1EY6A

Structure of s. nuclease stabilizing mutant t41i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDIPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 37
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ey6A00
3R3OA 1EZ6A 2SOBA 4R8NA 5CR3A 4EQNA 5C4HA 5IODA 3SHLA 1SNMA 5IGDA 5CV4A 4PMBA 3OMCA 3QOJA 3SK8A 5C5LA 5C4ZA 1ENAA 1A3UA 1SYFA 3OMGA 1STGA 4NDXA 5C5MA 2KQ3A 4ZQ3A 4KY6A 3SR1A 4N9PA 5ISRA 1STAA 2PQEA 4DF7A 3BDCA 1EY9A 1SYDA 4K8IA 4K5VA 4ODGA 4F8MA 3MEHA 3C1EA 4E6IA 2HQEA 4KJNA 4HMIA 5CC4A 5KYIA 5KEEA 2KHSA 2F0JA 4ID6A 2F0PA 3P75A 1F2MA 1SNPA 5E3FA 5F2DA 2OEOA 3ERQA 2O4XA 3SXHA 1SYGA 1F2ZA 3SK6A 3OWFA 4ME5A 4QMGA 2F0EA 3PMFA 4TRDA 5KIXA 3T13A 3NK9A 1A3VA 3NQTA 5DEHA 2F0LA 1JORA 3V2TA 1STHA 2F0MA 2LKVA 5C3XA 4KY7A 1SNCA 4EQPA 3QB3A 5J39A 4K6DA 1EYAA 3DMUA 3EJIA 2RBMA 4QB4A 2F0KA 2F0FA 2F0HA 2F0QA 2EY1A 3T16A 1TQOA 3MHBA 3SK5A 5CV7A 2F3VA 4WORA 1ENCA 5EKKA 5CV6A 3E5SA 3SK4A 4H7BA 4EVOA 2F0IA 2F0VA 4K8JA 3NUCA 3MVVA 4KY5A 1EYCA 1EY7A 1A2TA 5IGFA 4N9TA 5K5PA 3C1FA 1AEXA 2EYMA 4PMCA 2EY5A 2OXPA 1KDCA 4K2KA 4J1MA 4K2LA 3TP7A 3QOLA 4RKBA 4IALA 3LX0A 5CV9A 5C6AA 1U9RA 4DU9A 4KTAA 1EY5A 5KYLA 1SNOA 4PNYA 4OL7A 4WRDA 4K5WA 3TMEA 5I9PA 1NUCA 4G57A 1IHZA 3BDLA 2F0NA 1JOOA 1KABA 1KDAA 4B9XA 1EY8A 2PYKA 4HTHA 5KGUA 4KV6A 1II3A 1SYBA 3NHHA 4QF4A 1KDBA 1EQVA 2EY6A 3EROA 5EKLA 1SNDA 4I65A 5EGTA 2F0OA 3U9OA 2WACA 4ZUJA 2QDBA 4DFAA 2EXZA 5NUCA 2EY2A 4DGZA 5I6WA 2ENBA 2PW5A 2F0WA 3TP8A 2F0TA 3TP5A 3RUZA 5HGTA 5CV8A 3H6MA 5E1FA 5I6YA 5I9OA 1NSNS 2PW7A 2SNMA 4EQOA 1A3TA 5JAVA 3NXWA 3S9WA 4MIUA 4LAAA 3D6CA 3HZXA 5J1ZA 3D8GA 1EYDA 2F0DA 3P1HA 4S3SA 4KD3A 2RDFA 1JOQA 3MXPA 4K14A 2OF1A 1RKNA 5IGGA 5CGKA 5IOCA 1TR5A 2PZTA 1F2YA 2EYPA 4RKLA 4NKLA 1STBA 1EY6A 1STNA 2EYHA 3D4DA 1SYEA 3OSOA 4HMJA 5CV5A 5DAUA 5IGBA 1EY0A 5KRUA 5M9OA 2PZUA 3DHQA 5IGCA 4B9WA 5IGEA 5IIFA 2F0GA 2EYLA 3D4WA 4YIJA 4K5XA 4NMZA 2PZWA 2RKSA 4F7XA 2SNSA 1SYCA 1A2UA 4IZ8A 2F0SA 1TT2A 3EVQA 3MZ5A 4ZUIA 4NP5A 4J6HA 3ITPA 5J22A 3HEJA 2EYJA 2F0UA 3TP6A 1JOKA 1STYA 3NP8A 4KJOA 1EY4A 4IUNA 2NUCA 4KHVA 5JOBA 4KD4A 2EYOA 5C3WA 1SNQA 1EZ8A 2EYFA 5HURA 1KAAA 2M00A 2F3WA 3VA5A
chains in the Genus database with same CATH superfamily
4LFCQ 1STEA 1Q3LA 2F3IA 4AQYL 2NYZD 1B7YB 1EEFD 2TMPA 4NDXA 3K58A 1TXYA 3SR1A 2XN9C 3UE1A 2UUCL 2KECA 4K5VA 4OX9L 4E6IA 1N32L 1RTOA 4A3JB 3LWEA 2KHSA 1H9RA 1R4PB 4ID6A 4FNFA 1PRTC 4DAMA 3H0GG 3SDZA 1PTOD 3G6JB 1DM0B 1YBYA 3OWFA 4JI3L 2AQ1B 4B3ML 1TS3A 2EOTA 3G4SA 2C35B 1SNCA 2CQOA 4CBVA 2K7VA 4A3KB 3DM1A 4OWXB 4HJ5A 2JQOA 2F4VL 5LMUL 1Q86C 3MHBA 4BBSB 1NR2A 2ZM6Q 5K36G 2E5LL 3SK4A 1N36Q 1CKNA 1IW7C 2WV6D 2F0IA 2K1BA 4K8JA 3AFQA 3I4MB 5KNBA 4JPBW 2K75A 4POGA 3Q24A 1A63A 2ES2A 4IFDH 4DV4Q 3QOLA 4A3GH 1YHBA 4JI1Q 3AU7A 4PNYA 4BY7G 4O42A 5FOBB 2E5LQ 1KDAA 1Q12A 4DR6L 3HOWB 2EY6A 1HNZQ 2HT1A 2B2VC 1LO5D 4LFBL 3L7ZC 3IKJA 4DFAA 3R8BA 1N8RC 2G5DA 4CJ2C 5IP9H 4YWKA 2CKZB 4R4QA 2K52A 1NNXA 2OCEA 3E3XA 4X3KA 4A3GG 2Z1CA 3E6ZX 2JA6H 1YJWA 4L6TB 3OWEB 2VXWA 3CAMA 2QEJC 2NTTA 1TR5A 1JWSD 1SYEA 1RDPD 4DV5L 2PZUA 3DHQA 3PF5A 3FPUB 3RLOA 3FMCA 2NN6H 2N88A 2RVLA 4IOCA 3K7UC 4JOIC 2LMCB 5JOBA 1IL8A 1XNRL 5M3MG 2NZ1D 1M4VA 4A3DB 5IYCH 5ELDA 4DV6Q 3OTOQ 4NB3A 3K5OA 3CF5A 3MFYA 3QOJA 4DV7Q 1NBWA 2FINB 3K8AA 1I6HB 1PTOF 3M3YB 1K0SA 3NBHA 5LL6S 3W5OA 1F77A 1C4QA 2C5CA 1K0RA 3C3LA 4H0LC 1JJGA 5D3IB 4DK3C 5C0XG 1E7ZA 3CMAA 1N9WA 2A68C 4Y7NH 4LF9L 1Y8OB 5LMNW 3ERQA 1NE3A 4X66Q 4QMGA 4DUZL 3H0GH 1ENFA 5CMDA 2KOLA 4KKTA 3G48A 2RBMA 1MSHA 1JCKB 3GTOH 3S16H 3DWPA 4JI0Q 4JBMA 2UUAL 4JI4Q 1ENCA 2CFMA 1G6PA 5EKIA 2CVRA 3DWQA 2AMCB 1GUTA 1PYSB 5BR8L 1F9SA 5D65A 2ASBA 4YWMA 2VZAA 1XNQL 5DM63 3NE5B 3E0JA 1XMQL 1O7IA 1EY5A 4DPGA 4AYBG 2EQSA 1VQDA 2AQ3B 4NXML 4LUZA 1V9PA 2KEEA 1CTMA 3F2UA 1EQVA 3HOXH 1H9KA 2AHOB 4DV1Q 2F0OA 3U9OA 4OIJA 3SE0A 2ZXRA 2PQAB 1TU2B 5M5WH 1PZKD 1UE1A 1LTID 1X54A 1QNUA 2KCTA 3TSSA 2Q2IA 2IY5B 3HOVG 3P1HA 3KUPA 3CPFA 5ELOA 4ALPA 3D6WA 2OF1A 2KCMA 2KENA 4L8JA 2OT2A 1K73C 3HOYG 3ZJYC 4FYDA 1QVCA 2A19A 1NAPA 3FRPB 1UE5A 1XJVA 4YIJA 4OX9Q 4ZCKA 2NVTB 2Y0SG 4NP5A 4AYBB 3OW7A 3DUZA 4KN7C 4Q0FA 1DD2A 3TP6A 2I07B 4A93H 1WCMH 4LF7L 3J7A5 1EQRA 1FVIA 4LFCL 1BCPD 1KXLA 2UUAQ 3H91A 5CR3A 4DXGA 3S24A 2C9OA 1QNKA 3RLNA 1N33Q 2NVQH 2JA9A 1BKBA 5IP9G 4P71A 3GTMB 2JA5G 3NTIA 2NB0A 1FGBD 3BJUA 4H13C 4ZQ3A 5EPLA 4DV0L 4CGYB 5JPMC 4EGVA 4UDUC 3H15A 3PUZA 5JPNC 4LK1C 1HR0W 4KKSA 3ULPA 3S2DB 1EIYB 1ASYA 1E22A 1PFSA 4DXFA 1K8OA 5E3FA 3GTQB 1KL9A 1SROA 1A0IA 4A3BH 1A3VA 3NSWA 2XNAC 1NTGA 4PQXA 3DMUA 1DJRD 4GNXC 4QL5A 3HOUG 4AH6A 3RN2A 1BO0A 3E9HA 4IJHA 1MD2D 5ELEA 1K28A 2FJ2A 2QKIC 3MVVA 1LM0A 1VQLA 5IGFA 5G3LD 3BU2A 4PMCA 1B1ZA 1FJGL 1YVCA 2M9VA 1YHAA 3LX0A 4BBRH 1KLGD 1FL0A 1GHKA 3L2PA 4I7ZC 3CD6A 1MI2A 1I50H 5JJZA 5FO7B 3S16B 4KV6A 1G291 1QCBD 4DV2Q 4KKUA 3BS1A 5CBAE 4B3TQ 1M8AA 1PH1A 1HZBA 4PZ7A 4DK6C 1FNUA 2XWBB 1GO3E 2F0WA 4CJ0B 3S15B 2BDOA 5JJKA 4JBJA 5EBDA 5LMNQ 4UP8A 3X3MA 5FLXc 3H3VH 1AH9A 2UXDQ 2J4XA 2FMCA 3Q6SA 5D14A 1WTVA 1WTHA 3MXPA 3Q0AA 1QILA 1VQ4A 3CCSA 3S17B 5IGGA 5ELNA 3AMUA 1VQ7A 4DV3Q 2BE5D 4HMJA 3OSOA 4IPGA 1TWGB 1QZHA 3W1GA 1HR0L 3A54A 3TS2A 1IYJB 1PA6A 4QCLA 2A6HC 2RKSA 4NW2A 2IJ0A 2XGTA 1GUOA 1Y1VG 1MHWC 2RSOA 3FDTA 1HNWQ 2AWNA 1H9MA 1F9QA 1LT5D 3NTHA 2F0UA 4FXGC 2RSNA 4QIWE 2J0TD 3MXUA 4XDXA 3HOXG 2M00A 3OMGA 2SOBA 4UPAA 4XXEA 1Q46A 2L9HA 2BA1A 4ZLTF 2JP1A 3DXJC 3OYYA 3M4OB 1CT1D 4A3IB 4C3HB 2SDFA 1I4XA 5C4JH 3S14H 1VQHA 4NPSA 5ISRA 1GJXA 3CCRA 1Q7YC 1W6KA 4MTKA 1SYDA 4HJAA 3QJYA 3KDFA 4ZK9B 1HR0Q 5KEEA 1EWIA 3GV6A 3MC0B 1N34Q 2ZTCA 1PXUA 4DR5L 4ME5A 1PH2A 4CJ1B 1VF5C 4DK0A 4A3JG 4X3TA 3S1MH 3U58A 1XWEA 5M3FB 1EYAA 4QB4A 2B2TC 1TQOA 1F9PA 5DM73 3G7LA 1TWAH 1L2FA 2IX3A 4FVMA 3D3RA 5FKAC 1K8AC 3WOEA 4DAPA 3K0XA 5C3EH 4JI5L 1J5EQ 4N9TA 1CKNB 3V05A 1XYIA 1T5XD 1HZ9A 2D0OA 2UUBQ 4ZKCB 1Y1WB 1PRTD 1PV4A 1XNRQ 2Q2UA 1NUCA 4UY8C 3I70A 1YNJD 4BBSH 5KGUA 4IO9A 1Z6HA 5HY6A 2EXDA 2IPKD 3EROA 2K5DA 3CKIB 2MNAA 4KLKA 5M3MH 1QVFA 2MQHA 3I73A 1VMPA 5T1IA 1HJPA 2EJFC 2ENBA 3KJPA 3PIOA 4QIWB 1IYUA 4NXNL 4LUOA 3UDFA 4G7OC 1U4MA 2F0DA 1LT6D 1EL0A 4S3SA 1B3AA 4BBSG 2K5HA 2N3SA 2D2CC 4OELB 3OW2A 1WFQA 1Y1VB 4OONA 3I56A 4DR2Q 2V4DA 3D4DA 3SEBA 5GAGC 2NVXB 1VQ8A 4A3MG 4UP9A 3C46A 4K5XA 1HZAA 2QEXA 3M4PA 3K57A 1TT2A 4XTCS 4DAVA 4F87A 1BCPF 2Z6KA 3HEJA 3U4ZA 2NZOA 4IPDA 2O5IC 3ULLA 4P2CB 2EYOA 2K50A 1QWYA 2KHIA 1KAAA 3UDXA 4A75A 4RMFA 2NBFA 3STBD 5IODA 1O78A 3VYRA 5CV4A 3OMCA 3SK8A 4LF8L 1SE3A 3F2BA 1JB3A 3QG1A 1PLFA 5ELBA 4A3FG 4X6AH 2YU9H 4OO1G 4KY6A 2R6GA 3A5ZB 3BZDB 4GKJQ 1WCMG 2IX0A 2K5NA 4A93B 5IWAQ 1VCIA 2ZXOA 1D5ZC 1VQBA 2G9DA 2B2WC 4XYOA 2A69D 4A3CG 1WJJA 5FO9B 5HGQA 3VYSA 1VQKA 3I4NG 1D1IA 1HRJA 1S72A 5KIXA 2A69C 1V1OA 2K04A 4JVZA 1K3RA 3A8KE 1JORA 1DOKA 1CA6A 5C3XA 3MAQA 3AB9A 2O2LD 5IE8A 2F0KA 3NBHB 5M3FH 1OXTA 2KUMA 3S2HH 2PCFB 4HAEA 4QUCA 1V1QA 3M3YH 4EVOA 2BA0A 2F0VA 1VQ6A 1RHPA 1EY7A 1I6VC 3C1FA 4HIOA 1DONA 4KI0A 1Y1WG 3I55A 3TP7A 4LJZC 1I4QA 1GHJA 1H9JA 1KQSA 4B3RL 5KYLA 4G7ZC 3TMEA 1X3EA 3OOCA 1DYQA 1EY8A 1CI3M 2Z6BA 3MXNB 2ZJQA 3S14B 4TSSA 1EQQA 1XPOA 2QCPX 4IUUA 1Q82C 2PNHA 3NTKA 3RUZA 3J7ZC 2Q2TA 4BXXG 3AFPA 4XQNA 4YCUA 1EIGA 3PUVA 1K83H 3B6YA 4L5SA 4QY7A 3J7YW 1JT8A 4X66L 4NXNQ 1IBLL 4RKLA 1STBA 1EY6A 4RCNA 1AZQA 3T51B 3EFXD 3HOVB 2HHHQ 2IHFA 2WFWA 5IGEA 1RIPA 2VW9A 1ML0D 1A2UA 1OO9B 1T5EA 1ZEQX 1L1OA 3STBC 1QVGA 4J6HA 3NP8A 4CHTB 3PIP3 2IL8A 1ILQA 1RJTA 1HUNA 3K81C 4A4IA 5HURA 1EZ6A 1HA6A 2YU9B 5T1GA 3K0YA 3TZUA 5DNFA 1KHIA 2B8GA 3HKZG 4APVA 4K0KL 2JA5B 4HSVA 2I5LX 2KQ3A 4IPHA 1KTKA 2WB1G 2HUGA 1GD7A 4A76A 4A3FH 2VS1A 2K28A 2JA8B 1ONLA 2LS01 5BN4A 2RDGA 1TVXA 1EYGA 1C0AA 3KF6A 3CCJA 1SSOA 1AE2A 2WP8J 3K6OA 3T13A 3ND8A 3I4OA 2LKVA 3D31A 3TN2A 3BVGA 1TS4A 3EJIA 2BH2A 2EY1A 2EDGA 5DLQE 3QIAA 2DNCA 2I0QA 2D5DA 2EIFA 2GVBA 3VR3A 3TBIB 4XQQA 1I5FA 1I94Q 2VQEL 3BDOA 3KYHC 4IQZA 4JBWA 5EQ0A 2A6EC 5I2YA 3DEOA 5GAHC 4C3JG 4MZ9A 4WJ4A 1VQOA 2A6HD 3CW2C 1TWCB 1BXTA 2BE5C 1B3QA 5EPKA 3TP8A 1G2SA 5C0XI 4JYAL 3I4MH 2K14A 5JAVA 4MIUA 1KRSA 5J1ZA 1XX8A 1YHQA 5FO8B 2RDFA 4TVAB 2UXDL 1WTOA 2DJGC 3K5LA 2L15A 2XSCA 4NKLA 5IYBG 4IUQA 5CV5A 5AJ3Q 2FMMA 3LNNA 1LABA 2B2VA 1QZGA 4DV7L 2PNRC 4JI6L 4NMZA 2A8VA 4ZUIA 2VUMG 1UEAB 1S5BD 1I4GA 3RZDB 4A3JH 1RL2A 2E76C 1EY4A 3M85A 5COYA 1E1TA 2ZXPA 5C3WA 4LF4Q 3JC66 3ONAB 1G2TA 4A3EH 3ULJA 3I8ZA 4M8AA 5C4JB 4KHPL 5JEAH 2DUDA 1BCPB 2K32A 1JC7A 2QF7A 2JJQA 4RAUC 2HHHL 1MKHA 1STGA 3DM3A 2E74C 1VQMA 4RGOS 2VQFL 