1STHA

Two distinctly different metal binding modes are seen in x-ray crystal structures of staphylococcal nuclease-cobalt(ii)-nucleotide complexes
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structures of staphylococcal nuclease complexed with the competitive inhibitor cobalt(II) and nucleotide.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase (phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sthA00
2OEOA 4QB4A 5CV7A 5EGTA 4K14A 4YIJA 4HMJA 1STNA 4NP5A 4EVOA 5C3WA 4EQNA 4B9XA 2EYHA 1EY4A 2EXZA 2F0NA 2NUCA 3P75A 3QOJA 4TRDA 2PW7A 4B9WA 5KEEA 4KY6A 5M9OA 4KTAA 4R8NA 1STHA 3NXWA 1EY5A 3ERQA 3TP5A 2F3VA 1EY8A 4ZQ3A 3NK9A 4N9TA 1II3A 4KY5A 1JOQA 4KD4A 1SNMA 4F8MA 4NMZA 4H7BA 2PW5A 4K8IA 4K2LA 1A2TA 3TP8A 1IHZA 4PNYA 2F0JA 4KY7A 1EZ8A 4DFAA 1NUCA 2F0SA 3E5SA 3OMGA 1STGA 3OSOA 3HZXA 3MXPA 4K8JA 3R3OA 4KJOA 4WORA 5I6YA 1EQVA 2PZUA 1STAA 2EYLA 5IGBA 2ENBA 4LAAA 5KRUA 2SOBA 1TT2A 2F0LA 4RKLA 5CV5A 2PZTA 5DEHA 5C6AA 4ODGA 1KDCA 3MVVA 1F2MA 2SNMA 4ID6A 2EYPA 2EYOA 3SK6A 2QDBA 2KHSA 3S9WA 4PMCA 5KYIA 5IGEA 5E1FA 4K5VA 4K5XA 3C1EA 3SK5A 2F0OA 4IZ8A 4ZUIA 4DF7A 1EY0A 2F0MA 5C4ZA 5JAVA 5ISRA 5CV6A 3SK4A 3T16A 2F0TA 4NDXA 1TR5A 2F0KA 2F3WA 1SYDA 2F0DA 3PMFA 4RKBA 4F7XA 5JOBA 1F2YA 5C4HA 5CGKA 1KABA 1SNPA 2LKVA 2F0HA 1SYGA 1STYA 1EY9A 3H6MA 2F0UA 2PYKA 3EJIA 3LX0A 1KDBA 3V2TA 5C3XA 1EY6A 2O4XA 4QMGA 1EYAA 4WRDA 3TMEA 4EQOA 5CV8A 5I9PA 1ENCA 2EY2A 2OXPA 4N9PA 1SYFA 5NUCA 1TQOA 5J22A 3SK8A 5KIXA 2PZWA 2F0PA 1SYCA 3C1FA 4K2KA 5IGCA 5IGFA 3D4DA 4MIUA 1SYEA 1STBA 2RBMA 5CV4A 5DAUA 4DU9A 5IIFA 4K5WA 4J1MA 1SNOA 4OL7A 2F0WA 1ENAA 3D6CA 1SYBA 5IGDA 1A3UA 3QB3A 1EYDA 5IODA 5EKLA 3NUCA 4K6DA 4EQPA 3TP6A 4KV6A 2EY6A 3SXHA 5K5PA 4IALA 2F0VA 1A3VA 2SNSA 4S3SA 5CR3A 3RUZA 5HURA 5F2DA 5HGTA 3QOLA 3MZ5A 1A3TA 2M00A 3BDCA 3P1HA 1JORA 4J6HA 1AEXA 3DHQA 3BDLA 4HTHA 4NKLA 3OMCA 1EY7A 1U9RA 4ZUJA 3EROA 2EYFA 3ITPA 3NHHA 3SR1A 3DMUA 2EY1A 2EY5A 1RKNA 2EYJA 2WACA 4KHVA 5CC4A 1EZ6A 2RKSA 3MHBA 2F0QA 5I9OA 3D4WA 5J1ZA 3T13A 3TP7A 3OWFA 5E3FA 3HEJA 3SHLA 5IGGA 5EKKA 4QF4A 3EVQA 4I65A 4DGZA 2EYMA 5I6WA 3NP8A 5C5MA 1SNCA 1KAAA 5KGUA 1NSNS 2F0IA 5KYLA 1EYCA 2RDFA 3D8GA 1KDAA 1SNQA 4KD3A 3NQTA 1JOOA 3MEHA 4PMBA 2KQ3A 5J39A 2F0FA 4KJNA 4HMIA 3U9OA 5C5LA 4G57A 5CV9A 2OF1A 3VA5A 2F0EA 1JOKA 2PQEA 5IOCA 2F0GA 4ME5A 1F2ZA 2HQEA 4IUNA 4E6IA 1A2UA 1SNDA
chains in the Genus database with same CATH superfamily
2IT1A 3DUZA 4EVOA 1L1OC 2Q2TA 1PFNA 3PIO3 1VF7A 2A68D 4BBRH 5ELCA 2KHIA 3BU2A 3NTKA 1LTGD 4X62Q 1LV9A 3TRZA 1EY5A 3C2PA 1UNSA 4A3EB 1K8OA 2FJ2A 4ZAIA 4LF8Q 1YJWA 1JOQA 4LJZC 4FXDA 1HNXQ 2B2UC 4K0KL 3MAQA 2F3IA 4DV4Q 3KF6B 1CZGA 2NZ1D 2EPBA 2XSCA 1RHPA 3ZJYC 3AU7A 1AE2A 2EYLA 1UE1A 2UXCQ 4LAAA 3I7FA 5KRUA 2R6GA 2JSOA 5DLQE 2ZJPA 1GJXA 5LMNW 2L9HA 2KHSA 2G5DA 1ML0D 4GKJQ 1IYVA 1D5ZC 4DNRB 2A5HA 3H3VI 3GTOH 2B2VA 1Q3LA 4OWWB 3ER0A 2JA8H 4O2DA 1JE5A 1TWGB 2RF4A 2F0UA 4C1NK 5FLXE 3CRKC 1EY6A 1R4PB 1NJIC 4IOAA 2EE1A 5C4JB 1DD2A 1VQ4A 1RCVD 4DR4Q 4K2KA 1KNEA 4RCOA 1SYEA 1BUVT 4NXML 5BR8L 5G3LF 4ZKBB 2YV5A 1HFGA 4WFN3 1PYWD 2MP1A 3W3AA 4R4IA 1VQKA 3S16H 1WTRA 1N34L 1HR0L 2M00A 4DR6L 1PVOA 3RN5A 4JI5L 1NNXA 3EROA 1N9WA 3DMUA 1PH5A 1FGBD 1EZ6A 1X65A 1STEA 1YNND 2NTTA 1F9SA 5EPJA 2JEAI 1SXTA 4YHHL 3A0JA 1EYCA 3MFYA 1WCMH 4C3HB 1SNQA 1EL0A 1CA5A 2O2LD 4JI6L 1XXGA 1DXMA 2IX1A 2AKWB 5E7NA 5IYDG 4C56C 4JI3L 5L37A 3MEFA 1E22A 2ZXRA 4DR1L 3K5MA 2ZJRA 1XMOQ 3Q0AA 4A3EH 1YZ6A 1C0AA 4JI1Q 3ONAB 4EQNA 1EY4A 2F0NA 2A19A 5EPLA 2BDOA 4A3GB 1CKNA 1PZJD 2LS01 2NZHA 4RHSA 1GUWA 4X3KA 2RHQB 1UAPA 4P71A 1OXSC 1IHZA 3E9HA 4A3GG 3TZDA 3ND8A 1GD7A 1STGA 3HZXA 2KBNA 3TDQA 4XIGS 1D1IA 5DEHA 3PSIA 5C6AA 4ODGA 2EXDA 3S14H 3E9IA 3KLRA 2WB1E 3A5ZB 5C44G 5A35A 3M4OH 3PIOA 1WCMG 3A8IE 3K6OA 5I2YA 2H5XA 4N8FA 4WJ4A 4YY3L 2R93H 3PUXA 4NDXA 5AFWA 2OWOA 3W1GA 5M3MB 2HD3A 1MD2D 5I2XA 1B53A 3JC66 3BVMA 4Q0FA 3VR5A 4C3HH 1HR0W 2NVXH 2VB3X 4BBSB 2R92G 3KFUA 1TQOA 3VYUA 3KUPA 5C4XB 1BCPC 1GUOA 4UP7A 5DAUA 1VMPA 2ICEC 2UU9Q 4GNXC 1JICA 2GVAA 1SNOA 1ENAA 2NYZD 5JJIA 3MXUA 3NUCA 1Y1VB 3TP6A 3SXHA 2B2TA 4IALA 2B63H 4JI5Q 2MO1A 3H15A 1AEXA 2CQOA 3OWEB 3TS0A 4C3JB 4DK1A 4ZUJA 4MNOA 2R7ZH 2EY1A 2KA7A 4XQQA 1JCKB 4I7AA 5EQ0A 2EQSA 1QILA 2QKIC 1EQQA 1G6ZA 3T13A 3SHLA 5C44H 5C5MA 4DUZL 2IX3A 5DM63 2YTVA 5IP9H 1D8LA 4A3JH 4NXNQ 2K14A 2CFMA 2NVTB 4JI4L 2K52A 2K75A 1A2UA 5EAYA 1I4PA 5C0XG 4YWMA 3VR6A 2VS1A 2PW7A 4RHRA 4IJLA 1B3AA 3HOYG 3K80C 4CDDC 3G4SA 4G7HC 2DN8A 1PH4A 4JI0L 2MHVA 3F8TA 3HOUB 1YJNA 3T1HQ 2ZXOA 1HJPA 4UHVA 1HUNA 1SBBB 2M9VA 3PCOB 1GVPA 3SEBA 1GKHA 1L0YB 2I5HA 3QG1A 5M5XH 3FKIG 2CQAA 1V1PB 1Q8IA 2F0LA 4MTKA 4K0KQ 4HN7A 3I73A 1WTWA 1BKBA 3MVVA 4UP9A 4LFCQ 2EYPA 2QEJC 3GO5A 2FINB 1CHPD 4LF9Q 2KENA 2MNAA 2ZTEA 5C0XJ 2ZTDA 3KLWA 1MIUA 2TSSA 1PV4A 1MBYA 3VYSA 3HOZG 5CV6A 1WJJA 3NBHB 5TSSA 2E76C 4AIMA 1CHQD 4KN4C 1AFPA 2R7ZB 4DV0L 4BBRB 1IL8A 3A7AB 2O4XA 1F9PA 4QMGA 4JBKA 2K33A 1K3BC 4AH6A 4R8IA 2IHFA 4RAUC 2F4IA 2WAQE 4DV2Q 3VA7A 3MXNA 1NR4A 4L5QA 4DR5L 1RTOA 1HNZQ 3KDFA 3GTOB 1VCIA 3RMHA 1FJGL 2NVTH 3KJOA 1NMFA 1XJVA 1N36L 4KV6A 4GN4B 2XRQD 1QB5D 4QIWB 1BVSA 5HURA 4LNQA 1HUMA 2A73B 2HUGA 2XVSA 3T1YL 5FJ8G 1EY7A 2EYFA 5IYDH 5CC4A 5IP9G 2VQEQ 2CVRA 3L9AX 4RA8A 4UY8C 5ELDA 2HCCA 3F1ZA 1B2TA 1Y1VH 3NE5B 4PQXA 5M5WH 4LFBQ 5JPNC 1TXYA 3JAMc 4A76A 1XPUA 3S1RH 1K0SA 5D14A 4CDCC 2EDGA 4UAIA 2NZOA 3CAMA 3PO2G 3VYRA 3J7AF 5M3FB 5LL6S 1I6HB 1NE3A 4HMJA 2WP8J 1WI5A 3PO3B 4GNXA 1SSOA 4JBWA 4JYAL 4IFDG 3HS0C 4P72A 2PQAB 3I70A 1I3QH 3D3RA 1VQ7A 1E3PA 3ERQA 3WOFA 2F52A 4GLAC 1M90C 2VQFQ 3AB9A 1Q82C 1PLFA 1WVLA 2B8FA 4K8IA 1G2SA 4DNTB 4XYOA 1ET6A 1EU3A 1WTOA 1LT4D 3C46A 3CKIB 1STAA 1GXDC 1PTOC 4HSPA 4OIKA 4LFAL 1IBKQ 2NN6H 3NEMA 3MXGA 2YU9H 1KDCA 3KF8B 1D7QA 1TWCH 1G6PA 4A3MB 1F2MA 2JN4A 1IYUA 2PNHA 3A8JE 2HDLA 1V8QA 4RFBA 2NVQH 3K59A 1R9TH 2F3WA 1H9JA 2EVBA 1B44D 4KKSA 3I8ZA 1B1ZA 3RNUA 2E2DC 2NTSA 4YCVA 4APVA 2YTYA 1CQFA 2ATWA 4IUUA 3EBEA 5KIXA 4XDXA 3CMEA 5M3MG 2L4NA 4DU9A 4HIKA 4DPGA 3CC2A 2QEXA 1M8AA 1J6QA 5GAEC 1SYBA 4QUFA 1JJGA 3VR2A 5K5PA 1SLJA 5CYUA 3DM3A 3S14B 1S5FD 2K5HA 1JORA 3P1HA 4C3IB 3U4VA 4NKLA 5C4XH 3FMCA 2RCFA 2ALYB 5LHY1 1IKMA 1HTLD 4LF6Q 1QVCA 3A74A 1RKNA 3E3XA 3N6RA 1AH9A 4X3SA 2CW0D 4H02A 4U68A 1X3QA 1X3GA 5IWAQ 4BA2I 1BDOA 2F0IA 1HZCA 1K8MA 1JOOA 1GUSA 1RJTA 5J39A 5JEAG 2D9UA 2QCPX 5CV9A 1QVFA 1EIGA 2F0GA 2K01A 4IUNA 1VQNA 2R3ZA 3BG3A 3EQLC 1PTOF 1PRTF 3BVZA 3QWNA 1UUPA 1LTTD 5LL6X 1B9NA 4MN3A 4P73A 1W2BA 4ULLA 5FLMG 5COYA 4KY5A 4U673 1HZAA 3TSSA 2O5IC 3ULLA 1ESRA 1SMXA 1NUCA 1EWIA 3L2PA 3B6YA 3J80E 1K0RA 4GLVB 4IUPA 4RKLA 4CKCA 3HOUG 3L0OA 1TS3A 1DOLA 3L3OC 3S9WA 4A3BG 3HKZE 1Y1WH 1Y8PB 3S24A 3KJPA 3H0GB 5FLXc 1VQHA 2B3GA 3W1BA 2DJGC 3PF4A 3IKJA 4JC0A 1TIID 5IGCA 5IGFA 4O1NA 2PI2A 4QGUA 4A3DH 3G6JB 3I4OA 2V4DA 5E4XA 2FXQA 4X65L 1IBLQ 5C0XI 2A1AA 1A3UA 3QB3A 2WB1G 5IODA 1CA6A 1TS5A 1GO3E 4YCWA 2K04A 3BVGA 3PUZA 5T1GA 5EPKA 2NBFA 2PNRC 1H9SB 1E0BA 1OO9B 4X66Q 4IFDI 2AWOA 4L5SA 4LF8L 4OEMB 4X62L 3EVQA 2OTJA 3U50C 3NENA 4J15A 1XMQL 1AE3A 4JV5Q 2DNCA 2VUMB 4FNFA 3VR4A 1B70B 3QR8A 3H3VH 1EUJA 1IW7C 3RZOB 2WKCA 3NBHA 4G57A 3DWAA 2UXBL 1HFNA 1I4HA 3CCMA 4POGA 4ME5A 1F2ZA 1SE2A 2HQEA 4A3GH 2KUMA 3D4RA 5IE8A 2Q2HA 2ZT9C 3M4OB 3J7ZC 5C3WA 4B9XA 3W2DA 2NUCA 3JAME 1H9KA 1XNQQ 1BCPF 1B9MA 1R4QB 3KLSA 4DUYQ 4B3TL 4DXFA 1A6XA 4KD4A 4LF6L 1K73C 1T5EA 1AN8A 4A3DB 3I4MB 3OHXC 1DYQA 4P75A 4DR7L 2VL6A 3UI2A 2XN9C 1CI3M 3DEPA 4WORA 4WJWA 2PZUA 2RA4A 3F2DA 3OOCA 4M1UB 4LF4L 3CRLC 4OGQC 4A4IA 4LWCA 4DKAC 2N8NA 3D0FA 5E1FA 2D62A 2K5DA 3C1EA 3M9BA 1AZQA 2B39A 1AZPA 2HHHQ 2BH8A 3JAML 1T9HA 2L0CA 1KABA 5IYBG 3RR5A 1LM0A 1SYGA 3GTJH 2OQKA 5FLXL 4J8QA 1YITA 1PH3A 1VQBA 3CC7A 4IPHA 5FKAC 1Y8NB 3A8KE 4LFBL 1SYCA 1GOZA 4A3IG 4LUOA 1WTHA 5M3FG 3PF5A 1N33Q 3RZOH 5KNCA 5IGDA 2KCNA 4EQPA 4K6DA 1ASYA 5FJ8H 2WAQB 3I55A 2AHOB 3J81L 1PH1A 3M85A 2JA6H 1A3TA 1GHJA 2NN6G 2R93B 4BXXH 1UWVA 2JA8G 1X9NA 1J8IA 4LMQD 2GN5A 3ITPA 2K05A 2C35B 1O7YA 3KF6A 3Q22A 5FLMH 3QO2A 3NQIA 1RF2D 4BY1B 2BDNA 4I65A 1VQJA 3HKZB 4UPAA 1BBUA 1KAAA 2DGYA 4GN3B 1BQQT 3NQTA 1QZHA 1BR9A 1GUTA 3CP0A 1FNVA 3BZCA 4H13C 1O7IA 4GOPA 4BY1G 4JI8L 4B3MQ 3PIP3 4JI6Q 1N32L 5CV7A 1C7YA 4DK6C 1SJED 2N78A 1PRTB 2EXZA 3TN2A 1CSQA 1STHA 5FO7B 2CHBD 4OX9L 1XNRQ 4N9TA 3ND9A 4HIDA 4F8MA 3FKIH 2IPKD 3S15H 2H4OA 1SE8A 4FF3A 1PA6A 1I5FA 1S5ED 1U4LA 1N34Q 2PO4A 3MXPA 1F9QA 2UXDQ 2JEBI 5IGBA 4L6TB 3CCJA 2FHTA 5E4WC 2HDMA 3Q6SA 5BR8Q 5C3EG 3SVMA 4XQJA 3UDXA 4GKKQ 1C48A 1PH9A 