1ILQA

Cxcr-1 n-terminal peptide bound to interleukin-8 (minimized mean)
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
71
structure length
71
Chain Sequence
AKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords INTERLEUKIN-8 PRECURSOR
publication title Structure of a CXC chemokine-receptor fragment in complex with interleukin-8.
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ilqA00
5EKIA 1MI2A 2DY7A 3DEOA 2N55A 4IURA 1WD0A 2VXWA 4DN4M 2NYZD 1DOKA 1HUNA 1KNAA 2KEEA 1NAPA 2FMMA 2R3ZA 4ZAIA 4RWSC 4ZLTF 3GV3A 1CM9A 1X3QA 5DNFA 1A15A 3HP3A 3P7JA 2K04A 1WTPA 1IKLA 2KECA 1TVXA 4U68A 1QG7A 2EOTA 2KVMA 2B2UC 1B53A 3MTSA 1BF4A 1O7YA 2B2YA 4IUTA 3G7LA 1VMPA 3UI2A 1WTRA 4X3SA 1F9RA 5D14A 1IL8A 1CA5A 1RTNA 2JP1A 4HAEA 2X6LA 4RA8A 1ILQA 2L4NA 2MGSA 4QUCA 2FJ2A 1O80A 1G2SA 2RSNA 4NW2A 5EPJA 1ILPA 4UAIA 1F9SA 3I8ZA 1EQTA 4R9WA 4ZK9B 5CBEE 5E4WC 2H1EA 2B2TA 3TZDA 2B2VC 1RODA 1ZXTA 4X3UA 2K28A 1EL0A 1X32A 1SDFA 4XDXA 1Q3LA 5T1GA 1WTOA 1U4MA 2CVRA 2JYOA 1JE4A 2BDNA 1EOTA 2RVLA 1WTQA 1EIHA 1HFNA 2KEDA 1SAPA 3FDTA 3MWYW 1AZQA 1HA6A 1G6ZA 4XT1B 1BNZA 5CBAE 1PLFA 5CORA 2EE1A 4HCSA 5EPKA 4IUUA 4MN3A 1EIGA 2M2LA 2SDFA 2HCCA 4HEDA 4IUPA 3FPUB 4X3TA 1WTVA 1LV9A 1MSGA 2MPMA 1U4RA 3QO2A 1HUMA 1NCVA 3DM1A 4X3KA 3KBXA 1WD1A 5D65A 3DEPA 5CMDA 1QE6A 1XX8A 1O7ZA 2MJ8A 1MGSA 1PFBA 1GUWA 1QNKA 4ZKCB 3D6WA 5T1IA 2K01A 1M8AA 2NZ1D 2DY8A 4CJ1B 2FHTA 1WTWA 2N88A 1IKMA 2B2YC 2RSOA 2B2WA 1XYIA 4CJ0B 1DZ1A 3ONAB 2X69A 4XT3B 3SVMA 1PFNA 1PFMA 1B2TA 2L9HA 4O42A 1WVLA 1X3PA 3LWEA 2X6GA 1NR2A 2FFKB 3F2UA 1MSHA 4LMQD 1ICWA 1F2LA 2J7ZA 3TN2A 1ESRA 1VMCA 2FINB 2B2TC 3GV6A 4ZKBB 1J8IA 2HDLA 1B4OA 4IUVA 1AP0A 1DONA 2L11A 1J9OA 5EQ0A 2B2UA 5E4XA 1C8CA 2D9UA 5EJWA 1SSOA 4CJ2C 2XIWA 2HCIA 3H91A 1JICA 2L12A 1CA6A 1DOMA 1F9PA 2MP1A 2L1BA 2Q8RE 3R93A 1F9QA 2KUMA 3I91A 1S4ZA 1WTXA 4MHEA 3I3CA 3IL8A 1RTOA 2NWGA 5EPLA 2Q8TA 2IL8A 3I90A 1RHPA 1AZPA 1BBXC 1G91A 1KNEA 1G2TA 2K1BA 5AFWA 3Q6SA 5JJZA 3IFDA 1DOLA 3KUPA 2B2VA 4HSVA 4OIKA 1HRJA 2EPBA 1E0BA 1NR4A 2RA4A 1U4PA 4OIJA 4IUQA 2HUGA 1PDQA 4R8IA 1HFGA 1B3AA 1BO0A 2K05A 1U4LA 2HDMA 2K03A 4RAUC 5COYA 1HHVA 1RJTA 1ML0D 4QUFA 1B50A 2KOLA 3N52A 2B2WC
chains in the Genus database with same CATH superfamily
4XQNA 2A73B 2F0WA 2SNMA 1HUNA 3SK5A 1HJPA 1FYCA 3KF6A 5FLXc 3R2IA 1CI3M 1IW7D 3S16H 4B3RL 2DUDA 1JJ2A 1SYGA 1W6KA 3G6JB 1LTBD 2K5NA 1TS3A 2UUAL 1LT3D 3A7LA 1SNQA 4H7BA 2EY2A 2B2UC 1VQLA 1BF4A 1E3PA 3GTQH 3OIQA 3I4NB 2GN5A 2XSCA 2YV5A 2F4VL 2ID0A 3K7AH 4XYOA 3VR4A 2VW9A 1TS2A 2A69C 4QUCA 4DAYA 2UUAQ 2F3WA 1EYGA 3TZDA 4A3IB 2A6ED 2F0SA 5IYDG 4R4QA 1PRTC 4F88A 3CCSA 1LTID 5BN5A 2F4VQ 1PZKD 1HFNA 2QA4A 2NVTH 3Q23A 2E5LQ 1TT2A 2BA0A 4MN3A 1HA5A 1HPCA 2M2LA 3VR5A 2DNEA 4IJHA 2MPMA 3PO3B 2E2HB 4HTHA 5IYCG 4L5SA 2KHSA 5LL6X 4OL7A 5IT9c 3K5OA 3PUXA 3CD6A 4OONA 3HOUH 2B8FA 1Q81C 2PZUA 1N33L 4XXEA 2X69A 1E2ZA 3MC0B 2ZJRA 4K2KA 3SEBA 3UDIA 3RNUA 4BY7H 3M4YA 2N3SA 3CC4A 2PNRC 1H9MA 4IJLA 1ET9A 5E7NA 5C4JH 4LAAA 2R93H 2IX3A 3H0GB 3K0XA 1EIFA 3KF6B 4M1UB 4Y7NH 3MVVA 1SYDA 1PMRA 5KEEA 1AN8A 2Q2HA 1S4ZA 4C1NI 4U673 4N8FA 1LT5D 2ATWA 4AYBB 4HIDA 5M3FG 2RDGA 2B2VA 2HHHL 4DAYB 5JVG3 4IN3A 4DV3L 2K05A 3HOYB 3VDYA 1SYCA 2L15A 4R4CA 1H9SA 2B2WC 3MFYA 2H5XA 4DK1A 1HQRD 1TY2A 3CHBD 5M5YB 3HOWB 4IURA 1PHJA 3P1HA 2HHHQ 4DN4M 1EYAA 3KF8A 4JI2L 4DV3Q 3NELA 4DR5Q 1YBYA 5DNFA 4GKJL 1VQIA 3J7A5 4A3GB 3MXUA 2BOSA 3I72A 5DM63 1GD7A 2PW5A 3F1ZA 5KNCA 2K14A 4NXNQ 1WTRA 2MQHA 1D5ZC 1YJWA 1PFSA 4DV1L 2X6LA 4GKJQ 2L4NA 3BYYB 1UNSA 3RMHA 4NP5A 4RG1A 1F9SA 5IP9H 3J80c 3MXGA 3HOUG 1TWHB 5M3MG 2VUMB 5C0XI 3RN5A 1HR0L 1Z47A 4OWXB 1JE4A 3D6CA 4DV1Q 3VR2A 3CKIB 2WKDA 1SXTA 1PLFA 5M9OA 4BY7G 2QDLA 4DF7A 4KD3A 3QG1A 1UE5A 1U4RA 1VQ4A 2R93G 1Y8PB 1C48A 2LXJA 4P74A 3RD4A 1BBWA 4F7XA 1HR0Q 2QCPX 3OMGA 4KV6A 1L0XB 3S17H 4QCLA 3ITPA 2AUKA 3PMFA 3KJOA 2NVYB 4R8NA 2YYZA 1SJHD 3K58A 1STYA 1MJCA 3WOFA 3S14B 4FYDA 3AFPA 5C0XJ 2ZXRA 4BXXH 4POGA 1R4QB 1E7ZA 1WFQA 3RZDH 1X3PA 1SNPA 2F0PA 3TEHB 5I6YA 3H09A 2B2TC 2R92H 3TREA 3KF8B 1D1KA 1DGSA 1GKHA 1D5XC 5E4XA 5C3WA 1UEBA 1TY0A 3H91A 1BCPD 5M5WB 1K83H 3K80C 2NWGA 1G91A 1D1IA 2A68C 2K1BA 5J39A 2V4DA 1N36L 2JA9A 3R3OA 1VQPA 3SR1A 4JI0L 1Q8KA 1JB3A 3WDNA 5A2QE 3SGIA 3PIP3 1EZ6A 2PYKA 1CKMA 3KLRA 3C1EA 3DEOA 3UDXA 5HURA 3PIOA 5IP9G 1KNAA 4ZAIA 4JI0Q 5CV5A 1XPUA 3W1GA 4A3BH 3HOZB 1A15A 2C35B 2JSOA 2E2IH 2EOTA 1DD2A 2K32A 1II3A 3EVQA 2LY7A 4A93H 1O7YA 1ET6A 1E22A 3G7LA 3HOVG 4JI7L 4QY7A 1UE6A 4J6HA 4KY6A 3SHLA 1CA5A 1JOKA 3AQQA 3GTMB 2F0IA 3S2HB 1AE3A 4P2CB 1CSQA 3E6ZX 5D3IB 2Y0SE 1VQGA 4A3KB 3KYHC 2C5CA 2G9DA 3NUCA 4GLVB 5FO9B 1TS4A 5T1GA 3J7ZC 4XT1B 4BXXG 3TP8A 3A8KE 2HCCA 3FPUB 4FF3A 4ZUIA 3T4AC 2YTVA 4LUVA 1EY5A 1RKNA 4LW1A 3U9OA 1OO9B 1G291 2AKWB 1EEFD 4GZYC 2JK8A 3CPWA 4BBRG 1X54A 5G3LD 1S40A 4J15A 3TSSA 1QILA 1CFMA 1XYIA 4E6IA 3TMEA 1YNND 1OXXK 3VYRA 2UXBL 4A3CH 2E76C 4A3EG 1RIPA 5FO8B 3PQIA 1F2YA 4L8JA 3M4OH 5EQ0A 3L7ZC 2KHJA 3T53B 4QGUA 5JJIA 4BBSG 3NTIA 4X64L 3RZOB 1B70B 4APVA 2UXBQ 1DOMA 3N6RA 1LTLA 2WINB 3A5ZB 2O5IC 4MHEA 1F2MA 3L3OC 3M85A 2NVXH 4EQPA 3O13A 4A3BG 2MHVA 1L0YB 4DV6L 5CV8A 4IPCA 3I4MH 3QWNA 4IZ8A 3RR5A 2EXZA 4L6TB 4X64Q 1SE3A 3V96A 1V43A 5C5LA 5EAYA 1Q12A 3K57A 4K6DA 3DLLA 1RJTA 3A54A 1PV4A 1Y1WH 4DV6Q 4JI8L 1QB5D 4A3DB 2F0JA 3JAML 1Z6HA 1SR3A 2FMMA 4J8QA 1I6HB 1ENCA 2K04A 4ZYSA 3ERQA 1JOOA 4JI8Q 4DV4L 4JI6L 4X3SA 4DKAC 1QUQA 4KK7A 1W2BA 3EFXD 4OELB 2BDOA 2FJ2A 1G8ZD 3H0GH 1GVPA 2D2CC 3L0OA 4DV4Q 5C44B 4FNFA 3G48A 1ZYRC 4JI6Q 1ZXTA 5GADC 3HZXA 3NWSA 1HR0W 1HZAA 3TS0A 1EFWA 2PMZE 2D62A 4PV1C 5EKLA 4O1NA 5CORA 4GS3A 4X3TA 4A3CG 2CQOA 4A3JH 1TXYA 5FLXL 1SNMA 1SBBB 1QE6A 3I4NG 1XX8A 5IGCA 5C3EH 1SJED 3SK4A 1Y8NB 2F0QA 2IX1A 3CQZB 4PQXA 2F0DA 1Q86C 4C3JH 4A3IG 2JA7B 2E8GA 3OTOQ 1B2TA 4OO1I 2N8NA 3KDFA 3MEFA 1V1OA 1Q82C 4P73A 2FFKB 2E2JH 3H94A 1K8GA 2O2LD 3BZDB 2Y0SB 4WFN3 2EDGA 3W5OA 1EYCA 1JCKB 3HS0C 5CR3A 2Z9HA 3NPPA 4JI5L 2NTSA 2WAQB 4IUNA 2JA5H 1UWVA 3PO3G 1JICA 5C4XB 1N34L 1I94Q 1L2FA 4PG3A 3WWVA 4ZRZA 1WTXA 1KLUD 1K8OA 1K0RA 4FF4A 3OWFA 1W6JA 2R7FA 1ZEQX 1ZKOA 4JI5Q 1TWHH 1H9RA 1WTHA 2B8GA 2XN9C 2VUMH 5IT9L 4DNTB 1QUQB 1TKWB 1NR4A 1U4PA 4R8IA 1SRUA 4JYAQ 2ZJPA 2K50A 3MXNA 3BG3A 2HT1A 5KGUA 4MNOA 5COYA 2Z6KC 1A2TA 4O2DA 1DCZA 1SFOB 1Y1VB 2EYFA 4DR1L 2EYPA 3H0GG 1FGBD 3A55A 3P20A 3PV0A 3F2BA 3ICEA 2KEEA 1BUVT 2OF1A 2ICIA 4ZLTF 4X6AH 4DV7L 3SXHA 3PF4A 4N9TA 2R7ZB 2YU9H 3QJYA 4UP7A 3CW2C 2SNSA 4DR1Q 2LS01 3MTSA 3M4PA 3A7AB 4AYBG 2WP8J 2VQEL 1GUTA 2B2YA 2F0NA 4IUTA 2EYJA 3CP0A 1VMPA 5IP7H 1IL8A 1RTNA 4HJ5A 4HMIA 2ENBA 4LF8L 5FJ8G 1IHZA 3HOYG 4IFDI 5IOCA 1TQOA 4JC0A 5IGBA 4K5WA 3I70A 2ZTEA 5NUCA 2VQEQ 3KDFB 4WORA 2WIIB 4DAMA 2CW0C 2AWNA 3J81i 5M5WH 5BN4A 3HOWG 3GTOB 1Z9FA 3UE1A 4LF8Q 1ESFA 3NXWA 1WOCA 5EPKA 3GTGH 4RKLA 1GHJA 3GQBA 2QDBA 1C0AA 4A3GG 1I4PA 3FRPB 2FMCA 1SYFA 2NTTA 3HRZC 4KN7C 4K0KL 3NSWA 2XRSD 3PO2B 4IFDJ 2QF7A 1OXSC 1VQ8A 2RSOA 3CU7A 2MUYA 3SVMA 4JVZA 1PFMA 1BCPB 4UP8A 4H02A 2HD3A 2VUMG 3MXNB 1NR2A 4K0KQ 1KL9A 5CGKA 3J80L 4AYBE 2FINB 3A56A 2NZHA 2RBMA 2HDLA 2WB1E 2L11A 2SOBA 4Q5VA 4OO1G 2F0MA 2JA6B 3WOEA 1PRTD 4PZ8A 1CTMA 1PH3A 4CJ2C 3RLNA 1KDCA 3S2HH 3S15B 1NY4A 2K7VA 1JC7A 5IYDH 2N78A 2F3IA 4X62L 3J81j 1FD7D 4A3KH 3I90A 1KLGD 4H13C 1NNXA 3HKSA 5AFWA 4UDUC 2ASBA 4GOPC 2EQSA 4DNIA 1K9MC 1LT4D 1N32L 2L5TA 3FPPA 4DXFA 1HFGA 2GVAA 4X62Q 5IP7G 4H0LC 5JOBA 2K03A 1TIID 2FXQA 1NMFA 1B50A 1UAPA 5IYCH 4KKSA 1M4VA 2PQEA 3I73A 2SEBD 4HJ9A 3CCEA 2Z6BA 1CKNB 3DMUA 1PTOF 1KAWA 4X66L 4GKKL 4B9WA 3ND9A 1VQDA 3FVQA 3E3XA 2AHOB 3NE5B 3J81E 3CXCA 3S1QB 1EOVA 4GN3B 1LO5D 2F0TA 1I4QA 2DJFC 2I46A 1V8QA 1JORA 2ZXOA 5BN3A 2PZTA 4GKKQ 3HKZE 2JP1A 4ID6A 4HAEA 4DV0Q 4AQYL 2MGSA 4L5TA 1TWAB 4ZK9B 4K8JA 4WJ4A 1X3FA 1RODA 3IRBA 4DV5L 3NQTA 4V190 1F2ZA 1JQYD 2RVLA 5IGEA 4AQYQ 1C4QA 5M3FH 1BNZA 2NUCA 2EE1A 3HOZG 4IUPA 2B63B 4MIUA 4X3KA 4DV5Q 3NWTA 3BDOA 1TR5A 3K0YA 1OXTA 4XQJA 2E5LL 2CWAA 1P16A 1O7ZA 1JMCA 1PTOB 4JCVE 4ZKCB 3C46A 5T1IA 3AB9A 4KJNA 1U9RA 2DY8A 4DR3Q 2FHTA 2F03A 4A3KG 1S5DD 1U0LA 1SROA 5KRUA 1STNA 2K4KA 3TP5A 1CHPD 1JJCB 3HGBA 2X6GA 3LWEA 1X3GA 1R9TB 3FP9A 4C2MH 1F2LA 1WI5A 4M8AA 3UE0A 3OIPA 1QCBD 5L37A 3CCVA 3E0JA 1EY6A 2M9VA 5IY0A 4WJ3M 2KBNA 5EJWA 3QOLA 3K81C 3G4SA 3DM3A 4J1MA 3A8JE 3HOXB 2F0LA 4JG2A 4DFAA 5M3MH 3IL8A 1IYUA 1RHPA 2IWHA 2QILA 1YVCA 3H15A 3K8AA 1IYVA 4OIJA 5JAVA 1SNCA 5A2QL 4IPDA 4EGVA 1B1ZA 1EEID 4XQQA 4CHTB 1PYSB 1M1KC 1XJVA 2KCNA 1KHIA 3N52A 