2E2JH

Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3'
total genus 16
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e2jH00
4JI2Q 4MZ9A 1TXYA 1PH3A 4C2MH 4LF4L 4C3HH 1HJPA 5ELNA 3HOYG 3ULLA 1UE1A 1E7ZA 2VQFL 4JG2A 1IYJB 1BBUA 3AEVA 3S14H 3VDYA 5C0XJ 1HNZQ 1CSQA 4JBJA 2A1AA 3HKZG 4IFDG 3EIVA 4LWCA 2E2HH 1QUQB 2ZM6Q 2JEBI 3I4MG 3M4PA 5LMNQ 4A3GH 5LMUQ 1E1OA 1PH9A 1N36Q 4DV5L 4LF6L 1TWCH 1MJCA 2UXBQ 1LUZA 4JI8Q 2D0OA 2LSSA 2MO1A 3K81C 4JV5L 3S1MH 1L1OC 4JI5Q 1V9PA 4A76A 4Y52H 4L5RC 1XNRQ 4TVAB 4OXPA 4HJ8A 3HOYH 4NXNL 4A3DG 2V1CC 3CF5A 1P16A 2CKZB 1C7YA 3GTGH 1UE7A 2WAQG 3UDGA 4QQBX 1XTDA 2I5LX 4UP7A 1Q7YC 1HNXL 4JI6L 1YVCA 1B7YB 2WP8J 4A3IH 2R93H 2AWNA 2OTJA 3OTOQ 1W2BA 1GD7A 5C44G 1HZCA 4QY7A 1PH2A 3CQZH 1EUJA 2VQEL 1WFQA 2E8GA 3CPFA 5IYDG 1PH4A 2JA5H 2Z6KA 1BBWA 2K5VA 3H0GG 3FP9A 5IE8A 1L0WA 3KF6A 3PIOA 5C4XH 2VZAA 3H15A 1HR0W 4ALPA 2B63H 4A3BH 4POFA 5IYCG 4DV4L 3AFPA 4GNXA 3K8AA 3HOXG 2UUCQ 1BVSA 3KJPA 2MNAA 1N33Q 4DV0Q 1Q82C 2YTYA 4DR7Q 3PF5A 4GNXB 5JEAJ 1FJGQ 1QUQA 1VQJA 3FKIG 4GN3B 4DK3C 4YWMA 5FLXc 3G6EA 4B3RQ 3RZDH 1Q81C 1YHAA 4ME3A 2PQAB 4JBWA 3RN5A 3CC4A 1YEZA 1HNWL 3JAMc 2BA1A 4MNOA 2VW9A 1N32L 5ELOA 1HZ9A 3TQYA 5M5WH 5C3EH 2L15A 2PQAA 1GVPA 4LFCL 3PO2H 1KIXA 4LF7L 4JI4L 4C3IH 1KQSA 1EWIA 1SLJA 1W3SA 2KCMA 5FLMH 3DLLA 1Z9FA 3G71A 1QZHA 1QZGA 1VQKA 3I4NH 2NN6I 1X54A 1XMQL 1XNRL 1C0AA 2IY5B 3K7AH 1SR3A 3ULJA 1OXUA 5DLQE 1UE6A 3FHWA 3A5UA 2ZM6L 2UXBL 1M1KC 3GTQH 4A93G 1WJJA 2IHEA 2MQHA 2F3IA 1BKBA 5IP9G 2VUMG 2RHSB 1N34L 4DR6L 4KHPL 3OTOL 5IYBH 1U0LA 2CWPA 2UU9L 3RLOA 4LF9Q 4GNXC 1QVFA 1X56A 4HIMA 1K8GA 1TWHH 4GN4B 3L0OA 2Z6KC 4DR5L 4GKJL 3J81i 2I5MX 3W1BA 1AE3A 1IBLL 2UXCQ 2ZJQA 2KENA 3I4OA 1YBYA 1VQEA 1HH2P 2VUMH 4IJLA 1J5EL 1E3PA 4JI8L 2YV5A 4P73A 5M3MH 5E7NA 5M5XH 4HJ5A 3U4ZA 4UP8A 2UXDQ 4JC0A 4XIGS 4UP9A 1PH5A 3S17H 4DV7Q 1X65A 2Q2IA 1U5KA 3CMAA 4YHHL 4A3CH 4WJ4A 2N3SA 2QGQA 3U50C 5LMNL 4DR3Q 1KC8C 5LMUL 3HOZH 1VQHA 1VQDA 3MXNB 4DAYB 2PNHA 2NVTH 4UY8C 5FLMG 3I4NG 4K0KQ 2CQOA 5AJ3L 2LXKA 3M7NA 2RHQB 3CCMA 1E24A 1OXSC 4KI0A 5AJ3Q 4YCWA 3CPWA 2EIFA 4IO9A 3M4OH 4YWLA 4DPGA 4P74A 5H1SE 4R4OA 4DV3Q 1MIUA 2D62A 5C3EG 4X66L 4DKAC 4GOPB 1PH8A 2H5XA 4DNIA 3GTLH 1S3OA 3CCLA 2ZTDA 4DK6C 2N8NA 4JI3Q 1V1QA 4DV7L 2R6GA 3W5OA 1LYLA 2AKWB 1VQ6A 2NZHA 5C0XG 1A63A 4LF4Q 1KRTA 4DUYL 3EBEA 3HOUG 3FKIH 4JI2L 4POGA 4IPDA 1HNXQ 2IX0A 3J81j 4NXMQ 3U58A 1VQFA 2ALYB 3GD7A 3OW2A 2F4VQ 3KOJA 3HOWH 3B6YA 3S1NH 2K50A 1VQAA 2A8VA 3LGJA 3I7FA 4BY1H 3TEHB 1XMOL 4X62Q 4O0AA 2K14A 4GS3A 4B3SL 3ER0A 4LF9L 3PUZA 5C4XG 4A3BG 4WJ3M 5HY6A 2K75A 3UE0A 1K73C 1NMFA 4BBRG 1FGUA 3UDXA 4LFCQ 4DV5Q 4LF6Q 4A3MG 5JJIA 1PYBA 3E9HA 1Y1WH 2LXJA 1SN8A 1XNQQ 2YYZA 3PF4A 1JT8A 1EFWA 1Q8KA 1PH6A 4A3IG 3NENA 1PV4A 4LF8Q 1KXLA 2YU9H 4RG1A 4XTCS 5J3BA 3F1ZA 3STBC 1GM5A 4BBSH 1NE3A 4IPHA 3F2DA 3KYHC 3I55A 3PSIA 4NB3A 1I94L 2XTIA 4LFAQ 4UPAA 4IPCA 3KF8B 1P8LA 2F52A 4LFAL 2Y0SE 4FDBA 3ERSX 5GAGC 2KHJA 2R92H 3BJUA 1PHJA 1EYGA 3RR5A 1CKNA 2JE6I 4KHPQ 3Q8DA 2PI2E 3CC2A 3HOVH 4X65Q 5GADC 4B3TQ 4HIDA 4A3GG 1IZ6A 1VQCA 3EN2A 1CKMA 1IXRA 5JEAG 1XPOA 3W1GA 2A19A 2VQEQ 2UUAL 2NVYH 4LW1A 1YIJA 1IBKL 2JA8H 4GKKQ 4JBKA 1TWGH 5HGQA 2KCTA 3TRZA 1EIYB 3TS2A 4GOPA 3CD6A 1B70B 1QVGA 1C9OA 2HIXA 2ASBA 1M90C 1AE2A 3HFZB 3G4SA 1SROA 1VQPA 1K8AC 1NMGA 4DUZL 1FVIA 2BH2A 1YJNA 2UUBL 3M3YH 5K36G 3U4VA 1Q1EA 3CAMA 1WCMG 3T1HQ 4NXNQ 3BU2A 3PUYA 4APVA 4X66Q 3KDFA 4P71A 3T1HL 3A0JA 3S2HH 2B3GA 4LF5L 2MFIA 4DR4L 3S16H 2KHIA 3SGIA 1UEBA 3T1YQ 1SMXA 4O2DA 1EOVA 3J80i 2ZJPA 2OWOA 5IWAQ 1NTGA 4QGUA 1Q46A 4JOIA 4A3LH 2BH8A 2HHHQ 4R4TA 1I6HH 2R7ZG 1N34Q 3L7ZC 4DV3L 1YJWA 1JMCA 2ES2A 2Q2TA 3PO2G 1PH7A 3S2DH 2GN5A 1J6QA 2WAQE 5EAYA 4DV2L 2NZOA 2IX1A 1Q86C 3PUWA 4J15A 5FJ8G 1MKHA 5IP7G 1XMOQ 4PG3A 3J7A5 4DR2L 1I5FA 3KF6B 4B3MQ 4L5QA 4A3KG 2C35B 3L2PA 1X6OA 4DAMA 1Y14B 1Z47A 4P75A 1O7IA 5M3FH 3GTOH 2AWOA 4HIKA 2JA6H 2MO0A 2EQSA 2K52A 5GAEC 1YJ9A 4IJHA 2RF4A 1PVOA 1N8RC 1VQLA 4AH6A 3S1QH 2AHOB 2AMCB 3GO5A 4BY7G 3H3VH 4P72A 4BY7H 4JI1L 4PZ8A 2EXDA 4LUZA 4HJAA 1OXVA 2BA0A 4A3FH 1S72A 4B3ML 4YY3Q 2F4VL 3GTMH 2ZTEA 4R4QA 4DR5Q 1K3RA 2UU9Q 1JB7A 4GKJQ 3BZKA 2ZJRA 1JJCB 4QJFA 2ID0A 3RNUA 4PZ7A 2B29A 2Q2HA 1X3GA 4DV1L 1JE5A 1Y1VG 2VS1A 3F8TA 5LMNW 1IBML 2RCNA 1RL2A 4TQUS 2I5HA 2CCZA 4X6AH 4IPGA 5IP7H 3J81c 1K83H 3HOZG 2E5LL 1A62A 3T1YL 4YCVA 1VS0A 1ASYA 2NVXH 1D8LA 4A3CG 4X65L 5C4JH 1PA6A 4OO1I 1VQ5A 2YTXA 2UUBQ 5GROA 4BXXG 4QL5A 3D0FA 4OX9Q 1X9NA 4OWWB 4A3LG 3PGZA 1G51A 2N49A 3PO3H 4LFBQ 3GDEA 3RZOH 4GOPC 2HT1A 3J7ZC 4DUYQ 3ZJYC 4AYBG 1AH9A 3UE1A 4DV0L 1T9HA 3S15H 3PO3G 2UXCL 5JJLA 2VL6A 3CCUA 1D7QA 1YHBA 1E22A 3GTKH 1CKOA 4DR4Q 2XGTA 3K0XA 4LUVA 4X64L 4DV6L 4JI7L 2JQOA 4BXXH 2GVAA 1XPRA 1GKHA 4JI0L 3M9BA 5IYBG 4JYAL 4B3TL 1VQ7A 1YZ6A 2E2IH 4HJ7A 1IL2A 5IP9H 2DUDA 4LFBL 1N9WA 1I50H 1PYSB 3JC66 2YTVA 1L2FA 1HR0Q 3PUXA 1I3QH 1UWVA 4AYBE 1Y1VH 2E2JH 2DGYA 2JA8G 5JJKA 4C3JH 2QEXA 1VQMA 3CXCA 3ICEA 3F2CA 4LF7Q 2OQKA 4A4IA 5M5YH 3HOVG 3F2BA 4PZ6A 1B8AA 1A0IA 2I0QA 2R7FA 1XMQQ 3PIPA 4A3FG 4R4CA 4B3RL 3ULPA 1DGSA 4LF8L 1HZAA 4IFDJ 4MTNA 3S24A 5BR8L 3GTPH 4AQYL 1XNQL 3TREA 2IHFA 1KD1C 4BBSG 4KHZA 4DR6Q 1N32Q 4H02A 1K9MC 2JA6G 1CUKA 1YNXA 3A74A 1I94Q 5M3FG 4JI5L 3HKZE 4DR1Q 3PV0A 4L5SA 1OXTA 2WFWA 1VQNA 3CCSA 4GLVB 2VNUD 2JA7G 1Y1WG 3CW2C 2CFMA 1UE5A 2ZTCA 2UUAQ 4DR2Q 1YITA 4BBRH 3HOXH 4LUOA 2JA7H 4AIMA 1R9TH 1X55A 2NN6G 3AFQA 5IT9c 2B63G 4GKKL 3CCRA 1RIPA 1KRSA 2Z0SA 4A3JH 2R7ZH 4R1JA 2K5HA 4BA2I 4BY1G 4JI7Q 4DR1L 1J5EQ 1ASZA 5C44H 3K80C 1A8VA 4JI3L 1JJGA 4JYAQ 3UDIA 1QVCA 4DV2Q 4Y7NH 3I2ZA 2R93G 2R7DA 3HOUH 1VQOA 4DUZQ 1VQ8A 1WCMH 1SFOH 3DM3A 5IWAL 1VQGA 4A3DH 4OWXB 1VQBA 3HKSA 1VQ4A 3PUVA 3RN2A 1X3FA 2VY3A 4OO1G 4DR7L 1CKNB 1EIFA 4QIWE 4A75A 1S40A 4B3SQ 4JBMA 4A3JG 1WI5A 1KHIA 1SE8A 4JI0Q 2K4KA 2FXQA 3UDFA 3AQQA 4A93H 4EX5A 3JAMi 2E5LQ 1SRUA 4YWKA 2CWAA 3CCVA 2WB1G 1HR0L 3I4MH 1NBWA 1WOCA 3J80c 2ATWA 4PMWA 3S1RH 1NY4A 3RLNA 3H3VI 4IOAA 1TWAH 1LM0A 1HZBA 4X62L 2R92G 1KAWA 3K7UC 4JOIC 3GTJH 1FL0A 3M85A 1EQRA 4JCVE 2OTLA 4AQYQ 2Y0SG 4IOCA 1OXXK 2PI2A 2OQ0A 2QA4A 2PMZE 2HIVA 3CCJA 3KJOA 4YCUA 3AYHB 2D0PA 1PH1A 1N36L 2JEAI 5C0XI 2JA9A 1YI2A 3OYYA 5BR8Q 3D31A 4A3MH 1Q12A 1YHQA 3CCQA 4RMFA 3TS0A 1EQQA 2IT1A 1NJIC 3RLFA 3KLWA 1IBKQ 3MEFA 2OCEA 2GVBA 4A3EH 4R4IA 1PFSA 3WWVA 1E1TA 2VQFQ 3CC7A 1K0RA 3BZCA 2N78A 1TWFH 4GN5A 3PCOB 2UXDL 3M4QA 1JJ2A 4LNQA 3I56A 4JI4Q 4DV6Q 3E9IA 1GO3E 2JK8A 1G6PA 3HOWG 1IBLQ 4NPSA 1G291 3A5ZB 4L5TA 1XJVA 4KLKA 1CSPA 1L1OB 4IFDI 4LF5Q 2JJQA 4JI1Q 3STBD 4HJ9A 2NVQH 4GLXA 4YY3L 1N33L 1L1OA 1VQ9A 2KBNA 4NXML 4OX9L 3IRBA 4DV4Q 4JV5Q 1MJEA 4OONA 4A3KH 3KDFB 1FJGL 4EQ5A 1VQIA 2K5NA 2HQLA 4DV1Q 5GQOA 3G48A 1WYDA 1X3EA 2UUCL 5GAHC 1H95A 1IBMQ 4BA1I 3NBHB 5FJ8H 4DR3L 5IYCH 1V43A 1LTLA 3NEMA 4A3EG 2Q2UA 1Q1BA 4JI6Q 3H0GH 1VCIA 3CMEA 5IY0A 2JA5G 5IYDH 3NELA 1HNWQ 3CCEA 5M3MG 1XPUA 2WB1E 1KL9A 4GLAC 1HNZL 4OWTB 1OTCA 3KFUA 4X64Q 3E0EA 4HIOA 2HHHL 3CP0A 4K0KL 4YHHQ
chains in the Genus database with same CATH superfamily
1EYCA 4MZ9A 4LF4L 1JQYD 2F0HA 2RDFA 1IYJB 3S14H 4A3EB 5EGTA 1HNZQ 4A3GB 2RDHA 2XWJB 2PZUA 2B39A 3EIVA 4H44C 2E2HH 2EE1A 2ZM6Q 1WVLA 4DA2A 5JPMC 5LMNQ 1ET6A 5EKLA 1FNUA 4JPBW 4RFBA 2D0OA 2LSSA 2MO1A 3K81C 1D2BA 3N6RA 3GTPB 1V9PA 4A76A 4L5RC 3T16A 4HJ8A 1G2TA 4A3DG 4BY1B 1PLFA 4EQOA 3HOWB 1UE7A 4QQBX 3R2IA 1B7YB 4A3IH 3QOJA 4C1NI 3P75A 2AWNA 2HD3A 3KBXA 3I4LA 3PQIA 1YNNC 3CQZH 5IYDG 3D6WA 4X3UA 1BBWA 2MUYA 3NTHA 3KF6A 2M2LA 5D3DA 4CBVA 1CK1A 2FINB 5E4XA 5IYCG 4IQZA 3HOXG 1N33Q 2IPKD 3NK9A 3K0YA 1Q82C 4DR7Q 1F2YA 5JVG3 5D65A 3G6EA 3FKIG 5I2XA 4GN3B 5FO9B 1SMYD 4ZUJA 4ME3A 3CC4A 1YEZA 1HNWL 5M5WH 4MTKA 5DNFA 3CKIB 1O78A 4JI4L 3TP5A 3I72A 1W3SA 3MFYA 2KCMA 1Z9FA 1VQKA 1QZHA 1X54A 5T1GA 1XMQL 2IY5B 1Z7TA 3S1MB 3D3RA 3HG9A 1OXUA 5DLQE 3FHWA 5EQ0A 4NDXA 5CMDA 1WJJA 1BKBA 1S5CD 4KTAA 2ZXOA 1BUVT 1D6EC 3OTOL 1HTPA 4RKLA 3OWEB 3A8KE 3CHBD 3RLOA 2R93B 4B08A 1K8GA 2F0WA 2K32A 4GN4B 2Z6KC 4DR5L 1I4QA 5FLXL 2HDMA 2KENA 1VQEA 1SYCA 1LTSD 5M3MH 4P73A 5E7NA 1STEA 2B2UA 4UP9A 4DV7Q 1ZYRC 4FNFA 2N3SA 3U50C 1KC8C 1VQHA 4TKOB 5FLMG 3M7NA 5LL6S 1OXSC 5AJ3Q 3M4OH 4IO9A 1F2ZA 1SE2A 1TU2B 4X66L 4LAAA 2D2CC 2H5XA 4IUPA 3GTLH 1S3OA 3MVVA 2ZTDA 4DK6C 3CCLA 4OELB 4DV7L 3NHHA 2R61A 4ZLTF 2O2LD 3F2UA 5C0XG 2Z8LA 1KRTA 4DUYL 4LF4Q 1TWFB 1TVXA 5EJWA 4AYBB 3N52A 4C3IB 2F4VQ 1QG7A 4CJ1B 1EWHA 1HPCA 2WKDA 2A8VA 1VQAA 3LGJA 3I7FA 3I90A 1L0YB 3TEHB 2PZWA 4X62Q 2KEEA 4A3BG 5HY6A 2K75A 3UE0A 2CVRA 1FGUA 4LFCQ 2L9HA 2QCPX 5JJIA 4RGOS 3PF4A 1EFWA 1KXLA 5EPKA 4LF8Q 2ICIA 2YU9H 4RG1A 2NZ1D 3ND9A 1EOTA 1GM5A 3F2DA 2B2VC 3I55A 3GQBA 3KF8B 1LLRD 2K7VA 2Y0SE 5GAGC 1EY9A 3BJUA 1W6JA 1I3QB 3HOVH 4X65Q 4ZKCB 2J0TD 5GADC 4B3TQ 1CKMA 1IYUA 3SK8A 3W1GA 4XDXA 1SJHD 3ND8A 2EYOA 5HGQA 1H9SB 4GOPA 1EZ8A 1M90C 3G4SA 1SROA 1VQPA 4DFAA 2BH2A 1CZWA 4KD3A 2H1EA 4N9TA 2B2WA 2OEOA 3BU2A 4J6HA 3PUYA 3LWEA 1ILPA 1LTBD 1JCKB 3T1HL 3S2HH 2RVLA 1H9KA 3QWNA 2CHBD 1G91A 3T1YQ 1GUNA 1S4ZA 1J8IA 1VF5C 3OWFA 2OWOA 1HA6A 3WDNA 4A3LH 3GTGB 4R4TA 1MGSA 3HZXA 2EY2A 4Q0FA 4DV3L 1YJWA 1N34Q 1JMCA 3P1HA 1PH7A 3S2DH 2IX1A 5EAYA 1PTOF 1CM9A 5FJ8G 1MHWC 4X3TA 5IP7G 1I5FA 2R7ZB 1ICFB 1I50B 2KQ3A 2C35B 3R93A 1LTID 3M7GA 4HMIA 4EQNA 1Z47A 4P75A 1QOHA 4NMZA 4R8IA 3VYSA 2JA6H 