1Z9FA

Crystal structure of single stranded dna-binding protein (tm0604) from thermotoga maritima at 2.60 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
109
structure length
89
Chain Sequence
HMSFFNKIILIGRLVRDPEERYTLTPVTTFTIAVDRTTDFFRIVTFGRLAEFARTYLTKGRLVLVEGEMRMRRKRVSPEVVANVVRFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-strand binding protein
publication title Crystal structure of a single-stranded DNA-binding protein (TM0604) from Thermotoga maritima at 2.60 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Dna binding protein
total genus 16
structure length 89
sequence length 109
ec nomenclature
pdb deposition date 2005-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1z9fA00
1E22A 4JYAL 2I5MX 1M1KC 2IHFA 1CKMA 1PFSA 5AJ3Q 1YNXA 2KCMA 3KDFB 4YCUA 4YWKA 4JI1L 1G51A 3AFPA 3AFQA 3MEFA 5EAYA 1XNRQ 4B3TL 1FJGQ 1YHBA 3AYHB 3CW2C 3OTOQ 3UDXA 3U50C 5FJ8H 4DV2Q 1VQ9A 1YVCA 1WJJA 4LF7L 2XTIA 1IYJB 3T1YQ 2AMCB 4MNOA 4HJ7A 1VQNA 4HJ9A 3CCLA 3F1ZA 3F2DA 2PMZE 5LMUL 2VY3A 4PZ6A 2GVBA 3CMAA 4LFBQ 1I50H 1N34L 1HR0Q 1Y14B 4B3SQ 2K52A 1YITA 2KBNA 2Z6KA 4JBWA 4IO9A 5FLXc 1VQBA 3KJPA 3CCEA 4X66L 1Q82C 3E0EA 4L5QA 3S24A 1N8RC 4DV5Q 3PO3G 1N36Q 1FVIA 1KRSA 2Z0SA 4DAMA 1RL2A 1LYLA 3PGZA 2MNAA 1EFWA 4LF4Q 2E5LQ 5AJ3L 2Y0SG 4P73A 1VQIA 1SLJA 5J3BA 2K4KA 2R6GA 2YYZA 3CP0A 1OTCA 1K8GA 1GD7A 4A93G 1XNRL 4AQYQ 1FJGL 4JBMA 3HOZH 5C4JH 5HGQA 3OTOL 4ALPA 4DV2L 2Z6KC 1VQOA 4DR4Q 4FDBA 3T1YL 2ZJRA 1Z9FA 1HJPA 3VDYA 3KDFA 4C3HH 2GVAA 2NZHA 3M3YH 3K0XA 4GLVB 2IT1A 2D62A 1YHAA 4P71A 2NN6I 1C9OA 4LFBL 4DV4Q 5K36G 1HR0L 4B3SL 2JA5G 5LMNQ 1PH3A 5C3EH 3G71A 2HT1A 5C44H 4A3KH 2JA6H 4DV5L 1N36L 4LF4L 2RF4A 2E5LL 3KFUA 2CCZA 1I3QH 1EIFA 1V9PA 3ULJA 1XJVA 4O2DA 4AQYL 4QIWE 2WB1G 4A3DH 3CMEA 1YHQA 4GN3B 2E8GA 2WFWA 4X65Q 1N33Q 3NELA 2EXDA 4DR4L 3A5ZB 2MO1A 4DR2Q 4A3MH 2UU9Q 2UXBQ 2H5XA 4GOPB 3L7ZC 4DV4L 2Q2IA 1NMGA 3K7UC 3I56A 5LMNL 4BA1I 2VUMG 3UE1A 5IYCG 1K3RA 1Y1VH 3EBEA 2A19A 1BBWA 2Q2TA 3GDEA 1CUKA 4A76A 4A3LG 3CCJA 4DR5Q 5IP9G 3S14H 2K50A 3HFZB 3I4OA 1XMOQ 2MO0A 3UDGA 2ZTDA 1MKHA 4XIGS 4UP8A 4J15A 4P75A 5IYBG 3GD7A 4X65L 1N33L 2PI2A 3K8AA 4DR2L 2LSSA 1C7YA 1FGUA 2YTYA 4DAYB 2E2JH 3HOWH 1E3PA 4QQBX 4JOIA 1NBWA 2UXBL 1E24A 2UXCQ 1N32Q 3WWVA 5GQOA 4L5RC 4QY7A 5C4XG 5E7NA 4JC0A 3STBD 4DUYQ 1A8VA 4YY3Q 4A3CH 4JG2A 3HOXG 4LF9Q 4YWLA 1O7IA 4DR5L 2JK8A 2OTLA 1WCMG 4UPAA 2R7FA 1PVOA 4JI0Q 2CWPA 3BU2A 2WAQG 1GKHA 4KLKA 1UE5A 1PH6A 3GTPH 4DV0L 4BXXG 4R4IA 4A3EG 1X9NA 2UXCL 2KHJA 1JE5A 1OXTA 2IHEA 4A3JH 4IOAA 1N32L 4GOPC 1X54A 3M4OH 1H95A 4A3IG 1HNZQ 3MXNB 2EQSA 2E2HH 4B3TQ 1VQAA 2OTJA 4YY3L 4JI4Q 2B3GA 2NN6G 1EUJA 3CCVA 2F3IA 1S3OA 2CKZB 2VQFQ 1VQGA 2IY5B 3M9BA 4LF9L 2R93G 2Y0SE 2NVXH 1E1TA 3PO3H 3GTLH 2PI2E 5GAGC 5GADC 4YCWA 4JCVE 4X64Q 4JV5Q 3A0JA 1YJ9A 4JI0L 4A93H 1XPUA 1UWVA 1YJWA 4QJFA 4R4OA 3K81C 1PH4A 1YZ6A 4PG3A 2I0QA 5DLQE 4OXPA 5JEAJ 1W2BA 1VQCA 5GAEC 1CSQA 1PA6A 1HNZL 2K5NA 4XTCS 4JI4L 1HH2P 1MJCA 4OWXB 3RLOA 1HR0W 1X3GA 3D31A 5M3MG 2JA5H 3H0GH 2VQFL 4X6AH 1VQDA 1OXSC 1YBYA 1OXVA 1YIJA 4IFDJ 4UP9A 1Q81C 2JA7G 1IZ6A 1KAWA 3J7ZC 3PSIA 2WB1E 4K0KQ 4X64L 3A74A 1X3EA 4JV5L 2L15A 4A3GG 4IPHA 2R7ZG 2RHSB 1V1QA 3IRBA 2JEAI 2GN5A 3J81i 1E1OA 3J81j 1X55A 3E9IA 4EX5A 1IXRA 4JI6Q 1SROA 4BBSG 4A3BG 1Q8KA 2QA4A 1EYGA 2VL6A 5IP7G 2F4VQ 3PO2G 1WOCA 1VCIA 1KXLA 2N49A 2K75A 5LMNW 3CC7A 2C35B 4IJLA 2OWOA 1PH1A 2VUMH 1K0RA 4LF8L 5IYCH 3E9HA 1BVSA 2CFMA 3L0OA 5IYDG 3F2BA 3UE0A 4B3MQ 3TRZA 4K0KL 4A3LH 3GTJH 4DNIA 5IP9H 1IL2A 2YV5A 2HHHQ 1VQKA 2V1CC 3EIVA 4DUZQ 2UUAQ 4JI5Q 4JI7Q 3TS0A 3GTMH 5IYBH 5M3FG 1SFOH 2E2IH 3S1NH 4JI6L 1WYDA 1SRUA 3L2PA 2I5LX 3Q8DA 1B7YB 2NVQH 4IJHA 4IPDA 4KHZA 3PUZA 2F4VL 5M5YH 1QZGA 1KD1C 1WI5A 4DV1Q 5C4XH 1B70B 3ER0A 4X62Q 2JA8G 2YTVA 5JJLA 1AH9A 3TS2A 3BZCA 1IBKQ 3RZOH 3M4QA 1NJIC 4OONA 1LTLA 3FP9A 4TVAB 1VQ7A 2JE6I 2A1AA 4BA2I 1UE6A 5C0XG 3KOJA 3HOXH 2B63H 3CPWA 4B3ML 4R4QA 1J5EQ 4LF5Q 2UUCQ 2HHHL 1WCMH 2ALYB 2WAQE 4O0AA 4LUVA 3BZKA 4DUZL 1PV4A 2UUAL 4JI5L 4DV7Q 1L0WA 4JI7L 1G291 2VQEQ 2ASBA 4WJ3M 3W5OA 1V43A 1KL9A 4DV6Q 4HJ5A 1VQ4A 1NTGA 4BXXH 1NY4A 1SE8A 4R4CA 4DV1L 4A3EH 1JMCA 1VQLA 4A75A 4X62L 4A3IH 1TXYA 1IBKL 4A4IA 3PUYA 4EQ5A 3I4NG 4R1JA 2FXQA 2ID0A 3CF5A 4DV0Q 1UE7A 2BA0A 3CQZH 3CCRA 2R93H 3CPFA 1J5EL 4LF5L 1AE2A 2UUCL 2DGYA 1XNQQ 1I5FA 3H3VI 1A63A 3RLFA 1C0AA 4DV7L 4UP7A 1VQEA 2OQ0A 1T9HA 1K9MC 1L1OC 2RCNA 5M5WH 1ASYA 4UY8C 2VQEL 3J81c 3S2DH 4GOPA 3JAMi 4DR1Q 3ULLA 5FLMG 1M90C 4DV6L 1VQMA 3LGJA 4AYBG 2PNHA 3KLWA 4BY7G 1I6HH 4HJAA 4HIDA 2LXJA 1KQSA 2AKWB 4LNQA 1PYSB 1PH8A 4LFCQ 5M3MH 2VZAA 2BH8A 4LUOA 1Y1WG 2R7DA 3CCSA 1XNQL 2JA7H 3CC2A 1WFQA 2I5HA 3PV0A 1CKOA 4MTNA 1Z47A 2KENA 3I7FA 4RMFA 2IX0A 1PH5A 4AIMA 3S1RH 3ICEA 2KCTA 4A3GH 4OWTB 5C0XI 4GLXA 3S15H 4KHPQ 2R7ZH 1X56A 3JC66 2JJQA 1TWHH 1P8LA 4NPSA 4DR1L 2K5VA 1VQFA 3TEHB 1XPRA 3PCOB 1K73C 4BBSH 4A3BH 1E7ZA 1VS0A 5IP7H 3PO2H 1YJNA 5IWAQ 1HZAA 3PUXA 4ME3A 4LFCL 3STBC 1KHIA 1I94Q 2R92G 4C3JH 1NMFA 2AWNA 3H3VH 2D0OA 2Q2HA 1PH7A 3HKZG 3ERSX 4KI0A 5IYDH 2YTXA 1KIXA 1PYBA 2DUDA 2K5HA 2PQAB 4GN4B 3RNUA 1EIYB 3GTKH 4LUZA 3FKIG 4PMWA 4KHPL 3HOVG 4LF6Q 1Q1EA 4NB3A 3BJUA 3ZJYC 4OWWB 3CC4A 4PZ8A 1HNXQ 4LF8Q 5IE8A 3GTQH 2HQLA 1QZHA 3UDIA 1A62A 2EIFA 1G6PA 5JJKA 4QL5A 5M3FH 2HIXA 2MFIA 1DGSA 1A0IA 3TQYA 3PF5A 3G6EA 2ES2A 3G48A 4BBRG 1U0LA 5IWAL 3EN2A 4LWCA 4APVA 1I94L 2JA8H 2NVTH 4IPGA 1QUQB 2N3SA 4POFA 4IOCA 2D0PA 4QGUA 4LW1A 2WP8J 3OW2A 3GTGH 3HOUG 1HZBA 4DR3Q 1FL0A 1EQRA 3A5UA 3G4SA 4LF6L 4AH6A 4A3JG 2UXDQ 4A3FG 1X65A 1HNXL 1IBLQ 4IFDI 2K14A 3HOYG 1SMXA 3D0FA 1OXXK 3NEMA 3JAMc 1VQPA 2PQAA 3KYHC 1K8AC 3F8TA 4LFAL 5JJIA 3NENA 2NZOA 1RIPA 3W1GA 4JI3Q 4RG1A 4NXMQ 1EOVA 1EWIA 1GO3E 4NXNQ 1MJEA 1KRTA 1L1OB 2OQKA 1Q7YC 2AWOA 5M5XH 4BY1G 1BBUA 1YEZA 4YWMA 3I4MG 2Q2UA 4R4TA 1NE3A 3K80C 3I4NH 4DR7Q 4DR3L 4DK6C 4IPCA 4JI2Q 1JJ2A 3TREA 2VS1A 3S16H 2ZM6Q 1XTDA 4HIKA 3S1QH 4H02A 2MQHA 1S72A 1IBLL 4P72A 1B8AA 4GNXB 1QUQA 2CWAA 5IY0A 3PUWA 2JA9A 4AYBE 5FJ8G 3I55A 3RN5A 3GO5A 2F52A 3H0GG 3PIOA 1LM0A 5FLMH 4JI3L 4NXML 2HIVA 3ULPA 2VNUD 4Y7NH 1ASZA 4NXNL 3OYYA 1XMQQ 4BY7H 1QVCA 2ATWA 4HIOA 1TWGH 2N8NA 3RN2A 1QVGA 4DV3Q 1W3SA 3CXCA 2BA1A 4TQUS 4DR7L 3J80i 4GN5A 2CQOA 2JEBI 3I2ZA 1Y1WH 4JI2L 1VQJA 3U4VA 3KF6B 4OO1G 4GKKQ 3T1HQ 1GVPA 1R9TH 1PH9A 1L1OA 3PUVA 2ZM6L 1GM5A 4OX9Q 1D7QA 4HIMA 5ELNA 2BH2A 1D8LA 3M4PA 1Q86C 3HOZG 2UUBQ 1JB7A 1JJCB 3RR5A 1JT8A 1MIUA 1AE3A 3H15A 2ZJQA 1N9WA 4HJ8A 3RLNA 5HY6A 1XMQL 1YI2A 1SN8A 1CKNB 4MZ9A 4JI8Q 4GLAC 3M85A 4GNXA 3B6YA 3W1BA 4DV3L 1VQ6A 5C3EG 2YU9H 3CCUA 3HKZE 1PHJA 2R92H 1BKBA 5C44G 4A3KG 1TWCH 2JA6G 2KHIA 4B3RQ 1EQQA 2OCEA 3AEVA 5JEAG 4GKKL 3T1HL 4WJ4A 3KF8B 4DK3C 2VW9A 1VQ8A 4OX9L 4Y52H 3FKIH 4A3DG 3PIPA 1Q1BA 4L5TA 2ZJPA 4GNXC 2UUBL 3HOVH 2ZTEA 4IFDG 2NVYH 4GKJQ 1OXUA 1XPOA 2XGTA 2UU9L 3M7NA 3KF6A 4A3MG 4L5SA 1LUZA 3CCMA 3UDFA 4YHHQ 3RZDH 3S1MH 1HNWQ 5C0XJ 2B63G 4DR6Q 4JI8L 4DPGA 4BBRH 3CCQA 4JOIC 5ELOA 3AQQA 3U4ZA 4JBJA 1UEBA 2QEXA 2IX1A 5BR8Q 1XMOL 5IT9c 1U5KA 3K7AH 4B3RL 1Y1VG 4GS3A 1TWAH 3FHWA 3NBHB 1IBMQ 2A8VA 3HOUH 1CKNA 3KJOA 4JYAQ 1KC8C 2B29A 3SGIA 1PH2A 1VQ5A 2UXDL 4PZ7A 1JJGA 1SR3A 3F2CA 2JQOA 4JI1Q 3S17H 4A3FH 3PF4A 1VQHA 4YCVA 2ZTCA 4DUYL 3HOYH 4GKJL 1P16A 4OO1I 4POGA 2AHOB 4C3IH 4JBKA 1HZ9A 1UE1A 1L2FA 1QVFA 3HOWG 3J7A5 2LXKA 4YHHL 4DKAC 1HNWL 4DR6L 2N78A 1J6QA 3U58A 4LF7Q 1X6OA 1CSPA 3DM3A 3DLLA 1K83H 2RHQB 1S40A 1HZCA 3CAMA 3HKSA 4C2MH 5BR8L 1X3FA 5LMUQ 3GTOH 4A3CG 3S2HH 1N34Q 1Q46A 5GAHC 4BY1H 3I4MH 4LFAQ 4P74A 3J80c 1Q12A 4X66Q 1TWFH 2QGQA 1IBML 3CD6A 5H1SE 5GROA
chains in the Genus database with same CATH superfamily
4JYAL 2B2UA 4A3IB 1M1KC 1CKMA 5BN3A 5AJ3Q 2PZWA 4YCUA 1QG7A 2KHSA 4KHVA 4DAPA 3NBHA 3E5SA 4IQZA 3T1YQ 4MNOA 4HJ7A 2EY1A 4FF1A 3F1ZA 2JP1A 2PMZE 5FLXE 4PZ6A 4LFBQ 4B3SQ 2K52A 2Z6KA 2SNSA 4X66L 4L5QA 1N36Q 2Z0SA 4K5VA 1EFWA 2UU9L 4WORA 2E5LQ 3BVZA 1SLJA 3TZDA 1OTCA 2EYHA 1K8GA 2A6HD 5IGGA 1XNRL 4AQYQ 5M3MB 5KNBA 5HGQA 3OTOL 4H0LC 1TT2A 4ZCKA 4DV2L 2ZT9C 5JOBA 1Z9FA 4NMZA 4C3HH 3M3YH 4EQPA 1M4VA 4J1MA 5K36G 1DOLA 3SE0A 4DV5L 4WRDA 4A3BB 1FNUA 2XSCA 5JEAH 4LF4L 3N6RA 1XJVA 4O2DA 4G7OC 3J80E 2IJ0A 4HSVA 3DEOA 4X65Q 1W6KA 3NELA 3A5ZB 2MO1A 4K8IA 1ENFA 3BDLA 3KLSA 1Y69U 3I90A 5CORA 5LMNL 2CW0D 3UE1A 5IYCG 4QB4A 2XN9C 3EBEA 1EQTA 1TY0A 3C1EA 5IP9G 2K50A 3HFZB 2EY5A 2ICEC 3K5OA 4LJZC 4XIGS 4P75A 2WV6D 1N33L 1BCPB 2UXCQ 1LABA 4DNTB 3T56B 1EY9A 5C4XG 4JC0A 1F9SA 4DUYQ 3A8IE 2DNEA 3HOXG 3BG3A 2QKIC 1GUNA 3GTMB 1HRJA 3A56A 5M5XB 5C6AA 5FLXL 4F7XA 4JI0Q 1XXGA 2AQ2B 2C9OA 3F2UA 1UE5A 3T4AC 4R4IA 1TQOA 1OXTA 1HPCA 3OOCA 4GOPC 1H95A 3MXNB 2EQSA 3HOXB 1EUJA 4PQXA 2F0OA 3SXHA 1S3OA 4DAYA 4RHRA 2IY5B 3M9BA 4LF9L 1SNOA 2M00A 2A68C 4AYBB 2NVXH 4JCVE 4X64Q 4RAUC 3A0JA 3D8GA 4J6HA 4QJFA 3NTIA 5DLQE 3ITPA 1W2BA 3SEBA 4HCSA 1PA6A 5E4WC 5D3DA 4JI4L 4KY7A 3TMEA 5K36H 1G6ZA 2GA4B 1SYEA 2JA7G 3KK7A 1DM0B 1KAWA 1PTOH 1V1PB 4RWSC 3AU7A 4JV5L 2R7ZG 1GUTA 1GJXA 4V0BA 3E3XA 3QOLA 5IT9E 4BBSG 2EYOA 4RGOS 2BOSA 4N9TA 3HOVB 1GHJA 1VCIA 5LMNW 2JA7B 2C35B 4C3JG 3ND8A 5IYCH 3S1RB 2LMCB 3WOFA 2R7ZB 5IIFA 4K0KL 1F9QA 2K5DA 5IP9H 2YV5A 4IN3A 1VQKA 3EIVA 4DUZQ 4JI5Q 3GTMH 1R4PB 4DN4M 1F77A 4KJNA 3OSOA 4LMQD 1KTKA 2BCOA 1J8IA 2SOBA 4C3JB 2QDBA 4ID6A 5C4XH 1KNAA 4HMIA 3TS2A 1IBKQ 3M4QA 2SNMA 4OONA 1BQQT 4TVAB 1VQ7A 2JE6I 4BA2I 5C0XG 1LTBD 3KOJA 