1ILQA

Cxcr-1 n-terminal peptide bound to interleukin-8 (minimized mean)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-8 PRECURSOR
publication title Structure of a CXC chemokine-receptor fragment in complex with interleukin-8.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 12
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ilqA00
1F9QA 1DOLA 1EQTA 2K05A 2L1BA 2KEEA 1A15A 1MSGA 2K04A 2B2YC 2RVLA 2XIWA 5CBEE 4ZLTF 2EPBA 5CMDA 1O7YA 3GV3A 1RODA 1WTQA 4ZKCB 1KNAA 2FINB 2FHTA 2MJ8A 1WTXA 3R93A 1VMCA 1C8CA 2B2WC 2EOTA 3F2UA 1J9OA 2SDFA 3KUPA 1B2TA 2X6LA 1DOMA 2VXWA 3DM1A 3HP3A 4DN4M 2RSNA 4RWSC 2R3ZA 5EJWA 1B50A 2EE1A 5EPJA 2K28A 3ONAB 1BO0A 5AFWA 2B2VA 4OIKA 1PFBA 1X32A 3DEOA 1IL8A 4LMQD 1GUWA 1F9SA 5EPLA 1RHPA 1U4MA 2CVRA 3P7JA 5T1GA 2N88A 1J8IA 4X3SA 1G6ZA 4XDXA 2KOLA 1ZXTA 2N55A 4IUUA 4ZKBB 2KEDA 3I8ZA 1WTWA 1HFNA 4RA8A 5EQ0A 1MSHA 5D65A 2MPMA 3I90A 5CBAE 4IURA 1WD0A 4NW2A 1AZQA 1IKMA 2L9HA 1B3AA 3IL8A 4IUTA 4HAEA 1G2TA 1EL0A 1ML0D 1QG7A 1RJTA 1X3QA 2L4NA 4XT1B 1PFMA 1F9PA 3DEPA 1XYIA 1ILPA 1SAPA 1AZPA 1O7ZA 3N52A 1F2LA 2K01A 2RA4A 2NZ1D 1NR4A 4X3KA 2X69A 2DY8A 5COYA 2HCIA 1B53A 5DNFA 4R8IA 1U4PA 1WVLA 1MI2A 1WTVA 3I91A 1M8AA 2FMMA 1S4ZA 1NCVA 2B2TA 3UI2A 1BBXC 1JE4A 4XT3B 5D14A 3IFDA 4OIJA 3G7LA 3FDTA 3MTSA 1DONA 4IUPA 3TZDA 4HCSA 1EIGA 2IL8A 5T1IA 1RTOA 1CA5A 1Q3LA 2B2YA 1B4OA 1CM9A 3QO2A 1X3PA 5E4XA 5E4WC 4QUFA 4HSVA 4RAUC 1PLFA 2KUMA 4UAIA 1WTRA 1WD1A 1G91A 1E0BA 3D6WA 3H91A 4O42A 1EIHA 5CORA 1U4LA 1PDQA 1HUNA 2Q8TA 1HUMA 2FFKB 2NWGA 4X3UA 2NYZD 2MGSA 2B2WA 4HEDA 1ESRA 1ICWA 1HHVA 2B2UC 2M2LA 1SSOA 1XX8A 4MHEA 2RSOA 1VMPA 2B2VC 3SVMA 4CJ2C 2FJ2A 1QNKA 1NAPA 2H1EA 1KNEA 2X6GA 3LWEA 4X3TA 4CJ1B 2KVMA 4ZAIA 1EOTA 1DZ1A 1AP0A 1RTNA 3GV6A 2L12A 3I3CA 4QUCA 2K1BA 2HDMA 4IUVA 3TN2A 1G2SA 1HFGA 4ZK9B 1WTPA 1O80A 2Q8RE 1DOKA 1WTOA 2MP1A 3MWYW 1CA6A 1BF4A 1LV9A 2HUGA 2KECA 1ILQA 5JJZA 1SDFA 3KBXA 1HA6A 1JICA 2L11A 2B2UA 2DY7A 2JP1A 3FPUB 1F9RA 4U68A 5EKIA 1HRJA 4IUQA 1QE6A 1U4RA 2B2TC 1NR2A 1PFNA 1BNZA 1TVXA 2BDNA 5EPKA 1MGSA 2J7ZA 2JYOA 2K03A 4MN3A 4CJ0B 1IKLA 2HDLA 3Q6SA 2D9UA 4R9WA 2HCCA
chains in the Genus database with same CATH superfamily
1A15A 3VR5A 4B3SQ 2KA7A 4DK3C 1G51A 2H4OA 2WV6D 2CH4A 3AMUA 1QVCA 2FHTA 1PH6A 4LF4L 4ZYSA 4E6IA 3J81c 4FF1A 2QEJC 1I3QH 4A3JG 3S14H 3DWAA 3KLRA 5C44G 5EJWA 3MXGA 2EYHA 3T16A 2K5DA 2D0OA 2F0OA 3ERQA 2VNUD 1YBYA 4BS9A 2JA7H 1PRTB 1D1KA 1S5ED 2N88A 4BBSB 4XDXA 3S2HB 1G6ZA 1VQNA 1S5BD 4X64L 4RA8A 1SRUA 1Z7TA 5IYCG 4IURA 2HQLA 2JEAI 3IL8A 3CAMA 4KHZA 1NY4A 1IYVA 4A3MB 4A76A 2L15A 4HCEA 1ILPA 2QKIC 4X66Q 1GD7A 1EY7A 1WTHA 1FL0A 2K01A 1TIID 1EY4A 3QIAA 1W6JA 1Q1EA 4DV4Q 1CSPA 4LAAA 3K0XA 5CV6A 4C3JG 3E0EA 1VQCA 3SHLA 2N78A 1X3PA 3WDNA 4HSVA 2G9HD 4PNYA 2ENBA 3CQZB 2AWOA 3S24A 4RHSA 1F77A 3RD4A 3MXNB 2P5ZX 4BBSH 3S2HH 3J7ZC 3VYRA 2EYMA 2F0FA 3RNUA 1YHQA 5I9PA 2KENA 3GQBA 4JBJA 4QB4A 2PW7A 1EEFD 2BH8A 2F0TA 2L0CA 4A3MH 3K5OA 1WTPA 1O7LA 3OHXC 1N34L 3MWYW 2Z6KA 2ICEC 3R2TA 4IQZA 1ASZA 3TZUA 2CWAA 2UU9Q 4GOPB 2L11A 3MXUA 2F0KA 1S5CD 1XNRL 2VZAA 3UDIA 2R92G 3CQZH 1W2BA 5G3LF 4DFAA 5CR3A 2KHJA 5C3WA 5CMDA 3K6OA 2I0QA 3DHQA 4KV6A 1SROA 3I4MG 3KF8A 3NBHA 4AYBG 4QQBX 1WOCA 1YJ9A 4ODGA 3C46A 2EOTA 2X6LA 4JI3L 4GNXC 4DN4M 2I5MX 2SNMA 2TSSA 1FR3A 2Z4HA 3ONAB 2NTTA 2JSOA 4KI0A 4X62L 4DV2L 5I6WA 4OWXB 1SJED 4HMIA 4B08A 3PQIA 4FVMA 3S1RB 1L2FA 1CHPD 1LTAD 3I56A 5GAGC 1Y8OB 3EVQA 1FNUA 3RR5A 4RKLA 1SYEA 5COYA 2AUJD 4YY3L 5FLXE 3VYTA 4A3IG 1EWCA 4HIOA 5JJIA 4DR5L 5D14A 3KK7A 3G7LA 4JOIA 1DXMA 4EQPA 2RHSB 1EIGA 2MUYA 2KCNA 1FJGQ 4ZUJA 3J80L 3PO3G 5IP9H 5LL6X 4DXGA 2YTYA 1PH3A 3HGBA 2NWGA 5A2QL 3CCJA 2C5CA 2UUBQ 3OMGA 3P75A 1HHVA 2O4XA 1VQAA 2RSOA 1VMPA 1H9MA 2QF7A 4HIDA 4KHVA 1UWVA 1WJJA 2IPKD 2RCFA 1DZ1A 4BBRG 2XVSA 1AP0A 1AN8A 3K80C 3KYHC 3GV6A 5CV7A 1HH2P 1HTPA 4X65L 4CDDC 4IFDJ 2A73B 2ID0A 2HHHQ 5FLMH 5D3DA 1CTMA 1D1IA 2AQ3B 4HJ9A 1B1ZA 1VQHA 3FVQA 3MEHA 1EFWA 2O5JC 3S1QB 2A6ED 1I50B 4LUOA 3X3MA 1JMCA 1D5XC 4IPHA 3SR1A 1NMFA 5GADC 2QGQA 3K0YA 4LFAL 4CJ0B 1YNNC 1HQMC 1JC7A 1IHZA 4HCSA 1F9QA 4UDUC 4JK1C 1Q7YC 5KYIA 1EIYB 4R4CA 2LXJA 3ULJA 2C35B 4LUZA 1KD1C 1J5EQ 4ZKCB 4UY8C 1CQFA 1G6PA 1C4QA 3PO2B 1IL2A 3KUPA 1L0XB 4WJWA 2ZXOA 1DGSA 2VUMG 1Y8NB 1K8MA 1I94Q 4XYQA 1YHBA 2B2VA 2NN6G 3A56A 1X32A 4RFBA 3P7JA 3BZKA 4LF6L 4QCLA 2LS01 4IJHA 2LKVA 1VQ6A 2PI2E 4GLXA 1BCPD 4A3BG 3S1QH 5BN3A 2K5NA 4HN7A 1I50H 3A8JE 2EYPA 2RF4A 5IGFA 3I90A 5IYCH 4LF9Q 1IKMA 3T1HL 4Z9CB 1B3AA 2YTXA 4NP5A 2R7ZG 1V1QA 2EZVA 2JA9A 4GNXA 3I72A 3BZDB 1F2LA 2V1CC 1VDZA 1FD7D 3W5OA 2HCIA 3BVMA 3LGJA 2E2JB 3G71A 3ULLA 3L7ZC 4KY7A 1QZHA 3MEFA 4DAPA 2F03A 3PO2H 1STBA 3UE0A 4WJ4A 5I9OA 4QUFA 2R92B 3MA2B 3M85A 1FNVA 1KXLA 4BXXG 3TS0A 2VQEL 1FYCA 1A2TA 4YCVA 2FFKB 3NQIA 2F1MA 4QJFA 1ICWA 5LMUQ 1SMXA 1K3RA 4IO9A 4AQYL 1JWUD 4AYBB 5M3MG 1SFOB 4KKTA 3R8BA 1NAPA 2H1EA 3E3XA 4CDFC 5FO7B 2E74C 1EYCA 1XJVA 1U5KA 1A6XA 3PUWA 3RZDB 3H94A 1B8AA 4JI2Q 1Q12A 2PW5A 2A6HD 4V0BA 3HKZG 1FGBD 3MXNA 4XQJA 1O80A 3SEBA 1K8OA 5ELNA 1A3UA 2E2JH 4QL5A 1XMOQ 4A3DG 3DWPA 3F8TA 1EYAA 2KECA 3BVZA 3F2BA 3I4NB 1GJXA 4K14A 3IAYA 1YNJC 1GXDC 3OPOA 3PF5A 4KHPL 2K6AA 2R92H 3NHHA 1VQIA 2I07B 4TVAB 4R9WA 3M9BA 1KL9A 4Q0FA 1HR0W 4JBWA 4DK0A 5C3EG 3QWNA 2N8NA 1KABA 3O13A 4A3IB 4H13C 3J80i 3FRPB 4DUZQ 5TSSA 2DJFC 1EEID 1C8CA 4HSPA 4MTKA 1J9OA 2ICIA 3OWEB 3HP3A 4JBMA 3RZDH 5M5YB 4AYBE 2BA0A 3PO3B 4X64Q 3DEOA 1Y1VB 2PQAA 3R3OA 3K8AA 4FXKC 2M00A 4C3HG 4GKKQ 1F2ZA 2Z0SA 3L3OC 2N49A 2A69C 4K6LA 4TKOB 3I4NH 2MPMA 1JR0D 4G4KA 1RJTA 1PRTD 4BBRB 3T4AC 2SEBD 4P74A 2JJQA 2A74C 1O7ZA 3TREA 3HOYG 1SEBD 1UEBA 2AKWB 2RDGA 4P2CB 3NENA 1I4HA 4BA1I 1MI2A 1KRSA 4OO1G 4A3IH 1PMRA 4IPCA 3JAMc 2XWJB 4H7BA 2KCMA 2PQEA 4DV6Q 1B4OA 5M5YH 1KRTA 1M4VA 1PLFA 3PO3H 4IFDG 4JI6L 1O78A 1Y1VH 2Q8TA 4F7XA 1AW7A 4X3UA 4M8AA 2B8FA 4POGA 4GLAC 2KBNA 4G7HC 4FDBA 3MZ5A 4PQXA 2KVMA 1R4QB 5J39A 2NBFA 1EIFA 1XTCD 1OXUA 3K7AB 3MFYA 4BBRH 3UDXA 3CCRA 2CHBD 3D6CA 1A8VA 2Y0SG 5BR8L 2LXKA 1CKNA 1P8LA 1A62A 1H9JA 4DNIA 5IIFA 1NMGA 2OEOA 1PH8A 2RBMA 2QILA 1GUTA 1CT1D 1EY0A 1XPUA 3CF5A 2PI2A 1VQ8A 3NTIA 2GA4B 3NELA 1PTOD 4LF7Q 1CUKA 1X3EA 2F0HA 1II3A 3Q6SA 3U4ZA 1SNCA 1DOLA 3T1YL 4QF4A 3T51B 2K04A 5EGTA 4DV3Q 2B63G 1YJNA 1QJOA 3URYA 2MJ8A 1YJWA 3AFPA 1JWMD 2F3VA 3SK5A 3K7AH 3KF8B 1STEA 2CQAA 2E2DC 2GVBA 3NBHB 3QOJA 4DR1Q 2KHIA 4KMUC 3D4RA 1E3PA 1HZBA 4BY7G 1YNND 3I55A 4DXFA 4LMQD 1KQSA 4JI5L 5KIXA 2JXMB 5T1GA 2MO0A 1XNQQ 3AYHB 3ER0A 4IUUA 5C0XI 3HOVG 5M3MB 3QOLA 1LLRD 1VQPA 2B29A 1GHKA 2DNEA 4IUTA 5DLQE 4JI0L 1LTTD 1VF5C 4JC0A 1E2VA 1N33L 4DR5Q 3E5SA 2F3IA 3WOEA 2DJGC 3HKZB 2DY8A 1MJCA 1WTVA 1U4PA 4K2LA 1EFID 1LUZA 1OO9B 3UI2A 5C5LA 1TU2B 2BDOA 1QB5D 1X65A 2B2YA 3KDFA 3A54A 3M4YA 1UNSA 1K83B 1N36L 1G91A 4BXXH 5CORA 1K3BC 3BDCA 5LMNW 1M90C 4DV1L 2MGSA 1VQOA 2QCPX 2VY3A 3P1HA 4LJZC 3TDQA 1HCZA 4NMZA 5M3MH 2UXDL 4K0KL 1JB3A 4X65Q 1TS4A 2EYOA 1QVGA 3MAQA 4ZAIA 2ZXRA 4FYDA 2ZXPA 1G8ZD 3PCOB 3S1MH 5FOBB 1VQKA 1QNUA 3TP6A 2EVBA 2LSSA 3S2DB 1IW7D 2ASBA 2VQFQ 3W1BA 4RGTA 2ZT9C 3HOZG 1YHAA 3D31A 2HUGA 2MO1A 4I7ZC 4C3HB 5AJ3Q 4NXNL 3SXHA 2IJ0A 2JA8G 3HKZE 5FLXc 4U68A 1F9RA 2L5TA 5H1SE 2K5WA 2B2TC 1BCPF 1F2MA 1TY0A 2JA5B 2CKZB 3A74A 1K83H 4O1NA 2XTIA 3EQLC 3MFGA 4P72A 2RVLA 1Y8PB 2I5HA 1GUNA 4RGNA 1QCBD 1WCMB 2OQKA 1WTXA 3OMCA 3RMHA 4CHTB 4LF6Q 3AEVA 1GKHA 1TT2A 3F1ZA 3S2DH 1LYLA 2PPBC 4OIKA 1K0SA 1LTBD 3OTOL 2WKCA 1XXGA 2Q2IA 5C4XG 1X54A 3NPPA 3B6YA 3BZCA 3HEJA 1PYSB 2UXBL 1DJRD 2WAQG 1V1PA 4C3HH 1Q8IA 3LNNA 4JYAQ 4DV5L 4IOCA 2HIXA 1EL0A 2JA5H 4CKCA 4EQ5A 1W6KA 3AQQA 2EJGC 3D3RA 5J1ZA 1YEZA 3S9WA 2X69A 3J7AF 3UDGA 1W3SA 5F2DA 1M8AA 1V9PA 4JI4Q 4ILWA 4LW1A 1J6QA 2CQOA 3EIVA 4QY7A 2A69D 2IY5B 1WCMH 1IYUA 4GNXB 4JBKA 3GTLB 3NXWA 1SMYC 4F87A 1DONA 1A3VA 1LT3D 5CV5A 5E4WC 1CKMA 3NWTA 3H91A 1X56A 4K8IA 5HGQA 4IFDH 2OXPA 5E7NA 1VQ5A 4HEDA 1TWGB 1XPRA 2LFNA 4X6AH 3GTKB 5I2YA 2K4KA 2BOSA 4DU9A 2A68C 3NTHA 1PXUA 2B8GA 1VQLA 4YIJA 1MHWC 4OX9L 1LTRD 1D5ZC 4B3MQ 2VB2X 3HS0C 2F3WA 2O5IC 1XMQL 1QVFA 1QOHA 4DR7L 4L5QA 4LFBL 4KKSA 2RHQB 4YHHL 4KHPQ 1L1OC 3GTQB 3H0GG 3TEHB 2R7DA 3OW2A 2BH2A 3GTLH 3HOVB 4PMBA 4A93B 1I4PA 2Y0SE 4DR3L 3E9HA 1M1KC 1PH2A 1TVXA 3TS2A 5IWAQ 4IJLA 2KCCA 1IXRA 3J80E 1PZJD 3A7LA 3LX0A 3GTJB 2KEEA 4KJNA 1TWGH 1PRTF 2EPBA 5A2QE 1HNWQ 2BA1A 1XTDA 4KTAA 3TMEA 1KNAA 3HRZC 3GTKH 3M4PA 4HJ7A 5M5WB 2R6GA 1PTOB 2UUAL 1HXYD 1RIPA 1BKBA 4HIKA 1TXYA 1Q1BA 1SLJA 1QZGA 4LF5L 3ULPA 