1YJ9A 5GAEC 2RF4A 3Q0AA 3OOCA 4AH6A 4P72A 4BY7H 4JI1L 4LUZA 1C4QA 2BA0A 4V0BA 3GTMH 4OEMB 5JAVA 4R4QA 1JB7A 2F0SA 2ZJRA 5C4HA 1R4QB 4LJZC 2CW0D 4FXDA 3IKJA 3F8TA 1EY5A 1IBML 2RCNA 1S5DD 1A62A 1VS0A 1D8LA 4A3CG 3S15B 5C4JH 4IURA 4DNTB 5GROA 3VR2A 4F87A 3S2HB 2A68D 1STAA 4LFBQ 4GOPC 3AMUA 2HT1A 4DUYQ 2O4XA 1AH9A 3BDOA 3PO3G 3CCUA 1AN8A 5ELEA 4DR4Q 2RDGA 4V190 3K0XA 4X64L 4BXXH 4JI7L 3D4RA 3A56A 1VQ7A 2E2IH 1UAPA 1ILQA 5IP9H 4LFBL 5C3EB 1I50H 1L2FA 1EYAA 1I3QH 3HOVB 4AYBE 1B9NA 3HGBA 2DGYA 3QB3A 5JJKA 1WD1A 3CXCA 1HQMC 1H9SA 2JA6B 1F9SA 4LF7Q 4DAPA 4PZ6A 2RSNA 5IGGA 1B8AA 2F0VA 1QCBD 2KCNA 1TIID 2D5DA 1I4RA 4IFDJ 4MTNA 2FMMA 3BDLA 1QWYA 2B2WC 2DNEA 4KHZA 4H02A 3HKZE 3J80L 2ZTCA 3EVQA 4DR2Q 5M3FB 1YITA 2WKCA 2Z0SA 1E2WA 1YNND 5LHY1 4R1JA 2K5HA 3X3NA 3V05A 1RJTA 4JI3L 1JICA 3I2ZA 2DJGC 2R93G 5JVH3 3GTLB 5IGCA 1GOZA 3SK5A 1VQOA 5EBDA 1VQGA 5A2QL 3MXNA 5JPNC 1PTOH 1X3FA 4C3JG 1K0SA 1DOMA 4B3SQ 2PO4A 1WI5A 3UDFA 2EY6A 3M3YB 5JEAH 4EX5A 1FD7D 1SRUA 1QNUA 4YWKA 2E5LQ 3GTJB 3RLNA 4IOAA 5FK9C 3KLSX 1SYDA 2F3WA 3J80E 3I4MB 1EQRA 1FNVA 5KNCA 2PCFB 3EJIA 3FVQA 4F88A 3AU7A 1E2ZA 1PZJD 2VB3X 3AYHB 2SNMA 2ZT9C 4XT1B 1A2TA 4KV6A 1PH1A 3M4OB 1WCMB 4A3MH 1Q12A 1HQRD 3CCQA 2KECA 4RMFA 1NJIC 3DM1A 1TS5A 3KLWA 1IBKQ 2Z1CA 2OCEA 2GVBA 4U673 4A3EH 4R4IA 3NQTA 1M4VA 3CC7A 2FMCA 2VQFQ 4GN5A 4NKLA 3KK7A 3W3AA 1JJ2A 4LNQA 3FEWX 4JI4Q 1HCZA 2JK8A 3QR8A 3HOWG 5J39A 4L5TA 3GTQB 1JWUD 2IL8A 4C1NK 1L1OB 4LF5Q 3TMEA 3STBD 1QJOA 2F0KA 2Q8RE 1HXYD 4RHRA 1SEBD 3IRBA 4JV5Q 4WORA 3OSOA 1FJGL 4EQ5A 2K5DA 4DV1Q 1WYDA 2UUCL 4DR3L 1V43A 1LTLA 1NNXA 4A3EG 2XNAC 3H0GH 3J81E 1VMPA 2JA5G 3NELA 1HNWQ 5C4XB 2DY8A 1Y8NB 4X64Q 1BCPF 2HHHL 3G7LA 1DJRD 4DAVA 1WTVA 1TKWB 4C2MH 3DHQA 4C3HH 3QG1A 5KNDA 3SK4A 4IN3A 3LX0A 3MXUA 1BBUA 3AEVA 2B2YC 1I4PA 1CSQA 4KKSA 2QDBA 1AZQA 1ZYRD 2B2VA 1DYQA 4A3GH 5LMUQ 3PO2B 1E1OA 1PH9A 3SE0A 3TBIB 4FO2A 1JOQA 3LNNA 4YIJA 1MJCA 2UXBQ 1LUZA 2EYMA 4E6IA 2F0TA 1KLUD 4Y52H 5TSSA 4TVAB 1TWGB 3HOYH 2V1CC 2C9OA 2CKZB 3GTGH 2LY7A 2WAQG 4CDEC 1HNXL 2EJGC 4JI6L 1SMYC 1YVCA 2XN9C 2R93H 1PMRA 3DXJC 2FJ2A 2OTJA 1W2BA 1DONA 2I07B 4I7ZC 4WJWA 1J9OA 1E2VA 1WFQA 3CPFA 2G9DA 1DOKA 4K0KL 3FP9A 3PIOA 3H15A 5C4XH 3K5LA 1OO9B 3AFPA 3K8AA 2MNAA 1C8CA 4EVOA 3C1EA 5FLXE 3L3OC 4GNXB 1QNKA 1X32A 4XQQA 4DK3C 1VQJA 2KHSA 1Q81C 1S5FD 1M8AA 2O5JC 1PFNA 5CBEE 1BF4A 3JAMc 1ENCA 2F0FA 2K03A 4MNOA 5ELOA 1HZ9A 2VW9A 5C3EH 3I4NB 2E2DC 1N32L 2L15A 3T53B 3J7AF 1K83B 4PNYA 5HGTA 1GVPA 4LFCL 3CU7A 1PRTC 5HURA 4OIKA 1KIXA 4M8AA 1SLJA 3DLLA 1QZGA 3I4NH 1STGA 4RWSC 1XNRL 2NBFA 4JK1C 4G7OC 4RAUC 3TP7A 4Z9CB 1BQQT 2IHEA 2F3IA 2MQHA 3BYTB 1O7ZA 2RHSB 5IP9G 1N34L 2VUMG 1O80A 4KHPL 1GHKA 3D4DA 4LF9Q 4GNXC 4N9PA 2PZTA 5CV6A 1QVFA 2E76C 1TWHH 3I8ZA 3J81i 3W1BA 2HUGA 2B2TC 1GXDC 1J5EL 4K2KA 1VF7A 4HJ5A 5M5XH 1Y1VB 1FR3A 3U4ZA 4UP8A 1SNMA 2XRQD 1PH5A 3S17H 2Q2IA 4A3CH 3K5NA 4DR3Q 2ZXRA 1I4GA 4PMCA 5I6WA 1KNAA 2PNHA 1NUCA 2NVTH 5AJ3L 1PYWD 1ENAA 3PO2G 3CPWA 1EWCA 4RGNA 3NWTA 5H1SE 1MIUA 4DKAC 2L12A 1PH8A 3EA6A 4DNIA 4IUQA 2R6GA 2F0PA 3W5OA 3MC0B 1LYLA 4TRDA 1BOSA 3ONAB 3SEBA 3C1FA 3NUCA 1GUSA 4IPDA 1B50A 3J81j 4CGYB 3U58A 4NXMQ 1KAAA 3KOJA 3HOWH 1V1PA 3BG3A 3MEHA 4BY1H 1XMOL 2K14A 4GS3A 4FF3A 1WD0A 1K73C 3SVMA 4BBRG 2DN8A 2XRSD 1EY4A 4A3MG 1AFPA 3E9HA 1TT2A 1JT8A 1XNQQ 2YYZA 3PO3B 3HOXB 4ZK9B 2QILA 3NENA 4M1UB 4XTCS 1U4RA 4KKTA 3V2TA 3H0GB 3MA2B 4A3JB 4BBSH 3C2PA 3K58A 3I91A 4UPAA 4IPCA 1P8LA 2F52A 2A74C 4BY7B 2XVSA 4TSSA 2JE6I 2KUMA 1W6KA 3OMCA 3OPOA 1A3VA 1VQCA 3EN2A 1O7YA 1CI3M 5JEAG 2A19A 2VQEQ 4L6TB 4LW1A 2UUAL 2JA8H 4JBKA 2KCTA 1TS3A 1JWMD 3ITPA 1QVGA 1C9OA 2ASBA 2PMZB 5K36G 1EY0A 2LFNA 3T1HQ 4NXNQ 5E1FA 4ZCKA 4I65A 1BBXC 2B2TA 2B3GA 2MFIA 3G6JB 3S16H 1Y8OB 1CHQD 1EY7A 1SMXA 4O2DA 4A3MB 1EOVA 3J80i 4CKCA 1U4LA 5IWAQ 1NTGA 2BH8A 4KJNA 3A7LA 1I6HH 2EY1A 4CDFC 2EYHA 2WAQE 3SXHA 3DEOA 1XWEA 2MPMA 2K5QA 1WTQA 3KF6B 2DY7A 3FDTA 4KY6A 4B3MQ 2EY5A 4L5QA 3L2PA 1X6OA 1I6VC 5CV7A 2AWOA 4HIKA 1DOLA 2MO0A 2EQSA 2QF7A 2L1BA 2A6HC 4IJHA 1Y69U 1KDCA 1VQLA 4FF1A 4FXGC 3D6CA 4UHVA 5I4DA 3H3VH 4PZ8A 2M00A 1OXVA 2F0UA 3JAME 1S72A 4B3ML 1SNQA 1NSNS 3BZKA 1JJCB 4XXEA 2B29A 2G5DA 3FPPA 2NVQB 1X3GA 4DV1L 3S2DB 5LMNW 4IUNA 4RCNA 4X6AH 4FYDA 2B2YA 1EU3A 3A8JE 4RHSA 2SDFA 2OF1A 4BXXG 3PGZA 4UDUC 2N49A 3PO3H 3T51B 3MXPA 1I6HB 5IODA 3UE1A 2WB1B 4DV0L 4BBSB 5JJLA 3HOUB 1E22A 1SYGA 4CJ0B 2XGTA 4KK7A 1K8OA 2JQOA 1EFID 1KABA 1XPRA 2A73B 3H94A 3M9BA 4JI0L 4JYAL 4A3FB 1TY2A 1IL2A 2JXMB 2F0JA 2KA7A 1LTRD 2E2JH 2JA8G 4GZYC 2VUMB 2QEXA 3ICEA 1XX8A 4A4IA 4KN4C 3F2BA 3VR6A 2R7FA 4ILWA 3DMUA 4B3RL 1DGSA 1HZAA 1KLGD 4AQYL 1XNQL 2JYOA 2J4XA 4BBSG 4CDCC 2JA6G 4HTHA 1I94Q 3A74A 4X3SA 5KEEA 4DR1Q 1DXMA 5KRUA 4L5SA 1OXTA 2WFWA 1VQNA 5EKIA 4GLVB 3A7AB 2JA7G 2CFMA 2YU9B 2UUAQ 4BBRH 3HOXH 2JA7H 1X55A 3AFQA 4GKKL 3T56B 5ELFA 5FOBB 4BY1G 4DR1L 3KF8A 3GTMB 1JJGA 3ZYYX 1X3PA 4H7BA 3DM3A 5IWAL 4A3DH 1E0BA 4OWXB 1VQ4A 3PUVA 2A69D 4KY5A 4FVMA 1S40A 4JBMA 1SE8A 4L63B 2A5HA 3AQQA 1XYIA 1PTOD 4O1NA 3JAMi 3BDCA 1U4PA 5C6AA 2CWAA 3CCVA 1HR0L 1LT5D 1NBWA 1WOCA 2KVMA 5CV5A 3J80c 4PMWA 1NY4A 1LM0A 1KAWA 2IJ0A 4JOIC 1CQFA 4DNRB 4OL7A 4B9WA 1RF2D 1V1PB 2H4OA 2I46A 4U68A 3FKIB 3PMFA 2Y0SG 4IOCA 4MHEA 5M3MB 2PI2A 2PMZE 3D4WA 2NWGA 3U9SA 1SE3A 1JOKA 3MZ5A 1D5MC 3E0JA 5C0XI 2JA9A 4IALA 2X69A 2XSCA 3AB9A 4DGZA 4F8MA 2IT1A 1II3A 4XT3B 2DNCA 1E1TA 4Y7NB 2JA5B 1K0RA 2N78A 3PCOB 1ZKOA 5IIFA 3KUPA 3I56A 4DV6Q 1IKMA 2IX3A 4CJ2C 1G291 3L9AX 3P7JA 3FRPB 4KLKA 3VYUA 1CSPA 4IFDI 3S14B 3A8IE 1EIHA 2NVQH 4GLXA 4YY3L 4L8JA 4H0LC 1HRJA 4NXML 5DEHA 1CHPD 3OIPA 2EYFA 2K5NA 4HR7B 1IL8A 1JC7A 2JSOA 3UI2A 2BE5D 2KEDA 3CQZB 5GAHC 4BA1I 1WTWA 2Q2UA 1VCIA 1PTOC 2OXPA 4X3KA 5IY0A 1UNSA 3I70A 3TN2A 5M3MG 2NTTA 3EFXD 3KFUA 4OWTB 2F0MA 1TWHB 2EVBA 4G7ZC 1G8ZD 1TXYA 1PH3A 2CH4W 5ELNA 2K28A 1SNOA 3HOYG 3ULLA 1UE1A 1E7ZA 3NXWA 4JG2A 5K36H 1RKNA 2N55A 4BBRB 3VYTA 1AW7A 2R3ZA 2QDLA 3HKZG 4LWCA 3H09A 2JEBI 3SK6A 3I4MG 3M4PA 2X6GA 1HFGA 1LACA 1N36Q 1TWCH 4CDDC 3BS1A 1A6XA 4JI8Q 1L1OC 1RHPA 2K05A 2NVXB 1RDPD 5EPJA 1LABA 2MJ8A 3U9OA 1TS4A 2FHTA 4OXPA 4NXNL 3BVZA 5FO7B 1P16A 3VR5A 2BOSA 1SYBA 4FF2A 4C3HG 1NR2A 1LTTD 1VMCA 2BCOA 2I5LX 4UP7A 3K6OA 1Q7YC 3NQIA 2O5IC 3OTOQ 4S3SA 2GA4B 1GD7A 1MBYA 1HZCA 1PH2A 1JB3A 1GUGA 2VQEL 2JA5H 1HTLD 4HSPA 2K5VA 3H0GG 5IE8A 1HR0W 2VZAA 2B63H 3IL8A 4ALPA 3FMCA 4GNXA 2EDGA 1BVSA 3KJPA 5IT9E 2NYZD 3Q24A 5KIXA 3PF5A 2B2UC 4XYQA 1FJGQ 3EQLC 3E3XA 1QUQA 1CFMA 5E4WC 3RZDH 4Q5VA 2PQAB 3MXGA 2EJMA 2L0CA 3TQYA 1STYA 1H9MA 5ISRA 5KGUA 3PO2H 1ESRA 4CKBA 4LF7L 1EU4A 2L5TA 1KQSA 4EGVA 4K5VA 1C0AA 1SR3A 3ULJA 4K5XA 1UE6A 2ZM6L 2AUKA 5BN4A 3CRLC 1WTHA 5C4ZA 4KN7C 1IHZA 2F0NA 3X3MA 2K6AA 4K6DA 2UU9L 2Q8TA 5BN3A 1X56A 4HIMA 3L0OA 4HN7A 2ZXPA 5C3XA 3BYYB 2ZJQA 3I4OA 4HCEA 2VUMH 4C3HB 4LK1C 2Z6BA 2UUBQ 2YV5A 3JAML 4FF4A 4JC0A 2A6EC 2X6LA 4WJ4A 1EEID 4YHHL 2JA7B 5LMNL 3HOZH 3MXNB 4DAYB 3I4NG 3C46A 2CQOA 1VDZA 3CCMA 1FNWA 1TR5A 4YCWA 4YWLA 4DPGA 4P74A 2WACA 3TP8A 5IGFA 5C3EG 4GOPB 1LTAD 4WRDA 2AUJD 4RA8A 3W2DA 2AKWB 1PTOB 1A63A 1ZXTA 3EBEA 5DAUA 1PZKD 3VYRA 4JI2L 3R3OA 4IUUA 4K6LA 1VQFA 3OW2A 3B6YA 4DK1A 3S1NH 2K50A 1BO0A 3ER0A 5C4XG 2KCCA 1NMFA 1RD9D 1NCVA 1PDQA 5DM63 2K01A 1PFBA 1SN8A 1SNCA 1Q8KA 3TZDA 2M9VA 3F1ZA 5FKAC 3QIAA 2F3VA 1SYFA 4NB3A 1YNJD 1T5EA 1I94L 2FFKB 2XTIA 4KMUC 1ZEQX 1F9PA 4LFAL 4FDBA 3ERSX 2KHJA 2R92H 1EYGA 4KHPQ 1LT3D 2PI2E 3CC2A 4DAYA 3HS0C 4A3GG 1IZ6A 2ENBA 1CTMA 4GKKQ 4A93G 1JORA 5M5YB 1TWGH 3HOYB 4NW2A 3TS2A 5CYUA 2LKVA 1AE2A 1K8AC 1NMGA 4DUZL 1FVIA 2PNRC 3M3YH 1R4PB 1WCMG 4APVA 4X66Q 3DUZA 3KDFA 4P71A 4DR4L 3MTSA 2KOLA 1UEBA 2CW0C 1D1IA 1QB5D 1UEAB 1Q46A 1R9TB 2ES2A 2Q2TA 2B8GA 2GN5A 3J81L 1F9RA 1F2LA 3I3CA 3PUWA 4J15A 1LTGD 1MKHA 1PZID 4RH6A 4PG3A 4DR2L 4QUCA 3DWPA 4R9WA 1DD2A 1JE4A 2NVYB 5M3FH 1BDOA 1D5XC 4ODGA 2IWHA 3WOEA 1PRTB 3MFGA 2RBMA 3S1QH 3GO5A 3SR1A 5L37A 3GTOB 4BY7G 1F77A 2K5WA 1B3AA 2EXDA 4ZRZA 1EY8A 4HJAA 2F4VL 1V8QA 4YY3Q 4GKJQ 2UU9Q 4DXFA 4NP5A 1XTCD 4MN3A 3RNUA 2NB0A 4QMGA 2HCIA 2Q2HA 4RKBA 4ZYSA 1DCZA 4G7HC 3S1RB 1RL2A 2I5HA 3RZOB 5IP7H 1K83H 1V1OA 2E5LL 3T1YL 4YCVA 1ASYA 2NVXH 1VQ5A 2YTXA 4QL5A 4OX9Q 4OWWB 4A3LG 1G51A 4DR6L 4N8X1 3RZOH 5J1ZA 1HUNA 1XXGA 2RCFA 3ZJYC 3S15H 1T9HA 2UXCL 1CA6A 2VL6A 1D7QA 1YHBA 1CKOA 4LUVA 4DV6L 3HEJA 5IYBG 3KBGA 4B3TL 1YZ6A 4HJ7A 2CH4A 2DUDA 1N9WA 3JC66 2WIIB 1PRTD 4HSVA 1UWVA 4KY7A 4CHTB 1Y1VH 1LV9A 4C3JH 1HA5A 2LMCB 3HOVG 5EKKA 1A0IA 2I0QA 1XMQQ 4A3FG 5M5WB 3IFTA 4R4CA 3J7YW 3S24A 1CZGA 2IHFA 5F2DA 1KD1C 1D5ZC 1K9MC 1CUKA 1YNXA 4DXGA 4JI5L 3S9WA 3M4YA 1MSHA 1SSOA 3CCSA 2VNUD 3CW2C 1GJXA 2CQAA 2PW7A 1CA5A 1KNEA 5IT9c 3S17B 1G2SA 1KRSA 1RIPA 4A3JH 4C56C 4ULLA 2R7ZH 4BA2I 4JI7Q 3NTKA 1J5EQ 1ASZA 5C44H 1A8VA 1QVCA 2K33A 5EPLA 4DV2Q 4Y7NH 1BXTA 4QCLA 4DK0A 2L55A 3E6ZX 2F0QA 2VXWA 1VQ8A 1PXUA 4DUZQ 1K3BC 2RSOA 1SFOH 4ZKBB 5K5PA 1TQOA 3HKSA 1B9MA 4OO1G 1CKNB 1EIFA 4QIWE 5D14A 3TP6A 5T1IA 5C5MA 1RODA 2FXQA 2K4KA 3NP8A 3URYA 5M9OA 5CORA 3GV3A 2JN4A 2WB1G 3H3VI 3S1RH 1TWAH 1IKLA 4QUFA 1HZBA 4X62L 2JA8B 2QEJC 1QILA 1FL0A 3M85A 5CBAE 1SAPA 1GHJA 1BNZA 4IUTA 2QA4A 2HIVA 5J22A 3NE5B 3TDQA 1N36L 5BN5A 2RA4A 2JEAI 4A3DB 4P2CB 1YI2A 3O13A 3OYYA 5ELCA 5BR8Q 3D31A 4PMBA 3TS0A 3MEFA 1ML0D 1YNJC 2HCCA 2PYKA 4PQXA 1JR0D 1TWFH 2UXDL 