2E5LL

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
total genus 9
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e5lL00
3CCJA 2A1AA 2FXQA 2Q2IA 4DUZQ 2CQOA 3TREA 4HIDA 2CWAA 4QJFA 4DR3L 1SE8A 1MKHA 1A0IA 5BR8Q 1QVFA 3TS2A 4DV2L 3HFZB 2HQLA 2JE6I 1TWFH 2PI2A 4H02A 3W1BA 4DR1Q 4GKKL 1AH9A 1A62A 5ELNA 4A3JH 3J7A5 1TXYA 4LFCQ 2IHEA 2OWOA 5M5WH 2MFIA 2IX1A 2VZAA 2YTYA 2L15A 3GDEA 1BKBA 5IT9c 4GNXA 2F52A 1XPUA 3A0JA 1L1OB 3J81c 2Q2HA 1L2FA 4YCUA 4A3CG 3PUYA 1X6OA 3DLLA 2E8GA 4DV1Q 1VQPA 1YJWA 3AYHB 4OX9Q 4EX5A 1JT8A 1Z47A 1PH8A 4B3SQ 3KJPA 3D31A 2RHQB 4DV0L 4A75A 4KI0A 1VQ7A 1LM0A 2UUCQ 3G48A 4YY3Q 1XNRL 5IE8A 4LUVA 3J81j 2UXBQ 3S1MH 1UE6A 5IYDG 4DV3L 4A3GH 1VQOA 2UXDL 1QVCA 1EFWA 1VQLA 4L5SA 3T1YQ 2PQAA 3H15A 2UUBQ 1YVCA 3MXNB 4POFA 4DV7L 3PO2G 1I94L 3RZDH 1VQ6A 4IJHA 2K14A 1JJ2A 2UUAQ 2KENA 1KL9A 3KDFB 1X65A 1YHBA 1HR0Q 2E2HH 2ZM6Q 1Y1WG 1G291 3PUWA 4HJAA 1KIXA 5IYCG 1Y14B 3GTMH 3I4OA 2K75A 1K8AC 4QL5A 1UE7A 1CKNA 1HZAA 1TWCH 3EIVA 5FLMH 4BY1G 1X54A 2MNAA 3FKIH 4X66L 4Y52H 3CXCA 3NENA 4YCVA 4DAYB 4LF5L 3GO5A 3CMEA 3RZOH 4A3BH 5C3EG 3HOXH 4JI8L 4JV5L 2LXJA 3KF8B 2JA6G 1JJGA 2K50A 3FP9A 4A3EH 4P73A 2MQHA 4MTNA 1NBWA 5M3FH 1HZ9A 5LMUL 1HR0W 1EQRA 1TWHH 2R7FA 2N78A 3BU2A 3BJUA 3J80i 1KRTA 1XPRA 1XNQL 3GTLH 4A3LG 4IFDI 4X64Q 2B63G 5HY6A 3UE0A 4LF6L 1WFQA 4EQ5A 4K0KQ 3H0GH 4A3DG 4BBSG 1VQBA 1KQSA 3M4QA 1VQDA 4JI3L 1I5FA 1X56A 4JI1Q 1HH2P 4AYBE 3JC66 4C2MH 4LFBL 1YJ9A 4GN4B 1SR3A 4DR7L 5M3MH 3Q8DA 2VNUD 1GKHA 2KHIA 3CC2A 2AMCB 1OXTA 1XJVA 3CCLA 3EN2A 4B3TL 3I56A 4KHPQ 1U0LA 1M1KC 1UEBA 2CKZB 2UXCL 5IYBH 5JJKA 2VQEL 2JA7G 2Y0SG 3GTOH 1PH6A 1WJJA 3W5OA 3KF6A 3HOYG 1D7QA 1JMCA 2ASBA 4DR2Q 2R7ZG 1E1OA 3A74A 3W1GA 2ALYB 4DK6C 3OW2A 1HNZQ 1NJIC 1V43A 4GKJL 4OO1G 4BA1I 4IOAA 1J5EL 3HOVH 5C4JH 1C0AA 2Q2TA 5LMNQ 2WB1E 3PF5A 1GO3E 4WJ4A 3CCEA 4PZ6A 1MJCA 4KHZA 3S15H 2AHOB 4YWLA 1Q46A 3F2BA 1HNXL 1HNWQ 2MO1A 5JEAG 5IP9G 3MEFA 3TS0A 4A93G 3G71A 4DK3C 4C3JH 1HZBA 4RG1A 5FJ8G 1TWAH 5FLXc 2NZHA 3E9IA 3JAMi 3HKSA 1VS0A 2Q2UA 4JI4Q 3TRZA 1S40A 1XMOL 1N36L 2XGTA 4X65L 4A76A 4DR6L 4JOIC 1N32Q 1QZGA 4C3HH 4GOPA 3HOWG 1S3OA 1EUJA 1PYSB 4DV6Q 2UU9Q 4JI0Q 4LF7Q 1FJGL 2MO0A 1QUQB 3L0OA 5EAYA 1YZ6A 4P75A 2ZTEA 4JI7L 4LF9L 4NXMQ 4QQBX 1H95A 1PHJA 3CAMA 5LMNW 3A5UA 3T1HQ 2JJQA 1IBKQ 4LF8Q 4OO1I 4P74A 1W2BA 3VDYA 3M7NA 2JEBI 3M9BA 4DR1L 5C44H 3KJOA 4IO9A 2N3SA 1O7IA 3RN5A 5JEAJ 3K0XA 1KHIA 4JCVE 4LFCL 1OTCA 1TWGH 3STBD 4YWKA 4DV4Q 2NVTH 3K7AH 4DV5Q 4DR4Q 4OWTB 4DUYL 3E9HA 4R4IA 2QGQA 4YHHQ 3I4NG 4BXXG 4R4OA 1EQQA 1EYGA 2K5NA 4WJ3M 3G4SA 1PYBA 2YTXA 3ULJA 1Q8KA 1XMQQ 4OWWB 3CF5A 3FHWA 4GLAC 1N33L 2H5XA 4QY7A 4A3CH 3NELA 3UDGA 4OX9L 2WAQG 1X55A 4ME3A 4O2DA 4HIOA 4A3KH 1KC8C 2CWPA 5JJIA 1PV4A 3ER0A 4L5TA 1I3QH 5GROA 5H1SE 2NZOA 3CCQA 2UXBL 2PI2E 4APVA 4BA2I 3KFUA 1Q1EA 3PSIA 4DR3Q 2R92G 1E22A 1HZCA 1V9PA 4DV2Q 3K81C 1UWVA 3PGZA 1P8LA 3EBEA 4A3JG 2YTVA 1HR0L 2ZM6L 4IFDG 1Y1WH 2Z6KA 2QEXA 5AJ3L 2GN5A 1Q82C 5IYCH 1LUZA 4UY8C 1EOVA 4BBRG 4ALPA 2E2JH 3TQYA 4OWXB 4HJ7A 4JI2Q 4GNXC 3AEVA 1X3GA 1K3RA 4B3ML 2IY5B 2NVQH 5J3BA 1K0RA 4GNXB 1Q7YC 3PO3G 3H3VH 1FVIA 5C3EH 1PH2A 1A8VA 2I0QA 4DR5Q 4LUOA 4MNOA 3NEMA 1LTLA 4DV0Q 1XNRQ 2VUMG 3S2HH 4LF4Q 1K8GA 2R93H 1K83H 4A3LH 2K52A 4X64L 4DV3Q 2VW9A 2F3IA 5JJLA 2OCEA 2UXDQ 3S16H 4XTCS 2F4VL 2CFMA 3UDXA 3J7ZC 1SRUA 4K0KL 4IFDJ 1IL2A 3HOUG 2A8VA 4BBSH 2I5MX 1I94Q 4A3DH 1B70B 3OTOL 3CCSA 4P72A 2PQAB 4A3MG 1AE3A 5M5YH 1EIYB 3HOZG 4HJ9A 2CCZA 1CKMA 1X3FA 3CW2C 3PCOB 2NVXH 3UDIA 1T9HA 4IPGA 2ZTDA 4P71A 3I7FA 3FKIG 3J81i 1M90C 3PV0A 4X66Q 2VY3A 4OONA 1CKNB 4GLXA 1MJEA 1SN8A 2VUMH 4GS3A 2JA8H 2E5LQ 4LF5Q 5IP7G 1PH4A 1Q12A 4LFAL 4A3BG 1VQFA 1YNXA 1CSQA 1X9NA 4KHPL 4JV5Q 4HIMA 4JI8Q 3GTGH 2WB1G 3I4MH 2KCMA 3S14H 3CPWA 4A3EG 2JEAI 3M3YH 1V1QA 2JA7H 1G51A 4UP7A 3HOYH 1CUKA 1E1TA 4C3IH 5LMUQ 1XNQQ 2K5VA 1VQ5A 3ZJYC 3HKZG 3I2ZA 2ZJPA 3CCRA 1ASYA 4L5RC 1SLJA 4R4QA 4NXNQ 2R6GA 4LF6Q 1YEZA 3F1ZA 5GADC 3NBHB 1PH5A 3S1RH 1VQIA 2VQFL 2JA5G 4POGA 2JQOA 3S17H 1U5KA 1SROA 5IWAL 1HNWL 2K5HA 2BH8A 1SMXA 5IP9H 3F2CA 2YV5A 3F2DA 2KBNA 4GN3B 4RMFA 2VS1A 4JC0A 3CCVA 2HIVA 3PIOA 3M4OH 4DR7Q 3UE1A 3K8AA 1XTDA 1E24A 4PZ8A 4B3RL 3SGIA 5HGQA 1Y1VH 4JI6L 1YJNA 1N32L 4JI5Q 4AQYL 4A3IH 3LGJA 2WFWA 4X62L 2HHHL 1XPOA 1PH3A 1OXUA 2IHFA 1WYDA 3KLWA 2UXCQ 1IBMQ 1WCMG 5C0XI 2VQEQ 4A3FG 5K36G 3S2DH 1G6PA 4TQUS 1VQ8A 4JYAL 2EXDA 2OQ0A 4PG3A 3GTQH 3KF6B 4GKJQ 2Z0SA 3G6EA 2OQKA 4GN5A 4DUZL 1J5EQ 3HOVG 4IJLA 5BR8L 2RCNA 1JJCB 2D62A 4R1JA 5GAGC 1Q81C 1EWIA 2C35B 1QVGA 1B7YB 5M5XH 2YU9H 3F8TA 4DV4L 3BZCA 4DR4L 4DV5L 3PUZA 1J6QA 1HNXQ 3I4NH 1N34Q 3GTPH 1KXLA 2LSSA 3D0FA 1L1OA 5C4XG 2ES2A 3PIPA 1E7ZA 1N36Q 2DUDA 4X65Q 4DR6Q 1VQNA 4HIKA 2ZJRA 1ASZA 2EQSA 2D0PA 4GOPC 3K7UC 1FJGQ 4HJ5A 1N9WA 4DNIA 4BY7G 4JI7Q 1SFOH 4LF9Q 4GOPB 1IBLQ 4DV1L 1FGUA 1PFSA 2KCTA 4J15A 2GVAA 1RIPA 4B3SL 3CQZH 2UUCL 1NTGA 2R92H 4KLKA 3PF4A 3S24A 4DAMA 4YY3L 4YCWA 3S1QH 5C44G 3J80c 2I5HA 3U50C 5IYDH 3AFPA 4NPSA 1N8RC 1I50H 3KDFA 3T1YL 3PUXA 2UUBL 3I55A 1IXRA 4QGUA 1YHAA 2ID0A 3PO2H 3CD6A 4GKKQ 2DGYA 2UUAL 4DUYQ 3PUVA 4BBRH 1L1OC 2E2IH 3RN2A 4XIGS 4JI2L 1LYLA 3U4VA 1JE5A 2JK8A 2WP8J 2I5LX 1MIUA 5DLQE 4BY1H 2LXKA 1VQ4A 1N33Q 4LUZA 3PO3H 5E7NA 5IY0A 2PNHA 2HIXA 4MZ9A 4R4CA 3L2PA 4O0AA 1NMFA 2BA0A 4A3KG 2RF4A 4TVAB 3OYYA 4DR5L 3GTKH 2A19A 2HT1A 4LWCA 1I6HH 4LF4L 2K4KA 4IOCA 2JA6H 3KYHC 3ERSX 1YI2A 4AYBG 1VQMA 2BA1A 1VQJA 2ZTCA 3GTJH 1K9MC 4IPHA 3U4ZA 2RHSB 3HOUH 2B63H 1VQGA 4PMWA 4A3GG 2IX0A 1IYJB 1VQEA 1NY4A 2WAQE 3S1NH 4A3MH 1RL2A 2XTIA 3CC4A 3HOZH 4NB3A 5AJ3Q 4DV7Q 1W3SA 2Z6KC 4JG2A 3M85A 1OXXK 3AFQA 3IRBA 2KHJA 3RNUA 2B3GA 3ULPA 1KD1C 4JI1L 4UP9A 4IPCA 2NN6G 4YWMA 4HJ8A 4B3MQ 3CP0A 2JA9A 3DM3A 1JB7A 5FLMG 1VQKA 4PZ7A 2E5LL 3M4PA 4QIWE 1X3EA 5IP7H 1E3PA 4UP8A 1Z9FA 4A4IA 3JAMc 1YIJA 2AWNA 1YBYA 1QZHA 2AWOA 2N49A 5GAEC 4FDBA 2OTJA 1VQHA 3HOXG 1UE1A 2PMZE 1BBWA 1VCIA 5GAHC 5M3FG 4NXNL 1FL0A 1YHQA 2F4VQ 3CMAA 1IZ6A 2QA4A 5C0XG 1K73C 4DR2L 2JA5H 1GVPA 4LNQA 2R7ZH 1HNZL 3CCUA 3OTOQ 2EIFA 3H0GG 4DKAC 1A63A 5LMNL 2D0OA 3BZKA 2NN6I 1HJPA 3KOJA 1L0WA 4OXPA 1AE2A 4JI3Q 4Y7NH 1D8LA 4LFBQ 2VL6A 3U58A 1GD7A 3RLOA 4A93H 1OXSC 1PH9A 3H3VI 5FJ8H 3WWVA 2JA8G 4JI5L 5M3MG 3L7ZC 4LFAQ 4JI4L 2YYZA 2BH2A 3E0EA 2N8NA 4JBJA 4JOIA 3I4MG 1QUQA 4AH6A 2R93G 1BVSA 3HOWH 1IBML 2UU9L 4DV6L 1WCMH 4B3TQ 1B8AA 4A3FH 1YITA 4JI0L 3CCMA 4LF7L 1GM5A 5ELOA 4JBMA 4NXML 1VQAA 3CPFA 5IYBG 5C0XJ 4IPDA 4AIMA 3AQQA 3T1HL 1IBKL 4R4TA 4LF8L 2ZJQA 3RR5A 2AKWB 1NE3A 2NVYH 2VQFQ 1KAWA 3UDFA 1EIFA 1C7YA 4X6AH 1WOCA 3TEHB 5IWAQ 4GLVB 1BBUA 4JBWA 1Q1BA 1N34L 2OTLA 1KRSA 3GD7A 1P16A 3HKZE 2Y0SE 4LW1A 1VQ9A 1UE5A 1R9TH 4YHHL 3B6YA 4BXXH 5C4XH 3ICEA 5GQOA 1CSPA 1Y1VG 2B29A 4L5QA 3RLFA 4JI6Q 4B3RQ 2GVBA 1VQCA 1S72A 1NMGA 1XMQL 4DPGA 4AQYQ 3A5ZB 4A3IG 1XMOQ 3STBC 1CKOA 4X62Q 3ULLA 2HHHQ 1C9OA 4JBKA 4BY7H 1PA6A 1IBLL 1PH1A 1Q86C 2ATWA 1DGSA 1OXVA 2V1CC 3K80C 3RLNA 3CC7A 1PVOA 2R7DA 1PH7A 4JYAQ 4UPAA 2IT1A 1WI5A
chains in the Genus database with same CATH superfamily
1VF7A 2FXQA 1TQOA 4JW0A 1X32A 3K6OA 5BR8Q 3EVQA 4Y7NB 4DV2L 2EY6A 1QB5D 4I7ZC 1TWFH 1AH9A 2EXZA 3J7A5 4J8QA 2R3ZA 1A6XA 3A7AB 1TT2A 1WCMB 2F1MA 2F52A 3J81c 2N55A 2Q2HA 1JWSD 2HCCA 3DLLA 5KNDA 1YJWA 2ZXPA 4EX5A 2NVYB 3OIPA 1Z47A 1PH8A 3KJPA 3S15B 4DV0L 5EQ0A 2VUMH 4S3SA 5A2QL 5IE8A 2UXBQ 3S1MH 1LTID 4A3GH 2UXDL 1QVCA 3T1YQ 2UUBQ 1YVCA 4ZUJA 4POFA 3RZDH 1VQ6A 1YHBA 2ZM6Q 3H6MA 4HJAA 1KIXA 1B4OA 3I4OA 2D5DA 4QL5A 2MNAA 5KRUA 3D8GA 4EQOA 1LO5D 1SNDA 4JI8L 2K50A 3FP9A 1TWGB 5E4WC 3SE0A 4P73A 2Z8LA 1TWFB 4MTNA 4A3EH 2L4NA 5LMUL 3TP8A 3BU2A 3J80i 2R93G 2N78A 3BJUA 4DNTB 1XPRA 4IUUA 3EFXD 2B63G 4GZYC 1ML0D 3K5OA 4K0KQ 4NMZA 1B44D 1VQBA 1KQSA 1VQDA 4K14A 1D5MC 4AYBE 4C2MH 2OF1A 4FXKC 3CKIB 2VNUD 1IKMA 1OXTA 1ESRA 3T56B 3TP5A 3S1MB 2HCIA 3I56A 4A3GB 1U0LA 1PH6A 1WJJA 3HOYG 3KF6A 3VYTA 1JMCA 1L0XB 4NP5A 2ASBA 2R7ZG 1CFMA 1E1OA 3OW2A 1NJIC 2EYMA 4BA1I 1FYCA 5LMNQ 1I4GA 1GO3E 4CDDC 5JEAG 3TS0A 3MEFA 1SMYD 3SK6A 1HZBA 4RG1A 5FJ8G 1DOKA 4Z9CB 2HUGA 3JAMi 2WB1B 1XMOL 1N36L 2G9HD 4GOPA 3HOWG 3OWEB 3C1EA 5EJWA 4DF7A 1QUQB 1YZ6A 1H95A 5IGFA 3T1HQ 3ERQA 2EE1A 1XYIA 2A69C 1PDQA 3ONAB 4C2MB 4DR1L 3V05A 4IO9A 4DXGA 4XXEA 3AU7A 1ICWA 3QIAA 4DR4Q 4DV5Q 1MSHA 4DUYL 3GTGB 3I72A 1EQQA 5NUCA 1PYBA 5JVH3 4OWWB 2RBMA 2F3VA 3FHWA 2Z9HA 2H5XA 2RVLA 1R4PB 2B2WA 3UDGA 1YNND 2B2UC 5AFWA 4OX9L 2WAQG 1X55A 3FPUB 4ME3A 4O2DA 4A3KH 2CWPA 1PV4A 3ER0A 5H1SE 4X3UA 4CJ2C 3KFUA 3PSIA 1NR4A 3M4OB 4TRDA 4KY6A 2NB0A 4C1NK 5I9OA 3K81C 1P8LA 3EBEA 2M9VA 4UY8C 1NAPA 4HCSA 4ALPA 4OIKA 2NN6H 3TBIB 1K0RA 1EZ8A 1A2TA 3BYYB 3R93A 3H3VH 2Z4HA 1SBBB 2WKDA 2D9UA 2XNAC 4Q0FA 2I0QA 1D1KA 4EQNA 4DR5Q 2WACA 5M5XB 2VUMG 4TKOB 4A3LH 5JJLA 2OCEA 3DXJC 3S16H 4J1MA 4XTCS 3H91A 3J7ZC 4IFDJ 1RDPD 1WVLA 2I5MX 1B70B 5CGKA 4A3MG 2EYJA 1X3FA 3I7FA 3K5LA 2KOLA 3J81i 4X66Q 2CW0C 4OONA 3RMHA 1CKNB 2QF7A 2EYPA 2PYKA 3N52A 4OHJA 4RHRA 4LF5Q 4LFAL 3DWAA 5J22A 4UAIA 1E2VA 4KHPL 3SHLA 2WB1G 1BCPC 2FINB 4A3EG 1V1QA 1G91A 4IUVA 1ENFA 1J9OA 3HKZG 1HHVA 3I2ZA 1Q8IA 3CCRA 1ASYA 4L5RC 1YEZA 2JA5G 2F0PA 3S17H 4QUCA 1SROA 2WIIB 1HNWL 2K5HA 5IP9H 1HXYD 3MFGA 4RMFA 3PIOA 3CU7A 1CA5A 1E24A 4ZKCB 2X6LA 1LT4D 1TS5A 2E76C 2I07B 1N32L 4JI5Q 1SJHD 2DJFC 1PH3A 3KLWA 4ABNA 3S16B 2UXCQ 2F0UA 