1Z9FA

Crystal structure of single stranded dna-binding protein (tm0604) from thermotoga maritima at 2.60 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
109
structure length
89
Chain Sequence
b'HMSFFNKIILIGRLVRDPEERYTLTPVTTFTIAVDRTTDFFRIVTFGRLAEFARTYLTKGRLVLVEGEMRMRRKRVSPEVVANVVRFMD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-strand binding protein
publication title Crystal structure of a single-stranded DNA-binding protein (TM0604) from Thermotoga maritima at 2.60 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein
total genus 16
structure length 89
sequence length 109
ec nomenclature
pdb deposition date 2005-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1z9fA00
2LXJA 3DLLA 5IYBG 1JMCA 1YZ6A 3PSIA 1YIJA 1K0RA 1N34Q 1HNXQ 2NVTH 1TWCH 3GTOH 3I4NG 1OXUA 4DV5Q 1XJVA 1A8VA 2VUMH 2PQAB 4LUOA 4YCUA 4BY7G 2H5XA 1PH9A 3PIOA 1S72A 1TXYA 3WWVA 1PYBA 2QEXA 2F3IA 4IFDJ 1Q1BA 3M4OH 2WAQG 4AIMA 4A3EH 3A0JA 1GD7A 3L7ZC 3B6YA 4POGA 4DR7Q 4IPDA 1N34L 5IWAQ 1HNXL 2ZTCA 1U5KA 2WAQE 1SROA 5C0XG 4DV5L 3FHWA 2I5LX 3TEHB 2ZTDA 3NBHB 3ULLA 1PA6A 3CD6A 3A74A 2HQLA 2LSSA 4GKKQ 3F2CA 4YCWA 3CCVA 1A63A 2NVYH 3I56A 1BKBA 1IBMQ 3T1HQ 4DR7L 1A62A 1W2BA 5IWAL 1Q82C 3PO2G 1KD1C 1K73C 3MEFA 4L5SA 4AH6A 1IXRA 1TWAH 2EIFA 2K14A 3F8TA 3NEMA 4GKKL 1L1OC 1CKNB 1IBML 1H95A 3T1HL 1ASZA 4X66Q 3F1ZA 2F4VQ 1HZCA 2B63H 4MTNA 3TRZA 5JJIA 2XGTA 3KFUA 4X65Q 5IYCH 4H02A 1E22A 2E5LQ 4NXNQ 5J3BA 3S2HH 5HY6A 3H0GH 2R93H 3M85A 3U50C 1HZ9A 2YV5A 1VQPA 4X6AH 3T1YQ 4A3EG 2I5MX 3AYHB 3KDFB 5LMUQ 2ALYB 4HIKA 2JK8A 3LGJA 1YI2A 3GTQH 2AWNA 4X66L 5JJKA 1UE1A 2F4VL 4A3IH 1SE8A 4PZ8A 4QJFA 5DLQE 1E3PA 4DPGA 4GNXC 3J7ZC 4X65L 4A3MG 2E5LL 4NXNL 5M5WH 4QIWE 4QGUA 1PH5A 4JV5Q 1X55A 1RIPA 2BA1A 2WB1G 5GAEC 1HR0Q 4BBSH 4TQUS 4YCVA 1E1OA 3T1YL 4P73A 1FJGQ 2C35B 1OXSC 3CCRA 5LMUL 1PHJA 2OQKA 2WB1E 4JI6Q 3GTKH 4EQ5A 3RZDH 4JI7L 2EXDA 3G4SA 2NN6I 3M4QA 1SLJA 4IOCA 3FP9A 4IPGA 1EIFA 3JAMc 2IX0A 1WJJA 2OQ0A 1KL9A 4JV5L 1Q86C 1TWHH 1HR0L 4HIDA 4OWXB 2WFWA 1I3QH 3GTLH 4DUYQ 1N33Q 3W5OA 1Q7YC 1KQSA 1SFOH 1FJGL 2B63G 3I55A 4JI6L 4YWLA 3PUVA 2N8NA 4JBWA 2V1CC 5IYCG 5M5XH 1HR0W 4GS3A 1YBYA 5GADC 3H0GG 4DV3Q 2R93G 2N49A 4LF6Q 2UXDQ 3GD7A 4OXPA 1QUQA 4B3TQ 1PH3A 4GN3B 2YYZA 2MO1A 2NZHA 1L1OB 4DUYL 1NY4A 2CQOA 2PI2A 1N33L 4DK3C 2UUAQ 4A3IG 1VQAA 2D0OA 1EFWA 1IYJB 2NN6G 1LYLA 2YTYA 4HJAA 1X6OA 2CWAA 4A4IA 4DV3L 1HZBA 4GNXA 3CCLA 4LF6L 2UXDL 3VDYA 1EYGA 4B3TL 1S3OA 4JCVE 1OXVA 1M90C 2HIVA 3EBEA 3CF5A 4FDBA 3PUZA 1I94Q 2KCMA 4LWCA 1OTCA 2NVQH 4OONA 2UUAL 3KF6A 4JI4Q 3ER0A 4DV4Q 2BH8A 4P74A 1PVOA 1E24A 3KOJA 1Z47A 4JI0Q 1XPUA 3CMAA 3CC2A 1PYSB 1I94L 2ZJPA 2I5HA 2KHJA 4UP7A 3I2ZA 4Y7NH 4LUVA 3GTMH 4DR2Q 3U4ZA 3HOXG 4DV6Q 4RG1A 5C0XI 4JI4L 3KJOA 5M3FH 3JC66 4JBJA 1JJCB 3AFQA 4J15A 4L5QA 5IT9c 4DV4L 3CC4A 1YVCA 1A0IA 2PQAA 3GTPH 5GAHC 4TVAB 2OTJA 1UEBA 4JI0L 2DUDA 1PH4A 1X9NA 4OX9Q 4ALPA 1KC8C 2A1AA 3CCQA 4GLAC 1NMFA 4DR2L 3SGIA 2D62A 5IP7G 1EQRA 4DV6L 2ES2A 1HZAA 5E7NA 5C3EH 4GLXA 1D7QA 1JE5A 2K4KA 1VQ5A 3CXCA 1PH2A 1MJCA 2MO0A 3RNUA 1N8RC 1VQKA 1CSPA 3OYYA 4OX9L 2MQHA 3S1RH 2Q2TA 4GKJQ 2N78A 1UE7A 2VS1A 1Y1WG 5LMNQ 5H1SE 4A3MH 1CUKA 1XMOQ 1PV4A 2PNHA 4IJLA 4B3MQ 1Y1VH 3CPFA 4IJHA 2I0QA 1G6PA 4GLVB 2JEBI 2VY3A 2ZTEA 1VQFA 2OWOA 3M7NA 3KLWA 1V9PA 1CKNA 4DR4Q 1AH9A 4GKJL 2QGQA 2NZOA 3HOZG 5M3FG 4DAMA 5LMNL 4BBSG 1X3EA 1IBLQ 2HHHQ 1XMOL 2OCEA 4GN4B 3J81c 1J5EQ 2ZJRA 4XTCS 5JEAJ 4B3ML 4A3DH 5FLMH 3E9IA 4HJ5A 3A5UA 4DV0Q 4AQYQ 3RN5A 4PZ6A 1AE2A 5LMNW 3CCMA 3JAMi 1P16A 5FJ8H 4JI5Q 4GOPC 3K80C 3KDFA 1VQMA 2Q2HA 4DR4L 2BA0A 3HOUH 1CKOA 2JE6I 3M4PA 3J80c 3L2PA 5C3EG 1R9TH 1IBLL 2HHHL 2ASBA 4WJ4A 4A75A 1J5EL 2E2IH 1V43A 2Q2IA 4PZ7A 2R6GA 2NVXH 3ULJA 4AQYL 4DV0L 1K8AC 4IFDI 2DGYA 1N36Q 1WI5A 3ERSX 4JI5L 3G71A 2VW9A 1XPOA 3M9BA 2JQOA 3IRBA 1VQ8A 3M3YH 3E0EA 3NELA 2JA6G 1RL2A 4DR1Q 4BXXH 4KHZA 2VNUD 1U0LA 1Y1VG 1VQ7A 2VQFQ 1Y14B 3TREA 1EWIA 3PUYA 3CMEA 1GM5A 4Y52H 3RN2A 5IY0A 1C7YA 3U4VA 1N36L 3HOVG 3UDFA 3S14H 4JI2Q 1IL2A 1XPRA 4L5TA 3PF5A 1FGUA 1UWVA 4EX5A 1XNQQ 1BBWA 4A76A 5GAGC 2GVAA 1X56A 4DR1L 5FLMG 2JA7H 4YHHQ 4P71A 4A3DG 2VQFL 1ASYA 1E7ZA 4R4CA 1NTGA 4IFDG 1JJGA 5FJ8G 1TWGH 1V1QA 1L1OA 4RMFA 2RHQB 4JI2L 1NBWA 3HOUG 2JA5G 4A3CH 1NJIC 2CWPA 2KHIA 4QL5A 4XIGS 3HOXH 1VCIA 2R7FA 4MNOA 4GOPA 3I4MH 1XNQL 2D0PA 4YHHL 4YWKA 1BVSA 1Q12A 4A3KH 1X65A 1D8LA 1O7IA 1JT8A 3K8AA 4UP8A 4P75A 2VZAA 4LFBQ 1L0WA 4GOPB 3BZCA 2UXCQ 3D31A 4HJ9A 1QVFA 4BXXG 1EOVA 2K50A 5IP7H 3W1BA 2L15A 3I4OA 1GVPA 4R1JA 1YJ9A 3K7AH 3S1MH 2VL6A 3CP0A 5C0XJ 4PG3A 4DV7Q 3J7A5 2UU9Q 3EN2A 3S1QH 4POFA 3J81j 1YJWA 1Y1WH 1DGSA 2CCZA 4C2MH 4LFBL 4LF9Q 2UXCL 3BJUA 2JJQA 2JA7G 1QZHA 1CKMA 2GVBA 3AEVA 4OO1G 4DUZQ 4LF7Q 2WP8J 4DV7L 4KHPQ 4LFCQ 4HJ8A 1YITA 4OWTB 4DNIA 3FKIG 5BR8Q 5HGQA 1SN8A 4QY7A 4LF8Q 2UU9L 3CCSA 1K3RA 4A3CG 3U58A 3S2DH 4JC0A 4P72A 1WCMG 4JI1Q 4DR5Q 3HOZH 4LF9L 4DR6Q 1S40A 3I4MG 1N32Q 1C9OA 4C3IH 5IE8A 3CCJA 4A3KG 2HIXA 1VQOA 3ICEA 4DUZL 4LF7L 3H15A 2K52A 1X3GA 4BY1H 4KHPL 4LFCL 3H3VH 2OTLA 3J81i 2ATWA 3RLNA 5BR8L 4LF8L 4OWWB 3KF8B 2YTXA 4LFAQ 3AQQA 3K7UC 4JI1L 1FVIA 4R4OA 3STBD 1XTDA 1CSQA 4DR5L 4DR6L 3S16H 1N32L 2AWOA 4JYAQ 1VQLA 3PGZA 3TS0A 3H3VI 1VQNA 4NXMQ 1VQIA 3TS2A 2R92G 4A3FG 4APVA 1EQQA 4LFAL 3PCOB 1FL0A 3HKSA 1KAWA 2JA6H 5IYDG 2F52A 1Q46A 2K5HA 2ZJQA 1BBUA 1I6HH 4BA2I 4MZ9A 1I50H 4JYAL 4JI7Q 1GO3E 2KCTA 4LW1A 4JG2A 5IP9H 4K0KQ 5M5YH 1I5FA 2K5VA 4WJ3M 4C3JH 1K9MC 5C44G 3HOVH 2UXBQ 4C3HH 1XNRQ 1Z9FA 2MFIA 4BBRG 4LF5Q 4NXML 1G291 1JB7A 4GN5A 4DK6C 2GN5A 2YTVA 2PI2E 2BH2A 2B3GA 3E9HA 5C4XH 1MJEA 3CCEA 3HOWH 2N3SA 3NENA 3OTOQ 2E2HH 1T9HA 3RR5A 3F2DA 4A93H 3K0XA 4BY1G 1X3FA 1Q81C 1Q8KA 4JOIC 4K0KL 1VQHA 1VQGA 1VQDA 2UXBL 1XNRL 2AMCB 4LF5L 1XMQQ 2A8VA 2K5NA 2R7DA 2JA5H 1J6QA 3UDGA 4DAYB 5EAYA 3PUWA 1VS0A 2RF4A 3OTOL 3PO3H 1YEZA 4YY3Q 2XTIA 2AKWB 3S15H 3STBC 4UPAA 3G6EA 2MNAA 5K36G 4NB3A 4LUZA 1M1KC 4HIOA 1XMQL 1IBKQ 5FLXc 1LM0A 1GKHA 2LXKA 4UY8C 3UDIA 1MKHA 1SR3A 5IP9G 4YY3L 2JA8H 1KRTA 2VUMG 1KXLA 1PH8A 3S17H 1G51A 2EQSA 3HOYH 4O2DA 1VQ6A 5AJ3Q 3OW2A 1YHAA 1QVGA 1IBKL 4A3GH 5C4XG 3BZKA 2JEAI 3HOWG 4A3BH 3ZJYC 2UUCQ 3CW2C 2QA4A 4A93G 1LUZA 3RLOA 2Y0SG 3S1NH 4UP9A 2IHFA 4ME3A 1MIUA 2R7ZH 4DV1Q 3UDXA 3RLFA 1WYDA 2Q2UA 1SRUA 5M3MH 3PIPA 2Y0SE 3FKIH 1YHQA 3PF4A 1TWFH 2A19A 5ELNA 4A3LH 4JOIA 5AJ3L 1SMXA 3CAMA 2JA9A 3AFPA 1WCMH 4A3JH 1EIYB 3CCUA 1KRSA 1NMGA 3TQYA 4X62Q 2VQEQ 1PH1A 3PO3G 2Z0SA 2UUCL 3UE1A 1YNXA 3MXNB 2Z6KC 4PMWA 4OO1I 1NE3A 4HJ7A 3GDEA 4IPHA 2UUBQ 1L2FA 1HNZQ 1VQEA 3F2BA 4DV1L 4JBMA 4AYBG 1LTLA 3L0OA 3HFZB 1K8GA 3W1GA 1N9WA 2K75A 1YJNA 1OXXK 2PMZE 1W3SA 4BA1I 4AYBE 2ZM6Q 1AE3A 3BU2A 4X62L 4X64Q 3CQZH 2VQEL 3Q8DA 1KHIA 5JEAG 4L5RC 3CPWA 4JI3Q 2JA8G 4JI8Q 2CFMA 3EIVA 3GO5A 4O0AA 2AHOB 1P8LA 1HNZL 2UUBL 4IPCA 4DKAC 3K81C 1WFQA 2E8GA 1PH6A 3HOYG 4B3RQ 3UE0A 2R92H 4A3GG 4A3FH 4R4IA 3KJPA 4HIMA 1KIXA 4DR3Q 3CC7A 4NPSA 4KI0A 2FXQA 3G48A 4A3BG 5IYBH 2ZM6L 5IYDH 4KLKA 4QQBX 4LNQA 4X64L 1QVCA 4JI3L 3I4NH 1QZGA 2IY5B 4JI8L 1B70B 2R7ZG 1C0AA 1UE5A 4B3SQ 5M3MG 4LF4Q 1VQJA 1QUQB 3A5ZB 4YWMA 5C44H 3ULPA 2CKZB 1B8AA 2IX1A 4A3LG 4BBRH 1JJ2A 3GTGH 4BY7H 1IZ6A 3PUXA 4B3RL 4IO9A 4A3JG 1VQBA 4DR3L 5GROA 2IHEA 2ID0A 2IT1A 1VQ9A 3D0FA 4DV2Q 1HH2P 1X54A 4GNXB 4B3SL 4LF4L 2Z6KA 1HNWQ 2RHSB 1VQCA 1E1TA 1YHBA 1B7YB 1K83H 5ELOA 1PH7A 1PFSA 3HKZG 4R4TA 2HT1A 1UE6A 3KF6B 1VQ4A 1HJPA 3GTJH 5JJLA 2RCNA 4IOAA 3PV0A 5GQOA 2KBNA 5C4JH 3HKZE 2YU9H 3J80i 4DV2L 3I7FA 3PO2H 1EUJA 3RZOH 2E2JH 4JBKA 1WOCA 3S24A 1Q1EA 1HNWL 4R4QA 1OXTA 2KENA 3DM3A 2B29A 3KYHC
chains in the Genus database with same CATH superfamily
1CQFA 5IYBG 1YZ6A 1STBA 3PSIA 2F0TA 1EYCA 2PQAB 5IOCA 1D5ZC 1PH9A 1MHWC 1TXYA 2QEXA 1RJTA 2WAQG 5EBDA 3L7ZC 4POGA 2K5WA 1ICFB 1BCPC 2JP1A 2WAQE 5I2YA 5C0XG 3NP8A 3HOWB 2I5LX 4K6DA 4TKOB 2Y0SB 3CD6A 4X3TA 4CDFC 4GKKQ 3A8KE 4YCWA 2D5DA 1D1IA 2F0IA 1W2BA 1LT3D 1K73C 4L5SA 4AH6A 1TWAH 2EIFA 1RTOA 4GKKL 1CKNB 2PMZB 4C1NI 1H95A 4RGTA 3TRZA 5JJIA 4MTNA 4XQJA 4H02A 5J3BA 2JA8B 1EOTA 3M85A 2YV5A 1VQPA 3ITPA 3S17B 3HOYB 3AYHB 5J22A 5LMUQ 2JK8A 3LGJA 1G91A 2AWNA 5JPNC 3GP7A 1TVXA 4JI7Q 4DPGA 3J7ZC 1MGSA 2E75C 5M5WH 1PH5A 3IL8A 5EKLA 2BA1A 1HR0Q 1PRTF 2R7ZB 4TQUS 4CHTB 4YCVA 4P73A 4FF2A 2WKDA 3CCRA 5LMUL 1PHJA 2VB3X 2A6HD 4JI7L 4CKEA 4ODGA 2IX0A 3QB3A 4HIDA 1HR0L 2WFWA 4DUYQ 3VR2A 1Q7YC 4H44C 3X3NA 1TWHB 2EPBA 4UHVA 2AQ2B 3PUVA 2N8NA 2V1CC 3BYTB 4U68A 3PQIA 4GS3A 3CQZB 2AUKA 4B3TQ 1O7LA 1PH3A 4GN3B 2YYZA 1ET6A 2CH4W 1NY4A 4DUYL 2PI2A 1VQAA 1IYJB 2KQ3A 1KLUD 4A4IA 3VDYA 4C56C 4B3TL 1M90C 2HIVA 3EBEA 4LWCA 1OTCA 3CU7A 4OONA 3E6ZX 2F4IA 1SYEA 3SXHA 5FLXE 3HP3A 1LABA 3OIPA 3HOXG 1XXGA 2JN4A 3SK6A 1IL8A 3KJOA 4JBJA 4BBSH 3AFQA 1ZYRD 4J15A 1YVCA 2YU9B 2LMCB 4TVAB 1RD9D 4ME5A 5FKAC 2QF7A 1X9NA 4OX9Q 4ALPA 1R4PB 1IYUA 4GLAC 4G57A 2D62A 1QOHA 3NQIA 1TWCB 3I90A 5E7NA 4ZRZA 1D7QA 1VQ5A 3NBHA 1PH2A 1MJCA 1VQKA 1CSPA 4OX9L 2NB0A 3S1RH 1MI2A 3QOLA 1EY9A 4GKJQ 1DD2A 1K0SA 2N78A 4A3EB 5LMNQ 3LX0A 1CUKA 4A3MH 1SNQA 2F0UA 2ENBA 4P2CB 1G6PA 4IJHA 4GLVB 2QDBA 1VQFA 2OWOA 1I4PA 2PW7A 2WB1B 2A6ED 4GKJL 4HSPA 2NZOA 4DAMA 5LMNL 4BBSG 4F8MA 1X3EA 1IBLQ 3J81c 1J5EQ 1PLFA 1EEFD 4HJ5A 2B39A 4DV0Q 4AQYQ 5IGBA 3TP5A 3RN5A 2F0KA 4PZ6A 1AE2A 1EZ8A 4ZAIA 3JAMi 4QMGA 3A8JE 1P16A 4GOPC 3K80C 2BA0A 3HOUH 4DK1A 2JE6I 3J80c 1IBLL 4WJ4A 1R9TH 4A75A 1K3BC 1J5EL 