3DWPA 4RGTA 1O78A 5JVH3 1LTRD 3E9HA 3QIAA 3CCMA 3GV3A 4RMFA 4KHPL 4DUYL 3Q24A 1H95A 1Y14B 4RFBA 3S2DH 3C1FA 1VQ6A 4U68A 1LTGD 2PCFB 1JWSD 3NK9A 2WB1B 2YTXA 4JOIC 5JPMC 3B6YA 2JA7H 3KK7A 4A3LG 5D14A 5CV6A 3T51B 4DR5L 4KHPQ 4DUYQ 4PMBA 2GVBA 2LSSA 1QOHA 2A68D 4JBWA 3URYA 3I4LA 4K5XA 4NXNL 5E1FA 3VYSA 4KKUA 4A3DG 2K75A 3CF5A 2CVRA 1GUSA 2F4IA 1WTQA 2JJQA 3MWYW 4C56C 4QF4A 4DUZL 4KHVA 3ULPA 2MO0A 2EYOA 1I4GA 2AQ1B 1LV9A 2CHBD 3QO2A 1UUPA 4C3IB 4DUZQ 4B3ML 3GTKB 3M7NA 2IW3A 1GUGA 3GTJH 1Q46A 4YCWA 5C44G 5IWAQ 1Q8IA 1TU2B 1YHBA 3HKZB 1K28A 4B3MQ 4ZQ3A 3LGJA 4HMJA 3BZCA 1R4PB 3VA7A 1YNJC 1QJOA 3HOVH 4GN4B 1B3QA 2G9HD 3MZ5A 1P8LA 1KRTA 3M9BA 2B2UA 5LL6S 4KY5A 5KYIA 1KC8C 2BA1A 4NDXA 1CA6A 1A3TA 2KUMA 1RCVD 2EJMA 4JI3Q 4G7OC 3PCOB 4C1NK 4R1JA 2QGQA 4FDBA 1WJJA 1XPOA 1S3OA 4RGMA 4OXPA 2JA7G 1PDQA 2XGTA 4KTAA 5C0XH 4GLAC 3ND8A 2J0TD 1DJRD 5EKIA 2Y0SG 1WD0A 5FLMG 2VB2X 2BE5C 4BBRH 4LF9L 2WAQG 2KENA 5ELCA 1GXDC 5C4XG 4AIMA 4DPGA 3FKIB 4QJFA 2ZTDA 1OXVA 3DHQA 1M90C 4GNXC 1SYBA 2RDFA 4A3EH 4LF9Q 4P75A 4ALPA 2VB3X 4PNYA 2A74C 3GTLB 1KABA 1O80A 2D0PA 4BBSH 1EQTA 4A3MB 1KQSA 3KLSX 1TWCH 1GO3E 2D0OA 1Y1VG 1RD9D 4FF1A 3S15H 3RUZA 1U4MA 2Z8LA 2TSSA 1G6ZA 4B3TL 4BA1I 5LMNW 4IUUA 2R7ZG 2PQAA 2XTIA 2JE6I 1HUMA 1I50B 3NTKA 4LF7L 1MD2D 5D65A 1A2UA 1GUOA 2F0KA 3MHBA 3MXPA 3OSOA 4B3TQ 2MJ8A 1EY8A 4JI4Q 2KQ3A 4K6LA 1X65A 2Q2TA 1S5CD 2K01A 4HIKA 2Z0SA 1HXYD 2F0EA 4BY1B 2JA8B 1PRTB 4IPHA 2WAQE 2B2WA 4LF7Q 1DZ1A 4RCNA 3W1BA 1GUNA 1ONLA 3S1QH 1MSHA 3U50C 2LXKA 3TN2A 1XWEA 5C0XG 3D8GA 1B8AA 4IUVA 1SE4A 4UPAA 2IHEA 2NB0A 2UXCQ 5GAGC 1VQJA 1ZYRD 2EYMA 2K5HA 1PH4A 3R93A 2VY3A 4B08A 1VF5C 5M5XH 1I6VC 2JXMB 4HSPA 3D4WA 3MFGA 2VNUD 1AZPA 3PO2G 3S1MB 3Q6SA 1HCZA 1QVCA 2BH8A 3ZJYC 1HRJA 1Q7YC 3S1NB 1WYDA 2F3VA 4YIJA 3CCUA 1B3AA 3G6EA 2C9OA 3CRKC 1HHVA 3TQYA 3I4NH 1W3SA 1MI2A 2DY7A 4IALA 3TBIB 1KIXA 1BDOA 2JA6G 2R3ZA 1PTOH 1ICFB 2PQAB 4A3IH 3CPFA 1VQKA 3OYYA 1S5ED 5JPNC 1CZWA 2OWOA 3Q22A 5I6WA 2XVSA 3GP7A 1XNRL 1XPRA 2EXDA 1STBA 3GTPB 1ENFA 3GO5A 3PO3H 2UUCL 1UEAB 1VCIA 2E2HH 1JOQA 2B2TA 1ASYA 2EY5A 4WJWA 4X3UA 2K28A 1MBYA 4P71A 2BDNA 2E74C 1XNRQ 3GTQB 2KEDA 2Q8IB 2HIXA 3TRZA 1EU3A 1EFID 1RL2A 1AW7A 2UUCQ 3K7AB 4ME5A 2Z1CA 4YWMA 3KBXA 2CFMA 4LF5L 2QEJC 2E75C 1VQOA 1C7YA 3Q8DA 1EY9A 4ODGA 1XMQL 2WACA 1LABA 5K36G 4LK1C 2NVTB 3D6WA 3STBC 4JBJA 3UDGA 4LF5Q 3TDQA 4IO9A 2LMCB 4O42A 3DXJC 5IYBH 1A8VA 1PXUA 1XMQQ 4I7AA 4ME3A 4KJOA 1JB7A 1BXTA 3DWAA 2NN6I 4MTNA 5K5PA 1LM0A 1DONA 1L1OC 3QOJA 1IBLL 1J9OA 3OTOL 3OMCA 1A6XA 1LT6D 2CW0D 5FJ8H 1HZ9A 3HOYH 1IBKL 2HCIA 2XWBB 1VQEA 2DJGC 1E1TA 3Q0AA 3BYTB 5M5YH 1RTOA 1FNVA 3HOWH 2IL8A 2A8VA 2B3GA 5C4JB 1STGA 1IBLQ 2AWOA 4L5QA 1XMOL 4GN5A 1IBKQ 4IUQA 1I94L 2HIVA 5E3FA 1HNWL 4Y7NB 2HDMA 4FXGC 4V0BA 4A3GH 5KNDA 5CV9A 2OTLA 1RF2D 1FL0A 1XMOQ 5IE8A 4S3SA 3I4OA 3T1YL 1NAPA 1PH7A 2UXDQ 1HNWQ 2O5JC 3J81L 4JYAL 1WTPA 3HOXG 1CZGA 4TQUS 5IODA 1TVXA 2CWPA 1SYEA 2KVMA 4YCVA 3T1YQ 4CDCC 3CC7A 2EYHA 3AFQA 3UI2A 1Q1BA 1YJNA 4KKTA 2KA7A 4OO1H 3E9IA 3BS1A 1DXMA 1E1OA 1GM5A 2L55A 3OW7A 4R9WA 4K2LA 2AQ3B 2XWJB 1WTOA 3S1RB 3E5SA 3AU7A 1EOTA 1EIHA 2A1AA 4CKBA 2AQ2B 2NVYH 3H3VI 1BCPF 5KYLA 5IYBG 3S14H 4DR2L 1WTVA 1VQ5A 1LUZA 2IT1A 2BH2A 1NCVA 3DM1A 3OW2A 5IIFA 1CK1A 1QVGA 2WB1G 4HR7B 4N9PA 2RKSA 4UP9A 1N8RC 4DXGA 3F2CA 3PUZA 5KIXA 4DR2Q 1B9NA 1M8AA 2RHSB 3I56A 4NKLA 1YZ6A 2KCCA 3T13A 4CJ0B 4IOAA 4LFCL 2ZM6L 1CKNA 1B44D 3D4RA 3X3MA 1S5FD 4LMQD 4RGOS 1EY7A 2B39A 4H44C 1KDAA 3HEJA 1J8IA 1NBWA 3L2PA 4LFCQ 2ZM6Q 1LTSD 4L5RC 5DAUA 2RCNA 4OHJA 2I5HA 1O7LA 4C3IG 2L1BA 1I3QB 1F9QA 2I5LX 3GTLH 2NN6G 4WRDA 3RZDB 1YEZA 1S5BD 1VQFA 3NHHA 1KXLA 3IFDA 3DUZA 2R92B 2JQOA 3VYUA 5JEAJ 4HCEA 3G71A 3HOZH 2OT2A 3MEHA 3PIPA 4A76A 5FKAC 1EQQA 4DV2L 3HKZG 1HH2P 5I2XA 1WCMB 1JWMD 3D4DA 4FO2A 2G5DA 1K83B 1I50H 4RHSA 1XXGA 2N55A 2XRQD 3W3AA 2ALYB 2KCTA 3GTMH 5GQOA 1NMGA 4FVMA 4DV2Q 4CBVA 1U5KA 4FP5D 5LMUL 1IKLA 4CDFC 1X9NA 2WFWA 1YHAA 2CH4A 5G3LF 3QR8A 1BR9A 4DK0A 5AJ3L 3K5MA 4RA8A 2K5WA 5LMUQ 5DM73 4CKEA 2AMCB 4LJZC 1VQCA 5I9OA 2B2VC 1STEA 4PZ7A 2MNAA 1JR0D 2LKVA 1YITA 2YTYA 2E2IB 3EJIA 1AH9A 4XDXA 2JEAI 2RQXA 5AJ3Q 4A93B 4DV0L 1SAPA 4UHVA 1PH8A 2PNHA 4DNRB 1LACA 4IQZA 4YY3L 1ENAA 5ELOA 2SDFA 3FKIG 1J6QA 3FMCA 3K59A 2QW7A 2F0UA 1D2BA 4QB4A 3EN2A 1FNUA 3EBEA 4LF6L 5TSSA 3NEMA 1HTPA 3BDLA 1BOSA 1LTAD 1I4HA 1E2VA 1QNKA 4YY3Q 3KOJA 2Z6KA 1LTTD 2A5HA 3RZOH 4A3MG 3ULLA 3IKJA 5HGQA 3EA6A 1PH6A 4LF6Q 4JI1Q 4IFDG 4XYQA 5C4ZA 1VQBA 4KMUC 3F2UA 5LMNL 2EJFC 3J80i 4A3LH 4QL5A 1BQQT 4DR3L 2DNCA 2H4OA 4R4TA 2Z4HA 4IPGA 2UUBL 1C8CA 5ISRA 2F52A 2HQLA 2D9UA 1MJEA 2XIWA 3SK6A 5LMNQ 1OXUA 3BZKA 1FGUA 1XTDA 3GTPH 3SDZA 1PVOA 1CSPA 3PGZA 4A3DH 1KNEA 2UUBQ 1F77A 4YWKA 1GJXA 2O4XA 1NJIC 4BY1G 2JA8G 1AEXA 2EPBA 1I6HH 5H1SE 3M4OB 3BVMA 1CT1D 2A19A 3A5UA 4B3RQ 3J81c 3NENA 2QKIC 1SNDA 1VQNA 2EIFA 2NVXB 3R2TA 2EZVA 2NYZD 3OPOA 2CCZA 3BU2A 4KD4A 1S72A 3HG9A 4RWSC 3I4MB 3KFUA 3RLFA 1IL2A 3HP3A 5C44H 1YNJD 1X3EA 1VQMA 1QG7A 1FNWA 4HN7A 4Z9CB 1Y1WB 4CDEC 1EYDA 1SEBD 4LFAL 5DEHA 1G2SA 5EPJA 4ZCKA 1V1QA 5E4WC 3J7YW 3KLWA 4I65A 1K73C 4HIOA 4LFAQ 4JK1C 1IYJB 1SNOA 1HA6A 3CQZH 4RHRA 3OWEB 5CYUA 2RCFA 4HEDA 5J22A 1STHA 3J80E 2A6HC 1N33Q 4GOPA 1WD1A 1D6EC 3DEPA 3U4ZA 2BE5D 1VDZA 5FOBB 1K8MA 1EY4A 3DWQA 1GUWA 5FLMH 1K3RA 2I07B 2EY1A 1NTGA 1I5FA 4EX5A 1Q90A 1WTWA 4TKOB 5HGTA 2OTJA 5C4XH 1OTCA 4LNQA 4A3JB 4G57A 1IW7C 2EJGC 4CDDC 3ZYYX 3M7GA 4FXKC 4X65L 5C3EB 3VYTA 5IWAL 3TS2A 4C3JB 1F9PA 2Q8RE 3LWUA 1BVSA 5JJKA 4ABNA 1SFOH 3P75A 1Y1VH 4YCUA 4X65Q 2VQFL 4OX9L 2E2JB 1VQHA 2A6EC 5C5MA 1YI2A 1XTCD 3IFTA 3CCQA 3PUVA 5ELDA 3S1RH 4K8IA 2F0VA 2EVBA 2R7ZH 4OWTB 4JI2Q 2JA5B 4JI3L 4JBMA 2VQFQ 4OX9Q 1ML0D 4NB3A 1KAAA 1TWFB 1PH5A 2TMPA 1NSNS 1DM0B 4MZ9A 1EQVA 4DU9A 2F0HA 1CM9A 2JN4A 1X3QA 2N49A 2I5MX 1G6PA 4B3SL 1CQVA 2ZJQA 4KLKA 2OXPA 2KECA 3PSIA 2MO1A 4F8MA 4GOPB 3CRLC 1SE2A 3GTOH 1YNXA 3U9SA 1T9HA 4B3SQ 1ILQA 3EIVA 3PUYA 3M3YB 2IX0A 5JJLA 4UAIA 2ZT9C 5CBEE 1FJGL 3E0EA 2Q2IA 2YU9B 4R4OA 1EL0A 1I4RA 1I3QH 2HQEA 2AUJD 1PRTF 3PO2H 1QZHA 4JPBW 3TZUA 1PYWD 3D0FA 4DR6L 5I2YA 5EBCA 3J7AV 1FJGQ 1H9SB 4QMGA 3BJUA 2PZWA 2IPKD 1X6OA 4C3HB 2R61A 3I55A 3CCRA 1WCMH 1NE3A 2OQ0A 4DR6Q 4HJ8A 1MGSA 3NQIA 1JWUD 2JA6H 3UDFA 5ELFA 3NP8A 3RN2A 3OOCA 3GTGB 4EQ5A 1A0IA 1PFNA 1Y8OB 1WVLA 4F87A 4JI4L 4A3FB 3D31A 5CV7A 5C6AA 4PMWA 5GROA 1N36Q 4JOIA 1HZBA 1PZJD 3V05A 2ZTCA 3I91A 3I3CA 4DGZA 4OEMB 5EPLA 2Q2UA 1J5EL 3GDEA 1T5EA 1V1PA 4DA2A 3JC66 2QEXA 2NVQB 2UXCL 1HTLD 2K6AA 2P5ZX 1DOLA 4ILWA 1EQRA 4OIKA 1E24A 1CHQD 1K0SA 4RAUC 1J5EQ 1PYBA 5F2DA 2K52A 3STBD 3VR3A 1EIYB 1SLJA 1DOKA 5K36H 1JE5A 4JI7Q 4RCOA 3AYHB 1TWAH 4N8X1 4YHHL 4DAVA 4B9XA 4LWCA 1QZGA 2KJXA 4BA2I 3C3LA 3X3NA 3V2TA 2NBFA 1LLRD 2R92G 1F9RA 2PI2E 1QNUA 4YHHQ 1NUCA 2B63H 4NW2A 1IBML 1TWGB 1ILPA 1N9WA 1WCMG 4YWLA 4OGQC 4L63B 1X55A 3J7AF 4Y52H 3L9AX 1EWHA 1GHKA 2D5DA 1SDFA 1Q3LA 2F0FA 1BCPC 2JYOA 3TP6A 5BR8L 3FDTA 1T5XD 1IBMQ 1AFPA 4NMZA 5EKKA 5IGFA 4QIWE 1PTOD 3BVZA 2ICEC 1KTKA 2NZOA 2R6GA 5BR8Q 1R9TH 3K7UC 1PA6A 5J3BA 1V1PB 4DK6C 3S16B 1Y69U 3D3RA 5M3FB 2NZ1D 4NPSA 2B2YC 3KLSA 1A3UA 3HFZB 4XT3B 3CCLA 3HOXH 4A93G 2DN8A 2J7ZA 4ULLA 3PF5A 1EUJA 3SE0A 4R4IA 4PMCA 1TS5A 3BVGA 3K5LA 4QQBX 1SSOA 4GNXA 2K33A 3KBGA 2L12A 5A35A 2MP1A 1B9MA 1Q1EA 2UU9L 2IY5B 4C2MB 3U4VA 2PW7A 5IGDA 1MIUA 1MKHA 5ELEA 4HSVA 1C9OA 3M4QA 3FEWX 3LX0A 2UU9Q 2PI2A 2KOLA 2MFIA 1HNXL 3HOUB 4BWGB 1L0WA 5M3MB 2B63G 4HJAA 1D5MC 1RDPD 4RGNA 4TSSA 2VXWA 3S9WA 4KN4C 3F2DA 3NBHA 4BY7B 1VF7A 5CC4A 2KCMA 1STAA 4JBKA 1YJ9A 1AE2A 4MTKA 3CAMA 1HNXQ 4PZ6A 2R93B 2DGYA 1B53A 3IAYA 3EQLC 2OQKA 1VQ9A 1PH2A 3FHWA 3ER0A 1YNNC 3NBIA 2UXDL 3TP7A 2WV6D 4LFBL 2GA4B 1A62A 2I0QA 1PTOC 3MAQA 2PO4A 4C3IH 3A0JA 3JAMi 2NN6H 3S2DB 3ULJA 2M00A 3SK8A 3GTKH 1X32A 2CKZB 3KJPA 2B29A 2LFNA 1VS0A 4LFBQ 1AZQA 3I4MG 5CBAE 4LUOA 1DYQA 2F0GA 3U58A 4NXML 4HCSA 1EIGA 1SMXA 1KDBA 4GNXB 1KRSA 1HNZL 3T16A 4JV5L 3C2PA 3I2ZA 5I4DA 4DAPA 1Y1WG 1O7IA 2BCOA 3S24A 3BDCA 1QWYA 4NXMQ 4K14A 3LNNA 1TWFH 1EY0A 2L0CA 4HIMA 1HNZQ 2OEOA 4KI0A 1IKMA 2XNAC 4JV5Q 4BS9A 3CMEA 3ONAB 4FXDA 1IXRA 4XTCS 4Q0FA 1N34Q 3R8BA 2E2DC 4AH6A 1K3BC 1ESRA 1EWIA 3GV6A 1B4OA 1AP0A 3MA2B 1JT8A 1I4XA 2IHFA 3GTJB 3OHXC 4OWWB 3AMUA 3NBHB 1BBUA 5HY6A 3M3YH 4P72A 4EQNA 1EWCA 4G4KA 4JW0A 1G2TA 4QIWB 3KUPA 3HOVB 1E0BA 5EBDA 2RA4A 4IOCA 1SN8A 2HUGA 3AEVA 1K8AC 3FKIH 4A3JG 1SMYD 3K6OA 2EY6A 5FO7B 4DV7Q 3S17B 3A8IE 3H3VH 4QUFA 1LYLA 1KD1C 5CV4A 1PH1A 1JJGA 5C3EG 1PZID 5J1ZA 1CQFA 4C3HH 3CCJA 1QVFA 4TVAB 1PH9A 4LF4L 5ELBA 2JEBI 3JAME 4I7ZC 4C3JG 4A3MH 3PUWA 3P7JA 1BKBA 4DR7L 5C4HA 3I7FA 2J4XA 4IFDH 5EGTA 2WKCA 5KNBA 4RH6A 2EYLA 1D8LA 4LF4Q 1D7QA 3T1HL 1CUKA 3VR6A 1H9JA 4A3FH 5JEAH 4FF2A 4BBRB 4G7ZC 5FK9C 2RSNA 2JA5G 2IJ0A 4DR7Q 3I8ZA 5I9PA 5D3DA 3QB3A 2H1EA 2RDHA 2RF4A 1B7YB 2F1MA 1L1OA 3ERSX 3PIO3 1CKOA 3NTHA 3K5NA 3T1HQ 1V9PA 1XNQL 4A3EB 3CC2A 4G7HC 2CH4W 4BY1H 1IZ6A 1GOZA 5LHY1 1VQ7A 2JA8H 2NVQH 3RLOA 1E2WA 2A69D 2VL6A 5IGGA 1X56A 2R7DA 5ELNA 1UE1A 3H6MA 2VS1A 1MSGA 4XIGS 4BBSB 4KY7A 5DLQE 1SE8A 1TWCB 4EVOA 5FLXE 1FR3A 5CMDA 1XNQQ 4TRDA 4UY8C 4ZUJA 2RHQB 2PMZB 1PFBA 4A3BB 4A4IA 1HQMC 1EZ8A 4GLXA 4CJ1B 2N88A 5GAEC 4RKBA 4DK3C 3T56B 5C3XA 4DR4L 2L9HA 1A3VA 1UE7A 3JAMc 4LUZA 2F0OA 1ICWA 3GD7A 3S1MH 1H9KA 1VMCA 1YIJA 1ASZA 4ZKBB 2Z4IA 1HZCA 4HJ7A 4POFA 3S1NH 2VZAA 3F8TA 4DR4Q 1VQAA 5GAHC 4CGYB 1SMYC 4JI1L 1N32Q 2CQAA 4C3HG 4K5VA 1TWGH 1G51A 2Q8TA 2K5QA 2OCEA 1BBXC 3A74A 1Z7TA 4CKCA 5JJZA 2A6HD 3VA5A 1MHWC 2KHIA 3H3VC 1A63A 2PPBC 5IT9E 1YHQA 2ES2A 4X66Q 1BO0A 2K5DA 4EQOA 1EU4A 1U4LA 2K5VA 4KHZA 1FVIA 1L1OB 4O0AA 2ZXPA 4A75A 2V1CC 3W2DA 5JEAG 5M5XB 4A3FG 3CMAA 3EROA
