1ILQA

Cxcr-1 n-terminal peptide bound to interleukin-8 (minimized mean)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a CXC chemokine-receptor fragment in complex with interleukin-8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords INTERLEUKIN-8 PRECURSOR
total genus 12
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ilqA00
1BBXC 1WTPA 1Q3LA 3KBXA 5T1IA 1WTRA 2X6LA 2KUMA 1WTXA 3I90A 1IKMA 2N55A 2EOTA 2L1BA 1PFMA 4OIJA 2MJ8A 3DEOA 5T1GA 1BNZA 2B2TA 1HRJA 1AZPA 1U4MA 1DOLA 3GV6A 2B2UC 4LMQD 1PFNA 3MTSA 1EL0A 1J8IA 5DNFA 4CJ0B 3IL8A 1ILQA 2HDLA 3H91A 4IUQA 5EPKA 4DN4M 2N88A 1WTWA 3D6WA 5AFWA 4UAIA 2KECA 1WD1A 3P7JA 1SAPA 1PFBA 1HUMA 4X3UA 2K03A 2XIWA 2IL8A 2L12A 2CVRA 1MI2A 2FJ2A 3IFDA 3DM1A 2RVLA 3DEPA 3FDTA 3MWYW 1RTNA 1KNEA 3LWEA 3ONAB 4CJ2C 1DZ1A 1SSOA 4XDXA 2J7ZA 2H1EA 2RA4A 5EQ0A 3TN2A 1AP0A 5E4XA 2K04A 2KEEA 2L11A 2X6GA 4X3TA 1GUWA 2B2UA 2Q8RE 1NCVA 1CA5A 1PDQA 2JYOA 2HUGA 5EPJA 1BO0A 1O80A 2M2LA 1O7YA 5COYA 1MSHA 1X3QA 1TVXA 1KNAA 1ILPA 3FPUB 5JJZA 1DONA 2X69A 1LV9A 2DY8A 2DY7A 4ZLTF 1RODA 5CMDA 1WTVA 1B2TA 1IL8A 1MSGA 1QE6A 1NR4A 5EKIA 1DOMA 1U4PA 2FHTA 3I8ZA 2B2VC 2BDNA 2K28A 1G2TA 2NYZD 4HCSA 3HP3A 4U68A 1IKLA 5D65A 3R93A 5EJWA 2FFKB 4RWSC 2K1BA 1NAPA 3GV3A 1VMPA 4X3KA 1CA6A 1X32A 5CBEE 1ZXTA 4NW2A 4OIKA 5CORA 2VXWA 1RTOA 1VMCA 4ZK9B 3I91A 1RJTA 1JICA 1WVLA 2B2YA 1B4OA 2HDMA 3QO2A 1BF4A 4RA8A 1B50A 1NR2A 1C8CA 1EIGA 2B2WA 5CBAE 1B53A 1EIHA 1HA6A 1HHVA 1F9PA 1SDFA 1F9SA 1HFGA 1QNKA 2KEDA 4HEDA 1MGSA 1G91A 1ESRA 4QUFA 2NZ1D 2FMMA 2L4NA 1QG7A 1F9QA 2EPBA 2MGSA 4MHEA 4O42A 1PLFA 2HCCA 2B2TC 1F9RA 3KUPA 4MN3A 1AZQA 4ZAIA 1HUNA 1O7ZA 1XX8A 2HCIA 1ML0D 4RAUC 4XT1B 4R8IA 4HAEA 1ICWA 2NWGA 2JP1A 2K01A 2SDFA 1WD0A 3N52A 3F2UA 4ZKCB 1HFNA 4IUUA 2K05A 1JE4A 4IURA 1A15A 1X3PA 2B2YC 2EE1A 4IUVA 4XT3B 2RSOA 1U4RA 2D9UA 2R3ZA 1DOKA 1RHPA 4IUTA 2B2WC 2RSNA 2L9HA 5EPLA 1B3AA 3TZDA 4IUPA 3SVMA 3I3CA 1XYIA 2MP1A 1U4LA 2KOLA 4R9WA 1E0BA 1EOTA 1F2LA 1S4ZA 3G7LA 2Q8TA 2KVMA 4ZKBB 2B2VA 5E4WC 1J9OA 1WTOA 2FINB 1M8AA 3UI2A 1G6ZA 1WTQA 4QUCA 4HSVA 4CJ1B 2MPMA 3Q6SA 1G2SA 5D14A 1EQTA 4X3SA 1CM9A
chains in the Genus database with same CATH superfamily
3KDFA 2F3VA 4QB4A 4RGNA 1Q3LA 4RKBA 4X65L 1V9PA 4P75A 3S2HH 3J7AF 2EQSA 4OX9Q 4BA2I 3MXNB 1EU3A 2K14A 4DR6L 5LMNL 5HY6A 1KC8C 4A3GB 2NVXB 3GV6A 1FR3A 3WWVA 4KHPQ 5EBDA 3JAMi 5F2DA 2QGQA 4EQOA 2F0TA 1OXSC 1V1OA 2PQAB 1TS3A 4J1MA 5GQOA 2D5DA 2JA5H 2L12A 1AE2A 4L5QA 3RD4A 3MWYW 4KMUC 3M7GA 2JA7H 2KHJA 2H1EA 4A3FH 3CRKC 4LFAL 4OO1I 1SYEA 4GKJL 4BY7H 4RCNA 1B3QA 5LMNW 3Q22A 1V1PA 4PZ6A 3RUZA 1JWMD 4GN4B 1PH5A 5COYA 1I5FA 4DR1L 4O0AA 1N34L 4NXMQ 3WDNA 5M3MB 5C4XB 3L9AX 1Q90A 4H0LC 5H1SE 4WORA 5L37A 2SNSA 3GTJH 3M4OH 2JA6H 1XPUA 1JE5A 2WFWA 1JB7A 3CC2A 3KLSX 1TWAB 2JA8H 4NW2A 5LMUQ 1N33Q 1RJTA 4OWWB 1TU2B 4Y52H 1YHBA 3HOUH 4RHSA 1IBLL 5LL6X 2I0QA 1QB5D 2WB1G 5FLXc 1ESRA 2TSSA 3K7AH 2O5JC 1QG7A 2TMPA 2CWAA 3CCSA 4C3HG 4JI7Q 1QCBD 3T56B 2A5HA 5LL6S 3VYUA 5IODA 1VQIA 4JG2A 3RZOH 1SNDA 3KLRA 4TKOB 4IPGA 1EY9A 2ZM6Q 3NTKA 1DOKA 1EY7A 3KLWA 2F0JA 1QVCA 5DEHA 1STAA 4K0KQ 2AWOA 2C9OA 1TWCB 2F03A 4A4IA 2GA4B 1PRTD 3G6JB 4ZKBB 1ET6A 3VR3A 2KCNA 1NJIC 4RGMA 4JI1Q 4POFA 1W6JA 5CV9A 4WJ3M 5EKKA 4A3BB 4MTNA 1VQGA 1T5XD 4IN3A 3UDFA 2DN8A 2KA7A 5FKAC 2K5VA 1SR3A 2A68D 1PRTB 1VQ4A 1U4MA 1I94Q 1BKBA 3VYRA 4ZUIA 4A3CG 4RGOS 1DCZA 2VZAA 5EPKA 2L15A 3BDLA 1AN8A 4KJNA 2EXDA 1PFBA 4BXXH 5D3IB 4QCLA 2RVLA 3OSOA 1L1OA 1K8MA 3I4NG 5M5YH 1LTAD 3KYHC 4Y7NB 4H7BA 5DM63 1SYGA 1M4VA 2R6GA 4DK1A 2ZTDA 4IPDA 5FO9B 2CHBD 3Q0AA 1H95A 3TBIB 2Y0SB 1O7YA 3NPPA 3C46A 3S2HB 1IZ6A 4EGVA 1QJOA 4A93H 4XQJA 1WOCA 4CBVA 3C1EA 3LWUA 4DR4Q 4IJLA 4DNIA 4DK6C 4DFAA 2NVXH 1L1OC 5EJWA 5IYDH 4I65A 1A3VA 4NXNL 3FP9A 3QIAA 3S1NB 1ZXTA 3I4OA 1K8AC 3CPFA 1HH2P 1EZ6A 3ULPA 5IYCH 2RHQB 2F4VL 3MVVA 3ITPA 2Z4HA 3IKJA 1STGA 1TWGH 2Q2IA 4YWMA 1JR0D 2DJGC 4I7ZC 4L6TB 2NZ1D 2Q2UA 1PRTC 4C3IB 4E6IA 5I6YA 1KDBA 2B2TC 1ESFA 2B8FA 1D8LA 4EX5A 3NBIA 1DGSA 1ICWA 1XNQL 4IOAA 1SE8A 2V4DA 4IZ8A 1TWCH 4YWLA 1TY0A 2BCOA 2RSOA 2HT1A 3GD7A 4YHHQ 2DUDA 2B2WC 2NN6H 1WJJA 2NVQB 1TKWB 2UUBQ 1OO9B 2KOLA 1BCPF 2NTTA 4M8AA 3HOXH 2BA1A 4DAYA 1SNPA 1PMRA 5A2QL 1WCMH 5IGEA 4A75A 4HJ9A 1E2VA 1E3PA 4KY6A 3A7AB 2JE6I 5M9OA 4GLAC 1WTXA 2X6LA 1X56A 1CUKA 4B3RQ 3KFUA 3PIOA 1MBYA 5T1GA 1X54A 5I4DA 3L2PA 1Q82C 4RHRA 1AW7A 4ALPA 2YU9B 4FF2A 5LMNQ 3NWSA 1E22A 2HIVA 4X66Q 3F2DA 1EWCA 4K14A 1DYQA 2F0KA 1QZHA 4IFDH 3PUXA 2FJ2A 1RTNA 4GOPB 2BH8A 1AP0A 2ZXPA 1ASZA 2AUKA 1LT4D 1EYAA 4WJ4A 4L5SA 4CKBA 1SE2A 2M2LA 2R61A 5CGKA 1JOKA 2F0DA 4JCVE 1X3EA 1VQ9A 1U0LA 4CDCC 4ZUJA 1STYA 5EKIA 1NR4A 1VQAA 1FGBD 1SNMA 2BDNA 1PH8A 4LAAA 2NZHA 4JI5Q 1IKLA 3R8BA 5CV8A 5D65A 1D7QA 2NZOA 4OELB 4A93B 1GUSA 2VUMB 3HOYG 1KLGD 4BA1I 3DUZA 3I91A 5M3MH 1EWIA 5LMUL 2Z1CA 2F0HA 3R3OA 1PH9A 4DV7Q 4DV6L 5AJ3Q 1HZAA 2UXBQ 1F9SA 1QNKA 2UXDL 4AQYL 3UDGA 3STBD 1HZ9A 1D2BA 2MGSA 4LF7Q 1XTDA 1AZQA 3QJYA 1O7ZA 4A3KB 4JYAQ 4DR1Q 4DV3Q 1GHKA 5KRUA 3F2UA 1HNXL 4LF8Q 3BVZA 1NSNS 1NE3A 1Y8PB 2K52A 5E1FA 2R93B 2ZTEA 2CW0C 2MQHA 4L63B 2WKCA 3H94A 2B29A 3Q23A 4H13C 4DUYQ 4FO2A 5J3BA 3SK8A 3J7ZC 2A6EC 1H9SB 3D3RA 4K8IA 4XQNA 3Q6SA 2OTLA 1BBUA 1C4QA 1N9WA 4RG1A 3W1BA 1A3UA 4KD4A 3NTIA 4IFDI 1TS2A 3S1MB 3UE0A 1LTLA 1T9HA 2B63B 1H9KA 3MTSA 3EROA 1B7YB 2LXJA 1JJGA 2EY6A 1ILQA 1IL2A 5JAVA 1YNNC 2KECA 1SAPA 4A3MB 3TRZA 2IL8A 1CKOA 1HNZQ 3R2TA 1VQMA 1FVIA 1VDZA 3FMCA 4JI8Q 1KNEA 3LWEA 3U4VA 3VR5A 1BCPB 1NY4A 4A3DB 4XDXA 3U58A 1PTOB 3AQQA 3OPOA 1EQQA 1ET9A 2Z6KA 4KK7A 5IYCG 2L11A 4A3IG 4A3IB 1FD7D 3JAML 3NP8A 5C44H 3IAYA 4WRDA 2M9VA 2IX1A 5I2XA 4IQZA 4JI0Q 1MJEA 3CC4A 2ASBA 1ZYRD 2KCMA 3QR8A 3NELA 4GN5A 2VUMH 2A1AA 4PMWA 4DR3L 4CDDC 2E2JH 1JORA 2E2IH 2F0OA 1I4RA 4PG3A 3TQYA 4KY7A 4DV3L 4DAVA 1Y1WH 5GADC 3UDIA 5CORA 1RTOA 1VMCA 3QO2A 2HDMA 2JA5G 4POGA 1SBBB 2JA5B 3MEFA 2Y0SE 1F77A 1FGUA 2L0CA 1S5FD 4B08A 3E0JA 1L1OB 2MNAA 1SFOH 3L0OA 1SDFA 4HEDA 4UDUC 5CV7A 4R4OA 4C2MH 1YEZA 4BBRB 2NVTH 1PA6A 5G3LF 4OX9L 1S5ED 2IPKD 4K5XA 4HMIA 1IW7C 5HURA 4JC0A 2F1MA 4LFCQ 4CDEC 2AKWB 4F7XA 1S72A 4LF9Q 1M1KC 3H3VH 2JQOA 4HCEA 1Y1VG 5C4XG 4DV4L 4GLXA 4R9WA 3EVQA 1E0BA 2O5IC 4JI8L 3S14H 2KVMA 2F3IA 5E4WC 3K5MA 5GAEC 1U5KA 5C4HA 2I5MX 1UE6A 2GVAA 3PIPA 1KD1C 3PQIA 1YHQA 4BY1B 2VQEL 1U9RA 2A19A 1CM9A 5FO7B 4MZ9A 3PO3B 4K6DA 4NKLA 3OOCA 3CP0A 4MTKA 4NP5A 5IYDG 2SEBD 3M4PA 2EY2A 4IUNA 4XYOA 3HOZG 4IOCA 1KLUD 1PTOD 5I9PA 3PF4A 1OXTA 3F2CA 4CJ0B 3RR5A 3S1MH 2A6HC 2PCFB 4UAIA 3QOLA 1E1TA 4LFBQ 1VQKA 5E7NA 1EUJA 1KHIA 3GTKB 1O7IA 2A6ED 5C44B 4RMFA 1NMFA 1CKNB 5IT9c 4C3JB 4B3ML 1XXGA 3ULJA 3RLOA 1SROA 5J39A 3ICEA 2PI2E 1AE3A 1G8ZD 3M4QA 5I2YA 2EYFA 1CA5A 5HGTA 3S15B 1PDQA 1HR0Q 1DD2A 4KN4C 2PNHA 3K5NA 3K80C 4A3BH 1KTKA 1A63A 1Y1WB 3A5UA 2NVQH 4LW1A 5EBCA 4AQYQ 4G7ZC 3SXHA 1VMPA 2MO0A 1EWHA 2YU9H 4YY3L 2E5LQ 1GXDC 1Q1EA 2CQOA 2XRQD 3RLFA 1AFPA 3GTJB 3G4SA 1FL0A 3AMUA 1F9PA 4K2KA 3V96A 1EY5A 5ELFA 4FF1A 3U9SA 2RQXA 3A56A 2FMMA 2WV6D 3TS2A 1C48A 2L5TA 3A74A 4MHEA 1RCVD 4JI1L 4OHJA 1XX8A 1L0XB 3KK7A 4L5TA 3VDYA 1FJGL 3L3OC 1C0AA 4OWXB 3N52A 4ZKCB 1A62A 5M5WH 2B3GA 3EQLC 2R7ZB 1Y8NB 2HHHL 2R7ZG 2QILA 2B2YC 5CYUA 3MXNA 2D2CC 2OWOA 1PVOA 2HHHQ 3KF8B 4N9PA 1U4LA 3KDFB 3DMUA 4A3JB 3G7LA 4C3HH 5FLXE 2Q8TA 5C3XA 1EFID 2FINB 1M8AA 1EY6A 1YIJA 1G6ZA 4HMJA 3AU7A 2O4XA 4QUCA 3S1QB 1VQ5A 1LTSD 2YTYA 2K5NA 3A54A 4R1JA 3HFZB 4X3SA 3RLNA 1KIXA 3OMGA 1CZWA 4HJ5A 1K0SA 3H6MA 2HIXA 4OIJA 2UU9Q 2PMZB 3OW2A 1I6HB 1CZGA 3A55A 2JA6B 3BYTB 3S1RB 1VQNA 1CI3M 2ZJRA 3GTMB 1J6QA 2JA7B 4DPGA 1PFSA 4CHTB 4P72A 5AFWA 2UU9L 3OWEB 4DR5Q 4HIOA 2A74C 1QZGA 1SLJA 1DZ1A 5IY0A 3TZUA 4KKUA 2ZJPA 4GNXC 2EVBA 3S16B 4C3HB 1D6EC 3W5OA 2KEEA 3MZ5A 2G9HD 5M5YB 2E2IB 2K32A 1YNXA 1VS0A 1ILPA 2K5DA 1DONA 4TSSA 3RZOB 1VF7A 4HSPA 2LSSA 1CHQD 4HCSA 3NHHA 4FYDA 5IYBH 5CV5A 3WOEA 5JPNC 5CBEE 2GVBA 2E76C 3L7ZC 1JICA 4ME3A 2PPBC 1BQQT 4A3BG 4OEMB 3HKZB 4A93G 1A0IA 3HKZG 4JI3Q 1VQBA 2RDGA 3EBEA 4DR4L 1E7ZA 2HCCA 2KHSA 1HUNA 2HCIA 3QG1A 3PMFA 3I72A 2YTVA 3HOVB 3DM3A 4GKKL 1YNJC 4C1NI 4LF4Q 4PV1C 1VQDA 3D6CA 4X64Q 4IURA 4JI4L 1R9TB 3NXWA 3QB3A 1ONLA 5C4JH 1X3FA 2K5WA 3DHQA 3KBGA 4A3FB 2ATWA 3AB9A 2B2VA 1WTOA 4BBSH 1S5BD 4Y7NH 1CQVA 3SGIA 4HSVA 3BYYB 2D0PA 3NBHB 2F52A 2AUJD 3NK9A 3H3VI 1WTRA 2EOTA 3TS0A 3DEOA 1F2ZA 4B9XA 3A8IE 4WFN3 2IT1A 3T1HL 2CFMA 1TWAH 1W2BA 1D5XC 1PFNA 1HTPA 1S5CD 2A68C 1SYFA 4J15A 2UUAL 4IFDJ 2MO1A 3PO3H 1F2MA 4DN4M 1PTOF 4EQPA 3OHXC 