2JA8G 4JV5Q 5E4XA 4LUVA 4OHJA 3HOZG 1K3BC 1HA5A 1BOSA 1BUVT 2O4XA 2XVSA 3J80L 3R93A 2EJMA 3CRLC 1O7YA 2KBNA 1Y1VH 1K8GA 2HIXA 3GTOB 3KK7A 3TZDA 4DUYL 1HXYD 4GOPB 4DV0Q 2ICIA 2OTJA 2B29A 2E2JB 5IP7H 4UP7A 3FKIH 3CCUA 5CORA 1L0WA 1AEXA 1UAPA 4Y7NB 2PI2E 4RGTA 4KTAA 2Z6KC 3GTGH 4K5WA 1J6QA 3HOUH 3L3OC 1I94L 3QO2A 4RHRA 1C48A 4A3EG 2HQLA 3BG3A 4R9WA 3PQIA 4BY7B 1AZPA 1LTGD 4DN4M 5I6WA 1GVPA 4HJ7A 5I6YA 1XTCD 3ER0A 4LFAL 4DAYA 1B2TA 4A3LH 4MTNA 1ESRA 2B2WA 2R3ZA 5IYBH 4JV5L 1FR3A 1GM5A 1LV9A 1DOMA 1Q81C 3CQZB 2PMZE 3KJOA 4A3BB 1OXXK 1DXMA 1WTQA 4RH6A 1CHPD 4KHPQ 2F0SA 4J8QA 3SVMA 1T9HA 4GKKL 1S3OA 2UXCL 2VB3X 4RCOA 4DR4L 4C3JH 1Z9FA 1EOVA 2ZJPA 4H44C 1EZ8A 1SXTA 3FPPA 2CCZA 2LXJA 1YI2A 3H3VC 2UUBL 3BVZA 2B63H 5GQOA 4R8NA 4HJ8A 5K36H 2XTIA 1HH2P 4A3IG 1SNMA 1E1OA 1YNNC 1IXRA 4FDBA 2QGQA 3Q22A 3HOWH 4WFN3 1RCVD 1VQ9A 4BY7H 4N9PA 1EFWA 2B2TA 2PQEA 1VDZA 1CZWA 1GUNA 1J8IA 1JWMD 4IFDG 5L37A 2HIVA 3PUXA 5A2QE 1Z7TA 1WCMB 1D7QA 1XTDA 4X64Q 4R4IA 2HQEA 3RZOB 4HMIA 1I4HA 3GTGB 1YJNA 1IBLQ 5EPJA 1SAPA 4TRDA 3KLSX 3NK9A 1NR4A 2F0LA 5KNCA 3CC7A 3TREA 1EU4A 4X64L 4R4OA 5I4DA 2MUYA 4PZ8A 2E2JH 3X3NA 3A7AB 4GZYC 4CKEA 4A3KH 5CV7A 3BZCA 1R4QB 4JBKA 2EPBA 2QILA 2K03A 3J80i 1EU3A 5CBEE 3J81j 5LHY1 2VUMB 1G91A 3KLRA 3OTOL 2O5JC 2X6LA 2B2UC 2VQEQ 1LT3D 3FEWX 2EY5A 4KHZA 3PO2B 1SRUA 3RNUA 3HOXB 4QQBX 1KNAA 5IYDG 2V1CC 4G57A 1X9NA 3P20A 1U0LA 4LF5L 4HR7B 2NVYH 2ZT9C 2QA4A 1SNDA 2ZJRA 5JVH3 2F1MA 3ERSX 2WACA 1UEBA 4DV5Q 3ZYYX 3I4NH 3H6MA 3L0OA 4HEDA 3FP9A 3VA7A 1N34L 2IW3A 4LAAA 1LT4D 3D6CA 4IOAA 2E2HH 2A68D 2LXKA 3TDQA 1TWHB 4B3MQ 4DV1L 1LTRD 2KHJA 4DNRB 1STNA 1Y1WH 3F1ZA 2NVXH 3M4YA 3H0GB 1LTBD 3EIVA 5IIFA 1BR9A 4C3IB 4UAIA 1BBUA 5IWAL 1HNZL 3PF4A 4LFBQ 3VR5A 1SYCA 2PO4A 3O13A 2R92H 2RCFA 1TWAB 4Q5VA 1EEID 4A3KG 4LF8Q 2F03A 1E2ZA 4RGMA 3GTKB 2DGYA 3D8GA 2H4OA 1EWCA 4IJLA 4JOIA 3E0EA 3VYTA 4DA2A 4C3IH 1Y8PB 5IGDA 1CA5A 1VMCA 1Y14B 2CH4A 5C5MA 2BOSA 3A74A 1AN8A 3GP7A 1GUWA 3RZOH 5H1SE 3PIO3 1TIID 4HIDA 1LTAD 3CCLA 1PFBA 3P75A 5FLXL 1WTPA 4JI3Q 4V190 4C3HH 1BQQT 5IT9E 3PMFA 2Y0SE 3T53B 2R7ZH 2WAQG 1G51A 3BYYB 2F0MA 1UE7A 3J7AF 3KF8B 1UE6A 4DK1A 2NVYB 2X6GA 3S1MB 5CV6A 3EBEA 1CQVA 4IUVA 3JAML 4JI7L 1GXDC 1VS0A 3UDGA 1HFNA 4DNIA 5C3EG 3TRZA 4CKBA 2OXPA 1KDCA 4KK7A 3S1NH 4L5RC 1VQIA 3S17H 1TWHH 3K5MA 3T1HQ 1VF7A 2AKWB 2ZTDA 3M7NA 1QUQA 3RMHA 1GKHA 1SYBA 3RN5A 4A3FB 3M4OH 4GNXA 3I4NB 1C9OA 2Q8IB 3S1RB 2JA5H 4FXKC 5AJ3L 3GTLH 1TS2A 2F0TA 3TP5A 5HGTA 4LFAQ 3HOZB 3KDFB 5I9OA 1A3TA 1D6EC 1PTOC 3EA6A 3ICEA 2VL6A 2ZTEA 3NENA 1PZID 1YNXA 2N78A 2MGSA 4IPCA 4DR5Q 4FF4A 3EQLC 1WD0A 3OIQA 4BBRB 3HOYH 3CC2A 4LW1A 4P73A 2Z4IA 3GTLB 1TWGH 1X3PA 4AIMA 4B3RQ 2GVAA 3MXNA 4IFDJ 1J9OA 2GN5A 1W3SA 1YNJC 1XPRA 2EYJA 3UE0A 2B8FA 1YEZA 1B9NA 1FNVA 3NPPA 4R4TA 2R7FA 5C4HA 1K83B 2ZM6L 2KEDA 1XXGA 1K9MC 2CW0D 3SHLA 5EJWA 3A7LA 5C4ZA 2FXQA 5C5LA 1ENAA 3CQZH 4GLXA 5FK9C 1KLUD 1HTPA 2MJ8A 1IYVA 1PHJA 1RODA 1Q1BA 2RHSB 3OIPA 1PH6A 2LSSA 5JJLA 4U673 4XT3B 5F2DA 4LMQD 4JI2Q 3GTMH 2R7ZG 1R9TH 1HZCA 5C4XH 2B39A 1P8LA 4DNTB 1HNXL 2NVQB 1A15A 4KY7A 3NQIA 2YTYA 3MA2B 2R93G 2R61A 2Z8LA 3T16A 1A62A 5CYUA 1IL2A 2F3VA 4ZAIA 2K5WA 1VQPA 3RR5A 2MO0A 3KFUA 1S5DD 1LACA 4DR3L 4CKCA 4PV1C 1H9SA 2FHTA 4GN3B 3J7AV 3KLSA 2IHEA 4K2LA 5EBCA 4JI5Q 1PVOA 2L4NA 4IALA 3GTKH 1Y69U 4WJ3M 4K6LA 1S5CD 1I3QB 4JI8Q 1F9RA 2ALYB 1IZ6A 3MWYW 4JK1C 3J81c 1Z47A 1PRTF 3H94A 3KBXA 4GOPA 2JA7B 4KMUC 3GO5A 1JB7A 3J81i 1SN8A 3CCVA 4XQJA 1HQRD 1OXUA 5FLMH 3HKZB 4PZ6A 1RTNA 5LL6X 1ZKOA 4AYBE 2WB1B 2M2LA 3HKSA 3HOUB 3CHBD 3I91A 1W6JA 4POFA 1SBBB 3GDEA 2WAQB 2EYPA 2K33A 3A56A 1JMCA 2EYHA 2D62A 5DAUA 1SMYD 2XIWA 1HFGA 3ND9A 2CHBD 2F0GA 2A73B 2Y0SB 4F7XA 1X55A 4BS9A 3E9IA 3ITPA 5IT9L 1I4RA 1STYA 1PYWD 4L5QA 1RF2D 3NWTA 4QJFA 5G3LF 1CM9A 1B50A 2Z9HA 1XPUA 3RZDH 4DR4Q 1N33L 2X69A 4OWTB 3GTQH 4PMBA 5E4WC 5BN5A 3JAME 3GTPH 3HOWG 1VQ5A 4LF6L 2HCIA 1V1PB 1S4ZA 1AFPA 3MEHA 3C1EA 2WIIB 1IBKL 5M5XB 1DGSA 3AYHB 2OEOA 2WINB 3PGZA 3SXHA 1F2ZA 2E2DC 2F0EA 2I46A 1O80A 1NMGA 2KCCA 3PCOB 2JEBI 1N32Q 4K6DA 2JA7H 1GUSA 2YYZA 4DV2L 3VR6A 3DLLA 4GKJL 4HCEA 4GN5A 1GUGA 1KRTA 3SK5A 4MHEA 3T56B 4YCWA 1QOHA 1XMOL 3FHWA 1AE3A 4KN4C 4X65Q 3NUCA 1ET6A 3NEMA 4DV4L 4HSPA 1SFOB 4X3SA 3CP0A 4O0AA 4A3LG 4NXMQ 2B63B 1VQEA 3M7GA 1WTXA 1HHVA 2P5ZX 4YWLA 2CQAA 3S1QB 2UU9L 3PUYA 1X3QA 4C3JB 1EUJA 1JOOA 4J15A 3UI2A 2PYKA 4HTHA 5LMUQ 3I90A 1F2LA 2TSSA 5BN3A 1JWUD 3PUWA 3NWSA 5M5WB 1SMXA 2QDBA 1B9MA 1CKMA 2EXZA 3HRZC 5C4XG 2RDHA 5C4XB 1D1KA 2PW7A 4FP5D 2E8GA 3IFDA 4EQOA 1ZYRD 3GV3A 4CDFC 4KD3A 4DUZQ 4OO1I 2OWOA 1AW7A 2K4KA 1PH4A 1RKNA 5M5YH 1NMFA 3RD4A 2UUCQ 1DOLA 1CQFA 1QE6A 1X3FA 2HCCA 3K80C 3NBIA 2EYLA 4FXDA 4AQYQ 1NY4A 2OQKA 1E3PA 3JAMc 3WWVA 1E0BA 1FJGQ 4U68A 1ET9A 4OWWB 2MP1A 5J22A 2SEBD 1V1PA 4QUFA 5M3FG 3D4RA 4LF7Q 4BXXH 1TY2A 3MTSA 1I4PA 4G7HC 3C2PA 1WVLA 3KOJA 1PTOH 4EQNA 4L5TA 1YITA 3CC4A 1J5EL 3GTPB 2WB1E 1W2BA 4ZRZA 2GA4B 3L9AX 1VQJA 3HKZE 1TY0A 2B3GA 4X62Q 1EY9A 4YY3Q 3W2DA 4HJ9A 4GS3A 4MNOA 2PQAA 4PMWA 5CC4A 4A3CH 1WI5A 1KD1C 2EJGC 1HNXQ 3OPOA 3KBGA 4BA2I 5E7NA 3Q23A 2JYOA 1ZXTA 1MSGA 4EQPA 5J39A 4JC0A 4LNQA 2F0HA 2F0QA 4JW0A 3K7AB 3BVMA 1PH7A 1H9SB 1L0YB 3S1NB 3I2ZA 2L0CA 3WOFA 5A2QL 4A3EB 3MFGA 3CXCA 3CCMA 4Y52H 1MBYA 3M4QA 5C6AA 1IBMQ 1H95A 4V0BA 1MIUA 3F2CA 2Z0SA 1YIJA 2N8NA 3HGBA 3UDIA 1L1OC 2JA6B 4N8X1 4B9XA 4B3SL 4JI0L 1U4PA 4TKOB 4CDCC 4I65A 2AQ2B 4JCVE 3HFZB 5NUCA 2PW5A 1YZ6A 1SFOH 4DV3L 2KA7A 1B8AA 4P72A 2VNUD 5E1FA 2SNMA 1Y8NB 3GTJH 5GROA 1G6ZA 3TEHB 3N52A 3I3CA 4H02A 3V96A 4A93G 4K14A 4RHSA 2UXBL 2K01A 5LMNL 3J80c 1D5XC 1B44D 2KVMA 1EY0A 5TSSA 5KRUA 1RD9D 1EQTA 2LY7A 4B3TL 1FD7D 1XMQQ 4IZ8A 3EVQA 5M5XH 1IKLA 2E75C 4LF6Q 4DV6L 1FYCA 1JJ2A 4PG3A 4C3HG 3MEFA 3GTJB 5AFWA 1BDOA 2F3WA 4WJWA 3R3OA 3A8JE 4LF4L 1C8CA 4I7AA 1B53A 1IW7D 2Z4HA 1S40A 1SYFA 1FGUA 4ME3A 5ELFA 3HS0C 3BDCA 1HUMA 4ZKBB 1EFID 4ODGA 4JI6Q 2A74C 2A6ED 2E2HB 2RQXA 2RHQB 2F0JA 1ASZA 4P75A 1SNPA 3U9SA 1PH9A 3EN2A 3H3VI 1DCZA 1ICFB 4C3IG 4N8FA 3NQTA 3R2IA 1BF4A 3KLWA 3V2TA 1STHA 2PMZB 3JAMi 2JE6I 2F0FA 1TWFH 2VB2X 3TQYA 2RA4A 1A8VA 4DR6Q 2R93H 3H09A 3IAYA 3IL8A 2RF4A 1A6XA 2L12A 2KJXA 2D9UA 2I5HA 4KY5A 4L63B 1X65A 4O2DA 2UXCQ 4A3DG 4YCVA 4HIKA 3S1RH 1SLJA 4GKKQ 1JICA 4IN3A 2VUMH 4RKBA 4X65L 4DR7L 4OEMB 3IRBA 2KCNA 2E2IH 2N55A 3BDLA 3G71A 2CWPA 3CCEA 5IP7G 1V8QA 5IY0A 3KF8A 3NELA 3PIPA 2EY2A 3S15H 1I6HH 1YNND 2JSOA 4HN7A 1NCVA 1DZ1A 1EIFA 2UXBQ 1FNWA 1PZJD 4MN3A 3DEPA 4A3DH 4FF2A 1Q8IA 1Q1EA 2RCNA 5IOCA 1CFMA 1F2YA 5IYCG 1E2WA 4IUTA 3PV0A 3HOZH 4A3MB 2OQ0A 4A3IH 2R7ZB 2IT1A 5C3EB 3D4WA 4YY3L 2EVBA 2K5QA 2JXMB 2NTSA 5KNDA 1JE4A 2SNSA 3PO3B 2D0PA 1CSQA 2F52A 1EIHA 4QGUA 4GLAC 3MZ5A 1SE4A 3CU7A 4K0KQ 1JOKA 5FJ8G 2WAQE 2JA7G 2EYFA 3VA5A 4IFDI 1V43A 5JEAJ 3I4MG 2HD3A 2F4VQ 1NJIC 1Q8KA 4BY1H 1C7YA 4M1UB 1IKMA 2EE1A 3S2DH 3S2HB 4DF7A 4DR2L 4F8MA 4K8IA 3R2TA 2NZHA 2VY3A 5KYIA 4ABNA 4FF1A 2DY8A 1CUKA 3W3AA 4TQUS 1F2MA 2R7DA 2B2YC 2H1EA 3A0JA 2B2YA 1SYGA 2VQFQ 2K05A 5DEHA 2HDMA 3J81L 4C2MH 3HOYB 1Q90A 2BCOA 4IUPA 3TS0A 1BBXC 4UHVA 3MXGA 1QB5D 4BY1G 1HTLD 2R93B 4R8IA 2ID0A 1D5MC 5EKKA 4H7BA 1JQYD 3T1YQ 1BNZA 2MO1A 1EYCA 2K6AA 1KNEA 3VR4A 4F88A 2A1AA 4J1MA 2J7ZA 2B2UA 2UU9Q 3K59A 4X3UA 5CV9A 1ESFA 3T1YL 4XIGS 5ELCA 1SNOA 4DR3Q 3A55A 4OL7A 4G4KA 1U4RA 3LWUA 2XWJB 4GLVB 2Q8RE 1S5FD 2NN6I 4FF3A 1II3A 2B63G 4DKAC 5EKLA 5C44H 2YV5A 3SGIA 3GQBA 1OXSC 3AQQA 1X6OA 3HG9A 4YHHL 5C44B 2AUKA 4JYAQ 3S9WA 2F4IA 4JG2A 4C1NK 4Z9CB 2A5HA 5JVG3 3HZXA 3I4LA 4DR1Q 1I50B 1HPCA 1TWFB 4R1JA 4O1NA 3FKIG 5CGKA 1SE2A 2PI2A 2IX1A 1HQMC 3I72A 1QG7A 1E2VA 1VQNA 3Q8DA 5IGCA 1MGSA 4B9WA 5M3MB 5GADC 2JK8A 1OXVA 2L5TA 3CMEA 4IUNA 2NUCA 4KHVA 1VQFA 2Q8TA 3PO2H 4JI4L 3LGJA 2G9HD 1JE5A 1LTSD 1MJCA 1A3UA 1N36L 3VR2A 1PTOB 4EX5A 1K8MA 1STAA 1I3QH 1LYLA 5EAYA 1L1OB 1KC8C 4KJNA 5IYDH 2LFNA 1LUZA 2R92B 3BYTB 5IT9c 1PH3A 5C0XH 4XT1B 1ZYRC 1HCZA 2MFIA 2JN4A 3N6RA 1TWCH 2H5XA 2QW7A 3URYA 5M5YB 2Q2HA 2AUJD 1B70B 1WTRA 2BH8A 3FVQA 3A5UA 2HDLA 2IWHA 3E5SA 1U5KA 3T1HL 1KIXA 2CH4W 3F2DA 4OXPA 1L0XB 3U50C 1R9TB 5C0XJ 2MPMA 2EYMA 4LF5Q 5D3DA 4K2KA 3VDYA 1PDQA 4JI7Q 3HP3A 4DU9A 5I9PA 4IURA 2L1BA 1B4OA 2F0NA 1WTWA 1BBWA 2JA6G 3DWAA 5C44G 3NHHA 4QF4A 1KDBA 3PO2G 5EGTA 1CKOA 3KF6B 4LWCA 2N49A 1G8ZD 1VQAA 3W1BA 2DY7A 5GAEC 1NSNS 4BBRG 3P7JA 4OO1H 2YTVA 1SEBD 2NN6G 3G6EA 1SJHD 4RGNA 1PMRA 2NWGA 4B08A 1SDFA 2AWOA 1PH5A 1WYDA 1JOQA 2ICEC 3U4VA 3BZKA 4BA1I 1BVSA 4A3GB 4RFBA 1X3GA 2CWAA 4A3MH 2DNEA 1VQGA 4R4CA 2OTLA 3AEVA 1LTLA 4JI1L 2PZWA 4ULLA 1D8LA 2I5MX 1MJEA 4KJOA 4C1NI 3J81E 1EWHA 1IBML 1JR0D 4KD4A 1SNQA 1UUPA 1XMOQ 4C2MB 3VYUA 1M1KC 1TKWB 5I2XA 3T4AC 1WD1A 4XYQA 2BDNA 4OIKA 1M90C 1GOZA 1PYBA 1ILPA 3HOVH 1O7ZA 3PSIA 2EZVA 1SMYC 1HNWL 1SJED 1QJOA 1PFMA 1OTCA 2MHVA 3CCQA 1VQCA 3J80E 4DR1L 2F0PA 1IBKQ 3S1QH 1LTTD 4BY1B 4EQ5A 4YHHQ 2PPBC 3WDNA 4JI2L 3SK6A 2QDLA 4A3BG 2YTXA 1X56A 4HCSA 5FLXE 3QB3A 4RWSC 4X62L 4P74A 1PFNA 4B3SQ 4ZYSA 2JEAI 4WORA 3K5NA 4GOPC 1E24A 1SE8A 3GD7A 3PO3H 2CW0C 2XRSD 2DN8A 4RA8A 1A2TA 1PRTB 5K5PA 4CDDC 1XNQQ 3RLFA 3A8IE 4C56C 2K5VA 5BR8Q 1U9RA 3OHXC 4DR7Q 3D0FA 3QR8A 4WRDA 5FJ8H 1IHZA 4FO2A 1KABA 4BWGB 4GNXB 5JJIA 4CDEC 3IFTA 4GN4B 3CPWA 2NVTH 1QUQB 4ZUJA 4RG1A 2L11A 1O7LA 1LLRD 1U4LA 4DGZA 1CSPA 3FKIB 5CV8A 4DUYQ 2XRQD 1BCPC 4OGQC 4HIMA 1CK1A 3NXWA 2R92G 4LF9Q 1EYDA 2ATWA 2E2IB 1WOCA 5JEAG 2PZTA 5J3BA 1D2BA 1EOTA 5IGBA 1YJ9A 4JI8L 5FLMG 5M9OA 1AP0A 2L55A 2WKCA 1PH8A 5A35A 1P16A 3I7FA 1UNSA 1TS5A 3CRKC 1X32A 3F8TA 3QWNA 1S5ED 2WKDA 3M9BA 3K7AH 1UWVA 1ICWA 1CZGA 1JJCB 4DAYB 2JA8H 1KAWA 3PO3G 4ILWA 2FFKB 1CHQD 1SR3A 2DJFC
