3D6CA

Crystal structure of staphylococcal nuclease variant phs l38e at cryogenic temperature
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLEVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title The pK(a) values of acidic and basic residues buried at the same internal location in a protein are governed by different factors.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 40
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d6cA00
3EVQA 5HURA 2RKSA 5IGEA 3S9WA 3ERQA 4HMJA 4IALA 1ENAA 1SNDA 5C5LA 4ID6A 5M9OA 3SK8A 5I9OA 2F3VA 2F0MA 2EYPA 5J1ZA 1EZ6A 3MEHA 3RUZA 3BDCA 2PW7A 1JOKA 2PW5A 4G57A 4NMZA 5KGUA 4KY6A 3D6CA 3C1FA 4R8NA 3MXPA 3TP7A 3H6MA 1STYA 2EYMA 3DHQA 1EY5A 5C3XA 5C3WA 5C4ZA 1SYDA 2F0OA 2EYFA 1SYBA 1F2ZA 5CR3A 1EYCA 1JOOA 5CV4A 4PMCA 2F0DA 5KEEA 4WORA 3P1HA 1EYDA 2EY5A 5IGGA 3MZ5A 3LX0A 3QOJA 3E5SA 2OEOA 4HTHA 2F0QA 1EY7A 4ZUIA 4EQPA 1JOQA 5JAVA 3U9OA 4N9PA 3D4WA 1STNA 4F7XA 2WACA 1EY6A 4EVOA 4TRDA 2NUCA 4J1MA 3NXWA 5E1FA 4K8IA 4ME5A 5HGTA 5J39A 1AEXA 2EY6A 2F0KA 3NQTA 3NUCA 3OWFA 2F0LA 3SK5A 5CV6A 3TP6A 5CV5A 2F0SA 5J22A 4B9WA 1II3A 1TR5A 4K5WA 5F2DA 2OF1A 4HMIA 3NK9A 4S3SA 4ODGA 3C1EA 4K8JA 2RBMA 1NSNS 1EY8A 1SNMA 1F2MA 1F2YA 1NUCA 2ENBA 1SNOA 2LKVA 2PZUA 2QDBA 3D8GA 1EYAA 3SK6A 4DGZA 2EYHA 5C4HA 4EQNA 5I9PA 5IGBA 5KYLA 5ISRA 3V2TA 2F0IA 4IZ8A 4PNYA 5KIXA 4B9XA 4KV6A 4RKBA 5DEHA 3DMUA 1KAAA 4KHVA 1SNPA 3EROA 3OMGA 1EZ8A 3QOLA 2F0PA 4KY5A 5NUCA 1A3TA 2F0FA 4QB4A 1SYFA 4J6HA 2F0TA 3SHLA 3EJIA 4KTAA 1STAA 2SNMA 4EQOA 2M00A 1KDAA 1KDBA 1TQOA 2PZWA 2F0HA 4KJNA 4NP5A 1EY0A 1A3VA 3ITPA 4IUNA 1SNQA 4WRDA 5IOCA 5IODA 2EYJA 2F0UA 1A2TA 2PQEA 2F0JA 2PYKA 5CV9A 1STBA 3SK4A 4ZUJA 5JOBA 5DAUA 3D4DA 5CGKA 2SOBA 3QB3A 4PMBA 4LAAA 1RKNA 1A2UA 1EY9A 2EYOA 1ENCA 3T13A 4DU9A 5EKLA 1EQVA 3SXHA 5IIFA 5K5PA 2F0EA 5EGTA 5C5MA 1U9RA 1TT2A 4N9TA 1JORA 1STHA 5E3FA 4NKLA 2O4XA 5I6WA 3P75A 2EY2A 4H7BA 3R3OA 2F0GA 3OMCA 3PMFA 4DFAA 5KYIA 4QF4A 2HQEA 4K2LA 4DF7A 1EY4A 5EKKA 4I65A 4K14A 5KRUA 2KQ3A 3TP5A 5IGDA 1KABA 2EXZA 2KHSA 3OSOA 5I6YA 3MVVA 1SYGA 5IGCA 4ZQ3A 3HZXA 1A3UA 4MIUA 4OL7A 4E6IA 3BDLA 2EY1A 5CV7A 4KD4A 3SR1A 2PZTA 4F8MA 2RDFA 1STGA 5CC4A 2SNSA 4KY7A 5CV8A 4K2KA 4KD3A 2F3WA 4QMGA 3MHBA 4K5VA 4K6DA 5C6AA 4K5XA 1SYEA 3HEJA 3T16A 3TMEA 2F0VA 4RKLA 4NDXA 4KJOA 3NHHA 1SYCA 3NP8A 3VA5A 2EYLA 2F0NA 2OXPA 3TP8A 4YIJA 5IGFA 1SNCA 1KDCA 1IHZA 2F0WA
chains in the Genus database with same CATH superfamily
1BVSA 3J7ZC 3VR2A 1Y69U 1KIXA 1QNUA 1VQ9A 2B2WC 2BDNA 2MP1A 3KUPA 3AMUA 5ELNA 4G7OC 4NXMQ 4N8X1 5GAGC 1EFWA 4IOCA 3TS2A 5CV4A 2VQEQ 2JA7B 4HTHA 2PI2E 3U4ZA 3U9OA 5I4DA 4DR2L 1YI2A 3GTQB 4F7XA 3HS0C 2CQAA 4EVOA 4RFBA 3S2HB 2K7VA 2LFNA 2Q2IA 1KTKA 3NQTA 2R92B 1TWCB 1LT5D 2EJGC 1CZWA 1R4QB 1YNNC 5JEAG 4A93G 2YTXA 2Z6KA 5CORA 4HMIA 1VQHA 4OHJA 3R8BA 1NSNS 3HOVB 2DY7A 3HKZB 4S3SA 1C0AA 4QJFA 2B2UC 4KLKA 3F2UA 3Q6SA 4DUYL 2Y0SB 1I4HA 3CCLA 5LMUQ 3PUZA 1I4PA 4DV5L 3A5UA 3QOLA 1QUQA 2D62A 2UU9L 1PFBA 1STAA 3GO5A 2OWOA 3LNNA 4GN5A 3HOXH 2HHHL 3FKIG 1IYUA 4OELB 1I94Q 4M8AA 1VQ8A 2EYJA 1FYCA 2M9VA 2QW7A 4IURA 4LFCL 3QJYA 2N8NA 1BR9A 2VQFL 3QB3A 4CDCC 4TKOB 3CPFA 3ERSX 5ELBA 4HIOA 1FNWA 1I6VC 1GOZA 2BH2A 2JA5G 5CMDA 2AMCB 3BZDB 3R3OA 2B2TC 4XXEA 5EKKA 2B63B 1U4PA 5KRUA 1B3QA 1SRUA 2BE5C 1E24A 2EXZA 2KHSA 4PZ6A 2RDHA 1QZHA 2ZM6L 3DEOA 3UDIA 4RHSA 2VW9A 1YITA 4IUVA 5GAHC 1EUJA 5AJ3L 4TQUS 3TZUA 3EBEA 3OTOL 2JA8B 1Q8IA 2TSSA 3NHHA 1K0RA 4BBSB 2A8VA 4DR1Q 1WD0A 5T1IA 3K7AH 1EZ6A 3MEHA 5IT9E 3PCOB 1IXRA 4Q5VA 3S16B 3M3YB 3I4MB 3H6MA 4LWCA 1CKNA 4JI2Q 4DR4Q 1CKOA 1DCZA 3EN2A 4CBVA 4AQYQ 3MXUA 2R6GA 1XTDA 4A75A 4IPCA 3RLOA 1F77A 1W6KA 3PO2B 1MD2D 3NXWA 2PMZB 3KLSX 1VQNA 3CCSA 5C44G 1PHJA 1PTOF 5F2DA 2JN4A 3PSIA 5FLXL 3S1QH 5IP7H 2LY7A 1FR3A 4K0KL 3EQLC 3H0GB 3KK7A 5KYLA 1LTTD 4RCOA 4RWSC 4KMUC 1SFOB 3OWEB 3CKIB 4B9XA 3Q8DA 3URYA 2NWGA 4IUTA 1SNPA 2RF4A 3OPOA 5L37A 2M00A 1XWEA 3P7JA 4KJNA 3KYHC 2K05A 4NP5A 2K03A 3TZDA 1HXYD 4PV1C 2NZOA 1IL2A 1STBA 4JG2A 4EQ5A 2F4IA 3RZOB 4A3BH 1LTRD 4FXGC 4H0LC 3F2CA 3L7ZC 4I7ZC 3F2DA 2NVYB 3J80E 3NWSA 1XMOQ 4C1NK 3C2PA 2AQ3B 1IBKL 2EY2A 3OMCA 3PMFA 2R93B 3I70A 1NY4A 1XPOA 1SEBD 3ZYYX 5C4XG 1HJPA 2DNCA 3TN2A 1IBLQ 1PH3A 3ND9A 1UE1A 4LFAL 1HQRD 4A3KG 1N34Q 3EIVA 2PQAB 4IJHA 1PXUA 4C3IH 5IYDH 1GJXA 1XNQL 1Y1VG 2NN6H 4HSPA 1E1TA 2AWNA 1SDFA 2C35B 4DV1Q 1NJIC 2WP8J 4OO1I 4AH6A 3EVQA 1IHZA 4JYAQ 2A6EC 1X3QA 4DUZL 4GS3A 3WWVA 5EJWA 1AZPA 4G57A 1B7YB 4M1UB 4X3KA 4JOIA 2CH4A 2E5LQ 1S3OA 1LTID 3MWYW 1EYCA 1N9WA 4DXFA 4WJ3M 4EQPA 2VS1A 2HCIA 3K8AA 1J5EL 2A74C 1XXGA 5EQ0A 1EIGA 1NMGA 4HEDA 3OWFA 1HZAA 3NPPA 5C3EG 3CRKC 3K0XA 4BXXG 4DR7Q 1M4VA 1JJ2A 1O7LA 3HOWH 2CW0D 4NXML 4A93B 4RA8A 1GM5A 2PZUA 1P16A 2VL6A 3CC4A 2VQEL 1F9QA 1ICWA 3G48A 4UHVA 1Q1EA 4KV6A 4AYBG 2MUYA 1YNJC 1DM0B 2NB0A 1C48A 1GUOA 1U4MA 4ILWA 2G9DA 5JJLA 2J7ZA 4EQOA 2F0HA 1ESFA 3K81C 3ITPA 1TU2B 2D9UA 2YTVA 4ABNA 2R3ZA 1PTOC 1TXYA 2E75C 2EIFA 1I4XA 2SEBD 4ZUJA 4YCVA 2A1AA 4R1JA 1L0WA 1GUSA 2F52A 5DNFA 3M4QA 3SXHA 4CDFC 5LMUL 4DNTB 1AN8A 3KFUA 1F9PA 4HIMA 5H1SE 2O4XA 2ZXOA 4DR5L 4GKJQ 1AE2A 2B2WA 3FVQA 2M2LA 1RODA 2E2HH 4KK7A 2K1BA 1FNUA 2XWBB 3TP5A 4LK1C 1C8CA 3O13A 2KBNA 4GKKQ 5JJKA 4X64Q 1E7ZA 3SR1A 4IFDH 2NVTB 5GAEC 2IHEA 3QWNA 2DN8A 3GTMH 3S1MB 5C6AA 3T16A 5KNDA 1JCKB 2Q2UA 3HRZC 1TWAH 2PNRC 2F0NA 4QUCA 4IOAA 2LMCB 1RHPA 3HKZE 1WJJA 3E9HA 1WTWA 2Y0SE 4QY7A 3CW2C 4PG3A 3PF4A 3M4OH 1PVOA 3U58A 5C4ZA 1SYDA 4L5SA 4DK3C 3M85A 1F2ZA 3DWQA 3J80i 3S15H 2LSSA 5KEEA 2WAQB 5COYA 4DV0L 2EY5A 2OQ0A 1K0SA 3PUXA 1STEA 4ZYSA 2XRQD 5J3BA 1BXTA 2IL8A 1B2TA 2UUBL 2L12A 1LT4D 2NUCA 5HGTA 3NUCA 1Y1WH 1PH1A 2MO0A 3S14H 1O7YA 1V1QA 1TR5A 4OIKA 4V190 4JPBW 5EPJA 5C44B 4JI2L 2XIWA 5M5YH 5FLMG 4X3TA 2LKVA 1BCPC 1NUCA 3GV6A 4AQYL 5ISRA 1E2VA 3GD7A 1C4QA 1PTOB 2AKWB 1BBWA 3NE5B 4P2CB 3GTKB 1WFQA 1CQVA 1PLFA 1QWYA 1HTPA 1ZYRC 4XYOA 2G5DA 3J81L 4DV5Q 2XN9C 2UU9Q 1TQOA 2TMPA 4L5QA 1U5KA 2BE5D 4ZAIA 3GTLH 1X56A 4DV2Q 4UAIA 2IW3A 2J0TD 1CI3M 1S5FD 4LFBL 1SE4A 3QIAA 4YWLA 2K33A 4LFCQ 4A3DG 2VQFQ 2WB1G 1UAPA 3A0JA 5EKLA 2RQXA 4GLXA 5K5PA 4YCWA 3TDQA 3HOZG 3HP3A 3GTOB 1FGBD 2JA6B 3HFZB 1EL0A 4RGTA 1I3QH 3GTJH 1UE5A 2JJQA 3R2IA 5EBDA 1X65A 4X65L 1K28A 3PF5A 5C4XB 4OWXB 3PO3H 1EWCA 1RJTA 4OL7A 3CXCA 4B3SL 1A8VA 2ZM6Q 2K5DA 1EIFA 3PUWA 1MHWC 4A3KB 1STGA 1PH4A 3AFPA 1UE7A 3EA6A 3RLFA 4JI7L 4DV6Q 1QUQB 2D0OA 2PMZE 1XMOL 5ELDA 2F0VA 4KHPQ 4NDXA 1Y1VB 2LXKA 1SYCA 2OXPA 5CYUA 3KDFA 1KDCA 5JPMC 3A8JE 4P75A 3ERQA 2HT1A 1Z9FA 2NTSA 4A3CG 3I56A 3UE0A 5HGQA 5I9OA 1GO3E 1QOHA 3KF6A 2PW5A 2E2DC 4N8FA 3DHQA 1CK1A 3NTIA 2E2JB 3I4NH 5BN5A 1NAPA 1KL9A 2R7FA 2L5TA 4DV1L 2PPBC 1TS3A 2Z9HA 2JQOA 1XMQQ 4JV5L 3JAML 4QGUA 3SK5A 1WCMG 2VUMH 2E74C 5C3EB 2K75A 4CDDC 4BY7B 3IL8A 4ZRZA 5A35A 2Z6BA 2E5LL 1IL8A 1TWHH 1SNOA 2QEJC 3I3CA 2A69D 4KKUA 3Q22A 2L11A 5LMNW 4A3FH 3V2TA 3E6ZX 1EQRA 4KI0A 4RKBA 5DEHA 4B08A 5FJ8H 3CCUA 2BCOA 1V1OA 1AFPA 4JVZA 1IBML 2JA7H 4J6HA 1BBXC 4BS9A 3B6YA 1GKHA 4IN3A 2PZWA 3Q23A 4KKTA 4MTKA 1NR2A 1RL2A 3GTQH 2QKIC 1CKNB 1MJEA 2F03A 3S2HH 4KHZA 1DONA 1B53A 2R92H 3S1NB 1TWCH 1CM9A 2A6HD 1T5EA 5CGKA 4OWWB 4LAAA 1SSOA 1K8GA 2RVLA 3F1ZA 2OTLA 3A7AB 3HOVH 4HJ5A 1PMRA 1QILA 2ZTEA 5E7NA 2KOLA 2A6ED 4JOIC 1VQJA 2RDGA 1IBKQ 5KYIA 4IUQA 1PFMA 4QCLA 1TY0A 2NZ1D 4GN4B 1VQFA 1WTHA 2Z4HA 4LW1A 4ZKCB 4BA2I 4FYDA 1D1IA 5IGCA 2AHOB 3H3VC 2MQHA 2HQLA 1PH2A 3KLSA 5IT9c 3HOXG 4K6DA 3UDXA 3HEJA 1XNQQ 3G4SA 1RCVD 4BBRG 4GKJL 2JP1A 1XJVA 1LYLA 1IKLA 4Y7NB 2F0OA 2F0WA 4CKEA 1CA6A 4DV4L 1DGSA 3KBGA 1VF7A 2F3VA 2FFKB 4DUZQ 1CZGA 2A68D 1JOKA 2B63H 4X64L 4IPDA 2EYMA 3A5ZB 1EOVA 1HNWL 2XGTA 5CR3A 1JOOA 1VCIA 4XT1B 2IT1A 4R4OA 3J7A5 5JAVA 4FF1A 4A3MG 1STNA 4C3HB 2JA8H 2ASBA 1EQTA 3HKSA 5I2YA 2F0LA 5J22A 1PTOD 4BBSH 1D2BA 4WFN3 5KNBA 3MFGA 4K5WA 5JJIA 2K01A 4RGNA 3KJPA 1EYGA 1F2YA 1HPCA 1G2TA 3S16H 1HH2P 1O78A 3M3YH 3I4MH 4XDXA 2F0IA 5KIXA 3G6JB 4HAEA 2L1BA 1KAWA 1EWIA 3IAYA 1SYFA 3SHLA 1JWUD 3K59A 1D7QA 2K04A 3J80c 2Z0SA 2JXMB 3H09A 3V05A 4OIJA 1L0XB 4BY1H 2JK8A 2PYKA 4YHHQ 2ID0A 4O0AA 5IP9H 1WVLA 3PQIA 3OOCA 4UDUC 1ZEQX 2Q8IB 4A3DB 5EAYA 5K36G 1MSGA 3H0GH 1YHAA 1SFOH 3P75A 1PRTF 3GDEA 1BF4A 2EOTA 4H7BA 4DR5Q 1XYIA 4DV2L 4C2MH 3MXNA 1K3RA 2CFMA 2R7ZG 1IYVA 1L1OA 1I4GA 2HD3A 3OSOA 3H3VI 5A2QL 2WAQE 1HZBA 4TSSA 3VYTA 5HY6A 5C4JB 4KD4A 4JI0L 4QMGA 2DNEA 3TSSA 3RZOH 4K5XA 4C3JB 1Y14B 1NCVA 3A56A 4KKSA 3VA5A 5BN3A 2KEDA 2NVYH 3C46A 4A3BG 1NMFA 3S9WA 4IALA 2IX1A 1QZGA 2EYPA 2R93H 2CQOA 5KGUA 1DOKA 3KBXA 1X54A 4DV6L 5LL6X 