1Z9FA

Crystal structure of single stranded dna-binding protein (tm0604) from thermotoga maritima at 2.60 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
109
structure length
89
Chain Sequence
HMSFFNKIILIGRLVRDPEERYTLTPVTTFTIAVDRTTDFFRIVTFGRLAEFARTYLTKGRLVLVEGEMRMRRKRVSPEVVANVVRFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-strand binding protein
publication title Crystal structure of a single-stranded DNA-binding protein (TM0604) from Thermotoga maritima at 2.60 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein
total genus 16
structure length 89
sequence length 109
ec nomenclature
pdb deposition date 2005-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1z9fA00
3HOXG 1EIFA 4JOIA 2E2JH 4DV2L 1CKOA 4GNXA 3KFUA 3TS2A 1Q1BA 1NBWA 4L5QA 2YTXA 1IL2A 5FLMH 2VQEQ 5BR8L 4AQYQ 2E5LL 3S17H 4QY7A 1QZHA 3I7FA 4B3MQ 1Q82C 1I94L 4JBWA 4A3FG 3J80c 4QQBX 4JI7L 5JEAG 1VQ9A 4DR2Q 5IE8A 3I4NH 3HOYH 1GD7A 3T1YQ 4A3KG 1EQQA 1Q86C 1JJCB 3I2ZA 1QVGA 2HHHL 2UU9Q 3E9HA 4JI6Q 3AEVA 1Y1VH 2WB1E 1S3OA 2JA9A 2I0QA 4DV3Q 5LMUQ 3PUVA 1EOVA 1SROA 3TREA 1ASYA 1VQMA 1Q46A 3PO3G 3OYYA 4A3GG 3D31A 4JI8Q 1UE1A 2JA7G 1VQBA 3NEMA 2AWNA 2HIVA 2IT1A 2N49A 3J81c 4B3RL 1KXLA 2N3SA 1VQAA 4X66Q 1TWHH 4PMWA 3FKIG 1X9NA 4A3JG 3A0JA 4X64Q 2VZAA 1IBLL 2PI2A 2ATWA 3GTQH 4NB3A 3PO2G 3F1ZA 4A4IA 4DV4Q 4A3CG 2MO1A 2ZM6Q 4O0AA 1QVFA 4AYBG 5C4JH 4NXML 2JQOA 1PYBA 2JA6G 2OCEA 1HNZL 2XGTA 2QGQA 5LMNW 1HZBA 4GLXA 1CKMA 3TEHB 5IT9c 2R7FA 3U50C 1NJIC 2E2IH 5M5WH 2WP8J 1PYSB 3UDGA 2VUMG 3GTPH 3GDEA 1D8LA 4DV2Q 4DR5L 4OO1I 4TVAB 1WCMH 1SFOH 2YTVA 4PZ6A 4XIGS 3CCMA 4A3LH 5IYBH 3H0GG 4IFDJ 5BR8Q 3JAMi 2K5VA 3RZDH 2E5LQ 1JJ2A 4P71A 4MZ9A 4BBSH 4A3BH 1I94Q 3AFQA 1C7YA 3CW2C 4JOIC 1BBWA 3VDYA 4GLVB 1HR0L 2NZHA 4JI7Q 1R9TH 2CCZA 1VQPA 2EQSA 2NZOA 2HHHQ 1KAWA 3JC66 1JE5A 1Q12A 5IP7G 4IFDG 3UDXA 2Q2TA 5E7NA 1XNRL 3L2PA 3F2BA 4B3TL 1N32L 4A3MG 5GAGC 1L1OC 1VQFA 1PH4A 4DV0L 2Y0SE 4JI2L 4BY7H 4BXXH 5C44G 3I4MG 4A3DH 3HKZG 4B3RQ 1VS0A 1YHAA 3M4PA 2R93G 1IBML 3A74A 1PH1A 1P16A 2JEBI 1IBLQ 4RMFA 3CCQA 2ZJPA 3PUZA 4A93H 3GTOH 2VS1A 4A3EH 3LGJA 2OWOA 1L2FA 3G6EA 4JCVE 2YU9H 1FVIA 1OXTA 3RLOA 3K0XA 3CCRA 3RLFA 2JA5H 4IPHA 4NXMQ 3S14H 2VQFQ 3H3VH 3J7ZC 2LSSA 4BBRG 1HNZQ 2PQAB 1SRUA 3KDFB 1GO3E 2ZTDA 3WWVA 1W2BA 3G4SA 3ICEA 4QJFA 3AFPA 1PV4A 3Q8DA 4R4IA 3CMEA 4DR5Q 4JBKA 2F3IA 1A8VA 2ZJRA 3NELA 2NVQH 4HJ8A 4DNIA 4JBJA 3J81j 2LXKA 1KQSA 1LUZA 3RNUA 1PH9A 1Y14B 5AJ3L 2B29A 4HIDA 1Q81C 1W3SA 4JI0L 3CC4A 4LNQA 3ERSX 4JC0A 2K14A 1SN8A 1HH2P 1X3GA 3TS0A 1HR0Q 1K0RA 2GN5A 2K50A 3ZJYC 3OTOL 1U0LA 3ULJA 1VQ5A 2WAQE 4ME3A 4JV5L 2IHEA 2FXQA 5DLQE 4JI5L 1HZ9A 1MIUA 3CMAA 1QUQB 1N8RC 1JMCA 4DAYB 5HGQA 1YIJA 1S72A 1XNRQ 4B3TQ 3CCSA 2PI2E 1LM0A 3W1BA 4DR3L 2PMZE 1TXYA 1UE7A 4JI2Q 3CCJA 2A8VA 4DV0Q 2UXBL 2MO0A 1EYGA 5M3MH 1CSQA 3J80i 5GAHC 2VW9A 3ULPA 3HOXH 1IBMQ 4BY1G 3IRBA 2CKZB 4IFDI 1RIPA 2F4VQ 2HIXA 4DK6C 2KHIA 3UE1A 4YWLA 5FJ8H 2KHJA 1L1OA 3GD7A 5FLMG 4PG3A 1CKNA 2JE6I 2RCNA 4GKKL 2K4KA 1JB7A 2HQLA 4A3IH 1B70B 3KF6A 1PA6A 2K75A 2CQOA 4A75A 3NBHB 2UUAL 5GADC 1YZ6A 4A3KH 4WJ4A 3J81i 1MKHA 2JA8H 5IYCG 1HZCA 3HOZG 1I6HH 2Q2HA 1LTLA 1Y1VG 5JJLA 2GVAA 1UWVA 1A0IA 4QGUA 2BA0A 2I5MX 3EN2A 3DLLA 2JEAI 4R4QA 2UXDL 3PO3H 5M5YH 1SE8A 2YTYA 4YCVA 2EXDA 2Q2UA 2UUCL 3S1NH 4A3GH 5AJ3Q 4IPCA 4TQUS 3F2DA 1E3PA 4JI0Q 2BH8A 3HFZB 3DM3A 4GOPC 5K36G 1AE3A 2IY5B 4POGA 2UUBL 1EFWA 3OTOQ 5IP9H 1UE5A 2VQFL 2LXJA 1BVSA 1Q8KA 1QZGA 2UXCL 1OTCA 3BJUA 4JV5Q 3HOWG 4OXPA 3PUXA 1M1KC 3PO2H 1X65A 4JI5Q 4B3SL 1HR0W 4A3CH 4X62L 4UPAA 1VCIA 1UEBA 1VQHA 3GTLH 4IJHA 3K7UC 5M3FG 2KENA 3L0OA 4DR3Q 2AWOA 3S1RH 2AMCB 4GKJL 2JA6H 2UXBQ 1V43A 4A3LG 1J5EL 4POFA 4LUZA 1I50H 1TWFH 3GTJH 1E24A 4LF6L 4NXNL 1E22A 1NMFA 3T1HL 2OTJA 3L7ZC 2R92G 1NE3A 2C35B 3ULLA 3G71A 4DUZL 4GNXB 3U58A 2VUMH 1UE6A 2KBNA 4JI1L 3CCEA 3EBEA 1LYLA 1WCMG 1KD1C 4GKKQ 3RN2A 5IYBG 4OX9L 2R7ZG 1JJGA 1TWCH 4HJAA 4BBSG 4A3BG 1HNXL 1PFSA 3M4QA 2WB1G 1VQKA 2UUAQ 1OXVA 1VQLA 2A19A 3K80C 4OWWB 2I5LX 2ZTCA 3CPWA 1YJNA 1N9WA 2ES2A 4DPGA 4JI3L 3S2HH 4GN4B 4AIMA 4JI4L 4P72A 5C4XH 2IX1A 5IYDH 5HY6A 1WOCA 1XPOA 1VQOA 1VQJA 4DUYL 2UXDQ 2K52A 5GROA 1P8LA 1KRSA 4IPGA 4HIMA 1PH6A 2UUCQ 4BXXG 1HZAA 5ELNA 2ALYB 2QA4A 1VQ6A 4YY3L 3I4MH 5FLXc 1GKHA 4A3DG 1XMQL 1N36L 4YCWA 1XPRA 2UUBQ 2E8GA 3PGZA 3PUYA 1CUKA 1OXSC 4LW1A 4HJ7A 3CP0A 2UXCQ 4ALPA 1IBKL 4FDBA 4A93G 3S15H 4GN5A 1S40A 4B3SQ 2H5XA 4MNOA 3FHWA 4GOPA 3CPFA 4X62Q 1K8GA 3CC2A 2I5HA 2NN6G 2CWAA 3S16H 3M4OH 1KHIA 2JA5G 1SR3A 4GKJQ 2NVTH 4DR1L 3MEFA 3STBD 1NMGA 4MTNA 4LUOA 1J5EQ 4KHPL 2R7DA 4QIWE 3UDFA 1A62A 3BZKA 4IOAA 1XMOL 2OQKA 3I4OA 2F4VL 4LF6Q 3T1HQ 1C9OA 4NXNQ 2MQHA 2IX0A 4P74A 4DUZQ 1Z9FA 2R6GA 3BU2A 4JI1Q 1C0AA 1G291 3CXCA 1Y1WG 1D7QA 4OX9Q 1VQEA 4L5SA 2YV5A 3BZCA 4LFBL 1TWGH 2OQ0A 4H02A 3GTGH 4PZ8A 2QEXA 4HJ9A 1HNXQ 1YNXA 3HOVH 4DAMA 2F52A 4LF5L 1X3FA 1FL0A 2Z6KC 4JI3Q 4DV1L 1G51A 5C3EH 3M7NA 3A5ZB 1PVOA 2CFMA 1YJWA 2VY3A 2B63H 4JI4Q 1KRTA 4OONA 3U4ZA 1K73C 2ZJQA 1PH2A 4KHZA 3HOUG 4AYBE 1M90C 3TRZA 3PV0A 4JYAL 4DUYQ 1GVPA 2K5HA 1VQDA 1N33L 2HT1A 4YY3Q 4DV5L 5M5XH 5M3MG 5GAEC 1YHQA 4LF4L 3SGIA 2Q2IA 4EX5A 1XMQQ 1N36Q 5C0XJ 4BY1H 4A3FH 4OWTB 1VQGA 2D62A 3KOJA 2PNHA 4YWKA 4C2MH 3I4NG 1XNQL 4K0KL 3MXNB 3D0FA 4O2DA 1EIYB 1IBKQ 3HOYG 5FJ8G 5ELOA 1YEZA 5JJIA 1VQIA 2VL6A 4UP8A 2E2HH 3E9IA 4A3IG 2ZTEA 3HKSA 1B8AA 3E0EA 2B3GA 1WI5A 3AYHB 3KYHC 2DGYA 4P75A 4DR1Q 5C0XG 2JJQA 1N34L 4KHPQ 2MNAA 1WYDA 1MJCA 4DV6L 2JA7H 1XMOQ 4LFAL 5IYCH 1DGSA 2N8NA 4GOPB 1E1TA 1I3QH 2EIFA 3KF8B 4YWMA 4LFCL 3K81C 4UP7A 2JA8G 3RZOH 3S1MH 4DR4L 2VNUD 1K8AC 3FKIH 3F2CA 2Z0SA 3HOZH 2NN6I 4A3JH 4R4TA 4KI0A 1PH3A 4LF8L 4HJ5A 3K8AA 1X54A 4LWCA 3H3VI 4BA2I 4C3IH 2WAQG 4JBMA 3G48A 3HKZE 4LFBQ 2BH2A 2RF4A 4RG1A 4DR7L 1Z47A 1ASZA 4KLKA 3S1QH 3U4VA 3A5UA 5IP9G 1OXXK 4LF5Q 1MJEA 4GS3A 3PF4A 3KJOA 3F8TA 1GM5A 3HOWH 4DV1Q 4C3JH 2PQAA 3KDFA 4LUVA 3B6YA 4DKAC 3I55A 4LF7L 3PCOB 3H15A 4OWXB 3PIOA 1NY4A 1T9HA 1VQ8A 2YYZA 4Y52H 1PH8A 1YI2A 1Q7YC 3PSIA 2NVYH 5M3FH 3CCUA 1Q1EA 4DV7L 1K9MC 1VQNA 4JYAQ 2XTIA 1U5KA 1SMXA 4HIOA 1N33Q 2ID0A 4L5RC 1IYJB 2Z6KA 3H0GH 4IPDA 4LF9L 1G6PA 4DV5Q 3CCLA 1WJJA 4LF4Q 3UE0A 1XTDA 4P73A 1X6OA 2V1CC 4J15A 1YHBA 2R92H 1RL2A 2MFIA 1BBUA 2D0PA 4IJLA 3KJPA 4HIKA 4K0KQ 1XNQQ 1L1OB 1CKNB 1I5FA 2R7ZH 4C3HH 2ASBA 3W1GA 1WFQA 2KCTA 1PH7A 5IP7H 2L15A 4R1JA 3KF6B 4APVA 1TWAH 3JAMc 3M85A 5LMNL 3PF5A 1YJ9A 1FJGL 4DR6L 1QUQA 1EWIA 4GNXC 4YHHL 4A3MH 1FGUA 2KCMA 2WFWA 1KL9A 3PUWA 1N34Q 1HNWL 4UY8C 3M3YH 3NENA 4DV6Q 4LFAQ 5C44H 1K3RA 2AKWB 4BY7G 5IWAL 4LFCQ 4BA1I 4X65L 1K83H 1J6QA 4DR4Q 3EIVA 1VQ7A 2R93H 1X3EA 1YITA 1JT8A 5C4XG 5IYDG 2N78A 5J3BA 1N32Q 4LF8Q 2NVXH 1AH9A 4A76A 2RHSB 5C0XI 2VQEL 1O7IA 1XJVA 4AQYL 1SLJA 4A3EG 1XPUA 4DR7Q 3TQYA 4WJ3M 1PHJA 3ER0A 4B3ML 2IHFA 5JJKA 3M9BA 1E1OA 4DR2L 4BBRH 1YVCA 1X56A 1NTGA 3AQQA 1CSPA 2RHQB 3T1YL 2AHOB 3S2DH 2UU9L 2JK8A 4LF7Q 3KLWA 3I56A 4JI6L 1E7ZA 1A63A 4UP9A 2GVBA 1B7YB 3RR5A 1VQCA 3W5OA 4DV7Q 4YCUA 1EUJA 1V1QA 1PH5A 1L0WA 4DV3L 5LMUL 3OW2A 4PZ7A 4LF9Q 2D0OA 3CQZH 3GO5A 4IO9A 1VQ4A 1X55A 3FP9A 4XTCS 1EQRA 4JI8L 4DK3C 3PIPA 4GLAC 1YBYA 1BKBA 1OXUA 4X66L 4EQ5A 3GTKH 1IXRA 4L5TA 1KIXA 4X64L 1Y1WH 2A1AA 3CF5A 5H1SE 1IZ6A 2OTLA 1KC8C 2DUDA 4R4CA 3S24A 1HJPA 3CD6A 2Y0SG 2BA1A 4NPSA 4GN3B 5EAYA 3CCVA 5LMNQ 4DV4L 3J7A5 3CC7A 3RN5A 3CAMA 1FJGQ 2ZM6L 4OO1G 4Y7NH 3HOVG 4DR6Q 4X6AH 1H95A 4JG2A 5GQOA 3GTMH 4YHHQ 2CWPA 4R4OA 1HNWQ 1V9PA 3STBC 4IOCA 1QVCA 1AE2A 5IY0A 4QL5A 5C3EG 4AH6A 5IWAQ 3RLNA 3K7AH 5JEAJ 4X65Q 2B63G 2K5NA 3UDIA 3HOUH
chains in the Genus database with same CATH superfamily
2Z1CA 1ENAA 1SNQA 2PZWA 3VA5A 4Q5VA 5BR8L 1U4PA 3CRLC 3D4RA 1QZHA 1QCBD 4I65A 4B3MQ 1H9MA 3SR1A 4JBWA 1SYDA 2EOTA 1S5ED 5IE8A 4BBRB 3HOYH 4ZAIA 3OWEB 2FINB 1EQQA 1QVGA 2UU9Q 4JI6Q 3OW7A 4FO2A 2MJ8A 2WIIB 4H7BA 4JVZA 4NMZA 4X3SA 1Q46A 5FO9B 4A3GG 2E2HB 1HTLD 1TQOA 2PCFB 1VQBA 4B3RL 1KXLA 5FOBB 2N3SA 4X66Q 3MXPA 3FKIG 2IX3A 4A3JG 4X64Q 1TIID 2ATWA 4L63B 2K32A 2F3WA 5KRUA 2QEJC 3PO2G 3F1ZA 4A4IA 1SNMA 4DV4Q 4O0AA 4Y7NB 3LWUA 3FPUB 2B8GA 4NXML 1DD2A 1EEFD 3OIQA 2OCEA 4RH6A 4UDUC 5ELEA 1HZBA 1CKMA 2WP8J 1D8LA 2MHVA 4TVAB 4YIJA 3CCMA 2B2UC 1B4OA 3JAMi 1JJ2A 1TKWB 1I94Q 2AQ1B 3CW2C 4H0LC 1B50A 1HR0L 3LWEA 3O13A 1R9TH 4UAIA 5I6YA 1IL8A 2CCZA 5CV7A 2A6ED 3NHHA 5IODA 1KAWA 1JE5A 4FF3A 1Q12A 3K5NA 4IFDG 4FXDA 3L2PA 4A3MG 2OXPA 3HRZC 4BXXH 1CZGA 3I4MG 4A3DH 3M4PA 3NUCA 2EY5A 3A74A 2A6HC 2K5DA 4ZKBB 3BVMA 1HA5A 3GTQB 3PUZA 4A93H 3GTOH 4A3EH 1L2FA 2EJGC 3OMCA 3J7AV 1FVIA 1J9OA 2GA4B 3RLFA 3H3VH 3SHLA 5I6WA 3RD4A 2LSSA 1S5DD 4ZUJA 4BBRG 1HNZQ 1STNA 1ZEQX 3ZYYX 5I4DA 5CBEE 4MTKA 5M5WB 2WV6D 4QJFA 4DR5Q 1WCMB 4HJ8A 4DNIA 2CH4A 4TSSA 1SFOB 2LXKA 5I2XA 2R7ZB 4C3HB 1BCPC 2Z4HA 5AJ3L 2B29A 3CU7A 4OIKA 1KLUD 3ERSX 2WB1B 3DEPA 1SN8A 1X3GA 3I91A 1U0LA 3VYTA 4WRDA 1VQ5A 1H9JA 2B2UA 4ME3A 4JV5L 1ET9A 5DLQE 1TT2A 2E2DC 1DOMA 4HTHA 1MIUA 3VA7A 1XNRQ 5HGQA 1S72A 3QG1A 1X3QA 2PI2E 2CHBD 3W1BA 2PMZE 1N32Q 2UXBL 3BVGA 4DV0Q 4N8FA 1EYGA 5DEHA 1CSQA 1WVLA 2VW9A 2XWJB 3HOXH 2F0HA 4FP5D 2RSOA 2XN9C 2HIXA 4DK6C 2HDMA 3IFTA 5FLMG 1CI3M 1CKNA 2JE6I 3C46A 3OPOA 4CJ2C 4A3IH 2KEEA 3KF6A 2CQOA 3NBHB 4ID6A 4OIJA 1Q8IA 1YZ6A 3OSOA 4CBVA 4ZLTF 1WTXA 3KLSA 1LTLA 4PNYA 1BF4A 4ULLA 2UXDL 4YCVA 3HFZB 3Q24A 1UAPA 2A5HA 4HSPA 1AE3A 2PW5A 4POGA 4IALA 1EFWA 3OTOQ 