2E2JH

Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3'
total genus 16
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e2jH00
4PMWA 2JA6H 4B3TQ 3HOVH 1VQ5A 1QVFA 2NZOA 3EBEA 5BR8L 3PO3H 4PZ6A 4BY7H 1P8LA 2HIXA 2LSSA 4X66L 1MJEA 1VQKA 3TQYA 5FJ8G 5ELOA 4LF8L 4LFBQ 4WJ3M 2ZJRA 1TWGH 4GLXA 4DR3Q 2IY5B 1U5KA 3I7FA 3MXNB 4IPHA 4O2DA 4OWTB 2R6GA 4YY3L 1FJGQ 1Q86C 2IX1A 3G4SA 1SFOH 2UUBQ 4KLKA 2OWOA 2UUCL 3H3VH 1VQFA 1DGSA 1NTGA 1R9TH 2PQAB 4YCUA 1UWVA 1YJ9A 4A3LG 3BZCA 3K8AA 5M5XH 3I55A 2E2IH 4OXPA 4H02A 2Q2IA 4GOPA 1EYGA 4NXMQ 2GVBA 1VS0A 5M3FH 2NN6G 3S1MH 4R1JA 4IOCA 3CXCA 3KJPA 1KAWA 4LF6L 2E2HH 4DV1L 3HFZB 1OXXK 2K14A 5GADC 3KF8B 1VQHA 2YYZA 3J81c 4GNXA 5FLXc 1N33L 4DV4L 3I2ZA 4LF5Q 2HQLA 4R4OA 3KF6A 4EQ5A 3TS0A 1PH6A 3S14H 1PH2A 2IX0A 3CCVA 1E1OA 3GO5A 4JI2Q 5J3BA 4A3FH 4QY7A 2VNUD 2VQFQ 4JCVE 4YY3Q 2HT1A 4X64L 4HJAA 4BBSG 1HJPA 3CCSA 1X55A 4B3SQ 4A3MG 4QJFA 3GD7A 4BY7G 4LF7L 3D0FA 1KRTA 1KC8C 4A76A 2MO0A 1YZ6A 2NZHA 5IP9H 3GTQH 1HNXQ 4BXXG 3K0XA 2JA8H 2R93H 4JI0L 1MIUA 3F2BA 1SR3A 4DR1Q 5GQOA 2UXDL 4XTCS 5ELNA 4KHZA 4GKJQ 1PA6A 2E2JH 3FKIH 2Q2HA 2Q2TA 1N33Q 1UEBA 4A3KG 3I4MH 1Q8KA 5HGQA 3UE0A 4JG2A 1EFWA 1BVSA 4HJ8A 1XMOQ 1PV4A 3ERSX 1O7IA 2VUMH 4B3RL 3L0OA 2JA7G 3HOWH 4JI6L 4RG1A 4A93H 2KCMA 1L1OB 2VQEL 1HR0L 3RLFA 5IWAQ 5AJ3Q 2VQFL 2QGQA 4GKKL 5IYDH 4IPCA 1WCMG 1Y1VG 4JI3Q 2A8VA 4DR4L 3KYHC 4IJHA 5M3MH 1A0IA 1FVIA 4JI4L 1WI5A 3JAMi 4OWXB 3CC7A 2KENA 1TWCH 1V43A 2BA0A 4P71A 1VQMA 3M4QA 4GLVB 2BA1A 4L5QA 4DV2L 2K5NA 3PIOA 1TWAH 3T1YQ 1Y1WH 2JA9A 4TVAB 1EQRA 1YHQA 4JI7L 2JA7H 3KOJA 3BU2A 3L2PA 4A93G 1CKMA 3HOYG 3GTPH 4JOIA 3PUZA 4DR5Q 1EIYB 1K3RA 2E5LL 4UY8C 2EXDA 3UDGA 3CD6A 1D7QA 2BH8A 1SMXA 2R92H 4BY1H 1QVCA 4DNIA 2ZM6Q 5E7NA 3PUXA 4AYBG 4IFDJ 2A19A 2K4KA 5IWAL 5AJ3L 4HIOA 2UU9L 2ATWA 4GKKQ 1JT8A 2B63G 5C44G 2I0QA 3HOWG 4P74A 1IBMQ 3CCUA 1KIXA 4ME3A 4JI1Q 4A3FG 4P73A 3K81C 4AH6A 3F8TA 4A3JG 5IYBH 4DV4Q 1EUJA 3CCLA 3B6YA 1QUQB 3T1HQ 4B3SL 1JE5A 1KXLA 3IRBA 1C9OA 3JAMc 4JYAQ 5C4XG 1AE2A 2PNHA 1W2BA 2BH2A 1VQOA 1IL2A 4BXXH 1YNXA 1E3PA 4DR6Q 3U4ZA 3ULJA 2XTIA 2QEXA 5M5YH 4X64Q 1HR0W 2ALYB 4JBKA 2NVQH 3TS2A 3NELA 2K52A 4LW1A 3CF5A 3RZOH 1SE8A 3PSIA 5GAGC 4YHHQ 2I5MX 4ALPA 3U58A 1PH7A 2Z6KC 4OX9L 1GD7A 5M3FG 3NBHB 2N49A 1YBYA 1SROA 3RZDH 4LUZA 2LXKA 2OCEA 4A3CG 4GLAC 1BBUA 4GN5A 1BBWA 4NXNL 2N78A 3I4MG 4XIGS 4HIMA 1SRUA 3U50C 2K5HA 5C44H 4BBRG 1LTLA 1WYDA 5IY0A 1TXYA 3HOXG 1VQGA 4IO9A 4LF8Q 2D0OA 3I4NG 4JC0A 2MNAA 4Y52H 3GTGH 3H0GG 3CCEA 4DV2Q 1I5FA 4IOAA 2YTYA 3K7UC 3S17H 5GAHC 4DV3L 1NE3A 1VQIA 3M85A 5C3EG 2UUBL 1S72A 1GVPA 2UUAQ 4LFCL 3A5UA 2B63H 3F2DA 2KHIA 4DV7Q 4IFDI 5C4JH 1NJIC 2MFIA 4DR7L 4A3BH 2XGTA 1XMQL 4LWCA 3CMEA 4LF9L 1XJVA 3S1NH 4UPAA 5FLMH 3S2HH 1PFSA 1KHIA 3PF5A 3K80C 2A1AA 2AWNA 3CMAA 3RNUA 3M4PA 1N36L 5K36G 4DPGA 5IYDG 4DV6L 3STBD 4GOPB 1VCIA 3KLWA 4HIKA 2ES2A 1B70B 1WJJA 2PI2E 4DV5Q 4A75A 1FJGL 1XNQQ 3T1HL 1VQ6A 1S40A 4A3GH 2EIFA 3J81i 3UDFA 1IBLQ 3FKIG 1XPOA 2ID0A 1OXVA 4JI1L 1WCMH 1Y1VH 1FL0A 3H0GH 2ASBA 1OXSC 1MJCA 1Z9FA 2Z0SA 1G51A 1LYLA 4A3JH 1NMGA 1VQBA 3H3VI 4C3IH 4JBJA 1CSQA 1K9MC 2F4VQ 2MO1A 2YTXA 1N9WA 3KDFB 4BA1I 4JYAL 4A3EH 1X9NA 2GN5A 2UXBQ 1UE5A 1Q1BA 2D62A 1UE7A 2DUDA 2B29A 1Q82C 1K8GA 1XTDA 4AQYQ 3TREA 2VL6A 3J81j 3EIVA 2QA4A 4JOIC 4NXML 5FLMG 2WB1E 3M4OH 2PI2A 2F52A 1KL9A 1K8AC 5IYCH 5IT9c 3PV0A 5GROA 5JEAJ 3PCOB 4OONA 1EOVA 3UE1A 1MKHA 5IYBG 3PUWA 4C3JH 3I56A 4MTNA 1IBKL 1IBLL 3KJOA 1LUZA 4K0KL 5M5WH 4JI5Q 1XPRA 1Q46A 1VQ8A 1AE3A 1HNZL 4FDBA 3HOZH 2HIVA 4YCVA 1JJ2A 4NPSA 2R92G 3L7ZC 4X65L 3HKSA 5IP9G 2H5XA 4RMFA 1NY4A 3AFQA 1D8LA 4P72A 3STBC 4Y7NH 1L1OA 1YHAA 1M90C 4GNXC 3HOYH 1HNWQ 4A3MH 2K75A 3HKZG 4AIMA 4EX5A 1XNRL 4A3EG 1X56A 3J7A5 1X3GA 4QQBX 1C0AA 4LF4Q 1VQCA 4DAMA 1W3SA 1X3EA 1XMOL 4GS3A 3J80c 1B7YB 3BJUA 4JBWA 2Z6KA 4JI6Q 1N32L 4GOPC 4GKJL 4B3MQ 4TQUS 4DUZQ 1LM0A 3W5OA 3DLLA 3CCMA 3S1RH 1YIJA 4R4QA 1PH1A 1VQ7A 1I94Q 4DV6Q 4JV5L 1VQPA 1K83H 1KRSA 3Q8DA 1CKNB 3E0EA 1N8RC 4JI4Q 1YVCA 5C0XJ 4LFAQ 5C0XG 1YJNA 4OO1I 3CPWA 3MEFA 4K0KQ 5LMNL 4AYBE 3PO2G 4C3HH 4R4TA 1XNQL 5EAYA 4P75A 4A3IG 2F4VL 1VQJA 3PUYA 2HHHQ 5M3MG 1KD1C 1Z47A 3AEVA 3RR5A 3PO2H 2YV5A 4A3DG 1PYSB 1YITA 3ICEA 4JI7Q 1WOCA 4A3LH 1U0LA 2YTVA 3K7AH 4BY1G 3TRZA 4A3DH 1H95A 2K5VA 1NMFA 1X6OA 1PH9A 2CQOA 1G291 4L5RC 2Y0SG 1A63A 3RN2A 4AQYL 4L5SA 4X62Q 3BZKA 2JEBI 5JEAG 3HOUH 1GO3E 3HOXH 3AQQA 2WB1G 3U4VA 3PGZA 2UXCL 1UE1A 4HJ7A 1UE6A 4IPDA 5LMUQ 4YWMA 1J5EL 4X65Q 4JBMA 1Q81C 3F2CA 1IBML 4J15A 5BR8Q 3KDFA 4A4IA 1G6PA 2AHOB 3A5ZB 3UDXA 3AFPA 3CW2C 1L2FA 1XNRQ 3OYYA 2HHHL 2Q2UA 4BBRH 1JB7A 1A62A 1N34Q 4OWWB 3I4OA 4O0AA 1M1KC 2NVXH 4A3KH 2F3IA 4OX9Q 2C35B 1TWFH 5LMNW 4QGUA 4DV7L 1PH4A 3S24A 1PH5A 1E22A 3GDEA 1XMQQ 4GN3B 4X62L 2WAQE 4WJ4A 3CCQA 2NVYH 1PH3A 4NXNQ 1XPUA 2JA8G 4MZ9A 4JI8L 2UXCQ 5C4XH 1OXTA 1Y14B 2VY3A 1NBWA 3E9IA 1E24A 1L0WA 2ZJQA 1HZAA 4YWLA 2CWAA 4PZ8A 4A3GG 4BBSH 1YHBA 2N8NA 4B3ML 2RHSB 3G48A 1JJCB 1I3QH 1TWHH 5HY6A 1T9HA 1B8AA 3NENA 1HZCA 3W1BA 3G71A 4NB3A 2B3GA 1IXRA 3S15H 5IP7H 3OTOL 4QIWE 4IFDG 3CQZH 1HH2P 2RCNA 2LXJA 1V9PA 4DK3C 5LMUL 2CCZA 4LFCQ 5JJKA 3HOZG 3F1ZA 4DV3Q 5LMNQ 4JI2L 3HKZE 1E1TA 4L5TA 5GAEC 3CCRA 3CC4A 3FHWA 4IJLA 2EQSA 1ASYA 4YCWA 3TEHB 1SN8A 4DUYL 4C2MH 1VQDA 1JJGA 3ZJYC 4LF7Q 4JI8Q 1RL2A 1HZBA 2ZJPA 2PQAA 2VS1A 3M3YH 2OQ0A 1X54A 2ZTCA 4R4CA 2JA6G 3GTLH 4DR1L 3RLOA 1X3FA 2UXDQ 3RLNA 1CKNA 4DV1Q 5JJLA 3PF4A 4DV5L 2CWPA 4DK6C 3CC2A 4B3RQ 1N36Q 1I50H 4JI0Q 3PIPA 4A3IH 1QVGA 1PVOA 1J5EQ 5FJ8H 1Q1EA 2OQKA 4GN4B 4PZ7A 3S16H 1WFQA 1S3OA 2RF4A 1EIFA 3CCJA 2KCTA 4YWKA 2CFMA 2OTLA 1AH9A 2NN6I 2VUMG 4A3CH 4JI3L 4GNXB 4DR4Q 4DUYQ 3S2DH 3ULPA 4DV0Q 2KBNA 1VQLA 2D0PA 2RHQB 3GTMH 3CAMA 2VZAA 4PG3A 2VQEQ 4UP9A 1HR0Q 3ULLA 2R7ZH 3J7ZC 1C7YA 2CKZB 2MQHA 2L15A 1VQEA 2PMZE 2JA5G 1VQNA 2UXBL 2KHJA 2Y0SE 2I5HA 5C0XI 1HNXL 1HZ9A 4R4IA 1YJWA 3GTKH 2JEAI 3T1YL 1L1OC 3RN5A 1ASZA 4DR5L 2DGYA 4KI0A 4POGA 4OO1G 3W1GA 2GVAA 1QZGA 2V1CC 2R93G 1GM5A 3GTOH 1X65A 3I4NH 1RIPA 3LGJA 1VQAA 3SGIA 2JJQA 3G6EA 1IBKQ 5IP7G 2E5LQ 1YEZA 2AWOA 1CUKA 3JC66 3OTOQ 4B3TL 1K73C 5DLQE 4JI5L 3OW2A 3M9BA 2JA5H 1CSPA 2AKWB 4BA2I 2JE6I 1A8VA 1HNZQ 3S1QH 2ZTEA 2K50A 1J6QA 4LUOA 2UUCQ 4KHPL 1YI2A 1JMCA 4LUVA 2OTJA 3UDIA 4LFBL 2IHEA 4UP7A 4DR2L 4DR3L 3D31A 1VQ4A 3WWVA 3VDYA 1PH8A 1E7ZA 4LF4L 2WAQG 5IE8A 4HIDA 2NVTH 3PO3G 4APVA 1N32Q 1HNWL 4YHHL 3GTJH 1Q12A 4DR6L 1PHJA 5IYCG 1QZHA 3EN2A 1OTCA 1P16A 1BKBA 4HJ5A 3KFUA 4JV5Q 3A74A 2ZM6L 3AYHB 1SLJA 3J80i 4DUZL 3E9HA 2UU9Q 2IHFA 1I94L 5H1SE 4LF6Q 1Q7YC 2JK8A 1CKOA 4KHPQ 3M7NA 2R7FA 3KF6B 1Y1WG 4LFAL 4LNQA 4DAYB 1EQQA 4DV0L 4IPGA 3CPFA 2R7ZG 2WFWA 2YU9H 4QL5A 4X66Q 4X6AH 1IZ6A 1EWIA 1KQSA 3ER0A 3CP0A 4LF5L 1IYJB 2FXQA 1I6HH 2ZTDA 2UUAL 4DR2Q 2I5LX 2JQOA 4MNOA 2N3SA 1QUQA 4UP8A 2E8GA 4DKAC 3H15A 1N34L 4LF9Q 2VW9A 4A3BG 1PYBA 4POFA 1OXUA 4HJ9A 1VQ9A 3HOUG 1FGUA 5JJIA 3FP9A 3NEMA 2AMCB 1K0RA 3HOVG 3A0JA 2IT1A 5C3EH 3PUVA 3DM3A 1V1QA 2WP8J 1GKHA 4DR7Q 2R7DA
chains in the Genus database with same CATH superfamily
3E6ZX 4DNRB 1QVFA 1B50A 3TP5A 3K57A 4RCOA 1MJEA 1VQKA 3VYRA 4NMZA 3OMGA 3FEWX 1TWGH 4A3MB 1HQMC 2XVSA 4KLKA 4KN4C 2OWOA 1DM0B 1VQFA 1HUMA 1R9TH 1YJ9A 1UWVA 3P20A 2EYLA 3I55A 4CJ1B 1SXTA 3H0GB 3A8JE 3D6WA 4LAAA 3TDQA 3S1MH 2NN6G 1PTOB 4R1JA 2CH4A 3HFZB 2K14A 4A3GB 3SK8A 2ZXRA 5GADC 1HCZA 1SYCA 4DU9A 3J81c 4GNXA 5FLXc 1EY4A 4DV4L 1HHVA 2F0JA 2HQLA 4L63B 3KF6A 1PH2A 2IX0A 5F2DA 3CCVA 3EVQA 2HT1A 4B3SQ 1STGA 4A3MG 3GD7A 2F0DA 3D0FA 1KC8C 3RZDB 1DYQA 2F0NA 3VA7A 1H9SB 4BXXG 2CW0C 3F2BA 1TVXA 1CTMA 5DM63 4KHZA 4GKJQ 3U9OA 2Q2TA 1LTID 3I3CA 4A3KG 5HGQA 3UE0A 4ODGA 1BVSA 2VUMH 3GTKB 1RKNA 5KNBA 3HOWH 2NVYB 4QUCA 4HEDA 3PMFA 3GTMB 2KCMA 2VQEL 1IYVA 5AJ3Q 4CHTB 2VQFL 1SNDA 4IJHA 1PLFA 5IGDA 5FOBB 4OWXB 3I73A 3I90A 5JOBA 1TWCH 5EBDA 1VQMA 2K5NA 4ZRZA 1ILQA 4C1NK 3GTPH 5IGFA 4DR5Q 1EIYB 1D7QA 5EPJA 3EA6A 1ET6A 4FP5D 4DNIA 4U68A 2QF7A 2N88A 2K4KA 3EROA 4GKKQ 5M3FB 2ATWA 1H9MA 2B63G 1Y8OB 2I0QA 1JOKA 2EPBA 2H1EA 2EVBA 4AH6A 3T51B 4A3JG 4DV4Q 1EUJA 4N8FA 3CCLA 3QO2A 2WAQB 1EWHA 1VQOA 4IUTA 1YNXA 1E3PA 3K5OA 3QR8A 4DR6Q 3MWYW 4RGMA 3TS2A 3CF5A 2K52A 3NSWA 5EJWA 1SE8A 4YHHQ 4ALPA 1O80A 1PH7A 4OX9L 2Z4IA 2KECA 1PRTC 4GN5A 1BBWA 4NXNL 2EJGC 5EBCA 5HURA 3F2UA 1RHPA 1WYDA 1TXYA 4IALA 1VQGA 4JC0A 3MTSA 2YTYA 1I3QB 2E76C 5C3EG 2ICEC 4KK7A 2B63H 3MC0B 4ULLA 2A68C 5A2QL 2XGTA 4GZYC 1EIGA 3OHXC 2K04A 2DY8A 5FLMH 3S2HH 1KHIA 3PF5A 2A1AA 3IL8A 3RNUA 3H6MA 1N36L 1QB5D 5I6YA 5IYDG 2Z1CA 1FGBD 5C0XH 1JR0D 4BWGB 1A3VA 2IWHA 3MVVA 2J0TD 1IBLQ 3SK4A 1XPOA 5JJZA 2LS01 3H0GH 1MSGA 1NMGA 1TY2A 1CSQA 2HDLA 2YTXA 4BA1I 1TS4A 1QG7A 1X9NA 2UXBQ 1UE5A 2R7ZB 1XXGA 4AQYQ 3NTIA 3J81j 5FLMG 4OL7A 2EY1A 2MHVA 4OONA 5IYBG 3I56A 4C3JH 1II3A 1FD7D 1Q8IA 1MGSA 2PW7A 1Q46A 1SDFA 1AE3A 4YCVA 1JJ2A 2RDGA 4NPSA 1KAAA 2HCCA 4X65L 1D6EC 1TT2A 5IP9G 1NY4A 3AFQA 3A7AB 3K58A 1M90C 4K14A 1HNWQ 3TP8A 1G2TA 4FF3A 3J7A5 4QQBX 4IUQA 1X3EA 3C1FA 3J80c 2X69A 3BJUA 5BN3A 1A3TA 4FNFA 2SEBD 4B3MQ 4DUZQ 1LM0A 3W5OA 3CCMA 3S1RH 2Y0SB 3T13A 4XYOA 1N8RC 4KY5A 4JI4Q 1YVCA 1QILA 4BY1B 3MEFA 3DM1A 4K0KQ 4RKLA 5EAYA 4A3IG 2BCOA 2HHHQ 1HTPA 1Z47A 3RR5A 3FVQA 4N9PA 5CBAE 2K6AA 4JI7Q 1U0LA 4BY1G 4Z9CB 1H95A 2KVMA 1LACA 2HUGA 2K5VA 1TKWB 1PFBA 5LL6X 3R2TA 3EJIA 1HTLD 