2VQEQ 3S2DH 5ELEA 2CVRA 1VQ8A 1C48A 2EXDA 2F0KA 3GTQH 4GN5A 4DUZL 1J5EQ 4Q5VA 4X6AH 3A56A 1KDCA 1A3VA 5C5MA 3I4NH 1LABA 1N34Q 3OW7A 2LSSA 3LWEA 1MHWC 1E7ZA 5EKLA 2DUDA 2B8FA 4HIKA 2ZJRA 1ASZA 3VA7A 3I91A 1H9SA 4DV1L 1FGUA 5G3LD 2KCTA 1ILQA 2GVAA 1RIPA 3CQZH 2R92H 1NTGA 2A5HA 4KLKA 1I4RA 1QOHA 4DAMA 4YY3L 1QNUA 4IN3A 4NPSA 1HUNA 4K6LA 1I50H 1SYGA 2L1BA 1S5BD 1B3AA 3PO2H 3A8JE 1XXGA 3DEPA 2UUAL 1FNUA 4BBRH 3MTSA 3RN2A 4XIGS 5C4HA 1LYLA 3X3MA 4JI2L 1KNAA 5ISRA 1SYBA 2I5LX 1RCVD 1ZKOA 4BY1H 3S2DB 3PO3H 5E7NA 1MBYA 2HIXA 4MZ9A 3VR6A 3GTQB 2BA0A 4A3KG 2RF4A 3O13A 4TVAB 3ZYYX 3GTKH 1B9MA 1SNMA 4LF4L 1HCZA 2JA6H 3Q23A 5EPJA 3KYHC 4RGOS 3ERSX 1VQMA 1K9MC 1VQJA 4P2CB 1W6KA 3I4NB 2RHSB 3HOUH 4PMWA 2WAQE 1IHZA 1NY4A 1STHA 3NUCA 4ZCKA 5FO7B 2Q8RE 4NB3A 3HOZH 1TS3A 1W3SA 4PNYA 2C9OA 1QILA 1KLUD 4UP9A 4IPCA 5FLXE 2NN6G 1C8CA 4WORA 1L0YB 2F0HA 4HJ8A 4B3MQ 2CH4W 3DM3A 4X3SA 1VQKA 1BNZA 4PZ7A 2E5LL 1O7YA 4PV1C 1E3PA 4RKLA 4A4IA 2I46A 3CQZB 4K5XA 2R92B 1JE4A 1PZJD 4FF3A 1U4MA 3HOXG 3QB3A 1I50B 2LMCB 5GAHC 4ME5A 4NXNL 3PO2B 1FL0A 2QA4A 1IKLA 4BBRB 5C0XG 4LMQD 4DR2L 1GVPA 1K73C 1JB3A 1H9JA 3T53B 2EIFA 2VXWA 4OO1H 1EIGA 4FF1A 2NWGA 2PMZB 4DKAC 1A63A 4H44C 2TSSA 3BZKA 1LTTD 2NN6I 1XX8A 4OXPA 3PO3B 4JI3Q 4MN3A 1D8LA 1BCPF 2AUJD 4LFBQ 4A93H 5FO9B 1PH9A 3H3VI 2HQEA 1G2SA 5M3MG 3L7ZC 2Q8IB 3VA5A 2JA6B 2YYZA 3E0EA 4JOIA 1QUQA 4AH6A 1STYA 2UU9L 4B3TQ 4JI0L 4LF7L 4A3FH 2RDHA 3CCMA 3HOUB 5ELOA 4NXML 1NSNS 4CDFC 2B8GA 3CPFA 2B2YC 5IYBG 2E2HB 4U68A 2KEEA 3HOZB 1JORA 4R4TA 1PZID 4FXGC 4NDXA 2VQFQ 4HEDA 4ZYSA 3FKIB 2SDFA 5IGCA 5IWAQ 4HCEA 1CTMA 4JBWA 4DU9A 2OTLA 3GD7A 3HKZE 4RH6A 4A3BB 1MGSA 4YHHL 2IPKD 2QEJC 5C4XH 3ICEA 2PO4A 4JI6Q 2NTSA 1VQCA 1SE2A 1NMGA 1S72A 2BDOA 3QG1A 3STBC 2Y0SB 1D1IA 2F3WA 3VYSA 1DZ1A 2R7DA 4UPAA 3BDOA 3QWNA 3CCJA 3KUPA 2A1AA 3TREA 3NBIA 2CWAA 4QJFA 4DR3L 1NNXA 1A0IA 1X3PA 3TP7A 4H02A 1A62A 2J0TD 5ELNA 1B50A 4LFCQ 2IHEA 2A73B 2YTYA 3HP3A 1GJXA 2L15A 1E0BA 1BKBA 3I70A 1TS4A 3N6RA 4XYOA 2EJFC 4A3FB 2MP1A 3BVZA 3G6JB 3C46A 3KLRA 3GV6A 4YCUA 2EPBA 4FF4A 2RDFA 3DMUA 4N9PA 2F0DA 1CHPD 4B3SQ 5DAUA 3D31A 4A75A 1VQ7A 2UUCQ 4KI0A 3GTLH 1M8AA 3G48A 2FJ2A 1EFWA 4L5SA 3H15A 4DV7L 3PO2G 1I94L 5C4XB 4IJHA 2K14A 2KA7A 1JJ2A 4V190 3NXWA 1F9RA 1Y14B 2DJGC 1CKNA 1TWCH 2RQXA 4BY1G 5CBAE 1X54A 2SNMA 4Y52H 2BDNA 1UAPA 4ZRZA 1V1PB 2L55A 4DNRB 4RGTA 3A7LA 2F4IA 2XVSA 3GO5A 3H09A 3NWTA 3RZOH 5C44B 5T1IA 1EQTA 1BQQT 2A68D 5C3EG 5LL6S 2LXJA 3KF8B 4G7OC 2JA6G 5COYA 1U9RA 3H94A 1NBWA 2ZXRA 3DM1A 5M3FH 1HR0W 2R7FA 2SNSA 1EWHA 1HQRD 1SJED 1ZXTA 1JWUD 2F0JA 3H0GH 4JK1C 4EQ5A 4BBSG 2J4XA 2VB2X 3FPPA 3M4QA 1QNKA 4OELB 1X56A 1SNQA 1YJ9A 1LLRD 2RDGA 3CC2A 1BXTA 4DGZA 2B2VA 4X3TA 2KECA 1D7QA 2Y0SG 4ZK9B 3W5OA 3Q6SA 3IFTA 3J80E 1HNZQ 4DK6C 4GKJL 4OO1G 4K5WA 1TWCB 2EJMA 2Q2TA 4WJ4A 3PF5A 1MD2D 3CCEA 4PZ6A 3F2UA 3S15H 2AHOB 4YWLA 2MO1A 3M7GA 4A93G 1TS2A 5C4ZA 1S5CD 5JAVA 3K5NA 4EGVA 1VS0A 2Q2UA 4JI4Q 3TRZA 1S40A 2XGTA 4RFBA 4X65L 4A76A 5M3FB 2A6ED 4DR6L 4OIJA 4RCOA 1EUJA 1FJGL 1PFBA 2Z4IA 4JI7L 2EJGC 2ZTEA 4LF9L 1PRTC 3CAMA 3UI2A 5M5YB 3H0GB 1H9MA 4HAEA 2Z1CA 4OO1I 1JQYD 3M7NA 3VDYA 2MJ8A 3M9BA 3RD4A 3KJOA 1IYUA 3RN5A 5JEAJ 2JA8B 1TWGH 2A6HC 5EBDA 4YWKA 3K7AH 1KDAA 4OWTB 3I4MB 2ICIA 4R4OA 5KIXA 5HURA 3M3YB 4WJ3M 3NWSA 4C3IB 3ULJA 1XMQQ 1Q8KA 1EU3A 3JAME 4A3CH 1EY8A 4HIOA 1KC8C 3NQTA 5JJIA 1CQVA 5CBEE 5M9OA 2UXBL 4APVA 1H9SB 1LTSD 4DV2Q 1F2LA 4KD4A 1BR9A 4H7BA 2ZM6L 2Z6BA 1Y1WH 2F0FA 2QEXA 5IYCH 1QG7A 5IGDA 4IUTA 5JJZA 2E2JH 4RGMA 4OWXB 4UDUC 3T4AC 2NVQH 4GNXB 2BE5D 2RKSA 1PH2A 5J1ZA 1HUMA 2KQ3A 1ESFA 3A54A 4RAUC 1LTLA 4DV0Q 1WTWA 3S2HH 3C1FA 3E5SA 1G8ZD 2K52A 4KKSA 5IODA 3GTPB 2UXDQ 3K7AB 4K0KL 3UDXA 3NQIA 1SRUA 5LHY1 1IL2A 2B2TA 5FOBB 4A3DH 3OOCA 2GA4B 4P72A 1AE3A 2CCZA 3TSSA 2O5IC 3CW2C 5LL6X 2ZTDA 1EEFD 1SYCA 1SN8A 1PH4A 1Q12A 3FRPB 1SNOA 3GTGH 2XWJB 4JI8Q 3S14H 2H1EA 3MXGA 5F2DA 2JA7H 2K03A 4DAPA 1CUKA 5LMUQ 4DFAA 1Y1WB 1SNCA 1EY0A 2CW0D 4R4QA 2R6GA 1J8IA 4I65A 3NBHB 1PH5A 2E2JB 4XQNA 2JQOA 1TY0A 1SYFA 1Y8PB 5I4DA 1SMXA 2NVQB 3GP7A 2YV5A 2KBNA 4KJOA 3M4OH 2VS1A 4JC0A 2HIVA 4WJWA 3UE1A 1I6HB 1PYWD 4PZ8A 3SGIA 1AN8A 1Y1VH 1JWMD 1ONLA 2PZTA 3S2HB 4AQYL 4FP5D 2IHFA 5E3FA 2RSOA 5JVG3 1WCMG 5K36G 4A3DB 1NR2A 4WRDA 1G6PA 2A74C 4OGQC 4JYAL 3ND9A 3W3AA 5ELFA 2K05A 3G6EA 1AFPA 3VYUA 1QJOA 2XWBB 1STEA 3I3CA 2D62A 5GAGC 1QVGA 2YU9H 1KAAA 2M2LA 5KYIA 5M5XH 1BDOA 3F8TA 4DR4L 4DV5L 3PUZA 1J6QA 1PTOB 1KXLA 1PRTF 3S14B 1N36Q 1RTOA 2JA7B 1VQNA 1GHJA 3DUZA 4GOPC 1SFOH 4J15A 1JC7A 1WTOA 2K04A 3KBGA 3OWFA 3PF4A 4O1NA 5T1GA 1LACA 4PMCA 3U50C 4BS9A 3AFPA 3OHXC 3NE5B 4KTAA 1N8RC 3PUXA 4IFDH 1CQFA 1KABA 1YHAA 4EQPA 5C3WA 4GKKQ 1Y1VB 4DUYQ 3VYRA 2E2IH 2MGSA 4JVZA 3A8IE 3PIP3 3J7AF 1MIUA 1V1PA 1JICA 5IGEA 3FEWX 2MHVA 1O7LA 2B2WC 2FFKB 3QOLA 3KF8A 4O0AA 3GV3A 4DR5L 1DYQA 3SXHA 2XN9C 5CR3A 2YU9B 3MFYA 2EYHA 2ZTCA 4N8X1 4CKBA 3HEJA 3WOFA 4ZLTF 4A3GG 2XRQD 4LK1C 1SEBD 1RJTA 3AFQA 2KHJA 1KD1C 4JI1L 1Q90A 1X3QA 1SXTA 3U9SA 3LWUA 2K1BA 1BBXC 1SFOB 3M4YA 2JA9A 3MXPA 1B9NA 3M4PA 1ET6A 1X3EA 2R61A 3P75A 5IP7H 1YIJA 2AWNA 2AQ3B 4K6DA 1ZYRD 2N49A 4FDBA 1UE1A 1PMRA 4QIWB 4RKBA 1VCIA 1VDZA 1PFMA 1IZ6A 2OXPA 3D4DA 3P20A 2E2IB 4KK7A 4FYDA 2D0OA 3KOJA 1L0WA 5E4XA 2WINB 1ENCA 1SYEA 2XRSD 2K6AA 4JI5L 4KKUA 5IT9E 1HPCA 4LFAQ 4IUNA 2BH2A 5EGTA 5I6WA 3MEHA 1SMYC 4DV6L 4IUQA 4HTHA 5KNBA 1HTPA 1VQAA 4IALA 5C0XJ 2D2CC 4IPDA 1TY2A 3AQQA 1IBKL 3GTMB 4LF8L 2ZJQA 4RGNA 2F0EA 1H9KA 1KAWA 1C7YA 4KN7C 2QILA 3FVQA 2SOBA 4GLVB 4XQJA 3AMUA 2NUCA 3I73A 1N34L 3MC0B 2G5DA 4LW1A 3B6YA 1Y1VG 3R3OA 2E75C 1JOQA 1F9QA 4JBKA 4K2KA 3ULLA 4QB4A 1C9OA 4BY7H 3R8BA 5J39A 1Q86C 2ATWA 3RLNA 3CC7A 1PH7A 1PTOD 3J7AV 2Q2IA 4DUZQ 4HIDA 1MKHA 3TS2A 5D14A 1YNNC 3HFZB 2HQLA 2JE6I 2FMMA 2K01A 2PI2A 4K5VA 4CJ1B 2OWOA 1F77A 5M5WH 1QE6A 2TMPA 4GNXA 1L1OB 1GUSA 1L2FA 3TP6A 2EVBA 1F2YA 1X6OA 4DV1Q 2AQ2B 1AZPA 2F0IA 2AUKA 5IOCA 1I4QA 2BCOA 2RHQB 1XNRL 1LM0A 1DJRD 4YY3Q 3J81j 1GUNA 4WFN3 4DV3L 1TWAB 1VQOA 1VQLA 1EFID 3QO2A 3IFDA 3MXNB 2K7VA 2UUAQ 2KENA 5ELDA 2X6GA 1HR0Q 2E2HH 4C3HB 1E2ZA 1G291 3D6WA 4BY7B 2K75A 3R2TA 1K8AC 2SEBD 1UE7A 1HZAA 3EIVA 5FLMH 1B53A 3FKIH 4L63B 2EYLA 5DM63 5A2QE 2G9DA 4ZQ3A 3HZXA 3NENA 4DAYB 3TN2A 4A3BH 5ELCA 4JV5L 4DK1A 1HFGA 1MI2A 1JJGA 4ULLA 3J7YW 1HZ9A 1EQRA 1XNQL 1KRTA 4A3LG 1S5DD 4IFDI 3NBHA 4X64Q 1EL0A 5M5WB 1V8QA 3BVGA 3NP8A 4LF6L 2ICEC 5KEEA 1TR5A 3KBXA 4JI3L 2WKCA 4LFBL 1T5EA 3C2PA 1JOKA 4GN4B 4DR7L 5CYUA 1G2TA 4HSPA 2AMCB 1XJVA 2ENBA 3OPOA 4AYBB 4OL7A 4B3TL 1C4QA 1IW7D 1XTCD 1GXDC 1UEBA 3MHBA 3GTOH 3MVVA 1LT6D 3BDLA 4DR2Q 1CI3M 1TKWB 1V43A 2KHSA 4IOAA 4K8JA 3HOVH 5C4JH 1C0AA 1EY6A 2WB1E 1DXMA 1MJCA 1Q46A 3F2BA 1VF5C 1HNXL 5IP9G 4DAVA 1LTRD 1Z7TA 4DK3C 5HGTA 4ZAIA 5I2XA 1NUCA 3LNNA 3VR5A 1VMCA 4JOIC 4K2LA 1S3OA 1PYSB 2UU9Q 4JI0Q 4LF7Q 1EOTA 4JPBW 2H4OA 4QQBX 4P75A 4NXMQ 4CKCA 1V1OA 3P7JA 2JJQA 1LT3D 3SEBA 1I4XA 5C44H 4CDEC 2N3SA 3K0XA 4LFCL 5JPMC 4DV4Q 1CK1A 3E9HA 4YHHQ 3I4NG 3CRKC 4BWGB 2RSNA 1EYGA 3G4SA 1FNVA 1Z6HA 1EYDA 1N33L 2DY8A 3GTOB 4QY7A 4X3KA 1GUWA 2LFNA 4NW2A 2KVMA 5GROA 3HOVB 5C4JB 2NZOA 2MUYA 1Q1EA 2FHTA 4DR3Q 2R92G 1E22A 2F0OA 4B9XA 2PPBC 1UWVA 3PGZA 2FMCA 2K28A 5D3DA 1FNWA 4U673 2YTVA 2Z6KA 5AJ3L 2GN5A 4O42A 4A3IB 1LUZA 1EOVA 4BBRG 4CGYB 4RCNA 4IZ8A 1LV9A 1X3GA 1U4RA 5CV7A 3PO3G 1CZWA 3CRLC 2C5CA 2HDLA 2K32A 4LUOA 1O78A 3E6ZX 4ODGA 1BF4A 2R93H 1K8GA 1K83H 5E1FA 2L12A 4QMGA 2F3IA 3IKJA 2F4VL 3HOUG 1I94Q 4KJNA 3OTOL 1F2ZA 2PQAB 5M5YH 3HOZG 3QOJA 3D6CA 3TZDA 3FKIG 1YNJC 2DY7A 3PV0A 1F9PA 1OO9B 1FD7D 1MJEA 4GS3A 4HMJA 2JA8H 3S1QB 4A3BG 1VQFA 1YNXA 5IIFA 1X9NA 5JOBA 3I4MH 2KCMA 4R8NA 2JEAI 3M3YH 3TZUA 1G51A 4UP7A 3HOYH 1E1TA 4C3IH 2PW5A 1VQ5A 2ZJPA 1SLJA 2NZ1D 3I8ZA 4POGA 3S1RH 2AQ1B 2K33A 4LJZC 1STNA 3H3VC 2BH8A 5JEAH 4FXDA 4HR7B 1HA6A 1S5ED 3SR1A 5FO8B 1DD2A 3NK9A 3K8AA 1XTDA 4KV6A 4B3RL 5HGQA 1ENAA 2R93B 1K83B 3LGJA 4X62L 2B63B 2HHHL 2KJXA 2B2VC 4R9WA 3S1NB 1IBMQ 3MA2B 4A3FG 5C6AA 2L0CA 4GKJQ 2Z0SA 2OQKA 3HOVG 5BR8L 2RCNA 1JJCB 4R1JA 3Q22A 2C35B 1B7YB 3BZCA 3PIO3 3FDTA 2E74C 3GTPH 1E2WA 1WTHA 3D0FA 1L1OA 5C4XG 1KDBA 4X65Q 4DR6Q 3HOYB 2EQSA 4MIUA 2D0PA 1FJGQ 4HJ5A 1N9WA 4IUPA 2A69D 4DNIA 2R7ZB 4JI7Q 5BN3A 4LF9Q 5G3LF 1IBLQ 1PFSA 3S1RB 2KEDA 2N88A 4YCWA 5C44G 3MWYW 2I5HA 3MXNA 5IYDH 3LX0A 3T1YL 2QCPX 2UUBL 4QGUA 1DOMA 1L1OC 3HOWB 3OMGA 5D65A 1K28A 2JK8A 2WP8J 1I4HA 4LAAA 4G4KA 5DLQE 2LXKA 4DAYA 5CC4A 4LUZA 5EPLA 3SK5A 2PNHA 4FO2A 3L2PA 1NMFA 5FLXL 3KLSX 1I6HH 2K4KA 1NCVA 2PQEA 4F87A 1YI2A 2OEOA 2VB3X 3GTJH 1R9TB 4KHVA 4IPHA 3U4ZA 2IX0A 2EY1A 1B3QA 1IYJB 2A68C 3A8KE 4A3MH 2QDLA 1K3BC 4JG2A 4G57A 1OXXK 3IRBA 5IGGA 3RNUA 1CT1D 5L37A 1WTXA 1AP0A 2WAQB 4FVMA 3OMCA 3CP0A 1JB7A 4UP8A 1JCKB 1SAPA 1YBYA 3IAYA 1GOZA 1PTOH 2EZVA 5GAEC 3DWQA 4I7AA 1B1ZA 2O5JC 4NKLA 2IL8A 2PMZE 4L6TB 1A2UA 1UEAB 3V96A 5A35A 5M3FG 3WOEA 3NTIA 4CJ0B 3NHHA 2L5TA 2JA5H 4LNQA 2B2TC 2NTTA 3BZDB 5DNFA 3CCUA 3ND8A 1FR3A 3H0GG 5LMNL 1GUTA 1HJPA 1EIHA 2LS01 3SK4A 2VL6A 2E2DC 1BCPD 4E6IA 3RLOA 1OXSC 4G7HC 1D6EC 1EEID 4C56C 3WWVA 2F0MA 3MXUA 2JA8G 2VUMB 3J81E 3Q0AA 3NPPA 4JBJA 3I4MG 3NTKA 3GTJB 2JN4A 4PQXA 1A15A 2RCFA 4C3IG 3RZDB 1GM5A 4JBMA 4B08A 4A3MB 4QUFA 1K8MA 3T1HL 2A6EC 3P1HA 2AKWB 5I6YA 3UDFA 1EIFA 1XWEA 4ZUIA 1STAA 3KK7A 1WOCA 3TEHB 2EY2A 1BBUA 