chains in the Genus database with same CATH topology
1STEA 1Q3LA 2NYZD 1EEFD 2TMPA 4NDXA 3K58A 3SR1A 2XN9C 2KECA 4K5VA 4E6IA 1RTOA 4A3JB 3LWEA 2KHSA 1H9RA 1R4PB 4ID6A 4FNFA 1PRTC 3SDZA 1PTOD 3G6JB 1DM0B 3OWFA 2AQ1B 1TS3A 2EOTA 1SNCA 4CBVA 2K7VA 4A3KB 3DM1A 3MHBA 4BBSB 1NR2A 5K36G 3SK4A 1IW7C 2WV6D 2F0IA 2K1BA 4K8JA 3I4MB 5KNBA 3Q24A 4IFDH 3QOLA 3AU7A 4PNYA 4O42A 5FOBB 1KDAA 1Q12A 3HOWB 2EY6A 2B2VC 1LO5D 3L7ZC 3IKJA 4DFAA 3R8BA 4CJ2C 4X3KA 2Z1CA 3E6ZX 4L6TB 3OWEB 2VXWA 2QEJC 2NTTA 1TR5A 1JWSD 1SYEA 1RDPD 2PZUA 3DHQA 3FPUB 3FMCA 2NN6H 2N88A 2RVLA 2LMCB 5JOBA 1IL8A 2NZ1D 1M4VA 4A3DB 5ELDA 3K5OA 3MFYA 3QOJA 2FINB 1I6HB 1PTOF 3M3YB 3NBHA 5LL6S 1F77A 1C4QA 2C5CA 3C3LA 4H0LC 5D3IB 5C0XG 2A68C 1Y8OB 3ERQA 4QMGA 1ENFA 5CMDA 2KOLA 4KKTA 2RBMA 1MSHA 1JCKB 3DWPA 1ENCA 5EKIA 2CVRA 3DWQA 1GUTA 1F9SA 5D65A 5DM63 3NE5B 3E0JA 1EY5A 2AQ3B 2KEEA 1CTMA 3F2UA 1EQVA 1H9KA 2F0OA 3U9OA 4OIJA 3SE0A 2ZXRA 1TU2B 1PZKD 1LTID 1QNUA 3TSSA 3P1HA 3KUPA 3D6WA 2OF1A 4L8JA 2OT2A 4FYDA 3FRPB 1NAPA 4YIJA 2NVTB 4NP5A 4AYBB 3OW7A 3DUZA 4KN7C 4Q0FA 1DD2A 3TP6A 2I07B 1BCPD 3H91A 5CR3A 4DXGA 2C9OA 1QNKA 3GTMB 3NTIA 2NB0A 1FGBD 4H13C 4ZQ3A 5EPLA 4CGYB 5JPMC 4EGVA 4UDUC 3PUZA 5JPNC 4LK1C 4KKSA 3S2DB 4DXFA 1K8OA 5E3FA 3GTQB 1A3VA 3NSWA 2XNAC 4PQXA 3DMUA 1DJRD 1BO0A 1MD2D 5ELEA 2FJ2A 2QKIC 3MVVA 5IGFA 5G3LD 4PMCA 1B1ZA 2M9VA 3LX0A 1KLGD 1GHKA 4I7ZC 1MI2A 5JJZA 5FO7B 3S16B 4KV6A 1G291 1QCBD 4KKUA 3BS1A 5CBAE 1M8AA 1FNUA 2XWBB 2F0WA 4CJ0B 3S15B 2BDOA 5EBDA 3X3MA 2J4XA 2FMCA 3Q6SA 5D14A 1WTVA 3MXPA 3Q0AA 1QILA 3S17B 5IGGA 3AMUA 2BE5D 4HMJA 3OSOA 1TWGB 3A54A 4QCLA 2A6HC 2RKSA 2IJ0A 4NW2A 1GUOA 2RSOA 3FDTA 2AWNA 1H9MA 1F9QA 1LT5D 3NTHA 2F0UA 4FXGC 2RSNA 2J0TD 3MXUA 4XDXA 2M00A 3OMGA 2SOBA 4XXEA 2L9HA 4ZLTF 2BA1A 2JP1A 3DXJC 3M4OB 1CT1D 4A3IB 4C3HB 2SDFA 1I4XA 5ISRA 1GJXA 1W6KA 1SYDA 3QJYA 4ZK9B 5KEEA 3GV6A 3MC0B 1PXUA 4ME5A 4CJ1B 1VF5C 4DK0A 4X3TA 1XWEA 5M3FB 1EYAA 4QB4A 2B2TC 1TQOA 1F9PA 5DM73 3G7LA 2IX3A 3D3RA 4FVMA 5FKAC 3WOEA 4DAPA 4N9TA 3V05A 1XYIA 1T5XD 4ZKCB 1Y1WB 1PRTD 1NUCA 3I70A 1YNJD 5KGUA 1Z6HA 2IPKD 3EROA 2K5DA 3CKIB 3I73A 1VMPA 5T1IA 2EJFC 2ENBA 4QIWB 1IYUA 4G7OC 1U4MA 2F0DA 1LT6D 1EL0A 4S3SA 1B3AA 2D2CC 1Y1VB 2V4DA 3D4DA 3SEBA 2NVXB 3C46A 4K5XA 3K57A 1TT2A 4XTCS 4DAVA 4F87A 1BCPF 3HEJA 2O5IC 4P2CB 2EYOA 1QWYA 1KAAA 2NBFA 5IODA 1O78A 3VYRA 5CV4A 3OMCA 3SK8A 1SE3A 1JB3A 3QG1A 1PLFA 5ELBA 4OO1G 4KY6A 2R6GA 3BZDB 2IX0A 4A93B 1VCIA 2ZXOA 1D5ZC 2G9DA 2B2WC 4XYOA 2A69D 5FO9B 3VYSA 1D1IA 1HRJA 5KIXA 2A69C 1V1OA 2K04A 3A8KE 1JORA 1DOKA 1CA6A 5C3XA 3MAQA 3AB9A 2O2LD 2F0KA 1OXTA 2KUMA 2PCFB 4HAEA 4QUCA 4EVOA 2BA0A 2F0VA 1RHPA 1EY7A 1I6VC 3C1FA 1DONA 4KI0A 3TP7A 4LJZC 1I4QA 1GHJA 1H9JA 5KYLA 4G7ZC 3TMEA 3OOCA 1DYQA 1EY8A 1CI3M 3S14B 4TSSA 2QCPX 4IUUA 3NTKA 3RUZA 4XQNA 1EIGA 3PUVA 3J7YW 4RKLA 1STBA 1EY6A 4RCNA 1AZQA 3T51B 3EFXD 3HOVB 5IGEA 1ML0D 1A2UA 1OO9B 1T5EA 1ZEQX 4J6HA 3NP8A 4CHTB 3PIP3 2IL8A 1ILQA 1RJTA 1HUNA 5HURA 1EZ6A 1HA6A 2YU9B 5T1GA 3K0YA 3TZUA 5DNFA 2B8GA 2JA5B 4HSVA 2KQ3A 1KTKA 2HUGA 2K28A 2JA8B 1ONLA 2LS01 5BN4A 2RDGA 1TVXA 1SSOA 2WP8J 3K6OA 3T13A 3ND8A 2LKVA 3D31A 3TN2A 3BVGA 1TS4A 3EJIA 2EY1A 2EDGA 3QIAA 2DNCA 2D5DA 3VR3A 3TBIB 4XQQA 3BDOA 4IQZA 4JBWA 5EQ0A 2A6EC 5I2YA 3DEOA 4C3JG 2A6HD 1TWCB 1BXTA 2BE5C 5EPKA 3TP8A 1G2SA 5C0XI 5JAVA 4MIUA 5J1ZA 1XX8A 5FO8B 2RDFA 1WTOA 3K5LA 2XSCA 4NKLA 4IUQA 5CV5A 2FMMA 3LNNA 1LABA 2B2VA 2PNRC 4NMZA 4ZUIA 1UEAB 1S5BD 1I4GA 3RZDB 2E76C 1EY4A 3M85A 5COYA 2ZXPA 5C3WA 3ONAB 1G2TA 3I8ZA 4M8AA 5C4JB 5JEAH 1BCPB 2K32A 1JC7A 2QF7A 4RAUC 1STGA 2E74C 4RGOS 5E4XA 4OHJA 1HA5A 1BOSA 1BUVT 2O4XA 2XVSA 3J80L 3R93A 2EJMA 3CRLC 1O7YA 3GTOB 3KK7A 3TZDA 1HXYD 2ICIA 2E2JB 5CORA 1AEXA 1UAPA 4Y7NB 4RGTA 4KTAA 4K5WA 3L3OC 3QO2A 4RHRA 1C48A 3BG3A 4R9WA 4BY7B 1AZPA 1LTGD 4DN4M 5I6WA 5I6YA 1XTCD 4DAYA 1B2TA 1ESRA 2B2WA 2R3ZA 1FR3A 1LV9A 1DOMA 3CQZB 4A3BB 1OXXK 1DXMA 1WTQA 4RH6A 1CHPD 2F0SA 4J8QA 3SVMA 2VB3X 4RCOA 3H3VC 4H44C 1EZ8A 1SXTA 3FPPA 3BVZA 4R8NA 5K36H 1SNMA 1YNNC 3Q22A 4WFN3 1RCVD 4N9PA 2B2TA 2PQEA 1VDZA 1CZWA 1GUNA 1J8IA 1JWMD 4IFDG 5A2QE 3PUXA 1Z7TA 1WCMB 3RZOB 2HQEA 4HMIA 1I4HA 3GTGB 5EPJA 1SAPA 4TRDA 3KLSX 3NK9A 1NR4A 2F0LA 5KNCA 1EU4A 5I4DA 2MUYA 3X3NA 3A7AB 4GZYC 4CKEA 5CV7A 1R4QB 2EPBA 2QILA 5CBEE 2K03A 1EU3A 5LHY1 2VUMB 1G91A 3KLRA 2O5JC 2X6LA 2B2UC 1LT3D 3FEWX 2EY5A 4KHZA 3PO2B 3HOXB 1KNAA 4G57A 3P20A 4HR7B 2ZT9C 1SNDA 5JVH3 2F1MA 2WACA 3ZYYX 3H6MA 4HEDA 3VA7A 2IW3A 4LAAA 1LT4D 3D6CA 2A68D 3TDQA 1TWHB 1LTRD 4DNRB 1STNA 3M4YA 3H0GB 1LTBD 5IIFA 1BR9A 4C3IB 4UAIA 3VR5A 1SYCA 2PO4A 3O13A 1TWAB 4Q5VA 1EEID 2F03A 1E2ZA 4RGMA 3GTKB 3D8GA 2H4OA 1EWCA 3VYTA 4DA2A 1Y8PB 5IGDA 1CA5A 1VMCA 5C5MA 2BOSA 1AN8A 3GP7A 1GUWA 3PIO3 1TIID 1LTAD 1PFBA 3P75A 5FLXL 1WTPA 4V190 1BQQT 5IT9E 3PMFA 3T53B 3BYYB 2F0MA 3J7AF 4DK1A 2NVYB 2X6GA 3S1MB 5CV6A 1CQVA 4IUVA 3JAML 1GXDC 1HFNA 4CKBA 2OXPA 1KDCA 4KK7A 3K5MA 1VF7A 3M7NA 3RMHA 1SYBA 4A3FB 3I4NB 3S1RB 2Q8IB 4FXKC 1TS2A 2F0TA 3TP5A 5HGTA 3HOZB 5I9OA 1A3TA 1D6EC 1PTOC 3EA6A 1PZID 2MGSA 4FF4A 3EQLC 1WD0A 3OIQA 4BBRB 2Z4IA 3GTLB 1X3PA 3MXNA 4IFDJ 1J9OA 1YNJC 2EYJA 2B8FA 1B9NA 1FNVA 3NPPA 5C4HA 1K83B 2KEDA 1XXGA 2CW0D 3SHLA 5EJWA 3A7LA 5C4ZA 5C5LA 1ENAA 5FK9C 1KLUD 1HTPA 2MJ8A 1IYVA 1RODA 1Q1BA 3OIPA 4U673 4XT3B 5F2DA 4LMQD 2B39A 4DNTB 2NVQB 1A15A 4KY7A 3NQIA 3MA2B 2R61A 2Z8LA 3T16A 5CYUA 2F3VA 4ZAIA 2K5WA 1S5DD 1LACA 4CKCA 4PV1C 1H9SA 2FHTA 3J7AV 3KLSA 4K2LA 5EBCA 2L4NA 4IALA 1Y69U 4K6LA 1S5CD 1I3QB 1F9RA 3MWYW 4JK1C 1Z47A 1PRTF 3H94A 3KBXA 2JA7B 4KMUC 3GO5A 4XQJA 1HQRD 1OXUA 3HKZB 1RTNA 5LL6X 1ZKOA 2WB1B 2M2LA 3HOUB 3CHBD 3I91A 1W6JA 1SBBB 2WAQB 2EYPA 2K33A 3A56A 2EYHA 2D62A 5DAUA 1SMYD 2XIWA 1HFGA 3ND9A 2CHBD 2F0GA 2A73B 2Y0SB 4F7XA 4BS9A 3ITPA 5IT9L 1I4RA 1STYA 1PYWD 1RF2D 3NWTA 5G3LF 1CM9A 1B50A 2X69A 4PMBA 5E4WC 5BN5A 3JAME 2HCIA 1V1PB 1S4ZA 1AFPA 3MEHA 3C1EA 2WIIB 5M5XB 2OEOA 2WINB 3SXHA 1F2ZA 2E2DC 2F0EA 2I46A 1O80A 2KCCA 2JEBI 4K6DA 1GUSA 2YYZA 3VR6A 4HCEA 1GUGA 3SK5A 4MHEA 3T56B 1QOHA 4KN4C 3NUCA 1ET6A 4HSPA 1SFOB 4X3SA 2B63B 3M7GA 1WTXA 1HHVA 2CQAA 3S1QB 3PUYA 1X3QA 4C3JB 1JOOA 3UI2A 2PYKA 4HTHA 3I90A 1F2LA 2TSSA 5BN3A 1JWUD 3PUWA 3NWSA 5M5WB 2QDBA 1B9MA 2EXZA 3HRZC 2RDHA 5C4XB 1D1KA 2PW7A 4FP5D 3IFDA 4EQOA 1ZYRD 3GV3A 4KD3A 4OO1I 1AW7A 1RKNA 3RD4A 1CQFA 1DOLA 1QE6A 2HCCA 3NBIA 2EYLA 4FXDA 1E0BA 4U68A 1ET9A 2MP1A 5J22A 2SEBD 1V1PA 4QUFA 3D4RA 1TY2A 3MTSA 1I4PA 4G7HC 3C2PA 1WVLA 1PTOH 4EQNA 3GTPB 4ZRZA 2GA4B 3L9AX 1TY0A 1EY9A 3W2DA 4PMWA 5CC4A 2EJGC 3OPOA 3KBGA 4BA2I 3Q23A 2JYOA 1ZXTA 1MSGA 4EQPA 5J39A 2F0HA 2F0QA 3K7AB 3BVMA 1H9SB 1L0YB 3S1NB 2L0CA 3WOFA 5A2QL 4A3EB 3MFGA 1MBYA 5C6AA 4V0BA 3HGBA 2JA6B 4B9XA 1U4PA 4TKOB 4I65A 2AQ2B 5NUCA 2PW5A 2KA7A 2VNUD 5E1FA 2SNMA 1Y8NB 1G6ZA 3N52A 3I3CA 3V96A 4K14A 4RHSA 2K01A 1D5XC 1B44D 2KVMA 1EY0A 5TSSA 5KRUA 1RD9D 1EQTA 2LY7A 1FD7D 4IZ8A 3EVQA 1IKLA 2E75C 1FYCA 4C3HG 3GTJB 5AFWA 1BDOA 4WJWA 2F3WA 3R3OA 3A8JE 1C8CA 1B53A 1IW7D 2Z4HA 1SYFA 5ELFA 3HS0C 3BDCA 1HUMA 4ZKBB 1EFID 4ODGA 2A74C 2A6ED 2E2HB 2RQXA 2F0JA 1SNPA 3U9SA 1DCZA 4C3IG 3NQTA 3R2IA 1BF4A 3V2TA 1STHA 2PMZB 2JE6I 2F0FA 2VB2X 2RA4A 3H09A 3IAYA 3IL8A 1A6XA 2L12A 2KJXA 2D9UA 4KY5A 4L63B 1JICA 4IN3A 4RKBA 2KCNA 2N55A 3BDLA 1V8QA 3KF8A 2EY2A 1YNND 2JSOA 4HN7A 1NCVA 1DZ1A 1FNWA 1PZJD 4MN3A 3DEPA 4FF2A 1Q8IA 1Q1EA 5IOCA 1CFMA 1F2YA 1E2WA 4IUTA 3PV0A 