1G6ZA 2WAQB 4BWGB 1IBLQ 1WTPA 5IGEA 3NSWA 2WV6D 2A69C 3A55A 2DJFC 4OIJA 2JJQA 2D9UA 2F0GA 4HJ9A 1N33L 1CT1D 1VQ9A 2E2HB 2KBNA 4OX9L 4BS9A 3S16B 2BDNA 1STNA 3FPUB 1MJEA 4OONA 4FXKC 4UAIA 5GQOA 1EL0A 3G48A 3V96A 5CV4A 1X3EA 2B8FA 1H95A 1LT6D 2ICEC 5FJ8H 5IYCH 1Q1BA 4JI6Q 3IAYA 5IYDH 1XPUA 2WB1E 5NUCA 1OTCA 2Y0SB 1AEXA 4DU9A 4HIOA 3CP0A 4YHHQ 1MI2A 4K8IA 4JI2Q 5M5XB 4EQPA 1HJPA 4A3IB 1AP0A 1EZ6A 3MHBA 2EOTA 1EQVA 2VQFL 3SDZA 2PQEA 1Z6HA 1RTNA 5IGDA 3VDYA 5C0XJ 1A15A 2PW5A 3GP7A 2A1AA 4JBJA 4IFDG 3P20A 1SNPA 1QUQB 1SFOB 4I7AA 4MIUA 2SOBA 3BVGA 1EQTA 1FGBD 3OW7A 4DV5L 4LF6L 4JW0A 4C3IG 1BCPD 5KYLA 4JV5L 3S1MH 3RD4A 4OO1H 4JI5Q 2L4NA 1XNRQ 2C5CA 2F4IA 1IW7C 3K57A 3CF5A 1C7YA 3UDGA 5ELDA 1XTDA 2F1MA 2WP8J 4K14A 5C44G 4QY7A 1ONLA 1EUJA 1Y1WB 2E8GA 4XQNA 1PH4A 3BVMA 2Z6KA 4A3JG 4CKEA 3OIQA 1L0WA 4A3BH 1TWAB 4POFA 4DV4L 3QJYA 1GUOA 1FYCA 4J1MA 2UUCQ 4DV0Q 2YTYA 1WTXA 3H6MA 5JEAJ 3HP3A 1Q8IA 5DM73 4DF7A 5I9PA 3A54A 5I2YA 4B3RQ 4YWMA 5FLXc 5C0XH 3CRKC 1YHAA 1EY6A 4JBWA 3RN5A 4RGTA 1SXTA 4N8FA 2BA1A 1RCVD 3IFDA 1KDAA 3K59A 2PQAA 4ME5A 3NWSA 1BCPB 1UUPA 1Y8PB 4C3IH 2TSSA 1EWIA 5FLMH 1C48A 3G71A 2QKIC 2NN6I 1HHVA 3DWAA 3K7AH 2Q8IB 3A5UA 3H3VC 1STHA 2UXBL 1M1KC 4IFDH 3GTQH 2A6ED 5LL6X 1B53A 1ENFA 3HRZC 5IYBH 2MP1A 1U0LA 2CWPA 1PRTF 5C3WA 5I9OA 1EYDA 3RMHA 4GKJL 2I5MX 2SEBD 1B4OA 1AE3A 1IBLL 5KYIA 2UXCQ 1YBYA 1HH2P 4IJLA 1E3PA 4JI8L 2UXDQ 4KHVA 2A6HD 4XIGS 1TWCB 4HEDA 3VR3A 1X65A 4ZAIA 1U5KA 3QOLA 3CMAA 3I73A 2QGQA 5AFWA 5LMUL 1VQDA 4UY8C 2LS01 4K0KQ 2LXKA 2RHQB 1E24A 4KI0A 2EIFA 5CGKA 3HOZB 1LT4D 4R4OA 4DV3Q 2D62A 3T4AC 3HKZB 5ELBA 3PIP3 3E5SA 2N8NA 4JI3Q 1V1QA 1K8MA 1VQ6A 2NZHA 3HOUG 3GV6A 1PFMA 3FKIH 1SE4A 4O42A 5CV9A 1HNXQ 2N88A 2PPBC 4POGA 2IX0A 2EXZA 2ALYB 3GD7A 3Q6SA 3NBHA 4RCOA 3RUZA 4O0AA 3PIO3 4G57A 4B3SL 2TMPA 4LF9L 5C44B 3PUZA 4ID6A 4WJ3M 1SJED 2BDOA 1A3TA 3C3LA 3UDXA 4DV5Q 4LF6Q 1PYBA 1Y1WH 1TS2A 2LXJA 5I6YA 4IUVA 4R8NA 1PH6A 1K28A 4LMQD 4A3IG 1PV4A 1B2TA 1L0XB 3LWUA 5J3BA 2F0IA 5E3FA 3STBC 3GTKB 2J7ZA 1NE3A 2Z9HA 4IPHA 3KYHC 3PSIA 4J8QA 4LFAQ 1TY0A 3WOFA 2EYJA 5G3LF 1PHJA 4A93B 3S1QB 3RR5A 1CKNA 4KJOA 4OHJA 3Q8DA 4B9XA 1T5XD 4HIDA 4ZUIA 1IXRA 1XPOA 5IGBA 2NVYH 1YIJA 1IBKL 3BZDB 4A3KB 2P5ZX 3TRZA 1EIYB 1O7LA 3CD6A 1B70B 1BCPC 2HIXA 4QB4A 3HFZB 1CQVA 1B1ZA 3VR4A 1YJNA 2UUBL 2F03A 3U4VA 2QW7A 1Q1EA 1HUMA 3CAMA 1RTOA 3A0JA 4QIWB 4LF5L 1BR9A 2KHIA 3SGIA 3D8GA 3Q22A 2ZJPA 2OT2A 2E74C 4QGUA 4JOIA 2HHHQ 2R7ZG 3L7ZC 2EPBA 5C5LA 1J6QA 4DV2L 2NZOA 4PV1C 1Q86C 4OGQC 3NBIA 1XMOQ 5D3IB 3J7A5 3OMGA 4K8JA 2F0EA 4A3KG 2E2IB 4DAMA 1Y14B 1O7IA 3GTOH 1H9RA 4XYOA 2K52A 4JVZA 4IZ8A 2AQ3B 2EJFC 3MWYW 1N8RC 1PVOA 1Q90A 2AHOB 2AMCB 3R2TA 3R8BA 1F2MA 1Q3LA 4KKUA 3TSSA 4A3FH 2ZTEA 4DR5Q 1K3RA 2HQEA 4K5WA 4QJFA 2ID0A 4PZ7A 1KTKA 5C4JB 3Q23A 3K5MA 1F9QA 1JE5A 1KDBA 1I4HA 1Y1VG 2VS1A 5CV8A 3EROA 4TQUS 2CCZA 4IPGA 3J81c 5G3LD 3SHLA 3HOZG 5CR3A 2K04A 4X65L 1PA6A 4OO1I 1NAPA 4WFN3 4KD4A 3MAQA 3D0FA 1X9NA 3GDEA 1MSGA 3J7ZC 3S1NB 4AYBG 2MGSA 3GTKH 3H91A 2G9HD 2GVAA 1GKHA 5IOCA 1JOOA 1IW7D 2RQXA 4C3JB 1PYSB 1SDFA 2YTVA 1HR0Q 3PUXA 2R92B 3OHXC 1STBA 1VQMA 3RZDB 3F2CA 2WINB 2OQKA 1IYVA 5M5YH 1WTOA 3VA7A 1B3QA 3PIPA 3ULPA 1AZPA 4LF8L 5BR8L 1WTRA 1I4XA 3GTPH 1B44D 4XQJA 3TREA 2Z4IA 4F7XA 2B63B 4HMJA 4DR6Q 1LO5D 5A2QE 1N32Q 2VB2X 1EEFD 2AQ2B 5M3FG 4QF4A 1SNDA 3PV0A 2NN6H 5A35A 1QE6A 1Y1WG 1UE5A 3TZUA 2V4DA 5CC4A 4LUOA 4AIMA 1R9TH 2NN6G 5EBCA 2B63G 4K2LA 2F0LA 3CCRA 2E2JB 1H9JA 3VA5A 3K80C 4JYAQ 3UDIA 1U4MA 2JP1A 5JJZA 5FO8B 2R7DA 3T13A 3HOUH 1D1KA 1WCMH 2NUCA 2XIWA 1JWSD 2SNSA 1VQBA 2NVTB 3RN2A 2VY3A 4DR7L 4A75A 1S5ED 3QO2A 1KHIA 2EYPA 4JI0Q 4A93H 3KLSA 3I4MH 2F0OA 1ICWA 2ATWA 1NR4A 2EYLA 4FP5D 2R92G 3K7UC 5IT9L 3GTJH 4HAEA 4JCVE 2KJXA 3KLRA 2OTLA 2XWBB 4G4KA 4AQYQ 1OXXK 2OQ0A 1EIGA 2EZVA 1DM0B 3CCJA 3KJOA 4YCUA 2A68C 2D0PA 2Z4HA 3J7AV 1A2UA 4DN4M 1SBBB 2BE5C 3NPPA 1DZ1A 1YHQA 1GUTA 1EQQA 2E75C 3RLFA 4HCSA 2IW3A 1PFSA 2HDLA 3WWVA 3BZCA 2NTSA 3M4QA 3K7AB 1G6PA 3E9IA 1GO3E 4C2MB 4NPSA 3A5ZB 3NTIA 1SYEA 1XJVA 5KNBA 3DEPA 4JI1Q 1A3UA 1ET9A 4ZQ3A 4ABNA 1U9RA 1L1OA 4RGMA 2F0DA 4DV4Q 2AQ1B 1ESFA 4A3KH 3KDFB 1VQIA 2HQLA 5COYA 1IBMQ 1GUWA 3NBHB 2K1BA 3NEMA 1S5BD 4H13C 3ERQA 2RKSA 3DWQA 3CMEA 2MHVA 1X3QA 3K5OA 3CCEA 1KL9A 4GLAC 1MD2D 5JOBA 1HNZL 4A3BB 1HFNA 3E0EA 2L11A
chains in the Genus database with same CATH topology
4JI2Q 4MZ9A 1TXYA 1PH3A 4C2MH 4LF4L 4C3HH 1HJPA 5ELNA 3HOYG 3ULLA 1UE1A 1E7ZA 2VQFL 4JG2A 1IYJB 1BBUA 3AEVA 3S14H 3VDYA 5C0XJ 1HNZQ 1CSQA 4JBJA 2A1AA 3HKZG 4IFDG 3EIVA 4LWCA 2E2HH 1QUQB 2ZM6Q 2JEBI 3I4MG 3M4PA 5LMNQ 4A3GH 5LMUQ 1E1OA 1PH9A 1N36Q 4DV5L 4LF6L 1TWCH 1MJCA 2UXBQ 1LUZA 4JI8Q 2D0OA 2LSSA 2MO1A 3K81C 4JV5L 3S1MH 1L1OC 4JI5Q 1V9PA 4A76A 4Y52H 4L5RC 1XNRQ 4TVAB 4OXPA 4HJ8A 3HOYH 4NXNL 4A3DG 2V1CC 3CF5A 1P16A 2CKZB 1C7YA 3GTGH 1UE7A 2WAQG 3UDGA 4QQBX 1XTDA 2I5LX 4UP7A 1Q7YC 1HNXL 4JI6L 1YVCA 1B7YB 2WP8J 4A3IH 2R93H 2AWNA 2OTJA 3OTOQ 1W2BA 1GD7A 5C44G 1HZCA 4QY7A 1PH2A 3CQZH 1EUJA 2VQEL 1WFQA 2E8GA 3CPFA 5IYDG 1PH4A 2JA5H 2Z6KA 1BBWA 2K5VA 3H0GG 3FP9A 5IE8A 1L0WA 3KF6A 3PIOA 5C4XH 2VZAA 3H15A 1HR0W 4ALPA 2B63H 4A3BH 4POFA 5IYCG 4DV4L 3AFPA 4GNXA 3K8AA 3HOXG 2UUCQ 1BVSA 3KJPA 2MNAA 1N33Q 4DV0Q 1Q82C 2YTYA 4DR7Q 3PF5A 4GNXB 5JEAJ 1FJGQ 1QUQA 1VQJA 3FKIG 4GN3B 4DK3C 4YWMA 5FLXc 3G6EA 4B3RQ 3RZDH 1Q81C 1YHAA 4ME3A 2PQAB 4JBWA 3RN5A 3CC4A 1YEZA 1HNWL 3JAMc 2BA1A 4MNOA 2VW9A 1N32L 5ELOA 1HZ9A 3TQYA 5M5WH 5C3EH 2L15A 2PQAA 1GVPA 4LFCL 3PO2H 1KIXA 4LF7L 4JI4L 4C3IH 1KQSA 1EWIA 1SLJA 1W3SA 2KCMA 5FLMH 3DLLA 1Z9FA 3G71A 1QZHA 1QZGA 1VQKA 3I4NH 2NN6I 1X54A 1XMQL 1XNRL 1C0AA 2IY5B 3K7AH 1SR3A 3ULJA 1OXUA 5DLQE 1UE6A 3FHWA 3A5UA 2ZM6L 2UXBL 1M1KC 3GTQH 4A93G 1WJJA 2IHEA 2MQHA 2F3IA 1BKBA 5IP9G 2VUMG 2RHSB 1N34L 4DR6L 4KHPL 3OTOL 5IYBH 1U0LA 2CWPA 2UU9L 3RLOA 4LF9Q 4GNXC 1QVFA 1X56A 4HIMA 1K8GA 1TWHH 4GN4B 3L0OA 2Z6KC 4DR5L 4GKJL 3J81i 2I5MX 3W1BA 1AE3A 1IBLL 2UXCQ 2ZJQA 2KENA 3I4OA 1YBYA 1VQEA 1HH2P 2VUMH 4IJLA 1J5EL 1E3PA 4JI8L 2YV5A 4P73A 5M3MH 5E7NA 5M5XH 4HJ5A 3U4ZA 4UP8A 2UXDQ 4JC0A 4XIGS 4UP9A 1PH5A 3S17H 4DV7Q 1X65A 2Q2IA 1U5KA 3CMAA 4YHHL 4A3CH 4WJ4A 2N3SA 2QGQA 3U50C 5LMNL 4DR3Q 1KC8C 5LMUL 3HOZH 1VQHA 1VQDA 3MXNB 4DAYB 2PNHA 2NVTH 4UY8C 5FLMG 3I4NG 4K0KQ 2CQOA 5AJ3L 2LXKA 3M7NA 2RHQB 3CCMA 1E24A 1OXSC 4KI0A 5AJ3Q 4YCWA 3CPWA 2EIFA 4IO9A 3M4OH 4YWLA 4DPGA 4P74A 5H1SE 4R4OA 4DV3Q 1MIUA 2D62A 5C3EG 4X66L 4DKAC 4GOPB 1PH8A 2H5XA 4DNIA 3GTLH 1S3OA 3CCLA 2ZTDA 4DK6C 2N8NA 4JI3Q 1V1QA 4DV7L 2R6GA 3W5OA 1LYLA 2AKWB 1VQ6A 2NZHA 5C0XG 1A63A 4LF4Q 1KRTA 4DUYL 3EBEA 3HOUG 3FKIH 4JI2L 4POGA 4IPDA 1HNXQ 2IX0A 3J81j 4NXMQ 3U58A 1VQFA 2ALYB 3GD7A 3OW2A 2F4VQ 3KOJA 3HOWH 3B6YA 3S1NH 2K50A 1VQAA 2A8VA 3LGJA 3I7FA 4BY1H 3TEHB 1XMOL 4X62Q 4O0AA 2K14A 4GS3A 4B3SL 3ER0A 4LF9L 3PUZA 5C4XG 4A3BG 4WJ3M 5HY6A 2K75A 3UE0A 1K73C 1NMFA 4BBRG 1FGUA 3UDXA 4LFCQ 4DV5Q 4LF6Q 4A3MG 5JJIA 1PYBA 3E9HA 1Y1WH 2LXJA 1SN8A 1XNQQ 2YYZA 3PF4A 1JT8A 1EFWA 1Q8KA 1PH6A 4A3IG 3NENA 1PV4A 4LF8Q 1KXLA 2YU9H 4RG1A 4XTCS 5J3BA 3F1ZA 3STBC 1GM5A 4BBSH 1NE3A 4IPHA 3F2DA 3KYHC 3I55A 3PSIA 4NB3A 1I94L 2XTIA 4LFAQ 4UPAA 4IPCA 3KF8B 1P8LA 2F52A 4LFAL 2Y0SE 4FDBA 3ERSX 5GAGC 2KHJA 2R92H 3BJUA 1PHJA 1EYGA 3RR5A 1CKNA 2JE6I 4KHPQ 3Q8DA 2PI2E 3CC2A 3HOVH 4X65Q 5GADC 4B3TQ 4HIDA 4A3GG 1IZ6A 1VQCA 3EN2A 1CKMA 1IXRA 5JEAG 1XPOA 3W1GA 2A19A 2VQEQ 2UUAL 2NVYH 4LW1A 1YIJA 1IBKL 2JA8H 4GKKQ 4JBKA 1TWGH 5HGQA 2KCTA 3TRZA 1EIYB 3TS2A 4GOPA 3CD6A 1B70B 1QVGA 1C9OA 2HIXA 2ASBA 1M90C 1AE2A 3HFZB 3G4SA 1SROA 1VQPA 1K8AC 1NMGA 4DUZL 1FVIA 2BH2A 1YJNA 2UUBL 3M3YH 5K36G 3U4VA 1Q1EA 3CAMA 1WCMG 3T1HQ 4NXNQ 3BU2A 3PUYA 4APVA 4X66Q 3KDFA 4P71A 3T1HL 3A0JA 3S2HH 2B3GA 4LF5L 2MFIA 4DR4L 3S16H 2KHIA 3SGIA 1UEBA 3T1YQ 1SMXA 4O2DA 1EOVA 3J80i 2ZJPA 2OWOA 5IWAQ 1NTGA 4QGUA 1Q46A 4JOIA 4A3LH 2BH8A 2HHHQ 4R4TA 1I6HH 2R7ZG 1N34Q 3L7ZC 4DV3L 1YJWA 1JMCA 2ES2A 2Q2TA 3PO2G 1PH7A 3S2DH 2GN5A 1J6QA 2WAQE 5EAYA 4DV2L 2NZOA 2IX1A 1Q86C 3PUWA 4J15A 5FJ8G 1MKHA 5IP7G 1XMOQ 4PG3A 3J7A5 4DR2L 1I5FA 3KF6B 4B3MQ 4L5QA 4A3KG 2C35B 3L2PA 1X6OA 4DAMA 1Y14B 1Z47A 4P75A 1O7IA 5M3FH 3GTOH 2AWOA 4HIKA 2JA6H 2MO0A 2EQSA 2K52A 5GAEC 1YJ9A 4IJHA 2RF4A 1PVOA 1N8RC 1VQLA 4AH6A 3S1QH 2AHOB 2AMCB 3GO5A 4BY7G 3H3VH 4P72A 4BY7H 4JI1L 4PZ8A 2EXDA 4LUZA 4HJAA 1OXVA 2BA0A 4A3FH 1S72A 4B3ML 4YY3Q 2F4VL 3GTMH 2ZTEA 4R4QA 4DR5Q 1K3RA 2UU9Q 1JB7A 4GKJQ 3BZKA 2ZJRA 1JJCB 4QJFA 2ID0A 3RNUA 4PZ7A 2B29A 2Q2HA 1X3GA 4DV1L 1JE5A 1Y1VG 2VS1A 3F8TA 5LMNW 1IBML 2RCNA 1RL2A 4TQUS 2I5HA 2CCZA 4X6AH 4IPGA 5IP7H 3J81c 1K83H 3HOZG 2E5LL 1A62A 3T1YL 4YCVA 1VS0A 1ASYA 2NVXH 1D8LA 4A3CG 4X65L 5C4JH 1PA6A 4OO1I 1VQ5A 2YTXA 2UUBQ 5GROA 4BXXG 4QL5A 3D0FA 4OX9Q 1X9NA 4OWWB 4A3LG 3PGZA 1G51A 2N49A 3PO3H 4LFBQ 3GDEA 3RZOH 4GOPC 2HT1A 3J7ZC 4DUYQ 3ZJYC 4AYBG 1AH9A 3UE1A 4DV0L 1T9HA 3S15H 3PO3G 2UXCL 5JJLA 2VL6A 3CCUA 1D7QA 1YHBA 1E22A 3GTKH 1CKOA 4DR4Q 2XGTA 3K0XA 4LUVA 4X64L 4DV6L 4JI7L 2JQOA 4BXXH 2GVAA 1XPRA 1GKHA 4JI0L 3M9BA 5IYBG 4JYAL 4B3TL 1VQ7A 1YZ6A 2E2IH 4HJ7A 1IL2A 5IP9H 2DUDA 4LFBL 1N9WA 1I50H 1PYSB 3JC66 2YTVA 1L2FA 1HR0Q 3PUXA 1I3QH 1UWVA 4AYBE 1Y1VH 2E2JH 2DGYA 2JA8G 5JJKA 4C3JH 2QEXA 1VQMA 3CXCA 3ICEA 3F2CA 4LF7Q 2OQKA 4A4IA 5M5YH 3HOVG 3F2BA 4PZ6A 1B8AA 1A0IA 2I0QA 2R7FA 1XMQQ 3PIPA 