1EY6A

Structure of s. nuclease stabilizing mutant t41i
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDIPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 37
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ey6A00
4J1MA 5IODA 4J6HA 3C1FA 4KD3A 2F0GA 5CV5A 2F0MA 2PZWA 4KJNA 2EY5A 1TQOA 3MZ5A 2OF1A 4NMZA 5IGBA 5IGGA 5KEEA 2F0OA 2QDBA 4S3SA 4EQNA 1AEXA 4KJOA 2KHSA 5IGDA 5C5MA 1JORA 3DHQA 2EYHA 3EROA 1EQVA 1U9RA 2F0SA 5CV8A 5NUCA 3DMUA 3QB3A 4PNYA 4N9TA 2F0IA 4HTHA 2WACA 4N9PA 3TP8A 3SK4A 5KYIA 5C4ZA 2F0UA 3SK6A 5E3FA 1EY7A 2NUCA 1RKNA 2EYPA 3LX0A 3VA5A 1EYAA 4RKLA 4F7XA 1JOOA 4R8NA 4ME5A 2RBMA 1F2MA 4EQPA 3D4DA 5M9OA 4H7BA 1EYCA 1KDAA 2F0PA 4ZQ3A 4I65A 5EKLA 1KDCA 3D6CA 3MXPA 3NXWA 3R3OA 4KV6A 3SK5A 4E6IA 2RDFA 3HZXA 1SNOA 2SNSA 2EYFA 3SR1A 4KTAA 3T16A 5JAVA 2F0LA 3TP6A 2F0DA 5CV7A 5IIFA 1JOQA 4NDXA 1EY5A 5ISRA 1EY0A 3V2TA 5J39A 1STYA 4HMJA 4B9XA 3QOJA 1SYFA 4ZUJA 2EY6A 5JOBA 1SYEA 2SOBA 1KABA 2EYOA 4WRDA 2F0QA 4K2LA 5DEHA 3SK8A 2PYKA 4ZUIA 3SHLA 4KD4A 1STHA 4QF4A 1EZ6A 1STBA 1SNMA 3ITPA 4B9WA 4QB4A 3RUZA 3NK9A 3T13A 4DFAA 5E1FA 4K8JA 4K2KA 4NKLA 4KY5A 4EQOA 1KAAA 3C1EA 1STNA 4DF7A 5IGFA 5CV6A 3D8GA 3OMGA 1EZ8A 4IALA 3QOLA 5J22A 3MVVA 2LKVA 2PQEA 4QMGA 3H6MA 5KRUA 5IGEA 2OEOA 3TP7A 4K6DA 1EY9A 4YIJA 4IUNA 1A3TA 2EY1A 1SNCA 3TMEA 2F0EA 4K14A 4K8IA 5C6AA 4KY6A 3ERQA 3TP5A 3EJIA 2F0HA 3PMFA 5J1ZA 2EXZA 2EYLA 1NUCA 1SYDA 4ODGA 4IZ8A 2KQ3A 3MEHA 3NQTA 1II3A 5CV9A 1A2TA 1KDBA 3NHHA 1ENAA 2F3VA 4MIUA 5CR3A 5KYLA 2F0FA 2F0WA 4LAAA 5CGKA 5C3WA 5KGUA 3S9WA 3P75A 5C5LA 4G57A 4NP5A 3OSOA 2M00A 4EVOA 4KHVA 5DAUA 5F2DA 3D4WA 4K5WA 3SXHA 1SNDA 1ENCA 1SYGA 4DU9A 1JOKA 1SYBA 3OMCA 2ENBA 1STGA 3BDCA 5I9OA 4K5VA 5I6YA 5IGCA 4PMBA 2HQEA 4KY7A 3NUCA 5EKKA 1EYDA 4TRDA 3EVQA 1A3VA 2F0KA 1EY6A 2OXPA 3BDLA 4HMIA 4RKBA 4WORA 1IHZA 5C4HA 4K5XA 3OWFA 5I6WA 5EGTA 2F0JA 2EYMA 5I9PA 4PMCA 1EY4A 2PZUA 3NP8A 3U9OA 2PZTA 2F0NA 3MHBA 5C3XA 2EYJA 5HGTA 5IOCA 1TT2A 1A3UA 1F2ZA 2PW7A 2SNMA 4OL7A 2O4XA 2EY2A 4F8MA 5CC4A 4DGZA 5CV4A 4ID6A 1STAA 2F0VA 1SYCA 1TR5A 1SNQA 1F2YA 1NSNS 1SNPA 2PW5A 2RKSA 5K5PA 3E5SA 1A2UA 2F3WA 1EY8A 3HEJA 2F0TA 5HURA 5KIXA 3P1HA
chains in the Genus database with same CATH superfamily
1P16A 4DAYA 5ELBA 3BVMA 1WI5A 3J7ZC 1D2BA 1SMXA 1EEFD 4LF5L 2F0OA 5IT9L 1CA5A 1GUOA 1NNXA 3D4RA 5ELNA 1XPUA 1C7YA 4BXXG 1V9PA 1EY7A 4X66L 1DGSA 3G6EA 3UDXA 3KJPA 1IBKL 4CHTB 4A4IA 5D65A 2WINB 4B3SL 1F9SA 2V4DA 4YWKA 1EYCA 1XMQL 4Y52H 4CJ1B 2UUCQ 5EKLA 1HFGA 3BYYB 4X65L 2D2CC 4KV6A 2SNSA 5IT9c 5M3FH 1QB5D 2D0PA 5ISRA 4UP8A 2UUAL 1F9RA 3ICEA 1SYEA 4JI3Q 5M3MG 5AJ3L 2F4IA 2IW3A 1TS4A 1AZPA 1SNMA 1X3EA 1QOHA 3NK9A 3T13A 1PRTC 4DFAA 1AP0A 1O80A 4GNXC 2KHIA 3K80C 2AQ2B 1O78A 3CQZH 2A68D 4DR1L 1Z9FA 3UI2A 1PTOH 3JAME 1EY9A 2HDLA 2C35B 1ZEQX 5L37A 2IPKD 3UE1A 3CCSA 3J81i 4JBWA 4DPGA 4IPGA 3G71A 1TS2A 5JJZA 4R1JA 1S5BD 2XGTA 3KF6B 2NVXB 3GO5A 3BZCA 1ENAA 5M3MB 1HUNA 2GN5A 2R92G 2H4OA 5DLQE 5G3LF 2KCTA 3D4WA 1N8RC 3K81C 5GQOA 1ENCA 1SYGA 3AMUA 4DV7Q 3OMCA 1ILQA 4C2MB 5IGCA 1LV9A 3S15H 1VQ9A 1EY6A 2NBFA 4IQZA 5C4HA 3NEMA 3C3LA 1UAPA 4LWCA 5IP9H 1R9TB 2QDLA 3EN2A 4BA2I 2V1CC 1LTBD 3H3VH 4ALPA 2R92B 1BUVT 4YCUA 5FJ8G 1F2YA 3NTHA 5T1GA 1VQ6A 3HOUH 2RKSA 1HUMA 1UE5A 1KC8C 5KIXA 4AQYL 1JWUD 3S17B 2O5JC 4R4TA 1X56A 1TWHB 2ZTDA 1CK1A 3G6JB 3NELA 4DV4Q 4JCVE 3CC7A 5C0XG 3DEOA 4DXGA 4YWLA 3JC66 2XRSD 3DHQA 1AH9A 1NBWA 1N33L 1ZKOA 2KA7A 4R4IA 4PNYA 1HZBA 2NTSA 2JEBI 4Y7NH 2KHJA 2HHHL 1M4VA 1ML0D 2EVBA 4N9PA 5FO8B 5I2YA 1WTQA 1DD2A 3MC0B 5BN3A 1LTTD 1B7YB 1RKNA 4RHSA 4J8QA 5GAGC 2AQ3B 4XYOA 3PSIA 4IFDG 1LUZA 3UDGA 4FDBA 4DXFA 4P2CB 1UEBA 1XTCD 3STBC 1EY0A 4KKUA 2RCNA 1CSPA 3SEBA 2ZXOA 4A3CG 2PYKA 5IE8A 1STHA 2DUDA 4A93H 1KAAA 1STNA 4ME3A 3HS0C 2WV6D 4IALA 3CCLA 3CCUA 4JBJA 1JB7A 4C3IH 1GUGA 1N36L 2E2HB 1SNCA 4I7ZC 4KY6A 1KHIA 2NVTB 1VQFA 1E1OA 1YNXA 1Z6HA 3NSWA 3KF8A 4YCWA 5GROA 4HIKA 1STEA 1TS3A 4IUVA 1RHPA 3OSOA 4DUZQ 4KHVA 4XYQA 3VR4A 4DV1Q 1EIYB 2K28A 4R8IA 1JCKB 1KNAA 1VQ7A 2G5DA 2Q8RE 3URYA 1BBUA 2AWNA 2HDMA 1Y8NB 3EA6A 5EKKA 1E24A 3T53B 1CKNB 1A3VA 2QEJC 4IUQA 3K7AB 3OHXC 1C48A 2R7FA 1VCIA 3Q0AA 2AHOB 5I6WA 1YNNC 2I5LX 2XTIA 4DR6Q 3U9OA 5LMUL 2JSOA 1MI2A 1A3UA 4H0LC 3J7AF 3PUWA 2F03A 2JA8H 4B08A 2K52A 3KBXA 5AFWA 4GZYC 1TWCB 2O5IC 2E5LQ 5IODA 1JE5A 3PIOA 2UXBL 1F9QA 4JI8Q 2NN6G 4LK1C 1XPOA 4YCVA 2VQEQ 1I4RA 2JEAI 2ALYB 3M4YA 1O7LA 3NBHA 4XQJA 3KLRA 4OELB 1CQFA 4JOIC 1U9RA 2R7DA 3RLOA 5BN5A 3HOVH 4FXGC 1ONLA 4RCOA 3SK6A 4OIJA 5CMDA 3S16B 2YV5A 3I55A 3GTMH 3VR6A 2IX3A 2AWOA 4KMUC 3NWTA 2RBMA 4EQPA 3EQLC 1CTMA 1Q86C 1KDAA 2MFIA 3SE0A 2IL8A 3RZOH 1NR4A 3SK5A 1N32L 4PG3A 3S1MB 3SR1A 2WB1E 3QG1A 4NW2A 1ZYRD 3DM3A 1Y14B 3QOJA 3WOEA 3H94A 4LFBL 1IBKQ 4GOPC 1BNZA 1HPCA 4A3EH 4LMQD 4PV1C 2JXMB 5EAYA 1EZ6A 2B63H 1VQBA 1AFPA 3A74A 3H0GG 3I4MG 1IBLQ 3PUVA 4X65Q 3R93A 3OWEB 5EPJA 3J81E 1J8IA 1AW7A 1MSGA 2QEXA 2R93H 2IWHA 4K6DA 2LSSA 3AYHB 5HGQA 1Y1WG 3TRZA 1B3AA 2K01A 1TU2B 2B2UA 2WAQG 5AJ3Q 5BN4A 4HAEA 4ODGA 4RHRA 1E1TA 2KQ3A 2K32A 1KDBA 3NHHA 4V0BA 3HOZG 4L6TB 1RJTA 4LAAA 4POGA 3K0XA 3MEFA 1PFMA 3P75A 1HNWQ 1WFQA 4DR1Q 1N34L 2ICEC 3H0GB 1A8VA 3A8IE 2VNUD 3I4MB 4BA1I 4JOIA 3RMHA 2Y0SE 1GHKA 4X62L 3S2HB 1I6HB 1LTLA 1LTAD 4KI0A 1F9PA 1Y1WB 2WAQB 2RDHA 3OWFA 1LTRD 4LW1A 1K8GA 1Q82C 2PZUA 2HQLA 1JB3A 2F0NA 2EYJA 3GTOB 3KOJA 3HOZB 3T1YL 4JI5Q 4A76A 3Q22A 1L1OB 1PH1A 1SROA 1WTHA 2F0TA 4ZCKA 4OWXB 4J6HA 4GOPA 1UUPA 3PO3B 2NB0A 2WFWA 3GP7A 4AYBG 2BH8A 2QDBA 4XIGS 2CWAA 4HEDA 5EPKA 1PFBA 1S5DD 2EYHA 4BY1G 1EOTA 3NENA 2B2VA 1UE7A 1GUWA 2F0UA 2I5MX 3S1NH 3K59A 3AEVA 2JA6G 4AQYQ 5EBCA 4AH6A 2EJMA 3NPPA 1B9MA 1O7ZA 2KOLA 4QIWB 3WWVA 5JVG3 1VQGA 2MPMA 1S4ZA 1KDCA 2KJXA 4JBMA 3DWPA 4A3GH 1N33Q 2A6EC 4AYBB 2VXWA 2HHHQ 1O7IA 3V05A 1I5FA 2AKWB 1VQOA 4HJ9A 4BY1B 1X9NA 3CU7A 2JA9A 4EQ5A 1I50B 1B9NA 2FINB 1HQMC 2JA6B 2MGSA 5LMNQ 3I2ZA 2F3IA 2QKIC 4BBSH 5K36H 1VDZA 5IY0A 2A68C 4IO9A 4YIJA 1G2TA 3TMEA 5IP7H 4A3LH 1T5EA 3ULJA 4P72A 4HJ8A 2EZVA 1YNJC 3MEHA 1VQJA 1HTLD 5JJIA 1A2TA 5JJKA 3ZYYX 1I3QB 1QZHA 2N3SA 1OXVA 1XPRA 1XJVA 1J5EL 5DAUA 3BU2A 1YEZA 3GV6A 4JI4L 3E6ZX 1N36Q 4QQBX 1WCMG 4DV2L 1K83H 4A3FH 1UWVA 2VZAA 2I5HA 3DUZA 2KCMA 2WKDA 4RKBA 5CV9A 2OXPA 1NAPA 3CPFA 5C44G 2B2WA 2HD3A 1Y8OB 2X6LA 2E2IB 3M7NA 4XT1B 2PNHA 1MD2D 3MTSA 1TT2A 4FVMA 5CBAE 4GLXA 1AZQA 3KLSX 1GM5A 1SYCA 5ELCA 4MTNA 1WD0A 4DR4L 5DM63 1WCMB 3BVGA 4QGUA 4DR5Q 4DR7L 3TZDA 4KD3A 2E8GA 1LT4D 3LWEA 1HNZQ 4P75A 2NVYH 5C44B 5LMUQ 3CAMA 1SJHD 2B8FA 5KNCA 5M5WH 4MHEA 4U673 2JA5G 3GTGH 3NBIA 1B4OA 5D3IB 4RKLA 3DWQA 3I3CA 2RCFA 2B3GA 2HCIA 5IWAL 2UXBQ 5KNDA 1UNSA 3L2PA 3VR2A 1SMYC 2LXKA 3F2BA 4GN4B 3R3OA 3GV3A 1OXUA 2Z6KC 3HOYG 5C4XG 2VW9A 4MN3A 4LF4L 5FLMG 1PH2A 2F0DA 1IL8A 1H9KA 2F4VL 5C3EH 2DN8A 2C5CA 2QCPX 3W5OA 3R2TA 5GADC 1G91A 1U5KA 2HT1A 2NZHA 2JA5B 4QF4A 4DAPA 4F87A 3CXCA 2K75A 4NKLA 3CF5A 3HOWH 5T1IA 3OW7A 3A5ZB 5M5XB 1N32Q 5J22A 3QOLA 4NXNQ 4X3SA 3HOYB 5C4XB 3PF4A 4FP5D 4K14A 2MHVA 3TP5A 1B53A 3TEHB 2A73B 1TWFB 4LFBQ 4JI1L 3PMFA 1TWAB 1DONA 2NWGA 4LFCQ 1TIID 3CHBD 3VYRA 2F3VA 1OXXK 1CKNA 1XMOL 1BCPD 4HJ7A 4BY7H 1TWGB 1JOKA 4MZ9A 2PO4A 3PO2H 3DWAA 4RAUC 4EX5A 5IYCH 1A62A 4DR2L 2OWOA 5ELEA 4CJ0B 1LT3D 5C4ZA 5FOBB 1IHZA 1EQTA 4IN3A 5EGTA 1SJED 1E7ZA 3J80c 5I9PA 4DK3C 4A3JH 4DNRB 1EL0A 4JI0L 1GVPA 2SNMA 3F1ZA 2R7ZG 1XNQL 2E2DC 5EKIA 5C0XI 4X62Q 3H15A 1A2UA 1PDQA 3I7FA 2NVQB 4YHHL 4L5TA 4A3IG 1LM0A 2EY5A 1PYBA 5IGBA 4H02A 3ERSX 2A74C 2KHSA 1PTOD 1FR3A 4NXMQ 5JEAH 2VS1A 4A3BH 3S24A 5GAHC 3T1YQ 4DK1A 4IFDI 1GUSA 1CSQA 3RNUA 1DOKA 1Q81C 2CW0C 3BDOA 3QR8A 2R7ZB 1L1OC 4PZ6A 2N78A 3PUXA 4O1NA 4H7BA 1IW7D 4I65A 3S14H 3D6CA 3PQIA 4A3IB 2EYFA 5JAVA 1A6XA 4L8JA 3CP0A 5ELOA 2N88A 1ASYA 4FYDA 5M3FG 4JK1C 3R8BA 1YBYA 3K58A 1V1PB 2AUJD 2I0QA 1BCPB 4HSPA 2G9HD 3QIAA 4EGVA 1EZ8A 2PQEA 1Q8KA 3TP7A 4DAVA 3I56A 3IRBA 5BR8L 4WFN3 1DJRD 2F0HA 4HR7B 4JBKA 2EYLA 5M5YH 5FLXL 2ZT9C 4RH6A 5M3FB 4A3MH 1D6EC 3T4AC 1KTKA 1K8OA 2OCEA 3RN5A 5JEAJ 1FL0A 1QUQB 3S1QH 1STGA 3EFXD 1E2WA 2ZJQA 1YI2A 5CGKA 2F0KA 1L1OA 4KHPQ 4KLKA 4XXEA 3CQZB 1PXUA 3BS1A 5FLXc 4OEMB 4OO1H 1PTOB 3ULLA 5HGTA 1U0LA 1JR0D 1X3PA 4JI4Q 2PI2A 3OIPA 2CHBD 5JPNC 3DEPA 4DV2Q 2NN6I 5IP9G 1SNPA 1DYQA 3RZDH 1RF2D 2E2JB 4X64L 4UP7A 3EIVA 3FPPA 1L0YB 2F0GA 1SAPA 2K4KA 2PZWA 2Y0SG 4KKTA 3HOUG 2OF1A 1VQMA 4RA8A 1WTPA 1I94L 1JORA 5FK9C 2BH2A 3A7AB 2LMCB 1JJGA 2DJFC 3S15B 1YHBA 1EYGA 4LF8L 4IUTA 5E3FA 2B2YC 4CDDC 2VQFL 1KL9A 4DV3L 3OOCA 1F2MA 4Q5VA 1R9TH 1CUKA 2Y0SB 