4A3MB 2R7ZB 2IT1A 5C3EB 3D4WA 2EVBA 2K5QA 2JXMB 2NTSA 5KNDA 1JE4A 2SNSA 3PO3B 1EIHA 3MZ5A 1SE4A 3CU7A 1JOKA 2EYFA 3VA5A 4IFDI 1V43A 5JEAJ 4M1UB 1IKMA 2EE1A 3S2HB 4DF7A 4F8MA 4K8IA 3R2TA 5KYIA 4ABNA 4FF1A 2DY8A 3W3AA 4TQUS 1F2MA 2B2YC 2H1EA 2B2YA 1SYGA 2K05A 5DEHA 2HDMA 3J81L 3HOYB 1Q90A 2BCOA 4IUPA 1BBXC 3MXGA 1QB5D 1HTLD 2R93B 4R8IA 2ID0A 1D5MC 5EKKA 4H7BA 1JQYD 1BNZA 1EYCA 2K6AA 1KNEA 3VR4A 4F88A 4J1MA 2J7ZA 2B2UA 3K59A 4X3UA 5CV9A 1ESFA 4XIGS 5ELCA 1SNOA 3A55A 4OL7A 4G4KA 1U4RA 3LWUA 2XWJB 2Q8RE 1S5FD 2NN6I 4FF3A 1II3A 5EKLA 3GQBA 1OXSC 3HG9A 5C44B 2AUKA 3S9WA 2F4IA 4C1NK 4Z9CB 2A5HA 5JVG3 3HZXA 3I4LA 1I50B 1HPCA 1TWFB 4O1NA 5CGKA 1SE2A 2IX1A 1HQMC 3I72A 1QG7A 1E2VA 5IGCA 1MGSA 4B9WA 5M3MB 1OXVA 2L5TA 4IUNA 2NUCA 4KHVA 2Q8TA 2G9HD 1LTSD 1A3UA 3VR2A 1PTOB 1K8MA 1STAA 4KJNA 2LFNA 2R92B 3BYTB 5C0XH 4XT1B 1ZYRC 1HCZA 3N6RA 3URYA 5M5YB 2AUJD 1WTRA 3FVQA 2HDLA 2IWHA 3E5SA 1L0XB 1R9TB 5C0XJ 2MPMA 2EYMA 5D3DA 4K2KA 1PDQA 3HP3A 4DU9A 5I9PA 4IURA 2L1BA 1B4OA 2F0NA 1WTWA 3DWAA 3NHHA 4QF4A 1KDBA 5EGTA 1G8ZD 2DY7A 1NSNS 3P7JA 4OO1H 1SEBD 2NN6G 1SJHD 4RGNA 1PMRA 2NWGA 4B08A 1SDFA 2AWOA 1JOQA 2ICEC 4BA1I 4A3GB 4RFBA 2DNEA 2PZWA 4ULLA 4KJOA 4C1NI 3J81E 1EWHA 1JR0D 4KD4A 1SNQA 1UUPA 4C2MB 3VYUA 1TKWB 5I2XA 3T4AC 1WD1A 4XYQA 2BDNA 4OIKA 1GOZA 1ILPA 1O7ZA 2EZVA 1SMYC 1SJED 1QJOA 1PFMA 2MHVA 3J80E 2F0PA 1LTTD 4BY1B 2PPBC 3WDNA 3SK6A 4HCSA 5FLXE 3QB3A 4RWSC 1PFNA 4ZYSA 2JEAI 4WORA 3K5NA 3GD7A 2CW0C 2XRSD 2DN8A 4RA8A 1A2TA 1PRTB 5K5PA 3RLFA 3A8IE 4C56C 1U9RA 3OHXC 4WRDA 1IHZA 4FO2A 1KABA 4BWGB 3IFTA 4ZUJA 2L11A 1O7LA 1LLRD 1U4LA 4DGZA 3FKIB 5CV8A 2XRQD 1BCPC 4OGQC 1CK1A 3NXWA 1EYDA 2E2IB 5JEAG 2PZTA 1D2BA 1EOTA 5IGBA 5M9OA 1AP0A 2L55A 2WKCA 5A35A 1UNSA 1TS5A 3CRKC 1X32A 3QWNA 1S5ED 2WKDA 1ICWA 1CZGA 4ILWA 2FFKB 1CHQD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R3O A;  1EZ6 A;  2SOB A;  4R8N A;  5CR3 A;  4EQN A;  5C4H A;  5IOD A;  3SHL A;  1SNM A;  5IGD A;  5CV4 A;  4PMB A;  3OMC A;  3QOJ A;  3SK8 A;  5C5L A;  5C4Z A;  1ENA A;  1A3U A;  1SYF A;  3OMG A;  1STG A;  4NDX A;  5C5M A;  2KQ3 A;  4ZQ3 A;  4KY6 A;  3SR1 A;  4N9P A;  5ISR A;  1STA A;  2PQE A;  4DF7 A;  3BDC A;  1EY9 A;  1SYD A;  4K8I A;  4K5V A;  4ODG A;  4F8M A;  3MEH A;  3C1E A;  4E6I A;  2HQE A;  4KJN A;  4HMI A;  5CC4 A;  5KYI A;  5KEE A;  2KHS A;  2F0J A;  4ID6 A;  2F0P A;  3P75 A;  1F2M A;  1SNP A;  5E3F A;  5F2D A;  2OEO A;  3ERQ A;  2O4X A;  3SXH A;  1SYG A;  1F2Z A;  3SK6 A;  3OWF A;  4ME5 A;  4QMG A;  2F0E A;  3PMF A;  4TRD A;  5KIX A;  3T13 A;  3NK9 A;  1A3V A;  3NQT A;  5DEH A;  2F0L A;  1JOR A;  3V2T A;  1STH A;  2F0M A;  2LKV A;  5C3X A;  4KY7 A;  1SNC A;  4EQP A;  3QB3 A;  5J39 A;  4K6D A;  1EYA A;  3DMU A;  3EJI A;  2RBM A;  4QB4 A;  2F0K A;  2F0F A;  2F0H A;  2F0Q A;  2EY1 A;  3T16 A;  1TQO A;  3MHB A;  3SK5 A;  5CV7 A;  2F3V A;  4WOR A;  1ENC A;  5EKK A;  5CV6 A;  3E5S A;  3SK4 A;  4H7B A;  4EVO A;  2F0I A;  2F0V A;  4K8J A;  3NUC A;  3MVV A;  4KY5 A;  1EYC A;  1EY7 A;  1A2T A;  5IGF A;  4N9T A;  5K5P A;  3C1F A;  1AEX A;  2EYM A;  4PMC A;  2EY5 A;  2OXP A;  1KDC A;  4K2K A;  4J1M A;  4K2L A;  3TP7 A;  3QOL A;  4RKB A;  4IAL A;  3LX0 A;  5CV9 A;  5C6A A;  1U9R A;  4DU9 A;  4KTA A;  1EY5 A;  5KYL A;  1SNO A;  4PNY A;  4OL7 A;  4WRD A;  4K5W A;  3TME A;  5I9P A;  1NUC A;  4G57 A;  1IHZ A;  3BDL A;  2F0N A;  1JOO A;  1KAB A;  1KDA A;  4B9X A;  1EY8 A;  2PYK A;  4HTH A;  5KGU A;  4KV6 A;  1II3 A;  1SYB A;  3NHH A;  4QF4 A;  1KDB A;  1EQV A;  2EY6 A;  3ERO A;  5EKL A;  1SND A;  4I65 A;  5EGT A;  2F0O A;  3U9O A;  2WAC A;  4ZUJ A;  2QDB A;  4DFA A;  2EXZ A;  5NUC A;  2EY2 A;  4DGZ A;  5I6W A;  2ENB A;  2PW5 A;  2F0W A;  3TP8 A;  2F0T A;  3TP5 A;  3RUZ A;  5HGT A;  5CV8 A;  3H6M A;  5E1F A;  5I6Y A;  5I9O A;  1NSN S;  2PW7 A;  2SNM A;  4EQO A;  1A3T A;  5JAV A;  3NXW A;  3S9W A;  4MIU A;  4LAA A;  3D6C A;  3HZX A;  5J1Z A;  3D8G A;  1EYD A;  2F0D A;  3P1H A;  4S3S A;  4KD3 A;  2RDF A;  1JOQ A;  3MXP A;  4K14 A;  2OF1 A;  1RKN A;  5IGG A;  5CGK A;  5IOC A;  1TR5 A;  2PZT A;  1F2Y A;  2EYP A;  4RKL A;  4NKL A;  1STB A;  1EY6 A;  1STN A;  2EYH A;  3D4D A;  1SYE A;  3OSO A;  4HMJ A;  5CV5 A;  5DAU A;  5IGB A;  1EY0 A;  5KRU A;  5M9O A;  2PZU A;  3DHQ A;  5IGC A;  4B9W A;  5IGE A;  5IIF A;  2F0G A;  2EYL A;  3D4W A;  4YIJ A;  4K5X A;  4NMZ A;  2PZW A;  2RKS A;  4F7X A;  2SNS A;  1SYC A;  1A2U A;  4IZ8 A;  2F0S A;  1TT2 A;  3EVQ A;  3MZ5 A;  4ZUI A;  4NP5 A;  4J6H A;  3ITP A;  5J22 A;  3HEJ A;  2EYJ A;  2F0U A;  3TP6 A;  1JOK A;  1STY A;  3NP8 A;  4KJO A;  1EY4 A;  4IUN A;  2NUC A;  4KHV A;  5JOB A;  4KD4 A;  2EYO A;  5C3W A;  1SNQ A;  1EZ8 A;  2EYF A;  5HUR A;  1KAA A;  2M00 A;  2F3W A;  3VA5 A; 
#chains in the Genus database with same CATH topology
 4LFC Q;  1STE A;  1Q3L A;  2F3I A;  4AQY L;  2NYZ D;  1B7Y B;  1EEF D;  2TMP A;  4NDX A;  3K58 A;  1TXY A;  3SR1 A;  2XN9 C;  3UE1 A;  2UUC L;  2KEC A;  4K5V A;  4OX9 L;  4E6I A;  1N32 L;  1RTO A;  4A3J B;  3LWE A;  2KHS A;  1H9R A;  1R4P B;  4ID6 A;  4FNF A;  1PRT C;  4DAM A;  3H0G G;  3SDZ A;  1PTO D;  3G6J B;  1DM0 B;  1YBY A;  3OWF A;  4JI3 L;  2AQ1 B;  4B3M L;  1TS3 A;  2EOT A;  3G4S A;  2C35 B;  1SNC A;  2CQO A;  4CBV A;  2K7V A;  4A3K B;  3DM1 A;  4OWX B;  4HJ5 A;  2JQO A;  2F4V L;  5LMU L;  1Q86 C;  3MHB A;  4BBS B;  1NR2 A;  2ZM6 Q;  5K36 G;  2E5L L;  3SK4 A;  1N36 Q;  1CKN A;  1IW7 C;  2WV6 D;  2F0I A;  2K1B A;  4K8J A;  3AFQ A;  3I4M B;  5KNB A;  4JPB W;  2K75 A;  4POG A;  3Q24 A;  1A63 A;  2ES2 A;  4IFD H;  4DV4 Q;  3QOL A;  4A3G H;  1YHB A;  4JI1 Q;  3AU7 A;  4PNY A;  4BY7 G;  4O42 A;  5FOB B;  2E5L Q;  1KDA A;  1Q12 A;  4DR6 L;  3HOW B;  2EY6 A;  1HNZ Q;  2HT1 A;  2B2V C;  1LO5 D;  4LFB L;  3L7Z C;  3IKJ A;  4DFA A;  3R8B A;  1N8R C;  2G5D A;  4CJ2 C;  5IP9 H;  4YWK A;  2CKZ B;  4R4Q A;  2K52 A;  1NNX A;  2OCE A;  3E3X A;  4X3K A;  4A3G G;  2Z1C A;  3E6Z X;  2JA6 H;  1YJW A;  4L6T B;  3OWE B;  2VXW A;  3CAM A;  2QEJ C;  2NTT A;  1TR5 A;  1JWS D;  1SYE A;  1RDP D;  4DV5 L;  2PZU A;  3DHQ A;  3PF5 A;  3FPU B;  3RLO A;  3FMC A;  2NN6 H;  2N88 A;  2RVL A;  4IOC A;  3K7U C;  4JOI C;  2LMC B;  5JOB A;  1IL8 A;  1XNR L;  5M3M G;  2NZ1 D;  1M4V A;  4A3D B;  5IYC H;  5ELD A;  4DV6 Q;  3OTO Q;  4NB3 A;  3K5O A;  3CF5 A;  3MFY A;  3QOJ A;  4DV7 Q;  1NBW A;  2FIN B;  3K8A A;  1I6H B;  1PTO F;  3M3Y B;  1K0S A;  3NBH A;  5LL6 S;  3W5O A;  1F77 A;  1C4Q A;  2C5C A;  1K0R A;  3C3L A;  4H0L C;  1JJG A;  5D3I B;  4DK3 C;  5C0X G;  1E7Z A;  3CMA A;  1N9W A;  2A68 C;  4Y7N H;  4LF9 L;  1Y8O B;  5LMN W;  3ERQ A;  1NE3 A;  4X66 Q;  4QMG A;  4DUZ L;  3H0G H;  1ENF A;  5CMD A;  2KOL A;  4KKT A;  3G48 A;  2RBM A;  1MSH A;  1JCK B;  3GTO H;  3S16 H;  3DWP A;  4JI0 Q;  4JBM A;  2UUA L;  4JI4 Q;  1ENC A;  2CFM A;  1G6P A;  5EKI A;  2CVR A;  3DWQ A;  2AMC B;  1GUT A;  1PYS B;  5BR8 L;  1F9S A;  5D65 A;  2ASB A;  4YWM A;  2VZA A;  1XNQ L;  5DM6 3;  3NE5 B;  3E0J A;  1XMQ L;  1O7I A;  1EY5 A;  4DPG A;  4AYB G;  2EQS A;  1VQD A;  2AQ3 B;  4NXM L;  4LUZ A;  1V9P A;  2KEE A;  1CTM A;  3F2U A;  1EQV A;  3HOX H;  1H9K A;  2AHO B;  4DV1 Q;  2F0O A;  3U9O A;  4OIJ A;  3SE0 A;  2ZXR A;  2PQA B;  1TU2 B;  5M5W H;  1PZK D;  1UE1 A;  1LTI D;  1X54 A;  1QNU A;  2KCT A;  3TSS A;  2Q2I A;  2IY5 B;  3HOV G;  3P1H A;  3KUP A;  3CPF A;  5ELO A;  4ALP A;  3D6W A;  2OF1 A;  2KCM A;  2KEN A;  4L8J A;  2OT2 A;  1K73 C;  3HOY G;  3ZJY C;  4FYD A;  1QVC A;  2A19 A;  1NAP A;  3FRP B;  1UE5 A;  1XJV A;  4YIJ A;  4OX9 Q;  4ZCK A;  2NVT B;  2Y0S G;  4NP5 A;  4AYB B;  3OW7 A;  3DUZ A;  4KN7 C;  4Q0F A;  1DD2 A;  3TP6 A;  2I07 B;  4A93 H;  1WCM H;  4LF7 L;  3J7A 5;  1EQR A;  1FVI A;  4LFC L;  1BCP D;  1KXL A;  2UUA Q;  3H91 A;  5CR3 A;  4DXG A;  3S24 A;  2C9O A;  1QNK A;  3RLN A;  1N33 Q;  2NVQ H;  2JA9 A;  1BKB A;  5IP9 G;  4P71 A;  3GTM B;  2JA5 G;  3NTI A;  2NB0 A;  1FGB D;  3BJU A;  4H13 C;  4ZQ3 A;  5EPL A;  4DV0 L;  4CGY B;  5JPM C;  4EGV A;  4UDU C;  3H15 A;  3PUZ A;  5JPN C;  4LK1 C;  1HR0 W;  4KKS A;  3ULP A;  3S2D B;  1EIY B;  1ASY A;  1E22 A;  1PFS A;  4DXF A;  1K8O A;  5E3F A;  3GTQ B;  1KL9 A;  1SRO A;  1A0I A;  4A3B H;  1A3V A;  3NSW A;  2XNA C;  1NTG A;  4PQX A;  3DMU A;  1DJR D;  4GNX C;  4QL5 A;  3HOU G;  4AH6 A;  3RN2 A;  1BO0 A;  3E9H A;  4IJH A;  1MD2 D;  5ELE A;  1K28 A;  2FJ2 A;  2QKI C;  3MVV A;  1LM0 A;  1VQL A;  