3HOXH 2RSOA 2KOLA 4B3ML 1A2UA 2ALYB 3EFXD 4LUVA 4K6LA 1QJOA 4EQOA 1TWFB 2O4XA 1Q90A 2ASBA 1XTCD 4KV6A 1VQ4A 4R4CA 4DV1L 1STHA 1VQLA 4A75A 1PZJD 2EXZA 4X62L 2CH4W 4A4IA 5J22A 1KLUD 2QCPX 3I4NG 2FXQA 2NZ1D 3CF5A 1JB3A 2EYFA 1II3A 1VDZA 4LF5L 1GOZA 4EVOA 3H3VI 1A63A 3ERQA 4DV7L 3RD4A 4OHJA 1K9MC 5CC4A 1ZKOA 4GOPA 5KYLA 3ULLA 3LGJA 1H9KA 3KLWA 4PNYA 4C56C 2J0TD 4BY7G 3M4YA 5EKKA 4HJAA 1ILQA 2LXJA 3HOZB 1KQSA 3I4NB 1PH8A 4ZAIA 2A69D 4LUOA 3S1QB 2JA7H 5C3XA 2I5HA 3PV0A 1K3BC 4RMFA 3CC2A 2KENA 1G2SA 3S1RH 1G2TA 1QNKA 3ICEA 1A15A 2F0JA 1LTSD 5C0XI 2R7ZH 5I2YA 1B1ZA 1A2TA 1IL8A 5L37A 4BBSH 2EPBA 2JYOA 3STBC 4UDUC 4QUCA 4LFCL 1I94Q 2R92G 4C3JH 2AWNA 1R9TB 3H3VH 2OEOA 1PH7A 1ESRA 5J39A 3Q0AA 5C5LA 3H6MA 1PYBA 4GN4B 3C3LA 2TMPA 3W2DA 4LUZA 1IHZA 4KHPL 2B39A 3X3MA 1O78A 2EYMA 2WINB 3ZJYC 3CC4A 1HNXQ 4LF8Q 5KYIA 1Y1VB 1SSOA 2ZXRA 1DOKA 1G6PA 3ND9A 2MJ8A 3PF5A 3URYA 1I4XA 4APVA 2NVTH 3A8JE 1LTAD 1DONA 5T1IA 2D0PA 2WP8J 2AQ3B 2BE5D 3GTGH 5C0XH 3NXWA 3GV3A 1FL0A 4FF2A 1EQRA 2EE1A 4OIKA 1LT5D 3G4SA 3NWSA 4AH6A 4A3JG 2KVMA 1C48A 4IFDI 1WTPA 1SMXA 3NEMA 1YNJC 1CK1A 1K8AC 3F8TA 3MWYW 3K7AB 1NUCA 4FO2A 1I4RA 1L1OB 1R4QB 4YWMA 4XYQA 1NE3A 3I4NH 3NK9A 1Z6HA 4A3JB 1LLRD 3TREA 3D4DA 3S1QH 4HIKA 2MQHA 4P72A 1STYA 1CZWA 3R2IA 2F52A 2AQ1B 2PNRC 3PIOA 1FR3A 2WKDA 1XYIA 4NXML 2E2DC 3BVGA 2VNUD 1PFMA 1ASZA 4BY7H 4A93B 1QVCA 4IZ8A 4CBVA 3RN2A 3R93A 4V190 5C5MA 3J80i 3TDQA 3I2ZA 2LY7A 4GKKQ 1R9TH 1PH9A 4CJ0B 3PUVA 4HIMA 2BH2A 1D8LA 1IW7D 4RA8A 1JJCB 4KD3A 3HRZC 5CGKA 2L12A 1VMPA 1LTID 5HY6A 1XMQL 1SJED 5DNFA 3HKZE 1PMRA 2R92H 2JA6G 1EQQA 2E75C 4KN4C 2HD3A 1WVLA 1D1IA 1KDAA 1EU4A 3U9SA 2VUMB 4GNXC 5FO8B 2Z1CA 2ZTEA 4GKJQ 1OXUA 5CV6A 3M7NA 4A3MG 1X3QA 4L5SA 3CCMA 3GTJB 4CDEC 2B63G 1RODA 3VR4A 1JCKB 2JA6B 3CCQA 4JOIC 3AQQA 4JBJA 5BR8Q 3K7AH 5EPLA 2E74C 3D6CA 2A8VA 2R3ZA 4JYAQ 3TSSA 1KC8C 1ZEQX 1SR3A 4YCVA 2DJGC 5I6YA 2B63B 2AHOB 1PTOC 1RKNA 2RQXA 1QVFA 2O5JC 1EEFD 4DKAC 3K59A 1K83H 1B9NA 3CAMA 3EROA 5EQ0A 1CZGA 5GAHC 3IKJA 3H91A 3J80c 5E1FA 1Q12A 4X66Q 2QGQA 2UU9Q 1PRTC 1BCPC 1PFSA 3KDFB 1D5XC 4JI1L 1RDPD 3AFPA 3AFQA 3MEFA 2E2JB 1XNRQ 4B3TL 2K05A 2B8GA 3CW2C 1O7YA 3OTOQ 1NCVA 2Z9HA 5HGTA 4DV2Q 1Q3LA 1D6EC 1IYJB 4X3SA 4F8MA 1VQNA 4DFAA 3I72A 4ME5A 4X3KA 3CMAA 1I50H 1Y8PB 3HZXA 2KCNA 1F2YA 4IO9A 1Q82C 3KJPA 1VQBA 4E6IA 1B3QA 1N8RC 4DV5Q 1STNA 1KRSA 3PGZA 2MNAA 4LF4Q 4DXFA 4P73A 1VQIA 2K4KA 2YYZA 1FJGL 1STEA 3V96A 2IX3A 4JBMA 3L9AX 1EU3A 2F0QA 2Z6KC 5CV7A 1VQOA 2NTTA 4FDBA 3VDYA 2RCFA 3J7AF 1YHAA 4P71A 2NN6I 5JJZA 1GUWA 1ILPA 2JA5G 5LMNQ 3MAQA 2KEEA 2E76C 2JA6H 1JR0D 3KFUA 4WFN3 1U4RA 1V1OA 2SEBD 3CMEA 1YHQA 1NSNS 2E8GA 2DN8A 1N33Q 4DR4L 4IUNA 4MHEA 4A3MH 3PQIA 2B8FA 3GQBA 2JA5B 2H5XA 1DXMA 3L7ZC 1X3PA 1BOSA 4DV4L 4DK0A 3I91A 2F0FA 4RHSA 3GDEA 1YNNC 4A3LG 3CCJA 1ICFB 1EYDA 2G9DA 3S14H 2K04A 4EGVA 1SYCA 4N9PA 2MO0A 4J15A 1SE4A 5C3WA 3HGBA 2RDFA 2Z8LA 2EZVA 4DR2L 1C7YA 3NTHA 1FGUA 3QJYA 3R8BA 2QF7A 2E2JH 4JOIA 1NBWA 1EZ8A 3WWVA 1D1KA 4QY7A 1S4ZA 4S3SA 5E7NA 2AUJD 3SK8A 2PCFB 3G7LA 4XXEA 4JG2A 4NP5A 4OL7A 4LF9Q 1T5EA 4YWLA 1O7IA 3NQIA 4B08A 4DR5L 2OTLA 1WCMG 4UPAA 1SFOB 4X3TA 1PVOA 4TKOB 3H3VC 2CWPA 2PZUA 2L11A 2WAQG 1J9OA 5KNDA 1X32A 3GTPH 4DV0L 4A3EG 1N32L 1H9SB 2L9HA 2F0WA 2PYKA 1X54A 2KJXA 4A3IG 3V05A 4JI4Q 3CCVA 2F3IA 2V4DA 2CKZB 1VQGA 4XT1B 1WCMB 2R93G 2Y0SE 4Y7NB 3GTLH 3TZUA 5GAGC 5GADC 4YCWA 3I3CA 5FO7B 4L8JA 1ET9A 1ML0D 3K5LA 4JV5Q 1O7ZA 4ZKBB 1EYCA 2XIWA 1LT3D 2FJ2A 1XPUA 1UWVA 1IKMA 3OW7A 4R4OA 3MHBA 2F0MA 2Q8TA 4R8IA 1VQCA 5GAEC 1CSQA 1HNZL 4XT3B 1QB5D 4ZLTF 3RLOA 2OT2A 2R93B 4BS9A 4DK1A 5M3MG 2JA5H 2VQFL 3VR6A 1VQDA 4X6AH 4IFDJ 1TVXA 4QF4A 5NUCA 2NBFA 4CKCA 1RD9D 3I4LA 2WB1E 3MXNA 4K0KQ 1AW7A 1TWCB 2RHSB 2JSOA 2GN5A 1E1OA 1CQVA 1X55A 1SROA 2K1BA 4A3BG 4JK1C 2F0TA 5F2DA 1ICWA 2QILA 5C4ZA 1JWSD 1RTOA 1PH1A 3E9HA 3MXGA 2CFMA 3F2BA 4ZUJA 4B3MQ 4BBRB 3TRZA 4A3LH 2K03A 3T51B 2L5TA 2NWGA 1TWAB 2EJMA 5M3FG 1SFOH 2E2IH 1V1PA 2NVQH 4IPDA 1LV9A 4DV1Q 1CA5A 1B70B 4X62Q 5JJLA 1L0XB 4K2KA 3RZOH 1HUMA 2A6ED 1UE6A 3NUCA 3FEWX 3CPWA 1EOTA 3I73A 4RH6A 4Z9CB 1JC7A 2X6LA 4LF5Q 1F2MA 3GTQB 1WCMH 1I4PA 5M3FB 1E0BA 2ZXPA 3BZKA 2RVLA 4DV7Q 3I4MB 1L0WA 4JI7L 2A6HC 3VA5A 1B50A 2TSSA 3W5OA 5I4DA 3OHXC 4L63B 1KL9A 1DJRD 2B2WC 3TP8A 1NY4A 1SE8A 4A3EH 3OPOA 4EQNA 4KMUC 4A3IH 2OXPA 5ELEA 2Z4IA 1OO9B 4EQ5A 2CQAA 3NQTA 2ID0A 1UE7A 3CCRA 2R93H 2SDFA 3CPFA 4KD4A 3T13A 3RLFA 1C0AA 1SYGA 2OQ0A 1T9HA 1IYVA 1L1OC 4UY8C 5I6WA 4DV6L 3M7GA 4AYBG 5I9PA 1EY6A 3P75A 3MFYA 4HIDA 1I4QA 2AKWB 1TIID 1KDBA 4LFCQ 2CW0C 5M3MH 2K6AA 2BH8A 1XNQL 1WFQA 2PW5A 3R2TA 1PH5A 2KCTA 4KHPQ 5C3EB 4HAEA 3JC66 4NPSA 2VB3X 4DR1L 3PCOB 1JWUD 4A3BH 1E7ZA 1VS0A 1QCBD 1HZAA 3PUXA 5KGUA 1KHIA 3DUZA 2D0OA 2Q2HA 4XDXA 4M8AA 2EOTA 4KI0A 3A8KE 2IPKD 1EIYB 3RNUA 3J80L 3FKIG 3HOVG 1Q1EA 1HTLD 3BJUA 3DM1A 3GTQH 2HQLA 1QZHA 3UDIA 4CKBA 2EIFA 5JJKA 5M3FH 2HIXA 2MFIA 1DGSA 3E0JA 1HFNA 2YU9B 2ES2A 2IW3A 3G6EA 5IWAL 4LWCA 4IPGA 3T53B 1QUQB 3HOWB 4LW1A 3FKIB 5IGEA 2KECA 4Q0FA 5D14A 4YIJA 5CV8A 1FNWA 2K14A 3HOYG 2LKVA 2EDGA 1SNMA 3D0FA 1EY0A 4HMJA 4WJWA 4G7HC 5JJIA 4NXMQ 3W1GA 4JVZA 1EWIA 1MJEA 1KRTA 4B9XA 1Q7YC 1SMYD 1VF5C 2AWOA 3IFDA 5M5XH 2L4NA 1YEZA 2L0CA 2A5HA 2F0GA 1FD7D 3K80C 4DR3L 4IPCA 4J8QA 3M4OB 4KJOA 2VS1A 2E2HB 1CM9A 3QB3A 3HOYB 3K5MA 1ZYRD 4JPBW 2CWAA 5IY0A 3PUWA 2B2WA 5FJ8G 3PO3B 2NB0A 3H0GG 4C2MB 1FYCA 1I4GA 2VB2X 3OYYA 1XMQQ 4HIOA 3GV6A 3NTKA 2CHBD 4KN7C 2J4XA 2BA1A 1KDCA 5FKAC 5I9OA 4DR7L 4OGQC 4OO1G 1GVPA 1L1OA 5ELNA 3M4PA 3H0GB 3HOZG 3EQLC 1TKWB 1MIUA 1B44D 1N9WA 1CKNB 3FVQA 2PMZB 2WB1B 3W1BA 3DHQA 4I7AA 2YU9H 1PHJA 4G57A 1MGSA 1EYAA 2KHIA 1TS4A 2FFKB 1STGA 3PIP3 2OCEA 3FPPA 4U68A 3T1HL 4WJ4A 5FO9B 3FKIH 4A3DG 4IUTA 3HOVH 4IFDG 5IT9L 1XPOA 2ICIA 4JI8L 2F03A 5JVH3 2IX1A 3S1NB 1U5KA 4B3RL 4H7BA 1Y1VG 3FHWA 4A3DB 1Y8NB 1NR4A 1PH2A 3LWUA 3SGIA 2KCCA 2K32A 4M1UB 3F2CA 4KKSA 4JI1Q 1WTWA 5K5PA 5BN5A 4DUYL 2ZTCA 4OO1I 3HOYH 1P16A 1EQVA 1CT1D 4JBKA 4FXKC 3J7A5 2LXKA 2Q8IB 4DR6L 1J6QA 1ENCA 3LWEA 1PXUA 1LT6D 2RHQB 1S40A 4RGTA 4C2MH 1Q46A 4LFAQ 1BDOA 4P74A 1B2TA 1TWFH 2A69C 3CD6A 5GROA 2I5MX 1CQFA 1CHPD 1PFBA 3U9OA 1YNXA 2KCMA 1CTMA 1G51A 4QCLA 3HEJA 1FJGQ 1HUNA 3BDCA 3CQZB 3UDXA 5FJ8H 1VQ9A 1YVCA 1WJJA 2PW7A 3CCLA 3D4RA 2QDLA 3VR2A 3F2DA 1WTQA 5LMUL 2VY3A 5M5WB 3S2DB 1YITA 4JBWA 1TS3A 2FMCA 3E0EA 3S24A 3VYRA 3W3AA 2G5DA 1FVIA 3CRKC 1RL2A 2EYLA 1I6HB 4OO1H 4CDFC 1TR5A 1K8MA 2R6GA 3CP0A 4A93G 2D2CC 3SK5A 4ILWA 3HOZH 1CHQD 1KABA 4DR4Q 5EKLA 2ZJRA 1ESFA 3KDFA 4TSSA 5DEHA 3S15B 5IOCA 2ENBA 4HEDA 1RHPA 4DV4Q 1HR0L 2HT1A 1PH3A 3G71A 4FXDA 4DA2A 2BE5C 2CCZA 4FF4A 1V9PA 3ULJA 4QIWE 4A3DH 2DJFC 4ZK9B 3EVQA 4IFDH 5KNCA 1HA6A 1FGBD 4DR2Q 1Y8OB 2A73B 2C5CA 4GOPB 4XQNA 2MGSA 1QNUA 1SYDA 1KNEA 2Q2IA 3K7UC 5FOBB 2VUMG 2I07B 4BA1I 1HFGA 2F0UA 1K3RA 1Y1VH 4PMBA 1BBWA 2EYPA 1CUKA 3H09A 4A76A 5BN4A 4DR5Q 2K01A 4RCNA 1XMOQ 3UDGA 1MKHA 1GUSA 2KUMA 2PI2A 4QQBX 2UXDQ 2UXBL 1E24A 1N32Q 2RDGA 5GQOA 4X3UA 1DOMA 1K0SA 3TP6A 1HHVA 3SDZA 4HCEA 3BDOA 3G6JB 5DAUA 2QEJC 3BU2A 3Q23A 5M5YB 1IW7C 4BXXG 1X9NA 2N55A 3SK6A 1JE5A 2IHEA 4ODGA 4A3JH 3QIAA 1DCZA 1HNZQ 1VQAA 2OTJA 4YY3L 2B3GA 2NN6G 4R8NA 2VQFQ 1HQRD 1E1TA 3MZ5A 3MFGA 5EPKA 2X69A 1T5XD 3Q22A 4A93H 1BBXC 3C1FA 3SR1A 1Y1WB 1WTHA 3T16A 1CA6A 2K5NA 1SYBA 4OWXB 2O2LD 1HR0W 3D31A 4ZQ3A 3MXPA 4F87A 1OXSC 1YBYA 1OXVA 4UP9A 3NBIA 4HN7A 2KA7A 4MN3A 3A74A 1X3EA 3NWTA 2L15A 1ONLA 4IPHA 3FRPB 1H9MA 3IRBA 3NE5B 3J81i 3VYSA 4EX5A 3E9IA 1D5ZC 2K5WA 4R9WA 4KY5A 3HP3A 2QA4A 1EYGA 3PO2G 1TY2A 1KXLA 4IJLA 1I4HA 3DWAA 2OWOA 2VUMH 1K0RA 4LF8L 1BVSA 3L0OA 5AFWA 5IYDG 5CV4A 5ELBA 3VYUA 3K5NA 3UE0A 4OEMB 3RZDB 3GTJH 4KTAA 3BZDB 1AN8A 2V1CC 4I7ZC 1SNQA 4JI7Q 3TS0A 1DYQA 2XVSA 5CV5A 4JI6L 3PO2B 3Q8DA 1B7YB 5M9OA 4KHZA 2F4VL 5M5YH 1QZGA 1KD1C 3S17B 3ER0A 4A3FB 2JA8G 3BZCA 4C3IB 3GTKB 1LTLA 3FP9A 1WD1A 2B63H 2H1EA 4R4QA 2F0VA 2F1MA 1K8OA 2HHHL 2Z6BA 3NPPA 4O0AA 2UUAL 1PV4A 4BY1B 1SE2A 1U4LA 4F88A 1WD0A 1GUOA 2A74C 5EKIA 4DV6Q 2JA8B 4BXXH 1JMCA 3K57A 3GP7A 2IWHA 5DM63 1TXYA 1D2BA 5EGTA 4O1NA 2NN6H 3PUYA 5E4XA 4R1JA 3DMUA 2BA0A 2L1BA 1J5EL 2PPBC 1RF2D 2R61A 1XNQQ 2UUCL 1V8QA 3A54A 3DWPA 2HDLA 3Q24A 4UP7A 1VQEA 2B2TA 2RCNA 4RCOA 2VQEL 3J81c 1EEID 3JAMi 4DR1Q 1Q8IA 3V2TA 4ZUIA 1VQMA 4K5WA 2PNHA 2B2VC 3CRLC 3CHBD 1SNPA 2PZTA 3PMFA 4KKTA 4G7ZC 1EIGA 1PYSB 5LL6X 5A2QE 2VZAA 1LT4D 1W6JA 4QMGA 2R7DA 2FHTA 4C3HB 3CCSA 3M3YB 1CKOA 3I7FA 2IX0A 3IAYA 2EVBA 4FXGC 1A3UA 2H4OA 2NUCA 2XWJB 1HCZA 2NYZD 3TEHB 2XRQD 2RBMA 1K73C 3DWQA 5IGDA 4HSPA 3PO2H 1YJNA 2X6GA 5IWAQ 1B53A 1AZPA 4H13C 1NMFA 5CMDA 1GUGA 3HKZG 3ERSX 5IYDH 1KIXA 2PQAB 3GTKH 3S9WA 4PMCA 2F4IA 4PMWA 4NB3A 4OWWB 4PZ8A 4DAVA 1JOKA 3LNNA 1BF4A 4QL5A 4DXGA 3G48A 4BBRG 5JVG3 3EN2A 2JA8H 3HKZB 2P5ZX 3A7LA 2JN4A 2N3SA 1LTGD 3BVMA 4POFA 4QGUA 4IOCA 1F9RA 1HZBA 4DR3Q 2FINB 4LF6L 1TS5A 2DY7A 3S1MB 4RKBA 4FVMA 1OXXK 1L0YB 3JAMc 4ULLA 3ZYYX 1VQPA 3KYHC 4IUVA 2NZOA 1RIPA 1ENAA 1U9RA 3RUZA 1STAA 1PZID 1M8AA 1S5FD 2K5QA 2OF1A 2OQKA 3CKIB 1BBUA 3I4MG 1RCVD 3TBIB 1RJTA 1BXTA 4DR7Q 4DK6C 5TSSA 4K2LA 4H02A 1S72A 1IBLL 1B8AA 4GNXB 1QUQA 2NVXB 5A2QL 3I55A 4C1NK 3OIQA 4JI3L 3ULPA 2K33A 4RGMA 4Y7NH 4NXNL 4N8X1 2ATWA 4DU9A 4MIUA 4GN5A 4DNRB 5IGCA 4JI2L 1VQJA 3U4VA 3KF6B 3C46A 1JOQA 3T1HQ 2ZM6L 1GM5A 1D7QA 1MHWC 1PLFA 3MEHA 2B2VA 1PTOB 3H15A 2ZJQA 5COYA 5CR3A 3RLNA 1SN8A 2AUKA 4JI8Q 