2MGSA

Solution structure of cxcl5
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
71
structure length
71
Chain Sequence
LRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of CXCL5 - A Novel Chemokine and Adipokine Implicated in Inflammation and Obesity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords C-X-C motif chemokine 5
total genus 10
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2mgsA00
4U68A 2RSNA 1IKMA 1BO0A 4XT3B 1B2TA 3GV6A 1NCVA 1O80A 2BDNA 4HEDA 2X6GA 4OIKA 2KVMA 1DOMA 3F2UA 1HA6A 2HUGA 1J8IA 1EIGA 1EOTA 1RTNA 1MGSA 3H91A 1U4MA 2K01A 3KBXA 4O42A 1SSOA 2B2WC 2HDMA 2XIWA 1S4ZA 3FDTA 4IUTA 1C8CA 4NW2A 3SVMA 4HAEA 4QUCA 2K04A 4ZKBB 3G7LA 5CBEE 1HUMA 5EKIA 1WTPA 1HFNA 1WTWA 1JICA 1IL8A 1O7YA 4RA8A 2L9HA 1HUNA 1NR4A 1XYIA 1WTOA 1PFMA 1ICWA 1X3PA 5D65A 3I90A 2MP1A 4X3KA 3GV3A 1XX8A 2X6LA 1NAPA 3I91A 3KUPA 4RWSC 3DEPA 5CMDA 1WTVA 2IL8A 2JP1A 1B50A 4XT1B 1WTXA 2KECA 1SDFA 1RTOA 1RHPA 1HRJA 1QNKA 1EL0A 1MI2A 1U4PA 1RODA 2J7ZA 2KOLA 1X3QA 1ZXTA 2KEDA 2N55A 2MPMA 2L12A 2MGSA 2KUMA 4X3UA 2Q8TA 3ONAB 2B2YA 2EPBA 1F9RA 1O7ZA 2EE1A 2KEEA 2NWGA 3HP3A 4R9WA 1F9QA 4CJ0B 1J9OA 2CVRA 1B3AA 3DM1A 1ILPA 2Q8RE 1PFBA 1G91A 1BNZA 1G2TA 1EIHA 1ILQA 2M2LA 1MSGA 4HCSA 1LV9A 2B2UA 3FPUB 5AFWA 1GUWA 5CBAE 2K28A 4ZLTF 1BF4A 4XDXA 5EPKA 1PDQA 1CA5A 2HCCA 2B2VA 1SAPA 2RVLA 3P7JA 2B2TC 1E0BA 4IUVA 3MWYW 4X3SA 1JE4A 2FFKB 2JYOA 4UAIA 4X3TA 2DY8A 2L4NA 2FMMA 3DEOA 1ESRA 1RJTA 3MTSA 4ZK9B 2RA4A 1WTRA 2VXWA 1M8AA 1DONA 4CJ2C 2L1BA 1WVLA 2HCIA 3R93A 1DOLA 2K05A 2HDLA 4IUQA 2R3ZA 1B4OA 3IL8A 1AZQA 1X32A 2D9UA 1TVXA 1B53A 1QG7A 1BBXC 2MJ8A 1EQTA 1QE6A 4HSVA 1ML0D 2N88A 1Q3LA 1WD1A 2L11A 3UI2A 2B2YC 5JJZA 1F2LA 4R8IA 1IKLA 4MHEA 4QUFA 3Q6SA 1G2SA 3D6WA 3IFDA 4IURA 1F9PA 1WTQA 1G6ZA 2EOTA 2X69A 2B2TA 3QO2A 4ZAIA 2H1EA 2NYZD 1KNAA 1NR2A 1VMCA 1DOKA 1HFGA 4ZKCB 1F9SA 1VMPA 2K1BA 4IUUA 5COYA 1HHVA 1CM9A 1U4LA 2B2VC 1U4RA 1MSHA 2FJ2A 4OIJA 4RAUC 5D14A 1A15A 3TN2A 5EPJA 1WD0A 4CJ1B 2NZ1D 5E4XA 2FINB 1KNEA 1DZ1A 2DY7A 2FHTA 3N52A 4IUPA 5DNFA 5EQ0A 1PLFA 2K03A 2RSOA 5E4WC 5T1GA 5EJWA 5CORA 3I8ZA 5EPLA 5T1IA 1AZPA 1AP0A 3LWEA 3I3CA 4MN3A 3TZDA 1PFNA 2B2UC 1CA6A 2SDFA 4LMQD 4DN4M 2B2WA
chains in the Genus database with same CATH superfamily
1VQ9A 4A4IA 5JPNC 1D8LA 2VL6A 3T1YQ 1R4PB 4DV4Q 4JI5Q 1SE4A 4A3DH 3H3VI 2B8FA 4X66Q 3N6RA 1B8AA 2A6EC 4B3RL 2EYOA 1GD7A 4K2KA 4JOIC 1PTOB 2OTJA 3H0GG 3I4OA 4WORA 1BBXC 1K8OA 4BBRB 4EGVA 5IYDG 3OIPA 3ULJA 4JOIA 1Y1VH 3A5ZB 3VYUA 2F0FA 2JA7H 5C4JB 2I46A 3S2HB 2EXDA 3S1RH 1TS2A 3CU7A 3DM1A 4A3FG 1X54A 4PMBA 1EZ6A 2MFIA 3T56B 4P71A 1VQHA 3FPUB 4HMIA 4PV1C 3CMAA 2E2IB 2PZUA 2BDOA 1E0BA 5H1SE 4A3MH 4KHPQ 3DHQA 2C35B 1A63A 4LFBQ 4KLKA 4KY6A 1VS0A 3QR8A 2JA7G 1KTKA 2K05A 2JXMB 1LYLA 1B4OA 1G8ZD 1EEID 1X32A 4AQYL 4DPGA 3MXGA 2N49A 4UY8C 2VQFL 2ZJRA 2QF7A 1TS4A 1H95A 4L5TA 2B2YC 4NPSA 1Y1VB 1IW7D 4UP7A 1VQ5A 3J81i 2E2JB 3CHBD 4QMGA 1VF5C 4IFDH 5FKAC 1AE2A 3RMHA 4FF3A 2R92B 1NTGA 2Q8IB 3BZKA 1E2ZA 1C0AA 1JT8A 2EJGC 4M8AA 3SK5A 4GNXB 5ELEA 2NZ1D 2K7VA 2FINB 2R6GA 3GTOB 1HJPA 4A3DB 3MFGA 5CORA 4C2MB 3KLRA 3ER0A 1TXYA 2A19A 1XMOL 4YHHL 1OXXK 1VQ7A 1JORA 5JVG3 4XQJA 3MHBA 4OX9L 2E76C 3SGIA 4ID6A 2KVMA 4RCOA 1LTSD 1E2VA 1EIGA 1GOZA 1RTNA 1TR5A 3S2DH 2F0GA 1S5DD 2JA6B 1PRTD 2M9VA 4O42A 3EN2A 4NW2A 2MUYA 4X66L 2K04A 5CBEE 5M3FG 1B44D 2OF1A 2R93H 3RN2A 3HKZE 1CQFA 1L0XB 2IX0A 1Y14B 1B9MA 2Q2HA 5CGKA 1SE3A 1E1OA 4OL7A 5M3MH 3S9WA 1EY0A 1EQRA 3LWUA 2EJFC 1STGA 4DR7L 4PZ8A 5E1FA 1C48A 1BBWA 1O7IA 1PHJA 2E5LL 3GDEA 3CCRA 4DUZQ 1XTCD 4WJWA 1ENFA 2Q8TA 3HOXG 1N33L 1S5CD 2JJQA 2NWGA 2RKSA 3HG9A 2F0TA 3GTQH 4Y7NH 1PFBA 5L37A 3NQIA 3V05A 1YI2A 3FPPA 2HHHQ 1B70B 3VYRA 4LAAA 3NE5B 1SJED 2CQOA 4XQNA 1EYAA 4XDXA 3E9IA 3TP6A 2KENA 1L1OA 4LFAL 1S5BD 3S1MH 1HA6A 2RQXA 4OX9Q 2R7ZH 4UAIA 3M3YB 1SEBD 2E2DC 4EX5A 4A3EG 1EUJA 5CV5A 2E5LQ 2BA0A 4HR7B 3PIOA 5M3FB 4JCVE 2N3SA 1STHA 3NTIA 4BWGB 5EKLA 4I7ZC 5ELDA 3HOXH 3NTHA 1SNOA 1KC8C 3PO2H 3K80C 1QE6A 1UUPA 2YTYA 3F1ZA 4Q5VA 4NKLA 3UI2A 4KKTA 1EY7A 4J15A 1EWCA 1KDBA 4YCWA 2OCEA 2DJFC 5GQOA 1NR2A 3NELA 1U5KA 3EA6A 4CGYB 1EQVA 3HOYG 4LF4L 1CM9A 1OXTA 2Z6KA 4POGA 1N32L 1MSHA 4QF4A 2VQFQ 3S1RB 2F52A 2CHBD 1Q7YC 1D7QA 3KBGA 1SMXA 2QW7A 1JQYD 3H0GB 4KHVA 4A3KH 4H13C 2UU9L 1PH7A 3S1QB 4KKSA 3VR2A 2WB1E 4P2CB 3NWSA 3GQBA 1N8RC 2LY7A 3DUZA 3K5NA 2L5TA 3BDLA 4A3KG 1XJVA 3HOUH 3HOZH 2BDNA 3IAYA 1FNVA 3TP7A 1HR0L 2HUGA 2B63B 5ELCA 4A3GB 3HOVG 4I7AA 2LXJA 1XPRA 4R4QA 2F03A 1PXUA 1EY6A 3GTGB 3PQIA 3WDNA 2QKIC 1GHKA 1UWVA 2UUCQ 4IFDI 4YHHQ 1IL8A 2OT2A 1X6OA 3CXCA 3U4ZA 3T1HQ 1KABA 3KLWA 4RHSA 2JP1A 3J7YW 1P8LA 2IT1A 3BZDB 4DXGA 4ILWA 5JJIA 1IYJB 1ONLA 4A3GH 3QWNA 2ENBA 2PMZE 2I0QA 2JA9A 2EYMA 2KCNA 4X3UA 4X65L 4R4IA 4ZQ3A 4AIMA 1FGBD 3CQZH 3CW2C 3R2IA 1CSQA 1EIHA 1WCMB 4DR6L 3Q24A 5C4XB 2UXCQ 4DXFA 2B2VA 5A35A 4K5VA 5IWAQ 1LTID 1M8AA 1O7LA 3HOWG 1QB5D 3DM3A 1ASYA 3H94A 2A68D 2B8GA 1LTRD 3FMCA 1QG7A 4XTCS 5FOBB 4X64Q 4MNOA 4A3MB 1KQSA 3HS0C 1CZGA 3LX0A 2JA8G 4B3RQ 3OWFA 2MO0A 3BZCA 2PQAA 3V96A 4MHEA 3HKSA 1EU3A 4H7BA 3PO2B 1N9WA 5IODA 3RZDH 5DAUA 5LMNQ 4DNIA 4A3JB 4OWTB 4IUUA 4KK7A 3VR4A 3P1HA 4AYBB 4GN3B 1Q46A 1FJGL 3DXJC 4HIOA 3CPWA 1SNCA 1PRTF 1AP0A 5HGQA 4C3IB 1LTBD 3U50C 5KYLA 3SXHA 3BDOA 2K6AA 1TS5A 1BDOA 3S1NB 3F2UA 4NXNL 3T51B 3ZYYX 1WOCA 4DV4L 1PVOA 1SSOA 2B2WC 3EROA 1C8CA 1I6HB 3L3OC 1QNUA 4XYQA 1W6KA 5C4XH 4ZKBB 1WI5A 1EWIA 2WIIB 1O7YA 2F0NA 1ICWA 4TSSA 3VR5A 1CQVA 2X6LA 4DAMA 1EYCA 2JEBI 2NVYB 4A93G 2L12A 2TMPA 1F9RA 1O7ZA 2KEEA 1G2TA 3GTJH 4IO9A 3SEBA 4WRDA 3TS2A 1Y1WB 1KHIA 1IBKL 2CWPA 4LF8L 4CDDC 4FNFA 1JWSD 4JI0L 1I4PA 4CDFC 3L2PA 1BF4A 1KIXA 4UPAA 2K5HA 3GTOH 4IQZA 1V1OA 2B2TC 1IZ6A 3I73A 4MZ9A 4JI1L 4JV5Q 2K32A 4A3CH 3I4MG 4R1JA 2V4DA 4A93H 4BXXG 1LUZA 1W6JA 1S5FD 2AQ2B 3NP8A 1QUQA 2N88A 4HJ8A 1DD2A 2I5HA 3K5LA 2L11A 5FJ8H 1YNJD 4WJ4A 4XQQA 2I5LX 4A3IB 1UNSA 3KF6A 3E3XA 1I6HH 5EBDA 4BBSB 4KI0A 2QCPX 4ZAIA 4CKEA 1D6EC 3KK7A 4ZKCB 5GADC 1Y8OB 4IFDJ 1TWFB 2PCFB 4X64L 2LSSA 4RGMA 1XWEA 4IJHA 2HQEA 2NTSA 5E4XA 1GVPA 1FJGQ 2ASBA 2K03A 5K36G 1XNRL 4LF7L 3LNNA 2F3WA 5J3BA 3LWEA 4MN3A 1BCPF 3TSSA 1CA6A 4CBVA 1CI3M 4LMQD 5GROA 2PYKA 2UXCL 3PIP3 2F0KA 3OW2A 5IP9H 2JA5G 1RF2D 2UUBL 2JA6G 1HNWL 3W5OA 3M4PA 3RZDB 1U4MA 2A69C 4PZ7A 3T1YL 1CT1D 1MJCA 2HDMA 3FDTA 3M3YH 4BA2I 2F4VL 4FXDA 4JYAQ 1QVFA 4K2LA 5C4HA 3A5UA 1WTPA 2EY1A 2VUMH 1SJHD 4RA8A 2L9HA 3KF6B 5IGEA 1UEBA 3R2TA 2KA7A 4JI1Q 5I2XA 4JV5L 1A2TA 1YBYA 1MKHA 2NVQB 1B50A 3W1BA 3NBHB 1RTOA 2D0PA 1Z6HA 3U9OA 3I7FA 1X3QA 4LF4Q 1ZXTA 4K0KQ 1PH9A 1VQPA 1YVCA 4IUNA 3NXWA 3TP8A 2B63G 5KEEA 1W3SA 1J5EQ 3CCSA 4DR5L 4L5SA 2AWOA 1SROA 3TMEA 1HQMC 5AFWA 5CBAE 1UE6A 3STBC 4L8JA 2RVLA 1I4GA 4IUVA 2JYOA 3PMFA 1LT4D 3HOZB 2Z4IA 1B3QA 4OONA 4UP8A 5I9PA 4A3FB 2VXWA 1WJJA 2LMCB 4GNXC 1QVCA 4X62Q 2WAQB 1HZBA 2NUCA 1NSNS 4JG2A 2MJ8A 1N32Q 3MXPA 4IPDA 1BQQT 5FLXc 2R61A 2XNAC 5AJ3Q 4JI3L 2NB0A 3D6WA 4HTHA 4LF5L 4RKLA 3QOLA 2WFWA 4FP5D 2EOTA 2IW3A 1NUCA 3QO2A 2PPBC 2UUCL 2FJ2A 1LO5D 3TEHB 3GP7A 3S16H 5CV9A 1D5ZC 2XN9C 1HPCA 1GJXA 1PLFA 4BXXH 1DGSA 1BCPB 5G3LD 3H09A 4QCLA 1AEXA 3HOZG 5M5XH 3S15H 2JA8B 1VQEA 3UDXA 2N8NA 5IYCG 1O80A 4GOPB 2LS01 3HRZC 1PH1A 5IGGA 1TWAB 3RLFA 3VDYA 1J5EL 1TWHH 3E9HA 2E74C 2NN6H 5D3IB 4KMUC 1Q90A 1R9TH 2Q2UA 5M5WB 4GKJQ 2EIFA 1NMGA 1Z7TA 5LMNW 1FNWA 4CDCC 3NK9A 1YNJC 2D62A 5IWAL 1GM5A 3GV3A 5CMDA 4ME5A 1WTVA 2R7FA 2ICIA 4BA1I 2XGTA 2IL8A 3HGBA 3DLLA 4YWKA 1E22A 3AEVA 3HOUG 2A73B 5BR8L 3M4OH 4DR3Q 4OO1H 1EYDA 3VR3A 2NZHA 3S1MB 1Q86C 2A6HD 4BS9A 4GLAC 2CQAA 3HP3A 4DV3L 1GUWA 1GXDC 2EXZA 2Z8LA 4Z9CB 1S5ED 4C3JH 2QEXA 3S17B 1VQBA 4M1UB 4JI6L 2SNSA 4JBWA 4PG3A 1PDQA 4HMJA 3P7JA 3O13A 4C3JG 1YNND 2B29A 2DY8A 3D0FA 3ND9A 4L5RC 1A62A 4DAYA 2D0OA 2F0JA 3PUXA 4IALA 2C5CA 2JSOA 1HZAA 1NMFA 1R4QB 2D9UA 5JJLA 1C4QA 2F3VA 1L2FA 1Q1BA 1KDAA 3BJUA 4DV0L 1X9NA 2O5JC 3T53B 5FLMH 2FMCA 3PO2G 2IX1A 2B63H 3OOCA 3K7AB 3J81L 3CC7A 3ITPA 4K8IA 4DKAC 2JA6H 3J80c 3SK8A 1V43A 2NYZD 4X6AH 3NSWA 2A74C 2ZM6Q 1BBUA 1AFPA 1GHJA 2K50A 2Z4HA 1NJIC 2R7ZG 1A15A 4A75A 4CJ1B 2PO4A 3I4MB 1ET6A 4DV2L 2CKZB 2FHTA 4C2MH 4JI3Q 5LL6S 1C9OA 3RZOH 2O4XA 3FKIG 2NVQH 3CRKC 3U9SA 4KHPL 5IP7G 1VQOA 4WFN3 1IYVA 2QDBA 3RUZA 3GV6A 3J7AV 1U0LA 1VQMA 4UDUC 2KCMA 3E5SA 3G6EA 1QJOA 3C1FA 3X3MA 1S40A 1YJWA 3PGZA 5J39A 1SYBA 3AMUA 4UP9A 3HOXB 2PZWA 5M5YH 4UHVA 4A3GG 5CV6A 2VB3X 4R4OA 4F7XA 2SEBD 4IFDG 3I90A 1HQRD 2ZT9C 3I91A 4X3KA 4JI7Q 3GTLH 4KN7C 