4A3FG 4R4CA 4B3RL 3ULPA 1DGSA 4LF8L 1HZAA 4IFDJ 4MTNA 3S24A 5BR8L 3GTPH 4AQYL 1XNQL 3TREA 2IHFA 1KD1C 4BBSG 4KHZA 4DR6Q 1N32Q 4H02A 1K9MC 2JA6G 1CUKA 1YNXA 3A74A 1I94Q 5M3FG 4JI5L 3HKZE 4DR1Q 3PV0A 4L5SA 1OXTA 2WFWA 1VQNA 3CCSA 4GLVB 2VNUD 2JA7G 1Y1WG 3CW2C 2CFMA 1UE5A 2ZTCA 2UUAQ 4DR2Q 1YITA 4BBRH 3HOXH 4LUOA 2JA7H 4AIMA 1R9TH 1X55A 2NN6G 3AFQA 5IT9c 2B63G 4GKKL 3CCRA 1RIPA 1KRSA 2Z0SA 4A3JH 2R7ZH 4R1JA 2K5HA 4BA2I 4BY1G 4JI7Q 4DR1L 1J5EQ 1ASZA 5C44H 3K80C 1A8VA 4JI3L 1JJGA 4JYAQ 3UDIA 1QVCA 4DV2Q 4Y7NH 3I2ZA 2R93G 2R7DA 3HOUH 1VQOA 4DUZQ 1VQ8A 1WCMH 1SFOH 3DM3A 5IWAL 1VQGA 4A3DH 4OWXB 1VQBA 3HKSA 1VQ4A 3PUVA 3RN2A 1X3FA 2VY3A 4OO1G 4DR7L 1CKNB 1EIFA 4QIWE 4A75A 1S40A 4B3SQ 4JBMA 4A3JG 1WI5A 1KHIA 1SE8A 4JI0Q 2K4KA 2FXQA 3UDFA 3AQQA 4A93H 4EX5A 3JAMi 2E5LQ 1SRUA 4YWKA 2CWAA 3CCVA 2WB1G 1HR0L 3I4MH 1NBWA 1WOCA 3J80c 2ATWA 4PMWA 3S1RH 1NY4A 3RLNA 3H3VI 4IOAA 1TWAH 1LM0A 1HZBA 4X62L 2R92G 1KAWA 3K7UC 4JOIC 3GTJH 1FL0A 3M85A 1EQRA 4JCVE 2OTLA 4AQYQ 2Y0SG 4IOCA 1OXXK 2PI2A 2OQ0A 2QA4A 2PMZE 2HIVA 3CCJA 3KJOA 4YCUA 3AYHB 2D0PA 1PH1A 1N36L 2JEAI 5C0XI 2JA9A 1YI2A 3OYYA 5BR8Q 3D31A 4A3MH 1Q12A 1YHQA 3CCQA 4RMFA 3TS0A 1EQQA 2IT1A 1NJIC 3RLFA 3KLWA 1IBKQ 3MEFA 2OCEA 2GVBA 4A3EH 4R4IA 1PFSA 3WWVA 1E1TA 2VQFQ 3CC7A 1K0RA 3BZCA 2N78A 1TWFH 4GN5A 3PCOB 2UXDL 3M4QA 1JJ2A 4LNQA 3I56A 4JI4Q 4DV6Q 3E9IA 1GO3E 2JK8A 1G6PA 3HOWG 1IBLQ 4NPSA 1G291 3A5ZB 4L5TA 1XJVA 4KLKA 1CSPA 1L1OB 4IFDI 4LF5Q 2JJQA 4JI1Q 3STBD 4HJ9A 2NVQH 4GLXA 4YY3L 1N33L 1L1OA 1VQ9A 2KBNA 4NXML 4OX9L 3IRBA 4DV4Q 4JV5Q 1MJEA 4OONA 4A3KH 3KDFB 1FJGL 4EQ5A 1VQIA 2K5NA 2HQLA 4DV1Q 5GQOA 3G48A 1WYDA 1X3EA 2UUCL 5GAHC 1H95A 1IBMQ 4BA1I 3NBHB 5FJ8H 4DR3L 5IYCH 1V43A 1LTLA 3NEMA 4A3EG 2Q2UA 1Q1BA 4JI6Q 3H0GH 1VCIA 3CMEA 5IY0A 2JA5G 5IYDH 3NELA 1HNWQ 3CCEA 5M3MG 1XPUA 2WB1E 1KL9A 4GLAC 1HNZL 4OWTB 1OTCA 3KFUA 4X64Q 3E0EA 4HIOA 2HHHL 3CP0A 4K0KL 4YHHQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 Q;  4MZ9 A;  1TXY A;  1PH3 A;  4C2M H;  4LF4 L;  4C3H H;  1HJP A;  5ELN A;  3HOY G;  3ULL A;  1UE1 A;  1E7Z A;  2VQF L;  4JG2 A;  1IYJ B;  1BBU A;  3AEV A;  3S14 H;  3VDY A;  5C0X J;  1HNZ Q;  1CSQ A;  4JBJ A;  2A1A A;  3HKZ G;  4IFD G;  3EIV A;  4LWC A;  2E2H H;  1QUQ B;  2ZM6 Q;  2JEB I;  3I4M G;  3M4P A;  5LMN Q;  4A3G H;  5LMU Q;  1E1O A;  1PH9 A;  1N36 Q;  4DV5 L;  4LF6 L;  1TWC H;  1MJC A;  2UXB Q;  1LUZ A;  4JI8 Q;  2D0O A;  2LSS A;  2MO1 A;  3K81 C;  4JV5 L;  3S1M H;  1L1O C;  4JI5 Q;  1V9P A;  4A76 A;  4Y52 H;  4L5R C;  1XNR Q;  4TVA B;  4OXP A;  4HJ8 A;  3HOY H;  4NXN L;  4A3D G;  2V1C C;  3CF5 A;  1P16 A;  2CKZ B;  1C7Y A;  3GTG H;  1UE7 A;  2WAQ G;  3UDG A;  4QQB X;  1XTD A;  2I5L X;  4UP7 A;  1Q7Y C;  1HNX L;  4JI6 L;  1YVC A;  1B7Y B;  2WP8 J;  4A3I H;  2R93 H;  2AWN A;  2OTJ A;  3OTO Q;  1W2B A;  1GD7 A;  5C44 G;  1HZC A;  4QY7 A;  1PH2 A;  3CQZ H;  1EUJ A;  2VQE L;  1WFQ A;  2E8G A;  3CPF A;  5IYD G;  1PH4 A;  2JA5 H;  2Z6K A;  1BBW A;  2K5V A;  3H0G G;  3FP9 A;  5IE8 A;  1L0W A;  3KF6 A;  3PIO A;  5C4X H;  2VZA A;  3H15 A;  1HR0 W;  4ALP A;  2B63 H;  4A3B H;  4POF A;  5IYC G;  4DV4 L;  3AFP A;  4GNX A;  3K8A A;  3HOX G;  2UUC Q;  1BVS A;  3KJP A;  2MNA A;  1N33 Q;  4DV0 Q;  1Q82 C;  2YTY A;  4DR7 Q;  3PF5 A;  4GNX B;  5JEA J;  1FJG Q;  1QUQ A;  1VQJ A;  3FKI G;  4GN3 B;  4DK3 C;  4YWM A;  5FLX c;  3G6E A;  4B3R Q;  3RZD H;  1Q81 C;  1YHA A;  4ME3 A;  2PQA B;  4JBW A;  3RN5 A;  3CC4 A;  1YEZ A;  1HNW L;  3JAM c;  2BA1 A;  4MNO A;  2VW9 A;  1N32 L;  5ELO A;  1HZ9 A;  3TQY A;  5M5W H;  5C3E H;  2L15 A;  2PQA A;  1GVP A;  4LFC L;  3PO2 H;  1KIX A;  4LF7 L;  4JI4 L;  4C3I H;  1KQS A;  1EWI A;  1SLJ A;  1W3S A;  2KCM A;  5FLM H;  3DLL A;  1Z9F A;  3G71 A;  1QZH A;  1QZG A;  1VQK A;  3I4N H;  2NN6 I;  1X54 A;  1XMQ L;  1XNR L;  1C0A A;  2IY5 B;  3K7A H;  1SR3 A;  3ULJ A;  1OXU A;  5DLQ E;  1UE6 A;  3FHW A;  3A5U A;  2ZM6 L;  2UXB L;  1M1K C;  3GTQ H;  4A93 G;  1WJJ A;  2IHE A;  2MQH A;  2F3I A;  1BKB A;  5IP9 G;  2VUM G;  2RHS B;  1N34 L;  4DR6 L;  4KHP L;  3OTO L;  5IYB H;  1U0L A;  2CWP A;  2UU9 L;  3RLO A;  4LF9 Q;  4GNX C;  1QVF A;  1X56 A;  4HIM A;  1K8G A;  1TWH H;  4GN4 B;  3L0O A;  2Z6K C;  4DR5 L;  4GKJ L;  3J81 i;  2I5M X;  3W1B A;  1AE3 A;  1IBL L;  2UXC Q;  2ZJQ A;  2KEN A;  3I4O A;  1YBY A;  1VQE A;  1HH2 P;  2VUM H;  4IJL A;  1J5E L;  1E3P A;  4JI8 L;  2YV5 A;  4P73 A;  5M3M H;  5E7N A;  5M5X H;  4HJ5 A;  3U4Z A;  4UP8 A;  2UXD Q;  4JC0 A;  4XIG S;  4UP9 A;  1PH5 A;  3S17 H;  4DV7 Q;  1X65 A;  2Q2I A;  1U5K A;  3CMA A;  4YHH L;  4A3C H;  4WJ4 A;  2N3S A;  2QGQ A;  3U50 C;  5LMN L;  4DR3 Q;  1KC8 C;  5LMU L;  3HOZ H;  1VQH A;  1VQD A;  3MXN B;  4DAY B;  2PNH A;  2NVT H;  4UY8 C;  5FLM G;  3I4N G;  4K0K Q;  2CQO A;  5AJ3 L;  2LXK A;  3M7N A;  2RHQ B;  3CCM A;  1E24 A;  1OXS C;  4KI0 A;  5AJ3 Q;  4YCW A;  3CPW A;  2EIF A;  4IO9 A;  3M4O H;  4YWL A;  4DPG A;  4P74 A;  5H1S E;  4R4O A;  4DV3 Q;  1MIU A;  2D62 A;  5C3E G;  4X66 L;  4DKA C;  4GOP B;  1PH8 A;  2H5X A;  4DNI A;  3GTL H;  1S3O A;  3CCL A;  2ZTD A;  4DK6 C;  2N8N A;  4JI3 Q;  1V1Q A;  4DV7 L;  2R6G A;  3W5O A;  1LYL A;  2AKW B;  1VQ6 A;  2NZH A;  5C0X G;  1A63 A;  4LF4 Q;  1KRT A;  4DUY L;  3EBE A;  3HOU G;  3FKI H;  4JI2 L;  4POG A;  4IPD A;  1HNX Q;  2IX0 A;  3J81 j;  4NXM Q;  3U58 A;  1VQF A;  2ALY B;  3GD7 A;  3OW2 A;  2F4V Q;  3KOJ A;  3HOW H;  3B6Y A;  3S1N H;  2K50 A;  1VQA A;  2A8V A;  3LGJ A;  3I7F A;  4BY1 H;  3TEH B;  1XMO L;  4X62 Q;  4O0A A;  2K14 A;  4GS3 A;  4B3S L;  3ER0 A;  4LF9 L;  3PUZ A;  5C4X G;  4A3B G;  4WJ3 M;  5HY6 A;  2K75 A;  3UE0 A;  1K73 C;  1NMF A;  4BBR G;  1FGU A;  3UDX A;  4LFC Q;  4DV5 Q;  4LF6 Q;  4A3M G;  5JJI A;  1PYB A;  3E9H A;  1Y1W H;  2LXJ A;  1SN8 A;  1XNQ Q;  2YYZ A;  3PF4 A;  1JT8 A;  1EFW A;  1Q8K A;  1PH6 A;  4A3I G;  3NEN A;  1PV4 A;  4LF8 Q;  1KXL A;  2YU9 H;  4RG1 A;  4XTC S;  5J3B A;  3F1Z A;  3STB C;  1GM5 A;  4BBS H;  1NE3 A;  4IPH A;  3F2D A;  3KYH C;  3I55 A;  3PSI A;  4NB3 A;  1I94 L;  2XTI A;  4LFA Q;  4UPA A;  4IPC A;  3KF8 B;  1P8L A;  2F52 A;  4LFA L;  2Y0S E;  4FDB A;  3ERS X;  5GAG C;  2KHJ A;  2R92 H;  3BJU A;  1PHJ A;  1EYG A;  3RR5 A;  1CKN A;  2JE6 I;  4KHP Q;  3Q8D A;  2PI2 E;  3CC2 A;  3HOV H;  4X65 Q;  5GAD C;  4B3T Q;  4HID A;  4A3G G;  1IZ6 A;  1VQC A;  3EN2 A;  1CKM A;  1IXR A;  5JEA G;  1XPO A;  3W1G A;  2A19 A;  2VQE Q;  2UUA L;  2NVY H;  4LW1 A;  1YIJ A;  1IBK L;  2JA8 H;  4GKK Q;  4JBK A;  1TWG H;  5HGQ A;  2KCT A;  3TRZ A;  1EIY B;  3TS2 A;  4GOP A;  3CD6 A;  1B70 B;  1QVG A;  1C9O A;  2HIX A;  2ASB A;  1M90 C;  1AE2 A;  3HFZ B;  3G4S A;  1SRO A;  1VQP A;  1K8A C;  1NMG A;  4DUZ L;  1FVI A;  2BH2 A;  1YJN A;  2UUB L;  3M3Y H;  5K36 G;  3U4V A;  1Q1E A;  3CAM A;  1WCM G;  3T1H Q;  4NXN Q;  3BU2 A;  3PUY A;  4APV A;  4X66 Q;  3KDF A;  4P71 A;  3T1H L;  3A0J A;  3S2H H;  2B3G A;  4LF5 L;  2MFI A;  4DR4 L;  3S16 H;  2KHI A;  3SGI A;  1UEB A;  3T1Y Q;  1SMX A;  4O2D A;  1EOV A;  3J80 i;  2ZJP A;  2OWO A;  5IWA Q;  1NTG A;  4QGU A;  1Q46 A;  4JOI A;  4A3L H;  2BH8 A;  2HHH Q;  4R4T A;  1I6H H;  2R7Z G;  1N34 Q;  3L7Z C;  4DV3 L;  1YJW A;  1JMC A;  2ES2 A;  2Q2T A;  3PO2 G;  1PH7 A;  3S2D H;  2GN5 A;  1J6Q A;  2WAQ E;  5EAY A;  4DV2 L;  2NZO A;  2IX1 A;  1Q86 C;  3PUW A;  4J15 A;  5FJ8 G;  1MKH A;  5IP7 G;  1XMO Q;  4PG3 A;  3J7A 5;  4DR2 L;  1I5F A;  3KF6 B;  4B3M Q;  4L5Q A;  4A3K G;  2C35 B;  3L2P A;  1X6O A;  4DAM A;  1Y14 B;  1Z47 A;  4P75 A;  1O7I A;  5M3F H;  3GTO H;  2AWO A;  4HIK A;  2JA6 H;  2MO0 A;  2EQS A;  2K52 A;  5GAE C;  1YJ9 A;  4IJH A;  2RF4 A;  1PVO A;  1N8R C;  1VQL A;  4AH6 A;  3S1Q H;  2AHO B;  2AMC B;  3GO5 A;  4BY7 G;  3H3V H;  4P72 A;  4BY7 H;  4JI1 L;  4PZ8 A;  2EXD A;  4LUZ A;  4HJA A;  1OXV A;  2BA0 A;  4A3F H;  1S72 A;  4B3M L;  4YY3 Q;  2F4V L;  3GTM H;  2ZTE A;  4R4Q A;  4DR5 Q;  1K3R A;  2UU9 Q;  1JB7 A;  4GKJ Q;  3BZK A;  2ZJR A;  1JJC B;  4QJF A;  2ID0 A;  3RNU A;  4PZ7 A;  2B29 A;  2Q2H A;  1X3G A;  4DV1 L;  1JE5 A;  1Y1V G;  2VS1 A;  3F8T A;  5LMN W;  1IBM L;  2RCN A;  1RL2 A;  4TQU S;  2I5H A;  2CCZ A;  4X6A H;  4IPG A;  5IP7 H;  3J81 c;  1K83 H;  3HOZ G;  2E5L L;  1A62 A;  3T1Y L;  4YCV A;  1VS0 A;  1ASY A;  2NVX H;  1D8L A;  4A3C G;  4X65 L;  5C4J H;  1PA6 A;  4OO1 I;  1VQ5 A;  2YTX A;  2UUB Q;  5GRO A;  4BXX G;  4QL5 A;  3D0F A;  4OX9 Q;  1X9N A;  4OWW B;  4A3L G;  3PGZ A;  1G51 A;  2N49 A;  3PO3 H;  4LFB Q;  3GDE A;  3RZO H;  4GOP C;  2HT1 A;  3J7Z C;  4DUY Q;  3ZJY C;  4AYB G;  1AH9 A;  3UE1 A;  4DV0 L;  1T9H A;  3S15 H;  3PO3 G;  2UXC L;  5JJL A;  2VL6 A;  3CCU A;  1D7Q A;  1YHB A;  1E22 A;  3GTK H;  1CKO A;  4DR4 Q;  2XGT A;  3K0X A;  4LUV A;  4X64 L;  4DV6 L;  4JI7 L;  2JQO A;  4BXX H;  2GVA A;  1XPR A;  1GKH A;  4JI0 L;  3M9B A;  5IYB G;  4JYA L;  4B3T L;  1VQ7 A;  1YZ6 A;  2E2I H;  4HJ7 A;  1IL2 A;  5IP9 H;  2DUD A;  4LFB L;  1N9W A;  1I50 H;  1PYS B;  3JC6 6;  2YTV A;  1L2F A;  1HR0 Q;  3PUX A;  1I3Q H;  1UWV A;  4AYB E;  1Y1V H;  2E2J H;  2DGY A;  2JA8 G;  5JJK A;  4C3J H;  2QEX A;  1VQM A;  3CXC A;  3ICE A;  3F2C A;  4LF7 Q;  2OQK A;  4A4I A;  5M5Y H;  3HOV G;  3F2B A;  4PZ6 A;  1B8A