3VR3A 5CORA 4DR4L 1MHWC 4JI7L 4ZUIA 3LWUA 2JA7G 4GZYC 4BY1H 1FVIA 3HOVH 2P5ZX 4B3SL 2X69A 1VQFA 5GAHC 1I94L 3MC0B 4A3LH 4JI8Q 2V1CC 3I3CA 3K0XA 5JJZA 1YJ9A 3O13A 3HOVG 1TKWB 1F9RA 3TQYA 2K5WA 2PZWA 4IURA 3AEVA 2JA7H 1E7ZA 3UDFA 5FO9B 4HJ9A 2I07B 1VDZA 3UDGA 3LGJA 2RDGA 3Q24A 3BDOA 5EKLA 3K58A 3A7LA 3S2DB 3LWEA 4DNIA 5A2QE 5HGQA 1BCPD 2XRSD 3QOLA 1WCMB 2BE5C 1G2TA 1P8LA 3BDLA 4HTHA 1UE6A 2RSNA 2MO0A 3I4NH 1FNWA 1C9OA 2WIIB 1K83H 1OXXK 4ILWA 5CBAE 3WOEA 5I9OA 2C5CA 4RGMA 3D4WA 2NVYH 2LXJA 1RL2A 3OWFA 4HJ5A 4A3KH 3HOWH 1VQDA 2EYMA 1I6VC 3E0EA 3S1RB 4DV1Q 1TWHH 2WV6D 4HIOA 2RDFA 3V05A 3HOYH 2CW0C 2Y0SE 3I91A 4CDEC 2KEEA 1ILPA 3AMUA 2KCTA 3VA5A 3GTQB 4FYDA 3K57A 4F87A 4JI4Q 3CQZB 4TVAB 1K3RA 1X3PA 4E6IA 2L55A 3OW7A 1I4GA 2OEOA 3T53B 5ELNA 1Y1VG 2ZTCA 3DLLA 5KEEA 5IWAL 5ELFA 4A3JG 1TWFH 3NXWA 4ZCKA 2JA5H 4QY7A 2Q2IA 4A3BH 3SDZA 4KHPQ 4JPBW 4WJ3M 3HOVB 1O7LA 3U58A 3S2HB 4MZ9A 1YI2A 3P7JA 2E2JB 2LFNA 4A3MG 1EZ8A 1NY4A 1PRTD 2FFKB 2F03A 4KJOA 5G3LD 4FXGC 1MKHA 4JVZA 2L12A 2LY7A 2Z6KA 2Z9HA 5CV5A 3GTMH 1N33L 1YNJD 5GADC 2OCEA 1WTXA 2SNMA 1EQTA 4BY7G 2RCNA 3U4ZA 2Z6BA 5IGEA 1LO5D 2L1BA 3NELA 3SK5A 4DF7A 3RLFA 4DV6Q 3I4MH 4BBSG 2R7FA 3G6EA 3P20A 4V190 1EEFD 4YWLA 1XPRA 1HQMC 1WFQA 1J5EQ 2A6EC 2NN6I 5BN3A 5CGKA 1L1OA 1X3EA 1K83B 1UEAB 1IBML 1VQ6A 1H95A 3HOYB 1G8ZD 3EJIA 2Z0SA 3J7AV 1HTPA 2HIXA 1UE7A 4WRDA 3X3NA 1S72A 3J81i 3H3VC 5J22A 5D65A 1F77A 4Q5VA 3S2DH 1EFID 4YHHQ 3HGBA 3K7AH 4JV5L 1B50A 1OXTA 1JJCB 4J1MA 2JA8B 1PFMA 2HIVA 2AQ1B 4IUQA 2D5DA 2UUBL 4OO1H 1Q8KA 3RUZA 5JVH3 2KOLA 4TKOB 4A3BB 2VB2X 2NWGA 1SFOH 2NVQB 2NVYB 1QE6A 2R61A 4QJFA 3HOWB 1PHJA 5IP7G 4DV7L 2M2LA 2E75C 3JAMi 4KHVA 3NWSA 3MXNB 1VQEA 1CM9A 5IGGA 3NSWA 4QF4A 2Z4IA 2KHJA 5C4JH 1HNZL 3S2HH 1JT8A 3S16B 2X6GA 3GTQH 4A93B 3SGIA 3PO2H 4HCEA 1ZXTA 1EOTA 3MEHA 2KQ3A 1ET9A 4FF2A 4JW0A 1S5CD 3DWQA 2Y0SG 3FPPA 1H9RA 2F0EA 1JOKA 1VQAA 4DV0Q 4B3SQ 1ZYRD 3HFZB 2BCOA 1HNWL 3Q8DA 3WWVA 4K14A 5JVG3 1Y1WG 1CUKA 4PG3A 4DV1L 1RIPA 1LTSD 4XXEA 1CT1D 1HZ9A 4IUVA 4DA2A 4GLXA 4LF9L 5M5WB 2SEBD 4X3UA 4BS9A 2JYOA 1U4PA 1SNMA 4NMZA 4H7BA 1S5DD 3RN2A 1Z7TA 2MQHA 4A93H 4F88A 2AQ2B 1SMYC 4DFAA 2EJGC 4HJ8A 4FO2A 1KL9A 2BH2A 1RTNA 2AQ3B 1EQVA 1CK1A 1JR0D 4A3CH 1B3QA 1HNXL 1A8VA 3MWYW 1LTRD 2KVMA 4GOPC 2J0TD 3SK6A 4DR5Q 1JC7A 1PH2A 4HAEA 4OX9Q 1ASZA 2D0OA 1UE5A 4KN7C 5ELEA 3HOWG 4LK1C 4OO1I 4QCLA 2F0MA 1Q7YC 1K28A 4HIMA 4RKBA 5KNBA 4NB3A 1D1KA 3I4NG 4QUCA 2LKVA 1U4MA 1KDBA 1PTOB 4PZ6A 1ENCA 3K5LA 2BA0A 1SDFA 2G9DA 4GKJL 2A6HC 5IIFA 1STBA 2UUAQ 4OONA 2CKZB 3J80c 4YCUA 1JB3A 1EWCA 1BNZA 1NTGA 1QWYA 1EYDA 1O78A 2E8GA 1Y1WB 4AYBG 1L1OB 5K36G 2B2YC 4J6HA 1SR3A 5JPMC 3PUVA 2Z6KC 3G48A 4Y7NH 3IFDA 2ZM6Q 2UUBQ 2WACA 4RGOS 1VMCA 2EOTA 5J1ZA 3M3YH 4CKEA 3NP8A 4HJAA 2B63B 4M8AA 1V1OA 1MI2A 1K8GA 1PH7A 2K4KA 1PYSB 4ZRZA 1L2FA 1DJRD 3CPFA 4A3IB 5JJLA 2JXMB 3H09A 3L7ZC 2E2IH 3DEOA 1QUQB 2R92H 3MA2B 1IBMQ 3H0GG 3BYYB 2K50A 4C3HG 1STNA 2Q8TA 2EYHA 4B9WA 3GP7A 5GROA 3CCUA 1PYBA 3PQIA 4YY3Q 3Q23A 2IL8A 4OHJA 3PO2B 2R93G 2Z4HA 2AWNA 4RH6A 3IFTA 4K2LA 3TP8A 4PNYA 3V96A 1ESFA 1W6KA 5DM73 1X3FA 1W3SA 3HP3A 4DAPA 3A55A 1TWGH 3I4MG 4JG2A 3NTHA 2CWAA 4A3CG 1EIFA 1B8AA 1X55A 4IOCA 2VW9A 1XNQL 2BE5D 5C4ZA 5ISRA 3CQZH 4R4TA 3VYTA 3E6ZX 3KOJA 1SYDA 4JI1L 4PMWA 1JWUD 4P74A 1HA5A 4A3EG 2PYKA 3A56A 1I50B 2UXBQ 2LMCB 3TZUA 4N9PA 4A3KB 1SN8A 4JOIA 4A3FH 4UP8A 5CV4A 2RBMA 4K5WA 1D6EC 5LMUL 3CMAA 4JI2L 1BF4A 3FPUB 3FEWX 3D6CA 4N8X1 4EX5A 3S1QH 5EJWA 4FXKC 3DWPA 2E74C 1S4ZA 4X66L 4DR7Q 3KLSX 4XYQA 3M3YB 4I7ZC 4FP5D 3CHBD 2EY5A 4DUYL 3F2BA 4B3TQ 1E2VA 1EQRA 4QIWE 2F0QA 3HEJA 1BO0A 1TS4A 4DGZA 1KIXA 1VQIA 4BBRG 4G7ZC 1SNCA 4DV5Q 2Q8IB 1IXRA 4DR1Q 1CQVA 2B29A 2F0FA 4X6AH 2RQXA 1K8AC 3EN2A 4JI3Q 3GQBA 2PQEA 4CBVA 3AQQA 3K7AB 1I4RA 3CCVA 4NP5A 1V43A 1LT5D 2CH4W 1IL2A 1I4XA 5J3BA 1RODA 2UUCL 5JEAJ 3M7NA 2Q2UA 1GUGA 3G7LA 1CKMA 2VXWA 1EY8A 3K81C 3ICEA 1A15A 2PW5A 1LTLA 2WKDA 1NAPA 1TY2A 1KC8C 1BCPB 2B2YA 4FVMA 3I4LA 4ZK9B 2MGSA 3OIPA 2UXCL 3GTLH 1ICFB 1E2WA 4K8JA 4AQYL 1WD0A 1V1PA 3CCQA 1JMCA 2JA7B 1GHKA 2PZTA 3M7GA 1VQ9A 4DV3L 4FDBA 1H9MA 5AJ3L 4DV2L 1JJ2A 4K5VA 3FKIB 1M4VA 3S15B 2UUCQ 4L5RC 2B2TC 4POFA 4F7XA 5C4HA 1I94Q 1HNWQ 1Y69U 4MHEA 2MUYA 1TWCB 1JQYD 1OXVA 3GV3A 2CH4A 2DY7A 3TMEA 3PIPA 2K5QA 5CV8A 4DK3C 4NXNL 1VQLA 2JA5G 4LF7Q 2KECA 3TEHB 3M4QA 1DM0B 3J81c 1HA6A 2R7ZG 1XWEA 2A68C 1QJOA 3NWTA 3ULJA 4G7OC 3AFPA 3H94A 2ASBA 3CXCA 2PMZE 1U5KA 1CKNB 2K6AA 3GTGB 2EY6A 1NMGA 4AQYQ 1V1QA 1Q86C 5F2DA 3BDCA 3DHQA 1Y14B 5CBEE 2SDFA 1W6JA 1A0IA 3NHHA 3CCEA 2EYJA 4IO9A 1XNRL 2RKSA 2XNAC 3CCSA 3TP7A 5IY0A 1PZID 2A6ED 4KMUC 2JE6I 1YVCA 2UU9L 3S1QB 1G291 1TS2A 1YHAA 2XIWA 1X56A 2VZAA 1FNUA 1CZWA 1KTKA 5C0XH 4B3ML 2QILA 1ONLA 4X64Q 4XT1B 1YNJC 2K5NA 2A74C 1C4QA 4XT3B 3MFGA 1QNKA 2K7VA 3CW2C 1PMRA 3K8AA 2RDHA 4CHTB 4DV5L 1YIJA 3QOJA 4OWXB 2PQAA 3P75A 2I0QA 3GTKB 2HHHL 4KY6A 4EGVA 2PCFB 2A6HD 3HKSA 4CJ0B 4R8NA 2B2WC 2I5LX 2LXKA 3NK9A 1SE4A 1II3A 1MJCA 1WTVA 1QCBD 1S5BD 1D2BA 1VQCA 2N55A 3OIQA 1IW7D 1VS0A 4KY7A 1XPOA 3AYHB 3R8BA 5M5YB 2F1MA 4RWSC 3OSOA 5GAGC 4ZYSA 3HOXB 1Q12A 5H1SE 3C3LA 1C8CA 4IQZA 4L5TA 1TWAB 2SOBA 1J9OA 3CC4A 5T1IA 2B2VC 5FK9C 4GN5A 1ILQA 2EYOA 1BXTA 5KNDA 2X6LA 2VQFL 3UE0A 4NW2A 3HOXG 1KD1C 2E2JH 1GUNA 1QZGA 2R92B 5HY6A 3T16A 2F0TA 2Q8RE 3K0YA 5JOBA 1PFSA 2IY5B 4OO1G 1HH2P 3H6MA 4Y7NB 2HQLA 4X64L 4EQOA 1L0XB 4MTNA 4XTCS 2IW3A 2J4XA 1VQMA 1BOSA 1KHIA 4ABNA 4MIUA 5IT9E 4FF1A 3GTGH 1NCVA 2B8GA 1YHQA 1DCZA 5JJKA 2EJFC 2I5MX 4LF4Q 4FF4A 1RD9D 2K03A 1S3OA 3IRBA 4ZKCB 2WFWA 1NBWA 3EFXD 5EBDA 3H0GH 1ZKOA 3NBIA 2E2HH 1VQ8A 5HGTA 1ICWA 2YYZA 4DK0A 1SEBD 2G9HD 1TVXA 4R1JA 3SR1A 2QGQA 1Z6HA 2HCIA 3N52A 1MSGA 5BN4A 5EKKA 1FGUA 2DNEA 5I6WA 1P16A 3OYYA 1VQGA 3UDIA 5I4DA 5KGUA 1NSNS 3PGZA 5KYLA 2RHSB 3S17B 1YNXA 1PRTC 4PZ8A 1ZEQX 4BXXG 4H44C 4HMIA 3RLOA 2OTLA 2OQ0A 3K7UC 3T51B 2QF7A 1YBYA 3NTIA 1SNDA 1FD7D 1PTOD 4K6LA 5EBCA 5LMNQ 4YIJA 2WB1B 4CKBA 4JBJA 1SFOB 1TU2B 4KTAA 1DOMA 2F3VA 3BYTB 1YEZA 2E5LQ 4JBMA 1JWSD 1HR0Q 4EQ5A 5C3EB 4DR6Q 3OMGA 3PUYA 4R4CA 3CCRA 3CD6A 4DV4L 3ZYYX 1YNNC 1X54A 2UUAL 2WAQG 3KK7A 4JI0Q 2VNUD 3R2TA 2QDBA 4B08A 3CF5A 4C3IG 1EEID 2CWPA 1KAWA 2F0OA 2K28A 2N3SA 4KKTA 1EIHA 2F0KA 4O42A 1K9MC 2PPBC 2Z1CA 5LMNL 1SNPA 3S17H 1STYA 2IWHA 2B2UA 3PUWA 1KNAA 1SMYD 1NR2A 3HOZB 3SK8A 4H0LC 3OW2A 4TSSA 1Q46A 4Y52H 2F0PA 1E24A 4OELB 3I4NB 3OPOA 2I46A 4DUZQ 4OL7A 4A3FG 2AMCB 5ELOA 4A3IH 3GDEA 1PDQA 3G71A 1V9PA 3R93A 4JCVE 2MJ8A 4KHZA 1HHVA 3T1HL 1WD1A 3RD4A 2KCCA 2E5LL 5IYBH 1CSPA 1Q1EA 1QG7A 4HEDA 3MHBA 1Q90A 2AUKA 2Z8LA 4L8JA 3EIVA 3M4YA 2L15A 3F2CA 1Z9FA 5LMUQ 4X3TA 4L63B 3A5UA 4PMBA 4A3KG 3OTOL 1XYIA 5FO8B 4LUVA 3TREA 5IP7H 5C4XG 3EA6A 4TQUS 1Q81C 1SROA 4IJHA 3A54A 1DONA 5IOCA 1WOCA 3IL8A 3BZKA 2GA4B 2F4VQ 1EOVA 4IN3A 1WTPA 4B3RQ 5IYCG 3KDFB 1HXYD 1LABA 4TRDA 4A3DG 3S1NB 1DOKA 4Z9CB 3T56B 2C9OA 4YWKA 4LF5L 3KYHC 1PH8A 3RLNA 3GTMB 3TP5A 1XX8A 5M3MH 4RG1A 2PMZB 2JA9A 1E1TA 4RCNA 1KQSA 2VY3A 3DXJC 2ZXPA 2F0JA 4LFAQ 2XWJB 3PO3H 4R9WA 4DAYB 4DN4M 4XQNA 3R3OA 2QDLA 1CFMA 4A3FB 1I3QB 1ZYRC 1M1KC 1TT2A 4DAYA 4AYBE 4JI2Q 4BBSH 1B7YB 3QJYA 4HJ7A 2O5JC 1SE3A 3W5OA 1N8RC 3KBXA 4DXGA 3GD7A 1HCZA 5JAVA 4JYAQ 1E1OA 5C3EH 4HSVA 1HPCA 3PV0A 3S1MH 1TR5A 3PMFA 1CTMA 1MJEA 3QIAA 5C3XA 4A3MH 5K36H 1WTQA 1EYAA 3J81j 5I9PA 1KLGD 2EY2A 3NPPA 1UEBA 2JQOA 3C1FA 5D3IB 1A62A 1JB7A 5FOBB 3J80i 3HRZC 4IFDH 5M5YH 1F2LA 2F0WA 2B2WA 3HG9A 2RSOA 3PO3G 1EWHA 1BBWA 4BA1I 2FMMA 2F0VA 4RGNA 1X6OA 2K1BA 3J81E 1L0WA 4DAVA 1FYCA 2ID0A 1E2ZA 4KI0A 5JEAH 4A75A 1AP0A 4QQBX 3GTKH 1BBXC 1OXUA 2D0PA 4BWGB 5A2QL 3D31A 1N36Q 4ME3A 4CJ2C 1OTCA 5E3FA 2KJXA 5ELBA 3K5NA 4GNXB 4X65Q 4LF5Q 5IYCH 3I90A 4GS3A 4NPSA 2EIFA 2E2HB 4C2MH 2XTIA 2F4VL 1XMOL 3STBC 1JE4A 1SRUA 3E0JA 4RMFA 5C44B 4LUZA 4BY7B 2OF1A 1HZBA 1ENFA 1U0LA 1Z47A 2ZJQA 4IPDA 4A93G 3CPWA 2LSSA 2JA6G 1YHBA 2JJQA 3RZDB 4DAMA 1DGSA 3GV6A 3FP9A 1Q1BA 5M9OA 2NB0A 1PXUA 4JI7Q 2FMCA 5D3DA 4GKKL 4P2CB 1QOHA 5CMDA 2ZM6L 1XTDA 2IHEA 4KLKA 3I72A 1FL0A 2L5TA 1A2TA 2JK8A 3T1YQ 2A69C 5IT9c 1CKOA 4A3LG 3X3MA 1VF5C 3E5SA 1KRSA 2F0SA 2XWBB 2QA4A 2HT1A 2UXDL 3BS1A 1LYLA 1JWMD 1VQ5A 3GTPB 2ENBA 2J7ZA 3DM1A 1MGSA 2TMPA 4IPCA 2ES2A 1LUZA 3GTJB 1PTOH 4ID6A 1SJHD 5M5XB 3RZDH 2RVLA 4R4OA 4NXMQ 3KF8A 4PMCA 2K32A 5KYIA 4CGYB 4K5XA 2MFIA 4IZ8A 4JK1C 1HRJA 1SAPA 3SK4A 2N88A 3BZDB 1PH6A 1F2YA 3ERSX 2F0HA 3CCLA 1EYGA 4JOIC 3F2UA 1MSHA 4R4QA 4C1NI 2IJ0A 5NUCA 4QL5A 3KBGA 4C3IH 4GOPB 1VQOA 3IAYA 1S40A 3URYA 3GTPH 2YTXA 2DJFC 2QW7A 4KK7A 1X32A 1KRTA 5AJ3Q 4RGTA 4LFCL 4DV3Q 4OWTB 4CJ1B 3S1MB 5BN5A 2DY8A 4HCSA 1EU4A 3MTSA 3ULPA 4IPGA 5CR3A 4DV7Q 4IFDJ 3MZ5A 2CCZA 3M4PA 3BJUA 3TS2A 4LW1A 4PZ7A 4UDUC 3VDYA 4CDFC 2XGTA 4AYBB 1B4OA 2E2IB 1KXLA 1RDPD 4BY7H 2EZVA 3D8GA 1U4RA 1N32Q 1LT6D 3I2ZA 2MPMA 1LTID 4PV1C 1TWAH 1HQRD 3FRPB 1PFBA 2B63G 2K5VA 4QB4A 5EGTA 1IKLA 2R7DA 2H1EA 2ICIA 5M3FH 1I6HH 2NVXB 4DV6L 2YU9B 3J7A5 5GQOA 4C2MB 3U9SA 4ZQ3A 1D5MC 4HR7B 1AW7A 3J80L 3HOXH 2BOSA 3K5OA 1G91A 1IBKL 2KEDA 4OIJA 2D2CC 4A3JB 2AUJD 1EFWA 3R2IA 1TY0A 3HOZH 3TBIB 5I6YA 1PZKD 4O0AA 4DR3Q 1A63A 4DR2L 4ZLTF 5IT9L 1IZ6A 1FR3A 2A8VA 1I50H 3WDNA 4ALPA 1EY0A 1LTBD 1LACA 2L11A 3GTLB 1QUQA 5EKIA 3I56A 1LT3D 5DNFA 2DUDA 3J7YW 2JP1A 2F0DA 3HOUH 4B3RL 1XTCD 1LTAD 2A69D 1EY9A 3LX0A 3V2TA 1D5XC 1T5XD 3FHWA 1J5EL 2VUMG 4G4KA 2OXPA 1SYFA 3FDTA 4C3JH 3D4DA 1XMQQ 4DR2Q 2OT2A 2WINB 1EIYB 4DR3L 4C3JG 3LNNA 1KLUD 4IUTA 2VQEL 1GM5A 2PI2E 3CU7A 1G51A 2GVBA 2VUMH 4S3SA 2SNSA 1A3VA 1TWHB 1QNUA 4V0BA 3HKZG 1R9TB 1DZ1A 3STBD 3OMCA 1Y8OB 3SE0A 1LLRD 3S1NH 1U9RA 3UE1A 1H9SA 1O7ZA 1O80A 3FVQA 4KHPL 2Y0SB 2N49A 1VQPA 1FJGQ 1IBLL 2KCMA 1I4QA 2EJMA 1IYJB 3D6WA 3T4AC 2BA1A 4OXPA 2JA6B 1KDAA 4KD3A 1TWFB 4LF7L 2IX0A 2JA5B 4KJNA 3U9OA 5C5LA 3H91A 1QVGA 4KKUA 3AFQA 1WYDA 3OTOQ