3M85A 3K6OA 3B6YA 4DV3L 5C3EG 1XWEA 1BKBA 5C44G 2A68D 1TWCH 4A3KG 4B3RQ 3MA2B 3AEVA 2A6EC 1PZKD 3TP7A 1PRTB 3KF8B 5C4JB 2VW9A 3FDTA 4OX9L 3PIPA 4L5TA 2ZJPA 1EY5A 2UUBL 2RA4A 1SYFA 1BNZA 3S1MH 2PO4A 1EY4A 4DR6Q 1JWMD 4BBRH 5C44B 4A3KB 1I6VC 2ZXOA 3E6ZX 5ELOA 1UNSA 2QEXA 3WOEA 5LHY1 4GS3A 1I3QB 4IUPA 1EY8A 1TWAH 3NBHB 1NAPA 2F0HA 4RKLA 1CKNA 1STBA 3KJOA 5C4XB 1VQ5A 1EFID 1B9MA 2JQOA 3IFTA 1VQHA 3LX0A 1SJHD 1HZ9A 1UE1A 1L2FA 4NKLA 3HOWG 1GHKA 4YHHL 1HNWL 4TRDA 2CH4A 2K28A 1X6OA 3DLLA 3QOJA 1HZCA 3HKSA 1LACA 1XX8A 5LMUQ 1X3FA 1E2ZA 4A3CG 5I2XA 5KEEA 1AZQA 3I4MH 1IBML 1E22A 3J81E 2IHFA 3BYYB 4YWKA 5EAYA 4UAIA 2DY8A 3RMHA 1YHBA 3AYHB 3VR5A 3U50C 4LF7L 2XTIA 2MUYA 5ELCA 2AMCB 2XWBB 1TS2A 4O42A 4HJ9A 1MI2A 1HQMC 2GVBA 3UI2A 2RDHA 4FP5D 1Y14B 5IODA 1N34L 1HR0Q 2KBNA 3I8ZA 3CCEA 3J7AV 3PO3G 4CHTB 4DAMA 5JPMC 1LYLA 5AJ3L 2Y0SG 5J3BA 1O7LA 3QG1A 1GD7A 1KLGD 5FK9C 1VF7A 5C4JH 2JXMB 5HURA 4ALPA 5ELDA 2XNAC 3T1YL 1GXDC 3HS0C 1HJPA 2GVAA 2NZHA 3K0XA 2MPMA 2IT1A 2D62A 4GLVB 3KBXA 1C9OA 4IUQA 4LFBL 4B3SL 4LK1C 5C3EH 5C44H 4A3KH 2Y0SB 1N36L 4BBSB 1B4OA 2RF4A 2E5LL 1QE6A 3QWNA 1I3QH 1EIFA 1JICA 2MHVA 4CDDC 4FYDA 4AQYL 2WB1G 1SEBD 4GN3B 1VMCA 2WFWA 2EXDA 3R3OA 5G3LD 4CKEA 2UXBQ 2L55A 1MSHA 1S5DD 4XYOA 1NMGA 3I56A 1SMYC 3P7JA 1EWCA 2I46A 2K7VA 2FMMA 2A19A 2Q2TA 1F2ZA 3JAME 2NVTB 2N88A 4ZKCB 4ABNA 3I4OA 5IGFA 2ZTDA 3H94A 2F3VA 4UP8A 5IYBG 2M9VA 1ZYRC 3GD7A 4CGYB 4X65L 3GTGB 3MC0B 1EL0A 3K8AA 2LSSA 2BDOA 2YTYA 4DAYB 3HOWH 1E3PA 4RGNA 3J81L 4L5RC 3STBD 2LS01 1C8CA 4RFBA 1A8VA 2F0PA 4YY3Q 4A3CH 3KUPA 3TN2A 2JK8A 2R7FA 3D6WA 4K5XA 4Q5VA 3QO2A 1GKHA 1HXYD 5G3LF 1E2VA 3FPUB 1H9RA 2Z4HA 4KLKA 1PH6A 2UXCL 2KHJA 4IOAA 3P1HA 3M4OH 3NSWA 1KAAA 2E2HH 5E3FA 2F0IA 4B3TQ 4B9WA 1WTVA 3QR8A 1SE3A 3PO3H 1C4QA 2O5IC 2EYJA 2PI2E 4JW0A 4BY7B 1E2WA 3MTSA 1NNXA 3BS1A 1YJ9A 3J7YW 4JI0L 2KEDA 1YNJD 4FF3A 1YJWA 5C4HA 1UEAB 1SXTA 3K81C 1PH4A 1YZ6A 4PG3A 2I0QA 4XQJA 4OXPA 5JEAJ 4XTCS 1HH2P 1MJCA 1LO5D 2D9UA 1X3GA 1RTNA 3H0GH 2EJGC 1YIJA 1BUVT 1Q81C 1LTTD 1IZ6A 3VYTA 2RKSA 3PSIA 3J7ZC 4X64L 4A3GG 3HG9A 2R92B 1V1QA 1H9JA 3EJIA 2JEAI 3J81j 1PDQA 1IXRA 5A35A 4JI6Q 2MP1A 1Q8KA 2VL6A 5IP7G 4KY6A 2F4VQ 1WOCA 3JAML 2N49A 2WACA 2K75A 3VA7A 3CC7A 3FMCA 4NDXA 4KK7A 4A3GB 1SNDA 3N52A 4DNIA 2IL8A 1TWHB 1IL2A 2HHHQ 2BDNA 4GZYC 2F0LA 2UUAQ 2WIIB 5ISRA 4LAAA 5D65A 5IYBH 3S1NH 2F3WA 1WYDA 1SRUA 3L2PA 2I5LX 1SDFA 2Q8RE 4IJHA 2J7ZA 3PUZA 1IKLA 1QOHA 1WI5A 2B2YC 2YTVA 1AH9A 1NJIC 5LL6S 1SBBB 1LTRD 2A1AA 2HCCA 3P20A 4OIJA 1J5EQ 3D4WA 1K83B 2UUCQ 2QW7A 1ZXTA 2HCIA 3IL8A 3VR3A 2WAQE 4DUZL 4JI5L 1G91A 2PQEA 3L3OC 1G291 2EJFC 2WKCA 4KKUA 2CVRA 5H1SE 2VQEQ 4WJ3M 4CJ1B 1HA5A 1V43A 1UAPA 4HJ5A 1NTGA 3DEPA 1U4MA 1IBKL 3NP8A 3C2PA 1O80A 2F0DA 4DV0Q 4NW2A 3CQZH 1G8ZD 1AE2A 2DGYA 3EA6A 1I5FA 5JPNC 1JQYD 1A6XA 1I50B 5EPJA 2F0SA 1UUPA 1PTOD 1ET6A 1NR2A 5M5WH 1ASYA 1JORA 1TU2B 3S2DH 4DF7A 1M90C 5FLMG 1CI3M 3KBGA 1I6HH 1BR9A 1WTRA 4LNQA 5T1GA 2B2TC 4K6DA 3S16B 1PRTD 1D5MC 1Y1WG 3AB9A 1BCPD 5FLXc 4MTNA 1Z47A 2EY6A 2VXWA 4AIMA 4A3GH 4OWTB 4GLXA 3S15H 1F9PA 1X56A 2JJQA 1TWHH 1P8LA 4ZYSA 3K58A 2K5VA 5ELFA 1VQFA 1HTPA 1TWGB 4P2CB 1XPRA 2HDMA 5IP7H 2LFNA 4N8FA 4G4KA 4ME3A 1EY7A 4HTHA 5DM73 3SHLA 1A3VA 4U673 4A3MB 3O13A 4C1NI 5IGBA 1JOOA 1A3TA 2YTXA 4XQQA 2DUDA 2K5HA 1BO0A 4LF6Q 1PTOF 3A7AB 3Q6SA 4CJ2C 1IYUA 5IE8A 1H9SA 4IALA 1A62A 3ONAB 1A0IA 3X3NA 3S14B 3TQYA 1U0LA 2F0NA 1I94L 1FNVA 1PRTF 1BCPF 1MD2D 3OW2A 1PYWD 4PV1C 1AP0A 3NHHA 3HOUG 3KLRA 1PFNA 4FNFA 3A5UA 2NVYB 4CDCC 4A3FG 1X65A 1HNXL 1IBLQ 1AEXA 2B2UC 4C3IG 4H44C 2B2YA 2PQAA 4LFAL 3NENA 4JI3Q 4RG1A 1EOVA 1GO3E 3SK4A 1SNCA 4NXNQ 1WTOA 4ZRZA 3HOUB 2F0EA 4BY1G 5KIXA 3GTPB 4HR7B 2Q2UA 1YNND 4R4TA 2HUGA 4L6TB 4JI2Q 1JJ2A 3S16H 3PIO3 2ZM6Q 1XTDA 4K8JA 4QUFA 2JA9A 4UHVA 4AYBE 4BWGB 3RN5A 3GO5A 3I70A 3GTLB 1LM0A 1S5CD 5FLMH 3GTOB 2HIVA 3AMUA 3S2HB 5CYUA 5CBAE 1TWGH 2N8NA 1EZ6A 1QVGA 4DV3Q 1W3SA 1S5ED 1S5BD 4TQUS 3CXCA 4DGZA 3MVVA 2CQOA 2JEBI 3DXJC 1Y1WH 1B3AA 5D3IB 4OX9Q 2M2LA 1Q86C 2UUBQ 3D3RA 1JB7A 1AFPA 3RR5A 2DNCA 1JT8A 1AE3A 1Z7TA 4C3HG 4HJ8A 1YI2A 4MZ9A 4GLAC 4GNXA 1VQ6A 1EIHA 5JAVA 2F0KA 3CCUA 2D5DA 5JEAG 4GKKL 2RSNA 3CU7A 1WTXA 4DK3C 1VQ8A 1MSGA 4Y52H 4IURA 1F2LA 3OWEB 3OMCA 1Q1BA 3OIPA 2NVYH 1EWHA 4OELB 2G9HD 2XGTA 2HQEA 3KF6A 5EBDA 1LUZA 3UDFA 4YHHQ 3RZDH 1HNWQ 5C0XJ 1QILA 5CBEE 4DPGA 3BYTB 3SVMA 3U4ZA 3A55A 1UEBA 2NTSA 4MTKA 1XMOL 1CFMA 5IT9c 2E2IB 2NVQB 1IBMQ 1K28A 3HOUH 2B29A 2UXDL 1JJGA 4PZ7A 5KRUA 5CV9A 3RZOB 4QIWB 3S17H 2KQ3A 5EBCA 5J1ZA 4A3FH 3PF4A 4K14A 1U4PA 2EY2A 4GKJL 4POGA 4I65A 5EJWA 4C3IH 3K0YA 3KF8A 3TP5A 1MBYA 2N78A 3WDNA 3U58A 4LF7Q 3OWFA 1CSPA 3DM3A 3GTOH 3OMGA 2XRSD 5BR8L 3S2HH 2WAQB 4IUUA 1N34Q 1SAPA 4BY1H 1JE4A 1DZ1A 3MXUA 1DD2A 4A3EB 3KLSX 1QWYA
chains in the Genus database with same CATH topology
1E22A 4JYAL 2I5MX 1M1KC 2IHFA 1CKMA 1PFSA 5AJ3Q 1YNXA 2KCMA 3KDFB 4YCUA 4YWKA 4JI1L 1G51A 3AFPA 3AFQA 3MEFA 5EAYA 1XNRQ 4B3TL 1FJGQ 1YHBA 3AYHB 3CW2C 3OTOQ 3UDXA 3U50C 5FJ8H 4DV2Q 1VQ9A 1YVCA 1WJJA 4LF7L 2XTIA 1IYJB 3T1YQ 2AMCB 4MNOA 4HJ7A 1VQNA 4HJ9A 3CCLA 3F1ZA 3F2DA 2PMZE 5LMUL 2VY3A 4PZ6A 2GVBA 3CMAA 4LFBQ 1I50H 1N34L 1HR0Q 1Y14B 4B3SQ 2K52A 1YITA 2KBNA 2Z6KA 4JBWA 4IO9A 5FLXc 1VQBA 3KJPA 3CCEA 4X66L 1Q82C 3E0EA 4L5QA 3S24A 1N8RC 4DV5Q 3PO3G 1N36Q 1FVIA 1KRSA 2Z0SA 4DAMA 1RL2A 1LYLA 3PGZA 2MNAA 1EFWA 4LF4Q 2E5LQ 5AJ3L 2Y0SG 4P73A 1VQIA 1SLJA 5J3BA 2K4KA 2R6GA 2YYZA 3CP0A 1OTCA 1K8GA 1GD7A 4A93G 1XNRL 4AQYQ 1FJGL 4JBMA 3HOZH 5C4JH 5HGQA 3OTOL 4ALPA 4DV2L 2Z6KC 1VQOA 4DR4Q 4FDBA 3T1YL 2ZJRA 1Z9FA 1HJPA 3VDYA 3KDFA 4C3HH 2GVAA 2NZHA 3M3YH 3K0XA 4GLVB 2IT1A 2D62A 1YHAA 4P71A 2NN6I 1C9OA 4LFBL 4DV4Q 5K36G 1HR0L 4B3SL 2JA5G 5LMNQ 1PH3A 5C3EH 3G71A 2HT1A 5C44H 4A3KH 2JA6H 4DV5L 1N36L 4LF4L 2RF4A 2E5LL 3KFUA 2CCZA 1I3QH 1EIFA 1V9PA 3ULJA 1XJVA 4O2DA 4AQYL 4QIWE 2WB1G 4A3DH 3CMEA 1YHQA 4GN3B 2E8GA 2WFWA 4X65Q 1N33Q 3NELA 2EXDA 4DR4L 3A5ZB 2MO1A 4DR2Q 4A3MH 2UU9Q 2UXBQ 2H5XA 4GOPB 3L7ZC 4DV4L 2Q2IA 1NMGA 3K7UC 3I56A 5LMNL 4BA1I 2VUMG 3UE1A 5IYCG 1K3RA 1Y1VH 3EBEA 2A19A 1BBWA 2Q2TA 3GDEA 1CUKA 4A76A 4A3LG 3CCJA 4DR5Q 5IP9G 3S14H 2K50A 3HFZB 3I4OA 1XMOQ 2MO0A 3UDGA 2ZTDA 1MKHA 4XIGS 4UP8A 4J15A 4P75A 5IYBG 3GD7A 4X65L 1N33L 2PI2A 3K8AA 4DR2L 2LSSA 1C7YA 1FGUA 2YTYA 4DAYB 2E2JH 3HOWH 1E3PA 4QQBX 4JOIA 1NBWA 2UXBL 1E24A 2UXCQ 1N32Q 3WWVA 5GQOA 4L5RC 4QY7A 5C4XG 5E7NA 4JC0A 3STBD 4DUYQ 1A8VA 4YY3Q 4A3CH 4JG2A 3HOXG 4LF9Q 4YWLA 1O7IA 4DR5L 2JK8A 2OTLA 1WCMG 4UPAA 2R7FA 1PVOA 4JI0Q 2CWPA 3BU2A 2WAQG 1GKHA 4KLKA 1UE5A 1PH6A 3GTPH 4DV0L 4BXXG 4R4IA 4A3EG 1X9NA 2UXCL 2KHJA 1JE5A 1OXTA 2IHEA 4A3JH 4IOAA 1N32L 4GOPC 1X54A 3M4OH 1H95A 4A3IG 1HNZQ 3MXNB 2EQSA 2E2HH 4B3TQ 1VQAA 2OTJA 4YY3L 4JI4Q 2B3GA 2NN6G 1EUJA 3CCVA 2F3IA 1S3OA 2CKZB 2VQFQ 1VQGA 2IY5B 3M9BA 4LF9L 2R93G 2Y0SE 2NVXH 1E1TA 3PO3H 3GTLH 2PI2E 5GAGC 5GADC 4YCWA 4JCVE 4X64Q 4JV5Q 3A0JA 1YJ9A 4JI0L 4A93H 1XPUA 1UWVA 1YJWA 4QJFA 4R4OA 3K81C 1PH4A 1YZ6A 4PG3A 2I0QA 5DLQE 4OXPA 5JEAJ 1W2BA 1VQCA 5GAEC 1CSQA 1PA6A 1HNZL 2K5NA 4XTCS 4JI4L 1HH2P 1MJCA 4OWXB 3RLOA 1HR0W 1X3GA 3D31A 5M3MG 2JA5H 3H0GH 2VQFL 4X6AH 1VQDA 1OXSC 1YBYA 1OXVA 1YIJA 4IFDJ 4UP9A 1Q81C 2JA7G 1IZ6A 1KAWA 3J7ZC 3PSIA 2WB1E 4K0KQ 4X64L 3A74A 1X3EA 4JV5L 2L15A 4A3GG 4IPHA 2R7ZG 2RHSB 1V1QA 3IRBA 2JEAI 2GN5A 3J81i 1E1OA 3J81j 1X55A 3E9IA 4EX5A 1IXRA 4JI6Q 1SROA 4BBSG 4A3BG 1Q8KA 2QA4A 1EYGA 2VL6A 5IP7G 2F4VQ 3PO2G 1WOCA 1VCIA 1KXLA 2N49A 2K75A 5LMNW 3CC7A 2C35B 4IJLA 2OWOA 1PH1A 2VUMH 1K0RA 4LF8L 5IYCH 3E9HA 1BVSA 2CFMA 3L0OA 5IYDG 3F2BA 3UE0A 4B3MQ 3TRZA 4K0KL 4A3LH 3GTJH 4DNIA 5IP9H 1IL2A 2YV5A 2HHHQ 1VQKA 2V1CC 3EIVA 4DUZQ 2UUAQ 4JI5Q 4JI7Q 3TS0A 3GTMH 5IYBH 5M3FG 1SFOH 2E2IH 3S1NH 4JI6L 1WYDA 1SRUA 3L2PA 2I5LX 3Q8DA 1B7YB 2NVQH 4IJHA 4IPDA 4KHZA 3PUZA 2F4VL 5M5YH 1QZGA 1KD1C 1WI5A 4DV1Q 5C4XH 1B70B 3ER0A 4X62Q 2JA8G 2YTVA 5JJLA 1AH9A 3TS2A 3BZCA 1IBKQ 3RZOH 3M4QA 1NJIC 4OONA 1LTLA 3FP9A 4TVAB 1VQ7A 2JE6I 2A1AA 4BA2I 1UE6A 5C0XG 3KOJA 3HOXH 2B63H 3CPWA 4B3ML 4R4QA 1J5EQ 4LF5Q 2UUCQ 2HHHL 1WCMH 2ALYB 2WAQE 4O0AA 4LUVA 3BZKA 4DUZL 1PV4A 2UUAL 4JI5L 4DV7Q 1L0WA 4JI7L 1G291 2VQEQ 2ASBA 4WJ3M 3W5OA 1V43A 1KL9A 4DV6Q 4HJ5A 1VQ4A 1NTGA 4BXXH 1NY4A 1SE8A 4R4CA 4DV1L 4A3EH 1JMCA 1VQLA 4A75A 4X62L 4A3IH 1TXYA 1IBKL 4A4IA 3PUYA 4EQ5A 3I4NG 4R1JA 2FXQA 2ID0A 3CF5A 4DV0Q 1UE7A 2BA0A 3CQZH 3CCRA 2R93H 3CPFA 1J5EL 4LF5L 1AE2A 2UUCL 2DGYA 1XNQQ 1I5FA 3H3VI 1A63A 3RLFA 1C0AA 4DV7L 4UP7A 1VQEA 2OQ0A 1T9HA 1K9MC 1L1OC 2RCNA 5M5WH 1ASYA 4UY8C 2VQEL 3J81c 3S2DH 4GOPA 3JAMi 4DR1Q 3ULLA 5FLMG 1M90C 4DV6L 1VQMA 3LGJA 4AYBG 2PNHA 3KLWA 4BY7G 1I6HH 4HJAA 4HIDA 2LXJA 1KQSA 2AKWB 4LNQA 1PYSB 1PH8A 4LFCQ 5M3MH 2VZAA 2BH8A 4LUOA 1Y1WG 2R7DA 3CCSA 1XNQL 2JA7H 3CC2A 1WFQA 2I5HA 3PV0A 1CKOA 4MTNA 1Z47A 2KENA 3I7FA 4RMFA 2IX0A 1PH5A 4AIMA 3S1RH 3ICEA 2KCTA 4A3GH 4OWTB 5C0XI 4GLXA 3S15H 4KHPQ 2R7ZH 1X56A 3JC66 2JJQA 1TWHH 1P8LA 4NPSA 4DR1L 2K5VA 1VQFA 3TEHB 1XPRA 3PCOB 1K73C 4BBSH 4A3BH 1E7ZA 1VS0A 5IP7H 3PO2H 1YJNA 5IWAQ 1HZAA 3PUXA 4ME3A 4LFCL 3STBC 1KHIA 1I94Q 2R92G 4C3JH 1NMFA 2AWNA 3H3VH 2D0OA 2Q2HA 1PH7A 3HKZG 3ERSX 4KI0A 5IYDH 2YTXA 1KIXA 1PYBA 2DUDA 2K5HA 2PQAB 4GN4B 3RNUA 1EIYB 3GTKH 4LUZA 3FKIG 4PMWA 4KHPL 3HOVG 4LF6Q 1Q1EA 4NB3A 3BJUA 3ZJYC 4OWWB 3CC4A 4PZ8A 1HNXQ 4LF8Q 5IE8A 3GTQH 2HQLA 1QZHA 3UDIA 1A62A 2EIFA 1G6PA 5JJKA 4QL5A 