1ILQA

Cxcr-1 n-terminal peptide bound to interleukin-8 (minimized mean)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-8 PRECURSOR
publication title Structure of a CXC chemokine-receptor fragment in complex with interleukin-8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 12
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ilqA00
2B2YC 3HP3A 4X3KA 3TZDA 1WTOA 1BBXC 2HDLA 2JYOA 1S4ZA 5D14A 1F9RA 1ILPA 1EIHA 5E4WC 5CMDA 4CJ0B 5T1IA 1QE6A 1EIGA 3KUPA 3GV6A 5CBAE 2HCCA 1F9PA 2HUGA 3ONAB 2B2YA 4HCSA 5E4XA 4ZKCB 3GV3A 2MP1A 1JE4A 1AZQA 4OIJA 1JICA 2RVLA 2J7ZA 2FMMA 2MPMA 1O80A 3I8ZA 3P7JA 1DOMA 1B53A 1U4LA 4X3UA 2SDFA 5EKIA 1WTPA 5EPJA 2EOTA 1LV9A 4DN4M 4QUFA 1DZ1A 1BNZA 1X3PA 4ZAIA 2FHTA 1ILQA 2HDMA 1U4PA 1WTQA 4CJ2C 4CJ1B 2RSOA 2B2TC 3N52A 2NYZD 1WTXA 1F9QA 1PLFA 5CBEE 3DEOA 1HHVA 3FDTA 2K01A 2BDNA 4IURA 1BF4A 1HUNA 1B50A 1XYIA 2X69A 1B2TA 2M2LA 2IL8A 4NW2A 5EQ0A 1J8IA 2VXWA 1QG7A 3I90A 2DY8A 1F9SA 1NR2A 4RWSC 4R8IA 4LMQD 1XX8A 3FPUB 1EOTA 2FINB 2JP1A 2K28A 1G2TA 1RHPA 1RJTA 2H1EA 1HUMA 4UAIA 4ZKBB 3Q6SA 2KEDA 4HEDA 4ZK9B 3I91A 2EPBA 3SVMA 1SDFA 4RAUC 4X3SA 1HA6A 3G7LA 1WTWA 5EJWA 2N55A 4ZLTF 1PDQA 1BO0A 1WTRA 2CVRA 3DEPA 3KBXA 1AZPA 2B2UC 1GUWA 1SSOA 4O42A 4XDXA 5CORA 2R3ZA 5JJZA 1WVLA 2KECA 1CM9A 3TN2A 1C8CA 4IUTA 4XT1B 1IL8A 1B4OA 1RTOA 2KOLA 2B2TA 1NR4A 2L9HA 3F2UA 1MSGA 2K05A 2L11A 4MHEA 1DOLA 1B3AA 4MN3A 5D65A 4IUQA 1CA6A 1ICWA 1O7ZA 2D9UA 1NCVA 4R9WA 3DM1A 2NZ1D 4U68A 4IUPA 2B2VC 2KVMA 2Q8TA 2RA4A 4QUCA 2L12A 1HFGA 1Q3LA 1MI2A 4IUVA 1AP0A 1U4MA 2L1BA 3R93A 2X6GA 2K1BA 2MJ8A 1G6ZA 1E0BA 1ML0D 2MGSA 2FJ2A 1SAPA 2XIWA 1WD1A 1RODA 1IKMA 3H91A 1KNEA 1J9OA 3MWYW 2KUMA 3QO2A 4X3TA 5COYA 2EE1A 5AFWA 1QNKA 5T1GA 4IUUA 1HFNA 1VMPA 4XT3B 1MGSA 1EQTA 1VMCA 1PFNA 1ZXTA 1TVXA 2B2UA 2Q8RE 1RTNA 3IFDA 1O7YA 2K03A 2FFKB 3MTSA 1M8AA 1DONA 2NWGA 1EL0A 2K04A 1PFMA 1KNAA 1NAPA 1U4RA 2KEEA 1G91A 2B2WC 3IL8A 1WTVA 1F2LA 4HAEA 1CA5A 2DY7A 2N88A 5DNFA 3I3CA 1WD0A 2L4NA 3UI2A 1A15A 2B2WA 2HCIA 2B2VA 1PFBA 1X3QA 1X32A 1MSHA 5EPKA 5EPLA 1DOKA 3LWEA 1HRJA 4RA8A 1ESRA 4HSVA 4OIKA 3D6WA 2X6LA 2RSNA 1IKLA 1G2SA
chains in the Genus database with same CATH superfamily
1GOZA 3HP3A 4DR6L 5C3WA 1EIGA 2F0TA 4XYQA 2VQEL 1NBWA 1UWVA 2UU9Q 1II3A 3F2CA 1KLGD 2JA6H 2K5QA 1EYCA 1TQOA 1PTOB 2HIXA 4RCNA 4WJ3M 1N36Q 1Q1EA 2K14A 5EKIA 3UE1A 4DN4M 4GN4B 3WOFA 2I07B 4DV6Q 4JI0L 4JI4L 5E3FA 1B8AA 4LF6Q 4OXPA 1WTHA 5C3EB 4DAPA 3H3VC 1EFWA 4F7XA 3PIO3 5ELOA 2PQAB 5IYBH 4JBJA 3OPOA 1PRTB 3HOVG 1Y1VB 5JOBA 1T9HA 4B3SL 4X64L 3D4RA 4JI1L 1EQVA 3B6YA 4X6AH 5LMNL 2KEDA 1RKNA 1Y1WH 3TRZA 1VQ4A 1IYVA 3PMFA 1RL2A 2YV5A 1CUKA 4GS3A 1PDQA 2CVRA 5JVH3 4BBRH 3W5OA 3KLRA 3Q0AA 1C8CA 4IUTA 3U4ZA 4LFAL 1KAAA 2L9HA 2A6HC 3M4OB 1UE1A 1WJJA 2VB3X 1VQPA 4OEMB 1JJCB 1Q90A 2K32A 1KRTA 4QUCA 1MKHA 2R93B 3FVQA 4K5WA 5M3MH 3ERSX 1GJXA 5AJ3L 4N9TA 3HOWH 4DAVA 3L0OA 1HR0L 1WD1A 4A3BG 2O2LD 4X3TA 2EE1A 4LUOA 3GTMB 3MFYA 3CMAA 1VMCA 4Y7NH 1JMCA 5M3FH 5DLQE 1N9WA 4GLAC 4GNXC 4B9XA 1U4RA 4GKKL 1B9MA 4DXFA 2VUMH 1PYBA 2KJXA 1JB7A 1UE7A 5I9PA 3S15H 3LX0A 2OXPA 3OWFA 3M7GA 2F4IA 4JBWA 1VQKA 4Y52H 1QCBD 3PUVA 1SXTA 3PQIA 4YHHL 4EQ5A 2B2YC 3CCMA 1I4PA 3RR5A 4DV7L 2JN4A 3P20A 1G8ZD 1UE5A 5I6WA 4QIWB 3GV3A 1N33Q 4LAAA 5FO8B 3S14H 4DV5Q 2WB1B 3KF6B 4Q5VA 2Y0SB 1WTPA 2I5MX 5CV5A 1YJWA 4BS9A 5C4JB 2JA7H 5IP7H 1WTQA 4NXMQ 1SBBB 3ICEA 2GVAA 5I6YA 4LNQA 4PZ6A 2NVTH 2F0GA 1STBA 2QDLA 5EKLA 3J7AV 4DR7Q 3M4QA 3BVMA 4JOIA 1Q8KA 1QG7A 1A2TA 4RWSC 1PH9A 4MNOA 1PTOC 2K28A 2Q2UA 1XMQL 3H0GB 3T51B 4OWTB 3A54A 4RGNA 2WV6D 3J80c 2LFNA 1WTWA 3PF5A 3VYSA 2N55A 3GDEA 2JA9A 5IP7G 2JA7G 4FF1A 4G4KA 5KEEA 1H95A 1LT6D 4DGZA 3BYYB 1CM9A 2LSSA 1SNPA 4LF6L 5KYIA 5FLXL 1IL8A 2AWOA 1ZYRC 1XPOA 2K5NA 1B3AA 1DOLA 2R7ZH 2A68C 2E74C 5EAYA 2EYMA 3DM1A 4A3EG 1X6OA 4OGQC 4RHRA 4DUYL 1IHZA 2KQ3A 2RBMA 4J15A 1MHWC 2F4VQ 4NXNQ 5FJ8H 2IT1A 1SJED 5ELNA 4C1NK 1IKMA 2KUMA 5COYA 4MZ9A 1ASYA 5D3IB 4BY1B 1K9MC 4FXDA 3R8BA 2E2JH 1JWUD 1V1QA 4X62Q 4M1UB 5DM73 3X3NA 1HNWQ 3K59A 4BA1I 3HS0C 4RHSA 1STHA 3CQZB 2NVQH 1EY4A 3CU7A 2AKWB 2O5JC 3R2TA 2ZXRA 4FDBA 2AQ3B 5BR8Q 2UUBL 1EQQA 4PNYA 1BDOA 2J4XA 5E4WC 4K6LA 5CMDA 5M5WH 1NMFA 1LACA 4DR1L 2K5WA 1STEA 3BVZA 5KNBA 4PV1C 3BDCA 2FMMA 3RNUA 2PO4A 2EYHA 1JE5A 4X65L 3NELA 2EOTA 2ASBA 1U4PA 3J80i 4CJ2C 3K7AB 5ISRA 4HIDA 3N52A 2EYOA 2D5DA 5JAVA 3QR8A 1BF4A 4HJAA 1L0WA 1KL9A 5C4XH 3JAMi 1SN8A 2ZXOA 3GTQB 2Z4HA 2NB0A 4R4OA 4JI8L 5K5PA 4L5TA 5GQOA 3C1EA 2PNRC 2UXBL 1ET6A 3PO3G 2EPBA 3IFTA 3SVMA 5M5XB 4DV5L 1PH7A 4C3IB 1SFOB 3C2PA 4X3SA 5LMUQ 3PUZA 4B3RQ 4O42A 1DCZA 5M5YH 2VQFL 1K8GA 2EY1A 1S5ED 3HOZH 4XT1B 1G51A 4DR5Q 1FR3A 4DR7L 1KHIA 3KJPA 4EQPA 4ODGA 2GVBA 3TBIB 3AFPA 3A0JA 4GOPA 2B2VC 2K5DA 4RKLA 3ITPA 4I7ZC 2JA8G 4LFCL 1T5EA 2K1BA 2PZUA 2ZJQA 3CCUA 4IPHA 1PHJA 4CDEC 1KDAA 4YWLA 1AEXA 4BY7G 1J9OA 2L15A 3CC2A 4IZ8A 5I4DA 3NEMA 2K5HA 2RQXA 1PA6A 3PO2B 4HIOA 1S5FD 4G7OC 3GO5A 4K8JA 1PFMA 4A3DH 2CW0C 4HSPA 1ASZA 1IBLQ 2JA6B 2UUAL 3UI2A 5FLXE 3STBD 1A62A 1LTRD 2XNAC 4RA8A 1QUQA 1LUZA 4A3IB 2Q2TA 1G2SA 3J7A5 1QWYA 4UY8C 4L5RC 3ONAB 2I0QA 2RVLA 3D8GA 2ES2A 2F1MA 3E6ZX 4A3DG 2E2IH 1ENFA 4X62L 1DOMA 2SDFA 1GUNA 1HNWL 3MHBA 2A73B 2EJMA 1DM0B 4LF4L 1STGA 4CJ1B 2YU9B 1ENCA 3QOLA 1Y1WB 4APVA 1UE6A 2B63H 4HMJA 1WCMH 4DNTB 1CT1D 3KOJA 3EQLC 4BBRB 1OXVA 1A3VA 2AQ2B 1D8LA 3HKZE 5CR3A 5CC4A 1D1KA 1N8RC 1EOTA 3Q8DA 4LF7Q 3S24A 1KQSA 3CCEA 2UXDL 5KGUA 3EBEA 5H1SE 1BO0A 4LWCA 2IX0A 2Z4IA 2MO1A 5M3MB 1E1TA 2KENA 2K7VA 2KA7A 5IODA 5C44H 3J7ZC 1AE3A 3HOWB 3S1MH 2L11A 1ICWA 3HKZG 1NCVA 1ZKOA 2ATWA 3PF4A 2XGTA 1F2YA 4BXXH 1YNNC 5M3FB 3N6RA 4IOCA 1FNWA 1BBUA 3JC66 4B9WA 4AQYL 4B3MQ 4A3FB 1N34L 2R61A 4CBVA 2MJ8A 4QB4A 5I2XA 1ML0D 3VR2A 2VUMB 1IL2A 3S15B 3GTPH 2ZJRA 3MEHA 5LMUL 2YYZA 1Y8NB 2BE5C 4IO9A 3FMCA 5JPMC 5LL6S 3NQTA 4UDUC 1HNZQ 4G7HC 3I4NH 2V1CC 4A4IA 3D31A 3RZOH 1RCVD 1R9TH 3S1QH 3E9HA 1VQGA 2NWGA 3ZJYC 1NAPA 3HOXG 1FL0A 1VQDA 1F77A 4HAEA 1CA5A 4OO1I 2ZM6L 3S14B 2QA4A 1SLJA 2A74C 1YNJD 1XTDA 1CKNB 2OQKA 3L7ZC 1K3BC 2XN9C 4DR6Q 1BVSA 4Z9CB 2HDLA 4X66L 2EIFA 4NP5A 2NVTB 1W3SA 2VB2X 4J1MA 1D7QA 2WB1G 2Y0SG 3J81c 3QIAA 2E2HH 4ULLA 3TP8A 3H3VI 4IFDH 3RZDH 2P5ZX 1JJ2A 2RDHA 2R6GA 3GTGH 1JE4A 3I4NG 4RCOA 3I8ZA 3PCOB 2MHVA 1KLUD 1UAPA 4JI0Q 2ALYB 1EY0A 2F0DA 2FHTA 4C3JH 2MQHA 2NVXB 1TR5A 2RSOA 2WFWA 2B2TC 1KTKA 3KLSA 3NTIA 3WDNA 1XNQQ 4IURA 4KHVA 1PVOA 3BDOA 2IL8A 2VXWA 4B3SQ 2JE6I 1I4RA 1F9SA 4K5VA 3NUCA 4R4IA 1NR2A 2FINB 5LMNQ 4GKJL 4IFDG 3NQIA 2B39A 4JPBW 4DKAC 3ER0A 4WFN3 1EZ8A 2CFMA 4C2MH 1S5CD 2R3ZA 4LFAQ 1U0LA 1D1IA 1BCPB 2A6ED 4MHEA 2K4KA 2WKCA 3A55A 3CCQA 1J5EL 1AH9A 4KD4A 4IUPA 1SYEA 2Q8TA 1PV4A 3H94A 2E2JB 1XMOL 2Z6KA 5AJ3Q 1H9RA 5IY0A 1Z9FA 2E5LQ 3SK5A 5K36G 3BZDB 4KV6A 4KTAA 1HR0Q 5C0XH 1IXRA 1QZGA 2FJ2A 3S1RH 2NVQB 2F3VA 1JWSD 3QO2A 3Q22A 4KKUA 5J22A 3VR4A 5C0XJ 2M00A 3UDFA 2F0OA 1EQTA 2LMCB 3HKSA 4GKKQ 1PRTD 2K03A 4A3GH 1K0SA 3TZUA 3J81i 5IGCA 2NTSA 2BH2A 2E76C 3BVGA 3CCRA 4GNXB 2DY7A 2N88A 4IPDA 1SNMA 3CCLA 2B2WA 3A8IE 3MXNB 1K8OA 4A75A 2F0QA 2JA5G 3J80L 2NZHA 1EOVA 2EY5A 3QG1A 3MXUA 2GN5A 2X6LA 1EY5A 1X55A 2F0IA 2DJGC 2Q8IB 3CAMA 5C4ZA 1GHJA 1S4ZA 1BBXC 1NNXA 3GQBA 3KUPA 2JEAI 3SK8A 1X3EA 2F0KA 2HCCA 3JAML 4FXGC 1H9MA 2MP1A 4A3GG 1PFSA 5C4XB 4PMCA 2BOSA 3WOEA 1L1OC 5DAUA 3KDFA 4K2LA 1O80A 1MJEA 2ID0A 2EJFC 1LM0A 4V0BA 3EA6A 2VS1A 5FOBB 3NPPA 4CKEA 4KJOA 1QNUA 2SNSA 3T4AC 1Q82C 1GD7A 1X56A 3OW2A 2DN8A 1J8IA 1EEID 2IWHA 5CV8A 5M5YB 3HOVH 1IW7C 1SE8A 4M8AA 1XMQQ 2VZAA 3I4MB 1EIFA 1TWHH 1TWGB 4KLKA 1G2TA 4C3HH 1KXLA 4FVMA 4GLVB 4A3MG 4H7BA 3GD7A 1EFID 1HXYD 3MXPA 3UDIA 4XIGS 3G6JB 1B70B 1XNQL 1CA6A 1NE3A 1O7ZA 2LXKA 3K81C 4DUYQ 2NZ1D 4A93G 2B8GA 2QDBA 4QMGA 2OF1A 1JCKB 1HFGA 1SYGA 2A69C 2EVBA 3OMCA 3I7FA 2MUYA 1K83H 2L1BA 4C3HG 1I6HH 1JWMD 4P72A 2X6GA 4UP7A 3CCVA 1KC8C 2EYLA 1Z47A 4A3BH 3H91A 1EYAA 2KCMA 1BCPC 1EYGA 4DK1A 1CK1A 1U5KA 4C56C 1YIJA 2EXZA 2Q8RE 2SNMA 3NENA 4LK1C 4OX9L 1M8AA 1CZWA 1KRSA 4DV2L 4K5XA 4KI0A 5FK9C 3ULJA 1SR3A 1HZ9A 4OL7A 3I3CA 3PIP3 2DNCA 2PZWA 1PH1A 2AWNA 5IT9L 1Y69U 5M9OA 2E2IB 2UUBQ 1GUTA 2E5LL 4HSVA 4BBSB 1IKLA 2L55A 5D14A 1ILPA 5JEAH 4DR1Q 2B63B 1WCMB 1PH6A 5CGKA 2B2YA 1VF7A 4LF5L 2K6AA 5JEAJ 4ZUJA 4X65Q 5J3BA 3S1NH 3URYA 2B29A 4RKBA 3VDYA 1LTTD 1O78A 3QB3A 2YTVA 3ERQA 2IHFA 1DJRD 3A5UA 4JW0A 2QW7A 3DM3A 4A76A 3SEBA 2K01A 1UEAB 1LLRD 3GTKB 1SYBA 1XYIA 1H9SB 1I50H 4JI8Q 2M2LA 4G57A 1W6KA 4N8FA 2F0HA 4DV0L 5JEAG 1QZHA 5C44B 