5E4XA 3EFXD 3LNNA 3DMUA 1A63A 4AQYL 2Z8LA 2XN9C 1K3BC 2K01A 3WDNA 5JEAG 3HOUH 2IW3A 1GO3E 3PGZA 1UE1A 1VDZA 4RKBA 1AZPA 3KUPA 2JA6B 4DN4M 2L1BA 4YWMA 2B2TC 4A4IA 4C3JB 1L2FA 1XNRQ 3OYYA 3OMCA 3RMHA 2KQ3A 5D3IB 1JB7A 2Q2UA 1A62A 3HP3A 3SXHA 1NUCA 2C35B 3GTQH 1SFOB 4UHVA 4MIUA 1PFNA 2WKDA 4H13C 1S4ZA 4WJ4A 3CCQA 2JA8G 1XPUA 1QJOA 2UXCQ 1OXTA 2VY3A 2I46A 3P75A 4L8JA 2ZJQA 1VF5C 4PZ8A 2B8FA 4B3ML 5IGGA 3G48A 2RHSB 5HY6A 3NENA 3W1BA 3G71A 1EY7A 4IFDJ 1IXRA 3S15H 3OTOL 4IFDG 1B1ZA 3CQZH 5IGCA 2LXJA 5LMUL 1LT5D 4LFCQ 4B9WA 3F1ZA 4DAYA 1R4PB 2EQSA 1ASYA 3S2HB 3TEHB 1SN8A 4C2MH 1CFMA 4ILWA 4LF7Q 3I70A 3HZXA 2VB3X 3T53B 2PQAA 3M3YH 1WTQA 4RHRA 4DR1L 1CKNA 4DV1Q 1PFMA 3CC2A 4B3RQ 4PNYA 1QVGA 4PV1C 1PVOA 1BOSA 3S16H 2RF4A 3NBIA 1V8QA 1C48A 1EIFA 4YWKA 3CCJA 3BG3A 2NB0A 2LFNA 2D2CC 1S5BD 4JI3L 4DUYQ 3ULPA 4EQOA 3GV6A 2KBNA 4A93B 1TIID 2VQEQ 4UP9A 1K0SA 3ULLA 1B53A 3R8BA 1C7YA 2MQHA 3HOZB 2L15A 2PMZE 2JA5G 1VQNA 5M3MB 2I5HA 2FHTA 1H9JA 1YJWA 3OIQA 5E4WC 3GTKH 1I4HA 1ASZA 1I4XA 3LGJA 5IP7G 2HDMA 4B3TL 2KHSA 4JI5L 3M9BA 2JA5H 4BA2I 1MD2D 1A8VA 2JE6I 1OO9B 2K50A 2QDLA 1J6QA 2EYHA 1JMCA 4LUVA 5CGKA 3QIAA 4LFBL 1DCZA 3OW7A 1VQ4A 3WWVA 3VDYA 1PH8A 3S15B 2F0FA 4C3HB 3D4WA 3PO3G 1Z7TA 5EKIA 3QG1A 1F9RA 1Q12A 4DR6L 1ENCA 1KABA 1BKBA 4JV5Q 3A74A 3P7JA 1A15A 3E9HA 1CKOA 3M7NA 4LFAL 4LNQA 3BYYB 1EYAA 2RSOA 3DEPA 4QL5A 1HQRD 3LX0A 4X6AH 1EWIA 3CP0A 2SNMA 3M4YA 5K36H 1D5MC 2ZTDA 5KRUA 3D4RA 2UUAL 2EYFA 1H9SA 1RJTA 5IT9L 2JQOA 2E2JB 4LF9Q 4POFA 1OXUA 4HJ9A 1VQ9A 3CU7A 3NEMA 5C3EH 1GKHA 1RF2D 2QEJC 1ONLA 4ZKCB 1EY0A 2NZOA 4IZ8A 4PZ6A 1P8LA 2LSSA 5CV4A 4X66L 3BVZA 1RODA 4LF8L 1B44D 3WOEA 2KEDA 3S1RB 2IY5B 3MXNB 4O2DA 5JVH3 1SFOH 5T1IA 1S5FD 2EZVA 4NW2A 2A69D 4YCUA 2F0QA 3MXPA 2PPBC 4A3LG 5IGBA 1O78A 2KCCA 4V190 3D3RA 4NXMQ 2GVBA 4G7ZC 3NTKA 1LTBD 4OEMB 4LJZC 1KAWA 4DNTB 4LF6L 4DV1L 1JC7A 1OXXK 1FR3A 3KF8B 2YYZA 3H91A 1N33L 3X3NA 3DHQA 1SE4A 1XTCD 3I2ZA 4R8NA 2NZ1D 4R4OA 4C2MB 4EQ5A 2SNSA 1PH6A 3S14H 1CZWA 1E1OA 3GO5A 4OHJA 4JI2Q 3Q24A 5LL6S 2VNUD 4YY3Q 1EY5A 4QJFA 1QNUA 4BY7G 1ZKOA 4A76A 2MO0A 2NZHA 2JA8H 3SVMA 1MIUA 3ZYYX 1WTPA 5GQOA 1CM9A 5C44B 3FKIH 2ENBA 1UEBA 5DNFA 3ERSX 2A6HD 4RG1A 2CH4W 3E0JA 1HR0L 5IWAQ 1PZID 2A8VA 1WCMG 1Y1VG 2PQEA 1A0IA 1I4PA 2F3WA 4U673 1TWFB 4G57A 4JI4L 2M00A 1WTRA 2BDNA 3U9SA 4P71A 3M4QA 4DV2L 3PIOA 3AU7A 4TVAB 5C4XB 1CT1D 3BU2A 2B2YC 3L2PA 1B2TA 1F9QA 4JOIA 1K3RA 2EY5A 3UDGA 1SMXA 2R92H 4BY1H 3PUXA 4AYBG 4L6TB 5AJ3L 1JT8A 1PTOF 5C44G 1PTOC 3GTLB 4P74A 3CCUA 4ME3A 3W2DA 5IYBH 4FO2A 1XYIA 2L55A 1QE6A 2GA4B 3T1HQ 1C9OA 4JYAQ 1AE2A 3OSOA 1W2BA 3GTJB 3J7AV 1IL2A 4BXXH 3GQBA 2QEXA 3S14B 2K5QA 4JBKA 2NVQH 5AFWA 3EQLC 3PSIA 2I5MX 3U58A 4ID6A 3MXGA 2N49A 3A54A 1SBBB 1SE2A 4DAVA 2M2LA 2QKIC 4LUZA 3OWFA 4IUVA 5CV8A 4CJ2C 2N78A 1B3QA 4X3SA 1Q3LA 2Z9HA 1SRUA 4HIMA 2K5HA 3LWEA 1STAA 5IY0A 3CRLC 1C4QA 2BE5C 4LF8Q 5I2XA 3K6OA 5J22A 2DNCA 4BBSB 2OXPA 4IUUA 3K7UC 5CV5A 3SDZA 4DV3L 1NE3A 2F0EA 3H09A 3M85A 1GVPA 5C3EB 4LFCL 3A5UA 5C4ZA 2KHIA 4DV7Q 2SDFA 2MFIA 1CA6A 4DR7L 5C3WA 2BDOA 4LK1C 1EQVA 4LWCA 3CMEA 1O7LA 1XJVA 5ELCA 1R9TB 3K80C 4ZQ3A 3CMAA 1CHQD 5I6WA 5K36G 1CQFA 1QWYA 3STBD 4GOPB 3KLWA 2ES2A 4K8JA 1YNJC 1XNQQ 2EJMA 5IOCA 3L3OC 1AZQA 1S40A 4A3GH 3FKIG 5DM73 2ID0A 1QNKA 2E2IB 1LV9A 2ASBA 2KUMA 1OXSC 2CVRA 3QWNA 2Z0SA 4QF4A 1LYLA 4A3JH 3MAQA 3H3VI 2F4VQ 4JBJA 1K9MC 4A93G 4JYAL 5FO7B 2VXWA 1AFPA 1Q1BA 1Q82C 2B29A 4JOIC 3T16A 1BQQT 1SJED 4DFAA 5GROA 5JEAJ 1ILPA 2V4DA 1DXMA 1E2ZA 1MKHA 4MTNA 2A6ED 4IQZA 5ISRA 1IBKL 1IBLL 3KJOA 4G4KA 4K0KL 2P5ZX 5M5WH 1VQ8A 1BR9A 4RWSC 1HNZL 3HOZH 1HFNA 4KY7A 4HN7A 3L7ZC 2RDHA 5D14A 2D9UA 2H5XA 2BOSA 2F0OA 3S1QB 3J81E 4P72A 5C6AA 2JN4A 1G6ZA 3NBHA 4AIMA 4TSSA 4CBVA 1FNWA 3ND8A 1VQCA 1PZKD 3CRKC 1UNSA 1EYDA 5EKLA 4QCLA 1SMYC 3HEJA 5LHY1 4GOPC 4GKJL 4P2CB 4TQUS 4F87A 3DLLA 2JP1A 4JV5L 2PMZB 1KRSA 1YJNA 5C0XG 4OO1I 5EQ0A 1XNQL 5M5XB 4P75A 1VQJA 3PUYA 1KD1C 4DXGA 1TS5A 2K7VA 3ICEA 2AQ2B 2YTVA 1JICA 3TRZA 4A3DH 4A3FB 4A3IB 1X6OA 3R93A 3J81L 2CQOA 2EDGA 2PZTA 5KEEA 3MFYA 4L5SA 4X62Q 3BZKA 2Z6BA 4FXGC 2C5CA 3AQQA 1SYBA 2LKVA 5LMUQ 1J5EL 2PW5A 3P1HA 3F2CA 2MPMA 1AW7A 2AHOB 4J1MA 2CW0D 3A5ZB 3DXJC 3UDXA 3AFPA 3BS1A 1DD2A 1WVLA 2TMPA 3AMUA 2K32A 3VR2A 3W3AA 4O0AA 3SHLA 1M1KC 4A3KH 4DV7L 3KFUA 1PH5A 3S24A 1E22A 5FO9B 5KGUA 1KLUD 3HOWB 1PH3A 3K5LA 4JI8L 1K8MA 1RDPD 5G3LD 1HZAA 1EEFD 2CWAA 1BCPC 2E74C 4N9TA 4KHVA 1YHBA 4RGNA 5KYIA 2PO4A 1JJCB 1F2LA 2WKCA 2RSNA 4QB4A 2B3GA 4XQQA 3NTHA 2CCZA 4MTKA 4KD4A 5EPLA 1V1PB 4IJLA 3GTPB 2AUKA 1MI2A 3ZJYC 1F9SA 2RA4A 1TR5A 5JEAH 1CHPD 2OQ0A 1X54A 3BDOA 2UXDQ 3RLOA 1X3FA 3RLNA 4IN3A 1CA5A 4IUPA 3PF4A 3UI2A 4DV5L 3K7AB 4HMIA 2CWPA 4DK6C 4ZUIA 1YNNC 1N36Q 1I50H 4A3IH 4XQNA 1STHA 3NUCA 1Q1EA 2OQKA 4GN4B 4PZ7A 3M4OB 3FDTA 1S3OA 2Z4HA 1EU3A 1IW7C 1ZEQX 3I72A 2OEOA 2B2WC 1HRJA 1T5XD 5ELBA 4HSPA 1WD0A 2IPKD 4NDXA 4A3EB 4A3CH 4DR4Q 2D0PA 2JXMB 3TP6A 1HR0Q 4PG3A 3GTMH 1A6XA 2CKZB 1FNVA 2K5DA 3FKIB 4CJ0B 2UXBL 2J7ZA 3T56B 1HNXL 2L12A 4C3JG 1HFGA 4R4IA 1TS3A 1TWCB 5IGEA 2JEAI 4RA8A 1L1OC 3NPPA 1D5ZC 3NQTA 4KI0A 3RN5A 4OO1G 3W1GA 1GM5A 3GTOH 3I4NH 1RIPA 4CKCA 3SGIA 2JJQA 3S1NB 1LO5D 1X3PA 2MJ8A 1IYUA 2EY6A 3OW2A 1ICFB 2AKWB 1AEXA 1A2TA 3S1QH 2E75C 3C1EA 4LUOA 4O42A 3HOYB 4KHPL 5C4JB 3KBGA 1ML0D 3UDIA 2IHEA 4UP7A 1E7ZA 5IE8A 2RVLA 4TRDA 5I9PA 4JPBW 4HIDA 4APVA 2PNRC 4K8IA 3MFGA 4F88A 1HNWL 2F0TA 2F0GA 2RCFA 2HCIA 5FLXL 1PHJA 3EN2A 4N8X1 1P16A 1ZYRD 5CMDA 2ZM6L 3AYHB 5NUCA 4DUZL 4C56C 2XNAC 3R2IA 2IHFA 2XWBB 5H1SE 1Q7YC 1SEBD 3QOLA 4DV0L 4ZLTF 2AQ3B 3TZDA 3FMCA 3QB3A 5L37A 2NVQB 1SYGA 2FXQA 5M5WB 3D4DA 3I4LA 1LTGD 4XXEA 2PZWA 4K2LA 3VYUA 1FGUA 3HOXB 1GUTA 2Q8RE 3OWEB 3DM3A 5CYUA 2DJFC 4DR7Q 2WB1B 1UUPA 2FMMA 3I91A 1PRTB 3EBEA 5BR8L 1LT6D 2HIXA 3S17B 5FJ8G 5ELOA 1AP0A 1GUWA 2ZJRA 3O13A 4DR3Q 4CDCC 2LY7A 4OWTB 4YY3L 4FVMA 1Q86C 2IX1A 3H3VH 3J80L 2PQAB 4BS9A 1X32A 3K59A 3BZCA 3K8AA 1JORA 4DXFA 5M5XH 1KNAA 1WCMB 1Y1VB 4OXPA 2Q2IA 3LWUA 5M3FH 2B2UA 5ELEA 4LMQD 4IOCA 3BVGA 5I9OA 2RBMA 1NAPA 3D6CA 2EYMA 2LMCB 3BVMA 4LF5Q 4RHSA 4KKUA 3KLSX 1Y69U 1F77A 4QY7A 3TSSA 1WD1A 1D5XC 4JCVE 4BBSG 1HJPA 4K6LA 2F0LA 4LF7L 4ABNA 4DGZA 1YZ6A 3R3OA 1HNXQ 1L0YB 4UDUC 4JI0L 4DR1Q 4XTCS 5ELNA 4ZCKA 1AN8A 1N33Q 1Q8KA 1V1OA 1JWUD 1PV4A 3GTGB 4B3RL 3L0OA 4FF1A 1L1OB 2F0VA 3RLFA 3QJYA 4IPCA 2JYOA 2NBFA 4JI3Q 3CHBD 1ENFA 1WI5A 3JAMi 2BA0A 4GLVB 2BA1A 4L5QA 5A35A 3NWSA 3HOYG 3PUZA 2L9HA 2EXDA 3NE5B 2NVTB 2BH8A 2FFKB 1WTHA 4ZYSA 2IL8A 2ZM6Q 3VYTA 5E7NA 4DK1A 4QMGA 4OGQC 5IWAL 4HIOA 3S1MB 3ONAB 3HOWG 1Y8NB 1IBMQ 4ZK9B 1U9RA 1KIXA 4H0LC 5C5MA 4A3FG 3K81C 2K5WA 2MUYA 3B6YA 4B3SL 1JE5A 1KXLA 3IRBA 1PMRA 2NTSA 1O7YA 3JAMc 1J8IA 3PIO3 2PNHA 4KJOA 1TY0A 2BH2A 1CQVA 1JE4A 2B39A 2RQXA 2XRSD 2XTIA 3ULJA 1F2YA 4J6HA 1HR0W 3WOFA 3NELA 4LW1A 3J80E 3RZOH 5C3XA 1EIHA 1LABA 1LLRD 4IURA 4ZUJA 2K05A 3NBHB 1YBYA 1SROA 3RZDH 1KLGD 2B2TA 3IAYA 2OCEA 4GLAC 2OT2A 4RGTA 1U4MA 4WORA 1JCKB 3U50C 1X3QA 3HOXG 4QUFA 4FXDA 3I4NG 1GOZA 2MNAA 1FYCA 3GTGH 3H0GG 1IHZA 3CCEA 4IOAA 5FK9C 5GAHC 2H4OA 1S72A 2UUAQ 4CDDC 3CQZB 3FPPA 5C5LA 4IFDI 5C4JH 5CV6A 4EQNA 5BN5A 4ZKBB 4A3BH 1XMQL 3JAME 2A5HA 3N6RA 4LF9L 1JWSD 4OIKA 1R4QB 1KDAA 1KNEA 1STBA 1VMPA 2AWNA 2HQEA 3QOJA 3M4PA 4DPGA 2EYJA 3NP8A 2K03A 4NKLA 3A7LA 1EZ6A 2KOLA 1VCIA 4R8IA 4A75A 3MHBA 4DV5Q 1FJGL 1EY8A 1F9PA 1KDBA 3J81i 1WCMH 1Y1VH 1Z9FA 1B4OA 2F0UA 1FNUA 1G51A 1PTOH 5J39A 2O5IC 2MO1A 2GN5A 1XWEA 2D62A 1UE7A 1BCPF 1V1PA 1XTDA 2F4IA 2VL6A 3EIVA 4NXML 3M4OH 2PI2A 1K8AC 1BCPB 4B9XA 3JAML 3PUWA 5D3DA 2R93B 4FYDA 1S5DD 5E3FA 1LUZA 4XT3B 5CORA 3X3MA 3KBXA 4FDBA 2HIVA 1CI3M 3V96A 1G91A 3HKSA 3TMEA 4F8MA 1LTTD 3HS0C 4RMFA 4Y7NH 1L1OA 2DY7A 4GNXC 1IKLA 1T5EA 4A3MH 2K75A 1BNZA 1XNRL 1X56A 1X3GA 5ELFA 2DJGC 4DAMA 1W3SA 5COYA 2EXZA 1GHJA 1XMOL 4GS3A 1B7YB 4V0BA 1TWAB 1Y1WB 4JI6Q 2JA7B 3BDLA 1ZXTA 1YIJA 3GV3A 4R4QA 1PH1A 1VQ7A 1I94Q 5DEHA 3E0EA 5FKAC 1LTAD 2B2WA 2L5TA 4FXKC 3CPWA 5LMNL 1M8AA 4R4TA 3CKIB 2RDFA 3PO2H 4CDFC 4A3DG 1PYSB 2XSCA 4A3LH 1NMFA 3NWTA 1EU4A 1HPCA 1G291 4L5RC 3G7LA 4HR7B 4AYBB 3RN2A 1NSNS 1M4VA 2KA7A 2WB1G 1RCVD 2IJ0A 2KJXA 1NR2A 1MBYA 4IPDA 3SR1A 4JBMA 4X65Q 3HKZB 3TBIB 4MHEA 4KD3A 3KDFA 5BR8Q 1JOQA 1STNA 2EY2A 3CW2C 3J7AF 2M9VA 4RFBA 3DWPA 2VB2X 3RD4A 1N34Q 4OWWB 3I4OA 3I4MG 4K2KA 4KTAA 4QGUA 2X6LA 3GDEA 1XMQQ 4X62L 1EFID 2WAQE 1SNMA 2F0SA 4B08A 2O2LD 5TSSA 4XYQA 3E9IA 5I2YA 2F3VA 3DWAA 1CK1A 1TWGB 4G7OC 4A3GG 2N8NA 1WTWA 3K0YA 3NHHA 1QCBD 1I3QH 1TWHH 1T9HA 3VR3A 4X3TA 5M9OA 2RCNA 1V9PA 4DK3C 5IT9E 2A74C 3A8IE 4HCSA 3HOZG 4A3BB 4DV3Q 5LMNQ 2NYZD 1ICWA 4L5TA 3FHWA 2B2UC 1H9RA 1DOKA 1E2WA 1EWCA 4CKBA 1VQDA 1B9NA 4H44C 4JI8Q 2K33A 1RL2A 1PTOD 1WTVA 1KTKA 2VS1A 3AB9A 1XX8A 2EJFC 4R4CA 3GTLH 1BUVT 1K28A 4JI0Q 2YU9B 1BO0A 4KN7C 4EGVA 2JA8B 1EL0A 4HMJA 5FJ8H 5J1ZA 2DNEA 5EKKA 2KCTA 2B2YA 3Q0AA 2CFMA 3I4MB 2NN6I 2VUMG 2N55A 4GNXB 3S2DH 5M5YB 3FPUB 4C3HG 1DOMA 1PRTD 1PRTF 1UAPA 2RHQB 3A56A 3CAMA 4X3KA 2R7ZH 2B2VA 3J7ZC 5JPMC 1VQEA 5G3LF 1MHWC 5C0XI 1HZ9A 2AQ1B 2FMCA 3TZUA 5IODA 4YIJA 1E2VA 4DR5L 2DGYA 4POGA 1SYFA 1ESFA 2GVAA 1QZGA 2V1CC 1X65A 1IBKQ 3N52A 3G6EA 2A68D 4HSVA 1CUKA 3OTOQ 1K73C 3Q23A 2FJ2A 5A2QE 1CSPA 1HNZQ 4KV6A 3C46A 4Y7NB 2UUCQ 2WINB 1YI2A 2D5DA 1PXUA 3VYSA 3VR5A 3D31A 3H94A 2G5DA 4LF4L 3MEHA 