2MGSA

Solution structure of cxcl5
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
71
structure length
71
Chain Sequence
LRELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of CXCL5 - A Novel Chemokine and Adipokine Implicated in Inflammation and Obesity.
pubmed doi rcsb
molecule keywords C-X-C motif chemokine 5
molecule tags Signaling protein
source organism Homo sapiens
total genus 10
structure length 71
sequence length 71
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2mgsA00
4IUVA 4XDXA 1B3AA 1WTRA 4R9WA 3GV6A 4MHEA 3N52A 1G91A 1MSHA 1WTOA 1X3QA 2B2TC 4IUPA 1QNKA 1WTWA 1PLFA 1F9PA 1HUMA 2KEEA 1F2LA 4CJ2C 1JE4A 3I90A 2J7ZA 5E4XA 1ESRA 2L9HA 1ILPA 2X6LA 1ZXTA 2B2UA 4ZKCB 1HFNA 1HUNA 3TZDA 3I91A 5COYA 4IUUA 2DY8A 2EE1A 1B50A 2EPBA 3MWYW 1SSOA 1GUWA 2KVMA 1NCVA 1C8CA 5EQ0A 1WTVA 3GV3A 5EJWA 1A15A 2B2YC 4X3KA 2L4NA 2HDMA 1BO0A 1WTQA 1RHPA 1J9OA 1BNZA 1B2TA 1HFGA 2BDNA 2FJ2A 4HEDA 4DN4M 1ML0D 2N55A 1RODA 1AZPA 1SAPA 2SDFA 4OIJA 1U4MA 5DNFA 2D9UA 2HCCA 1IKLA 3LWEA 4RA8A 4ZKBB 2B2WC 1NR4A 1O7YA 2L11A 4XT1B 4ZK9B 1LV9A 4QUFA 1VMCA 1Q3LA 2B2VA 3Q6SA 1CA6A 1BF4A 1CA5A 3KUPA 1ILQA 1KNAA 1MI2A 2MGSA 1HHVA 1X3PA 2RA4A 1PFBA 2HUGA 1B53A 2KEDA 3FDTA 3DEPA 1F9QA 2RSOA 5CMDA 3D6WA 3ONAB 1X32A 4R8IA 2B2TA 4NW2A 1G2SA 2X6GA 5EPKA 1HRJA 1RTOA 2JP1A 2RSNA 1F9SA 2K05A 4RAUC 5EKIA 4IUTA 2MJ8A 1O80A 3F2UA 1EL0A 1E0BA 2K01A 1CM9A 2RVLA 4ZLTF 2FFKB 2HDLA 1U4PA 1G6ZA 1VMPA 5D65A 2KUMA 4IUQA 1EIGA 4RWSC 4IURA 1QE6A 3QO2A 2K28A 2IL8A 2KECA 2XIWA 1O7ZA 3H91A 1WTXA 1DOLA 3IL8A 1G2TA 2K03A 4QUCA 2FINB 1DZ1A 1IL8A 5T1GA 1RTNA 2X69A 4HCSA 5CBAE 2L12A 2B2YA 1WD0A 2MPMA 2KOLA 1U4RA 3KBXA 4ZAIA 5EPLA 4CJ0B 1DOMA 1KNEA 1MSGA 3P7JA 5CBEE 2L1BA 1MGSA 3I3CA 1NR2A 3DM1A 2JYOA 2H1EA 1HA6A 3DEOA 2DY7A 1RJTA 2B2UC 2B2WA 2MP1A 4X3TA 1BBXC 4MN3A 3SVMA 4O42A 1IKMA 2FHTA 3G7LA 4LMQD 4XT3B 2VXWA 2Q8TA 5D14A 1QG7A 4CJ1B 1U4LA 2EOTA 4UAIA 2NZ1D 1AP0A 4OIKA 1XX8A 3IFDA 5T1IA 1NAPA 2R3ZA 1WD1A 2HCIA 3MTSA 3UI2A 3R93A 1PFMA 1PDQA 4HAEA 4X3UA 1XYIA 5JJZA 1F9RA 1ICWA 2K04A 2M2LA 1M8AA 1EIHA 2CVRA 1B4OA 1DONA 3FPUB 2NYZD 4X3SA 1AZQA 5EPJA 2B2VC 2K1BA 4HSVA 1WVLA 4U68A 1JICA 1SDFA 5CORA 1WTPA 1DOKA 1PFNA 3TN2A 1EOTA 1S4ZA 2N88A 2NWGA 2Q8RE 3HP3A 3I8ZA 5AFWA 1J8IA 1EQTA 2FMMA 5E4WC 1TVXA
chains in the Genus database with same CATH superfamily
2I5HA 2QDBA 1WYDA 5JPMC 4BBSG 1XMOL 2E5LQ 1EY9A 1B9MA 4BBRG 3NTIA 3DM3A 1AEXA 2RCNA 2KA7A 3RZOH 3TEHB 1LTLA 5C4XG 1TY2A 3TP8A 2B2UA 3S24A 3F2BA 3OMCA 5CYUA 4QCLA 4FP5D 5D3DA 1K73C 2J4XA 3RD4A 1FGUA 1UE1A 1SSOA 5LMNW 2D0PA 1SYGA 2IX3A 4GN5A 2VB2X 2LXKA 3VA7A 2PMZE 5C5LA 1IL2A 4BY7G 1FD7D 4DR6Q 1EQRA 2F03A 2CH4W 1QWYA 2K50A 3EBEA 2OTJA 3G48A 4RGMA 3FMCA 4A3JH 3MXUA 2QKIC 2F0LA 3DEPA 3TSSA 4B08A 1X32A 5C6AA 1VQEA 1F2MA 1GVPA 2VQEQ 4LF5Q 3OPOA 1GOZA 1O80A 2MJ8A 1JJ2A 1JWMD 4ZLTF 1QVCA 1U4PA 3I4NH 3SXHA 2K5WA 5M5WH 1SJED 4YHHQ 3H91A 4IUNA 5AJ3Q 4WORA 1D5ZC 1IBKL 4U673 5H1SE 3VR2A 4L63B 3DM1A 2RBMA 1X9NA 2Q8IB 2B2WA 3OOCA 3ERSX 1IXRA 1O78A 3G7LA 3V2TA 1TQOA 1PRTF 3OHXC 1ICFB 2Z6KC 2MFIA 1VQAA 4LUOA 2C5CA 4KY5A 4B3TL 5C3WA 2KCMA 4ME3A 2CH4A 1K8GA 1NAPA 1QB5D 2F0MA 3UI2A 2ASBA 3RLOA 3F1ZA 1CKMA 1XNRQ 1PDQA 4JW0A 1H9MA 1Y1VH 2A6ED 3VYTA 3WOFA 4UPAA 1M1KC 1PA6A 2WACA 3U4ZA 3CCUA 3UDIA 4C3IH 4DFAA 4POFA 3J80i 4A3IG 1JB3A 1GUNA 5JVH3 1EL0A 3HOUB 3AU7A 1Y1WG 5I2XA 3DHQA 3CC7A 4OELB 4JOIA 3GTKB 5IT9c 2JA6B 3CKIB 3QJYA 2ICEC 1C4QA 1W3SA 5JVG3 1SYFA 2DNEA 4H7BA 1ILPA 1L0XB 1GUGA 5BR8L 2MHVA 2DY8A 4QJFA 4UHVA 1YIJA 4DNIA 2Z8LA 1C9OA 1R9TH 3NXWA 2F0DA 5J22A 1HZ9A 3ERQA 2WKDA 3SK5A 5JEAH 1RODA 2G9HD 4DV2Q 2ZM6Q 1MIUA 4A3DG 1IKLA 4PV1C 4HJ8A 3J7AV 1NUCA 3G71A 1VQFA 1LTGD 1PH2A 3BDCA 3PO3G 1OXXK 4GOPA 4ULLA 4UP7A 4X62L 5M3FB 2A19A 2A6EC 2PMZB 4GNXA 5EPKA 2JA5G 2QW7A 3VDYA 3J7ZC 4LFBL 4P72A 1SROA 1Q12A 1SYBA 4QF4A 2L15A 1T5XD 1VQDA 3DWPA 3AFPA 3HOUH 1I6HB 1I50B 1S5BD 4DV5Q 3D3RA 5LMUQ 1EWCA 4HCSA 2UXCL 3A8IE 3MA2B 1D5XC 4A3EB 4FF1A 3CD6A 4JK1C 3C3LA 4CJ0B 1H9KA 1MSGA 2KENA 2ZTEA 1OXTA 2LMCB 1IW7D 5IWAL 3TS0A 3WWVA 1TS2A 5M3MB 3ULPA 4JBWA 3E0EA 5FLXE 1SNPA 3L2PA 2PYKA 4LFCL 5GAGC 4DR6L 3P20A 3OW7A 4JI8L 1ICWA 2F0GA 4KD3A 1N32Q 1SE2A 3A8KE 2IHFA 1IBLQ 4NKLA 5EPJA 2B2VC 1DGSA 1EUJA 5CV5A 3KJPA 4NP5A 4WFN3 2VL6A 4LF8Q 1SE3A 4DK3C 4HSPA 5AFWA 4DK1A 1RCVD 5KNDA 1JOKA 4BS9A 5M3FH 4IUVA 4DV4L 3HOZH 5IP7G 2VQEL 1T5EA 2IX1A 4A3CG 5CV8A 4N9PA 3R3OA 3OIQA 1T9HA 1QZHA 2J7ZA 5K36H 3KDFB 1F77A 3K0XA 3GTLB 1N34Q 1I6HH 1I50H 4CHTB 1S3OA 1JCKB 1TWFB 4JC0A 3KYHC 5EJWA 3PIP3 3CCQA 1IW7C 1S72A 4DNTB 3OWEB 3FKIB 3EIVA 3PO2B 4A3KB 2UUBQ 3L0OA 1H95A 2EY1A 4C56C 2E2DC 1Q8IA 5M3MH 3CC2A 4KD4A 3CPFA 4A4IA 1JOOA 1MI2A 2Y0SB 1XNRL 1B53A 2ZXPA 1LO5D 4WRDA 2K6AA 2IY5B 2I46A 3J80c 3CPWA 4CKEA 1KIXA 4DR7Q 3NELA 2NN6G 3UE0A 4TKOB 5EKIA 2LXJA 3WDNA 2Z4HA 3S16B 5IYBG 1BCPF 4IN3A 1E0BA 2NVYB 2RVLA 4OO1I 4JG2A 2K5QA 4IUQA 4GLVB 1CT1D 2IL8A 4MTNA 1WTXA 3MVVA 4YCUA 2QA4A 1V9PA 1FNVA 2GVBA 3KBXA 2WINB 4Q0FA 1PTOB 2UXDQ 4JI4L 1LABA 3DEOA 1NMFA 4RFBA 2WIIB 2E75C 2EVBA 4HMJA 3GTLH 1CHPD 4KKSA 3AFQA 1EYAA 3S1NB 4OXPA 4R4CA 3T1YQ 2VQFL 3PUVA 3STBD 4CBVA 3GTPB 4GKKQ 2ES2A 4A3KH 4DV7Q 5JPNC 1TXYA 4YY3L 4P2CB 5M5YH 5C3EG 2K1BA 1EWHA 1HCZA 3D4RA 2G9DA 2N88A 1J8IA 4JPBW 5EKLA 1VQMA 2KCCA 1L1OA 3JAME 3U4VA 1FVIA 1B1ZA 4F7XA 1B3QA 3BYTB 5C4JH 2B63G 3TQYA 4FXKC 3T56B 3S14B 1I94Q 2ATWA 1F2LA 3I56A 3I90A 3HRZC 3GO5A 3TZUA 4DV5L 3TZDA 1KD1C 3S1RH 3HEJA 5LMUL 1XPRA 2PQAB 4NXML 3F8TA 2ZTDA 2F0FA 1CKNB 2Z9HA 3JC66 1NCVA 1STNA 4LW1A 1PH6A 2A68C 2CWAA 3G6EA 2K5NA 3FEWX 2KQ3A 1PTOH 3KF6A 2Q2TA 3AYHB 4JCVE 4DKAC 4C1NK 2LSSA 4K5WA 4ZK9B 3EROA 1C0AA 2K52A 2K75A 5FO7B 2JA7B 4LF6Q 4DV1Q 3IFTA 1X3PA 2E2IB 3STBC 2KEDA 4QMGA 3SK6A 3GTPH 2H4OA 1XMQQ 3SR1A 1DXMA 3TP6A 2JP1A 4N8FA 2YU9B 1UEBA 4LF8L 4NXNQ 1M4VA 3BS1A 1V43A 4RCOA 4IFDH 4CKCA 2OCEA 4UP8A 1E24A 1VQ6A 3CC4A 2B29A 1B70B 4KMUC 3ULJA 1KLUD 2F4VQ 1LT5D 1Q86C 3EFXD 2A5HA 3M4QA 3IL8A 1HNXQ 1PMRA 4KHZA 4TVAB 1YI2A 4ZYSA 1WD0A 4I7ZC 4ZAIA 4GLAC 2Z4IA 1OXUA 5C0XI 3PIO3 1VF5C 3S14H 4A3FB 1BXTA 4O1NA 4DAYB 1N34L 4XTCS 3MEFA 3EN2A 3PUXA 3PGZA 1XMOQ 1VQKA 3L3OC 4E6IA 3N6RA 4UAIA 2LKVA 1QUQA 3BG3A 3O13A 1QVGA 5FO8B 3MTSA 1A3VA 2E2HB 4KK7A 5G3LD 2F4IA 5DLQE 3DUZA 3SHLA 4XXEA 1RIPA 2C9OA 2SNMA 4B3SL 4DXGA 2NYZD 3PV0A 3A5ZB 5KEEA 2E2IH 3K80C 3E9HA 2IX0A 1EQTA 3HOXB 1HJPA 3PUZA 2QGQA 4JBMA 2L5TA 1YEZA 3NBHB 4PQXA 3PF5A 3NWSA 1PH9A 4H44C 1EU4A 1SNOA 4EQNA 2KEEA 2Q2UA 4A3GB 1SNQA 2X6LA 3M3YB 1IZ6A 3CCLA 3A54A 1HFNA 1I5FA 4Q5VA 3I91A 3H3VH 2EPBA 3MWYW 2EY6A 1EQQA 3I55A 3KJOA 4A3MG 3EA6A 3GTJB 2YYZA 1H9SA 5IODA 4R1JA 1B2TA 3K5LA 4A3FH 2WAQG 1A8VA 1HZBA 1PH8A 5C0XH 1TR5A 2F3IA 4KTAA 1VMCA 3KF8B 3CMAA 3T1YL 1IBKQ 1ASZA 3TRZA 3S1QB 1KNAA 4RHSA 1YNJD 1BBWA 1EY4A 3NQIA 4CDFC 4DV0Q 3NENA 2E2HH 2PI2E 2X6GA 1HRJA 1J6QA 1F9SA 2K05A 3HKSA 2I5MX 4IJHA 1HPCA 1WCMH 2IWHA 3EJIA 4Y7NH 2BE5D 1UE6A 2XSCA 1PRTD 2CQAA 5BN4A 1C7YA 1KABA 2ZTCA 5D65A 3ZYYX 5I6YA 3CMEA 4OX9Q 3HOXH 2K28A 3SEBA 1PH3A 2R93B 1HNZL 2D62A 1UNSA 4DUZQ 1I94L 3HS0C 4EQOA 4B3MQ 4KV6A 3W2DA 3S9WA 4A3JG 3P7JA 1MGSA 3P75A 1RDPD 5JJKA 4A3GH 1SN8A 1PYBA 3DWQA 3M3YH 3H0GH 1SEBD 5IT9E 4OL7A 2FHTA 3GTGH 5JEAJ 4ZCKA 5D14A 1I4XA 5FJ8H 4NPSA 3GTMB 3MFGA 3X3MA 3CAMA 3T16A 3GTJH 3PCOB 3I4NG 1X3FA 1SFOH 4LF7Q 2KHSA 5E7NA 1OXSC 3U50C 3VA5A 5C44H 5BR8Q 4DU9A 3K7AB 3UDXA 3CCJA 3M4YA 1E7ZA 4DV1L 4KI0A 3E9IA 4RGNA 1YNJC 4LUVA 1O7IA 3ER0A 3SDZA 3M4OB 1AE2A 4IPCA 4JI3L 4HIMA 4ZKCB 5E4WC 1XMQL 3S2DH 1Q1EA 2PPBC 4MHEA 2DJFC 5DAUA 2B2TC 4NXNL 3NTHA 3OSOA 2OF1A 1SMYD 3HG9A 2BE5C 1PRTC 1CTMA 1YJ9A 2R7ZB 2AUJD 5JOBA 2J0TD 2A74C 4M1UB 1ESRA 1ZYRD 4CDDC 4X62Q 2RDFA 4TQUS 1Y1VG 1QILA 4DR4L 3BJUA 1HTLD 1RKNA 4LFAL 2R93H 4HJ5A 2ICIA 4C3IG 4X3KA 1VQ9A 3VR3A 2IJ0A 1EYDA 4OHJA 4WJ3M 3W1BA 4AYBB 1YJWA 1SNDA 5LL6S 1TWGB 5GAEC 4QL5A 3TP7A 2UXCQ 5G3LF 3CCMA 1EY8A 1O7LA 5A2QL 1CSPA 4ILWA 4PG3A 1PV4A 3I70A 2PNHA 5IWAQ 2ZXRA 3HOYB 2VUMB 1PHJA 1PH5A 3K7AH 4FYDA 3KDFA 4P73A 2NVTH 1GKHA 1CFMA 4LFCQ 5JEAG 1EWIA 2BH2A 3M4OH 3TMEA 1JC7A 1A63A 2MNAA 4JI8Q 3HKZE 4XQQA 1SMYC 4AQYL 3A8JE 2X69A 2F3WA 1WFQA 1E3PA 1JOQA 1JJGA 1ZYRC 2HT1A 3AB9A 2R7ZH 1N9WA 4YWLA 2B2UC 4DV4Q 5M9OA 1I4RA 3FPPA 5TSSA 1MKHA 3K0YA 3H09A 5FLXL 1G6PA 1SR3A 3J81L 5ELOA 3E0JA 2NZ1D 4C3JB 1XX8A 2Z6BA 5FKAC 1BQQT 5FLMG 2HCIA 3CCSA 1I6VC 3CCRA 2UXBQ 3HOUG 3QR8A 3R8BA 4JI5Q 3AEVA 2AWOA 1FJGL 4LAAA 3RZDB 1NSNS 4BBSB 2R92G 1TWGH 1FGBD 4FF3A 1AZQA 4BBRB 3ZJYC 1EEID 4HSVA 