA A;  1A63 A;  1XNQ L;  1X9N A;  1LAC A;  1J5E L;  1I4P A;  2OXP A;  1RKN A;  4QMG A;  5JEA G;  1SDF A;  3CQZ H;  3KLR A;  3TZU A;  4DUZ L;  1HCZ A;  5GAG C;  4HIM A;  3AFQ A;  3QIA A;  1I94 L;  1SEB D;  5CV5 A;  1Y1W H;  3PUW A;  1SE8 A;  2UXC Q;  1C7Y A;  2MHV A;  1EZ8 A;  1JWU D;  2DNE A;  3VA7 A;  1F2L A;  3T1H L;  1FD7 D;  1UAP A;  2EXD A;  4R4T A;  2NTT A;  4Q5V A;  3PO2 H;  3S24 A;  4NKL A;  4N9T A;  1HFN A;  1Z9F A;  1YNN D;  1HNX L;  4RGO S;  5ELD A;  3QWN A;  1MI2 A;  5JJI A;  2HIX A;  4ZAI A;  4E6I A;  1UE6 A;  5I6W A;  1YNJ C;  1BBW A;  2MP1 A;  3J81 E;  4A3K B;  1KRS A;  3DXJ C;  3H0G H;  2BE5 C;  4IPD A;  4YWK A;  1KTK A;  1JJG A;  4A75 A;  1KDC A;  4FVM A;  2HD3 A;  3VYU A;  4DNI A;  3C1E A;  2F0L A;  4G7Z C;  1AP0 A;  5COR A;  3G48 A;  3FMC A;  3G6E A;  2E2I H;  2Q8R E;  5C4Z A;  1E24 A;  3KBX A;  4MZ9 A;  1A0I A;  4DK6 C;  2EY1 A;  3IKJ A;  3NQT A;  3MXU A;  2B2W A;  2B2V A;  1VQP A;  3PIP 3;  2BA0 A;  1G51 A;  4JC0 A;  4ZKB B;  1DJR D;  5DM7 3;  1Q1E A;  4A3B H;  4DFA A;  2ZM6 Q;  3HOZ B;  1VQ7 A;  1TWF H;  1G91 A;  2JEB I;  4X3S A;  1SRO A;  1HHV A;  1KHI A;  4DR4 L;  1GHJ A;  4JI2 Q;  2O5J C;  5CV9 A;  2ZTE A;  1FNU A;  3GTL B;  1NY4 A;  2HHH L;  1I5F A;  1K8O A;  1SYB A;  1OTC A;  1PYB A;  1SSO A;  1X3G A;  2LSS A;  1WTO A;  4R8N A;  4YY3 Q;  1QZH A;  3RMH A;  1VQF A;  4FXG C;  2GVA A;  1Y1W G;  4OWX B;  2SEB D;  1ZXT A;  5C0X J;  3A0J A;  5FLX E;  4ME5 A;  2JYO A;  4AH6 A;  4B9W A;  1B44 D;  5L37 A;  1JJC B;  3FRP B;  3PO2 G;  1ROD A;  4HN7 A;  2UUB Q;  1ZKO A;  3CCS A;  1V1Q A;  2Q2H A;  3KF6 B;  4ZLT F;  2TSS A;  3FKI H;  2K32 A;  5IE8 A;  3H0G G;  5I4D A;  4DK3 C;  4YCW A;  1KAB A;  1SRU A;  5LL6 S;  3PCO B;  1AE2 A;  2RDG A;  2A5H A;  2F0G A;  3D31 A;  3MHB A;  5DM6 3;  1MGS A;  2E74 C;  2X69 A;  3S17 H;  1HRJ A;  4HJA A;  2N49 A;  1VQI A;  3BJU A;  4EQP A;  2N88 A;  1GKH A;  1GUS A;  2EYF A;  4CBV A;  3HRZ C;  2OT2 A;  1C0A A;  1O7Z A;  4HR7 B;  1I6V C;  1LT4 D;  4JCV E;  2UUA Q;  3R2I A;  2AUJ D;  1IBL L;  4A3K G;  1II3 A;  2B29 A;  2OEO A;  4KJO A;  4FDB A;  2HQL A;  4A3I B;  1GM5 A;  2PQE A;  1FJG L;  4J6H A;  2KEE A;  5JPM C;  3STB D;  3I91 A;  4QB4 A;  3H91 A;  3K7U C;  5IT9 E;  2I0Q A;  3S15 H;  1MIU A;  1M1K C;  4P74 A;  4PMC A;  4OON A;  1PH3 A;  1TWC B;  1WI5 A;  3MFG A;  1XMQ Q;  5CMD A;  4B3R L;  4R9W A;  4QQB X;  3WOE A;  1XPR A;  1QCB D;  5D14 A;  3T1Y Q;  3GTQ H;  3K0Y A;  2NN6 H;  3HOZ G;  1SLJ A;  3RZO B;  1CKO A;  3M3Y H;  2MUY A;  2JA7 H;  2K5D A;  4PZ7 A;  3D4R A;  2L1B A;  1AEX A;  5K5P A;  1V1O A;  3CPW A;  4DR3 L;  1QE6 A;  2MJ8 A;  2SOB A;  1N34 L;  2L5T A;  5ELE A;  2PO4 A;  1SNQ A;  1CHQ D;  2JJQ A;  1OXS C;  2WV6 D;  1CKN B;  3SE0 A;  4DV4 Q;  3FKI G;  5A35 A;  4X66 L;  4DAM A;  3PO3 B;  1NSN S;  4N9P A;  1EY6 A;  1VQO A;  1BBU A;  5D65 A;  1EYA A;  1SXT A;  2KCN A;  3F2C A;  2F0P A;  3S1M H;  3GTM B;  2F0E A;  3N6R A;  3TRZ A;  1RIP A;  1QG7 A;  2D5D A;  1QVG A;  4IFD H;  3LX0 A;  4LF7 L;  3LNN A;  1GUW A;  3RUZ A;  4G57 A;  3Q6S A;  1SNM A;  1QVC A;  1Q8K A;  4GKJ Q;  1EL0 A;  4ILW A;  5EBC A;  2F4V L;  4FP5 D;  4NXM L;  4ZKC B;  4JI3 Q;  3OMG A;  2F0H A;  3OSO A;  1BCP D;  1NBW A;  3M4Y A;  5J22 A;  2A19 A;  3KJP A;  4KI0 A;  1UWV A;  3MZ5 A;  5ELB A;  4KLK A;  4I7Z C;  4QY7 A;  1WCM B;  4C2M H;  5CC4 A;  2UUC L;  1JB7 A;  4KD3 A;  3U4Z A;  5IYD H;  1EU4 A;  3OTO L;  4BY1 H;  1EY9 A;  2XTI A;  2SNM A;  1LTI D;  2KED A;  2I5L X;  4UP8 A;  2NN6 G;  3TP5 A;  1RD9 D;  4YHH L;  1SMX A;  4A3I G;  4X62 L;  3TME A;  5JAV A;  1JOQ A;  1WOC A;  3QOL A;  1MBY A;  3VYT A;  5LHY 1;  1DOL A;  4Y52 H;  2PYK A;  1VQ9 A;  3HP3 A;  1PFN A;  3AU7 A;  4JBW A;  1TXY A;  3CCE A;  1RF2 D;  