5IGF A;  5G3L D;  3BU2 A;  4PMC A;  1B1Z A;  1FJG L;  1YVC A;  2M9V A;  1YHA A;  3LX0 A;  4BBR H;  1KLG D;  1FL0 A;  1GHK A;  3L2P A;  4I7Z C;  3CD6 A;  1MI2 A;  1I50 H;  5JJZ A;  5FO7 B;  3S16 B;  4KV6 A;  1G29 1;  1QCB D;  4DV2 Q;  4KKU A;  3BS1 A;  5CBA E;  4B3T Q;  1M8A A;  1PH1 A;  1HZB A;  4PZ7 A;  4DK6 C;  1FNU A;  2XWB B;  1GO3 E;  2F0W A;  4CJ0 B;  3S15 B;  2BDO A;  5JJK A;  4JBJ A;  5EBD A;  5LMN Q;  4UP8 A;  3X3M A;  5FLX c;  3H3V H;  1AH9 A;  2UXD Q;  2J4X A;  2FMC A;  3Q6S A;  5D14 A;  1WTV A;  1WTH A;  3MXP A;  3Q0A A;  1QIL A;  1VQ4 A;  3CCS A;  3S17 B;  5IGG A;  5ELN A;  3AMU A;  1VQ7 A;  4DV3 Q;  2BE5 D;  4HMJ A;  3OSO A;  4IPG A;  1TWG B;  1QZH A;  3W1G A;  1HR0 L;  3A54 A;  3TS2 A;  1IYJ B;  1PA6 A;  4QCL A;  2A6H C;  2RKS A;  4NW2 A;  2IJ0 A;  2XGT A;  1GUO A;  1Y1V G;  1MHW C;  2RSO A;  3FDT A;  1HNW Q;  2AWN A;  1H9M A;  1F9Q A;  1LT5 D;  3NTH A;  2F0U A;  4FXG C;  2RSN A;  4QIW E;  2J0T D;  3MXU A;  4XDX A;  3HOX G;  2M00 A;  3OMG A;  2SOB A;  4UPA A;  4XXE A;  1Q46 A;  2L9H A;  2BA1 A;  4ZLT F;  2JP1 A;  3DXJ C;  3OYY A;  3M4O B;  1CT1 D;  4A3I B;  4C3H B;  2SDF A;  1I4X A;  5C4J H;  3S14 H;  1VQH A;  4NPS A;  5ISR A;  1GJX A;  3CCR A;  1Q7Y C;  1W6K A;  4MTK A;  1SYD A;  4HJA A;  3QJY A;  3KDF A;  4ZK9 B;  1HR0 Q;  5KEE A;  1EWI A;  3GV6 A;  3MC0 B;  1N34 Q;  2ZTC A;  1PXU A;  4DR5 L;  4ME5 A;  1PH2 A;  4CJ1 B;  1VF5 C;  4DK0 A;  4A3J G;  4X3T A;  3S1M H;  3U58 A;  1XWE A;  5M3F B;  1EYA A;  4QB4 A;  2B2T C;  1TQO A;  1F9P A;  5DM7 3;  3G7L A;  1TWA H;  1L2F A;  2IX3 A;  4FVM A;  3D3R A;  5FKA C;  1K8A C;  3WOE A;  4DAP A;  3K0X A;  5C3E H;  4JI5 L;  1J5E Q;  4N9T A;  1CKN B;  3V05 A;  1XYI A;  1T5X D;  1HZ9 A;  2D0O A;  2UUB Q;  4ZKC B;  1Y1W B;  1PRT D;  1PV4 A;  1XNR Q;  2Q2U A;  1NUC A;  4UY8 C;  3I70 A;  1YNJ D;  4BBS H;  5KGU A;  4IO9 A;  1Z6H A;  5HY6 A;  2EXD A;  2IPK D;  3ERO A;  2K5D A;  3CKI B;  2MNA A;  4KLK A;  5M3M H;  1QVF A;  2MQH A;  3I73 A;  1VMP A;  5T1I A;  1HJP A;  2EJF C;  2ENB A;  3KJP A;  3PIO A;  4QIW B;  1IYU A;  4NXN L;  4LUO A;  3UDF A;  4G7O C;  1U4M A;  2F0D A;  1LT6 D;  1EL0 A;  4S3S A;  1B3A A;  4BBS G;  2K5H A;  2N3S A;  2D2C C;  4OEL B;  3OW2 A;  1WFQ A;  1Y1V B;  4OON A;  3I56 A;  4DR2 Q;  2V4D A;  3D4D A;  3SEB A;  5GAG C;  2NVX B;  1VQ8 A;  4A3M G;  4UP9 A;  3C46 A;  4K5X A;  1HZA A;  2QEX A;  3M4P A;  3K57 A;  1TT2 A;  4XTC S;  4DAV A;  4F87 A;  1BCP F;  2Z6K A;  3HEJ A;  3U4Z A;  2NZO A;  4IPD A;  2O5I C;  3ULL A;  4P2C B;  2EYO A;  2K50 A;  1QWY A;  2KHI A;  1KAA A;  3UDX A;  4A75 A;  4RMF A;  2NBF A;  3STB D;  5IOD A;  1O78 A;  3VYR A;  5CV4 A;  3OMC A;  3SK8 A;  4LF8 L;  1SE3 A;  3F2B A;  1JB3 A;  3QG1 A;  1PLF A;  5ELB A;  4A3F G;  4X6A H;  2YU9 H;  4OO1 G;  4KY6 A;  2R6G A;  3A5Z B;  3BZD B;  4GKJ Q;  1WCM G;  2IX0 A;  2K5N A;  4A93 B;  5IWA Q;  1VCI A;  2ZXO A;  1D5Z C;  1VQB A;  2G9D A;  2B2W C;  4XYO A;  2A69 D;  4A3C G;  1WJJ A;  5FO9 B;  5HGQ A;  3VYS A;  1VQK A;  3I4N G;  1D1I A;  1HRJ A;  1S72 A;  5KIX A;  2A69 C;  1V1O A;  2K04 A;  4JVZ A;  1K3R A;  3A8K E;  1JOR A;  1DOK A;  1CA6 A;  5C3X A;  3MAQ A;  3AB9 A;  2O2L D;  5IE8 A;  2F0K A;  3NBH B;  5M3F H;  1OXT A;  2KUM A;  3S2H H;  2PCF B;  4HAE A;  4QUC A;  1V1Q A;  3M3Y H;  4EVO A;  2BA0 A;  2F0V A;  1VQ6 A;  1RHP A;  1EY7 A;  1I6V C;  3C1F A;  4HIO A;  1DON A;  4KI0 A;  1Y1W G;  3I55 A;  3TP7 A;  4LJZ C;  1I4Q A;  1GHJ A;  1H9J A;  1KQS A;  4B3R L;  5KYL A;  4G7Z C;  3TME A;  1X3E A;  3OOC A;  1DYQ A;  1EY8 A;  1CI3 M;  2Z6B A;  3MXN B;  2ZJQ A;  3S14 B;  4TSS A;  1EQQ A;  1XPO A;  2QCP X;  4IUU A;  1Q82 C;  2PNH A;  3NTK A;  3RUZ A;  3J7Z C;  2Q2T A;  4BXX G;  3AFP A;  4XQN A;  4YCU A;  1EIG A;  3PUV A;  1K83 H;  3B6Y A;  4L5S A;  4QY7 A;  3J7Y W;  1JT8 A;  4X66 L;  4NXN Q;  1IBL L;  4RKL A;  1STB A;  1EY6 A;  4RCN A;  1AZQ A;  3T51 B;  3EFX D;  3HOV B;  2HHH Q;  2IHF A;  2WFW A;  5IGE A;  1RIP A;  2VW9 A;  1ML0 D;  1A2U A;  1OO9 B;  1T5E A;  1ZEQ X;  1L1O A;  3STB C;  1QVG A;  4J6H A;  3NP8 A;  4CHT B;  3PIP 3;  2IL8 A;  1ILQ A;  1RJT A;  1HUN A;  3K81 C;  4A4I A;  5HUR A;  1EZ6 A;  1HA6 A;  2YU9 B;  5T1G A;  3K0Y A;  3TZU A;  5DNF A;  1KHI A;  2B8G A;  3HKZ G;  4APV A;  4K0K L;  2JA5 B;  4HSV A;  2I5L X;  2KQ3 A;  4IPH A;  1KTK A;  2WB1 G;  2HUG A;  1GD7 A;  4A76 A;  4A3F H;  2VS1 A;  2K28 A;  2JA8 B;  1ONL A;  2LS0 1;  5BN4 A;  2RDG A;  1TVX A;  1EYG A;  1C0A A;  3KF6 A;  3CCJ A;  1SSO A;  1AE2 A;  2WP8 J;  3K6O A;  3T13 A;  3ND8 A;  3I4O A;  2LKV A;  3D31 A;  3TN2 A;  3BVG A;  1TS4 A;  3EJI A;  2BH2 A;  2EY1 A;  2EDG A;  5DLQ E;  3QIA A;  2DNC A;  2I0Q A;  2D5D A;  2EIF A;  2GVB A;  3VR3 A;  3TBI B;  4XQQ A;  1I5F A;  1I94 Q;  2VQE L;  3BDO A;  3KYH C;  4IQZ A;  4JBW A;  5EQ0 A;  2A6E C;  5I2Y A;  3DEO A;  5GAH C;  4C3J G;  4MZ9 A;  4WJ4 A;  1VQO A;  2A6H D;  3CW2 C;  1TWC B;  1BXT A;  2BE5 C;  1B3Q A;  5EPK A;  3TP8 A;  1G2S A;  5C0X I;  4JYA L;  3I4M H;  2K14 A;  5JAV A;  4MIU A;  1KRS A;  5J1Z A;  1XX8 A;  1YHQ A;  5FO8 B;  2RDF A;  4TVA B;  2UXD L;  1WTO A;  2DJG C;  3K5L A;  2L15 A;  2XSC A;  4NKL A;  5IYB G;  4IUQ A;  5CV5 A;  5AJ3 Q;  2FMM A;  3LNN A;  1LAB A;  2B2V A;  1QZG A;  4DV7 L;  2PNR C;  4JI6 L;  4NMZ A;  2A8V A;  4ZUI A;  2VUM G;  1UEA B;  1S5B D;  1I4G A;  3RZD B;  4A3J H;  1RL2 A;  2E76 C;  1EY4 A;  3M85 A;  5COY A;  1E1T A;  2ZXP A;  5C3W A;  4LF4 Q;  3JC6 6;  3ONA B;  1G2T A;  4A3E H;  3ULJ A;  3I8Z A;  4M8A A;  5C4J B;  4KHP L;  5JEA H;  2DUD A;  1BCP B;  2K32 A;  1JC7 A;  2QF7 A;  2JJQ A;  4RAU C;  2HHH L;  1MKH A;  1STG A;  3DM3 A;  2E74 C;  1VQM A;  4RGO S;  2VQF L;  2JA8 G;  4JV5 Q;  5E4X A;  4LUV A;  4OHJ A;  3HOZ G;  1K3B C;  1HA5 A;  1BOS A;  1BUV T;  2O4X A;  2XVS A;  3J80 L;  3R93 A;  2EJM A;  3CRL C;  1O7Y A;  2KBN A;  1Y1V H;  1K8G A;  2HIX A;  3GTO B;  3KK7 A;  3TZD A;  4DUY L;  1HXY D;  4GOP B;  4DV0 Q;  2ICI A;  2OTJ A;  2B29 A;  2E2J B;  5IP7 H;  4UP7 A;  3FKI H;  3CCU A;  5COR A;  1L0W A;  1AEX A;  1UAP A;  4Y7N B;  2PI2 E;  4RGT A;  4KTA A;  2Z6K C;  3GTG H;  4K5W A;  1J6Q A;  3HOU H;  3L3O C;  1I94 L;  3QO2 A;  4RHR A;  1C48 A;  4A3E G;  2HQL A;  3BG3 A;  4R9W A;  3PQI A;  4BY7 B;  1AZP A;  1LTG D;  4DN4 M;  5I6W A;  1GVP A;  4HJ7 A;  5I6Y A;  1XTC D;  3ER0 A;  4LFA L;  4DAY A;  1B2T A;  4A3L H;  4MTN A;  1ESR A;  2B2W A;  2R3Z A;  5IYB H;  4JV5 L;  1FR3 A;  1GM5 A;  1LV9 A;  1DOM A;  1Q81 C;  3CQZ B;  2PMZ E;  3KJO A;  4A3B B;  1OXX K;  1DXM A;  1WTQ A;  4RH6 A;  1CHP D;  4KHP Q;  2F0S A;  4J8Q A;  3SVM A;  1T9H A;  4GKK L;  1S3O A;  2UXC L;  2VB3 X;  4RCO A;  4DR4 L;  4C3J H;  1Z9F A;  1EOV A;  2ZJP A;  4H44 C;  1EZ8 A;  1SXT A;  3FPP A;  2CCZ A;  2LXJ A;  1YI2 A;  3H3V C;  2UUB L;  3BVZ A;  2B63 H;  5GQO A;  4R8N A;  4HJ8 A;  5K36 H;  2XTI A;  1HH2 P;  4A3I G;  1SNM A;  1E1O A;  1YNN C;  1IXR A;  4FDB A;  2QGQ A;  3Q22 A;  3HOW H;  4WFN 3;  1RCV D;  1VQ9 A;  4BY7 H;  4N9P A;  1EFW A;  2B2T A;  2PQE A;  1VDZ A;  1CZW A;  1GUN A;  1J8I A;  1JWM D;  4IFD G;  5L37 A;  2HIV A;  3PUX A;  5A2Q E;  1Z7T A;  1WCM B;  1D7Q A;  1XTD A;  4X64 Q;  4R4I A;  2HQE A;  3RZO B;  4HMI A;  1I4H A;  3GTG B;  1YJN A;  1IBL Q;  5EPJ A;  1SAP A;  4TRD A;  3KLS X;  3NK9 A;  1NR4 A;  2F0L A;  5KNC A;  3CC7 A;  3TRE A;  1EU4 A;  4X64 L;  4R4O A;  5I4D A;  2MUY A;  4PZ8 A;  2E2J H;  3X3N A;  3A7A B;  4GZY C;  4CKE A;  4A3K H;  5CV7 A;  3BZC A;  1R4Q B;  4JBK A;  2EPB A;  2QIL A;  2K03 A;  3J80 i;  1EU3 A;  5CBE E;  3J81 j;  5LHY 1;  2VUM B;  1G91 A;  3KLR A;  3OTO L;  2O5J C;  2X6L A;  2B2U C;  2VQE Q;  1LT3 D;  3FEW X;  2EY5 A;  4KHZ A;  3PO2 B;  1SRU A;  3RNU A;  3HOX B;  4QQB X;  1KNA A;  5IYD G;  2V1C C;  4G57 A;  1X9N A;  3P20 A;  1U0L A;  4LF5 L;  4HR7 B;  2NVY H;  2ZT9 C;  2QA4 A;  1SND A;  2ZJR A;  5JVH 3;  2F1M A;  3ERS X;  2WAC A;  1UEB A;  4DV5 Q;  3ZYY X;  3I4N H;  3H6M A;  3L0O A;  4HED A;  3FP9 A;  3VA7 A;  1N34 L;  2IW3 A;  4LAA A;  1LT4 D;  3D6C A;  4IOA A;  2E2H H;  2A68 D;  2LXK A;  3TDQ A;  1TWH B;  4B3M Q;  4DV1 L;  1LTR D;  2KHJ A;  4DNR B;  1STN A;  1Y1W H;  3F1Z A;  2NVX H;  3M4Y A;  3H0G B;  1LTB D;  3EIV A;  5IIF A;  1BR9 A;  4C3I B;  4UAI A;  1BBU A;  5IWA L;  1HNZ L;  3PF4 A;  4LFB Q;  3VR5 A;  1SYC A;  2PO4 A;  3O13 A;  2R92 H;  2RCF A;  1TWA B;  4Q5V A;  1EEI D;  4A3K G;  4LF8 Q;  2F03 A;  1E2Z A;  4RGM A;  3GTK B;  2DGY A;  3D8G A;  2H4O A;  1EWC A;  4IJL A;  4JOI A;  3E0E A;  3VYT A;  4DA2 A;  4C3I H;  1Y8P B;  5IGD A;  1CA5 A;  1VMC A;  1Y14 B;  2CH4 A;  5C5M A;  2BOS A;  3A74 A;  1AN8 A;  3GP7 A;  1GUW A;  3RZO H;  5H1S E;  3PIO 3;  1TII D;  4HID A;  1LTA D;  3CCL A;  1PFB A;  3P75 A;  5FLX L;  1WTP A;  4JI3 Q;  4V19 0;  4C3H H;  1BQQ T;  5IT9 E;  3PMF A;  2Y0S E;  3T53 B;  2R7Z H;  2WAQ G;  1G51 A;  3BYY B;  2F0M A;  1UE7 A;  3J7A F;  3KF8 B;  1UE6 A;  4DK1 A;  2NVY B;  2X6G A;  3S1M B;  5CV6 A;  3EBE A;  1CQV A;  4IUV A;  3JAM L;  4JI7 L;  1GXD C;  1VS0 A;  3UDG A;  1HFN A;  4DNI A;  5C3E G;  3TRZ A;  4CKB A;  2OXP A;  1KDC A;  4KK7 A;  3S1N H;  4L5R C;  1VQI A;  3S17 H;  1TWH H;  3K5M A;  3T1H Q;  1VF7 A;  2AKW B;  2ZTD A;  3M7N A;  1QUQ A;  3RMH A;  1GKH A;  1SYB A;  3RN5 A;  4A3F B;  3M4O H;  4GNX A;  3I4N B;  1C9O A;  2Q8I B;  3S1R B;  2JA5 H;  4FXK C;  5AJ3 L;  3GTL H;  1TS2 A;  2F0T A;  3TP5 A;  5HGT A;  4LFA Q;  3HOZ B;  3KDF B;  5I9O A;  1A3T A;  1D6E C;  1PTO C;  3EA6 A;  3ICE A;  2VL6 A;  2ZTE A;  3NEN A;  1PZI D;  1YNX A;  2N78 A;  2MGS A;  4IPC A;  4DR5 Q;  4FF4 A;  3EQL C;  1WD0 A;  3OIQ A;  4BBR B;  3HOY H;  3CC2 A;  4LW1 A;  4P73 A;  2Z4I A;  3GTL B;  1TWG H;  1X3P A;  4AIM A;  4B3R Q;  2GVA A;  3MXN A;  4IFD J;  1J9O A;  2GN5 A;  1W3S A;  1YNJ C;  1XPR A;  2EYJ A;  3UE0 A;  2B8F A;  1YEZ A;  1B9N A;  1FNV A;  3NPP A;  4R4T A;  2R7F A;  5C4H A;  1K83 B;  2ZM6 L;  2KED A;  1XXG A;  1K9M C;  2CW0 D;  3SHL A;  5EJW A;  3A7L A;  5C4Z A;  2FXQ A;  5C5L A;  1ENA A;  3CQZ H;  4GLX A;  5FK9 C;  1KLU D;  1HTP A;  2MJ8 A;  1IYV A;  1PHJ A;  1ROD A;  1Q1B A;  2RHS B;  3OIP A;  1PH6 A;  2LSS A;  5JJL A;  4U67 3;  4XT3 B;  5F2D A;  4LMQ D;  4JI2 Q;  3GTM H;  2R7Z G;  1R9T H;  1HZC A;  5C4X H;  2B39 A;  1P8L A;  4DNT B;  1HNX L;  2NVQ B;  1A15 A;  4KY7 A;  3NQI A;  2YTY A;  3MA2 B;  2R93 G;  2R61 A;  2Z8L A;  3T16 A;  1A62 A;  5CYU A;  1IL2 A;  2F3V A;  4ZAI A;  2K5W A;  1VQP A;  3RR5 A;  2MO0 A;  3KFU A;  1S5D D;  1LAC A;  4DR3 L;  4CKC A;  4PV1 C;  1H9S A;  2FHT A;  4GN3 B;  3J7A V;  3KLS A;  2IHE A;  4K2L A;  5EBC A;  4JI5 Q;  1PVO A;  2L4N A;  4IAL A;  3GTK H;  1Y69 U;  4WJ3 M;  4K6L A;  1S5C D;  1I3Q B;  4JI8 Q;  1F9R A;  2ALY B;  1IZ6 A;  3MWY W;  4JK1 C;  3J81 c;  1Z47 A;  1PRT F;  3H94 A;  3KBX A;  4GOP A;  2JA7 B;  4KMU C;  3GO5 A;  1JB7 A;  3J81 i;  1SN8 A;  3CCV A;  4XQJ A;  1HQR D;  1OXU A;  5FLM H;  3HKZ B;  4PZ6 A;  1RTN A;  5LL6 X;  1ZKO A;  4AYB E;  2WB1 B;  2M2L A;  3HKS A;  3HOU B;  3CHB D;  3I91 A;  1W6J A;  4POF A;  1SBB B;  3GDE A;  2WAQ B;  2EYP A;  2K33 A;  3A56 A;  1JMC A;  2EYH A;  2D62 A;  5DAU A;  1SMY D;  2XIW A;  1HFG A;  3ND9 A;  2CHB D;  2F0G A;  2A73 B;  2Y0S B;  4F7X A;  1X55 A;  4BS9 A;  3E9I A;  3ITP A;  5IT9 L;  1I4R A;  1STY A;  1PYW D;  4L5Q A;  1RF2 D;  3NWT A;  4QJF A;  5G3L F;  1CM9 A;  1B50 A;  2Z9H A;  1XPU A;  3RZD H;  4DR4 Q;  1N33 L;  2X69 A;  4OWT B;  3GTQ H;  4PMB A;  5E4W C;  5BN5 A;  3JAM E;  3GTP H;  3HOW G;  1VQ5 A;  4LF6 L;  2HCI A;  1V1P B;  1S4Z A;  1AFP A;  3MEH A;  3C1E A;  2WII B;  1IBK L;  5M5X B;  1DGS A;  3AYH B;  2OEO A;  2WIN B;  3PGZ A;  3SXH A;  1F2Z A;  2E2D C;  2F0E A;  2I46 A;  1O80 A;  1NMG A;  2KCC A;  3PCO B;  2JEB I;  1N32 Q;  4K6D A;  2JA7 H;  1GUS A;  2YYZ A;  4DV2 L;  3VR6 A;  3DLL A;  4GKJ L;  4HCE A;  4GN5 A;  1GUG A;  1KRT A;  3SK5 A;  4MHE A;  3T56 B;  4YCW A;  1QOH A;  1XMO L;  3FHW A;  1AE3 A;  4KN4 C;  4X65 Q;  3NUC A;  1ET6 A;  3NEM A;  4DV4 L;  4HSP A;  1SFO B;  4X3S A;  3CP0 A;  4O0A A;  4A3L G;  4NXM Q;  2B63 B;  1VQE A;  3M7G A;  1WTX A;  1HHV A;  2P5Z X;  4YWL A;  2CQA A;  3S1Q B;  2UU9 L;  3PUY A;  1X3Q A;  4C3J B;  1EUJ A;  1JOO A;  4J15 A;  3UI2 A;  2PYK A;  4HTH A;  5LMU Q;  3I90 A;  1F2L A;  2TSS A;  5BN3 A;  1JWU D;  3PUW A;  3NWS A;  5M5W B;  1SMX A;  2QDB A;  1B9M A;  1CKM A;  2EXZ A;  3HRZ C;  5C4X G;  2RDH A;  5C4X B;  1D1K A;  2PW7 A;  4FP5 D;  2E8G A;  3IFD A;  4EQO A;  1ZYR D;  3GV3 A;  4CDF C;  4KD3 A;  4DUZ Q;  4OO1 I;  2OWO A;  1AW7 A;  2K4K A;  1PH4 A;  1RKN A;  5M5Y H;  1NMF A;  3RD4 A;  2UUC Q;  1DOL A;  1CQF A;  1QE6 A;  1X3F A;  2HCC A;  3K80 C;  3NBI A;  2EYL A;  4FXD A;  4AQY Q;  1NY4 A;  2OQK A;  1E3P A;  3JAM c;  3WWV A;  1E0B A;  1FJG Q;  4U68 A;  1ET9 A;  4OWW B;  2MP1 A;  5J22 A;  2SEB D;  1V1P A;  4QUF A;  5M3F G;  3D4R A;  4LF7 Q;  4BXX H;  1TY2 A;  3MTS A;  1I4P A;  4G7H C;  3C2P A;  1WVL A;  3KOJ A;  1PTO H;  4EQN A;  4L5T A;  1YIT A;  3CC4 A;  1J5E L;  3GTP B;  2WB1 E;  1W2B A;  4ZRZ A;  2GA4 B;  3L9A X;  1VQJ A;  3HKZ E;  1TY0 A;  2B3G A;  4X62 Q;  1EY9 A;  4YY3 Q;  3W2D A;  4HJ9 A;  4GS3 A;  4MNO A;  2PQA A;  4PMW A;  5CC4 A;  4A3C H;  1WI5 A;  1KD1 C;  2EJG C;  1HNX Q;  3OPO A;  3KBG A;  4BA2 I;  5E7N A;  3Q23 A;  2JYO A;  1ZXT A;  1MSG A;  4EQP A;  5J39 A;  4JC0 A;  4LNQ A;  2F0H A;  2F0Q A;  4JW0 A;  3K7A B;  3BVM A;  1PH7 A;  1H9S B;  1L0Y B;  3S1N B;  3I2Z A;  2L0C A;  3WOF A;  5A2Q L;  4A3E B;  3MFG A;  3CXC A;  3CCM A;  4Y52 H;  1MBY A;  3M4Q A;  5C6A A;  1IBM Q;  1H95 A;  4V0B A;  1MIU A;  3F2C A;  2Z0S A;  1YIJ A;  2N8N A;  3HGB A;  3UDI A;  1L1O C;  2JA6 B;  4N8X 1;  4B9X A;  4B3S L;  4JI0 L;  1U4P A;  4TKO B;  4CDC C;  4I65 A;  2AQ2 B;  4JCV E;  3HFZ B;  5NUC A;  2PW5 A;  1YZ6 A;  1SFO H;  4DV3 L;  2KA7 A;  1B8A A;  4P72 A;  2VNU D;  5E1F A;  2SNM A;  1Y8N B;  3GTJ H;  5GRO A;  1G6Z A;  3TEH B;  3N52 A;  3I3C A;  4H02 A;  3V96 A;  4A93 G;  4K14 A;  4RHS A;  2UXB L;  2K01 A;  5LMN L;  3J80 c;  1D5X C;  1B44 D;  2KVM A;  1EY0 A;  5TSS A;  5KRU A;  1RD9 D;  1EQT A;  2LY7 A;  4B3T L;  1FD7 D;  1XMQ Q;  4IZ8 A;  3EVQ A;  5M5X H;  1IKL A;  2E75 C;  4LF6 Q;  4DV6 L;  1FYC A;  1JJ2 A;  4PG3 A;  4C3H G;  3MEF A;  3GTJ B;  5AFW A;  1BDO A;  2F3W A;  4WJW A;  3R3O A;  3A8J E;  4LF4 L;  1C8C A;  4I7A A;  1B53 A;  1IW7 D;  2Z4H A;  1S40 A;  1SYF A;  1FGU A;  4ME3 A;  5ELF A;  3HS0 C;  3BDC A;  1HUM A;  4ZKB B;  1EFI D;  4ODG A;  4JI6 Q;  2A74 C;  2A6E D;  2E2H B;  2RQX A;  2RHQ B;  2F0J A;  1ASZ A;  4P75 A;  1SNP A;  3U9S A;  1PH9 A;  3EN2 A;  3H3V I;  1DCZ A;  1ICF B;  4C3I G;  4N8F A;  3NQT A;  3R2I A;  1BF4 A;  3KLW A;  3V2T A;  1STH A;  2PMZ B;  3JAM i;  2JE6 I;  2F0F A;  1TWF H;  2VB2 X;  3TQY A;  2RA4 A;  1A8V A;  4DR6 Q;  2R93 H;  3H09 A;  3IAY A;  3IL8 A;  2RF4 A;  1A6X A;  2L12 A;  2KJX A;  2D9U A;  2I5H A;  4KY5 A;  4L63 B;  1X65 A;  4O2D A;  2UXC Q;  4A3D G;  4YCV A;  4HIK A;  3S1R H;  1SLJ A;  4GKK Q;  1JIC A;  4IN3 A;  2VUM H;  4RKB A;  4X65 L;  4DR7 L;  4OEM B;  3IRB A;  2KCN A;  2E2I H;  2N55 A;  3BDL A;  3G71 A;  2CWP A;  3CCE A;  5IP7 G;  1V8Q A;  5IY0 A;  3KF8 A;  3NEL A;  3PIP A;  2EY2 A;  3S15 H;  1I6H H;  1YNN D;  2JSO A;  4HN7 A;  1NCV A;  1DZ1 A;  1EIF A;  2UXB Q;  1FNW A;  1PZJ D;  4MN3 A;  3DEP A;  4A3D H;  4FF2 A;  1Q8I A;  1Q1E A;  2RCN A;  5IOC A;  1CFM A;  1F2Y A;  5IYC G;  1E2W A;  4IUT A;  3PV0 A;  3HOZ H;  4A3M B;  2OQ0 A;  4A3I H;  2R7Z B;  2IT1 A;  5C3E B;  3D4W A;  4YY3 L;  2EVB A;  2K5Q A;  2JXM B;  2NTS A;  5KND A;  1JE4 A;  2SNS A;  3PO3 B;  2D0P A;  1CSQ A;  2F52 A;  1EIH A;  4QGU A;  4GLA C;  3MZ5 A;  1SE4 A;  3CU7 A;  4K0K Q;  1JOK A;  5FJ8 G;  2WAQ E;  2JA7 G;  2EYF A;  3VA5 A;  4IFD I;  1V43 A;  5JEA J;  3I4M G;  2HD3 A;  2F4V Q;  1NJI C;  1Q8K A;  4BY1 H;  1C7Y A;  4M1U B;  1IKM A;  2EE1 A;  3S2D H;  3S2H B;  4DF7 A;  4DR2 L;  4F8M A;  4K8I A;  3R2T A;  2NZH A;  2VY3 A;  5KYI A;  4ABN A;  4FF1 A;  2DY8 A;  1CUK A;  3W3A A;  4TQU S;  1F2M A;  2R7D A;  2B2Y C;  2H1E A;  3A0J A;  2B2Y A;  1SYG A;  2VQF Q;  2K05 A;  5DEH A;  2HDM A;  3J81 L;  4C2M H;  3HOY B;  1Q90 A;  2BCO A;  4IUP A;  3TS0 A;  1BBX C;  4UHV A;  3MXG A;  1QB5 D;  4BY1 G;  1HTL D;  2R93 B;  4R8I A;  2ID0 A;  1D5M C;  5EKK A;  4H7B A;  1JQY D;  3T1Y Q;  1BNZ A;  2MO1 A;  1EYC A;  2K6A A;  1KNE A;  3VR4 A;  4F88 A;  2A1A A;  4J1M A;  2J7Z A;  2B2U A;  2UU9 Q;  3K59 A;  4X3U A;  5CV9 A;  1ESF A;  3T1Y L;  4XIG S;  5ELC A;  1SNO A;  4DR3 Q;  3A55 A;  4OL7 A;  4G4K A;  1U4R A;  3LWU A;  2XWJ B;  4GLV B;  2Q8R E;  1S5F D;  2NN6 I;  4FF3 A;  1II3 A;  2B63 G;  4DKA C;  5EKL A;  5C44 H;  2YV5 A;  3SGI A;  3GQB A;  1OXS C;  3AQQ A;  1X6O A;  3HG9 A;  4YHH L;  5C44 B;  2AUK A;  4JYA Q;  3S9W A;  2F4I A;  4JG2 A;  4C1N K;  4Z9C B;  2A5H A;  5JVG 3;  3HZX A;  3I4L A;  4DR1 Q;  1I50 