A;  1A0I A;  2I0Q A;  2R7F A;  1XMQ Q;  3PIP A;  4A3F G;  4R4C A;  4B3R L;  3ULP A;  1DGS A;  4LF8 L;  1HZA A;  4IFD J;  4MTN A;  3S24 A;  5BR8 L;  3GTP H;  4AQY L;  1XNQ L;  3TRE A;  2IHF A;  1KD1 C;  4BBS G;  4KHZ A;  4DR6 Q;  1N32 Q;  4H02 A;  1K9M C;  2JA6 G;  1CUK A;  1YNX A;  3A74 A;  1I94 Q;  5M3F G;  4JI5 L;  3HKZ E;  4DR1 Q;  3PV0 A;  4L5S A;  1OXT A;  2WFW A;  1VQN A;  3CCS A;  4GLV B;  2VNU D;  2JA7 G;  1Y1W G;  3CW2 C;  2CFM A;  1UE5 A;  2ZTC A;  2UUA Q;  4DR2 Q;  1YIT A;  4BBR H;  3HOX H;  4LUO A;  2JA7 H;  4AIM A;  1R9T H;  1X55 A;  2NN6 G;  3AFQ A;  5IT9 c;  2B63 G;  4GKK L;  3CCR A;  1RIP A;  1KRS A;  2Z0S A;  4A3J H;  2R7Z H;  4R1J A;  2K5H A;  4BA2 I;  4BY1 G;  4JI7 Q;  4DR1 L;  1J5E Q;  1ASZ A;  5C44 H;  3K80 C;  1A8V A;  4JI3 L;  1JJG A;  4JYA Q;  3UDI A;  1QVC A;  4DV2 Q;  4Y7N H;  3I2Z A;  2R93 G;  2R7D A;  3HOU H;  1VQO A;  4DUZ Q;  1VQ8 A;  1WCM H;  1SFO H;  3DM3 A;  5IWA L;  1VQG A;  4A3D H;  4OWX B;  1VQB A;  3HKS A;  1VQ4 A;  3PUV A;  3RN2 A;  1X3F A;  2VY3 A;  4OO1 G;  4DR7 L;  1CKN B;  1EIF A;  4QIW E;  4A75 A;  1S40 A;  4B3S Q;  4JBM A;  4A3J G;  1WI5 A;  1KHI A;  1SE8 A;  4JI0 Q;  2K4K A;  2FXQ A;  3UDF A;  3AQQ A;  4A93 H;  4EX5 A;  3JAM i;  2E5L Q;  1SRU A;  4YWK A;  2CWA A;  3CCV A;  2WB1 G;  1HR0 L;  3I4M H;  1NBW A;  1WOC A;  3J80 c;  2ATW A;  4PMW A;  3S1R H;  1NY4 A;  3RLN A;  3H3V I;  4IOA A;  1TWA H;  1LM0 A;  1HZB A;  4X62 L;  2R92 G;  1KAW A;  3K7U C;  4JOI C;  3GTJ H;  1FL0 A;  3M85 A;  1EQR A;  4JCV E;  2OTL A;  4AQY Q;  2Y0S G;  4IOC A;  1OXX K;  2PI2 A;  2OQ0 A;  2QA4 A;  2PMZ E;  2HIV A;  3CCJ A;  3KJO A;  4YCU A;  3AYH B;  2D0P A;  1PH1 A;  1N36 L;  2JEA I;  5C0X I;  2JA9 A;  1YI2 A;  3OYY A;  5BR8 Q;  3D31 A;  4A3M H;  1Q12 A;  1YHQ A;  3CCQ A;  4RMF A;  3TS0 A;  1EQQ A;  2IT1 A;  1NJI C;  3RLF A;  3KLW A;  1IBK Q;  3MEF A;  2OCE A;  2GVB A;  4A3E H;  4R4I A;  1PFS A;  3WWV A;  1E1T A;  2VQF Q;  3CC7 A;  1K0R A;  3BZC A;  2N78 A;  1TWF H;  4GN5 A;  3PCO B;  2UXD L;  3M4Q A;  1JJ2 A;  4LNQ A;  3I56 A;  4JI4 Q;  4DV6 Q;  3E9I A;  1GO3 E;  2JK8 A;  1G6P A;  3HOW G;  1IBL Q;  4NPS A;  1G29 1;  3A5Z B;  4L5T A;  1XJV A;  4KLK A;  1CSP A;  1L1O B;  4IFD I;  4LF5 Q;  2JJQ A;  4JI1 Q;  3STB D;  4HJ9 A;  2NVQ H;  4GLX A;  4YY3 L;  1N33 L;  1L1O A;  1VQ9 A;  2KBN A;  4NXM L;  4OX9 L;  3IRB A;  4DV4 Q;  4JV5 Q;  1MJE A;  4OON A;  4A3K H;  3KDF B;  1FJG L;  4EQ5 A;  1VQI A;  2K5N A;  2HQL A;  4DV1 Q;  5GQO A;  3G48 A;  1WYD A;  1X3E A;  2UUC L;  5GAH C;  1H95 A;  1IBM Q;  4BA1 I;  3NBH B;  5FJ8 H;  4DR3 L;  5IYC H;  1V43 A;  1LTL A;  3NEM A;  4A3E G;  2Q2U A;  1Q1B A;  4JI6 Q;  3H0G H;  1VCI A;  3CME A;  5IY0 A;  2JA5 G;  5IYD H;  3NEL A;  1HNW Q;  3CCE A;  5M3M G;  1XPU A;  2WB1 E;  1KL9 A;  4GLA C;  1HNZ L;  4OWT B;  1OTC A;  3KFU A;  4X64 Q;  3E0E A;  4HIO A;  2HHH L;  3CP0 A;  4K0K L;  4YHH Q; 
#chains in the Genus database with same CATH topology
 1EYC A;  4MZ9 A;  4LF4 L;  1JQY D;  2F0H A;  2RDF A;  1IYJ B;  3S14 H;  4A3E B;  5EGT A;  1HNZ Q;  4A3G B;  2RDH A;  2XWJ B;  2PZU A;  2B39 A;  3EIV A;  4H44 C;  2E2H H;  2EE1 A;  2ZM6 Q;  1WVL A;  4DA2 A;  5JPM C;  5LMN Q;  1ET6 A;  5EKL A;  1FNU A;  4JPB W;  4RFB A;  2D0O A;  2LSS A;  2MO1 A;  3K81 C;  1D2B A;  3N6R A;  3GTP B;  1V9P A;  4A76 A;  4L5R C;  3T16 A;  4HJ8 A;  1G2T A;  4A3D G;  4BY1 B;  1PLF A;  4EQO A;  3HOW B;  1UE7 A;  4QQB X;  3R2I A;  1B7Y B;  4A3I H;  3QOJ A;  4C1N I;  3P75 A;  2AWN A;  2HD3 A;  3KBX A;  3I4L A;  3PQI A;  1YNN C;  3CQZ H;  5IYD G;  3D6W A;  4X3U A;  1BBW A;  2MUY A;  3NTH A;  3KF6 A;  2M2L A;  5D3D A;  4CBV A;  1CK1 A;  2FIN B;  5E4X A;  5IYC G;  4IQZ A;  3HOX G;  1N33 Q;  2IPK D;  3NK9 A;  3K0Y A;  1Q82 C;  4DR7 Q;  1F2Y A;  5JVG 3;  5D65 A;  3G6E A;  3FKI G;  5I2X A;  4GN3 B;  5FO9 B;  1SMY D;  4ZUJ A;  4ME3 A;  3CC4 A;  1YEZ A;  1HNW L;  5M5W H;  4MTK A;  5DNF A;  3CKI B;  1O78 A;  4JI4 L;  3TP5 A;  3I72 A;  1W3S A;  3MFY A;  2KCM A;  1Z9F A;  1VQK A;  1QZH A;  1X54 A;  5T1G A;  1XMQ L;  2IY5 B;  1Z7T A;  3S1M B;  3D3R A;  3HG9 A;  1OXU A;  5DLQ E;  3FHW A;  5EQ0 A;  4NDX A;  5CMD A;  1WJJ A;  1BKB A;  1S5C D;  4KTA A;  2ZXO A;  1BUV T;  1D6E C;  3OTO L;  1HTP A;  4RKL A;  3OWE B;  3A8K E;  3CHB D;  3RLO A;  2R93 B;  4B08 A;  1K8G A;  2F0W A;  2K32 A;  4GN4 B;  2Z6K C;  4DR5 L;  1I4Q A;  5FLX L;  2HDM A;  2KEN A;  1VQE A;  1SYC A;  1LTS D;  5M3M H;  4P73 A;  5E7N A;  1STE A;  2B2U A;  4UP9 A;  4DV7 Q;  1ZYR C;  4FNF A;  2N3S A;  3U50 C;  1KC8 C;  1VQH A;  4TKO B;  5FLM G;  3M7N A;  5LL6 S;  1OXS C;  5AJ3 Q;  3M4O H;  4IO9 A;  1F2Z A;  1SE2 A;  1TU2 B;  4X66 L;  4LAA A;  2D2C C;  2H5X A;  4IUP A;  3GTL H;  1S3O A;  3MVV A;  2ZTD A;  4DK6 C;  3CCL A;  4OEL B;  4DV7 L;  3NHH A;  2R61 A;  4ZLT F;  2O2L D;  3F2U A;  5C0X G;  2Z8L A;  1KRT A;  4DUY L;  4LF4 Q;  1TWF B;  1TVX A;  5EJW A;  4AYB B;  3N52 A;  4C3I B;  2F4V Q;  1QG7 A;  4CJ1 B;  1EWH A;  1HPC A;  2WKD A;  2A8V A;  1VQA A;  3LGJ A;  3I7F A;  3I90 A;  1L0Y B;  3TEH B;  2PZW A;  4X62 Q;  2KEE A;  4A3B G;  5HY6 A;  2K75 A;  3UE0 A;  2CVR A;  1FGU A;  4LFC Q;  2L9H A;  2QCP X;  5JJI A;  4RGO S;  3PF4 A;  1EFW A;  1KXL A;  5EPK A;  4LF8 Q;  2ICI A;  2YU9 H;  4RG1 A;  2NZ1 D;  3ND9 A;  1EOT A;  1GM5 A;  3F2D A;  2B2V C;  3I55 A;  3GQB A;  3KF8 B;  1LLR D;  2K7V A;  2Y0S E;  5GAG C;  1EY9 A;  3BJU A;  1W6J A;  1I3Q B;  3HOV H;  4X65 Q;  4ZKC B;  2J0T D;  5GAD C;  4B3T Q;  1CKM A;  1IYU A;  3SK8 A;  3W1G A;  4XDX A;  1SJH D;  3ND8 A;  2EYO A;  5HGQ A;  1H9S B;  4GOP A;  1EZ8 A;  1M90 C;  3G4S A;  1SRO A;  1VQP A;  4DFA A;  2BH2 A;  1CZW A;  4KD3 A;  2H1E A;  4N9T A;  2B2W A;  2OEO A;  3BU2 A;  4J6H A;  3PUY A;  3LWE A;  1ILP A;  1LTB D;  1JCK B;  3T1H L;  3S2H H;  2RVL A;  1H9K A;  3QWN A;  2CHB D;  1G91 A;  3T1Y Q;  1GUN A;  1S4Z A;  1J8I A;  1VF5 C;  3OWF A;  2OWO A;  1HA6 A;  3WDN A;  4A3L H;  3GTG B;  4R4T A;  1MGS A;  3HZX A;  2EY2 A;  4Q0F A;  4DV3 L;  1YJW A;  1N34 Q;  1JMC A;  3P1H A;  1PH7 A;  3S2D H;  2IX1 A;  5EAY A;  1PTO F;  1CM9 A;  5FJ8 G;  1MHW C;  4X3T A;  5IP7 G;  1I5F A;  2R7Z B;  1ICF B;  1I50 B;  2KQ3 A;  2C35 B;  3R93 A;  1LTI D;  3M7G A;  4HMI A;  4EQN A;  1Z47 A;  4P75 A;  1QOH A;  4NMZ A;  4R8I A;  3VYS A;  2JA6 H;  1YJ9 A;  5GAE C;  2RF4 A;  3Q0A A;  3OOC A;  4AH6 A;  4P72 A;  4BY7 H;  4JI1 L;  4LUZ A;  1C4Q A;  2BA0 A;  4V0B A;  3GTM H;  4OEM B;  5JAV A;  4R4Q A;  1JB7 A;  2F0S A;  2ZJR A;  5C4H A;  1R4Q B;  4LJZ C;  2CW0 D;  4FXD A;  3IKJ A;  3F8T A;  1EY5 A;  1IBM L;  2RCN A;  1S5D D;  1A62 A;  1VS0 A;  1D8L A;  4A3C G;  3S15 B;  5C4J H;  4IUR A;  4DNT B;  5GRO A;  3VR2 A;  4F87 A;  3S2H B;  2A68 D;  1STA A;  4LFB Q;  4GOP C;  3AMU A;  2HT1 A;  4DUY Q;  2O4X A;  1AH9 A;  3BDO A;  3PO3 G;  3CCU A;  1AN8 A;  5ELE A;  4DR4 Q;  2RDG A;  4V19 0;  3K0X A;  4X64 L;  4BXX H;  4JI7 L;  3D4R A;  3A56 A;  1VQ7 A;  2E2I H;  1UAP A;  1ILQ A;  5IP9 H;  4LFB L;  5C3E B;  1I50 H;  1L2F A;  1EYA A;  1I3Q H;  3HOV B;  4AYB E;  1B9N A;  3HGB A;  2DGY A;  3QB3 A;  5JJK A;  1WD1 A;  3CXC A;  1HQM C;  1H9S A;  2JA6 B;  1F9S A;  4LF7 Q;  4DAP A;  4PZ6 A;  2RSN A;  5IGG A;  1B8A A;  2F0V A;  1QCB D;  2KCN A;  1TII D;  2D5D A;  1I4R A;  4IFD J;  4MTN A;  2FMM A;  3BDL A;  1QWY A;  2B2W C;  2DNE A;  4KHZ A;  4H02 A;  3HKZ E;  3J80 L;  2ZTC A;  3EVQ A;  4DR2 Q;  5M3F B;  1YIT A;  2WKC A;  2Z0S A;  1E2W A;  1YNN D;  5LHY 1;  4R1J A;  2K5H A;  3X3N A;  3V05 A;  1RJT A;  4JI3 L;  1JIC A;  3I2Z A;  2DJG C;  2R93 G;  5JVH 3;  3GTL B;  5IGC A;  1GOZ A;  3SK5 A;  1VQO A;  5EBD A;  1VQG A;  5A2Q L;  3MXN A;  5JPN C;  1PTO H;  1X3F A;  4C3J G;  1K0S A;  1DOM A;  4B3S Q;  2PO4 A;  1WI5 A;  3UDF A;  2EY6 A;  3M3Y B;  5JEA H;  4EX5 A;  1FD7 D;  1SRU A;  1QNU A;  4YWK A;  2E5L Q;  3GTJ B;  3RLN A;  4IOA A;  5FK9 C;  3KLS X;  1SYD A;  2F3W A;  3J80 E;  3I4M B;  1EQR A;  1FNV A;  5KNC A;  2PCF B;  3EJI A;  3FVQ A;  4F88 A;  3AU7 A;  1E2Z A;  1PZJ D;  2VB3 X;  3AYH B;  2SNM A;  2ZT9 C;  4XT1 B;  1A2T A;  4KV6 A;  1PH1 A;  3M4O B;  1WCM B;  4A3M H;  1Q12 A;  1HQR D;  3CCQ A;  2KEC A;  4RMF A;  1NJI C;  3DM1 A;  1TS5 A;  3KLW A;  1IBK Q;  2Z1C A;  2OCE A;  2GVB A;  4U67 3;  4A3E H;  4R4I A;  3NQT A;  1M4V A;  3CC7 A;  2FMC A;  2VQF Q;  4GN5 A;  4NKL A;  3KK7 A;  3W3A A;  1JJ2 A;  4LNQ A;  3FEW X;  4JI4 Q;  1HCZ A;  2JK8 A;  3QR8 A;  3HOW G;  5J39 A;  4L5T A;  3GTQ B;  1JWU D;  2IL8 A;  4C1N K;  1L1O B;  4LF5 Q;  3TME A;  3STB D;  1QJO A;  2F0K A;  2Q8R E;  1HXY D;  4RHR A;  1SEB D;  3IRB A;  4JV5 Q;  4WOR A;  3OSO A;  1FJG L;  4EQ5 A;  2K5D A;  4DV1 Q;  1WYD A;  2UUC L;  4DR3 L;  1V43 A;  1LTL A;  1NNX A;  4A3E G;  2XNA C;  3H0G H;  3J81 E;  1VMP A;  2JA5 G;  3NEL A;  1HNW Q;  5C4X B;  2DY8 A;  1Y8N B;  4X64 Q;  1BCP F;  2HHH L;  3G7L A;  1DJR D;  4DAV A;  1WTV A;  1TKW B;  4C2M H;  3DHQ A;  4C3H H;  3QG1 A;  5KND A;  3SK4 A;  4IN3 A;  3LX0 A;  3MXU A;  1BBU A;  3AEV A;  2B2Y C;  1I4P A;  1CSQ A;  4KKS A;  2QDB A;  1AZQ A;  1ZYR D;  2B2V A;  1DYQ A;  4A3G H;  5LMU Q;  3PO2 B;  1E1O A;  1PH9 A;  3SE0 A;  3TBI B;  4FO2 A;  1JOQ A;  3LNN A;  4YIJ A;  1MJC A;  2UXB Q;  