2FMMA 3HOUB 3C2PA 1I4GA 2DY8A 1EY5A 1GO3E 2EY6A 5JOBA 4OWTB 1TVXA 4QUFA 4B9WA 4ZLTF 5IWAQ 3K0YA 4K2KA 4EQOA 5I4DA 4K6LA 4Y7NB 2ZTCA 4RWSC 1DXMA 3K5MA 2PMZB 4LF4Q 4DK6C 4A93G 2F4VQ 4XT3B 4JYAL 3ERQA 1YHQA 1CKMA 2D9UA 4C3IG 4IZ8A 3A7LA 3F2UA 1RCVD 2JJQA 3P7JA 1FYCA 3E9HA 3BVZA 4P74A 3MFGA 4J15A 4OXPA 4CDFC 2RA4A 4CJ2C 1FJGL 2EPBA 4K5WA 1M1KC 3U9SA 2QW7A 3AB9A 4JI1Q 4A93B 2B2YA 3EVQA 1Z47A 3N6RA 2UUBL 3L9AX 2DNEA 4UY8C 1XMOQ 4C3IB 1OTCA 1LYLA 3M3YH 4I7AA 3CC4A 3U4ZA 4G4KA 4OL7A 1U4PA 1SBBB 2EY2A 2E2HH 4FF2A 1WOCA 4DR2Q 1HCZA 1EY8A 2L9HA 3HFZB 4OHJA 1Y1VG 1I4HA 4EQNA 1S5ED 2CQOA 4JI0Q 3PIP3 1NCVA 3G4SA 5CV8A 2MQHA 5CBEE 1VQNA 1BDOA 1XNQQ 4HTHA 3GTKH 1PZID 3TP8A 3SK4A 2K50A 4CBVA 3F2CA 1E2ZA 2QGQA 1RTOA 2B2UC 1JOOA 4R8NA 3HOVG 4YHHQ 5JJLA 3LWUA 1WYDA 3K7UC 2UU9L 1XX8A 1JWSD 4OX9L 2OQKA 5J3BA 3C46A 4UP9A 3GTLH 3J7YW 1Y1VB 3E0JA 4LFAL 1Y8PB 1VQLA 4LF9L 1ZXTA 1Z7TA 1KAWA 4K2LA 1H9MA 4K0KL 3DLLA 2YU9H 4GLVB 3HOVB 1SDFA 4A3EG 1V8QA 4R4CA 1GUTA 4LF5Q 3GTMB 4JI6L 1GKHA 2B63G 3I4NH 2PQAA 2K5WA 3IL8A 3KJOA 4UHVA 1SLJA 2EY1A 4C1NI 3K5NA 4K8IA 4LNQA 1YITA 2A6HD 4C1NK 3GTQH 1MIUA 1NUCA 3CRLC 5LL6S 2VY3A 3RZOB 2R93G 1ILPA 4X66Q 3RR5A 1HR0W 1PVOA 2IX1A 4B3SQ 1EIFA 2HUGA 1XMQQ 4DV0L 3MA2B 2E75C 3D31A 1WTRA 2B2VC 2H5XA 4A3EB 1B44D 4DNTB 4IUPA 1MKHA 1GOZA 5FKAC 5I6YA 2B63B 4PMBA 3I8ZA 4ULLA 2KENA 1UE6A 3D0FA 1KIXA 2UUAQ 2B29A 3NWSA 4RGTA 1K8AC 4A3DH 1K0RA 2R93B 5C3XA 3FKIH 4FF3A 1LTID 2L12A 2N55A 1YIJA 4ID6A 2F0VA 1AN8A 1B1ZA 1SEBD 5K5PA 5EBDA 4HSVA 3L0OA 3G7LA 3L3OC 4TQUS 2RSNA 4NMZA 4L5QA 1FNVA 4KJOA 1O7YA 1OXSC 3QB3A 3PGZA 4DR3L 4ZKBB 5IYDH 2L4NA 1PRTD 4X64Q 1B70B 4A75A 4ME5A 2K7VA 2K5QA 4P73A 5M9OA 1IW7C 3EBEA 3PF5A 1I94Q 1BBXC 1L2FA 4RGMA 4E6IA 1V1PA 1CFMA 2Q8IB 1VQ5A 5E4XA 4R9WA 1HRJA 2GA4B 4N8X1 4A3GG 1KABA 2EYOA 2XIWA 1I6VC 2YTVA 4DV3Q 3PO3H 3W2DA 4RFBA 3GTPH 1DOLA 2Q2TA 4DV5L 2ZJPA 1TS5A 3KBGA 2B2WC 1BCPF 1D8LA 3O13A 3VR3A 4DF7A 1CQVA 1JJ2A 5CV6A 1KD1C 3S1NB 2LKVA 1X55A 4QMGA 2AUKA 1HNXL 1EEID 2KECA 2R6GA 4JC0A 2ZM6L 4A3KH 1HXYD 2MJ8A 4BBSG 1D1IA 1SSOA 1YZ6A 3T56B 1VQAA 4C3JH 1QUQA 3M4PA 4IPCA 4L63B 5I2XA 2EIFA 4A3GB 5IP7G 4A3LG 1Q3LA 2F0FA 4JI2L 2ES2A 2KBNA 3CCQA 1PYSB 4IPDA 4EVOA 2KUMA 1UE1A 3OIQA 4DU9A 3KF6A 1KNEA 2NZOA 4JYAQ 4GKKL 1ET6A 2XVSA 1K9MC 3AQQA 4CKCA 4PMWA 3BDLA 2FJ2A 1A15A 2MO0A 1Q90A 3GQBA 4HMIA 1VQEA 2Q2IA 1WJJA 4HJAA 4BBSB 2A69D 2NYZD 3FVQA 1S40A 3MXGA 5EQ0A 3A8JE 2JA7H 2JN4A 1B50A 2Z4IA 1PTOF 3S2DB 1F2ZA 2ATWA 3TN2A 1KLUD 2RF4A 1JICA 1STAA 4B3ML 2K33A 1PRTB 1X3GA 1Q7YC 4GNXB 2PW5A 1BVSA 3HEJA 1QZGA 1ET9A 3GTJB 2L1BA 4C3HH 2UUBQ 2A8VA 4TSSA 1OXTA 1D5XC 2P5ZX 2FHTA 1XXGA 3VA7A 1SXTA 1K83B 4GS3A 2D5DA 1G6PA 4LUVA 3QJYA 1DOMA 3SVMA 2FMCA 1EQRA 3LX0A 4QCLA 4CGYB 4N8FA 2ICIA 2H1EA 3OTOL 2CVRA 4ZQ3A 2OQ0A 4Z9CB 3W1GA 2DY7A 1C4QA 1E2VA 1W2BA 4GLAC 2RDFA 3HZXA 1K3RA 1CZGA 3TREA 3AU7A 2N8NA 2SOBA 3SK8A 4WRDA 4OWWB 2F0QA 4O2DA 4ZUIA 3M4OH 1AE3A 3TQYA 3TS0A 2UU9Q 5C3EG 4OX9Q 2VB2X 1E0BA 5M5WB 5IGFA 3MFYA 3PIO3 3GTGB 4LFAQ 3HKZE 3H6MA 1CHPD 4LF9Q 3HOWG 3S1RH 1MJEA 2WP8J 3AFQA 2IY5B 1KXLA 5A2QL 4K0KQ 2VUMH 4KKSA 3TS2A 1VQDA 2PNRC 4MIUA 4G7HC 2F0WA 2G9DA 1FNWA 3KLWA 3CCJA 3OPOA 4DNIA 1NTGA 5C3EB 2K03A 1H9SB 4H44C 4JI6Q 3MXNB 1LABA 3NE5B 3SXHA 2I07B 4MNOA 5DNFA 5EJWA 3VYSA 2R3ZA 4BY7G 4K5VA 1H9JA 1EOVA 2LS01 3HOWB 3L7ZC 1RDPD 1S5FD 3CCMA 2R61A 3CMAA 2KCNA 1LO5D 3PO2G 3WOFA 2N49A 3K57A 2EYMA 5IYCG 1YJWA 3J80L 3FHWA 3H3VI 3BJUA 1PLFA 1N9WA 4QUCA 4DV0Q 2D0OA 1HH2P 3HG9A 5E4WC 1SFOH 4A3JG 4IOCA 1PH9A 4IJHA 5CYUA 1PH6A 3V96A 2NZ1D 4O0AA 4BY7B 1C8CA 1ICWA 4XDXA 1PZJD 1AEXA 1G8ZD 5C4JH 3PO2B 3K5LA 1EU3A 1TXYA 1G2SA 2IT1A 4N9TA 2YYZA 3GDEA 2K6AA 3QO2A 3VYTA 2EQSA 3M9BA 1B3QA 1N34Q 3HP3A 3CCVA 1PH4A 5IT9E 3U50C 4A3BG 1DZ1A 4A3JB 1X65A 4DV1L 1HFNA 3K8AA 3HOXH 2RDGA 4KN4C 4BBRH 1W6KA 1KQSA 1SNOA 3T16A 2MO1A 1IYJB 1EWHA 1JOQA 4NDXA 2EE1A 4UPAA 3VR5A 1SYFA 4LUZA 4ABNA 2HIXA 4FF1A 1QJOA 4B3RL 5E1FA 4A3BB 3FEWX 4G7OC 3OMGA 5FLXE 4AYBE 3CKIB 3CD6A 3ND8A 2F0EA 2F52A 2Q2HA 1VQHA 2K5DA 2A6HC 1C0AA 5J1ZA 2VQEL 3S14B 3NQTA 1ZYRC 2XWJB 2XNAC 2KVMA 3NTKA 5IYBH 4DV5Q 1VQ4A 2KCCA 5C3WA 2KEEA 3K6OA 3S9WA 4NB3A 4G57A 3KDFB 5C5LA 1LLRD 2XN9C 2ZM6Q 3I72A 4ZK9B 2Z0SA 4A3MG 1SR3A 2CWPA 1X3QA 5I9OA 4HCSA 2SDFA 4R4OA 2BE5D 3GD7A 4BS9A 1F77A 4LF7L 3OYYA 1PYWD 4DN4M 1BF4A 4FF4A 2WB1G 4JI2Q 1NMGA 4ZRZA 3NP8A 2WIIB 4GOPB 1BO0A 2YTYA 2K5HA 2O4XA 4JI7L 1NY4A 2RHSB 1VF5C 1FVIA 4RMFA 4TVAB 2BA0A 1FGBD 4GKKQ 4OO1G 5M5YB 2JQOA 3E5SA 1DCZA 3X3MA 4A3MB 3CMEA 1IBLL 2A6ED 1PMRA 4IJLA 1EIHA 5KEEA 4DV6L 4BXXH 4FXKC 2B2TA 5C5MA 1KRSA 2RVLA 1ASZA 1LTSD 3UE0A 3S1QB 3EROA 2F0SA 2WB1B 4B3MQ 1QCBD 2Z8LA 4CKBA 3Q6SA 1J5EQ 1G291 4LUOA 1VF7A 1C9OA 1PH8A 1HR0L 1HNWL 2LFNA 1FNUA 4IUUA 3CCEA 5E7NA 3MXPA 2NVXH 3P20A 1QWYA 3PCOB 5M3MH 3RZDB 3KYHC 1YNJD 5J39A 3AFPA 4HMJA 2E2JH 5DEHA 2ASBA 2SEBD 4DA2A 2BDOA 4RG1A 2ZXRA 4C2MH 1ICFB 1K8MA 3CPWA 3OTOQ 4DR4Q 1SN8A 4CKEA 4DR7Q 1JJCB 4DAMA 4JV5L 1V43A 5EPLA 5FO9B 4JI5L 3NTIA 3MVVA 3M85A 4ZKCB 3J7AV 2YTXA 2XSCA 3IAYA 4PZ8A 2RQXA 1IBML 1WD1A 3EJIA 2UXDL 2R92H 3F8TA 1RIPA 3UDFA 4DK0A 3RLFA 1WTXA 5KYLA 5CR3A 2TMPA 1S5CD 1WVLA 1FD7D 1U4RA 3JAML 3S17H 1EFID 1TWHH 2EOTA 2Z9HA 5ELFA 5F2DA 2CCZA 1SE8A 2UXCL 3M7GA 3RD4A 1I4PA 4XTCS 4F88A 2CH4W 1D5MC 4TRDA 4WORA 4GNXA 4GN5A 1X32A 1D1KA 5FJ8H 2A69C 1CHQD 2QA4A 2EXDA 2F1MA 2HCCA 2AMCB 1SE2A 3JAMc 3Q8DA 1D7QA 2D62A 2VB3X 4DGZA 1GD7A 4B3TL 2B8GA 5JVH3 1PRTF 1NSNS 1QILA 5C0XH 1SMYD 2F3WA 2I46A 3ZJYC 1F2LA 5LMNL 3P1HA 3RLNA 3C1FA 1X6OA 5CV5A 3N52A 1NE3A 1TQOA 1E22A 2DJGC 1D5ZC 1W3SA 4PQXA 3CC2A 2QF7A 1EQVA 2A19A 2OT2A 5NUCA 2NTTA 1LTGD 3IFTA 2F0IA 1RODA 3U4VA 1HQRD 2WACA 5KYIA 1MGSA 2K5NA 2L55A 4ZAIA 4IFDH 1T9HA 2CKZB 4HJ5A 5LHY1 1JC7A 1BXTA 2AQ1B 1TY2A 2MP1A 1M90C 3M3YB 2NVTH 1EU4A 1HHVA 3DXJC 1LT5D 3I4LA 2JA8G 4A3CH 2Z1CA 2F0LA 3TP6A 1RTNA 4H13C 3LNNA 4YWMA 1STYA 4CDEC 1HZCA 2IHEA 1EQQA 1HJPA 1PZKD 2X6GA 1PFSA 4KD4A 1QVGA 3RUZA 5KNBA 3D3RA 1WTWA 1XNRL 5LL6X 1A63A 4QJFA 1ENFA 2J0TD 3K7AH 3GTKB 3VDYA 2C9OA 5FO7B 3D6WA 2Z4HA 4L5SA 3A55A 2BA1A 4DR5L 2JA8B 5C6AA 5TSSA 1H9SA 2FXQA 3MXNA 2A5HA 5C0XJ 2EXZA 1SYDA 1HNZL 1PH7A 3I4NG 3ND9A 3GTLB 1TWCH 5HY6A 4B3RQ 1QNUA 2IHFA 3SDZA 1R4PB 1Y1VH 5KGUA 2J7ZA 2Q8TA 2RSOA 3MAQA 3MWYW 3A56A 2Q2UA 3J81j 2WKCA 1SE3A 1VQPA 3ONAB 4YY3L 4DUYL 4G7ZC 4OONA 2YU9B 4IFDJ 1QVFA 3I4OA 1H95A 3NUCA 3HKZG 1NR2A 3S16H 3PV0A 1VQ8A 1VQIA 3J80i 2JE6I 4GKJL 2F0JA 3I4NB 1MHWC 2CW0D 2PZTA 1KRTA 5IOCA 1K0SA 2JYOA 5G3LD 2BOSA 1SRUA 2ZXPA 4WJ3M 3GTQB 4A3DG 1IKLA 3T1HL 1R4QB 1TR5A 2GVBA 1BCPC 2NN6H 1VQKA 3S1MH 1DM0B 3FKIG 5HURA 5COYA 4RGNA 4AIMA 2M9VA 1CZWA 1L0WA 4LF7Q 5BR8Q 4NXNL 2K5VA 3G48A 2L5TA 3HKZB 5IGGA 1LT6D 5IGDA 1QE6A 2OTJA 4ILWA 1SE4A 4QL5A 3DMUA 4M8AA 4JI7Q 2CQAA 3FMCA 4PZ7A 4LFCL 3KUPA 4DAYB 4LF6L 2DNCA 1B2TA 3VA5A 4A3DB 2CFMA 3BG3A 3D4DA 3PUYA 3FKIB 5IYDG 1JWMD 2MNAA 4M1UB 2F0PA 4DV6Q 1JE4A 2K1BA 3A0JA 1AE2A 5GAEC 5CV7A 5IIFA 1Q12A 1EWCA 3FPUB 4XQQA 1PTOC 3H0GH 3I4MH 1VS0A 2X69A 1STBA 3S2HH 3ITPA 3FP9A 1I6HH 4LJZC 1HR0Q 3X3NA 3I90A 1I4XA 4K8JA 4KY5A 1JT8A 4GN3B 3C1EA 1Y1WH 4X3UA 3FDTA 3PO3G 5KRUA 1VMPA 5IGEA 2KEDA 1YHAA 1A3TA 3VYUA 3TZUA 3KDFA 3GTOH 4O42A 3HOZH 1X54A 1FGUA 1HTPA 2L11A 3R2IA 1YJ9A 3H91A 4LF8Q 4FO2A 1BR9A 3J81L 1OO9B 4A3KG 4NXML 2VQFQ 4JV5Q 2HIVA 4C3JG 2M00A 2PMZE 5LMNW 2ID0A 1IXRA 3CW2C 3H3VC 1IYUA 1IBMQ 5DM73 5CORA 3BDCA 2UXDQ 3GTPB 1M8AA 1EYDA 3I73A 1IL2A 2BE5C 1IYVA 3TDQA 2K14A 4IURA 2Z6BA 4K5XA 5K36G 4L5RC 1MBYA 1HZAA 1BKBA 3J81c 1EY4A 4A3KB 1JQYD 5D3DA 4OGQC 2UXCQ 5H1SE 1J9OA 1ESFA 2DGYA 2K05A 3W1BA 2JK8A 4C3JB 2JA7G 1BQQT 5JPMC 2J4XA 4IPHA 3FRPB 4BY1H 4J1MA 3HGBA 1U4MA 4KJNA 4X3KA 3MZ5A 2PCFB 1J6QA 4S3SA 3F2DA 2UUCL 4RGOS 1QG7A 2EJFC 2JP1A 2XWBB 1CT1D 1I50H 3M4QA 4XQNA 4C3HG 2JA6H 1RD9D 3IFDA 1G6ZA 2EJGC 4A3FG 4UAIA 4B3TQ 1UEAB 2EDGA 3H09A 1CA6A 1YVCA 2QILA 1FJGQ 4JI3L 4F7XA 4KN7C 2JA7B 3E3XA 1JMCA 4POFA 1GHJA 3NXWA 2B39A 3S2DH 3E0EA 3STBD 2MUYA 3Q23A 3J7A5 1I3QH 1EIGA 4BWGB 4Q0FA 4KK7A 4UDUC 3V2TA 1GJXA 3TBIB 4C3HB 4KHPL 4ZUJA 1Q1EA 2L0CA 4A3FB 3GTJH 1LACA 1CKOA 4DKAC 2LY7A 2TSSA 5A2QE 1QVCA 3T51B 3D8GA 4HCEA 2IX0A 4FNFA 2E2IH 1HZ9A 1BOSA 3DM1A 4DV7L 3IKJA 2O2LD 3JAMi 1II3A 4WJWA 4APVA 4QY7A 1WCMH 1XNRQ 4NPSA 3ULPA 4HN7A 4HIDA 1U4LA 3U58A 1PHJA 2NVYB 4IOAA 4NP5A 2VUMG 3MXUA 1TKWB 2BCOA 5D14A 5C44H 2BDNA 3M4OB 1GUNA 3BZDB 3KK7A 2ENBA 3J80E 1PA6A 3BYTB 4KY7A 3KF8B 1K73C 3K5OA 1YNND 1K28A 3A5UA 4DV4L 4OO1I 3A54A 1EFWA 1VMCA 4X6AH 1RL2A 4ZYSA 2E76C 1IKMA 3S1RB 5CC4A 3UDIA 4F8MA 3QWNA 2L15A 1CM9A 3ER0A 1SNQA 4YY3Q 4DUYQ 2VUMB 1V1QA 1CI3M 1VQCA 1X3FA 2GVAA 2LXJA 5ELDA 2F0MA 4GKJQ 2JA5H 1EWIA 2PPBC 1K3BC 1H9RA 1EUJA 5M5XH 1W6JA 3NQIA 1NMFA 2E74C 3T1HQ 3WDNA 5A35A 2NUCA 1T5XD 2FFKB 2EYPA 1EYAA 1S3OA 2XRQD 4JVZA 5C4XH 2ZTEA 3HOYH 1E3PA 3NBHB 3Q24A 1TWFH 1Q1BA 5FLMH 1Q8IA 1WTVA 1TWAH 1S72A 2WAQE 1SFOB 4KTAA 2OTLA 3CRKC 3HOXG 1TY0A 4LF6Q 4B9XA 4BBRG 1TWGH 3PUZA 2RHQB 3A8KE 3SHLA 2PQAB 1ESRA 4MTKA 4QB4A 2ZJRA 5C4JB 1Y69U 4KHZA 5JEAG 1G51A 3RN2A 1YJNA 3W3AA 1XTDA 1KLGD 4U68A 4DUZL 2PI2E 1P8LA 2OEOA 3HKSA 1PH5A 3E9IA 4IUNA 1Q46A 2K04A 1L0XB 1XWEA 3BZKA 4DR3Q 1PFNA 3HOXB 4OIKA 3CCRA 3TSSA 1B8AA 3PIPA 1MJCA 4BBRB 1HA6A 4X3TA 1QNKA 2Z6KA 3B6YA 1NJIC 2NVQH 1BBWA 1HA5A 3OW2A 4DR6L 4C56C 3I70A 4QIWE 2B2TC 1A0IA 4P71A 4CDCC 5IYBG 1SNDA 3LGJA 1SYBA 3KFUA 4RCNA 3I91A 2HQEA 2E5LL 4JG2A 1WTOA 4HIMA 4FXDA 2R7ZH 1MSHA 4JW0A 4JI8L 4JPBW 1PV4A 4PMCA 3MHBA 2IJ0A 2CH4A 4WJ4A 2PW7A 3SGIA 2VL6A 5CV4A 4HIOA 4A3IH 2A1AA 1I4QA 4TKOB 3KLSA 1PH3A 2M2LA 3HRZC 1IZ6A 4R4QA 4V190 1GXDC 1XYIA 1HNXQ 1V1OA