1QVCA 2UXBQ 1FNVA 1RHPA 1V1OA 4A3KG 1V1PB 1YVCA 2KCNA 4UAIA 4WJ4A 1YNXA 1RD9D 3BU2A 3G7LA 4G7ZC 2VQFQ 2CQAA 5C4HA 3JAME 3G6EA 1CTMA 1JOQA 3GTOH 1TWAH 3GTPB 1MSGA 1SEBD 1C9OA 1FGBD 3I72A 4PZ7A 3KF8B 4FNFA 4A3EH 5IIFA 2PQAA 2F0EA 1BKBA 4PMBA 4LFCQ 3S1QB 1R9TB 3TDQA 4JBKA 4H0LC 3CD6A 2HT1A 3OSOA 1BR9A 1Z6HA 4KJNA 1EY8A 3EN2A 4K0KL 3I55A 3MWYW 4HTHA 2KHSA 4IUUA 3SXHA 3E0JA 5I2YA 3GTLH 1SYDA 1LYLA 2Z0SA 2UUAQ 1F2LA 2E2HB 3GTGB 1QB5D 1OTCA 3NWSA 3LWUA 3VYUA 1L2FA 2KCTA 4I7AA 1SYCA 1SROA 2DUDA 3FKIB 2NN6I 1K0RA 4DA2A 1EIHA 4OO1G 3PUXA 5T1IA 5FO9B 4PMWA 3UDGA 2UXCQ 5JJLA 2PYKA 2EY2A 1F9PA 4HCSA 3QWNA 1KDCA 5ELEA 2CKZB 1K3RA 4HIKA 3VA5A 2MFIA 5BN3A 3TQYA 4LF4Q 1LV9A 3DWAA 2PI2A 2G9HD 2D0PA 4IJLA 3A5ZB 1D5ZC 3S2HH 1H9JA 1CFMA 3DEOA 2KHIA 3FDTA 3K5NA 4F88A 4A3JB 4AIMA 3K8AA 1HZAA 4C2MB 4XQJA 4LF9L 3I90A 5HGTA 1TS3A 2WAQB 1TU2B 5IT9E 1FGUA 3E9IA 4F87A 4QY7A 1Q86C 4DR3L 3PO3H 2UXDQ 3Q6SA 2F03A 4R4TA 1XPRA 3KK7A 3LNNA 3KF6A 3HOYH 1G6PA 4RGOS 1AN8A 1QJOA 1SNCA 1GVPA 5ELCA 3KLWA 3PGZA 3CPFA 3E3XA 3S1RB 1Q1BA 2K05A 2N49A 3QOJA 1VQJA 3D0FA 4YWMA 4NDXA 2D9UA 1JQYD 2NVYH 1TWCB 2RKSA 2FMCA 3RN5A 3J81L 4PQXA 4AQYQ 1D2BA 3FPPA 1N34Q 3J81j 3C46A 2JA8H 1PXUA 1JORA 1EIYB 4KY5A 2RF4A 4BY7H 4JV5Q 1XTCD 1VF5C 3HOYG 3OWEB 4GZYC 4EGVA 1VQ9A 2F0UA 2K5VA 2R92G 4L6TB 2K04A 5KYLA 2KEEA 3VYTA 3IL8A 3HG9A 2ZM6Q 3I56A 1GUGA 2EDGA 3O13A 1MSHA 3K0YA 3W3AA 4WRDA 4X66Q 2I5LX 4YIJA 4DV3Q 1PH4A 3DMUA 4X3KA 1W6JA 4F8MA 5DEHA 2O5IC 3CRKC 2F0LA 2PQEA 1QE6A 5CBAE 4ZKCB 4AH6A 1TT2A 2CH4W 5BN4A 4AYBG 2PCFB 4QQBX 4O1NA 1YJNA 3HOUG 3T56B 1VQFA 4OHJA 5DM63 1BNZA 2RHQB 2HDMA 2JK8A 1CSQA 4MTNA 3PUYA 4ME5A 2RDFA 2IPKD 2Q2HA 4L63B 1BQQT 1PLFA 2E8GA 4QF4A 2RDGA 3NBHA 1HUNA 3EJIA 4LW1A 4GOPC 2XRSD 3D4WA 5LMNW 3RLOA 4GKJQ 4LMQD 3AB9A 3FPUB 2UXCL 1JOOA 2XRQD 1XPUA 4JI5L 4O2DA 3F2DA 3WWVA 3I91A 5C3EG 3EFXD 1VQOA 1K83B 2L5TA 5JJZA 4DXGA 2I5HA 1Y8OB 1EQRA 1ESFA 2VW9A 1Y1VG 1MJCA 4A3BB 1NR4A 1J5EQ 1PYSB 3M4PA 4IUQA 1AW7A 1XMOQ 1LTBD 1CKMA 4FF3A 1HR0W 1YZ6A 4GN3B 2ICIA 2OT2A 3OYYA 2EQSA 2F3IA 4JBMA 1A6XA 2MGSA 1O7IA 5FLXc 1SAPA 4LFBL 1LT5D 2JQOA 1HA5A 2IW3A 4ALPA 3ND9A 1HFNA 3NWTA 2N3SA 4IUNA 1GM5A 2B2UA 4DAYB 5GADC 1HTPA 2LS01 3W1BA 3HOXH 1Q7YC 2R93G 4OONA 4Y7NB 4JC0A 2HD3A 3A74A 1FNUA 1MD2D 3KBGA 5C6AA 4HJ9A 4JI3L 2WKDA 3SE0A 2BH8A 4XQNA 1X3FA 2CHBD 2XWBB 3J81E 1K73C 4QIWE 1PTOF 4JV5L 4POGA 1SNOA 1R4QB 3SHLA 1C0AA 4IALA 2WB1E 1E2ZA 2Y0SE 1I50B 2A6HD 2F0VA 1VDZA 3P7JA 4QGUA 1L1OB 4OWXB 4J8QA 2Q2IA 3L3OC 1XNRL 1X3PA 1TY2A 4S3SA 2PPBC 1B7YB 1PRTF 2WINB 3OIQA 1SNDA 4HCEA 5CV4A 4JI7L 2JA7B 1B50A 4ZUIA 4KY6A 4DV3L 2DY8A 4IJHA 2NBFA 3NBIA 3GTOB 2V4DA 1NUCA 5IGBA 1GO3E 5HY6A 3ULPA 2CCZA 5BN5A 1MBYA 1YHQA 4KK7A 4ME3A 1RJTA 4TRDA 4A3EB 4ZK9B 5CV6A 4IFDJ 3F8TA 2JSOA 5JJKA 4KKTA 1HNXL 5KRUA 1OXXK 4JVZA 2PW5A 3GTJH 3A7AB 5CORA 4JI6Q 2AUJD 2HHHQ 4NB3A 2F52A 3F2UA 3NTKA 5TSSA 4IQZA 3H0GG 3T13A 5C5LA 1SE3A 3T1YL 1HQRD 4DV1L 4EQOA 5HURA 3GTLB 1I94L 2ZT9C 1HZBA 1PZID 2F0SA 2R7ZB 1DGSA 1Q3LA 1MI2A 5K36H 1TWFH 1LO5D 4QL5A 4I65A 4BY1H 1QVFA 4LF8Q 4JCVE 1DXMA 4UP8A 2KHJA 3MC0B 2K75A 1CQVA 1PMRA 1EY7A 1KABA 5AFWA 5EGTA 5CV9A 1VMPA 4XT3B 4OX9Q 4HJ7A 1EY6A 1SMYC 4DV2Q 4IN3A 4MTKA 2M9VA 3G71A 1EL0A 3MXGA 3DUZA 1JT8A 5ELBA 2DGYA 3H6MA 1Y8PB 5DNFA 1PTOD 1XJVA 3FKIG 3D6CA 1WYDA 1PFBA 2JA5H 1GUSA 3CW2C 3M7NA 1M90C 1F2ZA 4BY1G 2K50A 3K5MA 2UUCL 3T1HQ 5EBCA 1V8QA 2JYOA 3MAQA 3MFGA 1D5XC 4LF5Q 3GV6A 1C4QA 1YJ9A 4BA2I 3V2TA 1ZYRD 3OW7A 4EQNA 4XXEA 3NP8A 3E0EA 5JJIA 2A68D 3BYTB 5M5WB 2NN6G 1SYFA 4X3UA 4QUFA 1DZ1A 3HRZC 4ZAIA 4A3JG 2F0NA 3ND8A 2Z9HA 1BBWA 3PO3B 1D6EC 5D3DA 3G48A 5G3LF 3GTQH 4ZRZA 1HQMC 2BDNA 1JC7A 4DV0Q 1B2TA 4BWGB 1CKNA 4R8IA 3UE0A 1E7ZA 2BCOA 4EVOA 1PH2A 4DAMA 1SFOH 1ZEQX 2XVSA 1EEFD 3NHHA 2NVYB 3STBC 4HEDA 3D4DA 4RAUC 4A3MH 4DUZL 4IPCA 5IYDG 3FHWA 4YCWA 1Q12A 2JA8B 5GAGC 1TY0A 3BG3A 3TN2A 2RCFA 1B4OA 2KOLA 3R2IA 4HJ8A 3CPWA 4BY7B 4ID6A 1WI5A 4CDFC 3PIOA 4A3CG 4YCVA 2CWAA 3FRPB 5KNDA 3HOZB 4R9WA 3DXJC 3P75A 3C1FA 3UDXA 4A93H 1SNQA 2RA4A 3MZ5A 3AYHB 1A2UA 4C3IG 2AUKA 3GP7A 3PUWA 2L12A 2TMPA 3T16A 1C7YA 2OWOA 1QVGA 4HJ5A 2QCPX 2OQ0A 3OMGA 3S16H 2H5XA 5CV7A 2A19A 1NSNS 4K0KQ 1LTGD 3AFQA 5E7NA 1D5MC 3VR3A 3SK4A 3HFZB 2SEBD 3K7UC 1SRUA 4JI6L 4KKSA 2HHHL 1RTNA 2FFKB 4NKLA 1IYJB 1G91A 5IP9G 1TKWB 5NUCA 2WP8J 3NSWA 1VQLA 1MIUA 3U50C 4A3IH 1GKHA 4RFBA 1LTSD 4A3DB 3PIPA 3Q24A 4DU9A 4JI2L 3M9BA 1A3UA 3KLSX 4FXKC 2QEXA 3PO2G 2RSNA 1DONA 4LF8L 4DR2Q 1YHAA 3OTOQ 1F2MA 1RIPA 1NY4A 5A35A 2HUGA 2C35B 1S5BD 5G3LD 3TS0A 2JA6G 4P74A 2ZTCA 2J7ZA 4YCUA 2YU9H 2ICEC 4DK0A 3OHXC 3S17H 3M3YH 3DLLA 1EYDA 1ILQA 1B1ZA 4GNXA 4A3IG 1VCIA 1WTXA 4DK3C 3MVVA 5C5MA 3MXNA 4LF9Q 3MA2B 3U9SA 1W2BA 1CHQD 1VQIA 2E2DC 4NW2A 5EQ0A 3T1HL 1IBML 1DYQA 2O4XA 2QF7A 5IYBG 2I46A 1EWHA 3HEJA 3L2PA 4DR3Q 2JP1A 3IRBA 4A3KH 2B3GA 1IYUA 3HKZB 1YNJC 2WIIB 2CW0D 1Y1WG 1GXDC 2LKVA 5A2QL 4ZLTF 1AZPA 4H02A 2EYPA 4P75A 1CKOA 2EJGC 4BBRG 1FJGQ 1YEZA 3C3LA 3CMEA 1Z7TA 2IX1A 3CCSA 4UP9A 4A3FH 3RN2A 3DHQA 4RH6A 3S1MB 1VQ8A 3J80E 1UEBA 4IUVA 3HOXB 1PH3A 2CQOA 3TMEA 1U9RA 5IGFA 1OXTA 3CHBD 5M3MG 3PV0A 3AU7A 3NK9A 1I3QH 3HOWG 4DV4Q 4B3TL 2MO0A 2R7FA 4ZCKA 4UPAA 1EY9A 1O7YA 4DFAA 5M3FG 4OELB 2ENBA 4KHZA 4POFA 1YBYA 2SOBA 4P73A 4K6DA 4YY3L 4A3FG 4NPSA 4RG1A 4XTCS 3Q23A 5LL6X 3I4NB 4XQQA 3RZOB 4MIUA 2VUMG 5GAHC 1DOKA 1VQ7A 1I4QA 1PH5A 4IFDI 4OIKA 2VNUD 1CQFA 3D6WA 2A6EC 3TZDA 2D2CC 4PZ8A 4OO1H 2XTIA 4FO2A 4CJ0B 2RHSB 3CXCA 1STYA 2H4OA 3CC7A 1HCZA 1T5XD 2LY7A 2UU9L 1FYCA 2NVXH 5EPJA 1YNND 1N36L 3RZDB 4HR7B 1FVIA 2PW7A 3H3VH 1GHKA 1YHBA 4JOIC 2Z6BA 2IHEA 4Q0FA 4DV6L 1HHVA 1K8MA 4C3JB 4JG2A 3JAMc 1PRTC 2X69A 3GTJB 1KAWA 4GOPB 2XWJB 4DR2L 2BE5D 1M4VA 4YWKA 1EUJA 3OTOL 1XX8A 1EWIA 4JI5Q 1LABA 4ZKBB 5EBDA 3SK6A 2JEBI 2F0MA 4O0AA 4FF4A 5EJWA 4RMFA 1EZ6A 2QGQA 1TWFB 2G5DA 3S2DH 1XXGA 3TSSA 4WJWA 2KECA 2YTYA 2LXJA 1AFPA 3CC4A 2BA0A 2FXQA 3T53B 4XYOA 1X3GA 4K14A 1VQHA 2F0WA 1CZGA 2R7ZG 1H9SA 3EIVA 2YTXA 1IZ6A 5C0XI 4CKBA 3U58A 3K5OA 4B08A 4KHPQ 5I9OA 3J7AF 1EU3A 2Z1CA 1QUQB 4TVAB 3OOCA 5FJ8G 1V1PA 3NBHB 4LFBQ 1G6ZA 1E0BA 1VQNA 3TP5A 4DK6C 4HN7A 1E2WA 3S9WA 1HPCA 3ULLA 2JA5B 1PZJD 1QNKA 5KNCA 5T1GA 4N9PA 1KIXA 4CKCA 1TS4A 5HGQA 4JK1C 1FJGL 4LUZA 2R92H 3MTSA 3KYHC 4CDCC 4H13C 1E22A 5A2QE 3BDLA 3TP7A 4JI3Q 2C9OA 1SJHD 3D3RA 3KF8A 3P1HA 3I4OA 3M85A 1LT4D 2PMZE 4A3GB 2L4NA 3NTHA 5GAEC 1E24A 2B2VA 1L0YB 1X3QA 4IPGA 2K33A 1L0XB 1HRJA 1ESRA 4HMIA 2ZTEA 4DV4L 4OWWB 3K6OA 1BUVT 4L5SA 4FF2A 1SMYD 2D0OA 3U9OA 1P16A 3DWQA 1VQMA 1AZQA 4N8X1 4QJFA 2OTLA 1N33L 4AYBE 5IT9c 1XNRQ 1I4GA 4HIMA 2EZVA 3HOUH 3H15A 5EKKA 2QEJC 4R4QA 3TREA 5C3XA 3AMUA 3W2DA 1I6VC 4DR4Q 3I2ZA 3K57A 1Q46A 4JYAQ 4JI7Q 1F9QA 2EYFA 4EX5A 4A3MB 4NXML 3K5LA 4WORA 3RUZA 3BZKA 3I4MH 2D62A 1O7LA 3QJYA 1HH2P 1TWGH 5ELDA 2RCNA 1PTOH 5C4XG 4KD3A 2KBNA 1VQEA 2TSSA 3TS2A 5IYCH 4R8NA 2HIVA 3AEVA 3HOVB 5IOCA 5IGDA 1HNXQ 5E1FA 4A93B 5C3EH 3CCJA 1TWHB 1HA6A 3MEFA 1GUOA 1X9NA 1BOSA 1BCPF 1WTRA 1CHPD 3DEPA 3LGJA 4CDDC 4C3HB 1GUWA 4NMZA 4E6IA 3S16B 2F0JA 1DD2A 3DWPA 1Y1VH 3HOZG 1RDPD 3I4LA 1RTOA 3I4MG 5D65A 3HZXA 3T1YQ 4A3LH 4DV1Q 1YITA 4C1NI 1I94Q 2PZTA 5FO7B 1LTID 5IYCG 5IWAQ 1U4MA 1VS0A 1WOCA 3FP9A 3R93A 3KJOA 1RF2D 2F4VL 4NXNL 2E75C 2NUCA 1I6HB 3TEHB 3M4OH 5J1ZA 4RGMA 3SDZA 5F2DA 1LT3D 1Q8IA 1B3QA 1G291 4ABNA 1PFNA 1TVXA 1S5DD 4PG3A 1S3OA 2CWPA 3A8KE 4A3LG 1HZCA 1XWEA 2R93H 1IW7D 3IKJA 2AMCB 1ENAA 4H44C 1Q81C 4BBSH 4KHPL 1A15A 1OO9B 1B44D 5EPKA 2UUCQ 3S17B 5EPLA 1ET9A 3LWEA 4DNIA 3GTMH 3M3YB 4TKOB 3NXWA 1YI2A 1NMGA 1WTOA 3VR5A 2WACA 5ELFA 5BR8L 4V190 2JXMB 1F9RA 4L8JA 4P71A 5JPNC 2J0TD 5E4XA 2PI2E 2A5HA 1LTLA 2G9DA 2HQEA 4OIJA 1I4HA 2MPMA 1STNA 1QOHA 2VY3A 4U673 4A3KB 3GTKH 2MNAA 4BBSG 5IGEA 2A69D 3VA7A 1EWCA 2NYZD 1E3PA 3S1NB 1K28A 4L5QA 3V96A 3A8JE 2B63G 4FYDA 1WCMG 4KN7C 2JJQA 1N32Q 3V05A 4GLXA 1JB3A 2OTJA 1BCPD 5IE8A 2B8FA 5C4JH 3F2BA 3HGBA 2H1EA 1HUMA 2IY5B 4DUZQ 5FKAC 3J7YW 1QILA 1SDFA 4P2CB 3SGIA 2NTTA 1A3TA 2VL6A 4LJZC 2A8VA 2OCEA 1NTGA 4DR4L 2B2UC 2BA1A 4XDXA 5LHY1 2F0FA 3E5SA 4JYAL 4B3RL 3L9AX 5L37A 4K2KA 5CYUA 5C44G 1TIID 1I3QB 2B2TA 1JR0D 1KDBA 1R4PB 1FD7D 3H0GH 4LUVA 3RLNA 1A63A 4DR5L 4U68A 1TWAB 1V43A 3F1ZA 5J39A 3VYRA 4BXXG 1IBKQ 1X65A 3AQQA 2ZJPA 1OXSC 3I73A 3BS1A 2DNEA 4RGTA 2VQEQ 1JJGA 1Y14B 3W1GA 1MGSA 1ZXTA 4DPGA 1PZKD 4KMUC 3KDFB 1SMXA 2IJ0A 1VQAA 3A56A 3X3MA 2F3WA 2L0CA 4QCLA 1TXYA 2KCCA 1X54A 4JI4Q 2R7DA 4TQUS 3RD4A 4DF7A 1WD0A 3FKIH 5IWAL 3EVQA 1IBLL 2HCIA 4JI2Q 3CP0A 3K0XA 2A1AA 3CKIB 2N8NA 3G4SA 1VQCA 1JOKA 2XSCA 2AQ1B 1ICFB 4R4CA 3K58A 4R1JA 1A8VA 2EXDA 2ZXPA 4X64Q 4GN5A 3KFUA 1J6QA 4ILWA 4JI1Q 2Z8LA 1OXUA 2QILA 3CQZH 1VQ6A 4K8IA 1C48A 1JICA 4DAYA 2NN6H 1TS5A 1U4LA 1B53A 1V9PA 1TS2A 1UUPA 3OIPA 4A3JH 3PSIA 4C3JG 3SR1A 1S72A 5FLMH 5CBEE 1HTLD 3RMHA 1IBMQ 4DNRB 2WAQE 3R3OA 1P8LA 3S2DB 3S2HB 2GA4B 1KD1C 4UHVA 1EU4A 2AHOB 3A7LA 1H9KA 5JVG3 3K7AH 4LF7L 1K8AC 2F0PA 3NE5B 2ZTDA 5IYDH 1L1OA 3BJUA 1S40A 1E1OA 1PYWD 3KBXA 4KY7A 1SSOA 1WVLA 5FLMG 1HJPA 2C5CA 1TWCH 2WAQG 2EYJA 3HOYB 3IAYA 4A3CH 1ONLA 1BXTA 1LTAD 3H09A 4MN3A 2HQLA 2Z6KC 3RLFA 1E2VA 1SE2A 5IGGA 1VQ5A 4IOAA 1PH8A 4ZYSA 1N32L 5M5XH 2KVMA 4C3IH 4J6HA 2R92B 1CSPA 1CI3M 1AP0A 4ZQ3A 2OEOA 2PMZB 2N78A 4CGYB 5KIXA 4YHHQ 4B3ML 4FP5D 4DV7Q 3FEWX 4B3TQ 2BDOA 5C0XG 2XIWA 2DJFC 1RODA 1KNEA 1WFQA 3I70A 1I5FA 2NZOA 1B9NA 2K52A 3ZYYX 1NJIC 2PNHA 3CRLC 4CHTB 1M1KC 3EROA 2EY6A 3IFDA 3TP6A 3VR6A 4YY3Q 5IP9H 3BZCA 1HNZL 1KNAA 1UNSA 3CF5A 1A0IA 2B2WC 3M4YA 1WTVA 1AE2A 1STAA 3U4VA 5GROA 4AYBB 3K80C 4TSSA 1IBKL 1VQBA 2IX3A 4KN4C 1X32A 3HOUB 2CH4A 1I4XA 1SE4A 2QKIC 3PO2H