1LUZ A;  2EYM A;  4E6I A;  2F0T A;  1KLU D;  4Y52 H;  5TSS A;  4TVA B;  1TWG B;  3HOY H;  2V1C C;  2C9O A;  2CKZ B;  3GTG H;  2LY7 A;  2WAQ G;  4CDE C;  1HNX L;  2EJG C;  4JI6 L;  1SMY C;  1YVC A;  2XN9 C;  2R93 H;  1PMR A;  3DXJ C;  2FJ2 A;  2OTJ A;  1W2B A;  1DON A;  2I07 B;  4I7Z C;  4WJW A;  1J9O A;  1E2V A;  1WFQ A;  3CPF A;  2G9D A;  1DOK A;  4K0K L;  3FP9 A;  3PIO A;  3H15 A;  5C4X H;  3K5L A;  1OO9 B;  3AFP A;  3K8A A;  2MNA A;  1C8C A;  4EVO A;  3C1E A;  5FLX E;  3L3O C;  4GNX B;  1QNK A;  1X32 A;  4XQQ A;  4DK3 C;  1VQJ A;  2KHS A;  1Q81 C;  1S5F D;  1M8A A;  2O5J C;  1PFN A;  5CBE E;  1BF4 A;  3JAM c;  1ENC A;  2F0F A;  2K03 A;  4MNO A;  5ELO A;  1HZ9 A;  2VW9 A;  5C3E H;  3I4N B;  2E2D C;  1N32 L;  2L15 A;  3T53 B;  3J7A F;  1K83 B;  4PNY A;  5HGT A;  1GVP A;  4LFC L;  3CU7 A;  1PRT C;  5HUR A;  4OIK A;  1KIX A;  4M8A A;  1SLJ A;  3DLL A;  1QZG A;  3I4N H;  1STG A;  4RWS C;  1XNR L;  2NBF A;  4JK1 C;  4G7O C;  4RAU C;  3TP7 A;  4Z9C B;  1BQQ T;  2IHE A;  2F3I A;  2MQH A;  3BYT B;  1O7Z A;  2RHS B;  5IP9 G;  1N34 L;  2VUM G;  1O80 A;  4KHP L;  1GHK A;  3D4D A;  4LF9 Q;  4GNX C;  4N9P A;  2PZT A;  5CV6 A;  1QVF A;  2E76 C;  1TWH H;  3I8Z A;  3J81 i;  3W1B A;  2HUG A;  2B2T C;  1GXD C;  1J5E L;  4K2K A;  1VF7 A;  4HJ5 A;  5M5X H;  1Y1V B;  1FR3 A;  3U4Z A;  4UP8 A;  1SNM A;  2XRQ D;  1PH5 A;  3S17 H;  2Q2I A;  4A3C H;  3K5N A;  4DR3 Q;  2ZXR A;  1I4G A;  4PMC A;  5I6W A;  1KNA A;  2PNH A;  1NUC A;  2NVT H;  5AJ3 L;  1PYW D;  1ENA A;  3PO2 G;  3CPW A;  1EWC A;  4RGN A;  3NWT A;  5H1S E;  1MIU A;  4DKA C;  2L12 A;  1PH8 A;  3EA6 A;  4DNI A;  4IUQ A;  2R6G A;  2F0P A;  3W5O A;  3MC0 B;  1LYL A;  4TRD A;  1BOS A;  3ONA B;  3SEB A;  3C1F A;  3NUC A;  1GUS A;  4IPD A;  1B50 A;  3J81 j;  4CGY B;  3U58 A;  4NXM Q;  1KAA A;  3KOJ A;  3HOW H;  1V1P A;  3BG3 A;  3MEH A;  4BY1 H;  1XMO L;  2K14 A;  4GS3 A;  4FF3 A;  1WD0 A;  1K73 C;  3SVM A;  4BBR G;  2DN8 A;  2XRS D;  1EY4 A;  4A3M G;  1AFP A;  3E9H A;  1TT2 A;  1JT8 A;  1XNQ Q;  2YYZ A;  3PO3 B;  3HOX B;  4ZK9 B;  2QIL A;  3NEN A;  4M1U B;  4XTC S;  1U4R A;  4KKT A;  3V2T A;  3H0G B;  3MA2 B;  4A3J B;  4BBS H;  3C2P A;  3K58 A;  3I91 A;  4UPA A;  4IPC A;  1P8L A;  2F52 A;  2A74 C;  4BY7 B;  2XVS A;  4TSS A;  2JE6 I;  2KUM A;  1W6K A;  3OMC A;  3OPO A;  1A3V A;  1VQC A;  3EN2 A;  1O7Y A;  1CI3 M;  5JEA G;  2A19 A;  2VQE Q;  4L6T B;  4LW1 A;  2UUA L;  2JA8 H;  4JBK A;  2KCT A;  1TS3 A;  1JWM D;  3ITP A;  1QVG A;  1C9O A;  2ASB A;  2PMZ B;  5K36 G;  1EY0 A;  2LFN A;  3T1H Q;  4NXN Q;  5E1F A;  4ZCK A;  4I65 A;  1BBX C;  2B2T A;  2B3G A;  2MFI A;  3G6J B;  3S16 H;  1Y8O B;  1CHQ D;  1EY7 A;  1SMX A;  4O2D A;  4A3M B;  1EOV A;  3J80 i;  4CKC A;  1U4L A;  5IWA Q;  1NTG A;  2BH8 A;  4KJN A;  3A7L A;  1I6H H;  2EY1 A;  4CDF C;  2EYH A;  2WAQ E;  3SXH A;  3DEO A;  1XWE A;  2MPM A;  2K5Q A;  1WTQ A;  3KF6 B;  2DY7 A;  3FDT A;  4KY6 A;  4B3M Q;  2EY5 A;  4L5Q A;  3L2P A;  1X6O A;  1I6V C;  5CV7 A;  2AWO A;  4HIK A;  1DOL A;  2MO0 A;  2EQS A;  2QF7 A;  2L1B A;  2A6H C;  4IJH A;  1Y69 U;  1KDC A;  1VQL A;  4FF1 A;  4FXG C;  3D6C A;  4UHV A;  5I4D A;  3H3V H;  4PZ8 A;  2M00 A;  1OXV A;  2F0U A;  3JAM E;  1S72 A;  4B3M L;  1SNQ A;  1NSN S;  3BZK A;  1JJC B;  4XXE A;  2B29 A;  2G5D A;  3FPP A;  2NVQ B;  1X3G A;  4DV1 L;  3S2D B;  5LMN W;  4IUN A;  4RCN A;  4X6A H;  4FYD A;  2B2Y A;  1EU3 A;  3A8J E;  4RHS A;  2SDF A;  2OF1 A;  4BXX G;  3PGZ A;  4UDU C;  2N49 A;  3PO3 H;  3T51 B;  3MXP A;  1I6H B;  5IOD A;  3UE1 A;  2WB1 B;  4DV0 L;  4BBS B;  5JJL A;  3HOU B;  1E22 A;  1SYG A;  4CJ0 B;  2XGT A;  4KK7 A;  1K8O A;  2JQO A;  1EFI D;  1KAB A;  1XPR A;  2A73 B;  3H94 A;  3M9B A;  4JI0 L;  4JYA L;  4A3F B;  1TY2 A;  1IL2 A;  2JXM B;  2F0J A;  2KA7 A;  1LTR D;  2E2J H;  2JA8 G;  4GZY C;  2VUM B;  2QEX A;  3ICE A;  1XX8 A;  4A4I A;  4KN4 C;  3F2B A;  3VR6 A;  2R7F A;  4ILW A;  3DMU A;  4B3R L;  1DGS A;  1HZA A;  1KLG D;  4AQY L;  1XNQ L;  2JYO A;  2J4X A;  4BBS G;  4CDC C;  2JA6 G;  4HTH A;  1I94 Q;  3A74 A;  4X3S A;  5KEE A;  4DR1 Q;  1DXM A;  5KRU A;  4L5S A;  1OXT A;  2WFW A;  1VQN A;  5EKI A;  4GLV B;  3A7A B;  2JA7 G;  2CFM A;  2YU9 B;  2UUA Q;  4BBR H;  3HOX H;  2JA7 H;  1X55 A;  3AFQ A;  4GKK L;  3T56 B;  5ELF A;  5FOB B;  4BY1 G;  4DR1 L;  3KF8 A;  3GTM B;  1JJG A;  3ZYY X;  1X3P A;  4H7B A;  3DM3 A;  5IWA L;  4A3D H;  1E0B A;  4OWX B;  1VQ4 A;  3PUV A;  2A69 D;  4KY5 A;  4FVM A;  1S40 A;  4JBM A;  1SE8 A;  4L63 B;  2A5H A;  3AQQ A;  1XYI A;  1PTO D;  4O1N A;  3JAM i;  3BDC A;  1U4P A;  5C6A A;  2CWA A;  3CCV A;  1HR0 L;  1LT5 D;  1NBW A;  1WOC A;  2KVM A;  5CV5 A;  3J80 c;  4PMW A;  1NY4 A;  1LM0 A;  1KAW A;  2IJ0 A;  4JOI C;  1CQF A;  4DNR B;  4OL7 A;  4B9W A;  1RF2 D;  1V1P B;  2H4O A;  2I46 A;  4U68 A;  3FKI B;  3PMF A;  2Y0S G;  4IOC A;  4MHE A;  5M3M B;  2PI2 A;  2PMZ E;  3D4W A;  2NWG A;  3U9S A;  1SE3 A;  1JOK A;  3MZ5 A;  1D5M C;  3E0J A;  5C0X I;  2JA9 A;  4IAL A;  2X69 A;  2XSC A;  3AB9 A;  4DGZ A;  4F8M A;  2IT1 A;  1II3 A;  4XT3 B;  2DNC A;  1E1T A;  4Y7N B;  2JA5 B;  1K0R A;  2N78 A;  3PCO B;  1ZKO A;  5IIF A;  3KUP A;  3I56 A;  4DV6 Q;  1IKM A;  2IX3 A;  4CJ2 C;  1G29 1;  3L9A X;  3P7J A;  3FRP B;  4KLK A;  3VYU A;  1CSP A;  4IFD I;  3S14 B;  3A8I E;  1EIH A;  2NVQ H;  4GLX A;  4YY3 L;  4L8J A;  4H0L C;  1HRJ A;  4NXM L;  5DEH A;  1CHP D;  3OIP A;  2EYF A;  2K5N A;  4HR7 B;  1IL8 A;  1JC7 A;  2JSO A;  3UI2 A;  2BE5 D;  2KED A;  3CQZ B;  5GAH C;  4BA1 I;  1WTW A;  2Q2U A;  1VCI A;  1PTO C;  2OXP A;  4X3K A;  5IY0 A;  1UNS A;  3I70 A;  3TN2 A;  5M3M G;  2NTT A;  3EFX D;  3KFU A;  4OWT B;  2F0M A;  1TWH B;  2EVB A;  4G7Z C;  1G8Z D;  1TXY A;  1PH3 A;  2CH4 W;  5ELN A;  2K28 A;  1SNO A;  3HOY G;  3ULL A;  1UE1 A;  1E7Z A;  3NXW A;  4JG2 A;  5K36 H;  1RKN A;  2N55 A;  4BBR B;  3VYT A;  1AW7 A;  2R3Z A;  2QDL A;  3HKZ G;  4LWC A;  3H09 A;  2JEB I;  3SK6 A;  3I4M G;  3M4P A;  2X6G A;  1HFG A;  1LAC A;  1N36 Q;  1TWC H;  4CDD C;  3BS1 A;  1A6X A;  4JI8 Q;  1L1O C;  1RHP A;  2K05 A;  2NVX B;  1RDP D;  5EPJ A;  1LAB A;  2MJ8 A;  3U9O A;  1TS4 A;  2FHT A;  4OXP A;  4NXN L;  3BVZ A;  5FO7 B;  1P16 A;  3VR5 A;  2BOS A;  1SYB A;  4FF2 A;  4C3H G;  1NR2 A;  1LTT D;  1VMC A;  2BCO A;  2I5L X;  4UP7 A;  3K6O A;  1Q7Y C;  3NQI A;  2O5I C;  3OTO Q;  4S3S A;  2GA4 B;  1GD7 A;  1MBY A;  1HZC A;  1PH2 A;  1JB3 A;  1GUG A;  2VQE L;  2JA5 H;  1HTL D;  4HSP A;  2K5V A;  3H0G G;  5IE8 A;  1HR0 W;  2VZA A;  2B63 H;  3IL8 A;  4ALP A;  3FMC A;  4GNX A;  2EDG A;  1BVS A;  3KJP A;  5IT9 E;  2NYZ D;  3Q24 A;  5KIX A;  3PF5 A;  2B2U C;  4XYQ A;  1FJG Q;  3EQL C;  3E3X A;  1QUQ A;  1CFM A;  5E4W C;  3RZD H;  4Q5V A;  2PQA B;  3MXG A;  2EJM A;  2L0C A;  3TQY A;  1STY A;  1H9M A;  5ISR A;  5KGU A;  3PO2 H;  1ESR A;  4CKB A;  4LF7 L;  1EU4 A;  2L5T A;  1KQS A;  4EGV A;  4K5V A;  1C0A A;  1SR3 A;  3ULJ A;  4K5X A;  1UE6 A;  2ZM6 L;  2AUK A;  5BN4 A;  3CRL C;  1WTH A;  5C4Z A;  4KN7 C;  1IHZ A;  2F0N A;  3X3M A;  2K6A A;  4K6D A;  2UU9 L;  2Q8T A;  5BN3 A;  1X56 A;  4HIM A;  3L0O A;  4HN7 A;  2ZXP A;  5C3X A;  3BYY B;  2ZJQ A;  3I4O A;  4HCE A;  2VUM H;  4C3H B;  4LK1 C;  2Z6B A;  2UUB Q;  2YV5 A;  3JAM L;  4FF4 A;  4JC0 A;  2A6E C;  2X6L A;  4WJ4 A;  1EEI D;  4YHH L;  2JA7 B;  5LMN L;  3HOZ H;  3MXN B;  4DAY B;  3I4N G;  3C46 A;  2CQO A;  1VDZ A;  3CCM A;  1FNW A;  1TR5 A;  4YCW A;  4YWL A;  4DPG A;  4P74 A;  2WAC A;  3TP8 A;  5IGF A;  5C3E G;  4GOP B;  1LTA D;  4WRD A;  2AUJ D;  4RA8 A;  3W2D A;  2AKW B;  1PTO B;  1A63 A;  1ZXT A;  3EBE A;  5DAU A;  1PZK D;  3VYR A;  4JI2 L;  3R3O A;  4IUU A;  4K6L A;  1VQF A;  3OW2 A;  3B6Y A;  4DK1 A;  3S1N H;  2K50 A;  1BO0 A;  3ER0 A;  5C4X G;  2KCC A;  1NMF A;  1RD9 D;  1NCV A;  1PDQ A;  5DM6 3;  2K01 A;  1PFB A;  1SN8 A;  1SNC A;  1Q8K A;  3TZD A;  2M9V A;  3F1Z A;  5FKA C;  3QIA A;  2F3V A;  1SYF A;  4NB3 A;  1YNJ D;  1T5E A;  1I94 L;  2FFK B;  2XTI A;  4KMU C;  1ZEQ X;  1F9P A;  4LFA L;  4FDB A;  3ERS X;  2KHJ A;  2R92 H;  1EYG A;  4KHP Q;  1LT3 D;  2PI2 E;  3CC2 A;  4DAY A;  3HS0 C;  4A3G G;  1IZ6 A;  2ENB A;  1CTM A;  4GKK Q;  4A93 G;  1JOR A;  5M5Y B;  1TWG H;  3HOY B;  4NW2 A;  3TS2 A;  5CYU A;  2LKV A;  1AE2 A;  1K8A C;  1NMG A;  4DUZ L;  1FVI A;  2PNR C;  3M3Y H;  1R4P B;  1WCM G;  4APV A;  4X66 Q;  3DUZ A;  3KDF A;  4P71 A;  4DR4 L;  3MTS A;  2KOL A;  1UEB A;  2CW0 C;  1D1I A;  1QB5 D;  1UEA B;  1Q46 A;  1R9T B;  2ES2 A;  2Q2T A;  2B8G A;  2GN5 A;  3J81 L;  1F9R A;  1F2L A;  3I3C A;  3PUW A;  4J15 A;  1LTG D;  1MKH A;  1PZI D;  4RH6 A;  4PG3 A;  4DR2 L;  4QUC A;  3DWP A;  4R9W A;  1DD2 A;  1JE4 A;  2NVY B;  5M3F H;  1BDO A;  1D5X C;  4ODG A;  2IWH A;  3WOE A;  1PRT B;  3MFG A;  2RBM A;  3S1Q H;  3GO5 A;  3SR1 A;  5L37 A;  3GTO B;  4BY7 G;  1F77 A;  2K5W A;  1B3A A;  2EXD A;  4ZRZ A;  1EY8 A;  4HJA A;  2F4V L;  1V8Q A;  4YY3 Q;  4GKJ Q;  2UU9 Q;  4DXF A;  4NP5 A;  1XTC D;  4MN3 A;  3RNU A;  2NB0 A;  4QMG A;  2HCI A;  2Q2H A;  4RKB A;  4ZYS A;  1DCZ A;  4G7H C;  3S1R B;  1RL2 A;  2I5H A;  3RZO B;  5IP7 H;  1K83 H;  1V1O A;  2E5L L;  3T1Y L;  4YCV A;  1ASY A;  2NVX