4XXEA 4DR1L 1VQIA 1X65A 3OSOA 1RODA 4DR2Q 1PTOD 4B3MQ 1CTMA 2Z6KC 3L0OA 2AQ3B 3S24A 3R3OA 2CH4W 1TWFH 1LACA 3GTKH 5C44B 4AYBE 3KOJA 1EY5A 1O78A 4O2DA 1Q81C 4KD3A 4BBSH 1I94L 3F8TA 1K0RA 3D3RA 1I4HA 1BXTA 4A3CG 3PO3H 1LTGD 2G9DA 1PYWD 1IBLQ 3JAMi 1N36L 2EQSA 3UDFA 2HDLA 4B08A 3PV0A 1JE5A 1I4QA 3HOYB 2BOSA 4A93B 4GN4B 2K75A 2F4VQ 3QB3A 1I3QB 4QB4A 1EQTA 1QZGA 3EFXD 1QZHA 3SR1A 5IT9E 4V0BA 1E1TA 1VQDA 3OPOA 3CF5A 4DNRB 3D4WA 5CR3A 1IBML 4LF6Q 2RDHA 4JI8L 3G71A 4LNQA 1YHQA 1UAPA 3AFQA 3HOVH 3OHXC 5JEAH 1KAAA 4DV7Q 2ID0A 1G6PA 4MIUA 1DXMA 5DLQE 2YU9H 2PI2A 4TVAB 4HN7A 5EAYA 1VF7A 2F0OA 5DM63 4EQ5A 5T1GA 2NVYH 5IYCH 1EOVA 1Q12A 3S17H 4F8MA 4KHZA 1NE3A 4KV6A 4PMCA 3TZDA 1CK1A 2GVAA 4P75A 1T9HA 3HZXA 3J7AF 2RSNA 4JVZA 3TZUA 1KXLA 2WINB 1EZ8A 1JB3A 1IBLL 1J8IA 5TSSA 2VQEL 1F77A 1JWUD 3MFYA 3H0GH 5IE8A 4JBMA 3SVMA 4QUCA 2QA4A 1DYQA 1HUMA 1WTWA 2UUAQ 2HIXA 1SYEA 3ICEA 3Q0AA 4LF9Q 3J7A5 3CCVA 2OQ0A 2A6HC 1X3PA 5K5PA 4H02A 5M5WH 3Q23A 3RN5A 1AW7A 2E2IH 3KF8B 4HJ7A 4AYBG 4R4CA 2WB1B 1K3RA 1HXYD 3EIVA 1PZJD 1L1OB 1ET9A 1Y69U 3ONAB 3VR6A 3NBHA 1LT5D 2A68C 2EDGA 5BN4A 1XPOA 5KNCA 1G91A 4QGUA 1LV9A 2B2UA 2NTTA 4BBRG 1UE5A 3K58A 4A3IG 2RCFA 4O1NA 4BBRH 4MTKA 2UUBQ 1HNWQ 2YTVA 1HNXQ 4B9WA 5IGDA 4Y7NB 3FRPB 2QGQA 1VQFA 4KKUA 1DJRD 4DK0A 4X65Q 1W2BA 3PF5A 3UE0A 3HOWB 3BYTB 1WYDA 2F0SA 1I6VC 3ULLA 2WV6D 1F2LA 4LUZA 3K6OA 1F9PA 1G6ZA 1SYCA 3CCUA 3TREA 2Q2IA 1KNAA 2NN6I 2Y0SE 1DOKA 3J81c 2VS1A 1XTDA 4DK1A 2RBMA 3FEWX 1T5XD 2EYHA 1YNXA 3PO3G 2K33A 3VYSA 2K5NA 1ZYRC 3N52A 3NBIA 4QL5A 1JB7A 4G7OC 5I6WA 1MHWC 2KHJA 4HJ9A 1PZID 1A3UA 3HKZB 2B2UC 4DN4M 1K8GA 4JI7L 1IKMA 1BO0A 2F0WA 2HQLA 4JI4Q 1IHZA 3I4NG 4OIKA 3KF8A 4DF7A 3I56A 1GUOA 2K14A 1SFOH 3H91A 3KLSA 1CKMA 1MGSA 1JCKB 3KDFB 4IN3A 1JJ2A 4BY1H 1NY4A 4K8JA 4LF8Q 3W2DA 3JAML 1EY8A 4O0AA 2AKWB 4C3JB 3GTMH 1TKWB 4G57A 4HJAA 4XYOA 4OGQC 4CKCA 2VUMB 2MP1A 3G48A 5ISRA 1NAPA 2ZJPA 1WTXA 1Q8KA 2JN4A 1H9KA 2KHSA 4B3TQ 4NXML 1AE3A 2RDGA 3TS0A 1LT6D 2J7ZA 3BVMA 3K7UC 5IT9c 2F0QA 1STBA 3GTPB 1FR3A 2EE1A 4A3JH 2E2HB 1E2WA 1U9RA 2N78A 1BNZA 1VCIA 3PCOB 3A8KE 5C6AA 1ILQA 2EYPA 4HCSA 2ES2A 4GN5A 2CCZA 2I07B 4GKJL 2O5IC 1F2YA 3CC4A 3F2DA 2JA5B 2HCCA 2LFNA 3K59A 1SYGA 1JE4A 1BUVT 1EY9A 3M9BA 3Q8DA 1AH9A 1RJTA 4NXNQ 1NBWA 4FDBA 4B3SL 3R8BA 5LL6X 3GTLB 5C0XI 2R3ZA 1BCPD 4L5QA 1VQ4A 1N33Q 4EQOA 2ALYB 4KTAA 4DUZL 2A6ED 3U4VA 2H5XA 4DAYB 1A6XA 2JQOA 2B3GA 1VQGA 3FHWA 4RKBA 2HIVA 1XNQL 2NBFA 4LWCA 2QEJC 1QOHA 2X69A 4OHJA 4JI6Q 3DWQA 3M7NA 5J22A 2A5HA 5CYUA 1JJGA 3NWTA 3KYHC 3UDIA 4OIJA 5D14A 5IIFA 2KQ3A 3G6JB 1B9NA 4L63B 4B3ML 3WOFA 1ENAA 5E4WC 4MTNA 4DV0Q 2P5ZX 3I3CA 4IOCA 1X55A 3K5MA 4ZRZA 2QILA 1Y8PB 1M90C 4C3HH 3Q22A 1YHAA 1MIUA 3K5OA 4A3FH 1JR0D 4IPGA 1FNUA 1PYSB 5C44G 1V8QA 4LUOA 5JEAJ 2F0DA 2L0CA 3EBEA 1PMRA 4TKOB 4ZCKA 1D1KA 4E6IA 2YV5A 3HOYH 4OO1G 5IYDH 2G9HD 5CV4A 4GKKQ 4RH6A 1XYIA 1SYFA 4NB3A 3QOJA 2DUDA 3CP0A 5DNFA 4C3HB 4A3KB 4FXGC 2R93G 1OXVA 2F1MA 4LFAQ 3J80E 2KECA 1XXGA 1TIID 3FP9A 1KL9A 4RGNA 4CHTB 4DV1Q 4B3SQ 4FF2A 1ZKOA 2GVBA 1QVGA 3I72A 2B2YA 5GAHC 5C44H 1GUGA 2CVRA 2J4XA 2F3IA 2OXPA 2Q8RE 2MNAA 1IL2A 5C4XG 1R9TB 2EZVA 4DNTB 1KRSA 2YTXA 2LKVA 4A3EH 3CCQA 4DR6Q 3MAQA 1HH2P 1SYDA 2K28A 3L7ZC 1XNQQ 4DAVA 3K8AA 2NVTB 2GN5A 1A0IA 3S14H 1ESRA 4H44C 1I5FA 3M4QA 5F2DA 2PNRC 2WKDA 4ZK9B 4DK6C 1FD7D 1IYUA 1DONA 3NQTA 1F2MA 2HT1A 3W3AA 1X3GA 2IJ0A 3J81E 4DV2Q 2R7ZB 1UEAB 2ZXPA 2NVTH 2UXBL 1ZYRD 4NDXA 2EJMA 4LW1A 4EQNA 1XNRQ 5JEAG 4A3JG 4HIDA 1A8VA 1I50B 4GLVB 4LFCQ 3A56A 2IWHA 1DCZA 4IPCA 4YWLA 5COYA 2NN6G 4A3LG 5HGTA 5KYIA 1PTOC 5A2QL 1PFSA 3BS1A 5C5MA 2AWNA 1L0WA 1CHPD 1QILA 4IUPA 5AJ3L 5LMUL 5DM73 3MC0B 5E3FA 5EPLA 1WCMH 1TQOA 1B1ZA 1PFNA 3FVQA 3IFTA 3S16B 3HEJA 3FKIH 4U68A 1PTOH 1BCPC 1OXSC 3AYHB 5EKKA 3A74A 5BN5A 3K7AH 4RHRA 3WOEA 1DOMA 3E6ZX 2PNHA 2K01A 1D5XC 2XIWA 4IUTA 2B39A 4BY7G 3G7LA 2CWAA 1E24A 2OQKA 1SXTA 2Z6BA 4IOAA 1CUKA 4N9PA 1STYA 2ZTEA 2Y0SB 3TP5A 1WTOA 1PFMA 5D65A 4B3TL 2FXQA 4GNXA 4JPBW 3A0JA 3CD6A 3GTGH 4KY5A 4XT1B 3HKZG 1NNXA 1HRJA 1QNKA 1PRTC 3IRBA 3EJIA 3K0YA 2I5MX 3SHLA 3DWAA 4QIWB 1SMYC 2AUJD 3NHHA 1K83H 4DFAA 4F88A 1ESFA 2PMZB 2EYFA 2NVXH 3PF4A 1LABA 3OIQA 2ICEC 4DR5Q 3CRLC 2D5DA 4R4TA 3MVVA 5I9OA 2BH8A 2L15A 5IP7H 5IOCA 5IT9L 2F4IA 3RLNA 2L4NA 3DEOA 1I4RA 3ZJYC 3A7AB 1KDCA 1KRTA 1OO9B 2DNEA 3S1NH 4K0KL 3JC66 4BY7B 2DN8A 4GOPA 5C3EG 2XSCA 1UE1A 3R93A 3TRZA 1CZWA 4OO1I 1G51A 2YYZA 4ABNA 2XVSA 2CW0D 1PZKD 2IPKD 3CKIB 4GOPC 1H9MA 2OEOA 4J1MA 3MZ5A 5GAGC 1EIFA 2PQAB 5DEHA 1LTTD 1B7YB 1G2SA 4IURA 4DV6L 3AFPA 1STNA 4C3IG 2EVBA 3K0XA 4K5WA 5FO9B 1JOKA 4RG1A 5KIXA 5M5XB 3S15B 1PH6A 5FLMG 3CCMA 4HIMA 1VMPA 1STEA 2Z9HA 5ELFA 5M5YB 1U4RA 1TY0A 4NMZA 1SMYD 5C3EH 3CAMA 1J6QA 2WKCA 4JW0A 5KNBA 1HCZA 2DJGC 3GD7A 5EJWA 1XPUA 1VQJA 1D1IA 4A3EB 1V1PB 3MEFA 1AN8A 4FF1A 1DM0B 2F0HA 4KD4A 5FO7B 4KY7A 1Y1WG 2XWBB 1H9RA 3H6MA 1BKBA 2O2LD 1EY4A 2G5DA 3D8GA 5A2QE 5JJKA 2E8GA 4DA2A 2MO1A 1PYBA 2F0MA 4JYAL 4RCNA 4FXKC 2F0LA 1SR3A 5C0XG 4PQXA 4XIGS 2D2CC 2VUMG 3W1GA 1Z47A 3OMCA 4YY3Q 5FJ8G 1V1QA 2XRSD 3DEPA 5FLXL 1SDFA 5CV8A 1N36Q 1EL0A 1MI2A 2KOLA 1PH5A 3K57A 1LM0A 1EQQA 3OW7A 2KUMA 3D31A 5IP9G 3IKJA 1HNZL 4FYDA 4DUYQ 1F9QA 4DV5L 1M4VA 1ILPA 5E7NA 4V190 4KJNA 1FVIA 3D4RA 4P72A 5LMNL 2CFMA 4K6DA 5FLXE 3JAMc 1IBKQ 4JI8Q 3HOWH 4X3SA 1JWMD 4G4KA 2VW9A 4KN4C 1Q82C 2FFKB 3PIPA 2RDFA 1UE7A 5I2YA 1A2UA 4J6HA 1STAA 2L1BA 1WVLA 2HCIA 3KFUA 1DOLA 3HOUB 3EVQA 1H9SB 1L0YB 3IL8A 4EVOA 2PW5A 1QCBD 4G7HC 1B53A 2AHOB 4A3BH 2PQEA 1QUQB 1BOSA 3SK4A 2J0TD 1HTPA 1LT3D 2BE5C 3OWEB 4APVA 1JOQA 1CKNB 4DV6Q 4L6TB 4Y52H 1X3FA 4C56C 1RKNA 5C0XJ 4YY3L 2VQEQ 1HFGA 1IW7C 3H3VC 4EQPA 4GS3A 1XMQL 3WWVA 1DZ1A 4P73A 1YZ6A 1XMQQ 4C3HG 3OTOL 2RSOA 3F2BA 3QG1A 1TWAH 4LK1C 5LMUQ 3SK6A 1CFMA 2A1AA 3E0EA 1YITA 4DK3C 4A3LH 2MQHA 4FF4A 5LHY1 2UUAL 3K81C 2E2HH 4XT3B 1B2TA 3GTPH 2SNMA 5K36H 1NCVA 2X6GA 4A3IH 1TY2A 5C4JH 4DV7L 3CPFA 2K5WA 2KCCA 1EIYB 2JE6I 2A69D 1Q8IA 1OTCA 2Z0SA 3RNUA 3I55A 1JOOA 4OEMB 1YJNA 1SNQA 3GTMB 1HUNA 1IXRA 3CCJA 2XWJB 2HD3A 1RL2A 4JK1C 1Y1VG 1VQAA 2F0EA 2WACA 5JVH3 5C4ZA 4BY7H 4FO2A 4K6LA 3P75A 1U4PA 1SFOB 1V9PA 2KEDA 2N55A 2Q2TA 1Y1WH 2L55A 2R92G 3MXNA 2EPBA 2EYJA 1ENCA 1SNDA 1J9OA 1B3AA 2CH4A 1EU4A 3UE1A 3E0JA 4BY1G 3CQZB 3KLSX 3I4NB 2DNCA 2UXBQ 1Q1EA 1CKNA 2RHSB 4LF5Q 3MWYW 5T1IA 3FKIB 2C9OA 3MTSA 1HR0Q 5M3MG 4H0LC 1ICFB 3P20A 5BR8Q 3A7LA 3S1QH 1GUSA 1JC7A 1AZQA 3A55A 4YCUA 1QWYA 4HIKA 2XTIA 1CHQD 3QIAA 1V1PA 5JAVA 3OMGA 1PV4A 3NEMA 2EY6A 1WD1A 4I65A 3L9AX 1HTLD 1F2ZA 4A76A 3C3LA 3VA7A 3A8JE 3C46A 3ERSX 3IFDA 3JAME 3J81j 1VQLA 5JOBA 1VMCA 2V1CC 5ELNA 2K1BA 1S72A 3CCEA 1EFWA 3BVZA 4DR2L 3T4AC 1U4LA 1KLUD 4RAUC 4JI4L 1WD0A 1RIPA 4DV3Q 2E2JH 2NZOA 1KNEA 1A3VA 3BU2A 3PUWA 4JI2L 4QQBX 1KLGD 2UU9Q 4LF9L 4LUVA 1P16A 1SN8A 1L1OC 2UXDL 3RD4A 5CC4A 2RF4A 1CKOA 4LFCL 5IYBG 2OWOA 4HEDA 5NUCA 1PH4A 4F87A 4JBKA 3NUCA 4LFBL 4N9TA 1EOTA 5D3DA 3KBXA 2MHVA 5KGUA 3STBD 1I50H 3I2ZA 3M4YA 2IY5B 1PRTB 4HAEA 1LTAD 5HURA 3GTQB 1HFNA 1JICA 1EFID 4NP5A 3M7GA 4ZUJA 4LJZC 2EYLA 3CC2A 3OYYA 4S3SA 3A54A 1NR4A 2BE5D 1MJEA 1YNNC 4TRDA 4ALPA 1K8MA 4RWSC 4DR1Q 1TWCH 1FYCA 5M3FH 2EY5A 4X62L 3U58A 3I4MH 2AUKA 4K5XA 2JA7B 1I4XA 5C0XH 2ZM6L 2MPMA 4A3BB 4HSPA 1FL0A 2RHQB 4CJ0B 2WAQE 4QJFA 2M2LA 1GKHA 2IHEA 5CV7A 4GZYC 3D4DA 2KBNA 4P74A 4POFA 3J80L 5BN3A 5C3WA 1EEFD 4ODGA 1EYGA 4JI5L 2F0PA 4ME3A 4FVMA 2KCTA 3T13A 4RGOS 3C1EA 5M3MB 3GTJB 2OTLA 1E3PA 3HOVB 1K0SA 4N8X1 1KAWA 1TVXA 3KDFA 1S3OA 2AQ1B 4Q0FA 1K73C 4HSVA 1TU2B 3DWPA 2WP8J 3J7ZC 2R93B 2XRQD 3LGJA 4R8IA 4OWXB 4OWWB 2F0UA 2H4OA 3Q6SA 1K9MC 5HY6A 3BG3A 3HFZB 1WTHA 1HZ9A 4WJ3M 2B2TA 4A3BG 2H1EA 3BDCA 1K8AC 1MBYA 3A8IE 1VQNA 2B2VC 4DR3L 5EPJA 3OTOQ 1PH8A 1WFQA 2DY7A 1TWCB 1H9JA 3PUYA 2F0IA 2SOBA 4N8FA 4YCVA 3I8ZA 5IGFA 1AZPA 4GKKL 4AQYQ 1LLRD 2K5VA 1GUTA 1K3BC 4ZUIA 1WCMG 4J8QA 5C5LA 3PUZA 5I6YA 3MA2B 1ASZA 2F0VA 2R92H 2JA5H 3MXNB 1RD9D 3TDQA 1M1KC 1SLJA 1II3A 1SNPA 2HHHL 4DUYL 2K4KA 1PH3A 5EKIA 5ELBA 1RDPD 3CMEA 4R8NA 3F2CA 2RCNA 2JA8H 1OXUA 1A3TA 3MXUA 5FO8B 3SDZA 1PA6A 5KNDA 3URYA 1XX8A 3KUPA 1XMOQ 3S14B 3TBIB 1SBBB 3H15A 2CW0C 1RHPA 2WAQG 1LTLA 5J1ZA 4JBJA 4OELB 3B6YA 3NENA 5IYBH 3ND8A 4R9WA 4AH6A 4DV5Q 2BA1A 4DU9A 4DAPA 4ULLA 5EGTA 1SE8A 1YJ9A 1SE2A 3KJOA 2E75C 3RZOB 2IX3A 3TQYA 4DV1L 4B9XA 1CA5A 2QDLA 3VYTA 4OXPA 3CCLA 1H9SA 2VY3A 4X3TA 1VQ8A 3D6CA 3X3NA 1SNMA 1WTRA 2BH2A 1T5EA 1HNXL 2JK8A 4U673 2VB2X 2LXKA 4IUQA 1JJCB 1VQKA 1K83B 5GAEC 4YIJA 1PTOF 3SE0A 4HJ5A 1ML0D 2Y0SG 1Q3LA 5JJZA 2JEAI 3S2DB 3UDGA 4BY1B 1IKLA 1GUNA 1WTQA 3ULPA 1E7ZA 4TQUS 5G3LF 5EBCA 1N34L 2PI2E 4K14A 1VQCA 2A8VA 4A3MG 3TN2A 3NTKA 2ZXRA 2EY2A 4PZ6A 4G7ZC 1TS3A 2KJXA 5EQ0A 2ZTCA 4IZ8A 3M85A 2ZJQA 1BR9A 1VQ6A 2UXDQ 4LF7Q 2IHFA 1I3QH 1VDZA 3GO5A 5IY0A 4BBSG 1TWGB 4JI2Q 4JC0A 3C2PA 3I70A 2K5QA 5M9OA 2B2WA 2Z1CA 2PW7A 4PNYA 4QIWE 5IGCA 3T1HL 1HR0W 2ATWA 1X56A 1FGUA 1RCVD 3PO3B 3J80i 4GLXA 3M4OB 1K28A 1S4ZA 3AB9A 3MEHA 5JPMC 2WB1G 2R7DA 3PSIA 2PZTA 1C7YA 2TSSA 3RLOA 1YEZA 3GTKB 1YIJA 1X3EA 4A3DG 3ERQA 4DR7Q 4QY7A 5I4DA 5IGBA 4C3IH 1TT2A 1D2BA 1TWHB 1G291 5KRUA 2K52A 4DR4L 1Z9FA 2AMCB 2MGSA 3VA5A 3G4SA 3KJPA 1BVSA 2ZXOA 5C3EB 1HNZQ 1IBMQ 1MSGA 3S2HH 3AQQA 4CDEC 1SRUA 4ZLTF 4NXMQ 1GO3E 5EPKA 1SAPA 4ZYSA 3AU7A 2BCOA 2FMMA 3I4LA 5FK9C 4IJLA 2RA4A 4DR4Q 4CJ2C 1TWGH 3PUVA 4RGTA 4DGZA 1D5MC 4KJOA 1N34Q 1HA5A 2GA4B 4C1NI 3H3VH 4RFBA 4YWMA 2KHIA 2ZTDA 1I94Q 5C3XA 4C1NK 4JI0Q 2K5DA 3V2TA 4CKBA 2VNUD 4QUFA 4LF6L 3QJYA 1Y8NB 2NVXB 3NPPA 3T16A 4RMFA 1EWHA 3BYYB 1F9SA 4PMWA 2VZAA 1HHVA 4HCEA 1KD1C 3EQLC 1JMCA 3RR5A 1CSPA 3PIO3 2M00A 3BVGA 1MD2D 5ELOA 1PH2A 1ZEQX 3I4NH 4IPHA 1YHBA 2DGYA 2YU9B 1HZCA 3DMUA 2SDFA