1SYG A;  3H3V H;  3S1R B;  2I5M X;  1SNC A;  2KOL A;  1KLU D;  1SR3 A;  4X3U A;  5JEA J;  1N32 Q;  5BN5 A;  2C5C A;  3HFZ B;  4BXX G;  3GTK H;  4NB3 A;  1LTS D;  1XYI A;  4A3J H;  4CHT B;  4A3F H;  4RMF A;  2IT1 A;  3CXC A;  2ZTC A;  3O13 A;  3S1N H;  4CDC C;  2OQK A;  1XJV A;  2DY7 A;  1DYQ A;  2EJF C;  2G9H D;  4ULL A;  4KY7 A;  5KRU A;  3S2H B;  1PTO D;  4JI4 Q;  1KAW A;  2KJX A;  4K5X A;  1VF5 C;  2E2J H;  3ICE A;  2HDL A;  3OIP A;  1F2Z A;  1F2Y A;  1PMR A;  4JV5 L;  1Q86 C;  4UPA A;  2NVQ B;  2EDG A;  1XMO L;  5KYI A;  1IW7 C;  1EWC A;  1OXV A;  2A6H C;  2NZH A;  2JA6 H;  1IBM L;  5I9P A;  1VQ6 A;  4OIJ A;  2OCE A;  1R9T B;  3RZD H;  4B3S L;  2NN6 I;  4JBM A;  2VB2 X;  4BY7 H;  4C1N I;  4YCU A;  4JI8 Q;  1KXL A;  4UP9 A;  1WYD A;  1EEF D;  3SDZ A;  4HCS A;  1KC8 C;  4OIK A;  3FVQ A;  4R4C A;  4OWT B;  4WJW A;  4JYA Q;  3W3A A;  3M85 A;  5JOB A;  1F9Q A;  1VF7 A;  4Y7N H;  5CGK A;  3A8K E;  3NQI A;  4GZY C;  4JK1 C;  3AYH B;  4LFA L;  4AYB B;  3P20 A;  2VQE L;  1MD2 D;  4KV6 A;  1Q81 C;  2PW5 A;  2ATW A;  1PZI D;  2R7Z B;  4WRD A;  1D6E C;  1PZK D;  5KGU A;  4LFC L;  3KF6 A;  5AJ3 Q;  4FO2 A;  4IFD I;  1GUT A;  3RNU A;  1TKW B;  5JJL A;  3EBE A;  3KLS A;  1OXX K;  1BXT A;  2QGQ A;  2X6L A;  1X3Q A;  5EQ0 A;  4QUC A;  2L55 A;  4R4O A;  2UXB Q;  1B70 B;  1SMY D;  5COY A;  1K28 A;  2G9D A;  1HTP A;  3SR1 A;  3ERO A;  1D1I A;  3GTO H;  2YYZ A;  4LF5 L;  3NP8 A;  1RCV D;  4BA1 I;  1YNN C;  3FDT A;  4RGT A;  2N78 A;  1BNZ A;  3G6J B;  3OYY A;  1A2U A;  4ZRZ A;  3Q8D A;  2N8N A;  1B7Y B;  2JE6 I;  1PH8 A;  2WKD A;  3K58 A;  2JA6 G;  1E2Z A;  2HCC A;  1RHP A;  1HR0 W;  1QNK A;  4DR1 L;  2NVY B;  1WTR A;  2R6G A;  5ELF A;  1HTL D;  3U50 C;  2Q2I A;  3DM1 A;  1TQO A;  1B4O A;  2BOS A;  3T13 A;  1TII D;  4RH6 A;  1VQB A;  1J9O A;  3KFU A;  3S9W A;  3OPO A;  5HY6 A;  3HG9 A;  4P75 A;  4Z9C B;  1WTW A;  2IHF A;  1SND A;  3KF8 A;  1EQR A;  4MN3 A;  2KHS A;  3RN2 A;  3R3O A;  2DNC A;  3NWS A;  2Z6K C;  2UU9 L;  1Q82 C;  3S2D B;  5M3M H;  1YI2 A;  3J7A 5;  4DV5 L;  4BBS H;  2XNA C;  3URY A;  1Q46 A;  2QW7 A;  5CR3 A;  3SHL A;  2R3Z A;  1EFW A;  1Z47 A;  4HSV A;  1EZ6 A;  1LTA D;  3ULL A;  3E0J A;  4CKE A;  3HOV H;  1E1T A;  1EIH A;  2B8F A;  2M2L A;  4X65 L;  3A8J E;  4IUQ A;  2IX3 A;  1F2M A;  2ICI A;  2CFM A;  3SXH A;  5JJZ A;  5FJ8 G;  1C8C A;  2QDB A;  5NUC A;  4ZCK A;  1EQT A;  5KNB A;  1BCP F;  1S4Z A;  1CKN A;  1GD7 A;  1VQJ A;  3HOW H;  2EY2 A;  1L0X B;  4DUY Q;  5JJK A;  2M9V A;  2EYJ A;  2K5Q A;  5M3F H;  1Y8N B;  1D5X C;  3T16 A;  2VQF L;  3HOU H;  1EOT A;  2IX0 A;  2SNS A;  4DR5 Q;  2CH4 A;  1U9R A;  2MPM A;  2O2L D;  2MO0 A;  5IWA L;  3CC7 A;  1X32 A;  5IGG A;  2F0J A;  3SEB A;  1A3V A;  2AQ1 B;  4DR2 L;  4KN4 C;  1X3F A;  1ESR A;  2L9H A;  1NMF A;  5M5X H;  4UY8 C;  2VUM B;  4QIW E;  1T5E A;  3K5N A;  1WVL A;  4DPG A;  1F9S A;  1EYD A;  1STB A;  3IRB A;  3NBH A;  4DGZ A;  2JA5 H;  2R92 H;  1NE3 A;  1LTR D;  1QUQ A;  1PYW D;  1B3Q A;  3T4A C;  3I73 A;  1DOM A;  1VQE A;  2V1C C;  2QIL A;  1KLG D;  3TP7 A;  5JEA H;  3R8B A;  2R7D A;  2Y0S B;  3PF5 A;  4DR7 L;  1PH5 A;  1Z6H A;  4GLX A;  2RSN A;  5M3M G;  4H02 A;  2R93 H;  3S1Q B;  4IAL A;  4BBR B;  4BBS G;  2PPB C;  3S14 H;  1TS3 A;  3STB C;  1EYG A;  3T53 B;  5DLQ E;  4LF8 L;  3D3R A;  1HZ9 A;  3HOV G;  1IKM A;  3SVM A;  3CAM A;  4DV7 L;  3KBG A;  4UAI A;  3KLW A;  2EOT A;  3A54 A;  4PNY A;  4ALP A;  2L0C A;  3B6Y A;  2YU9 B;  1ET9 A;  1UE1 A;  1G6Z A;  4HJ5 A;  2K4K A;  1E2V A;  2E5L Q;  1DGS A;  4JG2 A;  1GXD C;  2IPK D;  3P75 A;  2DJF C;  3UDI A;  3HKZ B;  1M8A A;  4M8A A;  4G4K A;  3CF5 A;  5M3F G;  4B3M Q;  3HOX B;  4NMZ A;  3OW2 A;  4L6T B;  2ALY B;  3HOU G;  2NWG