1XNRL 2F0DA 4WORA 4KHPL 2EJFC 3Q0AA 5M3MB 4GOPA 3E5SA 1VQAA 2NVXB 4DV0Q 4ZCKA 3OIQA 4C3IG 5IYDG 4MN3A 2E2IB 2UUBQ 2XWJB 5J39A 4GLVB 3CD6A 3NBHB 5CV5A 2F0SA 1TWGB 1S5ED 3KJOA 4DGZA 1R9TB 4YWMA 2O2LD 4RMFA 1JJGA 3CHBD 3CAMA 1QVGA 2UXBQ 2DJFC 5EPKA 1BKBA 1XMQL 1BOSA 1E0BA 1LTSD 4LUZA 2JEBI 3PIOA 5IOCA 2OCEA 1I6HB 4QQBX 1OXSC 1TIID 1D5XC 1WTQA 2AQ2B 2RHSB 3CCMA 4XTCS 4XQNA 4LFBQ 1LTBD 4CKBA 3I55A 2QA4A 3W5OA 1RKNA 3BJUA 4DR6Q 1EY9A 1OXXK 1XPUA 1ENCA 3T13A 1PH6A 1EQVA 5IIFA 2O5IC 4HN7A 3RN2A 2ZJRA 3HOWG 3WOFA 1H9KA 2YV5A 4FDBA 4R9WA 4BA1I 5GADC 1GUGA 1EY4A 1AW7A 3A7LA 3HG9A 2UUCQ 1CUKA 3MVVA 4HIKA 4X65Q 3DXJC 3FEWX 3RMHA 2A5HA 2B29A 2RDFA 1G6PA 1LO5D 4B3SQ 3HOYG 3AQQA 3BZKA 3W3AA 2NTTA 4JI7Q 4RH6A 3PIPA 2PCFB 4OX9L 3MC0B 1SMXA 2EDGA 3HOUB 1FD7D 5IGFA 4BBRB 1PRTC 1V1PB 5EKIA 1B44D 1VQ6A 2ZT9C 5C5LA 1K8MA 1SAPA 1DD2A 1A15A 1Q8KA 3AB9A 1X6OA 4JI5Q 3C1FA 1Y8PB 3TP7A 1F9SA 1LV9A 1CSQA 4GNXC 1GD7A 3K5MA 3P1HA 2NVTH 1KQSA 3AFQA 2JSOA 3QOJA 2WINB 5M3FG 1V9PA 3S1MH 2ZXPA 1AE3A 4UP9A 4TRDA 2QDLA 3J7AF 1TS5A 3J81i 4A3MB 4IFDG 1VQBA 3H94A 1SE3A 2D5DA 3S1RB 4JV5Q 3TP6A 1LLRD 1X3PA 4B9WA 3GTPB 3BYYB 4XT3B 1GVPA 2L15A 5C0XJ 1LT6D 3VR3A 5M5XB 1PA6A 1BCPF 1EY8A 1IW7C 1PH5A 1VQMA 4MHEA 2GA4B 3GQBA 1K3BC 1TS2A 1EEID 3KDFB 5DLQE 3MAQA 1SJED 2Q2TA 1D6EC 4KY5A 4A3IG 3T56B 1E2WA 3T4AC 4JBJA 1IBMQ 1ENFA 3KF6B 3X3NA 2G9HD 2I5LX 1M90C 1EIYB 1LABA 2F0JA 4LF4L 2Z8LA 3VR4A 1YZ6A 2V1CC 1SE8A 1W2BA 2Q8RE 4XQJA 4LUVA 2A73B 1WYDA 3SVMA 1W3SA 5C0XH 1Y1WG 1HA6A 1SMYD 4RGMA 5C5MA 1U9RA 1TT2A 1PTOH 3G7LA 3GTGB 2ALYB 3GTKH 1F9RA 4K2LA 3NWTA 1WTPA 2L9HA 3U50C 2CH4W 1XPRA 1G2SA 4YHHL 1PRTB 4IFDJ 2R7ZB 5IYBH 3FKIB 4I7AA 4MTNA 3RZDB 1DOLA 1D5MC 3PIO3 3UDGA 4K5VA 1X55A 5LMNL 1SNCA 1H9JA 1RIPA 4R4IA 3TRZA 3GTOH 2RKSA 2KCMA 2JA6H 1PYSB 5G3LD 2JA5B 3K0YA 1HUNA 4ZK9B 2I0QA 3ONAB 4DV4Q 3JAMi 3RUZA 2HCCA 2PW7A 4CKCA 1JC7A 2K28A 1HNXL 3NBHA 1N32L 1B3AA 2GVAA 4POFA 3CQZB 5IWAL 1U0LA 1HNWQ 4A3KH 3ND8A 1JMCA 3I90A 4ZUIA 5LL6S 3MXGA 1VQCA 2X69A 3PO3G 1IKMA 2CHBD 4DK1A 1LTLA 4J1MA 3NTHA 1JJCB 4IJLA 3S17B 1YNND 4C3IB 1KC8C 4JI4Q 1VQ4A 2E76C 5E4WC 3PIP3 5E4XA 1Y8NB 2WB1E 4GZYC 4HCEA 3E0JA 2F4VQ 2P5ZX 2EYHA 2F1MA 4EQNA 1PH8A 1L1OC 3W1BA 3DLLA 2E2JH 3RN5A 1HRJA 3OMGA 3L9AX 4YWKA 2NN6I 1PZKD 4CJ1B 1KDBA 3I4NG 1FVIA 4JW0A 1C9OA 5I2XA 1XX8A 2NVQB 4PMWA 1KLUD 1B50A 3UDFA 1EQQA 1S40A 4BWGB 1SXTA 2AQ1B 4LMQD 3A54A 5EPLA 3OYYA 4GLAC 1VQ5A 4BY7H 4DU9A 5LHY1 2QEXA 2UXBL 5EGTA 3SGIA 1STHA 4A76A 1SLJA 5I6WA 1E22A 1EIHA 3H91A 4O42A 3ICEA 4A3FG 3CU7A 5ELCA 4Y52H 1OO9B 1QE6A 4GOPC 5FK9C 2DGYA 1X9NA 1V1PA 3L0OA 2YU9H 1LACA 1O7ZA 3DEPA 4NXNQ 4ALPA 2JA7G 4F8MA 2KCTA 2PZTA 4DR6L 3K5LA 1E1OA 3S1NH 1NBWA 4JI0Q 4A3GH 5FLXE 2I07B 3T51B 1HQMC 3HOYB 1QG7A 2D2CC 1JE4A 1WTRA 1Q7YC 3BVZA 4LF6L 2CWAA 2ZTCA 3NP8A 2RHQB 1I50B 2XNAC 4YIJA 2EJMA 2KECA 2C9OA 4IQZA 3UI2A 2UUCL 3AU7A 4OGQC 1NE3A 2HDMA 3HOVG 3BYTB 1WTVA 4YY3L 3WDNA 4DXGA 1STYA 5M5WB 2MJ8A 3JC66 1G6ZA 3KF8A 1SYBA 4DNIA 1YHBA 4C1NI 4H13C 1XNRQ 1TVXA 1RTNA 3NTKA 2OEOA 4RG1A 4L8JA 1LT3D 2VXWA 4CGYB 1LTAD 2YTYA 4N9PA 3MXNB 1GHJA 1L1OB 5M3FB 5IYCG 1ICFB 1X3EA 4P72A 4XQQA 3OIPA 1DZ1A 4HIDA 4Y7NH 1BNZA 5D65A 4JI5L 3QG1A 3E9IA 4IPGA 4X62L 1TWFH 2I46A 2PO4A 2ENBA 2XSCA 4IUPA 1JOQA 1Z7TA 1B9NA 1MGSA 1H95A 2KHJA 5I9PA 5BR8Q 4PNYA 2FHTA 1K9MC 1KHIA 1ILPA 4IFDI 5D14A 2AUKA 1ET9A 1BCPB 5NUCA 4JI3L 5IT9L 2AWOA 2B63G 1A3TA 1PH9A 2K6AA 2R7DA 2AUJD 4OXPA 4JI1L 1K83B 1KDAA 1PH7A 4A3IB 2K4KA 3VYRA 4EGVA 4A3EG 3D4RA 4A3JG 4C3HH 1EY0A 4CJ2C 2ICEC 1BO0A 1A2TA 2PQEA 3CC7A 3D6WA 5CV9A 3TBIB 4PMBA 2FJ2A 4GOPB 2ZXRA 1A6XA 3MFYA 4BBSG 1UWVA 1Y1WB 1PRTD 5FLMH 3S14B 4AYBB 1VQKA 2F0GA 2K5QA 1S5CD 1CA5A 2FMCA 4R8IA 1CT1D 4H02A 5CBEE 1KNAA 3A8KE 3J7AV 5DM73 5IGDA 4GNXA 5I6YA 4JI8Q 4ZQ3A 1B8AA 4ULLA 3HZXA 4O2DA 2PNHA 4A4IA 1ASZA 2BA0A 1H9MA 2KEEA 1VMPA 3AYHB 5FOBB 2ZJPA 4FF3A 1L0YB 3GTLB 4BY1G 1VQEA 1A0IA 1RD9D 1OXUA 3TP8A 1FJGL 4OX9Q 1K8OA 4FVMA 3UE1A 4A3DH 5IP9G 1CHPD 5IGEA 4A3LH 3PV0A 4ZKBB 1YJ9A 1HCZA 3D0FA 3EFXD 3K5OA 2HIXA 3VYUA 3N6RA 1FNVA 3RNUA 4FNFA 1VQDA 3J80L 4B3MQ 3S2DB 1PFSA 3PUVA 1Q82C 2EYFA 2KVMA 1I3QB 5C4JH 3SE0A 4X3SA 2K52A 3VYSA 1EY7A 1SR3A 3GV3A 1JT8A 1DYQA 4IUUA 2WKCA 4C3JH 1EY6A 2I5HA 1YJNA 5E1FA 1MSHA 2MGSA 3TS0A 1JWMD 2J4XA 1RDPD 3C3LA 2HIVA 1ET6A 4LNQA 2CW0C 1Z47A 1S72A 1F2MA 1MI2A 2RCNA 1PZJD 2QDBA 4DAYA 1EYAA 3SEBA 1GUTA 4DR3Q 1LUZA 4IZ8A 3T1HQ 1YNJD 2R93G 1Q86C 2RCFA 3OW2A 4L6TB 2F0FA 2F0TA 5M3MH 2KUMA 3W1GA 2NVXH 4JI4L 3DM3A 5EBCA 3L2PA 1SBBB 4DK6C 2E2IH 1G291 1H9SB 1EEFD 4C56C 3ULPA 3M7NA 4LF4Q 3K57A 1TWGH 2C5CA 2F4VL 5CBAE 1DXMA 2B2YC 2CWPA 1ZKOA 1KRTA 2MO1A 1R9TH 2XRSD 3HGBA 4O1NA 4DV3Q 4OWTB 4NKLA 4LF9Q 4DFAA 5JJZA 3LWEA 4I65A 3CCEA 4LF7Q 3NQIA 1TWHB 1T5XD 4A3FB 4H44C 2UUAL 3OHXC 3PO2H 1Y8OB 2EQSA 4OEMB 3I4OA 1I6HH 4DN4M 4AIMA 4KY7A 4KD3A 2DUDA 2F3WA 1WD1A 3ULLA 4DV7L 3I4LA 3I8ZA 4UY8C 4CHTB 1DJRD 4KJOA 2WB1B 2IPKD 2LXJA 5IP7G 1C7YA 5LMNQ 3HOZB 2ZTDA 3BG3A 2B2VC 2NYZD 4LJZC 2B3GA 3STBC 2K5HA 2F0MA 3FPUB 3J81E 1I4RA 1MBYA 2MFIA 1GXDC 4NMZA 4NXNL 4G7HC 3CCQA 5GROA 1KRSA 1UUPA 5C3WA 1VS0A 1HNXQ 1N32Q 5IWAQ 1EYDA 1RTOA 4HJ8A 1S5DD 1CSPA 3ER0A 3IFTA 1A62A 4ME5A 3FP9A 1O80A 4MZ9A 2F0KA 3HOUH 1JQYD 4LUOA 5CV6A 4BBRH 3MEFA 3K5NA 2ZJQA 2IHFA 2Q8TA 2V4DA 1S5BD 4XYQA 4ODGA 1BCPD 1OXVA 1PV4A 5FKAC 1QVFA 2MPMA 5DM63 4OO1H 2QGQA 2F3IA 1QVCA 3DMUA 1ZYRD 4KHVA 1S4ZA 4HJ7A 3PGZA 3EJIA 1EWHA 5FO8B 3A8IE 5IODA 2Q2HA 2N88A 2ATWA 2NN6G 4A3MH 4A3EB 4A3JB 3S1RH 3SK4A 5JEAJ 1WCMB 1N36L 5JOBA 1R4PB 5DAUA 3TEHB 1YJWA 2SOBA 3GTPH 5BR8L 1A2UA 1WI5A 5M5XH 1AZQA 2I5MX 4NPSA 3CRLC 1V8QA 1Q90A 2UXDL 4DPGA 4Q0FA 4R4TA 3F2BA 1YEZA 2IJ0A 2EXDA 1FGUA 1HR0W 4PZ8A 1PDQA 5IY0A 2UXCL 1CTMA 2BOSA 3DM1A 4P73A 3JAME 2WAQG 4OONA 4LF8L 3U4VA 5CC4A 1Q81C 3CP0A 1B9MA 5JEAH 2H4OA 4KN4C 4ME3A 4A93H 4X66L 5KNCA 4X6AH 2NBFA 1B1ZA 1QNKA 4PQXA 4LF6Q 1HNZL 4BY1B 3BU2A 2YYZA 3VA7A 5JPNC 4HMJA 3BDOA 3GTGH 2VNUD 5K36H 1TS4A 4JI8L 3RD4A 5C0XG 2QILA 2KA7A 2R61A 3ULJA 1FL0A 2L4NA 1GHKA 4L5TA 3FDTA 3I2ZA 4HJ9A 2L0CA 4YY3Q 1ML0D 2CCZA 2BDOA 2R7ZH 3FKIH 4B3RQ 5JVG3 4LF5Q 3RZDH 1UNSA 3QR8A 1SN8A 5IGGA 3MZ5A 3LX0A 4C2MB 3HOXB 5IYBG 1BDOA 2WACA 2Z4IA 2B8GA 2CKZB 2EPBA 2X6GA 1ESRA 3KLRA 1KLGD 3LGJA 5ELOA 1YNXA 3D31A 4X3UA 2JA5H 4V0BA 4B3ML 3BZCA 4YCUA 4X62Q 3D8GA 5C4HA 3SK6A 1EU3A 4IPHA 4AYBE 5IGBA 1H9SA 2JA6G 2A69C 1L2FA 4UPAA 1V43A 1HZCA 3CQZH 2K14A 4PZ7A 1D8LA 3M9BA 3TREA 4QB4A 4HCSA 4JI3Q 2N78A 1U4LA 2MHVA 2RSOA 4R4QA 3G6EA 4JI1Q 3M4PA 4IUNA 4CDEC 1SNQA 1HHVA 3CCVA 3S17H 1M8AA 1LTGD 3KF8B 4FO2A 4JBWA 3T53B 1N8RC 4RAUC 2A6HC 4DR3L 1ZXTA 2EVBA 3T1HL 3S24A 1NR4A 1Q46A 3FMCA 4DAVA 1MJCA 1U4RA 4N9TA 3T1YQ 3GP7A 4RGOS 1N33Q 5FLXc 1JB7A 3K7AB 4B3TQ 4JBMA 4K14A 1X3GA 3CCRA 1SYGA 1Q1BA 4U673 2Z1CA 2VB2X 1YIJA 3K80C 2NVQH 5CV7A 1E3PA 3FHWA 1TKWB 5C44H 1VQPA 4DNRB 3H15A 3P20A 2JE6I 2HDLA 2A19A 4DV3L 3AEVA 4RKLA 4LF9L 3FPPA 3U9SA 1FJGQ 3S1QB 1G51A 5FO7B 2B8FA 4LF7L 4BY7G 1QB5D 4ID6A 3SK8A 5AFWA 4RCNA 2A68C 3X3MA 1UE6A 4R8NA 4J15A 1SJHD 1OXTA 4K6LA 1OTCA 4PMCA 1HR0Q 1MIUA 4JI6Q 1UEAB 2IY5B 3BVGA 2IX0A 4UP8A 1VDZA 3HOYH 4GNXB 3NELA 2EY6A 4NB3A 1O7IA 1I4QA 1I50H 1JWSD 1JB3A 3E0EA 4A3GG 2B2YA 4A3BB 2XVSA 4U68A 1GUNA 3LWUA 1E2ZA 1SNMA 3QO2A 4FF2A 4QIWE 4G4KA 4POGA 5C4XH 1D1KA 5A2QE 5M5WH 1VQIA 1KAAA 1Q3LA 1EZ8A 4APVA 2HUGA 3CMAA 4FP5D 2GN5A 1YHQA 2RA4A 1I94L 4L5RC 1Y1VH 2E8GA 3I91A 2BA1A 1KXLA 1YVCA 1Q12A 5M3FH 2FINB 1AP0A 3SDZA 3R93A 3IRBA 1HFGA 5T1GA 4CJ0B 4Z9CB 2B2VA 2VB3X 4HSVA 2Z6KC 1HTLD 4P71A 4ZLTF 1HUMA 3DUZA 1VQGA 1CQFA 1JORA 5E3FA 3VR6A 1QCBD 3STBD 3CCJA 3G71A 2LS01 2B2UA 1KABA 1K83H 2K5NA 4DAYB 3CF5A 4A3IH 2UUAQ 1MKHA 1VF5C 3A55A 2EY1A 1WTXA 1IZ6A 2D0PA 4UP7A 3PUYA 5CV8A 3N52A 5C3EH 4BXXH 4RHRA 4C3HG 2FMMA 3TMEA 2VUMG 4DV7Q 1YBYA 4R4CA 1B70B 1A63A 2BH8A 4G7ZC 4DR1L 4DR2Q 4IO9A 2VZAA 3WOEA 2N55A 4F87A 3HOWB 1SNDA 5M9OA 3BDCA 1J9OA 4DR4L 5FJ8G 1KD1C 3D6CA 3MXPA 1DOMA 1CKMA 2B2TA 4DAPA 1UEBA 2NZHA 2K5WA 1M1KC 4DUYQ 4TVAB 4L63B 3D4WA 3K6OA 5C0XI 2R92G 2K50A 3DWAA 1CHQD 1AEXA 1B4OA 2QCPX 2GVBA 1WTOA 2IX3A 2HHHQ 1II3A 2JYOA 4JC0A 1PYBA 1ILQA 3HKZG 1NNXA 2OF1A 2KCCA 4KN7C 4WJ4A 3C1EA 3D3RA 1T9HA 2KENA 2Y0SG 3NEMA 3J7YW 4B3RL 4LF5L 4A3LG 1W6JA 1D5ZC 2PQAA 3S2DH 1J8IA 2RSNA 1G91A 2JA9A 2FXQA 3EROA 2E2HB 4HJAA 5D3DA 3DWPA 1VQLA 5GQOA 3R2TA 3W2DA 1SROA 3KLWA 3IKJA 3A74A 3KOJA 2K32A 5BN4A 3GTMB 1KNEA 4P74A 2KCNA 2L55A 3D4DA 4C3JG 1IYJB 3BS1A 1N36Q 1TWAB 2SDFA 5TSSA 1XTCD 5AJ3Q 3OTOQ 1I5FA 4FF4A 4JK1C 1EOTA 2ES2A 4FXDA 1PYWD 1NTGA 