2E5LL

A snapshot of the 30s ribosomal subunit capturing mrna via the shine- dalgarno interaction
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title A snapshot of the 30S ribosomal subunit capturing mRNA via the Shine-Dalgarno interaction
pubmed doi rcsb
molecule tags Ribosome
total genus 9
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2006-12-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2e5lL00
2BA0A 3AFQA 4GOPB 1X3FA 1VQ6A 5FLMG 3KF6B 3K80C 5FJ8H 4DR2L 3CCJA 1V1QA 3U50C 4DR1L 3TRZA 1A8VA 3KDFA 1DGSA 4A3JG 1VQFA 4LF4Q 3PUWA 4MNOA 1W3SA 4KI0A 4AYBE 5GADC 3PIOA 3HOZH 1ASYA 3I4MG 4X6AH 2UU9L 3I4OA 1I50H 3SGIA 2D0PA 4QY7A 5C4XH 4HJAA 3BZKA 4LF6Q 5C0XJ 4XIGS 1Q1EA 1EIYB 1YIJA 1IBLQ 3S16H 3M4QA 4IPGA 3ULPA 4B3SQ 3ICEA 3S1MH 1XPRA 2JJQA 2Z6KA 3BJUA 3T1HL 3J81j 1FL0A 2JA8G 3I7FA 1CKOA 3BZCA 4GLAC 1VQLA 3CCLA 1TWAH 5IT9c 1PH8A 2ZJQA 3G71A 1CSQA 5M5YH 2UXCQ 1X65A 4GOPC 2CWAA 1HJPA 2LXKA 3HOWG 3A5ZB 2ZTCA 1EWIA 1YVCA 1JJGA 2NVQH 2UXCL 2JEBI 4YY3L 1LM0A 4LF5L 3I4NH 3FP9A 1OXVA 1S3OA 4DUYL 1JJCB 1XJVA 3UDGA 1NE3A 3FHWA 1T9HA 4LUZA 2JA7H 3NBHB 5IYBG 1XMOQ 1E1TA 3GTGH 2NN6I 2YYZA 3KF6A 3KJOA 3PSIA 4R4CA 1MJEA 2F4VQ 2CQOA 4PG3A 4P75A 4A3MH 1BBUA 3PO3H 2AMCB 2KHIA 1XNQL 4DR5L 2E2JH 1VQ9A 3RR5A 4DNIA 1TWGH 1FGUA 1HNZL 4JBMA 3CD6A 5HY6A 3PUVA 1VQ4A 4POGA 1QZHA 1XPOA 3GDEA 1VQIA 3M7NA 2VUMG 1K83H 2WFWA 3PGZA 4MTNA 1PH3A 1VQDA 1PV4A 1S40A 1S72A 3UE0A 1IZ6A 2YTYA 2OQ0A 4UPAA 3RLFA 2PMZE 3I55A 1LYLA 3HOYG 4A3BG 1NY4A 2KENA 3BU2A 4IFDI 1K8GA 2HIXA 4A3CG 1N8RC 2RCNA 4OX9L 1IBMQ 2Z0SA 4GN4B 4HJ9A 1EQQA 2UUCQ 4BBSH 4C3HH 1P16A 1QVGA 1N34L 2VQFQ 4A3EH 1IBKL 1OXSC 4P74A 4B3ML 3PO2H 3S1NH 4GKJQ 1VQBA 3OYYA 2N8NA 1KQSA 1NMFA 1IBML 3HOUH 4BY7H 4JI6Q 4OWXB 5IYCH 1G51A 4DV3Q 1RL2A 3W1GA 4P71A 3CMAA 4YHHL 2UUBQ 2JA6G 4DR4Q 1Q1BA 1D7QA 1XMQL 5ELNA 1KD1C 2E8GA 4HIMA 1UE1A 1Y1WG 1HR0W 2E2HH 3PUXA 2DUDA 4APVA 4A3KH 2UUBL 3I2ZA 3A0JA 1TWCH 3M3YH 4R4QA 4BXXG 1FJGQ 2CWPA 3M9BA 3H0GG 2ASBA 2QEXA 2YTVA 1PA6A 3HOVH 3KFUA 3HOXG 1N32L 3S15H 5GROA 3WWVA 1HNXL 1L1OC 4DV5Q 4A3MG 2ZTDA 1YHBA 2JEAI 1QUQB 2F3IA 4PZ8A 4DAYB 1E7ZA 1G291 3AEVA 5GAEC 4C3IH 3CPFA 3RLNA 5BR8L 4LNQA 3K0XA 1GO3E 2Y0SE 4GLVB 4BY1G 1GD7A 3E0EA 1X9NA 1SRUA 1PH2A 1VQAA 3AFPA 1N36Q 1Z9FA 4R1JA 3F8TA 2KCMA 3K81C 2I0QA 1QZGA 4RG1A 2I5HA 1UE7A 3Q8DA 3B6YA 3CAMA 3U4VA 5AJ3L 4GNXA 3PIPA 3JC66 2R93H 1VCIA 1ASZA 5IP7G 3RNUA 1YZ6A 1SROA 4DR2Q 4LFAL 2KHJA 2PI2E 3DM3A 4DR1Q 3VDYA 1VQ8A 1SE8A 4DR7L 3PCOB 1TWFH 4WJ4A 4P72A 4R4TA 4A3IG 2NN6G 3W5OA 1VQNA 3GTOH 3L2PA 1QVFA 1WFQA 4BA2I 3E9IA 3PV0A 4Y7NH 1PH1A 3E9HA 1Q8KA 4KLKA 2UU9Q 5C0XI 1MIUA 2Z6KC 3K8AA 3OTOQ 2R7ZG 2MFIA 4A75A 2CKZB 1IL2A 1EOVA 1PYBA 3G6EA 1I5FA 2B3GA 2JE6I 3T1HQ 2BH2A 4A3LG 3OTOL 1QUQA 4A3KG 3GTPH 4A76A 2PQAA 4POFA 2Y0SG 1X55A 1EYGA 1L2FA 4UP7A 2VY3A 5EAYA 4JCVE 1Y1VG 3F1ZA 4UP8A 1UE6A 1J6QA 3ULJA 1PH4A 4DV7L 1XNRL 3CW2C 5C44G 3CCEA 2JA5H 3G4SA 3CPWA 3KYHC 4LUOA 1VQJA 4QJFA 4YY3Q 4LF5Q 3EBEA 4X65Q 2NVYH 4IFDG 4DUYQ 4MZ9A 5JJKA 1JE5A 3KOJA 3NEMA 4IPHA 4OONA 1X3EA 3S1RH 2OWOA 4BBRH 1X6OA 1OTCA 1BKBA 4ME3A 3CF5A 2JQOA 4X65L 5IYDH 3S1QH 2N49A 3M85A 4UP9A 3OW2A 1H95A 3K7AH 4PZ6A 4JBJA 4X64Q 1YNXA 3HKSA 4B3SL 4IJLA 5IWAL 2K75A 4X66L 2UUAL 4QQBX 1B8AA 1XNQQ 4JOIC 5M3FG 2LSSA 4DKAC 4DR5Q 4YCWA 4X64L 3J80c 1V9PA 1P8LA 1YJWA 2YTXA 1W2BA 4AYBG 3GO5A 4A3FG 1HNZQ 4JBKA 4DPGA 2N3SA 1LUZA 2RF4A 4OXPA 3STBD 3J81c 3J7ZC 5DLQE 2GVAA 4AIMA 1XTDA 4JI2L 3D31A 4JI4L 2R92G 1U5KA 1HZAA 3MEFA 4GN3B 4NPSA 4L5SA 4TQUS 4LF7Q 4YCVA 5FJ8G 4OWTB 4YWLA 5JEAJ 3UE1A 1SLJA 1Q12A 3K7UC 3GTJH 1N33L 4LF7L 4GKKL 5E7NA 3CXCA 1I94L 4OX9Q 3PUZA 5M3MH 2MNAA 4HIDA 2HT1A 4KHPL 1PVOA 3CCVA 1MJCA 3HFZB 3CCQA 3HOZG 3S2DH 4DR6L 1N34Q 1IBKQ 3RN2A 1XPUA 4LUVA 4B3MQ 4L5RC 2HHHQ 5C4XG 5C3EH 1SR3A 2ATWA 2XTIA 1KXLA 4IO9A 2NZOA 3CCUA 3G48A 4B3RL 3J80i 1VQOA 1M90C 2KCTA 4L5TA 2HHHL 4YHHQ 1KAWA 1K3RA 2K50A 2B63H 3AYHB 2WB1E 1XMQQ 1A0IA 3L7ZC 5IP9H 2VQEL 1SFOH 4GNXB 3FKIH 1LTLA 4JG2A 3NELA 1WI5A 3CCRA 1VQKA 4DV2L 4DK3C 1OXTA 5ELOA 3KLWA 4PMWA 1KIXA 4A3GH 1OXUA 3I4NG 4NB3A 4K0KL 1E22A 3TEHB 2IX0A 3CC2A 1N32Q 1VQHA 3CCSA 2K14A 2D62A 5C0XG 1KRSA 2FXQA 4DV4Q 1K9MC 1A62A 5LMUL 1HNXQ 2JA7G 3TREA 2F52A 4JI7L 5FLMH 3UDFA 1K0RA 1K8AC 5HGQA 4R4IA 1Q86C 4A3JH 4AQYL 4DV4L 4A3DH 5BR8Q 4QL5A 4J15A 1VS0A 4JI8L 4B3TL 2JK8A 1AE2A 4TVAB 1GM5A 3PO3G 1JMCA 3CP0A 3I4MH 2PQAB 4AH6A 2UXDL 2Q2TA 1BVSA 1EIFA 2B29A 4DV0Q 1K73C 2R92H 2K52A 1OXXK 2CFMA 1G6PA 1BBWA 3CC7A 4IJHA 3CMEA 5AJ3Q 3PUYA 3STBC 3J7A5 2R7FA 4DV0L 5M5WH 2H5XA 2JA8H 1J5EL 2VW9A 3U58A 4LFAQ 2ZJRA 2EQSA 4DR7Q 1WYDA 3CC4A 2VL6A 3S2HH 1IYJB 3KJPA 3HOWH 3MXNB 4IOAA 2E5LL 1EUJA 3ULLA 4HJ5A 3NENA 5H1SE 4DV6L 4BA1I 3S17H 2ZTEA 4BBSG 1VQMA 3PO2G 2A19A 4A3EG 5J3BA 1WCMH 2UXBL 4IPDA 3HOUG 1HNWL 4EQ5A 4BY7G 5LMNL 2WP8J 4EX5A 5M5XH 5IYCG 4C3JH 1PFSA 1WOCA 1V43A 1YHAA 3CCMA 2IHFA 2OTLA 3T1YL 4GLXA 2GVBA 1NJIC 1YJ9A 1HR0L 4DV7Q 1XNRQ 5C4JH 2BH8A 2AWOA 2K4KA 4X62L 1X56A 2RHSB 5GAGC 1JJ2A 1JB7A 1L0WA 4LF9L 3H3VI 4WJ3M 1CSPA 1KRTA 3W1BA 1VQEA 5IY0A 1R9TH 1CKNA 2D0OA 3HOVG 1TWHH 1C9OA 2QGQA 4NXNL 2VUMH 4JV5L 2ZM6Q 2VNUD 1IXRA 1VQ5A 2MO1A 4A3DG 3TQYA 2AHOB 1Y14B 4XTCS 1RIPA 1MKHA 2K5VA 4JI3Q 2I5MX 2GN5A 4P73A 4DAMA 2ZM6L 4RMFA 5IWAQ 3HOYH 4A3BH 2YV5A 4LF4L 4X66Q 2UUAQ 1VQ7A 4NXMQ 2EXDA 4DR3Q 2VZAA 4GN5A 1B7YB 4JI3L 4QGUA 4JI1Q 1NMGA 4JI0Q 2IHEA 4O0AA 1YEZA 4NXML 4DR3L 2HQLA 3L0OA 2V1CC 4ALPA 1EFWA 4LF6L 4LFCQ 2K5HA 3EIVA 1KHIA 2WAQE 3AQQA 3ER0A 5FLXc 3TS0A 4JI1L 1IBLL 3A74A 1E1OA 2AWNA 4JI2Q 2ES2A 2NVXH 1E24A 4JI0L 4JI4Q 4A3CH 2JA6H 1I6HH 2OTJA 1QVCA 2R93G 1D8LA 2A1AA 1M1KC 4LFCL 3H3VH 1A63A 4C2MH 3GTMH 2R7DA 2XGTA 2PNHA 1Y1WH 2OCEA 2EIFA 1N33Q 4GKKQ 3CQZH 1I94Q 3ZJYC 3GTQH 1WCMG 2YU9H 4BXXH 4DR6Q 3UDXA 3H0GH 4KHPQ 4OO1I 1U0LA 2IY5B 4GOPA 2RHQB 3H15A 3F2DA 1GVPA 3HOXH 2PI2A 4A93H 1GKHA 3RN5A 2IT1A 2HIVA 2C35B 2I5LX 2QA4A 4JBWA 4B3RQ 1AE3A 1I3QH 3ERSX 3M4OH 2MO0A 1X3GA 1XMOL 1CKMA 2L15A 1JT8A 2NZHA 1PYSB 2VQEQ 2F4VL 1AH9A 2DGYA 3RZOH 1Z47A 1YHQA 4YWMA 3F2CA 4BY1H 4DV2Q 4JOIA 5JJLA 1CUKA 2JA5G 1Q82C 3J81i 1C7YA 1YJNA 4K0KQ 2WAQG 4QIWE 1NBWA 4LFBQ 3M4PA 1TXYA 5GAHC 4BBRG 1VQPA 5LMUQ 2VS1A 4GS3A 4JI7Q 5IP7H 5IYDG 4OWWB 1PH6A 1HZ9A 4LWCA 4L5QA 3GTKH 4LFBL 2ALYB 3U4ZA 4LW1A 4AQYQ 4A3IH 3HKZE 1L1OB 2LXJA 4B3TQ 4JI8Q 1FVIA 1EQRA 1PH9A 3JAMc 4A4IA 3PF5A 1HZCA 2UXDQ 4IFDJ 1KC8C 2ID0A 5LMNW 3LGJA 1PHJA 2Q2UA 2UUCL 2R7ZH 1C0AA 2VQFL 4GKJL 1VQGA 1SN8A 2Q2HA 3KF8B 4LF8Q 2OQKA 1NTGA 1E3PA 3EN2A 1HH2P 4GNXC 4JI6L 4A3LH 4HIOA 1UWVA 1Q46A 4DV3L 1J5EQ 1CKNB 4UY8C 1SMXA 4DR4L 1X54A 1YBYA 3S24A 4LF8L 4JI5Q 4R4OA 3I56A 2E2IH 3RLOA 2A8VA 1Y1VH 3KDFB 2WB1G 5C44H 2Q2IA 2E5LQ 4A93G 5M3MG 4JI5L 2BA1A 4DV6Q 1WJJA 1FJGL 4YWKA 4DV1Q 1YI2A 2IX1A 5IE8A 3GTLH 3D0FA 5K36G 1UEBA 4DUZQ 2UXBQ 2JA9A 2MQHA 5C3EG 3JAMi 1VQCA 5GQOA 3DLLA 3F2BA 3S14H 4JYAQ 2N78A 1HNWQ 4IPCA 5JJIA 5LMNQ 3IRBA 4DV1L 4DV5L 3UDIA 4JC0A 4DUZL 3HKZG 4HJ8A 1Q7YC 2B63G 4JYAL 2NVTH 2CCZA 4H02A 5IYBH 1UE5A 5IP9G 1L1OA 3T1YQ 4HIKA 2AKWB 4YCUA 3FKIG 5JEAG 1N9WA 1HR0Q 1B70B 5M3FH 4Y52H 3PF4A 4X62Q 1PH5A 1KL9A 1O7IA 1YITA 4PZ7A 1HZBA 4DK6C 1N36L 4LF9Q 4FDBA 4IOCA 4A3FH 4HJ7A 1PH7A 4A3GG 4O2DA 3TS2A 4NXNQ 3GD7A 4JV5Q 4OO1G 2KBNA 4KHZA 3A5UA 2ZJPA 1Q81C 2K5NA 3RZDH 2R6GA