A;  1E3P A;  2NZO A;  1N8R C;  1EY8 A;  1CI3 M;  3NPP A;  1HPC A;  4RAU C;  3M4O H;  4GOP C;  2EE1 A;  4P2C B;  3KJO A;  2V4D A;  3RD4 A;  1UEA B;  2B63 B;  1ZEQ X;  3MFY A;  1CA6 A;  1EWH A;  5T1G A;  1TWA H;  3GTG H;  1TS5 A;  3NEM A;  3NTK A;  3ULJ A;  1KL9 A;  5FKA C;  1V9P A;  3WWV A;  2B2Y C;  4DNT B;  1WTH A;  3BDO A;  1YBY A;  2EIF A;  3L3O C;  5EPJ A;  1OXU A;  3NUC A;  2B2T C;  4IFD J;  1E1O A;  1YIT A;  4KHP Q;  5C44 H;  2Z6K A;  1TS4 A;  3W1B A;  2PZT A;  1B53 A;  4YY3 L;  2GN5 A;  1SFO B;  4EX5 A;  2JEA I;  4CJ2 C;  2XRS D;  2WB1 B;  5C4J H;  2VNU D;  2WFW A;  5IYB G;  1PRT D;  2VUM G;  3MTS A;  3RLO A;  5FLM G;  1YIJ A;  2J4X A;  5M5Y B;  1TWG B;  2R93 G;  4K0K L;  3A5U A;  2UUB L;  4NW2 A;  4XQQ A;  2ZJR A;  4ABN A;  1QJO A;  1BCP C;  1YZ6 A;  2IX1 A;  3TQY A;  3DMU A;  3PMF A;  1ILP A;  2F0T A;  2B2U C;  4PMW A;  2UXD Q;  3A7L A;  1JOR A;  3X3M A;  3X3N A;  1EU3 A;  5A2Q E;  3AFP A;  5G3L D;  1PA6 A;  2BH2 A;  4R1J A;  1LTG D;  3HOY B;  3SK5 A;  4BBR G;  1STN A;  4CKB A;  4IZ8 A;  2K5N A;  1EQQ A;  2L4N A;  1MSG A;  2KVM A;  2H4O A;  3J7Z C;  2ID0 A;  4XXE A;  5CBA E;  4WJ3 M;  3R93 A;  2B3G A;  1X3P A;  3ND9 A;  4RKL A;  1HR0 L;  3H94 A;  4DV2 Q;  1EIG A;  2YTV A;  5I6Y A;  4A3C H;  2F0M A;  3P1H A;  1HFG A;  5CBE E;  4JI7 Q;  2PMZ B;  4IUN A;  5H1S E;  3UDF A;  1FL0 A;  2HCI A;  4A3K H;  3R2T A;  3UE0 A;  5IP9 G;  2JA8 B;  4KK7 A;  3BDL A;  2IWH A;  1NMG A;  3KK7 A;  2IY5 B;  5IOD A;  1PFB A;  4K6D A;  5ELC A;  3CC2 A;  3QB3 A;  3V96 A;  3SK6 A;  3ULP A;  4LFB Q;  1VMC A;  1XMQ L;  1SJH D;  3CCJ A;  1V43 A;  4DK1 A;  5J1Z A;  1B1Z A;  1N36 Q;  1JB3 A;  4BWG B;  5C44 G;  3T1Y L;  4DV1 L;  3LWU A;  2IW3 A;  1PTO C;  5E3F A;  1PFM A;  2EXZ A;  1IKL A;  4XT1 B;  3K6O A;  3FEW X;  1A6X A;  1I4G A;  4JI6 L;  3PGZ A;  3BYT B;  4L5T A;  1K83 B;  1A15 A;  1NR2 A;  3PV0 A;  2B63 G;  1K8A C;  3HOZ H;  5C4X B;  2KCC A;  1QB5 D;  5M5W B;  5JVG 3;  4IUR A;  4XQN A;  4C56 C;  3BZK A;  1PZJ D;  4JI0 Q;  2KHI A;  4DV3 L;  1CUK A;  1L2F A;  1JOO A;  2ZXP A;  3GTL H;  5LMU Q;  3V2T A;  3DUZ A;  1EWI A;  4LK1 C;  1O7Y A;  5C6A A;  1NR4 A;  4H44 C;  5BR8 Q;  1XNQ Q;  5IOC A;  1J5E Q;  1J8I A;  1M90 C;  1CZW A;  2WB1 G;  4PZ8 A;  5DEH A;  1ILQ A;  4DUZ Q;  4C3J B;  4L5R C;  2EJG C;  3C46 A;  2Z9H A;  4GOP A;  4DKA C;  4IUU A;  1ASY A;  3TN2 A;  2A69 D;  3W1G A;  3CCR A;  3T1H Q;  3D6W A;  1RTN A;  1PH4 A;  1B3A A;  3NWT A;  1GUG A;  4GKJ L;  3ERQ A;  2B2Y A;  3VR3 A;  4OGQ C;  2AQ2 B;  3CME A;  3D0F A;  4A3C G;  3D8G A;  2J7Z A;  5EPK A;  2CQO A;  2KBN A;  3BVM A;  4L63 B;  2B2T A;  4LF6 L;  4C3H B;  1K9M C;  2LFN A;  4I7A A;  2PI2 E;  4K5W A;  2Z1C A;  4OXP A;  2KA7 A;  2C9O A;  1I4H A;  1SAP A;  3JAM i;  3OIQ A;  1HXY D;  5I2Y A;  1ZYR D;  2P5Z X;  5FO7 B;  1OO9 B;  4ME3 A;  4RG1 A;  1MJC A;  3NSW A;  1ENA A;  3E6Z X;  2NVX B;  4UP7 A;  5LMN Q;  4F8M A;  2ENB A;  2PQA B;  1PLF A;  3KF8 B;  4LNQ A;  1S5F D;  4JI1 L;  1W6J A;  3M4Q A;  3J7A V;  4ZYS A;  4DU9 A;  2JA8 G;  2NUC A;  3K57 A;  1LT3 D;  4GNX C;  4A3I H;  2B2U A;  4GKK Q;  5LL6 X;  2AHO B;  1FYC A;  1B8A A;  4OHJ A;  4O42 A;  5FLX c;  2AUK A;  1Q3L A;  2M00 A;  5J39 A;  2EJM A;  1TWC H;  1LT5 D;  4BXX H;  2WAC A;  2HHH Q;  2RCF A;  1K3B C;  5ELN A;  1PH6 A;  2LXK A;  4DR6 Q;  1Y1V B;  4DAV A;  4POG A;  2PW7 A;  3K7A B;  4L5Q A;  4A4I A;  4C3I B;  4JW0 A;  4G7O C;  3RZO H;  4FF2 A;  2AQ3 B;  3BU2 A;  1C9O A;  5HUR A;  1BBX C;  1JOK A;  3S16 B;  4EQ5 A;  4JI4 L;  3MC0 B;  1TWH B;  1CM9 A;  1V1P B;  2NVT B;  3G4S A;  3CU7 A;  2E75 C;  3C1F A;  2RSO A;  3J80 i;  1P16 A;  2F0F A;  4KY6 A;  2K50 A;  2XWB B;  3TDQ A;  2D0P A;  2NB0 A;  4DA2 A;  3PO3 H;  3Q0A A;  2BDN A;  