2E2IH 1F2ZA 3IAYA 3S2HB 4AQYL 4DV0L 5KEEA 1FNVA 2DGYA 2ZXPA 1WI5A 1LLRD 1VQ8A 3GTQB 1WTRA 2JA6G 2VNUD 4DR1Q 2EVBA 1QILA 1PFMA 3J7AF 3M3YB 2VQFQ 2Q8TA 3Q22A 5KYIA 3PUYA 1EFID 1AP0A 1XWEA 1GM5A 4Y52H 1C7YA 4CKCA 3HOVG 2NUCA 3UDFA 4JI2Q 3Q23A 1XPRA 4KV6A 4DR1L 4IUQA 1BCPF 4YHHQ 3C2PA 2VQFL 1ASYA 1AFPA 5ELFA 1L1OA 4RMFA 4JI2L 1NBWA 1DOLA 3HOUG 2CWPA 4XIGS 1SNCA 2MGSA 3N52A 3M7GA 4GOPA 4DXFA 3WDNA 1B1ZA 4YHHL 4YWKA 1BVSA 1Q12A 1ML0D 3MVVA 1X65A 1FD7D 1JT8A 1J8IA 2WV6D 4UP8A 4GOPB 2UXCQ 4HJ9A 2K50A 5IP7H 3W1BA 1UNSA 1AZPA 1HA5A 1VMCA 4MIUA 4R1JA 1YJ9A 3J7A5 3DM1A 3K7AB 3FRPB 1I4QA 1IYVA 2IX3A 4POFA 4QUCA 1Y1WH 3FDTA 2CCZA 2UXCL 4LF9Q 3BJUA 1PRTD 2A68D 2GVBA 1WTOA 4GZYC 4LFCQ 1I4GA 4HJ8A 1YITA 3NQTA 5HGQA 3CCSA 4PQXA 1WCMG 4Y7NB 4LF9L 3CKIB 3OWEB 1QE6A 3D6WA 3HOZB 1SE3A 3H15A 3I72A 3NSWA 4LFCL 5JAVA 2OTLA 1FNWA 2ATWA 4B08A 2K1BA 1ENFA 3KF8B 2NWGA 3STBD 1FVIA 1CSQA 5JVH3 1VQNA 3DXJC 5K36H 1VQIA 1H9KA 2R92G 1I4XA 4F87A 1EQQA 3JAME 1FL0A 4CDEC 1BBUA 1I6HH 1JWMD 2RSNA 1F9QA 5CV7A 4MZ9A 1F2YA 1GO3E 4RKBA 4JG2A 4K0KQ 5M5YH 1I5FA 2K5VA 1Y1VB 4R8NA 1Q90A 4C3HH 1Z9FA 2MFIA 2HDMA 1G291 2PI2E 1HFNA 1HTPA 1LTGD 3OTOQ 1T9HA 3RR5A 1B2TA 2WACA 1VDZA 4JOIC 4K0KL 4A3DB 1PTOC 2C9OA 3MZ5A 2K01A 1CI3M 2K5NA 4DAYB 5C3WA 4IUUA 2RQXA 3OTOL 3PO3H 3A55A 1Q3LA 2XTIA 1ZEQX 3C1FA 4UPAA 5HURA 3G6EA 5K36G 3CRLC 2XSCA 4HCSA 4HIOA 2MHVA 1IBKQ 2KVMA 1BNZA 1GKHA 2A69C 4C1NK 2LXKA 2RCFA 4UY8C 4JK1C 2CW0C 1HCZA 2F0JA 2VUMG 3C1EA 1KXLA 1EL0A 4B9XA 4O2DA 3OW2A 1NCVA 1IBKL 3BZKA 3R8BA 2RDGA 2IWHA 4UP9A 2IHFA 1MIUA 2XVSA 3RLFA 2Q2UA 5CGKA 3PF4A 3H3VC 4JOIA 3CAMA 3FVQA 2JA9A 1L0XB 2LY7A 1KRSA 1PH1A 3PO3G 5IGFA 3GDEA 1VQEA 3F2BA 4A3KB 1PTOB 3URYA 1N9WA 1W3SA 3V96A 2KCNA 2PW5A 1KHIA 3HRZC 4L5RC 1STYA 3EIVA 3PMFA 4IPCA 4DKAC 2E8GA 3UE0A 4YIJA 1GUSA 4A3FH 3J80L 4R4IA 3G48A 2C5CA 1EY4A 3OMGA 3S1QB 5IYDH 1GUGA 1QVCA 1ZXTA 2Z4HA 3I4NH 1JOKA 5IGEA 4WJWA 2F0VA 4QB4A 5A2QL 2IX1A 3GTGH 3PUXA 1BCPD 4KD4A 5DM63 5C44B 5GROA 1KDCA 1BF4A 2L1BA 1D2BA 5J1ZA 3LWEA 4GNXB 3HEJA 4K8JA 2XRSD 1VQCA 1E1TA 1H9JA 3M4YA 5ISRA 1PH7A 3MXPA 5ELDA 3A7LA 1X3QA 5JJLA 1EU4A 1S5BD 2E2DC 3PV0A 4IOAA 5C4JH 3S16B 4X3KA 3P7JA 3RZOH 2AQ1B 5FOBB 3GTJB 2AUJD 2PYKA 1OXTA 3DM3A 2B29A 3KYHC 2F0NA 1SNOA 3DLLA 2O4XA 1JMCA 3GTOH 1HNXQ 3I4NG 3DWAA 3R2IA 1Q8IA 4L6TB 1XJVA 2FJ2A 1S72A 1JQYD 2F3IA 1Q1BA 2B8GA 3CHBD 3BVMA 4IPDA 4DR7Q 1HNXL 5EPLA 1S5ED 3FHWA 1G2SA 2E2HB 1A2TA 1PA6A 3A74A 2HQLA 1LT6D 1YNNC 1A63A 2NVYH 1DONA 1IBMQ 1YNJC 4QCLA 3T1HQ 4DR7L 1XYIA 2K32A 1M4VA 4ABNA 2EYPA 3S15B 4J6HA 2H4OA 3KLSA 1IBML 4AYBB 3T1HL 5D65A 1ASZA 1ONLA 2B63H 1BXTA 2XGTA 3KFUA 4X65Q 5IYCH 5D14A 3H0GH 1MD2D 1GUWA 3DWPA 1TKWB 1YI2A 2ALYB 5T1GA 1SNPA 4A3GB 5JJKA 3FPPA 4A3IH 1X32A 3F2UA 4H13C 1E3PA 5DLQE 4DAVA 2XN9C 4X65L 5JJZA 4QIWE 1B9MA 3S1NB 4EQOA 1RIPA 2B2VA 1CZWA 5GAEC 5LHY1 5M5WB 5M3MB 1TWFB 2C35B 1OXSC 3KLRA 4JI6Q 2Z9HA 4IOCA 4IPGA 1EIFA 1WJJA 2I46A 1PTOF 1I3QH 3AB9A 5JOBA 3GTLH 3FEWX 3W5OA 1SFOH 2B63G 4JI6L 4YWLA 4JBWA 5IYCG 2CHBD 2XRQD 4DU9A 5GADC 3H0GG 4DV3Q 4G4KA 4LF6Q 2UXDQ 4Z9CB 1FGBD 1QUQA 2NZHA 2UUAQ 4K14A 4A3IG 2LS01 5F2DA 1X6OA 4DV3L 1HZBA 3CCLA 4LF6L 2UXDL 3LNNA 5IGGA 5CV6A 1OXVA 3ND8A 3ZYYX 3CF5A 4FDBA 3G7LA 1I94Q 4K5WA 1IW7C 2NVQH 2UUAL 1JWUD 5EPJA 4JI4Q 3ER0A 5C0XH 4DV4Q 1HHVA 2LFNA 2EZVA 1Z47A 4JI0Q 1XPUA 3MEHA 3CMAA 1PYSB 3MXUA 1I94L 3I2ZA 3GTMH 4LUVA 2AQ3B 4DV6Q 4RG1A 4JI4L 5J39A 5M3FH 3JC66 4DV4L 1CFMA 2PQAA 3PO2B 2F1MA 4BBSB 2E2JB 1UEBA 4JI0L 3TP8A 3AMUA 2LKVA 3T16A 1U4MA 4DV6L 1HZAA 4DA2A 1U9RA 5EGTA 5C3EH 4PV1C 3IKJA 1K28A 1NNXA 2MO0A 1N8RC 3I70A 2N88A 5C3XA 2MUYA 3L9AX 4IALA 3S1RB 3KLSX 3NE5B 3NUCA 3V05A 1PV4A 1RF2D 4B3MQ 2BOSA 4FXGC 4L8JA 3CPFA 4A3MB 1NSNS 2VY3A 3M7NA 2F0OA 1CKNA 5M3FG 1K8OA 5LL6X 4X3UA 2CQAA 4XTCS 4B3ML 5FLMH 1BDOA 3CCMA 3D8GA 4I7ZC 5FJ8H 4HAEA 1VQMA 3E5SA 5C3EG 1V43A 1VF7A 3T56B 2NVXH 3ULJA 1SXTA 2R93B 3U9OA 4OIKA 4CDCC 2E2IB 2NYZD 5CBAE 3K5MA 3E0EA 3NELA 1FYCA 4BXXH 5EQ0A 1VQ7A 4JVZA 1Y14B 3TREA 1EWIA 3BYYB 3RN2A 5IY0A 3S14H 2F0DA 3NXWA 3GTKB 2EDGA 1FGUA 1A6XA 1EQVA 1BBWA 1WD1A 2JA7H 1AN8A 5FLMG 2QDLA 2BE5C 3QO2A 1EYDA 1KAAA 3LWUA 5FJ8G 1V1QA 2RHQB 2MP1A 3NBIA 2JA5G 1AEXA 3HOXH 2K03A 2D2CC 4DAPA 1CZGA 2JSOA 4FVMA 5M5XB 3T51B 3I4MH 2ICIA 2WKCA 1ILQA 3K8AA 2L11A 4LFBQ 3D31A 4BXXG 1EY5A 4HN7A 2L15A 5KNCA 3S1MH 4KN4C 2RSOA 1G2TA 4I7AA 2TSSA 5D3DA 1EZ6A 4ZKCB 3EN2A 4LFBL 3J81j 1JR0D 4C2MH 2JA7G 1QZHA 5E4XA 4ZYSA 4EVOA 1Y1WB 1NR4A 4K2LA 4KHPQ 1R4QB 2BDOA 1STHA 3FKIG 5BR8Q 3U58A 3S2DH 4JC0A 4JI1Q 4DR6Q 2NTSA 1S40A 3I4MG 1PTOD 3CCJA 4PMBA 2K52A 1X3GA 4BY1H 4KHPL 3GTPB 3OPOA 3J81i 2Z6BA 5BR8L 4LK1C 4NKLA 1TQOA 3AQQA 4JI1L 4DR6L 2RDFA 4IUNA 3R3OA 2O2LD 2A69D 1A15A 3A7AB 3TS2A 4G7OC 2CW0D 3HKSA 1KAWA 2JA6H 1Q46A 4BWGB 5DNFA 3I4LA 5EKIA 1GUOA 1D5MC 3HOVH 2UXBQ 4LF5Q 4BBRG 3X3MA 4O42A 5COYA 2F0FA 4C3HB 2B3GA 1BQQT 1MJEA 1VMPA 3HOWH 3NENA 1QJOA 3PIP3 4QF4A 4ILWA 3NPPA 4BY1G 1WTWA 4MHEA 1VQHA 2UXBL 4LF5L 1XMQQ 2EY2A 1BOSA 1O80A 3UDGA 5EAYA 3PUWA 3TN2A 3I91A 3Q0AA 4EGVA 3I73A 2N55A 1M1KC 1XMQL 3OIQA 4KMUC 5T1IA 1V1OA 3UDIA 5C6AA 1MKHA 1IHZA 2JA8H 1PMRA 2M00A 3S17H 1G51A 2EQSA 3HOYH 1YHAA 2DNCA 4KJNA 3HOWG 4A3BH 3ZJYC 3A56A 2UUCQ 3CW2C 1LUZA 2Y0SG 3Q6SA 2H1EA 4ZLTF 2I07B 4ME3A 1B3QA 2B2YC 2R7ZH 1SRUA 2Y0SE 1G6ZA 4A3LH 1SMXA 3QOJA 3AFPA 1WCMH 1EIYB 3CCUA 4RAUC 2VQEQ 4J1MA 2Z0SA 2UUCL 3UE1A 1YNXA 3MXNB 2Z6KC 4LAAA 4OO1I 2RKSA 4HJ7A 3TZDA 3HFZB 3VR6A 1K8GA 1SMYC 3W1GA 2K75A 1JOOA 5AFWA 1H9SB 2PMZE 2V4DA 1LTAD 4X64Q 2VQEL 3CQZH 2JA8G 4JI8Q 1CHPD 1D6EC 1MSHA 4FXKC 1F9PA 1WFQA 1PZJD 3DEOA 1PH6A 3HOYG 4B3RQ 2R92H 2K33A 3H91A 2XNAC 3J81E 2RDHA 1KIXA 4A3BG 2FXQA 1EQTA 4A3FB 4LNQA 4X64L 2HQEA 1LTBD 2K28A 1QZGA 2K5DA 4MTKA 4JI8L 2R7ZG 1C0AA 1UE5A 2GA4B 2PQEA 4B3SQ 4LF4Q 2XWBB 3A5ZB 3QJYA 2B8FA 4A3LG 4BY7H 3O13A 4FP5D 4B3RL 5FLXL 3J80E 2B2YA 3C46A 4H7BA 3KF8A 1VQBA 3G6JB 1YNND 4ZK9B 4DV2Q 4C3IB 5I6YA 1YNJD 3CRKC 4B3SL 4LF4L 2Z6KA 3WOFA 5CYUA 1A3VA 1YHBA 3OWFA 1B7YB 1GUTA 3MFYA 3NTHA 3VYRA 4R4TA 2L9HA 2HT1A 3KF6B 2FMMA 1SYCA 2RCNA 2YU9H 4DV2L 2KUMA 1DOMA 3EQLC 3RZOB 1ZKOA 1K0RA 1N34Q 1HQRD 2NVTH 1TWCH 1E2WA 1OXUA 4DV5Q 1C4QA 1A8VA 2F0PA 2F03A 2VUMH 3GTOB 4YCUA 1I50B 4BY7G 3PIOA 1PYBA 4C3JB 3D6CA 4IFDJ 3M4OH 4AIMA 1LV9A 3A0JA 4A3EH 3Q24A 4DAYA 3MAQA 3B6YA 4OGQC 4KY5A 5IWAQ 1N34L 4DV5L 1SYFA 3TEHB 2R61A 2ZTDA 3CCVA 2IL8A 3I56A 1BKBA 3V2TA 2NZ1D 5IWAL 1Q82C 4IZ8A 1AZQA 1QNUA 3H09A 5HGTA 1CHQD 3F8TA 3NK9A 1JWSD 4X66Q 2F4VQ 2E74C 1E22A 3S2HH 2OXPA 5HY6A 2B63B 4HSVA 3VYTA 3U50C 4CGYB 3T1YQ 4A3EG 3KDFB 2L55A 3GTQH 4X66L 1UE1A 2F4VL 4GNXC 5EJWA 2DNEA 2NN6H 3BDOA 2Z4IA 1EY7A 4QGUA 1ENAA 1H9MA 1IW7D 2HCCA 2WB1G 1E1OA 3T1YL 2OQKA 1II3A 2WB1E 4EQ5A 2Z8LA 3RZDH 4A3JB 2EXDA 3G4SA 3M4QA 1RHPA 3I8ZA 2OQ0A 1KL9A 5BN4A 1Q86C 1V1PB 1K8MA 4OWXB 1TS3A 3W3AA 1N33Q 1E2VA 1KNEA 2D9UA 3TMEA 3BDLA 1SEBD 3GTLB 4K5VA 3HKZB 2N49A 1SBBB 1JOQA 1SYGA 3VYUA 1WTHA 1N33L 2D0OA 3SVMA 1EFWA 4HJAA 2NN6G 4FF4A 2CWAA 4K2KA 4GNXA 4DN4M 4KN7C 4RGNA 1EYGA 3VR4A 1S3OA 4N9PA 1S5DD 3SHLA 1SE4A 1QB5D 5KYLA 3U9SA 1EY8A 2WAQB 1KABA 4P74A 2F3VA 2X6GA 4EQNA 2SDFA 1U4RA 2EY5A 3K5NA 4K6LA 4CJ2C 2KHJA 2JXMB 4UP7A 4Y7NH 1XX8A 2O5JC 1ILPA 1V8QA 3U4ZA 2OEOA 2VXWA 4DR2Q 5C0XI 4R9WA 4L5QA 5IT9c 3GTMB 1S5FD 1STNA 1U4LA 3CC4A 1A0IA 5GAHC 5G3LF 2BDNA 1S4ZA 2DUDA 4IUPA 1PZID 4DFAA 3QWNA 4DNRB 1KC8C 1NMFA 1SYBA 4MN3A 4DR2L 3SGIA 2ES2A 3JAML 4GLXA 1JE5A 2K4KA 5KNBA 3HG9A 3CXCA 1C8CA 1KDBA 2PCFB 1X3PA 4ZUJA 5E3FA 4PNYA 1UE7A 2VS1A 1DM0B 2PNHA 4IJLA 1PYWD 2KECA 2IW3A 5BN5A 1Y1VH 3OSOA 5ELBA 4OL7A 2Q8RE 3OHXC 2BE5D 2QGQA 3HOZG 2K04A 2HHHQ 2OCEA 3E3XA 4GN4B 4FXDA 3GV6A 5JEAJ 4A3DH 2J7ZA 3E9IA 1TWAB 2KJXA 2K7VA 4IFDH 1ICWA 1G8ZD 3TBIB 4KKSA 2Q2HA 1CKOA 1PFNA 4RKLA 1KLGD 3M4PA 5K5PA 3L2PA 2HHHL 2R3ZA 2R6GA 1F9SA 1W6JA 1K8AC 1RODA 2JQOA 3IRBA 4ULLA 4KHZA 1Y1VG 1PXUA 3TDQA 4FNFA 3CMEA 5C4HA 3NWSA 4F7XA 3U4VA 1ENCA 3A54A 4HEDA 4L5TA 4OELB 3T53B 4EX5A 1XNQQ 4A76A 5CV8A 2GVAA 5GAGC 2WIIB 4A3DG 4N9TA 5ELEA 4R4CA 1NTGA 4IFDG 1JJGA 1DJRD 1TWGH 1PRTB 4A3CH 2KHIA 4QL5A 4RGOS 5C4ZA 1XNQL 5CMDA 3HOXB 5E1FA 2EE1A 1WVLA 4A3KH 1EY6A 1PTOH 1D8LA 1O7IA 4KY7A 2B2TC 2VZAA 2ZXRA 3BZCA 1QVFA 1TU2B 1EOVA 3I4OA 1GVPA 3ERQA 3KBXA 2EYFA 2VL6A 3CP0A 3BS1A 1EWCA 3DWQA 4IQZA 3S1QH 1DGSA 1F9RA 1BR9A 3MC0B 4IURA 2JJQA 5EPKA 4CBVA 1LT4D 4Q5VA 4QUFA 1WTVA 3P1HA 4DK0A 5TSSA 4KJOA 2K05A 4XYQA 5I9PA 1A2UA 1NAPA 3WOEA 4XT1B 1J9OA 4A3CG 1SN8A 1SJHD 1STGA 2OT2A 1O7ZA 2EYJA 2OF1A 5IE8A 4A3KG 5FK9C 1VQOA 5JVG3 2BCOA 2F0WA 3MTSA 3H3VH 3RLNA 2KOLA 4BY1B 2YTXA 4LFAQ 4BS9A 4R4OA 1XTDA 2B2TA 3S16H 3EJIA 4V0BA 1HTLD 3OOCA 4HTHA 2QCPX 1VQLA 3HZXA 3PGZA 3ND9A 2X6LA 4K8IA 4OIJA 4LFAL 3PCOB 2Q8IB 4KHVA 3SK8A 4HR7B 2F52A 3QG1A 1GJXA 4BA2I 2L4NA 2JA6B 4LW1A 3NWTA 5IP9H 5C44G 1CA5A 4J8QA 1XNRQ 2HD3A 4JPBW 4G7ZC 3BZDB 4GN5A 4DK6C 3HOVB 2PPBC 1JORA 3E9HA 5C4XH 3CCEA 2N3SA 3SDZA 3VR3A 2E2HH 4A93H 3F2DA 3K0XA 1Q81C 1I6VC 1VQDA 4RFBA 1XNRL 1OO9B 2A8VA 2R7DA 2JA5H 5G3LD 1VS0A 1DXMA 1T5XD 3HOUB 1SNDA 1SMYD 3TP6A 1R9TB 4RA8A 3S15H 1GHKA 1LT5D 2KEDA 4NB3A 2PZUA 1HPCA 3D4RA 5FLXc 1TY0A 5IT9L 1D5XC 1CTMA 3A8IE 2L12A 5JEAH 5IP9G 4PMCA 1PH8A 5L37A 1CT1D 4N8FA 4X3SA 4E6IA 1W6KA 5AJ3Q 1RDPD 4CKBA 1TS2A 1QVGA 4A3GH 1EIHA 1EYAA 1UEAB 4H0LC 3SEBA 5C4XG 2EYLA 2QA4A 4A93G 3S1NH 4A3BB 3UDXA 5M3MH 1YHQA 3FKIH 1TWFH 2A19A 5ELNA 