1Z9FA

Crystal structure of single stranded dna-binding protein (tm0604) from thermotoga maritima at 2.60 a resolution
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
109
structure length
89
Chain Sequence
HMSFFNKIILIGRLVRDPEERYTLTPVTTFTIAVDRTTDFFRIVTFGRLAEFARTYLTKGRLVLVEGEMRMRRKRVSPEVVANVVRFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Single-strand binding protein
publication title Crystal structure of a single-stranded DNA-binding protein (TM0604) from Thermotoga maritima at 2.60 A resolution.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 16
structure length 89
sequence length 109
ec nomenclature
pdb deposition date 2005-04-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1z9fA00
1VQJA 2JJQA 3CW2C 4KHPL 2UXDL 3S14H 5JEAG 3RLNA 3HOVG 2R92H 1K0RA 2XTIA 2VW9A 2VNUD 3AEVA 3HOYH 4A3LG 5FLXc 3CXCA 3VDYA 5GADC 4JI0Q 2OQKA 3TRZA 1JT8A 4JI4Q 1TWCH 4B3SL 2F3IA 4BA1I 3HKZE 4OWTB 4XTCS 1L1OA 4LFCL 5IYCG 5C3EH 1I6HH 3CD6A 1VQHA 4DR3L 4HJ8A 3D0FA 1EWIA 4DV7Q 2I5HA 1VQBA 3J81c 1Y1WG 2PQAA 3KYHC 3AQQA 1TWGH 2CKZB 1LTLA 3L2PA 2VUMH 3GTOH 4C2MH 3GTJH 2OWOA 3F2BA 5IYDG 1UE6A 1NY4A 1J5EL 1X56A 2KHIA 4JG2A 2UXCQ 4A3BH 4KLKA 3GTQH 4JCVE 2JA7H 2NVTH 4YY3Q 3CCLA 3TQYA 4IFDG 1XPUA 5M3MH 1OTCA 2PMZE 2UUAQ 4L5RC 3KDFA 3TEHB 2AMCB 3D31A 3UE1A 4UP9A 5FJ8G 2R93G 4LFBQ 4ALPA 5K36G 1BBUA 4A93H 4WJ4A 3PUVA 2ZTCA 1HNXL 4GKKQ 2JA6H 4LF5Q 2JA5G 3S1QH 5IP7H 3AYHB 4BBRG 3TS0A 4NXML 4A3FG 3PO2G 1SLJA 3J81j 3PUWA 4R1JA 5JEAJ 4R4TA 4NXNQ 2K52A 2JA8H 3S17H 5IYDH 1G6PA 4DKAC 2UUCL 4DV2L 3K0XA 4HJ7A 3ZJYC 1R9TH 3HFZB 3UDXA 3ULJA 5IT9c 4DR5L 3CCEA 2K14A 2A19A 2XGTA 3I56A 1XJVA 1Q7YC 3S1RH 4OXPA 2ATWA 2UUBQ 1HNZL 4L5SA 4JBWA 4GNXB 2ALYB 1N36L 4FDBA 2JK8A 1VQLA 4X64Q 1UEBA 1E24A 5EAYA 1EOVA 3I4OA 5ELOA 1S72A 4YWLA 4DR7Q 2Y0SG 3H0GH 1CUKA 1S40A 1I94Q 2NN6I 2QGQA 4UY8C 4DR4Q 4JI6Q 4DV6Q 4JI7Q 4B3SQ 3PO3G 1PH1A 4B3ML 5C0XG 1VQFA 2YTYA 3G6EA 4A3JG 1LUZA 1QUQB 4IFDJ 2C35B 1VQ7A 3KOJA 5IWAL 1K9MC 1FJGL 1N32Q 1X65A 1VS0A 2CWAA 5DLQE 1CKMA 3KF8B 3W1BA 1IYJB 1PA6A 1X3EA 5BR8L 3CCMA 4EQ5A 4B3RL 3UDFA 3CAMA 2UXDQ 4JBMA 1W3SA 3UDIA 1CKOA 3PF4A 4BY7G 4JI1L 4XIGS 1LM0A 4APVA 2DGYA 3A74A 1YBYA 5JJIA 4YHHL 1WI5A 4QL5A 4JI3L 4DV1L 1YZ6A 1A62A 2OTJA 1NBWA 4IJHA 4YWMA 4C3IH 2KBNA 2VZAA 5GAHC 4LFCQ 4JV5L 5LMNL 1KHIA 1CKNB 3RR5A 4GNXC 4DR3Q 1ASYA 3I55A 4AH6A 4Y52H 3HOVH 1S3OA 4TQUS 3T1HL 1UE5A 4A3LH 1IBLL 1BKBA 2ZJRA 2LXJA 2R6GA 1VQ9A 1IL2A 5C4JH 1OXVA 1J5EQ 1VQIA 1FGUA 1SN8A 1N34L 4PG3A 1FL0A 3GD7A 4H02A 5IYCH 3HOZH 5LMNW 5IYBH 3HOXG 3MEFA 3U50C 3G71A 1PH3A 1BVSA 1KD1C 3U4VA 4A3IG 2N78A 1OXSC 1Y1WH 2AWOA 4DAYB 1QZGA 1AE2A 4JOIC 4DR1L 1WFQA 1XNRL 2N3SA 1QVGA 2GVAA 4A3EG 4PZ8A 2F52A 3S2HH 1PYSB 2Z6KA 2KCMA 3J80c 1OXTA 1BBWA 2BA1A 4DK3C 3TREA 1HNXQ 3M3YH 3M4OH 4A3CH 1IBKL 3CPWA 4NXMQ 5M5XH 5LMUL 3CQZH 5JJKA 4R4CA 1VQEA 3HOUG 4PZ7A 2YYZA 4DAMA 1HH2P 3PIOA 1QVCA 1JMCA 3WWVA 4QY7A 2UUCQ 4DV2Q 2BH8A 5FJ8H 2MFIA 2R93H 4DUZL 1AE3A 4QIWE 4IPHA 1SFOH 1GD7A 2Z0SA 1X6OA 1GVPA 4DR5Q 2KHJA 3L7ZC 1VQNA 2JE6I 4AIMA 2JA5H 5IP9G 1VQGA 4BBRH 4GLVB 4DV4L 1HNZQ 3A5UA 4A3FH 3STBC 4DR2L 3EBEA 4DV3L 3PO2H 3LGJA 1N36Q 1HR0L 1SR3A 3CMAA 4EX5A 4BBSG 3DLLA 1E3PA 3MXNB 2D0PA 5M3FG 3H3VH 1WCMG 3PCOB 1KRTA 1D7QA 1O7IA 4HJ9A 2R7ZG 1HNWL 4IFDI 1GO3E 2VY3A 4KI0A 4B3MQ 1PH7A 1A0IA 1K73C 1XNQL 4IPGA 1HJPA 4C3HH 3M85A 4HIKA 1EIYB 1V9PA 1HR0W 3F1ZA 2B3GA 1Q1BA 2IHFA 3J81i 4OX9L 1YI2A 1FJGQ 2K5VA 1IZ6A 4OWXB 3CCRA 2CCZA 4R4IA 3G4SA 1DGSA 2VL6A 4P75A 1V43A 5BR8Q 1TWFH 2VS1A 2ZTEA 3KF6A 3UE0A 1Q12A 1A63A 3K80C 3H3VI 1KRSA 2WB1G 3PIPA 3F2CA 4A3JH 4JI2L 4JBKA 3S1MH 4JI7L 4YCVA 4YWKA 4JI1Q 1XMQL 1WYDA 2JEBI 4HIMA 2Q2IA 4DV0L 2OQ0A 2HQLA 1Y1VH 2D0OA 2Q2HA 1N33L 3FP9A 4YHHQ 4JI3Q 1M90C 1E1OA 4DV1Q 1LYLA 3CCUA 2F4VL 1VQDA 2RF4A 1C9OA 1A8VA 2DUDA 3HOWG 4JV5Q 5LMNQ 5JJLA 5FLMG 3H15A 1NMGA 2HIXA 1SRUA 3F8TA 1KL9A 2ZM6L 3J7A5 3T1YL 1P8LA 5GAEC 3FHWA 2BA0A 5C44G 1I5FA 3T1HQ 1G291 4IJLA 1ASZA 4BY7H 1IBLQ 2Q2TA 2E2IH 1C0AA 4GS3A 4Y7NH 4WJ3M 3DM3A 1NJIC 4TVAB 1U0LA 5C0XI 3CCQA 3U58A 1N34Q 4LUVA 2IY5B 2K75A 1HZAA 4LF7L 1HZCA 3KFUA 4GN4B 4YCUA 5M5YH 4OWWB 2R7FA 3RZOH 3K81C 3I4MG 1JE5A 1UE7A 2B63G 2GN5A 4GLXA 2MQHA 4A3BG 1XNRQ 4DR1Q 1VQAA 2K5NA 1P16A 2UU9L 4LUZA 4AYBG 2JA7G 4K0KL 4LF9L 4X65L 2IHEA 1OXUA 4BY1H 5J3BA 4X62Q 1M1KC 2K50A 1IBKQ 1E1TA 5LMUQ 3PGZA 4GLAC 3PUYA 4A4IA 4LF6L 4KHPQ 1B70B 2CWPA 2WP8J 2YU9H 3HOXH 2I5MX 3BZKA 1L1OB 1Q1EA 4BXXH 4A3IH 1Q86C 1XPOA 4X6AH 2NZOA 4QJFA 4A3GH 4LW1A 3CP0A 1EQRA 1HZ9A 3FKIG 2WAQG 4NB3A 4DUZQ 2A1AA 4A75A 4A3EH 4LF8L 2A8VA 3GTGH 3S15H 1K3RA 1JJ2A 2PQAB 4LF4L 2JA8G 1KXLA 2ES2A 2PI2A 5HGQA 4POGA 3PV0A 4A3DH 4DV4Q 2LXKA 1OXXK 3CCSA 4DV3Q 4DR2Q 4DR6L 1MIUA 1HR0Q 3HOUH 1NMFA 2NVYH 4JI8L 2I5LX 4P74A 4AQYL 1X9NA 3TS2A 3HKZG 2UXBL 1EFWA 4PMWA 2K5HA 1QZHA 3ULLA 4X66L 1VQOA 1XMOL 1PH9A 1HNWQ 2K4KA 1YHBA 3KDFB 1YJNA 4LNQA 5C4XG 1PH4A 2E2HH 2ZJQA 2HIVA 2KENA 3A0JA 1XNQQ 2VQEL 5IP9H 2ZJPA 2B29A 3H0GG 2HHHL 2OCEA 5C0XJ 2N8NA 1KAWA 1CSPA 1JB7A 3PUZA 1YVCA 4BBSH 1N9WA 5M3FH 4IOCA 1WCMH 2Y0SE 4A3MG 4OO1G 5GAGC 4DK6C 1WOCA 1YHQA 4UP8A 3S1NH 1YEZA 2R7ZH 1MKHA 2JA9A 2R7DA 4HIDA 4UPAA 5E7NA 4C3JH 3RLFA 1SROA 1X3GA 2VQFL 4JI2Q 1L1OC 4GNXA 4DNIA 1XMQQ 3IRBA 3EN2A 4DV0Q 1W2BA 4JI6L 4JI5L 2EQSA 3I4NG 1N33Q 1Q46A 1YHAA 2YTXA 3OW2A 1PVOA 1G51A 1T9HA 1VQCA 3J80i 1GM5A 2F4VQ 3OTOL 1VQ6A 3GTLH 1UE1A 2QEXA 4IOAA 4JYAL 1I50H 3BZCA 3PUXA 1N8RC 3EIVA 3T1YQ 3CPFA 2PI2E 3Q8DA 3JAMc 3GTMH 1V1QA 4DV5L 4GKJL 1PH6A 1IBML 1JJCB 3RN2A 4JOIA 1XPRA 3NELA 1Q82C 2H5XA 3GTKH 1Y14B 4QGUA 3OYYA 2E5LL 2YTVA 3E9HA 4O2DA 4GOPA 1NE3A 1B8AA 3M9BA 4LF7Q 4LFAL 3HOWH 1WJJA 2FXQA 5FLMH 4ME3A 2E8GA 5AJ3L 5IWAQ 3JAMi 2EXDA 5C44H 3HOZG 2UU9Q 1J6QA 1IXRA 4L5QA 4JBJA 5IYBG 4LF9Q 4X65Q 4K0KQ 4DUYL 3UDGA 1VCIA 1VQ5A 3KJOA 1D8LA 4B3RQ 4B3TL 4YCWA 3PO3H 1E22A 4LF6Q 3GO5A 1CKNA 4A3KG 5IE8A 1VQMA 2CQOA 1KQSA 4A3CG 3RN5A 2YV5A 1EUJA 2B63H 3K7AH 3RNUA 1I3QH 5HY6A 4LF8Q 3NENA 2NVQH 3BJUA 3SGIA 2LSSA 4LF4Q 4PZ6A 1PYBA 2R92G 3HOYG 1YIJA 1K83H 1Q8KA 4IPCA 4P71A 2HT1A 3HKSA 1EIFA 4DR6Q 1AH9A 2V1CC 2IX1A 1PH2A 4JI8Q 3ERSX 4AQYQ 1SMXA 4HJ5A 3S16H 2UXBQ 3AFQA 5C3EG 3E0EA 3JC66 1YNXA 2IX0A 3FKIH 4X66Q 1XMOQ 1L0WA 1B7YB 3CCVA 3U4ZA 1PV4A 2JEAI 2VUMG 2RCNA 2VQEQ 2HHHQ 4JI0L 3S24A 1TWHH 4JI4L 1RIPA 2MNAA 2BH2A 2QA4A 3L0OA 2ZTDA 1YJWA 3I7FA 4NPSA 2Q2UA 3W1GA 1E7ZA 5M3MG 1VQ8A 2I0QA 4MZ9A 4DV7L 3M4PA 5C4XH 3S2DH 4UP7A 1PFSA 1K8GA 2VQFQ 1RL2A 1PH8A 2JQOA 1VQKA 2GVBA 2WFWA 2OTLA 3GTPH 4GN3B 1YJ9A 4A93G 2D62A 3STBD 1KIXA 2JA6G 1TWAH 1X54A 1XTDA 2AKWB 5IP7G 3CCJA 4JI5Q 2ASBA 3F2DA 2UXCL 4MTNA 4A3MH 1X3FA 3KJPA 2NN6G 4OONA 4YY3L 4JC0A 1KC8C 3OTOQ 4IPDA 1Z9FA 5IY0A 2UUAL 4JYAQ 3M7NA 4QQBX 2MO1A 1HZBA 1Y1VG 3ER0A 4BA2I 2WB1E 4P72A 2NZHA 4LFBL 2RHSB 5ELNA 3CC7A 1NTGA 4DV5Q 4GOPB 4GKKL 1Z47A 3ULPA 3KLWA 4LF5L 4GKJQ 1MJEA 1IBMQ 4HJAA 1CSQA 3I4NH 3AFPA 3CF5A 1U5KA 2E2JH 2L15A 1X55A 1PHJA 3CMEA 2E5LQ 2PNHA 4NXNL 4POFA 1JJGA 3NBHB 4LFAQ 4DPGA 2Z6KC 1QVFA 5H1SE 4GN5A 2MO0A 3BU2A 4OO1I 3G48A 1VQPA 2AHOB 5AJ3Q 4IO9A 1EYGA 3KF6B 3NEMA 4OX9Q 4O0AA 3E9IA 1EQQA 2UUBL 4DUYQ 1Q81C 4B3TQ 1UWVA 4X64L 3I4MH 5GQOA 3CC2A 3I2ZA 3A5ZB 3RLOA 2EIFA 4A76A 4BY1G 4DR7L 3PF5A 2NVXH 3ICEA 3PSIA 3RZDH 1I94L 4DR4L 1GKHA 3K7UC 4DV6L 1MJCA 1FVIA 1L2FA 4P73A 4R4OA 4AYBE 2KCTA 1SE8A 3K8AA 4MNOA 2CFMA 5M5WH 2AWNA 1C7YA 3J7ZC 2IT1A 1PH5A 1VQ4A 3GDEA 4RMFA 3W5OA 4BXXG 3M4QA 1K8AC 4A3GG 4J15A 4HIOA 1YITA 4R4QA 4LUOA 5GROA 1TXYA 2ZM6Q 1H95A 4A3KH 4GOPC 1N32L 1QUQA 3B6YA 4LWCA 4X62L 4KHZA 4L5TA 2N49A 2RHQB 4A3DG 2ID0A 3CC4A 2WAQE 4RG1A
chains in the Genus database with same CATH superfamily
1PTOD 2JJQA 3Q6SA 3S14H 2E74C 3I70A 5CYUA 1K0RA 1MHWC 2B2TA 3E3XA 1ESRA 3L9AX 4QUFA 4JI4Q 4A3JB 1WTHA 3FRPB 4XTCS 4KKUA 2CVRA 1K8MA 4HJ8A 2HUGA 3KYHC 3AQQA 1TWGH 2CKZB 4N9TA 2PCFB 2OWOA 5IYDG 1JQYD 1UE6A 4QB4A 1NY4A 1FNVA 4A3BH 4JCVE 4Y7NB 4IFDG 2F0DA 5M3MH 1HTLD 5ELDA 2AMCB 1O7YA 2K03A 3TP6A 1L0XB 5FJ8G 2R93G 1EEFD 5CORA 5FKAC 3DWPA 1BBUA 4A93H 4LF5Q 3F2UA 5IP7H 3AYHB 4IUUA 3TS0A 3J81j 3PUWA 3A56A 4R4TA 4NXNQ 2FHTA 3J80E 4DKAC 2UUCL 4DV2L 4HJ7A 2YU9B 1BBXC 3ULJA 1D5XC 2K14A 2XGTA 1XJVA 1Q7YC 1DXMA 1HNZL 4L5SA 4GNXB 3GTGB 2JK8A 1M8AA 1UEBA 3K5OA 3A54A 4O42A 4KV6A 1EY9A 4YWLA 4DR7Q 2Y0SG 2PW7A 1TY0A 4KY5A 2NN6I 2NVYB 4UY8C 1QB5D 2ICIA 1PH1A 2YTYA 3G6EA 1QUQB 4DK0A 2QCPX 5HURA 2QDBA 1R4QB 1TQOA 4CKCA 1X3QA 3BYTB 2ICEC 1CKMA 1A3TA 5BR8L 1LTID 3UDFA 4IUPA 2UXDQ 3S1NB 3PF4A 2R7ZB 1PLFA 3UI2A 1LM0A 2DGYA 1I4PA 2I07B 3QR8A 2F0SA 4C3IH 4ZK9B 4OGQC 1CKNB 4RFBA 4AH6A 5JEAH 1S3OA 1UE5A 1G2TA 2ZJRA 1VQ9A 3GTMB 3I8ZA 1J5EQ 1VQIA 1N34L 2B2UA 1FL0A 4Z9CB 3MEFA 3U50C 4FXDA 2NWGA 2AWOA 2X6LA 3S2HH 3J80c 2IWHA 1HNXQ 2EOTA 2B39A 3W2DA 3OMCA 5CR3A 4PZ7A 3A8JE 2D5DA 1QVCA 1JMCA 3PO3B 3MC0B 2RBMA 4DUZL 4QIWE 1SNMA 1SFOH 2NBFA 3CKIB 2DY8A 1VQGA 4IQZA 1EYAA 2F0TA 1N36Q 1CA5A 4EX5A 3DLLA 1Y8NB 3MXNB 4C56C 3NP8A 5FO9B 4HJ9A 1LTAD 4K8IA 2VY3A 5J1ZA 4KI0A 3X3NA 3NPPA 1PH7A 1EOTA 2E2IB 3FKIB 3J7AF 4HIKA 3F1ZA 5HGTA 2OEOA 1TWHB 3D4RA 3QIAA 3G4SA 1BO0A 1DONA 4ZUJA 3H3VI 1KRSA 1LTRD 2WB1G 3SE0A 3PIPA 4JBKA 4JI1Q 3H09A 1HRJA 3S2DB 4BWGB 2OQ0A 1Y1VH 1T5XD 1ET6A 1F2ZA 3C1EA 4YHHQ 1I4HA 3GTPB 4DV1Q 3CCUA 1VQDA 3HOWG 1STYA 2EY6A 4JV5Q 1NMGA 2HIXA 1SRUA 5F2DA 1KL9A 2ZM6L 2IJ0A 1P8LA 3T1YL 2EY5A 3FHWA 4DNTB 3T1HQ 1I5FA 4BY7H 1XXGA 