chains in the Genus database with same CATH topology
1GOZA 3HP3A 5C3WA 1EIGA 2F0TA 4XYQA 1II3A 1KLGD 2K5QA 1EYCA 1TQOA 1PTOB 4RCNA 1Q1EA 5EKIA 4DN4M 3WOFA 2I07B 5E3FA 5C3EB 4DAPA 3H3VC 4F7XA 3PIO3 3OPOA 1PRTB 1Y1VB 5JOBA 3D4RA 1EQVA 2KEDA 1RKNA 1IYVA 3PMFA 1PDQA 2CVRA 5JVH3 3KLRA 3Q0AA 1C8CA 4IUTA 1KAAA 2L9HA 2A6HC 3M4OB 2VB3X 1Q90A 2K32A 4QUCA 2R93B 3FVQA 4K5WA 1GJXA 4N9TA 4DAVA 1WD1A 2O2LD 4X3TA 2EE1A 3GTMB 3MFYA 1VMCA 4B9XA 1U4RA 1B9MA 4DXFA 2KJXA 5I9PA 3LX0A 2OXPA 3OWFA 3M7GA 2F4IA 4JBWA 1QCBD 3PUVA 1SXTA 2B2YC 1I4PA 3P20A 1G8ZD 5I6WA 4QIWB 3GV3A 4LAAA 5FO8B 2WB1B 4Q5VA 2Y0SB 1WTPA 5CV5A 4BS9A 5C4JB 1WTQA 1SBBB 5I6YA 2F0GA 1STBA 5EKLA 3J7AV 3BVMA 1QG7A 1A2TA 4RWSC 1PTOC 2K28A 3H0GB 3T51B 3A54A 4RGNA 2WV6D 2LFNA 1WTWA 3VYSA 2N55A 4FF1A 4G4KA 5KEEA 1LT6D 4DGZA 3BYYB 1CM9A 1SNPA 5KYIA 5FLXL 1IL8A 2AWOA 1ZYRC 1B3AA 1DOLA 2A68C 2E74C 2EYMA 3DM1A 4OGQC 4RHRA 1IHZA 2KQ3A 2RBMA 2IT1A 1SJED 4C1NK 1IKMA 2KUMA 5COYA 5D3IB 4BY1B 4FXDA 3R8BA 1JWUD 4M1UB 5DM73 3X3NA 3K59A 4BA1I 3HS0C 4RHSA 1STHA 3CQZB 1EY4A 3CU7A 2O5JC 3R2TA 2ZXRA 2AQ3B 4PNYA 1BDOA 2J4XA 5E4WC 4K6LA 5CMDA 1LACA 2K5WA 1STEA 3BVZA 5KNBA 4PV1C 3BDCA 2FMMA 2PO4A 2EYHA 2EOTA 1U4PA 4CJ2C 3K7AB 5ISRA 3N52A 2EYOA 2D5DA 5JAVA 1BF4A 2ZXOA 3GTQB 2Z4HA 2NB0A 5K5PA 3C1EA 2PNRC 1ET6A 2EPBA 3IFTA 3SVMA 5M5XB 4C3IB 1SFOB 3C2PA 4X3SA 3PUZA 4O42A 1DCZA 2EY1A 1S5ED 4XT1B 1FR3A 4EQPA 4ODGA 3TBIB 2B2VC 2K5DA 4RKLA 3ITPA 4I7ZC 1T5EA 2K1BA 2PZUA 1KDAA 1AEXA 1J9OA 4IZ8A 5I4DA 2RQXA 3PO2B 1S5FD 4G7OC 3GO5A 4K8JA 1PFMA 2CW0C 4HSPA 2JA6B 3UI2A 5FLXE 1LTRD 2XNAC 4RA8A 4A3IB 1G2SA 1QWYA 3ONAB 2RVLA 3D8GA 2F1MA 3E6ZX 1ENFA 1DOMA 2SDFA 1GUNA 3MHBA 2A73B 2EJMA 1DM0B 1STGA 4CJ1B 2YU9B 1ENCA 3QOLA 1Y1WB 4HMJA 4DNTB 1CT1D 3EQLC 4BBRB 1OXVA 1A3VA 2AQ2B 5CR3A 5CC4A 1D1KA 1EOTA 5KGUA 1BO0A 2IX0A 2Z4IA 5M3MB 5IODA 2K7VA 2KA7A 3HOWB 2L11A 1ICWA 1NCVA 1ZKOA 1F2YA 1YNNC 5M3FB 3N6RA 1FNWA 4B9WA 4A3FB 2R61A 4CBVA 2MJ8A 4QB4A 5I2XA 1ML0D 3VR2A 2VUMB 3S15B 3MEHA 2YYZA 1Y8NB 2BE5C 3FMCA 5JPMC 5LL6S 3NQTA 4UDUC 4G7HC 3D31A 1RCVD 2NWGA 1NAPA 1F77A 4HAEA 1CA5A 4OO1I 3S14B 2A74C 1YNJD 3L7ZC 2XN9C 4Z9CB 2HDLA 4NP5A 2NVTB 2VB2X 4J1MA 3QIAA 4ULLA 3TP8A 4IFDH 2RDHA 2R6GA 1JE4A 4RCOA 3I8ZA 2MHVA 1KLUD 1UAPA 1EY0A 2F0DA 2FHTA 2NVXB 1TR5A 2RSOA 2B2TC 1KTKA 3KLSA 3NTIA 3WDNA 4IURA 4KHVA 3BDOA 2IL8A 2VXWA 2JE6I 1I4RA 1F9SA 4K5VA 3NUCA 1NR2A 2FINB 4IFDG 3NQIA 2B39A 4WFN3 1EZ8A 1S5CD 2R3ZA 1D1IA 1BCPB 2A6ED 4MHEA 2WKCA 3A55A 4KD4A 4IUPA 1SYEA 2Q8TA 3H94A 2E2JB 1H9RA 5K36G 3SK5A 3BZDB 4KV6A 4KTAA 5C0XH 2FJ2A 2NVQB 2F3VA 1JWSD 3QO2A 3Q22A 4KKUA 5J22A 3VR4A 5C0XJ 2M00A 2F0OA 1EQTA 2LMCB 1PRTD 2K03A 3TZUA 5IGCA 2NTSA 2E76C 3BVGA 2DY7A 2N88A 1SNMA 2B2WA 3A8IE 1K8OA 2F0QA 3J80L 2EY5A 3QG1A 3MXUA 2X6LA 1EY5A 2F0IA 2Q8IB 1BBXC 5C4ZA 1GHJA 1S4ZA 3GQBA 3KUPA 2JEAI 3SK8A 2F0KA 2HCCA 3JAML 4FXGC 1H9MA 2MP1A 5C4XB 4PMCA 2BOSA 3WOEA 5DAUA 4K2LA 1O80A 2ID0A 2EJFC 4V0BA 3EA6A 5FOBB 3NPPA 4CKEA 4KJOA 1QNUA 2SNSA 3T4AC 2DN8A 1J8IA 1EEID 2IWHA 5CV8A 5M5YB 1IW7C 4M8AA 3I4MB 1TWGB 1G2TA 4FVMA 4H7BA 3GD7A 1EFID 1HXYD 3MXPA 4XIGS 3G6JB 1CA6A 1O7ZA 2NZ1D 2B8GA 2QDBA 4QMGA 2OF1A 1JCKB 1HFGA 1SYGA 2A69C 2EVBA 2MUYA 3OMCA 2L1BA 4C3HG 1JWMD 2X6GA 2EYLA 1Z47A 3H91A 1EYAA 1BCPC 4DK1A 1CK1A 4C56C 2EXZA 2Q8RE 2SNMA 4LK1C 1M8AA 1CZWA 4K5XA 4KI0A 5FK9C 4OL7A 3I3CA 3PIP3 2DNCA 2PZWA 2AWNA 5IT9L 1Y69U 5M9OA 2E2IB 1GUTA 4HSVA 4BBSB 1IKLA 2L55A 5D14A 1ILPA 5JEAH 2B63B 1WCMB 5CGKA 2B2YA 1VF7A 2K6AA 5JEAJ 4ZUJA 3URYA 4RKBA 1LTTD 1O78A 3QB3A 3ERQA 1DJRD 3SEBA 2K01A 1UEAB 1LLRD 3GTKB 1SYBA 1XYIA 1H9SB 2M2LA 4G57A 1W6KA 2F0HA 5JEAG 5C44B 1FNVA 1RHPA 1V1OA 1V1PB 2KCNA 4UAIA 1RD9D 3G7LA 4G7ZC 2CQAA 5C4HA 3JAME 1CTMA 1JOQA 3GTPB 1MSGA 1SEBD 1FGBD 3I72A 4FNFA 5IIFA 2F0EA 4PMBA 3S1QB 1R9TB 3TDQA 4H0LC 3OSOA 1BR9A 1Z6HA 4KJNA 1EY8A 3MWYW 4HTHA 2KHSA 4IUUA 3SXHA 3E0JA 5I2YA 1SYDA 1F2LA 2E2HB 3GTGB 1QB5D 3NWSA 3LWUA 3VYUA 1SYCA 3FKIB 2NN6I 4DA2A 1EIHA 4OO1G 3PUXA 5T1IA 5FO9B 4PMWA 2PYKA 2EY2A 1F9PA 4HCSA 3QWNA 1KDCA 5ELEA 3VA5A 5BN3A 1LV9A 3DWAA 2G9HD 1D5ZC 1H9JA 1CFMA 3DEOA 3K5NA 3FDTA 4F88A 4A3JB 4C2MB 4XQJA 3I90A 5HGTA 1TS3A 2WAQB 1TU2B 5IT9E 4F87A 3Q6SA 2F03A 3KK7A 3LNNA 4RGOS 1AN8A 1QJOA 1SNCA 5ELCA 3S1RB 1Q1BA 2K05A 3QOJA 4NDXA 2D9UA 1JQYD 1TWCB 2RKSA 2FMCA 3J81L 4PQXA 1D2BA 3FPPA 3C46A 1JORA 1PXUA 4KY5A 1XTCD 1VF5C 3OWEB 4GZYC 4EGVA 2F0UA 4L6TB 2K04A 5KYLA 2KEEA 3VYTA 3IL8A 3HG9A 1GUGA 2EDGA 3O13A 1MSHA 3K0YA 3W3AA 4WRDA 4YIJA 3DMUA 4X3KA 1W6JA 4F8MA 5DEHA 2O5IC 3CRKC 2F0LA 2PQEA 1QE6A 5CBAE 4ZKCB 1TT2A 5BN4A 2PCFB 4O1NA 3T56B 4OHJA 5DM63 1BNZA 2HDMA 3PUYA 4ME5A 2RDFA 2IPKD 4L63B 1BQQT 1PLFA 4QF4A 2RDGA 3NBHA 1HUNA 3EJIA 2XRSD 3D4WA 4LMQD 3AB9A 3FPUB 1JOOA 2XRQD 3I91A 3EFXD 1K83B 2L5TA 5JJZA 4DXGA 1Y8OB 1ESFA 4A3BB 1NR4A 4IUQA 1AW7A 1LTBD 4FF3A 2ICIA 2OT2A 1A6XA 2MGSA 1SAPA 1LT5D 1HA5A 2IW3A 3ND9A 1HFNA 3NWTA 4IUNA 2B2UA 1HTPA 2LS01 4Y7NB 3KBGA 1FNUA 1MD2D 5C6AA 2WKDA 3SE0A 4XQNA 2CHBD 2XWBB 3J81E 1PTOF 1SNOA 1R4QB 3SHLA 4IALA 1E2ZA 1I50B 2A6HD 2F0VA 1VDZA 3P7JA 4J8QA 3L3OC 1X3PA 1TY2A 4S3SA 2PPBC 1PRTF 2WINB 3OIQA 1SNDA 4HCEA 5CV4A 2JA7B 1B50A 4ZUIA 4KY6A 2DY8A 2NBFA 3NBIA 3GTOB 2V4DA 1NUCA 5IGBA 5BN5A 1MBYA 4KK7A 4TRDA 1RJTA 4A3EB 4ZK9B 5CV6A 4IFDJ 2JSOA 4KKTA 5KRUA 1OXXK 2PW5A 3A7AB 5CORA 2AUJD 3F2UA 3NTKA 5TSSA 4IQZA 3T13A 5C5LA 1SE3A 1HQRD 4EQOA 5HURA 3GTLB 2ZT9C 1PZID 2F0SA 2R7ZB 1Q3LA 1MI2A 5K36H 1LO5D 4I65A 1DXMA 3MC0B 5EGTA 1CQVA 1PMRA 1EY7A 1KABA 5AFWA 5CV9A 1VMPA 4XT3B 1EY6A 1SMYC 4IN3A 2M9VA 1EL0A 3MXGA 3DUZA 5ELBA 3H6MA 1Y8PB 5DNFA 1PTOD 3D6CA 1PFBA 1GUSA 3M7NA 1F2ZA 3K5MA 5EBCA 1V8QA 2JYOA 3MAQA 3MFGA 1D5XC 3GV6A 1C4QA 4BA2I 3V2TA 1ZYRD 3OW7A 4EQNA 4XXEA 3NP8A 2A68D 3BYTB 5M5WB 2NN6G 1SYFA 4X3UA 4QUFA 1DZ1A 3HRZC 4ZAIA 2F0NA 3ND8A 3PO3B 1D6EC 5D3DA 5G3LF 4ZRZA 1HQMC 2BDNA 1JC7A 1B2TA 4BWGB 4R8IA 2BCOA 4EVOA 1ZEQX 2XVSA 1EEFD 3NHHA 2NVYB 4HEDA 3D4DA 4RAUC 1Q12A 2JA8B 1TY0A 3BG3A 3TN2A 1B4OA 2KOLA 3R2IA 4BY7B 4ID6A 3FRPB 5KNDA 3HOZB 4R9WA 3DXJC 3P75A 3C1FA 1SNQA 2RA4A 3MZ5A 1A2UA 4C3IG 2AUKA 3GP7A 3PUWA 2L12A 2TMPA 3T16A 2QCPX 3OMGA 5CV7A 1NSNS 1LTGD 1D5MC 3VR3A 3SK4A 2SEBD 4KKSA 1RTNA 2FFKB 4NKLA 1G91A 1TKWB 5NUCA 2WP8J 3NSWA 4RFBA 1LTSD 4A3DB 3Q24A 4DU9A 1A3UA 3KLSX 4FXKC 2RSNA 1DONA 1F2MA 5A35A 2HUGA 1S5BD 5G3LD 2J7ZA 2ICEC 4DK0A 3OHXC 1EYDA 1B1ZA 1ILQA 1VCIA 1WTXA 3MVVA 5C5MA 3MXNA 3MA2B 3U9SA 1CHQD 2E2DC 4NW2A 5EQ0A 1DYQA 2O4XA 2QF7A 2I46A 1EWHA 3HEJA 2JP1A 1IYUA 3HKZB 1YNJC 2WIIB 2CW0D 1GXDC 2LKVA 5A2QL 4ZLTF 1AZPA 2EYPA 2EJGC 3C3LA 1Z7TA 2IX1A 3DHQA 4RH6A 3S1MB 3J80E 4IUVA 3HOXB 3TMEA 1U9RA 5IGFA 1OXTA 3CHBD 3PV0A 3AU7A 3NK9A 1EY9A 1O7YA 4DFAA 2ENBA 4KHZA 2SOBA 4K6DA 4XTCS 3Q23A 5LL6X 3I4NB 4XQQA 3RZOB 4MIUA 1DOKA 1I4QA 4IFDI 4OIKA 2VNUD 1CQFA 3D6WA 2A6EC 3TZDA 2D2CC 4OO1H 4CJ0B 4FO2A 1STYA 2H4OA 1HCZA 1T5XD 2LY7A 1FYCA 5EPJA 1YNND 3RZDB 4HR7B 2PW7A 1GHKA 4Q0FA 1HHVA 1K8MA 4C3JB 1PRTC 2X69A 3GTJB 2XWJB 2BE5D 1M4VA 1XX8A 1LABA 4ZKBB 5EBDA 3SK6A 2JEBI 2F0MA 4FF4A 5EJWA 1EZ6A 1TWFB 1XXGA 3TSSA 4WJWA 2KECA 1AFPA 2BA0A 3T53B 4XYOA 4K14A 2F0WA 1CZGA 1H9SA 5C0XI 4CKBA 3K5OA 4B08A 5I9OA 3J7AF 1EU3A 2Z1CA 3OOCA 1V1PA 1G6ZA 1E0BA 3TP5A 4HN7A 1E2WA 3S9WA 1HPCA 2JA5B 1PZJD 1QNKA 5KNCA 5T1GA 4N9PA 4CKCA 1TS4A 4JK1C 3MTSA 4H13C 5A2QE 3BDLA 3TP7A 