2E2JH

Rna polymerase ii elongation complex in 5 mm mg+2 with gmpcpp
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(P*AP*UP*CP*GP*AP*GP*AP*GP*G)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 16
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2006-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e2jH00
1EUJA 1N34L 2WB1G 2N8NA 2OTJA 2QGQA 2Y0SE 4H02A 1L1OA 4IJHA 3CC7A 3J81c 3ULPA 2ZM6Q 2VQEL 1PH4A 4JI7Q 4BBSH 5C3EG 3S15H 4B3TQ 1KQSA 5HY6A 3EBEA 1X3GA 4JI2L 4HIDA 4ALPA 1I94L 4GN5A 4GLAC 4GKJQ 4IFDJ 4A3LH 1NJIC 4JI6Q 1I5FA 4A3DH 3A5UA 2KENA 1AE2A 4DK6C 3S17H 1G51A 4YY3Q 4BXXG 2ZJRA 1HZCA 1WI5A 2DUDA 4A3JG 1UE1A 3PUXA 4JCVE 4OX9Q 3HOYG 2NN6I 1Y1WH 3M7NA 5M3MG 2AWOA 4DV4Q 1Q7YC 2JK8A 1S3OA 2NZHA 3BZCA 1K3RA 4GOPA 1TWGH 1PFSA 1K8AC 4YHHQ 2VZAA 4P72A 4IOCA 1OXTA 2JA5G 4BY1G 3KDFA 2ZJQA 4JYAQ 2ZTDA 4DK3C 1QUQA 4DR4Q 5IT9c 1HNZQ 1GD7A 5E7NA 1XJVA 4A3CH 4AYBE 2N78A 4LF4L 1Q8KA 1V43A 4HJAA 3T1YL 1CSQA 4BY7H 2YV5A 4JI3L 1L1OC 3GTJH 1OXVA 1JJGA 3OTOQ 4PG3A 4JBJA 4APVA 3BZKA 3F8TA 1UE5A 2JEAI 3S16H 2CQOA 2GN5A 5K36G 3PGZA 1IBLQ 3GTQH 1W3SA 3VDYA 2NVTH 5LMUL 1N32L 3I2ZA 5LMNW 1N33L 2F4VQ 4OWWB 3L2PA 2MO0A 5HGQA 4LFBL 4PZ8A 1O7IA 2CFMA 5BR8Q 3K80C 1OTCA 1AE3A 2VUMH 5IP7H 4DV0Q 3H0GH 1IXRA 4GN4B 3HKZE 1YNXA 1FGUA 3W1BA 3UE1A 5C44H 2WB1E 5M5XH 4HIOA 3T1HL 1FJGQ 2Q2HA 4A3FH 4GOPC 5DLQE 2K75A 4RMFA 3RR5A 3Q8DA 3M3YH 3KJPA 5IWAQ 3F1ZA 3U4VA 2OWOA 1A62A 3UE0A 4DR3Q 4LF7L 1Q1EA 4DR1Q 1QZHA 4NXML 4DAMA 4JI8Q 1XNRL 3I4NG 4Y52H 1U0LA 2Y0SG 3AFQA 3I56A 2JA8H 1VQBA 3I4MH 3E0EA 2MO1A 3KLWA 4DUYL 2A8VA 1S40A 2UXBQ 4YWMA 1UEBA 1EQRA 3TEHB 2E5LL 1WCMH 1Z47A 2KHIA 3PCOB 5FJ8G 4A3KG 4A75A 3HFZB 4HIKA 1MJEA 4AH6A 2AWNA 2PQAA 5AJ3Q 3RN2A 4LF6L 3ERSX 3JAMi 1LTLA 5IYBG 3HOVG 5GAHC 4X66L 1YVCA 2VQFL 4AQYQ 1VQLA 4LF8L 2JA6G 1VQKA 2R7ZG 3PO3G 4A3MH 3PUWA 3F2CA 2VNUD 4DR2L 1YI2A 3NBHB 4IPDA 3UDIA 3S1QH 1N9WA 4GNXA 4KHPL 4QGUA 5LMNL 5IYDH 1SRUA 2MQHA 4R4CA 4PMWA 1A63A 4PZ7A 4BBSG 1X3FA 2I5HA 2ES2A 2WFWA 1X56A 4A4IA 1EOVA 2NN6G 3NEMA 3CAMA 1Q82C 4A3LG 4DV2Q 1VCIA 4A3DG 5JJIA 3BJUA 1EQQA 1VQ9A 3PUVA 1KRTA 1T9HA 1GVPA 4DNIA 3UDGA 1QZGA 3CCJA 3KF8B 4KLKA 4DV1L 3PIOA 4A3BH 4AYBG 4JBMA 4POGA 2YTVA 1E7ZA 1TXYA 4POFA 2UXDQ 2NVYH 3AFPA 4A3GH 4KHZA 1Y1WG 5IP9H 4GKKQ 2K5HA 1KAWA 3KF6B 1G291 1J5EL 3CD6A 3RLNA 1YJ9A 2I5MX 1PH5A 3S1MH 4X6AH 3GTGH 1YHBA 3PF5A 4GLXA 1U5KA 1KIXA 1P16A 2Q2UA 4LUOA 3PF4A 1FL0A 1YBYA 2BH8A 4X64L 4JI1Q 3S2DH 2RCNA 1HR0W 3M4PA 2CCZA 4P71A 4C2MH 2UUAQ 3KOJA 4B3RL 5JEAG 4A3CG 3ULJA 4LF5Q 1TWAH 3CMEA 4MNOA 2N49A 1XNQQ 4BY7G 5H1SE 1XMQL 4DV3L 1RL2A 1WFQA 4GN3B 1IBKL 1N34Q 1HNWL 3CC4A 2VL6A 1D8LA 1CUKA 2VQEQ 1MJCA 2IHEA 5JJLA 4DUZL 4IPCA 5IYCH 4B3SL 1YHQA 1Z9FA 1EIFA 1VQDA 2OQKA 3KYHC 1I94Q 1D7QA 1YZ6A 1X55A 2YTXA 1VQ4A 4XIGS 5GAEC 1M1KC 3TS2A 2VUMG 4A93H 3GTKH 2LXJA 4NXNL 5IP7G 3M4OH 3H0GG 4X62L 5C44G 4QQBX 3BU2A 3L0OA 2ALYB 3CCRA 3FP9A 4HIMA 2F52A 4JOIC 4A3FG 1K8GA 1C7YA 2IHFA 4UPAA 5JJKA 1EYGA 3J80i 4L5RC 1I3QH 4FDBA 1Q1BA 3ER0A 4J15A 2Q2IA 2PI2E 4DR5L 2VW9A 3AYHB 1VQGA 2EXDA 5FLMH 3TQYA 3G4SA 4HJ8A 1WJJA 4EX5A 3W5OA 3TS0A 2UUCL 2Z0SA 2JA8G 1HR0L 3I4MG 3M4QA 1VQPA 1VQAA 3G6EA 3T1YQ 2IY5B 1VQ7A 1WCMG 4JI3Q 4DR6L 3LGJA 2D0OA 5FLXc 3F2DA 4C3HH 2EIFA 4MZ9A 3CPFA 3DM3A 1PVOA 4IO9A 4A3MG 5GQOA 1HZ9A 5LMUQ 1HJPA 4A3EH 1N32Q 4LFAL 3W1GA 1QVFA 1N33Q 5JEAJ 2ID0A 1NE3A 2KCMA 5IYDG 3OW2A 4DV7L 4LFBQ 2BA1A 2XTIA 5C0XI 2D62A 4P75A 4QL5A 4A76A 1JE5A 1M90C 4UP8A 2OTLA 1K83H 4UY8C 2NZOA 3T1HQ 4JBKA 3B6YA 4L5QA 1H95A 1TWHH 3CW2C 3E9IA 3J81i 2JA7H 1PH9A 1L2FA 5J3BA 2ATWA 4A3BG 4LF7Q 1VQOA 1KXLA 1IZ6A 4NXMQ 4A3GG 4B3ML 5EAYA 5IP9G 4YCUA 4QY7A 2VY3A 1CKNA 3TRZA 4JI0Q 1OXXK 1I50H 4X65L 1Q86C 3CMAA 4K0KL 2R93H 1PV4A 4DUYQ 2UUBL 3PO2H 4JI5L 4YCWA 2E5LQ 4DPGA 1HNXL 1HZBA 4TVAB 3TREA 1KC8C 4LF6Q 2BH2A 3STBC 3S1NH 1JT8A 1N36L 4LF8Q 3GDEA 4X66Q 3K0XA 3J81j 4DR2Q 1CSPA 3PUYA 1X65A 5LMNQ 4HJ9A 1GO3E 2JJQA 5M3FH 4DV6Q 3UDFA 1IBML 1SFOH 4JI4L 3RNUA 2R92H 4O2DA 5IYCG 1NY4A 4DR7L 4DV5L 4DKAC 1N8RC 4LF9Q 4OXPA 4IPGA 1YJWA 1GKHA 1PYBA 3KJOA 5GADC 3PV0A 2HQLA 1L1OB 3CPWA 3G71A 2K14A 4A93G 2OQ0A 2ZTEA 4DV1Q 1I6HH 2E2IH 4HJ5A 2FXQA 3FHWA 2R7FA 1CKOA 4L5TA 2F3IA 3RLFA 2B63H 3HOZH 1TWFH 1J5EQ 3F2BA 1QVCA 1XMOL 4P74A 2UU9L 2CKZB 3AEVA 2CWAA 5FLMG 3HOWH 1VQHA 1VQ5A 1VQCA 2UXCL 3A5ZB 4JV5L 2I0QA 2JEBI 1SMXA 4B3RQ 3E9HA 1VQJA 4GOPB 2K5NA 4GNXC 1Q46A 1XMQQ 4WJ4A 4DV3Q 1PH6A 3KDFB 4OO1I 3K8AA 2QA4A 5C0XG 1IBKQ 1HNWQ 1QUQB 2KCTA 1XTDA 2LSSA 2NVQH 4L5SA 2YYZA 3WWVA 2LXKA 3HOXH 4BBRH 1LUZA 2MFIA 1VQ8A 2WAQE 1J6QA 4DUZQ 4BA2I 4B3SQ 1C9OA 3FKIH 3U4ZA 1BKBA 1Y14B 2K5VA 4JI2Q 3ZJYC 4A3EG 3S2HH 3K7AH 3STBD 4DAYB 3CXCA 3IRBA 4R1JA 1DGSA 1JMCA 1ASYA 2HHHL 4LUVA 4O0AA 3S1RH 2DGYA 1IYJB 1HH2P 3CP0A 4OONA 4QJFA 3UDXA 5C4XH 1XPOA 1VQMA 4NXNQ 2HIVA 4LFCL 4LF5L 1PHJA 1L0WA 4C3JH 3DLLA 4MTNA 3CCVA 2IT1A 2KBNA 1HZAA 3D31A 1MIUA 1Y1VH 2QEXA 2YU9H 4OX9L 3J7A5 2JA7G 1YHAA 2YTYA 1JB7A 1B70B 5GROA 3HOUH 3A0JA 1PH7A 1KD1C 1VQNA 2ZM6L 2RHQB 2EQSA 4JI7L 1E1OA 1Q12A 4DR5Q 4B3TL 4IJLA 4IFDI 2RHSB 3H3VH 1S72A 4JBWA 1SR3A 3M9BA 1EIYB 4GKJL 1UWVA 1QVGA 2L15A 4JI6L 2UUCQ 1XPUA 2NVXH 1HR0Q 3KF6A 4LWCA 2R93G 4LF4Q 4JC0A 3PO2G 2GVAA 5M5WH 4YY3L 2WP8J 1R9TH 4DR6Q 1BBUA 1NMFA 5IE8A 3H3VI 4AIMA 4HJ7A 1CKNB 1NTGA 3M85A 1ASZA 2E8GA 4DV4L 1PH2A 1X6OA 1MKHA 2PMZE 1KL9A 4OWTB 3RZDH 1PH8A 2XGTA 3G48A 1A0IA 3JAMc 2ASBA 1LM0A 1K0RA 4YHHL 1KRSA 2VS1A 4LFAQ 2AKWB 4YCVA 2MNAA 4JYAL 2A1AA 3AQQA 2PQAB 3SGIA 5M3FG 4DV7Q 5ELNA 4YWKA 1PH1A 4DR4L 1EFWA 2R92G 1LYLA 2B3GA 1HNZL 1C0AA 3PIPA 2CWPA 3EN2A 3I4OA 5C0XJ 3H15A 3CCSA 1X9NA 4GNXB 5IY0A 1E1TA 4A3IH 3I4NH 2K4KA 3OTOL 2KHJA 3L7ZC 1K9MC 1WYDA 2R6GA 3CF5A 3I55A 1OXSC 1IBLL 1B7YB 3NENA 5C3EH 4IPHA 4R4IA 4B3MQ 1JJ2A 2B63G 3HOZG 2F4VL 1OXUA 1VS0A 1XNRQ 4R4TA 1CKMA 4LW1A 5BR8L 4JG2A 4X65Q 4TQUS 4YWLA 1GM5A 1SROA 3PUZA 4XTCS 4K0KQ 2OCEA 1TWCH 3HOWG 2K52A 1E3PA 2WAQG 2ZJPA 4DV0L 3JC66 3GD7A 2UUBQ 4JI5Q 4BXXH 4OO1G 1EWIA 3ULLA 1HNXQ 1FJGL 3KFUA 4R4OA 4A3JH 3HOYH 3GO5A 1IL2A 1YEZA 5IWAL 5M3MH 1N36Q 2VQFQ 1V9PA 4DR3L 2R7DA 3U58A 2H5XA 3CCMA 4DR1L 3MEFA 4JI8L 3S14H 4KHPQ 2JE6I 3OYYA 2JA5H 2Q2TA 4BY1H 3HOXG 2RF4A 1JJCB 4BBRG 4JI0L 3GTOH 1V1QA 1IBMQ 4JI4Q 1A8VA 4P73A 1E22A 3FKIG 4DR7Q 2UXBL 3RN5A 4DV5Q 2E2JH 2D0PA 1YITA 1P8LA 1UE7A 4C3IH 3D0FA 1VQ6A 5AJ3L 5C4XG 1VQEA 2Z6KA 3A74A 2JQOA 2K50A 3GTLH 4AQYL 3GTPH 2V1CC 4IFDG 3K7UC 1PYSB 3CCLA 3CCUA 4GLVB 1YJNA 1Y1VG 2HT1A 2GVBA 2AMCB 1KHIA 1AH9A 4PZ6A 4R4QA 3HOUG 1Q81C 1XMOQ 3EIVA 4ME3A 4EQ5A 3GTMH 2UU9Q 4DV6L 1VQIA 3CQZH 3U50C 3J80c 2A19A 2N3SA 1BVSA 1NBWA 1PH3A 1G6PA 3RLOA 3CC2A 3HKSA 4X64Q 1W2BA 1B8AA 2PI2A 4DV2L 4LF9L 2UXCQ 4JV5Q 5GAGC 4LNQA 2IX1A 2C35B 3MXNB 5ELOA 4GS3A 3K81C 1XPRA 1UE6A 4IOAA 2IX0A 1E24A 4Y7NH 2E2HH 4WJ3M 2UXDL 1X3EA 2PNHA 3I7FA 3CCQA 2ZTCA 1SLJA 1X54A 3NELA 4GKKL 1SE8A 1WOCA 1RIPA 2BA0A 3ICEA 4JOIA 4BA1I 3CCEA 5C4JH 2HIXA 1SN8A 4KI0A 2Z6KC 1VQFA 4NPSA 2JA9A 2B29A 3J7ZC 4JI1L 1PA6A 4A3KH 4UP9A 5FJ8H 2HHHQ 1BBWA 4RG1A 4OWXB 3RZOH 1K73C 5M5YH 2UUAL 4LUZA 1YIJA 4NB3A 4UP7A 4QIWE 4X62Q 5IYBH 4LFCQ 3HOVH 2AHOB 2I5LX 3S24A 1XNQL 1NMGA 2JA6H 3PO3H 2R7ZH 4A3IG 3PSIA 1FVIA 3HKZG
chains in the Genus database with same CATH superfamily
1N34L 1EY0A 1TU2B 1CFMA 2OTJA 4ZUJA 2F1MA 4B9XA 3J81c 1STHA 2VQEL 1PH4A 3IAYA 5IT9L 1S5ED 2CH4A 5HY6A 3OW7A 1X3GA 4ALPA 2BE5D 1SEBD 3GTPB 1AE2A 4DK6C 3NQIA 2F0GA 4YY3Q 1MGSA 2K32A 2ZJRA 4KHVA 3HOYG 1DZ1A 5KRUA 3WOFA 2AWOA 2NZHA 4P72A 2DJGC 4RGNA 2JA5G 5EKLA 3NWTA 3AB9A 5I9OA 3K5NA 4LAAA 1HNZQ 3TBIB 1GD7A 4LF4L 1Q8KA 1V43A 4HJAA 1VDZA 1EQTA 4JI3L 2KEDA 5IT9E 5DEHA 4PG3A 3J7YW 3OOCA 1K8MA 4RKBA 5HGTA 2Y0SB 1CHPD 3PGZA 1IBLQ 3GTQH 5LMUL 1STEA 2IJ0A 5JVH3 2F0NA 4OWWB 2QCPX 4LFBL 1T5EA 2ZXRA 1D5MC 1G2SA 1PRTC 1EEFD 1QNKA 3H0GH 4GN4B 3W1BA 4A76A 2R7ZB 3T4AC 5I2XA 3UE1A 2Q2HA 1F9QA 4RMFA 3BVZA 4N9TA 4RGOS 3KJPA 2B8GA 3F1ZA 4R8NA 4DR3Q 3S15B 4FXDA 4JK1C 1MSGA 1TS3A 2VB3X 1WD0A 3AFQA 5M5WB 1EY6A 1S40A 3NBIA 1EQRA 3TEHB 2KHIA 4A3KG 1MJEA 1Y1WB 2RQXA 2PQAA 4LF6L 5IGBA 1U4MA 1D1IA 4AQYQ 1GUGA 2JA6G 4A3MH 5EPLA 3F2CA 2A6EC 3CHBD 3UDIA 1N9WA 4QGUA 4FVMA 5IYDH 1SRUA 2MQHA 4IUNA 4R4CA 1A63A 4O1NA 2I5HA 2ES2A 1G6ZA 1PXUA 1VF5C 4DAVA 1Q82C 4A3LG 5EPJA 4A3DG 5JJIA 3BJUA 3PUVA 1KRTA 3R2TA 1STNA 1G2TA 1SYCA 1PFMA 3D8GA 1TY0A 1BNZA 2YTVA 1TXYA 3NTKA 1PRTD 3H09A 4KHZA 5IGCA 4GKKQ 1LO5D 1KAWA 2G9HD 2K5HA 3CD6A 1S5CD 4PMBA 1RHPA 4GLXA 2Q2UA 3KBGA 1JWUD 5ELCA 5M5XB 1YBYA 3S2DH 4ODGA 3M3YB 2UUAQ 2EJFC 1BUVT 4A3CG 2M2LA 5H1SE 1XMQL 2B8FA 4GN3B 3NQTA 1CUKA 2JA8B 2IHEA 3DHQA 4M1UB 3G7LA 1W6JA 3NTHA 5FLXL 4RHSA 1X55A 3GTKH 2LXJA 5C3WA 1X3PA 2A6ED 3A8JE 5C44G 4QQBX 3BU2A 2ALYB 3FP9A 5FOBB 2F52A 3S1QB 1U9RA 4CDFC 4DXFA 1PRTF 1EYGA 3GTMB 1JC7A 5J39A 1DOLA 1Q1BA 4HSPA 3D6WA 3AYHB 5JOBA 4RAUC 1VQGA 2EXDA 5FLMH 3LWUA 1EYDA 4HJ8A 2IPKD 2E76C 1HR0L 4JW0A 2Z6BA 1TVXA 3I4MG 3T1YQ 2IY5B 1WCMG 2ENBA 4PMCA 4DR6L 3F2DA 5L37A 5C0XH 3CRLC 3ITPA 1R4QB 5GQOA 1JOKA 3HG9A 1ICWA 5COYA 3W1GA 3Q24A 1NE3A 3OW2A 3C2PA 2R3ZA 4UY8C 3B6YA 3J81i 1LT4D 3MHBA 4RA8A 1PH9A 4YIJA 3K6OA 2KCCA 1L2FA 2L1BA 4DXGA 4BBSB 2F0PA 4LF7Q 3ONAB 1IZ6A 4IUQA 4S3SA 3R3OA 5EAYA 1CKNA 4A93B 3CRKC 4X65L 3CMAA 1M4VA 3IFTA 1Y8PB 1HNXL 1CI3M 2KECA 4TVAB 3TREA 2HQEA 4IUPA 3STBC 1I3QB 1LACA 2R61A 1JT8A 1N36L 1FNVA 