chains in the Genus database with same CATH topology
4DAYA 5ELBA 3BVMA 1D2BA 1EEFD 2F0OA 5IT9L 1CA5A 1GUOA 3D4RA 1EY7A 4CHTB 5D65A 2WINB 1F9SA 2V4DA 1EYCA 4CJ1B 5EKLA 1HFGA 3BYYB 2D2CC 4KV6A 2SNSA 1QB5D 5ISRA 1F9RA 1SYEA 2F4IA 2IW3A 1TS4A 1AZPA 1SNMA 1QOHA 3NK9A 3T13A 1PRTC 4DFAA 1AP0A 1O80A 2AQ2B 1O78A 2A68D 3UI2A 1PTOH 3JAME 1EY9A 2HDLA 1ZEQX 2IPKD 4JBWA 1TS2A 5JJZA 1S5BD 2NVXB 3GO5A 1ENAA 5M3MB 1HUNA 2H4OA 5G3LF 3D4WA 1ENCA 1SYGA 3AMUA 3OMCA 1ILQA 4C2MB 5IGCA 1LV9A 1EY6A 2NBFA 4IQZA 5C4HA 3C3LA 1UAPA 1R9TB 4BA2I 1LTBD 2R92B 1BUVT 1F2YA 3NTHA 5T1GA 2RKSA 1HUMA 5KIXA 1JWUD 3S17B 2O5JC 1TWHB 3G6JB 1CK1A 5C0XG 3DEOA 4DXGA 2XRSD 3DHQA 1ZKOA 2KA7A 4PNYA 2NTSA 2JEBI 1M4VA 1ML0D 2EVBA 4N9PA 5FO8B 5I2YA 1WTQA 1DD2A 3MC0B 5BN3A 1LTTD 1RKNA 4RHSA 4J8QA 2AQ3B 4XYOA 4IFDG 4DXFA 4P2CB 1XTCD 1EY0A 4KKUA 3SEBA 2ZXOA 2PYKA 1STHA 1KAAA 1STNA 3HS0C 2WV6D 4IALA 1GUGA 2E2HB 1SNCA 4I7ZC 4KY6A 2NVTB 1Z6HA 3NSWA 3KF8A 1STEA 1TS3A 4IUVA 1RHPA 3OSOA 4KHVA 4XYQA 3VR4A 2K28A 4R8IA 1JCKB 1KNAA 3URYA 2Q8RE 2AWNA 2HDMA 1Y8NB 3EA6A 5EKKA 3T53B 1A3VA 2QEJC 4IUQA 3K7AB 3OHXC 1C48A 1VCIA 3Q0AA 5I6WA 1YNNC 3U9OA 2JSOA 1MI2A 1A3UA 4H0LC 3J7AF 3PUWA 2F03A 4B08A 3KBXA 5AFWA 4GZYC 1TWCB 2O5IC 5IODA 1F9QA 2NN6G 4LK1C 1I4RA 2JEAI 3M4YA 1O7LA 3NBHA 4XQJA 3KLRA 1CQFA 1U9RA 5BN5A 4FXGC 1ONLA 4RCOA 3SK6A 4OIJA 5CMDA 3S16B 3VR6A 2IX3A 2AWOA 4KMUC 3NWTA 2RBMA 4EQPA 3EQLC 1CTMA 1KDAA 3SE0A 2IL8A 1NR4A 3SK5A 3S1MB 3SR1A 3QG1A 4NW2A 1ZYRD 3QOJA 3WOEA 3H94A 1BNZA 1HPCA 4LMQD 4PV1C 2JXMB 1EZ6A 1AFPA 3PUVA 3R93A 3OWEB 5EPJA 3J81E 1J8IA 1AW7A 1MSGA 2IWHA 4K6DA 1B3AA 2K01A 1TU2B 2B2UA 5BN4A 4HAEA 4ODGA 4RHRA 2KQ3A 2K32A 1KDBA 3NHHA 4V0BA 4L6TB 1RJTA 4LAAA 1PFMA 3P75A 2ICEC 3H0GB 3A8IE 2VNUD 3I4MB 4BA1I 3RMHA 1GHKA 3S2HB 1I6HB 1LTAD 4KI0A 1F9PA 1Y1WB 2WAQB 2RDHA 3OWFA 1LTRD 2PZUA 1JB3A 2F0NA 2EYJA 3GTOB 3HOZB 3Q22A 2F0TA 4J6HA 1UUPA 3PO3B 2NB0A 3GP7A 2QDBA 4XIGS 4HEDA 5EPKA 1PFBA 1S5DD 2EYHA 1EOTA 2B2VA 1GUWA 2F0UA 3K59A 5EBCA 2EJMA 3NPPA 1B9MA 1O7ZA 2KOLA 4QIWB 5JVG3 2MPMA 1S4ZA 1KDCA 2KJXA 3DWPA 2A6EC 4AYBB 2VXWA 3V05A 4BY1B 3CU7A 1I50B 1B9NA 2FINB 1HQMC 2JA6B 2MGSA 2QKIC 5K36H 1VDZA 2A68C 4YIJA 1G2TA 3TMEA 1T5EA 2EZVA 1YNJC 3MEHA 1HTLD 1A2TA 3ZYYX 1I3QB 1OXVA 5DAUA 3GV6A 3E6ZX 3DUZA 2WKDA 4RKBA 5CV9A 2OXPA 1NAPA 2B2WA 1Y8OB 2X6LA 2E2IB 3M7NA 4XT1B 1MD2D 3MTSA 1TT2A 4FVMA 5CBAE 1AZQA 3KLSX 1SYCA 5ELCA 1WD0A 5DM63 1WCMB 3BVGA 3TZDA 4KD3A 1LT4D 3LWEA 5C44B 1SJHD 2B8FA 5KNCA 4MHEA 4U673 3NBIA 1B4OA 5D3IB 4RKLA 3DWQA 3I3CA 2HCIA 5KNDA 1UNSA 3VR2A 1SMYC 3R3OA 3GV3A 1OXUA 4MN3A 2F0DA 1IL8A 1H9KA 2DN8A 2C5CA 2QCPX 3R2TA 1G91A 2JA5B 4QF4A 4DAPA 4F87A 4NKLA 5T1IA 3OW7A 5M5XB 5J22A 3QOLA 4X3SA 3HOYB 5C4XB 4FP5D 4K14A 2MHVA 3TP5A 1B53A 2A73B 1TWFB 3PMFA 1TWAB 1DONA 2NWGA 1TIID 3CHBD 3VYRA 2F3VA 1OXXK 1BCPD 1TWGB 1JOKA 2PO4A 3DWAA 4RAUC 5ELEA 4CJ0B 1LT3D 5C4ZA 5FOBB 1IHZA 1EQTA 4IN3A 5EGTA 1SJED 5I9PA 4DNRB 1EL0A 2SNMA 2E2DC 5EKIA 5C0XI 1A2UA 1PDQA 2NVQB 2EY5A 5IGBA 2A74C 2KHSA 1PTOD 1FR3A 5JEAH 4DK1A 4IFDI 1GUSA 1DOKA 2CW0C 3BDOA 2R7ZB 3PUXA 4O1NA 4H7BA 1IW7D 4I65A 3D6CA 4A3IB 2EYFA 5JAVA 1A6XA 4L8JA 2N88A 4FYDA 4JK1C 3R8BA 3K58A 1V1PB 2AUJD 1BCPB 4HSPA 2G9HD 3QIAA 4EGVA 1EZ8A 2PQEA 3TP7A 4DAVA 4WFN3 1DJRD 2F0HA 4HR7B 2EYLA 5FLXL 2ZT9C 4RH6A 5M3FB 1D6EC 3T4AC 1KTKA 1K8OA 5JEAJ 1STGA 3EFXD 1E2WA 5CGKA 2F0KA 4XXEA 3CQZB 1PXUA 3BS1A 4OO1H 1PTOB 5HGTA 1JR0D 1X3PA 3OIPA 2CHBD 5JPNC 3DEPA 2NN6I 1SNPA 1DYQA 1RF2D 2E2JB 3FPPA 1L0YB 2F0GA 1SAPA 2PZWA 4KKTA 2OF1A 4RA8A 1WTPA 1JORA 5FK9C 3A7AB 2LMCB 3S15B 4IUTA 5E3FA 2B2YC 3OOCA 1F2MA 4Q5VA 2Y0SB 2FMMA 3HOUB 3C2PA 1I4GA 2DY8A 1EY5A 2EY6A 5JOBA 1TVXA 4QUFA 4B9WA 4ZLTF 3K0YA 4K2KA 4EQOA 5I4DA 4K6LA 4Y7NB 4RWSC 1DXMA 3K5MA 2PMZB 4XT3B 3ERQA 2D9UA 4C3IG 4IZ8A 3A7LA 3F2UA 1RCVD 3P7JA 1FYCA 3BVZA 3MFGA 2RA4A 4CJ2C 2EPBA 4K5WA 3U9SA 3AB9A 4A93B 2B2YA 3EVQA 1Z47A 3N6RA 3L9AX 2DNEA 4C3IB 4G4KA 4OL7A 1U4PA 1SBBB 2EY2A 4FF2A 1HCZA 1EY8A 2L9HA 4OHJA 1I4HA 4EQNA 1S5ED 3PIP3 1NCVA 5CV8A 5CBEE 1BDOA 4HTHA 1PZID 3TP8A 3SK4A 4CBVA 1E2ZA 1RTOA 2B2UC 1JOOA 4R8NA 3LWUA 1XX8A 1JWSD 3C46A 3J7YW 1Y1VB 3E0JA 1Y8PB 1ZXTA 1Z7TA 4K2LA 1H9MA 3HOVB 1SDFA 1V8QA 1GUTA 3GTMB 2K5WA 3IL8A 2EY1A 4C1NI 3K5NA 4K8IA 2A6HD 4C1NK 1NUCA 3CRLC 5LL6S 3RZOB 1ILPA 2IX1A 2HUGA 1WTRA 3MA2B 2E75C 3D31A 2B2VC 4A3EB 1B44D 4DNTB 4IUPA 1GOZA 5FKAC 5I6YA 2B63B 4PMBA 3I8ZA 4ULLA 3NWSA 4RGTA 2R93B 5C3XA 4FF3A 1LTID 2L12A 2N55A 4ID6A 2F0VA 1AN8A 1B1ZA 1SEBD 5K5PA 5EBDA 4HSVA 3G7LA 3L3OC 4TQUS 2RSNA 4NMZA 1FNVA 4KJOA 1O7YA 1OXSC 3QB3A 4ZKBB 2L4NA 1PRTD 4ME5A 2K7VA 2K5QA 5M9OA 1IW7C 1BBXC 4RGMA 4E6IA 1V1PA 1CFMA 2Q8IB 5E4XA 4R9WA 1HRJA 2GA4B 1KABA 2EYOA 2XIWA 1I6VC 3W2DA 4RFBA 1DOLA 1TS5A 3KBGA 2B2WC 1BCPF 4DF7A 3O13A 3VR3A 1CQVA 5CV6A 3S1NB 2LKVA 4QMGA 2AUKA 1EEID 2KECA 2R6GA 1HXYD 2MJ8A 1D1IA 1SSOA 3T56B 4L63B 5I2XA 4A3GB 1Q3LA 2F0FA 4EVOA 2KUMA 3OIQA 4DU9A 1KNEA 1ET6A 2XVSA 4CKCA 4PMWA 3BDLA 2FJ2A 1A15A 3GQBA 1Q90A 4HMIA 4BBSB 2A69D 2NYZD 3FVQA 3MXGA 5EQ0A 3A8JE 1B50A 2Z4IA 1PTOF 3S2DB 1F2ZA 3TN2A 1KLUD 1JICA 1STAA 2K33A 1PRTB 2PW5A 3HEJA 1ET9A 3GTJB 2L1BA 4TSSA 1OXTA 1D5XC 2FHTA 1XXGA 3VA7A 1SXTA 1K83B 2D5DA 3QJYA 1DOMA 3SVMA 2FMCA 3LX0A 4QCLA 4CGYB 2ICIA 2H1EA 2CVRA 4ZQ3A 4Z9CB 2DY7A 1C4QA 1E2VA 2RDFA 3HZXA 1CZGA 3AU7A 2SOBA 3SK8A 4WRDA 2F0QA 4ZUIA 2VB2X 1E0BA 5M5WB 5IGFA 3MFYA 3PIO3 3GTGB 3H6MA 1CHPD 2WP8J 5A2QL 4KKSA 2PNRC 4MIUA 4G7HC 2F0WA 2G9DA 1FNWA 3OPOA 5C3EB 2K03A 1H9SB 4H44C 1LABA 3NE5B 3SXHA 2I07B 5DNFA 5EJWA 3VYSA 2R3ZA 4K5VA 1H9JA 2LS01 3HOWB 3L7ZC 1RDPD 1S5FD 2R61A 2KCNA 1LO5D 3WOFA 3K57A 2EYMA 3J80L 1PLFA 4QUCA 3HG9A 5E4WC 5CYUA 3V96A 2NZ1D 4BY7B 1C8CA 1ICWA 4XDXA 1PZJD 1AEXA 1G8ZD 3PO2B 3K5LA 1EU3A 1G2SA 2IT1A 4N9TA 2YYZA 3QO2A 2K6AA 3VYTA 3HP3A 5IT9E 1DZ1A 4A3JB 1HFNA 2RDGA 4KN4C 1W6KA 1SNOA 3T16A 1EWHA 1JOQA 4NDXA 2EE1A 3VR5A 1SYFA 4ABNA 4FF1A 1QJOA 5E1FA 4A3BB 3FEWX 4G7OC 3OMGA 5FLXE 3CKIB 3ND8A 2F0EA 2K5DA 2A6HC 5J1ZA 3S14B 3NQTA 1ZYRC 2XWJB 2XNAC 2KVMA 3NTKA 5C3WA 2KCCA 2KEEA 3K6OA 3S9WA 5C5LA 4G57A 1LLRD 2XN9C 3I72A 4ZK9B 1X3QA 5I9OA 4HCSA 2SDFA 2BE5D 3GD7A 4BS9A 1F77A 1PYWD 4DN4M 1BF4A 4FF4A 4ZRZA 3NP8A 2WIIB 1BO0A 2O4XA 1VF5C 2BA0A 1FGBD 5M5YB 4OO1G 3X3MA 3E5SA 1DCZA 4A3MB 2A6ED 1PMRA 1EIHA 5KEEA 4FXKC 2B2TA 5C5MA 2RVLA 1LTSD 3S1QB 3EROA 2F0SA 2WB1B 1QCBD 2Z8LA 4CKBA 3Q6SA 1G291 1VF7A 2LFNA 1FNUA 4IUUA 3MXPA 3P20A 1QWYA 3RZDB 1YNJD 5J39A 4HMJA 5DEHA 2SEBD 4DA2A 2BDOA 2ZXRA 1K8MA 4CKEA 1V43A 5EPLA 5FO9B 3NTIA 3MVVA 3M85A 4ZKCB 3J7AV 2XSCA 3IAYA 2RQXA 1WD1A 3EJIA 4DK0A 3RLFA 1WTXA 5KYLA 5CR3A 2TMPA 1S5CD 1WVLA 1FD7D 1U4RA 3JAML 1EFID 2EOTA 5ELFA 5F2DA 3M7GA 3RD4A 1I4PA 4XTCS 4F88A 1D5MC 4TRDA 4WORA 1X32A 1D1KA 2A69C 1CHQD 2F1MA 2HCCA 1SE2A 2D62A 2VB3X 4DGZA 2B8GA 5JVH3 1PRTF 1NSNS 1QILA 5C0XH 1SMYD 2F3WA 2I46A 1F2LA 3P1HA 3C1FA 5CV5A 3N52A 1TQOA 1D5ZC 4PQXA 2QF7A 1EQVA 2OT2A 5NUCA 2NTTA 1LTGD 3IFTA 2F0IA 1RODA 1HQRD 2WACA 5KYIA 1MGSA 4IFDH 2L55A 4ZAIA 5LHY1 1JC7A 1BXTA 2AQ1B 1TY2A 2MP1A 3M3YB 1EU4A 1HHVA 3DXJC 1LT5D 3I4LA 2Z1CA 2F0LA 3TP6A 1RTNA 4H13C 3LNNA 1STYA 1PZKD 2X6GA 4KD4A 3RUZA 5KNBA 3D3RA 1WTWA 5LL6X 1ENFA 2J0TD 3GTKB 2C9OA 5FO7B 3D6WA 2Z4HA 3A55A 2BA1A 2JA8B 5C6AA 5TSSA 1H9SA 3MXNA 2A5HA 5C0XJ 2EXZA 1SYDA 3ND9A 3GTLB 1QNUA 3SDZA 1R4PB 5KGUA 2J7ZA 2Q8TA 2RSOA 3MAQA 3MWYW 3A56A 2WKCA 1SE3A 3ONAB 4G7ZC 2YU9B 4IFDJ 