2C9OA 1SJHD 3D3RA 3KF8A 3P1HA 3M85A 1LT4D 4A3GB 2L4NA 3NTHA 2B2VA 1L0YB 1X3QA 2K33A 1L0XB 1HRJA 1ESRA 4HMIA 3K6OA 1BUVT 4FF2A 1SMYD 3U9OA 3DWQA 1AZQA 1I4GA 2EZVA 5EKKA 2QEJC 3AMUA 5C3XA 3W2DA 1I6VC 3K57A 1F9QA 2EYFA 4A3MB 3K5LA 4WORA 3RUZA 2D62A 1O7LA 3QJYA 5ELDA 1PTOH 4KD3A 2TSSA 4R8NA 3HOVB 5IOCA 5IGDA 5E1FA 4A93B 1TWHB 1HA6A 1GUOA 1BOSA 1BCPF 1WTRA 1CHPD 3DEPA 4C3HB 1GUWA 4NMZA 4E6IA 3S16B 2F0JA 1DD2A 3DWPA 1RDPD 3I4LA 1RTOA 5D65A 3HZXA 4C1NI 2PZTA 5FO7B 1LTID 1U4MA 3R93A 1RF2D 2E75C 2NUCA 1I6HB 5J1ZA 4RGMA 3SDZA 5F2DA 1LT3D 1Q8IA 1G291 4ABNA 1PFNA 1TVXA 1S5DD 3A8KE 1XWEA 1IW7D 3IKJA 1ENAA 4H44C 1A15A 1OO9B 1B44D 5EPKA 3S17B 5EPLA 1ET9A 3LWEA 3M3YB 4TKOB 3NXWA 1WTOA 4V190 3VR5A 2WACA 5ELFA 2JXMB 1F9RA 4L8JA 5JPNC 2J0TD 5E4XA 2A5HA 2G9DA 2HQEA 4OIJA 1I4HA 2MPMA 1STNA 1QOHA 4U673 4A3KB 5IGEA 2A69D 3VA7A 1EWCA 2NYZD 3S1NB 3V96A 3A8JE 4FYDA 4KN7C 3V05A 1JB3A 1BCPD 2B8FA 3HGBA 2H1EA 1HUMA 5FKAC 3J7YW 1QILA 1SDFA 4P2CB 2NTTA 1A3TA 4LJZC 2B2UC 2BA1A 4XDXA 5LHY1 2F0FA 3E5SA 3L9AX 4K2KA 5CYUA 1TIID 1I3QB 2B2TA 1JR0D 1KDBA 1R4PB 1FD7D 4U68A 1TWAB 1V43A 5J39A 3VYRA 1OXSC 3I73A 3BS1A 2DNEA 4RGTA 1MGSA 1ZXTA 1PZKD 4KMUC 2IJ0A 3A56A 3X3MA 2F3WA 2L0CA 4QCLA 2KCCA 4TQUS 3RD4A 4DF7A 1WD0A 3EVQA 2HCIA 3CKIB 1JOKA 2XSCA 2AQ1B 3K58A 2ZXPA 4ILWA 2Z8LA 1OXUA 2QILA 4K8IA 1C48A 1JICA 4DAYA 2NN6H 1TS5A 1U4LA 1B53A 1TS2A 1UUPA 3OIPA 4C3JG 3SR1A 5CBEE 1HTLD 3RMHA 4DNRB 3R3OA 3S2DB 3S2HB 2GA4B 1EU4A 3A7LA 1H9KA 5JVG3 2F0PA 3NE5B 1PYWD 3KBXA 4KY7A 1SSOA 1WVLA 2C5CA 2EYJA 3HOYB 3IAYA 1ONLA 1BXTA 1LTAD 3H09A 4MN3A 3RLFA 1E2VA 1SE2A 5IGGA 4ZYSA 2KVMA 4J6HA 2R92B 1CI3M 1AP0A 4ZQ3A 2OEOA 2PMZB 4CGYB 5KIXA 4FP5D 3FEWX 2BDOA 5C0XG 2XIWA 1RODA 1KNEA 3I70A 1B9NA 3ZYYX 3CRLC 4CHTB 3EROA 2EY6A 3IFDA 3TP6A 3VR6A 1KNAA 1UNSA 2B2WC 3M4YA 1WTVA 1STAA 4AYBB 4TSSA 2IX3A 4KN4C 1X32A 3HOUB 1I4XA 1SE4A 2QKIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B2Y C;  3HP3 A;  4X3K A;  3TZD A;  1WTO A;  1BBX C;  2HDL A;  2JYO A;  1S4Z A;  5D14 A;  1F9R A;  1ILP A;  1EIH A;  5E4W C;  5CMD A;  4CJ0 B;  5T1I A;  1QE6 A;  1EIG A;  3KUP A;  3GV6 A;  5CBA E;  2HCC A;  1F9P A;  2HUG A;  3ONA B;  2B2Y A;  4HCS A;  5E4X A;  4ZKC B;  3GV3 A;  2MP1 A;  1JE4 A;  1AZQ A;  4OIJ A;  1JIC A;  2RVL A;  2J7Z A;  2FMM A;  2MPM A;  1O80 A;  3I8Z A;  3P7J A;  1DOM A;  1B53 A;  1U4L A;  4X3U A;  2SDF A;  5EKI A;  1WTP A;  5EPJ A;  2EOT A;  1LV9 A;  4DN4 M;  4QUF A;  1DZ1 A;  1BNZ A;  1X3P A;  4ZAI A;  2FHT A;  1ILQ A;  2HDM A;  1U4P A;  1WTQ A;  4CJ2 C;  4CJ1 B;  2RSO A;  2B2T C;  3N52 A;  2NYZ D;  1WTX A;  1F9Q A;  1PLF A;  5CBE E;  3DEO A;  1HHV A;  3FDT A;  2K01 A;  2BDN A;  4IUR A;  1BF4 A;  1HUN A;  1B50 A;  1XYI A;  2X69 A;  1B2T A;  2M2L A;  2IL8 A;  4NW2 A;  5EQ0 A;  1J8I A;  2VXW A;  1QG7 A;  3I90 A;  2DY8 A;  1F9S A;  1NR2 A;  4RWS C;  4R8I A;  4LMQ D;  1XX8 A;  3FPU B;  1EOT A;  2FIN B;  2JP1 A;  2K28 A;  1G2T A;  1RHP A;  1RJT A;  2H1E A;  1HUM A;  4UAI A;  4ZKB B;  3Q6S A;  2KED A;  4HED A;  4ZK9 B;  3I91 A;  2EPB A;  3SVM A;  1SDF A;  4RAU C;  4X3S A;  1HA6 A;  3G7L A;  1WTW A;  5EJW A;  2N55 A;  4ZLT F;  1PDQ A;  1BO0 A;  1WTR A;  2CVR A;  3DEP A;  3KBX A;  1AZP A;  2B2U C;  1GUW A;  1SSO A;  4O42 A;  4XDX A;  5COR A;  2R3Z A;  5JJZ A;  1WVL A;  2KEC A;  1CM9 A;  3TN2 A;  1C8C A;  4IUT A;  4XT1 B;  1IL8 A;  1B4O A;  1RTO A;  2KOL A;  2B2T A;  1NR4 A;  2L9H A;  3F2U A;  1MSG A;  2K05 A;  2L11 A;  4MHE A;  1DOL A;  1B3A A;  4MN3 A;  5D65 A;  4IUQ A;  1CA6 A;  1ICW A;  1O7Z A;  2D9U A;  1NCV A;  4R9W A;  3DM1 A;  2NZ1 D;  4U68 A;  4IUP A;  2B2V C;  2KVM A;  2Q8T A;  2RA4 A;  4QUC A;  2L12 A;  1HFG A;  1Q3L A;  1MI2 A;  4IUV A;  1AP0 A;  1U4M A;  2L1B A;  3R93 A;  2X6G A;  2K1B A;  2MJ8 A;  1G6Z A;  1E0B A;  1ML0 D;  2MGS A;  2FJ2 A;  1SAP A;  2XIW A;  1WD1 A;  1ROD A;  1IKM A;  3H91 A;  1KNE A;  1J9O A;  3MWY W;  2KUM A;  3QO2 A;  4X3T A;  5COY A;  2EE1 A;  5AFW A;  1QNK A;  5T1G A;  4IUU A;  1HFN A;  1VMP A;  4XT3 B;  1MGS A;  1EQT A;  1VMC A;  1PFN A;  1ZXT A;  1TVX A;  2B2U A;  2Q8R E;  1RTN A;  3IFD A;  1O7Y A;  2K03 A;  2FFK B;  3MTS A;  1M8A A;  1DON A;  2NWG A;  1EL0 A;  2K04 A;  1PFM A;  1KNA A;  1NAP A;  1U4R A;  2KEE A;  1G91 A;  2B2W C;  3IL8 A;  1WTV A;  1F2L A;  4HAE A;  1CA5 A;  2DY7 A;  2N88 A;  5DNF A;  3I3C A;  1WD0 A;  2L4N A;  3UI2 A;  1A15 A;  2B2W A;  2HCI A;  2B2V A;  1PFB A;  1X3Q A;  1X32 A;  1MSH A;  5EPK A;  5EPL A;  1DOK A;  3LWE A;  1HRJ A;  4RA8 A;  1ESR A;  4HSV A;  4OIK A;  3D6W A;  2X6L A;  2RSN A;  1IKL A;  1G2S A; 
#chains in the Genus database with same CATH topology
 1GOZ A;  3HP3 A;  4DR6 L;  5C3W A;  1EIG A;  2F0T A;  4XYQ A;  2VQE L;  1NBW A;  1UWV A;  2UU9 Q;  1II3 A;  3F2C A;  1KLG D;  2JA6 H;  2K5Q A;  1EYC A;  1TQO A;  1PTO B;  2HIX A;  4RCN A;  4WJ3 M;  1N36 Q;  1Q1E A;  2K14 A;  5EKI A;  3UE1 A;  4DN4 M;  4GN4 B;  3WOF A;  2I07 B;  4DV6 Q;  4JI0 L;  4JI4 L;  5E3F A;  1B8A A;  4LF6 Q;  4OXP A;  1WTH A;  5C3E B;  4DAP A;  3H3V C;  1EFW A;  4F7X A;  3PIO 3;  5ELO A;  2PQA B;  5IYB H;  4JBJ A;  3OPO A;  1PRT B;  3HOV G;  1Y1V B;  5JOB A;  1T9H A;  4B3S L;  4X64 L;  3D4R A;  4JI1 L;  1EQV A;  3B6Y A;  4X6A H;  5LMN L;  2KED A;  1RKN A;  1Y1W H;  3TRZ A;  1VQ4 A;  1IYV A;  3PMF A;  1RL2 A;  2YV5 A;  1CUK A;  4GS3 A;  1PDQ A;  2CVR A;  5JVH 3;  4BBR H;  3W5O A;  3KLR A;  3Q0A A;  1C8C A;  4IUT A;  3U4Z A;  4LFA L;  1KAA A;  2L9H A;  2A6H C;  3M4O B;  1UE1 A;  1WJJ A;  2VB3 X;  1VQP A;  4OEM B;  1JJC B;  1Q90 A;  2K32 A;  1KRT A;  4QUC A;  1MKH A;  2R93 B;  3FVQ A;  4K5W A;  5M3M H;  3ERS X;  1GJX A;  5AJ3 L;  4N9T A;  3HOW H;  4DAV A;  3L0O A;  1HR0 L;  1WD1 A;  4A3B G;  2O2L D;  4X3T A;  2EE1 A;  4LUO A;  3GTM B;  3MFY A;  3CMA A;  1VMC A;  4Y7N H;  1JMC A;  5M3F H;  5DLQ E;  1N9W A;  4GLA C;  4GNX C;  4B9X A;  1U4R A;  4GKK L;  1B9M A;  4DXF A;  2VUM H;  1PYB A;  2KJX A;  1JB7 A;  1UE7 A;  5I9P A;  3S15 H;  3LX0 A;  2OXP A;  3OWF A;  3M7G A;  2F4I A;  4JBW A;  1VQK A;  4Y52 H;  1QCB D;  3PUV A;  1SXT A;  3PQI A;  4YHH L;  4EQ5 A;  2B2Y C;  3CCM A;  1I4P A;  3RR5 A;  4DV7 L;  2JN4 A;  3P20 A;  1G8Z D;  1UE5 A;  5I6W A;  4QIW B;  3GV3 A;  1N33 Q;  4LAA A;  5FO8 B;  3S14 H;  4DV5 Q;  2WB1 B;  3KF6 B;  4Q5V A;  2Y0S B;  1WTP A;  2I5M X;  5CV5 A;  1YJW A;  4BS9 A;  5C4J B;  2JA7 H;  5IP7 H;  1WTQ A;  4NXM Q;  1SBB B;  3ICE A;  2GVA A;  5I6Y A;  4LNQ A;  4PZ6 A;  2NVT H;  2F0G A;  1STB A;  2QDL A;  5EKL A;  3J7A V;  4DR7 Q;  3M4Q A;  3BVM A;  4JOI A;  1Q8K A;  1QG7 A;  1A2T A;  4RWS C;  1PH9 A;  4MNO A;  1PTO C;  2K28 A;  2Q2U A;  1XMQ L;  3H0G B;  3T51 B;  4OWT B;  3A54 A;  4RGN A;  2WV6 D;  3J80 c;  2LFN A;  1WTW A;  3PF5 A;  3VYS A;  2N55 A;  3GDE A;  2JA9 A;  5IP7 G;  2JA7 G;  4FF1 A;  4G4K A;  5KEE A;  1H95 A;  1LT6 D;  4DGZ A;  3BYY B;  1CM9 A;  2LSS A;  1SNP A;  4LF6 L;  5KYI A;  5FLX L;  1IL8 A;  2AWO A;  1ZYR C;  1XPO A;  2K5N A;  1B3A A;  1DOL A;  2R7Z H;  2A68 C;  2E74 C;  5EAY A;  2EYM A;  3DM1 A;  4A3E G;  1X6O A;  4OGQ C;  4RHR A;  4DUY L;  1IHZ A;  2KQ3 A;  2RBM A;  4J15 A;  1MHW C;  2F4V Q;  4NXN Q;  5FJ8 H;  2IT1 A;  1SJE D;  5ELN A;  4C1N K;  1IKM A;  2KUM A;  5COY A;  4MZ9 A;  1ASY A;  5D3I B;  4BY1 B;  1K9M C;  4FXD A;  3R8B A;  2E2J H;  1JWU D;  1V1Q A;  4X62 Q;  4M1U B;  5DM7 3;  3X3N A;  1HNW Q;  3K59 A;  4BA1 I;  3HS0 C;  4RHS A;  1STH A;  3CQZ B;  2NVQ H;  1EY4 A;  3CU7 A;  2AKW B;  2O5J C;  3R2T A;  2ZXR A;  4FDB A;  2AQ3 B;  5BR8 Q;  2UUB L;  1EQQ A;  4PNY A;  1BDO A;  2J4X A;  5E4W C;  4K6L A;  5CMD A;  5M5W H;  1NMF A;  1LAC A;  4DR1 L;  2K5W A;  1STE A;  3BVZ A;  5KNB A;  4PV1 C;  3BDC A;  2FMM A;  3RNU A;  2PO4 A;  2EYH A;  1JE5 A;  4X65 L;  3NEL A;  2EOT A;  2ASB A;  1U4P A;  3J80 i;  4CJ2 C;  3K7A B;  5ISR A;  4HID A;  3N52 A;  2EYO A;  2D5D A;  5JAV A;  3QR8 A;  1BF4 A;  4HJA A;  1L0W A;  1KL9 A;  5C4X H;  3JAM i;  1SN8 A;  2ZXO A;  3GTQ B;  2Z4H A;  2NB0 A;  4R4O A;  4JI8 L;  5K5P A;  4L5T A;  5GQO A;  3C1E A;  2PNR C;  2UXB L;  1ET6 A;  3PO3 G;  2EPB A;  3IFT A;  3SVM A;  5M5X B;  4DV5 L;  1PH7 A;  4C3I B;  1SFO B;  3C2P A;  4X3S A;  5LMU Q;  3PUZ A;  4B3R Q;  4O42 A;  1DCZ A;  5M5Y H;  2VQF L;  1K8G A;  2EY1 A;  1S5E D;  3HOZ H;  4XT1 B;  1G51 A;  4DR5 Q;  1FR3 A;  4DR7 L;  1KHI A;  3KJP A;  4EQP A;  4ODG A;  2GVB A;  3TBI B;  3AFP A;  3A0J A;  