1SNQA 4HSVA 2RVLA 3MXPA 4DR2Q 2XIWA 1V1OA 5M3FH 2WKCA 5LL6X 3SK5A 1YJWA 1PYBA 3KJOA 2A6HC 5GADC 2HQLA 1L1OB 2J0TD 2K01A 2SOBA 3MEHA 2HDMA 3T56B 4HJ5A 4KY5A 4HEDA 4G7ZC 3SK4A 3HOZH 1QVCA 3W2DA 4Q0FA 4OO1H 4CHTB 3K0YA 1VQ5A 3A5ZB 5JVG3 4WFN3 3BDLA 2Z4IA 1E2VA 2PZTA 4C3HG 2HCCA 3KDFB 3TZDA 1PH6A 1L0XB 1IBKQ 1EL0A 1QUQB 2WV6D 4BBRH 1VQ8A 1J6QA 1NUCA 4B3SQ 1C9OA 1L0YB 3PO2B 1BKBA 3S2HH 4QB4A 2QF7A 3K7AH 3STBD 3NBHA 1ASYA 3SDZA 4O0AA 2DGYA 1EEID 3NUCA 1BXTA 1B9MA 3ERQA 2Z8LA 2IT1A 1NR2A 4NP5A 2YU9H 3IL8A 1QE6A 3LX0A 4OX9L 2E75C 1B70B 1CQFA 4DAPA 1DOMA 3TP8A 1VQNA 3H3VC 2MGSA 3KF8A 4DR5Q 1Q12A 4B3TL 4IJLA 2RHSB 3H3VH 1S72A 4JBWA 1B53A 1EIYB 1FGBD 1JR0D 2UUCQ 2M00A 4RWSC 3J81E 2A74C 1STBA 2R93G 3PIO3 2EYJA 2B39A 5M5WH 2EE1A 1NMFA 2KJXA 3L3OC 2B63B 1CKNB 1TWFB 4DV4L 1PH2A 2PMZE 4OWTB 2XGTA 3JAMc 4YHHL 4ILWA 2F0OA 2L5TA 2NZ1D 2MNAA 1RJTA 4DV7Q 4K8JA 4YWKA 1C48A 2R92G 1LYLA 2B3GA 1JOOA 3H15A 1BOSA 2SDFA 4GNXB 4NKLA 4DK1A 3I4NH 2OF1A 2PW7A 1DM0B 1LTTD 1K9MC 2R6GA 5D3DA 5EPKA 3DM1A 4R4IA 2F4VL 1XNRQ 3NXWA 5NUCA 1S5DD 4ZUIA 3S1RB 4TQUS 5C4XB 2OCEA 3HOWG 4DV0L 3JC66 4JI5Q 1Y1VB 3ULLA 1FJGL 3KFUA 4R4OA 1X3QA 5M3MH 2VQFQ 2MP1A 2H5XA 3U58A 5BN5A 4KN7C 4KHPQ 3OYYA 3HOXG 1JJCB 3FPUB 2QDLA 5ELEA 5CBAE 2UXBL 4UHVA 1YITA 3D0FA 3FPPA 4ZRZA 1EY7A 3I91A 1ZKOA 3MFGA 4QUFA 3CCLA 1D6EC 2EDGA 4GLVB 5K36H 2RCFA 1F2ZA 4NW2A 4R4QA 3HOUG 2XRSD 3GTMH 4K2KA 4DV6L 3U50C 2A19A 1CA5A 3RLOA 3CC2A 1D2BA 1A15A 1EWHA 4LF9L 2UXCQ 2JYOA 4LNQA 1KLUD 2C35B 1E2WA 2AUJD 1E24A 2E2HH 2UXDL 5J22A 5A35A 1X3EA 4CKEA 1SLJA 1SE8A 1B4OA 2Z6KC 1VQFA 5E3FA 2JA9A 4RGMA 3J7ZC 4JI1L 5FJ8H 5LHY1 2HHHQ 1BBWA 1KDAA 1MBYA 4RG1A 3RZOH 5M5YH 2BDNA 3HOYB 3VYTA 4LFCQ 2AHOB 2DY8A 2QKIC 4A3IG 3HKZG 1EUJA 2JA5B 1HUMA 2WB1G 4B9WA 2QGQA 1HCZA 3CC7A 4IJHA 3MXUA 3GTOB 4JI7Q 1JB3A 1KTKA 2EY2A 2SNMA 4BBSH 2NTTA 5EKIA 4JI2L 4HIDA 1I94L 3QOLA 2NN6H 4GKJQ 3F2UA 3GTLB 2E2IB 4BXXG 3TN2A 1HZCA 4KKSA 4HN7A 1UE1A 3PUXA 2D5DA 3M7NA 1ZYRC 5CV8A 1XWEA 2B2UC 3BZCA 4GOPA 1E2ZA 1PFSA 2K05A 2ZXPA 1BO0A 2N88A 2ZTDA 1H9SA 1JORA 5E7NA 2J7ZA 2KVMA 1KNAA 4UDUC 2L12A 1GUTA 4Y7NB 3J7AV 4BY7H 1L1OC 1GUSA 4C3IG 3GTJH 1C4QA 3OTOQ 4JBJA 2K6AA 1UE5A 2XN9C 4H13C 3VDYA 2VB2X 4A3KB 3L2PA 1LABA 2JP1A 1QJOA 3K80C 5KNBA 2VUMH 3C1FA 2JA6B 2JXMB 1YNXA 1FGUA 2L11A 4HIOA 3OMGA 2D9UA 3E0JA 1JQYD 4A3FH 1HA6A 2K75A 2RBMA 3RR5A 3Q8DA 4LJZC 5IWAQ 1U4RA 1A62A 4IUVA 1Q1EA 4NXML 4A3DB 1KABA 1JWSD 3PQIA 4Y52H 3NSWA 3S17B 4DUYL 2CW0C 3PCOB 3QB3A 3X3NA 2AWNA 3RN2A 3JAMi 1LTLA 3HOVG 4LF8L 1YVCA 1TWGB 3PO3G 1VQKA 2AQ3B 1YI2A 1NAPA 4PZ7A 2ZT9C 3NE5B 1X3FA 3H91A 2K1BA 2L9HA 1EOVA 3P1HA 2O4XA 4DV2Q 1VCIA 5C5MA 1EQQA 4DNIA 5ELDA 3S16B 1GHKA 4A3BH 4FP5D 4JBMA 2NVTB 2OEOA 1PMRA 4F88A 2NVYH 1WTWA 4A3GH 5IP9H 4Z9CB 3KF6B 4IQZA 4X6AH 1YHBA 3PF5A 1P16A 3PF4A 5C44B 1FL0A 4X64L 4A3JB 1HR0W 2CCZA 4KJNA 4C2MH 2XWJB 1XNQQ 2EYMA 4DV3L 2L55A 2L4NA 1HNWL 1N34Q 4EQOA 4BY1B 1AZQA 1D8LA 2VQEQ 2CW0D 2K5WA 3I4MB 5IYCH 1RF2D 1VQDA 1AEXA 1WCMB 5IIFA 1YZ6A 1F2YA 5GAEC 1M1KC 1SYEA 3OSOA 3H0GG 4X62L 4OHJA 4JOIC 2LMCB 4K8IA 4LMQD 4L5RC 1PFBA 1UNSA 1I4GA 3MXNA 2EPBA 2LKVA 1WJJA 1OO9B 4PNYA 1EYCA 5CGKA 4JI3Q 3LGJA 2D0OA 4M8AA 4ZK9B 4IURA 3S1MB 3GTGB 4A3MG 1LTSD 5IGDA 1ENAA 2Q8TA 1LT3D 5LMUQ 4A3EH 4LFAL 2WKDA 5M9OA 5IYDG 4LFBQ 5C0XI 2D62A 3JAME 1TWAB 2EYOA 4NDXA 2BOSA 2NZOA 2B2YC 4IN3A 3CW2C 5KIXA 2JA7H 4O42A 1KXLA 3EA6A 2X6GA 4B3ML 2LS01 1CHQD 4P2CB 4JI0Q 1OXXK 2F0QA 1M8AA 3M4OB 4K0KL 1ILQA 1K28A 5KYLA 5I4DA 2FINB 4LF6Q 3S1NH 5T1GA 1EZ6A 2K7VA 3J81j 3PUYA 1CSPA 2RSOA 4CDCC 1GO3E 3UDFA 3RNUA 2B2VC 5G3LD 4DR7L 4H44C 4DV5L 4DKAC 4OXPA 1X32A 4C3HB 5IOCA 5IODA 2K14A 2F0JA 2I46A 4HMJA 2B2TA 2E2IH 1WTRA 5FO8B 3L9AX 4L5TA 4CKBA 2F3IA 4WORA 3F2BA 2UU9L 1C8CA 3R93A 1K83B 5FLMG 3VR5A 1TKWB 1O80A 2F4IA 2TSSA 3A55A 4XYOA 3TSSA 4JV5L 4QCLA 2I0QA 3MC0B 1KNEA 1SMXA 1TS4A 3E9HA 4QF4A 4L6TB 3OWEB 1XMQQ 4WJ4A 1RCVD 4IALA 4OO1I 1BQQT 5CV4A 5C0XG 1XTDA 4L5SA 5EBDA 1DYQA 1I50B 2LXKA 4FNFA 1LUZA 4RGTA 3U9SA 2R93B 5G3LF 3FKIH 3MVVA 4EQPA 4IZ8A 3ZJYC 1AW7A 2EZVA 4TRDA 4LUVA 1IYJB 3PMFA 4DA2A 3UDXA 4OONA 1IL8A 1XPOA 1VQMA 4IFDH 4KK7A 1L0WA 2KBNA 1F2LA 3J7A5 3I72A 3FDTA 2YTYA 3O13A 1KD1C 2ZM6L 3DWAA 1SFOB 1A2UA 5CR3A 1E1OA 3P75A 2F0LA 3M9BA 4K14A 1UWVA 1QVGA 2L15A 4JI6L 1HR0Q 1I6HB 2HDLA 5CV5A 1CTMA 1FD7D 1F9RA 2RDFA 4I7AA 1R9TH 4DR6Q 1SE3A 3H3VI 4HJ7A 5C4HA 1PTOC 1NTGA 2GA4B 4CJ0B 1ASZA 2E8GA 4OL7A 1X6OA 1MKHA 4RFBA 1KL9A 1QG7A 1PTOH 3RZDH 2K04A 1PH8A 1KRSA 3HOWB 1TR5A 4WJWA 4YCVA 1I4PA 4JYAL 2A1AA 3AQQA 2PQAB 5M3FG 4XYQA 3Q0AA 4DR4L 4KV6A 1EFWA 3PIPA 1MD2D 3EN2A 3I4OA 5C0XJ 1BCPB 1HXYD 3CCSA 4KY6A 4KN4C 1CK1A 1E1TA 5KGUA 4X3TA 2NVQB 3HOXB 1WYDA 1SJED 3LWEA 5JPNC 3I55A 2JN4A 1OXSC 3QG1A 5C3EH 3NENA 1IYVA 2DY7A 3HOZG 1OXUA 2K28A 3NK9A 4QUCA 2EJMA 5BR8L 4X65Q 1GM5A 1B1ZA 1EFID 1SROA 3I8ZA 1TWCH 2C5CA 4C3JB 4OO1G 2ZJPA 3GD7A 2IX3A 1KLGD 3QO2A 1HNXQ 4FF3A 2M9VA 4A3JH 3HOUB 3I90A 1YEZA 1N36Q 1RTOA 2R7DA 4F8MA 2PMZB 1JCKB 4DR1L 4JI8L 1DOKA 2JE6I 4KD3A 4BY1H 4GZYC 3D4RA 3MA2B 2NVXB 4BBRG 1TY2A 1O78A 1CA6A 1PTOD 3HGBA 2D0PA 3D4WA 3HZXA 4HAEA 1VQ6A 5AJ3L 1FNUA 1VQEA 3A74A 2JQOA 4R8IA 3GTPH 1LLRD 2FHTA 2V1CC 1ZEQX 3CCUA 4DFAA 2Z1CA 1YJNA 1SJHD 2HT1A 2JSOA 2KA7A 1K0SA 3FRPB 4K2LA 1DXMA 4C1NI 3I73A 3UI2A 1Q81C 4RH6A 1SNCA 2EYHA 2NYZD 3HEJA 3VR3A 4KKTA 2N3SA 3J80c 1NBWA 1PH3A 1G6PA 3H6MA 1B8AA 4A3IB 3HKZB 2MJ8A 1NR4A 3GP7A 4WRDA 3DMUA 3K81C 3J81L 1UE6A 1O7LA 4DNRB 1J9OA 4WJ3M 2DNCA 4IUUA 3I7FA 3OWFA 3CCQA 3NELA 5K5PA 2CHBD 4JOIA 4BA1I 3P20A 1H9JA 1SN8A 4KI0A 5E4XA 1PTOF 1PA6A 2MHVA 4HR7B 4OWXB 1SE4A 2ICEC 3DXJC 4NB3A 4UP7A 4QIWE 5IYBH 1ILPA 2I5LX 1Y69U 1NMGA 4KJOA 3BZDB 2R7ZH 3QWNA 1RKNA 4OX9Q 3I4NG 3T16A 2QEJC 1IKMA 1XYIA 5DNFA 3S15H 4B3TQ 2E2JB 4GN5A 4C3IB 1NJIC 1I5FA 1GOZA 3S9WA 3A5UA 2KENA 2PNRC 1Q3LA 1ENCA 1WI5A 3URYA 3OMCA 5I2YA 5KNCA 2NN6I 1Y1WH 5M3MG 4DV4Q 1Q7YC 1S3OA 3CQZB 1K3RA 3M4YA 1K8AC 4YHHQ 2VZAA 2RSNA 1OXTA 3SR1A 3E6ZX 2ZJQA 3TP7A 4XXEA 1O7ZA 5IT9c 3X3MA 1PYWD 1XJVA 5AFWA 5JEAH 3NWSA 4AYBE 2N78A 1CSQA 1S4ZA 1XXGA 1OXVA 4DAYA 1F2MA 4APVA 1STAA 3F8TA 4X3KA 1BDOA 2FJ2A 5C4JB 5K36G 5IGGA 1B9NA 4TKOB 1EYAA 1WVLA 1N32L 1N33L 2F4VQ 2XVSA 2MO0A 4FF4A 1I4HA 5HGQA 4PZ8A 2HCIA 1FYCA 2FMCA 1S5FD 3HOVB 3ZYYX 5IP7H 4DV0Q 3HKZE 3T1HL 1SAPA 2WB1E 5M5XH 1FJGQ 2I07B 5J1ZA 3N52A 3M3YH 3U4VA 2OWOA 3UE0A 4DNTB 4DAMA 1TQOA 4CDDC 1XNRL 4FF1A 1ESFA 2EY5A 1U0LA 4TSSA 1QCBD 5CYUA 2JA8H 1HTPA 2AQ1B 1VQBA 2UXBQ 1O7YA 2MO1A 2F0TA 2A8VA 1PFNA 2E5LL 5FJ8G 4A75A 3HFZB 4AH6A 1A3VA 2PPBC 4X66L 2VQFL 2D2CC 1AZPA 5CV6A 4CJ2C 3PUWA 4ZLTF 3NBHB 2FFKB 3S1QH 1T5XD 4KHPL 5LMNL 1V1PA 2QW7A 5T1IA 5CV9A 4PMWA 1FNWA 4BBSG 4B08A 2WFWA 2H1EA 2ZXOA 1DONA 2NN6G 3CAMA 3SK6A 4K5VA 1V8QA 1VQ9A 1GVPA 5ISRA 3V2TA 1QZGA 3UDGA 3CCJA 3KF8B 4KLKA 4DV1L 3GTQB 4AYBG 2UXDQ 1FR3A 3AFPA 2MPMA 1ML0D 4BS9A 4CDEC 1J5EL 1G291 3E5SA 1YJ9A 1PH5A 4ID6A 1U5KA 1TIID 3H0GB 3VYUA 1PRTB 4LUOA 4XDXA 3K58A 4JI1Q 1LT5D 4XQNA 4P71A 1K3BC 2F0UA 4CKCA 1SMYD 4B3RL 1TS5A 3T51B 3ULJA 4RCNA 4LF5Q 4BY7G 2N49A 1U4PA 1VF7A 3S14B 1LTAD 1H9RA 2OXPA 2VL6A 5DM73 3GV6A 2RKSA 4JPBW 1WTPA 4DUZL 4IPCA 1YHQA 1EIFA 3EVQA 4X3SA 1I94Q 2YTXA 1VQ4A 4XIGS 3TS2A 4A93H 2VUMG 2Z4HA 4NXNL 1G8ZD 4A3MB 1K8GA 4A3FG 4UPAA 2RA4A 3J80i 1I3QH 4FDBA 3NTIA 2VW9A 2DJFC 2QDBA 1BF4A 3TQYA 2EYLA 1E0BA 4EX5A 5EJWA 3W5OA 2Z0SA 3NP8A 1EY9A 4MN3A 3VYRA 2F0DA 4V0BA 2P5ZX 3G6EA 1VQ7A 3Q23A 5FLXc 2EIFA 5FO9B 2IL8A 3DM3A 4IO9A 2A69D 4RCOA 1HJPA 3W3AA 2Z9HA 5F2DA 1QVFA 3S2DB 2ID0A 2KCMA 2AUKA 5CV7A 2BA1A 2XTIA 1SXTA 1M90C 4UP8A 2OTLA 1GUNA 1SE2A 4R9WA 3E9IA 5J3BA 2ATWA 4A3BG 1PZID 1WTXA 1VQOA 1CZGA 2EY6A 4NXMQ 1UEAB 4A3GG 2PZUA 5IP9G 3FMCA 4QY7A 4YCUA 2VY3A 3A7LA 1Q86C 3GTKB 2HUGA 4QMGA 3V96A 3Q22A 1PZJD 4DUYQ 2UUBL 1XTCD 3OIPA 3PO2H 4YCWA 4DPGA 3FVQA 1HZBA 2VXWA 4L63B 1KC8C 2BH2A 4OEMB 4J1MA 4LF8Q 4DN4M 1AN8A 3EJIA 2WACA 4HJ9A 2QILA 2XNAC 1A3TA 1IBML 4JI4L 4O2DA 5IYCG 3I4LA 2NB0A 5ELFA 2IW3A 4CJ1B 1GKHA 4K6LA 3PV0A 2ICIA 3GQBA 3G71A 3Q6SA 1IKLA 4KY7A 4NMZA 3FHWA 3KLSA 1HQMC 2R7FA 2B63H 3RLFA 1TWFH 3TMEA 1XMOL 1LT6D 4P74A 2CKZB 2CH4W 3AEVA 1EIGA 1WD1A 1Q90A 4C56C 3E3XA 4CBVA 4GOPB 2K5NA 4GNXC 1Q46A 4G4KA 4DV3Q 1WTVA 5IGEA 1HNWQ 1H9SB 2F0KA 2YYZA 3WWVA 5DAUA 4ZKBB 2MFIA 4ZCKA 2WAQE 4BA2I 3U4ZA 4A3EG 1Y14B 2K5VA 4F7XA 4X3UA 3CXCA 2XSCA 2WIIB 3C3LA 1DGSA 2O2LD 5C5LA 1JMCA 3S1RH 1HUNA 1IHZA 4QJFA 3CP0A 5C4XH 1D1KA 2BDOA 4EGVA 3AU7A 1PHJA 3DLLA 2F0EA 3JAML 3D31A 1HZAA 1Y1VH 2JA7G 1YHAA 1JB7A 4ME5A 1HFGA 5M3FB 1PH7A 3D4DA 3TP5A 2RHQB 4IFDI 2F0HA 1SR3A 1H9KA 1F9SA 4MHEA 1XPUA 4ZAIA 1KAAA 2F0FA 1SYFA 4LF4Q 2X6LA 4YY3L 1MSHA 2XRQD 2WP8J 1BBUA 3V05A 5IE8A 4AIMA 3HOZB 1JOQA 4K6DA 2CQAA 4I65A 3G48A 1A0IA 1K0RA 1LM0A 1PLFA 3DEPA 2VS1A 2PW5A 4LFAQ 3QR8A 1NNXA 5C6AA 1PH1A 3OIQA 1HNZL 1C0AA 1X9NA 4CGYB 3K5LA 3ND8A 3BG3A 4IUTA 4BBRB 3CF5A 1IBLL 1I4QA 3R2IA 3S2HB 1SDFA 3K7AB 4B3MQ 1JJ2A 1H9MA 1LTRD 1VS0A 4R4TA 4LW1A 3T13A 4YWLA 4OIKA 1HA5A 3IFDA 4XTCS 4K0KQ 2K52A 1E3PA 2WAQG 5JPMC 4F87A 3KBXA 2YU9B 3MZ5A 3HOYH 4N8X1 4V190 1V9PA 3BDCA 4DR3L 4ULLA 3I3CA 1BBXC 1CM9A 3DUZA 3S14H 3OPOA 2JA5H 5LL6S 4JI0L 1PZKD 3GTOH 1NSNS 4P73A 3FKIG 4DR7Q 3RN5A 4DV5Q 2H4OA 4PQXA 5CC4A 1EU4A 1P8LA 2LFNA 3SVMA 1F77A 2Z6KA 3A54A 3GTLH 2K50A 4IFDG 4AQYL 1HPCA 3K7UC 3RUZA 1EY5A 1AH9A 4PZ6A 4UAIA 