3NUCA 1NR2A 3PV0A 2JE6I 2F0JA 3I4NB 2CW0D 2PZTA 5IOCA 2JYOA 5G3LD 2BOSA 2ZXPA 3GTQB 1IKLA 1R4QB 1TR5A 1BCPC 2NN6H 1DM0B 5HURA 5COYA 4RGNA 2M9VA 1CZWA 3HKZB 2L5TA 5IGGA 1LT6D 5IGDA 1QE6A 4ILWA 1SE4A 3DMUA 4M8AA 2CQAA 3FMCA 3KUPA 2DNCA 1B2TA 3VA5A 4A3DB 3BG3A 3D4DA 3PUYA 3FKIB 1JWMD 4M1UB 2F0PA 1JE4A 2K1BA 5CV7A 5IIFA 1Q12A 1EWCA 3FPUB 4XQQA 1PTOC 2X69A 1STBA 3ITPA 4LJZC 3X3NA 3I90A 1I4XA 4K8JA 4KY5A 3C1EA 4X3UA 3FDTA 5KRUA 1VMPA 5IGEA 2KEDA 1A3TA 3VYUA 3TZUA 4O42A 1HTPA 2L11A 3R2IA 3H91A 4FO2A 1BR9A 3J81L 1OO9B 4C3JG 2M00A 2ID0A 3H3VC 1IYUA 5DM73 5CORA 3BDCA 3GTPB 1M8AA 1EYDA 3I73A 2BE5C 1IYVA 3TDQA 4IURA 5K36G 4K5XA 1MBYA 1EY4A 4A3KB 1JQYD 5D3DA 4OGQC 1J9OA 1ESFA 4C3JB 2K05A 1BQQT 5JPMC 2J4XA 3FRPB 4J1MA 3HGBA 1U4MA 4KJNA 4X3KA 3MZ5A 2PCFB 4S3SA 4RGOS 1QG7A 2EJFC 2JP1A 2XWBB 1CT1D 4XQNA 4C3HG 1RD9D 3IFDA 1G6ZA 2EJGC 4UAIA 1UEAB 2EDGA 3H09A 1CA6A 2QILA 4F7XA 4KN7C 2JA7B 1GHJA 3NXWA 2B39A 2MUYA 3Q23A 1EIGA 4BWGB 4Q0FA 4KK7A 4UDUC 3V2TA 1GJXA 3TBIB 4C3HB 4ZUJA 1Q1EA 2L0CA 4A3FB 1LACA 2LY7A 2TSSA 5A2QE 3T51B 3D8GA 4HCEA 2IX0A 4FNFA 1BOSA 3DM1A 3IKJA 2O2LD 1II3A 4WJWA 4HN7A 1U4LA 2NVYB 4NP5A 3MXUA 1TKWB 2BCOA 5D14A 2BDNA 3M4OB 1GUNA 3BZDB 3KK7A 2ENBA 3J80E 3BYTB 4KY7A 3K5OA 1YNND 4OO1I 3A54A 1VMCA 4ZYSA 1IKMA 2E76C 3S1RB 5CC4A 4F8MA 3QWNA 1CM9A 1SNQA 2VUMB 1CI3M 5ELDA 2F0MA 2PPBC 1H9RA 1W6JA 3NQIA 2E74C 3WDNA 5A35A 2NUCA 1T5XD 2FFKB 2EYPA 1EYAA 2XRQD 3Q24A 1Q1BA 1Q8IA 1WTVA 1SFOB 4KTAA 3CRKC 1TY0A 4B9XA 3PUZA 3A8KE 3SHLA 1ESRA 4QB4A 5C4JB 1Y69U 4KHZA 5JEAG 3W3AA 1KLGD 4U68A 2OEOA 4IUNA 2K04A 1L0XB 1XWEA 1PFNA 3HOXB 4OIKA 3TSSA 4BBRB 1HA6A 4X3TA 1QNKA 1HA5A 4C56C 3I70A 2B2TC 1SNDA 1SYBA 4RCNA 3I91A 2HQEA 1WTOA 4FXDA 1MSHA 4PMCA 3MHBA 2IJ0A 2PW7A 5CV4A 4TKOB 1I4QA 3KLSA 2M2LA 3HRZC 4V190 1GXDC 1XYIA 1V1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J1M A;  5IOD A;  4J6H A;  3C1F A;  4KD3 A;  2F0G A;  5CV5 A;  2F0M A;  2PZW A;  4KJN A;  2EY5 A;  1TQO A;  3MZ5 A;  2OF1 A;  4NMZ A;  5IGB A;  5IGG A;  5KEE A;  2F0O A;  2QDB A;  4S3S A;  4EQN A;  1AEX A;  4KJO A;  2KHS A;  5IGD A;  5C5M A;  1JOR A;  3DHQ A;  2EYH A;  3ERO A;  1EQV A;  1U9R A;  2F0S A;  5CV8 A;  5NUC A;  3DMU A;  3QB3 A;  4PNY A;  4N9T A;  2F0I A;  4HTH A;  2WAC A;  4N9P A;  3TP8 A;  3SK4 A;  5KYI A;  5C4Z A;  2F0U A;  3SK6 A;  5E3F A;  1EY7 A;  2NUC A;  1RKN A;  2EYP A;  3LX0 A;  3VA5 A;  1EYA A;  4RKL A;  4F7X A;  1JOO A;  4R8N A;  4ME5 A;  2RBM A;  1F2M A;  4EQP A;  3D4D A;  5M9O A;  4H7B A;  1EYC A;  1KDA A;  2F0P A;  4ZQ3 A;  4I65 A;  5EKL A;  1KDC A;  3D6C A;  3MXP A;  3NXW A;  3R3O A;  4KV6 A;  3SK5 A;  4E6I A;  2RDF A;  3HZX A;  1SNO A;  2SNS A;  2EYF A;  3SR1 A;  4KTA A;  3T16 A;  5JAV A;  2F0L A;  3TP6 A;  2F0D A;  5CV7 A;  5IIF A;  1JOQ A;  4NDX A;  1EY5 A;  5ISR A;  1EY0 A;  3V2T A;  5J39 A;  1STY A;  4HMJ A;  4B9X A;  3QOJ A;  1SYF A;  4ZUJ A;  2EY6 A;  5JOB A;  1SYE A;  2SOB A;  1KAB A;  2EYO A;  4WRD A;  2F0Q A;  4K2L A;  5DEH A;  3SK8 A;  2PYK A;  4ZUI A;  3SHL A;  4KD4 A;  1STH A;  4QF4 A;  1EZ6 A;  1STB A;  1SNM A;  3ITP A;  4B9W A;  4QB4 A;  3RUZ A;  3NK9 A;  3T13 A;  4DFA A;  5E1F A;  4K8J A;  4K2K A;  4NKL A;  4KY5 A;  4EQO A;  1KAA A;  3C1E A;  1STN A;  4DF7 A;  5IGF A;  5CV6 A;  3D8G A;  3OMG A;  1EZ8 A;  4IAL A;  3QOL A;  5J22 A;  3MVV A;  2LKV A;  2PQE A;  4QMG A;  3H6M A;  5KRU A;  5IGE A;  2OEO A;  3TP7 A;  4K6D A;  1EY9 A;  4YIJ A;  4IUN A;  1A3T A;  2EY1 A;  1SNC A;  3TME A;  2F0E A;  4K14 A;  4K8I A;  5C6A A;  4KY6 A;  3ERQ A;  3TP5 A;  3EJI A;  2F0H A;  3PMF A;  5J1Z A;  2EXZ A;  2EYL A;  1NUC A;  1SYD A;  4ODG A;  4IZ8 A;  2KQ3 A;  3MEH A;  3NQT A;  1II3 A;  5CV9 A;  1A2T A;  1KDB A;  3NHH A;  1ENA A;  2F3V A;  4MIU A;  5CR3 A;  5KYL A;  2F0F A;  2F0W A;  4LAA A;  5CGK A;  5C3W A;  5KGU A;  3S9W A;  3P75 A;  5C5L A;  4G57 A;  4NP5 A;  3OSO A;  2M00 A;  4EVO A;  4KHV A;  5DAU A;  5F2D A;  3D4W A;  4K5W A;  3SXH A;  1SND A;  1ENC A;  1SYG A;  4DU9 A;  1JOK A;  1SYB A;  3OMC A;  2ENB A;  1STG A;  3BDC A;  5I9O A;  4K5V A;  5I6Y A;  5IGC A;  4PMB A;  2HQE A;  4KY7 A;  3NUC A;  5EKK A;  1EYD A;  4TRD A;  3EVQ A;  1A3V A;  2F0K A;  1EY6 A;  2OXP A;  3BDL A;  4HMI A;  4RKB A;  4WOR A;  1IHZ A;  5C4H A;  4K5X A;  3OWF A;  5I6W A;  5EGT A;  2F0J A;  2EYM A;  5I9P A;  4PMC A;  1EY4 A;  2PZU A;  3NP8 A;  3U9O A;  2PZT A;  2F0N A;  3MHB A;  5C3X A;  2EYJ A;  5HGT A;  5IOC A;  1TT2 A;  1A3U A;  1F2Z A;  2PW7 A;  2SNM A;  4OL7 A;  2O4X A;  2EY2 A;  4F8M A;  5CC4 A;  4DGZ A;  5CV4 A;  4ID6 A;  1STA A;  2F0V A;  1SYC A;  1TR5 A;  1SNQ A;  1F2Y A;  1NSN S;  1SNP A;  2PW5 A;  2RKS A;  5K5P A;  3E5S A;  1A2U A;  2F3W A;  1EY8 A;  3HEJ A;  2F0T A;  5HUR A;  5KIX A;  3P1H A; 
#chains in the Genus database with same CATH topology
 1P16 A;  4DAY A;  5ELB A;  3BVM A;  1WI5 A;  3J7Z C;  1D2B A;  1SMX A;  1EEF D;  4LF5 L;  2F0O A;  5IT9 L;  1CA5 A;  1GUO A;  1NNX A;  3D4R A;  5ELN A;  1XPU A;  1C7Y A;  4BXX G;  1V9P A;  1EY7 A;  4X66 L;  1DGS A;  3G6E A;  3UDX A;  3KJP A;  1IBK L;  4CHT B;  4A4I A;  5D65 A;  2WIN B;  4B3S L;  1F9S A;  2V4D A;  4YWK A;  1EYC A;  1XMQ L;  4Y52 H;  4CJ1 B;  2UUC Q;  5EKL A;  1HFG A;  3BYY B;  4X65 L;  2D2C C;  4KV6 A;  2SNS A;  5IT9 c;  5M3F H;  1QB5 D;  2D0P A;  5ISR A;  4UP8 A;  2UUA L;  1F9R A;  3ICE A;  1SYE A;  4JI3 Q;  5M3M G;  5AJ3 L;  2F4I A;  2IW3 A;  1TS4 A;  1AZP A;  1SNM A;  1X3E A;  1QOH A;  3NK9 A;  3T13 A;  1PRT C;  4DFA A;  1AP0 A;  1O80 A;  4GNX C;  2KHI A;  3K80 C;  2AQ2 B;  1O78 A;  3CQZ H;  2A68 D;  4DR1 L;  1Z9F A;  3UI2 A;  1PTO H;  3JAM E;  1EY9 A;  2HDL A;  2C35 B;  1ZEQ X;  5L37 A;  2IPK D;  3UE1 A;  3CCS A;  3J81 i;  4JBW A;  4DPG A;  4IPG A;  3G71 A;  1TS2 A;  5JJZ A;  4R1J A;  1S5B D;  2XGT A;  3KF6 B;  2NVX B;  3GO5 A;  3BZC A;  1ENA A;  5M3M B;  1HUN A;  2GN5 A;  2R92 G;  2H4O A;  5DLQ E;  5G3L F;  2KCT A;  3D4W A;  1N8R C;  3K81 C;  5GQO A;  1ENC A;  1SYG A;  3AMU A;  4DV7 Q;  3OMC A;  1ILQ A;  4C2M B;  5IGC A;  1LV9 A;  3S15 H;  1VQ9 A;  1EY6 A;  2NBF A;  4IQZ A;  5C4H A;  3NEM A;  3C3L A;  1UAP A;  4LWC A;  5IP9 H;  1R9T B;  2QDL A;  3EN2 A;  4BA2 I;  2V1C C;  1LTB D;  3H3V H;  4ALP A;  2R92 B;  1BUV T;  4YCU A;  5FJ8 G;  1F2Y A;  3NTH A;  5T1G A;  1VQ6 A;  3HOU H;  2RKS A;  1HUM A;  1UE5 A;  1KC8 C;  5KIX A;  4AQY L;  1JWU D;  3S17 B;  2O5J C;  4R4T A;  1X56 A;  1TWH B;  2ZTD A;  1CK1 A;  3G6J B;  3NEL A;  4DV4 Q;  4JCV E;  3CC7 A;  5C0X G;  3DEO A;  4DXG A;  4YWL A;  3JC6 6;  2XRS D;  3DHQ A;  1AH9 A;  1NBW A;  1N33 L;  1ZKO A;  2KA7 A;  4R4I A;  4PNY A;  1HZB A;  2NTS A;  2JEB I;  4Y7N H;  2KHJ A;  2HHH L;  1M4V A;  1ML0 D;  2EVB A;  4N9P A;  5FO8 B;  5I2Y A;  1WTQ A;  1DD2 A;  3MC0 B;  5BN3 A;  1LTT D;  1B7Y B;  1RKN A;  4RHS A;  4J8Q A;  5GAG C;  2AQ3 B;  4XYO A;  3PSI A;  4IFD G;  1LUZ A;  3UDG A;  4FDB A;  4DXF A;  4P2C B;  1UEB A;  1XTC D;  3STB C;  1EY0 A;  4KKU A;  2RCN A;  1CSP A;  3SEB A;  2ZXO A;  4A3C G;  2PYK A;  5IE8 A;  1STH A;  2DUD A;  4A93 H;  1KAA A;  1STN A;  4ME3 A;  3HS0 C;  2WV6 D;  4IAL A;  3CCL A;  3CCU A;  4JBJ A;  1JB7 A;  4C3I H;  1GUG A;  1N36 L;  2E2H B;  1SNC A;  4I7Z C;  4KY6 A;  1KHI A;  2NVT B;  1VQF A;  1E1O A;  1YNX A;  1Z6H A;  3NSW A;  3KF8 A;  4YCW A;  5GRO A;  4HIK A;  1STE A;  1TS3 A;  4IUV A;  1RHP A;  3OSO A;  4DUZ Q;  4KHV A;  4XYQ A;  3VR4 A;  4DV1 Q;  1EIY B;  2K28 A;  4R8I A;  1JCK B;  1KNA A;  1VQ7 A;  2G5D A;  2Q8R E;  3URY A;  1BBU A;  2AWN A;  2HDM A;  1Y8N B;  3EA6 A;  5EKK A;  1E24 A;  3T53 B;  1CKN B;  1A3V A;  2QEJ C;  4IUQ A;  3K7A B;  3OHX C;  1C48 A;  2R7F A;  1VCI A;  3Q0A A;  2AHO B;  5I6W A;  1YNN C;  2I5L X;  2XTI A;  4DR6 Q;  3U9O A;  5LMU L;  2JSO A;  1MI2 A;  1A3U A;  4H0L C;  3J7A F;  3PUW A;  2F03 A;  2JA8 H;  4B08 A;  2K52 A;  3KBX A;  5AFW A;  4GZY C;  1TWC B;  2O5I C;  2E5L Q;  5IOD A;  1JE5 A;  3PIO A;  2UXB L;  1F9Q A;  4JI8 Q;  2NN6 G;  4LK1 C;  1XPO A;  4YCV A;  2VQE Q;  1I4R A;  2JEA I;  2ALY B;  3M4Y A;  1O7L A;  3NBH A;  4XQJ A;  3KLR A;  4OEL B;  1CQF A;  4JOI C;  1U9R A;  2R7D A;  3RLO A;  5BN5 A;  3HOV H;  4FXG C;  1ONL A;  4RCO A;  3SK6 A;  4OIJ A;  5CMD A;  3S16 B;  2YV5 A;  3I55 A;  3GTM H;  3VR6 A;  2IX3 A;  2AWO A;  4KMU C;  3NWT A;  2RBM A;  4EQP A;  3EQL C;  1CTM A;  1Q86 C;  1KDA A;  2MFI A;  3SE0 A;  2IL8 A;  3RZO H;  1NR4 A;  3SK5 A;  1N32 L;  4PG3 A;  3S1M B;  3SR1 A;  