4UAIA 2E2IH 1C0AA 4GS3A 4WJ3M 3DM3A 1NJIC 1WD0A 3U58A 4FVMA 3CCQA 1EYCA 2K75A 3NSWA 3J81L 5G3LD 4PMCA 1F9SA 1KAAA 4GLXA 3K57A 1PTOC 1STHA 4DR1Q 3MFGA 2KHSA 4X62Q 4ABNA 1IL8A 1IBKQ 5LMUQ 2EYOA 4GLAC 1B70B 2CWPA 2I5MX 3BZKA 4X6AH 3DHQA 4NW2A 4A3IH 1Q86C 1XPOA 2B2YC 2NZOA 1K0SA 4A3GH 1EQRA 2WAQG 2DJFC 2MUYA 2K7VA 1KXLA 2PQAB 2VB3X 2ES2A 2Q8TA 2Z4IA 1KLUD 4A3DH 4CDDC 1OXXK 4DV3Q 1MIUA 3VA7A 1NMFA 3HOUH 2I5LX 1EFWA 2OXPA 3BG3A 4X66L 1PH9A 2K4KA 4HTHA 1YJNA 5C4XG 4KN4C 1PH4A 2ZJQA 2KENA 2VQEL 2LY7A 2MHVA 5C0XJ 1KAWA 1CSPA 1JB7A 4DNRB 1GOZA 5I6WA 4BBSH 1IKMA 4XT3B 4IOCA 1WCMH 1WOCA 1TWCB 4WRDA 2PNRC 2JA9A 1SBBB 5C3EB 4HIDA 5D14A 2VQFL 1L1OC 1XMQQ 5JPNC 5EKIA 2VUMB 4C2MB 3GTJB 1Q46A 2FJ2A 1PVOA 3GTLH 1GM5A 1JWMD 4LMQD 4CDEC 1VQ6A 4FYDA 1UE1A 1N8RC 1SYGA 3CU7A 1WTRA 2X69A 4HR7B 5BN5A 1ICWA 2L12A 1E2WA 4JW0A 1V1QA 4EVOA 3VYSA 1IBML 1JJCB 1G6ZA 1NNXA 1Q82C 1D6EC 1DCZA 4QGUA 3KF8A 3I4MG 2YTVA 5KRUA 1NE3A 3M9BA 1WJJA 2JA8B 3JAMi 3BVZA 3S17B 4K0KQ 2UU9Q 4LF9Q 4X65Q 3UDGA 1VCIA 3DEPA 1X32A 4QIWB 1VQ5A 1LT6D 1Q90A 3S1RB 5I6YA 1I4RA 1U4MA 5C6AA 1VQMA 1F2MA 4Q0FA 1DOKA 3K7AH 3J7YW 4ZKCB 3RNUA 3FVQA 3BJUA 3H0GB 2KQ3A 2SEBD 3M7GA 1K83H 1Q8KA 3I73A 4P71A 2HT1A 1STNA 1RKNA 2V1CC 5DAUA 1SMXA 1T5EA 2PMZB 1FD7D 1WD1A 2K5DA 3AFQA 2UXBQ 1DD2A 1YNXA 2H1EA 2RA4A 1L0WA 1SE4A 2NUCA 5J39A 1PV4A 3E0JA 3EJIA 4O1NA 2F0JA 3K5NA 1PTOH 4CJ1B 1E2ZA 4JI4L 1H9RA 2MNAA 2QA4A 3D4WA 4F7XA 3I7FA 4NPSA 3ND9A 5M3MG 2I0QA 4ME5A 4MZ9A 1Z6HA 1H9SB 1PMRA 1XWEA 1PFSA 3MXPA 4UP7A 1K8GA 1SNPA 4A93G 5I2YA 4F8MA 5KNBA 3STBD 1LTBD 5LL6X 3OW7A 4PMBA 4BS9A 5IP7G 3J81E 4A3MH 1KC8C 3RZDB 5IY0A 4DA2A 4HMIA 3AB9A 4RGMA 3ER0A 4BA2I 5M5WB 4P72A 2NZHA 5K5PA 1H9JA 4GOPB 1Y1WB 1IHZA 3KLWA 4LF5L 1SYDA 1XYIA 5FO7B 3D6WA 2E2JH 2L15A 1X55A 2E5LQ 4NXNL 4POFA 3NBHB 2J0TD 1Y8OB 4OO1I 3G48A 3HG9A 1H9KA 3NEMA 4O0AA 2MP1A 2EXZA 2LS01 3FMCA 1D1IA 4N9PA 2JA5B 2LMCB 1D5MC 3CC2A 4BBRB 3A5ZB 3RLOA 2EIFA 1HFGA 4DR7L 3PF5A 2NVXH 4KD3A 3RZDH 4B9WA 5C4ZA 4AYBE 4G7HC 1KABA 5M5WH 2AWNA 1ZEQX 2K5QA 3SHLA 3MTSA 2P5ZX 1VQ4A 4BXXG 1QE6A 1X3PA 4LUOA 2ZM6Q 4C3HB 1EWHA 5CBAE 4ID6A 3VYTA 4C3IG 2ID0A 3R2IA 4RG1A 3K5LA 3CW2C 2UXDL 5JEAG 2XRSD 1SXTA 2R92H 2XTIA 1TWFB 4B08A 2RDHA 5GADC 4FXKC 4JI0Q 3TRZA 1JT8A 1RJTA 3HKZE 3L3OC 1L1OA 2EPBA 1I6HH 1VQHA 1EWIA 4DV7Q 2I5HA 3J81c 3FDTA 4L6TB 3GTOH 5T1IA 4ZCKA 1SE3A 2KA7A 1J5EL 1X56A 1FNWA 2A5HA 4I7ZC 4JG2A 4KLKA 1DZ1A 2NVTH 1CM9A 1MSHA 3CCLA 1CFMA 1XPUA 2UUAQ 3TEHB 3T16A 2O4XA 2PO4A 3V05A 4LFBQ 5K36G 3PUVA 4EGVA 1HNXL 3QJYA 3CRKC 3NK9A 1SLJA 2F0LA 5FK9C 4TRDA 3K59A 3SDZA 5COYA 3K0XA 3HFZB 3UDXA 3NTHA 4HN7A 5JJLA 3I56A 1AZPA 4A3EB 1PFNA 2ALYB 1N36L 1D1KA 4DAVA 4KKSA 1E24A 3NUCA 1EOVA 5ELOA 1S72A 2HQEA 4K6DA 3MFYA 1CUKA 1I94Q 4DV6Q 1Z7TA 2H4OA 2EZVA 3PO3G 3FEWX 4U68A 5C0XG 4E6IA 1LUZA 1F2LA 3MA2B 1SDFA 2KJXA 1VQ7A 5I9PA 3VYUA 5CMDA 2EY1A 4RHSA 1BNZA 1UUPA 5DLQE 3W1BA 2CHBD 3LWUA 2PZTA 3CCMA 4B3RL 5M3FB 3CAMA 4IN3A 1SJED 3PMFA 3UDIA 1CKOA 4BY7G 3P75A 4JI1L 4XIGS 4C3JB 3CQZB 4YHHL 2G9DA 1GUGA 5ELFA 1WI5A 4DV1L 1A62A 2OTJA 4LFCQ 3G6JB 1UNSA 1V1PB 4DN4M 4GNXC 4DR3Q 4JV5L 1MI2A 3I55A 4Y52H 3HOVH 1U4PA 3T1HL 1I50B 1BKBA 1UEAB 3TN2A 4A3FB 2LXJA 1FGUA 1SN8A 1QILA 1ENAA 3GD7A 2RSOA 4X3TA 4FF3A 3U4VA 4A3IG 3U9SA 4DAYB 1QZGA 4DR1L 3ZYYX 2F52A 1QG7A 2G9HD 1GHKA 1PYSB 1STAA 2KCMA 2BA1A 4HSVA 3I3CA 1WVLA 3M3YH 1BQQT 3M4OH 1IBKL 3DWAA 5LMUL 1CQFA 1DJRD 1MBYA 3ND8A 1F2YA 3CQZH 5JJKA 2B2VC 3HOUG 2EYMA 2LFNA 3RMHA 1ET9A 2E75C 3WWVA 3PQIA 2MFIA 4RA8A 2TMPA 1GD7A 2Z0SA 2B63B 1X6OA 4ZQ3A 2KHJA 3L7ZC 4AYBB 2F0NA 4CDCC 4A3FH 3STBC 4DV3L 3PO2H 3LGJA 4MTKA 1EZ8A 3RD4A 4BBSG 1MD2D 1WCMG 2RDGA 1PZJD 4IFDI 3S16B 1GO3E 3M4YA 4B3MQ 2RVLA 5G3LF 1K73C 4TSSA 4C1NK 4KMUC 1EY5A 2B3GA 1Q1BA 1LT4D 5ELCA 1FJGQ 3KLSX 1AFPA 4OWXB 2ZXRA 1DGSA 3VR6A 2Z9HA 3KF6A 4A3JH 2FMCA 4ZAIA 4YCVA 1XMQL 3Q24A 3N6RA 2JEBI 1HQMC 4M8AA 1HXYD 4CKBA 3QB3A 4HAEA 3HOXB 4JI3Q 1E1OA 2RF4A 1C9OA 1A8VA 1BR9A 1LACA 2G5DA 3H15A 5FLXL 3J7A5 3KUPA 2Z4HA 1ASZA 2BE5D 1IBLQ 1VF5C 2Q2TA 1QJOA 4Y7NH 4TVAB 1CT1D 2IY5B 1SYBA 1HZAA 1HZCA 2IX3A 4YCUA 4OWWB 3I4NB 4ZKBB 2R7FA 3K81C 1JE5A 3DXJC 2L9HA 2GN5A 3TBIB 4X3KA 4K5WA 4R8NA 1VQAA 4K0KL 5TSSA 2UU9L 4LUZA 4ILWA 4LF9L 4X65L 2IHEA 1OXUA 1M1KC 2M9VA 2N55A 1E1TA 1LABA 2F0GA 3PUYA 2L1BA 3EVQA 4RGTA 2WP8J 1TS2A 2YU9H 3HOXH 4FO2A 1EFID 1Q1EA 1PYWD 4BXXH 1KLGD 2J4XA 4LW1A 3QOLA 1HZ9A 5C5MA 5IGBA 4A75A 2A1AA 2A8VA 5I4DA 3SK8A 3GTGH 4KJNA 2JA8G 5EKKA 2PI2A 5ELBA 1EY0A 4POGA 4DV4Q 2QW7A 2NYZD 3CCSA 4DR2Q 2J7ZA 1HR0Q 1B50A 2NVYH 1X9NA 2UXBL 3IL8A 5IT9L 2QILA 1WTOA 1BCPF 4A3KB 3KDFB 1YHBA 4LJZC 2F0UA 1XNQQ 5IP9H 3H0GG 3URYA 5KYLA 4OEMB 3PUZA 1YVCA 4RCOA 1EU4A 4A3MG 2Y0SE 3S1NH 4U673 4HSPA 2R7ZH 1EY7A 5C44B 2Z8LA 1EWCA 1SROA 3NHHA 4GNXA 4HCEA 4DV0Q 1G91A 2L4NA 2EQSA 1EQVA 1V1OA 1N33Q 5E4WC 4ZYSA 1YHAA 5K36H 2F4VQ 2RSNA 4IOAA 3GTQB 2FINB 3PUXA 2JA7B 4KJOA 2NVQB 3MZ5A 3GTMH 1U4RA 1PRTF 5CV4A 4FXGC 3HEJA 3NTKA 2E5LL 5L37A 2JA6B 3RUZA 4O2DA 4ZRZA 1B8AA 3Q0AA 1TS3A 2Z6BA 4ME3A 1C48A 2E8GA 2MGSA 4H13C 2OT2A 5C44H 4L5QA 4JBJA 5IYBG 5D3IB 1NSNS 1R9TB 3CRLC 3KJOA 4B3RQ 2AQ3B 4YCWA 3PO3H 3GO5A 2C9OA 1CKNA 5C0XH 4IUQA 5IE8A 3ERQA 4A3CG 2WKDA 2YV5A 1EUJA 1STBA 4K6LA 4LK1C 4IUTA 2QF7A 2NVQH 1ILPA 1AN8A 3D4DA 4PZ6A 2R92G 4IPCA 3C2PA 1EIFA 1SNCA 4HJ5A 2IX0A 2DN8A 5FO8B 4JPBW 3FKIH 1HQRD 3NE5B 4NMZA 3R8BA 3EFXD 5E3FA 3JAML 2EJGC 4JI0L 4H0LC 1TWHH 5CV5A 3DM1A 5EBDA 4C1NI 2SDFA 2XRQD 5ISRA 2ZTDA 3W1GA 5FLXE 1VQ8A 4DV7L 3ONAB 3S2DH 2XN9C 2JQOA 2WFWA 2OF1A 3TP8A 3GTPH 3NWSA 2D62A 4ODGA 1XTDA 2AKWB 3MXNA 4IURA 2ZXOA 2FMMA 1X3FA 5C4JB 3I72A 4IPDA 1Z9FA 2UUAL 1EYDA 5IGFA 4JYAQ 3HOZB 2O5IC 2WB1E 4LFBL 2RHSB 3Q22A 3CC7A 1KDCA 1NTGA 4DV5Q 3HP3A 1MJEA 3AFPA 2DNCA 5C4HA 3NWTA 1STGA 1PHJA 2F3VA 2PNHA 5M5XB 4DPGA 1PXUA 2AQ1B 1LO5D 5H1SE 1QOHA 1VQPA 1FYCA 3GQBA 1JCKB 5KIXA 1RDPD 2GA4B 3E9IA 4RWSC 1EQQA 2R93B 4M1UB 2F1MA 4B3TQ 3SVMA 3EA6A 5IT9E 4DXGA 2F0HA 1EL0A 3PSIA 1I94L 5LL6S 1GKHA 4DV6L 1FVIA 4P73A 1IYUA 2CFMA 2BE5C 5DEHA 1J9OA 1PH5A 3GDEA 2CH4A 2WV6D 1K8AC 3OWFA 5JPMC 1TXYA 2EDGA 4GOPC 1PZKD 3B6YA 1CI3M 1DOMA 3QO2A 1FR3A 2WAQE 1ICFB 1VQJA 2Y0SB 2EVBA 4MN3A 3RLNA 3HOVG 1C4QA 3AEVA 5FLXc 3CXCA 2PW5A 3KBGA 2L0CA 3S1MB 1TWCH 1V8QA 3NQTA 4BA1I 4LFCL 2BDNA 5C3EH 2K32A 4N8X1 3CD6A 4H44C 4DR3L 1SEBD 1SNDA 5D3DA 3AU7A 1VQBA 2PQAA 3MVVA 1HFNA 2VUMH 4C2MH 1DM0B 1S5ED 3C1FA 3GTJH 3F2BA 1EZ6A 1TR5A 1HPCA 3QWNA 3WOFA 3H3VC 4C3JG 4K14A 2HD3A 3I4LA 4YY3Q 1TT2A 1OTCA 4S3SA 5EGTA 1XTCD 4L5RC 2EJFC 3MXUA 3Q23A 1TY2A 5ELEA 3D31A 3UE1A 5M5YB 4RGOS 3RZOB 1WTWA 4ALPA 5IGGA 1TKWB 1EY8A 5IGCA 1KNAA 2A69D 2EYFA 4A3FG 3PO2G 4BY1B 2NN6H 3SK5A 4R1JA 2JA8H 2K52A 3SXHA 3S17H 4PV1C 5JAVA 1G6PA 1BDOA 5BN3A 5IT9c 3CCEA 3D3RA 1UAPA 3S1RH 1RF2D 3I91A 2ATWA 4ULLA 1KTKA 3S15B 4FDBA 3AMUA 4X64Q 1D2BA 1WTPA 3OIQA 5EAYA 2K05A 3H0GH 1RTNA 1S40A 5CV8A 4DR4Q 1CA6A 4B3SQ 3JAME 4B3ML 1IKLA 1VQFA 4A3JG 1S4ZA 3DMUA 1EIHA 4IFDJ 2I46A 1K9MC 3QOJA 1EU3A 1STEA 4OHJA 1FJGL 5CBEE 1N32Q 1VF7A 3A7AB 1VS0A 1IYJB 4EQ5A 1PTOF 1W3SA 5M9OA 4RKBA 3T56B 3TDQA 2JXMB 4APVA 1QNKA 2Q8RE 4JI3L 4DF7A 1YZ6A 4IJHA 4YWMA 5GAHC 2KBNA 1ASYA 3TSSA 2B2YA 3SK6A 4J8QA 2CQAA 4A3LH 1IBLL 5C3XA 2E2DC 1K3BC 1U4LA 1BOSA 2R6GA 2WB1B 1IL2A 1OXVA 4PG3A 2V4DA 5IYCH 5IYBH 3HOXG 5KNCA 1PH3A 2F0MA 3GTKB 3KLRA 1BVSA 1KD1C 2N78A 1Y1WH 2O5JC 3HOWB 1AE2A 2N88A 4JOIC 2N3SA 5DM73 4PZ8A 3WDNA 1LV9A 1OXTA 1JE4A 4A3CH 3TREA 3CPWA 5IOCA 4NXMQ 4R4CA 1VQEA 1TS4A 1H9SA 3PIOA 4QY7A 4K8JA 4OL7A 1BF4A 2BH8A 1AE3A 2KEEA 4IPHA 4DR5Q 1GXDC 1O78A 2JE6I 1I3QB 3VA5A 2JA5H 2F0IA 4YIJA 1YNJD 3E6ZX 4BBRH 5IP9G 3A5UA 4DV4L 4DR2L 2A68D 2SOBA 1JOOA 1Q3LA 1HR0L 3CMAA 3LNNA 2D0PA 3H3VH 1O7IA 2R7ZG 3P1HA 1XNQL 3A8IE 4IPGA 2WAQB 3GP7A 5E1FA 4C3HH 3OWEB 1HR0W 4OX9L 4XT1B 3NBHA 1YI2A 2F0KA 3IAYA 2K5VA 3TP7A 2CCZA 4R4IA 3OMGA 5IIFA 2HCIA 3R2TA 1TWFH 1A63A 3UE0A 1Q12A 1A2TA 3K80C 5JOBA 1W6JA 4YWKA 5C4XB 1KNEA 4DV0L 5KGUA 2Q2HA 3LX0A 3FP9A 2F0PA 1N33L 4F88A 1M90C 2ZT9C 1LYLA 2A6ED 2F4VL 1TWAB 2DNEA 2SNSA 5LMNQ 1ONLA 3F8TA 5GAEC 4KN7C 5C44G 1G291 4IJLA 3K58A 4DXFA 1GUOA 5EQ0A 3NTIA 5C0XI 1Y69U 3A8KE 4LUVA 3OHXC 4GN4B 2BDOA 1GUWA 2MQHA 2E2HB 4KD4A 1XNRQ 1P16A 3TMEA 1E2VA 2JA7G 3BDCA 4KHVA 1GUSA 4R9WA 4V0BA 2L55A 2AUJD 3PGZA 4A4IA 3BVMA 5CV6A 4NDXA 1BXTA 4QF4A 4FF2A 3I4MB 2KCCA 4QJFA 3T13A 2PPBC 1SYEA 3CP0A 3FKIG 4A3EH 1SE2A 1I4XA 1K28A 1JR0D 5HGQA 1B9MA 3PV0A 2B2UC 4CGYB 3S9WA 4P74A 1KDBA 2XWBB 4PMWA 2PYKA 2F0EA 4DAPA 2BOSA 3ULLA 1VQOA 1IW7D 1HNWQ 2E2HH 4RGNA 1M4VA 2HIVA 3A0JA 2ZJPA 2B29A 5JJZA 4X3UA 3S14B 2N8NA 4IUVA 1O7LA 4RKLA 2A69C 1HCZA 1N9WA 5M3FH 3HZXA 5IODA 4DK6C 1ENFA 1YHQA 1QNUA 2R7DA 5EBCA 1RTOA 5CV9A 4UPAA 4C3JH 3H91A 1X3GA 2TSSA 1JICA 4JI2Q 3VR3A 2KOLA 4X3SA 3GV6A 1A3VA 3IRBA 3EN2A 1TWGB 4JI6L 2WACA 2YTXA 2F0VA 1G51A 1VQCA 3J80i 3J7AV 2QEXA 1SYFA 4JYAL 4A3BB 1I50H 3FPUB 3MXGA 3EIVA 5AFWA 5M3MB 3D6CA 3CPFA 3Q8DA 4DV5L 3IFTA 3OOCA 1PH6A 3RN2A 4JOIA 3T53B 4A93B 1XPRA 1W6KA 3NELA 1Y14B 4LF7Q 1LT5D 5FLMH 5EKLA 4CDFC 2EXDA 3HOZG 2KEDA 2JYOA 3WOEA 4HCSA 1D8LA 4B3TL 3HKZB 2E76C 3G7LA 1E22A 4LF6Q 1V1PA 3DUZA 1KQSA 3RN5A 2B63H 4LF8Q 3NENA 3SGIA 3SR1A 4LF4Q 4ZUIA 3MEHA 1YNND 3HKSA 4I65A 4DR6Q 1PDQA 1CZWA 2X6GA 1BCPB 4JI8Q 4AQYQ 3S16H 1B44D 5C3EG 4DAYA 4F87A 2NTTA 1XMOQ 2A6HD 4JK1C 2VUMG 2RCNA 3I90A 2HHHQ 1LTGD 1RIPA 2HDLA 2BH2A 1JOQA 1YJWA 