5M3FH 2HIXA 2MFIA 1DGSA 1A0IA 3TQYA 3PF5A 3G6EA 2ES2A 3G48A 4BBRG 1U0LA 5IWAL 3EN2A 4LWCA 4APVA 1I94L 2JA8H 2NVTH 4IPGA 1QUQB 2N3SA 4POFA 4IOCA 2D0PA 4QGUA 4LW1A 2WP8J 3OW2A 3GTGH 3HOUG 1HZBA 4DR3Q 1FL0A 1EQRA 3A5UA 3G4SA 4LF6L 4AH6A 4A3JG 2UXDQ 4A3FG 1X65A 1HNXL 1IBLQ 4IFDI 2K14A 3HOYG 1SMXA 3D0FA 1OXXK 3NEMA 3JAMc 1VQPA 2PQAA 3KYHC 1K8AC 3F8TA 4LFAL 5JJIA 3NENA 2NZOA 1RIPA 3W1GA 4JI3Q 4RG1A 4NXMQ 1EOVA 1EWIA 1GO3E 4NXNQ 1MJEA 1KRTA 1L1OB 2OQKA 1Q7YC 2AWOA 5M5XH 4BY1G 1BBUA 1YEZA 4YWMA 3I4MG 2Q2UA 4R4TA 1NE3A 3K80C 3I4NH 4DR7Q 4DR3L 4DK6C 4IPCA 4JI2Q 1JJ2A 3TREA 2VS1A 3S16H 2ZM6Q 1XTDA 4HIKA 3S1QH 4H02A 2MQHA 1S72A 1IBLL 4P72A 1B8AA 4GNXB 1QUQA 2CWAA 5IY0A 3PUWA 2JA9A 4AYBE 5FJ8G 3I55A 3RN5A 3GO5A 2F52A 3H0GG 3PIOA 1LM0A 5FLMH 4JI3L 4NXML 2HIVA 3ULPA 2VNUD 4Y7NH 1ASZA 4NXNL 3OYYA 1XMQQ 4BY7H 1QVCA 2ATWA 4HIOA 1TWGH 2N8NA 3RN2A 1QVGA 4DV3Q 1W3SA 3CXCA 2BA1A 4TQUS 4DR7L 3J80i 4GN5A 2CQOA 2JEBI 3I2ZA 1Y1WH 4JI2L 1VQJA 3U4VA 3KF6B 4OO1G 4GKKQ 3T1HQ 1GVPA 1R9TH 1PH9A 1L1OA 3PUVA 2ZM6L 1GM5A 4OX9Q 1D7QA 4HIMA 5ELNA 2BH2A 1D8LA 3M4PA 1Q86C 3HOZG 2UUBQ 1JB7A 1JJCB 3RR5A 1JT8A 1MIUA 1AE3A 3H15A 2ZJQA 1N9WA 4HJ8A 3RLNA 5HY6A 1XMQL 1YI2A 1SN8A 1CKNB 4MZ9A 4JI8Q 4GLAC 3M85A 4GNXA 3B6YA 3W1BA 4DV3L 1VQ6A 5C3EG 2YU9H 3CCUA 3HKZE 1PHJA 2R92H 1BKBA 5C44G 4A3KG 1TWCH 2JA6G 2KHIA 4B3RQ 1EQQA 2OCEA 3AEVA 5JEAG 4GKKL 3T1HL 4WJ4A 3KF8B 4DK3C 2VW9A 1VQ8A 4OX9L 4Y52H 3FKIH 4A3DG 3PIPA 1Q1BA 4L5TA 2ZJPA 4GNXC 2UUBL 3HOVH 2ZTEA 4IFDG 2NVYH 4GKJQ 1OXUA 1XPOA 2XGTA 2UU9L 3M7NA 3KF6A 4A3MG 4L5SA 1LUZA 3CCMA 3UDFA 4YHHQ 3RZDH 3S1MH 1HNWQ 5C0XJ 2B63G 4DR6Q 4JI8L 4DPGA 4BBRH 3CCQA 4JOIC 5ELOA 3AQQA 3U4ZA 4JBJA 1UEBA 2QEXA 2IX1A 5BR8Q 1XMOL 5IT9c 1U5KA 3K7AH 4B3RL 1Y1VG 4GS3A 1TWAH 3FHWA 3NBHB 1IBMQ 2A8VA 3HOUH 1CKNA 3KJOA 4JYAQ 1KC8C 2B29A 3SGIA 1PH2A 1VQ5A 2UXDL 4PZ7A 1JJGA 1SR3A 3F2CA 2JQOA 4JI1Q 3S17H 4A3FH 3PF4A 1VQHA 4YCVA 2ZTCA 4DUYL 3HOYH 4GKJL 1P16A 4OO1I 4POGA 2AHOB 4C3IH 4JBKA 1HZ9A 1UE1A 1L2FA 1QVFA 3HOWG 3J7A5 2LXKA 4YHHL 4DKAC 1HNWL 4DR6L 2N78A 1J6QA 3U58A 4LF7Q 1X6OA 1CSPA 3DM3A 3DLLA 1K83H 2RHQB 1S40A 1HZCA 3CAMA 3HKSA 4C2MH 5BR8L 1X3FA 5LMUQ 3GTOH 4A3CG 3S2HH 1N34Q 1Q46A 5GAHC 4BY1H 3I4MH 4LFAQ 4P74A 3J80c 1Q12A 4X66Q 1TWFH 2QGQA 1IBML 3CD6A 5H1SE 5GROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E22 A;  4JYA L;  2I5M X;  1M1K C;  2IHF A;  1CKM A;  1PFS A;  5AJ3 Q;  1YNX A;  2KCM A;  3KDF B;  4YCU A;  4YWK A;  4JI1 L;  1G51 A;  3AFP A;  3AFQ A;  3MEF A;  5EAY A;  1XNR Q;  4B3T L;  1FJG Q;  1YHB A;  3AYH B;  3CW2 C;  3OTO Q;  3UDX A;  3U50 C;  5FJ8 H;  4DV2 Q;  1VQ9 A;  1YVC A;  1WJJ A;  4LF7 L;  2XTI A;  1IYJ B;  3T1Y Q;  2AMC B;  4MNO A;  4HJ7 A;  1VQN A;  4HJ9 A;  3CCL A;  3F1Z A;  3F2D A;  2PMZ E;  5LMU L;  2VY3 A;  4PZ6 A;  2GVB A;  3CMA A;  4LFB Q;  1I50 H;  1N34 L;  1HR0 Q;  1Y14 B;  4B3S Q;  2K52 A;  1YIT A;  2KBN A;  2Z6K A;  4JBW A;  4IO9 A;  5FLX c;  1VQB A;  3KJP A;  3CCE A;  4X66 L;  1Q82 C;  3E0E A;  4L5Q A;  3S24 A;  1N8R C;  4DV5 Q;  3PO3 G;  1N36 Q;  1FVI A;  1KRS A;  2Z0S A;  4DAM A;  1RL2 A;  1LYL A;  3PGZ A;  2MNA A;  1EFW A;  4LF4 Q;  2E5L Q;  5AJ3 L;  2Y0S G;  4P73 A;  1VQI A;  1SLJ A;  5J3B A;  2K4K A;  2R6G A;  2YYZ A;  3CP0 A;  1OTC A;  1K8G A;  1GD7 A;  4A93 G;  1XNR L;  4AQY Q;  1FJG L;  4JBM A;  3HOZ H;  5C4J H;  5HGQ A;  3OTO L;  4ALP A;  4DV2 L;  2Z6K C;  1VQO A;  4DR4 Q;  4FDB A;  3T1Y L;  2ZJR A;  1Z9F A;  1HJP A;  3VDY A;  3KDF A;  4C3H H;  2GVA A;  2NZH A;  3M3Y H;  3K0X A;  4GLV B;  2IT1 A;  2D62 A;  1YHA A;  4P71 A;  2NN6 I;  1C9O A;  4LFB L;  4DV4 Q;  5K36 G;  1HR0 L;  4B3S L;  2JA5 G;  5LMN Q;  1PH3 A;  5C3E H;  3G71 A;  2HT1 A;  5C44 H;  4A3K H;  2JA6 H;  4DV5 L;  1N36 L;  4LF4 L;  2RF4 A;  2E5L L;  3KFU A;  2CCZ A;  1I3Q H;  1EIF A;  1V9P A;  3ULJ A;  1XJV A;  4O2D A;  4AQY L;  4QIW E;  2WB1 G;  4A3D H;  3CME A;  1YHQ A;  4GN3 B;  2E8G A;  2WFW A;  4X65 Q;  1N33 Q;  3NEL A;  2EXD A;  4DR4 L;  3A5Z B;  2MO1 A;  4DR2 Q;  4A3M H;  2UU9 Q;  2UXB Q;  2H5X A;  4GOP B;  3L7Z C;  4DV4 L;  2Q2I A;  1NMG A;  3K7U C;  3I56 A;  5LMN L;  4BA1 I;  2VUM G;  3UE1 A;  5IYC G;  1K3R A;  1Y1V H;  3EBE A;  2A19 A;  1BBW A;  2Q2T A;  3GDE A;  1CUK A;  4A76 A;  4A3L G;  3CCJ A;  4DR5 Q;  5IP9 G;  3S14 H;  2K50 A;  3HFZ B;  3I4O A;  1XMO Q;  2MO0 A;  3UDG A;  2ZTD A;  1MKH A;  4XIG S;  4UP8 A;  4J15 A;  4P75 A;  5IYB G;  3GD7 A;  4X65 L;  1N33 L;  2PI2 A;  3K8A A;  4DR2 L;  2LSS A;  1C7Y A;  1FGU A;  2YTY A;  4DAY B;  2E2J H;  3HOW H;  1E3P A;  4QQB X;  4JOI A;  1NBW A;  2UXB L;  1E24 A;  2UXC Q;  1N32 Q;  3WWV A;  5GQO A;  4L5R C;  4QY7 A;  5C4X G;  5E7N A;  4JC0 A;  3STB D;  4DUY Q;  1A8V A;  4YY3 Q;  4A3C H;  4JG2 A;  3HOX G;  4LF9 Q;  4YWL A;  1O7I A;  4DR5 L;  2JK8 A;  2OTL A;  1WCM G;  4UPA A;  2R7F A;  1PVO A;  4JI0 Q;  2CWP A;  3BU2 A;  2WAQ G;  1GKH A;  4KLK A;  1UE5 A;  1PH6 A;  3GTP H;  4DV0 L;  4BXX G;  4R4I A;  4A3E G;  1X9N A;  2UXC L;  2KHJ A;  1JE5 A;  1OXT A;  2IHE A;  4A3J H;  4IOA A;  1N32 L;  4GOP C;  1X54 A;  3M4O H;  1H95 A;  4A3I G;  1HNZ Q;  3MXN B;  2EQS A;  2E2H H;  4B3T Q;  1VQA A;  2OTJ A;  4YY3 L;  4JI4 Q;  2B3G A;  2NN6 G;  1EUJ A;  3CCV A;  2F3I A;  1S3O A;  2CKZ B;  2VQF Q;  1VQG A;  2IY5 B;  3M9B A;  4LF9 L;  2R93 G;  2Y0S E;  2NVX H;  1E1T A;  3PO3 H;  3GTL H;  2PI2 E;  5GAG C;  5GAD C;  4YCW A;  4JCV E;  4X64 Q;  4JV5 Q;  3A0J A;  1YJ9 A;  4JI0 L;  4A93 H;  1XPU A;  1UWV A;  1YJW A;  4QJF A;  4R4O A;  3K81 C;  1PH4 A;  1YZ6 A;  4PG3 A;  2I0Q A;  5DLQ E;  4OXP A;  5JEA J;  1W2B A;  1VQC A;  5GAE C;  1CSQ A;  1PA6 A;  1HNZ L;  2K5N A;  4XTC S;  4JI4 L;  1HH2 P;  1MJC A;  4OWX B;  3RLO A;  1HR0 W;  1X3G A;  3D31 A;  5M3M G;  2JA5 H;  3H0G H;  2VQF L;  4X6A H;  1VQD A;  1OXS C;  1YBY A;  1OXV A;  1YIJ A;  4IFD J;  4UP9 A;  1Q81 C;  2JA7 G;  1IZ6 A;  1KAW A;  3J7Z C;  3PSI A;  2WB1 E;  4K0K Q;  4X64 L;  3A74 A;  1X3E A;  4JV5 L;  2L15 A;  4A3G G;  4IPH A;  2R7Z G;  2RHS B;  1V1Q A;  3IRB A;  2JEA I;  2GN5 A;  3J81 i;  1E1O A;  3J81 j;  1X55 A;  3E9I A;  4EX5 A;  1IXR A;  4JI6 Q;  1SRO A;  4BBS G;  4A3B G;  1Q8K A;  2QA4 A;  1EYG A;  2VL6 A;  5IP7 G;  2F4V Q;  3PO2 G;  1WOC A;  1VCI A;  1KXL A;  2N49 A;  2K75 A;  5LMN W;  3CC7 A;  2C35 B;  4IJL A;  2OWO A;  1PH1 A;  2VUM H;  1K0R A;  4LF8 L;  5IYC H;  3E9H A;  1BVS A;  2CFM A;  3L0O A;  5IYD G;  3F2B A;  3UE0 A;  4B3M Q;  3TRZ A;  4K0K L;  4A3L H;  3GTJ H;  4DNI A;  5IP9 H;  1IL2 A;  2YV5 A;  2HHH Q;  1VQK A;  2V1C C;  3EIV A;  4DUZ Q;  2UUA Q;  4JI5 Q;  4JI7 Q;  3TS0 A;  3GTM H;  5IYB H;  5M3F G;  1SFO H;  2E2I H;  3S1N H;  4JI6 L;  1WYD A;  1SRU A;  3L2P A;  2I5L X;  3Q8D A;  1B7Y B;  2NVQ H;  4IJH A;  4IPD A;  4KHZ A;  3PUZ A;  2F4V L;  5M5Y H;  1QZG A;  1KD1 C;  1WI5 A;  4DV1 Q;  5C4X H;  1B70 B;  3ER0 A;  4X62 Q;  2JA8 G;  2YTV A;  5JJL A;  1AH9 A;  3TS2 A;  3BZC A;  1IBK Q;  3RZO H;  3M4Q A;  1NJI C;  4OON A;  1LTL A;  3FP9 A;  4TVA B;  1VQ7 A;  2JE6 I;  2A1A A;  4BA2 I;  1UE6 A;  5C0X G;  3KOJ A;  3HOX H;  2B63 H;  3CPW A;  4B3M L;  4R4Q A;  1J5E Q;  4LF5 Q;  2UUC Q;  2HHH L;  1WCM H;  2ALY B;  2WAQ E;  4O0A A;  4LUV A;  3BZK A;  4DUZ L;  1PV4 A;  2UUA L;  4JI5 L;  4DV7 Q;  1L0W A;  4JI7 L;  1G29 1;  2VQE Q;  2ASB A;  4WJ3 M;  3W5O A;  1V43 A;  1KL9 A;  4DV6 Q;  4HJ5 A;  1VQ4 A;  1NTG A;  4BXX H;  1NY4 A;  1SE8 A;  4R4C A;  4DV1 L;  4A3E H;  1JMC A;  1VQL A;  4A75 A;  4X62 L;  4A3I H;  1TXY A;  1IBK L;  4A4I A;  3PUY A;  4EQ5 A;  3I4N G;  4R1J A;  2FXQ A;  2ID0 A;  3CF5 A;  4DV0 Q;  1UE7 A;  2BA0 A;  3CQZ H;  3CCR A;  2R93 H;  3CPF A;  1J5E L;  4LF5 L;  1AE2 A;  2UUC L;  2DGY A;  1XNQ Q;  1I5F A;  3H3V I;  1A63 A;  3RLF A;  1C0A A;  4DV7 L;  4UP7 A;  1VQE A;  2OQ0 A;  1T9H A;  1K9M C;  1L1O C;  2RCN A;  5M5W H;  1ASY A;  4UY8 C;  2VQE L;  3J81 c;  3S2D H;  4GOP A;  3JAM i;  4DR1 Q;  3ULL A;  5FLM G;  1M90 C;  4DV6 L;  1VQM A;  3LGJ A;  4AYB G;  2PNH A;  3KLW A;  4BY7 G;  1I6H H;  4HJA A;  4HID A;  2LXJ A;  1KQS A;  2AKW B;  4LNQ A;  1PYS B;  1PH8 A;  4LFC Q;  5M3M H;  2VZA A;  2BH8 A;  4LUO A;  1Y1W G;  2R7D A;  3CCS A;  1XNQ L;  2JA7 H;  3CC2 A;  1WFQ A;  2I5H A;  3PV0 A;  1CKO A;  4MTN A;  1Z47 A;  2KEN A;  3I7F A;  4RMF A;  2IX0 A;  1PH5 A;  4AIM A;  3S1R H;  3ICE A;  2KCT A;  4A3G H;  4OWT B;  5C0X I;  4GLX A;  3S15 H;  4KHP Q;  2R7Z H;  1X56 A;  3JC6 6;  2JJQ A;  1TWH H;  1P8L A;  4NPS A;  4DR1 L;  2K5V A;  1VQF A;  3TEH B;  1XPR A;  3PCO B;  1K73 C;  4BBS H;  4A3B H;  1E7Z A;  1VS0 A;  5IP7 H;  3PO2 H;  1YJN A;  5IWA Q;  1HZA A;  3PUX A;  4ME3 A;  4LFC L;  3STB C;  1KHI A;  1I94 Q;  2R92 G;  4C3J H;  1NMF A;  2AWN A;  3H3V H;  2D0O A;  2Q2H A;  1PH7 A;  3HKZ G;  3ERS X;  4KI0 A;  5IYD H;  2YTX A;  1KIX A;  1PYB A;  2DUD A;  2K5H A;  2PQA B;  4GN4 B;  3RNU A;  1EIY B;  3GTK H;  4LUZ A;  3FKI G;  4PMW A;  4KHP L;  3HOV G;  4LF6 Q;  1Q1E A;  4NB3 A;  3BJU A;  3ZJY C;  4OWW B;  3CC4 A;  4PZ8 A;  1HNX Q;  4LF8 Q;  5IE8 A;  3GTQ H;  2HQL A;  1QZH A;  3UDI A;  1A62 A;  2EIF A;  1G6P A;  5JJK A;  4QL5 A;  5M3F H;  2HIX A;  2MFI A;  1DGS A;  1A0I A;  3TQY A;  3PF5 A;  3G6E A;  2ES2 A;  3G48 A;  4BBR G;  1U0L A;  5IWA L;  3EN2 A;  4LWC A;  4APV A;  1I94 L;  2JA8 H;  2NVT H;  4IPG A;  1QUQ B;  2N3S