3VR4A 3I90A 1VQ9A 2Y0SE 5CV4A 1UE5A 2K5DA 4BXXH 2F03A 4A3EB 3RLFA 3RUZA 4YIJA 2GVBA 2F0SA 1LTAD 3A5ZB 4CKEA 4AQYQ 1XMOQ 1IL8A 1CKOA 3HKZB 1RF2D 5TSSA 1HFNA 5CV8A 1PH1A 2B2UA 2JA5B 1DGSA 1OXVA 4OEMB 2Q8TA 4JYAQ 4N9TA 2IT1A 2CQOA 2DN8A 1SE8A 1QVFA 3DEOA 4DR1Q 3W1BA 4GKKL 3URYA 1F2MA 4A3JH 1JOOA 1TXYA 2MFIA 2IX1A 2VZAA 1EWCA 3GDEA 1LT5D 5IT9c 1A3UA 1SE4A 1XPUA 3A0JA 1I6VC 4TSSA 2CQAA 1T5XD 4QCLA 4A3CG 3PUYA 2E8GA 2NYZD 1VQPA 3AYHB 4IQZA 3CHBD 4OX9Q 4R8IA 2V4DA 1JT8A 4LUVA 1UE6A 3BVMA 5IYDG 1QWYA 2BE5C 3SVMA 2PQAA 3S9WA 2PNRC 1KL9A 1RODA 1X65A 3KDFB 1WTPA 1Y1WG 3V2TA 1KLGD 3PUWA 3GTMH 5IYCG 2F0GA 4X66L 3CXCA 5CV6A 4N8FA 4YCVA 1RTNA 4LF5L 3CMEA 4DXFA 1DCZA 3EQLC 3HOXH 3DWPA 5FKAC 3BS1A 1EZ6A 2JYOA 2OT2A 2QKIC 2MQHA 5BN4A 1TWHH 4A3JB 5C0XH 2IW3A 5HY6A 3UE0A 2LY7A 4FNFA 1WFQA 4ZKBB 4A3DG 1EYAA 1I5FA 1D5XC 5CMDA 4JI1Q 1HH2P 4IURA 3JC66 3J80L 3K59A 3EA6A 4FF2A 3HG9A 1TU2B 4A3KB 1SR3A 5M3MH 2PZUA 1MSGA 3Q8DA 1PLFA 3EJIA 1BO0A 1GKHA 2KHIA 2XIWA 1B2TA 5D3IB 3CCLA 3EN2A 4DK0A 1U4PA 2IX3A 4KHPQ 1M1KC 2CKZB 2UXCL 1Q3LA 5IYBH 5JJKA 2VQEL 2JA7G 3TMEA 3TDQA 1GHKA 2EOTA 3SK8A 4CHTB 3QJYA 1AW7A 5CV5A 3A74A 3W1GA 2ALYB 1EQVA 2ZXOA 1J5EL 4XDXA 2XSCA 4KHZA 1STBA 1HNWQ 1U4LA 3G71A 2HD3A 4C3JH 1TWAH 5FLXc 1CA6A 2NZHA 5C5LA 3HOXB 3E9IA 2B39A 3R2IA 3HKSA 3OIQA 3L9AX 1N32Q 3GQBA 1QZGA 1TWHB 4C3HH 4HSVA 4DV6Q 2MO0A 3L0OA 5EAYA 5CV9A 1WTRA 1PHJA 5LMNW 2F0TA 4M1UB 3A5UA 3JAML 1IBKQ 1PRTB 4PMBA 4LF8Q 4P74A 1W2BA 2M00A 2JEBI 5EBCA 4HMIA 2O4XA 1O7IA 1RHPA 1KHIA 4JCVE 1OTCA 3HS0C 4H13C 3T16A 5M3MB 3STBD 3U9OA 2NVTH 1DM0B 5DM73 4R4IA 4XQQA 2QGQA 4BXXG 2LKVA 4RHSA 1F9SA 1SYDA 3DHQA 2K5NA 1PZKD 2YTXA 4UHVA 3CF5A 1RKNA 1WD0A 4GLAC 1RD9D 3NELA 2CHBD 2EYOA 3NSWA 3S17B 1PXUA 4L5TA 1I3QH 3CCQA 2PI2E 1O80A 4BA2I 2O2LD 1HZCA 3PMFA 1V9PA 4F88A 4C3JB 1EY4A 4A3JG 1HR0L 5BN5A 4IFDG 1AZQA 3SDZA 1Q82C 3E0JA 3TQYA 3OSOA 4HJ7A 4JI2Q 4GNXC 3AEVA 1K3RA 4B3ML 5C3XA 2IY5B 1QCBD 2JSOA 5J3BA 4K8IA 1Q7YC 3I4LA 3ITPA 4C1NI 1FVIA 5C3EH 1A8VA 1EU4A 4MNOA 3NEMA 1I4PA 1XNRQ 1O7ZA 4LF4Q 1EY7A 4X64L 4DV3Q 2VW9A 4QF4A 5EKIA 5I2YA 2NVTB 1G6ZA 2CFMA 3MAQA 1ZYRC 2A8VA 4BBSH 1Y8OB 3CCSA 1EIYB 4HJ9A 3QR8A 1CKMA 3PCOB 2NVXH 3UDIA 1T9HA 4IPGA 4P71A 4XYQA 4KN4C 1M90C 2VY3A 2IWHA 4GLXA 2E5LQ 2JP1A 1I3QB 3NTHA 5IP7G 4B9WA 1CSQA 4JV5Q 1UUPA 4HIMA 2BOSA 3CPWA 4ILWA 1CHQD 4EVOA 3J81L 1DOLA 1JR0D 1XNQQ 2EYFA 1D5ZC 2B2YA 2K5VA 3ZJYC 5KGUA 4XT1B 1ILPA 1YNJD 2K5WA 3E3XA 2KCCA 5DEHA 4NXNQ 4LF6Q 3F1ZA 5GADC 1VQIA 2VQFL 4BY1B 1CZGA 1S5FD 1U5KA 5IWAL 3L3OC 2DNEA 3F2CA 4HN7A 3F2DA 4KD3A 4GN3B 3GTKB 3CCVA 5K5PA 4DR7Q 5C3EB 2EDGA 1HQMC 3BDCA 3T13A 3KLSA 4F7XA 1YJNA 4JI6L 3BYTB 1SNPA 2WV6D 3K0YA 1EY9A 4A3IH 4F8MA 2WFWA 1SSOA 1XPOA 1LTBD 1OXUA 2K5QA 1II3A 1WYDA 5EKKA 5C0XI 4BBSB 4TQUS 1D2BA 1LTGD 2OQ0A 4PG3A 3KF6B 4L8JA 2NVXB 2KUMA 1VMPA 4IJLA 3Q24A 2J7ZA 2F0VA 5FK9C 3T51B 1Q81C 1ZEQX 1EWIA 1GUOA 4KKTA 3HRZC 4DV4L 1BOSA 1Y69U 1PTOC 2ZT9C 1HNXQ 4KY7A 5ELBA 4C3JG 3D4RA 1W6JA 3VR3A 1EYCA 1PRTD 1R4QB 1CM9A 2ES2A 3PIPA 1HRJA 1WTQA 4C3HG 5CORA 3K7UC 4BY7G 5JPNC 2F0NA 4GOPB 4MTKA 4J6HA 4RWSC 1K0SA 2MPMA 2A6HD 1HA5A 4B3SL 2UUCL 3S24A 3S1QH 3J80c 4A93B 3KDFA 3I55A 1IXRA 2PZWA 2ID0A 3CD6A 2DGYA 2IJ0A 3PUVA 5EPKA 1SDFA 3U4VA 1JE5A 1FGBD 2P5ZX 1N33Q 1VQ4A 5IY0A 2CH4A 4R4CA 1EY5A 3OYYA 2A19A 2HT1A 3X3NA 4LWCA 3MZ5A 4IOCA 1WTVA 3A55A 2L9HA 4AYBG 2BA1A 2QDBA 4H0LC 4V0BA 1UNSA 2B63H 1VQGA 1VQEA 3S1NH 1AEXA 1RL2A 2XTIA 3CC4A 4DV7Q 5AJ3Q 2Z6KC 2PCFB 2PW7A 3M85A 3IL8A 2B3GA 3ULPA 1KTKA 4YWMA 4XT3B 5FLMG 4QIWE 4M8AA 1ET9A 1ICFB 1Z9FA 3JAMc 1QZHA 4ID6A 2AWOA 2OTJA 1TVXA 4KY5A 1VQHA 2RA4A 1PFNA 5IT9L 5KNCA 1BBWA 3HGBA 1YHQA 2F4VQ 1BCPB 3CMAA 1SE3A 2R7ZH 1HNZL 1IW7C 3OTOQ 3PQIA 5KYLA 1HTLD 2QW7A 4CBVA 2X69A 2F0QA 1AE2A 4Y7NH 1DONA 3U58A 1GD7A 2F0LA 3D4WA 1GUGA 3WDNA 5FJ8H 1TIID 3GTLB 4JI4L 2DNCA 2N8NA 2EY5A 2L11A 5I9PA 1BVSA 1BUVT 3K5MA 2HDMA 1WD1A 1IBML 3HOWH 1WCMH 1B8AA 1YITA 5K36H 3G7LA 1Y8NB 1IYVA 4G7ZC 3C3LA 5IGBA 4AIMA 4MHEA 1M4VA 3K58A 3AB9A 3RR5A 4KMUC 1NE3A 2NVYH 2NBFA 1A3TA 3D3RA 1S4ZA 4RA8A 1Q1BA 1KRSA 3K57A 1P16A 3RZOB 3W2DA 1R9TH 4DN4M 1STGA 3BG3A 5GQOA 1CSPA 2B29A 4B3RQ 4L5QA 1H9RA 2JXMB 1XMQL 1K8OA 4DPGA 4A3IG 3VR2A 4X62Q 2HHHQ 1PA6A 1IBLL 3EROA 2KCNA 3FMCA 4CDCC 3K80C 2V1CC 1PVOA 2F0WA 4DA2A 1PTOF 1KNEA 1WI5A
chains in the Genus database with same CATH topology
3CCJA 2A1AA 2FXQA 2Q2IA 4DUZQ 2CQOA 3TREA 4HIDA 2CWAA 4QJFA 4DR3L 1SE8A 1MKHA 1A0IA 5BR8Q 1QVFA 3TS2A 4DV2L 3HFZB 2HQLA 2JE6I 1TWFH 2PI2A 4H02A 3W1BA 4DR1Q 4GKKL 1AH9A 1A62A 5ELNA 4A3JH 3J7A5 1TXYA 4LFCQ 2IHEA 2OWOA 5M5WH 2MFIA 2IX1A 2VZAA 2YTYA 2L15A 3GDEA 1BKBA 5IT9c 4GNXA 2F52A 1XPUA 3A0JA 1L1OB 3J81c 2Q2HA 1L2FA 4YCUA 4A3CG 3PUYA 1X6OA 3DLLA 2E8GA 4DV1Q 1VQPA 1YJWA 3AYHB 4OX9Q 4EX5A 1JT8A 1Z47A 1PH8A 4B3SQ 3KJPA 3D31A 2RHQB 4DV0L 4A75A 4KI0A 1VQ7A 1LM0A 2UUCQ 3G48A 4YY3Q 1XNRL 5IE8A 4LUVA 3J81j 2UXBQ 3S1MH 1UE6A 5IYDG 4DV3L 4A3GH 1VQOA 2UXDL 1QVCA 1EFWA 1VQLA 4L5SA 3T1YQ 2PQAA 3H15A 2UUBQ 1YVCA 3MXNB 4POFA 4DV7L 3PO2G 1I94L 3RZDH 1VQ6A 4IJHA 2K14A 1JJ2A 2UUAQ 2KENA 1KL9A 3KDFB 1X65A 1YHBA 1HR0Q 2E2HH 2ZM6Q 1Y1WG 1G291 3PUWA 4HJAA 1KIXA 5IYCG 1Y14B 3GTMH 3I4OA 2K75A 1K8AC 4QL5A 1UE7A 1CKNA 1HZAA 1TWCH 3EIVA 5FLMH 4BY1G 1X54A 2MNAA 3FKIH 4X66L 4Y52H 3CXCA 3NENA 4YCVA 4DAYB 4LF5L 3GO5A 3CMEA 3RZOH 4A3BH 5C3EG 3HOXH 4JI8L 4JV5L 2LXJA 3KF8B 2JA6G 1JJGA 2K50A 3FP9A 4A3EH 4P73A 2MQHA 4MTNA 1NBWA 5M3FH 1HZ9A 5LMUL 1HR0W 1EQRA 1TWHH 2R7FA 2N78A 3BU2A 3BJUA 3J80i 1KRTA 1XPRA 1XNQL 3GTLH 4A3LG 4IFDI 4X64Q 2B63G 5HY6A 3UE0A 4LF6L 1WFQA 4EQ5A 4K0KQ 3H0GH 4A3DG 4BBSG 1VQBA 1KQSA 3M4QA 1VQDA 4JI3L 1I5FA 1X56A 4JI1Q 1HH2P 4AYBE 3JC66 4C2MH 4LFBL 1YJ9A 4GN4B 1SR3A 4DR7L 5M3MH 3Q8DA 2VNUD 1GKHA 2KHIA 3CC2A 2AMCB 1OXTA 1XJVA 3CCLA 3EN2A 4B3TL 3I56A 4KHPQ 1U0LA 1M1KC 1UEBA 2CKZB 2UXCL 5IYBH 5JJKA 2VQEL 2JA7G 2Y0SG 3GTOH 1PH6A 1WJJA 3W5OA 3KF6A 3HOYG 1D7QA 1JMCA 2ASBA 4DR2Q 2R7ZG 1E1OA 3A74A 3W1GA 2ALYB 4DK6C 3OW2A 1HNZQ 1NJIC 1V43A 4GKJL 4OO1G 4BA1I 4IOAA 1J5EL 3HOVH 5C4JH 1C0AA 2Q2TA 5LMNQ 2WB1E 3PF5A 1GO3E 4WJ4A 3CCEA 4PZ6A 1MJCA 4KHZA 3S15H 2AHOB 4YWLA 1Q46A 3F2BA 1HNXL 1HNWQ 2MO1A 5JEAG 5IP9G 3MEFA 3TS0A 4A93G 3G71A 4DK3C 4C3JH 1HZBA 4RG1A 5FJ8G 1TWAH 5FLXc 2NZHA 3E9IA 3JAMi 3HKSA 1VS0A 2Q2UA 4JI4Q 3TRZA 1S40A 1XMOL 1N36L 2XGTA 4X65L 4A76A 4DR6L 4JOIC 1N32Q 1QZGA 4C3HH 4GOPA 3HOWG 1S3OA 1EUJA 1PYSB 4DV6Q 2UU9Q 4JI0Q 4LF7Q 1FJGL 2MO0A 1QUQB 3L0OA 5EAYA 1YZ6A 4P75A 2ZTEA 4JI7L 4LF9L 4NXMQ 4QQBX 1H95A 1PHJA 3CAMA 5LMNW 3A5UA 3T1HQ 2JJQA 1IBKQ 4LF8Q 4OO1I 4P74A 1W2BA 3VDYA 3M7NA 2JEBI 3M9BA 4DR1L 5C44H 3KJOA 4IO9A 2N3SA 1O7IA 3RN5A 5JEAJ 3K0XA 1KHIA 4JCVE 4LFCL 1OTCA 1TWGH 3STBD 4YWKA 4DV4Q 2NVTH 3K7AH 4DV5Q 4DR4Q 4OWTB 4DUYL 3E9HA 4R4IA 2QGQA 4YHHQ 3I4NG 4BXXG 4R4OA 1EQQA 1EYGA 2K5NA 4WJ3M 3G4SA 1PYBA 2YTXA 3ULJA 1Q8KA 1XMQQ 4OWWB 3CF5A 3FHWA 4GLAC 1N33L 2H5XA 4QY7A 4A3CH 3NELA 3UDGA 4OX9L 2WAQG 1X55A 4ME3A 4O2DA 4HIOA 4A3KH 1KC8C 2CWPA 5JJIA 1PV4A 3ER0A 4L5TA 1I3QH 5GROA 5H1SE 2NZOA 3CCQA 2UXBL 2PI2E 4APVA 4BA2I 3KFUA 1Q1EA 3PSIA 4DR3Q 2R92G 1E22A 1HZCA 1V9PA 4DV2Q 3K81C 1UWVA 3PGZA 1P8LA 3EBEA 4A3JG 2YTVA 1HR0L 2ZM6L 4IFDG 1Y1WH 2Z6KA 2QEXA 5AJ3L 2GN5A 1Q82C 5IYCH 1LUZA 4UY8C 1EOVA 4BBRG 4ALPA 2E2JH 3TQYA 4OWXB 4HJ7A 4JI2Q 4GNXC 3AEVA 1X3GA 1K3RA 4B3ML 2IY5B 2NVQH 5J3BA 1K0RA 4GNXB 1Q7YC 3PO3G 3H3VH 1FVIA 5C3EH 1PH2A 1A8VA 2I0QA 4DR5Q 4LUOA 4MNOA 3NEMA 1LTLA 4DV0Q 1XNRQ 2VUMG 3S2HH 4LF4Q 1K8GA 2R93H 1K83H 4A3LH 2K52A 4X64L 4DV3Q 2VW9A 2F3IA 5JJLA 2OCEA 2UXDQ 3S16H 4XTCS 2F4VL 2CFMA 3UDXA 3J7ZC 1SRUA 4K0KL 4IFDJ 1IL2A 3HOUG 2A8VA 4BBSH 2I5MX 1I94Q 4A3DH 1B70B 3OTOL 3CCSA 4P72A 2PQAB 4A3MG 1AE3A 5M5YH 1EIYB 3HOZG 4HJ9A 2CCZA 1CKMA 1X3FA 3CW2C 3PCOB 2NVXH 3UDIA 1T9HA 4IPGA 2ZTDA 4P71A 3I7FA 3FKIG 3J81i 1M90C 3PV0A 4X66Q 2VY3A 4OONA 1CKNB 4GLXA 1MJEA 1SN8A 2VUMH 4GS3A 2JA8H 2E5LQ 4LF5Q 5IP7G 1PH4A 1Q12A 4LFAL 4A3BG 1VQFA 1YNXA 1CSQA 1X9NA 4KHPL 4JV5Q 4HIMA 4JI8Q 3GTGH 2WB1G 3I4MH 2KCMA 3S14H 3CPWA 4A3EG 2JEAI 3M3YH 1V1QA 2JA7H 1G51A 4UP7A 3HOYH 1CUKA 1E1TA 4C3IH 5LMUQ 1XNQQ 2K5VA 1VQ5A 3ZJYC 3HKZG 3I2ZA 2ZJPA 3CCRA 1ASYA 4L5RC 1SLJA 4R4QA 4NXNQ 2R6GA 4LF6Q 1YEZA 3F1ZA 5GADC 3NBHB 1PH5A 3S1RH 1VQIA 2VQFL 2JA5G 4POGA 2JQOA 3S17H 1U5KA 1SROA 5IWAL 1HNWL 2K5HA 2BH8A 1SMXA 5IP9H 3F2CA 2YV5A 3F2DA 2KBNA 4GN3B 4RMFA 2VS1A 4JC0A 3CCVA 2HIVA 3PIOA 3M4OH 4DR7Q 3UE1A 3K8AA 1XTDA 1E24A 4PZ8A 4B3RL 3SGIA 5HGQA 1Y1VH 4JI6L 1YJNA 1N32L 4JI5Q 4AQYL 4A3IH 3LGJA 2WFWA 4X62L 2HHHL 1XPOA 1PH3A 1OXUA 2IHFA 1WYDA 3KLWA 2UXCQ 1IBMQ 1WCMG 5C0XI 2VQEQ 4A3FG 5K36G 3S2DH 1G6PA 4TQUS 1VQ8A 4JYAL 2EXDA 2OQ0A 4PG3A 3GTQH 3KF6B 4GKJQ 2Z0SA 3G6EA 2OQKA 4GN5A 4DUZL 1J5EQ 3HOVG 4IJLA 5BR8L 2RCNA 1JJCB 2D62A 4R1JA 5GAGC 1Q81C 1EWIA 2C35B 1QVGA 1B7YB 5M5XH 2YU9H 3F8TA 4DV4L 3BZCA 4DR4L 4DV5L 3PUZA 1J6QA 1HNXQ 3I4NH 1N34Q 3GTPH 1KXLA 2LSSA 3D0FA 1L1OA 5C4XG 2ES2A 3PIPA 1E7ZA 1N36Q 2DUDA 4X65Q 4DR6Q 1VQNA 4HIKA 2ZJRA 1ASZA 2EQSA 2D0PA 4GOPC 3K7UC 1FJGQ 4HJ5A 1N9WA 4DNIA 4BY7G 4JI7Q 1SFOH 4LF9Q 4GOPB 1IBLQ 4DV1L 1FGUA 1PFSA 2KCTA 4J15A 2GVAA 1RIPA 4B3SL 3CQZH 2UUCL 1NTGA 2R92H 4KLKA 3PF4A 3S24A 4DAMA 4YY3L 4YCWA 3S1QH 5C44G 3J80c 2I5HA 3U50C 5IYDH 3AFPA 4NPSA 1N8RC 1I50H 3KDFA 3T1YL 3PUXA 2UUBL 3I55A 1IXRA 4QGUA 1YHAA 