chains in the Genus database with same CATH topology
4XQNA 2A73B 2F0WA 2SNMA 1HUNA 3SK5A 1FYCA 3R2IA 1CI3M 1IW7D 1SYGA 1W6KA 3G6JB 1LTBD 1TS3A 1LT3D 3A7LA 1SNQA 4H7BA 2EY2A 2B2UC 1BF4A 3OIQA 3I4NB 2XSCA 2ID0A 4XYOA 3VR4A 1TS2A 2A69C 4QUCA 4DAYA 2F3WA 3TZDA 4A3IB 2A6ED 2F0SA 1PRTC 4F88A 1LTID 5BN5A 1PZKD 1HFNA 3Q23A 1TT2A 2BA0A 4MN3A 1HA5A 1HPCA 2M2LA 3VR5A 2DNEA 2MPMA 3PO3B 2E2HB 4HTHA 2KHSA 5LL6X 4OL7A 3K5OA 3PUXA 2B8FA 2PZUA 4XXEA 2X69A 1E2ZA 3MC0B 4K2KA 3SEBA 3M4YA 2PNRC 1H9MA 1ET9A 4LAAA 2IX3A 3H0GB 4M1UB 3MVVA 1SYDA 1PMRA 5KEEA 1AN8A 1S4ZA 4C1NI 4U673 1LT5D 4AYBB 2RDGA 2B2VA 4IN3A 2K05A 3HOYB 1SYCA 1H9SA 2B2WC 3MFYA 4DK1A 5M5YB 1HQRD 1TY2A 3CHBD 3HOWB 4IURA 3P1HA 4DN4M 1EYAA 3KF8A 5DNFA 4A3GB 3MXUA 2BOSA 3I72A 5DM63 2PW5A 5KNCA 1WTRA 1D5ZC 2X6LA 2L4NA 3BYYB 1UNSA 3RMHA 4NP5A 1F9SA 3MXGA 1TWHB 2VUMB 5C0XI 1Z47A 1JE4A 3D6CA 3VR2A 3CKIB 2WKDA 1SXTA 1PLFA 5M9OA 4DF7A 4KD3A 3QG1A 1U4RA 1Y8PB 1C48A 3RD4A 4F7XA 2QCPX 3OMGA 4KV6A 1L0XB 4QCLA 3ITPA 2AUKA 3PMFA 2NVYB 4R8NA 2YYZA 1SJHD 3K58A 1STYA 3WOFA 3S14B 4FYDA 5C0XJ 2ZXRA 1R4QB 1X3PA 1SNPA 2F0PA 5I6YA 3H09A 2B2TC 1D1KA 5E4XA 1D5XC 5C3WA 1TY0A 3H91A 1BCPD 5M5WB 2NWGA 1G91A 1D1IA 2A68C 2K1BA 5J39A 2V4DA 3R3OA 3SR1A 1JB3A 3WDNA 5A2QE 3PIP3 1EZ6A 2PYKA 3KLRA 3C1EA 3DEOA 5HURA 1KNAA 4ZAIA 5CV5A 3HOZB 1A15A 2JSOA 2EOTA 1DD2A 2K32A 1II3A 3EVQA 2LY7A 1O7YA 1ET6A 3G7LA 4J6HA 4KY6A 3SHLA 1CA5A 1JOKA 3GTMB 3S2HB 2F0IA 4P2CB 3E6ZX 5D3IB 4A3KB 2C5CA 2G9DA 3NUCA 5FO9B 1TS4A 5T1GA 4XT1B 3TP8A 3A8KE 2HCCA 3FPUB 4FF3A 4ZUIA 3T4AC 1EY5A 1RKNA 3U9OA 1OO9B 1G291 1EEFD 4GZYC 5G3LD 3TSSA 1QILA 1CFMA 1XYIA 4E6IA 3TMEA 1YNND 1OXXK 3VYRA 2E76C 5FO8B 1F2YA 4L8JA 5EQ0A 3L7ZC 3T53B 3NTIA 3RZOB 1DOMA 3N6RA 2WINB 2O5IC 4MHEA 1F2MA 3L3OC 3M85A 4EQPA 3O13A 2MHVA 1L0YB 5CV8A 3QWNA 4IZ8A 2EXZA 4L6TB 1SE3A 3V96A 1V43A 5C5LA 1Q12A 3K57A 4K6DA 1RJTA 3A54A 1QB5D 4A3DB 2F0JA 3JAML 1Z6HA 2FMMA 4J8QA 1I6HB 1ENCA 2K04A 4ZYSA 3ERQA 1JOOA 4X3SA 4KK7A 3EFXD 2BDOA 2FJ2A 1G8ZD 2D2CC 5C44B 4FNFA 1ZYRC 1ZXTA 3HZXA 3NWSA 2D62A 4PV1C 5EKLA 4O1NA 5CORA 4X3TA 5FLXL 1SNMA 1SBBB 1QE6A 1XX8A 5IGCA 1SJED 3SK4A 1Y8NB 2F0QA 2IX1A 3CQZB 4PQXA 2F0DA 2JA7B 1B2TA 4OO1I 1V1OA 2FFKB 3H94A 2O2LD 3BZDB 2Y0SB 4WFN3 2EDGA 1EYCA 1JCKB 3HS0C 5CR3A 3NPPA 2NTSA 2WAQB 4IUNA 1JICA 5C4XB 4ZRZA 1WTXA 1KLUD 1K8OA 4FF4A 3OWFA 1W6JA 1ZEQX 1ZKOA 1H9RA 2B8GA 2XN9C 5IT9L 4DNTB 1TKWB 1NR4A 1U4PA 4R8IA 3MXNA 3BG3A 5KGUA 5COYA 1A2TA 1DCZA 1SFOB 1Y1VB 2EYFA 2EYPA 1FGBD 3A55A 3P20A 3PV0A 2KEEA 1BUVT 2OF1A 2ICIA 4ZLTF 3SXHA 4N9TA 2R7ZB 3QJYA 2SNSA 2LS01 3MTSA 3A7AB 2WP8J 1GUTA 2B2YA 2F0NA 4IUTA 2EYJA 1VMPA 1IL8A 1RTNA 4HMIA 2ENBA 1IHZA 4IFDI 5IOCA 1TQOA 5IGBA 4K5WA 3I70A 5NUCA 4WORA 2WIIB 2CW0C 2AWNA 5BN4A 3GTOB 1ESFA 3NXWA 5EPKA 4RKLA 1GHJA 3GQBA 2QDBA 1I4PA 3FRPB 2FMCA 1SYFA 2NTTA 3HRZC 4KN7C 3NSWA 2XRSD 3PO2B 4IFDJ 2QF7A 1OXSC 2RSOA 3CU7A 2MUYA 3SVMA 1PFMA 1BCPB 1NR2A 5CGKA 3J80L 2FINB 3A56A 2RBMA 2HDLA 4Q5VA 2L11A 2SOBA 4OO1G 2F0MA 2JA6B 3WOEA 1PRTD 1CTMA 4CJ2C 1KDCA 3S15B 2K7VA 1JC7A 1FD7D 3I90A 1KLGD 4H13C 5AFWA 4UDUC 1LT4D 2L5TA 3FPPA 4DXFA 1HFGA 4H0LC 5JOBA 2K03A 1TIID 1B50A 1UAPA 4KKSA 1M4VA 2PQEA 3I73A 2SEBD 3DMUA 1PTOF 4B9WA 3ND9A 3FVQA 3S1QB 3NE5B 3J81E 1LO5D 2F0TA 1I4QA 2I46A 1V8QA 1JORA 2ZXOA 5BN3A 2PZTA 2JP1A 4ID6A 4HAEA 2MGSA 1TWAB 4ZK9B 4K8JA 1RODA 3NQTA 4V190 1F2ZA 1JQYD 2RVLA 5IGEA 1C4QA 1BNZA 2NUCA 2EE1A 4IUPA 2B63B 4MIUA 4X3KA 3NWTA 3BDOA 1TR5A 3K0YA 1OXTA 4XQJA 1O7ZA 1PTOB 4ZKCB 3C46A 5T1IA 3AB9A 4KJNA 1U9RA 2DY8A 2FHTA 2F03A 1S5DD 5KRUA 1STNA 3TP5A 1CHPD 3LWEA 3HGBA 2X6GA 1R9TB 1F2LA 4M8AA 3OIPA 1QCBD 3E0JA 1EY6A 2M9VA 5EJWA 3QOLA 4J1MA 3A8JE 3HOXB 2F0LA 4DFAA 3IL8A 1IYUA 1RHPA 2IWHA 2QILA 1IYVA 4OIJA 5JAVA 1SNCA 5A2QL 4EGVA 1B1ZA 1EEID 4XQQA 4CHTB 2KCNA 3N52A 3DWPA 4RGTA 1O78A 5JVH3 1LTRD 3QIAA 3GV3A 3Q24A 4RFBA 3C1FA 4U68A 1LTGD 2PCFB 1JWSD 2WB1B 3NK9A 5JPMC 3KK7A 5D14A 5CV6A 3T51B 4PMBA 1QOHA 2A68D 4JBWA 3URYA 3I4LA 4K5XA 5E1FA 3VYSA 4KKUA 2CVRA 1GUSA 2F4IA 1WTQA 3MWYW 4C56C 4QF4A 4KHVA 2EYOA 1I4GA 2AQ1B 1LV9A 2CHBD 3QO2A 1UUPA 4C3IB 3GTKB 3M7NA 2IW3A 1GUGA 1Q8IA 1TU2B 3HKZB 4ZQ3A 4HMJA 1R4PB 3VA7A 1YNJC 1QJOA 2G9HD 3MZ5A 2B2UA 5LL6S 4KY5A 5KYIA 2BA1A 4NDXA 1CA6A 1A3TA 2KUMA 1RCVD 2EJMA 4G7OC 4C1NK 4RGMA 1PDQA 4KTAA 5C0XH 3ND8A 2J0TD 1DJRD 5EKIA 1WD0A 2VB2X 2BE5C 5ELCA 1GXDC 3FKIB 1OXVA 3DHQA 1SYBA 2RDFA 2VB3X 4PNYA 2A74C 3GTLB 1KABA 1O80A 1EQTA 4A3MB 3KLSX 1RD9D 4FF1A 3RUZA 1U4MA 2Z8LA 2TSSA 1G6ZA 4BA1I 4IUUA 2JE6I 1HUMA 1I50B 3NTKA 1MD2D 5D65A 1A2UA 1GUOA 2F0KA 3MHBA 3MXPA 3OSOA 2MJ8A 1EY8A 2KQ3A 4K6LA 1S5CD 2K01A 1HXYD 2F0EA 4BY1B 2JA8B 1PRTB 2B2WA 1DZ1A 4RCNA 1GUNA 1ONLA 1MSHA 3TN2A 1XWEA 5C0XG 3D8GA 4IUVA 1SE4A 2NB0A 1ZYRD 2EYMA 3R93A 4B08A 1VF5C 1I6VC 2JXMB 4HSPA 3D4WA 3MFGA 2VNUD 1AZPA 3S1MB 3Q6SA 1HCZA 1HRJA 3S1NB 2F3VA 4YIJA 1B3AA 2C9OA 3CRKC 1HHVA 1MI2A 2DY7A 4IALA 3TBIB 1BDOA 2R3ZA 1PTOH 1S5ED 5JPNC 1CZWA 3Q22A 5I6WA 2XVSA 3GP7A 1STBA 3GTPB 1ENFA 3GO5A 1UEAB 1VCIA 1JOQA 2B2TA 2EY5A 4WJWA 4X3UA 2K28A 1MBYA 2BDNA 2E74C 3GTQB 2KEDA 2Q8IB 1EU3A 1EFID 1AW7A 3K7AB 4ME5A 2Z1CA 3KBXA 2QEJC 2E75C 1EY9A 4ODGA 2WACA 1LABA 5K36G 4LK1C 2NVTB 3D6WA 3TDQA 2LMCB 4O42A 3DXJC 1PXUA 4KJOA 1BXTA 3DWAA 2NN6I 5K5PA 1DONA 3QOJA 1J9OA 3OMCA 1A6XA 1LT6D 2CW0D 2HCIA 2XWBB 3Q0AA 3BYTB 1RTOA 1FNVA 2IL8A 5C4JB 1STGA 2AWOA 4IUQA 5E3FA 4Y7NB 2HDMA 4FXGC 4V0BA 5KNDA 5CV9A 1RF2D 4S3SA 1NAPA 2O5JC 3J81L 1WTPA 1CZGA 4TQUS 5IODA 1TVXA 1SYEA 2KVMA 2EYHA 3UI2A 1Q1BA 4KKTA 2KA7A 4OO1H 3BS1A 1DXMA 2L55A 3OW7A 4R9WA 4K2LA 2AQ3B 2XWJB 1WTOA 3S1RB 3E5SA 3AU7A 1EOTA 1EIHA 4CKBA 2AQ2B 1BCPF 5KYLA 1WTVA 2IT1A 1NCVA 3DM1A 5IIFA 1CK1A 4HR7B 4N9PA 2RKSA 4DXGA 3PUZA 5KIXA 1B9NA 1M8AA 4NKLA 2KCCA 3T13A 4CJ0B 1B44D 3D4RA 3X3MA 1S5FD 4LMQD 4RGOS 1EY7A 2B39A 4H44C 1KDAA 3HEJA 1J8IA 1LTSD 5DAUA 4OHJA 1O7LA 4C3IG 2L1BA 1I3QB 1F9QA 2NN6G 4WRDA 3RZDB 1S5BD 3NHHA 3IFDA 3DUZA 2R92B 3VYUA 5JEAJ 4HCEA 2OT2A 3MEHA 5FKAC 5I2XA 1WCMB 1JWMD 3D4DA 4FO2A 1K83B 4RHSA 1XXGA 2N55A 2XRQD 3W3AA 4FVMA 4CBVA 4FP5D 1IKLA 5G3LF 1BR9A 4DK0A 3K5MA 4RA8A 2K5WA 5DM73 4CKEA 4LJZC 5I9OA 2B2VC 1STEA 1JR0D 2LKVA 2E2IB 3EJIA 4XDXA 2JEAI 2RQXA 4A93B 1SAPA 4DNRB 1LACA 4IQZA 1ENAA 2SDFA 3FMCA 3K59A 2F0UA 1D2BA 4QB4A 1FNUA 5TSSA 1HTPA 3BDLA 1BOSA 1LTAD 1I4HA 1E2VA 1QNKA 1LTTD 2A5HA 3IKJA 3EA6A 4IFDG 4XYQA 5C4ZA 4KMUC 3F2UA 2EJFC 1BQQT 2DNCA 2H4OA 2Z4HA 1C8CA 5ISRA 2D9UA 2XIWA 3SK6A 1OXUA 3SDZA 1KNEA 1F77A 1GJXA 2O4XA 1AEXA 2EPBA 3M4OB 3BVMA 1CT1D 2QKIC 1SNDA 2NVXB 3R2TA 2EZVA 2NYZD 3OPOA 4KD4A 3HG9A 4RWSC 3I4MB 3RLFA 3HP3A 1YNJD 1QG7A 1FNWA 4HN7A 4Z9CB 1Y1WB 1EYDA 1SEBD 5DEHA 1G2SA 5EPJA 5E4WC 3J7YW 4I65A 4JK1C 1SNOA 1HA6A 4RHRA 3OWEB 5CYUA 4HEDA 5J22A 1STHA 3J80E 2A6HC 1WD1A 1D6EC 3DEPA 2BE5D 1VDZA 5FOBB 1K8MA 1EY4A 3DWQA 1GUWA 2I07B 2EY1A 1Q90A 1WTWA 4TKOB 5HGTA 4A3JB 4G57A 1IW7C 2EJGC 3ZYYX 3M7GA 4FXKC 5C3EB 3VYTA 4C3JB 1F9PA 2Q8RE 3LWUA 4ABNA 3P75A 2E2JB 2A6EC 5C5MA 1XTCD 3IFTA 3PUVA 5ELDA 4K8IA 2F0VA 2EVBA 2JA5B 1ML0D 1KAAA 1TWFB 2TMPA 1NSNS 1DM0B 1EQVA 4DU9A 2F0HA 1CM9A 1X3QA 1CQVA 2OXPA 2KECA 4F8MA 3CRLC 1SE2A 3U9SA 1ILQA 3PUYA 3M3YB 2IX0A 4UAIA 2ZT9C 5CBEE 2YU9B 1EL0A 1I4RA 2HQEA 2AUJD 1PRTF 3TZUA 1PYWD 5I2YA 5EBCA 3J7AV 1H9SB 4QMGA 2PZWA 2IPKD 4C3HB 