2QF7A 3M7GA 4QF4A 1IBLL 2HQEA 1VQ7A 2O5JC 2DJGC 2UXDQ 4DF7A 5G3LF 2B39A 2KQ3A 1N34L 3M4OB 3I72A 4J8QA 3MTSA 4MIUA 3S15B 2WV6D 2WFWA 3CMEA 2UXCQ 5M3MG 3J81c 4K2KA 4LF8Q 2JA8G 3MHBA 3T1YL 2KJXA 1N33L 1F2LA 4X66Q 3MA2B 4JYAL 1PZID 5ELFA 4B3TL 2EZVA 4WJWA 4EX5A 1HNZQ 5HURA 4MNOA 1ENAA 1JR0D 5M5YB 3ZJYC 5J1ZA 3I4MG 1TY2A 4KY6A 3BVMA 1EY5A 5C3XA 3I73A 3M4YA 4K0KQ 1VQOA 2F0QA 3PO2G 4FXKC 5FO9B 1X32A 3FRPB 1BQQT 1HZ9A 3H3VH 2H1EA 4JCVE 2YU9B 2K5VA 4K8IA 4DK0A 3VDYA 4DR7L 3TQYA 3HOZH 3L3OC 5JVH3 4NW2A 3K7UC 2XTIA 4A3GB 3NK9A 3RR5A 3H0GG 4K8JA 1IW7D 2RBMA 2PI2A 1GUWA 1ONLA 1EFID 1HR0L 1LM0A 4JI6L 4DAMA 2N49A 4DKAC 1K8AC 3GTJB 2OQKA 3V96A 5IE8A 1AH9A 2IWHA 2F0PA 3J81j 1VMCA 2WIIB 3NENA 4KTAA 2SNMA 1K73C 3PO3B 4JBKA 1A3VA 2MNAA 4WRDA 2F0UA 1EU4A 1HA5A 4LFAQ 2H5XA 3F8TA 2KHIA 5IYCH 1SE2A 1H9RA 3NSWA 1X3FA 3OW7A 4GN3B 1WOCA 3IFDA 4A3CH 2EYOA 2ICIA 1ASYA 3HOUG 3JAMc 3E3XA 3RLNA 2F0EA 1SMYC 1BBUA 1CFMA 2CVRA 2X6LA 4F88A 3NBIA 4QUFA 1BUVT 1G8ZD 3I7FA 2JEAI 1QJOA 1TWFB 3CPWA 2DY8A 2OT2A 4OO1G 3K58A 2EE1A 4QL5A 4GKKL 3I4NB 3CC2A 1A3UA 1JE5A 1Z6HA 4DA2A 4E6IA 3BDLA 1PFNA 2SNSA 3VR5A 4A3EH 4A3JH 1WCMH 4XIGS 1J6QA 4HR7B 1SYEA 3Q24A 1JICA 1RF2D 2VY3A 5D3IB 2OTJA 2N3SA 2EYLA 2WKDA 4QIWB 2VUMB 1HFNA 1P8LA 1J5EQ 5ELEA
chains in the Genus database with same CATH topology
3VR2A 1Y69U 1QNUA 2B2WC 2BDNA 2MP1A 3KUPA 3AMUA 4G7OC 5CV4A 2JA7B 4HTHA 3U9OA 5I4DA 3GTQB 4F7XA 3HS0C 2CQAA 4EVOA 4RFBA 3S2HB 2K7VA 2LFNA 1KTKA 3NQTA 2R92B 1TWCB 1LT5D 2EJGC 1CZWA 1R4QB 1YNNC 5JEAG 5CORA 4HMIA 4OHJA 3R8BA 1NSNS 3HOVB 2DY7A 3HKZB 4S3SA 2B2UC 3F2UA 3Q6SA 2Y0SB 1I4HA 3PUZA 1I4PA 3QOLA 2D62A 1PFBA 1STAA 3GO5A 3LNNA 1IYUA 4M8AA 2EYJA 1FYCA 2M9VA 4IURA 3QJYA 1BR9A 3QB3A 4TKOB 5ELBA 1FNWA 1I6VC 1GOZA 5CMDA 3BZDB 3R3OA 2B2TC 4XXEA 5EKKA 2B63B 1U4PA 5KRUA 2BE5C 2EXZA 2KHSA 2RDHA 3DEOA 4RHSA 4IUVA 4TQUS 3TZUA 2JA8B 1Q8IA 2TSSA 3NHHA 4BBSB 1WD0A 5T1IA 1EZ6A 3MEHA 5IT9E 4Q5VA 3S16B 3M3YB 3I4MB 3H6MA 1DCZA 4CBVA 3MXUA 2R6GA 1F77A 1W6KA 3PO2B 1MD2D 3NXWA 2PMZB 3KLSX 1PTOF 5F2DA 5FLXL 2LY7A 1FR3A 3EQLC 3H0GB 3KK7A 5KYLA 1LTTD 4RCOA 4RWSC 4KMUC 1SFOB 3OWEB 3CKIB 4B9XA 3URYA 2NWGA 4IUTA 1SNPA 3OPOA 2M00A 1XWEA 3P7JA 4KJNA 2K05A 4NP5A 2K03A 3TZDA 1HXYD 4PV1C 1STBA 2F4IA 3RZOB 1LTRD 4FXGC 4H0LC 3L7ZC 4I7ZC 2NVYB 3J80E 3NWSA 4C1NK 3C2PA 2AQ3B 2EY2A 3OMCA 3PMFA 2R93B 3I70A 1SEBD 3ZYYX 2DNCA 3TN2A 3ND9A 1HQRD 1PXUA 1GJXA 2NN6H 4HSPA 2AWNA 1SDFA 2WP8J 4OO1I 3EVQA 1IHZA 2A6EC 1X3QA 5EJWA 1AZPA 4G57A 4M1UB 4X3KA 1LTID 3MWYW 1EYCA 4DXFA 4EQPA 2HCIA 2A74C 1XXGA 5EQ0A 1EIGA 4HEDA 3OWFA 3NPPA 3CRKC 1M4VA 1O7LA 2CW0D 4A93B 4RA8A 2PZUA 1F9QA 1ICWA 1Q1EA 4KV6A 2MUYA 1YNJC 1DM0B 2NB0A 1C48A 1GUOA 1U4MA 4ILWA 2G9DA 2J7ZA 4EQOA 2F0HA 1ESFA 3ITPA 1TU2B 2D9UA 4ABNA 2R3ZA 1PTOC 2E75C 1I4XA 2SEBD 4ZUJA 1GUSA 5DNFA 3SXHA 4DNTB 1AN8A 1F9PA 2O4XA 2ZXOA 2B2WA 3FVQA 2M2LA 1RODA 4KK7A 2K1BA 1FNUA 2XWBB 3TP5A 4LK1C 1C8CA 3O13A 3SR1A 2NVTB 4IFDH 3QWNA 2DN8A 3S1MB 5C6AA 3T16A 5KNDA 1JCKB 3HRZC 2PNRC 2F0NA 4QUCA 2LMCB 1RHPA 1WTWA 5C4ZA 1SYDA 3M85A 1F2ZA 3DWQA 5KEEA 2WAQB 5COYA 2EY5A 3PUXA 1STEA 4ZYSA 2XRQD 1BXTA 2IL8A 1B2TA 2L12A 1LT4D 2NUCA 5HGTA 3NUCA 1O7YA 1TR5A 4OIKA 4V190 5EPJA 5C44B 2XIWA 4X3TA 2LKVA 1BCPC 1NUCA 3GV6A 5ISRA 1E2VA 3GD7A 1C4QA 1PTOB 3NE5B 4P2CB 3GTKB 1CQVA 1PLFA 1QWYA 1HTPA 1ZYRC 4XYOA 3J81L 2XN9C 1TQOA 2TMPA 2BE5D 4ZAIA 4UAIA 2IW3A 2J0TD 1CI3M 1S5FD 1SE4A 3QIAA 2K33A 1UAPA 5EKLA 2RQXA 5K5PA 3TDQA 3HP3A 3GTOB 1FGBD 2JA6B 1EL0A 4RGTA 3R2IA 5EBDA 5C4XB 1EWCA 1RJTA 4OL7A 2K5DA 3PUWA 4A3KB 1STGA 3EA6A 3RLFA 5ELDA 2F0VA 4NDXA 1Y1VB 1SYCA 2OXPA 5CYUA 1KDCA 5JPMC 3A8JE 3ERQA 2NTSA 5I9OA 1QOHA 2PW5A 2E2DC 3DHQA 1CK1A 3NTIA 2E2JB 5BN5A 1NAPA 2L5TA 2PPBC 1TS3A 3JAML 3SK5A 2E74C 5C3EB 4BY7B 3IL8A 4ZRZA 5A35A 1IL8A 1SNOA 2QEJC 3I3CA 2A69D 4KKUA 3Q22A 2L11A 3V2TA 3E6ZX 4KI0A 4RKBA 5DEHA 4B08A 2BCOA 1V1OA 1AFPA 4J6HA 1BBXC 4BS9A 4IN3A 2PZWA 3Q23A 4KKTA 1NR2A 2QKIC 2F03A 4KHZA 1DONA 1B53A 3S1NB 1CM9A 2A6HD 1T5EA 5CGKA 4LAAA 1SSOA 2RVLA 3A7AB 1PMRA 1QILA 2KOLA 2A6ED 2RDGA 5KYIA 4IUQA 1PFMA 4QCLA 1TY0A 2NZ1D 4ZKCB 2Z4HA 4BA2I 4FYDA 1D1IA 5IGCA 3H3VC 3KLSA 4K6DA 3HEJA 1RCVD 2JP1A 1IKLA 4Y7NB 2F0OA 2F0WA 4CKEA 1CA6A 3KBGA 1VF7A 2F3VA 2FFKB 1CZGA 2A68D 1JOKA 2EYMA 5CR3A 1JOOA 1VCIA 4XT1B 2IT1A 5JAVA 4FF1A 1STNA 4C3HB 1EQTA 5I2YA 2F0LA 5J22A 1PTOD 1D2BA 4WFN3 5KNBA 3MFGA 4K5WA 2K01A 4RGNA 1F2YA 1HPCA 1G2TA 1O78A 4XDXA 2F0IA 5KIXA 3G6JB 4HAEA 2L1BA 3IAYA 1SYFA 3SHLA 1JWUD 3K59A 2K04A 2JXMB 3H09A 3V05A 4OIJA 1L0XB 2PYKA 2ID0A 1WVLA 3OOCA 4UDUC 1ZEQX 2Q8IB 4A3DB 5K36G 1MSGA 3P75A 1PRTF 1BF4A 2EOTA 4H7BA 1XYIA 3MXNA 1IYVA 1I4GA 3OSOA 5A2QL 4TSSA 3VYTA 5C4JB 4KD4A 4QMGA 2DNEA 3TSSA 4K5XA 4C3JB 1NCVA 3A56A 4KKSA 3VA5A 5BN3A 2KEDA 3C46A 3S9WA 4IALA 2IX1A 2EYPA 5KGUA 1DOKA 3KBXA 5LL6X 2F0DA 4WORA 2EJFC 3Q0AA 5M3MB 3E5SA 2NVXB 3OIQA 4C3IG 4MN3A 2E2IB 2XWJB 5J39A 5CV5A 2F0SA 1TWGB 1S5ED 4DGZA 1R9TB 2O2LD 3CHBD 5EPKA 1BOSA 1E0BA 1LTSD 2JEBI 5IOCA 1I6HB 1OXSC 1TIID 1D5XC 1WTQA 2AQ2B 4XTCS 4XQNA 1LTBD 4CKBA 1RKNA 1EY9A 1OXXK 1ENCA 3T13A 1EQVA 5IIFA 2O5IC 4HN7A 3WOFA 1H9KA 4R9WA 4BA1I 1GUGA 1EY4A 1AW7A 3A7LA 3HG9A 3MVVA 3DXJC 3FEWX 3RMHA 2A5HA 2RDFA 1LO5D 3W3AA 2NTTA 4RH6A 2PCFB 3MC0B 2EDGA 3HOUB 1FD7D 5IGFA 4BBRB 1PRTC 1V1PB 5EKIA 1B44D 2ZT9C 5C5LA 1K8MA 1SAPA 1DD2A 1A15A 3AB9A 3C1FA 1Y8PB 3TP7A 1F9SA 1LV9A 3K5MA 3P1HA 2JSOA 3QOJA 2WINB 2ZXPA 4TRDA 3J7AF 1TS5A 4IFDG 4A3MB 3H94A 1SE3A 2D5DA 3S1RB 3TP6A 1LLRD 1X3PA 4B9WA 3GTPB 3BYYB 4XT3B 5C0XJ 1LT6D 3VR3A 5M5XB 1BCPF 1EY8A 1IW7C 4MHEA 2GA4B 3GQBA 1TS2A 1EEID 3MAQA 1SJED 1D6EC 4KY5A 3T56B 1E2WA 3T4AC 1ENFA 3X3NA 2G9HD 1LABA 2F0JA 2Z8LA 3VR4A 2Q8RE 4XQJA 2A73B 5C0XH 3SVMA 1HA6A 1SMYD 4RGMA 5C5MA 1U9RA 1TT2A 1PTOH 3G7LA 3GTGB 1F9RA 4K2LA 3NWTA 1WTPA 2L9HA 1G2SA 1PRTB 4IFDJ 2R7ZB 3FKIB 3RZDB 1DOLA 1D5MC 3PIO3 4K5VA 1H9JA 1SNCA 2RKSA 2JA5B 1HUNA 5G3LD 3K0YA 4ZK9B 3ONAB 3RUZA 2HCCA 2PW7A 4CKCA 1JC7A 2K28A 3NBHA 1B3AA 3CQZB 3ND8A 3I90A 4ZUIA 5LL6S 3MXGA 2X69A 1IKMA 2CHBD 4DK1A 4J1MA 3NTHA 3S17B 1YNND 4C3IB 2E76C 5E4WC 3PIP3 5E4XA 1Y8NB 4GZYC 4HCEA 3E0JA 2EYHA 2F1MA 4EQNA 1HRJA 3OMGA 3L9AX 2NN6I 1PZKD 4CJ1B 1KDBA 5I2XA 1XX8A 2NVQB 4PMWA 1KLUD 1B50A 4BWGB 1SXTA 2AQ1B 4LMQD 3A54A 5EPLA 4DU9A 5LHY1 5EGTA 1STHA 5I6WA 1EIHA 3H91A 4O42A 3CU7A 5ELCA 1OO9B 1QE6A 5FK9C 1V1PA 1LACA 1O7ZA 3DEPA 4F8MA 2PZTA 3K5LA 5FLXE 2I07B 3T51B 1HQMC 3HOYB 1QG7A 2D2CC 1JE4A 1WTRA 3BVZA 3NP8A 1I50B 2XNAC 4YIJA 2EJMA 2KECA 2C9OA 4IQZA 3UI2A 3AU7A 4OGQC 2HDMA 3BYTB 1WTVA 3WDNA 4DXGA 1STYA 5M5WB 2MJ8A 1G6ZA 3KF8A 1SYBA 4C1NI 4H13C 1TVXA 1RTNA 3NTKA 2OEOA 4L8JA 1LT3D 2VXWA 4CGYB 1LTAD 4N9PA 1GHJA 5M3FB 4XQQA 3OIPA 1DZ1A 1BNZA 5D65A 3QG1A 2I46A 2PO4A 2ENBA 2XSCA 4IUPA 1JOQA 1Z7TA 1B9NA 1MGSA 5I9PA 4PNYA 2FHTA 1ILPA 4IFDI 5D14A 2AUKA 1ET9A 1BCPB 5NUCA 5IT9L 2AWOA 1A3TA 2K6AA 2AUJD 1K83B 1KDAA 4A3IB 3VYRA 4EGVA 3D4RA 1EY0A 4CJ2C 2ICEC 1BO0A 1A2TA 2PQEA 3D6WA 5CV9A 3TBIB 4PMBA 2FJ2A 2ZXRA 1A6XA 3MFYA 1Y1WB 1PRTD 3S14B 4AYBB 2F0GA 2K5QA 1S5CD 1CA5A 2FMCA 4R8IA 1CT1D 5CBEE 1KNAA 3A8KE 3J7AV 5DM73 5IGDA 5I6YA 4ZQ3A 4ULLA 3HZXA 2BA0A 1H9MA 2KEEA 1VMPA 5FOBB 4FF3A 1L0YB 3GTLB 1K8OA 1RD9D 3TP8A 1OXUA 4FVMA 1CHPD 5IGEA 3PV0A 4ZKBB 1HCZA 3EFXD 3K5OA 3VYUA 3N6RA 1FNVA 4FNFA 3J80L 3S2DB 3PUVA 2EYFA 2KVMA 1I3QB 3SE0A 4X3SA 3VYSA 1EY7A 3GV3A 1DYQA 4IUUA 2WKCA 1EY6A 5E1FA 1MSHA 2MGSA 1JWMD 2J4XA 1RDPD 3C3LA 1ET6A 2CW0C 1Z47A 1F2MA 1MI2A 4DAYA 1PZJD 2QDBA 1EYAA 3SEBA 1GUTA 4IZ8A 1YNJD 4L6TB 2F0FA 2F0TA 2KUMA 5EBCA 1SBBB 1G291 1H9SB 1EEFD 4C56C 3M7NA 3K57A 2C5CA 5CBAE 1DXMA 2B2YC 1ZKOA 2XRSD 3HGBA 4O1NA 4NKLA 4DFAA 5JJZA 3LWEA 4I65A 3NQIA 1TWHB 1T5XD 4A3FB 4H44C 3OHXC 1Y8OB 4DN4M 4KY7A 4KD3A 2F3WA 1WD1A 3I4LA 3I8ZA 4CHTB 1DJRD 4KJOA 2WB1B 2IPKD 3HOZB 3BG3A 2B2VC 2NYZD 4LJZC 2F0MA 3FPUB 3J81E 1I4RA 1MBYA 1GXDC 4NMZA 4G7HC 1UUPA 5C3WA 1EYDA 1RTOA 1S5DD 3IFTA 4ME5A 1O80A 2F0KA 1JQYD 5CV6A 3K5NA 2Q8TA 2V4DA 1S5BD 4XYQA 4ODGA 1BCPD 1OXVA 5FKAC 2MPMA 5DM63 4OO1H 3DMUA 1ZYRD 4KHVA 1S4ZA 3EJIA 1EWHA 5FO8B 3A8IE 5IODA 2N88A 2NN6G 4A3EB 4A3JB 3SK4A 5JEAJ 1WCMB 5JOBA 1R4PB 5DAUA 2SOBA 1A2UA 1AZQA 3CRLC 1V8QA 1Q90A 4Q0FA 2IJ0A 1PDQA 1CTMA 2BOSA 3DM1A 3JAME 5CC4A 1B9MA 5JEAH 2H4OA 4KN4C 5KNCA 2NBFA 1B1ZA 1QNKA 4PQXA 4BY1B 2YYZA 3VA7A 5JPNC 4HMJA 3BDOA 2VNUD 5K36H 1TS4A 5C0XG 3RD4A 2QILA 2KA7A 2R61A 2L4NA 1GHKA 3FDTA 2L0CA 1ML0D 2BDOA 5JVG3 1UNSA 5IGGA 3MZ5A 3LX0A 4C2MB 3HOXB 1BDOA 2WACA 2Z4IA 2B8GA 2EPBA 2X6GA 1ESRA 3KLRA 1KLGD 4X3UA 3D31A 4V0BA 