2WB1 E;  3QG1 A;  4NW2 A;  1ZYR D;  3DM3 A;  1Y14 B;  3QOJ A;  3WOE A;  3H94 A;  4LFB L;  1IBK Q;  4GOP C;  1BNZ A;  1HPC A;  4A3E H;  4LMQ D;  4PV1 C;  2JXM B;  5EAY A;  1EZ6 A;  2B63 H;  1VQB A;  1AFP A;  3A74 A;  3H0G G;  3I4M G;  1IBL Q;  3PUV A;  4X65 Q;  3R93 A;  3OWE B;  5EPJ A;  3J81 E;  1J8I A;  1AW7 A;  1MSG A;  2QEX A;  2R93 H;  2IWH A;  4K6D A;  2LSS A;  3AYH B;  5HGQ A;  1Y1W G;  3TRZ A;  1B3A A;  2K01 A;  1TU2 B;  2B2U A;  2WAQ G;  5AJ3 Q;  5BN4 A;  4HAE A;  4ODG A;  4RHR A;  1E1T A;  2KQ3 A;  2K32 A;  1KDB A;  3NHH A;  4V0B A;  3HOZ G;  4L6T B;  1RJT A;  4LAA A;  4POG A;  3K0X A;  3MEF A;  1PFM A;  3P75 A;  1HNW Q;  1WFQ A;  4DR1 Q;  1N34 L;  2ICE C;  3H0G B;  1A8V A;  3A8I E;  2VNU D;  3I4M B;  4BA1 I;  4JOI A;  3RMH A;  2Y0S E;  1GHK A;  4X62 L;  3S2H B;  1I6H B;  1LTL A;  1LTA D;  4KI0 A;  1F9P A;  1Y1W B;  2WAQ B;  2RDH A;  3OWF A;  1LTR D;  4LW1 A;  1K8G A;  1Q82 C;  2PZU A;  2HQL A;  1JB3 A;  2F0N A;  2EYJ A;  3GTO B;  3KOJ A;  3HOZ B;  3T1Y L;  4JI5 Q;  4A76 A;  3Q22 A;  1L1O B;  1PH1 A;  1SRO A;  1WTH A;  2F0T A;  4ZCK A;  4OWX B;  4J6H A;  4GOP A;  1UUP A;  3PO3 B;  2NB0 A;  2WFW A;  3GP7 A;  4AYB G;  2BH8 A;  2QDB A;  4XIG S;  2CWA A;  4HED A;  5EPK A;  1PFB A;  1S5D D;  2EYH A;  4BY1 G;  1EOT A;  3NEN A;  2B2V A;  1UE7 A;  1GUW A;  2F0U A;  2I5M X;  3S1N H;  3K59 A;  3AEV A;  2JA6 G;  4AQY Q;  5EBC A;  4AH6 A;  2EJM A;  3NPP A;  1B9M A;  1O7Z A;  2KOL A;  4QIW B;  3WWV A;  5JVG 3;  1VQG A;  2MPM A;  1S4Z A;  1KDC A;  2KJX A;  4JBM A;  3DWP A;  4A3G H;  1N33 Q;  2A6E C;  4AYB B;  2VXW A;  2HHH Q;  1O7I A;  3V05 A;  1I5F A;  2AKW B;  1VQO A;  4HJ9 A;  4BY1 B;  1X9N A;  3CU7 A;  2JA9 A;  4EQ5 A;  1I50 B;  1B9N A;  2FIN B;  1HQM C;  2JA6 B;  2MGS A;  5LMN Q;  3I2Z A;  2F3I A;  2QKI C;  4BBS H;  5K36 H;  1VDZ A;  5IY0 A;  2A68 C;  4IO9 A;  4YIJ A;  1G2T A;  3TME A;  5IP7 H;  4A3L H;  1T5E A;  3ULJ A;  4P72 A;  4HJ8 A;  2EZV A;  1YNJ C;  3MEH A;  1VQJ A;  1HTL D;  5JJI A;  1A2T A;  5JJK A;  3ZYY X;  1I3Q B;  1QZH A;  2N3S A;  1OXV A;  1XPR A;  1XJV A;  1J5E L;  5DAU A;  3BU2 A;  1YEZ A;  3GV6 A;  4JI4 L;  3E6Z X;  1N36 Q;  4QQB X;  1WCM G;  4DV2 L;  1K83 H;  4A3F H;  1UWV A;  2VZA A;  2I5H A;  3DUZ A;  2KCM A;  2WKD A;  4RKB A;  5CV9 A;  2OXP A;  1NAP A;  3CPF A;  5C44 G;  2B2W A;  2HD3 A;  1Y8O B;  2X6L A;  2E2I B;  3M7N A;  4XT1 B;  2PNH A;  1MD2 D;  3MTS A;  1TT2 A;  4FVM A;  5CBA E;  4GLX A;  1AZQ A;  3KLS X;  1GM5 A;  1SYC A;  5ELC A;  4MTN A;  1WD0 A;  4DR4 L;  5DM6 3;  1WCM B;  3BVG A;  4QGU A;  4DR5 Q;  4DR7 L;  3TZD A;  4KD3 A;  2E8G A;  1LT4 D;  3LWE A;  1HNZ Q;  4P75 A;  2NVY H;  5C44 B;  5LMU Q;  3CAM A;  1SJH D;  2B8F A;  5KNC A;  5M5W H;  4MHE A;  4U67 3;  2JA5 G;  3GTG H;  3NBI A;  1B4O A;  5D3I B;  4RKL A;  3DWQ A;  3I3C A;  2RCF A;  2B3G A;  2HCI A;  5IWA L;  2UXB Q;  5KND A;  1UNS A;  3L2P A;  3VR2 A;  1SMY C;  2LXK A;  3F2B A;  4GN4 B;  3R3O A;  3GV3 A;  1OXU A;  2Z6K C;  3HOY G;  5C4X G;  2VW9 A;  4MN3 A;  4LF4 L;  5FLM G;  1PH2 A;  2F0D A;  1IL8 A;  1H9K A;  2F4V L;  5C3E H;  2DN8 A;  2C5C A;  2QCP X;  3W5O A;  3R2T A;  5GAD C;  1G91 A;  1U5K A;  2HT1 A;  2NZH A;  2JA5 B;  4QF4 A;  4DAP A;  4F87 A;  3CXC A;  2K75 A;  4NKL A;  3CF5 A;  3HOW H;  5T1I A;  3OW7 A;  3A5Z B;  5M5X B;  1N32 Q;  5J22 A;  3QOL A;  4NXN Q;  4X3S A;  3HOY B;  5C4X B;  3PF4 A;  4FP5 D;  4K14 A;  2MHV A;  3TP5 A;  1B53 A;  3TEH B;  2A73 B;  1TWF B;  4LFB Q;  4JI1 L;  3PMF A;  1TWA B;  1DON A;  2NWG A;  4LFC Q;  1TII D;  3CHB D;  3VYR A;  2F3V A;  1OXX K;  1CKN A;  1XMO L;  1BCP D;  4HJ7 A;  4BY7 H;  1TWG B;  1JOK A;  4MZ9 A;  2PO4 A;  3PO2 H;  3DWA A;  4RAU C;  4EX5 A;  5IYC H;  1A62 A;  4DR2 L;  2OWO A;  5ELE A;  4CJ0 B;  1LT3 D;  5C4Z A;  5FOB B;  1IHZ A;  1EQT A;  4IN3 A;  5EGT A;  1SJE D;  1E7Z A;  3J80 c;  5I9P A;  4DK3 C;  4A3J H;  4DNR B;  1EL0 A;  4JI0 L;  1GVP A;  2SNM A;  3F1Z A;  2R7Z G;  1XNQ L;  2E2D C;  5EKI A;  5C0X I;  4X62 Q;  3H15 A;  1A2U A;  1PDQ A;  3I7F A;  2NVQ B;  4YHH L;  4L5T A;  4A3I G;  1LM0 A;  2EY5 A;  1PYB A;  5IGB A;  4H02 A;  3ERS X;  2A74 C;  2KHS A;  1PTO D;  1FR3 A;  4NXM Q;  5JEA H;  2VS1 A;  4A3B H;  3S24 A;  5GAH C;  3T1Y Q;  4DK1 A;  4IFD I;  1GUS A;  1CSQ A;  3RNU A;  1DOK A;  1Q81 C;  2CW0 C;  3BDO A;  3QR8 A;  2R7Z B;  1L1O C;  4PZ6 A;  2N78 A;  3PUX A;  4O1N A;  4H7B A;  1IW7 D;  4I65 A;  3S14 H;  3D6C A;  3PQI A;  4A3I B;  2EYF A;  5JAV A;  1A6X A;  4L8J A;  3CP0 A;  5ELO A;  2N88 A;  1ASY A;  4FYD A;  5M3F G;  4JK1 C;  3R8B A;  1YBY A;  3K58 A;  1V1P B;  2AUJ D;  2I0Q A;  1BCP B;  4HSP A;  2G9H D;  3QIA A;  4EGV A;  1EZ8 A;  2PQE A;  1Q8K A;  3TP7 A;  4DAV A;  3I56 A;  3IRB A;  5BR8 L;  4WFN 3;  1DJR D;  2F0H A;  4HR7 B;  4JBK A;  2EYL A;  5M5Y H;  5FLX L;  2ZT9 C;  4RH6 A;  5M3F B;  4A3M H;  1D6E C;  3T4A C;  1KTK A;  1K8O A;  2OCE A;  3RN5 A;  5JEA J;  1FL0 A;  1QUQ B;  3S1Q H;  1STG A;  3EFX D;  1E2W A;  2ZJQ A;  1YI2 A;  5CGK A;  2F0K A;  1L1O A;  4KHP Q;  4KLK A;  4XXE A;  3CQZ B;  1PXU A;  3BS1 A;  5FLX c;  4OEM B;  4OO1 H;  1PTO B;  3ULL A;  5HGT A;  1U0L A;  1JR0 D;  1X3P A;  4JI4 Q;  2PI2 A;  3OIP A;  2CHB D;  5JPN C;  3DEP A;  4DV2 Q;  2NN6 I;  5IP9 G;  1SNP A;  1DYQ A;  3RZD H;  1RF2 D;  2E2J B;  4X64 L;  4UP7 A;  3EIV A;  3FPP A;  1L0Y B;  2F0G A;  1SAP A;  2K4K A;  2PZW A;  2Y0S G;  4KKT A;  3HOU G;  2OF1 A;  1VQM A;  4RA8 A;  1WTP A;  1I94 L;  1JOR A;  5FK9 C;  2BH2 A;  3A7A B;  2LMC B;  1JJG A;  2DJF C;  3S15 B;  1YHB A;  1EYG A;  4LF8 L;  4IUT A;  5E3F A;  2B2Y C;  4CDD C;  2VQF L;  1KL9 A;  4DV3 L;  3OOC A;  1F2M A;  4Q5V A;  1R9T H;  1CUK A;  2Y0S B;  2FMM A;  3HOU B;  3C2P A;  1I4G A;  2DY8 A;  1EY5 A;  1GO3 E;  2EY6 A;  5JOB A;  4OWT B;  1TVX A;  4QUF A;  4B9W A;  4ZLT F;  5IWA Q;  3K0Y A;  4K2K A;  4EQO A;  5I4D A;  4K6L A;  4Y7N B;  2ZTC A;  4RWS C;  1DXM A;  3K5M A;  2PMZ B;  4LF4 Q;  4DK6 C;  4A93 G;  2F4V Q;  4XT3 B;  4JYA L;  3ERQ A;  1YHQ A;  1CKM A;  2D9U A;  4C3I G;  4IZ8 A;  3A7L A;  3F2U A;  1RCV D;  2JJQ A;  3P7J A;  1FYC A;  3E9H A;  3BVZ A;  4P74 A;  3MFG A;  4J15 A;  4OXP A;  4CDF C;  2RA4 A;  4CJ2 C;  1FJG L;  2EPB A;  4K5W A;  1M1K C;  3U9S A;  2QW7 A;  3AB9 A;  4JI1 Q;  4A93 B;  2B2Y A;  3EVQ A;  1Z47 A;  3N6R A;  2UUB L;  3L9A X;  2DNE A;  4UY8 C;  1XMO Q;  4C3I B;  1OTC A;  1LYL A;  3M3Y H;  4I7A A;  3CC4 A;  3U4Z A;  4G4K A;  4OL7 A;  1U4P A;  1SBB B;  2EY2 A;  2E2H H;  4FF2 A;  1WOC A;  4DR2 Q;  1HCZ A;  1EY8 A;  2L9H A;  3HFZ B;  4OHJ A;  1Y1V G;  1I4H A;  4EQN A;  1S5E D;  2CQO A;  4JI0 Q;  3PIP 3;  1NCV A;  3G4S A;  5CV8 A;  2MQH A;  5CBE E;  1VQN A;  1BDO A;  1XNQ Q;  4HTH A;  3GTK H;  1PZI D;  3TP8 A;  3SK4 A;  2K50 A;  4CBV A;  3F2C A;  1E2Z A;  2QGQ A;  1RTO A;  2B2U C;  1JOO A;  4R8N A;  3HOV G;  4YHH Q;  5JJL A;  3LWU A;  1WYD A;  3K7U C;  2UU9 L;  1XX8 A;  1JWS D;  4OX9 L;  2OQK A;  5J3B A;  3C46 A;  4UP9 A;  3GTL H;  3J7Y W;  1Y1V B;  3E0J A;  4LFA L;  1Y8P B;  1VQL A;  4LF9 L;  1ZXT A;  1Z7T A;  1KAW A;  4K2L A;  1H9M A;  4K0K L;  3DLL A;  2YU9 H;  4GLV B;  3HOV B;  1SDF A;  4A3E G;  1V8Q A;  4R4C A;  1GUT A;  4LF5 Q;  3GTM B;  4JI6 L;  1GKH A;  2B63 G;  3I4N H;  2PQA A;  2K5W A;  3IL8 A;  3KJO A;  4UHV A;  1SLJ A;  2EY1 A;  4C1N I;  3K5N A;  4K8I A;  4LNQ A;  1YIT A;  2A6H D;  4C1N K;  3GTQ H;  1MIU A;  1NUC A;  3CRL C;  5LL6 S;  2VY3 A;  3RZO B;  2R93 G;  1ILP A;  4X66 Q;  3RR5 A;  1HR0 W;  1PVO A;  2IX1 A;  4B3S Q;  1EIF A;  2HUG A;  1XMQ Q;  4DV0 L;  3MA2 B;  2E75 C;  3D31 A;  1WTR A;  2B2V C;  2H5X A;  4A3E B;  1B44 D;  4DNT B;  4IUP A;  1MKH A;  1GOZ A;  5FKA C;  5I6Y A;  2B63 B;  4PMB A;  3I8Z A;  4ULL A;  2KEN A;  1UE6 A;  3D0F A;  1KIX A;  2UUA Q;  2B29 A;  3NWS A;  4RGT A;  1K8A C;  4A3D H;  1K0R A;  2R93 B;  5C3X A;  3FKI H;  4FF3 A;  1LTI D;  2L12 A;  2N55 A;  1YIJ A;  4ID6 A;  2F0V A;  1AN8 A;  1B1Z A;  1SEB D;  5K5P A;  5EBD A;  4HSV A;  3L0O A;  3G7L A;  3L3O C;  4TQU S;  2RSN A;  4NMZ A;  4L5Q A;  1FNV A;  4KJO A;  1O7Y A;  1OXS C;  3QB3 A;  3PGZ A;  4DR3 L;  4ZKB B;  5IYD H;  2L4N A;  1PRT D;  4X64 Q;  1B70 B;  4A75 A;  4ME5 A;  2K7V A;  2K5Q A;  4P73 A;  5M9O A;  1IW7 C;  3EBE A;  3PF5 A;  1I94 Q;  1BBX C;  1L2F A;  4RGM A;  4E6I A;  1V1P A;  1CFM A;  2Q8I B;  1VQ5 A;  5E4X A;  4R9W A;  1HRJ A;  2GA4 B;  4N8X 1;  4A3G G;  1KAB A;  2EYO A;  2XIW A;  1I6V C;  2YTV