2WAQG 2NVTH 4PMBA 2E2HB 1N32Q 4YHHL 3GTJH 3IFDA 1QZHA 1OTCA 3PQIA 5FO8B 3KLSA 5E1FA 3J80i 4HTHA 2UU9Q 2EE1A 4LF6Q 4KHPQ 4EVOA 3KF6B 1Y1WG 4C3IG 4M1UB 5T1GA 3CPFA 3DEOA 2WFWA 1C8CA 2YU9H 2G9DA 2JSOA 1LT3D 4DK0A 3S9WA 1KQSA 4CGYB 1IYJB 1I6HH 2L0CA 1GUNA 3TP7A 4DR2Q 1LTSD 5BN4A 4MNOA 2N3SA 1N34L 1NCVA 2E8GA 3H15A 4Q5VA 4KKTA 5JJIA 3FP9A 2AMCB 3HOVG 3A0JA 2IT1A 3PUVA 4XDXA 2SOBA 4E6IA 4ME5A 4PMWA 2JA6H 4A3KB 4B3TQ 1VQ5A 2F03A 3PO3H 4BY7H 3TQYA 5CC4A 1BF4A 4LFBQ 4WJ3M 4GLXA 4K5WA 4XT1B 5KIXA 1U5KA 2OF1A 3I7FA 4IPHA 1FJGQ 2R6GA 3G4SA 2UUBQ 2UUCL 2JA5B 1DGSA 1NTGA 4CKEA 1PYWD 2A6HC 3J7YW 2E2IH 1HA5A 4H02A 4GOPA 1WTOA 4OELB 1EYGA 4F7XA 1EY9A 2HD3A 1VS0A 4C3IB 3CXCA 1TWHB 3KJPA 1KDCA 3NQIA 2E2HH 2RKSA 4WFN3 1DONA 1VQHA 3ERQA 1H9KA 3L9AX 4UAIA 1W6KA 3K5MA 4JW0A 1HXYD 2F0WA 5HGTA 5JVG3 3TS0A 3HG9A 5J3BA 4A3FH 2AUJD 2VQFQ 4X64L 4HJAA 3CCSA 1X55A 1KRTA 5ELDA 5IP9H 2R93H 3K0XA 3HRZC 4K5XA 1F2ZA 1L0XB 1SR3A 2UXDL 2EYOA 1PA6A 2E2JH 3GTQB 2Q2HA 1Z6HA 3DWQA 3I4MH 4JG2A 1EOTA 1EFWA 4HJ8A 1XMOQ 1O7IA 2A69C 3D8GA 2JA7G 4JI6L 4KMUC 4A93H 4C1NI 1G2SA 5CV7A 3OPOA 3ITPA 3NXWA 4GKKL 2QGQA 5IYDH 4DR4L 1STYA 3KYHC 1SYDA 5M3MH 1FVIA 4BY7B 3CC7A 2KENA 1V43A 2I07B 1TWAH 3T1YQ 1SYEA 2JA9A 1BCPD 1EQRA 3E5SA 1Y1WH 1YHQA 4JI7L 2JA7H 1GHKA 3KOJA 1QOHA 3KLRA 1CKMA 5DAUA 2WV6D 2E5LL 5CV9A 4UY8C 1I6VC 1ESRA 3CD6A 4TKOB 2EOTA 1QVCA 2NN6H 4QIWB 4I7AA 2A19A 2UU9L 1SJHD 2X6GA 3M3YB 3V05A 5I4DA 3URYA 4JI1Q 4P73A 5IIFA 4X3UA 2CQAA 3F8TA 1QUQB 4I7ZC 5C4XG 1DJRD 1TU2B 1GUOA 1YNJD 3U4ZA 3GP7A 5M5YH 3S2DB 4X64Q 3IFTA 2ALYB 5CR3A 4BBRB 5GAGC 1PZJD 2XRQD 3C3LA 4KY6A 2Z6KC 1GD7A 2QILA 5M3FG 2NVXB 2LXKA 4A3CG 4DA2A 1BBUA 1CZGA 5FLXE 4XIGS 3PIP3 1EY6A 1EYCA 5C44H 4BBRG 5CBEE 1LTLA 1VMCA 4IO9A 2F0PA 2D0OA 1SSOA 4Y52H 3BYTB 4DV2Q 1I5FA 2KCNA 3S17H 1J9OA 1VQIA 2ICIA 2UUBL 1IKMA 1JB3A 3F2DA 1B9MA 1F2MA 1NJIC 1NNXA 3I4NB 4S3SA 5C4HA 3MA2B 3S1NH 4UPAA 2PZUA 4IUNA 3RUZA 1PFSA 1K83B 1I4GA 1GJXA 4ZAIA 4DV6L 2ZT9C 4WRDA 3E3XA 4HAEA 3IKJA 4HIKA 1LTRD 4DAPA 1B70B 1WJJA 2PI2E 2PYKA 3SE0A 1ET9A 3T1HL 1VQ6A 2L4NA 2K1BA 2EIFA 2G9HD 3UDFA 2NUCA 1OXVA 4JI1L 1SMYD 1FL0A 1MJCA 4IFDH 5JPNC 2C9OA 4RCNA 1RTOA 4K6DA 1VQBA 4C3IH 5KNDA 1N9WA 3KDFB 4A3EH 1HUNA 1Y8PB 3FRPB 1SNCA 1I6HB 2DUDA 1K8GA 3ND9A 4R9WA 3TREA 2QA4A 3S16B 3A55A 2WB1E 1U4PA 2F52A 1KL9A 4I65A 5IYCH 5IT9c 3PV0A 1MSHA 3I8ZA 3PCOB 4Q0FA 4WJWA 1EOVA 3UE1A 4O1NA 2XIWA 4JI5Q 1XPRA 2B2VC 3SK6A 3DUZA 2R92G 3PO3B 4JVZA 3SEBA 1D8LA 3STBC 1WTXA 3HOYH 1YHAA 2Q8TA 3V2TA 4EX5A 3HKZG 4A3EG 2Q8IB 2E2DC 5KYLA 1C0AA 4LF4Q 2F0KA 3A8KE 1DZ1A 4JBWA 2Z6KA 3OIPA 1N32L 4EQPA 2IX3A 1W6JA 2MP1A 4DV6Q 1VQPA 1K83H 2NWGA 3Q8DA 1CKNB 5C0XJ 4LFAQ 2B8GA 4OIJA 4AYBE 3PO2G 4C3HH 2F4VL 5M3MG 3AEVA 2F0MA 2F0IA 2YV5A 4XQJA 1YITA 1WOCA 2A6EC 1GUGA 3K7AH 1U4RA 1I50B 4RH6A 3SK5A 1G8ZD 1PH9A 4A3JB 1D1IA 2K28A 2Y0SG 3H3VC 1S5CD 5EGTA 3OOCA 2JEBI 1BXTA 1VF7A 5EPKA 3HOXH 3U4VA 4MN3A 2UXCL 2O5JC 4HJ7A 1EEID 2WACA 1UE6A 1Q81C 1IBML 4J15A 1G6PA 2O4XA 1Q90A 1JOOA 2EYPA 2HHHL 4BBRH 1K8OA 3G6JB 2NVXH 4OX9Q 2F3IA 1TWFH 5LMNW 1PH4A 3GTOB 1SE3A 1TS2A 4GN3B 4FF2A 1GUSA 2NVYH 4NXNQ 4MZ9A 1IL8A 5C4XH 1Y14B 1NBWA 1L0WA 1E24A 4YWLA 1GXDC 4BBSH 1BBXC 1B8AA 1HZCA 4NB3A 4PMCA 5IP7H 4QIWE 1HH2P 5JJKA 3VA5A 1A3UA 4JI2L 3HKZE 1E1TA 4H7BA 5GAEC 3CCRA 3CC4A 1E0BA 1EZ8A 4YCWA 4DUYL 5KNCA 1JJGA 2KEEA 1B3AA 3Q6SA 1I4QA 2WIIB 1HZBA 2ZJPA 2FINB 1UEAB 1BDOA 1D1KA 2ZTCA 2JA6G 2QW7A 3K5NA 4J8QA 5JJLA 2F1MA 1JQYD 1LT4D 4NP5A 3PIPA 1ENAA 1J5EQ 3MXUA 5K5PA 3BZDB 1WFQA 1PDQA 2OTLA 3KF8A 2F0HA 3HOVB 1AH9A 1ZYRC 1U4LA 3HGBA 1DOLA 2R61A 4DV0Q 1VQLA 2VZAA 2ZXPA 2R3ZA 2CHBD 1SNPA 3MXNA 2KHJA 2Y0SE 2BE5D 4HCEA 3T1YL 4K5VA 2R93G 4CDEC 2XWJB 1VQAA 2E5LQ 1YEZA 4KKSA 2AWOA 3JC66 5DLQE 4RAUC 2ZTEA 1HA6A 2J4XA 4KJNA 2OTJA 4FF4A 3T4AC 4OO1H 1SNQA 4DR2L 4DR3L 2DN8A 1STEA 3BDCA 1YNND 1S5ED 4PQXA 2A73B 2R92B 1RTNA 5D65A 2QDBA 1IW7D 2TSSA 3PO2B 3C2PA 5IYCG 1NR4A 4HJ5A 2NTTA 1O7ZA 1SLJA 3VR4A 2QCPX 3RZOB 1EQTA 1I94L 1SNOA 1JWMD 2JK8A 3M7GA 3NK9A 2R7FA 4DAYB 1EQQA 4IPGA 4DF7A 1A2UA 1SAPA 3HOUB 2R7ZG 2MGSA 1RD9D 4G7HC 3TN2A 1D2BA 4JK1C 4X66Q 2ZXOA 3MZ5A 1IZ6A 4A3DB 3ER0A 4LF5L 4M8AA 2I5LX 4UP8A 5JAVA 4DKAC 1QUQA 3HOVH 4A3BG 2VW9A 1PYBA 2L11A 2PCFB 4RGOS 3HOUG 3KK7A 1I4RA 3VR6A 1K0RA 2VUMB 3Q22A 1TQOA 1V1QA 2B63B 2WP8J 2R7DA
chains in the Genus database with same CATH topology
4PMWA 2JA6H 4B3TQ 3HOVH 1VQ5A 1QVFA 2NZOA 3EBEA 5BR8L 3PO3H 4PZ6A 4BY7H 1P8LA 2HIXA 2LSSA 4X66L 1MJEA 1VQKA 3TQYA 5FJ8G 5ELOA 4LF8L 4LFBQ 4WJ3M 2ZJRA 1TWGH 4GLXA 4DR3Q 2IY5B 1U5KA 3I7FA 3MXNB 4IPHA 4O2DA 4OWTB 2R6GA 4YY3L 1FJGQ 1Q86C 2IX1A 3G4SA 1SFOH 2UUBQ 4KLKA 2OWOA 2UUCL 3H3VH 1VQFA 1DGSA 1NTGA 1R9TH 2PQAB 4YCUA 1UWVA 1YJ9A 4A3LG 3BZCA 3K8AA 5M5XH 3I55A 2E2IH 4OXPA 4H02A 2Q2IA 4GOPA 1EYGA 4NXMQ 2GVBA 1VS0A 5M3FH 2NN6G 3S1MH 4R1JA 4IOCA 3CXCA 3KJPA 1KAWA 4LF6L 2E2HH 4DV1L 3HFZB 1OXXK 2K14A 5GADC 3KF8B 1VQHA 2YYZA 3J81c 4GNXA 5FLXc 1N33L 4DV4L 3I2ZA 4LF5Q 2HQLA 4R4OA 3KF6A 4EQ5A 3TS0A 1PH6A 3S14H 1PH2A 2IX0A 3CCVA 1E1OA 3GO5A 4JI2Q 5J3BA 4A3FH 4QY7A 2VNUD 2VQFQ 4JCVE 4YY3Q 2HT1A 4X64L 4HJAA 4BBSG 1HJPA 3CCSA 1X55A 4B3SQ 4A3MG 4QJFA 3GD7A 4BY7G 4LF7L 3D0FA 1KRTA 1KC8C 4A76A 2MO0A 1YZ6A 2NZHA 5IP9H 3GTQH 1HNXQ 4BXXG 3K0XA 2JA8H 2R93H 4JI0L 1MIUA 3F2BA 1SR3A 4DR1Q 5GQOA 2UXDL 4XTCS 5ELNA 4KHZA 4GKJQ 1PA6A 2E2JH 3FKIH 2Q2HA 2Q2TA 1N33Q 1UEBA 4A3KG 3I4MH 1Q8KA 5HGQA 3UE0A 4JG2A 1EFWA 1BVSA 4HJ8A 1XMOQ 1PV4A 3ERSX 1O7IA 2VUMH 4B3RL 3L0OA 2JA7G 3HOWH 4JI6L 4RG1A 4A93H 2KCMA 1L1OB 2VQEL 1HR0L 3RLFA 5IWAQ 5AJ3Q 2VQFL 2QGQA 4GKKL 5IYDH 4IPCA 1WCMG 1Y1VG 4JI3Q 2A8VA 4DR4L 3KYHC 4IJHA 5M3MH 1A0IA 1FVIA 4JI4L 1WI5A 3JAMi 4OWXB 3CC7A 2KENA 1TWCH 1V43A 2BA0A 4P71A 1VQMA 3M4QA 4GLVB 2BA1A 4L5QA 4DV2L 2K5NA 3PIOA 1TWAH 3T1YQ 1Y1WH 2JA9A 4TVAB 1EQRA 1YHQA 4JI7L 2JA7H 3KOJA 3BU2A 3L2PA 4A93G 1CKMA 3HOYG 3GTPH 4JOIA 3PUZA 4DR5Q 1EIYB 1K3RA 2E5LL 4UY8C 2EXDA 3UDGA 3CD6A 1D7QA 2BH8A 1SMXA 2R92H 4BY1H 1QVCA 4DNIA 2ZM6Q 5E7NA 3PUXA 4AYBG 4IFDJ 2A19A 2K4KA 5IWAL 5AJ3L 4HIOA 2UU9L 2ATWA 4GKKQ 1JT8A 2B63G 5C44G 2I0QA 3HOWG 4P74A 1IBMQ 3CCUA 1KIXA 4ME3A 4JI1Q 4A3FG 4P73A 3K81C 4AH6A 3F8TA 4A3JG 5IYBH 4DV4Q 1EUJA 3CCLA 3B6YA 1QUQB 3T1HQ 4B3SL 1JE5A 1KXLA 3IRBA 1C9OA 3JAMc 4JYAQ 5C4XG 1AE2A 2PNHA 1W2BA 2BH2A 1VQOA 1IL2A 4BXXH 1YNXA 1E3PA 4DR6Q 3U4ZA 3ULJA 2XTIA 2QEXA 5M5YH 4X64Q 1HR0W 2ALYB 4JBKA 2NVQH 3TS2A 3NELA 2K52A 4LW1A 3CF5A 3RZOH 1SE8A 3PSIA 5GAGC 4YHHQ 2I5MX 4ALPA 3U58A 1PH7A 2Z6KC 4OX9L 1GD7A 5M3FG 3NBHB 2N49A 1YBYA 1SROA 3RZDH 4LUZA 2LXKA 2OCEA 4A3CG 4GLAC 1BBUA 4GN5A 1BBWA 4NXNL 2N78A 3I4MG 4XIGS 4HIMA 1SRUA 3U50C 2K5HA 5C44H 4BBRG 1LTLA 1WYDA 5IY0A 1TXYA 3HOXG 1VQGA 4IO9A 4LF8Q 2D0OA 3I4NG 4JC0A 2MNAA 4Y52H 3GTGH 3H0GG 3CCEA 4DV2Q 1I5FA 4IOAA 2YTYA 3K7UC 3S17H 5GAHC 4DV3L 1NE3A 1VQIA 3M85A 5C3EG 2UUBL 1S72A 1GVPA 2UUAQ 4LFCL 3A5UA 2B63H 3F2DA 2KHIA 4DV7Q 4IFDI 5C4JH 1NJIC 2MFIA 4DR7L 4A3BH 2XGTA 1XMQL 4LWCA 3CMEA 4LF9L 1XJVA 3S1NH 4UPAA 5FLMH 3S2HH 1PFSA 1KHIA 3PF5A 3K80C 2A1AA 2AWNA 3CMAA 3RNUA 3M4PA 1N36L 5K36G 4DPGA 5IYDG 4DV6L 3STBD 4GOPB 1VCIA 3KLWA 4HIKA 2ES2A 1B70B 1WJJA 2PI2E 4DV5Q 4A75A 1FJGL 1XNQQ 3T1HL 1VQ6A 1S40A 4A3GH 2EIFA 3J81i 3UDFA 1IBLQ 3FKIG 1XPOA 2ID0A 1OXVA 4JI1L 1WCMH 1Y1VH 1FL0A 3H0GH 2ASBA 1OXSC 1MJCA 1Z9FA 2Z0SA 1G51A 1LYLA 4A3JH 1NMGA 1VQBA 3H3VI 4C3IH 4JBJA 1CSQA 1K9MC 2F4VQ 2MO1A 2YTXA 1N9WA 3KDFB 4BA1I 4JYAL 4A3EH 1X9NA 2GN5A 2UXBQ 1UE5A 1Q1BA 2D62A 1UE7A 2DUDA 2B29A 1Q82C 1K8GA 1XTDA 4AQYQ 3TREA 2VL6A 3J81j 3EIVA 2QA4A 4JOIC 4NXML 5FLMG 2WB1E 3M4OH 2PI2A 2F52A 1KL9A 1K8AC 5IYCH 5IT9c 3PV0A 5GROA 5JEAJ 3PCOB 4OONA 1EOVA 3UE1A 1MKHA 5IYBG 3PUWA 4C3JH 3I56A 4MTNA 1IBKL 1IBLL 3KJOA 1LUZA 4K0KL 5M5WH 4JI5Q 1XPRA 1Q46A 1VQ8A 1AE3A 1HNZL 4FDBA 3HOZH 2HIVA 4YCVA 1JJ2A 4NPSA 2R92G 3L7ZC 4X65L 3HKSA 5IP9G 2H5XA 4RMFA 1NY4A 3AFQA 1D8LA 4P72A 3STBC 4Y7NH 1L1OA 1YHAA 1M90C 4GNXC 3HOYH 1HNWQ 4A3MH 2K75A 3HKZG 4AIMA 4EX5A 1XNRL 4A3EG 1X56A 3J7A5 1X3GA 4QQBX 1C0AA 4LF4Q 1VQCA 4DAMA 1W3SA 1X3EA 1XMOL 4GS3A 3J80c 1B7YB 3BJUA 4JBWA 2Z6KA 4JI6Q 1N32L 4GOPC 4GKJL 4B3MQ 4TQUS 4DUZQ 1LM0A 3W5OA 3DLLA 3CCMA 3S1RH 1YIJA 4R4QA 1PH1A 1VQ7A 1I94Q 4DV6Q 4JV5L 1VQPA 1K83H 1KRSA 3Q8DA 1CKNB 3E0EA 1N8RC 4JI4Q 1YVCA 5C0XJ 4LFAQ 5C0XG 1YJNA 4OO1I 3CPWA 3MEFA 4K0KQ 5LMNL 4AYBE 3PO2G 4C3HH 4R4TA 1XNQL 5EAYA 4P75A 4A3IG 2F4VL 1VQJA 3PUYA 2HHHQ 5M3MG 1KD1C 1Z47A 3AEVA 3RR5A 3PO2H 2YV5A 4A3DG 1PYSB 1YITA 3ICEA 4JI7Q 1WOCA 4A3LH 1U0LA 2YTVA 3K7AH 4BY1G 3TRZA 4A3DH 1H95A 2K5VA 1NMFA 1X6OA 1PH9A 2CQOA 1G291 4L5RC 2Y0SG 1A63A 3RN2A 4AQYL 4L5SA 4X62Q 3BZKA 2JEBI 5JEAG 3HOUH 1GO3E 3HOXH 3AQQA 2WB1G 3U4VA 3PGZA 2UXCL 1UE1A 4HJ7A 1UE6A 4IPDA 5LMUQ 4YWMA 1J5EL 4X65Q 4JBMA 1Q81C 3F2CA 1IBML 4J15A 5BR8Q 3KDFA 4A4IA 1G6PA 2AHOB 3A5ZB 3UDXA 3AFPA 3CW2C 1L2FA 1XNRQ 3OYYA 2HHHL 2Q2UA 4BBRH 1JB7A 1A62A 1N34Q 4OWWB 3I4OA 4O0AA 1M1KC 2NVXH 4A3KH 2F3IA 4OX9Q 2C35B 1TWFH 5LMNW 4QGUA 4DV7L 1PH4A 3S24A 1PH5A 1E22A 3GDEA 1XMQQ 4GN3B 4X62L 2WAQE 4WJ4A 3CCQA 2NVYH 1PH3A 4NXNQ 1XPUA 2JA8G 4MZ9A 4JI8L 2UXCQ 5C4XH 1OXTA 1Y14B 2VY3A 1NBWA 3E9IA 1E24A 1L0WA 2ZJQA 1HZAA 4YWLA 2CWAA 4PZ8A 4A3GG 4BBSH 1YHBA 2N8NA 4B3ML 2RHSB 3G48A 1JJCB 1I3QH 1TWHH 5HY6A 1T9HA 1B8AA 3NENA 1HZCA 3W1BA 3G71A 4NB3A 2B3GA 1IXRA 3S15H 