5C5MA 1Z7TA 3J81E 2LXJA 1K0SA 2B2TC 3OOCA 2Q8RE 3ND9A 3TP6A 1VF5C 1M1KC 4B3SL 1ET6A 1RKNA 2AUJD 1CQFA 4A3CH 4X62L 1B3QA 1S5BD 1T5EA 3K7UC 2AWOA 2JA6H 2RBMA 2F0UA 2EYHA 3HZXA 2HCCA 2IWHA 2FJ2A 4B9WA 1CK1A 3GTJH 4NXNL 3T1HL 2F0FA 4TKOB 2WKDA 2KBNA 3CCEA 3EBEA 3HOYB 1WCMG 4OGQC 1KD1C 1MI2A 2R7ZG 3GV6A 4C3HG 1JJGA 5FK9C 2OT2A 1EWCA 1WD0A 5F2DA 1WTQA 1DOKA 3M4QA 1F2ZA 2WB1G 1VQKA 2N88A 4QUCA 3K0YA 2RDGA 2I5LX 5E1FA 2ES2A 1PXUA 4KY7A 5CORA 4JI4L 1PZKD 2K5QA 5IYDH 1WOCA 3ITPA 2TSSA 5M5YB 2PNRC 3D6WA 4HIMA 1HZAA 2ALYB 3T16A 4P2CB 3IL8A 1GOZA 1XMQL 1I4QA 2E75C 2P5ZX 4JK1C 3CP0A 2UXCQ 3DM1A 4FF4A 1GHKA 1EYDA 1EY6A 3BZDB 4GN5A 4MNOA 3CPFA 3U9OA 1A3UA 4WORA 2NN6G 3M4OH 2RDFA 2NWGA 3MVVA 2B2TA 2WKCA 2NVTH 1YNJD 4MTNA 2Z4IA 4LUOA 3LX0A 4QIWE 1CQVA 2F0DA 3UDFA 4R8NA 1XMOL 2F4VL 2MQHA 2IX0A 3T4AC 1Z9FA 1ESRA 4JI1Q 1C0AA 1G291 3CXCA 1JWSD 5CMDA 1KDBA 3OWFA 5EGTA 1TWGH 2J0TD 4H02A 4IQZA 4IUTA 1SYEA 1XTCD 1D1KA 3FDTA 4RKBA 1FL0A 2MP1A 2Z6KC 3A5ZB 1YJWA 2VY3A 2B63H 4MHEA 4OONA 3U4ZA 1WTRA 1JCKB 1K73C 1PH2A 4KHZA 5C4XB 1M90C 3PV0A 4DUYQ 1GVPA 4FVMA 5DM73 1N33L 2QCPX 4YY3Q 4DV5L 1RDPD 4A3EB 4LF4L 4DAVA 4RFBA 2Q2IA 5C0XJ 4ABNA 2PNHA 2OEOA 4YWKA 1XNQL 3HOYG 3D0FA 5A2QL 2F0PA 2AUKA 2VL6A 2F0VA 3E9IA 3C1EA 3J7YW 3E0EA 2B3GA 1WI5A 4FYDA 4KHPQ 2MNAA 1L0XB 1MJCA 4LFAL 4GOPB 2EIFA 3K81C 4UP7A 4JW0A 4DR4L 1WTVA 3FKIH 3F2CA 4A3JH 4KI0A 2KVMA 5C3XA 4K8IA 4LF8L 4BA2I 1G91A 4LWCA 4G57A 5G3LD 2B8FA 4CKBA 2Y0SB 4LFBQ 1KABA 3I70A 1Z47A 3S1QH 3N6RA 3A5UA 2X69A 4LF5Q 4GS3A 3PF4A 2A74C 3RMHA 3KJOA 4KN7C 1GUTA 4DKAC 2LKVA 1QNKA 3MFGA 3PCOB 1TY2A 3PIOA 1T9HA 1BXTA 2RA4A 3HOXB 4Y52H 1IHZA 1PH8A 1RCVD 1K9MC 4JYAQ 2EJMA 2XTIA 3S17H 4A3LH 2Z6KA 4IPDA 4ZYSA 4LF9L 2IW3A 1WJJA 5M5XB 3UE0A 4P73A 2V1CC 3A8JE 1YHBA 2A6HD 4A3FB 4HIKA 4IJLA 4C2MB 4K0KQ 1CKNB 1I5FA 3QOJA 3W1GA 1PH7A 2FHTA 1MSHA 2L15A 3KF6B 4APVA 4IFDH 3KBXA 1FJGL 2LY7A 3E6ZX 1QUQA 4A3MH 1FGUA 3FRPB 2WFWA 1HNWL 4UY8C 1EY4A 3NENA 2ZXOA 4KKUA 1JC7A 1I3QB 3RZOB 1K83H 3S1MB 1J6QA 1HXYD 5C4XG 3I4LA 2F0QA 2NVXH 1GJXA 1BCPD 4C3IB 3X3NA 2VQEL 1O7IA 4AQYL 4K5WA 4A3EG 5J39A 1TVXA 3ER0A 2IHFA 2K33A 3M9BA 1E1OA 4BBRH 2JA6B 1YVCA 2PPBC 2M00A 3AQQA 1NTGA 1BCPB 1BUVT 2RHQB 1B44D 1FNVA 2RCFA 3GTJB 3FVQA 1C4QA 2GVBA 1VQCA 3W5OA 4YCUA 1V1QA 1PH5A 5LMUL 3OW2A 2IJ0A 4K14A 1VDZA 3NSWA 4PZ7A 2D0OA 4IO9A 2E2HH 1X55A 4XTCS 3HP3A 5KNCA 2ZXPA 4RAUC 3AMUA 4EQ5A 4R8IA 4L5TA 3GTKH 1IW7C 3IKJA 4R4CA 3S24A 1UEAB 1PTOD 2Y0SG 4NPSA 4GN3B 5LMNQ 4EGVA 3CC7A 3CAMA 4OO1G 4X6AH 4Y7NH 2NB0A 3G6JB 3STBC 4IOCA 5C44B 5IWAQ 3TP8A 1QE6A 3U4VA 5FKAC 2R93B 3HOUH 3HOXG 4JOIA 3D4DA 4X3TA 1EYCA 3KFUA 4DV2L 1CKOA 3TS2A 3P75A 5CV9A 5IT9L 5FLMH 1U9RA 1PYWD 2VB3X 4QY7A 4CDEC 5KYLA 3VR3A 4A3FG 3J80c 1I6VC 4DR2Q 2NVTB 4U673 1HQRD 5AFWA 3I73A 3S2DB 5D3DA 2HHHL 1TU2B 3E9HA 3AEVA 5DAUA 1S3OA 2PYKA 2K01A 3A7AB 2I0QA 4DV3Q 1SROA 5CV6A 1ASYA 1VQMA 1RF2D 4JI8Q 1G8ZD 3NEMA 2IT1A 2N49A 4NDXA 1EYAA 2QKIC 4PMWA 3A0JA 1Y1WB 3GTQH 4NB3A 5COYA 4C3IG 1MGSA 5G3LF 4A3CG 2ZM6Q 1B3AA 1QVFA 1STGA 5KGUA 3PIP3 1II3A 5EPJA 2JA6G 2XGTA 1MHWC 1EU4A 2OF1A 3U50C 1NJIC 2F0SA 5M5WH 1PYSB 5E4XA 2XSCA 3GTPH 3GDEA 2E2JB 1SNPA 2QW7A 3HS0C 1WCMH 1SFOH 4XIGS 1QOHA 1EY0A 4IFDJ 1HHVA 1UNSA 3DEOA 2E5LQ 4P71A 1F9PA 1C7YA 4JI7Q 4L8JA 1ENFA 2EQSA 4F87A 2RQXA 3SK5A 1Y1VB 1EIGA 5GAGC 4NKLA 1VQFA 1PH4A 4JI2L 2Y0SE 1ZKOA 5C44G 4Z9CB 1VS0A 4PV1C 3S1QB 4NW2A 2R93G 1PH1A 4R9WA 2B2VC 4CJ1B 1M8AA 1P16A 3H94A 5CGKA 3A8IE 1IBLQ 4RWSC 2ZT9C 2VS1A 2B63G 1NCVA 3LGJA 5T1IA 3G6EA 1E2VA 1BCPF 3Q6SA 4HCSA 4JCVE 2NN6H 3K59A 2YU9H 5C6AA 5C4JB 1K28A 1AP0A 3J7ZC 3WWVA 2E2IB 3G4SA 1C8CA 3MEHA 4EVOA 1R4QB 3AFPA 4HMJA 5IGEA 1PV4A 1A8VA 2NYZD 1A2UA 4EQNA 3Q0AA 2ZJRA 2EZVA 1K8OA 1LUZA 1NNXA 3RNUA 1RD9D 3IAYA 5CR3A 4BBSB 2EY1A 3BYTB 4JC0A 2K14A 1C48A 1EY5A 1ZXTA 3ULJA 5IGGA 3R93A 1PZID 4XQQA 1YNJC 3ONAB 3SK8A 3I90A 5TSSA 4JI5L 2JXMB 1K83B 2KHSA 3MWYW 3CKIB 4IN3A 1HZ9A 1QUQB 3QOLA 4B3TQ 4DR3L 2A8VA 2NVXB 1UE7A 2Z9HA 1SNCA 1O7YA 4U68A 4XT3B 1HA6A 5GAHC 3PMFA 1IBMQ 3HGBA 1ML0D 1RIPA 3MZ5A 4NP5A 3DMUA 2IPKD 2KHIA 3UE1A 3I8ZA 4PG3A 5ELDA 4GKKL 2FMCA 1DCZA 3ND8A 2JA5B 1TS2A 2B2VA 1A3TA 2K75A 2UUAL 4ZK9B 4WJ4A 4A3KH 4ME5A 3J81i 5ISRA 1I4RA 1MKHA 2A73B 1HZCA 5JJLA 2Q2HA 1Y1VG 4QGUA 4RGNA 2BA0A 2I5MX 3EN2A 3GTKB 1FNWA 4FXKC 3NWSA 3PO3H 2I46A 1SE8A 2YTYA 5M5YH 2EXDA 4MN3A 4WJWA 2Q2UA 5JVH3 4JI0Q 3N52A 2BH8A 3DM3A 4GOPC 4G4KA 5K36G 2IY5B 2UUBL 1J8IA 4E6IA 1QZGA 3BJUA 5FLXL 2CVRA 3VR2A 4OXPA 4X3KA 3HOUB 1VCIA 1VQHA 3GTLH 1DM0B 2ICEC 2KENA 3L0OA 1B9NA 2AMCB 4HN7A 1O78A 1EY8A 2SEBD 4A3LG 5M3MB 1I50H 1E22A 1NMFA 3L7ZC 4IUVA 1VMPA 4KN4C 5IYBG 4OX9L 4DXFA 4F88A 4HJAA 2G5DA 4BBSG 1HNXL 2QDBA 2F3VA 2K5WA 1JOQA 2R3ZA 1VQLA 3K80C 2ZTCA 5C3WA 1YJNA 4KV6A 1A3VA 4JI3L 3S2HH 4GN4B 2JA8B 1LO5D 3TN2A 1ONLA 2EYLA 3V2TA 5C4XH 4V190 1XPOA 4HR7B 2BDOA 3G7LA 3VR4A 3S1NB 1PH6A 2UUCQ 2WAQB 2F0LA 1EQVA 5BN5A 1N36L 1XPRA 2MGSA 3R2TA 1IW7D 2A68D 3DWPA 1F9RA 4FDBA 3V96A 3KLRA 4V0BA 3FHWA 4GOPA 1L0YB 5CC4A 3GTPB 2JA5G 2L12A 4GKJQ 4DGZA 3STBD 4DR1L 1G6ZA 1NMGA 1J5EQ 1TS5A 2R7DA 1A62A 3BZKA 4IOAA 2OQKA 1TWFB 4LF6Q 1NR2A 4DUZQ 3BG3A 1PRTC 2R6GA 3FMCA 4GZYC 3M7GA 1SYGA 1DOLA 1FD7D 3TDQA 1VQEA 3KK7A 1FGBD 4QCLA 2YV5A 2OQ0A 4DA2A 4PZ8A 2QEXA 3OHXC 4OO1H 1YNXA 4B9XA 2F52A 3QWNA 1A15A 1PMRA 2JN4A 1HCZA 4DV1L 1G51A 1LTGD 2CFMA 3QIAA 2DN8A 3U9SA 1KRTA 2ZJQA 3HOUG 1STAA 2E74C 2M2LA 1K8MA 3NE5B 2K5HA 3HG9A 2ICIA 5M5XH 5M3MG 1PTOC 4EX5A 4RCNA 2YU9B 4ZCKA 4A3FH 2WACA 2NTTA 2SNSA 3KOJA 3P20A 4C2MH 4O2DA 1EIYB 1IBKQ 1YEZA 1ZYRD 5JJIA 1VQIA 2IL8A 2L55A 3HKSA 3AYHB 5FO8B 2Q8IB 5KNBA 1N34L 1WYDA 4HAEA 1DGSA 2HDLA 1I3QH 1AW7A 4YWMA 1BNZA 2JA8G 3RZOH 2EE1A 3S1MH 5IGDA 3TSSA 2F4IA 1PH3A 3H3VI 3WOFA 4C3IH 1NUCA 1UUPA 2WAQG 4EQOA 3NTKA 3QR8A 2BH2A 3VYUA 4HSVA 4RG1A 3GTGB 4DR7L 1E0BA 3HOVB 2I07B 5CV8A 5IP9G 1MJEA 2PQAA 3KDFA 3NTIA 2YYZA 1Q7YC 3PSIA 3CCUA 4DV7L 1SJHD 1G6PA 2ID0A 1IYJB 1WD1A 1NSNS 4Q0FA 2G9HD 1ILQA 1LT3D 2D0PA 2J4XA 1LTBD 1HRJA 4A3KB 2ASBA 1H9SA 4K6DA 1WFQA 2DNEA 3JAMc 3M85A 4G7ZC 3PF5A 1JWUD 4RHSA 4DR6L 1Y8OB 1EWIA 4CHTB 2DY8A 4DXGA 4YHHL 4GNXC 3PO3B 2C9OA 4DV6Q 4F7XA 2JA7B 5C44H 1PTOH 4LFCQ 3EFXD 4X65L 5IGCA 2R93H 1YITA 4KK7A 5JVG3 2N78A 1KAAA 2F0WA 4XYQA 1LABA 5C0XI 1XJVA 2BDNA 2L9HA 4B08A 4WJ3M 3K58A 1PHJA 4B3ML 3GTLB 4AYBB 3S2DH 4C3JB 1I50B 2UU9L 2JK8A 4LF7Q 4JI6L 1A63A 1B7YB 3E3XA 1D5ZC 1S5CD 4C1NI 3H0GB 3GQBA 4DK3C 1EQRA 2K04A 1QWYA 2R92B 2FFKB 4X66L 3SVMA 1IXRA 4X64L 1Y1WH 2OTLA 3S2HB 3J81L 2CQAA 5EAYA 3J7A5 4DV4L 4IUNA 3S9WA 4RKLA 4X3UA 3HOVG 3FPPA 5LL6X 1GUOA 1LTAD 1QVCA 3TBIB 1STHA 3HKZB 3UDIA 1EIFA 4M8AA 2E2JH 4GNXA 1U4LA 3EROA 1Q1BA 4L5QA 4ZKCB 5EBDA 1D1IA 1I94L 1V1OA 5E3FA 1VQ9A 1GD7A 3T1YQ 4A3KG 1JJCB 3I2ZA 2L4NA 3JAML 1Y1VH 1SEBD 4IUQA 2WB1E 2EYPA 2KECA 5J1ZA 1Q3LA 3PUVA 3C1FA 3PO3G 3CQZB 2KJXA 4XXEA 3EJIA 2JA7G 1ICWA 2AWNA 3IFDA 5K36H 1LTTD 1VQAA 1TWHH 4OELB 3OMGA 1LT6D 4ILWA 1X9NA 2VZAA 2PI2A 3D6CA 1CFMA 3MA2B 1W6JA 2SOBA 4S3SA 4AYBG 5C4JH 4DK1A 1PYBA 1HNZL 5LMNW 4C3JG 3R3OA 5IT9c 2E2IH 1EIHA 3GP7A 2K6AA 4DR5L 1CHPD 2YTVA 5IYBH 3H0GG 5ELBA 5BR8Q 3RZDH 3BYYB 1HUMA 3H09A 4MZ9A 4BBSH 4JOIC 1BBWA 4UHVA 4GLVB 1VF7A 4KTAA 2MPMA 1EOTA 1VQPA 5NUCA 1SJED 2B2YC 2EPBA 3EQLC 3UDXA 2Q2TA 1XNRL 3BVZA 3F2BA 1N32L 1L1OC 4DV0L 1U4RA 3NBIA 3HKZG 4B3RQ 1YHAA 1AFPA 1PRTD 1JOOA 2TMPA 2JEBI 4RMFA 3MXNA 3K57A 2ZJPA 3DUZA 5EPKA 2OWOA 3J7AF 4QUFA 1PRTB 1OXTA 2JA5H 4NXMQ 5D3IB 2Q8TA 1FNUA 2PQAB 1SRUA 3KDFB 1FR3A 3TZDA 1W2BA 3ICEA 2D5DA 3KF8A 2F0MA 4R4IA 4ZQ3A 3T53B 2O5JC 4JBKA 1WTHA 2NVQH 3NELA 2F0TA 2A68C 5CBAE 4JBJA 3J81j 2LS01 1FYCA 1Y14B 1Q81C 4LNQA 4A3BB 3L3OC 3TS0A 1HR0Q 2ENBA 1K0RA 2GN5A 3OTOL 1TS4A 1XXGA 1H9SB 1PTOB 3QB3A 3K5MA 2B39A 1N8RC 2F0IA 1YIJA 5JOBA 1TXYA 3CCJA 2MO0A 5M3MH 4QF4A 5JPMC 3ULPA 2F0GA 2B2YA 4IFDI 2EXZA 4YWLA 5EKLA 2KHJA 1L1OA 3GD7A 5I9OA 2RCNA 1O7ZA 1BO0A 4PMBA 2K4KA 4RCOA 2HQLA 3NK9A 4OL7A 1PA6A 3S14B 5IOCA 3J80E 3X3MA 2NUCA 3F2UA 2JA8H 1I6HH 1Q90A 1UWVA 1A0IA 4WFN3 3DLLA 1F9QA 1SE2A 3S1NH 2HQEA 1LTSD 3K6OA 3R8BA 2EVBA 5AJ3Q 1E3PA 1SNOA 1SMYD 1ZYRC 4KJOA 3SDZA 1AZQA 2WINB 5IP9H 1UE5A 2VQFL 1BVSA 2UXCL 1WTPA 4JV5Q 3PUXA 4K5VA 1X65A 1E2ZA 5CV5A 2K05A 4UPAA 1UEBA 3S1RH 2HUGA 2UXBQ 1EL0A 2PO4A 3A56A 4POFA 4LUZA 2EJFC 1GUSA 1TWFH 1SAPA 1D2BA 2JSOA 2OTJA 3TP5A 5I9PA 3ULLA 3G71A 2VUMH 5HGTA 4GNXB 3V05A 1UE6A 2QF7A 4JI1L 4C1NK 2K1BA 1LYLA 5KEEA 1CZWA 1IYUA 1QG7A 3RN2A 2DY7A 1PLFA 5JAVA 4A3BG 1PFSA 5EJWA 2EYFA 4N9PA 1OXVA 4DNRB 4IURA 4OWWB 1N9WA 3MAQA 4DPGA 1YNND 5EQ0A 4PQXA 1TWHB 2IX1A 5HY6A 2RSNA 4DUYL 2UXDQ 1P8LA 1KRSA 4IUUA 4YY3L 1VQ6A 5FLXc 1GKHA 4YCWA 2E8GA 3PUYA 1QJOA 1OXSC 1SXTA 1PRTF 2PMZB 4FNFA 3MXGA 1S40A 4B3SQ 3SK4A 4X62Q 3CC2A 4RGTA 2I5HA 2FMMA 3S16H 1MD2D 1SR3A 4FF2A 1GUNA 3MEFA 4KHPL 1NAPA 2BOSA 3RZDB 2DJFC 3T1HQ 4NXNQ 4BS9A 4FXGC 3BU2A 2X6GA 1Y1WG 1CA5A 1ESFA 4M1UB 1DONA 1G2TA 3CRKC 4RGOS 4LFBL 3GTGH 1TWCB 4HJ9A 3MXUA 4KJNA 2PZTA 4N9TA 4O42A 1LT4D 1PTOF 1F2LA 3HOVH 4LF5L 3NXWA 3GV3A 1PVOA 4CJ0B 1DJRD 1HFGA 5D65A 4JI4Q 4RGMA 1AZPA 5K5PA 2B2WC 3TRZA 4JYAL 1RHPA 1QB5D 1VQDA 2HT1A 3M4YA 4QB4A 3SGIA 2NBFA 1XMQQ 5EPLA 2MUYA 4BY1H 1VQGA 2D62A 2XNAC 4K0KL 3D3RA 4DN4M 3MXNB 5FJ8G 3S15B 4UP8A 1B8AA 4P75A 2NVQB 1EWHA 2L0CA 1KNEA 2JJQA 3AB9A 2JA7H 1XMOQ 3SE0A 4XYOA 5IYCH 2F4VQ 1E1TA 1K3BC 3KF8B 3HOZH 2H4OA 2VNUD 2Z0SA 3C3LA 2NN6I 4R4TA 