2ALYB 5AFWA 3VR2A 2F0IA 2K7VA 3ND9A 5J22A 4FF4A 4R4IA 1PZKD 2ATWA 3VYUA 4PZ7A 1IBLQ 3GTQH 1BUVT 4K5XA 2L55A 3HOVH 1BXTA 4A93H 2PQAB 1GUOA 5GQOA 2AQ1B 2QEXA 1Q82C 4HAEA 1EQQA 3TBIB 3HOXG 2JN4A 4DR6L 1HNXQ 3U4VA 4K2KA 4KK7A 3GTJH 5KNDA 2WFWA 3HOZB 2A8VA 2RDFA 4JI8Q 5HY6A 1S4ZA 1NCVA 3K58A 5M5WH 1GM5A 4K8JA 4RH6A 4A3KG 1PTOH 4MIUA 4HTHA 3RLFA 4JI6Q 4JV5Q 2LY7A 3CC7A 4RAUC 4UAIA 1SE8A 4DPGA 3AFQA 3CCQA 1X3GA 1Q81C 1U4LA 1K9MC 4LF8Q 1PTOF 2E75C 3RZOB 1QNKA 1L0WA 3CCEA 3FHWA 3FEWX 2K75A 4A3EB 1TWHB 5EKLA 3RUZA 1GO3E 1I6VC 2HDMA 2AQ2B 5IGDA 1EQVA 4A3CH 1S3OA 1STHA 3H3VH 5C4XB 5LL6S 1IBKQ 2ZTCA 4ZCKA 4GKJL 1A63A 5IE8A 4PG3A 1SBBB 2WAQB 2EYLA 2ZM6L 1CKNB 3TP7A 4EX5A 5EKIA 4L63B 4IUQA 3S1RH 1BNZA 2Q2HA 3OIQA 2EDGA 3GTMB 2R3ZA 3UDFA 1E1TA 5FJ8G 2E5LQ 4A3JB 5C44B 2C9OA 3CPWA 5E3FA 3ND8A 3RZOH 4A3GG 4IUNA 4JI1Q 5IYDH 2F4VQ 2QW7A 3S17B 3DM1A 2VXWA 1L1OA 3TP5A 5K5PA 1DCZA 3AU7A 5KEEA 4A3EH 3CCUA 1TWHH 2EE1A 1VQFA 1DYQA 1ONLA 1VS0A 4YWLA 1SE4A 4LUVA 3STBD 5IYBG 5C4XH 4DV0Q 4BY1G 3X3NA 1NUCA 2K52A 3H09A 3I7FA 4JI0Q 4GOPC 2KJXA 4I65A 2F0WA 4RGOS 1AZQA 4KY5A 2UUCL 2OTJA 4BWGB 1E24A 1N32L 4KD4A 3LWUA 4XT1B 3RLNA 3TP8A 4C3JB 3GTMH 2WAQE 3G4SA 1SYCA 5C4JB 1TS2A 5IOCA 4A3JH 2XGTA 5C44H 1SNPA 2E2HB 4JI7Q 2JK8A 1AEXA 2PCFB 3RN5A 2QDBA 4ID6A 2EQSA 4DUYL 5IT9L 3RN2A 1BBXC 1VQ7A 3H0GB 1HNZQ 1AH9A 1T9HA 3S17H 1N9WA 4A3FG 2A5HA 1E22A 1EUJA 3VR3A 2QA4A 1IBMQ 2UXDQ 1C7YA 2NVYB 5IGGA 4DR2Q 2NYZD 2CW0C 5CV4A 3KDFB 1S5DD 3HKSA 3L2PA 2VB3X 4OEMB 4DK6C 1QUQA 1JOKA 1JWSD 5ELDA 2FJ2A 4X3TA 2Z4IA 5JPNC 1Q90A 2K5HA 4XQNA 4EVOA 2L12A 4C3JH 3I3CA 4AH6A 2V4DA 5C4JH 1PA6A 1WTOA 2E2HH 3CCVA 2PZUA 3I4OA 4B3SL 4OONA 4TSSA 2IX3A 3KBXA 1PZID 1UEAB 3H0GH 1NTGA 2A68D 3E6ZX 3I4MB 5EAYA 2FXQA 2CH4W 3FPUB 4J8QA 4B3RQ 3NP8A 2MNAA 2EJMA 1OTCA 2EXZA 4C3IG 4C2MB 4DV7Q 2QDLA 4MZ9A 2Z8LA 3SK6A 1GOZA 5EPLA 1P16A 4N9TA 2NVYH 3VA5A 1T5EA 4ZLTF 3A5ZB 3TQYA 1WTQA 3A5UA 4G7OC 1KAWA 4LWCA 2Z9HA 2JQOA 1LT6D 2IHEA 3T13A 2G5DA 2B2WC 3F2UA 2SDFA 3OTOQ 4R4QA 2K50A 1B2TA 5CV9A 5ELOA 4H0LC 2K28A 4GLVB 1Y1WG 4X66L 3J81L 4B9XA 4YWKA 1A2UA 2K14A 3OIPA 4K5WA 4DV4L 4LF4Q 2JA6G 1G291 3I4MH 1VQBA 3PUXA 3CW2C 1SFOH 3IFTA 4C2MH 3WOFA 2M9VA 1V1PB 1EY8A 3C3LA 1VQ4A 5DM73 4OWWB 1D5MC 2MHVA 3W2DA 2DGYA 3I91A 1KHIA 5BN5A 1D7QA 2VL6A 3EN2A 5GAEC 1SR3A 5JAVA 2NUCA 5T1IA 5CGKA 5IP7G 1Q3LA 1MD2D 2D2CC 3FPPA 5JEAJ 3V05A 3KJPA 5IGCA 1V1OA 4RGMA 4AIMA 3M7GA 3NSWA 2JE6I 3SVMA 5M3FG 4A3GB 4UP7A 2BCOA 4K6DA 2LMCB 2F0DA 2NN6I 1PV4A 1C0AA 1OXSC 3SK8A 2RDHA 4RKBA 1DOKA 4V190 2GN5A 2ZTEA 1LTSD 5EKKA 4WFN3 2R93G 4GN5A 1YVCA 3M7NA 1B7YB 2AWNA 3CRLC 2RKSA 3HZXA 2JA7G 5EPKA 3I4LA 4QMGA 4JW0A 2HCCA 1N34Q 5FJ8H 2XIWA 1MSGA 1HZAA 3NEMA 5CBEE 1OXVA 3GV3A 1RODA 3I73A 2VUMB 4A3GH 4HMJA 3PSIA 4FF2A 1LT5D 1PFSA 1VMCA 2AMCB 2N3SA 3C1FA 3G6JB 4LK1C 1XNRQ 1DOMA 1EWHA 4IPDA 4A3BB 2KHSA 5JJKA 2KCTA 5EPJA 4A3FB 5GROA 1Q46A 2EJFC 4MTNA 3F2DA 5K36G 4RG1A 5IYBH 2O2LD 2R7ZB 1EYGA 2UXCL 4GN3B 1EU4A 2Q8IB 3RLOA 1UAPA 4DAYA 4OELB 3U50C 3DUZA 5D65A 4NXML 1AE2A 4JI3Q 2EY6A 2WACA 1G2TA 1ML0D 4O0AA 3IKJA 1FJGL 2IT1A 3HOWG 4BBSG 4IALA 4X62Q 1X6OA 2XNAC 5GAHC 3HFZB 1STYA 1X3FA 3HG9A 3N52A 2YV5A 5IGBA 4DV2Q 1STGA 5JJLA 1TWFB 1B53A 2OT2A 1JB7A 3K5MA 5FO9B 2UUBL 2VUMH 2FMMA 2NN6H 3J80c 3FP9A 3U9OA 1UE7A 4KKUA 3MTSA 1YIJA 4IUPA 2H5XA 4A3BH 1CM9A 4XXEA 4A3FH 3CC4A 1WTRA 1CK1A 3SGIA 4EQNA 3KF6A 3K59A 1PH1A 2PYKA 3ERSX 4YY3Q 2R7ZH 2HHHL 1ESRA 1UE5A 1MKHA 1XX8A 3V2TA 2I5LX 3OWFA 4DNTB 1RCVD 4BA2I 2WINB 3J81i 1PVOA 4A3DB 1HZCA 5JOBA 1RTNA 2E76C 4GKJQ 1HPCA 1V43A 2K1BA 1Q86C 1UUPA 3TN2A 2HIVA 3GTPB 1TWFH 3U9SA 2CW0D 1CA6A 2F0LA 1J5EL 1ILQA 3M4OB 2JA6B 4PZ6A 1NNXA 5C3EB 2JP1A 5M9OA 1PH4A 5LHY1 3PIO3 3FKIG 1QILA 2F0GA 3JC66 2K03A 2HDLA 1BQQT 3OW7A 3UE1A 1OXXK 4ZQ3A 5E1FA 1R9TB 4CDCC 1EZ6A 4J15A 4A3LG 1I6HB 1X9NA 1TR5A 3ICEA 1PYBA 4A3DH 1AE3A 4LF9L 3MXPA 4C1NI 4N8FA 4IFDI 4I7AA 4TRDA 4LFAQ 2ES2A 1JORA 1I4GA 4FP5D 4YWMA 4ULLA 1PFBA 4DGZA 4DR4L 3A55A 3GTPH 4NPSA 1RHPA 1L1OB 1SE2A 1VQDA 1J8IA 3QB3A 3CC2A 4DNRB 1ZXTA 4ZKBB 2KEDA 1D6EC 3M4OH 3HOYB 3G48A 3BU2A 1Z6HA 5M3FB 2CWPA 2JA6H 5IP9G 5C3EH 1TS5A 1HR0L 1JOOA 5NUCA 1E2WA 1QG7A 3D4WA 4CDEC 1PFMA 4GN4B 1RDPD 3N6RA 1KDBA 2WP8J 1XYIA 3QG1A 4DUYQ 5JEAG 3F2CA 1YNJD 2I46A 2OCEA 4RCOA 3VR4A 1WVLA 1H95A 2K33A 3V96A 1R9TH 3CP0A 3MVVA 4B3TL 5LMUL 4JVZA 1L0YB 4XT3B 1S5FD 2NVTB 1I6HH 3KLWA 2R93B 1AFPA 3T1HQ 3TZDA 3NK9A 5FLMG 4XQQA 1JCKB 1EIHA 1DM0B 4R1JA 4J1MA 2M2LA 1XMOL 2OF1A 1SNDA 2Y0SB 4IN3A 5M3FH 3HOYH 3QR8A 3CKIB 3C2PA 4OO1H 4GS3A 3J7AV 4GZYC 4FXGC 1QUQB 5JVH3 1X55A 2VQEQ 4CGYB 2YTVA 1BCPC 1TWAB 1NE3A 2MP1A 4AQYQ 3EFXD 4ZRZA 1LABA 5IY0A 1TKWB 3EROA 5D3IB 1TS3A 5JJZA 2NVTH 2R93H 4DUZL 2B63B 2EYFA 3BYYB 1RKNA 4KN4C 1U4RA 3NWSA 4TQUS 1VQGA 3HOWB 3D4DA 4JOIC 2D9UA 1KIXA 1ZKOA 1GHJA 4BY7B 4FF3A 4P71A 2F0PA 3E9IA 4GKKL 2A1AA 1O7IA 4NKLA 1KC8C 1CI3M 1B3QA 4F8MA 5DAUA 1R4PB 3ZJYC 3PUYA 2Q2UA 3BVGA 3A8IE 3H6MA 3G6EA 2D62A 2HT1A 2OTLA 4UP8A 4OHJA 5K36H 1VQEA 1N8RC 1TWAH 1YNXA 3PO2G 3Q0AA 1SYDA 2K5VA 2KOLA 2N55A 3I8ZA 4R8NA 1CZWA 2EY2A 2VS1A 4F88A 5CBAE 2B63H 2IX0A 2MFIA 5I4DA 4DV6L 2A6HC 1ASYA 1EY9A 1X3QA 3H3VI 3HOWH 2SNSA 3L0OA 3EA6A 2G9DA 5DNFA 3KLSA 4QIWB 2B3GA 4BY7H 4Q5VA 2B2TA 1VF7A 4XTCS 1BR9A 5FK9C 2NVXB 2F4IA 1LT4D 1HJPA 1HA5A 4P75A 3FDTA 3VYSA 3SE0A 5C4ZA 2NZHA 3KLSX 4CKEA 1I5FA 1RF2D 1ZYRC 1PH9A 2KUMA 5CYUA 3JAML 1OXTA 3FKIB 2F52A 1LO5D 3HOUG 5L37A 3CMAA 5ELCA 4RMFA 5DM63 3ITPA 2B2VC 3PGZA 4RHRA 1VQJA 2NTSA 1SXTA 1LTLA 3BYTB 1XWEA 2PZWA 1EU3A 1TY2A 1EZ8A 4LF7L 2NZOA 4QUCA 2JA8B 2RCNA 1H9SA 1Y14B 2Q8RE 4HIMA 4DV3L 1BF4A 3PV0A 1WYDA 3PIOA 2NVXH 1SDFA 5IT9E 1PRTC 1MBYA 3PUVA 5LMNL 4QIWE 5C0XJ 1QE6A 1PH5A 1S72A 2J0TD 4DR1L 2PO4A 3FKIH 2JYOA 4MN3A 5BR8Q 1GUSA 3DWQA 2K05A 2L1BA 5CC4A 3I4NG 4LFCL 2F0QA 3AB9A 1O7YA 1HTLD 4A75A 2IX1A 2FINB 1XNQL 5KRUA 1B9MA 3R93A 3HOZH 4A3LH 2PZTA 2J4XA 1TWCB 1UE6A 1PH7A 4HJAA 2UXCQ 5KNBA 1YI2A 1BO0A 2JA8H 3T1YQ 3K7UC 1F9SA 2D0PA 2KQ3A 4KJOA 4NXMQ 1U4MA 4C1NK 2BE5C 4A4IA 3Q8DA 3ZYYX 1BBWA 3I2ZA 1FVIA 3CXCA 1U9RA 2L9HA 1Y1VG 1I4QA 2L4NA 1SNQA 1IYJB 4FNFA 4DAYB 1BDOA 2YYZA 1AZPA 5JEAH 4JI5Q 4R4OA 3DLLA 3PIPA 4R8IA 1ZEQX 4FXDA 4JG2A 3BJUA 1JE4A 1PTOC 3CMEA 1TWCH 2IL8A 1RTOA 1JE5A 5E4XA 5ELBA 1N33Q 4XYOA 2EXDA 1ET9A 3KBGA 1E0BA 4K5VA 5KNCA 1JT8A 4O42A 4POFA 3A0JA 3CCLA 2VQFL 3J81E 5ISRA 4DAMA 2B2UC 1EQRA 4NDXA 5A35A 4N8X1 5FO8B 5AJ3L 2X6GA 3KF6B 1KNEA 3OSOA 1LM0A 5IODA 4QGUA 3CCMA 1EOVA 1GVPA 1N36Q 1EY5A 4KN7C 5ELEA 3IRBA 1JJGA 4DV1Q 1G2SA 1HFGA 4P73A 4ZK9B 3H3VC 5ELFA 5C4HA 4IOAA 4K0KQ 1D2BA 1I4RA 2WB1G 1TQOA 4R4TA 4ABNA 1E7ZA 2ZJPA 4LNQA 1KLUD 1V8QA 3K81C 3DXJC 4XIGS 4CKBA 1SMYD 1MGSA 2F0EA 2EYJA 1IKLA 1CFMA 2AHOB 1EQTA 5FLXL 3GO5A 4L8JA 3BDLA 3D8GA 2IWHA 5HURA 1B44D 3CU7A 1Y69U 1HZ9A 4NXNQ 4OL7A 4CBVA 4N9PA 3JAMi 1B70B 1EYDA 1WI5A 1CSQA 2PMZB 4DR4Q 1BOSA 1RL2A 4JYAL 1E2ZA 3T53B 2YU9B 1KDCA 1ESFA 1DD2A 1NSNS 3HOUB 3HOXB 1K73C 1HR0Q 1KDAA 4JI4L 5C3XA 2XRSD 2F0NA 5EQ0A 3J7YW 3PMFA 1JJ2A 4IZ8A 4NW2A 4ME5A 3H15A 3NTKA 1IW7C 3CD6A 1VCIA 2RQXA 3Q22A 4A3KB 3K5LA 4B3TQ 3S15B 1QWYA 2B39A 4WORA 4O2DA 2WKDA 1STNA 2XRQD 2K5QA 2UXBQ 4HJ5A 5KGUA 1HQRD 3P20A 3IFDA 3I70A 4DV5Q 4EQOA 2DN8A 3QO2A 4L5SA 1VQMA 2YU9H 5DEHA 1WD1A 4PV1C 4B3ML 3HOUH 2PMZE 3HOXH 3CCSA 2F0UA 1MJEA 1UE1A 3CHBD 4ZUIA 3E0JA 2Z6BA 3LWEA 4CJ1B 5M5XB 3DM3A 5C0XG 3NE5B 1ENAA 2IW3A 1ZYRD 1ENFA 4A3KH 1NBWA 3S15H 5IWAL 1PHJA 1ICFB 4IUVA 4GOPA 3QJYA 3BS1A 2E8GA 1SNOA 1KAAA 1JJCB 1LACA 1HNWL 3PF4A 4JPBW 2XSCA 2ZTDA 2Q2TA 1CHQD 1JICA 2B2UA 4UHVA 1HRJA 3Q23A 3S1NB 3GP7A 1NR2A 3J81j 4OX9Q 2UU9L 2IHFA 1F2YA 4B9WA 3PUZA 1XMQQ 2WIIB 2Z1CA 5JPMC 2B2YC 1YZ6A 1K0RA 4DR7Q 1IZ6A 1KLGD 4LFBQ 1Q8KA 3FMCA 4YHHQ 1SN8A 2JA5G 3NBIA 3K57A 1IBLL 5M5XH 1SYBA 2CCZA 2GVAA 4DR3Q 4BY1B 4ME3A 2AUKA 1I4XA 2RSNA 5KYLA 3S16B 3A7AB 4RWSC 3C1EA 3A8KE 4Y52H 1HNXL 1YITA 1IL8A 1WCMG 4L5TA 1KTKA 2CVRA 3KOJA 1U0LA 4JI8L 1WTWA 1STAA 4APVA 2F0VA 5G3LD 2UUAQ 1H9KA 4JV5L 3D0FA 3S1NH 4LF5Q 2CFMA 1S40A 3EJIA 3DEPA 1SAPA 1JOQA 2RA4A 2NZ1D 1MIUA 4NB3A 1SYFA 2ZJQA 4LF8L 1Z47A 2BE5D 4DAVA 2DNCA 2K32A 2EIFA 2PNHA 4WJ3M 4OIJA 4BY1H 2WB1B 1E1OA 1CA5A 4DR6Q 3S16H 3NQTA 3K5NA 4L5RC 5IGEA 3D6WA 4J6HA 5JVG3 3VDYA 3BG3A 1PDQA 1HUNA 3U58A 3GTOB 1HUMA 3SK4A 2B2WA 1SJHD 3GDEA 4YCWA 1IBKL 5C5MA 4MHEA 2XWBB 2F0SA 3M4QA 3L9AX 3NUCA 5I6YA 4A3MG 1VQ9A 4Y7NB 1JQYD 1CKOA 2OQ0A 1ET6A 3VR6A 2E5LL 5CV8A 4C3IB 5LMNQ 4DA2A 4EGVA 3TSSA 3W3AA 1CZGA 1H9RA 5FKAC 1HA6A 1PYWD 1BBUA 3KFUA 1H9SB 4KY6A 4JI1L 3J7A5 2DY7A 2XN9C 3WWVA 2F4VL 2E2IB 4LFCQ 2BDNA 1XPOA 4KLKA 2EY1A 2J7ZA 4H44C 3CPFA 4IPGA 3GTOH 2WB1E 4HJ8A 4G7ZC 4A93G 4DV0L 1LTGD 1Y1WB 4KD3A 4L6TB 4H02A 2ZM6Q 3M3YB 2A19A 3S1MB 1SNMA 3DMUA 2JEBI 3VA7A 2OWOA 2NB0A 1SE3A 4G57A 1B50A 1BCPB 3MHBA 4Y7NH 3TRZA 1Z9FA 3R2IA 4DKAC 1NJIC 1GUWA 4S3SA 1EY6A 1A0IA 1FNWA 2HD3A 2SOBA 2NVQB 2VW9A 4C3IH 4C56C 4OGQC 2DUDA 4X3SA 1I94L 4JI7L 1ENCA 2TMPA 4OO1I 2D5DA 1HFNA 5BN4A 1MSHA 4UP9A 1WD0A 1HNZL 2E2IH 1D8LA 3OOCA 4WRDA 1K8GA 1A3TA 5IT9c 1K8AC 1F9PA 4ALPA 2F0MA 4FO2A 1FGUA 5I2XA 1CQVA 1IBML 1NR4A 4X3KA 1EWIA 1RD9D 4DR2L 3GTGB 2PNRC 2ZJRA 1Y1WH 4YCUA 1K28A 3M3YH 2R61A 3GD7A 2UUCQ 5HGTA 4DF7A 1N32Q 3Q24A 4DK1A 1C48A 4A3CG 3MC0B 5EBDA 3T56B 5C6AA 2Z6KC 2EY5A 2NVQH 4U673 1GUGA 2F0JA 4HR7B 1SSOA 2R7FA 3W1GA 4CJ2C 4OXPA 3OYYA 2A6EC 4PMWA 2MQHA 3CRKC 1EOTA 5C0XH 1I3QB 4JCVE 3S14B 4PZ8A 4B3RL 3STBC 3PIP3 4DV7L 1B9NA 1LTID 2HQEA 5IP7H 5IYDG 3EBEA 3GTGH 2JA7B 3KJOA 1T5XD 2FMCA 4JI2L 1LV9A 4M1UB 5J3BA 1SYGA 4A3EG 1BVSA 4PMCA 4MNOA 1C9OA 5EBCA 1PFNA 4UPAA 4OWTB 4RCNA 3SDZA 1WFQA 3JAME 3BDOA