2HIVA 1YNXA 4DV0L 1SDFA 1TWHB 2PW7A 2A6HD 4XDXA 1M90C 3RN2A 1VQCA 2OQ0A 1MSHA 4LK1C 2E2JB 3NEMA 2K7VA 3UDGA 3J80E 4OX9L 4WJWA 2D2CC 2L0CA 3FRPB 1E1OA 2AWNA 1PH7A 5ELCA 1S5FD 1X6OA 4BY7B 4DUZL 3S1MB 3HKZG 4B3ML 2KBNA 1ET6A 5EQ0A 2AMCB 2DJGC 2L4NA 2HDMA 3T13A 2TSSA 1Z47A 2VB3X 1WTQA 1K3BC 3FHWA 4RKBA 4HEDA 5M3FG 1KHIA 1BCPD 3HOZG 4H13C 3S17B 2NTTA 2B2WC 1LT3D 1VCIA 1CUKA 1CA6A 4F88A 1LYLA 1QCBD 2NZHA 4LF7L 1F2ZA 4BWGB 1D5MC 3FDTA 5K36G 2RSOA 4JI4Q 3IAYA 3FVQA 4RAUC 2N8NA 1XXGA 2PQAA 1CKNA 1CI3M 3A7LA 4HCEA 1CM9A 2A6HC 2VQFQ 2PZTA 1PZID 1RD9D 1U0LA 3QO2A 3VYSA 5M3MG 1RTNA 5CV9A 2L12A 4JOIC 4YY3Q 2E2JH 4EX5A 1TT2A 1AE3A 5CGKA 1BUVT 2E74C 5CBEE 3Q22A 5IP9G 4EQ5A 4F8MA 1PH1A 5GQOA 4O42A 4L5TA 3D4DA 4BY7H 2WKCA 3S1MH 3S15B 1I4QA 3RLNA 1TS3A 4C3HB 1BCPC 3TP5A 1I4GA 3BDLA 5CV7A 1KQSA 4A3IB 3S17H 1M8AA 4NXMQ 1X56A 4B9XA 3L7ZC 3GTKH 1EZ6A 2JA6H 1X3GA 3C1EA 2NB0A 4V190 4GOPC 4FF2A 4IZ8A 5KNBA 4IFDJ 1TIID 1B3AA 1K28A 3JAML 2O5JC 3GV6A 1WTOA 5IOCA 4GNXC 4K8IA 2RQXA 4IUPA 4KHVA 1HH2P 2VZAA 1PLFA 4EQPA 1JE4A 1ZXTA 4IQZA 5IGBA 1JT8A 4A3KG 2EE1A 4A3DB 2K5HA 4TRDA 4UY8C 5HGTA 4DGZA 2Y0SG 2OXPA 3GTOB 2SDFA 2DGYA 3PF4A 1D6EC 3HOWB 4JYAL 2JQOA 4X6AH 1CZWA 3CXCA 5IGCA 4FDBA 1STAA 2AQ2B 2CCZA 3KUPA 3S15H 1JWSD 3NBHA 4K2KA 5HY6A 1V1PB 2MGSA 4DR1Q 3D6CA 4XYQA 2EYOA 3T1HQ 1PFBA 2UXBL 4C3HH 3J81i 1TS4A 1UEAB 2LY7A 1YHBA 1IBML 4JI5L 4DR3L 2XVSA 3KK7A 2CW0D 3ONAB 1YHQA 4APVA 1PVOA 1LTBD 3NWTA 2MO0A 4KKTA 1VDZA 1VQ7A 4A3EH 4IUTA 1NJIC 1N36Q 3Q8DA 3NE5B 1Y8PB 2E76C 2FFKB 4YCWA 3BVMA 1LLRD 4DA2A 2M00A 4DNRB 4OGQC 2NVQB 4RWSC 4LF9Q 3CRKC 1DJRD 1E2VA 1GHJA 4QB4A 4CKBA 1B44D 4B3SQ 5EBDA 3VR4A 4A93B 2B8GA 4R4IA 3BZCA 5J3BA 2EIFA 5KIXA 4PMWA 1Y69U 1RJTA 4HMIA 5IGEA 2I07B 3Q0AA 4Y52H 4CDEC 5C0XJ 1P16A 3E6ZX 4IFDG 3NPPA 4OIKA 2OT2A 3K59A 1XPOA 1BDOA 1EIYB 1PXUA 2P5ZX 4QGUA 3HOVB 5JAVA 4KKUA 1F9RA 3Q24A 3HOWH 2D0OA 1EEFD 1E22A 1LT4D 5FO9B 4K8JA 2A68D 1R4PB 3U9OA 3ND8A 1SYDA 4HTHA 3MZ5A 2KHJA 3HP3A 2CW0C 3IKJA 3DWAA 2EYJA 1G291 1NE3A 2SNSA 2F0VA 4G57A 4A75A 4YWKA 1TWFH 3J81j 3NK9A 1JORA 3Q23A 2A1AA 1UWVA 3A56A 3M7NA 4V0BA 3FKIH 2L9HA 1WI5A 1XTDA 2NVQH 3PO2H 1D7QA 4ME5A 5J1ZA 1EY7A 4HJ9A 1EY0A 4F87A 4A93H 2NVXB 3BVZA 1VQOA 2PW5A 2EZVA 4WJ4A 1FR3A 4N8X1 4L5SA 1RL2A 5I6WA 1UUPA 3I72A 1FNWA 1HZCA 5F2DA 1ET9A 2NN6I 2AQ3B 2L11A 4XT1B 1HNZQ 3S16H 5LL6X 4KY6A 1BBUA 1ILQA 2RHQB 2HHHL 2FMCA 2NVYH 1EU3A 4LF4L 2WB1G 4IPGA 1SE8A 3UDFA 4OO1H 5CMDA 3I4MG 4IPHA 4R8IA 3T51B 1KLGD 3HOVH 1IYUA 4RG1A 5FK9C 3CW2C 4PMBA 2F0EA 2K01A 1K0SA 3I7FA 4ODGA 2Z0SA 3VYUA 4OONA 3QB3A 1GUTA 4QUCA 1A3UA 1L1OC 5T1GA 2Q2IA 1PZJD 2B2YA 3S1NH 1BCPB 4X64L 2KOLA 1VQHA 5EPLA 3CQZB 3C2PA 4P74A 2GA4B 4LJZC 1HA6A 3U9SA 4JI3Q 3ICEA 2JA8G 2MO1A 3NUCA 4GOPB 4YWMA 1WCMG 1QOHA 3K58A 4A3BB 4R4QA 1Z9FA 2NVXH 4JI1Q 5IE8A 5FLXc 2GN5A 4GNXB 3J81c 1STYA 4DR4Q 1HQRD 1X3EA 4LFAQ 4X3SA 4DR1L 3T1HL 3WOEA 5CC4A 2B63B 2QF7A 2WAQE 5KNCA 3BYYB 4DK6C 4C2MB 3TN2A 4A3GG 5JJIA 2ZT9C 3H0GG 4CDCC 2C35B 1X55A 2PZUA 3N52A 5FJ8G 1NMGA 1N36L 1KRSA 3AQQA 1X3QA 2HD3A 4JI0Q 4X66L 4ALPA 2BOSA 2F0NA 4CJ2C 2EYLA 4LF9L 5C44G 2VY3A 2LS01 3T4AC 1GUWA 3K81C 4KY7A 5C3XA 2JA7H 1CSQA 1WTVA 1QVFA 3D4WA 1BNZA 1HFGA 3CQZH 3R2IA 3OYYA 2XNAC 4OIJA 2NTSA 5IIFA 3OTOL 3ND9A 3LWEA 2BDOA 4ZKBB 4AQYQ 1VQPA 4NDXA 2E8GA 2YU9H 4DUYL 4A3BH 1A2UA 1KDBA 1Y14B 2HUGA 2XWJB 3J7AF 4DPGA 4PZ6A 1GUOA 2R93G 2SOBA 5ISRA 4B3RL 2MUYA 4K5VA 2FXQA 1H9RA 2BA1A 2N3SA 5ELDA 1GM5A 4QQBX 2QDLA 2HDLA 3I4LA 1K8AC 2YTYA 1A0IA 4IURA 1FYCA 2KECA 4DV3L 1DOLA 2HIXA 5I2YA 1FJGQ 5CBAE 1JMCA 4GN4B 2PO4A 2XGTA 1JE5A 3CU7A 4FXDA 4ZRZA 3I3CA 1NR2A 4RHRA 3GP7A 2AHOB 4X3TA 2MP1A 1LUZA 1TWAB 5ELBA 2B8FA 1D1KA 3BDOA 4NB3A 4ZUJA 3RUZA 2EYMA 3C1FA 4B9WA 3CCEA 3R93A 1II3A 5DM63 3RNUA 4X3UA 1KC8C 1SYCA 5ELEA 1BOSA 1YHAA 1D2BA 1YVCA 5CORA 2R7ZG 1DOKA 1S4ZA 2NWGA 1HR0L 1XNQL 3K7UC 1G91A 1ASYA 1EFWA 1G51A 2YV5A 4O2DA 5EGTA 4FO2A 1S5DD 3EVQA 4R4TA 4A3MB 2KJXA 4FNFA 1TY0A 1WOCA 3OMGA 1V1QA 3HFZB 2I0QA 1HUNA 4AYBG 2UU9L 3NSWA 1P8LA 1B50A 2B39A 2PNRC 3S1QH 5KYIA 1MHWC 1A15A 1BO0A 2UUCL 4DN4M 1VQGA 4M8AA 1U4MA 4RA8A 2K4KA 1LV9A 1TWAH 4I7AA 1CA5A 5IYCH 4JI1L 1A2TA 3KLWA 4KN4C 2F1MA 1S5CD 2RDGA 4IOAA 1TKWB 4OWTB 1LTRD 4A3LH 4TSSA 4YIJA 1K83B 3H6MA 3PSIA 4AH6A 5HGQA 3KOJA 4A3JB 2F0OA 1AN8A 3E3XA 3RLFA 4DK0A 1I4HA 1O7ZA 1V8QA 4XIGS 2IW3A 4JI0L 2BCOA 1WJJA 4L6TB 3GTMH 2IT1A 3NBIA 3MXGA 4J6HA 3K5OA 4DR2L 3KF6B 4PNYA 4A3MH 2KCTA 1STEA 2RKSA 1V1PA 3M9BA 2DN8A 5KRUA 1BBXC 3MXNB 4RCNA 1PH4A 1IKMA 2Q8TA 5J39A 1LT6D 4LWCA 1YITA 4AIMA 3QIAA 1U4LA 1CZGA 1N8RC 3QOJA 1SLJA 2NBFA 5LMNL 1YJNA 1C48A 2JE6I 4OEMB 5IYDH 5JJZA 5D3IB 5KGUA 1XWEA 2CVRA 4X65L 2PQEA 1JB7A 2F52A 4O0AA 2JA9A 2QEJC 1JICA 1EYGA 2WP8J 4HIOA 1WTPA 4JI6L 2CFMA 1XJVA 2F3VA 3KFUA 2Q8RE 2EOTA 3PUWA 3H15A 5DM73 2CHBD 1Y1VB 4JYAQ 1SBBB 1PTOD 2N49A 3W5OA 1K83H 3DXJC 3NTKA 1F9PA 1JWUD 1PYWD 4C3IB 1LTSD 3SE0A 3X3NA 4BY1B 1GO3E 2XRQD 1Q7YC 1IBMQ 4DR3Q 4IUUA 2Z6KA 3RMHA 2JA6G 2K14A 2VNUD 3A0JA 1VQIA 3V05A 2G5DA 1QUQB 1L0WA 1L2FA 5GADC 1Z6HA 2A69D 4C1NI 4J15A 4P75A 5C4XB 1AZPA 5A35A 2H5XA 3A55A 2VUMH 3HOYH 2HCCA 2JN4A 4GN3B 1ENFA 4LNQA 4QUFA 1Q3LA 1SJHD 2CQOA 3BVGA 4BA1I 3KLRA 4POGA 4GZYC 1B8AA 1R9TB 1CKOA 2K5DA 3PQIA 3VR6A 1F9QA 1ENAA 2LFNA 2F0QA 2RDHA 3D6WA 3K6OA 1R4QB 2ZJRA 3CCVA 4RGOS 4ZUIA 3GDEA 4K0KQ 4DAVA 2SEBD 1VMPA 4BXXH 1BR9A 1QE6A 1FNUA 1CQVA 1G2TA 1PTOC 1DZ1A 1PFSA 2RCFA 4HJ7A 1H9SB 1Q90A 2N78A 1U4RA 4RGTA 4C3JH 3URYA 4C3HG 5IY0A 1SXTA 1VQNA 2JYOA 4XYOA 3F2DA 4KHPL 3D31A 2DY7A 4BY1H 1FL0A 3RZDH 4JV5L 5I9OA 4IO9A 2NZOA 2VXWA 2O5IC 4BBSH 4A3EG 3CHBD 1A62A 3FP9A 4BBRH 1VF7A 4GLXA 2UUAL 2R92B 2A69C 1TWHH 5T1IA 1HNWL 1K3RA 3MAQA 2JK8A 4J8QA 4UDUC 5C4XH 4DAPA 4DR5L 4L8JA 1EY5A 2JEAI 1S5ED 1EYCA 3GTQB 5I9PA 1KXLA 1MBYA 5LHY1 4A76A 1BKBA 2Y0SE 5EKKA 5IGDA 4QIWE 3BZDB 3D8GA 4R9WA 4BA2I 1H9JA 3HKZB 1OTCA 2HHHQ 4DV6Q 5I4DA 1Q1BA 4LF4Q 1DCZA 4P71A 5A2QE 4JI7L 1STBA 1PRTB 1Y1WB 1TS5A 3L9AX 3LNNA 1CQFA 1I3QB 1J5EL 1GUSA 3HOWG 3HOZB 1VQ5A 4S3SA 1QJOA 5GROA 2RHSB 2ZJPA 2YTVA 1D1IA 3P1HA 3NHHA 2FJ2A 3K5NA 1TU2B 1GJXA 1SAPA 5FLMH 4DAYA 2EYFA 2E5LL 1K9MC 2ZJQA 4PZ8A 2B2VA 3Q6SA 3DMUA 1BF4A 3BZKA 4X64Q 2R92H 4DF7A 3FKIG 4IOCA 4ID6A 3PO2G 1Q82C 4N9TA 3TREA 1EZ8A 4K6LA 1TWCB 4A93G 3GTQH 2EY5A 1OXVA 3PO3B 3M4PA 3GQBA 4ABNA 3G6JB 3S2HB 3H3VC 3J81E 4DXFA 1PTOF 1G6ZA 3HZXA 2K32A 5E3FA 4G4KA 4MIUA 1X54A 3KBGA 1IHZA 3RN5A 1QZGA 2EDGA 2JA5B 1IL8A 2BA0A 4MNOA 1D8LA 2EYHA 2NUCA 2L1BA 1NNXA 4OO1G 3TS2A 2H1EA 4PZ7A 4A3IH 3HOVG 1Y1WH 1U5KA 1I3QH 2EJGC 1N33Q 4LF5L 1NBWA 4CJ1B 4X66Q 3MXPA 2EJMA 2EYPA 2ID0A 3IFDA 1ZKOA 1GHKA 1IYVA 1EOVA 4YHHL 1XYIA 2VW9A 3G4SA 5AJ3L 1B4OA 1E2WA 5HURA 2O2LD 5ELNA 2AUKA 3KF8A 3U58A 1STHA 1HA5A 1UE7A 4G7ZC 1DM0B 3I8ZA 2FMMA 2KCNA 1SNCA 3OTOQ 1KL9A 1ONLA 4HJAA 4A3DH 2BH8A 1TWCH 3M7GA 3MC0B 4K0KL 1K0RA 1QNKA 2CKZB 4DUYQ 3HGBA 3PO3H 5M5YB 5DEHA 2R7DA 1HUMA 2WB1E 2HQLA 3S2HH 5EAYA 3GTOH 4QIWB 5L37A 2KHIA 5COYA 5IP9H 4B3RQ 2JA5H 5JJLA 5C4JB 1LTID 1W2BA 1RHPA 4JI2Q 2V1CC 5NUCA 3H94A 1ML0D 3J7A5 3A5UA 1UAPA 2D9UA 3LGJA 3S1RB 4DV3Q 1NR4A 1VS0A 1RF2D 3TBIB 3PIPA 1LTAD 3VYRA 3KLSA 3W1GA 2RA4A 2XN9C 3NQTA 2A73B 2OTLA 3CF5A 1Z7TA 2IPKD 2JXMB 4H02A 4HIKA 1VQLA 3E5SA 2HQEA 1XTCD 2JA7G 2RSNA 4G7OC 5E1FA 3CP0A 4Z9CB 3K57A 4DV2L 4LUZA 1EIGA 1HXYD 1ESFA 1MJCA 4YCVA 4XQNA 2ZM6L 2AQ1B 2TMPA 1STGA 1EFID 2XTIA 4A3BG 4IFDI 4DV6L 2V4DA 1DOMA 4NMZA 3LWUA 4K14A 2EJFC 1LM0A 1HR0Q 4JBKA 1XNQQ 2QCPX 3SVMA 5IP7H 4A3CH 4KLKA 2ALYB 4JVZA 1EQVA 2O4XA 4ZQ3A 4A3FG 1E2ZA 3ITPA 4GS3A 5C0XG 2R3ZA 4IPDA 4K6DA 1PFMA 1AW7A 4RMFA 2R6GA 4MZ9A 5M5XB 2UU9Q 1EIHA 4I65A 1DONA 3I4OA 3JAMi 3FPUB 1PYSB 3PUYA 2EXDA 2EQSA 1WVLA 3IRBA 3GD7A 2WFWA 1W6JA 2UUCQ 4K2LA 5IT9L 4HAEA 3SK8A 5BN5A 5GAHC 1TVXA 1WTRA 5ELFA 3F2CA 3A74A 1ENCA 3OW2A 4EVOA 1AH9A 3MXNA 5CR3A 5C3EB 1Q8KA 2K5VA 3QG1A 2JJQA 3HOXG 5E4XA 4CGYB 5IGGA 4G7HC 5FOBB 2EXZA 1CK1A 2F0TA 4FXGC 3RR5A 1N32L 3M85A 1IBLL 1I4PA 2NN6H 1KDCA 2KVMA 2PCFB 4J1MA 1C8CA 2JEBI 3GV3A 2B2YC 1JJCB 5IYBH 5IGFA 4OWWB 3AMUA 2OQKA 2RF4A 1J9OA 1SYEA 2PI2A 1A6XA 2IHEA 3LX0A 2WB1B 3DLLA 5DNFA 4GKJQ 3ULLA 3H3VI 1N33L 3I4MB 4KJNA 5EBCA 3R2TA 1MD2D 4DR2Q 1Y8OB 1GD7A 1HHVA 2I5LX 1KAAA 2MQHA 2K33A 2QEXA 2R61A 2XWBB 5M5XH 1G2SA 1DYQA 3J7YW 2A8VA 4XQJA 3I2ZA 3F2UA 2F0WA 2KUMA 5LMNQ 3OWFA 2F0UA 2UUBL 4HN7A 2JA8B 2ZXOA 2FINB 1VQJA 4X65Q 5IYCG 1JR0D 4HIDA 1WCMB 5C3EH 4Y7NB 1KNEA 4KN7C 5KYLA 4JI6Q 2Z1CA 4PMCA 4H0LC 1AFPA 4DR7L 1K8MA 2L55A 2DUDA 4A3LG 1QG7A 1V1OA 1Q81C 1LACA 2B63H 1LTTD 1U9RA 1YBYA 3PIOA 4JI2L 1W6KA 4C2MH 3K5MA 4AYBE 4JBJA 3QOLA 3H0GB 2M2LA 2K04A 2PZWA 1IYJB 1JQYD 1Q46A 3I4MH 3GTGB 1L0YB 1SMXA 2F0JA 1WTHA 3SGIA 2UXDL 1KDAA 1PFNA 3D0FA 1EOTA 3QWNA 1SFOB 2OEOA 2XRSD 3K8AA 3VR5A 5CV6A 5C44B 2F0IA 1SE4A 4KJOA 1KAWA 1WTWA 3W3AA 1K8OA 4IALA 1MJEA 2VS1A 4QY7A 1YNND 4FVMA 4GKKL 5IYDG 1X65A 3MFYA 4RH6A 3S2DB 5C4ZA 3MEHA 4DV7L 1KRTA 2JA8H 2F0HA 3V96A 1E1TA 4IJLA 2GVAA 1NY4A 4B3TQ 3TDQA 2BDNA 5BN3A 2M9VA 1GXDC 3C46A 1XPUA 1EIFA 2N55A 1NTGA 4DAMA 1VQ4A 1S40A 1SRUA 2DNCA 2QILA 1O7YA 1SNMA 1HR0W 3T53B 2WV6D 2B3GA 4MTKA 3J80L 3JAMc 4L5RC 3OIPA 2R7FA 2WAQB 2AKWB 4FF4A 4KHPQ 2YTXA 1EY6A 2B2TA 4NW2A 4JV5Q 1RTOA 3MHBA 1BVSA 2UUAQ 3RZOB 1PZKD 1HNWQ 2VUMG 1F2YA 3HOYG 3B6YA 2XIWA 4DR5Q 1G8ZD 1OO9B 2EY2A 1HQMC 2K03A 2CWPA 2D5DA 1KTKA 2MPMA 4LF6L 4K5XA 1HZAA 4EGVA 3PMFA 2Q2HA 1VQ8A 3A7AB 1YNNC 3I73A 2NVTB 1QNUA 1L1OB 3EQLC 1VQBA 5C5MA 4HR7B 3CRLC 1B7YB 4MN3A 1Y8NB 4LMQD 4XT3B 5C4HA 2F0SA 2OWOA 2F0KA 1CHQD 3UE1A 1A3TA 1B9NA 2JSOA 1AP0A 3SK4A 2ENBA 4R4OA 5CV4A 1DD2A 1WD1A 1HTPA 3KLSX 4BXXG 4GKJL 1YZ6A 4JI7Q 2F4VL 1ZEQX 1HNXL 4UP9A 1J5EQ 2F0PA 4OWXB 1UE5A 3NP8A 4C3JG 4RKLA 4U68A 5K5PA 4LFBQ 4L5QA 3BU2A 3I4NB 5M5WB 4R8NA 4BY1G