chains in the Genus database with same CATH superfamily
3AFQA 4GOPB 1AN8A 4CDFC 2PYKA 3KF6B 3K80C 3VR4A 5ISRA 3A56A 1IHZA 3QOJA 3TRZA 1LACA 1A8VA 1QWYA 3W3AA 1A15A 2J0TD 4ABNA 1G6ZA 5C6AA 4KI0A 1L0YB 5K5PA 1ASYA 3I4MG 4X6AH 4Q0FA 1I50H 2D0PA 4QY7A 4LF6Q 1WTVA 3OW7A 3DUZA 3S1MH 3S16H 4B3SQ 3FPPA 3A55A 4DU9A 5KRUA 1CKOA 1VQLA 4M8AA 5EKLA 3CCLA 3GTOB 4K5WA 2ZJQA 3G71A 1O78A 1NSNS 1WCMB 4GOPC 2HUGA 3A5ZB 1YVCA 4C3JB 1SYCA 4LF5L 1KNEA 3L9AX 3I4NH 1OXVA 4DUYL 2R3ZA 1HCZA 3UDGA 2EYHA 5KGUA 1I4QA 3GTPB 4ZLTF 3GTGH 1E1TA 4R4CA 2FHTA 2CQOA 3K57A 2RSOA 3TZUA 4A3MH 2JA5B 4TKOB 1BBUA 1RKNA 4DR5L 1FNWA 4N9PA 5CMDA 1ESRA 2EZVA 4JBMA 5D3DA 3PUVA 1VQ4A 4UAIA 4POGA 1G2TA 2KHSA 1Y8NB 3GDEA 1IL8A 4MTNA 2F3VA 3PGZA 1PV4A 1S40A 1HUMA 1SYDA 3TDQA 4UPAA 5FK9C 2H4OA 2KOLA 4A3BG 1M8AA 2KENA 1K8GA 1STAA 4A3CG 1N8RC 2BE5D 2Z0SA 2UUCQ 5J1ZA 3PO2H 1OXSC 5FO9B 3OYYA 1NMFA 3NBHA 5IOCA 3GTQB 1E2WA 1GUGA 1GOZA 1EZ6A 1RL2A 2UUBQ 4DR4Q 2WB1B 4XDXA 1Q1BA 2DNCA 2K5QA 3K5NA 1UE1A 4ZUJA 1HA6A 3J7AV 2DUDA 4A3KH 4RGNA 1H9RA 3QG1A 2ASBA 2BDNA 1N32L 4HMJA 3HKZB 5L37A 4M1UB 1L1OC 1ET9A 1YHBA 2B8FA 1SFOB 1QG7A 3FKIB 4DAYB 4RCOA 5GAEC 4I7ZC 1MD2D 4BY1G 4A3GB 3F8TA 2PQEA 3K6OA 3K81C 4QMGA 4RG1A 4F7XA 1UE7A 3Q8DA 5AJ3L 4GNXA 3PIPA 4JW0A 5KYLA 1YZ6A 1T5XD 4B9XA 4DR2Q 3DM3A 4KKTA 2NTTA 4HAEA 4A3IG 3W5OA 3QR8A 4BA2I 1J9OA 1BO0A 1Q8KA 5D3IB 1PRTB 3MVVA 3SK8A 2UU9Q 1LTSD 3MC0B 3OMGA 1MIUA 1KNAA 2BE5C 1SJED 2R7ZG 2MFIA 2CKZB 5M5WB 1EOVA 2JA8B 3G6EA 1I5FA 2B3GA 2JE6I 3T1HQ 2BH2A 4A3LG 4A76A 3A8JE 2Y0SG 1L2FA 3ZYYX 4PNYA 4UP7A 2VY3A 1ZKOA 5EAYA 3ULJA 2A74C 3CCEA 3T53B 3G4SA 4CJ2C 1VQJA 4YY3Q 2B8GA 2B2UC 3R2IA 1DCZA 2L0CA 4LK1C 1B53A 5DNFA 1SSOA 1X6OA 4FF3A 4QUFA 2JQOA 2B2VA 4C3IG 4X65L 2N49A 3ERQA 4UHVA 2CVRA 2EYPA 1WVLA 1YNXA 3AU7A 4IJLA 5IWAL 2N88A 4QQBX 2EJFC 4JOIC 4DKAC 4FF4A 4YCWA 1V9PA 1YJWA 4AYBG 1JORA 1HNZQ 2VUMB 1TS3A 2N3SA 2RF4A 3STBD 2E76C 3J81c 4K6LA 3J7ZC 1XTDA 2K5WA 4JI2L 2IJ0A 1HZAA 1RD9D 4NKLA 3NHHA 4YCVA 4X3SA 1E0BA 4YWLA 2SNSA 1N33L 4GKKL 4NDXA 4LF7L 3D4RA 5E7NA 2TMPA 1I94L 2F4IA 1PVOA 3HFZB 3CCQA 3K5MA 1XPUA 1JCKB 4L5RC 2JN4A 2Z4HA 2HHHQ 4KY7A 3IAYA 5C4XG 2XTIA 2F1MA 1RODA 4L5TA 5KNBA 1A0IA 3HG9A 2K03A 3TZDA 1O80A 4G7HC 3H0GB 3V05A 3CCRA 1VQKA 2K6AA 4FP5D 4CKEA 1SE3A 3SEBA 3FRPB 3KLWA 1H9SB 1OXUA 4NB3A 4K0KL 1WTPA 3CC2A 3Q0AA 1B4OA 2K14A 1K9MC 1A62A 2M2LA 5LMUL 2JA7G 1ICWA 3H09A 4FXDA 1Q86C 3BVMA 3JAML 2F0QA 3F2UA 2JK8A 1WTXA 1JMCA 4IALA 4CGYB 3I4MH 2PQAB 2KECA 1EIFA 2WKCA 4DV0Q 1ZEQX 2CFMA 1BBWA 1S5FD 3CC7A 2G5DA 2M9VA 1ENFA 3PUYA 3STBC 4HN7A 3GTKB 3U58A 4LFAQ 2EQSA 4DR7Q 3QWNA 1HXYD 2XIWA 3HGBA 3CC4A 3KJPA 3G7LA 3MXNB 4RGMA 2B2TA 4BA1I 4BBSG 1D6EC 2O4XA 4A3EG 1H9JA 2F0WA 1JOQA 5BN3A 1SXTA 3N6RA 1PFSA 5C44B 3CCMA 1BDOA 2BH8A 4X3TA 4YIJA 4K5VA 5LHY1 1CA6A 1NUCA 1JJ2A 3GTLB 4LF9L 1CSPA 1KRTA 1R9TH 5IGCA 1CKNA 1TU2B 1TWHH 4NXNL 4K8IA 4JV5L 2V4DA 2ZM6Q 1IXRA 1VQ5A 2K33A 4RHSA 2QW7A 1Y14B 4XTCS 5FKAC 1MKHA 1CHPD 4X3UA 4DAMA 1D5XC 4A3BH 4LF4L 1VQ7A 1EL0A 3I90A 3H6MA 3X3NA 1BCPF 1EOTA 4JI1Q 2IWHA 1NMGA 4JI0Q 4O0AA 4HR7B 4NXML 1FGBD 4DR3L 3TP6A 1PYWD 1ENCA 3R93A 1D2BA 1KHIA 1F9PA 3AQQA 5C4HA 3TS0A 1IBLL 1VQ6A 2AWNA 5I2XA 1I6HH 3EVQA 1HTLD 1QVCA 1M1KC 3HP3A 4IN3A 3ZJYC 1WCMG 1EQTA 3A7LA 5A35A 4KHPQ 5TSSA 1HTPA 4GOPA 2RHQB 3I4LA 4U68A 3CRKC 4C3JG 4A93H 3BZDB 2I5LX 4B3RQ 3TP8A 1STYA 3ERSX 4CDDC 2AQ3B 3M4OH 3N52A 1TWAB 1KAAA 1EYAA 4FO2A 1HFGA 1AH9A 4BY1H 5IIFA 2GA4B 5JJLA 3BDCA 3MA2B 2JA5G 1Q82C 3VA5A 1DJRD 2PO4A 1NBWA 3G6JB 1A3VA 2VS1A 1O7ZA 1MHWC 3I73A 1QNKA 2D5DA 1PH6A 2CH4W 4FXKC 2ALYB 4AQYQ 4LW1A 4A3IH 2QDBA 1Q8IA 1Q3LA 4N9TA 1KDAA 3JAMc 1SAPA 4A4IA 1HZCA 1S4ZA 1TT2A 2ID0A 3LGJA 3NQIA 2R7ZH 4EGVA 1C0AA 5I2YA 4CDCC 2Q8RE 2OQKA 1UEAB 1E3PA 1BOSA 3VYTA 4GNXC 4A3LH 2F0IA 1Q46A 4DV3L 4UY8C 5IGEA 2JXMB 1AZQA 2E2IH 4H0LC 2A8VA 3KDFB 2WB1G 3T56B 2Q2IA 4C3HB 1F2ZA 2EYOA 1XX8A 4ILWA 1G8ZD 3O13A 4BY7B 3KUPA 4DUZQ 4WJWA 2JA9A 3JAMi 5GQOA 5I9PA 3F2BA 4QCLA 2VB2X 2CW0D 4IPCA 5JOBA 3C1FA 3UDIA 4JC0A 3HKZG 2E2HB 1Q90A 1UE5A 1L1OA 3M3YB 2AKWB 2N55A 4YCUA 3FKIG 1N9WA 3I3CA 4JPBW 3HOVB 1N36L 5BN5A 4IOCA 1SYFA 4A3GG 2OEOA 4O2DA 3KF8A 3GD7A 4OO1G 3KBGA 4WORA 3LWUA 1XWEA 2ZJPA 2KQ3A 2R6GA 2DY8A 2C9OA 3U50C 5C4ZA 1RTNA 2XWJB 3PUWA 4MNOA 5GADC 3PIOA 1TY0A 4X3KA 4KD4A 2IL8A 3SGIA 5C4XH 4HJAA 3BZKA 2R93B 4DAYA 1Q1EA 5FLXE 4IPGA 2BDOA 2FJ2A 3OPOA 1XPRA 1I4PA 2JJQA 4J8QA 4Z9CB 2A6HD 3J81j 2JA8G 3BG3A 3I7FA 4DXGA 4GLAC 3BZCA 1SNPA 5IT9c 1PH8A 2K01A 5JVG3 5M5YH 1X65A 1LO5D 3CKIB 3LWEA 5FOBB 1VDZA 1O7YA 1CHQD 3WOEA 4P2CB 1HUNA 1PFBA 4RKLA 2UXCL 1LM0A 5G3LF 1JJCB 1NE3A 1NR4A 2A68D 4L6TB 4FYDA 2JA7H 5C4JB 5CV7A 2B2UA 1XMOQ 2K1BA 3PSIA 4DK0A 4PG3A 1EY5A 2NWGA 1T5EA 1XNQL 5ELFA 3S1RB 1TWGH 1FGUA 2R61A 5CV5A 4BBRB 3IL8A 4EVOA 1VQIA 2VUMG 1PTOF 3HS0C 1PH3A 4KY5A 4HSPA 5ELDA 2YTYA 2OQ0A 3DXJC 4EQPA 1LYLA 3HOYG 3MXUA 4IFDI 2HIXA 2RCNA 2TSSA 4GN4B 4BBSH 1QVGA 1N34L 4A3EH 4R9WA 3S1NH 3GTMB 2G9DA 1EYDA 4OL7A 1KQSA 1IBML 3UI2A 4JI6Q 2VB3X 1G51A 2O5JC 3OMCA 3W1GA 1KLUD 3E3XA 2K32A 2A6HC 3SXHA 3EFXD 4HIMA 4APVA 1STHA 3S2DB 4MHEA 2QCPX 3A0JA 1TWCH 4R4QA 1FJGQ 5C3EB 3H0GG 1F2MA 2EJMA 1SBBB 2X6LA 3KFUA 4LJZC 3S15H 1HNXL 5CV6A 4DV5Q 2A68C 1QUQB 4QF4A 4E6IA 4PZ8A 5EBDA 1E7ZA 1R4PB 4KKSA 5BR8L 4MN3A 5C3XA 1X9NA 1V1PB 1PDQA 2HD3A 2KCMA 3U9SA 4CJ1B 2I0QA 2DJFC 1TKWB 4FNFA 3CAMA 1B44D 2Z6BA 1VCIA 4KJOA 4LMQD 4A3JB 1D1KA 4DNRB 4DR1Q 3PCOB 2NN6G 1H9SA 4V190 1VQNA 3GTOH 3L2PA 3PIP3 3NTIA 3E9IA 3E9HA 4KLKA 5A2QL 2Z6KC 2NYZD 4A75A 5CORA 1IL2A 1GUSA 5I6YA 1LT4D 1PYBA 3NK9A 3OTOL 5CV9A 4JVZA 1GUOA 3GTPH 3DM1A 