4GOP A;  2B2V C;  2K5D A;  4RKL A;  3ITP A;  4I7Z C;  2JA8 G;  4LFC L;  1T5E A;  2K1B A;  2PZU A;  2ZJQ A;  3CCU A;  4IPH A;  1PHJ A;  4CDE C;  1KDA A;  4YWL A;  1AEX A;  4BY7 G;  1J9O A;  2L15 A;  3CC2 A;  4IZ8 A;  5I4D A;  3NEM A;  2K5H A;  2RQX A;  1PA6 A;  3PO2 B;  4HIO A;  1S5F D;  4G7O C;  3GO5 A;  4K8J A;  1PFM A;  4A3D H;  2CW0 C;  4HSP A;  1ASZ A;  1IBL Q;  2JA6 B;  2UUA L;  3UI2 A;  5FLX E;  3STB D;  1A62 A;  1LTR D;  2XNA C;  4RA8 A;  1QUQ A;  1LUZ A;  4A3I B;  2Q2T A;  1G2S A;  3J7A 5;  1QWY A;  4UY8 C;  4L5R C;  3ONA B;  2I0Q A;  2RVL A;  3D8G A;  2ES2 A;  2F1M A;  3E6Z X;  4A3D G;  2E2I H;  1ENF A;  4X62 L;  1DOM A;  2SDF A;  1GUN A;  1HNW L;  3MHB A;  2A73 B;  2EJM A;  1DM0 B;  4LF4 L;  1STG A;  4CJ1 B;  2YU9 B;  1ENC A;  3QOL A;  1Y1W B;  4APV A;  1UE6 A;  2B63 H;  4HMJ A;  1WCM H;  4DNT B;  1CT1 D;  3KOJ A;  3EQL C;  4BBR B;  1OXV A;  1A3V A;  2AQ2 B;  1D8L A;  3HKZ E;  5CR3 A;  5CC4 A;  1D1K A;  1N8R C;  1EOT A;  3Q8D A;  4LF7 Q;  3S24 A;  1KQS A;  3CCE A;  2UXD L;  5KGU A;  3EBE A;  5H1S E;  1BO0 A;  4LWC A;  2IX0 A;  2Z4I A;  2MO1 A;  5M3M B;  1E1T A;  2KEN A;  2K7V A;  2KA7 A;  5IOD A;  5C44 H;  3J7Z C;  1AE3 A;  3HOW B;  3S1M H;  2L11 A;  1ICW A;  3HKZ G;  1NCV A;  1ZKO A;  2ATW A;  3PF4 A;  2XGT A;  1F2Y A;  4BXX H;  1YNN C;  5M3F B;  3N6R A;  4IOC A;  1FNW A;  1BBU A;  3JC6 6;  4B9W A;  4AQY L;  4B3M Q;  4A3F B;  1N34 L;  2R61 A;  4CBV A;  2MJ8 A;  4QB4 A;  5I2X A;  1ML0 D;  3VR2 A;  2VUM B;  1IL2 A;  3S15 B;  3GTP H;  2ZJR A;  3MEH A;  5LMU L;  2YYZ A;  1Y8N B;  2BE5 C;  4IO9 A;  3FMC A;  5JPM C;  5LL6 S;  3NQT A;  4UDU C;  1HNZ Q;  4G7H C;  3I4N H;  2V1C C;  4A4I A;  3D31 A;  3RZO H;  1RCV D;  1R9T H;  3S1Q H;  3E9H A;  1VQG A;  2NWG A;  3ZJY C;  1NAP A;  3HOX G;  1FL0 A;  1VQD A;  1F77 A;  4HAE A;  1CA5 A;  4OO1 I;  2ZM6 L;  3S14 B;  2QA4 A;  1SLJ A;  2A74 C;  1YNJ D;  1XTD A;  1CKN B;  2OQK A;  3L7Z C;  1K3B C;  2XN9 C;  4DR6 Q;  1BVS A;  4Z9C B;  2HDL A;  4X66 L;  2EIF A;  4NP5 A;  2NVT B;  1W3S A;  2VB2 X;  4J1M A;  1D7Q A;  2WB1 G;  2Y0S G;  3J81 c;  3QIA A;  2E2H H;  4ULL A;  3TP8 A;  3H3V I;  4IFD H;  3RZD H;  2P5Z X;  1JJ2 A;  2RDH A;  2R6G A;  3GTG H;  1JE4 A;  3I4N G;  4RCO A;  3I8Z A;  3PCO B;  2MHV A;  1KLU D;  1UAP A;  4JI0 Q;  2ALY B;  1EY0 A;  2F0D A;  2FHT A;  4C3J H;  2MQH A;  2NVX B;  1TR5 A;  2RSO A;  2WFW A;  2B2T C;  1KTK A;  3KLS A;  3NTI A;  3WDN A;  1XNQ Q;  4IUR A;  4KHV A;  1PVO A;  3BDO A;  2IL8 A;  2VXW A;  4B3S Q;  2JE6 I;  1I4R A;  1F9S A;  4K5V A;  3NUC A;  4R4I A;  1NR2 A;  2FIN B;  5LMN Q;  4GKJ L;  4IFD G;  3NQI A;  2B39 A;  4JPB W;  4DKA C;  3ER0 A;  4WFN 3;  1EZ8 A;  2CFM A;  4C2M H;  1S5C D;  2R3Z A;  4LFA Q;  1U0L A;  1D1I A;  1BCP B;  2A6E D;  4MHE A;  2K4K A;  2WKC A;  3A55 A;  3CCQ A;  1J5E L;  1AH9 A;  4KD4 A;  4IUP A;  1SYE A;  2Q8T A;  1PV4 A;  3H94 A;  2E2J B;  1XMO L;  2Z6K A;  5AJ3 Q;  1H9R A;  5IY0 A;  1Z9F A;  2E5L Q;  3SK5 A;  5K36 G;  3BZD B;  4KV6 A;  4KTA A;  1HR0 Q;  5C0X H;  1IXR A;  1QZG A;  2FJ2 A;  3S1R H;  2NVQ B;  2F3V A;  1JWS D;  3QO2 A;  3Q22 A;  4KKU A;  5J22 A;  3VR4 A;  5C0X J;  2M00 A;  3UDF A;  2F0O A;  1EQT A;  2LMC B;  3HKS A;  4GKK Q;  1PRT D;  2K03 A;  4A3G H;  1K0S A;  3TZU A;  3J81 i;  5IGC A;  2NTS A;  2BH2 A;  2E76 C;  3BVG A;  3CCR A;  4GNX B;  2DY7 A;  2N88 A;  4IPD A;  1SNM A;  3CCL A;  2B2W A;  3A8I E;  3MXN B;  1K8O A;  4A75 A;  2F0Q A;  2JA5 G;  3J80 L;  2NZH A;  1EOV A;  2EY5 A;  3QG1 A;  3MXU A;  2GN5 A;  2X6L A;  1EY5 A;  1X55 A;  2F0I A;  2DJG C;  2Q8I B;  3CAM A;  5C4Z A;  1GHJ A;  1S4Z A;  1BBX C;  1NNX A;  3GQB A;  3KUP A;  2JEA I;  3SK8 A;  1X3E A;  2F0K A;  2HCC A;  3JAM L;  4FXG C;  1H9M A;  2MP1 A;  4A3G G;  1PFS A;  5C4X B;  4PMC A;  2BOS A;  3WOE A;  1L1O C;  5DAU A;  3KDF A;  4K2L A;  1O80 A;  1MJE A;  2ID0 A;  2EJF C;  1LM0 A;  4V0B A;  3EA6 A;  2VS1 A;  5FOB B;  3NPP A;  4CKE A;  4KJO A;  1QNU A;  2SNS A;  3T4A C;  1Q82 C;  1GD7 A;  1X56 A;  3OW2 A;  2DN8 A;  1J8I A;  1EEI D;  2IWH A;  5CV8 A;  5M5Y B;  3HOV H;  1IW7 C;  1SE8 A;  4M8A A;  1XMQ Q;  2VZA A;  3I4M B;  1EIF A;  1TWH H;  1TWG B;  4KLK A;  1G2T A;  4C3H H;  1KXL A;  4FVM A;  4GLV B;  4A3M G;  4H7B A;  3GD7 A;  1EFI D;  1HXY D;  3MXP A;  3UDI A;  4XIG S;  3G6J B;  1B70 B;  1XNQ L;  1CA6 A;  1NE3 A;  1O7Z A;  2LXK A;  3K81 C;  4DUY Q;  2NZ1 D;  4A93 G;  2B8G A;  2QDB A;  4QMG A;  2OF1 A;  1JCK B;  1HFG A;  1SYG A;  2A69 C;  2EVB A;  3OMC A;  3I7F A;  2MUY A;  1K83 H;  2L1B A;  4C3H G;  1I6H H;  1JWM D;  4P72 A;  2X6G A;  4UP7 A;  3CCV A;  1KC8 C;  2EYL A;  1Z47 A;  4A3B H;  3H91 A;  1EYA A;  2KCM A;  1BCP C;  1EYG A;  4DK1 A;  1CK1 A;  1U5K A;  4C56 C;  1YIJ A;  2EXZ A;  2Q8R E;  2SNM A;  3NEN A;  4LK1 C;  4OX9 L;  1M8A A;  1CZW A;  1KRS A;  4DV2 L;  4K5X A;  4KI0 A;  5FK9 C;  3ULJ A;  1SR3 A;  1HZ9 A;  4OL7 A;  3I3C A;  3PIP 3;  2DNC A;  2PZW A;  1PH1 A;  2AWN A;  5IT9 L;  1Y69 U;  5M9O A;  2E2I B;  2UUB Q;  1GUT A;  2E5L L;  4HSV A;  4BBS B;  1IKL A;  2L55 A;  5D14 A;  1ILP A;  5JEA H;  4DR1 Q;  2B63 B;  1WCM B;  1PH6 A;  5CGK A;  2B2Y A;  1VF7 A;  4LF5 L;  2K6A A;  5JEA J;  4ZUJ A;  4X65 Q;  5J3B A;  3S1N H;  3URY A;  2B29 A;  4RKB A;  3VDY A;  1LTT D;  1O78 A;  3QB3 A;  2YTV A;  3ERQ A;  2IHF A;  1DJR D;  3A5U A;  4JW0 A;  2QW7 A;  3DM3 A;  4A76 A;  3SEB A;  2K01 A;  1UEA B;  1LLR D;  3GTK B;  1SYB A;  1XYI A;  1H9S B;  1I50 H;  4JI8 Q;  2M2L A;  4G57 A;  1W6K A;  4N8F A;  2F0H A;  4DV0 L;  5JEA G;  1QZH A;  5C44 B;  1QVC A;  2UXB Q;  1FNV A;  1RHP A;  1V1O A;  4A3K G;  1V1P B;  1YVC A;  2KCN A;  4UAI A;  4WJ4 A;  1YNX A;  1RD9 D;  3BU2 A;  3G7L A;  4G7Z C;  2VQF Q;  2CQA A;  5C4H A;  3JAM E;  3G6E A;  1CTM A;  1JOQ A;  3GTO H;  1TWA H;  3GTP B;  1MSG A;  1SEB D;  1C9O A;  1FGB D;  3I72 A;  4PZ7 A;  3KF8 B;  4FNF A;  4A3E H;  5IIF A;  2PQA A;  2F0E A;  1BKB A;  4PMB A;  4LFC Q;  3S1Q B;  1R9T B;  3TDQ A;  4JBK A;  4H0L C;  3CD6 A;  2HT1 A;  3OSO A;  1BR9 A;  1Z6H A;  4KJN A;  1EY8 A;  3EN2 A;  4K0K L;  3I55 A;  3MWY W;  4HTH A;  2KHS A;  4IUU A;  3SXH A;  3E0J A;  5I2Y A;  3GTL H;  1SYD A;  1LYL A;  2Z0S A;  2UUA Q;  1F2L A;  2E2H B;  3GTG B;  1QB5 D;  1OTC A;  3NWS A;  3LWU A;  3VYU A;  1L2F A;  2KCT A;  4I7A A;  1SYC A;  1SRO A;  2DUD A;  3FKI B;  2NN6 I;  1K0R A;  4DA2 A;  1EIH A;  4OO1 G;  3PUX A;  5T1I A;  5FO9 B;  4PMW A;  3UDG A;  2UXC Q;  5JJL A;  2PYK A;  2EY2 A;  1F9P A;  4HCS A;  3QWN A;  1KDC A;  5ELE A;  2CKZ B;  1K3R A;  4HIK A;  3VA5 A;  2MFI A;  5BN3 A;  3TQY A;  4LF4 Q;  1LV9 A;  3DWA A;  2PI2 A;  2G9H D;  2D0P A;  4IJL A;  3A5Z B;  1D5Z C;  3S2H H;  1H9J A;  1CFM A;  3DEO A;  2KHI A;  3FDT A;  3K5N A;  4F88 A;  4A3J B;  4AIM A;  3K8A A;  1HZA A;  4C2M B;  4XQJ A;  4LF9 L;  3I90 A;  5HGT A;  1TS3 A;  2WAQ B;  1TU2 B;  5IT9 E;  1FGU A;  3E9I A;  4F87 A;  4QY7 A;  1Q86 C;  4DR3 L;  3PO3 H;  2UXD Q;  3Q6S A;  2F03 A;  4R4T A;  1XPR A;  3KK7 A;  3LNN A;  3KF6 A;  3HOY H;  1G6P A;  4RGO S;  1AN8 A;  1QJO A;  1SNC A;  1GVP A;  5ELC A;  3KLW A;  3PGZ A;  3CPF A;  3E3X A;  3S1R B;  1Q1B A;  2K05 A;  2N49 A;  3QOJ A;  1VQJ A;  3D0F A;  4YWM A;  4NDX A;  2D9U A;  1JQY D;  2NVY H;  1TWC B;  2RKS A;  2FMC A;  3RN5 A;  3J81 L;  4PQX A;  4AQY Q;  1D2B A;  3FPP A;  1N34 Q;  3J81 j;  3C46 A;  2JA8 H;  1PXU A;  1JOR A;  1EIY B;  4KY5 A;  2RF4 A;  4BY7 H;  4JV5 Q;  1XTC D;  1VF5 C;  3HOY G;  3OWE B;  4GZY C;  4EGV A;  1VQ9 A;  2F0U A;  2K5V A;  2R92 G;  4L6T B;  2K04 A;  5KYL A;  2KEE A;  3VYT A;  3IL8 A;  3HG9 A;  2ZM6 Q;  3I56 A;  1GUG A;  2EDG A;  3O13 A;  1MSH A;  3K0Y A;  3W3A A;  4WRD A;  4X66 Q;  2I5L X;  4YIJ A;  4DV3 Q;  1PH4 A;  3DMU A;  4X3K A;  1W6J A;  4F8M A;  5DEH A;  2O5I C;  3CRK C;  2F0L A;  2PQE A;  1QE6 A;  5CBA E;  4ZKC B;  4AH6 A;  1TT2 A;  2CH4 W;  5BN4 A;  4AYB G;  2PCF B;  4QQB X;  4O1N A;  1YJN A;  3HOU G;  3T56 B;  1VQF A;  4OHJ A;  5DM6 3;  1BNZ A;  2RHQ B;  2HDM A;  2JK8 A;  1CSQ A;  4MTN A;  3PUY A;  4ME5 A;  2RDF A;  2IPK D;  2Q2H A;  4L63 B;  1BQQ T;  1PLF A;  2E8G A;  4QF4 A;  2RDG A;  3NBH A;  1HUN A;  3EJI A;  4LW1 A;  4GOP C;  2XRS D;  3D4W A;  5LMN W;  3RLO A;  4GKJ Q;  4LMQ D;  3AB9 A;  3FPU B;  2UXC L;  1JOO A;  2XRQ D;  1XPU A;  4JI5 L;  4O2D A;  3F2D A;  3WWV A;  3I91 A;  5C3E G;  3EFX D;  1VQO A;  1K83 B;  2L5T A;  5JJZ A;  4DXG A;  2I5H