1NUCA 5AJ3L 3K0YA 1B9NA 4TSSA 2DY7A 1NMGA 4KTAA 1WCMB 4HMIA 1BO0A 1NE3A 4IPHA 2FHTA 1BCPB 1L2FA 4JBMA 4AYBG 1JB3A 1YJNA 3DHQA 4BA1I 4AYBE 1SJED 3Q8DA 4IUTA 5JEAG 1CK1A 3CPWA 1JICA 5FO8B 4O0AA 3K81C 1EU3A 5C5LA 4JW0A 1KNAA 4A3GG 1CM9A 4DR3Q 4KI0A 3D4DA 5I9OA 2R92B 4KLKA 4HMJA 2HDLA 1MBYA 3TP7A 3N6RA 2IY5B 5M3MG 1BBXC 1VQJA 3ONAB 5JPMC 3ULPA 2CKZB 1B8AA 4BBRH 5E4WC 1L0YB 2FMCA 1LTTD 4DR3L 4BY7B 2IHEA 2SNMA 1VQ9A 3KUPA 1HH2P 3MHBA 1LO5D 4RCOA 1HNWQ 2A5HA 2J0TD 1K83H 3HGBA 5KGUA 1EIGA 1B4OA 1HJPA 2QILA 5GQOA 3TSSA 3J80i 2J4XA 3I7FA 3PO2H 1HRJA 3K58A 4NMZA 2E2JH 4JBKA 4NP5A 1Q1EA 1HNWL 4L63B 4R4QA 1IKMA 1PFBA 2LXJA 4HCEA 1DYQA 1YIJA 1Z7TA 5CR3A 2XIWA 4LJZC 2WINB 1I6HB 4LUOA 2NVTB 5A35A 2H5XA 2MPMA 3WWVA 5M5YB 2VUMB 1FNUA 1H9RA 1TS4A 1GD7A 2DN8A 4M8AA 4WFN3 2ZTCA 3M4OB 1U5KA 1TT2A 1SROA 3NBHB 3ULLA 1S5CD 2LSSA 1QWYA 3F2CA 3L3OC 1Y8OB 2CH4A 3EFXD 3K5LA 1A62A 5CV4A 5CV9A 3PO2G 1KD1C 3MEFA 3PO3B 1IXRA 5DAUA 1QG7A 3UI2A 1IKLA 2K14A 3E0JA 3NEMA 5LL6S 3VA7A 1L1OC 2KHSA 1STEA 3F1ZA 1HZCA 4F88A 4OEMB 2E5LQ 4NXNQ 3OW7A 1ET9A 2R93H 1LTRD 1HZ9A 4X6AH 2I5MX 2NBFA 4HIKA 1JC7A 2F0HA 1HFGA 4ZUIA 1SE8A 4PZ8A 4QJFA 5FO9B 3MXNA 4A3MG 2E5LL 4NXNL 3GQBA 3P75A 1HUMA 4IN3A 5M9OA 4JV5Q 1X55A 3DMUA 4ZCKA 5CORA 3FMCA 4FF3A 1JCKB 1D1KA 3VYSA 1FJGQ 2A73B 1WTQA 3GTKH 1H9SA 2PZTA 4FO2A 5CV5A 2NN6I 1SLJA 3FP9A 3JAMc 3RZDB 4M1UB 4JV5L 1TWHH 2EYOA 2KEEA 4CDDC 2P5ZX 1FJGL 1KQSA 4U673 3I55A 5BN3A 1SAPA 5M5XH 4XDXA 1HR0W 1YBYA 4I65A 2R93G 3GD7A 1Y69U 4OXPA 2F0EA 4XQQA 3K57A 5DEHA 1ESRA 2MO1A 1B3AA 1L1OB 4OHJA 2CQOA 4DK3C 2YTYA 1LYLA 2DJGC 3P20A 4RCNA 3I4NB 4UAIA 4B9WA 4JCVE 1RCVD 3GTGB 3PUZA 2KCMA 2SNSA 5IODA 3KF6A 2M9VA 1JE4A 2BH8A 5A2QE 1B53A 2HUGA 1PVOA 1E24A 2A6HC 2K5QA 3KOJA 4KY6A 1C48A 5NUCA 4WRDA 3CC2A 1CA6A 1WD0A 2ZJPA 2I5HA 4FYDA 1JJCB 5C4JB 4CJ1B 3GTPH 2OTJA 3RUZA 3D4WA 3BDCA 3NTIA 1PH4A 2A1AA 3CCQA 3MWYW 2RBMA 1RKNA 5I2XA 3IFTA 1EQRA 5IP7G 1A3TA 3T13A 3RNUA 5IIFA 1PDQA 3OYYA 2KCCA 2MQHA 1FR3A 5D3IB 2Q2TA 1Y1WG 1F2MA 5H1SE 1XMOQ 4QIWB 4WORA 3J7AV 2I0QA 1RTNA 1T5EA 2EJFC 2EXZA 2JEBI 2ZTEA 4R8IA 3KLWA 1V9PA 4DR4Q 2NVYB 4XT3B 1AH9A 1UAPA 2QW7A 1AW7A 1XMOL 2RVLA 2F3WA 2ZJRA 1CQVA 1Z6HA 5KRUA 3DEPA 3A5UA 4EQPA 1LACA 5LMNW 5C5MA 1MSGA 1ZYRC 2ZXOA 4JI5Q 3KDFA 4DR4L 2QEJC 5DM73 2FINB 2ASBA 1E0BA 2Q2IA 4PZ7A 2SOBA 3K5OA 3NHHA 2SEBD 4ZKBB 3QR8A 3H0GB 4NDXA 4IFDI 1N36Q 2IPKD 2F0QA 3ERSX 4JI5L 3G71A 2VW9A 3OMCA 3M9BA 1XPOA 2EJMA 2G9HD 3EVQA 3M3YH 3VA5A 1NR2A 1RL2A 4A3IB 1U0LA 1M8AA 1DOKA 1LTSD 4KKUA 1V1PA 1N36L 4C3HG 2ICEC 1GHJA 1IL2A 1DCZA 3HS0C 2F0SA 3PF5A 2HCIA 1UWVA 3VR5A 1I4HA 1X56A 5CBEE 4P71A 2A6EC 4OO1H 1E7ZA 5I4DA 1SSOA 3IFDA 4N8X1 1I3QB 3EROA 1NJIC 1TS5A 3QIAA 1TWGB 1KDAA 1VCIA 4KD3A 2R7FA 4MNOA 4RHSA 1SFOB 2D0PA 1SYDA 2Z1CA 4DF7A 1A3UA 4RGMA 2MJ8A 1TR5A 4P75A 1XTCD 1L0WA 3GV3A 2IJ0A 4DGZA 2EJGC 3J81L 2L5TA 3BVZA 2B2UC 3K7AH 3SK5A 3SE0A 5C0XJ 4PG3A 4DV7Q 4RWSC 4ID6A 3KK7A 1TIID 3FPUB 4K5XA 2UU9Q 4KK7A 3R2TA 1YJWA 2NVQB 4ZQ3A 1WTPA 1CKMA 3AEVA 3D3RA 4OO1G 4V190 4DUZQ 4LF7Q 2WP8J 3H6MA 4LMQD 4DV7L 1WTXA 1O78A 4OWTB 4DNIA 1O7YA 4LF8Q 2DJFC 4QY7A 2UU9L 1K3RA 1ESFA 3MA2B 3R93A 4P72A 4DR5Q 3HOZH 1N32Q 5I6WA 2PZWA 3KBGA 2EOTA 1C9OA 4C3IH 5CC4A 1HA6A 1E2ZA 2HIXA 5M3FB 1KTKA 3TZUA 4FF1A 3ICEA 4DUZL 4LF7L 1SNMA 1U4PA 1Y8NB 3MFGA 4OWWB 4LF8L 1Y8PB 3AU7A 4NW2A 1F2LA 3K7UC 4DR5L 1N32L 2NTTA 4CJ0B 2AWOA 4JYAQ 4DNTB 5C3EB 3TS0A 3H3VI 2B2UA 4NXMQ 4A3FG 4APVA 4Q0FA 3NTKA 5IYDG 2ZJQA 2K5HA 2ZT9C 4JYAL 1I50H 2KCTA 3BG3A 1PRTC 2PNRC 4WJ3M 4C3JH 1K9MC 2A68C 3T4AC 4NXML 1HUNA 1JB7A 1VF5C 2GN5A 2YTVA 2FFKB 2BH2A 1QNKA 1I4RA 2X69A 4C3IG 5FO7B 3S9WA 5C4XB 1X3FA 1Q8KA 2B2VC 5EBCA 2DY8A 1VQGA 4A93B 1QCBD 2AMCB 1PZKD 1J6QA 2G5DA 2RF4A 3J7YW 2JA5B 1SE2A 1YEZA 1F77A 3H94A 2AKWB 4YY3Q 3STBC 1TY2A 3SK4A 2MNAA 2NVXB 4LUZA 5IGDA 3MXGA 1B44D 1LM0A 2K6AA 1GUNA 2EYHA 2F0LA 2RA4A 1SR3A 2XWJB 4YY3L 4G7HC 1KRTA 4C3JG 2G9DA 1VQ6A 3C3LA 5IT9E 2B2WC 1GOZA 3S14B 4O1NA 2JYOA 4RH6A 2JEAI 3DUZA 2EY6A 2F0MA 2TMPA 4XYOA 3RLOA 4XXEA 5ELCA 2JA7B 4XQNA 5IGCA 4DXGA 3SR1A 2F0GA 4TRDA 4DV1Q 2QKIC 1WYDA 1BUVT 1B50A 3PIPA 1DZ1A 2CVRA 1EWHA 4A3JH 2PO4A 3FKIB 3TQYA 4X62Q 1UUPA 4PMWA 3I4MB 2UUBQ 1HNZQ 3EA6A 1GXDC 4DV1L 3I3CA 3RD4A 1LTLA 3L0OA 5KNDA 1OXXK 2E76C 2ZM6Q 1AE3A 3BU2A 4X62L 4JI3Q 3W2DA 2CFMA 2KA7A 3GO5A 2UUBL 2AHOB 1P8LA 1HNZL 3S1MB 4RHRA 4UDUC 4S3SA 3KJPA 4HIMA 4IUVA 4NPSA 3CC7A 5IYBH 2ZM6L 4QQBX 4C2MB 2B2WA 3PIO3 1EY0A 1LTID 4JI3L 1B70B 1HQMC 1QUQB 4YWMA 5C44H 1JJ2A 1IZ6A 1STAA 4IO9A 4A3JG 2EY1A 1HXYD 4BBRB 3K6OA 2ID0A 2IT1A 3S2DB 3D0FA 2M2LA 1X54A 3BVGA 2RHSB 2EYMA 4KKTA 5KIXA 5ELOA 1PFSA 5EKKA 3HKZG 1SDFA 1UE6A 2L0CA 1VQ4A 2O5IC 3GTJH 1K83B 2VB2X 2KBNA 3HKZE 1EUJA 1WOCA 3RMHA 1EEID 3S24A 3K59A 2KENA 2A74C
chains in the Genus database with same CATH topology
2LXJA 3DLLA 5IYBG 1JMCA 1YZ6A 3PSIA 1YIJA 1K0RA 1N34Q 1HNXQ 2NVTH 1TWCH 3GTOH 3I4NG 1OXUA 4DV5Q 1XJVA 1A8VA 2VUMH 2PQAB 4LUOA 4YCUA 4BY7G 2H5XA 1PH9A 3PIOA 1S72A 1TXYA 3WWVA 1PYBA 2QEXA 2F3IA 4IFDJ 1Q1BA 3M4OH 2WAQG 4AIMA 4A3EH 3A0JA 1GD7A 3L7ZC 3B6YA 4POGA 4DR7Q 4IPDA 1N34L 5IWAQ 1HNXL 2ZTCA 1U5KA 2WAQE 1SROA 5C0XG 4DV5L 3FHWA 2I5LX 3TEHB 2ZTDA 3NBHB 3ULLA 1PA6A 3CD6A 3A74A 2HQLA 2LSSA 4GKKQ 3F2CA 4YCWA 3CCVA 1A63A 2NVYH 3I56A 1BKBA 1IBMQ 3T1HQ 4DR7L 1A62A 1W2BA 5IWAL 1Q82C 3PO2G 1KD1C 1K73C 3MEFA 4L5SA 4AH6A 1IXRA 1TWAH 2EIFA 2K14A 3F8TA 3NEMA 4GKKL 1L1OC 1CKNB 1IBML 1H95A 3T1HL 1ASZA 4X66Q 3F1ZA 2F4VQ 1HZCA 2B63H 4MTNA 3TRZA 5JJIA 2XGTA 3KFUA 4X65Q 5IYCH 4H02A 1E22A 2E5LQ 4NXNQ 5J3BA 3S2HH 5HY6A 3H0GH 2R93H 3M85A 3U50C 1HZ9A 2YV5A 1VQPA 4X6AH 3T1YQ 4A3EG 2I5MX 3AYHB 3KDFB 5LMUQ 2ALYB 4HIKA 2JK8A 3LGJA 1YI2A 3GTQH 2AWNA 4X66L 5JJKA 1UE1A 2F4VL 4A3IH 1SE8A 4PZ8A 4QJFA 5DLQE 1E3PA 4DPGA 4GNXC 3J7ZC 4X65L 4A3MG 2E5LL 4NXNL 5M5WH 4QIWE 4QGUA 1PH5A 4JV5Q 1X55A 1RIPA 2BA1A 2WB1G 5GAEC 1HR0Q 4BBSH 4TQUS 4YCVA 1E1OA 3T1YL 4P73A 1FJGQ 2C35B 1OXSC 3CCRA 5LMUL 1PHJA 2OQKA 2WB1E 4JI6Q 3GTKH 4EQ5A 3RZDH 4JI7L 2EXDA 3G4SA 2NN6I 3M4QA 1SLJA 4IOCA 3FP9A 4IPGA 1EIFA 3JAMc 2IX0A 1WJJA 2OQ0A 1KL9A 4JV5L 1Q86C 1TWHH 1HR0L 4HIDA 4OWXB 2WFWA 1I3QH 3GTLH 4DUYQ 1N33Q 3W5OA 1Q7YC 1KQSA 1SFOH 1FJGL 2B63G 3I55A 4JI6L 4YWLA 3PUVA 2N8NA 4JBWA 2V1CC 5IYCG 5M5XH 1HR0W 4GS3A 1YBYA 5GADC 3H0GG 4DV3Q 2R93G 2N49A 4LF6Q 2UXDQ 3GD7A 4OXPA 1QUQA 4B3TQ 1PH3A 4GN3B 2YYZA 2MO1A 2NZHA 1L1OB 4DUYL 1NY4A 2CQOA 2PI2A 1N33L 4DK3C 2UUAQ 4A3IG 1VQAA 2D0OA 1EFWA 1IYJB 2NN6G 1LYLA 2YTYA 4HJAA 1X6OA 2CWAA 4A4IA 4DV3L 1HZBA 4GNXA 3CCLA 4LF6L 2UXDL 3VDYA 1EYGA 4B3TL 1S3OA 4JCVE 1OXVA 1M90C 2HIVA 3EBEA 3CF5A 4FDBA 3PUZA 1I94Q 2KCMA 4LWCA 1OTCA 2NVQH 4OONA 2UUAL 3KF6A 4JI4Q 3ER0A 4DV4Q 2BH8A 4P74A 1PVOA 1E24A 3KOJA 1Z47A 4JI0Q 1XPUA 3CMAA 3CC2A 1PYSB 1I94L 2ZJPA 2I5HA 2KHJA 4UP7A 3I2ZA 4Y7NH 4LUVA 3GTMH 4DR2Q 3U4ZA 3HOXG 4DV6Q 4RG1A 5C0XI 4JI4L 3KJOA 5M3FH 3JC66 4JBJA 1JJCB 3AFQA 4J15A 4L5QA 5IT9c 4DV4L 3CC4A 1YVCA 1A0IA 2PQAA 3GTPH 5GAHC 4TVAB 2OTJA 1UEBA 4JI0L 2DUDA 1PH4A 1X9NA 4OX9Q 4ALPA 1KC8C 2A1AA 3CCQA 4GLAC 1NMFA 4DR2L 3SGIA 2D62A 5IP7G 1EQRA 4DV6L 2ES2A 1HZAA 5E7NA 5C3EH 4GLXA 1D7QA 1JE5A 2K4KA 1VQ5A 3CXCA 1PH2A 1MJCA 2MO0A 3RNUA 1N8RC 1VQKA 1CSPA 3OYYA 4OX9L 2MQHA 3S1RH 2Q2TA 4GKJQ 2N78A 1UE7A 2VS1A 1Y1WG 5LMNQ 5H1SE 4A3MH 1CUKA 1XMOQ 1PV4A 2PNHA 4IJLA 4B3MQ 1Y1VH 3CPFA 4IJHA 2I0QA 1G6PA 4GLVB 2JEBI 2VY3A 2ZTEA 1VQFA 2OWOA 3M7NA 3KLWA 1V9PA 1CKNA 4DR4Q 1AH9A 4GKJL 2QGQA 2NZOA 3HOZG 5M3FG 4DAMA 5LMNL 4BBSG 1X3EA 1IBLQ 2HHHQ 1XMOL 2OCEA 4GN4B 3J81c 1J5EQ 2ZJRA 4XTCS 5JEAJ 4B3ML 4A3DH 5FLMH 3E9IA 4HJ5A 3A5UA 4DV0Q 4AQYQ 3RN5A 4PZ6A 1AE2A 5LMNW 3CCMA 3JAMi 1P16A 5FJ8H 4JI5Q 4GOPC 3K80C 3KDFA 1VQMA 2Q2HA 4DR4L 2BA0A 3HOUH 1CKOA 2JE6I 3M4PA 3J80c 3L2PA 5C3EG 1R9TH 1IBLL 2HHHL 2ASBA 4WJ4A 4A75A 1J5EL 2E2IH 1V43A 2Q2IA 4PZ7A 2R6GA 2NVXH 3ULJA 4AQYL 4DV0L 1K8AC 4IFDI 2DGYA 1N36Q 1WI5A 3ERSX 4JI5L 3G71A 2VW9A 1XPOA 3M9BA 2JQOA 3IRBA 1VQ8A 3M3YH 3E0EA 3NELA 2JA6G 1RL2A 4DR1Q 4BXXH 4KHZA 2VNUD 1U0LA 1Y1VG 1VQ7A 2VQFQ 1Y14B 3TREA 1EWIA 3PUYA 3CMEA 1GM5A 4Y52H 3RN2A 5IY0A 1C7YA 3U4VA 1N36L 3HOVG 3UDFA 3S14H 4JI2Q 1IL2A 1XPRA 4L5TA 3PF5A 1FGUA 1UWVA 4EX5A 1XNQQ 1BBWA 4A76A 5GAGC 2GVAA 1X56A 4DR1L 5FLMG 2JA7H 4YHHQ 4P71A 4A3DG 2VQFL 1ASYA 1E7ZA 4R4CA 1NTGA 4IFDG 1JJGA 5FJ8G 1TWGH 1V1QA 1L1OA 4RMFA 2RHQB 4JI2L 1NBWA 3HOUG 2JA5G 4A3CH 1NJIC 2CWPA 2KHIA 4QL5A 4XIGS 3HOXH 1VCIA 2R7FA 4MNOA 4GOPA 3I4MH 1XNQL 2D0PA 4YHHL 4YWKA 1BVSA 1Q12A 4A3KH 1X65A 1D8LA 1O7IA 1JT8A 3K8AA 4UP8A 4P75A 2VZAA 4LFBQ 1L0WA 4GOPB 3BZCA 2UXCQ 3D31A 4HJ9A 1QVFA 4BXXG 1EOVA 2K50A 5IP7H 3W1BA 2L15A 3I4OA 1GVPA 4R1JA 1YJ9A 3K7AH 3S1MH 2VL6A 3CP0A 5C0XJ 4PG3A 4DV7Q 3J7A5 2UU9Q 3EN2A 3S1QH 4POFA 3J81j 1YJWA 1Y1WH 1DGSA 2CCZA 4C2MH 4LFBL 4LF9Q 2UXCL 3BJUA 2JJQA 2JA7G 1QZHA 1CKMA 2GVBA 3AEVA 4OO1G 4DUZQ 4LF7Q 2WP8J 4DV7L 4KHPQ 4LFCQ 4HJ8A 1YITA 4OWTB 4DNIA 3FKIG 5BR8Q 5HGQA 1SN8A 4QY7A 4LF8Q 2UU9L 3CCSA 1K3RA 4A3CG 3U58A 3S2DH 4JC0A 4P72A 1WCMG 4JI1Q 4DR5Q 3HOZH 4LF9L 4DR6Q 1S40A 3I4MG 1N32Q 1C9OA 4C3IH 5IE8A 3CCJA 4A3KG 2HIXA 1VQOA 3ICEA 4DUZL 4LF7L 3H15A 2K52A 1X3GA 4BY1H 4KHPL 4LFCL 3H3VH 2OTLA 3J81i 2ATWA 3RLNA 5BR8L 4LF8L 4OWWB 3KF8B 2YTXA 4LFAQ 3AQQA 3K7UC 4JI1L 1FVIA 4R4OA 3STBD 1XTDA 1CSQA 4DR5L 4DR6L 3S16H 1N32L 2AWOA 4JYAQ 1VQLA 3PGZA 3TS0A 3H3VI 1VQNA 4NXMQ 1VQIA 3TS2A 2R92G 4A3FG 4APVA 1EQQA 4LFAL 