2PQAA 4XT3B 1EYGA 3S2HB 1LTBD 1PLFA 4JCVE 4UP8A 2HCIA 3CW2C 5C44G 2JA5H 2KEDA 1S5BD 4LUOA 3EBEA 4X65Q 3SK6A 2F0FA 4OONA 4IUQA 4HTHA 2QF7A 1OTCA 4ME3A 2Z1CA 4KD3A 5I4DA 1IKLA 1HPCA 3MXNA 1V8QA 4UP9A 4DXFA 1IKMA 3HKSA 1KLGD 2B39A 4MTKA 2LSSA 2EPBA 4X64L 1GXDC 1CFMA 2L5TA 4XT1B 4A3FG 3QOLA 4DPGA 5M9OA 4DK1A 5DLQE 4JI4L 3D31A 3J81L 3MEFA 5IGGA 1MSGA 4EQNA 4LF7Q 5FJ8G 1I50B 4OWTB 3UE1A 1SLJA 1I4GA 3K7UC 3GTJH 2Q8TA 4OX9Q 3CCVA 1MJCA 1IBKQ 5KIXA 4LUVA 2MUYA 4B3MQ 1D5MC 2FMCA 4KV6A 3SVMA 1SR3A 2ATWA 2JA6B 2LY7A 2DN8A 4QB4A 4YHHQ 3I4NB 1XMQQ 3D4DA 2VQEL 5D65A 1SFOH 4OEMB 3FKIH 1LTLA 2B2YC 2L1BA 2YU9B 3NELA 2C5CA 4RAUC 1TY2A 4PMWA 1KIXA 4A3GH 1E22A 1I3QB 3TEHB 4A3MB 4OO1H 3CCSA 1R4QB 5C0XG 1LTTD 2K7VA 2K5DA 1PRTD 4JI7L 1BBXC 2KA7A 2J7ZA 3VR3A 5HGQA 4R4IA 3BYYB 4DV4L 4A3DH 3H3VC 4G7ZC 4B3TL 4JI8L 4XYQA 2EYFA 4AH6A 2UXDL 2D9UA 1K73C 4Q5VA 4ZYSA 4XQNA 3D4WA 4DFAA 3CMEA 2EVBA 5M5WH 2H5XA 2JA8H 1J5EL 1LTGD 2ZJRA 1X3QA 1TS2A 1QOHA 1UUPA 4HJ5A 1CQVA 4DV6L 1B1ZA 4C3HG 3M7GA 1EY9A 5G3LD 2UXBL 4A3KB 2RBMA 4EQ5A 3C2PA 3P7JA 2WP8J 4BY7G 5IYCG 5M5XH 1NR2A 3LX0A 3Q23A 1Y1VB 1WOCA 1YHAA 2IHFA 1ET6A 3T1YL 2GVBA 1XNRQ 1HR0L 4DV7Q 4S3SA 2RHSB 1JB7A 2Z9HA 1SYBA 2KJXA 2IPKD 3HOVG 4CKBA 3SR1A 2VUMH 5EPKA 2MO1A 2NVTB 3TQYA 2AHOB 4GZYC 1PFMA 1PRTC 4P73A 5M3FB 4RMFA 4K2LA 3HOYH 2YV5A 5HURA 4X66Q 2UUAQ 1MGSA 4NXMQ 4DR3Q 5T1GA 2HCCA 2VZAA 1B7YB 1STBA 2IHEA 2HQLA 3EA6A 2V1CC 3RZDB 4LF6L 4RH6A 2R92B 2K5HA 1JOOA 1I6VC 4B3SL 2ES2A 1E1OA 3A74A 2NVXH 2R93G 2EE1A 2NTSA 4C2MH 3C1EA 3HOZB 3CQZH 1GUNA 3MTSA 1XYIA 2IY5B 1EZ8A 4DR6Q 1F9QA 3H0GH 4OHJA 3F2DA 1GVPA 1PTOB 2PI2A 4KMUC 3RN5A 2IT1A 1AE3A 2MO0A 1X3GA 5K36H 1CKMA 4CJ0B 2L15A 1BF4A 5T1IA 2DGYA 5LL6S 1Z47A 4ID6A 4DV2Q 2AUKA 2NVQB 4K6DA 3QJYA 3J81i 1C7YA 3KLSA 4QIWE 4XQQA 1EU4A 4BBRG 3LNNA 4GS3A 3JAME 4OWWB 1MSHA 3GTKH 3PO3B 3OSOA 1RDPD 2E2JB 2WINB 1EQRA 1S5CD 3PF5A 2UUCL 1QB5D 2Q2UA 1FD7D 1SN8A 2Q2HA 1K0SA 2NUCA 1SMXA 2SOBA 1X54A 3J7AF 4DR4L 4R4OA 3I56A 3RLOA 2PCFB 3T51B 5C44H 2E5LQ 2RVLA 1O7LA 5M3MG 4JI5L 1WJJA 4YWKA 5CC4A 2IX1A 3GTLH 4IUTA 3D0FA 3HOUB 5C3EG 1HA5A 3DLLA 1VQCA 3S14H 5JJIA 1G91A 1HNWQ 5LMNQ 4DV1L 1II3A 2QDLA 3OHXC 4ULLA 4JYAL 2ZXPA 5IP9G 1NCVA 5JEAG 4X62Q 1GHJA 2SDFA 4PZ7A 4RKBA 3KK7A 2PZWA 4A3FH 1A2UA 3TS2A 1EY0A 1LTAD 2EOTA 3A5UA 1SYGA 2BA0A 1X3FA 5FJ8H 4DR2L 3CCJA 4A3JG 1DGSA 1TIID 3WOFA 4K5XA 4AYBE 2EY6A 2UU9L 5FO7B 1EYCA 2EDGA 4RFBA 4A3CH 5C0XJ 1EIYB 2OT2A 2A69D 3PIO3 3BJUA 2Z6KA 5BN4A 3T1HL 1FL0A 1V1PA 1TWAH 5KYIA 3P75A 1CSQA 2X69A 2UXCQ 1WD0A 4Y7NB 2CWAA 1RJTA 5IT9L 1HJPA 2LXKA 2L11A 4CKCA 2ZTCA 1EWIA 2JEBI 4K2KA 4YY3L 1YNND 1S3OA 1SJHD 5AFWA 1XJVA 5C0XH 2WKDA 4V0BA 3FHWA 1T9HA 4LUZA 5EQ0A 3NBHB 3SK5A 5IYBG 1EEID 4U673 3KF6A 1W6KA 1EY8A 1MJEA 1EY6A 3PMFA 2F4VQ 1TWHB 2NVYB 1CT1D 5NUCA 1HNZL 3CD6A 1HHVA 3S1QB 3M7NA 1QILA 1K83H 1JQYD 3K7AB 4F88A 2F0OA 1SDFA 1S72A 1JICA 1LT3D 2F0VA 3RLFA 3NTHA 1NY4A 3BU2A 3E5SA 1I6HB 1IBMQ 3ND9A 4G4KA 5EKIA 4HJ9A 4C3HH 4IUNA 2VQFQ 1D1IA 4GKJQ 1B9NA 1SNDA 1Z6HA 3DHQA 4KN4C 4BY7H 5IYCH 2A69C 2JA6G 3CMAA 2K28A 4HEDA 5ELNA 1KD1C 2E8GA 2F0MA 2E75C 4A93B 4J1MA 3BS1A 2E2HH 3PUXA 4QIWB 3I2ZA 1AEXA 3M3YH 1UAPA 4BXXG 2CWPA 3M9BA 4N8X1 4ZKCB 2QEXA 4PV1C 3AMUA 2B2YA 2YTVA 3HOVH 3HZXA 1YNNC 2B63B 3C3LA 4A3MG 4DN4M 5CBAE 5KNDA 1DM0B 1G291 4C3IH 2LS01 3CPFA 4LNQA 1GO3E 4GLVB 4KTAA 1GD7A 3E0EA 1SRUA 3NWSA 3S9WA 1Z9FA 4DF7A 3MEHA 2RDFA 1QZGA 1CM9A 3TMEA 3KLRA 3V96A 3B6YA 2R93H 3U4VA 3JC66 1ASZA 5IP7G 3RNUA 3IKJA 2F0NA 4LFAL 2KHJA 2NB0A 1GHKA 4DR7L 4WJ4A 1TWFH 4P72A 1GJXA 3NE5B 2NZ1D 1WFQA 3PV0A 2SNMA 4KN7C 2QKIC 3BYTB 2L12A 3OTOQ 3C46A 2MP1A 4DGZA 2RQXA 3M4YA 1EEFD 1GUTA 1K8OA 4A3KG 3HOWB 2F0HA 2MGSA 1KDBA 1Y1VG 1UE6A 1J6QA 1PH4A 1C8CA 1U9RA 1VMCA 3S17B 3CPWA 3KYHC 1F2LA 4LF5Q 1SEBD 1SMYD 5KNCA 4DUYQ 5JJKA 3S1RH 2OWOA 3DWAA 4BBRH 1BKBA 3CF5A 2ZXRA 3M85A 3H94A 4AYBB 3CRLC 4X64Q 1TVXA 1STNA 1KTKA 2CW0C 5M3FG 4DR5Q 1Y69U 3J80c 3NSWA 1P8LA 3EQLC 3T4AC 1W2BA 4JBKA 1J8IA 1A3TA 3DEPA 1LUZA 4OXPA 1MI2A 1JR0D 1HRJA 1RTOA 2GVAA 2ZXOA 2R92G 1CZWA 1U5KA 3SDZA 4TQUS 1STEA 5JEAJ 4KHVA 5M3MH 2HT1A 4HIDA 2G9HD 1WTHA 4KHPL 1E2VA 4IURA 3HOZG 3S2DH 3RN2A 1NNXA 5J39A 2K04A 3TSSA 5C3EH 4NMZA 2MJ8A 2WACA 4L63B 2NZOA 3CCUA 4B3RL 3J80i 1VQOA 1M90C 2KCTA 5IGDA 1KAWA 1K3RA 1Y1WB 3AYHB 2WB1E 3L7ZC 4HMIA 5IP9H 1DONA 1ILQA 5JEAH 1VF5C 3V2TA 3MWYW 3VA7A 1EFID 5ELOA 4ZQ3A 4I7AA 3HOXB 4B08A 4N8FA 1AP0A 2IX0A 1N32Q 1K8MA 1VQHA 2D62A 4DV4Q 2FXQA 1K3BC 4H44C 2F52A 3I8ZA 4IUPA 2PW5A 3RZOB 2CQAA 4B9WA 4A3JH 4AQYL 1JWUD 4F8MA 4QL5A 4J15A 2EXZA 3NUCA 2ZT9C 4TVAB 3PO3G 3NQTA 2RSNA 2Q2TA 5IGBA 1BVSA 5ELEA 2K52A 1OXXK 1Z7TA 1BUVT 2EY1A 2L9HA 3VYRA 4IJHA 1BCPD 5JVH3 5AJ3Q 3J7A5 1FNUA 1M4VA 1XTCD 5FO8B 2JYOA 2VW9A 2ENBA 3OIPA 1WYDA 2X6GA 3S2HH 1IYJB 5I9OA 4ZUIA 1BR9A 5A2QE 4IOAA 1EUJA 2RCFA 5H1SE 1VQMA 3RD4A 2A19A 1WCMH 4ZAIA 4IPDA 3HOUG 3PQIA 1K28A 4C3JH 3K5OA 3I70A 1EU3A 1BNZA 2AWOA 2K4KA 1FR3A 1X56A 1L0WA 3H3VI 4DAVA 3QB3A 2EYLA 3QIAA 3W1BA 1A3UA 1BCPB 2D0OA 2F0PA 1Y8OB 2QGQA 1C9OA 2VNUD 3RUZA 1CK1A 3URYA 5D14A 3D6CA 1B2TA 2E2DC 4XXEA 1RIPA 1W6JA 5IODA 2I5MX 1LT6D 1RHPA 5IWAQ 2O2LD 2EXDA 2FFKB 3D8GA 4GN5A 4JI3L 4QGUA 3ITPA 1YEZA 1MBYA 1EFWA 3FEWX 3A54A 2Q8IB 5JPNC 3J81E 2B2WA 3Q6SA 2WAQE 1AFPA 3FDTA 5FLXc 5CYUA 4ZK9B 4JI2Q 1E24A 3SE0A 2JA6H 1KDCA 1BCPC 1D8LA 1SNOA 4LFCL 3H3VH 4TSSA 2XGTA 2PNHA 4NW2A 3OWEB 2OCEA 2EIFA 1N33Q 4GKKQ 1I94Q 3IFTA 3GTQH 2MHVA 4C1NK 5E4XA 2YU9H 4BXXH 4OO1I 1U0LA 1B9MA 1VMPA 3H15A 3S1MB 3FVQA 3S16B 1GKHA 2PZTA 2C35B 1ILPA 1RF2D 1I3QH 3VYSA 1XMOL 2A5HA 4PMBA 1SNMA 1JT8A 2NZHA 2RDHA 2F0UA 3MFYA 3P1HA 1F77A 2M00A 1YHQA 4DA2A 4YWMA 3F2CA 2CHBD 3H91A 1ZYRD 1CUKA 2XSCA 2EJGC 3KBXA 1YJNA 5EKKA 2F03A 4K0KQ 3GTGB 3A8IE 5LMUQ 1PZJD 3K59A 2J4XA 5IP7H 5IYDG 4O1NA 1HZ9A 4LWCA 4LFBL 3U4ZA 3MHBA 4OELB 4CHTB 1L1OB 2P5ZX 4ZRZA 1PH9A 4K8JA 1KC8C 5C5MA 1JOKA 3MAQA 3NXWA 1VQGA 3KF8B 1NTGA 4RCNA 1XXGA 3GTJB 4JI6L 4HIOA 4OIKA 3R2TA 4PQXA 1YBYA 1YNJD 3S24A 4LF8L 4JI5Q 1SNQA 1Y1VH 1U4RA 5CBEE 1JB3A 1TS4A 3PO2B 3MXGA 2FMMA 4A93G 1CI3M 3OOCA 4O42A 1FJGL 4DV1Q 1LTID 4G57A 3L3OC 4JYAQ 3BVGA 2N78A 3T16A 1F9SA 2LFNA 3BVZA 4DV5L 3OIQA 1WD1A 2B63G 1SE4A 2NVTH 2HDLA 4Y52H 5M3FH 3PF4A 1O7IA 1ZXTA 1YITA 2F3WA 1HZBA 4DK6C 4LF9Q 2EY5A 1ZYRC 3D6WA 2MPMA 4HJ7A 1PH7A 2JSOA 4A3DB 3DEOA 4NXNQ 4JV5Q 2KBNA 4KHZA 2K5NA 4CDEC 3RZDH 2R92H 2H1EA 2AQ1B 5FLMG 2WV6D 1V1QA 4DR1L 1PTOD 1F9RA 3KDFA 1VQFA 