3D6CA

Crystal structure of staphylococcal nuclease variant phs l38e at cryogenic temperature
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLEVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title The pK(a) values of acidic and basic residues buried at the same internal location in a protein are governed by different factors.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 40
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3d6cA00
3DMUA 3MHBA 2PZWA 3BDCA 4ID6A 3RUZA 3P1HA 2KQ3A 3VA5A 1EYCA 1STAA 3MVVA 5CV4A 1A2UA 2EYMA 2EY6A 4ZUIA 5IGDA 3QOJA 3TP7A 3NK9A 3OWFA 3SR1A 4K2KA 5E3FA 2RKSA 1EY6A 4J6HA 1STBA 5C5MA 5EKKA 2OXPA 3EJIA 2HQEA 5E1FA 2F0SA 1A3UA 2PZUA 3MZ5A 1SYDA 2OEOA 3D4WA 2F0QA 1IHZA 3BDLA 4N9TA 3SXHA 3SK8A 3TP8A 1F2ZA 4KTAA 5J39A 4IZ8A 4KV6A 3MXPA 3E5SA 5HGTA 2WACA 2F0TA 4PMCA 3SHLA 5HURA 3TP5A 5KYIA 2SNSA 1F2YA 4KD3A 4B9WA 1EYDA 2EYHA 4RKLA 4QF4A 5ISRA 2F0LA 3NP8A 2EYLA 5I6WA 1U9RA 4ODGA 4QB4A 2EY2A 5CR3A 4F7XA 2PW7A 4KHVA 4PNYA 1EY7A 2F0WA 5J1ZA 2F0OA 4K2LA 4K14A 3R3OA 1STNA 1SNMA 4EQNA 1KDBA 1EY0A 4EQOA 4K8IA 3TP6A 4NMZA 3D8GA 4KY6A 3D6CA 5CV6A 3C1FA 5EGTA 2F0IA 3V2TA 2F3VA 1RKNA 1A2TA 2F0JA 2NUCA 2F3WA 1SNOA 3NXWA 4IUNA 4OL7A 4QMGA 3LX0A 5CV9A 4N9PA 4EQPA 2F0DA 2M00A 4KJOA 4MIUA 4WRDA 5IODA 4HMJA 1KAAA 4KJNA 2PQEA 3NHHA 2EY5A 3OMCA 4E6IA 2RDFA 5JOBA 1JOOA 2PZTA 3SK5A 5I6YA 4K6DA 3OMGA 3TMEA 2F0HA 3D4DA 5IGGA 1ENAA 1SNQA 1EY8A 3T13A 3HEJA 4TRDA 1SYBA 3ERQA 1KABA 3OSOA 4PMBA 4RKBA 5EKLA 1TT2A 1EY5A 1A3VA 1TR5A 4KD4A 4DFAA 5CC4A 1SYCA 5CGKA 4KY7A 1JORA 5IGBA 2F0UA 5M9OA 5IGEA 5IGCA 1NSNS 5C3WA 5KGUA 1STYA 5C3XA 3MEHA 1SYEA 2EXZA 5DEHA 2RBMA 3NUCA 1JOQA 2EYJA 4DGZA 2F0MA 3ITPA 5CV7A 4DU9A 5C4HA 3PMFA 4I65A 1SNPA 4K8JA 4K5WA 5K5PA 1TQOA 4K5VA 3T16A 1EY4A 4NDXA 4HTHA 2O4XA 2EYOA 5IOCA 1EZ8A 5J22A 2F0FA 1ENCA 1SYGA 1SYFA 2ENBA 5C6AA 5KIXA 2EY1A 4LAAA 2F0GA 4NKLA 4HMIA 2PW5A 1JOKA 5I9OA 4S3SA 4NP5A 2EYPA 2EYFA 5NUCA 3DHQA 5CV8A 4B9XA 5IGFA 4G57A 4J1MA 2F0KA 4ME5A 1II3A 5IIFA 3S9WA 1NUCA 1EZ6A 1STGA 1KDCA 2PYKA 4IALA 4ZUJA 2KHSA 1STHA 3P75A 1SNCA 2OF1A 4H7BA 4K5XA 5C5LA 4EVOA 2F0VA 3C1EA 3SK6A 5C4ZA 1A3TA 3H6MA 5JAVA 3QB3A 3NQTA 1EYAA 1F2MA 2SOBA 4DF7A 1AEXA 1EY9A 2F0EA 1KDAA 2F0NA 4KY5A 2LKVA 3EROA 4WORA 4F8MA 1EQVA 5CV5A 2F0PA 3EVQA 5F2DA 5KRUA 4R8NA 3QOLA 1SNDA 2SNMA 3U9OA 2QDBA 5KYLA 3HZXA 4YIJA 4ZQ3A 5DAUA 3SK4A 5I9PA 5KEEA
chains in the Genus database with same CATH superfamily
3GTMH 4Z9CB 2EYMA 5DM63 1D5MC 2WAQG 2R7ZB 4A3DB 1F9QA 1TWCB 4R4TA 4J6HA 1SAPA 1LT3D 2YTVA 2X69A 1XX8A 2GVBA 2OEOA 3E3XA 4BBRB 3SK8A 1Y1WB 1O7LA 1V43A 2A68C 4DPGA 3CQZB 2VUMB 1PH6A 1B2TA 4DR6L 3K5NA 2R92B 2K5WA 1PH3A 3HOVH 1VQAA 1HJPA 1K28A 4RKLA 4JI6Q 3BG3A 3T1HQ 2ICEC 4PNYA 3S2HH 3U58A 1SNMA 2KJXA 1ASYA 3TP6A 1OXTA 5M5WB 1WTOA 2LMCB 2XN9C 3HRZC 4I7AA 5M5YB 3IFTA 5EGTA 4X65Q 2L1BA 1CZGA 3D6WA 2M00A 3JAME 4DV0L 2L4NA 4JG2A 3I4MB 4DR7Q 4JW0A 2BE5C 5IYBH 1PFNA 5BN4A 5E4XA 3UDGA 2A5HA 4A3GH 3HEJA 3CPWA 3HKSA 3RN5A 1Q81C 1IL8A 2IWHA 2UU9L 3CAMA 3NELA 3T56B 2L11A 1VF7A 5C3WA 2K5NA 4RGMA 1F9RA 1X6OA 3E0EA 2NVYH 1DOMA 2N78A 3X3NA 3H94A 3GTGB 2NYZD 4GLAC 1ENFA 4X62L 1HNZQ 3HOZH 1BCPD 3W5OA 1S5FD 2B2TC 2AWOA 4K0KL 5KIXA 2ZXOA 1C8CA 4R1JA 4DR1L 1R4QB 3RLFA 4G57A 1EZ6A 1YVCA 5D3IB 3M3YB 1RDPD 3M4PA 4UP7A 1E7ZA 2OF1A 4BWGB 4EVOA 1QVFA 4DV2Q 1WOCA 4PQXA 1QVGA 3GTQB 1K0RA 3FPUB 2Q8IB 4Y7NB 4IOAA 4GN3B 4PZ6A 2Z4HA 4FXDA 5IT9E 4DR5L 1NMGA 3PIPA 4K6LA 1I4RA 3HG9A 1MD2D 3S1RH 5CV4A 3A5ZB 4LF8Q 4GOPB 2J4XA 4GN4B 4A3LH 3I4NB 3RMHA 4K2KA 1Q3LA 3N52A 4P72A 5C5MA 4V190 3R2IA 5HY6A 1IHZA 1E2ZA 1I50B 2B2UA 2A73B 4V0BA 3MXPA 2BOSA 5HGTA 1NR4A 4X66L 1HCZA 1YNND 1KL9A 2GVAA 1QUQA 1QILA 5CORA 2F4IA 3WOFA 3HKZE 2CHBD 2CW0D 1C7YA 3MEFA 4YHHL 2B63H 4JK1C 1EY0A 3QO2A 3SDZA 1FYCA 4NMZA 1LT4D 1SMYC 3D6CA 1DYQA 1K3BC 1O80A 1WTQA 1C0AA 3S14B 2K75A 1LO5D 5GAHC 2Z6KA 4RAUC 4N8FA 1B9MA 1PFSA 1VQOA 5JOBA 2NB0A 1N34Q 2YU9B 2R7ZH 4XYOA 5DLQE 3OTOL 3KF6A 4A3DH 3CCRA 4FXGC 2E2JB 3S15B 1YNJC 4A3EG 3IL8A 1KABA 2HCCA 1K8MA 4APVA 5IWAQ 4LF6Q 4B3RQ 4DV5L 3DEPA 2JA6H 5ELDA 2PQAB 2VUMH 3CPFA 1N8RC 4FF4A 1UEAB 2WAQB 4JV5Q 2DNCA 1FD7D 1HZ9A 1I4QA 2AHOB 2NN6G 2VQEL 1VQPA 1PVOA 3M9BA 3OIPA 5JEAG 2IX3A 1SROA 1X3EA 4UPAA 5A2QL 5C44G 1SR3A 2ALYB 2VQFL 2A69C 4NKLA 3MFYA 3A7AB 2JA5H 4J1MA 2ZJPA 3J81i 2OTJA 1PH8A 1UEBA 5J39A 3G4SA 4B3SQ 2UUCL 3R2TA 1HZCA 4A3FB 1J6QA 1NE3A 4IUVA 2AQ2B 4F8MA 4WORA 4PMWA 5FKAC 3C2PA 5CV5A 2R7DA 4DUZL 1A0IA 1SNDA 4JBJA 5KYLA 1L1OA 5DAUA 3P1HA 1D6EC 2IT1A 5AJ3Q 2OCEA 1Y14B 1PYWD 1I4PA 4LUOA 1LABA 2F0SA 4UHVA 3A56A 3E9IA 2F0QA 2ZT9C 5FO9B 4KMUC 5CMDA 3MXGA 1X3GA 3A54A 2CH4A 2C5CA 4B9WA 4GNXB 4IQZA 3BDOA 2EJGC 2BH2A 5KNCA 3J80c 1PRTB 3E0JA 4K14A 2NVXB 3D31A 3D8GA 2DGYA 2FINB 3PUYA 1KIXA 1ICWA 2NUCA 2ZM6Q 1YEZA 3LX0A 2X6GA 4Y52H 1UWVA 4M8AA 2EY5A 3OMCA 3PUWA 4ZKCB 2Z8LA 4IN3A 1ENAA 2A68D 2K1BA 1BQQT 4RKBA 4KK7A 3HOVG 4DFAA 5CGKA 2I46A 1SE2A 3MC0B 2H4OA 4BA1I 1GHJA 1E3PA 5C0XI 2CKZB 5C4JB 2IW3A 4FF2A 5LL6X 4B3TQ 3V96A 2CFMA 4K5VA 5FO8B 4HTHA 3ND9A 1Q7YC 2F0FA 1ESRA 5LHY1 1LM0A 3KLSX 3H15A 2PW5A 5IYBG 5M3MB 1AN8A 1XJVA 1EFID 1UE6A 1BKBA 5CV8A 1KRTA 4ME5A 1XNRQ 3FEWX 2BE5D 3A8KE 4XTCS 4A3GG 2PYKA 1PFBA 4IALA 1TS5A 1PH9A 1T9HA 3Q22A 4UAIA 1HQMC 5ELFA 3ULJA 4GOPC 3PUVA 3QB3A 3EQLC 2JA7H 1M90C 2CWAA 1IYJB 1RHPA 4IFDH 5JVG3 4DF7A 2WAQE 3KJPA 3I72A 3Q8DA 2D9UA 4CHTB 1VQEA 3GV3A 2SNMA 3HOZG 3HZXA 1MBYA 4YIJA 5G3LF 2MP1A 5GAEC 1OXUA 1N9WA 4FF1A 1U0LA 1Q90A 3CD6A 1Y1VH 4OGQC 3L2PA 2A74C 1GXDC 2XRSD 2CH4W 2PNRC 4MN3A 4JI8Q 5E7NA 1CQFA 5DNFA 4IZ8A 2JP1A 3WWVA 1VS0A 5BN3A 2F0TA 4A3JB 1N32L 1Q46A 1RL2A 2E76C 2DUDA 3DWPA 1PMRA 4QB4A 5C44B 4A3FH 5L37A 3MA2B 4K2LA 3HP3A 4ABNA 1N36Q 2HDLA 3A0JA 1KHIA 1I4XA 4YCUA 1B3QA 5DM73 4LWCA 3UE1A 3M4OH 1B4OA 4A3LG 3STBC 4P75A 1UUPA 1M1KC 3F1ZA 3A55A 4KI0A 4P71A 4A3IH 1EIGA 2MGSA 1EWIA 2DNEA 4DR2Q 1JJGA 1HNWQ 3J7AF 1VQHA 3OIQA 4H44C 4JI2L 1H9RA 5JJZA 1VQMA 2ATWA 3CF5A 4LFAL 2ASBA 1JQYD 4HJ5A 3CXCA 4A3MG 4ZK9B 1PH4A 5IGCA 1RTOA 1E22A 4JI1L 1STYA 1GUSA 5JEAJ 1I4HA 2B63G 4UP8A 2WINB 3IRBA 1O7YA 4LMQD 2KA7A 4HN7A 1SMYD 1XMQQ 3S1MH 3S2DH 2AQ1B 4FVMA 3HOYH 1GUOA 1TVXA 4L63B 3TN2A 3FRPB 2A1AA 1IYUA 4OWWB 3QR8A 3MTSA 2R7ZG 4H0LC 1GM5A 4A3DG 1S5ED 4DV3Q 1FVIA 3S16H 4QQBX 2KHSA 3T53B 3ND8A 3MFGA 5BR8L 4XT1B 2WP8J 3C1EA 1GUNA 3TQYA 2XWBB 1YNJD 4KKUA 2JA6G 2V4DA 3GTMB 2VUMG 1BCPF 2F0EA 2BCOA 2G9HD 4BY7B 1K73C 4OEMB 4L5RC 3QOLA 2F4VL 1VQBA 4Q5VA 4MTKA 3J80E 5KEEA 2NTTA 1I5FA 3HOXH 4P2CB 2L5TA 2R7FA 2UUAQ 3QOJA 1HA5A 3HOVB 2JA5G 4BY1H 1VMPA 3H3VI 5I2YA 1E2VA 1LYLA 2UXBL 3K5MA 3I4MG 2AUJD 3S2HB 4GN5A 1ML0D 2PI2E 4KTAA 4EQ5A 4JC0A 4QUFA 3WOEA 5ELEA 2JQOA 3SHLA 1QUQB 5HURA 4KD3A 1EYDA 2E75C 1PTOH 1HNXL 1ET9A 4OONA 2KHIA 1K8OA 1WD1A 4LF4Q 4A3GB 1BUVT 1VQ7A 1A2TA 1XMOL 4IUNA 1D5ZC 4C2MH 3PF4A 2PQEA 3NHHA 2E5LL 1AFPA 4AYBG 2PZTA 2YTYA 1G51A 3KF6B 5EPLA 3QG1A 1LUZA 5EKLA 4A75A 3HOZB 5M3FH 5EPJA 4GKJL 1EQTA 5IGEA 3BS1A 4YCVA 2B2YC 5ELBA 1Y8NB 3NUCA 1Y69U 4JI0L 1I94L 2WV6D 1MJEA 4CKCA 1LLRD 1EZ8A 3TSSA 2KEEA 2O5JC 2Q2TA 1SSOA 4PZ8A 1NY4A 1A6XA 1TY0A 1GUTA 1S4ZA 5IGFA 2N3SA 4X3TA 3I4NG 2I5HA 1OXSC 1BXTA 1UE7A 4TKOB 1TXYA 3KYHC 1FNWA 4HJ8A 3S1RB 2A8VA 3NQTA 4L5SA 3OOCA 3VYUA 1KRSA 1VQ6A 4JI5Q 2LXKA 4WJ4A 3AB9A 4G7OC 3U9OA 1OO9B 2JJQA 1L1OB 5IE8A 3O13A 2WKCA 3DMUA 3VA5A 1IBLQ 1A2UA 3BVMA 3M7GA 3R8BA 2Q2UA 4DAYB 1WTHA 1TY2A 3SR1A 1WFQA 2BH8A 5FK9C 1FJGL 2JK8A 1JMCA 4UY8C 3D0FA 1X9NA 2B63B 2RDHA 5K36H 4M1UB 2UXDQ 1AZPA 5COYA 2JA7G 4IFDG 4LF9L 1ILPA 4ZRZA 3S17B 5CR3A 3P7JA 2PW7A 1T5EA 1EY7A 5A2QE 3R3OA 2QDLA 1DONA 3GTPH 4DK6C 4BY7H 1YJNA 1BR9A 5GAGC 1RKNA 3GTLH 3NXWA 4OL7A 2SDFA 1N33L 1Y1VG 2P5ZX 2Y0SG 1CM9A 3DEOA 1VDZA 2QCPX 2JA6B 3PCOB 1D1KA 4P74A 1KLGD 2K7VA 3TMEA 2VL6A 1QZGA 3GTOH 2K5DA 2ZJQA 5CC4A 2GA4B 2A6HD 1WTWA 4XT3B 2JA8H 5M9OA 1VQ4A 1NSNS 4A3FG 2Z9HA 3CCVA 1VQGA 4NPSA 4A4IA 2RBMA 2BDOA 3UDXA 1Q8IA 4FO2A 1HR0Q 2JA5B 2F0MA 2CQAA 1MHWC 1RTNA 3PMFA 5GROA 3PV0A 3W3AA 3PGZA 4C56C 5D3DA 1NMFA 4BA2I 4UP9A 1YJ9A 2RHSB 4RHSA 5HGQA 3GV6A 3URYA 1AH9A 1F9SA 3STBD 5EBCA 1CK1A 2HD3A 4LJZC 4JI3Q 5LMNL 2F0KA 2NBFA 4DR3L 4GLVB 3F8TA 3P75A 3BJUA 3H3VC 1X65A 2F1MA 1CZWA 2EJMA 3GO5A 4H13C 2QEJC 1GJXA 5IYCH 1K8AC 1HNWL 2JSOA 1WI5A 3LNNA 3H91A 1P16A 1EQVA 2F0PA 1BVSA 5EJWA 5LMNW 1B50A 1XPOA 4KKSA 2RVLA 4AYBB 1D2BA 3SK4A 1EU4A 4QY7A 5EPKA 4CJ1B 1QCBD 3HOYG 4DV1L 4JOIC 1KNEA 3CC4A 3DXJC 3QIAA 1SRUA 3Q23A 1XMQL 4DNIA 3D4WA 4RHRA 3J81L 4NXMQ 3TS2A 4YWKA 3A5UA 2K5HA 2QILA 2L0CA 