2ID0A 3PO2H 3CD6A 4GKKQ 2DGYA 2UUAL 4DUYQ 3PUVA 4BBRH 1L1OC 2E2IH 3RN2A 4XIGS 4JI2L 1LYLA 3U4VA 1JE5A 2JK8A 2WP8J 2I5LX 1MIUA 5DLQE 4BY1H 2LXKA 1VQ4A 1N33Q 4LUZA 3PO3H 5E7NA 5IY0A 2PNHA 2HIXA 4MZ9A 4R4CA 3L2PA 4O0AA 1NMFA 2BA0A 4A3KG 2RF4A 4TVAB 3OYYA 4DR5L 3GTKH 2A19A 2HT1A 4LWCA 1I6HH 4LF4L 2K4KA 4IOCA 2JA6H 3KYHC 3ERSX 1YI2A 4AYBG 1VQMA 2BA1A 1VQJA 2ZTCA 3GTJH 1K9MC 4IPHA 3U4ZA 2RHSB 3HOUH 2B63H 1VQGA 4PMWA 4A3GG 2IX0A 1IYJB 1VQEA 1NY4A 2WAQE 3S1NH 4A3MH 1RL2A 2XTIA 3CC4A 3HOZH 4NB3A 5AJ3Q 4DV7Q 1W3SA 2Z6KC 4JG2A 3M85A 1OXXK 3AFQA 3IRBA 2KHJA 3RNUA 2B3GA 3ULPA 1KD1C 4JI1L 4UP9A 4IPCA 2NN6G 4YWMA 4HJ8A 4B3MQ 3CP0A 2JA9A 3DM3A 1JB7A 5FLMG 1VQKA 4PZ7A 2E5LL 3M4PA 4QIWE 1X3EA 5IP7H 1E3PA 4UP8A 1Z9FA 4A4IA 3JAMc 1YIJA 2AWNA 1YBYA 1QZHA 2AWOA 2N49A 5GAEC 4FDBA 2OTJA 1VQHA 3HOXG 1UE1A 2PMZE 1BBWA 1VCIA 5GAHC 5M3FG 4NXNL 1FL0A 1YHQA 2F4VQ 3CMAA 1IZ6A 2QA4A 5C0XG 1K73C 4DR2L 2JA5H 1GVPA 4LNQA 2R7ZH 1HNZL 3CCUA 3OTOQ 2EIFA 3H0GG 4DKAC 1A63A 5LMNL 2D0OA 3BZKA 2NN6I 1HJPA 3KOJA 1L0WA 4OXPA 1AE2A 4JI3Q 4Y7NH 1D8LA 4LFBQ 2VL6A 3U58A 1GD7A 3RLOA 4A93H 1OXSC 1PH9A 3H3VI 5FJ8H 3WWVA 2JA8G 4JI5L 5M3MG 3L7ZC 4LFAQ 4JI4L 2YYZA 2BH2A 3E0EA 2N8NA 4JBJA 4JOIA 3I4MG 1QUQA 4AH6A 2R93G 1BVSA 3HOWH 1IBML 2UU9L 4DV6L 1WCMH 4B3TQ 1B8AA 4A3FH 1YITA 4JI0L 3CCMA 4LF7L 1GM5A 5ELOA 4JBMA 4NXML 1VQAA 3CPFA 5IYBG 5C0XJ 4IPDA 4AIMA 3AQQA 3T1HL 1IBKL 4R4TA 4LF8L 2ZJQA 3RR5A 2AKWB 1NE3A 2NVYH 2VQFQ 1KAWA 3UDFA 1EIFA 1C7YA 4X6AH 1WOCA 3TEHB 5IWAQ 4GLVB 1BBUA 4JBWA 1Q1BA 1N34L 2OTLA 1KRSA 3GD7A 1P16A 3HKZE 2Y0SE 4LW1A 1VQ9A 1UE5A 1R9TH 4YHHL 3B6YA 4BXXH 5C4XH 3ICEA 5GQOA 1CSPA 1Y1VG 2B29A 4L5QA 3RLFA 4JI6Q 4B3RQ 2GVBA 1VQCA 1S72A 1NMGA 1XMQL 4DPGA 4AQYQ 3A5ZB 4A3IG 1XMOQ 3STBC 1CKOA 4X62Q 3ULLA 2HHHQ 1C9OA 4JBKA 4BY7H 1PA6A 1IBLL 1PH1A 1Q86C 2ATWA 1DGSA 1OXVA 2V1CC 3K80C 3RLNA 3CC7A 1PVOA 2R7DA 1PH7A 4JYAQ 4UPAA 2IT1A 1WI5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCJ A;  2A1A A;  2FXQ A;  2Q2I A;  4DUZ Q;  2CQO A;  3TRE A;  4HID A;  2CWA A;  4QJF A;  4DR3 L;  1SE8 A;  1MKH A;  1A0I A;  5BR8 Q;  1QVF A;  3TS2 A;  4DV2 L;  3HFZ B;  2HQL A;  2JE6 I;  1TWF H;  2PI2 A;  4H02 A;  3W1B A;  4DR1 Q;  4GKK L;  1AH9 A;  1A62 A;  5ELN A;  4A3J H;  3J7A 5;  1TXY A;  4LFC Q;  2IHE A;  2OWO A;  5M5W H;  2MFI A;  2IX1 A;  2VZA A;  2YTY A;  2L15 A;  3GDE A;  1BKB A;  5IT9 c;  4GNX A;  2F52 A;  1XPU A;  3A0J A;  1L1O B;  3J81 c;  2Q2H A;  1L2F A;  4YCU A;  4A3C G;  3PUY A;  1X6O A;  3DLL A;  2E8G A;  4DV1 Q;  1VQP A;  1YJW A;  3AYH B;  4OX9 Q;  4EX5 A;  1JT8 A;  1Z47 A;  1PH8 A;  4B3S Q;  3KJP A;  3D31 A;  2RHQ B;  4DV0 L;  4A75 A;  4KI0 A;  1VQ7 A;  1LM0 A;  2UUC Q;  3G48 A;  4YY3 Q;  1XNR L;  5IE8 A;  4LUV A;  3J81 j;  2UXB Q;  3S1M H;  1UE6 A;  5IYD G;  4DV3 L;  4A3G H;  1VQO A;  2UXD L;  1QVC A;  1EFW A;  1VQL A;  4L5S A;  3T1Y Q;  2PQA A;  3H15 A;  2UUB Q;  1YVC A;  3MXN B;  4POF A;  4DV7 L;  3PO2 G;  1I94 L;  3RZD H;  1VQ6 A;  4IJH A;  2K14 A;  1JJ2 A;  2UUA Q;  2KEN A;  1KL9 A;  3KDF B;  1X65 A;  1YHB A;  1HR0 Q;  2E2H H;  2ZM6 Q;  1Y1W G;  1G29 1;  3PUW A;  4HJA A;  1KIX A;  5IYC G;  1Y14 B;  3GTM H;  3I4O A;  2K75 A;  1K8A C;  4QL5 A;  1UE7 A;  1CKN A;  1HZA A;  1TWC H;  3EIV A;  5FLM H;  4BY1 G;  1X54 A;  2MNA A;  3FKI H;  4X66 L;  4Y52 H;  3CXC A;  3NEN A;  4YCV A;  4DAY B;  4LF5 L;  3GO5 A;  3CME A;  3RZO H;  4A3B H;  5C3E G;  3HOX H;  4JI8 L;  4JV5 L;  2LXJ A;  3KF8 B;  2JA6 G;  1JJG A;  2K50 A;  3FP9 A;  4A3E H;  4P73 A;  2MQH A;  4MTN A;  1NBW A;  5M3F H;  1HZ9 A;  5LMU L;  1HR0 W;  1EQR A;  1TWH H;  2R7F A;  2N78 A;  3BU2 A;  3BJU A;  3J80 i;  1KRT A;  1XPR A;  1XNQ L;  3GTL H;  4A3L G;  4IFD I;  4X64 Q;  2B63 G;  5HY6 A;  3UE0 A;  4LF6 L;  1WFQ A;  4EQ5 A;  4K0K Q;  3H0G H;  4A3D G;  4BBS G;  1VQB A;  1KQS A;  3M4Q A;  1VQD A;  4JI3 L;  1I5F A;  1X56 A;  4JI1 Q;  1HH2 P;  4AYB E;  3JC6 6;  4C2M H;  4LFB L;  1YJ9 A;  4GN4 B;  1SR3 A;  4DR7 L;  5M3M H;  3Q8D A;  2VNU D;  1GKH A;  2KHI A;  3CC2 A;  2AMC B;  1OXT A;  1XJV A;  3CCL A;  3EN2 A;  4B3T L;  3I56 A;  4KHP Q;  1U0L A;  1M1K C;  1UEB A;  2CKZ B;  2UXC L;  5IYB H;  5JJK A;  2VQE L;  2JA7 G;  2Y0S G;  3GTO H;  1PH6 A;  1WJJ A;  3W5O A;  3KF6 A;  3HOY G;  1D7Q A;  1JMC A;  2ASB A;  4DR2 Q;  2R7Z G;  1E1O A;  3A74 A;  3W1G A;  2ALY B;  4DK6 C;  3OW2 A;  1HNZ Q;  1NJI C;  1V43 A;  4GKJ L;  4OO1 G;  4BA1 I;  4IOA A;  1J5E L;  3HOV H;  5C4J H;  1C0A A;  2Q2T A;  5LMN Q;  2WB1 E;  3PF5 A;  1GO3 E;  4WJ4 A;  3CCE A;  4PZ6 A;  1MJC A;  4KHZ A;  3S15 H;  2AHO B;  4YWL A;  1Q46 A;  3F2B A;  1HNX L;  1HNW Q;  2MO1 A;  5JEA G;  5IP9 G;  3MEF A;  3TS0 A;  4A93 G;  3G71 A;  4DK3 C;  4C3J H;  1HZB A;  4RG1 A;  5FJ8 G;  1TWA H;  5FLX c;  2NZH A;  3E9I A;  3JAM i;  3HKS A;  1VS0 A;  2Q2U A;  4JI4 Q;  3TRZ A;  1S40 A;  1XMO L;  1N36 L;  2XGT A;  4X65 L;  4A76 A;  4DR6 L;  4JOI C;  1N32 Q;  1QZG A;  4C3H H;  4GOP A;  3HOW G;  1S3O A;  1EUJ A;  1PYS B;  4DV6 Q;  2UU9 Q;  4JI0 Q;  4LF7 Q;  1FJG L;  2MO0 A;  1QUQ B;  3L0O A;  5EAY A;  1YZ6 A;  4P75 A;  2ZTE A;  4JI7 L;  4LF9 L;  4NXM Q;  4QQB X;  1H95 A;  1PHJ A;  3CAM A;  5LMN W;  3A5U A;  3T1H Q;  2JJQ A;  1IBK Q;  4LF8 Q;  4OO1 I;  4P74 A;  1W2B A;  3VDY A;  3M7N A;  2JEB I;  3M9B A;  4DR1 L;  5C44 H;  3KJO A;  4IO9 A;  2N3S A;  1O7I A;  3RN5 A;  5JEA J;  3K0X A;  1KHI A;  4JCV E;  4LFC L;  1OTC A;  1TWG H;  3STB D;  4YWK A;  4DV4 Q;  2NVT H;  3K7A H;  4DV5 Q;  4DR4 Q;  4OWT B;  4DUY L;  3E9H A;  4R4I A;  2QGQ A;  4YHH Q;  3I4N G;  4BXX G;  4R4O A;  1EQQ A;  1EYG A;  2K5N A;  4WJ3 M;  3G4S A;  1PYB A;  2YTX A;  3ULJ A;  1Q8K A;  1XMQ Q;  4OWW B;  3CF5 A;  3FHW A;  4GLA C;  1N33 L;  2H5X A;  4QY7 A;  4A3C H;  3NEL A;  3UDG A;  4OX9 L;  2WAQ G;  1X55 A;  4ME3 A;  4O2D A;  4HIO A;  4A3K H;  1KC8 C;  2CWP A;  5JJI A;  1PV4 A;  3ER0 A;  4L5T A;  1I3Q H;  5GRO A;  5H1S E;  2NZO A;  3CCQ A;  2UXB L;  2PI2 E;  4APV A;  4BA2 I;  3KFU A;  1Q1E A;  3PSI A;  4DR3 Q;  2R92 G;  1E22 A;  1HZC A;  1V9P A;  4DV2 Q;  3K81 C;  1UWV A;  3PGZ A;  1P8L A;  3EBE A;  4A3J G;  2YTV A;  1HR0 L;  2ZM6 L;  4IFD G;  1Y1W H;  2Z6K A;  2QEX A;  5AJ3 L;  2GN5 A;  1Q82 C;  5IYC H;  1LUZ A;  4UY8 C;  1EOV A;  4BBR G;  4ALP A;  2E2J H;  3TQY A;  4OWX B;  4HJ7 A;  4JI2 Q;  4GNX C;  3AEV A;  1X3G A;  1K3R A;  4B3M L;  2IY5 B;  2NVQ H;  5J3B A;  1K0R A;  4GNX B;  1Q7Y C;  3PO3 G;  3H3V H;  1FVI A;  5C3E H;  1PH2 A;  1A8V A;  2I0Q A;  4DR5 Q;  4LUO A;  4MNO A;  3NEM A;  1LTL A;  4DV0 Q;  1XNR Q;  2VUM G;  3S2H H;  4LF4 Q;  1K8G A;  2R93 H;  1K83 H;  4A3L H;  2K52 A;  4X64 L;  4DV3 Q;  2VW9 A;  2F3I A;  5JJL A;  2OCE A;  2UXD Q;  3S16 H;  4XTC S;  2F4V L;  2CFM A;  3UDX A;  3J7Z C;  1SRU A;  4K0K L;  4IFD J;  1IL2 A;  3HOU G;  2A8V A;  4BBS H;  2I5M X;  1I94 Q;  4A3D H;  1B70 B;  3OTO L;  3CCS A;  4P72 A;  2PQA B;  4A3M G;  1AE3 A;  5M5Y H;  1EIY B;  3HOZ G;  4HJ9 A;  2CCZ A;  1CKM A;  1X3F A;  3CW2 C;  3PCO B;  2NVX H;  3UDI A;  1T9H A;  4IPG A;  2ZTD A;  4P71 A;  3I7F A;  3FKI G;  3J81 i;  1M90 C;  3PV0 A;  4X66 Q;  2VY3 A;  4OON A;  1CKN B;  4GLX A;  1MJE A;  1SN8 A;  2VUM H;  4GS3 A;  2JA8 H;  2E5L Q;  4LF5 Q;  5IP7 G;  1PH4 A;  1Q12 A;  4LFA L;  4A3B G;  1VQF A;  1YNX A;  1CSQ A;  1X9N A;  4KHP L;  4JV5 Q;  4HIM A;  4JI8 Q;  3GTG H;  2WB1 G;  3I4M H;  2KCM A;  3S14 H;  3CPW A;  4A3E G;  2JEA I;  3M3Y H;  1V1Q A;  2JA7 H;  1G51 A;  4UP7 A;  3HOY H;  1CUK A;  1E1T A;  4C3I H;  5LMU Q;  1XNQ Q;  2K5V A;  1VQ5 A;  3ZJY C;  3HKZ G;  3I2Z A;  2ZJP A;  3CCR A;  1ASY A;  4L5R C;  1SLJ A;  4R4Q A;  4NXN Q;  2R6G A;  4LF6 Q;  1YEZ A;  3F1Z A;  5GAD C;  3NBH B;  1PH5 A;  3S1R H;  1VQI A;  2VQF L;  2JA5 G;  4POG A;  2JQO A;  3S17 H;  1U5K A;  1SRO A;  5IWA L;  1HNW L;  2K5H A;  2BH8 A;  1SMX A;  5IP9 H;  3F2C A;  2YV5 A;  3F2D A;  2KBN A;  4GN3 B;  4RMF A;  2VS1 A;  4JC0 A;  3CCV A;  2HIV A;  3PIO A;  3M4O H;  4DR7 Q;  3UE1 A;  3K8A A;  1XTD A;  1E24 A;  4PZ8 A;  4B3R L;  3SGI A;  5HGQ A;  1Y1V H;  4JI6 L;  1YJN A;  1N32 L;  4JI5 Q;  4AQY L;  4A3I H;  3LGJ A;  2WFW A;  4X62 L;  2HHH L;  1XPO A;  1PH3 A;  1OXU A;  2IHF A;  1WYD A;  3KLW A;  2UXC Q;  1IBM Q;  1WCM G;  5C0X I;  2VQE Q;  4A3F G;  5K36 G;  3S2D H;  1G6P A;  4TQU S;  1VQ8 A;  4JYA L;  2EXD A;  2OQ0 A;  4PG3 A;  3GTQ H;  3KF6 B;  4GKJ Q;  2Z0S A;  3G6E A;  2OQK A;  4GN5 A;  4DUZ L;  1J5E Q;  3HOV G;  4IJL A;  5BR8 L;  2RCN A;  1JJC B;  2D62 A;  4R1J A;  5GAG C;  1Q81 C;  1EWI A;  2C35 B;  1QVG A;  1B7Y B;  5M5X H;  2YU9 H;  3F8T A;  4DV4 L;  3BZC A;  4DR4 L;  4DV5 L;  3PUZ A;  1J6Q A;  1HNX Q;  3I4N H;  1N34 Q;  3GTP H;  1KXL A;  2LSS A;  3D0F A;  1L1O A;  5C4X G;  2ES2 A;  3PIP A;  1E7Z A;  1N36 Q;  2DUD A;  4X65 Q;  4DR6 Q;  1VQN A;  4HIK A;  2ZJR A;  1ASZ A;  2EQS A;  2D0P A;  4GOP C;  3K7U C;  1FJG Q;  4HJ5 A;  1N9W A;  4DNI A;  4BY7 G;  4JI7 Q;  1SFO H;  4LF9 Q;  4GOP B;  1IBL Q;  4DV1 L;  1FGU A;  1PFS A;  2KCT A;  4J15 A;  2GVA A;  1RIP A;  4B3S L;  3CQZ H;  2UUC L;  1NTG A;  2R92 H;  4KLK A;  3PF4 A;  3S24 A;  4DAM A;  4YY3 L;  4YCW A;  3S1Q H;  5C44 G;  3J80 c;  2I5H A;  3U50 C;  5IYD H;  3AFP A;  4NPS A;  1N8R C;  1I50 H;  3KDF A;  3T1Y L;  