2N3S A;  3NBH B;  4C1N K;  1SYD A;  3CW2 C;  1PV4 A;  4JI8 L;  4A3M B;  1QUQ B;  1D7Q A;  4IOC A;  3L0O A;  3TZD A;  3GTM H;  4L8J A;  4P72 A;  4JI5 L;  1O7L A;  1LT6 D;  5GRO A;  1L0W A;  3OWF A;  1FGB D;  4DV6 Q;  5G3L F;  5KND A;  3DEO A;  1TVX A;  4K2L A;  1VQM A;  5IGE A;  1VMP A;  1Q90 A;  3ZJY C;  2HIV A;  1NCV A;  3FPU B;  4X64 L;  2KQ3 A;  4C3H G;  1IBK Q;  1IBL Q;  4LJZ C;  1XTC D;  4A3E B;  5CV7 A;  1JE4 A;  3BG3 A;  3I72 A;  1RL2 A;  1CHP D;  3CD6 A;  2K28 A;  1WTV A;  4Q0F A;  2JSO A;  2CQA A;  4F7X A;  1WCM H;  2B8G A;  3HGB A;  3K0X A;  3GDE A;  1TY2 A;  2BE5 D;  1EIY B;  2RA4 A;  4LF4 L;  4WFN 3;  1SBB B;  1CQF A;  4ZQ3 A;  1EUJ A;  1O80 A;  2FXQ A;  3ER0 A;  4LF9 L;  1KQS A;  5I9O A;  2ZXO A;  1C4Q A;  2KEC A;  1NAP A;  1IL2 A;  2VS1 A;  1JIC A;  1YNX A;  2A68 D;  4KTA A;  1DOK A;  3S1R H;  2RQX A;  4HID A;  2E2D C;  1KNA A;  1TT2 A;  3AQQ A;  4DAY B;  1HNW L;  4DR3 Q;  1ICF B;  4OX9 Q;  2F0Q A;  3K81 C;  3NK9 A;  1CT1 D;  3HZX A;  2QEX A;  1BR9 A;  1I3Q B;  3E9I A;  1RJT A;  3PO3 G;  1H9S A;  4X66 Q;  1YHQ A;  2HDM A;  4RWS C;  3QR8 A;  1GVP A;  2D0O A;  5BN4 A;  2XN9 C;  3A55 A;  3D4W A;  1B9M A;  3EN2 A;  1WTX A;  4QUF A;  1EY0 A;  3S2H H;  2K1B A;  4GNX A;  2YTY A;  3M7N A;  4DXG A;  1X56 A;  3I4M B;  3ITP A;  5DAU A;  2K5V A;  3J81 i;  4LF7 Q;  5K36 G;  5TSS A;  2LKV A;  2NVQ H;  4MHE A;  1CKM A;  2PCF B;  3IFD A;  2LS0 1;  4IPH A;  1LTL A;  2JK8 A;  1W6K A;  2BH8 A;  1R9T H;  3BVZ A;  1YHA A;  2O5I C;  3MXG A;  3SGI A;  4GN3 B;  1Q1B A;  1WCM G;  1CFM A;  1EY4 A;  1EOV A;  5DNF A;  3JC6 6;  4OEL B;  1B9N A;  3PIO A;  1M4V A;  2EYL A;  5FJ8 H;  4DUY L;  3OWE B;  4RHS A;  3GV6 A;  4HMI A;  1XPO A;  3H6M A;  4A3E G;  4HSP A;  3E3X A;  4YHH Q;  1SYF A;  1Z7T A;  2MFI A;  4KD4 A;  5IGB A;  3GV3 A;  4X62 Q;  1JR0 D;  1VQK A;  5IY0 A;  4WOR A;  4ZK9 B;  2WAQ B;  4OEM B;  1HNZ Q;  3MA2 B;  4DR5 L;  2F0I A;  2FMM A;  4R4Q A;  3D6C A;  1U4R A;  5ISR A;  2HQE A;  5F2D A;  2R7Z H;  2QF7 A;  4HCE A;  3HS0 C;  4GN5 A;  2FHT A;  3GTJ B;  3L7Z C;  4XYQ A;  5C3E B;  2I46 A;  5EKL A;  1AZQ A;  5CV4 A;  4CDF C;  4MTK A;  4A3D B;  3CCV A;  4AQY Q;  3EJI A;  3ND8 A;  3AB9 A;  4BS9 A;  1SE4 A;  1CQV A;  3BYY B;  3GTP B;  2DY8 A;  1A3U A;  2F52 A;  4TRD A;  1G2T A;  4QF4 A;  1LLR D;  1G29 1;  1STA A;  4LW1 A;  2G5D A;  2ICE C;  3A8I E;  2Q8I B;  1K8M A;  1ICW A;  2J0T D;  3H3V I;  4A93 B;  2EZV A;  2PQA A;  4AYB E;  2WIN B;  3H09 A;  4P73 A;  4QL5 A;  2QA4 A;  4JV5 Q;  1E7Z A;  4N8F A;  1N33 Q;  4OO1 G;  2F3V A;  1JWM D;  3UE1 A;  4PG3 A;  2OWO A;  2VL6 A;  2NVY H;  3BZC A;  1GHK A;  4X3K A;  4B3S Q;  1BDO A;  2Z6B A;  3I4M G;  2HUG A;  2E5L L;  1IL8 A;  3ERS X;  4X3T A;  3I90 A;  3CPF A;  4LWC A;  4GOP B;  3EQL C;  4PZ6 A;  2OTJ A;  3S2D H;  5EPL A;  1TS2 A;  3KOJ A;  2NYZ D;  2RDH A;  1S5C D;  4OL7 A;  1L0Y B;  4PQX A;  5IGF A;  1XNR L;  3W5O A;  2JA9 A;  4KHZ A;  4AYB G;  1RDP D;  2VY3 A;  1NTG A;  1V1P A;  4LFA Q;  1ENF A;  2R7Z G;  2K7V A;  3I7F A;  5C5M A;  1TU2 B;  1TR5 A;  3I4N B;  3BVG A;  2HT1 A;  1CZG A;  2CH4 W;  3J81 L;  4KN7 C;  2K04 A;  2KHJ A;  2WP8 J;  2OQ0 A;  2RHS B;  4A3L G;  2A8V A;  2VZA A;  4IOA A;  2A69 C;  3DWP A;  3CCL A;  1Q8I A;  4DN4 M;  4B3T Q;  1BCP B;  1J6Q A;  2UXC L;  2DN8 A;  4LF5 Q;  1I6H B;  1WFQ A;  2F0K A;  5IYB H;  1P8L A;  3M9B A;  4S3S A;  2VUM H;  4QCL A;  5FLM H;  5KNC A;  4RCO A;  3ZYY X;  1AW7 A;  1U4M A;  4A3G B;  1PTO F;  1PXU A;  2CWP A;  2GVB A;  1ESF A;  2B2V C;  1SYC A;  4OWW B;  3QJY A;  1K0R A;  1HUN A;  2UXD L;  3NHH A;  1KD1 C;  4NXN Q;  1G8Z D;  3W2D A;  1STE A;  5IP7 H;  3CKI B;  3TS2 A;  3I4L A;  1EY7 A;  2X6G A;  4LUO A;  3JAM c;  4JBK A;  3MAQ A;  4CKC A;  4DV0 