A;  4POF A;  4IOC A;  2D0P A;  4QGU A;  4LW1 A;  2WP8 J;  3OW2 A;  3GTG H;  3HOU G;  1HZB A;  4DR3 Q;  1FL0 A;  1EQR A;  3A5U A;  3G4S A;  4LF6 L;  4AH6 A;  4A3J G;  2UXD Q;  4A3F G;  1X65 A;  1HNX L;  1IBL Q;  4IFD I;  2K14 A;  3HOY G;  1SMX A;  3D0F A;  1OXX K;  3NEM A;  3JAM c;  1VQP A;  2PQA A;  3KYH C;  1K8A C;  3F8T A;  4LFA L;  5JJI A;  3NEN A;  2NZO A;  1RIP A;  3W1G A;  4JI3 Q;  4RG1 A;  4NXM Q;  1EOV A;  1EWI A;  1GO3 E;  4NXN Q;  1MJE A;  1KRT A;  1L1O B;  2OQK A;  1Q7Y C;  2AWO A;  5M5X H;  4BY1 G;  1BBU A;  1YEZ A;  4YWM A;  3I4M G;  2Q2U A;  4R4T A;  1NE3 A;  3K80 C;  3I4N H;  4DR7 Q;  4DR3 L;  4DK6 C;  4IPC A;  4JI2 Q;  1JJ2 A;  3TRE A;  2VS1 A;  3S16 H;  2ZM6 Q;  1XTD A;  4HIK A;  3S1Q H;  4H02 A;  2MQH A;  1S72 A;  1IBL L;  4P72 A;  1B8A A;  4GNX B;  1QUQ A;  2CWA A;  5IY0 A;  3PUW A;  2JA9 A;  4AYB E;  5FJ8 G;  3I55 A;  3RN5 A;  3GO5 A;  2F52 A;  3H0G G;  3PIO A;  1LM0 A;  5FLM H;  4JI3 L;  4NXM L;  2HIV A;  3ULP A;  2VNU D;  4Y7N H;  1ASZ A;  4NXN L;  3OYY A;  1XMQ Q;  4BY7 H;  1QVC A;  2ATW A;  4HIO A;  1TWG H;  2N8N A;  3RN2 A;  1QVG A;  4DV3 Q;  1W3S A;  3CXC A;  2BA1 A;  4TQU S;  4DR7 L;  3J80 i;  4GN5 A;  2CQO A;  2JEB I;  3I2Z A;  1Y1W H;  4JI2 L;  1VQJ A;  3U4V A;  3KF6 B;  4OO1 G;  4GKK Q;  3T1H Q;  1GVP A;  1R9T H;  1PH9 A;  1L1O A;  3PUV A;  2ZM6 L;  1GM5 A;  4OX9 Q;  1D7Q A;  4HIM A;  5ELN A;  2BH2 A;  1D8L A;  3M4P A;  1Q86 C;  3HOZ G;  2UUB Q;  1JB7 A;  1JJC B;  3RR5 A;  1JT8 A;  1MIU A;  1AE3 A;  3H15 A;  2ZJQ A;  1N9W A;  4HJ8 A;  3RLN A;  5HY6 A;  1XMQ L;  1YI2 A;  1SN8 A;  1CKN B;  4MZ9 A;  4JI8 Q;  4GLA C;  3M85 A;  4GNX A;  3B6Y A;  3W1B A;  4DV3 L;  1VQ6 A;  5C3E G;  2YU9 H;  3CCU A;  3HKZ E;  1PHJ A;  2R92 H;  1BKB A;  5C44 G;  4A3K G;  1TWC H;  2JA6 G;  2KHI A;  4B3R Q;  1EQQ A;  2OCE A;  3AEV A;  5JEA G;  4GKK L;  3T1H L;  4WJ4 A;  3KF8 B;  4DK3 C;  2VW9 A;  1VQ8 A;  4OX9 L;  4Y52 H;  3FKI H;  4A3D G;  3PIP A;  1Q1B A;  4L5T A;  2ZJP A;  4GNX C;  2UUB L;  3HOV H;  2ZTE A;  4IFD G;  2NVY H;  4GKJ Q;  1OXU A;  1XPO A;  2XGT A;  2UU9 L;  3M7N A;  3KF6 A;  4A3M G;  4L5S A;  1LUZ A;  3CCM A;  3UDF A;  4YHH Q;  3RZD H;  3S1M H;  1HNW Q;  5C0X J;  2B63 G;  4DR6 Q;  4JI8 L;  4DPG A;  4BBR H;  3CCQ A;  4JOI C;  5ELO A;  3AQQ A;  3U4Z A;  4JBJ A;  1UEB A;  2QEX A;  2IX1 A;  5BR8 Q;  1XMO L;  5IT9 c;  1U5K A;  3K7A H;  4B3R L;  1Y1V G;  4GS3 A;  1TWA H;  3FHW A;  3NBH B;  1IBM Q;  2A8V A;  3HOU H;  1CKN A;  3KJO A;  4JYA Q;  1KC8 C;  2B29 A;  3SGI A;  1PH2 A;  1VQ5 A;  2UXD L;  4PZ7 A;  1JJG A;  1SR3 A;  3F2C A;  2JQO A;  4JI1 Q;  3S17 H;  4A3F H;  3PF4 A;  1VQH A;  4YCV A;  2ZTC A;  4DUY L;  3HOY H;  4GKJ L;  1P16 A;  4OO1 I;  4POG A;  2AHO B;  4C3I H;  4JBK A;  1HZ9 A;  1UE1 A;  1L2F A;  1QVF A;  3HOW G;  3J7A 5;  2LXK A;  4YHH L;  4DKA C;  1HNW L;  4DR6 L;  2N78 A;  1J6Q A;  3U58 A;  4LF7 Q;  1X6O A;  1CSP A;  3DM3 A;  3DLL A;  1K83 H;  2RHQ B;  1S40 A;  1HZC A;  3CAM A;  3HKS A;  4C2M H;  5BR8 L;  1X3F A;  5LMU Q;  3GTO H;  4A3C G;  3S2H H;  1N34 Q;  1Q46 A;  5GAH C;  4BY1 H;  3I4M H;  4LFA Q;  4P74 A;  3J80 c;  1Q12 A;  4X66 Q;  1TWF H;  2QGQ A;  1IBM L;  3CD6 A;  5H1S E;  5GRO A; 
#chains in the Genus database with same CATH topology
 4JYA L;  2B2U A;  4A3I B;  1M1K C;  1CKM A;  5BN3 A;  5AJ3 Q;  2PZW A;  4YCU A;  1QG7 A;  2KHS A;  4KHV A;  4DAP A;  3NBH A;  3E5S A;  4IQZ A;  3T1Y Q;  4MNO A;  4HJ7 A;  2EY1 A;  4FF1 A;  3F1Z A;  2JP1 A;  2PMZ E;  5FLX E;  4PZ6 A;  4LFB Q;  4B3S Q;  2K52 A;  2Z6K A;  2SNS A;  4X66 L;  4L5Q A;  1N36 Q;  2Z0S A;  4K5V A;  1EFW A;  2UU9 L;  4WOR A;  2E5L Q;  3BVZ A;  1SLJ A;  3TZD A;  1OTC A;  2EYH A;  1K8G A;  2A6H D;  5IGG A;  1XNR L;  4AQY Q;  5M3M B;  5KNB A;  5HGQ A;  3OTO L;  4H0L C;  1TT2 A;  4ZCK A;  4DV2 L;  2ZT9 C;  5JOB A;  1Z9F A;  4NMZ A;  4C3H H;  3M3Y H;  4EQP A;  1M4V A;  4J1M A;  5K36 G;  1DOL A;  3SE0 A;  4DV5 L;  4WRD A;  4A3B B;  1FNU A;  2XSC A;  5JEA H;  4LF4 L;  3N6R A;  1XJV A;  4O2D A;  4G7O C;  3J80 E;  2IJ0 A;  4HSV A;  3DEO A;  4X65 Q;  1W6K A;  3NEL A;  3A5Z B;  2MO1 A;  4K8I A;  1ENF A;  3BDL A;  3KLS A;  1Y69 U;  3I90 A;  5COR A;  5LMN L;  2CW0 D;  3UE1 A;  5IYC G;  4QB4 A;  2XN9 C;  3EBE A;  1EQT A;  1TY0 A;  3C1E A;  5IP9 G;  2K50 A;  3HFZ B;  2EY5 A;  2ICE C;  3K5O A;  4LJZ C;  4XIG S;  4P75 A;  2WV6 D;  1N33 L;  1BCP B;  2UXC Q;  1LAB A;  4DNT B;  3T56 B;  1EY9 A;  5C4X G;  4JC0 A;  1F9S A;  4DUY Q;  3A8I E;  2DNE A;  3HOX G;  3BG3 A;  2QKI C;  1GUN A;  3GTM B;  1HRJ A;  3A56 A;  5M5X B;  5C6A A;  5FLX L;  4F7X A;  4JI0 Q;  1XXG A;  2AQ2 B;  2C9O A;  3F2U A;  1UE5 A;  3T4A C;  4R4I A;  1TQO A;  1OXT A;  1HPC A;  3OOC A;  4GOP C;  1H95 A;  3MXN B;  2EQS A;  3HOX B;  1EUJ A;  4PQX A;  2F0O A;  3SXH A;  1S3O A;  4DAY A;  4RHR A;  2IY5 B;  3M9B A;  4LF9 L;  1SNO A;  2M00 A;  2A68 C;  4AYB B;  2NVX H;  4JCV E;  4X64 Q;  4RAU C;  3A0J A;  3D8G A;  4J6H A;  4QJF A;  3NTI A;  5DLQ E;  3ITP A;  1W2B A;  3SEB A;  4HCS A;  1PA6 A;  5E4W C;  5D3D A;  4JI4 L;  4KY7 A;  3TME A;  5K36 H;  1G6Z A;  2GA4 B;  1SYE A;  2JA7 G;  3KK7 A;  1DM0 B;  1KAW A;  1PTO H;  1V1P B;  4RWS C;  3AU7 A;  4JV5 L;  2R7Z G;  1GUT A;  1GJX A;  4V0B A;  3E3X A;  3QOL A;  5IT9 E;  4BBS G;  2EYO A;  4RGO S;  2BOS A;  4N9T A;  3HOV B;  1GHJ A;  1VCI A;  5LMN W;  2JA7 B;  2C35 B;  4C3J G;  3ND8 A;  5IYC H;  3S1R B;  2LMC B;  3WOF A;  2R7Z B;  5IIF A;  4K0K L;  1F9Q A;  2K5D A;  5IP9 H;  2YV5 A;  4IN3 A;  1VQK A;  3EIV A;  4DUZ Q;  4JI5 Q;  3GTM H;  1R4P B;  4DN4 M;  1F77 A;  4KJN A;  3OSO A;  4LMQ D;  1KTK A;  2BCO A;  1J8I A;  2SOB A;  4C3J B;  2QDB A;  4ID6 A;  5C4X H;  1KNA A;  4HMI A;  3TS2 A;  1IBK Q;  3M4Q A;  2SNM A;  4OON A;  1BQQ T;  4TVA B;  1VQ7 A;  2JE6 I;  4BA2 I;  5C0X G;  1LTB D;  3KOJ A;  3HOX H;  2RSO A;  2KOL A;  4B3M L;  1A2U A;  2ALY B;  3EFX D;  4LUV A;  4K6L A;  1QJO A;  4EQO A;  1TWF B;  2O4X A;  1Q90 A;  2ASB A;  1XTC D;  4KV6 A;  1VQ4 A;  4R4C A;  4DV1 L;  1STH A;  1VQL A;  4A75 A;  1PZJ D;  2EXZ A;  4X62 L;  2CH4 W;  4A4I A;  5J22 A;  1KLU D;  2QCP X;  3I4N G;  2FXQ A;  2NZ1 D;  3CF5 A;  1JB3 A;  2EYF A;  1II3 A;  1VDZ A;  4LF5 L;  1GOZ A;  4EVO A;  3H3V I;  1A63 A;  3ERQ A;  4DV7 L;  3RD4 A;  4OHJ A;  1K9M C;  5CC4 A;  1ZKO A;  4GOP A;  5KYL A;  3ULL A;  3LGJ A;  1H9K A;  3KLW A;  4PNY A;  4C56 C;  2J0T D;  4BY7 G;  3M4Y A;  5EKK A;  4HJA A;  1ILQ A;  2LXJ A;  3HOZ B;  1KQS A;  3I4N B;  1PH8 A;  4ZAI A;  2A69 D;  4LUO A;  3S1Q B;  2JA7 H;  5C3X A;  2I5H A;  3PV0 A;  1K3B C;  4RMF A;  3CC2 A;  2KEN A;  1G2S A;  3S1R H;  1G2T A;  1QNK A;  3ICE A;  1A15 A;  2F0J A;  1LTS D;  5C0X I;  2R7Z H;  5I2Y A;  1B1Z A;  1A2T A;  1IL8 A;  5L37 A;  4BBS H;  2EPB A;  2JYO A;  3STB C;  4UDU C;  4QUC A;  4LFC L;  1I94 Q;  2R92 G;  4C3J H;  2AWN A;  1R9T B;  3H3V H;  2OEO A;  1PH7 A;  1ESR A;  5J39 A;  3Q0A A;  5C5L A;  3H6M A;  1PYB A;  4GN4 B;  3C3L A;  2TMP A;  3W2D A;  4LUZ A;  1IHZ A;  4KHP L;  2B39 A;  3X3M A;  1O78 A;  2EYM A;  2WIN B;  3ZJY C;  3CC4 A;  1HNX Q;  4LF8 Q;  5KYI A;  1Y1V B;  1SSO A;  2ZXR A;  1DOK A;  1G6P A;  3ND9 A;  2MJ8 A;  3PF5 A;  3URY A;  1I4X A;  4APV A;  2NVT H;  3A8J E;  1LTA D;  1DON A;  5T1I A;  2D0P A;  2WP8 J;  2AQ3 B;  2BE5 D;  3GTG H;  5C0X H;  3NXW A;  3GV3 A;  1FL0 A;  4FF2 A;  1EQR A;  2EE1 A;  4OIK A;  1LT5 D;  3G4S A;  3NWS A;  4AH6 A;  4A3J G;  2KVM A;  1C48 A;  4IFD I;  1WTP A;  1SMX A;  3NEM A;  1YNJ C;  1CK1 A;  1K8A C;  3F8T A;  3MWY W;  3K7A B;  1NUC A;  4FO2 A;  1I4R A;  1L1O B;  1R4Q B;  4YWM A;  4XYQ A;  1NE3 A;  3I4N H;  3NK9 A;  1Z6H A;  4A3J B;  1LLR D;  3TRE A;  3D4D A;  3S1Q H;  4HIK A;  2MQH A;  4P72 A;  1STY A;  1CZW A;  3R2I A;  2F52 A;  2AQ1 B;  2PNR C;  3PIO A;  1FR3 A;  2WKD A;  1XYI A;  4NXM L;  2E2D C;  3BVG A;  2VNU D;  1PFM A;  1ASZ A;  4BY7 H;  4A93 B;  1QVC A;  4IZ8 A;  4CBV A;  3RN2 A;  3R93 A;  4V19 0;  5C5M A;  3J80 i;  3TDQ A;  3I2Z A;  2LY7 A;  4GKK Q;  1R9T H;  1PH9 A;  4CJ0 B;  3PUV A;  4HIM A;  2BH2 A;  1D8L A;  1IW7 D;  4RA8 A;  1JJC B;  4KD3 A;  3HRZ C;  5CGK A;  2L12 A;  1VMP A;  1LTI D;  5HY6 A;  1XMQ L;  1SJE D;  5DNF A;  3HKZ E;  1PMR A;  2R92 H;  2JA6 G;  1EQQ A;  2E75 C;  4KN4 C;  2HD3 A;  1WVL A;  1D1I A;  1KDA A;  1EU4 A;  3U9S A;  2VUM B;  4GNX C;  5FO8 B;  2Z1C A;  2ZTE A;  4GKJ Q;  1OXU A;  5CV6 A;  3M7N A;  4A3M G;  1X3Q A;  4L5S A;  3CCM A;  3GTJ B;  4CDE C;  2B63 G;  1ROD A;  3VR4 A;  1JCK B;  2JA6 B;  3CCQ A;  4JOI C;  3AQQ A;  4JBJ A;  5BR8 Q;  3K7A H;  5EPL A;  2E74 C;  3D6C A;  2A8V A;  2R3Z A;  4JYA Q;  3TSS A;  1KC8 C;  1ZEQ X;  1SR3 A;  4YCV A;  2DJG C;  5I6Y A;  2B63 B;  2AHO B;  1PTO C;  1RKN A;  2RQX A;  1QVF A;  2O5J C;  1EEF D;  4DKA C;  3K59 A;  1K83 H;  1B9N A;  3CAM A;  3ERO A;  5EQ0 A;  1CZG A;  5GAH C;  3IKJ A;  3H91 A;  3J80 c;  5E1F A;  1Q12 A;  4X66 Q;  2QGQ A;  2UU9 Q;  1PRT C;  1BCP C;  1PFS A;  3KDF B;  1D5X C;  4JI1 L;  1RDP D;  3AFP A;  3AFQ A;  3MEF A;  2E2J B;  1XNR Q;  4B3T L;  2K05 A;  2B8G A;  3CW2 C;  1O7Y A;  3OTO Q;  1NCV A;  2Z9H A;  5HGT A;  4DV2 Q;  1Q3L A;  1D6E C;  1IYJ B;  4X3S A;  4F8M A;  1VQN A;  4DFA A;  3I72 A;  4ME5 A;  4X3K A;  3CMA A;  1I50 H;  1Y8P B;  3HZX A;  2KCN A;  1F2Y A;  4IO9 A;  