chains in the Genus database with same CATH topology
1A15A 3VR5A 2KA7A 2H4OA 2WV6D 3AMUA 2FHTA 4ZYSA 4E6IA 4FF1A 2QEJC 3DWAA 3KLRA 5EJWA 3MXGA 2EYHA 3T16A 2K5DA 2F0OA 3ERQA 2VNUD 4BS9A 1PRTB 1D1KA 1S5ED 2N88A 4BBSB 4XDXA 3S2HB 1G6ZA 1S5BD 4RA8A 1Z7TA 4IURA 2JEAI 3IL8A 4KHZA 1IYVA 4A3MB 4HCEA 1ILPA 2QKIC 1EY7A 2K01A 1TIID 1EY4A 3QIAA 1W6JA 1Q1EA 4LAAA 5CV6A 4C3JG 3SHLA 1X3PA 3WDNA 4HSVA 2G9HD 4PNYA 2ENBA 3CQZB 2AWOA 4RHSA 1F77A 3RD4A 3VYRA 2EYMA 2F0FA 5I9PA 3GQBA 4QB4A 2PW7A 1EEFD 2F0TA 2L0CA 3K5OA 1WTPA 1O7LA 3OHXC 3MWYW 2ICEC 3R2TA 4IQZA 3TZUA 2L11A 3MXUA 2F0KA 1S5CD 5G3LF 4DFAA 5CR3A 5C3WA 5CMDA 3K6OA 3DHQA 4KV6A 3KF8A 3NBHA 4ODGA 3C46A 2EOTA 2X6LA 4DN4M 2SNMA 2TSSA 1FR3A 2Z4HA 3ONAB 2NTTA 2JSOA 4KI0A 5I6WA 1SJED 4HMIA 4B08A 4FVMA 3S1RB 1CHPD 1LTAD 1Y8OB 3EVQA 1FNUA 4RKLA 1SYEA 5COYA 2AUJD 5FLXE 3VYTA 1EWCA 5D14A 3KK7A 3G7LA 1DXMA 4EQPA 1EIGA 2MUYA 2KCNA 4ZUJA 3J80L 5LL6X 4DXGA 3HGBA 2NWGA 5A2QL 2C5CA 3OMGA 3P75A 1HHVA 2O4XA 2RSOA 1VMPA 1H9MA 2QF7A 4KHVA 2IPKD 1DZ1A 2XVSA 1AP0A 1AN8A 3GV6A 5CV7A 1HTPA 4IFDJ 2A73B 2ID0A 5D3DA 1CTMA 1D1IA 2AQ3B 1B1ZA 3FVQA 3MEHA 2O5JC 3S1QB 2A6ED 1I50B 3X3MA 1D5XC 3SR1A 3K0YA 4CJ0B 4UDUC 4HCSA 1YNNC 1HQMC 1JC7A 1IHZA 1F9QA 4JK1C 5KYIA 4ZKCB 1CQFA 1C4QA 3PO2B 3KUPA 1L0XB 4WJWA 2ZXOA 1Y8NB 1K8MA 4XYQA 2NN6G 2B2VA 3A56A 1X32A 4RFBA 3P7JA 4QCLA 2LS01 2LKVA 1BCPD 5BN3A 4HN7A 3A8JE 2EYPA 5IGFA 3I90A 1IKMA 4Z9CB 1B3AA 4NP5A 2EZVA 3I72A 3BZDB 1F2LA 1VDZA 1FD7D 2HCIA 3BVMA 2E2JB 3L7ZC 4KY7A 4DAPA 2F03A 1STBA 5I9OA 4QUFA 2R92B 3MA2B 3M85A 1FNVA 1FYCA 1A2TA 2FFKB 3NQIA 2F1MA 1ICWA 1JWUD 4AYBB 1SFOB 4KKTA 3R8BA 1NAPA 2H1EA 5FO7B 2E74C 1EYCA 1A6XA 3PUWA 3RZDB 3H94A 1Q12A 2PW5A 2A6HD 4V0BA 1FGBD 3MXNA 4XQJA 1O80A 3SEBA 1K8OA 1A3UA 3DWPA 1EYAA 2KECA 3BVZA 1GJXA 3I4NB 4K14A 3IAYA 1YNJC 1GXDC 3OPOA 2K6AA 3NHHA 2I07B 4R9WA 4Q0FA 4JBWA 4DK0A 3QWNA 1KABA 3O13A 4A3IB 4H13C 3FRPB 5TSSA 1EEID 1C8CA 4HSPA 1J9OA 2ICIA 3OWEB 3HP3A 5M5YB 2BA0A 3PO3B 3DEOA 1Y1VB 4FXKC 3R3OA 2M00A 4C3HG 1F2ZA 3L3OC 2A69C 4K6LA 4TKOB 2MPMA 1JR0D 4G4KA 1RJTA 1PRTD 4BBRB 3T4AC 2SEBD 2A74C 1O7ZA 1SEBD 2RDGA 4P2CB 1I4HA 4BA1I 1MI2A 4OO1G 1PMRA 2XWJB 4H7BA 2PQEA 1B4OA 1M4VA 1PLFA 4IFDG 1O78A 2Q8TA 4F7XA 1AW7A 4X3UA 4M8AA 2B8FA 4G7HC 3MZ5A 4PQXA 2KVMA 1R4QB 5J39A 2NBFA 1XTCD 1OXUA 3K7AB 3MFYA 2CHBD 3D6CA 1H9JA 5IIFA 2OEOA 2RBMA 2QILA 1GUTA 1CT1D 1EY0A 3NTIA 2GA4B 1PTOD 2F0HA 1II3A 3Q6SA 1SNCA 1DOLA 4QF4A 3T51B 2K04A 5EGTA 1QJOA 3URYA 2MJ8A 1JWMD 2F3VA 3SK5A 1STEA 2CQAA 2E2DC 3QOJA 4KMUC 3D4RA 1YNND 4DXFA 4LMQD 5KIXA 2JXMB 5T1GA 4IUUA 5C0XI 5M3MB 3QOLA 1LLRD 1GHKA 2DNEA 4IUTA 1LTTD 1VF5C 1E2VA 3E5SA 3WOEA 3HKZB 2DY8A 1WTVA 1U4PA 4K2LA 1EFID 1OO9B 3UI2A 5C5LA 1TU2B 2BDOA 1QB5D 2B2YA 3A54A 3M4YA 1UNSA 1K83B 1G91A 5CORA 3BDCA 2MGSA 2QCPX 3P1HA 4LJZC 3TDQA 1HCZA 4NMZA 1JB3A 1TS4A 2EYOA 3MAQA 4ZAIA 2ZXRA 4FYDA 2ZXPA 1G8ZD 5FOBB 1QNUA 3TP6A 2EVBA 3S2DB 1IW7D 4RGTA 2ZT9C 3D31A 2HUGA 4I7ZC 4C3HB 3SXHA 2IJ0A 4U68A 1F9RA 2L5TA 2K5WA 2B2TC 1BCPF 1F2MA 1TY0A 2JA5B 4O1NA 3EQLC 3MFGA 2RVLA 1Y8PB 1GUNA 4RGNA 1QCBD 1WCMB 1WTXA 3OMCA 3RMHA 4CHTB 1TT2A 2PPBC 4OIKA 1LTBD 2WKCA 1XXGA 3NPPA 3HEJA 1DJRD 1V1PA 1Q8IA 3LNNA 1EL0A 4CKCA 1W6KA 2EJGC 3D3RA 5J1ZA 3S9WA 2X69A 3J7AF 5F2DA 1M8AA 4ILWA 2A69D 1IYUA 3GTLB 3NXWA 4F87A 1SMYC 1DONA 1A3VA 1LT3D 5CV5A 5E4WC 3NWTA 3H91A 4K8IA 4IFDH 2OXPA 4HEDA 1TWGB 2LFNA 3GTKB 5I2YA 2BOSA 4DU9A 2A68C 3NTHA 1PXUA 2B8GA 4YIJA 1LTRD 1D5ZC 2VB2X 3HS0C 2F3WA 2O5IC 1QOHA 4KKSA 3GTQB 3HOVB 4PMBA 4A93B 1I4PA 1TVXA 2KCCA 3J80E 1PZJD 3A7LA 3LX0A 3GTJB 2KEEA 4KJNA 1PRTF 2EPBA 5A2QE 2BA1A 4KTAA 3TMEA 1KNAA 3HRZC 5M5WB 2R6GA 1PTOB 1HXYD 1Q1BA 5AFWA 3VR2A 2F0IA 2K7VA 3ND9A 5J22A 4FF4A 1PZKD 3VYUA 1BUVT 4K5XA 2L55A 1BXTA 1GUOA 2AQ1B 4HAEA 3TBIB 4K2KA 4KK7A 5KNDA 3HOZB 2RDFA 1S4ZA 1NCVA 3K58A 4K8JA 4RH6A 1PTOH 4MIUA 4HTHA 3RLFA 2LY7A 4RAUC 4UAIA 1U4LA 1PTOF 2E75C 3RZOB 1QNKA 3FEWX 4A3EB 1TWHB 5EKLA 3RUZA 1I6VC 2HDMA 2AQ2B 5IGDA 1EQVA 1STHA 5C4XB 5LL6S 1SBBB 2WAQB 2EYLA 3TP7A 5EKIA 4L63B 4IUQA 1BNZA 3OIQA 2EDGA 3GTMB 2R3ZA 4A3JB 5C44B 2C9OA 5E3FA 3ND8A 4IUNA 3S17B 3DM1A 2VXWA 3TP5A 5K5PA 1DCZA 3AU7A 5KEEA 2EE1A 1DYQA 1ONLA 1SE4A 3X3NA 1NUCA 3H09A 2KJXA 4I65A 2F0WA 4RGOS 1AZQA 4KY5A 4BWGB 4KD4A 3LWUA 4XT1B 3TP8A 4C3JB 1SYCA 5C4JB 5IOCA 1TS2A 1SNPA 2E2HB 1AEXA 2PCFB 2QDBA 4ID6A 5IT9L 1BBXC 3H0GB 2A5HA 3VR3A 2NVYB 5IGGA 2NYZD 2CW0C 5CV4A 1S5DD 2VB3X 1JOKA 1JWSD 5ELDA 2FJ2A 4X3TA 2Z4IA 5JPNC 1Q90A 4XQNA 4EVOA 2L12A 3I3CA 2V4DA 1WTOA 2PZUA 4TSSA 2IX3A 3KBXA 1PZID 1UEAB 3E6ZX 2A68D 3I4MB 3FPUB 4J8QA 3NP8A 2EJMA 2EXZA 4C3IG 4C2MB 2Z8LA 3SK6A 1GOZA 5EPLA 4N9TA 3VA5A 1T5EA 4ZLTF 4G7OC 1WTQA 1LT6D 3T13A 2B2WC 3F2UA 2SDFA 1B2TA 5CV9A 4H0LC 2K28A 3J81L 4B9XA 1A2UA 3OIPA 4K5WA 1G291 3PUXA 3IFTA 3WOFA 2M9VA 1V1PB 1EY8A 3C3LA 5DM73 1D5MC 2MHVA 3W2DA 3I91A 5BN5A 5JAVA 2NUCA 5T1IA 5CGKA 1Q3LA 1MD2D 2D2CC 3FPPA 5JEAJ 3V05A 5IGCA 1V1OA 4RGMA 3M7GA 3NSWA 2JE6I 3SVMA 4A3GB 2BCOA 4K6DA 2LMCB 2F0DA 2NN6I 1OXSC 3SK8A 2RDHA 4RKBA 1DOKA 4V190 1LTSD 5EKKA 4WFN3 3M7NA 2AWNA 3CRLC 2RKSA 3HZXA 5EPKA 3I4LA 4QMGA 2HCCA 2XIWA 1MSGA 5CBEE 1OXVA 3GV3A 1RODA 3I73A 2VUMB 4HMJA 4FF2A 1LT5D 4LK1C 1VMCA 3C1FA 3G6JB 1DOMA 1EWHA 4A3BB 2KHSA 5EPJA 4A3FB 2EJFC 5K36G 2O2LD 2R7ZB 2Q8IB 1EU4A 1UAPA 4DAYA 3DUZA 5D65A 2EY6A 2WACA 1G2TA 1ML0D 3IKJA 2IT1A 4IALA 2XNAC 1STYA 3HG9A 3N52A 5IGBA 1STGA 1TWFB 1B53A 2OT2A 3K5MA 5FO9B 2FMMA 2NN6H 3U9OA 4KKUA 3MTSA 4IUPA 1CM9A 4XXEA 1WTRA 1CK1A 4EQNA 3K59A 2PYKA 1ESRA 1XX8A 3V2TA 3OWFA 4DNTB 1RCVD 4BA2I 2WINB 4A3DB 5JOBA 1RTNA 2E76C 1HPCA 1V43A 2K1BA 1UUPA 3TN2A 3GTPB 3U9SA 2CW0D 1CA6A 2F0LA 1ILQA 3M4OB 2JA6B 5C3EB 2JP1A 5M9OA 5LHY1 3PIO3 1QILA 2F0GA 2K03A 2HDLA 1BQQT 3OW7A 1OXXK 4ZQ3A 5E1FA 1R9TB 1EZ6A 1I6HB 1TR5A 3MXPA 4C1NI 4IFDI 4TRDA 1JORA 1I4GA 4FP5D 4ULLA 1PFBA 4DGZA 3A55A 1RHPA 1SE2A 1J8IA 3QB3A 4DNRB 1ZXTA 4ZKBB 2KEDA 1D6EC 3HOYB 5M3FB 1Z6HA 1TS5A 1JOOA 5NUCA 1E2WA 1QG7A 3D4WA 1PFMA 1RDPD 3N6RA 1KDBA 2WP8J 1XYIA 3QG1A 5JEAG 1YNJD 2I46A 4RCOA 3VR4A 1WVLA 2K33A 3V96A 3MVVA 1L0YB 4XT3B 1S5FD 2NVTB 2R93B 1AFPA 3TZDA 3NK9A 4XQQA 1JCKB 1EIHA 1DM0B 4J1MA 2M2LA 2OF1A 1SNDA 2Y0SB 4IN3A 3CKIB 3C2PA 4OO1H 4GZYC 3J7AV 4FXGC 5JVH3 4CGYB 1BCPC 1TWAB 2MP1A 3EFXD 4ZRZA 1LABA 1TKWB 3EROA 5D3IB 1TS3A 5JJZA 2B63B 2EYFA 3BYYB 1RKNA 4KN4C 1U4RA 3NWSA 4TQUS 3HOWB 3D4DA 2D9UA 1ZKOA 1GHJA 4BY7B 4FF3A 2F0PA 4NKLA 1CI3M 4F8MA 5DAUA 1R4PB 3PUYA 3BVGA 3A8IE 3H6MA 2D62A 4OHJA 5K36H 3Q0AA 1SYDA 2KOLA 2N55A 3I8ZA 4R8NA 1CZWA 2EY2A 4F88A 5CBAE 2IX0A 5I4DA 2A6HC 1EY9A 1X3QA 2SNSA 3EA6A 2G9DA 5DNFA 3KLSA 4QIWB 4Q5VA 2B2TA 1VF7A 4XTCS 1BR9A 5FK9C 2NVXB 2F4IA 1LT4D 1HA5A 3FDTA 3VYSA 3SE0A 5C4ZA 3KLSX 4CKEA 1RF2D 1ZYRC 2KUMA 5CYUA 3JAML 1OXTA 3FKIB 1LO5D 5ELCA 5DM63 3ITPA 2B2VC 4RHRA 2NTSA 1SXTA 3BYTB 1XWEA 2PZWA 1EU3A 1TY2A 1EZ8A 4QUCA 2JA8B 1H9SA 2Q8RE 1BF4A 3PV0A 1SDFA 5IT9E 1PRTC 1MBYA 3PUVA 5C0XJ 1QE6A 2J0TD 2PO4A 2JYOA 4MN3A 1GUSA 3DWQA 2K05A 2L1BA 5CC4A 2F0QA 3AB9A 1O7YA 1HTLD 2IX1A 2FINB 5KRUA 1B9MA 3R93A 2PZTA 2J4XA 1TWCB 5KNBA 1BO0A 1F9SA 2KQ3A 4KJOA 1U4MA 4C1NK 2BE5C 3ZYYX 1U9RA 2L9HA 1I4QA 2L4NA 1SNQA 4FNFA 1BDOA 2YYZA 1AZPA 5JEAH 4R8IA 1ZEQX 4FXDA 1JE4A 1PTOC 2IL8A 1RTOA 5E4XA 5ELBA 4XYOA 1ET9A 3KBGA 1E0BA 4K5VA 5KNCA 4O42A 3J81E 5ISRA 2B2UC 4NDXA 5A35A 