A;  1Y8O B;  1EQR A;  1ESF A;  2VW9 A;  1Y1V G;  1MJC A;  4A3B B;  1NR4 A;  1J5E Q;  1PYS B;  3M4P A;  4IUQ A;  1AW7 A;  1XMO Q;  1LTB D;  1CKM A;  4FF3 A;  1HR0 W;  1YZ6 A;  4GN3 B;  2ICI A;  2OT2 A;  3OYY A;  2EQS A;  2F3I A;  4JBM A;  1A6X A;  2MGS A;  1O7I A;  5FLX c;  1SAP A;  4LFB L;  1LT5 D;  2JQO A;  1HA5 A;  2IW3 A;  4ALP A;  3ND9 A;  1HFN A;  3NWT A;  2N3S A;  4IUN A;  1GM5 A;  2B2U A;  4DAY B;  5GAD C;  1HTP A;  2LS0 1;  3W1B A;  3HOX H;  1Q7Y C;  2R93 G;  4OON A;  4Y7N B;  4JC0 A;  2HD3 A;  3A74 A;  1FNU A;  1MD2 D;  3KBG A;  5C6A A;  4HJ9 A;  4JI3 L;  2WKD A;  3SE0 A;  2BH8 A;  4XQN A;  1X3F A;  2CHB D;  2XWB B;  3J81 E;  1K73 C;  4QIW E;  1PTO F;  4JV5 L;  4POG A;  1SNO A;  1R4Q B;  3SHL A;  1C0A A;  4IAL A;  2WB1 E;  1E2Z A;  2Y0S E;  1I50 B;  2A6H D;  2F0V A;  1VDZ A;  3P7J A;  4QGU A;  1L1O B;  4OWX B;  4J8Q A;  2Q2I A;  3L3O C;  1XNR L;  1X3P A;  1TY2 A;  4S3S A;  2PPB C;  1B7Y B;  1PRT F;  2WIN B;  3OIQ A;  1SND A;  4HCE A;  5CV4 A;  4JI7 L;  2JA7 B;  1B50 A;  4ZUI A;  4KY6 A;  4DV3 L;  2DY8 A;  4IJH A;  2NBF A;  3NBI A;  3GTO B;  2V4D A;  1NUC A;  5IGB A;  1GO3 E;  5HY6 A;  3ULP A;  2CCZ A;  5BN5 A;  1MBY A;  1YHQ A;  4KK7 A;  4ME3 A;  1RJT A;  4TRD A;  4A3E B;  4ZK9 B;  5CV6 A;  4IFD J;  3F8T A;  2JSO A;  5JJK A;  4KKT A;  1HNX L;  5KRU A;  1OXX K;  4JVZ A;  2PW5 A;  3GTJ H;  3A7A B;  5COR A;  4JI6 Q;  2AUJ D;  2HHH Q;  4NB3 A;  2F52 A;  3F2U A;  3NTK A;  5TSS A;  4IQZ A;  3H0G G;  3T13 A;  5C5L A;  1SE3 A;  3T1Y L;  1HQR D;  4DV1 L;  4EQO A;  5HUR A;  3GTL B;  1I94 L;  2ZT9 C;  1HZB A;  1PZI D;  2F0S A;  2R7Z B;  1DGS A;  1Q3L A;  1MI2 A;  5K36 H;  1TWF H;  1LO5 D;  4QL5 A;  4I65 A;  4BY1 H;  1QVF A;  4LF8 Q;  4JCV E;  1DXM A;  4UP8 A;  2KHJ A;  3MC0 B;  2K75 A;  1CQV A;  1PMR A;  1EY7 A;  1KAB A;  5AFW A;  5EGT A;  5CV9 A;  1VMP A;  4XT3 B;  4OX9 Q;  4HJ7 A;  1EY6 A;  1SMY C;  4DV2 Q;  4IN3 A;  4MTK A;  2M9V A;  3G71 A;  1EL0 A;  3MXG A;  3DUZ A;  1JT8 A;  5ELB A;  2DGY A;  3H6M A;  1Y8P B;  5DNF A;  1PTO D;  1XJV A;  3FKI G;  3D6C A;  1WYD A;  1PFB A;  2JA5 H;  1GUS A;  3CW2 C;  3M7N A;  1M90 C;  1F2Z A;  4BY1 G;  2K50 A;  3K5M A;  2UUC L;  3T1H Q;  5EBC A;  1V8Q A;  2JYO A;  3MAQ A;  3MFG A;  1D5X C;  4LF5 Q;  3GV6 A;  1C4Q A;  1YJ9 A;  4BA2 I;  3V2T A;  1ZYR D;  3OW7 A;  4EQN A;  4XXE A;  3NP8 A;  3E0E A;  5JJI A;  2A68 D;  3BYT B;  5M5W B;  2NN6 G;  1SYF A;  4X3U A;  4QUF A;  1DZ1 A;  3HRZ C;  4ZAI A;  4A3J G;  2F0N A;  3ND8 A;  2Z9H A;  1BBW A;  3PO3 B;  1D6E C;  5D3D A;  3G48 A;  5G3L F;  3GTQ H;  4ZRZ A;  1HQM C;  2BDN A;  1JC7 A;  4DV0 Q;  1B2T A;  4BWG B;  1CKN A;  4R8I A;  3UE0 A;  1E7Z A;  2BCO A;  4EVO A;  1PH2 A;  4DAM A;  1SFO H;  1ZEQ X;  2XVS A;  1EEF D;  3NHH A;  2NVY B;  3STB C;  4HED A;  3D4D A;  4RAU C;  4A3M H;  4DUZ L;  4IPC A;  5IYD G;  3FHW A;  4YCW A;  1Q12 A;  2JA8 B;  5GAG C;  1TY0 A;  3BG3 A;  3TN2 A;  2RCF A;  1B4O A;  2KOL A;  3R2I A;  4HJ8 A;  3CPW A;  4BY7 B;  4ID6 A;  1WI5 A;  4CDF C;  3PIO A;  4A3C G;  4YCV A;  2CWA A;  3FRP B;  5KND A;  3HOZ B;  4R9W A;  3DXJ C;  3P75 A;  3C1F A;  3UDX A;  4A93 H;  1SNQ A;  2RA4 A;  3MZ5 A;  3AYH B;  1A2U A;  4C3I G;  2AUK A;  3GP7 A;  3PUW A;  2L12 A;  2TMP A;  3T16 A;  1C7Y A;  2OWO A;  1QVG A;  4HJ5 A;  2QCP X;  2OQ0 A;  3OMG A;  3S16 H;  2H5X A;  5CV7 A;  2A19 A;  1NSN S;  4K0K Q;  1LTG D;  3AFQ A;  5E7N A;  1D5M C;  3VR3 A;  3SK4 A;  3HFZ B;  2SEB D;  3K7U C;  1SRU A;  4JI6 L;  4KKS A;  2HHH L;  1RTN A;  2FFK B;  4NKL A;  1IYJ B;  1G91 A;  5IP9 G;  1TKW B;  5NUC A;  2WP8 J;  3NSW A;  1VQL A;  1MIU A;  3U50 C;  4A3I H;  1GKH A;  4RFB A;  1LTS D;  4A3D B;  3PIP A;  3Q24 A;  4DU9 A;  4JI2 L;  3M9B A;  1A3U A;  3KLS X;  4FXK C;  2QEX A;  3PO2 G;  2RSN A;  1DON A;  4LF8 L;  4DR2 Q;  1YHA A;  3OTO Q;  1F2M A;  1RIP A;  1NY4 A;  5A35 A;  2HUG A;  2C35 B;  1S5B D;  5G3L D;  3TS0 A;  2JA6 G;  4P74 A;  2ZTC A;  2J7Z A;  4YCU A;  2YU9 H;  2ICE C;  4DK0 A;  3OHX C;  3S17 H;  3M3Y H;  3DLL A;  1EYD A;  1ILQ A;  1B1Z A;  4GNX A;  4A3I G;  1VCI A;  1WTX A;  4DK3 C;  3MVV A;  5C5M A;  3MXN A;  4LF9 Q;  3MA2 B;  3U9S A;  1W2B A;  1CHQ D;  1VQI A;  2E2D C;  4NW2 A;  5EQ0 A;  3T1H L;  1IBM L;  1DYQ A;  2O4X A;  2QF7 A;  5IYB G;  2I46 A;  1EWH A;  3HEJ A;  3L2P A;  4DR3 Q;  2JP1 A;  3IRB A;  4A3K H;  2B3G A;  1IYU A;  3HKZ B;  1YNJ C;  2WII B;  2CW0 D;  1Y1W G;  1GXD C;  2LKV A;  5A2Q L;  4ZLT F;  1AZP A;  4H02 A;  2EYP A;  4P75 A;  1CKO A;  2EJG C;  4BBR G;  1FJG Q;  1YEZ A;  3C3L A;  3CME A;  1Z7T A;  2IX1 A;  3CCS A;  4UP9 A;  4A3F H;  3RN2 A;  3DHQ A;  4RH6 A;  3S1M B;  1VQ8 A;  3J80 E;  1UEB A;  4IUV A;  3HOX B;  1PH3 A;  2CQO A;  3TME A;  1U9R A;  5IGF A;  1OXT A;  3CHB D;  5M3M G;  3PV0 A;  3AU7 A;  3NK9 A;  1I3Q H;  3HOW G;  4DV4 Q;  4B3T L;  2MO0 A;  2R7F A;  4ZCK A;  4UPA A;  1EY9 A;  1O7Y A;  4DFA A;  5M3F G;  4OEL B;  2ENB A;  4KHZ A;  4POF A;  1YBY A;  2SOB A;  4P73 A;  4K6D A;  4YY3 L;  4A3F G;  4NPS A;  4RG1 A;  4XTC S;  3Q23 A;  5LL6 X;  3I4N B;  4XQQ A;  3RZO B;  4MIU A;  2VUM G;  5GAH C;  1DOK A;  1VQ7 A;  1I4Q A;  1PH5 A;  4IFD I;  4OIK A;  2VNU D;  1CQF A;  3D6W A;  2A6E C;  3TZD A;  2D2C C;  4PZ8 A;  4OO1 H;  2XTI A;  4FO2 A;  4CJ0 B;  2RHS B;  3CXC A;  1STY A;  2H4O A;  3CC7 A;  1HCZ A;  1T5X D;  2LY7 A;  2UU9 L;  1FYC A;  2NVX H;  5EPJ A;  1YNN D;  1N36 L;  3RZD B;  4HR7 B;  1FVI A;  2PW7 A;  3H3V H;  1GHK A;  1YHB A;  4JOI C;  2Z6B A;  2IHE A;  4Q0F A;  4DV6 L;  1HHV A;  1K8M A;  4C3J B;  4JG2 A;  3JAM c;  1PRT C;  2X69 A;  3GTJ B;  1KAW A;  4GOP B;  2XWJ B;  4DR2 L;  2BE5 D;  1M4V A;  4YWK A;  1EUJ A;  3OTO L;  1XX8 A;  1EWI A;  4JI5 Q;  1LAB A;  4ZKB B;  5EBD A;  3SK6 A;  2JEB I;  2F0M A;  4O0A A;  4FF4 A;  5EJW A;  4RMF A;  1EZ6 A;  2QGQ A;  1TWF B;  2G5D A;  3S2D H;  1XXG A;  3TSS A;  4WJW A;  2KEC A;  2YTY A;  2LXJ A;  1AFP A;  3CC4 A;  2BA0 A;  2FXQ A;  3T53 B;  4XYO A;  1X3G A;  4K14 A;  1VQH A;  2F0W A;  1CZG A;  2R7Z G;  1H9S A;  3EIV A;  2YTX A;  1IZ6 A;  5C0X I;  4CKB A;  3U58 A;  3K5O A;  4B08 A;  4KHP Q;  5I9O A;  3J7A F;  1EU3 A;  2Z1C A;  1QUQ B;  4TVA B;  3OOC A;  5FJ8 G;  1V1P A;  3NBH B;  4LFB Q;  1G6Z A;  1E0B A;  1VQN A;  3TP5 A;  4DK6 C;  4HN7 A;  1E2W A;  3S9W A;  1HPC A;  3ULL A;  2JA5 B;  1PZJ D;  1QNK A;  5KNC A;  5T1G A;  4N9P A;  1KIX A;  4CKC A;  1TS4 A;  5HGQ A;  4JK1 C;  1FJG L;  4LUZ A;  2R92 H;  3MTS A;  3KYH C;  4CDC C;  4H13 C;  1E22 A;  5A2Q E;  3BDL A;  3TP7 A;  4JI3 Q;  2C9O A;  1SJH D;  3D3R A;  3KF8 A;  3P1H A;  3I4O A;  3M85 A;  1LT4 D;  2PMZ E;  4A3G B;  2L4N A;  3NTH A;  5GAE C;  1E24 A;  2B2V A;  1L0Y B;  1X3Q A;  4IPG A;  2K33 A;  1L0X B;  1HRJ A;  1ESR A;  4HMI A;  2ZTE A;  4DV4 L;  4OWW B;  3K6O A;  1BUV T;  4L5S A;  4FF2 A;  1SMY D;  2D0O A;  3U9O A;  1P16 A;  3DWQ A;  1VQM A;  1AZQ A;  4N8X 1;  4QJF A;  2OTL A;  1N33 L;  4AYB E;  5IT9 c;  1XNR Q;  1I4G A;  4HIM A;  2EZV A;  3HOU H;  3H15 A;  5EKK A;  2QEJ C;  4R4Q A;  3TRE A;  5C3X A;  3AMU A;  3W2D A;  1I6V C;  4DR4 Q;  3I2Z A;  3K57 A;  1Q46 A;  4JYA Q;  4JI7 Q;  1F9Q A;  2EYF A;  4EX5 A;  4A3M B;  4NXM L;  3K5L A;  4WOR A;  3RUZ A;  3BZK A;  3I4M H;  2D62 A;  1O7L A;  3QJY A;  1HH2 P;  1TWG H;  5ELD A;  2RCN A;  1PTO H;  5C4X G;  4KD3 A;  2KBN A;  1VQE A;  2TSS A;  3TS2 A;  5IYC H;  4R8N A;  2HIV A;  3AEV A;  3HOV B;  5IOC A;  5IGD A;  1HNX Q;  5E1F A;  4A93 B;  5C3E H;  3CCJ A;  1TWH B;  1HA6 A;  3MEF A;  1GUO A;  1X9N A;  1BOS A;  1BCP F;  1WTR A;  1CHP D;  3DEP A;  3LGJ A;  4CDD C;  4C3H B;  1GUW A;  4NMZ A;  4E6I A;  3S16 B;  2F0J A;  1DD2 A;  3DWP A;  1Y1V H;  3HOZ G;  1RDP D;  3I4L A;  1RTO A;  3I4M G;  5D65 A;  3HZX A;  3T1Y Q;  4A3L H;  4DV1 Q;  1YIT A;  4C1N I;  1I94 Q;  2PZT A;  5FO7 B;  1LTI D;  5IYC G;  5IWA Q;  1U4M A;  1VS0 A;  1WOC A;  3FP9 A;  3R93 A;  3KJO A;  1RF2 D;  2F4V L;  4NXN L;  2E75 C;  2NUC A;  1I6H B;  3TEH B;  3M4O H;  5J1Z A;  4RGM A;  3SDZ A;  5F2D A;  1LT3 D;  1Q8I A;  1B3Q A;  1G29 1;  4ABN A;  1PFN A;  1TVX A;  1S5D D;  4PG3 A;  1S3O A;  2CWP A;  3A8K E;  4A3L G;  1HZC A;  1XWE A;  2R93 H;  1IW7 D;  3IKJ A;  2AMC B;  1ENA A;  4H44 C;  1Q81 C;  4BBS H;  4KHP L;  1A15 A;  1OO9 B;  1B44 D;  5EPK A;  2UUC Q;  3S17 B;  5EPL A;  1ET9 A;  3LWE A;  4DNI A;  3GTM H;  3M3Y B;  4TKO B;  3NXW A;  1YI2 A;  1NMG A;  1WTO A;  3VR5 A;  2WAC