2DGYA 4X3UA 1YBYA 2XIWA 2PYKA 5IP7G 1IBKQ 1KL9A 1LTBD 1I4HA 3I4LA 5IGBA 1SSOA 2Q8IB 3ERQA 3D31A 4K0KL 3R2IA 1QUQB 1S3OA 2NN6G 2UXCQ 5M5XB 3FKIB 3PUZA 3FKIG 1I4PA 1VQFA 3OTOQ 1TVXA 1L0WA 3GTPB 5IT9L 4GLVB 4ID6A 1IL8A 4A3EG 1CHPD 2ALYB 3QOJA 1BUVT 1GUGA 3PSIA 3UDXA 3PO2B 3FKIH 1LTID 4RWSC 2B63G 2DNEA 1SRUA 2O2LD 3SEBA 4G7HC 2HQLA 1MIUA 2B2YA 2JA6G 2EYOA 4MNOA 2MUYA 4A3MH 5G3LD 5BN5A 4RGTA 1JJCB 1I94L 1G91A 4Z9CB 3HRZC 3P20A 2L4NA 2N8NA 5CC4A 1PLFA 4BY7G 1PTOH 3A8KE 1EIFA 4YIJA 4P73A 1B1ZA 1VQHA 3CHBD 1RKNA 1YJNA 2Z6BA 3P75A 1E24A 1VQEA 1A15A 2E2JB 4WJWA 3CCEA 5IE8A 1IW7D 4CDFC 3KJOA 4GN3B 3M85A 3Q24A 3VR6A 4A3LH 2JA8G 2F0LA 2JXMB 4DXGA 3NBHA 1VQ6A 2A8VA 1DM0B 4JYAL 3BDCA 2ZM6L 2K75A 3UI2A 1YJ9A 1GUTA 1UWVA 3E6ZX 1Q8IA 4KTAA 2P5ZX 5IYBG 2A69C 2RCNA 1EQVA 3NE5B 1YHAA 5T1IA 5HGQA 2L1BA 1EEID 3PUVA 4YCWA 3PF5A 1HNWL 5K5PA 4LF5L 1YVCA 5C0XH 1YZ6A 4DNTB 2B8GA 2R92G 3UE1A 2C35B 5JEAH 4KJOA 3E9IA 3HGBA 2CH4W 1EIYB 1K83H 4H44C 3ZYYX 5C3EG 3BU2A 2KHIA 4HIKA 4UP9A 2A69D 3IRBA 3I55A 4B9WA 4N9TA 2EYJA 2PMZE 2D62A 3TN2A 4FXDA 2R7DA 1GUNA 2AMCB 3ERSX 5JOBA 2XWJB 3JAMc 1K28A 4DUYL 5E3FA 3GTOH 5JJZA 4BY1H 1MSGA 1HPCA 3PO3G 4FF4A 1STNA 3I4MG 2JEBI 3D0FA 5BR8L 3I4MB 2DNCA 3GTGH 2VQFQ 3NEMA 1LUZA 1NAPA 3QWNA 4FXGC 1TS5A 3TEHB 4KHVA 4J8QA 4C3IH 4FXKC 4K2LA 4NDXA 1K83B 1BF4A 4RA8A 1C8CA 4B3RL 5CBAE 3EIVA 2UXDQ 3B6YA 2OXPA 2BE5D 4DR7Q 1SMXA 3I4NH 4DV0Q 1XMQQ 4QUFA 1LTRD 1D5ZC 3SDZA 1EU4A 3K58A 1HA5A 4DR3Q 1TQOA 4QJFA 1ML0D 4LUVA 1QVFA 2QDLA 3K7UC 2E74C 4R8IA 2A73B 4DV5L 4IJHA 3I4NB 3HZXA 3NTHA 3HG9A 2XNAC 2JA9A 4DK3C 2ID0A 1L2FA 1U4RA 3Q8DA 1T5EA 3P1HA 2RKSA 4A3LG 2CQAA 2IWHA 3CCUA 3EA6A 2C5CA 1VF5C 2ZTCA 1J9OA 4A3EH 4LF9L 3S9WA 3OYYA 3T1YL 1K8OA 5C5MA 5FO8B 3H15A 1PYWD 3PO2G 2F0QA 4A3JG 3M7NA 4AYBB 2R92H 3PUWA 1IBKL 5C6AA 2BH2A 2F0UA 2PO4A 3KF8A 4DAPA 2YV5A 2F0SA 3K81C 5CV6A 3WOFA 2VS1A 2OQ0A 4X66L 4QY7A 3CAMA 2QF7A 4A3MG 3AFPA 1JMCA 2F0IA 3HOYH 3T1HQ 1XPRA 1JWSD 3CD6A 2JN4A 2RHSB 2EJMA 4AIMA 4UP8A 2OCEA 3P7JA 1Z7TA 2JEAI 4BY7B 2JA7G 3D4RA 4PZ7A 4AYBE 5C3WA 1S5DD 4YCUA 3DM1A 1W3SA 3ONAB 4RCOA 2VQFL 1C7YA 2RA4A 3CKIB 5GROA 4KN7C 3DWQA 1B9NA 1IHZA 2IHFA 5C0XG 3FHWA 4JI0L 2NVYH 5EPJA 3PIP3 3ND9A 4FVMA 2QEXA 2JA8B 5EGTA 1B2TA 4QMGA 4JI4Q 1V1QA 5JPMC 1YNJD 4PNYA 5M3MG 5KIXA 3HP3A 1SJHD 1GVPA 2K1BA 4B3SL 1TIID 1Q8KA 1HCZA 3T13A 3S17B 4BBRG 2NTSA 2H4OA 3KF6A 1CKNA 2I5LX 3MXUA 4ILWA 2KEDA 3H09A 4JI5L 2WB1B 4EVOA 1EFWA 5BN4A 3RN5A 2WAQB 1VQCA 1MD2D 3SK5A 5M3FH 3S1RH 4ZQ3A 4HAEA 3CCLA 4R4QA 4APVA 5KGUA 5IGDA 4BBSG 4C2MB 1X3GA 4QQBX 2LXKA 1I4GA 3FVQA 4LWCA 3GTLB 1BR9A 2N49A 4K5WA 3SVMA 1K8GA 1XYIA 5GAGC 3F2BA 1PXUA 1B70B 1EOTA 1F2LA 3TP5A 1FJGQ 3HOWG 2VL6A 1QOHA 1YI2A 1LT3D 1CTMA 3E3XA 2EY5A 5DLQE 5ELBA 1RIPA 1G2SA 4LF8L 3SE0A 3GTPH 1K3BC 3GTMH 1UEBA 4G4KA 4OONA 2WACA 2KUMA 1Y1WG 2VUMG 4NPSA 1JB3A 2PI2A 2B39A 1JCKB 3T16A 3C1FA 4F87A 3E9HA 1F2YA 2B2UC 3I70A 5DAUA 3J81i 2PW5A 1FNUA 5FJ8G 1EY8A 3IL8A 4UHVA 5C44G 1N36L 3GDEA 1BCPD 1LT5D 1I50H 4A3IH 4JI6L 1HUMA 3VR4A 1EZ8A 2KBNA 5C4JB 3T53B 1A6XA 1KRSA 4G7OC 2E75C 5C0XI 2PW7A 1HR0L 3A5ZB 3VYTA 2EYHA 4DV2L 2MHVA 2VB3X 3HKSA 4YHHL 3M9BA 4X3TA 4X64L 2JYOA 3BZKA 4K6LA 5IP9H 3OTOL 1BO0A 5C4XH 3BS1A 1MSHA 1NNXA 3FPUB 1EYGA 2UXCL 4P2CB 3CXCA 4HIDA 1GJXA 2B2VC 3V2TA 1B9MA 4JI3L 3W2DA 3RZDB 1CA6A 4OO1H 4JI7L 3K5LA 1DJRD 2VXWA 1Y8OB 1XMOQ 3CQZB 2LKVA 3D8GA 2ZT9C 1I6VC 3CW2C 1EYDA 2EYLA 1AEXA 1XWEA 4R4TA 1WTHA 4BS9A 3K0XA 1F9QA 1JWUD 2QW7A 2XSCA 1UE5A 1N33L 1NBWA 2UUCL 1WD0A 4BBRH 2Z9HA 5JJIA 3VR2A 4KKTA 4IUVA 5ELOA 2D9UA 3GQBA 1N34Q 3CPWA 4A3EB 2L9HA 1B3AA 5CR3A 3GP7A 3TZDA 4IUPA 3GTKH 3HEJA 1X6OA 3RMHA 3LX0A 4CKEA 4X62Q 1PZID 4X62L 2WIIB 3F1ZA 3C3LA 4TRDA 1A8VA 1LACA 2E2HB 1LO5D 4A3GH 1WTPA 5IWAQ 4A76A 1I3QH 5FLXL 2F0PA 1JJ2A 2NVTB 2EZVA 5KNBA 3X3NA 1DOLA 2F4IA 4DGZA 4KHPL 4LMQD 1FYCA 3NWTA 3BZDB 4DUZL 4LF6Q 2SNMA 5DNFA 2ZXOA 1PRTF 4A3DH 1Q46A 4YWKA 4KKSA 2K03A 1IBMQ 4NXNQ 3X3MA 5IIFA 4V0BA 2VQEQ 2OF1A 1TS4A 2ENBA 2H5XA 2J7ZA 3ND8A 1NMGA 2K4KA 2FMCA 1S40A 2MFIA 1R4QB 3HOVG 4AH6A 1H9JA 2WB1E 3D4WA 2Z8LA 2DY8A 2DY7A 5BN3A 3CRLC 1KQSA 3HOWB 2WAQE 2PNRC 2FHTA 2NYZD 3S17H 1XPOA 4S3SA 3S2DB 1Y1VH 2Z4IA 2FFKB 3VA7A 1Q1BA 3GV3A 3MFGA 1IBLQ 3HOYB 4JI6Q 1ENFA 2IJ0A 4HJ7A 2QDBA 3CMEA 3HOZB 2KENA 4Q0FA 3S1NH 2KCCA 1Z6HA 4JOIA 4MN3A 2KJXA 3PCOB 2B63H 4RAUC 4XT1B 1KXLA 3KJPA 4QL5A 1VQ8A 1ZYRC 4JK1C 4IUUA 3DLLA 4C3JG 4A3FG 4GKJQ 3HOUG 3BG3A 5C3EH 4KV6A 1HZCA 1G6PA 3OW7A 4KY5A 1ZEQX 2K50A 1ZKOA 1WCMB 2I46A 2ICIA 3OIPA 4HJAA 3I4MH 4PMBA 3M4OB 4L8JA 2LS01 2NUCA 5K36G 4DAMA 5I6WA 3TP7A 1LM0A 4JI2Q 4DF7A 1WTQA 4DAYB 2MPMA 3GTLH 1SNOA 3S14B 2PZWA 1X9NA 1AH9A 1EQTA 4OL7A 4C1NK 1IKMA 3PUYA 4DR6Q 2N55A 1SNCA 2BA0A 1PTOC 3S1QH 1JOQA 1E1OA 4PZ8A 3TDQA 4KD3A 1QVGA 2Z0SA 5ELDA 3PO2H 4F8MA 1I4QA 4JV5Q 4JV5L 4GNXA 2EYMA 1PYBA 3S16H 1YITA 2HDLA 1WD1A 4C3IG 1A3TA 2Q2HA 3I2ZA 4A3GG 2PQEA 3SR1A 3O13A 4CKCA 2I5HA 4H02A 1RD9D 1C9OA 1TY2A 3M3YH 5IT9E 4XYQA 1TWHH 4UY8C 1TWFH 2J4XA 3NENA 1SMYD 2CW0D 4A3CH 1KAWA 3TMEA 3BVGA 3EN2A 4DV5Q 1PH3A 2F0FA 2QKIC 1OTCA 2X69A 1LV9A 2EDGA 4ZLTF 4HN7A 5M5WB 5CMDA 3RZDH 1IBML 1XTCD 1FNWA 4LFAQ 1DOMA 1U4PA 4NB3A 4YCVA 3S15H 2Z6KC 1BDOA 4U68A 2RDFA 1SFOB 2E2DC 4EQNA 3R93A 1L0YB 4OWTB 1CK1A 4EQ5A 5EKLA 4DV1L 3K8AA 3A0JA 1P8LA 1Z47A 5EAYA 1B50A 1EIGA 1K0RA 3HOVH 4HR7B 1HFGA 4BXXG 3LNNA 4DKAC 5KNCA 1PH1A 3SK4A 5LHY1 1Q86C 2IW3A 4O42A 2R7ZH 1Z9FA 1JOOA 3ULLA 1E2ZA 1OXXK 5FJ8H 1CKMA 3I56A 2NWGA 2SOBA 2CKZB 4HJ8A 5ELEA 1BOSA 3GO5A 4ZYSA 2UUBL 4QIWB 4MIUA 4KLKA 4OXPA 2RCFA 4QGUA 2R3ZA 4DA2A 1UE1A 4IPHA 1Y1VB 3W1GA 4U673 1FNVA 4DV4Q 3PV0A 2WKDA 1Q81C 4B3TL 1N8RC 3U9OA 4C56C 4FNFA 1I3QB 2ICEC 5JJLA 4PMCA 2CH4A 3CF5A 1HJPA 1BBXC 1TR5A 2XVSA 1A2TA 2JSOA 2F4VQ 3M4YA 1PYSB 1XMOL 1MJCA 2LY7A 1IYVA 2YTXA 1ENAA 5NUCA 1IXRA 3G48A 3E5SA 1XMQL 5IP7H 5K36H 3VYSA 1P16A 3FPPA 3CU7A 1EEFD 4IUQA 3D6WA 5TSSA 4DV1Q 4XQQA 5FK9C 5IP9G 3C2PA 3J80E 3MAQA 4DNRB 3TP6A 3DWPA 2DJFC 5E4XA 3TSSA 3J80i 4KHZA 1IYUA 4ODGA 1LLRD 3MXGA 1O78A 1O80A 2AHOB 1WCMG 4BWGB 1CSPA 1OXUA 3H0GH 2I07B 2ZXRA 4K5VA 1WTVA 3VA5A 2F0NA 4RKLA 5C4ZA 1SYDA 2NB0A 2XGTA 1RF2D 4A3JH 1SE3A 1TWGB 3A7LA 1SNQA 5ELNA 3J80L 5D3DA 1HNZL 1V1PB 1KRTA 5AJ3L 1SJED 5IOCA 2K33A 5KYIA 1LYLA 1AZPA 1NR2A 4ZCKA 2EXZA 4J6HA 1WYDA 1ASYA 1TWHB 3MEHA 3CMAA 1I6HH 3K6OA 4LF5Q 3SHLA 2PQAA 2IX0A 4ZAIA 4R8NA 4JBJA 1V43A 5IGFA 2JP1A 2CCZA 2OQKA 4IALA 3J81c 1KABA 1JE4A 4NMZA 1PV4A 2EE1A 4XT3B 2LFNA 3H0GB 5FOBB 4DXFA 1K3RA 3H0GG 1HZBA 2N3SA 1X55A 4JOIC 4JBMA 1WFQA 1D1IA 1KDAA 1RL2A 1QWYA 4CGYB 3IFTA 3MXPA 2F3WA 2EYPA 3BJUA 4JPBW 5FLMG 4IPCA 4CJ1B 4KI0A 4DV2Q 4TVAB 4LUZA 2VNUD 1BCPC 2VB2X 2F0GA 3I90A 2MJ8A 1Q7YC 4F88A 2B2TA 1N36Q 1QNUA 1HRJA 2WINB 4LUOA 2E5LL 3HKZE 1PZKD 5KEEA 5A2QE 1LTTD 3KLSA 1CQFA 1VQ7A 1SYCA 3G6EA 4DV7L 3HS0C 1O7LA 3KOJA 4LJZC 1B44D 4IFDG 5CV4A 5JVG3 2NVYB 1EIHA 1HHVA 2KQ3A 4R4CA 2WP8J 4DR2L 3LGJA 1UNSA 2K7VA 4HIMA 1I50B 5EQ0A 1GUWA 2B2UA 5C5LA 3D4DA 1NCVA 3DXJC 3FEWX 2AQ1B 2XN9C 4GNXB 3AYHB 2UUCQ 4I7AA 3K5OA 2BOSA 2G5DA 4O1NA 1EQRA 1MKHA 1G2TA 1EY0A 2Q2TA 1D1KA 3J7YW 1STBA 4BY1G 4X3KA 2V1CC 4QIWE 4OIKA 4ZK9B 1WVLA 1VQJA 2VY3A 4DU9A 1H9SA 3GTGB 2R92B 2WAQG 2E2HH 1B53A 4DUZQ 4LF6L 4FP5D 5J1ZA 4X65Q 2PZUA 4RFBA 1N32Q 1PH4A 1VCIA 3CCMA 2LMCB 3CQZH 1PHJA 1DXMA 1F9RA 4TQUS 4L5RC 1V8QA 4YY3Q 3K59A 3PIO3 2SDFA 2RBMA 2AQ2B 1YJWA 2F0WA 5JVH3 1RHPA 3MFYA 1EY4A 2RSNA 1J5EL 3OIQA 3J7A5 2MP1A 3BVMA 1SXTA 4DR2Q 5JEAJ 1UEAB 1TWFB 2JJQA 3J81L 1J5EQ 3H3VC 4XXEA 3EJIA 2F0VA 4B3MQ 1VQLA 3U50C 2J0TD 1PH6A 1M90C 1VQOA 4GKKQ 3BZCA 3G71A 4DV0L 1XNQQ 1I4XA 3KBXA 3CCJA 1K9MC 2NN6I 4R4IA 4X6AH 1PFMA 5KYLA 1UAPA 2AWNA 1HTLD 2QEJC 1N32L 4P74A 1KAAA 4P71A 3BDOA 5FLMH 3J81E 2CWPA 2N78A 3ER0A 3H91A 1GHJA 2N88A 3JC66 3J80c 2KCTA 3CC7A 3TP8A 3JAME 2CVRA 3HOZH 4GOPA 3GTQH 2R93H 1X65A 3DEPA 3FDTA 4GS3A 3V05A 2QCPX 3HOXG 2EJGC 3T4AC 2Y0SG 3HOXB 4RH6A 2JK8A 1XNRL 2GN5A 3T1YQ 2D0OA 1CT1D 1HQRD 1D5MC 1HQMC 5M3FG 2K04A 1MHWC 2X6GA 4B3TQ 4A3KH 2HUGA 1X3QA 2A6HD 5KNDA 2OEOA 1A2UA 1PH7A 1RODA 3NQIA 3J7AV 1QE6A 1PH2A 4C3JH 1TXYA 4ULLA 3I8ZA 1EOVA 1Y69U 1NUCA 2ES2A 4AYBG 2OTJA 3K0YA 1RDPD 1CFMA 4QF4A 2IY5B 1X32A 4DR5L 1B4OA 1QUQA 1HNWQ 2XRSD 2RF4A 2B2WA 4GZYC 1UUPA 4V190 1EYCA 3MHBA 1MGSA 2K5HA 2XWBB 4LNQA 4A3DG 1QILA 1GUOA 4JBWA 4JI2L 3KUPA 5J22A 4FF3A 4N8FA 4XIGS 3CCVA 3K7AB 4PQXA 1OXVA 3TREA 5BR8Q 3S24A 5GAHC 2K05A 1X3PA 2IX3A 3K57A 4IUTA 1KDCA 2M00A 3I3CA 2HD3A 1HNXQ 3AEVA 3DWAA 2K5QA 4LFBL 3CCQA 1HR0W 2ZJQA 2YYZA 2HQEA 5ELCA 2EY1A 2E8GA 1XJVA 3ZJYC 1CSQA 1GOZA 4UPAA 2UXBL 2FXQA 5DM73 1K73C 4M1UB 1II3A 4ZRZA 1BNZA 1Y14B 3OWFA 2R7FA 3EFXD 1G51A 1BBWA 1G291 3URYA 5A35A 5IGCA 1EL0A 1LTGD 1JQYD 3N6RA 1J8IA 4IO9A 3RNUA 5C3EB 4DK0A 2RDHA 1TT2A 4B3SQ 1MI2A 3IFDA 3MA2B 1WTWA 5M5XH 3GTOB 4CJ2C 4FDBA 3AFQA 4BBSB 1WI5A 5IGGA 1H9RA 4NXML 3RN2A 1NTGA 2QA4A 3PGZA 2Q8RE 2IHEA 4Q5VA 4HTHA 1YNND 1B8AA 4OO1G 1KNAA 3E0EA 1JC7A 2BDOA 1R4PB 1LT6D 1W6KA 2K28A 1SEBD 1E2WA 2AQ3B 1SMYC 3MC0B 2VW9A 3T51B 2UUAQ 4DR7L 5JJKA 2L55A 3NQTA 3U4ZA 3CCRA 4LF7L 3HOWH 1H9MA 2BE5C 2XTIA 3NUCA 1GO3E 3OMCA 3F8TA 1SE4A 5IWAL 1HA6A 4N8X1 4A3KG 2F0MA 4GOPC 3S2DH 4G57A 4DV6Q 2NBFA 1BVSA 2OT2A 4ABNA 1GD7A 2EIFA 2EPBA 2PZTA 3NSWA 1STHA 3HOUB 1IYJB 1LABA 4JBKA 2R93G 1JT8A 1R9TH 2K6AA 2K01A 2EJFC 3W3AA 4UP7A 1HFNA 5I9OA 4ME5A 1GM5A 2F0EA 1SN8A 3I73A 5M3FB 1BXTA 1PZJD 1UE7A 5EPLA 1STEA 3SK6A 4O2DA 3J81j 3A8JE 3M3YB 1ENCA 4LF4L 1VQPA 1GKHA 3GTQB 4K8JA 4OGQC 4LK1C 1S4ZA 1ICFB 5C0XJ 3KF6B 3STBC 5JEAG 5ISRA 3I7FA 4JVZA 1Q12A 4JW0A 1XNRQ 4XTCS 5D14A 3FRPB 1SYBA 2G9DA 4LFCL 1HXYD