3SXHA 3H3VC 4HJ5A 3K8AA 5I2YA 4KKSA 3G48A 1EY7A 4JBMA 3I3CA 4EQPA 2VB2X 4KLKA 4K2LA 1GHJA 1JR0D 3HOWH 4C3JH 5C3EB 1ILPA 3B6YA 4XT1B 4OWXB 1NY4A 2O5IC 3WOEA 1STEA 5M3FH 1Q1EA 4HMIA 4HIOA 1X3PA 4L5RC 1N33Q 3H0GH 4DV5Q 3CCLA 4LF4Q 4LJZC 1XTDA 3VYRA 2HD3A 4J15A 1I4HA 2R92H 1RL2A 2B2WA 2MFIA 3KJPA 1EZ6A 1SDFA 1W6KA 3VR6A 1XNQQ 1L1OB 1JORA 3A54A 2H1EA 3KLSX 1S5FD 4QIWB 2KCTA 2J7ZA 5LMNL 1SE3A 1YJ9A 1I6HB 1TWAH 4DAYA 3PUWA 3VYSA 3M3YH 3OIPA 4LFAQ 5FO7B 1RTOA 5IWAL 4BA1I 3SEBA 4DR4Q 3EIVA 4J1MA 1VQ7A 1JT8A 5CV4A 2KUMA 3CHBD 2DJGC 4LF8Q 1H9KA 1AH9A 4CDDC 2RHSB 2D9UA 2EYJA 4KY6A 1XPUA 1SLJA 2E76C 1I4XA 3S1RB 2EYOA 2L5TA 2DNCA 4DR2L 5DM63 1R4PB 2AHOB 1X32A 3P7JA 1E7ZA 1AEXA 2VUMB 2NVYB 2BE5D 1L0WA 4DV3L 4LF9Q 3CQZH 3FP9A 4JI8L 1GUGA 3NP8A 3L9AX 1CHQD 4CKCA 3UI2A 4RHRA 3TP7A 1KIXA 1F2YA 3TMEA 5H1SE 1O7LA 1EQTA 2DUDA 3CD6A 1AN8A 2BA1A 2KCNA 2VXWA 3RN5A 1FJGQ 2ZM6L 4F8MA 1RJTA 4JG2A 1SYFA 5GQOA 3GTMH 3E0JA 4R4OA 1HNWQ 3A55A 1AE2A 5C3EG 1JWMD 1BOSA 3RLNA 1KTKA 1S4ZA 4CDFC 4TRDA 2R61A 2N55A 1NBWA 2YTXA 1IL2A 4XQJA 2VQEQ 3HEJA 4AQYQ 2E5LL 3FEWX 3I7FA 3MHBA 1Q82C 1CTMA 3S16B 4KD3A 4XQNA 1D5MC 4JI7L 4QQBX 5JEAG 3I4NH 2LMCB 1MSGA 2RDHA 1Q86C 5KNDA 1Z6HA 1KNAA 1V1PA 4DFAA 2JA9A 1D6EC 5C4HA 5LMUQ 5C0XH 1EOVA 3TREA 3OYYA 3D31A 1UE1A 2HIVA 3K5OA 3J81c 5JJZA 2AQ2B 3WDNA 5C4ZA 5E4WC 1IBLL 4DAPA 1B2TA 1XX8A 3MTSA 3NQIA 3DHQA 2MO1A 2O4XA 2RKSA 2XRSD 1BBXC 3ERQA 5M9OA 2JQOA 2V4DA 2QGQA 4GLXA 3TEHB 2M9VA 1SYCA 2R7FA 3K7AB 2KEDA 3EA6A 1SMYC 4I7AA 4BY1B 3UDGA 2VUMG 3W2DA 4DV2Q 2KOLA 4OO1I 1D5XC 4PZ6A 4G7HC 2K5VA 1SYBA 4A3BH 3AFQA 3I72A 3VDYA 2NZHA 3EVQA 1Y69U 5A2QE 2PZUA 2QILA 4ZRZA 5A35A 2NZOA 2HHHQ 3JC66 2EY2A 3BDLA 3HOZB 5IP7G 3H91A 4IZ8A 5E7NA 5IGBA 2Z8LA 3JAME 4B3TL 4HEDA 4DF7A 4BY7H 1IBML 2CW0C 1E2WA 3QO2A 1KDAA 3CCQA 4FF1A 3HOWB 4QMGA 2F03A 3A7LA 2Z6BA 3RLOA 1YNNC 3K0XA 3CCRA 5M3FB 4IPHA 3S14H 2VQFQ 2RVLA 3DWQA 1RODA 5L37A 1GO3E 1Y8PB 2ZTDA 3K5LA 4K2KA 1SE4A 3Q8DA 3CMEA 2SDFA 2F3IA 4CKEA 3PIO3 1XWEA 1HQMC 1V8QA 1KQSA 1PDQA 1PH9A 4KY5A 4HIDA 2F0NA 1G2SA 1W3SA 4JI0L 3CC4A 1TWAB 3AU7A 1A2TA 1HH2P 1KLGD 3BDCA 2K50A 1LLRD 3ZJYC 1R9TB 1WTWA 2WAQE 3M3YB 3URYA 1H9RA 2IHEA 2FXQA 3A8KE 3P1HA 2BCOA 1F9SA 3CMAA 1JMCA 4CDCC 4DAYB 4KHVA 2CH4W 3CCSA 1LM0A 5IIFA 1HUNA 4JI2Q 2SNMA 2KCCA 4A3DB 3J80i 2A69C 1F2MA 5DNFA 4BY1G 3IRBA 2CKZB 4CGYB 5KIXA 5FJ8H 4A93B 1LT5D 3GTOB 2LFNA 1JB7A 1B70B 1HPCA 4A75A 1GUWA 1T5XD 5GADC 5IYCG 3HOZG 1IKMA 2GVAA 5BN4A 1B9MA 2JEAI 2C5CA 4OEMB 4R4QA 5EBCA 4A3GH 2O2LD 2UUCL 4IPCA 4TQUS 3F2DA 1LTID 3RUZA 4J8QA 3GTMB 2EDGA 1Q8KA 4K6LA 1KDCA 1PZJD 3D8GA 1OTCA 2L11A 3HOWG 1BDOA 3PO2H 4JI5Q 1QNUA 1HR0W 3T51B 1CA6A 1LACA 4IJHA 1SBBB 5M3FG 4DR3Q 3D4WA 4MIUA 4GKJL 1V43A 1J5EL 4HCEA 1EU3A 1E24A 4LF6L 3NTHA 2R92G 3KUPA 1NE3A 2C35B 4DUZL 3U58A 5IT9E 4PMCA 3I4NB 1CM9A 2ZXRA 4K5XA 5JPNC 4GKKQ 4IUPA 1TWCH 2X6LA 4A3IB 5HURA 2NZ1D 2UUAQ 1U4MA 1TR5A 2A19A 2D2CC 1SNDA 3CPWA 2F0OA 1V1PB 5ELFA 4AIMA 1HFNA 4P72A 2K03A 1VQOA 1VQJA 2XIWA 2K52A 5GROA 1EFID 4IPGA 4BXXG 5ELNA 1B53A 2QA4A 3I4MH 1I4PA 5LHY1 4A3DG 2UUBQ 3PGZA 1CUKA 3E5SA 4LW1A 4HJ7A 3NPPA 4ALPA 1IBKL 4A93G 3S15H 2A6EC 2H5XA 3C2PA 1K8GA 2NTSA 2CWAA 2XRQD 1KHIA 1JQYD 3DXJC 3R2IA 5D14A 1ICFB 3I4OA 1C9OA 4P74A 1CT1D 3MC0B 2EY6A 1NR4A 1STYA 1M4VA 1D7QA 3T56B 4OX9Q 4L5SA 3BZCA 4XDXA 3SK6A 4LK1C 4KKTA 1HNXQ 1O80A 4DAMA 2F0EA 2BE5C 5J22A 1I4GA 1X3FA 4J6HA 1ENCA 4JI3Q 4BY7B 5C3EH 3M7NA 3DWAA 2G9DA 1DYQA 5CYUA 4G7OC 4AYBE 3TZUA 2KA7A 3T13A 4LMQD 5GAEC 1YHQA 2AQ3B 1N36Q 5BN3A 1JB3A 4H13C 4OWTB 4RA8A 5JEAH 3Q23A 4KD4A 3I4NG 2JYOA 3BS1A 4I7ZC 5ELOA 1EEID 1IKLA 3LNNA 1EZ8A 1STBA 1TY0A 3BDOA 4A3IG 1F77A 3M4OB 2ZTEA 1QILA 3KYHC 2DGYA 4DR1Q 5ELCA 5C0XG 3NWTA 1RTNA 1GXDC 4C56C 4DV6L 1B1ZA 2N8NA 4LFCL 1LV9A 5T1GA 1K8AC 5IGFA 1X54A 2F0JA 4OHJA 2QDLA 3HKZE 1TWGB 2RF4A 1JICA 1ASZA 3MFYA 2PW7A 1OXXK 2EYMA 4ZUIA 1GM5A 3F8TA 4DV1Q 4LAAA 2K7VA 4LUVA 2K28A 3I55A 4LF7L 2B63B 3H15A 1VQ8A 1YI2A 4BWGB 1DXMA 2NVYH 1VQNA 1U5KA 1SMXA 3NQTA 2L1BA 3Q22A 4ODGA 1PFMA 4N8X1 1X6OA 2CW0D 1DZ1A 1MBYA 1BBUA 2R7ZH 4C3HH 5IP7H 1SSOA 1A6XA 4R1JA 2KCMA 1KL9A 2F1MA 1N34Q 4A3GB 4O1NA 4BY7G 1EY9A 1K3RA 2AKWB 2HCIA 1X3EA 3FKIB 5IYDG 1Y8NB 5J3BA 4A3JB 3H6MA 4A76A 3KBGA 3PO2B 4L6TB 4K8JA 3QJYA 4DR7Q 3TQYA 5JJKA 1XYIA 5FLXE 1JOKA 3NBHA 1X56A 1CSPA 3T1YL 2XWBB 2PQEA 3KLWA 3I56A 1JE4A 3J80L 4UP9A 1BQQT 3RR5A 4DV7Q 3W3AA 1EUJA 1OO9B 4DK0A 5EKKA 3S17B 5LL6S 3GO5A 1VQ4A 3PIPA 4GLAC 5EKIA 1YBYA 1BKBA 2A69D 1OXUA 1WTOA 4DU9A 1IYVA 2F0KA 4DNTB 4JPBW 4H44C 1PFBA 2A1AA 3VR5A 1VMCA 3CF5A 2KQ3A 1IZ6A 1KC8C 1HJPA 1BR9A 1HTPA 3CCVA 1H95A 1TS3A 4DR6Q 5C5LA 4YHHQ 2CWPA 4A3MB 3PQIA 1V9PA 1LTRD 5IY0A 4QL5A 1PFNA 4AH6A 3I4MB 4KMUC 3K7AH 2XVSA 5JEAJ 4X65Q 2JP1A 2K5NA 5KYIA
chains in the Genus database with same CATH topology
3HOXG 1EIFA 4JOIA 2E2JH 4DV2L 1CKOA 4GNXA 3KFUA 3TS2A 1Q1BA 1NBWA 4L5QA 2YTXA 1IL2A 5FLMH 2VQEQ 5BR8L 4AQYQ 2E5LL 3S17H 4QY7A 1QZHA 3I7FA 4B3MQ 1Q82C 1I94L 4JBWA 4A3FG 3J80c 4QQBX 4JI7L 5JEAG 1VQ9A 4DR2Q 5IE8A 3I4NH 3HOYH 1GD7A 3T1YQ 4A3KG 1EQQA 1Q86C 1JJCB 3I2ZA 1QVGA 2HHHL 2UU9Q 3E9HA 4JI6Q 3AEVA 1Y1VH 2WB1E 1S3OA 2JA9A 2I0QA 4DV3Q 5LMUQ 3PUVA 1EOVA 1SROA 3TREA 1ASYA 1VQMA 1Q46A 3PO3G 3OYYA 4A3GG 3D31A 4JI8Q 1UE1A 2JA7G 1VQBA 3NEMA 2AWNA 2HIVA 2IT1A 2N49A 3J81c 4B3RL 1KXLA 2N3SA 1VQAA 4X66Q 1TWHH 4PMWA 3FKIG 1X9NA 4A3JG 3A0JA 4X64Q 2VZAA 1IBLL 2PI2A 2ATWA 3GTQH 4NB3A 3PO2G 3F1ZA 4A4IA 4DV4Q 4A3CG 2MO1A 2ZM6Q 4O0AA 1QVFA 4AYBG 5C4JH 4NXML 2JQOA 1PYBA 2JA6G 2OCEA 1HNZL 2XGTA 2QGQA 5LMNW 1HZBA 4GLXA 1CKMA 3TEHB 5IT9c 2R7FA 3U50C 1NJIC 2E2IH 5M5WH 2WP8J 1PYSB 3UDGA 2VUMG 3GTPH 3GDEA 1D8LA 4DV2Q 4DR5L 4OO1I 4TVAB 1WCMH 1SFOH 2YTVA 4PZ6A 4XIGS 3CCMA 4A3LH 5IYBH 3H0GG 4IFDJ 5BR8Q 3JAMi 2K5VA 3RZDH 2E5LQ 1JJ2A 4P71A 4MZ9A 4BBSH 4A3BH 1I94Q 3AFQA 1C7YA 3CW2C 4JOIC 1BBWA 3VDYA 4GLVB 1HR0L 2NZHA 4JI7Q 1R9TH 2CCZA 1VQPA 2EQSA 2NZOA 2HHHQ 1KAWA 3JC66 1JE5A 1Q12A 5IP7G 4IFDG 3UDXA 2Q2TA 5E7NA 1XNRL 3L2PA 3F2BA 4B3TL 1N32L 4A3MG 5GAGC 1L1OC 1VQFA 1PH4A 4DV0L 2Y0SE 4JI2L 4BY7H 4BXXH 5C44G 3I4MG 4A3DH 3HKZG 4B3RQ 1VS0A 1YHAA 3M4PA 2R93G 1IBML 3A74A 1PH1A 1P16A 2JEBI 1IBLQ 4RMFA 3CCQA 2ZJPA 3PUZA 4A93H 3GTOH 2VS1A 4A3EH 3LGJA 2OWOA 1L2FA 3G6EA 4JCVE 2YU9H 1FVIA 1OXTA 3RLOA 3K0XA 3CCRA 3RLFA 2JA5H 4IPHA 4NXMQ 3S14H 2VQFQ 3H3VH 3J7ZC 2LSSA 4BBRG 1HNZQ 2PQAB 1SRUA 3KDFB 1GO3E 2ZTDA 3WWVA 1W2BA 3G4SA 3ICEA 4QJFA 3AFPA 1PV4A 3Q8DA 4R4IA 3CMEA 4DR5Q 4JBKA 2F3IA 1A8VA 2ZJRA 3NELA 2NVQH 4HJ8A 4DNIA 4JBJA 3J81j 2LXKA 1KQSA 1LUZA 3RNUA 1PH9A 1Y14B 5AJ3L 2B29A 4HIDA 1Q81C 1W3SA 4JI0L 3CC4A 4LNQA 3ERSX 4JC0A 2K14A 1SN8A 1HH2P 1X3GA 3TS0A 1HR0Q 1K0RA 2GN5A 2K50A 3ZJYC 3OTOL 1U0LA 3ULJA 1VQ5A 2WAQE 4ME3A 4JV5L 2IHEA 2FXQA 5DLQE 4JI5L 1HZ9A 1MIUA 3CMAA 1QUQB 1N8RC 1JMCA 4DAYB 5HGQA 1YIJA 1S72A 1XNRQ 4B3TQ 3CCSA 2PI2E 1LM0A 3W1BA 4DR3L 2PMZE 1TXYA 1UE7A 4JI2Q 3CCJA 2A8VA 4DV0Q 2UXBL 2MO0A 1EYGA 5M3MH 1CSQA 3J80i 5GAHC 2VW9A 3ULPA 3HOXH 1IBMQ 4BY1G 3IRBA 2CKZB 4IFDI 1RIPA 2F4VQ 2HIXA 4DK6C 2KHIA 3UE1A 4YWLA 5FJ8H 2KHJA 1L1OA 3GD7A 5FLMG 4PG3A 1CKNA 2JE6I 2RCNA 4GKKL 2K4KA 1JB7A 2HQLA 4A3IH 1B70B 3KF6A 1PA6A 2K75A 2CQOA 4A75A 3NBHB 2UUAL 5GADC 1YZ6A 4A3KH 4WJ4A 3J81i 1MKHA 2JA8H 5IYCG 1HZCA 3HOZG 1I6HH 2Q2HA 1LTLA 1Y1VG 5JJLA 2GVAA 1UWVA 1A0IA 4QGUA 2BA0A 2I5MX 3EN2A 3DLLA 2JEAI 4R4QA 2UXDL 3PO3H 5M5YH 1SE8A 2YTYA 4YCVA 2EXDA 2Q2UA 2UUCL 3S1NH 4A3GH 5AJ3Q 4IPCA 4TQUS 3F2DA 1E3PA 4JI0Q 2BH8A 3HFZB 3DM3A 4GOPC 5K36G 1AE3A 2IY5B 4POGA 2UUBL 1EFWA 3OTOQ 5IP9H 1UE5A 2VQFL 2LXJA 1BVSA 1Q8KA 1QZGA 2UXCL 1OTCA 3BJUA 4JV5Q 3HOWG 4OXPA 3PUXA 1M1KC 3PO2H 1X65A 4JI5Q 4B3SL 1HR0W 4A3CH 4X62L 4UPAA 1VCIA 1UEBA 1VQHA 3GTLH 4IJHA 3K7UC 5M3FG 2KENA 3L0OA 4DR3Q 2AWOA 3S1RH 2AMCB 4GKJL 2JA6H 2UXBQ 1V43A 4A3LG 1J5EL 4POFA 4LUZA 1I50H 1TWFH 3GTJH 1E24A 4LF6L 4NXNL 1E22A 1NMFA 3T1HL 2OTJA 3L7ZC 2R92G 1NE3A 2C35B 3ULLA 3G71A 4DUZL 4GNXB 3U58A 2VUMH 1UE6A 2KBNA 4JI1L 3CCEA 3EBEA 1LYLA 1WCMG 1KD1C 4GKKQ 3RN2A 5IYBG 4OX9L 2R7ZG 1JJGA 1TWCH 4HJAA 4BBSG 4A3BG 1HNXL 1PFSA 3M4QA 2WB1G 1VQKA 2UUAQ 1OXVA 1VQLA 2A19A 3K80C 4OWWB 2I5LX 2ZTCA 3CPWA 1YJNA 1N9WA 2ES2A 4DPGA 4JI3L 3S2HH 4GN4B 4AIMA 4JI4L 4P72A 5C4XH 2IX1A 5IYDH 5HY6A 1WOCA 1XPOA 1VQOA 1VQJA 4DUYL 2UXDQ 2K52A 5GROA 1P8LA 1KRSA 4IPGA 4HIMA 1PH6A 2UUCQ 4BXXG 1HZAA 5ELNA 2ALYB 2QA4A 1VQ6A 4YY3L 3I4MH 5FLXc 1GKHA 4A3DG 1XMQL 1N36L 4YCWA 1XPRA 2UUBQ 2E8GA 3PGZA 3PUYA 1CUKA 1OXSC 4LW1A 4HJ7A 3CP0A 2UXCQ 4ALPA 1IBKL 4FDBA 4A93G 3S15H 4GN5A 1S40A 4B3SQ 2H5XA 4MNOA 3FHWA 4GOPA 3CPFA 4X62Q 1K8GA 3CC2A 2I5HA 2NN6G 2CWAA 3S16H 3M4OH 1KHIA 2JA5G 1SR3A 4GKJQ 2NVTH 4DR1L 3MEFA 3STBD 1NMGA 4MTNA 4LUOA 1J5EQ 4KHPL 2R7DA 4QIWE 3UDFA 1A62A 3BZKA 4IOAA 1XMOL 2OQKA 3I4OA 2F4VL 4LF6Q 3T1HQ 1C9OA 4NXNQ 2MQHA 2IX0A 4P74A 4DUZQ 1Z9FA 2R6GA 3BU2A 4JI1Q 1C0AA 1G291 3CXCA 1Y1WG 1D7QA 4OX9Q 1VQEA 4L5SA 2YV5A 3BZCA 4LFBL 1TWGH 2OQ0A 4H02A 3GTGH 4PZ8A 2QEXA 4HJ9A 1HNXQ 1YNXA 3HOVH 4DAMA 2F52A 4LF5L 1X3FA 1FL0A 2Z6KC 4JI3Q 4DV1L 1G51A 5C3EH 3M7NA 3A5ZB 1PVOA 2CFMA 1YJWA 2VY3A 2B63H 4JI4Q 1KRTA 4OONA 3U4ZA 1K73C 2ZJQA 1PH2A 4KHZA 3HOUG 4AYBE 1M90C 3TRZA 3PV0A 4JYAL 4DUYQ 1GVPA 2K5HA 1VQDA 1N33L 2HT1A 4YY3Q 4DV5L 5M5XH 5M3MG 5GAEC 1YHQA 4LF4L 3SGIA 2Q2IA 4EX5A 1XMQQ 1N36Q 5C0XJ 4BY1H 4A3FH 4OWTB 1VQGA 2D62A 3KOJA 2PNHA 4YWKA 4C2MH 3I4NG 1XNQL 4K0KL 3MXNB 