1TT2A 2TMPA 3EIVA 4EQ5A 2UU9Q 1IYUA 3KK7A 1BVSA 1CQVA 4BWGB 5JJZA 1W2BA 4G7HC 1TWHB 2PO4A 2PI2A 3TP6A 3I4NB 1UUPA 4JV5Q 5GAGC 3MXNB 5ELOA 4GS3A 5IGFA 4IOAA 3FEWX 2AQ2B 2IX0A 4Y7NH 1R4PB 4OIJA 4HCSA 2ZTCA 4GKKL 3ICEA 2NUCA 3K5MA 1B50A 2EVBA 2B2UA 4NPSA 2B29A 3SE0A 4A3KH 2J4XA 1DD2A 1HQRD 1K73C 2UUAL 4LUZA 1RTNA 4K5XA 5M3MB 2JA6H 3S24A 3PSIA 2OT2A 2N8NA 1SNPA 2Y0SE 4H02A 1L1OA 5E4WC 3ULPA 4XT1B 2B2WC 2ZM6Q 2A5HA 2R92B 1G91A 5C3EG 4OGQC 1KQSA 3EBEA 1CT1D 4GLAC 4IFDJ 4A3LH 2LY7A 1CZWA 4JI6Q 3MWYW 4A3DH 2K5QA 3S17H 1G51A 1RDPD 3NPPA 3RMHA 1U4LA 2DUDA 3HRZC 4A3JG 4JCVE 2K03A 3A8KE 4RHRA 4K5WA 1GJXA 2JK8A 2F0VA 1RODA 1TWGH 2DN8A 3RD4A 4IOCA 1KDCA 2F3WA 4BY1G 3KDFA 3DWQA 4JYAQ 4DK3C 1QUQA 4DR4Q 5TSSA 4A3CH 1MI2A 2O5IC 1EZ8A 3T1YL 2E2HB 2YV5A 4QIWB 5I9PA 1B44D 1JJGA 3BZKA 2JEAI 2G5DA 3S16H 2CQOA 4DGZA 5EQ0A 2GN5A 3G6JB 1W3SA 4HTHA 2NVTH 5FLXE 3I2ZA 5LMNW 3BS1A 4U673 2F03A 3C1EA 2IWHA 3RZOB 5M5YB 5BR8Q 1O7IA 2CFMA 3D3RA 1OTCA 1AE3A 1JE4A 1TS2A 1IXRA 2KHSA 3MAQA 5C44H 2G9DA 3A8IE 4GOPC 5DLQE 1JWMD 4LF7L 4ZQ3A 4DR1Q 1QZHA 3IKJA 4JI8Q 1EWCA 2Q8RE 4JVZA 3AMUA 4XT3B 2Y0SG 3I56A 3I4MH 3E0EA 3QOJA 3KLWA 4YWMA 1UEBA 4AYBB 5I6WA 1WCMH 1Z47A 5BN4A 4HIKA 3VR4A 5AJ3Q 1BR9A 3ERSX 5IYBG 5GAHC 1VQLA 4FYDA 2R7ZG 1HFNA 3MXGA 3TDQA 4XQJA 2VNUD 4DR2L 4IPDA 4MTKA 4GNXA 1DJRD 3M7GA 3PIP3 1SNDA 1X56A 2O5JC 4BY7B 4A4IA 3GTJB 3NEMA 2EXZA 2PCFB 1PDQA 1NCVA 1EU3A 2WB1B 1T9HA 1LTGD 2EYFA 3N6RA 3PIOA 1Y8NB 4POGA 4POFA 1E7ZA 1Y1WG 1GXDC 1GUOA 2EOTA 4RKLA 5E1FA 3RLNA 2I5MX 3S1MH 2VUMB 3GTGH 5DM63 2KUMA 4LK1C 1AP0A 1KIXA 1D5XC 2FMMA 3BVGA 1EY8A 2BH8A 4A3FB 2RCNA 3M4PA 1VMCA 1GUWA 5KYIA 3KOJA 2Q8IB 5JEAG 1Y8OB 1QOHA 1TWAH 1SYBA 3EROA 4MNOA 3CMEA 4ZYSA 4I7ZC 2WINB 3WDNA 1RL2A 3KLSX 1WFQA 1IBKL 5D3IB 3CC4A 4G7OC 1MJCA 5JJLA 4B3SL 2RDHA 1Z9FA 2OQKA 3KYHC 2V4DA 1D7QA 1LV9A 4Q5VA 5IP7G 3M4OH 4EVOA 4FO2A 4FXKC 3L0OA 4MIUA 3CCRA 4HIMA 1C7YA 1EIHA 2K5DA 2IHFA 5JJKA 1KDBA 2E2DC 2B2YA 3ER0A 4J15A 2Q2IA 2PI2E 4DR5L 2A6HD 2A68C 3G4SA 3TS0A 2UUCL 1A3UA 2JA8G 5FK9C 3M4QA 1VQPA 1XX8A 1VQAA 1LTID 4EQNA 4KTAA 4A3BB 2NVYB 4A3GB 4C3HH 2EY1A 1AFPA 4MZ9A 3CPFA 1PVOA 2L0CA 1HZ9A 1UAPA 1QILA 2F0IA 1N32Q 1N33Q 4L8JA 5JEAJ 1QNUA 3QIAA 4DV7L 5D14A 4C2MB 2KEEA 4P75A 4QL5A 4KD4A 1JE5A 3PO3B 1K83H 3T1HQ 4JBKA 4L5QA 2B2VA 3K5OA 1H95A 1STYA 1TWHH 1YNJC 1S5BD 3A56A 1ET6A 1Z7TA 1SMYC 2F0SA 2DNEA 5EKKA 3TRZA 1I50H 2F0WA 5KNDA 3K57A 2R93H 1PV4A 3EFXD 1Q8IA 4JI5L 2E5LQ 1II3A 3VA5A 5I6YA 2A68D 3GDEA 4X66Q 2PQEA 4HCEA 3VA7A 3K0XA 3EQLC 5LMNQ 1JICA 1IW7C 1X65A 2SNSA 3U9OA 2JJQA 2PYKA 4J8QA 2F0MA 4DV6Q 1SFOH 2R92H 1NY4A 4DU9A 1F9PA 1I6VC 1N8RC 4H7BA 4LF9Q 4IPGA 5C3XA 1J8IA 1B2TA 4A93G 3CPWA 4DK0A 3SEBA 2OQ0A 2ZTEA 4DV1Q 1I6HH 4C3JG 5JAVA 2FXQA 3KLRA 3I70A 3SK8A 4A3EB 3BVMA 1CKOA 3GV3A 4HMIA 5CBEE 1J5EQ 1ESRA 5EGTA 2CWAA 5CORA 1YNJD 3HOWH 3BYTB 1VQHA 2B2WA 1I4RA 1VQCA 2A69C 2UXCL 1HRJA 2CVRA 3VR2A 2JA7B 2JEBI 4B3RQ 1BCPC 1VQJA 1ICFB 2HD3A 2SEBD 4PV1C 3R8BA 1K8OA 1WTQA 1ET9A 3K8AA 3SHLA 2QA4A 1VMPA 2KCTA 2LSSA 2NVQH 3LNNA 3HOXH 5ELBA 4DUZQ 1SNOA 4JI2Q 4DAYB 1WTHA 3IRBA 4R1JA 2HHHL 1W6KA 2B2TC 3S1NB 1HH2P 4NXNQ 2HIVA 4LFCL 4LF5L 2XWBB 4C3JH 2A73B 3K59A 4MTNA 1IW7D 3CCVA 2MUYA 2RDGA 1MIUA 3CU7A 5EBCA 4XQQA 3QJYA 2QEXA 3H94A 5A2QL 5GROA 3HOUH 3A0JA 3A7AB 4KKUA 4JI7L 2EQSA 2KQ3A 4KMUC 1SSOA 4N8FA 4GKJL 1A6XA 1GHJA 2NVXH 1SBBB 3KF6A 4LWCA 4JC0A 5KEEA 3PO2G 2GVAA 2KOLA 1QB5D 2K33A 3M85A 2EJGC 2NBFA 2ASBA 1EY4A 2X69A 2WAQB 3P7JA 3HP3A 3C46A 1HHVA 1BCPD 2AKWB 3SGIA 5ELNA 1YNNC 4G57A 2KCNA 3TZUA 2CWPA 5BN3A 5A2QE 4N9PA 2C9OA 5HURA 5IY0A 3BYYB 4A3IH 4J6HA 1V1PB 2K4KA 3OTOL 1STGA 2KHJA 3L7ZC 3FKIB 3VYSA 1B7YB 1DCZA 4IPHA 2EYPA 3BDOA 5CMDA 1WTOA 2B63G 2BCOA 1CKMA 4JG2A 3J7AF 3PUZA 1LTBD 3NHHA 2UUBQ 4BXXH 1MHWC 2N55A 1EWIA 3KUPA 1ONLA 4FF2A 3DWPA 3MTSA 3GO5A 1IL2A 5IWAL 5D65A 1QWYA 5FKAC 3VR6A 3J80L 3CCMA 1I4XA 2F3VA 3MEFA 1BCPF 2Q2TA 3D6CA 3MFYA 2RF4A 4E6IA 1B3QA 1V1QA 3DEOA 1IBMQ 1A8VA 4JI4Q 1E22A 1R9TB 2E2JH 1UE7A 1ZYRD 4C3IH 4U68A 1SYDA 5C4XG 1EQVA 1D5ZC 3RZDB 1PTOB 2BE5C 1PYSB 1Y1VG 2GVBA 2NWGA 2AMCB 1KHIA 1YNND 2PZWA 3OHXC 1XMOQ 4ME3A 1VQIA 3CQZH 5C4ZA 3ND9A 4C1NK 2NTSA 3HKSA 4X64Q 4DV2L 1ZXTA 3WOEA 2IX1A 1EOTA 3CKIB 3J80E 1XPRA 1SYGA 5C3EB 1ENFA 2E74C 4DF7A 2PNHA 1Z6HA 1X54A 1RD9D 1WOCA 1RIPA 2BA0A 4H0LC 4OELB 3HS0C 3CCEA 5FO7B 1TWCB 5C4JH 2HIXA 1B3AA 4UP9A 3T53B 4ZKCB 1YIJA 1SNMA 4X62Q 4ABNA 3HOVH 1XNQL 4FXGC 3PO3H 3SXHA 1HTLD 1A2TA 1FVIA
chains in the Genus database with same CATH topology
1EUJA 1N34L 2WB1G 2N8NA 2OTJA 2QGQA 2Y0SE 4H02A 1L1OA 4IJHA 3CC7A 3J81c 3ULPA 2ZM6Q 2VQEL 1PH4A 4JI7Q 4BBSH 5C3EG 3S15H 4B3TQ 1KQSA 5HY6A 3EBEA 1X3GA 4JI2L 4HIDA 4ALPA 1I94L 4GN5A 4GLAC 4GKJQ 4IFDJ 4A3LH 1NJIC 4JI6Q 1I5FA 4A3DH 3A5UA 2KENA 1AE2A 4DK6C 3S17H 1G51A 4YY3Q 4BXXG 2ZJRA 1HZCA 1WI5A 2DUDA 4A3JG 1UE1A 3PUXA 4JCVE 4OX9Q 3HOYG 2NN6I 1Y1WH 3M7NA 5M3MG 2AWOA 4DV4Q 1Q7YC 2JK8A 1S3OA 2NZHA 3BZCA 1K3RA 4GOPA 1TWGH 1PFSA 1K8AC 4YHHQ 2VZAA 4P72A 4IOCA 1OXTA 2JA5G 4BY1G 3KDFA 2ZJQA 4JYAQ 2ZTDA 4DK3C 1QUQA 4DR4Q 5IT9c 1HNZQ 1GD7A 5E7NA 1XJVA 4A3CH 4AYBE 2N78A 4LF4L 1Q8KA 1V43A 4HJAA 3T1YL 1CSQA 4BY7H 2YV5A 4JI3L 1L1OC 3GTJH 1OXVA 1JJGA 3OTOQ 4PG3A 4JBJA 4APVA 3BZKA 3F8TA 1UE5A 2JEAI 3S16H 2CQOA 2GN5A 5K36G 3PGZA 1IBLQ 3GTQH 1W3SA 3VDYA 2NVTH 5LMUL 1N32L 3I2ZA 5LMNW 1N33L 2F4VQ 4OWWB 3L2PA 2MO0A 5HGQA 4LFBL 4PZ8A 1O7IA 2CFMA 5BR8Q 3K80C 1OTCA 1AE3A 2VUMH 5IP7H 4DV0Q 3H0GH 1IXRA 4GN4B 3HKZE 1YNXA 1FGUA 3W1BA 3UE1A 5C44H 2WB1E 5M5XH 4HIOA 3T1HL 1FJGQ 2Q2HA 4A3FH 4GOPC 5DLQE 2K75A 4RMFA 3RR5A 3Q8DA 3M3YH 3KJPA 5IWAQ 3F1ZA 3U4VA 2OWOA 1A62A 3UE0A 4DR3Q 4LF7L 1Q1EA 4DR1Q 1QZHA 4NXML 4DAMA 4JI8Q 1XNRL 3I4NG 4Y52H 1U0LA 2Y0SG 3AFQA 3I56A 2JA8H 1VQBA 3I4MH 3E0EA 2MO1A 3KLWA 4DUYL 2A8VA 1S40A 2UXBQ 4YWMA 1UEBA 1EQRA 3TEHB 2E5LL 1WCMH 1Z47A 2KHIA 3PCOB 5FJ8G 4A3KG 4A75A 3HFZB 4HIKA 1MJEA 4AH6A 2AWNA 2PQAA 5AJ3Q 3RN2A 4LF6L 3ERSX 3JAMi 1LTLA 5IYBG 3HOVG 5GAHC 4X66L 1YVCA 2VQFL 4AQYQ 1VQLA 4LF8L 2JA6G 1VQKA 2R7ZG 3PO3G 4A3MH 3PUWA 3F2CA 2VNUD 4DR2L 1YI2A 3NBHB 4IPDA 3UDIA 3S1QH 1N9WA 4GNXA 4KHPL 4QGUA 5LMNL 5IYDH 1SRUA 2MQHA 4R4CA 4PMWA 1A63A 4PZ7A 4BBSG 1X3FA 2I5HA 2ES2A 2WFWA 1X56A 4A4IA 1EOVA 2NN6G 3NEMA 3CAMA 1Q82C 4A3LG 4DV2Q 1VCIA 4A3DG 5JJIA 3BJUA 1EQQA 1VQ9A 3PUVA 1KRTA 1T9HA 1GVPA 4DNIA 3UDGA 1QZGA 3CCJA 3KF8B 4KLKA 4DV1L 3PIOA 4A3BH 4AYBG 4JBMA 4POGA 2YTVA 1E7ZA 1TXYA 4POFA 2UXDQ 2NVYH 3AFPA 4A3GH 4KHZA 1Y1WG 5IP9H 4GKKQ 2K5HA 1KAWA 3KF6B 1G291 1J5EL 3CD6A 3RLNA 1YJ9A 2I5MX 1PH5A 3S1MH 4X6AH 3GTGH 1YHBA 3PF5A 4GLXA 1U5KA 1KIXA 1P16A 2Q2UA 4LUOA 3PF4A 1FL0A 1YBYA 2BH8A 4X64L 4JI1Q 3S2DH 2RCNA 1HR0W 3M4PA 2CCZA 4P71A 4C2MH 2UUAQ 3KOJA 4B3RL 5JEAG 4A3CG 3ULJA 4LF5Q 1TWAH 3CMEA 4MNOA 2N49A 1XNQQ 4BY7G 5H1SE 1XMQL 4DV3L 1RL2A 1WFQA 4GN3B 1IBKL 1N34Q 1HNWL 3CC4A 2VL6A 1D8LA 1CUKA 2VQEQ 1MJCA 2IHEA 5JJLA 4DUZL 4IPCA 5IYCH 4B3SL 1YHQA 1Z9FA 1EIFA 1VQDA 2OQKA 3KYHC 1I94Q 1D7QA 1YZ6A 1X55A 2YTXA 1VQ4A 4XIGS 5GAEC 1M1KC 3TS2A 2VUMG 4A93H 3GTKH 2LXJA 4NXNL 5IP7G 3M4OH 3H0GG 4X62L 5C44G 4QQBX 3BU2A 3L0OA 2ALYB 3CCRA 3FP9A 4HIMA 2F52A 4JOIC 4A3FG 1K8GA 1C7YA 2IHFA 4UPAA 5JJKA 1EYGA 3J80i 4L5RC 1I3QH 4FDBA 1Q1BA 3ER0A 4J15A 2Q2IA 2PI2E 4DR5L 2VW9A 3AYHB 1VQGA 2EXDA 5FLMH 3TQYA 3G4SA 4HJ8A 1WJJA 4EX5A 3W5OA 3TS0A 2UUCL 2Z0SA 2JA8G 1HR0L 3I4MG 3M4QA 1VQPA 1VQAA 3G6EA 3T1YQ 2IY5B 1VQ7A 1WCMG 4JI3Q 4DR6L 3LGJA 2D0OA 5FLXc 3F2DA 4C3HH 2EIFA 4MZ9A 3CPFA 3DM3A 1PVOA 4IO9A 4A3MG 5GQOA 1HZ9A 5LMUQ 1HJPA 4A3EH 1N32Q 4LFAL 3W1GA 1QVFA 1N33Q 5JEAJ 2ID0A 1NE3A 2KCMA 5IYDG 3OW2A 4DV7L 4LFBQ 2BA1A 2XTIA 5C0XI 2D62A 4P75A 4QL5A 4A76A 1JE5A 1M90C 4UP8A 2OTLA 1K83H 4UY8C 2NZOA 3T1HQ 4JBKA 3B6YA 4L5QA 1H95A 1TWHH 3CW2C 3E9IA 3J81i 2JA7H 1PH9A 1L2FA 5J3BA 2ATWA 4A3BG 4LF7Q 1VQOA 1KXLA 1IZ6A 4NXMQ 4A3GG 4B3ML 5EAYA 5IP9G 4YCUA 4QY7A 2VY3A 1CKNA 3TRZA 4JI0Q 1OXXK 1I50H 4X65L 1Q86C 3CMAA 4K0KL 2R93H 1PV4A 4DUYQ 2UUBL 3PO2H 4JI5L 4YCWA 2E5LQ 4DPGA 1HNXL 1HZBA 4TVAB 3TREA 1KC8C 4LF6Q 2BH2A 3STBC 3S1NH 1JT8A 1N36L 4LF8Q 3GDEA 4X66Q 3K0XA 3J81j 4DR2Q 1CSPA 3PUYA 1X65A 5LMNQ 4HJ9A 1GO3E 2JJQA 5M3FH 4DV6Q 3UDFA 1IBML 1SFOH 4JI4L 3RNUA 2R92H 4O2DA 5IYCG 1NY4A 4DR7L 4DV5L 4DKAC 1N8RC 4LF9Q 4OXPA 4IPGA 1YJWA 1GKHA 1PYBA 3KJOA 5GADC 3PV0A 2HQLA 1L1OB 3CPWA 3G71A 2K14A 4A93G 2OQ0A 2ZTEA 4DV1Q 1I6HH 2E2IH 4HJ5A 2FXQA 3FHWA 2R7FA 1CKOA 4L5TA 2F3IA 3RLFA 2B63H 3HOZH 1TWFH 1J5EQ 3F2BA 1QVCA 1XMOL 4P74A 2UU9L 2CKZB 3AEVA 2CWAA 5FLMG 3HOWH 1VQHA 1VQ5A 1VQCA 2UXCL 3A5ZB 4JV5L 2I0QA 2JEBI 1SMXA 4B3RQ 3E9HA 1VQJA 4GOPB 2K5NA 4GNXC 1Q46A 1XMQQ 4WJ4A 4DV3Q 1PH6A 3KDFB 4OO1I 3K8AA 2QA4A 5C0XG 1IBKQ 1HNWQ 1QUQB 2KCTA 1XTDA 2LSSA 2NVQH 4L5SA 2YYZA 3WWVA 2LXKA 3HOXH 4BBRH 1LUZA 2MFIA 1VQ8A 2WAQE 1J6QA 4DUZQ 4BA2I 4B3SQ 1C9OA 3FKIH 3U4ZA 1BKBA 1Y14B 2K5VA 4JI2Q 3ZJYC 4A3EG 3S2HH 3K7AH 3STBD 4DAYB 3CXCA 3IRBA 4R1JA 1DGSA 1JMCA 1ASYA 2HHHL 4LUVA 4O0AA 3S1RH 2DGYA 1IYJB 1HH2P 3CP0A 4OONA 4QJFA 3UDXA 5C4XH 1XPOA 1VQMA 4NXNQ 2HIVA 4LFCL 4LF5L 1PHJA 1L0WA 4C3JH 3DLLA 4MTNA 3CCVA 2IT1A 2KBNA 1HZAA 3D31A 1MIUA 1Y1VH 2QEXA 2YU9H 4OX9L 3J7A5 2JA7G 1YHAA 2YTYA 1JB7A 1B70B 5GROA 3HOUH 3A0JA 1PH7A 1KD1C 1VQNA 2ZM6L 2RHQB 2EQSA 4JI7L 1E1OA 1Q12A 4DR5Q 4B3TL 4IJLA 4IFDI 2RHSB 3H3VH 1S72A 4JBWA 1SR3A 3M9BA 1EIYB 4GKJL 1UWVA 1QVGA 