chains in the Genus database with same CATH topology
2F3VA 4QB4A 4RGNA 1Q3LA 4RKBA 3J7AF 4BA2I 1EU3A 4A3GB 2NVXB 3GV6A 1FR3A 5EBDA 5F2DA 4EQOA 2F0TA 1OXSC 1V1OA 1TS3A 4J1MA 2D5DA 2L12A 3RD4A 3MWYW 4KMUC 3M7GA 2H1EA 3CRKC 4OO1I 1SYEA 4RCNA 3Q22A 1V1PA 3RUZA 1JWMD 5COYA 3WDNA 5M3MB 5C4XB 3L9AX 1Q90A 4H0LC 4WORA 2SNSA 3KLSX 1TWAB 4NW2A 1RJTA 1TU2B 4RHSA 5LL6X 1QB5D 1ESRA 2TSSA 2O5JC 1QG7A 2TMPA 4C3HG 1QCBD 3T56B 2A5HA 5LL6S 3VYUA 5IODA 1SNDA 3KLRA 4TKOB 1EY9A 3NTKA 1DOKA 1EY7A 2F0JA 5DEHA 1STAA 2AWOA 2C9OA 1TWCB 2F03A 2GA4B 1PRTD 3G6JB 4ZKBB 1ET6A 3VR3A 2KCNA 4RGMA 1W6JA 5CV9A 5EKKA 4A3BB 1T5XD 4IN3A 2DN8A 2KA7A 5FKAC 2A68D 1PRTB 1U4MA 3VYRA 4ZUIA 4RGOS 1DCZA 5EPKA 3BDLA 1AN8A 4KJNA 1PFBA 5D3IB 4QCLA 2RVLA 3OSOA 1K8MA 1LTAD 4Y7NB 4H7BA 5DM63 1SYGA 1M4VA 2R6GA 4DK1A 5FO9B 3Q0AA 2CHBD 3TBIB 2Y0SB 1O7YA 3NPPA 3C46A 3S2HB 4EGVA 1QJOA 4XQJA 4CBVA 3C1EA 3LWUA 4DFAA 5EJWA 4I65A 1A3VA 3QIAA 3S1NB 1ZXTA 1EZ6A 3MVVA 3ITPA 2Z4HA 1STGA 3IKJA 1JR0D 4I7ZC 4L6TB 2NZ1D 1PRTC 4C3IB 4E6IA 5I6YA 1KDBA 2B2TC 1ESFA 2B8FA 3NBIA 1ICWA 2V4DA 4IZ8A 1TY0A 2BCOA 2RSOA 3GD7A 2B2WC 2NN6H 2NVQB 1TKWB 1OO9B 2KOLA 1BCPF 2NTTA 4M8AA 2BA1A 4DAYA 1SNPA 1PMRA 5A2QL 5IGEA 1E2VA 4KY6A 3A7AB 2JE6I 5M9OA 1WTXA 2X6LA 1MBYA 5T1GA 5I4DA 4RHRA 1AW7A 2YU9B 4FF2A 3NWSA 1EWCA 4K14A 1DYQA 2F0KA 4IFDH 3PUXA 2FJ2A 1RTNA 1AP0A 2ZXPA 2AUKA 1LT4D 1EYAA 4CKBA 1SE2A 2M2LA 2R61A 5CGKA 1JOKA 2F0DA 4ZUJA 1STYA 5EKIA 1NR4A 1FGBD 1SNMA 2BDNA 4LAAA 1IKLA 3R8BA 5CV8A 5D65A 4A93B 1GUSA 2VUMB 1KLGD 4BA1I 3DUZA 3I91A 2Z1CA 2F0HA 3R3OA 1F9SA 1QNKA 1D2BA 2MGSA 1AZQA 3QJYA 1O7ZA 4A3KB 1GHKA 5KRUA 3F2UA 3BVZA 1NSNS 1Y8PB 5E1FA 2R93B 2CW0C 4L63B 2WKCA 3H94A 3Q23A 4H13C 4FO2A 3SK8A 2A6EC 1H9SB 3D3RA 4K8IA 4XQNA 3Q6SA 1C4QA 1A3UA 4KD4A 3NTIA 4IFDI 1TS2A 3S1MB 2B63B 1H9KA 3MTSA 3EROA 2EY6A 1ILQA 5JAVA 1YNNC 2KECA 1SAPA 4A3MB 2IL8A 3R2TA 1VDZA 3FMCA 1KNEA 3LWEA 3VR5A 1BCPB 4A3DB 4XDXA 1PTOB 3OPOA 1ET9A 4KK7A 2L11A 4A3IB 1FD7D 3JAML 3NP8A 3IAYA 4WRDA 2M9VA 2IX1A 5I2XA 4IQZA 1ZYRD 4PMWA 1JORA 2F0OA 1I4RA 4KY7A 4DAVA 5CORA 1RTOA 1VMCA 2HDMA 3QO2A 1SBBB 2JA5B 1F77A 2L0CA 1S5FD 4B08A 3E0JA 1SDFA 4HEDA 4UDUC 5CV7A 4BBRB 5G3LF 1S5ED 2IPKD 4K5XA 4HMIA 1IW7C 5HURA 2F1MA 4F7XA 4HCEA 4R9WA 3EVQA 1E0BA 2O5IC 2KVMA 5E4WC 3K5MA 5C4HA 4BY1B 1U9RA 1CM9A 5FO7B 3PO3B 4K6DA 4NKLA 3OOCA 4NP5A 2SEBD 2EY2A 4IUNA 4XYOA 1KLUD 1PTOD 5I9PA 1OXTA 4CJ0B 2A6HC 2PCFB 4UAIA 3QOLA 3GTKB 2A6ED 5C44B 4C3JB 1XXGA 5J39A 5I2YA 1G8ZD 2EYFA 1CA5A 5HGTA 3S15B 1PDQA 1DD2A 4KN4C 3K5NA 1KTKA 1Y1WB 5EBCA 4G7ZC 3SXHA 1VMPA 1EWHA 1GXDC 1Q1EA 3RLFA 2XRQD 1AFPA 3GTJB 3AMUA 1F9PA 4K2KA 3V96A 1EY5A 5ELFA 4FF1A 3U9SA 2RQXA 3A56A 2FMMA 2WV6D 1C48A 2L5TA 4MHEA 1RCVD 4OHJA 1XX8A 1L0XB 3KK7A 3L3OC 3N52A 4ZKCB 3EQLC 2R7ZB 1Y8NB 2QILA 2B2YC 5CYUA 3MXNA 2D2CC 4N9PA 1U4LA 3DMUA 4A3JB 3G7LA 5FLXE 2Q8TA 5C3XA 1EFID 2FINB 1M8AA 1EY6A 1G6ZA 4HMJA 3AU7A 2O4XA 4QUCA 3S1QB 1LTSD 3A54A 4X3SA 3OMGA 1CZWA 3H6MA 4OIJA 2PMZB 1I6HB 1CZGA 3A55A 2JA6B 3BYTB 3S1RB 1CI3M 3GTMB 2JA7B 4CHTB 5AFWA 3OWEB 2A74C 1DZ1A 3TZUA 4KKUA 2EVBA 3S16B 4C3HB 1D6EC 2KEEA 3MZ5A 2G9HD 5M5YB 2E2IB 2K32A 1ILPA 2K5DA 1DONA 4TSSA 3RZOB 1VF7A 4HSPA 1CHQD 4HCSA 3NHHA 4FYDA 5CV5A 3WOEA 5JPNC 5CBEE 2E76C 3L7ZC 1JICA 2PPBC 1BQQT 3HKZB 2RDGA 2HCCA 2KHSA 1HUNA 2HCIA 3QG1A 3PMFA 3I72A 3HOVB 1YNJC 4C1NI 4PV1C 3D6CA 4IURA 1R9TB 3NXWA 3QB3A 1ONLA 3KBGA 2K5WA 3DHQA 4A3FB 3AB9A 2B2VA 1WTOA 1S5BD 1CQVA 4HSVA 3BYYB 2AUJD 3NK9A 1WTRA 2EOTA 3DEOA 1F2ZA 4B9XA 3A8IE 4WFN3 2IT1A 1D5XC 1PFNA 1HTPA 1S5CD 2A68C 1SYFA 4IFDJ 1F2MA 4DN4M 1PTOF 4EQPA 3OHXC 4X3UA 2XIWA 2PYKA 1LTBD 1I4HA 3I4LA 5IGBA 1SSOA 2Q8IB 3ERQA 3D31A 3R2IA 2NN6G 5M5XB 3FKIB 3PUZA 1I4PA 1TVXA 3GTPB 5IT9L 4ID6A 1IL8A 1CHPD 3QOJA 1BUVT 1GUGA 3PO2B 1LTID 4RWSC 2DNEA 2O2LD 3SEBA 4G7HC 2B2YA 2EYOA 2MUYA 5G3LD 5BN5A 4RGTA 1G91A 4Z9CB 3HRZC 3P20A 2L4NA 5CC4A 1PLFA 1PTOH 3A8KE 4YIJA 1B1ZA 3CHBD 1RKNA 3P75A 1A15A 2E2JB 4WJWA 1IW7D 3M85A 3Q24A 3VR6A 2F0LA 2JXMB 4DXGA 3NBHA 1DM0B 3BDCA 3UI2A 1GUTA 3E6ZX 1Q8IA 4KTAA 2A69C 1EQVA 3NE5B 5T1IA 2L1BA 1EEID 3PUVA 5K5PA 5C0XH 4DNTB 2B8GA 5JEAH 4KJOA 3HGBA 4H44C 3ZYYX 2A69D 4B9WA 4N9TA 2EYJA 2D62A 3TN2A 4FXDA 1GUNA 5JOBA 2XWJB 5E3FA 5JJZA 1MSGA 1HPCA 4FF4A 1STNA 2JEBI 3I4MB 2DNCA 1NAPA 3QWNA 4FXGC 1TS5A 4KHVA 4J8QA 4FXKC 4K2LA 4NDXA 1K83B 1BF4A 4RA8A 1C8CA 5CBAE 2OXPA 2BE5D 4QUFA 1LTRD 1D5ZC 3SDZA 1EU4A 3K58A 1HA5A 1TQOA 1ML0D 4R8IA 2E74C 2A73B 3I4NB 3HZXA 3NTHA 3HG9A 2XNAC 2ID0A 1U4RA 1T5EA 3P1HA 2RKSA 2CQAA 2IWHA 3EA6A 2C5CA 1VF5C 1J9OA 3S9WA 1K8OA 5C5MA 5FO8B 1PYWD 2F0QA 3M7NA 4AYBB 3PUWA 5C6AA 2F0UA 2PO4A 3KF8A 4DAPA 2F0SA 5CV6A 3WOFA 2QF7A 2F0IA 1JWSD 2EJMA 3P7JA 1Z7TA 2JEAI 4BY7B 3D4RA 5C3WA 1S5DD 3DM1A 3ONAB 4RCOA 2RA4A 3CKIB 4KN7C 3DWQA 1B9NA 1IHZA 5C0XG 5EPJA 3PIP3 3ND9A 4FVMA 2JA8B 5EGTA 1B2TA 4QMGA 5JPMC 1YNJD 4PNYA 5KIXA 3HP3A 1SJHD 2K1BA 1TIID 1HCZA 3T13A 3S17B 2NTSA 2H4OA 4ILWA 3MXUA 2KEDA 3H09A 2WB1B 4EVOA 5BN4A 2WAQB 1MD2D 3SK5A 4ZQ3A 4HAEA 5KGUA 5IGDA 4C2MB 1I4GA 3FVQA 3GTLB 1BR9A 4K5WA 3SVMA 1XYIA 1PXUA 1EOTA 1F2LA 3TP5A 1QOHA 1LT3D 1CTMA 2EY5A 5ELBA 1G2SA 3SE0A 4G4KA 2WACA 2KUMA 1JB3A 2B39A 1JCKB 3T16A 3C1FA 4F87A 1F2YA 2B2UC 3I70A 5DAUA 2PW5A 1FNUA 1EY8A 3IL8A 1BCPD 1LT5D 1HUMA 3VR4A 1EZ8A 5C4JB 3T53B 1A6XA 4G7OC 2E75C 5C0XI 2PW7A 3VYTA 2EYHA 2MHVA 2VB3X 4X3TA 2JYOA 4K6LA 1BO0A 3BS1A 1MSHA 3FPUB 4P2CB 1GJXA 2B2VC 3V2TA 1B9MA 3W2DA 3RZDB 1CA6A 4OO1H 3K5LA 1DJRD 2VXWA 1Y8OB 3CQZB 2LKVA 3D8GA 2ZT9C 1I6VC 1EYDA 2EYLA 1AEXA 1XWEA 4BS9A 1F9QA 1JWUD 2XSCA 1WD0A 3VR2A 4KKTA 4IUVA 2D9UA 3GQBA 4A3EB 2L9HA 1B3AA 5CR3A 3GP7A 3TZDA 4IUPA 3HEJA 3RMHA 3LX0A 4CKEA 1PZID 2WIIB 3C3LA 4TRDA 1LACA 2E2HB 1LO5D 1WTPA 5FLXL 2F0PA 2NVTB 2EZVA 5KNBA 3X3NA 1DOLA 2F4IA 4DGZA 4LMQD 1FYCA 3NWTA 3BZDB 2SNMA 5DNFA 2ZXOA 1PRTF 4KKSA 2K03A 3X3MA 5IIFA 4V0BA 2OF1A 1TS4A 2ENBA 2J7ZA 3ND8A 2FMCA 1R4QB 1H9JA 3D4WA 2Z8LA 2DY8A 2DY7A 5BN3A 3HOWB 3CRLC 2PNRC 2FHTA 2NYZD 4S3SA 3S2DB 2Z4IA 2FFKB 3VA7A 1Q1BA 3GV3A 3MFGA 3HOYB 1ENFA 2IJ0A 2QDBA 3HOZB 4Q0FA 2KCCA 1Z6HA 4MN3A 2KJXA 4RAUC 4XT1B 1ZYRC 4JK1C 4IUUA 4C3JG 3BG3A 4KV6A 3OW7A 4KY5A 1ZEQX 1ZKOA 1WCMB 2I46A 2ICIA 3OIPA 4PMBA 3M4OB 4L8JA 2LS01 2NUCA 5K36G 5I6WA 3TP7A 4DF7A 1WTQA 2MPMA 1SNOA 3S14B 2PZWA 1EQTA 4OL7A 4C1NK 1IKMA 3PUYA 2N55A 1SNCA 2BA0A 1PTOC 1JOQA 3TDQA 4KD3A 5ELDA 4F8MA 1I4QA 2EYMA 2HDLA 1WD1A 4C3IG 1A3TA 2PQEA 3SR1A 3O13A 4CKCA 1RD9D 1TY2A 5IT9E 4XYQA 2J4XA 1SMYD 2CW0D 3TMEA 3BVGA 2F0FA 2QKIC 2X69A 1LV9A 2EDGA 4ZLTF 4HN7A 5M5WB 5CMDA 1XTCD 1FNWA 1DOMA 1U4PA 1BDOA 4U68A 2RDFA 1SFOB 2E2DC 4EQNA 3R93A 1L0YB 1CK1A 5EKLA 1Z47A 1B50A 1EIGA 4HR7B 1HFGA 3LNNA 5KNCA 3SK4A 5LHY1 2IW3A 4O42A 1JOOA 1E2ZA 1OXXK 2NWGA 2SOBA 5ELEA 1BOSA 3GO5A 4ZYSA 4QIWB 4MIUA 2R3ZA 4DA2A 1Y1VB 4U673 1FNVA 3PV0A 2WKDA 3U9OA 4C56C 4FNFA 1I3QB 2ICEC 4PMCA 1BBXC 1TR5A 2XVSA 1A2TA 2JSOA 3M4YA 2LY7A 1IYVA 1ENAA 5NUCA 3E5SA 5K36H 3VYSA 3FPPA 3CU7A 1EEFD 4IUQA 3D6WA 5TSSA 4XQQA 5FK9C 3C2PA 3J80E 3MAQA 4DNRB 3TP6A 3DWPA 5E4XA 3TSSA 4KHZA 1IYUA 4ODGA 1LLRD 3MXGA 1O78A 1O80A 4BWGB 1OXUA 2I07B 2ZXRA 4K5VA 1WTVA 3VA5A 2F0NA 4RKLA 5C4ZA 1SYDA 2NB0A 1RF2D 1SE3A 1TWGB 3A7LA 1SNQA 3J80L 5D3DA 1V1PB 1SJED 5IOCA 2K33A 5KYIA 1AZPA 1NR2A 2EXZA 4J6HA 1TWHB 3MEHA 3K6OA 3SHLA 2IX0A 4ZAIA 4R8NA 1V43A 5IGFA 2JP1A 4IALA 