4XIGS 4OWXB 3K6OA 2KCNA 2R61A 1TIID 1SE8A 4F7XA 2Z1CA 4OHJA 1PYSB 1GO3E 3A8JE 2QW7A 4K8IA 3HOXG 2WFWA 4RFBA 3V2TA 4EX5A 3M7NA 1U4MA 4ME3A 4X64L 1TWHH 4BY1G 3RD4A 4WRDA 1VQ9A 4HMJA 3UDIA 4KJNA 1RCVD 1KLUD 3F2UA 3ONAB 2VNUD 1YHQA 3KOJA 4LW1A 1PRTD 1SFOH 5M3MG 3KLWA 2LSSA 4JI7L 4TRDA 4ZKBB 3C46A 3ERQA 1TR5A 5GQOA 1M4VA 1SYCA 2FXQA 5IGBA 1XNQQ 3U9SA 1PA6A 1G2SA 3K0XA 1J5EL 4NXNQ 3J7A5 2MHVA 5IP9H 3S17H 1VQCA 3T16A 4DV6Q 4A3KH 5J22A 2DY7A 2L15A 1SYFA 5C6AA 2F0GA 1CUKA 2JA7B 2PMZB 4G4KA 4RGNA 5NUCA 4DV7Q 2IL8A 3J80i 1S5CD 1FR3A 1II3A 3S24A 3VYRA 2A6ED 2DN8A 3FDTA 4L5TA 4ZUJA 1YI2A 5M5XH 1XYIA 3NBHB 3SK6A 1V9PA 1TWGH 5M3FG 3SEBA 5AFWA 1EYAA 3BYYB 1G91A 4DNTB 1C4QA 2F0NA 2NZ1D 2JXMB 4A3JG 3I56A 2B2VC 1UAPA 2G5DA 1EIYB 4EGVA 1Y1VB 2KECA 1EU3A 1JICA 2Y0SB 4XQNA 2C35B 1JWUD 4LFBQ 3MHBA 3D3RA 1O7IA 4B3ML 2EY6A 4X6AH 3OHXC 4KN4C 3FP9A 2FJ2A 3FMCA 2M2LA 4DV4Q 5E1FA 2CQOA 4C3HH 1NBWA 1OTCA 4IFDJ 3BDLA 2I5LX 4N9TA 3S1QH 3EA6A 4YCWA 3KBGA 4KV6A 3PQIA 1JT8A 4CDFC 2AWNA 2LS01 4IPHA 1JJ2A 4A93H 3M4OB 4DUYQ 1IBMQ 2F52A 1E0BA 4A3IB 1YIJA 5IYDH 4AYBE 3DM3A 4OIJA 5GADC 2LXJA 1A8VA 3KDFA 2LFNA 2EXDA 4KY6A 3BZDB 2WB1B 4XYQA 1H95A 1B3AA 1QVCA 1K0SA 4N9PA 4POFA 4LF5Q 4IUPA 1HRJA 2SEBD 1X3PA 1U5KA 1XPRA 3I4LA 5K36G 2WIIB 1DCZA 4GKKQ 2XNAC 3MXUA 3CKIB 4KY7A 4R4OA 3S1MB 3S2DB 3HOYB 3GDEA 4JBWA 5C3XA 2J0TD 1JOQA 3ER0A 4DGZA 2Z4IA 4BY7G 3H09A 2B8GA 4FF3A 4K8JA 3S16B 1KQSA 1B44D 3NWTA 1EOTA 2JEBI 2EYOA 3IAYA 1PDQA 1ENCA 4MTNA 2EY1A 5LMUQ 3Q24A 3A74A 3AEVA 4JBMA 2EYPA 1HQRD 1F77A 3DHQA 4B9XA 4L5QA 3S9WA 1U4PA 1DJRD 3D4RA 4DR4Q 1V8QA 5KNBA 3H6MA 4J8QA 2M9VA 2JA8G 4CKBA 4CBVA 5ELOA 3HOXB 2ID0A 4JI6L 2MNAA 1EIHA 3T1HL 4R8NA 4BY1B 2K14A 3GD7A 1YHAA 3K5LA 5C3EH 3EBEA 2Z6BA 1BBUA 3J81c 4X65L 2PMZE 2KBNA 4AIMA 5IT9L 2DY8A 2KEDA 1SE3A 1STBA 4RGTA 1PTOB 1ZEQX 4DR7L 3MZ5A 1SYDA 3W2DA 1LTID 1LV9A 1Y8OB 1NNXA 3K7AH 1SE4A 2K03A 5IYCG 1VQFA 4CGYB 3MXNB 2Y0SE 4ODGA 2B39A 4C2MB 2X6LA 5J1ZA 4JCVE 4OXPA 3MAQA 1STNA 1DD2A 3RZOB 2Q8RE 1RJTA 4IO9A 2ZJRA 1KD1C 1HUNA 4YY3Q 1HNZL 3C1FA 3EIVA 4LF7Q 1DOKA 2RHQB 1AE2A 1SNOA 2D0PA 3W1GA 2PPBC 3I73A 3BVZA 2F0DA 5M3FB 2JN4A 1STEA 2RDFA 4JYAQ 2YV5A 2A6HC 3JAMi 1E2WA 4YWMA 3FPPA 4DR6Q 1Z6HA 5CBAE 2NN6I 1RODA 4EQOA 4DV2L 1L0YB 1W6KA 4RGOS 3F2DA 1JORA 2VXWA 1VQIA 1Q8KA 2Q2HA 3NTKA 1S5DD 5BN5A 1ASZA 2RSNA 1SYEA 3G7LA 2A19A 1PHJA 4QIWB 5C4HA 1G6ZA 1AZQA 1CSQA 4LAAA 4LF8L 1MJCA 3TDQA 4HMIA 4DV0Q 1JOKA 1I3QH 3E9HA 4C3IH 1LTLA 4B08A 3K58A 1STHA 5EKIA 4FXKC 2QKIC 1A3TA 1LTGD 1LT6D 1T5XD 2UU9Q 5D14A 2ZTCA 1Z9FA 1Q1EA 2SOBA 1K9MC 4R4QA 4KY5A 4AQYQ 3NTIA 1UE1A 1JJCB 5IP9G 5KRUA 4FYDA 1UNSA 2EE1A 4DK1A 4DXGA 1O7ZA 4A3KG 2PNHA 5I9PA 1IYVA 2K52A 4HCSA 5I2XA 3MVVA 3BZCA 5IGDA 2JEAI 3TP7A 2I0QA 2QF7A 4DR1Q 2E2IH 2B2WC 3L0OA 4DV6L 4HIOA 3KK7A 1RD9D 2KCTA 1TS3A 4QL5A 3RLNA 1N34L 5IP7H 1VQ5A 4GS3A 3CMEA 4A3BH 4DV7L 4OX9Q 3GTPB 3E5SA 4RMFA 2K6AA 4B3RL 5IWAL 4LF6L 3L3OC 1Q82C 4KN7C 1WD0A 3GTLB 2UXCQ 4NW2A 2F0LA 2EY2A 1GUGA 3RZDH 4JV5L 2F0OA 4KLKA 3CCEA 4U673 4GNXC 3VR3A 4HJ9A 2L55A 2K5VA 4FP5D 2XWJB 1PRTC 1Q86C 2F0JA 3GTOB 1YBYA 4CKEA 2K4KA 1F9PA 2BDNA 1O78A 1PFMA 2XSCA 4KJOA 3VR4A 5IODA 5C0XH 2JA8B 4E6IA 2CVRA 4C3HG 3T13A 2EIFA 1SYBA 4B3SL 1IBKQ 4DV4L 3GTKH 4A93G 3I8ZA 2PO4A 3VDYA 5IYDG 2NTSA 3QWNA 4OO1H 4YHHQ 1PLFA 2IHFA 1U4RA 1M8AA 3TRZA 3NE5B 4J15A 1TQOA 5ELNA 1ZYRC 3NEMA 1J8IA 1EY4A 4HIMA 5C4XH 1JCKB 2R93B 1B9NA 3KF8A 1XTCD 2A6EC 3K8AA 3RZOH 1Q12A 5AJ3L 3J81E 1D5XC 4N8X1 1LTRD 2NVTH 3A8IE 1HHVA 4IJLA 4GZYC 4ZYSA 3OTOQ 1L0WA 1W2BA 2RA4A 4PZ7A 3PIP3 4RWSC 5EQ0A 4NB3A 1WCMH 2E2HH 4PV1C 4DV5Q 1MGSA 3DUZA 4Q0FA 1PYBA 1DOLA 2IY5B 3UE0A 1PTOC 1L0XB 4A3EH 2VQEQ 1VQLA 3CMAA 3VA7A 4ZAIA 3FKIH 2RCFA 3CC2A 3PUXA 2HHHQ 3CC7A 1EEID 1LTTD 4C1NI 2ZM6L 1IKLA 3KLRA 2QA4A 5E3FA 1SXTA 2RKSA 1JC7A 1E1OA 3K59A 4C1NK 2OXPA 2IX1A 4LK1C 2VY3A 3KLSA 1C48A 1JB7A 2AKWB 3NENA 1B7YB 1BNZA 4IOCA 2UUCQ 1LTBD 3SGIA 3HGBA 4BS9A 1XTDA 3WDNA 1TWHB 3CCUA 1KNAA 4HIKA 1KDBA 4RA8A 1SFOB 2JYOA 4B3TL 3T1YQ 1W3SA 3KDFB 3HS0C 1VQNA 1Y8PB 3K80C 2RCNA 3HOWH 4MIUA 1FGUA 1FGBD 1WTRA 3CCMA 4JI4Q 2EPBA 4IUTA 3V05A 1JOOA 4P73A 3M85A 2YYZA 1XNRL 1KTKA 4HCEA 4WJ3M 1SNQA 5G3LD 2HIXA 2B2YA 4A3KB 1PH1A 4HR7B 1DXMA 4WJWA 3M4QA 1L2FA 3OW2A 2KVMA 2PI2A 1YNXA 4YWLA 5CV7A 5K5PA 3X3MA 1E24A 3OYYA 5M5XB 2HQLA 3OPOA 3E6ZX 1X56A 1TWGB 2PCFB 1DGSA 4X3KA 2EZVA 5I9OA 2QEXA 1S3OA 2ZXRA 2EYFA 4YY3L 2H1EA 4LF7L 1VQ8A 4RCOA 3CCLA 4JI8L 4K5XA 1SNCA 2D5DA 3CU7A 1HH2P 2VZAA 4JYAL 2K01A 3H0GH 2OTLA 3H3VH 1AEXA 2Q2IA 3VYSA 1MI2A 3I55A 4CJ2C 1I6HH 3DM1A 1R4PB 4TQUS 4A3IG 4C3HB 1N36L 3S1QB 1TS2A 4L8JA 1EIFA 2PZWA 4ID6A 1YITA 2C9OA 1STAA 3BYTB 1YHBA 2G9DA 2CCZA 2WB1G 4JBKA 3U4VA 2R93H 4A93B 1XPUA 3I91A 1WVLA 4C3IG 3J80L 4DAMA 4DR2L 1HPCA 2Q8TA 1A63A 1V1PA 2WACA 5IY0A 3I4OA 2B2UC 3TP5A 2EYHA 1ILQA 4IPDA 4QF4A 3HOUB 4R9WA 4R8IA 3N6RA 3TREA 4G7ZC 1CKNA 2B29A 2IHEA 1HTPA 3S1NH 1SDFA 4AQYL 3I7FA 1MKHA 2F3VA 1TWFH 3L7ZC 2K5QA 5A35A 1VQDA 3PO3B 1A15A 5I6YA 2XGTA 2Z6KC 5IP7G 1E1TA 1KAWA 4DV3L 1QB5D 4A3BG 3CCJA 2DJFC 3ERSX 1EY8A 3GQBA 4A76A 1N32Q 4BBSB 1EY5A 1EQQA 2F0UA 1V1QA 2JE6I 5H1SE 2GN5A 3BU2A 3PO2H 1QJOA 4OX9L 3G6JB 1PZID 2MFIA 3BVGA 1DM0B 2CWPA 1S5BD 2ZTEA 5FLXL 1ESFA 1SNPA 2UXCL 3DWAA 4NDXA 2ZXPA 3A7LA 4HSPA 4H02A 2N88A 5C0XG 1SJHD 3SVMA 3T51B 2UUAL 1GD7A 2UUBQ 1VQKA 1HA6A 1IZ6A 2EQSA 1KDCA 5FLMH 2R6GA 4FDBA 4JI2Q 5C3EB 1EUJA 3DLLA 4LFAQ 4XDXA 4C3JH 2K04A 3GTJH 1HZAA 2B2TA 1F2MA 1ONLA 2D0OA 4JI1Q 1EOVA 4OO1G 3K57A 3EVQA 1IBKL 1SJED 1G6PA 1X55A 4RCNA 2QDBA 4A3MH 2ZTDA 4JOIA 5C4XG 3TEHB 4LF4L 1ZYRD 5D65A 2K05A 4LUZA 1G291 3K7AB 2N49A 5CBEE 1L1OC 3NK9A 3OWFA 4POGA 1NCVA 5LL6S 4IFDI 1DZ1A 2FMMA 1QNUA 1GOZA 1AE3A 1HTLD 1WCMG 4LNQA 5BR8Q 3AQQA 3OWEB 4OWTB 1HXYD 1TWCH 5KYIA 1WJJA 5JPMC 4MNOA 1EWHA 3NP8A 1QNKA 2EYLA 3MWYW 1PTOD 2OWOA 2F4VQ 4KHVA 4BBRH 1ZKOA 2F0WA 3J81j 1Y1WH 3FKIG 1NAPA 2TSSA 4HEDA 3CQZH 2NVQB 4KHZA 5T1IA 4RH6A 2R92H 5CV6A 2F0IA 2L9HA 2F3WA 4HJ7A 1SBBB 1CKMA 2K32A 2NWGA 2UXBQ 2HHHL 2IX0A 2AUKA 2OQ0A 5M5WH 1PV4A 2F0HA 5M5YH 3IFDA 2B8FA 1X32A 2VW9A 1BCPB 3I4MH 4DKAC 4DNRB 1QZHA 1VF5C 5KGUA 1HNXQ 1I3QB 4HAEA 1HUMA 3NSWA 4JI5L 3HOUH 4DU9A 3ICEA 2XIWA 4C3IB 2LY7A 2I5MX 3KF8B 1LTSD 2D62A 3HOWG 1XMOQ 1NJIC 3RN2A 2ENBA 1IBLL 3TBIB 2MPMA 2HDMA 2E5LQ 3T1YL 4TVAB 1R9TB 2MUYA 3GTGH 4QCLA 4DAYA 3K7UC 1NUCA 1YJWA 2K50A 3JAML 1YZ6A 1TU2B 5FJ8H 4DA2A 3CCQA 1H9SA 2F0VA 4JI4L 3PO3H 1HFNA 2UXDL 1FNVA 1LTAD 3T4AC 4BXXH 2B2VA 4GKJQ 2KENA 1Q1BA 1NR2A 4IPCA 1KDAA 2LKVA 3EROA 3I2ZA 4BBSH 1CSPA 1MSGA 2E2IB 3M3YH 2K33A 1VMCA 5I4DA 4JI0Q 1GVPA 3AFQA 4ZQ3A 3GTQH 1I94Q 2OT2A 3BDCA 1BO0A 3RUZA 2FFKB 4Y7NH 4A3BB 4OELB 3G6EA 2KHJA 1IW7D 1SLJA 1CA5A 3OW7A 2MO1A 5EAYA 3EJIA 2PZUA 3KJOA 4XXEA 3RZDB 3TP8A 3RR5A 4DAVA 3ULPA 4QUCA 4QJFA 3H0GG 1B53A 3I4NH 1KXLA 1GUWA 2YTXA 4KHPQ 2ES2A 3I3CA 1LT5D 4O42A 1I50H 3CRLC 2XVSA 1HR0L 2E2DC 4ZCKA 4KKTA 4LFCQ 2RSOA 1JE4A 1XXGA 2FHTA 3FVQA 1G8ZD 3DWQA 5ELCA 4QMGA 2VS1A 1P8LA 3GTKB 2R93G 2K28A 1EYGA 1FJGQ 3GP7A 3U4ZA 4JI3L 4XQJA 1B70B 3NWSA 1H9JA 1HR0W 3S14H 4PMBA 2WKDA 5FLXc 1TT2A 4KD4A 1GHKA 1CKOA 4LF9Q 5C4XB 4OO1I 4ZLTF 1MIUA 2YU9H 3PIO3 3MEHA 2EXZA 5DEHA 2NVTB 2E2JH 3HOWB 2EYJA 3J7YW 3S15H 1BOSA 4JVZA 1JWSD 4ILWA 5C0XJ 1PH7A 4A3CH 2QGQA 5JJIA 3F2CA 1WYDA 5IOCA 1WCMB 2E2HB 3B6YA 1N33Q 4R4IA 2NVQH 3L9AX 4S3SA 1V1OA 4U68A 2DJGC 5IIFA 5JJLA 4A3EB 1SEBD 4LUVA 1STGA 1BDOA 4NXML 1H9MA 3NQIA 3LWEA 3K5OA 1TS4A 3FKIB 3PSIA 1VQJA 5JAVA 2E8GA 1QG7A 3PO2G 2EDGA 1PH5A 2WB1E 3AYHB 1CFMA 1B8AA 3AMUA 2BA1A 4ALPA 1X3QA 3VR2A 4GOPA 3J7AV 4F87A 3F2BA 2AMCB 2FMCA 1EY6A 5LMNQ 3EFXD 4DR3Q 3AU7A 2HQEA 1JR0D 5FLMG 1Z47A 4HIDA 5JVH3 2RDGA 3VR5A 2KCCA 3PUZA 2AQ3B 1F2ZA 2UUBL 2NZHA 1EL0A 1R9TH 4C3JG 1PH2A 1V1PB 2EVBA 2OQKA 4ULLA 2RF4A 5TSSA 5T1GA 5ISRA 1F2LA 4X62Q 1JB3A 2MQHA 1U9RA 1J9OA 5I6WA 1XNQL 1AP0A 1CTMA 2MO0A 1CKNB 4NXNL 4K0KQ 4EQNA 2VB2X 4F88A 4WFN3 1GKHA 1BCPC 1JWMD 1IXRA 4OIKA 2KCMA 4DV1Q 2O2LD 5CV9A 4EQPA 1KAAA 4DK0A 2ICIA 3HKZG 1D1IA 4HJAA 1SMXA 5JJKA 3SK5A 2NVXH 2TMPA 4K6DA 3SE0A 3TS0A 3OMGA 2IPKD 5IGGA 4CDDC 2RQXA 1K83B 2N8NA 3OSOA 1TWAB 3KUPA 4DR5Q 1WTPA 1QWYA 3CRKC 1WTXA 5EBDA 4X3UA 3ZJYC 2R3ZA 5KNDA 3LWUA 2PQAA 1EWCA 4O2DA 3NBHA 4AH6A 3P20A 4BBRG 3C3LA 1Y1WG 1OXVA 1S40A 1EFWA 2HCIA 4IJHA 3VR6A 2XRQD 2R92G 4I65A 3R93A 4K5WA 1KC8C 4IUQA 2O4XA 4LFBL 1BBWA 4G7HC 3JAMc 4UDUC 1SYGA 3G48A 4X64Q 1EEFD 3H0GB 4NP5A 3U50C 1B1ZA 4IPGA 5C4JH 4X66Q 1IL2A 2HIVA 5JPNC 2A69D 3K0YA 3RLOA 5CYUA 4JI7Q 2Z0SA 5C5LA 1I6HB 4H7BA 1Z7TA 1YNNC 3K81C 