chains in the Genus database with same CATH topology
5JPNC 1R4PB 1SE4A 2B8FA 3N6RA 2A6EC 2EYOA 4K2KA 1PTOB 4WORA 1K8OA 1BBXC 4BBRB 4EGVA 3OIPA 3VYUA 2F0FA 5C4JB 2I46A 3S2HB 1TS2A 3CU7A 3DM1A 4PMBA 1EZ6A 3T56B 3FPUB 4HMIA 4PV1C 2E2IB 2PZUA 2BDOA 1E0BA 3DHQA 4KY6A 1KTKA 2K05A 2JXMB 1B4OA 1G8ZD 1EEID 1X32A 3MXGA 2QF7A 1TS4A 2B2YC 1Y1VB 1IW7D 2E2JB 3CHBD 4QMGA 1VF5C 4IFDH 5FKAC 3RMHA 4FF3A 2R92B 2Q8IB 1E2ZA 2EJGC 4M8AA 3SK5A 5ELEA 2NZ1D 2K7VA 2FINB 2R6GA 3GTOB 4A3DB 3MFGA 5CORA 4C2MB 3KLRA 1OXXK 1JORA 5JVG3 4XQJA 3MHBA 2E76C 4ID6A 2KVMA 4RCOA 1LTSD 1E2VA 1EIGA 1GOZA 1TR5A 1RTNA 2F0GA 1S5DD 2JA6B 1PRTD 2M9VA 4O42A 4NW2A 2MUYA 2K04A 5CBEE 1B44D 2OF1A 1CQFA 1L0XB 2IX0A 1B9MA 5CGKA 1SE3A 4OL7A 3S9WA 1EY0A 3LWUA 2EJFC 1STGA 5E1FA 1C48A 1XTCD 4WJWA 1ENFA 2Q8TA 1S5CD 2NWGA 2RKSA 3HG9A 2F0TA 1PFBA 3NQIA 3V05A 3FPPA 3VYRA 4LAAA 3NE5B 1SJED 4XQNA 1EYAA 4XDXA 3TP6A 1S5BD 1HA6A 2RQXA 4UAIA 3M3YB 1SEBD 2E2DC 5CV5A 2BA0A 4HR7B 5M3FB 1STHA 3NTIA 4BWGB 5EKLA 4I7ZC 5ELDA 3NTHA 1SNOA 1QE6A 1UUPA 4Q5VA 4NKLA 3UI2A 4KKTA 1EY7A 1EWCA 1KDBA 1NR2A 3EA6A 4CGYB 1EQVA 1CM9A 1OXTA 1MSHA 4QF4A 3S1RB 2CHBD 3KBGA 3H0GB 1JQYD 4KHVA 4H13C 3S1QB 4KKSA 3VR2A 4P2CB 3NWSA 3GQBA 2LY7A 3DUZA 3K5NA 2L5TA 3BDLA 2BDNA 3IAYA 1FNVA 3TP7A 2HUGA 2B63B 5ELCA 4A3GB 2F03A 1PXUA 1EY6A 3GTGB 3WDNA 2QKIC 1GHKA 4IFDI 1IL8A 2OT2A 1KABA 4RHSA 2JP1A 3J7YW 2IT1A 3BZDB 4DXGA 4ILWA 1ONLA 3QWNA 2ENBA 2EYMA 2KCNA 4X3UA 4ZQ3A 1FGBD 3R2IA 1EIHA 1WCMB 3Q24A 5C4XB 4DXFA 2B2VA 5A35A 4K5VA 1LTID 1M8AA 1O7LA 1QB5D 3H94A 2A68D 2B8GA 1LTRD 3FMCA 1QG7A 4XTCS 5FOBB 4A3MB 3HS0C 1CZGA 3LX0A 3OWFA 3V96A 4MHEA 1EU3A 4H7BA 3PO2B 5IODA 5DAUA 4A3JB 4IUUA 4KK7A 3VR4A 3P1HA 4AYBB 3DXJC 1SNCA 1PRTF 1AP0A 4C3IB 1LTBD 5KYLA 3SXHA 3BDOA 2K6AA 1TS5A 1BDOA 3S1NB 3F2UA 3T51B 3ZYYX 1SSOA 2B2WC 3EROA 1C8CA 1I6HB 3L3OC 1QNUA 4XYQA 1W6KA 4ZKBB 2WIIB 1O7YA 2F0NA 1ICWA 4TSSA 3VR5A 1CQVA 2X6LA 1EYCA 2JEBI 2NVYB 2L12A 2TMPA 1F9RA 1O7ZA 2KEEA 1G2TA 3SEBA 4WRDA 1Y1WB 4FNFA 1JWSD 1I4PA 1BF4A 4IQZA 1V1OA 2B2TC 3I73A 2K32A 2V4DA 1W6JA 1S5FD 2AQ2B 3NP8A 2N88A 1DD2A 3K5LA 2L11A 1YNJD 4XQQA 4A3IB 1UNSA 5EBDA 4BBSB 4KI0A 2QCPX 4ZAIA 4CKEA 1D6EC 3KK7A 4ZKCB 1Y8OB 4IFDJ 1TWFB 2PCFB 4RGMA 1XWEA 2HQEA 2NTSA 5E4XA 2K03A 5K36G 3LNNA 2F3WA 3LWEA 4MN3A 1BCPF 3TSSA 1CA6A 4CBVA 1CI3M 4LMQD 2PYKA 3PIP3 2F0KA 1RF2D 3RZDB 1U4MA 2A69C 1CT1D 2HDMA 3FDTA 4BA2I 4FXDA 4K2LA 5C4HA 1WTPA 2EY1A 1SJHD 4RA8A 2L9HA 5IGEA 3R2TA 2KA7A 5I2XA 1A2TA 2NVQB 1B50A 1RTOA 1Z6HA 3U9OA 1X3QA 1ZXTA 4IUNA 3NXWA 3TP8A 5KEEA 2AWOA 3TMEA 1HQMC 5AFWA 5CBAE 4L8JA 2RVLA 1I4GA 4IUVA 2JYOA 3PMFA 1LT4D 3HOZB 2Z4IA 5I9PA 4A3FB 2VXWA 2LMCB 2WAQB 2NUCA 1NSNS 2MJ8A 3MXPA 1BQQT 2R61A 2XNAC 2NB0A 3D6WA 4HTHA 4RKLA 3QOLA 4FP5D 2EOTA 2IW3A 1NUCA 3QO2A 2PPBC 2FJ2A 1LO5D 3GP7A 5CV9A 1D5ZC 2XN9C 1HPCA 1GJXA 1PLFA 1BCPB 5G3LD 3H09A 4QCLA 1AEXA 2JA8B 1O80A 2LS01 3HRZC 5IGGA 1TWAB 3RLFA 2E74C 2NN6H 5D3IB 4KMUC 1Q90A 5M5WB 1Z7TA 1FNWA 3NK9A 1YNJC 2D62A 3GV3A 5CMDA 4ME5A 1WTVA 2ICIA 4BA1I 2IL8A 3HGBA 4OO1H 2A73B 1EYDA 3VR3A 3S1MB 2A6HD 4BS9A 2CQAA 3HP3A 1GUWA 1GXDC 2EXZA 2Z8LA 4Z9CB 1S5ED 3S17B 4M1UB 2SNSA 4JBWA 1PDQA 4HMJA 3P7JA 3O13A 4C3JG 1YNND 2DY8A 3ND9A 4DAYA 2F0JA 3PUXA 4IALA 2C5CA 2JSOA 1R4QB 2D9UA 1C4QA 2F3VA 1Q1BA 1KDAA 2O5JC 3T53B 2FMCA 2IX1A 3OOCA 3K7AB 3J81L 3ITPA 4K8IA 3SK8A 1V43A 2NYZD 3NSWA 2A74C 1AFPA 1GHJA 2Z4HA 1A15A 4CJ1B 2PO4A 3I4MB 1ET6A 2FHTA 5LL6S 2O4XA 3CRKC 3U9SA 4WFN3 1IYVA 2QDBA 3J7AV 3GV6A 3RUZA 4UDUC 3E5SA 1QJOA 3C1FA 3X3MA 5J39A 1SYBA 3AMUA 3HOXB 2PZWA 5CV6A 2VB3X 4F7XA 2SEBD 4IFDG 3I90A 1HQRD 2ZT9C 3I91A 4X3KA 4KN7C 4XXEA 3OSOA 1RODA 1PTOD 1CTMA 2AQ3B 3R3OA 1LACA 5C44B 1EY5A 1O78A 4KD3A 3D3RA 1I4HA 1BXTA 1LTGD 2G9DA 1PYWD 2HDLA 4B08A 3PV0A 3HOYB 1I4QA 2BOSA 4A93B 4QB4A 3QB3A 1I3QB 1EQTA 3EFXD 3SR1A 5IT9E 4V0BA 3OPOA 4DNRB 3D4WA 5CR3A 2RDHA 1UAPA 3OHXC 5JEAH 1KAAA 2ID0A 4MIUA 1DXMA 4HN7A 1VF7A 2F0OA 5DM63 5T1GA 1Q12A 4F8MA 4KHZA 4PMCA 4KV6A 3TZDA 1CK1A 3HZXA 3J7AF 2RSNA 3TZUA 2WINB 1EZ8A 1JB3A 1J8IA 5TSSA 1F77A 1JWUD 3MFYA 3SVMA 4QUCA 1DYQA 1HUMA 1WTWA 1SYEA 3Q0AA 2A6HC 1X3PA 5K5PA 3Q23A 1AW7A 2WB1B 1HXYD 1PZJD 1ET9A 1Y69U 3ONAB 3VR6A 3NBHA 1LT5D 2A68C 2EDGA 5BN4A 5KNCA 1G91A 1LV9A 2B2UA 2NTTA 3K58A 4O1NA 4B9WA 5IGDA 4Y7NB 3FRPB 4KKUA 1DJRD 4DK0A 3HOWB 3BYTB 2F0SA 1I6VC 2WV6D 1F2LA 3K6OA 1F9PA 1G6ZA 1SYCA 1KNAA 2NN6I 1DOKA 4DK1A 2RBMA 3FEWX 1T5XD 2EYHA 2K33A 3VYSA 1ZYRC 3N52A 3NBIA 4G7OC 5I6WA 1PZID 1A3UA 3HKZB 2B2UC 4DN4M 1IKMA 1BO0A 2F0WA 1IHZA 4OIKA 3KF8A 4DF7A 1GUOA 3H91A 3KLSA 1MGSA 1JCKB 4IN3A 4K8JA 3W2DA 3JAML 1EY8A 4C3JB 1TKWB 4G57A 4XYOA 4OGQC 4CKCA 2VUMB 2MP1A 5ISRA 1NAPA 1WTXA 1H9KA 2KHSA 2RDGA 1LT6D 2J7ZA 3BVMA 2F0QA 1STBA 3GTPB 1FR3A 2EE1A 2E2HB 1E2WA 1U9RA 1BNZA 1VCIA 5C6AA 3A8KE 1ILQA 2EYPA 4HCSA 2I07B 2O5IC 1F2YA 2JA5B 2HCCA 2LFNA 3K59A 1SYGA 1JE4A 1BUVT 1EY9A 1RJTA 3R8BA 5LL6X 3GTLB 5C0XI 2R3ZA 1BCPD 4EQOA 4KTAA 2A6ED 1A6XA 4RKBA 2NBFA 2QEJC 1QOHA 2X69A 4OHJA 3DWQA 3M7NA 5J22A 2A5HA 5CYUA 3NWTA 4OIJA 5D14A 5IIFA 2KQ3A 3G6JB 1B9NA 4L63B 3WOFA 1ENAA 5E4WC 3I3CA 3K5MA 4ZRZA 2QILA 1Y8PB 2SDFA 3Q22A 3K5OA 1JR0D 1FNUA 1V8QA 5JEAJ 2F0DA 2L0CA 1PMRA 4TKOB 1D1KA 4E6IA 4OO1G 2G9HD 5CV4A 4RH6A 1XYIA 1SYFA 4A3KB 3QOJA 5DNFA 4C3HB 4FXGC 1OXVA 2F1MA 3J80E 2KECA 1XXGA 1TIID 4CHTB 4RGNA 4FF2A 1ZKOA 3I72A 2B2YA 1GUGA 2CVRA 2J4XA 2OXPA 2Q8RE 1R9TB 2EZVA 4DNTB 2LKVA 3MAQA 1SYDA 2K28A 3L7ZC 4DAVA 2NVTB 1ESRA 4H44C 5F2DA 2PNRC 2WKDA 4ZK9B 1FD7D 1IYUA 1DONA 3NQTA 1F2MA 3W3AA 2IJ0A 3J81E 2R7ZB 1UEAB 2ZXPA 1ZYRD 4NDXA 2EJMA 4EQNA 5JEAG 1I50B 3A56A 2IWHA 1DCZA 5COYA 2NN6G 5HGTA 5KYIA 1PTOC 5A2QL 3BS1A 5C5MA 2AWNA 1CHPD 1QILA 4IUPA 5DM73 3MC0B 5E3FA 5EPLA 1TQOA 1B1ZA 1PFNA 3FVQA 3IFTA 3S16B 3HEJA 4U68A 1PTOH 1BCPC 1OXSC 5EKKA 5BN5A 4RHRA 3WOEA 1DOMA 3E6ZX 2K01A 1D5XC 2XIWA 4IUTA 2B39A 3G7LA 1SXTA 4N9PA 1STYA 2Y0SB 3TP5A 1WTOA 1PFMA 5D65A 4KY5A 4XT1B 1HRJA 1QNKA 1PRTC 3K0YA 3EJIA 3SHLA 3DWAA 4QIWB 1SMYC 2AUJD 3NHHA 4DFAA 4F88A 1ESFA 2PMZB 2EYFA 1LABA 3OIQA 2ICEC 3CRLC 2D5DA 3MVVA 5I9OA 5IOCA 5IT9L 2F4IA 2L4NA 3DEOA 1I4RA 3A7AB 1KDCA 1OO9B 2DNEA 4BY7B 2DN8A 2XSCA 3R93A 1CZWA 4OO1I 2YYZA 4ABNA 2XVSA 2CW0D 1PZKD 2IPKD 3CKIB 1H9MA 2OEOA 4J1MA 3MZ5A 5DEHA 1LTTD 1G2SA 4IURA 1STNA 4C3IG 2EVBA 4K5WA 5FO9B 1JOKA 5KIXA 5M5XB 3S15B 1VMPA 1STEA 5ELFA 5M5YB 1U4RA 1TY0A 4NMZA 1SMYD 2WKCA 5KNBA 1HCZA 3GD7A 5EJWA 1D1IA 4A3EB 1V1PB 1AN8A 4FF1A 1DM0B 2F0HA 4KD4A 5FO7B 4KY7A 2XWBB 1H9RA 3H6MA 2O2LD 1EY4A 3D8GA 5A2QE 4DA2A 2F0MA 4RCNA 4FXKC 2F0LA 5C0XG 4PQXA 4XIGS 2D2CC 1Z47A 3OMCA 2XRSD 3DEPA 5FLXL 1SDFA 5CV8A 1EL0A 1MI2A 2KOLA 3K57A 3OW7A 2KUMA 3D31A 3IKJA 4FYDA 1F9QA 1M4VA 1ILPA 4V190 4KJNA 3D4RA 4K6DA 5FLXE 4X3SA 1JWMD 4G4KA 4KN4C 2FFKB 2RDFA 5I2YA 1A2UA 4J6HA 1STAA 2L1BA 1WVLA 2HCIA 1DOLA 3HOUB 3EVQA 1H9SB 1L0YB 3IL8A 4EVOA 2PW5A 1QCBD 4G7HC 1B53A 2PQEA 1BOSA 3SK4A 2J0TD 1HTPA 1LT3D 2BE5C 3OWEB 1JOQA 4L6TB 4C56C 1RKNA 5C0XJ 1HFGA 1IW7C 3H3VC 4EQPA 1DZ1A 4C3HG 2RSOA 3QG1A 4LK1C 3SK6A 1CFMA 4FF4A 5LHY1 4XT3B 1B2TA 2SNMA 5K36H 1NCVA 2X6GA 1TY2A 2K5WA 2KCCA 2JE6I 2A69D 1Q8IA 1JOOA 1SNQA 3GTMB 1HUNA 2XWJB 4JK1C 2F0EA 2WACA 5JVH3 5C4ZA 4FO2A 4K6LA 3P75A 1U4PA 1SFOB 2KEDA 2N55A 2L55A 3MXNA 2EPBA 2EYJA 1ENCA 1SNDA 1J9OA 1B3AA 1EU4A 