3D8GA 5C4HA 3SK6A 1EU3A 5IGBA 1H9SA 2A69C 1V43A 4QB4A 4HCSA 1U4LA 2MHVA 2RSOA 4IUNA 1SNQA 1HHVA 1M8AA 1LTGD 4FO2A 4JBWA 3T53B 4RAUC 2A6HC 1ZXTA 2EVBA 1NR4A 3FMCA 4DAVA 1U4RA 4N9TA 3GP7A 4RGOS 3K7AB 4K14A 1SYGA 1Q1BA 4U673 2Z1CA 2VB2X 5CV7A 1TKWB 4DNRB 3P20A 2JE6I 2HDLA 4RKLA 3FPPA 3U9SA 3S1QB 5FO7B 2B8FA 1QB5D 4ID6A 3SK8A 5AFWA 4RCNA 2A68C 3X3MA 4R8NA 1SJHD 1OXTA 4K6LA 4PMCA 1UEAB 3BVGA 2IX0A 1VDZA 2EY6A 1I4QA 1JWSD 1JB3A 2B2YA 4A3BB 2XVSA 4U68A 1GUNA 3LWUA 1E2ZA 1SNMA 3QO2A 4FF2A 4G4KA 1D1KA 5A2QE 1KAAA 1Q3LA 1EZ8A 2HUGA 4FP5D 2RA4A 3I91A 2BA1A 1Q12A 2FINB 1AP0A 3SDZA 3R93A 1HFGA 5T1GA 4CJ0B 4Z9CB 2B2VA 2VB3X 4HSVA 1HTLD 4ZLTF 1HUMA 3DUZA 1CQFA 1JORA 5E3FA 3VR6A 1QCBD 2LS01 2B2UA 1KABA 1VF5C 3A55A 2EY1A 1WTXA 3PUYA 5CV8A 3N52A 4RHRA 4C3HG 2FMMA 3TMEA 4G7ZC 3WOEA 2N55A 4F87A 3HOWB 1SNDA 5M9OA 3BDCA 1J9OA 3D6CA 3MXPA 1DOMA 2B2TA 4DAPA 2K5WA 4L63B 3D4WA 3K6OA 5C0XI 3DWAA 1CHQD 1AEXA 1B4OA 2QCPX 1WTOA 2IX3A 1II3A 2JYOA 1ILQA 2OF1A 2KCCA 4KN7C 3C1EA 3D3RA 3J7YW 1W6JA 1D5ZC 1J8IA 2RSNA 1G91A 3EROA 2E2HB 5D3DA 3DWPA 3R2TA 3W2DA 3IKJA 2K32A 5BN4A 3GTMB 1KNEA 2KCNA 2L55A 3D4DA 4C3JG 3BS1A 1TWAB 2SDFA 5TSSA 1XTCD 4FF4A 4JK1C 1EOTA 4FXDA 1PYWD 2QF7A 3M7GA 4QF4A 2O5JC 2HQEA 4DF7A 5G3LF 2B39A 2KQ3A 3M4OB 3I72A 4J8QA 3MTSA 4MIUA 3S15B 2WV6D 4K2KA 3MHBA 2KJXA 1F2LA 3MA2B 1PZID 5ELFA 2EZVA 4WJWA 5HURA 1ENAA 1JR0D 5M5YB 5J1ZA 1TY2A 4KY6A 3BVMA 1EY5A 5C3XA 3I73A 3M4YA 2F0QA 4FXKC 5FO9B 1X32A 3FRPB 1BQQT 2H1EA 2YU9B 4K8IA 4DK0A 3L3OC 5JVH3 4NW2A 4A3GB 3NK9A 4K8JA 1IW7D 2RBMA 1GUWA 1ONLA 1EFID 3GTJB 3V96A 2IWHA 2F0PA 1VMCA 2WIIB 4KTAA 2SNMA 3PO3B 1A3VA 4WRDA 2F0UA 1EU4A 1HA5A 1SE2A 1H9RA 3NSWA 3OW7A 3IFDA 2EYOA 2ICIA 2F0EA 1SMYC 1CFMA 2CVRA 2X6LA 4F88A 3NBIA 4QUFA 1BUVT 1G8ZD 2JEAI 1QJOA 1TWFB 2DY8A 2OT2A 4OO1G 3K58A 2EE1A 3I4NB 1A3UA 1Z6HA 4DA2A 4E6IA 3BDLA 1PFNA 2SNSA 3VR5A 4XIGS 4HR7B 1SYEA 3Q24A 1JICA 1RF2D 5D3IB 2EYLA 2WKDA 4QIWB 2VUMB 1HFNA 5ELEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EVQ A;  5HUR A;  2RKS A;  5IGE A;  3S9W A;  3ERQ A;  4HMJ A;  4IAL A;  1ENA A;  1SND A;  5C5L A;  4ID6 A;  5M9O A;  3SK8 A;  5I9O A;  2F3V A;  2F0M A;  2EYP A;  5J1Z A;  1EZ6 A;  3MEH A;  3RUZ A;  3BDC A;  2PW7 A;  1JOK A;  2PW5 A;  4G57 A;  4NMZ A;  5KGU A;  4KY6 A;  3D6C A;  3C1F A;  4R8N A;  3MXP A;  3TP7 A;  3H6M A;  1STY A;  2EYM A;  3DHQ A;  1EY5 A;  5C3X A;  5C3W A;  5C4Z A;  1SYD A;  2F0O A;  2EYF A;  1SYB A;  1F2Z A;  5CR3 A;  1EYC A;  1JOO A;  5CV4 A;  4PMC A;  2F0D A;  5KEE A;  4WOR A;  3P1H A;  1EYD A;  2EY5 A;  5IGG A;  3MZ5 A;  3LX0 A;  3QOJ A;  3E5S A;  2OEO A;  4HTH A;  2F0Q A;  1EY7 A;  4ZUI A;  4EQP A;  1JOQ A;  5JAV A;  3U9O A;  4N9P A;  3D4W A;  1STN A;  4F7X A;  2WAC A;  1EY6 A;  4EVO A;  4TRD A;  2NUC A;  4J1M A;  3NXW A;  5E1F A;  4K8I A;  4ME5 A;  5HGT A;  5J39 A;  1AEX A;  2EY6 A;  2F0K A;  3NQT A;  3NUC A;  3OWF A;  2F0L A;  3SK5 A;  5CV6 A;  3TP6 A;  5CV5 A;  2F0S A;  5J22 A;  4B9W A;  1II3 A;  1TR5 A;  4K5W A;  5F2D A;  2OF1 A;  4HMI A;  3NK9 A;  4S3S A;  4ODG A;  3C1E A;  4K8J A;  2RBM A;  1NSN S;  1EY8 A;  1SNM A;  1F2M A;  1F2Y A;  1NUC A;  2ENB A;  1SNO A;  2LKV A;  2PZU A;  2QDB A;  3D8G A;  1EYA A;  3SK6 A;  4DGZ A;  2EYH A;  5C4H A;  4EQN A;  5I9P A;  5IGB A;  5KYL A;  5ISR A;  3V2T A;  2F0I A;  4IZ8 A;  4PNY A;  5KIX A;  4B9X A;  4KV6 A;  4RKB A;  5DEH A;  3DMU A;  1KAA A;  4KHV A;  1SNP A;  3ERO A;  3OMG A;  1EZ8 A;  3QOL A;  2F0P A;  4KY5 A;  5NUC A;  1A3T A;  2F0F A;  4QB4 A;  1SYF A;  4J6H A;  2F0T A;  3SHL A;  3EJI A;  4KTA A;  1STA A;  2SNM A;  4EQO A;  2M00 A;  1KDA A;  1KDB A;  1TQO A;  2PZW A;  2F0H A;  4KJN A;  4NP5 A;  1EY0 A;  1A3V A;  3ITP A;  4IUN A;  1SNQ A;  4WRD A;  5IOC A;  5IOD A;  2EYJ A;  2F0U A;  1A2T A;  2PQE A;  2F0J A;  2PYK A;  5CV9 A;  1STB A;  3SK4 A;  4ZUJ A;  5JOB A;  5DAU A;  3D4D A;  5CGK A;  2SOB A;  3QB3 A;  4PMB A;  4LAA A;  1RKN A;  1A2U A;  1EY9 A;  2EYO A;  1ENC A;  3T13 A;  4DU9 A;  5EKL A;  1EQV A;  3SXH A;  5IIF A;  5K5P A;  2F0E A;  5EGT A;  5C5M A;  1U9R A;  1TT2 A;  4N9T A;  1JOR A;  1STH A;  5E3F A;  4NKL A;  2O4X A;  5I6W A;  3P75 A;  2EY2 A;  4H7B A;  3R3O A;  2F0G A;  3OMC A;  3PMF A;  4DFA A;  5KYI A;  4QF4 A;  2HQE A;  4K2L A;  4DF7 A;  1EY4 A;  5EKK A;  4I65 A;  4K14 A;  5KRU A;  2KQ3 A;  3TP5 A;  5IGD A;  1KAB A;  2EXZ A;  2KHS A;  3OSO A;  5I6Y A;  3MVV A;  1SYG A;  5IGC A;  4ZQ3 A;  3HZX A;  1A3U A;  4MIU A;  4OL7 A;  4E6I A;  3BDL A;  2EY1 A;  5CV7 A;  4KD4 A;  3SR1 A;  2PZT A;  4F8M A;  2RDF A;  1STG A;  5CC4 A;  2SNS A;  4KY7 A;  5CV8 A;  4K2K A;  4KD3 A;  2F3W A;  4QMG A;  3MHB A;  4K5V A;  4K6D A;  5C6A A;  4K5X A;  1SYE A;  3HEJ A;  3T16 A;  3TME A;  2F0V A;  4RKL A;  4NDX A;  4KJO A;  3NHH A;  1SYC A;  3NP8 A;  3VA5 A;  2EYL A;  2F0N A;  2OXP A;  3TP8 A;  4YIJ A;  5IGF A;  1SNC A;  1KDC A;  1IHZ A;  2F0W A; 
#chains in the Genus database with same CATH topology
 1BVS A;  3J7Z C;  3VR2 A;  1Y69 U;  1KIX A;  1QNU A;  1VQ9 A;  2B2W C;  2BDN A;  2MP1 A;  3KUP A;  3AMU A;  5ELN A;  4G7O C;  4NXM Q;  4N8X 1;  5GAG C;  1EFW A;  4IOC A;  3TS2 A;  5CV4 A;  2VQE Q;  2JA7 B;  4HTH A;  2PI2 E;  3U4Z A;  3U9O A;  5I4D A;  4DR2 L;  1YI2 A;  3GTQ B;  4F7X A;  3HS0 C;  2CQA A;  4EVO A;  4RFB A;  3S2H B;  2K7V A;  2LFN A;  2Q2I A;  1KTK A;  3NQT A;  2R92 B;  1TWC B;  1LT5 D;  2EJG C;  1CZW A;  1R4Q B;  1YNN C;  5JEA G;  4A93 G;  2YTX A;  2Z6K A;  5COR A;  4HMI A;  1VQH A;  4OHJ A;  3R8B A;  1NSN S;  3HOV B;  2DY7 A;  3HKZ B;  4S3S A;  1C0A A;  4QJF A;  2B2U C;  4KLK A;  3F2U A;  3Q6S A;  4DUY L;  2Y0S B;  1I4H A;  3CCL A;  5LMU Q;  3PUZ A;  1I4P A;  4DV5 L;  3A5U A;  3QOL A;  1QUQ A;  2D62 A;  2UU9 L;  1PFB A;  1STA A;  3GO5 A;  2OWO A;  3LNN A;  4GN5 A;  3HOX H;  2HHH L;  3FKI G;  1IYU A;  4OEL B;  1I94 Q;  4M8A A;  1VQ8 A;  2EYJ A;  1FYC A;  2M9V A;  2QW7 A;  4IUR A;  4LFC L;  3QJY A;  2N8N A;  1BR9 A;  2VQF L;  3QB3 A;  4CDC C;  4TKO B;  3CPF A;  3ERS X;  5ELB A;  4HIO A;  1FNW A;  1I6V C;  1GOZ A;  2BH2 A;  2JA5 G;  5CMD A;  2AMC B;  3BZD B;  3R3O A;  2B2T C;  4XXE A;  5EKK A;  2B63 B;  1U4P A;  5KRU A;  1B3Q A;  1SRU A;  2BE5 C;  1E24 A;  2EXZ A;  2KHS A;  4PZ6 A;  2RDH A;  1QZH A;  2ZM6 L;  3DEO A;  3UDI A;  4RHS A;  2VW9 A;  1YIT A;  4IUV A;  5GAH C;  1EUJ A;  5AJ3 L;  4TQU S;  3TZU A;  3EBE A;  3OTO L;  2JA8 B;  1Q8I A;  2TSS A;  3NHH A;  1K0R A;  4BBS B;  2A8V A;  4DR1 Q;  1WD0 A;  5T1I A;  3K7A H;  1EZ6 A;  3MEH A;  5IT9 E;  3PCO B;  1IXR A;  4Q5V A;  3S16 B;  3M3Y B;  3I4M B;  3H6M A;  4LWC A;  1CKN A;  4JI2 Q;  4DR4 Q;  1CKO A;  1DCZ A;  3EN2 A;  4CBV A;  4AQY Q;  3MXU A;  2R6G A;  1XTD A;  4A75 A;  4IPC A;  3RLO A;  1F77 A;  1W6K A;  3PO2 B;  1MD2 D;  3NXW A;  2PMZ B;  3KLS X;  1VQN A;  3CCS A;  5C44 G;  1PHJ A;  1PTO F;  5F2D A;  2JN4 A;  3PSI A;  5FLX L;  3S1Q H;  5IP7 H;  2LY7 A;  1FR3 A;  4K0K L;  3EQL C;  3H0G B;  3KK7 A;  5KYL A;  1LTT D;  4RCO A;  4RWS C;  4KMU C;  1SFO B;  3OWE B;  3CKI B;  4B9X A;  3Q8D A;  3URY A;  2NWG A;  4IUT A;  1SNP A;  2RF4 A;  3OPO A;  5L37 A;  2M00 A;  1XWE A;  3P7J A;  4KJN A;  3KYH C;  2K05 A;  4NP5 A;  2K03 A;  3TZD A;  1HXY D;  4PV1 C;  2NZO A;  1IL2 A;  1STB A;  4JG2 A;  4EQ5 A;  2F4I A;  3RZO B;  4A3B H;  1LTR D;  4FXG C;  4H0L C;  3F2C A;  3L7Z C;  4I7Z C;  3F2D A;  2NVY B;  3J80 E;  3NWS A;  1XMO Q;  4C1N K;  3C2P A;  2AQ3 B;  1IBK L;  2EY2 A;  3OMC A;  3PMF A;  2R93 B;  3I70 A;  1NY4 A;  1XPO A;  1SEB D;  3ZYY X;  5C4X G;  1HJP A;  2DNC A;  3TN2 A;  1IBL Q;  1PH3 A;  3ND9 A;  1UE1 A;  4LFA L;  1HQR D;  4A3K G;  1N34 Q;  3EIV A;  2PQA B;  4IJH A;  1PXU A;  4C3I H;  5IYD H;  1GJX A;  1XNQ L;  1Y1V G;  2NN6 H;  4HSP A;  1E1T A;  2AWN A;  1SDF A;  2C35 B;  4DV1 Q;  1NJI C;  2WP8 J;  4OO1 I;  4AH6 A;  3EVQ A;  1IHZ A;  4JYA Q;  2A6E C;  1X3Q A;  4DUZ L;  4GS3 A;  3WWV A;  5EJW A;  1AZP A;  4G57 A;  1B7Y B;  4M1U B;  4X3K A;  4JOI A;  2CH4 A;  2E5L Q;  1S3O A;  1LTI D;  3MWY W;  1EYC A;  1N9W A;  4DXF A;  4WJ3 M;  4EQP A;  2VS1 A;  2HCI A;  3K8A A;  1J5E L;  2A74 C;  1XXG A;  5EQ0 A;  1EIG A;  1NMG A;  4HED A;  3OWF A;  1HZA A;  3NPP A;  5C3E G;  3CRK C;  3K0X A;  4BXX G;  4DR7 Q;  1M4V A;  1JJ2 A;  1O7L A;  3HOW H;  2CW0 D;  4NXM L;  4A93 B;  4RA8 A;  1GM5 A;  2PZU A;  1P16 A;  2VL6 A;  3CC4 A;  2VQE L;  1F9Q A;  1ICW A;  3G48 A;  4UHV A;  1Q1E A;  4KV6 A;  4AYB G;  2MUY A;  1YNJ C;  1DM0 B;  2NB0 A;  1C48 