Q;  1JC7 A;  4TSS A;  2FJ2 A;  1NUC A;  3WOF A;  1UNS A;  3DWQ A;  4FF1 A;  3S1Q H;  4BBR H;  2MQH A;  3G7L A;  1H9R A;  3VR4 A;  1PH2 A;  1VQA A;  3Q23 A;  4DV2 L;  1D5Z C;  2R61 A;  3RN5 A;  2RKS A;  1VQ8 A;  4JI7 L;  2RBM A;  4JVZ A;  2E2H B;  5EBD A;  2CHB D;  4KKT A;  3NBI A;  5C3W A;  5FLX L;  2XWJ B;  3MXN A;  5JVH 3;  3Q24 A;  4H13 C;  1F77 A;  4V19 0;  2PNR C;  2A6H D;  5E4X A;  4DAY A;  3I55 A;  2ZM6 L;  1I50 B;  3CMA A;  1U4L A;  4TQU S;  2YU9 H;  1QVF A;  1PTO B;  1HQM C;  1V8Q A;  3TP8 A;  5IP9 H;  2RCN A;  3OW7 A;  1QIL A;  2TMP A;  1JE5 A;  2A74 C;  2EYM A;  4YWM A;  4LFB L;  2ZTD A;  3VA5 A;  4JI2 L;  1G6P A;  4EQO A;  1EQV A;  3GO5 A;  1N36 L;  2Y0S E;  1MHW C;  3U4V A;  5KEE A;  1SYE A;  3HOX H;  2A73 B;  2MGS A;  3BDC A;  4IPG A;  4KY5 A;  1SJE D;  2L15 A;  2R7F A;  3I4O A;  1OXT A;  1C48 A;  3VR2 A;  3PIP A;  3CQZ B;  5T1I A;  1Y1W B;  3I4N G;  5IWA Q;  2B63 H;  3J80 c;  2K14 A;  5JPN C;  5LMU L;  1LAB A;  3PO2 B;  4GLV B;  1PHJ A;  5BR8 L;  5FK9 C;  5IT9 L;  1GUO A;  3DHQ A;  3HKZ E;  5IP7 G;  1SFO H;  3FPP A;  3I2Z A;  1LO5 D;  2FMC A;  2LXJ A;  4K5V A;  2KUM A;  2F3W A;  1PYS B;  2Y0S G;  3H0G B;  4KKU A;  2NZ1 D;  3PF4 A;  2GA4 B;  3CP0 A;  3CCU A;  4DR7 Q;  4EGV A;  2K33 A;  5M5Y H; 
#chains in the Genus database with same CATH homology
 1SE2 A;  4PMB A;  3SK4 A;  1DM0 B;  3KUP A;  1CK1 A;  3CHB D;  2E2I B;  3I3C A;  2L12 A;  3IL8 A;  1H9S B;  3MVV A;  4A3B B;  3T56 B;  2EY6 A;  3P7J A;  4RGM A;  1TWF B;  1DXM A;  1R4P B;  2ZT9 C;  3V05 A;  5CV6 A;  1Y69 U;  2BCO A;  2LY7 A;  3LWE A;  5E1F A;  3EVQ A;  2A68 C;  3A56 A;  4DXF A;  1I4Q A;  4XDX A;  4RA8 A;  2QEJ C;  2A6E D;  3D4D A;  2XSC A;  3K5L A;  1XWE A;  2CVR A;  2AWN A;  5IGC A;  2RVL A;  3FKI B;  4RGN A;  1D5M C;  1S5D D;  3MEH A;  3J7Y W;  1BO0 A;  4YIJ A;  1STH A;  1CTM A;  3WDN A;  3S17 B;  2CW0 D;  1STG A;  2FFK B;  1WTP A;  3J7A F;  1D1K A;  4K14 A;  5FO8 B;  1DZ1 A;  1QWY A;  1FNW A;  2F03 A;  2B39 A;  5I2X A;  4LAA A;  5EKI A;  1VDZ A;  4CJ0 B;  5BN3 A;  3S15 B;  1ONL A;  2D2C C;  2PZU A;  4CJ1 B;  5M9O A;  1SMY C;  1BOS A;  1EYC A;  4DF7 A;  3AMU A;  3GTQ B;  4IQZ A;  3GP7 A;  3L9A X;  4K8I A;  2F1M A;  2EVB A;  3M3Y B;  2JA7 B;  1HA5 A;  1F9R A;  5KYL A;  2JP1 A;  1SNP A;  1S5E D;  3VYS A;  5EKK A;  1LTB D;  3QOJ A;  2L11 A;  1LV9 A;  2Q8T A;  1E0B A;  4M1U B;  1KNE A;  4BA2 I;  4F87 A;  1GOZ A;  5D3D A;  2F4I A;  3S1M B;  3VYR A;  1IYU A;  4HAE A;  1UUP A;  1AN8 A;  1PRT F;  1S5B D;  3KLS X;  1H9K A;  1VCI A;  3OHX C;  4XIG S;  3T51 B;  2IL8 A;  4C3J G;  2F0W A;  4KKS A;  4FNF A;  2RDF A;  5EGT A;  3PUX A;  3IAY A;  2F0S A;  4C2M B;  1WD0 A;  1JCK B;  4BY1 B;  5K36 H;  4IN3 A;  4ZUI A;  4HMJ A;  4UDU C;  3BZD B;  1QOH A;  1PRT B;  3F2U A;  2XRQ D;  2XVS A;  4NDX A;  1YNJ D;  3GTK B;  1EFI D;  2EPB A;  4A3J B;  3A7A B;  3PUZ A;  4A3F B;  3QO2 A;  4F88 A;  2F0U A;  1XXG A;  4B9X A;  3S1N B;  1A3T A;  3TBI B;  4FXD A;  4H0L C;  1BF4 A;  2BA1 A;  5CYU A;  2E2J B;  3JAM L;  2EYP A;  2WKC A;  5AFW A;  1B50 A;  4C3I G;  5FO9 B;  1O78 A;  3HEJ A;  3U9S A;  2JA6 B;  3NE5 B;  5HGT A;  1I4R A;  3RZD B;  4V0B A;  1DD2 A;  1STY A;  1F9P A;  4BY7 B;  5C3X A;  3NXW A;  4IFD G;  2NTS A;  4I65 A;  3EFX D;  3SK8 A;  1AZP A;  4IUP A;  4LMQ D;  2VXW A;  4OO1 H;  1ET6 A;  5D3I B;  4B08 A;  4Y7N B;  1ML0 D;  3QG1 A;  2ZXR A;  5C0X H;  4FXK C;  3E5S A;  4H7B A;  1WTQ A;  3GQB A;  3MXP A;  3VR6 A;  5C4H A;  2LMC B;  1DON A;  3J80 L;  4K6L A;  3H3V C;  4XT3 B;  1FNV A;  1PRT C;  2K5W A;  4HTH A;  2F0D A;  3MWY W;  1GJX A;  3GTO B;  4KMU C;  1AFP A;  3C2P A;  4K8J A;  3N52 A;  1ENC A;  2JXM B;  2FIN B;  4DK0 A;  5CV8 A;  5IIF A;  4J1M A;  4FF3 A;  4TKO B;  