4EQPA 1VMCA 2D2CC 2EYLA 4C3IB 2R3ZA 3IFDA 4KK7A 3GV3A 4XXEA 1ZKOA 1YNJC 1X54A 4JI5Q 4IZ8A 3X3MA 3CCJA 3F2DA 2A68C 3MAQA 4MTNA 4OO1H 2K1BA 2NN6G 4OONA 4YY3L 4JC0A 3KK7A 1ZYRD 3OTOQ 2WKCA 1OO9B 4QQBX 2MO1A 4KY7A 1HZBA 1PRTB 4DU9A 5ELNA 2QDLA 2EE1A 4GKJQ 2JN4A 4HJAA 1CSQA 3I4NH 3S2HB 3CF5A 1C8CA 1U5KA 1A3UA 1WTVA 4LFAQ 4I7AA 2ENBA 2Z6KC 5EPJA 3BVGA 4GN5A 3BU2A 1F9PA 2AHOB 5AJ3Q 4DFAA 1B3QA 4KY6A 5BN4A 3HOYB 4OX9Q 4N8FA 3W3AA 1SMYD 1SSOA 4DUYQ 1SFOB 2D9UA 1Q81C 1UWVA 1VDZA 4X64L 3I2ZA 3HS0C 1FGBD 2A6EC 4K2KA 4PQXA 4BY1G 2SNMA 4RH6A 4DR4L 2IPKD 3K7UC 1MJCA 1L2FA 1LT3D 4R4OA 1S5FD 4B3SL 2KCTA 1EY4A 4MNOA 3BDLA 1EQTA 1S5CD 1AW7A 1MSGA 3C46A 3W5OA 3M4QA 2KUMA 5C5LA 4J15A 5CGKA 1YITA 1H95A 3V96A 4A3KH 1N32L 3P20A 1HUNA 1QUQA 1EIGA 4KHZA 1CTMA 2N49A 1JOKA 4JVZA 3CC4A 1PFMA 1H9MA 4KHPL 2VNUD 2VW9A 4K2LA 3HOYH 4A3LG 3VDYA 2OQKA 1FNUA 4J6HA 1B53A 5D65A 2F3IA 1LLRD 4OWTB 2B2VA 4G7ZC 5IYCG 1Y1VB 2XIWA 1B4OA 3D0FA 2RDFA 4P2CB 1Y1WG 5EPKA 3L2PA 1LTLA 3MHBA 4UHVA 1WTQA 3BDOA 2VXWA 4BY7B 2KHIA 4GZYC 2UXCQ 5E4XA 5JVH3 1JORA 3GTQH 2JA7H 3TQYA 1CK1A 3HRZC 2PMZE 2F4IA 3KDFA 4NKLA 1IW7C 2K6AA 4UP9A 3NXWA 1BUVT 5I2XA 4WJ4A 2ZTCA 4GKKQ 2JA6H 4DK1A 2JA5G 3SEBA 3PIP3 4BBRG 4Q5VA 4NXML 1K8OA 3HGBA 4UDUC 3NBIA 2WIIB 3S1QB 5JEAJ 1HTPA 1NUCA 4WFN3 3ZJYC 1U9RA 1R9TH 4A3IB 4DR5L 2A19A 4A3GB 4OXPA 2UUBQ 1HA5A 4JBWA 3VYRA 4C3HG 1I4GA 4RCNA 1VQLA 3LWEA 2NTSA 4A3DB 3I4OA 1L0YB 1GUTA 3HOUB 2QGQA 4JI6Q 4JI7Q 1G8ZD 5A35A 2C35B 4HEDA 3KOJA 5IWAL 3N52A 3CHBD 4IUNA 3VR5A 4CHTB 1GJXA 2RKSA 1QCBD 1SYCA 1X65A 2CWAA 1PA6A 2IW3A 3KF8B 3S1QH 2B8FA 1X3EA 4BBSB 5KEEA 1WCMB 2DY7A 3A55A 4JBMA 4FNFA 2CW0D 2F0QA 3P7JA 1HA6A 3A74A 1YBYA 2HCCA 5JJIA 4QL5A 1NBWA 2L11A 2VZAA 1ENCA 5LMNL 1KHIA 3RR5A 4IALA 3GTLB 1RCVD 1F9RA 2C5CA 4TQUS 4NP5A 5C4JH 2M00A 1YNNC 4K5VA 1F77A 4H02A 5JVG3 3HOZH 5LMNW 3G71A 1LTSD 3U9OA 4QMGA 1OXSC 1XNRL 2A6HC 1WFQA 1QVGA 2GVAA 4A3EG 2K33A 2EY2A 2Z6KA 3R93A 5IYDH 1A6XA 4DK3C 1BBWA 2M2LA 5CC4A 4XQJA 3H94A 2JSOA 5KYIA 5M5XH 1EEID 2K04A 3IKJA 1DYQA 4CBVA 4IFDH 2YYZA 3KBXA 1GUNA 2JP1A 4DAMA 1HH2P 2AQ2B 4R8IA 2UUCQ 4DV2Q 5FJ8H 2R93H 1ILQA 1NCVA 3VR4A 1GVPA 3K7AB 4G57A 1VQNA 4AIMA 2B2WC 5KNDA 4GLVB 1HNZQ 1WTXA 1SAPA 3EBEA 1AP0A 1SR3A 5DNFA 1E3PA 1K83B 1JB3A 5M3FG 3PCOB 1ZYRC 2EYHA 3OSOA 1KRTA 4QUCA 3TP5A 3KLSA 1D7QA 1HNWL 1BCPD 1E0BA 4FF4A 1A0IA 5EJWA 1HJPA 3M85A 1EIYB 4CKEA 1V9PA 3FPPA 3J81i 2IHFA 2EJMA 2PZWA 1CHPD 2RQXA 1PTOB 1A15A 1IZ6A 1XX8A 3CCRA 4P75A 2VL6A 4G4KA 1V43A 5BR8Q 2VS1A 2ZTEA 4JI2L 3F2CA 4RAUC 3S1MH 1I4QA 1WYDA 4HIMA 4FF1A 1SMYC 2A74C 2NZ1D 2Q2IA 4KKTA 2HQLA 4L63B 1ML0D 2D0OA 5A2QL 5EPLA 1AEXA 2MPMA 3A7LA 1GHJA 1O80A 2DUDA 4RHRA 5FLMG 4A3MB 2AUKA 3ITPA 4XDXA 2F0WA 2BA0A 4EQOA 2L5TA 2XNAC 1JWUD 1PRTD 1CQVA 3DEOA 5DM63 1U0LA 1N34Q 4LF7L 3KFUA 5M5YH 3RZOH 4CJ0B 2E2JB 1UE7A 2B63G 4A3BG 2K5NA 1KDAA 4TKOB 4AYBG 2B8GA 1SNOA 1JC7A 4BY1H 1O7ZA 5J3BA 2K50A 2HDMA 4L8JA 3T4AC 2K28A 4OIJA 4LF6L 4KHPQ 2BCOA 2A73B 1L1OB 1PFBA 2RCFA 4NB3A 2EYJA 4DUZQ 4LF8L 2NVXB 3S15H 1K3RA 1JJ2A 4LF4L 1JWSD 3VR2A 1VMPA 3NQIA 2LXKA 4DR6L 3TS2A 4JI8L 4AQYL 2WINB 1NR2A 4LAAA 3HKZG 4XYQA 4WORA 2K5HA 1QZHA 1NAPA 1XMOL 3DWQA 4LNQA 3BZDB 2XWJB 2HHHL 2OCEA 1DOLA 1G2SA 1S5DD 2R92B 1CZGA 4OO1G 4WJWA 5GAGC 2K5WA 1MGSA 2B2TC 4UP8A 2KECA 1YEZA 1MKHA 1I6HB 5E7NA 4CJ2C 4KTAA 3RLFA 4DNIA 3MWYW 1AZQA 1W2BA 4JI5L 3GTOB 1II3A 3I4NG 2DJGC 3OW2A 1RHPA 1T9HA 2F0FA 3OTOL 4MIUA 3K0YA 4XYOA 2QEJC 1TS5A 5NUCA 3BZCA 4V190 2NVTB 1IYVA 3T1YQ 3OPOA 2PI2E 2FFKB 1ESFA 3JAMc 4OIKA 3EROA 4XQNA 4GKJL 1HUMA 3SK4A 4G7OC 1B2TA 3GTKH 3PIO3 2H5XA 3OYYA 4GOPA 3E9HA 3HOWH 4LFAL 2FXQA 3V2TA 2EYPA 5I9OA 5IWAQ 5AJ3L 1EY6A 1J6QA 1IXRA 4ZLTF 1QWYA 2CW0C 2XVSA 2Z1CA 4DUYL 1B1ZA 4MHEA 4A3KG 1CHQD 2B2WA 2CQOA 3J80L 2XSCA 4FP5D 4HMJA 1I3QH 5HY6A 5C3WA 4K5XA 2CH4W 2LSSA 1J8IA 5T1GA 1PYBA 3HOYG 4H7BA 1YIJA 1B9NA 1AH9A 2O2LD 2IX1A 1PH2A 3ERSX 3E5SA 1S5BD 1A2UA 1LTTD 3E0EA 3JC66 2NB0A 4X66Q 1B7YB 3O13A 3CCVA 2VB2X 3U4ZA 5FOBB 2JEAI 2VQEQ 5CV7A 5A2QE 3S24A 2MJ8A 3QG1A 3H6MA 3L0OA 2Q2UA 1R4PB 2F0OA 1E7ZA 2R61A 4OELB 4PNYA 2ZXPA 3M4PA 5C4XH 1TVXA 4QCLA 2VQFQ 1RL2A 1PH8A 1VQKA 2GVBA 2OTLA 4GN3B 1YJ9A 3HOVB 1D5ZC 1KIXA 2JA6G 1TWAH 5IGDA 2ASBA 2UXCL 3TZDA 2PZUA 3KJPA 3K5MA 1F9QA 1RD9D 3R3OA 3BYYB 3M7NA 1Y1VG 1BCPC 3D8GA 1HHVA 2QKIC 4GKKL 1Z47A 1NR4A 3ULPA 4B9XA 1IBMQ 1TIID 2F3WA 1SNQA 2Q8IB 3M4OB 3CMEA 3M3YB 2PQEA 1JJGA 4J1MA 3C3LA 5J22A 1QVFA 1RODA 2MO0A 4IO9A 1B3AA 1EYGA 3KF6B 1SJHD 2UUBL 2F03A 3I4MH 5GQOA 4DGZA 3EQLC 1TU2B 4EQNA 4A76A 3PO2B 3OIPA 1I6VC 2LKVA 3ICEA 1ZXTA 1Q8IA 2KVMA 5LHY1 4JI7L 3K8AA 1SE8A 5IGEA 2KCNA 1C7YA 3J7ZC 2IT1A 1Y8PB 4RMFA 3T51B 1PRTC 4A3GG 4XQQA 4HIOA 2K01A 4R4QA 3K6OA 5GROA 4LWCA 3TZUA 4X62L 2IL8A 4L5TA 3BS1A 2RHQB 4A3DG 1PZID
chains in the Genus database with same CATH topology
1VQJA 2JJQA 3CW2C 4KHPL 2UXDL 3S14H 5JEAG 3RLNA 3HOVG 2R92H 1K0RA 2XTIA 2VW9A 2VNUD 3AEVA 3HOYH 4A3LG 5FLXc 3CXCA 3VDYA 5GADC 4JI0Q 2OQKA 3TRZA 1JT8A 4JI4Q 1TWCH 4B3SL 2F3IA 4BA1I 3HKZE 4OWTB 4XTCS 1L1OA 4LFCL 5IYCG 5C3EH 1I6HH 3CD6A 1VQHA 4DR3L 4HJ8A 3D0FA 1EWIA 4DV7Q 2I5HA 1VQBA 3J81c 1Y1WG 2PQAA 3KYHC 3AQQA 1TWGH 2CKZB 1LTLA 3L2PA 2VUMH 3GTOH 4C2MH 3GTJH 2OWOA 3F2BA 5IYDG 1UE6A 1NY4A 1J5EL 1X56A 2KHIA 4JG2A 2UXCQ 4A3BH 4KLKA 3GTQH 4JCVE 2JA7H 2NVTH 4YY3Q 3CCLA 3TQYA 4IFDG 1XPUA 5M3MH 1OTCA 2PMZE 2UUAQ 4L5RC 3KDFA 3TEHB 2AMCB 3D31A 3UE1A 4UP9A 5FJ8G 2R93G 4LFBQ 4ALPA 5K36G 1BBUA 4A93H 4WJ4A 3PUVA 2ZTCA 1HNXL 4GKKQ 2JA6H 4LF5Q 2JA5G 3S1QH 5IP7H 3AYHB 4BBRG 3TS0A 4NXML 4A3FG 3PO2G 1SLJA 3J81j 3PUWA 4R1JA 5JEAJ 4R4TA 4NXNQ 2K52A 2JA8H 3S17H 5IYDH 1G6PA 4DKAC 2UUCL 4DV2L 3K0XA 4HJ7A 3ZJYC 1R9TH 3HFZB 3UDXA 3ULJA 5IT9c 4DR5L 3CCEA 2K14A 2A19A 2XGTA 3I56A 1XJVA 1Q7YC 3S1RH 4OXPA 2ATWA 2UUBQ 1HNZL 4L5SA 4JBWA 4GNXB 2ALYB 1N36L 4FDBA 2JK8A 1VQLA 4X64Q 1UEBA 1E24A 5EAYA 1EOVA 3I4OA 5ELOA 1S72A 4YWLA 4DR7Q 2Y0SG 3H0GH 1CUKA 1S40A 1I94Q 2NN6I 2QGQA 4UY8C 4DR4Q 4JI6Q 4DV6Q 4JI7Q 4B3SQ 3PO3G 1PH1A 4B3ML 5C0XG 1VQFA 2YTYA 3G6EA 4A3JG 1LUZA 1QUQB 4IFDJ 2C35B 1VQ7A 3KOJA 5IWAL 1K9MC 1FJGL 1N32Q 1X65A 1VS0A 2CWAA 5DLQE 1CKMA 3KF8B 3W1BA 1IYJB 1PA6A 1X3EA 5BR8L 3CCMA 4EQ5A 4B3RL 3UDFA 3CAMA 2UXDQ 4JBMA 1W3SA 3UDIA 1CKOA 3PF4A 4BY7G 4JI1L 4XIGS 1LM0A 4APVA 2DGYA 3A74A 1YBYA 5JJIA 4YHHL 1WI5A 4QL5A 4JI3L 4DV1L 1YZ6A 1A62A 2OTJA 1NBWA 4IJHA 4YWMA 4C3IH 2KBNA 2VZAA 5GAHC 4LFCQ 4JV5L 5LMNL 1KHIA 1CKNB 3RR5A 4GNXC 4DR3Q 1ASYA 3I55A 4AH6A 4Y52H 3HOVH 1S3OA 4TQUS 3T1HL 1UE5A 4A3LH 1IBLL 1BKBA 2ZJRA 2LXJA 2R6GA 1VQ9A 1IL2A 5C4JH 1OXVA 1J5EQ 1VQIA 1FGUA 1SN8A 1N34L 4PG3A 1FL0A 3GD7A 4H02A 5IYCH 3HOZH 5LMNW 5IYBH 3HOXG 3MEFA 3U50C 3G71A 1PH3A 1BVSA 1KD1C 3U4VA 4A3IG 2N78A 1OXSC 1Y1WH 2AWOA 4DAYB 1QZGA 1AE2A 4JOIC 4DR1L 1WFQA 1XNRL 2N3SA 1QVGA 2GVAA 4A3EG 4PZ8A 2F52A 3S2HH 1PYSB 2Z6KA 2KCMA 3J80c 1OXTA 1BBWA 2BA1A 4DK3C 3TREA 1HNXQ 3M3YH 3M4OH 4A3CH 1IBKL 3CPWA 4NXMQ 5M5XH 5LMUL 3CQZH 5JJKA 4R4CA 1VQEA 3HOUG 4PZ7A 2YYZA 4DAMA 1HH2P 3PIOA 1QVCA 1JMCA 3WWVA 4QY7A 2UUCQ 4DV2Q 2BH8A 5FJ8H 2MFIA 2R93H 4DUZL 1AE3A 4QIWE 4IPHA 1SFOH 1GD7A 2Z0SA 1X6OA 1GVPA 4DR5Q 2KHJA 3L7ZC 1VQNA 2JE6I 4AIMA 2JA5H 5IP9G 1VQGA 4BBRH 4GLVB 4DV4L 1HNZQ 3A5UA 4A3FH 3STBC 4DR2L 3EBEA 4DV3L 3PO2H 3LGJA 1N36Q 1HR0L 1SR3A 3CMAA 4EX5A 4BBSG 3DLLA 1E3PA 3MXNB 2D0PA 5M3FG 3H3VH 1WCMG 3PCOB 1KRTA 1D7QA 1O7IA 4HJ9A 2R7ZG 1HNWL 4IFDI 1GO3E 2VY3A 4KI0A 4B3MQ 1PH7A 1A0IA 1K73C 1XNQL 4IPGA 1HJPA 4C3HH 3M85A 4HIKA 1EIYB 1V9PA 1HR0W 3F1ZA 2B3GA 1Q1BA 2IHFA 3J81i 4OX9L 1YI2A 1FJGQ 2K5VA 1IZ6A 4OWXB 3CCRA 2CCZA 4R4IA 3G4SA 1DGSA 2VL6A 4P75A 1V43A 5BR8Q 1TWFH 2VS1A 2ZTEA 3KF6A 3UE0A 1Q12A 1A63A 3K80C 3H3VI 1KRSA 2WB1G 3PIPA 3F2CA 4A3JH 4JI2L 4JBKA 3S1MH 4JI7L 4YCVA 4YWKA 4JI1Q 1XMQL 1WYDA 2JEBI 4HIMA 2Q2IA 4DV0L 2OQ0A 2HQLA 1Y1VH 2D0OA 2Q2HA 1N33L 3FP9A 4YHHQ 4JI3Q 1M90C 1E1OA 4DV1Q 1LYLA 3CCUA 2F4VL 1VQDA 2RF4A 1C9OA 1A8VA 2DUDA 3HOWG 4JV5Q 5LMNQ 5JJLA 5FLMG 3H15A 1NMGA 2HIXA 1SRUA 3F8TA 1KL9A 2ZM6L 3J7A5 3T1YL 1P8LA 5GAEC 3FHWA 2BA0A 5C44G 1I5FA 3T1HQ 1G291 4IJLA 1ASZA 4BY7H 1IBLQ 2Q2TA 2E2IH 1C0AA 4GS3A 4Y7NH 4WJ3M 3DM3A 1NJIC 4TVAB 1U0LA 5C0XI 3CCQA 3U58A 1N34Q 4LUVA 2IY5B 2K75A 1HZAA 4LF7L 1HZCA 3KFUA 4GN4B 4YCUA 5M5YH 4OWWB 2R7FA 3RZOH 3K81C 3I4MG 1JE5A 1UE7A 2B63G 2GN5A 4GLXA 2MQHA 4A3BG 1XNRQ 4DR1Q 1VQAA 2K5NA 1P16A 2UU9L 4LUZA 4AYBG 2JA7G 4K0KL 4LF9L 4X65L 2IHEA 1OXUA 4BY1H 5J3BA 4X62Q 1M1KC 2K50A 1IBKQ 1E1TA 5LMUQ 3PGZA 4GLAC 3PUYA 4A4IA 4LF6L 4KHPQ 1B70B 2CWPA 2WP8J 2YU9H 3HOXH 2I5MX 3BZKA 1L1OB 1Q1EA 4BXXH 4A3IH 1Q86C 1XPOA 4X6AH 2NZOA 4QJFA 4A3GH 4LW1A 3CP0A 1EQRA 1HZ9A 3FKIG 2WAQG 4NB3A 4DUZQ 2A1AA 4A75A 4A3EH 4LF8L 2A8VA 3GTGH 3S15H 1K3RA 1JJ2A 2PQAB 4LF4L 2JA8G 1KXLA 2ES2A 2PI2A 5HGQA 4POGA 3PV0A 4A3DH 4DV4Q 2LXKA 1OXXK 3CCSA 4DV3Q 4DR2Q 4DR6L 1MIUA 1HR0Q 3HOUH 1NMFA 2NVYH 4JI8L 2I5LX 4P74A 4AQYL 1X9NA 3TS2A 3HKZG 2UXBL 1EFWA 4PMWA 2K5HA 1QZHA 3ULLA 4X66L 1VQOA 1XMOL 1PH9A 1HNWQ 2K4KA 1YHBA 3KDFB 1YJNA 4LNQA 5C4XG 1PH4A 2E2HH 2ZJQA 2HIVA 2KENA 3A0JA 1XNQQ 2VQEL 5IP9H 2ZJPA 2B29A 3H0GG 2HHHL 2OCEA 5C0XJ 2N8NA 1KAWA 1CSPA 1JB7A 3PUZA 1YVCA 4BBSH 1N9WA 5M3FH 4IOCA 1WCMH 2Y0SE 4A3MG 4OO1G 5GAGC 4DK6C 1WOCA 1YHQA 4UP8A 3S1NH 1YEZA 2R7ZH 1MKHA 2JA9A 2R7DA 4HIDA 4UPAA 5E7NA 4C3JH 3RLFA 1SROA 1X3GA 2VQFL 4JI2Q 1L1OC 4GNXA 4DNIA 1XMQQ 3IRBA 3EN2A 4DV0Q 1W2BA 4JI6L 4JI5L 