A;  1GUO A;  1U4M A;  4ILW A;  2G9D A;  5JJL A;  2J7Z A;  4EQO A;  2F0H A;  1ESF A;  3K81 C;  3ITP A;  1TU2 B;  2D9U A;  2YTV A;  4ABN A;  2R3Z A;  1PTO C;  1TXY A;  2E75 C;  2EIF A;  1I4X A;  2SEB D;  4ZUJ A;  4YCV A;  2A1A A;  4R1J A;  1L0W A;  1GUS A;  2F52 A;  5DNF A;  3M4Q A;  3SXH A;  4CDF C;  5LMU L;  4DNT B;  1AN8 A;  3KFU A;  1F9P A;  4HIM A;  5H1S E;  2O4X A;  2ZXO A;  4DR5 L;  4GKJ Q;  1AE2 A;  2B2W A;  3FVQ A;  2M2L A;  1ROD A;  2E2H H;  4KK7 A;  2K1B A;  1FNU A;  2XWB B;  3TP5 A;  4LK1 C;  1C8C A;  3O13 A;  2KBN A;  4GKK Q;  5JJK A;  4X64 Q;  1E7Z A;  3SR1 A;  4IFD H;  2NVT B;  5GAE C;  2IHE A;  3QWN A;  2DN8 A;  3GTM H;  3S1M B;  5C6A A;  3T16 A;  5KND A;  1JCK B;  2Q2U A;  3HRZ C;  1TWA H;  2PNR C;  2F0N A;  4QUC A;  4IOA A;  2LMC B;  1RHP A;  3HKZ E;  1WJJ A;  3E9H A;  1WTW A;  2Y0S E;  4QY7 A;  3CW2 C;  4PG3 A;  3PF4 A;  3M4O H;  1PVO A;  3U58 A;  5C4Z A;  1SYD A;  4L5S A;  4DK3 C;  3M85 A;  1F2Z A;  3DWQ A;  3J80 i;  3S15 H;  2LSS A;  5KEE A;  2WAQ B;  5COY A;  4DV0 L;  2EY5 A;  2OQ0 A;  1K0S A;  3PUX A;  1STE A;  4ZYS A;  2XRQ D;  5J3B A;  1BXT A;  2IL8 A;  1B2T A;  2UUB L;  2L12 A;  1LT4 D;  2NUC A;  5HGT A;  3NUC A;  1Y1W H;  1PH1 A;  2MO0 A;  3S14 H;  1O7Y A;  1V1Q A;  1TR5 A;  4OIK A;  4V19 0;  4JPB W;  5EPJ A;  5C44 B;  4JI2 L;  2XIW A;  5M5Y H;  5FLM G;  4X3T A;  2LKV A;  1BCP C;  1NUC A;  3GV6 A;  4AQY L;  5ISR A;  1E2V A;  3GD7 A;  1C4Q A;  1PTO B;  2AKW B;  1BBW A;  3NE5 B;  4P2C B;  3GTK B;  1WFQ A;  1CQV A;  1PLF A;  1QWY A;  1HTP A;  1ZYR C;  4XYO A;  2G5D A;  3J81 L;  4DV5 Q;  2XN9 C;  2UU9 Q;  1TQO A;  2TMP A;  4L5Q A;  1U5K A;  2BE5 D;  4ZAI A;  3GTL H;  1X56 A;  4DV2 Q;  4UAI A;  2IW3 A;  2J0T D;  1CI3 M;  1S5F D;  4LFB L;  1SE4 A;  3QIA A;  4YWL A;  2K33 A;  4LFC Q;  4A3D G;  2VQF Q;  2WB1 G;  1UAP A;  3A0J A;  5EKL A;  2RQX A;  4GLX A;  5K5P A;  4YCW A;  3TDQ A;  3HOZ G;  3HP3 A;  3GTO B;  1FGB D;  2JA6 B;  3HFZ B;  1EL0 A;  4RGT A;  1I3Q H;  3GTJ H;  1UE5 A;  2JJQ A;  3R2I A;  5EBD A;  1X65 A;  4X65 L;  1K28 A;  3PF5 A;  5C4X B;  4OWX B;  3PO3 H;  1EWC A;  1RJT A;  4OL7 A;  3CXC A;  4B3S L;  1A8V A;  2ZM6 Q;  2K5D A;  1EIF A;  3PUW A;  1MHW C;  4A3K B;  1STG A;  1PH4 A;  3AFP A;  1UE7 A;  3EA6 A;  3RLF A;  4JI7 L;  4DV6 Q;  1QUQ B;  2D0O A;  2PMZ E;  1XMO L;  5ELD A;  2F0V A;  4KHP Q;  4NDX A;  1Y1V B;  2LXK A;  1SYC A;  2OXP A;  5CYU A;  3KDF A;  1KDC A;  5JPM C;  3A8J E;  4P75 A;  3ERQ A;  2HT1 A;  1Z9F A;  2NTS A;  4A3C G;  3I56 A;  3UE0 A;  5HGQ A;  5I9O A;  1GO3 E;  1QOH A;  3KF6 A;  2PW5 A;  2E2D C;  4N8F A;  3DHQ A;  1CK1 A;  3NTI A;  2E2J B;  3I4N H;  5BN5 A;  1NAP A;  1KL9 A;  2R7F A;  2L5T A;  4DV1 L;  2PPB C;  1TS3 A;  2Z9H A;  2JQO A;  1XMQ Q;  4JV5 L;  3JAM L;  4QGU A;  3SK5 A;  1WCM G;  2VUM H;  2E74 C;  5C3E B;  2K75 A;  4CDD C;  4BY7 B;  3IL8 A;  4ZRZ A;  5A35 A;  2Z6B A;  2E5L L;  1IL8 A;  1TWH H;  1SNO A;  2QEJ C;  3I3C A;  2A69 D;  4KKU A;  3Q22 A;  2L11 A;  5LMN W;  4A3F H;  3V2T A;  3E6Z X;  1EQR A;  4KI0 A;  4RKB A;  5DEH A;  4B08 A;  5FJ8 H;  3CCU A;  2BCO A;  1V1O A;  1AFP A;  4JVZ A;  1IBM L;  2JA7 H;  4J6H A;  1BBX C;  4BS9 A;  3B6Y A;  1GKH A;  4IN3 A;  2PZW A;  3Q23 A;  4KKT A;  4MTK A;  1NR2 A;  1RL2 A;  3GTQ H;  2QKI C;  1CKN B;  1MJE A;  2F03 A;  3S2H H;  4KHZ A;  1DON A;  1B53 A;  2R92 H;  3S1N B;  1TWC H;  1CM9 A;  2A6H D;  1T5E A;  5CGK A;  4OWW B;  4LAA A;  1SSO A;  1K8G A;  2RVL A;  3F1Z A;  2OTL A;  3A7A B;  3HOV H;  4HJ5 A;  1PMR A;  1QIL A;  2ZTE A;  5E7N A;  2KOL A;  2A6E D;  4JOI C;  1VQJ A;  2RDG A;  1IBK Q;  5KYI A;  4IUQ A;  1PFM A;  4QCL A;  1TY0 A;  2NZ1 D;  4GN4 B;  1VQF A;  1WTH A;  2Z4H A;  4LW1 A;  4ZKC B;  4BA2 I;  4FYD A;  1D1I A;  5IGC A;  2AHO B;  3H3V C;  2MQH A;  2HQL A;  1PH2 A;  3KLS A;  5IT9 c;  3HOX G;  4K6D A;  3UDX A;  3HEJ A;  1XNQ Q;  3G4S A;  1RCV D;  4BBR G;  4GKJ L;  2JP1 A;  1XJV A;  1LYL A;  1IKL A;  4Y7N B;  2F0O A;  2F0W A;  4CKE A;  1CA6 A;  4DV4 L;  1DGS A;  3KBG A;  1VF7 A;  2F3V A;  2FFK B;  4DUZ Q;  1CZG A;  2A68 D;  1JOK A;  2B63 H;  4X64 L;  4IPD A;  2EYM A;  3A5Z B;  1EOV A;  1HNW L;  2XGT A;  5CR3 A;  1JOO A;  1VCI A;  4XT1 B;  2IT1 A;  4R4O A;  3J7A 5;  5JAV A;  4FF1 A;  4A3M G;  1STN A;  4C3H B;  2JA8 H;  2ASB A;  1EQT A;  3HKS A;  5I2Y A;  2F0L A;  5J22 A;  1PTO D;  4BBS H;  1D2B A;  4WFN 3;  5KNB A;  3MFG A;  4K5W A;  5JJI A;  2K01 A;  4RGN A;  3KJP A;  1EYG A;  1F2Y A;  1HPC A;  1G2T A;  3S16 H;  1HH2 P;  1O78 A;  3M3Y H;  3I4M H;  4XDX A;  2F0I A;  5KIX A;  3G6J B;  4HAE A;  2L1B A;  1KAW A;  1EWI A;  3IAY A;  1SYF A;  3SHL A;  1JWU D;  3K59 A;  1D7Q A;  2K04 A;  3J80 c;  2Z0S A;  2JXM B;  3H09 A;  3V05 A;  4OIJ A;  1L0X B;  4BY1 H;  2JK8 A;  2PYK A;  4YHH Q;  2ID0 A;  4O0A A;  5IP9 H;  1WVL A;  3PQI A;  3OOC A;  4UDU C;  1ZEQ X;  2Q8I B;  4A3D B;  5EAY A;  5K36 G;  1MSG A;  3H0G H;  1YHA A;  1SFO H;  3P75 A;  1PRT F;  3GDE A;  1BF4 A;  2EOT A;  4H7B A;  4DR5 Q;  1XYI A;  4DV2 L;  4C2M H;  3MXN A;  1K3R A;  2CFM A;  2R7Z G;  1IYV A;  1L1O A;  1I4G A;  2HD3 A;  3OSO A;  3H3V I;  5A2Q L;  2WAQ E;  1HZB A;  4TSS A;  3VYT A;  5HY6 A;  5C4J B;  4KD4 A;  4JI0 L;  4QMG A;  2DNE A;  3TSS A;  3RZO H;  4K5X A;  4C3J B;  1Y14 B;  1NCV A;  3A56 A;  4KKS A;  3VA5 A;  5BN3 A;  2KED A;  2NVY H;  3C46 A;  4A3B G;  1NMF A;  3S9W A;  4IAL A;  2IX1 A;  1QZG A;  2EYP A;  2R93 H;  2CQO A;  5KGU A;  1DOK A;  3KBX A;  1X54 A;  4DV6 L;  5LL6 X;  1XNR L;  2F0D A;  4WOR A;  4KHP L;  2EJF C;  3Q0A A;  5M3M B;  4GOP A;  3E5S A;  1VQA A;  2NVX B;  4DV0 Q;  4ZCK A;  3OIQ A;  4C3I G;  5IYD G;  4MN3 A;  2E2I B;  2UUB Q;  2XWJ B;  5J39 A;  4GLV B;  3CD6 A;  3NBH B;  5CV5 A;  2F0S A;  1TWG B;  1S5E D;  3KJO A;  4DGZ A;  1R9T B;  4YWM A;  2O2L D;  4RMF A;  1JJG A;  3CHB D;  3CAM A;  1QVG A;  2UXB Q;  2DJF C;  5EPK A;  1BKB A;  1XMQ L;  1BOS A;  1E0B A;  1LTS D;  4LUZ A;  2JEB I;  3PIO A;  5IOC A;  2OCE A;  1I6H B;  4QQB X;  1OXS C;  1TII D;  1D5X C;  1WTQ A;  2AQ2 B;  2RHS B;  3CCM A;  4XTC S;  4XQN A;  4LFB Q;  1LTB D;  4CKB A;  3I55 A;  2QA4 A;  3W5O A;  1RKN A;  3BJU A;  4DR6 Q;  1EY9 A;  1OXX K;  1XPU A;  1ENC A;  3T13 A;  1PH6 A;  1EQV A;  5IIF A;  2O5I C;  4HN7 A;  3RN2 A;  2ZJR A;  3HOW G;  3WOF A;  1H9K A;  2YV5 A;  4FDB A;  4R9W A;  4BA1 I;  5GAD C;  1GUG A;  1EY4 A;  1AW7 A;  3A7L A;  3HG9 A;  2UUC Q;  1CUK A;  3MVV A;  4HIK A;  4X65 Q;  3DXJ C;  3FEW X;  3RMH A;  2A5H A;  2B29 A;  2RDF A;  1G6P A;  1LO5 D;  4B3S Q;  3HOY G;  3AQQ A;  3BZK A;  3W3A A;  2NTT A;  4JI7 Q;  4RH6 A;  3PIP A;  2PCF B;  4OX9 L;  3MC0 B;  1SMX A;  2EDG A;  3HOU B;  1FD7 D;  5IGF A;  4BBR B;  1PRT C;  1V1P B;  5EKI A;  1B44 D;  1VQ6 A;  2ZT9 C;  5C5L A;  1K8M A;  1SAP A;  1DD2 A;  1A15 A;  1Q8K A;  3AB9 A;  1X6O A;  4JI5 Q;  3C1F A;  1Y8P B;  3TP7 A;  1F9S A;  1LV9 A;  1CSQ A;  4GNX C;  1GD7 A;  3K5M A;  3P1H A;  2NVT H;  1KQS A;  3AFQ A;  2JSO A;  3QOJ A;  2WIN B;  5M3F G;  1V9P A;  3S1M H;  2ZXP A;  1AE3 A;  4UP9 A;  4TRD A;  2QDL A;  3J7A F;  1TS5 A;  3J81 i;  4A3M B;  4IFD G;  1VQB A;  3H94 A;  1SE3 A;  2D5D A;  3S1R B;  4JV5 Q;  3TP6 A;  1LLR D;  1X3P A;  4B9W A;  3GTP B;  3BYY B;  4XT3 B;  1GVP A;  2L15 A;  5C0X J;  1LT6 D;  3VR3 A;  5M5X B;  1PA6 A;  1BCP F;  1EY8 A;  1IW7 C;  1PH5 A;  1VQM A;  4MHE A;  2GA4 B;  3GQB A;  1K3B C;  1TS2 A;  1EEI D;  3KDF B;  5DLQ E;  3MAQ A;  1SJE D;  2Q2T A;  1D6E C;  4KY5 A;  4A3I G;  3T56 B;  1E2W A;  3T4A C;  4JBJ A;  1IBM Q;  1ENF A;  3KF6 B;  3X3N A;  2G9H D;  2I5L X;  1M90 C;  1EIY B;  1LAB A;  2F0J A;  4LF4 L;  2Z8L A;  3VR4 A;  1YZ6 A;  2V1C C;  1SE8 A;  1W2B A;  2Q8R E;  4XQJ A;  4LUV A;  2A73 B;  1WYD A;  3SVM A;  1W3S A;  5C0X H;  1Y1W G;  1HA6 A;  1SMY D;  4RGM A;  5C5M A;  1U9R A;  1TT2 A;  1PTO H;  3G7L A;  3GTG B;  2ALY B;  3GTK H;  1F9R A;  4K2L A;  3NWT A;  1WTP A;  2L9H A;  3U50 C;  2CH4 W;  1XPR A;  1G2S A;  4YHH L;  1PRT B;  4IFD J;  2R7Z B;  5IYB H;  3FKI B;  4I7A A;  4MTN A;  3RZD B;  1DOL A;  1D5M C;  3PIO 3;  3UDG A;  4K5V A;  1X55 A;  5LMN L;  1SNC A;  1H9J A;  1RIP A;  4R4I A;  3TRZ A;  3GTO H;  2RKS A;  2KCM A;  2JA6 H;  1PYS B;  5G3L D;  2JA5 B;  3K0Y A;  1HUN A;  4ZK9 B;  2I0Q A;  3ONA B;  4DV4 Q;  3JAM i;  3RUZ A;  2HCC A;  2PW7 A;  4CKC A;  1JC7 A;  2K28 A;  1HNX L;  3NBH A;  1N32 L;  1B3A A;  2GVA A;  4POF A;  3CQZ B;  5IWA L;  1U0L A;  1HNW Q;  4A3K H;  3ND8 A;  1JMC A;  3I90 