chains in the Genus database with same CATH topology
2IT1A 3DUZA 4EVOA 1PFNA 3PIO3 1VF7A 2A68D 5ELCA 3NTKA 1LTGD 1LV9A 1EY5A 3C2PA 1UNSA 4A3EB 1K8OA 2FJ2A 4ZAIA 1JOQA 4LJZC 4FXDA 2B2UC 3MAQA 1CZGA 2NZ1D 2EPBA 2XSCA 1RHPA 3AU7A 2EYLA 4LAAA 5KRUA 2R6GA 2JSOA 1GJXA 2L9HA 2KHSA 1ML0D 1IYVA 1D5ZC 4DNRB 2A5HA 2B2VA 1Q3LA 1TWGB 2F0UA 4C1NK 5FLXE 3CRKC 1EY6A 1R4PB 2EE1A 5C4JB 1DD2A 1RCVD 4K2KA 1KNEA 4RCOA 1SYEA 1BUVT 5G3LF 4ZKBB 1HFGA 4WFN3 1PYWD 2MP1A 3W3AA 1WTRA 2M00A 3EROA 3DMUA 1FGBD 1EZ6A 1STEA 1YNND 2NTTA 1F9SA 5EPJA 2JEAI 1SXTA 1EYCA 3MFYA 4C3HB 1SNQA 1EL0A 1CA5A 2O2LD 1XXGA 1DXMA 2IX1A 4C56C 2ZXRA 3K5MA 3Q0AA 3ONAB 4EQNA 1EY4A 2F0NA 5EPLA 2BDOA 4A3GB 1PZJD 2LS01 4RHSA 1GUWA 4X3KA 1UAPA 1OXSC 1IHZA 3TZDA 3ND8A 1STGA 3HZXA 3TDQA 4XIGS 1D1IA 5DEHA 5C6AA 4ODGA 3KLRA 5A35A 3A8IE 3K6OA 5I2YA 3PUXA 4NDXA 5AFWA 5M3MB 1MD2D 5I2XA 1B53A 4Q0FA 3BVMA 3VR5A 2VB3X 4BBSB 1TQOA 3VYUA 3KUPA 5C4XB 1BCPC 1GUOA 5DAUA 1VMPA 2ICEC 1JICA 1SNOA 1ENAA 2NYZD 3MXUA 3NUCA 1Y1VB 3TP6A 3SXHA 2B2TA 4IALA 1AEXA 3OWEB 4C3JB 4DK1A 4ZUJA 2EY1A 2KA7A 4XQQA 1JCKB 5EQ0A 1G6ZA 2QKIC 1QILA 3T13A 3SHLA 5C5MA 2IX3A 5DM63 2NVTB 1A2UA 1I4PA 5C0XG 3VR6A 2PW7A 4RHRA 1B3AA 4G7HC 2DN8A 2MHVA 3HOUB 2ZXOA 1HUNA 1SBBB 2M9VA 3SEBA 1L0YB 3QG1A 2CQAA 1V1PB 1Q8IA 2F0LA 4HN7A 3I73A 1WTWA 3MVVA 2EYPA 2QEJC 3GO5A 2FINB 1CHPD 5C0XJ 2TSSA 1MBYA 3VYSA 5CV6A 5TSSA 2E76C 1CHQD 4KN4C 1AFPA 2R7ZB 4BBRB 1IL8A 3A7AB 2O4XA 1F9PA 4QMGA 2K33A 4R8IA 4RAUC 2F4IA 3VA7A 3MXNA 1NR4A 1RTOA 3GTOB 1VCIA 3RMHA 4KV6A 2XRQD 1QB5D 4QIWB 5HURA 1HUMA 2A73B 2HUGA 2XVSA 1EY7A 2EYFA 5CC4A 2CVRA 3L9AX 4RA8A 5ELDA 2HCCA 1B2TA 3NE5B 4PQXA 5JPNC 5D14A 2EDGA 4UAIA 3J7AF 3VYRA 5M3FB 5LL6S 1I6HB 4HMJA 2WP8J 3PO3B 1SSOA 4JBWA 4IFDG 3HS0C 3I70A 3D3RA 3ERQA 3WOFA 3AB9A 1PLFA 1WVLA 2B8FA 4K8IA 1G2SA 4DNTB 4XYOA 1ET6A 1EU3A 1WTOA 3C46A 1LT4D 3CKIB 1STAA 1GXDC 1PTOC 4HSPA 4OIKA 2NN6H 3MXGA 1KDCA 4A3MB 1F2MA 1IYUA 3A8JE 2HDLA 1V8QA 4RFBA 3K59A 2F3WA 1H9JA 2EVBA 1B44D 4KKSA 3I8ZA 1B1ZA 2E2DC 2NTSA 1CQFA 4IUUA 5KIXA 4XDXA 2L4NA 4DU9A 1M8AA 1SYBA 4QUFA 3VR2A 5K5PA 5CYUA 3S14B 1S5FD 1JORA 3P1HA 4C3IB 4NKLA 3FMCA 5LHY1 1IKMA 1HTLD 1RKNA 3N6RA 4X3SA 2CW0D 4U68A 1X3QA 4BA2I 1BDOA 2F0IA 1K8MA 5JEAG 5J39A 1RJTA 1JOOA 1GUSA 2D9UA 2QCPX 5CV9A 1EIGA 2F0GA 2K01A 4IUNA 2R3ZA 3BG3A 3EQLC 1PTOF 1PRTF 3BVZA 3QWNA 1UUPA 1LTTD 5LL6X 1B9NA 4MN3A 4ULLA 5COYA 4KY5A 4U673 3TSSA 2O5IC 1ESRA 1NUCA 3J80E 4IUPA 4RKLA 4CKCA 1TS3A 1DOLA 3L3OC 3S9WA 1Y8PB 3H0GB 3IKJA 1TIID 5IGCA 5IGFA 4O1NA 3G6JB 2V4DA 5E4XA 5C0XI 1A3UA 3QB3A 5IODA 1CA6A 1TS5A 2K04A 3BVGA 3PUZA 5T1GA 5EPKA 2NBFA 2PNRC 1H9SB 1E0BA 1OO9B 4IFDI 2AWOA 3EVQA 2DNCA 2VUMB 4FNFA 3VR4A 1IW7C 3RZOB 2WKCA 3NBHA 4G57A 3DWAA 1HFNA 1I4HA 4ME5A 1F2ZA 1SE2A 2HQEA 2KUMA 3D4RA 2ZT9C 3M4OB 5C3WA 4B9XA 3W2DA 2NUCA 3JAME 1H9KA 1BCPF 1B9MA 1R4QB 3KLSA 4DXFA 1A6XA 4KD4A 1T5EA 1AN8A 4A3DB 3I4MB 3OHXC 1DYQA 3UI2A 2XN9C 1CI3M 3DEPA 4WORA 4WJWA 2PZUA 2RA4A 3OOCA 4M1UB 3CRLC 4OGQC 5E1FA 2D62A 2K5DA 3C1EA 1AZQA 2B39A 1AZPA 3JAML 2L0CA 1KABA 1SYGA 5FLXL 4J8QA 5FKAC 1Y8NB 3A8KE 1SYCA 1GOZA 5KNCA 5IGDA 2KCNA 4EQPA 4K6DA 2WAQB 3J81L 3M85A 1A3TA 1GHJA 2NN6G 2R93B 1J8IA 4LMQD 3ITPA 2K05A 1O7YA 3Q22A 3QO2A 3NQIA 1RF2D 4BY1B 2BDNA 4I65A 3HKZB 1KAAA 1BQQT 3NQTA 1BR9A 1GUTA 1FNVA 4H13C 3PIP3 5CV7A 1SJED 1PRTB 2EXZA 3TN2A 1STHA 5FO7B 2CHBD 4N9TA 3ND9A 4F8MA 2IPKD 2H4OA 4FF3A 1S5ED 1U4LA 2PO4A 3MXPA 1F9QA 2JEBI 5IGBA 4L6TB 2FHTA 5E4WC 2HDMA 3Q6SA 3SVMA 4XQJA 1C48A 3VR3A 5CORA 4ZUIA 3LWUA 4GZYC 2X69A 3MC0B 3I3CA 5JJZA 3O13A 1TKWB 1F9RA 2K5WA 2PZWA 4IURA 5FO9B 2I07B 1VDZA 2RDGA 3Q24A 3BDOA 5EKLA 3K58A 3A7LA 3S2DB 3LWEA 5A2QE 1BCPD 2XRSD 3QOLA 1WCMB 2BE5C 1G2TA 4HTHA 3BDLA 2RSNA 1FNWA 2WIIB 1OXXK 4ILWA 5CBAE 3WOEA 5I9OA 2C5CA 4RGMA 3D4WA 3OWFA 2EYMA 1I6VC 3S1RB 2WV6D 2RDFA 3V05A 2CW0C 3I91A 1ILPA 2KEEA 3AMUA 3VA5A 3GTQB 4FYDA 3K57A 4F87A 3CQZB 1X3PA 4E6IA 2L55A 1I4GA 3OW7A 2OEOA 3T53B 5KEEA 5ELFA 3NXWA 3SDZA 3HOVB 1O7LA 3S2HB 3P7JA 2E2JB 2LFNA 1EZ8A 1PRTD 2FFKB 2F03A 4KJOA 5G3LD 4FXGC 2L12A 2LY7A 5CV5A 1YNJD 1WTXA 2SNMA 1EQTA 5IGEA 1LO5D 2L1BA 3SK5A 4DF7A 3RLFA 3P20A 4V190 1EEFD 1HQMC 2A6EC 2NN6I 5BN3A 5CGKA 1K83B 1UEAB 3HOYB 1G8ZD 3EJIA 3J7AV 1HTPA 4WRDA 3X3NA 3H3VC 5J22A 5D65A 1F77A 4Q5VA 1EFID 3HGBA 1B50A 1OXTA 4J1MA 2JA8B 1PFMA 2AQ1B 4IUQA 2D5DA 4OO1H 3RUZA 5JVH3 2KOLA 4TKOB 4A3BB 2VB2X 2NWGA 2NVQB 2NVYB 1QE6A 2R61A 3HOWB 2M2LA 2E75C 4KHVA 3NWSA 1CM9A 5IGGA 3NSWA 4QF4A 2Z4IA 3S16B 2X6GA 4A93B 4HCEA 1ZXTA 1EOTA 3MEHA 2KQ3A 1ET9A 4FF2A 1S5CD 3DWQA 3FPPA 1H9RA 2F0EA 1JOKA 1ZYRD 2BCOA 5JVG3 4K14A 1LTSD 4XXEA 1CT1D 4IUVA 4DA2A 5M5WB 2SEBD 4X3UA 4BS9A 2JYOA 1U4PA 1SNMA 4NMZA 4H7BA 1S5DD 1Z7TA 4F88A 2AQ2B 1SMYC 4DFAA 2EJGC 4FO2A 1RTNA 2AQ3B 1EQVA 1CK1A 1JR0D 3MWYW 1LTRD 2KVMA 2J0TD 3SK6A 1JC7A 4HAEA 4KN7C 5ELEA 4LK1C 4OO1I 4QCLA 2F0MA 4RKBA 5KNBA 1D1KA 4QUCA 2LKVA 1U4MA 1KDBA 1PTOB 1ENCA 3K5LA 2BA0A 1SDFA 2G9DA 2A6HC 5IIFA 1STBA 1JB3A 1EWCA 1BNZA 1QWYA 1EYDA 1O78A 1Y1WB 5K36G 2B2YC 4J6HA 5JPMC 3PUVA 3IFDA 2WACA 4RGOS 1VMCA 2EOTA 5J1ZA 4CKEA 3NP8A 2B63B 4M8AA 1V1OA 1MI2A 4ZRZA 1DJRD 4A3IB 2JXMB 3H09A 3L7ZC 3DEOA 3MA2B 3BYYB 4C3HG 1STNA 2Q8TA 2EYHA 4B9WA 3GP7A 3Q23A 2IL8A 4OHJA 3PO2B 2Z4HA 2AWNA 4RH6A 3IFTA 4K2LA 3TP8A 4PNYA 3V96A 1ESFA 1W6KA 5DM73 3HP3A 4DAPA 3A55A 3NTHA 2BE5D 5C4ZA 5ISRA 3VYTA 3E6ZX 1SYDA 4PMWA 1JWUD 1HA5A 2PYKA 3A56A 1I50B 2LMCB 3TZUA 4N9PA 4A3KB 5CV4A 2RBMA 4K5WA 1D6EC 1BF4A 3FPUB 3FEWX 3D6CA 5EJWA 4FXKC 3DWPA 2E74C 1S4ZA 3KLSX 4XYQA 3M3YB 4I7ZC 4FP5D 3CHBD 2EY5A 1E2VA 2F0QA 3HEJA 1BO0A 1TS4A 4DGZA 4G7ZC 1SNCA 2Q8IB 1CQVA 2F0FA 2RQXA 3GQBA 2PQEA 4CBVA 3K7AB 1I4RA 4NP5A 1V43A 1LT5D 1I4XA 1RODA 5JEAJ 3M7NA 1GUGA 3G7LA 2VXWA 1EY8A 1A15A 2PW5A 2WKDA 1NAPA 1TY2A 1BCPB 2B2YA 4FVMA 3I4LA 4ZK9B 2MGSA 3OIPA 1E2WA 4K8JA 1WD0A 1V1PA 2JA7B 1GHKA 2PZTA 3M7GA 1H9MA 4K5VA 3FKIB 1M4VA 3S15B 2B2TC 4F7XA 5C4HA 1Y69U 4MHEA 2MUYA 1TWCB 1JQYD 1OXVA 3GV3A 2DY7A 3TMEA 2K5QA 5CV8A 2KECA 1DM0B 1HA6A 1XWEA 2A68C 1QJOA 3NWTA 4G7OC 3H94A 2K6AA 3GTGB 2EY6A 5F2DA 3BDCA 3DHQA 5CBEE 2SDFA 1W6JA 3NHHA 2EYJA 2RKSA 2XNAC 3TP7A 1PZID 2A6ED 4KMUC 2JE6I 3S1QB 1G291 1TS2A 2XIWA 1FNUA 1CZWA 1KTKA 5C0XH 2QILA 1ONLA 4XT1B 1YNJC 2A74C 1C4QA 4XT3B 3MFGA 1QNKA 2K7VA 1PMRA 2RDHA 4CHTB 3QOJA 3GTKB 3P75A 4KY6A 4EGVA 2PCFB 2A6HD 4CJ0B 4R8NA 2B2WC 3NK9A 1SE4A 1II3A 1WTVA 1QCBD 1S5BD 1D2BA 2N55A 3OIQA 1IW7D 4KY7A 3R8BA 5M5YB 2F1MA 4RWSC 3OSOA 4ZYSA 3HOXB 1Q12A 3C3LA 1C8CA 4IQZA 1TWAB 2SOBA 1J9OA 5T1IA 2B2VC 5FK9C 1ILQA 2EYOA 1BXTA 5KNDA 2X6LA 4NW2A 1GUNA 2R92B 3T16A 2F0TA 2Q8RE 3K0YA 5JOBA 4OO1G 4Y7NB 3H6MA 4EQOA 1L0XB 4XTCS 2IW3A 2J4XA 1BOSA 4ABNA 4MIUA 5IT9E 4FF1A 1NCVA 2B8GA 1DCZA 2EJFC 4FF4A 1RD9D 2K03A 4ZKCB 3EFXD 5EBDA 1ZKOA 3NBIA 5HGTA 1ICWA 2YYZA 4DK0A 1SEBD 2G9HD 1TVXA 3SR1A 1Z6HA 2HCIA 3N52A 1MSGA 5BN4A 5EKKA 2DNEA 5I6WA 5I4DA 5KGUA 1NSNS 5KYLA 3S17B 1PRTC 1ZEQX 4H44C 4HMIA 3T51B 2QF7A 3NTIA 1SNDA 1FD7D 1PTOD 4K6LA 5EBCA 4YIJA 2WB1B 4CKBA 1SFOB 1TU2B 4KTAA 1DOMA 2F3VA 3BYTB 1JWSD 5C3EB 3OMGA 3PUYA 3ZYYX 1YNNC 3KK7A 2VNUD 3R2TA 2QDBA 4B08A 4C3IG 1EEID 2F0OA 2K28A 4KKTA 1EIHA 2F0KA 4O42A 2PPBC 2Z1CA 1SNPA 1STYA 2IWHA 2B2UA 3PUWA 1KNAA 1SMYD 1NR2A 3HOZB 3SK8A 4H0LC 4TSSA 2F0PA 3I4NB 