1KABA 1JE4A 4NMZA 2EE1A 4XT3B 2LFNA 3H0GB 5FOBB 4DXFA 1D1IA 1KDAA 1QWYA 4CGYB 3IFTA 3MXPA 2F3WA 2EYPA 4CJ1B 4KI0A 2VNUD 1BCPC 2VB2X 2F0GA 3I90A 2MJ8A 4F88A 2B2TA 1QNUA 1HRJA 2WINB 1PZKD 5KEEA 5A2QE 1LTTD 3KLSA 1CQFA 1SYCA 3HS0C 1O7LA 4LJZC 1B44D 4IFDG 5CV4A 5JVG3 2NVYB 1EIHA 1HHVA 2KQ3A 2WP8J 1UNSA 2K7VA 1I50B 5EQ0A 1GUWA 2B2UA 5C5LA 3D4DA 1NCVA 3DXJC 3FEWX 2AQ1B 2XN9C 3K5OA 2BOSA 4O1NA 1G2TA 1EY0A 1D1KA 3J7YW 1STBA 4X3KA 4OIKA 4ZK9B 1WVLA 4DU9A 1H9SA 3GTGB 2R92B 1B53A 4FP5D 5J1ZA 2PZUA 4RFBA 1VCIA 2LMCB 1DXMA 1F9RA 4TQUS 1V8QA 3K59A 3PIO3 2SDFA 2RBMA 2AQ2B 2F0WA 5JVH3 1RHPA 3MFYA 1EY4A 2RSNA 3OIQA 2MP1A 3BVMA 1SXTA 5JEAJ 1UEAB 1TWFB 3J81L 3H3VC 4XXEA 3EJIA 2F0VA 2J0TD 1I4XA 3KBXA 2NN6I 1PFMA 5KYLA 1UAPA 2AWNA 1HTLD 2QEJC 1KAAA 3BDOA 3J81E 3H91A 1GHJA 2N88A 3TP8A 3JAME 2CVRA 3V05A 3DEPA 3FDTA 2QCPX 2EJGC 3T4AC 3HOXB 4RH6A 1CT1D 1HQRD 1D5MC 1HQMC 2K04A 2X6GA 2HUGA 1X3QA 2A6HD 5KNDA 2OEOA 1A2UA 1RODA 3NQIA 3J7AV 1QE6A 4ULLA 3I8ZA 1Y69U 1NUCA 3K0YA 1RDPD 1CFMA 4QF4A 1X32A 1B4OA 2XRSD 2B2WA 4GZYC 1UUPA 4V190 1EYCA 3MHBA 1MGSA 2XWBB 1QILA 1GUOA 4JBWA 3KUPA 5J22A 4FF3A 4XIGS 3K7AB 4PQXA 1OXVA 2K05A 1X3PA 2IX3A 3K57A 4IUTA 1KDCA 2M00A 3I3CA 3DWAA 2K5QA 2YYZA 2HQEA 5ELCA 2EY1A 1GOZA 5DM73 4M1UB 1II3A 4ZRZA 1BNZA 3OWFA 3EFXD 1G291 3URYA 5A35A 5IGCA 1EL0A 1LTGD 1JQYD 3N6RA 1J8IA 5C3EB 4DK0A 2RDHA 1TT2A 1MI2A 3IFDA 3MA2B 1WTWA 3GTOB 4CJ2C 4BBSB 5IGGA 1H9RA 2Q8RE 4Q5VA 4HTHA 1YNND 4OO1G 1KNAA 1JC7A 2BDOA 1R4PB 1LT6D 1W6KA 2K28A 1SEBD 1E2WA 2AQ3B 1SMYC 3MC0B 3T51B 2L55A 3NQTA 1H9MA 2BE5C 3NUCA 3OMCA 1SE4A 1HA6A 2F0MA 4G57A 2NBFA 2OT2A 4ABNA 2EPBA 2PZTA 3NSWA 1STHA 3HOUB 1LABA 2K6AA 2K01A 2EJFC 3W3AA 1HFNA 5I9OA 4ME5A 2F0EA 3I73A 5M3FB 1BXTA 1PZJD 5EPLA 1STEA 3SK6A 3M3YB 3A8JE 1ENCA 3GTQB 4K8JA 4OGQC 4LK1C 1S4ZA 5C0XJ 5JEAG 5ISRA 1Q12A 4XTCS 5D14A 3FRPB 1SYBA 2G9DA 1HXYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BBX C;  1WTP A;  1Q3L A;  3KBX A;  5T1I A;  1WTR A;  2X6L A;  2KUM A;  1WTX A;  3I90 A;  1IKM A;  2N55 A;  2EOT A;  2L1B A;  1PFM A;  4OIJ A;  2MJ8 A;  3DEO A;  5T1G A;  1BNZ A;  2B2T A;  1HRJ A;  1AZP A;  1U4M A;  1DOL A;  3GV6 A;  2B2U C;  4LMQ D;  1PFN A;  3MTS A;  1EL0 A;  1J8I A;  5DNF A;  4CJ0 B;  3IL8 A;  1ILQ A;  2HDL A;  3H91 A;  4IUQ A;  5EPK A;  4DN4 M;  2N88 A;  1WTW A;  3D6W A;  5AFW A;  4UAI A;  2KEC A;  1WD1 A;  3P7J A;  1SAP A;  1PFB A;  1HUM A;  4X3U A;  2K03 A;  2XIW A;  2IL8 A;  2L12 A;  2CVR A;  1MI2 A;  2FJ2 A;  3IFD A;  3DM1 A;  2RVL A;  3DEP A;  3FDT A;  3MWY W;  1RTN A;  1KNE A;  3LWE A;  3ONA B;  4CJ2 C;  1DZ1 A;  1SSO A;  4XDX A;  2J7Z A;  2H1E A;  2RA4 A;  5EQ0 A;  3TN2 A;  1AP0 A;  5E4X A;  2K04 A;  2KEE A;  2L11 A;  2X6G A;  4X3T A;  1GUW A;  2B2U A;  2Q8R E;  1NCV A;  1CA5 A;  1PDQ A;  2JYO A;  2HUG A;  5EPJ A;  1BO0 A;  1O80 A;  2M2L A;  1O7Y A;  5COY A;  1MSH A;  1X3Q A;  1TVX A;  1KNA A;  1ILP A;  3FPU B;  5JJZ A;  1DON A;  2X69 A;  1LV9 A;  2DY8 A;  2DY7 A;  4ZLT F;  1ROD A;  5CMD A;  1WTV A;  1B2T A;  1IL8 A;  1MSG A;  1QE6 A;  1NR4 A;  5EKI A;  1DOM A;  1U4P A;  2FHT A;  3I8Z A;  2B2V C;  2BDN A;  2K28 A;  1G2T A;  2NYZ D;  4HCS A;  3HP3 A;  4U68 A;  1IKL A;  5D65 A;  3R93 A;  5EJW A;  2FFK B;  4RWS C;  2K1B A;  1NAP A;  3GV3 A;  1VMP A;  4X3K A;  1CA6 A;  1X32 A;  5CBE E;  1ZXT A;  4NW2 A;  4OIK A;  5COR A;  2VXW A;  1RTO A;  1VMC A;  4ZK9 B;  3I91 A;  1RJT A;  1JIC A;  1WVL A;  2B2Y A;  1B4O A;  2HDM A;  3QO2 A;  1BF4 A;  4RA8 A;  1B50 A;  1NR2 A;  1C8C A;  1EIG A;  2B2W A;  5CBA E;  1B53 A;  1EIH A;  1HA6 A;  1HHV A;  1F9P A;  1SDF A;  1F9S A;  1HFG A;  1QNK A;  2KED A;  4HED A;  1MGS A;  1G91 A;  1ESR A;  4QUF A;  2NZ1 D;  2FMM A;  2L4N A;  1QG7 A;  1F9Q A;  2EPB A;  2MGS A;  4MHE A;  4O42 A;  1PLF A;  2HCC A;  2B2T C;  1F9R A;  3KUP A;  4MN3 A;  1AZQ A;  4ZAI A;  1HUN A;  1O7Z A;  1XX8 A;  2HCI A;  1ML0 D;  4RAU C;  4XT1 B;  4R8I A;  4HAE A;  1ICW A;  2NWG A;  2JP1 A;  2K01 A;  2SDF A;  1WD0 A;  3N52 A;  3F2U A;  4ZKC B;  1HFN A;  4IUU A;  2K05 A;  1JE4 A;  4IUR A;  1A15 A;  1X3P A;  2B2Y C;  2EE1 A;  4IUV A;  4XT3 B;  2RSO A;  1U4R A;  2D9U A;  2R3Z A;  1DOK A;  1RHP A;  4IUT A;  2B2W C;  2RSN A;  2L9H A;  5EPL A;  1B3A A;  3TZD A;  4IUP A;  3SVM A;  3I3C A;  1XYI A;  2MP1 A;  1U4L A;  2KOL A;  4R9W A;  1E0B A;  1EOT A;  1F2L A;  1S4Z A;  3G7L A;  2Q8T A;  2KVM A;  4ZKB B;  2B2V A;  5E4W C;  1J9O A;  1WTO A;  2FIN B;  1M8A A;  3UI2 A;  1G6Z A;  1WTQ A;  4QUC A;  4HSV A;  4CJ1 B;  2MPM A;  3Q6S A;  1G2S A;  5D14 A;  1EQT A;  4X3S A;  1CM9 A; 
#chains in the Genus database with same CATH topology
 3KDF A;  2F3V A;  4QB4 A;  4RGN A;  1Q3L A;  4RKB A;  4X65 L;  1V9P A;  4P75 A;  3S2H H;  3J7A F;  2EQS A;  4OX9 Q;  4BA2 I;  3MXN B;  1EU3 A;  2K14 A;  4DR6 L;  5LMN L;  5HY6 A;  1KC8 C;  4A3G B;  2NVX B;  3GV6 A;  1FR3 A;  3WWV A;  4KHP Q;  5EBD A;  3JAM i;  5F2D A;  2QGQ A;  4EQO A;  2F0T A;  1OXS C;  1V1O A;  2PQA B;  1TS3 A;  4J1M A;  5GQO A;  2D5D A;  2JA5 H;  2L12 A;  1AE2 A;  4L5Q A;  3RD4 A;  3MWY W;  4KMU C;  3M7G A;  2JA7 H;  2KHJ A;  2H1E A;  4A3F H;  3CRK C;  4LFA L;  4OO1 I;  1SYE A;  4GKJ L;  4BY7 H;  4RCN A;  1B3Q A;  5LMN W;  3Q22 A;  1V1P A;  4PZ6 A;  3RUZ A;  1JWM D;  4GN4 B;  1PH5 A;  5COY A;  1I5F A;  4DR1 L;  4O0A A;  1N34 L;  4NXM Q;  3WDN A;  5M3M B;  5C4X B;  3L9A X;  1Q90 A;  4H0L C;  5H1S E;  4WOR A;  5L37 A;  2SNS A;  3GTJ H;  3M4O H;  2JA6 H;  1XPU A;  1JE5 A;  2WFW A;  1JB7 A;  3CC2 A;  3KLS X;  1TWA B;  2JA8 H;  4NW2 A;  5LMU Q;  1N33 Q;  1RJT A;  4OWW B;  1TU2 B;  4Y52 H;  1YHB A;  3HOU H;  4RHS A;  1IBL L;  5LL6 X;  2I0Q A;  1QB5 D;  2WB1 G;  5FLX c;  1ESR A;  2TSS A;  3K7A H;  2O5J C;  1QG7 A;  2TMP A;  2CWA A;  3CCS A;  4C3H G;  4JI7 Q;  1QCB D;  3T56 B;  2A5H A;  5LL6 S;  3VYU A;  5IOD A;  1VQI A;  4JG2 A;  3RZO H;  1SND A;  3KLR A;  4TKO B;  4IPG A;  1EY9 A;  2ZM6 Q;  3NTK A;  1DOK A;  1EY7 A;  3KLW A;  2F0J A;  1QVC A;  5DEH A;  1STA A;  4K0K Q;  2AWO A;  2C9O A;  1TWC B;  2F03 A;  4A4I A;  2GA4 B;  1PRT D;  3G6J B;  4ZKB B;  1ET6 A;  3VR3 A;  2KCN A;  1NJI C;  4RGM A;  4JI1 Q;  4POF A;  1W6J A;  5CV9 A;  4WJ3 M;  5EKK A;  4A3B B;  4MTN A;  1VQG A;  1T5X D;  4IN3 A;  3UDF A;  2DN8 A;  2KA7 A;  5FKA C;  2K5V A;  1SR3 A;  2A68 D;  1PRT B;  1VQ4 A;  1U4M A;  1I94 Q;  1BKB A;  3VYR A;  4ZUI A;  4A3C G;  4RGO S;  1DCZ A;  2VZA A;  5EPK A;  2L15 A;  3BDL A;  1AN8 A;  4KJN A;  2EXD A;  1PFB A;  4BXX H;  5D3I B;  4QCL A;  2RVL A;  3OSO A;  1L1O A;  1K8M A;  3I4N G;  5M5Y H;  1LTA D;  3KYH C;  4Y7N B;  4H7B A;  5DM6 3;  1SYG A;  1M4V A;  2R6G A;  4DK1 A;  2ZTD A;  4IPD A;  5FO9 B;  2CHB D;  3Q0A A;  1H95 A;  3TBI B;  2Y0S B;  1O7Y A;  3NPP A;  3C46 A;  3S2H B;  1IZ6 A;  4EGV A;  1QJO A;  4A93 H;  4XQJ A;  1WOC A;  4CBV A;  3C1E A;  3LWU A;  4DR4 Q;  4IJL A;  4DNI A;  4DK6 C;  4DFA A;  2NVX H;  1L1O C;  5EJW A;  5IYD H;  4I65 A;  1A3V A;  4NXN L;  3FP9 A;  3QIA A;  3S1N B;  1ZXT A;  3I4O A;  1K8A C;  3CPF A;  1HH2 P;  1EZ6 A;  3ULP A;  5IYC H;  2RHQ B;  2F4V L;  3MVV A;  3ITP A;  2Z4H A;  3IKJ A;  1STG A;  1TWG H;  2Q2I A;  4YWM A;  1JR0 D;  2DJG C;  4I7Z C;  4L6T B;  2NZ1 D;  2Q2U A;  1PRT C;  4C3I B;  4E6I A;  5I6Y A;  1KDB A;  2B2T C;  1ESF A;  2B8F A;  1D8L A;  4EX5 A;  3NBI A;  1DGS A;  1ICW A;  1XNQ L;  4IOA A;  1SE8 A;  2V4D A;  4IZ8 A;  1TWC H;  4YWL A;  1TY0 A;  2BCO A;  2RSO A;  2HT1 A;  3GD7 A;  4YHH Q;  2DUD A;  2B2W C;  2NN6 H;  1WJJ A;  2NVQ B;  1TKW B;  2UUB Q;  1OO9 B;  2KOL A;  1BCP F;  2NTT A;  4M8A A;  3HOX H;  2BA1 A;  4DAY A;  1SNP A;  1PMR A;  5A2Q L;  1WCM H;  5IGE A;  4A75 A;  4HJ9 A;  1E2V A;  1E3P A;  4KY6 A;  3A7A B;  2JE6 I;  5M9O A;  4GLA C;  1WTX A;  2X6L A;  1X56 A;  1CUK A;  4B3R Q;  3KFU A;  3PIO A;  1MBY A;  5T1G A;  1X54 A;  5I4D A;  3L2P A;  1Q82 C;  4RHR A;  1AW7 A;  4ALP A;  2YU9 B;  4FF2 A;  5LMN Q;  3NWS A;  1E22 A;  2HIV A;  4X66 Q;  3F2D A;  1EWC A;  4K14 A;  1DYQ A;  2F0K A;  1QZH A;  4IFD H;  3PUX A;  2FJ2 A;  1RTN A;  4GOP B;  2BH8 A;  1AP0 A;  2ZXP A;  1ASZ A;  2AUK A;  1LT4 D;  1EYA A;  4WJ4 A;  4L5S A;  4CKB A;  1SE2 A;  2M2L A;  2R61 A;  5CGK A;  1JOK A;  2F0D A;  4JCV E;  1X3E A;  1VQ9 A;  1U0L A;  4CDC C;  4ZUJ A;  1STY A;  5EKI A;  1NR4 A;  1VQA A;  1FGB D;  1SNM A;  2BDN A;  1PH8 A;  4LAA A;  2NZH A;  4JI5 Q;  1IKL A;  3R8B A;  5CV8 A;  5D65 