A;  4ZUI A;  5LL6 S;  3MXG A;  1VQC A;  2X69 A;  3PO3 G;  1IKM A;  2CHB D;  4DK1 A;  1LTL A;  4J1M A;  3NTH A;  1JJC B;  4IJL A;  3S17 B;  1YNN D;  4C3I B;  1KC8 C;  4JI4 Q;  1VQ4 A;  2E76 C;  5E4W C;  3PIP 3;  5E4X A;  1Y8N B;  2WB1 E;  4GZY C;  4HCE A;  3E0J A;  2F4V Q;  2P5Z X;  2EYH A;  2F1M A;  4EQN A;  1PH8 A;  1L1O C;  3W1B A;  3DLL A;  2E2J H;  3RN5 A;  1HRJ A;  3OMG A;  3L9A X;  4YWK A;  2NN6 I;  1PZK D;  4CJ1 B;  1KDB A;  3I4N G;  1FVI A;  4JW0 A;  1C9O A;  5I2X A;  1XX8 A;  2NVQ B;  4PMW A;  1KLU D;  1B50 A;  3UDF A;  1EQQ A;  1S40 A;  4BWG B;  1SXT A;  2AQ1 B;  4LMQ D;  3A54 A;  5EPL A;  3OYY A;  4GLA C;  1VQ5 A;  4BY7 H;  4DU9 A;  5LHY 1;  2QEX A;  2UXB L;  5EGT A;  3SGI A;  1STH A;  4A76 A;  1SLJ A;  5I6W A;  1E22 A;  1EIH A;  3H91 A;  4O42 A;  3ICE A;  4A3F G;  3CU7 A;  5ELC A;  4Y52 H;  1OO9 B;  1QE6 A;  4GOP C;  5FK9 C;  2DGY A;  1X9N A;  1V1P A;  3L0O A;  2YU9 H;  1LAC A;  1O7Z A;  3DEP A;  4NXN Q;  4ALP A;  2JA7 G;  4F8M A;  2KCT A;  2PZT A;  4DR6 L;  3K5L A;  1E1O A;  3S1N H;  1NBW A;  4JI0 Q;  4A3G H;  5FLX E;  2I07 B;  3T51 B;  1HQM C;  3HOY B;  1QG7 A;  2D2C C;  1JE4 A;  1WTR A;  1Q7Y C;  3BVZ A;  4LF6 L;  2CWA A;  2ZTC A;  3NP8 A;  2RHQ B;  1I50 B;  2XNA C;  4YIJ A;  2EJM A;  2KEC A;  2C9O A;  4IQZ A;  3UI2 A;  2UUC L;  3AU7 A;  4OGQ C;  1NE3 A;  2HDM A;  3HOV G;  3BYT B;  1WTV A;  4YY3 L;  3WDN A;  4DXG A;  1STY A;  5M5W B;  2MJ8 A;  3JC6 6;  1G6Z A;  3KF8 A;  1SYB A;  4DNI A;  1YHB A;  4C1N I;  4H13 C;  1XNR Q;  1TVX A;  1RTN A;  3NTK A;  2OEO A;  4RG1 A;  4L8J A;  1LT3 D;  2VXW A;  4CGY B;  1LTA D;  2YTY A;  4N9P A;  3MXN B;  1GHJ A;  1L1O B;  5M3F B;  5IYC G;  1ICF B;  1X3E A;  4P72 A;  4XQQ A;  3OIP A;  1DZ1 A;  4HID A;  4Y7N H;  1BNZ A;  5D65 A;  4JI5 L;  3QG1 A;  3E9I A;  4IPG A;  4X62 L;  1TWF H;  2I46 A;  2PO4 A;  2ENB A;  2XSC A;  4IUP A;  1JOQ A;  1Z7T A;  1B9N A;  1MGS A;  1H95 A;  2KHJ A;  5I9P A;  5BR8 Q;  4PNY A;  2FHT A;  1K9M C;  1KHI A;  1ILP A;  4IFD I;  5D14 A;  2AUK A;  1ET9 A;  1BCP B;  5NUC A;  4JI3 L;  5IT9 L;  2AWO A;  2B63 G;  1A3T A;  1PH9 A;  2K6A A;  2R7D A;  2AUJ D;  4OXP A;  4JI1 L;  1K83 B;  1KDA A;  1PH7 A;  4A3I B;  2K4K A;  3VYR A;  4EGV A;  4A3E G;  3D4R A;  4A3J G;  4C3H H;  1EY0 A;  4CJ2 C;  2ICE C;  1BO0 A;  1A2T A;  2PQE A;  3CC7 A;  3D6W A;  5CV9 A;  3TBI B;  4PMB A;  2FJ2 A;  4GOP B;  2ZXR A;  1A6X A;  3MFY A;  4BBS G;  1UWV A;  1Y1W B;  1PRT D;  5FLM H;  3S14 B;  4AYB B;  1VQK A;  2F0G A;  2K5Q A;  1S5C D;  1CA5 A;  2FMC A;  4R8I A;  1CT1 D;  4H02 A;  5CBE E;  1KNA A;  3A8K E;  3J7A V;  5DM7 3;  5IGD A;  4GNX A;  5I6Y A;  4JI8 Q;  4ZQ3 A;  1B8A A;  4ULL A;  3HZX A;  4O2D A;  2PNH A;  4A4I A;  1ASZ A;  2BA0 A;  1H9M A;  2KEE A;  1VMP A;  3AYH B;  5FOB B;  2ZJP A;  4FF3 A;  1L0Y B;  3GTL B;  4BY1 G;  1VQE A;  1A0I A;  1RD9 D;  1OXU A;  3TP8 A;  1FJG L;  4OX9 Q;  1K8O A;  4FVM A;  3UE1 A;  4A3D H;  5IP9 G;  1CHP D;  5IGE A;  4A3L H;  3PV0 A;  4ZKB B;  1YJ9 A;  1HCZ A;  3D0F A;  3EFX D;  3K5O A;  2HIX A;  3VYU A;  3N6R A;  1FNV A;  3RNU A;  4FNF A;  1VQD A;  3J80 L;  4B3M Q;  3S2D B;  1PFS A;  3PUV A;  1Q82 C;  2EYF A;  2KVM A;  1I3Q B;  5C4J H;  3SE0 A;  4X3S A;  2K52 A;  3VYS A;  1EY7 A;  1SR3 A;  3GV3 A;  1JT8 A;  1DYQ A;  4IUU A;  2WKC A;  4C3J H;  1EY6 A;  2I5H A;  1YJN A;  5E1F A;  1MSH A;  2MGS A;  3TS0 A;  1JWM D;  2J4X A;  1RDP D;  3C3L A;  2HIV A;  1ET6 A;  4LNQ A;  2CW0 C;  1Z47 A;  1S72 A;  1F2M A;  1MI2 A;  2RCN A;  1PZJ D;  2QDB A;  4DAY A;  1EYA A;  3SEB A;  1GUT A;  4DR3 Q;  1LUZ A;  4IZ8 A;  3T1H Q;  1YNJ D;  2R93 G;  1Q86 C;  2RCF A;  3OW2 A;  4L6T B;  2F0F A;  2F0T A;  5M3M H;  2KUM A;  3W1G A;  2NVX H;  4JI4 L;  3DM3 A;  5EBC A;  3L2P A;  1SBB B;  4DK6 C;  2E2I H;  1G29 1;  1H9S B;  1EEF D;  4C56 C;  3ULP A;  3M7N A;  4LF4 Q;  3K57 A;  1TWG H;  2C5C A;  2F4V L;  5CBA E;  1DXM A;  2B2Y C;  2CWP A;  1ZKO A;  1KRT A;  2MO1 A;  1R9T H;  2XRS D;  3HGB A;  4O1N A;  4DV3 Q;  4OWT B;  4NKL A;  4LF9 Q;  4DFA A;  5JJZ A;  3LWE A;  4I65 A;  3CCE A;  4LF7 Q;  3NQI A;  1TWH B;  1T5X D;  4A3F B;  4H44 C;  2UUA L;  3OHX C;  3PO2 H;  1Y8O B;  2EQS A;  4OEM B;  3I4O A;  1I6H H;  4DN4 M;  4AIM A;  4KY7 A;  4KD3 A;  2DUD A;  2F3W A;  1WD1 A;  3ULL A;  4DV7 L;  3I4L A;  3I8Z A;  4UY8 C;  4CHT B;  1DJR D;  4KJO A;  2WB1 B;  2IPK D;  2LXJ A;  5IP7 G;  1C7Y A;  5LMN Q;  3HOZ B;  2ZTD A;  3BG3 A;  2B2V C;  2NYZ D;  4LJZ C;  2B3G A;  3STB C;  2K5H A;  2F0M A;  3FPU B;  3J81 E;  1I4R A;  1MBY A;  2MFI A;  1GXD C;  4NMZ A;  4NXN L;  4G7H C;  3CCQ A;  5GRO A;  1KRS A;  1UUP A;  5C3W A;  1VS0 A;  1HNX Q;  1N32 Q;  5IWA Q;  1EYD A;  1RTO A;  4HJ8 A;  1S5D D;  1CSP A;  3ER0 A;  3IFT A;  1A62 A;  4ME5 A;  3FP9 A;  1O80 A;  4MZ9 A;  2F0K A;  3HOU H;  1JQY D;  4LUO A;  5CV6 A;  4BBR H;  3MEF A;  3K5N A;  2ZJQ A;  2IHF A;  2Q8T A;  2V4D A;  1S5B D;  4XYQ A;  4ODG A;  1BCP D;  1OXV A;  1PV4 A;  5FKA C;  1QVF A;  2MPM A;  5DM6 3;  4OO1 H;  2QGQ A;  2F3I A;  1QVC A;  3DMU A;  1ZYR D;  4KHV A;  1S4Z A;  4HJ7 A;  3PGZ A;  3EJI A;  1EWH A;  5FO8 B;  3A8I E;  5IOD A;  2Q2H A;  2N88 A;  2ATW A;  2NN6 G;  4A3M H;  4A3E B;  4A3J B;  3S1R H;  3SK4 A;  5JEA J;  1WCM B;  1N36 L;  5JOB A;  1R4P B;  5DAU A;  3TEH B;  1YJW A;  2SOB A;  3GTP H;  5BR8 L;  1A2U A;  1WI5 A;  5M5X H;  1AZQ A;  2I5M X;  4NPS A;  3CRL C;  1V8Q A;  1Q90 A;  2UXD L;  4DPG A;  4Q0F A;  4R4T A;  3F2B A;  1YEZ A;  2IJ0 A;  2EXD A;  1FGU A;  1HR0 W;  4PZ8 A;  1PDQ A;  5IY0 A;  2UXC L;  1CTM A;  2BOS A;  3DM1 A;  4P73 A;  3JAM E;  2WAQ G;  4OON A;  4LF8 L;  3U4V A;  5CC4 A;  1Q81 C;  3CP0 A;  1B9M A;  5JEA H;  2H4O A;  4KN4 C;  4ME3 A;  4A93 H;  4X66 L;  5KNC A;  4X6A H;  2NBF A;  1B1Z A;  1QNK A;  4PQX A;  4LF6 Q;  1HNZ L;  4BY1 B;  3BU2 A;  2YYZ A;  3VA7 A;  5JPN C;  4HMJ A;  3BDO A;  3GTG H;  2VNU D;  5K36 H;  1TS4 A;  4JI8 L;  3RD4 A;  5C0X G;  2QIL A;  2KA7 A;  2R61 A;  3ULJ A;  1FL0 A;  2L4N A;  1GHK A;  4L5T A;  3FDT A;  3I2Z A;  4HJ9 A;  2L0C A;  4YY3 Q;  1ML0 D;  2CCZ A;  2BDO A;  2R7Z H;  3FKI H;  4B3R Q;  5JVG 3;  4LF5 Q;  3RZD H;  1UNS A;  3QR8 A;  1SN8 A;  5IGG A;  3MZ5 A;  3LX0 A;  4C2M B;  3HOX B;  5IYB G;  1BDO A;  2WAC A;  2Z4I A;  2B8G A;  2CKZ B;  2EPB A;  2X6G A;  1ESR A;  3KLR A;  1KLG D;  3LGJ A;  5ELO A;  1YNX A;  3D31 A;  4X3U A;  2JA5 H;  4V0B A;  4B3M L;  3BZC A;  4YCU A;  4X62 Q;  3D8G A;  5C4H A;  3SK6 A;  1EU3 A;  4IPH A;  4AYB E;  5IGB A;  1H9S A;  2JA6 G;  2A69 C;  1L2F A;  4UPA A;  1V43 A;  1HZC A;  3CQZ H;  2K14 A;  4PZ7 A;  1D8L A;  3M9B A;  3TRE A;  4QB4 A;  4HCS A;  4JI3 Q;  2N78 A;  1U4L A;  2MHV A;  2RSO A;  4R4Q A;  3G6E A;  4JI1 Q;  3M4P A;  4IUN A;  4CDE C;  1SNQ A;  1HHV A;  3CCV A;  3S17 H;  1M8A A;  1LTG D;  3KF8 B;  4FO2 A;  4JBW A;  3T53 B;  1N8R C;  4RAU C;  2A6H C;  4DR3 L;  1ZXT A;  2EVB A;  3T1H L;  3S24 A;  1NR4 A;  1Q46 A;  3FMC A;  4DAV A;  1MJC A;  1U4R A;  4N9T A;  3T1Y Q;  3GP7 A;  4RGO S;  1N33 Q;  5FLX c;  1JB7 A;  3K7A B;  4B3T Q;  4JBM A;  4K14 A;  1X3G A;  3CCR A;  1SYG A;  1Q1B A;  4U67 3;  2Z1C A;  2VB2 X;  1YIJ A;  3K80 C;  2NVQ H;  5CV7 A;  1E3P A;  3FHW A;  1TKW B;  5C44 H;  1VQP A;  4DNR B;  3H15 A;  3P20 A;  2JE6 I;  2HDL A;  2A19 A;  4DV3 L;  3AEV A;  4RKL A;  4LF9 L;  3FPP A;  3U9S A;  1FJG Q;  3S1Q B;  1G51 A;  5FO7 B;  2B8F A;  4LF7 L;  4BY7 G;  1QB5 D;  4ID6 A;  3SK8 A;  5AFW A;  4RCN A;  2A68 C;  3X3M A;  1UE6 A;  4R8N A;  4J15 A;  1SJH D;  1OXT A;  4K6L A;  1OTC A;  4PMC A;  1HR0 Q;  1MIU A;  4JI6 Q;  1UEA B;  2IY5 B;  3BVG A;  2IX0 A;  4UP8 A;  1VDZ A;  3HOY H;  4GNX B;  3NEL A;  2EY6 A;  4NB3 A;  1O7I A;  1I4Q A;  1I50 H;  1JWS D;  1JB3 A;  3E0E A;  4A3G G;  2B2Y A;  4A3B B;  2XVS A;  4U68 A;  1GUN A;  3LWU A;  1E2Z A;  1SNM A;  3QO2 A;  4FF2 A;  4QIW E;  4G4K A;  4POG A;  5C4X H;  1D1K A;  5A2Q E;  5M5W H;  1VQI A;  1KAA A;  1Q3L A;  1EZ8 A;  4APV A;  2HUG A;  3CMA A;  4FP5 D;  2GN5 A;  1YHQ A;  2RA4 A;  1I94 L;  4L5R C;  1Y1V H;  2E8G A;  3I91 A;  2BA1 A;  1KXL A;  1YVC A;  1Q12 A;  5M3F H;  2FIN B;  1AP0 A;  3SDZ A;  3R93 A;  3IRB A;  1HFG A;  5T1G A;  4CJ0 B;  4Z9C B;  2B2V A;  2VB3 X;  4HSV A;  2Z6K C;  1HTL D;  4P71 A;  4ZLT F;  1HUM A;  3DUZ A;  1VQG A;  1CQF A;  1JOR A;  5E3F A;  3VR6 A;  1QCB D;  3STB D;  3CCJ A;  3G71 A;  2LS0 1;  2B2U A;  1KAB A;  1K83 H;  2K5N A;  4DAY B;  3CF5 A;  4A3I H;  2UUA Q;  1MKH A;  1VF5 C;  3A55 A;  