3D0FA 4O2DA 1EIYB 1IBKQ 3HOYG 5FJ8G 5ELOA 1YEZA 5JJIA 1VQIA 2VL6A 4UP8A 2E2HH 3E9IA 4A3IG 2ZTEA 3HKSA 1B8AA 3E0EA 2B3GA 1WI5A 3AYHB 3KYHC 2DGYA 4P75A 4DR1Q 5C0XG 2JJQA 1N34L 4KHPQ 2MNAA 1WYDA 1MJCA 4DV6L 2JA7H 1XMOQ 4LFAL 5IYCH 1DGSA 2N8NA 4GOPB 1E1TA 1I3QH 2EIFA 3KF8B 4YWMA 4LFCL 3K81C 4UP7A 2JA8G 3RZOH 3S1MH 4DR4L 2VNUD 1K8AC 3FKIH 3F2CA 2Z0SA 3HOZH 2NN6I 4A3JH 4R4TA 4KI0A 1PH3A 4LF8L 4HJ5A 3K8AA 1X54A 4LWCA 3H3VI 4BA2I 4C3IH 2WAQG 4JBMA 3G48A 3HKZE 4LFBQ 2BH2A 2RF4A 4RG1A 4DR7L 1Z47A 1ASZA 4KLKA 3S1QH 3U4VA 3A5UA 5IP9G 1OXXK 4LF5Q 1MJEA 4GS3A 3PF4A 3KJOA 3F8TA 1GM5A 3HOWH 4DV1Q 4C3JH 2PQAA 3KDFA 4LUVA 3B6YA 4DKAC 3I55A 4LF7L 3PCOB 3H15A 4OWXB 3PIOA 1NY4A 1T9HA 1VQ8A 2YYZA 4Y52H 1PH8A 1YI2A 1Q7YC 3PSIA 2NVYH 5M3FH 3CCUA 1Q1EA 4DV7L 1K9MC 1VQNA 4JYAQ 2XTIA 1U5KA 1SMXA 4HIOA 1N33Q 2ID0A 4L5RC 1IYJB 2Z6KA 3H0GH 4IPDA 4LF9L 1G6PA 4DV5Q 3CCLA 1WJJA 4LF4Q 3UE0A 1XTDA 4P73A 1X6OA 2V1CC 4J15A 1YHBA 2R92H 1RL2A 2MFIA 1BBUA 2D0PA 4IJLA 3KJPA 4HIKA 4K0KQ 1XNQQ 1L1OB 1CKNB 1I5FA 2R7ZH 4C3HH 2ASBA 3W1GA 1WFQA 2KCTA 1PH7A 5IP7H 2L15A 4R1JA 3KF6B 4APVA 1TWAH 3JAMc 3M85A 5LMNL 3PF5A 1YJ9A 1FJGL 4DR6L 1QUQA 1EWIA 4GNXC 4YHHL 4A3MH 1FGUA 2KCMA 2WFWA 1KL9A 3PUWA 1N34Q 1HNWL 4UY8C 3M3YH 3NENA 4DV6Q 4LFAQ 5C44H 1K3RA 2AKWB 4BY7G 5IWAL 4LFCQ 4BA1I 4X65L 1K83H 1J6QA 4DR4Q 3EIVA 1VQ7A 2R93H 1X3EA 1YITA 1JT8A 5C4XG 5IYDG 2N78A 5J3BA 1N32Q 4LF8Q 2NVXH 1AH9A 4A76A 2RHSB 5C0XI 2VQEL 1O7IA 1XJVA 4AQYL 1SLJA 4A3EG 1XPUA 4DR7Q 3TQYA 4WJ3M 1PHJA 3ER0A 4B3ML 2IHFA 5JJKA 3M9BA 1E1OA 4DR2L 4BBRH 1YVCA 1X56A 1NTGA 3AQQA 1CSPA 2RHQB 3T1YL 2AHOB 3S2DH 2UU9L 2JK8A 4LF7Q 3KLWA 3I56A 4JI6L 1E7ZA 1A63A 4UP9A 2GVBA 1B7YB 3RR5A 1VQCA 3W5OA 4DV7Q 4YCUA 1EUJA 1V1QA 1PH5A 1L0WA 4DV3L 5LMUL 3OW2A 4PZ7A 4LF9Q 2D0OA 3CQZH 3GO5A 4IO9A 1VQ4A 1X55A 3FP9A 4XTCS 1EQRA 4JI8L 4DK3C 3PIPA 4GLAC 1YBYA 1BKBA 1OXUA 4X66L 4EQ5A 3GTKH 1IXRA 4L5TA 1KIXA 4X64L 1Y1WH 2A1AA 3CF5A 5H1SE 1IZ6A 2OTLA 1KC8C 2DUDA 4R4CA 3S24A 1HJPA 3CD6A 2Y0SG 2BA1A 4NPSA 4GN3B 5EAYA 3CCVA 5LMNQ 4DV4L 3J7A5 3CC7A 3RN5A 3CAMA 1FJGQ 2ZM6L 4OO1G 4Y7NH 3HOVG 4DR6Q 4X6AH 1H95A 4JG2A 5GQOA 3GTMH 4YHHQ 2CWPA 4R4OA 1HNWQ 1V9PA 3STBC 4IOCA 1QVCA 1AE2A 5IY0A 4QL5A 5C3EG 4AH6A 5IWAQ 3RLNA 3K7AH 5JEAJ 4X65Q 2B63G 2K5NA 3UDIA 3HOUH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HOX G;  1EIF A;  4JOI A;  2E2J H;  4DV2 L;  1CKO A;  4GNX A;  3KFU A;  3TS2 A;  1Q1B A;  1NBW A;  4L5Q A;  2YTX A;  1IL2 A;  5FLM H;  2VQE Q;  5BR8 L;  4AQY Q;  2E5L L;  3S17 H;  4QY7 A;  1QZH A;  3I7F A;  4B3M Q;  1Q82 C;  1I94 L;  4JBW A;  4A3F G;  3J80 c;  4QQB X;  4JI7 L;  5JEA G;  1VQ9 A;  4DR2 Q;  5IE8 A;  3I4N H;  3HOY H;  1GD7 A;  3T1Y Q;  4A3K G;  1EQQ A;  1Q86 C;  1JJC B;  3I2Z A;  1QVG A;  2HHH L;  2UU9 Q;  3E9H A;  4JI6 Q;  3AEV A;  1Y1V H;  2WB1 E;  1S3O A;  2JA9 A;  2I0Q A;  4DV3 Q;  5LMU Q;  3PUV A;  1EOV A;  1SRO A;  3TRE A;  1ASY A;  1VQM A;  1Q46 A;  3PO3 G;  3OYY A;  4A3G G;  3D31 A;  4JI8 Q;  1UE1 A;  2JA7 G;  1VQB A;  3NEM A;  2AWN A;  2HIV A;  2IT1 A;  2N49 A;  3J81 c;  4B3R L;  1KXL A;  2N3S A;  1VQA A;  4X66 Q;  1TWH H;  4PMW A;  3FKI G;  1X9N A;  4A3J G;  3A0J A;  4X64 Q;  2VZA A;  1IBL L;  2PI2 A;  2ATW A;  3GTQ H;  4NB3 A;  3PO2 G;  3F1Z A;  4A4I A;  4DV4 Q;  4A3C G;  2MO1 A;  2ZM6 Q;  4O0A A;  1QVF A;  4AYB G;  5C4J H;  4NXM L;  2JQO A;  1PYB A;  2JA6 G;  2OCE A;  1HNZ L;  2XGT A;  2QGQ A;  5LMN W;  1HZB A;  4GLX A;  1CKM A;  3TEH B;  5IT9 c;  2R7F A;  3U50 C;  1NJI C;  2E2I H;  5M5W H;  2WP8 J;  1PYS B;  3UDG A;  2VUM G;  3GTP H;  3GDE A;  1D8L A;  4DV2 Q;  4DR5 L;  4OO1 I;  4TVA B;  1WCM H;  1SFO H;  2YTV A;  4PZ6 A;  4XIG S;  3CCM A;  4A3L H;  5IYB H;  3H0G G;  4IFD J;  5BR8 Q;  3JAM i;  2K5V A;  3RZD H;  2E5L Q;  1JJ2 A;  4P71 A;  4MZ9 A;  4BBS H;  4A3B H;  1I94 Q;  3AFQ A;  1C7Y A;  3CW2 C;  4JOI C;  1BBW A;  3VDY A;  4GLV B;  1HR0 L;  2NZH A;  4JI7 Q;  1R9T H;  2CCZ A;  1VQP A;  2EQS A;  2NZO A;  2HHH Q;  1KAW A;  3JC6 6;  1JE5 A;  1Q12 A;  5IP7 G;  4IFD G;  3UDX A;  2Q2T A;  5E7N A;  1XNR L;  3L2P A;  3F2B A;  4B3T L;  1N32 L;  4A3M G;  5GAG C;  1L1O C;  1VQF A;  1PH4 A;  4DV0 L;  2Y0S E;  4JI2 L;  4BY7 H;  4BXX H;  5C44 G;  3I4M G;  4A3D H;  3HKZ G;  4B3R Q;  1VS0 A;  1YHA A;  3M4P A;  2R93 G;  1IBM L;  3A74 A;  1PH1 A;  1P16 A;  2JEB I;  1IBL Q;  4RMF A;  3CCQ A;  2ZJP A;  3PUZ A;  4A93 H;  3GTO H;  2VS1 A;  4A3E H;  3LGJ A;  2OWO A;  1L2F A;  3G6E A;  4JCV E;  2YU9 H;  1FVI A;  1OXT A;  3RLO A;  3K0X A;  3CCR A;  3RLF A;  2JA5 H;  4IPH A;  4NXM Q;  3S14 H;  2VQF Q;  3H3V H;  3J7Z C;  2LSS A;  4BBR G;  1HNZ Q;  2PQA B;  1SRU A;  3KDF B;  1GO3 E;  2ZTD A;  3WWV A;  1W2B A;  3G4S A;  3ICE A;  4QJF A;  3AFP A;  1PV4 A;  3Q8D A;  4R4I A;  3CME A;  4DR5 Q;  4JBK A;  2F3I A;  1A8V A;  2ZJR A;  3NEL A;  2NVQ H;  4HJ8 A;  4DNI A;  4JBJ A;  3J81 j;  2LXK A;  1KQS A;  1LUZ A;  3RNU A;  1PH9 A;  1Y14 B;  5AJ3 L;  2B29 A;  4HID A;  1Q81 C;  1W3S A;  4JI0 L;  3CC4 A;  4LNQ A;  3ERS X;  4JC0 A;  2K14 A;  1SN8 A;  1HH2 P;  1X3G A;  3TS0 A;  1HR0 Q;  1K0R A;  2GN5 A;  2K50 A;  3ZJY C;  3OTO L;  1U0L A;  3ULJ A;  1VQ5 A;  2WAQ E;  4ME3 A;  4JV5 L;  2IHE A;  2FXQ A;  5DLQ E;  4JI5 L;  1HZ9 A;  1MIU A;  3CMA A;  1QUQ B;  1N8R C;  1JMC A;  4DAY B;  5HGQ A;  1YIJ A;  1S72 A;  1XNR Q;  4B3T Q;  3CCS A;  2PI2 E;  1LM0 A;  3W1B A;  4DR3 L;  2PMZ E;  1TXY A;  1UE7 A;  4JI2 Q;  3CCJ A;  2A8V A;  4DV0 Q;  2UXB L;  2MO0 A;  1EYG A;  5M3M H;  1CSQ A;  3J80 i;  5GAH C;  2VW9 A;  3ULP A;  3HOX H;  1IBM Q;  4BY1 G;  3IRB A;  2CKZ B;  4IFD I;  1RIP A;  2F4V Q;  2HIX A;  4DK6 C;  2KHI A;  3UE1 A;  4YWL A;  5FJ8 H;  2KHJ A;  1L1O A;  3GD7 A;  5FLM G;  4PG3 A;  1CKN A;  2JE6 I;  2RCN A;  4GKK L;  2K4K A;  1JB7 A;  2HQL A;  4A3I H;  1B70 B;  3KF6 A;  1PA6 A;  2K75 A;  2CQO A;  4A75 A;  3NBH B;  2UUA L;  5GAD C;  1YZ6 A;  4A3K H;  4WJ4 A;  3J81 i;  1MKH A;  2JA8 H;  5IYC G;  1HZC A;  3HOZ G;  1I6H H;  2Q2H A;  1LTL A;  1Y1V G;  5JJL A;  2GVA A;  1UWV A;  1A0I A;  4QGU A;  2BA0 A;  2I5M X;  3EN2 A;  3DLL A;  2JEA I;  4R4Q A;  2UXD L;  3PO3 H;  5M5Y H;  1SE8 A;  2YTY A;  4YCV A;  2EXD A;  2Q2U A;  2UUC L;  3S1N H;  4A3G H;  5AJ3 Q;  4IPC A;  4TQU S;  3F2D A;  1E3P A;  4JI0 Q;  2BH8 A;  3HFZ B;  3DM3 A;  4GOP C;  5K36 G;  1AE3 A;  2IY5 B;  4POG A;  2UUB L;  1EFW A;  3OTO Q;  5IP9 H;  1UE5 A;  2VQF L;  2LXJ A;  1BVS A;  1Q8K A;  1QZG A;  2UXC L;  1OTC A;  3BJU A;  4JV5 Q;  3HOW G;  4OXP A;  3PUX A;  1M1K C;  3PO2 H;  1X65 A;  4JI5 Q;  4B3S L;  1HR0 W;  4A3C H;  4X62 L;  4UPA A;  1VCI A;  1UEB A;  1VQH A;  3GTL H;  4IJH A;  3K7U C;  5M3F G;  2KEN A;  3L0O A;  4DR3 Q;  2AWO A;  3S1R H;  2AMC B;  4GKJ L;  2JA6 H;  2UXB Q;  1V43 A;  4A3L G;  1J5E L;  4POF A;  4LUZ A;  1I50 H;  1TWF H;  3GTJ H;  1E24 A;  4LF6 L;  4NXN L;  1E22 A;  1NMF A;  3T1H L;  2OTJ A;  3L7Z C;  2R92 G;  1NE3 A;  2C35 B;  3ULL A;  3G71 A;  4DUZ L;  4GNX B;  3U58 A;  2VUM H;  1UE6 A;  2KBN A;  4JI1 L;  3CCE A;  3EBE A;  1LYL A;  1WCM G;  1KD1 C;  4GKK Q;  3RN2 A;  5IYB G;  4OX9 L;  2R7Z G;  1JJG A;  1TWC H;  4HJA A;  4BBS G;  4A3B G;  1HNX L;  1PFS A;  3M4Q A;  2WB1 G;  1VQK A;  2UUA Q;  1OXV A;  1VQL A;  2A19 A;  3K80 C;  4OWW B;  2I5L X;  2ZTC A;  3CPW A;  1YJN A;  1N9W A;  2ES2 A;  4DPG A;  4JI3 L;  3S2H H;  4GN4 B;  4AIM A;  4JI4 L;  4P72 A;  5C4X H;  2IX1 A;  5IYD H;  5HY6 A;  1WOC A;  1XPO A;  1VQO A;  1VQJ A;  4DUY L;  2UXD Q;  2K52 A;  5GRO A;  1P8L A;  1KRS A;  4IPG A;  4HIM A;  1PH6 A;  2UUC Q;  4BXX G;  1HZA A;  5ELN A;  2ALY B;  2QA4 A;  1VQ6 A;  4YY3 L;  3I4M H;  5FLX c;  1GKH A;  4A3D G;  1XMQ L;  1N36 L;  4YCW A;  1XPR A;  2UUB Q;  2E8G A;  3PGZ A;  3PUY A;  1CUK A;  1OXS C;  4LW1 A;  4HJ7 A;  3CP0 A;  2UXC Q;  4ALP A;  1IBK L;  4FDB A;  4A93 G;  3S15 H;  4GN5 A;  1S40 A;  4B3S Q;  2H5X A;  4MNO A;  3FHW A;  4GOP A;  3CPF A;  4X62 Q;  1K8G A;  3CC2 A;  2I5H A;  2NN6 G;  2CWA A;  3S16 H;  3M4O H;  1KHI A;  2JA5 G;  1SR3 A;  4GKJ Q;  2NVT H;  4DR1 L;  3MEF A;  3STB D;  1NMG A;  4MTN A;  4LUO A;  1J5E Q;  4KHP L;  2R7D A;  4QIW E;  3UDF A;  1A62 A;  3BZK A;  4IOA A;  1XMO L;  2OQK A;  3I4O A;  2F4V L;  4LF6 Q;  3T1H Q;  1C9O A;  4NXN Q;  2MQH A;  2IX0 A;  4P74 A;  4DUZ Q;  1Z9F A;  2R6G A;  3BU2 A;  4JI1 Q;  1C0A A;  1G29 1;  3CXC A;  1Y1W G;  1D7Q A;  4OX9 Q;  1VQE A;  4L5S A;  2YV5 A;  3BZC A;  4LFB L;  1TWG H;  2OQ0 A;  4H02 A;  3GTG H;  4PZ8 A;  2QEX A;  4HJ9 A;  1HNX Q;  1YNX A;  3HOV H;  4DAM A;  2F52 A;  4LF5 L;  1X3F A;  1FL0 A;  2Z6K C;  4JI3 Q;  4DV1 L;  1G51 A;  5C3E H;  3M7N A;  3A5Z B;  1PVO A;  2CFM A;  1YJW A;  2VY3 A;  2B63 H;  4JI4 Q;  1KRT A;  4OON A;  3U4Z A;  1K73 C;  2ZJQ A;  1PH2 A;  4KHZ A;  3HOU G;  4AYB E;  1M90 C;  3TRZ A;  3PV0 A;  4JYA L;  4DUY Q;  1GVP A;  2K5H A;  1VQD A;  1N33 L;  2HT1 A;  4YY3 Q;  4DV5 L;  5M5X H;  5M3M G;  5GAE C;  1YHQ A;  4LF4 L;  3SGI A;  2Q2I A;  4EX5 A;  1XMQ Q;  1N36 Q;  5C0X J;  4BY1 H;  4A3F H;  4OWT B;  1VQG A;  2D62 A;  3KOJ A;  2PNH A;  4YWK A;  4C2M H;  3I4N G;  1XNQ L;  4K0K L;  3MXN B;  3D0F A;  4O2D A;  1EIY B;  1IBK Q;  3HOY G;  5FJ8 G;  5ELO A;  1YEZ A;  5JJI A;  1VQI A;  2VL6 A;  4UP8 A;  2E2H H;  3E9I A;  4A3I G;  2ZTE A;  3HKS A;  1B8A A;  3E0E A;  2B3G A;  1WI5 A;  3AYH