2L15A 4JI6L 2UUCQ 1XPUA 2NVXH 1HR0Q 3KF6A 4LWCA 2R93G 4LF4Q 4JC0A 3PO2G 2GVAA 5M5WH 4YY3L 2WP8J 1R9TH 4DR6Q 1BBUA 1NMFA 5IE8A 3H3VI 4AIMA 4HJ7A 1CKNB 1NTGA 3M85A 1ASZA 2E8GA 4DV4L 1PH2A 1X6OA 1MKHA 2PMZE 1KL9A 4OWTB 3RZDH 1PH8A 2XGTA 3G48A 1A0IA 3JAMc 2ASBA 1LM0A 1K0RA 4YHHL 1KRSA 2VS1A 4LFAQ 2AKWB 4YCVA 2MNAA 4JYAL 2A1AA 3AQQA 2PQAB 3SGIA 5M3FG 4DV7Q 5ELNA 4YWKA 1PH1A 4DR4L 1EFWA 2R92G 1LYLA 2B3GA 1HNZL 1C0AA 3PIPA 2CWPA 3EN2A 3I4OA 5C0XJ 3H15A 3CCSA 1X9NA 4GNXB 5IY0A 1E1TA 4A3IH 3I4NH 2K4KA 3OTOL 2KHJA 3L7ZC 1K9MC 1WYDA 2R6GA 3CF5A 3I55A 1OXSC 1IBLL 1B7YB 3NENA 5C3EH 4IPHA 4R4IA 4B3MQ 1JJ2A 2B63G 3HOZG 2F4VL 1OXUA 1VS0A 1XNRQ 4R4TA 1CKMA 4LW1A 5BR8L 4JG2A 4X65Q 4TQUS 4YWLA 1GM5A 1SROA 3PUZA 4XTCS 4K0KQ 2OCEA 1TWCH 3HOWG 2K52A 1E3PA 2WAQG 2ZJPA 4DV0L 3JC66 3GD7A 2UUBQ 4JI5Q 4BXXH 4OO1G 1EWIA 3ULLA 1HNXQ 1FJGL 3KFUA 4R4OA 4A3JH 3HOYH 3GO5A 1IL2A 1YEZA 5IWAL 5M3MH 1N36Q 2VQFQ 1V9PA 4DR3L 2R7DA 3U58A 2H5XA 3CCMA 4DR1L 3MEFA 4JI8L 3S14H 4KHPQ 2JE6I 3OYYA 2JA5H 2Q2TA 4BY1H 3HOXG 2RF4A 1JJCB 4BBRG 4JI0L 3GTOH 1V1QA 1IBMQ 4JI4Q 1A8VA 4P73A 1E22A 3FKIG 4DR7Q 2UXBL 3RN5A 4DV5Q 2E2JH 2D0PA 1YITA 1P8LA 1UE7A 4C3IH 3D0FA 1VQ6A 5AJ3L 5C4XG 1VQEA 2Z6KA 3A74A 2JQOA 2K50A 3GTLH 4AQYL 3GTPH 2V1CC 4IFDG 3K7UC 1PYSB 3CCLA 3CCUA 4GLVB 1YJNA 1Y1VG 2HT1A 2GVBA 2AMCB 1KHIA 1AH9A 4PZ6A 4R4QA 3HOUG 1Q81C 1XMOQ 3EIVA 4ME3A 4EQ5A 3GTMH 2UU9Q 4DV6L 1VQIA 3CQZH 3U50C 3J80c 2A19A 2N3SA 1BVSA 1NBWA 1PH3A 1G6PA 3RLOA 3CC2A 3HKSA 4X64Q 1W2BA 1B8AA 2PI2A 4DV2L 4LF9L 2UXCQ 4JV5Q 5GAGC 4LNQA 2IX1A 2C35B 3MXNB 5ELOA 4GS3A 3K81C 1XPRA 1UE6A 4IOAA 2IX0A 1E24A 4Y7NH 2E2HH 4WJ3M 2UXDL 1X3EA 2PNHA 3I7FA 3CCQA 2ZTCA 1SLJA 1X54A 3NELA 4GKKL 1SE8A 1WOCA 1RIPA 2BA0A 3ICEA 4JOIA 4BA1I 3CCEA 5C4JH 2HIXA 1SN8A 4KI0A 2Z6KC 1VQFA 4NPSA 2JA9A 2B29A 3J7ZC 4JI1L 1PA6A 4A3KH 4UP9A 5FJ8H 2HHHQ 1BBWA 4RG1A 4OWXB 3RZOH 1K73C 5M5YH 2UUAL 4LUZA 1YIJA 4NB3A 4UP7A 4QIWE 4X62Q 5IYBH 4LFCQ 3HOVH 2AHOB 2I5LX 3S24A 1XNQL 1NMGA 2JA6H 3PO3H 2R7ZH 4A3IG 3PSIA 1FVIA 3HKZG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EUJ A;  1N34 L;  2WB1 G;  2N8N A;  2OTJ A;  2QGQ A;  2Y0S E;  4H02 A;  1L1O A;  4IJH A;  3CC7 A;  3J81 c;  3ULP A;  2ZM6 Q;  2VQE L;  1PH4 A;  4JI7 Q;  4BBS H;  5C3E G;  3S15 H;  4B3T Q;  1KQS A;  5HY6 A;  3EBE A;  1X3G A;  4JI2 L;  4HID A;  4ALP A;  1I94 L;  4GN5 A;  4GLA C;  4GKJ Q;  4IFD J;  4A3L H;  1NJI C;  4JI6 Q;  1I5F A;  4A3D H;  3A5U A;  2KEN A;  1AE2 A;  4DK6 C;  3S17 H;  1G51 A;  4YY3 Q;  4BXX G;  2ZJR A;  1HZC A;  1WI5 A;  2DUD A;  4A3J G;  1UE1 A;  3PUX A;  4JCV E;  4OX9 Q;  3HOY G;  2NN6 I;  1Y1W H;  3M7N A;  5M3M G;  2AWO A;  4DV4 Q;  1Q7Y C;  2JK8 A;  1S3O A;  2NZH A;  3BZC A;  1K3R A;  4GOP A;  1TWG H;  1PFS A;  1K8A C;  4YHH Q;  2VZA A;  4P72 A;  4IOC A;  1OXT A;  2JA5 G;  4BY1 G;  3KDF A;  2ZJQ A;  4JYA Q;  2ZTD A;  4DK3 C;  1QUQ A;  4DR4 Q;  5IT9 c;  1HNZ Q;  1GD7 A;  5E7N A;  1XJV A;  4A3C H;  4AYB E;  2N78 A;  4LF4 L;  1Q8K A;  1V43 A;  4HJA A;  3T1Y L;  1CSQ A;  4BY7 H;  2YV5 A;  4JI3 L;  1L1O C;  3GTJ H;  1OXV A;  1JJG A;  3OTO Q;  4PG3 A;  4JBJ A;  4APV A;  3BZK A;  3F8T A;  1UE5 A;  2JEA I;  3S16 H;  2CQO A;  2GN5 A;  5K36 G;  3PGZ A;  1IBL Q;  3GTQ H;  1W3S A;  3VDY A;  2NVT H;  5LMU L;  1N32 L;  3I2Z A;  5LMN W;  1N33 L;  2F4V Q;  4OWW B;  3L2P A;  2MO0 A;  5HGQ A;  4LFB L;  4PZ8 A;  1O7I A;  2CFM A;  5BR8 Q;  3K80 C;  1OTC A;  1AE3 A;  2VUM H;  5IP7 H;  4DV0 Q;  3H0G H;  1IXR A;  4GN4 B;  3HKZ E;  1YNX A;  1FGU A;  3W1B A;  3UE1 A;  5C44 H;  2WB1 E;  5M5X H;  4HIO A;  3T1H L;  1FJG Q;  2Q2H A;  4A3F H;  4GOP C;  5DLQ E;  2K75 A;  4RMF A;  3RR5 A;  3Q8D A;  3M3Y H;  3KJP A;  5IWA Q;  3F1Z A;  3U4V A;  2OWO A;  1A62 A;  3UE0 A;  4DR3 Q;  4LF7 L;  1Q1E A;  4DR1 Q;  1QZH A;  4NXM L;  4DAM A;  4JI8 Q;  1XNR L;  3I4N G;  4Y52 H;  1U0L A;  2Y0S G;  3AFQ A;  3I56 A;  2JA8 H;  1VQB A;  3I4M H;  3E0E A;  2MO1 A;  3KLW A;  4DUY L;  2A8V A;  1S40 A;  2UXB Q;  4YWM A;  1UEB A;  1EQR A;  3TEH B;  2E5L L;  1WCM H;  1Z47 A;  2KHI A;  3PCO B;  5FJ8 G;  4A3K G;  4A75 A;  3HFZ B;  4HIK A;  1MJE A;  4AH6 A;  2AWN A;  2PQA A;  5AJ3 Q;  3RN2 A;  4LF6 L;  3ERS X;  3JAM i;  1LTL A;  5IYB G;  3HOV G;  5GAH C;  4X66 L;  1YVC A;  2VQF L;  4AQY Q;  1VQL A;  4LF8 L;  2JA6 G;  1VQK A;  2R7Z G;  3PO3 G;  4A3M H;  3PUW A;  3F2C A;  2VNU D;  4DR2 L;  1YI2 A;  3NBH B;  4IPD A;  3UDI A;  3S1Q H;  1N9W A;  4GNX A;  4KHP L;  4QGU A;  5LMN L;  5IYD H;  1SRU A;  2MQH A;  4R4C A;  4PMW A;  1A63 A;  4PZ7 A;  4BBS G;  1X3F A;  2I5H A;  2ES2 A;  2WFW A;  1X56 A;  4A4I A;  1EOV A;  2NN6 G;  3NEM A;  3CAM A;  1Q82 C;  4A3L G;  4DV2 Q;  1VCI A;  4A3D G;  5JJI A;  3BJU A;  1EQQ A;  1VQ9 A;  3PUV A;  1KRT A;  1T9H A;  1GVP A;  4DNI A;  3UDG A;  1QZG A;  3CCJ A;  3KF8 B;  4KLK A;  4DV1 L;  3PIO A;  4A3B H;  4AYB G;  4JBM A;  4POG A;  2YTV A;  1E7Z A;  1TXY A;  4POF A;  2UXD Q;  2NVY H;  3AFP A;  4A3G H;  4KHZ A;  1Y1W G;  5IP9 H;  4GKK Q;  2K5H A;  1KAW A;  3KF6 B;  1G29 1;  1J5E L;  3CD6 A;  3RLN A;  1YJ9 A;  2I5M X;  1PH5 A;  3S1M H;  4X6A H;  3GTG H;  1YHB A;  3PF5 A;  4GLX A;  1U5K A;  1KIX A;  1P16 A;  2Q2U A;  4LUO A;  3PF4 A;  1FL0 A;  1YBY A;  2BH8 A;  4X64 L;  4JI1 Q;  3S2D H;  2RCN A;  1HR0 W;  3M4P A;  2CCZ A;  4P71 A;  4C2M H;  2UUA Q;  3KOJ A;  4B3R L;  5JEA G;  4A3C G;  3ULJ A;  4LF5 Q;  1TWA H;  3CME A;  4MNO A;  2N49 A;  1XNQ Q;  4BY7 G;  5H1S E;  1XMQ L;  4DV3 L;  1RL2 A;  1WFQ A;  4GN3 B;  1IBK L;  1N34 Q;  1HNW L;  3CC4 A;  2VL6 A;  1D8L A;  1CUK A;  2VQE Q;  1MJC A;  2IHE A;  5JJL A;  4DUZ L;  4IPC A;  5IYC H;  4B3S L;  1YHQ A;  1Z9F A;  1EIF A;  1VQD A;  2OQK A;  3KYH C;  1I94 Q;  1D7Q A;  1YZ6 A;  1X55 A;  2YTX A;  1VQ4 A;  4XIG S;  5GAE C;  1M1K C;  3TS2 A;  2VUM G;  4A93 H;  3GTK H;  2LXJ A;  4NXN L;  5IP7 G;  3M4O H;  3H0G G;  4X62 L;  5C44 G;  4QQB X;  3BU2 A;  3L0O A;  2ALY B;  3CCR A;  3FP9 A;  4HIM A;  2F52 A;  4JOI C;  4A3F G;  1K8G A;  1C7Y A;  2IHF A;  4UPA A;  5JJK A;  1EYG A;  3J80 i;  4L5R C;  1I3Q H;  4FDB A;  1Q1B A;  3ER0 A;  4J15 A;  2Q2I A;  2PI2 E;  4DR5 L;  2VW9 A;  3AYH B;  1VQG A;  2EXD A;  5FLM H;  3TQY A;  3G4S A;  4HJ8 A;  1WJJ A;  4EX5 A;  3W5O A;  3TS0 A;  2UUC L;  2Z0S A;  2JA8 G;  1HR0 L;  3I4M G;  3M4Q A;  1VQP A;  1VQA A;  3G6E A;  3T1Y Q;  2IY5 B;  1VQ7 A;  1WCM G;  4JI3 Q;  4DR6 L;  3LGJ A;  2D0O A;  5FLX c;  3F2D A;  4C3H H;  2EIF A;  4MZ9 A;  3CPF A;  3DM3 A;  1PVO A;  4IO9 A;  4A3M G;  5GQO A;  1HZ9 A;  5LMU Q;  1HJP A;  4A3E H;  1N32 Q;  4LFA L;  3W1G A;  1QVF A;  1N33 Q;  5JEA J;  2ID0 A;  1NE3 A;  2KCM A;  5IYD G;  3OW2 A;  4DV7 L;  4LFB Q;  2BA1 A;  2XTI A;  5C0X I;  2D62 A;  4P75 A;  4QL5 A;  4A76 A;  1JE5 A;  1M90 C;  4UP8 A;  2OTL A;  1K83 H;  4UY8 C;  2NZO A;  3T1H Q;  4JBK A;  3B6Y A;  4L5Q A;  1H95 A;  1TWH H;  3CW2 C;  3E9I A;  3J81 i;  2JA7 H;  1PH9 A;  1L2F A;  5J3B A;  2ATW A;  4A3B G;  4LF7 Q;  1VQO A;  1KXL A;  1IZ6 A;  4NXM Q;  4A3G G;  4B3M L;  5EAY A;  5IP9 G;  4YCU A;  4QY7 A;  2VY3 A;  1CKN A;  3TRZ A;  4JI0 Q;  1OXX K;  1I50 H;  4X65 L;  1Q86 C;  3CMA A;  4K0K L;  2R93 H;  1PV4 A;  4DUY Q;  2UUB L;  3PO2 H;  4JI5 L;  4YCW A;  2E5L Q;  4DPG A;  1HNX L;  1HZB A;  4TVA B;  3TRE A;  1KC8 C;  4LF6 Q;  2BH2 A;  3STB C;  3S1N H;  1JT8 A;  1N36 L;  4LF8 Q;  3GDE A;  4X66 Q;  3K0X A;  3J81 j;  4DR2 Q;  1CSP A;  3PUY A;  1X65 A;  5LMN Q;  4HJ9 A;  1GO3 E;  2JJQ A;  5M3F H;  4DV6 Q;  3UDF A;  1IBM L;  1SFO H;  4JI4 L;  3RNU A;  2R92 H;  4O2D A;  5IYC G;  1NY4 A;  4DR7 L;  4DV5 L;  4DKA C;  1N8R C;  4LF9 Q;  4OXP A;  4IPG A;  1YJW A;  1GKH A;  1PYB A;  3KJO A;  5GAD C;  3PV0 A;  2HQL A;  1L1O B;  3CPW A;  3G71 A;  2K14 A;  4A93 G;  2OQ0 A;  2ZTE A;  4DV1 Q;  1I6H H;  2E2I H;  4HJ5 A;  2FXQ A;  3FHW A;  2R7F A;  1CKO A;  4L5T A;  2F3I A;  3RLF A;  2B63 H;  3HOZ H;  1TWF H;  1J5E Q;  3F2B A;  1QVC A;  1XMO L;  4P74 A;  2UU9 L;  2CKZ B;  3AEV A;  2CWA A;  5FLM G;  3HOW H;  1VQH A;  1VQ5 A;  1VQC A;  2UXC L;  3A5Z B;  4JV5 L;  2I0Q A;  2JEB I;  1SMX A;  4B3R Q;  3E9H A;  1VQJ A;  4GOP B;  2K5N A;  4GNX C;  1Q46 A;  1XMQ Q;  4WJ4 A;  4DV3 Q;  1PH6 A;  3KDF B;  4OO1 I;  3K8A A;  2QA4 A;  5C0X G;  1IBK Q;  1HNW Q;  1QUQ B;  2KCT A;  1XTD A;  2LSS A;  2NVQ H;  4L5S A;  2YYZ A;  3WWV A;  2LXK A;  3HOX H;  4BBR H;  1LUZ A;  2MFI A;  1VQ8 A;  2WAQ E;  1J6Q A;  4DUZ Q;  4BA2 I;  4B3S Q;  1C9O A;  3FKI H;  3U4Z A;  1BKB A;  1Y14 B;  2K5V A;  4JI2 Q;  3ZJY C;  4A3E G;  3S2H H;  3K7A H;  3STB D;  4DAY B;  3CXC A;  3IRB A;  4R1J A;  1DGS A;  1JMC A;  1ASY A;  2HHH L;  4LUV A;  4O0A A;  3S1R H;  2DGY A;  1IYJ B;  1HH2 P;  3CP0 A;  4OON A;  4QJF A;  3UDX A;  5C4X H;  1XPO A;  1VQM A;  4NXN Q;  2HIV A;  4LFC L;  4LF5 L;  1PHJ A;  1L0W A;  4C3J H;  3DLL A;  4MTN A;  3CCV A;  2IT1 A;  2KBN A;  1HZA A;  3D31 A;  1MIU A;  1Y1V H;  2QEX A;  2YU9 H;  4OX9 L;  3J7A 5;  2JA7 G;  1YHA A;  2YTY A;  1JB7 A;  1B70 B;  5GRO A;  3HOU H;  3A0J A;  1PH7 A;  1KD1 C;  1VQN A;  2ZM6 L;  2RHQ B;  2EQS A;  4JI7 L;  1E1O A;  1Q12 A;  4DR5 Q;  4B3T L;  4IJL A;  4IFD I;  2RHS B;  3H3V H;  1S72 A;  4JBW A;  1SR3 A;  3M9B A;  1EIY B;  4GKJ L;  1UWV A;  1QVG A;  2L15 A;  4JI6 L;  2UUC Q;  