3PCOB 1FL0A 3HKSA 1KAWA 2JA6H 5IYDG 2F52A 1Q46A 2K5HA 2ZJQA 1BBUA 1I6HH 4BA2I 4MZ9A 1I50H 4JYAL 4JI7Q 1GO3E 2KCTA 4LW1A 4JG2A 5IP9H 4K0KQ 5M5YH 1I5FA 2K5VA 4WJ3M 4C3JH 1K9MC 5C44G 3HOVH 2UXBQ 4C3HH 1XNRQ 1Z9FA 2MFIA 4BBRG 4LF5Q 4NXML 1G291 1JB7A 4GN5A 4DK6C 2GN5A 2YTVA 2PI2E 2BH2A 2B3GA 3E9HA 5C4XH 1MJEA 3CCEA 3HOWH 2N3SA 3NENA 3OTOQ 2E2HH 1T9HA 3RR5A 3F2DA 4A93H 3K0XA 4BY1G 1X3FA 1Q81C 1Q8KA 4JOIC 4K0KL 1VQHA 1VQGA 1VQDA 2UXBL 1XNRL 2AMCB 4LF5L 1XMQQ 2A8VA 2K5NA 2R7DA 2JA5H 1J6QA 3UDGA 4DAYB 5EAYA 3PUWA 1VS0A 2RF4A 3OTOL 3PO3H 1YEZA 4YY3Q 2XTIA 2AKWB 3S15H 3STBC 4UPAA 3G6EA 2MNAA 5K36G 4NB3A 4LUZA 1M1KC 4HIOA 1XMQL 1IBKQ 5FLXc 1LM0A 1GKHA 2LXKA 4UY8C 3UDIA 1MKHA 1SR3A 5IP9G 4YY3L 2JA8H 1KRTA 2VUMG 1KXLA 1PH8A 3S17H 1G51A 2EQSA 3HOYH 4O2DA 1VQ6A 5AJ3Q 3OW2A 1YHAA 1QVGA 1IBKL 4A3GH 5C4XG 3BZKA 2JEAI 3HOWG 4A3BH 3ZJYC 2UUCQ 3CW2C 2QA4A 4A93G 1LUZA 3RLOA 2Y0SG 3S1NH 4UP9A 2IHFA 4ME3A 1MIUA 2R7ZH 4DV1Q 3UDXA 3RLFA 1WYDA 2Q2UA 1SRUA 5M3MH 3PIPA 2Y0SE 3FKIH 1YHQA 3PF4A 1TWFH 2A19A 5ELNA 4A3LH 4JOIA 5AJ3L 1SMXA 3CAMA 2JA9A 3AFPA 1WCMH 4A3JH 1EIYB 3CCUA 1KRSA 1NMGA 3TQYA 4X62Q 2VQEQ 1PH1A 3PO3G 2Z0SA 2UUCL 3UE1A 1YNXA 3MXNB 2Z6KC 4PMWA 4OO1I 1NE3A 4HJ7A 3GDEA 4IPHA 2UUBQ 1L2FA 1HNZQ 1VQEA 3F2BA 4DV1L 4JBMA 4AYBG 1LTLA 3L0OA 3HFZB 1K8GA 3W1GA 1N9WA 2K75A 1YJNA 1OXXK 2PMZE 1W3SA 4BA1I 4AYBE 2ZM6Q 1AE3A 3BU2A 4X62L 4X64Q 3CQZH 2VQEL 3Q8DA 1KHIA 5JEAG 4L5RC 3CPWA 4JI3Q 2JA8G 4JI8Q 2CFMA 3EIVA 3GO5A 4O0AA 2AHOB 1P8LA 1HNZL 2UUBL 4IPCA 4DKAC 3K81C 1WFQA 2E8GA 1PH6A 3HOYG 4B3RQ 3UE0A 2R92H 4A3GG 4A3FH 4R4IA 3KJPA 4HIMA 1KIXA 4DR3Q 3CC7A 4NPSA 4KI0A 2FXQA 3G48A 4A3BG 5IYBH 2ZM6L 5IYDH 4KLKA 4QQBX 4LNQA 4X64L 1QVCA 4JI3L 3I4NH 1QZGA 2IY5B 4JI8L 1B70B 2R7ZG 1C0AA 1UE5A 4B3SQ 5M3MG 4LF4Q 1VQJA 1QUQB 3A5ZB 4YWMA 5C44H 3ULPA 2CKZB 1B8AA 2IX1A 4A3LG 4BBRH 1JJ2A 3GTGH 4BY7H 1IZ6A 3PUXA 4B3RL 4IO9A 4A3JG 1VQBA 4DR3L 5GROA 2IHEA 2ID0A 2IT1A 1VQ9A 3D0FA 4DV2Q 1HH2P 1X54A 4GNXB 4B3SL 4LF4L 2Z6KA 1HNWQ 2RHSB 1VQCA 1E1TA 1YHBA 1B7YB 1K83H 5ELOA 1PH7A 1PFSA 3HKZG 4R4TA 2HT1A 1UE6A 3KF6B 1VQ4A 1HJPA 3GTJH 5JJLA 2RCNA 4IOAA 3PV0A 5GQOA 2KBNA 5C4JH 3HKZE 2YU9H 3J80i 4DV2L 3I7FA 3PO2H 1EUJA 3RZOH 2E2JH 4JBKA 1WOCA 3S24A 1Q1EA 1HNWL 4R4QA 1OXTA 2KENA 3DM3A 2B29A 3KYHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXJ A;  3DLL A;  5IYB G;  1JMC A;  1YZ6 A;  3PSI A;  1YIJ A;  1K0R A;  1N34 Q;  1HNX Q;  2NVT H;  1TWC H;  3GTO H;  3I4N G;  1OXU A;  4DV5 Q;  1XJV A;  1A8V A;  2VUM H;  2PQA B;  4LUO A;  4YCU A;  4BY7 G;  2H5X A;  1PH9 A;  3PIO A;  1S72 A;  1TXY A;  3WWV A;  1PYB A;  2QEX A;  2F3I A;  4IFD J;  1Q1B A;  3M4O H;  2WAQ G;  4AIM A;  4A3E H;  3A0J A;  1GD7 A;  3L7Z C;  3B6Y A;  4POG A;  4DR7 Q;  4IPD A;  1N34 L;  5IWA Q;  1HNX L;  2ZTC A;  1U5K A;  2WAQ E;  1SRO A;  5C0X G;  4DV5 L;  3FHW A;  2I5L X;  3TEH B;  2ZTD A;  3NBH B;  3ULL A;  1PA6 A;  3CD6 A;  3A74 A;  2HQL A;  2LSS A;  4GKK Q;  3F2C A;  4YCW A;  3CCV A;  1A63 A;  2NVY H;  3I56 A;  1BKB A;  1IBM Q;  3T1H Q;  4DR7 L;  1A62 A;  1W2B A;  5IWA L;  1Q82 C;  3PO2 G;  1KD1 C;  1K73 C;  3MEF A;  4L5S A;  4AH6 A;  1IXR A;  1TWA H;  2EIF A;  2K14 A;  3F8T A;  3NEM A;  4GKK L;  1L1O C;  1CKN B;  1IBM L;  1H95 A;  3T1H L;  1ASZ A;  4X66 Q;  3F1Z A;  2F4V Q;  1HZC A;  2B63 H;  4MTN A;  3TRZ A;  5JJI A;  2XGT A;  3KFU A;  4X65 Q;  5IYC H;  4H02 A;  1E22 A;  2E5L Q;  4NXN Q;  5J3B A;  3S2H H;  5HY6 A;  3H0G H;  2R93 H;  3M85 A;  3U50 C;  1HZ9 A;  2YV5 A;  1VQP A;  4X6A H;  3T1Y Q;  4A3E G;  2I5M X;  3AYH B;  3KDF B;  5LMU Q;  2ALY B;  4HIK A;  2JK8 A;  3LGJ A;  1YI2 A;  3GTQ H;  2AWN A;  4X66 L;  5JJK A;  1UE1 A;  2F4V L;  4A3I H;  1SE8 A;  4PZ8 A;  4QJF A;  5DLQ E;  1E3P A;  4DPG A;  4GNX C;  3J7Z C;  4X65 L;  4A3M G;  2E5L L;  4NXN L;  5M5W H;  4QIW E;  4QGU A;  1PH5 A;  4JV5 Q;  1X55 A;  1RIP A;  2BA1 A;  2WB1 G;  5GAE C;  1HR0 Q;  4BBS H;  4TQU S;  4YCV A;  1E1O A;  3T1Y L;  4P73 A;  1FJG Q;  2C35 B;  1OXS C;  3CCR A;  5LMU L;  1PHJ A;  2OQK A;  2WB1 E;  4JI6 Q;  3GTK H;  4EQ5 A;  3RZD H;  4JI7 L;  2EXD A;  3G4S A;  2NN6 I;  3M4Q A;  1SLJ A;  4IOC A;  3FP9 A;  4IPG A;  1EIF A;  3JAM c;  2IX0 A;  1WJJ A;  2OQ0 A;  1KL9 A;  4JV5 L;  1Q86 C;  1TWH H;  1HR0 L;  4HID A;  4OWX B;  2WFW A;  1I3Q H;  3GTL H;  4DUY Q;  1N33 Q;  3W5O A;  1Q7Y C;  1KQS A;  1SFO H;  1FJG L;  2B63 G;  3I55 A;  4JI6 L;  4YWL A;  3PUV A;  2N8N A;  4JBW A;  2V1C C;  5IYC G;  5M5X H;  1HR0 W;  4GS3 A;  1YBY A;  5GAD C;  3H0G G;  4DV3 Q;  2R93 G;  2N49 A;  4LF6 Q;  2UXD Q;  3GD7 A;  4OXP A;  1QUQ A;  4B3T Q;  1PH3 A;  4GN3 B;  2YYZ A;  2MO1 A;  2NZH A;  1L1O B;  4DUY L;  1NY4 A;  2CQO A;  2PI2 A;  1N33 L;  4DK3 C;  2UUA Q;  4A3I G;  1VQA A;  2D0O A;  1EFW A;  1IYJ B;  2NN6 G;  1LYL A;  2YTY A;  4HJA A;  1X6O A;  2CWA A;  4A4I A;  4DV3 L;  1HZB A;  4GNX A;  3CCL A;  4LF6 L;  2UXD L;  3VDY A;  1EYG A;  4B3T L;  1S3O A;  4JCV E;  1OXV A;  1M90 C;  2HIV A;  3EBE A;  3CF5 A;  4FDB A;  3PUZ A;  1I94 Q;  2KCM A;  4LWC A;  1OTC A;  2NVQ H;  4OON A;  2UUA L;  3KF6 A;  4JI4 Q;  3ER0 A;  4DV4 Q;  2BH8 A;  4P74 A;  1PVO A;  1E24 A;  3KOJ A;  1Z47 A;  4JI0 Q;  1XPU A;  3CMA A;  3CC2 A;  1PYS B;  1I94 L;  2ZJP A;  2I5H A;  2KHJ A;  4UP7 A;  3I2Z A;  4Y7N H;  4LUV A;  3GTM H;  4DR2 Q;  3U4Z A;  3HOX G;  4DV6 Q;  4RG1 A;  5C0X I;  4JI4 L;  3KJO A;  5M3F H;  3JC6 6;  4JBJ A;  1JJC B;  3AFQ A;  4J15 A;  4L5Q A;  5IT9 c;  4DV4 L;  3CC4 A;  1YVC A;  1A0I A;  2PQA A;  3GTP H;  5GAH C;  4TVA B;  2OTJ A;  1UEB A;  4JI0 L;  2DUD A;  1PH4 A;  1X9N A;  4OX9 Q;  4ALP A;  1KC8 C;  2A1A A;  3CCQ A;  4GLA C;  1NMF A;  4DR2 L;  3SGI A;  2D62 A;  5IP7 G;  1EQR A;  4DV6 L;  2ES2 A;  1HZA A;  5E7N A;  5C3E H;  4GLX A;  1D7Q A;  1JE5 A;  2K4K A;  1VQ5 A;  3CXC A;  1PH2 A;  1MJC A;  2MO0 A;  3RNU A;  1N8R C;  1VQK A;  1CSP A;  3OYY A;  4OX9 L;  2MQH A;  3S1R H;  2Q2T A;  4GKJ Q;  2N78 A;  1UE7 A;  2VS1 A;  1Y1W G;  5LMN Q;  5H1S E;  4A3M H;  1CUK A;  1XMO Q;  1PV4 A;  2PNH A;  4IJL A;  4B3M Q;  1Y1V H;  3CPF A;  4IJH A;  2I0Q A;  1G6P A;  4GLV B;  2JEB I;  2VY3 A;  2ZTE A;  1VQF A;  2OWO A;  3M7N A;  3KLW A;  1V9P A;  1CKN A;  4DR4 Q;  1AH9 A;  4GKJ L;  2QGQ A;  2NZO A;  3HOZ G;  5M3F G;  4DAM A;  5LMN L;  4BBS G;  1X3E A;  1IBL Q;  2HHH Q;  1XMO L;  2OCE A;  4GN4 B;  3J81 c;  1J5E Q;  2ZJR A;  4XTC S;  5JEA J;  4B3M L;  4A3D H;  5FLM H;  3E9I A;  4HJ5 A;  3A5U A;  4DV0 Q;  4AQY Q;  3RN5 A;  4PZ6 A;  1AE2 A;  5LMN W;  3CCM A;  3JAM i;  1P16 A;  5FJ8 H;  4JI5 Q;  4GOP C;  3K80 C;  3KDF A;  1VQM A;  2Q2H A;  4DR4 L;  2BA0 A;  3HOU H;  1CKO A;  2JE6 I;  3M4P A;  3J80 c;  3L2P A;  5C3E G;  1R9T H;  1IBL L;  2HHH L;  2ASB A;  4WJ4 A;  4A75 A;  1J5E L;  2E2I H;  1V43 A;  2Q2I A;  4PZ7 A;  2R6G A;  2NVX H;  3ULJ A;  4AQY L;  4DV0 L;  1K8A C;  4IFD I;  2DGY A;  1N36 Q;  1WI5 A;  3ERS X;  4JI5 L;  3G71 A;  2VW9 A;  1XPO A;  3M9B A;  2JQO A;  3IRB A;  1VQ8 A;  3M3Y H;  3E0E A;  3NEL A;  2JA6 G;  1RL2 A;  4DR1 Q;  4BXX H;  4KHZ A;  2VNU D;  1U0L A;  1Y1V G;  1VQ7 A;  2VQF Q;  1Y14 B;  3TRE A;  1EWI A;  3PUY A;  3CME A;  1GM5 A;  4Y52 H;  3RN2 A;  5IY0 A;  1C7Y A;  3U4V A;  1N36 L;  3HOV G;  3UDF A;  3S14 H;  4JI2 Q;  1IL2 A;  1XPR A;  4L5T A;  3PF5 A;  1FGU A;  1UWV A;  4EX5 A;  1XNQ Q;  1BBW A;  4A76 A;  5GAG C;  2GVA A;  1X56 A;  4DR1 L;  5FLM G;  2JA7 H;  4YHH Q;  4P71 A;  4A3D G;  2VQF L;  1ASY A;  1E7Z A;  4R4C A;  1NTG A;  4IFD G;  1JJG A;  5FJ8 G;  1TWG H;  1V1Q A;  1L1O A;  4RMF A;  2RHQ B;  4JI2 L;  1NBW A;  3HOU G;  2JA5 G;  4A3C H;  1NJI C;  2CWP A;  2KHI A;  4QL5 A;  4XIG S;  3HOX H;  1VCI A;  2R7F A;  4MNO A;  4GOP A;  3I4M H;  1XNQ L;  2D0P A;  4YHH L;  4YWK A;  1BVS A;  1Q12 A;  4A3K H;  1X65 A;  1D8L A;  1O7I A;  1JT8 A;  3K8A A;  4UP8 A;  4P75 A;  2VZA A;  4LFB Q;  1L0W A;  4GOP B;  3BZC A;  2UXC Q;  3D31 A;  4HJ9 A;  1QVF A;  4BXX G;  1EOV A;  2K50 A;  5IP7 H;  3W1B A;  2L15 A;  3I4O A;  1GVP A;  4R1J A;  1YJ9 A;  3K7A H;  3S1M H;  2VL6 A;  3CP0 A;  5C0X J;  4PG3 A;  4DV7 Q;  3J7A 5;  2UU9 Q;  3EN2 A;  3S1Q H;  4POF A;  3J81 j;  1YJW A;  1Y1W H;  1DGS A;  2CCZ A;  4C2M H;  4LFB L;  4LF9 Q;  2UXC L;  3BJU A;  2JJQ A;  2JA7 G;  1QZH A;  1CKM A;  2GVB A;  3AEV A;  4OO1 G;  4DUZ Q;  4LF7 Q;  2WP8 J;  4DV7 L;  4KHP Q;  4LFC Q;  4HJ8 A;  1YIT A;  4OWT B;  4DNI A;  3FKI G;  5BR8 Q;  5HGQ A;  1SN8 A;  4QY7 A;  4LF8 Q;  2UU9 L;  3CCS A;  1K3R A;  4A3C G;  3U58 A;  3S2D H;  4JC0 A;  4P72 A;  1WCM G;  4JI1 Q;  4DR5 Q;  3HOZ H;  4LF9 L;  4DR6 Q;  1S40 A;  3I4M G;  1N32 Q;  1C9O A;  4C3I H;  5IE8 A;  3CCJ A;  4A3K G;  2HIX A;  1VQO A;  3ICE A;  4DUZ L;  4LF7 L;  3H15 A;  2K52 A;  1X3G A;  4BY1 H;  4KHP L;  4LFC L;  3H3V H;  2OTL A;  3J81 i;  2ATW A;  3RLN A;  5BR8 L;  4LF8 L;  4OWW B;  3KF8 B;  2YTX A;  4LFA Q;  3AQQ A;  3K7U C;  4JI1 L;  1FVI A;  4R4O A;  3STB D;  1XTD A;  1CSQ A;  4DR5 L;  4DR6 L;  3S16 H;  1N32 L;  2AWO A;  4JYA Q;  1VQL A;  3PGZ A;  3TS0 A;  3H3V I;  1VQN A;  4NXM Q;  1VQI A;  3TS2 A;  2R92 G;  4A3F G;  4APV A;  1EQQ A;  4LFA L;  3PCO B;  1FL0 A;  3HKS A;  1KAW A;  2JA6 H;  5IYD G;  2F52 A;  1Q46 A;  2K5H A;  2ZJQ A;  1BBU A;  1I6H H;  4BA2 I;  4MZ9 A;  1I50 H;  4JYA L;  4JI7 Q;  1GO3 E;  2KCT A;  4LW1 A;  4JG2 A;  5IP9 