5FO8B 2X6GA 1KNEA 3OSOA 5IODA 1EY5A 4KN7C 5ELEA 1G2SA 1HFGA 4ZK9B 3H3VC 5ELFA 5C4HA 1D2BA 1I4RA 1TQOA 4ABNA 1KLUD 1V8QA 3DXJC 4XIGS 4CKBA 1SMYD 1MGSA 2F0EA 2EYJA 1IKLA 1CFMA 1EQTA 5FLXL 3GO5A 4L8JA 3BDLA 3D8GA 2IWHA 5HURA 1B44D 3CU7A 1Y69U 4OL7A 4CBVA 4N9PA 1EYDA 2PMZB 1BOSA 1E2ZA 3T53B 2YU9B 1KDCA 1ESFA 1DD2A 1NSNS 3HOUB 3HOXB 1KDAA 5C3XA 2XRSD 2F0NA 5EQ0A 3J7YW 3PMFA 4IZ8A 4NW2A 4ME5A 3NTKA 1IW7C 1VCIA 2RQXA 3Q22A 4A3KB 3K5LA 3S15B 1QWYA 2B39A 4WORA 2WKDA 1STNA 2XRQD 2K5QA 5KGUA 1HQRD 3P20A 3IFDA 3I70A 4EQOA 2DN8A 3QO2A 5DEHA 1WD1A 4PV1C 2F0UA 3CHBD 4ZUIA 3E0JA 3LWEA 5M5XB 4CJ1B 5C0XG 3NE5B 1ENAA 2IW3A 1ZYRD 1ENFA 4IUVA 3QJYA 3BS1A 1SNOA 1KAAA 1LACA 2XSCA 1CHQD 1JICA 2B2UA 1HRJA 3Q23A 3S1NB 3GP7A 1NR2A 1F2YA 4B9WA 3PUZA 2WIIB 2Z1CA 5JPMC 2B2YC 1KLGD 3FMCA 3NBIA 3K57A 1SYBA 4BY1B 2AUKA 1I4XA 2RSNA 5KYLA 3S16B 3A7AB 4RWSC 3C1EA 3A8KE 1IL8A 1KTKA 2CVRA 1WTWA 1STAA 2F0VA 5G3LD 1H9KA 3EJIA 3DEPA 1SAPA 1JOQA 2RA4A 2NZ1D 1SYFA 1Z47A 2BE5D 4DAVA 2DNCA 2K32A 4OIJA 2WB1B 1CA5A 3NQTA 3K5NA 5IGEA 3D6WA 4J6HA 5JVG3 3BG3A 1PDQA 1HUNA 3GTOB 1HUMA 3SK4A 2B2WA 1SJHD 5C5MA 4MHEA 2XWBB 2F0SA 3L9AX 3NUCA 5I6YA 4Y7NB 1JQYD 1ET6A 3VR6A 5CV8A 4C3IB 4DA2A 4EGVA 3TSSA 3W3AA 1CZGA 1H9RA 5FKAC 1HA6A 1PYWD 1H9SB 4KY6A 2DY7A 2XN9C 2E2IB 2BDNA 2EY1A 2J7ZA 4H44C 4G7ZC 1LTGD 1Y1WB 4KD3A 4L6TB 3M3YB 3S1MB 1SNMA 3DMUA 2JEBI 3VA7A 2NB0A 1SE3A 4G57A 1B50A 1BCPB 3MHBA 3R2IA 1GUWA 4S3SA 1EY6A 1FNWA 2SOBA 2NVQB 4C56C 4OGQC 4X3SA 1ENCA 2TMPA 4OO1I 2D5DA 1HFNA 5BN4A 1MSHA 1WD0A 3OOCA 4WRDA 1A3TA 1F9PA 2F0MA 4FO2A 5I2XA 1CQVA 1NR4A 4X3KA 1RD9D 3GTGB 2PNRC 2R61A 3GD7A 5HGTA 4DF7A 3Q24A 4DK1A 1C48A 3MC0B 5EBDA 3T56B 5C6AA 2EY5A 4U673 1GUGA 2F0JA 4HR7B 1SSOA 4CJ2C 2A6EC 4PMWA 3CRKC 1EOTA 5C0XH 1I3QB 3S14B 3PIP3 1B9NA 1LTID 2HQEA 2JA7B 1T5XD 2FMCA 1LV9A 4M1UB 1SYGA 4PMCA 5EBCA 1PFNA 4RCNA 3SDZA 3JAME 3BDOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9Q A;  1DOL A;  1EQT A;  2K05 A;  2L1B A;  2KEE A;  1A15 A;  1MSG A;  2K04 A;  2B2Y C;  2RVL A;  2XIW A;  5CBE E;  4ZLT F;  2EPB A;  5CMD A;  1O7Y A;  3GV3 A;  1ROD A;  1WTQ A;  4ZKC B;  1KNA A;  2FIN B;  2FHT A;  2MJ8 A;  1WTX A;  3R93 A;  1VMC A;  1C8C A;  2B2W C;  2EOT A;  3F2U A;  1J9O A;  2SDF A;  3KUP A;  1B2T A;  2X6L A;  1DOM A;  2VXW A;  3DM1 A;  3HP3 A;  4DN4 M;  2RSN A;  4RWS C;  2R3Z A;  5EJW A;  1B50 A;  2EE1 A;  5EPJ A;  2K28 A;  3ONA B;  1BO0 A;  5AFW A;  2B2V A;  4OIK A;  1PFB A;  1X32 A;  3DEO A;  1IL8 A;  4LMQ D;  1GUW A;  1F9S A;  5EPL A;  1RHP A;  1U4M A;  2CVR A;  3P7J A;  5T1G A;  2N88 A;  1J8I A;  4X3S A;  1G6Z A;  4XDX A;  2KOL A;  1ZXT A;  2N55 A;  4IUU A;  4ZKB B;  2KED A;  3I8Z A;  1WTW A;  1HFN A;  4RA8 A;  5EQ0 A;  1MSH A;  5D65 A;  2MPM A;  3I90 A;  5CBA E;  4IUR A;  1WD0 A;  4NW2 A;  1AZQ A;  1IKM A;  2L9H A;  1B3A A;  3IL8 A;  4IUT A;  4HAE A;  1G2T A;  1EL0 A;  1ML0 D;  1QG7 A;  1RJT A;  1X3Q A;  2L4N A;  4XT1 B;  1PFM A;  1F9P A;  3DEP A;  1XYI A;  1ILP A;  1SAP A;  1AZP A;  1O7Z A;  3N52 A;  1F2L A;  2K01 A;  2RA4 A;  2NZ1 D;  1NR4 A;  4X3K A;  2X69 A;  2DY8 A;  5COY A;  2HCI A;  1B53 A;  5DNF A;  4R8I A;  1U4P A;  1WVL A;  1MI2 A;  1WTV A;  3I91 A;  1M8A A;  2FMM A;  1S4Z A;  1NCV A;  2B2T A;  3UI2 A;  1BBX C;  1JE4 A;  4XT3 B;  5D14 A;  3IFD A;  4OIJ A;  3G7L A;  3FDT A;  3MTS A;  1DON A;  4IUP A;  3TZD A;  4HCS A;  1EIG A;  2IL8 A;  5T1I A;  1RTO A;  1CA5 A;  1Q3L A;  2B2Y A;  1B4O A;  1CM9 A;  3QO2 A;  1X3P A;  5E4X A;  5E4W C;  4QUF A;  4HSV A;  4RAU C;  1PLF A;  2KUM A;  4UAI A;  1WTR A;  1WD1 A;  1G91 A;  1E0B A;  3D6W A;  3H91 A;  4O42 A;  1EIH A;  5COR A;  1U4L A;  1PDQ A;  1HUN A;  2Q8T A;  1HUM A;  2FFK B;  2NWG A;  4X3U A;  2NYZ D;  2MGS A;  2B2W A;  4HED A;  1ESR A;  1ICW A;  1HHV A;  2B2U C;  2M2L A;  1SSO A;  1XX8 A;  4MHE A;  2RSO A;  1VMP A;  2B2V C;  3SVM A;  4CJ2 C;  2FJ2 A;  1QNK A;  1NAP A;  2H1E A;  1KNE A;  2X6G A;  3LWE A;  4X3T A;  4CJ1 B;  2KVM A;  4ZAI A;  1EOT A;  1DZ1 A;  1AP0 A;  1RTN A;  3GV6 A;  2L12 A;  3I3C A;  4QUC A;  2K1B A;  2HDM A;  4IUV A;  3TN2 A;  1G2S A;  1HFG A;  4ZK9 B;  1WTP A;  1O80 A;  2Q8R E;  1DOK A;  1WTO A;  2MP1 A;  3MWY W;  1CA6 A;  1BF4 A;  1LV9 A;  2HUG A;  2KEC A;  1ILQ A;  5JJZ A;  1SDF A;  3KBX A;  1HA6 A;  1JIC A;  2L11 A;  2B2U A;  2DY7 A;  2JP1 A;  3FPU B;  1F9R A;  4U68 A;  5EKI A;  1HRJ A;  4IUQ A;  1QE6 A;  1U4R A;  2B2T C;  1NR2 A;  1PFN A;  1BNZ A;  1TVX A;  2BDN A;  5EPK A;  1MGS A;  2J7Z A;  2JYO A;  2K03 A;  4MN3 A;  4CJ0 B;  1IKL A;  2HDL A;  3Q6S A;  2D9U A;  4R9W A;  2HCC A; 
#chains in the Genus database with same CATH topology
 1A15 A;  3VR5 A;  4B3S Q;  2KA7 A;  4DK3 C;  1G51 A;  2H4O A;  2WV6 D;  2CH4 A;  3AMU A;  1QVC A;  2FHT A;  1PH6 A;  4LF4 L;  4ZYS A;  4E6I A;  3J81 c;  4FF1 A;  2QEJ C;  1I3Q H;  4A3J G;  3S14 H;  3DWA A;  3KLR A;  5C44 G;  5EJW A;  3MXG A;  2EYH A;  3T16 A;  2K5D A;  2D0O A;  2F0O A;  3ERQ A;  2VNU D;  1YBY A;  4BS9 A;  2JA7 H;  1PRT B;  1D1K A;  1S5E D;  2N88 A;  4BBS B;  4XDX A;  3S2H B;  1G6Z A;  1VQN A;  1S5B D;  4X64 L;  4RA8 A;  1SRU A;  1Z7T A;  5IYC G;  4IUR A;  2HQL A;  2JEA I;  3IL8 A;  3CAM A;  4KHZ A;  1NY4 A;  1IYV A;  4A3M B;  4A76 A;  2L15 A;  4HCE A;  1ILP A;  2QKI C;  4X66 Q;  1GD7 A;  1EY7 A;  1WTH A;  1FL0 A;  2K01 A;  1TII D;  1EY4 A;  3QIA A;  1W6J A;  1Q1E A;  4DV4 Q;  1CSP A;  4LAA A;  3K0X A;  5CV6 A;  4C3J G;  3E0E A;  1VQC A;  3SHL A;  2N78 A;  1X3P A;  3WDN A;  4HSV A;  2G9H D;  4PNY A;  2ENB A;  3CQZ B;  2AWO A;  3S24 A;  4RHS A;  1F77 A;  3RD4 A;  3MXN B;  2P5Z X;  4BBS H;  3S2H H;  3J7Z C;  3VYR A;  2EYM A;  2F0F A;  3RNU A;  1YHQ A;  5I9P A;  2KEN A;  3GQB A;  4JBJ A;  4QB4 A;  2PW7 A;  1EEF D;  2BH8 A;  2F0T A;  2L0C A;  4A3M H;  3K5O A;  1WTP A;  1O7L A;  3OHX C;  1N34 L;  3MWY W;  2Z6K A;  2ICE C;  3R2T A;  4IQZ A;  1ASZ A;  3TZU A;  2CWA A;  2UU9 Q;  4GOP B;  2L11 A;  3MXU A;  2F0K A;  1S5C D;  1XNR L;  2VZA A;  3UDI A;  2R92 G;  3CQZ H;  1W2B A;  5G3L F;  4DFA A;  5CR3 A;  2KHJ A;  5C3W A;  5CMD A;  3K6O A;  2I0Q A;  3DHQ A;  4KV6 A;  1SRO A;  3I4M G;  3KF8 A;  3NBH A;  4AYB G;  4QQB X;  1WOC A;  1YJ9 A;  4ODG A;  3C46 A;  2EOT A;  2X6L A;  4JI3 L;  4GNX C;  4DN4 M;  2I5M X;  2SNM A;  2TSS A;  1FR3 A;  2Z4H A;  3ONA B;  2NTT A;  2JSO A;  4KI0 A;  4X62 L;  4DV2 L;  5I6W A;  4OWX B;  1SJE D;  4HMI A;  4B08 A;  3PQI A;  4FVM A;  3S1R B;  1L2F A;  1CHP D;  1LTA D;  3I56 A;  5GAG C;  1Y8O B;  3EVQ A;  1FNU A;  3RR5 A;  4RKL A;  1SYE A;  5COY A;  2AUJ D;  4YY3 L;  5FLX E;  3VYT A;  4A3I G;  1EWC A;  4HIO A;  5JJI A;  4DR5 L;  5D14 A;  3KK7 A;  3G7L A;  4JOI A;  1DXM A;  4EQP A;  2RHS B;  1EIG A;  2MUY A;  2KCN A;  1FJG Q;  4ZUJ A;  3J80 L;  3PO3 G;  5IP9 H;  5LL6 X;  4DXG A;  2YTY A;  1PH3 A;  3HGB A;  2NWG A;  5A2Q L;  3CCJ A;  2C5C A;  2UUB Q;  3OMG A;  3P75 A;  1HHV A;  2O4X A;  1VQA A;  2RSO A;  1VMP A;  1H9M A;  2QF7 A;  4HID A;  4KHV A;  1UWV A;  1WJJ A;  2IPK D;  2RCF A;  1DZ1 A;  4BBR G;  2XVS A;  1AP0 A;  1AN8 A;  3K80 C;  3KYH C;  3GV6 A;  5CV7 A;  1HH2 P;  1HTP A;  4X65 L;  4CDD C;  4IFD J;  2A73 B;  2ID0 A;  2HHH Q;  5FLM H;  5D3D A;  1CTM A;  1D1I A;  2AQ3 B;  4HJ9 A;  1B1Z A;  1VQH A;  3FVQ A;  3MEH A;  1EFW A;  2O5J C;  3S1Q B;  2A6E D;  1I50 B;  4LUO A;  3X3M A;  1JMC A;  1D5X C;  4IPH A;  3SR1 A;  1NMF A;  5GAD C;  2QGQ A;  3K0Y A;  4LFA L;  4CJ0 B;  1YNN C;  1HQM C;  1JC7 A;  1IHZ A;  4HCS A;  1F9Q A;  4UDU C;  4JK1 C;  1Q7Y C;  5KYI A;  1EIY B;  4R4C A;  2LXJ A;  3ULJ A;  2C35 B;  4LUZ A;  1KD1 C;  1J5E Q;  4ZKC B;  4UY8 C;  1CQF A;  1G6P A;  1C4Q A;  3PO2 B;  1IL2 A;  3KUP A;  1L0X B;  4WJW A;  2ZXO A;  1DGS A;  2VUM G;  1Y8N B;  1K8M A;  1I94 Q;  4XYQ A;  1YHB A;  2B2V A;  2NN6 G;  3A56 A;  1X32 A;  4RFB A;  3P7J A;  3BZK A;  4LF6 L;  4QCL A;  2LS0 1;  4IJH A;  2LKV A;  1VQ6 A;  2PI2 E;  4GLX A;  1BCP D;  4A3B G;  3S1Q H;  5BN3 A;  2K5N A;  4HN7 A;  1I50 H;  3A8J E;  2EYP A;  2RF4 A;  5IGF A;  3I90 A;  5IYC H;  4LF9 Q;  1IKM A;  3T1H L;  4Z9C B;  1B3A A;  2YTX A;  4NP5 A;  2R7Z G;  1V1Q A;  2EZV A;  2JA9 A;  4GNX A;  3I72 A;  3BZD B;  1F2L A;  2V1C C;  1VDZ A;  1FD7 D;  3W5O A;  2HCI A;  3BVM A;  3LGJ A;  2E2J B;  3G71 A;  3ULL A;  3L7Z C;  4KY7 A;  1QZH A;  3MEF A;  4DAP A;  2F03 A;  3PO2 H;  1STB A;  3UE0 A;  4WJ4 A;  5I9O A;  4QUF A;  2R92 B;  3MA2 B;  3M85 A;  