A;  5ELF A;  5BR8 L;  4V19 0;  2JXM B;  1F9R A;  4L8J A;  4P71 A;  5JPN C;  2J0T D;  5E4X A;  2PI2 E;  2A5H A;  1LTL A;  2G9D A;  2HQE A;  4OIJ A;  1I4H A;  2MPM A;  1STN A;  1QOH A;  2VY3 A;  4U67 3;  4A3K B;  3GTK H;  2MNA A;  4BBS G;  5IGE A;  2A69 D;  3VA7 A;  1EWC A;  2NYZ D;  1E3P A;  3S1N B;  1K28 A;  4L5Q A;  3V96 A;  3A8J E;  2B63 G;  4FYD A;  1WCM G;  4KN7 C;  2JJQ A;  1N32 Q;  3V05 A;  4GLX A;  1JB3 A;  2OTJ A;  1BCP D;  5IE8 A;  2B8F A;  5C4J H;  3F2B A;  3HGB A;  2H1E A;  1HUM A;  2IY5 B;  4DUZ Q;  5FKA C;  3J7Y W;  1QIL A;  1SDF A;  4P2C B;  3SGI A;  2NTT A;  1A3T A;  2VL6 A;  4LJZ C;  2A8V A;  2OCE A;  1NTG A;  4DR4 L;  2B2U C;  2BA1 A;  4XDX A;  5LHY 1;  2F0F A;  3E5S A;  4JYA L;  4B3R L;  3L9A X;  5L37 A;  4K2K A;  5CYU A;  5C44 G;  1TII D;  1I3Q B;  2B2T A;  1JR0 D;  1KDB A;  1R4P B;  1FD7 D;  3H0G H;  4LUV A;  3RLN A;  1A63 A;  4DR5 L;  4U68 A;  1TWA B;  1V43 A;  3F1Z A;  5J39 A;  3VYR A;  4BXX G;  1IBK Q;  1X65 A;  3AQQ A;  2ZJP A;  1OXS C;  3I73 A;  3BS1 A;  2DNE A;  4RGT A;  2VQE Q;  1JJG A;  1Y14 B;  3W1G A;  1MGS A;  1ZXT A;  4DPG A;  1PZK D;  4KMU C;  3KDF B;  1SMX A;  2IJ0 A;  1VQA A;  3A56 A;  3X3M A;  2F3W A;  2L0C A;  4QCL A;  1TXY A;  2KCC A;  1X54 A;  4JI4 Q;  2R7D A;  4TQU S;  3RD4 A;  4DF7 A;  1WD0 A;  3FKI H;  5IWA L;  3EVQ A;  1IBL L;  2HCI A;  4JI2 Q;  3CP0 A;  3K0X A;  2A1A A;  3CKI B;  2N8N A;  3G4S A;  1VQC A;  1JOK A;  2XSC A;  2AQ1 B;  1ICF B;  4R4C A;  3K58 A;  4R1J A;  1A8V A;  2EXD A;  2ZXP A;  4X64 Q;  4GN5 A;  3KFU A;  1J6Q A;  4ILW A;  4JI1 Q;  2Z8L A;  1OXU A;  2QIL A;  3CQZ H;  1VQ6 A;  4K8I A;  1C48 A;  1JIC A;  4DAY A;  2NN6 H;  1TS5 A;  1U4L A;  1B53 A;  1V9P A;  1TS2 A;  1UUP A;  3OIP A;  4A3J H;  3PSI A;  4C3J G;  3SR1 A;  1S72 A;  5FLM H;  5CBE E;  1HTL D;  3RMH A;  1IBM Q;  4DNR B;  2WAQ E;  3R3O A;  1P8L A;  3S2D B;  3S2H B;  2GA4 B;  1KD1 C;  4UHV A;  1EU4 A;  2AHO B;  3A7L A;  1H9K A;  5JVG 3;  3K7A H;  4LF7 L;  1K8A C;  2F0P A;  3NE5 B;  2ZTD A;  5IYD H;  1L1O A;  3BJU A;  1S40 A;  1E1O A;  1PYW D;  3KBX A;  4KY7 A;  1SSO A;  1WVL A;  5FLM G;  1HJP A;  2C5C A;  1TWC H;  2WAQ G;  2EYJ A;  3HOY B;  3IAY A;  4A3C H;  1ONL A;  1BXT A;  1LTA D;  3H09 A;  4MN3 A;  2HQL A;  2Z6K C;  3RLF A;  1E2V A;  1SE2 A;  5IGG A;  1VQ5 A;  4IOA A;  1PH8 A;  4ZYS A;  1N32 L;  5M5X H;  2KVM A;  4C3I H;  4J6H A;  2R92 B;  1CSP A;  1CI3 M;  1AP0 A;  4ZQ3 A;  2OEO A;  2PMZ B;  2N78 A;  4CGY B;  5KIX A;  4YHH Q;  4B3M L;  4FP5 D;  4DV7 Q;  3FEW X;  4B3T Q;  2BDO A;  5C0X G;  2XIW A;  2DJF C;  1ROD A;  1KNE A;  1WFQ A;  3I70 A;  1I5F A;  2NZO A;  1B9N A;  2K52 A;  3ZYY X;  1NJI C;  2PNH A;  3CRL C;  4CHT B;  1M1K C;  3ERO A;  2EY6 A;  3IFD A;  3TP6 A;  3VR6 A;  4YY3 Q;  5IP9 H;  3BZC A;  1HNZ L;  1KNA A;  1UNS A;  3CF5 A;  1A0I A;  2B2W C;  3M4Y A;  1WTV A;  1AE2 A;  1STA A;  3U4V A;  5GRO A;  4AYB B;  3K80 C;  4TSS A;  1IBK L;  1VQB A;  2IX3 A;  4KN4 C;  1X32 A;  3HOU B;  2CH4 A;  1I4X A;  1SE4 A;  2QKI C;  3PO2 H; 
#chains in the Genus database with same CATH homology
 1GOZ A;  3HP3 A;  5C3W A;  1EIG A;  2F0T A;  4XYQ A;  1II3 A;  1KLG D;  2K5Q A;  1EYC A;  1TQO A;  1PTO B;  4RCN A;  1Q1E A;  5EKI A;  4DN4 M;  3WOF A;  2I07 B;  5E3F A;  5C3E B;  4DAP A;  3H3V C;  4F7X A;  3PIO 3;  3OPO A;  1PRT B;  1Y1V B;  5JOB A;  3D4R A;  1EQV A;  2KED A;  1RKN A;  1IYV A;  3PMF A;  1PDQ A;  2CVR A;  5JVH 3;  3KLR A;  3Q0A A;  1C8C A;  4IUT A;  1KAA A;  2L9H A;  2A6H C;  3M4O B;  2VB3 X;  1Q90 A;  2K32 A;  4QUC A;  2R93 B;  3FVQ A;  4K5W A;  1GJX A;  4N9T A;  4DAV A;  1WD1 A;  2O2L D;  4X3T A;  2EE1 A;  3GTM B;  3MFY A;  1VMC A;  4B9X A;  1U4R A;  1B9M A;  4DXF A;  2KJX A;  5I9P A;  3LX0 A;  2OXP A;  3OWF A;  3M7G A;  2F4I A;  4JBW A;  1QCB D;  3PUV A;  1SXT A;  2B2Y C;  1I4P A;  3P20 A;  1G8Z D;  5I6W A;  4QIW B;  3GV3 A;  4LAA A;  5FO8 B;  2WB1 B;  4Q5V A;  2Y0S B;  1WTP A;  5CV5 A;  4BS9 A;  5C4J B;  1WTQ A;  1SBB B;  5I6Y A;  2F0G A;  1STB A;  5EKL A;  3J7A V;  3BVM A;  1QG7 A;  1A2T A;  4RWS C;  1PTO C;  2K28 A;  3H0G B;  3T51 B;  3A54 A;  4RGN A;  2WV6 D;  2LFN A;  1WTW A;  3VYS A;  2N55 A;  4FF1 A;  4G4K A;  5KEE A;  1LT6 D;  4DGZ A;  3BYY B;  1CM9 A;  1SNP A;  5KYI A;  5FLX L;  1IL8 A;  2AWO A;  1ZYR C;  1B3A A;  1DOL A;  2A68 C;  2E74 C;  2EYM A;  3DM1 A;  4OGQ C;  4RHR A;  1IHZ A;  2KQ3 A;  2RBM A;  2IT1 A;  1SJE D;  4C1N K;  1IKM A;  2KUM A;  5COY A;  5D3I B;  4BY1 B;  4FXD A;  3R8B A;  1JWU D;  4M1U B;  5DM7 3;  3X3N A;  3K59 A;  4BA1 I;  3HS0 C;  4RHS A;  1STH A;  3CQZ B;  1EY4 A;  3CU7 A;  2O5J C;  3R2T A;  2ZXR A;  2AQ3 B;  4PNY A;  1BDO A;  2J4X A;  5E4W C;  4K6L A;  5CMD A;  1LAC A;  2K5W A;  1STE A;  3BVZ A;  5KNB A;  4PV1 C;  3BDC A;  2FMM A;  2PO4 A;  2EYH A;  2EOT A;  1U4P A;  4CJ2 C;  3K7A B;  5ISR A;  3N52 A;  2EYO A;  2D5D A;  5JAV A;  1BF4 A;  2ZXO A;  3GTQ B;  2Z4H A;  2NB0 A;  5K5P A;  3C1E A;  2PNR C;  1ET6 A;  2EPB A;  3IFT A;  3SVM A;  5M5X B;  4C3I B;  1SFO B;  3C2P A;  4X3S A;  3PUZ A;  4O42 A;  1DCZ A;  2EY1 A;  1S5E D;  4XT1 B;  1FR3 A;  4EQP A;  4ODG A;  3TBI B;  2B2V C;  2K5D A;  4RKL A;  3ITP A;  4I7Z C;  1T5E A;  2K1B A;  2PZU A;  1KDA A;  1AEX A;  1J9O A;  4IZ8 A;  5I4D A;  2RQX A;  3PO2 B;  1S5F D;  4G7O C;  3GO5 A;  4K8J A;  1PFM A;  2CW0 C;  4HSP A;  2JA6 B;  3UI2 A;  5FLX E;  1LTR D;  2XNA C;  4RA8 A;  4A3I B;  1G2S A;  1QWY A;  3ONA B;  2RVL A;  3D8G A;  2F1M A;  3E6Z X;  1ENF A;  1DOM A;  2SDF A;  1GUN A;  3MHB A;  2A73 B;  2EJM A;  1DM0 B;  1STG A;  4CJ1 B;  2YU9 B;  1ENC A;  3QOL A;  1Y1W B;  4HMJ A;  4DNT B;  1CT1 D;  3EQL C;  4BBR B;  1OXV A;  1A3V A;  2AQ2 B;  5CR3 A;  5CC4 A;  1D1K A;  1EOT A;  5KGU A;  1BO0 A;  2IX0 A;  2Z4I A;  5M3M B;  5IOD A;  2K7V A;  2KA7 A;  3HOW B;  2L11 A;  1ICW A;  1NCV A;  1ZKO A;  1F2Y A;  1YNN C;  5M3F B;  3N6R A;  1FNW A;  4B9W A;  4A3F B;  2R61 A;  4CBV A;  2MJ8 A;  4QB4 A;  5I2X A;  1ML0 D;  3VR2 A;  2VUM B;  3S15 B;  3MEH A;  2YYZ A;  1Y8N B;  2BE5 C;  3FMC A;  5JPM C;  5LL6 S;  3NQT A;  4UDU C;  4G7H C;  3D31 A;  1RCV D;  2NWG A;  1NAP A;  1F77 A;  4HAE A;  1CA5 A;  4OO1 I;  3S14 B;  2A74 C;  1YNJ D;  3L7Z C;  2XN9 C;  4Z9C B;  2HDL A;  4NP5 A;  2NVT B;  2VB2 X;  4J1M A;  3QIA A;  4ULL A;  3TP8 A;  4IFD H;  2RDH A;  2R6G A;  1JE4 A;  4RCO A;  3I8Z A;  2MHV A;  1KLU D;  1UAP A;  1EY0 A;  2F0D A;  2FHT A;  2NVX B;  1TR5 A;  2RSO A;  2B2T C;  1KTK A;  3KLS A;  3NTI A;  3WDN A;  4IUR A;  4KHV A;  3BDO A;  2IL8 A;  2VXW A;  2JE6 I;  1I4R A;  1F9S A;  4K5V A;  3NUC A;  1NR2 A;  2FIN B;  4IFD G;  3NQI A;  2B39 A;  4WFN 3;  1EZ8 A;  1S5C D;  2R3Z A;  1D1I A;  1BCP B;  2A6E D;  4MHE A;  2WKC A;  3A55 A;  4KD4 A;  4IUP A;  1SYE A;  2Q8T A;  3H94 A;  2E2J B;  1H9R A;  5K36 G;  3SK5 A;  3BZD B;  4KV6 A;  4KTA A;  5C0X H;  2FJ2 A;  2NVQ B;  2F3V A;  1JWS D;  3QO2 A;  3Q22 A;  4KKU A;  5J22 A;  3VR4 A;  5C0X J;  2M00 A;  2F0O A;  1EQT A;  2LMC B;  1PRT D;  2K03 A;  3TZU A;  5IGC A;  2NTS A;  2E76 C;  3BVG A;  2DY7 A;  2N88 A;  1SNM A;  2B2W A;  3A8I E;  1K8O A;  2F0Q A;  3J80 L;  2EY5 A;  3QG1 A;  3MXU A;  2X6L A;  1EY5 A;  2F0I A;  2Q8I B;  1BBX C;  5C4Z A;  1GHJ A;  1S4Z A;  3GQB A;  3KUP A;  2JEA I;  3SK8 A;  2F0K A;  2HCC A;  3JAM L;  4FXG C;  1H9M A;  2MP1 A;  5C4X B;  4PMC A;  2BOS A;  3WOE A;  5DAU A;  4K2L A;  1O80 A;  2ID0 A;  2EJF C;  4V0B A;  3EA6 A;  5FOB B;  3NPP A;  4CKE A;  4KJO A;  1QNU A;  2SNS A;  3T4A C;  2DN8 A;  1J8I A;  1EEI D;  2IWH A;  5CV8 A;  5M5Y B;  1IW7 C;  4M8A A;  3I4M B;  1TWG B;  1G2T A;  4FVM A;  4H7B A;  3GD7 A;  1EFI D;  1HXY D;  3MXP A;  4XIG S;  3G6J B;  1CA6 A;  1O7Z A;  2NZ1 D;  2B8G A;  2QDB A;  4QMG A;  2OF1 A;  1JCK B;  1HFG A;  1SYG A;  2A69 C;  2EVB A;  2MUY A;  3OMC A;  2L1B A;  4C3H G;  1JWM D;  2X6G A;  2EYL A;  1Z47 A;  3H91 A;  1EYA A;  1BCP C;  4DK1 A;  1CK1 A;  4C56 C;  2EXZ A;  2Q8R E;  2SNM A;  4LK1 C;  1M8A A;  1CZW A;  4K5X A;  4KI0 A;  5FK9 C;  4OL7 A;  3I3C A;  3PIP 3;  2DNC A;  2PZW A;  2AWN A;  5IT9 L;  1Y69 U;  5M9O A;  2E2I B;  1GUT A;  4HSV A;  4BBS B;  1IKL A;  2L55 A;  5D14 A;  1ILP A;  5JEA H;  2B63 B;  1WCM B;  5CGK A;  2B2Y A;  1VF7 A;  2K6A A;  5JEA J;  4ZUJ A;  3URY A;  4RKB A;  1LTT D;  1O78 A;  3QB3 A;  3ERQ A;  1DJR D;  3SEB A;  2K01 A;  1UEA B;  1LLR D;  3GTK B;  1SYB A;  1XYI A;  1H9S B;  2M2L