A;  1D7Q A;  2NZO A;  4OEL B;  4A93 B;  1GUS A;  2VUM B;  3HOY G;  1KLG D;  4BA1 I;  3DUZ A;  3I91 A;  5M3M H;  1EWI A;  5LMU L;  2Z1C A;  2F0H A;  3R3O A;  1PH9 A;  4DV7 Q;  4DV6 L;  5AJ3 Q;  1HZA A;  2UXB Q;  1F9S A;  1QNK A;  2UXD L;  4AQY L;  3UDG A;  3STB D;  1HZ9 A;  1D2B A;  2MGS A;  4LF7 Q;  1XTD A;  1AZQ A;  3QJY A;  1O7Z A;  4A3K B;  4JYA Q;  4DR1 Q;  4DV3 Q;  1GHK A;  5KRU A;  3F2U A;  1HNX L;  4LF8 Q;  3BVZ A;  1NSN S;  1NE3 A;  1Y8P B;  2K52 A;  5E1F A;  2R93 B;  2ZTE A;  2CW0 C;  2MQH A;  4L63 B;  2WKC A;  3H94 A;  2B29 A;  3Q23 A;  4H13 C;  4DUY Q;  4FO2 A;  5J3B A;  3SK8 A;  3J7Z C;  2A6E C;  1H9S B;  3D3R A;  4K8I A;  4XQN A;  3Q6S A;  2OTL A;  1BBU A;  1C4Q A;  1N9W A;  4RG1 A;  3W1B A;  1A3U A;  4KD4 A;  3NTI A;  4IFD I;  1TS2 A;  3S1M B;  3UE0 A;  1LTL A;  1T9H A;  2B63 B;  1H9K A;  3MTS A;  3ERO A;  1B7Y B;  2LXJ A;  1JJG A;  2EY6 A;  1ILQ A;  1IL2 A;  5JAV A;  1YNN C;  2KEC A;  1SAP A;  4A3M B;  3TRZ A;  2IL8 A;  1CKO A;  1HNZ Q;  3R2T A;  1VQM A;  1FVI A;  1VDZ A;  3FMC A;  4JI8 Q;  1KNE A;  3LWE A;  3U4V A;  3VR5 A;  1BCP B;  1NY4 A;  4A3D B;  4XDX A;  3U58 A;  1PTO B;  3AQQ A;  3OPO A;  1EQQ A;  1ET9 A;  2Z6K A;  4KK7 A;  5IYC G;  2L11 A;  4A3I G;  4A3I B;  1FD7 D;  3JAM L;  3NP8 A;  5C44 H;  3IAY A;  4WRD A;  2M9V A;  2IX1 A;  5I2X A;  4IQZ A;  4JI0 Q;  1MJE A;  3CC4 A;  2ASB A;  1ZYR D;  2KCM A;  3QR8 A;  3NEL A;  4GN5 A;  2VUM H;  2A1A A;  4PMW A;  4DR3 L;  4CDD C;  2E2J H;  1JOR A;  2E2I H;  2F0O A;  1I4R A;  4PG3 A;  3TQY A;  4KY7 A;  4DV3 L;  4DAV A;  1Y1W H;  5GAD C;  3UDI A;  5COR A;  1RTO A;  1VMC A;  3QO2 A;  2HDM A;  2JA5 G;  4POG A;  1SBB B;  2JA5 B;  3MEF A;  2Y0S E;  1F77 A;  1FGU A;  2L0C A;  1S5F D;  4B08 A;  3E0J A;  1L1O B;  2MNA A;  1SFO H;  3L0O A;  1SDF A;  4HED A;  4UDU C;  5CV7 A;  4R4O A;  4C2M H;  1YEZ A;  4BBR B;  2NVT H;  1PA6 A;  5G3L F;  4OX9 L;  1S5E D;  2IPK D;  4K5X A;  4HMI A;  1IW7 C;  5HUR A;  4JC0 A;  2F1M A;  4LFC Q;  4CDE C;  2AKW B;  4F7X A;  1S72 A;  4LF9 Q;  1M1K C;  3H3V H;  2JQO A;  4HCE A;  1Y1V G;  5C4X G;  4DV4 L;  4GLX A;  4R9W A;  3EVQ A;  1E0B A;  2O5I C;  4JI8 L;  3S14 H;  2KVM A;  2F3I A;  5E4W C;  3K5M A;  5GAE C;  1U5K A;  5C4H A;  2I5M X;  1UE6 A;  2GVA A;  3PIP A;  1KD1 C;  3PQI A;  1YHQ A;  4BY1 B;  2VQE L;  1U9R A;  2A19 A;  1CM9 A;  5FO7 B;  4MZ9 A;  3PO3 B;  4K6D A;  4NKL A;  3OOC A;  3CP0 A;  4MTK A;  4NP5 A;  5IYD G;  2SEB D;  3M4P A;  2EY2 A;  4IUN A;  4XYO A;  3HOZ G;  4IOC A;  1KLU D;  1PTO D;  5I9P A;  3PF4 A;  1OXT A;  3F2C A;  4CJ0 B;  3RR5 A;  3S1M H;  2A6H C;  2PCF B;  4UAI A;  3QOL A;  1E1T A;  4LFB Q;  1VQK A;  5E7N A;  1EUJ A;  1KHI A;  3GTK B;  1O7I A;  2A6E D;  5C44 B;  4RMF A;  1NMF A;  1CKN B;  5IT9 c;  4C3J B;  4B3M L;  1XXG A;  3ULJ A;  3RLO A;  1SRO A;  5J39 A;  3ICE A;  2PI2 E;  1AE3 A;  1G8Z D;  3M4Q A;  5I2Y A;  2EYF A;  1CA5 A;  5HGT A;  3S15 B;  1PDQ A;  1HR0 Q;  1DD2 A;  4KN4 C;  2PNH A;  3K5N A;  3K80 C;  4A3B H;  1KTK A;  1A63 A;  1Y1W B;  3A5U A;  2NVQ H;  4LW1 A;  5EBC A;  4AQY Q;  4G7Z C;  3SXH A;  1VMP A;  2MO0 A;  1EWH A;  2YU9 H;  4YY3 L;  2E5L Q;  1GXD C;  1Q1E A;  2CQO A;  2XRQ D;  3RLF A;  1AFP A;  3GTJ B;  3G4S A;  1FL0 A;  3AMU A;  1F9P A;  4K2K A;  3V96 A;  1EY5 A;  5ELF A;  4FF1 A;  3U9S A;  2RQX A;  3A56 A;  2FMM A;  2WV6 D;  3TS2 A;  1C48 A;  2L5T A;  3A74 A;  4MHE A;  1RCV D;  4JI1 L;  4OHJ A;  1XX8 A;  1L0X B;  3KK7 A;  4L5T A;  3VDY A;  1FJG L;  3L3O C;  1C0A A;  4OWX B;  3N52 A;  4ZKC B;  1A62 A;  5M5W H;  2B3G A;  3EQL C;  2R7Z B;  1Y8N B;  2HHH L;  2R7Z G;  2QIL A;  2B2Y C;  5CYU A;  3MXN A;  2D2C C;  2OWO A;  1PVO A;  2HHH Q;  3KF8 B;  4N9P A;  1U4L A;  3KDF B;  3DMU A;  4A3J B;  3G7L A;  4C3H H;  5FLX E;  2Q8T A;  5C3X A;  1EFI D;  2FIN B;  1M8A A;  1EY6 A;  1YIJ A;  1G6Z A;  4HMJ A;  3AU7 A;  2O4X A;  4QUC A;  3S1Q B;  1VQ5 A;  1LTS D;  2YTY A;  2K5N A;  3A54 A;  4R1J A;  3HFZ B;  4X3S A;  3RLN A;  1KIX A;  3OMG A;  1CZW A;  4HJ5 A;  1K0S A;  3H6M A;  2HIX A;  4OIJ A;  2UU9 Q;  2PMZ B;  3OW2 A;  1I6H B;  1CZG A;  3A55 A;  2JA6 B;  3BYT B;  3S1R B;  1VQN A;  1CI3 M;  2ZJR A;  3GTM B;  1J6Q A;  2JA7 B;  4DPG A;  1PFS A;  4CHT B;  4P72 A;  5AFW A;  2UU9 L;  3OWE B;  4DR5 Q;  4HIO A;  2A74 C;  1QZG A;  1SLJ A;  1DZ1 A;  5IY0 A;  3TZU A;  4KKU A;  2ZJP A;  4GNX C;  2EVB A;  3S16 B;  4C3H B;  1D6E C;  3W5O A;  2KEE A;  3MZ5 A;  2G9H D;  5M5Y B;  2E2I B;  2K32 A;  1YNX A;  1VS0 A;  1ILP A;  2K5D A;  1DON A;  4TSS A;  3RZO B;  1VF7 A;  4HSP A;  2LSS A;  1CHQ D;  4HCS A;  3NHH A;  4FYD A;  5IYB H;  5CV5 A;  3WOE A;  5JPN C;  5CBE E;  2GVB A;  2E76 C;  3L7Z C;  1JIC A;  4ME3 A;  2PPB C;  1BQQ T;  4A3B G;  4OEM B;  3HKZ B;  4A93 G;  1A0I A;  3HKZ G;  4JI3 Q;  1VQB A;  2RDG A;  3EBE A;  4DR4 L;  1E7Z A;  2HCC A;  2KHS A;  1HUN A;  2HCI A;  3QG1 A;  3PMF A;  3I72 A;  2YTV A;  3HOV B;  3DM3 A;  4GKK L;  1YNJ C;  4C1N I;  4LF4 Q;  4PV1 C;  1VQD A;  3D6C A;  4X64 Q;  4IUR A;  4JI4 L;  1R9T B;  3NXW A;  3QB3 A;  1ONL A;  5C4J H;  1X3F A;  2K5W A;  3DHQ A;  3KBG A;  4A3F B;  2ATW A;  3AB9 A;  2B2V A;  1WTO A;  4BBS H;  1S5B D;  4Y7N H;  1CQV A;  3SGI A;  4HSV A;  3BYY B;  2D0P A;  3NBH B;  2F52 A;  2AUJ D;  3NK9 A;  3H3V I;  1WTR A;  2EOT A;  3TS0 A;  3DEO A;  1F2Z A;  4B9X A;  3A8I E;  4WFN 3;  2IT1 A;  3T1H L;  2CFM A;  1TWA H;  1W2B A;  1D5X C;  1PFN A;  1HTP A;  1S5C D;  2A68 C;  1SYF A;  4J15 A;  2UUA L;  4IFD J;  2MO1 A;  3PO3 H;  1F2M A;  4DN4 M;  1PTO F;  4EQP A;  3OHX C;  2DGY A;  4X3U A;  1YBY A;  2XIW A;  2PYK A;  5IP7 G;  1IBK Q;  1KL9 A;  1LTB D;  1I4H A;  3I4L A;  5IGB A;  1SSO A;  2Q8I B;  3ERQ A;  3D31 A;  4K0K L;  3R2I A;  1QUQ B;  1S3O A;  2NN6 G;  2UXC Q;  5M5X B;  3FKI B;  3PUZ A;  3FKI G;  1I4P A;  1VQF A;  3OTO Q;  1TVX A;  1L0W A;  3GTP B;  5IT9 L;  4GLV B;  4ID6 A;  1IL8 A;  4A3E G;  1CHP D;  2ALY B;  3QOJ A;  1BUV T;  1GUG A;  3PSI A;  3UDX A;  3PO2 B;  3FKI H;  1LTI D;  4RWS C;  2B63 G;  2DNE A;  1SRU A;  2O2L D;  3SEB A;  4G7H C;  2HQL A;  1MIU A;  2B2Y A;  2JA6 G;  2EYO A;  4MNO A;  2MUY A;  4A3M H;  5G3L D;  5BN5 A;  4RGT A;  1JJC B;  1I94 L;  1G91 A;  4Z9C B;  3HRZ C;  3P20 A;  2L4N A;  2N8N A;  5CC4 A;  1PLF A;  4BY7 G;  1PTO H;  3A8K E;  1EIF A;  4YIJ A;  4P73 A;  1B1Z A;  1VQH A;  3CHB D;  1RKN A;  1YJN A;  2Z6B A;  3P75 A;  1E24 A;  1VQE A;  1A15 A;  2E2J B;  4WJW A;  3CCE A;  5IE8 A;  1IW7 D;  4CDF C;  3KJO A;  4GN3 B;  3M85 A;  3Q24 A;  3VR6 A;  4A3L H;  2JA8 G;  2F0L A;  2JXM B;  4DXG A;  3NBH A;  1VQ6 A;  2A8V A;  1DM0 B;  4JYA L;  3BDC A;  2ZM6 L;  2K75 A;  3UI2 A;  1YJ9 A;  1GUT A;  1UWV A;  3E6Z X;  1Q8I A;  4KTA A;  2P5Z X;  5IYB G;  2A69 C;  2RCN A;  1EQV A;  3NE5 B;  1YHA A;  5T1I A;  5HGQ A;  2L1B A;  1EEI D;  3PUV A;  4YCW A;  3PF5 A;  1HNW L;  5K5P A;  4LF5 L;  1YVC A;  5C0X H;  1YZ6 A;  4DNT B;  2B8G A;  2R92 G;  3UE1 A;  2C35 B;  5JEA H;  4KJO A;  3E9I A;  3HGB A;  2CH4 W;  1EIY B;  1K83 H;  4H44 C;  3ZYY X;  5C3E G;  3BU2 A;  2KHI A;  4HIK A;  4UP9 A;  2A69 D;  3IRB A;  3I55 A;  4B9W A;  4N9T A;  2EYJ A;  2PMZ E;  2D62 A;  3TN2 A;  4FXD A;  2R7D A;  1GUN A;  2AMC B;  3ERS X;  5JOB A;  2XWJ B;  3JAM c;  1K28 A;  4DUY L;  5E3F A;  3GTO H;  5JJZ A;  4BY1 H;  1MSG A;  1HPC A;  3PO3 G;  4FF4 A;  1STN A;  3I4M G;  2JEB I;  3D0F A;  5BR8 L;  3I4M B;  2DNC A;  3GTG H;  2VQF Q;  3NEM A;  1LUZ A;  1NAP A;  3QWN A;  4FXG C;  1TS5 A;  3TEH B;  4KHV A;  4J8Q A;  4C3I H;  4FXK C;  4K2L A;  4NDX A;  1K83 B;  1BF4 A;  4RA8 A;  1C8C A;  4B3R L;  5CBA E;  3EIV A;  2UXD Q;  3B6Y A;  2OXP A;  2BE5 D;  4DR7 Q;  1SMX A;  3I4N H;  4DV0 Q;  1XMQ Q;  4QUF A;  1LTR D;  1D5Z C;  3SDZ A;  1EU4 A;  3K58 A;  1HA5 A;  4DR3 Q;  1TQO A;  4QJF A;  1ML0 D;  4LUV A;  1QVF A;  2QDL A;  3K7U C;  2E74 C;  4R8I A;  2A73 B;  4DV5 L;  4IJH A;  3I4N B;  3HZX A;  3NTH A;  3HG9 A;  2XNA C;  2JA9 A;  4DK3 C;  2ID0 A;  1L2F A;  1U4R A;  3Q8D A;  1T5E A;  3P1H A;  2RKS A;  4A3L G;  2CQA A;  2IWH A;  3CCU A;  3EA6 A;  2C5C A;  1VF5 C;  2ZTC A;  1J9O A;  4A3E H;  4LF9 L;  3S9W A;  3OYY A;  3T1Y L;  1K8O A;  5C5M A;  5FO8 B;  3H15 A;  1PYW D;  3PO2 G;  2F0Q A;  4A3J G;  3M7N A;  4AYB B;  2R92 H;  3PUW A;  1IBK L;  5C6A A;  2BH2 A;  2F0U A;  2PO4 A;  3KF8 A;  4DAP A;  2YV5 A;  2F0S A;  3K81 C;  5CV6 A;  3WOF A;  2VS1 A;  2OQ0 A;  4X66 L;  4QY7 