3PUX A;  2UUB L;  3I55 A;  1IXR A;  4QGU A;  1YHA A;  2ID0 A;  3PO2 H;  3CD6 A;  4GKK Q;  2DGY A;  2UUA L;  4DUY Q;  3PUV A;  4BBR H;  1L1O C;  2E2I H;  3RN2 A;  4XIG S;  4JI2 L;  1LYL A;  3U4V A;  1JE5 A;  2JK8 A;  2WP8 J;  2I5L X;  1MIU A;  5DLQ E;  4BY1 H;  2LXK A;  1VQ4 A;  1N33 Q;  4LUZ A;  3PO3 H;  5E7N A;  5IY0 A;  2PNH A;  2HIX A;  4MZ9 A;  4R4C A;  3L2P A;  4O0A A;  1NMF A;  2BA0 A;  4A3K G;  2RF4 A;  4TVA B;  3OYY A;  4DR5 L;  3GTK H;  2A19 A;  2HT1 A;  4LWC A;  1I6H H;  4LF4 L;  2K4K A;  4IOC A;  2JA6 H;  3KYH C;  3ERS X;  1YI2 A;  4AYB G;  1VQM A;  2BA1 A;  1VQJ A;  2ZTC A;  3GTJ H;  1K9M C;  4IPH A;  3U4Z A;  2RHS B;  3HOU H;  2B63 H;  1VQG A;  4PMW A;  4A3G G;  2IX0 A;  1IYJ B;  1VQE A;  1NY4 A;  2WAQ E;  3S1N H;  4A3M H;  1RL2 A;  2XTI A;  3CC4 A;  3HOZ H;  4NB3 A;  5AJ3 Q;  4DV7 Q;  1W3S A;  2Z6K C;  4JG2 A;  3M85 A;  1OXX K;  3AFQ A;  3IRB A;  2KHJ A;  3RNU A;  2B3G A;  3ULP A;  1KD1 C;  4JI1 L;  4UP9 A;  4IPC A;  2NN6 G;  4YWM A;  4HJ8 A;  4B3M Q;  3CP0 A;  2JA9 A;  3DM3 A;  1JB7 A;  5FLM G;  1VQK A;  4PZ7 A;  2E5L L;  3M4P A;  4QIW E;  1X3E A;  5IP7 H;  1E3P A;  4UP8 A;  1Z9F A;  4A4I A;  3JAM c;  1YIJ A;  2AWN A;  1YBY A;  1QZH A;  2AWO A;  2N49 A;  5GAE C;  4FDB A;  2OTJ A;  1VQH A;  3HOX G;  1UE1 A;  2PMZ E;  1BBW A;  1VCI A;  5GAH C;  5M3F G;  4NXN L;  1FL0 A;  1YHQ A;  2F4V Q;  3CMA A;  1IZ6 A;  2QA4 A;  5C0X G;  1K73 C;  4DR2 L;  2JA5 H;  1GVP A;  4LNQ A;  2R7Z H;  1HNZ L;  3CCU A;  3OTO Q;  2EIF A;  3H0G G;  4DKA C;  1A63 A;  5LMN L;  2D0O A;  3BZK A;  2NN6 I;  1HJP A;  3KOJ A;  1L0W A;  4OXP A;  1AE2 A;  4JI3 Q;  4Y7N H;  1D8L A;  4LFB Q;  2VL6 A;  3U58 A;  1GD7 A;  3RLO A;  4A93 H;  1OXS C;  1PH9 A;  3H3V I;  5FJ8 H;  3WWV A;  2JA8 G;  4JI5 L;  5M3M G;  3L7Z C;  4LFA Q;  4JI4 L;  2YYZ A;  2BH2 A;  3E0E A;  2N8N A;  4JBJ A;  4JOI A;  3I4M G;  1QUQ A;  4AH6 A;  2R93 G;  1BVS A;  3HOW H;  1IBM L;  2UU9 L;  4DV6 L;  1WCM H;  4B3T Q;  1B8A A;  4A3F H;  1YIT A;  4JI0 L;  3CCM A;  4LF7 L;  1GM5 A;  5ELO A;  4JBM A;  4NXM L;  1VQA A;  3CPF A;  5IYB G;  5C0X J;  4IPD A;  4AIM A;  3AQQ A;  3T1H L;  1IBK L;  4R4T A;  4LF8 L;  2ZJQ A;  3RR5 A;  2AKW B;  1NE3 A;  2NVY H;  2VQF Q;  1KAW A;  3UDF A;  1EIF A;  1C7Y A;  4X6A H;  1WOC A;  3TEH B;  5IWA Q;  4GLV B;  1BBU A;  4JBW A;  1Q1B A;  1N34 L;  2OTL A;  1KRS A;  3GD7 A;  1P16 A;  3HKZ E;  2Y0S E;  4LW1 A;  1VQ9 A;  1UE5 A;  1R9T H;  4YHH L;  3B6Y A;  4BXX H;  5C4X H;  3ICE A;  5GQO A;  1CSP A;  1Y1V G;  2B29 A;  4L5Q A;  3RLF A;  4JI6 Q;  4B3R Q;  2GVB A;  1VQC A;  1S72 A;  1NMG A;  1XMQ L;  4DPG A;  4AQY Q;  3A5Z B;  4A3I G;  1XMO Q;  3STB C;  1CKO A;  4X62 Q;  3ULL A;  2HHH Q;  1C9O A;  4JBK A;  4BY7 H;  1PA6 A;  1IBL L;  1PH1 A;  1Q86 C;  2ATW A;  1DGS A;  1OXV A;  2V1C C;  3K80 C;  3RLN A;  3CC7 A;  1PVO A;  2R7D A;  1PH7 A;  4JYA Q;  4UPA A;  2IT1 A;  1WI5 A; 
#chains in the Genus database with same CATH topology
 1VF7 A;  2FXQ A;  1TQO A;  4JW0 A;  1X32 A;  3K6O A;  5BR8 Q;  3EVQ A;  4Y7N B;  4DV2 L;  2EY6 A;  1QB5 D;  4I7Z C;  1TWF H;  1AH9 A;  2EXZ A;  3J7A 5;  4J8Q A;  2R3Z A;  1A6X A;  3A7A B;  1TT2 A;  1WCM B;  2F1M A;  2F52 A;  3J81 c;  2N55 A;  2Q2H A;  1JWS D;  2HCC A;  3DLL A;  5KND A;  1YJW A;  2ZXP A;  4EX5 A;  2NVY B;  3OIP A;  1Z47 A;  1PH8 A;  3KJP A;  3S15 B;  4DV0 L;  5EQ0 A;  2VUM H;  4S3S A;  5A2Q L;  5IE8 A;  2UXB Q;  3S1M H;  1LTI D;  4A3G H;  2UXD L;  1QVC A;  3T1Y Q;  2UUB Q;  1YVC A;  4ZUJ A;  4POF A;  3RZD H;  1VQ6 A;  1YHB A;  2ZM6 Q;  3H6M A;  4HJA A;  1KIX A;  1B4O A;  3I4O A;  2D5D A;  4QL5 A;  2MNA A;  5KRU A;  3D8G A;  4EQO A;  1LO5 D;  1SND A;  4JI8 L;  2K50 A;  3FP9 A;  1TWG B;  5E4W C;  3SE0 A;  4P73 A;  2Z8L A;  1TWF B;  4MTN A;  4A3E H;  2L4N A;  5LMU L;  3TP8 A;  3BU2 A;  3J80 i;  2R93 G;  2N78 A;  3BJU A;  4DNT B;  1XPR A;  4IUU A;  3EFX D;  2B63 G;  4GZY C;  1ML0 D;  3K5O A;  4K0K Q;  4NMZ A;  1B44 D;  1VQB A;  1KQS A;  1VQD A;  4K14 A;  1D5M C;  4AYB E;  4C2M H;  2OF1 A;  4FXK C;  3CKI B;  2VNU D;  1IKM A;  1OXT A;  1ESR A;  3T56 B;  3TP5 A;  3S1M B;  2HCI A;  3I56 A;  4A3G B;  1U0L A;  1PH6 A;  1WJJ A;  3HOY G;  3KF6 A;  3VYT A;  1JMC A;  1L0X B;  4NP5 A;  2ASB A;  2R7Z G;  1CFM A;  1E1O A;  3OW2 A;  1NJI C;  2EYM A;  4BA1 I;  1FYC A;  5LMN Q;  1I4G A;  1GO3 E;  4CDD C;  5JEA G;  3TS0 A;  3MEF A;  1SMY D;  3SK6 A;  1HZB A;  4RG1 A;  5FJ8 G;  1DOK A;  4Z9C B;  2HUG A;  3JAM i;  2WB1 B;  1XMO L;  1N36 L;  2G9H D;  4GOP A;  3HOW G;  3OWE B;  3C1E A;  5EJW A;  4DF7 A;  1QUQ B;  1YZ6 A;  1H95 A;  5IGF A;  3T1H Q;  3ERQ A;  2EE1 A;  1XYI A;  2A69 C;  1PDQ A;  3ONA B;  4C2M B;  4DR1 L;  3V05 A;  4IO9 A;  4DXG A;  4XXE A;  3AU7 A;  1ICW A;  3QIA A;  4DR4 Q;  4DV5 Q;  1MSH A;  4DUY L;  3GTG B;  3I72 A;  1EQQ A;  5NUC A;  1PYB A;  5JVH 3;  4OWW B;  2RBM A;  2F3V A;  3FHW A;  2Z9H A;  2H5X A;  2RVL A;  1R4P B;  2B2W A;  3UDG A;  1YNN D;  2B2U C;  5AFW A;  4OX9 L;  2WAQ G;  1X55 A;  3FPU B;  4ME3 A;  4O2D A;  4A3K H;  2CWP A;  1PV4 A;  3ER0 A;  5H1S E;  4X3U A;  4CJ2 C;  3KFU A;  3PSI A;  1NR4 A;  3M4O B;  4TRD A;  4KY6 A;  2NB0 A;  4C1N K;  5I9O A;  3K81 C;  1P8L A;  3EBE A;  2M9V A;  4UY8 C;  1NAP A;  4HCS A;  4ALP A;  4OIK A;  2NN6 H;  3TBI B;  1K0R A;  1EZ8 A;  1A2T A;  3BYY B;  3R93 A;  3H3V H;  2Z4H A;  1SBB B;  2WKD A;  2D9U A;  2XNA C;  4Q0F A;  2I0Q A;  1D1K A;  4EQN A;  4DR5 Q;  2WAC A;  5M5X B;  2VUM G;  4TKO B;  4A3L H;  5JJL A;  2OCE A;  3DXJ C;  3S16 H;  4J1M A;  4XTC S;  3H91 A;  3J7Z C;  4IFD J;  1RDP D;  1WVL A;  2I5M X;  1B70 B;  5CGK A;  4A3M G;  2EYJ A;  1X3F A;  3I7F A;  3K5L A;  2KOL A;  3J81 i;  4X66 Q;  2CW0 C;  4OON A;  3RMH A;  1CKN B;  2QF7 A;  2EYP A;  2PYK A;  3N52 A;  4OHJ A;  4RHR A;  4LF5 Q;  4LFA L;  3DWA A;  5J22 A;  4UAI A;  1E2V A;  4KHP L;  3SHL A;  2WB1 G;  1BCP C;  2FIN B;  4A3E G;  1V1Q A;  1G91 A;  4IUV A;  1ENF A;  1J9O A;  3HKZ G;  1HHV A;  3I2Z A;  1Q8I A;  3CCR A;  1ASY A;  4L5R C;  1YEZ A;  2JA5 G;  2F0P A;  3S17 H;  4QUC A;  1SRO A;  2WII B;  1HNW L;  2K5H A;  5IP9 H;  1HXY D;  3MFG A;  4RMF A;  3PIO A;  3CU7 A;  1CA5 A;  1E24 A;  4ZKC B;  2X6L A;  1LT4 D;  1TS5 A;  2E76 C;  2I07 B;  1N32 L;  4JI5 Q;  1SJH D;  2DJF C;  1PH3 A;  3KLW A;  4ABN A;  3S16 B;  2UXC Q;  2F0U A;  2VQE Q;  3S2D H;  5ELE A;  2CVR A;  1VQ8 A;  1C48 A;  2EXD A;  2F0K A;  3GTQ H;  4GN5 A;  4DUZ L;  1J5E Q;  4Q5V A;  4X6A H;  3A56 A;  1KDC A;  1A3V A;  5C5M A;  3I4N H;  1LAB A;  1N34 Q;  3OW7 A;  2LSS A;  3LWE A;  1MHW C;  1E7Z A;  5EKL A;  2DUD A;  2B8F A;  4HIK A;  2ZJR A;  1ASZ A;  3VA7 A;  3I91 A;  1H9S A;  4DV1 L;  1FGU A;  5G3L D;  2KCT A;  1ILQ A;  2GVA A;  1RIP A;  3CQZ H;  2R92 H;  1NTG A;  2A5H A;  4KLK A;  1I4R A;  1QOH A;  4DAM A;  4YY3 L;  1QNU A;  4IN3 A;  4NPS A;  1HUN A;  4K6L A;  1I50 H;  1SYG A;  2L1B A;  1S5B D;  1B3A A;  3PO2 H;  3A8J E;  1XXG A;  3DEP A;  2UUA L;  1FNU A;  4BBR H;  3MTS A;  3RN2 A;  4XIG S;  5C4H A;  1LYL A;  3X3M A;  4JI2 L;  1KNA A;  5ISR A;  1SYB A;  2I5L X;  1RCV D;  1ZKO A;  4BY1 H;  3S2D B;  3PO3 H;  5E7N A;  1MBY A;  2HIX A;  4MZ9 A;  3VR6 A;  3GTQ B;  2BA0 A;  4A3K G;  2RF4 A;  3O13 A;  4TVA B;  3ZYY X;  3GTK H;  1B9M A;  1SNM A;  4LF4 L;  1HCZ A;  2JA6 H;  3Q23 A;  5EPJ A;  3KYH C;  4RGO S;  3ERS X;  1VQM A;  1K9M C;  1VQJ A;  4P2C B;  1W6K A;  3I4N B;  2RHS B;  3HOU H;  4PMW A;  2WAQ E;  1IHZ A;  1NY4 A;  1STH A;  3NUC A;  4ZCK A;  5FO7 B;  2Q8R E;  4NB3 A;  3HOZ H;  1TS3 A;  1W3S A;  4PNY A;  2C9O A;  1QIL A;  1KLU D;  4UP9 A;  4IPC A;  5FLX E;  2NN6 G;  1C8C A;  4WOR A;  1L0Y B;  2F0H A;  4HJ8 A;  4B3M Q;  2CH4 W;  3DM3 A;  4X3S A;  1VQK A;  1BNZ A;  4PZ7 A;  2E5L L;  1O7Y A;  4PV1 C;  1E3P A;  4RKL A;  4A4I A;  2I46 A;  3CQZ B;  4K5X A;  2R92 B;  1JE4 A;  1PZJ D;  4FF3 A;  1U4M A;  3HOX G;  3QB3 A;  1I50 B;  2LMC B;  5GAH C;  4ME5 A;  4NXN L;  3PO2 B;  1FL0 A;  2QA4 A;  1IKL A;  4BBR B;  5C0X G;  4LMQ D;  4DR2 L;  1GVP A;  1K73 C;  1JB3 A;  1H9J A;  3T53 B;  2EIF A;  2VXW A;  4OO1 H;  1EIG A;  4FF1 A;  2NWG A;  2PMZ B;  4DKA C;  1A63 A;  4H44 C;  2TSS A;  3BZK A;  1LTT D;  2NN6 I;  1XX8 A;  4OXP A;  3PO3 B;  4JI3 Q;  4MN3 A;  1D8L A;  1BCP F;  2AUJ D;  4LFB Q;  4A93 H;  5FO9 B;  1PH9 A;  3H3V I;  2HQE A;  1G2S A;  5M3M G;  3L7Z C;  2Q8I B;  3VA5 A;  2JA6 B;  2YYZ A;  3E0E A;  4JOI A;  1QUQ A;  4AH6 A;  1STY A;  2UU9 L;  4B3T Q;  4JI0 L;  4LF7 L;  4A3F H;  2RDH A;  3CCM A;  3HOU B;  5ELO A;  4NXM L;  1NSN S;  4CDF C;  2B8G A;  3CPF A;  2B2Y C;  5IYB G;  2E2H B;  4U68 A;  2KEE A;  3HOZ B;  1JOR A;  4R4T A;  1PZI D;  4FXG C;  4NDX A;  2VQF Q;  4HED A;  4ZYS A;  3FKI B;  2SDF A;  5IGC A;  5IWA Q;  4HCE A;  1CTM A;  4JBW A;  4DU9 A;  2OTL A;  3GD7 A;  3HKZ E;  4RH6 A;  4A3B B;  1MGS A;  4YHH L;  2IPK D;  2QEJ C;  5C4X H;  3ICE A;  2PO4 A;  4JI6 Q;  2NTS A;  1VQC A;  1SE2 A;  1NMG A;  1S72 A;  2BDO A;  3QG1 A;  3STB C;  2Y0S B;  1D1I A;  2F3W A;  3VYS A;  1DZ1 A;  2R7D A;  4UPA A;  3BDO A;  3QWN A;  3CCJ A;  3KUP A;  2A1A A;  3TRE A;  3NBI A;  2CWA A;  4QJF A;  4DR3 L;  1NNX A;  1A0I A;  1X3P A;  3TP7 A;  4H02 A;  1A62 A;  2J0T D;  5ELN A;  1B50 A;  4LFC Q;  