A;  4G57 A;  1W6K A;  2F0H A;  5JEA G;  5C44 B;  1FNV A;  1RHP A;  1V1O A;  1V1P B;  2KCN A;  4UAI A;  1RD9 D;  3G7L A;  4G7Z C;  2CQA A;  5C4H A;  3JAM E;  1CTM A;  1JOQ A;  3GTP B;  1MSG A;  1SEB D;  1FGB D;  3I72 A;  4FNF A;  5IIF A;  2F0E A;  4PMB A;  3S1Q B;  1R9T B;  3TDQ A;  4H0L C;  3OSO A;  1BR9 A;  1Z6H A;  4KJN A;  1EY8 A;  3MWY W;  4HTH A;  2KHS A;  4IUU A;  3SXH A;  3E0J A;  5I2Y A;  1SYD A;  1F2L A;  2E2H B;  3GTG B;  1QB5 D;  3NWS A;  3LWU A;  3VYU A;  1SYC A;  3FKI B;  2NN6 I;  4DA2 A;  1EIH A;  4OO1 G;  3PUX A;  5T1I A;  5FO9 B;  4PMW A;  2PYK A;  2EY2 A;  1F9P A;  4HCS A;  3QWN A;  1KDC A;  5ELE A;  3VA5 A;  5BN3 A;  1LV9 A;  3DWA A;  2G9H D;  1D5Z C;  1H9J A;  1CFM A;  3DEO A;  3K5N A;  3FDT A;  4F88 A;  4A3J B;  4C2M B;  4XQJ A;  3I90 A;  5HGT A;  1TS3 A;  2WAQ B;  1TU2 B;  5IT9 E;  4F87 A;  3Q6S A;  2F03 A;  3KK7 A;  3LNN A;  4RGO S;  1AN8 A;  1QJO A;  1SNC A;  5ELC A;  3S1R B;  1Q1B A;  2K05 A;  3QOJ A;  4NDX A;  2D9U A;  1JQY D;  1TWC B;  2RKS A;  2FMC A;  3J81 L;  4PQX A;  1D2B A;  3FPP A;  3C46 A;  1JOR A;  1PXU A;  4KY5 A;  1XTC D;  1VF5 C;  3OWE B;  4GZY C;  4EGV A;  2F0U A;  4L6T B;  2K04 A;  5KYL A;  2KEE A;  3VYT A;  3IL8 A;  3HG9 A;  1GUG A;  2EDG A;  3O13 A;  1MSH A;  3K0Y A;  3W3A A;  4WRD A;  4YIJ A;  3DMU A;  4X3K A;  1W6J A;  4F8M A;  5DEH A;  2O5I C;  3CRK C;  2F0L A;  2PQE A;  1QE6 A;  5CBA E;  4ZKC B;  1TT2 A;  5BN4 A;  2PCF B;  4O1N A;  3T56 B;  4OHJ A;  5DM6 3;  1BNZ A;  2HDM A;  3PUY A;  4ME5 A;  2RDF A;  2IPK D;  4L63 B;  1BQQ T;  1PLF A;  4QF4 A;  2RDG A;  3NBH A;  1HUN A;  3EJI A;  2XRS D;  3D4W A;  4LMQ D;  3AB9 A;  3FPU B;  1JOO A;  2XRQ D;  3I91 A;  3EFX D;  1K83 B;  2L5T A;  5JJZ A;  4DXG A;  1Y8O B;  1ESF A;  4A3B B;  1NR4 A;  4IUQ A;  1AW7 A;  1LTB D;  4FF3 A;  2ICI A;  2OT2 A;  1A6X A;  2MGS A;  1SAP A;  1LT5 D;  1HA5 A;  2IW3 A;  3ND9 A;  1HFN A;  3NWT A;  4IUN A;  2B2U A;  1HTP A;  2LS0 1;  4Y7N B;  3KBG A;  1FNU A;  1MD2 D;  5C6A A;  2WKD A;  3SE0 A;  4XQN A;  2CHB D;  2XWB B;  3J81 E;  1PTO F;  1SNO A;  1R4Q B;  3SHL A;  4IAL A;  1E2Z A;  1I50 B;  2A6H D;  2F0V A;  1VDZ A;  3P7J A;  4J8Q A;  3L3O C;  1X3P A;  1TY2 A;  4S3S A;  2PPB C;  1PRT F;  2WIN B;  3OIQ A;  1SND A;  4HCE A;  5CV4 A;  2JA7 B;  1B50 A;  4ZUI A;  4KY6 A;  2DY8 A;  2NBF A;  3NBI A;  3GTO B;  2V4D A;  1NUC A;  5IGB A;  5BN5 A;  1MBY A;  4KK7 A;  4TRD A;  1RJT A;  4A3E B;  4ZK9 B;  5CV6 A;  4IFD J;  2JSO A;  4KKT A;  5KRU A;  1OXX K;  2PW5 A;  3A7A B;  5COR A;  2AUJ D;  3F2U A;  3NTK A;  5TSS A;  4IQZ A;  3T13 A;  5C5L A;  1SE3 A;  1HQR D;  4EQO A;  5HUR A;  3GTL B;  2ZT9 C;  1PZI D;  2F0S A;  2R7Z B;  1Q3L A;  1MI2 A;  5K36 H;  1LO5 D;  4I65 A;  1DXM A;  3MC0 B;  5EGT A;  1CQV A;  1PMR A;  1EY7 A;  1KAB A;  5AFW A;  5CV9 A;  1VMP A;  4XT3 B;  1EY6 A;  1SMY C;  4IN3 A;  2M9V A;  1EL0 A;  3MXG A;  3DUZ A;  5ELB A;  3H6M A;  1Y8P B;  5DNF A;  1PTO D;  3D6C A;  1PFB A;  1GUS A;  3M7N A;  1F2Z A;  3K5M A;  5EBC A;  1V8Q A;  2JYO A;  3MAQ A;  3MFG A;  1D5X C;  3GV6 A;  1C4Q A;  4BA2 I;  3V2T A;  1ZYR D;  3OW7 A;  4EQN A;  4XXE A;  3NP8 A;  2A68 D;  3BYT B;  5M5W B;  2NN6 G;  1SYF A;  4X3U A;  4QUF A;  1DZ1 A;  3HRZ C;  4ZAI A;  2F0N A;  3ND8 A;  3PO3 B;  1D6E C;  5D3D A;  5G3L F;  4ZRZ A;  1HQM C;  2BDN A;  1JC7 A;  1B2T A;  4BWG B;  4R8I A;  2BCO A;  4EVO A;  1ZEQ X;  2XVS A;  1EEF D;  3NHH A;  2NVY B;  4HED A;  3D4D A;  4RAU C;  1Q12 A;  2JA8 B;  1TY0 A;  3BG3 A;  3TN2 A;  1B4O A;  2KOL A;  3R2I A;  4BY7 B;  4ID6 A;  3FRP B;  5KND A;  3HOZ B;  4R9W A;  3DXJ C;  3P75 A;  3C1F A;  1SNQ A;  2RA4 A;  3MZ5 A;  1A2U A;  4C3I G;  2AUK A;  3GP7 A;  3PUW A;  2L12 A;  2TMP A;  3T16 A;  2QCP X;  3OMG A;  5CV7 A;  1NSN S;  1LTG D;  1D5M C;  3VR3 A;  3SK4 A;  2SEB D;  4KKS A;  1RTN A;  2FFK B;  4NKL A;  1G91 A;  1TKW B;  5NUC A;  2WP8 J;  3NSW A;  4RFB A;  1LTS D;  4A3D B;  3Q24 A;  4DU9 A;  1A3U A;  3KLS X;  4FXK C;  2RSN A;  1DON A;  1F2M A;  5A35 A;  2HUG A;  1S5B D;  5G3L D;  2J7Z A;  2ICE C;  4DK0 A;  3OHX C;  1EYD A;  1B1Z A;  1ILQ A;  1VCI A;  1WTX A;  3MVV A;  5C5M A;  3MXN A;  3MA2 B;  3U9S A;  1CHQ D;  2E2D C;  4NW2 A;  5EQ0 A;  1DYQ A;  2O4X A;  2QF7 A;  2I46 A;  1EWH A;  3HEJ A;  2JP1 A;  1IYU A;  3HKZ B;  1YNJ C;  2WII B;  2CW0 D;  1GXD C;  2LKV A;  5A2Q L;  4ZLT F;  1AZP A;  2EYP A;  2EJG C;  3C3L A;  1Z7T A;  2IX1 A;  3DHQ A;  4RH6 A;  3S1M B;  3J80 E;  4IUV A;  3HOX B;  3TME A;  1U9R A;  5IGF A;  1OXT A;  3CHB D;  3PV0 A;  3AU7 A;  3NK9 A;  1EY9 A;  1O7Y A;  4DFA A;  2ENB A;  4KHZ A;  2SOB A;  4K6D A;  4XTC S;  3Q23 A;  5LL6 X;  3I4N B;  4XQQ A;  3RZO B;  4MIU A;  1DOK A;  1I4Q A;  4IFD I;  4OIK A;  2VNU D;  1CQF A;  3D6W A;  2A6E C;  3TZD A;  2D2C C;  4OO1 H;  4CJ0 B;  4FO2 A;  1STY A;  2H4O A;  1HCZ A;  1T5X D;  2LY7 A;  1FYC A;  5EPJ A;  1YNN D;  3RZD B;  4HR7 B;  2PW7 A;  1GHK A;  4Q0F A;  1HHV A;  1K8M A;  4C3J B;  1PRT C;  2X69 A;  3GTJ B;  2XWJ B;  2BE5 D;  1M4V A;  1XX8 A;  1LAB A;  4ZKB B;  5EBD A;  3SK6 A;  2JEB I;  2F0M A;  4FF4 A;  5EJW A;  1EZ6 A;  1TWF B;  1XXG A;  3TSS A;  4WJW A;  2KEC A;  1AFP A;  2BA0 A;  3T53 B;  4XYO A;  4K14 A;  2F0W A;  1CZG A;  1H9S A;  5C0X I;  4CKB A;  3K5O A;  4B08 A;  5I9O A;  3J7A F;  1EU3 A;  2Z1C A;  3OOC A;  1V1P A;  1G6Z A;  1E0B A;  3TP5 A;  4HN7 A;  1E2W A;  3S9W A;  1HPC A;  2JA5 B;  1PZJ D;  1QNK A;  5KNC A;  5T1G A;  4N9P A;  4CKC A;  1TS4 A;  4JK1 C;  3MTS A;  4H13 C;  5A2Q E;  3BDL A;  3TP7 A;  2C9O A;  1SJH D;  3D3R A;  3KF8 A;  3P1H A;  3M85 A;  1LT4 D;  4A3G B;  2L4N A;  3NTH A;  2B2V A;  1L0Y B;  1X3Q A;  2K33 A;  1L0X B;  1HRJ A;  1ESR A;  4HMI A;  3K6O A;  1BUV T;  4FF2 A;  1SMY D;  3U9O A;  3DWQ A;  1AZQ A;  1I4G A;  2EZV A;  5EKK A;  2QEJ C;  3AMU A;  5C3X A;  3W2D A;  1I6V C;  3K57 A;  1F9Q A;  2EYF A;  4A3M B;  3K5L A;  4WOR A;  3RUZ A;  2D62 A;  1O7L A;  3QJY A;  5ELD A;  1PTO H;  4KD3 A;  2TSS A;  4R8N A;  3HOV B;  5IOC A;  5IGD A;  5E1F A;  4A93 B;  1TWH B;  1HA6 A;  1GUO A;  1BOS A;  1BCP F;  1WTR A;  1CHP D;  3DEP A;  4C3H B;  1GUW A;  4NMZ A;  4E6I A;  3S16 B;  2F0J A;  1DD2 A;  3DWP A;  1RDP D;  3I4L A;  1RTO A;  5D65 A;  3HZX A;  4C1N I;  2PZT A;  5FO7 B;  1LTI D;  1U4M A;  3R93 A;  1RF2 D;  2E75 C;  2NUC A;  1I6H B;  5J1Z A;  4RGM A;  3SDZ A;  5F2D A;  1LT3 D;  1Q8I A;  1G29 1;  4ABN A;  1PFN A;  1TVX A;  1S5D D;  3A8K E;  1XWE A;  1IW7 D;  3IKJ A;  1ENA A;  4H44 C;  1A15 A;  1OO9 B;  1B44 D;  5EPK A;  3S17 B;  5EPL A;  1ET9 A;  3LWE A;  3M3Y B;  4TKO B;  3NXW A;  1WTO A;  4V19 0;  3VR5 A;  2WAC A;  5ELF A;  2JXM B;  1F9R A;  4L8J A;  5JPN C;  2J0T D;  5E4X A;  2A5H A;  2G9D A;  2HQE A;  4OIJ A;  1I4H A;  2MPM A;  1STN A;  1QOH A;  4U67 3;  4A3K B;  5IGE A;  2A69 D;  3VA7 A;  1EWC A;  2NYZ D;  3S1N B;  3V96 A;  3A8J E;  4FYD A;  4KN7 C;  3V05 A;  1JB3 A;  1BCP D;  2B8F A;  3HGB A;  2H1E A;  1HUM A;  5FKA C;  3J7Y W;  1QIL A;  1SDF A;  4P2C B;  2NTT A;  1A3T A;  4LJZ C;  2B2U C;  2BA1 A;  4XDX A;  5LHY 1;  2F0F A;  3E5S A;  3L9A X;  4K2K A;  5CYU A;  1TII D;  1I3Q B;  2B2T A;  1JR0 D;  1KDB A;  1R4P B;  1FD7 D;  4U68 A;  1TWA B;  1V43 A;  5J39 A;  3VYR A;  1OXS C;  3I73 A;  3BS1 A;  2DNE A;  4RGT A;  1MGS A;  1ZXT A;  1PZK D;  4KMU C;  2IJ0 A;  3A56 A;  3X3M A;  2F3W A;  2L0C A;  4QCL A;  2KCC A;  4TQU S;  3RD4 A;  4DF7 A;  1WD0 A;  3EVQ A;  2HCI A;  3CKI B;  1JOK A;  2XSC A;  2AQ1 B;  3K58 A;  2ZXP A;  4ILW A;  2Z8L A;  1OXU A;  2QIL A;  4K8I A;  1C48 A;  1JIC A;  4DAY A;  2NN6 H;  1TS5 A;  1U4L A;  1B53 A;  1TS2 A;  1UUP A;  3OIP A;  4C3J G;  3SR1 A;  5CBE E;  1HTL D;  3RMH A;  4DNR B;  3R3O A;  3S2D B;  3S2H B;  2GA4 B;  1EU4 A;  3A7L A;  1H9K A;  5JVG 3;  2F0P A;  3NE5 B;  1PYW D;  3KBX A;  4KY7 A;  1SSO A;  1WVL A;  2C5C A;  2EYJ A;  3HOY B;  3IAY A;  1ONL A;  1BXT A;  1LTA D;  3H09 A;  4MN3 A;  3RLF A;  1E2V A;  1SE2 A;  5IGG A;  4ZYS A;  2KVM A;  4J6H A;  2R92 B;  1CI3 M;  1AP0 A;  4ZQ3 A;  2OEO A;  2PMZ B;  4CGY B;  5KIX A;  4FP5 D;  3FEW X;  2BDO A;  5C0X G;  2XIW A;  1ROD A;  1KNE A;  3I70 A;  1B9N A;  3ZYY X;  3CRL C;  4CHT B;  3ERO A;  2EY6 A;  3IFD A;  3TP6 A;  3VR6 A;  1KNA A;  1UNS A;  2B2W C;  3M4Y A;  1WTV A;  1STA A;  4AYB B;  4TSS A;  2IX3 A;  4KN4 C;  1X32 A;  3HOU B;  1I4X A;  1SE4 A;  2QKI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...