A;  4DV3 Q;  3PO3 H;  3W2D A;  4RFB A;  3GTP H;  1DOL A;  2Q2T A;  4DV5 L;  2ZJP A;  1TS5 A;  3KBG A;  2B2W C;  1BCP F;  1D8L A;  3O13 A;  3VR3 A;  4DF7 A;  1CQV A;  1JJ2 A;  5CV6 A;  1KD1 C;  3S1N B;  2LKV A;  1X55 A;  4QMG A;  2AUK A;  1HNX L;  1EEI D;  2KEC A;  2R6G A;  4JC0 A;  2ZM6 L;  4A3K H;  1HXY D;  2MJ8 A;  4BBS G;  1D1I A;  1SSO A;  1YZ6 A;  3T56 B;  1VQA A;  4C3J H;  1QUQ A;  3M4P A;  4IPC A;  4L63 B;  5I2X A;  2EIF A;  4A3G B;  5IP7 G;  4A3L G;  1Q3L A;  2F0F A;  4JI2 L;  2ES2 A;  2KBN A;  3CCQ A;  1PYS B;  4IPD A;  4EVO A;  2KUM A;  1UE1 A;  3OIQ A;  4DU9 A;  3KF6 A;  1KNE A;  2NZO A;  4JYA Q;  4GKK L;  1ET6 A;  2XVS A;  1K9M C;  3AQQ A;  4CKC A;  4PMW A;  3BDL A;  2FJ2 A;  1A15 A;  2MO0 A;  1Q90 A;  3GQB A;  4HMI A;  1VQE A;  2Q2I A;  1WJJ A;  4HJA A;  4BBS B;  2A69 D;  2NYZ D;  3FVQ A;  1S40 A;  3MXG A;  5EQ0 A;  3A8J E;  2JA7 H;  2JN4 A;  1B50 A;  2Z4I A;  1PTO F;  3S2D B;  1F2Z A;  2ATW A;  3TN2 A;  1KLU D;  2RF4 A;  1JIC A;  1STA A;  4B3M L;  2K33 A;  1PRT B;  1X3G A;  1Q7Y C;  4GNX B;  2PW5 A;  1BVS A;  3HEJ A;  1QZG A;  1ET9 A;  3GTJ B;  2L1B A;  4C3H H;  2UUB Q;  2A8V A;  4TSS A;  1OXT A;  1D5X C;  2P5Z X;  2FHT A;  1XXG A;  3VA7 A;  1SXT A;  1K83 B;  4GS3 A;  2D5D A;  1G6P A;  4LUV A;  3QJY A;  1DOM A;  3SVM A;  2FMC A;  1EQR A;  3LX0 A;  4QCL A;  4CGY B;  4N8F A;  2ICI A;  2H1E A;  3OTO L;  2CVR A;  4ZQ3 A;  2OQ0 A;  4Z9C B;  3W1G A;  2DY7 A;  1C4Q A;  1E2V A;  1W2B A;  4GLA C;  2RDF A;  3HZX A;  1K3R A;  1CZG A;  3TRE A;  3AU7 A;  2N8N A;  2SOB A;  3SK8 A;  4WRD A;  4OWW B;  2F0Q A;  4O2D A;  4ZUI A;  3M4O H;  1AE3 A;  3TQY A;  3TS0 A;  2UU9 Q;  5C3E G;  4OX9 Q;  2VB2 X;  1E0B A;  5M5W B;  5IGF A;  3MFY A;  3PIO 3;  3GTG B;  4LFA Q;  3HKZ E;  3H6M A;  1CHP D;  4LF9 Q;  3HOW G;  3S1R H;  1MJE A;  2WP8 J;  3AFQ A;  2IY5 B;  1KXL A;  5A2Q L;  4K0K Q;  2VUM H;  4KKS A;  3TS2 A;  1VQD A;  2PNR C;  4MIU A;  4G7H C;  2F0W A;  2G9D A;  1FNW A;  3KLW A;  3CCJ A;  3OPO A;  4DNI A;  1NTG A;  5C3E B;  2K03 A;  1H9S B;  4H44 C;  4JI6 Q;  3MXN B;  1LAB A;  3NE5 B;  3SXH A;  2I07 B;  4MNO A;  5DNF A;  5EJW A;  3VYS A;  2R3Z A;  4BY7 G;  4K5V A;  1H9J A;  1EOV A;  2LS0 1;  3HOW B;  3L7Z C;  1RDP D;  1S5F D;  3CCM A;  2R61 A;  3CMA A;  2KCN A;  1LO5 D;  3PO2 G;  3WOF A;  2N49 A;  3K57 A;  2EYM A;  5IYC G;  1YJW A;  3J80 L;  3FHW A;  3H3V I;  3BJU A;  1PLF A;  1N9W A;  4QUC A;  4DV0 Q;  2D0O A;  1HH2 P;  3HG9 A;  5E4W C;  1SFO H;  4A3J G;  4IOC A;  1PH9 A;  4IJH A;  5CYU A;  1PH6 A;  3V96 A;  2NZ1 D;  4O0A A;  4BY7 B;  1C8C A;  1ICW A;  4XDX A;  1PZJ D;  1AEX A;  1G8Z D;  5C4J H;  3PO2 B;  3K5L A;  1EU3 A;  1TXY A;  1G2S A;  2IT1 A;  4N9T A;  2YYZ A;  3GDE A;  2K6A A;  3QO2 A;  3VYT A;  2EQS A;  3M9B A;  1B3Q A;  1N34 Q;  3HP3 A;  3CCV A;  1PH4 A;  5IT9 E;  3U50 C;  4A3B G;  1DZ1 A;  4A3J B;  1X65 A;  4DV1 L;  1HFN A;  3K8A A;  3HOX H;  2RDG A;  4KN4 C;  4BBR H;  1W6K A;  1KQS A;  1SNO A;  3T16 A;  2MO1 A;  1IYJ B;  1EWH A;  1JOQ A;  4NDX A;  2EE1 A;  4UPA A;  3VR5 A;  1SYF A;  4LUZ A;  4ABN A;  2HIX A;  4FF1 A;  1QJO A;  4B3R L;  5E1F A;  4A3B B;  3FEW X;  4G7O C;  3OMG A;  5FLX E;  4AYB E;  3CKI B;  3CD6 A;  3ND8 A;  2F0E A;  2F52 A;  2Q2H A;  1VQH A;  2K5D A;  2A6H C;  1C0A A;  5J1Z A;  2VQE L;  3S14 B;  3NQT A;  1ZYR C;  2XWJ B;  2XNA C;  2KVM A;  3NTK A;  5IYB H;  4DV5 Q;  1VQ4 A;  2KCC A;  5C3W A;  2KEE A;  3K6O A;  3S9W A;  4NB3 A;  4G57 A;  3KDF B;  5C5L A;  1LLR D;  2XN9 C;  2ZM6 Q;  3I72 A;  4ZK9 B;  2Z0S A;  4A3M G;  1SR3 A;  2CWP A;  1X3Q A;  5I9O A;  4HCS A;  2SDF A;  4R4O A;  2BE5 D;  3GD7 A;  4BS9 A;  1F77 A;  4LF7 L;  3OYY A;  1PYW D;  4DN4 M;  1BF4 A;  4FF4 A;  2WB1 G;  4JI2 Q;  1NMG A;  4ZRZ A;  3NP8 A;  2WII B;  4GOP B;  1BO0 A;  2YTY A;  2K5H A;  2O4X A;  4JI7 L;  1NY4 A;  2RHS B;  1VF5 C;  1FVI A;  4RMF A;  4TVA B;  2BA0 A;  1FGB D;  4GKK Q;  4OO1 G;  5M5Y B;  2JQO A;  3E5S A;  1DCZ A;  3X3M A;  4A3M B;  3CME A;  1IBL L;  2A6E D;  1PMR A;  4IJL A;  1EIH A;  5KEE A;  4DV6 L;  4BXX H;  4FXK C;  2B2T A;  5C5M A;  1KRS A;  2RVL A;  1ASZ A;  1LTS D;  3UE0 A;  3S1Q B;  3ERO A;  2F0S A;  2WB1 B;  4B3M Q;  1QCB D;  2Z8L A;  4CKB A;  3Q6S A;  1J5E Q;  1G29 1;  4LUO A;  1VF7 A;  1C9O A;  1PH8 A;  1HR0 L;  1HNW L;  2LFN A;  1FNU A;  4IUU A;  3CCE A;  5E7N A;  3MXP A;  2NVX H;  3P20 A;  1QWY A;  3PCO B;  5M3M H;  3RZD B;  3KYH C;  1YNJ D;  5J39 A;  3AFP A;  4HMJ A;  2E2J H;  5DEH A;  2ASB A;  2SEB D;  4DA2 A;  2BDO A;  4RG1 A;  2ZXR A;  4C2M H;  1ICF B;  1K8M A;  3CPW A;  3OTO Q;  4DR4 Q;  1SN8 A;  4CKE A;  4DR7 Q;  1JJC B;  4DAM A;  4JV5 L;  1V43 A;  5EPL A;  5FO9 B;  4JI5 L;  3NTI A;  3MVV A;  3M85 A;  4ZKC B;  3J7A V;  2YTX A;  2XSC A;  3IAY A;  4PZ8 A;  2RQX A;  1IBM L;  1WD1 A;  3EJI A;  2UXD L;  2R92 H;  3F8T A;  1RIP A;  3UDF A;  4DK0 A;  3RLF A;  1WTX A;  5KYL A;  5CR3 A;  2TMP A;  1S5C D;  1WVL A;  1FD7 D;  1U4R A;  3JAM L;  3S17 H;  1EFI D;  1TWH H;  2EOT A;  2Z9H A;  5ELF A;  5F2D A;  2CCZ A;  1SE8 A;  2UXC L;  3M7G A;  3RD4 A;  1I4P A;  4XTC S;  4F88 A;  2CH4 W;  1D5M C;  4TRD A;  4WOR A;  4GNX A;  4GN5 A;  1X32 A;  1D1K A;  5FJ8 H;  2A69 C;  1CHQ D;  2QA4 A;  2EXD A;  2F1M A;  2HCC A;  2AMC B;  1SE2 A;  3JAM c;  3Q8D A;  1D7Q A;  2D62 A;  2VB3 X;  4DGZ A;  1GD7 A;  4B3T L;  2B8G A;  5JVH 3;  1PRT F;  1NSN S;  1QIL A;  5C0X H;  1SMY D;  2F3W A;  2I46 A;  3ZJY C;  1F2L A;  5LMN L;  3P1H A;  3RLN A;  3C1F A;  1X6O A;  5CV5 A;  3N52 A;  1NE3 A;  1TQO A;  1E22 A;  2DJG C;  1D5Z C;  1W3S A;  4PQX A;  3CC2 A;  2QF7 A;  1EQV A;  2A19 A;  2OT2 A;  5NUC A;  2NTT A;  1LTG D;  3IFT A;  2F0I A;  1ROD A;  3U4V A;  1HQR D;  2WAC A;  5KYI A;  1MGS A;  2K5N A;  2L55 A;  4ZAI A;  4IFD H;  1T9H A;  2CKZ B;  4HJ5 A;  5LHY 1;  1JC7 A;  1BXT A;  2AQ1 B;  1TY2 A;  2MP1 A;  1M90 C;  3M3Y B;  2NVT H;  1EU4 A;  1HHV A;  3DXJ C;  1LT5 D;  3I4L A;  2JA8 G;  4A3C H;  2Z1C A;  2F0L A;  3TP6 A;  1RTN A;  4H13 C;  3LNN A;  4YWM A;  1STY A;  4CDE C;  1HZC A;  2IHE A;  1EQQ A;  1HJP A;  1PZK D;  2X6G A;  1PFS A;  4KD4 A;  1QVG A;  3RUZ A;  5KNB A;  3D3R A;  1WTW A;  1XNR L;  5LL6 X;  1A63 A;  4QJF A;  1ENF A;  2J0T D;  3K7A H;  3GTK B;  3VDY A;  2C9O A;  5FO7 B;  3D6W A;  2Z4H A;  4L5S A;  3A55 A;  2BA1 A;  4DR5 L;  2JA8 B;  5C6A A;  5TSS A;  1H9S A;  2FXQ A;  3MXN A;  2A5H A;  5C0X J;  2EXZ A;  1SYD A;  1HNZ L;  1PH7 A;  3I4N G;  3ND9 A;  3GTL B;  1TWC H;  5HY6 A;  4B3R Q;  1QNU A;  2IHF A;  3SDZ A;  1R4P B;  1Y1V H;  5KGU A;  2J7Z A;  2Q8T A;  2RSO A;  3MAQ A;  3MWY W;  3A56 A;  2Q2U A;  3J81 j;  2WKC A;  1SE3 A;  1VQP A;  3ONA B;  4YY3 L;  4DUY L;  4G7Z C;  4OON A;  2YU9 B;  4IFD J;  1QVF A;  3I4O A;  1H95 A;  3NUC A;  3HKZ G;  1NR2 A;  3S16 H;  3PV0 A;  1VQ8 A;  1VQI A;  3J80 i;  2JE6 I;  4GKJ L;  2F0J A;  3I4N B;  1MHW C;  2CW0 D;  2PZT A;  1KRT A;  5IOC A;  1K0S A;  2JYO A;  5G3L D;  2BOS A;  1SRU A;  2ZXP A;  4WJ3 M;  3GTQ B;  4A3D G;  1IKL A;  3T1H L;  1R4Q B;  1TR5 A;  2GVB A;  1BCP C;  2NN6 H;  1VQK A;  3S1M H;  1DM0 B;  3FKI G;  5HUR A;  5COY A;  4RGN A;  4AIM A;  2M9V A;  1CZW A;  1L0W A;  4LF7 Q;  5BR8 Q;  4NXN L;  2K5V A;  3G48 A;  2L5T A;  3HKZ B;  5IGG A;  1LT6 D;  5IGD A;  1QE6 A;  2OTJ A;  4ILW A;  1SE4 A;  4QL5 A;  3DMU A;  4M8A A;  4JI7 Q;  2CQA A;  3FMC A;  4PZ7 A;  4LFC L;  3KUP A;  4DAY B;  4LF6 L;  2DNC A;  1B2T A;  3VA5 A;  4A3D B;  2CFM A;  3BG3 A;  3D4D A;  3PUY A;  3FKI B;  5IYD G;  1JWM D;  2MNA A;  4M1U B;  2F0P A;  4DV6 Q;  1JE4 A;  2K1B A;  3A0J A;  1AE2 A;  5GAE C;  5CV7 A;  5IIF A;  1Q12 A;  1EWC A;  3FPU B;  4XQQ A;  1PTO C;  3H0G H;  3I4M H;  1VS0 A;  2X69 A;  1STB A;  3S2H H;  3ITP A;  3FP9 A;  1I6H H;  4LJZ C;  1HR0 Q;  3X3N A;  3I90 A;  1I4X A;  4K8J A;  4KY5 A;  1JT8 A;  4GN3 B;  3C1E A;  1Y1W H;  4X3U A;  3FDT A;  3PO3 G;  5KRU A;  1VMP A;  5IGE A;  2KED A;  1YHA A;  1A3T A;  3VYU A;  3TZU A;  3KDF A;  3GTO H;  4O42 A;  3HOZ H;  1X54 A;  1FGU A;  1HTP A;  2L11 A;  3R2I A;  1YJ9 A;  3H91 A;  4LF8 Q;  4FO2 A;  1BR9 A;  3J81 L;  1OO9 B;  4A3K G;  4NXM L;  2VQF Q;  4JV5 Q;  2HIV A;  4C3J G;  2M00 A;  2PMZ E;  5LMN W;  2ID0 A;  1IXR A;  3CW2 C;  3H3V C;  1IYU A;  1IBM Q;  5DM7 3;  5COR A;  3BDC A;  2UXD Q;  3GTP B;  1M8A A;  1EYD A;  3I73 A;  1IL2 A;  2BE5 C;  1IYV A;  3TDQ A;  2K14 A;  4IUR A;  2Z6B A;  4K5X A;  5K36 G;  4L5R C;  1MBY A;  1HZA A;  1BKB A;  3J81 