4LF4Q 1PZKD 1W3SA 4ZCKA 3HOZH 5LL6X 1TR5A 3I4OA 4F87A 2F0DA 4XIGS 4IQZA 1YIJA 4JK1C 1IBLQ 3M4QA 3ULPA 4IUUA 3ICEA 1PTOH 1G2SA 1H9KA 2QILA 1DOKA 1KABA 4FVMA 2Z4IA 1YNJC 3HOWG 4IZ8A 5M5XB 1JJGA 2NVQH 2VXWA 1SE2A 4CBVA 2CH4A 3FP9A 2XWBB 2A6ED 1U4MA 2Z8LA 1LABA 2LMCB 2NN6I 2YYZA 3KJOA 4XYOA 1S5ED 1LT5D 4P75A 1HQRD 3PO3H 2AMCB 2KHIA 1ENAA 2XNAC 5E4WC 2WAQB 2E2JH 1CZGA 4KKUA 1VQ9A 3RR5A 4DNIA 4RA8A 1HFNA 5HY6A 1IYUA 4DAPA 4BWGB 3HOYB 1QZHA 1XPOA 2XN9C 2WFWA 2JP1A 1VQDA 4PMCA 1DZ1A 5ELCA 2K05A 3UE0A 1IZ6A 5CGKA 2L4NA 2ICIA 2PMZE 3I55A 1E2ZA 2AUJD 1IYVA 5EPJA 5E3FA 1PTOC 4HCEA 4OX9L 2NVXB 3OWFA 2PW7A 3WDNA 1EQQA 2NN6H 1P16A 1IBKL 4C2MB 4P74A 4B3ML 4J6HA 1VQBA 2N8NA 3Q22A 3GV3A 2KCNA 4FF1A 1FYCA 3HOUH 3CQZB 4OWXB 1QE6A 5JJZA 4DV3Q 2XVSA 4P71A 4YHHL 1DOLA 1D7QA 1XMQL 1A2TA 1Y1WG 1HR0W 2UUBL 1C48A 3R8BA 3IFDA 2D2CC 1VF7A 1PA6A 3HOXG 1TS5A 2DY7A 5C3WA 5GROA 3WWVA 5E1FA 4RHRA 2ZTDA 2JEAI 2A6EC 2E74C 3ONAB 2F3IA 3AEVA 3RLNA 5DEHA 3K0XA 2Y0SE 1PH2A 5ELBA 1VQAA 3AFPA 1N36Q 4R8IA 4IUVA 4R1JA 2I5HA 3DWPA 4L8JA 3MFGA 4ODGA 2XRSD 1SROA 1PMRA 2PI2E 3VDYA 1VQ8A 1SE8A 1CTMA 4MIUA 4KY6A 4R4TA 3I4MB 3TP5A 2F0SA 1QVFA 5KEEA 1SYEA 4Y7NH 1PH1A 5C0XI 3K8AA 3MZ5A 1EIHA 2B2WC 5EGTA 3K5LA 1QUQA 3SHLA 1Y8PB 3E6ZX 3TBIB 5DM63 4POFA 5IT9E 1X55A 5JAVA 3GP7A 5I6WA 3F1ZA 1XNRL 5J22A 3S14B 1UNSA 3TP7A 4DV7L 2IX3A 5DM73 4QJFA 3FMCA 2NVYH 4IFDG 1JWSD 4MZ9A 1JE5A 3KOJA 3NEMA 3QO2A 4IPHA 1X3EA 3X3MA 3U9OA 1L0XB 5EPLA 2HQEA 3K0YA 5IYDH 3S1QH 3OW2A 4A3FB 1H95A 3K7AH 4PZ6A 4JBJA 3J80E 1EY7A 2K75A 2KCCA 4X66L 2A73B 2UUAL 1B8AA 1XNQQ 1R9TB 3DWQA 2YTXA 4TRDA 3GO5A 3J80L 1PFNA 2FINB 2PZUA 4AIMA 1RCVD 1JE4A 4GN3B 4NPSA 4L5SA 4A3BB 2WIIB 4BS9A 4XQJA 1DD2A 3SK4A 4C56C 1Q12A 3NTKA 3RMHA 1JC7A 3CXCA 1U4LA 3PUZA 3BDLA 2MNAA 4DR6L 5IGFA 1N34Q 5JPMC 1KXLA 4IO9A 3HRZC 3G48A 3I91A 3J7YW 1EWCA 2HHHL 2K50A 1DOMA 2B63H 1X32A 1EQVA 2EY2A 2PPBC 1ML0D 2OF1A 4ME5A 4GNXB 1X3PA 4JG2A 1WI5A 3I72A 4DV2L 4DK3C 2PNRC 1OXTA 1CA5A 1LTRD 3I4NG 2SEBD 3R3OA 3M4OB 3NP8A 4H13C 4QUCA 2PMZB 1KRSA 1HNXQ 3TREA 5FLMH 3UDFA 4KK7A 1WTQA 1K0RA 1WTRA 1K8AC 3GQBA 4BY1B 1FNVA 1DYQA 2F0TA 5BR8Q 1VS0A 1B3QA 2IW3A 1AE2A 1K83B 1QCBD 1GM5A 3CP0A 5EBCA 2B29A 1G6PA 3E0JA 3AB9A 3EJIA 2BCOA 2R7FA 4DV0L 4LAAA 4A3IB 2BOSA 1PXUA 2VL6A 3HOWH 4DNTB 2E5LL 2R7ZB 1JWMD 3ULLA 2HDMA 2ICEC 3NENA 4H7BA 3S17H 2ZTEA 3FPUB 3PO2G 5J3BA 3Q24A 1NAPA 4I65A 1HNWL 5LMNL 2Y0SB 2F0GA 5C5LA 4C1NI 4EX5A 2E2IB 1GUWA 1V43A 5COYA 2DNEA 2OTLA 1B50A 2F0LA 4GLXA 1NJIC 1YJ9A 5C4JH 3TN2A 4X62L 1EIGA 2OXPA 4EQOA 5GAGC 3MXPA 4WJ3M 2I07B 3T13A 2B2VC 1PRTF 1VQEA 5IY0A 4WRDA 4OGQC 4C3IB 3VYUA 1ONLA 1TQOA 1DXMA 4A3DG 4FXGC 2K5VA 4JI3Q 1STGA 2GN5A 2ZM6L 1PZID 2LKVA 1EY4A 2EYMA 1D5ZC 3P20A 5F2DA 5CV4A 3ND8A 4ALPA 3L0OA 1TWFB 2L55A 4LFCQ 3EIVA 3ER0A 4JI1L 4JI4Q 3DMUA 4RGTA 4JI0L 5FLXL 2OTJA 2A1AA 1WTWA 2QEJC 1C4QA 1A63A 3GTMH 2R7DA 1Y1WH 2XRQD 1ICFB 5HGTA 4RGOS 2EYJA 1ESFA 5C4XB 3UDXA 2KVMA 4OIJA 3K58A 3W2DA 3HOXH 1AZPA 2F0JA 2HIVA 2QA4A 4WFN3 4JBWA 4G7OC 5M5YB 1HQMC 1SNCA 1PYSB 2VQEQ 1U4PA 2F4VL 2NBFA 3D3RA 3RZOH 2KUMA 2AQ2B 4JOIA 1A6XA 1IW7D 3HEJA 1B3AA 3EROA 2WAQG 5DAUA 2JA7B 1QNUA 1V1OA 4LFBQ 1I4RA 3M4PA 1TXYA 5GAHC 1VQPA 1WTOA 4RWSC 4JI7Q 1QJOA 3NPPA 4K14A 1SMYC 4L5QA 4NP5A 1H9MA 3HKZE 2LXJA 4B3TQ 4JI8Q 2KEEA 1FVIA 3CU7A 1AW7A 3VR6A 1TWGB 2RKSA 1EWHA 2UXDQ 4IFDJ 3NBIA 5LMNW 4R8NA 1PHJA 2VQFL 4GKJL 3GV6A 2DJGC 4LF8Q 3EN2A 1HH2P 5EJWA 5M3MB 1UWVA 1J5EQ 1CKNB 2O5IC 5CR3A 2B2TC 2RDGA 4ZKBB 4KJNA 2I46A 4BBSB 4FF2A 4A3EB 3S1NB 2BA1A 3VR2A 4DV6Q 2F0EA 4IFDH 1F2YA 1YI2A 5K36G 5IE8A 1I4HA 1UEBA 2UXBQ 2MQHA 3NWTA 1S5DD 3IRBA 4HCSA 4HSVA 3KLSX 4DUZL 4HJ8A 1Q7YC 1OO9B 1BQQT 1BXTA 1LLRD 2F0KA 2RA4A 1CQFA 4H02A 5IYBH 2CCZA 3T1YQ 1TWCB 4HIKA 1HR0Q 1B70B 1PH5A 1KL9A 4UDUC 3BDOA 1I4XA 3A8KE 4FDBA 1LV9A 3VR5A 3S15B 1IW7C 5CV8A 1Q81C 3A7AB 3CHBD
chains in the Genus database with same CATH topology
2BA0A 3AFQA 4GOPB 1X3FA 1VQ6A 5FLMG 3KF6B 3K80C 5FJ8H 4DR2L 3CCJA 1V1QA 3U50C 4DR1L 3TRZA 1A8VA 3KDFA 1DGSA 4A3JG 1VQFA 4LF4Q 3PUWA 4MNOA 1W3SA 4KI0A 4AYBE 5GADC 3PIOA 3HOZH 1ASYA 3I4MG 4X6AH 2UU9L 3I4OA 1I50H 3SGIA 2D0PA 4QY7A 5C4XH 4HJAA 3BZKA 4LF6Q 5C0XJ 4XIGS 1Q1EA 1EIYB 1YIJA 1IBLQ 3S16H 3M4QA 4IPGA 3ULPA 4B3SQ 3ICEA 3S1MH 1XPRA 2JJQA 2Z6KA 3BJUA 3T1HL 3J81j 1FL0A 2JA8G 3I7FA 1CKOA 3BZCA 4GLAC 1VQLA 3CCLA 1TWAH 5IT9c 1PH8A 2ZJQA 3G71A 1CSQA 5M5YH 2UXCQ 1X65A 4GOPC 2CWAA 1HJPA 2LXKA 3HOWG 3A5ZB 2ZTCA 1EWIA 1YVCA 1JJGA 2NVQH 2UXCL 2JEBI 4YY3L 1LM0A 4LF5L 3I4NH 3FP9A 1OXVA 1S3OA 4DUYL 1JJCB 1XJVA 3UDGA 1NE3A 3FHWA 1T9HA 4LUZA 2JA7H 3NBHB 5IYBG 1XMOQ 1E1TA 3GTGH 2NN6I 2YYZA 3KF6A 3KJOA 3PSIA 4R4CA 1MJEA 2F4VQ 2CQOA 4PG3A 4P75A 4A3MH 1BBUA 3PO3H 2AMCB 2KHIA 1XNQL 4DR5L 2E2JH 1VQ9A 3RR5A 4DNIA 1TWGH 1FGUA 1HNZL 4JBMA 3CD6A 5HY6A 3PUVA 1VQ4A 4POGA 1QZHA 1XPOA 3GDEA 1VQIA 3M7NA 2VUMG 1K83H 2WFWA 3PGZA 4MTNA 1PH3A 1VQDA 1PV4A 1S40A 1S72A 3UE0A 1IZ6A 2YTYA 2OQ0A 4UPAA 3RLFA 2PMZE 3I55A 1LYLA 3HOYG 4A3BG 1NY4A 2KENA 3BU2A 4IFDI 1K8GA 2HIXA 4A3CG 1N8RC 2RCNA 4OX9L 1IBMQ 2Z0SA 4GN4B 4HJ9A 1EQQA 2UUCQ 4BBSH 4C3HH 1P16A 1QVGA 1N34L 2VQFQ 4A3EH 1IBKL 1OXSC 4P74A 4B3ML 3PO2H 3S1NH 4GKJQ 1VQBA 3OYYA 2N8NA 1KQSA 1NMFA 1IBML 3HOUH 4BY7H 4JI6Q 4OWXB 5IYCH 1G51A 4DV3Q 1RL2A 3W1GA 4P71A 3CMAA 4YHHL 2UUBQ 2JA6G 4DR4Q 1Q1BA 1D7QA 1XMQL 5ELNA 1KD1C 2E8GA 4HIMA 1UE1A 1Y1WG 1HR0W 2E2HH 3PUXA 2DUDA 4APVA 4A3KH 2UUBL 3I2ZA 3A0JA 1TWCH 3M3YH 4R4QA 4BXXG 1FJGQ 2CWPA 3M9BA 3H0GG 2ASBA 2QEXA 2YTVA 1PA6A 3HOVH 3KFUA 3HOXG 1N32L 3S15H 5GROA 3WWVA 1HNXL 1L1OC 4DV5Q 4A3MG 2ZTDA 1YHBA 2JEAI 1QUQB 2F3IA 4PZ8A 4DAYB 1E7ZA 1G291 3AEVA 5GAEC 4C3IH 3CPFA 3RLNA 5BR8L 4LNQA 3K0XA 1GO3E 2Y0SE 4GLVB 4BY1G 1GD7A 3E0EA 1X9NA 1SRUA 1PH2A 1VQAA 3AFPA 1N36Q 1Z9FA 4R1JA 3F8TA 2KCMA 3K81C 2I0QA 1QZGA 4RG1A 2I5HA 1UE7A 3Q8DA 3B6YA 3CAMA 3U4VA 5AJ3L 4GNXA 3PIPA 3JC66 2R93H 1VCIA 1ASZA 5IP7G 3RNUA 1YZ6A 1SROA 4DR2Q 4LFAL 2KHJA 2PI2E 3DM3A 4DR1Q 3VDYA 1VQ8A 1SE8A 4DR7L 3PCOB 1TWFH 4WJ4A 4P72A 4R4TA 4A3IG 2NN6G 3W5OA 1VQNA 3GTOH 3L2PA 1QVFA 1WFQA 4BA2I 3E9IA 3PV0A 4Y7NH 1PH1A 3E9HA 1Q8KA 4KLKA 2UU9Q 5C0XI 1MIUA 2Z6KC 3K8AA 3OTOQ 2R7ZG 2MFIA 4A75A 2CKZB 1IL2A 1EOVA 1PYBA 3G6EA 1I5FA 2B3GA 2JE6I 3T1HQ 2BH2A 4A3LG 3OTOL 1QUQA 4A3KG 3GTPH 4A76A 2PQAA 4POFA 2Y0SG 1X55A 1EYGA 1L2FA 4UP7A 2VY3A 5EAYA 4JCVE 1Y1VG 3F1ZA 4UP8A 1UE6A 1J6QA 3ULJA 1PH4A 4DV7L 1XNRL 3CW2C 5C44G 3CCEA 2JA5H 3G4SA 3CPWA 3KYHC 4LUOA 