3E0JA 3CQZB 3KLSX 3I4NB 2DNCA 1Q1EA 3MWYW 5T1IA 3FKIB 2C9OA 3MTSA 4H0LC 3P20A 3A7LA 1GUSA 1JC7A 1AZQA 3A55A 1QWYA 1CHQD 3QIAA 1V1PA 5JAVA 3OMGA 2EY6A 1WD1A 4I65A 3L9AX 1HTLD 1F2ZA 3C3LA 3VA7A 3A8JE 3C46A 3IFDA 3JAME 5JOBA 1VMCA 2K1BA 3BVZA 3T4AC 1U4LA 1KLUD 4RAUC 1WD0A 1KNEA 1A3VA 3PUWA 1KLGD 5CC4A 4HEDA 5NUCA 4F87A 3NUCA 4N9TA 1EOTA 5D3DA 3KBXA 2MHVA 5KGUA 3M4YA 1PRTB 4HAEA 1LTAD 5HURA 3GTQB 1HFNA 1JICA 1EFID 4NP5A 3M7GA 4ZUJA 4LJZC 2EYLA 4S3SA 3A54A 1NR4A 2BE5D 1YNNC 4TRDA 1K8MA 4RWSC 1FYCA 2EY5A 2AUKA 4K5XA 2JA7B 1I4XA 5C0XH 2MPMA 4A3BB 4HSPA 4CJ0B 2M2LA 4GZYC 5CV7A 3D4DA 3J80L 5BN3A 5C3WA 1EEFD 4ODGA 2F0PA 4FVMA 3T13A 4RGOS 3C1EA 5M3MB 3GTJB 3HOVB 1TVXA 2AQ1B 4Q0FA 4HSVA 1TU2B 3DWPA 2WP8J 2R93B 2XRQD 4R8IA 2F0UA 2H4OA 3Q6SA 3BG3A 2B2TA 2H1EA 3BDCA 1MBYA 3A8IE 2B2VC 5EPJA 2DY7A 1TWCB 1H9JA 3PUYA 2F0IA 2SOBA 5IGFA 3I8ZA 1AZPA 1LLRD 1GUTA 4ZUIA 4J8QA 5C5LA 3PUZA 5I6YA 3MA2B 2F0VA 1RD9D 3TDQA 1II3A 1SNPA 5EKIA 5ELBA 1RDPD 4R8NA 1OXUA 1A3TA 3MXUA 5FO8B 3SDZA 5KNDA 3URYA 1XX8A 3KUPA 3S14B 3TBIB 1SBBB 2CW0C 1RHPA 5J1ZA 3ND8A 4R9WA 2BA1A 4DU9A 4DAPA 4ULLA 5EGTA 1SE2A 2E75C 3RZOB 2IX3A 4B9XA 1CA5A 3VYTA 1H9SA 4X3TA 3D6CA 3X3NA 1SNMA 1WTRA 1T5EA 4U673 2VB2X 4IUQA 1K83B 4YIJA 1PTOF 3SE0A 1ML0D 1Q3LA 5JJZA 2JEAI 3S2DB 4BY1B 1IKLA 1GUNA 1WTQA 4TQUS 5G3LF 5EBCA 4K14A 3TN2A 3NTKA 2ZXRA 2EY2A 4G7ZC 1TS3A 2KJXA 5EQ0A 4IZ8A 3M85A 1BR9A 1VDZA 3GO5A 1TWGB 3C2PA 3I70A 2K5QA 5M9OA 2B2WA 2Z1CA 2PW7A 4PNYA 5IGCA 1RCVD 3PO3B 3M4OB 1S4ZA 3AB9A 3MEHA 5JPMC 2PZTA 2TSSA 3GTKB 3ERQA 5I4DA 5IGBA 1TT2A 1D2BA 1TWHB 1G291 5KRUA 2MGSA 3VA5A 2ZXOA 5C3EB 1MSGA 4ZLTF 5EPKA 1SAPA 4ZYSA 3AU7A 2BCOA 2FMMA 3I4LA 5FK9C 2RA4A 4CJ2C 3PUVA 4RGTA 4DGZA 1D5MC 4KJOA 1HA5A 2GA4B 4C1NI 4RFBA 5C3XA 4C1NK 2K5DA 3V2TA 4CKBA 2VNUD 4QUFA 3QJYA 1Y8NB 2NVXB 3NPPA 3T16A 1EWHA 3BYYB 1F9SA 4PMWA 1HHVA 4HCEA 3EQLC 3PIO3 2M00A 3BVGA 1MD2D 1ZEQX 2YU9B 3DMUA 3RD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U68 A;  2RSN A;  1IKM A;  1BO0 A;  4XT3 B;  1B2T A;  3GV6 A;  1NCV A;  1O80 A;  2BDN A;  4HED A;  2X6G A;  4OIK A;  2KVM A;  1DOM A;  3F2U A;  1HA6 A;  2HUG A;  1J8I A;  1EIG A;  1EOT A;  1RTN A;  1MGS A;  3H91 A;  1U4M A;  2K01 A;  3KBX A;  4O42 A;  1SSO A;  2B2W C;  2HDM A;  2XIW A;  1S4Z A;  3FDT A;  4IUT A;  1C8C A;  4NW2 A;  3SVM A;  4HAE A;  4QUC A;  2K04 A;  4ZKB B;  3G7L A;  5CBE E;  1HUM A;  5EKI A;  1WTP A;  1HFN A;  1WTW A;  1JIC A;  1IL8 A;  1O7Y A;  4RA8 A;  2L9H A;  1HUN A;  1NR4 A;  1XYI A;  1WTO A;  1PFM A;  1ICW A;  1X3P A;  5D65 A;  3I90 A;  2MP1 A;  4X3K A;  3GV3 A;  1XX8 A;  2X6L A;  1NAP A;  3I91 A;  3KUP A;  4RWS C;  3DEP A;  5CMD A;  1WTV A;  2IL8 A;  2JP1 A;  1B50 A;  4XT1 B;  1WTX A;  2KEC A;  1SDF A;  1RTO A;  1RHP A;  1HRJ A;  1QNK A;  1EL0 A;  1MI2 A;  1U4P A;  1ROD A;  2J7Z A;  2KOL A;  1X3Q A;  1ZXT A;  2KED A;  2N55 A;  2MPM A;  2L12 A;  2MGS A;  2KUM A;  4X3U A;  2Q8T A;  3ONA B;  2B2Y A;  2EPB A;  1F9R A;  1O7Z A;  2EE1 A;  2KEE A;  2NWG A;  3HP3 A;  4R9W A;  1F9Q A;  4CJ0 B;  1J9O A;  2CVR A;  1B3A A;  3DM1 A;  1ILP A;  2Q8R E;  1PFB A;  1G91 A;  1BNZ A;  1G2T A;  1EIH A;  1ILQ A;  2M2L A;  1MSG A;  4HCS A;  1LV9 A;  2B2U A;  3FPU B;  5AFW A;  1GUW A;  5CBA E;  2K28 A;  4ZLT F;  1BF4 A;  4XDX A;  5EPK A;  1PDQ A;  1CA5 A;  2HCC A;  2B2V A;  1SAP A;  2RVL A;  3P7J A;  2B2T C;  1E0B A;  4IUV A;  3MWY W;  4X3S A;  1JE4 A;  2FFK B;  2JYO A;  4UAI A;  4X3T A;  2DY8 A;  2L4N A;  2FMM A;  3DEO A;  1ESR A;  1RJT A;  3MTS A;  4ZK9 B;  2RA4 A;  1WTR A;  2VXW A;  1M8A A;  1DON A;  4CJ2 C;  2L1B A;  1WVL A;  2HCI A;  3R93 A;  1DOL A;  2K05 A;  2HDL A;  4IUQ A;  2R3Z A;  1B4O A;  3IL8 A;  1AZQ A;  1X32 A;  2D9U A;  1TVX A;  1B53 A;  1QG7 A;  1BBX C;  2MJ8 A;  1EQT A;  1QE6 A;  4HSV A;  1ML0 D;  2N88 A;  1Q3L A;  1WD1 A;  2L11 A;  3UI2 A;  2B2Y C;  5JJZ A;  1F2L A;  4R8I A;  1IKL A;  4MHE A;  4QUF A;  3Q6S A;  1G2S A;  3D6W A;  3IFD A;  4IUR A;  1F9P A;  1WTQ A;  1G6Z A;  2EOT A;  2X69 A;  2B2T A;  3QO2 A;  4ZAI A;  2H1E A;  2NYZ D;  1KNA A;  1NR2 A;  1VMC A;  1DOK A;  1HFG A;  4ZKC B;  1F9S A;  1VMP A;  2K1B A;  4IUU A;  5COY A;  1HHV A;  1CM9 A;  1U4L A;  2B2V C;  1U4R A;  1MSH A;  2FJ2 A;  4OIJ A;  4RAU C;  5D14 A;  1A15 A;  3TN2 A;  5EPJ A;  1WD0 A;  4CJ1 B;  2NZ1 D;  5E4X A;  2FIN B;  1KNE A;  1DZ1 A;  2DY7 A;  2FHT A;  3N52 A;  4IUP A;  5DNF A;  5EQ0 A;  1PLF A;  2K03 A;  2RSO A;  5E4W C;  5T1G A;  5EJW A;  5COR A;  3I8Z A;  5EPL A;  5T1I A;  1AZP A;  1AP0 A;  3LWE A;  3I3C A;  4MN3 A;  3TZD A;  1PFN A;  2B2U C;  1CA6 A;  2SDF A;  4LMQ D;  4DN4 M;  2B2W A; 
#chains in the Genus database with same CATH topology
 1VQ9 A;  4A4I A;  5JPN C;  1D8L A;  2VL6 A;  3T1Y Q;  1R4P B;  4DV4 Q;  4JI5 Q;  1SE4 A;  4A3D H;  3H3V I;  2B8F A;  4X66 Q;  3N6R A;  1B8A A;  2A6E C;  4B3R L;  2EYO A;  1GD7 A;  4K2K A;  4JOI C;  1PTO B;  2OTJ A;  3H0G G;  3I4O A;  4WOR A;  1BBX C;  1K8O A;  4BBR B;  4EGV A;  5IYD G;  3OIP A;  3ULJ A;  4JOI A;  1Y1V H;  3A5Z B;  3VYU A;  2F0F A;  2JA7 H;  5C4J B;  2I46 A;  3S2H B;  2EXD A;  3S1R H;  1TS2 A;  3CU7 A;  3DM1 A;  4A3F G;  1X54 A;  4PMB A;  1EZ6 A;  2MFI A;  3T56 B;  4P71 A;  1VQH A;  3FPU B;  4HMI A;  4PV1 C;  3CMA A;  2E2I B;  2PZU A;  2BDO A;  1E0B A;  5H1S E;  4A3M H;  4KHP Q;  3DHQ A;  2C35 B;  1A63 A;  4LFB Q;  4KLK A;  4KY6 A;  1VS0 A;  3QR8 A;  2JA7 G;  1KTK A;  2K05 A;  2JXM B;  1LYL A;  1B4O A;  1G8Z D;  1EEI D;  1X32 A;  4AQY L;  4DPG A;  3MXG A;  2N49 A;  4UY8 C;  2VQF L;  2ZJR A;  2QF7 A;  1TS4 A;  1H95 A;  4L5T A;  2B2Y C;  4NPS A;  1Y1V B;  1IW7 D;  4UP7 A;  1VQ5 A;  3J81 i;  2E2J B;  3CHB D;  4QMG A;  1VF5 C;  4IFD H;  5FKA C;  1AE2 A;  3RMH A;  4FF3 A;  2R92 B;  1NTG A;  2Q8I B;  3BZK A;  1E2Z A;  1C0A A;  1JT8 A;  2EJG C;  4M8A A;  3SK5 A;  4GNX B;  5ELE A;  2NZ1 D;  2K7V A;  2FIN B;  2R6G A;  3GTO B;  1HJP A;  4A3D B;  3MFG A;  5COR A;  4C2M B;  3KLR A;  3ER0 A;  1TXY A;  2A19 A;  1XMO L;  4YHH L;  1OXX K;  1VQ7 A;  1JOR A;  5JVG 3;  4XQJ A;  3MHB A;  4OX9 L;  2E76 C;  3SGI A;  4ID6 A;  2KVM A;  4RCO A;  1LTS D;  1E2V A;  1EIG A;  1GOZ A;  1RTN A;  1TR5 A;  3S2D H;  2F0G A;  1S5D D;  2JA6 B;  1PRT D;  2M9V A;  4O42 A;  3EN2 A;  4NW2 A;  2MUY A;  4X66 L;  2K04 A;  5CBE E;  5M3F G;  1B44 D;  2OF1 A;  2R93 H;  3RN2 A;  3HKZ E;  1CQF A;  1L0X B;  2IX0 A;  1Y14 B;  1B9M A;  2Q2H A;  5CGK A;  1SE3 A;  1E1O A;  4OL7 A;  5M3M H;  3S9W A;  1EY0 A;  1EQR A;  3LWU A;  2EJF C;  1STG A;  4DR7 L;  4PZ8 A;  5E1F A;  1C48 A;  1BBW A;  1O7I A;  1PHJ A;  2E5L L;  3GDE A;  3CCR A;  4DUZ Q;  1XTC D;  4WJW A;  1ENF A;  2Q8T A;  3HOX G;  1N33 L;  1S5C D;  2JJQ A;  2NWG A;  2RKS A;  3HG9 A;  2F0T A;  3GTQ H;  4Y7N H;  1PFB A;  5L37 A;  3NQI A;  3V05 A;  1YI2 A;  3FPP A;  2HHH Q;  1B70 B;  3VYR A;  4LAA A;  3NE5 B;  1SJE D;  2CQO A;  4XQN A;  1EYA A;  4XDX A;  3E9I A;  3TP6 A;  2KEN A;  1L1O A;  4LFA L;  1S5B D;  3S1M H;  1HA6 A;  2RQX A;  4OX9 Q;  2R7Z H;  4UAI A;  3M3Y B;  1SEB D;  2E2D C;  4EX5 A;  4A3E G;  1EUJ A;  5CV5 A;  2E5L Q;  2BA0 A;  4HR7 B;  3PIO A;  5M3F B;  4JCV E;  2N3S A;  1STH A;  3NTI A;  4BWG B;  5EKL A;  4I7Z C;  5ELD A;  3HOX H;  3NTH A;  1SNO A;  1KC8 C;  3PO2 H;  3K80 C;  1QE6 A;  1UUP A;  2YTY A;  3F1Z A;  4Q5V A;  4NKL A;  3UI2 A;  4KKT A;  1EY7 A;  4J15 A;  1EWC A;  1KDB A;  4YCW A;  2OCE A;  2DJF C;  5GQO A;  1NR2 A;  3NEL A;  1U5K A;  3EA6 A;  4CGY B;  1EQV A;  3HOY G;  4LF4 L;  1CM9 A;  1OXT A;  2Z6K A;  4POG A;  1N32 L;  1MSH A;  4QF4 A;  2VQF Q;  3S1R B;  2F52 A;  2CHB D;  1Q7Y C;  1D7Q A;  3KBG A;  1SMX A;  2QW7 A;  1JQY D;  3H0G B;  4KHV A;  4A3K H;  4H13 C;  2UU9 L;  1PH7 A;  3S1Q B;  4KKS A;  3VR2 A;  2WB1 E;  4P2C B;  3NWS A;  3GQB A;  1N8R C;  2LY7 A;  3DUZ A;  3K5N A;  2L5T A;  3BDL A;  4A3K G;  1XJV A;  3HOU H;  3HOZ H;  2BDN A;  3IAY A;  1FNV A;  3TP7 A;  1HR0 L;  2HUG A;  2B63 B;  5ELC A;  4A3G B;  3HOV G;  4I7A A;  2LXJ A;  1XPR A;  4R4Q A;  2F03 A;  1PXU A;  1EY6 A;  3GTG B;  3PQI A;  3WDN A;  2QKI C;  1GHK A;  1UWV A;  2UUC Q;  4IFD I;  4YHH Q;  1IL8 A;  2OT2 A;  1X6O A;  3CXC A;  3U4Z A;  3T1H Q;  1KAB A;  3KLW A;  4RHS A;  2JP1 A;  3J7Y W;  1P8L A;  2IT1 A;  3BZD B;  4DXG A;  4ILW A;  5JJI A;  1IYJ B;  1ONL A;  4A3G H;  3QWN A;  2ENB A;  2PMZ E;  2I0Q A;  2JA9 A;  2EYM A;  2KCN A;  4X3U A;  4X65 L;  4R4I A;  4ZQ3 A;  4AIM A;  