B;  1HPC A;  1TWF B;  4R1J A;  4O1N A;  3FKI G;  5CGK A;  1SE2 A;  2PI2 A;  2IX1 A;  1HQM C;  3I72 A;  1QG7 A;  1E2V A;  1VQN A;  3Q8D A;  5IGC A;  1MGS A;  4B9W A;  5M3M B;  5GAD C;  2JK8 A;  1OXV A;  2L5T A;  3CME A;  4IUN A;  2NUC A;  4KHV A;  1VQF A;  2Q8T A;  3PO2 H;  4JI4 L;  3LGJ A;  2G9H D;  1JE5 A;  1LTS D;  1MJC A;  1A3U A;  1N36 L;  3VR2 A;  1PTO B;  4EX5 A;  1K8M A;  1STA A;  1I3Q H;  1LYL A;  5EAY A;  1L1O B;  1KC8 C;  4KJN A;  5IYD H;  2LFN A;  1LUZ A;  2R92 B;  3BYT B;  5IT9 c;  1PH3 A;  5C0X H;  4XT1 B;  1ZYR C;  1HCZ A;  2MFI A;  2JN4 A;  3N6R A;  1TWC H;  2H5X A;  2QW7 A;  3URY A;  5M5Y B;  2Q2H A;  2AUJ D;  1B70 B;  1WTR A;  2BH8 A;  3FVQ A;  3A5U A;  2HDL A;  2IWH A;  3E5S A;  1U5K A;  3T1H L;  1KIX A;  2CH4 W;  3F2D A;  4OXP A;  1L0X B;  3U50 C;  1R9T B;  5C0X J;  2MPM A;  2EYM A;  4LF5 Q;  5D3D A;  4K2K A;  3VDY A;  1PDQ A;  4JI7 Q;  3HP3 A;  4DU9 A;  5I9P A;  4IUR A;  2L1B A;  1B4O A;  2F0N A;  1WTW A;  1BBW A;  2JA6 G;  3DWA A;  5C44 G;  3NHH A;  4QF4 A;  1KDB A;  3PO2 G;  5EGT A;  1CKO A;  3KF6 B;  4LWC A;  2N49 A;  1G8Z D;  1VQA A;  3W1B A;  2DY7 A;  5GAE C;  1NSN S;  4BBR G;  3P7J A;  4OO1 H;  2YTV A;  1SEB D;  2NN6 G;  3G6E A;  1SJH D;  4RGN A;  1PMR A;  2NWG A;  4B08 A;  1SDF A;  2AWO A;  1PH5 A;  1WYD A;  1JOQ A;  2ICE C;  3U4V A;  3BZK A;  4BA1 I;  1BVS A;  4A3G B;  4RFB A;  1X3G A;  2CWA A;  4A3M H;  2DNE A;  1VQG A;  4R4C A;  2OTL A;  3AEV A;  1LTL A;  4JI1 L;  2PZW A;  4ULL A;  1D8L A;  2I5M X;  1MJE A;  4KJO A;  4C1N I;  3J81 E;  1EWH A;  1IBM L;  1JR0 D;  4KD4 A;  1SNQ A;  1UUP A;  1XMO Q;  4C2M B;  3VYU A;  1M1K C;  1TKW B;  5I2X A;  3T4A C;  1WD1 A;  4XYQ A;  2BDN A;  4OIK A;  1M90 C;  1GOZ A;  1PYB A;  1ILP A;  3HOV H;  1O7Z A;  3PSI A;  2EZV A;  1SMY C;  1HNW L;  1SJE D;  1QJO A;  1PFM A;  1OTC A;  2MHV A;  3CCQ A;  1VQC A;  3J80 E;  4DR1 L;  2F0P A;  1IBK Q;  3S1Q H;  1LTT D;  4BY1 B;  4EQ5 A;  4YHH Q;  2PPB C;  3WDN A;  4JI2 L;  3SK6 A;  2QDL A;  4A3B G;  2YTX A;  1X56 A;  4HCS A;  5FLX E;  3QB3 A;  4RWS C;  4X62 L;  4P74 A;  1PFN A;  4B3S Q;  4ZYS A;  2JEA I;  4WOR A;  3K5N A;  4GOP C;  1E24 A;  1SE8 A;  3GD7 A;  3PO3 H;  2CW0 C;  2XRS D;  2DN8 A;  4RA8 A;  1A2T A;  1PRT B;  5K5P A;  4CDD C;  1XNQ Q;  3RLF A;  3A8I E;  4C56 C;  2K5V A;  5BR8 Q;  1U9R A;  3OHX C;  4DR7 Q;  3D0F A;  3QR8 A;  4WRD A;  5FJ8 H;  1IHZ A;  4FO2 A;  1KAB A;  4BWG B;  4GNX B;  5JJI A;  4CDE C;  3IFT A;  4GN4 B;  3CPW A;  2NVT H;  1QUQ B;  4ZUJ A;  4RG1 A;  2L11 A;  1O7L A;  1LLR D;  1U4L A;  4DGZ A;  1CSP A;  3FKI B;  5CV8 A;  4DUY Q;  2XRQ D;  1BCP C;  4OGQ C;  4HIM A;  1CK1 A;  3NXW A;  2R92 G;  4LF9 Q;  1EYD A;  2ATW A;  2E2I B;  1WOC A;  5JEA G;  2PZT A;  5J3B A;  1D2B A;  1EOT A;  5IGB A;  1YJ9 A;  4JI8 L;  5FLM G;  5M9O A;  1AP0 A;  2L55 A;  2WKC A;  1PH8 A;  5A35 A;  1P16 A;  3I7F A;  1UNS A;  1TS5 A;  3CRK C;  1X32 A;  3F8T A;  3QWN A;  1S5E D;  2WKD A;  3M9B A;  3K7A H;  1UWV A;  1ICW A;  1CZG A;  1JJC B;  4DAY B;  2JA8 H;  1KAW A;  3PO3 G;  4ILW A;  2FFK B;  1CHQ D;  1SR3 A;  2DJF C; 
#chains in the Genus database with same CATH homology
 1STE A;  1Q3L A;  2NYZ D;  1EEF D;  2TMP A;  4NDX A;  3K58 A;  3SR1 A;  2XN9 C;  2KEC A;  4K5V A;  4E6I A;  1RTO A;  4A3J B;  3LWE A;  2KHS A;  1H9R A;  1R4P B;  4ID6 A;  4FNF A;  1PRT C;  3SDZ A;  1PTO D;  3G6J B;  1DM0 B;  3OWF A;  2AQ1 B;  1TS3 A;  2EOT A;  1SNC A;  4CBV A;  2K7V A;  4A3K B;  3DM1 A;  3MHB A;  4BBS B;  1NR2 A;  5K36 G;  3SK4 A;  1IW7 C;  2WV6 D;  2F0I A;  2K1B A;  4K8J A;  3I4M B;  5KNB A;  3Q24 A;  4IFD H;  3QOL A;  3AU7 A;  4PNY A;  4O42 A;  5FOB B;  1KDA A;  1Q12 A;  3HOW B;  2EY6 A;  2B2V C;  1LO5 D;  3L7Z C;  3IKJ A;  4DFA A;  3R8B A;  4CJ2 C;  4X3K A;  2Z1C A;  3E6Z X;  4L6T B;  3OWE B;  2VXW A;  2QEJ C;  2NTT A;  1TR5 A;  1JWS D;  1SYE A;  1RDP D;  2PZU A;  3DHQ A;  3FPU B;  3FMC A;  2NN6 H;  2N88 A;  2RVL A;  2LMC B;  5JOB A;  1IL8 A;  2NZ1 D;  1M4V A;  4A3D B;  5ELD A;  3K5O A;  3MFY A;  3QOJ A;  2FIN B;  1I6H B;  1PTO F;  3M3Y B;  3NBH A;  5LL6 S;  1F77 A;  1C4Q A;  2C5C A;  3C3L A;  4H0L C;  5D3I B;  5C0X G;  2A68 C;  1Y8O B;  3ERQ A;  4QMG A;  1ENF A;  5CMD A;  2KOL A;  4KKT A;  2RBM A;  1MSH A;  1JCK B;  3DWP A;  1ENC A;  5EKI A;  2CVR A;  3DWQ A;  1GUT A;  1F9S A;  5D65 A;  5DM6 3;  3NE5 B;  3E0J A;  1EY5 A;  2AQ3 B;  2KEE A;  1CTM A;  3F2U A;  1EQV A;  1H9K A;  2F0O A;  3U9O A;  4OIJ A;  3SE0 A;  2ZXR A;  1TU2 B;  1PZK D;  1LTI D;  1QNU A;  3TSS A;  3P1H A;  3KUP A;  3D6W A;  2OF1 A;  4L8J A;  2OT2 A;  4FYD A;  3FRP B;  1NAP A;  4YIJ A;  2NVT B;  4NP5 A;  4AYB B;  3OW7 A;  3DUZ A;  4KN7 C;  4Q0F A;  1DD2 A;  3TP6 A;  2I07 B;  1BCP D;  3H91 A;  5CR3 A;  4DXG A;  2C9O A;  1QNK A;  3GTM B;  3NTI A;  2NB0 A;  1FGB D;  4H13 C;  4ZQ3 A;  5EPL A;  4CGY B;  5JPM C;  4EGV A;  4UDU C;  3PUZ A;  5JPN C;  4LK1 C;  4KKS A;  3S2D B;  4DXF A;  1K8O A;  5E3F A;  3GTQ B;  1A3V A;  3NSW A;  2XNA C;  4PQX A;  3DMU A;  1DJR D;  1BO0 A;  1MD2 D;  5ELE A;  2FJ2 A;  2QKI C;  3MVV A;  5IGF A;  5G3L D;  4PMC A;  1B1Z A;  2M9V A;  3LX0 A;  1KLG D;  1GHK A;  4I7Z C;  1MI2 A;  5JJZ A;  5FO7 B;  3S16 B;  4KV6 A;  1G29 1;  1QCB D;  4KKU A;  3BS1 A;  5CBA E;  1M8A A;  1FNU A;  2XWB B;  2F0W A;  4CJ0 B;  3S15 B;  2BDO A;  5EBD A;  3X3M A;  2J4X A;  2FMC A;  3Q6S A;  5D14 A;  1WTV A;  3MXP A;  3Q0A A;  1QIL A;  3S17 B;  5IGG A;  3AMU A;  2BE5 D;  4HMJ A;  3OSO A;  1TWG B;  3A54 A;  4QCL A;  2A6H C;  2RKS A;  2IJ0 A;  4NW2 A;  1GUO A;  2RSO A;  3FDT A;  2AWN A;  1H9M A;  1F9Q A;  1LT5 D;  3NTH A;  2F0U A;  4FXG C;  2RSN A;  2J0T D;  3MXU A;  4XDX A;  2M00 A;  3OMG A;  2SOB A;  4XXE A;  2L9H A;  4ZLT F;  2BA1 A;  2JP1 A;  3DXJ C;  3M4O B;  1CT1 D;  4A3I B;  4C3H B;  2SDF A;  1I4X A;  5ISR A;  1GJX A;  1W6K A;  1SYD A;  3QJY A;  4ZK9 B;  5KEE A;  3GV6 A;  3MC0 B;  1PXU A;  4ME5 A;  4CJ1 B;  1VF5 C;  4DK0 A;  4X3T A;  1XWE A;  5M3F B;  1EYA A;  4QB4 A;  2B2T C;  1TQO A;  1F9P A;  5DM7 3;  3G7L A;  2IX3 A;  3D3R A;  4FVM A;  5FKA C;  3WOE A;  4DAP A;  4N9T A;  3V05 A;  1XYI A;  1T5X D;  4ZKC B;  1Y1W B;  1PRT D;  1NUC A;  3I70 A;  1YNJ D;  5KGU A;  1Z6H A;  2IPK D;  3ERO A;  2K5D A;  3CKI B;  3I73 A;  1VMP A;  5T1I A;  2EJF C;  2ENB A;  4QIW B;  1IYU A;  4G7O C;  1U4M A;  2F0D A;  1LT6 D;  1EL0 A;  4S3S A;  1B3A A;  2D2C C;  1Y1V B;  2V4D A;  3D4D A;  3SEB A;  2NVX B;  3C46 A;  4K5X A;  3K57 A;  1TT2 A;  4XTC S;  4DAV A;  4F87 A;  1BCP F;  3HEJ A;  2O5I C;  4P2C B;  2EYO A;  1QWY A;  1KAA A;  2NBF A;  5IOD A;  1O78 A;  3VYR A;  5CV4 A;  3OMC A;  3SK8 A;  1SE3 A;  1JB3 A;  3QG1 A;  1PLF A;  5ELB A;  4OO1 G;  4KY6 A;  2R6G A;  3BZD B;  2IX0 A;  4A93 B;  1VCI A;  2ZXO A;  1D5Z C;  2G9D A;  2B2W C;  4XYO A;  2A69 D;  5FO9 B;  3VYS A;  1D1I A;  1HRJ A;  5KIX A;  2A69 C;  1V1O A;  2K04 A;  3A8K E;  1JOR A;  1DOK A;  1CA6 A;  5C3X A;  3MAQ A;  3AB9 A;  2O2L D;  2F0K A;  1OXT A;  2KUM A;  2PCF B;  4HAE A;  4QUC A;  4EVO A;  2BA0 A;  2F0V A;  1RHP A;  1EY7 A;  1I6V C;  3C1F A;  1DON A;  4KI0 A;  3TP7 A;  4LJZ C;  1I4Q A;  1GHJ A;  1H9J A;  5KYL A;  4G7Z C;  3TME A;  3OOC A;  1DYQ A;  1EY8 A;  1CI3 M;  3S14 B;  4TSS A;  2QCP X;  4IUU A;  3NTK A;  3RUZ A;  4XQN A;  1EIG A;  3PUV A;  3J7Y W;  4RKL A;  1STB A;  1EY6 A;  4RCN A;  1AZQ A;  3T51 B;  3EFX D;  3HOV B;  5IGE A;  1ML0 D;  1A2U A;  1OO9 B;  1T5E A;  1ZEQ X;  4J6H A;  3NP8 A;  4CHT B;  3PIP 3;  2IL8 A;  1ILQ A;  1RJT A;  1HUN A;  5HUR A;  1EZ6 A;  1HA6 A;  2YU9 B;  5T1G A;  3K0Y A;  3TZU A;  5DNF A;  2B8G A;  2JA5 B;  4HSV A;  2KQ3 A;  1KTK A;  2HUG A;  2K28 A;  2JA8 B;  1ONL A;  2LS0 1;  5BN4 A;  2RDG A;  1TVX A;  1SSO A;  2WP8 J;  3K6O A;  3T13 A;  3ND8 A;  2LKV A;  3D31 A;  3TN2 A;  3BVG A;  1TS4 A;  3EJI A;  2EY1 A;  2EDG A;  3QIA A;  2DNC A;  2D5D A;  3VR3 A;  3TBI B;  4XQQ A;  3BDO A;  4IQZ A;  4JBW A;  5EQ0 A;  2A6E C;  5I2Y A;  3DEO A;  4C3J G;  2A6H D;  1TWC B;  1BXT A;  2BE5 C;  5EPK A;  3TP8 A;  1G2S A;  5C0X I;  5JAV A;  4MIU A;  5J1Z A;  1XX8 A;  5FO8 B;  2RDF A;  1WTO A;  3K5L A;  2XSC A;  4NKL A;  4IUQ A;  5CV5 A;  2FMM A;  3LNN A;  1LAB A;  2B2V A;  2PNR C;  4NMZ A;  4ZUI A;  1UEA B;  1S5B D;  1I4G A;  3RZD B;  2E76 C;  1EY4 A;  3M85 A;  5COY A;  2ZXP A;  5C3W A;  3ONA B;  1G2T A;  3I8Z A;  4M8A A;  5C4J B;  5JEA H;  1BCP B;  2K32 A;  1JC7 A;  2QF7 A;  4RAU C;  1STG A;  