2IHE A;  2A73 B;  2YTY A;  3HP3 A;  1GJX A;  2L15 A;  1E0B A;  1BKB A;  3I70 A;  1TS4 A;  3N6R A;  4XYO A;  2EJF C;  4A3F B;  2MP1 A;  3BVZ A;  3G6J B;  3C46 A;  3KLR A;  3GV6 A;  4YCU A;  2EPB A;  4FF4 A;  2RDF A;  3DMU A;  4N9P A;  2F0D A;  1CHP D;  4B3S Q;  5DAU A;  3D31 A;  4A75 A;  1VQ7 A;  2UUC Q;  4KI0 A;  3GTL H;  1M8A A;  3G48 A;  2FJ2 A;  1EFW A;  4L5S A;  3H15 A;  4DV7 L;  3PO2 G;  1I94 L;  5C4X B;  4IJH A;  2K14 A;  2KA7 A;  1JJ2 A;  4V19 0;  3NXW A;  1F9R A;  1Y14 B;  2DJG C;  1CKN A;  1TWC H;  2RQX A;  4BY1 G;  5CBA E;  1X54 A;  2SNM A;  4Y52 H;  2BDN A;  1UAP A;  4ZRZ A;  1V1P B;  2L55 A;  4DNR B;  4RGT A;  3A7L A;  2F4I A;  2XVS A;  3GO5 A;  3H09 A;  3NWT A;  3RZO H;  5C44 B;  5T1I A;  1EQT A;  1BQQ T;  2A68 D;  5C3E G;  5LL6 S;  2LXJ A;  3KF8 B;  4G7O C;  2JA6 G;  5COY A;  1U9R A;  3H94 A;  1NBW A;  2ZXR A;  3DM1 A;  5M3F H;  1HR0 W;  2R7F A;  2SNS A;  1EWH A;  1HQR D;  1SJE D;  1ZXT A;  1JWU D;  2F0J A;  3H0G H;  4JK1 C;  4EQ5 A;  4BBS G;  2J4X A;  2VB2 X;  3FPP A;  3M4Q A;  1QNK A;  4OEL B;  1X56 A;  1SNQ A;  1YJ9 A;  1LLR D;  2RDG A;  3CC2 A;  1BXT A;  4DGZ A;  2B2V A;  4X3T A;  2KEC A;  1D7Q A;  2Y0S G;  4ZK9 B;  3W5O A;  3Q6S A;  3IFT A;  3J80 E;  1HNZ Q;  4DK6 C;  4GKJ L;  4OO1 G;  4K5W A;  1TWC B;  2EJM A;  2Q2T A;  4WJ4 A;  3PF5 A;  1MD2 D;  3CCE A;  4PZ6 A;  3F2U A;  3S15 H;  2AHO B;  4YWL A;  2MO1 A;  3M7G A;  4A93 G;  1TS2 A;  5C4Z A;  1S5C D;  5JAV A;  3K5N A;  4EGV A;  1VS0 A;  2Q2U A;  4JI4 Q;  3TRZ A;  1S40 A;  2XGT A;  4RFB A;  4X65 L;  4A76 A;  5M3F B;  2A6E D;  4DR6 L;  4OIJ A;  4RCO A;  1EUJ A;  1FJG L;  1PFB A;  2Z4I A;  4JI7 L;  2EJG C;  2ZTE A;  4LF9 L;  1PRT C;  3CAM A;  3UI2 A;  5M5Y B;  3H0G B;  1H9M A;  4HAE A;  2Z1C A;  4OO1 I;  1JQY D;  3M7N A;  3VDY A;  2MJ8 A;  3M9B A;  3RD4 A;  3KJO A;  1IYU A;  3RN5 A;  5JEA J;  2JA8 B;  1TWG H;  2A6H C;  5EBD A;  4YWK A;  3K7A H;  1KDA A;  4OWT B;  3I4M B;  2ICI A;  4R4O A;  5KIX A;  5HUR A;  3M3Y B;  4WJ3 M;  3NWS A;  4C3I B;  3ULJ A;  1XMQ Q;  1Q8K A;  1EU3 A;  3JAM E;  4A3C H;  1EY8 A;  4HIO A;  1KC8 C;  3NQT A;  5JJI A;  1CQV A;  5CBE E;  5M9O A;  2UXB L;  4APV A;  1H9S B;  1LTS D;  4DV2 Q;  1F2L A;  4KD4 A;  1BR9 A;  4H7B A;  2ZM6 L;  2Z6B A;  1Y1W H;  2F0F A;  2QEX A;  5IYC H;  1QG7 A;  5IGD A;  4IUT A;  5JJZ A;  2E2J H;  4RGM A;  4OWX B;  4UDU C;  3T4A C;  2NVQ H;  4GNX B;  2BE5 D;  2RKS A;  1PH2 A;  5J1Z A;  1HUM A;  2KQ3 A;  1ESF A;  3A54 A;  4RAU C;  1LTL A;  4DV0 Q;  1WTW A;  3S2H H;  3C1F A;  3E5S A;  1G8Z D;  2K52 A;  4KKS A;  5IOD A;  3GTP B;  2UXD Q;  3K7A B;  4K0K L;  3UDX A;  3NQI A;  1SRU A;  5LHY 1;  1IL2 A;  2B2T A;  5FOB B;  4A3D H;  3OOC A;  2GA4 B;  4P72 A;  1AE3 A;  2CCZ A;  3TSS A;  2O5I C;  3CW2 C;  5LL6 X;  2ZTD A;  1EEF D;  1SYC A;  1SN8 A;  1PH4 A;  1Q12 A;  3FRP B;  1SNO A;  3GTG H;  2XWJ B;  4JI8 Q;  3S14 H;  2H1E A;  3MXG A;  5F2D A;  2JA7 H;  2K03 A;  4DAP A;  1CUK A;  5LMU Q;  4DFA A;  1Y1W B;  1SNC A;  1EY0 A;  2CW0 D;  4R4Q A;  2R6G A;  1J8I A;  4I65 A;  3NBH B;  1PH5 A;  2E2J B;  4XQN A;  2JQO A;  1TY0 A;  1SYF A;  1Y8P B;  5I4D A;  1SMX A;  2NVQ B;  3GP7 A;  2YV5 A;  2KBN A;  4KJO A;  3M4O H;  2VS1 A;  4JC0 A;  2HIV A;  4WJW A;  3UE1 A;  1I6H B;  1PYW D;  4PZ8 A;  3SGI A;  1AN8 A;  1Y1V H;  1JWM D;  1ONL A;  2PZT A;  3S2H B;  4AQY L;  4FP5 D;  2IHF A;  5E3F A;  2RSO A;  5JVG 3;  1WCM G;  5K36 G;  4A3D B;  1NR2 A;  4WRD A;  1G6P A;  2A74 C;  4OGQ C;  4JYA L;  3ND9 A;  3W3A A;  5ELF A;  2K05 A;  3G6E A;  1AFP A;  3VYU A;  1QJO A;  2XWB B;  1STE A;  3I3C A;  2D62 A;  5GAG C;  1QVG A;  2YU9 H;  1KAA A;  2M2L A;  5KYI A;  5M5X H;  1BDO A;  3F8T A;  4DR4 L;  4DV5 L;  3PUZ A;  1J6Q A;  1PTO B;  1KXL A;  1PRT F;  3S14 B;  1N36 Q;  1RTO A;  2JA7 B;  1VQN A;  1GHJ A;  3DUZ A;  4GOP C;  1SFO H;  4J15 A;  1JC7 A;  1WTO A;  2K04 A;  3KBG A;  3OWF A;  3PF4 A;  4O1N A;  5T1G A;  1LAC A;  4PMC A;  3U50 C;  4BS9 A;  3AFP A;  3OHX C;  3NE5 B;  4KTA A;  1N8R C;  3PUX A;  4IFD H;  1CQF A;  1KAB A;  1YHA A;  4EQP A;  5C3W A;  4GKK Q;  1Y1V B;  4DUY Q;  3VYR A;  2E2I H;  2MGS A;  4JVZ A;  3A8I E;  3PIP 3;  3J7A F;  1MIU A;  1V1P A;  1JIC A;  5IGE A;  3FEW X;  2MHV A;  1O7L A;  2B2W C;  2FFK B;  3QOL A;  3KF8 A;  4O0A A;  3GV3 A;  4DR5 L;  1DYQ A;  3SXH A;  2XN9 C;  5CR3 A;  2YU9 B;  3MFY A;  2EYH A;  2ZTC A;  4N8X 1;  4CKB A;  3HEJ A;  3WOF A;  4ZLT F;  4A3G G;  2XRQ D;  4LK1 C;  1SEB D;  1RJT A;  3AFQ A;  2KHJ A;  1KD1 C;  4JI1 L;  1Q90 A;  1X3Q A;  1SXT A;  3U9S A;  3LWU A;  2K1B A;  1BBX C;  1SFO B;  3M4Y A;  2JA9 A;  3MXP A;  1B9N A;  3M4P A;  1ET6 A;  1X3E A;  2R61 A;  3P75 A;  5IP7 H;  1YIJ A;  2AWN A;  2AQ3 B;  4K6D A;  1ZYR D;  2N49 A;  4FDB A;  1UE1 A;  1PMR A;  4QIW B;  4RKB A;  1VCI A;  1VDZ A;  1PFM A;  1IZ6 A;  2OXP A;  3D4D A;  3P20 A;  2E2I B;  4KK7 A;  4FYD A;  2D0O A;  3KOJ A;  1L0W A;  5E4X A;  2WIN B;  1ENC A;  1SYE A;  2XRS D;  2K6A A;  4JI5 L;  4KKU A;  5IT9 E;  1HPC A;  4LFA Q;  4IUN A;  2BH2 A;  5EGT A;  5I6W A;  3MEH A;  1SMY C;  4DV6 L;  4IUQ A;  4HTH A;  5KNB A;  1HTP A;  1VQA A;  4IAL A;  5C0X J;  2D2C C;  4IPD A;  1TY2 A;  3AQQ A;  1IBK L;  3GTM B;  4LF8 L;  2ZJQ A;  4RGN A;  2F0E A;  1H9K A;  1KAW A;  1C7Y A;  4KN7 C;  2QIL A;  3FVQ A;  2SOB A;  4GLV B;  4XQJ A;  3AMU A;  2NUC A;  3I73 A;  1N34 L;  3MC0 B;  2G5D A;  4LW1 A;  3B6Y A;  1Y1V G;  3R3O A;  2E75 C;  1JOQ A;  1F9Q A;  4JBK A;  4K2K A;  3ULL A;  4QB4 A;  1C9O A;  4BY7 H;  3R8B A;  5J39 A;  1Q86 C;  2ATW A;  3RLN A;  3CC7 A;  1PH7 A;  1PTO D;  3J7A V;  2Q2I A;  4DUZ Q;  4HID A;  1MKH A;  3TS2 A;  5D14 A;  1YNN C;  3HFZ B;  2HQL A;  2JE6 I;  2FMM A;  2K01 A;  2PI2 A;  4K5V A;  4CJ1 B;  2OWO A;  1F77 A;  5M5W H;  1QE6 A;  2TMP A;  4GNX A;  1L1O B;  1GUS A;  1L2F A;  3TP6 A;  2EVB A;  1F2Y A;  1X6O A;  4DV1 Q;  2AQ2 B;  1AZP A;  2F0I A;  2AUK A;  5IOC A;  1I4Q A;  2BCO A;  2RHQ B;  1XNR L;  1LM0 A;  1DJR D;  4YY3 Q;  3J81 j;  1GUN A;  4WFN 3;  4DV3 L;  1TWA B;  1VQO A;  1VQL A;  1EFI D;  3QO2 A;  3IFD A;  3MXN B;  2K7V A;  2UUA Q;  2KEN A;  5ELD A;  2X6G A;  1HR0 Q;  2E2H H;  4C3H B;  1E2Z A;  1G29 1;  3D6W A;  4BY7 B;  2K75 A;  3R2T A;  1K8A C;  2SEB D;  1UE7 A;  1HZA A;  3EIV A;  5FLM H;  1B53 A;  3FKI H;  4L63 B;  2EYL A;  5DM6 3;  5A2Q E;  2G9D A;  4ZQ3 A;  3HZX A;  3NEN A;  4DAY B;  3TN2 A;  4A3B H;  5ELC A;  4JV5 L;  4DK1 A;  1HFG A;  1MI2 A;  1JJG A;  4ULL A;  3J7Y W;  1HZ9 A;  1EQR A;  1XNQ L;  1KRT A;  4A3L G;  1S5D D;  4IFD I;  3NBH A;  4X64 Q;  1EL0 A;  5M5W B;  1V8Q A;  3BVG A;  3NP8 A;  4LF6 L;  2ICE C;  5KEE A;  1TR5 A;  3KBX A;  4JI3 L;  2WKC A;  4LFB L;  1T5E A;  3C2P A;  1JOK A;  4GN4 B;  4DR7 L;  5CYU A;  1G2T A;  4HSP A;  2AMC B;  1XJV A;  2ENB A;  3OPO A;  4AYB B;  4OL7 A;  4B3T L;  1C4Q A;  1IW7 D;  1XTC D;  1GXD C;  1UEB A;  3MHB A;  3GTO H;  3MVV A;  1LT6 D;  3BDL A;  4DR2 Q;  1CI3 M;  1TKW B;  1V43 A;  2KHS A;  4IOA A;  4K8J A;  3HOV H;  5C4J H;  1C0A A;  1EY6 A;  2WB1 E;  1DXM A;  1MJC A;  1Q46 A;  3F2B A;  1VF5 C;  1HNX L;  5IP9 G;  4DAV A;  1LTR D;  1Z7T A;  4DK3 C;  5HGT A;  4ZAI A;  5I2X A;  1NUC A;  3LNN A;  3VR5 A;  1VMC A;  4JOI C;  4K2L A;  1S3O A;  1PYS B;  2UU9 Q;  4JI0 Q;  4LF7 Q;  1EOT A;  4JPB W;  2H4O A;  4QQB X;  4P75 A;  4NXM Q;  4CKC A;  1V1O A;  3P7J A;  2JJQ A;  1LT3 D;  3SEB A;  1I4X A;  5C44 H;  4CDE C;  2N3S A;  3K0X A;  4LFC L;  5JPM C;  4DV4 Q;  1CK1 A;  3E9H A;  4YHH Q;  3I4N G;  3CRK C;  4BWG B;  2RSN A;  1EYG A;  3G4S A;  1FNV A;  1Z6H A;  1EYD A;  1N33 L;  2DY8 A;  3GTO B;  4QY7 A;  4X3K A;  1GUW A;  2LFN A;  4NW2 A;  2KVM A;  5GRO A;  3HOV B;  5C4J B;  2NZO A;  2MUY A;  1Q1E A;  2FHT A;  4DR3 Q;  2R92 G;  1E22 A;  2F0O A;  4B9X A;  2PPB C;  1UWV A;  3PGZ A;  2FMC A;  2K28 A;  5D3D A;  1FNW A;  4U67 3;  2YTV A;  2Z6K A;  5AJ3 L;  2GN5 A;  4O42 A;  4A3I B;  1LUZ A;  1EOV A;  4BBR G;  4CGY B;  4RCN A;  4IZ8 A;  1LV9 A;  1X3G A;  1U4R A;  5CV7 A;  3PO3 G;  1CZW A;  3CRL C;  2C5C A;  2HDL A;  2K32 A;  4LUO A;  1O78 A;  3E6Z X;  4ODG A;  1BF4 A;  2R93 H;  1K8G A;  1K83 H;  5E1F A;  2L12 A;  4QMG A;  2F3I A;  3IKJ A;  2F4V L;  3HOU G;  1I94 Q;  4KJN A;  3OTO L;  1F2Z A;  2PQA B;  5M5Y H;  3HOZ G;  3QOJ A;  3D6C A;  3TZD A;  3FKI G;  1YNJ C;  2DY7 A;  3PV0 A;  1F9P A;  1OO9 B;  1FD7 D;  1MJE A;  4GS3 A;  4HMJ A;  2JA8 H;  3S1Q B;  4A3B G;  1VQF A;  1YNX A;  5IIF A;  1X9N A;  5JOB A;  3I4M H;  2KCM A;  4R8N A;  2JEA I;  3M3Y H;  3TZU A;  1G51 A;  4UP7 A;  3HOY H;  1E1T A;  4C3I H;  2PW5 A;  1VQ5 A;  2ZJP A;  1SLJ A;  2NZ1 D;  3I8Z A;  4POG A;  3S1R H;  2AQ1 B;  2K33 A;  4LJZ C;  1STN A;  3H3V C;  2BH8 A;  5JEA H;  4FXD A;  4HR7 B;  1HA6 A;  1S5E D;  3SR1 A;  5FO8 B;  1DD2 A;  3NK9 A;  3K8A A;  1XTD A;  4KV6 A;  4B3R L;  5HGQ A;  1ENA A;  2R93 B;  1K83 B;  3LGJ A;  4X62 L;  2B63 B;  2HHH L;  2KJX A;  2B2V C;  4R9W A;  3S1N B;  1IBM Q;  3MA2 B;  4A3F G;  5C6A A;  2L0C A;  4GKJ Q;  2Z0S A;  2OQK A;  3HOV G;  5BR8 L;  2RCN A;  1JJC B;  4R1J A;  3Q22 A;  2C35 B;  1B7Y B;  3BZC A;  3PIO 3;  3FDT A;  2E74 C;  3GTP H;  1E2W A;  1WTH A;  3D0F A;  1L1O A;  5C4X G;  1KDB A;  4X65 Q;  4DR6 Q;  3HOY B;  2EQS