B;  3KYH C;  2DGY A;  4P75 A;  4DR1 Q;  5C0X G;  2JJQ A;  1N34 L;  4KHP Q;  2MNA A;  1WYD A;  1MJC A;  4DV6 L;  2JA7 H;  1XMO Q;  4LFA L;  5IYC H;  1DGS A;  2N8N A;  4GOP B;  1E1T A;  1I3Q H;  2EIF A;  3KF8 B;  4YWM A;  4LFC L;  3K81 C;  4UP7 A;  2JA8 G;  3RZO H;  3S1M H;  4DR4 L;  2VNU D;  1K8A C;  3FKI H;  3F2C A;  2Z0S A;  3HOZ H;  2NN6 I;  4A3J H;  4R4T A;  4KI0 A;  1PH3 A;  4LF8 L;  4HJ5 A;  3K8A A;  1X54 A;  4LWC A;  3H3V I;  4BA2 I;  4C3I H;  2WAQ G;  4JBM A;  3G48 A;  3HKZ E;  4LFB Q;  2BH2 A;  2RF4 A;  4RG1 A;  4DR7 L;  1Z47 A;  1ASZ A;  4KLK A;  3S1Q H;  3U4V A;  3A5U A;  5IP9 G;  1OXX K;  4LF5 Q;  1MJE A;  4GS3 A;  3PF4 A;  3KJO A;  3F8T A;  1GM5 A;  3HOW H;  4DV1 Q;  4C3J H;  2PQA A;  3KDF A;  4LUV A;  3B6Y A;  4DKA C;  3I55 A;  4LF7 L;  3PCO B;  3H15 A;  4OWX B;  3PIO A;  1NY4 A;  1T9H A;  1VQ8 A;  2YYZ A;  4Y52 H;  1PH8 A;  1YI2 A;  1Q7Y C;  3PSI A;  2NVY H;  5M3F H;  3CCU A;  1Q1E A;  4DV7 L;  1K9M C;  1VQN A;  4JYA Q;  2XTI A;  1U5K A;  1SMX A;  4HIO A;  1N33 Q;  2ID0 A;  4L5R C;  1IYJ B;  2Z6K A;  3H0G H;  4IPD A;  4LF9 L;  1G6P A;  4DV5 Q;  3CCL A;  1WJJ A;  4LF4 Q;  3UE0 A;  1XTD A;  4P73 A;  1X6O A;  2V1C C;  4J15 A;  1YHB A;  2R92 H;  1RL2 A;  2MFI A;  1BBU A;  2D0P A;  4IJL A;  3KJP A;  4HIK A;  4K0K Q;  1XNQ Q;  1L1O B;  1CKN B;  1I5F A;  2R7Z H;  4C3H H;  2ASB A;  3W1G A;  1WFQ A;  2KCT A;  1PH7 A;  5IP7 H;  2L15 A;  4R1J A;  3KF6 B;  4APV A;  1TWA H;  3JAM c;  3M85 A;  5LMN L;  3PF5 A;  1YJ9 A;  1FJG L;  4DR6 L;  1QUQ A;  1EWI A;  4GNX C;  4YHH L;  4A3M H;  1FGU A;  2KCM A;  2WFW A;  1KL9 A;  3PUW A;  1N34 Q;  1HNW L;  4UY8 C;  3M3Y H;  3NEN A;  4DV6 Q;  4LFA Q;  5C44 H;  1K3R A;  2AKW B;  4BY7 G;  5IWA L;  4LFC Q;  4BA1 I;  4X65 L;  1K83 H;  1J6Q A;  4DR4 Q;  3EIV A;  1VQ7 A;  2R93 H;  1X3E A;  1YIT A;  1JT8 A;  5C4X G;  5IYD G;  2N78 A;  5J3B A;  1N32 Q;  4LF8 Q;  2NVX H;  1AH9 A;  4A76 A;  2RHS B;  5C0X I;  2VQE L;  1O7I A;  1XJV A;  4AQY L;  1SLJ A;  4A3E G;  1XPU A;  4DR7 Q;  3TQY A;  4WJ3 M;  1PHJ A;  3ER0 A;  4B3M L;  2IHF A;  5JJK A;  3M9B A;  1E1O A;  4DR2 L;  4BBR H;  1YVC A;  1X56 A;  1NTG A;  3AQQ A;  1CSP A;  2RHQ B;  3T1Y L;  2AHO B;  3S2D H;  2UU9 L;  2JK8 A;  4LF7 Q;  3KLW A;  3I56 A;  4JI6 L;  1E7Z A;  1A63 A;  4UP9 A;  2GVB A;  1B7Y B;  3RR5 A;  1VQC A;  3W5O A;  4DV7 Q;  4YCU A;  1EUJ A;  1V1Q A;  1PH5 A;  1L0W A;  4DV3 L;  5LMU L;  3OW2 A;  4PZ7 A;  4LF9 Q;  2D0O A;  3CQZ H;  3GO5 A;  4IO9 A;  1VQ4 A;  1X55 A;  3FP9 A;  4XTC S;  1EQR A;  4JI8 L;  4DK3 C;  3PIP A;  4GLA C;  1YBY A;  1BKB A;  1OXU A;  4X66 L;  4EQ5 A;  3GTK H;  1IXR A;  4L5T A;  1KIX A;  4X64 L;  1Y1W H;  2A1A A;  3CF5 A;  5H1S E;  1IZ6 A;  2OTL A;  1KC8 C;  2DUD A;  4R4C A;  3S24 A;  1HJP A;  3CD6 A;  2Y0S G;  2BA1 A;  4NPS A;  4GN3 B;  5EAY A;  3CCV A;  5LMN Q;  4DV4 L;  3J7A 5;  3CC7 A;  3RN5 A;  3CAM A;  1FJG Q;  2ZM6 L;  4OO1 G;  4Y7N H;  3HOV G;  4DR6 Q;  4X6A H;  1H95 A;  4JG2 A;  5GQO A;  3GTM H;  4YHH Q;  2CWP A;  4R4O A;  1HNW Q;  1V9P A;  3STB C;  4IOC A;  1QVC A;  1AE2 A;  5IY0 A;  4QL5 A;  5C3E G;  4AH6 A;  5IWA Q;  3RLN A;  3K7A H;  5JEA J;  4X65 Q;  2B63 G;  2K5N A;  3UDI A;  3HOU H; 
#chains in the Genus database with same CATH topology
 2Z1C A;  1ENA A;  1SNQ A;  2PZW A;  3VA5 A;  4Q5V A;  5BR8 L;  1U4P A;  3CRL C;  3D4R A;  1QZH A;  1QCB D;  4I65 A;  4B3M Q;  1H9M A;  3SR1 A;  4JBW A;  1SYD A;  2EOT A;  1S5E D;  5IE8 A;  4BBR B;  3HOY H;  4ZAI A;  3OWE B;  2FIN B;  1EQQ A;  1QVG A;  2UU9 Q;  4JI6 Q;  3OW7 A;  4FO2 A;  2MJ8 A;  2WII B;  4H7B A;  4JVZ A;  4NMZ A;  4X3S A;  1Q46 A;  5FO9 B;  4A3G G;  2E2H B;  1HTL D;  1TQO A;  2PCF B;  1VQB A;  4B3R L;  1KXL A;  5FOB B;  2N3S A;  4X66 Q;  3MXP A;  3FKI G;  2IX3 A;  4A3J G;  4X64 Q;  1TII D;  2ATW A;  4L63 B;  2K32 A;  2F3W A;  5KRU A;  2QEJ C;  3PO2 G;  3F1Z A;  4A4I A;  1SNM A;  4DV4 Q;  4O0A A;  4Y7N B;  3LWU A;  3FPU B;  2B8G A;  4NXM L;  1DD2 A;  1EEF D;  3OIQ A;  2OCE A;  4RH6 A;  4UDU C;  5ELE A;  1HZB A;  1CKM A;  2WP8 J;  1D8L A;  2MHV A;  4TVA B;  4YIJ A;  3CCM A;  2B2U C;  1B4O A;  3JAM i;  1JJ2 A;  1TKW B;  1I94 Q;  2AQ1 B;  3CW2 C;  4H0L C;  1B50 A;  1HR0 L;  3LWE A;  3O13 A;  1R9T H;  4UAI A;  5I6Y A;  1IL8 A;  2CCZ A;  5CV7 A;  2A6E D;  3NHH A;  5IOD A;  1KAW A;  1JE5 A;  4FF3 A;  1Q12 A;  3K5N A;  4IFD G;  4FXD A;  3L2P A;  4A3M G;  2OXP A;  3HRZ C;  4BXX H;  1CZG A;  3I4M G;  4A3D H;  3M4P A;  3NUC A;  2EY5 A;  3A74 A;  2A6H C;  2K5D A;  4ZKB B;  3BVM A;  1HA5 A;  3GTQ B;  3PUZ A;  4A93 H;  3GTO H;  4A3E H;  1L2F A;  2EJG C;  3OMC A;  3J7A V;  1FVI A;  1J9O A;  2GA4 B;  3RLF A;  3H3V H;  3SHL A;  5I6W A;  3RD4 A;  2LSS A;  1S5D D;  4ZUJ A;  4BBR G;  1HNZ Q;  1STN A;  1ZEQ X;  3ZYY X;  5I4D A;  5CBE E;  4MTK A;  5M5W B;  2WV6 D;  4QJF A;  4DR5 Q;  1WCM B;  4HJ8 A;  4DNI A;  2CH4 A;  4TSS A;  1SFO B;  2LXK A;  5I2X A;  2R7Z B;  4C3H B;  1BCP C;  2Z4H A;  5AJ3 L;  2B29 A;  3CU7 A;  4OIK A;  1KLU D;  3ERS X;  2WB1 B;  3DEP A;  1SN8 A;  1X3G A;  3I91 A;  1U0L A;  3VYT A;  4WRD A;  1VQ5 A;  1H9J A;  2B2U A;  4ME3 A;  4JV5 L;  1ET9 A;  5DLQ E;  1TT2 A;  2E2D C;  1DOM A;  4HTH A;  1MIU A;  3VA7 A;  1XNR Q;  5HGQ A;  1S72 A;  3QG1 A;  1X3Q A;  2PI2 E;  2CHB D;  3W1B A;  2PMZ E;  1N32 Q;  2UXB L;  3BVG A;  4DV0 Q;  4N8F A;  1EYG A;  5DEH A;  1CSQ A;  1WVL A;  2VW9 A;  2XWJ B;  3HOX H;  2F0H A;  4FP5 D;  2RSO A;  2XN9 C;  2HIX A;  4DK6 C;  2HDM A;  3IFT A;  5FLM G;  1CI3 M;  1CKN A;  2JE6 I;  3C46 A;  3OPO A;  4CJ2 C;  4A3I H;  2KEE A;  3KF6 A;  2CQO A;  3NBH B;  4ID6 A;  4OIJ A;  1Q8I A;  1YZ6 A;  3OSO A;  4CBV A;  4ZLT F;  1WTX A;  3KLS A;  1LTL A;  4PNY A;  1BF4 A;  4ULL A;  2UXD L;  4YCV A;  3HFZ B;  3Q24 A;  1UAP A;  2A5H A;  4HSP A;  1AE3 A;  2PW5 A;  4POG A;  4IAL A;  1EFW A;  3OTO Q;  5C5M A;  1Z7T A;  3J81 E;  2LXJ A;  1K0S A;  2B2T C;  3OOC A;  2Q8R E;  3ND9 A;  3TP6 A;  1VF5 C;  1M1K C;  4B3S L;  1ET6 A;  1RKN A;  2AUJ D;  1CQF A;  4A3C H;  4X62 L;  1B3Q A;  1S5B D;  1T5E A;  3K7U C;  2AWO A;  2JA6 H;  2RBM A;  2F0U A;  2EYH A;  3HZX A;  2HCC A;  2IWH A;  2FJ2 A;  4B9W A;  1CK1 A;  3GTJ H;  4NXN L;  3T1H L;  2F0F A;  4TKO B;  2WKD A;  2KBN A;  3CCE A;  3EBE A;  3HOY B;  1WCM G;  4OGQ C;  1KD1 C;  1MI2 A;  2R7Z G;  3GV6 A;  4C3H G;  1JJG A;  5FK9 C;  2OT2 A;  1EWC A;  1WD0 A;  5F2D A;  1WTQ A;  1DOK A;  3M4Q A;  1F2Z A;  2WB1 G;  1VQK A;  2N88 A;  4QUC A;  3K0Y A;  2RDG A;  2I5L X;  5E1F A;  2ES2 A;  1PXU A;  4KY7 A;  5COR A;  4JI4 L;  1PZK D;  2K5Q A;  5IYD H;  1WOC A;  3ITP A;  2TSS A;  5M5Y B;  2PNR C;  3D6W A;  4HIM A;  1HZA A;  2ALY B;  3T16 A;  4P2C B;  3IL8 A;  1GOZ A;  1XMQ L;  1I4Q A;  2E75 C;  2P5Z X;  4JK1 C;  3CP0 A;  2UXC Q;  3DM1 A;  4FF4 A;  1GHK A;  1EYD A;  1EY6 A;  3BZD B;  4GN5 A;  4MNO A;  3CPF A;  3U9O A;  1A3U A;  4WOR A;  2NN6 G;  3M4O H;  2RDF A;  2NWG A;  3MVV A;  2B2T A;  2WKC A;  2NVT H;  1YNJ D;  4MTN A;  2Z4I A;  4LUO A;  3LX0 A;  4QIW E;  1CQV A;  2F0D A;  3UDF A;  4R8N A;  1XMO L;  2F4V L;  2MQH A;  2IX0 A;  3T4A C;  1Z9F A;  1ESR A;  4JI1 Q;  1C0A A;  1G29 1;  3CXC A;  1JWS D;  5CMD A;  1KDB A;  3OWF A;  5EGT A;  1TWG H;  2J0T D;  4H02 A;  4IQZ A;  4IUT A;  1SYE A;  1XTC D;  1D1K A;  3FDT A;  4RKB A;  1FL0 A;  2MP1 A;  2Z6K C;  3A5Z B;  1YJW A;  2VY3 A;  2B63 H;  4MHE A;  4OON A;  3U4Z A;  1WTR A;  1JCK B;  1K73 C;  1PH2 A;  4KHZ A;  5C4X B;  1M90 C;  3PV0 A;  4DUY Q;  1GVP A;  4FVM A;  5DM7 3;  1N33 L;  2QCP X;  4YY3 Q;  4DV5 L;  1RDP D;  4A3E B;  4LF4 L;  4DAV A;  4RFB A;  2Q2I A;  5C0X J;  4ABN A;  2PNH A;  2OEO A;  4YWK A;  1XNQ L;  3HOY G;  3D0F A;  5A2Q L;  2F0P A;  2AUK A;  2VL6 A;  2F0V A;  3E9I A;  3C1E A;  3J7Y W;  3E0E A;  2B3G A;  1WI5 A;  4FYD A;  4KHP Q;  2MNA A;  1L0X B;  1MJC A;  4LFA L;  4GOP B;  2EIF A;  3K81 C;  4UP7 A;  4JW0 A;  4DR4 L;  1WTV A;  3FKI H;  3F2C A;  4A3J H;  4KI0 A;  2KVM A;  5C3X A;  4K8I A;  4LF8 L;  4BA2 I;  1G91 A;  4LWC A;  4G57 A;  5G3L D;  2B8F A;  4CKB A;  2Y0S B;  4LFB Q;  1KAB A;  3I70 A;  1Z47 A;  3S1Q H;  3N6R A;  3A5U A;  2X69 A;  4LF5 Q;  4GS3 A;  3PF4 A;  2A74 C;  3RMH A;  3KJO A;  4KN7 C;  1GUT A;  4DKA C;  2LKV A;  1QNK A;  3MFG A;  3PCO B;  1TY2 A;  3PIO A;  1T9H A;  1BXT A;  2RA4 A;  3HOX B;  4Y52 H;  1IHZ A;  1PH8 A;  1RCV D;  1K9M C;  4JYA Q;  2EJM A;  2XTI A;  3S17 H;  4A3L H;  2Z6K A;  4IPD A;  4ZYS A;  4LF9 L;  2IW3 A;  1WJJ A;  5M5X B;  3UE0 A;  4P73 A;  2V1C C;  3A8J E;  1YHB A;  2A6H D;  4A3F B;  4HIK A;  4IJL A;  4C2M B;  4K0K Q;  1CKN B;  1I5F A;  3QOJ A;  3W1G A;  1PH7 A;  2FHT A;  1MSH A;  2L15 A;  3KF6 B;  4APV A;  4IFD H;  3KBX A;  1FJG L;  2LY7 A;  3E6Z X;  1QUQ A;  4A3M H;  1FGU A;  3FRP B;  2WFW A;  1HNW L;  4UY8 C;  1EY4 A;  3NEN A;  2ZXO A;  4KKU A;  1JC7 A;  1I3Q B;  3RZO B;  1K83 H;  3S1M B;  1J6Q A;  1HXY D;  5C4X G;  3I4L A;  2F0Q A;  2NVX H;  1GJX A;  1BCP D;  4C3I B;  3X3N A;  2VQE L;  1O7I A;  4AQY L;  4K5W A;  4A3E G;  5J39 A;  1TVX A;  3ER0 A;  2IHF A;  2K33 A;  3M9B A;  1E1O A;  4BBR H;  2JA6 B;  1YVC A;  2PPB C;  2M00 A;  3AQQ A;  1NTG A;  1BCP B;  1BUV T;  2RHQ B;  1B44 D;  1FNV A;  2RCF A;  3GTJ B;  3FVQ A;  1C4Q A;  2GVB A;  1VQC A;  3W5O A;  4YCU A;  1V1Q A;  1PH5 A;  5LMU L;  3OW2 A;  