2E74C 2V1CC 3AFPA 4O0AA 5J3BA 5M3MH 1EY9A 1HFGA 4DUYL 5FO7B 1IBML 1J5EQ 1U4LA 1PRTF 2CW0C 2N55A 4O1NA 1UE5A 2B3GA 3HOUG 1LACA 1QE6A 4QGUA 1I6VC 3QJYA 1XWEA 3NBIA 2B2WA 2IJ0A 2KQ3A 3W1BA 1EYCA 4ZUIA 1IKMA 3UI2A 4DN4M 1ET6A 1BF4A 3PF5A 4LF5L 1VCIA 5EKKA 1TKWB 1A3UA 3Q0AA 5FJ8G 3CCSA 3HFZB 3SXHA 1G2TA 3PO3G 4BXXG 4L6TB 4GKKL 2L12A 2EJFC 1RF2D 4I7ZC 3S1NB 2NVYB 4PMCA 4DK3C 4QIWE 1D8LA 2SNSA 1F2YA 1H9KA 3M4YA 1EQRA 4FNFA 1TWFB 3NTHA 3TZUA 1PXUA 1W6JA 5FLXE 5IT9c 4GNXA 4BBSG 2F3IA 2KOLA 5FOBB 3ULLA 2VQFQ 2NN6H 4DAPA 1A62A 1CA6A 1WTVA 4A3JH 4B3MQ 2NZOA 3CP0A 1NTGA 1CHQD 3ZYYX 4CJ0B 5JEAH 2VB3X 1I4GA 2F03A 4MZ9A 3G71A 5C44H 1FNUA 4IURA 5LMUL 1RIPA 2J7ZA 1JE5A 3KBXA 4RG1A 4CDCC 3PO2B 3TZDA 4CDEC 1PTOF 1ICFB 3D4DA 3PIOA 1C9OA 4X3SA 3J7ZC 4DR4L 1A3VA 4DUZQ 5C3EG 3EN2A 1CHPD 4IUUA 3VYTA 4HSVA 4DXFA 1CI3M 3CW2C 2H5XA 1PZJD 1FL0A 1CQVA 4TSSA 2MJ8A 5E4WC 3BZKA 3UDFA 3Q6SA 1ZXTA 1AW7A 3ITPA 1S72A 3FHWA 4KHPL 4MHEA 1K3RA 1QOHA 1BBXC 1X3FA 1PZKD 4R4CA 4C3JB 3IKJA 2HUGA 3GTJB 4PG3A 1OXXK 4LFCL 3I90A 2KUMA 1K8GA 2EOTA 2XTIA 3LGJA 3NPPA 1SN8A 1CT1D 1H9SB 5C4ZA 4A3MB 1D7QA 1X54A 3RNUA 3I70A 2I07B 3CHBD 3JC66 1MSHA 1K83H 1TWAH 4GLXA 5F2DA 2O5IC 4XQQA 2BA0A 3MXNA 3KFUA 3HKZB 4A3CG 1IW7C 2HT1A 2D2CC 4JPBW 2JA9A 1HZBA
chains in the Genus database with same CATH topology
4Z9CB 2EYMA 5DM63 1D5MC 2R7ZB 4A3DB 1F9QA 1TWCB 4J6HA 1SAPA 1LT3D 2X69A 1XX8A 2OEOA 4BBRB 3SK8A 1Y1WB 1O7LA 1V43A 2A68C 3CQZB 2VUMB 1B2TA 3K5NA 2R92B 2K5WA 4RKLA 3BG3A 2ICEC 4PNYA 1SNMA 2KJXA 3TP6A 1OXTA 5M5WB 1WTOA 2LMCB 2XN9C 3HRZC 5M5YB 3IFTA 5EGTA 2L1BA 1CZGA 3D6WA 2M00A 3JAME 2L4NA 3I4MB 2BE5C 1PFNA 5BN4A 5E4XA 2A5HA 3HEJA 1IL8A 2IWHA 3T56B 2L11A 1VF7A 5C3WA 4RGMA 1F9RA 1DOMA 3X3NA 3H94A 3GTGB 2NYZD 1ENFA 1BCPD 1S5FD 2B2TC 2AWOA 5KIXA 2ZXOA 1C8CA 1R4QB 3RLFA 4G57A 1EZ6A 5D3IB 3M3YB 1RDPD 4BWGB 2OF1A 4EVOA 4PQXA 3GTQB 3FPUB 2Q8IB 4Y7NB 2Z4HA 4FXDA 5IT9E 4K6LA 1I4RA 3HG9A 1MD2D 5CV4A 2J4XA 3I4NB 3RMHA 4K2KA 1Q3LA 3N52A 5C5MA 4V190 3R2IA 1IHZA 1E2ZA 1I50B 2B2UA 2A73B 4V0BA 3MXPA 2BOSA 5HGTA 1NR4A 1HCZA 1YNND 1QILA 5CORA 2F4IA 3WOFA 2CHBD 2CW0D 4JK1C 1EY0A 3QO2A 3SDZA 1FYCA 4NMZA 1LT4D 1SMYC 3D6CA 1DYQA 1O80A 1WTQA 3S14B 1LO5D 4RAUC 1B9MA 5JOBA 2NB0A 2YU9B 4XYOA 4FXGC 2E2JB 3S15B 1YNJC 3IL8A 1KABA 2HCCA 1K8MA 3DEPA 5ELDA 4FF4A 1UEAB 2WAQB 2DNCA 1FD7D 1I4QA 2NN6G 3OIPA 5JEAG 2IX3A 5A2QL 2A69C 4NKLA 3MFYA 3A7AB 4J1MA 5J39A 3R2TA 4A3FB 4IUVA 2AQ2B 4F8MA 4WORA 4PMWA 5FKAC 3C2PA 5CV5A 1SNDA 5KYLA 5DAUA 3P1HA 1D6EC 2IT1A 1PYWD 1I4PA 1LABA 2F0SA 3A56A 2F0QA 2ZT9C 5FO9B 4KMUC 5CMDA 3MXGA 3A54A 2C5CA 4B9WA 4IQZA 3BDOA 2EJGC 5KNCA 1PRTB 3E0JA 4K14A 2NVXB 3D31A 3D8GA 2FINB 3PUYA 1ICWA 2NUCA 3LX0A 2X6GA 4M8AA 2EY5A 3OMCA 3PUWA 4ZKCB 2Z8LA 4IN3A 1ENAA 2A68D 2K1BA 1BQQT 4RKBA 4KK7A 4DFAA 5CGKA 2I46A 1SE2A 3MC0B 2H4OA 4BA1I 1GHJA 5C0XI 5C4JB 2IW3A 4FF2A 5LL6X 3V96A 4K5VA 5FO8B 4HTHA 3ND9A 2F0FA 1ESRA 5LHY1 3KLSX 2PW5A 5M3MB 1AN8A 1EFID 5CV8A 4ME5A 3FEWX 2BE5D 3A8KE 4XTCS 2PYKA 1PFBA 4IALA 1TS5A 3Q22A 4UAIA 1HQMC 5ELFA 3PUVA 3QB3A 3EQLC 1RHPA 4IFDH 5JVG3 4DF7A 3I72A 2D9UA 4CHTB 3GV3A 2SNMA 3HZXA 1MBYA 4YIJA 5G3LF 2MP1A 1OXUA 4FF1A 1Q90A 4OGQC 2A74C 1GXDC 2XRSD 2PNRC 4MN3A 1CQFA 5DNFA 4IZ8A 2JP1A 5BN3A 2F0TA 4A3JB 2E76C 3DWPA 1PMRA 4QB4A 5C44B 3MA2B 4K2LA 3HP3A 4ABNA 2HDLA 1I4XA 5DM73 1B4OA 1UUPA 3A55A 4KI0A 1EIGA 2MGSA 2DNEA 3J7AF 3OIQA 4H44C 1H9RA 5JJZA 1JQYD 4ZK9B 5IGCA 1RTOA 1STYA 1GUSA 5JEAJ 1I4HA 2WINB 1O7YA 4LMQD 2KA7A 4HN7A 1SMYD 2AQ1B 4FVMA 1GUOA 1TVXA 4L63B 3TN2A 3FRPB 1IYUA 3MTSA 4H0LC 1S5ED 2KHSA 3T53B 3ND8A 3MFGA 4XT1B 2WP8J 3C1EA 1GUNA 2XWBB 1YNJD 4KKUA 2V4DA 3GTMB 1BCPF 2F0EA 2BCOA 2G9HD 4BY7B 3QOLA 4Q5VA 3J80E 5KEEA 2NTTA 4P2CB 2L5TA 3QOJA 1HA5A 3HOVB 1VMPA 5I2YA 1E2VA 3K5MA 2AUJD 3S2HB 1ML0D 4KTAA 4QUFA 3WOEA 5ELEA 3SHLA 5HURA 4KD3A 1EYDA 2E75C 1PTOH 1ET9A 1K8OA 1WD1A 4A3GB 1BUVT 1A2TA 4IUNA 1D5ZC 2PQEA 3NHHA 1AFPA 2PZTA 5EPLA 3QG1A 5EKLA 3HOZB 5EPJA 1EQTA 5IGEA 3BS1A 2B2YC 5ELBA 1Y8NB 3NUCA 1Y69U 2WV6D 4CKCA 1LLRD 1EZ8A 3TSSA 2KEEA 2O5JC 1SSOA 1A6XA 1TY0A 1GUTA 1S4ZA 5IGFA 4X3TA 1OXSC 1BXTA 4TKOB 1FNWA 3S1RB 3NQTA 3OOCA 3VYUA 4G7OC 3AB9A 3U9OA 1OO9B 3O13A 2WKCA 3DMUA 3VA5A 1A2UA 3BVMA 3M7GA 3R8BA 1TY2A 3SR1A 5FK9C 2B63B 2RDHA 5K36H 4M1UB 1AZPA 5COYA 4IFDG 1ILPA 4ZRZA 3S17B 5CR3A 3P7JA 2PW7A 1T5EA 1EY7A 5A2QE 3R3OA 1DONA 1BR9A 1RKNA 3NXWA 4OL7A 2SDFA 1CM9A 3DEOA 1VDZA 2QCPX 2JA6B 1D1KA 1KLGD 2K7VA 3TMEA 2K5DA 5CC4A 2GA4B 2A6HD 1WTWA 4XT3B 5M9OA 1NSNS 2RBMA 2BDOA 1Q8IA 4FO2A 2JA5B 2F0MA 2CQAA 3PMFA 1RTNA 3PV0A 3W3AA 4C56C 5D3DA 4BA2I 4RHSA 3GV6A 3URYA 1F9SA 5EBCA 1CK1A 4LJZC 2F0KA 2NBFA 3P75A 3H3VC 2F1MA 1CZWA 2EJMA 3GO5A 4H13C 2QEJC 1GJXA 2JSOA 3LNNA 3H91A 1EQVA 2F0PA 5EJWA 1B50A 4KKSA 2RVLA 4AYBB 1D2BA 3SK4A 1EU4A 5EPKA 4CJ1B 1QCBD 1KNEA 3DXJC 3QIAA 3Q23A 3D4WA 4RHRA 3J81L 2QILA 2L0CA 4XIGS 3K6OA 2KCNA 2R61A 1TIID 4F7XA 2Z1CA 4OHJA 3A8JE 4K8IA 4RFBA 3V2TA 3M7NA 1U4MA 3RD4A 4WRDA 4HMJA 4KJNA 1RCVD 1KLUD 3F2UA 3ONAB 2VNUD 1PRTD 4ZKBB 4TRDA 3C46A 3ERQA 1TR5A 1M4VA 1SYCA 5IGBA 3U9SA 1G2SA 2MHVA 3T16A 5J22A 2DY7A 1SYFA 5C6AA 2F0GA 2JA7B 2PMZB 4G4KA 4RGNA 5NUCA 2IL8A 1S5CD 1FR3A 1II3A 3VYRA 2A6ED 2DN8A 3FDTA 4ZUJA 1XYIA 3SK6A 3SEBA 5AFWA 1EYAA 3BYYB 1G91A 4DNTB 1C4QA 2F0NA 2NZ1D 2JXMB 2B2VC 1UAPA 4EGVA 1Y1VB 2KECA 1EU3A 1JICA 2Y0SB 4XQNA 1JWUD 3MHBA 3D3RA 2EY6A 3OHXC 4KN4C 2FJ2A 3FMCA 2M2LA 5E1FA 4IFDJ 3BDLA 4N9TA 3EA6A 3KBGA 4KV6A 2AWNA 2LS01 3M4OB 1E0BA 4A3IB 4OIJA 2LFNA 4KY6A 3BZDB 2WB1B 4XYQA 1B3AA 4N9PA 4IUPA 1HRJA 2SEBD 1X3PA 3I4LA 5K36G 2WIIB 1DCZA 2XNAC 3MXUA 3CKIB 4KY7A 3S1MB 3S2DB 3HOYB 4JBWA 5C3XA 2J0TD 1JOQA 4DGZA 2Z4IA 3H09A 2B8GA 4FF3A 4K8JA 3S16B 1B44D 3NWTA 1EOTA 2JEBI 2EYOA 3IAYA 1PDQA 1ENCA 2EY1A 3Q24A 2EYPA 1HQRD 1F77A 3DHQA 4B9XA 3S9WA 1U4PA 1DJRD 3D4RA 1V8QA 5KNBA 3H6MA 4J8QA 2M9VA 4CKBA 4CBVA 3HOXB 2ID0A 1EIHA 4R8NA 4BY1B 3GD7A 3K5LA 5IT9L 2DY8A 2KEDA 1SE3A 1STBA 4RGTA 1PTOB 1ZEQX 3MZ5A 1SYDA 3W2DA 1LTID 1LV9A 1Y8OB 1SE4A 2K03A 4CGYB 4ODGA 2B39A 4C2MB 2X6LA 5J1ZA 1DD2A 3MAQA 1STNA 3RZOB 2Q8RE 1RJTA 1HUNA 3C1FA 1DOKA 1SNOA 2PPBC 3I73A 3BVZA 2F0DA 5M3FB 1STEA 2RDFA 2A6HC 1E2WA 3FPPA 1Z6HA 5CBAE 2NN6I 1RODA 4EQOA 1L0YB 1W6KA 4RGOS 1JORA 2VXWA 3NTKA 1S5DD 5BN5A 2RSNA 1SYEA 3G7LA 4QIWB 5C4HA 1G6ZA 1AZQA 4LAAA 3TDQA 4HMIA 1JOKA 4B08A 3K58A 1STHA 5EKIA 4FXKC 2QKIC 1A3TA 1LTGD 1LT6D 1T5XD 5D14A 1Q1EA 2SOBA 4KY5A 3NTIA 5KRUA 4FYDA 1UNSA 2EE1A 4DK1A 4DXGA 1O7ZA 5I9PA 1IYVA 4HCSA 5I2XA 3MVVA 5IGDA 2JEAI 3TP7A 2QF7A 2B2WC 3KK7A 1RD9D 1TS3A 3GTPB 3E5SA 2K6AA 3L3OC 4KN7C 1WD0A 3GTLB 4NW2A 2F0LA 2EY2A 1GUGA 2F0OA 4U673 3VR3A 2L55A 4FP5D 2XWJB 1PRTC 2F0JA 3GTOB 4CKEA 1F9PA 2BDNA 1O78A 1PFMA 2XSCA 4KJOA 3VR4A 5IODA 5C0XH 2JA8B 4E6IA 2CVRA 4C3HG 3T13A 1SYBA 3I8ZA 2PO4A 2NTSA 3QWNA 4OO1H 1PLFA 1U4RA 1M8AA 3NE5B 1TQOA 1ZYRC 1J8IA 1EY4A 2R93B 1JCKB 1B9NA 3KF8A 1XTCD 2A6EC 1Q12A 3J81E 1D5XC 1LTRD 3A8IE 1HHVA 4GZYC 4ZYSA 2RA4A 3PIP3 4RWSC 5EQ0A 4PV1C 1MGSA 3DUZA 4Q0FA 1DOLA 1PTOC 1L0XB 3VA7A 4ZAIA 3PUXA 1EEID 1LTTD 4C1NI 1IKLA 3KLRA 5E3FA 1SXTA 2RKSA 1JC7A 3K59A 4C1NK 2OXPA 2IX1A 4LK1C 3KLSA 1C48A 1BNZA 1LTBD 3HGBA 4BS9A 3WDNA 1TWHB 1KNAA 1KDBA 4RA8A 1SFOB 2JYOA 3HS0C 1Y8PB 4MIUA 1FGBD 1WTRA 2EPBA 4IUTA 3V05A 1JOOA 3M85A 2YYZA 1KTKA 4HCEA 1SNQA 5G3LD 2B2YA 4A3KB 4HR7B 1DXMA 4WJWA 2KVMA 5CV7A 5K5PA 3X3MA 5M5XB 3OPOA 3E6ZX 1TWGB 2PCFB 4X3KA 2EZVA 5I9OA 2ZXRA 2EYFA 2H1EA 4RCOA 4K5XA 1SNCA 2D5DA 3CU7A 2K01A 1AEXA 3VYSA 1MI2A 4CJ2C 3DM1A 1R4PB 4TQUS 4C3HB 3S1QB 4L8JA 1TS2A 2PZWA 4ID6A 2C9OA 1STAA 3BYTB 2G9DA 4A93B 3I91A 1WVLA 4C3IG 3J80L 1HPCA 2Q8TA 1V1PA 2WACA 2B2UC 3TP5A 2EYHA 1ILQA 4QF4A 3HOUB 4R9WA 4R8IA 3N6RA 4G7ZC 1HTPA 1SDFA 2F3VA 3L7ZC 2K5QA 5A35A 3PO3B 1A15A 5I6YA 1QB5D 1EY8A 3GQBA 4BBSB 1EY5A 2F0UA 2JE6I 1QJOA 3G6JB 1PZID 3BVGA 1DM0B 1S5BD 5FLXL 1ESFA 1SNPA 3DWAA 4NDXA 2ZXPA 3A7LA 4HSPA 2N88A 5C0XG 1SJHD 3SVMA 3T51B 1HA6A 1KDCA 2R6GA 5C3EB 4XDXA 2K04A 2B2TA 1F2MA 1ONLA 4OO1G 3K57A 3EVQA 1SJED 4RCNA 2QDBA 1ZYRD 5D65A 2K05A 1G291 3K7AB 5CBEE 3NK9A 3OWFA 1NCVA 5LL6S 4IFDI 1DZ1A 2FMMA 1QNUA 1GOZA 1HTLD 3OWEB 1HXYD 5KYIA 5JPMC 1EWHA 3NP8A 1QNKA 2EYLA 3MWYW 1PTOD 4KHVA 1ZKOA 2F0WA 1NAPA 2TSSA 4HEDA 2NVQB 4KHZA 5T1IA 4RH6A 5CV6A 2F0IA 2L9HA 2F3WA 1SBBB 2K32A 2NWGA 2IX0A 2AUKA 2F0HA 3IFDA 2B8FA 1X32A 1BCPB 4DNRB 1VF5C 5KGUA 1I3QB 4HAEA 1HUMA 3NSWA 4DU9A 2XIWA 4C3IB 2LY7A 1LTSD 2D62A 2ENBA 3TBIB 2MPMA 2HDMA 1R9TB 2MUYA 4QCLA 4DAYA 1NUCA 3JAML 1TU2B 4DA2A 1H9SA 2F0VA 1HFNA 1FNVA 1LTAD 