2EY1 A;  1WTX A;  1IZ6 A;  2D0P A;  4UP7 A;  3PUY A;  5CV8 A;  3N52 A;  5C3E H;  4BXX H;  4RHR A;  4C3H G;  2FMM A;  3TME A;  2VUM G;  4DV7 Q;  1YBY A;  4R4C A;  1B70 B;  1A63 A;  2BH8 A;  4G7Z C;  4DR1 L;  4DR2 Q;  4IO9 A;  2VZA A;  3WOE A;  2N55 A;  4F87 A;  3HOW B;  1SND A;  5M9O A;  3BDC A;  1J9O A;  4DR4 L;  5FJ8 G;  1KD1 C;  3D6C A;  3MXP A;  1DOM A;  1CKM A;  2B2T A;  4DAP A;  1UEB A;  2NZH A;  2K5W A;  1M1K C;  4DUY Q;  4TVA B;  4L63 B;  3D4W A;  3K6O A;  5C0X I;  2R92 G;  2K50 A;  3DWA A;  1CHQ D;  1AEX A;  1B4O A;  2QCP X;  2GVB A;  1WTO A;  2IX3 A;  2HHH Q;  1II3 A;  2JYO A;  4JC0 A;  1PYB A;  1ILQ A;  3HKZ G;  1NNX A;  2OF1 A;  2KCC A;  4KN7 C;  4WJ4 A;  3C1E A;  3D3R A;  1T9H A;  2KEN A;  2Y0S G;  3NEM A;  3J7Y W;  4B3R L;  4LF5 L;  4A3L G;  1W6J A;  1D5Z C;  2PQA A;  3S2D H;  1J8I A;  2RSN A;  1G91 A;  2JA9 A;  2FXQ A;  3ERO A;  2E2H B;  4HJA A;  5D3D A;  3DWP A;  1VQL A;  5GQO A;  3R2T A;  3W2D A;  1SRO A;  3KLW A;  3IKJ A;  3A74 A;  3KOJ A;  2K32 A;  5BN4 A;  3GTM B;  1KNE A;  4P74 A;  2KCN A;  2L55 A;  3D4D A;  4C3J G;  1IYJ B;  3BS1 A;  1N36 Q;  1TWA B;  2SDF A;  5TSS A;  1XTC D;  5AJ3 Q;  3OTO Q;  1I5F A;  4FF4 A;  4JK1 C;  1EOT A;  2ES2 A;  4FXD A;  1PYW D;  1NTG A;  2QF7 A;  3M7G A;  4QF4 A;  1IBL L;  2HQE A;  1VQ7 A;  2O5J C;  2DJG C;  2UXD Q;  4DF7 A;  5G3L F;  2B39 A;  2KQ3 A;  1N34 L;  3M4O B;  3I72 A;  4J8Q A;  3MTS A;  4MIU A;  3S15 B;  2WV6 D;  2WFW A;  3CME A;  2UXC Q;  5M3M G;  3J81 c;  4K2K A;  4LF8 Q;  2JA8 G;  3MHB A;  3T1Y L;  2KJX A;  1N33 L;  1F2L A;  4X66 Q;  3MA2 B;  4JYA L;  1PZI D;  5ELF A;  4B3T L;  2EZV A;  4WJW A;  4EX5 A;  1HNZ Q;  5HUR A;  4MNO A;  1ENA A;  1JR0 D;  5M5Y B;  3ZJY C;  5J1Z A;  3I4M G;  1TY2 A;  4KY6 A;  3BVM A;  1EY5 A;  5C3X A;  3I73 A;  3M4Y A;  4K0K Q;  1VQO A;  2F0Q A;  3PO2 G;  4FXK C;  5FO9 B;  1X32 A;  3FRP B;  1BQQ T;  1HZ9 A;  3H3V H;  2H1E A;  4JCV E;  2YU9 B;  2K5V A;  4K8I A;  4DK0 A;  3VDY A;  4DR7 L;  3TQY A;  3HOZ H;  3L3O C;  5JVH 3;  4NW2 A;  3K7U C;  2XTI A;  4A3G B;  3NK9 A;  3RR5 A;  3H0G G;  4K8J A;  1IW7 D;  2RBM A;  2PI2 A;  1GUW A;  1ONL A;  1EFI D;  1HR0 L;  1LM0 A;  4JI6 L;  4DAM A;  2N49 A;  4DKA C;  1K8A C;  3GTJ B;  2OQK A;  3V96 A;  5IE8 A;  1AH9 A;  2IWH A;  2F0P A;  3J81 j;  1VMC A;  2WII B;  3NEN A;  4KTA A;  2SNM A;  1K73 C;  3PO3 B;  4JBK A;  1A3V A;  2MNA A;  4WRD A;  2F0U A;  1EU4 A;  1HA5 A;  4LFA Q;  2H5X A;  3F8T A;  2KHI A;  5IYC H;  1SE2 A;  1H9R A;  3NSW A;  1X3F A;  3OW7 A;  4GN3 B;  1WOC A;  3IFD A;  4A3C H;  2EYO A;  2ICI A;  1ASY A;  3HOU G;  3JAM c;  3E3X A;  3RLN A;  2F0E A;  1SMY C;  1BBU A;  1CFM A;  2CVR A;  2X6L A;  4F88 A;  3NBI A;  4QUF A;  1BUV T;  1G8Z D;  3I7F A;  2JEA I;  1QJO A;  1TWF B;  3CPW A;  2DY8 A;  2OT2 A;  4OO1 G;  3K58 A;  2EE1 A;  4QL5 A;  4GKK L;  3I4N B;  3CC2 A;  1A3U A;  1JE5 A;  1Z6H A;  4DA2 A;  4E6I A;  3BDL A;  1PFN A;  2SNS A;  3VR5 A;  4A3E H;  4A3J H;  1WCM H;  4XIG S;  1J6Q A;  4HR7 B;  1SYE A;  3Q24 A;  1JIC A;  1RF2 D;  2VY3 A;  5D3I B;  2OTJ A;  2N3S A;  2EYL A;  2WKD A;  4QIW B;  2VUM B;  1HFN A;  1P8L A;  1J5E Q;  5ELE A; 
#chains in the Genus database with same CATH homology
 3VR2 A;  1Y69 U;  1QNU A;  2B2W C;  2BDN A;  2MP1 A;  3KUP A;  3AMU A;  4G7O C;  5CV4 A;  2JA7 B;  4HTH A;  3U9O A;  5I4D A;  3GTQ B;  4F7X A;  3HS0 C;  2CQA A;  4EVO A;  4RFB A;  3S2H B;  2K7V A;  2LFN A;  1KTK A;  3NQT A;  2R92 B;  1TWC B;  1LT5 D;  2EJG C;  1CZW A;  1R4Q B;  1YNN C;  5JEA G;  5COR A;  4HMI A;  4OHJ A;  3R8B A;  1NSN S;  3HOV B;  2DY7 A;  3HKZ B;  4S3S A;  2B2U C;  3F2U A;  3Q6S A;  2Y0S B;  1I4H A;  3PUZ A;  1I4P A;  3QOL A;  2D62 A;  1PFB A;  1STA A;  3GO5 A;  3LNN A;  1IYU A;  4M8A A;  2EYJ A;  1FYC A;  2M9V A;  4IUR A;  3QJY A;  1BR9 A;  3QB3 A;  4TKO B;  5ELB A;  1FNW A;  1I6V C;  1GOZ A;  5CMD A;  3BZD B;  3R3O A;  2B2T C;  4XXE A;  5EKK A;  2B63 B;  1U4P A;  5KRU A;  2BE5 C;  2EXZ A;  2KHS A;  2RDH A;  3DEO A;  4RHS A;  4IUV A;  4TQU S;  3TZU A;  2JA8 B;  1Q8I A;  2TSS A;  3NHH A;  4BBS B;  1WD0 A;  5T1I A;  1EZ6 A;  3MEH A;  5IT9 E;  4Q5V A;  3S16 B;  3M3Y B;  3I4M B;  3H6M A;  1DCZ A;  4CBV A;  3MXU A;  2R6G A;  1F77 A;  1W6K A;  3PO2 B;  1MD2 D;  3NXW A;  2PMZ B;  3KLS X;  1PTO F;  5F2D A;  5FLX L;  2LY7 A;  1FR3 A;  3EQL C;  3H0G B;  3KK7 A;  5KYL A;  1LTT D;  4RCO A;  4RWS C;  4KMU C;  1SFO B;  3OWE B;  3CKI B;  4B9X A;  3URY A;  2NWG A;  4IUT A;  1SNP A;  3OPO A;  2M00 A;  1XWE A;  3P7J A;  4KJN A;  2K05 A;  4NP5 A;  2K03 A;  3TZD A;  1HXY D;  4PV1 C;  1STB A;  2F4I A;  3RZO B;  1LTR D;  4FXG C;  4H0L C;  3L7Z C;  4I7Z C;  2NVY B;  3J80 E;  3NWS A;  4C1N K;  3C2P A;  2AQ3 B;  2EY2 A;  3OMC A;  3PMF A;  2R93 B;  3I70 A;  1SEB D;  3ZYY X;  2DNC A;  3TN2 A;  3ND9 A;  1HQR D;  1PXU A;  1GJX A;  2NN6 H;  4HSP A;  2AWN A;  1SDF A;  2WP8 J;  4OO1 I;  3EVQ A;  1IHZ A;  2A6E C;  1X3Q A;  5EJW A;  1AZP A;  4G57 A;  4M1U B;  4X3K A;  1LTI D;  3MWY W;  1EYC A;  4DXF A;  4EQP A;  2HCI A;  2A74 C;  1XXG A;  5EQ0 A;  1EIG A;  4HED A;  3OWF A;  3NPP A;  3CRK C;  1M4V A;  1O7L A;  2CW0 D;  4A93 B;  4RA8 A;  2PZU A;  1F9Q A;  1ICW A;  1Q1E A;  4KV6 A;  2MUY A;  1YNJ C;  1DM0 B;  2NB0 A;  1C48 A;  1GUO A;  1U4M A;  4ILW A;  2G9D A;  2J7Z A;  4EQO A;  2F0H A;  1ESF A;  3ITP A;  1TU2 B;  2D9U A;  4ABN A;  2R3Z A;  1PTO C;  2E75 C;  1I4X A;  2SEB D;  4ZUJ A;  1GUS A;  5DNF A;  3SXH A;  4DNT B;  1AN8 A;  1F9P A;  2O4X A;  2ZXO A;  2B2W A;  3FVQ A;  2M2L A;  1ROD A;  4KK7 A;  2K1B A;  1FNU A;  2XWB B;  3TP5 A;  4LK1 C;  1C8C A;  3O13 A;  3SR1 A;  2NVT B;  4IFD H;  3QWN A;  2DN8 A;  3S1M B;  5C6A A;  3T16 A;  5KND A;  1JCK B;  3HRZ C;  2PNR C;  2F0N A;  4QUC A;  2LMC B;  1RHP A;  1WTW A;  5C4Z A;  1SYD A;  3M85 A;  1F2Z A;  3DWQ A;  5KEE A;  2WAQ B;  5COY A;  2EY5 A;  3PUX A;  1STE A;  4ZYS A;  2XRQ D;  1BXT A;  2IL8 A;  1B2T A;  2L12 A;  1LT4 D;  2NUC A;  5HGT A;  3NUC A;  1O7Y A;  1TR5 A;  4OIK A;  4V19 0;  5EPJ A;  5C44 B;  2XIW A;  4X3T A;  2LKV A;  1BCP C;  1NUC A;  3GV6 A;  5ISR A;  1E2V A;  3GD7 A;  1C4Q A;  1PTO B;  3NE5 B;  4P2C B;  3GTK B;  1CQV A;  1PLF A;  1QWY A;  1HTP A;  1ZYR C;  4XYO A;  3J81 L;  2XN9 C;  1TQO A;  2TMP A;  2BE5 D;  4ZAI A;  4UAI A;  2IW3 A;  2J0T D;  1CI3 M;  1S5F D;  1SE4 A;  3QIA A;  2K33 A;  1UAP A;  5EKL A;  2RQX A;  5K5P A;  3TDQ A;  3HP3 A;  3GTO B;  1FGB D;  2JA6 B;  1EL0 A;  4RGT A;  3R2I A;  5EBD A;  5C4X B;  1EWC A;  1RJT A;  4OL7 A;  2K5D A;  3PUW A;  4A3K B;  1STG A;  3EA6 A;  3RLF A;  5ELD A;  2F0V A;  4NDX A;  1Y1V B;  1SYC A;  2OXP A;  5CYU A;  1KDC A;  5JPM C;  3A8J E;  3ERQ A;  2NTS A;  5I9O A;  1QOH A;  2PW5 A;  2E2D C;  3DHQ A;  1CK1 A;  3NTI A;  2E2J B;  5BN5 A;  1NAP A;  2L5T A;  2PPB C;  1TS3 A;  3JAM L;  3SK5 A;  2E74 C;  5C3E B;  4BY7 B;  3IL8 A;  4ZRZ A;  5A35 A;  1IL8 A;  1SNO A;  2QEJ C;  3I3C A;  2A69 D;  4KKU A;  3Q22 A;  2L11 A;  3V2T A;  3E6Z X;  4KI0 A;  4RKB A;  5DEH A;  4B08 A;  2BCO A;  1V1O A;  1AFP A;  4J6H A;  1BBX C;  4BS9 A;  4IN3 A;  2PZW A;  3Q23 A;  4KKT A;  1NR2 A;  2QKI C;  2F03 A;  4KHZ A;  1DON A;  1B53 A;  3S1N B;  1CM9 A;  2A6H D;  1T5E A;  5CGK A;  4LAA A;  1SSO A;  2RVL A;  3A7A B;  1PMR A;  1QIL A;  2KOL A;  2A6E D;  2RDG A;  5KYI A;  4IUQ A;  1PFM A;  4QCL A;  1TY0 A;  2NZ1 D;  4ZKC B;  2Z4H A;  4BA2 I;  4FYD A;  1D1I A;  5IGC A;  3H3V C;  3KLS A;  4K6D A;  3HEJ A;  1RCV D;  2JP1 A;  1IKL A;  4Y7N B;  2F0O A;  2F0W A;  4CKE A;  1CA6 A;  3KBG A;  1VF7 A;  2F3V A;  2FFK B;  1CZG A;  2A68 D;  1JOK A;  2EYM A;  5CR3 A;  1JOO A;  1VCI A;  4XT1 B;  2IT1 A;  5JAV A;  4FF1 A;  1STN A;  4C3H B;  1EQT A;  5I2Y A;  2F0L A;  5J22 A;  1PTO D;  1D2B A;  4WFN 3;  5KNB A;  3MFG A;  4K5W A;  2K01 A;  4RGN A;  1F2Y A;  1HPC A;  1G2T A;  1O78 A;  4XDX A;  2F0I A;  5KIX A;  3G6J B;  4HAE A;  2L1B A;  3IAY A;  1SYF A;  3SHL A;  1JWU D;  3K59 A;  2K04 A;  2JXM B;  3H09 A;  3V05 A;  4OIJ A;  1L0X B;  2PYK A;  2ID0 A;  1WVL A;  3OOC A;  4UDU C;  1ZEQ X;  2Q8I B;  4A3D B;  5K36 G;  1MSG A;  3P75 A;  1PRT F;  1BF4 A;  2EOT A;  4H7B A;  1XYI A;  3MXN A;  1IYV A;  1I4G A;  3OSO A;  5A2Q L;  4TSS A;  3VYT A;  5C4J B;  4KD4 A;  4QMG A;  2DNE A;  3TSS A;  4K5X A;  4C3J B;  1NCV A;  3A56 A;  4KKS A;  3VA5 A;  5BN3 A;  2KED A;  3C46 A;  3S9W A;  4IAL A;  2IX1 A;  2EYP A;  5KGU A;  1DOK A;  3KBX A;  5LL6 X;  2F0D A;  4WOR A;  2EJF C;  3Q0A A;  