3OPOA 2I46A 4OL7A 1PDQA 3R93A 2MJ8A 4KHZA 1HHVA 1WD1A 3RD4A 2KCCA 1Q1EA 1QG7A 4HEDA 3MHBA 1Q90A 2AUKA 2Z8LA 4L8JA 3M4YA 4X3TA 4L63B 4PMBA 1XYIA 5FO8B 3EA6A 4TQUS 3A54A 1DONA 5IOCA 3IL8A 2GA4B 1WTPA 4IN3A 1HXYD 1LABA 4TRDA 3S1NB 1DOKA 4Z9CB 3T56B 2C9OA 3GTMB 3TP5A 1XX8A 2PMZB 4RCNA 3DXJC 2ZXPA 2F0JA 2XWJB 4R9WA 4XQNA 4DN4M 3R3OA 1CFMA 4A3FB 1I3QB 1ZYRC 1TT2A 4DAYA 3QJYA 2O5JC 1SE3A 3KBXA 4DXGA 3GD7A 1HCZA 5JAVA 4HSVA 1HPCA 3PV0A 1TR5A 3PMFA 1CTMA 3QIAA 5C3XA 5K36H 1WTQA 1EYAA 5I9PA 1KLGD 2EY2A 3NPPA 3C1FA 5D3IB 5FOBB 3HRZC 4IFDH 1F2LA 2F0WA 2B2WA 3HG9A 2RSOA 1EWHA 4BA1I 2FMMA 2F0VA 4RGNA 2K1BA 3J81E 4DAVA 1FYCA 2ID0A 1E2ZA 4KI0A 5JEAH 1AP0A 1BBXC 1OXUA 4BWGB 5A2QL 3D31A 4CJ2C 5E3FA 2KJXA 5ELBA 3K5NA 3I90A 2E2HB 1JE4A 5C44B 3E0JA 4BY7B 2OF1A 1ENFA 1Z47A 3RZDB 3GV6A 1Q1BA 5M9OA 2NB0A 1PXUA 2FMCA 5D3DA 4P2CB 1QOHA 5CMDA 3I72A 2L5TA 1A2TA 2A69C 3X3MA 1VF5C 2F0SA 3E5SA 2XWBB 3BS1A 1JWMD 3GTPB 2ENBA 2J7ZA 3DM1A 1MGSA 2TMPA 3GTJB 1PTOH 4ID6A 1SJHD 5M5XB 2RVLA 3KF8A 4PMCA 2K32A 5KYIA 4CGYB 4K5XA 4IZ8A 4JK1C 1HRJA 1SAPA 3SK4A 2N88A 3BZDB 1F2YA 2F0HA 3F2UA 1MSHA 4C1NI 2IJ0A 5NUCA 3KBGA 3IAYA 3URYA 4KK7A 1X32A 4RGTA 4CJ1B 3S1MB 5BN5A 2DY8A 4HCSA 1EU4A 3MTSA 5CR3A 4IFDJ 3MZ5A 4UDUC 4AYBB 1B4OA 2E2IB 1RDPD 2EZVA 3D8GA 1U4RA 1LT6D 2MPMA 1LTID 4PV1C 1HQRD 3FRPB 1PFBA 4QB4A 5EGTA 1IKLA 2H1EA 2ICIA 2NVXB 2YU9B 4C2MB 3U9SA 4ZQ3A 1D5MC 4HR7B 1AW7A 3J80L 2BOSA 3K5OA 1G91A 2KEDA 4OIJA 4A3JB 2D2CC 2AUJD 3R2IA 1TY0A 3TBIB 5I6YA 1PZKD 4ZLTF 5IT9L 1FR3A 3WDNA 1EY0A 1LTBD 1LACA 2L11A 3GTLB 5EKIA 1LT3D 5DNFA 3J7YW 2JP1A 2F0DA 1XTCD 1LTAD 2A69D 1EY9A 3LX0A 3V2TA 1T5XD 1D5XC 4G4KA 2OXPA 1SYFA 3FDTA 3D4DA 2OT2A 2WINB 4C3JG 3LNNA 1KLUD 4IUTA 3CU7A 4S3SA 2SNSA 1A3VA 1TWHB 1QNUA 4V0BA 1R9TB 1DZ1A 3OMCA 1Y8OB 3SE0A 1LLRD 1U9RA 1H9SA 1O7ZA 1O80A 3FVQA 2Y0SB 1I4QA 2EJMA 3D6WA 3T4AC 2BA1A 2JA6B 1KDAA 4KD3A 1TWFB 2IX0A 2JA5B 4KJNA 3U9OA 5C5LA 3H91A 4KKUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OEO A;  4QB4 A;  5CV7 A;  5EGT A;  4K14 A;  4YIJ A;  4HMJ A;  1STN A;  4NP5 A;  4EVO A;  5C3W A;  4EQN A;  4B9X A;  2EYH A;  1EY4 A;  2EXZ A;  2F0N A;  2NUC A;  3P75 A;  3QOJ A;  4TRD A;  2PW7 A;  4B9W A;  5KEE A;  4KY6 A;  5M9O A;  4KTA A;  4R8N A;  1STH A;  3NXW A;  1EY5 A;  3ERQ A;  3TP5 A;  2F3V A;  1EY8 A;  4ZQ3 A;  3NK9 A;  4N9T A;  1II3 A;  4KY5 A;  1JOQ A;  4KD4 A;  1SNM A;  4F8M A;  4NMZ A;  4H7B A;  2PW5 A;  4K8I A;  4K2L A;  1A2T A;  3TP8 A;  1IHZ A;  4PNY A;  2F0J A;  4KY7 A;  1EZ8 A;  4DFA A;  1NUC A;  2F0S A;  3E5S A;  3OMG A;  1STG A;  3OSO A;  3HZX A;  3MXP A;  4K8J A;  3R3O A;  4KJO A;  4WOR A;  5I6Y A;  1EQV A;  2PZU A;  1STA A;  2EYL A;  5IGB A;  2ENB A;  4LAA A;  5KRU A;  2SOB A;  1TT2 A;  2F0L A;  4RKL A;  5CV5 A;  2PZT A;  5DEH A;  5C6A A;  4ODG A;  1KDC A;  3MVV A;  1F2M A;  2SNM A;  4ID6 A;  2EYP A;  2EYO A;  3SK6 A;  2QDB A;  2KHS A;  3S9W A;  4PMC A;  5KYI A;  5IGE A;  5E1F A;  4K5V A;  4K5X A;  3C1E A;  3SK5 A;  2F0O A;  4IZ8 A;  4ZUI A;  4DF7 A;  1EY0 A;  2F0M A;  5C4Z A;  5JAV A;  5ISR A;  5CV6 A;  3SK4 A;  3T16 A;  2F0T A;  4NDX A;  1TR5 A;  2F0K A;  2F3W A;  1SYD A;  2F0D A;  3PMF A;  4RKB A;  4F7X A;  5JOB A;  1F2Y A;  5C4H A;  5CGK A;  1KAB A;  1SNP A;  2LKV A;  2F0H A;  1SYG A;  1STY A;  1EY9 A;  3H6M A;  2F0U A;  2PYK A;  3EJI A;  3LX0 A;  1KDB A;  3V2T A;  5C3X A;  1EY6 A;  2O4X A;  4QMG A;  1EYA A;  4WRD A;  3TME A;  4EQO A;  5CV8 A;  5I9P A;  1ENC A;  2EY2 A;  2OXP A;  4N9P A;  1SYF A;  5NUC A;  1TQO A;  5J22 A;  3SK8 A;  5KIX A;  2PZW A;  2F0P A;  1SYC A;  3C1F A;  4K2K A;  5IGC A;  5IGF A;  3D4D A;  4MIU A;  1SYE A;  1STB A;  2RBM A;  5CV4 A;  5DAU A;  4DU9 A;  5IIF A;  4K5W A;  4J1M A;  1SNO A;  4OL7 A;  2F0W A;  1ENA A;  3D6C A;  1SYB A;  5IGD A;  1A3U A;  3QB3 A;  1EYD A;  5IOD A;  5EKL A;  3NUC A;  4K6D A;  4EQP A;  3TP6 A;  4KV6 A;  2EY6 A;  3SXH A;  5K5P A;  4IAL A;  2F0V A;  1A3V A;  2SNS A;  4S3S A;  5CR3 A;  3RUZ A;  5HUR A;  5F2D A;  5HGT A;  3QOL A;  3MZ5 A;  1A3T A;  2M00 A;  3BDC A;  3P1H A;  1JOR A;  4J6H A;  1AEX A;  3DHQ A;  3BDL A;  4HTH A;  4NKL A;  3OMC A;  1EY7 A;  1U9R A;  4ZUJ A;  3ERO A;  2EYF A;  3ITP A;  3NHH A;  3SR1 A;  3DMU A;  2EY1 A;  2EY5 A;  1RKN A;  2EYJ A;  2WAC A;  4KHV A;  5CC4 A;  1EZ6 A;  2RKS A;  3MHB A;  2F0Q A;  5I9O A;  3D4W A;  5J1Z A;  3T13 A;  3TP7 A;  3OWF A;  5E3F A;  3HEJ A;  3SHL A;  5IGG A;  5EKK A;  4QF4 A;  3EVQ A;  4I65 A;  4DGZ A;  2EYM A;  5I6W A;  3NP8 A;  5C5M A;  1SNC A;  1KAA A;  5KGU A;  1NSN S;  2F0I A;  5KYL A;  1EYC A;  2RDF A;  3D8G A;  1KDA A;  1SNQ A;  4KD3 A;  3NQT A;  1JOO A;  3MEH A;  4PMB A;  2KQ3 A;  5J39 A;  2F0F A;  4KJN A;  4HMI A;  3U9O A;  5C5L A;  4G57 A;  5CV9 A;  2OF1 A;  3VA5 A;  2F0E A;  1JOK A;  2PQE A;  5IOC A;  2F0G A;  4ME5 A;  1F2Z A;  2HQE A;  4IUN A;  4E6I A;  1A2U A;  1SND A; 
#chains in the Genus database with same CATH topology
 2IT1 A;  3DUZ A;  4EVO A;  1L1O C;  2Q2T A;  1PFN A;  3PIO 3;  1VF7 A;  2A68 D;  4BBR H;  5ELC A;  2KHI A;  3BU2 A;  3NTK A;  1LTG D;  4X62 Q;  1LV9 A;  3TRZ A;  1EY5 A;  3C2P A;  1UNS A;  4A3E B;  1K8O A;  2FJ2 A;  4ZAI A;  4LF8 Q;  1YJW A;  1JOQ A;  4LJZ C;  4FXD A;  1HNX Q;  2B2U C;  4K0K L;  3MAQ A;  2F3I A;  4DV4 Q;  3KF6 B;  1CZG A;  2NZ1 D;  2EPB A;  2XSC A;  1RHP A;  3ZJY C;  3AU7 A;  1AE2 A;  2EYL A;  1UE1 A;  2UXC Q;  4LAA A;  3I7F A;  5KRU A;  2R6G A;  2JSO A;  5DLQ E;  2ZJP A;  1GJX A;  5LMN W;  2L9H A;  2KHS A;  2G5D A;  1ML0 D;  4GKJ Q;  1IYV A;  1D5Z C;  4DNR B;  2A5H A;  3H3V I;  3GTO H;  2B2V A;  1Q3L A;  4OWW B;  3ER0 A;  2JA8 H;  4O2D A;  1JE5 A;  1TWG B;  2RF4 A;  2F0U A;  4C1N K;  5FLX E;  3CRK C;  1EY6 A;  1R4P B;  1NJI C;  4IOA A;  2EE1 A;  5C4J B;  1DD2 A;  1VQ4 A;  1RCV D;  4DR4 Q;  4K2K A;  1KNE A;  4RCO A;  1SYE A;  1BUV T;  4NXM L;  5BR8 L;  5G3L F;  4ZKB B;  2YV5 A;  1HFG A;  4WFN 3;  1PYW D;  2MP1 A;  3W3A A;  4R4I A;  1VQK A;  3S16 H;  1WTR A;  1N34 L;  1HR0 L;  2M00 A;  4DR6 L;  1PVO A;  3RN5 A;  4JI5 L;  1NNX A;  3ERO A;  1N9W A;  3DMU A;  1PH5 A;  1FGB D;  1EZ6 A;  1X65 A;  1STE A;  1YNN D;  2NTT A;  1F9S A;  5EPJ A;  2JEA I;  1SXT A;  4YHH L;  3A0J A;  1EYC A;  3MFY A;  1WCM H;  4C3H B;  1SNQ A;  1EL0 A;  1CA5 A;  2O2L D;  4JI6 L;  1XXG A;  1DXM A;  2IX1 A;  2AKW B;  5E7N A;  5IYD G;  4C56 C;  4JI3 L;  5L37 A;  3MEF A;  1E22 A;  2ZXR A;  4DR1 L;  3K5M A;  2ZJR A;  1XMO Q;  3Q0A A;  4A3E H;  1YZ6 A;  1C0A A;  4JI1 Q;  3ONA B;  4EQN A;  1EY4 A;  2F0N A;  2A19 A;  5EPL A;  2BDO A;  4A3G B;  1CKN A;  1PZJ D;  2LS0 1;  2NZH A;  4RHS A;  1GUW A;  4X3K A;  2RHQ B;  1UAP A;  4P71 A;  1OXS C;  1IHZ A;  3E9H A;  4A3G G;  3TZD A;  3ND8 A;  1GD7 A;  1STG A;  3HZX A;  2KBN A;  3TDQ A;  4XIG S;  1D1I A;  5DEH A;  3PSI A;  5C6A A;  4ODG A;  2EXD A;  3S14 H;  3E9I A;  3KLR A;  2WB1 E;  3A5Z B;  5C44 G;  5A35 A;  3M4O H;  3PIO A;  1WCM G;  3A8I E;  3K6O A;  5I2Y A;  2H5X A;  4N8F A;  4WJ4 A;  4YY3 L;  2R93 H;  3PUX A;  4NDX A;  5AFW A;  2OWO A;  3W1G A;  5M3M B;  2HD3 A;  1MD2 D;  5I2X A;  1B53 A;  3JC6 6;  3BVM A;  4Q0F A;  3VR5 A;  4C3H H;  1HR0 W;  2NVX H;  2VB3 X;  4BBS B;  2R92 G;  3KFU A;  1TQO A;  3VYU A;  3KUP A;  5C4X B;  1BCP C;  1GUO A;  4UP7 A;  5DAU A;  1VMP A;  2ICE C;  2UU9 Q;  4GNX C;  1JIC A;  2GVA A;  1SNO A;  1ENA A;  2NYZ D;  5JJI A;  3MXU A;  3NUC A;  1Y1V B;  3TP6 A;  3SXH A;  2B2T A;  4IAL A;  2B63 H;  4JI5 Q;  2MO1 A;  3H15 A;  1AEX A;  2CQO A;  3OWE B;  3TS0 A;  4C3J B;  4DK1 A;  4ZUJ A;  4MNO A;  2R7Z H;  2EY1 A;  2KA7 A;  4XQQ A;  1JCK B;  4I7A A;  5EQ0 A;  2EQS A;  1QIL A;  2QKI C;  1EQQ A;  1G6Z A;  3T13 A;  3SHL A;  5C44 H;  5C5M A;  4DUZ L;  2IX3 A;  5DM6 3;  2YTV A;  5IP9 H;  1D8L A;  4A3J H;  4NXN Q;  2K14 A;  2CFM A;  2NVT B;  4JI4 L;  2K52 A;  2K75 A;  1A2U A;  5EAY A;  1I4P A;  5C0X G;  4YWM A;  3VR6 A;  2VS1 A;  2PW7 A;  4RHR A;  4IJL A;  1B3A A;  3HOY G;  3K80 C;  4CDD C;  3G4S A;  4G7H C;  2DN8 A;  1PH4 A;  4JI0 L;  2MHV A;  3F8T A;  3HOU B;  1YJN A;  3T1H Q;  2ZXO A;  1HJP A;  4UHV A;  1HUN A;  1SBB B;  2M9V A;  3PCO B;  1GVP A;  3SEB A;  1GKH A;  1L0Y B;  2I5H A;  3QG1 A;  5M5X H;  3FKI G;  2CQA A;  1V1P B;  1Q8I A;  2F0L A;  4MTK A;  4K0K Q;  4HN7 A;  3I73 A;  1WTW A;  1BKB A;  3MVV A;  4UP9 A;  4LFC Q;  2EYP A;  2QEJ C;  3GO5 A;  2FIN B;  1CHP D;  4LF9 Q;  2KEN A;  2MNA A;  2ZTE A;  5C0X J;  2ZTD A;  3KLW A;  1MIU A;  2TSS A;  1PV4 A;  