5IP7H 3OTOL 4QIWE 4IFDG 3CQZH 1HH2P 2RCNA 2LXJA 1V9PA 4DK3C 5LMUL 2CCZA 4LFCQ 5JJKA 3HOZG 3F1ZA 4DV3Q 5LMNQ 4JI2L 3HKZE 1E1TA 4L5TA 5GAEC 3CCRA 3CC4A 3FHWA 4IJLA 2EQSA 1ASYA 4YCWA 3TEHB 1SN8A 4DUYL 4C2MH 1VQDA 1JJGA 3ZJYC 4LF7Q 4JI8Q 1RL2A 1HZBA 2ZJPA 2PQAA 2VS1A 3M3YH 2OQ0A 1X54A 2ZTCA 4R4CA 2JA6G 3GTLH 4DR1L 3RLOA 1X3FA 2UXDQ 3RLNA 1CKNA 4DV1Q 5JJLA 3PF4A 4DV5L 2CWPA 4DK6C 3CC2A 4B3RQ 1N36Q 1I50H 4JI0Q 3PIPA 4A3IH 1QVGA 1PVOA 1J5EQ 5FJ8H 1Q1EA 2OQKA 4GN4B 4PZ7A 3S16H 1WFQA 1S3OA 2RF4A 1EIFA 3CCJA 2KCTA 4YWKA 2CFMA 2OTLA 1AH9A 2NN6I 2VUMG 4A3CH 4JI3L 4GNXB 4DR4Q 4DUYQ 3S2DH 3ULPA 4DV0Q 2KBNA 1VQLA 2D0PA 2RHQB 3GTMH 3CAMA 2VZAA 4PG3A 2VQEQ 4UP9A 1HR0Q 3ULLA 2R7ZH 3J7ZC 1C7YA 2CKZB 2MQHA 2L15A 1VQEA 2PMZE 2JA5G 1VQNA 2UXBL 2KHJA 2Y0SE 2I5HA 5C0XI 1HNXL 1HZ9A 4R4IA 1YJWA 3GTKH 2JEAI 3T1YL 1L1OC 3RN5A 1ASZA 4DR5L 2DGYA 4KI0A 4POGA 4OO1G 3W1GA 2GVAA 1QZGA 2V1CC 2R93G 1GM5A 3GTOH 1X65A 3I4NH 1RIPA 3LGJA 1VQAA 3SGIA 2JJQA 3G6EA 1IBKQ 5IP7G 2E5LQ 1YEZA 2AWOA 1CUKA 3JC66 3OTOQ 4B3TL 1K73C 5DLQE 4JI5L 3OW2A 3M9BA 2JA5H 1CSPA 2AKWB 4BA2I 2JE6I 1A8VA 1HNZQ 3S1QH 2ZTEA 2K50A 1J6QA 4LUOA 2UUCQ 4KHPL 1YI2A 1JMCA 4LUVA 2OTJA 3UDIA 4LFBL 2IHEA 4UP7A 4DR2L 4DR3L 3D31A 1VQ4A 3WWVA 3VDYA 1PH8A 1E7ZA 4LF4L 2WAQG 5IE8A 4HIDA 2NVTH 3PO3G 4APVA 1N32Q 1HNWL 4YHHL 3GTJH 1Q12A 4DR6L 1PHJA 5IYCG 1QZHA 3EN2A 1OTCA 1P16A 1BKBA 4HJ5A 3KFUA 4JV5Q 3A74A 2ZM6L 3AYHB 1SLJA 3J80i 4DUZL 3E9HA 2UU9Q 2IHFA 1I94L 5H1SE 4LF6Q 1Q7YC 2JK8A 1CKOA 4KHPQ 3M7NA 2R7FA 3KF6B 1Y1WG 4LFAL 4LNQA 4DAYB 1EQQA 4DV0L 4IPGA 3CPFA 2R7ZG 2WFWA 2YU9H 4QL5A 4X66Q 4X6AH 1IZ6A 1EWIA 1KQSA 3ER0A 3CP0A 4LF5L 1IYJB 2FXQA 1I6HH 2ZTDA 2UUAL 4DR2Q 2I5LX 2JQOA 4MNOA 2N3SA 1QUQA 4UP8A 2E8GA 4DKAC 3H15A 1N34L 4LF9Q 2VW9A 4A3BG 1PYBA 4POFA 1OXUA 4HJ9A 1VQ9A 3HOUG 1FGUA 5JJIA 3FP9A 3NEMA 2AMCB 1K0RA 3HOVG 3A0JA 2IT1A 5C3EH 3PUVA 3DM3A 1V1QA 2WP8J 1GKHA 4DR7Q 2R7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PMW A;  2JA6 H;  4B3T Q;  3HOV H;  1VQ5 A;  1QVF A;  2NZO A;  3EBE A;  5BR8 L;  3PO3 H;  4PZ6 A;  4BY7 H;  1P8L A;  2HIX A;  2LSS A;  4X66 L;  1MJE A;  1VQK A;  3TQY A;  5FJ8 G;  5ELO A;  4LF8 L;  4LFB Q;  4WJ3 M;  2ZJR A;  1TWG H;  4GLX A;  4DR3 Q;  2IY5 B;  1U5K A;  3I7F A;  3MXN B;  4IPH A;  4O2D A;  4OWT B;  2R6G A;  4YY3 L;  1FJG Q;  1Q86 C;  2IX1 A;  3G4S A;  1SFO H;  2UUB Q;  4KLK A;  2OWO A;  2UUC L;  3H3V H;  1VQF A;  1DGS A;  1NTG A;  1R9T H;  2PQA B;  4YCU A;  1UWV A;  1YJ9 A;  4A3L G;  3BZC A;  3K8A A;  5M5X H;  3I55 A;  2E2I H;  4OXP A;  4H02 A;  2Q2I A;  4GOP A;  1EYG A;  4NXM Q;  2GVB A;  1VS0 A;  5M3F H;  2NN6 G;  3S1M H;  4R1J A;  4IOC A;  3CXC A;  3KJP A;  1KAW A;  4LF6 L;  2E2H H;  4DV1 L;  3HFZ B;  1OXX K;  2K14 A;  5GAD C;  3KF8 B;  1VQH A;  2YYZ A;  3J81 c;  4GNX A;  5FLX c;  1N33 L;  4DV4 L;  3I2Z A;  4LF5 Q;  2HQL A;  4R4O A;  3KF6 A;  4EQ5 A;  3TS0 A;  1PH6 A;  3S14 H;  1PH2 A;  2IX0 A;  3CCV A;  1E1O A;  3GO5 A;  4JI2 Q;  5J3B A;  4A3F H;  4QY7 A;  2VNU D;  2VQF Q;  4JCV E;  4YY3 Q;  2HT1 A;  4X64 L;  4HJA A;  4BBS G;  1HJP A;  3CCS A;  1X55 A;  4B3S Q;  4A3M G;  4QJF A;  3GD7 A;  4BY7 G;  4LF7 L;  3D0F A;  1KRT A;  1KC8 C;  4A76 A;  2MO0 A;  1YZ6 A;  2NZH A;  5IP9 H;  3GTQ H;  1HNX Q;  4BXX G;  3K0X A;  2JA8 H;  2R93 H;  4JI0 L;  1MIU A;  3F2B A;  1SR3 A;  4DR1 Q;  5GQO A;  2UXD L;  4XTC S;  5ELN A;  4KHZ A;  4GKJ Q;  1PA6 A;  2E2J H;  3FKI H;  2Q2H A;  2Q2T A;  1N33 Q;  1UEB A;  4A3K G;  3I4M H;  1Q8K A;  5HGQ A;  3UE0 A;  4JG2 A;  1EFW A;  1BVS A;  4HJ8 A;  1XMO Q;  1PV4 A;  3ERS X;  1O7I A;  2VUM H;  4B3R L;  3L0O A;  2JA7 G;  3HOW H;  4JI6 L;  4RG1 A;  4A93 H;  2KCM A;  1L1O B;  2VQE L;  1HR0 L;  3RLF A;  5IWA Q;  5AJ3 Q;  2VQF L;  2QGQ A;  4GKK L;  5IYD H;  4IPC A;  1WCM G;  1Y1V G;  4JI3 Q;  2A8V A;  4DR4 L;  3KYH C;  4IJH A;  5M3M H;  1A0I A;  1FVI A;  4JI4 L;  1WI5 A;  3JAM i;  4OWX B;  3CC7 A;  2KEN A;  1TWC H;  1V43 A;  2BA0 A;  4P71 A;  1VQM A;  3M4Q A;  4GLV B;  2BA1 A;  4L5Q A;  4DV2 L;  2K5N A;  3PIO A;  1TWA H;  3T1Y Q;  1Y1W H;  2JA9 A;  4TVA B;  1EQR A;  1YHQ A;  4JI7 L;  2JA7 H;  3KOJ A;  3BU2 A;  3L2P A;  4A93 G;  1CKM A;  3HOY G;  3GTP H;  4JOI A;  3PUZ A;  4DR5 Q;  1EIY B;  1K3R A;  2E5L L;  4UY8 C;  2EXD A;  3UDG A;  3CD6 A;  1D7Q A;  2BH8 A;  1SMX A;  2R92 H;  4BY1 H;  1QVC A;  4DNI A;  2ZM6 Q;  5E7N A;  3PUX A;  4AYB G;  4IFD J;  2A19 A;  2K4K A;  5IWA L;  5AJ3 L;  4HIO A;  2UU9 L;  2ATW A;  4GKK Q;  1JT8 A;  2B63 G;  5C44 G;  2I0Q A;  3HOW G;  4P74 A;  1IBM Q;  3CCU A;  1KIX A;  4ME3 A;  4JI1 Q;  4A3F G;  4P73 A;  3K81 C;  4AH6 A;  3F8T A;  4A3J G;  5IYB H;  4DV4 Q;  1EUJ A;  3CCL A;  3B6Y A;  1QUQ B;  3T1H Q;  4B3S L;  1JE5 A;  1KXL A;  3IRB A;  1C9O A;  3JAM c;  4JYA Q;  5C4X G;  1AE2 A;  2PNH A;  1W2B A;  2BH2 A;  1VQO A;  1IL2 A;  4BXX H;  1YNX A;  1E3P A;  4DR6 Q;  3U4Z A;  3ULJ A;  2XTI A;  2QEX A;  5M5Y H;  4X64 Q;  1HR0 W;  2ALY B;  4JBK A;  2NVQ H;  3TS2 A;  3NEL A;  2K52 A;  4LW1 A;  3CF5 A;  3RZO H;  1SE8 A;  3PSI A;  5GAG C;  4YHH Q;  2I5M X;  4ALP A;  3U58 A;  1PH7 A;  2Z6K C;  4OX9 L;  1GD7 A;  5M3F G;  3NBH B;  2N49 A;  1YBY A;  1SRO A;  3RZD H;  4LUZ A;  2LXK A;  2OCE A;  4A3C G;  4GLA C;  1BBU A;  4GN5 A;  1BBW A;  4NXN L;  2N78 A;  3I4M G;  4XIG S;  4HIM A;  1SRU A;  3U50 C;  2K5H A;  5C44 H;  4BBR G;  1LTL A;  1WYD A;  5IY0 A;  1TXY A;  3HOX G;  1VQG A;  4IO9 A;  4LF8 Q;  2D0O A;  3I4N G;  4JC0 A;  2MNA A;  4Y52 H;  3GTG H;  3H0G G;  3CCE A;  4DV2 Q;  1I5F A;  4IOA A;  2YTY A;  3K7U C;  3S17 H;  5GAH C;  4DV3 L;  1NE3 A;  1VQI A;  3M85 A;  5C3E G;  2UUB L;  1S72 A;  1GVP A;  2UUA Q;  4LFC L;  3A5U A;  2B63 H;  3F2D A;  2KHI A;  4DV7 Q;  4IFD I;  5C4J H;  1NJI C;  2MFI A;  4DR7 L;  4A3B H;  2XGT A;  1XMQ L;  4LWC A;  3CME A;  4LF9 L;  1XJV A;  3S1N H;  4UPA A;  5FLM H;  3S2H H;  1PFS A;  1KHI A;  3PF5 A;  3K80 C;  2A1A A;  2AWN A;  3CMA A;  3RNU A;  3M4P A;  1N36 L;  5K36 G;  4DPG A;  5IYD G;  4DV6 L;  3STB D;  4GOP B;  1VCI A;  3KLW A;  4HIK A;  2ES2 A;  1B70 B;  1WJJ A;  2PI2 E;  4DV5 Q;  4A75 A;  1FJG L;  1XNQ Q;  3T1H L;  1VQ6 A;  1S40 A;  4A3G H;  2EIF A;  3J81 i;  3UDF A;  1IBL Q;  3FKI G;  1XPO A;  2ID0 A;  1OXV A;  4JI1 L;  1WCM H;  1Y1V H;  1FL0 A;  3H0G H;  2ASB A;  1OXS C;  1MJC A;  1Z9F A;  2Z0S A;  1G51 A;  1LYL A;  4A3J H;  1NMG A;  1VQB A;  3H3V I;  4C3I H;  4JBJ A;  1CSQ A;  1K9M C;  2F4V Q;  2MO1 A;  2YTX A;  1N9W A;  3KDF B;  4BA1 I;  4JYA L;  4A3E H;  1X9N A;  2GN5 A;  2UXB Q;  1UE5 A;  1Q1B A;  2D62 A;  1UE7 A;  2DUD A;  2B29 A;  1Q82 C;  1K8G A;  1XTD A;  4AQY Q;  3TRE A;  2VL6 A;  3J81 j;  3EIV A;  2QA4 A;  4JOI C;  4NXM L;  5FLM G;  2WB1 E;  3M4O H;  2PI2 A;  2F52 A;  1KL9 A;  1K8A C;  5IYC H;  5IT9 c;  3PV0 A;  5GRO A;  5JEA J;  3PCO B;  4OON A;  1EOV A;  3UE1 A;  1MKH A;  5IYB G;  3PUW A;  4C3J H;  3I56 A;  4MTN A;  1IBK L;  1IBL L;  3KJO A;  1LUZ A;  4K0K L;  5M5W H;  4JI5 Q;  1XPR A;  1Q46 A;  1VQ8 A;  1AE3 A;  1HNZ L;  4FDB A;  3HOZ H;  2HIV A;  4YCV A;  1JJ2 A;  4NPS A;  2R92 G;  3L7Z C;  4X65 L;  3HKS A;  5IP9 G;  2H5X A;  4RMF A;  1NY4 A;  3AFQ A;  1D8L A;  4P72 A;  3STB C;  4Y7N H;  1L1O A;  1YHA A;  1M90 C;  4GNX C;  3HOY H;  1HNW Q;  4A3M H;  2K75 A;  3HKZ G;  4AIM A;  4EX5 A;  1XNR L;  4A3E G;  1X56 A;  3J7A 5;  1X3G A;  4QQB X;  1C0A A;  4LF4 Q;  1VQC A;  4DAM A;  1W3S A;  1X3E A;  1XMO L;  4GS3 A;  3J80 c;  1B7Y B;  3BJU A;  4JBW A;  2Z6K A;  4JI6 Q;  1N32 L;  4GOP C;  4GKJ L;  4B3M Q;  4TQU S;  4DUZ Q;  1LM0 A;  3W5O A;  3DLL A;  3CCM A;  3S1R H;  1YIJ A;  4R4Q A;  1PH1 A;  1VQ7 A;  1I94 Q;  4DV6 Q;  4JV5 L;  1VQP A;  1K83 H;  1KRS A;  3Q8D A;  1CKN B;  3E0E A;  1N8R C;  4JI4 Q;  1YVC A;  5C0X J;  4LFA Q;  5C0X G;  1YJN A;  4OO1 I;  3CPW A;  3MEF A;  4K0K Q;  5LMN L;  4AYB E;  3PO2 G;  4C3H H;  4R4T A;  1XNQ L;  5EAY A;  4P75 A;  4A3I G;  2F4V L;  1VQJ A;  3PUY A;  2HHH Q;  5M3M G;  1KD1 C;  1Z47 A;  3AEV A;  3RR5 A;  3PO2 H;  2YV5 A;  4A3D G;  1PYS B;  1YIT A;  3ICE A;  4JI7 Q;  1WOC A;  4A3L H;  1U0L A;  2YTV A;  3K7A H;  4BY1 G;  3TRZ A;  4A3D H;  1H95 A;  2K5V A;  1NMF A;  1X6O A;  1PH9 A;  2CQO A;  1G29 1;  4L5R C;  2Y0S G;  1A63 A;  3RN2 A;  4AQY L;  4L5S A;  4X62 Q;  3BZK A;  2JEB I;  5JEA G;  3HOU H;  1GO3 E;  3HOX H;  3AQQ A;  2WB1 G;  3U4V A;  3PGZ A;  2UXC L;  1UE1 A;  4HJ7 A;  1UE6 A;  4IPD A;  5LMU Q;  4YWM A;  1J5E L;  4X65 Q;  4JBM A;  1Q81 C;  3F2C A;  1IBM L;  4J15 A;  5BR8 Q;  3KDF A;  4A4I A;  1G6P A;  2AHO B;  3A5Z B;  3UDX A;  3AFP A;  3CW2 C;  1L2F A;  1XNR Q;  3OYY A;  2HHH L;  2Q2U A;  4BBR H;  1JB7 A;  1A62 A;  1N34 Q;  4OWW B;  3I4O A;  4O0A A;  1M1K C;  2NVX H;  4A3K H;  2F3I A;  4OX9 Q;  2C35 B;  1TWF H;  5LMN W;  4QGU A;  4DV7 L;  1PH4 A;  3S24 A;  1PH5 A;  1E22 A;  3GDE A;  1XMQ Q;  4GN3 B;  4X62 L;  2WAQ E;  4WJ4 A;  3CCQ A;  2NVY H;  1PH3 A;  4NXN Q;  1XPU A;  2JA8 G;  4MZ9 A;  4JI8 L;  2UXC Q;  5C4X H;  1OXT A;  1Y14 B;  2VY3 A;  1NBW A;  3E9I A;  1E24 A;  1L0W A;  2ZJQ A;  1HZA A;  4YWL A;  2CWA A;  4PZ8 A;  4A3G G;  4BBS H;  1YHB A;  2N8N A;  4B3M L;  2RHS B;  3G48 A;  1JJC B;  1I3Q H;  1TWH H;  5HY6 A;  1T9H A;  1B8A A;  3NEN A;  1HZC A;  3W1B