2IJ0 A;  4K14 A;  1VDZ A;  3NSW A;  4PZ7 A;  2D0O A;  4IO9 A;  2E2H H;  1X55 A;  4XTC S;  3HP3 A;  5KNC A;  2ZXP A;  4RAU C;  3AMU A;  4EQ5 A;  4R8I A;  4L5T A;  3GTK H;  1IW7 C;  3IKJ A;  4R4C A;  3S24 A;  1UEA B;  1PTO D;  2Y0S G;  4NPS A;  4GN3 B;  5LMN Q;  4EGV A;  3CC7 A;  3CAM A;  4OO1 G;  4X6A H;  4Y7N H;  2NB0 A;  3G6J B;  3STB C;  4IOC A;  5C44 B;  5IWA Q;  3TP8 A;  1QE6 A;  3U4V A;  5FKA C;  2R93 B;  3HOU H;  3HOX G;  4JOI A;  3D4D A;  4X3T A;  1EYC A;  3KFU A;  4DV2 L;  1CKO A;  3TS2 A;  3P75 A;  5CV9 A;  5IT9 L;  5FLM H;  1U9R A;  1PYW D;  2VB3 X;  4QY7 A;  4CDE C;  5KYL A;  3VR3 A;  4A3F G;  3J80 c;  1I6V C;  4DR2 Q;  2NVT B;  4U67 3;  1HQR D;  5AFW A;  3I73 A;  3S2D B;  5D3D A;  2HHH L;  1TU2 B;  3E9H A;  3AEV A;  5DAU A;  1S3O A;  2PYK A;  2K01 A;  3A7A B;  2I0Q A;  4DV3 Q;  1SRO A;  5CV6 A;  1ASY A;  1VQM A;  1RF2 D;  4JI8 Q;  1G8Z D;  3NEM A;  2IT1 A;  2N49 A;  4NDX A;  1EYA A;  2QKI C;  4PMW A;  3A0J A;  1Y1W B;  3GTQ H;  4NB3 A;  5COY A;  4C3I G;  1MGS A;  5G3L F;  4A3C G;  2ZM6 Q;  1B3A A;  1QVF A;  1STG A;  5KGU A;  3PIP 3;  1II3 A;  5EPJ A;  2JA6 G;  2XGT A;  1MHW C;  1EU4 A;  2OF1 A;  3U50 C;  1NJI C;  2F0S A;  5M5W H;  1PYS B;  5E4X A;  2XSC A;  3GTP H;  3GDE A;  2E2J B;  1SNP A;  2QW7 A;  3HS0 C;  1WCM H;  1SFO H;  4XIG S;  1QOH A;  1EY0 A;  4IFD J;  1HHV A;  1UNS A;  3DEO A;  2E5L Q;  4P71 A;  1F9P A;  1C7Y A;  4JI7 Q;  4L8J A;  1ENF A;  2EQS A;  4F87 A;  2RQX A;  3SK5 A;  1Y1V B;  1EIG A;  5GAG C;  4NKL A;  1VQF A;  1PH4 A;  4JI2 L;  2Y0S E;  1ZKO A;  5C44 G;  4Z9C B;  1VS0 A;  4PV1 C;  3S1Q B;  4NW2 A;  2R93 G;  1PH1 A;  4R9W A;  2B2V C;  4CJ1 B;  1M8A A;  1P16 A;  3H94 A;  5CGK A;  3A8I E;  1IBL Q;  4RWS C;  2ZT9 C;  2VS1 A;  2B63 G;  1NCV A;  3LGJ A;  5T1I A;  3G6E A;  1E2V A;  1BCP F;  3Q6S A;  4HCS A;  4JCV E;  2NN6 H;  3K59 A;  2YU9 H;  5C6A A;  5C4J B;  1K28 A;  1AP0 A;  3J7Z C;  3WWV A;  2E2I B;  3G4S A;  1C8C A;  3MEH A;  4EVO A;  1R4Q B;  3AFP A;  4HMJ A;  5IGE A;  1PV4 A;  1A8V A;  2NYZ D;  1A2U A;  4EQN A;  3Q0A A;  2ZJR A;  2EZV A;  1K8O A;  1LUZ A;  1NNX A;  3RNU A;  1RD9 D;  3IAY A;  5CR3 A;  4BBS B;  2EY1 A;  3BYT B;  4JC0 A;  2K14 A;  1C48 A;  1EY5 A;  1ZXT A;  3ULJ A;  5IGG A;  3R93 A;  1PZI D;  4XQQ A;  1YNJ C;  3ONA B;  3SK8 A;  3I90 A;  5TSS A;  4JI5 L;  2JXM B;  1K83 B;  2KHS A;  3MWY W;  3CKI B;  4IN3 A;  1HZ9 A;  1QUQ B;  3QOL A;  4B3T Q;  4DR3 L;  2A8V A;  2NVX B;  1UE7 A;  2Z9H A;  1SNC A;  1O7Y A;  4U68 A;  4XT3 B;  1HA6 A;  5GAH C;  3PMF A;  1IBM Q;  3HGB A;  1ML0 D;  1RIP A;  3MZ5 A;  4NP5 A;  3DMU A;  2IPK D;  2KHI A;  3UE1 A;  3I8Z A;  4PG3 A;  5ELD A;  4GKK L;  2FMC A;  1DCZ A;  3ND8 A;  2JA5 B;  1TS2 A;  2B2V A;  1A3T A;  2K75 A;  2UUA L;  4ZK9 B;  4WJ4 A;  4A3K H;  4ME5 A;  3J81 i;  5ISR A;  1I4R A;  1MKH A;  2A73 B;  1HZC A;  5JJL A;  2Q2H A;  1Y1V G;  4QGU A;  4RGN A;  2BA0 A;  2I5M X;  3EN2 A;  3GTK B;  1FNW A;  4FXK C;  3NWS A;  3PO3 H;  2I46 A;  1SE8 A;  2YTY A;  5M5Y H;  2EXD A;  4MN3 A;  4WJW A;  2Q2U A;  5JVH 3;  4JI0 Q;  3N52 A;  2BH8 A;  3DM3 A;  4GOP C;  4G4K A;  5K36 G;  2IY5 B;  2UUB L;  1J8I A;  4E6I A;  1QZG A;  3BJU A;  5FLX L;  2CVR A;  3VR2 A;  4OXP A;  4X3K A;  3HOU B;  1VCI A;  1VQH A;  3GTL H;  1DM0 B;  2ICE C;  2KEN A;  3L0O A;  1B9N A;  2AMC B;  4HN7 A;  1O78 A;  1EY8 A;  2SEB D;  4A3L G;  5M3M B;  1I50 H;  1E22 A;  1NMF A;  3L7Z C;  4IUV A;  1VMP A;  4KN4 C;  5IYB G;  4OX9 L;  4DXF A;  4F88 A;  4HJA A;  2G5D A;  4BBS G;  1HNX L;  2QDB A;  2F3V A;  2K5W A;  1JOQ A;  2R3Z A;  1VQL A;  3K80 C;  2ZTC A;  5C3W A;  1YJN A;  4KV6 A;  1A3V A;  4JI3 L;  3S2H H;  4GN4 B;  2JA8 B;  1LO5 D;  3TN2 A;  1ONL A;  2EYL A;  3V2T A;  5C4X H;  4V19 0;  1XPO A;  4HR7 B;  2BDO A;  3G7L A;  3VR4 A;  3S1N B;  1PH6 A;  2UUC Q;  2WAQ B;  2F0L A;  1EQV A;  5BN5 A;  1N36 L;  1XPR A;  2MGS A;  3R2T A;  1IW7 D;  2A68 D;  3DWP A;  1F9R A;  4FDB A;  3V96 A;  3KLR A;  4V0B A;  3FHW A;  4GOP A;  1L0Y B;  5CC4 A;  3GTP B;  2JA5 G;  2L12 A;  4GKJ Q;  4DGZ A;  3STB D;  4DR1 L;  1G6Z A;  1NMG A;  1J5E Q;  1TS5 A;  2R7D A;  1A62 A;  3BZK A;  4IOA A;  2OQK A;  1TWF B;  4LF6 Q;  1NR2 A;  4DUZ Q;  3BG3 A;  1PRT C;  2R6G A;  3FMC A;  4GZY C;  3M7G A;  1SYG A;  1DOL A;  1FD7 D;  3TDQ A;  1VQE A;  3KK7 A;  1FGB D;  4QCL A;  2YV5 A;  2OQ0 A;  4DA2 A;  4PZ8 A;  2QEX A;  3OHX C;  4OO1 H;  1YNX A;  4B9X A;  2F52 A;  3QWN A;  1A15 A;  1PMR A;  2JN4 A;  1HCZ A;  4DV1 L;  1G51 A;  1LTG D;  2CFM A;  3QIA A;  2DN8 A;  3U9S A;  1KRT A;  2ZJQ A;  3HOU G;  1STA A;  2E74 C;  2M2L A;  1K8M A;  3NE5 B;  2K5H A;  3HG9 A;  2ICI A;  5M5X H;  5M3M G;  1PTO C;  4EX5 A;  4RCN A;  2YU9 B;  4ZCK A;  4A3F H;  2WAC A;  2NTT A;  2SNS A;  3KOJ A;  3P20 A;  4C2M H;  4O2D A;  1EIY B;  1IBK Q;  1YEZ A;  1ZYR D;  5JJI A;  1VQI A;  2IL8 A;  2L55 A;  3HKS A;  3AYH B;  5FO8 B;  2Q8I B;  5KNB A;  1N34 L;  1WYD A;  4HAE A;  1DGS A;  2HDL A;  1I3Q H;  1AW7 A;  4YWM A;  1BNZ A;  2JA8 G;  3RZO H;  2EE1 A;  3S1M H;  5IGD A;  3TSS A;  2F4I A;  1PH3 A;  3H3V I;  3WOF A;  4C3I H;  1NUC A;  1UUP A;  2WAQ G;  4EQO A;  3NTK A;  3QR8 A;  2BH2 A;  3VYU A;  4HSV A;  4RG1 A;  3GTG B;  4DR7 L;  1E0B A;  3HOV B;  2I07 B;  5CV8 A;  5IP9 G;  1MJE A;  2PQA A;  3KDF A;  3NTI A;  2YYZ A;  1Q7Y C;  3PSI A;  3CCU A;  4DV7 L;  1SJH D;  1G6P A;  2ID0 A;  1IYJ B;  1WD1 A;  1NSN S;  4Q0F A;  2G9H D;  1ILQ A;  1LT3 D;  2D0P A;  2J4X A;  1LTB D;  1HRJ A;  4A3K B;  2ASB A;  1H9S A;  4K6D A;  1WFQ A;  2DNE A;  3JAM c;  3M85 A;  4G7Z C;  3PF5 A;  1JWU D;  4RHS A;  4DR6 L;  1Y8O B;  1EWI A;  4CHT B;  2DY8 A;  4DXG A;  4YHH L;  4GNX C;  3PO3 B;  2C9O A;  4DV6 Q;  4F7X A;  2JA7 B;  5C44 H;  1PTO H;  4LFC Q;  3EFX D;  4X65 L;  5IGC A;  2R93 H;  1YIT A;  4KK7 A;  5JVG 3;  2N78 A;  1KAA A;  2F0W A;  4XYQ A;  1LAB A;  5C0X I;  1XJV A;  2BDN A;  2L9H A;  4B08 A;  4WJ3 M;  3K58 A;  1PHJ A;  4B3M L;  3GTL B;  4AYB B;  3S2D H;  4C3J B;  1I50 B;  2UU9 L;  2JK8 A;  4LF7 Q;  4JI6 L;  1A63 A;  1B7Y B;  3E3X A;  1D5Z C;  1S5C D;  4C1N I;  3H0G B;  3GQB A;  4DK3 C;  1EQR A;  2K04 A;  1QWY A;  2R92 B;  2FFK B;  4X66 L;  3SVM A;  1IXR A;  4X64 L;  1Y1W H;  2OTL A;  3S2H B;  3J81 L;  2CQA A;  5EAY A;  3J7A 5;  4DV4 L;  4IUN A;  3S9W A;  4RKL A;  4X3U A;  3HOV G;  3FPP A;  5LL6 X;  1GUO A;  1LTA D;  1QVC A;  3TBI B;  1STH A;  3HKZ B;  3UDI A;  1EIF A;  4M8A A;  2E2J H;  4GNX A;  1U4L A;  3ERO A;  1Q1B A;  4L5Q A;  4ZKC B;  5EBD A;  1D1I A;  1I94 L;  1V1O A;  5E3F A;  1VQ9 A;  1GD7 A;  3T1Y Q;  4A3K G;  1JJC B;  3I2Z A;  2L4N A;  3JAM L;  1Y1V H;  1SEB D;  4IUQ A;  2WB1 E;  2EYP A;  2KEC A;  5J1Z A;  1Q3L A;  3PUV A;  3C1F A;  3PO3 G;  3CQZ B;  2KJX A;  4XXE A;  3EJI A;  2JA7 G;  1ICW A;  2AWN A;  3IFD A;  5K36 H;  1LTT D;  1VQA A;  1TWH H;  4OEL B;  3OMG A;  1LT6 D;  4ILW A;  1X9N A;  2VZA A;  2PI2 A;  3D6C A;  1CFM A;  3MA2 B;  1W6J A;  2SOB A;  4S3S A;  4AYB G;  5C4J H;  4DK1 A;  1PYB A;  1HNZ L;  5LMN W;  4C3J G;  3R3O A;  5IT9 c;  2E2I H;  1EIH A;  3GP7 A;  2K6A A;  4DR5 L;  1CHP D;  2YTV A;  5IYB H;  3H0G G;  5ELB A;  5BR8 Q;  3RZD H;  3BYY B;  1HUM A;  3H09 A;  4MZ9 A;  4BBS H;  4JOI C;  1BBW A;  4UHV A;  4GLV B;  1VF7 A;  4KTA A;  2MPM A;  1EOT A;  1VQP A;  5NUC A;  1SJE D;  2B2Y C;  2EPB A;  3EQL C;  3UDX A;  2Q2T A;  1XNR L;  3BVZ A;  3F2B A;  1N32 L;  1L1O C;  4DV0 L;  1U4R A;  3NBI A;  3HKZ G;  4B3R Q;  1YHA A;  1AFP A;  1PRT D;  1JOO A;  2TMP A;  2JEB I;  4RMF A;  3MXN A;  3K57 A;  2ZJP A;  3DUZ A;  5EPK A;  2OWO A;  3J7A F;  4QUF A;  1PRT B;  1OXT A;  2JA5 H;  4NXM Q;  5D3I B;  2Q8T A;  1FNU A;  2PQA B;  1SRU A;  3KDF B;  1FR3 A;  3TZD A;  1W2B A;  3ICE A;  2D5D A;  3KF8 A;  2F0M A;  4R4I A;  4ZQ3 A;  3T53 B;  2O5J C;  4JBK A;  1WTH A;  2NVQ H;  3NEL A;  2F0T A;  2A68 C;  5CBA E;  4JBJ A;  3J81 j;  2LS0 1;  1FYC A;  1Y14 B;  1Q81 C;  4LNQ A;  4A3B B;  3L3O C;  3TS0 A;  1HR0 Q;  2ENB A;  1K0R A;  2GN5 A;  3OTO L;  1TS4 A;  1XXG A;  1H9S B;  1PTO B;  3QB3 A;  3K5M A;  2B39 A;  1N8R C;  2F0I A;  1YIJ A;  5JOB A;  1TXY A;  3CCJ A;  2MO0 A;  5M3M H;  4QF4 A;  5JPM C;  3ULP A;  2F0G A;  2B2Y A;  4IFD I;  2EXZ A;  4YWL A;  5EKL A;  2KHJ A;  1L1O A;  3GD7 A;  5I9O A;  2RCN A;  1O7Z A;  1BO0 A;  4PMB A;  2K4K A;  4RCO A;  2HQL A;  3NK9 A;  4OL7 A;  1PA6 A;  3S14 B;  5IOC A;  3J80 E;  3X3M A;  2NUC A;  3F2U A;  2JA8 H;  1I6H H;  1Q90 A;  1UWV A;  1A0I A;  4WFN 3;  3DLL A;  1F9Q A;  1SE2 A;  3S1N H;  2HQE A;  1LTS D;  3K6O A;  3R8B A;  2EVB A;  5AJ3 Q;  1E3P A;  1SNO A;  1SMY D;  1ZYR C;  4KJO A;  3SDZ A;  1AZQ A;  2WIN B;  5IP9 H;  1UE5 A;  2VQF L;  1BVS A;  2UXC L;  1WTP A;  4JV5 Q;  3PUX A;  4K5V A;  1X65 A;  1E2Z A;  5CV5 A;  2K05 A;  4UPA A;  1UEB A;  3S1R H;  2HUG A;  2UXB Q;  1EL0 A;  2PO4 A;  3A56 A;  4POF A;  4LUZ A;  2EJF C;  1GUS A;  1TWF H;  1SAP A;  1D2B A;  2JSO A;  2OTJ A;  3TP5 A;  5I9P A;  3ULL A;  3G71 A;  2VUM H;  5HGT A;  4GNX B;  3V05 A;  1UE6 A;  2QF7 A;  4JI1 L;  4C1N K;  2K1B A;  1LYL A;  5KEE A;  1CZW A;  1IYU A;  1QG7 A;  3RN2 A;  2DY7 A;  1PLF A;  5JAV A;  4A3B G;  1PFS A;  5EJW A;  2EYF A;  4N9P A;  1OXV A;  4DNR B;  4IUR A;  4OWW B;  1N9W A;  3MAQ A;  4DPG A;  1YNN D;  5EQ0 A;  4PQX A;  1TWH B;  2IX1 A;  