1FNV A;  1KXL A;  4BXX G;  3TS0 A;  2VQE L;  1FYC A;  1A2T A;  4YCV A;  2FFK B;  3NQI A;  2F1M A;  4QJF A;  1ICW A;  5LMU Q;  1SMX A;  1K3R A;  4IO9 A;  4AQY L;  1JWU D;  4AYB B;  5M3M G;  1SFO B;  4KKT A;  3R8B A;  1NAP A;  2H1E A;  3E3X A;  4CDF C;  5FO7 B;  2E74 C;  1EYC A;  1XJV A;  1U5K A;  1A6X A;  3PUW A;  3RZD B;  3H94 A;  1B8A A;  4JI2 Q;  1Q12 A;  2PW5 A;  2A6H D;  4V0B A;  3HKZ G;  1FGB D;  3MXN A;  4XQJ A;  1O80 A;  3SEB A;  1K8O A;  5ELN A;  1A3U A;  2E2J H;  4QL5 A;  1XMO Q;  4A3D G;  3DWP A;  3F8T A;  1EYA A;  2KEC A;  3BVZ A;  3F2B A;  3I4N B;  1GJX A;  4K14 A;  3IAY A;  1YNJ C;  1GXD C;  3OPO A;  3PF5 A;  4KHP L;  2K6A A;  2R92 H;  3NHH A;  1VQI A;  2I07 B;  4TVA B;  4R9W A;  3M9B A;  1KL9 A;  4Q0F A;  1HR0 W;  4JBW A;  4DK0 A;  5C3E G;  3QWN A;  2N8N A;  1KAB A;  3O13 A;  4A3I B;  4H13 C;  3J80 i;  3FRP B;  4DUZ Q;  5TSS A;  2DJF C;  1EEI D;  1C8C A;  4HSP A;  4MTK A;  1J9O A;  2ICI A;  3OWE B;  3HP3 A;  4JBM A;  3RZD H;  5M5Y B;  4AYB E;  2BA0 A;  3PO3 B;  4X64 Q;  3DEO A;  1Y1V B;  2PQA A;  3R3O A;  3K8A A;  4FXK C;  2M00 A;  4C3H G;  4GKK Q;  1F2Z A;  2Z0S A;  3L3O C;  2N49 A;  2A69 C;  4K6L A;  4TKO B;  3I4N H;  2MPM A;  1JR0 D;  4G4K A;  1RJT A;  1PRT D;  4BBR B;  3T4A C;  2SEB D;  4P74 A;  2JJQ A;  2A74 C;  1O7Z A;  3TRE A;  3HOY G;  1SEB D;  1UEB A;  2AKW B;  2RDG A;  4P2C B;  3NEN A;  1I4H A;  4BA1 I;  1MI2 A;  1KRS A;  4OO1 G;  4A3I H;  1PMR A;  4IPC A;  3JAM c;  2XWJ B;  4H7B A;  2KCM A;  2PQE A;  4DV6 Q;  1B4O A;  5M5Y H;  1KRT A;  1M4V A;  1PLF A;  3PO3 H;  4IFD G;  4JI6 L;  1O78 A;  1Y1V H;  2Q8T A;  4F7X A;  1AW7 A;  4X3U A;  4M8A A;  2B8F A;  4POG A;  4GLA C;  2KBN A;  4G7H C;  4FDB A;  3MZ5 A;  4PQX A;  2KVM A;  1R4Q B;  5J39 A;  2NBF A;  1EIF A;  1XTC D;  1OXU A;  3K7A B;  3MFY A;  4BBR H;  3UDX A;  3CCR A;  2CHB D;  3D6C A;  1A8V A;  2Y0S G;  5BR8 L;  2LXK A;  1CKN A;  1P8L A;  1A62 A;  1H9J A;  4DNI A;  5IIF A;  1NMG A;  2OEO A;  1PH8 A;  2RBM A;  2QIL A;  1GUT A;  1CT1 D;  1EY0 A;  1XPU A;  3CF5 A;  2PI2 A;  1VQ8 A;  3NTI A;  2GA4 B;  3NEL A;  1PTO D;  4LF7 Q;  1CUK A;  1X3E A;  2F0H A;  1II3 A;  3Q6S A;  3U4Z A;  1SNC A;  1DOL A;  3T1Y L;  4QF4 A;  3T51 B;  2K04 A;  5EGT A;  4DV3 Q;  2B63 G;  1YJN A;  1QJO A;  3URY A;  2MJ8 A;  1YJW A;  3AFP A;  1JWM D;  2F3V A;  3SK5 A;  3K7A H;  3KF8 B;  1STE A;  2CQA A;  2E2D C;  2GVB A;  3NBH B;  3QOJ A;  4DR1 Q;  2KHI A;  4KMU C;  3D4R A;  1E3P A;  1HZB A;  4BY7 G;  1YNN D;  3I55 A;  4DXF A;  4LMQ D;  1KQS A;  4JI5 L;  5KIX A;  2JXM B;  5T1G A;  2MO0 A;  1XNQ Q;  3AYH B;  3ER0 A;  4IUU A;  5C0X I;  3HOV G;  5M3M B;  3QOL A;  1LLR D;  1VQP A;  2B29 A;  1GHK A;  2DNE A;  4IUT A;  5DLQ E;  4JI0 L;  1LTT D;  1VF5 C;  4JC0 A;  1E2V A;  1N33 L;  4DR5 Q;  3E5S A;  2F3I A;  3WOE A;  2DJG C;  3HKZ B;  2DY8 A;  1MJC A;  1WTV A;  1U4P A;  4K2L A;  1EFI D;  1LUZ A;  1OO9 B;  3UI2 A;  5C5L A;  1TU2 B;  2BDO A;  1QB5 D;  1X65 A;  2B2Y A;  3KDF A;  3A54 A;  3M4Y A;  1UNS A;  1K83 B;  1N36 L;  1G91 A;  4BXX H;  5COR A;  1K3B C;  3BDC A;  5LMN W;  1M90 C;  4DV1 L;  2MGS A;  1VQO A;  2QCP X;  2VY3 A;  3P1H A;  4LJZ C;  3TDQ A;  1HCZ A;  4NMZ A;  5M3M H;  2UXD L;  4K0K L;  1JB3 A;  4X65 Q;  1TS4 A;  2EYO A;  1QVG A;  3MAQ A;  4ZAI A;  2ZXR A;  4FYD A;  2ZXP A;  1G8Z D;  3PCO B;  3S1M H;  5FOB B;  1VQK A;  1QNU A;  3TP6 A;  2EVB A;  2LSS A;  3S2D B;  1IW7 D;  2ASB A;  2VQF Q;  3W1B A;  4RGT A;  2ZT9 C;  3HOZ G;  1YHA A;  3D31 A;  2HUG A;  2MO1 A;  4I7Z C;  4C3H B;  5AJ3 Q;  4NXN L;  3SXH A;  2IJ0 A;  2JA8 G;  3HKZ E;  5FLX c;  4U68 A;  1F9R A;  2L5T A;  5H1S E;  2K5W A;  2B2T C;  1BCP F;  1F2M A;  1TY0 A;  2JA5 B;  2CKZ B;  3A74 A;  1K83 H;  4O1N A;  2XTI A;  3EQL C;  3MFG A;  4P72 A;  2RVL A;  1Y8P B;  2I5H A;  1GUN A;  4RGN A;  1QCB D;  1WCM B;  2OQK A;  1WTX A;  3OMC A;  3RMH A;  4CHT B;  4LF6 Q;  3AEV A;  1GKH A;  1TT2 A;  3F1Z A;  3S2D H;  1LYL A;  2PPB C;  4OIK A;  1K0S A;  1LTB D;  3OTO L;  2WKC A;  1XXG A;  2Q2I A;  5C4X G;  1X54 A;  3NPP A;  3B6Y A;  3BZC A;  3HEJ A;  1PYS B;  2UXB L;  1DJR D;  2WAQ G;  1V1P A;  4C3H H;  1Q8I A;  3LNN A;  4JYA Q;  4DV5 L;  4IOC A;  2HIX A;  1EL0 A;  2JA5 H;  4CKC A;  4EQ5 A;  1W6K A;  3AQQ A;  2EJG C;  3D3R A;  5J1Z A;  1YEZ A;  3S9W A;  2X69 A;  3J7A F;  3UDG A;  1W3S A;  5F2D A;  1M8A A;  1V9P A;  4JI4 Q;  4ILW A;  4LW1 A;  1J6Q A;  2CQO A;  3EIV A;  4QY7 A;  2A69 D;  2IY5 B;  1WCM H;  1IYU A;  4GNX B;  4JBK A;  3GTL B;  3NXW A;  1SMY C;  4F87 A;  1DON A;  1A3V A;  1LT3 D;  5CV5 A;  5E4W C;  1CKM A;  3NWT A;  3H91 A;  1X56 A;  4K8I A;  5HGQ A;  4IFD H;  2OXP A;  5E7N A;  1VQ5 A;  4HED A;  1TWG B;  1XPR A;  2LFN A;  4X6A H;  3GTK B;  5I2Y A;  2K4K A;  2BOS A;  4DU9 A;  2A68 C;  3NTH A;  1PXU A;  2B8G A;  1VQL A;  4YIJ A;  1MHW C;  4OX9 L;  1LTR D;  1D5Z C;  4B3M Q;  2VB2 X;  3HS0 C;  2F3W A;  2O5I C;  1XMQ L;  1QVF A;  1QOH A;  4DR7 L;  4L5Q A;  4LFB L;  4KKS A;  2RHQ B;  4YHH L;  4KHP Q;  1L1O C;  3GTQ B;  3H0G G;  3TEH B;  2R7D A;  3OW2 A;  2BH2 A;  3GTL H;  3HOV B;  4PMB A;  4A93 B;  1I4P A;  2Y0S E;  4DR3 L;  3E9H A;  1M1K C;  1PH2 A;  1TVX A;  3TS2 A;  5IWA Q;  4IJL A;  2KCC A;  1IXR A;  3J80 E;  1PZJ D;  3A7L A;  3LX0 A;  3GTJ B;  2KEE A;  4KJN A;  1TWG H;  1PRT F;  2EPB A;  5A2Q E;  1HNW Q;  2BA1 A;  1XTD A;  4KTA A;  3TME A;  1KNA A;  3HRZ C;  3GTK H;  3M4P A;  4HJ7 A;  5M5W B;  2R6G A;  1PTO B;  2UUA L;  1HXY D;  1RIP A;  1BKB A;  4HIK A;  1TXY A;  1Q1B A;  1SLJ A;  1QZG A;  4LF5 L;  3ULP A;  2ALY B;  5AFW A;  3VR2 A;  2F0I A;  2K7V A;  3ND9 A;  5J22 A;  4FF4 A;  4R4I A;  1PZK D;  2ATW A;  3VYU A;  4PZ7 A;  1IBL Q;  3GTQ H;  1BUV T;  4K5X A;  2L55 A;  3HOV H;  1BXT A;  4A93 H;  2PQA B;  1GUO A;  5GQO A;  2AQ1 B;  2QEX A;  1Q82 C;  4HAE A;  1EQQ A;  3TBI B;  3HOX G;  2JN4 A;  4DR6 L;  1HNX Q;  3U4V A;  4K2K A;  4KK7 A;  3GTJ H;  5KND A;  2WFW A;  3HOZ B;  2A8V A;  2RDF A;  4JI8 Q;  5HY6 A;  1S4Z A;  1NCV A;  3K58 A;  5M5W H;  1GM5 A;  4K8J A;  4RH6 A;  4A3K G;  1PTO H;  4MIU A;  4HTH A;  3RLF A;  4JI6 Q;  4JV5 Q;  2LY7 A;  3CC7 A;  4RAU C;  4UAI A;  1SE8 A;  4DPG A;  3AFQ A;  3CCQ A;  1X3G A;  1Q81 C;  1U4L A;  1K9M C;  4LF8 Q;  1PTO F;  2E75 C;  3RZO B;  1QNK A;  1L0W A;  3CCE A;  3FHW A;  3FEW X;  2K75 A;  4A3E B;  1TWH B;  5EKL A;  3RUZ A;  1GO3 E;  1I6V C;  2HDM A;  2AQ2 B;  5IGD A;  1EQV A;  4A3C H;  1S3O A;  1STH A;  3H3V H;  5C4X B;  5LL6 S;  1IBK Q;  2ZTC A;  4ZCK A;  4GKJ L;  1A63 A;  5IE8 A;  4PG3 A;  1SBB B;  2WAQ B;  2EYL A;  2ZM6 L;  1CKN B;  3TP7 A;  4EX5 A;  5EKI A;  4L63 B;  4IUQ A;  3S1R H;  1BNZ A;  2Q2H A;  3OIQ A;  2EDG A;  3GTM B;  2R3Z A;  3UDF A;  1E1T A;  5FJ8 G;  2E5L Q;  4A3J B;  5C44 B;  2C9O A;  3CPW A;  5E3F A;  3ND8 A;  3RZO H;  4A3G G;  4IUN A;  4JI1 Q;  5IYD H;  2F4V Q;  2QW7 A;  3S17 B;  3DM1 A;  2VXW A;  1L1O A;  3TP5 A;  5K5P A;  1DCZ A;  3AU7 A;  5KEE A;  4A3E H;  3CCU A;  1TWH H;  2EE1 A;  1VQF A;  1DYQ A;  1ONL A;  1VS0 A;  4YWL A;  1SE4 A;  4LUV A;  3STB D;  5IYB G;  5C4X H;  4DV0 Q;  4BY1 G;  3X3N A;  1NUC A;  2K52 A;  3H09 A;  3I7F A;  4JI0 Q;  4GOP C;  2KJX A;  4I65 A;  2F0W A;  4RGO S;  1AZQ A;  4KY5 A;  2UUC L;  2OTJ A;  4BWG B;  1E24 A;  1N32 L;  4KD4 A;  3LWU A;  4XT1 B;  3RLN A;  3TP8 A;  4C3J B;  3GTM H;  2WAQ E;  3G4S A;  1SYC A;  5C4J B;  1TS2 A;  5IOC A;  4A3J H;  2XGT A;  5C44 H;  1SNP A;  2E2H B;  4JI7 Q;  2JK8 A;  1AEX A;  2PCF B;  3RN5 A;  2QDB A;  4ID6 A;  2EQS A;  4DUY L;  5IT9 L;  3RN2 A;  1BBX C;  1VQ7 A;  3H0G B;  1HNZ Q;  1AH9 A;  1T9H A;  3S17 H;  1N9W A;  4A3F G;  2A5H A;  1E22 A;  1EUJ A;  3VR3 A;  2QA4 A;  1IBM Q;  2UXD Q;  1C7Y A;  2NVY B;  5IGG A;  4DR2 Q;  2NYZ D;  2CW0 C;  5CV4 A;  3KDF B;  1S5D D;  3HKS A;  3L2P A;  2VB3 X;  4OEM B;  4DK6 C;  1QUQ A;  1JOK A;  1JWS D;  5ELD A;  2FJ2 A;  4X3T A;  2Z4I A;  5JPN C;  1Q90 A;  2K5H A;  4XQN A;  4EVO A;  2L12 A;  4C3J H;  3I3C A;  4AH6 A;  2V4D A;  5C4J H;  1PA6 A;  1WTO A;  2E2H H;  3CCV A;  2PZU A;  3I4O A;  4B3S L;  4OON A;  4TSS A;  2IX3 A;  3KBX A;  1PZI D;  1UEA B;  3H0G H;  1NTG A;  2A68 D;  3E6Z X;  3I4M B;  5EAY A;  2FXQ A;  2CH4 W;  3FPU B;  4J8Q A;  4B3R Q;  3NP8 A;  2MNA A;  2EJM A;  1OTC A;  2EXZ A;  4C3I G;  4C2M B;  4DV7 Q;  2QDL A;  4MZ9 A;  2Z8L A;  3SK6 A;  1GOZ A;  5EPL A;  1P16 A;  4N9T A;  2NVY H;  3VA5 A;  1T5E A;  4ZLT