3T4AC 2B2VA 1Q1BA 1NR2A 1KDAA 2LKVA 3EROA 2E2IB 1MSGA 2K33A 1VMCA 5I4DA 4ZQ3A 2OT2A 3BDCA 1BO0A 3RUZA 2FFKB 4A3BB 1IW7D 1CA5A 3OW7A 3EJIA 2PZUA 4XXEA 3RZDB 3TP8A 4DAVA 4QUCA 1B53A 1GUWA 3I3CA 1LT5D 4O42A 3CRLC 2XVSA 2E2DC 4KKTA 2RSOA 1JE4A 1XXGA 2FHTA 3FVQA 1G8ZD 3DWQA 5ELCA 4QMGA 3GTKB 2K28A 3GP7A 4XQJA 3NWSA 1H9JA 4PMBA 2WKDA 1TT2A 4KD4A 1GHKA 5C4XB 4OO1I 4ZLTF 3PIO3 3MEHA 2EXZA 5DEHA 2NVTB 2EYJA 3J7YW 1BOSA 1JWSD 4ILWA 5C0XJ 5IOCA 1WCMB 2E2HB 3L9AX 4S3SA 1V1OA 4U68A 5IIFA 4A3EB 1SEBD 1STGA 1BDOA 1H9MA 3NQIA 3LWEA 3K5OA 1TS4A 3FKIB 5JAVA 1QG7A 2EDGA 1CFMA 3AMUA 2BA1A 1X3QA 3VR2A 3J7AV 4F87A 2FMCA 1EY6A 3EFXD 3AU7A 2HQEA 1JR0D 1Z47A 5JVH3 2RDGA 3VR5A 2KCCA 3PUZA 2AQ3B 1F2ZA 1EL0A 4C3JG 1V1PB 2EVBA 4ULLA 5TSSA 5T1GA 5ISRA 1F2LA 3HOWB 1JB3A 5I6WA 1U9RA 1J9OA 1AP0A 1CTMA 4EQNA 2VB2X 4F88A 4WFN3 1JWMD 1BCPC 4OIKA 2O2LD 5CV9A 4EQPA 1KAAA 4DK0A 2ICIA 1D1IA 3SK5A 2TMPA 4K6DA 3SE0A 3OMGA 2IPKD 5IGGA 2RQXA 1K83B 3OSOA 1TWAB 3KUPA 1WTPA 1QWYA 3CRKC 1WTXA 5EBDA 4X3UA 2R3ZA 5KNDA 3LWUA 1EWCA 3NBHA 3P20A 3C3LA 1OXVA 2HCIA 3VR6A 2XRQD 4I65A 3R93A 4K5WA 4IUQA 2O4XA 4G7HC 4UDUC 1SYGA 1EEFD 3H0GB 4NP5A 1B1ZA 5JPNC 2A69D 3K0YA 5CYUA 5C5LA 1I6HB 4H7BA 1Z7TA 1YNNC 2E74C 1EY9A 1HFGA 5FO7B 1U4LA 1PRTF 2CW0C 2N55A 4O1NA 1LACA 1QE6A 1I6VC 3QJYA 1XWEA 3NBIA 2B2WA 2IJ0A 2KQ3A 1EYCA 4ZUIA 1IKMA 3UI2A 4DN4M 1ET6A 1BF4A 1VCIA 5EKKA 1TKWB 1A3UA 3Q0AA 3SXHA 1G2TA 4L6TB 2L12A 2EJFC 1RF2D 4I7ZC 3S1NB 2NVYB 4PMCA 2SNSA 1F2YA 3TZUA 1H9KA 5FLXE 3M4YA 4FNFA 1TWFB 3NTHA 1PXUA 1W6JA 2KOLA 5FOBB 2NN6H 4DAPA 1CA6A 1WTVA 1CHQD 3ZYYX 4CJ0B 5JEAH 2VB3X 1I4GA 2F03A 1FNUA 4IURA 2J7ZA 3KBXA 3PO2B 3TZDA 1PTOF 3D4DA 4X3SA 1A3VA 1CHPD 4IUUA 3VYTA 4HSVA 4DXFA 1CI3M 1PZJD 1CQVA 4TSSA 2MJ8A 5E4WC 3Q6SA 1ZXTA 1AW7A 3ITPA 4MHEA 1QOHA 1BBXC 1PZKD 4C3JB 3IKJA 2HUGA 3GTJB 1OXXK 3I90A 2KUMA 2EOTA 3NPPA 1CT1D 1H9SB 5C4ZA 4A3MB 3I70A 2I07B 3CHBD 1MSHA 5F2DA 2O5IC 4XQQA 2BA0A 3MXNA 3HKZB 1IW7C 2D2CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DMU A;  3MHB A;  2PZW A;  3BDC A;  4ID6 A;  3RUZ A;  3P1H A;  2KQ3 A;  3VA5 A;  1EYC A;  1STA A;  3MVV A;  5CV4 A;  1A2U A;  2EYM A;  2EY6 A;  4ZUI A;  5IGD A;  3QOJ A;  3TP7 A;  3NK9 A;  3OWF A;  3SR1 A;  4K2K A;  5E3F A;  2RKS A;  1EY6 A;  4J6H A;  1STB A;  5C5M A;  5EKK A;  2OXP A;  3EJI A;  2HQE A;  5E1F A;  2F0S A;  1A3U A;  2PZU A;  3MZ5 A;  1SYD A;  2OEO A;  3D4W A;  2F0Q A;  1IHZ A;  3BDL A;  4N9T A;  3SXH A;  3SK8 A;  3TP8 A;  1F2Z A;  4KTA A;  5J39 A;  4IZ8 A;  4KV6 A;  3MXP A;  3E5S A;  5HGT A;  2WAC A;  2F0T A;  4PMC A;  3SHL A;  5HUR A;  3TP5 A;  5KYI A;  2SNS A;  1F2Y A;  4KD3 A;  4B9W A;  1EYD A;  2EYH A;  4RKL A;  4QF4 A;  5ISR A;  2F0L A;  3NP8 A;  2EYL A;  5I6W A;  1U9R A;  4ODG A;  4QB4 A;  2EY2 A;  5CR3 A;  4F7X A;  2PW7 A;  4KHV A;  4PNY A;  1EY7 A;  2F0W A;  5J1Z A;  2F0O A;  4K2L A;  4K14 A;  3R3O A;  1STN A;  1SNM A;  4EQN A;  1KDB A;  1EY0 A;  4EQO A;  4K8I A;  3TP6 A;  4NMZ A;  3D8G A;  4KY6 A;  3D6C A;  5CV6 A;  3C1F A;  5EGT A;  2F0I A;  3V2T A;  2F3V A;  1RKN A;  1A2T A;  2F0J A;  2NUC A;  2F3W A;  1SNO A;  3NXW A;  4IUN A;  4OL7 A;  4QMG A;  3LX0 A;  5CV9 A;  4N9P A;  4EQP A;  2F0D A;  2M00 A;  4KJO A;  4MIU A;  4WRD A;  5IOD A;  4HMJ A;  1KAA A;  4KJN A;  2PQE A;  3NHH A;  2EY5 A;  3OMC A;  4E6I A;  2RDF A;  5JOB A;  1JOO A;  2PZT A;  3SK5 A;  5I6Y A;  4K6D A;  3OMG A;  3TME A;  2F0H A;  3D4D A;  5IGG A;  1ENA A;  1SNQ A;  1EY8 A;  3T13 A;  3HEJ A;  4TRD A;  1SYB A;  3ERQ A;  1KAB A;  3OSO A;  4PMB A;  4RKB A;  5EKL A;  1TT2 A;  1EY5 A;  1A3V A;  1TR5 A;  4KD4 A;  4DFA A;  5CC4 A;  1SYC A;  5CGK A;  4KY7 A;  1JOR A;  5IGB A;  2F0U A;  5M9O A;  5IGE A;  5IGC A;  1NSN S;  5C3W A;  5KGU A;  1STY A;  5C3X A;  3MEH A;  1SYE A;  2EXZ A;  5DEH A;  2RBM A;  3NUC A;  1JOQ A;  2EYJ A;  4DGZ A;  2F0M A;  3ITP A;  5CV7 A;  4DU9 A;  5C4H A;  3PMF A;  4I65 A;  1SNP A;  4K8J A;  4K5W A;  5K5P A;  1TQO A;  4K5V A;  3T16 A;  1EY4 A;  4NDX A;  4HTH A;  2O4X A;  2EYO A;  5IOC A;  1EZ8 A;  5J22 A;  2F0F A;  1ENC A;  1SYG A;  1SYF A;  2ENB A;  5C6A A;  5KIX A;  2EY1 A;  4LAA A;  2F0G A;  4NKL A;  4HMI A;  2PW5 A;  1JOK A;  5I9O A;  4S3S A;  4NP5 A;  2EYP A;  2EYF A;  5NUC A;  3DHQ A;  5CV8 A;  4B9X A;  5IGF A;  4G57 A;  4J1M A;  2F0K A;  4ME5 A;  1II3 A;  5IIF A;  3S9W A;  1NUC A;  1EZ6 A;  1STG A;  1KDC A;  2PYK A;  4IAL A;  4ZUJ A;  2KHS A;  1STH A;  3P75 A;  1SNC A;  2OF1 A;  4H7B A;  4K5X A;  5C5L A;  4EVO A;  2F0V A;  3C1E A;  3SK6 A;  5C4Z A;  1A3T A;  3H6M A;  5JAV A;  3QB3 A;  3NQT A;  1EYA A;  1F2M A;  2SOB A;  4DF7 A;  1AEX A;  1EY9 A;  2F0E A;  1KDA A;  2F0N A;  4KY5 A;  2LKV A;  3ERO A;  4WOR A;  4F8M A;  1EQV A;  5CV5 A;  2F0P A;  3EVQ A;  5F2D A;  5KRU A;  4R8N A;  3QOL A;  1SND A;  2SNM A;  3U9O A;  2QDB A;  5KYL A;  3HZX A;  4YIJ A;  4ZQ3 A;  5DAU A;  3SK4 A;  5I9P A;  5KEE A; 
#chains in the Genus database with same CATH topology
 3GTM H;  4Z9C B;  2EYM A;  5DM6 3;  1D5M C;  2WAQ G;  2R7Z B;  4A3D B;  1F9Q A;  1TWC B;  4R4T A;  4J6H A;  1SAP A;  1LT3 D;  2YTV A;  2X69 A;  1XX8 A;  2GVB A;  2OEO A;  3E3X A;  4BBR B;  3SK8 A;  1Y1W B;  1O7L A;  1V43 A;  2A68 C;  4DPG A;  3CQZ B;  2VUM B;  1PH6 A;  1B2T A;  4DR6 L;  3K5N A;  2R92 B;  2K5W A;  1PH3 A;  3HOV H;  1VQA A;  1HJP A;  1K28 A;  4RKL A;  4JI6 Q;  3BG3 A;  3T1H Q;  2ICE C;  4PNY A;  3S2H H;  3U58 A;  1SNM A;  2KJX A;  1ASY A;  3TP6 A;  1OXT A;  5M5W B;  1WTO A;  2LMC B;  2XN9 C;  3HRZ C;  4I7A A;  5M5Y B;  3IFT A;  5EGT A;  4X65 Q;  2L1B A;  1CZG A;  3D6W A;  2M00 A;  3JAM E;  4DV0 L;  2L4N A;  4JG2 A;  3I4M B;  4DR7 Q;  4JW0 A;  2BE5 C;  5IYB H;  1PFN A;  5BN4 A;  5E4X A;  3UDG A;  2A5H A;  4A3G H;  3HEJ A;  3CPW A;  3HKS A;  3RN5 A;  1Q81 C;  1IL8 A;  2IWH A;  2UU9 L;  3CAM A;  3NEL A;  3T56 B;  2L11 A;  1VF7 A;  5C3W A;  2K5N A;  4RGM A;  1F9R A;  1X6O A;  3E0E A;  2NVY H;  1DOM A;  2N78 A;  3X3N A;  3H94 A;  3GTG B;  2NYZ D;  4GLA C;  1ENF A;  4X62 L;  1HNZ Q;  3HOZ H;  1BCP D;  3W5O A;  1S5F D;  2B2T C;  2AWO A;  4K0K L;  5KIX A;  2ZXO A;  1C8C A;  4R1J A;  4DR1 L;  1R4Q B;  3RLF A;  4G57 A;  1EZ6 A;  1YVC A;  5D3I B;  3M3Y B;  1RDP D;  3M4P A;  4UP7 A;  1E7Z A;  2OF1 A;  4BWG B;  4EVO A;  1QVF A;  4DV2 Q;  1WOC A;  4PQX A;  1QVG A;  3GTQ B;  1K0R A;  3FPU B;  2Q8I B;  4Y7N B;  4IOA A;  4GN3 B;  4PZ6 A;  2Z4H A;  4FXD A;  5IT9 E;  4DR5 L;  1NMG A;  3PIP A;  4K6L A;  1I4R A;  3HG9 A;  1MD2 D;  3S1R H;  5CV4 A;  3A5Z B;  4LF8 Q;  4GOP B;  2J4X A;  4GN4 B;  4A3L H;  3I4N B;  3RMH A;  4K2K A;  1Q3L A;  3N52 A;  4P72 A;  5C5M A;  4V19 0;  3R2I A;  5HY6 A;  1IHZ A;  1E2Z A;  1I50 B;  2B2U A;  2A73 B;  4V0B A;  3MXP A;  2BOS A;  5HGT A;  1NR4 A;  4X66 L;  1HCZ A;  1YNN D;  1KL9 A;  2GVA A;  1QUQ A;  1QIL A;  5COR A;  2F4I A;  3WOF A;  3HKZ E;  2CHB D;  2CW0 D;  1C7Y A;  3MEF A;  4YHH L;  2B63 H;  4JK1 C;  1EY0 A;  3QO2 A;  3SDZ A;  1FYC A;  4NMZ A;  1LT4 D;  1SMY C;  3D6C A;  1DYQ A;  1K3B C;  1O80 A;  1WTQ A;  1C0A A;  3S14 B;  2K75 A;  1LO5 D;  5GAH C;  2Z6K A;  4RAU C;  4N8F A;  1B9M A;  1PFS A;  1VQO A;  5JOB A;  2NB0 A;  1N34 Q;  2YU9 B;  2R7Z H;  4XYO A;  5DLQ E;  3OTO L;  3KF6 A;  4A3D H;  3CCR A;  4FXG C;  2E2J B;  3S15 B;  1YNJ C;  4A3E G;  3IL8 A;  1KAB A;  2HCC A;  1K8M A;  4APV A;  5IWA Q;  4LF6 Q;  4B3R Q;  4DV5 L;  3DEP A;  2JA6 H;  5ELD A;  2PQA B;  2VUM H;  3CPF A;  1N8R C;  4FF4 A;  1UEA B;  2WAQ B;  4JV5 Q;  2DNC A;  1FD7 D;  1HZ9 A;  1I4Q A;  2AHO B;  2NN6 G;  2VQE L;  1VQP A;  1PVO A;  3M9B A;  3OIP A;  5JEA G;  2IX3 A;  1SRO A;  1X3E A;  4UPA A;  5A2Q L;  5C44 G;  1SR3 A;  2ALY B;  2VQF L;  2A69 C;  4NKL A;  3MFY A;  3A7A B;  2JA5 H;  4J1M A;  2ZJP A;  3J81 i;  2OTJ A;  1PH8 A;  1UEB A;  5J39 A;  3G4S A;  4B3S Q;  2UUC L;  3R2T A;  1HZC A;  4A3F B;  1J6Q A;  1NE3 A;  4IUV A;  2AQ2 B;  4F8M A;  4WOR A;  4PMW A;  5FKA C;  3C2P A;  5CV5 A;  2R7D A;  4DUZ L;  1A0I A;  1SND A;  4JBJ A;  5KYL A;  1L1O A;  5DAU A;  3P1H A;  1D6E C;  2IT1 A;  5AJ3 Q;  2OCE A;  1Y14 B;  1PYW D;  1I4P A;  4LUO A;  1LAB A;  2F0S A;  4UHV A;  3A56 A;  3E9I A;  2F0Q A;  2ZT9 C;  5FO9 B;  4KMU C;  5CMD A;  3MXG A;  1X3G A;  3A54 A;  2CH4 A;  2C5C A;  4B9W A;  4GNX B;  4IQZ A;  3BDO A;  2EJG C;  2BH2 A;  5KNC A;  3J80 c;  1PRT B;  3E0J A;  4K14 A;  2NVX B;  3D31 A;  3D8G A;  2DGY A;  2FIN B;  3PUY A;  1KIX A;  1ICW A;  2NUC A;  2ZM6 Q;  1YEZ A;  3LX0 A;  2X6G A;  4Y52 