H;  1VQ5 A;  2YTX A;  4QL5 A;  4OX9 Q;  4OWW B;  4A3L G;  1G51 A;  4DR6 L;  4N8X 1;  3RZO H;  5J1Z A;  1HUN A;  1XXG A;  2RCF A;  3ZJY C;  3S15 H;  1T9H A;  2UXC L;  1CA6 A;  2VL6 A;  1D7Q A;  1YHB A;  1CKO A;  4LUV A;  4DV6 L;  3HEJ A;  5IYB G;  3KBG A;  4B3T L;  1YZ6 A;  4HJ7 A;  2CH4 A;  2DUD A;  1N9W A;  3JC6 6;  2WII B;  1PRT D;  4HSV A;  1UWV A;  4KY7 A;  4CHT B;  1Y1V H;  1LV9 A;  4C3J H;  1HA5 A;  2LMC B;  3HOV G;  5EKK A;  1A0I A;  2I0Q A;  1XMQ Q;  4A3F G;  5M5W B;  3IFT A;  4R4C A;  3J7Y W;  3S24 A;  1CZG A;  2IHF A;  5F2D A;  1KD1 C;  1D5Z C;  1K9M C;  1CUK A;  1YNX A;  4DXG A;  4JI5 L;  3S9W A;  3M4Y A;  1MSH A;  1SSO A;  3CCS A;  2VNU D;  3CW2 C;  1GJX A;  2CQA A;  2PW7 A;  1CA5 A;  1KNE A;  5IT9 c;  3S17 B;  1G2S A;  1KRS A;  1RIP A;  4A3J H;  4C56 C;  4ULL A;  2R7Z H;  4BA2 I;  4JI7 Q;  3NTK A;  1J5E Q;  1ASZ A;  5C44 H;  1A8V A;  1QVC A;  2K33 A;  5EPL A;  4DV2 Q;  4Y7N H;  1BXT A;  4QCL A;  4DK0 A;  2L55 A;  3E6Z X;  2F0Q A;  2VXW A;  1VQ8 A;  1PXU A;  4DUZ Q;  1K3B C;  2RSO A;  1SFO H;  4ZKB B;  5K5P A;  1TQO A;  3HKS A;  1B9M A;  4OO1 G;  1CKN B;  1EIF A;  4QIW E;  5D14 A;  3TP6 A;  5T1I A;  5C5M A;  1ROD A;  2FXQ A;  2K4K A;  3NP8 A;  3URY A;  5M9O A;  5COR A;  3GV3 A;  2JN4 A;  2WB1 G;  3H3V I;  3S1R H;  1TWA H;  1IKL A;  4QUF A;  1HZB A;  4X62 L;  2JA8 B;  2QEJ C;  1QIL A;  1FL0 A;  3M85 A;  5CBA E;  1SAP A;  1GHJ A;  1BNZ A;  4IUT A;  2QA4 A;  2HIV A;  5J22 A;  3NE5 B;  3TDQ A;  1N36 L;  5BN5 A;  2RA4 A;  2JEA I;  4A3D B;  4P2C B;  1YI2 A;  3O13 A;  3OYY A;  5ELC A;  5BR8 Q;  3D31 A;  4PMB A;  3TS0 A;  3MEF A;  1ML0 D;  1YNJ C;  2HCC A;  2PYK A;  4PQX A;  1JR0 D;  1TWF H;  2UXD L;  1G6Z A;  2WAQ B;  4BWG B;  1IBL Q;  1WTP A;  5IGE A;  3NSW A;  2WV6 D;  2A69 C;  3A55 A;  2DJF C;  4OIJ A;  2JJQ A;  2D9U A;  2F0G A;  4HJ9 A;  1N33 L;  1CT1 D;  1VQ9 A;  2E2H B;  2KBN A;  4OX9 L;  4BS9 A;  3S16 B;  2BDN A;  1STN A;  3FPU B;  1MJE A;  4OON A;  4FXK C;  4UAI A;  5GQO A;  1EL0 A;  3G48 A;  3V96 A;  5CV4 A;  1X3E A;  2B8F A;  1H95 A;  1LT6 D;  2ICE C;  5FJ8 H;  5IYC H;  1Q1B A;  4JI6 Q;  3IAY A;  5IYD H;  1XPU A;  2WB1 E;  5NUC A;  1OTC A;  2Y0S B;  1AEX A;  4DU9 A;  4HIO A;  3CP0 A;  4YHH Q;  1MI2 A;  4K8I A;  4JI2 Q;  5M5X B;  4EQP A;  1HJP A;  4A3I B;  1AP0 A;  1EZ6 A;  3MHB A;  2EOT A;  1EQV A;  2VQF L;  3SDZ A;  2PQE A;  1Z6H A;  1RTN A;  5IGD A;  3VDY A;  5C0X J;  1A15 A;  2PW5 A;  3GP7 A;  2A1A A;  4JBJ A;  4IFD G;  3P20 A;  1SNP A;  1QUQ B;  1SFO B;  4I7A A;  4MIU A;  2SOB A;  3BVG A;  1EQT A;  1FGB D;  3OW7 A;  4DV5 L;  4LF6 L;  4JW0 A;  4C3I G;  1BCP D;  5KYL A;  4JV5 L;  3S1M H;  3RD4 A;  4OO1 H;  4JI5 Q;  2L4N A;  1XNR Q;  2C5C A;  2F4I A;  1IW7 C;  3K57 A;  3CF5 A;  1C7Y A;  3UDG A;  5ELD A;  1XTD A;  2F1M A;  2WP8 J;  4K14 A;  5C44 G;  4QY7 A;  1ONL A;  1EUJ A;  1Y1W B;  2E8G A;  4XQN A;  1PH4 A;  3BVM A;  2Z6K A;  4A3J G;  4CKE A;  3OIQ A;  1L0W A;  4A3B H;  1TWA B;  4POF A;  4DV4 L;  3QJY A;  1GUO A;  1FYC A;  4J1M A;  2UUC Q;  4DV0 Q;  2YTY A;  1WTX A;  3H6M A;  5JEA J;  3HP3 A;  1Q8I A;  5DM7 3;  4DF7 A;  5I9P A;  3A54 A;  5I2Y A;  4B3R Q;  4YWM A;  5FLX c;  5C0X H;  3CRK C;  1YHA A;  1EY6 A;  4JBW A;  3RN5 A;  4RGT A;  1SXT A;  4N8F A;  2BA1 A;  1RCV D;  3IFD A;  1KDA A;  3K59 A;  2PQA A;  4ME5 A;  3NWS A;  1BCP B;  1UUP A;  1Y8P B;  4C3I H;  2TSS A;  1EWI A;  5FLM H;  1C48 A;  3G71 A;  2QKI C;  2NN6 I;  1HHV A;  3DWA A;  3K7A H;  2Q8I B;  3A5U A;  3H3V C;  1STH A;  2UXB L;  1M1K C;  4IFD H;  3GTQ H;  2A6E D;  5LL6 X;  1B53 A;  1ENF A;  3HRZ C;  5IYB H;  2MP1 A;  1U0L A;  2CWP A;  1PRT F;  5C3W A;  5I9O A;  1EYD A;  3RMH A;  4GKJ L;  2I5M X;  2SEB D;  1B4O A;  1AE3 A;  1IBL L;  5KYI A;  2UXC Q;  1YBY A;  1HH2 P;  4IJL A;  1E3P A;  4JI8 L;  2UXD Q;  4KHV A;  2A6H D;  4XIG S;  1TWC B;  4HED A;  3VR3 A;  1X65 A;  4ZAI A;  1U5K A;  3QOL A;  3CMA A;  3I73 A;  2QGQ A;  5AFW A;  5LMU L;  1VQD A;  4UY8 C;  2LS0 1;  4K0K Q;  2LXK A;  2RHQ B;  1E24 A;  4KI0 A;  2EIF A;  5CGK A;  3HOZ B;  1LT4 D;  4R4O A;  4DV3 Q;  2D62 A;  3T4A C;  3HKZ B;  5ELB A;  3PIP 3;  3E5S A;  2N8N A;  4JI3 Q;  1V1Q A;  1K8M A;  1VQ6 A;  2NZH A;  3HOU G;  3GV6 A;  1PFM A;  3FKI H;  1SE4 A;  4O42 A;  5CV9 A;  1HNX Q;  2N88 A;  2PPB C;  4POG A;  2IX0 A;  2EXZ A;  2ALY B;  3GD7 A;  3Q6S A;  3NBH A;  4RCO A;  3RUZ A;  4O0A A;  3PIO 3;  4G57 A;  4B3S L;  2TMP A;  4LF9 L;  5C44 B;  3PUZ A;  4ID6 A;  4WJ3 M;  1SJE D;  2BDO A;  1A3T A;  3C3L A;  3UDX A;  4DV5 Q;  4LF6 Q;  1PYB A;  1Y1W H;  1TS2 A;  2LXJ A;  5I6Y A;  4IUV A;  4R8N A;  1PH6 A;  1K28 A;  4LMQ D;  4A3I G;  1PV4 A;  1B2T A;  1L0X B;  3LWU A;  5J3B A;  2F0I A;  5E3F A;  3STB C;  3GTK B;  2J7Z A;  1NE3 A;  2Z9H A;  4IPH A;  3KYH C;  3PSI A;  4J8Q A;  4LFA Q;  1TY0 A;  3WOF A;  2EYJ A;  5G3L F;  1PHJ A;  4A93 B;  3S1Q B;  3RR5 A;  1CKN A;  4KJO A;  4OHJ A;  3Q8D A;  4B9X A;  1T5X D;  4HID A;  4ZUI A;  1IXR A;  1XPO A;  5IGB A;  2NVY H;  1YIJ A;  1IBK L;  3BZD B;  4A3K B;  2P5Z X;  3TRZ A;  1EIY B;  1O7L A;  3CD6 A;  1B70 B;  1BCP C;  2HIX A;  4QB4 A;  3HFZ B;  1CQV A;  1B1Z A;  3VR4 A;  1YJN A;  2UUB L;  2F03 A;  3U4V A;  2QW7 A;  1Q1E A;  1HUM A;  3CAM A;  1RTO A;  3A0J A;  4QIW B;  4LF5 L;  1BR9 A;  2KHI A;  3SGI A;  3D8G A;  3Q22 A;  2ZJP A;  2OT2 A;  2E74 C;  4QGU A;  4JOI A;  2HHH Q;  2R7Z G;  3L7Z C;  2EPB A;  5C5L A;  1J6Q A;  4DV2 L;  2NZO A;  4PV1 C;  1Q86 C;  4OGQ C;  3NBI A;  1XMO Q;  5D3I B;  3J7A 5;  3OMG A;  4K8J A;  2F0E A;  4A3K G;  2E2I B;  4DAM A;  1Y14 B;  1O7I A;  3GTO H;  1H9R A;  4XYO A;  2K52 A;  4JVZ A;  4IZ8 A;  2AQ3 B;  2EJF C;  3MWY W;  1N8R C;  1PVO A;  1Q90 A;  2AHO B;  2AMC B;  3R2T A;  3R8B A;  1F2M A;  1Q3L A;  4KKU A;  3TSS A;  4A3F H;  2ZTE A;  4DR5 Q;  1K3R A;  2HQE A;  4K5W A;  4QJF A;  2ID0 A;  4PZ7 A;  1KTK A;  5C4J B;  3Q23 A;  3K5M A;  1F9Q A;  1JE5 A;  1KDB A;  1I4H A;  1Y1V G;  2VS1 A;  5CV8 A;  3ERO A;  4TQU S;  2CCZ A;  4IPG A;  3J81 c;  5G3L D;  3SHL A;  3HOZ G;  5CR3 A;  2K04 A;  4X65 L;  1PA6 A;  4OO1 I;  1NAP A;  4WFN 3;  4KD4 A;  3MAQ A;  3D0F A;  1X9N A;  3GDE A;  1MSG A;  3J7Z C;  3S1N B;  4AYB G;  2MGS A;  3GTK H;  3H91 A;  2G9H D;  2GVA A;  1GKH A;  5IOC A;  1JOO A;  1IW7 D;  2RQX A;  4C3J B;  1PYS B;  1SDF A;  2YTV A;  1HR0 Q;  3PUX A;  2R92 B;  3OHX C;  1STB A;  1VQM A;  3RZD B;  3F2C A;  2WIN B;  2OQK A;  1IYV A;  5M5Y H;  1WTO A;  3VA7 A;  1B3Q A;  3PIP A;  3ULP A;  1AZP A;  4LF8 L;  5BR8 L;  1WTR A;  1I4X A;  3GTP H;  1B44 D;  4XQJ A;  3TRE A;  2Z4I A;  4F7X A;  2B63 B;  4HMJ A;  4DR6 Q;  1LO5 D;  5A2Q E;  1N32 Q;  2VB2 X;  1EEF D;  2AQ2 B;  5M3F G;  4QF4 A;  1SND A;  3PV0 A;  2NN6 H;  5A35 A;  1QE6 A;  1Y1W G;  1UE5 A;  3TZU A;  2V4D A;  5CC4 A;  4LUO A;  4AIM A;  1R9T H;  2NN6 G;  5EBC A;  2B63 G;  4K2L A;  2F0L A;  3CCR A;  2E2J B;  1H9J A;  3VA5 A;  3K80 C;  4JYA Q;  3UDI A;  1U4M A;  2JP1 A;  5JJZ A;  5FO8 B;  2R7D A;  3T13 A;  3HOU H;  1D1K A;  1WCM H;  2NUC A;  2XIW A;  1JWS D;  2SNS A;  1VQB A;  2NVT B;  3RN2 A;  2VY3 A;  4DR7 L;  4A75 A;  1S5E D;  3QO2 A;  1KHI A;  2EYP A;  4JI0 Q;  4A93 H;  3KLS A;  3I4M H;  2F0O A;  1ICW A;  2ATW A;  1NR4 A;  2EYL A;  4FP5 D;  2R92 G;  3K7U C;  5IT9 L;  3GTJ H;  4HAE A;  4JCV E;  2KJX A;  3KLR A;  2OTL A;  2XWB B;  4G4K A;  4AQY Q;  1OXX K;  2OQ0 A;  1EIG A;  2EZV A;  1DM0 B;  3CCJ A;  3KJO A;  4YCU A;  2A68 C;  2D0P A;  2Z4H A;  3J7A V;  1A2U A;  4DN4 M;  1SBB B;  2BE5 C;  3NPP A;  1DZ1 A;  1YHQ A;  1GUT A;  1EQQ A;  2E75 C;  3RLF A;  4HCS A;  2IW3 A;  1PFS A;  2HDL A;  3WWV A;  3BZC A;  2NTS A;  3M4Q A;  3K7A B;  1G6P A;  3E9I A;  1GO3 E;  4C2M B;  4NPS A;  3A5Z B;  3NTI A;  1SYE A;  1XJV A;  5KNB A;  3DEP A;  4JI1 Q;  1A3U A;  1ET9 A;  4ZQ3 A;  4ABN A;  1U9R A;  1L1O A;  4RGM A;  2F0D A;  4DV4 Q;  2AQ1 B;  1ESF A;  4A3K H;  3KDF B;  1VQI A;  2HQL A;  5COY A;  1IBM Q;  1GUW A;  3NBH B;  2K1B A;  3NEM A;  1S5B D;  4H13 C;  3ERQ A;  2RKS A;  3DWQ A;  3CME A;  2MHV A;  1X3Q A;  3K5O A;  3CCE A;  1KL9 A;  4GLA C;  1MD2 D;  5JOB A;  1HNZ L;  4A3B B;  1HFN A;  3E0E A;  2L11 A; 
#chains in the Genus database with same CATH homology