H;  4K0K Q;  5M5Y H;  1I5F A;  2K5V A;  4WJ3 M;  4C3J H;  1K9M C;  5C44 G;  3HOV H;  2UXB Q;  4C3H H;  1XNR Q;  1Z9F A;  2MFI A;  4BBR G;  4LF5 Q;  4NXM L;  1G29 1;  1JB7 A;  4GN5 A;  4DK6 C;  2GN5 A;  2YTV A;  2PI2 E;  2BH2 A;  2B3G A;  3E9H A;  5C4X H;  1MJE A;  3CCE A;  3HOW H;  2N3S A;  3NEN A;  3OTO Q;  2E2H H;  1T9H A;  3RR5 A;  3F2D A;  4A93 H;  3K0X A;  4BY1 G;  1X3F A;  1Q81 C;  1Q8K A;  4JOI C;  4K0K L;  1VQH A;  1VQG A;  1VQD A;  2UXB L;  1XNR L;  2AMC B;  4LF5 L;  1XMQ Q;  2A8V A;  2K5N A;  2R7D A;  2JA5 H;  1J6Q A;  3UDG A;  4DAY B;  5EAY A;  3PUW A;  1VS0 A;  2RF4 A;  3OTO L;  3PO3 H;  1YEZ A;  4YY3 Q;  2XTI A;  2AKW B;  3S15 H;  3STB C;  4UPA A;  3G6E A;  2MNA A;  5K36 G;  4NB3 A;  4LUZ A;  1M1K C;  4HIO A;  1XMQ L;  1IBK Q;  5FLX c;  1LM0 A;  1GKH A;  2LXK A;  4UY8 C;  3UDI A;  1MKH A;  1SR3 A;  5IP9 G;  4YY3 L;  2JA8 H;  1KRT A;  2VUM G;  1KXL A;  1PH8 A;  3S17 H;  1G51 A;  2EQS A;  3HOY H;  4O2D A;  1VQ6 A;  5AJ3 Q;  3OW2 A;  1YHA A;  1QVG A;  1IBK L;  4A3G H;  5C4X G;  3BZK A;  2JEA I;  3HOW G;  4A3B H;  3ZJY C;  2UUC Q;  3CW2 C;  2QA4 A;  4A93 G;  1LUZ A;  3RLO A;  2Y0S G;  3S1N H;  4UP9 A;  2IHF A;  4ME3 A;  1MIU A;  2R7Z H;  4DV1 Q;  3UDX A;  3RLF A;  1WYD A;  2Q2U A;  1SRU A;  5M3M H;  3PIP A;  2Y0S E;  3FKI H;  1YHQ A;  3PF4 A;  1TWF H;  2A19 A;  5ELN A;  4A3L H;  4JOI A;  5AJ3 L;  1SMX A;  3CAM A;  2JA9 A;  3AFP A;  1WCM H;  4A3J H;  1EIY B;  3CCU A;  1KRS A;  1NMG A;  3TQY A;  4X62 Q;  2VQE Q;  1PH1 A;  3PO3 G;  2Z0S A;  2UUC L;  3UE1 A;  1YNX A;  3MXN B;  2Z6K C;  4PMW A;  4OO1 I;  1NE3 A;  4HJ7 A;  3GDE A;  4IPH A;  2UUB Q;  1L2F A;  1HNZ Q;  1VQE A;  3F2B A;  4DV1 L;  4JBM A;  4AYB G;  1LTL A;  3L0O A;  3HFZ B;  1K8G A;  3W1G A;  1N9W A;  2K75 A;  1YJN A;  1OXX K;  2PMZ E;  1W3S A;  4BA1 I;  4AYB E;  2ZM6 Q;  1AE3 A;  3BU2 A;  4X62 L;  4X64 Q;  3CQZ H;  2VQE L;  3Q8D A;  1KHI A;  5JEA G;  4L5R C;  3CPW A;  4JI3 Q;  2JA8 G;  4JI8 Q;  2CFM A;  3EIV A;  3GO5 A;  4O0A A;  2AHO B;  1P8L A;  1HNZ L;  2UUB L;  4IPC A;  4DKA C;  3K81 C;  1WFQ A;  2E8G A;  1PH6 A;  3HOY G;  4B3R Q;  3UE0 A;  2R92 H;  4A3G G;  4A3F H;  4R4I A;  3KJP A;  4HIM A;  1KIX A;  4DR3 Q;  3CC7 A;  4NPS A;  4KI0 A;  2FXQ A;  3G48 A;  4A3B G;  5IYB H;  2ZM6 L;  5IYD H;  4KLK A;  4QQB X;  4LNQ A;  4X64 L;  1QVC A;  4JI3 L;  3I4N H;  1QZG A;  2IY5 B;  4JI8 L;  1B70 B;  2R7Z G;  1C0A A;  1UE5 A;  4B3S Q;  5M3M G;  4LF4 Q;  1VQJ A;  1QUQ B;  3A5Z B;  4YWM A;  5C44 H;  3ULP A;  2CKZ B;  1B8A A;  2IX1 A;  4A3L G;  4BBR H;  1JJ2 A;  3GTG H;  4BY7 H;  1IZ6 A;  3PUX A;  4B3R L;  4IO9 A;  4A3J G;  1VQB A;  4DR3 L;  5GRO A;  2IHE A;  2ID0 A;  2IT1 A;  1VQ9 A;  3D0F A;  4DV2 Q;  1HH2 P;  1X54 A;  4GNX B;  4B3S L;  4LF4 L;  2Z6K A;  1HNW Q;  2RHS B;  1VQC A;  1E1T A;  1YHB A;  1B7Y B;  1K83 H;  5ELO A;  1PH7 A;  1PFS A;  3HKZ G;  4R4T A;  2HT1 A;  1UE6 A;  3KF6 B;  1VQ4 A;  1HJP A;  3GTJ H;  5JJL A;  2RCN A;  4IOA A;  3PV0 A;  5GQO A;  2KBN A;  5C4J H;  3HKZ E;  2YU9 H;  3J80 i;  4DV2 L;  3I7F A;  3PO2 H;  1EUJ A;  3RZO H;  2E2J H;  4JBK A;  1WOC A;  3S24 A;  1Q1E A;  1HNW L;  4R4Q A;  1OXT A;  2KEN A;  3DM3 A;  2B29 A;  3KYH C; 
#chains in the Genus database with same CATH topology
 1CQF A;  5IYB G;  1YZ6 A;  1STB A;  3PSI A;  2F0T A;  1EYC A;  2PQA B;  5IOC A;  1D5Z C;  1PH9 A;  1MHW C;  1TXY A;  2QEX A;  1RJT A;  2WAQ G;  5EBD A;  3L7Z C;  4POG A;  2K5W A;  1ICF B;  1BCP C;  2JP1 A;  2WAQ E;  5I2Y A;  5C0X G;  3NP8 A;  3HOW B;  2I5L X;  4K6D A;  4TKO B;  2Y0S B;  3CD6 A;  4X3T A;  4CDF C;  4GKK Q;  3A8K E;  4YCW A;  2D5D A;  1D1I A;  2F0I A;  1W2B A;  1LT3 D;  1K73 C;  4L5S A;  4AH6 A;  1TWA H;  2EIF A;  1RTO A;  4GKK L;  1CKN B;  2PMZ B;  4C1N I;  1H95 A;  4RGT A;  3TRZ A;  5JJI A;  4MTN A;  4XQJ A;  4H02 A;  5J3B A;  2JA8 B;  1EOT A;  3M85 A;  2YV5 A;  1VQP A;  3ITP A;  3S17 B;  3HOY B;  3AYH B;  5J22 A;  5LMU Q;  2JK8 A;  3LGJ A;  1G91 A;  2AWN A;  5JPN C;  3GP7 A;  1TVX A;  4JI7 Q;  4DPG A;  3J7Z C;  1MGS A;  2E75 C;  5M5W H;  1PH5 A;  3IL8 A;  5EKL A;  2BA1 A;  1HR0 Q;  1PRT F;  2R7Z B;  4TQU S;  4CHT B;  4YCV A;  4P73 A;  4FF2 A;  2WKD A;  3CCR A;  5LMU L;  1PHJ A;  2VB3 X;  2A6H D;  4JI7 L;  4CKE A;  4ODG A;  2IX0 A;  3QB3 A;  4HID A;  1HR0 L;  2WFW A;  4DUY Q;  3VR2 A;  1Q7Y C;  4H44 C;  3X3N A;  1TWH B;  2EPB A;  4UHV A;  2AQ2 B;  3PUV A;  2N8N A;  2V1C C;  3BYT B;  4U68 A;  3PQI A;  4GS3 A;  3CQZ B;  2AUK A;  4B3T Q;  1O7L A;  1PH3 A;  4GN3 B;  2YYZ A;  1ET6 A;  2CH4 W;  1NY4 A;  4DUY L;  2PI2 A;  1VQA A;  1IYJ B;  2KQ3 A;  1KLU D;  4A4I A;  3VDY A;  4C56 C;  4B3T L;  1M90 C;  2HIV A;  3EBE A;  4LWC A;  1OTC A;  3CU7 A;  4OON A;  3E6Z X;  2F4I A;  1SYE A;  3SXH A;  5FLX E;  3HP3 A;  1LAB A;  3OIP A;  3HOX G;  1XXG A;  2JN4 A;  3SK6 A;  1IL8 A;  3KJO A;  4JBJ A;  4BBS H;  3AFQ A;  1ZYR D;  4J15 A;  1YVC A;  2YU9 B;  2LMC B;  4TVA B;  1RD9 D;  4ME5 A;  5FKA C;  2QF7 A;  1X9N A;  4OX9 Q;  4ALP A;  1R4P B;  1IYU A;  4GLA C;  4G57 A;  2D62 A;  1QOH A;  3NQI A;  1TWC B;  3I90 A;  5E7N A;  4ZRZ A;  1D7Q A;  1VQ5 A;  3NBH A;  1PH2 A;  1MJC A;  1VQK A;  1CSP A;  4OX9 L;  2NB0 A;  3S1R H;  1MI2 A;  3QOL A;  1EY9 A;  4GKJ Q;  1DD2 A;  1K0S A;  2N78 A;  4A3E B;  5LMN Q;  3LX0 A;  1CUK A;  4A3M H;  1SNQ A;  2F0U A;  2ENB A;  4P2C B;  1G6P A;  4IJH A;  4GLV B;  2QDB A;  1VQF A;  2OWO A;  1I4P A;  2PW7 A;  2WB1 B;  2A6E D;  4GKJ L;  4HSP A;  2NZO A;  4DAM A;  5LMN L;  4BBS G;  4F8M A;  1X3E A;  1IBL Q;  3J81 c;  1J5E Q;  1PLF A;  1EEF D;  4HJ5 A;  2B39 A;  4DV0 Q;  4AQY Q;  5IGB A;  3TP5 A;  3RN5 A;  2F0K A;  4PZ6 A;  1AE2 A;  1EZ8 A;  4ZAI A;  3JAM i;  4QMG A;  3A8J E;  1P16 A;  4GOP C;  3K80 C;  2BA0 A;  3HOU H;  4DK1 A;  2JE6 I;  3J80 c;  1IBL L;  4WJ4 A;  1R9T H;  4A75 A;  1K3B C;  1J5E L;  2E2I H;  1F2Z A;  3IAY A;  3S2H B;  4AQY L;  4DV0 L;  5KEE A;  1FNV A;  2DGY A;  2ZXP A;  1WI5 A;  1LLR D;  1VQ8 A;  3GTQ B;  1WTR A;  2JA6 G;  2VNU D;  4DR1 Q;  2EVB A;  1QIL A;  1PFM A;  3J7A F;  3M3Y B;  2VQF Q;  2Q8T A;  3Q22 A;  5KYI A;  3PUY A;  1EFI D;  1AP0 A;  1XWE A;  1GM5 A;  4Y52 H;  1C7Y A;  4CKC A;  3HOV G;  2NUC A;  3UDF A;  4JI2 Q;  3Q23 A;  1XPR A;  4KV6 A;  4DR1 L;  4IUQ A;  1BCP F;  4YHH Q;  3C2P A;  2VQF L;  1ASY A;  1AFP A;  5ELF A;  1L1O A;  4RMF A;  4JI2 L;  1NBW A;  1DOL A;  3HOU G;  2CWP A;  4XIG S;  1SNC A;  2MGS A;  3N52 A;  3M7G A;  4GOP A;  4DXF A;  3WDN A;  1B1Z A;  4YHH L;  4YWK A;  1BVS A;  1Q12 A;  1ML0 D;  3MVV A;  1X65 A;  1FD7 D;  1JT8 A;  1J8I A;  2WV6 D;  4UP8 A;  4GOP B;  2UXC Q;  4HJ9 A;  2K50 A;  5IP7 H;  3W1B A;  1UNS A;  1AZP A;  1HA5 A;  1VMC A;  4MIU A;  4R1J A;  1YJ9 A;  3J7A 5;  3DM1 A;  3K7A B;  3FRP B;  1I4Q A;  1IYV A;  2IX3 A;  4POF A;  4QUC A;  1Y1W H;  3FDT A;  2CCZ A;  2UXC L;  4LF9 Q;  3BJU A;  1PRT D;  2A68 D;  2GVB A;  1WTO A;  4GZY C;  4LFC Q;  1I4G A;  4HJ8 A;  1YIT A;  3NQT A;  5HGQ A;  3CCS A;  4PQX A;  1WCM G;  4Y7N B;  4LF9 L;  3CKI B;  3OWE B;  1QE6 A;  3D6W A;  3HOZ B;  1SE3 A;  3H15 A;  3I72 A;  3NSW A;  4LFC L;  5JAV A;  2OTL A;  1FNW A;  2ATW A;  4B08 A;  2K1B A;  1ENF A;  3KF8 B;  2NWG A;  3STB D;  1FVI A;  1CSQ A;  5JVH 3;  1VQN A;  3DXJ C;  5K36 H;  1VQI A;  1H9K A;  2R92 G;  1I4X A;  4F87 A;  1EQQ A;  3JAM E;  1FL0 A;  4CDE C;  1BBU A;  1I6H H;  1JWM D;  2RSN A;  1F9Q A;  5CV7 A;  4MZ9 A;  1F2Y A;  1GO3 E;  4RKB A;  4JG2 A;  4K0K Q;  5M5Y H;  1I5F A;  2K5V A;  1Y1V B;  4R8N A;  1Q90 A;  4C3H H;  1Z9F A;  2MFI A;  2HDM A;  1G29 1;  2PI2 E;  1HFN A;  1HTP A;  1LTG D;  3OTO Q;  1T9H A;  3RR5 A;  1B2T A;  2WAC A;  1VDZ A;  4JOI C;  4K0K L;  4A3D B;  1PTO C;  2C9O A;  3MZ5 A;  2K01 A;  1CI3 M;  2K5N A;  4DAY B;  5C3W A;  4IUU A;  2RQX A;  3OTO L;  3PO3 H;  3A55 A;  1Q3L A;  2XTI A;  1ZEQ X;  3C1F A;  4UPA A;  5HUR A;  3G6E A;  5K36 G;  3CRL C;  2XSC A;  4HCS A;  4HIO A;  2MHV A;  1IBK Q;  2KVM A;  1BNZ A;  1GKH A;  2A69 C;  4C1N K;  2LXK A;  2RCF A;  4UY8 C;  4JK1 C;  2CW0 C;  1HCZ A;  2F0J A;  2VUM G;  3C1E A;  1KXL A;  1EL0 A;  4B9X A;  4O2D A;  3OW2 A;  1NCV A;  1IBK L;  3BZK A;  3R8B A;  2RDG A;  2IWH A;  4UP9 A;  2IHF A;  1MIU A;  2XVS A;  3RLF A;  2Q2U A;  5CGK A;  3PF4 A;  3H3V C;  4JOI A;  3CAM A;  3FVQ A;  2JA9 A;  1L0X B;  2LY7 A;  1KRS A;  1PH1 A;  3PO3 G;  5IGF A;  3GDE A;  1VQE A;  3F2B A;  4A3K B;  1PTO B;  3URY A;  1N9W A;  1W3S A;  3V96 A;  2KCN A;  2PW5 A;  1KHI A;  3HRZ C;  4L5R C;  1STY A;  3EIV A;  3PMF A;  4IPC A;  4DKA C;  2E8G A;  3UE0 A;  4YIJ A;  1GUS A;  4A3F H;  3J80 L;  4R4I A;  3G48 A;  2C5C A;  1EY4 A;  3OMG A;  3S1Q B;  5IYD H;  1GUG A;  1QVC A;  1ZXT A;  2Z4H A;  3I4N H;  1JOK A;  5IGE A;  4WJW A;  2F0V A;  4QB4 A;  5A2Q L;  2IX1 A;  3GTG H;  3PUX A;  1BCP D;  4KD4 A;  5DM6 3;  5C44 B;  5GRO A;  1KDC A;  1BF4 A;  2L1B A;  1D2B A;  5J1Z A;  3LWE A;  4GNX B;  3HEJ A;  4K8J A;  2XRS D;  1VQC A;  1E1T A;  1H9J A;  3M4Y A;  5ISR A;  1PH7 A;  3MXP A;  5ELD A;  3A7L A;  1X3Q A;  5JJL A;  1EU4 A;  1S5B D;  2E2D C;  3PV0 A;  4IOA A;  5C4J H;  3S16 B;  4X3K A;  3P7J A;  3RZO H;  2AQ1 B;  5FOB B;  3GTJ B;  2AUJ D;  2PYK A;  1OXT A;  3DM3 A;  2B29 A;  3KYH C;  2F0N A;  1SNO A;  3DLL A;  2O4X A;  1JMC A;  3GTO H;  1HNX Q;  3I4N G;  3DWA