H;  1UWV A;  4M8A A;  2EY5 A;  3OMC A;  3PUW A;  4ZKC B;  2Z8L A;  4IN3 A;  1ENA A;  2A68 D;  2K1B A;  1BQQ T;  4RKB A;  4KK7 A;  3HOV G;  4DFA A;  5CGK A;  2I46 A;  1SE2 A;  3MC0 B;  2H4O A;  4BA1 I;  1GHJ A;  1E3P A;  5C0X I;  2CKZ B;  5C4J B;  2IW3 A;  4FF2 A;  5LL6 X;  4B3T Q;  3V96 A;  2CFM A;  4K5V A;  5FO8 B;  4HTH A;  3ND9 A;  1Q7Y C;  2F0F A;  1ESR A;  5LHY 1;  1LM0 A;  3KLS X;  3H15 A;  2PW5 A;  5IYB G;  5M3M B;  1AN8 A;  1XJV A;  1EFI D;  1UE6 A;  1BKB A;  5CV8 A;  1KRT A;  4ME5 A;  1XNR Q;  3FEW X;  2BE5 D;  3A8K E;  4XTC S;  4A3G G;  2PYK A;  1PFB A;  4IAL A;  1TS5 A;  1PH9 A;  1T9H A;  3Q22 A;  4UAI A;  1HQM C;  5ELF A;  3ULJ A;  4GOP C;  3PUV A;  3QB3 A;  3EQL C;  2JA7 H;  1M90 C;  2CWA A;  1IYJ B;  1RHP A;  4IFD H;  5JVG 3;  4DF7 A;  2WAQ E;  3KJP A;  3I72 A;  3Q8D A;  2D9U A;  4CHT B;  1VQE A;  3GV3 A;  2SNM A;  3HOZ G;  3HZX A;  1MBY A;  4YIJ A;  5G3L F;  2MP1 A;  5GAE C;  1OXU A;  1N9W A;  4FF1 A;  1U0L A;  1Q90 A;  3CD6 A;  1Y1V H;  4OGQ C;  3L2P A;  2A74 C;  1GXD C;  2XRS D;  2CH4 W;  2PNR C;  4MN3 A;  4JI8 Q;  5E7N A;  1CQF A;  5DNF A;  4IZ8 A;  2JP1 A;  3WWV A;  1VS0 A;  5BN3 A;  2F0T A;  4A3J B;  1N32 L;  1Q46 A;  1RL2 A;  2E76 C;  2DUD A;  3DWP A;  1PMR A;  4QB4 A;  5C44 B;  4A3F H;  5L37 A;  3MA2 B;  4K2L A;  3HP3 A;  4ABN A;  1N36 Q;  2HDL A;  3A0J A;  1KHI A;  1I4X A;  4YCU A;  1B3Q A;  5DM7 3;  4LWC A;  3UE1 A;  3M4O H;  1B4O A;  4A3L G;  3STB C;  4P75 A;  1UUP A;  1M1K C;  3F1Z A;  3A55 A;  4KI0 A;  4P71 A;  4A3I H;  1EIG A;  2MGS A;  1EWI A;  2DNE A;  4DR2 Q;  1JJG A;  1HNW Q;  3J7A F;  1VQH A;  3OIQ A;  4H44 C;  4JI2 L;  1H9R A;  5JJZ A;  1VQM A;  2ATW A;  3CF5 A;  4LFA L;  2ASB A;  1JQY D;  4HJ5 A;  3CXC A;  4A3M G;  4ZK9 B;  1PH4 A;  5IGC A;  1RTO A;  1E22 A;  4JI1 L;  1STY A;  1GUS A;  5JEA J;  1I4H A;  2B63 G;  4UP8 A;  2WIN B;  3IRB A;  1O7Y A;  4LMQ D;  2KA7 A;  4HN7 A;  1SMY D;  1XMQ Q;  3S1M H;  3S2D H;  2AQ1 B;  4FVM A;  3HOY H;  1GUO A;  1TVX A;  4L63 B;  3TN2 A;  3FRP B;  2A1A A;  1IYU A;  4OWW B;  3QR8 A;  3MTS A;  2R7Z G;  4H0L C;  1GM5 A;  4A3D G;  1S5E D;  4DV3 Q;  1FVI A;  3S16 H;  4QQB X;  2KHS A;  3T53 B;  3ND8 A;  3MFG A;  5BR8 L;  4XT1 B;  2WP8 J;  3C1E A;  1GUN A;  3TQY A;  2XWB B;  1YNJ D;  4KKU A;  2JA6 G;  2V4D A;  3GTM B;  2VUM G;  1BCP F;  2F0E A;  2BCO A;  2G9H D;  4BY7 B;  1K73 C;  4OEM B;  4L5R C;  3QOL A;  2F4V L;  1VQB A;  4Q5V A;  4MTK A;  3J80 E;  5KEE A;  2NTT A;  1I5F A;  3HOX H;  4P2C B;  2L5T A;  2R7F A;  2UUA Q;  3QOJ A;  1HA5 A;  3HOV B;  2JA5 G;  4BY1 H;  1VMP A;  3H3V I;  5I2Y A;  1E2V A;  1LYL A;  2UXB L;  3K5M A;  3I4M G;  2AUJ D;  3S2H B;  4GN5 A;  1ML0 D;  2PI2 E;  4KTA A;  4EQ5 A;  4JC0 A;  4QUF A;  3WOE A;  5ELE A;  2JQO A;  3SHL A;  1QUQ B;  5HUR A;  4KD3 A;  1EYD A;  2E75 C;  1PTO H;  1HNX L;  1ET9 A;  4OON A;  2KHI A;  1K8O A;  1WD1 A;  4LF4 Q;  4A3G B;  1BUV T;  1VQ7 A;  1A2T A;  1XMO L;  4IUN A;  1D5Z C;  4C2M H;  3PF4 A;  2PQE A;  3NHH A;  2E5L L;  1AFP A;  4AYB G;  2PZT A;  2YTY A;  1G51 A;  3KF6 B;  5EPL A;  3QG1 A;  1LUZ A;  5EKL A;  4A75 A;  3HOZ B;  5M3F H;  5EPJ A;  4GKJ L;  1EQT A;  5IGE A;  3BS1 A;  4YCV A;  2B2Y C;  5ELB A;  1Y8N B;  3NUC A;  1Y69 U;  4JI0 L;  1I94 L;  2WV6 D;  1MJE A;  4CKC A;  1LLR D;  1EZ8 A;  3TSS A;  2KEE A;  2O5J C;  2Q2T A;  1SSO A;  4PZ8 A;  1NY4 A;  1A6X A;  1TY0 A;  1GUT A;  1S4Z A;  5IGF A;  2N3S A;  4X3T A;  3I4N G;  2I5H A;  1OXS C;  1BXT A;  1UE7 A;  4TKO B;  1TXY A;  3KYH C;  1FNW A;  4HJ8 A;  3S1R B;  2A8V A;  3NQT A;  4L5S A;  3OOC A;  3VYU A;  1KRS A;  1VQ6 A;  4JI5 Q;  2LXK A;  4WJ4 A;  3AB9 A;  4G7O C;  3U9O A;  1OO9 B;  2JJQ A;  1L1O B;  5IE8 A;  3O13 A;  2WKC A;  3DMU A;  3VA5 A;  1IBL Q;  1A2U A;  3BVM A;  3M7G A;  3R8B A;  2Q2U A;  4DAY B;  1WTH A;  1TY2 A;  3SR1 A;  1WFQ A;  2BH8 A;  5FK9 C;  1FJG L;  2JK8 A;  1JMC A;  4UY8 C;  3D0F A;  1X9N A;  2B63 B;  2RDH A;  5K36 H;  4M1U B;  2UXD Q;  1AZP A;  5COY A;  2JA7 G;  4IFD G;  4LF9 L;  1ILP A;  4ZRZ A;  3S17 B;  5CR3 A;  3P7J A;  2PW7 A;  1T5E A;  1EY7 A;  5A2Q E;  3R3O A;  2QDL A;  1DON A;  3GTP H;  4DK6 C;  4BY7 H;  1YJN A;  1BR9 A;  5GAG C;  1RKN A;  3GTL H;  3NXW A;  4OL7 A;  2SDF A;  1N33 L;  1Y1V G;  2P5Z X;  2Y0S G;  1CM9 A;  3DEO A;  1VDZ A;  2QCP X;  2JA6 B;  3PCO B;  1D1K A;  4P74 A;  1KLG D;  2K7V A;  3TME A;  2VL6 A;  1QZG A;  3GTO H;  2K5D A;  2ZJQ A;  5CC4 A;  2GA4 B;  2A6H D;  1WTW A;  4XT3 B;  2JA8 H;  5M9O A;  1VQ4 A;  1NSN S;  4A3F G;  2Z9H A;  3CCV A;  1VQG A;  4NPS A;  4A4I A;  2RBM A;  2BDO A;  3UDX A;  1Q8I A;  4FO2 A;  1HR0 Q;  2JA5 B;  2F0M A;  2CQA A;  1MHW C;  1RTN A;  3PMF A;  5GRO A;  3PV0 A;  3W3A A;  3PGZ A;  4C56 C;  5D3D A;  1NMF A;  4BA2 I;  4UP9 A;  1YJ9 A;  2RHS B;  4RHS A;  5HGQ A;  3GV6 A;  3URY A;  1AH9 A;  1F9S A;  3STB D;  5EBC A;  1CK1 A;  2HD3 A;  4LJZ C;  4JI3 Q;  5LMN L;  2F0K A;  2NBF A;  4DR3 L;  4GLV B;  3F8T A;  3P75 A;  3BJU A;  3H3V C;  1X65 A;  2F1M A;  1CZW A;  2EJM A;  3GO5 A;  4H13 C;  2QEJ C;  1GJX A;  5IYC H;  1K8A C;  1HNW L;  2JSO A;  1WI5 A;  3LNN A;  3H91 A;  1P16 A;  1EQV A;  2F0P A;  1BVS A;  5EJW A;  5LMN W;  1B50 A;  1XPO A;  4KKS A;  2RVL A;  4AYB B;  1D2B A;  3SK4 A;  1EU4 A;  4QY7 A;  5EPK A;  4CJ1 B;  1QCB D;  3HOY G;  4DV1 L;  4JOI C;  1KNE A;  3CC4 A;  3DXJ C;  3QIA A;  1SRU A;  3Q23 A;  1XMQ L;  4DNI A;  3D4W A;  4RHR A;  3J81 L;  4NXM Q;  3TS2 A;  4YWK A;  3A5U A;  2K5H A;  2QIL A;  2L0C A;  4XIG S;  4OWX B;  3K6O A;  2KCN A;  2R61 A;  1TII D;  1SE8 A;  4F7X A;  2Z1C A;  4OHJ A;  1PYS B;  1GO3 E;  3A8J E;  2QW7 A;  4K8I A;  3HOX G;  2WFW A;  4RFB A;  3V2T A;  4EX5 A;  3M7N A;  1U4M A;  4ME3 A;  4X64 L;  1TWH H;  4BY1 G;  3RD4 A;  4WRD A;  1VQ9 A;  4HMJ A;  3UDI A;  4KJN A;  1RCV D;  1KLU D;  3F2U A;  3ONA B;  2VNU D;  1YHQ A;  3KOJ A;  4LW1 A;  1PRT D;  1SFO H;  5M3M G;  3KLW A;  2LSS A;  4JI7 L;  4TRD A;  4ZKB B;  3C46 A;  3ERQ A;  1TR5 A;  5GQO A;  1M4V A;  1SYC A;  2FXQ A;  5IGB A;  1XNQ Q;  3U9S A;  1PA6 A;  1G2S A;  3K0X A;  1J5E L;  4NXN Q;  3J7A 5;  2MHV A;  5IP9 H;  3S17 H;  1VQC A;  3T16 A;  4DV6 Q;  4A3K H;  5J22 A;  2DY7 A;  2L15 A;  1SYF A;  5C6A A;  2F0G A;  1CUK A;  2JA7 B;  2PMZ B;  4G4K A;  4RGN A;  5NUC A;  4DV7 Q;  2IL8 A;  3J80 i;  1S5C D;  1FR3 A;  1II3 A;  3S24 A;  3VYR A;  2A6E D;  2DN8 A;  3FDT A;  4L5T A;  4ZUJ A;  1YI2 A;  5M5X H;  1XYI A;  3NBH B;  3SK6 A;  1V9P A;  1TWG H;  5M3F G;  3SEB A;  5AFW A;  1EYA A;  3BYY B;  1G91 A;  4DNT B;  1C4Q A;  2F0N A;  2NZ1 D;  2JXM B;  4A3J G;  3I56 A;  2B2V C;  1UAP A;  2G5D A;  1EIY B;  4EGV A;  1Y1V B;  2KEC A;  1EU3 A;  1JIC A;  2Y0S B;  4XQN A;  2C35 B;  1JWU D;  4LFB Q;  3MHB A;  3D3R A;  1O7I A;  4B3M L;  2EY6 A;  4X6A H;  3OHX C;  4KN4 C;  3FP9 A;  2FJ2 A;  3FMC A;  2M2L A;  4DV4 Q;  5E1F A;  2CQO A;  4C3H H;  1NBW A;  1OTC A;  4IFD J;  3BDL A;  2I5L X;  4N9T A;  3S1Q H;  3EA6 A;  4YCW A;  3KBG A;  4KV6 A;  3PQI A;  1JT8 A;  4CDF C;  2AWN A;  2LS0 1;  4IPH A;  1JJ2 A;  4A93 H;  3M4O B;  4DUY Q;  1IBM Q;  2F52 A;  1E0B A;  4A3I B;  1YIJ A;  5IYD H;  4AYB E;  3DM3 A;  4OIJ A;  5GAD C;  2LXJ A;  1A8V A;  3KDF A;  2LFN A;  2EXD A;  4KY6 A;  3BZD B;  2WB1 B;  4XYQ A;  1H95 A;  1B3A A;  1QVC A;  1K0S A;  4N9P A;  4POF A;  4LF5 Q;  4IUP A;  1HRJ A;  2SEB D;  1X3P A;  1U5K A;  1XPR A;  3I4L A;  5K36 G;  2WII B;  1DCZ A;  4GKK Q;  2XNA C;  3MXU A;  3CKI B;  4KY7 A;  4R4O A;  3S1M B;  3S2D B;  3HOY B;  3GDE A;  4JBW A;  5C3X A;  2J0T D;  1JOQ A;  3ER0 A;  4DGZ A;  2Z4I A;  4BY7 G;  3H09 A;  2B8G A;  4FF3 A;  4K8J A;  3S16 B;  1KQS A;  1B44 D;  3NWT A;  1EOT A;  2JEB I;  2EYO A;  3IAY A;  1PDQ A;  1ENC A;  4MTN A;  2EY1 A;  5LMU Q;  3Q24 A;  3A74 A;  3AEV A;  4JBM A;  2EYP A;  1HQR D;  1F77 A;  3DHQ A;  4B9X A;  4L5Q A;  3S9W A;  1U4P A;  1DJR D;  3D4R A;  4DR4 Q;  1V8Q A;  5KNB A;  3H6M A;  4J8Q A;  2M9V A;  2JA8 G;  4CKB A;  4CBV A;  5ELO A;  3HOX B;  2ID0 A;  4JI6 L;  2MNA A;  1EIH A;  3T1H L;  4R8N A;  4BY1 B;  2K14 A;  3GD7 A;  1YHA A;  3K5L A;  5C3E H;  3EBE A;  2Z6B A;  1BBU A;  3J81 c;  4X65 L;  2PMZ E;  2KBN A;  4AIM A;  5IT9 L;  2DY8 A;  2KED A;  1SE3 A;  1STB A;  4RGT A;  1PTO B;  1ZEQ X;  4DR7 L;  3MZ5 A;  1SYD A;  3W2D A;  1LTI D;  1LV9 A;  1Y8O B;  1NNX A;  3K7A H;  1SE4 A;  2K03 A;  5IYC G;  1VQF A;  4CGY B;  3MXN B;  2Y0S E;  4ODG A;  2B39 A;  4C2M B;  2X6L A;  5J1Z A;  4JCV E;  4OXP A;  