A;  3CAM A;  2QF7 A;  4A3M G;  3AFP A;  1JMC A;  2F0I A;  3HOY H;  3T1H Q;  1XPR A;  1JWS D;  3CD6 A;  2JN4 A;  2RHS B;  2EJM A;  4AIM A;  4UP8 A;  2OCE A;  3P7J A;  1Z7T A;  2JEA I;  4BY7 B;  2JA7 G;  3D4R A;  4PZ7 A;  4AYB E;  5C3W A;  1S5D D;  4YCU A;  3DM1 A;  1W3S A;  3ONA B;  4RCO A;  2VQF L;  1C7Y A;  2RA4 A;  3CKI B;  5GRO A;  4KN7 C;  3DWQ A;  1B9N A;  1IHZ A;  2IHF A;  5C0X G;  3FHW A;  4JI0 L;  2NVY H;  5EPJ A;  3PIP 3;  3ND9 A;  4FVM A;  2QEX A;  2JA8 B;  5EGT A;  1B2T A;  4QMG A;  4JI4 Q;  1V1Q A;  5JPM C;  1YNJ D;  4PNY A;  5M3M G;  5KIX A;  3HP3 A;  1SJH D;  1GVP A;  2K1B A;  4B3S L;  1TII D;  1Q8K A;  1HCZ A;  3T13 A;  3S17 B;  4BBR G;  2NTS A;  2H4O A;  3KF6 A;  1CKN A;  2I5L X;  3MXU A;  4ILW A;  2KED A;  3H09 A;  4JI5 L;  2WB1 B;  4EVO A;  1EFW A;  5BN4 A;  3RN5 A;  2WAQ B;  1VQC A;  1MD2 D;  3SK5 A;  5M3F H;  3S1R H;  4ZQ3 A;  4HAE A;  3CCL A;  4R4Q A;  4APV A;  5KGU A;  5IGD A;  4BBS G;  4C2M B;  1X3G A;  4QQB X;  2LXK A;  1I4G A;  3FVQ A;  4LWC A;  3GTL B;  1BR9 A;  2N49 A;  4K5W A;  3SVM A;  1K8G A;  1XYI A;  5GAG C;  3F2B A;  1PXU A;  1B70 B;  1EOT A;  1F2L A;  3TP5 A;  1FJG Q;  3HOW G;  2VL6 A;  1QOH A;  1YI2 A;  1LT3 D;  1CTM A;  3E3X A;  2EY5 A;  5DLQ E;  5ELB A;  1RIP A;  1G2S A;  4LF8 L;  3SE0 A;  3GTP H;  1K3B C;  3GTM H;  1UEB A;  4G4K A;  4OON A;  2WAC A;  2KUM A;  1Y1W G;  2VUM G;  4NPS A;  1JB3 A;  2PI2 A;  2B39 A;  1JCK B;  3T16 A;  3C1F A;  4F87 A;  3E9H A;  1F2Y A;  2B2U C;  3I70 A;  5DAU A;  3J81 i;  2PW5 A;  1FNU A;  5FJ8 G;  1EY8 A;  3IL8 A;  4UHV A;  5C44 G;  1N36 L;  3GDE A;  1BCP D;  1LT5 D;  1I50 H;  4A3I H;  4JI6 L;  1HUM A;  3VR4 A;  1EZ8 A;  2KBN A;  5C4J B;  3T53 B;  1A6X A;  1KRS A;  4G7O C;  2E75 C;  5C0X I;  2PW7 A;  1HR0 L;  3A5Z B;  3VYT A;  2EYH A;  4DV2 L;  2MHV A;  2VB3 X;  3HKS A;  4YHH L;  3M9B A;  4X3T A;  4X64 L;  2JYO A;  3BZK A;  4K6L A;  5IP9 H;  3OTO L;  1BO0 A;  5C4X H;  3BS1 A;  1MSH A;  1NNX A;  3FPU B;  1EYG A;  2UXC L;  4P2C B;  3CXC A;  4HID A;  1GJX A;  2B2V C;  3V2T A;  1B9M A;  4JI3 L;  3W2D A;  3RZD B;  1CA6 A;  4OO1 H;  4JI7 L;  3K5L A;  1DJR D;  2VXW A;  1Y8O B;  1XMO Q;  3CQZ B;  2LKV A;  3D8G A;  2ZT9 C;  1I6V C;  3CW2 C;  1EYD A;  2EYL A;  1AEX A;  1XWE A;  4R4T A;  1WTH A;  4BS9 A;  3K0X A;  1F9Q A;  1JWU D;  2QW7 A;  2XSC A;  1UE5 A;  1N33 L;  1NBW A;  2UUC L;  1WD0 A;  4BBR H;  2Z9H A;  5JJI A;  3VR2 A;  4KKT A;  4IUV A;  5ELO A;  2D9U A;  3GQB A;  1N34 Q;  3CPW A;  4A3E B;  2L9H A;  1B3A A;  5CR3 A;  3GP7 A;  3TZD A;  4IUP A;  3GTK H;  3HEJ A;  1X6O A;  3RMH A;  3LX0 A;  4CKE A;  4X62 Q;  1PZI D;  4X62 L;  2WII B;  3F1Z A;  3C3L A;  4TRD A;  1A8V A;  1LAC A;  2E2H B;  1LO5 D;  4A3G H;  1WTP A;  5IWA Q;  4A76 A;  1I3Q H;  5FLX L;  2F0P A;  1JJ2 A;  2NVT B;  2EZV A;  5KNB A;  3X3N A;  1DOL A;  2F4I A;  4DGZ A;  4KHP L;  4LMQ D;  1FYC A;  3NWT A;  3BZD B;  4DUZ L;  4LF6 Q;  2SNM A;  5DNF A;  2ZXO A;  1PRT F;  4A3D H;  1Q46 A;  4YWK A;  4KKS A;  2K03 A;  1IBM Q;  4NXN Q;  3X3M A;  5IIF A;  4V0B A;  2VQE Q;  2OF1 A;  1TS4 A;  2ENB A;  2H5X A;  2J7Z A;  3ND8 A;  1NMG A;  2K4K A;  2FMC A;  1S40 A;  2MFI A;  1R4Q B;  3HOV G;  4AH6 A;  1H9J A;  2WB1 E;  3D4W A;  2Z8L A;  2DY8 A;  2DY7 A;  5BN3 A;  3CRL C;  1KQS A;  3HOW B;  2WAQ E;  2PNR C;  2FHT A;  2NYZ D;  3S17 H;  1XPO A;  4S3S A;  3S2D B;  1Y1V H;  2Z4I A;  2FFK B;  3VA7 A;  1Q1B A;  3GV3 A;  3MFG A;  1IBL Q;  3HOY B;  4JI6 Q;  1ENF A;  2IJ0 A;  4HJ7 A;  2QDB A;  3CME A;  3HOZ B;  2KEN A;  4Q0F A;  3S1N H;  2KCC A;  1Z6H A;  4JOI A;  4MN3 A;  2KJX A;  3PCO B;  2B63 H;  4RAU C;  4XT1 B;  1KXL A;  3KJP A;  4QL5 A;  1VQ8 A;  1ZYR C;  4JK1 C;  4IUU A;  3DLL A;  4C3J G;  4A3F G;  4GKJ Q;  3HOU G;  3BG3 A;  5C3E H;  4KV6 A;  1HZC A;  1G6P A;  3OW7 A;  4KY5 A;  1ZEQ X;  2K50 A;  1ZKO A;  1WCM B;  2I46 A;  2ICI A;  3OIP A;  4HJA A;  3I4M H;  4PMB A;  3M4O B;  4L8J A;  2LS0 1;  2NUC A;  5K36 G;  4DAM A;  5I6W A;  3TP7 A;  1LM0 A;  4JI2 Q;  4DF7 A;  1WTQ A;  4DAY B;  2MPM A;  3GTL H;  1SNO A;  3S14 B;  2PZW A;  1X9N A;  1AH9 A;  1EQT A;  4OL7 A;  4C1N K;  1IKM A;  3PUY A;  4DR6 Q;  2N55 A;  1SNC A;  2BA0 A;  1PTO C;  3S1Q H;  1JOQ A;  1E1O A;  4PZ8 A;  3TDQ A;  4KD3 A;  1QVG A;  2Z0S A;  5ELD A;  3PO2 H;  4F8M A;  1I4Q A;  4JV5 Q;  4JV5 L;  4GNX A;  2EYM A;  1PYB A;  3S16 H;  1YIT A;  2HDL A;  1WD1 A;  4C3I G;  1A3T A;  2Q2H A;  3I2Z A;  4A3G G;  2PQE A;  3SR1 A;  3O13 A;  4CKC A;  2I5H A;  4H02 A;  1RD9 D;  1C9O A;  1TY2 A;  3M3Y H;  5IT9 E;  4XYQ A;  1TWH H;  4UY8 C;  1TWF H;  2J4X A;  3NEN A;  1SMY D;  2CW0 D;  4A3C H;  1KAW A;  3TME A;  3BVG A;  3EN2 A;  4DV5 Q;  1PH3 A;  2F0F A;  2QKI C;  1OTC A;  2X69 A;  1LV9 A;  2EDG A;  4ZLT F;  4HN7 A;  5M5W B;  5CMD A;  3RZD H;  1IBM L;  1XTC D;  1FNW A;  4LFA Q;  1DOM A;  1U4P A;  4NB3 A;  4YCV A;  3S15 H;  2Z6K C;  1BDO A;  4U68 A;  2RDF A;  1SFO B;  2E2D C;  4EQN A;  3R93 A;  1L0Y B;  4OWT B;  1CK1 A;  4EQ5 A;  5EKL A;  4DV1 L;  3K8A A;  3A0J A;  1P8L A;  1Z47 A;  5EAY A;  1B50 A;  1EIG A;  1K0R A;  3HOV H;  4HR7 B;  1HFG A;  4BXX G;  3LNN A;  4DKA C;  5KNC A;  1PH1 A;  3SK4 A;  5LHY 1;  1Q86 C;  2IW3 A;  4O42 A;  2R7Z H;  1Z9F A;  1JOO A;  3ULL A;  1E2Z A;  1OXX K;  5FJ8 H;  1CKM A;  3I56 A;  2NWG A;  2SOB A;  2CKZ B;  4HJ8 A;  5ELE A;  1BOS A;  3GO5 A;  4ZYS A;  2UUB L;  4QIW B;  4MIU A;  4KLK A;  4OXP A;  2RCF A;  4QGU A;  2R3Z A;  4DA2 A;  1UE1 A;  4IPH A;  1Y1V B;  3W1G A;  4U67 3;  1FNV A;  4DV4 Q;  3PV0 A;  2WKD A;  1Q81 C;  4B3T L;  1N8R C;  3U9O A;  4C56 C;  4FNF A;  1I3Q B;  2ICE C;  5JJL A;  4PMC A;  2CH4 A;  3CF5 A;  1HJP A;  1BBX C;  1TR5 A;  2XVS A;  1A2T A;  2JSO A;  2F4V Q;  3M4Y A;  1PYS B;  1XMO L;  1MJC A;  2LY7 A;  1IYV A;  2YTX A;  1ENA A;  5NUC A;  1IXR A;  3G48 A;  3E5S A;  1XMQ L;  5IP7 H;  5K36 H;  3VYS A;  1P16 A;  3FPP A;  3CU7 A;  1EEF D;  4IUQ A;  3D6W A;  5TSS A;  4DV1 Q;  4XQQ A;  5FK9 C;  5IP9 G;  3C2P A;  3J80 E;  3MAQ A;  4DNR B;  3TP6 A;  3DWP A;  2DJF C;  5E4X A;  3TSS A;  3J80 i;  4KHZ A;  1IYU A;  4ODG A;  1LLR D;  3MXG A;  1O78 A;  1O80 A;  2AHO B;  1WCM G;  4BWG B;  1CSP A;  1OXU A;  3H0G H;  2I07 B;  2ZXR A;  4K5V A;  1WTV A;  3VA5 A;  2F0N A;  4RKL A;  5C4Z A;  1SYD A;  2NB0 A;  2XGT A;  1RF2 D;  4A3J H;  1SE3 A;  1TWG B;  3A7L A;  1SNQ A;  5ELN A;  3J80 L;  5D3D A;  1HNZ L;  1V1P B;  1KRT A;  5AJ3 L;  1SJE D;  5IOC A;  2K33 A;  5KYI A;  1LYL A;  1AZP A;  1NR2 A;  4ZCK A;  2EXZ A;  4J6H A;  1WYD A;  1ASY A;  1TWH B;  3MEH A;  3CMA A;  1I6H H;  3K6O A;  4LF5 Q;  3SHL A;  2PQA A;  2IX0 A;  4ZAI A;  4R8N A;  4JBJ A;  1V43 A;  5IGF A;  2JP1 A;  2CCZ A;  2OQK A;  4IAL A;  3J81 c;  1KAB A;  1JE4 A;  4NMZ A;  1PV4 A;  2EE1 A;  4XT3 B;  2LFN A;  3H0G B;  5FOB B;  4DXF A;  1K3R A;  3H0G G;  1HZB A;  2N3S A;  1X55 A;  4JOI C;  4JBM A;  1WFQ A;  1D1I A;  1KDA A;  1RL2 A;  1QWY A;  4CGY B;  3IFT A;  3MXP A;  2F3W A;  2EYP A;  3BJU A;  4JPB W;  5FLM G;  4IPC A;  4CJ1 B;  4KI0 A;  4DV2 Q;  4TVA B;  4LUZ A;  2VNU D;  1BCP C;  2VB2 X;  2F0G A;  3I90 A;  2MJ8 A;  1Q7Y C;  4F88 A;  2B2T A;  1N36 Q;  1QNU A;  1HRJ A;  2WIN B;  4LUO A;  2E5L L;  3HKZ E;  1PZK D;  5KEE A;  5A2Q E;  1LTT D;  3KLS A;  1CQF A;  1VQ7 A;  1SYC A;  3G6E A;  4DV7 L;  3HS0 C;  1O7L A;  3KOJ A;  4LJZ C;  1B44 D;  4IFD G;  5CV4 A;  5JVG 3;  2NVY B;  1EIH A;  1HHV A;  2KQ3 A;  4R4C A;  2WP8 J;  4DR2 L;  3LGJ A;  1UNS A;  2K7V A;  4HIM A;  1I50 B;  5EQ0 A;  1GUW A;  2B2U A;  5C5L A;  3D4D A;  1NCV A;  3DXJ C;  3FEW X;  2AQ1 B;  2XN9 C;  4GNX B;  3AYH B;  2UUC Q;  4I7A A;  3K5O A;  2BOS A;  2G5D A;  4O1N A;  1EQR A;  1MKH A;  1G2T A;  1EY0 A;  2Q2T A;  1D1K A;  3J7Y W;  1STB A;  4BY1 G;  4X3K A;  2V1C C;  4QIW E;  4OIK A;  4ZK9 B;  1WVL A;  1VQJ A;  2VY3 A;  4DU9 A;  1H9S A;  3GTG B;  2R92 B;  2WAQ G;  2E2H H;  1B53 A;  4DUZ Q;  4LF6 L;  4FP5 D;  5J1Z A;  4X65 Q;  2PZU A;  4RFB A;  1N32 Q;  1PH4 A;  1VCI A;  3CCM A;  2LMC B;  3CQZ H;  1PHJ A;  1DXM A;  1F9R A;  4TQU S;  4L5R C;  1V8Q A;  4YY3 Q;  3K59 A;  3PIO 3;  2SDF A;  2RBM A;  2AQ2 B;  1YJW A;  2F0W A;  5JVH 3;  1RHP A;  3MFY A;  1EY4 A;  2RSN A;  1J5E L;  3OIQ A;  3J7A 5;  2MP1 A;  3BVM A;  1SXT A;  4DR2 Q;  5JEA J;  1UEA B;  1TWF B;  2JJQ A;  3J81 L;  1J5E Q;  3H3V C;  4XXE A;  3EJI A;  2F0V A;  4B3M Q;  1VQL A;  3U50 C;  2J0T D;  1PH6 A;  1M90 