chains in the Genus database with same CATH topology
2QDBA 5JPMC 1EY9A 1B9MA 3NTIA 1AEXA 2KA7A 1TY2A 3TP8A 2B2UA 3OMCA 5CYUA 4QCLA 4FP5D 5D3DA 2J4XA 3RD4A 1SSOA 1SYGA 2IX3A 2VB2X 3VA7A 5C5LA 1FD7D 2F03A 1QWYA 4RGMA 3FMCA 3MXUA 2QKIC 2F0LA 3DEPA 3TSSA 4B08A 1X32A 5C6AA 1F2MA 3OPOA 1GOZA 1O80A 2MJ8A 1JWMD 4ZLTF 1U4PA 3SXHA 2K5WA 1SJED 3H91A 4IUNA 4WORA 1D5ZC 4U673 3VR2A 4L63B 3DM1A 2RBMA 2Q8IB 2B2WA 3OOCA 1O78A 3G7LA 3V2TA 1TQOA 1PRTF 3OHXC 2C5CA 4KY5A 5C3WA 1NAPA 1QB5D 2F0MA 3UI2A 1PDQA 1H9MA 2A6ED 3VYTA 3WOFA 2WACA 4DFAA 1JB3A 1GUNA 5JVH3 1EL0A 3HOUB 3AU7A 5I2XA 3DHQA 3GTKB 2JA6B 3CKIB 3QJYA 2ICEC 1C4QA 5JVG3 1SYFA 2DNEA 4H7BA 1ILPA 1L0XB 1GUGA 2MHVA 2DY8A 2Z8LA 3NXWA 2F0DA 5J22A 3ERQA 2WKDA 3SK5A 5JEAH 1RODA 2G9HD 1IKLA 4PV1C 3J7AV 1NUCA 1LTGD 3BDCA 1OXXK 4ULLA 5M3FB 2A6EC 2PMZB 5EPKA 1Q12A 1SYBA 4QF4A 1T5XD 3DWPA 1I6HB 1I50B 1S5BD 3D3RA 1EWCA 4HCSA 3A8IE 3MA2B 1D5XC 4A3EB 4FF1A 4JK1C 3C3LA 4CJ0B 1H9KA 1MSGA 1OXTA 2LMCB 1IW7D 1TS2A 5M3MB 4JBWA 5FLXE 1SNPA 2PYKA 3P20A 3OW7A 1ICWA 2F0GA 4KD3A 1SE2A 3A8KE 4NKLA 5EPJA 2B2VC 5CV5A 4NP5A 4WFN3 1SE3A 4HSPA 5AFWA 4DK1A 1RCVD 5KNDA 1JOKA 4BS9A 4IUVA 1T5EA 2IX1A 5CV8A 4N9PA 3R3OA 3OIQA 2J7ZA 5K36H 1F77A 3GTLB 4CHTB 1JCKB 1TWFB 5EJWA 3PIP3 1IW7C 4DNTB 3OWEB 3FKIB 3PO2B 4A3KB 2EY1A 4C56C 2E2DC 1Q8IA 4KD4A 1JOOA 1MI2A 2Y0SB 1B53A 2ZXPA 1LO5D 4WRDA 2K6AA 2I46A 4CKEA 2NN6G 4TKOB 5EKIA 3WDNA 2Z4HA 3S16B 1BCPF 4IN3A 1E0BA 2NVYB 2RVLA 4OO1I 2K5QA 4IUQA 1CT1D 2IL8A 1WTXA 3MVVA 1FNVA 3KBXA 2WINB 4Q0FA 1PTOB 1LABA 3DEOA 4RFBA 2WIIB 2E75C 2EVBA 4HMJA 1CHPD 4KKSA 1EYAA 3S1NB 3PUVA 4CBVA 3GTPB 5JPNC 4P2CB 2K1BA 1EWHA 1HCZA 2G9DA 3D4RA 2N88A 1J8IA 5EKLA 2KCCA 3JAME 1B1ZA 4F7XA 3BYTB 4FXKC 3T56B 3S14B 1F2LA 3I90A 3HRZC 3GO5A 3TZUA 3TZDA 3HEJA 2F0FA 1NCVA 1STNA 2A68C 3FEWX 2KQ3A 1PTOH 4C1NK 4K5WA 4ZK9B 3EROA 5FO7B 2JA7B 3IFTA 1X3PA 2E2IB 2KEDA 4QMGA 3SK6A 2H4OA 3SR1A 1DXMA 3TP6A 2JP1A 2YU9B 1M4VA 3BS1A 1V43A 4RCOA 4IFDH 4CKCA 4KMUC 1KLUD 1LT5D 3EFXD 2A5HA 3IL8A 1PMRA 4KHZA 4ZYSA 1WD0A 4I7ZC 4ZAIA 2Z4IA 1OXUA 5C0XI 3PIO3 1VF5C 4A3FB 1BXTA 4O1NA 4XTCS 3PUXA 3L3OC 4E6IA 3N6RA 4UAIA 2LKVA 3BG3A 3O13A 5FO8B 3MTSA 1A3VA 2E2HB 4KK7A 5G3LD 2F4IA 3SHLA 3DUZA 4XXEA 2C9OA 2SNMA 4DXGA 2NYZD 3PV0A 5KEEA 2IX0A 1EQTA 3HOXB 3PUZA 2L5TA 4PQXA 3NWSA 4H44C 1EU4A 1SNOA 4EQNA 2KEEA 4A3GB 1SNQA 2X6LA 3M3YB 1HFNA 3A54A 4Q5VA 3I91A 2EPBA 3MWYW 2EY6A 3EA6A 3GTJB 2YYZA 1H9SA 5IODA 1B2TA 3K5LA 5C0XH 1TR5A 4KTAA 1VMCA 3S1QB 1KNAA 4RHSA 1YNJD 1EY4A 3NQIA 2X6GA 1HRJA 1F9SA 2K05A 1HPCA 2IWHA 3EJIA 2BE5D 2XSCA 1PRTD 2CQAA 5BN4A 1KABA 5D65A 3ZYYX 5I6YA 2K28A 3SEBA 2R93B 2D62A 1UNSA 3HS0C 4EQOA 4KV6A 3W2DA 3S9WA 3P7JA 1MGSA 3P75A 1RDPD 3DWQA 1SEBD 5IT9E 4OL7A 2FHTA 5JEAJ 5D14A 1I4XA 3GTMB 3MFGA 3X3MA 3T16A 2KHSA 1OXSC 3VA5A 4DU9A 3K7AB 3M4YA 4KI0A 4RGNA 1YNJC 3SDZA 3M4OB 4ZKCB 5E4WC 1Q1EA 2PPBC 4MHEA 5DAUA 2B2TC 3NTHA 3OSOA 2OF1A 1SMYD 3HG9A 2BE5C 1PRTC 1CTMA 2R7ZB 2AUJD 5JOBA 2J0TD 2A74C 4M1UB 1ESRA 1ZYRD 2RDFA 4TQUS 1QILA 1HTLD 1RKNA 2ICIA 4C3IG 4X3KA 3VR3A 2IJ0A 1EYDA 4OHJA 4AYBB 1SNDA 5LL6S 1TWGB 3TP7A 5G3LF 1EY8A 1O7LA 5A2QL 4ILWA 3I70A 2ZXRA 3HOYB 2VUMB 4FYDA 1CFMA 5JEAG 3TMEA 1JC7A 4XQQA 1SMYC 3A8JE 2X69A 2F3WA 1JOQA 1ZYRC 3AB9A 2B2UC 5M9OA 1I4RA 3FPPA 5TSSA 3K0YA 3H09A 5FLXL 3J81L 3E0JA 2NZ1D 4C3JB 1XX8A 5FKAC 1BQQT 2HCIA 1I6VC 3R8BA 2AWOA 4LAAA 3RZDB 1NSNS 4BBSB 1FGBD 4FF3A 1AZQA 4BBRB 1EEID 4HSVA 1SDFA 1TWHB 2PW7A 2A6HD 4XDXA 1MSHA 4LK1C 2E2JB 2K7VA 3J80E 4WJWA 2D2CC 2L0CA 3FRPB 2AWNA 5ELCA 1S5FD 4BY7B 3S1MB 1ET6A 5EQ0A 2L4NA 2HDMA 3T13A 2TSSA 1Z47A 2VB3X 1WTQA 4RKBA 4HEDA 1BCPD 4H13C 3S17B 2NTTA 2B2WC 1LT3D 1VCIA 1CA6A 4F88A 1QCBD 1F2ZA 4BWGB 1D5MC 3FDTA 5K36G 2RSOA 3IAYA 3FVQA 4RAUC 1XXGA 1CI3M 3A7LA 4HCEA 1CM9A 2A6HC 2PZTA 1PZID 1RD9D 3QO2A 3VYSA 1RTNA 5CV9A 2L12A 1TT2A 5CGKA 1BUVT 2E74C 5CBEE 3Q22A 4F8MA 4O42A 3D4DA 2WKCA 3S15B 1I4QA 1TS3A 4C3HB 1BCPC 3TP5A 1I4GA 3BDLA 5CV7A 4A3IB 1M8AA 4B9XA 3L7ZC 1EZ6A 3C1EA 4V190 2NB0A 4FF2A 4IZ8A 5KNBA 4IFDJ 1TIID 1B3AA 3JAML 2O5JC 3GV6A 1WTOA 5IOCA 4K8IA 2RQXA 4IUPA 4KHVA 1PLFA 4EQPA 1JE4A 1ZXTA 4IQZA 5IGBA 2EE1A 4A3DB 4TRDA 5HGTA 4DGZA 2OXPA 3GTOB 2SDFA 1D6EC 3HOWB 1CZWA 5IGCA 1STAA 2AQ2B 3KUPA 1JWSD 3NBHA 4K2KA 1V1PB 2MGSA 3D6CA 4XYQA 2EYOA 1PFBA 1TS4A 1UEAB 2LY7A 2XVSA 3KK7A 2CW0D 3ONAB 1LTBD 3NWTA 4KKTA 1VDZA 4IUTA 3NE5B 1Y8PB 2E76C 2FFKB 3BVMA 1LLRD 4DA2A 2M00A 4DNRB 4OGQC 2NVQB 4RWSC 3CRKC 1DJRD 1E2VA 1GHJA 4QB4A 4CKBA 1B44D 4A93B 5EBDA 3VR4A 2B8GA 5KIXA 4PMWA 1Y69U 1RJTA 4HMIA 5IGEA 2I07B 3Q0AA 5C0XJ 3E6ZX 4IFDG 3NPPA 4OIKA 2OT2A 3K59A 1BDOA 1PXUA 3HOVB 5JAVA 4KKUA 1F9RA 3Q24A 1EEFD 1LT4D 5FO9B 4K8JA 2A68D 1R4PB 3U9OA 3ND8A 1SYDA 4HTHA 3MZ5A 3HP3A 2CW0C 3IKJA 3DWAA 2EYJA 1G291 2SNSA 2F0VA 4G57A 3NK9A 1JORA 3Q23A 3A56A 3M7NA 4V0BA 2L9HA 4ME5A 5J1ZA 1EY7A 1EY0A 4F87A 2NVXB 3BVZA 2PW5A 2EZVA 1FR3A 5I6WA 1UUPA 3I72A 1FNWA 5F2DA 1ET9A 2NN6I 2AQ3B 2L11A 4XT1B 5LL6X 4KY6A 1ILQA 2FMCA 1EU3A 4OO1H 5CMDA 4R8IA 3T51B 1KLGD 1IYUA 5FK9C 4PMBA 2F0EA 2K01A 4ODGA 3VYUA 3QB3A 1GUTA 4QUCA 1A3UA 5T1GA 1PZJD 2B2YA 1BCPB 2KOLA 5EPLA 3CQZB 3C2PA 2GA4B 4LJZC 1HA6A 3U9SA 3NUCA 1QOHA 3K58A 4A3BB 1STYA 1HQRD 4X3SA 3WOEA 5CC4A 2B63B 2QF7A 5KNCA 3BYYB 4C2MB 3TN2A 2ZT9C 3N52A 2PZUA 1X3QA 2BOSA 2F0NA 4CJ2C 2EYLA 2LS01 3T4AC 1GUWA 5C3XA 4KY7A 1WTVA 3D4WA 1BNZA 1HFGA 3R2IA 2XNAC 4OIJA 2NTSA 5IIFA 3ND9A 3LWEA 2BDOA 4ZKBB 4NDXA 1A2UA 1KDBA 2HUGA 2XWJB 3J7AF 1GUOA 2SOBA 5ISRA 2MUYA 4K5VA 1H9RA 2BA1A 5ELDA 2HDLA 3I4LA 4IURA 1FYCA 2KECA 1DOLA 5I2YA 5CBAE 2PO4A 3CU7A 4FXDA 4ZRZA 3I3CA 1NR2A 4RHRA 3GP7A 4X3TA 2MP1A 1TWAB 5ELBA 2B8FA 1D1KA 3BDOA 4ZUJA 3RUZA 2EYMA 3C1FA 4B9WA 3R93A 1II3A 5DM63 4X3UA 1SYCA 5ELEA 1BOSA 1D2BA 5CORA 1DOKA 1S4ZA 2NWGA 1G91A 5EGTA 4FO2A 1S5DD 3EVQA 4A3MB 2KJXA 4FNFA 1TY0A 3OMGA 1HUNA 3NSWA 1B50A 2B39A 2PNRC 5KYIA 1A15A 1BO0A 4DN4M 4M8AA 1U4MA 4RA8A 1LV9A 1CA5A 1A2TA 4KN4C 2F1MA 1S5CD 2RDGA 1TKWB 1LTRD 4TSSA 4YIJA 1K83B 3H6MA 4A3JB 2F0OA 1AN8A 3RLFA 4DK0A 1I4HA 1O7ZA 1V8QA 4XIGS 2IW3A 2BCOA 4L6TB 2IT1A 3NBIA 3MXGA 4J6HA 3K5OA 4PNYA 1STEA 2RKSA 1V1PA 2DN8A 5KRUA 1BBXC 4RCNA 1IKMA 2Q8TA 5J39A 1LT6D 3QIAA 1U4LA 1CZGA 3QOJA 2NBFA 1C48A 2JE6I 5JJZA 5D3IB 5KGUA 1XWEA 2CVRA 2PQEA 2QEJC 1JICA 2WP8J 1WTPA 2F3VA 2Q8RE 2EOTA 3PUWA 5DM73 2CHBD 1Y1VB 1SBBB 1PTOD 3DXJC 3NTKA 1F9PA 1JWUD 1PYWD 4C3IB 1LTSD 3SE0A 3X3NA 4BY1B 2XRQD 4IUUA 3RMHA 2VNUD 3V05A 1Z6HA 2A69D 4C1NI 5C4XB 1AZPA 5A35A 3A55A 2HCCA 1ENFA 4QUFA 1Q3LA 1SJHD 3BVGA 4BA1I 3KLRA 4GZYC 1R9TB 2K5DA 3VR6A 1F9QA 1ENAA 2LFNA 2F0QA 2RDHA 3D6WA 3K6OA 1R4QB 4RGOS 4ZUIA 4DAVA 2SEBD 1VMPA 1BR9A 1QE6A 1FNUA 1CQVA 1G2TA 1PTOC 1DZ1A 1H9SB 1Q90A 1U4RA 4RGTA 3URYA 4C3HG 1SXTA 2JYOA 4XYOA 3D31A 2DY7A 5I9OA 2O5IC 2VXWA 3CHBD 1VF7A 2R92B 2A69C 5T1IA 3MAQA 4J8QA 4UDUC 4DAPA 4L8JA 1EY5A 2JEAI 1S5ED 1EYCA 3GTQB 5I9PA 1MBYA 5LHY1 5IGDA 5EKKA 3BZDB 3D8GA 4R9WA 4BA2I 1H9JA 3HKZB 5I4DA 1Q1BA 1DCZA 5A2QE 1STBA 1PRTB 1Y1WB 1TS5A 3L9AX 3LNNA 1CQFA 1I3QB 3HOZB 1GUSA 4S3SA 1QJOA 1D1IA 3P1HA 3NHHA 2FJ2A 3K5NA 1TU2B 1GJXA 1SAPA 4DAYA 2EYFA 2B2VA 3Q6SA 3DMUA 1BF4A 4DF7A 4ID6A 4N9TA 1EZ8A 4K6LA 1TWCB 2EY5A 1OXVA 3PO3B 3GQBA 4ABNA 3G6JB 3S2HB 3H3VC 3J81E 4DXFA 