c;  1EY4 A;  4A3K B;  1JQY D;  5D3D A;  4OGQ C;  2UXC Q;  5H1S E;  1J9O A;  1ESF A;  2DGY A;  2K05 A;  3W1B A;  2JK8 A;  4C3J B;  2JA7 G;  1BQQ T;  5JPM C;  2J4X A;  4IPH A;  3FRP B;  4BY1 H;  4J1M A;  3HGB A;  1U4M A;  4KJN A;  4X3K A;  3MZ5 A;  2PCF B;  1J6Q A;  4S3S A;  3F2D A;  2UUC L;  4RGO S;  1QG7 A;  2EJF C;  2JP1 A;  2XWB B;  1CT1 D;  1I50 H;  3M4Q A;  4XQN A;  4C3H G;  2JA6 H;  1RD9 D;  3IFD A;  1G6Z A;  2EJG C;  4A3F G;  4UAI A;  4B3T Q;  1UEA B;  2EDG A;  3H09 A;  1CA6 A;  1YVC A;  2QIL A;  1FJG Q;  4JI3 L;  4F7X A;  4KN7 C;  2JA7 B;  3E3X A;  1JMC A;  4POF A;  1GHJ A;  3NXW A;  2B39 A;  3S2D H;  3E0E A;  3STB D;  2MUY A;  3Q23 A;  3J7A 5;  1I3Q H;  1EIG A;  4BWG B;  4Q0F A;  4KK7 A;  4UDU C;  3V2T A;  1GJX A;  3TBI B;  4C3H B;  4KHP L;  4ZUJ A;  1Q1E A;  2L0C A;  4A3F B;  3GTJ H;  1LAC A;  1CKO A;  4DKA C;  2LY7 A;  2TSS A;  5A2Q E;  1QVC A;  3T51 B;  3D8G A;  4HCE A;  2IX0 A;  4FNF A;  2E2I H;  1HZ9 A;  1BOS A;  3DM1 A;  4DV7 L;  3IKJ A;  2O2L D;  3JAM i;  1II3 A;  4WJW A;  4APV A;  4QY7 A;  1WCM H;  1XNR Q;  4NPS A;  3ULP A;  4HN7 A;  4HID A;  1U4L A;  3U58 A;  1PHJ A;  2NVY B;  4IOA A;  4NP5 A;  2VUM G;  3MXU A;  1TKW B;  2BCO A;  5D14 A;  5C44 H;  2BDN A;  3M4O B;  1GUN A;  3BZD B;  3KK7 A;  2ENB A;  3J80 E;  1PA6 A;  3BYT B;  4KY7 A;  3KF8 B;  1K73 C;  3K5O A;  1YNN D;  1K28 A;  3A5U A;  4DV4 L;  4OO1 I;  3A54 A;  1EFW A;  1VMC A;  4X6A H;  1RL2 A;  4ZYS A;  2E76 C;  1IKM A;  3S1R B;  5CC4 A;  3UDI A;  4F8M A;  3QWN A;  2L15 A;  1CM9 A;  3ER0 A;  1SNQ A;  4YY3 Q;  4DUY Q;  2VUM B;  1V1Q A;  1CI3 M;  1VQC A;  1X3F A;  2GVA A;  2LXJ A;  5ELD A;  2F0M A;  4GKJ Q;  2JA5 H;  1EWI A;  2PPB C;  1K3B C;  1H9R A;  1EUJ A;  5M5X H;  1W6J A;  3NQI A;  1NMF A;  2E74 C;  3T1H Q;  3WDN A;  5A35 A;  2NUC A;  1T5X D;  2FFK B;  2EYP A;  1EYA A;  1S3O A;  2XRQ D;  4JVZ A;  5C4X H;  2ZTE A;  3HOY H;  1E3P A;  3NBH B;  3Q24 A;  1TWF H;  1Q1B A;  5FLM H;  1Q8I A;  1WTV A;  1TWA H;  1S72 A;  2WAQ E;  1SFO B;  4KTA A;  2OTL A;  3CRK C;  3HOX G;  1TY0 A;  4LF6 Q;  4B9X A;  4BBR G;  1TWG H;  3PUZ A;  2RHQ B;  3A8K E;  3SHL A;  2PQA B;  1ESR A;  4MTK A;  4QB4 A;  2ZJR A;  5C4J B;  1Y69 U;  4KHZ A;  5JEA G;  1G51 A;  3RN2 A;  1YJN A;  3W3A A;  1XTD A;  1KLG D;  4U68 A;  4DUZ L;  2PI2 E;  1P8L A;  2OEO A;  3HKS A;  1PH5 A;  3E9I A;  4IUN A;  1Q46 A;  2K04 A;  1L0X B;  1XWE A;  3BZK A;  4DR3 Q;  1PFN A;  3HOX B;  4OIK A;  3CCR A;  3TSS A;  1B8A A;  3PIP A;  1MJC A;  4BBR B;  1HA6 A;  4X3T A;  1QNK A;  2Z6K A;  3B6Y A;  1NJI C;  2NVQ H;  1BBW A;  1HA5 A;  3OW2 A;  4DR6 L;  4C56 C;  3I70 A;  4QIW E;  2B2T C;  1A0I A;  4P71 A;  4CDC C;  5IYB G;  1SND A;  3LGJ A;  1SYB A;  3KFU A;  4RCN A;  3I91 A;  2HQE A;  2E5L L;  4JG2 A;  1WTO A;  4HIM A;  4FXD A;  2R7Z H;  1MSH A;  4JW0 A;  4JI8 L;  4JPB W;  1PV4 A;  4PMC A;  3MHB A;  2IJ0 A;  2CH4 A;  4WJ4 A;  2PW7 A;  3SGI A;  2VL6 A;  5CV4 A;  4HIO A;  4A3I H;  2A1A A;  1I4Q A;  4TKO B;  3KLS A;  1PH3 A;  2M2L A;  3HRZ C;  1IZ6 A;  4R4Q A;  4V19 0;  1GXD C;  1XYI A;  1HNX Q;  1V1O A; 
#chains in the Genus database with same CATH homology
 4DAY A;  5ELB A;  3BVM A;  1D2B A;  1EEF D;  2F0O A;  5IT9 L;  1CA5 A;  1GUO A;  3D4R A;  1EY7 A;  4CHT B;  5D65 A;  2WIN B;  1F9S A;  2V4D A;  1EYC A;  4CJ1 B;  5EKL A;  1HFG A;  3BYY B;  2D2C C;  4KV6 A;  2SNS A;  1QB5 D;  5ISR A;  1F9R A;  1SYE A;  2F4I A;  2IW3 A;  1TS4 A;  1AZP A;  1SNM A;  1QOH A;  3NK9 A;  3T13 A;  1PRT C;  4DFA A;  1AP0 A;  1O80 A;  2AQ2 B;  1O78 A;  2A68 D;  3UI2 A;  1PTO H;  3JAM E;  1EY9 A;  2HDL A;  1ZEQ X;  2IPK D;  4JBW A;  1TS2 A;  5JJZ A;  1S5B D;  2NVX B;  3GO5 A;  1ENA A;  5M3M B;  1HUN A;  2H4O A;  5G3L F;  3D4W A;  1ENC A;  1SYG A;  3AMU A;  3OMC A;  1ILQ A;  4C2M B;  5IGC A;  1LV9 A;  1EY6 A;  2NBF A;  4IQZ A;  5C4H A;  3C3L A;  1UAP A;  1R9T B;  4BA2 I;  1LTB D;  2R92 B;  1BUV T;  1F2Y A;  3NTH A;  5T1G A;  2RKS A;  1HUM A;  5KIX A;  1JWU D;  3S17 B;  2O5J C;  1TWH B;  3G6J B;  1CK1 A;  5C0X G;  3DEO A;  4DXG A;  2XRS D;  3DHQ A;  1ZKO A;  2KA7 A;  4PNY A;  2NTS A;  2JEB I;  1M4V A;  1ML0 D;  2EVB A;  4N9P A;  5FO8 B;  5I2Y A;  1WTQ A;  1DD2 A;  3MC0 B;  5BN3 A;  1LTT D;  1RKN A;  4RHS A;  4J8Q A;  2AQ3 B;  4XYO A;  4IFD G;  4DXF A;  4P2C B;  1XTC D;  1EY0 A;  4KKU A;  3SEB A;  2ZXO A;  2PYK A;  1STH A;  1KAA A;  1STN A;  3HS0 C;  2WV6 D;  4IAL A;  1GUG A;  2E2H B;  1SNC A;  4I7Z C;  4KY6 A;  2NVT B;  1Z6H A;  3NSW A;  3KF8 A;  1STE A;  1TS3 A;  4IUV A;  1RHP A;  3OSO A;  4KHV A;  4XYQ A;  3VR4 A;  2K28 A;  4R8I A;  1JCK B;  1KNA A;  3URY A;  2Q8R E;  2AWN A;  2HDM A;  1Y8N B;  3EA6 A;  5EKK A;  3T53 B;  1A3V A;  2QEJ C;  4IUQ A;  3K7A B;  3OHX C;  1C48 A;  1VCI A;  3Q0A A;  5I6W A;  1YNN C;  3U9O A;  2JSO A;  1MI2 A;  1A3U A;  4H0L C;  3J7A F;  3PUW A;  2F03 A;  4B08 A;  3KBX A;  5AFW A;  4GZY C;  1TWC B;  2O5I C;  5IOD A;  1F9Q A;  2NN6 G;  4LK1 C;  1I4R A;  2JEA I;  3M4Y A;  1O7L A;  3NBH A;  4XQJ A;  3KLR A;  1CQF A;  1U9R A;  5BN5 A;  4FXG C;  1ONL A;  4RCO A;  3SK6 A;  4OIJ A;  5CMD A;  3S16 B;  3VR6 A;  2IX3 A;  2AWO A;  4KMU C;  3NWT A;  2RBM A;  4EQP A;  3EQL C;  1CTM A;  1KDA A;  3SE0 A;  2IL8 A;  1NR4 A;  3SK5 A;  3S1M B;  3SR1 A;  3QG1 A;  4NW2 A;  1ZYR D;  3QOJ A;  3WOE A;  3H94 A;  1BNZ A;  1HPC A;  4LMQ D;  4PV1 C;  2JXM B;  1EZ6 A;  1AFP A;  3PUV A;  3R93 A;  3OWE B;  5EPJ A;  3J81 E;  1J8I A;  1AW7 A;  1MSG A;  2IWH A;  4K6D A;  1B3A A;  2K01 A;  1TU2 B;  2B2U A;  5BN4 A;  4HAE A;  4ODG A;  4RHR A;  2KQ3 A;  2K32 A;  1KDB A;  3NHH A;  4V0B A;  4L6T B;  1RJT A;  4LAA A;  1PFM A;  3P75 A;  2ICE C;  3H0G B;  3A8I E;  2VNU D;  3I4M B;  4BA1 I;  3RMH A;  1GHK A;  3S2H B;  1I6H B;  1LTA D;  4KI0 A;  1F9P A;  1Y1W B;  2WAQ B;  2RDH A;  3OWF A;  1LTR D;  2PZU A;  1JB3 A;  2F0N A;  2EYJ A;  3GTO B;  3HOZ B;  3Q22 A;  2F0T A;  4J6H A;  1UUP A;  3PO3 B;  2NB0 A;  3GP7 A;  2QDB A;  4XIG S;  4HED A;  5EPK A;  1PFB A;  1S5D D;  2EYH A;  1EOT A;  2B2V A;  1GUW A;  2F0U A;  3K59 A;  5EBC A;  2EJM A;  3NPP A;  1B9M A;  1O7Z A;  2KOL A;  4QIW B;  5JVG 3;  2MPM A;  1S4Z A;  1KDC A;  2KJX A;  3DWP A;  2A6E C;  4AYB B;  2VXW A;  3V05 A;  4BY1 B;  3CU7 A;  1I50 B;  1B9N A;  2FIN B;  1HQM C;  2JA6 B;  2MGS A;  2QKI C;  5K36 H;  1VDZ A;  2A68 C;  4YIJ A;  1G2T A;  3TME A;  1T5E A;  2EZV A;  1YNJ C;  3MEH A;  1HTL D;  1A2T A;  3ZYY X;  1I3Q B;  1OXV A;  5DAU A;  3GV6 A;  3E6Z X;  3DUZ A;  2WKD A;  4RKB A;  5CV9 A;  2OXP A;  1NAP A;  2B2W A;  1Y8O B;  2X6L A;  2E2I B;  3M7N A;  4XT1 B;  1MD2 D;  3MTS A;  1TT2 A;  4FVM A;  5CBA E;  1AZQ A;  3KLS X;  1SYC A;  5ELC A;  1WD0 A;  5DM6 3;  1WCM B;  3BVG A;  3TZD A;  4KD3 A;  1LT4 D;  3LWE A;  5C44 B;  1SJH D;  2B8F A;  5KNC A;  4MHE A;  4U67 3;  3NBI A;  1B4O A;  5D3I B;  4RKL A;  3DWQ A;  3I3C A;  2HCI A;  5KND A;  1UNS A;  3VR2 A;  1SMY C;  3R3O A;  3GV3 A;  1OXU A;  4MN3 A;  2F0D A;  1IL8 A;  1H9K A;  2DN8 A;  2C5C A;  2QCP X;  3R2T A;  1G91 A;  2JA5 B;  4QF4 A;  4DAP A;  4F87 A;  4NKL A;  5T1I A;  3OW7 A;  5M5X B;  5J22 A;  3QOL A;  4X3S A;  3HOY B;  5C4X B;  4FP5 D;  4K14 A;  2MHV A;  3TP5 A;  1B53 A;  2A73 B;  1TWF B;  3PMF A;  1TWA B;  1DON A;  2NWG A;  1TII D;  3CHB D;  3VYR A;  2F3V A;  1OXX K;  1BCP D;  1TWG B;  1JOK A;  2PO4 A;  3DWA A;  4RAU C;  5ELE A;  4CJ0 B;  1LT3 D;  5C4Z A;  5FOB B;  1IHZ A;  1EQT A;  4IN3 A;  5EGT A;  1SJE D;  5I9P A;  4DNR B;  1EL0 A;  2SNM A;  2E2D C;  5EKI A;  5C0X I;  1A2U A;  1PDQ A;  2NVQ B;  2EY5 A;  5IGB A;  2A74 C;  2KHS A;  1PTO D;  1FR3 A;  5JEA H;  4DK1 A;  4IFD I;  1GUS A;  1DOK A;  2CW0 C;  3BDO A;  2R7Z B;  3PUX A;  4O1N A;  4H7B A;  1IW7 D;  4I65 A;  3D6C A;  4A3I B;  2EYF A;  5JAV A;  1A6X A;  4L8J A;  2N88 A;  4FYD A;  4JK1 C;  3R8B A;  3K58 A;  1V1P B;  2AUJ D;  1BCP B;  4HSP A;  2G9H D;  3QIA A;  4EGV A;  1EZ8 A;  2PQE A;  3TP7 A;  4DAV A;  4WFN 3;  1DJR D;  2F0H A;  4HR7 B;  2EYL A;  5FLX L;  2ZT9 C;  4RH6 A;  5M3F B;  1D6E C;  3T4A C;  1KTK A;  1K8O A;  5JEA J;  1STG A;  3EFX D;  1E2W A;  5CGK A;  2F0K A;  4XXE A;  3CQZ B;  1PXU A;  3BS1 A;  4OO1 H;  1PTO B;  5HGT A;  1JR0 D;  1X3P A;  3OIP A;  2CHB D;  5JPN C;  3DEP A;  2NN6 I;  1SNP A;  1DYQ A;  1RF2 D;  2E2J B;  3FPP A;  1L0Y B;  2F0G A;  1SAP A;  2PZW A;  4KKT A;  2OF1 A;  4RA8 A;  1WTP A;  1JOR A;  5FK9 C;  3A7A B;  2LMC B;  3S15 B;  4IUT A;  