2F0O A;  3Q22 A;  3GD7 A;  1GUN A;  4FYD A;  1KAA A;  4DNR B;  4R8I A;  1HQR D;  4J8Q A;  3PUY A;  2F0V A;  1SNO A;  1JWS D;  3CRK C;  1CA5 A;  1Q12 A;  4IUV A;  5M3M B;  1BUV T;  4BBS B;  2VB3 X;  2K05 A;  2EY5 A;  3UI2 A;  5C0X G;  1U4P A;  3HOV B;  1IHZ A;  1WD1 A;  4QIW B;  3CRL C;  4DAP A;  3IFT A;  4U67 3;  3PIO 3;  4CGY B;  4KJN A;  1I4X A;  4PV1 C;  1H9M A;  1SE3 A;  1FR3 A;  4XTC S;  4FF4 A;  3HOW B;  1B2T A;  4KHV A;  1HUM A;  5M3F B;  2A6E C;  4RKB A;  3JAM E;  2D62 A;  3HOU B;  3VR5 A;  2F0N A;  3RLF A;  3EA6 A;  3K5M A;  4NP5 A;  1IYV A;  3U9O A;  2O4X A;  4ID6 A;  2WII B;  2IJ0 A;  5M5X B;  4RFB A;  2Z4I A;  3OMC A;  1EEI D;  5C5L A;  3TSS A;  1T5X D;  5A2Q L;  2K03 A;  3PUV A;  2AWO A;  1R4Q B;  2I07 B;  2JA5 B;  2R92 B;  5E4W C;  1KDB A;  1EY5 A;  1PDQ A;  1H9J A;  1MSH A;  1G2S A;  4ZUJ A;  4OO1 I;  2EYH A;  3NTI A;  4K2K A;  2CW0 C;  1HA6 A;  1LTT D;  4O1N A;  5C0X I;  1E2W A;  2N55 A;  3OOC A;  3M7G A;  2R93 B;  1DCZ A;  3S14 B;  2OF1 A;  4HED A;  2B2W C;  2H1E A;  1RTO A;  2Z8L A;  1ZYR C;  3J80 E;  3NTH A;  4EVO A;  1XX8 A;  2SDF A;  2K6A A;  2QCP X;  2NBF A;  3ONA B;  3DWA A;  4MIU A;  2E76 C;  4EQN A;  1JQY D;  2D9U A;  4U68 A;  1QNU A;  3BS1 A;  2QKI C;  4IUT A;  3M4O B;  1IW7 D;  2Z4H A;  1A2T A;  2K01 A;  1TWA B;  5IGD A;  3GTG B;  3DEP A;  3K59 A;  1Y8P B;  4ODG A;  3C3L A;  4XYO A;  5C44 B;  3K5O A;  4XQJ A;  3I70 A;  2PZW A;  5EJW A;  2XIW A;  5KIX A;  3I8Z A;  1PTO H;  5C4J B;  4RCN A;  2BDO A;  1BQQ T;  2EYO A;  1TY0 A;  3TP6 A;  1Y8O B;  4RHR A;  5FOB B;  4G7H C;  1D2B A;  1KDA A;  1LAC A;  1I4P A;  2OXP A;  1RKN A;  4QMG A;  5JEA G;  1SDF A;  3KLR A;  3TZU A;  1HCZ A;  3QIA A;  1SEB D;  5CV5 A;  3PUW A;  2MHV A;  1EZ8 A;  1JWU D;  2DNE A;  3VA7 A;  1F2L A;  1FD7 D;  1UAP A;  2NTT A;  4Q5V A;  4NKL A;  4N9T A;  1HFN A;  1YNN D;  4RGO S;  5ELD A;  3QWN A;  1MI2 A;  4ZAI A;  4E6I A;  5I6W A;  3J81 E;  1YNJ C;  2MP1 A;  4A3K B;  3DXJ C;  2BE5 C;  1KTK A;  1KDC A;  4FVM A;  3VYU A;  3C1E A;  2F0L A;  4G7Z C;  1AP0 A;  5COR A;  3FMC A;  2Q8R E;  5C4Z A;  3KBX A;  2EY1 A;  3IKJ A;  3NQT A;  3MXU A;  2B2W A;  2B2V A;  3PIP 3;  2BA0 A;  4ZKB B;  1DJR D;  5DM7 3;  1Q1E A;  4DFA A;  3HOZ B;  1G91 A;  2JEB I;  4X3S A;  1HHV A;  1GHJ A;  2O5J C;  5CV9 A;  1FNU A;  3GTL B;  1K8O A;  1SYB A;  1SSO A;  1WTO A;  4R8N A;  3RMH A;  4FXG C;  2SEB D;  1ZXT A;  5C0X J;  5FLX E;  4ME5 A;  2JYO A;  4B9W A;  1B44 D;  3FRP B;  1ROD A;  4HN7 A;  1ZKO A;  4ZLT F;  2TSS A;  2K32 A;  5I4D A;  1KAB A;  5LL6 S;  2RDG A;  2A5H A;  2F0G A;  3D31 A;  3MHB A;  5DM6 3;  1MGS A;  2E74 C;  2X69 A;  1HRJ A;  4EQP A;  2N88 A;  1GUS A;  2EYF A;  4CBV A;  3HRZ C;  2OT2 A;  1O7Z A;  4HR7 B;  1I6V C;  1LT4 D;  3R2I A;  2AUJ D;  1II3 A;  2OEO A;  4KJO A;  4A3I B;  2PQE A;  4J6H A;  2KEE A;  5JPM C;  3I91 A;  4QB4 A;  3H91 A;  5IT9 E;  4PMC A;  1TWC B;  3MFG A;  5CMD A;  4R9W A;  3WOE A;  1QCB D;  5D14 A;  3K0Y A;  2NN6 H;  3RZO B;  2MUY A;  2K5D A;  3D4R A;  2L1B A;  1AEX A;  5K5P A;  1V1O A;  1QE6 A;  2MJ8 A;  2SOB A;  2L5T A;  5ELE A;  2PO4 A;  1SNQ A;  1CHQ D;  1OXS C;  2WV6 D;  3SE0 A;  5A35 A;  3PO3 B;  1NSN S;  4N9P A;  1EY6 A;  5D65 A;  1EYA A;  1SXT A;  2KCN A;  2F0P A;  3GTM B;  2F0E A;  3N6R A;  1QG7 A;  2D5D A;  4IFD H;  3LX0 A;  3LNN A;  1GUW A;  3RUZ A;  4G57 A;  3Q6S A;  1SNM A;  1EL0 A;  4ILW A;  5EBC A;  4FP5 D;  4ZKC B;  3OMG A;  2F0H A;  3OSO A;  1BCP D;  3M4Y A;  5J22 A;  4KI0 A;  3MZ5 A;  5ELB A;  4I7Z C;  1WCM B;  5CC4 A;  4KD3 A;  1EU4 A;  1EY9 A;  2SNM A;  1LTI D;  2KED A;  2NN6 G;  3TP5 A;  1RD9 D;  3TME A;  5JAV A;  1JOQ A;  3QOL A;  1MBY A;  3VYT A;  5LHY 1;  1DOL A;  2PYK A;  3HP3 A;  1PFN A;  3AU7 A;  4JBW