2EQSA 3I4NG 1N33Q 1Q46A 1YHAA 2YTXA 3OW2A 1PVOA 1G51A 1T9HA 1VQCA 3J80i 1GM5A 2F4VQ 3OTOL 1VQ6A 3GTLH 1UE1A 2QEXA 4IOAA 4JYAL 1I50H 3BZCA 3PUXA 1N8RC 3EIVA 3T1YQ 3CPFA 2PI2E 3Q8DA 3JAMc 3GTMH 1V1QA 4DV5L 4GKJL 1PH6A 1IBML 1JJCB 3RN2A 4JOIA 1XPRA 3NELA 1Q82C 2H5XA 3GTKH 1Y14B 4QGUA 3OYYA 2E5LL 2YTVA 3E9HA 4O2DA 4GOPA 1NE3A 1B8AA 3M9BA 4LF7Q 4LFAL 3HOWH 1WJJA 2FXQA 5FLMH 4ME3A 2E8GA 5AJ3L 5IWAQ 3JAMi 2EXDA 5C44H 3HOZG 2UU9Q 1J6QA 1IXRA 4L5QA 4JBJA 5IYBG 4LF9Q 4X65Q 4K0KQ 4DUYL 3UDGA 1VCIA 1VQ5A 3KJOA 1D8LA 4B3RQ 4B3TL 4YCWA 3PO3H 1E22A 4LF6Q 3GO5A 1CKNA 4A3KG 5IE8A 1VQMA 2CQOA 1KQSA 4A3CG 3RN5A 2YV5A 1EUJA 2B63H 3K7AH 3RNUA 1I3QH 5HY6A 4LF8Q 3NENA 2NVQH 3BJUA 3SGIA 2LSSA 4LF4Q 4PZ6A 1PYBA 2R92G 3HOYG 1YIJA 1K83H 1Q8KA 4IPCA 4P71A 2HT1A 3HKSA 1EIFA 4DR6Q 1AH9A 2V1CC 2IX1A 1PH2A 4JI8Q 3ERSX 4AQYQ 1SMXA 4HJ5A 3S16H 2UXBQ 3AFQA 5C3EG 3E0EA 3JC66 1YNXA 2IX0A 3FKIH 4X66Q 1XMOQ 1L0WA 1B7YB 3CCVA 3U4ZA 1PV4A 2JEAI 2VUMG 2RCNA 2VQEQ 2HHHQ 4JI0L 3S24A 1TWHH 4JI4L 1RIPA 2MNAA 2BH2A 2QA4A 3L0OA 2ZTDA 1YJWA 3I7FA 4NPSA 2Q2UA 3W1GA 1E7ZA 5M3MG 1VQ8A 2I0QA 4MZ9A 4DV7L 3M4PA 5C4XH 3S2DH 4UP7A 1PFSA 1K8GA 2VQFQ 1RL2A 1PH8A 2JQOA 1VQKA 2GVBA 2WFWA 2OTLA 3GTPH 4GN3B 1YJ9A 4A93G 2D62A 3STBD 1KIXA 2JA6G 1TWAH 1X54A 1XTDA 2AKWB 5IP7G 3CCJA 4JI5Q 2ASBA 3F2DA 2UXCL 4MTNA 4A3MH 1X3FA 3KJPA 2NN6G 4OONA 4YY3L 4JC0A 1KC8C 3OTOQ 4IPDA 1Z9FA 5IY0A 2UUAL 4JYAQ 3M7NA 4QQBX 2MO1A 1HZBA 1Y1VG 3ER0A 4BA2I 2WB1E 4P72A 2NZHA 4LFBL 2RHSB 5ELNA 3CC7A 1NTGA 4DV5Q 4GOPB 4GKKL 1Z47A 3ULPA 3KLWA 4LF5L 4GKJQ 1MJEA 1IBMQ 4HJAA 1CSQA 3I4NH 3AFPA 3CF5A 1U5KA 2E2JH 2L15A 1X55A 1PHJA 3CMEA 2E5LQ 2PNHA 4NXNL 4POFA 1JJGA 3NBHB 4LFAQ 4DPGA 2Z6KC 1QVFA 5H1SE 4GN5A 2MO0A 3BU2A 4OO1I 3G48A 1VQPA 2AHOB 5AJ3Q 4IO9A 1EYGA 3KF6B 3NEMA 4OX9Q 4O0AA 3E9IA 1EQQA 2UUBL 4DUYQ 1Q81C 4B3TQ 1UWVA 4X64L 3I4MH 5GQOA 3CC2A 3I2ZA 3A5ZB 3RLOA 2EIFA 4A76A 4BY1G 4DR7L 3PF5A 2NVXH 3ICEA 3PSIA 3RZDH 1I94L 4DR4L 1GKHA 3K7UC 4DV6L 1MJCA 1FVIA 1L2FA 4P73A 4R4OA 4AYBE 2KCTA 1SE8A 3K8AA 4MNOA 2CFMA 5M5WH 2AWNA 1C7YA 3J7ZC 2IT1A 1PH5A 1VQ4A 3GDEA 4RMFA 3W5OA 4BXXG 3M4QA 1K8AC 4A3GG 4J15A 4HIOA 1YITA 4R4QA 4LUOA 5GROA 1TXYA 2ZM6Q 1H95A 4A3KH 4GOPC 1N32L 1QUQA 3B6YA 4LWCA 4X62L 4KHZA 4L5TA 2N49A 2RHQB 4A3DG 2ID0A 3CC4A 2WAQE 4RG1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQJ A;  2JJQ A;  3CW2 C;  4KHP L;  2UXD L;  3S14 H;  5JEA G;  3RLN A;  3HOV G;  2R92 H;  1K0R A;  2XTI A;  2VW9 A;  2VNU D;  3AEV A;  3HOY H;  4A3L G;  5FLX c;  3CXC A;  3VDY A;  5GAD C;  4JI0 Q;  2OQK A;  3TRZ A;  1JT8 A;  4JI4 Q;  1TWC H;  4B3S L;  2F3I A;  4BA1 I;  3HKZ E;  4OWT B;  4XTC S;  1L1O A;  4LFC L;  5IYC G;  5C3E H;  1I6H H;  3CD6 A;  1VQH A;  4DR3 L;  4HJ8 A;  3D0F A;  1EWI A;  4DV7 Q;  2I5H A;  1VQB A;  3J81 c;  1Y1W G;  2PQA A;  3KYH C;  3AQQ A;  1TWG H;  2CKZ B;  1LTL A;  3L2P A;  2VUM H;  3GTO H;  4C2M H;  3GTJ H;  2OWO A;  3F2B A;  5IYD G;  1UE6 A;  1NY4 A;  1J5E L;  1X56 A;  2KHI A;  4JG2 A;  2UXC Q;  4A3B H;  4KLK A;  3GTQ H;  4JCV E;  2JA7 H;  2NVT H;  4YY3 Q;  3CCL A;  3TQY A;  4IFD G;  1XPU A;  5M3M H;  1OTC A;  2PMZ E;  2UUA Q;  4L5R C;  3KDF A;  3TEH B;  2AMC B;  3D31 A;  3UE1 A;  4UP9 A;  5FJ8 G;  2R93 G;  4LFB Q;  4ALP A;  5K36 G;  1BBU A;  4A93 H;  4WJ4 A;  3PUV A;  2ZTC A;  1HNX L;  4GKK Q;  2JA6 H;  4LF5 Q;  2JA5 G;  3S1Q H;  5IP7 H;  3AYH B;  4BBR G;  3TS0 A;  4NXM L;  4A3F G;  3PO2 G;  1SLJ A;  3J81 j;  3PUW A;  4R1J A;  5JEA J;  4R4T A;  4NXN Q;  2K52 A;  2JA8 H;  3S17 H;  5IYD H;  1G6P A;  4DKA C;  2UUC L;  4DV2 L;  3K0X A;  4HJ7 A;  3ZJY C;  1R9T H;  3HFZ B;  3UDX A;  3ULJ A;  5IT9 c;  4DR5 L;  3CCE A;  2K14 A;  2A19 A;  2XGT A;  3I56 A;  1XJV A;  1Q7Y C;  3S1R H;  4OXP A;  2ATW A;  2UUB Q;  1HNZ L;  4L5S A;  4JBW A;  4GNX B;  2ALY B;  1N36 L;  4FDB A;  2JK8 A;  1VQL A;  4X64 Q;  1UEB A;  1E24 A;  5EAY A;  1EOV A;  3I4O A;  5ELO A;  1S72 A;  4YWL A;  4DR7 Q;  2Y0S G;  3H0G H;  1CUK A;  1S40 A;  1I94 Q;  2NN6 I;  2QGQ A;  4UY8 C;  4DR4 Q;  4JI6 Q;  4DV6 Q;  4JI7 Q;  4B3S Q;  3PO3 G;  1PH1 A;  4B3M L;  5C0X G;  1VQF A;  2YTY A;  3G6E A;  4A3J G;  1LUZ A;  1QUQ B;  4IFD J;  2C35 B;  1VQ7 A;  3KOJ A;  5IWA L;  1K9M C;  1FJG L;  1N32 Q;  1X65 A;  1VS0 A;  2CWA A;  5DLQ E;  1CKM A;  3KF8 B;  3W1B A;  1IYJ B;  1PA6 A;  1X3E A;  5BR8 L;  3CCM A;  4EQ5 A;  4B3R L;  3UDF A;  3CAM A;  2UXD Q;  4JBM A;  1W3S A;  3UDI A;  1CKO A;  3PF4 A;  4BY7 G;  4JI1 L;  4XIG S;  1LM0 A;  4APV A;  2DGY A;  3A74 A;  1YBY A;  5JJI A;  4YHH L;  1WI5 A;  4QL5 A;  4JI3 L;  4DV1 L;  1YZ6 A;  1A62 A;  2OTJ A;  1NBW A;  4IJH A;  4YWM A;  4C3I H;  2KBN A;  2VZA A;  5GAH C;  4LFC Q;  4JV5 L;  5LMN L;  1KHI A;  1CKN B;  3RR5 A;  4GNX C;  4DR3 Q;  1ASY A;  3I55 A;  4AH6 A;  4Y52 H;  3HOV H;  1S3O A;  4TQU S;  3T1H L;  1UE5 A;  4A3L H;  1IBL L;  1BKB A;  2ZJR A;  2LXJ A;  2R6G A;  1VQ9 A;  1IL2 A;  5C4J H;  1OXV A;  1J5E Q;  1VQI A;  1FGU A;  1SN8 A;  1N34 L;  4PG3 A;  1FL0 A;  3GD7 A;  4H02 A;  5IYC H;  3HOZ H;  5LMN W;  5IYB H;  3HOX G;  3MEF A;  3U50 C;  3G71 A;  1PH3 A;  1BVS A;  1KD1 C;  3U4V A;  4A3I G;  2N78 A;  1OXS C;  1Y1W H;  2AWO A;  4DAY B;  1QZG A;  1AE2 A;  4JOI C;  4DR1 L;  1WFQ A;  1XNR L;  2N3S A;  1QVG A;  2GVA A;  4A3E G;  4PZ8 A;  2F52 A;  3S2H H;  1PYS B;  2Z6K A;  2KCM A;  3J80 c;  1OXT A;  1BBW A;  2BA1 A;  4DK3 C;  3TRE A;  1HNX Q;  3M3Y H;  3M4O H;  4A3C H;  1IBK L;  3CPW A;  4NXM Q;  5M5X H;  5LMU L;  3CQZ H;  5JJK A;  4R4C A;  1VQE A;  3HOU G;  4PZ7 A;  2YYZ A;  4DAM A;  1HH2 P;  3PIO A;  1QVC A;  1JMC A;  3WWV A;  4QY7 A;  2UUC Q;  4DV2 Q;  2BH8 A;  5FJ8 H;  2MFI A;  2R93 H;  4DUZ L;  1AE3 A;  4QIW E;  4IPH A;  1SFO H;  1GD7 A;  2Z0S A;  1X6O A;  1GVP A;  4DR5 Q;  2KHJ A;  3L7Z C;  1VQN A;  2JE6 I;  4AIM A;  2JA5 H;  5IP9 G;  1VQG A;  4BBR H;  4GLV B;  4DV4 L;  1HNZ Q;  3A5U A;  4A3F H;  3STB C;  4DR2 L;  3EBE A;  4DV3 L;  3PO2 H;  3LGJ A;  1N36 Q;  1HR0 L;  1SR3 A;  3CMA A;  4EX5 A;  4BBS G;  3DLL A;  1E3P A;  3MXN B;  2D0P A;  5M3F G;  3H3V H;  1WCM G;  3PCO B;  1KRT A;  1D7Q A;  1O7I A;  4HJ9 A;  2R7Z G;  1HNW L;  4IFD I;  1GO3 E;  2VY3 A;  4KI0 A;  4B3M Q;  1PH7 A;  1A0I A;  1K73 C;  1XNQ L;  4IPG A;  1HJP A;  4C3H H;  3M85 A;  4HIK A;  1EIY B;  1V9P A;  1HR0 W;  3F1Z A;  2B3G A;  1Q1B A;  2IHF A;  3J81 i;  4OX9 L;  1YI2 A;  1FJG Q;  2K5V A;  1IZ6 A;  4OWX B;  3CCR A;  2CCZ A;  4R4I A;  3G4S A;  1DGS A;  2VL6 A;  4P75 A;  1V43 A;  5BR8 Q;  1TWF H;  2VS1 A;  2ZTE A;  3KF6 A;  3UE0 A;  1Q12 A;  1A63 A;  3K80 C;  3H3V I;  1KRS A;  2WB1 G;  3PIP A;  3F2C A;  4A3J H;  4JI2 L;  4JBK A;  3S1M H;  4JI7 L;  4YCV A;  4YWK A;  4JI1 Q;  1XMQ L;  1WYD A;  2JEB I;  4HIM A;  2Q2I A;  4DV0 L;  2OQ0 A;  2HQL A;  1Y1V H;  2D0O A;  2Q2H A;  1N33 L;  3FP9 A;  4YHH Q;  4JI3 Q;  1M90 C;  1E1O A;  4DV1 Q;  1LYL A;  3CCU A;  2F4V L;  1VQD A;  2RF4 A;  1C9O A;  1A8V A;  2DUD A;  3HOW G;  4JV5 Q;  5LMN Q;  5JJL A;  5FLM G;  3H15 A;  1NMG A;  2HIX A;  1SRU A;  3F8T A;  1KL9 A;  2ZM6 L;  3J7A 5;  3T1Y L;  1P8L A;  5GAE C;  3FHW A;  2BA0 A;  5C44 G;  1I5F A;  3T1H Q;  1G29 1;  4IJL A;  1ASZ A;  4BY7 H;  1IBL Q;  2Q2T A;  2E2I H;  1C0A A;  4GS3 A;  4Y7N H;  4WJ3 M;  3DM3 A;  1NJI C;  4TVA B;  1U0L A;  5C0X I;  3CCQ A;  3U58 A;  1N34 Q;  4LUV A;  2IY5 B;  2K75 A;  1HZA A;  4LF7 L;  1HZC A;  3KFU A;  4GN4 B;  4YCU A;  5M5Y H;  4OWW B;  2R7F A;  3RZO H;  3K81 C;  3I4M G;  1JE5 A;  1UE7 A;  2B63 G;  2GN5 A;  4GLX A;  2MQH A;  4A3B G;  1XNR Q;  4DR1 Q;  1VQA A;  2K5N A;  1P16 A;  2UU9 L;  4LUZ A;  4AYB G;  2JA7 G;  4K0K L;  4LF9 L;  4X65 L;  2IHE A;  1OXU A;  4BY1 H;  5J3B A;  4X62 Q;  1M1K C;  2K50 A;  1IBK Q;  1E1T A;  5LMU Q;  3PGZ A;  4GLA C;  3PUY A;  4A4I A;  4LF6 L;  4KHP Q;  1B70 B;  2CWP A;  2WP8 J;  2YU9 H;  3HOX H;  2I5M X;  3BZK A;  1L1O B;  1Q1E A;  4BXX H;  4A3I H;  1Q86 C;  1XPO A;  4X6A H;  2NZO A;  4QJF A;  4A3G H;  4LW1 A;  3CP0 A;  1EQR A;  1HZ9 A;  3FKI G;  2WAQ G;  4NB3 A;  4DUZ Q;  2A1A A;  4A75 A;  4A3E H;  4LF8 L;  2A8V A;  3GTG H;  3S15 H;  1K3R A;  1JJ2 A;  2PQA B;  4LF4 L;  2JA8 G;  1KXL A;  2ES2 A;  2PI2 A;  5HGQ A;  4POG A;  3PV0 A;  4A3D H;  4DV4 Q;  2LXK A;  1OXX K;  3CCS A;  4DV3 Q;  4DR2 Q;  4DR6 L;  1MIU A;  1HR0 Q;  3HOU H;  1NMF A;  2NVY H;  4JI8 L;  2I5L X;  4P74 A;  4AQY L;  1X9N A;  3TS2 A;  3HKZ G;  2UXB L;  1EFW A;  4PMW A;  2K5H A;  1QZH A;  3ULL A;  4X66 L;  1VQO A;  1XMO L;  1PH9 A;  1HNW Q;  2K4K A;  1YHB A;  3KDF B;  1YJN A;  4LNQ A;  5C4X G;  1PH4 A;  2E2H H;  2ZJQ A;  2HIV A;  2KEN A;  3A0J A;  1XNQ Q;  2VQE L;  5IP9 H;  2ZJP A;  2B29 A;  3H0G G;  2HHH L;  2OCE A;  5C0X J;  2N8N A;  1KAW A;  1CSP A;  1JB7 A;  3PUZ A;  1YVC A;  4BBS H;  1N9W A;  5M3F H;  4IOC A;  1WCM H;  2Y0S E;  4A3M G;  4OO1 G;  5GAG C;  4DK6 C;  1WOC A;  1YHQ A;  4UP8 A;  3S1N H;  1YEZ A;  2R7Z H;  1MKH A;  2JA9 A;  2R7D A;  4HID A;  4UPA A;  5E7N A;  4C3J H;  3RLF A;  1SRO A;  1X3G A;  2VQF L;  4JI2 Q;  1L1O C;  4GNX A;  4DNI A;  1XMQ Q;  3IRB A;  3EN2 A;  4DV0 Q;  1W2B A;  4JI6 L;  4JI5 L;  2EQS A;  3I4N G;  1N33 Q;  1Q46 A;  1YHA A;  2YTX A;  3OW2 A;  1PVO A;  1G51 A;  1T9H A;  1VQC A;  3J80 i;  1GM5 A;  2F4V Q;  3OTO L;  1VQ6 A;  3GTL H;  1UE1 A;  2QEX A;  4IOA A;  4JYA L;  1I50 H;  3BZC A;  3PUX A;  1N8R C;  3EIV A;  3T1Y Q;  3CPF A;  2PI2 E;  3Q8D A;  3JAM c;  3GTM H;  1V1Q A;  4DV5 L;  4GKJ L;  1PH6 A;  1IBM L;  1JJC B;  3RN2 A;  4JOI A;  1XPR A;  3NEL A;  1Q82 C;  2H5X A;  3GTK H;  1Y14 B;  4QGU A;  3OYY A;  2E5L L;  2YTV A;  3E9H A;  4O2D A;  4GOP A;  1NE3 A;  1B8A A;  3M9B A;  4LF7 Q;  4LFA L;  3HOW H;  1WJJ A;  2FXQ A;  5FLM H;  4ME3 A;  2E8G A;  5AJ3 L;  5IWA Q;  3JAM i;  2EXD A;  5C44 H;  3HOZ G;  2UU9 Q;  1J6Q A;  1IXR A;  4L5Q A;  4JBJ A;  5IYB G;  4LF9 Q;  4X65 Q;  4K0K Q;  4DUY L;  3UDG A;  1VCI A;  1VQ5 A;  3KJO A;  1D8L A;  4B3R Q;  4B3T L;  4YCW A;  3PO3 H;  1E22 A;  4LF6 Q;  3GO5 A;  1CKN A;  4A3K G;  5IE8 A;  1VQM A;  2CQO A;  1KQS A;  4A3C G;  3RN5 A;  2YV5 A;  1EUJ A;  2B63 H;  3K7A H;  3RNU A;  1I3Q H;  5HY6 A;  4LF8 Q;  3NEN A;  2NVQ H;  3BJU A;  3SGI A;  2LSS A;  4LF4 Q;  4PZ6 A;  1PYB A;  2R92 G;  3HOY G;  1YIJ A;  1K83 H;  1Q8K A;  4IPC A;  4P71 A;  2HT1 A;  3HKS A;  1EIF A;  4DR6 Q;  1AH9 A;  2V1C C;  2IX1 A;  1PH2 A;  4JI8 Q;  3ERS X;  4AQY Q;  1SMX A;  4HJ5 A;  3S16 H;  2UXB Q;  3AFQ A;  5C3E G;  3E0E A;  3JC6 6;  1YNX A;  2IX0 A;  3FKI H;  4X66 Q;  1XMO Q;  1L0W A;  1B7Y B;  3CCV A;  3U4Z A;  1PV4 A;  2JEA I;  2VUM G;  2RCN A;  2VQE Q;  2HHH Q;  4JI0 L;  3S24 A;  1TWH H;  4JI4 L;  1RIP A;  2MNA A;  2BH2 A;  2QA4 A;  3L0O A;  2ZTD A;  1YJW A;  3I7F A;  4NPS A;  2Q2U A;  3W1G A;  1E7Z A;  5M3M G;  1VQ8 A;  2I0Q A;  4MZ9 A;  4DV7 L;  3M4P A;  5C4X H;  3S2D H;  4UP7 A;  1PFS A;  1K8G A;  2VQF Q;  1RL2 A;  1PH8 A;  2JQO A;  1VQK A;  2GVB A;  2WFW A;  2OTL A;  3GTP H;  4GN3 B;  1YJ9 A;  4A93 G;  2D62 A;  3STB D;  1KIX A;  2JA6 G;  1TWA H;  1X54 A;  1XTD A;  2AKW B;  5IP7 G;  3CCJ A;  4JI5 Q;  2ASB A;  3F2D A;  2UXC L;  4MTN A;  4A3M H;  1X3F A;  3KJP A;  2NN6 G;  4OON A;  4YY3 L;  4JC0 A;  1KC8 C;  3OTO Q;  4IPD A;  1Z9F A;  5IY0 A;  2UUA L;  4JYA Q;  3M7N A;  4QQB X;  2MO1 A;  1HZB A;  1Y1V G;  3ER0 A;  4BA2 I;  2WB1 E;  4P72 A;  2NZH A;  4LFB L;  2RHS B;  5ELN A;  3CC7 A;  1NTG A;  4DV5 Q;  4GOP B;  4GKK L;  1Z47 A;  3ULP A;  3KLW A;  4LF5 L;  4GKJ Q;  1MJE A;  1IBM Q;  4HJA A;  1CSQ A;  3I4N H;  3AFP A;  3CF5 A;  1U5K A;  2E2J H;  2L15 A;  1X55 A;  1PHJ A;  3CME A;  2E5L Q;  2PNH A;  4NXN L;  4POF A;  1JJG A;  3NBH B;  4LFA Q;  4DPG A;  2Z6K C;  1QVF A;  5H1S E;  4GN5 A;  2MO0 A;  3BU2 A;  4OO1 I;  3G48 A;  1VQP A;  2AHO B;  5AJ3 Q;  4IO9 A;  1EYG A;  3KF6 B;  3NEM A;  4OX9 Q;  4O0A A;  3E9I A;  1EQQ A;  2UUB L;  4DUY Q;  1Q81 C;  4B3T Q;  1UWV A;  4X64 L;  3I4M H;  5GQO A;  3CC2 A;  3I2Z A;  3A5Z B;  3RLO A;  2EIF A;  4A76 A;  4BY1 G;  4DR7 L;  3PF5 A;  2NVX H;  3ICE A;  3PSI A;  3RZD H;  1I94 L;  4DR4 L;  1GKH A;  3K7U C;  4DV6 L;  1MJC A;  1FVI A;  1L2F A;  4P73 A;  4R4O A;  4AYB E;  2KCT A;  1SE8 A;  3K8A A;  4MNO A;  2CFM A;  5M5W H;  2AWN A;  1C7Y A;  3J7Z C;  2IT1 A;  1PH5 A;  1VQ4 A;  3GDE A;  4RMF A;  3W5O A;  4BXX G;  3M4Q A;  1K8A C;  4A3G G;  4J15 A;  4HIO A;  1YIT A;  4R4Q A;  4LUO A;  5GRO A;  1TXY A;  2ZM6 Q;  1H95 A;  4A3K H;  4GOP C;  1N32 L;  1QUQ A;  3B6Y A;  4LWC A;  4X62 L;  4KHZ A;  4L5T A;  2N49 A;  2RHQ B;  4A3D G;  2ID0 A;  3CC4 A;  2WAQ E;  4RG1 A; 
#chains in the Genus database with same CATH topology
 1PTO D;  2JJQ A;  3Q6S A;  3S14 H;  2E74 C;  3I70 A;  5CYU A;  1K0R A;  1MHW C;  2B2T A;  3E3X A;  1ESR A;  3L9A X;  4QUF A;  4JI4 Q;  4A3J B;  1WTH A;  3FRP B;  4XTC S;  4KKU A;  2CVR A;  1K8M A;  4HJ8 A;  2HUG A;  3KYH C;  3AQQ A;  1TWG H;  2CKZ B;  4N9T A;  2PCF B;  2OWO A;  5IYD G;  1JQY D;  1UE6 A;  4QB4 A;  1NY4 A;  1FNV A;  4A3B H;  4JCV E;  4Y7N B;  4IFD G;  2F0D A;  5M3M H;  1HTL D;  5ELD A;  2AMC B;  1O7Y A;  2K03 A;  3TP6 A;  1L0X B;  5FJ8 G;  2R93 G;  1EEF D;  5COR A;  5FKA C;  3DWP A;  1BBU A;  4A93 H;  4LF5 Q;  3F2U A;  5IP7 H;  3AYH B;  4IUU A;  3TS0 A;  3J81 j;  3PUW A;  3A56 A;  4R4T A;  4NXN Q;  2FHT A;  3J80 E;  4DKA C;  2UUC L;  4DV2 L;  4HJ7 A;  2YU9 B;  1BBX C;  3ULJ A;  1D5X C;  2K14 A;  2XGT A;  1XJV A;  1Q7Y C;  1DXM A;  1HNZ L;  4L5S A;  4GNX B;  3GTG B;  2JK8 A;  1M8A A;  1UEB A;  3K5O A;  3A54 A;  4O42 A;  4KV6 A;  1EY9 A;  4YWL A;  4DR7 Q;  2Y0S G;  2PW7 A;  1TY0 A;  4KY5 A;  2NN6 I;  2NVY B;  4UY8 C;  1QB5 D;  2ICI A;  1PH1 A;  2YTY A;  3G6E A;  1QUQ B;  4DK0 A;  2QCP X;  5HUR A;  2QDB A;  1R4Q B;  1TQO A;  4CKC A;  1X3Q A;  3BYT B;  2ICE C;  1CKM A;  1A3T A;  5BR8 L;  1LTI D;  3UDF A;  4IUP A;  2UXD Q;  3S1N B;  3PF4 A;  2R7Z B;  1PLF A;  3UI2 A;  1LM0 A;  2DGY A;  1I4P A;  2I07 B;  3QR8 A;  2F0S A;  4C3I H;  4ZK9 B;  4OGQ C;  1CKN B;  4RFB A;  4AH6 A;  5JEA H;  1S3O A;  1UE5 A;  1G2T A;  2ZJR A;  1VQ9 A;  3GTM B;  3I8Z A;  1J5E Q;  1VQI A;  1N34 L;  2B2U A;  1FL0 A;  4Z9C B;  3MEF A;  3U50 C;  4FXD A;  2NWG A;  2AWO A;  2X6L A;  3S2H H;  3J80 c;  2IWH A;  1HNX Q;  2EOT A;  2B39 A;  3W2D A;  3OMC A;  5CR3 A;  4PZ7 A;  3A8J E;  2D5D A;  1QVC A;  1JMC A;  3PO3 B;  3MC0 B;  2RBM A;  4DUZ L;  4QIW E;  1SNM A;  1SFO H;  2NBF A;  3CKI B;  2DY8 A;  1VQG A;  4IQZ A;  1EYA A;  2F0T A;  1N36 Q;  1CA5 A;  4EX5 A;  3DLL A;  1Y8N B;  3MXN B;  4C56 C;  3NP8 A;  5FO9 B;  4HJ9 A;  1LTA D;  4K8I A;  2VY3 A;  5J1Z A;  4KI0 A;  3X3N A;  3NPP A;  1PH7 A;  1EOT A;  2E2I B;  3FKI B;  3J7A F;  4HIK A;  3F1Z A;  5HGT A;  2OEO A;  1TWH B;  3D4R A;  3QIA A;  3G4S A;  1BO0 A;  1DON A;  4ZUJ A;  3H3V I;  1KRS A;  1LTR D;  2WB1 G;  3SE0 A;  3PIP A;  4JBK A;  4JI1 Q;  3H09 A;  1HRJ A;  3S2D B;  4BWG B;  2OQ0 A;  1Y1V H;  1T5X D;  1ET6 A;  1F2Z A;  3C1E A;  4YHH Q;  1I4H A;  3GTP B;  4DV1 Q;  3CCU A;  1VQD A;  3HOW G;  1STY A;  2EY6 A;  4JV5 Q;  1NMG A;  2HIX A;  1SRU A;  5F2D A;  1KL9 A;  2ZM6 L;  2IJ0 A;  1P8L A;  3T1Y L;  2EY5 A;  3FHW A;  4DNT B;  3T1H Q;  1I5F A;  4BY7 H;  1XXG A;  4UAI A;  2E2I H;  1C0A A;  4GS3 A;  4WJ3 M;  3DM3 A;  1NJI C;  1WD0 A;  3U58 A;  4FVM A;  3CCQ A;  1EYC A;  2K75 A;  3NSW A;  3J81 L;  5G3L D;  4PMC A;  1F9S A;  1KAA A;  4GLX A;  3K57 A;  1PTO C;  1STH A;  4DR1 Q;  3MFG A;  2KHS A;  4X62 Q;  4ABN A;  1IL8 A;  1IBK Q;  5LMU Q;  2EYO A;  4GLA C;  1B70 B;  2CWP A;  2I5M X;  3BZK A;  4X6A H;  3DHQ A;  4NW2 A;  4A3I H;  1Q86 C;  1XPO A;  2B2Y C;  2NZO A;  1K0S A;  4A3G H;  1EQR A;  2WAQ G;  2DJF C;  2MUY A;  2K7V A;  1KXL A;  2PQA B;  2VB3 X;  2ES2 A;  2Q8T A;  2Z4I A;  1KLU D;  4A3D H;  4CDD C;  1OXX K;  4DV3 Q;  1MIU A;  3VA7 A;  1NMF A;  3HOU H;  2I5L X;  1EFW A;  2OXP A;  3BG3 A;  4X66 L;  1PH9 A;  2K4K A;  4HTH A;  1YJN A;  5C4X G;  4KN4 C;  1PH4 A;  2ZJQ A;  2KEN A;  2VQE L;  2LY7 A;  2MHV A;  5C0X J;  1KAW A;  1CSP A;  1JB7 A;  4DNR B;  1GOZ A;  5I6W A;  4BBS H;  1IKM A;  4XT3 B;  4IOC A;  1WCM H;  1WOC A;  1TWC B;  4WRD A;  2PNR C;  2JA9 A;  1SBB B;  5C3E B;  4HID A;  5D14 A;  2VQF L;  1L1O C;  1XMQ Q;  5JPN C;  5EKI A;  2VUM B;  4C2M B;  3GTJ B;  1Q46 A;  2FJ2 A;  1PVO A;  3GTL H;  1GM5 A;  1JWM D;  4LMQ D;  4CDE C;  1VQ6 A;  4FYD A;  1UE1 A;  1N8R C;  1SYG A;  3CU7 A;  1WTR A;  2X69 A;  4HR7 B;  5BN5 A;  1ICW A;  2L12 A;  1E2W A;  4JW0 A;  1V1Q A;  4EVO A;  3VYS A;  1IBM L;  1JJC B;  1G6Z A;  1NNX A;  1Q82 C;  1D6E C;  1DCZ A;  4QGU A;  3KF8 A;  3I4M G;  2YTV A;  5KRU A;  1NE3 A;  3M9B A;  1WJJ A;  2JA8 B;  3JAM i;  3BVZ A;  3S17 B;  4K0K Q;  2UU9 Q;  4LF9 Q;  4X65 Q;  3UDG A;  1VCI A;  3DEP A;  1X32 A;  4QIW B;  1VQ5 A;  1LT6 D;  1Q90 A;  3S1R B;  5I6Y A;  1I4R A;  1U4M A;  5C6A A;  1VQM A;  1F2M A;  4Q0F A;  1DOK A;  3K7A H;  3J7Y W;  4ZKC B;  3RNU A;  3FVQ A;  3BJU A;  3H0G B;  2KQ3 A;  2SEB D;  3M7G A;  1K83 H;  1Q8K A;  3I73 A;  4P71 A;  2HT1 A;  1STN A;  1RKN A;  2V1C C;  5DAU A;  1SMX A;  1T5E A;  2PMZ B;  1FD7 D;  1WD1 A;  2K5D A;  3AFQ A;  2UXB Q;  1DD2 A;  1YNX A;  2H1E A;  2RA4 A;  1L0W A;  1SE4 A;  2NUC A;  5J39 A;  1PV4 A;  3E0J A;  3EJI A;  4O1N A;  2F0J A;  3K5N A;  1PTO H;  4CJ1 B;  1E2Z A;  4JI4 L;  1H9R A;  2MNA A;  2QA4 A;  3D4W A;  4F7X A;  3I7F A;  4NPS A;  3ND9 A;  5M3M G;  2I0Q A;  4ME5 A;  4MZ9 A;  1Z6H A;  1H9S B;  1PMR A;  1XWE A;  1PFS A;  3MXP A;  4UP7 A;  1K8G A;  1SNP A;  4A93 G;  5I2Y A;  4F8M A;  5KNB A;  3STB D;  1LTB D;  5LL6 X;  3OW7 A;  4PMB A;  4BS9 A;  5IP7 G;  3J81 E;  4A3M H;  1KC8 C;  3RZD B;  5IY0 A;  4DA2 A;  4HMI A;  3AB9 A;  4RGM A;  3ER0 A;  4BA2 I;  5M5W B;  4P72 A;  2NZH A;  5K5P A;  1H9J A;  4GOP B;  1Y1W B;  1IHZ A;  3KLW A;  4LF5 L;  1SYD A;  1XYI A;  5FO7 B;  3D6W A;  2E2J H;  2L15 A;  1X55 A;  2E5L Q;  4NXN L;  4POF A;  3NBH B;  2J0T D;  1Y8O B;  4OO1 I;  3G48 A;  3HG9 A;  1H9K A;  3NEM A;  4O0A A;  2MP1 A;  2EXZ A;  2LS0 1;  3FMC A;  1D1I A;  4N9P A;  2JA5 B;  2LMC B;  1D5M C;  3CC2 A;  4BBR B;  3A5Z B;  3RLO A;  2EIF A;  1HFG A;  4DR7 L;  3PF5 A;  2NVX H;  4KD3 A;  3RZD H;  4B9W A;  5C4Z A;  4AYB E;  4G7H C;  1KAB A;  5M5W H;  2AWN A;  1ZEQ X;  2K5Q A;  3SHL A;  3MTS A;  2P5Z X;  1VQ4 A;  4BXX G;  1QE6 A;  1X3P A;  4LUO A;  2ZM6 Q;  4C3H B;  1EWH A;  5CBA E;  4ID6 A;  3VYT A;  4C3I G;  2ID0 A;  3R2I A;  4RG1 A;  3K5L A;  3CW2 C;  2UXD L;  5JEA G;  2XRS D;  1SXT A;  2R92 H;  2XTI A;  1TWF B;  4B08 A;  2RDH A;  5GAD C;  4FXK C;  4JI0 Q;  3TRZ A;  1JT8 A;  1RJT A;  3HKZ E;  3L3O C;  1L1O A;  2EPB A;  1I6H H;  1VQH A;  1EWI A;  4DV7 Q;  