1XPU A;  2NVX H;  1HR0 Q;  3KF6 A;  4LWC A;  2R93 G;  4LF4 Q;  4JC0 A;  3PO2 G;  2GVA A;  5M5W H;  4YY3 L;  2WP8 J;  1R9T H;  4DR6 Q;  1BBU A;  1NMF A;  5IE8 A;  3H3V I;  4AIM A;  4HJ7 A;  1CKN B;  1NTG A;  3M85 A;  1ASZ A;  2E8G A;  4DV4 L;  1PH2 A;  1X6O A;  1MKH A;  2PMZ E;  1KL9 A;  4OWT B;  3RZD H;  1PH8 A;  2XGT A;  3G48 A;  1A0I A;  3JAM c;  2ASB A;  1LM0 A;  1K0R A;  4YHH L;  1KRS A;  2VS1 A;  4LFA Q;  2AKW B;  4YCV A;  2MNA A;  4JYA L;  2A1A A;  3AQQ A;  2PQA B;  3SGI A;  5M3F G;  4DV7 Q;  5ELN A;  4YWK A;  1PH1 A;  4DR4 L;  1EFW A;  2R92 G;  1LYL A;  2B3G A;  1HNZ L;  1C0A A;  3PIP A;  2CWP A;  3EN2 A;  3I4O A;  5C0X J;  3H15 A;  3CCS A;  1X9N A;  4GNX B;  5IY0 A;  1E1T A;  4A3I H;  3I4N H;  2K4K A;  3OTO L;  2KHJ A;  3L7Z C;  1K9M C;  1WYD A;  2R6G A;  3CF5 A;  3I55 A;  1OXS C;  1IBL L;  1B7Y B;  3NEN A;  5C3E H;  4IPH A;  4R4I A;  4B3M Q;  1JJ2 A;  2B63 G;  3HOZ G;  2F4V L;  1OXU A;  1VS0 A;  1XNR Q;  4R4T A;  1CKM A;  4LW1 A;  5BR8 L;  4JG2 A;  4X65 Q;  4TQU S;  4YWL A;  1GM5 A;  1SRO A;  3PUZ A;  4XTC S;  4K0K Q;  2OCE A;  1TWC H;  3HOW G;  2K52 A;  1E3P A;  2WAQ G;  2ZJP A;  4DV0 L;  3JC6 6;  3GD7 A;  2UUB Q;  4JI5 Q;  4BXX H;  4OO1 G;  1EWI A;  3ULL A;  1HNX Q;  1FJG L;  3KFU A;  4R4O A;  4A3J H;  3HOY H;  3GO5 A;  1IL2 A;  1YEZ A;  5IWA L;  5M3M H;  1N36 Q;  2VQF Q;  1V9P A;  4DR3 L;  2R7D A;  3U58 A;  2H5X A;  3CCM A;  4DR1 L;  3MEF A;  4JI8 L;  3S14 H;  4KHP Q;  2JE6 I;  3OYY A;  2JA5 H;  2Q2T A;  4BY1 H;  3HOX G;  2RF4 A;  1JJC B;  4BBR G;  4JI0 L;  3GTO H;  1V1Q A;  1IBM Q;  4JI4 Q;  1A8V A;  4P73 A;  1E22 A;  3FKI G;  4DR7 Q;  2UXB L;  3RN5 A;  4DV5 Q;  2E2J H;  2D0P A;  1YIT A;  1P8L A;  1UE7 A;  4C3I H;  3D0F A;  1VQ6 A;  5AJ3 L;  5C4X G;  1VQE A;  2Z6K A;  3A74 A;  2JQO A;  2K50 A;  3GTL H;  4AQY L;  3GTP H;  2V1C C;  4IFD G;  3K7U C;  1PYS B;  3CCL A;  3CCU A;  4GLV B;  1YJN A;  1Y1V G;  2HT1 A;  2GVB A;  2AMC B;  1KHI A;  1AH9 A;  4PZ6 A;  4R4Q A;  3HOU G;  1Q81 C;  1XMO Q;  3EIV A;  4ME3 A;  4EQ5 A;  3GTM H;  2UU9 Q;  4DV6 L;  1VQI A;  3CQZ H;  3U50 C;  3J80 c;  2A19 A;  2N3S A;  1BVS A;  1NBW A;  1PH3 A;  1G6P A;  3RLO A;  3CC2 A;  3HKS A;  4X64 Q;  1W2B A;  1B8A A;  2PI2 A;  4DV2 L;  4LF9 L;  2UXC Q;  4JV5 Q;  5GAG C;  4LNQ A;  2IX1 A;  2C35 B;  3MXN B;  5ELO A;  4GS3 A;  3K81 C;  1XPR A;  1UE6 A;  4IOA A;  2IX0 A;  1E24 A;  4Y7N H;  2E2H H;  4WJ3 M;  2UXD L;  1X3E A;  2PNH A;  3I7F A;  3CCQ A;  2ZTC A;  1SLJ A;  1X54 A;  3NEL A;  4GKK L;  1SE8 A;  1WOC A;  1RIP A;  2BA0 A;  3ICE A;  4JOI A;  4BA1 I;  3CCE A;  5C4J H;  2HIX A;  1SN8 A;  4KI0 A;  2Z6K C;  1VQF A;  4NPS A;  2JA9 A;  2B29 A;  3J7Z C;  4JI1 L;  1PA6 A;  4A3K H;  4UP9 A;  5FJ8 H;  2HHH Q;  1BBW A;  4RG1 A;  4OWX B;  3RZO H;  1K73 C;  5M5Y H;  2UUA L;  4LUZ A;  1YIJ A;  4NB3 A;  4UP7 A;  4QIW E;  4X62 Q;  5IYB H;  4LFC Q;  3HOV H;  2AHO B;  2I5L X;  3S24 A;  1XNQ L;  1NMG A;  2JA6 H;  3PO3 H;  2R7Z H;  4A3I G;  3PSI A;  1FVI A;  3HKZ G; 
#chains in the Genus database with same CATH topology
 1N34 L;  1EY0 A;  1TU2 B;  1CFM A;  2OTJ A;  4ZUJ A;  2F1M A;  4B9X A;  3J81 c;  1STH A;  2VQE L;  1PH4 A;  3IAY A;  5IT9 L;  1S5E D;  2CH4 A;  5HY6 A;  3OW7 A;  1X3G A;  4ALP A;  2BE5 D;  1SEB D;  3GTP B;  1AE2 A;  4DK6 C;  3NQI A;  2F0G A;  4YY3 Q;  1MGS A;  2K32 A;  2ZJR A;  4KHV A;  3HOY G;  1DZ1 A;  5KRU A;  3WOF A;  2AWO A;  2NZH A;  4P72 A;  2DJG C;  4RGN A;  2JA5 G;  5EKL A;  3NWT A;  3AB9 A;  5I9O A;  3K5N A;  4LAA A;  1HNZ Q;  3TBI B;  1GD7 A;  4LF4 L;  1Q8K A;  1V43 A;  4HJA A;  1VDZ A;  1EQT A;  4JI3 L;  2KED A;  5IT9 E;  5DEH A;  4PG3 A;  3J7Y W;  3OOC A;  1K8M A;  4RKB A;  5HGT A;  2Y0S B;  1CHP D;  3PGZ A;  1IBL Q;  3GTQ H;  5LMU L;  1STE A;  2IJ0 A;  5JVH 3;  2F0N A;  4OWW B;  2QCP X;  4LFB L;  1T5E A;  2ZXR A;  1D5M C;  1G2S A;  1PRT C;  1EEF D;  1QNK A;  3H0G H;  4GN4 B;  3W1B A;  4A76 A;  2R7Z B;  3T4A C;  5I2X A;  3UE1 A;  2Q2H A;  1F9Q A;  4RMF A;  3BVZ A;  4N9T A;  4RGO S;  3KJP A;  2B8G A;  3F1Z A;  4R8N A;  4DR3 Q;  3S15 B;  4FXD A;  4JK1 C;  1MSG A;  1TS3 A;  2VB3 X;  1WD0 A;  3AFQ A;  5M5W B;  1EY6 A;  1S40 A;  3NBI A;  1EQR A;  3TEH B;  2KHI A;  4A3K G;  1MJE A;  1Y1W B;  2RQX A;  2PQA A;  4LF6 L;  5IGB A;  1U4M A;  1D1I A;  4AQY Q;  1GUG A;  2JA6 G;  4A3M H;  5EPL A;  3F2C A;  2A6E C;  3CHB D;  3UDI A;  1N9W A;  4QGU A;  4FVM A;  5IYD H;  1SRU A;  2MQH A;  4IUN A;  4R4C A;  1A63 A;  4O1N A;  2I5H A;  2ES2 A;  1G6Z A;  1PXU A;  1VF5 C;  4DAV A;  1Q82 C;  4A3L G;  5EPJ A;  4A3D G;  5JJI A;  3BJU A;  3PUV A;  1KRT A;  3R2T A;  1STN A;  1G2T A;  1SYC A;  1PFM A;  3D8G A;  1TY0 A;  1BNZ A;  2YTV A;  1TXY A;  3NTK A;  1PRT D;  3H09 A;  4KHZ A;  5IGC A;  4GKK Q;  1LO5 D;  1KAW A;  2G9H D;  2K5H A;  3CD6 A;  1S5C D;  4PMB A;  1RHP A;  4GLX A;  2Q2U A;  3KBG A;  1JWU D;  5ELC A;  5M5X B;  1YBY A;  3S2D H;  4ODG A;  3M3Y B;  2UUA Q;  2EJF C;  1BUV T;  4A3C G;  2M2L A;  5H1S E;  1XMQ L;  2B8F A;  4GN3 B;  3NQT A;  1CUK A;  2JA8 B;  2IHE A;  3DHQ A;  4M1U B;  3G7L A;  1W6J A;  3NTH A;  5FLX L;  4RHS A;  1X55 A;  3GTK H;  2LXJ A;  5C3W A;  1X3P A;  2A6E D;  3A8J E;  5C44 G;  4QQB X;  3BU2 A;  2ALY B;  3FP9 A;  5FOB B;  2F52 A;  3S1Q B;  1U9R A;  4CDF C;  4DXF A;  1PRT F;  1EYG A;  3GTM B;  1JC7 A;  5J39 A;  1DOL A;  1Q1B A;  4HSP A;  3D6W A;  3AYH B;  5JOB A;  4RAU C;  1VQG A;  2EXD A;  5FLM H;  3LWU A;  1EYD A;  4HJ8 A;  2IPK D;  2E76 C;  1HR0 L;  4JW0 A;  2Z6B A;  1TVX A;  3I4M G;  3T1Y Q;  2IY5 B;  1WCM G;  2ENB A;  4PMC A;  4DR6 L;  3F2D A;  5L37 A;  5C0X H;  3CRL C;  3ITP A;  1R4Q B;  5GQO A;  1JOK A;  3HG9 A;  1ICW A;  5COY A;  3W1G A;  3Q24 A;  1NE3 A;  3OW2 A;  3C2P A;  2R3Z A;  4UY8 C;  3B6Y A;  3J81 i;  1LT4 D;  3MHB A;  4RA8 A;  1PH9 A;  4YIJ A;  3K6O A;  2KCC A;  1L2F A;  2L1B A;  4DXG A;  4BBS B;  2F0P A;  4LF7 Q;  3ONA B;  1IZ6 A;  4IUQ A;  4S3S A;  3R3O A;  5EAY A;  1CKN A;  4A93 B;  3CRK C;  4X65 L;  3CMA A;  1M4V A;  3IFT A;  1Y8P B;  1HNX L;  1CI3 M;  2KEC A;  4TVA B;  3TRE A;  2HQE A;  4IUP A;  3STB C;  1I3Q B;  1LAC A;  2R61 A;  1JT8 A;  1N36 L;  1FNV A;  1SNQ A;  4HSV A;  2RVL A;  3MXP A;  4DR2 Q;  2XIW A;  1V1O A;  5M3F H;  2WKC A;  5LL6 X;  3SK5 A;  1YJW A;  1PYB A;  3KJO A;  2A6H C;  5GAD C;  2HQL A;  1L1O B;  2J0T D;  2K01 A;  2SOB A;  3MEH A;  2HDM A;  3T56 B;  4HJ5 A;  4KY5 A;  4HED A;  4G7Z C;  3SK4 A;  3HOZ H;  1QVC A;  3W2D A;  4Q0F A;  4OO1 H;  4CHT B;  3K0Y A;  1VQ5 A;  3A5Z B;  5JVG 3;  4WFN 3;  3BDL A;  2Z4I A;  1E2V A;  2PZT A;  4C3H G;  2HCC A;  3KDF B;  3TZD A;  1PH6 A;  1L0X B;  1IBK Q;  1EL0 A;  1QUQ B;  2WV6 D;  4BBR H;  1VQ8 A;  1J6Q A;  1NUC A;  4B3S Q;  1C9O A;  1L0Y B;  3PO2 B;  1BKB A;  3S2H H;  4QB4 A;  2QF7 A;  3K7A H;  3STB D;  3NBH A;  1ASY A;  3SDZ A;  4O0A A;  2DGY A;  1EEI D;  3NUC A;  1BXT A;  1B9M A;  3ERQ A;  2Z8L A;  2IT1 A;  1NR2 A;  4NP5 A;  2YU9 H;  3IL8 A;  1QE6 A;  3LX0 A;  4OX9 L;  2E75 C;  1B70 B;  1CQF A;  4DAP A;  1DOM A;  3TP8 A;  1VQN A;  3H3V C;  2MGS A;  3KF8 A;  4DR5 Q;  1Q12 A;  4B3T L;  4IJL A;  2RHS B;  3H3V H;  1S72 A;  4JBW A;  1B53 A;  1EIY B;  1FGB D;  1JR0 D;  2UUC Q;  2M00 A;  4RWS C;  3J81 E;  2A74 C;  1STB A;  2R93 G;  3PIO 3;  2EYJ A;  2B39 A;  5M5W H;  2EE1 A;  1NMF A;  2KJX A;  3L3O C;  2B63 B;  1CKN B;  1TWF B;  4DV4 L;  1PH2 A;  2PMZ E;  4OWT B;  2XGT A;  3JAM c;  4YHH L;  4ILW A;  2F0O A;  2L5T A;  2NZ1 D;  2MNA A;  1RJT A;  4DV7 Q;  4K8J A;  4YWK A;  1C48 A;  2R92 G;  1LYL A;  2B3G A;  1JOO A;  3H15 A;  1BOS A;  2SDF A;  4GNX B;  4NKL A;  4DK1 A;  3I4N H;  2OF1 A;  2PW7 A;  1DM0 B;  1LTT D;  1K9M C;  2R6G A;  5D3D A;  5EPK A;  3DM1 A;  4R4I A;  2F4V L;  1XNR Q;  3NXW A;  5NUC A;  1S5D D;  4ZUI A;  3S1R B;  4TQU S;  5C4X B;  2OCE A;  3HOW G;  4DV0 L;  3JC6 6;  4JI5 Q;  1Y1V B;  3ULL A;  1FJG L;  3KFU A;  4R4O A;  1X3Q A;  5M3M H;  2VQF Q;  2MP1 A;  2H5X A;  3U58 A;  5BN5 A;  4KN7 C;  4KHP Q;  3OYY A;  3HOX G;  1JJC B;  3FPU B;  2QDL A;  5ELE A;  5CBA E;  2UXB L;  4UHV A;  1YIT A;  3D0F A;  3FPP A;  4ZRZ A;  1EY7 A;  3I91 A;  1ZKO A;  3MFG A;  4QUF A;  3CCL A;  1D6E C;  2EDG A;  4GLV B;  5K36 H;  2RCF A;  1F2Z A;  4NW2 A;  4R4Q A;  3HOU G;  2XRS D;  3GTM H;  4K2K A;  4DV6 L;  3U50 C;  2A19 A;  1CA5 A;  3RLO A;  3CC2 A;  1D2B A;  1A15 A;  1EWH A;  4LF9 L;  2UXC Q;  2JYO A;  4LNQ A;  1KLU D;  2C35 B;  1E2W A;  2AUJ D;  1E24 A;  2E2H H;  2UXD L;  5J22 A;  5A35 A;  1X3E A;  4CKE A;  1SLJ A;  1SE8 A;  1B4O A;  2Z6K C;  1VQF A;  5E3F A;  2JA9 A;  4RGM A;  3J7Z C;  4JI1 L;  5FJ8 H;  5LHY 1;  2HHH Q;  1BBW A;  1KDA A;  1MBY A;  4RG1 A;  3RZO H;  5M5Y H;  2BDN A;  3HOY B;  3VYT A;  4LFC Q;  2AHO B;  2DY8 A;  2QKI C;  4A3I G;  3HKZ G;  1EUJ A;  2JA5 B;  1HUM A;  2WB1 G;  4B9W A;  2QGQ A;  1HCZ A;  3CC7 A;  4IJH A;  3MXU A;  3GTO B;  4JI7 Q;  1JB3 A;  1KTK A;  2EY2 A;  2SNM A;  4BBS H;  2NTT A;  5EKI A;  4JI2 L;  4HID A;  1I94 L;  3QOL A;  2NN6 H;  4GKJ Q;  3F2U A;  3GTL B;  2E2I B;  4BXX G;  3TN2 A;  1HZC A;  4KKS A;  4HN7 A;  1UE1 A;  3PUX A;  2D5D A;  3M7N A;  1ZYR C;  5CV8 A;  1XWE A;  2B2U C;  3BZC A;  4GOP A;  1E2Z A;  1PFS A;  2K05 A;  2ZXP A;  1BO0 A;  2N88 A;  2ZTD A;  