1FGB D;  3CQZ H;  3CW2 C;  3R2I A;  1CSQ A;  1EIH A;  1WCM B;  4DR6 L;  3Q24 A;  5C4X B;  2UXC Q;  4DXF A;  2B2V A;  5A35 A;  4K5V A;  5IWA Q;  1LTI D;  1M8A A;  1O7L A;  3HOW G;  1QB5 D;  3DM3 A;  1ASY A;  3H94 A;  2A68 D;  2B8G A;  1LTR D;  3FMC A;  1QG7 A;  4XTC S;  5FOB B;  4X64 Q;  4MNO A;  4A3M B;  1KQS A;  3HS0 C;  1CZG A;  3LX0 A;  2JA8 G;  4B3R Q;  3OWF A;  2MO0 A;  3BZC A;  2PQA A;  3V96 A;  4MHE A;  3HKS A;  1EU3 A;  4H7B A;  3PO2 B;  1N9W A;  5IOD A;  3RZD H;  5DAU A;  5LMN Q;  4DNI A;  4A3J B;  4OWT B;  4IUU A;  4KK7 A;  3VR4 A;  3P1H A;  4AYB B;  4GN3 B;  1Q46 A;  1FJG L;  3DXJ C;  4HIO A;  3CPW A;  1SNC A;  1PRT F;  1AP0 A;  5HGQ A;  4C3I B;  1LTB D;  3U50 C;  5KYL A;  3SXH A;  3BDO A;  2K6A A;  1TS5 A;  1BDO A;  3S1N B;  3F2U A;  4NXN L;  3T51 B;  3ZYY X;  1WOC A;  4DV4 L;  1PVO A;  1SSO A;  2B2W C;  3ERO A;  1C8C A;  1I6H B;  3L3O C;  1QNU A;  4XYQ A;  1W6K A;  5C4X H;  4ZKB B;  1WI5 A;  1EWI A;  2WII B;  1O7Y A;  2F0N A;  1ICW A;  4TSS A;  3VR5 A;  1CQV A;  2X6L A;  4DAM A;  1EYC A;  2JEB I;  2NVY B;  4A93 G;  2L12 A;  2TMP A;  1F9R A;  1O7Z A;  2KEE A;  1G2T A;  3GTJ H;  4IO9 A;  3SEB A;  4WRD A;  3TS2 A;  1Y1W B;  1KHI A;  1IBK L;  2CWP A;  4LF8 L;  4CDD C;  4FNF A;  1JWS D;  4JI0 L;  1I4P A;  4CDF C;  3L2P A;  1BF4 A;  1KIX A;  4UPA A;  2K5H A;  3GTO H;  4IQZ A;  1V1O A;  2B2T C;  1IZ6 A;  3I73 A;  4MZ9 A;  4JI1 L;  4JV5 Q;  2K32 A;  4A3C H;  3I4M G;  4R1J A;  2V4D A;  4A93 H;  4BXX G;  1LUZ A;  1W6J A;  1S5F D;  2AQ2 B;  3NP8 A;  1QUQ A;  2N88 A;  4HJ8 A;  1DD2 A;  2I5H A;  3K5L A;  2L11 A;  5FJ8 H;  1YNJ D;  4WJ4 A;  4XQQ A;  2I5L X;  4A3I B;  1UNS A;  3KF6 A;  3E3X A;  1I6H H;  5EBD A;  4BBS B;  4KI0 A;  2QCP X;  4ZAI A;  4CKE A;  1D6E C;  3KK7 A;  4ZKC B;  5GAD C;  1Y8O B;  4IFD J;  1TWF B;  2PCF B;  4X64 L;  2LSS A;  4RGM A;  1XWE A;  4IJH A;  2HQE A;  2NTS A;  5E4X A;  1GVP A;  1FJG Q;  2ASB A;  2K03 A;  5K36 G;  1XNR L;  4LF7 L;  3LNN A;  2F3W A;  5J3B A;  3LWE A;  4MN3 A;  1BCP F;  3TSS A;  1CA6 A;  4CBV A;  1CI3 M;  4LMQ D;  5GRO A;  2PYK A;  2UXC L;  3PIP 3;  2F0K A;  3OW2 A;  5IP9 H;  2JA5 G;  1RF2 D;  2UUB L;  2JA6 G;  1HNW L;  3W5O A;  3M4P A;  3RZD B;  1U4M A;  2A69 C;  4PZ7 A;  3T1Y L;  1CT1 D;  1MJC A;  2HDM A;  3FDT A;  3M3Y H;  4BA2 I;  2F4V L;  4FXD A;  4JYA Q;  1QVF A;  4K2L A;  5C4H A;  3A5U A;  1WTP A;  2EY1 A;  2VUM H;  1SJH D;  4RA8 A;  2L9H A;  3KF6 B;  5IGE A;  1UEB A;  3R2T A;  2KA7 A;  4JI1 Q;  5I2X A;  4JV5 L;  1A2T A;  1YBY A;  1MKH A;  2NVQ B;  1B50 A;  3W1B A;  3NBH B;  1RTO A;  2D0P A;  1Z6H A;  3U9O A;  3I7F A;  1X3Q A;  4LF4 Q;  1ZXT A;  4K0K Q;  1PH9 A;  1VQP A;  1YVC A;  4IUN A;  3NXW A;  3TP8 A;  2B63 G;  5KEE A;  1W3S A;  1J5E Q;  3CCS A;  4DR5 L;  4L5S A;  2AWO A;  1SRO A;  3TME A;  1HQM C;  5AFW A;  5CBA E;  1UE6 A;  3STB C;  4L8J A;  2RVL A;  1I4G A;  4IUV A;  2JYO A;  3PMF A;  1LT4 D;  3HOZ B;  2Z4I A;  1B3Q A;  4OON A;  4UP8 A;  5I9P A;  4A3F B;  2VXW A;  1WJJ A;  2LMC B;  4GNX C;  1QVC A;  4X62 Q;  2WAQ B;  1HZB A;  2NUC A;  1NSN S;  4JG2 A;  2MJ8 A;  1N32 Q;  3MXP A;  4IPD A;  1BQQ T;  5FLX c;  2R61 A;  2XNA C;  5AJ3 Q;  4JI3 L;  2NB0 A;  3D6W A;  4HTH A;  4LF5 L;  4RKL A;  3QOL A;  2WFW A;  4FP5 D;  2EOT A;  2IW3 A;  1NUC A;  3QO2 A;  2PPB C;  2UUC L;  2FJ2 A;  1LO5 D;  3TEH B;  3GP7 A;  3S16 H;  5CV9 A;  1D5Z C;  2XN9 C;  1HPC A;  1GJX A;  1PLF A;  4BXX H;  1DGS A;  1BCP B;  5G3L D;  3H09 A;  4QCL A;  1AEX A;  3HOZ G;  5M5X H;  3S15 H;  2JA8 B;  1VQE A;  3UDX A;  2N8N A;  5IYC G;  1O80 A;  4GOP B;  2LS0 1;  3HRZ C;  1PH1 A;  5IGG A;  1TWA B;  3RLF A;  3VDY A;  1J5E L;  1TWH H;  3E9H A;  2E74 C;  2NN6 H;  5D3I B;  4KMU C;  1Q90 A;  1R9T H;  2Q2U A;  5M5W B;  4GKJ Q;  2EIF A;  1NMG A;  1Z7T A;  5LMN W;  1FNW A;  4CDC C;  3NK9 A;  1YNJ C;  2D62 A;  5IWA L;  1GM5 A;  3GV3 A;  5CMD A;  4ME5 A;  1WTV A;  2R7F A;  2ICI A;  4BA1 I;  2XGT A;  2IL8 A;  3HGB A;  3DLL A;  4YWK A;  1E22 A;  3AEV A;  3HOU G;  2A73 B;  5BR8 L;  3M4O H;  4DR3 Q;  4OO1 H;  1EYD A;  3VR3 A;  2NZH A;  3S1M B;  1Q86 C;  2A6H D;  4BS9 A;  4GLA C;  2CQA A;  3HP3 A;  4DV3 L;  1GUW A;  1GXD C;  2EXZ A;  2Z8L A;  4Z9C B;  1S5E D;  4C3J H;  2QEX A;  3S17 B;  1VQB A;  4M1U B;  4JI6 L;  2SNS A;  4JBW A;  4PG3 A;  1PDQ A;  4HMJ A;  3P7J A;  3O13 A;  4C3J G;  1YNN D;  2B29 A;  2DY8 A;  3D0F A;  3ND9 A;  4L5R C;  1A62 A;  4DAY A;  2D0O A;  2F0J A;  3PUX A;  4IAL A;  2C5C A;  2JSO A;  1HZA A;  1NMF A;  1R4Q B;  2D9U A;  5JJL A;  1C4Q A;  2F3V A;  1L2F A;  1Q1B A;  1KDA A;  3BJU A;  4DV0 L;  1X9N A;  2O5J C;  3T53 B;  5FLM H;  2FMC A;  3PO2 G;  2IX1 A;  2B63 H;  3OOC A;  3K7A B;  3J81 L;  3CC7 A;  3ITP A;  4K8I A;  4DKA C;  2JA6 H;  3J80 c;  3SK8 A;  1V43 A;  2NYZ D;  4X6A H;  3NSW A;  2A74 C;  2ZM6 Q;  1BBU A;  1AFP A;  1GHJ A;  2K50 A;  2Z4H A;  1NJI C;  2R7Z G;  1A15 A;  4A75 A;  4CJ1 B;  2PO4 A;  3I4M B;  1ET6 A;  4DV2 L;  2CKZ B;  2FHT A;  4C2M H;  4JI3 Q;  5LL6 S;  1C9O A;  3RZO H;  2O4X A;  3FKI G;  2NVQ H;  3CRK C;  3U9S A;  4KHP L;  5IP7 G;  1VQO A;  4WFN 3;  1IYV A;  2QDB A;  3RUZ A;  3GV6 A;  3J7A V;  1U0L A;  1VQM A;  4UDU C;  2KCM A;  3E5S A;  3G6E A;  1QJO A;  3C1F A;  3X3M A;  1S40 A;  1YJW A;  3PGZ A;  5J39 A;  1SYB A;  3AMU A;  4UP9 A;  3HOX B;  2PZW A;  5M5Y H;  4UHV A;  4A3G G;  5CV6 A;  2VB3 X;  4R4O A;  4F7X A;  2SEB D;  4IFD G;  3I90 A;  1HQR D;  2ZT9 C;  3I91 A;  4X3K A;  4JI7 Q;  3GTL H;  4KN7 C;  4XXE A;  4DR1 L;  1VQI A;  1X65 A;  3OSO A;  1ROD A;  4DR2 Q;  1PTO D;  4B3M Q;  1CTM A;  2Z6K C;  3L0O A;  2AQ3 B;  3S24 A;  3R3O A;  2CH4 W;  1TWF H;  1LAC A;  3GTK H;  5C44 B;  4AYB E;  3KOJ A;  1EY5 A;  1O78 A;  4O2D A;  1Q81 C;  4KD3 A;  4BBS H;  1I94 L;  3F8T A;  1K0R A;  3D3R A;  1I4H A;  1BXT A;  4A3C G;  3PO3 H;  1LTG D;  2G9D A;  1PYW D;  1IBL Q;  3JAM i;  1N36 L;  2EQS A;  3UDF A;  2HDL A;  4B08 A;  3PV0 A;  1JE5 A;  1I4Q A;  3HOY B;  2BOS A;  4A93 B;  4GN4 B;  2K75 A;  2F4V Q;  3QB3 A;  1I3Q B;  4QB4 A;  1EQT A;  1QZG A;  3EFX D;  1QZH A;  3SR1 A;  5IT9 E;  4V0B A;  1E1T A;  1VQD A;  3OPO A;  3CF5 A;  4DNR B;  3D4W A;  5CR3 A;  1IBM L;  4LF6 Q;  2RDH A;  4JI8 L;  3G71 A;  4LNQ A;  1YHQ A;  1UAP A;  3AFQ A;  3HOV H;  3OHX C;  5JEA H;  1KAA A;  4DV7 Q;  2ID0 A;  1G6P A;  4MIU A;  1DXM A;  5DLQ E;  2YU9 H;  2PI2 A;  4TVA B;  4HN7 A;  5EAY A;  1VF7 A;  2F0O A;  5DM6 3;  4EQ5 A;  5T1G A;  2NVY H;  5IYC H;  1EOV A;  1Q12 A;  3S17 H;  4F8M A;  4KHZ A;  1NE3 A;  4KV6 A;  4PMC A;  3TZD A;  1CK1 A;  2GVA A;  4P75 A;  1T9H A;  3HZX A;  3J7A F;  2RSN A;  4JVZ A;  3TZU A;  1KXL A;  2WIN B;  1EZ8 A;  1JB3 A;  1IBL L;  1J8I A;  5TSS A;  2VQE L;  1F77 A;  1JWU D;  3MFY A;  3H0G H;  5IE8 A;  4JBM A;  3SVM A;  4QUC A;  2QA4 A;  1DYQ A;  1HUM A;  1WTW A;  2UUA Q;  2HIX A;  1SYE A;  3ICE A;  3Q0A A;  4LF9 Q;  3J7A 5;  3CCV A;  2OQ0 A;  2A6H C;  1X3P A;  5K5P A;  4H02 A;  5M5W H;  3Q23 A;  3RN5 A;  1AW7 A;  2E2I H;  3KF8 B;  4HJ7 A;  4AYB G;  4R4C A;  2WB1 B;  1K3R A;  1HXY D;  3EIV A;  1PZJ D;  1L1O B;  1ET9 A;  1Y69 U;  3ONA B;  3VR6 A;  3NBH A;  1LT5 D;  2A68 C;  2EDG A;  5BN4 A;  1XPO A;  5KNC A;  1G91 A;  4QGU A;  1LV9 A;  2B2U A;  2NTT A;  4BBR G;  1UE5 A;  3K58 A;  4A3I G;  2RCF A;  4O1N A;  4BBR H;  4MTK A;  2UUB Q;  1HNW Q;  2YTV A;  1HNX Q;  4B9W A;  5IGD A;  4Y7N B;  3FRP B;  2QGQ A;  1VQF A;  4KKU A;  1DJR D;  4DK0 A;  4X65 Q;  1W2B A;  3PF5 A;  3UE0 A;  3HOW B;  3BYT B;  1WYD A;  2F0S A;  1I6V C;  3ULL A;  2WV6 D;  1F2L A;  4LUZ A;  3K6O A;  1F9P A;  1G6Z A;  1SYC A;  3CCU A;  3TRE A;  2Q2I A;  1KNA A;  2NN6 I;  2Y0S E;  1DOK A;  3J81 c;  2VS1 A;  1XTD A;  4DK1 A;  2RBM A;  3FEW X;  1T5X D;  2EYH A;  1YNX A;  3PO3 G;  2K33 A;  3VYS A;  2K5N A;  1ZYR C;  3N52 A;  3NBI A;  4QL5 A;  1JB7 A;  4G7O C;  5I6W A;  1MHW C;  2KHJ A;  4HJ9 A;  1PZI D;  1A3U A;  3HKZ B;  2B2U C;  4DN4 M;  1K8G A;  4JI7 L;  1IKM A;  1BO0 A;  2F0W A;  2HQL A;  4JI4 Q;  1IHZ A;  3I4N G;  4OIK A;  3KF8 A;  4DF7 A;  3I56 A;  1GUO A;  2K14 A;  1SFO H;  3H91 A;  3KLS A;  1CKM A;  1MGS A;  1JCK B;  3KDF B;  4IN3 A;  1JJ2 A;  4BY1 H;  1NY4 A;  4K8J A;  4LF8 Q;  3W2D A;  3JAM L;  1EY8 A;  4O0A A;  2AKW B;  4C3J B;  3GTM H;  1TKW B;  4G57 A;  4HJA A;  4XYO A;  4OGQ C;  4CKC A;  2VUM B;  2MP1 A;  3G48 A;  5ISR A;  1NAP A;  2ZJP A;  1WTX A;  1Q8K A;  2JN4 A;  1H9K A;  2KHS