1VQJA 4QJFA 4YY3Q 4LF5Q 3EBEA 4X65Q 2NVYH 4IFDG 4DUYQ 4MZ9A 5JJKA 1JE5A 3KOJA 3NEMA 4IPHA 4OONA 1X3EA 3S1RH 2OWOA 4BBRH 1X6OA 1OTCA 1BKBA 4ME3A 3CF5A 2JQOA 4X65L 5IYDH 3S1QH 2N49A 3M85A 4UP9A 3OW2A 1H95A 3K7AH 4PZ6A 4JBJA 4X64Q 1YNXA 3HKSA 4B3SL 4IJLA 5IWAL 2K75A 4X66L 2UUAL 4QQBX 1B8AA 1XNQQ 4JOIC 5M3FG 2LSSA 4DKAC 4DR5Q 4YCWA 4X64L 3J80c 1V9PA 1P8LA 1YJWA 2YTXA 1W2BA 4AYBG 3GO5A 4A3FG 1HNZQ 4JBKA 4DPGA 2N3SA 1LUZA 2RF4A 4OXPA 3STBD 3J81c 3J7ZC 5DLQE 2GVAA 4AIMA 1XTDA 4JI2L 3D31A 4JI4L 2R92G 1U5KA 1HZAA 3MEFA 4GN3B 4NPSA 4L5SA 4TQUS 4LF7Q 4YCVA 5FJ8G 4OWTB 4YWLA 5JEAJ 3UE1A 1SLJA 1Q12A 3K7UC 3GTJH 1N33L 4LF7L 4GKKL 5E7NA 3CXCA 1I94L 4OX9Q 3PUZA 5M3MH 2MNAA 4HIDA 2HT1A 4KHPL 1PVOA 3CCVA 1MJCA 3HFZB 3CCQA 3HOZG 3S2DH 4DR6L 1N34Q 1IBKQ 3RN2A 1XPUA 4LUVA 4B3MQ 4L5RC 2HHHQ 5C4XG 5C3EH 1SR3A 2ATWA 2XTIA 1KXLA 4IO9A 2NZOA 3CCUA 3G48A 4B3RL 3J80i 1VQOA 1M90C 2KCTA 4L5TA 2HHHL 4YHHQ 1KAWA 1K3RA 2K50A 2B63H 3AYHB 2WB1E 1XMQQ 1A0IA 3L7ZC 5IP9H 2VQEL 1SFOH 4GNXB 3FKIH 1LTLA 4JG2A 3NELA 1WI5A 3CCRA 1VQKA 4DV2L 4DK3C 1OXTA 5ELOA 3KLWA 4PMWA 1KIXA 4A3GH 1OXUA 3I4NG 4NB3A 4K0KL 1E22A 3TEHB 2IX0A 3CC2A 1N32Q 1VQHA 3CCSA 2K14A 2D62A 5C0XG 1KRSA 2FXQA 4DV4Q 1K9MC 1A62A 5LMUL 1HNXQ 2JA7G 3TREA 2F52A 4JI7L 5FLMH 3UDFA 1K0RA 1K8AC 5HGQA 4R4IA 1Q86C 4A3JH 4AQYL 4DV4L 4A3DH 5BR8Q 4QL5A 4J15A 1VS0A 4JI8L 4B3TL 2JK8A 1AE2A 4TVAB 1GM5A 3PO3G 1JMCA 3CP0A 3I4MH 2PQAB 4AH6A 2UXDL 2Q2TA 1BVSA 1EIFA 2B29A 4DV0Q 1K73C 2R92H 2K52A 1OXXK 2CFMA 1G6PA 1BBWA 3CC7A 4IJHA 3CMEA 5AJ3Q 3PUYA 3STBC 3J7A5 2R7FA 4DV0L 5M5WH 2H5XA 2JA8H 1J5EL 2VW9A 3U58A 4LFAQ 2ZJRA 2EQSA 4DR7Q 1WYDA 3CC4A 2VL6A 3S2HH 1IYJB 3KJPA 3HOWH 3MXNB 4IOAA 2E5LL 1EUJA 3ULLA 4HJ5A 3NENA 5H1SE 4DV6L 4BA1I 3S17H 2ZTEA 4BBSG 1VQMA 3PO2G 2A19A 4A3EG 5J3BA 1WCMH 2UXBL 4IPDA 3HOUG 1HNWL 4EQ5A 4BY7G 5LMNL 2WP8J 4EX5A 5M5XH 5IYCG 4C3JH 1PFSA 1WOCA 1V43A 1YHAA 3CCMA 2IHFA 2OTLA 3T1YL 4GLXA 2GVBA 1NJIC 1YJ9A 1HR0L 4DV7Q 1XNRQ 5C4JH 2BH8A 2AWOA 2K4KA 4X62L 1X56A 2RHSB 5GAGC 1JJ2A 1JB7A 1L0WA 4LF9L 3H3VI 4WJ3M 1CSPA 1KRTA 3W1BA 1VQEA 5IY0A 1R9TH 1CKNA 2D0OA 3HOVG 1TWHH 1C9OA 2QGQA 4NXNL 2VUMH 4JV5L 2ZM6Q 2VNUD 1IXRA 1VQ5A 2MO1A 4A3DG 3TQYA 2AHOB 1Y14B 4XTCS 1RIPA 1MKHA 2K5VA 4JI3Q 2I5MX 2GN5A 4P73A 4DAMA 2ZM6L 4RMFA 5IWAQ 3HOYH 4A3BH 2YV5A 4LF4L 4X66Q 2UUAQ 1VQ7A 4NXMQ 2EXDA 4DR3Q 2VZAA 4GN5A 1B7YB 4JI3L 4QGUA 4JI1Q 1NMGA 4JI0Q 2IHEA 4O0AA 1YEZA 4NXML 4DR3L 2HQLA 3L0OA 2V1CC 4ALPA 1EFWA 4LF6L 4LFCQ 2K5HA 3EIVA 1KHIA 2WAQE 3AQQA 3ER0A 5FLXc 3TS0A 4JI1L 1IBLL 3A74A 1E1OA 2AWNA 4JI2Q 2ES2A 2NVXH 1E24A 4JI0L 4JI4Q 4A3CH 2JA6H 1I6HH 2OTJA 1QVCA 2R93G 1D8LA 2A1AA 1M1KC 4LFCL 3H3VH 1A63A 4C2MH 3GTMH 2R7DA 2XGTA 2PNHA 1Y1WH 2OCEA 2EIFA 1N33Q 4GKKQ 3CQZH 1I94Q 3ZJYC 3GTQH 1WCMG 2YU9H 4BXXH 4DR6Q 3UDXA 3H0GH 4KHPQ 4OO1I 1U0LA 2IY5B 4GOPA 2RHQB 3H15A 3F2DA 1GVPA 3HOXH 2PI2A 4A93H 1GKHA 3RN5A 2IT1A 2HIVA 2C35B 2I5LX 2QA4A 4JBWA 4B3RQ 1AE3A 1I3QH 3ERSX 3M4OH 2MO0A 1X3GA 1XMOL 1CKMA 2L15A 1JT8A 2NZHA 1PYSB 2VQEQ 2F4VL 1AH9A 2DGYA 3RZOH 1Z47A 1YHQA 4YWMA 3F2CA 4BY1H 4DV2Q 4JOIA 5JJLA 1CUKA 2JA5G 1Q82C 3J81i 1C7YA 1YJNA 4K0KQ 2WAQG 4QIWE 1NBWA 4LFBQ 3M4PA 1TXYA 5GAHC 4BBRG 1VQPA 5LMUQ 2VS1A 4GS3A 4JI7Q 5IP7H 5IYDG 4OWWB 1PH6A 1HZ9A 4LWCA 4L5QA 3GTKH 4LFBL 2ALYB 3U4ZA 4LW1A 4AQYQ 4A3IH 3HKZE 1L1OB 2LXJA 4B3TQ 4JI8Q 1FVIA 1EQRA 1PH9A 3JAMc 4A4IA 3PF5A 1HZCA 2UXDQ 4IFDJ 1KC8C 2ID0A 5LMNW 3LGJA 1PHJA 2Q2UA 2UUCL 2R7ZH 1C0AA 2VQFL 4GKJL 1VQGA 1SN8A 2Q2HA 3KF8B 4LF8Q 2OQKA 1NTGA 1E3PA 3EN2A 1HH2P 4GNXC 4JI6L 4A3LH 4HIOA 1UWVA 1Q46A 4DV3L 1J5EQ 1CKNB 4UY8C 1SMXA 4DR4L 1X54A 1YBYA 3S24A 4LF8L 4JI5Q 4R4OA 3I56A 2E2IH 3RLOA 2A8VA 1Y1VH 3KDFB 2WB1G 5C44H 2Q2IA 2E5LQ 4A93G 5M3MG 4JI5L 2BA1A 4DV6Q 1WJJA 1FJGL 4YWKA 4DV1Q 1YI2A 2IX1A 5IE8A 3GTLH 3D0FA 5K36G 1UEBA 4DUZQ 2UXBQ 2JA9A 2MQHA 5C3EG 3JAMi 1VQCA 5GQOA 3DLLA 3F2BA 3S14H 4JYAQ 2N78A 1HNWQ 4IPCA 5JJIA 5LMNQ 3IRBA 4DV1L 4DV5L 3UDIA 4JC0A 4DUZL 3HKZG 4HJ8A 1Q7YC 2B63G 4JYAL 2NVTH 2CCZA 4H02A 5IYBH 1UE5A 5IP9G 1L1OA 3T1YQ 4HIKA 2AKWB 4YCUA 3FKIG 5JEAG 1N9WA 1HR0Q 1B70B 5M3FH 4Y52H 3PF4A 4X62Q 1PH5A 1KL9A 1O7IA 1YITA 4PZ7A 1HZBA 4DK6C 1N36L 4LF9Q 4FDBA 4IOCA 4A3FH 4HJ7A 1PH7A 4A3GG 4O2DA 3TS2A 4NXNQ 3GD7A 4JV5Q 4OO1G 2KBNA 4KHZA 3A5UA 2ZJPA 1Q81C 2K5NA 3RZDH 2R6GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA0 A;  3AFQ A;  4GOP B;  1X3F A;  1VQ6 A;  5FLM G;  3KF6 B;  3K80 C;  5FJ8 H;  4DR2 L;  3CCJ A;  1V1Q A;  3U50 C;  4DR1 L;  3TRZ A;  1A8V A;  3KDF A;  1DGS A;  4A3J G;  1VQF A;  4LF4 Q;  3PUW A;  4MNO A;  1W3S A;  4KI0 A;  4AYB E;  5GAD C;  3PIO A;  3HOZ H;  1ASY A;  3I4M G;  4X6A H;  2UU9 L;  3I4O A;  1I50 H;  3SGI A;  2D0P A;  4QY7 A;  5C4X H;  4HJA A;  3BZK A;  4LF6 Q;  5C0X J;  4XIG S;  1Q1E A;  1EIY B;  1YIJ A;  1IBL Q;  3S16 H;  3M4Q A;  4IPG A;  3ULP A;  4B3S Q;  3ICE A;  3S1M H;  1XPR A;  2JJQ A;  2Z6K A;  3BJU A;  3T1H L;  3J81 j;  1FL0 A;  2JA8 G;  3I7F A;  1CKO A;  3BZC A;  4GLA C;  1VQL A;  3CCL A;  1TWA H;  5IT9 c;  1PH8 A;  2ZJQ A;  3G71 A;  1CSQ A;  5M5Y H;  2UXC Q;  1X65 A;  4GOP C;  2CWA A;  1HJP A;  2LXK A;  3HOW G;  3A5Z B;  2ZTC A;  1EWI A;  1YVC A;  1JJG A;  2NVQ H;  2UXC L;  2JEB I;  4YY3 L;  1LM0 A;  4LF5 L;  3I4N H;  3FP9 A;  1OXV A;  1S3O A;  4DUY L;  1JJC B;  1XJV A;  3UDG A;  1NE3 A;  3FHW A;  1T9H A;  4LUZ A;  2JA7 H;  3NBH B;  5IYB G;  1XMO Q;  1E1T A;  3GTG H;  2NN6 I;  2YYZ A;  3KF6 A;  3KJO A;  3PSI A;  4R4C A;  1MJE A;  2F4V Q;  2CQO A;  4PG3 A;  4P75 A;  4A3M H;  1BBU A;  3PO3 H;  2AMC B;  2KHI A;  1XNQ L;  4DR5 L;  2E2J H;  1VQ9 A;  3RR5 A;  4DNI A;  1TWG H;  1FGU A;  1HNZ L;  4JBM A;  3CD6 A;  5HY6 A;  3PUV A;  1VQ4 A;  4POG A;  1QZH A;  1XPO A;  3GDE A;  1VQI A;  3M7N A;  2VUM G;  1K83 H;  2WFW A;  3PGZ A;  4MTN A;  1PH3 A;  1VQD A;  1PV4 A;  1S40 A;  1S72 A;  3UE0 A;  1IZ6 A;  2YTY A;  2OQ0 A;  4UPA A;  3RLF A;  2PMZ E;  3I55 A;  1LYL A;  3HOY G;  4A3B G;  1NY4 A;  2KEN A;  3BU2 A;  4IFD I;  1K8G A;  2HIX A;  4A3C G;  1N8R C;  2RCN A;  4OX9 L;  1IBM Q;  2Z0S A;  4GN4 B;  4HJ9 A;  1EQQ A;  2UUC Q;  4BBS H;  4C3H H;  1P16 A;  1QVG A;  1N34 L;  2VQF Q;  4A3E H;  1IBK L;  1OXS C;  4P74 A;  4B3M L;  3PO2 H;  3S1N H;  4GKJ Q;  1VQB A;  3OYY A;  2N8N A;  1KQS A;  1NMF A;  1IBM L;  3HOU H;  4BY7 H;  4JI6 Q;  4OWX B;  5IYC H;  1G51 A;  4DV3 Q;  1RL2 A;  3W1G A;  4P71 A;  3CMA A;  4YHH L;  2UUB Q;  2JA6 G;  