A;  3R2I A;  1Q8I A;  4L6T B;  1XJV A;  2FJ2 A;  1S72 A;  1JQY D;  2F3I A;  1Q1B A;  2B8G A;  3CHB D;  3BVM A;  4IPD A;  4DR7 Q;  1HNX L;  5EPL A;  1S5E D;  3FHW A;  1G2S A;  2E2H B;  1A2T A;  1PA6 A;  3A74 A;  2HQL A;  1LT6 D;  1YNN C;  1A63 A;  2NVY H;  1DON A;  1IBM Q;  1YNJ C;  4QCL A;  3T1H Q;  4DR7 L;  1XYI A;  2K32 A;  1M4V A;  4ABN A;  2EYP A;  3S15 B;  4J6H A;  2H4O A;  3KLS A;  1IBM L;  4AYB B;  3T1H L;  5D65 A;  1ASZ A;  1ONL A;  2B63 H;  1BXT A;  2XGT A;  3KFU A;  4X65 Q;  5IYC H;  5D14 A;  3H0G H;  1MD2 D;  1GUW A;  3DWP A;  1TKW B;  1YI2 A;  2ALY B;  5T1G A;  1SNP A;  4A3G B;  5JJK A;  3FPP A;  4A3I H;  1X32 A;  3F2U A;  4H13 C;  1E3P A;  5DLQ E;  4DAV A;  2XN9 C;  4X65 L;  5JJZ A;  4QIW E;  1B9M A;  3S1N B;  4EQO A;  1RIP A;  2B2V A;  1CZW A;  5GAE C;  5LHY 1;  5M5W B;  5M3M B;  1TWF B;  2C35 B;  1OXS C;  3KLR A;  4JI6 Q;  2Z9H A;  4IOC A;  4IPG A;  1EIF A;  1WJJ A;  2I46 A;  1PTO F;  1I3Q H;  3AB9 A;  5JOB A;  3GTL H;  3FEW X;  3W5O A;  1SFO H;  2B63 G;  4JI6 L;  4YWL A;  4JBW A;  5IYC G;  2CHB D;  2XRQ D;  4DU9 A;  5GAD C;  3H0G G;  4DV3 Q;  4G4K A;  4LF6 Q;  2UXD Q;  4Z9C B;  1FGB D;  1QUQ A;  2NZH A;  2UUA Q;  4K14 A;  4A3I G;  2LS0 1;  5F2D A;  1X6O A;  4DV3 L;  1HZB A;  3CCL A;  4LF6 L;  2UXD L;  3LNN A;  5IGG A;  5CV6 A;  1OXV A;  3ND8 A;  3ZYY X;  3CF5 A;  4FDB A;  3G7L A;  1I94 Q;  4K5W A;  1IW7 C;  2NVQ H;  2UUA L;  1JWU D;  5EPJ A;  4JI4 Q;  3ER0 A;  5C0X H;  4DV4 Q;  1HHV A;  2LFN A;  2EZV A;  1Z47 A;  4JI0 Q;  1XPU A;  3MEH A;  3CMA A;  1PYS B;  3MXU A;  1I94 L;  3I2Z A;  3GTM H;  4LUV A;  2AQ3 B;  4DV6 Q;  4RG1 A;  4JI4 L;  5J39 A;  5M3F H;  3JC6 6;  4DV4 L;  1CFM A;  2PQA A;  3PO2 B;  2F1M A;  4BBS B;  2E2J B;  1UEB A;  4JI0 L;  3TP8 A;  3AMU A;  2LKV A;  3T16 A;  1U4M A;  4DV6 L;  1HZA A;  4DA2 A;  1U9R A;  5EGT A;  5C3E H;  4PV1 C;  3IKJ A;  1K28 A;  1NNX A;  2MO0 A;  1N8R C;  3I70 A;  2N88 A;  5C3X A;  2MUY A;  3L9A X;  4IAL A;  3S1R B;  3KLS X;  3NE5 B;  3NUC A;  3V05 A;  1PV4 A;  1RF2 D;  4B3M Q;  2BOS A;  4FXG C;  4L8J A;  3CPF A;  4A3M B;  1NSN S;  2VY3 A;  3M7N A;  2F0O A;  1CKN A;  5M3F G;  1K8O A;  5LL6 X;  4X3U A;  2CQA A;  4XTC S;  4B3M L;  5FLM H;  1BDO A;  3CCM A;  3D8G A;  4I7Z C;  5FJ8 H;  4HAE A;  1VQM A;  3E5S A;  5C3E G;  1V43 A;  1VF7 A;  3T56 B;  2NVX H;  3ULJ A;  1SXT A;  2R93 B;  3U9O A;  4OIK A;  4CDC C;  2E2I B;  2NYZ D;  5CBA E;  3K5M A;  3E0E A;  3NEL A;  1FYC A;  4BXX H;  5EQ0 A;  1VQ7 A;  4JVZ A;  1Y14 B;  3TRE A;  1EWI A;  3BYY B;  3RN2 A;  5IY0 A;  3S14 H;  2F0D A;  3NXW A;  3GTK B;  2EDG A;  1FGU A;  1A6X A;  1EQV A;  1BBW A;  1WD1 A;  2JA7 H;  1AN8 A;  5FLM G;  2QDL A;  2BE5 C;  3QO2 A;  1EYD A;  1KAA A;  3LWU A;  5FJ8 G;  1V1Q A;  2RHQ B;  2MP1 A;  3NBI A;  2JA5 G;  1AEX A;  3HOX H;  2K03 A;  2D2C C;  4DAP A;  1CZG A;  2JSO A;  4FVM A;  5M5X B;  3T51 B;  3I4M H;  2ICI A;  2WKC A;  1ILQ A;  3K8A A;  2L11 A;  4LFB Q;  3D31 A;  4BXX G;  1EY5 A;  4HN7 A;  2L15 A;  5KNC A;  3S1M H;  4KN4 C;  2RSO A;  1G2T A;  4I7A A;  2TSS A;  5D3D A;  1EZ6 A;  4ZKC B;  3EN2 A;  4LFB L;  3J81 j;  1JR0 D;  4C2M H;  2JA7 G;  1QZH A;  5E4X A;  4ZYS A;  4EVO A;  1Y1W B;  1NR4 A;  4K2L A;  4KHP Q;  1R4Q B;  2BDO A;  1STH A;  3FKI G;  5BR8 Q;  3U58 A;  3S2D H;  4JC0 A;  4JI1 Q;  4DR6 Q;  2NTS A;  1S40 A;  3I4M G;  1PTO D;  3CCJ A;  4PMB A;  2K52 A;  1X3G A;  4BY1 H;  4KHP L;  3GTP B;  3OPO A;  3J81 i;  2Z6B A;  5BR8 L;  4LK1 C;  4NKL A;  1TQO A;  3AQQ A;  4JI1 L;  4DR6 L;  2RDF A;  4IUN A;  3R3O A;  2O2L D;  2A69 D;  1A15 A;  3A7A B;  3TS2 A;  4G7O C;  2CW0 D;  3HKS A;  1KAW A;  2JA6 H;  1Q46 A;  4BWG B;  5DNF A;  3I4L A;  5EKI A;  1GUO A;  1D5M C;  3HOV H;  2UXB Q;  4LF5 Q;  4BBR G;  3X3M A;  4O42 A;  5COY A;  2F0F A;  4C3H B;  2B3G A;  1BQQ T;  1MJE A;  1VMP A;  3HOW H;  3NEN A;  1QJO A;  3PIP 3;  4QF4 A;  4ILW A;  3NPP A;  4BY1 G;  1WTW A;  4MHE A;  1VQH A;  2UXB L;  4LF5 L;  1XMQ Q;  2EY2 A;  1BOS A;  1O80 A;  3UDG A;  5EAY A;  3PUW A;  3TN2 A;  3I91 A;  3Q0A A;  4EGV A;  3I73 A;  2N55 A;  1M1K C;  1XMQ L;  3OIQ A;  4KMU C;  5T1I A;  1V1O A;  3UDI A;  5C6A A;  1MKH A;  1IHZ A;  2JA8 H;  1PMR A;  2M00 A;  3S17 H;  1G51 A;  2EQS A;  3HOY H;  1YHA A;  2DNC A;  4KJN A;  3HOW G;  4A3B H;  3ZJY C;  3A56 A;  2UUC Q;  3CW2 C;  1LUZ A;  2Y0S G;  3Q6S A;  2H1E A;  4ZLT F;  2I07 B;  4ME3 A;  1B3Q A;  2B2Y C;  2R7Z H;  1SRU A;  2Y0S E;  1G6Z A;  4A3L H;  1SMX A;  3QOJ A;  3AFP A;  1WCM H;  1EIY B;  3CCU A;  4RAU C;  2VQE Q;  4J1M A;  2Z0S A;  2UUC L;  3UE1 A;  1YNX A;  3MXN B;  2Z6K C;  4LAA A;  4OO1 I;  2RKS A;  4HJ7 A;  3TZD A;  3HFZ B;  3VR6 A;  1K8G A;  1SMY C;  3W1G A;  2K75 A;  1JOO A;  5AFW A;  1H9S B;  2PMZ E;  2V4D A;  1LTA D;  4X64 Q;  2VQE L;  3CQZ H;  2JA8 G;  4JI8 Q;  1CHP D;  1D6E C;  1MSH A;  4FXK C;  1F9P A;  1WFQ A;  1PZJ D;  3DEO A;  1PH6 A;  3HOY G;  4B3R Q;  2R92 H;  2K33 A;  3H91 A;  2XNA C;  3J81 E;  2RDH A;  1KIX A;  4A3B G;  2FXQ A;  1EQT A;  4A3F B;  4LNQ A;  4X64 L;  2HQE A;  1LTB D;  2K28 A;  1QZG A;  2K5D A;  4MTK A;  4JI8 L;  2R7Z G;  1C0A A;  1UE5 A;  2GA4 B;  2PQE A;  4B3S Q;  4LF4 Q;  2XWB B;  3A5Z B;  3QJY A;  2B8F A;  4A3L G;  4BY7 H;  3O13 A;  4FP5 D;  4B3R L;  5FLX L;  3J80 E;  2B2Y A;  3C46 A;  4H7B A;  3KF8 A;  1VQB A;  3G6J B;  1YNN D;  4ZK9 B;  4DV2 Q;  4C3I B;  5I6Y A;  1YNJ D;  3CRK C;  4B3S L;  4LF4 L;  2Z6K A;  3WOF A;  5CYU A;  1A3V A;  1YHB A;  3OWF A;  1B7Y B;  1GUT A;  3MFY A;  3NTH A;  3VYR A;  4R4T A;  2L9H A;  2HT1 A;  3KF6 B;  2FMM A;  1SYC A;  2RCN A;  2YU9 H;  4DV2 L;  2KUM A;  1DOM A;  3EQL C;  3RZO B;  1ZKO A;  1K0R A;  1N34 Q;  1HQR D;  2NVT H;  1TWC H;  1E2W A;  1OXU A;  4DV5 Q;  1C4Q A;  1A8V A;  2F0P A;  2F03 A;  2VUM H;  3GTO B;  4YCU A;  1I50 B;  4BY7 G;  3PIO A;  1PYB A;  4C3J B;  3D6C A;  4IFD J;  3M4O H;  4AIM A;  1LV9 A;  3A0J A;  4A3E H;  3Q24 A;  4DAY A;  3MAQ A;  3B6Y A;  4OGQ C;  4KY5 A;  5IWA Q;  1N34 L;  4DV5 L;  1SYF A;  3TEH B;  2R61 A;  2ZTD A;  3CCV A;  2IL8 A;  3I56 A;  1BKB A;  3V2T A;  2NZ1 D;  5IWA L;  1Q82 C;  4IZ8 A;  1AZQ A;  1QNU A;  3H09 A;  5HGT A;  1CHQ D;  3F8T A;  3NK9 A;  1JWS D;  4X66 Q;  2F4V Q;  2E74 C;  1E22 A;  3S2H H;  2OXP A;  5HY6 A;  2B63 B;  4HSV A;  3VYT A;  3U50 C;  4CGY B;  3T1Y Q;  4A3E G;  3KDF B;  2L55 A;  3GTQ H;  4X66 L;  1UE1 A;  2F4V L;  4GNX C;  5EJW A;  2DNE A;  2NN6 H;  3BDO A;  2Z4I A;  1EY7 A;  4QGU A;  1ENA A;  1H9M A;  1IW7 D;  2HCC A;  2WB1 G;  1E1O A;  3T1Y L;  2OQK A;  1II3 A;  2WB1 E;  4EQ5 A;  2Z8L A;  3RZD H;  4A3J B;  2EXD A;  3G4S A;  3M4Q A;  1RHP A;  3I8Z A;  2OQ0 A;  1KL9 A;  5BN4 A;  1Q86 C;  1V1P B;  1K8M A;  4OWX B;  1TS3 A;  3W3A A;  1N33 Q;  1E2V A;  1KNE A;  2D9U A;  3TME A;  3BDL A;  1SEB D;  3GTL B;  4K5V A;  3HKZ B;  2N49 A;  1SBB B;  1JOQ A;  1SYG A;  3VYU A;  1WTH A;  1N33 L;  2D0O A;  3SVM A;  1EFW A;  4HJA A;  2NN6 G;  4FF4 A;  2CWA A;  4K2K A;  4GNX A;  4DN4 M;  4KN7 C;  4RGN A;  1EYG A;  3VR4 A;  1S3O A;  4N9P A;  1S5D D;  3SHL A;  1SE4 A;  1QB5 D;  5KYL A;  3U9S A;  1EY8 A;  2WAQ B;  1KAB A;  4P74 A;  2F3V A;  2X6G A;  4EQN A;  2SDF A;  1U4R A;  2EY5 A;  3K5N A;  4K6L A;  4CJ2 C;  2KHJ A;  2JXM B;  4UP7 A;  4Y7N H;  1XX8 A;  2O5J C;  1ILP A;  1V8Q A;  3U4Z A;  2OEO A;  2VXW A;  4DR2 Q;  5C0X I;  4R9W A;  4L5Q A;  5IT9 c;  3GTM B;  1S5F D;  1STN A;  1U4L A;  3CC4 A;  1A0I A;  5GAH C;  5G3L F;  2BDN A;  1S4Z A;  2DUD A;  4IUP A;  1PZI D;  4DFA A;  3QWN A;  4DNR B;  1KC8 C;  1NMF A;  1SYB A;  4MN3 A;  4DR2 L;  3SGI A;  2ES2 A;  3JAM L;  4GLX A;  1JE5 A;  2K4K A;  5KNB A;  3HG9 A;  3CXC A;  1C8C A;  1KDB A;  2PCF B;  1X3P A;  4ZUJ A;  5E3F A;  4PNY A;  1UE7 A;  2VS1 A;  1DM0 B;  2PNH A;  4IJL A;  1PYW D;  2KEC A;  2IW3 A;  5BN5 A;  1Y1V H;  3OSO A;  5ELB A;  4OL7 A;  2Q8R E;  3OHX C;  2BE5 D;  2QGQ A;  3HOZ G;  2K04 A;  2HHH Q;  2OCE A;  3E3X A;  4GN4 B;  4FXD A;  3GV6 A;  5JEA J;  4A3D H;  2J7Z A;  3E9I A;  1TWA B;  2KJX A;  2K7V A;  4IFD H;  1ICW A;  1G8Z D;  3TBI B;  4KKS A;  2Q2H A;  1CKO A;  1PFN A;  4RKL A;  1KLG D;  3M4P A;  5K5P A;  3L2P A;  2HHH L;  2R3Z A;  2R6G A;  1F9S A;  1W6J A;  1K8A C;  1ROD A;  2JQO A;  3IRB A;  4ULL A;  4KHZ A;  1Y1V G;  1PXU A;  3TDQ A;  4FNF A;  3CME A;  5C4H A;  3NWS A;  4F7X A;  3U4V A;  1ENC A;  3A54 A;  4HED A;  4L5T A;  4OEL B;  3T53 B;  4EX5 A;  1XNQ Q;  4A76 A;  5CV8 A;  2GVA A;  5GAG C;  2WII B;  4A3D G;  4N9T A;  5ELE A;  4R4C A;  1NTG A;  4IFD G;  1JJG A;  1DJR D;  1TWG H;  1PRT B;  4A3C H;  2KHI A;  4QL5 A;  4RGO S;  5C4Z A;  1XNQ L;  5CMD A;  3HOX B;  5E1F A;  2EE1 A;  1WVL A;  4A3K H;  1EY6 A;  1PTO H;  1D8L A;  1O7I A;  4KY7 A;  2B2T C;  2VZA A;  2ZXR A;  3BZC A;  1QVF A;  1TU2 B;  1EOV A;  3I4O A;  1GVP A;  3ERQ A;  3KBX A;  2EYF A;  2VL6 A;  3CP0 A;  3BS1 A;  1EWC A;  3DWQ A;  4IQZ A;  3S1Q H;  1DGS A;  1F9R A;  1BR9 A;  3MC0 B;  4IUR A;  2JJQ A;  5EPK A;  4CBV A;  1LT4 D;  4Q5V A;  4QUF A;  1WTV A;  3P1H A;  4DK0 A;  5TSS A;  4KJO A;  2K05 A;  4XYQ A;  5I9P A;  1A2U A;  1NAP A;  3WOE A;  4XT1 B;  1J9O A;  4A3C G;  1SN8 A;  1SJH D;  1STG A;  2OT2 A;  1O7Z A;  2EYJ A;  2OF1 A;  5IE8 A;  4A3K G;  5FK9 C;  1VQO A;  5JVG 3;  2BCO A;  2F0W A;  3MTS A;  3H3V H;  3RLN A;  2KOL A;  