1MBY A;  3VYS A;  3HOZ G;  5CV6 A;  1WJJ A;  3NBH B;  5TSS A;  2E76 C;  4AIM A;  1CHQ D;  4KN4 C;  1AFP A;  2R7Z B;  4DV0 L;  4BBR B;  1IL8 A;  3A7A B;  2O4X A;  1F9P A;  4QMG A;  4JBK A;  2K33 A;  1K3B C;  4AH6 A;  4R8I A;  2IHF A;  4RAU C;  2F4I A;  2WAQ E;  4DV2 Q;  3VA7 A;  3MXN A;  1NR4 A;  4L5Q A;  4DR5 L;  1RTO A;  1HNZ Q;  3KDF A;  3GTO B;  1VCI A;  3RMH A;  1FJG L;  2NVT H;  3KJO A;  1NMF A;  1XJV A;  1N36 L;  4KV6 A;  4GN4 B;  2XRQ D;  1QB5 D;  4QIW B;  1BVS A;  5HUR A;  4LNQ A;  1HUM A;  2A73 B;  2HUG A;  2XVS A;  3T1Y L;  5FJ8 G;  1EY7 A;  2EYF A;  5IYD H;  5CC4 A;  5IP9 G;  2VQE Q;  2CVR A;  3L9A X;  4RA8 A;  4UY8 C;  5ELD A;  2HCC A;  3F1Z A;  1B2T A;  1Y1V H;  3NE5 B;  4PQX A;  5M5W H;  4LFB Q;  5JPN C;  1TXY A;  3JAM c;  4A76 A;  1XPU A;  3S1R H;  1K0S A;  5D14 A;  4CDC C;  2EDG A;  4UAI A;  2NZO A;  3CAM A;  3PO2 G;  3VYR A;  3J7A F;  5M3F B;  5LL6 S;  1I6H B;  1NE3 A;  4HMJ A;  2WP8 J;  1WI5 A;  3PO3 B;  4GNX A;  1SSO A;  4JBW A;  4JYA L;  4IFD G;  3HS0 C;  4P72 A;  2PQA B;  3I70 A;  1I3Q H;  3D3R A;  1VQ7 A;  1E3P A;  3ERQ A;  3WOF A;  2F52 A;  4GLA C;  1M90 C;  2VQF Q;  3AB9 A;  1Q82 C;  1PLF A;  1WVL A;  2B8F A;  4K8I A;  1G2S A;  4DNT B;  4XYO A;  1ET6 A;  1EU3 A;  1WTO A;  1LT4 D;  3C46 A;  3CKI B;  1STA A;  1GXD C;  1PTO C;  4HSP A;  4OIK A;  4LFA L;  1IBK Q;  2NN6 H;  3NEM A;  3MXG A;  2YU9 H;  1KDC A;  3KF8 B;  1D7Q A;  1TWC H;  1G6P A;  4A3M B;  1F2M A;  2JN4 A;  1IYU A;  2PNH A;  3A8J E;  2HDL A;  1V8Q A;  4RFB A;  2NVQ H;  3K59 A;  1R9T H;  2F3W A;  1H9J A;  2EVB A;  1B44 D;  4KKS A;  3I8Z A;  1B1Z A;  3RNU A;  2E2D C;  2NTS A;  4YCV A;  4APV A;  2YTY A;  1CQF A;  2ATW A;  4IUU A;  3EBE A;  5KIX A;  4XDX A;  3CME A;  5M3M G;  2L4N A;  4DU9 A;  4HIK A;  4DPG A;  3CC2 A;  2QEX A;  1M8A A;  1J6Q A;  5GAE C;  1SYB A;  4QUF A;  1JJG A;  3VR2 A;  5K5P A;  1SLJ A;  5CYU A;  3DM3 A;  3S14 B;  1S5F D;  2K5H A;  1JOR A;  3P1H A;  4C3I B;  3U4V A;  4NKL A;  5C4X H;  3FMC A;  2RCF A;  2ALY B;  5LHY 1;  1IKM A;  1HTL D;  4LF6 Q;  1QVC A;  3A74 A;  1RKN A;  3E3X A;  3N6R A;  1AH9 A;  4X3S A;  2CW0 D;  4H02 A;  4U68 A;  1X3Q A;  1X3G A;  5IWA Q;  4BA2 I;  1BDO A;  2F0I A;  1HZC A;  1K8M A;  1JOO A;  1GUS A;  1RJT A;  5J39 A;  5JEA G;  2D9U A;  2QCP X;  5CV9 A;  1QVF A;  1EIG A;  2F0G A;  2K01 A;  4IUN A;  1VQN A;  2R3Z A;  3BG3 A;  3EQL C;  1PTO F;  1PRT F;  3BVZ A;  3QWN A;  1UUP A;  1LTT D;  5LL6 X;  1B9N A;  4MN3 A;  4P73 A;  1W2B A;  4ULL A;  5FLM G;  5COY A;  4KY5 A;  4U67 3;  1HZA A;  3TSS A;  2O5I C;  3ULL A;  1ESR A;  1SMX A;  1NUC A;  1EWI A;  3L2P A;  3B6Y A;  3J80 E;  1K0R A;  4GLV B;  4IUP A;  4RKL A;  4CKC A;  3HOU G;  3L0O A;  1TS3 A;  1DOL A;  3L3O C;  3S9W A;  4A3B G;  3HKZ E;  1Y1W H;  1Y8P B;  3S24 A;  3KJP A;  3H0G B;  5FLX c;  1VQH A;  2B3G A;  3W1B A;  2DJG C;  3PF4 A;  3IKJ A;  4JC0 A;  1TII D;  5IGC A;  5IGF A;  4O1N A;  2PI2 A;  4QGU A;  4A3D H;  3G6J B;  3I4O A;  2V4D A;  5E4X A;  2FXQ A;  4X65 L;  1IBL Q;  5C0X I;  2A1A A;  1A3U A;  3QB3 A;  2WB1 G;  5IOD A;  1CA6 A;  1TS5 A;  1GO3 E;  4YCW A;  2K04 A;  3BVG A;  3PUZ A;  5T1G A;  5EPK A;  2NBF A;  2PNR C;  1H9S B;  1E0B A;  1OO9 B;  4X66 Q;  4IFD I;  2AWO A;  4L5S A;  4LF8 L;  4OEM B;  4X62 L;  3EVQ A;  2OTJ A;  3U50 C;  3NEN A;  4J15 A;  1XMQ L;  1AE3 A;  4JV5 Q;  2DNC A;  2VUM B;  4FNF A;  3VR4 A;  1B70 B;  3QR8 A;  3H3V H;  1EUJ A;  1IW7 C;  3RZO B;  2WKC A;  3NBH A;  4G57 A;  3DWA A;  2UXB L;  1HFN A;  1I4H A;  3CCM A;  4POG A;  4ME5 A;  1F2Z A;  1SE2 A;  2HQE A;  4A3G H;  2KUM A;  3D4R A;  5IE8 A;  2Q2H A;  2ZT9 C;  3M4O B;  3J7Z C;  5C3W A;  4B9X A;  3W2D A;  2NUC A;  3JAM E;  1H9K A;  1XNQ Q;  1BCP F;  1B9M A;  1R4Q B;  3KLS A;  4DUY Q;  4B3T L;  4DXF A;  1A6X A;  4KD4 A;  4LF6 L;  1K73 C;  1T5E A;  1AN8 A;  4A3D B;  3I4M B;  3OHX C;  1DYQ A;  4P75 A;  4DR7 L;  2VL6 A;  3UI2 A;  2XN9 C;  1CI3 M;  3DEP A;  4WOR A;  4WJW A;  2PZU A;  2RA4 A;  3F2D A;  3OOC A;  4M1U B;  4LF4 L;  3CRL C;  4OGQ C;  4A4I A;  4LWC A;  4DKA C;  2N8N A;  3D0F A;  5E1F A;  2D62 A;  2K5D A;  3C1E A;  3M9B A;  1AZQ A;  2B39 A;  1AZP A;  2HHH Q;  2BH8 A;  3JAM L;  1T9H A;  2L0C A;  1KAB A;  5IYB G;  3RR5 A;  1LM0 A;  1SYG A;  3GTJ H;  2OQK A;  5FLX L;  4J8Q A;  1YIT A;  1PH3 A;  1VQB A;  3CC7 A;  4IPH A;  5FKA C;  1Y8N B;  3A8K E;  4LFB L;  1SYC A;  1GOZ A;  4A3I G;  4LUO A;  1WTH A;  5M3F G;  3PF5 A;  1N33 Q;  3RZO H;  5KNC A;  5IGD A;  2KCN A;  4EQP A;  4K6D A;  1ASY A;  5FJ8 H;  2WAQ B;  3I55 A;  2AHO B;  3J81 L;  1PH1 A;  3M85 A;  2JA6 H;  1A3T A;  1GHJ A;  2NN6 G;  2R93 B;  4BXX H;  1UWV A;  2JA8 G;  1X9N A;  1J8I A;  4LMQ D;  2GN5 A;  3ITP A;  2K05 A;  2C35 B;  1O7Y A;  3KF6 A;  3Q22 A;  5FLM H;  3QO2 A;  3NQI A;  1RF2 D;  4BY1 B;  2BDN A;  4I65 A;  1VQJ A;  3HKZ B;  4UPA A;  1BBU A;  1KAA A;  2DGY A;  4GN3 B;  1BQQ T;  3NQT A;  1QZH A;  1BR9 A;  1GUT A;  3CP0 A;  1FNV A;  3BZC A;  4H13 C;  1O7I A;  4GOP A;  4BY1 G;  4JI8 L;  4B3M Q;  3PIP 3;  4JI6 Q;  1N32 L;  5CV7 A;  1C7Y A;  4DK6 C;  1SJE D;  2N78 A;  1PRT B;  2EXZ A;  3TN2 A;  1CSQ A;  1STH A;  5FO7 B;  2CHB D;  4OX9 L;  1XNR Q;  4N9T A;  3ND9 A;  4HID A;  4F8M A;  3FKI H;  2IPK D;  3S15 H;  2H4O A;  1SE8 A;  4FF3 A;  1PA6 A;  1I5F A;  1S5E D;  1U4L A;  1N34 Q;  2PO4 A;  3MXP A;  1F9Q A;  2UXD Q;  2JEB I;  5IGB A;  4L6T B;  3CCJ A;  2FHT A;  5E4W C;  2HDM A;  3Q6S A;  5BR8 Q;  5C3E G;  3SVM A;  4XQJ A;  3UDX A;  4GKK Q;  1C48 A;  1PH9 A;  3VR3 A;  5COR A;  4DR4 L;  1MHW C;  4JI7 L;  4ZUI A;  3LWU A;  2JA7 G;  4GZY C;  4BY1 H;  1FVI A;  3HOV H;  2P5Z X;  4B3S L;  2X69 A;  1VQF A;  5GAH C;  1I94 L;  3MC0 B;  4A3L H;  4JI8 Q;  2V1C C;  3I3C A;  3K0X A;  5JJZ A;  1YJ9 A;  3O13 A;  3HOV G;  1TKW B;  1F9R A;  3TQY A;  2K5W A;  2PZW A;  4IUR A;  3AEV A;  2JA7 H;  1E7Z A;  3UDF A;  5FO9 B;  4HJ9 A;  2I07 B;  1VDZ A;  3UDG A;  3LGJ A;  2RDG A;  3Q24 A;  3BDO A;  5EKL A;  3K58 A;  3A7L A;  3S2D B;  3LWE A;  4DNI A;  5A2Q E;  5HGQ A;  1BCP D;  2XRS D;  3QOL A;  1WCM B;  2BE5 C;  1G2T A;  1P8L A;  3BDL A;  4HTH A;  1UE6 A;  2RSN A;  2MO0 A;  3I4N H;  1FNW A;  1C9O A;  2WII B;  1K83 H;  1OXX K;  4ILW A;  5CBA E;  3WOE A;  5I9O A;  2C5C A;  4RGM A;  3D4W A;  2NVY H;  2LXJ A;  1RL2 A;  3OWF A;  4HJ5 A;  4A3K H;  3HOW H;  1VQD A;  2EYM A;  1I6V C;  3E0E A;  3S1R B;  4DV1 Q;  1TWH H;  2WV6 D;  4HIO A;  2RDF A;  3V05 A;  3HOY H;  2CW0 C;  2Y0S E;  3I91 A;  4CDE C;  2KEE A;  1ILP A;  3AMU A;  2KCT A;  3VA5 A;  3GTQ B;  4FYD A;  3K57 A;  4F87 A;  4JI4 Q;  3CQZ B;  4TVA B;  1K3R A;  1X3P A;  4E6I A;  2L55 A;  3OW7 A;  1I4G A;  2OEO A;  3T53 B;  5ELN A;  1Y1V G;  2ZTC A;  3DLL A;  5KEE A;  5IWA L;  5ELF A;  4A3J G;  1TWF H;  3NXW A;  4ZCK A;  2JA5 H;  4QY7 A;  2Q2I A;  4A3B H;  3SDZ A;  4KHP Q;  4JPB W;  4WJ3 M;  3HOV B;  1O7L A;  3U58 A;  3S2H B;  4MZ9 A;  1YI2 A;  3P7J A;  2E2J B;  2LFN A;  4A3M G;  1EZ8 A;  1NY4 A;  1PRT D;  2FFK B;  2F03 A;  4KJO A;  5G3L D;  4FXG C;  1MKH A;  4JVZ A;  2L12 A;  2LY7 A;  2Z6K A;  2Z9H A;  5CV5 A;  3GTM H;  1N33 L;  1YNJ D;  5GAD C;  2OCE A;  1WTX A;  2SNM A;  1EQT A;  4BY7 G;  2RCN A;  3U4Z A;  2Z6B A;  5IGE A;  1LO5 D;  2L1B A;  3NEL A;  3SK5 A;  4DF7 A;  3RLF A;  4DV6 Q;  3I4M H;  4BBS G;  2R7F A;  3G6E A;  3P20 A;  4V19 0;  1EEF D;  4YWL A;  1XPR A;  1HQM C;  1WFQ A;  1J5E Q;  2A6E C;  2NN6 I;  5BN3 A;  5CGK A;  1L1O A;  1X3E A;  1K83 B;  1UEA B;  1IBM L;  1VQ6 A;  1H95 A;  3HOY B;  1G8Z D;  3EJI A;  2Z0S A;  3J7A V;  1HTP A;  2HIX A;  1UE7 A;  4WRD A;  3X3N A;  1S72 A;  3J81 i;  3H3V C;  5J22 A;  5D65 A;  1F77 A;  4Q5V A;  3S2D H;  1EFI D;  4YHH Q;  3HGB A;  3K7A H;  4JV5 L;  1B50 A;  1OXT A;  1JJC B;  4J1M A;  2JA8 B;  1PFM A;  2HIV A;  2AQ1 B;  4IUQ A;  2D5D A;  2UUB L;  4OO1 H;  1Q8K A;  3RUZ A;  5JVH 3;  2KOL A;  4TKO B;  4A3B B;  2VB2 X;  2NWG A;  1SFO H;  2NVQ B;  2NVY B;  1QE6 A;  2R61 A;  4QJF A;  3HOW B;  1PHJ A;  5IP7 G;  4DV7 L;  2M2L A;  2E75 C;  3JAM i;  4KHV A;  3NWS A;  3MXN B;  1VQE A;  1CM9 A;  5IGG A;  3NSW A;  4QF4 A;  2Z4I A;  2KHJ A;  5C4J H;  1HNZ L;  3S2H H;  1JT8 A;  3S16 B;  2X6G A;  3GTQ H;  4A93 B;  3SGI A;  3PO2 H;  4HCE A;  1ZXT A;  1EOT A;  3MEH A;  2KQ3 A;  1ET9 A;  4FF2 A;  4JW0 A;  1S5C D;  3DWQ A;  2Y0S G;  3FPP A;  1H9R A;  2F0E A;  1JOK A;  1VQA A;  4DV0 Q;  4B3S Q;  1ZYR D;  3HFZ B;  2BCO A;  1HNW L;  3Q8D A;  3WWV A;  4K14 A;  5JVG 