3MAQ A;  1STN A;  1DD2 A;  3RZO B;  2Q8R E;  1RJT A;  4IO9 A;  2ZJR A;  1KD1 C;  1HUN A;  4YY3 Q;  1HNZ L;  3C1F A;  3EIV A;  4LF7 Q;  1DOK A;  2RHQ B;  1AE2 A;  1SNO A;  2D0P A;  3W1G A;  2PPB C;  3I73 A;  3BVZ A;  2F0D A;  5M3F B;  2JN4 A;  1STE A;  2RDF A;  4JYA Q;  2YV5 A;  2A6H C;  3JAM i;  1E2W A;  4YWM A;  3FPP A;  4DR6 Q;  1Z6H A;  5CBA E;  2NN6 I;  1ROD A;  4EQO A;  4DV2 L;  1L0Y B;  1W6K A;  4RGO S;  3F2D A;  1JOR A;  2VXW A;  1VQI A;  1Q8K A;  2Q2H A;  3NTK A;  1S5D D;  5BN5 A;  1ASZ A;  2RSN A;  1SYE A;  3G7L A;  2A19 A;  1PHJ A;  4QIW B;  5C4H A;  1G6Z A;  1AZQ A;  1CSQ A;  4LAA A;  4LF8 L;  1MJC A;  3TDQ A;  4HMI A;  4DV0 Q;  1JOK A;  1I3Q H;  3E9H A;  4C3I H;  1LTL A;  4B08 A;  3K58 A;  1STH A;  5EKI A;  4FXK C;  2QKI C;  1A3T A;  1LTG D;  1LT6 D;  1T5X D;  2UU9 Q;  5D14 A;  2ZTC A;  1Z9F A;  1Q1E A;  2SOB A;  1K9M C;  4R4Q A;  4KY5 A;  4AQY Q;  3NTI A;  1UE1 A;  1JJC B;  5IP9 G;  5KRU A;  4FYD A;  1UNS A;  2EE1 A;  4DK1 A;  4DXG A;  1O7Z A;  4A3K G;  2PNH A;  5I9P A;  1IYV A;  2K52 A;  4HCS A;  5I2X A;  3MVV A;  3BZC A;  5IGD A;  2JEA I;  3TP7 A;  2I0Q A;  2QF7 A;  4DR1 Q;  2E2I H;  2B2W C;  3L0O A;  4DV6 L;  4HIO A;  3KK7 A;  1RD9 D;  2KCT A;  1TS3 A;  4QL5 A;  3RLN A;  1N34 L;  5IP7 H;  1VQ5 A;  4GS3 A;  3CME A;  4A3B H;  4DV7 L;  4OX9 Q;  3GTP B;  3E5S A;  4RMF A;  2K6A A;  4B3R L;  5IWA L;  4LF6 L;  3L3O C;  1Q82 C;  4KN7 C;  1WD0 A;  3GTL B;  2UXC Q;  4NW2 A;  2F0L A;  2EY2 A;  1GUG A;  3RZD H;  4JV5 L;  2F0O A;  4KLK A;  3CCE A;  4U67 3;  4GNX C;  3VR3 A;  4HJ9 A;  2L55 A;  2K5V A;  4FP5 D;  2XWJ B;  1PRT C;  1Q86 C;  2F0J A;  3GTO B;  1YBY A;  4CKE A;  2K4K A;  1F9P A;  2BDN A;  1O78 A;  1PFM A;  2XSC A;  4KJO A;  3VR4 A;  5IOD A;  5C0X H;  2JA8 B;  4E6I A;  2CVR A;  4C3H G;  3T13 A;  2EIF A;  1SYB A;  4B3S L;  1IBK Q;  4DV4 L;  3GTK H;  4A93 G;  3I8Z A;  2PO4 A;  3VDY A;  5IYD G;  2NTS A;  3QWN A;  4OO1 H;  4YHH Q;  1PLF A;  2IHF A;  1U4R A;  1M8A A;  3TRZ A;  3NE5 B;  4J15 A;  1TQO A;  5ELN A;  1ZYR C;  3NEM A;  1J8I A;  1EY4 A;  4HIM A;  5C4X H;  1JCK B;  2R93 B;  1B9N A;  3KF8 A;  1XTC D;  2A6E C;  3K8A A;  3RZO H;  1Q12 A;  5AJ3 L;  3J81 E;  1D5X C;  4N8X 1;  1LTR D;  2NVT H;  3A8I E;  1HHV A;  4IJL A;  4GZY C;  4ZYS A;  3OTO Q;  1L0W A;  1W2B A;  2RA4 A;  4PZ7 A;  3PIP 3;  4RWS C;  5EQ0 A;  4NB3 A;  1WCM H;  2E2H H;  4PV1 C;  4DV5 Q;  1MGS A;  3DUZ A;  4Q0F A;  1PYB A;  1DOL A;  2IY5 B;  3UE0 A;  1PTO C;  1L0X B;  4A3E H;  2VQE Q;  1VQL A;  3CMA A;  3VA7 A;  4ZAI A;  3FKI H;  2RCF A;  3CC2 A;  3PUX A;  2HHH Q;  3CC7 A;  1EEI D;  1LTT D;  4C1N I;  2ZM6 L;  1IKL A;  3KLR A;  2QA4 A;  5E3F A;  1SXT A;  2RKS A;  1JC7 A;  1E1O A;  3K59 A;  4C1N K;  2OXP A;  2IX1 A;  4LK1 C;  2VY3 A;  3KLS A;  1C48 A;  1JB7 A;  2AKW B;  3NEN A;  1B7Y B;  1BNZ A;  4IOC A;  2UUC Q;  1LTB D;  3SGI A;  3HGB A;  4BS9 A;  1XTD A;  3WDN A;  1TWH B;  3CCU A;  1KNA A;  4HIK A;  1KDB A;  4RA8 A;  1SFO B;  2JYO A;  4B3T L;  3T1Y Q;  1W3S A;  3KDF B;  3HS0 C;  1VQN A;  1Y8P B;  3K80 C;  2RCN A;  3HOW H;  4MIU A;  1FGU A;  1FGB D;  1WTR A;  3CCM A;  4JI4 Q;  2EPB A;  4IUT A;  3V05 A;  1JOO A;  4P73 A;  3M85 A;  2YYZ A;  1XNR L;  1KTK A;  4HCE A;  4WJ3 M;  1SNQ A;  5G3L D;  2HIX A;  2B2Y A;  4A3K B;  1PH1 A;  4HR7 B;  1DXM A;  4WJW A;  3M4Q A;  1L2F A;  3OW2 A;  2KVM A;  2PI2 A;  1YNX A;  4YWL A;  5CV7 A;  5K5P A;  3X3M A;  1E24 A;  3OYY A;  5M5X B;  2HQL A;  3OPO A;  3E6Z X;  1X56 A;  1TWG B;  2PCF B;  1DGS A;  4X3K A;  2EZV A;  5I9O A;  2QEX A;  1S3O A;  2ZXR A;  2EYF A;  4YY3 L;  2H1E A;  4LF7 L;  1VQ8 A;  4RCO A;  3CCL A;  4JI8 L;  4K5X A;  1SNC A;  2D5D A;  3CU7 A;  1HH2 P;  2VZA A;  4JYA L;  2K01 A;  3H0G H;  2OTL A;  3H3V H;  1AEX A;  2Q2I A;  3VYS A;  1MI2 A;  3I55 A;  4CJ2 C;  1I6H H;  3DM1 A;  1R4P B;  4TQU S;  4A3I G;  4C3H B;  1N36 L;  3S1Q B;  1TS2 A;  4L8J A;  1EIF A;  2PZW A;  4ID6 A;  1YIT A;  2C9O A;  1STA A;  3BYT B;  1YHB A;  2G9D A;  2CCZ A;  2WB1 G;  4JBK A;  3U4V A;  2R93 H;  4A93 B;  1XPU A;  3I91 A;  1WVL A;  4C3I G;  3J80 L;  4DAM A;  4DR2 L;  1HPC A;  2Q8T A;  1A63 A;  1V1P A;  2WAC A;  5IY0 A;  3I4O A;  2B2U C;  3TP5 A;  2EYH A;  1ILQ A;  4IPD A;  4QF4 A;  3HOU B;  4R9W A;  4R8I A;  3N6R A;  3TRE A;  4G7Z C;  1CKN A;  2B29 A;  2IHE A;  1HTP A;  3S1N H;  1SDF A;  4AQY L;  3I7F A;  1MKH A;  2F3V A;  1TWF H;  3L7Z C;  2K5Q A;  5A35 A;  1VQD A;  3PO3 B;  1A15 A;  5I6Y A;  2XGT A;  2Z6K C;  5IP7 G;  1E1T A;  1KAW A;  4DV3 L;  1QB5 D;  4A3B G;  3CCJ A;  2DJF C;  3ERS X;  1EY8 A;  3GQB A;  4A76 A;  1N32 Q;  4BBS B;  1EY5 A;  1EQQ A;  2F0U A;  1V1Q A;  2JE6 I;  5H1S E;  2GN5 A;  3BU2 A;  3PO2 H;  1QJO A;  4OX9 L;  3G6J B;  1PZI D;  2MFI A;  3BVG A;  1DM0 B;  2CWP A;  1S5B D;  2ZTE A;  5FLX L;  1ESF A;  1SNP A;  2UXC L;  3DWA A;  4NDX A;  2ZXP A;  3A7L A;  4HSP A;  4H02 A;  2N88 A;  5C0X G;  1SJH D;  3SVM A;  3T51 B;  2UUA L;  1GD7 A;  2UUB Q;  1VQK A;  1HA6 A;  1IZ6 A;  2EQS A;  1KDC A;  5FLM H;  2R6G A;  4FDB A;  4JI2 Q;  5C3E B;  1EUJ A;  3DLL A;  4LFA Q;  4XDX A;  4C3J H;  2K04 A;  3GTJ H;  1HZA A;  2B2T A;  1F2M A;  1ONL A;  2D0O A;  4JI1 Q;  1EOV A;  4OO1 G;  3K57 A;  3EVQ A;  1IBK L;  1SJE D;  1G6P A;  1X55 A;  4RCN A;  2QDB A;  4A3M H;  2ZTD A;  4JOI A;  5C4X G;  3TEH B;  4LF4 L;  1ZYR D;  5D65 A;  2K05 A;  4LUZ A;  1G29 1;  3K7A B;  2N49 A;  5CBE E;  1L1O C;  3NK9 A;  3OWF A;  4POG A;  1NCV A;  5LL6 S;  4IFD I;  1DZ1 A;  2FMM A;  1QNU A;  1GOZ A;  1AE3 A;  1HTL D;  1WCM G;  4LNQ A;  5BR8 Q;  3AQQ A;  3OWE B;  4OWT B;  1HXY D;  1TWC H;  5KYI A;  1WJJ A;  5JPM C;  4MNO A;  1EWH A;  3NP8 A;  1QNK A;  2EYL A;  3MWY W;  1PTO D;  2OWO A;  2F4V Q;  4KHV A;  4BBR H;  1ZKO A;  2F0W A;  3J81 j;  1Y1W H;  3FKI G;  1NAP A;  2TSS A;  4HED A;  3CQZ H;  2NVQ B;  4KHZ A;  5T1I A;  4RH6 A;  2R92 H;  5CV6 A;  2F0I A;  2L9H A;  2F3W A;  4HJ7 A;  1SBB B;  1CKM A;  2K32 A;  2NWG A;  2UXB Q;  2HHH L;  2IX0 A;  2AUK A;  2OQ0 A;  5M5W H;  1PV4 A;  2F0H A;  5M5Y H;  3IFD A;  2B8F A;  1X32 A;  2VW9 A;  1BCP B;  3I4M H;  4DKA C;  4DNR B;  1QZH A;  1VF5 C;  5KGU A;  1HNX Q;  1I3Q B;  4HAE A;  1HUM A;  3NSW A;  4JI5 L;  3HOU H;  4DU9 A;  3ICE A;  2XIW A;  4C3I B;  2LY7 A;  2I5M X;  3KF8 B;  1LTS D;  2D62 A;  3HOW G;  1XMO Q;  1NJI C;  3RN2 A;  2ENB A;  1IBL L;  3TBI B;  2MPM A;  2HDM A;  2E5L Q;  3T1Y L;  4TVA B;  1R9T B;  2MUY A;  3GTG H;  4QCL A;  4DAY A;  3K7U C;  1NUC A;  1YJW A;  2K50 A;  3JAM L;  1YZ6 A;  1TU2 B;  5FJ8 H;  4DA2 A;  3CCQ A;  1H9S A;  2F0V A;  4JI4 L;  3PO3 H;  1HFN A;  2UXD L;  1FNV A;  1LTA D;  3T4A C;  4BXX H;  2B2V A;  4GKJ Q;  2KEN A;  1Q1B A;  1NR2 A;  4IPC A;  1KDA A;  2LKV A;  3ERO A;  3I2Z A;  4BBS H;  1CSP A;  1MSG A;  2E2I B;  3M3Y H;  2K33 A;  1VMC A;  5I4D A;  4JI0 Q;  1GVP A;  3AFQ A;  4ZQ3 A;  3GTQ H;  1I94 Q;  2OT2 A;  3BDC A;  1BO0 A;  3RUZ A;  2FFK B;  4Y7N H;  4A3B B;  4OEL B;  3G6E A;  2KHJ A;  1IW7 D;  1SLJ A;  1CA5 A;  3OW7 A;  2MO1 A;  5EAY A;  3EJI A;  2PZU A;  3KJO A;  4XXE A;  3RZD B;  3TP8 A;  3RR5 A;  4DAV A;  3ULP A;  4QUC A;  4QJF A;  3H0G G;  1B53 A;  3I4N H;  1KXL A;  1GUW A;  2YTX A;  4KHP Q;  2ES2 A;  3I3C A;  1LT5 D;  4O42 A;  1I50 H;  3CRL C;  2XVS A;  1HR0 L;  2E2D C;  4ZCK A;  4KKT A;  4LFC Q;  2RSO A;  1JE4 A;  1XXG A;  2FHT A;  3FVQ A;  1G8Z D;  3DWQ A;  5ELC A;  4QMG A;  2VS1 A;  1P8L A;  3GTK B;  2R93 G;  2K28 A;  1EYG A;  1FJG Q;  3GP7 A;  3U4Z A;  4JI3 L;  4XQJ A;  1B70 B;  3NWS A;  1H9J A;  1HR0 W;  3S14 H;  4PMB A;  2WKD A;  5FLX c;  1TT2 A;  4KD4 A;  1GHK A;  1CKO A;  4LF9 Q;  5C4X B;  4OO1 I;  4ZLT F;  1MIU A;  2YU9 H;  3PIO 3;  3MEH A;  2EXZ A;  5DEH A;  2NVT B;  2E2J H;  3HOW B;  2EYJ A;  3J7Y W;  3S15 H;  1BOS A;  4JVZ A;  1JWS D;  4ILW A;  5C0X J;  1PH7 A;  4A3C H;  2QGQ A;  5JJI A;  3F2C A;  1WYD A;  5IOC A;  1WCM B;  2E2H B;  3B6Y A;  1N33 Q;  4R4I A;  2NVQ H;  3L9A X;  4S3S A;  1V1O A;  4U68 A;  2DJG C;  5IIF A;  5JJL A;  4A3E B;  1SEB D;  4LUV A;  1STG A;  1BDO A;  4NXM L;  1H9M A;  3NQI A;  3LWE A;  3K5O A;  1TS4 A;  3FKI B;  3PSI A;  1VQJ A;  5JAV A;  2E8G A;  1QG7 A;  3PO2 G;  2EDG A;  1PH5 A;  2WB1 E;  3AYH B;  1CFM A;  1B8A A;  3AMU A;  2BA1 A;  4ALP A;  1X3Q A;  3VR2 A;  4GOP A;  3J7A V;  4F87 A;  3F2B A;  2AMC B;  2FMC A;  1EY6 A;  5LMN Q;  3EFX D;  4DR3 Q;  3AU7 A;  2HQE A;  1JR0 D;  5FLM G;  1Z47 A;  4HID A;  5JVH 3;  2RDG A;  3VR5 A;  2KCC A;  