C;  1VQO A;  4GKK Q;  3BZC A;  3G71 A;  4DV0 L;  1XNQ Q;  1I4X A;  3KBX A;  3CCJ A;  1K9M C;  2NN6 I;  4R4I A;  4X6A H;  1PFM A;  5KYL A;  1UAP A;  2AWN A;  1HTL D;  2QEJ C;  1N32 L;  4P74 A;  1KAA A;  4P71 A;  3BDO A;  5FLM H;  3J81 E;  2CWP A;  2N78 A;  3ER0 A;  3H91 A;  1GHJ A;  2N88 A;  3JC6 6;  3J80 c;  2KCT A;  3CC7 A;  3TP8 A;  3JAM E;  2CVR A;  3HOZ H;  4GOP A;  3GTQ H;  2R93 H;  1X65 A;  3DEP A;  3FDT A;  4GS3 A;  3V05 A;  2QCP X;  3HOX G;  2EJG C;  3T4A C;  2Y0S G;  3HOX B;  4RH6 A;  2JK8 A;  1XNR L;  2GN5 A;  3T1Y Q;  2D0O A;  1CT1 D;  1HQR D;  1D5M C;  1HQM C;  5M3F G;  2K04 A;  1MHW C;  2X6G A;  4B3T Q;  4A3K H;  2HUG A;  1X3Q A;  2A6H D;  5KND A;  2OEO A;  1A2U A;  1PH7 A;  1ROD A;  3NQI A;  3J7A V;  1QE6 A;  1PH2 A;  4C3J H;  1TXY A;  4ULL A;  3I8Z A;  1EOV A;  1Y69 U;  1NUC A;  2ES2 A;  4AYB G;  2OTJ A;  3K0Y A;  1RDP D;  1CFM A;  4QF4 A;  2IY5 B;  1X32 A;  4DR5 L;  1B4O A;  1QUQ A;  1HNW Q;  2XRS D;  2RF4 A;  2B2W A;  4GZY C;  1UUP A;  4V19 0;  1EYC A;  3MHB A;  1MGS A;  2K5H A;  2XWB B;  4LNQ A;  4A3D G;  1QIL A;  1GUO A;  4JBW A;  4JI2 L;  3KUP A;  5J22 A;  4FF3 A;  4N8F A;  4XIG S;  3CCV A;  3K7A B;  4PQX A;  1OXV A;  3TRE A;  5BR8 Q;  3S24 A;  5GAH C;  2K05 A;  1X3P A;  2IX3 A;  3K57 A;  4IUT A;  1KDC A;  2M00 A;  3I3C A;  2HD3 A;  1HNX Q;  3AEV A;  3DWA A;  2K5Q A;  4LFB L;  3CCQ A;  1HR0 W;  2ZJQ A;  2YYZ A;  2HQE A;  5ELC A;  2EY1 A;  2E8G A;  1XJV A;  3ZJY C;  1CSQ A;  1GOZ A;  4UPA A;  2UXB L;  2FXQ A;  5DM7 3;  1K73 C;  4M1U B;  1II3 A;  4ZRZ A;  1BNZ A;  1Y14 B;  3OWF A;  2R7F A;  3EFX D;  1G51 A;  1BBW A;  1G29 1;  3URY A;  5A35 A;  5IGC A;  1EL0 A;  1LTG D;  1JQY D;  3N6R A;  1J8I A;  4IO9 A;  3RNU A;  5C3E B;  4DK0 A;  2RDH A;  1TT2 A;  4B3S Q;  1MI2 A;  3IFD A;  3MA2 B;  1WTW A;  5M5X H;  3GTO B;  4CJ2 C;  4FDB A;  3AFQ A;  4BBS B;  1WI5 A;  5IGG A;  1H9R A;  4NXM L;  3RN2 A;  1NTG A;  2QA4 A;  3PGZ A;  2Q8R E;  2IHE A;  4Q5V A;  4HTH A;  1YNN D;  1B8A A;  4OO1 G;  1KNA A;  3E0E A;  1JC7 A;  2BDO A;  1R4P B;  1LT6 D;  1W6K A;  2K28 A;  1SEB D;  1E2W A;  2AQ3 B;  1SMY C;  3MC0 B;  2VW9 A;  3T51 B;  2UUA Q;  4DR7 L;  5JJK A;  2L55 A;  3NQT A;  3U4Z A;  3CCR A;  4LF7 L;  3HOW H;  1H9M A;  2BE5 C;  2XTI A;  3NUC A;  1GO3 E;  3OMC A;  3F8T A;  1SE4 A;  5IWA L;  1HA6 A;  4N8X 1;  4A3K G;  2F0M A;  4GOP C;  3S2D H;  4G57 A;  4DV6 Q;  2NBF A;  1BVS A;  2OT2 A;  4ABN A;  1GD7 A;  2EIF A;  2EPB A;  2PZT A;  3NSW A;  1STH A;  3HOU B;  1IYJ B;  1LAB A;  4JBK A;  2R93 G;  1JT8 A;  1R9T H;  2K6A A;  2K01 A;  2EJF C;  3W3A A;  4UP7 A;  1HFN A;  5I9O A;  4ME5 A;  1GM5 A;  2F0E A;  1SN8 A;  3I73 A;  5M3F B;  1BXT A;  1PZJ D;  1UE7 A;  5EPL A;  1STE A;  3SK6 A;  4O2D A;  3J81 j;  3A8J E;  3M3Y B;  1ENC A;  4LF4 L;  1VQP A;  1GKH A;  3GTQ B;  4K8J A;  4OGQ C;  4LK1 C;  1S4Z A;  1ICF B;  5C0X J;  3KF6 B;  3STB C;  5JEA G;  5ISR A;  3I7F A;  4JVZ A;  1Q12 A;  4JW0 A;  1XNR Q;  4XTC S;  5D14 A;  3FRP B;  1SYB A;  2G9D A;  4LFC L;  1HXY D; 
#chains in the Genus database with same CATH homology
 2F3V A;  4QB4 A;  4RGN A;  1Q3L A;  4RKB A;  3J7A F;  4BA2 I;  1EU3 A;  4A3G B;  2NVX B;  3GV6 A;  1FR3 A;  5EBD A;  5F2D A;  4EQO A;  2F0T A;  1OXS C;  1V1O A;  1TS3 A;  4J1M A;  2D5D A;  2L12 A;  3RD4 A;  3MWY W;  4KMU C;  3M7G A;  2H1E A;  3CRK C;  4OO1 I;  1SYE A;  4RCN A;  3Q22 A;  1V1P A;  3RUZ A;  1JWM D;  5COY A;  3WDN A;  5M3M B;  5C4X B;  3L9A X;  1Q90 A;  4H0L C;  4WOR A;  2SNS A;  3KLS X;  1TWA B;  4NW2 A;  1RJT A;  1TU2 B;  4RHS A;  5LL6 X;  1QB5 D;  1ESR A;  2TSS A;  2O5J C;  1QG7 A;  2TMP A;  4C3H G;  1QCB D;  3T56 B;  2A5H A;  5LL6 S;  3VYU A;  5IOD A;  1SND A;  3KLR A;  4TKO B;  1EY9 A;  3NTK A;  1DOK A;  1EY7 A;  2F0J A;  5DEH A;  1STA A;  2AWO A;  2C9O A;  1TWC B;  2F03 A;  2GA4 B;  1PRT D;  3G6J B;  4ZKB B;  1ET6 A;  3VR3 A;  2KCN A;  4RGM A;  1W6J A;  5CV9 A;  5EKK A;  4A3B B;  1T5X D;  4IN3 A;  2DN8 A;  2KA7 A;  5FKA C;  2A68 D;  1PRT B;  1U4M A;  3VYR A;  4ZUI A;  4RGO S;  1DCZ A;  5EPK A;  3BDL A;  1AN8 A;  4KJN A;  1PFB A;  5D3I B;  4QCL A;  2RVL A;  3OSO A;  1K8M A;  1LTA D;  4Y7N B;  4H7B A;  5DM6 3;  1SYG A;  1M4V A;  2R6G A;  4DK1 A;  5FO9 B;  3Q0A A;  2CHB D;  3TBI B;  2Y0S B;  1O7Y A;  3NPP A;  3C46 A;  3S2H B;  4EGV A;  1QJO A;  4XQJ A;  4CBV A;  3C1E A;  3LWU A;  4DFA A;  5EJW A;  4I65 A;  1A3V A;  3QIA A;  3S1N B;  1ZXT A;  1EZ6 A;  3MVV A;  3ITP A;  2Z4H A;  1STG A;  3IKJ A;  1JR0 D;  4I7Z C;  4L6T B;  2NZ1 D;  1PRT C;  4C3I B;  4E6I A;  5I6Y A;  1KDB A;  2B2T C;  1ESF A;  2B8F A;  3NBI A;  1ICW A;  2V4D A;  4IZ8 A;  1TY0 A;  2BCO A;  2RSO A;  3GD7 A;  2B2W C;  2NN6 H;  2NVQ B;  1TKW B;  1OO9 B;  2KOL A;  1BCP F;  2NTT A;  4M8A A;  2BA1 A;  4DAY A;  1SNP A;  1PMR A;  5A2Q L;  5IGE A;  1E2V A;  4KY6 A;  3A7A B;  2JE6 I;  5M9O A;  1WTX A;  2X6L A;  1MBY A;  5T1G A;  5I4D A;  4RHR A;  1AW7 A;  2YU9 B;  4FF2 A;  3NWS A;  1EWC A;  4K14 A;  1DYQ A;  2F0K A;  4IFD H;  3PUX A;  2FJ2 A;  1RTN A;  1AP0 A;  2ZXP A;  2AUK A;  1LT4 D;  1EYA A;  4CKB A;  1SE2 A;  2M2L A;  2R61 A;  5CGK A;  1JOK A;  2F0D A;  4ZUJ A;  1STY A;  5EKI A;  1NR4 A;  1FGB D;  1SNM A;  2BDN A;  4LAA A;  1IKL A;  3R8B A;  5CV8 A;  5D65 A;  4A93 B;  1GUS A;  2VUM B;  1KLG D;  4BA1 I;  3DUZ A;  3I91 A;  2Z1C A;  2F0H A;  3R3O A;  1F9S A;  1QNK A;  1D2B A;  2MGS A;  1AZQ A;  3QJY A;  1O7Z A;  4A3K B;  1GHK A;  5KRU A;  3F2U A;  3BVZ A;  1NSN S;  1Y8P B;  5E1F A;  2R93 B;  2CW0 C;  4L63 B;  2WKC A;  3H94 A;  3Q23 A;  4H13 C;  4FO2 A;  3SK8 A;  2A6E C;  1H9S B;  3D3R A;  4K8I A;  4XQN A;  3Q6S A;  1C4Q A;  1A3U A;  4KD4 A;  3NTI A;  4IFD I;  1TS2 A;  3S1M B;  2B63 B;  1H9K A;  3MTS A;  3ERO A;  2EY6 A;  1ILQ A;  5JAV A;  1YNN C;  2KEC A;  1SAP A;  4A3M B;  2IL8 A;  3R2T A;  1VDZ A;  3FMC A;  1KNE A;  3LWE A;  3VR5 A;  1BCP B;  4A3D B;  4XDX A;  1PTO B;  3OPO A;  1ET9 A;  4KK7 A;  2L11 A;  4A3I B;  1FD7 D;  3JAM L;  3NP8 A;  3IAY A;  4WRD A;  2M9V A;  2IX1 A;  5I2X A;  4IQZ A;  1ZYR D;  4PMW A;  1JOR A;  2F0O A;  1I4R A;  4KY7 A;  4DAV A;  5COR A;  1RTO A;  1VMC A;  2HDM A;  3QO2 A;  1SBB B;  2JA5 B;  1F77 A;  2L0C A;  1S5F D;  4B08 A;  3E0J A;  1SDF A;  4HED A;  4UDU C;  5CV7 A;  4BBR B;  5G3L F;  1S5E D;  2IPK D;  4K5X A;  4HMI A;  1IW7 C;  5HUR A;  2F1M A;  4F7X A;  4HCE A;  4R9W A;  3EVQ A;  1E0B A;  2O5I C;  2KVM A;  5E4W C;  3K5M A;  5C4H A;  4BY1 B;  1U9R A;  1CM9 A;  5FO7 B;  3PO3 B;  4K6D A;  4NKL A;  3OOC A;  4NP5 A;  2SEB D;  2EY2 A;  4IUN A;  4XYO A;  1KLU D;  1PTO D;  5I9P A;  1OXT A;  4CJ0 B;  2A6H C;  2PCF B;  4UAI A;  3QOL A;  3GTK B;  2A6E D;  5C44 B;  4C3J B;  1XXG A;  5J39 A;  5I2Y A;  1G8Z D;  2EYF A;  1CA5 A;  5HGT A;  3S15 B;  1PDQ A;  1DD2 A;  4KN4 C;  3K5N A;  1KTK A;  1Y1W B;  5EBC A;  4G7Z C;  3SXH A;  1VMP A;  1EWH A;  1GXD C;  1Q1E A;  3RLF A;  2XRQ D;  1AFP A;  3GTJ B;  3AMU A;  1F9P A;  4K2K A;  3V96 A;  1EY5 A;  5ELF A;  4FF1 A;  3U9S A;  2RQX A;  3A56 A;  2FMM A;  2WV6 D;  1C48 A;  2L5T A;  4MHE A;  1RCV D;  4OHJ A;  1XX8 A;  1L0X B;  3KK7 A;  3L3O C;  3N52 A;  4ZKC B;  3EQL C;  2R7Z B;  1Y8N B;  2QIL A;  2B2Y C;  5CYU A;  3MXN A;  2D2C C;  4N9P A;  1U4L A;  3DMU A;  4A3J B;  3G7L A;  5FLX E;  2Q8T A;  5C3X A;  1EFI D;  2FIN B;  1M8A A;  1EY6 A;  1G6Z A;  4HMJ A;  3AU7 A;  2O4X A;  4QUC A;  3S1Q B;  1LTS D;  3A54 A;  4X3S A;  3OMG A;  1CZW A;  3H6M A;  4OIJ A;  2PMZ B;  1I6H B;  1CZG A;  3A55 A;  2JA6 B;  3BYT B;  3S1R B;  1CI3 M;  3GTM B;  2JA7 B;  4CHT B;  5AFW A;  3OWE B;  2A74 C;  1DZ1 A;  3TZU A;  4KKU A;  2EVB A;  3S16 B;  4C3H B;  1D6E C;  2KEE A;  3MZ5 A;  2G9H D;  5M5Y B;  2E2I B;  2K32 A;  1ILP A;  2K5D A;  1DON A;  4TSS A;  3RZO B;  1VF7 A;  4HSP A;  1CHQ D;  4HCS A;  3NHH A;  4FYD A;  5CV5 A;  3WOE A;  5JPN C;  5CBE E;  2E76 C;  3L7Z C;  1JIC A;  2PPB C;  1BQQ T;  3HKZ B;  2RDG A;  2HCC A;  2KHS A;  1HUN A;  2HCI A;  3QG1 A;  3PMF A;  3I72 A;  3HOV B;  1YNJ C;  4C1N I;  4PV1 C;  3D6C A;  4IUR A;  1R9T B;  3NXW A;  3QB3 A;  1ONL A;  3KBG A;  2K5W A;  3DHQ A;  4A3F B;  3AB9 A;  2B2V A;  1WTO A;  1S5B D;  1CQV A;  4HSV A;  3BYY B;  2AUJ D;  3NK9 A;  1WTR A;  2EOT A;  3DEO A;  1F2Z A;  4B9X A;  3A8I E;  4WFN 3;  2IT1 A;  1D5X C;  1PFN A;  1HTP A;  1S5C D;  2A68 C;  1SYF A;  4IFD J;  1F2M A;  4DN4 M;  1PTO F;  4EQP A;  3OHX C;  4X3U