A;  1RF2 D;  1SYG A;  3S1R B;  1SNC A;  2KOL A;  1KLU D;  4X3U A;  5JEA J;  5BN5 A;  2C5C A;  1LTS D;  1XYI A;  4CHT B;  2IT1 A;  3O13 A;  2DY7 A;  1DYQ A;  2EJF C;  2G9H D;  4ULL A;  4KY7 A;  5KRU A;  3S2H B;  1PTO D;  2KJX A;  4K5X A;  1VF5 C;  2HDL A;  3OIP A;  1F2Z A;  1F2Y A;  1PMR A;  2NVQ B;  2EDG A;  5KYI A;  1IW7 C;  1EWC A;  1OXV A;  2A6H C;  5I9P A;  4OIJ A;  1R9T B;  2NN6 I;  2VB2 X;  4C1N I;  1EEF D;  3SDZ A;  4HCS A;  4OIK A;  3FVQ A;  4WJW A;  3W3A A;  3M85 A;  5JOB A;  1F9Q A;  1VF7 A;  5CGK A;  3A8K E;  3NQI A;  4GZY C;  4JK1 C;  4AYB B;  3P20 A;  1MD2 D;  4KV6 A;  2PW5 A;  2R7Z B;  1PZI D;  4WRD A;  1D6E C;  1PZK D;  5KGU A;  4FO2 A;  4IFD I;  1GUT A;  1TKW B;  3KLS A;  1OXX K;  1BXT A;  2X6L A;  1X3Q A;  5EQ0 A;  4QUC A;  2L55 A;  1SMY D;  5COY A;  2G9D A;  1HTP A;  3SR1 A;  3ERO A;  1D1I A;  2YYZ A;  3NP8 A;  1RCV D;  4BA1 I;  1YNN C;  3FDT A;  4RGT A;  1BNZ A;  3G6J B;  1A2U A;  4ZRZ A;  2JE6 I;  2WKD A;  3K58 A;  1E2Z A;  2HCC A;  1RHP A;  1QNK A;  2NVY B;  1WTR A;  2R6G A;  5ELF A;  1HTL D;  3DM1 A;  1TQO A;  1B4O A;  2BOS A;  3T13 A;  1TII D;  4RH6 A;  1J9O A;  3S9W A;  3OPO A;  3HG9 A;  1WTW A;  4Z9C B;  1SND A;  3KF8 A;  4MN3 A;  2KHS A;  3R3O A;  2DNC A;  3NWS A;  3S2D B;  2XNA C;  3URY A;  5CR3 A;  3SHL A;  2R3Z A;  1Z47 A;  4HSV A;  1EZ6 A;  1LTA D;  3E0J A;  4CKE A;  1EIH A;  2B8F A;  2M2L A;  3A8J E;  4IUQ A;  2IX3 A;  1F2M A;  2ICI A;  3SXH A;  5JJZ A;  1C8C A;  2QDB A;  5NUC A;  1EQT A;  5KNB A;  1BCP F;  1S4Z A;  2EY2 A;  1L0X B;  2M9V A;  2EYJ A;  2K5Q A;  1Y8N B;  1D5X C;  3T16 A;  1EOT A;  2IX0 A;  2SNS A;  1U9R A;  2MPM A;  2O2L D;  1X32 A;  5IGG A;  2F0J A;  3SEB A;  1A3V A;  2AQ1 B;  4KN4 C;  1ESR A;  2L9H A;  2VUM B;  1T5E A;  3K5N A;  1WVL A;  1F9S A;  1EYD A;  1STB A;  3NBH A;  4DGZ A;  1LTR D;  1PYW D;  3T4A C;  3I73 A;  1DOM A;  2QIL A;  1KLG D;  3TP7 A;  5JEA H;  3R8B A;  2Y0S B;  1Z6H A;  2RSN A;  3S1Q B;  4IAL A;  4BBR B;  2PPB C;  1TS3 A;  3T53 B;  3D3R A;  1IKM A;  3SVM A;  3KBG A;  4UAI A;  2EOT A;  3A54 A;  4PNY A;  2L0C A;  2YU9 B;  1ET9 A;  1G6Z A;  1E2V A;  1GXD C;  2IPK D;  3P75 A;  3HKZ B;  1M8A A;  4M8A A;  4G4K A;  3HOX B;  4NMZ A;  4L6T B;  2NWG A;  1EY8 A;  1CI3 M;  3NPP A;  1HPC A;  4RAU C;  2EE1 A;  4P2C B;  2V4D A;  3RD4 A;  1UEA B;  2B63 B;  1ZEQ X;  3MFY A;  1CA6 A;  1EWH A;  5T1G A;  1TS5 A;  3NTK A;  5FKA C;  4DNT B;  2B2Y C;  3BDO A;  3L3O C;  5EPJ A;  1OXU A;  3NUC A;  2B2T C;  4IFD J;  1TS4 A;  2PZT A;  1B53 A;  1SFO B;  2JEA I;  4CJ2 C;  2XRS D;  2WB1 B;  2VNU D;  1PRT D;  3MTS A;  2J4X A;  5M5Y B;  1TWG B;  4NW2 A;  4XQQ A;  4ABN A;  1QJO A;  1BCP C;  2IX1 A;  3DMU A;  3PMF A;  1ILP A;  2F0T A;  2B2U C;  4PMW A;  3A7L A;  1JOR A;  3X3M A;  3X3N A;  1EU3 A;  5A2Q E;  5G3L D;  1LTG D;  3HOY B;  3SK5 A;  1STN A;  4CKB A;  4IZ8 A;  2L4N A;  1MSG A;  2KVM A;  2H4O A;  2ID0 A;  4XXE A;  5CBA E;  3R93 A;  1X3P A;  3ND9 A;  4RKL A;  3H94 A;  1EIG A;  5I6Y A;  2F0M A;  3P1H A;  1HFG A;  5CBE E;  2PMZ B;  4IUN A;  2HCI A;  3R2T A;  2JA8 B;  4KK7 A;  3BDL A;  2IWH A;  3KK7 A;  5IOD A;  5ELC A;  1PFB A;  4K6D A;  3QB3 A;  3V96 A;  3SK6 A;  1VMC A;  1SJH D;  1V43 A;  4DK1 A;  5J1Z A;  1B1Z A;  1JB3 A;  4BWG B;  3LWU A;  2IW3 A;  1PTO C;  5E3F A;  1PFM A;  2EXZ A;  1IKL A;  4XT1 B;  3K6O A;  3FEW X;  1A6X A;  1I4G A;  3BYT B;  1K83 B;  1A15 A;  1NR2 A;  3PV0 A;  5C4X B;  2KCC A;  1QB5 D;  5M5W B;  5JVG 3;  4IUR A;  4XQN A;  4C56 C;  1PZJ D;  1JOO A;  2ZXP A;  3V2T A;  3DUZ A;  4LK1 C;  1O7Y A;  5C6A A;  1NR4 A;  4H44 C;  5IOC A;  1J8I A;  1CZW A;  5DEH A;  1ILQ A;  4C3J B;  2EJG C;  3C46 A;  4IUU A;  3TN2 A;  2A69 D;  3D6W A;  1RTN A;  1B3A A;  3NWT A;  1GUG A;  