A;  4MIU A;  2D0P A;  1FJG Q;  4HJ5 A;  1N9W A;  4IUP A;  2A69 D;  4DNI A;  2R7Z B;  4JI7 Q;  5BN3 A;  4LF9 Q;  5G3L F;  1IBL Q;  1PFS A;  3S1R B;  2KED A;  2N88 A;  4YCW A;  5C44 G;  3MWY W;  2I5H A;  3MXN A;  5IYD H;  3LX0 A;  3T1Y L;  2QCP X;  2UUB L;  4QGU A;  1DOM A;  1L1O C;  3HOW B;  3OMG A;  5D65 A;  1K28 A;  2JK8 A;  2WP8 J;  1I4H A;  4LAA A;  4G4K A;  5DLQ E;  2LXK A;  4DAY A;  5CC4 A;  4LUZ A;  5EPL A;  3SK5 A;  2PNH A;  4FO2 A;  3L2P A;  1NMF A;  5FLX L;  3KLS X;  1I6H H;  2K4K A;  1NCV A;  2PQE A;  4F87 A;  1YI2 A;  2OEO A;  2VB3 X;  3GTJ H;  1R9T B;  4KHV A;  4IPH A;  3U4Z A;  2IX0 A;  2EY1 A;  1B3Q A;  1IYJ B;  2A68 C;  3A8K E;  4A3M H;  2QDL A;  1K3B C;  4JG2 A;  4G57 A;  1OXX K;  3IRB A;  5IGG A;  3RNU A;  1CT1 D;  5L37 A;  1WTX A;  1AP0 A;  2WAQ B;  4FVM A;  3OMC A;  3CP0 A;  1JB7 A;  4UP8 A;  1JCK B;  1SAP A;  1YBY A;  3IAY A;  1GOZ A;  1PTO H;  2EZV A;  5GAE C;  3DWQ A;  4I7A A;  1B1Z A;  2O5J C;  4NKL A;  2IL8 A;  2PMZ E;  4L6T B;  1A2U A;  1UEA B;  3V96 A;  5A35 A;  5M3F G;  3WOE A;  3NTI A;  4CJ0 B;  3NHH A;  2L5T A;  2JA5 H;  4LNQ A;  2B2T C;  2NTT A;  3BZD B;  5DNF A;  3CCU A;  3ND8 A;  1FR3 A;  3H0G G;  5LMN L;  1GUT A;  1HJP A;  1EIH A;  2LS0 1;  3SK4 A;  2VL6 A;  2E2D C;  1BCP D;  4E6I A;  3RLO A;  1OXS C;  4G7H C;  1D6E C;  1EEI D;  4C56 C;  3WWV A;  2F0M A;  3MXU A;  2JA8 G;  2VUM B;  3J81 E;  3Q0A A;  3NPP A;  4JBJ A;  3I4M G;  3NTK A;  3GTJ B;  2JN4 A;  4PQX A;  1A15 A;  2RCF A;  4C3I G;  3RZD B;  1GM5 A;  4JBM A;  4B08 A;  4A3M B;  4QUF A;  1K8M A;  3T1H L;  2A6E C;  3P1H A;  2AKW B;  5I6Y A;  3UDF A;  1EIF A;  1XWE A;  4ZUI A;  1STA A;  3KK7 A;  1WOC A;  3TEH B;  2EY2 A;  1BBU A;  3VR4 A;  3I90 A;  1VQ9 A;  2Y0S E;  5CV4 A;  1UE5 A;  2K5D A;  4BXX H;  2F03 A;  4A3E B;  3RLF A;  3RUZ A;  4YIJ A;  2GVB A;  2F0S A;  1LTA D;  3A5Z B;  4CKE A;  4AQY Q;  1XMO Q;  1IL8 A;  1CKO A;  3HKZ B;  1RF2 D;  5TSS A;  1HFN A;  5CV8 A;  1PH1 A;  2B2U A;  2JA5 B;  1DGS A;  1OXV A;  4OEM B;  2Q8T A;  4JYA Q;  4N9T A;  2IT1 A;  2CQO A;  2DN8 A;  1SE8 A;  1QVF A;  3DEO A;  4DR1 Q;  3W1B A;  4GKK L;  3URY A;  1F2M A;  4A3J H;  1JOO A;  1TXY A;  2MFI A;  2IX1 A;  2VZA A;  1EWC A;  3GDE A;  1LT5 D;  5IT9 c;  1A3U A;  1SE4 A;  1XPU A;  3A0J A;  1I6V C;  4TSS A;  2CQA A;  1T5X D;  4QCL A;  4A3C G;  3PUY A;  2E8G A;  2NYZ D;  1VQP A;  3AYH B;  4IQZ A;  3CHB D;  4OX9 Q;  4R8I A;  2V4D A;  1JT8 A;  4LUV A;  1UE6 A;  3BVM A;  5IYD G;  1QWY A;  2BE5 C;  3SVM A;  2PQA A;  3S9W A;  2PNR C;  1KL9 A;  1ROD A;  1X65 A;  3KDF B;  1WTP A;  1Y1W G;  3V2T A;  1KLG D;  3PUW A;  3GTM H;  5IYC G;  2F0G A;  4X66 L;  3CXC A;  5CV6 A;  4N8F A;  4YCV A;  1RTN A;  4LF5 L;  3CME A;  4DXF A;  1DCZ A;  3EQL C;  3HOX H;  3DWP A;  5FKA C;  3BS1 A;  1EZ6 A;  2JYO A;  2OT2 A;  2QKI C;  2MQH A;  5BN4 A;  1TWH H;  4A3J B;  5C0X H;  2IW3 A;  5HY6 A;  3UE0 A;  2LY7 A;  4FNF A;  1WFQ A;  4ZKB B;  4A3D G;  1EYA A;  1I5F A;  1D5X C;  5CMD A;  4JI1 Q;  1HH2 P;  4IUR A;  3JC6 6;  3J80 L;  3K59 A;  3EA6 A;  4FF2 A;  3HG9 A;  1TU2 B;  4A3K B;  1SR3 A;  5M3M H;  2PZU A;  1MSG A;  3Q8D A;  1PLF A;  3EJI A;  1BO0 A;  1GKH A;  2KHI A;  2XIW A;  1B2T A;  5D3I B;  3CCL A;  3EN2 A;  4DK0 A;  1U4P A;  2IX3 A;  4KHP Q;  1M1K C;  2CKZ B;  2UXC L;  1Q3L A;  5IYB H;  5JJK A;  2VQE L;  2JA7 G;  3TME A;  3TDQ A;  1GHK A;  2EOT A;  3SK8 A;  4CHT B;  3QJY A;  1AW7 A;  5CV5 A;  3A74 A;  3W1G A;  2ALY B;  1EQV A;  2ZXO A;  1J5E L;  4XDX A;  2XSC A;  4KHZ A;  1STB A;  1HNW Q;  1U4L A;  3G71 A;  2HD3 A;  4C3J H;  1TWA H;  5FLX c;  1CA6 A;  2NZH A;  5C5L A;  3HOX B;  3E9I A;  2B39 A;  3R2I A;  3HKS A;  3OIQ A;  3L9A X;  1N32 Q;  3GQB A;  1QZG A;  1TWH B;  4C3H H;  4HSV A;  4DV6 Q;  2MO0 A;  3L0O A;  5EAY A;  5CV9 A;  1WTR A;  1PHJ A;  5LMN W;  2F0T A;  4M1U B;  3A5U A;  3JAM L;  1IBK Q;  1PRT B;  4PMB A;  4LF8 Q;  4P74 A;  1W2B A;  2M00 A;  2JEB I;  5EBC A;  4HMI A;  2O4X A;  1O7I A;  1RHP A;  1KHI A;  4JCV E;  1OTC A;  3HS0 C;  4H13 C;  3T16 A;  5M3M B;  3STB D;  3U9O A;  2NVT H;  1DM0 B;  5DM7 3;  4R4I A;  4XQQ A;  2QGQ A;  4BXX G;  2LKV A;  4RHS A;  1F9S A;  1SYD A;  3DHQ A;  2K5N A;  1PZK D;  2YTX A;  4UHV A;  3CF5 A;  1RKN A;  1WD0 A;  4GLA C;  1RD9 D;  3NEL A;  2CHB D;  2EYO A;  3NSW A;  3S17 B;  1PXU A;  4L5T A;  1I3Q H;  3CCQ A;  2PI2 E;  1O80 A;  4BA2 I;  2O2L D;  1HZC A;  3PMF A;  1V9P A;  4F88 A;  4C3J B;  1EY4 A;  4A3J G;  1HR0 L;  5BN5 A;  4IFD G;  1AZQ A;  3SDZ A;  1Q82 C;  3E0J A;  3TQY A;  3OSO A;  4HJ7 A;  4JI2 Q;  4GNX C;  3AEV A;  1K3R A;  4B3M L;  5C3X A;  2IY5 B;  1QCB D;  2JSO A;  5J3B A;  4K8I A;  1Q7Y C;  3I4L A;  3ITP A;  4C1N I;  1FVI A;  5C3E H;  1A8V A;  1EU4 A;  4MNO A;  3NEM A;  1I4P A;  1XNR Q;  1O7Z A;  4LF4 Q;  1EY7 A;  4X64 L;  4DV3 Q;  2VW9 A;  4QF4 A;  5EKI A;  5I2Y A;  2NVT B;  1G6Z A;  2CFM A;  3MAQ A;  1ZYR C;  2A8V A;  4BBS H;  1Y8O B;  3CCS A;  1EIY B;  4HJ9 A;  3QR8 A;  1CKM A;  3PCO B;  2NVX H;  3UDI A;  1T9H A;  4IPG A;  4P71 A;  4XYQ A;  4KN4 C;  1M90 C;  2VY3 A;  2IWH A;  4GLX A;  2E5L Q;  2JP1 A;  1I3Q B;  3NTH A;  5IP7 G;  4B9W A;  1CSQ A;  4JV5 Q;  1UUP A;  4HIM A;  2BOS A;  3CPW A;  4ILW A;  1CHQ D;  4EVO A;  3J81 L;  1DOL A;  1JR0 D;  1XNQ Q;  2EYF A;  1D5Z C;  2B2Y A;  2K5V A;  3ZJY C;  5KGU A;  4XT1 B;  1ILP A;  1YNJ D;  2K5W A;  3E3X A;  2KCC A;  5DEH A;  4NXN Q;  4LF6 Q;  3F1Z A;  5GAD C;  1VQI A;  2VQF L;  4BY1 B;  1CZG A;  1S5F D;  1U5K A;  5IWA L;  3L3O C;  2DNE A;  3F2C A;  4HN7 A;  3F2D A;  4KD3 A;  4GN3 B;  3GTK B;  3CCV A;  5K5P A;  4DR7 Q;  5C3E B;  2EDG A;  1HQM C;  3BDC A;  3T13 A;  3KLS A;  4F7X A;  1YJN A;  4JI6 L;  3BYT B;  1SNP A;  2WV6 D;  3K0Y A;  1EY9 A;  4A3I H;  4F8M A;  2WFW A;  1SSO A;  1XPO A;  1LTB D;  1OXU A;  2K5Q A;  1II3 A;  1WYD A;  5EKK A;  5C0X I;  4BBS B;  4TQU S;  1D2B A;  1LTG D;  2OQ0 A;  4PG3 A;  3KF6 B;  4L8J A;  2NVX B;  2KUM A;  1VMP A;  4IJL A;  3Q24 A;  2J7Z A;  2F0V A;  5FK9 C;  3T51 B;  1Q81 C;  1ZEQ X;  1EWI A;  1GUO A;  4KKT A;  3HRZ C;  4DV4 L;  1BOS A;  1Y69 U;  1PTO C;  2ZT9 C;  1HNX Q;  4KY7 A;  5ELB A;  4C3J G;  3D4R A;  1W6J A;  3VR3 A;  1EYC A;  1PRT D;  1R4Q B;  1CM9 A;  2ES2 A;  3PIP A;  1HRJ A;  1WTQ A;  4C3H G;  5COR A;  3K7U C;  4BY7 G;  5JPN C;  2F0N A;  4GOP B;  4MTK A;  4J6H A;  4RWS C;  1K0S A;  2MPM A;  2A6H D;  1HA5 A;  4B3S L;  2UUC L;  3S24 A;  3S1Q H;  3J80 c;  4A93 B;  3KDF A;  3I55 A;  1IXR A;  2PZW A;  2ID0 A;  3CD6 A;  2DGY A;  2IJ0 A;  3PUV A;  5EPK A;  1SDF A;  3U4V A;  1JE5 A;  1FGB D;  2P5Z X;  1N33 Q;  1VQ4 A;  5IY0 A;  2CH4 A;  4R4C A;  1EY5 A;  3OYY A;  2A19 A;  2HT1 A;  3X3N A;  4LWC A;  3MZ5 A;  4IOC A;  1WTV A;  3A55 A;  2L9H A;  4AYB G;  2BA1 A;  2QDB A;  4H0L C;  4V0B A;  1UNS A;  2B63 H;  1VQG A;  1VQE A;  3S1N H;  1AEX A;  1RL2 A;  2XTI A;  3CC4 A;  4DV7 Q;  5AJ3 Q;  2Z6K C;  2PCF B;  2PW7 A;  3M85 A;  3IL8 A;  2B3G A;  3ULP A;  1KTK A;  4YWM A;  4XT3 B;  5FLM G;  4QIW E;  4M8A A;  1ET9 A;  1ICF B;  1Z9F A;  3JAM c;  1QZH A;  4ID6 A;  2AWO A;  2OTJ A;  1TVX A;  4KY5 A;  1VQH A;  2RA4 A;  1PFN A;  5IT9 L;  5KNC A;  1BBW A;  3HGB A;  1YHQ A;  2F4V Q;  1BCP B;  3CMA A;  1SE3 A;  2R7Z H;  1HNZ L;  1IW7 C;  3OTO Q;  3PQI A;  5KYL A;  1HTL D;  2QW7 A;  4CBV A;  2X69 A;  2F0Q A;  1AE2 A;  4Y7N H;  1DON A;  3U58 A;  1GD7 A;  2F0L A;  3D4W A;  1GUG A;  3WDN A;  5FJ8 H;  1TII D;  3GTL B;  4JI4 L;  2DNC A;  2N8N A;  2EY5 A;  2L11 A;  5I9P A;  1BVS A;  1BUV T;  3K5M A;  2HDM A;  1WD1 A;  1IBM L;  3HOW H;  1WCM H;  1B8A A;  1YIT A;  5K36 H;  3G7L A;  1Y8N B;  1IYV A;  4G7Z C;  3C3L A;  5IGB A;  4AIM A;  4MHE A;  1M4V A;  3K58 A;  3AB9 A;  3RR5 A;  4KMU C;  1NE3 A;  2NVY H;  2NBF A;  1A3T A;  3D3R A;  1S4Z A;  4RA8 A;  1Q1B A;  1KRS A;  3K57 A;  1P16 A;  3RZO B;  3W2D A;  1R9T H;  4DN4 M;  1STG A;  3BG3 A;  5GQO A;  1CSP A;  2B29 A;  4B3R Q;  4L5Q A;  1H9R A;  2JXM B;  1XMQ L;  1K8O A;  4DPG A;  4A3I G;  3VR2 A;  4X62 Q;  2HHH Q;  1PA6 A;  1IBL L;  3ERO A;  2KCN A;  3FMC A;  4CDC C;  3K80 C;  2V1C C;  1PVO A;  2F0W A;  4DA2 A;  1PTO F;  1KNE A;  1WI5 A; 
#chains in the Genus database with same CATH homology