1PTOF 1G6ZA 3HZXA 2K32A 5E3FA 4G4KA 4MIUA 3KBGA 1IHZA 2EDGA 2JA5B 1IL8A 2BA0A 2EYHA 2NUCA 2L1BA 4OO1G 2H1EA 2EJGC 4CJ1B 3MXPA 2EJMA 2EYPA 2ID0A 3IFDA 1ZKOA 1GHKA 1IYVA 1XYIA 1B4OA 1E2WA 5HURA 2O2LD 2AUKA 3KF8A 1STHA 1HA5A 4G7ZC 1DM0B 3I8ZA 2FMMA 2KCNA 1SNCA 1ONLA 3M7GA 3MC0B 1QNKA 5M5YB 3HGBA 5DEHA 1HUMA 4QIWB 5COYA 5C4JB 1LTID 1RHPA 5NUCA 3H94A 1ML0D 1UAPA 2D9UA 3S1RB 1NR4A 1RF2D 3TBIB 1LTAD 3VYRA 3KLSA 2RA4A 2XN9C 3NQTA 2A73B 1Z7TA 2IPKD 2JXMB 3E5SA 2HQEA 1XTCD 2RSNA 4G7OC 5E1FA 4Z9CB 3K57A 1EIGA 1HXYD 1ESFA 4XQNA 2AQ1B 2TMPA 1STGA 1EFID 4IFDI 2V4DA 1DOMA 4NMZA 3LWUA 4K14A 2EJFC 2QCPX 3SVMA 1EQVA 2O4XA 4ZQ3A 1E2ZA 3ITPA 5C0XG 2R3ZA 4K6DA 1PFMA 1AW7A 2R6GA 5M5XB 1EIHA 4I65A 1DONA 3FPUB 3PUYA 1WVLA 3GD7A 1W6JA 4K2LA 5IT9L 4HAEA 3SK8A 5BN5A 1TVXA 1WTRA 5ELFA 1ENCA 4EVOA 3MXNA 5CR3A 5C3EB 3QG1A 5E4XA 4CGYB 5IGGA 4G7HC 5FOBB 2EXZA 1CK1A 2F0TA 4FXGC 3M85A 1I4PA 2NN6H 1KDCA 2KVMA 2PCFB 4J1MA 1C8CA 2JEBI 3GV3A 2B2YC 5IGFA 3AMUA 1J9OA 1SYEA 1A6XA 3LX0A 2WB1B 5DNFA 3I4MB 4KJNA 5EBCA 3R2TA 1MD2D 1HHVA 1Y8OB 1KAAA 2K33A 2R61A 2XWBB 1G2SA 1DYQA 3J7YW 4XQJA 3F2UA 2F0WA 2KUMA 3OWFA 2F0UA 4HN7A 2JA8B 2ZXOA 2FINB 1JR0D 1WCMB 4Y7NB 1KNEA 4KN7C 5KYLA 2Z1CA 4PMCA 4H0LC 1AFPA 1K8MA 2L55A 1QG7A 1V1OA 1LACA 1LTTD 1U9RA 1W6KA 3K5MA 3QOLA 3H0GB 2M2LA 2K04A 2PZWA 1JQYD 3GTGB 1L0YB 2F0JA 1KDAA 1PFNA 1EOTA 3QWNA 1SFOB 2OEOA 2XRSD 3VR5A 5CV6A 5C44B 2F0IA 1SE4A 4KJOA 1WTWA 3W3AA 1K8OA 4IALA 1YNND 4FVMA 3MFYA 4RH6A 3S2DB 5C4ZA 3MEHA 2F0HA 3V96A 3TDQA 2BDNA 5BN3A 2M9VA 1GXDC 3C46A 2N55A 2DNCA 2QILA 1O7YA 1SNMA 3T53B 2WV6D 3J80L 3OIPA 2WAQB 4FF4A 1EY6A 2B2TA 4NW2A 1RTOA 3MHBA 3RZOB 1PZKD 1F2YA 2XIWA 1G8ZD 1OO9B 2EY2A 1HQMC 2K03A 2D5DA 1KTKA 2MPMA 4K5XA 4EGVA 3PMFA 3A7AB 1YNNC 3I73A 2NVTB 1QNUA 3EQLC 5C5MA 4HR7B 3CRLC 4MN3A 1Y8NB 4LMQD 4XT3B 5C4HA 2F0SA 2F0KA 1CHQD 1A3TA 1B9NA 2JSOA 1AP0A 3SK4A 2ENBA 5CV4A 1DD2A 1WD1A 1HTPA 3KLSX 1ZEQX 2F0PA 3NP8A 4C3JG 4RKLA 4U68A 5K5PA 3I4NB 5M5WB 4R8NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IUV A;  4XDX A;  1B3A A;  1WTR A;  4R9W A;  3GV6 A;  4MHE A;  3N52 A;  1G91 A;  1MSH A;  1WTO A;  1X3Q A;  2B2T C;  4IUP A;  1QNK A;  1WTW A;  1PLF A;  1F9P A;  1HUM A;  2KEE A;  1F2L A;  4CJ2 C;  1JE4 A;  3I90 A;  2J7Z A;  5E4X A;  1ESR A;  2L9H A;  1ILP A;  2X6L A;  1ZXT A;  2B2U A;  4ZKC B;  1HFN A;  1HUN A;  3TZD A;  3I91 A;  5COY A;  4IUU A;  2DY8 A;  2EE1 A;  1B50 A;  2EPB A;  3MWY W;  1SSO A;  1GUW A;  2KVM A;  1NCV A;  1C8C A;  5EQ0 A;  1WTV A;  3GV3 A;  5EJW A;  1A15 A;  2B2Y C;  4X3K A;  2L4N A;  2HDM A;  1BO0 A;  1WTQ A;  1RHP A;  1J9O A;  1BNZ A;  1B2T A;  1HFG A;  2BDN A;  2FJ2 A;  4HED A;  4DN4 M;  1ML0 D;  2N55 A;  1ROD A;  1AZP A;  1SAP A;  2SDF A;  4OIJ A;  1U4M A;  5DNF A;  2D9U A;  2HCC A;  1IKL A;  3LWE A;  4RA8 A;  4ZKB B;  2B2W C;  1NR4 A;  1O7Y A;  2L11 A;  4XT1 B;  4ZK9 B;  1LV9 A;  4QUF A;  1VMC A;  1Q3L A;  2B2V A;  3Q6S A;  1CA6 A;  1BF4 A;  1CA5 A;  3KUP A;  1ILQ A;  1KNA A;  1MI2 A;  2MGS A;  1HHV A;  1X3P A;  2RA4 A;  1PFB A;  2HUG A;  1B53 A;  2KED A;  3FDT A;  3DEP A;  1F9Q A;  2RSO A;  5CMD A;  3D6W A;  3ONA B;  1X32 A;  4R8I A;  2B2T A;  4NW2 A;  1G2S A;  2X6G A;  5EPK A;  1HRJ A;  1RTO A;  2JP1 A;  2RSN A;  1F9S A;  2K05 A;  4RAU C;  5EKI A;  4IUT A;  2MJ8 A;  1O80 A;  3F2U A;  1EL0 A;  1E0B A;  2K01 A;  1CM9 A;  2RVL A;  4ZLT F;  2FFK B;  2HDL A;  1U4P A;  1G6Z A;  1VMP A;  5D65 A;  2KUM A;  4IUQ A;  1EIG A;  4RWS C;  4IUR A;  1QE6 A;  3QO2 A;  2K28 A;  2IL8 A;  2KEC A;  2XIW A;  1O7Z A;  3H91 A;  1WTX A;  1DOL A;  3IL8 A;  1G2T A;  2K03 A;  4QUC A;  2FIN B;  1DZ1 A;  1IL8 A;  5T1G A;  1RTN A;  2X69 A;  4HCS A;  5CBA E;  2L12 A;  2B2Y A;  1WD0 A;  2MPM A;  2KOL A;  1U4R A;  3KBX A;  4ZAI A;  5EPL A;  4CJ0 B;  1DOM A;  1KNE A;  1MSG A;  3P7J A;  5CBE E;  2L1B A;  1MGS A;  3I3C A;  1NR2 A;  3DM1 A;  2JYO A;  2H1E A;  1HA6 A;  3DEO A;  2DY7 A;  1RJT A;  2B2U C;  2B2W A;  2MP1 A;  4X3T A;  1BBX C;  4MN3 A;  3SVM A;  4O42 A;  1IKM A;  2FHT A;  3G7L A;  4LMQ D;  4XT3 B;  2VXW A;  2Q8T A;  5D14 A;  1QG7 A;  4CJ1 B;  1U4L A;  2EOT A;  4UAI A;  2NZ1 D;  1AP0 A;  4OIK A;  1XX8 A;  3IFD A;  5T1I A;  1NAP A;  2R3Z A;  1WD1 A;  2HCI A;  3MTS A;  3UI2 A;  3R93 A;  1PFM A;  1PDQ A;  4HAE A;  4X3U A;  1XYI A;  5JJZ A;  1F9R A;  1ICW A;  2K04 A;  2M2L A;  1M8A A;  1EIH A;  2CVR A;  1B4O A;  1DON A;  3FPU B;  2NYZ D;  4X3S A;  1AZQ A;  5EPJ A;  2B2V C;  2K1B A;  4HSV A;  1WVL A;  4U68 A;  1JIC A;  1SDF A;  5COR A;  1WTP A;  1DOK A;  1PFN A;  3TN2 A;  1EOT A;  1S4Z A;  2N88 A;  2NWG A;  2Q8R E;  3HP3 A;  3I8Z A;  5AFW A;  1J8I A;  1EQT A;  2FMM A;  5E4W C;  1TVX A; 
#chains in the Genus database with same CATH topology
 2I5H A;  2QDB A;  1WYD A;  5JPM C;  4BBS G;  1XMO L;  2E5L Q;  1EY9 A;  1B9M A;  4BBR G;  3NTI A;  3DM3 A;  1AEX A;  2RCN A;  2KA7 A;  3RZO H;  3TEH B;  1LTL A;  5C4X G;  1TY2 A;  3TP8 A;  2B2U A;  3S24 A;  3F2B A;  3OMC A;  5CYU A;  4QCL A;  4FP5 D;  5D3D A;  1K73 C;  2J4X A;  3RD4 A;  1FGU A;  1UE1 A;  1SSO A;  5LMN W;  2D0P A;  1SYG A;  2IX3 A;  4GN5 A;  2VB2 X;  2LXK A;  3VA7 A;  2PMZ E;  5C5L A;  1IL2 A;  4BY7 G;  1FD7 D;  4DR6 Q;  1EQR A;  2F03 A;  2CH4 W;  1QWY A;  2K50 A;  3EBE A;  2OTJ A;  3G48 A;  4RGM A;  3FMC A;  4A3J H;  3MXU A;  2QKI C;  2F0L A;  3DEP A;  3TSS A;  4B08 A;  1X32 A;  5C6A A;  1VQE A;  1F2M A;  1GVP A;  2VQE Q;  4LF5 Q;  3OPO A;  1GOZ A;  1O80 A;  2MJ8 A;  1JJ2 A;  1JWM D;  4ZLT F;  1QVC A;  1U4P A;  3I4N H;  3SXH A;  2K5W A;  5M5W H;  1SJE D;  4YHH Q;  3H91 A;  4IUN A;  5AJ3 Q;  4WOR A;  1D5Z C;  1IBK L;  4U67 3;  5H1S E;  3VR2 A;  4L63 B;  3DM1 A;  2RBM A;  1X9N A;  2Q8I B;  2B2W A;  3OOC A;  3ERS X;  1IXR A;  1O78 A;  3G7L A;  3V2T A;  1TQO A;  1PRT F;  3OHX C;  1ICF B;  2Z6K C;  2MFI A;  1VQA A;  4LUO A;  2C5C A;  4KY5 A;  4B3T L;  5C3W A;  2KCM A;  4ME3 A;  2CH4 A;  1K8G A;  1NAP A;  1QB5 D;  2F0M A;  3UI2 A;  2ASB A;  3RLO A;  3F1Z A;  1CKM A;  1XNR Q;  1PDQ A;  4JW0 A;  1H9M A;  1Y1V H;  2A6E D;  3VYT A;  3WOF A;  4UPA A;  1M1K C;  1PA6 A;  2WAC A;  3U4Z A;  3CCU A;  3UDI A;  4C3I H;  4DFA A;  4POF A;  3J80 i;  4A3I G;  1JB3 A;  1GUN A;  5JVH 3;  1EL0 A;  3HOU B;  3AU7 A;  1Y1W G;  5I2X A;  3DHQ A;  3CC7 A;  4OEL B;  4JOI A;  3GTK B;  5IT9 c;  2JA6 B;  3CKI B;  3QJY A;  2ICE C;  1C4Q A;  1W3S A;  5JVG 3;  1SYF A;  2DNE A;  4H7B A;  1ILP A;  1L0X B;  1GUG A;  5BR8 L;  2MHV A;  2DY8 A;  4QJF A;  4UHV A;  1YIJ A;  4DNI A;  2Z8L A;  1C9O A;  1R9T H;  3NXW A;  2F0D A;  5J22 A;  1HZ9 A;  3ERQ A;  2WKD A;  3SK5 A;  5JEA H;  1ROD A;  2G9H D;  4DV2 Q;  2ZM6 Q;  1MIU A;  4A3D G;  1IKL A;  4PV1 C;  4HJ8 A;  3J7A V;  1NUC A;  3G71 A;  1VQF A;  1LTG D;  1PH2 A;  3BDC A;  3PO3 G;  1OXX K;  4GOP A;  4ULL A;  4UP7 A;  4X62 L;  5M3F B;  2A19 A;  2A6E C;  2PMZ B;  4GNX A;  5EPK A;  2JA5 G;  2QW7 A;  3VDY A;  3J7Z C;  4LFB L;  4P72 A;  1SRO A;  1Q12 A;  1SYB A;  4QF4 A;  2L15 A;  1T5X D;  1VQD A;  3DWP A;  3AFP A;  3HOU H;  1I6H B;  1I50 B;  1S5B D;  4DV5 Q;  3D3R A;  5LMU Q;  1EWC A;  4HCS A;  2UXC L;  3A8I E;  3MA2 B;  1D5X C;  4A3E B;  4FF1 A;  3CD6 A;  4JK1 C;  3C3L A;  4CJ0 B;  1H9K A;  1MSG A;  2KEN A;  2ZTE A;  1OXT A;  2LMC B;  1IW7 D;  5IWA L;  3TS0 A;  3WWV A;  1TS2 A;  5M3M B;  3ULP A;  4JBW A;  3E0E A;  5FLX E;  1SNP A;  3L2P A;  2PYK A;  4LFC L;  5GAG C;  4DR6 L;  3P20 A;  3OW7 A;  4JI8 L;  1ICW A;  2F0G A;  4KD3 A;  1N32 Q;  1SE2 A;  3A8K E;  2IHF A;  1IBL Q;  4NKL A;  5EPJ A;  2B2V C;  1DGS A;  1EUJ A;  5CV5 A;  3KJP A;  4NP5 A;  4WFN 3;  2VL6 A;  4LF8 Q;  1SE3 A;  4DK3 C;  4HSP A;  5AFW A;  4DK1 A;  1RCV D;  5KND A;  1JOK A;  4BS9 A;  5M3F H;  4IUV A;  4DV4 L;  3HOZ H;  5IP7 G;  2VQE L;  1T5E A;  2IX1 A;  4A3C G;  5CV8 A;  4N9P A;  3R3O A;  3OIQ A;  1T9H A;  1QZH A;  2J7Z A;  5K36 H;  3KDF B;  1F77 A;  3K0X A;  3GTL B;  1N34 Q;  1I6H H;  1I50 H;  4CHT B;  1S3O A;  1JCK B;  1TWF B;  4JC0 A;  3KYH C;  5EJW A;  3PIP 3;  3CCQ A;  1IW7 C;  1S72 A;  4DNT B;  3OWE B;  3FKI B;  3EIV A;  3PO2 B;  4A3K B;  2UUB Q;  3L0O A;  1H95 A;  2EY1 A;  4C56 C;  2E2D C;  1Q8I A;  5M3M H;  3CC2 A;  4KD4 A;  3CPF A;  4A4I A;  1JOO A;  1MI2 A;  2Y0S B;  1XNR L;  1B53 A;  2ZXP A;  1LO5 D;  4WRD A;  2K6A A;  2IY5 B;  2I46 A;  3J80 c;  3CPW A;  4CKE A;  1KIX A;  4DR7 Q;  3NEL A;  2NN6 G;  3UE0 A;  4TKO B;  5EKI A;  2LXJ A;  3WDN A;  2Z4H A;  