5E3F A;  2B2Y C;  3OOC A;  1F2M A;  4Q5V A;  2Y0S B;  2FMM A;  3HOU B;  3C2P A;  1I4G A;  2DY8 A;  1EY5 A;  2EY6 A;  5JOB A;  1TVX A;  4QUF A;  4B9W A;  4ZLT F;  3K0Y A;  4K2K A;  4EQO A;  5I4D A;  4K6L A;  4Y7N B;  4RWS C;  1DXM A;  3K5M A;  2PMZ B;  4XT3 B;  3ERQ A;  2D9U A;  4C3I G;  4IZ8 A;  3A7L A;  3F2U A;  1RCV D;  3P7J A;  1FYC A;  3BVZ A;  3MFG A;  2RA4 A;  4CJ2 C;  2EPB A;  4K5W A;  3U9S A;  3AB9 A;  4A93 B;  2B2Y A;  3EVQ A;  1Z47 A;  3N6R A;  3L9A X;  2DNE A;  4C3I B;  4G4K A;  4OL7 A;  1U4P A;  1SBB B;  2EY2 A;  4FF2 A;  1HCZ A;  1EY8 A;  2L9H A;  4OHJ A;  1I4H A;  4EQN A;  1S5E D;  3PIP 3;  1NCV A;  5CV8 A;  5CBE E;  1BDO A;  4HTH A;  1PZI D;  3TP8 A;  3SK4 A;  4CBV A;  1E2Z A;  1RTO A;  2B2U C;  1JOO A;  4R8N A;  3LWU A;  1XX8 A;  1JWS D;  3C46 A;  3J7Y W;  1Y1V B;  3E0J A;  1Y8P B;  1ZXT A;  1Z7T A;  4K2L A;  1H9M A;  3HOV B;  1SDF A;  1V8Q A;  1GUT A;  3GTM B;  2K5W A;  3IL8 A;  2EY1 A;  4C1N I;  3K5N A;  4K8I A;  2A6H D;  4C1N K;  1NUC A;  3CRL C;  5LL6 S;  3RZO B;  1ILP A;  2IX1 A;  2HUG A;  1WTR A;  3MA2 B;  2E75 C;  3D31 A;  2B2V C;  4A3E B;  1B44 D;  4DNT B;  4IUP A;  1GOZ A;  5FKA C;  5I6Y A;  2B63 B;  4PMB A;  3I8Z A;  4ULL A;  3NWS A;  4RGT A;  2R93 B;  5C3X A;  4FF3 A;  1LTI D;  2L12 A;  2N55 A;  4ID6 A;  2F0V A;  1AN8 A;  1B1Z A;  1SEB D;  5K5P A;  5EBD A;  4HSV A;  3G7L A;  3L3O C;  4TQU S;  2RSN A;  4NMZ A;  1FNV A;  4KJO A;  1O7Y A;  1OXS C;  3QB3 A;  4ZKB B;  2L4N A;  1PRT D;  4ME5 A;  2K7V A;  2K5Q A;  5M9O A;  1IW7 C;  1BBX C;  4RGM A;  4E6I A;  1V1P A;  1CFM A;  2Q8I B;  5E4X A;  4R9W A;  1HRJ A;  2GA4 B;  1KAB A;  2EYO A;  2XIW A;  1I6V C;  3W2D A;  4RFB A;  1DOL A;  1TS5 A;  3KBG A;  2B2W C;  1BCP F;  4DF7 A;  3O13 A;  3VR3 A;  1CQV A;  5CV6 A;  3S1N B;  2LKV A;  4QMG A;  2AUK A;  1EEI D;  2KEC A;  2R6G A;  1HXY D;  2MJ8 A;  1D1I A;  1SSO A;  3T56 B;  4L63 B;  5I2X A;  4A3G B;  1Q3L A;  2F0F A;  4EVO A;  2KUM A;  3OIQ A;  4DU9 A;  1KNE A;  1ET6 A;  2XVS A;  4CKC A;  4PMW A;  3BDL A;  2FJ2 A;  1A15 A;  3GQB A;  1Q90 A;  4HMI A;  4BBS B;  2A69 D;  2NYZ D;  3FVQ A;  3MXG A;  5EQ0 A;  3A8J E;  1B50 A;  2Z4I A;  1PTO F;  3S2D B;  1F2Z A;  3TN2 A;  1KLU D;  1JIC A;  1STA A;  2K33 A;  1PRT B;  2PW5 A;  3HEJ A;  1ET9 A;  3GTJ B;  2L1B A;  4TSS A;  1OXT A;  1D5X C;  2FHT A;  1XXG A;  3VA7 A;  1SXT A;  1K83 B;  2D5D A;  3QJY A;  1DOM A;  3SVM A;  2FMC A;  3LX0 A;  4QCL A;  4CGY B;  2ICI A;  2H1E A;  2CVR A;  4ZQ3 A;  4Z9C B;  2DY7 A;  1C4Q A;  1E2V A;  2RDF A;  3HZX A;  1CZG A;  3AU7 A;  2SOB A;  3SK8 A;  4WRD A;  2F0Q A;  4ZUI A;  2VB2 X;  1E0B A;  5M5W B;  5IGF A;  3MFY A;  3PIO 3;  3GTG B;  3H6M A;  1CHP D;  2WP8 J;  5A2Q L;  4KKS A;  2PNR C;  4MIU A;  4G7H C;  2F0W A;  2G9D A;  1FNW A;  3OPO A;  5C3E B;  2K03 A;  1H9S B;  4H44 C;  1LAB A;  3NE5 B;  3SXH A;  2I07 B;  5DNF A;  5EJW A;  3VYS A;  2R3Z A;  4K5V A;  1H9J A;  2LS0 1;  3HOW B;  3L7Z C;  1RDP D;  1S5F D;  2R61 A;  2KCN A;  1LO5 D;  3WOF A;  3K57 A;  2EYM A;  3J80 L;  1PLF A;  4QUC A;  3HG9 A;  5E4W C;  5CYU A;  3V96 A;  2NZ1 D;  4BY7 B;  1C8C A;  1ICW A;  4XDX A;  1PZJ D;  1AEX A;  1G8Z D;  3PO2 B;  3K5L A;  1EU3 A;  1G2S A;  2IT1 A;  4N9T A;  2YYZ A;  3QO2 A;  2K6A A;  3VYT A;  3HP3 A;  5IT9 E;  1DZ1 A;  4A3J B;  1HFN A;  2RDG A;  4KN4 C;  1W6K A;  1SNO A;  3T16 A;  1EWH A;  1JOQ A;  4NDX A;  2EE1 A;  3VR5 A;  1SYF A;  4ABN A;  4FF1 A;  1QJO A;  5E1F A;  4A3B B;  3FEW X;  4G7O C;  3OMG A;  5FLX E;  3CKI B;  3ND8 A;  2F0E A;  2K5D A;  2A6H C;  5J1Z A;  3S14 B;  3NQT A;  1ZYR C;  2XWJ B;  2XNA C;  2KVM A;  3NTK A;  5C3W A;  2KCC A;  2KEE A;  3K6O A;  3S9W A;  5C5L A;  4G57 A;  1LLR D;  2XN9 C;  3I72 A;  4ZK9 B;  1X3Q A;  5I9O A;  4HCS A;  2SDF A;  2BE5 D;  3GD7 A;  4BS9 A;  1F77 A;  1PYW D;  4DN4 M;  1BF4 A;  4FF4 A;  4ZRZ A;  3NP8 A;  2WII B;  1BO0 A;  2O4X A;  1VF5 C;  2BA0 A;  1FGB D;  5M5Y B;  4OO1 G;  3X3M A;  3E5S A;  1DCZ A;  4A3M B;  2A6E D;  1PMR A;  1EIH A;  5KEE A;  4FXK C;  2B2T A;  5C5M A;  2RVL A;  1LTS D;  3S1Q B;  3ERO A;  2F0S A;  2WB1 B;  1QCB D;  2Z8L A;  4CKB A;  3Q6S A;  1G29 1;  1VF7 A;  2LFN A;  1FNU A;  4IUU A;  3MXP A;  3P20 A;  1QWY A;  3RZD B;  1YNJ D;  5J39 A;  4HMJ A;  5DEH A;  2SEB D;  4DA2 A;  2BDO A;  2ZXR A;  1K8M A;  4CKE A;  1V43 A;  5EPL A;  5FO9 B;  3NTI A;  3MVV A;  3M85 A;  4ZKC B;  3J7A V;  2XSC A;  3IAY A;  2RQX A;  1WD1 A;  3EJI A;  4DK0 A;  3RLF A;  1WTX A;  5KYL A;  5CR3 A;  2TMP A;  1S5C D;  1WVL A;  1FD7 D;  1U4R A;  3JAM L;  1EFI D;  2EOT A;  5ELF A;  5F2D A;  3M7G A;  3RD4 A;  1I4P A;  4XTC S;  4F88 A;  1D5M C;  4TRD A;  4WOR A;  1X32 A;  1D1K A;  2A69 C;  1CHQ D;  2F1M A;  2HCC A;  1SE2 A;  2D62 A;  2VB3 X;  4DGZ A;  2B8G A;  5JVH 3;  1PRT F;  1NSN S;  1QIL A;  5C0X H;  1SMY D;  2F3W A;  2I46 A;  1F2L A;  3P1H A;  3C1F A;  5CV5 A;  3N52 A;  1TQO A;  1D5Z C;  4PQX A;  2QF7 A;  1EQV A;  2OT2 A;  5NUC A;  2NTT A;  1LTG D;  3IFT A;  2F0I A;  1ROD A;  1HQR D;  2WAC A;  5KYI A;  1MGS A;  4IFD H;  2L55 A;  4ZAI A;  5LHY 1;  1JC7 A;  1BXT A;  2AQ1 B;  1TY2 A;  2MP1 A;  3M3Y B;  1EU4 A;  1HHV A;  3DXJ C;  1LT5 D;  3I4L A;  2Z1C A;  2F0L A;  3TP6 A;  1RTN A;  4H13 C;  3LNN A;  1STY A;  1PZK D;  2X6G A;  4KD4 A;  3RUZ A;  5KNB A;  3D3R A;  1WTW A;  5LL6 X;  1ENF A;  2J0T D;  3GTK B;  2C9O A;  5FO7 B;  3D6W A;  2Z4H A;  3A55 A;  2BA1 A;  2JA8 B;  5C6A A;  5TSS A;  1H9S A;  3MXN A;  2A5H A;  5C0X J;  2EXZ A;  1SYD A;  3ND9 A;  3GTL B;  1QNU A;  3SDZ A;  1R4P B;  5KGU A;  2J7Z A;  2Q8T A;  2RSO A;  3MAQ A;  3MWY W;  3A56 A;  2WKC A;  1SE3 A;  3ONA B;  4G7Z C;  2YU9 B;  4IFD J;  3NUC A;  1NR2 A;  3PV0 A;  2JE6 I;  2F0J A;  3I4N B;  2CW0 D;  2PZT A;  5IOC A;  2JYO A;  5G3L D;  2BOS A;  2ZXP A;  3GTQ B;  1IKL A;  1R4Q B;  1TR5 A;  1BCP C;  2NN6 H;  1DM0 B;  5HUR A;  5COY A;  4RGN A;  2M9V A;  1CZW A;  3HKZ B;  2L5T A;  5IGG A;  1LT6 D;  5IGD A;  1QE6 A;  4ILW A;  1SE4 A;  3DMU A;  4M8A A;  2CQA A;  3FMC A;  3KUP A;  2DNC A;  1B2T A;  3VA5 A;  4A3D B;  3BG3 A;  3D4D A;  3PUY A;  3FKI B;  1JWM D;  4M1U B;  2F0P A;  1JE4 A;  2K1B A;  5CV7 A;  5IIF A;  1Q12 A;  1EWC A;  3FPU B;  4XQQ A;  1PTO C;  2X69 A;  1STB A;  3ITP A;  4LJZ C;  3X3N A;  3I90 A;  1I4X A;  4K8J A;  4KY5 A;  3C1E A;  4X3U A;  3FDT A;  5KRU A;  1VMP A;  5IGE A;  2KED A;  1A3T A;  3VYU A;  3TZU A;  4O42 A;  1HTP A;  2L11 A;  3R2I A;  3H91 A;  4FO2 A;  1BR9 A;  3J81 L;  1OO9 B;  4C3J G;  2M00 A;  2ID0 A;  3H3V C;  1IYU A;  5DM7 3;  5COR A;  3BDC A;  3GTP B;  1M8A A;  1EYD A;  3I73 A;  2BE5 C;  1IYV A;  3TDQ A;  4IUR A;  5K36 G;  4K5X A;  1MBY A;  1EY4 A;  4A3K B;  1JQY D;  5D3D A;  4OGQ C;  1J9O A;  1ESF A;  4C3J B;  2K05 A;  1BQQ T;  5JPM C;  2J4X A;  3FRP B;  4J1M A;  3HGB A;  1U4M A;  4KJN A;  4X3K A;  3MZ5 A;  2PCF B;  4S3S A;  4RGO S;  1QG7 A;  2EJF C;  2JP1 A;  2XWB B;  1CT1 D;  4XQN A;  4C3H G;  1RD9 D;  3IFD A;  1G6Z A;  2EJG C;  4UAI A;  1UEA B;  2EDG A;  3H09 A;  1CA6 A;  2QIL A;  4F7X A;  4KN7 C;  2JA7 B;  1GHJ A;  3NXW A;  2B39 A;  2MUY A;  3Q23 A;  1EIG A;  4BWG B;  4Q0F A;  4KK7 A;  4UDU C;  3V2T A;  1GJX A;  3TBI B;  4C3H B;  4ZUJ A;  1Q1E A;  2L0C A;  4A3F B;  1LAC A;  2LY7 A;  2TSS A;  5A2Q E;  3T51 B;  3D8G A;  4HCE A;  2IX0 A;  4FNF A;  1BOS A;  3DM1 A;  3IKJ A;  2O2L D;  1II3 A;  4WJW A;  4HN7 A;  1U4L A;  2NVY B;  4NP5 A;  3MXU A;  1TKW B;  2BCO A;  5D14 A;  2BDN A;  3M4O B;  1GUN A;  3BZD B;  3KK7 A;  2ENB A;  3J80 E;  3BYT B;  4KY7 A;  3K5O A;  1YNN D;  4OO1 I;  3A54 A;  1VMC A;  4ZYS A;  1IKM A;  2E76 C;  3S1R B;  5CC4 A;  4F8M A;  3QWN A;  1CM9 A;  1SNQ A;  2VUM B;  1CI3 M;  5ELD A;  2F0M A;  2PPB C;  1H9R A;  1W6J A;  3NQI A;  2E74 C;  3WDN A;  5A35 A;  2NUC A;  1T5X D;  2FFK B;  2EYP A;  1EYA A;  2XRQ D;  3Q24 A;  1Q1B A;  1Q8I A;  1WTV A;  1SFO B;  4KTA A;  3CRK C;  1TY0 A;  4B9X A;  3PUZ A;  3A8K E;  3SHL A;  1ESR A;  4QB4 A;  5C4J B;  1Y69 U;  4KHZ A;  5JEA G;  3W3A A;  1KLG D;  4U68 A;  2OEO A;  4IUN A;  2K04 A;  1L0X B;  1XWE A;  1PFN A;  3HOX B;  4OIK A;  3TSS A;  4BBR B;  1HA6 A;  4X3T A;  1QNK A;  1HA5 A;  4C56 C;  3I70 A;  2B2T C;  1SND A;  1SYB A;  4RCN A;  3I91 A;  2HQE A;  1WTO A;  4FXD A;  1MSH A;  4PMC A;  3MHB A;  2IJ0 A;  2PW7 A;  5CV4 A;  4TKO B;  1I4Q A;  3KLS A;  2M2L A;  3HRZ C;  4V19 0;  1GXD C;  1XYI A;  1V1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...