2I5H A;  3J81 c;  3FDT A;  4L6T B;  3GTO H;  5T1I A;  4ZCK A;  1SE3 A;  2KA7 A;  1J5E L;  1X56 A;  1FNW A;  2A5H A;  4I7Z C;  4JG2 A;  4KLK A;  1DZ1 A;  2NVT H;  1CM9 A;  1MSH A;  3CCL A;  1CFM A;  1XPU A;  2UUA Q;  3TEH B;  3T16 A;  2O4X A;  2PO4 A;  3V05 A;  4LFB Q;  5K36 G;  3PUV A;  4EGV A;  1HNX L;  3QJY A;  3CRK C;  3NK9 A;  1SLJ A;  2F0L A;  5FK9 C;  4TRD A;  3K59 A;  3SDZ A;  5COY A;  3K0X A;  3HFZ B;  3UDX A;  3NTH A;  4HN7 A;  5JJL A;  3I56 A;  1AZP A;  4A3E B;  1PFN A;  2ALY B;  1N36 L;  1D1K A;  4DAV A;  4KKS A;  1E24 A;  3NUC A;  1EOV A;  5ELO A;  1S72 A;  2HQE A;  4K6D A;  3MFY A;  1CUK A;  1I94 Q;  4DV6 Q;  1Z7T A;  2H4O A;  2EZV A;  3PO3 G;  3FEW X;  4U68 A;  5C0X G;  4E6I A;  1LUZ A;  1F2L A;  3MA2 B;  1SDF A;  2KJX A;  1VQ7 A;  5I9P A;  3VYU A;  5CMD A;  2EY1 A;  4RHS A;  1BNZ A;  1UUP A;  5DLQ E;  3W1B A;  2CHB D;  3LWU A;  2PZT A;  3CCM A;  4B3R L;  5M3F B;  3CAM A;  4IN3 A;  1SJE D;  3PMF A;  3UDI A;  1CKO A;  4BY7 G;  3P75 A;  4JI1 L;  4XIG S;  4C3J B;  3CQZ B;  4YHH L;  2G9D A;  1GUG A;  5ELF A;  1WI5 A;  4DV1 L;  1A62 A;  2OTJ A;  4LFC Q;  3G6J B;  1UNS A;  1V1P B;  4DN4 M;  4GNX C;  4DR3 Q;  4JV5 L;  1MI2 A;  3I55 A;  4Y52 H;  3HOV H;  1U4P A;  3T1H L;  1I50 B;  1BKB A;  1UEA B;  3TN2 A;  4A3F B;  2LXJ A;  1FGU A;  1SN8 A;  1QIL A;  1ENA A;  3GD7 A;  2RSO A;  4X3T A;  4FF3 A;  3U4V A;  4A3I G;  3U9S A;  4DAY B;  1QZG A;  4DR1 L;  3ZYY X;  2F52 A;  1QG7 A;  2G9H D;  1GHK A;  1PYS B;  1STA A;  2KCM A;  2BA1 A;  4HSV A;  3I3C A;  1WVL A;  3M3Y H;  1BQQ T;  3M4O H;  1IBK L;  3DWA A;  5LMU L;  1CQF A;  1DJR D;  1MBY A;  3ND8 A;  1F2Y A;  3CQZ H;  5JJK A;  2B2V C;  3HOU G;  2EYM A;  2LFN A;  3RMH A;  1ET9 A;  2E75 C;  3WWV A;  3PQI A;  2MFI A;  4RA8 A;  2TMP A;  1GD7 A;  2Z0S A;  2B63 B;  1X6O A;  4ZQ3 A;  2KHJ A;  3L7Z C;  4AYB B;  2F0N A;  4CDC C;  4A3F H;  3STB C;  4DV3 L;  3PO2 H;  3LGJ A;  4MTK A;  1EZ8 A;  3RD4 A;  4BBS G;  1MD2 D;  1WCM G;  2RDG A;  1PZJ D;  4IFD I;  3S16 B;  1GO3 E;  3M4Y A;  4B3M Q;  2RVL A;  5G3L F;  1K73 C;  4TSS A;  4C1N K;  4KMU C;  1EY5 A;  2B3G A;  1Q1B A;  1LT4 D;  5ELC A;  1FJG Q;  3KLS X;  1AFP A;  4OWX B;  2ZXR A;  1DGS A;  3VR6 A;  2Z9H A;  3KF6 A;  4A3J H;  2FMC A;  4ZAI A;  4YCV A;  1XMQ L;  3Q24 A;  3N6R A;  2JEB I;  1HQM C;  4M8A A;  1HXY D;  4CKB A;  3QB3 A;  4HAE A;  3HOX B;  4JI3 Q;  1E1O A;  2RF4 A;  1C9O A;  1A8V A;  1BR9 A;  1LAC A;  2G5D A;  3H15 A;  5FLX L;  3J7A 5;  3KUP A;  2Z4H A;  1ASZ A;  2BE5 D;  1IBL Q;  1VF5 C;  2Q2T A;  1QJO A;  4Y7N H;  4TVA B;  1CT1 D;  2IY5 B;  1SYB A;  1HZA A;  1HZC A;  2IX3 A;  4YCU A;  4OWW B;  3I4N B;  4ZKB B;  2R7F A;  3K81 C;  1JE5 A;  3DXJ C;  2L9H A;  2GN5 A;  3TBI B;  4X3K A;  4K5W A;  4R8N A;  1VQA A;  4K0K L;  5TSS A;  2UU9 L;  4LUZ A;  4ILW A;  4LF9 L;  4X65 L;  2IHE A;  1OXU A;  1M1K C;  2M9V A;  2N55 A;  1E1T A;  1LAB A;  2F0G A;  3PUY A;  2L1B A;  3EVQ A;  4RGT A;  2WP8 J;  1TS2 A;  2YU9 H;  3HOX H;  4FO2 A;  1EFI D;  1Q1E A;  1PYW D;  4BXX H;  1KLG D;  2J4X A;  4LW1 A;  3QOL A;  1HZ9 A;  5C5M A;  5IGB A;  4A75 A;  2A1A A;  2A8V A;  5I4D A;  3SK8 A;  3GTG H;  4KJN A;  2JA8 G;  5EKK A;  2PI2 A;  5ELB A;  1EY0 A;  4POG A;  4DV4 Q;  2QW7 A;  2NYZ D;  3CCS A;  4DR2 Q;  2J7Z A;  1HR0 Q;  1B50 A;  2NVY H;  1X9N A;  2UXB L;  3IL8 A;  5IT9 L;  2QIL A;  1WTO A;  1BCP F;  4A3K B;  3KDF B;  1YHB A;  4LJZ C;  2F0U A;  1XNQ Q;  5IP9 H;  3H0G G;  3URY A;  5KYL A;  4OEM B;  3PUZ A;  1YVC A;  4RCO A;  1EU4 A;  4A3M G;  2Y0S E;  3S1N H;  4U67 3;  4HSP A;  2R7Z H;  1EY7 A;  5C44 B;  2Z8L A;  1EWC A;  1SRO A;  3NHH A;  4GNX A;  4HCE A;  4DV0 Q;  1G91 A;  2L4N A;  2EQS A;  1EQV A;  1V1O A;  1N33 Q;  5E4W C;  4ZYS A;  1YHA A;  5K36 H;  2F4V Q;  2RSN A;  4IOA A;  3GTQ B;  2FIN B;  3PUX A;  2JA7 B;  4KJO A;  2NVQ B;  3MZ5 A;  3GTM H;  1U4R A;  1PRT F;  5CV4 A;  4FXG C;  3HEJ A;  3NTK A;  2E5L L;  5L37 A;  2JA6 B;  3RUZ A;  4O2D A;  4ZRZ A;  1B8A A;  3Q0A A;  1TS3 A;  2Z6B A;  4ME3 A;  1C48 A;  2E8G A;  2MGS A;  4H13 C;  2OT2 A;  5C44 H;  4L5Q A;  4JBJ A;  5IYB G;  5D3I B;  1NSN S;  1R9T B;  3CRL C;  3KJO A;  4B3R Q;  2AQ3 B;  4YCW A;  3PO3 H;  3GO5 A;  2C9O A;  1CKN A;  5C0X H;  4IUQ A;  5IE8 A;  3ERQ A;  4A3C G;  2WKD A;  2YV5 A;  1EUJ A;  1STB A;  4K6L A;  4LK1 C;  4IUT A;  2QF7 A;  2NVQ H;  1ILP A;  1AN8 A;  3D4D A;  4PZ6 A;  2R92 G;  4IPC A;  3C2P A;  1EIF A;  1SNC A;  4HJ5 A;  2IX0 A;  2DN8 A;  5FO8 B;  4JPB W;  3FKI H;  1HQR D;  3NE5 B;  4NMZ A;  3R8B A;  3EFX D;  5E3F A;  3JAM L;  2EJG C;  4JI0 L;  4H0L C;  1TWH H;  5CV5 A;  3DM1 A;  5EBD A;  4C1N I;  2SDF A;  2XRQ D;  5ISR A;  2ZTD A;  3W1G A;  5FLX E;  1VQ8 A;  4DV7 L;  3ONA B;  3S2D H;  2XN9 C;  2JQO A;  2WFW A;  2OF1 A;  3TP8 A;  3GTP H;  3NWS A;  2D62 A;  4ODG A;  1XTD A;  2AKW B;  3MXN A;  4IUR A;  2ZXO A;  2FMM A;  1X3F A;  5C4J B;  3I72 A;  4IPD A;  1Z9F A;  2UUA L;  1EYD A;  5IGF A;  4JYA Q;  3HOZ B;  2O5I C;  2WB1 E;  4LFB L;  2RHS B;  3Q22 A;  3CC7 A;  1KDC A;  1NTG A;  4DV5 Q;  3HP3 A;  1MJE A;  3AFP A;  2DNC A;  5C4H A;  3NWT A;  1STG A;  1PHJ A;  2F3V A;  2PNH A;  5M5X B;  4DPG A;  1PXU A;  2AQ1 B;  1LO5 D;  5H1S E;  1QOH A;  1VQP A;  1FYC A;  3GQB A;  1JCK B;  5KIX A;  1RDP D;  2GA4 B;  3E9I A;  4RWS C;  1EQQ A;  2R93 B;  4M1U B;  2F1M A;  4B3T Q;  3SVM A;  3EA6 A;  5IT9 E;  4DXG A;  2F0H A;  1EL0 A;  3PSI A;  1I94 L;  5LL6 S;  1GKH A;  4DV6 L;  1FVI A;  4P73 A;  1IYU A;  2CFM A;  2BE5 C;  5DEH A;  1J9O A;  1PH5 A;  3GDE A;  2CH4 A;  2WV6 D;  1K8A C;  3OWF A;  5JPM C;  1TXY A;  2EDG A;  4GOP C;  1PZK D;  3B6Y A;  1CI3 M;  1DOM A;  3QO2 A;  1FR3 A;  2WAQ E;  1ICF B;  1VQJ A;  2Y0S B;  2EVB A;  4MN3 A;  3RLN A;  3HOV G;  1C4Q A;  3AEV A;  5FLX c;  3CXC A;  2PW5 A;  3KBG A;  2L0C A;  3S1M B;  1TWC H;  1V8Q A;  3NQT A;  4BA1 I;  4LFC L;  2BDN A;  5C3E H;  2K32 A;  4N8X 1;  3CD6 A;  4H44 C;  4DR3 L;  1SEB D;  1SND A;  5D3D A;  3AU7 A;  1VQB A;  2PQA A;  3MVV A;  1HFN A;  2VUM H;  4C2M H;  1DM0 B;  1S5E D;  3C1F A;  3GTJ H;  3F2B A;  1EZ6 A;  1TR5 A;  1HPC A;  3QWN A;  3WOF A;  3H3V C;  4C3J G;  4K14 A;  2HD3 A;  3I4L A;  4YY3 Q;  1TT2 A;  1OTC A;  4S3S A;  5EGT A;  1XTC D;  4L5R C;  2EJF C;  3MXU A;  3Q23 A;  1TY2 A;  5ELE A;  3D31 A;  3UE1 A;  5M5Y B;  4RGO S;  3RZO B;  1WTW A;  4ALP A;  5IGG A;  1TKW B;  1EY8 A;  5IGC A;  1KNA A;  2A69 D;  2EYF A;  4A3F G;  3PO2 G;  4BY1 B;  2NN6 H;  3SK5 A;  4R1J A;  2JA8 H;  2K52 A;  3SXH A;  3S17 H;  4PV1 C;  5JAV A;  1G6P A;  1BDO A;  5BN3 A;  5IT9 c;  3CCE A;  3D3R A;  1UAP A;  3S1R H;  1RF2 D;  3I91 A;  2ATW A;  4ULL A;  1KTK A;  3S15 B;  4FDB A;  3AMU A;  4X64 Q;  1D2B A;  1WTP A;  3OIQ A;  5EAY A;  2K05 A;  3H0G H;  1RTN A;  1S40 A;  5CV8 A;  4DR4 Q;  1CA6 A;  4B3S Q;  3JAM E;  4B3M L;  1IKL A;  1VQF A;  4A3J G;  1S4Z A;  3DMU A;  1EIH A;  4IFD J;  2I46 A;  1K9M C;  3QOJ A;  1EU3 A;  1STE A;  4OHJ A;  1FJG L;  5CBE E;  1N32 Q;  1VF7 A;  3A7A B;  1VS0 A;  1IYJ B;  4EQ5 A;  1PTO F;  1W3S A;  5M9O A;  4RKB A;  3T56 B;  3TDQ A;  2JXM B;  4APV A;  1QNK A;  2Q8R E;  4JI3 L;  4DF7 A;  1YZ6 A;  4IJH A;  4YWM A;  5GAH C;  2KBN A;  1ASY A;  3TSS A;  2B2Y A;  3SK6 A;  4J8Q A;  2CQA A;  4A3L H;  1IBL L;  5C3X A;  2E2D C;  1K3B C;  1U4L A;  1BOS A;  2R6G A;  2WB1 B;  1IL2 A;  1OXV A;  4PG3 A;  2V4D A;  5IYC H;  5IYB H;  3HOX G;  5KNC A;  1PH3 A;  2F0M A;  3GTK B;  3KLR A;  1BVS A;  1KD1 C;  2N78 A;  1Y1W H;  2O5J C;  3HOW B;  1AE2 A;  2N88 A;  4JOI C;  2N3S A;  5DM7 3;  4PZ8 A;  3WDN A;  1LV9 A;  1OXT A;  1JE4 A;  4A3C H;  3TRE A;  3CPW A;  5IOC A;  4NXM Q;  4R4C A;  1VQE A;  1TS4 A;  1H9S A;  3PIO A;  4QY7 A;  4K8J A;  4OL7 A;  1BF4 A;  2BH8 A;  1AE3 A;  2KEE A;  4IPH A;  4DR5 Q;  1GXD C;  1O78 A;  2JE6 I;  1I3Q B;  3VA5 A;  2JA5 H;  2F0I A;  4YIJ A;  1YNJ D;  3E6Z X;  4BBR H;  5IP9 G;  3A5U A;  4DV4 L;  4DR2 L;  2A68 D;  2SOB A;  1JOO A;  1Q3L A;  1HR0 L;  3CMA A;  3LNN A;  2D0P A;  3H3V H;  1O7I A;  2R7Z G;  3P1H A;  1XNQ L;  3A8I E;  4IPG A;  2WAQ B;  3GP7 A;  5E1F A;  4C3H H;  3OWE B;  1HR0 W;  4OX9 L;  4XT1 B;  3NBH A;  1YI2 A;  2F0K A;  3IAY A;  2K5V A;  3TP7 A;  2CCZ A;  4R4I A;  3OMG A;  5IIF A;  2HCI A;  3R2T A;  1TWF H;  1A63 A;  3UE0 A;  1Q12 A;  1A2T A;  3K80 C;  5JOB A;  1W6J A;  4YWK A;  5C4X B;  1KNE A;  4DV0 L;  5KGU A;  2Q2H A;  3LX0 A;  3FP9 A;  2F0P A;  1N33 L;  4F88 A;  1M90 C;  2ZT9 C;  1LYL A;  2A6E D;  2F4V L;  1TWA B;  2DNE A;  2SNS A;  5LMN Q;  1ONL A;  3F8T A;  5GAE C;  4KN7 C;  5C44 G;  1G29 1;  4IJL A;  3K58 A;  4DXF A;  1GUO A;  5EQ0 A;  3NTI A;  5C0X I;  1Y69 U;  3A8K E;  4LUV A;  3OHX C;  4GN4 B;  2BDO A;  1GUW A;  2MQH A;  2E2H B;  4KD4 A;  1XNR Q;  1P16 A;  3TME A;  1E2V A;  2JA7 G;  3BDC A;  4KHV A;  1GUS A;  4R9W A;  4V0B A;  2L55 A;  2AUJ D;  3PGZ A;  4A4I A;  3BVM A;  5CV6 A;  4NDX A;  1BXT A;  4QF4 A;  4FF2 A;  3I4M B;  2KCC A;  4QJF A;  3T13 A;  2PPB C;  1SYE A;  3CP0 A;  3FKI G;  4A3E H;  1SE2 A;  1I4X A;  1K28 A;  1JR0 D;  5HGQ A;  1B9M A;  3PV0 A;  2B2U C;  4CGY B;  3S9W A;  4P74 A;  1KDB A;  2XWB B;  4PMW A;  2PYK A;  2F0E A;  4DAP A;  2BOS A;  3ULL A;  1VQO A;  1IW7 D;  1HNW Q;  2E2H H;  4RGN A;  1M4V A;  2HIV A;  3A0J A;  2ZJP A;  2B29 A;  5JJZ A;  4X3U A;  3S14 