5HY6 A;  2RSN A;  4DUY L;  2UXD Q;  1P8L A;  1KRS A;  4IUU A;  4YY3 L;  1VQ6 A;  5FLX c;  1GKH A;  4YCW A;  2E8G A;  3PUY A;  1QJO A;  1OXS C;  1SXT A;  1PRT F;  2PMZ B;  4FNF A;  3MXG A;  1S40 A;  4B3S Q;  3SK4 A;  4X62 Q;  3CC2 A;  4RGT A;  2I5H A;  2FMM A;  3S16 H;  1MD2 D;  1SR3 A;  4FF2 A;  1GUN A;  3MEF A;  4KHP L;  1NAP A;  2BOS A;  3RZD B;  2DJF C;  3T1H Q;  4NXN Q;  4BS9 A;  4FXG C;  3BU2 A;  2X6G A;  1Y1W G;  1CA5 A;  1ESF A;  4M1U B;  1DON A;  1G2T A;  3CRK C;  4RGO S;  4LFB L;  3GTG H;  1TWC B;  4HJ9 A;  3MXU A;  4KJN A;  2PZT A;  4N9T A;  4O42 A;  1LT4 D;  1PTO F;  1F2L A;  3HOV H;  4LF5 L;  3NXW A;  3GV3 A;  1PVO A;  4CJ0 B;  1DJR D;  1HFG A;  5D65 A;  4JI4 Q;  4RGM A;  1AZP A;  5K5P A;  2B2W C;  3TRZ A;  4JYA L;  1RHP A;  1QB5 D;  1VQD A;  2HT1 A;  3M4Y A;  4QB4 A;  3SGI A;  2NBF A;  1XMQ Q;  5EPL A;  2MUY A;  4BY1 H;  1VQG A;  2D62 A;  2XNA C;  4K0K L;  3D3R A;  4DN4 M;  3MXN B;  5FJ8 G;  3S15 B;  4UP8 A;  1B8A A;  4P75 A;  2NVQ B;  1EWH A;  2L0C A;  1KNE A;  2JJQ A;  3AB9 A;  2JA7 H;  1XMO Q;  3SE0 A;  4XYO A;  5IYC H;  2F4V Q;  1E1T A;  1K3B C;  3KF8 B;  3HOZ H;  2H4O A;  2VNU D;  2Z0S A;  3C3L A;  2NN6 I;  4R4T A;  3SXH A;  3H3V C;  4HJ5 A;  3K8A A;  5I2Y A;  4KKS A;  3G48 A;  1EY7 A;  4JBM A;  3I3C A;  4EQP A;  2VB2 X;  4KLK A;  4K2L A;  1GHJ A;  1JR0 D;  3HOW H;  4C3J H;  5C3E B;  1ILP A;  3B6Y A;  4XT1 B;  4OWX B;  1NY4 A;  2O5I C;  3WOE A;  1STE A;  5M3F H;  1Q1E A;  4HMI A;  4HIO A;  1X3P A;  4L5R C;  1N33 Q;  3H0G H;  4DV5 Q;  3CCL A;  4LF4 Q;  4LJZ C;  1XTD A;  3VYR A;  2HD3 A;  4J15 A;  1I4H A;  2R92 H;  1RL2 A;  2B2W A;  2MFI A;  3KJP A;  1EZ6 A;  1SDF A;  1W6K A;  3VR6 A;  1XNQ Q;  1L1O B;  1JOR A;  3A54 A;  2H1E A;  3KLS X;  1S5F D;  4QIW B;  2KCT A;  2J7Z A;  5LMN L;  1SE3 A;  1YJ9 A;  1I6H B;  1TWA H;  4DAY A;  3PUW A;  3VYS A;  3M3Y H;  3OIP A;  4LFA Q;  5FO7 B;  1RTO A;  5IWA L;  4BA1 I;  3SEB A;  4DR4 Q;  3EIV A;  4J1M A;  1VQ7 A;  1JT8 A;  5CV4 A;  2KUM A;  3CHB D;  2DJG C;  4LF8 Q;  1H9K A;  1AH9 A;  4CDD C;  2RHS B;  2D9U A;  2EYJ A;  4KY6 A;  1XPU A;  1SLJ A;  2E76 C;  1I4X A;  3S1R B;  2EYO A;  2L5T A;  2DNC A;  4DR2 L;  5DM6 3;  1R4P B;  2AHO B;  1X32 A;  3P7J A;  1E7Z A;  1AEX A;  2VUM B;  2NVY B;  2BE5 D;  1L0W A;  4DV3 L;  4LF9 Q;  3CQZ H;  3FP9 A;  4JI8 L;  1GUG A;  3NP8 A;  3L9A X;  1CHQ D;  4CKC A;  3UI2 A;  4RHR A;  3TP7 A;  1KIX A;  1F2Y A;  3TME A;  5H1S E;  1O7L A;  1EQT A;  2DUD A;  3CD6 A;  1AN8 A;  2BA1 A;  2KCN A;  2VXW A;  3RN5 A;  1FJG Q;  2ZM6 L;  4F8M A;  1RJT A;  4JG2 A;  1SYF A;  5GQO A;  3GTM H;  3E0J A;  4R4O A;  1HNW Q;  3A55 A;  1AE2 A;  5C3E G;  1JWM D;  1BOS A;  3RLN A;  1KTK A;  1S4Z A;  4CDF C;  4TRD A;  2R61 A;  2N55 A;  1NBW A;  2YTX A;  1IL2 A;  4XQJ A;  2VQE Q;  3HEJ A;  4AQY Q;  2E5L L;  3FEW X;  3I7F A;  3MHB A;  1Q82 C;  1CTM A;  3S16 B;  4KD3 A;  4XQN A;  1D5M C;  4JI7 L;  4QQB X;  5JEA G;  3I4N H;  2LMC B;  1MSG A;  2RDH A;  1Q86 C;  5KND A;  1Z6H A;  1KNA A;  1V1P A;  4DFA A;  2JA9 A;  1D6E C;  5C4H A;  5LMU Q;  5C0X H;  1EOV A;  3TRE A;  3OYY A;  3D31 A;  1UE1 A;  2HIV A;  3K5O A;  3J81 c;  5JJZ A;  2AQ2 B;  3WDN A;  5C4Z A;  5E4W C;  1IBL L;  4DAP A;  1B2T A;  1XX8 A;  3MTS A;  3NQI A;  3DHQ A;  2MO1 A;  2O4X A;  2RKS A;  2XRS D;  1BBX C;  3ERQ A;  5M9O A;  2JQO A;  2V4D A;  2QGQ A;  4GLX A;  3TEH B;  2M9V A;  1SYC A;  2R7F A;  3K7A B;  2KED A;  3EA6 A;  1SMY C;  4I7A A;  4BY1 B;  3UDG A;  2VUM G;  3W2D A;  4DV2 Q;  2KOL A;  4OO1 I;  1D5X C;  4PZ6 A;  4G7H C;  2K5V A;  1SYB A;  4A3B H;  3AFQ A;  3I72 A;  3VDY A;  2NZH A;  3EVQ A;  1Y69 U;  5A2Q E;  2PZU A;  2QIL A;  4ZRZ A;  5A35 A;  2NZO A;  2HHH Q;  3JC6 6;  2EY2 A;  3BDL A;  3HOZ B;  5IP7 G;  3H91 A;  4IZ8 A;  5E7N A;  5IGB A;  2Z8L A;  3JAM E;  4B3T L;  4HED A;  4DF7 A;  4BY7 H;  1IBM L;  2CW0 C;  1E2W A;  3QO2 A;  1KDA A;  3CCQ A;  4FF1 A;  3HOW B;  4QMG A;  2F03 A;  3A7L A;  2Z6B A;  3RLO A;  1YNN C;  3K0X A;  3CCR A;  5M3F B;  4IPH A;  3S14 H;  2VQF Q;  2RVL A;  3DWQ A;  1ROD A;  5L37 A;  1GO3 E;  1Y8P B;  2ZTD A;  3K5L A;  4K2K A;  1SE4 A;  3Q8D A;  3CME A;  2SDF A;  2F3I A;  4CKE A;  3PIO 3;  1XWE A;  1HQM C;  1V8Q A;  1KQS A;  1PDQ A;  1PH9 A;  4KY5 A;  4HID A;  2F0N A;  1G2S A;  1W3S A;  4JI0 L;  3CC4 A;  1TWA B;  3AU7 A;  1A2T A;  1HH2 P;  1KLG D;  3BDC A;  2K50 A;  1LLR D;  3ZJY C;  1R9T B;  1WTW A;  2WAQ E;  3M3Y B;  3URY A;  1H9R A;  2IHE A;  2FXQ A;  3A8K E;  3P1H A;  2BCO A;  1F9S A;  3CMA A;  1JMC A;  4CDC C;  4DAY B;  4KHV A;  2CH4 W;  3CCS A;  1LM0 A;  5IIF A;  1HUN A;  4JI2 Q;  2SNM A;  2KCC A;  4A3D B;  3J80 i;  2A69 C;  1F2M A;  5DNF A;  4BY1 G;  3IRB A;  2CKZ B;  4CGY B;  5KIX A;  5FJ8 H;  4A93 B;  1LT5 D;  3GTO B;  2LFN A;  1JB7 A;  1B70 B;  1HPC A;  4A75 A;  1GUW A;  1T5X D;  5GAD C;  5IYC G;  3HOZ G;  1IKM A;  2GVA A;  5BN4 A;  1B9M A;  2JEA I;  2C5C A;  4OEM B;  4R4Q A;  5EBC A;  4A3G H;  2O2L D;  2UUC L;  4IPC A;  4TQU S;  3F2D A;  1LTI D;  3RUZ A;  4J8Q A;  3GTM B;  2EDG A;  1Q8K A;  4K6L A;  1KDC A;  1PZJ D;  3D8G A;  1OTC A;  2L11 A;  3HOW G;  1BDO A;  3PO2 H;  4JI5 Q;  1QNU A;  1HR0 W;  3T51 B;  1CA6 A;  1LAC A;  4IJH A;  1SBB B;  5M3F G;  4DR3 Q;  3D4W A;  4MIU A;  4GKJ L;  1V43 A;  1J5E L;  4HCE A;  1EU3 A;  1E24 A;  4LF6 L;  3NTH A;  2R92 G;  3KUP A;  1NE3 A;  2C35 B;  4DUZ L;  3U58 A;  5IT9 E;  4PMC A;  3I4N B;  1CM9 A;  2ZXR A;  4K5X A;  5JPN C;  4GKK Q;  4IUP A;  1TWC H;  2X6L A;  4A3I B;  5HUR A;  2NZ1 D;  2UUA Q;  1U4M A;  1TR5 A;  2A19 A;  2D2C C;  1SND A;  3CPW A;  2F0O A;  1V1P B;  5ELF A;  4AIM A;  1HFN A;  4P72 A;  2K03 A;  1VQO A;  1VQJ A;  2XIW A;  2K52 A;  5GRO A;  1EFI D;  4IPG A;  4BXX G;  5ELN A;  1B53 A;  2QA4 A;  3I4M H;  1I4P A;  5LHY 1;  4A3D G;  2UUB Q;  3PGZ A;  1CUK A;  3E5S A;  4LW1 A;  4HJ7 A;  3NPP A;  4ALP A;  1IBK L;  4A93 G;  3S15 H;  2A6E C;  2H5X A;  3C2P A;  1K8G A;  2NTS A;  2CWA A;  2XRQ D;  1KHI A;  1JQY D;  3DXJ C;  3R2I A;  5D14 A;  1ICF B;  3I4O A;  1C9O A;  4P74 A;  1CT1 D;  3MC0 B;  2EY6 A;  1NR4 A;  1STY A;  1M4V A;  1D7Q A;  3T56 B;  4OX9 Q;  4L5S A;  3BZC A;  4XDX A;  3SK6 A;  4LK1 C;  4KKT A;  1HNX Q;  1O80 A;  4DAM A;  2F0E A;  2BE5 C;  5J22 A;  1I4G A;  1X3F A;  4J6H A;  1ENC A;  4JI3 Q;  4BY7 B;  5C3E H;  3M7N A;  3DWA A;  2G9D A;  1DYQ A;  5CYU A;  4G7O C;  4AYB E;  3TZU A;  2KA7 A;  3T13 A;  4LMQ D;  5GAE C;  1YHQ A;  2AQ3 B;  1N36 Q;  5BN3 A;  1JB3 A;  4H13 C;  4OWT B;  4RA8 A;  5JEA H;  3Q23 A;  4KD4 A;  3I4N G;  2JYO A;  3BS1 A;  4I7Z C;  5ELO A;  1EEI D;  1IKL A;  3LNN A;  1EZ8 A;  1STB A;  1TY0 A;  3BDO A;  4A3I G;  1F77 A;  3M4O B;  2ZTE A;  1QIL A;  3KYH C;  2DGY A;  4DR1 Q;  5ELC A;  5C0X G;  3NWT A;  1RTN A;  1GXD C;  4C56 C;  4DV6 L;  1B1Z A;  2N8N A;  4LFC L;  1LV9 A;  5T1G A;  1K8A C;  5IGF A;  1X54 A;  2F0J A;  4OHJ A;  2QDL A;  3HKZ E;  1TWG B;  2RF4 A;  1JIC A;  1ASZ A;  3MFY A;  2PW7 A;  1OXX K;  2EYM A;  4ZUI A;  1GM5 A;  3F8T A;  4DV1 Q;  4LAA A;  2K7V A;  4LUV A;  2K28 A;  3I55 A;  4LF7 L;  2B63 B;  3H15 A;  1VQ8 A;  1YI2 A;  4BWG B;  1DXM A;  2NVY H;  1VQN A;  1U5K A;  1SMX A;  3NQT A;  2L1B A;  3Q22 A;  4ODG A;  1PFM A;  4N8X 1;  1X6O A;  2CW0 D;  1DZ1 A;  1MBY A;  1BBU A;  2R7Z H;  4C3H H;  5IP7 H;  1SSO A;  1A6X A;  4R1J A;  2KCM A;  1KL9 A;  2F1M A;  1N34 Q;  4A3G B;  4O1N A;  4BY7 G;  1EY9 A;  1K3R A;  2AKW B;  2HCI A;  1X3E A;  3FKI B;  5IYD G;  1Y8N B;  5J3B A;  4A3J B;  3H6M A;  4A76 A;  3KBG A;  3PO2 B;  4L6T B;  4K8J A;  3QJY A;  4DR7 Q;  3TQY A;  5JJK A;  1XYI A;  5FLX E;  1JOK A;  3NBH A;  1X56 A;  1CSP A;  3T1Y L;  2XWB B;  2PQE A;  3KLW A;  3I56 A;  1JE4 A;  3J80 L;  4UP9 A;  1BQQ T;  3RR5 A;  4DV7 Q;  3W3A A;  1EUJ A;  1OO9 B;  4DK0 A;  5EKK A;  3S17 B;  5LL6 S;  3GO5 A;  1VQ4 A;  3PIP A;  4GLA C;  5EKI A;  1YBY A;  1BKB A;  2A69 D;  1OXU A;  1WTO A;  4DU9 A;  1IYV A;  2F0K A;  4DNT B;  4JPB W;  4H44 C;  1PFB A;  2A1A A;  3VR5 A;  1VMC A;  3CF5 A;  2KQ3 A;  1IZ6 A;  1KC8 C;  1HJP A;  1BR9 A;  1HTP A;  3CCV A;  1H95 A;  1TS3 A;  4DR6 Q;  5C5L A;  4YHH Q;  2CWP A;  4A3M B;  3PQI A;  1V9P A;  1LTR D;  5IY0 A;  4QL5 A;  1PFN A;  4AH6 A;  3I4M B;  4KMU C;  3K7A H;  2XVS A;  5JEA J;  4X65 Q;  2JP1 A;  2K5N A;  5KYI A; 
#chains in the Genus database with same CATH homology