1H9S A;  1JOR A;  5E7N A;  2J7Z A;  2KVM A;  1KNA A;  4UDU C;  2L12 A;  1GUT A;  4Y7N B;  3J7A V;  4BY7 H;  1L1O C;  1GUS A;  4C3I G;  3GTJ H;  1C4Q A;  3OTO Q;  4JBJ A;  2K6A A;  1UE5 A;  2XN9 C;  4H13 C;  3VDY A;  2VB2 X;  4A3K B;  3L2P A;  1LAB A;  2JP1 A;  1QJO A;  3K80 C;  5KNB A;  2VUM H;  3C1F A;  2JA6 B;  2JXM B;  1YNX A;  1FGU A;  2L11 A;  4HIO A;  3OMG A;  2D9U A;  3E0J A;  1JQY D;  4A3F H;  1HA6 A;  2K75 A;  2RBM A;  3RR5 A;  3Q8D A;  4LJZ C;  5IWA Q;  1U4R A;  1A62 A;  4IUV A;  1Q1E A;  4NXM L;  4A3D B;  1KAB A;  1JWS D;  3PQI A;  4Y52 H;  3NSW A;  3S17 B;  4DUY L;  2CW0 C;  3PCO B;  3QB3 A;  3X3N A;  2AWN A;  3RN2 A;  3JAM i;  1LTL A;  3HOV G;  4LF8 L;  1YVC A;  1TWG B;  3PO3 G;  1VQK A;  2AQ3 B;  1YI2 A;  1NAP A;  4PZ7 A;  2ZT9 C;  3NE5 B;  1X3F A;  3H91 A;  2K1B A;  2L9H A;  1EOV A;  3P1H A;  2O4X A;  4DV2 Q;  1VCI A;  5C5M A;  1EQQ A;  4DNI A;  5ELD A;  3S16 B;  1GHK A;  4A3B H;  4FP5 D;  4JBM A;  2NVT B;  2OEO A;  1PMR A;  4F88 A;  2NVY H;  1WTW A;  4A3G H;  5IP9 H;  4Z9C B;  3KF6 B;  4IQZ A;  4X6A H;  1YHB A;  3PF5 A;  1P16 A;  3PF4 A;  5C44 B;  1FL0 A;  4X64 L;  4A3J B;  1HR0 W;  2CCZ A;  4KJN A;  4C2M H;  2XWJ B;  1XNQ Q;  2EYM A;  4DV3 L;  2L55 A;  2L4N A;  1HNW L;  1N34 Q;  4EQO A;  4BY1 B;  1AZQ A;  1D8L A;  2VQE Q;  2CW0 D;  2K5W A;  3I4M B;  5IYC H;  1RF2 D;  1VQD A;  1AEX A;  1WCM B;  5IIF A;  1YZ6 A;  1F2Y A;  5GAE C;  1M1K C;  1SYE A;  3OSO A;  3H0G G;  4X62 L;  4OHJ A;  4JOI C;  2LMC B;  4K8I A;  4LMQ D;  4L5R C;  1PFB A;  1UNS A;  1I4G A;  3MXN A;  2EPB A;  2LKV A;  1WJJ A;  1OO9 B;  4PNY A;  1EYC A;  5CGK A;  4JI3 Q;  3LGJ A;  2D0O A;  4M8A A;  4ZK9 B;  4IUR A;  3S1M B;  3GTG B;  4A3M G;  1LTS D;  5IGD A;  1ENA A;  2Q8T A;  1LT3 D;  5LMU Q;  4A3E H;  4LFA L;  2WKD A;  5M9O A;  5IYD G;  4LFB Q;  5C0X I;  2D62 A;  3JAM E;  1TWA B;  2EYO A;  4NDX A;  2BOS A;  2NZO A;  2B2Y C;  4IN3 A;  3CW2 C;  5KIX A;  2JA7 H;  4O42 A;  1KXL A;  3EA6 A;  2X6G A;  4B3M L;  2LS0 1;  1CHQ D;  4P2C B;  4JI0 Q;  1OXX K;  2F0Q A;  1M8A A;  3M4O B;  4K0K L;  1ILQ A;  1K28 A;  5KYL A;  5I4D A;  2FIN B;  4LF6 Q;  3S1N H;  5T1G A;  1EZ6 A;  2K7V A;  3J81 j;  3PUY A;  1CSP A;  2RSO A;  4CDC C;  1GO3 E;  3UDF A;  3RNU A;  2B2V C;  5G3L D;  4DR7 L;  4H44 C;  4DV5 L;  4DKA C;  4OXP A;  1X32 A;  4C3H B;  5IOC A;  5IOD A;  2K14 A;  2F0J A;  2I46 A;  4HMJ A;  2B2T A;  2E2I H;  1WTR A;  5FO8 B;  3L9A X;  4L5T A;  4CKB A;  2F3I A;  4WOR A;  3F2B A;  2UU9 L;  1C8C A;  3R93 A;  1K83 B;  5FLM G;  3VR5 A;  1TKW B;  1O80 A;  2F4I A;  2TSS A;  3A55 A;  4XYO A;  3TSS A;  4JV5 L;  4QCL A;  2I0Q A;  3MC0 B;  1KNE A;  1SMX A;  1TS4 A;  3E9H A;  4QF4 A;  4L6T B;  3OWE B;  1XMQ Q;  4WJ4 A;  1RCV D;  4IAL A;  4OO1 I;  1BQQ T;  5CV4 A;  5C0X G;  1XTD A;  4L5S A;  5EBD A;  1DYQ A;  1I50 B;  2LXK A;  4FNF A;  1LUZ A;  4RGT A;  3U9S A;  2R93 B;  5G3L F;  3FKI H;  3MVV A;  4EQP A;  4IZ8 A;  3ZJY C;  1AW7 A;  2EZV A;  4TRD A;  4LUV A;  1IYJ B;  3PMF A;  4DA2 A;  3UDX A;  4OON A;  1IL8 A;  1XPO A;  1VQM A;  4IFD H;  4KK7 A;  1L0W A;  2KBN A;  1F2L A;  3J7A 5;  3I72 A;  3FDT A;  2YTY A;  3O13 A;  1KD1 C;  2ZM6 L;  3DWA A;  1SFO B;  1A2U A;  5CR3 A;  1E1O A;  3P75 A;  2F0L A;  3M9B A;  4K14 A;  1UWV A;  1QVG A;  2L15 A;  4JI6 L;  1HR0 Q;  1I6H B;  2HDL A;  5CV5 A;  1CTM A;  1FD7 D;  1F9R A;  2RDF A;  4I7A A;  1R9T H;  4DR6 Q;  1SE3 A;  3H3V I;  4HJ7 A;  5C4H A;  1PTO C;  1NTG A;  2GA4 B;  4CJ0 B;  1ASZ A;  2E8G A;  4OL7 A;  1X6O A;  1MKH A;  4RFB A;  1KL9 A;  1QG7 A;  1PTO H;  3RZD H;  2K04 A;  1PH8 A;  1KRS A;  3HOW B;  1TR5 A;  4WJW A;  4YCV A;  1I4P A;  4JYA L;  2A1A A;  3AQQ A;  2PQA B;  5M3F G;  4XYQ A;  3Q0A A;  4DR4 L;  4KV6 A;  1EFW A;  3PIP A;  1MD2 D;  3EN2 A;  3I4O A;  5C0X J;  1BCP B;  1HXY D;  3CCS A;  4KY6 A;  4KN4 C;  1CK1 A;  1E1T A;  5KGU A;  4X3T A;  2NVQ B;  3HOX B;  1WYD A;  1SJE D;  3LWE A;  5JPN C;  3I55 A;  2JN4 A;  1OXS C;  3QG1 A;  5C3E H;  3NEN A;  1IYV A;  2DY7 A;  3HOZ G;  1OXU A;  2K28 A;  3NK9 A;  4QUC A;  2EJM A;  5BR8 L;  4X65 Q;  1GM5 A;  1B1Z A;  1EFI D;  1SRO A;  3I8Z A;  1TWC H;  2C5C A;  4C3J B;  4OO1 G;  2ZJP A;  3GD7 A;  2IX3 A;  1KLG D;  3QO2 A;  1HNX Q;  4FF3 A;  2M9V A;  4A3J H;  3HOU B;  3I90 A;  1YEZ A;  1N36 Q;  1RTO A;  2R7D A;  4F8M A;  2PMZ B;  1JCK B;  4DR1 L;  4JI8 L;  1DOK A;  2JE6 I;  4KD3 A;  4BY1 H;  4GZY C;  3D4R A;  3MA2 B;  2NVX B;  4BBR G;  1TY2 A;  1O78 A;  1CA6 A;  1PTO D;  3HGB A;  2D0P A;  3D4W A;  3HZX A;  4HAE A;  1VQ6 A;  5AJ3 L;  1FNU A;  1VQE A;  3A74 A;  2JQO A;  4R8I A;  3GTP H;  1LLR D;  2FHT A;  2V1C C;  1ZEQ X;  3CCU A;  4DFA A;  2Z1C A;  1YJN A;  1SJH D;  2HT1 A;  2JSO A;  2KA7 A;  1K0S A;  3FRP B;  4K2L A;  1DXM A;  4C1N I;  3I73 A;  3UI2 A;  1Q81 C;  4RH6 A;  1SNC A;  2EYH A;  2NYZ D;  3HEJ A;  3VR3 A;  4KKT A;  2N3S A;  3J80 c;  1NBW A;  1PH3 A;  1G6P A;  3H6M A;  1B8A A;  4A3I B;  3HKZ B;  2MJ8 A;  1NR4 A;  3GP7 A;  4WRD A;  3DMU A;  3K81 C;  3J81 L;  1UE6 A;  1O7L A;  4DNR B;  1J9O A;  4WJ3 M;  2DNC A;  4IUU A;  3I7F A;  3OWF A;  3CCQ A;  3NEL A;  5K5P A;  2CHB D;  4JOI A;  4BA1 I;  3P20 A;  1H9J A;  1SN8 A;  4KI0 A;  5E4X A;  1PTO F;  1PA6 A;  2MHV A;  4HR7 B;  4OWX B;  1SE4 A;  2ICE C;  3DXJ C;  4NB3 A;  4UP7 A;  4QIW E;  5IYB H;  1ILP A;  2I5L X;  1Y69 U;  1NMG A;  4KJO A;  3BZD B;  2R7Z H;  3QWN A;  1RKN A;  4OX9 Q;  3I4N G;  3T16 A;  2QEJ C;  1IKM A;  1XYI A;  5DNF A;  3S15 H;  4B3T Q;  2E2J B;  4GN5 A;  4C3I B;  1NJI C;  1I5F A;  1GOZ A;  3S9W A;  3A5U A;  2KEN A;  2PNR C;  1Q3L A;  1ENC A;  1WI5 A;  3URY A;  3OMC A;  5I2Y A;  5KNC A;  2NN6 I;  1Y1W H;  5M3M G;  4DV4 Q;  1Q7Y C;  1S3O A;  3CQZ B;  1K3R A;  3M4Y A;  1K8A C;  4YHH Q;  2VZA A;  2RSN A;  1OXT A;  3SR1 A;  3E6Z X;  2ZJQ A;  3TP7 A;  4XXE A;  1O7Z A;  5IT9 c;  3X3M A;  1PYW D;  1XJV A;  5AFW A;  5JEA H;  3NWS A;  4AYB E;  2N78 A;  1CSQ A;  1S4Z A;  1XXG A;  1OXV A;  4DAY A;  1F2M A;  4APV A;  1STA A;  3F8T A;  4X3K A;  1BDO A;  2FJ2 A;  5C4J B;  5K36 G;  5IGG A;  1B9N A;  4TKO B;  1EYA A;  1WVL A;  1N32 L;  1N33 L;  2F4V Q;  2XVS A;  2MO0 A;  4FF4 A;  1I4H A;  5HGQ A;  4PZ8 A;  2HCI A;  1FYC A;  2FMC A;  1S5F D;  3HOV B;  3ZYY X;  5IP7 H;  4DV0 Q;  3HKZ E;  3T1H L;  1SAP A;  2WB1 E;  5M5X H;  1FJG Q;  2I07 B;  5J1Z A;  3N52 A;  3M3Y H;  3U4V A;  2OWO A;  3UE0 A;  4DNT B;  4DAM A;  1TQO A;  4CDD C;  1XNR L;  4FF1 A;  1ESF A;  2EY5 A;  1U0L A;  4TSS A;  1QCB D;  5CYU A;  2JA8 H;  1HTP A;  2AQ1 B;  1VQB A;  2UXB Q;  1O7Y A;  2MO1 A;  2F0T A;  2A8V A;  1PFN A;  2E5L L;  5FJ8 G;  4A75 A;  3HFZ B;  4AH6 A;  1A3V A;  2PPB C;  4X66 L;  2VQF L;  2D2C C;  1AZP A;  5CV6 A;  4CJ2 C;  3PUW A;  4ZLT F;  3NBH B;  2FFK B;  3S1Q H;  1T5X D;  4KHP L;  5LMN L;  1V1P A;  2QW7 A;  5T1I A;  5CV9 A;  4PMW A;  1FNW A;  4BBS G;  4B08 A;  2WFW A;  2H1E A;  2ZXO A;  1DON A;  2NN6 G;  3CAM A;  3SK6 A;  4K5V A;  1V8Q A;  1VQ9 A;  1GVP A;  5ISR A;  3V2T A;  1QZG A;  3UDG A;  3CCJ A;  3KF8 B;  4KLK A;  4DV1 L;  3GTQ B;  4AYB G;  2UXD Q;  1FR3 A;  3AFP A;  2MPM A;  1ML0 D;  4BS9 A;  4CDE C;  1J5E L;  1G29 1;  3E5S A;  1YJ9 A;  1PH5 A;  4ID6 A;  1U5K A;  1TII D;  3H0G B;  3VYU A;  1PRT B;  4LUO A;  4XDX A;  3K58 A;  4JI1 Q;  1LT5 D;  4XQN A;  4P71 A;  1K3B C;  2F0U A;  4CKC A;  1SMY D;  4B3R L;  1TS5 A;  3T51 B;  3ULJ A;  4RCN A;  4LF5 Q;  4BY7 G;  2N49 A;  1U4P A;  1VF7 A;  3S14 B;  1LTA D;  1H9R A;  2OXP A;  2VL6 A;  5DM7 3;  3GV6 A;  2RKS A;  4JPB W;  1WTP A;  4DUZ L;  4IPC A;  1YHQ A;  1EIF A;  3EVQ A;  4X3S A;  1I94 Q;  2YTX A;  1VQ4 A;  4XIG S;  3TS2 A;  4A93 H;  2VUM G;  2Z4H A;  4NXN L;  1G8Z D;  4A3M B;  1K8G A;  4A3F G;  4UPA A;  2RA4 A;  3J80 i;  1I3Q H;  4FDB A;  3NTI A;  2VW9 A;  2DJF C;  2QDB A;  1BF4 A;  3TQY A;  2EYL A;  1E0B A;  4EX5 A;  5EJW A;  3W5O A;  2Z0S A;  3NP8 A;  1EY9 A;  4MN3 A;  3VYR A;  2F0D A;  4V0B A;  2P5Z X;  3G6E A;  1VQ7 A;  3Q23 A;  5FLX c;  2EIF A;  5FO9 B;  2IL8 A;  3DM3 A;  4IO9 A;  2A69 D;  4RCO A;  1HJP A;  3W3A A;  2Z9H A;  5F2D A;  1QVF A;  3S2D B;  2ID0 A;  2KCM A;  2AUK A;  5CV7 A;  2BA1 A;  2XTI A;  1SXT A;  1M90 C;  4UP8 A;  2OTL A;  1GUN A;  1SE2 A;  4R9W A;  3E9I A;  5J3B A;  2ATW A;  4A3B G;  1PZI D;  1WTX A;  1VQO A;  1CZG A;  2EY6 A;  4NXM Q;  1UEA B;  4A3G G;  2PZU A;  5IP9 G;  3FMC A;  4QY7 A;  4YCU A;  2VY3 A;  3A7L A;  1Q86 C;  3GTK B;  2HUG A;  4QMG A;  3V96 A;  3Q22 A;  1PZJ D;  4DUY Q;  2UUB L;  1XTC D;  3OIP A;  3PO2 H;  4YCW A;  4DPG A;  3FVQ A;  1HZB A;  2VXW A;  4L63 B;  1KC8 C;  2BH2 A;  4OEM B;  4J1M A;  4LF8 Q;  4DN4 M;  1AN8 A;  3EJI A;  2WAC A;  4HJ9 A;  2QIL A;  2XNA C;  1A3T A;  1IBM L;  4JI4 L;  4O2D A;  5IYC G;  3I4L A;  2NB0 A;  5ELF A;  2IW3 A;  4CJ1 B;  1GKH A;  4K6L A;  3PV0 A;  2ICI A;  3GQB A;  3G71 A;  3Q6S A;  1IKL A;  4KY7 A;  4NMZ A;  3FHW A;  3KLS A;  1HQM C;  2R7F A;  2B63 H;  3RLF A;  1TWF H;  3TME A;  1XMO L;  1LT6 D;  4P74 A;  2CKZ B;  2CH4 W;  3AEV A;  1EIG A;  1WD1 A;  1Q90 A;  4C56 C;  3E3X A;  4CBV A;  4GOP B;  2K5N A;  4GNX C;  1Q46 A;  4G4K A;  4DV3 Q;  1WTV A;  5IGE A;  1HNW Q;  1H9S B;  2F0K A;  2YYZ A;  3WWV A;  5DAU A;  4ZKB B;  2MFI A;  4ZCK A;  2WAQ E;  4BA2 I;  3U4Z