3S16 B;  5IYB G;  1BCP F;  4IN3 A;  1E0B A;  2NVY B;  2RVL A;  4OO1 I;  4JG2 A;  2K5Q A;  4IUQ A;  4GLV B;  1CT1 D;  2IL8 A;  4MTN A;  1WTX A;  3MVV A;  4YCU A;  2QA4 A;  1V9P A;  1FNV A;  2GVB A;  3KBX A;  2WIN B;  4Q0F A;  1PTO B;  2UXD Q;  4JI4 L;  1LAB A;  3DEO A;  1NMF A;  4RFB A;  2WII B;  2E75 C;  2EVB A;  4HMJ A;  3GTL H;  1CHP D;  4KKS A;  3AFQ A;  1EYA A;  3S1N B;  4OXP A;  4R4C A;  3T1Y Q;  2VQF L;  3PUV A;  3STB D;  4CBV A;  3GTP B;  4GKK Q;  2ES2 A;  4A3K H;  4DV7 Q;  5JPN C;  1TXY A;  4YY3 L;  4P2C B;  5M5Y H;  5C3E G;  2K1B A;  1EWH A;  1HCZ A;  3D4R A;  2G9D A;  2N88 A;  1J8I A;  4JPB W;  5EKL A;  1VQM A;  2KCC A;  1L1O A;  3JAM E;  3U4V A;  1FVI A;  1B1Z A;  4F7X A;  1B3Q A;  3BYT B;  5C4J H;  2B63 G;  3TQY A;  4FXK C;  3T56 B;  3S14 B;  1I94 Q;  2ATW A;  1F2L A;  3I56 A;  3I90 A;  3HRZ C;  3GO5 A;  3TZU A;  4DV5 L;  3TZD A;  1KD1 C;  3S1R H;  3HEJ A;  5LMU L;  1XPR A;  2PQA B;  4NXM L;  3F8T A;  2ZTD A;  2F0F A;  1CKN B;  2Z9H A;  3JC6 6;  1NCV A;  1STN A;  4LW1 A;  1PH6 A;  2A68 C;  2CWA A;  3G6E A;  2K5N A;  3FEW X;  2KQ3 A;  1PTO H;  3KF6 A;  2Q2T A;  3AYH B;  4JCV E;  4DKA C;  4C1N K;  2LSS A;  4K5W A;  4ZK9 B;  3ERO A;  1C0A A;  2K52 A;  2K75 A;  5FO7 B;  2JA7 B;  4LF6 Q;  4DV1 Q;  3IFT A;  1X3P A;  2E2I B;  3STB C;  2KED A;  4QMG A;  3SK6 A;  3GTP H;  2H4O A;  1XMQ Q;  3SR1 A;  1DXM A;  3TP6 A;  2JP1 A;  4N8F A;  2YU9 B;  1UEB A;  4LF8 L;  4NXN Q;  1M4V A;  3BS1 A;  1V43 A;  4RCO A;  4IFD H;  4CKC A;  2OCE A;  4UP8 A;  1E24 A;  1VQ6 A;  3CC4 A;  2B29 A;  1B70 B;  4KMU C;  3ULJ A;  1KLU D;  2F4V Q;  1LT5 D;  1Q86 C;  3EFX D;  2A5H A;  3M4Q A;  3IL8 A;  1HNX Q;  1PMR A;  4KHZ A;  4TVA B;  1YI2 A;  4ZYS A;  1WD0 A;  4I7Z C;  4ZAI A;  4GLA C;  2Z4I A;  1OXU A;  5C0X I;  3PIO 3;  1VF5 C;  3S14 H;  4A3F B;  1BXT A;  4O1N A;  4DAY B;  1N34 L;  4XTC S;  3MEF A;  3EN2 A;  3PUX A;  3PGZ A;  1XMO Q;  1VQK A;  3L3O C;  4E6I A;  3N6R A;  4UAI A;  2LKV A;  1QUQ A;  3BG3 A;  3O13 A;  1QVG A;  5FO8 B;  3MTS A;  1A3V A;  2E2H B;  4KK7 A;  5G3L D;  2F4I A;  5DLQ E;  3DUZ A;  3SHL A;  4XXE A;  1RIP A;  2C9O A;  2SNM A;  4B3S L;  4DXG A;  2NYZ D;  3PV0 A;  3A5Z B;  5KEE A;  2E2I H;  3K80 C;  3E9H A;  2IX0 A;  1EQT A;  3HOX B;  1HJP A;  3PUZ A;  2QGQ A;  4JBM A;  2L5T A;  1YEZ A;  3NBH B;  4PQX A;  3PF5 A;  3NWS A;  1PH9 A;  4H44 C;  1EU4 A;  1SNO A;  4EQN A;  2KEE A;  2Q2U A;  4A3G B;  1SNQ A;  2X6L A;  3M3Y B;  1IZ6 A;  3CCL A;  3A54 A;  1HFN A;  1I5F A;  4Q5V A;  3I91 A;  3H3V H;  2EPB A;  3MWY W;  2EY6 A;  1EQQ A;  3I55 A;  3KJO A;  4A3M G;  3EA6 A;  3GTJ B;  2YYZ A;  1H9S A;  5IOD A;  4R1J A;  1B2T A;  3K5L A;  4A3F H;  2WAQ G;  1A8V A;  1HZB A;  1PH8 A;  5C0X H;  1TR5 A;  2F3I A;  4KTA A;  1VMC A;  3KF8 B;  3CMA A;  3T1Y L;  1IBK Q;  1ASZ A;  3TRZ A;  3S1Q B;  1KNA A;  4RHS A;  1YNJ D;  1BBW A;  1EY4 A;  3NQI A;  4CDF C;  4DV0 Q;  3NEN A;  2E2H H;  2PI2 E;  2X6G A;  1HRJ A;  1J6Q A;  1F9S A;  2K05 A;  3HKS A;  2I5M X;  4IJH A;  1HPC A;  1WCM H;  2IWH A;  3EJI A;  4Y7N H;  2BE5 D;  1UE6 A;  2XSC A;  1PRT D;  2CQA A;  5BN4 A;  1C7Y A;  1KAB A;  2ZTC A;  5D65 A;  3ZYY X;  5I6Y A;  3CME A;  4OX9 Q;  3HOX H;  2K28 A;  3SEB A;  1PH3 A;  2R93 B;  1HNZ L;  2D62 A;  1UNS A;  4DUZ Q;  1I94 L;  3HS0 C;  4EQO A;  4B3M Q;  4KV6 A;  3W2D A;  3S9W A;  4A3J G;  3P7J A;  1MGS A;  3P75 A;  1RDP D;  5JJK A;  4A3G H;  1SN8 A;  1PYB A;  3DWQ A;  3M3Y H;  3H0G H;  1SEB D;  5IT9 E;  4OL7 A;  2FHT A;  3GTG H;  5JEA J;  4ZCK A;  5D14 A;  1I4X A;  5FJ8 H;  4NPS A;  3GTM B;  3MFG A;  3X3M A;  3CAM A;  3T16 A;  3GTJ H;  3PCO B;  3I4N G;  1X3F A;  1SFO H;  4LF7 Q;  2KHS A;  5E7N A;  1OXS C;  3U50 C;  3VA5 A;  5C44 H;  5BR8 Q;  4DU9 A;  3K7A B;  3UDX A;  3CCJ A;  3M4Y A;  1E7Z A;  4DV1 L;  4KI0 A;  3E9I A;  4RGN A;  1YNJ C;  4LUV A;  1O7I A;  3ER0 A;  3SDZ A;  3M4O B;  1AE2 A;  4IPC A;  4JI3 L;  4HIM A;  4ZKC B;  5E4W C;  1XMQ L;  3S2D H;  1Q1E A;  2PPB C;  4MHE A;  2DJF C;  5DAU A;  2B2T C;  4NXN L;  3NTH A;  3OSO A;  2OF1 A;  1SMY D;  3HG9 A;  2BE5 C;  1PRT C;  1CTM A;  1YJ9 A;  2R7Z B;  2AUJ D;  5JOB A;  2J0T D;  2A74 C;  4M1U B;  1ESR A;  1ZYR D;  4CDD C;  4X62 Q;  2RDF A;  4TQU S;  1Y1V G;  1QIL A;  4DR4 L;  3BJU A;  1HTL D;  1RKN A;  4LFA L;  2R93 H;  4HJ5 A;  2ICI A;  4C3I G;  4X3K A;  1VQ9 A;  3VR3 A;  2IJ0 A;  1EYD A;  4OHJ A;  4WJ3 M;  3W1B A;  4AYB B;  1YJW A;  1SND A;  5LL6 S;  1TWG B;  5GAE C;  4QL5 A;  3TP7 A;  2UXC Q;  5G3L F;  3CCM A;  1EY8 A;  1O7L A;  5A2Q L;  1CSP A;  4ILW A;  4PG3 A;  1PV4 A;  3I70 A;  2PNH A;  5IWA Q;  2ZXR A;  3HOY B;  2VUM B;  1PHJ A;  1PH5 A;  3K7A H;  4FYD A;  3KDF A;  4P73 A;  2NVT H;  1GKH A;  1CFM A;  4LFC Q;  5JEA G;  1EWI A;  2BH2 A;  3M4O H;  3TME A;  1JC7 A;  1A63 A;  2MNA A;  4JI8 Q;  3HKZ E;  4XQQ A;  1SMY C;  4AQY L;  3A8J E;  2X69 A;  2F3W A;  1WFQ A;  1E3P A;  1JOQ A;  1JJG A;  1ZYR C;  2HT1 A;  3AB9 A;  2R7Z H;  1N9W A;  4YWL A;  2B2U C;  4DV4 Q;  5M9O A;  1I4R A;  3FPP A;  5TSS A;  1MKH A;  3K0Y A;  3H09 A;  5FLX L;  1G6P A;  1SR3 A;  3J81 L;  5ELO A;  3E0J A;  2NZ1 D;  4C3J B;  1XX8 A;  2Z6B A;  5FKA C;  1BQQ T;  5FLM G;  2HCI A;  3CCS A;  1I6V C;  3CCR A;  2UXB Q;  3HOU G;  3QR8 A;  3R8B A;  4JI5 Q;  3AEV A;  2AWO A;  1FJG L;  4LAA A;  3RZD B;  1NSN S;  4BBS B;  2R92 G;  1TWG H;  1FGB D;  4FF3 A;  1AZQ A;  4BBR B;  3ZJY C;  1EEI D;  4HSV A;  2HIV A;  1YNX A;  4DV0 L;  1SDF A;  1TWH B;  2PW7 A;  2A6H D;  4XDX A;  1M90 C;  3RN2 A;  1VQC A;  2OQ0 A;  1MSH A;  4LK1 C;  2E2J B;  3NEM A;  2K7V A;  3UDG A;  3J80 E;  4OX9 L;  4WJW A;  2D2C C;  2L0C A;  3FRP B;  1E1O A;  2AWN A;  1PH7 A;  5ELC A;  1S5F D;  1X6O A;  4BY7 B;  4DUZ L;  3S1M B;  3HKZ G;  4B3M L;  2KBN A;  1ET6 A;  5EQ0 A;  2AMC B;  2DJG C;  2L4N A;  2HDM A;  3T13 A;  2TSS A;  1Z47 A;  2VB3 X;  1WTQ A;  1K3B C;  3FHW A;  4RKB A;  4HED A;  5M3F G;  1KHI A;  1BCP D;  3HOZ G;  4H13 C;  3S17 B;  2NTT A;  2B2W C;  1LT3 D;  1VCI A;  1CUK A;  1CA6 A;  4F88 A;  1LYL A;  1QCB D;  2NZH A;  4LF7 L;  1F2Z A;  4BWG B;  1D5M C;  3FDT A;  5K36 G;  2RSO A;  4JI4 Q;  3IAY A;  3FVQ A;  4RAU C;  2N8N A;  1XXG A;  2PQA A;  1CKN A;  1CI3 M;  3A7L A;  4HCE A;  1CM9 A;  2A6H C;  2VQF Q;  2PZT A;  1PZI D;  1RD9 D;  1U0L A;  3QO2 A;  3VYS A;  5M3M G;  1RTN A;  5CV9 A;  2L12 A;  4JOI C;  4YY3 Q;  2E2J H;  4EX5 A;  1TT2 A;  1AE3 A;  5CGK A;  1BUV T;  2E74 C;  5CBE E;  3Q22 A;  5IP9 G;  4EQ5 A;  4F8M A;  1PH1 A;  5GQO A;  4O42 A;  4L5T A;  3D4D A;  4BY7 H;  2WKC A;  3S1M H;  3S15 B;  1I4Q A;  3RLN A;  1TS3 A;  4C3H B;  1BCP C;  3TP5 A;  1I4G A;  3BDL A;  5CV7 A;  1KQS A;  4A3I B;  3S17 H;  1M8A A;  4NXM Q;  1X56 A;  4B9X A;  3L7Z C;  3GTK H;  1EZ6 A;  2JA6 H;  1X3G A;  3C1E A;  2NB0 A;  4V19 0;  4GOP C;  4FF2 A;  4IZ8 A;  5KNB A;  4IFD J;  1TII D;  1B3A A;  1K28 A;  3JAM L;  2O5J C;  3GV6 A;  1WTO A;  5IOC A;  4GNX C;  4K8I A;  2RQX A;  4IUP A;  4KHV A;  1HH2 P;  2VZA A;  1PLF A;  4EQP A;  1JE4 A;  1ZXT A;  4IQZ A;  5IGB A;  1JT8 A;  4A3K G;  2EE1 A;  4A3D B;  2K5H A;  4TRD A;  4UY8 C;  5HGT A;  4DGZ A;  2Y0S G;  2OXP A;  3GTO B;  2SDF A;  2DGY A;  3PF4 A;  1D6E C;  3HOW B;  4JYA L;  2JQO A;  4X6A H;  1CZW A;  3CXC A;  5IGC A;  4FDB A;  1STA A;  2AQ2 B;  2CCZ A;  3KUP A;  3S15 H;  1JWS D;  3NBH A;  4K2K A;  5HY6 A;  1V1P B;  2MGS A;  4DR1 Q;  3D6C A;  4XYQ A;  2EYO A;  3T1H Q;  1PFB A;  2UXB L;  4C3H H;  3J81 i;  1TS4 A;  1UEA B;  2LY7 A;  1YHB A;  1IBM L;  4JI5 L;  4DR3 L;  2XVS A;  3KK7 A;  2CW0 D;  3ONA B;  1YHQ A;  4APV A;  1PVO A;  1LTB D;  3NWT A;  2MO0 A;  4KKT A;  1VDZ A;  1VQ7 A;  4A3E H;  4IUT A;  1NJI C;  1N36 Q;  3Q8D A;  3NE5 B;  1Y8P B;  2E76 C;  2FFK B;  4YCW A;  3BVM A;  1LLR D;  4DA2 A;  2M00 A;  4DNR B;  4OGQ C;  2NVQ B;  4RWS C;  4LF9 Q;  3CRK C;  1DJR D;  1E2V A;  1GHJ A;  4QB4 A;  4CKB A;  1B44 D;  4B3S Q;  5EBD A;  3VR4 A;  4A93 B;  2B8G A;  4R4I A;  3BZC A;  5J3B A;  2EIF A;  5KIX A;  4PMW A;  1Y69 U;  1RJT A;  4HMI A;  5IGE A;  2I07 B;  3Q0A A;  4Y52 H;  4CDE C;  5C0X J;  1P16 A;  3E6Z X;  4IFD G;  3NPP A;  4OIK A;  2OT2 A;  3K59 A;  1XPO A;  1BDO A;  1EIY B;  1PXU A;  2P5Z X;  4QGU A;  3HOV B;  5JAV A;  4KKU A;  1F9R A;  3Q24 A;  3HOW H;  2D0O A;  1EEF D;  1E22 A;  1LT4 D;  5FO9 B;  4K8J A;  2A68 D;  1R4P B;  3U9O A;  3ND8 A;  1SYD A;  4HTH A;  3MZ5 A;  2KHJ A;  3HP3 A;  2CW0 C;  3IKJ A;  