1Q82 C;  3KJP A;  1VQB A;  4E6I A;  1B3Q A;  1N8R C;  4DV5 Q;  1STN A;  1KRS A;  3PGZ A;  2MNA A;  4LF4 Q;  4DXF A;  4P73 A;  1VQI A;  2K4K A;  2YYZ A;  1FJG L;  1STE A;  3V96 A;  2IX3 A;  4JBM A;  3L9A X;  1EU3 A;  2F0Q A;  2Z6K C;  5CV7 A;  1VQO A;  2NTT A;  4FDB A;  3VDY A;  2RCF A;  3J7A F;  1YHA A;  4P71 A;  2NN6 I;  5JJZ A;  1GUW A;  1ILP A;  2JA5 G;  5LMN Q;  3MAQ A;  2KEE A;  2E76 C;  2JA6 H;  1JR0 D;  3KFU A;  4WFN 3;  1U4R A;  1V1O A;  2SEB D;  3CME A;  1YHQ A;  1NSN S;  2E8G A;  2DN8 A;  1N33 Q;  4DR4 L;  4IUN A;  4MHE A;  4A3M H;  3PQI A;  2B8F A;  3GQB A;  2JA5 B;  2H5X A;  1DXM A;  3L7Z C;  1X3P A;  1BOS A;  4DV4 L;  4DK0 A;  3I91 A;  2F0F A;  4RHS A;  3GDE A;  1YNN C;  4A3L G;  3CCJ A;  1ICF B;  1EYD A;  2G9D A;  3S14 H;  2K04 A;  4EGV A;  1SYC A;  4N9P A;  2MO0 A;  4J15 A;  1SE4 A;  5C3W A;  3HGB A;  2RDF A;  2Z8L A;  2EZV A;  4DR2 L;  1C7Y A;  3NTH A;  1FGU A;  3QJY A;  3R8B A;  2QF7 A;  2E2J H;  4JOI A;  1NBW A;  1EZ8 A;  3WWV A;  1D1K A;  4QY7 A;  1S4Z A;  4S3S A;  5E7N A;  2AUJ D;  3SK8 A;  2PCF B;  3G7L A;  4XXE A;  4JG2 A;  4NP5 A;  4OL7 A;  4LF9 Q;  1T5E A;  4YWL A;  1O7I A;  3NQI A;  4B08 A;  4DR5 L;  2OTL A;  1WCM G;  4UPA A;  1SFO B;  4X3T A;  1PVO A;  4TKO B;  3H3V C;  2CWP A;  2PZU A;  2L11 A;  2WAQ G;  1J9O A;  5KND A;  1X32 A;  3GTP H;  4DV0 L;  4A3E G;  1N32 L;  1H9S B;  2L9H A;  2F0W A;  2PYK A;  1X54 A;  2KJX A;  4A3I G;  3V05 A;  4JI4 Q;  3CCV A;  2F3I A;  2V4D A;  2CKZ B;  1VQG A;  4XT1 B;  1WCM B;  2R93 G;  2Y0S E;  4Y7N B;  3GTL H;  3TZU A;  5GAG C;  5GAD C;  4YCW A;  3I3C A;  5FO7 B;  4L8J A;  1ET9 A;  1ML0 D;  3K5L A;  4JV5 Q;  1O7Z A;  4ZKB B;  1EYC A;  2XIW A;  1LT3 D;  2FJ2 A;  1XPU A;  1UWV A;  1IKM A;  3OW7 A;  4R4O A;  3MHB A;  2F0M A;  2Q8T A;  4R8I A;  1VQC A;  5GAE C;  1CSQ A;  1HNZ L;  4XT3 B;  1QB5 D;  4ZLT F;  3RLO A;  2OT2 A;  2R93 B;  4BS9 A;  4DK1 A;  5M3M G;  2JA5 H;  2VQF L;  3VR6 A;  1VQD A;  4X6A H;  4IFD J;  1TVX A;  4QF4 A;  5NUC A;  2NBF A;  4CKC A;  1RD9 D;  3I4L A;  2WB1 E;  3MXN A;  4K0K Q;  1AW7 A;  1TWC B;  2RHS B;  2JSO A;  2GN5 A;  1E1O A;  1CQV A;  1X55 A;  1SRO A;  2K1B A;  4A3B G;  4JK1 C;  2F0T A;  5F2D A;  1ICW A;  2QIL A;  5C4Z A;  1JWS D;  1RTO A;  1PH1 A;  3E9H A;  3MXG A;  2CFM A;  3F2B A;  4ZUJ A;  4B3M Q;  4BBR B;  3TRZ A;  4A3L H;  2K03 A;  3T51 B;  2L5T A;  2NWG A;  1TWA B;  2EJM A;  5M3F G;  1SFO H;  2E2I H;  1V1P A;  2NVQ H;  4IPD A;  1LV9 A;  4DV1 Q;  1CA5 A;  1B70 B;  4X62 Q;  5JJL A;  1L0X B;  4K2K A;  3RZO H;  1HUM A;  2A6E D;  1UE6 A;  3NUC A;  3FEW X;  3CPW A;  1EOT A;  3I73 A;  4RH6 A;  4Z9C B;  1JC7 A;  2X6L A;  4LF5 Q;  1F2M A;  3GTQ B;  1WCM H;  1I4P A;  5M3F B;  1E0B A;  2ZXP A;  3BZK A;  2RVL A;  4DV7 Q;  3I4M B;  1L0W A;  4JI7 L;  2A6H C;  3VA5 A;  1B50 A;  2TSS A;  3W5O A;  5I4D A;  3OHX C;  4L63 B;  1KL9 A;  1DJR D;  2B2W C;  3TP8 A;  1NY4 A;  1SE8 A;  4A3E H;  3OPO A;  4EQN A;  4KMU C;  4A3I H;  2OXP A;  5ELE A;  2Z4I A;  1OO9 B;  4EQ5 A;  2CQA A;  3NQT A;  2ID0 A;  1UE7 A;  3CCR A;  2R93 H;  2SDF A;  3CPF A;  4KD4 A;  3T13 A;  3RLF A;  1C0A A;  1SYG A;  2OQ0 A;  1T9H A;  1IYV A;  1L1O C;  4UY8 C;  5I6W A;  4DV6 L;  3M7G A;  4AYB G;  5I9P A;  1EY6 A;  3P75 A;  3MFY A;  4HID A;  1I4Q A;  2AKW B;  1TII D;  1KDB A;  4LFC Q;  2CW0 C;  5M3M H;  2K6A A;  2BH8 A;  1XNQ L;  1WFQ A;  2PW5 A;  3R2T A;  1PH5 A;  2KCT A;  4KHP Q;  5C3E B;  4HAE A;  3JC6 6;  4NPS A;  2VB3 X;  4DR1 L;  3PCO B;  1JWU D;  4A3B H;  1E7Z A;  1VS0 A;  1QCB D;  1HZA A;  3PUX A;  5KGU A;  1KHI A;  3DUZ A;  2D0O A;  2Q2H A;  4XDX A;  4M8A A;  2EOT A;  4KI0 A;  3A8K E;  2IPK D;  1EIY B;  3RNU A;  3J80 L;  3FKI G;  3HOV G;  1Q1E A;  1HTL D;  3BJU A;  3DM1 A;  3GTQ H;  2HQL A;  1QZH A;  3UDI A;  4CKB A;  2EIF A;  5JJK A;  5M3F H;  2HIX A;  2MFI A;  1DGS A;  3E0J A;  1HFN A;  2YU9 B;  2ES2 A;  2IW3 A;  3G6E A;  5IWA L;  4LWC A;  4IPG A;  3T53 B;  1QUQ B;  3HOW B;  4LW1 A;  3FKI B;  5IGE A;  2KEC A;  4Q0F A;  5D14 A;  4YIJ A;  5CV8 A;  1FNW A;  2K14 A;  3HOY G;  2LKV A;  2EDG A;  1SNM A;  3D0F A;  1EY0 A;  4HMJ A;  4WJW A;  4G7H C;  5JJI A;  4NXM Q;  3W1G A;  4JVZ A;  1EWI A;  1MJE A;  1KRT A;  4B9X A;  1Q7Y C;  1SMY D;  1VF5 C;  2AWO A;  3IFD A;  5M5X H;  2L4N A;  1YEZ A;  2L0C A;  2A5H A;  2F0G A;  1FD7 D;  3K80 C;  4DR3 L;  4IPC A;  4J8Q A;  3M4O B;  4KJO A;  2VS1 A;  2E2H B;  1CM9 A;  3QB3 A;  3HOY B;  3K5M A;  1ZYR D;  4JPB W;  2CWA A;  5IY0 A;  3PUW A;  2B2W A;  5FJ8 G;  3PO3 B;  2NB0 A;  3H0G G;  4C2M B;  1FYC A;  1I4G A;  2VB2 X;  3OYY A;  1XMQ Q;  4HIO A;  3GV6 A;  3NTK A;  2CHB D;  4KN7 C;  2J4X A;  2BA1 A;  1KDC A;  5FKA C;  5I9O A;  4DR7 L;  4OGQ C;  4OO1 G;  1GVP A;  1L1O A;  5ELN A;  3M4P A;  3H0G B;  3HOZ G;  3EQL C;  1TKW B;  1MIU A;  1B44 D;  1N9W A;  1CKN B;  3FVQ A;  2PMZ B;  2WB1 B;  3W1B A;  3DHQ A;  4I7A A;  2YU9 H;  1PHJ A;  4G57 A;  1MGS A;  1EYA A;  2KHI A;  1TS4 A;  2FFK B;  1STG A;  3PIP 3;  2OCE A;  3FPP A;  4U68 A;  3T1H L;  4WJ4 A;  5FO9 B;  3FKI H;  4A3D G;  4IUT A;  3HOV H;  4IFD G;  5IT9 L;  1XPO A;  2ICI A;  4JI8 L;  2F03 A;  5JVH 3;  2IX1 A;  3S1N B;  1U5K A;  4B3R L;  4H7B A;  1Y1V G;  3FHW A;  4A3D B;  1Y8N B;  1NR4 A;  1PH2 A;  3LWU A;  3SGI A;  2KCC A;  2K32 A;  4M1U B;  3F2C A;  4KKS A;  4JI1 Q;  1WTW A;  5K5P A;  5BN5 A;  4DUY L;  2ZTC A;  4OO1 I;  3HOY H;  1P16 A;  1EQV A;  1CT1 D;  4JBK A;  4FXK C;  3J7A 5;  2LXK A;  2Q8I B;  4DR6 L;  1J6Q A;  1ENC A;  3LWE A;  1PXU A;  1LT6 D;  2RHQ B;  1S40 A;  4RGT A;  4C2M H;  1Q46 A;  4LFA Q;  1BDO A;  4P74 A;  1B2T A;  1TWF H;  2A69 C;  3CD6 A;  5GRO A;  2I5M X;  1CQF A;  1CHP D;  1PFB A;  3U9O A;  1YNX A;  2KCM A;  1CTM A;  1G51 A;  4QCL A;  3HEJ A;  1FJG Q;  1HUN A;  3BDC A;  3CQZ B;  3UDX A;  5FJ8 H;  1VQ9 A;  1YVC A;  1WJJ A;  2PW7 A;  3CCL A;  3D4R A;  2QDL A;  3VR2 A;  3F2D A;  1WTQ A;  5LMU L;  2VY3 A;  5M5W B;  3S2D B;  1YIT A;  4JBW A;  1TS3 A;  2FMC A;  3E0E A;  3S24 A;  3VYR A;  3W3A A;  2G5D A;  1FVI A;  3CRK C;  1RL2 A;  2EYL A;  1I6H B;  4OO1 H;  4CDF C;  1TR5 A;  1K8M A;  2R6G A;  3CP0 A;  4A93 G;  2D2C C;  3SK5 A;  4ILW A;  3HOZ H;  1CHQ D;  1KAB A;  4DR4 Q;  5EKL A;  2ZJR A;  1ESF A;  3KDF A;  4TSS A;  5DEH A;  3S15 B;  5IOC A;  2ENB A;  4HED A;  1RHP A;  4DV4 Q;  1HR0 L;  2HT1 A;  1PH3 A;  3G71 A;  4FXD A;  4DA2 A;  2BE5 C;  2CCZ A;  4FF4 A;  1V9P A;  3ULJ A;  4QIW E;  4A3D H;  2DJF C;  4ZK9 B;  3EVQ A;  4IFD H;  5KNC A;  1HA6 A;  1FGB D;  4DR2 Q;  1Y8O B;  2A73 B;  2C5C A;  4GOP B;  4XQN A;  2MGS A;  1QNU A;  1SYD A;  1KNE A;  2Q2I A;  3K7U C;  5FOB B;  2VUM G;  2I07 B;  4BA1 I;  1HFG A;  2F0U A;  1K3R A;  1Y1V H;  4PMB A;  1BBW A;  2EYP A;  1CUK A;  3H09 A;  4A76 A;  5BN4 A;  4DR5 Q;  2K01 A;  4RCN A;  1XMO Q;  3UDG A;  1MKH A;  1GUS A;  2KUM A;  2PI2 A;  4QQB X;  2UXD Q;  2UXB L;  1E24 A;  1N32 Q;  2RDG A;  5GQO A;  4X3U A;  1DOM A;  1K0S A;  3TP6 A;  1HHV A;  3SDZ A;  4HCE A;  3BDO A;  3G6J B;  5DAU A;  2QEJ C;  3BU2 A;  3Q23 A;  5M5Y B;  1IW7 C;  4BXX G;  1X9N A;  2N55 A;  3SK6 A;  1JE5 A;  2IHE A;  4ODG A;  4A3J H;  3QIA A;  1DCZ A;  1HNZ Q;  1VQA A;  2OTJ A;  4YY3 L;  2B3G A;  2NN6 G;  4R8N A;  2VQF Q;  1HQR D;  1E1T A;  3MZ5 A;  3MFG A;  5EPK A;  2X69 A;  1T5X D;  3Q22 A;  4A93 H;  1BBX C;  3C1F A;  3SR1 A;  1Y1W B;  1WTH A;  3T16 A;  1CA6 A;  2K5N A;  1SYB A;  4OWX B;  2O2L D;  1HR0 W;  3D31 A;  4ZQ3 A;  3MXP A;  4F87 A;  1OXS C;  1YBY A;  1OXV A;  4UP9 A;  3NBI A;  4HN7 A;  2KA7 A;  4MN3 A;  3A74 A;  1X3E A;  3NWT A;  2L15 A;  1ONL A;  4IPH A;  3FRP B;  1H9M A;  3IRB A;  3NE5 B;  3J81 i;  3VYS A;  4EX5 A;  3E9I A;  1D5Z C;  2K5W A;  4R9W A;  4KY5 A;  3HP3 A;  2QA4 A;  1EYG A;  3PO2 G;  1TY2 A;  1KXL A;  4IJL A;  1I4H A;  3DWA A;  2OWO A;  2VUM H;  1K0R A;  4LF8 L;  1BVS A;  3L0O A;  5AFW A;  5IYD G;  5CV4 A;  5ELB A;  3VYU A;  3K5N A;  3UE0 A;  4OEM B;  3RZD B;  3GTJ H;  4KTA A;  3BZD B;  1AN8 A;  2V1C C;  4I7Z C;  1SNQ A;  4JI7 Q;  3TS0 A;  1DYQ A;  2XVS A;  5CV5 A;  4JI6 L;  3PO2 B;  3Q8D A;  1B7Y B;  5M9O A;  4KHZ A;  2F4V L;  5M5Y H;  1QZG A;  1KD1 C;  3S17 B;  3ER0 A;  4A3F B;  2JA8 G;  3BZC A;  4C3I B;  3GTK B;  1LTL A;  3FP9 A;  1WD1 A;  2B63 H;  2H1E A;  4R4Q A;  2F0V A;  2F1M A;  1K8O A;  2HHH L;  2Z6B A;  3NPP A;  4O0A A;  2UUA L;  1PV4 A;  4BY1 B;  1SE2 A;  1U4L A;  4F88 A;  1WD0 A;  1GUO A;  2A74 C;  5EKI A;  4DV6 Q;  2JA8 B;  4BXX H;  1JMC A;  3K57 A;  3GP7 A;  2IWH A;  5DM6 3;  1TXY A;  1D2B A;  5EGT A;  4O1N A;  2NN6 H;  3PUY A;  5E4X A;  4R1J A;  3DMU A;  2BA0 A;  2L1B A;  1J5E L;  2PPB C;  1RF2 D;  2R61 A;  1XNQ Q;  2UUC L;  1V8Q A;  3A54 A;  3DWP A;  2HDL A;  3Q24 A;  4UP7 A;  1VQE A;  2B2T A;  2RCN A;  4RCO A;  2VQE L;  3J81 c;  1EEI D;  3JAM i;  4DR1 Q;  1Q8I A;  3V2T A;  4ZUI A;  1VQM A;  4K5W A;  2PNH A;  2B2V C;  3CRL C;  3CHB D;  1SNP A;  2PZT A;  3PMF A;  4KKT A;  4G7Z C;  1EIG A;  1PYS B;  5LL6 X;  5A2Q E;  2VZA A;  1LT4 D;  1W6J A;  4QMG A;  2R7D A;  2FHT A;  4C3H B;  3CCS A;  3M3Y B;  1CKO A;  3I7F A;  2IX0 A;  3IAY A;  2EVB A;  4FXG C;  1A3U A;  2H4O A;  2NUC A;  2XWJ B;  1HCZ A;  2NYZ D;  3TEH B;  2XRQ D;  2RBM A;  1K73 C;  3DWQ A;  5IGD A;  4HSP A;  3PO2 H;  1YJN A;  2X6G A;  5IWA Q;  1B53 A;  1AZP