4DR4 Q;  1Q1B A;  1D7Q A;  1XMQ L;  5ELN A;  1KD1 C;  2E8G A;  4HIM A;  1UE1 A;  1Y1W G;  1HR0 W;  2E2H H;  3PUX A;  2DUD A;  4APV A;  4A3K H;  2UUB L;  3I2Z A;  3A0J A;  1TWC H;  3M3Y H;  4R4Q A;  4BXX G;  1FJG Q;  2CWP A;  3M9B A;  3H0G G;  2ASB A;  2QEX A;  2YTV A;  1PA6 A;  3HOV H;  3KFU A;  3HOX G;  1N32 L;  3S15 H;  5GRO A;  3WWV A;  1HNX L;  1L1O C;  4DV5 Q;  4A3M G;  2ZTD A;  1YHB A;  2JEA I;  1QUQ B;  2F3I A;  4PZ8 A;  4DAY B;  1E7Z A;  1G29 1;  3AEV A;  5GAE C;  4C3I H;  3CPF A;  3RLN A;  5BR8 L;  4LNQ A;  3K0X A;  1GO3 E;  2Y0S E;  4GLV B;  4BY1 G;  1GD7 A;  3E0E A;  1X9N A;  1SRU A;  1PH2 A;  1VQA A;  3AFP A;  1N36 Q;  1Z9F A;  4R1J A;  3F8T A;  2KCM A;  3K81 C;  2I0Q A;  1QZG A;  4RG1 A;  2I5H A;  1UE7 A;  3Q8D A;  3B6Y A;  3CAM A;  3U4V A;  5AJ3 L;  4GNX A;  3PIP A;  3JC6 6;  2R93 H;  1VCI A;  1ASZ A;  5IP7 G;  3RNU A;  1YZ6 A;  1SRO A;  4DR2 Q;  4LFA L;  2KHJ A;  2PI2 E;  3DM3 A;  4DR1 Q;  3VDY A;  1VQ8 A;  1SE8 A;  4DR7 L;  3PCO B;  1TWF H;  4WJ4 A;  4P72 A;  4R4T A;  4A3I G;  2NN6 G;  3W5O A;  1VQN A;  3GTO H;  3L2P A;  1QVF A;  1WFQ A;  4BA2 I;  3E9I A;  3PV0 A;  4Y7N H;  1PH1 A;  3E9H A;  1Q8K A;  4KLK A;  2UU9 Q;  5C0X I;  1MIU A;  2Z6K C;  3K8A A;  3OTO Q;  2R7Z G;  2MFI A;  4A75 A;  2CKZ B;  1IL2 A;  1EOV A;  1PYB A;  3G6E A;  1I5F A;  2B3G A;  2JE6 I;  3T1H Q;  2BH2 A;  4A3L G;  3OTO L;  1QUQ A;  4A3K G;  3GTP H;  4A76 A;  2PQA A;  4POF A;  2Y0S G;  1X55 A;  1EYG A;  1L2F A;  4UP7 A;  2VY3 A;  5EAY A;  4JCV E;  1Y1V G;  3F1Z A;  4UP8 A;  1UE6 A;  1J6Q A;  3ULJ A;  1PH4 A;  4DV7 L;  1XNR L;  3CW2 C;  5C44 G;  3CCE A;  2JA5 H;  3G4S A;  3CPW A;  3KYH C;  4LUO A;  1VQJ A;  4QJF A;  4YY3 Q;  4LF5 Q;  3EBE A;  4X65 Q;  2NVY H;  4IFD G;  4DUY Q;  4MZ9 A;  5JJK A;  1JE5 A;  3KOJ A;  3NEM A;  4IPH A;  4OON A;  1X3E A;  3S1R H;  2OWO A;  4BBR H;  1X6O A;  1OTC A;  1BKB A;  4ME3 A;  3CF5 A;  2JQO A;  4X65 L;  5IYD H;  3S1Q H;  2N49 A;  3M85 A;  4UP9 A;  3OW2 A;  1H95 A;  3K7A H;  4PZ6 A;  4JBJ A;  4X64 Q;  1YNX A;  3HKS A;  4B3S L;  4IJL A;  5IWA L;  2K75 A;  4X66 L;  2UUA L;  4QQB X;  1B8A A;  1XNQ Q;  4JOI C;  5M3F G;  2LSS A;  4DKA C;  4DR5 Q;  4YCW A;  4X64 L;  3J80 c;  1V9P A;  1P8L A;  1YJW A;  2YTX A;  1W2B A;  4AYB G;  3GO5 A;  4A3F G;  1HNZ Q;  4JBK A;  4DPG A;  2N3S A;  1LUZ A;  2RF4 A;  4OXP A;  3STB D;  3J81 c;  3J7Z C;  5DLQ E;  2GVA A;  4AIM A;  1XTD A;  4JI2 L;  3D31 A;  4JI4 L;  2R92 G;  1U5K A;  1HZA A;  3MEF A;  4GN3 B;  4NPS A;  4L5S A;  4TQU S;  4LF7 Q;  4YCV A;  5FJ8 G;  4OWT B;  4YWL A;  5JEA J;  3UE1 A;  1SLJ A;  1Q12 A;  3K7U C;  3GTJ H;  1N33 L;  4LF7 L;  4GKK L;  5E7N A;  3CXC A;  1I94 L;  4OX9 Q;  3PUZ A;  5M3M H;  2MNA A;  4HID A;  2HT1 A;  4KHP L;  1PVO A;  3CCV A;  1MJC A;  3HFZ B;  3CCQ A;  3HOZ G;  3S2D H;  4DR6 L;  1N34 Q;  1IBK Q;  3RN2 A;  1XPU A;  4LUV A;  4B3M Q;  4L5R C;  2HHH Q;  5C4X G;  5C3E H;  1SR3 A;  2ATW A;  2XTI A;  1KXL A;  4IO9 A;  2NZO A;  3CCU A;  3G48 A;  4B3R L;  3J80 i;  1VQO A;  1M90 C;  2KCT A;  4L5T A;  2HHH L;  4YHH Q;  1KAW A;  1K3R A;  2K50 A;  2B63 H;  3AYH B;  2WB1 E;  1XMQ Q;  1A0I A;  3L7Z C;  5IP9 H;  2VQE L;  1SFO H;  4GNX B;  3FKI H;  1LTL A;  4JG2 A;  3NEL A;  1WI5 A;  3CCR A;  1VQK A;  4DV2 L;  4DK3 C;  1OXT A;  5ELO A;  3KLW A;  4PMW A;  1KIX A;  4A3G H;  1OXU A;  3I4N G;  4NB3 A;  4K0K L;  1E22 A;  3TEH B;  2IX0 A;  3CC2 A;  1N32 Q;  1VQH A;  3CCS A;  2K14 A;  2D62 A;  5C0X G;  1KRS A;  2FXQ A;  4DV4 Q;  1K9M C;  1A62 A;  5LMU L;  1HNX Q;  2JA7 G;  3TRE A;  2F52 A;  4JI7 L;  5FLM H;  3UDF A;  1K0R A;  1K8A C;  5HGQ A;  4R4I A;  1Q86 C;  4A3J H;  4AQY L;  4DV4 L;  4A3D H;  5BR8 Q;  4QL5 A;  4J15 A;  1VS0 A;  4JI8 L;  4B3T L;  2JK8 A;  1AE2 A;  4TVA B;  1GM5 A;  3PO3 G;  1JMC A;  3CP0 A;  3I4M H;  2PQA B;  4AH6 A;  2UXD L;  2Q2T A;  1BVS A;  1EIF A;  2B29 A;  4DV0 Q;  1K73 C;  2R92 H;  2K52 A;  1OXX K;  2CFM A;  1G6P A;  1BBW A;  3CC7 A;  4IJH A;  3CME A;  5AJ3 Q;  3PUY A;  3STB C;  3J7A 5;  2R7F A;  4DV0 L;  5M5W H;  2H5X A;  2JA8 H;  1J5E L;  2VW9 A;  3U58 A;  4LFA Q;  2ZJR A;  2EQS A;  4DR7 Q;  1WYD A;  3CC4 A;  2VL6 A;  3S2H H;  1IYJ B;  3KJP A;  3HOW H;  3MXN B;  4IOA A;  2E5L L;  1EUJ A;  3ULL A;  4HJ5 A;  3NEN A;  5H1S E;  4DV6 L;  4BA1 I;  3S17 H;  2ZTE A;  4BBS G;  1VQM A;  3PO2 G;  2A19 A;  4A3E G;  5J3B A;  1WCM H;  2UXB L;  4IPD A;  3HOU G;  1HNW L;  4EQ5 A;  4BY7 G;  5LMN L;  2WP8 J;  4EX5 A;  5M5X H;  5IYC G;  4C3J H;  1PFS A;  1WOC A;  1V43 A;  1YHA A;  3CCM A;  2IHF A;  2OTL A;  3T1Y L;  4GLX A;  2GVB A;  1NJI C;  1YJ9 A;  1HR0 L;  4DV7 Q;  1XNR Q;  5C4J H;  2BH8 A;  2AWO A;  2K4K A;  4X62 L;  1X56 A;  2RHS B;  5GAG C;  1JJ2 A;  1JB7 A;  1L0W A;  4LF9 L;  3H3V I;  4WJ3 M;  1CSP A;  1KRT A;  3W1B A;  1VQE A;  5IY0 A;  1R9T H;  1CKN A;  2D0O A;  3HOV G;  1TWH H;  1C9O A;  2QGQ A;  4NXN L;  2VUM H;  4JV5 L;  2ZM6 Q;  2VNU D;  1IXR A;  1VQ5 A;  2MO1 A;  4A3D G;  3TQY A;  2AHO B;  1Y14 B;  4XTC S;  1RIP A;  1MKH A;  2K5V A;  4JI3 Q;  2I5M X;  2GN5 A;  4P73 A;  4DAM A;  2ZM6 L;  4RMF A;  5IWA Q;  3HOY H;  4A3B H;  2YV5 A;  4LF4 L;  4X66 Q;  2UUA Q;  1VQ7 A;  4NXM Q;  2EXD A;  4DR3 Q;  2VZA A;  4GN5 A;  1B7Y B;  4JI3 L;  4QGU A;  4JI1 Q;  1NMG A;  4JI0 Q;  2IHE A;  4O0A A;  1YEZ A;  4NXM L;  4DR3 L;  2HQL A;  3L0O A;  2V1C C;  4ALP A;  1EFW A;  4LF6 L;  4LFC Q;  2K5H A;  3EIV A;  1KHI A;  2WAQ E;  3AQQ A;  3ER0 A;  5FLX c;  3TS0 A;  4JI1 L;  1IBL L;  3A74 A;  1E1O A;  2AWN A;  4JI2 Q;  2ES2 A;  2NVX H;  1E24 A;  4JI0 L;  4JI4 Q;  4A3C H;  2JA6 H;  1I6H H;  2OTJ A;  1QVC A;  2R93 G;  1D8L A;  2A1A A;  1M1K C;  4LFC L;  3H3V H;  1A63 A;  4C2M H;  3GTM H;  2R7D A;  2XGT A;  2PNH A;  1Y1W H;  2OCE A;  2EIF A;  1N33 Q;  4GKK Q;  3CQZ H;  1I94 Q;  3ZJY C;  3GTQ H;  1WCM G;  2YU9 H;  4BXX H;  4DR6 Q;  3UDX A;  3H0G H;  4KHP Q;  4OO1 I;  1U0L A;  2IY5 B;  4GOP A;  2RHQ B;  3H15 A;  3F2D A;  1GVP A;  3HOX H;  2PI2 A;  4A93 H;  1GKH A;  3RN5 A;  2IT1 A;  2HIV A;  2C35 B;  2I5L X;  2QA4 A;  4JBW A;  4B3R Q;  1AE3 A;  1I3Q H;  3ERS X;  3M4O H;  2MO0 A;  1X3G A;  1XMO L;  1CKM A;  2L15 A;  1JT8 A;  2NZH A;  1PYS B;  2VQE Q;  2F4V L;  1AH9 A;  2DGY A;  3RZO H;  1Z47 A;  1YHQ A;  4YWM A;  3F2C A;  4BY1 H;  4DV2 Q;  4JOI A;  5JJL A;  1CUK A;  2JA5 G;  1Q82 C;  3J81 i;  1C7Y A;  1YJN A;  4K0K Q;  2WAQ G;  4QIW