 4JI2 Q;  4MZ9 A;  1TXY A;  1PH3 A;  4C2M H;  4LF4 L;  4C3H H;  1HJP A;  5ELN A;  3HOY G;  3ULL A;  1UE1 A;  1E7Z A;  2VQF L;  4JG2 A;  1IYJ B;  1BBU A;  3AEV A;  3S14 H;  3VDY A;  5C0X J;  1HNZ Q;  1CSQ A;  4JBJ A;  2A1A A;  3HKZ G;  4IFD G;  3EIV A;  4LWC A;  2E2H H;  1QUQ B;  2ZM6 Q;  2JEB I;  3I4M G;  3M4P A;  5LMN Q;  4A3G H;  5LMU Q;  1E1O A;  1PH9 A;  1N36 Q;  4DV5 L;  4LF6 L;  1TWC H;  1MJC A;  2UXB Q;  1LUZ A;  4JI8 Q;  2D0O A;  2LSS A;  2MO1 A;  3K81 C;  4JV5 L;  3S1M H;  1L1O C;  4JI5 Q;  1V9P A;  4A76 A;  4Y52 H;  4L5R C;  1XNR Q;  4TVA B;  4OXP A;  4HJ8 A;  3HOY H;  4NXN L;  4A3D G;  2V1C C;  3CF5 A;  1P16 A;  2CKZ B;  1C7Y A;  3GTG H;  1UE7 A;  2WAQ G;  3UDG A;  4QQB X;  1XTD A;  2I5L X;  4UP7 A;  1Q7Y C;  1HNX L;  4JI6 L;  1YVC A;  1B7Y B;  2WP8 J;  4A3I H;  2R93 H;  2AWN A;  2OTJ A;  3OTO Q;  1W2B A;  1GD7 A;  5C44 G;  1HZC A;  4QY7 A;  1PH2 A;  3CQZ H;  1EUJ A;  2VQE L;  1WFQ A;  2E8G A;  3CPF A;  5IYD G;  1PH4 A;  2JA5 H;  2Z6K A;  1BBW A;  2K5V A;  3H0G G;  3FP9 A;  5IE8 A;  1L0W A;  3KF6 A;  3PIO A;  5C4X H;  2VZA A;  3H15 A;  1HR0 W;  4ALP A;  2B63 H;  4A3B H;  4POF A;  5IYC G;  4DV4 L;  3AFP A;  4GNX A;  3K8A A;  3HOX G;  2UUC Q;  1BVS A;  3KJP A;  2MNA A;  1N33 Q;  4DV0 Q;  1Q82 C;  2YTY A;  4DR7 Q;  3PF5 A;  4GNX B;  5JEA J;  1FJG Q;  1QUQ A;  1VQJ A;  3FKI G;  4GN3 B;  4DK3 C;  4YWM A;  5FLX c;  3G6E A;  4B3R Q;  3RZD H;  1Q81 C;  1YHA A;  4ME3 A;  2PQA B;  4JBW A;  3RN5 A;  3CC4 A;  1YEZ A;  1HNW L;  3JAM c;  2BA1 A;  4MNO A;  2VW9 A;  1N32 L;  5ELO A;  1HZ9 A;  3TQY A;  5M5W H;  5C3E H;  2L15 A;  2PQA A;  1GVP A;  4LFC L;  3PO2 H;  1KIX A;  4LF7 L;  4JI4 L;  4C3I H;  1KQS A;  1EWI A;  1SLJ A;  1W3S A;  2KCM A;  5FLM H;  3DLL A;  1Z9F A;  3G71 A;  1QZH A;  1QZG A;  1VQK A;  3I4N H;  2NN6 I;  1X54 A;  1XMQ L;  1XNR L;  1C0A A;  2IY5 B;  3K7A H;  1SR3 A;  3ULJ A;  1OXU A;  5DLQ E;  1UE6 A;  3FHW A;  3A5U A;  2ZM6 L;  2UXB L;  1M1K C;  3GTQ H;  4A93 G;  1WJJ A;  2IHE A;  2MQH A;  2F3I A;  1BKB A;  5IP9 G;  2VUM G;  2RHS B;  1N34 L;  4DR6 L;  4KHP L;  3OTO L;  5IYB H;  1U0L A;  2CWP A;  2UU9 L;  3RLO A;  4LF9 Q;  4GNX C;  1QVF A;  1X56 A;  4HIM A;  1K8G A;  1TWH H;  4GN4 B;  3L0O A;  2Z6K C;  4DR5 L;  4GKJ L;  3J81 i;  2I5M X;  3W1B A;  1AE3 A;  1IBL L;  2UXC Q;  2ZJQ A;  2KEN A;  3I4O A;  1YBY A;  1VQE A;  1HH2 P;  2VUM H;  4IJL A;  1J5E L;  1E3P A;  4JI8 L;  2YV5 A;  4P73 A;  5M3M H;  5E7N A;  5M5X H;  4HJ5 A;  3U4Z A;  4UP8 A;  2UXD Q;  4JC0 A;  4XIG S;  4UP9 A;  1PH5 A;  3S17 H;  4DV7 Q;  1X65 A;  2Q2I A;  1U5K A;  3CMA A;  4YHH L;  4A3C H;  4WJ4 A;  2N3S A;  2QGQ A;  3U50 C;  5LMN L;  4DR3 Q;  1KC8 C;  5LMU L;  3HOZ H;  1VQH A;  1VQD A;  3MXN B;  4DAY B;  2PNH A;  2NVT H;  4UY8 C;  5FLM G;  3I4N G;  4K0K Q;  2CQO A;  5AJ3 L;  2LXK A;  3M7N A;  2RHQ B;  3CCM A;  1E24 A;  1OXS C;  4KI0 A;  5AJ3 Q;  4YCW A;  3CPW A;  2EIF A;  4IO9 A;  3M4O H;  4YWL A;  4DPG A;  4P74 A;  5H1S E;  4R4O A;  4DV3 Q;  1MIU A;  2D62 A;  5C3E G;  4X66 L;  4DKA C;  4GOP B;  1PH8 A;  2H5X A;  4DNI A;  3GTL H;  1S3O A;  3CCL A;  2ZTD A;  4DK6 C;  2N8N A;  4JI3 Q;  1V1Q A;  4DV7 L;  2R6G A;  3W5O A;  1LYL A;  2AKW B;  1VQ6 A;  2NZH A;  5C0X G;  1A63 A;  4LF4 Q;  1KRT A;  4DUY L;  3EBE A;  3HOU G;  3FKI H;  4JI2 L;  4POG A;  4IPD A;  1HNX Q;  2IX0 A;  3J81 j;  4NXM Q;  3U58 A;  1VQF A;  2ALY B;  3GD7 A;  3OW2 A;  2F4V Q;  3KOJ A;  3HOW H;  3B6Y A;  3S1N H;  2K50 A;  1VQA A;  2A8V A;  3LGJ A;  3I7F A;  4BY1 H;  3TEH B;  1XMO L;  4X62 Q;  4O0A A;  2K14 A;  4GS3 A;  4B3S L;  3ER0 A;  4LF9 L;  3PUZ A;  5C4X G;  4A3B G;  4WJ3 M;  5HY6 A;  2K75 A;  3UE0 A;  1K73 C;  1NMF A;  4BBR G;  1FGU A;  3UDX A;  4LFC Q;  4DV5 Q;  4LF6 Q;  4A3M G;  5JJI A;  1PYB A;  3E9H A;  1Y1W H;  2LXJ A;  1SN8 A;  1XNQ Q;  2YYZ A;  3PF4 A;  1JT8 A;  1EFW A;  1Q8K A;  1PH6 A;  4A3I G;  3NEN A;  1PV4 A;  4LF8 Q;  1KXL A;  2YU9 H;  4RG1 A;  4XTC S;  5J3B A;  3F1Z A;  3STB C;  1GM5 A;  4BBS H;  1NE3 A;  4IPH A;  3F2D A;  3KYH C;  3I55 A;  3PSI A;  4NB3 A;  1I94 L;  2XTI A;  4LFA Q;  4UPA A;  4IPC A;  3KF8 B;  1P8L A;  2F52 A;  4LFA L;  2Y0S E;  4FDB A;  3ERS X;  5GAG C;  2KHJ A;  2R92 H;  3BJU A;  1PHJ A;  1EYG A;  3RR5 A;  1CKN A;  2JE6 I;  4KHP Q;  3Q8D A;  2PI2 E;  3CC2 A;  3HOV H;  4X65 Q;  5GAD C;  4B3T Q;  4HID A;  4A3G G;  1IZ6 A;  1VQC A;  3EN2 A;  1CKM A;  1IXR A;  5JEA G;  1XPO A;  3W1G A;  2A19 A;  2VQE Q;  2UUA L;  2NVY H;  4LW1 A;  1YIJ A;  1IBK L;  2JA8 H;  4GKK Q;  4JBK A;  1TWG H;  5HGQ A;  2KCT A;  3TRZ A;  1EIY B;  3TS2 A;  4GOP A;  3CD6 A;  1B70 B;  1QVG A;  1C9O A;  2HIX A;  2ASB A;  1M90 C;  1AE2 A;  3HFZ B;  3G4S A;  1SRO A;  1VQP A;  1K8A C;  1NMG A;  4DUZ L;  1FVI A;  2BH2 A;  1YJN A;  2UUB L;  3M3Y H;  5K36 G;  3U4V A;  1Q1E A;  3CAM A;  1WCM G;  3T1H Q;  4NXN Q;  3BU2 A;  3PUY A;  4APV A;  4X66 Q;  3KDF A;  4P71 A;  3T1H L;  3A0J A;  3S2H H;  2B3G A;  4LF5 L;  2MFI A;  4DR4 L;  3S16 H;  2KHI A;  3SGI A;  1UEB A;  3T1Y Q;  1SMX A;  4O2D A;  1EOV A;  3J80 i;  2ZJP A;  2OWO A;  5IWA Q;  1NTG A;  4QGU A;  1Q46 A;  4JOI A;  4A3L H;  2BH8 A;  2HHH Q;  4R4T A;  1I6H H;  2R7Z G;  1N34 Q;  3L7Z C;  4DV3 L;  1YJW A;  1JMC A;  2ES2 A;  2Q2T A;  3PO2 G;  1PH7 A;  3S2D H;  2GN5 A;  1J6Q A;  2WAQ E;  5EAY A;  4DV2 L;  2NZO A;  2IX1 A;  1Q86 C;  3PUW A;  4J15 A;  5FJ8 G;  1MKH A;  5IP7 G;  1XMO Q;  4PG3 A;  3J7A 5;  4DR2 L;  1I5F A;  3KF6 B;  4B3M Q;  4L5Q A;  4A3K G;  2C35 B;  3L2P A;  1X6O A;  4DAM A;  1Y14 B;  1Z47 A;  4P75 A;  1O7I A;  5M3F H;  3GTO H;  2AWO A;  4HIK A;  2JA6 H;  2MO0 A;  2EQS A;  2K52 A;  5GAE C;  1YJ9 A;  4IJH A;  2RF4 A;  1PVO A;  1N8R C;  1VQL A;  4AH6 A;  3S1Q H;  2AHO B;  2AMC B;  3GO5 A;  4BY7 G;  3H3V H;  4P72 A;  4BY7 H;  4JI1 L;  4PZ8 A;  2EXD A;  4LUZ A;  4HJA A;  1OXV A;  2BA0 A;  4A3F H;  1S72 A;  4B3M L;  4YY3 Q;  2F4V L;  3GTM H;  2ZTE A;  4R4Q A;  4DR5 Q;  1K3R A;  2UU9 Q;  1JB7 A;  4GKJ Q;  3BZK A;  2ZJR A;  1JJC B;  4QJF A;  2ID0 A;  3RNU A;  4PZ7 A;  2B29 A;  2Q2H A;  1X3G A;  4DV1 L;  1JE5 A;  1Y1V G;  2VS1 A;  3F8T A;  5LMN W;  1IBM L;  2RCN A;  1RL2 A;  4TQU S;  2I5H A;  2CCZ A;  4X6A H;  4IPG A;  5IP7 H;  3J81 c;  1K83 H;  3HOZ G;  2E5L L;  1A62 A;  3T1Y L;  4YCV A;  1VS0 A;  1ASY A;  2NVX H;  1D8L A;  4A3C G;  4X65 L;  5C4J H;  1PA6 A;  4OO1 I;  1VQ5 A;  2YTX A;  2UUB Q;  5GRO A;  4BXX G;  4QL5 A;  3D0F A;  4OX9 Q;  1X9N A;  4OWW B;  4A3L G;  3PGZ A;  1G51 A;  2N49 A;  3PO3 H;  4LFB Q;  3GDE A;  3RZO H;  4GOP C;  2HT1 A;  3J7Z C;  4DUY Q;  3ZJY C;  4AYB G;  1AH9 A;  3UE1 A;  4DV0 L;  1T9H A;  3S15 H;  3PO3 G;  2UXC L;  5JJL A;  2VL6 A;  3CCU A;  1D7Q A;  1YHB A;  1E22 A;  3GTK H;  1CKO A;  4DR4 Q;  2XGT A;  3K0X A;  4LUV A;  4X64 L;  4DV6 L;  4JI7 L;  2JQO A;  4BXX H;  2GVA A;  1XPR A;  1GKH A;  4JI0 L;  3M9B A;  5IYB G;  4JYA L;  4B3T L;  1VQ7 A;  1YZ6 A;  2E2I H;  4HJ7 A;  1IL2 A;  5IP9 H;  2DUD A;  4LFB L;  1N9W A;  1I50 H;  1PYS B;  3JC6 6;  2YTV A;  1L2F A;  1HR0 Q;  3PUX A;  1I3Q H;  1UWV A;  4AYB E;  1Y1V H;  2E2J H;  2DGY A;  2JA8 G;  5JJK A;  4C3J H;  2QEX A;  1VQM A;  3CXC A;  3ICE A;  3F2C A;  4LF7 Q;  2OQK A;  4A4I A;  5M5Y H;  3HOV G;  3F2B A;  4PZ6 A;  1B8A A;  1A0I A;  2I0Q A;  2R7F A;  1XMQ Q;  3PIP A;  4A3F G;  4R4C A;  4B3R L;  3ULP A;  1DGS A;  4LF8 L;  1HZA A;  4IFD J;  4MTN A;  3S24 A;  5BR8 L;  3GTP H;  4AQY L;  1XNQ L;  3TRE A;  2IHF A;  1KD1 C;  4BBS G;  4KHZ A;  4DR6 Q;  1N32 Q;  4H02 A;  1K9M C;  2JA6 G;  1CUK A;  1YNX A;  3A74 A;  1I94 Q;  5M3F G;  4JI5 L;  3HKZ E;  4DR1 Q;  3PV0 A;  4L5S A;  1OXT A;  2WFW A;  1VQN A;  3CCS A;  4GLV B;  2VNU D;  2JA7 G;  1Y1W G;  3CW2 C;  2CFM A;  1UE5 A;  2ZTC A;  2UUA Q;  4DR2 Q;  1YIT A;  4BBR H;  3HOX H;  4LUO A;  2JA7 H;  4AIM A;  1R9T H;  1X55 A;  2NN6 G;  3AFQ A;  5IT9 c;  2B63 G;  4GKK L;  3CCR A;  1RIP A;  1KRS A;  2Z0S A;  4A3J H;  2R7Z H;  4R1J A;  2K5H A;  4BA2 I;  4BY1 G;  4JI7 Q;  4DR1 L;  1J5E Q;  1ASZ A;  5C44 H;  3K80 C;  1A8V A;  4JI3 L;  1JJG A;  4JYA Q;  3UDI A;  1QVC A;  4DV2 Q;  4Y7N H;  3I2Z A;  2R93 G;  2R7D A;  3HOU H;  1VQO A;  4DUZ Q;  1VQ8 A;  1WCM H;  1SFO H;  3DM3 A;  5IWA L;  1VQG A;  4A3D H;  4OWX B;  1VQB A;  3HKS A;  1VQ4 A;  3PUV A;  3RN2 A;  1X3F A;  2VY3 A;  4OO1 G;  4DR7 L;  1CKN B;  1EIF A;  4QIW E;  4A75 A;  1S40 A;  4B3S Q;  4JBM A;  4A3J G;  1WI5 A;  1KHI A;  1SE8 A;  4JI0 Q;  2K4K A;  2FXQ A;  3UDF A;  3AQQ A;  4A93 H;  4EX5 A;  3JAM i;  2E5L Q;  1SRU A;  4YWK A;  2CWA A;  3CCV A;  2WB1 G;  1HR0 L;  3I4M H;  1NBW A;  1WOC A;  3J80 c;  2ATW A;  4PMW A;  3S1R H;  1NY4 A;  3RLN A;  3H3V I;  4IOA A;  1TWA H;  1LM0 A;  1HZB A;  4X62 L;  2R92 G;  1KAW A;  3K7U C;  4JOI C;  3GTJ H;  1FL0 A;  3M85 A;  1EQR A;  4JCV E;  2OTL A;  4AQY Q;  2Y0S G;  4IOC A;  1OXX K;  2PI2 A;  2OQ0 A;  2QA4 A;  2PMZ E;  2HIV A;  3CCJ A;  3KJO A;  4YCU A;  3AYH B;  2D0P A;  1PH1 A;  1N36 L;  2JEA I;  5C0X I;  2JA9 A;  1YI2 A;  3OYY A;  5BR8 Q;  3D31 A;  4A3M H;  1Q12 A;  1YHQ A;  3CCQ A;  4RMF A;  3TS0 A;  1EQQ A;  2IT1 A;  1NJI C;  3RLF A;  3KLW A;  1IBK Q;  3MEF A;  2OCE A;  2GVB A;  4A3E H;  4R4I A;  1PFS A;  3WWV A;  1E1T A;  2VQF Q;  3CC7 A;  1K0R A;  3BZC A;  2N78 A;  1TWF H;  4GN5 A;  3PCO B;  2UXD L;  3M4Q A;  1JJ2 A;  4LNQ A;  3I56 A;  4JI4 Q;  4DV6 Q;  3E9I A;  1GO3 E;  2JK8 A;  1G6P A;  3HOW G;  1IBL Q;  4NPS A;  1G29 1;  3A5Z B;  4L5T A;  1XJV A;  4KLK A;  1CSP A;  1L1O B;  4IFD I;  4LF5 Q;  2JJQ A;  4JI1 Q;  3STB D;  4HJ9 A;  2NVQ H;  4GLX A;  4YY3 L;  1N33 L;  1L1O A;  1VQ9 A;  2KBN A;  4NXM L;  4OX9 L;  3IRB A;  4DV4 Q;  4JV5 Q;  1MJE A;  4OON A;  4A3K H;  3KDF B;  1FJG L;  4EQ5 A;  1VQI A;  2K5N A;  2HQL A;  4DV1 Q;  5GQO A;  3G48 A;  1WYD A;  1X3E A;  2UUC L;  5GAH C;  1H95 A;  1IBM Q;  4BA1 I;  3NBH B;  5FJ8 H;  4DR3 L;  5IYC H;  1V43 A;  1LTL A;  3NEM A;  4A3E G;  2Q2U A;  1Q1B A;  4JI6 Q;  3H0G H;  1VCI A;  3CME A;  5IY0 A;  2JA5 G;  5IYD H;  3NEL A;  1HNW Q;  3CCE A;  5M3M G;  1XPU A;  2WB1 E;  1KL9 A;  4GLA C;  1HNZ L;  4OWT B;  1OTC A;  3KFU A;  4X64 Q;  3E0E A;  4HIO A;  2HHH L;  3CP0 A;  4K0K L;  4YHH Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...