3DWA A;  2EYJ A;  1G29 1;  1NE3 A;  2SNS A;  2F0V A;  4G57 A;  4A75 A;  4YWK A;  1TWF H;  3J81 j;  3NK9 A;  1JOR A;  3Q23 A;  2A1A A;  1UWV A;  3A56 A;  3M7N A;  4V0B A;  3FKI H;  2L9H A;  1WI5 A;  1XTD A;  2NVQ H;  3PO2 H;  1D7Q A;  4ME5 A;  5J1Z A;  1EY7 A;  4HJ9 A;  1EY0 A;  4F87 A;  4A93 H;  2NVX B;  3BVZ A;  1VQO A;  2PW5 A;  2EZV A;  4WJ4 A;  1FR3 A;  4N8X 1;  4L5S A;  1RL2 A;  5I6W A;  1UUP A;  3I72 A;  1FNW A;  1HZC A;  5F2D A;  1ET9 A;  2NN6 I;  2AQ3 B;  2L11 A;  4XT1 B;  1HNZ Q;  3S16 H;  5LL6 X;  4KY6 A;  1BBU A;  1ILQ A;  2RHQ B;  2HHH L;  2FMC A;  2NVY H;  1EU3 A;  4LF4 L;  2WB1 G;  4IPG A;  1SE8 A;  3UDF A;  4OO1 H;  5CMD A;  3I4M G;  4IPH A;  4R8I A;  3T51 B;  1KLG D;  3HOV H;  1IYU A;  4RG1 A;  5FK9 C;  3CW2 C;  4PMB A;  2F0E A;  2K01 A;  1K0S A;  3I7F A;  4ODG A;  2Z0S A;  3VYU A;  4OON A;  3QB3 A;  1GUT A;  4QUC A;  1A3U A;  1L1O C;  5T1G A;  2Q2I A;  1PZJ D;  2B2Y A;  3S1N H;  1BCP B;  4X64 L;  2KOL A;  1VQH A;  5EPL A;  3CQZ B;  3C2P A;  4P74 A;  2GA4 B;  4LJZ C;  1HA6 A;  3U9S A;  4JI3 Q;  3ICE A;  2JA8 G;  2MO1 A;  3NUC A;  4GOP B;  4YWM A;  1WCM G;  1QOH A;  3K58 A;  4A3B B;  4R4Q A;  1Z9F A;  2NVX H;  4JI1 Q;  5IE8 A;  5FLX c;  2GN5 A;  4GNX B;  3J81 c;  1STY A;  4DR4 Q;  1HQR D;  1X3E A;  4LFA Q;  4X3S A;  4DR1 L;  3T1H L;  3WOE A;  5CC4 A;  2B63 B;  2QF7 A;  2WAQ E;  5KNC A;  3BYY B;  4DK6 C;  4C2M B;  3TN2 A;  4A3G G;  5JJI A;  2ZT9 C;  3H0G G;  4CDC C;  2C35 B;  1X55 A;  2PZU A;  3N52 A;  5FJ8 G;  1NMG A;  1N36 L;  1KRS A;  3AQQ A;  1X3Q A;  2HD3 A;  4JI0 Q;  4X66 L;  4ALP A;  2BOS A;  2F0N A;  4CJ2 C;  2EYL A;  4LF9 L;  5C44 G;  2VY3 A;  2LS0 1;  3T4A C;  1GUW A;  3K81 C;  4KY7 A;  5C3X A;  2JA7 H;  1CSQ A;  1WTV A;  1QVF A;  3D4W A;  1BNZ A;  1HFG A;  3CQZ H;  3R2I A;  3OYY A;  2XNA C;  4OIJ A;  2NTS A;  5IIF A;  3OTO L;  3ND9 A;  3LWE A;  2BDO A;  4ZKB B;  4AQY Q;  1VQP A;  4NDX A;  2E8G A;  2YU9 H;  4DUY L;  4A3B H;  1A2U A;  1KDB A;  1Y14 B;  2HUG A;  2XWJ B;  3J7A F;  4DPG A;  4PZ6 A;  1GUO A;  2R93 G;  2SOB A;  5ISR A;  4B3R L;  2MUY A;  4K5V A;  2FXQ A;  1H9R A;  2BA1 A;  2N3S A;  5ELD A;  1GM5 A;  4QQB X;  2QDL A;  2HDL A;  3I4L A;  1K8A C;  2YTY A;  1A0I A;  4IUR A;  1FYC A;  2KEC A;  4DV3 L;  1DOL A;  2HIX A;  5I2Y A;  1FJG Q;  5CBA E;  1JMC A;  4GN4 B;  2PO4 A;  2XGT A;  1JE5 A;  3CU7 A;  4FXD A;  4ZRZ A;  3I3C A;  1NR2 A;  4RHR A;  3GP7 A;  2AHO B;  4X3T A;  2MP1 A;  1LUZ A;  1TWA B;  5ELB A;  2B8F A;  1D1K A;  3BDO A;  4NB3 A;  4ZUJ A;  3RUZ A;  2EYM A;  3C1F A;  4B9W A;  3CCE A;  3R93 A;  1II3 A;  5DM6 3;  3RNU A;  4X3U A;  1KC8 C;  1SYC A;  5ELE A;  1BOS A;  1YHA A;  1D2B A;  1YVC A;  5COR A;  2R7Z G;  1DOK A;  1S4Z A;  2NWG A;  1HR0 L;  1XNQ L;  3K7U C;  1G91 A;  1ASY A;  1EFW A;  1G51 A;  2YV5 A;  4O2D A;  5EGT A;  4FO2 A;  1S5D D;  3EVQ A;  4R4T A;  4A3M B;  2KJX A;  4FNF A;  1TY0 A;  1WOC A;  3OMG A;  1V1Q A;  3HFZ B;  2I0Q A;  1HUN A;  4AYB G;  2UU9 L;  3NSW A;  1P8L A;  1B50 A;  2B39 A;  2PNR C;  3S1Q H;  5KYI A;  1MHW C;  1A15 A;  1BO0 A;  2UUC L;  4DN4 M;  1VQG A;  4M8A A;  1U4M A;  4RA8 A;  2K4K A;  1LV9 A;  1TWA H;  4I7A A;  1CA5 A;  5IYC H;  4JI1 L;  1A2T A;  3KLW A;  4KN4 C;  2F1M A;  1S5C D;  2RDG A;  4IOA A;  1TKW B;  4OWT B;  1LTR D;  4A3L H;  4TSS A;  4YIJ A;  1K83 B;  3H6M A;  3PSI A;  4AH6 A;  5HGQ A;  3KOJ A;  4A3J B;  2F0O A;  1AN8 A;  3E3X A;  3RLF A;  4DK0 A;  1I4H A;  1O7Z A;  1V8Q A;  4XIG S;  2IW3 A;  4JI0 L;  2BCO A;  1WJJ A;  4L6T B;  3GTM H;  2IT1 A;  3NBI A;  3MXG A;  4J6H A;  3K5O A;  4DR2 L;  3KF6 B;  4PNY A;  4A3M H;  2KCT A;  1STE A;  2RKS A;  1V1P A;  3M9B A;  2DN8 A;  5KRU A;  1BBX C;  3MXN B;  4RCN A;  1PH4 A;  1IKM A;  2Q8T A;  5J39 A;  1LT6 D;  4LWC A;  1YIT A;  4AIM A;  3QIA A;  1U4L A;  1CZG A;  1N8R C;  3QOJ A;  1SLJ A;  2NBF A;  5LMN L;  1YJN A;  1C48 A;  2JE6 I;  4OEM B;  5IYD H;  5JJZ A;  5D3I B;  5KGU A;  1XWE A;  2CVR A;  4X65 L;  2PQE A;  1JB7 A;  2F52 A;  4O0A A;  2JA9 A;  2QEJ C;  1JIC A;  1EYG A;  2WP8 J;  4HIO A;  1WTP A;  4JI6 L;  2CFM A;  1XJV A;  2F3V A;  3KFU A;  2Q8R E;  2EOT A;  3PUW A;  3H15 A;  5DM7 3;  2CHB D;  1Y1V B;  4JYA Q;  1SBB B;  1PTO D;  2N49 A;  3W5O A;  1K83 H;  3DXJ C;  3NTK A;  1F9P A;  1JWU D;  1PYW D;  4C3I B;  1LTS D;  3SE0 A;  3X3N A;  4BY1 B;  1GO3 E;  2XRQ D;  1Q7Y C;  1IBM Q;  4DR3 Q;  4IUU A;  2Z6K A;  3RMH A;  2JA6 G;  2K14 A;  2VNU D;  3A0J A;  1VQI A;  3V05 A;  2G5D A;  1QUQ B;  1L0W A;  1L2F A;  5GAD C;  1Z6H A;  2A69 D;  4C1N I;  4J15 A;  4P75 A;  5C4X B;  1AZP A;  5A35 A;  2H5X A;  3A55 A;  2VUM H;  3HOY H;  2HCC A;  2JN4 A;  4GN3 B;  1ENF A;  4LNQ A;  4QUF A;  1Q3L A;  1SJH D;  2CQO A;  3BVG A;  4BA1 I;  3KLR A;  4POG A;  4GZY C;  1B8A A;  1R9T B;  1CKO A;  2K5D A;  3PQI A;  3VR6 A;  1F9Q A;  1ENA A;  2LFN A;  2F0Q A;  2RDH A;  3D6W A;  3K6O A;  1R4Q B;  2ZJR A;  3CCV A;  4RGO S;  4ZUI A;  3GDE A;  4K0K Q;  4DAV A;  2SEB D;  1VMP A;  4BXX H;  1BR9 A;  1QE6 A;  1FNU A;  1CQV A;  1G2T A;  1PTO C;  1DZ1 A;  1PFS A;  2RCF A;  4HJ7 A;  1H9S B;  1Q90 A;  2N78 A;  1U4R A;  4RGT A;  4C3J H;  3URY A;  4C3H G;  5IY0 A;  1SXT A;  1VQN A;  2JYO A;  4XYO A;  3F2D A;  4KHP L;  3D31 A;  2DY7 A;  4BY1 H;  1FL0 A;  3RZD H;  4JV5 L;  5I9O A;  4IO9 A;  2NZO A;  2VXW A;  2O5I C;  4BBS H;  4A3E G;  3CHB D;  1A62 A;  3FP9 A;  4BBR H;  1VF7 A;  4GLX A;  2UUA L;  2R92 B;  2A69 C;  1TWH H;  5T1I A;  1HNW L;  1K3R A;  3MAQ A;  2JK8 A;  4J8Q A;  4UDU C;  5C4X H;  4DAP A;  4DR5 L;  4L8J A;  1EY5 A;  2JEA I;  1S5E D;  1EYC A;  3GTQ B;  5I9P A;  1KXL A;  1MBY A;  5LHY 1;  4A76 A;  1BKB A;  2Y0S E;  5EKK A;  5IGD A;  4QIW E;  3BZD B;  3D8G A;  4R9W A;  4BA2 I;  1H9J A;  3HKZ B;  1OTC A;  2HHH Q;  4DV6 Q;  5I4D A;  1Q1B A;  4LF4 Q;  1DCZ A;  4P71 A;  5A2Q E;  4JI7 L;  1STB A;  1PRT B;  1Y1W B;  1TS5 A;  3L9A X;  3LNN A;  1CQF A;  1I3Q B;  1J5E L;  1GUS A;  3HOW G;  3HOZ B;  1VQ5 A;  4S3S A;  1QJO A;  5GRO A;  2RHS B;  2ZJP A;  2YTV A;  1D1I A;  3P1H A;  3NHH A;  2FJ2 A;  3K5N A;  1TU2 B;  1GJX A;  1SAP A;  5FLM H;  4DAY A;  2EYF A;  2E5L L;  1K9M C;  2ZJQ A;  4PZ8 A;  2B2V A;  3Q6S A;  3DMU A;  1BF4 A;  3BZK A;  4X64 Q;  2R92 H;  4DF7 A;  3FKI G;  4IOC A;  4ID6 A;  3PO2 G;  1Q82 C;  4N9T A;  3TRE A;  1EZ8 A;  4K6L A;  1TWC B;  4A93 G;  3GTQ H;  2EY5 A;  1OXV A;  3PO3 B;  3M4P A;  3GQB A;  4ABN A;  3G6J B;  3S2H B;  3H3V C;  3J81 E;  4DXF A;  1PTO F;  1G6Z A;  3HZX A;  2K32 A;  5E3F A;  4G4K A;  4MIU A;  1X54 A;  3KBG A;  1IHZ A;  3RN5 A;  1QZG A;  2EDG A;  2JA5 B;  1IL8 A;  2BA0 A;  4MNO A;  1D8L A;  2EYH A;  2NUC A;  2L1B A;  1NNX A;  4OO1 G;  3TS2 A;  2H1E A;  4PZ7 A;  4A3I H;  3HOV G;  1Y1W H;  1U5K A;  1I3Q H;  2EJG C;  1N33 Q;  4LF5 L;  1NBW A;  4CJ1 B;  4X66 Q;  3MXP A;  2EJM A;  2EYP A;  2ID0 A;  3IFD A;  1ZKO A;  1GHK A;  1IYV A;  1EOV A;  4YHH L;  1XYI A;  2VW9 A;  3G4S A;  5AJ3 L;  1B4O A;  1E2W A;  5HUR A;  2O2L D;  5ELN A;  2AUK A;  3KF8 A;  3U58 A;  1STH A;  1HA5 A;  1UE7 A;  4G7Z C;  1DM0 B;  3I8Z A;  2FMM A;  2KCN A;  1SNC A;  3OTO Q;  1KL9 A;  1ONL A;  4HJA A;  4A3D H;  2BH8 A;  1TWC H;  3M7G A;  3MC0 B;  4K0K L;  1K0R A;  1QNK A;  2CKZ B;  4DUY Q;  3HGB A;  3PO3 H;  5M5Y B;  5DEH A;  2R7D A;  1HUM A;  2WB1 E;  2HQL A;  3S2H H;  5EAY A;  3GTO H;  4QIW B;  5L37 A;  2KHI A;  5COY A;  5IP9 H;  4B3R Q;  2JA5 H;  5JJL A;  5C4J B;  1LTI D;  1W2B A;  1RHP A;  4JI2 Q;  2V1C C;  5NUC A;  3H94 A;  1ML0 D;  3J7A 5;  3A5U A;  1UAP A;  2D9U A;  3LGJ A;  3S1R B;  4DV3 Q;  1NR4 A;  1VS0 A;  1RF2 D;  3TBI B;  3PIP A;  1LTA D;  3VYR A;  3KLS A;  3W1G A;  2RA4 A;  2XN9 C;  3NQT A;  2A73 B;  2OTL A;  3CF5 A;  1Z7T A;  2IPK D;  2JXM B;  4H02 A;  4HIK A;  1VQL A;  3E5S A;  2HQE A;  1XTC D;  2JA7 G;  2RSN A;  4G7O C;  5E1F A;  3CP0 A;  4Z9C B;  3K57 A;  4DV2 L;  4LUZ A;  1EIG A;  1HXY D;  1ESF A;  1MJC A;  4YCV A;  4XQN A;  2ZM6 L;  2AQ1 B;  2TMP A;  1STG A;  1EFI D;  2XTI A;  4A3B G;  4IFD I;  4DV6 L;  2V4D A;  1DOM A;  4NMZ A;  3LWU A;  4K14 A;  2EJF C;  1LM0 A;  1HR0 Q;  4JBK A;  1XNQ Q;  2QCP X;  3SVM A;  5IP7 H;  4A3C H;  4KLK A;  2ALY B;  4JVZ A;  1EQV A;  2O4X A;  4ZQ3 A;  4A3F G;  1E2Z A;  3ITP A;  4GS3 A;  5C0X G;  2R3Z A;  4IPD A;  4K6D A;  1PFM A;  1AW7 A;  4RMF A;  2R6G A;  4MZ9 A;  5M5X B;  2UU9 Q;  1EIH A;  4I65 A;  1DON A;  3I4O A;  3JAM i;  3FPU B;  1PYS B;  3PUY A;  2EXD