2R61A 1MGSA 3NQIA 1JWUD 5ELFA 3NP8A 3OOCA 3GTGB 1PFNA 1Y8OB 1WVLA 4F87A 4A3FB 3D31A 5CV7A 5C6AA 4PMWA 1PZJD 3V05A 3I91A 3I3CA 4DGZA 5EPLA 1T5EA 1V1PA 4DA2A 2NVQB 1HTLD 2K6AA 1DOLA 4ILWA 4OIKA 1CHQD 4RAUC 5F2DA 3VR3A 1DOKA 5K36H 4RCOA 4DAVA 4B9XA 2KJXA 4BA2I 3C3LA 3X3NA 3V2TA 2NBFA 1LLRD 1F9RA 1QNUA 1NUCA 4NW2A 1ILPA 1TWGB 3J7AF 4OGQC 4L63B 3L9AX 1EWHA 1GHKA 2D5DA 1SDFA 1Q3LA 2F0FA 1BCPC 2JYOA 3TP6A 3FDTA 1T5XD 1AFPA 4NMZA 5EKKA 5IGFA 1PTOD 3BVZA 2ICEC 1KTKA 2R6GA 1V1PB 3S16B 1Y69U 3D3RA 5M3FB 2NZ1D 2B2YC 3KLSA 1A3UA 4XT3B 2DN8A 2J7ZA 4ULLA 3SE0A 4PMCA 1TS5A 3BVGA 3K5LA 1SSOA 2K33A 3KBGA 2L12A 5A35A 2MP1A 1B9MA 1Q1EA 4C2MB 2PW7A 5IGDA 5ELEA 4HSVA 3FEWX 3LX0A 2KOLA 3HOUB 4BWGB 5M3MB 1D5MC 1RDPD 4RGNA 4TSSA 2VXWA 3S9WA 4KN4C 3NBHA 4BY7B 1VF7A 5CC4A 1STAA 2R93B 1B53A 3IAYA 3EQLC 1YNNC 3NBIA 3TP7A 2WV6D 2GA4B 1PTOC 3MAQA 2PO4A 2NN6H 3S2DB 2M00A 3SK8A 1X32A 2LFNA 1AZQA 5CBAE 1DYQA 2F0GA 4HCSA 1EIGA 1KDBA 3T16A 3C2PA 5I4DA 4DAPA 2BCOA 3BDCA 1QWYA 4K14A 3LNNA 1EY0A 2L0CA 2OEOA 4KI0A 1IKMA 2XNAC 4BS9A 3ONAB 4FXDA 4XTCS 4Q0FA 3R8BA 2E2DC 1ESRA 3GV6A 1B4OA 1AP0A 3MA2B 1I4XA 3GTJB 3OHXC 3AMUA 4EQNA 1EWCA 4G4KA 1G2TA 4QIWB 3KUPA 3HOVB 1E0BA 5EBDA 2RA4A 2HUGA 1SMYD 3K6OA 2EY6A 5FO7B 3S17B 3A8IE 4QUFA 5CV4A 1PZID 5J1ZA 1CQFA 5ELBA 2JEBI 3JAME 4I7ZC 4C3JG 3PUWA 3P7JA 5C4HA 4IFDH 2J4XA 5EGTA 2WKCA 5KNBA 4RH6A 2EYLA 3VR6A 1H9JA 5JEAH 4FF2A 4BBRB 4G7ZC 5FK9C 2RSNA 2IJ0A 3I8ZA 5I9PA 5D3DA 3QB3A 2H1EA 2RDHA 2F1MA 3K5NA 3PIO3 3NTHA 4A3EB 4G7HC 1GOZA 5LHY1 1E2WA 2A69D 5IGGA 4XIGS 3H6MA 1MSGA 4BBSB 4KY7A 4EVOA 1TWCB 5FLXE 1FR3A 5CMDA 4TRDA 4ZUJA 2PMZB 1PFBA 4A3BB 1HQMC 1EZ8A 4CJ1B 2N88A 4RKBA 3T56B 5C3XA 2L9HA 1A3VA 2F0OA 1ICWA 3GD7A 1H9KA 1VMCA 4ZKBB 2Z4IA 4CGYB 1SMYC 2CQAA 4C3HG 4K5VA 2Q8TA 2K5QA 1BBXC 1Z7TA 4CKCA 5JJZA 2A6HD 3VA5A 3H3VC 2PPBC 5IT9E 1BO0A 2K5DA 4EQOA 1EU4A 1U4LA 4KHZA 2ZXPA 3W2DA 5JEAG 5M5XB 5JVG3 3EROA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EKI A;  1MI2 A;  2DY7 A;  3DEO A;  2N55 A;  4IUR A;  1WD0 A;  2VXW A;  4DN4 M;  2NYZ D;  1DOK A;  1HUN A;  1KNA A;  2KEE A;  1NAP A;  2FMM A;  2R3Z A;  4ZAI A;  4RWS C;  4ZLT F;  3GV3 A;  1CM9 A;  1X3Q A;  5DNF A;  1A15 A;  3HP3 A;  3P7J A;  2K04 A;  1WTP A;  1IKL A;  2KEC A;  1TVX A;  4U68 A;  1QG7 A;  2EOT A;  2KVM A;  2B2U C;  1B53 A;  3MTS A;  1BF4 A;  1O7Y A;  2B2Y A;  4IUT A;  3G7L A;  1VMP A;  3UI2 A;  1WTR A;  4X3S A;  1F9R A;  5D14 A;  1IL8 A;  1CA5 A;  1RTN A;  2JP1 A;  4HAE A;  2X6L A;  4RA8 A;  1ILQ A;  2L4N A;  2MGS A;  4QUC A;  2FJ2 A;  1O80 A;  1G2S A;  2RSN A;  4NW2 A;  5EPJ A;  1ILP A;  4UAI A;  1F9S A;  3I8Z A;  1EQT A;  4R9W A;  4ZK9 B;  5CBE E;  5E4W C;  2H1E A;  2B2T A;  3TZD A;  2B2V C;  1ROD A;  1ZXT A;  4X3U A;  2K28 A;  1EL0 A;  1X32 A;  1SDF A;  4XDX A;  1Q3L A;  5T1G A;  1WTO A;  1U4M A;  2CVR A;  2JYO A;  1JE4 A;  2BDN A;  1EOT A;  2RVL A;  1WTQ A;  1EIH A;  1HFN A;  2KED A;  1SAP A;  3FDT A;  3MWY W;  1AZQ A;  1HA6 A;  1G6Z A;  4XT1 B;  1BNZ A;  5CBA E;  1PLF A;  5COR A;  2EE1 A;  4HCS A;  5EPK A;  4IUU A;  4MN3 A;  1EIG A;  2M2L A;  2SDF A;  2HCC A;  4HED A;  4IUP A;  3FPU B;  4X3T A;  1WTV A;  1LV9 A;  1MSG A;  2MPM A;  1U4R A;  3QO2 A;  1HUM A;  1NCV A;  3DM1 A;  4X3K A;  3KBX A;  1WD1 A;  5D65 A;  3DEP A;  5CMD A;  1QE6 A;  1XX8 A;  1O7Z A;  2MJ8 A;  1MGS A;  1PFB A;  1GUW A;  1QNK A;  4ZKC B;  3D6W A;  5T1I A;  2K01 A;  1M8A A;  2NZ1 D;  2DY8 A;  4CJ1 B;  2FHT A;  1WTW A;  2N88 A;  1IKM A;  2B2Y C;  2RSO A;  2B2W A;  1XYI A;  4CJ0 B;  1DZ1 A;  3ONA B;  2X69 A;  4XT3 B;  3SVM A;  1PFN A;  1PFM A;  1B2T A;  2L9H A;  4O42 A;  1WVL A;  1X3P A;  3LWE A;  2X6G A;  1NR2 A;  2FFK B;  3F2U A;  1MSH A;  4LMQ D;  1ICW A;  1F2L A;  2J7Z A;  3TN2 A;  1ESR A;  1VMC A;  2FIN B;  2B2T C;  3GV6 A;  4ZKB B;  1J8I A;  2HDL A;  1B4O A;  4IUV A;  1AP0 A;  1DON A;  2L11 A;  1J9O A;  5EQ0 A;  2B2U A;  5E4X A;  1C8C A;  2D9U A;  5EJW A;  1SSO A;  4CJ2 C;  2XIW A;  2HCI A;  3H91 A;  1JIC A;  2L12 A;  1CA6 A;  1DOM A;  1F9P A;  2MP1 A;  2L1B A;  2Q8R E;  3R93 A;  1F9Q A;  2KUM A;  3I91 A;  1S4Z A;  1WTX A;  4MHE A;  3I3C A;  3IL8 A;  1RTO A;  2NWG A;  5EPL A;  2Q8T A;  2IL8 A;  3I90 A;  1RHP A;  1AZP A;  1BBX C;  1G91 A;  1KNE A;  1G2T A;  2K1B A;  5AFW A;  3Q6S A;  5JJZ A;  3IFD A;  1DOL A;  3KUP A;  2B2V A;  4HSV A;  4OIK A;  1HRJ A;  2EPB A;  1E0B A;  1NR4 A;  2RA4 A;  1U4P A;  4OIJ A;  4IUQ A;  2HUG A;  1PDQ A;  4R8I A;  1HFG A;  1B3A A;  1BO0 A;  2K05 A;  1U4L A;  2HDM A;  2K03 A;  4RAU C;  5COY A;  1HHV A;  1RJT A;  1ML0 D;  4QUF A;  1B50 A;  2KOL A;  3N52 A;  2B2W C; 
#chains in the Genus database with same CATH topology
 4XQN A;  2A73 B;  2F0W A;  2SNM A;  1HUN A;  3SK5 A;  1HJP A;  1FYC A;  3KF6 A;  5FLX c;  3R2I A;  1CI3 M;  1IW7 D;  3S16 H;  4B3R L;  2DUD A;  1JJ2 A;  1SYG A;  1W6K A;  3G6J B;  1LTB D;  2K5N A;  1TS3 A;  2UUA L;  1LT3 D;  3A7L A;  1SNQ A;  4H7B A;  2EY2 A;  2B2U C;  1VQL A;  1BF4 A;  1E3P A;  3GTQ H;  3OIQ A;  3I4N B;  2GN5 A;  2XSC A;  2YV5 A;  2F4V L;  2ID0 A;  3K7A H;  4XYO A;  3VR4 A;  2VW9 A;  1TS2 A;  2A69 C;  4QUC A;  4DAY A;  2UUA Q;  2F3W A;  1EYG A;  3TZD A;  4A3I B;  2A6E D;  2F0S A;  5IYD G;  4R4Q A;  1PRT C;  4F88 A;  3CCS A;  1LTI D;  5BN5 A;  2F4V Q;  1PZK D;  1HFN A;  2QA4 A;  2NVT H;  3Q23 A;  2E5L Q;  1TT2 A;  2BA0 A;  4MN3 A;  1HA5 A;  1HPC A;  2M2L A;  3VR5 A;  2DNE A;  4IJH A;  2MPM A;  3PO3 B;  2E2H B;  4HTH A;  5IYC G;  4L5S A;  2KHS A;  5LL6 X;  4OL7 A;  5IT9 c;  3K5O A;  3PUX A;  3CD6 A;  4OON A;  3HOU H;  2B8F A;  1Q81 C;  2PZU A;  1N33 L;  4XXE A;  2X69 A;  1E2Z A;  3MC0 B;  2ZJR A;  4K2K A;  3SEB A;  3UDI A;  3RNU A;  4BY7 H;  3M4Y A;  2N3S A;  3CC4 A;  2PNR C;  1H9M A;  4IJL A;  1ET9 A;  5E7N A;  5C4J H;  4LAA A;  2R93 H;  2IX3 A;  3H0G B;  3K0X A;  1EIF A;  3KF6 B;  4M1U B;  4Y7N H;  3MVV A;  1SYD A;  1PMR A;  5KEE A;  1AN8 A;  2Q2H A;  1S4Z A;  4C1N I;  4U67 3;  4N8F A;  1LT5 D;  2ATW A;  4AYB B;  4HID A;  5M3F G;  2RDG A;  2B2V A;  2HHH L;  4DAY B;  5JVG 3;  4IN3 A;  4DV3 L;  2K05 A;  3HOY B;  3VDY A;  1SYC A;  2L15 A;  4R4C A;  1H9S A;  2B2W C;  3MFY A;  2H5X A;  4DK1 A;  1HQR D;  1TY2 A;  3CHB D;  5M5Y B;  3HOW B;  4IUR A;  1PHJ A;  3P1H A;  2HHH Q;  4DN4 M;  1EYA A;  3KF8 A;  4JI2 L;  4DV3 Q;  3NEL A;  4DR5 Q;  1YBY A;  5DNF A;  4GKJ L;  1VQI A;  3J7A 5;  4A3G B;  3MXU A;  2BOS A;  3I72 A;  5DM6 3;  1GD7 A;  2PW5 A;  3F1Z A;  5KNC A;  2K14 A;  4NXN Q;  1WTR A;  2MQH A;  1D5Z C;  1YJW A;  1PFS A;  4DV1 L;  2X6L A;  4GKJ Q;  2L4N A;  3BYY B;  1UNS A;  3RMH A;  4NP5 A;  4RG1 A;  1F9S A;  5IP9 H;  3J80 c;  3MXG A;  3HOU G;  1TWH B;  5M3M G;  2VUM B;  5C0X I;  3RN5 A;  1HR0 L;  1Z47 A;  4OWX B;  1JE4 A;  3D6C A;  4DV1 Q;  3VR2 A;  3CKI B;  2WKD A;  1SXT A;  1PLF A;  5M9O A;  4BY7 G;  2QDL A;  4DF7 A;  4KD3 A;  3QG1 A;  1UE5 A;  1U4R A;  1VQ4 A;  2R93 G;  1Y8P B;  1C48 A;  2LXJ A;  4P74 A;  3RD4 A;  1BBW A;  4F7X A;  1HR0 Q;  2QCP X;  3OMG A;  4KV6 A;  1L0X B;  3S17 H;  4QCL A;  3ITP A;  2AUK A;  3PMF A;  3KJO A;  2NVY B;  4R8N A;  2YYZ A;  1SJH D;  3K58 A;  1STY A;  1MJC A;  3WOF A;  3S14 B;  4FYD A;  3AFP A;  5C0X J;  2ZXR A;  4BXX H;  4POG A;  1R4Q B;  1E7Z A;  1WFQ A;  3RZD H;  1X3P A;  1SNP A;  2F0P A;  3TEH B;  5I6Y A;  3H09 A;  2B2T C;  2R92 H;  3TRE A;  3KF8 B;  1D1K A;  1DGS A;  1GKH A;  1D5X C;  5E4X A;  5C3W A;  1UEB A;  1TY0 A;  3H91 A;  1BCP D;  5M5W B;  1K83 H;  3K80 C;  2NWG A;  1G91 A;  1D1I A;  2A68 C;  2K1B A;  5J39 A;  2V4D A;  1N36 L;  2JA9 A;  3R3O A;  1VQP A;  3SR1 A;  4JI0 L;  1Q8K A;  1JB3 A;  3WDN A;  5A2Q E;  3SGI A;  3PIP 3;  1EZ6 A;  2PYK A;  1CKM A;  3KLR A;  3C1E A;  3DEO A;  3UDX A;  5HUR A;  3PIO A;  5IP9 G;  1KNA A;  4ZAI A;  4JI0 Q;  5CV5 A;  1XPU A;  3W1G A;  4A3B H;  3HOZ B;  1A15 A;  2C35 B;  2JSO A;  2E2I H;  2EOT A;  1DD2 A;  2K32 A;  1II3 A;  3EVQ A;  2LY7 A;  4A93 H;  1O7Y A;  1ET6 A;  1E22 A;  3G7L A;  3HOV G;  4JI7 L;  4QY7 A;  1UE6 A;  4J6H A;  4KY6 A;  3SHL A;  1CA5 A;  1JOK A;  3AQQ A;  3GTM B;  2F0I A;  3S2H B;  1AE3 A;  4P2C B;  1CSQ A;  3E6Z X;  5D3I B;  2Y0S E;  1VQG A;  4A3K B;  3KYH C;  2C5C A;  2G9D A;  3NUC A;  4GLV B;  5FO9 B;  1TS4 A;  5T1G A;  3J7Z C;  4XT1 B;  4BXX G;  3TP8 A;  3A8K E;  2HCC A;  3FPU B;  4FF3 A;  4ZUI A;  3T4A C;  2YTV A;  4LUV A;  1EY5 A;  1RKN A;  4LW1 A;  3U9O A;  1OO9 B;  1G29 1;  