3;  1Y1W G;  1CUK A;  4PG3 A;  4DV1 L;  1RIP A;  1LTS D;  4XXE A;  1CT1 D;  1HZ9 A;  4IUV A;  4DA2 A;  4GLX A;  4LF9 L;  5M5W B;  2SEB D;  4X3U A;  4BS9 A;  2JYO A;  1U4P A;  1SNM A;  4NMZ A;  4H7B A;  1S5D D;  3RN2 A;  1Z7T A;  2MQH A;  4A93 H;  4F88 A;  2AQ2 B;  1SMY C;  4DFA A;  2EJG C;  4HJ8 A;  4FO2 A;  1KL9 A;  2BH2 A;  1RTN A;  2AQ3 B;  1EQV A;  1CK1 A;  1JR0 D;  4A3C H;  1B3Q A;  1HNX L;  1A8V A;  3MWY W;  1LTR D;  2KVM A;  4GOP C;  2J0T D;  3SK6 A;  4DR5 Q;  1JC7 A;  1PH2 A;  4HAE A;  4OX9 Q;  1ASZ A;  2D0O A;  1UE5 A;  4KN7 C;  5ELE A;  3HOW G;  4LK1 C;  4OO1 I;  4QCL A;  2F0M A;  1Q7Y C;  1K28 A;  4HIM A;  4RKB A;  5KNB A;  4NB3 A;  1D1K A;  3I4N G;  4QUC A;  2LKV A;  1U4M A;  1KDB A;  1PTO B;  4PZ6 A;  1ENC A;  3K5L A;  2BA0 A;  1SDF A;  2G9D A;  4GKJ L;  2A6H C;  5IIF A;  1STB A;  2UUA Q;  4OON A;  2CKZ B;  3J80 c;  4YCU A;  1JB3 A;  1EWC A;  1BNZ A;  1NTG A;  1QWY A;  1EYD A;  1O78 A;  2E8G A;  1Y1W B;  4AYB G;  1L1O B;  5K36 G;  2B2Y C;  4J6H A;  1SR3 A;  5JPM C;  3PUV A;  2Z6K C;  3G48 A;  4Y7N H;  3IFD A;  2ZM6 Q;  2UUB Q;  2WAC A;  4RGO S;  1VMC A;  2EOT A;  5J1Z A;  3M3Y H;  4CKE A;  3NP8 A;  4HJA A;  2B63 B;  4M8A A;  1V1O A;  1MI2 A;  1K8G A;  1PH7 A;  2K4K A;  1PYS B;  4ZRZ A;  1L2F A;  1DJR D;  3CPF A;  4A3I B;  5JJL A;  2JXM B;  3H09 A;  3L7Z C;  2E2I H;  3DEO A;  1QUQ B;  2R92 H;  3MA2 B;  1IBM Q;  3H0G G;  3BYY B;  2K50 A;  4C3H G;  1STN A;  2Q8T A;  2EYH A;  4B9W A;  3GP7 A;  5GRO A;  3CCU A;  1PYB A;  3PQI A;  4YY3 Q;  3Q23 A;  2IL8 A;  4OHJ A;  3PO2 B;  2R93 G;  2Z4H A;  2AWN A;  4RH6 A;  3IFT A;  4K2L A;  3TP8 A;  4PNY A;  3V96 A;  1ESF A;  1W6K A;  5DM7 3;  1X3F A;  1W3S A;  3HP3 A;  4DAP A;  3A55 A;  1TWG H;  3I4M G;  4JG2 A;  3NTH A;  2CWA A;  4A3C G;  1EIF A;  1B8A A;  1X55 A;  4IOC A;  2VW9 A;  1XNQ L;  2BE5 D;  5C4Z A;  5ISR A;  3CQZ H;  4R4T A;  3VYT A;  3E6Z X;  3KOJ A;  1SYD A;  4JI1 L;  4PMW A;  1JWU D;  4P74 A;  1HA5 A;  4A3E G;  2PYK A;  3A56 A;  1I50 B;  2UXB Q;  2LMC B;  3TZU A;  4N9P A;  4A3K B;  1SN8 A;  4JOI A;  4A3F H;  4UP8 A;  5CV4 A;  2RBM A;  4K5W A;  1D6E C;  5LMU L;  3CMA A;  4JI2 L;  1BF4 A;  3FPU B;  3FEW X;  3D6C A;  4N8X 1;  4EX5 A;  3S1Q H;  5EJW A;  4FXK C;  3DWP A;  2E74 C;  1S4Z A;  4X66 L;  4DR7 Q;  3KLS X;  4XYQ A;  3M3Y B;  4I7Z C;  4FP5 D;  3CHB D;  2EY5 A;  4DUY L;  3F2B A;  4B3T Q;  1E2V A;  1EQR A;  4QIW E;  2F0Q A;  3HEJ A;  1BO0 A;  1TS4 A;  4DGZ A;  1KIX A;  1VQI A;  4BBR G;  4G7Z C;  1SNC A;  4DV5 Q;  2Q8I B;  1IXR A;  4DR1 Q;  1CQV A;  2B29 A;  2F0F A;  4X6A H;  2RQX A;  1K8A C;  3EN2 A;  4JI3 Q;  3GQB A;  2PQE A;  4CBV A;  3AQQ A;  3K7A B;  1I4R A;  3CCV A;  4NP5 A;  1V43 A;  1LT5 D;  2CH4 W;  1IL2 A;  1I4X A;  5J3B A;  1ROD A;  2UUC L;  5JEA J;  3M7N A;  2Q2U A;  1GUG A;  3G7L A;  1CKM A;  2VXW A;  1EY8 A;  3K81 C;  3ICE A;  1A15 A;  2PW5 A;  1LTL A;  2WKD A;  1NAP A;  1TY2 A;  1KC8 C;  1BCP B;  2B2Y A;  4FVM A;  3I4L A;  4ZK9 B;  2MGS A;  3OIP A;  2UXC L;  3GTL H;  1ICF B;  1E2W A;  4K8J A;  4AQY L;  1WD0 A;  1V1P A;  3CCQ A;  1JMC A;  2JA7 B;  1GHK A;  2PZT A;  3M7G A;  1VQ9 A;  4DV3 L;  4FDB A;  1H9M A;  5AJ3 L;  4DV2 L;  1JJ2 A;  4K5V A;  3FKI B;  1M4V A;  3S15 B;  2UUC Q;  4L5R C;  2B2T C;  4POF A;  4F7X A;  5C4H A;  1I94 Q;  1HNW Q;  1Y69 U;  4MHE A;  2MUY A;  1TWC B;  1JQY D;  1OXV A;  3GV3 A;  2CH4 A;  2DY7 A;  3TME A;  3PIP A;  2K5Q A;  5CV8 A;  4DK3 C;  4NXN L;  1VQL A;  2JA5 G;  4LF7 Q;  2KEC A;  3TEH B;  3M4Q A;  1DM0 B;  3J81 c;  1HA6 A;  2R7Z G;  1XWE A;  2A68 C;  1QJO A;  3NWT A;  3ULJ A;  4G7O C;  3AFP A;  3H94 A;  2ASB A;  3CXC A;  2PMZ E;  1U5K A;  1CKN B;  2K6A A;  3GTG B;  2EY6 A;  1NMG A;  4AQY Q;  1V1Q A;  1Q86 C;  5F2D A;  3BDC A;  3DHQ A;  1Y14 B;  5CBE E;  2SDF A;  1W6J A;  1A0I A;  3NHH A;  3CCE A;  2EYJ A;  4IO9 A;  1XNR L;  2RKS A;  2XNA C;  3CCS A;  3TP7 A;  5IY0 A;  1PZI D;  2A6E D;  4KMU C;  2JE6 I;  1YVC A;  2UU9 L;  3S1Q B;  1G29 1;  1TS2 A;  1YHA A;  2XIW A;  1X56 A;  2VZA A;  1FNU A;  1CZW A;  1KTK A;  5C0X H;  4B3M L;  2QIL A;  1ONL A;  4X64 Q;  4XT1 B;  1YNJ C;  2K5N A;  2A74 C;  1C4Q A;  4XT3 B;  3MFG A;  1QNK A;  2K7V A;  3CW2 C;  1PMR A;  3K8A A;  2RDH A;  4CHT B;  4DV5 L;  1YIJ A;  3QOJ A;  4OWX B;  2PQA A;  3P75 A;  2I0Q A;  3GTK B;  2HHH L;  4KY6 A;  4EGV A;  2PCF B;  2A6H D;  3HKS A;  4CJ0 B;  4R8N A;  2B2W C;  2I5L X;  2LXK A;  3NK9 A;  1SE4 A;  1II3 A;  1MJC A;  1WTV A;  1QCB D;  1S5B D;  1D2B A;  1VQC A;  2N55 A;  3OIQ A;  1IW7 D;  1VS0 A;  4KY7 A;  1XPO A;  3AYH B;  3R8B A;  5M5Y B;  2F1M A;  4RWS C;  3OSO A;  5GAG C;  4ZYS A;  3HOX B;  1Q12 A;  5H1S E;  3C3L A;  1C8C A;  4IQZ A;  4L5T A;  1TWA B;  2SOB A;  1J9O A;  3CC4 A;  5T1I A;  2B2V C;  5FK9 C;  4GN5 A;  1ILQ A;  2EYO A;  1BXT A;  5KND A;  2X6L A;  2VQF L;  3UE0 A;  4NW2 A;  3HOX G;  1KD1 C;  2E2J H;  1GUN A;  1QZG A;  2R92 B;  5HY6 A;  3T16 A;  2F0T A;  2Q8R E;  3K0Y A;  5JOB A;  1PFS A;  2IY5 B;  4OO1 G;  1HH2 P;  3H6M A;  4Y7N B;  2HQL A;  4X64 L;  4EQO A;  1L0X B;  4MTN A;  4XTC S;  2IW3 A;  2J4X A;  1VQM A;  1BOS A;  1KHI A;  4ABN A;  4MIU A;  5IT9 E;  4FF1 A;  3GTG H;  1NCV A;  2B8G A;  1YHQ A;  1DCZ A;  5JJK A;  2EJF C;  2I5M X;  4LF4 Q;  4FF4 A;  1RD9 D;  2K03 A;  1S3O A;  3IRB A;  4ZKC B;  2WFW A;  1NBW A;  3EFX D;  5EBD A;  3H0G H;  1ZKO A;  3NBI A;  2E2H H;  1VQ8 A;  5HGT A;  1ICW A;  2YYZ A;  4DK0 A;  1SEB D;  2G9H D;  1TVX A;  4R1J A;  3SR1 A;  2QGQ A;  1Z6H A;  2HCI A;  3N52 A;  1MSG A;  5BN4 A;  5EKK A;  1FGU A;  2DNE A;  5I6W A;  1P16 A;  3OYY A;  1VQG A;  3UDI A;  5I4D A;  5KGU A;  1NSN S;  3PGZ A;  5KYL A;  2RHS B;  3S17 B;  1YNX A;  1PRT C;  4PZ8 A;  1ZEQ X;  4BXX G;  4H44 C;  4HMI A;  3RLO A;  2OTL A;  2OQ0 A;  3K7U C;  3T51 B;  2QF7 A;  1YBY A;  3NTI A;  1SND A;  1FD7 D;  1PTO D;  4K6L A;  5EBC A;  5LMN Q;  4YIJ A;  2WB1 B;  4CKB A;  4JBJ A;  1SFO B;  1TU2 B;  4KTA A;  1DOM A;  2F3V A;  3BYT B;  1YEZ A;  2E5L Q;  4JBM A;  1JWS D;  1HR0 Q;  4EQ5 A;  5C3E B;  4DR6 Q;  3OMG A;  3PUY A;  4R4C A;  3CCR A;  3CD6 A;  4DV4 L;  3ZYY X;  1YNN C;  1X54 A;  2UUA L;  2WAQ G;  3KK7 A;  4JI0 Q;  2VNU D;  3R2T A;  2QDB A;  4B08 A;  3CF5 A;  4C3I G;  1EEI D;  2CWP A;  1KAW A;  2F0O A;  2K28 A;  2N3S A;  4KKT A;  1EIH A;  2F0K A;  4O42 A;  1K9M C;  2PPB C;  2Z1C A;  5LMN L;  1SNP A;  3S17 H;  1STY A;  2IWH A;  2B2U A;  3PUW A;  1KNA A;  1SMY D;  1NR2 A;  3HOZ B;  3SK8 A;  4H0L C;  3OW2 A;  4TSS A;  1Q46 A;  4Y52 H;  2F0P A;  1E24 A;  4OEL B;  3I4N B;  3OPO A;  2I46 A;  4DUZ Q;  4OL7 A;  4A3F G;  2AMC B;  5ELO A;  4A3I H;  3GDE A;  1PDQ A;  3G71 A;  1V9P A;  3R93 A;  4JCV E;  2MJ8 A;  4KHZ A;  1HHV A;  3T1H L;  1WD1 A;  3RD4 A;  2KCC A;  2E5L L;  5IYB H;  1CSP A;  1Q1E A;  1QG7 A;  4HED A;  3MHB A;  1Q90 A;  2AUK A;  2Z8L A;  4L8J A;  3EIV A;  3M4Y A;  2L15 A;  3F2C A;  1Z9F A;  5LMU Q;  4X3T A;  4L63 B;  3A5U A;  4PMB A;  4A3K G;  3OTO L;  1XYI A;  5FO8 B;  4LUV A;  3TRE A;  5IP7 H;  5C4X G;  3EA6 A;  4TQU S;  1Q81 C;  1SRO A;  4IJH A;  3A54 A;  1DON A;  5IOC A;  1WOC A;  3IL8 A;  3BZK A;  2GA4 B;  2F4V Q;  1EOV A;  4IN3 A;  1WTP A;  4B3R Q;  5IYC G;  3KDF B;  1HXY D;  1LAB A;  4TRD A;  4A3D G;  3S1N B;  1DOK A;  4Z9C B;  3T56 B;  2C9O A;  4YWK A;  4LF5 L;  3KYH C;  1PH8 A;  3RLN A;  3GTM B;  3TP5 A;  1XX8 A;  5M3M H;  4RG1 A;  2PMZ B;  2JA9 A;  1E1T A;  4RCN A;  1KQS A;  2VY3 A;  3DXJ C;  2ZXP A;  2F0J A;  4LFA Q;  2XWJ B;  3PO3 H;  4R9W A;  4DAY B;  4DN4 M;  4XQN A;  3R3O A;  2QDL A;  1CFM A;  4A3F B;  1I3Q B;  1ZYR C;  1M1K C;  1TT2 A;  4DAY A;  4AYB E;  4JI2 Q;  4BBS H;  1B7Y B;  3QJY A;  4HJ7 A;  2O5J C;  1SE3 A;  3W5O A;  1N8R C;  3KBX A;  4DXG A;  3GD7 A;  1HCZ A;  5JAV A;  4JYA Q;  1E1O A;  5C3E H;  4HSV A;  1HPC A;  3PV0 A;  3S1M H;  1TR5 A;  3PMF A;  1CTM A;  1MJE A;  3QIA A;  5C3X A;  4A3M H;  5K36 H;  1WTQ A;  1EYA A;  3J81 j;  5I9P A;  1KLG D;  2EY2 A;  3NPP A;  1UEB A;  2JQO A;  3C1F A;  5D3I B;  1A62 A;  1JB7 A;  5FOB B;  3J80 i;  3HRZ C;  4IFD H;  5M5Y H;  1F2L A;  2F0W A;  2B2W A;  3HG9 A;  2RSO A;  3PO3 G;  1EWH A;  1BBW A;  4BA1 I;  2FMM A;  2F0V A;  4RGN A;  1X6O A;  2K1B A;  3J81 E;  1L0W A;  4DAV A;  1FYC A;  2ID0 A;  1E2Z A;  4KI0 A;  5JEA H;  4A75 A;  1AP0 A;  4QQB X;  3GTK H;  1BBX C;  1OXU A;  2D0P A;  4BWG B;  5A2Q L;  3D31 A;  1N36 Q;  4ME3 A;  4CJ2 C;  1OTC A;  5E3F A;  2KJX A;  5ELB A;  3K5N A;  4GNX B;  