A;  2EQS A;  1WVL A;  3IRB A;  3GD7 A;  2WFW A;  1W6J A;  2UUC Q;  4K2L A;  5IT9 L;  4HAE A;  3SK8 A;  5BN5 A;  5GAH C;  1TVX A;  1WTR A;  5ELF A;  3F2C A;  3A74 A;  1ENC A;  3OW2 A;  4EVO A;  1AH9 A;  3MXN A;  5CR3 A;  5C3E B;  1Q8K A;  2K5V A;  3QG1 A;  2JJQ A;  3HOX G;  5E4X A;  4CGY B;  5IGG A;  4G7H C;  5FOB B;  2EXZ A;  1CK1 A;  2F0T A;  4FXG C;  3RR5 A;  1N32 L;  3M85 A;  1IBL L;  1I4P A;  2NN6 H;  1KDC A;  2KVM A;  2PCF B;  4J1M A;  1C8C A;  2JEB I;  3GV3 A;  2B2Y C;  1JJC B;  5IYB H;  5IGF A;  4OWW B;  3AMU A;  2OQK A;  2RF4 A;  1J9O A;  1SYE A;  2PI2 A;  1A6X A;  2IHE A;  3LX0 A;  2WB1 B;  3DLL A;  5DNF A;  4GKJ Q;  3ULL A;  3H3V I;  1N33 L;  3I4M B;  4KJN A;  5EBC A;  3R2T A;  1MD2 D;  4DR2 Q;  1Y8O B;  1GD7 A;  1HHV A;  2I5L X;  1KAA A;  2MQH A;  2K33 A;  2QEX A;  2R61 A;  2XWB B;  5M5X H;  1G2S A;  1DYQ A;  3J7Y W;  2A8V A;  4XQJ A;  3I2Z A;  3F2U A;  2F0W A;  2KUM A;  5LMN Q;  3OWF A;  2F0U A;  2UUB L;  4HN7 A;  2JA8 B;  2ZXO A;  2FIN B;  1VQJ A;  4X65 Q;  5IYC G;  1JR0 D;  4HID A;  1WCM B;  5C3E H;  4Y7N B;  1KNE A;  4KN7 C;  5KYL A;  4JI6 Q;  2Z1C A;  4PMC A;  4H0L C;  1AFP A;  4DR7 L;  1K8M A;  2L55 A;  2DUD A;  4A3L G;  1QG7 A;  1V1O A;  1Q81 C;  1LAC A;  2B63 H;  1LTT D;  1U9R A;  1YBY A;  3PIO A;  4JI2 L;  1W6K A;  4C2M H;  3K5M A;  4AYB E;  4JBJ A;  3QOL A;  3H0G B;  2M2L A;  2K04 A;  2PZW A;  1IYJ B;  1JQY D;  1Q46 A;  3I4M H;  3GTG B;  1L0Y B;  1SMX A;  2F0J A;  1WTH A;  3SGI A;  2UXD L;  1KDA A;  1PFN A;  3D0F A;  1EOT A;  3QWN A;  1SFO B;  2OEO A;  2XRS D;  3K8A A;  3VR5 A;  5CV6 A;  5C44 B;  2F0I A;  1SE4 A;  4KJO A;  1KAW A;  1WTW A;  3W3A A;  1K8O A;  4IAL A;  1MJE A;  2VS1 A;  4QY7 A;  1YNN D;  4FVM A;  4GKK L;  5IYD G;  1X65 A;  3MFY A;  4RH6 A;  3S2D B;  5C4Z A;  3MEH A;  4DV7 L;  1KRT A;  2JA8 H;  2F0H A;  3V96 A;  1E1T A;  4IJL A;  2GVA A;  1NY4 A;  4B3T Q;  3TDQ A;  2BDN A;  5BN3 A;  2M9V A;  1GXD C;  3C46 A;  1XPU A;  1EIF A;  2N55 A;  1NTG A;  4DAM A;  1VQ4 A;  1S40 A;  1SRU A;  2DNC A;  2QIL A;  1O7Y A;  1SNM A;  1HR0 W;  3T53 B;  2WV6 D;  2B3G A;  4MTK A;  3J80 L;  3JAM c;  4L5R C;  3OIP A;  2R7F A;  2WAQ B;  2AKW B;  4FF4 A;  4KHP Q;  2YTX A;  1EY6 A;  2B2T A;  4NW2 A;  4JV5 Q;  1RTO A;  3MHB A;  1BVS A;  2UUA Q;  3RZO B;  1PZK D;  1HNW Q;  2VUM G;  1F2Y A;  3HOY G;  3B6Y A;  2XIW A;  4DR5 Q;  1G8Z D;  1OO9 B;  2EY2 A;  1HQM C;  2K03 A;  2CWP A;  2D5D A;  1KTK A;  2MPM A;  4LF6 L;  4K5X A;  1HZA A;  4EGV A;  3PMF A;  2Q2H A;  1VQ8 A;  3A7A B;  1YNN C;  3I73 A;  2NVT B;  1QNU A;  1L1O B;  3EQL C;  1VQB A;  5C5M A;  4HR7 B;  3CRL C;  1B7Y B;  4MN3 A;  1Y8N B;  4LMQ D;  4XT3 B;  5C4H A;  2F0S A;  2OWO A;  2F0K A;  1CHQ D;  3UE1 A;  1A3T A;  1B9N A;  2JSO A;  1AP0 A;  3SK4 A;  2ENB A;  4R4O A;  5CV4 A;  1DD2 A;  1WD1 A;  1HTP A;  3KLS X;  4BXX G;  4GKJ L;  1YZ6 A;  4JI7 Q;  2F4V L;  1ZEQ X;  1HNX L;  4UP9 A;  1J5E Q;  2F0P A;  4OWX B;  1UE5 A;  3NP8 A;  4C3J G;  4RKL A;  4U68 A;  5K5P A;  4LFB Q;  4L5Q A;  3BU2 A;  3I4N B;  5M5W B;  4R8N A;  4BY1 G; 
#chains in the Genus database with same CATH homology
 2QDB A;  5JPM C;  1EY9 A;  1B9M A;  3NTI A;  1AEX A;  2KA7 A;  1TY2 A;  3TP8 A;  2B2U A;  3OMC A;  5CYU A;  4QCL A;  4FP5 D;  5D3D A;  2J4X A;  3RD4 A;  1SSO A;  1SYG A;  2IX3 A;  2VB2 X;  3VA7 A;  5C5L A;  1FD7 D;  2F03 A;  1QWY A;  4RGM A;  3FMC A;  3MXU A;  2QKI C;  2F0L A;  3DEP A;  3TSS A;  4B08 A;  1X32 A;  5C6A A;  1F2M A;  3OPO A;  1GOZ A;  1O80 A;  2MJ8 A;  1JWM D;  4ZLT F;  1U4P A;  3SXH A;  2K5W A;  1SJE D;  3H91 A;  4IUN A;  4WOR A;  1D5Z C;  4U67 3;  3VR2 A;  4L63 B;  3DM1 A;  2RBM A;  2Q8I B;  2B2W A;  3OOC A;  1O78 A;  3G7L A;  3V2T A;  1TQO A;  1PRT F;  3OHX C;  2C5C A;  4KY5 A;  5C3W A;  1NAP A;  1QB5 D;  2F0M A;  3UI2 A;  1PDQ A;  1H9M A;  2A6E D;  3VYT A;  3WOF A;  2WAC A;  4DFA A;  1JB3 A;  1GUN A;  5JVH 3;  1EL0 A;  3HOU B;  3AU7 A;  5I2X A;  3DHQ A;  3GTK B;  2JA6 B;  3CKI B;  3QJY A;  2ICE C;  1C4Q A;  5JVG 3;  1SYF A;  2DNE A;  4H7B A;  1ILP A;  1L0X B;  1GUG A;  2MHV A;  2DY8 A;  2Z8L A;  3NXW A;  2F0D A;  5J22 A;  3ERQ A;  2WKD A;  3SK5 A;  5JEA H;  1ROD A;  2G9H D;  1IKL A;  4PV1 C;  3J7A V;  1NUC A;  1LTG D;  3BDC A;  1OXX K;  4ULL A;  5M3F B;  2A6E C;  2PMZ B;  5EPK A;  1Q12 A;  1SYB A;  4QF4 A;  1T5X D;  3DWP A;  1I6H B;  1I50 B;  1S5B D;  3D3R A;  1EWC A;  4HCS A;  3A8I E;  3MA2 B;  1D5X C;  4A3E B;  4FF1 A;  4JK1 C;  3C3L A;  4CJ0 B;  1H9K A;  1MSG A;  1OXT A;  2LMC B;  1IW7 D;  1TS2 A;  5M3M B;  4JBW A;  5FLX E;  1SNP A;  2PYK A;  3P20 A;  3OW7 A;  1ICW A;  2F0G A;  4KD3 A;  1SE2 A;  3A8K E;  4NKL A;  5EPJ A;  2B2V C;  5CV5 A;  4NP5 A;  4WFN 3;  1SE3 A;  4HSP A;  5AFW A;  4DK1 A;  1RCV D;  5KND A;  1JOK A;  4BS9 A;  4IUV A;  1T5E A;  2IX1 A;  5CV8 A;  4N9P A;  3R3O A;  3OIQ A;  2J7Z A;  5K36 H;  1F77 A;  3GTL B;  4CHT B;  1JCK B;  1TWF B;  5EJW A;  3PIP 3;  1IW7 C;  4DNT B;  3OWE B;  3FKI B;  3PO2 B;  4A3K B;  2EY1 A;  4C56 C;  2E2D C;  1Q8I A;  4KD4 A;  1JOO A;  1MI2 A;  2Y0S B;  1B53 A;  2ZXP A;  1LO5 D;  4WRD A;  2K6A A;  2I46 A;  4CKE A;  2NN6 G;  4TKO B;  5EKI A;  3WDN A;  2Z4H A;  3S16 B;  1BCP F;  4IN3 A;  1E0B A;  2NVY B;  2RVL A;  4OO1 I;  2K5Q A;  4IUQ A;  1CT1 D;  2IL8 A;  1WTX A;  3MVV A;  1FNV A;  3KBX A;  2WIN B;  4Q0F A;  1PTO B;  1LAB A;  3DEO A;  4RFB A;  2WII B;  2E75 C;  2EVB A;  4HMJ A;  1CHP D;  4KKS A;  1EYA A;  3S1N B;  3PUV A;  4CBV A;  3GTP B;  5JPN C;  4P2C B;  2K1B A;  1EWH A;  1HCZ A;  2G9D A;  3D4R A;  2N88 A;  1J8I A;  5EKL A;  2KCC A;  3JAM E;  1B1Z A;  4F7X A;  3BYT B;  4FXK C;  3T56 B;  3S14 B;  1F2L A;  3I90 A;  3HRZ C;  3GO5 A;  3TZU A;  3TZD A;  3HEJ A;  2F0F A;  1NCV A;  1STN A;  2A68 C;  3FEW X;  2KQ3 A;  1PTO H;  4C1N K;  4K5W A;  4ZK9 B;  3ERO A;  5FO7 B;  2JA7 B;  3IFT A;  1X3P A;  2E2I B;  2KED A;  4QMG A;  3SK6 A;  2H4O A;  3SR1 A;  1DXM A;  3TP6 A;  2JP1 A;  2YU9 B;  1M4V A;  3BS1 A;  1V43 A;  4RCO A;  4IFD H;  4CKC A;  4KMU C;  1KLU D;  1LT5 D;  3EFX D;  2A5H A;  3IL8 A;  1PMR A;  4KHZ A;  4ZYS A;  1WD0 A;  4I7Z C;  4ZAI A;  2Z4I A;  1OXU A;  5C0X I;  3PIO 3;  1VF5 C;  4A3F B;  1BXT A;  4O1N A;  4XTC S;  3PUX A;  3L3O C;  4E6I A;  3N6R A;  4UAI A;  2LKV A;  3BG3 A;  3O13 A;  5FO8 B;  3MTS A;  1A3V A;  2E2H B;  4KK7 A;  5G3L D;  2F4I A;  3SHL A;  3DUZ A;  4XXE A;  2C9O A;  2SNM A;  4DXG A;  2NYZ D;  3PV0 A;  5KEE A;  2IX0 A;  1EQT A;  3HOX B;  3PUZ A;  2L5T A;  4PQX A;  3NWS A;  4H44 C;  1EU4 A;  1SNO A;  4EQN A;  2KEE A;  4A3G B;  1SNQ A;  2X6L A;  3M3Y B;  1HFN A;  3A54 A;  4Q5V A;  3I91 A;  2EPB A;  3MWY W;  2EY6 A;  3EA6 A;  3GTJ B;  2YYZ A;  1H9S A;  5IOD A;  1B2T A;  3K5L A;  5C0X H;  1TR5 A;  4KTA A;  1VMC A;  3S1Q B;  1KNA A;  4RHS A;  1YNJ D;  1EY4 A;  3NQI A;  2X6G A;  1HRJ A;  1F9S A;  2K05 A;  1HPC A;  2IWH A;  3EJI A;  2BE5 D;  2XSC A;  1PRT D;  2CQA A;  5BN4 A;  1KAB A;  5D65 A;  3ZYY X;  5I6Y A;  2K28 A;  3SEB A;  2R93 B;  2D62 A;  1UNS A;  3HS0 C;  4EQO A;  4KV6 A;  3W2D A;  3S9W A;  3P7J A;  1MGS A;  3P75 A;  1RDP D;  3DWQ A;  1SEB D;  5IT9 E;  4OL7 A;  2FHT A;  5JEA J;  5D14 A;  1I4X A;  3GTM B;  3MFG A;  3X3M A;  3T16 A;  2KHS A;  1OXS C;  3VA5 A;  4DU9 A;  3K7A B;  3M4Y A;  4KI0 A;  4RGN A;  1YNJ C;  3SDZ A;  3M4O B;  4ZKC B;  5E4W C;  1Q1E A;  2PPB C;  4MHE A;  5DAU A;  2B2T C;  3NTH A;  3OSO A;  2OF1 A;  1SMY D;  3HG9 A;  2BE5 C;  1PRT C;  1CTM A;  2R7Z B;  2AUJ D;  5JOB A;  2J0T D;  2A74 C;  4M1U B;  1ESR A;  1ZYR D;  2RDF A;  4TQU S;  1QIL A;  1HTL D;  1RKN A;  2ICI A;  4C3I G;  4X3K A;  3VR3 A;  2IJ0 A;  1EYD A;  4OHJ A;  4AYB B;  1SND A;  5LL6 S;  1TWG B;  3TP7 A;  5G3L F;  1EY8 A;  1O7L A;  5A2Q L;  4ILW A;  3I70 A;  2ZXR A;  3HOY B;  2VUM B;  4FYD A;  1CFM A;  5JEA G;  3TME A;  1JC7 A;  4XQQ A;  1SMY C;  3A8J E;  2X69 A;  2F3W A;  1JOQ A;  1ZYR C;  3AB9 A;  2B2U C;  5M9O A;  1I4R A;  3FPP A;  5TSS A;  3K0Y A;  3H09 A;  5FLX L;  3J81 L;  3E0J A;  2NZ1 D;  4C3J B;  1XX8 A;  5FKA C;  1BQQ T;  2HCI A;  1I6V C;  3R8B A;  2AWO A;  4LAA A;  3RZD B;  1NSN S;  4BBS B;  1FGB D;  4FF3 A;  1AZQ A;  4BBR B;  1EEI D;  4HSV A;  1SDF A;  1TWH B;  2PW7 A;  2A6H D;  4XDX A;  1MSH A;  4LK1 C;  2E2J B;  2K7V A;  3J80 E;  4WJW A;  2D2C C;  2L0C A;  3FRP B;  2AWN A;  5ELC A;  1S5F D;  4BY7 B;  3S1M B;  1ET6 A;  5EQ0 A;  2L4N A;  2HDM A;  3T13 A;  2TSS A;  1Z47 