A;  3G71 A;  4NB3 A;  2B3G A;  1IXR A;  3S15 H;  5IP7 H;  3OTO L;  4QIW E;  4IFD G;  3CQZ H;  1HH2 P;  2RCN A;  2LXJ A;  1V9P A;  4DK3 C;  5LMU L;  2CCZ A;  4LFC Q;  5JJK A;  3HOZ G;  3F1Z A;  4DV3 Q;  5LMN Q;  4JI2 L;  3HKZ E;  1E1T A;  4L5T A;  5GAE C;  3CCR A;  3CC4 A;  3FHW A;  4IJL A;  2EQS A;  1ASY A;  4YCW A;  3TEH B;  1SN8 A;  4DUY L;  4C2M H;  1VQD A;  1JJG A;  3ZJY C;  4LF7 Q;  4JI8 Q;  1RL2 A;  1HZB A;  2ZJP A;  2PQA A;  2VS1 A;  3M3Y H;  2OQ0 A;  1X54 A;  2ZTC A;  4R4C A;  2JA6 G;  3GTL H;  4DR1 L;  3RLO A;  1X3F A;  2UXD Q;  3RLN A;  1CKN A;  4DV1 Q;  5JJL A;  3PF4 A;  4DV5 L;  2CWP A;  4DK6 C;  3CC2 A;  4B3R Q;  1N36 Q;  1I50 H;  4JI0 Q;  3PIP A;  4A3I H;  1QVG A;  1PVO A;  1J5E Q;  5FJ8 H;  1Q1E A;  2OQK A;  4GN4 B;  4PZ7 A;  3S16 H;  1WFQ A;  1S3O A;  2RF4 A;  1EIF A;  3CCJ A;  2KCT A;  4YWK A;  2CFM A;  2OTL A;  1AH9 A;  2NN6 I;  2VUM G;  4A3C H;  4JI3 L;  4GNX B;  4DR4 Q;  4DUY Q;  3S2D H;  3ULP A;  4DV0 Q;  2KBN A;  1VQL A;  2D0P A;  2RHQ B;  3GTM H;  3CAM A;  2VZA A;  4PG3 A;  2VQE Q;  4UP9 A;  1HR0 Q;  3ULL A;  2R7Z H;  3J7Z C;  1C7Y A;  2CKZ B;  2MQH A;  2L15 A;  1VQE A;  2PMZ E;  2JA5 G;  1VQN A;  2UXB L;  2KHJ A;  2Y0S E;  2I5H A;  5C0X I;  1HNX L;  1HZ9 A;  4R4I A;  1YJW A;  3GTK H;  2JEA I;  3T1Y L;  1L1O C;  3RN5 A;  1ASZ A;  4DR5 L;  2DGY A;  4KI0 A;  4POG A;  4OO1 G;  3W1G A;  2GVA A;  1QZG A;  2V1C C;  2R93 G;  1GM5 A;  3GTO H;  1X65 A;  3I4N H;  1RIP A;  3LGJ A;  1VQA A;  3SGI A;  2JJQ A;  3G6E A;  1IBK Q;  5IP7 G;  2E5L Q;  1YEZ A;  2AWO A;  1CUK A;  3JC6 6;  3OTO Q;  4B3T L;  1K73 C;  5DLQ E;  4JI5 L;  3OW2 A;  3M9B A;  2JA5 H;  1CSP A;  2AKW B;  4BA2 I;  2JE6 I;  1A8V A;  1HNZ Q;  3S1Q H;  2ZTE A;  2K50 A;  1J6Q A;  4LUO A;  2UUC Q;  4KHP L;  1YI2 A;  1JMC A;  4LUV A;  2OTJ A;  3UDI A;  4LFB L;  2IHE A;  4UP7 A;  4DR2 L;  4DR3 L;  3D31 A;  1VQ4 A;  3WWV A;  3VDY A;  1PH8 A;  1E7Z A;  4LF4 L;  2WAQ G;  5IE8 A;  4HID A;  2NVT H;  3PO3 G;  4APV A;  1N32 Q;  1HNW L;  4YHH L;  3GTJ H;  1Q12 A;  4DR6 L;  1PHJ A;  5IYC G;  1QZH A;  3EN2 A;  1OTC A;  1P16 A;  1BKB A;  4HJ5 A;  3KFU A;  4JV5 Q;  3A74 A;  2ZM6 L;  3AYH B;  1SLJ A;  3J80 i;  4DUZ L;  3E9H A;  2UU9 Q;  2IHF A;  1I94 L;  5H1S E;  4LF6 Q;  1Q7Y C;  2JK8 A;  1CKO A;  4KHP Q;  3M7N A;  2R7F A;  3KF6 B;  1Y1W G;  4LFA L;  4LNQ A;  4DAY B;  1EQQ A;  4DV0 L;  4IPG A;  3CPF A;  2R7Z G;  2WFW A;  2YU9 H;  4QL5 A;  4X66 Q;  4X6A H;  1IZ6 A;  1EWI A;  1KQS A;  3ER0 A;  3CP0 A;  4LF5 L;  1IYJ B;  2FXQ A;  1I6H H;  2ZTD A;  2UUA L;  4DR2 Q;  2I5L X;  2JQO A;  4MNO A;  2N3S A;  1QUQ A;  4UP8 A;  2E8G A;  4DKA C;  3H15 A;  1N34 L;  4LF9 Q;  2VW9 A;  4A3B G;  1PYB A;  4POF A;  1OXU A;  4HJ9 A;  1VQ9 A;  3HOU G;  1FGU A;  5JJI A;  3FP9 A;  3NEM A;  2AMC B;  1K0R A;  3HOV G;  3A0J A;  2IT1 A;  5C3E H;  3PUV A;  3DM3 A;  1V1Q A;  2WP8 J;  1GKH A;  4DR7 Q;  2R7D A; 
#chains in the Genus database with same CATH topology
 3E6Z X;  4DNR B;  1QVF A;  1B50 A;  3TP5 A;  3K57 A;  4RCO A;  1MJE A;  1VQK A;  3VYR A;  4NMZ A;  3OMG A;  3FEW X;  1TWG H;  4A3M B;  1HQM C;  2XVS A;  4KLK A;  4KN4 C;  2OWO A;  1DM0 B;  1VQF A;  1HUM A;  1R9T H;  1YJ9 A;  1UWV A;  3P20 A;  2EYL A;  3I55 A;  4CJ1 B;  1SXT A;  3H0G B;  3A8J E;  3D6W A;  4LAA A;  3TDQ A;  3S1M H;  2NN6 G;  1PTO B;  4R1J A;  2CH4 A;  3HFZ B;  2K14 A;  4A3G B;  3SK8 A;  2ZXR A;  5GAD C;  1HCZ A;  1SYC A;  4DU9 A;  3J81 c;  4GNX A;  5FLX c;  1EY4 A;  4DV4 L;  1HHV A;  2F0J A;  2HQL A;  4L63 B;  3KF6 A;  1PH2 A;  2IX0 A;  5F2D A;  3CCV A;  3EVQ A;  2HT1 A;  4B3S Q;  1STG A;  4A3M G;  3GD7 A;  2F0D A;  3D0F A;  1KC8 C;  3RZD B;  1DYQ A;  2F0N A;  3VA7 A;  1H9S B;  4BXX G;  2CW0 C;  3F2B A;  1TVX A;  1CTM A;  5DM6 3;  4KHZ A;  4GKJ Q;  3U9O A;  2Q2T A;  1LTI D;  3I3C A;  4A3K G;  5HGQ A;  3UE0 A;  4ODG A;  1BVS A;  2VUM H;  3GTK B;  1RKN A;  5KNB A;  3HOW H;  2NVY B;  4QUC A;  4HED A;  3PMF A;  3GTM B;  2KCM A;  2VQE L;  1IYV A;  5AJ3 Q;  4CHT B;  2VQF L;  1SND A;  4IJH A;  1PLF A;  5IGD A;  5FOB B;  4OWX B;  3I73 A;  3I90 A;  5JOB A;  1TWC H;  5EBD A;  1VQM A;  2K5N A;  4ZRZ A;  1ILQ A;  4C1N K;  3GTP H;  5IGF A;  4DR5 Q;  1EIY B;  1D7Q A;  5EPJ A;  3EA6 A;  1ET6 A;  4FP5 D;  4DNI A;  4U68 A;  2QF7 A;  2N88 A;  2K4K A;  3ERO A;  4GKK Q;  5M3F B;  2ATW A;  1H9M A;  2B63 G;  1Y8O B;  2I0Q A;  1JOK A;  2EPB A;  2H1E A;  2EVB A;  4AH6 A;  3T51 B;  4A3J G;  4DV4 Q;  1EUJ A;  4N8F A;  3CCL A;  3QO2 A;  2WAQ B;  1EWH A;  1VQO A;  4IUT A;  1YNX A;  1E3P A;  3K5O A;  3QR8 A;  4DR6 Q;  3MWY W;  4RGM A;  3TS2 A;  3CF5 A;  2K52 A;  3NSW A;  5EJW A;  1SE8 A;  4YHH Q;  4ALP A;  1O80 A;  1PH7 A;  4OX9 L;  2Z4I A;  2KEC A;  1PRT C;  4GN5 A;  1BBW A;  4NXN L;  2EJG C;  5EBC A;  5HUR A;  3F2U A;  1RHP A;  1WYD A;  1TXY A;  4IAL A;  1VQG A;  4JC0 A;  3MTS A;  2YTY A;  1I3Q B;  2E76 C;  5C3E G;  2ICE C;  4KK7 A;  2B63 H;  3MC0 B;  4ULL A;  2A68 C;  5A2Q L;  2XGT A;  4GZY C;  1EIG A;  3OHX C;  2K04 A;  2DY8 A;  5FLM H;  3S2H H;  1KHI A;  3PF5 A;  2A1A A;  3IL8 A;  3RNU A;  3H6M A;  1N36 L;  1QB5 D;  5I6Y A;  5IYD G;  2Z1C A;  1FGB D;  5C0X H;  1JR0 D;  4BWG B;  1A3V A;  2IWH A;  3MVV A;  2J0T D;  1IBL Q;  3SK4 A;  1XPO A;  5JJZ A;  2LS0 1;  3H0G H;  1MSG A;  1NMG A;  1TY2 A;  1CSQ A;  2HDL A;  2YTX A;  4BA1 I;  1TS4 A;  1QG7 A;  1X9N A;  2UXB Q;  1UE5 A;  2R7Z B;  1XXG A;  4AQY Q;  3NTI A;  3J81 j;  5FLM G;  4OL7 A;  2EY1 A;  2MHV A;  4OON A;  5IYB G;  3I56 A;  4C3J H;  1II3 A;  1FD7 D;  1Q8I A;  1MGS A;  2PW7 A;  1Q46 A;  1SDF A;  1AE3 A;  4YCV A;  1JJ2 A;  2RDG A;  4NPS A;  1KAA A;  2HCC A;  4X65 L;  1D6E C;  1TT2 A;  5IP9 G;  1NY4 A;  3AFQ A;  3A7A B;  3K58 A;  1M90 C;  4K14 A;  1HNW Q;  3TP8 A;  1G2T A;  4FF3 A;  3J7A 5;  4QQB X;  4IUQ A;  1X3E A;  3C1F A;  3J80 c;  2X69 A;  3BJU A;  5BN3 A;  1A3T A;  4FNF A;  2SEB D;  4B3M Q;  4DUZ Q;  1LM0 A;  3W5O A;  3CCM A;  3S1R H;  2Y0S B;  3T13 A;  4XYO A;  1N8R C;  4KY5 A;  4JI4 Q;  1YVC A;  1QIL A;  4BY1 B;  3MEF A;  3DM1 A;  4K0K Q;  4RKL A;  5EAY A;  4A3I G;  2BCO A;  2HHH Q;  1HTP A;  1Z47 A;  3RR5 A;  3FVQ A;  4N9P A;  5CBA E;  2K6A A;  4JI7 Q;  1U0L A;  4BY1 G;  4Z9C B;  1H95 A;  2KVM A;  1LAC A;  2HUG A;  2K5V A;  1TKW B;  1PFB A;  5LL6 X;  3R2T A;  3EJI A;  1HTL D;  5E4X A;  3EFX D;  3LNN A;  3DMU A;  1A63 A;  4AQY L;  2Z8L A;  2XN9 C;  1K3B C;  2K01 A;  3WDN A;  5JEA G;  3HOU H;  2IW3 A;  1GO3 E;  3PGZ A;  1UE1 A;  1VDZ A;  4RKB A;  1AZP A;  3KUP A;  2JA6 B;  4DN4 M;  2L1B A;  4YWM A;  2B2T C;  4A4I A;  4C3J B;  1L2F A;  1XNR Q;  3OYY A;  3OMC A;  3RMH A;  2KQ3 A;  5D3I B;  1JB7 A;  2Q2U A;  1A62 A;  3HP3 A;  3SXH A;  1NUC A;  2C35 B;  3GTQ H;  1SFO B;  4UHV A;  4MIU A;  1PFN A;  2WKD A;  4H13 C;  1S4Z A;  4WJ4 A;  3CCQ A;  2JA8 G;  1XPU A;  1QJO A;  2UXC Q;  1OXT A;  2VY3 A;  2I46 A;  3P75 A;  4L8J A;  2ZJQ A;  1VF5 C;  4PZ8 A;  2B8F A;  4B3M L;  5IGG A;  3G48 A;  2RHS B;  5HY6 A;  3NEN A;  3W1B A;  3G71 A;  1EY7 A;  4IFD J;  1IXR A;  3S15 H;  3OTO L;  4IFD G;  1B1Z A;  3CQZ H;  5IGC A;  2LXJ A;  5LMU L;  1LT5 D;  4LFC Q;  4B9W A;  3F1Z A;  4DAY A;  1R4P B;  2EQS A;  1ASY A;  3S2H B;  3TEH B;  1SN8 A;  4C2M H;  1CFM A;  4ILW A;  4LF7 Q;  3I70 A;  3HZX A;  2VB3 X;  3T53 B;  2PQA A;  3M3Y H;  1WTQ A;  4RHR A;  4DR1 L;  1CKN A;  4DV1 Q;  1PFM A;  3CC2 A;  4B3R Q;  4PNY A;  1QVG A;  4PV1 C;  1PVO A;  1BOS A;  3S16 H;  2RF4 A;  3NBI A;  1V8Q A;  1C48 A;  1EIF A;  4YWK A;  3CCJ A;  3BG3 A;  2NB0 A;  2LFN A;  2D2C C;  1S5B D;  4JI3 L;  4DUY Q;  3ULP A;  4EQO A;  3GV6 A;  2KBN A;  4A93 B;  1TII D;  2VQE Q;  4UP9 A;  1K0S A;  3ULL A;  1B53 A;  3R8B A;  1C7Y A;  2MQH A;  3HOZ B;  2L15 A;  2PMZ E;  2JA5 G;  1VQN A;  5M3M B;  2I5H A;  2FHT A;  1H9J A;  1YJW A;  3OIQ A;  5E4W C;  3GTK H;  1I4H A;  1ASZ A;  1I4X A;  3LGJ A;  5IP7 G;  2HDM A;  4B3T L;  2KHS A;  4JI5 L;  3M9B A;  2JA5 H;  4BA2 I;  1MD2 D;  1A8V A;  2JE6 I;  1OO9 B;  2K50 A;  2QDL A;  1J6Q A;  2EYH A;  1JMC A;  4LUV A;  5CGK A;  3QIA A;  4LFB L;  1DCZ A;  3OW7 A;  1VQ4 A;  3WWV A;  3VDY A;  1PH8 A;  3S15 B;  2F0F A;  4C3H B;  3D4W A;  3PO3 G;  1Z7T A;  5EKI A;  3QG1 A;  1F9R A;  1Q12 A;  4DR6 L;  1ENC A;  1KAB A;  1BKB A;  4JV5 Q;  3A74 A;  3P7J A;  1A15 A;  3E9H A;  1CKO A;  3M7N A;  4LFA L;  4LNQ A;  3BYY B;  1EYA A;  2RSO A;  3DEP A;  4QL5 A;  1HQR D;  3LX0 A;  4X6A H;  1EWI A;  3CP0 A;  2SNM A;  3M4Y A;  5K36 H;  1D5M C;  2ZTD A;  5KRU A;  3D4R A;  2UUA L;  2EYF A;  1H9S A;  1RJT A;  5IT9 L;  2JQO A;  2E2J B;  4LF9 Q;  4POF A;  1OXU A;  4HJ9 A;  1VQ9 A;  3CU7 A;  3NEM A;  5C3E H;  1GKH A;  1RF2 D;  2QEJ C;  1ONL A;  4ZKC B;  1EY0 A;  2NZO A;  4IZ8 A;  4PZ6 A;  1P8L A;  2LSS A;  5CV4 A;  4X66 L;  3BVZ A;  1ROD A;  4LF8 L;  1B44 D;  3WOE A;  2KED A;  3S1R B;  2IY5 B;  3MXN B;  4O2D A;  5JVH 3;  1SFO H;  5T1I A;  1S5F D;  2EZV A;  4NW2 A;  2A69 D;  4YCU A;  2F0Q A;  3MXP A;  2PPB C;  4A3L G;  5IGB A;  1O78 A;  2KCC A;  4V19 0;  3D3R A;  4NXM Q;  2GVB A;  4G7Z C;  3NTK A;  1LTB D;  4OEM B;  4LJZ C;  1KAW A;  4DNT B;  4LF6 L;  4DV1 L;  1JC7 A;  1OXX K;  1FR3 A;  3KF8 B;  2YYZ A;  3H91 A;  1N33 L;  3X3N A;  3DHQ A;  1SE4 A;  