F;  3A5Z B;  3TQY A;  1WTQ A;  3A5U A;  4G7O C;  1KAW A;  4LWC A;  2Z9H A;  2JQO A;  1LT6 D;  2IHE A;  3T13 A;  2G5D A;  2B2W C;  3F2U A;  2SDF A;  3OTO Q;  4R4Q A;  2K50 A;  1B2T A;  5CV9 A;  5ELO A;  4H0L C;  2K28 A;  4GLV B;  1Y1W G;  4X66 L;  3J81 L;  4B9X A;  4YWK A;  1A2U A;  2K14 A;  3OIP A;  4K5W A;  4DV4 L;  4LF4 Q;  2JA6 G;  1G29 1;  3I4M H;  1VQB A;  3PUX A;  3CW2 C;  1SFO H;  3IFT A;  4C2M H;  3WOF A;  2M9V A;  1V1P B;  1EY8 A;  3C3L A;  1VQ4 A;  5DM7 3;  4OWW B;  1D5M C;  2MHV A;  3W2D A;  2DGY A;  3I91 A;  1KHI A;  5BN5 A;  1D7Q A;  2VL6 A;  3EN2 A;  5GAE C;  1SR3 A;  5JAV A;  2NUC A;  5T1I A;  5CGK A;  5IP7 G;  1Q3L A;  1MD2 D;  2D2C C;  3FPP A;  5JEA J;  3V05 A;  3KJP A;  5IGC A;  1V1O A;  4RGM A;  4AIM A;  3M7G A;  3NSW A;  2JE6 I;  3SVM A;  5M3F G;  4A3G B;  4UP7 A;  2BCO A;  4K6D A;  2LMC B;  2F0D A;  2NN6 I;  1PV4 A;  1C0A A;  1OXS C;  3SK8 A;  2RDH A;  4RKB A;  1DOK A;  4V19 0;  2GN5 A;  2ZTE A;  1LTS D;  5EKK A;  4WFN 3;  2R93 G;  4GN5 A;  1YVC A;  3M7N A;  1B7Y B;  2AWN A;  3CRL C;  2RKS A;  3HZX A;  2JA7 G;  5EPK A;  3I4L A;  4QMG A;  4JW0 A;  2HCC A;  1N34 Q;  5FJ8 H;  2XIW A;  1MSG A;  1HZA A;  3NEM A;  5CBE E;  1OXV A;  3GV3 A;  1ROD A;  3I73 A;  2VUM B;  4A3G H;  4HMJ A;  3PSI A;  4FF2 A;  1LT5 D;  1PFS A;  1VMC A;  2AMC B;  2N3S A;  3C1F A;  3G6J B;  4LK1 C;  1XNR Q;  1DOM A;  1EWH A;  4IPD A;  4A3B B;  2KHS A;  5JJK A;  2KCT A;  5EPJ A;  4A3F B;  5GRO A;  1Q46 A;  2EJF C;  4MTN A;  3F2D A;  5K36 G;  4RG1 A;  5IYB H;  2O2L D;  2R7Z B;  1EYG A;  2UXC L;  4GN3 B;  1EU4 A;  2Q8I B;  3RLO A;  1UAP A;  4DAY A;  4OEL B;  3U50 C;  3DUZ A;  5D65 A;  4NXM L;  1AE2 A;  4JI3 Q;  2EY6 A;  2WAC A;  1G2T A;  1ML0 D;  4O0A A;  3IKJ A;  1FJG L;  2IT1 A;  3HOW G;  4BBS G;  4IAL A;  4X62 Q;  1X6O A;  2XNA C;  5GAH C;  3HFZ B;  1STY A;  1X3F A;  3HG9 A;  3N52 A;  2YV5 A;  5IGB A;  4DV2 Q;  1STG A;  5JJL A;  1TWF B;  1B53 A;  2OT2 A;  1JB7 A;  3K5M A;  5FO9 B;  2UUB L;  2VUM H;  2FMM A;  2NN6 H;  3J80 c;  3FP9 A;  3U9O A;  1UE7 A;  4KKU A;  3MTS A;  1YIJ A;  4IUP A;  2H5X A;  4A3B H;  1CM9 A;  4XXE A;  4A3F H;  3CC4 A;  1WTR A;  1CK1 A;  3SGI A;  4EQN A;  3KF6 A;  3K59 A;  1PH1 A;  2PYK A;  3ERS X;  4YY3 Q;  2R7Z H;  2HHH L;  1ESR A;  1UE5 A;  1MKH A;  1XX8 A;  3V2T A;  2I5L X;  3OWF A;  4DNT B;  1RCV D;  4BA2 I;  2WIN B;  3J81 i;  1PVO A;  4A3D B;  1HZC A;  5JOB A;  1RTN A;  2E76 C;  4GKJ Q;  1HPC A;  1V43 A;  2K1B A;  1Q86 C;  1UUP A;  3TN2 A;  2HIV A;  3GTP B;  1TWF H;  3U9S A;  2CW0 D;  1CA6 A;  2F0L A;  1J5E L;  1ILQ A;  3M4O B;  2JA6 B;  4PZ6 A;  1NNX A;  5C3E B;  2JP1 A;  5M9O A;  1PH4 A;  5LHY 1;  3PIO 3;  3FKI G;  1QIL A;  2F0G A;  3JC6 6;  2K03 A;  2HDL A;  1BQQ T;  3OW7 A;  3UE1 A;  1OXX K;  4ZQ3 A;  5E1F A;  1R9T B;  4CDC C;  1EZ6 A;  4J15 A;  4A3L G;  1I6H B;  1X9N A;  1TR5 A;  3ICE A;  1PYB A;  4A3D H;  1AE3 A;  4LF9 L;  3MXP A;  4C1N I;  4N8F A;  4IFD I;  4I7A A;  4TRD A;  4LFA Q;  2ES2 A;  1JOR A;  1I4G A;  4FP5 D;  4YWM A;  4ULL A;  1PFB A;  4DGZ A;  4DR4 L;  3A55 A;  3GTP H;  4NPS A;  1RHP A;  1L1O B;  1SE2 A;  1VQD A;  1J8I A;  3QB3 A;  3CC2 A;  4DNR B;  1ZXT A;  4ZKB B;  2KED A;  1D6E C;  3M4O H;  3HOY B;  3G48 A;  3BU2 A;  1Z6H A;  5M3F B;  2CWP A;  2JA6 H;  5IP9 G;  5C3E H;  1TS5 A;  1HR0 L;  1JOO A;  5NUC A;  1E2W A;  1QG7 A;  3D4W A;  4CDE C;  1PFM A;  4GN4 B;  1RDP D;  3N6R A;  1KDB A;  2WP8 J;  1XYI A;  3QG1 A;  4DUY Q;  5JEA G;  3F2C A;  1YNJ D;  2I46 A;  2OCE A;  4RCO A;  3VR4 A;  1WVL A;  1H95 A;  2K33 A;  3V96 A;  1R9T H;  3CP0 A;  3MVV A;  4B3T L;  5LMU L;  4JVZ A;  1L0Y B;  4XT3 B;  1S5F D;  2NVT B;  1I6H H;  3KLW A;  2R93 B;  1AFP A;  3T1H Q;  3TZD A;  3NK9 A;  5FLM G;  4XQQ A;  1JCK B;  1EIH A;  1DM0 B;  4R1J A;  4J1M A;  2M2L A;  1XMO L;  2OF1 A;  1SND A;  2Y0S B;  4IN3 A;  5M3F H;  3HOY H;  3QR8 A;  3CKI B;  3C2P A;  4OO1 H;  4GS3 A;  3J7A V;  4GZY C;  4FXG C;  1QUQ B;  5JVH 3;  1X55 A;  2VQE Q;  4CGY B;  2YTV A;  1BCP C;  1TWA B;  1NE3 A;  2MP1 A;  4AQY Q;  3EFX D;  4ZRZ A;  1LAB A;  5IY0 A;  1TKW B;  3ERO A;  5D3I B;  1TS3 A;  5JJZ A;  2NVT H;  2R93 H;  4DUZ L;  2B63 B;  2EYF A;  3BYY B;  1RKN A;  4KN4 C;  1U4R A;  3NWS A;  4TQU S;  1VQG A;  3HOW B;  3D4D A;  4JOI C;  2D9U A;  1KIX A;  1ZKO A;  1GHJ A;  4BY7 B;  4FF3 A;  4P71 A;  2F0P A;  3E9I A;  4GKK L;  2A1A A;  1O7I A;  4NKL A;  1KC8 C;  1CI3 M;  1B3Q A;  4F8M A;  5DAU A;  1R4P B;  3ZJY C;  3PUY A;  2Q2U A;  3BVG A;  3A8I E;  3H6M A;  3G6E A;  2D62 A;  2HT1 A;  2OTL A;  4UP8 A;  4OHJ A;  5K36 H;  1VQE A;  1N8R C;  1TWA H;  1YNX A;  3PO2 G;  3Q0A A;  1SYD A;  2K5V A;  2KOL A;  2N55 A;  3I8Z A;  4R8N A;  1CZW A;  2EY2 A;  2VS1 A;  4F88 A;  5CBA E;  2B63 H;  2IX0 A;  2MFI A;  5I4D A;  4DV6 L;  2A6H C;  1ASY A;  1EY9 A;  1X3Q A;  3H3V I;  3HOW H;  2SNS A;  3L0O A;  3EA6 A;  2G9D A;  5DNF A;  3KLS A;  4QIW B;  2B3G A;  4BY7 H;  4Q5V A;  2B2T A;  1VF7 A;  4XTC S;  1BR9 A;  5FK9 C;  2NVX B;  2F4I A;  1LT4 D;  1HJP A;  1HA5 A;  4P75 A;  3FDT A;  3VYS A;  3SE0 A;  5C4Z A;  2NZH A;  3KLS X;  4CKE A;  1I5F A;  1RF2 D;  1ZYR C;  1PH9 A;  2KUM A;  5CYU A;  3JAM L;  1OXT A;  3FKI B;  2F52 A;  1LO5 D;  3HOU G;  5L37 A;  3CMA A;  5ELC A;  4RMF A;  5DM6 3;  3ITP A;  2B2V C;  3PGZ A;  4RHR A;  1VQJ A;  2NTS A;  1SXT A;  1LTL A;  3BYT B;  1XWE A;  2PZW A;  1EU3 A;  1TY2 A;  1EZ8 A;  4LF7 L;  2NZO A;  4QUC A;  2JA8 B;  2RCN A;  1H9S A;  1Y14 B;  2Q8R E;  4HIM A;  4DV3 L;  1BF4 A;  3PV0 A;  1WYD A;  3PIO A;  2NVX H;  1SDF A;  5IT9 E;  1PRT C;  1MBY A;  3PUV A;  5LMN L;  4QIW E;  5C0X J;  1QE6 A;  1PH5 A;  1S72 A;  2J0T D;  4DR1 L;  2PO4 A;  3FKI H;  2JYO A;  4MN3 A;  5BR8 Q;  1GUS A;  3DWQ A;  2K05 A;  2L1B A;  5CC4 A;  3I4N G;  4LFC L;  2F0Q A;  3AB9 A;  1O7Y A;  1HTL D;  4A75 A;  2IX1 A;  2FIN B;  1XNQ L;  5KRU A;  1B9M A;  3R93 A;  3HOZ H;  4A3L H;  2PZT A;  2J4X A;  1TWC B;  1UE6 A;  1PH7 A;  4HJA A;  2UXC Q;  5KNB A;  1YI2 A;  1BO0 A;  2JA8 H;  3T1Y Q;  3K7U C;  1F9S A;  2D0P A;  2KQ3 A;  4KJO A;  4NXM Q;  1U4M A;  4C1N K;  2BE5 C;  4A4I A;  3Q8D A;  3ZYY X;  1BBW A;  3I2Z A;  1FVI A;  3CXC A;  1U9R A;  2L9H A;  1Y1V G;  1I4Q A;  2L4N A;  1SNQ A;  1IYJ B;  4FNF A;  4DAY B;  1BDO A;  2YYZ A;  1AZP A;  5JEA H;  4JI5 Q;  4R4O A;  3DLL A;  3PIP A;  4R8I A;  1ZEQ X;  4FXD A;  4JG2 A;  3BJU A;  1JE4 A;  1PTO C;  3CME A;  1TWC H;  2IL8 A;  1RTO A;  1JE5 A;  5E4X A;  5ELB A;  1N33 Q;  4XYO A;  2EXD A;  1ET9 A;  3KBG A;  1E0B A;  4K5V A;  5KNC A;  1JT8 A;  4O42 A;  4POF A;  3A0J A;  3CCL A;  2VQF L;  3J81 E;  5ISR A;  4DAM A;  2B2U C;  1EQR A;  4NDX A;  5A35 A;  4N8X 1;  5FO8 B;  5AJ3 L;  2X6G A;  3KF6 B;  1KNE A;  3OSO A;  1LM0 A;  5IOD A;  4QGU A;  3CCM A;  1EOV A;  1GVP A;  1N36 Q;  1EY5 A;  4KN7 C;  5ELE A;  3IRB A;  1JJG A;  4DV1 Q;  1G2S A;  1HFG A;  4P73 A;  4ZK9 B;  3H3V C;  5ELF A;  5C4H A;  4IOA A;  4K0K Q;  1D2B A;  1I4R A;  2WB1 G;  1TQO A;  4R4T A;  4ABN A;  1E7Z A;  2ZJP A;  4LNQ A;  1KLU D;  1V8Q A;  3K81 C;  3DXJ C;  4XIG S;  4CKB A;  1SMY D;  1MGS A;  2F0E A;  2EYJ A;  1IKL A;  1CFM A;  2AHO B;  1EQT A;  5FLX L;  3GO5 A;  4L8J A;  3BDL A;  3D8G A;  2IWH A;  5HUR A;  1B44 D;  3CU7 A;  1Y69 U;  1HZ9 A;  4NXN Q;  4OL7 A;  4CBV A;  4N9P A;  3JAM i;  1B70 B;  1EYD A;  1WI5 A;  1CSQ A;  2PMZ B;  4DR4 Q;  1BOS A;  1RL2 A;  4JYA L;  1E2Z A;  3T53 B;  2YU9 B;  1KDC A;  1ESF A;  1DD2 A;  1NSN S;  3HOU B;  3HOX B;  1K73 C;  1HR0 Q;  1KDA A;  4JI4 L;  5C3X A;  2XRS D;  2F0N A;  5EQ0 A;  3J7Y W;  3PMF A;  1JJ2 A;  4IZ8 A;  4NW2 A;  4ME5 A;  3H15 A;  3NTK A;  1IW7 C;  3CD6 A;  1VCI A;  2RQX A;  3Q22 A;  4A3K B;  3K5L A;  4B3T Q;  3S15 B;  1QWY A;  2B39 A;  4WOR A;  4O2D A;  2WKD A;  1STN A;  2XRQ D;  2K5Q A;  2UXB Q;  4HJ5 A;  5KGU A;  1HQR D;  3P20 A;  3IFD A;  3I70 A;  4DV5 Q;  4EQO A;  2DN8 A;  3QO2 A;  4L5S A;  1VQM A;  2YU9 H;  5DEH A;  1WD1 A;  4PV1 C;  4B3M L;  3HOU H;  2PMZ E;  3HOX H;  3CCS A;  2F0U A;  1MJE A;  1UE1 A;  3CHB D;  4ZUI A;  3E0J A;  2Z6B A;  3LWE A;  4CJ1 B;  5M5X B;  3DM3 A;  5C0X G;  3NE5 B;  1ENA A;  2IW3 A;  1ZYR D;  1ENF A;  4A3K H;  1NBW A;  3S15 H;  5IWA L;  1PHJ A;  1ICF B;  4IUV A;  4GOP A;  3QJY A;  3BS1 A;  2E8G A;  1SNO A;  1KAA A;  1JJC B;  1LAC A;  1HNW L;  3PF4 A;  4JPB W;  2XSC A;  2ZTD A;  2Q2T A;  1CHQ D;  1JIC A;  2B2U A;  4UHV A;  1HRJ A;  3Q23 A;  3S1N B;  3GP7 A;  1NR2 A;  3J81 j;  4OX9 Q;  2UU9 L;  2IHF A;  1F2Y A;  4B9W A;  3PUZ A;  1XMQ Q;  2WII B;  2Z1C A;  5JPM C;  2B2Y C;  1YZ6 A;  1K0R A;  4DR7 Q;  1IZ6 A;  1KLG D;  4LFB Q;  1Q8K A;  3FMC A;  4YHH Q;  1SN8 A;  2JA5 G;  3NBI A;  3K57 A;  1IBL L;  5M5X H;  1SYB A;  2CCZ A;  2GVA A;  4DR3 Q;  4BY1 B;  4ME3 A;  2AUK A;  1I4X A;  2RSN A;  5KYL A;  3S16 B;  3A7A B;  4RWS C;  3C1E A;  3A8K E;  4Y52 H;  1HNX L;  1YIT A;  1IL8 A;  1WCM G;  4L5T A;  1KTK A;  2CVR A;  3KOJ A;  1U0L A;  4JI8 L;  1WTW A;  1STA A;  4APV A;  2F0V A;  5G3L D;  2UUA Q;  1H9K A;  4JV5 L;  3D0F A;  3S1N H;  4LF5 Q;  2CFM A;  1S40 A;  3EJI A;  3DEP A;  1SAP A;  1JOQ A;  2RA4 A;  2NZ1 D;  1MIU A;  4NB3 A;  1SYF A;  2ZJQ A;  4LF8 L;  1Z47 A;  2BE5 D;  4DAV A;  2DNC A;  2K32 A;  2EIF A;  2PNH A;  4WJ3 M;  4OIJ A;  4BY1 H;  2WB1 B;  1E1O A;  1CA5 A;  4DR6 Q;  3S16 H;  3NQT A;  3K5N A;  4L5R C;  5IGE A;  3D6W A;  4J6H A;  5JVG 3;  3VDY A;  3BG3 A;  1PDQ A;  1HUN A;  3U58 A;  3GTO B;  1HUM A;  3SK4 A;  2B2W A;  1SJH D;  3GDE A;  4YCW A;  1IBK L;  5C5M A;  4MHE A;  2XWB B;  2F0S A;  3M4Q A;  3L9A X;  3NUC A;  5I6Y A;  4A3M G;  1VQ9 A;  4Y7N B;  1JQY D;  1CKO A;  2OQ0 A;  1ET6 A;  3VR6 A;  2E5L L;  5CV8 A;  4C3I B;  5LMN Q;  4DA2 A;  4EGV A;  3TSS A;  3W3A A;  1CZG A;  1H9R A;  5FKA C;  1HA6 A;  1PYW D;  1BBU A;  3KFU A;  1H9S B;  4KY6 A;  4JI1 L;  3J7A 5;  2DY7 A;  2XN9 C;  3WWV A;  2F4V L;  2E2I B;  4LFC Q;  2BDN A;  1XPO A;  4KLK A;  2EY1 A;  2J7Z A;  4H44 C;  3CPF A;  4IPG A;  3GTO H;  2WB1 E;  4HJ8 A;  4G7Z C;  4A93 G;  4DV0 L;  1LTG D;  1Y1W B;  4KD3 A;  4L6T B;  4H02 A;  2ZM6 Q;  3M3Y B;  2A19 A;  3S1M B;  1SNM A;  3DMU A;  2JEB I;  3VA7 A;  2OWO A;  2NB0 A;  1SE3 A;  4G57 A;  1B50 A;  1BCP B;  3MHB A;  4Y7N H;  3TRZ A;  1Z9F A;  3R2I A;  4DKA C;  1NJI C;  1GUW A;  4S3S A;  1EY6 A;  1A0I A;  1FNW A;  2HD3 A;  2SOB A;  2NVQ B;  2VW9 A;  4C3I H;  4C56 C;  4OGQ C;  2DUD A;  4X3S A;  1I94 L;  4JI7 L;  1ENC A;  2TMP A;  4OO1 I;  2D5D A;  1HFN A;  5BN4 A;  1MSH A;  4UP9 A;  1WD0 A;  1HNZ L;  2E2I H;  1D8L A;  3OOC A;  4WRD A;  1K8G A;  1A3T A;  5IT9 c;  1K8A C;  1F9P A;  4ALP A;  2F0M A;  4FO2 A;  1FGU A;  5I2X A;  1CQV A;  1IBM L;  1NR4 A;  4X3K A;  1EWI A;  1RD9 D;  4DR2 L;  3GTG B;  2PNR C;  2ZJR A;  1Y1W H;  4YCU A;  1K28 A;  3M3Y H;  2R61 A;  3GD7 A;  2UUC Q;  5HGT A;  4DF7 A;  1N32 Q;  3Q24 A;  4DK1 A;  1C48 A;  4A3C G;  3MC0 B;  5EBD A;  3T56 B;  5C6A A;  2Z6K C;  2EY5 A;  2NVQ H;  4U67 3;  1GUG A;  2F0J A;  4HR7 B;  1SSO A;  2R7F A;  3W1G A;  4CJ2 C;  4OXP A;  3OYY A;  2A6E C;  4PMW A;  2MQH A;  3CRK C;  1EOT A;  5C0X H;  1I3Q B;  4JCV E;  3S14 B;  4PZ8 A;  4B3R L;  3STB C;  3PIP 3;  4DV7 L;  1B9N A;  1LTI D;  2HQE A;  5IP7 H;  5IYD G;  3EBE A;  3GTG H;  2JA7 B;  3KJO A;  1T5X D;  2FMC A;  4JI2 L;  1LV9 A;  4M1U B;  5J3B A;  1SYG A;  4A3E G;  1BVS A;  4PMC A;  4MNO A;  1C9O A;  5EBC A;  1PFN A;  4UPA A;  4OWT B;  4RCN A;  3SDZ A;  1WFQ A;  3JAM E;  3BDO A; 
#chains in the Genus database with same CATH homology
 1A15 A;  3VR5 A;  2KA7 A;  2H4O A;  2WV6 D;  3AMU A;  2FHT A;  4ZYS A;  4E6I A;  4FF1 A;  2QEJ C;  3DWA A;  3KLR A;  5EJW A;  3MXG A;  2EYH A;  3T16 A;  2K5D A;  2F0O A;  3ERQ A;  2VNU D;  4BS9 A;  1PRT B;  1D1K A;  1S5E D;  2N88 A;  4BBS B;  4XDX A;  3S2H B;  1G6Z A;  1S5B D;  4RA8 A;  1Z7T A;  4IUR A;  2JEA I;  3IL8 A;  4KHZ A;  1IYV A;  4A3M B;  4HCE A;  1ILP A;  2QKI C;  1EY7 A;  2K01 A;  1TII D;  1EY4 A;  3QIA A;  1W6J A;  1Q1E A;  4LAA A;  5CV6 A;  4C3J G;  3SHL A;  1X3P A;  3WDN A;  4HSV A;  2G9H D;  4PNY A;  2ENB A;  3CQZ B;  2AWO A;  4RHS A;  1F77 A;  3RD4 A;  3VYR A;  2EYM A;  2F0F A;  5I9P A;  3GQB A;  4QB4 A;  2PW7 A;  1EEF D;  2F0T A;  2L0C A;  3K5O A;  1WTP A;  1O7L A;  3OHX C;  3MWY W;  2ICE C;  3R2T A;  4IQZ A;  3TZU A;  2L11 A;  3MXU A;  2F0K A;  1S5C D;  5G3L F;  4DFA A;  5CR3 A;  5C3W A;  5CMD A;  3K6O A;  3DHQ A;  4KV6 A;  3KF8 A;  3NBH A;  4ODG A;  3C46 A;  2EOT A;  2X6L A;  4DN4 M;  2SNM A;  2TSS A;  1FR3 A;  2Z4H A;  3ONA B;  2NTT A;  2JSO A;  4KI0 A;  5I6W A;  1SJE D;  4HMI A;  4B08 A;  4FVM A;  3S1R B;  1CHP D;  1LTA D;  1Y8O B;  3EVQ A;  1FNU A;  4RKL A;  1SYE A;  5COY A;  2AUJ D;  5FLX E;  3VYT A;  1EWC A;  5D14 A;  3KK7 A;  3G7L A;  1DXM A;  4EQP A;  1EIG A;  2MUY A;  2KCN A;  4ZUJ A;  3J80 L;  5LL6 X;  4DXG A;  3HGB A;  2NWG A;  5A2Q L;  2C5C A;  3OMG A;  3P75 A;  1HHV A;  2O4X A;  2RSO A;  1VMP A;  1H9M A;  2QF7 A;  4KHV A;  2IPK D;  1DZ1 A;  2XVS A;  1AP0 A;  1AN8 A;  3GV6 A;  5CV7 A;  1HTP A;  4IFD J;  2A73 B;  2ID0 A;  5D3D A;  1CTM A;  1D1I A;  2AQ3 B;  1B1Z A;  3FVQ A;  3MEH A;  2O5J C;  3S1Q B;  2A6E D;  1I50 B;  3X3M A;  1D5X C;  3SR1 A;  3K0Y A;  4CJ0 B;  4UDU C;  4HCS A;  1YNN C;  1HQM C;  1JC7 A;  1IHZ A;  1F9Q A;  4JK1 C;  5KYI A;  4ZKC B;  1CQF A;  1C4Q A;  3PO2 B;  3KUP A;  1L0X B;  4WJW A;  2ZXO A;  1Y8N B;  1K8M A;  4XYQ A;  2NN6 G;  2B2V A;  3A56 A;  1X32 A;  4RFB A;  3P7J A;  4QCL A;  2LS0 1;  2LKV A;  1BCP D;  5BN3 A;  4HN7 A;  3A8J E;  2EYP A;  5IGF A;  3I90 A;  1IKM A;  4Z9C B;  1B3A A;  4NP5 A;  2EZV A;  3I72 A;  3BZD B;  1F2L A;  1VDZ A;  1FD7 D;  2HCI A;  3BVM A;  2E2J B;  3L7Z C;  4KY7 A;  4DAP A;  2F03 A;  1STB A;  5I9O A;  4QUF A;  2R92 B;  3MA2 B;  3M85 A;  1FNV A;  1FYC A;  1A2T A;  2FFK B;  3NQI A;  2F1M A;  1ICW A;  1JWU D;  4AYB B;  1SFO B;  4KKT A;  3R8B A;  1NAP A;  2H1E A;  5FO7 B;  2E74 C;  1EYC A;  1A6X A;  3PUW A;  3RZD B;  3H94 A;  1Q12 A;  2PW5 A;  2A6H D;  4V0B A;  1FGB D;  3MXN A;  4XQJ A;  1O80 A;  3SEB A;  1K8O A;  1A3U A;  3DWP A;  1EYA A;  2KEC A;  3BVZ A;  1GJX A;  3I4N B;  4K14 A;  3IAY A;  1YNJ C;  1GXD C;  3OPO A;  2K6A A;  3NHH A;  2I07 B;  4R9W A;  4Q0F A;  4JBW A;  4DK0 A;  3QWN A;  1KAB A;  3O13 A;  4A3I B;  4H13 C;  3FRP B;  5TSS A;  1EEI D;  1C8C A;  4HSP A;  1J9O A;  2ICI A;  3OWE B;  3HP3 A;  5M5Y B;  2BA0 A;  3PO3 B;  3DEO A;  1Y1V B;  4FXK C;  3R3O A;  2M00 A;  4C3H G;  1F2Z A;  3L3O C;  2A69 C;  4K6L A;  4TKO B;  2MPM A;  1JR0 D;  4G4K A;  1RJT A;  1PRT D;  4BBR B;  3T4A C;  2SEB D;  2A74 C;  1O7Z A;  1SEB D;  2RDG A;  4P2C B;  1I4H A;  4BA1 I;  1MI2 A;  4OO1 G;  1PMR A;  2XWJ B;  4H7B A;  2PQE A;  1B4O A;  1M4V A;  1PLF A;  4IFD G;  1O78 A;  2Q8T A;  4F7X A;  1AW7 A;  4X3U A;  4M8A A;  2B8F A;  4G7H C;  3MZ5 A;  4PQX A;  2KVM A;  1R4Q B;  5J39 A;  2NBF A;  1XTC D;  1OXU A;  3K7A B;  3MFY A;  2CHB D;  3D6C A;  1H9J A;  5IIF A;  2OEO A;  2RBM A;  2QIL A;  1GUT A;  1CT1 D;  1EY0 A;  3NTI A;  2GA4 B;  1PTO D;  2F0H A;  1II3 A;  3Q6S A;  1SNC A;  1DOL A;  4QF4 A;  3T51 B;  2K04 A;  5EGT A;  1QJO A;  3URY A;  2MJ8 A;  1JWM D;  2F3V A;  3SK5 A;  1STE A;  2CQA A;  2E2D C;  3QOJ A;  4KMU C;  3D4R A;  1YNN D;  4DXF A;  4LMQ D;  5KIX A;  2JXM B;  5T1G A;  4IUU A;  5C0X I;  5M3M B;  3QOL A;  1LLR D;  1GHK A;  2DNE A;  4IUT A;  1LTT D;  1VF5 C;  1E2V A;  3E5S A;  3WOE A;  3HKZ B;  2DY8 A;  1WTV A;  1U4P A;  4K2L A;  1EFI D;  1OO9 B;  3UI2 A;  5C5L A;  1TU2 B;  2BDO A;  1QB5 D;  2B2Y A;  3A54 A;  3M4Y A;  1UNS A;  1K83 B;  1G91 A;  5COR A;  3BDC A;  2MGS A;  2QCP X;  3P1H A;  4LJZ C;  3TDQ A;  1HCZ A;  4NMZ A;  1JB3 A;  1TS4 A;  2EYO A;  3MAQ A;  4ZAI A;  2ZXR A;  4FYD A;  2ZXP A;  1G8Z D;  5FOB B;  1QNU A;  3TP6 A;  2EVB A;  3S2D B;  1IW7 D;  4RGT A;  2ZT9 C;  3D31 A;  2HUG A;  4I7Z C;  4C3H B;  3SXH A;  2IJ0 A;  4U68 A;  1F9R A;  2L5T A;  2K5W A;  2B2T C;  1BCP F;  1F2M A;  1TY0 A;  2JA5 B;  4O1N A;  3EQL C;  3MFG A;  2RVL A;  1Y8P B;  1GUN A;  4RGN A;  1QCB D;  1WCM B;  1WTX A;  3OMC A;  3RMH A;  4CHT B;  1TT2 A;  2PPB C;  4OIK A;  1LTB D;  2WKC A;  1XXG A;  3NPP A;  3HEJ A;  1DJR D;  1V1P A;  1Q8I A;  3LNN A;  1EL0 A;  4CKC A;  1W6K A;  2EJG C;  3D3R A;  5J1Z A;  3S9W A;  2X69 A;  3J7A F;  5F2D A;  1M8A A;  4ILW A;  2A69 D;  1IYU A;  3GTL B;  3NXW A;  4F87 A;  1SMY C;  1DON A;  1A3V A;  1LT3 D;  5CV5 A;  5E4W C;  3NWT A;  3H91 A;  4K8I A;  4IFD H;  2OXP A;  4HED A;  1TWG B;  2LFN A;  3GTK B;  5I2Y A;  2BOS A;  4DU9 A;  2A68 C;  3NTH A;  1PXU A;  2B8G A;  4YIJ A;  1LTR D;  1D5Z C;  2VB2 X;  3HS0 C;  2F3W A;  2O5I C;  1QOH A;  4KKS A;  3GTQ B;  3HOV B;  4PMB A;  4A93 B;  1I4P A;  1TVX A;  2KCC A;  3J80 E;  1PZJ D;  3A7L A;  3LX0 A;  3GTJ B;  2KEE A;  4KJN A;  1PRT F;  2EPB A;  5A2Q