4X65 Q;  4LF5 Q;  5IYC H;  3I90 A;  4GS3 A;  4NPS A;  2EIF A;  2E2H B;  4C2M H;  2XTI A;  2F4V L;  1XMO L;  3STB C;  1JE4 A;  1SRU A;  3E0J A;  4RMF A;  5C44 B;  4LUZ A;  4BY7 B;  2OF1 A;  1HZB A;  1ENF A;  1U0L A;  1Z47 A;  2ZJQ A;  4IPD A;  4A93 G;  3CPW A;  2LSS A;  2JA6 G;  1YHB A;  2JJQ A;  3RZD B;  4DAM A;  1DGS A;  3GV6 A;  3FP9 A;  1Q1B A;  5M9O A;  2NB0 A;  1PXU A;  4JI7 Q;  2FMC A;  5D3D A;  4GKK L;  4P2C B;  1QOH A;  5CMD A;  2ZM6 L;  1XTD A;  2IHE A;  4KLK A;  3I72 A;  1FL0 A;  2L5T A;  1A2T A;  2JK8 A;  3T1Y Q;  2A69 C;  5IT9 c;  1CKO A;  4A3L G;  3X3M A;  1VF5 C;  3E5S A;  1KRS A;  2F0S A;  2XWB B;  2QA4 A;  2HT1 A;  2UXD L;  3BS1 A;  1LYL A;  1JWM D;  1VQ5 A;  3GTP B;  2ENB A;  2J7Z A;  3DM1 A;  1MGS A;  2TMP A;  4IPC A;  2ES2 A;  1LUZ A;  3GTJ B;  1PTO H;  4ID6 A;  1SJH D;  5M5X B;  3RZD H;  2RVL A;  4R4O A;  4NXM Q;  3KF8 A;  4PMC A;  2K32 A;  5KYI A;  4CGY B;  4K5X A;  2MFI A;  4IZ8 A;  4JK1 C;  1HRJ A;  1SAP A;  3SK4 A;  2N88 A;  3BZD B;  1PH6 A;  1F2Y A;  3ERS X;  2F0H A;  3CCL A;  1EYG A;  4JOI C;  3F2U A;  1MSH A;  4R4Q A;  4C1N I;  2IJ0 A;  5NUC A;  4QL5 A;  3KBG A;  4C3I H;  4GOP B;  1VQO A;  3IAY A;  1S40 A;  3URY A;  3GTP H;  2YTX A;  2DJF C;  2QW7 A;  4KK7 A;  1X32 A;  1KRT A;  5AJ3 Q;  4RGT A;  4LFC L;  4DV3 Q;  4OWT B;  4CJ1 B;  3S1M B;  5BN5 A;  2DY8 A;  4HCS A;  1EU4 A;  3MTS A;  3ULP A;  4IPG A;  5CR3 A;  4DV7 Q;  4IFD J;  3MZ5 A;  2CCZ A;  3M4P A;  3BJU A;  3TS2 A;  4LW1 A;  4PZ7 A;  4UDU C;  3VDY A;  4CDF C;  2XGT A;  4AYB B;  1B4O A;  2E2I B;  1KXL A;  1RDP D;  4BY7 H;  2EZV A;  3D8G A;  1U4R A;  1N32 Q;  1LT6 D;  3I2Z A;  2MPM A;  1LTI D;  4PV1 C;  1TWA H;  1HQR D;  3FRP B;  1PFB A;  2B63 G;  2K5V A;  4QB4 A;  5EGT A;  1IKL A;  2R7D A;  2H1E A;  2ICI A;  5M3F H;  1I6H H;  2NVX B;  4DV6 L;  2YU9 B;  3J7A 5;  5GQO A;  4C2M B;  3U9S A;  4ZQ3 A;  1D5M C;  4HR7 B;  1AW7 A;  3J80 L;  3HOX H;  2BOS A;  3K5O A;  1G91 A;  1IBK L;  2KED A;  4OIJ A;  2D2C C;  4A3J B;  2AUJ D;  1EFW A;  3R2I A;  1TY0 A;  3HOZ H;  3TBI B;  5I6Y A;  1PZK D;  4O0A A;  4DR3 Q;  1A63 A;  4DR2 L;  4ZLT F;  5IT9 L;  1IZ6 A;  1FR3 A;  2A8V A;  1I50 H;  3WDN A;  4ALP A;  1EY0 A;  1LTB D;  1LAC A;  2L11 A;  3GTL B;  1QUQ A;  5EKI A;  3I56 A;  1LT3 D;  5DNF A;  2DUD A;  3J7Y W;  2JP1 A;  2F0D A;  3HOU H;  4B3R L;  1XTC D;  1LTA D;  2A69 D;  1EY9 A;  3LX0 A;  3V2T A;  1D5X C;  1T5X D;  3FHW A;  1J5E L;  2VUM G;  4G4K A;  2OXP A;  1SYF A;  3FDT A;  4C3J H;  3D4D A;  1XMQ Q;  4DR2 Q;  2OT2 A;  2WIN B;  1EIY B;  4DR3 L;  4C3J G;  3LNN A;  1KLU D;  4IUT A;  2VQE L;  1GM5 A;  2PI2 E;  3CU7 A;  1G51 A;  2GVB A;  2VUM H;  4S3S A;  2SNS A;  1A3V A;  1TWH B;  1QNU A;  4V0B A;  3HKZ G;  1R9T B;  1DZ1 A;  3STB D;  3OMC A;  1Y8O B;  3SE0 A;  1LLR D;  3S1N H;  1U9R A;  3UE1 A;  1H9S A;  1O7Z A;  1O80 A;  3FVQ A;  4KHP L;  2Y0S B;  2N49 A;  1VQP A;  1FJG Q;  1IBL L;  2KCM A;  1I4Q A;  2EJM A;  1IYJ B;  3D6W A;  3T4A C;  2BA1 A;  4OXP A;  2JA6 B;  1KDA A;  4KD3 A;  1TWF B;  4LF7 L;  2IX0 A;  2JA5 B;  4KJN A;  3U9O A;  5C5L A;  3H91 A;  1QVG A;  4KKU A;  3AFQ A;  1WYD A;  3OTO Q; 
#chains in the Genus database with same CATH homology
 2IT1 A;  3DUZ A;  4EVO A;  1PFN A;  3PIO 3;  1VF7 A;  2A68 D;  5ELC A;  3NTK A;  1LTG D;  1LV9 A;  1EY5 A;  3C2P A;  1UNS A;  4A3E B;  1K8O A;  2FJ2 A;  4ZAI A;  1JOQ A;  4LJZ C;  4FXD A;  2B2U C;  3MAQ A;  1CZG A;  2NZ1 D;  2EPB A;  2XSC A;  1RHP A;  3AU7 A;  2EYL A;  4LAA A;  5KRU A;  2R6G A;  2JSO A;  1GJX A;  2L9H A;  2KHS A;  1ML0 D;  1IYV A;  1D5Z C;  4DNR B;  2A5H A;  2B2V A;  1Q3L A;  1TWG B;  2F0U A;  4C1N K;  5FLX E;  3CRK C;  1EY6 A;  1R4P B;  2EE1 A;  5C4J B;  1DD2 A;  1RCV D;  4K2K A;  1KNE A;  4RCO A;  1SYE A;  1BUV T;  5G3L F;  4ZKB B;  1HFG A;  4WFN 3;  1PYW D;  2MP1 A;  3W3A A;  1WTR A;  2M00 A;  3ERO A;  3DMU A;  1FGB D;  1EZ6 A;  1STE A;  1YNN D;  2NTT A;  1F9S A;  5EPJ A;  2JEA I;  1SXT A;  1EYC A;  3MFY A;  4C3H B;  1SNQ A;  1EL0 A;  1CA5 A;  2O2L D;  1XXG A;  1DXM A;  2IX1 A;  4C56 C;  2ZXR A;  3K5M A;  3Q0A A;  3ONA B;  4EQN A;  1EY4 A;  2F0N A;  5EPL A;  2BDO A;  4A3G B;  1PZJ D;  2LS0 1;  4RHS A;  1GUW A;  4X3K A;  1UAP A;  1OXS C;  1IHZ A;  3TZD A;  3ND8 A;  1STG A;  3HZX A;  3TDQ A;  4XIG S;  1D1I A;  5DEH A;  5C6A A;  4ODG A;  3KLR A;  5A35 A;  3A8I E;  3K6O A;  5I2Y A;  3PUX A;  4NDX A;  5AFW A;  5M3M B;  1MD2 D;  5I2X A;  1B53 A;  4Q0F A;  3BVM A;  3VR5 A;  2VB3 X;  4BBS B;  1TQO A;  3VYU A;  3KUP A;  5C4X B;  1BCP C;  1GUO A;  5DAU A;  1VMP A;  2ICE C;  1JIC A;  1SNO A;  1ENA A;  2NYZ D;  3MXU A;  3NUC A;  1Y1V B;  3TP6 A;  3SXH A;  2B2T A;  4IAL A;  1AEX A;  3OWE B;  4C3J B;  4DK1 A;  4ZUJ A;  2EY1 A;  2KA7 A;  4XQQ A;  1JCK B;  5EQ0 A;  1G6Z A;  2QKI C;  1QIL A;  3T13 A;  3SHL A;  5C5M A;  2IX3 A;  5DM6 3;  2NVT B;  1A2U A;  1I4P A;  5C0X G;  3VR6 A;  2PW7 A;  4RHR A;  1B3A A;  4G7H C;  2DN8 A;  2MHV A;  3HOU B;  2ZXO A;  1HUN A;  1SBB B;  2M9V A;  3SEB A;  1L0Y B;  3QG1 A;  2CQA A;  1V1P B;  1Q8I A;  2F0L A;  4HN7 A;  3I73 A;  1WTW A;  3MVV A;  2EYP A;  2QEJ C;  3GO5 A;  2FIN B;  1CHP D;  5C0X J;  2TSS A;  1MBY A;  3VYS A;  5CV6 A;  5TSS A;  2E76 C;  1CHQ D;  4KN4 C;  1AFP A;  2R7Z B;  4BBR B;  1IL8 A;  3A7A B;  2O4X A;  1F9P A;  4QMG A;  2K33 A;  4R8I A;  4RAU C;  2F4I A;  3VA7 A;  3MXN A;  1NR4 A;  1RTO A;  3GTO B;  1VCI A;  3RMH A;  4KV6 A;  2XRQ D;  1QB5 D;  4QIW B;  5HUR A;  1HUM A;  2A73 B;  2HUG A;  2XVS A;  1EY7 A;  2EYF A;  5CC4 A;  2CVR A;  3L9A X;  4RA8 A;  5ELD A;  2HCC A;  1B2T A;  3NE5 B;  4PQX A;  5JPN C;  5D14 A;  2EDG A;  4UAI A;  3J7A F;  3VYR A;  5M3F B;  5LL6 S;  1I6H B;  4HMJ A;  2WP8 J;  3PO3 B;  1SSO A;  4JBW A;  4IFD G;  3HS0 C;  3I70 A;  3D3R A;  3ERQ A;  3WOF A;  3AB9 A;  1PLF A;  1WVL A;  2B8F A;  4K8I A;  1G2S A;  4DNT B;  4XYO A;  1ET6 A;  1EU3 A;  1WTO A;  3C46 A;  1LT4 D;  3CKI B;  1STA A;  1GXD C;  1PTO C;  4HSP A;  4OIK A;  2NN6 H;  3MXG A;  1KDC A;  4A3M B;  1F2M A;  1IYU A;  3A8J E;  2HDL A;  1V8Q A;  4RFB A;  3K59 A;  2F3W A;  1H9J A;  2EVB A;  1B44 D;  4KKS A;  3I8Z A;  1B1Z A;  2E2D C;  2NTS A;  1CQF A;  4IUU A;  5KIX A;  4XDX A;  2L4N A;  4DU9 A;  1M8A A;  1SYB A;  4QUF A;  3VR2 A;  5K5P A;  5CYU A;  3S14 B;  1S5F D;  1JOR A;  3P1H A;  4C3I B;  4NKL A;  3FMC A;  5LHY 1;  1IKM A;  1HTL D;  1RKN A;  3N6R A;  4X3S A;  2CW0 D;  4U68 A;  1X3Q A;  4BA2 I;  1BDO A;  2F0I A;  1K8M A;  5JEA G;  5J39 A;  1RJT A;  1JOO A;  1GUS A;  2D9U A;  2QCP X;  5CV9 A;  1EIG A;  2F0G A;  2K01 A;  4IUN A;  2R3Z A;  3BG3 A;  3EQL C;  1PTO F;  1PRT F;  3BVZ A;  3QWN A;  1UUP A;  1LTT D;  5LL6 X;  1B9N A;  4MN3 A;  4ULL A;  5COY A;  4KY5 A;  4U67 3;  3TSS A;  2O5I C;  1ESR A;  1NUC A;  3J80 E;  4IUP A;  4RKL A;  4CKC A;  1TS3 A;  1DOL A;  3L3O C;  3S9W A;  1Y8P B;  3H0G B;  3IKJ A;  1TII D;  5IGC A;  5IGF A;  4O1N A;  3G6J B;  2V4D A;  5E4X A;  5C0X I;  1A3U A;  3QB3 A;  5IOD A;  1CA6 A;  1TS5 A;  2K04 A;  3BVG A;  3PUZ A;  5T1G A;  5EPK A;  2NBF A;  2PNR C;  1H9S B;  1E0B A;  1OO9 B;  4IFD I;  2AWO A;  3EVQ A;  2DNC A;  2VUM B;  4FNF A;  3VR4 A;  1IW7 C;  3RZO B;  2WKC A;  3NBH A;  4G57 A;  3DWA A;  1HFN A;  1I4H A;  4ME5 A;  1F2Z A;  1SE2 A;  2HQE A;  2KUM A;  3D4R A;  2ZT9 C;  3M4O B;  5C3W A;  4B9X A;  3W2D A;  2NUC A;  3JAM E;  1H9K A;  1BCP F;  1B9M A;  1R4Q B;  3KLS A;  4DXF A;  1A6X A;  4KD4 A;  1T5E A;  1AN8 A;  4A3D B;  3I4M B;  3OHX C;  1DYQ A;  3UI2 A;  2XN9 C;  1CI3 M;  3DEP A;  4WOR A;  4WJW A;  2PZU A;  2RA4 A;  3OOC A;  4M1U B;  3CRL C;  4OGQ C;  5E1F A;  2D62 A;  2K5D A;  3C1E A;  1AZQ A;  2B39 A;  1AZP A;  3JAM L;  2L0C A;  1KAB A;  1SYG A;  5FLX L;  4J8Q A;  5FKA C;  1Y8N B;  3A8K E;  1SYC A;  1GOZ A;  5KNC A;  5IGD A;  2KCN A;  4EQP A;  4K6D A;  2WAQ B;  3J81 L;  3M85 A;  1A3T A;  1GHJ A;  2NN6 G;  2R93 B;  1J8I A;  4LMQ D;  3ITP A;  2K05 A;  1O7Y A;  3Q22 A;  3QO2 A;  3NQI A;  1RF2 D;  4BY1 B;  2BDN A;  4I65 A;  3HKZ B;  1KAA A;  1BQQ T;  3NQT A;  1BR9 A;  1GUT A;  1FNV A;  4H13 C;  3PIP 3;  5CV7 A;  1SJE D;  1PRT B;  2EXZ A;  3TN2 A;  1STH A;  5FO7 B;  2CHB D;  4N9T A;  3ND9 A;  4F8M A;  2IPK D;  2H4O A;  4FF3 A;  1S5E D;  1U4L A;  2PO4 A;  3MXP A;  1F9Q A;  2JEB I;  5IGB A;  4L6T B;  2FHT A;  5E4W C;  2HDM A;  3Q6S A;  3SVM A;  4XQJ A;  1C48 A;  3VR3 A;  5COR A;  4ZUI A;  3LWU A;  4GZY C;  2X69 A;  3MC0 B;  3I3C A;  5JJZ A;  3O13 A;  