2AKW B;  1EEF D;  4GZY C;  2JK8 A;  3CPW A;  4BBR G;  1X54 A;  5G3L D;  1S40 A;  4J15 A;  3TSS A;  1QIL A;  1CFM A;  1XYI A;  4E6I A;  3TME A;  1YNN D;  1OXX K;  3VYR A;  2UXB L;  4A3C H;  2E76 C;  4A3E G;  1RIP A;  5FO8 B;  3PQI A;  1F2Y A;  4L8J A;  3M4O H;  5EQ0 A;  3L7Z C;  2KHJ A;  3T53 B;  4QGU A;  5JJI A;  4BBS G;  3NTI A;  4X64 L;  3RZO B;  1B70 B;  4APV A;  2UXB Q;  1DOM A;  3N6R A;  1LTL A;  2WIN B;  3A5Z B;  2O5I C;  4MHE A;  1F2M A;  3L3O C;  3M85 A;  2NVX H;  4EQP A;  3O13 A;  4A3B G;  2MHV A;  1L0Y B;  4DV6 L;  5CV8 A;  4IPC A;  3I4M H;  3QWN A;  4IZ8 A;  3RR5 A;  2EXZ A;  4L6T B;  4X64 Q;  1SE3 A;  3V96 A;  1V43 A;  5C5L A;  5EAY A;  1Q12 A;  3K57 A;  4K6D A;  3DLL A;  1RJT A;  3A54 A;  1PV4 A;  1Y1W H;  4DV6 Q;  4JI8 L;  1QB5 D;  4A3D B;  2F0J A;  3JAM L;  1Z6H A;  1SR3 A;  2FMM A;  4J8Q A;  1I6H B;  1ENC A;  2K04 A;  4ZYS A;  3ERQ A;  1JOO A;  4JI8 Q;  4DV4 L;  4JI6 L;  4X3S A;  4DKA C;  1QUQ A;  4KK7 A;  1W2B A;  3EFX D;  4OEL B;  2BDO A;  2FJ2 A;  1G8Z D;  3H0G H;  1GVP A;  2D2C C;  3L0O A;  4DV4 Q;  5C44 B;  4FNF A;  3G48 A;  1ZYR C;  4JI6 Q;  1ZXT A;  5GAD C;  3HZX A;  3NWS A;  1HR0 W;  1HZA A;  3TS0 A;  1EFW A;  2PMZ E;  2D62 A;  4PV1 C;  5EKL A;  4O1N A;  5COR A;  4GS3 A;  4X3T A;  4A3C G;  2CQO A;  4A3J H;  1TXY A;  5FLX L;  1SNM A;  1SBB B;  1QE6 A;  3I4N G;  1XX8 A;  5IGC A;  5C3E H;  1SJE D;  3SK4 A;  1Y8N B;  2F0Q A;  2IX1 A;  3CQZ B;  4PQX A;  2F0D A;  1Q86 C;  4C3J H;  4A3I G;  2JA7 B;  2E8G A;  3OTO Q;  1B2T A;  4OO1 I;  2N8N A;  3KDF A;  3MEF A;  1V1O A;  1Q82 C;  4P73 A;  2FFK B;  2E2J H;  3H94 A;  1K8G A;  2O2L D;  3BZD B;  2Y0S B;  4WFN 3;  2EDG A;  3W5O A;  1EYC A;  1JCK B;  3HS0 C;  5CR3 A;  2Z9H A;  3NPP A;  4JI5 L;  2NTS A;  2WAQ B;  4IUN A;  2JA5 H;  1UWV A;  3PO3 G;  1JIC A;  5C4X B;  1N34 L;  1I94 Q;  1L2F A;  4PG3 A;  3WWV A;  4ZRZ A;  1WTX A;  1KLU D;  1K8O A;  1K0R A;  4FF4 A;  3OWF A;  1W6J A;  2R7F A;  1ZEQ X;  1ZKO A;  4JI5 Q;  1TWH H;  1H9R A;  1WTH A;  2B8G A;  2XN9 C;  2VUM H;  5IT9 L;  4DNT B;  1QUQ B;  1TKW B;  1NR4 A;  1U4P A;  4R8I A;  1SRU A;  4JYA Q;  2ZJP A;  2K50 A;  3MXN A;  3BG3 A;  2HT1 A;  5KGU A;  4MNO A;  5COY A;  2Z6K C;  1A2T A;  4O2D A;  1DCZ A;  1SFO B;  1Y1V B;  2EYF A;  4DR1 L;  2EYP A;  3H0G G;  1FGB D;  3A55 A;  3P20 A;  3PV0 A;  3F2B A;  3ICE A;  2KEE A;  1BUV T;  2OF1 A;  2ICI A;  4ZLT F;  4X6A H;  4DV7 L;  3SXH A;  3PF4 A;  4N9T A;  2R7Z B;  2YU9 H;  3QJY A;  4UP7 A;  3CW2 C;  2SNS A;  4DR1 Q;  2LS0 1;  3MTS A;  3M4P A;  3A7A B;  4AYB G;  2WP8 J;  2VQE L;  1GUT A;  2B2Y A;  2F0N A;  4IUT A;  2EYJ A;  3CP0 A;  1VMP A;  5IP7 H;  1IL8 A;  1RTN A;  4HJ5 A;  4HMI A;  2ENB A;  4LF8 L;  5FJ8 G;  1IHZ A;  3HOY G;  4IFD I;  5IOC A;  1TQO A;  4JC0 A;  5IGB A;  4K5W A;  3I70 A;  2ZTE A;  5NUC A;  2VQE Q;  3KDF B;  4WOR A;  2WII B;  4DAM A;  2CW0 C;  2AWN A;  3J81 i;  5M5W H;  5BN4 A;  3HOW G;  3GTO B;  1Z9F A;  3UE1 A;  4LF8 Q;  1ESF A;  3NXW A;  1WOC A;  5EPK A;  3GTG H;  4RKL A;  1GHJ A;  3GQB A;  2QDB A;  1C0A A;  4A3G G;  1I4P A;  3FRP B;  2FMC A;  1SYF A;  2NTT A;  3HRZ C;  4KN7 C;  4K0K L;  3NSW A;  2XRS D;  3PO2 B;  4IFD J;  2QF7 A;  1OXS C;  1VQ8 A;  2RSO A;  3CU7 A;  2MUY A;  3SVM A;  4JVZ A;  1PFM A;  1BCP B;  4UP8 A;  4H02 A;  2HD3 A;  2VUM G;  3MXN B;  1NR2 A;  4K0K Q;  1KL9 A;  5CGK A;  3J80 L;  4AYB E;  2FIN B;  3A56 A;  2NZH A;  2RBM A;  2HDL A;  2WB1 E;  2L11 A;  2SOB A;  4Q5V A;  4OO1 G;  2F0M A;  2JA6 B;  3WOE A;  1PRT D;  4PZ8 A;  1CTM A;  1PH3 A;  4CJ2 C;  3RLN A;  1KDC A;  3S2H H;  3S15 B;  1NY4 A;  2K7V A;  1JC7 A;  5IYD H;  2N78 A;  2F3I A;  4X62 L;  3J81 j;  1FD7 D;  4A3K H;  3I90 A;  1KLG D;  4H13 C;  1NNX A;  3HKS A;  5AFW A;  4UDU C;  2ASB A;  4GOP C;  2EQS A;  4DNI A;  1K9M C;  1LT4 D;  1N32 L;  2L5T A;  3FPP A;  4DXF A;  1HFG A;  2GVA A;  4X62 Q;  5IP7 G;  4H0L C;  5JOB A;  2K03 A;  1TII D;  2FXQ A;  1NMF A;  1B50 A;  1UAP A;  5IYC H;  4KKS A;  1M4V A;  2PQE A;  3I73 A;  2SEB D;  4HJ9 A;  3CCE A;  2Z6B A;  1CKN B;  3DMU A;  1PTO F;  1KAW A;  4X66 L;  4GKK L;  4B9W A;  3ND9 A;  1VQD A;  3FVQ A;  3E3X A;  2AHO B;  3NE5 B;  3J81 E;  3CXC A;  3S1Q B;  1EOV A;  4GN3 B;  1LO5 D;  2F0T A;  1I4Q A;  2DJF C;  2I46 A;  1V8Q A;  1JOR A;  2ZXO A;  5BN3 A;  2PZT A;  4GKK Q;  3HKZ E;  2JP1 A;  4ID6 A;  4HAE A;  4DV0 Q;  4AQY L;  2MGS A;  4L5T A;  1TWA B;  4ZK9 B;  4K8J A;  4WJ4 A;  1X3F A;  1ROD A;  3IRB A;  4DV5 L;  3NQT A;  4V19 0;  1F2Z A;  1JQY D;  2RVL A;  5IGE A;  4AQY Q;  1C4Q A;  5M3F H;  1BNZ A;  2NUC A;  2EE1 A;  3HOZ G;  4IUP A;  2B63 B;  4MIU A;  4X3K A;  4DV5 Q;  3NWT A;  3BDO A;  1TR5 A;  3K0Y A;  1OXT A;  4XQJ A;  2E5L L;  2CWA A;  1P16 A;  1O7Z A;  1JMC A;  1PTO B;  4JCV E;  4ZKC B;  3C46 A;  5T1I A;  3AB9 A;  4KJN A;  1U9R A;  2DY8 A;  4DR3 Q;  2FHT A;  2F03 A;  4A3K G;  1S5D D;  1U0L A;  1SRO A;  5KRU A;  1STN A;  2K4K A;  3TP5 A;  1CHP D;  1JJC B;  3HGB A;  2X6G A;  3LWE A;  1X3G A;  1R9T B;  3FP9 A;  4C2M H;  1F2L A;  1WI5 A;  4M8A A;  3UE0 A;  3OIP A;  1QCB D;  5L37 A;  3CCV A;  3E0J A;  1EY6 A;  2M9V A;  5IY0 A;  4WJ3 M;  2KBN A;  5EJW A;  3QOL A;  3K81 C;  3G4S A;  3DM3 A;  4J1M A;  3A8J E;  3HOX B;  2F0L A;  4JG2 A;  4DFA A;  5M3M H;  3IL8 A;  1IYU A;  1RHP A;  2IWH A;  2QIL A;  1YVC A;  3H15 A;  3K8A A;  1IYV A;  4OIJ A;  5JAV A;  1SNC A;  5A2Q L;  4IPD A;  4EGV A;  1B1Z A;  1EEI D;  4XQQ A;  4CHT B;  1PYS B;  1M1K C;  1XJV A;  2KCN A;  1KHI A;  3N52 A;  3DWP A;  4RGT A;  1O78 A;  5JVH 3;  1LTR D;  3E9H A;  3QIA A;  3CCM A;  3GV3 A;  4RMF A;  4KHP L;  4DUY L;  3Q24 A;  1H95 A;  1Y14 B;  4RFB A;  3S2D H;  3C1F A;  1VQ6 A;  4U68 A;  1LTG D;  2PCF B;  1JWS D;  3NK9 A;  2WB1 B;  2YTX A;  4JOI C;  5JPM C;  3B6Y A;  2JA7 H;  3KK7 A;  4A3L G;  5D14 A;  5CV6 A;  3T51 B;  4DR5 L;  4KHP Q;  4DUY Q;  4PMB A;  2GVB A;  2LSS A;  1QOH A;  2A68 D;  4JBW A;  3URY A;  3I4L A;  4K5X A;  4NXN L;  5E1F A;  3VYS A;  4KKU A;  4A3D G;  2K75 A;  3CF5 A;  2CVR A;  1GUS A;  2F4I A;  1WTQ A;  2JJQ A;  3MWY W;  4C56 C;  4QF4 A;  4DUZ L;  4KHV A;  3ULP A;  2MO0 A;  2EYO A;  1I4G A;  2AQ1 B;  1LV9 A;  2CHB D;  3QO2 A;  1UUP A;  4C3I B;  4DUZ Q;  4B3M L;  3GTK B;  3M7N A;  2IW3 A;  1GUG A;  3GTJ H;  1Q46 A;  4YCW A;  5C44 G;  5IWA Q;  1Q8I A;  1TU2 B;  1YHB A;  3HKZ B;  1K28 A;  4B3M Q;  4ZQ3 A;  3LGJ A;  4HMJ A;  3BZC A;  1R4P B;  3VA7 A;  1YNJ C;  1QJO A;  3HOV H;  4GN4 B;  1B3Q A;  2G9H D;  3MZ5 A;  1P8L A;  1KRT A;  3M9B A;  2B2U A;  5LL6 S;  4KY5 A;  5KYI A;  1KC8 C;  2BA1 A;  4NDX A;  1CA6 A;  1A3T A;  2KUM A;  1RCV D;  2EJM A;  4JI3 Q;  4G7O C;  3PCO B;  4C1N K;  4R1J A;  2QGQ A;  4FDB A;  1WJJ A;  1XPO A;  1S3O A;  4RGM A;  4OXP A;  2JA7 G;  1PDQ A;  2XGT A;  4KTA A;  5C0X H;  4GLA C;  3ND8 A;  2J0T D;  1DJR D;  5EKI A;  2Y0S G;  1WD0 A;  5FLM G;  2VB2 X;  2BE5 C;  4BBR H;  4LF9 L;  2WAQ G;  2KEN A;  5ELC A;  1GXD C;  5C4X G;  4AIM A;  4DPG A;  3FKI B;  4QJF A;  2ZTD A;  1OXV A;  3DHQ A;  1M90 C;  4GNX C;  1SYB A;  2RDF A;  4A3E H;  4LF9 Q;  4P75 A;  4ALP A;  2VB3 X;  4PNY A;  2A74 C;  3GTL B;  1KAB A;  1O80 A;  2D0P A;  4BBS H;  1EQT A;  4A3M B;  1KQS A;  3KLS X;  1TWC H;  1GO3 E;  2D0O A;  1Y1V G;  1RD9 D;  4FF1 A;  3S15 H;  3RUZ A;  1U4M A;  2Z8L A;  2TSS A;  1G6Z A;  4B3T L;  4BA1 I;  5LMN W;  4IUU A;  2R7Z G;  2PQA A;  2XTI A;  2JE6 I;  1HUM A;  1I50 B;  3NTK A;  4LF7 L;  1MD2 D;  5D65 A;  1A2U A;  1GUO A;  2F0K A;  3MHB A;  3MXP A;  3OSO A;  4B3T Q;  2MJ8 A;  1EY8 A;  4JI4 Q;  2KQ3 A;  4K6L A;  1X65 A;  2Q2T A;  1S5C D;  2K01 A;  4HIK A;  2Z0S A;  1HXY D;  2F0E A;  4BY1 B;  2JA8 B;  1PRT B;  4IPH A;  2WAQ E;  2B2W A;  4LF7 Q;  1DZ1 A;  4RCN A;  3W1B A;  1GUN A;  1ONL A;  3S1Q H;  1MSH A;  3U50 C;  2LXK A;  3TN2 A;  1XWE A;  5C0X G;  3D8G A;  1B8A A;  4IUV A;  1SE4 A;  4UPA A;  2IHE A;  2NB0 A;  2UXC Q;  5GAG C;  1VQJ A;  1ZYR D;  2EYM A;  2K5H A;  1PH4 A;  3R93 A;  2VY3 A;  4B08 A;  1VF5 C;  5M5X H;  1I6V C;  2JXM B;  4HSP A;  3D4W A;  3MFG A;  2VNU D;  1AZP A;  3PO2 G;  3S1M B;  3Q6S A;  1HCZ A;  1QVC A;  2BH8 A;  3ZJY C;  1HRJ A;  1Q7Y C;  3S1N B;  1WYD A;  2F3V A;  4YIJ A;  3CCU A;  1B3A A;  3G6E A;  2C9O A;  3CRK C;  1HHV A;  3TQY A;  3I4N H;  1W3S A;  1MI2 A;  2DY7 A;  4IAL A;  3TBI B;  1KIX A;  1BDO A;  2JA6 G;  2R3Z A;  1PTO H;  1ICF B;  2PQA B;  4A3I H;  3CPF A;  1VQK A;  