E;  2BA1 A;  4KTA A;  3TME A;  1KNA A;  3HRZ C;  5M5W B;  2R6G A;  1PTO B;  1HXY D;  1Q1B A;  5AFW A;  3VR2 A;  2F0I A;  2K7V A;  3ND9 A;  5J22 A;  4FF4 A;  1PZK D;  3VYU A;  1BUV T;  4K5X A;  2L55 A;  1BXT A;  1GUO A;  2AQ1 B;  4HAE A;  3TBI B;  4K2K A;  4KK7 A;  5KND A;  3HOZ B;  2RDF A;  1S4Z A;  1NCV A;  3K58 A;  4K8J A;  4RH6 A;  1PTO H;  4MIU A;  4HTH A;  3RLF A;  2LY7 A;  4RAU C;  4UAI A;  1U4L A;  1PTO F;  2E75 C;  3RZO B;  1QNK A;  3FEW X;  4A3E B;  1TWH B;  5EKL A;  3RUZ A;  1I6V C;  2HDM A;  2AQ2 B;  5IGD A;  1EQV A;  1STH A;  5C4X B;  5LL6 S;  1SBB B;  2WAQ B;  2EYL A;  3TP7 A;  5EKI A;  4L63 B;  4IUQ A;  1BNZ A;  3OIQ A;  2EDG A;  3GTM B;  2R3Z A;  4A3J B;  5C44 B;  2C9O A;  5E3F A;  3ND8 A;  4IUN A;  3S17 B;  3DM1 A;  2VXW A;  3TP5 A;  5K5P A;  1DCZ A;  3AU7 A;  5KEE A;  2EE1 A;  1DYQ A;  1ONL A;  1SE4 A;  3X3N A;  1NUC A;  3H09 A;  2KJX A;  4I65 A;  2F0W A;  4RGO S;  1AZQ A;  4KY5 A;  4BWG B;  4KD4 A;  3LWU A;  4XT1 B;  3TP8 A;  4C3J B;  1SYC A;  5C4J B;  5IOC A;  1TS2 A;  1SNP A;  2E2H B;  1AEX A;  2PCF B;  2QDB A;  4ID6 A;  5IT9 L;  1BBX C;  3H0G B;  2A5H A;  3VR3 A;  2NVY B;  5IGG A;  2NYZ D;  2CW0 C;  5CV4 A;  1S5D D;  2VB3 X;  1JOK A;  1JWS D;  5ELD A;  2FJ2 A;  4X3T A;  2Z4I A;  5JPN C;  1Q90 A;  4XQN A;  4EVO A;  2L12 A;  3I3C A;  2V4D A;  1WTO A;  2PZU A;  4TSS A;  2IX3 A;  3KBX A;  1PZI D;  1UEA B;  3E6Z X;  2A68 D;  3I4M B;  3FPU B;  4J8Q A;  3NP8 A;  2EJM A;  2EXZ A;  4C3I G;  4C2M B;  2Z8L A;  3SK6 A;  1GOZ A;  5EPL A;  4N9T A;  3VA5 A;  1T5E A;  4ZLT F;  4G7O C;  1WTQ A;  1LT6 D;  3T13 A;  2B2W C;  3F2U A;  2SDF A;  1B2T A;  5CV9 A;  4H0L C;  2K28 A;  3J81 L;  4B9X A;  1A2U A;  3OIP A;  4K5W A;  1G29 1;  3PUX A;  3IFT A;  3WOF A;  2M9V A;  1V1P B;  1EY8 A;  3C3L A;  5DM7 3;  1D5M C;  2MHV A;  3W2D A;  3I91 A;  5BN5 A;  5JAV A;  2NUC A;  5T1I A;  5CGK A;  1Q3L A;  1MD2 D;  2D2C C;  3FPP A;  5JEA J;  3V05 A;  5IGC A;  1V1O A;  4RGM A;  3M7G A;  3NSW A;  2JE6 I;  3SVM A;  4A3G B;  2BCO A;  4K6D A;  2LMC B;  2F0D A;  2NN6 I;  1OXS C;  3SK8 A;  2RDH A;  4RKB A;  1DOK A;  4V19 0;  1LTS D;  5EKK A;  4WFN 3;  3M7N A;  2AWN A;  3CRL C;  2RKS A;  3HZX A;  5EPK A;  3I4L A;  4QMG A;  2HCC A;  2XIW A;  1MSG A;  5CBE E;  1OXV A;  3GV3 A;  1ROD A;  3I73 A;  2VUM B;  4HMJ A;  4FF2 A;  1LT5 D;  4LK1 C;  1VMC A;  3C1F A;  3G6J B;  1DOM A;  1EWH A;  4A3B B;  2KHS A;  5EPJ A;  4A3F B;  2EJF C;  5K36 G;  2O2L D;  2R7Z B;  2Q8I B;  1EU4 A;  1UAP A;  4DAY A;  3DUZ A;  5D65 A;  2EY6 A;  2WAC A;  1G2T A;  1ML0 D;  3IKJ A;  2IT1 A;  4IAL A;  2XNA C;  1STY A;  3HG9 A;  3N52 A;  5IGB A;  1STG A;  1TWF B;  1B53 A;  2OT2 A;  3K5M A;  5FO9 B;  2FMM A;  2NN6 H;  3U9O A;  4KKU A;  3MTS A;  4IUP A;  1CM9 A;  4XXE A;  1WTR A;  1CK1 A;  4EQN A;  3K59 A;  2PYK A;  1ESR A;  1XX8 A;  3V2T A;  3OWF A;  4DNT B;  1RCV D;  4BA2 I;  2WIN B;  4A3D B;  5JOB A;  1RTN A;  2E76 C;  1HPC A;  1V43 A;  2K1B A;  1UUP A;  3TN2 A;  3GTP B;  3U9S A;  2CW0 D;  1CA6 A;  2F0L A;  1ILQ A;  3M4O B;  2JA6 B;  5C3E B;  2JP1 A;  5M9O A;  5LHY 1;  3PIO 3;  1QIL A;  2F0G A;  2K03 A;  2HDL A;  1BQQ T;  3OW7 A;  1OXX K;  4ZQ3 A;  5E1F A;  1R9T B;  1EZ6 A;  1I6H B;  1TR5 A;  3MXP A;  4C1N I;  4IFD I;  4TRD A;  1JOR A;  1I4G A;  4FP5 D;  4ULL A;  1PFB A;  4DGZ A;  3A55 A;  1RHP A;  1SE2 A;  1J8I A;  3QB3 A;  4DNR B;  1ZXT A;  4ZKB B;  2KED A;  1D6E C;  3HOY B;  5M3F B;  1Z6H A;  1TS5 A;  1JOO A;  5NUC A;  1E2W A;  1QG7 A;  3D4W A;  1PFM A;  1RDP D;  3N6R A;  1KDB A;  2WP8 J;  1XYI A;  3QG1 A;  5JEA G;  1YNJ D;  2I46 A;  4RCO A;  3VR4 A;  1WVL A;  2K33 A;  3V96 A;  3MVV A;  1L0Y B;  4XT3 B;  1S5F D;  2NVT B;  2R93 B;  1AFP A;  3TZD A;  3NK9 A;  4XQQ A;  1JCK B;  1EIH A;  1DM0 B;  4J1M A;  2M2L A;  2OF1 A;  1SND A;  2Y0S B;  4IN3 A;  3CKI B;  3C2P A;  4OO1 H;  4GZY C;  3J7A V;  4FXG C;  5JVH 3;  4CGY B;  1BCP C;  1TWA B;  2MP1 A;  3EFX D;  4ZRZ A;  1LAB A;  1TKW B;  3ERO A;  5D3I B;  1TS3 A;  5JJZ A;  2B63 B;  2EYF A;  3BYY B;  1RKN A;  4KN4 C;  1U4R A;  3NWS A;  4TQU S;  3HOW B;  3D4D A;  2D9U A;  1ZKO A;  1GHJ A;  4BY7 B;  4FF3 A;  2F0P A;  4NKL A;  1CI3 M;  4F8M A;  5DAU A;  1R4P B;  3PUY A;  3BVG A;  3A8I E;  3H6M A;  2D62 A;  4OHJ A;  5K36 H;  3Q0A A;  1SYD A;  2KOL A;  2N55 A;  3I8Z A;  4R8N A;  1CZW A;  2EY2 A;  4F88 A;  5CBA E;  2IX0 A;  5I4D A;  2A6H C;  1EY9 A;  1X3Q A;  2SNS A;  3EA6 A;  2G9D A;  5DNF A;  3KLS A;  4QIW B;  4Q5V A;  2B2T A;  1VF7 A;  4XTC S;  1BR9 A;  5FK9 C;  2NVX B;  2F4I A;  1LT4 D;  1HA5 A;  3FDT A;  3VYS A;  3SE0 A;  5C4Z A;  3KLS X;  4CKE A;  1RF2 D;  1ZYR C;  2KUM A;  5CYU A;  3JAM L;  1OXT A;  3FKI B;  1LO5 D;  5ELC A;  5DM6 3;  3ITP A;  2B2V C;  4RHR A;  2NTS A;  1SXT A;  3BYT B;  1XWE A;  2PZW A;  1EU3 A;  1TY2 A;  1EZ8 A;  4QUC A;  2JA8 B;  1H9S A;  2Q8R E;  1BF4 A;  3PV0 A;  1SDF A;  5IT9 E;  1PRT C;  1MBY A;  3PUV A;  5C0X J;  1QE6 A;  2J0T D;  2PO4 A;  2JYO A;  4MN3 A;  1GUS A;  3DWQ A;  2K05 A;  2L1B A;  5CC4 A;  2F0Q A;  3AB9 A;  1O7Y A;  1HTL D;  2IX1 A;  2FIN B;  5KRU A;  1B9M A;  3R93 A;  2PZT A;  2J4X A;  1TWC B;  5KNB A;  1BO0 A;  1F9S A;  2KQ3 A;  4KJO A;  1U4M A;  4C1N K;  2BE5 C;  3ZYY X;  1U9R A;  2L9H A;  1I4Q A;  2L4N A;  1SNQ A;  4FNF A;  1BDO A;  2YYZ A;  1AZP A;  5JEA H;  4R8I A;  1ZEQ X;  4FXD A;  1JE4 A;  1PTO C;  2IL8 A;  1RTO A;  5E4X A;  5ELB A;  4XYO A;  1ET9 A;  3KBG A;  1E0B A;  4K5V A;  5KNC A;  4O42 A;  3J81 E;  5ISR A;  2B2U C;  4NDX A;  5A35 A;  5FO8 B;  2X6G A;  1KNE A;  3OSO A;  5IOD A;  1EY5 A;  4KN7 C;  5ELE A;  1G2S A;  1HFG A;  4ZK9 B;  3H3V C;  5ELF A;  5C4H A;  1D2B A;  1I4R A;  1TQO A;  4ABN A;  1KLU D;  1V8Q A;  3DXJ C;  4XIG S;  4CKB A;  1SMY D;  1MGS A;  2F0E A;  2EYJ A;  1IKL A;  1CFM A;  1EQT A;  5FLX L;  3GO5 A;  4L8J A;  3BDL A;  3D8G A;  2IWH A;  5HUR A;  1B44 D;  3CU7 A;  1Y69 U;  4OL7 A;  4CBV A;  4N9P A;  1EYD A;  2PMZ B;  1BOS A;  1E2Z A;  3T53 B;  2YU9 B;  1KDC A;  1ESF A;  1DD2 A;  1NSN S;  3HOU B;  3HOX B;  1KDA A;  5C3X A;  2XRS D;  2F0N A;  5EQ0 A;  3J7Y W;  3PMF A;  4IZ8 A;  4NW2 A;  4ME5 A;  3NTK A;  1IW7 C;  1VCI A;  2RQX A;  3Q22 A;  4A3K B;  3K5L A;  3S15 B;  1QWY A;  2B39 A;  4WOR A;  2WKD A;  1STN A;  2XRQ D;  2K5Q A;  5KGU A;  1HQR D;  3P20 A;  3IFD A;  3I70 A;  4EQO A;  2DN8 A;  3QO2 A;  5DEH A;  1WD1 A;  4PV1 C;  2F0U A;  3CHB D;  4ZUI A;  3E0J A;  3LWE A;  5M5X B;  4CJ1 B;  5C0X G;  3NE5 B;  1ENA A;  2IW3 A;  1ZYR D;  1ENF A;  4IUV A;  3QJY A;  3BS1 A;  1SNO A;  1KAA A;  1LAC A;  2XSC A;  1CHQ D;  1JIC A;  2B2U A;  1HRJ A;  3Q23 A;  3S1N B;  3GP7 A;  1NR2 A;  1F2Y A;  4B9W A;  3PUZ A;  2WII B;  2Z1C A;  5JPM C;  2B2Y C;  1KLG D;  3FMC A;  3NBI A;  3K57 A;  1SYB A;  4BY1 B;  2AUK A;  1I4X A;  2RSN A;  5KYL A;  3S16 B;  3A7A B;  4RWS C;  3C1E A;  3A8K E;  1IL8 A;  1KTK A;  2CVR A;  1WTW A;  1STA A;  2F0V A;  5G3L D;  1H9K A;  3EJI A;  3DEP A;  1SAP A;  1JOQ A;  2RA4 A;  2NZ1 D;  1SYF A;  1Z47 A;  2BE5 D;  4DAV A;  2DNC A;  2K32 A;  4OIJ A;  2WB1 B;  1CA5 A;  3NQT A;  3K5N A;  5IGE A;  3D6W A;  4J6H A;  5JVG 3;  3BG3 A;  1PDQ A;  1HUN A;  3GTO B;  1HUM A;  3SK4 A;  2B2W A;  1SJH D;  5C5M A;  4MHE A;  2XWB B;  2F0S A;  3L9A X;  3NUC A;  5I6Y A;  4Y7N B;  1JQY D;  1ET6 A;  3VR6 A;  5CV8 A;  4C3I B;  4DA2 A;  4EGV A;  3TSS A;  3W3A A;  1CZG A;  1H9R A;  5FKA C;  1HA6 A;  1PYW D;  1H9S B;  4KY6 A;  2DY7 A;  2XN9 C;  2E2I B;  2BDN A;  2EY1 A;  2J7Z A;  4H44 C;  4G7Z C;  1LTG D;  1Y1W B;  4KD3 A;  4L6T B;  3M3Y B;  3S1M B;  1SNM A;  3DMU A;  2JEB I;  3VA7 A;  2NB0 A;  1SE3 A;  4G57 A;  1B50 A;  1BCP B;  3MHB A;  3R2I A;  1GUW A;  4S3S A;  1EY6 A;  1FNW A;  2SOB A;  2NVQ B;  4C56 C;  4OGQ C;  4X3S A;  1ENC A;  2TMP A;  4OO1 I;  2D5D A;  1HFN A;  5BN4 A;  1MSH A;  1WD0 A;  3OOC A;  4WRD A;  1A3T A;  1F9P A;  2F0M A;  4FO2 A;  5I2X A;  1CQV A;  1NR4 A;  4X3K A;  1RD9 D;  3GTG B;  2PNR C;  2R61 A;  3GD7 A;  5HGT A;  4DF7 A;  3Q24 A;  4DK1 A;  1C48 A;  3MC0 B;  5EBD A;  3T56 B;  5C6A A;  2EY5 A;  4U67 3;  1GUG A;  2F0J A;  4HR7 B;  1SSO A;  4CJ2 C;  2A6E C;  4PMW A;  3CRK C;  1EOT A;  5C0X H;  1I3Q B;  3S14 B;  3PIP 3;  1B9N A;  1LTI D;  2HQE A;  2JA7 B;  1T5X D;  2FMC A;  1LV9 A;  4M1U B;  1SYG A;  4PMC A;  5EBC A;  1PFN A;  4RCN A;  3SDZ A;  3JAM E;  3BDO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...