A;  2VB3 X;  1WTQ A;  4RKB A;  4HED A;  1BCP D;  4H13 C;  3S17 B;  2NTT A;  2B2W C;  1LT3 D;  1VCI A;  1CA6 A;  4F88 A;  1QCB D;  1F2Z A;  4BWG B;  1D5M C;  3FDT A;  5K36 G;  2RSO A;  3IAY A;  3FVQ A;  4RAU C;  1XXG A;  1CI3 M;  3A7L A;  4HCE A;  1CM9 A;  2A6H C;  2PZT A;  1PZI D;  1RD9 D;  3QO2 A;  3VYS A;  1RTN A;  5CV9 A;  2L12 A;  1TT2 A;  5CGK A;  1BUV T;  2E74 C;  5CBE E;  3Q22 A;  4F8M A;  4O42 A;  3D4D A;  2WKC A;  3S15 B;  1I4Q A;  1TS3 A;  4C3H B;  1BCP C;  3TP5 A;  1I4G A;  3BDL A;  5CV7 A;  4A3I B;  1M8A A;  4B9X A;  3L7Z C;  1EZ6 A;  3C1E A;  4V19 0;  2NB0 A;  4FF2 A;  4IZ8 A;  5KNB A;  4IFD J;  1TII D;  1B3A A;  3JAM L;  2O5J C;  3GV6 A;  1WTO A;  5IOC A;  4K8I A;  2RQX A;  4IUP A;  4KHV A;  1PLF A;  4EQP A;  1JE4 A;  1ZXT A;  4IQZ A;  5IGB A;  2EE1 A;  4A3D B;  4TRD A;  5HGT A;  4DGZ A;  2OXP A;  3GTO B;  2SDF A;  1D6E C;  3HOW B;  1CZW A;  5IGC A;  1STA A;  2AQ2 B;  3KUP A;  1JWS D;  3NBH A;  4K2K A;  1V1P B;  2MGS A;  3D6C A;  4XYQ A;  2EYO A;  1PFB A;  1TS4 A;  1UEA B;  2LY7 A;  2XVS A;  3KK7 A;  2CW0 D;  3ONA B;  1LTB D;  3NWT A;  4KKT A;  1VDZ A;  4IUT A;  3NE5 B;  1Y8P B;  2E76 C;  2FFK B;  3BVM A;  1LLR D;  4DA2 A;  2M00 A;  4DNR B;  4OGQ C;  2NVQ B;  4RWS C;  3CRK C;  1DJR D;  1E2V A;  1GHJ A;  4QB4 A;  4CKB A;  1B44 D;  4A93 B;  5EBD A;  3VR4 A;  2B8G A;  5KIX A;  4PMW A;  1Y69 U;  1RJT A;  4HMI A;  5IGE A;  2I07 B;  3Q0A A;  5C0X J;  3E6Z X;  4IFD G;  3NPP A;  4OIK A;  2OT2 A;  3K59 A;  1BDO A;  1PXU A;  3HOV B;  5JAV A;  4KKU A;  1F9R A;  3Q24 A;  1EEF D;  1LT4 D;  5FO9 B;  4K8J A;  2A68 D;  1R4P B;  3U9O A;  3ND8 A;  1SYD A;  4HTH A;  3MZ5 A;  3HP3 A;  2CW0 C;  3IKJ A;  3DWA A;  2EYJ A;  1G29 1;  2SNS A;  2F0V A;  4G57 A;  3NK9 A;  1JOR A;  3Q23 A;  3A56 A;  3M7N A;  4V0B A;  2L9H A;  4ME5 A;  5J1Z A;  1EY7 A;  1EY0 A;  4F87 A;  2NVX B;  3BVZ A;  2PW5 A;  2EZV A;  1FR3 A;  5I6W A;  1UUP A;  3I72 A;  1FNW A;  5F2D A;  1ET9 A;  2NN6 I;  2AQ3 B;  2L11 A;  4XT1 B;  5LL6 X;  4KY6 A;  1ILQ A;  2FMC A;  1EU3 A;  4OO1 H;  5CMD A;  4R8I A;  3T51 B;  1KLG D;  1IYU A;  5FK9 C;  4PMB A;  2F0E A;  2K01 A;  4ODG A;  3VYU A;  3QB3 A;  1GUT A;  4QUC A;  1A3U A;  5T1G A;  1PZJ D;  2B2Y A;  1BCP B;  2KOL A;  5EPL A;  3CQZ B;  3C2P A;  2GA4 B;  4LJZ C;  1HA6 A;  3U9S A;  3NUC A;  1QOH A;  3K58 A;  4A3B B;  1STY A;  1HQR D;  4X3S A;  3WOE A;  5CC4 A;  2B63 B;  2QF7 A;  5KNC A;  3BYY B;  4C2M B;  3TN2 A;  2ZT9 C;  3N52 A;  2PZU A;  1X3Q A;  2BOS A;  2F0N A;  4CJ2 C;  2EYL A;  2LS0 1;  3T4A C;  1GUW A;  5C3X A;  4KY7 A;  1WTV A;  3D4W A;  1BNZ A;  1HFG A;  3R2I A;  2XNA C;  4OIJ A;  2NTS A;  5IIF A;  3ND9 A;  3LWE A;  2BDO A;  4ZKB B;  4NDX A;  1A2U A;  1KDB A;  2HUG A;  2XWJ B;  3J7A F;  1GUO A;  2SOB A;  5ISR A;  2MUY A;  4K5V A;  1H9R A;  2BA1 A;  5ELD A;  2HDL A;  3I4L A;  4IUR A;  1FYC A;  2KEC A;  1DOL A;  5I2Y A;  5CBA E;  2PO4 A;  3CU7 A;  4FXD A;  4ZRZ A;  3I3C A;  1NR2 A;  4RHR A;  3GP7 A;  4X3T A;  2MP1 A;  1TWA B;  5ELB A;  2B8F A;  1D1K A;  3BDO A;  4ZUJ A;  3RUZ A;  2EYM A;  3C1F A;  4B9W A;  3R93 A;  1II3 A;  5DM6 3;  4X3U A;  1SYC A;  5ELE A;  1BOS A;  1D2B A;  5COR A;  1DOK A;  1S4Z A;  2NWG A;  1G91 A;  5EGT A;  4FO2 A;  1S5D D;  3EVQ A;  4A3M B;  2KJX A;  4FNF A;  1TY0 A;  3OMG A;  1HUN A;  3NSW A;  1B50 A;  2B39 A;  2PNR C;  5KYI A;  1A15 A;  1BO0 A;  4DN4 M;  4M8A A;  1U4M A;  4RA8 A;  1LV9 A;  1CA5 A;  1A2T A;  4KN4 C;  2F1M A;  1S5C D;  2RDG A;  1TKW B;  1LTR D;  4TSS A;  4YIJ A;  1K83 B;  3H6M A;  4A3J B;  2F0O A;  1AN8 A;  3RLF A;  4DK0 A;  1I4H A;  1O7Z A;  1V8Q A;  4XIG S;  2IW3 A;  2BCO A;  4L6T B;  2IT1 A;  3NBI A;  3MXG A;  4J6H A;  3K5O A;  4PNY A;  1STE A;  2RKS A;  1V1P A;  2DN8 A;  5KRU A;  1BBX C;  4RCN A;  1IKM A;  2Q8T A;  5J39 A;  1LT6 D;  3QIA A;  1U4L A;  1CZG A;  3QOJ A;  2NBF A;  1C48 A;  2JE6 I;  5JJZ A;  5D3I B;  5KGU A;  1XWE A;  2CVR A;  2PQE A;  2QEJ C;  1JIC A;  2WP8 J;  1WTP A;  2F3V A;  2Q8R E;  2EOT A;  3PUW A;  5DM7 3;  2CHB D;  1Y1V B;  1SBB B;  1PTO D;  3DXJ C;  3NTK A;  1F9P A;  1JWU D;  1PYW D;  4C3I B;  1LTS D;  3SE0 A;  3X3N A;  4BY1 B;  2XRQ D;  4IUU A;  3RMH A;  2VNU D;  3V05 A;  1Z6H A;  2A69 D;  4C1N I;  5C4X B;  1AZP A;  5A35 A;  3A55 A;  2HCC A;  1ENF A;  4QUF A;  1Q3L A;  1SJH D;  3BVG A;  4BA1 I;  3KLR A;  4GZY C;  1R9T B;  2K5D A;  3VR6 A;  1F9Q A;  1ENA A;  2LFN A;  2F0Q A;  2RDH A;  3D6W A;  3K6O A;  1R4Q B;  4RGO S;  4ZUI A;  4DAV A;  2SEB D;  1VMP A;  1BR9 A;  1QE6 A;  1FNU A;  1CQV A;  1G2T A;  1PTO C;  1DZ1 A;  1H9S B;  1Q90 A;  1U4R A;  4RGT A;  3URY A;  4C3H G;  1SXT A;  2JYO A;  4XYO A;  3D31 A;  2DY7 A;  5I9O A;  2O5I C;  2VXW A;  3CHB D;  1VF7 A;  2R92 B;  2A69 C;  5T1I A;  3MAQ A;  4J8Q A;  4UDU C;  4DAP A;  4L8J A;  1EY5 A;  2JEA I;  1S5E D;  1EYC A;  3GTQ B;  5I9P A;  1MBY A;  5LHY 1;  5IGD A;  5EKK A;  3BZD B;  3D8G A;  4R9W A;  4BA2 I;  1H9J A;  3HKZ B;  5I4D A;  1Q1B A;  1DCZ A;  5A2Q E;  1STB A;  1PRT B;  1Y1W B;  1TS5 A;  3L9A X;  3LNN A;  1CQF A;  1I3Q B;  3HOZ B;  1GUS A;  4S3S A;  1QJO A;  1D1I A;  3P1H A;  3NHH A;  2FJ2 A;  3K5N A;  1TU2 B;  1GJX A;  1SAP A;  4DAY A;  2EYF A;  2B2V A;  3Q6S A;  3DMU A;  1BF4 A;  4DF7 A;  4ID6 A;  4N9T A;  1EZ8 A;  4K6L A;  1TWC B;  2EY5 A;  1OXV A;  3PO3 B;  3GQB A;  4ABN A;  3G6J B;  3S2H B;  3H3V C;  3J81 E;  4DXF A;  1PTO F;  1G6Z A;  3HZX A;  2K32 A;  5E3F A;  4G4K A;  4MIU A;  3KBG A;  1IHZ A;  2EDG A;  2JA5 B;  1IL8 A;  2BA0 A;  2EYH A;  2NUC A;  2L1B A;  4OO1 G;  2H1E A;  2EJG C;  4CJ1 B;  3MXP A;  2EJM A;  2EYP A;  2ID0 A;  3IFD A;  1ZKO A;  1GHK A;  1IYV A;  1XYI A;  1B4O A;  1E2W A;  5HUR A;  2O2L D;  2AUK A;  3KF8 A;  1STH A;  1HA5 A;  4G7Z C;  1DM0 B;  3I8Z A;  2FMM A;  2KCN A;  1SNC A;  1ONL A;  3M7G A;  3MC0 B;  1QNK A;  5M5Y B;  3HGB A;  5DEH A;  1HUM A;  4QIW B;  5COY A;  5C4J B;  1LTI D;  1RHP A;  5NUC A;  3H94 A;  1ML0 D;  1UAP A;  2D9U A;  3S1R B;  1NR4 A;  1RF2 D;  3TBI B;  1LTA D;  3VYR A;  3KLS A;  2RA4 A;  2XN9 C;  3NQT A;  2A73 B;  1Z7T A;  2IPK D;  2JXM B;  3E5S A;  2HQE A;  1XTC D;  2RSN A;  4G7O C;  5E1F A;  4Z9C B;  3K57 A;  1EIG A;  1HXY D;  1ESF A;  4XQN A;  2AQ1 B;  2TMP A;  1STG A;  1EFI D;  4IFD I;  2V4D A;  1DOM A;  4NMZ A;  3LWU A;  4K14 A;  2EJF C;  2QCP X;  3SVM A;  1EQV A;  2O4X A;  4ZQ3 A;  1E2Z A;  3ITP A;  5C0X G;  2R3Z A;  4K6D A;  1PFM A;  1AW7 A;  2R6G A;  5M5X B;  1EIH A;  4I65 A;  1DON A;  3FPU B;  3PUY A;  1WVL A;  3GD7 A;  1W6J A;  4K2L A;  5IT9 L;  4HAE A;  3SK8 A;  5BN5 A;  1TVX A;  1WTR A;  5ELF A;  1ENC A;  4EVO A;  3MXN A;  5CR3 A;  5C3E B;  3QG1 A;  5E4X A;  4CGY B;  5IGG A;  4G7H C;  5FOB B;  2EXZ A;  1CK1 A;  2F0T A;  4FXG C;  3M85 A;  1I4P A;  2NN6 H;  1KDC A;  2KVM A;  2PCF B;  4J1M A;  1C8C A;  2JEB I;  3GV3 A;  2B2Y C;  5IGF A;  3AMU A;  1J9O A;  1SYE A;  1A6X A;  3LX0 A;  2WB1 B;  5DNF A;  3I4M B;  4KJN A;  5EBC A;  3R2T A;  1MD2 D;  1HHV A;  1Y8O B;  1KAA A;  2K33 A;  2R61 A;  2XWB B;  1G2S A;  1DYQ A;  3J7Y W;  4XQJ A;  3F2U A;  2F0W A;  2KUM A;  3OWF A;  2F0U A;  4HN7 A;  2JA8 B;  2ZXO A;  2FIN B;  1JR0 D;  1WCM B;  4Y7N B;  1KNE A;  4KN7 C;  5KYL A;  2Z1C A;  4PMC A;  4H0L C;  1AFP A;  1K8M A;  2L55 A;  1QG7 A;  1V1O A;  1LAC A;  1LTT D;  1U9R A;  1W6K A;  3K5M A;  3QOL A;  3H0G B;  2M2L A;  2K04 A;  2PZW A;  1JQY D;  3GTG B;  1L0Y B;  2F0J A;  1KDA A;  1PFN A;  1EOT A;  3QWN A;  1SFO B;  2OEO A;  2XRS D;  3VR5 A;  5CV6 A;  5C44 B;  2F0I A;  1SE4 A;  4KJO A;  1WTW A;  3W3A A;  1K8O A;  4IAL A;  1YNN D;  4FVM A;  3MFY A;  4RH6 A;  3S2D B;  5C4Z A;  3MEH A;  2F0H A;  3V96 A;  3TDQ A;  2BDN A;  5BN3 A;  2M9V A;  1GXD C;  3C46 A;  2N55 A;  2DNC A;  2QIL A;  1O7Y A;  1SNM A;  3T53 B;  2WV6 D;  3J80 L;  3OIP A;  2WAQ B;  4FF4 A;  1EY6 A;  2B2T A;  4NW2 A;  1RTO A;  3MHB A;  3RZO B;  1PZK D;  1F2Y A;  2XIW A;  1G8Z D;  1OO9 B;  2EY2 A;  1HQM C;  2K03 A;  2D5D A;  1KTK A;  2MPM A;  4K5X A;  4EGV A;  3PMF A;  3A7A B;  1YNN C;  3I73 A;  2NVT B;  1QNU A;  3EQL C;  5C5M A;  4HR7 B;  3CRL C;  4MN3 A;  1Y8N B;  4LMQ D;  4XT3 B;  5C4H A;  2F0S A;  2F0K A;  1CHQ D;  1A3T A;  1B9N A;  2JSO A;  1AP0 A;  3SK4 A;  2ENB A;  5CV4 A;  1DD2 A;  1WD1 A;  1HTP A;  3KLS X;  1ZEQ X;  2F0P A;  3NP8 A;  4C3J G;  4RKL A;  4U68 A;  5K5P A;  3I4N B;  5M5W B;  4R8N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...