2E74 C;  4RGO S;  5E4X A;  4OHJ A;  1HA5 A;  1BOS A;  1BUV T;  2O4X A;  2XVS A;  3J80 L;  3R93 A;  2EJM A;  3CRL C;  1O7Y A;  3GTO B;  3KK7 A;  3TZD A;  1HXY D;  2ICI A;  2E2J B;  5COR A;  1AEX A;  1UAP A;  4Y7N B;  4RGT A;  4KTA A;  4K5W A;  3L3O C;  3QO2 A;  4RHR A;  1C48 A;  3BG3 A;  4R9W A;  4BY7 B;  1AZP A;  1LTG D;  4DN4 M;  5I6W A;  5I6Y A;  1XTC D;  4DAY A;  1B2T A;  1ESR A;  2B2W A;  2R3Z A;  1FR3 A;  1LV9 A;  1DOM A;  3CQZ B;  4A3B B;  1OXX K;  1DXM A;  1WTQ A;  4RH6 A;  1CHP D;  2F0S A;  4J8Q A;  3SVM A;  2VB3 X;  4RCO A;  3H3V C;  4H44 C;  1EZ8 A;  1SXT A;  3FPP A;  3BVZ A;  4R8N A;  5K36 H;  1SNM A;  1YNN C;  3Q22 A;  4WFN 3;  1RCV D;  4N9P A;  2B2T A;  2PQE A;  1VDZ A;  1CZW A;  1GUN A;  1J8I A;  1JWM D;  4IFD G;  5A2Q E;  3PUX A;  1Z7T A;  1WCM B;  3RZO B;  2HQE A;  4HMI A;  1I4H A;  3GTG B;  5EPJ A;  1SAP A;  4TRD A;  3KLS X;  3NK9 A;  1NR4 A;  2F0L A;  5KNC A;  1EU4 A;  5I4D A;  2MUY A;  3X3N A;  3A7A B;  4GZY C;  4CKE A;  5CV7 A;  1R4Q B;  2EPB A;  2QIL A;  5CBE E;  2K03 A;  1EU3 A;  5LHY 1;  2VUM B;  1G91 A;  3KLR A;  2O5J C;  2X6L A;  2B2U C;  1LT3 D;  3FEW X;  2EY5 A;  4KHZ A;  3PO2 B;  3HOX B;  1KNA A;  4G57 A;  3P20 A;  4HR7 B;  2ZT9 C;  1SND A;  5JVH 3;  2F1M A;  2WAC A;  3ZYY X;  3H6M A;  4HED A;  3VA7 A;  2IW3 A;  4LAA A;  1LT4 D;  3D6C A;  2A68 D;  3TDQ A;  1TWH B;  1LTR D;  4DNR B;  1STN A;  3M4Y A;  3H0G B;  1LTB D;  5IIF A;  1BR9 A;  4C3I B;  4UAI A;  3VR5 A;  1SYC A;  2PO4 A;  3O13 A;  1TWA B;  4Q5V A;  1EEI D;  2F03 A;  1E2Z A;  4RGM A;  3GTK B;  3D8G A;  2H4O A;  1EWC A;  3VYT A;  4DA2 A;  1Y8P B;  5IGD A;  1CA5 A;  1VMC A;  5C5M A;  2BOS A;  1AN8 A;  3GP7 A;  1GUW A;  3PIO 3;  1TII D;  1LTA D;  1PFB A;  3P75 A;  5FLX L;  1WTP A;  4V19 0;  1BQQ T;  5IT9 E;  3PMF A;  3T53 B;  3BYY B;  2F0M A;  3J7A F;  4DK1 A;  2NVY B;  2X6G A;  3S1M B;  5CV6 A;  1CQV A;  4IUV A;  3JAM L;  1GXD C;  1HFN A;  4CKB A;  2OXP A;  1KDC A;  4KK7 A;  3K5M A;  1VF7 A;  3M7N A;  3RMH A;  1SYB A;  4A3F B;  3I4N B;  3S1R B;  2Q8I B;  4FXK C;  1TS2 A;  2F0T A;  3TP5 A;  5HGT A;  3HOZ B;  5I9O A;  1A3T A;  1D6E C;  1PTO C;  3EA6 A;  1PZI D;  2MGS A;  4FF4 A;  3EQL C;  1WD0 A;  3OIQ A;  4BBR B;  2Z4I A;  3GTL B;  1X3P A;  3MXN A;  4IFD J;  1J9O A;  1YNJ C;  2EYJ A;  2B8F A;  1B9N A;  1FNV A;  3NPP A;  5C4H A;  1K83 B;  2KED A;  1XXG A;  2CW0 D;  3SHL A;  5EJW A;  3A7L A;  5C4Z A;  5C5L A;  1ENA A;  5FK9 C;  1KLU D;  1HTP A;  2MJ8 A;  1IYV A;  1ROD A;  1Q1B A;  3OIP A;  4U67 3;  4XT3 B;  5F2D A;  4LMQ D;  2B39 A;  4DNT B;  2NVQ B;  1A15 A;  4KY7 A;  3NQI A;  3MA2 B;  2R61 A;  2Z8L A;  3T16 A;  5CYU A;  2F3V A;  4ZAI A;  2K5W A;  1S5D D;  1LAC A;  4CKC A;  4PV1 C;  1H9S A;  2FHT A;  3J7A V;  3KLS A;  4K2L A;  5EBC A;  2L4N A;  4IAL A;  1Y69 U;  4K6L A;  1S5C D;  1I3Q B;  1F9R A;  3MWY W;  4JK1 C;  1Z47 A;  1PRT F;  3H94 A;  3KBX A;  2JA7 B;  4KMU C;  3GO5 A;  4XQJ A;  1HQR D;  1OXU A;  3HKZ B;  1RTN A;  5LL6 X;  1ZKO A;  2WB1 B;  2M2L A;  3HOU B;  3CHB D;  3I91 A;  1W6J A;  1SBB B;  2WAQ B;  2EYP A;  2K33 A;  3A56 A;  2EYH A;  2D62 A;  5DAU A;  1SMY D;  2XIW A;  1HFG A;  3ND9 A;  2CHB D;  2F0G A;  2A73 B;  2Y0S B;  4F7X A;  4BS9 A;  3ITP A;  5IT9 L;  1I4R A;  1STY A;  1PYW D;  1RF2 D;  3NWT A;  5G3L F;  1CM9 A;  1B50 A;  2X69 A;  4PMB A;  5E4W C;  5BN5 A;  3JAM E;  2HCI A;  1V1P B;  1S4Z A;  1AFP A;  3MEH A;  3C1E A;  2WII B;  5M5X B;  2OEO A;  2WIN B;  3SXH A;  1F2Z A;  2E2D C;  2F0E A;  2I46 A;  1O80 A;  2KCC A;  2JEB I;  4K6D A;  1GUS A;  2YYZ A;  3VR6 A;  4HCE A;  1GUG A;  3SK5 A;  4MHE A;  3T56 B;  1QOH A;  4KN4 C;  3NUC A;  1ET6 A;  4HSP A;  1SFO B;  4X3S A;  2B63 B;  3M7G A;  1WTX A;  1HHV A;  2CQA A;  3S1Q B;  3PUY A;  1X3Q A;  4C3J B;  1JOO A;  3UI2 A;  2PYK A;  4HTH A;  3I90 A;  1F2L A;  2TSS A;  5BN3 A;  1JWU D;  3PUW A;  3NWS A;  5M5W B;  2QDB A;  1B9M A;  2EXZ A;  3HRZ C;  2RDH A;  5C4X B;  1D1K A;  2PW7 A;  4FP5 D;  3IFD A;  4EQO A;  1ZYR D;  3GV3 A;  4KD3 A;  4OO1 I;  1AW7 A;  1RKN A;  3RD4 A;  1CQF A;  1DOL A;  1QE6 A;  2HCC A;  3NBI A;  2EYL A;  4FXD A;  1E0B A;  4U68 A;  1ET9 A;  2MP1 A;  5J22 A;  2SEB D;  1V1P A;  4QUF A;  3D4R A;  1TY2 A;  3MTS A;  1I4P A;  4G7H C;  3C2P A;  1WVL A;  1PTO H;  4EQN A;  3GTP B;  4ZRZ A;  2GA4 B;  3L9A X;  1TY0 A;  1EY9 A;  3W2D A;  4PMW A;  5CC4 A;  2EJG C;  3OPO A;  3KBG A;  4BA2 I;  3Q23 A;  2JYO A;  1ZXT A;  1MSG A;  4EQP A;  5J39 A;  2F0H A;  2F0Q A;  3K7A B;  3BVM A;  1H9S B;  1L0Y B;  3S1N B;  2L0C A;  3WOF A;  5A2Q L;  4A3E B;  3MFG A;  1MBY A;  5C6A A;  4V0B A;  3HGB A;  2JA6 B;  4B9X A;  1U4P A;  4TKO B;  4I65 A;  2AQ2 B;  5NUC A;  2PW5 A;  2KA7 A;  2VNU D;  5E1F A;  2SNM A;  1Y8N B;  1G6Z A;  3N52 A;  3I3C A;  3V96 A;  4K14 A;  4RHS A;  2K01 A;  1D5X C;  1B44 D;  2KVM A;  1EY0 A;  5TSS A;  5KRU A;  1RD9 D;  1EQT A;  2LY7 A;  1FD7 D;  4IZ8 A;  3EVQ A;  1IKL A;  2E75 C;  1FYC A;  4C3H G;  3GTJ B;  5AFW A;  1BDO A;  4WJW A;  2F3W A;  3R3O A;  3A8J E;  1C8C A;  1B53 A;  1IW7 D;  2Z4H A;  1SYF A;  5ELF A;  3HS0 C;  3BDC A;  1HUM A;  4ZKB B;  1EFI D;  4ODG A;  2A74 C;  2A6E D;  2E2H B;  2RQX A;  2F0J A;  1SNP A;  3U9S A;  1DCZ A;  4C3I G;  3NQT A;  3R2I A;  1BF4 A;  3V2T A;  1STH A;  2PMZ B;  2JE6 I;  2F0F A;  2VB2 X;  2RA4 A;  3H09 A;  3IAY A;  3IL8 A;  1A6X A;  2L12 A;  2KJX A;  2D9U A;  4KY5 A;  4L63 B;  1JIC A;  4IN3 A;  4RKB A;  2KCN A;  2N55 A;  3BDL A;  1V8Q A;  3KF8 A;  2EY2 A;  1YNN D;  2JSO A;  4HN7 A;  1NCV A;  1DZ1 A;  1FNW A;  1PZJ D;  4MN3 A;  3DEP A;  4FF2 A;  1Q8I A;  1Q1E A;  5IOC A;  1CFM A;  1F2Y A;  1E2W A;  4IUT A;  3PV0 A;  4A3M B;  2R7Z B;  2IT1 A;  5C3E B;  3D4W A;  2EVB A;  2K5Q A;  2JXM B;  2NTS A;  5KND A;  1JE4 A;  2SNS A;  3PO3 B;  1EIH A;  3MZ5 A;  1SE4 A;  3CU7 A;  1JOK A;  2EYF A;  3VA5 A;  4IFD I;  1V43 A;  5JEA J;  4M1U B;  1IKM A;  2EE1 A;  3S2H B;  4DF7 A;  4F8M A;  4K8I A;  3R2T A;  5KYI A;  4ABN A;  4FF1 A;  2DY8 A;  3W3A A;  4TQU S;  1F2M A;  2B2Y C;  2H1E A;  2B2Y A;  1SYG A;  2K05 A;  5DEH A;  2HDM A;  3J81 L;  3HOY B;  1Q90 A;  2BCO A;  4IUP A;  1BBX C;  3MXG A;  1QB5 D;  1HTL D;  2R93 B;  4R8I A;  2ID0 A;  1D5M C;  5EKK A;  4H7B A;  1JQY D;  1BNZ A;  1EYC A;  2K6A A;  1KNE A;  3VR4 A;  4F88 A;  4J1M A;  2J7Z A;  2B2U A;  3K59 A;  4X3U A;  5CV9 A;  1ESF A;  4XIG S;  5ELC A;  1SNO A;  3A55 A;  4OL7 A;  4G4K A;  1U4R A;  3LWU A;  2XWJ B;  2Q8R E;  1S5F D;  2NN6 I;  4FF3 A;  1II3 A;  5EKL A;  3GQB A;  1OXS C;  3HG9 A;  5C44 B;  2AUK A;  3S9W A;  2F4I A;  4C1N K;  4Z9C B;  2A5H A;  5JVG 3;  3HZX A;  3I4L A;  1I50 B;  1HPC A;  1TWF B;  4O1N A;  5CGK A;  1SE2 A;  2IX1 A;  1HQM C;  3I72 A;  1QG7 A;  1E2V A;  5IGC A;  1MGS A;  4B9W A;  5M3M B;  1OXV A;  2L5T A;  4IUN A;  2NUC A;  4KHV A;  2Q8T A;  2G9H D;  1LTS D;  1A3U A;  3VR2 A;  1PTO B;  1K8M A;  1STA A;  4KJN A;  2LFN A;  2R92 B;  3BYT B;  5C0X H;  4XT1 B;  1ZYR C;  1HCZ A;  3N6R A;  3URY A;  5M5Y B;  2AUJ D;  1WTR A;  3FVQ A;  2HDL A;  2IWH A;  3E5S A;  1L0X B;  1R9T B;  5C0X J;  2MPM A;  2EYM A;  5D3D A;  4K2K A;  1PDQ A;  3HP3 A;  4DU9 A;  5I9P A;  4IUR A;  2L1B A;  1B4O A;  2F0N A;  1WTW A;  3DWA A;  3NHH A;  4QF4 A;  1KDB A;  5EGT A;  1G8Z D;  2DY7 A;  1NSN S;  3P7J A;  4OO1 H;  1SEB D;  2NN6 G;  1SJH D;  4RGN A;  1PMR A;  2NWG A;  4B08 A;  1SDF A;  2AWO A;  1JOQ A;  2ICE C;  4BA1 I;  4A3G B;  4RFB A;  2DNE A;  2PZW A;  4ULL A;  4KJO A;  4C1N I;  3J81 E;  1EWH A;  1JR0 D;  4KD4 A;  1SNQ A;  1UUP A;  4C2M B;  3VYU A;  1TKW B;  5I2X A;  3T4A C;  1WD1 A;  4XYQ A;  2BDN A;  4OIK A;  1GOZ A;  1ILP A;  1O7Z A;  2EZV A;  1SMY C;  1SJE D;  1QJO A;  1PFM A;  2MHV A;  3J80 E;  2F0P A;  1LTT D;  4BY1 B;  2PPB C;  3WDN A;  3SK6 A;  4HCS A;  5FLX E;  3QB3 A;  4RWS C;  1PFN A;  4ZYS A;  2JEA I;  4WOR A;  3K5N A;  3GD7 A;  2CW0 C;  2XRS D;  2DN8 A;  4RA8 A;  1A2T A;  1PRT B;  5K5P A;  3RLF A;  3A8I E;  4C56 C;  1U9R A;  3OHX C;  4WRD A;  1IHZ A;  4FO2 A;  1KAB A;  4BWG B;  3IFT A;  4ZUJ A;  2L11 A;  1O7L A;  1LLR D;  1U4L A;  4DGZ A;  3FKI B;  5CV8 A;  2XRQ D;  1BCP C;  4OGQ C;  1CK1 A;  3NXW A;  1EYD A;  2E2I B;  5JEA G;  2PZT A;  1D2B A;  1EOT A;  5IGB A;  5M9O A;  1AP0 A;  2L55 A;  2WKC A;  5A35 A;  1UNS A;  1TS5 A;  3CRK C;  1X32 A;  3QWN A;  1S5E D;  2WKD A;  1ICW A;  1CZG A;  4ILW A;  2FFK B;  1CHQ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...