A;  4A3E G;  1Y14 B;  2K5V A;  4F7X A;  4X3U A;  3CXC A;  2XSC A;  2WII B;  3C3L A;  1DGS A;  2O2L D;  5C5L A;  1JMC A;  3S1R H;  1HUN A;  1IHZ A;  4QJF A;  3CP0 A;  5C4X H;  1D1K A;  2BDO A;  4EGV A;  3AU7 A;  1PHJ A;  3DLL A;  2F0E A;  3JAM L;  3D31 A;  1HZA A;  1Y1V H;  2JA7 G;  1YHA A;  1JB7 A;  4ME5 A;  1HFG A;  5M3F B;  1PH7 A;  3D4D A;  3TP5 A;  2RHQ B;  4IFD I;  2F0H A;  1SR3 A;  1H9K A;  1F9S A;  4MHE A;  1XPU A;  4ZAI A;  1KAA A;  2F0F A;  1SYF A;  4LF4 Q;  2X6L A;  4YY3 L;  1MSH A;  2XRQ D;  2WP8 J;  1BBU A;  3V05 A;  5IE8 A;  4AIM A;  3HOZ B;  1JOQ A;  4K6D A;  2CQA A;  4I65 A;  3G48 A;  1A0I A;  1K0R A;  1LM0 A;  1PLF A;  3DEP A;  2VS1 A;  2PW5 A;  4LFA Q;  3QR8 A;  1NNX A;  5C6A A;  1PH1 A;  3OIQ A;  1HNZ L;  1C0A A;  1X9N A;  4CGY B;  3K5L A;  3ND8 A;  3BG3 A;  4IUT A;  4BBR B;  3CF5 A;  1IBL L;  1I4Q A;  3R2I A;  3S2H B;  1SDF A;  3K7A B;  4B3M Q;  1JJ2 A;  1H9M A;  1LTR D;  1VS0 A;  4R4T A;  4LW1 A;  3T13 A;  4YWL A;  4OIK A;  1HA5 A;  3IFD A;  4XTC S;  4K0K Q;  2K52 A;  1E3P A;  2WAQ G;  5JPM C;  4F87 A;  3KBX A;  2YU9 B;  3MZ5 A;  3HOY H;  4N8X 1;  4V19 0;  1V9P A;  3BDC A;  4DR3 L;  4ULL A;  3I3C A;  1BBX C;  1CM9 A;  3DUZ A;  3S14 H;  3OPO A;  2JA5 H;  5LL6 S;  4JI0 L;  1PZK D;  3GTO H;  1NSN S;  4P73 A;  3FKI G;  4DR7 Q;  3RN5 A;  4DV5 Q;  2H4O A;  4PQX A;  5CC4 A;  1EU4 A;  1P8L A;  2LFN A;  3SVM A;  1F77 A;  2Z6K A;  3A54 A;  3GTL H;  2K50 A;  4IFD G;  4AQY L;  1HPC A;  3K7U C;  3RUZ A;  1EY5 A;  1AH9 A;  4PZ6 A;  4UAI A;  1TT2 A;  2TMP A;  3EIV A;  4EQ5 A;  2UU9 Q;  1IYU A;  3KK7 A;  1BVS A;  1CQV A;  4BWG B;  5JJZ A;  1W2B A;  4G7H C;  1TWH B;  2PO4 A;  2PI2 A;  3TP6 A;  3I4N B;  1UUP A;  4JV5 Q;  5GAG C;  3MXN B;  5ELO A;  4GS3 A;  5IGF A;  4IOA A;  3FEW X;  2AQ2 B;  2IX0 A;  4Y7N H;  1R4P B;  4OIJ A;  4HCS A;  2ZTC A;  4GKK L;  3ICE A;  2NUC A;  3K5M A;  1B50 A;  2EVB A;  2B2U A;  4NPS A;  2B29 A;  3SE0 A;  4A3K H;  2J4X A;  1DD2 A;  1HQR D;  1K73 C;  2UUA L;  4LUZ A;  1RTN A;  4K5X A;  5M3M B;  2JA6 H;  3S24 A;  3PSI A;  2OT2 A;  2N8N A;  1SNP A;  2Y0S E;  4H02 A;  1L1O A;  5E4W C;  3ULP A;  4XT1 B;  2B2W C;  2ZM6 Q;  2A5H A;  2R92 B;  1G91 A;  5C3E G;  4OGQ C;  1KQS A;  3EBE A;  1CT1 D;  4GLA C;  4IFD J;  4A3L H;  2LY7 A;  1CZW A;  4JI6 Q;  3MWY W;  4A3D H;  2K5Q A;  3S17 H;  1G51 A;  1RDP D;  3NPP A;  3RMH A;  1U4L A;  2DUD A;  3HRZ C;  4A3J G;  4JCV E;  2K03 A;  3A8K E;  4RHR A;  4K5W A;  1GJX A;  2JK8 A;  2F0V A;  1ROD A;  1TWG H;  2DN8 A;  3RD4 A;  4IOC A;  1KDC A;  2F3W A;  4BY1 G;  3KDF A;  3DWQ A;  4JYA Q;  4DK3 C;  1QUQ A;  4DR4 Q;  5TSS A;  4A3C H;  1MI2 A;  2O5I C;  1EZ8 A;  3T1Y L;  2E2H B;  2YV5 A;  4QIW B;  5I9P A;  1B44 D;  1JJG A;  3BZK A;  2JEA I;  2G5D A;  3S16 H;  2CQO A;  4DGZ A;  5EQ0 A;  2GN5 A;  3G6J B;  1W3S A;  4HTH A;  2NVT H;  5FLX E;  3I2Z A;  5LMN W;  3BS1 A;  4U67 3;  2F03 A;  3C1E A;  2IWH A;  3RZO B;  5M5Y B;  5BR8 Q;  1O7I A;  2CFM A;  3D3R A;  1OTC A;  1AE3 A;  1JE4 A;  1TS2 A;  1IXR A;  2KHS A;  3MAQ A;  5C44 H;  2G9D A;  3A8I E;  4GOP C;  5DLQ E;  1JWM D;  4LF7 L;  4ZQ3 A;  4DR1 Q;  1QZH A;  3IKJ A;  4JI8 Q;  1EWC A;  2Q8R E;  4JVZ A;  3AMU A;  4XT3 B;  2Y0S G;  3I56 A;  3I4M H;  3E0E A;  3QOJ A;  3KLW A;  4YWM A;  1UEB A;  4AYB B;  5I6W A;  1WCM H;  1Z47 A;  5BN4 A;  4HIK A;  3VR4 A;  5AJ3 Q;  1BR9 A;  3ERS X;  5IYB G;  5GAH C;  1VQL A;  4FYD A;  2R7Z G;  1HFN A;  3MXG A;  3TDQ A;  4XQJ A;  2VNU D;  4DR2 L;  4IPD A;  4MTK A;  4GNX A;  1DJR D;  3M7G A;  3PIP 3;  1SND A;  1X56 A;  2O5J C;  4BY7 B;  4A4I A;  3GTJ B;  3NEM A;  2EXZ A;  2PCF B;  1PDQ A;  1NCV A;  1EU3 A;  2WB1 B;  1T9H A;  1LTG D;  2EYF A;  3N6R A;  3PIO A;  1Y8N B;  4POG A;  4POF A;  1E7Z A;  1Y1W G;  1GXD C;  1GUO A;  2EOT A;  4RKL A;  5E1F A;  3RLN A;  2I5M X;  3S1M H;  2VUM B;  3GTG H;  5DM6 3;  2KUM A;  4LK1 C;  1AP0 A;  1KIX A;  1D5X C;  2FMM A;  3BVG A;  1EY8 A;  2BH8 A;  4A3F B;  2RCN A;  3M4P A;  1VMC A;  1GUW A;  5KYI A;  3KOJ A;  2Q8I B;  5JEA G;  1Y8O B;  1QOH A;  1TWA H;  1SYB A;  3ERO A;  4MNO A;  3CME A;  4ZYS A;  4I7Z C;  2WIN B;  3WDN A;  1RL2 A;  3KLS X;  1WFQ A;  1IBK L;  5D3I B;  3CC4 A;  4G7O C;  1MJC A;  5JJL A;  4B3S L;  2RDH A;  1Z9F A;  2OQK A;  3KYH C;  2V4D A;  1D7Q A;  1LV9 A;  4Q5V A;  5IP7 G;  3M4O H;  4EVO A;  4FO2 A;  4FXK C;  3L0O A;  4MIU A;  3CCR A;  4HIM A;  1C7Y A;  1EIH A;  2K5D A;  2IHF A;  5JJK A;  1KDB A;  2E2D C;  2B2Y A;  3ER0 A;  4J15 A;  2Q2I A;  2PI2 E;  4DR5 L;  2A6H D;  2A68 C;  3G4S A;  3TS0 A;  2UUC L;  1A3U A;  2JA8 G;  5FK9 C;  3M4Q A;  1VQP A;  1XX8 A;  1VQA A;  1LTI D;  4EQN A;  4KTA A;  4A3B B;  2NVY B;  4A3G B;  4C3H H;  2EY1 A;  1AFP A;  4MZ9 A;  3CPF A;  1PVO A;  2L0C A;  1HZ9 A;  1UAP A;  1QIL A;  2F0I A;  1N32 Q;  1N33 Q;  4L8J A;  5JEA J;  1QNU A;  3QIA A;  4DV7 L;  5D14 A;  4C2M B;  2KEE A;  4P75 A;  4QL5 A;  4KD4 A;  1JE5 A;  3PO3 B;  1K83 H;  3T1H Q;  4JBK A;  4L5Q A;  2B2V A;  3K5O A;  1H95 A;  1STY A;  1TWH H;  1YNJ C;  1S5B D;  3A56 A;  1ET6 A;  1Z7T A;  1SMY C;  2F0S A;  2DNE A;  5EKK A;  3TRZ A;  1I50 H;  2F0W A;  5KND A;  3K57 A;  2R93 H;  1PV4 A;  3EFX D;  1Q8I A;  4JI5 L;  2E5L Q;  1II3 A;  3VA5 A;  5I6Y A;  2A68 D;  3GDE A;  4X66 Q;  2PQE A;  4HCE A;  3VA7 A;  3K0X A;  3EQL C;  5LMN Q;  1JIC A;  1IW7 C;  1X65 A;  2SNS A;  3U9O A;  2JJQ A;  2PYK A;  4J8Q A;  2F0M A;  4DV6 Q;  1SFO H;  2R92 H;  1NY4 A;  4DU9 A;  1F9P A;  1I6V C;  1N8R C;  4H7B A;  4LF9 Q;  4IPG A;  5C3X A;  1J8I A;  1B2T A;  4A93 G;  3CPW A;  4DK0 A;  3SEB A;  2OQ0 A;  2ZTE A;  4DV1 Q;  1I6H H;  4C3J G;  5JAV A;  2FXQ A;  3KLR A;  3I70 A;  3SK8 A;  4A3E B;  3BVM A;  1CKO A;  3GV3 A;  4HMI A;  5CBE E;  1J5E Q;  1ESR A;  5EGT A;  2CWA A;  5COR A;  1YNJ D;  3HOW H;  3BYT B;  1VQH A;  2B2W A;  1I4R A;  1VQC A;  2A69 C;  2UXC L;  1HRJ A;  2CVR A;  3VR2 A;  2JA7 B;  2JEB I;  4B3R Q;  1BCP C;  1VQJ A;  1ICF B;  2HD3 A;  2SEB D;  4PV1 C;  3R8B A;  1K8O A;  1WTQ A;  1ET9 A;  3K8A A;  3SHL A;  2QA4 A;  1VMP A;  2KCT A;  2LSS A;  2NVQ H;  3LNN A;  3HOX H;  5ELB A;  4DUZ Q;  1SNO A;  4JI2 Q;  4DAY B;  1WTH A;  3IRB A;  4R1J A;  2HHH L;  1W6K A;  2B2T C;  3S1N B;  1HH2 P;  4NXN Q;  2HIV A;  4LFC L;  4LF5 L;  2XWB B;  4C3J H;  2A73 B;  3K59 A;  4MTN A;  1IW7 D;  3CCV A;  2MUY A;  2RDG A;  1MIU A;  3CU7 A;  5EBC A;  4XQQ A;  3QJY A;  2QEX A;  3H94 A;  5A2Q L;  5GRO A;  3HOU H;  3A0J A;  3A7A B;  4KKU A;  4JI7 L;  2EQS A;  2KQ3 A;  4KMU C;  1SSO A;  4N8F A;  4GKJ L;  1A6X A;  1GHJ A;  2NVX H;  1SBB B;  3KF6 A;  4LWC A;  4JC0 A;  5KEE A;  3PO2 G;  2GVA A;  2KOL A;  1QB5 D;  2K33 A;  3M85 A;  2EJG C;  2NBF A;  2ASB A;  1EY4 A;  2X69 A;  2WAQ B;  3P7J A;  3HP3 A;  3C46 A;  1HHV A;  1BCP D;  2AKW B;  3SGI A;  5ELN A;  1YNN C;  4G57 A;  2KCN A;  3TZU A;  2CWP A;  5BN3 A;  5A2Q E;  4N9P A;  2C9O A;  5HUR A;  5IY0 A;  3BYY B;  4A3I H;  4J6H A;  1V1P B;  2K4K A;  3OTO L;  1STG A;  2KHJ A;  3L7Z C;  3FKI B;  3VYS A;  1B7Y B;  1DCZ A;  4IPH A;  2EYP A;  3BDO A;  5CMD A;  1WTO A;  2B63 G;  2BCO A;  1CKM A;  4JG2 A;  3J7A F;  3PUZ A;  1LTB D;  3NHH A;  2UUB Q;  4BXX H;  1MHW C;  2N55 A;  1EWI A;  3KUP A;  1ONL A;  4FF2 A;  3DWP A;  3MTS A;  3GO5 A;  1IL2 A;  5IWA L;  5D65 A;  1QWY A;  5FKA C;  3VR6 A;  3J80 L;  3CCM A;  1I4X A;  2F3V A;  3MEF A;  1BCP F;  2Q2T A;  3D6C A;  3MFY A;  2RF4 A;  4E6I A;  1B3Q A;  1V1Q A;  3DEO A;  1IBM Q;  1A8V A;  4JI4 Q;  1E22 A;  1R9T B;  2E2J H;  1UE7 A;  1ZYR D;  4C3I H;  4U68 A;  1SYD A;  5C4X G;  1EQV A;  1D5Z C;  3RZD B;  1PTO B;  2BE5 C;  1PYS B;  1Y1V G;  2GVB A;  2NWG A;  2AMC B;  1KHI A;  1YNN D;  2PZW A;  3OHX C;  1XMO Q;  4ME3 A;  1VQI A;  3CQZ H;  5C4Z A;  3ND9 A;  4C1N K;  2NTS A;  3HKS A;  4X64 Q;  4DV2 L;  1ZXT A;  3WOE A;  2IX1 A;  1EOT A;  3CKI B;  3J80 E;  1XPR A;  1SYG A;  5C3E B;  1ENF A;  2E74 C;  4DF7 A;  2PNH A;  1Z6H A;  1X54 A;  1RD9 D;  1WOC A;  1RIP A;  2BA0 A;  4H0L C;  4OEL B;  3HS0 C;  3CCE A;  5FO7 B;  1TWC B;  5C4J H;  2HIX A;  1B3A A;  4UP9 A;  3T53 B;  4ZKC B;  1YIJ A;  1SNM A;  4X62 Q;  4ABN A;  3HOV H;  1XNQ L;  4FXG C;  3PO3 H;  3SXH A;  1HTL D;  1A2T A;  1FVI A; 
#chains in the Genus database with same CATH homology