1XTC D;  3I2Z A;  4R8N A;  2NZ1 D;  4R4O A;  4C2M B;  4EQ5 A;  2SNS A;  1PH6 A;  3S14 H;  1CZW A;  1E1O A;  3GO5 A;  4OHJ A;  4JI2 Q;  3Q24 A;  5LL6 S;  2VNU D;  4YY3 Q;  1EY5 A;  4QJF A;  1QNU A;  4BY7 G;  1ZKO A;  4A76 A;  2MO0 A;  2NZH A;  2JA8 H;  3SVM A;  1MIU A;  3ZYY X;  1WTP A;  5GQO A;  1CM9 A;  5C44 B;  3FKI H;  2ENB A;  1UEB A;  5DNF A;  3ERS X;  2A6H D;  4RG1 A;  2CH4 W;  3E0J A;  1HR0 L;  5IWA Q;  1PZI D;  2A8V A;  1WCM G;  1Y1V G;  2PQE A;  1A0I A;  1I4P A;  2F3W A;  4U67 3;  1TWF B;  4G57 A;  4JI4 L;  2M00 A;  1WTR A;  2BDN A;  3U9S A;  4P71 A;  3M4Q A;  4DV2 L;  3PIO A;  3AU7 A;  4TVA B;  5C4X B;  1CT1 D;  3BU2 A;  2B2Y C;  3L2P A;  1B2T A;  1F9Q A;  4JOI A;  1K3R A;  2EY5 A;  3UDG A;  1SMX A;  2R92 H;  4BY1 H;  3PUX A;  4AYB G;  4L6T B;  5AJ3 L;  1JT8 A;  1PTO F;  5C44 G;  1PTO C;  3GTL B;  4P74 A;  3CCU A;  4ME3 A;  3W2D A;  5IYB H;  4FO2 A;  1XYI A;  2L55 A;  1QE6 A;  2GA4 B;  3T1H Q;  1C9O A;  4JYA Q;  1AE2 A;  3OSO A;  1W2B A;  3GTJ B;  3J7A V;  1IL2 A;  4BXX H;  3GQB A;  2QEX A;  3S14 B;  2K5Q A;  4JBK A;  2NVQ H;  5AFW A;  3EQL C;  3PSI A;  2I5M X;  3U58 A;  4ID6 A;  3MXG A;  2N49 A;  3A54 A;  1SBB B;  1SE2 A;  4DAV A;  2M2L A;  2QKI C;  4LUZ A;  3OWF A;  4IUV A;  5CV8 A;  4CJ2 C;  2N78 A;  1B3Q A;  4X3S A;  1Q3L A;  2Z9H A;  1SRU A;  4HIM A;  2K5H A;  3LWE A;  1STA A;  5IY0 A;  3CRL C;  1C4Q A;  2BE5 C;  4LF8 Q;  5I2X A;  3K6O A;  5J22 A;  2DNC A;  4BBS B;  2OXP A;  4IUU A;  3K7U C;  5CV5 A;  3SDZ A;  4DV3 L;  1NE3 A;  2F0E A;  3H09 A;  3M85 A;  1GVP A;  5C3E B;  4LFC L;  3A5U A;  5C4Z A;  2KHI A;  4DV7 Q;  2SDF A;  2MFI A;  1CA6 A;  4DR7 L;  5C3W A;  2BDO A;  4LK1 C;  1EQV A;  4LWC A;  3CME A;  1O7L A;  1XJV A;  5ELC A;  1R9T B;  3K80 C;  4ZQ3 A;  3CMA A;  1CHQ D;  5I6W A;  5K36 G;  1CQF A;  1QWY A;  3STB D;  4GOP B;  3KLW A;  2ES2 A;  4K8J A;  1YNJ C;  1XNQ Q;  2EJM A;  5IOC A;  3L3O C;  1AZQ A;  1S40 A;  4A3G H;  3FKI G;  5DM7 3;  2ID0 A;  1QNK A;  2E2I B;  1LV9 A;  2ASB A;  2KUM A;  1OXS C;  2CVR A;  3QWN A;  2Z0S A;  4QF4 A;  1LYL A;  4A3J H;  3MAQ A;  3H3V I;  2F4V Q;  4JBJ A;  1K9M C;  4A93 G;  4JYA L;  5FO7 B;  2VXW A;  1AFP A;  1Q1B A;  1Q82 C;  2B29 A;  4JOI C;  3T16 A;  1BQQ T;  1SJE D;  4DFA A;  5GRO A;  5JEA J;  1ILP A;  2V4D A;  1DXM A;  1E2Z A;  1MKH A;  4MTN A;  2A6E D;  4IQZ A;  5ISR A;  1IBK L;  1IBL L;  3KJO A;  4G4K A;  4K0K L;  2P5Z X;  5M5W H;  1VQ8 A;  1BR9 A;  4RWS C;  1HNZ L;  3HOZ H;  1HFN A;  4KY7 A;  4HN7 A;  3L7Z C;  2RDH A;  5D14 A;  2D9U A;  2H5X A;  2BOS A;  2F0O A;  3S1Q B;  3J81 E;  4P72 A;  5C6A A;  2JN4 A;  1G6Z A;  3NBH A;  4AIM A;  4TSS A;  4CBV A;  1FNW A;  3ND8 A;  1VQC A;  1PZK D;  3CRK C;  1UNS A;  1EYD A;  5EKL A;  4QCL A;  1SMY C;  3HEJ A;  5LHY 1;  4GOP C;  4GKJ L;  4P2C B;  4TQU S;  4F87 A;  3DLL A;  2JP1 A;  4JV5 L;  2PMZ B;  1KRS A;  1YJN A;  5C0X G;  4OO1 I;  5EQ0 A;  1XNQ L;  5M5X B;  4P75 A;  1VQJ A;  3PUY A;  1KD1 C;  4DXG A;  1TS5 A;  2K7V A;  3ICE A;  2AQ2 B;  2YTV A;  1JIC A;  3TRZ A;  4A3D H;  4A3F B;  4A3I B;  1X6O A;  3R93 A;  3J81 L;  2CQO A;  2EDG A;  2PZT A;  5KEE A;  3MFY A;  4L5S A;  4X62 Q;  3BZK A;  2Z6B A;  4FXG C;  2C5C A;  3AQQ A;  1SYB A;  2LKV A;  5LMU Q;  1J5E L;  2PW5 A;  3P1H A;  3F2C A;  2MPM A;  1AW7 A;  2AHO B;  4J1M A;  2CW0 D;  3A5Z B;  3DXJ C;  3UDX A;  3AFP A;  3BS1 A;  1DD2 A;  1WVL A;  2TMP A;  3AMU A;  2K32 A;  3VR2 A;  3W3A A;  4O0A A;  3SHL A;  1M1K C;  4A3K H;  4DV7 L;  3KFU A;  1PH5 A;  3S24 A;  1E22 A;  5FO9 B;  5KGU A;  1KLU D;  3HOW B;  1PH3 A;  3K5L A;  4JI8 L;  1K8M A;  1RDP D;  5G3L D;  1HZA A;  1EEF D;  2CWA A;  1BCP C;  2E74 C;  4N9T A;  4KHV A;  1YHB A;  4RGN A;  5KYI A;  2PO4 A;  1JJC B;  1F2L A;  2WKC A;  2RSN A;  4QB4 A;  2B3G A;  4XQQ A;  3NTH A;  2CCZ A;  4MTK A;  4KD4 A;  5EPL A;  1V1P B;  4IJL A;  3GTP B;  2AUK A;  1MI2 A;  3ZJY C;  1F9S A;  2RA4 A;  1TR5 A;  5JEA H;  1CHP D;  2OQ0 A;  1X54 A;  3BDO A;  2UXD Q;  3RLO A;  1X3F A;  3RLN A;  4IN3 A;  1CA5 A;  4IUP A;  3PF4 A;  3UI2 A;  4DV5 L;  3K7A B;  4HMI A;  2CWP A;  4DK6 C;  4ZUI A;  1YNN C;  1N36 Q;  1I50 H;  4A3I H;  4XQN A;  1STH A;  3NUC A;  1Q1E A;  2OQK A;  4GN4 B;  4PZ7 A;  3M4O B;  3FDT A;  1S3O A;  2Z4H A;  1EU3 A;  1IW7 C;  1ZEQ X;  3I72 A;  2OEO A;  2B2W C;  1HRJ A;  1T5X D;  5ELB A;  4HSP A;  1WD0 A;  2IPK D;  4NDX A;  4A3E B;  4A3C H;  4DR4 Q;  2D0P A;  2JXM B;  3TP6 A;  1HR0 Q;  4PG3 A;  3GTM H;  1A6X A;  2CKZ B;  1FNV A;  2K5D A;  3FKI B;  4CJ0 B;  2UXB L;  2J7Z A;  3T56 B;  1HNX L;  2L12 A;  4C3J G;  1HFG A;  4R4I A;  1TS3 A;  1TWC B;  5IGE A;  2JEA I;  4RA8 A;  1L1O C;  3NPP A;  1D5Z C;  3NQT A;  4KI0 A;  3RN5 A;  4OO1 G;  3W1G A;  1GM5 A;  3GTO H;  3I4N H;  1RIP A;  4CKC A;  3SGI A;  2JJQ A;  3S1N B;  1LO5 D;  1X3P A;  2MJ8 A;  1IYU A;  2EY6 A;  3OW2 A;  1ICF B;  2AKW B;  1AEX A;  1A2T A;  3S1Q H;  2E75 C;  3C1E A;  4LUO A;  4O42 A;  3HOY B;  4KHP L;  5C4J B;  3KBG A;  1ML0 D;  3UDI A;  2IHE A;  4UP7 A;  1E7Z A;  5IE8 A;  2RVL A;  4TRD A;  5I9P A;  4JPB W;  4HID A;  4APV A;  2PNR C;  4K8I A;  3MFG A;  4F88 A;  1HNW L;  2F0T A;  2F0G A;  2RCF A;  2HCI A;  5FLX L;  1PHJ A;  3EN2 A;  4N8X 1;  1P16 A;  1ZYR D;  5CMD A;  2ZM6 L;  3AYH B;  5NUC A;  4DUZ L;  4C56 C;  2XNA C;  3R2I A;  2IHF A;  2XWB B;  5H1S E;  1Q7Y C;  1SEB D;  3QOL A;  4DV0 L;  4ZLT F;  2AQ3 B;  3TZD A;  3FMC A;  3QB3 A;  5L37 A;  2NVQ B;  1SYG A;  2FXQ A;  5M5W B;  3D4D A;  3I4L A;  1LTG D;  4XXE A;  2PZW A;  4K2L A;  3VYU A;  1FGU A;  3HOX B;  1GUT A;  2Q8R E;  3OWE B;  3DM3 A;  5CYU A;  2DJF C;  4DR7 Q;  2WB1 B;  1UUP A;  2FMM A;  3I91 A;  1PRT B;  3EBE A;  5BR8 L;  1LT6 D;  2HIX A;  3S17 B;  5FJ8 G;  5ELO A;  1AP0 A;  1GUW A;  2ZJR A;  3O13 A;  4DR3 Q;  4CDC C;  2LY7 A;  4OWT B;  4YY3 L;  4FVM A;  1Q86 C;  2IX1 A;  3H3V H;  3J80 L;  2PQA B;  4BS9 A;  1X32 A;  3K59 A;  3BZC A;  3K8A A;  1JOR A;  4DXF A;  5M5X H;  1KNA A;  1WCM B;  1Y1V B;  4OXP A;  2Q2I A;  3LWU A;  5M3F H;  2B2U A;  5ELE A;  4LMQ D;  4IOC A;  3BVG A;  5I9O A;  2RBM A;  1NAP A;  3D6C A;  2EYM A;  2LMC B;  3BVM A;  4LF5 Q;  4RHS A;  4KKU A;  3KLS X;  1Y69 U;  1F77 A;  4QY7 A;  3TSS A;  1WD1 A;  1D5X C;  4JCV E;  4BBS G;  1HJP A;  4K6L A;  2F0L A;  4LF7 L;  4ABN A;  4DGZ A;  1YZ6 A;  3R3O A;  1HNX Q;  1L0Y B;  4UDU C;  4JI0 L;  4DR1 Q;  4XTC S;  5ELN A;  4ZCK A;  1AN8 A;  1N33 Q;  1Q8K A;  1V1O A;  1JWU D;  1PV4 A;  3GTG B;  4B3R L;  3L0O A;  4FF1 A;  1L1O B;  2F0V A;  3RLF A;  3QJY A;  4IPC A;  2JYO A;  2NBF A;  4JI3 Q;  3CHB D;  1ENF A;  1WI5 A;  3JAM i;  2BA0 A;  4GLV B;  2BA1 A;  4L5Q A;  5A35 A;  3NWS A;  3HOY G;  3PUZ A;  2L9H A;  2EXD A;  3NE5 B;  2NVT B;  2BH8 A;  2FFK B;  1WTH A;  4ZYS A;  2IL8 A;  2ZM6 Q;  3VYT A;  5E7N A;  4DK1 A;  4QMG A;  4OGQ C;  5IWA L;  4HIO A;  3S1M B;  3ONA B;  3HOW G;  1Y8N B;  1IBM Q;  4ZK9 B;  1U9R A;  1KIX A;  4H0L C;  5C5M A;  4A3F G;  3K81 C;  2K5W A;  2MUY A;  3B6Y A;  4B3S L;  1JE5 A;  1KXL A;  3IRB A;  1PMR A;  2NTS A;  1O7Y A;  3JAM c;  1J8I A;  3PIO 3;  2PNH A;  4KJO A;  1TY0 A;  2BH2 A;  1CQV A;  1JE4 A;  2B39 A;  2RQX A;  2XRS D;  2XTI A;  3ULJ A;  1F2Y A;  4J6H A;  1HR0 W;  3WOF A;  3NEL A;  4LW1 A;  3J80 E;  3RZO H;  5C3X A;  1EIH A;  1LAB A;  1LLR D;  4IUR A;  4ZUJ A;  2K05 A;  3NBH B;  1YBY A;  1SRO A;  3RZD H;  1KLG D;  2B2T A;  3IAY A;  2OCE A;  4GLA C;  2OT2 A;  4RGT A;  1U4M A;  4WOR A;  1JCK B;  3U50 C;  1X3Q A;  3HOX G;  4QUF A;  4FXD A;  3I4N G;  1GOZ A;  2MNA A;  1FYC A;  3GTG H;  3H0G G;  1IHZ A;  3CCE A;  4IOA A;  5FK9 C;  5GAH C;  2H4O A;  1S72 A;  2UUA Q;  4CDD C;  3CQZ B;  3FPP A;  5C5L A;  4IFD I;  5C4J H;  5CV6 A;  4EQN A;  5BN5 A;  4ZKB B;  4A3B H;  1XMQ L;  3JAM E;  2A5H A;  3N6R A;  4LF9 L;  1JWS D;  4OIK A;  1R4Q B;  1KDA A;  1KNE A;  1STB A;  1VMP A;  2AWN A;  2HQE A;  3QOJ A;  3M4P A;  4DPG A;  2EYJ A;  3NP8 A;  2K03 A;  4NKL A;  3A7L A;  1EZ6 A;  2KOL A;  1VCI A;  4R8I A;  4A75 A;  3MHB A;  4DV5 Q;  1FJG L;  1EY8 A;  1F9P A;  1KDB A;  3J81 i;  1WCM H;  1Y1V H;  1Z9F A;  1B4O A;  2F0U A;  1FNU A;  1G51 A;  1PTO H;  5J39 A;  2O5I C;  2MO1 A;  2GN5 A;  1XWE A;  2D62 A;  1UE7 A;  1BCP F;  1V1P A;  1XTD A;  2F4I A;  2VL6 A;  3EIV A;  4NXM L;  3M4O H;  2PI2 A;  1K8A C;  1BCP B;  4B9X A;  3JAM L;  3PUW A;  5D3D A;  2R93 B;  4FYD A;  1S5D D;  5E3F A;  1LUZ A;  4XT3 B;  5COR A;  3X3M A;  3KBX A;  4FDB A;  2HIV A;  1CI3 M;  3V96 A;  1G91 A;  3HKS A;  3TME A;  4F8M A;  1LTT D;  3HS0 C;  4RMF A;  4Y7N H;  1L1O A;  2DY7 A;  4GNX C;  1IKL A;  1T5E A;  4A3M H;  2K75 A;  1BNZ A;  1XNR L;  1X56 A;  1X3G A;  5ELF A;  2DJG C;  4DAM A;  1W3S A;  5COY A;  2EXZ A;  1GHJ A;  1XMO L;  4GS3 A;  1B7Y B;  4V0B A;  1TWA B;  1Y1W B;  4JI6 Q;  2JA7 B;  3BDL A;  1ZXT A;  1YIJ A;  3GV3 A;  4R4Q A;  1PH1 A;  1VQ7 A;  1I94 Q;  5DEH A;  3E0E A;  5FKA C;  1LTA D;  2B2W A;  2L5T A;  4FXK C;  3CPW A;  5LMN L;  1M8A A;  4R4T A;  3CKI B;  2RDF A;  3PO2 H;  4CDF C;  4A3D G;  1PYS B;  2XSC A;  4A3L H;  1NMF A;  3NWT A;  1EU4 A;  1HPC A;  1G29 1;  4L5R C;  3G7L A;  4HR7 B;  4AYB B;  3RN2 A;  1NSN S;  1M4V A;  2KA7 A;  2WB1 G;  1RCV D;  2IJ0 A;  2KJX A;  1NR2 A;  1MBY