3PUZ A;  2AQ3 B;  1F2Z A;  2UUB L;  2NZH A;  1EL0 A;  1R9T H;  4C3J G;  1PH2 A;  1V1P B;  2EVB A;  2OQK A;  4ULL A;  2RF4 A;  5TSS A;  5T1G A;  5ISR A;  1F2L A;  4X62 Q;  1JB3 A;  2MQH A;  1U9R A;  1J9O A;  5I6W A;  1XNQ L;  1AP0 A;  1CTM A;  2MO0 A;  1CKN B;  4NXN L;  4K0K Q;  4EQN A;  2VB2 X;  4F88 A;  4WFN 3;  1GKH A;  1BCP C;  1JWM D;  1IXR A;  4OIK A;  2KCM A;  4DV1 Q;  2O2L D;  5CV9 A;  4EQP A;  1KAA A;  4DK0 A;  2ICI A;  3HKZ G;  1D1I A;  4HJA A;  1SMX A;  5JJK A;  3SK5 A;  2NVX H;  2TMP A;  4K6D A;  3SE0 A;  3TS0 A;  3OMG A;  2IPK D;  5IGG A;  4CDD C;  2RQX A;  1K83 B;  2N8N A;  3OSO A;  1TWA B;  3KUP A;  4DR5 Q;  1WTP A;  1QWY A;  3CRK C;  1WTX A;  5EBD A;  4X3U A;  3ZJY C;  2R3Z A;  5KND A;  3LWU A;  2PQA A;  1EWC A;  4O2D A;  3NBH A;  4AH6 A;  3P20 A;  4BBR G;  3C3L A;  1Y1W G;  1OXV A;  1S40 A;  1EFW A;  2HCI A;  4IJH A;  3VR6 A;  2XRQ D;  2R92 G;  4I65 A;  3R93 A;  4K5W A;  1KC8 C;  4IUQ A;  2O4X A;  4LFB L;  1BBW A;  4G7H C;  3JAM c;  4UDU C;  1SYG A;  3G48 A;  4X64 Q;  1EEF D;  3H0G B;  4NP5 A;  3U50 C;  1B1Z A;  4IPG A;  5C4J H;  4X66 Q;  1IL2 A;  2HIV A;  5JPN C;  2A69 D;  3K0Y A;  3RLO A;  5CYU A;  4JI7 Q;  2Z0S A;  5C5L A;  1I6H B;  4H7B A;  1Z7T A;  1YNN C;  3K81 C;  2E74 C;  2V1C C;  3AFP A;  4O0A A;  5J3B A;  5M3M H;  1EY9 A;  1HFG A;  4DUY L;  5FO7 B;  1IBM L;  1J5E Q;  1U4L A;  1PRT F;  2CW0 C;  2N55 A;  4O1N A;  1UE5 A;  2B3G A;  3HOU G;  1LAC A;  1QE6 A;  4QGU A;  1I6V C;  3QJY A;  1XWE A;  3NBI A;  2B2W A;  2IJ0 A;  2KQ3 A;  3W1B A;  1EYC A;  4ZUI A;  1IKM A;  3UI2 A;  4DN4 M;  1ET6 A;  1BF4 A;  3PF5 A;  4LF5 L;  1VCI A;  5EKK A;  1TKW B;  1A3U A;  3Q0A A;  5FJ8 G;  3CCS A;  3HFZ B;  3SXH A;  1G2T A;  3PO3 G;  4BXX G;  4L6T B;  4GKK L;  2L12 A;  2EJF C;  1RF2 D;  4I7Z C;  3S1N B;  2NVY B;  4PMC A;  4DK3 C;  4QIW E;  1D8L A;  2SNS A;  1F2Y A;  1H9K A;  3M4Y A;  1EQR A;  4FNF A;  1TWF B;  3NTH A;  3TZU A;  1PXU A;  1W6J A;  5FLX E;  5IT9 c;  4GNX A;  4BBS G;  2F3I A;  2KOL A;  5FOB B;  3ULL A;  2VQF Q;  2NN6 H;  4DAP A;  1A62 A;  1CA6 A;  1WTV A;  4A3J H;  4B3M Q;  2NZO A;  3CP0 A;  1NTG A;  1CHQ D;  3ZYY X;  4CJ0 B;  5JEA H;  2VB3 X;  1I4G A;  2F03 A;  4MZ9 A;  3G71 A;  5C44 H;  1FNU A;  4IUR A;  5LMU L;  1RIP A;  2J7Z A;  1JE5 A;  3KBX A;  4RG1 A;  4CDC C;  3PO2 B;  3TZD A;  4CDE C;  1PTO F;  1ICF B;  3D4D A;  3PIO A;  1C9O A;  4X3S A;  3J7Z C;  4DR4 L;  1A3V A;  4DUZ Q;  5C3E G;  3EN2 A;  1CHP D;  4IUU A;  3VYT A;  4HSV A;  4DXF A;  1CI3 M;  3CW2 C;  2H5X A;  1PZJ D;  1FL0 A;  1CQV A;  4TSS A;  2MJ8 A;  5E4W C;  3BZK A;  3UDF A;  3Q6S A;  1ZXT A;  1AW7 A;  3ITP A;  1S72 A;  3FHW A;  4KHP L;  4MHE A;  1K3R A;  1QOH A;  1BBX C;  1X3F A;  1PZK D;  4R4C A;  4C3J B;  3IKJ A;  2HUG A;  3GTJ B;  4PG3 A;  1OXX K;  4LFC L;  3I90 A;  2KUM A;  1K8G A;  2EOT A;  2XTI A;  3LGJ A;  3NPP A;  1SN8 A;  1CT1 D;  1H9S B;  5C4Z A;  4A3M B;  1D7Q A;  1X54 A;  3RNU A;  3I70 A;  2I07 B;  3CHB D;  3JC6 6;  1MSH A;  1K83 H;  1TWA H;  4GLX A;  5F2D A;  2O5I C;  4XQQ A;  2BA0 A;  3MXN A;  3KFU A;  3HKZ B;  4A3C G;  1IW7 C;  2HT1 A;  2D2C C;  4JPB W;  2JA9 A;  1HZB A; 
#chains in the Genus database with same CATH homology
 4Z9C B;  2EYM A;  5DM6 3;  1D5M C;  2R7Z B;  4A3D B;  1F9Q A;  1TWC B;  4J6H A;  1SAP A;  1LT3 D;  2X69 A;  1XX8 A;  2OEO A;  4BBR B;  3SK8 A;  1Y1W B;  1O7L A;  1V43 A;  2A68 C;  3CQZ B;  2VUM B;  1B2T A;  3K5N A;  2R92 B;  2K5W A;  4RKL A;  3BG3 A;  2ICE C;  4PNY A;  1SNM A;  2KJX A;  3TP6 A;  1OXT A;  5M5W B;  1WTO A;  2LMC B;  2XN9 C;  3HRZ C;  5M5Y B;  3IFT A;  5EGT A;  2L1B A;  1CZG A;  3D6W A;  2M00 A;  3JAM E;  2L4N A;  3I4M B;  2BE5 C;  1PFN A;  5BN4 A;  5E4X A;  2A5H A;  3HEJ A;  1IL8 A;  2IWH A;  3T56 B;  2L11 A;  1VF7 A;  5C3W A;  4RGM A;  1F9R A;  1DOM A;  3X3N A;  3H94 A;  3GTG B;  2NYZ D;  1ENF A;  1BCP D;  1S5F D;  2B2T C;  2AWO A;  5KIX A;  2ZXO A;  1C8C A;  1R4Q B;  3RLF A;  4G57 A;  1EZ6 A;  5D3I B;  3M3Y B;  1RDP D;  4BWG B;  2OF1 A;  4EVO A;  4PQX A;  3GTQ B;  3FPU B;  2Q8I B;  4Y7N B;  2Z4H A;  4FXD A;  5IT9 E;  4K6L A;  1I4R A;  3HG9 A;  1MD2 D;  5CV4 A;  2J4X A;  3I4N B;  3RMH A;  4K2K A;  1Q3L A;  3N52 A;  5C5M A;  4V19 0;  3R2I A;  1IHZ A;  1E2Z A;  1I50 B;  2B2U A;  2A73 B;  4V0B A;  3MXP A;  2BOS A;  5HGT A;  1NR4 A;  1HCZ A;  1YNN D;  1QIL A;  5COR A;  2F4I A;  3WOF A;  2CHB D;  2CW0 D;  4JK1 C;  1EY0 A;  3QO2 A;  3SDZ A;  1FYC A;  4NMZ A;  1LT4 D;  1SMY C;  3D6C A;  1DYQ A;  1O80 A;  1WTQ A;  3S14 B;  1LO5 D;  4RAU C;  1B9M A;  5JOB A;  2NB0 A;  2YU9 B;  4XYO A;  4FXG C;  2E2J B;  3S15 B;  1YNJ C;  3IL8 A;  1KAB A;  2HCC A;  1K8M A;  3DEP A;  5ELD A;  4FF4 A;  1UEA B;  2WAQ B;  2DNC A;  1FD7 D;  1I4Q A;  2NN6 G;  3OIP A;  5JEA G;  2IX3 A;  5A2Q L;  2A69 C;  4NKL A;  3MFY A;  3A7A B;  4J1M A;  5J39 A;  3R2T A;  4A3F B;  4IUV A;  2AQ2 B;  4F8M A;  4WOR A;  4PMW A;  5FKA C;  3C2P A;  5CV5 A;  1SND A;  5KYL A;  5DAU A;  3P1H A;  1D6E C;  2IT1 A;  1PYW D;  1I4P A;  1LAB A;  2F0S A;  3A56 A;  2F0Q A;  2ZT9 C;  5FO9 B;  4KMU C;  5CMD A;  3MXG A;  3A54 A;  2C5C A;  4B9W A;  4IQZ A;  3BDO A;  2EJG C;  5KNC A;  1PRT B;  3E0J A;  4K14 A;  2NVX B;  3D31 A;  3D8G A;  2FIN B;  3PUY A;  1ICW A;  2NUC A;  3LX0 A;  2X6G A;  4M8A A;  2EY5 A;  3OMC A;  3PUW A;  4ZKC B;  2Z8L A;  4IN3 A;  1ENA A;  2A68 D;  2K1B A;  1BQQ T;  4RKB A;  4KK7 A;  4DFA A;  5CGK A;  2I46 A;  1SE2 A;  3MC0 B;  2H4O A;  4BA1 I;  1GHJ A;  5C0X I;  5C4J B;  2IW3 A;  4FF2 A;  5LL6 X;  3V96 A;  4K5V A;  5FO8 B;  4HTH A;  3ND9 A;  2F0F A;  1ESR A;  5LHY 1;  3KLS X;  2PW5 A;  5M3M B;  1AN8 A;  1EFI D;  5CV8 A;  4ME5 A;  3FEW X;  2BE5 D;  3A8K E;  4XTC S;  2PYK A;  1PFB A;  4IAL A;  1TS5 A;  3Q22 A;  4UAI A;  1HQM C;  5ELF A;  3PUV A;  3QB3 A;  3EQL C;  1RHP A;  4IFD H;  5JVG 3;  4DF7 A;  3I72 A;  2D9U A;  4CHT B;  3GV3 A;  2SNM A;  3HZX A;  1MBY A;  4YIJ A;  5G3L F;  2MP1 A;  1OXU A;  4FF1 A;  1Q90 A;  4OGQ C;  2A74 C;  1GXD C;  2XRS D;  2PNR C;  4MN3 A;  1CQF A;  5DNF A;  4IZ8 A;  2JP1 A;  5BN3 A;  2F0T A;  4A3J B;  2E76 C;  3DWP A;  1PMR A;  4QB4 A;  5C44 B;  3MA2 B;  4K2L A;  3HP3 A;  4ABN A;  2HDL A;  1I4X A;  5DM7 3;  1B4O A;  1UUP A;  3A55 A;  4KI0 A;  1EIG A;  2MGS A;  2DNE A;  3J7A F;  3OIQ A;  4H44 C;  1H9R A;  5JJZ A;  1JQY D;  4ZK9 B;  5IGC A;  1RTO A;  1STY A;  1GUS A;  5JEA J;  1I4H A;  2WIN B;  1O7Y A;  4LMQ D;  2KA7 A;  4HN7 A;  1SMY D;  2AQ1 B;  4FVM A;  1GUO A;  1TVX A;  4L63 B;  3TN2 A;  3FRP B;  1IYU A;  3MTS A;  4H0L C;  1S5E D;  2KHS A;  3T53 B;  3ND8 A;  3MFG A;  4XT1 B;  2WP8 J;  3C1E A;  1GUN A;  2XWB B;  1YNJ D;  4KKU A;  2V4D A;  3GTM B;  1BCP F;  2F0E A;  2BCO A;  2G9H D;  4BY7 B;  3QOL A;  4Q5V A;  3J80 E;  5KEE A;  2NTT A;  4P2C B;  2L5T A;  3QOJ A;  1HA5 A;  3HOV B;  1VMP A;  5I2Y A;  1E2V A;  3K5M A;  2AUJ D;  3S2H B;  1ML0 D;  4KTA A;  4QUF A;  3WOE A;  5ELE A;  3SHL A;  5HUR A;  4KD3 A;  1EYD A;  2E75 C;  1PTO H;  1ET9 A;  1K8O A;  1WD1 A;  4A3G B;  1BUV T;  1A2T A;  4IUN A;  1D5Z C;  2PQE A;  3NHH A;  1AFP A;  2PZT A;  5EPL A;  3QG1 A;  5EKL A;  3HOZ B;  5EPJ A;  1EQT A;  5IGE A;  3BS1 A;  2B2Y C;  5ELB A;  1Y8N B;  3NUC A;  1Y69 U;  2WV6 D;  4CKC A;  1LLR D;  1EZ8 A;  3TSS A;  2KEE A;  2O5J C;  1SSO A;  1A6X A;  1TY0 A;  1GUT A;  1S4Z A;  5IGF A;  4X3T A;  1OXS C;  1BXT A;  4TKO B;  1FNW A;  3S1R B;  3NQT A;  3OOC A;  3VYU A;  4G7O C;  3AB9 A;  3U9O A;  1OO9 B;  3O13 A;  2WKC A;  3DMU A;  3VA5 A;  1A2U A;  3BVM A;  3M7G A;  3R8B A;  1TY2 A;  3SR1 A;  5FK9 C;  2B63 B;  2RDH A;  5K36 H;  4M1U B;  1AZP A;  5COY A;  4IFD G;  1ILP A;  4ZRZ A;  3S17 B;  5CR3 A;  3P7J A;  2PW7 A;  1T5E A;  1EY7 A;  5A2Q E;  3R3O A;  1DON A;  1BR9 A;  1RKN A;  3NXW A;  4OL7 A;  2SDF A;  1CM9 A;  3DEO A;  1VDZ A;  2QCP X;  2JA6 B;  1D1K A;  1KLG D;  2K7V A;  3TME A;  2K5D A;  5CC4 A;  2GA4 B;  2A6H D;  1WTW A;  4XT3 B;  5M9O A;  1NSN S;  2RBM A;  2BDO A;  1Q8I A;  4FO2 A;  2JA5 B;  2F0M A;  2CQA A;  3PMF A;  1RTN A;  3PV0 A;  3W3A A;  4C56 C;  5D3D A;  4BA2 I;  4RHS A;  3GV6 A;  3URY A;  1F9S A;  5EBC A;  1CK1 A;  4LJZ C;  2F0K A;  2NBF A;  3P75 A;  3H3V C;  2F1M A;  1CZW A;  2EJM A;  3GO5 A;  4H13 C;  2QEJ C;  1GJX A;  2JSO A;  3LNN A;  3H91 A;  1EQV A;  2F0P A;  5EJW A;  1B50 A;  4KKS A;  2RVL A;  4AYB B;  1D2B A;  3SK4 A;  1EU4 A;  5EPK A;  4CJ1 B;  1QCB D;  1KNE A;  3DXJ C;  3QIA A;  3Q23 A;  3D4W A;  4RHR A;  