A;  4H13 C;  1NMF A;  5CMD A;  1GUG A;  3HKZ G;  3ERS X;  5IYD H;  1KIX A;  2PQA B;  3GTK H;  3S9W A;  4PMC A;  2F4I A;  4PMW A;  4NB3 A;  4OWW B;  4PZ8 A;  4DAV A;  1JOK A;  3LNN A;  1BF4 A;  4QL5 A;  4DXG A;  3G48 A;  4BBR G;  5JVG 3;  3EN2 A;  2JA8 H;  3HKZ B;  2P5Z X;  3A7L A;  2JN4 A;  2N3S A;  1LTG D;  3BVM A;  4POF A;  4QGU A;  4IOC A;  1F9R A;  1HZB A;  4DR3 Q;  2FIN B;  4LF6 L;  1TS5 A;  2DY7 A;  3S1M B;  4RKB A;  4FVM A;  1OXX K;  1L0Y B;  3JAM c;  4ULL A;  3ZYY X;  1VQP A;  3KYH C;  4IUV A;  2NZO A;  1RIP A;  1ENA A;  1U9R A;  3RUZ A;  1STA A;  1PZI D;  1M8A A;  1S5F D;  2K5Q A;  2OF1 A;  2OQK A;  3CKI B;  1BBU A;  3I4M G;  1RCV D;  3TBI B;  1RJT A;  1BXT A;  4DR7 Q;  4DK6 C;  5TSS A;  4K2L A;  4H02 A;  1S72 A;  1IBL L;  1B8A A;  4GNX B;  1QUQ A;  2NVX B;  5A2Q L;  3I55 A;  4C1N K;  3OIQ A;  4JI3 L;  3ULP A;  2K33 A;  4RGM A;  4Y7N H;  4NXN L;  4N8X 1;  2ATW A;  4DU9 A;  4MIU A;  4GN5 A;  4DNR B;  5IGC A;  4JI2 L;  1VQJ A;  3U4V A;  3KF6 B;  3C46 A;  1JOQ A;  3T1H Q;  2ZM6 L;  1GM5 A;  1D7Q A;  1MHW C;  1PLF A;  3MEH A;  2B2V A;  1PTO B;  3H15 A;  2ZJQ A;  5COY A;  5CR3 A;  3RLN A;  1SN8 A;  2AUK A;  4JI8 Q;  3M85 A;  3K6O A;  3B6Y A;  4DV3 L;  5C3E G;  1XWE A;  1BKB A;  5C44 G;  2A68 D;  1TWC H;  4A3K G;  4B3R Q;  3MA2 B;  3AEV A;  2A6E C;  1PZK D;  3TP7 A;  1PRT B;  3KF8 B;  5C4J B;  2VW9 A;  3FDT A;  4OX9 L;  3PIP A;  4L5T A;  2ZJP A;  1EY5 A;  2UUB L;  2RA4 A;  1SYF A;  1BNZ A;  3S1M H;  2PO4 A;  1EY4 A;  4DR6 Q;  1JWM D;  4BBR H;  5C44 B;  4A3K B;  1I6V C;  2ZXO A;  3E6Z X;  5ELO A;  1UNS A;  2QEX A;  3WOE A;  5LHY 1;  4GS3 A;  1I3Q B;  4IUP A;  1EY8 A;  1TWA H;  3NBH B;  1NAP A;  2F0H A;  4RKL A;  1CKN A;  1STB A;  3KJO A;  5C4X B;  1VQ5 A;  1EFI D;  1B9M A;  2JQO A;  3IFT A;  1VQH A;  3LX0 A;  1SJH D;  1HZ9 A;  1UE1 A;  1L2F A;  4NKL A;  3HOW G;  1GHK A;  4YHH L;  1HNW L;  4TRD A;  2CH4 A;  2K28 A;  1X6O A;  3DLL A;  3QOJ A;  1HZC A;  3HKS A;  1LAC A;  1XX8 A;  5LMU Q;  1X3F A;  1E2Z A;  4A3C G;  5I2X A;  5KEE A;  1AZQ A;  3I4M H;  1IBM L;  1E22 A;  3J81 E;  2IHF A;  3BYY B;  4YWK A;  5EAY A;  4UAI A;  2DY8 A;  3RMH A;  1YHB A;  3AYH B;  3VR5 A;  3U50 C;  4LF7 L;  2XTI A;  2MUY A;  5ELC A;  2AMC B;  2XWB B;  1TS2 A;  4O42 A;  4HJ9 A;  1MI2 A;  1HQM C;  2GVB A;  3UI2 A;  2RDH A;  4FP5 D;  1Y14 B;  5IOD A;  1N34 L;  1HR0 Q;  2KBN A;  3I8Z A;  3CCE A;  3J7A V;  3PO3 G;  4CHT B;  4DAM A;  5JPM C;  1LYL A;  5AJ3 L;  2Y0S G;  5J3B A;  1O7L A;  3QG1 A;  1GD7 A;  1KLG D;  5FK9 C;  1VF7 A;  5C4J H;  2JXM B;  5HUR A;  4ALP A;  5ELD A;  2XNA C;  3T1Y L;  1GXD C;  3HS0 C;  1HJP A;  2GVA A;  2NZH A;  3K0X A;  2MPM A;  2IT1 A;  2D62 A;  4GLV B;  3KBX A;  1C9O A;  4IUQ A;  4LFB L;  4B3S L;  4LK1 C;  5C3E H;  5C44 H;  4A3K H;  2Y0S B;  1N36 L;  4BBS B;  1B4O A;  2RF4 A;  2E5L L;  1QE6 A;  3QWN A;  1I3Q H;  1EIF A;  1JIC A;  2MHV A;  4CDD C;  4FYD A;  4AQY L;  2WB1 G;  1SEB D;  4GN3 B;  1VMC A;  2WFW A;  2EXD A;  3R3O A;  5G3L D;  4CKE A;  2UXB Q;  2L55 A;  1MSH A;  1S5D D;  4XYO A;  1NMG A;  3I56 A;  1SMY C;  3P7J A;  1EWC A;  2I46 A;  2K7V A;  2FMM A;  2A19 A;  2Q2T A;  1F2Z A;  3JAM E;  2NVT B;  2N88 A;  4ZKC B;  4ABN A;  3I4O A;  5IGF A;  2ZTD A;  3H94 A;  2F3V A;  4UP8 A;  5IYB G;  2M9V A;  1ZYR C;  3GD7 A;  4CGY B;  4X65 L;  3GTG B;  3MC0 B;  1EL0 A;  3K8A A;  2LSS A;  2BDO A;  2YTY A;  4DAY B;  3HOW H;  1E3P A;  4RGN A;  3J81 L;  4L5R C;  3STB D;  2LS0 1;  1C8C A;  4RFB A;  1A8V A;  2F0P A;  4YY3 Q;  4A3C H;  3KUP A;  3TN2 A;  2JK8 A;  2R7F A;  3D6W A;  4K5X A;  4Q5V A;  3QO2 A;  1GKH A;  1HXY D;  5G3L F;  1E2V A;  3FPU B;  1H9R A;  2Z4H A;  4KLK A;  1PH6 A;  2UXC L;  2KHJ A;  4IOA A;  3P1H A;  3M4O H;  3NSW A;  1KAA A;  2E2H H;  5E3F A;  2F0I A;  4B3T Q;  4B9W A;  1WTV A;  3QR8 A;  1SE3 A;  3PO3 H;  1C4Q A;  2O5I C;  2EYJ A;  2PI2 E;  4JW0 A;  4BY7 B;  1E2W A;  3MTS A;  1NNX A;  3BS1 A;  1YJ9 A;  3J7Y W;  4JI0 L;  2KED A;  1YNJ D;  4FF3 A;  1YJW A;  5C4H A;  1UEA B;  1SXT A;  3K81 C;  1PH4 A;  1YZ6 A;  4PG3 A;  2I0Q A;  4XQJ A;  4OXP A;  5JEA J;  4XTC S;  1HH2 P;  1MJC A;  1LO5 D;  2D9U A;  1X3G A;  1RTN A;  3H0G H;  2EJG C;  1YIJ A;  1BUV T;  1Q81 C;  1LTT D;  1IZ6 A;  3VYT A;  2RKS A;  3PSI A;  3J7Z C;  4X64 L;  4A3G G;  3HG9 A;  2R92 B;  1V1Q A;  1H9J A;  3EJI A;  2JEA I;  3J81 j;  1PDQ A;  1IXR A;  5A35 A;  4JI6 Q;  2MP1 A;  1Q8K A;  2VL6 A;  5IP7 G;  4KY6 A;  2F4V Q;  1WOC A;  3JAM L;  2N49 A;  2WAC A;  2K75 A;  3VA7 A;  3CC7 A;  3FMC A;  4NDX A;  4KK7 A;  4A3G B;  1SND A;  3N52 A;  4DNI A;  2IL8 A;  1TWH B;  1IL2 A;  2HHH Q;  2BDN A;  4GZY C;  2F0L A;  2UUA Q;  2WII B;  5ISR A;  4LAA A;  5D65 A;  5IYB H;  3S1N H;  2F3W A;  1WYD A;  1SRU A;  3L2P A;  2I5L X;  1SDF A;  2Q8R E;  4IJH A;  2J7Z A;  3PUZ A;  1IKL A;  1QOH A;  1WI5 A;  2B2Y C;  2YTV A;  1AH9 A;  1NJI C;  5LL6 S;  1SBB B;  1LTR D;  2A1A A;  2HCC A;  3P20 A;  4OIJ A;  1J5E Q;  3D4W A;  1K83 B;  2UUC Q;  2QW7 A;  1ZXT A;  2HCI A;  3IL8 A;  3VR3 A;  2WAQ E;  4DUZ L;  4JI5 L;  1G91 A;  2PQE A;  3L3O C;  1G29 1;  2EJF C;  2WKC A;  4KKU A;  2CVR A;  5H1S E;  2VQE Q;  4WJ3 M;  4CJ1 B;  1HA5 A;  1V43 A;  1UAP A;  4HJ5 A;  1NTG A;  3DEP A;  1U4M A;  1IBK L;  3NP8 A;  3C2P A;  1O80 A;  2F0D A;  4DV0 Q;  4NW2 A;  3CQZ H;  1G8Z D;  1AE2 A;  2DGY A;  3EA6 A;  1I5F A;  5JPN C;  1JQY D;  1A6X A;  1I50 B;  5EPJ A;  2F0S A;  1UUP A;  1PTO D;  1ET6 A;  1NR2 A;  5M5W H;  1ASY A;  1JOR A;  1TU2 B;  3S2D H;  4DF7 A;  1M90 C;  5FLM G;  1CI3 M;  3KBG A;  1I6H H;  1BR9 A;  1WTR A;  4LNQ A;  5T1G A;  2B2T C;  4K6D A;  3S16 B;  1PRT D;  1D5M C;  1Y1W G;  3AB9 A;  1BCP D;  5FLX c;  4MTN A;  1Z47 A;  2EY6 A;  2VXW A;  4AIM A;  4A3G H;  4OWT B;  4GLX A;  3S15 H;  1F9P A;  1X56 A;  2JJQ A;  1TWH H;  1P8L A;  4ZYS A;  3K58 A;  2K5V A;  5ELF A;  1VQF A;  1HTP A;  1TWG B;  4P2C B;  1XPR A;  2HDM A;  5IP7 H;  2LFN A;  4N8F A;  4G4K A;  4ME3 A;  1EY7 A;  4HTH A;  5DM7 3;  3SHL A;  1A3V A;  4U67 3;  4A3M B;  3O13 A;  4C1N I;  5IGB A;  1JOO A;  1A3T A;  2YTX A;  4XQQ A;  2DUD A;  2K5H A;  1BO0 A;  4LF6 Q;  1PTO F;  3A7A B;  3Q6S A;  4CJ2 C;  1IYU A;  5IE8 A;  1H9S A;  4IAL A;  1A62 A;  3ONA B;  1A0I A;  3X3N A;  3S14 B;  3TQY A;  1U0L A;  2F0N A;  1I94 L;  1FNV A;  1PRT F;  1BCP F;  1MD2 D;  3OW2 A;  1PYW D;  4PV1 C;  1AP0 A;  3NHH A;  3HOU G;  3KLR A;  1PFN A;  4FNF A;  3A5U A;  2NVY B;  4CDC C;  4A3F G;  1X65 A;  1HNX L;  1IBL Q;  1AEX A;  2B2U C;  4C3I G;  4H44 C;  2B2Y A;  2PQA A;  4LFA L;  3NEN A;  4JI3 Q;  4RG1 A;  1EOV A;  1GO3 E;  3SK4 A;  1SNC A;  4NXN Q;  1WTO A;  4ZRZ A;  3HOU B;  2F0E A;  4BY1 G;  5KIX A;  3GTP B;  4HR7 B;  2Q2U A;  1YNN D;  4R4T A;  2HUG A;  4L6T B;  4JI2 Q;  1JJ2 A;  3S16 H;  3PIO 3;  2ZM6 Q;  1XTD A;  4K8J A;  4QUF A;  2JA9 A;  4UHV A;  4AYB E;  4BWG B;  3RN5 A;  3GO5 A;  3I70 A;  3GTL B;  1LM0 A;  1S5C D;  5FLM H;  3GTO B;  2HIV A;  3AMU A;  3S2H B;  5CYU A;  5CBA E;  1TWG H;  2N8N A;  1EZ6 A;  1QVG A;  4DV3 Q;  1W3S A;  1S5E D;  1S5B D;  4TQU S;  3CXC A;  4DGZ A;  3MVV A;  2CQO A;  2JEB I;  3DXJ C;  1Y1W H;  1B3A A;  5D3I B;  4OX9 Q;  2M2L A;  1Q86 C;  2UUB Q;  3D3R A;  1JB7 A;  1AFP A;  3RR5 A;  2DNC A;  1JT8 A;  1AE3 A;  1Z7T A;  4C3H G;  4HJ8 A;  1YI2 A;  4MZ9 A;  4GLA C;  4GNX A;  1VQ6 A;  1EIH A;  5JAV A;  2F0K A;  3CCU A;  2D5D A;  5JEA G;  4GKK L;  2RSN A;  3CU7 A;  1WTX A;  4DK3 C;  1VQ8 A;  1MSG A;  4Y52 H;  4IUR A;  1F2L A;  3OWE B;  3OMC A;  1Q1B A;  3OIP A;  2NVY H;  1EWH A;  4OEL B;  2G9H D;  2XGT A;  2HQE A;  3KF6 A;  5EBD A;  1LUZ A;  3UDF A;  4YHH Q;  3RZD H;  1HNW Q;  5C0X J;  1QIL A;  5CBE E;  4DPG A;  3BYT B;  3SVM A;  3U4Z A;  3A55 A;  1UEB A;  2NTS A;  4MTK A;  1XMO L;  1CFM A;  5IT9 c;  2E2I B;  2NVQ B;  1IBM Q;  1K28 A;  3HOU H;  2B29 A;  2UXD L;  1JJG A;  4PZ7 A;  5KRU A;  5CV9 A;  3RZO B;  4QIW B;  3S17 H;  2KQ3 A;  5EBC A;  5J1Z A;  4A3F H;  3PF4 A;  4K14 A;  1U4P A;  2EY2 A;  4GKJ L;  4POG A;  4I65 A;  5EJW A;  4C3I H;  3K0Y A;  3KF8 A;  3TP5 A;  1MBY A;  2N78 A;  3WDN A;  3U58 A;  4LF7 Q;  3OWF A;  1CSP A;  3DM3 A;  3GTO H;  3OMG A;  2XRS D;  5BR8 L;  3S2H H;  2WAQ B;  4IUU A;  1N34 Q;  1SAP A;  4BY1 H;  1JE4 A;  1DZ1 A;  3MXU A;  1DD2 A;  4A3E B;  3KLS X;  1QWY A; 
#chains in the Genus database with same CATH homology