5M3M B;  3E5S A;  2NVX B;  3OIQ A;  4C3I G;  4MN3 A;  2E2I B;  2XWJ B;  5J39 A;  5CV5 A;  2F0S A;  1TWG B;  1S5E D;  4DGZ A;  1R9T B;  2O2L D;  3CHB D;  5EPK A;  1BOS A;  1E0B A;  1LTS D;  2JEB I;  5IOC A;  1I6H B;  1OXS C;  1TII D;  1D5X C;  1WTQ A;  2AQ2 B;  4XTC S;  4XQN A;  1LTB D;  4CKB A;  1RKN A;  1EY9 A;  1OXX K;  1ENC A;  3T13 A;  1EQV A;  5IIF A;  2O5I C;  4HN7 A;  3WOF A;  1H9K A;  4R9W A;  4BA1 I;  1GUG A;  1EY4 A;  1AW7 A;  3A7L A;  3HG9 A;  3MVV A;  3DXJ C;  3FEW X;  3RMH A;  2A5H A;  2RDF A;  1LO5 D;  3W3A A;  2NTT A;  4RH6 A;  2PCF B;  3MC0 B;  2EDG A;  3HOU B;  1FD7 D;  5IGF A;  4BBR B;  1PRT C;  1V1P B;  5EKI A;  1B44 D;  2ZT9 C;  5C5L A;  1K8M A;  1SAP A;  1DD2 A;  1A15 A;  3AB9 A;  3C1F A;  1Y8P B;  3TP7 A;  1F9S A;  1LV9 A;  3K5M A;  3P1H A;  2JSO A;  3QOJ A;  2WIN B;  2ZXP A;  4TRD A;  3J7A F;  1TS5 A;  4IFD G;  4A3M B;  3H94 A;  1SE3 A;  2D5D A;  3S1R B;  3TP6 A;  1LLR D;  1X3P A;  4B9W A;  3GTP B;  3BYY B;  4XT3 B;  5C0X J;  1LT6 D;  3VR3 A;  5M5X B;  1BCP F;  1EY8 A;  1IW7 C;  4MHE A;  2GA4 B;  3GQB A;  1TS2 A;  1EEI D;  3MAQ A;  1SJE D;  1D6E C;  4KY5 A;  3T56 B;  1E2W A;  3T4A C;  1ENF A;  3X3N A;  2G9H D;  1LAB A;  2F0J A;  2Z8L A;  3VR4 A;  2Q8R E;  4XQJ A;  2A73 B;  5C0X H;  3SVM A;  1HA6 A;  1SMY D;  4RGM A;  5C5M A;  1U9R A;  1TT2 A;  1PTO H;  3G7L A;  3GTG B;  1F9R A;  4K2L A;  3NWT A;  1WTP A;  2L9H A;  1G2S A;  1PRT B;  4IFD J;  2R7Z B;  3FKI B;  3RZD B;  1DOL A;  1D5M C;  3PIO 3;  4K5V A;  1H9J A;  1SNC A;  2RKS A;  2JA5 B;  1HUN A;  5G3L D;  3K0Y A;  4ZK9 B;  3ONA B;  3RUZ A;  2HCC A;  2PW7 A;  4CKC A;  1JC7 A;  2K28 A;  3NBH A;  1B3A A;  3CQZ B;  3ND8 A;  3I90 A;  4ZUI A;  5LL6 S;  3MXG A;  2X69 A;  1IKM A;  2CHB D;  4DK1 A;  4J1M A;  3NTH A;  3S17 B;  1YNN D;  4C3I B;  2E76 C;  5E4W C;  3PIP 3;  5E4X A;  1Y8N B;  4GZY C;  4HCE A;  3E0J A;  2EYH A;  2F1M A;  4EQN A;  1HRJ A;  3OMG A;  3L9A X;  2NN6 I;  1PZK D;  4CJ1 B;  1KDB A;  5I2X A;  1XX8 A;  2NVQ B;  4PMW A;  1KLU D;  1B50 A;  4BWG B;  1SXT A;  2AQ1 B;  4LMQ D;  3A54 A;  5EPL A;  4DU9 A;  5LHY 1;  5EGT A;  1STH A;  5I6W A;  1EIH A;  3H91 A;  4O42 A;  3CU7 A;  5ELC A;  1OO9 B;  1QE6 A;  5FK9 C;  1V1P A;  1LAC A;  1O7Z A;  3DEP A;  4F8M A;  2PZT A;  3K5L A;  5FLX E;  2I07 B;  3T51 B;  1HQM C;  3HOY B;  1QG7 A;  2D2C C;  1JE4 A;  1WTR A;  3BVZ A;  3NP8 A;  1I50 B;  2XNA C;  4YIJ A;  2EJM A;  2KEC A;  2C9O A;  4IQZ A;  3UI2 A;  3AU7 A;  4OGQ C;  2HDM A;  3BYT B;  1WTV A;  3WDN A;  4DXG A;  1STY A;  5M5W B;  2MJ8 A;  1G6Z A;  3KF8 A;  1SYB A;  4C1N I;  4H13 C;  1TVX A;  1RTN A;  3NTK A;  2OEO A;  4L8J A;  1LT3 D;  2VXW A;  4CGY B;  1LTA D;  4N9P A;  1GHJ A;  5M3F B;  4XQQ A;  3OIP A;  1DZ1 A;  1BNZ A;  5D65 A;  3QG1 A;  2I46 A;  2PO4 A;  2ENB A;  2XSC A;  4IUP A;  1JOQ A;  1Z7T A;  1B9N A;  1MGS A;  5I9P A;  4PNY A;  2FHT A;  1ILP A;  4IFD I;  5D14 A;  2AUK A;  1ET9 A;  1BCP B;  5NUC A;  5IT9 L;  2AWO A;  1A3T A;  2K6A A;  2AUJ D;  1K83 B;  1KDA A;  4A3I B;  3VYR A;  4EGV A;  3D4R A;  1EY0 A;  4CJ2 C;  2ICE C;  1BO0 A;  1A2T A;  2PQE A;  3D6W A;  5CV9 A;  3TBI B;  4PMB A;  2FJ2 A;  2ZXR A;  1A6X A;  3MFY A;  1Y1W B;  1PRT D;  3S14 B;  4AYB B;  2F0G A;  2K5Q A;  1S5C D;  1CA5 A;  2FMC A;  4R8I A;  1CT1 D;  5CBE E;  1KNA A;  3A8K E;  3J7A V;  5DM7 3;  5IGD A;  5I6Y A;  4ZQ3 A;  4ULL A;  3HZX A;  2BA0 A;  1H9M A;  2KEE A;  1VMP A;  5FOB B;  4FF3 A;  1L0Y B;  3GTL B;  1K8O A;  1RD9 D;  3TP8 A;  1OXU A;  4FVM A;  1CHP D;  5IGE A;  3PV0 A;  4ZKB B;  1HCZ A;  3EFX D;  3K5O A;  3VYU A;  3N6R A;  1FNV A;  4FNF A;  3J80 L;  3S2D B;  3PUV A;  2EYF A;  2KVM A;  1I3Q B;  3SE0 A;  4X3S A;  3VYS A;  1EY7 A;  3GV3 A;  1DYQ A;  4IUU A;  2WKC A;  1EY6 A;  5E1F A;  1MSH A;  2MGS A;  1JWM D;  2J4X A;  1RDP D;  3C3L A;  1ET6 A;  2CW0 C;  1Z47 A;  1F2M A;  1MI2 A;  4DAY A;  1PZJ D;  2QDB A;  1EYA A;  3SEB A;  1GUT A;  4IZ8 A;  1YNJ D;  4L6T B;  2F0F A;  2F0T A;  2KUM A;  5EBC A;  1SBB B;  1G29 1;  1H9S B;  1EEF D;  4C56 C;  3M7N A;  3K57 A;  2C5C A;  5CBA E;  1DXM A;  2B2Y C;  1ZKO A;  2XRS D;  3HGB A;  4O1N A;  4NKL A;  4DFA A;  5JJZ A;  3LWE A;  4I65 A;  3NQI A;  1TWH B;  1T5X D;  4A3F B;  4H44 C;  3OHX C;  1Y8O B;  4DN4 M;  4KY7 A;  4KD3 A;  2F3W A;  1WD1 A;  3I4L A;  3I8Z A;  4CHT B;  1DJR D;  4KJO A;  2WB1 B;  2IPK D;  3HOZ B;  3BG3 A;  2B2V C;  2NYZ D;  4LJZ C;  2F0M A;  3FPU B;  3J81 E;  1I4R A;  1MBY A;  1GXD C;  4NMZ A;  4G7H C;  1UUP A;  5C3W A;  1EYD A;  1RTO A;  1S5D D;  3IFT A;  4ME5 A;  1O80 A;  2F0K A;  1JQY D;  5CV6 A;  3K5N A;  2Q8T A;  2V4D A;  1S5B D;  4XYQ A;  4ODG A;  1BCP D;  1OXV A;  5FKA C;  2MPM A;  5DM6 3;  4OO1 H;  3DMU A;  1ZYR D;  4KHV A;  1S4Z A;  3EJI A;  1EWH A;  5FO8 B;  3A8I E;  5IOD A;  2N88 A;  2NN6 G;  4A3E B;  4A3J B;  3SK4 A;  5JEA J;  1WCM B;  5JOB A;  1R4P B;  5DAU A;  2SOB A;  1A2U A;  1AZQ A;  3CRL C;  1V8Q A;  1Q90 A;  4Q0F A;  2IJ0 A;  1PDQ A;  1CTM A;  2BOS A;  3DM1 A;  3JAM E;  5CC4 A;  1B9M A;  5JEA H;  2H4O A;  4KN4 C;  5KNC A;  2NBF A;  1B1Z A;  1QNK A;  4PQX A;  4BY1 B;  2YYZ A;  3VA7 A;  5JPN C;  4HMJ A;  3BDO A;  2VNU D;  5K36 H;  1TS4 A;  5C0X G;  3RD4 A;  2QIL A;  2KA7 A;  2R61 A;  2L4N A;  1GHK A;  3FDT A;  2L0C A;  1ML0 D;  2BDO A;  5JVG 3;  1UNS A;  5IGG A;  3MZ5 A;  3LX0 A;  4C2M B;  3HOX B;  1BDO A;  2WAC A;  2Z4I A;  2B8G A;  2EPB A;  2X6G A;  1ESR A;  3KLR A;  1KLG D;  4X3U A;  3D31 A;  4V0B A;  3D8G A;  5C4H A;  3SK6 A;  1EU3 A;  5IGB A;  1H9S A;  2A69 C;  1V43 A;  4QB4 A;  4HCS A;  1U4L A;  2MHV A;  2RSO A;  4IUN A;  1SNQ A;  1HHV A;  1M8A A;  1LTG D;  4FO2 A;  4JBW A;  3T53 B;  4RAU C;  2A6H C;  1ZXT A;  2EVB A;  1NR4 A;  3FMC A;  4DAV A;  1U4R A;  4N9T A;  3GP7 A;  4RGO S;  3K7A B;  4K14 A;  1SYG A;  1Q1B A;  4U67 3;  2Z1C A;  2VB2 X;  5CV7 A;  1TKW B;  4DNR B;  3P20 A;  2JE6 I;  2HDL A;  4RKL A;  3FPP A;  3U9S A;  3S1Q B;  5FO7 B;  2B8F A;  1QB5 D;  4ID6 A;  3SK8 A;  5AFW A;  4RCN A;  2A68 C;  3X3M A;  4R8N A;  1SJH D;  1OXT A;  4K6L A;  4PMC A;  1UEA B;  3BVG A;  2IX0 A;  1VDZ A;  2EY6 A;  1I4Q A;  1JWS D;  1JB3 A;  2B2Y A;  4A3B B;  2XVS A;  4U68 A;  1GUN A;  3LWU A;  1E2Z A;  1SNM A;  3QO2 A;  4FF2 A;  4G4K A;  1D1K A;  5A2Q E;  1KAA A;  1Q3L A;  1EZ8 A;  2HUG A;  4FP5 D;  2RA4 A;  3I91 A;  2BA1 A;  1Q12 A;  2FIN B;  1AP0 A;  3SDZ A;  3R93 A;  1HFG A;  5T1G A;  4CJ0 B;  4Z9C B;  2B2V A;  2VB3 X;  4HSV A;  1HTL D;  4ZLT F;  1HUM A;  3DUZ A;  1CQF A;  1JOR A;  5E3F A;  3VR6 A;  1QCB D;  2LS0 1;  2B2U A;  1KAB A;  1VF5 C;  3A55 A;  2EY1 A;  1WTX A;  3PUY A;  5CV8 A;  3N52 A;  4RHR A;  4C3H G;  2FMM A;  3TME A;  4G7Z C;  3WOE A;  2N55 A;  4F87 A;  3HOW B;  1SND A;  5M9O A;  3BDC A;  1J9O A;  3D6C A;  3MXP A;  1DOM A;  2B2T A;  4DAP A;  2K5W A;  4L63 B;  3D4W A;  3K6O A;  5C0X I;  3DWA A;  1CHQ D;  1AEX A;  1B4O A;  2QCP X;  1WTO A;  2IX3 A;  1II3 A;  2JYO A;  1ILQ A;  2OF1 A;  2KCC A;  4KN7 C;  3C1E A;  3D3R A;  3J7Y W;  1W6J A;  1D5Z C;  1J8I A;  2RSN A;  1G91 A;  3ERO A;  2E2H B;  5D3D A;  3DWP A;  3R2T A;  3W2D A;  3IKJ A;  2K32 A;  5BN4 A;  3GTM B;  1KNE A;  2KCN A;  2L55 A;  3D4D A;  4C3J G;  3BS1 A;  1TWA B;  2SDF A;  5TSS A;  1XTC D;  4FF4 A;  4JK1 C;  1EOT A;  4FXD A;  1PYW D;  2QF7 A;  3M7G A;  4QF4 A;  2O5J C;  2HQE A;  4DF7 A;  5G3L F;  2B39 A;  2KQ3 A;  3M4O B;  3I72 A;  4J8Q A;  3MTS A;  4MIU A;  3S15 B;  2WV6 D;  4K2K A;  3MHB A;  2KJX A;  1F2L A;  3MA2 B;  1PZI D;  5ELF A;  2EZV A;  4WJW A;  5HUR A;  1ENA A;  1JR0 D;  5M5Y B;  5J1Z A;  1TY2 A;  4KY6 A;  3BVM A;  1EY5 A;  5C3X A;  3I73 A;  3M4Y A;  2F0Q A;  4FXK C;  5FO9 B;  1X32 A;  3FRP B;  1BQQ T;  2H1E A;  2YU9 B;  4K8I A;  4DK0 A;  3L3O C;  5JVH 3;  4NW2 A;  4A3G B;  3NK9 A;  4K8J A;  1IW7 D;  2RBM A;  1GUW A;  1ONL A;  1EFI D;  3GTJ B;  3V96 A;  2IWH A;  2F0P A;  1VMC A;  2WII B;  4KTA A;  2SNM A;  3PO3 B;  1A3V A;  4WRD A;  2F0U A;  1EU4 A;  1HA5 A;  1SE2 A;  1H9R A;  3NSW A;  3OW7 A;  3IFD A;  2EYO A;  2ICI A;  2F0E A;  1SMY C;  1CFM A;  2CVR A;  2X6L A;  4F88 A;  3NBI A;  4QUF A;  1BUV T;  1G8Z D;  2JEA I;  1QJO A;  1TWF B;  2DY8 A;  2OT2 A;  4OO1 G;  3K58 A;  2EE1 A;  3I4N B;  1A3U A;  1Z6H A;  4DA2 A;  4E6I A;  3BDL A;  1PFN A;  2SNS A;  3VR5 A;  4XIG S;  4HR7 B;  1SYE A;  3Q24 A;  1JIC A;  1RF2 D;  5D3I B;  2EYL A;  2WKD A;  4QIW B;  2VUM B;  1HFN A;  5ELE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...