B;  2N8N A;  4IUV A;  1O7L A;  4RKL A;  2A69 C;  1HCZ A;  1N9W A;  5M3F H;  3HZX A;  5IOD A;  4DK6 C;  1ENF A;  1YHQ A;  1QNU A;  2R7D A;  5EBC A;  1RTO A;  5CV9 A;  4UPA A;  4C3J H;  3H91 A;  1X3G A;  2TSS A;  1JIC A;  4JI2 Q;  3VR3 A;  2KOL A;  4X3S A;  3GV6 A;  1A3V A;  3IRB A;  3EN2 A;  1TWG B;  4JI6 L;  2WAC A;  2YTX A;  2F0V A;  1G51 A;  1VQC A;  3J80 i;  3J7A V;  2QEX A;  1SYF A;  4JYA L;  4A3B B;  1I50 H;  3FPU B;  3MXG A;  3EIV A;  5AFW A;  5M3M B;  3D6C A;  3CPF A;  3Q8D A;  4DV5 L;  3IFT A;  3OOC A;  1PH6 A;  3RN2 A;  4JOI A;  3T53 B;  4A93 B;  1XPR A;  1W6K A;  3NEL A;  1Y14 B;  4LF7 Q;  1LT5 D;  5FLM H;  5EKL A;  4CDF C;  2EXD A;  3HOZ G;  2KED A;  2JYO A;  3WOE A;  4HCS A;  1D8L A;  4B3T L;  3HKZ B;  2E76 C;  3G7L A;  1E22 A;  4LF6 Q;  1V1P A;  3DUZ A;  1KQS A;  3RN5 A;  2B63 H;  4LF8 Q;  3NEN A;  3SGI A;  3SR1 A;  4LF4 Q;  4ZUI A;  3MEH A;  1YNN D;  3HKS A;  4I65 A;  4DR6 Q;  1PDQ A;  1CZW A;  2X6G A;  1BCP B;  4JI8 Q;  4AQY Q;  3S16 H;  1B44 D;  5C3E G;  4DAY A;  4F87 A;  2NTT A;  1XMO Q;  2A6H D;  4JK1 C;  2VUM G;  2RCN A;  3I90 A;  2HHH Q;  1LTG D;  1RIP A;  2HDL A;  2BH2 A;  1JOQ A;  1YJW A;  4EQP A;  1VMC A;  2D2C C;  2EYL A;  4C3I B;  2R3Z A;  3IFD A;  4KK7 A;  3GV3 A;  4XXE A;  1ZKO A;  1YNJ C;  1X54 A;  4JI5 Q;  4IZ8 A;  3X3M A;  3CCJ A;  3F2D A;  2A68 C;  3MAQ A;  4MTN A;  4OO1 H;  2K1B A;  2NN6 G;  4OON A;  4YY3 L;  4JC0 A;  3KK7 A;  1ZYR D;  3OTO Q;  2WKC A;  1OO9 B;  4QQB X;  2MO1 A;  4KY7 A;  1HZB A;  1PRT B;  4DU9 A;  5ELN A;  2QDL A;  2EE1 A;  4GKJ Q;  2JN4 A;  4HJA A;  1CSQ A;  3I4N H;  3S2H B;  3CF5 A;  1C8C A;  1U5K A;  1A3U A;  1WTV A;  4LFA Q;  4I7A A;  2ENB A;  2Z6K C;  5EPJ A;  3BVG A;  4GN5 A;  3BU2 A;  1F9P A;  2AHO B;  5AJ3 Q;  4DFA A;  1B3Q A;  4KY6 A;  5BN4 A;  3HOY B;  4OX9 Q;  4N8F A;  3W3A A;  1SMY D;  1SSO A;  4DUY Q;  1SFO B;  2D9U A;  1Q81 C;  1UWV A;  1VDZ A;  4X64 L;  3I2Z A;  3HS0 C;  1FGB D;  2A6E C;  4K2K A;  4PQX A;  4BY1 G;  2SNM A;  4RH6 A;  4DR4 L;  2IPK D;  3K7U C;  1MJC A;  1L2F A;  1LT3 D;  4R4O A;  1S5F D;  4B3S L;  2KCT A;  1EY4 A;  4MNO A;  3BDL A;  1EQT A;  1S5C D;  1AW7 A;  1MSG A;  3C46 A;  3W5O A;  3M4Q A;  2KUM A;  5C5L A;  4J15 A;  5CGK A;  1YIT A;  1H95 A;  3V96 A;  4A3K H;  1N32 L;  3P20 A;  1HUN A;  1QUQ A;  1EIG A;  4KHZ A;  1CTM A;  2N49 A;  1JOK A;  4JVZ A;  3CC4 A;  1PFM A;  1H9M A;  4KHP L;  2VNU D;  2VW9 A;  4K2L A;  3HOY H;  4A3L G;  3VDY A;  2OQK A;  1FNU A;  4J6H A;  1B53 A;  5D65 A;  2F3I A;  1LLR D;  4OWT B;  2B2V A;  4G7Z C;  5IYC G;  1Y1V B;  2XIW A;  1B4O A;  3D0F A;  2RDF A;  4P2C B;  1Y1W G;  5EPK A;  3L2P A;  1LTL A;  3MHB A;  4UHV A;  1WTQ A;  3BDO A;  2VXW A;  4BY7 B;  2KHI A;  4GZY C;  2UXC Q;  5E4X A;  5JVH 3;  1JOR A;  3GTQ H;  2JA7 H;  3TQY A;  1CK1 A;  3HRZ C;  2PMZ E;  2F4I A;  3KDF A;  4NKL A;  1IW7 C;  2K6A A;  4UP9 A;  3NXW A;  1BUV T;  5I2X A;  4WJ4 A;  2ZTC A;  4GKK Q;  2JA6 H;  4DK1 A;  2JA5 G;  3SEB A;  3PIP 3;  4BBR G;  4Q5V A;  4NXM L;  1K8O A;  3HGB A;  4UDU C;  3NBI A;  2WII B;  3S1Q B;  5JEA J;  1HTP A;  1NUC A;  4WFN 3;  3ZJY C;  1U9R A;  1R9T H;  4A3I B;  4DR5 L;  2A19 A;  4A3G B;  4OXP A;  2UUB Q;  1HA5 A;  4JBW A;  3VYR A;  4C3H G;  1I4G A;  4RCN A;  1VQL A;  3LWE A;  2NTS A;  4A3D B;  3I4O A;  1L0Y B;  1GUT A;  3HOU B;  2QGQ A;  4JI6 Q;  4JI7 Q;  1G8Z D;  5A35 A;  2C35 B;  4HED A;  3KOJ A;  5IWA L;  3N52 A;  3CHB D;  4IUN A;  3VR5 A;  4CHT B;  1GJX A;  2RKS A;  1QCB D;  1SYC A;  1X65 A;  2CWA A;  1PA6 A;  2IW3 A;  3KF8 B;  3S1Q H;  2B8F A;  1X3E A;  4BBS B;  5KEE A;  1WCM B;  2DY7 A;  3A55 A;  4JBM A;  4FNF A;  2CW0 D;  2F0Q A;  3P7J A;  1HA6 A;  3A74 A;  1YBY A;  2HCC A;  5JJI A;  4QL5 A;  1NBW A;  2L11 A;  2VZA A;  1ENC A;  5LMN L;  1KHI A;  3RR5 A;  4IAL A;  3GTL B;  1RCV D;  1F9R A;  2C5C A;  4TQU S;  4NP5 A;  5C4J H;  2M00 A;  1YNN C;  4K5V A;  1F77 A;  4H02 A;  5JVG 3;  3HOZ H;  5LMN W;  3G71 A;  1LTS D;  3U9O A;  4QMG A;  1OXS C;  1XNR L;  2A6H C;  1WFQ A;  1QVG A;  2GVA A;  4A3E G;  2K33 A;  2EY2 A;  2Z6K A;  3R93 A;  5IYD H;  1A6X A;  4DK3 C;  1BBW A;  2M2L A;  5CC4 A;  4XQJ A;  3H94 A;  2JSO A;  5KYI A;  5M5X H;  1EEI D;  2K04 A;  3IKJ A;  1DYQ A;  4CBV A;  4IFD H;  2YYZ A;  3KBX A;  1GUN A;  2JP1 A;  4DAM A;  1HH2 P;  2AQ2 B;  4R8I A;  2UUC Q;  4DV2 Q;  5FJ8 H;  2R93 H;  1ILQ A;  1NCV A;  3VR4 A;  1GVP A;  3K7A B;  4G57 A;  1VQN A;  4AIM A;  2B2W C;  5KND A;  4GLV B;  1HNZ Q;  1WTX A;  1SAP A;  3EBE A;  1AP0 A;  1SR3 A;  5DNF A;  1E3P A;  1K83 B;  1JB3 A;  5M3F G;  3PCO B;  1ZYR C;  2EYH A;  3OSO A;  1KRT A;  4QUC A;  3TP5 A;  3KLS A;  1D7Q A;  1HNW L;  1BCP D;  1E0B A;  4FF4 A;  1A0I A;  5EJW A;  1HJP A;  3M85 A;  1EIY B;  4CKE A;  1V9P A;  3FPP A;  3J81 i;  2IHF A;  2EJM A;  2PZW A;  1CHP D;  2RQX A;  1PTO B;  1A15 A;  1IZ6 A;  1XX8 A;  3CCR A;  4P75 A;  2VL6 A;  4G4K A;  1V43 A;  5BR8 Q;  2VS1 A;  2ZTE A;  4JI2 L;  3F2C A;  4RAU C;  3S1M H;  1I4Q A;  1WYD A;  4HIM A;  4FF1 A;  1SMY C;  2A74 C;  2NZ1 D;  2Q2I A;  4KKT A;  2HQL A;  4L63 B;  1ML0 D;  2D0O A;  5A2Q L;  5EPL A;  1AEX A;  2MPM A;  3A7L A;  1GHJ A;  1O80 A;  2DUD A;  4RHR A;  5FLM G;  4A3M B;  2AUK A;  3ITP A;  4XDX A;  2F0W A;  2BA0 A;  4EQO A;  2L5T A;  2XNA C;  1JWU D;  1PRT D;  1CQV A;  3DEO A;  5DM6 3;  1U0L A;  1N34 Q;  4LF7 L;  3KFU A;  5M5Y H;  3RZO H;  4CJ0 B;  2E2J B;  1UE7 A;  2B63 G;  4A3B G;  2K5N A;  1KDA A;  4TKO B;  4AYB G;  2B8G A;  1SNO A;  1JC7 A;  4BY1 H;  1O7Z A;  5J3B A;  2K50 A;  2HDM A;  4L8J A;  3T4A C;  2K28 A;  4OIJ A;  4LF6 L;  4KHP Q;  2BCO A;  2A73 B;  1L1O B;  1PFB A;  2RCF A;  4NB3 A;  2EYJ A;  4DUZ Q;  4LF8 L;  2NVX B;  3S15 H;  1K3R A;  1JJ2 A;  4LF4 L;  1JWS D;  3VR2 A;  1VMP A;  3NQI A;  2LXK A;  4DR6 L;  3TS2 A;  4JI8 L;  4AQY L;  2WIN B;  1NR2 A;  4LAA A;  3HKZ G;  4XYQ A;  4WOR A;  2K5H A;  1QZH A;  1NAP A;  1XMO L;  3DWQ A;  4LNQ A;  3BZD B;  2XWJ B;  2HHH L;  2OCE A;  1DOL A;  1G2S A;  1S5D D;  2R92 B;  1CZG A;  4OO1 G;  4WJW A;  5GAG C;  2K5W A;  1MGS A;  2B2T C;  4UP8 A;  2KEC A;  1YEZ A;  1MKH A;  1I6H B;  5E7N A;  4CJ2 C;  4KTA A;  3RLF A;  4DNI A;  3MWY W;  1AZQ A;  1W2B A;  4JI5 L;  3GTO B;  1II3 A;  3I4N G;  2DJG C;  3OW2 A;  1RHP A;  1T9H A;  2F0F A;  3OTO L;  4MIU A;  3K0Y A;  4XYO A;  2QEJ C;  1TS5 A;  5NUC A;  3BZC A;  4V19 0;  2NVT B;  1IYV A;  3T1Y Q;  3OPO A;  2PI2 E;  2FFK B;  1ESF A;  3JAM c;  4OIK A;  3ERO A;  4XQN A;  4GKJ L;  1HUM A;  3SK4 A;  4G7O C;  1B2T A;  3GTK H;  3PIO 3;  2H5X A;  3OYY A;  4GOP A;  3E9H A;  3HOW H;  4LFA L;  2FXQ A;  3V2T A;  2EYP A;  5I9O A;  5IWA Q;  5AJ3 L;  1EY6 A;  1J6Q A;  1IXR A;  4ZLT F;  1QWY A;  2CW0 C;  2XVS A;  2Z1C A;  4DUY L;  1B1Z A;  4MHE A;  4A3K G;  1CHQ D;  2B2W A;  2CQO A;  3J80 L;  2XSC A;  4FP5 D;  4HMJ A;  1I3Q H;  5HY6 A;  5C3W A;  4K5X A;  2CH4 W;  2LSS A;  1J8I A;  5T1G A;  1PYB A;  3HOY G;  4H7B A;  1YIJ A;  1B9N A;  1AH9 A;  2O2L D;  2IX1 A;  1PH2 A;  3ERS X;  3E5S A;  1S5B D;  1A2U A;  1LTT D;  3E0E A;  3JC6 6;  2NB0 A;  4X66 Q;  1B7Y B;  3O13 A;  3CCV A;  2VB2 X;  3U4Z A;  5FOB B;  2JEA I;  2VQE Q;  5CV7 A;  5A2Q E;  3S24 A;  2MJ8 A;  3QG1 A;  3H6M A;  3L0O A;  2Q2U A;  1R4P B;  2F0O A;  1E7Z A;  2R61 A;  4OEL B;  4PNY A;  2ZXP A;  3M4P A;  5C4X H;  1TVX A;  4QCL A;  2VQF Q;  1RL2 A;  1PH8 A;  1VQK A;  2GVB A;  2OTL A;  4GN3 B;  1YJ9 A;  3HOV B;  1D5Z C;  1KIX A;  2JA6 G;  1TWA H;  5IGD A;  2ASB A;  2UXC L;  3TZD A;  2PZU A;  3KJP A;  3K5M A;  1F9Q A;  1RD9 D;  3R3O A;  3BYY B;  3M7N A;  1Y1V G;  1BCP C;  3D8G A;  1HHV A;  2QKI C;  4GKK L;  1Z47 A;  1NR4 A;  3ULP A;  4B9X A;  1IBM Q;  1TII D;  2F3W A;  1SNQ A;  2Q8I B;  3M4O B;  3CME A;  3M3Y B;  2PQE A;  1JJG A;  4J1M A;  3C3L A;  5J22 A;  1QVF A;  1ROD A;  2MO0 A;  4IO9 A;  1B3A A;  1EYG A;  3KF6 B;  1SJH D;  2UUB L;  2F03 A;  3I4M H;  5GQO A;  4DGZ A;  3EQL C;  1TU2 B;  4EQN A;  4A76 A;  3PO2 B;  3OIP A;  1I6V C;  2LKV A;  3ICE A;  1ZXT A;  1Q8I A;  2KVM A;  5LHY 1;  4JI7 L;  3K8A A;  1SE8 A;  5IGE A;  2KCN A;  1C7Y A;  3J7Z C;  2IT1 A;  1Y8P B;  4RMF A;  3T51 B;  1PRT C;  4A3G G;  4XQQ A;  4HIO A;  2K01 A;  4R4Q A;  3K6O A;  5GRO A;  4LWC A;  3TZU A;  4X62 L;  2IL8 A;  4L5T A;  3BS1 A;  2RHQ B;  4A3D G;  1PZI D; 
#chains in the Genus database with same CATH homology