1TKW B;  1F9R A;  2K5W A;  2PZW A;  4IUR A;  5FO9 B;  2I07 B;  1VDZ A;  2RDG A;  3Q24 A;  3BDO A;  5EKL A;  3K58 A;  3A7L A;  3S2D B;  3LWE A;  5A2Q E;  1BCP D;  2XRS D;  3QOL A;  1WCM B;  2BE5 C;  1G2T A;  4HTH A;  3BDL A;  2RSN A;  1FNW A;  2WII B;  1OXX K;  4ILW A;  5CBA E;  3WOE A;  5I9O A;  2C5C A;  4RGM A;  3D4W A;  3OWF A;  2EYM A;  1I6V C;  3S1R B;  2WV6 D;  2RDF A;  3V05 A;  2CW0 C;  3I91 A;  1ILP A;  2KEE A;  3AMU A;  3VA5 A;  3GTQ B;  4FYD A;  3K57 A;  4F87 A;  3CQZ B;  1X3P A;  4E6I A;  2L55 A;  1I4G A;  3OW7 A;  2OEO A;  3T53 B;  5KEE A;  5ELF A;  3NXW A;  3SDZ A;  3HOV B;  1O7L A;  3S2H B;  3P7J A;  2E2J B;  2LFN A;  1EZ8 A;  1PRT D;  2FFK B;  2F03 A;  4KJO A;  5G3L D;  4FXG C;  2L12 A;  2LY7 A;  5CV5 A;  1YNJ D;  1WTX A;  2SNM A;  1EQT A;  5IGE A;  1LO5 D;  2L1B A;  3SK5 A;  4DF7 A;  3RLF A;  3P20 A;  4V19 0;  1EEF D;  1HQM C;  2A6E C;  2NN6 I;  5BN3 A;  5CGK A;  1K83 B;  1UEA B;  3HOY B;  1G8Z D;  3EJI A;  3J7A V;  1HTP A;  4WRD A;  3X3N A;  3H3V C;  5J22 A;  5D65 A;  1F77 A;  4Q5V A;  1EFI D;  3HGB A;  1B50 A;  1OXT A;  4J1M A;  2JA8 B;  1PFM A;  2AQ1 B;  4IUQ A;  2D5D A;  4OO1 H;  3RUZ A;  5JVH 3;  2KOL A;  4TKO B;  4A3B B;  2VB2 X;  2NWG A;  2NVQ B;  2NVY B;  1QE6 A;  2R61 A;  3HOW B;  2M2L A;  2E75 C;  4KHV A;  3NWS A;  1CM9 A;  5IGG A;  3NSW A;  4QF4 A;  2Z4I A;  3S16 B;  2X6G A;  4A93 B;  4HCE A;  1ZXT A;  1EOT A;  3MEH A;  2KQ3 A;  1ET9 A;  4FF2 A;  1S5C D;  3DWQ A;  3FPP A;  1H9R A;  2F0E A;  1JOK A;  1ZYR D;  2BCO A;  5JVG 3;  4K14 A;  1LTS D;  4XXE A;  1CT1 D;  4IUV A;  4DA2 A;  5M5W B;  2SEB D;  4X3U A;  4BS9 A;  2JYO A;  1U4P A;  1SNM A;  4NMZ A;  4H7B A;  1S5D D;  1Z7T A;  4F88 A;  2AQ2 B;  1SMY C;  4DFA A;  2EJG C;  4FO2 A;  1RTN A;  2AQ3 B;  1EQV A;  1CK1 A;  1JR0 D;  3MWY W;  1LTR D;  2KVM A;  2J0T D;  3SK6 A;  1JC7 A;  4HAE A;  4KN7 C;  5ELE A;  4LK1 C;  4OO1 I;  4QCL A;  2F0M A;  4RKB A;  5KNB A;  1D1K A;  4QUC A;  2LKV A;  1U4M A;  1KDB A;  1PTO B;  1ENC A;  3K5L A;  2BA0 A;  1SDF A;  2G9D A;  2A6H C;  5IIF A;  1STB A;  1JB3 A;  1EWC A;  1BNZ A;  1QWY A;  1EYD A;  1O78 A;  1Y1W B;  5K36 G;  2B2Y C;  4J6H A;  5JPM C;  3PUV A;  3IFD A;  2WAC A;  4RGO S;  1VMC A;  2EOT A;  5J1Z A;  4CKE A;  3NP8 A;  2B63 B;  4M8A A;  1V1O A;  1MI2 A;  4ZRZ A;  1DJR D;  4A3I B;  2JXM B;  3H09 A;  3L7Z C;  3DEO A;  3MA2 B;  3BYY B;  4C3H G;  1STN A;  2Q8T A;  2EYH A;  4B9W A;  3GP7 A;  3Q23 A;  2IL8 A;  4OHJ A;  3PO2 B;  2Z4H A;  2AWN A;  4RH6 A;  3IFT A;  4K2L A;  3TP8 A;  4PNY A;  3V96 A;  1ESF A;  1W6K A;  5DM7 3;  3HP3 A;  4DAP A;  3A55 A;  3NTH A;  2BE5 D;  5C4Z A;  5ISR A;  3VYT A;  3E6Z X;  1SYD A;  4PMW A;  1JWU D;  1HA5 A;  2PYK A;  3A56 A;  1I50 B;  2LMC B;  3TZU A;  4N9P A;  4A3K B;  5CV4 A;  2RBM A;  4K5W A;  1D6E C;  1BF4 A;  3FPU B;  3FEW X;  3D6C A;  5EJW A;  4FXK C;  3DWP A;  2E74 C;  1S4Z A;  3KLS X;  4XYQ A;  3M3Y B;  4I7Z C;  4FP5 D;  3CHB D;  2EY5 A;  1E2V A;  2F0Q A;  3HEJ A;  1BO0 A;  1TS4 A;  4DGZ A;  4G7Z C;  1SNC A;  2Q8I B;  1CQV A;  2F0F A;  2RQX A;  3GQB A;  2PQE A;  4CBV A;  3K7A B;  1I4R A;  4NP5 A;  1V43 A;  1LT5 D;  1I4X A;  1ROD A;  5JEA J;  3M7N A;  1GUG A;  3G7L A;  2VXW A;  1EY8 A;  1A15 A;  2PW5 A;  2WKD A;  1NAP A;  1TY2 A;  1BCP B;  2B2Y A;  4FVM A;  3I4L A;  4ZK9 B;  2MGS A;  3OIP A;  1E2W A;  4K8J A;  1WD0 A;  1V1P A;  2JA7 B;  1GHK A;  2PZT A;  3M7G A;  1H9M A;  4K5V A;  3FKI B;  1M4V A;  3S15 B;  2B2T C;  4F7X A;  5C4H A;  1Y69 U;  4MHE A;  2MUY A;  1TWC B;  1JQY D;  1OXV A;  3GV3 A;  2DY7 A;  3TME A;  2K5Q A;  5CV8 A;  2KEC A;  1DM0 B;  1HA6 A;  1XWE A;  2A68 C;  1QJO A;  3NWT A;  4G7O C;  3H94 A;  2K6A A;  3GTG B;  2EY6 A;  5F2D A;  3BDC A;  3DHQ A;  5CBE E;  2SDF A;  1W6J A;  3NHH A;  2EYJ A;  2RKS A;  2XNA C;  3TP7 A;  1PZI D;  2A6E D;  4KMU C;  2JE6 I;  3S1Q B;  1G29 1;  1TS2 A;  2XIW A;  1FNU A;  1CZW A;  1KTK A;  5C0X H;  2QIL A;  1ONL A;  4XT1 B;  1YNJ C;  2A74 C;  1C4Q A;  4XT3 B;  3MFG A;  1QNK A;  2K7V A;  1PMR A;  2RDH A;  4CHT B;  3QOJ A;  3GTK B;  3P75 A;  4KY6 A;  4EGV A;  2PCF B;  2A6H D;  4CJ0 B;  4R8N A;  2B2W C;  3NK9 A;  1SE4 A;  1II3 A;  1WTV A;  1QCB D;  1S5B D;  1D2B A;  2N55 A;  3OIQ A;  1IW7 D;  4KY7 A;  3R8B A;  5M5Y B;  2F1M A;  4RWS C;  3OSO A;  4ZYS A;  3HOX B;  1Q12 A;  3C3L A;  1C8C A;  4IQZ A;  1TWA B;  2SOB A;  1J9O A;  5T1I A;  2B2V C;  5FK9 C;  1ILQ A;  2EYO A;  1BXT A;  5KND A;  2X6L A;  4NW2 A;  1GUN A;  2R92 B;  3T16 A;  2F0T A;  2Q8R E;  3K0Y A;  5JOB A;  4OO1 G;  4Y7N B;  3H6M A;  4EQO A;  1L0X B;  4XTC S;  2IW3 A;  2J4X A;  1BOS A;  4ABN A;  4MIU A;  5IT9 E;  4FF1 A;  1NCV A;  2B8G A;  1DCZ A;  2EJF C;  4FF4 A;  1RD9 D;  2K03 A;  4ZKC B;  3EFX D;  5EBD A;  1ZKO A;  3NBI A;  5HGT A;  1ICW A;  2YYZ A;  4DK0 A;  1SEB D;  2G9H D;  1TVX A;  3SR1 A;  1Z6H A;  2HCI A;  3N52 A;  1MSG A;  5BN4 A;  5EKK A;  2DNE A;  5I6W A;  5I4D A;  5KGU A;  1NSN S;  5KYL A;  3S17 B;  1PRT C;  1ZEQ X;  4H44 C;  4HMI A;  3T51 B;  2QF7 A;  3NTI A;  1SND A;  1FD7 D;  1PTO D;  4K6L A;  5EBC A;  4YIJ A;  2WB1 B;  4CKB A;  1SFO B;  1TU2 B;  4KTA A;  1DOM A;  2F3V A;  3BYT B;  1JWS D;  5C3E B;  3OMG A;  3PUY A;  3ZYY X;  1YNN C;  3KK7 A;  2VNU D;  3R2T A;  2QDB A;  4B08 A;  4C3I G;  1EEI D;  2F0O A;  2K28 A;  4KKT A;  1EIH A;  2F0K A;  4O42 A;  2PPB C;  2Z1C A;  1SNP A;  1STY A;  2IWH A;  2B2U A;  3PUW A;  1KNA A;  1SMY D;  1NR2 A;  3HOZ B;  3SK8 A;  4H0L C;  4TSS A;  2F0P A;  3I4N B;  3OPO A;  2I46 A;  4OL7 A;  1PDQ A;  3R93 A;  2MJ8 A;  4KHZ A;  1HHV A;  1WD1 A;  3RD4 A;  2KCC A;  1Q1E A;  1QG7 A;  4HED A;  3MHB A;  1Q90 A;  2AUK A;  2Z8L A;  4L8J A;  3M4Y A;  4X3T A;  4L63 B;  4PMB A;  1XYI A;  5FO8 B;  3EA6 A;  4TQU S;  3A54 A;  1DON A;  5IOC A;  3IL8 A;  2GA4 B;  1WTP A;  4IN3 A;  1HXY D;  1LAB A;  4TRD A;  3S1N B;  1DOK A;  4Z9C B;  3T56 B;  2C9O A;  3GTM B;  3TP5 A;  1XX8 A;  2PMZ B;  4RCN A;  3DXJ C;  2ZXP A;  2F0J A;  2XWJ B;  4R9W A;  4XQN A;  4DN4 M;  3R3O A;  1CFM A;  4A3F B;  1I3Q B;  1ZYR C;  1TT2 A;  4DAY A;  3QJY A;  2O5J C;  1SE3 A;  3KBX A;  4DXG A;  3GD7 A;  1HCZ A;  5JAV A;  4HSV A;  1HPC A;  3PV0 A;  1TR5 A;  3PMF A;  1CTM A;  3QIA A;  5C3X A;  5K36 H;  1WTQ A;  1EYA A;  5I9P A;  1KLG D;  2EY2 A;  3NPP A;  3C1F A;  5D3I B;  5FOB B;  3HRZ C;  4IFD H;  1F2L A;  2F0W A;  2B2W A;  3HG9 A;  2RSO A;  1EWH A;  4BA1 I;  2FMM A;  2F0V A;  4RGN A;  2K1B A;  3J81 E;  4DAV A;  1FYC A;  2ID0 A;  1E2Z A;  4KI0 A;  5JEA H;  1AP0 A;  1BBX C;  1OXU A;  4BWG B;  5A2Q L;  3D31 A;  4CJ2 C;  5E3F A;  2KJX A;  5ELB A;  3K5N A;  3I90 A;  2E2H B;  1JE4 A;  5C44 B;  3E0J A;  4BY7 B;  2OF1 A;  1ENF A;  1Z47 A;  3RZD B;  3GV6 A;  1Q1B A;  5M9O A;  2NB0 A;  1PXU A;  2FMC A;  5D3D A;  4P2C B;  1QOH A;  5CMD A;  3I72 A;  2L5T A;  1A2T A;  2A69 C;  3X3M A;  1VF5 C;  2F0S A;  3E5S A;  2XWB B;  3BS1 A;  1JWM D;  3GTP B;  2ENB A;  2J7Z A;  3DM1 A;  1MGS A;  2TMP A;  3GTJ B;  1PTO H;  4ID6 A;  1SJH D;  5M5X B;  2RVL A;  3KF8 A;  4PMC A;  2K32 A;  5KYI A;  4CGY B;  4K5X A;  4IZ8 A;  4JK1 C;  1HRJ A;  1SAP A;  3SK4 A;  2N88 A;  3BZD B;  1F2Y A;  2F0H A;  3F2U A;  1MSH A;  4C1N I;  2IJ0 A;  5NUC A;  3KBG A;  3IAY A;  3URY A;  4KK7 A;  1X32 A;  4RGT A;  4CJ1 B;  3S1M B;  5BN5 A;  2DY8 A;  4HCS A;  1EU4 A;  3MTS A;  5CR3 A;  4IFD J;  3MZ5 A;  4UDU C;  4AYB B;  1B4O A;  2E2I B;  1RDP D;  2EZV A;  3D8G A;  1U4R A;  1LT6 D;  2MPM A;  1LTI D;  4PV1 C;  1HQR D;  3FRP B;  1PFB A;  4QB4 A;  5EGT A;  1IKL A;  2H1E A;  2ICI A;  2NVX B;  2YU9 B;  4C2M B;  3U9S A;  4ZQ3 A;  1D5M C;  4HR7 B;  1AW7 A;  3J80 L;  2BOS A;  3K5O A;  1G91 A;  2KED A;  4OIJ A;  4A3J B;  2D2C C;  2AUJ D;  3R2I A;  1TY0 A;  3TBI B;  5I6Y A;  1PZK D;  4ZLT F;  5IT9 L;  1FR3 A;  3WDN A;  1EY0 A;  1LTB D;  1LAC A;  2L11 A;  3GTL B;  5EKI A;  1LT3 D;  5DNF A;  3J7Y W;  2JP1 A;  2F0D A;  1XTC D;  1LTA D;  2A69 D;  1EY9 A;  3LX0 A;  3V2T A;  1T5X D;  1D5X C;  4G4K A;  2OXP A;  1SYF A;  3FDT A;  3D4D A;  2OT2 A;  2WIN B;  4C3J G;  3LNN A;  1KLU D;  4IUT A;  3CU7 A;  4S3S A;  2SNS A;  1A3V A;  1TWH B;  1QNU A;  4V0B A;  1R9T B;  1DZ1 A;  3OMC A;  1Y8O B;  3SE0 A;  1LLR D;  1U9R A;  1H9S A;  1O7Z A;  1O80 A;  3FVQ A;  2Y0S B;  1I4Q A;  2EJM A;  3D6W A;  3T4A C;  2BA1 A;  2JA6 B;  1KDA A;  4KD3 A;  1TWF B;  2IX0 A;  2JA5 B;  4KJN A;  3U9O A;  5C5L A;  3H91 A;  4KKU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...