 1E22 A;  4JYA L;  2I5M X;  1M1K C;  2IHF A;  1CKM A;  1PFS A;  5AJ3 Q;  1YNX A;  2KCM A;  3KDF B;  4YCU A;  4YWK A;  4JI1 L;  1G51 A;  3AFP A;  3AFQ A;  3MEF A;  5EAY A;  1XNR Q;  4B3T L;  1FJG Q;  1YHB A;  3AYH B;  3CW2 C;  3OTO Q;  3UDX A;  3U50 C;  5FJ8 H;  4DV2 Q;  1VQ9 A;  1YVC A;  1WJJ A;  4LF7 L;  2XTI A;  1IYJ B;  3T1Y Q;  2AMC B;  4MNO A;  4HJ7 A;  1VQN A;  4HJ9 A;  3CCL A;  3F1Z A;  3F2D A;  2PMZ E;  5LMU L;  2VY3 A;  4PZ6 A;  2GVB A;  3CMA A;  4LFB Q;  1I50 H;  1N34 L;  1HR0 Q;  1Y14 B;  4B3S Q;  2K52 A;  1YIT A;  2KBN A;  2Z6K A;  4JBW A;  4IO9 A;  5FLX c;  1VQB A;  3KJP A;  3CCE A;  4X66 L;  1Q82 C;  3E0E A;  4L5Q A;  3S24 A;  1N8R C;  4DV5 Q;  3PO3 G;  1N36 Q;  1FVI A;  1KRS A;  2Z0S A;  4DAM A;  1RL2 A;  1LYL A;  3PGZ A;  2MNA A;  1EFW A;  4LF4 Q;  2E5L Q;  5AJ3 L;  2Y0S G;  4P73 A;  1VQI A;  1SLJ A;  5J3B A;  2K4K A;  2R6G A;  2YYZ A;  3CP0 A;  1OTC A;  1K8G A;  1GD7 A;  4A93 G;  1XNR L;  4AQY Q;  1FJG L;  4JBM A;  3HOZ H;  5C4J H;  5HGQ A;  3OTO L;  4ALP A;  4DV2 L;  2Z6K C;  1VQO A;  4DR4 Q;  4FDB A;  3T1Y L;  2ZJR A;  1Z9F A;  1HJP A;  3VDY A;  3KDF A;  4C3H H;  2GVA A;  2NZH A;  3M3Y H;  3K0X A;  4GLV B;  2IT1 A;  2D62 A;  1YHA A;  4P71 A;  2NN6 I;  1C9O A;  4LFB L;  4DV4 Q;  5K36 G;  1HR0 L;  4B3S L;  2JA5 G;  5LMN Q;  1PH3 A;  5C3E H;  3G71 A;  2HT1 A;  5C44 H;  4A3K H;  2JA6 H;  4DV5 L;  1N36 L;  4LF4 L;  2RF4 A;  2E5L L;  3KFU A;  2CCZ A;  1I3Q H;  1EIF A;  1V9P A;  3ULJ A;  1XJV A;  4O2D A;  4AQY L;  4QIW E;  2WB1 G;  4A3D H;  3CME A;  1YHQ A;  4GN3 B;  2E8G A;  2WFW A;  4X65 Q;  1N33 Q;  3NEL A;  2EXD A;  4DR4 L;  3A5Z B;  2MO1 A;  4DR2 Q;  4A3M H;  2UU9 Q;  2UXB Q;  2H5X A;  4GOP B;  3L7Z C;  4DV4 L;  2Q2I A;  1NMG A;  3K7U C;  3I56 A;  5LMN L;  4BA1 I;  2VUM G;  3UE1 A;  5IYC G;  1K3R A;  1Y1V H;  3EBE A;  2A19 A;  1BBW A;  2Q2T A;  3GDE A;  1CUK A;  4A76 A;  4A3L G;  3CCJ A;  4DR5 Q;  5IP9 G;  3S14 H;  2K50 A;  3HFZ B;  3I4O A;  1XMO Q;  2MO0 A;  3UDG A;  2ZTD A;  1MKH A;  4XIG S;  4UP8 A;  4J15 A;  4P75 A;  5IYB G;  3GD7 A;  4X65 L;  1N33 L;  2PI2 A;  3K8A A;  4DR2 L;  2LSS A;  1C7Y A;  1FGU A;  2YTY A;  4DAY B;  2E2J H;  3HOW H;  1E3P A;  4QQB X;  4JOI A;  1NBW A;  2UXB L;  1E24 A;  2UXC Q;  1N32 Q;  3WWV A;  5GQO A;  4L5R C;  4QY7 A;  5C4X G;  5E7N A;  4JC0 A;  3STB D;  4DUY Q;  1A8V A;  4YY3 Q;  4A3C H;  4JG2 A;  3HOX G;  4LF9 Q;  4YWL A;  1O7I A;  4DR5 L;  2JK8 A;  2OTL A;  1WCM G;  4UPA A;  2R7F A;  1PVO A;  4JI0 Q;  2CWP A;  3BU2 A;  2WAQ G;  1GKH A;  4KLK A;  1UE5 A;  1PH6 A;  3GTP H;  4DV0 L;  4BXX G;  4R4I A;  4A3E G;  1X9N A;  2UXC L;  2KHJ A;  1JE5 A;  1OXT A;  2IHE A;  4A3J H;  4IOA A;  1N32 L;  4GOP C;  1X54 A;  3M4O H;  1H95 A;  4A3I G;  1HNZ Q;  3MXN B;  2EQS A;  2E2H H;  4B3T Q;  1VQA A;  2OTJ A;  4YY3 L;  4JI4 Q;  2B3G A;  2NN6 G;  1EUJ A;  3CCV A;  2F3I A;  1S3O A;  2CKZ B;  2VQF Q;  1VQG A;  2IY5 B;  3M9B A;  4LF9 L;  2R93 G;  2Y0S E;  2NVX H;  1E1T A;  3PO3 H;  3GTL H;  2PI2 E;  5GAG C;  5GAD C;  4YCW A;  4JCV E;  4X64 Q;  4JV5 Q;  3A0J A;  1YJ9 A;  4JI0 L;  4A93 H;  1XPU A;  1UWV A;  1YJW A;  4QJF A;  4R4O A;  3K81 C;  1PH4 A;  1YZ6 A;  4PG3 A;  2I0Q A;  5DLQ E;  4OXP A;  5JEA J;  1W2B A;  1VQC A;  5GAE C;  1CSQ A;  1PA6 A;  1HNZ L;  2K5N A;  4XTC S;  4JI4 L;  1HH2 P;  1MJC A;  4OWX B;  3RLO A;  1HR0 W;  1X3G A;  3D31 A;  5M3M G;  2JA5 H;  3H0G H;  2VQF L;  4X6A H;  1VQD A;  1OXS C;  1YBY A;  1OXV A;  1YIJ A;  4IFD J;  4UP9 A;  1Q81 C;  2JA7 G;  1IZ6 A;  1KAW A;  3J7Z C;  3PSI A;  2WB1 E;  4K0K Q;  4X64 L;  3A74 A;  1X3E A;  4JV5 L;  2L15 A;  4A3G G;  4IPH A;  2R7Z G;  2RHS B;  1V1Q A;  3IRB A;  2JEA I;  2GN5 A;  3J81 i;  1E1O A;  3J81 j;  1X55 A;  3E9I A;  4EX5 A;  1IXR A;  4JI6 Q;  1SRO A;  4BBS G;  4A3B G;  1Q8K A;  2QA4 A;  1EYG A;  2VL6 A;  5IP7 G;  2F4V Q;  3PO2 G;  1WOC A;  1VCI A;  1KXL A;  2N49 A;  2K75 A;  5LMN W;  3CC7 A;  2C35 B;  4IJL A;  2OWO A;  1PH1 A;  2VUM H;  1K0R A;  4LF8 L;  5IYC H;  3E9H A;  1BVS A;  2CFM A;  3L0O A;  5IYD G;  3F2B A;  3UE0 A;  4B3M Q;  3TRZ A;  4K0K L;  4A3L H;  3GTJ H;  4DNI A;  5IP9 H;  1IL2 A;  2YV5 A;  2HHH Q;  1VQK A;  2V1C C;  3EIV A;  4DUZ Q;  2UUA Q;  4JI5 Q;  4JI7 Q;  3TS0 A;  3GTM H;  5IYB H;  5M3F G;  1SFO H;  2E2I H;  3S1N H;  4JI6 L;  1WYD A;  1SRU A;  3L2P A;  2I5L X;  3Q8D A;  1B7Y B;  2NVQ H;  4IJH A;  4IPD A;  4KHZ A;  3PUZ A;  2F4V L;  5M5Y H;  1QZG A;  1KD1 C;  1WI5 A;  4DV1 Q;  5C4X H;  1B70 B;  3ER0 A;  4X62 Q;  2JA8 G;  2YTV A;  5JJL A;  1AH9 A;  3TS2 A;  3BZC A;  1IBK Q;  3RZO H;  3M4Q A;  1NJI C;  4OON A;  1LTL A;  3FP9 A;  4TVA B;  1VQ7 A;  2JE6 I;  2A1A A;  4BA2 I;  1UE6 A;  5C0X G;  3KOJ A;  3HOX H;  2B63 H;  3CPW A;  4B3M L;  4R4Q A;  1J5E Q;  4LF5 Q;  2UUC Q;  2HHH L;  1WCM H;  2ALY B;  2WAQ E;  4O0A A;  4LUV A;  3BZK A;  4DUZ L;  1PV4 A;  2UUA L;  4JI5 L;  4DV7 Q;  1L0W A;  4JI7 L;  1G29 1;  2VQE Q;  2ASB A;  4WJ3 M;  3W5O A;  1V43 A;  1KL9 A;  4DV6 Q;  4HJ5 A;  1VQ4 A;  1NTG A;  4BXX H;  1NY4 A;  1SE8 A;  4R4C A;  4DV1 L;  4A3E H;  1JMC A;  1VQL A;  4A75 A;  4X62 L;  4A3I H;  1TXY A;  1IBK L;  4A4I A;  3PUY A;  4EQ5 A;  3I4N G;  4R1J A;  2FXQ A;  2ID0 A;  3CF5 A;  4DV0 Q;  1UE7 A;  2BA0 A;  3CQZ H;  3CCR A;  2R93 H;  3CPF A;  1J5E L;  4LF5 L;  1AE2 A;  2UUC L;  2DGY A;  1XNQ Q;  1I5F A;  3H3V I;  1A63 A;  3RLF A;  1C0A A;  4DV7 L;  4UP7 A;  1VQE A;  2OQ0 A;  1T9H A;  1K9M C;  1L1O C;  2RCN A;  5M5W H;  1ASY A;  4UY8 C;  2VQE L;  3J81 c;  3S2D H;  4GOP A;  3JAM i;  4DR1 Q;  3ULL A;  5FLM G;  1M90 C;  4DV6 L;  1VQM A;  3LGJ A;  4AYB G;  2PNH A;  3KLW A;  4BY7 G;  1I6H H;  4HJA A;  4HID A;  2LXJ A;  1KQS A;  2AKW B;  4LNQ A;  1PYS B;  1PH8 A;  4LFC Q;  5M3M H;  2VZA A;  2BH8 A;  4LUO A;  1Y1W G;  2R7D A;  3CCS A;  1XNQ L;  2JA7 H;  3CC2 A;  1WFQ A;  2I5H A;  3PV0 A;  1CKO A;  4MTN A;  1Z47 A;  2KEN A;  3I7F A;  4RMF A;  2IX0 A;  1PH5 A;  4AIM A;  3S1R H;  3ICE A;  2KCT A;  4A3G H;  4OWT B;  5C0X I;  4GLX A;  3S15 H;  4KHP Q;  2R7Z H;  1X56 A;  3JC6 6;  2JJQ A;  1TWH H;  1P8L A;  4NPS A;  4DR1 L;  2K5V A;  1VQF A;  3TEH B;  1XPR A;  3PCO B;  1K73 C;  4BBS H;  4A3B H;  1E7Z A;  1VS0 A;  5IP7 H;  3PO2 H;  1YJN A;  5IWA Q;  1HZA A;  3PUX A;  4ME3 A;  4LFC L;  3STB C;  1KHI A;  1I94 Q;  2R92 G;  4C3J H;  1NMF A;  2AWN A;  3H3V H;  2D0O A;  2Q2H A;  1PH7 A;  3HKZ G;  3ERS X;  4KI0 A;  5IYD H;  2YTX A;  1KIX A;  1PYB A;  2DUD A;  2K5H A;  2PQA B;  4GN4 B;  3RNU A;  1EIY B;  3GTK H;  4LUZ A;  3FKI G;  4PMW A;  4KHP L;  3HOV G;  4LF6 Q;  1Q1E A;  4NB3 A;  3BJU A;  3ZJY C;  4OWW B;  3CC4 A;  4PZ8 A;  1HNX Q;  4LF8 Q;  5IE8 A;  3GTQ H;  2HQL A;  1QZH A;  3UDI A;  1A62 A;  2EIF A;  1G6P A;  5JJK A;  4QL5 A;  5M3F H;  2HIX A;  2MFI A;  1DGS A;  1A0I A;  3TQY A;  3PF5 A;  3G6E A;  2ES2 A;  3G48 A;  4BBR G;  1U0L A;  5IWA L;  3EN2 A;  4LWC A;  4APV A;  1I94 L;  2JA8 H;  2NVT H;  4IPG A;  1QUQ B;  2N3S A;  4POF A;  4IOC A;  2D0P A;  4QGU A;  4LW1 A;  2WP8 J;  3OW2 A;  3GTG H;  3HOU G;  1HZB A;  4DR3 Q;  1FL0 A;  1EQR A;  3A5U A;  3G4S A;  4LF6 L;  4AH6 A;  4A3J G;  2UXD Q;  4A3F G;  1X65 A;  1HNX L;  1IBL Q;  4IFD I;  2K14 A;  3HOY G;  1SMX A;  3D0F A;  1OXX K;  3NEM A;  3JAM c;  1VQP A;  2PQA A;  3KYH C;  1K8A C;  3F8T A;  4LFA L;  5JJI A;  3NEN A;  2NZO A;  1RIP A;  3W1G A;  4JI3 Q;  4RG1 A;  4NXM Q;  1EOV A;  1EWI A;  1GO3 E;  4NXN Q;  1MJE A;  1KRT A;  1L1O B;  2OQK A;  1Q7Y C;  2AWO A;  5M5X H;  4BY1 G;  1BBU A;  1YEZ A;  4YWM A;  3I4M G;  2Q2U A;  4R4T A;  1NE3 A;  3K80 C;  3I4N H;  4DR7 Q;  4DR3 L;  4DK6 C;  4IPC A;  4JI2 Q;  1JJ2 A;  3TRE A;  2VS1 A;  3S16 H;  2ZM6 Q;  1XTD A;  4HIK A;  3S1Q H;  4H02 A;  2MQH A;  1S72 A;  1IBL L;  4P72 A;  1B8A A;  4GNX B;  1QUQ A;  2CWA A;  5IY0 A;  3PUW A;  2JA9 A;  4AYB E;  5FJ8 G;  3I55 A;  3RN5 A;  3GO5 A;  2F52 A;  3H0G G;  3PIO A;  1LM0 A;  5FLM H;  4JI3 L;  4NXM L;  2HIV A;  3ULP A;  2VNU D;  4Y7N H;  1ASZ A;  4NXN L;  3OYY A;  1XMQ Q;  4BY7 H;  1QVC A;  2ATW A;  4HIO A;  1TWG H;  2N8N A;  3RN2 A;  1QVG A;  4DV3 Q;  1W3S A;  3CXC A;  2BA1 A;  4TQU S;  4DR7 L;  3J80 i;  4GN5 A;  2CQO A;  2JEB I;  3I2Z A;  1Y1W H;  4JI2 L;  1VQJ A;  3U4V A;  3KF6 B;  4OO1 G;  4GKK Q;  3T1H Q;  1GVP A;  1R9T H;  1PH9 A;  1L1O A;  3PUV A;  2ZM6 L;  1GM5 A;  4OX9 Q;  1D7Q A;  4HIM A;  5ELN A;  2BH2 A;  1D8L A;  3M4P A;  1Q86 C;  3HOZ G;  2UUB Q;  1JB7 A;  1JJC B;  3RR5 A;  1JT8 A;  1MIU A;  1AE3 A;  3H15 A;  2ZJQ A;  1N9W A;  4HJ8 A;  3RLN A;  5HY6 A;  1XMQ L;  1YI2 A;  1SN8 A;  1CKN B;  4MZ9 A;  4JI8 Q;  4GLA C;  3M85 A;  4GNX A;  3B6Y A;  3W1B A;  4DV3 L;  1VQ6 A;  5C3E G;  2YU9 H;  3CCU A;  3HKZ E;  1PHJ A;  2R92 H;  1BKB A;  5C44 G;  4A3K G;  1TWC H;  2JA6 G;  2KHI A;  4B3R Q;  1EQQ A;  2OCE A;  3AEV A;  5JEA G;  4GKK L;  3T1H L;  4WJ4 A;  3KF8 B;  4DK3 C;  2VW9 A;  1VQ8 A;  4OX9 L;  4Y52 H;  3FKI H;  4A3D G;  3PIP A;  1Q1B A;  4L5T A;  2ZJP A;  4GNX C;  2UUB L;  3HOV H;  2ZTE A;  4IFD G;  2NVY H;  4GKJ Q;  1OXU A;  1XPO A;  2XGT A;  2UU9 L;  3M7N A;  3KF6 A;  4A3M G;  4L5S A;  1LUZ A;  3CCM A;  3UDF A;  4YHH Q;  3RZD H;  3S1M H;  1HNW Q;  5C0X J;  2B63 G;  4DR6 Q;  4JI8 L;  4DPG A;  4BBR H;  3CCQ A;  4JOI C;  5ELO A;  3AQQ A;  3U4Z A;  4JBJ A;  1UEB A;  2QEX A;  2IX1 A;  5BR8 Q;  1XMO L;  5IT9 c;  1U5K A;  3K7A H;  4B3R L;  1Y1V G;  4GS3 A;  1TWA H;  3FHW A;  3NBH B;  1IBM Q;  2A8V A;  3HOU H;  1CKN A;  3KJO A;  4JYA Q;  1KC8 C;  2B29 A;  3SGI A;  1PH2 A;  1VQ5 A;  2UXD L;  4PZ7 A;  1JJG A;  1SR3 A;  3F2C A;  2JQO A;  4JI1 Q;  3S17 H;  4A3F H;  3PF4 A;  1VQH A;  4YCV A;  2ZTC A;  4DUY L;  3HOY H;  4GKJ L;  1P16 A;  4OO1 I;  4POG A;  2AHO B;  4C3I H;  4JBK A;  1HZ9 A;  1UE1 A;  1L2F A;  1QVF A;  3HOW G;  3J7A 5;  2LXK A;  4YHH L;  4DKA C;  1HNW L;  4DR6 L;  2N78 A;  1J6Q A;  3U58 A;  4LF7 Q;  1X6O A;  1CSP A;  3DM3 A;  3DLL A;  1K83 H;  2RHQ B;  1S40 A;  1HZC A;  3CAM A;  3HKS A;  4C2M H;  5BR8 L;  1X3F A;  5LMU Q;  3GTO H;  4A3C G;  3S2H H;  1N34 Q;  1Q46 A;  5GAH C;  4BY1 H;  3I4M H;  4LFA Q;  4P74 A;  3J80 c;  1Q12 A;  4X66 Q;  1TWF H;  2QGQ A;  1IBM L;  3CD6 A;  5H1S E;  5GRO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...