 1VQJ A;  2JJQ A;  3CW2 C;  4KHP L;  2UXD L;  3S14 H;  5JEA G;  3RLN A;  3HOV G;  2R92 H;  1K0R A;  2XTI A;  2VW9 A;  2VNU D;  3AEV A;  3HOY H;  4A3L G;  5FLX c;  3CXC A;  3VDY A;  5GAD C;  4JI0 Q;  2OQK A;  3TRZ A;  1JT8 A;  4JI4 Q;  1TWC H;  4B3S L;  2F3I A;  4BA1 I;  3HKZ E;  4OWT B;  4XTC S;  1L1O A;  4LFC L;  5IYC G;  5C3E H;  1I6H H;  3CD6 A;  1VQH A;  4DR3 L;  4HJ8 A;  3D0F A;  1EWI A;  4DV7 Q;  2I5H A;  1VQB A;  3J81 c;  1Y1W G;  2PQA A;  3KYH C;  3AQQ A;  1TWG H;  2CKZ B;  1LTL A;  3L2P A;  2VUM H;  3GTO H;  4C2M H;  3GTJ H;  2OWO A;  3F2B A;  5IYD G;  1UE6 A;  1NY4 A;  1J5E L;  1X56 A;  2KHI A;  4JG2 A;  2UXC Q;  4A3B H;  4KLK A;  3GTQ H;  4JCV E;  2JA7 H;  2NVT H;  4YY3 Q;  3CCL A;  3TQY A;  4IFD G;  1XPU A;  5M3M H;  1OTC A;  2PMZ E;  2UUA Q;  4L5R C;  3KDF A;  3TEH B;  2AMC B;  3D31 A;  3UE1 A;  4UP9 A;  5FJ8 G;  2R93 G;  4LFB Q;  4ALP A;  5K36 G;  1BBU A;  4A93 H;  4WJ4 A;  3PUV A;  2ZTC A;  1HNX L;  4GKK Q;  2JA6 H;  4LF5 Q;  2JA5 G;  3S1Q H;  5IP7 H;  3AYH B;  4BBR G;  3TS0 A;  4NXM L;  4A3F G;  3PO2 G;  1SLJ A;  3J81 j;  3PUW A;  4R1J A;  5JEA J;  4R4T A;  4NXN Q;  2K52 A;  2JA8 H;  3S17 H;  5IYD H;  1G6P A;  4DKA C;  2UUC L;  4DV2 L;  3K0X A;  4HJ7 A;  3ZJY C;  1R9T H;  3HFZ B;  3UDX A;  3ULJ A;  5IT9 c;  4DR5 L;  3CCE A;  2K14 A;  2A19 A;  2XGT A;  3I56 A;  1XJV A;  1Q7Y C;  3S1R H;  4OXP A;  2ATW A;  2UUB Q;  1HNZ L;  4L5S A;  4JBW A;  4GNX B;  2ALY B;  1N36 L;  4FDB A;  2JK8 A;  1VQL A;  4X64 Q;  1UEB A;  1E24 A;  5EAY A;  1EOV A;  3I4O A;  5ELO A;  1S72 A;  4YWL A;  4DR7 Q;  2Y0S G;  3H0G H;  1CUK A;  1S40 A;  1I94 Q;  2NN6 I;  2QGQ A;  4UY8 C;  4DR4 Q;  4JI6 Q;  4DV6 Q;  4JI7 Q;  4B3S Q;  3PO3 G;  1PH1 A;  4B3M L;  5C0X G;  1VQF A;  2YTY A;  3G6E A;  4A3J G;  1LUZ A;  1QUQ B;  4IFD J;  2C35 B;  1VQ7 A;  3KOJ A;  5IWA L;  1K9M C;  1FJG L;  1N32 Q;  1X65 A;  1VS0 A;  2CWA A;  5DLQ E;  1CKM A;  3KF8 B;  3W1B A;  1IYJ B;  1PA6 A;  1X3E A;  5BR8 L;  3CCM A;  4EQ5 A;  4B3R L;  3UDF A;  3CAM A;  2UXD Q;  4JBM A;  1W3S A;  3UDI A;  1CKO A;  3PF4 A;  4BY7 G;  4JI1 L;  4XIG S;  1LM0 A;  4APV A;  2DGY A;  3A74 A;  1YBY A;  5JJI A;  4YHH L;  1WI5 A;  4QL5 A;  4JI3 L;  4DV1 L;  1YZ6 A;  1A62 A;  2OTJ A;  1NBW A;  4IJH A;  4YWM A;  4C3I H;  2KBN A;  2VZA A;  5GAH C;  4LFC Q;  4JV5 L;  5LMN L;  1KHI A;  1CKN B;  3RR5 A;  4GNX C;  4DR3 Q;  1ASY A;  3I55 A;  4AH6 A;  4Y52 H;  3HOV H;  1S3O A;  4TQU S;  3T1H L;  1UE5 A;  4A3L H;  1IBL L;  1BKB A;  2ZJR A;  2LXJ A;  2R6G A;  1VQ9 A;  1IL2 A;  5C4J H;  1OXV A;  1J5E Q;  1VQI A;  1FGU A;  1SN8 A;  1N34 L;  4PG3 A;  1FL0 A;  3GD7 A;  4H02 A;  5IYC H;  3HOZ H;  5LMN W;  5IYB H;  3HOX G;  3MEF A;  3U50 C;  3G71 A;  1PH3 A;  1BVS A;  1KD1 C;  3U4V A;  4A3I G;  2N78 A;  1OXS C;  1Y1W H;  2AWO A;  4DAY B;  1QZG A;  1AE2 A;  4JOI C;  4DR1 L;  1WFQ A;  1XNR L;  2N3S A;  1QVG A;  2GVA A;  4A3E G;  4PZ8 A;  2F52 A;  3S2H H;  1PYS B;  2Z6K A;  2KCM A;  3J80 c;  1OXT A;  1BBW A;  2BA1 A;  4DK3 C;  3TRE A;  1HNX Q;  3M3Y H;  3M4O H;  4A3C H;  1IBK L;  3CPW A;  4NXM Q;  5M5X H;  5LMU L;  3CQZ H;  5JJK A;  4R4C A;  1VQE A;  3HOU G;  4PZ7 A;  2YYZ A;  4DAM A;  1HH2 P;  3PIO A;  1QVC A;  1JMC A;  3WWV A;  4QY7 A;  2UUC Q;  4DV2 Q;  2BH8 A;  5FJ8 H;  2MFI A;  2R93 H;  4DUZ L;  1AE3 A;  4QIW E;  4IPH A;  1SFO H;  1GD7 A;  2Z0S A;  1X6O A;  1GVP A;  4DR5 Q;  2KHJ A;  3L7Z C;  1VQN A;  2JE6 I;  4AIM A;  2JA5 H;  5IP9 G;  1VQG A;  4BBR H;  4GLV B;  4DV4 L;  1HNZ Q;  3A5U A;  4A3F H;  3STB C;  4DR2 L;  3EBE A;  4DV3 L;  3PO2 H;  3LGJ A;  1N36 Q;  1HR0 L;  1SR3 A;  3CMA A;  4EX5 A;  4BBS G;  3DLL A;  1E3P A;  3MXN B;  2D0P A;  5M3F G;  3H3V H;  1WCM G;  3PCO B;  1KRT A;  1D7Q A;  1O7I A;  4HJ9 A;  2R7Z G;  1HNW L;  4IFD I;  1GO3 E;  2VY3 A;  4KI0 A;  4B3M Q;  1PH7 A;  1A0I A;  1K73 C;  1XNQ L;  4IPG A;  1HJP A;  4C3H H;  3M85 A;  4HIK A;  1EIY B;  1V9P A;  1HR0 W;  3F1Z A;  2B3G A;  1Q1B A;  2IHF A;  3J81 i;  4OX9 L;  1YI2 A;  1FJG Q;  2K5V A;  1IZ6 A;  4OWX B;  3CCR A;  2CCZ A;  4R4I A;  3G4S A;  1DGS A;  2VL6 A;  4P75 A;  1V43 A;  5BR8 Q;  1TWF H;  2VS1 A;  2ZTE A;  3KF6 A;  3UE0 A;  1Q12 A;  1A63 A;  3K80 C;  3H3V I;  1KRS A;  2WB1 G;  3PIP A;  3F2C A;  4A3J H;  4JI2 L;  4JBK A;  3S1M H;  4JI7 L;  4YCV A;  4YWK A;  4JI1 Q;  1XMQ L;  1WYD A;  2JEB I;  4HIM A;  2Q2I A;  4DV0 L;  2OQ0 A;  2HQL A;  1Y1V H;  2D0O A;  2Q2H A;  1N33 L;  3FP9 A;  4YHH Q;  4JI3 Q;  1M90 C;  1E1O A;  4DV1 Q;  1LYL A;  3CCU A;  2F4V L;  1VQD A;  2RF4 A;  1C9O A;  1A8V A;  2DUD A;  3HOW G;  4JV5 Q;  5LMN Q;  5JJL A;  5FLM G;  3H15 A;  1NMG A;  2HIX A;  1SRU A;  3F8T A;  1KL9 A;  2ZM6 L;  3J7A 5;  3T1Y L;  1P8L A;  5GAE C;  3FHW A;  2BA0 A;  5C44 G;  1I5F A;  3T1H Q;  1G29 1;  4IJL A;  1ASZ A;  4BY7 H;  1IBL Q;  2Q2T A;  2E2I H;  1C0A A;  4GS3 A;  4Y7N H;  4WJ3 M;  3DM3 A;  1NJI C;  4TVA B;  1U0L A;  5C0X I;  3CCQ A;  3U58 A;  1N34 Q;  4LUV A;  2IY5 B;  2K75 A;  1HZA A;  4LF7 L;  1HZC A;  3KFU A;  4GN4 B;  4YCU A;  5M5Y H;  4OWW B;  2R7F A;  3RZO H;  3K81 C;  3I4M G;  1JE5 A;  1UE7 A;  2B63 G;  2GN5 A;  4GLX A;  2MQH A;  4A3B G;  1XNR Q;  4DR1 Q;  1VQA A;  2K5N A;  1P16 A;  2UU9 L;  4LUZ A;  4AYB G;  2JA7 G;  4K0K L;  4LF9 L;  4X65 L;  2IHE A;  1OXU A;  4BY1 H;  5J3B A;  4X62 Q;  1M1K C;  2K50 A;  1IBK Q;  1E1T A;  5LMU Q;  3PGZ A;  4GLA C;  3PUY A;  4A4I A;  4LF6 L;  4KHP Q;  1B70 B;  2CWP A;  2WP8 J;  2YU9 H;  3HOX H;  2I5M X;  3BZK A;  1L1O B;  1Q1E A;  4BXX H;  4A3I H;  1Q86 C;  1XPO A;  4X6A H;  2NZO A;  4QJF A;  4A3G H;  4LW1 A;  3CP0 A;  1EQR A;  1HZ9 A;  3FKI G;  2WAQ G;  4NB3 A;  4DUZ Q;  2A1A A;  4A75 A;  4A3E H;  4LF8 L;  2A8V A;  3GTG H;  3S15 H;  1K3R A;  1JJ2 A;  2PQA B;  4LF4 L;  2JA8 G;  1KXL A;  2ES2 A;  2PI2 A;  5HGQ A;  4POG A;  3PV0 A;  4A3D H;  4DV4 Q;  2LXK A;  1OXX K;  3CCS A;  4DV3 Q;  4DR2 Q;  4DR6 L;  1MIU A;  1HR0 Q;  3HOU H;  1NMF A;  2NVY H;  4JI8 L;  2I5L X;  4P74 A;  4AQY L;  1X9N A;  3TS2 A;  3HKZ G;  2UXB L;  1EFW A;  4PMW A;  2K5H A;  1QZH A;  3ULL A;  4X66 L;  1VQO A;  1XMO L;  1PH9 A;  1HNW Q;  2K4K A;  1YHB A;  3KDF B;  1YJN A;  4LNQ A;  5C4X G;  1PH4 A;  2E2H H;  2ZJQ A;  2HIV A;  2KEN A;  3A0J A;  1XNQ Q;  2VQE L;  5IP9 H;  2ZJP A;  2B29 A;  3H0G G;  2HHH L;  2OCE A;  5C0X J;  2N8N A;  1KAW A;  1CSP A;  1JB7 A;  3PUZ A;  1YVC A;  4BBS H;  1N9W A;  5M3F H;  4IOC A;  1WCM H;  2Y0S E;  4A3M G;  4OO1 G;  5GAG C;  4DK6 C;  1WOC A;  1YHQ A;  4UP8 A;  3S1N H;  1YEZ A;  2R7Z H;  1MKH A;  2JA9 A;  2R7D A;  4HID A;  4UPA A;  5E7N A;  4C3J H;  3RLF A;  1SRO A;  1X3G A;  2VQF L;  4JI2 Q;  1L1O C;  4GNX A;  4DNI A;  1XMQ Q;  3IRB A;  3EN2 A;  4DV0 Q;  1W2B A;  4JI6 L;  4JI5 L;  2EQS A;  3I4N G;  1N33 Q;  1Q46 A;  1YHA A;  2YTX A;  3OW2 A;  1PVO A;  1G51 A;  1T9H A;  1VQC A;  3J80 i;  1GM5 A;  2F4V Q;  3OTO L;  1VQ6 A;  3GTL H;  1UE1 A;  2QEX A;  4IOA A;  4JYA L;  1I50 H;  3BZC A;  3PUX A;  1N8R C;  3EIV A;  3T1Y Q;  3CPF A;  2PI2 E;  3Q8D A;  3JAM c;  3GTM H;  1V1Q A;  4DV5 L;  4GKJ L;  1PH6 A;  1IBM L;  1JJC B;  3RN2 A;  4JOI A;  1XPR A;  3NEL A;  1Q82 C;  2H5X A;  3GTK H;  1Y14 B;  4QGU A;  3OYY A;  2E5L L;  2YTV A;  3E9H A;  4O2D A;  4GOP A;  1NE3 A;  1B8A A;  3M9B A;  4LF7 Q;  4LFA L;  3HOW H;  1WJJ A;  2FXQ A;  5FLM H;  4ME3 A;  2E8G A;  5AJ3 L;  5IWA Q;  3JAM i;  2EXD A;  5C44 H;  3HOZ G;  2UU9 Q;  1J6Q A;  1IXR A;  4L5Q A;  4JBJ A;  5IYB G;  4LF9 Q;  4X65 Q;  4K0K Q;  4DUY L;  3UDG A;  1VCI A;  1VQ5 A;  3KJO A;  1D8L A;  4B3R Q;  4B3T L;  4YCW A;  3PO3 H;  1E22 A;  4LF6 Q;  3GO5 A;  1CKN A;  4A3K G;  5IE8 A;  1VQM A;  2CQO A;  1KQS A;  4A3C G;  3RN5 A;  2YV5 A;  1EUJ A;  2B63 H;  3K7A H;  3RNU A;  1I3Q H;  5HY6 A;  4LF8 Q;  3NEN A;  2NVQ H;  3BJU A;  3SGI A;  2LSS A;  4LF4 Q;  4PZ6 A;  1PYB A;  2R92 G;  3HOY G;  1YIJ A;  1K83 H;  1Q8K A;  4IPC A;  4P71 A;  2HT1 A;  3HKS A;  1EIF A;  4DR6 Q;  1AH9 A;  2V1C C;  2IX1 A;  1PH2 A;  4JI8 Q;  3ERS X;  4AQY Q;  1SMX A;  4HJ5 A;  3S16 H;  2UXB Q;  3AFQ A;  5C3E G;  3E0E A;  3JC6 6;  1YNX A;  2IX0 A;  3FKI H;  4X66 Q;  1XMO Q;  1L0W A;  1B7Y B;  3CCV A;  3U4Z A;  1PV4 A;  2JEA I;  2VUM G;  2RCN A;  2VQE Q;  2HHH Q;  4JI0 L;  3S24 A;  1TWH H;  4JI4 L;  1RIP A;  2MNA A;  2BH2 A;  2QA4 A;  3L0O A;  2ZTD A;  1YJW A;  3I7F A;  4NPS A;  2Q2U A;  3W1G A;  1E7Z A;  5M3M G;  1VQ8 A;  2I0Q A;  4MZ9 A;  4DV7 L;  3M4P A;  5C4X H;  3S2D H;  4UP7 A;  1PFS A;  1K8G A;  2VQF Q;  1RL2 A;  1PH8 A;  2JQO A;  1VQK A;  2GVB A;  2WFW A;  2OTL A;  3GTP H;  4GN3 B;  1YJ9 A;  4A93 G;  2D62 A;  3STB D;  1KIX A;  2JA6 G;  1TWA H;  1X54 A;  1XTD A;  2AKW B;  5IP7 G;  3CCJ A;  4JI5 Q;  2ASB A;  3F2D A;  2UXC L;  4MTN A;  4A3M H;  1X3F A;  3KJP A;  2NN6 G;  4OON A;  4YY3 L;  4JC0 A;  1KC8 C;  3OTO Q;  4IPD A;  1Z9F A;  5IY0 A;  2UUA L;  4JYA Q;  3M7N A;  4QQB X;  2MO1 A;  1HZB A;  1Y1V G;  3ER0 A;  4BA2 I;  2WB1 E;  4P72 A;  2NZH A;  4LFB L;  2RHS B;  5ELN A;  3CC7 A;  1NTG A;  4DV5 Q;  4GOP B;  4GKK L;  1Z47 A;  3ULP A;  3KLW A;  4LF5 L;  4GKJ Q;  1MJE A;  1IBM Q;  4HJA A;  1CSQ A;  3I4N H;  3AFP A;  3CF5 A;  1U5K A;  2E2J H;  2L15 A;  1X55 A;  1PHJ A;  3CME A;  2E5L Q;  2PNH A;  4NXN L;  4POF A;  1JJG A;  3NBH B;  4LFA Q;  4DPG A;  2Z6K C;  1QVF A;  5H1S E;  4GN5 A;  2MO0 A;  3BU2 A;  4OO1 I;  3G48 A;  1VQP A;  2AHO B;  5AJ3 Q;  4IO9 A;  1EYG A;  3KF6 B;  3NEM A;  4OX9 Q;  4O0A A;  3E9I A;  1EQQ A;  2UUB L;  4DUY Q;  1Q81 C;  4B3T Q;  1UWV A;  4X64 L;  3I4M H;  5GQO A;  3CC2 A;  3I2Z A;  3A5Z B;  3RLO A;  2EIF A;  4A76 A;  4BY1 G;  4DR7 L;  3PF5 A;  2NVX H;  3ICE A;  3PSI A;  3RZD H;  1I94 L;  4DR4 L;  1GKH A;  3K7U C;  4DV6 L;  1MJC A;  1FVI A;  1L2F A;  4P73 A;  4R4O A;  4AYB E;  2KCT A;  1SE8 A;  3K8A A;  4MNO A;  2CFM A;  5M5W H;  2AWN A;  1C7Y A;  3J7Z C;  2IT1 A;  1PH5 A;  1VQ4 A;  3GDE A;  4RMF A;  3W5O A;  4BXX G;  3M4Q A;  1K8A C;  4A3G G;  4J15 A;  4HIO A;  1YIT A;  4R4Q A;  4LUO A;  5GRO A;  1TXY A;  2ZM6 Q;  1H95 A;  4A3K H;  4GOP C;  1N32 L;  1QUQ A;  3B6Y A;  4LWC A;  4X62 L;  4KHZ A;  4L5T A;  2N49 A;  2RHQ B;  4A3D G;  2ID0 A;  3CC4 A;  2WAQ E;  4RG1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...