E;  1NBW A;  4LFB Q;  3M4P A;  1TXY A;  5GAH C;  4BBR G;  1VQP A;  5LMU Q;  2VS1 A;  4GS3 A;  4JI7 Q;  5IP7 H;  5IYD G;  4OWW B;  1PH6 A;  1HZ9 A;  4LWC A;  4L5Q A;  3GTK H;  4LFB L;  2ALY B;  3U4Z A;  4LW1 A;  4AQY Q;  4A3I H;  3HKZ E;  1L1O B;  2LXJ A;  4B3T Q;  4JI8 Q;  1FVI A;  1EQR A;  1PH9 A;  3JAM c;  4A4I A;  3PF5 A;  1HZC A;  2UXD Q;  4IFD J;  1KC8 C;  2ID0 A;  5LMN W;  3LGJ A;  1PHJ A;  2Q2U A;  2UUC L;  2R7Z H;  1C0A A;  2VQF L;  4GKJ L;  1VQG A;  1SN8 A;  2Q2H A;  3KF8 B;  4LF8 Q;  2OQK A;  1NTG A;  1E3P A;  3EN2 A;  1HH2 P;  4GNX C;  4JI6 L;  4A3L H;  4HIO A;  1UWV A;  1Q46 A;  4DV3 L;  1J5E Q;  1CKN B;  4UY8 C;  1SMX A;  4DR4 L;  1X54 A;  1YBY A;  3S24 A;  4LF8 L;  4JI5 Q;  4R4O A;  3I56 A;  2E2I H;  3RLO A;  2A8V A;  1Y1V H;  3KDF B;  2WB1 G;  5C44 H;  2Q2I A;  2E5L Q;  4A93 G;  5M3M G;  4JI5 L;  2BA1 A;  4DV6 Q;  1WJJ A;  1FJG L;  4YWK A;  4DV1 Q;  1YI2 A;  2IX1 A;  5IE8 A;  3GTL H;  3D0F A;  5K36 G;  1UEB A;  4DUZ Q;  2UXB Q;  2JA9 A;  2MQH A;  5C3E G;  3JAM i;  1VQC A;  5GQO A;  3DLL A;  3F2B A;  3S14 H;  4JYA Q;  2N78 A;  1HNW Q;  4IPC A;  5JJI A;  5LMN Q;  3IRB A;  4DV1 L;  4DV5 L;  3UDI A;  4JC0 A;  4DUZ L;  3HKZ G;  4HJ8 A;  1Q7Y C;  2B63 G;  4JYA L;  2NVT H;  2CCZ A;  4H02 A;  5IYB H;  1UE5 A;  5IP9 G;  1L1O A;  3T1Y Q;  4HIK A;  2AKW B;  4YCU A;  3FKI G;  5JEA G;  1N9W A;  1HR0 Q;  1B70 B;  5M3F H;  4Y52 H;  3PF4 A;  4X62 Q;  1PH5 A;  1KL9 A;  1O7I A;  1YIT A;  4PZ7 A;  1HZB A;  4DK6 C;  1N36 L;  4LF9 Q;  4FDB A;  4IOC A;  4A3F H;  4HJ7 A;  1PH7 A;  4A3G G;  4O2D A;  3TS2 A;  4NXN Q;  3GD7 A;  4JV5 Q;  4OO1 G;  2KBN A;  4KHZ A;  3A5U A;  2ZJP A;  1Q81 C;  2K5N A;  3RZD H;  2R6G A; 
#chains in the Genus database with same CATH topology
 3AFQ A;  4GOP B;  1AN8 A;  4CDF C;  2PYK A;  3KF6 B;  3K80 C;  3VR4 A;  5ISR A;  3A56 A;  1IHZ A;  3QOJ A;  3TRZ A;  1LAC A;  1A8V A;  1QWY A;  3W3A A;  1A15 A;  2J0T D;  4ABN A;  1G6Z A;  5C6A A;  4KI0 A;  1L0Y B;  5K5P A;  1ASY A;  3I4M G;  4X6A H;  4Q0F A;  1I50 H;  2D0P A;  4QY7 A;  4LF6 Q;  1WTV A;  3OW7 A;  3DUZ A;  3S1M H;  3S16 H;  4B3S Q;  3FPP A;  3A55 A;  4DU9 A;  5KRU A;  1CKO A;  1VQL A;  4M8A A;  5EKL A;  3CCL A;  3GTO B;  4K5W A;  2ZJQ A;  3G71 A;  1O78 A;  1NSN S;  1WCM B;  4GOP C;  2HUG A;  3A5Z B;  1YVC A;  4C3J B;  1SYC A;  4LF5 L;  1KNE A;  3L9A X;  3I4N H;  1OXV A;  4DUY L;  2R3Z A;  1HCZ A;  3UDG A;  2EYH A;  5KGU A;  1I4Q A;  3GTP B;  4ZLT F;  3GTG H;  1E1T A;  4R4C A;  2FHT A;  2CQO A;  3K57 A;  2RSO A;  3TZU A;  4A3M H;  2JA5 B;  4TKO B;  1BBU A;  1RKN A;  4DR5 L;  1FNW A;  4N9P A;  5CMD A;  1ESR A;  2EZV A;  4JBM A;  5D3D A;  3PUV A;  1VQ4 A;  4UAI A;  4POG A;  1G2T A;  2KHS A;  1Y8N B;  3GDE A;  1IL8 A;  4MTN A;  2F3V A;  3PGZ A;  1PV4 A;  1S40 A;  1HUM A;  1SYD A;  3TDQ A;  4UPA A;  5FK9 C;  2H4O A;  2KOL A;  4A3B G;  1M8A A;  2KEN A;  1K8G A;  1STA A;  4A3C G;  1N8R C;  2BE5 D;  2Z0S A;  2UUC Q;  5J1Z A;  3PO2 H;  1OXS C;  5FO9 B;  3OYY A;  1NMF A;  3NBH A;  5IOC A;  3GTQ B;  1E2W A;  1GUG A;  1GOZ A;  1EZ6 A;  1RL2 A;  2UUB Q;  4DR4 Q;  2WB1 B;  4XDX A;  1Q1B A;  2DNC A;  2K5Q A;  3K5N A;  1UE1 A;  4ZUJ A;  1HA6 A;  3J7A V;  2DUD A;  4A3K H;  4RGN A;  1H9R A;  3QG1 A;  2ASB A;  2BDN A;  1N32 L;  4HMJ A;  3HKZ B;  5L37 A;  4M1U B;  1L1O C;  1ET9 A;  1YHB A;  2B8F A;  1SFO B;  1QG7 A;  3FKI B;  4DAY B;  4RCO A;  5GAE C;  4I7Z C;  1MD2 D;  4BY1 G;  4A3G B;  3F8T A;  2PQE A;  3K6O A;  3K81 C;  4QMG A;  4RG1 A;  4F7X A;  1UE7 A;  3Q8D A;  5AJ3 L;  4GNX A;  3PIP A;  4JW0 A;  5KYL A;  1YZ6 A;  1T5X D;  4B9X A;  4DR2 Q;  3DM3 A;  4KKT A;  2NTT A;  4HAE A;  4A3I G;  3W5O A;  3QR8 A;  4BA2 I;  1J9O A;  1BO0 A;  1Q8K A;  5D3I B;  1PRT B;  3MVV A;  3SK8 A;  2UU9 Q;  1LTS D;  3MC0 B;  3OMG A;  1MIU A;  1KNA A;  2BE5 C;  1SJE D;  2R7Z G;  2MFI A;  2CKZ B;  5M5W B;  1EOV A;  2JA8 B;  3G6E A;  1I5F A;  2B3G A;  2JE6 I;  3T1H Q;  2BH2 A;  4A3L G;  4A76 A;  3A8J E;  2Y0S G;  1L2F A;  3ZYY X;  4PNY A;  4UP7 A;  2VY3 A;  1ZKO A;  5EAY A;  3ULJ A;  2A74 C;  3CCE A;  3T53 B;  3G4S A;  4CJ2 C;  1VQJ A;  4YY3 Q;  2B8G A;  2B2U C;  3R2I A;  1DCZ A;  2L0C A;  4LK1 C;  1B53 A;  5DNF A;  1SSO A;  1X6O A;  4FF3 A;  4QUF A;  2JQO A;  2B2V A;  4C3I G;  4X65 L;  2N49 A;  3ERQ A;  4UHV A;  2CVR A;  2EYP A;  1WVL A;  1YNX A;  3AU7 A;  4IJL A;  5IWA L;  2N88 A;  4QQB X;  2EJF C;  4JOI C;  4DKA C;  4FF4 A;  4YCW A;  1V9P A;  1YJW A;  4AYB G;  1JOR A;  1HNZ Q;  2VUM B;  1TS3 A;  2N3S A;  2RF4 A;  3STB D;  2E76 C;  3J81 c;  4K6L A;  3J7Z C;  1XTD A;  2K5W A;  4JI2 L;  2IJ0 A;  1HZA A;  1RD9 D;  4NKL A;  3NHH A;  4YCV A;  4X3S A;  1E0B A;  4YWL A;  2SNS A;  1N33 L;  4GKK L;  4NDX A;  4LF7 L;  3D4R A;  5E7N A;  2TMP A;  1I94 L;  2F4I A;  1PVO A;  3HFZ B;  3CCQ A;  3K5M A;  1XPU A;  1JCK B;  4L5R C;  2JN4 A;  2Z4H A;  2HHH Q;  4KY7 A;  3IAY A;  5C4X G;  2XTI A;  2F1M A;  1ROD A;  4L5T A;  5KNB A;  1A0I A;  3HG9 A;  2K03 A;  3TZD A;  1O80 A;  4G7H C;  3H0G B;  3V05 A;  3CCR A;  1VQK A;  2K6A A;  4FP5 D;  4CKE A;  1SE3 A;  3SEB A;  3FRP B;  3KLW A;  1H9S B;  1OXU A;  4NB3 A;  4K0K L;  1WTP A;  3CC2 A;  3Q0A A;  1B4O A;  2K14 A;  1K9M C;  1A62 A;  2M2L A;  5LMU L;  2JA7 G;  1ICW A;  3H09 A;  4FXD A;  1Q86 C;  3BVM A;  3JAM L;  2F0Q A;  3F2U A;  2JK8 A;  1WTX A;  1JMC A;  4IAL A;  4CGY B;  3I4M H;  2PQA B;  2KEC A;  1EIF A;  2WKC A;  4DV0 Q;  1ZEQ X;  2CFM A;  1BBW A;  1S5F D;  3CC7 A;  2G5D A;  2M9V A;  1ENF A;  3PUY A;  3STB C;  4HN7 A;  3GTK B;  3U58 A;  4LFA Q;  2EQS A;  4DR7 Q;  3QWN A;  1HXY D;  2XIW A;  3HGB A;  3CC4 A;  3KJP A;  3G7L A;  3MXN B;  4RGM A;  2B2T A;  4BA1 I;  4BBS G;  1D6E C;  2O4X A;  4A3E G;  1H9J A;  2F0W A;  1JOQ A;  5BN3 A;  1SXT A;  3N6R A;  1PFS A;  5C44 B;  3CCM A;  1BDO A;  2BH8 A;  4X3T A;  4YIJ A;  4K5V A;  5LHY 1;  1CA6 A;  1NUC A;  1JJ2 A;  3GTL B;  4LF9 L;  1CSP A;  1KRT A;  1R9T H;  5IGC A;  1CKN A;  1TU2 B;  1TWH H;  4NXN L;  4K8I A;  4JV5 L;  2V4D A;  2ZM6 Q;  1IXR A;  1VQ5 A;  2K33 A;  4RHS A;  2QW7 A;  1Y14 B;  4XTC S;  5FKA C;  1MKH A;  1CHP D;  4X3U A;  4DAM A;  1D5X C;  4A3B H;  4LF4 L;  1VQ7 A;  1EL0 A;  3I90 A;  3H6M A;  3X3N A;  1BCP F;  1EOT A;  4JI1 Q;  2IWH A;  1NMG A;  4JI0 Q;  4O0A A;  4HR7 B;  4NXM L;  1FGB D;  4DR3 L;  3TP6 A;  1PYW D;  1ENC A;  3R93 A;  1D2B A;  1KHI A;  1F9P A;  3AQQ A;  