3OYY A;  1S5E D;  5JPN C;  1CZW A;  2OWO A;  3Q22 A;  5I6W A;  2XVS A;  3GP7 A;  1XNR L;  1XPR A;  2EXD A;  1STB A;  3GTP B;  1ENF A;  3GO5 A;  3PO3 H;  2UUC L;  1UEA B;  1VCI A;  2E2H H;  1JOQ A;  2B2T A;  1ASY A;  2EY5 A;  4WJW A;  4X3U A;  2K28 A;  1MBY A;  4P71 A;  2BDN A;  2E74 C;  1XNR Q;  3GTQ B;  2KED A;  2Q8I B;  2HIX A;  3TRZ A;  1EU3 A;  1EFI D;  1RL2 A;  1AW7 A;  2UUC Q;  3K7A B;  4ME5 A;  2Z1C A;  4YWM A;  3KBX A;  2CFM A;  4LF5 L;  2QEJ C;  2E75 C;  1VQO A;  1C7Y A;  3Q8D A;  1EY9 A;  4ODG A;  1XMQ L;  2WAC A;  1LAB A;  5K36 G;  4LK1 C;  2NVT B;  3D6W A;  3STB C;  4JBJ A;  3UDG A;  4LF5 Q;  3TDQ A;  4IO9 A;  2LMC B;  4O42 A;  3DXJ C;  5IYB H;  1A8V A;  1PXU A;  1XMQ Q;  4I7A A;  4ME3 A;  4KJO A;  1JB7 A;  1BXT A;  3DWA A;  2NN6 I;  4MTN A;  5K5P A;  1LM0 A;  1DON A;  1L1O C;  3QOJ A;  1IBL L;  1J9O A;  3OTO L;  3OMC A;  1A6X A;  1LT6 D;  2CW0 D;  5FJ8 H;  1HZ9 A;  3HOY H;  1IBK L;  2HCI A;  2XWB B;  1VQE A;  2DJG C;  1E1T A;  3Q0A A;  3BYT B;  5M5Y H;  1RTO A;  1FNV A;  3HOW H;  2IL8 A;  2A8V A;  2B3G A;  5C4J B;  1STG A;  1IBL Q;  2AWO A;  4L5Q A;  1XMO L;  4GN5 A;  1IBK Q;  4IUQ A;  1I94 L;  2HIV A;  5E3F A;  1HNW L;  4Y7N B;  2HDM A;  4FXG C;  4V0B A;  4A3G H;  5KND A;  5CV9 A;  2OTL A;  1RF2 D;  1FL0 A;  1XMO Q;  5IE8 A;  4S3S A;  3I4O A;  3T1Y L;  1NAP A;  1PH7 A;  2UXD Q;  1HNW Q;  2O5J C;  3J81 L;  4JYA L;  1WTP A;  3HOX G;  1CZG A;  4TQU S;  5IOD A;  1TVX A;  2CWP A;  1SYE A;  2KVM A;  4YCV A;  3T1Y Q;  4CDC C;  3CC7 A;  2EYH A;  3AFQ A;  3UI2 A;  1Q1B A;  1YJN A;  4KKT A;  2KA7 A;  4OO1 H;  3E9I A;  3BS1 A;  1DXM A;  1E1O A;  1GM5 A;  2L55 A;  3OW7 A;  4R9W A;  4K2L A;  2AQ3 B;  2XWJ B;  1WTO A;  3S1R B;  3E5S A;  3AU7 A;  1EOT A;  1EIH A;  2A1A A;  4CKB A;  2AQ2 B;  2NVY H;  3H3V I;  1BCP F;  5KYL A;  5IYB G;  3S14 H;  4DR2 L;  1WTV A;  1VQ5 A;  1LUZ A;  2IT1 A;  2BH2 A;  1NCV A;  3DM1 A;  3OW2 A;  5IIF A;  1CK1 A;  1QVG A;  2WB1 G;  4HR7 B;  4N9P A;  2RKS A;  4UP9 A;  1N8R C;  4DXG A;  3F2C A;  3PUZ A;  5KIX A;  4DR2 Q;  1B9N A;  1M8A A;  2RHS B;  3I56 A;  4NKL A;  1YZ6 A;  2KCC A;  3T13 A;  4CJ0 B;  4IOA A;  4LFC L;  2ZM6 L;  1CKN A;  1B44 D;  3D4R A;  3X3M A;  1S5F D;  4LMQ D;  4RGO S;  1EY7 A;  2B39 A;  4H44 C;  1KDA A;  3HEJ A;  1J8I A;  1NBW A;  3L2P A;  4LFC Q;  2ZM6 Q;  1LTS D;  4L5R C;  5DAU A;  2RCN A;  4OHJ A;  2I5H A;  1O7L A;  4C3I G;  2L1B A;  1I3Q B;  1F9Q A;  2I5L X;  3GTL H;  2NN6 G;  4WRD A;  3RZD B;  1YEZ A;  1S5B D;  1VQF A;  3NHH A;  1KXL A;  3IFD A;  3DUZ A;  2R92 B;  2JQO A;  3VYU A;  5JEA J;  4HCE A;  3G71 A;  3HOZ H;  2OT2 A;  3MEH A;  3PIP A;  4A76 A;  5FKA C;  1EQQ A;  4DV2 L;  3HKZ G;  1HH2 P;  5I2X A;  1WCM B;  1JWM D;  3D4D A;  4FO2 A;  2G5D A;  1K83 B;  1I50 H;  4RHS A;  1XXG A;  2N55 A;  2XRQ D;  3W3A A;  2ALY B;  2KCT A;  3GTM H;  5GQO A;  1NMG A;  4FVM A;  4DV2 Q;  4CBV A;  1U5K A;  4FP5 D;  5LMU L;  1IKL A;  4CDF C;  1X9N A;  2WFW A;  1YHA A;  2CH4 A;  5G3L F;  3QR8 A;  1BR9 A;  4DK0 A;  5AJ3 L;  3K5M A;  4RA8 A;  2K5W A;  5LMU Q;  5DM7 3;  4CKE A;  2AMC B;  4LJZ C;  1VQC A;  5I9O A;  2B2V C;  1STE A;  4PZ7 A;  2MNA A;  1JR0 D;  2LKV A;  1YIT A;  2YTY A;  2E2I B;  3EJI A;  1AH9 A;  4XDX A;  2JEA I;  2RQX A;  5AJ3 Q;  4A93 B;  4DV0 L;  1SAP A;  4UHV A;  1PH8 A;  2PNH A;  4DNR B;  1LAC A;  4IQZ A;  4YY3 L;  1ENA A;  5ELO A;  2SDF A;  3FKI G;  1J6Q A;  3FMC A;  3K59 A;  2QW7 A;  2F0U A;  1D2B A;  4QB4 A;  3EN2 A;  1FNU A;  3EBE A;  4LF6 L;  5TSS A;  3NEM A;  1HTP A;  3BDL A;  1BOS A;  1LTA D;  1I4H A;  1E2V A;  1QNK A;  4YY3 Q;  3KOJ A;  2Z6K A;  1LTT D;  2A5H A;  3RZO H;  4A3M G;  3ULL A;  3IKJ A;  5HGQ A;  3EA6 A;  1PH6 A;  4LF6 Q;  4JI1 Q;  4IFD G;  4XYQ A;  5C4Z A;  1VQB A;  4KMU C;  3F2U A;  5LMN L;  2EJF C;  3J80 i;  4A3L H;  4QL5 A;  1BQQ T;  4DR3 L;  2DNC A;  2H4O A;  4R4T A;  2Z4H A;  4IPG A;  2UUB L;  1C8C A;  5ISR A;  2F52 A;  2HQL A;  2D9U A;  1MJE A;  2XIW A;  3SK6 A;  5LMN Q;  1OXU A;  3BZK A;  1FGU A;  1XTD A;  3GTP H;  3SDZ A;  1PVO A;  1CSP A;  3PGZ A;  4A3D H;  1KNE A;  2UUB Q;  1F77 A;  4YWK A;  1GJX A;  2O4X A;  1NJI C;  4BY1 G;  2JA8 G;  1AEX A;  2EPB A;  1I6H H;  5H1S E;  3M4O B;  3BVM A;  1CT1 D;  2A19 A;  3A5U A;  4B3R Q;  3J81 c;  3NEN A;  2QKI C;  1SND A;  1VQN A;  2EIF A;  2NVX B;  3R2T A;  2EZV A;  2NYZ D;  3OPO A;  2CCZ A;  3BU2 A;  4KD4 A;  1S72 A;  3HG9 A;  4RWS C;  3I4M B;  3KFU A;  3RLF A;  1IL2 A;  3HP3 A;  5C44 H;  1YNJ D;  1X3E A;  1VQM A;  1QG7 A;  1FNW A;  4HN7 A;  4Z9C B;  1Y1W B;  4CDE C;  1EYD A;  1SEB D;  4LFA L;  5DEH A;  1G2S A;  5EPJ A;  4ZCK A;  1V1Q A;  5E4W C;  3J7Y W;  3KLW A;  4I65 A;  1K73 C;  4HIO A;  4LFA Q;  4JK1 C;  1IYJ B;  1SNO A;  1HA6 A;  3CQZ H;  4RHR A;  3OWE B;  5CYU A;  2RCF A;  4HED A;  5J22 A;  1STH A;  3J80 E;  2A6H C;  1N33 Q;  4GOP A;  1WD1 A;  1D6E C;  3DEP A;  3U4Z A;  2BE5 D;  1VDZ A;  5FOB B;  1K8M A;  1EY4 A;  3DWQ A;  1GUW A;  5FLM H;  1K3R A;  2I07 B;  2EY1 A;  1NTG A;  1I5F A;  4EX5 A;  1Q90 A;  1WTW A;  4TKO B;  5HGT A;  2OTJ A;  5C4X H;  1OTC A;  4LNQ A;  4A3J B;  4G57 A;  1IW7 C;  2EJG C;  4CDD C;  3ZYY X;  3M7G A;  4FXK C;  4X65 L;  5C3E B;  3VYT A;  5IWA L;  3TS2 A;  4C3J B;  1F9P A;  2Q8R E;  3LWU A;  1BVS A;  5JJK A;  4ABN A;  1SFO H;  3P75 A;  1Y1V H;  4YCU A;  4X65 Q;  2VQF L;  4OX9 L;  2E2J B;  1VQH A;  2A6E C;  5C5M A;  1YI2 A;  1XTC D;  3IFT A;  3CCQ A;  3PUV A;  5ELD A;  3S1R H;  4K8I A;  2F0V A;  2EVB A;  2R7Z H;  4OWT B;  4JI2 Q;  2JA5 B;  4JI3 L;  4JBM A;  2VQF Q;  4OX9 Q;  1ML0 D;  4NB3 A;  1KAA A;  1TWF B;  1PH5 A;  2TMP A;  1NSN S;  1DM0 B;  4MZ9 A;  1EQV A;  4DU9 A;  2F0H A;  1CM9 A;  2JN4 A;  1X3Q A;  2N49 A;  2I5M X;  1G6P A;  4B3S L;  1CQV A;  2ZJQ A;  4KLK A;  2OXP A;  2KEC A;  3PSI A;  2MO1 A;  4F8M A;  4GOP B;  3CRL C;  1SE2 A;  3GTO H;  1YNX A;  3U9S A;  1T9H A;  4B3S Q;  1ILQ A;  3EIV A;  3PUY A;  3M3Y B;  2IX0 A;  5JJL A;  4UAI A;  2ZT9 C;  5CBE E;  1FJG L;  3E0E A;  2Q2I A;  2YU9 B;  4R4O A;  1EL0 A;  1I4R A;  1I3Q H;  2HQE A;  2AUJ D;  1PRT F;  3PO2 H;  1QZH A;  4JPB W;  3TZU A;  1PYW D;  3D0F A;  4DR6 L;  5I2Y A;  5EBC A;  3J7A V;  1FJG Q;  1H9S B;  4QMG A;  3BJU A;  2PZW A;  2IPK D;  1X6O A;  4C3H B;  2R61 A;  3I55 A;  3CCR A;  1WCM H;  1NE3 A;  2OQ0 A;  4DR6 Q;  4HJ8 A;  1MGS A;  3NQI A;  1JWU D;  2JA6 H;  3UDF A;  5ELF A;  3NP8 A;  3RN2 A;  3OOC A;  3GTG B;  4EQ5 A;  1A0I A;  1PFN A;  1Y8O B;  1WVL A;  4F87 A;  4JI4 L;  4A3F B;  3D31 A;  5CV7 A;  5C6A A;  4PMW A;  5GRO A;  1N36 Q;  4JOI A;  1HZB A;  1PZJ D;  3V05 A;  2ZTC A;  3I91 A;  3I3C A;  4DGZ A;  4OEM B;  5EPL A;  2Q2U A;  1J5E L;  3GDE A;  1T5E A;  1V1P A;  4DA2 A;  3JC6 6;  2QEX A;  2NVQ B;  2UXC L;  1HTL D;  2K6A A;  2P5Z X;  1DOL A;  4ILW A;  1EQR A;  4OIK A;  1E24 A;  1CHQ D;  1K0S A;  4RAU C;  1J5E Q;  1PYB A;  5F2D A;  2K52 A;  3STB D;  3VR3 A;  1EIY B;  1SLJ A;  1DOK A;  5K36 H;  1JE5 A;  4JI7 Q;  4RCO A;  3AYH B;  1TWA H;  4N8X 1;  4YHH L;  4DAV A;  4B9X A;  4LWC A;  1QZG A;  2KJX A;  4BA2 I;  3C3L A;  3X3N A;  3V2T A;  2NBF A;  1LLR D;  2R92 G;  1F9R A;  2PI2 E;  1QNU A;  4YHH Q;  1NUC A;  2B63 H;  4NW2 A;  1IBM L;  1TWG B;  1ILP A;  1N9W A;  1WCM G;  4YWL A;  4OGQ C;  4L63 B;  1X55 A;  3J7A F;  4Y52 H;  3L9A X;  1EWH A;  1GHK A;  2D5D A;  1SDF A;  1Q3L A;  2F0F A;  1BCP C;  2JYO A;  3TP6 A;  5BR8 L;  3FDT A;  1T5X D;  1IBM Q;  1AFP A;  4NMZ A;  5EKK A;  5IGF A;  4QIW E;  1PTO D;  3BVZ A;  2ICE C;  1KTK A;  2NZO A;  2R6G A;  5BR8 Q;  1R9T H;  3K7U C;  1PA6 A;  5J3B A;  1V1P B;  4DK6 C;  3S16 B;  1Y69 U;  3D3R A;  5M3F B;  2NZ1 D;  4NPS A;  2B2Y C;  3KLS A;  1A3U A;  3HFZ B;  4XT3 B;  3CCL A;  3HOX H;  4A93 G;  2DN8 A;  2J7Z A;  4ULL A;  3PF5 A;  1EUJ A;  3SE0 A;  4R4I A;  4PMC A;  1TS5 A;  3BVG A;  3K5L A;  4QQB X;  1SSO A;  4GNX A;  2K33 A;  3KBG A;  2L12 A;  5A35 A;  2MP1 A;  1B9M A;  1Q1E A;  2UU9 L;  2IY5 B;  4C2M B;  3U4V A;  2PW7 A;  5IGD A;  1MIU A;  1MKH A;  5ELE A;  4HSV A;  1C9O A;  3M4Q A;  3FEW X;  3LX0 A;  2UU9 Q;  2PI2 A;  2KOL A;  2MFI A;  1HNX L;  3HOU B;  4BWG B;  1L0W A;  5M3M B;  2B63 G;  4HJA A;  1D5M C;  1RDP D;  4RGN A;  4TSS A;  2VXW A;  3S9W A;  4KN4 C;  3F2D A;  3NBH A;  4BY7 B;  1VF7 A;  5CC4 A;  2KCM A;  1STA A;  4JBK A;  1YJ9 A;  1AE2 A;  4MTK A;  3CAM A;  1HNX Q;  4PZ6 A;  2R93 B;  2DGY A;  1B53 A;  3IAY A;  