A;  4IPD A;  3SR1 A;  4JBM A;  4X65 Q;  3HKZ B;  3TBI B;  4MHE A;  4KD3 A;  3KDF A;  5BR8 Q;  1JOQ A;  1STN A;  2EY2 A;  3CW2 C;  3J7A F;  2M9V A;  4RFB A;  3DWP A;  2VB2 X;  3RD4 A;  1N34 Q;  4OWW B;  3I4O A;  3I4M G;  4K2K A;  4KTA A;  4QGU A;  2X6L A;  3GDE A;  1XMQ Q;  4X62 L;  1EFI D;  2WAQ E;  1SNM A;  2F0S A;  4B08 A;  2O2L D;  5TSS A;  4XYQ A;  3E9I A;  5I2Y A;  2F3V A;  3DWA A;  1CK1 A;  1TWG B;  4G7O C;  4A3G G;  2N8N A;  1WTW A;  3K0Y A;  3NHH A;  1QCB D;  1I3Q H;  1TWH H;  1T9H A;  3VR3 A;  4X3T A;  5M9O A;  2RCN A;  1V9P A;  4DK3 C;  5IT9 E;  2A74 C;  3A8I E;  4HCS A;  3HOZ G;  4A3B B;  4DV3 Q;  5LMN Q;  2NYZ D;  1ICW A;  4L5T A;  3FHW A;  2B2U C;  1H9R A;  1DOK A;  1E2W A;  1EWC A;  4CKB A;  1VQD A;  1B9N A;  4H44 C;  4JI8 Q;  2K33 A;  1RL2 A;  1PTO D;  1WTV A;  1KTK A;  2VS1 A;  3AB9 A;  1XX8 A;  2EJF C;  4R4C A;  3GTL H;  1BUV T;  1K28 A;  4JI0 Q;  2YU9 B;  1BO0 A;  4KN7 C;  4EGV A;  2JA8 B;  1EL0 A;  4HMJ A;  5FJ8 H;  5J1Z A;  2DNE A;  5EKK A;  2KCT A;  2B2Y A;  3Q0A A;  2CFM A;  3I4M B;  2NN6 I;  2VUM G;  2N55 A;  4GNX B;  3S2D H;  5M5Y B;  3FPU B;  4C3H G;  1DOM A;  1PRT D;  1PRT F;  1UAP A;  2RHQ B;  3A56 A;  3CAM A;  4X3K A;  2R7Z H;  2B2V A;  3J7Z C;  5JPM C;  1VQE A;  5G3L F;  1MHW C;  5C0X I;  1HZ9 A;  2AQ1 B;  2FMC A;  3TZU A;  5IOD A;  4YIJ A;  1E2V A;  4DR5 L;  2DGY A;  4POG A;  1SYF A;  1ESF A;  2GVA A;  1QZG A;  2V1C C;  1X65 A;  1IBK Q;  3N52 A;  3G6E A;  2A68 D;  4HSV A;  1CUK A;  3OTO Q;  1K73 C;  3Q23 A;  2FJ2 A;  5A2Q E;  1CSP A;  1HNZ Q;  4KV6 A;  3C46 A;  4Y7N B;  2UUC Q;  2WIN B;  1YI2 A;  2D5D A;  1PXU A;  3VYS A;  3VR5 A;  3D31 A;  3H94 A;  2G5D A;  4LF4 L;  3MEH A;  2WAQ G;  2NVT H;  4PMB A;  2E2H B;  1N32 Q;  4YHH L;  3GTJ H;  3IFD A;  1QZH A;  1OTC A;  3PQI A;  5FO8 B;  3KLS A;  5E1F A;  3J80 i;  4HTH A;  2UU9 Q;  2EE1 A;  4LF6 Q;  4KHP Q;  4EVO A;  3KF6 B;  1Y1W G;  4C3I G;  4M1U B;  5T1G A;  3CPF A;  3DEO A;  2WFW A;  1C8C A;  2YU9 H;  2G9D A;  2JSO A;  1LT3 D;  4DK0 A;  3S9W A;  1KQS A;  4CGY B;  1IYJ B;  1I6H H;  2L0C A;  1GUN A;  3TP7 A;  4DR2 Q;  1LTS D;  5BN4 A;  4MNO A;  2N3S A;  1N34 L;  1NCV A;  2E8G A;  3H15 A;  4Q5V A;  4KKT A;  5JJI A;  3FP9 A;  2AMC B;  3HOV G;  3A0J A;  2IT1 A;  3PUV A;  4XDX A;  2SOB A;  4E6I A;  4ME5 A;  4PMW A;  2JA6 H;  4A3K B;  4B3T Q;  1VQ5 A;  2F03 A;  3PO3 H;  4BY7 H;  3TQY A;  5CC4 A;  1BF4 A;  4LFB Q;  4WJ3 M;  4GLX A;  4K5W A;  4XT1 B;  5KIX A;  1U5K A;  2OF1 A;  3I7F A;  4IPH A;  1FJG Q;  2R6G A;  3G4S A;  2UUB Q;  2UUC L;  2JA5 B;  1DGS A;  1NTG A;  4CKE A;  1PYW D;  2A6H C;  3J7Y W;  2E2I H;  1HA5 A;  4H02 A;  4GOP A;  1WTO A;  4OEL B;  1EYG A;  4F7X A;  1EY9 A;  2HD3 A;  1VS0 A;  4C3I B;  3CXC A;  1TWH B;  3KJP A;  1KDC A;  3NQI A;  2E2H H;  2RKS A;  4WFN 3;  1DON A;  1VQH A;  3ERQ A;  1H9K A;  3L9A X;  4UAI A;  1W6K A;  3K5M A;  4JW0 A;  1HXY D;  2F0W A;  5HGT A;  5JVG 3;  3TS0 A;  3HG9 A;  5J3B A;  4A3F H;  2AUJ D;  2VQF Q;  4X64 L;  4HJA A;  3CCS A;  1X55 A;  1KRT A;  5ELD A;  5IP9 H;  2R93 H;  3K0X A;  3HRZ C;  4K5X A;  1F2Z A;  1L0X B;  1SR3 A;  2UXD L;  2EYO A;  1PA6 A;  2E2J H;  3GTQ B;  2Q2H A;  1Z6H A;  3DWQ A;  3I4M H;  4JG2 A;  1EOT A;  1EFW A;  4HJ8 A;  1XMO Q;  1O7I A;  2A69 C;  3D8G A;  2JA7 G;  4JI6 L;  4KMU C;  4A93 H;  4C1N I;  1G2S A;  5CV7 A;  3OPO A;  3ITP A;  3NXW A;  4GKK L;  2QGQ A;  5IYD H;  4DR4 L;  1STY A;  3KYH C;  1SYD A;  5M3M H;  1FVI A;  4BY7 B;  3CC7 A;  2KEN A;  1V43 A;  2I07 B;  1TWA H;  3T1Y Q;  1SYE A;  2JA9 A;  1BCP D;  1EQR A;  3E5S A;  1Y1W H;  1YHQ A;  4JI7 L;  2JA7 H;  1GHK A;  3KOJ A;  1QOH A;  3KLR A;  1CKM A;  5DAU A;  2WV6 D;  2E5L L;  5CV9 A;  4UY8 C;  1I6V C;  1ESR A;  3CD6 A;  4TKO B;  2EOT A;  1QVC A;  2NN6 H;  4QIW B;  4I7A A;  2A19 A;  2UU9 L;  1SJH D;  2X6G A;  3M3Y B;  3V05 A;  5I4D A;  3URY A;  4JI1 Q;  4P73 A;  5IIF A;  4X3U A;  2CQA A;  3F8T A;  1QUQ B;  4I7Z C;  5C4X G;  1DJR D;  1TU2 B;  1GUO A;  1YNJ D;  3U4Z A;  3GP7 A;  5M5Y H;  3S2D B;  4X64 Q;  3IFT A;  2ALY B;  5CR3 A;  4BBR B;  5GAG C;  1PZJ D;  2XRQ D;  3C3L A;  4KY6 A;  2Z6K C;  1GD7 A;  2QIL A;  5M3F G;  2NVX B;  2LXK A;  4A3C G;  4DA2 A;  1BBU A;  1CZG A;  5FLX E;  4XIG S;  3PIP 3;  1EY6 A;  1EYC A;  5C44 H;  4BBR G;  5CBE E;  1LTL A;  1VMC A;  4IO9 A;  2F0P A;  2D0O A;  1SSO A;  4Y52 H;  3BYT B;  4DV2 Q;  1I5F A;  2KCN A;  3S17 H;  1J9O A;  1VQI A;  2ICI A;  2UUB L;  1IKM A;  1JB3 A;  3F2D A;  1B9M A;  1F2M A;  1NJI C;  1NNX A;  3I4N B;  4S3S A;  5C4H A;  3MA2 B;  3S1N H;  4UPA A;  2PZU A;  4IUN A;  3RUZ A;  1PFS A;  1K83 B;  1I4G A;  1GJX A;  4ZAI A;  4DV6 L;  2ZT9 C;  4WRD A;  3E3X A;  4HAE A;  3IKJ A;  4HIK A;  1LTR D;  4DAP A;  1B70 B;  1WJJ A;  2PI2 E;  2PYK A;  3SE0 A;  1ET9 A;  3T1H L;  1VQ6 A;  2L4N A;  2K1B A;  2EIF A;  2G9H D;  3UDF A;  2NUC A;  1OXV A;  4JI1 L;  1SMY D;  1FL0 A;  1MJC A;  4IFD H;  5JPN C;  2C9O A;  4RCN A;  1RTO A;  4K6D A;  1VQB A;  4C3I H;  5KND A;  1N9W A;  3KDF B;  4A3E H;  1HUN A;  1Y8P B;  3FRP B;  1SNC A;  1I6H B;  2DUD A;  1K8G A;  3ND9 A;  4R9W A;  3TRE A;  2QA4 A;  3S16 B;  3A55 A;  2WB1 E;  1U4P A;  2F52 A;  1KL9 A;  4I65 A;  5IYC H;  5IT9 c;  3PV0 A;  1MSH A;  3I8Z A;  3PCO B;  4Q0F A;  4WJW A;  1EOV A;  3UE1 A;  4O1N A;  2XIW A;  4JI5 Q;  1XPR A;  2B2V C;  3SK6 A;  3DUZ A;  2R92 G;  3PO3 B;  4JVZ A;  3SEB A;  1D8L A;  3STB C;  1WTX A;  3HOY H;  1YHA A;  2Q8T A;  3V2T A;  4EX5 A;  3HKZ G;  4A3E G;  2Q8I B;  2E2D C;  5KYL A;  1C0A A;  4LF4 Q;  2F0K A;  3A8K E;  1DZ1 A;  4JBW A;  2Z6K A;  3OIP A;  1N32 L;  4EQP A;  2IX3 A;  1W6J A;  2MP1 A;  4DV6 Q;  1VQP A;  1K83 H;  2NWG A;  3Q8D A;  1CKN B;  5C0X J;  4LFA Q;  2B8G A;  4OIJ A;  4AYB E;  3PO2 G;  4C3H H;  2F4V L;  5M3M G;  3AEV A;  2F0M A;  2F0I A;  2YV5 A;  4XQJ A;  1YIT A;  1WOC A;  2A6E C;  1GUG A;  3K7A H;  1U4R A;  1I50 B;  4RH6 A;  3SK5 A;  1G8Z D;  1PH9 A;  4A3J B;  1D1I A;  2K28 A;  2Y0S G;  3H3V C;  1S5C D;  5EGT A;  3OOC A;  2JEB I;  1BXT A;  1VF7 A;  5EPK A;  3HOX H;  3U4V A;  4MN3 A;  2UXC L;  2O5J C;  4HJ7 A;  1EEI D;  2WAC A;  1UE6 A;  1Q81 C;  1IBM L;  4J15 A;  1G6P A;  2O4X A;  1Q90 A;  1JOO A;  2EYP A;  2HHH L;  4BBR H;  1K8O A;  3G6J B;  2NVX H;  4OX9 Q;  2F3I A;  1TWF H;  5LMN W;  1PH4 A;  3GTO B;  1SE3 A;  1TS2 A;  4GN3 B;  4FF2 A;  1GUS A;  2NVY H;  4NXN Q;  4MZ9 A;  1IL8 A;  5C4X H;  1Y14 B;  1NBW A;  1L0W A;  1E24 A;  4YWL A;  1GXD C;  4BBS H;  1BBX C;  1B8A A;  1HZC A;  4NB3 A;  4PMC A;  5IP7 H;  4QIW E;  1HH2 P;  5JJK A;  3VA5 A;  1A3U A;  4JI2 L;  3HKZ E;  1E1T A;  4H7B A;  5GAE C;  3CCR A;  3CC4 A;  1E0B A;  1EZ8 A;  4YCW A;  4DUY L;  5KNC A;  1JJG A;  2KEE A;  1B3A A;  3Q6S A;  1I4Q A;  2WII B;  1HZB A;  2ZJP A;  2FIN B;  1UEA B;  1BDO A;  1D1K A;  2ZTC A;  2JA6 G;  2QW7 A;  3K5N A;  4J8Q A;  5JJL A;  2F1M A;  1JQY D;  1LT4 D;  4NP5 A;  3PIP A;  1ENA A;  1J5E Q;  3MXU A;  5K5P A;  3BZD B;  1WFQ A;  1PDQ A;  2OTL A;  3KF8 A;  2F0H A;  3HOV B;  1AH9 A;  1ZYR C;  1U4L A;  3HGB A;  1DOL A;  2R61 A;  4DV0 Q;  1VQL A;  2VZA A;  2ZXP A;  2R3Z A;  2CHB D;  1SNP A;  3MXN A;  2KHJ A;  2Y0S E;  2BE5 D;  4HCE A;  3T1Y L;  4K5V A;  2R93 G;  4CDE C;  2XWJ B;  1VQA A;  2E5L Q;  1YEZ A;  4KKS A;  2AWO A;  3JC6 6;  5DLQ E;  4RAU C;  2ZTE A;  1HA6 A;  2J4X A;  4KJN A;  2OTJ A;  4FF4 A;  3T4A C;  4OO1 H;  1SNQ A;  4DR2 L;  4DR3 L;  2DN8 A;  1STE A;  3BDC A;  1YNN D;  1S5E D;  4PQX A;  2A73 B;  2R92 B;  1RTN A;  5D65 A;  2QDB A;  1IW7 D;  2TSS A;  3PO2 B;  3C2P A;  5IYC G;  1NR4 A;  4HJ5 A;  2NTT A;  1O7Z A;  1SLJ A;  3VR4 A;  2QCP X;  3RZO B;  1EQT A;  1I94 L;  1SNO A;  1JWM D;  2JK8 A;  3M7G A;  3NK9 A;  2R7F A;  4DAY B;  1EQQ A;  4IPG A;  4DF7 A;  1A2U A;  1SAP A;  3HOU B;  2R7Z G;  2MGS A;  1RD9 D;  4G7H C;  3TN2 A;  1D2B A;  4JK1 C;  4X66 Q;  2ZXO A;  3MZ5 A;  1IZ6 A;  4A3D B;  3ER0 A;  4LF5 L;  4M8A A;  2I5L X;  4UP8 A;  5JAV A;  4DKA C;  1QUQ A;  3HOV H;  4A3B G;  2VW9 A;  1PYB A;  2L11 A;  2PCF B;  4RGO S;  3HOU G;  3KK7 A;  1I4R A;  3VR6 A;  1K0R A;  2VUM B;  3Q22 A;  1TQO A;  1V1Q A;  2B63 B;  2WP8 J;  2R7D A; 
#chains in the Genus database with same CATH homology