 3HOX G;  1EIF A;  4JOI A;  2E2J H;  4DV2 L;  1CKO A;  4GNX A;  3KFU A;  3TS2 A;  1Q1B A;  1NBW A;  4L5Q A;  2YTX A;  1IL2 A;  5FLM H;  2VQE Q;  5BR8 L;  4AQY Q;  2E5L L;  3S17 H;  4QY7 A;  1QZH A;  3I7F A;  4B3M Q;  1Q82 C;  1I94 L;  4JBW A;  4A3F G;  3J80 c;  4QQB X;  4JI7 L;  5JEA G;  1VQ9 A;  4DR2 Q;  5IE8 A;  3I4N H;  3HOY H;  1GD7 A;  3T1Y Q;  4A3K G;  1EQQ A;  1Q86 C;  1JJC B;  3I2Z A;  1QVG A;  2HHH L;  2UU9 Q;  3E9H A;  4JI6 Q;  3AEV A;  1Y1V H;  2WB1 E;  1S3O A;  2JA9 A;  2I0Q A;  4DV3 Q;  5LMU Q;  3PUV A;  1EOV A;  1SRO A;  3TRE A;  1ASY A;  1VQM A;  1Q46 A;  3PO3 G;  3OYY A;  4A3G G;  3D31 A;  4JI8 Q;  1UE1 A;  2JA7 G;  1VQB A;  3NEM A;  2AWN A;  2HIV A;  2IT1 A;  2N49 A;  3J81 c;  4B3R L;  1KXL A;  2N3S A;  1VQA A;  4X66 Q;  1TWH H;  4PMW A;  3FKI G;  1X9N A;  4A3J G;  3A0J A;  4X64 Q;  2VZA A;  1IBL L;  2PI2 A;  2ATW A;  3GTQ H;  4NB3 A;  3PO2 G;  3F1Z A;  4A4I A;  4DV4 Q;  4A3C G;  2MO1 A;  2ZM6 Q;  4O0A A;  1QVF A;  4AYB G;  5C4J H;  4NXM L;  2JQO A;  1PYB A;  2JA6 G;  2OCE A;  1HNZ L;  2XGT A;  2QGQ A;  5LMN W;  1HZB A;  4GLX A;  1CKM A;  3TEH B;  5IT9 c;  2R7F A;  3U50 C;  1NJI C;  2E2I H;  5M5W H;  2WP8 J;  1PYS B;  3UDG A;  2VUM G;  3GTP H;  3GDE A;  1D8L A;  4DV2 Q;  4DR5 L;  4OO1 I;  4TVA B;  1WCM H;  1SFO H;  2YTV A;  4PZ6 A;  4XIG S;  3CCM A;  4A3L H;  5IYB H;  3H0G G;  4IFD J;  5BR8 Q;  3JAM i;  2K5V A;  3RZD H;  2E5L Q;  1JJ2 A;  4P71 A;  4MZ9 A;  4BBS H;  4A3B H;  1I94 Q;  3AFQ A;  1C7Y A;  3CW2 C;  4JOI C;  1BBW A;  3VDY A;  4GLV B;  1HR0 L;  2NZH A;  4JI7 Q;  1R9T H;  2CCZ A;  1VQP A;  2EQS A;  2NZO A;  2HHH Q;  1KAW A;  3JC6 6;  1JE5 A;  1Q12 A;  5IP7 G;  4IFD G;  3UDX A;  2Q2T A;  5E7N A;  1XNR L;  3L2P A;  3F2B A;  4B3T L;  1N32 L;  4A3M G;  5GAG C;  1L1O C;  1VQF A;  1PH4 A;  4DV0 L;  2Y0S E;  4JI2 L;  4BY7 H;  4BXX H;  5C44 G;  3I4M G;  4A3D H;  3HKZ G;  4B3R Q;  1VS0 A;  1YHA A;  3M4P A;  2R93 G;  1IBM L;  3A74 A;  1PH1 A;  1P16 A;  2JEB I;  1IBL Q;  4RMF A;  3CCQ A;  2ZJP A;  3PUZ A;  4A93 H;  3GTO H;  2VS1 A;  4A3E H;  3LGJ A;  2OWO A;  1L2F A;  3G6E A;  4JCV E;  2YU9 H;  1FVI A;  1OXT A;  3RLO A;  3K0X A;  3CCR A;  3RLF A;  2JA5 H;  4IPH A;  4NXM Q;  3S14 H;  2VQF Q;  3H3V H;  3J7Z C;  2LSS A;  4BBR G;  1HNZ Q;  2PQA B;  1SRU A;  3KDF B;  1GO3 E;  2ZTD A;  3WWV A;  1W2B A;  3G4S A;  3ICE A;  4QJF A;  3AFP A;  1PV4 A;  3Q8D A;  4R4I A;  3CME A;  4DR5 Q;  4JBK A;  2F3I A;  1A8V A;  2ZJR A;  3NEL A;  2NVQ H;  4HJ8 A;  4DNI A;  4JBJ A;  3J81 j;  2LXK A;  1KQS A;  1LUZ A;  3RNU A;  1PH9 A;  1Y14 B;  5AJ3 L;  2B29 A;  4HID A;  1Q81 C;  1W3S A;  4JI0 L;  3CC4 A;  4LNQ A;  3ERS X;  4JC0 A;  2K14 A;  1SN8 A;  1HH2 P;  1X3G A;  3TS0 A;  1HR0 Q;  1K0R A;  2GN5 A;  2K50 A;  3ZJY C;  3OTO L;  1U0L A;  3ULJ A;  1VQ5 A;  2WAQ E;  4ME3 A;  4JV5 L;  2IHE A;  2FXQ A;  5DLQ E;  4JI5 L;  1HZ9 A;  1MIU A;  3CMA A;  1QUQ B;  1N8R C;  1JMC A;  4DAY B;  5HGQ A;  1YIJ A;  1S72 A;  1XNR Q;  4B3T Q;  3CCS A;  2PI2 E;  1LM0 A;  3W1B A;  4DR3 L;  2PMZ E;  1TXY A;  1UE7 A;  4JI2 Q;  3CCJ A;  2A8V A;  4DV0 Q;  2UXB L;  2MO0 A;  1EYG A;  5M3M H;  1CSQ A;  3J80 i;  5GAH C;  2VW9 A;  3ULP A;  3HOX H;  1IBM Q;  4BY1 G;  3IRB A;  2CKZ B;  4IFD I;  1RIP A;  2F4V Q;  2HIX A;  4DK6 C;  2KHI A;  3UE1 A;  4YWL A;  5FJ8 H;  2KHJ A;  1L1O A;  3GD7 A;  5FLM G;  4PG3 A;  1CKN A;  2JE6 I;  2RCN A;  4GKK L;  2K4K A;  1JB7 A;  2HQL A;  4A3I H;  1B70 B;  3KF6 A;  1PA6 A;  2K75 A;  2CQO A;  4A75 A;  3NBH B;  2UUA L;  5GAD C;  1YZ6 A;  4A3K H;  4WJ4 A;  3J81 i;  1MKH A;  2JA8 H;  5IYC G;  1HZC A;  3HOZ G;  1I6H H;  2Q2H A;  1LTL A;  1Y1V G;  5JJL A;  2GVA A;  1UWV A;  1A0I A;  4QGU A;  2BA0 A;  2I5M X;  3EN2 A;  3DLL A;  2JEA I;  4R4Q A;  2UXD L;  3PO3 H;  5M5Y H;  1SE8 A;  2YTY A;  4YCV A;  2EXD A;  2Q2U A;  2UUC L;  3S1N H;  4A3G H;  5AJ3 Q;  4IPC A;  4TQU S;  3F2D A;  1E3P A;  4JI0 Q;  2BH8 A;  3HFZ B;  3DM3 A;  4GOP C;  5K36 G;  1AE3 A;  2IY5 B;  4POG A;  2UUB L;  1EFW A;  3OTO Q;  5IP9 H;  1UE5 A;  2VQF L;  2LXJ A;  1BVS A;  1Q8K A;  1QZG A;  2UXC L;  1OTC A;  3BJU A;  4JV5 Q;  3HOW G;  4OXP A;  3PUX A;  1M1K C;  3PO2 H;  1X65 A;  4JI5 Q;  4B3S L;  1HR0 W;  4A3C H;  4X62 L;  4UPA A;  1VCI A;  1UEB A;  1VQH A;  3GTL H;  4IJH A;  3K7U C;  5M3F G;  2KEN A;  3L0O A;  4DR3 Q;  2AWO A;  3S1R H;  2AMC B;  4GKJ L;  2JA6 H;  2UXB Q;  1V43 A;  4A3L G;  1J5E L;  4POF A;  4LUZ A;  1I50 H;  1TWF H;  3GTJ H;  1E24 A;  4LF6 L;  4NXN L;  1E22 A;  1NMF A;  3T1H L;  2OTJ A;  3L7Z C;  2R92 G;  1NE3 A;  2C35 B;  3ULL A;  3G71 A;  4DUZ L;  4GNX B;  3U58 A;  2VUM H;  1UE6 A;  2KBN A;  4JI1 L;  3CCE A;  3EBE A;  1LYL A;  1WCM G;  1KD1 C;  4GKK Q;  3RN2 A;  5IYB G;  4OX9 L;  2R7Z G;  1JJG A;  1TWC H;  4HJA A;  4BBS G;  4A3B G;  1HNX L;  1PFS A;  3M4Q A;  2WB1 G;  1VQK A;  2UUA Q;  1OXV A;  1VQL A;  2A19 A;  3K80 C;  4OWW B;  2I5L X;  2ZTC A;  3CPW A;  1YJN A;  1N9W A;  2ES2 A;  4DPG A;  4JI3 L;  3S2H H;  4GN4 B;  4AIM A;  4JI4 L;  4P72 A;  5C4X H;  2IX1 A;  5IYD H;  5HY6 A;  1WOC A;  1XPO A;  1VQO A;  1VQJ A;  4DUY L;  2UXD Q;  2K52 A;  5GRO A;  1P8L A;  1KRS A;  4IPG A;  4HIM A;  1PH6 A;  2UUC Q;  4BXX G;  1HZA A;  5ELN A;  2ALY B;  2QA4 A;  1VQ6 A;  4YY3 L;  3I4M H;  5FLX c;  1GKH A;  4A3D G;  1XMQ L;  1N36 L;  4YCW A;  1XPR A;  2UUB Q;  2E8G A;  3PGZ A;  3PUY A;  1CUK A;  1OXS C;  4LW1 A;  4HJ7 A;  3CP0 A;  2UXC Q;  4ALP A;  1IBK L;  4FDB A;  4A93 G;  3S15 H;  4GN5 A;  1S40 A;  4B3S Q;  2H5X A;  4MNO A;  3FHW A;  4GOP A;  3CPF A;  4X62 Q;  1K8G A;  3CC2 A;  2I5H A;  2NN6 G;  2CWA A;  3S16 H;  3M4O H;  1KHI A;  2JA5 G;  1SR3 A;  4GKJ Q;  2NVT H;  4DR1 L;  3MEF A;  3STB D;  1NMG A;  4MTN A;  4LUO A;  1J5E Q;  4KHP L;  2R7D A;  4QIW E;  3UDF A;  1A62 A;  3BZK A;  4IOA A;  1XMO L;  2OQK A;  3I4O A;  2F4V L;  4LF6 Q;  3T1H Q;  1C9O A;  4NXN Q;  2MQH A;  2IX0 A;  4P74 A;  4DUZ Q;  1Z9F A;  2R6G A;  3BU2 A;  4JI1 Q;  1C0A A;  1G29 1;  3CXC A;  1Y1W G;  1D7Q A;  4OX9 Q;  1VQE A;  4L5S A;  2YV5 A;  3BZC A;  4LFB L;  1TWG H;  2OQ0 A;  4H02 A;  3GTG H;  4PZ8 A;  2QEX A;  4HJ9 A;  1HNX Q;  1YNX A;  3HOV H;  4DAM A;  2F52 A;  4LF5 L;  1X3F A;  1FL0 A;  2Z6K C;  4JI3 Q;  4DV1 L;  1G51 A;  5C3E H;  3M7N A;  3A5Z B;  1PVO A;  2CFM A;  1YJW A;  2VY3 A;  2B63 H;  4JI4 Q;  1KRT A;  4OON A;  3U4Z A;  1K73 C;  2ZJQ A;  1PH2 A;  4KHZ A;  3HOU G;  4AYB E;  1M90 C;  3TRZ A;  3PV0 A;  4JYA L;  4DUY Q;  1GVP A;  2K5H A;  1VQD A;  1N33 L;  2HT1 A;  4YY3 Q;  4DV5 L;  5M5X H;  5M3M G;  5GAE C;  1YHQ A;  4LF4 L;  3SGI A;  2Q2I A;  4EX5 A;  1XMQ Q;  1N36 Q;  5C0X J;  4BY1 H;  4A3F H;  4OWT B;  1VQG A;  2D62 A;  3KOJ A;  2PNH A;  4YWK A;  4C2M H;  3I4N G;  1XNQ L;  4K0K L;  3MXN B;  3D0F A;  4O2D A;  1EIY B;  1IBK Q;  3HOY G;  5FJ8 G;  5ELO A;  1YEZ A;  5JJI A;  1VQI A;  2VL6 A;  4UP8 A;  2E2H H;  3E9I A;  4A3I G;  2ZTE A;  3HKS A;  1B8A A;  3E0E A;  2B3G A;  1WI5 A;  3AYH B;  3KYH C;  2DGY A;  4P75 A;  4DR1 Q;  5C0X G;  2JJQ A;  1N34 L;  4KHP Q;  2MNA A;  1WYD A;  1MJC A;  4DV6 L;  2JA7 H;  1XMO Q;  4LFA L;  5IYC H;  1DGS A;  2N8N A;  4GOP B;  1E1T A;  1I3Q H;  2EIF A;  3KF8 B;  4YWM A;  4LFC L;  3K81 C;  4UP7 A;  2JA8 G;  3RZO H;  3S1M H;  4DR4 L;  2VNU D;  1K8A C;  3FKI H;  3F2C A;  2Z0S A;  3HOZ H;  2NN6 I;  4A3J H;  4R4T A;  4KI0 A;  1PH3 A;  4LF8 L;  4HJ5 A;  3K8A A;  1X54 A;  4LWC A;  3H3V I;  4BA2 I;  4C3I H;  2WAQ G;  4JBM A;  3G48 A;  3HKZ E;  4LFB Q;  2BH2 A;  2RF4 A;  4RG1 A;  4DR7 L;  1Z47 A;  1ASZ A;  4KLK A;  3S1Q H;  3U4V A;  3A5U A;  5IP9 G;  1OXX K;  4LF5 Q;  1MJE A;  4GS3 A;  3PF4 A;  3KJO A;  3F8T A;  1GM5 A;  3HOW H;  4DV1 Q;  4C3J H;  2PQA A;  3KDF A;  4LUV A;  3B6Y A;  4DKA C;  3I55 A;  4LF7 L;  3PCO B;  3H15 A;  4OWX B;  3PIO A;  1NY4 A;  1T9H A;  1VQ8 A;  2YYZ A;  4Y52 H;  1PH8 A;  1YI2 A;  1Q7Y C;  3PSI A;  2NVY H;  5M3F H;  3CCU A;  1Q1E A;  4DV7 L;  1K9M C;  1VQN A;  4JYA Q;  2XTI A;  1U5K A;  1SMX A;  4HIO A;  1N33 Q;  2ID0 A;  4L5R C;  1IYJ B;  2Z6K A;  3H0G H;  4IPD A;  4LF9 L;  1G6P A;  4DV5 Q;  3CCL A;  1WJJ A;  4LF4 Q;  3UE0 A;  1XTD A;  4P73 A;  1X6O A;  2V1C C;  4J15 A;  1YHB A;  2R92 H;  1RL2 A;  2MFI A;  1BBU A;  2D0P A;  4IJL A;  3KJP A;  4HIK A;  4K0K Q;  1XNQ Q;  1L1O B;  1CKN B;  1I5F A;  2R7Z H;  4C3H H;  2ASB A;  3W1G A;  1WFQ A;  2KCT A;  1PH7 A;  5IP7 H;  2L15 A;  4R1J A;  3KF6 B;  4APV A;  1TWA H;  3JAM c;  3M85 A;  5LMN L;  3PF5 A;  1YJ9 A;  1FJG L;  4DR6 L;  1QUQ A;  1EWI A;  4GNX C;  4YHH L;  4A3M H;  1FGU A;  2KCM A;  2WFW A;  1KL9 A;  3PUW A;  1N34 Q;  1HNW L;  4UY8 C;  3M3Y H;  3NEN A;  4DV6 Q;  4LFA Q;  5C44 H;  1K3R A;  2AKW B;  4BY7 G;  5IWA L;  4LFC Q;  4BA1 I;  4X65 L;  1K83 H;  1J6Q A;  4DR4 Q;  3EIV A;  1VQ7 A;  2R93 H;  1X3E A;  1YIT A;  1JT8 A;  5C4X G;  5IYD G;  2N78 A;  5J3B A;  1N32 Q;  4LF8 Q;  2NVX H;  1AH9 A;  4A76 A;  2RHS B;  5C0X I;  2VQE L;  1O7I A;  1XJV A;  4AQY L;  1SLJ A;  4A3E G;  1XPU A;  4DR7 Q;  3TQY A;  4WJ3 M;  1PHJ A;  3ER0 A;  4B3M L;  2IHF A;  5JJK A;  3M9B A;  1E1O A;  4DR2 L;  4BBR H;  1YVC A;  1X56 A;  1NTG A;  3AQQ A;  1CSP A;  2RHQ B;  3T1Y L;  2AHO B;  3S2D H;  2UU9 L;  2JK8 A;  4LF7 Q;  3KLW A;  3I56 A;  4JI6 L;  1E7Z A;  1A63 A;  4UP9 A;  2GVB A;  1B7Y B;  3RR5 A;  1VQC A;  3W5O A;  4DV7 Q;  4YCU A;  1EUJ A;  1V1Q A;  1PH5 A;  1L0W A;  4DV3 L;  5LMU L;  3OW2 A;  4PZ7 A;  4LF9 Q;  2D0O A;  3CQZ H;  3GO5 A;  4IO9 A;  1VQ4 A;  1X55 A;  3FP9 A;  4XTC S;  1EQR A;  4JI8 L;  4DK3 C;  3PIP A;  4GLA C;  1YBY A;  1BKB A;  1OXU A;  4X66 L;  4EQ5 A;  3GTK H;  1IXR A;  4L5T A;  1KIX A;  4X64 L;  1Y1W H;  2A1A A;  3CF5 A;  5H1S E;  1IZ6 A;  2OTL A;  1KC8 C;  2DUD A;  4R4C A;  3S24 A;  1HJP A;  3CD6 A;  2Y0S G;  2BA1 A;  4NPS A;  4GN3 B;  5EAY A;  3CCV A;  5LMN Q;  4DV4 L;  3J7A 5;  3CC7 A;  3RN5 A;  3CAM A;  1FJG Q;  2ZM6 L;  4OO1 G;  4Y7N H;  3HOV G;  4DR6 Q;  4X6A H;  1H95 A;  4JG2 A;  5GQO A;  3GTM H;  4YHH Q;  2CWP A;  4R4O A;  1HNW Q;  1V9P A;  3STB C;  4IOC A;  1QVC A;  1AE2 A;  5IY0 A;  4QL5 A;  5C3E G;  4AH6 A;  5IWA Q;  3RLN A;  3K7A H;  5JEA J;  4X65 Q;  2B63 G;  2K5N A;  3UDI A;  3HOU H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...