4BY1 B;  2YTX A;  4LFA Q;  4BS9 A;  4R4O A;  1XTD A;  2B2T A;  3S16 H;  3EJI A;  4V0B A;  1HTL D;  3OOC A;  4HTH A;  2QCP X;  1VQL A;  3HZX A;  3PGZ A;  3ND9 A;  2X6L A;  4K8I A;  4OIJ A;  4LFA L;  3PCO B;  2Q8I B;  4KHV A;  3SK8 A;  4HR7 B;  2F52 A;  3QG1 A;  1GJX A;  4BA2 I;  2L4N A;  2JA6 B;  4LW1 A;  3NWT A;  5IP9 H;  5C44 G;  1CA5 A;  4J8Q A;  1XNR Q;  2HD3 A;  4JPB W;  4G7Z C;  3BZD B;  4GN5 A;  4DK6 C;  3HOV B;  2PPB C;  1JOR A;  3E9H A;  5C4X H;  3CCE A;  2N3S A;  3SDZ A;  3VR3 A;  2E2H H;  4A93 H;  3F2D A;  3K0X A;  1Q81 C;  1I6V C;  1VQD A;  4RFB A;  1XNR L;  1OO9 B;  2A8V A;  2R7D A;  2JA5 H;  5G3L D;  1VS0 A;  1DXM A;  1T5X D;  3HOU B;  1SND A;  1SMY D;  3TP6 A;  1R9T B;  4RA8 A;  3S15 H;  1GHK A;  1LT5 D;  2KED A;  4NB3 A;  2PZU A;  1HPC A;  3D4R A;  5FLX c;  1TY0 A;  5IT9 L;  1D5X C;  1CTM A;  3A8I E;  2L12 A;  5JEA H;  5IP9 G;  4PMC A;  1PH8 A;  5L37 A;  1CT1 D;  4N8F A;  4X3S A;  4E6I A;  1W6K A;  5AJ3 Q;  1RDP D;  4CKB A;  1TS2 A;  1QVG A;  4A3G H;  1EIH A;  1EYA A;  1UEA B;  4H0L C;  3SEB A;  5C4X G;  2EYL A;  2QA4 A;  4A93 G;  3S1N H;  4A3B B;  3UDX A;  5M3M H;  1YHQ A;  3FKI H;  1TWF H;  2A19 A;  5ELN A;  1NUC A;  5AJ3 L;  3K0Y A;  1B9N A;  4TSS A;  2DY7 A;  1NMG A;  4KTA A;  1WCM B;  4HMI A;  1BO0 A;  1NE3 A;  4IPH A;  2FHT A;  1BCP B;  1L2F A;  4JBM A;  4AYB G;  1JB3 A;  1YJN A;  3DHQ A;  4BA1 I;  4AYB E;  1SJE D;  3Q8D A;  4IUT A;  5JEA G;  1CK1 A;  3CPW A;  1JIC A;  5FO8 B;  4O0A A;  3K81 C;  1EU3 A;  5C5L A;  4JW0 A;  1KNA A;  4A3G G;  1CM9 A;  4DR3 Q;  4KI0 A;  3D4D A;  5I9O A;  2R92 B;  4KLK A;  4HMJ A;  2HDL A;  1MBY A;  3TP7 A;  3N6R A;  2IY5 B;  5M3M G;  1BBX C;  1VQJ A;  3ONA B;  5JPM C;  3ULP A;  2CKZ B;  1B8A A;  4BBR H;  5E4W C;  1L0Y B;  2FMC A;  1LTT D;  4DR3 L;  4BY7 B;  2IHE A;  2SNM A;  1VQ9 A;  3KUP A;  1HH2 P;  3MHB A;  1LO5 D;  4RCO A;  1HNW Q;  2A5H A;  2J0T D;  1K83 H;  3HGB A;  5KGU A;  1EIG A;  1B4O A;  1HJP A;  2QIL A;  5GQO A;  3TSS A;  3J80 i;  2J4X A;  3I7F A;  3PO2 H;  1HRJ A;  3K58 A;  4NMZ A;  2E2J H;  4JBK A;  4NP5 A;  1Q1E A;  1HNW L;  4L63 B;  4R4Q A;  1IKM A;  1PFB A;  2LXJ A;  4HCE A;  1DYQ A;  1YIJ A;  1Z7T A;  5CR3 A;  2XIW A;  4LJZ C;  2WIN B;  1I6H B;  4LUO A;  2NVT B;  5A35 A;  2H5X A;  2MPM A;  3WWV A;  5M5Y B;  2VUM B;  1FNU A;  1H9R A;  1TS4 A;  1GD7 A;  2DN8 A;  4M8A A;  4WFN 3;  2ZTC A;  3M4O B;  1U5K A;  1TT2 A;  1SRO A;  3NBH B;  3ULL A;  1S5C D;  2LSS A;  1QWY A;  3F2C A;  3L3O C;  1Y8O B;  2CH4 A;  3EFX D;  3K5L A;  1A62 A;  5CV4 A;  5CV9 A;  3PO2 G;  1KD1 C;  3MEF A;  3PO3 B;  1IXR A;  5DAU A;  1QG7 A;  3UI2 A;  1IKL A;  2K14 A;  3E0J A;  3NEM A;  5LL6 S;  3VA7 A;  1L1O C;  2KHS A;  1STE A;  3F1Z A;  1HZC A;  4F88 A;  4OEM B;  2E5L Q;  4NXN Q;  3OW7 A;  1ET9 A;  2R93 H;  1LTR D;  1HZ9 A;  4X6A H;  2I5M X;  2NBF A;  4HIK A;  1JC7 A;  2F0H A;  1HFG A;  4ZUI A;  1SE8 A;  4PZ8 A;  4QJF A;  5FO9 B;  3MXN A;  4A3M G;  2E5L L;  4NXN L;  3GQB A;  3P75 A;  1HUM A;  4IN3 A;  5M9O A;  4JV5 Q;  1X55 A;  3DMU A;  4ZCK A;  5COR A;  3FMC A;  4FF3 A;  1JCK B;  1D1K A;  3VYS A;  1FJG Q;  2A73 B;  1WTQ A;  3GTK H;  1H9S A;  2PZT A;  4FO2 A;  5CV5 A;  2NN6 I;  1SLJ A;  3FP9 A;  3JAM c;  3RZD B;  4M1U B;  4JV5 L;  1TWH H;  2EYO A;  2KEE A;  4CDD C;  2P5Z X;  1FJG L;  1KQS A;  4U67 3;  3I55 A;  5BN3 A;  1SAP A;  5M5X H;  4XDX A;  1HR0 W;  1YBY A;  4I65 A;  2R93 G;  3GD7 A;  1Y69 U;  4OXP A;  2F0E A;  4XQQ A;  3K57 A;  5DEH A;  1ESR A;  2MO1 A;  1B3A A;  1L1O B;  4OHJ A;  2CQO A;  4DK3 C;  2YTY A;  1LYL A;  2DJG C;  3P20 A;  4RCN A;  3I4N B;  4UAI A;  4B9W A;  4JCV E;  1RCV D;  3GTG B;  3PUZ A;  2KCM A;  2SNS A;  5IOD A;  3KF6 A;  2M9V A;  1JE4 A;  2BH8 A;  5A2Q E;  1B53 A;  2HUG A;  1PVO A;  1E24 A;  2A6H C;  2K5Q A;  3KOJ A;  4KY6 A;  1C48 A;  5NUC A;  4WRD A;  3CC2 A;  1CA6 A;  1WD0 A;  2ZJP A;  2I5H A;  4FYD A;  1JJC B;  5C4J B;  4CJ1 B;  3GTP H;  2OTJ A;  3RUZ A;  3D4W A;  3BDC A;  3NTI A;  1PH4 A;  2A1A A;  3CCQ A;  3MWY W;  2RBM A;  1RKN A;  5I2X A;  3IFT A;  1EQR A;  5IP7 G;  1A3T A;  3T13 A;  3RNU A;  5IIF A;  1PDQ A;  3OYY A;  2KCC A;  2MQH A;  1FR3 A;  5D3I B;  2Q2T A;  1Y1W G;  1F2M A;  5H1S E;  1XMO Q;  4QIW B;  4WOR A;  3J7A V;  2I0Q A;  1RTN A;  1T5E A;  2EJF C;  2EXZ A;  2JEB I;  2ZTE A;  4R8I A;  3KLW A;  1V9P A;  4DR4 Q;  2NVY B;  4XT3 B;  1AH9 A;  1UAP A;  2QW7 A;  1AW7 A;  1XMO L;  2RVL A;  2F3W A;  2ZJR A;  1CQV A;  1Z6H A;  5KRU A;  3DEP A;  3A5U A;  4EQP A;  1LAC A;  5LMN W;  5C5M A;  1MSG A;  1ZYR C;  2ZXO A;  4JI5 Q;  3KDF A;  4DR4 L;  2QEJ C;  5DM7 3;  2FIN B;  2ASB A;  1E0B A;  2Q2I A;  4PZ7 A;  2SOB A;  3K5O A;  3NHH A;  2SEB D;  4ZKB B;  3QR8 A;  3H0G B;  4NDX A;  4IFD I;  1N36 Q;  2IPK D;  2F0Q A;  3ERS X;  4JI5 L;  3G71 A;  2VW9 A;  3OMC A;  3M9B A;  1XPO A;  2EJM A;  2G9H D;  3EVQ A;  3M3Y H;  3VA5 A;  1NR2 A;  1RL2 A;  4A3I B;  1U0L A;  1M8A A;  1DOK A;  1LTS D;  4KKU A;  1V1P A;  1N36 L;  4C3H G;  2ICE C;  1GHJ A;  1IL2 A;  1DCZ A;  3HS0 C;  2F0S A;  3PF5 A;  2HCI A;  1UWV A;  3VR5 A;  1I4H A;  1X56 A;  5CBE E;  4P71 A;  2A6E C;  4OO1 H;  1E7Z A;  5I4D A;  1SSO A;  3IFD A;  4N8X 1;  1I3Q B;  3ERO A;  1NJI C;  1TS5 A;  3QIA A;  1TWG B;  1KDA A;  1VCI A;  4KD3 A;  2R7F A;  4MNO A;  4RHS A;  1SFO B;  2D0P A;  1SYD A;  2Z1C A;  4DF7 A;  1A3U A;  4RGM A;  2MJ8 A;  1TR5 A;  4P75 A;  1XTC D;  1L0W A;  3GV3 A;  2IJ0 A;  4DGZ A;  2EJG C;  3J81 L;  2L5T A;  3BVZ A;  2B2U C;  3K7A H;  3SK5 A;  3SE0 A;  5C0X J;  4PG3 A;  4DV7 Q;  4RWS C;  4ID6 A;  3KK7 A;  1TII D;  3FPU B;  4K5X A;  2UU9 Q;  4KK7 A;  3R2T A;  1YJW A;  2NVQ B;  4ZQ3 A;  1WTP A;  1CKM A;  3AEV A;  3D3R A;  4OO1 G;  4V19 0;  4DUZ Q;  4LF7 Q;  2WP8 J;  3H6M A;  4LMQ D;  4DV7 L;  1WTX A;  1O78 A;  4OWT B;  4DNI A;  1O7Y A;  4LF8 Q;  2DJF C;  4QY7 A;  2UU9 L;  1K3R A;  1ESF A;  3MA2 B;  3R93 A;  4P72 A;  4DR5 Q;  3HOZ H;  1N32 Q;  5I6W A;  2PZW A;  3KBG A;  2EOT A;  1C9O A;  4C3I H;  5CC4 A;  1HA6 A;  1E2Z A;  2HIX A;  5M3F B;  1KTK A;  3TZU A;  4FF1 A;  3ICE A;  4DUZ L;  4LF7 L;  1SNM A;  1U4P A;  1Y8N B;  3MFG A;  4OWW B;  4LF8 L;  1Y8P B;  3AU7 A;  4NW2 A;  1F2L A;  3K7U C;  4DR5 L;  1N32 L;  2NTT A;  4CJ0 B;  2AWO A;  4JYA Q;  4DNT B;  5C3E B;  3TS0 A;  3H3V I;  2B2U A;  4NXM Q;  4A3F G;  4APV A;  4Q0F A;  3NTK A;  5IYD G;  2ZJQ A;  2K5H A;  2ZT9 C;  4JYA L;  1I50 H;  2KCT A;  3BG3 A;  1PRT C;  2PNR C;  4WJ3 M;  4C3J H;  1K9M C;  2A68 C;  3T4A C;  4NXM L;  1HUN A;  1JB7 A;  1VF5 C;  2GN5 A;  2YTV A;  2FFK B;  2BH2 A;  1QNK A;  1I4R A;  2X69 A;  4C3I G;  5FO7 B;  3S9W A;  5C4X B;  1X3F A;  1Q8K A;  2B2V C;  5EBC A;  2DY8 A;  1VQG A;  4A93 B;  1QCB D;  2AMC B;  1PZK D;  1J6Q A;  2G5D A;  2RF4 A;  3J7Y W;  2JA5 B;  1SE2 A;  1YEZ A;  1F77 A;  3H94 A;  2AKW B;  4YY3 Q;  3STB C;  1TY2 A;  3SK4 A;  2MNA A;  2NVX B;  4LUZ A;  5IGD A;  3MXG A;  1B44 D;  1LM0 A;  2K6A A;  1GUN A;  2EYH A;  2F0L A;  2RA4 A;  1SR3 A;  2XWJ B;  4YY3 L;  4G7H C;  1KRT A;  4C3J G;  2G9D A;  1VQ6 A;  3C3L A;  5IT9 E;  2B2W C;  1GOZ A;  3S14 B;  4O1N A;  2JYO A;  4RH6 A;  2JEA I;  3DUZ A;  2EY6 A;  2F0M A;  2TMP A;  4XYO A;  3RLO A;  4XXE A;  5ELC A;  2JA7 B;  4XQN A;  5IGC A;  4DXG A;  3SR1 A;  2F0G A;  4TRD A;  4DV1 Q;  2QKI C;  1WYD A;  1BUV T;  1B50 A;  3PIP A;  1DZ1 A;  2CVR A;  1EWH A;  4A3J H;  2PO4 A;  3FKI B;  3TQY A;  4X62 Q;  1UUP A;  4PMW A;  3I4M B;  2UUB Q;  1HNZ Q;  3EA6 A;  1GXD C;  4DV1 L;  3I3C A;  3RD4 A;  1LTL A;  3L0O A;  5KND A;  1OXX K;  2E76 C;  2ZM6 Q;  1AE3 A;  3BU2 A;  4X62 L;  4JI3 Q;  3W2D A;  2CFM A;  2KA7 A;  3GO5 A;  2UUB L;  2AHO B;  1P8L A;  1HNZ L;  3S1M B;  4RHR A;  4UDU C;  4S3S A;  3KJP A;  4HIM A;  4IUV A;  4NPS A;  3CC7 A;  5IYB H;  2ZM6 L;  4QQB X;  4C2M B;  2B2W A;  3PIO 3;  1EY0 A;  1LTI D;  4JI3 L;  1B70 B;  1HQM C;  1QUQ B;  4YWM A;  5C44 H;  1JJ2 A;  1IZ6 A;  1STA A;  4IO9 A;  4A3J G;  2EY1 A;  1HXY D;  4BBR B;  3K6O A;  2ID0 A;  2IT1 A;  3S2D B;  3D0F A;  2M2L A;  1X54 A;  3BVG A;  2RHS B;  2EYM A;  4KKT A;  5KIX A;  5ELO A;  1PFS A;  5EKK A;  3HKZ G;  1SDF A;  1UE6 A;  2L0C A;  1VQ4 A;  2O5I C;  3GTJ H;  1K83 B;  2VB2 X;  2KBN A;  3HKZ E;  1EUJ A;  1WOC A;  3RMH A;  1EEI D;  3S24 A;  3K59 A;  2KEN A;  2A74 C; 
#chains in the Genus database with same CATH homology