 3CCJ A;  2A1A A;  2FXQ A;  2Q2I A;  4DUZ Q;  2CQO A;  3TRE A;  4HID A;  2CWA A;  4QJF A;  4DR3 L;  1SE8 A;  1MKH A;  1A0I A;  5BR8 Q;  1QVF A;  3TS2 A;  4DV2 L;  3HFZ B;  2HQL A;  2JE6 I;  1TWF H;  2PI2 A;  4H02 A;  3W1B A;  4DR1 Q;  4GKK L;  1AH9 A;  1A62 A;  5ELN A;  4A3J H;  3J7A 5;  1TXY A;  4LFC Q;  2IHE A;  2OWO A;  5M5W H;  2MFI A;  2IX1 A;  2VZA A;  2YTY A;  2L15 A;  3GDE A;  1BKB A;  5IT9 c;  4GNX A;  2F52 A;  1XPU A;  3A0J A;  1L1O B;  3J81 c;  2Q2H A;  1L2F A;  4YCU A;  4A3C G;  3PUY A;  1X6O A;  3DLL A;  2E8G A;  4DV1 Q;  1VQP A;  1YJW A;  3AYH B;  4OX9 Q;  4EX5 A;  1JT8 A;  1Z47 A;  1PH8 A;  4B3S Q;  3KJP A;  3D31 A;  2RHQ B;  4DV0 L;  4A75 A;  4KI0 A;  1VQ7 A;  1LM0 A;  2UUC Q;  3G48 A;  4YY3 Q;  1XNR L;  5IE8 A;  4LUV A;  3J81 j;  2UXB Q;  3S1M H;  1UE6 A;  5IYD G;  4DV3 L;  4A3G H;  1VQO A;  2UXD L;  1QVC A;  1EFW A;  1VQL A;  4L5S A;  3T1Y Q;  2PQA A;  3H15 A;  2UUB Q;  1YVC A;  3MXN B;  4POF A;  4DV7 L;  3PO2 G;  1I94 L;  3RZD H;  1VQ6 A;  4IJH A;  2K14 A;  1JJ2 A;  2UUA Q;  2KEN A;  1KL9 A;  3KDF B;  1X65 A;  1YHB A;  1HR0 Q;  2E2H H;  2ZM6 Q;  1Y1W G;  1G29 1;  3PUW A;  4HJA A;  1KIX A;  5IYC G;  1Y14 B;  3GTM H;  3I4O A;  2K75 A;  1K8A C;  4QL5 A;  1UE7 A;  1CKN A;  1HZA A;  1TWC H;  3EIV A;  5FLM H;  4BY1 G;  1X54 A;  2MNA A;  3FKI H;  4X66 L;  4Y52 H;  3CXC A;  3NEN A;  4YCV A;  4DAY B;  4LF5 L;  3GO5 A;  3CME A;  3RZO H;  4A3B H;  5C3E G;  3HOX H;  4JI8 L;  4JV5 L;  2LXJ A;  3KF8 B;  2JA6 G;  1JJG A;  2K50 A;  3FP9 A;  4A3E H;  4P73 A;  2MQH A;  4MTN A;  1NBW A;  5M3F H;  1HZ9 A;  5LMU L;  1HR0 W;  1EQR A;  1TWH H;  2R7F A;  2N78 A;  3BU2 A;  3BJU A;  3J80 i;  1KRT A;  1XPR A;  1XNQ L;  3GTL H;  4A3L G;  4IFD I;  4X64 Q;  2B63 G;  5HY6 A;  3UE0 A;  4LF6 L;  1WFQ A;  4EQ5 A;  4K0K Q;  3H0G H;  4A3D G;  4BBS G;  1VQB A;  1KQS A;  3M4Q A;  1VQD A;  4JI3 L;  1I5F A;  1X56 A;  4JI1 Q;  1HH2 P;  4AYB E;  3JC6 6;  4C2M H;  4LFB L;  1YJ9 A;  4GN4 B;  1SR3 A;  4DR7 L;  5M3M H;  3Q8D A;  2VNU D;  1GKH A;  2KHI A;  3CC2 A;  2AMC B;  1OXT A;  1XJV A;  3CCL A;  3EN2 A;  4B3T L;  3I56 A;  4KHP Q;  1U0L A;  1M1K C;  1UEB A;  2CKZ B;  2UXC L;  5IYB H;  5JJK A;  2VQE L;  2JA7 G;  2Y0S G;  3GTO H;  1PH6 A;  1WJJ A;  3W5O A;  3KF6 A;  3HOY G;  1D7Q A;  1JMC A;  2ASB A;  4DR2 Q;  2R7Z G;  1E1O A;  3A74 A;  3W1G A;  2ALY B;  4DK6 C;  3OW2 A;  1HNZ Q;  1NJI C;  1V43 A;  4GKJ L;  4OO1 G;  4BA1 I;  4IOA A;  1J5E L;  3HOV H;  5C4J H;  1C0A A;  2Q2T A;  5LMN Q;  2WB1 E;  3PF5 A;  1GO3 E;  4WJ4 A;  3CCE A;  4PZ6 A;  1MJC A;  4KHZ A;  3S15 H;  2AHO B;  4YWL A;  1Q46 A;  3F2B A;  1HNX L;  1HNW Q;  2MO1 A;  5JEA G;  5IP9 G;  3MEF A;  3TS0 A;  4A93 G;  3G71 A;  4DK3 C;  4C3J H;  1HZB A;  4RG1 A;  5FJ8 G;  1TWA H;  5FLX c;  2NZH A;  3E9I A;  3JAM i;  3HKS A;  1VS0 A;  2Q2U A;  4JI4 Q;  3TRZ A;  1S40 A;  1XMO L;  1N36 L;  2XGT A;  4X65 L;  4A76 A;  4DR6 L;  4JOI C;  1N32 Q;  1QZG A;  4C3H H;  4GOP A;  3HOW G;  1S3O A;  1EUJ A;  1PYS B;  4DV6 Q;  2UU9 Q;  4JI0 Q;  4LF7 Q;  1FJG L;  2MO0 A;  1QUQ B;  3L0O A;  5EAY A;  1YZ6 A;  4P75 A;  2ZTE A;  4JI7 L;  4LF9 L;  4NXM Q;  4QQB X;  1H95 A;  1PHJ A;  3CAM A;  5LMN W;  3A5U A;  3T1H Q;  2JJQ A;  1IBK Q;  4LF8 Q;  4OO1 I;  4P74 A;  1W2B A;  3VDY A;  3M7N A;  2JEB I;  3M9B A;  4DR1 L;  5C44 H;  3KJO A;  4IO9 A;  2N3S A;  1O7I A;  3RN5 A;  5JEA J;  3K0X A;  1KHI A;  4JCV E;  4LFC L;  1OTC A;  1TWG H;  3STB D;  4YWK A;  4DV4 Q;  2NVT H;  3K7A H;  4DV5 Q;  4DR4 Q;  4OWT B;  4DUY L;  3E9H A;  4R4I A;  2QGQ A;  4YHH Q;  3I4N G;  4BXX G;  4R4O A;  1EQQ A;  1EYG A;  2K5N A;  4WJ3 M;  3G4S A;  1PYB A;  2YTX A;  3ULJ A;  1Q8K A;  1XMQ Q;  4OWW B;  3CF5 A;  3FHW A;  4GLA C;  1N33 L;  2H5X A;  4QY7 A;  4A3C H;  3NEL A;  3UDG A;  4OX9 L;  2WAQ G;  1X55 A;  4ME3 A;  4O2D A;  4HIO A;  4A3K H;  1KC8 C;  2CWP A;  5JJI A;  1PV4 A;  3ER0 A;  4L5T A;  1I3Q H;  5GRO A;  5H1S E;  2NZO A;  3CCQ A;  2UXB L;  2PI2 E;  4APV A;  4BA2 I;  3KFU A;  1Q1E A;  3PSI A;  4DR3 Q;  2R92 G;  1E22 A;  1HZC A;  1V9P A;  4DV2 Q;  3K81 C;  1UWV A;  3PGZ A;  1P8L A;  3EBE A;  4A3J G;  2YTV A;  1HR0 L;  2ZM6 L;  4IFD G;  1Y1W H;  2Z6K A;  2QEX A;  5AJ3 L;  2GN5 A;  1Q82 C;  5IYC H;  1LUZ A;  4UY8 C;  1EOV A;  4BBR G;  4ALP A;  2E2J H;  3TQY A;  4OWX B;  4HJ7 A;  4JI2 Q;  4GNX C;  3AEV A;  1X3G A;  1K3R A;  4B3M L;  2IY5 B;  2NVQ H;  5J3B A;  1K0R A;  4GNX B;  1Q7Y C;  3PO3 G;  3H3V H;  1FVI A;  5C3E H;  1PH2 A;  1A8V A;  2I0Q A;  4DR5 Q;  4LUO A;  4MNO A;  3NEM A;  1LTL A;  4DV0 Q;  1XNR Q;  2VUM G;  3S2H H;  4LF4 Q;  1K8G A;  2R93 H;  1K83 H;  4A3L H;  2K52 A;  4X64 L;  4DV3 Q;  2VW9 A;  2F3I A;  5JJL A;  2OCE A;  2UXD Q;  3S16 H;  4XTC S;  2F4V L;  2CFM A;  3UDX A;  3J7Z C;  1SRU A;  4K0K L;  4IFD J;  1IL2 A;  3HOU G;  2A8V A;  4BBS H;  2I5M X;  1I94 Q;  4A3D H;  1B70 B;  3OTO L;  3CCS A;  4P72 A;  2PQA B;  4A3M G;  1AE3 A;  5M5Y H;  1EIY B;  3HOZ G;  4HJ9 A;  2CCZ A;  1CKM A;  1X3F A;  3CW2 C;  3PCO B;  2NVX H;  3UDI A;  1T9H A;  4IPG A;  2ZTD A;  4P71 A;  3I7F A;  3FKI G;  3J81 i;  1M90 C;  3PV0 A;  4X66 Q;  2VY3 A;  4OON A;  1CKN B;  4GLX A;  1MJE A;  1SN8 A;  2VUM H;  4GS3 A;  2JA8 H;  2E5L Q;  4LF5 Q;  5IP7 G;  1PH4 A;  1Q12 A;  4LFA L;  4A3B G;  1VQF A;  1YNX A;  1CSQ A;  1X9N A;  4KHP L;  4JV5 Q;  4HIM A;  4JI8 Q;  3GTG H;  2WB1 G;  3I4M H;  2KCM A;  3S14 H;  3CPW A;  4A3E G;  2JEA I;  3M3Y H;  1V1Q A;  2JA7 H;  1G51 A;  4UP7 A;  3HOY H;  1CUK A;  1E1T A;  4C3I H;  5LMU Q;  1XNQ Q;  2K5V A;  1VQ5 A;  3ZJY C;  3HKZ G;  3I2Z A;  2ZJP A;  3CCR A;  1ASY A;  4L5R C;  1SLJ A;  4R4Q A;  4NXN Q;  2R6G A;  4LF6 Q;  1YEZ A;  3F1Z A;  5GAD C;  3NBH B;  1PH5 A;  3S1R H;  1VQI A;  2VQF L;  2JA5 G;  4POG A;  2JQO A;  3S17 H;  1U5K A;  1SRO A;  5IWA L;  1HNW L;  2K5H A;  2BH8 A;  1SMX A;  5IP9 H;  3F2C A;  2YV5 A;  3F2D A;  2KBN A;  4GN3 B;  4RMF A;  2VS1 A;  4JC0 A;  3CCV A;  2HIV A;  3PIO A;  3M4O H;  4DR7 Q;  3UE1 A;  3K8A A;  1XTD A;  1E24 A;  4PZ8 A;  4B3R L;  3SGI A;  5HGQ A;  1Y1V H;  4JI6 L;  1YJN A;  1N32 L;  4JI5 Q;  4AQY L;  4A3I H;  3LGJ A;  2WFW A;  4X62 L;  2HHH L;  1XPO A;  1PH3 A;  1OXU A;  2IHF A;  1WYD A;  3KLW A;  2UXC Q;  1IBM Q;  1WCM G;  5C0X I;  2VQE Q;  4A3F G;  5K36 G;  3S2D H;  1G6P A;  4TQU S;  1VQ8 A;  4JYA L;  2EXD A;  2OQ0 A;  4PG3 A;  3GTQ H;  3KF6 B;  4GKJ Q;  2Z0S A;  3G6E A;  2OQK A;  4GN5 A;  4DUZ L;  1J5E Q;  3HOV G;  4IJL A;  5BR8 L;  2RCN A;  1JJC B;  2D62 A;  4R1J A;  5GAG C;  1Q81 C;  1EWI A;  2C35 B;  1QVG A;  1B7Y B;  5M5X H;  2YU9 H;  3F8T A;  4DV4 L;  3BZC A;  4DR4 L;  4DV5 L;  3PUZ A;  1J6Q A;  1HNX Q;  3I4N H;  1N34 Q;  3GTP H;  1KXL A;  2LSS A;  3D0F A;  1L1O A;  5C4X G;  2ES2 A;  3PIP A;  1E7Z A;  1N36 Q;  2DUD A;  4X65 Q;  4DR6 Q;  1VQN A;  4HIK A;  2ZJR A;  1ASZ A;  2EQS A;  2D0P A;  4GOP C;  3K7U C;  1FJG Q;  4HJ5 A;  1N9W A;  4DNI A;  4BY7 G;  4JI7 Q;  1SFO H;  4LF9 Q;  4GOP B;  1IBL Q;  4DV1 L;  1FGU A;  1PFS A;  2KCT A;  4J15 A;  2GVA A;  1RIP A;  4B3S L;  3CQZ H;  2UUC L;  1NTG A;  2R92 H;  4KLK A;  3PF4 A;  3S24 A;  4DAM A;  4YY3 L;  4YCW A;  3S1Q H;  5C44 G;  3J80 c;  2I5H A;  3U50 C;  5IYD H;  3AFP A;  4NPS A;  1N8R C;  1I50 H;  3KDF A;  3T1Y L;  3PUX A;  2UUB L;  3I55 A;  1IXR A;  4QGU A;  1YHA A;  2ID0 A;  3PO2 H;  3CD6 A;  4GKK Q;  2DGY A;  2UUA L;  4DUY Q;  3PUV A;  4BBR H;  1L1O C;  2E2I H;  3RN2 A;  4XIG S;  4JI2 L;  1LYL A;  3U4V A;  1JE5 A;  2JK8 A;  2WP8 J;  2I5L X;  1MIU A;  5DLQ E;  4BY1 H;  2LXK A;  1VQ4 A;  1N33 Q;  4LUZ A;  3PO3 H;  5E7N A;  5IY0 A;  2PNH A;  2HIX A;  4MZ9 A;  4R4C A;  3L2P A;  4O0A A;  1NMF A;  2BA0 A;  4A3K G;  2RF4 A;  4TVA B;  3OYY A;  4DR5 L;  3GTK H;  2A19 A;  2HT1 A;  4LWC A;  1I6H H;  4LF4 L;  2K4K A;  4IOC A;  2JA6 H;  3KYH C;  3ERS X;  1YI2 A;  4AYB G;  1VQM A;  2BA1 A;  1VQJ A;  2ZTC A;  3GTJ H;  1K9M C;  4IPH A;  3U4Z A;  2RHS B;  3HOU H;  2B63 H;  1VQG A;  4PMW A;  4A3G G;  2IX0 A;  1IYJ B;  1VQE A;  1NY4 A;  2WAQ E;  3S1N H;  4A3M H;  1RL2 A;  2XTI A;  3CC4 A;  3HOZ H;  4NB3 A;  5AJ3 Q;  4DV7 Q;  1W3S A;  2Z6K C;  4JG2 A;  3M85 A;  1OXX K;  3AFQ A;  3IRB A;  2KHJ A;  3RNU A;  2B3G A;  3ULP A;  1KD1 C;  4JI1 L;  4UP9 A;  4IPC A;  2NN6 G;  4YWM A;  4HJ8 A;  4B3M Q;  3CP0 A;  2JA9 A;  3DM3 A;  1JB7 A;  5FLM G;  1VQK A;  4PZ7 A;  2E5L L;  3M4P A;  4QIW E;  1X3E A;  5IP7 H;  1E3P A;  4UP8 A;  1Z9F A;  4A4I A;  3JAM c;  1YIJ A;  2AWN A;  1YBY A;  1QZH A;  2AWO A;  2N49 A;  5GAE C;  4FDB A;  2OTJ A;  1VQH A;  3HOX G;  1UE1 A;  2PMZ E;  1BBW A;  1VCI A;  5GAH C;  5M3F G;  4NXN L;  1FL0 A;  1YHQ A;  2F4V Q;  3CMA A;  1IZ6 A;  2QA4 A;  5C0X G;  1K73 C;  4DR2 L;  2JA5 H;  1GVP A;  4LNQ A;  2R7Z H;  1HNZ L;  3CCU A;  3OTO Q;  2EIF A;  3H0G G;  4DKA C;  1A63 A;  5LMN L;  2D0O A;  3BZK A;  2NN6 I;  1HJP A;  3KOJ A;  1L0W A;  4OXP A;  1AE2 A;  4JI3 Q;  4Y7N H;  1D8L A;  4LFB Q;  2VL6 A;  3U58 A;  1GD7 A;  3RLO A;  4A93 H;  1OXS C;  1PH9 A;  3H3V I;  5FJ8 H;  3WWV A;  2JA8 G;  4JI5 L;  5M3M G;  3L7Z C;  4LFA Q;  4JI4 L;  2YYZ A;  2BH2 A;  3E0E A;  2N8N A;  4JBJ A;  4JOI A;  3I4M G;  1QUQ A;  4AH6 A;  2R93 G;  1BVS A;  3HOW H;  1IBM L;  2UU9 L;  4DV6 L;  1WCM H;  4B3T Q;  1B8A A;  4A3F H;  1YIT A;  4JI0 L;  3CCM A;  4LF7 L;  1GM5 A;  5ELO A;  4JBM A;  4NXM L;  1VQA A;  3CPF A;  5IYB G;  5C0X J;  4IPD A;  4AIM A;  3AQQ A;  3T1H L;  1IBK L;  4R4T A;  4LF8 L;  2ZJQ A;  3RR5 A;  2AKW B;  1NE3 A;  2NVY H;  2VQF Q;  1KAW A;  3UDF A;  1EIF A;  1C7Y A;  4X6A H;  1WOC A;  3TEH B;  5IWA Q;  4GLV B;  1BBU A;  4JBW A;  1Q1B A;  1N34 L;  2OTL A;  1KRS A;  3GD7 A;  1P16 A;  3HKZ E;  2Y0S E;  4LW1 A;  1VQ9 A;  1UE5 A;  1R9T H;  4YHH L;  3B6Y A;  4BXX H;  5C4X H;  3ICE A;  5GQO A;  1CSP A;  1Y1V G;  2B29 A;  4L5Q A;  3RLF A;  4JI6 Q;  4B3R Q;  2GVB A;  1VQC A;  1S72 A;  1NMG A;  1XMQ L;  4DPG A;  4AQY Q;  3A5Z B;  4A3I G;  1XMO Q;  3STB C;  1CKO A;  4X62 Q;  3ULL A;  2HHH Q;  1C9O A;  4JBK A;  4BY7 H;  1PA6 A;  1IBL L;  1PH1 A;  1Q86 C;  2ATW A;  1DGS A;  1OXV A;  2V1C C;  3K80 C;  3RLN A;  3CC7 A;  1PVO A;  2R7D A;  1PH7 A;  4JYA Q;  4UPA A;  2IT1 A;  1WI5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...