 1EUJ A;  1N34 L;  2WB1 G;  2N8N A;  2OTJ A;  2QGQ A;  2Y0S E;  4H02 A;  1L1O A;  4IJH A;  3CC7 A;  3J81 c;  3ULP A;  2ZM6 Q;  2VQE L;  1PH4 A;  4JI7 Q;  4BBS H;  5C3E G;  3S15 H;  4B3T Q;  1KQS A;  5HY6 A;  3EBE A;  1X3G A;  4JI2 L;  4HID A;  4ALP A;  1I94 L;  4GN5 A;  4GLA C;  4GKJ Q;  4IFD J;  4A3L H;  1NJI C;  4JI6 Q;  1I5F A;  4A3D H;  3A5U A;  2KEN A;  1AE2 A;  4DK6 C;  3S17 H;  1G51 A;  4YY3 Q;  4BXX G;  2ZJR A;  1HZC A;  1WI5 A;  2DUD A;  4A3J G;  1UE1 A;  3PUX A;  4JCV E;  4OX9 Q;  3HOY G;  2NN6 I;  1Y1W H;  3M7N A;  5M3M G;  2AWO A;  4DV4 Q;  1Q7Y C;  2JK8 A;  1S3O A;  2NZH A;  3BZC A;  1K3R A;  4GOP A;  1TWG H;  1PFS A;  1K8A C;  4YHH Q;  2VZA A;  4P72 A;  4IOC A;  1OXT A;  2JA5 G;  4BY1 G;  3KDF A;  2ZJQ A;  4JYA Q;  2ZTD A;  4DK3 C;  1QUQ A;  4DR4 Q;  5IT9 c;  1HNZ Q;  1GD7 A;  5E7N A;  1XJV A;  4A3C H;  4AYB E;  2N78 A;  4LF4 L;  1Q8K A;  1V43 A;  4HJA A;  3T1Y L;  1CSQ A;  4BY7 H;  2YV5 A;  4JI3 L;  1L1O C;  3GTJ H;  1OXV A;  1JJG A;  3OTO Q;  4PG3 A;  4JBJ A;  4APV A;  3BZK A;  3F8T A;  1UE5 A;  2JEA I;  3S16 H;  2CQO A;  2GN5 A;  5K36 G;  3PGZ A;  1IBL Q;  3GTQ H;  1W3S A;  3VDY A;  2NVT H;  5LMU L;  1N32 L;  3I2Z A;  5LMN W;  1N33 L;  2F4V Q;  4OWW B;  3L2P A;  2MO0 A;  5HGQ A;  4LFB L;  4PZ8 A;  1O7I A;  2CFM A;  5BR8 Q;  3K80 C;  1OTC A;  1AE3 A;  2VUM H;  5IP7 H;  4DV0 Q;  3H0G H;  1IXR A;  4GN4 B;  3HKZ E;  1YNX A;  1FGU A;  3W1B A;  3UE1 A;  5C44 H;  2WB1 E;  5M5X H;  4HIO A;  3T1H L;  1FJG Q;  2Q2H A;  4A3F H;  4GOP C;  5DLQ E;  2K75 A;  4RMF A;  3RR5 A;  3Q8D A;  3M3Y H;  3KJP A;  5IWA Q;  3F1Z A;  3U4V A;  2OWO A;  1A62 A;  3UE0 A;  4DR3 Q;  4LF7 L;  1Q1E A;  4DR1 Q;  1QZH A;  4NXM L;  4DAM A;  4JI8 Q;  1XNR L;  3I4N G;  4Y52 H;  1U0L A;  2Y0S G;  3AFQ A;  3I56 A;  2JA8 H;  1VQB A;  3I4M H;  3E0E A;  2MO1 A;  3KLW A;  4DUY L;  2A8V A;  1S40 A;  2UXB Q;  4YWM A;  1UEB A;  1EQR A;  3TEH B;  2E5L L;  1WCM H;  1Z47 A;  2KHI A;  3PCO B;  5FJ8 G;  4A3K G;  4A75 A;  3HFZ B;  4HIK A;  1MJE A;  4AH6 A;  2AWN A;  2PQA A;  5AJ3 Q;  3RN2 A;  4LF6 L;  3ERS X;  3JAM i;  1LTL A;  5IYB G;  3HOV G;  5GAH C;  4X66 L;  1YVC A;  2VQF L;  4AQY Q;  1VQL A;  4LF8 L;  2JA6 G;  1VQK A;  2R7Z G;  3PO3 G;  4A3M H;  3PUW A;  3F2C A;  2VNU D;  4DR2 L;  1YI2 A;  3NBH B;  4IPD A;  3UDI A;  3S1Q H;  1N9W A;  4GNX A;  4KHP L;  4QGU A;  5LMN L;  5IYD H;  1SRU A;  2MQH A;  4R4C A;  4PMW A;  1A63 A;  4PZ7 A;  4BBS G;  1X3F A;  2I5H A;  2ES2 A;  2WFW A;  1X56 A;  4A4I A;  1EOV A;  2NN6 G;  3NEM A;  3CAM A;  1Q82 C;  4A3L G;  4DV2 Q;  1VCI A;  4A3D G;  5JJI A;  3BJU A;  1EQQ A;  1VQ9 A;  3PUV A;  1KRT A;  1T9H A;  1GVP A;  4DNI A;  3UDG A;  1QZG A;  3CCJ A;  3KF8 B;  4KLK A;  4DV1 L;  3PIO A;  4A3B H;  4AYB G;  4JBM A;  4POG A;  2YTV A;  1E7Z A;  1TXY A;  4POF A;  2UXD Q;  2NVY H;  3AFP A;  4A3G H;  4KHZ A;  1Y1W G;  5IP9 H;  4GKK Q;  2K5H A;  1KAW A;  3KF6 B;  1G29 1;  1J5E L;  3CD6 A;  3RLN A;  1YJ9 A;  2I5M X;  1PH5 A;  3S1M H;  4X6A H;  3GTG H;  1YHB A;  3PF5 A;  4GLX A;  1U5K A;  1KIX A;  1P16 A;  2Q2U A;  4LUO A;  3PF4 A;  1FL0 A;  1YBY A;  2BH8 A;  4X64 L;  4JI1 Q;  3S2D H;  2RCN A;  1HR0 W;  3M4P A;  2CCZ A;  4P71 A;  4C2M H;  2UUA Q;  3KOJ A;  4B3R L;  5JEA G;  4A3C G;  3ULJ A;  4LF5 Q;  1TWA H;  3CME A;  4MNO A;  2N49 A;  1XNQ Q;  4BY7 G;  5H1S E;  1XMQ L;  4DV3 L;  1RL2 A;  1WFQ A;  4GN3 B;  1IBK L;  1N34 Q;  1HNW L;  3CC4 A;  2VL6 A;  1D8L A;  1CUK A;  2VQE Q;  1MJC A;  2IHE A;  5JJL A;  4DUZ L;  4IPC A;  5IYC H;  4B3S L;  1YHQ A;  1Z9F A;  1EIF A;  1VQD A;  2OQK A;  3KYH C;  1I94 Q;  1D7Q A;  1YZ6 A;  1X55 A;  2YTX A;  1VQ4 A;  4XIG S;  5GAE C;  1M1K C;  3TS2 A;  2VUM G;  4A93 H;  3GTK H;  2LXJ A;  4NXN L;  5IP7 G;  3M4O H;  3H0G G;  4X62 L;  5C44 G;  4QQB X;  3BU2 A;  3L0O A;  2ALY B;  3CCR A;  3FP9 A;  4HIM A;  2F52 A;  4JOI C;  4A3F G;  1K8G A;  1C7Y A;  2IHF A;  4UPA A;  5JJK A;  1EYG A;  3J80 i;  4L5R C;  1I3Q H;  4FDB A;  1Q1B A;  3ER0 A;  4J15 A;  2Q2I A;  2PI2 E;  4DR5 L;  2VW9 A;  3AYH B;  1VQG A;  2EXD A;  5FLM H;  3TQY A;  3G4S A;  4HJ8 A;  1WJJ A;  4EX5 A;  3W5O A;  3TS0 A;  2UUC L;  2Z0S A;  2JA8 G;  1HR0 L;  3I4M G;  3M4Q A;  1VQP A;  1VQA A;  3G6E A;  3T1Y Q;  2IY5 B;  1VQ7 A;  1WCM G;  4JI3 Q;  4DR6 L;  3LGJ A;  2D0O A;  5FLX c;  3F2D A;  4C3H H;  2EIF A;  4MZ9 A;  3CPF A;  3DM3 A;  1PVO A;  4IO9 A;  4A3M G;  5GQO A;  1HZ9 A;  5LMU Q;  1HJP A;  4A3E H;  1N32 Q;  4LFA L;  3W1G A;  1QVF A;  1N33 Q;  5JEA J;  2ID0 A;  1NE3 A;  2KCM A;  5IYD G;  3OW2 A;  4DV7 L;  4LFB Q;  2BA1 A;  2XTI A;  5C0X I;  2D62 A;  4P75 A;  4QL5 A;  4A76 A;  1JE5 A;  1M90 C;  4UP8 A;  2OTL A;  1K83 H;  4UY8 C;  2NZO A;  3T1H Q;  4JBK A;  3B6Y A;  4L5Q A;  1H95 A;  1TWH H;  3CW2 C;  3E9I A;  3J81 i;  2JA7 H;  1PH9 A;  1L2F A;  5J3B A;  2ATW A;  4A3B G;  4LF7 Q;  1VQO A;  1KXL A;  1IZ6 A;  4NXM Q;  4A3G G;  4B3M L;  5EAY A;  5IP9 G;  4YCU A;  4QY7 A;  2VY3 A;  1CKN A;  3TRZ A;  4JI0 Q;  1OXX K;  1I50 H;  4X65 L;  1Q86 C;  3CMA A;  4K0K L;  2R93 H;  1PV4 A;  4DUY Q;  2UUB L;  3PO2 H;  4JI5 L;  4YCW A;  2E5L Q;  4DPG A;  1HNX L;  1HZB A;  4TVA B;  3TRE A;  1KC8 C;  4LF6 Q;  2BH2 A;  3STB C;  3S1N H;  1JT8 A;  1N36 L;  4LF8 Q;  3GDE A;  4X66 Q;  3K0X A;  3J81 j;  4DR2 Q;  1CSP A;  3PUY A;  1X65 A;  5LMN Q;  4HJ9 A;  1GO3 E;  2JJQ A;  5M3F H;  4DV6 Q;  3UDF A;  1IBM L;  1SFO H;  4JI4 L;  3RNU A;  2R92 H;  4O2D A;  5IYC G;  1NY4 A;  4DR7 L;  4DV5 L;  4DKA C;  1N8R C;  4LF9 Q;  4OXP A;  4IPG A;  1YJW A;  1GKH A;  1PYB A;  3KJO A;  5GAD C;  3PV0 A;  2HQL A;  1L1O B;  3CPW A;  3G71 A;  2K14 A;  4A93 G;  2OQ0 A;  2ZTE A;  4DV1 Q;  1I6H H;  2E2I H;  4HJ5 A;  2FXQ A;  3FHW A;  2R7F A;  1CKO A;  4L5T A;  2F3I A;  3RLF A;  2B63 H;  3HOZ H;  1TWF H;  1J5E Q;  3F2B A;  1QVC A;  1XMO L;  4P74 A;  2UU9 L;  2CKZ B;  3AEV A;  2CWA A;  5FLM G;  3HOW H;  1VQH A;  1VQ5 A;  1VQC A;  2UXC L;  3A5Z B;  4JV5 L;  2I0Q A;  2JEB I;  1SMX A;  4B3R Q;  3E9H A;  1VQJ A;  4GOP B;  2K5N A;  4GNX C;  1Q46 A;  1XMQ Q;  4WJ4 A;  4DV3 Q;  1PH6 A;  3KDF B;  4OO1 I;  3K8A A;  2QA4 A;  5C0X G;  1IBK Q;  1HNW Q;  1QUQ B;  2KCT A;  1XTD A;  2LSS A;  2NVQ H;  4L5S A;  2YYZ A;  3WWV A;  2LXK A;  3HOX H;  4BBR H;  1LUZ A;  2MFI A;  1VQ8 A;  2WAQ E;  1J6Q A;  4DUZ Q;  4BA2 I;  4B3S Q;  1C9O A;  3FKI H;  3U4Z A;  1BKB A;  1Y14 B;  2K5V A;  4JI2 Q;  3ZJY C;  4A3E G;  3S2H H;  3K7A H;  3STB D;  4DAY B;  3CXC A;  3IRB A;  4R1J A;  1DGS A;  1JMC A;  1ASY A;  2HHH L;  4LUV A;  4O0A A;  3S1R H;  2DGY A;  1IYJ B;  1HH2 P;  3CP0 A;  4OON A;  4QJF A;  3UDX A;  5C4X H;  1XPO A;  1VQM A;  4NXN Q;  2HIV A;  4LFC L;  4LF5 L;  1PHJ A;  1L0W A;  4C3J H;  3DLL A;  4MTN A;  3CCV A;  2IT1 A;  2KBN A;  1HZA A;  3D31 A;  1MIU A;  1Y1V H;  2QEX A;  2YU9 H;  4OX9 L;  3J7A 5;  2JA7 G;  1YHA A;  2YTY A;  1JB7 A;  1B70 B;  5GRO A;  3HOU H;  3A0J A;  1PH7 A;  1KD1 C;  1VQN A;  2ZM6 L;  2RHQ B;  2EQS A;  4JI7 L;  1E1O A;  1Q12 A;  4DR5 Q;  4B3T L;  4IJL A;  4IFD I;  2RHS B;  3H3V H;  1S72 A;  4JBW A;  1SR3 A;  3M9B A;  1EIY B;  4GKJ L;  1UWV A;  1QVG A;  2L15 A;  4JI6 L;  2UUC Q;  1XPU A;  2NVX H;  1HR0 Q;  3KF6 A;  4LWC A;  2R93 G;  4LF4 Q;  4JC0 A;  3PO2 G;  2GVA A;  5M5W H;  4YY3 L;  2WP8 J;  1R9T H;  4DR6 Q;  1BBU A;  1NMF A;  5IE8 A;  3H3V I;  4AIM A;  4HJ7 A;  1CKN B;  1NTG A;  3M85 A;  1ASZ A;  2E8G A;  4DV4 L;  1PH2 A;  1X6O A;  1MKH A;  2PMZ E;  1KL9 A;  4OWT B;  3RZD H;  1PH8 A;  2XGT A;  3G48 A;  1A0I A;  3JAM c;  2ASB A;  1LM0 A;  1K0R A;  4YHH L;  1KRS A;  2VS1 A;  4LFA Q;  2AKW B;  4YCV A;  2MNA A;  4JYA L;  2A1A A;  3AQQ A;  2PQA B;  3SGI A;  5M3F G;  4DV7 Q;  5ELN A;  4YWK A;  1PH1 A;  4DR4 L;  1EFW A;  2R92 G;  1LYL A;  2B3G A;  1HNZ L;  1C0A A;  3PIP A;  2CWP A;  3EN2 A;  3I4O A;  5C0X J;  3H15 A;  3CCS A;  1X9N A;  4GNX B;  5IY0 A;  1E1T A;  4A3I H;  3I4N H;  2K4K A;  3OTO L;  2KHJ A;  3L7Z C;  1K9M C;  1WYD A;  2R6G A;  3CF5 A;  3I55 A;  1OXS C;  1IBL L;  1B7Y B;  3NEN A;  5C3E H;  4IPH A;  4R4I A;  4B3M Q;  1JJ2 A;  2B63 G;  3HOZ G;  2F4V L;  1OXU A;  1VS0 A;  1XNR Q;  4R4T A;  1CKM A;  4LW1 A;  5BR8 L;  4JG2 A;  4X65 Q;  4TQU S;  4YWL A;  1GM5 A;  1SRO A;  3PUZ A;  4XTC S;  4K0K Q;  2OCE A;  1TWC H;  3HOW G;  2K52 A;  1E3P A;  2WAQ G;  2ZJP A;  4DV0 L;  3JC6 6;  3GD7 A;  2UUB Q;  4JI5 Q;  4BXX H;  4OO1 G;  1EWI A;  3ULL A;  1HNX Q;  1FJG L;  3KFU A;  4R4O A;  4A3J H;  3HOY H;  3GO5 A;  1IL2 A;  1YEZ A;  5IWA L;  5M3M H;  1N36 Q;  2VQF Q;  1V9P A;  4DR3 L;  2R7D A;  3U58 A;  2H5X A;  3CCM A;  4DR1 L;  3MEF A;  4JI8 L;  3S14 H;  4KHP Q;  2JE6 I;  3OYY A;  2JA5 H;  2Q2T A;  4BY1 H;  3HOX G;  2RF4 A;  1JJC B;  4BBR G;  4JI0 L;  3GTO H;  1V1Q A;  1IBM Q;  4JI4 Q;  1A8V A;  4P73 A;  1E22 A;  3FKI G;  4DR7 Q;  2UXB L;  3RN5 A;  4DV5 Q;  2E2J H;  2D0P A;  1YIT A;  1P8L A;  1UE7 A;  4C3I H;  3D0F A;  1VQ6 A;  5AJ3 L;  5C4X G;  1VQE A;  2Z6K A;  3A74 A;  2JQO A;  2K50 A;  3GTL H;  4AQY L;  3GTP H;  2V1C C;  4IFD G;  3K7U C;  1PYS B;  3CCL A;  3CCU A;  4GLV B;  1YJN A;  1Y1V G;  2HT1 A;  2GVB A;  2AMC B;  1KHI A;  1AH9 A;  4PZ6 A;  4R4Q A;  3HOU G;  1Q81 C;  1XMO Q;  3EIV A;  4ME3 A;  4EQ5 A;  3GTM H;  2UU9 Q;  4DV6 L;  1VQI A;  3CQZ H;  3U50 C;  3J80 c;  2A19 A;  2N3S A;  1BVS A;  1NBW A;  1PH3 A;  1G6P A;  3RLO A;  3CC2 A;  3HKS A;  4X64 Q;  1W2B A;  1B8A A;  2PI2 A;  4DV2 L;  4LF9 L;  2UXC Q;  4JV5 Q;  5GAG C;  4LNQ A;  2IX1 A;  2C35 B;  3MXN B;  5ELO A;  4GS3 A;  3K81 C;  1XPR A;  1UE6 A;  4IOA A;  2IX0 A;  1E24 A;  4Y7N H;  2E2H H;  4WJ3 M;  2UXD L;  1X3E A;  2PNH A;  3I7F A;  3CCQ A;  2ZTC A;  1SLJ A;  1X54 A;  3NEL A;  4GKK L;  1SE8 A;  1WOC A;  1RIP A;  2BA0 A;  3ICE A;  4JOI A;  4BA1 I;  3CCE A;  5C4J H;  2HIX A;  1SN8 A;  4KI0 A;  2Z6K C;  1VQF A;  4NPS A;  2JA9 A;  2B29 A;  3J7Z C;  4JI1 L;  1PA6 A;  4A3K H;  4UP9 A;  5FJ8 H;  2HHH Q;  1BBW A;  4RG1 A;  4OWX B;  3RZO H;  1K73 C;  5M5Y H;  2UUA L;  4LUZ A;  1YIJ A;  4NB3 A;  4UP7 A;  4QIW E;  4X62 Q;  5IYB H;  4LFC Q;  3HOV H;  2AHO B;  2I5L X;  3S24 A;  1XNQ L;  1NMG A;  2JA6 H;  3PO3 H;  2R7Z H;  4A3I G;  3PSI A;  1FVI A;  3HKZ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...