 2LXJ A;  3DLL A;  5IYB G;  1JMC A;  1YZ6 A;  3PSI A;  1YIJ A;  1K0R A;  1N34 Q;  1HNX Q;  2NVT H;  1TWC H;  3GTO H;  3I4N G;  1OXU A;  4DV5 Q;  1XJV A;  1A8V A;  2VUM H;  2PQA B;  4LUO A;  4YCU A;  4BY7 G;  2H5X A;  1PH9 A;  3PIO A;  1S72 A;  1TXY A;  3WWV A;  1PYB A;  2QEX A;  2F3I A;  4IFD J;  1Q1B A;  3M4O H;  2WAQ G;  4AIM A;  4A3E H;  3A0J A;  1GD7 A;  3L7Z C;  3B6Y A;  4POG A;  4DR7 Q;  4IPD A;  1N34 L;  5IWA Q;  1HNX L;  2ZTC A;  1U5K A;  2WAQ E;  1SRO A;  5C0X G;  4DV5 L;  3FHW A;  2I5L X;  3TEH B;  2ZTD A;  3NBH B;  3ULL A;  1PA6 A;  3CD6 A;  3A74 A;  2HQL A;  2LSS A;  4GKK Q;  3F2C A;  4YCW A;  3CCV A;  1A63 A;  2NVY H;  3I56 A;  1BKB A;  1IBM Q;  3T1H Q;  4DR7 L;  1A62 A;  1W2B A;  5IWA L;  1Q82 C;  3PO2 G;  1KD1 C;  1K73 C;  3MEF A;  4L5S A;  4AH6 A;  1IXR A;  1TWA H;  2EIF A;  2K14 A;  3F8T A;  3NEM A;  4GKK L;  1L1O C;  1CKN B;  1IBM L;  1H95 A;  3T1H L;  1ASZ A;  4X66 Q;  3F1Z A;  2F4V Q;  1HZC A;  2B63 H;  4MTN A;  3TRZ A;  5JJI A;  2XGT A;  3KFU A;  4X65 Q;  5IYC H;  4H02 A;  1E22 A;  2E5L Q;  4NXN Q;  5J3B A;  3S2H H;  5HY6 A;  3H0G H;  2R93 H;  3M85 A;  3U50 C;  1HZ9 A;  2YV5 A;  1VQP A;  4X6A H;  3T1Y Q;  4A3E G;  2I5M X;  3AYH B;  3KDF B;  5LMU Q;  2ALY B;  4HIK A;  2JK8 A;  3LGJ A;  1YI2 A;  3GTQ H;  2AWN A;  4X66 L;  5JJK A;  1UE1 A;  2F4V L;  4A3I H;  1SE8 A;  4PZ8 A;  4QJF A;  5DLQ E;  1E3P A;  4DPG A;  4GNX C;  3J7Z C;  4X65 L;  4A3M G;  2E5L L;  4NXN L;  5M5W H;  4QIW E;  4QGU A;  1PH5 A;  4JV5 Q;  1X55 A;  1RIP A;  2BA1 A;  2WB1 G;  5GAE C;  1HR0 Q;  4BBS H;  4TQU S;  4YCV A;  1E1O A;  3T1Y L;  4P73 A;  1FJG Q;  2C35 B;  1OXS C;  3CCR A;  5LMU L;  1PHJ A;  2OQK A;  2WB1 E;  4JI6 Q;  3GTK H;  4EQ5 A;  3RZD H;  4JI7 L;  2EXD A;  3G4S A;  2NN6 I;  3M4Q A;  1SLJ A;  4IOC A;  3FP9 A;  4IPG A;  1EIF A;  3JAM c;  2IX0 A;  1WJJ A;  2OQ0 A;  1KL9 A;  4JV5 L;  1Q86 C;  1TWH H;  1HR0 L;  4HID A;  4OWX B;  2WFW A;  1I3Q H;  3GTL H;  4DUY Q;  1N33 Q;  3W5O A;  1Q7Y C;  1KQS A;  1SFO H;  1FJG L;  2B63 G;  3I55 A;  4JI6 L;  4YWL A;  3PUV A;  2N8N A;  4JBW A;  2V1C C;  5IYC G;  5M5X H;  1HR0 W;  4GS3 A;  1YBY A;  5GAD C;  3H0G G;  4DV3 Q;  2R93 G;  2N49 A;  4LF6 Q;  2UXD Q;  3GD7 A;  4OXP A;  1QUQ A;  4B3T Q;  1PH3 A;  4GN3 B;  2YYZ A;  2MO1 A;  2NZH A;  1L1O B;  4DUY L;  1NY4 A;  2CQO A;  2PI2 A;  1N33 L;  4DK3 C;  2UUA Q;  4A3I G;  1VQA A;  2D0O A;  1EFW A;  1IYJ B;  2NN6 G;  1LYL A;  2YTY A;  4HJA A;  1X6O A;  2CWA A;  4A4I A;  4DV3 L;  1HZB A;  4GNX A;  3CCL A;  4LF6 L;  2UXD L;  3VDY A;  1EYG A;  4B3T L;  1S3O A;  4JCV E;  1OXV A;  1M90 C;  2HIV A;  3EBE A;  3CF5 A;  4FDB A;  3PUZ A;  1I94 Q;  2KCM A;  4LWC A;  1OTC A;  2NVQ H;  4OON A;  2UUA L;  3KF6 A;  4JI4 Q;  3ER0 A;  4DV4 Q;  2BH8 A;  4P74 A;  1PVO A;  1E24 A;  3KOJ A;  1Z47 A;  4JI0 Q;  1XPU A;  3CMA A;  3CC2 A;  1PYS B;  1I94 L;  2ZJP A;  2I5H A;  2KHJ A;  4UP7 A;  3I2Z A;  4Y7N H;  4LUV A;  3GTM H;  4DR2 Q;  3U4Z A;  3HOX G;  4DV6 Q;  4RG1 A;  5C0X I;  4JI4 L;  3KJO A;  5M3F H;  3JC6 6;  4JBJ A;  1JJC B;  3AFQ A;  4J15 A;  4L5Q A;  5IT9 c;  4DV4 L;  3CC4 A;  1YVC A;  1A0I A;  2PQA A;  3GTP H;  5GAH C;  4TVA B;  2OTJ A;  1UEB A;  4JI0 L;  2DUD A;  1PH4 A;  1X9N A;  4OX9 Q;  4ALP A;  1KC8 C;  2A1A A;  3CCQ A;  4GLA C;  1NMF A;  4DR2 L;  3SGI A;  2D62 A;  5IP7 G;  1EQR A;  4DV6 L;  2ES2 A;  1HZA A;  5E7N A;  5C3E H;  4GLX A;  1D7Q A;  1JE5 A;  2K4K A;  1VQ5 A;  3CXC A;  1PH2 A;  1MJC A;  2MO0 A;  3RNU A;  1N8R C;  1VQK A;  1CSP A;  3OYY A;  4OX9 L;  2MQH A;  3S1R H;  2Q2T A;  4GKJ Q;  2N78 A;  1UE7 A;  2VS1 A;  1Y1W G;  5LMN Q;  5H1S E;  4A3M H;  1CUK A;  1XMO Q;  1PV4 A;  2PNH A;  4IJL A;  4B3M Q;  1Y1V H;  3CPF A;  4IJH A;  2I0Q A;  1G6P A;  4GLV B;  2JEB I;  2VY3 A;  2ZTE A;  1VQF A;  2OWO A;  3M7N A;  3KLW A;  1V9P A;  1CKN A;  4DR4 Q;  1AH9 A;  4GKJ L;  2QGQ A;  2NZO A;  3HOZ G;  5M3F G;  4DAM A;  5LMN L;  4BBS G;  1X3E A;  1IBL Q;  2HHH Q;  1XMO L;  2OCE A;  4GN4 B;  3J81 c;  1J5E Q;  2ZJR A;  4XTC S;  5JEA J;  4B3M L;  4A3D H;  5FLM H;  3E9I A;  4HJ5 A;  3A5U A;  4DV0 Q;  4AQY Q;  3RN5 A;  4PZ6 A;  1AE2 A;  5LMN W;  3CCM A;  3JAM i;  1P16 A;  5FJ8 H;  4JI5 Q;  4GOP C;  3K80 C;  3KDF A;  1VQM A;  2Q2H A;  4DR4 L;  2BA0 A;  3HOU H;  1CKO A;  2JE6 I;  3M4P A;  3J80 c;  3L2P A;  5C3E G;  1R9T H;  1IBL L;  2HHH L;  2ASB A;  4WJ4 A;  4A75 A;  1J5E L;  2E2I H;  1V43 A;  2Q2I A;  4PZ7 A;  2R6G A;  2NVX H;  3ULJ A;  4AQY L;  4DV0 L;  1K8A C;  4IFD I;  2DGY A;  1N36 Q;  1WI5 A;  3ERS X;  4JI5 L;  3G71 A;  2VW9 A;  1XPO A;  3M9B A;  2JQO A;  3IRB A;  1VQ8 A;  3M3Y H;  3E0E A;  3NEL A;  2JA6 G;  1RL2 A;  4DR1 Q;  4BXX H;  4KHZ A;  2VNU D;  1U0L A;  1Y1V G;  1VQ7 A;  2VQF Q;  1Y14 B;  3TRE A;  1EWI A;  3PUY A;  3CME A;  1GM5 A;  4Y52 H;  3RN2 A;  5IY0 A;  1C7Y A;  3U4V A;  1N36 L;  3HOV G;  3UDF A;  3S14 H;  4JI2 Q;  1IL2 A;  1XPR A;  4L5T A;  3PF5 A;  1FGU A;  1UWV A;  4EX5 A;  1XNQ Q;  1BBW A;  4A76 A;  5GAG C;  2GVA A;  1X56 A;  4DR1 L;  5FLM G;  2JA7 H;  4YHH Q;  4P71 A;  4A3D G;  2VQF L;  1ASY A;  1E7Z A;  4R4C A;  1NTG A;  4IFD G;  1JJG A;  5FJ8 G;  1TWG H;  1V1Q A;  1L1O A;  4RMF A;  2RHQ B;  4JI2 L;  1NBW A;  3HOU G;  2JA5 G;  4A3C H;  1NJI C;  2CWP A;  2KHI A;  4QL5 A;  4XIG S;  3HOX H;  1VCI A;  2R7F A;  4MNO A;  4GOP A;  3I4M H;  1XNQ L;  2D0P A;  4YHH L;  4YWK A;  1BVS A;  1Q12 A;  4A3K H;  1X65 A;  1D8L A;  1O7I A;  1JT8 A;  3K8A A;  4UP8 A;  4P75 A;  2VZA A;  4LFB Q;  1L0W A;  4GOP B;  3BZC A;  2UXC Q;  3D31 A;  4HJ9 A;  1QVF A;  4BXX G;  1EOV A;  2K50 A;  5IP7 H;  3W1B A;  2L15 A;  3I4O A;  1GVP A;  4R1J A;  1YJ9 A;  3K7A H;  3S1M H;  2VL6 A;  3CP0 A;  5C0X J;  4PG3 A;  4DV7 Q;  3J7A 5;  2UU9 Q;  3EN2 A;  3S1Q H;  4POF A;  3J81 j;  1YJW A;  1Y1W H;  1DGS A;  2CCZ A;  4C2M H;  4LFB L;  4LF9 Q;  2UXC L;  3BJU A;  2JJQ A;  2JA7 G;  1QZH A;  1CKM A;  2GVB A;  3AEV A;  4OO1 G;  4DUZ Q;  4LF7 Q;  2WP8 J;  4DV7 L;  4KHP Q;  4LFC Q;  4HJ8 A;  1YIT A;  4OWT B;  4DNI A;  3FKI G;  5BR8 Q;  5HGQ A;  1SN8 A;  4QY7 A;  4LF8 Q;  2UU9 L;  3CCS A;  1K3R A;  4A3C G;  3U58 A;  3S2D H;  4JC0 A;  4P72 A;  1WCM G;  4JI1 Q;  4DR5 Q;  3HOZ H;  4LF9 L;  4DR6 Q;  1S40 A;  3I4M G;  1N32 Q;  1C9O A;  4C3I H;  5IE8 A;  3CCJ A;  4A3K G;  2HIX A;  1VQO A;  3ICE A;  4DUZ L;  4LF7 L;  3H15 A;  2K52 A;  1X3G A;  4BY1 H;  4KHP L;  4LFC L;  3H3V H;  2OTL A;  3J81 i;  2ATW A;  3RLN A;  5BR8 L;  4LF8 L;  4OWW B;  3KF8 B;  2YTX A;  4LFA Q;  3AQQ A;  3K7U C;  4JI1 L;  1FVI A;  4R4O A;  3STB D;  1XTD A;  1CSQ A;  4DR5 L;  4DR6 L;  3S16 H;  1N32 L;  2AWO A;  4JYA Q;  1VQL A;  3PGZ A;  3TS0 A;  3H3V I;  1VQN A;  4NXM Q;  1VQI A;  3TS2 A;  2R92 G;  4A3F G;  4APV A;  1EQQ A;  4LFA L;  3PCO B;  1FL0 A;  3HKS A;  1KAW A;  2JA6 H;  5IYD G;  2F52 A;  1Q46 A;  2K5H A;  2ZJQ A;  1BBU A;  1I6H H;  4BA2 I;  4MZ9 A;  1I50 H;  4JYA L;  4JI7 Q;  1GO3 E;  2KCT A;  4LW1 A;  4JG2 A;  5IP9 H;  4K0K Q;  5M5Y H;  1I5F A;  2K5V A;  4WJ3 M;  4C3J H;  1K9M C;  5C44 G;  3HOV H;  2UXB Q;  4C3H H;  1XNR Q;  1Z9F A;  2MFI A;  4BBR G;  4LF5 Q;  4NXM L;  1G29 1;  1JB7 A;  4GN5 A;  4DK6 C;  2GN5 A;  2YTV A;  2PI2 E;  2BH2 A;  2B3G A;  3E9H A;  5C4X H;  1MJE A;  3CCE A;  3HOW H;  2N3S A;  3NEN A;  3OTO Q;  2E2H H;  1T9H A;  3RR5 A;  3F2D A;  4A93 H;  3K0X A;  4BY1 G;  1X3F A;  1Q81 C;  1Q8K A;  4JOI C;  4K0K L;  1VQH A;  1VQG A;  1VQD A;  2UXB L;  1XNR L;  2AMC B;  4LF5 L;  1XMQ Q;  2A8V A;  2K5N A;  2R7D A;  2JA5 H;  1J6Q A;  3UDG A;  4DAY B;  5EAY A;  3PUW A;  1VS0 A;  2RF4 A;  3OTO L;  3PO3 H;  1YEZ A;  4YY3 Q;  2XTI A;  2AKW B;  3S15 H;  3STB C;  4UPA A;  3G6E A;  2MNA A;  5K36 G;  4NB3 A;  4LUZ A;  1M1K C;  4HIO A;  1XMQ L;  1IBK Q;  5FLX c;  1LM0 A;  1GKH A;  2LXK A;  4UY8 C;  3UDI A;  1MKH A;  1SR3 A;  5IP9 G;  4YY3 L;  2JA8 H;  1KRT A;  2VUM G;  1KXL A;  1PH8 A;  3S17 H;  1G51 A;  2EQS A;  3HOY H;  4O2D A;  1VQ6 A;  5AJ3 Q;  3OW2 A;  1YHA A;  1QVG A;  1IBK L;  4A3G H;  5C4X G;  3BZK A;  2JEA I;  3HOW G;  4A3B H;  3ZJY C;  2UUC Q;  3CW2 C;  2QA4 A;  4A93 G;  1LUZ A;  3RLO A;  2Y0S G;  3S1N H;  4UP9 A;  2IHF A;  4ME3 A;  1MIU A;  2R7Z H;  4DV1 Q;  3UDX A;  3RLF A;  1WYD A;  2Q2U A;  1SRU A;  5M3M H;  3PIP A;  2Y0S E;  3FKI H;  1YHQ A;  3PF4 A;  1TWF H;  2A19 A;  5ELN A;  4A3L H;  4JOI A;  5AJ3 L;  1SMX A;  3CAM A;  2JA9 A;  3AFP A;  1WCM H;  4A3J H;  1EIY B;  3CCU A;  1KRS A;  1NMG A;  3TQY A;  4X62 Q;  2VQE Q;  1PH1 A;  3PO3 G;  2Z0S A;  2UUC L;  3UE1 A;  1YNX A;  3MXN B;  2Z6K C;  4PMW A;  4OO1 I;  1NE3 A;  4HJ7 A;  3GDE A;  4IPH A;  2UUB Q;  1L2F A;  1HNZ Q;  1VQE A;  3F2B A;  4DV1 L;  4JBM A;  4AYB G;  1LTL A;  3L0O A;  3HFZ B;  1K8G A;  3W1G A;  1N9W A;  2K75 A;  1YJN A;  1OXX K;  2PMZ E;  1W3S A;  4BA1 I;  4AYB E;  2ZM6 Q;  1AE3 A;  3BU2 A;  4X62 L;  4X64 Q;  3CQZ H;  2VQE L;  3Q8D A;  1KHI A;  5JEA G;  4L5R C;  3CPW A;  4JI3 Q;  2JA8 G;  4JI8 Q;  2CFM A;  3EIV A;  3GO5 A;  4O0A A;  2AHO B;  1P8L A;  1HNZ L;  2UUB L;  4IPC A;  4DKA C;  3K81 C;  1WFQ A;  2E8G A;  1PH6 A;  3HOY G;  4B3R Q;  3UE0 A;  2R92 H;  4A3G G;  4A3F H;  4R4I A;  3KJP A;  4HIM A;  1KIX A;  4DR3 Q;  3CC7 A;  4NPS A;  4KI0 A;  2FXQ A;  3G48 A;  4A3B G;  5IYB H;  2ZM6 L;  5IYD H;  4KLK A;  4QQB X;  4LNQ A;  4X64 L;  1QVC A;  4JI3 L;  3I4N H;  1QZG A;  2IY5 B;  4JI8 L;  1B70 B;  2R7Z G;  1C0A A;  1UE5 A;  4B3S Q;  5M3M G;  4LF4 Q;  1VQJ A;  1QUQ B;  3A5Z B;  4YWM A;  5C44 H;  3ULP A;  2CKZ B;  1B8A A;  2IX1 A;  4A3L G;  4BBR H;  1JJ2 A;  3GTG H;  4BY7 H;  1IZ6 A;  3PUX A;  4B3R L;  4IO9 A;  4A3J G;  1VQB A;  4DR3 L;  5GRO A;  2IHE A;  2ID0 A;  2IT1 A;  1VQ9 A;  3D0F A;  4DV2 Q;  1HH2 P;  1X54 A;  4GNX B;  4B3S L;  4LF4 L;  2Z6K A;  1HNW Q;  2RHS B;  1VQC A;  1E1T A;  1YHB A;  1B7Y B;  1K83 H;  5ELO A;  1PH7 A;  1PFS A;  3HKZ G;  4R4T A;  2HT1 A;  1UE6 A;  3KF6 B;  1VQ4 A;  1HJP A;  3GTJ H;  5JJL A;  2RCN A;  4IOA A;  3PV0 A;  5GQO A;  2KBN A;  5C4J H;  3HKZ E;  2YU9 H;  3J80 i;  4DV2 L;  3I7F A;  3PO2 H;  1EUJ A;  3RZO H;  2E2J H;  4JBK A;  1WOC A;  3S24 A;  1Q1E A;  1HNW L;  4R4Q A;  1OXT A;  2KEN A;  3DM3 A;  2B29 A;  3KYH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...