A;  4B3T Q;  4NXM L;  1AE3 A;  2RDG A;  3TS0 A;  1LT6 D;  2J7Z A;  3BVM A;  3K7U C;  5IT9 c;  2F0Q A;  1STB A;  3GTP B;  1FR3 A;  2EE1 A;  4A3J H;  2E2H B;  1E2W A;  1U9R A;  2N78 A;  1BNZ A;  1VCI A;  3PCO B;  3A8K E;  5C6A A;  1ILQ A;  2EYP A;  4HCS A;  2ES2 A;  4GN5 A;  2CCZ A;  2I07 B;  4GKJ L;  2O5I C;  1F2Y A;  3CC4 A;  3F2D A;  2JA5 B;  2HCC A;  2LFN A;  3K59 A;  1SYG A;  1JE4 A;  1BUV T;  1EY9 A;  3M9B A;  3Q8D A;  1AH9 A;  1RJT A;  4NXN Q;  1NBW A;  4FDB A;  4B3S L;  3R8B A;  5LL6 X;  3GTL B;  5C0X I;  2R3Z A;  1BCP D;  4L5Q A;  1VQ4 A;  1N33 Q;  4EQO A;  2ALY B;  4KTA A;  4DUZ L;  2A6E D;  3U4V A;  2H5X A;  4DAY B;  1A6X A;  2JQO A;  2B3G A;  1VQG A;  3FHW A;  4RKB A;  2HIV A;  1XNQ L;  2NBF A;  4LWC A;  2QEJ C;  1QOH A;  2X69 A;  4OHJ A;  4JI6 Q;  3DWQ A;  3M7N A;  5J22 A;  2A5H A;  5CYU A;  1JJG A;  3NWT A;  3KYH C;  3UDI A;  4OIJ A;  5D14 A;  5IIF A;  2KQ3 A;  3G6J B;  1B9N A;  4L63 B;  4B3M L;  3WOF A;  1ENA A;  5E4W C;  4MTN A;  4DV0 Q;  2P5Z X;  3I3C A;  4IOC A;  1X55 A;  3K5M A;  4ZRZ A;  2QIL A;  1Y8P B;  1M90 C;  4C3H H;  3Q22 A;  1YHA A;  1MIU A;  3K5O A;  4A3F H;  1JR0 D;  4IPG A;  1FNU A;  1PYS B;  5C44 G;  1V8Q A;  4LUO A;  5JEA J;  2F0D A;  2L0C A;  3EBE A;  1PMR A;  4TKO B;  4ZCK A;  1D1K A;  4E6I A;  2YV5 A;  3HOY H;  4OO1 G;  5IYD H;  2G9H D;  5CV4 A;  4GKK Q;  4RH6 A;  1XYI A;  1SYF A;  4NB3 A;  3QOJ A;  2DUD A;  3CP0 A;  5DNF A;  4C3H B;  4A3K B;  4FXG C;  2R93 G;  1OXV A;  2F1M A;  4LFA Q;  3J80 E;  2KEC A;  1XXG A;  1TII D;  3FP9 A;  1KL9 A;  4RGN A;  4CHT B;  4DV1 Q;  4B3S Q;  4FF2 A;  1ZKO A;  2GVB A;  1QVG A;  3I72 A;  2B2Y A;  5GAH C;  5C44 H;  1GUG A;  2CVR A;  2J4X A;  2F3I A;  2OXP A;  2Q8R E;  2MNA A;  1IL2 A;  5C4X G;  1R9T B;  2EZV A;  4DNT B;  1KRS A;  2YTX A;  2LKV A;  4A3E H;  3CCQ A;  4DR6 Q;  3MAQ A;  1HH2 P;  1SYD A;  2K28 A;  3L7Z C;  1XNQ Q;  4DAV A;  3K8A A;  2NVT B;  2GN5 A;  1A0I A;  3S14 H;  1ESR A;  4H44 C;  1I5F A;  3M4Q A;  5F2D A;  2PNR C;  2WKD A;  4ZK9 B;  4DK6 C;  1FD7 D;  1IYU A;  1DON A;  3NQT A;  1F2M A;  2HT1 A;  3W3A A;  1X3G A;  2IJ0 A;  3J81 E;  4DV2 Q;  2R7Z B;  1UEA B;  2ZXP A;  2NVT H;  2UXB L;  1ZYR D;  4NDX A;  2EJM A;  4LW1 A;  4EQN A;  1XNR Q;  5JEA G;  4A3J G;  4HID A;  1A8V A;  1I50 B;  4GLV B;  4LFC Q;  3A56 A;  2IWH A;  1DCZ A;  4IPC A;  4YWL A;  5COY A;  2NN6 G;  4A3L G;  5HGT A;  5KYI A;  1PTO C;  5A2Q L;  1PFS A;  3BS1 A;  5C5M A;  2AWN A;  1L0W A;  1CHP D;  1QIL A;  4IUP A;  5AJ3 L;  5LMU L;  5DM7 3;  3MC0 B;  5E3F A;  5EPL A;  1WCM H;  1TQO A;  1B1Z A;  1PFN A;  3FVQ A;  3IFT A;  3S16 B;  3HEJ A;  3FKI H;  4U68 A;  1PTO H;  1BCP C;  1OXS C;  3AYH B;  5EKK A;  3A74 A;  5BN5 A;  3K7A H;  4RHR A;  3WOE A;  1DOM A;  3E6Z X;  2PNH A;  2K01 A;  1D5X C;  2XIW A;  4IUT A;  2B39 A;  4BY7 G;  3G7L A;  2CWA A;  1E24 A;  2OQK A;  1SXT A;  2Z6B A;  4IOA A;  1CUK A;  4N9P A;  1STY A;  2ZTE A;  2Y0S B;  3TP5 A;  1WTO A;  1PFM A;  5D65 A;  4B3T L;  2FXQ A;  4GNX A;  4JPB W;  3A0J A;  3CD6 A;  3GTG H;  4KY5 A;  4XT1 B;  3HKZ G;  1NNX A;  1HRJ A;  1QNK A;  1PRT C;  3IRB A;  3EJI A;  3K0Y A;  2I5M X;  3SHL A;  3DWA A;  4QIW B;  1SMY C;  2AUJ D;  3NHH A;  1K83 H;  4DFA A;  4F88 A;  1ESF A;  2PMZ B;  2EYF A;  2NVX H;  3PF4 A;  1LAB A;  3OIQ A;  2ICE C;  4DR5 Q;  3CRL C;  2D5D A;  4R4T A;  3MVV A;  5I9O A;  2BH8 A;  2L15 A;  5IP7 H;  5IOC A;  5IT9 L;  2F4I A;  3RLN A;  2L4N A;  3DEO A;  1I4R A;  3ZJY C;  3A7A B;  1KDC A;  1KRT A;  1OO9 B;  2DNE A;  3S1N H;  4K0K L;  3JC6 6;  4BY7 B;  2DN8 A;  4GOP A;  5C3E G;  2XSC A;  1UE1 A;  3R93 A;  3TRZ A;  1CZW A;  4OO1 I;  1G51 A;  2YYZ A;  4ABN A;  2XVS A;  2CW0 D;  1PZK D;  2IPK D;  3CKI B;  4GOP C;  1H9M A;  2OEO A;  4J1M A;  3MZ5 A;  5GAG C;  1EIF A;  2PQA B;  5DEH A;  1LTT D;  1B7Y B;  1G2S A;  4IUR A;  4DV6 L;  3AFP A;  1STN A;  4C3I G;  2EVB A;  3K0X A;  4K5W A;  5FO9 B;  1JOK A;  4RG1 A;  5KIX A;  5M5X B;  3S15 B;  1PH6 A;  5FLM G;  3CCM A;  4HIM A;  1VMP A;  1STE A;  2Z9H A;  5ELF A;  5M5Y B;  1U4R A;  1TY0 A;  4NMZ A;  1SMY D;  5C3E H;  3CAM A;  1J6Q A;  2WKC A;  4JW0 A;  5KNB A;  1HCZ A;  2DJG C;  3GD7 A;  5EJW A;  1XPU A;  1VQJ A;  1D1I A;  4A3E B;  1V1P B;  3MEF A;  1AN8 A;  4FF1 A;  1DM0 B;  2F0H A;  4KD4 A;  5FO7 B;  4KY7 A;  1Y1W G;  2XWB B;  1H9R A;  3H6M A;  1BKB A;  2O2L D;  1EY4 A;  2G5D A;  3D8G A;  5A2Q E;  5JJK A;  2E8G A;  4DA2 A;  2MO1 A;  1PYB A;  2F0M A;  4JYA L;  4RCN A;  4FXK C;  2F0L A;  1SR3 A;  5C0X G;  4PQX A;  4XIG S;  2D2C C;  2VUM G;  3W1G A;  1Z47 A;  3OMC A;  4YY3 Q;  5FJ8 G;  1V1Q A;  2XRS D;  3DEP A;  5FLX L;  1SDF A;  5CV8 A;  1N36 Q;  1EL0 A;  1MI2 A;  2KOL A;  1PH5 A;  3K57 A;  1LM0 A;  1EQQ A;  3OW7 A;  2KUM A;  3D31 A;  5IP9 G;  3IKJ A;  1HNZ L;  4FYD A;  4DUY Q;  1F9Q A;  4DV5 L;  1M4V A;  1ILP A;  5E7N A;  4V19 0;  4KJN A;  1FVI A;  3D4R A;  4P72 A;  5LMN L;  2CFM A;  4K6D A;  5FLX E;  3JAM c;  1IBK Q;  4JI8 Q;  3HOW H;  4X3S A;  1JWM D;  4G4K A;  2VW9 A;  4KN4 C;  1Q82 C;  2FFK B;  3PIP A;  2RDF A;  1UE7 A;  5I2Y A;  1A2U A;  4J6H A;  1STA A;  2L1B A;  1WVL A;  2HCI A;  3KFU A;  1DOL A;  3HOU B;  3EVQ A;  1H9S B;  1L0Y B;  3IL8 A;  4EVO A;  2PW5 A;  1QCB D;  4G7H C;  1B53 A;  2AHO B;  4A3B H;  2PQE A;  1QUQ B;  1BOS A;  3SK4 A;  2J0T D;  1HTP A;  1LT3 D;  2BE5 C;  3OWE B;  4APV A;  1JOQ A;  1CKN B;  4DV6 Q;  4L6T B;  4Y52 H;  1X3F A;  4C56 C;  1RKN A;  5C0X J;  4YY3 L;  2VQE Q;  1HFG A;  1IW7 C;  3H3V C;  4EQP A;  4GS3 A;  1XMQ L;  3WWV A;  1DZ1 A;  4P73 A;  1YZ6 A;  1XMQ Q;  4C3H G;  3OTO L;  2RSO A;  3F2B A;  3QG1 A;  1TWA H;  4LK1 C;  5LMU Q;  3SK6 A;  1CFM A;  2A1A A;  3E0E A;  1YIT A;  4DK3 C;  4A3L H;  2MQH A;  4FF4 A;  5LHY 1;  2UUA L;  3K81 C;  2E2H H;  4XT3 B;  1B2T A;  3GTP H;  2SNM A;  5K36 H;  1NCV A;  2X6G A;  4A3I H;  1TY2 A;  5C4J H;  4DV7 L;  3CPF A;  2K5W A;  2KCC A;  1EIY B;  2JE6 I;  2A69 D;  1Q8I A;  1OTC A;  2Z0S A;  3RNU A;  3I55 A;  1JOO A;  4OEM B;  1YJN A;  1SNQ A;  3GTM B;  1HUN A;  1IXR A;  3CCJ A;  2XWJ B;  2HD3 A;  1RL2 A;  4JK1 C;  1Y1V G;  1VQA A;  2F0E A;  2WAC A;  5JVH 3;  5C4Z A;  4BY7 H;  4FO2 A;  4K6L A;  3P75 A;  1U4P A;  1SFO B;  1V9P A;  2KED A;  2N55 A;  2Q2T A;  1Y1W H;  2L55 A;  2R92 G;  3MXN A;  2EPB A;  2EYJ A;  1ENC A;  1SND A;  1J9O A;  1B3A A;  2CH4 A;  1EU4 A;  3UE1 A;  3E0J A;  4BY1 G;  3CQZ B;  3KLS X;  3I4N B;  2DNC A;  2UXB Q;  1Q1E A;  1CKN A;  2RHS B;  4LF5 Q;  3MWY W;  5T1I A;  3FKI B;  2C9O A;  3MTS A;  1HR0 Q;  5M3M G;  4H0L C;  1ICF B;  3P20 A;  5BR8 Q;  3A7L A;  3S1Q H;  1GUS A;  1JC7 A;  1AZQ A;  3A55 A;  4YCU A;  1QWY A;  4HIK A;  2XTI A;  1CHQ D;  3QIA A;  1V1P A;  5JAV A;  3OMG A;  1PV4 A;  3NEM A;  2EY6 A;  1WD1 A;  4I65 A;  3L9A X;  1HTL D;  1F2Z A;  4A76 A;  3C3L A;  3VA7 A;  3A8J E;  3C46 A;  3ERS X;  3IFD A;  3JAM E;  3J81 j;  1VQL A;  5JOB A;  1VMC A;  2V1C C;  5ELN A;  2K1B A;  1S72 A;  3CCE A;  1EFW A;  3BVZ A;  4DR2 L;  3T4A C;  1U4L A;  1KLU D;  4RAU C;  4JI4 L;  1WD0 A;  1RIP A;  4DV3 Q;  2E2J H;  2NZO A;  1KNE A;  1A3V A;  3BU2 A;  3PUW A;  4JI2 L;  4QQB X;  1KLG D;  2UU9 Q;  4LF9 L;  4LUV A;  1P16 A;  1SN8 A;  1L1O C;  2UXD L;  3RD4 A;  5CC4 A;  2RF4 A;  1CKO A;  4LFC L;  5IYB G;  2OWO A;  4HED A;  5NUC A;  1PH4 A;  4F87 A;  4JBK A;  3NUC A;  4LFB L;  4N9T A;  1EOT A;  5D3D A;  3KBX A;  2MHV A;  5KGU A;  3STB D;  1I50 H;  3I2Z A;  3M4Y A;  2IY5 B;  1PRT B;  4HAE A;  1LTA D;  5HUR A;  3GTQ B;  1HFN A;  1JIC A;  1EFI D;  4NP5 A;  3M7G A;  4ZUJ A;  4LJZ C;  2EYL A;  3CC2 A;  3OYY A;  4S3S A;  3A54 A;  1NR4 A;  2BE5 D;  1MJE A;  1YNN C;  4TRD A;  4ALP A;  1K8M A;  4RWS C;  4DR1 Q;  1TWC H;  1FYC A;  5M3F H;  2EY5 A;  4X62 L;  3U58 A;  3I4M H;  2AUK A;  4K5X A;  2JA7 B;  1I4X A;  5C0X H;  2ZM6 L;  2MPM A;  4A3B B;  4HSP A;  1FL0 A;  2RHQ B;  4CJ0 B;  2WAQ E;  4QJF A;  2M2L A;  1GKH A;  2IHE A;  5CV7 A;  4GZY C;  3D4D A;  2KBN A;  4P74 A;  4POF A;  3J80 L;  5BN3 A;  5C3W A;  1EEF D;  4ODG A;  1EYG A;  4JI5 L;  2F0P A;  4ME3 A;  4FVM A;  2KCT A;  3T13 A;  4RGO S;  3C1E A;  5M3M B;  3GTJ B;  2OTL A;  1E3P A;  3HOV B;  1K0S A;  4N8X 1;  1KAW A;  1TVX A;  3KDF A;  1S3O A;  2AQ1 B;  4Q0F A;  1K73 C;  4HSV A;  1TU2 B;  3DWP A;  2WP8 J;  3J7Z C;  2R93 B;  2XRQ D;  3LGJ A;  4R8I A;  4OWX B;  4OWW B;  2F0U A;  2H4O A;  3Q6S A;  1K9M C;  5HY6 A;  3BG3 A;  3HFZ B;  1WTH A;  1HZ9 A;  4WJ3 M;  2B2T A;  4A3B G;  2H1E A;  3BDC A;  1K8A C;  1MBY A;  3A8I E;  1VQN A;  2B2V C;  4DR3 L;  5EPJ A;  3OTO Q;  1PH8 A;  1WFQ A;  2DY7 A;  1TWC B;  1H9J A;  3PUY A;  2F0I A;  2SOB A;  4N8F A;  4YCV A;  3I8Z A;  5IGF A;  1AZP A;  4GKK L;  4AQY Q;  1LLR D;  2K5V A;  1GUT A;  1K3B C;  4ZUI A;  1WCM G;  4J8Q A;  5C5L A;  3PUZ A;  5I6Y A;  3MA2 B;  1ASZ A;  2F0V A;  2R92 H;  2JA5 H;  3MXN B;  1RD9 D;  3TDQ A;  1M1K C;  1SLJ A;  1II3 A;  1SNP A;  2HHH L;  4DUY L;  2K4K A;  1PH3 A;  5EKI A;  5ELB A;  1RDP D;  3CME A;  4R8N A;  3F2C A;  2RCN A;  2JA8 H;  1OXU A;  1A3T A;  3MXU A;  5FO8 B;  3SDZ A;  1PA6 A;  5KND A;  3URY A;  1XX8 A;  3KUP A;  1XMO Q;  3S14 B;  3TBI B;  1SBB B;  3H15 A;  2CW0 C;  1RHP A;  2WAQ G;  1LTL A;  5J1Z A;  4JBJ A;  4OEL B;  3B6Y A;  3NEN A;  5IYB H;  3ND8 A;  4R9W A;  4AH6 A;  4DV5 Q;  2BA1 A;  4DU9 A;  4DAP A;  4ULL A;  5EGT A;  1SE8 A;  1YJ9 A;  1SE2 A;  3KJO A;  2E75 C;  3RZO B;  2IX3 A;  3TQY A;  4DV1 L;  4B9X A;  1CA5 A;  2QDL A;  3VYT A;  4OXP A;  3CCL A;  1H9S A;  2VY3 A;  4X3T A;  1VQ8 A;  3D6C A;  3X3N A;  1SNM A;  1WTR A;  2BH2 A;  1T5E A;  1HNX L;  2JK8 A;  4U67 3;  2VB2 X;  2LXK A;  4IUQ A;  1JJC B;  1VQK A;  1K83 B;  5GAE C;  4YIJ A;  1PTO F;  3SE0 A;  4HJ5 A;  1ML0 D;  2Y0S G;  1Q3L A;  5JJZ A;  2JEA I;  3S2D B;  3UDG A;  4BY1 B;  1IKL A;  1GUN A;  1WTQ A;  3ULP A;  1E7Z A;  4TQU S;  5G3L F;  5EBC A;  1N34 L;  2PI2 E;  4K14 A;  1VQC A;  2A8V A;  4A3M G;  3TN2 A;  3NTK A;  2ZXR A;  2EY2 A;  4PZ6 A;  4G7Z C;  1TS3 A;  2KJX A;  5EQ0 A;  2ZTC A;  4IZ8 A;  3M85 A;  2ZJQ A;  1BR9 A;  1VQ6 A;  2UXD Q;  4LF7 Q;  2IHF A;  1I3Q H;  1VDZ A;  3GO5 A;  5IY0 A;  4BBS G;  1TWG B;  4JI2 Q;  4JC0 A;  3C2P A;  3I70 A;  2K5Q A;  5M9O A;  2B2W A;  2Z1C A;  2PW7 A;  4PNY A;  4QIW E;  5IGC A;  3T1H L;  1HR0 W;  2ATW A;  1X56 A;  1FGU A;  1RCV D;  3PO3 B;  3J80 i;  4GLX A;  3M4O B;  1K28 A;  1S4Z A;  3AB9 A;  3MEH A;  5JPM C;  2WB1 G;  2R7D A;  3PSI A;  2PZT A;  1C7Y A;  2TSS A;  3RLO A;  1YEZ A;  3GTK B;  1YIJ A;  1X3E A;  4A3D G;  3ERQ A;  4DR7 Q;  4QY7 A;  5I4D A;  5IGB A;  4C3I H;  1TT2 A;  1D2B A;  1TWH B;  1G29 1;  5KRU A;  2K52 A;  4DR4 L;  1Z9F A;  2AMC B;  2MGS A;  3VA5 A;  3G4S A;  3KJP A;  1BVS A;  2ZXO A;  5C3E B;  1HNZ Q;  1IBM Q;  1MSG A;  3S2H H;  3AQQ A;  4CDE C;  1SRU A;  4ZLT F;  4NXM Q;  1GO3 E;  5EPK A;  1SAP A;  4ZYS A;  3AU7 A;  2BCO A;  2FMM A;  3I4L A;  5FK9 C;  4IJL A;  2RA4 A;  4DR4 Q;  4CJ2 C;  1TWG H;  3PUV A;  4RGT A;  4DGZ A;  1D5M C;  4KJO A;  1N34 Q;  1HA5 A;  2GA4 B;  4C1N I;  3H3V H;  4RFB A;  4YWM A;  2KHI A;  2ZTD A;  1I94 Q;  5C3X A;  4C1N K;  4JI0 Q;  2K5D A;  3V2T A;  4CKB A;  2VNU D;  4QUF A;  4LF6 L;  3QJY A;  1Y8N B;  2NVX B;  3NPP A;  3T16 A;  4RMF A;  1EWH A;  3BYY B;  1F9S A;  4PMW A;  2VZA A;  1HHV A;  4HCE A;  1KD1 C;  3EQL C;  1JMC A;  3RR5 A;  1CSP A;  3PIO 3;  2M00 A;  3BVG A;  1MD2 D;  5ELO A;  1PH2 A;  1ZEQ X;  3I4N H;  4IPH A;  1YHB A;  2DGY A;  2YU9 B;  1HZC A;  3DMU A;  2SDF A; 
#chains in the Genus database with same CATH homology
 5JPN C;  1R4P B;  1SE4 A;  2B8F A;  3N6R A;  2A6E C;  2EYO A;  4K2K A;  1PTO B;  4WOR A;  1K8O A;  1BBX C;  4BBR B;  4EGV A;  3OIP A;  3VYU A;  2F0F A;  5C4J B;  2I46 A;  3S2H B;  1TS2 A;  3CU7 A;  3DM1 A;  4PMB A;  1EZ6 A;  3T56 B;  3FPU B;  4HMI A;  4PV1 C;  2E2I B;  2PZU A;  2BDO A;  1E0B A;  3DHQ A;  4KY6 A;  1KTK A;  2K05 A;  2JXM B;  1B4O A;  1G8Z D;  1EEI D;  1X32 A;  3MXG A;  2QF7 A;  1TS4 A;  2B2Y C;  1Y1V B;  1IW7 D;  2E2J B;  3CHB D;  4QMG A;  1VF5 C;  4IFD H;  5FKA C;  3RMH A;  4FF3 A;  2R92 B;  2Q8I B;  1E2Z A;  2EJG C;  4M8A A;  3SK5 A;  5ELE A;  2NZ1 D;  2K7V A;  2FIN B;  2R6G A;  3GTO B;  4A3D B;  3MFG A;  5COR A;  4C2M B;  3KLR A;  1OXX K;  1JOR A;  5JVG 3;  4XQJ A;  3MHB A;  2E76 C;  4ID6 A;  2KVM A;  4RCO A;  1LTS D;  1E2V A;  1EIG A;  1GOZ A;  1TR5 A;  1RTN A;  2F0G A;  1S5D D;  2JA6 B;  1PRT D;  2M9V A;  4O42 A;  4NW2 A;  2MUY A;  2K04 A;  5CBE E;  1B44 D;  2OF1 A;  1CQF A;  1L0X B;  2IX0 A;  1B9M A;  5CGK A;  1SE3 A;  4OL7 A;  3S9W A;  1EY0 A;  3LWU A;  2EJF C;  1STG A;  5E1F A;  1C48 A;  1XTC D;  4WJW A;  1ENF A;  2Q8T A;  1S5C D;  2NWG A;  2RKS A;  3HG9 A;  2F0T A;  1PFB A;  3NQI A;  3V05 A;  3FPP A;  3VYR A;  4LAA A;  3NE5 B;  1SJE D;  4XQN A;  1EYA A;  4XDX A;  3TP6 A;  1S5B D;  1HA6 A;  2RQX A;  4UAI A;  3M3Y B;  1SEB D;  2E2D C;  5CV5 A;  2BA0 A;  4HR7 B;  5M3F B;  1STH A;  3NTI A;  4BWG B;  5EKL A;  4I7Z C;  5ELD A;  3NTH A;  1SNO A;  1QE6 A;  1UUP A;  4Q5V A;  4NKL A;  3UI2 A;  4KKT A;  1EY7 A;  1EWC A;  1KDB A;  1NR2 A;  3EA6 A;  4CGY B;  1EQV A;  1CM9 A;  1OXT A;  1MSH A;  4QF4 A;  3S1R B;  2CHB D;  3KBG A;  3H0G B;  1JQY D;  4KHV A;  4H13 C;  3S1Q B;  4KKS A;  3VR2 A;  4P2C B;  3NWS A;  3GQB A;  2LY7 A;  3DUZ A;  3K5N A;  2L5T A;  3BDL A;  2BDN A;  3IAY A;  1FNV A;  3TP7 A;  2HUG A;  2B63 B;  5ELC A;  4A3G B;  2F03 A;  1PXU A;  1EY6 A;  3GTG B;  3WDN A;  2QKI C;  1GHK A;  4IFD I;  1IL8 A;  2OT2 A;  1KAB A;  4RHS A;  2JP1 A;  3J7Y W;  2IT1 A;  3BZD B;  4DXG A;  4ILW A;  1ONL A;  3QWN A;  2ENB A;  2EYM A;  2KCN A;  4X3U A;  4ZQ3 A;  1FGB D;  3R2I A;  1EIH A;  1WCM B;  3Q24 A;  5C4X B;  4DXF A;  2B2V A;  5A35 A;  4K5V A;  1LTI D;  1M8A A;  1O7L A;  1QB5 D;  3H94 A;  2A68 D;  2B8G A;  1LTR D;  3FMC A;  1QG7 A;  4XTC S;  5FOB B;  4A3M B;  3HS0 C;  1CZG A;  3LX0 A;  3OWF A;  3V96 A;  4MHE A;  1EU3 A;  4H7B A;  3PO2 B;  5IOD A;  5DAU A;  4A3J B;  4IUU A;  4KK7 A;  3VR4 A;  3P1H A;  4AYB B;  3DXJ C;  1SNC A;  1PRT F;  1AP0 A;  4C3I B;  1LTB D;  5KYL A;  3SXH A;  3BDO A;  2K6A A;  1TS5 A;  1BDO A;  3S1N B;  3F2U A;  3T51 B;  3ZYY X;  1SSO A;  2B2W C;  3ERO A;  1C8C A;  1I6H B;  3L3O C;  1QNU A;  4XYQ A;  1W6K A;  4ZKB B;  2WII B;  1O7Y A;  2F0N A;  1ICW A;  4TSS A;  3VR5 A;  1CQV A;  2X6L A;  1EYC A;  2JEB I;  2NVY B;  2L12 A;  2TMP A;  1F9R A;  1O7Z A;  2KEE A;  1G2T A;  3SEB A;  4WRD A;  1Y1W B;  4FNF A;  1JWS D;  1I4P A;  1BF4 A;  4IQZ A;  1V1O A;  2B2T C;  3I73 A;  2K32 A;  2V4D A;  1W6J A;  1S5F D;  2AQ2 B;  3NP8 A;  2N88 A;  1DD2 A;  3K5L A;  2L11 A;  1YNJ D;  4XQQ A;  4A3I B;  1UNS A;  5EBD A;  4BBS B;  4KI0 A;  2QCP X;  4ZAI A;  4CKE A;  1D6E C;  3KK7 A;  4ZKC B;  1Y8O B;  4IFD J;  1TWF B;  2PCF B;  4RGM A;  1XWE A;  2HQE A;  2NTS A;  5E4X A;  2K03 A;  5K36 G;  3LNN A;  2F3W A;  3LWE A;  4MN3 A;  1BCP F;  3TSS A;  1CA6 A;  4CBV A;  1CI3 M;  4LMQ D;  2PYK A;  3PIP 3;  2F0K A;  1RF2 D;  3RZD B;  1U4M A;  2A69 C;  1CT1 D;  2HDM A;  3FDT A;  4BA2 I;  4FXD A;  4K2L A;  5C4H A;  1WTP A;  2EY1 A;  1SJH D;  4RA8 A;  2L9H A;  5IGE A;  3R2T A;  2KA7 A;  5I2X A;  1A2T A;  2NVQ B;  1B50 A;  1RTO A;  1Z6H A;  3U9O A;  1X3Q A;  1ZXT A;  4IUN A;  3NXW A;  3TP8 A;  5KEE A;  2AWO A;  3TME A;  1HQM C;  5AFW A;  5CBA E;  4L8J A;  2RVL A;  1I4G A;  4IUV A;  2JYO A;  3PMF A;  1LT4 D;  3HOZ B;  2Z4I A;  5I9P A;  4A3F B;  2VXW A;  2LMC B;  2WAQ B;  2NUC A;  1NSN S;  2MJ8 A;  3MXP A;  1BQQ T;  2R61 A;  2XNA C;  2NB0 A;  3D6W A;  4HTH A;  4RKL A;  3QOL A;  4FP5 D;  2EOT A;  2IW3 A;  1NUC A;  3QO2 A;  2PPB C;  2FJ2 A;  1LO5 D;  3GP7 A;  5CV9 A;  1D5Z C;  2XN9 C;  1HPC A;  1GJX A;  1PLF A;  1BCP B;  5G3L D;  3H09 A;  4QCL A;  1AEX A;  2JA8 B;  1O80 A;  2LS0 1;  3HRZ C;  5IGG A;  1TWA B;  3RLF A;  2E74 C;  2NN6 H;  5D3I B;  4KMU C;  1Q90 A;  5M5W B;  1Z7T A;  1FNW A;  3NK9 A;  1YNJ C;  2D62 A;  3GV3 A;  5CMD A;  4ME5 A;  1WTV A;  2ICI A;  4BA1 I;  2IL8 A;  3HGB A;  4OO1 H;  2A73 B;  1EYD A;  3VR3 A;  3S1M B;  2A6H D;  4BS9 A;  2CQA A;  3HP3 A;  1GUW A;  1GXD C;  2EXZ A;  2Z8L A;  4Z9C B;  1S5E D;  3S17 B;  4M1U B;  2SNS A;  4JBW A;  1PDQ A;  4HMJ A;  3P7J A;  3O13 A;  4C3J G;  1YNN D;  2DY8 A;  3ND9 A;  4DAY A;  2F0J A;  3PUX A;  4IAL A;  2C5C A;  2JSO A;  1R4Q B;  2D9U A;  1C4Q A;  2F3V A;  1Q1B A;  1KDA A;  2O5J C;  3T53 B;  2FMC A;  2IX1 A;  3OOC A;  3K7A B;  3J81 L;  3ITP A;  4K8I A;  3SK8 A;  1V43 A;  2NYZ D;  3NSW A;  2A74 C;  1AFP A;  1GHJ A;  2Z4H A;  1A15 A;  4CJ1 B;  2PO4 A;  3I4M B;  1ET6 A;  2FHT A;  5LL6 S;  2O4X A;  3CRK C;  3U9S A;  4WFN 3;  1IYV A;  2QDB A;  3J7A V;  3GV6 A;  3RUZ A;  4UDU C;  3E5S A;  1QJO A;  3C1F A;  3X3M A;  5J39 A;  1SYB A;  3AMU A;  3HOX B;  2PZW A;  5CV6 A;  2VB3 X;  4F7X A;  2SEB D;  4IFD G;  3I90 A;  1HQR