3EQL C;  2OQK A;  1VQ9 A;  1PH2 A;  3FHW A;  3ER0 A;  1YNN C;  3NBI A;  2UXD L;  3TP7 A;  2WV6 D;  4LFB L;  2GA4 B;  1A62 A;  2I0Q A;  1PTO C;  3MAQ A;  2PO4 A;  4C3I H;  3A0J A;  3JAM i;  2NN6 H;  3S2D B;  3ULJ A;  2M00 A;  3SK8 A;  3GTK H;  1X32 A;  2CKZ B;  3KJP A;  2B29 A;  2LFN A;  1VS0 A;  4LFB Q;  1AZQ A;  3I4M G;  5CBA E;  4LUO A;  1DYQ A;  2F0G A;  3U58 A;  4NXM L;  4HCS A;  1EIG A;  1SMX A;  1KDB A;  4GNX B;  1KRS A;  1HNZ L;  3T16 A;  4JV5 L;  3C2P A;  3I2Z A;  5I4D A;  4DAP A;  1Y1W G;  1O7I A;  2BCO A;  3S24 A;  3BDC A;  1QWY A;  4NXM Q;  4K14 A;  3LNN A;  1TWF H;  1EY0 A;  2L0C A;  4HIM A;  1HNZ Q;  2OEO A;  4KI0 A;  1IKM A;  2XNA C;  4JV5 Q;  4BS9 A;  3CME A;  3ONA B;  4FXD A;  1IXR A;  4XTC S;  4Q0F A;  1N34 Q;  3R8B A;  2E2D C;  4AH6 A;  1K3B C;  1ESR A;  1EWI A;  3GV6 A;  1B4O A;  1AP0 A;  3MA2 B;  1JT8 A;  1I4X A;  2IHF A;  3GTJ B;  3OHX C;  4OWW B;  3AMU A;  3NBH B;  1BBU A;  5HY6 A;  3M3Y H;  4P72 A;  4EQN A;  1EWC A;  4G4K A;  4JW0 A;  1G2T A;  4QIW B;  3KUP A;  3HOV B;  1E0B A;  5EBD A;  2RA4 A;  4IOC A;  1SN8 A;  2HUG A;  3AEV A;  1K8A C;  3FKI H;  4A3J G;  1SMY D;  3K6O A;  2EY6 A;  5FO7 B;  4DV7 Q;  3S17 B;  3A8I E;  3H3V H;  4QUF A;  1LYL A;  1KD1 C;  5CV4 A;  1PH1 A;  1JJG A;  5C3E G;  1PZI D;  5J1Z A;  1CQF A;  4C3H H;  3CCJ A;  1QVF A;  4TVA B;  1PH9 A;  4LF4 L;  5ELB A;  2JEB I;  3JAM E;  4I7Z C;  4C3J G;  4A3M H;  3PUW A;  3P7J A;  1BKB A;  4DR7 L;  5C4H A;  3I7F A;  2J4X A;  4IFD H;  5EGT A;  2WKC A;  5KNB A;  4RH6 A;  2EYL A;  1D8L A;  4LF4 Q;  1D7Q A;  3T1H L;  1CUK A;  3VR6 A;  1H9J A;  4A3F H;  5JEA H;  4FF2 A;  4BBR B;  4G7Z C;  5FK9 C;  2RSN A;  2JA5 G;  2IJ0 A;  4DR7 Q;  3I8Z A;  5I9P A;  5D3D A;  3QB3 A;  2H1E A;  2RDH A;  2RF4 A;  1B7Y B;  2F1M A;  1L1O A;  3ERS X;  3PIO 3;  1CKO A;  3NTH A;  3K5N A;  3T1H Q;  1V9P A;  1XNQ L;  4A3E B;  3CC2 A;  4G7H C;  2CH4 W;  4BY1 H;  1IZ6 A;  1GOZ A;  5LHY 1;  1VQ7 A;  2JA8 H;  2NVQ H;  3RLO A;  1E2W A;  2A69 D;  2VL6 A;  5IGG A;  1X56 A;  2R7D A;  5ELN A;  1UE1 A;  3H6M A;  2VS1 A;  1MSG A;  4XIG S;  4BBS B;  4KY7 A;  5DLQ E;  1SE8 A;  1TWC B;  4EVO A;  5FLX E;  1FR3 A;  5CMD A;  1XNQ Q;  4TRD A;  4UY8 C;  4ZUJ A;  2RHQ B;  2PMZ B;  1PFB A;  4A3B B;  4A4I A;  1HQM C;  1EZ8 A;  4GLX A;  4CJ1 B;  2N88 A;  5GAE C;  4RKB A;  4DK3 C;  3T56 B;  5C3X A;  4DR4 L;  2L9H A;  1A3V A;  1UE7 A;  3JAM c;  4LUZ A;  2F0O A;  1ICW A;  3GD7 A;  3S1M H;  1H9K A;  1VMC A;  1YIJ A;  1ASZ A;  4ZKB B;  2Z4I A;  1HZC A;  4HJ7 A;  4POF A;  3S1N H;  2VZA A;  3F8T A;  4DR4 Q;  1VQA A;  5GAH C;  4CGY B;  1SMY C;  4JI1 L;  1N32 Q;  2CQA A;  4C3H G;  4K5V A;  1TWG H;  1G51 A;  2Q8T A;  2K5Q A;  2OCE A;  1BBX C;  3A74 A;  1Z7T A;  4CKC A;  5JJZ A;  2A6H D;  3VA5 A;  1MHW C;  2KHI A;  3H3V C;  1A63 A;  2PPB C;  5IT9 E;  1YHQ A;  2ES2 A;  4X66 Q;  1BO0 A;  2K5D A;  4EQO A;  1EU4 A;  1U4L A;  2K5V A;  4KHZ A;  1FVI A;  1L1O B;  4O0A A;  2ZXP A;  4A75 A;  2V1C C;  3W2D A;  5JEA G;  5M5X B;  4A3F G;  3CMA A;  3ERO A; 
#chains in the Genus database with same CATH homology
 4XQN A;  2A73 B;  2F0W A;  2SNM A;  1HUN A;  3SK5 A;  1FYC A;  3R2I A;  1CI3 M;  1IW7 D;  1SYG A;  1W6K A;  3G6J B;  1LTB D;  1TS3 A;  1LT3 D;  3A7L A;  1SNQ A;  4H7B A;  2EY2 A;  2B2U C;  1BF4 A;  3OIQ A;  3I4N B;  2XSC A;  2ID0 A;  4XYO A;  3VR4 A;  1TS2 A;  2A69 C;  4QUC A;  4DAY A;  2F3W A;  3TZD A;  4A3I B;  2A6E D;  2F0S A;  1PRT C;  4F88 A;  1LTI D;  5BN5 A;  1PZK D;  1HFN A;  3Q23 A;  1TT2 A;  2BA0 A;  4MN3 A;  1HA5 A;  1HPC A;  2M2L A;  3VR5 A;  2DNE A;  2MPM A;  3PO3 B;  2E2H B;  4HTH A;  2KHS A;  5LL6 X;  4OL7 A;  3K5O A;  3PUX A;  2B8F A;  2PZU A;  4XXE A;  2X69 A;  1E2Z A;  3MC0 B;  4K2K A;  3SEB A;  3M4Y A;  2PNR C;  1H9M A;  1ET9 A;  4LAA A;  2IX3 A;  3H0G B;  4M1U B;  3MVV A;  1SYD A;  1PMR A;  5KEE A;  1AN8 A;  1S4Z A;  4C1N I;  4U67 3;  1LT5 D;  4AYB B;  2RDG A;  2B2V A;  4IN3 A;  2K05 A;  3HOY B;  1SYC A;  1H9S A;  2B2W C;  3MFY A;  4DK1 A;  5M5Y B;  1HQR D;  1TY2 A;  3CHB D;  3HOW B;  4IUR A;  3P1H A;  4DN4 M;  1EYA A;  3KF8 A;  5DNF A;  4A3G B;  3MXU A;  2BOS A;  3I72 A;  5DM6 3;  2PW5 A;  5KNC A;  1WTR A;  1D5Z C;  2X6L A;  2L4N A;  3BYY B;  1UNS A;  3RMH A;  4NP5 A;  1F9S A;  3MXG A;  1TWH B;  2VUM B;  5C0X I;  1Z47 A;  1JE4 A;  3D6C A;  3VR2 A;  3CKI B;  2WKD A;  1SXT A;  1PLF A;  5M9O A;  4DF7 A;  4KD3 A;  3QG1 A;  1U4R A;  1Y8P B;  1C48 A;  3RD4 A;  4F7X A;  2QCP X;  3OMG A;  4KV6 A;  1L0X B;  4QCL A;  3ITP A;  2AUK A;  3PMF A;  2NVY B;  4R8N A;  2YYZ A;  1SJH D;  3K58 A;  1STY A;  3WOF A;  3S14 B;  4FYD A;  5C0X J;  2ZXR A;  1R4Q B;  1X3P A;  1SNP A;  2F0P A;  5I6Y A;  3H09 A;  2B2T C;  1D1K A;  5E4X A;  1D5X C;  5C3W A;  1TY0 A;  3H91 A;  1BCP D;  5M5W B;  2NWG A;  1G91 A;  1D1I A;  2A68 C;  2K1B A;  5J39 A;  2V4D A;  3R3O A;  3SR1 A;  1JB3 A;  3WDN A;  5A2Q E;  3PIP 3;  1EZ6 A;  2PYK A;  3KLR A;  3C1E A;  3DEO A;  5HUR A;  1KNA A;  4ZAI A;  5CV5 A;  3HOZ B;  1A15 A;  2JSO A;  2EOT A;  1DD2 A;  2K32 A;  1II3 A;  3EVQ A;  2LY7 A;  1O7Y A;  1ET6 A;  3G7L A;  4J6H A;  4KY6 A;  3SHL A;  1CA5 A;  1JOK A;  3GTM B;  3S2H B;  2F0I A;  4P2C B;  3E6Z X;  5D3I B;  4A3K B;  2C5C A;  2G9D A;  3NUC A;  5FO9 B;  1TS4 A;  5T1G A;  4XT1 B;  3TP8 A;  3A8K E;  2HCC A;  3FPU B;  4FF3 A;  4ZUI A;  3T4A C;  1EY5 A;  1RKN A;  3U9O A;  1OO9 B;  1G29 1;  1EEF D;  4GZY C;  5G3L D;  3TSS A;  1QIL A;  1CFM A;  1XYI A;  4E6I A;  3TME A;  1YNN D;  1OXX K;  3VYR A;  2E76 C;  5FO8 B;  1F2Y A;  4L8J A;  5EQ0 A;  3L7Z C;  3T53 B;  3NTI A;  3RZO B;  1DOM A;  3N6R A;  2WIN B;  2O5I C;  4MHE A;  1F2M A;  3L3O C;  3M85 A;  4EQP A;  3O13 A;  2MHV A;  1L0Y B;  5CV8 A;  3QWN A;  4IZ8 A;  2EXZ A;  4L6T B;  1SE3 A;  3V96 A;  1V43 A;  5C5L A;  1Q12 A;  3K57 A;  4K6D A;  1RJT A;  3A54 A;  1QB5 D;  4A3D B;  2F0J A;  3JAM L;  1Z6H A;  2FMM A;  4J8Q A;  1I6H B;  1ENC A;  2K04 A;  4ZYS A;  3ERQ A;  1JOO A;  4X3S A;  4KK7 A;  3EFX D;  2BDO A;  2FJ2 A;  1G8Z D;  2D2C C;  5C44 B;  4FNF A;  1ZYR C;  1ZXT A;  3HZX A;  3NWS A;  2D62 A;  4PV1 C;  5EKL A;  4O1N A;  5COR A;  4X3T A;  5FLX L;  1SNM A;  1SBB B;  1QE6 A;  1XX8 A;  5IGC A;  1SJE D;  3SK4 A;  1Y8N B;  2F0Q A;  2IX1 A;  3CQZ B;  4PQX A;  2F0D A;  2JA7 B;  1B2T A;  4OO1 I;  1V1O A;  2FFK B;  3H94 A;  2O2L D;  3BZD B;  2Y0S B;  4WFN 3;  2EDG A;  1EYC A;  1JCK B;  3HS0 C;  5CR3 A;  3NPP A;  2NTS A;  2WAQ B;  4IUN A;  1JIC A;  5C4X B;  4ZRZ A;  1WTX A;  1KLU D;  1K8O A;  4FF4 A;  3OWF A;  1W6J A;  1ZEQ X;  1ZKO A;  1H9R A;  2B8G A;  2XN9 C;  5IT9 L;  4DNT B;  1TKW B;  1NR4 A;  1U4P A;  4R8I A;  3MXN A;  3BG3 A;  5KGU A;  5COY A;  1A2T A;  1DCZ A;  1SFO B;  1Y1V B;  2EYF A;  2EYP A;  1FGB D;  3A55 A;  3P20 A;  3PV0 A;  2KEE A;  1BUV T;  2OF1 A;  2ICI A;  4ZLT F;  3SXH A;  4N9T A;  2R7Z B;  3QJY A;  2SNS A;  2LS0 1;  3MTS A;  3A7A B;  2WP8 J;  1GUT A;  2B2Y A;  2F0N A;  4IUT A;  2EYJ A;  1VMP A;  1IL8 A;  1RTN A;  4HMI A;  2ENB A;  1IHZ A;  4IFD I;  5IOC A;  1TQO A;  5IGB A;  4K5W A;  3I70 A;  5NUC A;  4WOR A;  2WII B;  2CW0 C;  2AWN A;  5BN4 A;  3GTO B;  1ESF A;  3NXW A;  5EPK A;  4RKL A;  1GHJ A;  3GQB A;  2QDB A;  1I4P A;  3FRP B;  2FMC A;  1SYF A;  2NTT A;  3HRZ C;  4KN7 C;  3NSW A;  2XRS D;  3PO2 B;  4IFD J;  2QF7 A;  1OXS C;  2RSO A;  3CU7 A;  2MUY A;  3SVM A;  1PFM A;  1BCP B;  1NR2 A;  5CGK A;  3J80 L;  2FIN B;  3A56 A;  2RBM A;  2HDL A;  4Q5V A;  2L11 A;  2SOB A;  4OO1 G;  2F0M A;  2JA6 B;  3WOE A;  1PRT D;  1CTM A;  4CJ2 C;  1KDC A;  3S15 B;  2K7V A;  1JC7 A;  1FD7 D;  3I90 A;  1KLG D;  4H13 C;  5AFW A;  4UDU C;  1LT4 D;  2L5T A;  3FPP A;  4DXF A;  1HFG A;  4H0L C;  5JOB A;  2K03 A;  1TII D;  1B50 A;  1UAP A;  4KKS A;  1M4V A;  2PQE A;  3I73 A;  2SEB D;  3DMU A;  1PTO F;  4B9W A;  3ND9 A;  3FVQ A;  3S1Q B;  3NE5 B;  3J81 E;  1LO5 D;  2F0T A;  1I4Q A;  2I46 A;  1V8Q A;  1JOR A;  2ZXO A;  5BN3 A;  2PZT A;  2JP1 A;  4ID6 A;  4HAE A;  2MGS A;  1TWA B;  4ZK9 B;  4K8J A;  1ROD A;  3NQT A;  4V19 0;  1F2Z A;  1JQY D;  2RVL A;  5IGE A;  1C4Q A;  1BNZ A;  2NUC A;  2EE1 A;  4IUP A;  2B63 B;  4MIU A;  4X3K A;  3NWT A;  3BDO A;  1TR5 A;  3K0Y A;  1OXT A;  4XQJ A;  1O7Z A;  1PTO B;  4ZKC B;  3C46 A;  5T1I A;  3AB9 A;  4KJN A;  1U9R A;  2DY8 A;  2FHT A;  2F03 A;  1S5D D;  5KRU A;  1STN A;  3TP5 A;  1CHP D;  3LWE A;  3HGB A;  2X6G