A;  2XIW A;  2PYK A;  1LTB D;  1I4H A;  3I4L A;  5IGB A;  1SSO A;  2Q8I B;  3ERQ A;  3D31 A;  3R2I A;  2NN6 G;  5M5X B;  3FKI B;  3PUZ A;  1I4P A;  1TVX A;  3GTP B;  5IT9 L;  4ID6 A;  1IL8 A;  1CHP D;  3QOJ A;  1BUV T;  1GUG A;  3PO2 B;  1LTI D;  4RWS C;  2DNE A;  2O2L D;  3SEB A;  4G7H C;  2B2Y A;  2EYO A;  2MUY A;  5G3L D;  5BN5 A;  4RGT A;  1G91 A;  4Z9C B;  3HRZ C;  3P20 A;  2L4N A;  5CC4 A;  1PLF A;  1PTO H;  3A8K E;  4YIJ A;  1B1Z A;  3CHB D;  1RKN A;  3P75 A;  1A15 A;  2E2J B;  4WJW A;  1IW7 D;  3M85 A;  3Q24 A;  3VR6 A;  2F0L A;  2JXM B;  4DXG A;  3NBH A;  1DM0 B;  3BDC A;  3UI2 A;  1GUT A;  3E6Z X;  1Q8I A;  4KTA A;  2A69 C;  1EQV A;  3NE5 B;  5T1I A;  2L1B A;  1EEI D;  3PUV A;  5K5P A;  5C0X H;  4DNT B;  2B8G A;  5JEA H;  4KJO A;  3HGB A;  4H44 C;  3ZYY X;  2A69 D;  4B9W A;  4N9T A;  2EYJ A;  2D62 A;  3TN2 A;  4FXD A;  1GUN A;  5JOB A;  2XWJ B;  5E3F A;  5JJZ A;  1MSG A;  1HPC A;  4FF4 A;  1STN A;  2JEB I;  3I4M B;  2DNC A;  1NAP A;  3QWN A;  4FXG C;  1TS5 A;  4KHV A;  4J8Q A;  4FXK C;  4K2L A;  4NDX A;  1K83 B;  1BF4 A;  4RA8 A;  1C8C A;  5CBA E;  2OXP A;  2BE5 D;  4QUF A;  1LTR D;  1D5Z C;  3SDZ A;  1EU4 A;  3K58 A;  1HA5 A;  1TQO A;  1ML0 D;  4R8I A;  2E74 C;  2A73 B;  3I4N B;  3HZX A;  3NTH A;  3HG9 A;  2XNA C;  2ID0 A;  1U4R A;  1T5E A;  3P1H A;  2RKS A;  2CQA A;  2IWH A;  3EA6 A;  2C5C A;  1VF5 C;  1J9O A;  3S9W A;  1K8O A;  5C5M A;  5FO8 B;  1PYW D;  2F0Q A;  3M7N A;  4AYB B;  3PUW A;  5C6A A;  2F0U A;  2PO4 A;  3KF8 A;  4DAP A;  2F0S A;  5CV6 A;  3WOF A;  2QF7 A;  2F0I A;  1JWS D;  2EJM A;  3P7J A;  1Z7T A;  2JEA I;  4BY7 B;  3D4R A;  5C3W A;  1S5D D;  3DM1 A;  3ONA B;  4RCO A;  2RA4 A;  3CKI B;  4KN7 C;  3DWQ A;  1B9N A;  1IHZ A;  5C0X G;  5EPJ A;  3PIP 3;  3ND9 A;  4FVM A;  2JA8 B;  5EGT A;  1B2T A;  4QMG A;  5JPM C;  1YNJ D;  4PNY A;  5KIX A;  3HP3 A;  1SJH D;  2K1B A;  1TII D;  1HCZ A;  3T13 A;  3S17 B;  2NTS A;  2H4O A;  4ILW A;  3MXU A;  2KED A;  3H09 A;  2WB1 B;  4EVO A;  5BN4 A;  2WAQ B;  1MD2 D;  3SK5 A;  4ZQ3 A;  4HAE A;  5KGU A;  5IGD A;  4C2M B;  1I4G A;  3FVQ A;  3GTL B;  1BR9 A;  4K5W A;  3SVM A;  1XYI A;  1PXU A;  1EOT A;  1F2L A;  3TP5 A;  1QOH A;  1LT3 D;  1CTM A;  2EY5 A;  5ELB A;  1G2S A;  3SE0 A;  4G4K A;  2WAC A;  2KUM A;  1JB3 A;  2B39 A;  1JCK B;  3T16 A;  3C1F A;  4F87 A;  1F2Y A;  2B2U C;  3I70 A;  5DAU A;  2PW5 A;  1FNU A;  1EY8 A;  3IL8 A;  1BCP D;  1LT5 D;  1HUM A;  3VR4 A;  1EZ8 A;  5C4J B;  3T53 B;  1A6X A;  4G7O C;  2E75 C;  5C0X I;  2PW7 A;  3VYT A;  2EYH A;  2MHV A;  2VB3 X;  4X3T A;  2JYO A;  4K6L A;  1BO0 A;  3BS1 A;  1MSH A;  3FPU B;  4P2C B;  1GJX A;  2B2V C;  3V2T A;  1B9M A;  3W2D A;  3RZD B;  1CA6 A;  4OO1 H;  3K5L A;  1DJR D;  2VXW A;  1Y8O B;  3CQZ B;  2LKV A;  3D8G A;  2ZT9 C;  1I6V C;  1EYD A;  2EYL A;  1AEX A;  1XWE A;  4BS9 A;  1F9Q A;  1JWU D;  2XSC A;  1WD0 A;  3VR2 A;  4KKT A;  4IUV A;  2D9U A;  3GQB A;  4A3E B;  2L9H A;  1B3A A;  5CR3 A;  3GP7 A;  3TZD A;  4IUP A;  3HEJ A;  3RMH A;  3LX0 A;  4CKE A;  1PZI D;  2WII B;  3C3L A;  4TRD A;  1LAC A;  2E2H B;  1LO5 D;  1WTP A;  5FLX L;  2F0P A;  2NVT B;  2EZV A;  5KNB A;  3X3N A;  1DOL A;  2F4I A;  4DGZ A;  4LMQ D;  1FYC A;  3NWT A;  3BZD B;  2SNM A;  5DNF A;  2ZXO A;  1PRT F;  4KKS A;  2K03 A;  3X3M A;  5IIF A;  4V0B A;  2OF1 A;  1TS4 A;  2ENB A;  2J7Z A;  3ND8 A;  2FMC A;  1R4Q B;  1H9J A;  3D4W A;  2Z8L A;  2DY8 A;  2DY7 A;  5BN3 A;  3HOW B;  3CRL C;  2PNR C;  2FHT A;  2NYZ D;  4S3S A;  3S2D B;  2Z4I A;  2FFK B;  3VA7 A;  1Q1B A;  3GV3 A;  3MFG A;  3HOY B;  1ENF A;  2IJ0 A;  2QDB A;  3HOZ B;  4Q0F A;  2KCC A;  1Z6H A;  4MN3 A;  2KJX A;  4RAU C;  4XT1 B;  1ZYR C;  4JK1 C;  4IUU A;  4C3J G;  3BG3 A;  4KV6 A;  3OW7 A;  4KY5 A;  1ZEQ X;  1ZKO A;  1WCM B;  2I46 A;  2ICI A;  3OIP A;  4PMB A;  3M4O B;  4L8J A;  2LS0 1;  2NUC A;  5K36 G;  5I6W A;  3TP7 A;  4DF7 A;  1WTQ A;  2MPM A;  1SNO A;  3S14 B;  2PZW A;  1EQT A;  4OL7 A;  4C1N K;  1IKM A;  3PUY A;  2N55 A;  1SNC A;  2BA0 A;  1PTO C;  1JOQ A;  3TDQ A;  4KD3 A;  5ELD A;  4F8M A;  1I4Q A;  2EYM A;  2HDL A;  1WD1 A;  4C3I G;  1A3T A;  2PQE A;  3SR1 A;  3O13 A;  4CKC A;  1RD9 D;  1TY2 A;  5IT9 E;  4XYQ A;  2J4X A;  1SMY D;  2CW0 D;  3TME A;  3BVG A;  2F0F A;  2QKI C;  2X69 A;  1LV9 A;  2EDG A;  4ZLT F;  4HN7 A;  5M5W B;  5CMD A;  1XTC D;  1FNW A;  1DOM A;  1U4P A;  1BDO A;  4U68 A;  2RDF A;  1SFO B;  2E2D C;  4EQN A;  3R93 A;  1L0Y B;  1CK1 A;  5EKL A;  1Z47 A;  1B50 A;  1EIG A;  4HR7 B;  1HFG A;  3LNN A;  5KNC A;  3SK4 A;  5LHY 1;  2IW3 A;  4O42 A;  1JOO A;  1E2Z A;  1OXX K;  2NWG A;  2SOB A;  5ELE A;  1BOS A;  3GO5 A;  4ZYS A;  4QIW B;  4MIU A;  2R3Z A;  4DA2 A;  1Y1V B;  4U67 3;  1FNV A;  3PV0 A;  2WKD A;  3U9O A;  4C56 C;  4FNF A;  1I3Q B;  2ICE C;  4PMC A;  1BBX C;  1TR5 A;  2XVS A;  1A2T A;  2JSO A;  3M4Y A;  2LY7 A;  1IYV A;  1ENA A;  5NUC A;  3E5S A;  5K36 H;  3VYS A;  3FPP A;  3CU7 A;  1EEF D;  4IUQ A;  3D6W A;  5TSS A;  4XQQ A;  5FK9 C;  3C2P A;  3J80 E;  3MAQ A;  4DNR B;  3TP6 A;  3DWP A;  5E4X A;  3TSS A;  4KHZ A;  1IYU A;  4ODG A;  1LLR D;  3MXG A;  1O78 A;  1O80 A;  4BWG B;  1OXU A;  2I07 B;  2ZXR A;  4K5V A;  1WTV A;  3VA5 A;  2F0N A;  4RKL A;  5C4Z A;  1SYD A;  2NB0 A;  1RF2 D;  1SE3 A;  1TWG B;  3A7L A;  1SNQ A;  3J80 L;  5D3D A;  1V1P B;  1SJE D;  5IOC A;  2K33 A;  5KYI A;  1AZP A;  1NR2 A;  2EXZ A;  4J6H A;  1TWH B;  3MEH A;  3K6O A;  3SHL A;  2IX0 A;  4ZAI A;  4R8N A;  1V43 A;  5IGF A;  2JP1 A;  4IAL A;  1KAB A;  1JE4 A;  4NMZ A;  2EE1 A;  4XT3 B;  2LFN A;  3H0G B;  5FOB B;  4DXF A;  1D1I A;  1KDA A;  1QWY A;  4CGY B;  3IFT A;  3MXP A;  2F3W A;  2EYP A;  4CJ1 B;  4KI0 A;  2VNU D;  1BCP C;  2VB2 X;  2F0G A;  3I90 A;  2MJ8 A;  4F88 A;  2B2T A;  1QNU A;  1HRJ A;  2WIN B;  1PZK D;  5KEE A;  5A2Q E;  1LTT D;  3KLS A;  1CQF A;  1SYC A;  3HS0 C;  1O7L A;  4LJZ C;  1B44 D;  4IFD G;  5CV4 A;  5JVG 3;  2NVY B;  1EIH A;  1HHV A;  2KQ3 A;  2WP8 J;  1UNS A;  2K7V A;  1I50 B;  5EQ0 A;  1GUW A;  2B2U A;  5C5L A;  3D4D A;  1NCV A;  3DXJ C;  3FEW X;  2AQ1 B;  2XN9 C;  3K5O A;  2BOS A;  4O1N A;  1G2T A;  1EY0 A;  1D1K A;  3J7Y W;  1STB A;  4X3K A;  4OIK A;  4ZK9 B;  1WVL A;  4DU9 A;  1H9S A;  3GTG B;  2R92 B;  1B53 A;  4FP5 D;  5J1Z A;  2PZU A;  4RFB A;  1VCI A;  2LMC B;  1DXM A;  1F9R A;  4TQU S;  1V8Q A;  3K59 A;  3PIO 3;  2SDF A;  2RBM A;  2AQ2 B;  2F0W A;  5JVH 3;  1RHP A;  3MFY A;  1EY4 A;  2RSN A;  3OIQ A;  2MP1 A;  3BVM A;  1SXT A;  5JEA J;  1UEA B;  1TWF B;  3J81 L;  3H3V C;  4XXE A;  3EJI A;  2F0V A;  2J0T D;  1I4X A;  3KBX A;  2NN6 I;  1PFM A;  5KYL A;  1UAP A;  2AWN A;  1HTL D;  2QEJ C;  1KAA A;  3BDO A;  3J81 E;  3H91 A;  1GHJ A;  2N88 A;  3TP8 A;  3JAM E;  2CVR A;  3V05 A;  3DEP A;  3FDT A;  2QCP X;  2EJG C;  3T4A C;  3HOX B;  4RH6 A;  1CT1 D;  1HQR D;  1D5M C;  1HQM C;  2K04 A;  2X6G A;  2HUG A;  1X3Q A;  2A6H D;  5KND A;  2OEO A;  1A2U A;  1ROD A;  3NQI A;  3J7A V;  1QE6 A;  4ULL A;  3I8Z A;  1Y69 U;  1NUC A;  3K0Y A;  1RDP D;  1CFM A;  4QF4 A;  1X32 A;  1B4O A;  2XRS D;  2B2W A;  4GZY C;  1UUP A;  4V19 0;  1EYC A;  3MHB A;  1MGS A;  2XWB B;  1QIL A;  1GUO A;  4JBW A;  3KUP A;  5J22 A;  4FF3 A;  4XIG S;  3K7A B;  4PQX A;  1OXV A;  2K05 A;  1X3P A;  2IX3 A;  3K57 A;  4IUT A;  1KDC A;  2M00 A;  3I3C A;  3DWA A;  2K5Q A;  2YYZ A;  2HQE A;  5ELC A;  2EY1 A;  1GOZ A;  5DM7 3;  4M1U B;  1II3 A;  4ZRZ A;  1BNZ A;  3OWF A;  3EFX D;  1G29 1;  3URY A;  5A35 A;  5IGC A;  1EL0 A;  1LTG D;  1JQY D;  3N6R A;  1J8I A;  5C3E B;  4DK0 A;  2RDH A;  1TT2 A;  1MI2 A;  3IFD A;  3MA2 B;  1WTW A;  3GTO B;  4CJ2 C;  4BBS B;  5IGG A;  1H9R A;  2Q8R E;  4Q5V A;  4HTH A;  1YNN D;  4OO1 G;  1KNA A;  1JC7 A;  2BDO A;  1R4P B;  1LT6 D;  1W6K A;  2K28 A;  1SEB D;  1E2W A;  2AQ3 B;  1SMY C;  3MC0 B;  3T51 B;  2L55 A;  3NQT A;  1H9M A;  2BE5 C;  3NUC A;  3OMC A;  1SE4 A;  1HA6 A;  2F0M A;  4G57 A;  2NBF A;  2OT2 A;  4ABN A;  2EPB A;  2PZT A;  3NSW A;  1STH A;  3HOU B;  1LAB A;  2K6A A;  2K01 A;  2EJF C;  3W3A A;  1HFN A;  5I9O A;  4ME5 A;  2F0E A;  3I73 A;  5M3F B;  1BXT A;  1PZJ D;  5EPL A;  1STE A;  3SK6 A;  3M3Y B;  3A8J E;  1ENC A;  3GTQ B;  4K8J A;  4OGQ C;  4LK1 C;  1S4Z A;  5C0X J;  5JEA G;  5ISR A;  1Q12 A;  4XTC S;  5D14 A;  3FRP B;  1SYB A;  2G9D A;  1HXY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...