D;  2ZT9 C;  3I91 A;  4X3K A;  4KN7 C;  4XXE A;  3OSO A;  1ROD A;  1PTO D;  1CTM A;  2AQ3 B;  3R3O A;  1LAC A;  5C44 B;  1EY5 A;  1O78 A;  4KD3 A;  3D3R A;  1I4H A;  1BXT A;  1LTG D;  2G9D A;  1PYW D;  2HDL A;  4B08 A;  3PV0 A;  3HOY B;  1I4Q A;  2BOS A;  4A93 B;  4QB4 A;  3QB3 A;  1I3Q B;  1EQT A;  3EFX D;  3SR1 A;  5IT9 E;  4V0B A;  3OPO A;  4DNR B;  3D4W A;  5CR3 A;  2RDH A;  1UAP A;  3OHX C;  5JEA H;  1KAA A;  2ID0 A;  4MIU A;  1DXM A;  4HN7 A;  1VF7 A;  2F0O A;  5DM6 3;  5T1G A;  1Q12 A;  4F8M A;  4KHZ A;  4PMC A;  4KV6 A;  3TZD A;  1CK1 A;  3HZX A;  3J7A F;  2RSN A;  3TZU A;  2WIN B;  1EZ8 A;  1JB3 A;  1J8I A;  5TSS A;  1F77 A;  1JWU D;  3MFY A;  3SVM A;  4QUC A;  1DYQ A;  1HUM A;  1WTW A;  1SYE A;  3Q0A A;  2A6H C;  1X3P A;  5K5P A;  3Q23 A;  1AW7 A;  2WB1 B;  1HXY D;  1PZJ D;  1ET9 A;  1Y69 U;  3ONA B;  3VR6 A;  3NBH A;  1LT5 D;  2A68 C;  2EDG A;  5BN4 A;  5KNC A;  1G91 A;  1LV9 A;  2B2U A;  2NTT A;  3K58 A;  4O1N A;  4B9W A;  5IGD A;  4Y7N B;  3FRP B;  4KKU A;  1DJR D;  4DK0 A;  3HOW B;  3BYT B;  2F0S A;  1I6V C;  2WV6 D;  1F2L A;  3K6O A;  1F9P A;  1G6Z A;  1SYC A;  1KNA A;  2NN6 I;  1DOK A;  4DK1 A;  2RBM A;  3FEW X;  1T5X D;  2EYH A;  2K33 A;  3VYS A;  1ZYR C;  3N52 A;  3NBI A;  4G7O C;  5I6W A;  1PZI D;  1A3U A;  3HKZ B;  2B2U C;  4DN4 M;  1IKM A;  1BO0 A;  2F0W A;  1IHZ A;  4OIK A;  3KF8 A;  4DF7 A;  1GUO A;  3H91 A;  3KLS A;  1MGS A;  1JCK B;  4IN3 A;  4K8J A;  3W2D A;  3JAM L;  1EY8 A;  4C3J B;  1TKW B;  4G57 A;  4XYO A;  4OGQ C;  4CKC A;  2VUM B;  2MP1 A;  5ISR A;  1NAP A;  1WTX A;  1H9K A;  2KHS A;  2RDG A;  1LT6 D;  2J7Z A;  3BVM A;  2F0Q A;  1STB A;  3GTP B;  1FR3 A;  2EE1 A;  2E2H B;  1E2W A;  1U9R A;  1BNZ A;  1VCI A;  5C6A A;  3A8K E;  1ILQ A;  2EYP A;  4HCS A;  2I07 B;  2O5I C;  1F2Y A;  2JA5 B;  2HCC A;  2LFN A;  3K59 A;  1SYG A;  1JE4 A;  1BUV T;  1EY9 A;  1RJT A;  3R8B A;  5LL6 X;  3GTL B;  5C0X I;  2R3Z A;  1BCP D;  4EQO A;  4KTA A;  2A6E D;  1A6X A;  4RKB A;  2NBF A;  2QEJ C;  1QOH A;  2X69 A;  4OHJ A;  3DWQ A;  3M7N A;  5J22 A;  2A5H A;  5CYU A;  3NWT A;  4OIJ A;  5D14 A;  5IIF A;  2KQ3 A;  3G6J B;  1B9N A;  4L63 B;  3WOF A;  1ENA A;  5E4W C;  3I3C A;  3K5M A;  4ZRZ A;  2QIL A;  1Y8P B;  2SDF A;  3Q22 A;  3K5O A;  1JR0 D;  1FNU A;  1V8Q A;  5JEA J;  2F0D A;  2L0C A;  1PMR A;  4TKO B;  1D1K A;  4E6I A;  4OO1 G;  2G9H D;  5CV4 A;  4RH6 A;  1XYI A;  1SYF A;  4A3K B;  3QOJ A;  5DNF A;  4C3H B;  4FXG C;  1OXV A;  2F1M A;  3J80 E;  2KEC A;  1XXG A;  1TII D;  4CHT B;  4RGN A;  4FF2 A;  1ZKO A;  3I72 A;  2B2Y A;  1GUG A;  2CVR A;  2J4X A;  2OXP A;  2Q8R E;  1R9T B;  2EZV A;  4DNT B;  2LKV A;  3MAQ A;  1SYD A;  2K28 A;  3L7Z C;  4DAV A;  2NVT B;  1ESR A;  4H44 C;  5F2D A;  2PNR C;  2WKD A;  4ZK9 B;  1FD7 D;  1IYU A;  1DON A;  3NQT A;  1F2M A;  3W3A A;  2IJ0 A;  3J81 E;  2R7Z B;  1UEA B;  2ZXP A;  1ZYR D;  4NDX A;  2EJM A;  4EQN A;  5JEA G;  1I50 B;  3A56 A;  2IWH A;  1DCZ A;  5COY A;  2NN6 G;  5HGT A;  5KYI A;  1PTO C;  5A2Q L;  3BS1 A;  5C5M A;  2AWN A;  1CHP D;  1QIL A;  4IUP A;  5DM7 3;  3MC0 B;  5E3F A;  5EPL A;  1TQO A;  1B1Z A;  1PFN A;  3FVQ A;  3IFT A;  3S16 B;  3HEJ A;  4U68 A;  1PTO H;  1BCP C;  1OXS C;  5EKK A;  5BN5 A;  4RHR A;  3WOE A;  1DOM A;  3E6Z X;  2K01 A;  1D5X C;  2XIW A;  4IUT A;  2B39 A;  3G7L A;  1SXT A;  4N9P A;  1STY A;  2Y0S B;  3TP5 A;  1WTO A;  1PFM A;  5D65 A;  4KY5 A;  4XT1 B;  1HRJ A;  1QNK A;  1PRT C;  3K0Y A;  3EJI A;  3SHL A;  3DWA A;  4QIW B;  1SMY C;  2AUJ D;  3NHH A;  4DFA A;  4F88 A;  1ESF A;  2PMZ B;  2EYF A;  1LAB A;  3OIQ A;  2ICE C;  3CRL C;  2D5D A;  3MVV A;  5I9O A;  5IOC A;  5IT9 L;  2F4I A;  2L4N A;  3DEO A;  1I4R A;  3A7A B;  1KDC A;  1OO9 B;  2DNE A;  4BY7 B;  2DN8 A;  2XSC A;  3R93 A;  1CZW A;  4OO1 I;  2YYZ A;  4ABN A;  2XVS A;  2CW0 D;  1PZK D;  2IPK D;  3CKI B;  1H9M A;  2OEO A;  4J1M A;  3MZ5 A;  5DEH A;  1LTT D;  1G2S A;  4IUR A;  1STN A;  4C3I G;  2EVB A;  4K5W A;  5FO9 B;  1JOK A;  5KIX A;  5M5X B;  3S15 B;  1VMP A;  1STE A;  5ELF A;  5M5Y B;  1U4R A;  1TY0 A;  4NMZ A;  1SMY D;  2WKC A;  5KNB A;  1HCZ A;  3GD7 A;  5EJW A;  1D1I A;  4A3E B;  1V1P B;  1AN8 A;  4FF1 A;  1DM0 B;  2F0H A;  4KD4 A;  5FO7 B;  4KY7 A;  2XWB B;  1H9R A;  3H6M A;  2O2L D;  1EY4 A;  3D8G A;  5A2Q E;  4DA2 A;  2F0M A;  4RCN A;  4FXK C;  2F0L A;  5C0X G;  4PQX A;  4XIG S;  2D2C C;  1Z47 A;  3OMC A;  2XRS D;  3DEP A;  5FLX L;  1SDF A;  5CV8 A;  1EL0 A;  1MI2 A;  2KOL A;  3K57 A;  3OW7 A;  2KUM A;  3D31 A;  3IKJ A;  4FYD A;  1F9Q A;  1M4V A;  1ILP A;  4V19 0;  4KJN A;  3D4R A;  4K6D A;  5FLX E;  4X3S A;  1JWM D;  4G4K A;  4KN4 C;  2FFK B;  2RDF A;  5I2Y A;  1A2U A;  4J6H A;  1STA A;  2L1B A;  1WVL A;  2HCI A;  1DOL A;  3HOU B;  3EVQ A;  1H9S B;  1L0Y B;  3IL8 A;  4EVO A;  2PW5 A;  1QCB D;  4G7H C;  1B53 A;  2PQE A;  1BOS A;  3SK4 A;  2J0T D;  1HTP A;  1LT3 D;  2BE5 C;  3OWE B;  1JOQ A;  4L6T B;  4C56 C;  1RKN A;  5C0X J;  1HFG A;  1IW7 C;  3H3V C;  4EQP A;  1DZ1 A;  4C3H G;  2RSO A;  3QG1 A;  4LK1 C;  3SK6 A;  1CFM A;  4FF4 A;  5LHY 1;  4XT3 B;  1B2T A;  2SNM A;  5K36 H;  1NCV A;  2X6G A;  1TY2 A;  2K5W A;  2KCC A;  2JE6 I;  2A69 D;  1Q8I A;  1JOO A;  1SNQ A;  3GTM B;  1HUN A;  2XWJ B;  4JK1 C;  2F0E A;  2WAC A;  5JVH 3;  5C4Z A;  4FO2 A;  4K6L A;  3P75 A;  1U4P A;  1SFO B;  2KED A;  2N55 A;  2L55 A;  3MXN A;  2EPB A;  2EYJ A;  1ENC A;  1SND A;  1J9O A;  1B3A A;  1EU4 A;  3E0J A;  3CQZ B;  3KLS X;  3I4N B;  2DNC A;  1Q1E A;  3MWY W;  5T1I A;  3FKI B;  2C9O A;  3MTS A;  4H0L C;  3P20 A;  3A7L A;  1GUS A;  1JC7 A;  1AZQ A;  3A55 A;  1QWY A;  1CHQ D;  3QIA A;  1V1P A;  5JAV A;  3OMG A;  2EY6 A;  1WD1 A;  4I65 A;  3L9A X;  1HTL D;  1F2Z A;  3C3L A;  3VA7 A;  3A8J E;  3C46 A;  3IFD A;  3JAM E;  5JOB A;  1VMC A;  2K1B A;  3BVZ A;  3T4A C;  1U4L A;  1KLU D;  4RAU C;  1WD0 A;  1KNE A;  1A3V A;  3PUW A;  1KLG D;  5CC4 A;  4HED A;  5NUC A;  4F87 A;  3NUC A;  4N9T A;  1EOT A;  5D3D A;  3KBX A;  2MHV A;  5KGU A;  3M4Y A;  1PRT B;  4HAE A;  1LTA D;  5HUR A;  3GTQ B;  1HFN A;  1JIC A;  1EFI D;  4NP5 A;  3M7G A;  4ZUJ A;  4LJZ C;  2EYL A;  4S3S A;  3A54 A;  1NR4 A;  2BE5 D;  1YNN C;  4TRD A;  1K8M A;  4RWS C;  1FYC A;  2EY5 A;  2AUK A;  4K5X A;  2JA7 B;  1I4X A;  5C0X H;  2MPM A;  4A3B B;  4HSP A;  4CJ0 B;  2M2L A;  4GZY C;  5CV7 A;  3D4D A;  3J80 L;  5BN3 A;  5C3W A;  1EEF D;  4ODG A;  2F0P A;  4FVM A;  3T13 A;  4RGO S;  3C1E A;  5M3M B;  3GTJ B;  3HOV B;  1TVX A;  2AQ1 B;  4Q0F A;  4HSV A;  1TU2 B;  3DWP A;  2WP8 J;  2R93 B;  2XRQ D;  4R8I A;  2F0U A;  2H4O A;  3Q6S A;  3BG3 A;  2B2T A;  2H1E A;  3BDC A;  1MBY A;  3A8I E;  2B2V C;  5EPJ A;  2DY7 A;  1TWC B;  1H9J A;  3PUY A;  2F0I A;  2SOB A;  5IGF A;  3I8Z A;  1AZP A;  1LLR D;  1GUT A;  4ZUI A;  4J8Q A;  5C5L A;  3PUZ A;  5I6Y A;  3MA2 B;  2F0V A;  1RD9 D;  3TDQ A;  1II3 A;  1SNP A;  5EKI A;  5ELB A;  1RDP D;  4R8N A;  1OXU A;  1A3T A;  3MXU A;  5FO8 B;  3SDZ A;  5KND A;  3URY A;  1XX8 A;  3KUP A;  3S14 B;  3TBI B;  1SBB B;  2CW0 C;  1RHP A;  5J1Z A;  3ND8 A;  4R9W A;  2BA1 A;  4DU9 A;  4DAP A;  4ULL A;  5EGT A;  1SE2 A;  2E75 C;  3RZO B;  2IX3 A;  4B9X A;  1CA5 A;  3VYT A;  1H9S A;  4X3T A;  3D6C A;  3X3N A;  1SNM A;  1WTR A;  1T5E A;  4U67 3;  2VB2 X;  4IUQ A;  1K83 B;  4YIJ A;  1PTO F;  3SE0 A;  1ML0 D;  1Q3L A;  5JJZ A;  2JEA I;  3S2D B;  4BY1 B;  1IKL A;  1GUN A;  1WTQ A;  4TQU S;  5G3L F;  5EBC A;  4K14 A;  3TN2 A;  3NTK A;  2ZXR A;  2EY2 A;  4G7Z C;  1TS3 A;  2KJX A;  5EQ0 A;  4IZ8 A;  3M85 A;  1BR9 A;  1VDZ A;  3GO5 A;  1TWG B;  3C2P A;  3I70 A;  2K5Q A;  5M9O A;  2B2W A;  2Z1C A;  2PW7 A;  4PNY A;  5IGC A;  1RCV D;  3PO3 B;  3M4O B;  1S4Z A;  3AB9 A;  3MEH A;  5JPM C;  2PZT A;  2TSS A;  3GTK B;  3ERQ A;  5I4D A;  5IGB A;  1TT2 A;  1D2B A;  1TWH B;  1G29 1;  5KRU A;  2MGS A;  3VA5 A;  2ZXO A;  5C3E B;  1MSG A;  4ZLT F;  5EPK A;  1SAP A;  4ZYS A;  3AU7 A;  2BCO A;  2FMM A;  3I4L A;  5FK9 C;  2RA4 A;  4CJ2 C;  3PUV A;  4RGT A;  4DGZ A;  1D5M C;  4KJO A;  1HA5 A;  2GA4 B;  4C1N I;  4RFB A;  5C3X A;  4C1N K;  2K5D A;  3V2T A;  4CKB A;  2VNU D;  4QUF A;  3QJY A;  1Y8N B;  2NVX B;  3NPP A;  3T16 A;  1EWH A;  3BYY B;  1F9S A;  4PMW A;  1HHV A;  4HCE A;  3EQL C;  3PIO 3;  2M00 A;  3BVG A;  1MD2 D;  1ZEQ X;  2YU9 B;  3DMU A;  3RD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...