3J81 L;  2QIL A;  2L0C A;  4XIG S;  3K6O A;  2KCN A;  2R61 A;  1TII D;  4F7X A;  2Z1C A;  4OHJ A;  3A8J E;  4K8I A;  4RFB A;  3V2T A;  3M7N A;  1U4M A;  3RD4 A;  4WRD A;  4HMJ A;  4KJN A;  1RCV D;  1KLU D;  3F2U A;  3ONA B;  2VNU D;  1PRT D;  4ZKB B;  4TRD A;  3C46 A;  3ERQ A;  1TR5 A;  1M4V A;  1SYC A;  5IGB A;  3U9S A;  1G2S A;  2MHV A;  3T16 A;  5J22 A;  2DY7 A;  1SYF A;  5C6A A;  2F0G A;  2JA7 B;  2PMZ B;  4G4K A;  4RGN A;  5NUC A;  2IL8 A;  1S5C D;  1FR3 A;  1II3 A;  3VYR A;  2A6E D;  2DN8 A;  3FDT A;  4ZUJ A;  1XYI A;  3SK6 A;  3SEB A;  5AFW A;  1EYA A;  3BYY B;  1G91 A;  4DNT B;  1C4Q A;  2F0N A;  2NZ1 D;  2JXM B;  2B2V C;  1UAP A;  4EGV A;  1Y1V B;  2KEC A;  1EU3 A;  1JIC A;  2Y0S B;  4XQN A;  1JWU D;  3MHB A;  3D3R A;  2EY6 A;  3OHX C;  4KN4 C;  2FJ2 A;  3FMC A;  2M2L A;  5E1F A;  4IFD J;  3BDL A;  4N9T A;  3EA6 A;  3KBG A;  4KV6 A;  2AWN A;  2LS0 1;  3M4O B;  1E0B A;  4A3I B;  4OIJ A;  2LFN A;  4KY6 A;  3BZD B;  2WB1 B;  4XYQ A;  1B3A A;  4N9P A;  4IUP A;  1HRJ A;  2SEB D;  1X3P A;  3I4L A;  5K36 G;  2WII B;  1DCZ A;  2XNA C;  3MXU A;  3CKI B;  4KY7 A;  3S1M B;  3S2D B;  3HOY B;  4JBW A;  5C3X A;  2J0T D;  1JOQ A;  4DGZ A;  2Z4I A;  3H09 A;  2B8G A;  4FF3 A;  4K8J A;  3S16 B;  1B44 D;  3NWT A;  1EOT A;  2JEB I;  2EYO A;  3IAY A;  1PDQ A;  1ENC A;  2EY1 A;  3Q24 A;  2EYP A;  1HQR D;  1F77 A;  3DHQ A;  4B9X A;  3S9W A;  1U4P A;  1DJR D;  3D4R A;  1V8Q A;  5KNB A;  3H6M A;  4J8Q A;  2M9V A;  4CKB A;  4CBV A;  3HOX B;  2ID0 A;  1EIH A;  4R8N A;  4BY1 B;  3GD7 A;  3K5L A;  5IT9 L;  2DY8 A;  2KED A;  1SE3 A;  1STB A;  4RGT A;  1PTO B;  1ZEQ X;  3MZ5 A;  1SYD A;  3W2D A;  1LTI D;  1LV9 A;  1Y8O B;  1SE4 A;  2K03 A;  4CGY B;  4ODG A;  2B39 A;  4C2M B;  2X6L A;  5J1Z A;  1DD2 A;  3MAQ A;  1STN A;  3RZO B;  2Q8R E;  1RJT A;  1HUN A;  3C1F A;  1DOK A;  1SNO A;  2PPB C;  3I73 A;  3BVZ A;  2F0D A;  5M3F B;  1STE A;  2RDF A;  2A6H C;  1E2W A;  3FPP A;  1Z6H A;  5CBA E;  2NN6 I;  1ROD A;  4EQO A;  1L0Y B;  1W6K A;  4RGO S;  1JOR A;  2VXW A;  3NTK A;  1S5D D;  5BN5 A;  2RSN A;  1SYE A;  3G7L A;  4QIW B;  5C4H A;  1G6Z A;  1AZQ A;  4LAA A;  3TDQ A;  4HMI A;  1JOK A;  4B08 A;  3K58 A;  1STH A;  5EKI A;  4FXK C;  2QKI C;  1A3T A;  1LTG D;  1LT6 D;  1T5X D;  5D14 A;  1Q1E A;  2SOB A;  4KY5 A;  3NTI A;  5KRU A;  4FYD A;  1UNS A;  2EE1 A;  4DK1 A;  4DXG A;  1O7Z A;  5I9P A;  1IYV A;  4HCS A;  5I2X A;  3MVV A;  5IGD A;  2JEA I;  3TP7 A;  2QF7 A;  2B2W C;  3KK7 A;  1RD9 D;  1TS3 A;  3GTP B;  3E5S A;  2K6A A;  3L3O C;  4KN7 C;  1WD0 A;  3GTL B;  4NW2 A;  2F0L A;  2EY2 A;  1GUG A;  2F0O A;  4U67 3;  3VR3 A;  2L55 A;  4FP5 D;  2XWJ B;  1PRT C;  2F0J A;  3GTO B;  4CKE A;  1F9P A;  2BDN A;  1O78 A;  1PFM A;  2XSC A;  4KJO A;  3VR4 A;  5IOD A;  5C0X H;  2JA8 B;  4E6I A;  2CVR A;  4C3H G;  3T13 A;  1SYB A;  3I8Z A;  2PO4 A;  2NTS A;  3QWN A;  4OO1 H;  1PLF A;  1U4R A;  1M8A A;  3NE5 B;  1TQO A;  1ZYR C;  1J8I A;  1EY4 A;  2R93 B;  1JCK B;  1B9N A;  3KF8 A;  1XTC D;  2A6E C;  1Q12 A;  3J81 E;  1D5X C;  1LTR D;  3A8I E;  1HHV A;  4GZY C;  4ZYS A;  2RA4 A;  3PIP 3;  4RWS C;  5EQ0 A;  4PV1 C;  1MGS A;  3DUZ A;  4Q0F A;  1DOL A;  1PTO C;  1L0X B;  3VA7 A;  4ZAI A;  3PUX A;  1EEI D;  1LTT D;  4C1N I;  1IKL A;  3KLR A;  5E3F A;  1SXT A;  2RKS A;  1JC7 A;  3K59 A;  4C1N K;  2OXP A;  2IX1 A;  4LK1 C;  3KLS A;  1C48 A;  1BNZ A;  1LTB D;  3HGB A;  4BS9 A;  3WDN A;  1TWH B;  1KNA A;  1KDB A;  4RA8 A;  1SFO B;  2JYO A;  3HS0 C;  1Y8P B;  4MIU A;  1FGB D;  1WTR A;  2EPB A;  4IUT A;  3V05 A;  1JOO A;  3M85 A;  2YYZ A;  1KTK A;  4HCE A;  1SNQ A;  5G3L D;  2B2Y A;  4A3K B;  4HR7 B;  1DXM A;  4WJW A;  2KVM A;  5CV7 A;  5K5P A;  3X3M A;  5M5X B;  3OPO A;  3E6Z X;  1TWG B;  2PCF B;  4X3K A;  2EZV A;  5I9O A;  2ZXR A;  2EYF A;  2H1E A;  4RCO A;  4K5X A;  1SNC A;  2D5D A;  3CU7 A;  2K01 A;  1AEX A;  3VYS A;  1MI2 A;  4CJ2 C;  3DM1 A;  1R4P B;  4TQU S;  4C3H B;  3S1Q B;  4L8J A;  1TS2 A;  2PZW A;  4ID6 A;  2C9O A;  1STA A;  3BYT B;  2G9D A;  4A93 B;  3I91 A;  1WVL A;  4C3I G;  3J80 L;  1HPC A;  2Q8T A;  1V1P A;  2WAC A;  2B2U C;  3TP5 A;  2EYH A;  1ILQ A;  4QF4 A;  3HOU B;  4R9W A;  4R8I A;  3N6R A;  4G7Z C;  1HTP A;  1SDF A;  2F3V A;  3L7Z C;  2K5Q A;  5A35 A;  3PO3 B;  1A15 A;  5I6Y A;  1QB5 D;  1EY8 A;  3GQB A;  4BBS B;  1EY5 A;  2F0U A;  2JE6 I;  1QJO A;  3G6J B;  1PZI D;  3BVG A;  1DM0 B;  1S5B D;  5FLX L;  1ESF A;  1SNP A;  3DWA A;  4NDX A;  2ZXP A;  3A7L A;  4HSP A;  2N88 A;  5C0X G;  1SJH D;  3SVM A;  3T51 B;  1HA6 A;  1KDC A;  2R6G A;  5C3E B;  4XDX A;  2K04 A;  2B2T A;  1F2M A;  1ONL A;  4OO1 G;  3K57 A;  3EVQ A;  1SJE D;  4RCN A;  2QDB A;  1ZYR D;  5D65 A;  2K05 A;  1G29 1;  3K7A B;  5CBE E;  3NK9 A;  3OWF A;  1NCV A;  5LL6 S;  4IFD I;  1DZ1 A;  2FMM A;  1QNU A;  1GOZ A;  1HTL D;  3OWE B;  1HXY D;  5KYI A;  5JPM C;  1EWH A;  3NP8 A;  1QNK A;  2EYL A;  3MWY W;  1PTO D;  4KHV A;  1ZKO A;  2F0W A;  1NAP A;  2TSS A;  4HED A;  2NVQ B;  4KHZ A;  5T1I A;  4RH6 A;  5CV6 A;  2F0I A;  2L9H A;  2F3W A;  1SBB B;  2K32 A;  2NWG A;  2IX0 A;  2AUK A;  2F0H A;  3IFD A;  2B8F A;  1X32 A;  1BCP B;  4DNR B;  1VF5 C;  5KGU A;  1I3Q B;  4HAE A;  1HUM A;  3NSW A;  4DU9 A;  2XIW A;  4C3I B;  2LY7 A;  1LTS D;  2D62 A;  2ENB A;  3TBI B;  2MPM A;  2HDM A;  1R9T B;  2MUY A;  4QCL A;  4DAY A;  1NUC A;  3JAM L;  1TU2 B;  4DA2 A;  1H9S A;  2F0V A;  1HFN A;  1FNV A;  1LTA D;  3T4A C;  2B2V A;  1Q1B A;  1NR2 A;  1KDA A;  2LKV A;  3ERO A;  2E2I B;  1MSG A;  2K33 A;  1VMC A;  5I4D A;  4ZQ3 A;  2OT2 A;  3BDC A;  1BO0 A;  3RUZ A;  2FFK B;  4A3B B;  1IW7 D;  1CA5 A;  3OW7 A;  3EJI A;  2PZU A;  4XXE A;  3RZD B;  3TP8 A;  4DAV A;  4QUC A;  1B53 A;  1GUW A;  3I3C A;  1LT5 D;  4O42 A;  3CRL C;  2XVS A;  2E2D C;  4KKT A;  2RSO A;  1JE4 A;  1XXG A;  2FHT A;  3FVQ A;  1G8Z D;  3DWQ A;  5ELC A;  4QMG A;  3GTK B;  2K28 A;  3GP7 A;  4XQJ A;  3NWS A;  1H9J A;  4PMB A;  2WKD A;  1TT2 A;  4KD4 A;  1GHK A;  5C4X B;  4OO1 I;  4ZLT F;  3PIO 3;  3MEH A;  2EXZ A;  5DEH A;  2NVT B;  2EYJ A;  3J7Y W;  1BOS A;  1JWS D;  4ILW A;  5C0X J;  5IOC A;  1WCM B;  2E2H B;  3L9A X;  4S3S A;  1V1O A;  4U68 A;  5IIF A;  4A3E B;  1SEB D;  1STG A;  1BDO A;  1H9M A;  3NQI A;  3LWE A;  3K5O A;  1TS4 A;  3FKI B;  5JAV A;  1QG7 A;  2EDG A;  1CFM A;  3AMU A;  2BA1 A;  1X3Q A;  3VR2 A;  3J7A V;  4F87 A;  2FMC A;  1EY6 A;  3EFX D;  3AU7 A;  2HQE A;  1JR0 D;  1Z47 A;  5JVH 3;  2RDG A;  3VR5 A;  2KCC A;  3PUZ A;  2AQ3 B;  1F2Z A;  1EL0 A;  4C3J G;  1V1P B;  2EVB A;  4ULL A;  5TSS A;  5T1G A;  5ISR A;  1F2L A;  3HOW B;  1JB3 A;  5I6W A;  1U9R A;  1J9O A;  1AP0 A;  1CTM A;  4EQN A;  2VB2 X;  4F88 A;  4WFN 3;  1JWM D;  1BCP C;  4OIK A;  2O2L D;  5CV9 A;  4EQP A;  1KAA A;  4DK0 A;  2ICI A;  1D1I A;  3SK5 A;  2TMP A;  4K6D A;  3SE0 A;  3OMG A;  2IPK D;  5IGG A;  2RQX A;  1K83 B;  3OSO A;  1TWA B;  3KUP A;  1WTP A;  1QWY A;  3CRK C;  1WTX A;  5EBD A;  4X3U A;  2R3Z A;  5KND A;  3LWU A;  1EWC A;  3NBH A;  3P20 A;  3C3L A;  1OXV A;  2HCI A;  3VR6 A;  2XRQ D;  4I65 A;  3R93 A;  4K5W A;  4IUQ A;  2O4X A;  4G7H C;  4UDU C;  1SYG A;  1EEF D;  3H0G B;  4NP5 A;  1B1Z A;  5JPN C;  2A69 D;  3K0Y A;  5CYU A;  5C5L A;  1I6H B;  4H7B A;  1Z7T A;  1YNN C;  2E74 C;  1EY9 A;  1HFG A;  5FO7 B;  1U4L A;  1PRT F;  2CW0 C;  2N55 A;  4O1N A;  1LAC A;  1QE6 A;  1I6V C;  3QJY A;  1XWE A;  3NBI A;  2B2W A;  2IJ0 A;  2KQ3 A;  1EYC A;  4ZUI A;  1IKM A;  3UI2 A;  4DN4 M;  1ET6 A;  1BF4 A;  1VCI A;  5EKK A;  1TKW B;  1A3U A;  3Q0A A;  3SXH A;  1G2T A;  4L6T B;  2L12 A;  2EJF C;  1RF2 D;  4I7Z C;  3S1N B;  2NVY B;  4PMC A;  2SNS A;  1F2Y A;  3TZU A;  1H9K A;  5FLX E;  3M4Y A;  4FNF A;  1TWF B;  3NTH A;  1PXU A;  1W6J A;  2KOL A;  5FOB B;  2NN6 H;  4DAP A;  1CA6 A;  1WTV A;  1CHQ D;  3ZYY X;  4CJ0 B;  5JEA H;  2VB3 X;  1I4G A;  2F03 A;  1FNU A;  4IUR A;  2J7Z A;  3KBX A;  3PO2 B;  3TZD A;  1PTO F;  3D4D A;  4X3S A;  1A3V A;  1CHP D;  4IUU A;  3VYT A;  4HSV A;  4DXF A;  1CI3 M;  1PZJ D;  1CQV A;  4TSS A;  2MJ8 A;  5E4W C;  3Q6S A;  1ZXT A;  1AW7 A;  3ITP A;  4MHE A;  1QOH A;  1BBX C;  1PZK D;  4C3J B;  3IKJ A;  2HUG A;  3GTJ B;  1OXX K;  3I90 A;  2KUM A;  2EOT A;  3NPP A;  1CT1 D;  1H9S B;  5C4Z A;  4A3M B;  3I70 A;  2I07 B;  3CHB D;  1MSH A;  5F2D A;  2O5I C;  4XQQ A;  2BA0 A;  3MXN A;  3HKZ B;  1IW7 C;  2D2C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...