3ERQ A;  2B2Y A;  3VR3 A;  4OGQ C;  2AQ2 B;  3D8G A;  2J7Z A;  5EPK A;  3BVM A;  4L63 B;  2B2T A;  4C3H B;  2LFN A;  4K5W A;  2Z1C A;  2KA7 A;  2C9O A;  1I4H A;  1SAP A;  3OIQ A;  1HXY D;  5I2Y A;  1ZYR D;  5FO7 B;  1OO9 B;  3NSW A;  1ENA A;  3E6Z X;  2NVX B;  4F8M A;  2ENB A;  1PLF A;  1S5F D;  1W6J A;  3J7A V;  4ZYS A;  4DU9 A;  2NUC A;  3K57 A;  1LT3 D;  2B2U A;  5LL6 X;  1FYC A;  4OHJ A;  4O42 A;  2AUK A;  1Q3L A;  2M00 A;  5J39 A;  2EJM A;  1LT5 D;  2WAC A;  1Y1V B;  4DAV A;  2PW7 A;  3K7A B;  4C3I B;  4G7O C;  4FF2 A;  2AQ3 B;  5HUR A;  1BBX C;  1JOK A;  3S16 B;  3MC0 B;  1TWH B;  1CM9 A;  1V1P B;  2NVT B;  3CU7 A;  2E75 C;  3C1F A;  2RSO A;  2F0F A;  4KY6 A;  2XWB B;  3TDQ A;  2NB0 A;  4DA2 A;  3Q0A A;  2BDN A;  4C1N K;  1SYD A;  4A3M B;  3TZD A;  4L8J A;  1O7L A;  1LT6 D;  3OWF A;  1FGB D;  5G3L F;  5KND A;  3DEO A;  1TVX A;  4K2L A;  5IGE A;  1VMP A;  1Q90 A;  3FPU B;  1NCV A;  2KQ3 A;  4C3H G;  4LJZ C;  1XTC D;  4A3E B;  5CV7 A;  1JE4 A;  3BG3 A;  3I72 A;  1CHP D;  2K28 A;  1WTV A;  4Q0F A;  2JSO A;  2CQA A;  4F7X A;  2B8G A;  3HGB A;  1TY2 A;  2BE5 D;  2RA4 A;  4WFN 3;  1SBB B;  1CQF A;  4ZQ3 A;  1O80 A;  5I9O A;  2ZXO A;  1C4Q A;  2KEC A;  1NAP A;  1JIC A;  2A68 D;  4KTA A;  1DOK A;  2RQX A;  2E2D C;  1KNA A;  1TT2 A;  2F0Q A;  3NK9 A;  1CT1 D;  3HZX A;  1BR9 A;  1I3Q B;  1RJT A;  1H9S A;  2HDM A;  4RWS C;  5BN4 A;  2XN9 C;  3A55 A;  3D4W A;  1B9M A;  1WTX A;  4QUF A;  1EY0 A;  2K1B A;  3M7N A;  4DXG A;  3I4M B;  3ITP A;  5DAU A;  5K36 G;  5TSS A;  2LKV A;  4MHE A;  2PCF B;  3IFD A;  2LS0 1;  1W6K A;  3BVZ A;  2O5I C;  3MXG A;  1Q1B A;  1CFM A;  1EY4 A;  5DNF A;  1B9N A;  1M4V A;  2EYL A;  3OWE B;  4RHS A;  3GV6 A;  4HMI A;  3H6M A;  4HSP A;  1SYF A;  1Z7T A;  5IGB A;  4KD4 A;  3GV3 A;  1JR0 D;  4WOR A;  4ZK9 B;  2WAQ B;  3MA2 B;  2F0I A;  2FMM A;  3D6C A;  1U4R A;  5ISR A;  2HQE A;  5F2D A;  2QF7 A;  4HCE A;  3HS0 C;  2FHT A;  3GTJ B;  3L7Z C;  4XYQ A;  5C3E B;  2I46 A;  5EKL A;  1AZQ A;  5CV4 A;  4A3D B;  3EJI A;  3ND8 A;  3AB9 A;  4BS9 A;  1SE4 A;  1CQV A;  3BYY B;  3GTP B;  2DY8 A;  1A3U A;  4TRD A;  1G2T A;  4QF4 A;  1LLR D;  1G29 1;  1STA A;  2ICE C;  3A8I E;  2Q8I B;  1K8M A;  1ICW A;  2J0T D;  4A93 B;  2EZV A;  2WIN B;  3H09 A;  4OO1 G;  2F3V A;  1JWM D;  1GHK A;  4X3K A;  1BDO A;  2HUG A;  1IL8 A;  4X3T A;  3I90 A;  3EQL C;  5EPL A;  1TS2 A;  2NYZ D;  2RDH A;  1S5C D;  4OL7 A;  1L0Y B;  4PQX A;  5IGF A;  4KHZ A;  1RDP D;  1V1P A;  1ENF A;  2K7V A;  5C5M A;  1TU2 B;  1TR5 A;  3I4N B;  3BVG A;  1CZG A;  3J81 L;  4KN7 C;  2K04 A;  2WP8 J;  2A69 C;  3DWP A;  1Q8I A;  4DN4 M;  1BCP B;  2DN8 A;  1I6H B;  2F0K A;  4S3S A;  4QCL A;  5KNC A;  4RCO A;  3ZYY X;  1AW7 A;  1U4M A;  4A3G B;  1PTO F;  1PXU A;  1ESF A;  2B2V C;  1SYC A;  3QJY A;  1HUN A;  3NHH A;  1G8Z D;  3W2D A;  1STE A;  3CKI B;  3I4L A;  1EY7 A;  2X6G A;  3MAQ A;  4CKC A;  1JC7 A;  4TSS A;  2FJ2 A;  1NUC A;  3WOF A;  1UNS A;  3DWQ A;  4FF1 A;  3G7L A;  1H9R A;  3VR4 A;  3Q23 A;  1D5Z C;  2R61 A;  2RKS A;  2RBM A;  2E2H B;  5EBD A;  2CHB D;  4KKT A;  3NBI A;  5C3W A;  5FLX L;  2XWJ B;  3MXN A;  5JVH 3;  3Q24 A;  4H13 C;  1F77 A;  4V19 0;  2PNR C;  2A6H D;  5E4X A;  4DAY A;  1I50 B;  1U4L A;  4TQU S;  1PTO B;  1HQM C;  1V8Q A;  3TP8 A;  3OW7 A;  1QIL A;  2TMP A;  2A74 C;  2EYM A;  3VA5 A;  4EQO A;  1EQV A;  3GO5 A;  5KEE A;  1SYE A;  2A73 B;  2MGS A;  3BDC A;  4KY5 A;  1SJE D;  1OXT A;  1C48 A;  3VR2 A;  3CQZ B;  5T1I A;  1Y1W B;  5JPN C;  1LAB A;  3PO2 B;  5FK9 C;  5IT9 L;  1GUO A;  3DHQ A;  3FPP A;  1LO5 D;  2FMC A;  4K5V A;  2KUM A;  2F3W A;  3H0G B;  4KKU A;  2NZ1 D;  2GA4 B;  4EGV A;  2K33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...