 4PMW A;  2JA6 H;  4B3T Q;  3HOV H;  1VQ5 A;  1QVF A;  2NZO A;  3EBE A;  5BR8 L;  3PO3 H;  4PZ6 A;  4BY7 H;  1P8L A;  2HIX A;  2LSS A;  4X66 L;  1MJE A;  1VQK A;  3TQY A;  5FJ8 G;  5ELO A;  4LF8 L;  4LFB Q;  4WJ3 M;  2ZJR A;  1TWG H;  4GLX A;  4DR3 Q;  2IY5 B;  1U5K A;  3I7F A;  3MXN B;  4IPH A;  4O2D A;  4OWT B;  2R6G A;  4YY3 L;  1FJG Q;  1Q86 C;  2IX1 A;  3G4S A;  1SFO H;  2UUB Q;  4KLK A;  2OWO A;  2UUC L;  3H3V H;  1VQF A;  1DGS A;  1NTG A;  1R9T H;  2PQA B;  4YCU A;  1UWV A;  1YJ9 A;  4A3L G;  3BZC A;  3K8A A;  5M5X H;  3I55 A;  2E2I H;  4OXP A;  4H02 A;  2Q2I A;  4GOP A;  1EYG A;  4NXM Q;  2GVB A;  1VS0 A;  5M3F H;  2NN6 G;  3S1M H;  4R1J A;  4IOC A;  3CXC A;  3KJP A;  1KAW A;  4LF6 L;  2E2H H;  4DV1 L;  3HFZ B;  1OXX K;  2K14 A;  5GAD C;  3KF8 B;  1VQH A;  2YYZ A;  3J81 c;  4GNX A;  5FLX c;  1N33 L;  4DV4 L;  3I2Z A;  4LF5 Q;  2HQL A;  4R4O A;  3KF6 A;  4EQ5 A;  3TS0 A;  1PH6 A;  3S14 H;  1PH2 A;  2IX0 A;  3CCV A;  1E1O A;  3GO5 A;  4JI2 Q;  5J3B A;  4A3F H;  4QY7 A;  2VNU D;  2VQF Q;  4JCV E;  4YY3 Q;  2HT1 A;  4X64 L;  4HJA A;  4BBS G;  1HJP A;  3CCS A;  1X55 A;  4B3S Q;  4A3M G;  4QJF A;  3GD7 A;  4BY7 G;  4LF7 L;  3D0F A;  1KRT A;  1KC8 C;  4A76 A;  2MO0 A;  1YZ6 A;  2NZH A;  5IP9 H;  3GTQ H;  1HNX Q;  4BXX G;  3K0X A;  2JA8 H;  2R93 H;  4JI0 L;  1MIU A;  3F2B A;  1SR3 A;  4DR1 Q;  5GQO A;  2UXD L;  4XTC S;  5ELN A;  4KHZ A;  4GKJ Q;  1PA6 A;  2E2J H;  3FKI H;  2Q2H A;  2Q2T A;  1N33 Q;  1UEB A;  4A3K G;  3I4M H;  1Q8K A;  5HGQ A;  3UE0 A;  4JG2 A;  1EFW A;  1BVS A;  4HJ8 A;  1XMO Q;  1PV4 A;  3ERS X;  1O7I A;  2VUM H;  4B3R L;  3L0O A;  2JA7 G;  3HOW H;  4JI6 L;  4RG1 A;  4A93 H;  2KCM A;  1L1O B;  2VQE L;  1HR0 L;  3RLF A;  5IWA Q;  5AJ3 Q;  2VQF L;  2QGQ A;  4GKK L;  5IYD H;  4IPC A;  1WCM G;  1Y1V G;  4JI3 Q;  2A8V A;  4DR4 L;  3KYH C;  4IJH A;  5M3M H;  1A0I A;  1FVI A;  4JI4 L;  1WI5 A;  3JAM i;  4OWX B;  3CC7 A;  2KEN A;  1TWC H;  1V43 A;  2BA0 A;  4P71 A;  1VQM A;  3M4Q A;  4GLV B;  2BA1 A;  4L5Q A;  4DV2 L;  2K5N A;  3PIO A;  1TWA H;  3T1Y Q;  1Y1W H;  2JA9 A;  4TVA B;  1EQR A;  1YHQ A;  4JI7 L;  2JA7 H;  3KOJ A;  3BU2 A;  3L2P A;  4A93 G;  1CKM A;  3HOY G;  3GTP H;  4JOI A;  3PUZ A;  4DR5 Q;  1EIY B;  1K3R A;  2E5L L;  4UY8 C;  2EXD A;  3UDG A;  3CD6 A;  1D7Q A;  2BH8 A;  1SMX A;  2R92 H;  4BY1 H;  1QVC A;  4DNI A;  2ZM6 Q;  5E7N A;  3PUX A;  4AYB G;  4IFD J;  2A19 A;  2K4K A;  5IWA L;  5AJ3 L;  4HIO A;  2UU9 L;  2ATW A;  4GKK Q;  1JT8 A;  2B63 G;  5C44 G;  2I0Q A;  3HOW G;  4P74 A;  1IBM Q;  3CCU A;  1KIX A;  4ME3 A;  4JI1 Q;  4A3F G;  4P73 A;  3K81 C;  4AH6 A;  3F8T A;  4A3J G;  5IYB H;  4DV4 Q;  1EUJ A;  3CCL A;  3B6Y A;  1QUQ B;  3T1H Q;  4B3S L;  1JE5 A;  1KXL A;  3IRB A;  1C9O A;  3JAM c;  4JYA Q;  5C4X G;  1AE2 A;  2PNH A;  1W2B A;  2BH2 A;  1VQO A;  1IL2 A;  4BXX H;  1YNX A;  1E3P A;  4DR6 Q;  3U4Z A;  3ULJ A;  2XTI A;  2QEX A;  5M5Y H;  4X64 Q;  1HR0 W;  2ALY B;  4JBK A;  2NVQ H;  3TS2 A;  3NEL A;  2K52 A;  4LW1 A;  3CF5 A;  3RZO H;  1SE8 A;  3PSI A;  5GAG C;  4YHH Q;  2I5M X;  4ALP A;  3U58 A;  1PH7 A;  2Z6K C;  4OX9 L;  1GD7 A;  5M3F G;  3NBH B;  2N49 A;  1YBY A;  1SRO A;  3RZD H;  4LUZ A;  2LXK A;  2OCE A;  4A3C G;  4GLA C;  1BBU A;  4GN5 A;  1BBW A;  4NXN L;  2N78 A;  3I4M G;  4XIG S;  4HIM A;  1SRU A;  3U50 C;  2K5H A;  5C44 H;  4BBR G;  1LTL A;  1WYD A;  5IY0 A;  1TXY A;  3HOX G;  1VQG A;  4IO9 A;  4LF8 Q;  2D0O A;  3I4N G;  4JC0 A;  2MNA A;  4Y52 H;  3GTG H;  3H0G G;  3CCE A;  4DV2 Q;  1I5F A;  4IOA A;  2YTY A;  3K7U C;  3S17 H;  5GAH C;  4DV3 L;  1NE3 A;  1VQI A;  3M85 A;  5C3E G;  2UUB L;  1S72 A;  1GVP A;  2UUA Q;  4LFC L;  3A5U A;  2B63 H;  3F2D A;  2KHI A;  4DV7 Q;  4IFD I;  5C4J H;  1NJI C;  2MFI A;  4DR7 L;  4A3B H;  2XGT A;  1XMQ L;  4LWC A;  3CME A;  4LF9 L;  1XJV A;  3S1N H;  4UPA A;  5FLM H;  3S2H H;  1PFS A;  1KHI A;  3PF5 A;  3K80 C;  2A1A A;  2AWN A;  3CMA A;  3RNU A;  3M4P A;  1N36 L;  5K36 G;  4DPG A;  5IYD G;  4DV6 L;  3STB D;  4GOP B;  1VCI A;  3KLW A;  4HIK A;  2ES2 A;  1B70 B;  1WJJ A;  2PI2 E;  4DV5 Q;  4A75 A;  1FJG L;  1XNQ Q;  3T1H L;  1VQ6 A;  1S40 A;  4A3G H;  2EIF A;  3J81 i;  3UDF A;  1IBL Q;  3FKI G;  1XPO A;  2ID0 A;  1OXV A;  4JI1 L;  1WCM H;  1Y1V H;  1FL0 A;  3H0G H;  2ASB A;  1OXS C;  1MJC A;  1Z9F A;  2Z0S A;  1G51 A;  1LYL A;  4A3J H;  1NMG A;  1VQB A;  3H3V I;  4C3I H;  4JBJ A;  1CSQ A;  1K9M C;  2F4V Q;  2MO1 A;  2YTX A;  1N9W A;  3KDF B;  4BA1 I;  4JYA L;  4A3E H;  1X9N A;  2GN5 A;  2UXB Q;  1UE5 A;  1Q1B A;  2D62 A;  1UE7 A;  2DUD A;  2B29 A;  1Q82 C;  1K8G A;  1XTD A;  4AQY Q;  3TRE A;  2VL6 A;  3J81 j;  3EIV A;  2QA4 A;  4JOI C;  4NXM L;  5FLM G;  2WB1 E;  3M4O H;  2PI2 A;  2F52 A;  1KL9 A;  1K8A C;  5IYC H;  5IT9 c;  3PV0 A;  5GRO A;  5JEA J;  3PCO B;  4OON A;  1EOV A;  3UE1 A;  1MKH A;  5IYB G;  3PUW A;  4C3J H;  3I56 A;  4MTN A;  1IBK L;  1IBL L;  3KJO A;  1LUZ A;  4K0K L;  5M5W H;  4JI5 Q;  1XPR A;  1Q46 A;  1VQ8 A;  1AE3 A;  1HNZ L;  4FDB A;  3HOZ H;  2HIV A;  4YCV A;  1JJ2 A;  4NPS A;  2R92 G;  3L7Z C;  4X65 L;  3HKS A;  5IP9 G;  2H5X A;  4RMF A;  1NY4 A;  3AFQ A;  1D8L A;  4P72 A;  3STB C;  4Y7N H;  1L1O A;  1YHA A;  1M90 C;  4GNX C;  3HOY H;  1HNW Q;  4A3M H;  2K75 A;  3HKZ G;  4AIM A;  4EX5 A;  1XNR L;  4A3E G;  1X56 A;  3J7A 5;  1X3G A;  4QQB X;  1C0A A;  4LF4 Q;  1VQC A;  4DAM A;  1W3S A;  1X3E A;  1XMO L;  4GS3 A;  3J80 c;  1B7Y B;  3BJU A;  4JBW A;  2Z6K A;  4JI6 Q;  1N32 L;  4GOP C;  4GKJ L;  4B3M Q;  4TQU S;  4DUZ Q;  1LM0 A;  3W5O A;  3DLL A;  3CCM A;  3S1R H;  1YIJ A;  4R4Q A;  1PH1 A;  1VQ7 A;  1I94 Q;  4DV6 Q;  4JV5 L;  1VQP A;  1K83 H;  1KRS A;  3Q8D A;  1CKN B;  3E0E A;  1N8R C;  4JI4 Q;  1YVC A;  5C0X J;  4LFA Q;  5C0X G;  1YJN A;  4OO1 I;  3CPW A;  3MEF A;  4K0K Q;  5LMN L;  4AYB E;  3PO2 G;  4C3H H;  4R4T A;  1XNQ L;  5EAY A;  4P75 A;  4A3I G;  2F4V L;  1VQJ A;  3PUY A;  2HHH Q;  5M3M G;  1KD1 C;  1Z47 A;  3AEV A;  3RR5 A;  3PO2 H;  2YV5 A;  4A3D G;  1PYS B;  1YIT A;  3ICE A;  4JI7 Q;  1WOC A;  4A3L H;  1U0L A;  2YTV A;  3K7A H;  4BY1 G;  3TRZ A;  4A3D H;  1H95 A;  2K5V A;  1NMF A;  1X6O A;  1PH9 A;  2CQO A;  1G29 1;  4L5R C;  2Y0S G;  1A63 A;  3RN2 A;  4AQY L;  4L5S A;  4X62 Q;  3BZK A;  2JEB I;  5JEA G;  3HOU H;  1GO3 E;  3HOX H;  3AQQ A;  2WB1 G;  3U4V A;  3PGZ A;  2UXC L;  1UE1 A;  4HJ7 A;  1UE6 A;  4IPD A;  5LMU Q;  4YWM A;  1J5E L;  4X65 Q;  4JBM A;  1Q81 C;  3F2C A;  1IBM L;  4J15 A;  5BR8 Q;  3KDF A;  4A4I A;  1G6P A;  2AHO B;  3A5Z B;  3UDX A;  3AFP A;  3CW2 C;  1L2F A;  1XNR Q;  3OYY A;  2HHH L;  2Q2U A;  4BBR H;  1JB7 A;  1A62 A;  1N34 Q;  4OWW B;  3I4O A;  4O0A A;  1M1K C;  2NVX H;  4A3K H;  2F3I A;  4OX9 Q;  2C35 B;  1TWF H;  5LMN W;  4QGU A;  4DV7 L;  1PH4 A;  3S24 A;  1PH5 A;  1E22 A;  3GDE A;  1XMQ Q;  4GN3 B;  4X62 L;  2WAQ E;  4WJ4 A;  3CCQ A;  2NVY H;  1PH3 A;  4NXN Q;  1XPU A;  2JA8 G;  4MZ9 A;  4JI8 L;  2UXC Q;  5C4X H;  1OXT A;  1Y14 B;  2VY3 A;  1NBW A;  3E9I A;  1E24 A;  1L0W A;  2ZJQ A;  1HZA A;  4YWL A;  2CWA A;  4PZ8 A;  4A3G G;  4BBS H;  1YHB A;  2N8N A;  4B3M L;  2RHS B;  3G48 A;  1JJC B;  1I3Q H;  1TWH H;  5HY6 A;  1T9H A;  1B8A A;  3NEN A;  1HZC A;  3W1B A;  3G71 A;  4NB3 A;  2B3G A;  1IXR A;  3S15 H;  5IP7 H;  3OTO L;  4QIW E;  4IFD G;  3CQZ H;  1HH2 P;  2RCN A;  2LXJ A;  1V9P A;  4DK3 C;  5LMU L;  2CCZ A;  4LFC Q;  5JJK A;  3HOZ G;  3F1Z A;  4DV3 Q;  5LMN Q;  4JI2 L;  3HKZ E;  1E1T A;  4L5T A;  5GAE C;  3CCR A;  3CC4 A;  3FHW A;  4IJL A;  2EQS A;  1ASY A;  4YCW A;  3TEH B;  1SN8 A;  4DUY L;  4C2M H;  1VQD A;  1JJG A;  3ZJY C;  4LF7 Q;  4JI8 Q;  1RL2 A;  1HZB A;  2ZJP A;  2PQA A;  2VS1 A;  3M3Y H;  2OQ0 A;  1X54 A;  2ZTC A;  4R4C A;  2JA6 G;  3GTL H;  4DR1 L;  3RLO A;  1X3F A;  2UXD Q;  3RLN A;  1CKN A;  4DV1 Q;  5JJL A;  3PF4 A;  4DV5 L;  2CWP A;  4DK6 C;  3CC2 A;  4B3R Q;  1N36 Q;  1I50 H;  4JI0 Q;  3PIP A;  4A3I H;  1QVG A;  1PVO A;  1J5E Q;  5FJ8 H;  1Q1E A;  2OQK A;  4GN4 B;  4PZ7 A;  3S16 H;  1WFQ A;  1S3O A;  2RF4 A;  1EIF A;  3CCJ A;  2KCT A;  4YWK A;  2CFM A;  2OTL A;  1AH9 A;  2NN6 I;  2VUM G;  4A3C H;  4JI3 L;  4GNX B;  4DR4 Q;  4DUY Q;  3S2D H;  3ULP A;  4DV0 Q;  2KBN A;  1VQL A;  2D0P A;  2RHQ B;  3GTM H;  3CAM A;  2VZA A;  4PG3 A;  2VQE Q;  4UP9 A;  1HR0 Q;  3ULL A;  2R7Z H;  3J7Z C;  1C7Y A;  2CKZ B;  2MQH A;  2L15 A;  1VQE A;  2PMZ E;  2JA5 G;  1VQN A;  2UXB L;  2KHJ A;  2Y0S E;  2I5H A;  5C0X I;  1HNX L;  1HZ9 A;  4R4I A;  1YJW A;  3GTK H;  2JEA I;  3T1Y L;  1L1O C;  3RN5 A;  1ASZ A;  4DR5 L;  2DGY A;  4KI0 A;  4POG A;  4OO1 G;  3W1G A;  2GVA A;  1QZG A;  2V1C C;  2R93 G;  1GM5 A;  3GTO H;  1X65 A;  3I4N H;  1RIP A;  3LGJ A;  1VQA A;  3SGI A;  2JJQ A;  3G6E A;  1IBK Q;  5IP7 G;  2E5L Q;  1YEZ A;  2AWO A;  1CUK A;  3JC6 6;  3OTO Q;  4B3T L;  1K73 C;  5DLQ E;  4JI5 L;  3OW2 A;  3M9B A;  2JA5 H;  1CSP A;  2AKW B;  4BA2 I;  2JE6 I;  1A8V A;  1HNZ Q;  3S1Q H;  2ZTE A;  2K50 A;  1J6Q A;  4LUO A;  2UUC Q;  4KHP L;  1YI2 A;  1JMC A;  4LUV A;  2OTJ A;  3UDI A;  4LFB L;  2IHE A;  4UP7 A;  4DR2 L;  4DR3 L;  3D31 A;  1VQ4 A;  3WWV A;  3VDY A;  1PH8 A;  1E7Z A;  4LF4 L;  2WAQ G;  5IE8 A;  4HID A;  2NVT H;  3PO3 G;  4APV A;  1N32 Q;  1HNW L;  4YHH L;  3GTJ H;  1Q12 A;  4DR6 L;  1PHJ A;  5IYC G;  1QZH A;  3EN2 A;  1OTC A;  1P16 A;  1BKB A;  4HJ5 A;  3KFU A;  4JV5 Q;  3A74 A;  2ZM6 L;  3AYH B;  1SLJ A;  3J80 i;  4DUZ L;  3E9H A;  2UU9 Q;  2IHF A;  1I94 L;  5H1S E;  4LF6 Q;  1Q7Y C;  2JK8 A;  1CKO A;  4KHP Q;  3M7N A;  2R7F A;  3KF6 B;  1Y1W G;  4LFA L;  4LNQ A;  4DAY B;  1EQQ A;  4DV0 L;  4IPG A;  3CPF A;  2R7Z G;  2WFW A;  2YU9 H;  4QL5 A;  4X66 Q;  4X6A H;  1IZ6 A;  1EWI A;  1KQS A;  3ER0 A;  3CP0 A;  4LF5 L;  1IYJ B;  2FXQ A;  1I6H H;  2ZTD A;  2UUA L;  4DR2 Q;  2I5L X;  2JQO A;  4MNO A;  2N3S A;  1QUQ A;  4UP8 A;  2E8G A;  4DKA C;  3H15 A;  1N34 L;  4LF9 Q;  2VW9 A;  4A3B G;  1PYB A;  4POF A;  1OXU A;  4HJ9 A;  1VQ9 A;  3HOU G;  1FGU A;  5JJI A;  3FP9 A;  3NEM A;  2AMC B;  1K0R A;  3HOV G;  3A0J A;  2IT1 A;  5C3E H;  3PUV A;  3DM3 A;  1V1Q A;  2WP8 J;  1GKH A;  4DR7 Q;  2R7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...