A;  1R9T B;  1F2L A;  4M8A A;  3OIP A;  1QCB D;  3E0J A;  1EY6 A;  2M9V A;  5EJW A;  3QOL A;  4J1M A;  3A8J E;  3HOX B;  2F0L A;  4DFA A;  3IL8 A;  1IYU A;  1RHP A;  2IWH A;  2QIL A;  1IYV A;  4OIJ A;  5JAV A;  1SNC A;  5A2Q L;  4EGV A;  1B1Z A;  1EEI D;  4XQQ A;  4CHT B;  2KCN A;  3N52 A;  3DWP A;  4RGT A;  1O78 A;  5JVH 3;  1LTR D;  3QIA A;  3GV3 A;  3Q24 A;  4RFB A;  3C1F A;  4U68 A;  1LTG D;  2PCF B;  1JWS D;  2WB1 B;  3NK9 A;  5JPM C;  3KK7 A;  5D14 A;  5CV6 A;  3T51 B;  4PMB A;  1QOH A;  2A68 D;  4JBW A;  3URY A;  3I4L A;  4K5X A;  5E1F A;  3VYS A;  4KKU A;  2CVR A;  1GUS A;  2F4I A;  1WTQ A;  3MWY W;  4C56 C;  4QF4 A;  4KHV A;  2EYO A;  1I4G A;  2AQ1 B;  1LV9 A;  2CHB D;  3QO2 A;  1UUP A;  4C3I B;  3GTK B;  3M7N A;  2IW3 A;  1GUG A;  1Q8I A;  1TU2 B;  3HKZ B;  4ZQ3 A;  4HMJ A;  1R4P B;  3VA7 A;  1YNJ C;  1QJO A;  2G9H D;  3MZ5 A;  2B2U A;  5LL6 S;  4KY5 A;  5KYI A;  2BA1 A;  4NDX A;  1CA6 A;  1A3T A;  2KUM A;  1RCV D;  2EJM A;  4G7O C;  4C1N K;  4RGM A;  1PDQ A;  4KTA A;  5C0X H;  3ND8 A;  2J0T D;  1DJR D;  5EKI A;  1WD0 A;  2VB2 X;  2BE5 C;  5ELC A;  1GXD C;  3FKI B;  1OXV A;  3DHQ A;  1SYB A;  2RDF A;  2VB3 X;  4PNY A;  2A74 C;  3GTL B;  1KAB A;  1O80 A;  1EQT A;  4A3M B;  3KLS X;  1RD9 D;  4FF1 A;  3RUZ A;  1U4M A;  2Z8L A;  2TSS A;  1G6Z A;  4BA1 I;  4IUU A;  2JE6 I;  1HUM A;  1I50 B;  3NTK A;  1MD2 D;  5D65 A;  1A2U A;  1GUO A;  2F0K A;  3MHB A;  3MXP A;  3OSO A;  2MJ8 A;  1EY8 A;  2KQ3 A;  4K6L A;  1S5C D;  2K01 A;  1HXY D;  2F0E A;  4BY1 B;  2JA8 B;  1PRT B;  2B2W A;  1DZ1 A;  4RCN A;  1GUN A;  1ONL A;  1MSH A;  3TN2 A;  1XWE A;  5C0X G;  3D8G A;  4IUV A;  1SE4 A;  2NB0 A;  1ZYR D;  2EYM A;  3R93 A;  4B08 A;  1VF5 C;  1I6V C;  2JXM B;  4HSP A;  3D4W A;  3MFG A;  2VNU D;  1AZP A;  3S1M B;  3Q6S A;  1HCZ A;  1HRJ A;  3S1N B;  2F3V A;  4YIJ A;  1B3A A;  2C9O A;  3CRK C;  1HHV A;  1MI2 A;  2DY7 A;  4IAL A;  3TBI B;  1BDO A;  2R3Z A;  1PTO H;  1S5E D;  5JPN C;  1CZW A;  3Q22 A;  5I6W A;  2XVS A;  3GP7 A;  1STB A;  3GTP B;  1ENF A;  3GO5 A;  1UEA B;  1VCI A;  1JOQ A;  2B2T A;  2EY5 A;  4WJW A;  4X3U A;  2K28 A;  1MBY A;  2BDN A;  2E74 C;  3GTQ B;  2KED A;  2Q8I B;  1EU3 A;  1EFI D;  1AW7 A;  3K7A B;  4ME5 A;  2Z1C A;  3KBX A;  2QEJ C;  2E75 C;  1EY9 A;  4ODG A;  2WAC A;  1LAB A;  5K36 G;  4LK1 C;  2NVT B;  3D6W A;  3TDQ A;  2LMC B;  4O42 A;  3DXJ C;  1PXU A;  4KJO A;  1BXT A;  3DWA A;  2NN6 I;  5K5P A;  1DON A;  3QOJ A;  1J9O A;  3OMC A;  1A6X A;  1LT6 D;  2CW0 D;  2HCI A;  2XWB B;  3Q0A A;  3BYT B;  1RTO A;  1FNV A;  2IL8 A;  5C4J B;  1STG A;  2AWO A;  4IUQ A;  5E3F A;  4Y7N B;  2HDM A;  4FXG C;  4V0B A;  5KND A;  5CV9 A;  1RF2 D;  4S3S A;  1NAP A;  2O5J C;  3J81 L;  1WTP A;  1CZG A;  4TQU S;  5IOD A;  1TVX A;  1SYE A;  2KVM A;  2EYH A;  3UI2 A;  1Q1B A;  4KKT A;  2KA7 A;  4OO1 H;  3BS1 A;  1DXM A;  2L55 A;  3OW7 A;  4R9W A;  4K2L A;  2AQ3 B;  2XWJ B;  1WTO A;  3S1R B;  3E5S A;  3AU7 A;  1EOT A;  1EIH A;  4CKB A;  2AQ2 B;  1BCP F;  5KYL A;  1WTV A;  2IT1 A;  1NCV A;  3DM1 A;  5IIF A;  1CK1 A;  4HR7 B;  4N9P A;  2RKS A;  4DXG A;  3PUZ A;  5KIX A;  1B9N A;  1M8A A;  4NKL A;  2KCC A;  3T13 A;  4CJ0 B;  1B44 D;  3D4R A;  3X3M A;  1S5F D;  4LMQ D;  4RGO S;  1EY7 A;  2B39 A;  4H44 C;  1KDA A;  3HEJ A;  1J8I A;  1LTS D;  5DAU A;  4OHJ A;  1O7L A;  4C3I G;  2L1B A;  1I3Q B;  1F9Q A;  2NN6 G;  4WRD A;  3RZD B;  1S5B D;  3NHH A;  3IFD A;  3DUZ A;  2R92 B;  3VYU A;  5JEA J;  4HCE A;  2OT2 A;  3MEH A;  5FKA C;  5I2X A;  1WCM B;  1JWM D;  3D4D A;  4FO2 A;  1K83 B;  4RHS A;  1XXG A;  2N55 A;  2XRQ D;  3W3A A;  4FVM A;  4CBV A;  4FP5 D;  1IKL A;  5G3L F;  1BR9 A;  4DK0 A;  3K5M A;  4RA8 A;  2K5W A;  5DM7 3;  4CKE A;  4LJZ C;  5I9O A;  2B2V C;  1STE A;  1JR0 D;  2LKV A;  2E2I B;  3EJI A;  4XDX A;  2JEA I;  2RQX A;  4A93 B;  1SAP A;  4DNR B;  1LAC A;  4IQZ A;  1ENA A;  2SDF A;  3FMC A;  3K59 A;  2F0U A;  1D2B A;  4QB4 A;  1FNU A;  5TSS A;  1HTP A;  3BDL A;  1BOS A;  1LTA D;  1I4H A;  1E2V A;  1QNK A;  1LTT D;  2A5H A;  3IKJ A;  3EA6 A;  4IFD G;  4XYQ A;  5C4Z A;  4KMU C;  3F2U A;  2EJF C;  1BQQ T;  2DNC A;  2H4O A;  2Z4H A;  1C8C A;  5ISR A;  2D9U A;  2XIW A;  3SK6 A;  1OXU A;  3SDZ A;  1KNE A;  1F77 A;  1GJX A;  2O4X A;  1AEX A;  2EPB A;  3M4O B;  3BVM A;  1CT1 D;  2QKI C;  1SND A;  2NVX B;  3R2T A;  2EZV A;  2NYZ D;  3OPO A;  4KD4 A;  3HG9 A;  4RWS C;  3I4M B;  3RLF A;  3HP3 A;  1YNJ D;  1QG7 A;  1FNW A;  4HN7 A;  4Z9C B;  1Y1W B;  1EYD A;  1SEB D;  5DEH A;  1G2S A;  5EPJ A;  5E4W C;  3J7Y W;  4I65 A;  4JK1 C;  1SNO A;  1HA6 A;  4RHR A;  3OWE B;  5CYU A;  4HED A;  5J22 A;  1STH A;  3J80 E;  2A6H C;  1WD1 A;  1D6E C;  3DEP A;  2BE5 D;  1VDZ A;  5FOB B;  1K8M A;  1EY4 A;  3DWQ A;  1GUW A;  2I07 B;  2EY1 A;  1Q90 A;  1WTW A;  4TKO B;  5HGT A;  4A3J B;  4G57 A;  1IW7 C;  2EJG C;  3ZYY X;  3M7G A;  4FXK C;  5C3E B;  3VYT A;  4C3J B;  1F9P A;  2Q8R E;  3LWU A;  4ABN A;  3P75 A;  2E2J B;  2A6E C;  5C5M A;  1XTC D;  3IFT A;  3PUV A;  5ELD A;  4K8I A;  2F0V A;  2EVB A;  2JA5 B;  1ML0 D;  1KAA A;  1TWF B;  2TMP A;  1NSN S;  1DM0 B;  1EQV A;  4DU9 A;  2F0H A;  1CM9 A;  1X3Q A;  1CQV A;  2OXP A;  2KEC A;  4F8M A;  3CRL C;  1SE2 A;  3U9S A;  1ILQ A;  3PUY A;  3M3Y B;  2IX0 A;  4UAI A;  2ZT9 C;  5CBE E;  2YU9 B;  1EL0 A;  1I4R A;  2HQE A;  2AUJ D;  1PRT F;  3TZU A;  1PYW D;  5I2Y A;  5EBC A;  3J7A V;  1H9S B;  4QMG A;  2PZW A;  2IPK D;  4C3H B;  2R61 A;  1MGS A;  3NQI A;  1JWU D;  5ELF A;  3NP8 A;  3OOC A;  3GTG B;  1PFN A;  1Y8O B;  1WVL A;  4F87 A;  4A3F B;  3D31 A;  5CV7 A;  5C6A A;  4PMW A;  1PZJ D;  3V05 A;  3I91 A;  3I3C A;  4DGZ A;  5EPL A;  1T5E A;  1V1P A;  4DA2 A;  2NVQ B;  1HTL D;  2K6A A;  1DOL A;  4ILW A;  4OIK A;  1CHQ D;  4RAU C;  5F2D A;  3VR3 A;  1DOK A;  5K36 H;  4RCO A;  4DAV A;  4B9X A;  2KJX A;  4BA2 I;  3C3L A;  3X3N A;  3V2T A;  2NBF A;  1LLR D;  1F9R A;  1QNU A;  1NUC A;  4NW2 A;  1ILP A;  1TWG B;  3J7A F;  4OGQ C;  4L63 B;  3L9A X;  1EWH A;  1GHK A;  2D5D A;  1SDF A;  1Q3L A;  2F0F A;  1BCP C;  2JYO A;  3TP6 A;  3FDT A;  1T5X D;  1AFP A;  4NMZ A;  5EKK A;  5IGF A;  1PTO D;  3BVZ A;  2ICE C;  1KTK A;  2R6G A;  1V1P B;  3S16 B;  1Y69 U;  3D3R A;  5M3F B;  2NZ1 D;  2B2Y C;  3KLS A;  1A3U A;  4XT3 B;  2DN8 A;  2J7Z A;  4ULL A;  3SE0 A;  4PMC A;  1TS5 A;  3BVG A;  3K5L A;  1SSO A;  2K33 A;  3KBG A;  2L12 A;  5A35 A;  2MP1 A;  1B9M A;  1Q1E A;  4C2M B;  2PW7 A;  5IGD A;  5ELE A;  4HSV A;  3FEW X;  3LX0 A;  2KOL A;  3HOU B;  4BWG B;  5M3M B;  1D5M C;  1RDP D;  4RGN A;  4TSS A;  2VXW A;  3S9W A;  4KN4 C;  3NBH A;  4BY7 B;  1VF7 A;  5CC4 A;  1STA A;  2R93 B;  1B53 A;  3IAY A;  3EQL C;  1YNN C;  3NBI A;  3TP7 A;  2WV6 D;  2GA4 B;  1PTO C;  3MAQ A;  2PO4 A;  2NN6 H;  3S2D B;  2M00 A;  3SK8 A;  1X32 A;  2LFN A;  1AZQ A;  5CBA E;  1DYQ A;  2F0G A;  4HCS A;  1EIG A;  1KDB A;  3T16 A;  3C2P A;  5I4D A;  4DAP A;  2BCO A;  3BDC A;  1QWY A;  4K14 A;  3LNN A;  1EY0 A;  2L0C A;  2OEO A;  4KI0 A;  1IKM A;  2XNA C;  4BS9 A;  3ONA B;  4FXD A;  4XTC S;  4Q0F A;  3R8B A;  2E2D C;  1ESR A;  3GV6 A;  1B4O A;  1AP0 A;  3MA2 B;  1I4X A;  3GTJ B;  3OHX C;  3AMU A;  4EQN A;  1EWC A;  4G4K A;  1G2T A;  4QIW B;  3KUP A;  3HOV B;  1E0B A;  5EBD A;  2RA4 A;  2HUG A;  1SMY D;  3K6O A;  2EY6 A;  5FO7 B;  3S17 B;  3A8I E;  4QUF A;  5CV4 A;  1PZI D;  5J1Z A;  1CQF A;  5ELB A;  2JEB I;  3JAM E;  4I7Z C;  4C3J G;  3PUW A;  3P7J A;  5C4H A;  4IFD H;  2J4X A;  5EGT A;  2WKC A;  5KNB A;  4RH6 A;  2EYL A;  3VR6 A;  1H9J A;  5JEA H;  4FF2 A;  4BBR B;  4G7Z C;  5FK9 C;  2RSN A;  2IJ0 A;  3I8Z A;  5I9P A;  5D3D A;  3QB3 A;  2H1E A;  2RDH A;  2F1M A;  3K5N A;  3PIO 3;  3NTH A;  4A3E B;  4G7H C;  1GOZ A;  5LHY 1;  1E2W A;  2A69 D;  5IGG A;  4XIG S;  3H6M A;  1MSG A;  4BBS B;  4KY7 A;  4EVO A;  1TWC B;  5FLX E;  1FR3 A;  5CMD A;  4TRD A;  4ZUJ A;  2PMZ B;  1PFB A;  4A3B B;  1HQM C;  1EZ8 A;  4CJ1 B;  2N88 A;  4RKB A;  3T56 B;  5C3X A;  2L9H A;  1A3V A;  2F0O A;  1ICW A;  3GD7 A;  1H9K A;  1VMC A;  4ZKB B;  2Z4I A;  4CGY B;  1SMY C;  2CQA A;  4C3H G;  4K5V A;  2Q8T A;  2K5Q A;  1BBX C;  1Z7T A;  4CKC A;  5JJZ A;  2A6H D;  3VA5 A;  3H3V C;  2PPB C;  5IT9 E;  1BO0 A;  2K5D A;  4EQO A;  1EU4 A;  1U4L A;  4KHZ A;  2ZXP A;  3W2D A;  5JEA G;  5M5X B;  5JVG 3;  3ERO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...