5C4H A;  3TS0 A;  1IBL L;  1VQ6 A;  2AWN A;  5I2X A;  1I6H H;  3EVQ A;  1HTL D;  1QVC A;  1M1K C;  3HP3 A;  4IN3 A;  3ZJY C;  1WCM G;  1EQT A;  3A7L A;  5A35 A;  4KHP Q;  5TSS A;  1HTP A;  4GOP A;  2RHQ B;  3I4L A;  4U68 A;  3CRK C;  4C3J G;  4A93 H;  3BZD B;  2I5L X;  4B3R Q;  3TP8 A;  1STY A;  3ERS X;  4CDD C;  2AQ3 B;  3M4O H;  3N52 A;  1TWA B;  1KAA A;  1EYA A;  4FO2 A;  1HFG A;  1AH9 A;  4BY1 H;  5IIF A;  2GA4 B;  5JJL A;  3BDC A;  3MA2 B;  2JA5 G;  1Q82 C;  3VA5 A;  1DJR D;  2PO4 A;  1NBW A;  3G6J B;  1A3V A;  2VS1 A;  1O7Z A;  1MHW C;  3I73 A;  1QNK A;  2D5D A;  1PH6 A;  2CH4 W;  4FXK C;  2ALY B;  4AQY Q;  4LW1 A;  4A3I H;  2QDB A;  1Q8I A;  1Q3L A;  4N9T A;  1KDA A;  3JAM c;  1SAP A;  4A4I A;  1HZC A;  1S4Z A;  1TT2 A;  2ID0 A;  3LGJ A;  3NQI A;  2R7Z H;  4EGV A;  1C0A A;  5I2Y A;  4CDC C;  2Q8R E;  2OQK A;  1UEA B;  1E3P A;  1BOS A;  3VYT A;  4GNX C;  4A3L H;  2F0I A;  1Q46 A;  4DV3 L;  4UY8 C;  5IGE A;  2JXM B;  1AZQ A;  2E2I H;  4H0L C;  2A8V A;  3KDF B;  2WB1 G;  3T56 B;  2Q2I A;  4C3H B;  1F2Z A;  2EYO A;  1XX8 A;  4ILW A;  1G8Z D;  3O13 A;  4BY7 B;  3KUP A;  4DUZ Q;  4WJW A;  2JA9 A;  3JAM i;  5GQO A;  5I9P A;  3F2B A;  4QCL A;  2VB2 X;  2CW0 D;  4IPC A;  5JOB A;  3C1F A;  3UDI A;  4JC0 A;  3HKZ G;  2E2H B;  1Q90 A;  1UE5 A;  1L1O A;  3M3Y B;  2AKW B;  2N55 A;  4YCU A;  3FKI G;  1N9W A;  3I3C A;  4JPB W;  3HOV B;  1N36 L;  5BN5 A;  4IOC A;  1SYF A;  4A3G G;  2OEO A;  4O2D A;  3KF8 A;  3GD7 A;  4OO1 G;  3KBG A;  4WOR A;  3LWU A;  1XWE A;  2ZJP A;  2KQ3 A;  2R6G A;  2DY8 A;  2C9O A;  3U50 C;  5C4Z A;  1RTN A;  2XWJ B;  3PUW A;  4MNO A;  5GAD C;  3PIO A;  1TY0 A;  4X3K A;  4KD4 A;  2IL8 A;  3SGI A;  5C4X H;  4HJA A;  3BZK A;  2R93 B;  4DAY A;  1Q1E A;  5FLX E;  4IPG A;  2BDO A;  2FJ2 A;  3OPO A;  1XPR A;  1I4P A;  2JJQ A;  4J8Q A;  4Z9C B;  2A6H D;  3J81 j;  2JA8 G;  3BG3 A;  3I7F A;  4DXG A;  4GLA C;  3BZC A;  1SNP A;  5IT9 c;  1PH8 A;  2K01 A;  5JVG 3;  5M5Y H;  1X65 A;  1LO5 D;  3CKI B;  3LWE A;  5FOB B;  1VDZ A;  1O7Y A;  1CHQ D;  3WOE A;  4P2C B;  1HUN A;  1PFB A;  4RKL A;  2UXC L;  1LM0 A;  5G3L F;  1JJC B;  1NE3 A;  1NR4 A;  2A68 D;  4L6T B;  4FYD A;  2JA7 H;  5C4J B;  5CV7 A;  2B2U A;  1XMO Q;  2K1B A;  3PSI A;  4DK0 A;  4PG3 A;  1EY5 A;  2NWG A;  1T5E A;  1XNQ L;  5ELF A;  3S1R B;  1TWG H;  1FGU A;  2R61 A;  5CV5 A;  4BBR B;  3IL8 A;  4EVO A;  1VQI A;  2VUM G;  1PTO F;  3HS0 C;  1PH3 A;  4KY5 A;  4HSP A;  5ELD A;  2YTY A;  2OQ0 A;  3DXJ C;  4EQP A;  1LYL A;  3HOY G;  3MXU A;  4IFD I;  2HIX A;  2RCN A;  2TSS A;  4GN4 B;  4BBS H;  1QVG A;  1N34 L;  4A3E H;  4R9W A;  3S1N H;  3GTM B;  2G9D A;  1EYD A;  4OL7 A;  1KQS A;  1IBM L;  3UI2 A;  4JI6 Q;  2VB3 X;  1G51 A;  2O5J C;  3OMC A;  3W1G A;  1KLU D;  3E3X A;  2K32 A;  2A6H C;  3SXH A;  3EFX D;  4HIM A;  4APV A;  1STH A;  3S2D B;  4MHE A;  2QCP X;  3A0J A;  1TWC H;  4R4Q A;  1FJG Q;  5C3E B;  3H0G G;  1F2M A;  2EJM A;  1SBB B;  2X6L A;  3KFU A;  4LJZ C;  3S15 H;  1HNX L;  5CV6 A;  4DV5 Q;  2A68 C;  1QUQ B;  4QF4 A;  4E6I A;  4PZ8 A;  5EBD A;  1E7Z A;  1R4P B;  4KKS A;  5BR8 L;  4MN3 A;  5C3X A;  1X9N A;  1V1P B;  1PDQ A;  2HD3 A;  2KCM A;  3U9S A;  4CJ1 B;  2I0Q A;  2DJF C;  1TKW B;  4FNF A;  3CAM A;  1B44 D;  2Z6B A;  1VCI A;  4KJO A;  4LMQ D;  4A3J B;  1D1K A;  4DNR B;  4DR1 Q;  3PCO B;  2NN6 G;  1H9S A;  4V19 0;  1VQN A;  3GTO H;  3L2P A;  3PIP 3;  3NTI A;  3E9I A;  3E9H A;  4KLK A;  5A2Q L;  2Z6K C;  2NYZ D;  4A75 A;  5COR A;  1IL2 A;  1GUS A;  5I6Y A;  1LT4 D;  1PYB A;  3NK9 A;  3OTO L;  5CV9 A;  4JVZ A;  1GUO A;  3GTP H;  3DM1 A;  2PQA A;  4XT3 B;  1EYG A;  3S2H B;  1LTB D;  1PLF A;  4JCV E;  4UP8 A;  2HCI A;  3CW2 C;  5C44 G;  2JA5 H;  2KED A;  1S5B D;  4LUO A;  3EBE A;  4X65 Q;  3SK6 A;  2F0F A;  4OON A;  4IUQ A;  4HTH A;  2QF7 A;  1OTC A;  4ME3 A;  2Z1C A;  4KD3 A;  5I4D A;  1IKL A;  1HPC A;  3MXN A;  1V8Q A;  4UP9 A;  4DXF A;  1IKM A;  3HKS A;  1KLG D;  2B39 A;  4MTK A;  2LSS A;  2EPB A;  4X64 L;  1GXD C;  1CFM A;  2L5T A;  4XT1 B;  4A3F G;  3QOL A;  4DPG A;  5M9O A;  4DK1 A;  5DLQ E;  4JI4 L;  3D31 A;  3J81 L;  3MEF A;  5IGG A;  1MSG A;  4EQN A;  4LF7 Q;  5FJ8 G;  1I50 B;  4OWT B;  3UE1 A;  1SLJ A;  1I4G A;  3K7U C;  3GTJ H;  2Q8T A;  4OX9 Q;  3CCV A;  1MJC A;  1IBK Q;  5KIX A;  4LUV A;  2MUY A;  4B3M Q;  1D5M C;  2FMC A;  4KV6 A;  3SVM A;  1SR3 A;  2ATW A;  2JA6 B;  2LY7 A;  2DN8 A;  4QB4 A;  4YHH Q;  3I4N B;  1XMQ Q;  3D4D A;  2VQE L;  5D65 A;  1SFO H;  4OEM B;  3FKI H;  1LTL A;  2B2Y C;  2L1B A;  2YU9 B;  3NEL A;  2C5C A;  4RAU C;  1TY2 A;  4PMW A;  1KIX A;  4A3G H;  1E22 A;  1I3Q B;  3TEH B;  4A3M B;  4OO1 H;  3CCS A;  1R4Q B;  5C0X G;  1LTT D;  2K7V A;  2K5D A;  1PRT D;  4JI7 L;  1BBX C;  2KA7 A;  2J7Z A;  3VR3 A;  5HGQ A;  4R4I A;  3BYY B;  4DV4 L;  4A3D H;  3H3V C;  4G7Z C;  4B3T L;  4JI8 L;  4XYQ A;  2EYF A;  4AH6 A;  2UXD L;  2D9U A;  1K73 C;  4Q5V A;  4ZYS A;  4XQN A;  3D4W A;  4DFA A;  3CME A;  2EVB A;  5M5W H;  2H5X A;  2JA8 H;  1J5E L;  1LTG D;  2ZJR A;  1X3Q A;  1TS2 A;  1QOH A;  1UUP A;  4HJ5 A;  1CQV A;  4DV6 L;  1B1Z A;  4C3H G;  3M7G A;  1EY9 A;  5G3L D;  2UXB L;  4A3K B;  2RBM A;  4EQ5 A;  3C2P A;  3P7J A;  2WP8 J;  4BY7 G;  5IYC G;  5M5X H;  1NR2 A;  3LX0 A;  3Q23 A;  1Y1V B;  1WOC A;  1YHA A;  2IHF A;  1ET6 A;  3T1Y L;  2GVB A;  1XNR Q;  1HR0 L;  4DV7 Q;  4S3S A;  2RHS B;  1JB7 A;  2Z9H A;  1SYB A;  2KJX A;  2IPK D;  3HOV G;  4CKB A;  3SR1 A;  2VUM H;  5EPK A;  2MO1 A;  2NVT B;  3TQY A;  2AHO B;  4GZY C;  1PFM A;  1PRT C;  4P73 A;  5M3F B;  4RMF A;  4K2L A;  3HOY H;  2YV5 A;  5HUR A;  4X66 Q;  2UUA Q;  1MGS A;  4NXM Q;  4DR3 Q;  5T1G A;  2HCC A;  2VZA A;  1B7Y B;  1STB A;  2IHE A;  2HQL A;  3EA6 A;  2V1C C;  3RZD B;  4LF6 L;  4RH6 A;  2R92 B;  2K5H A;  1JOO A;  1I6V C;  4B3S L;  2ES2 A;  1E1O A;  3A74 A;  2NVX H;  2R93 G;  2EE1 A;  2NTS A;  4C2M H;  3C1E A;  3HOZ B;  3CQZ H;  1GUN A;  3MTS A;  1XYI A;  2IY5 B;  1EZ8 A;  4DR6 Q;  1F9Q A;  3H0G H;  4OHJ A;  3F2D A;  1GVP A;  1PTO B;  2PI2 A;  4KMU C;  3RN5 A;  2IT1 A;  1AE3 A;  2MO0 A;  1X3G A;  5K36 H;  1CKM A;  4CJ0 B;  2L15 A;  1BF4 A;  5T1I A;  2DGY A;  5LL6 S;  1Z47 A;  4ID6 A;  4DV2 Q;  2AUK A;  2NVQ B;  4K6D A;  3QJY A;  3J81 i;  1C7Y A;  3KLS A;  4QIW E;  4XQQ A;  1EU4 A;  4BBR G;  3LNN A;  4GS3 A;  3JAM E;  4OWW B;  1MSH A;  3GTK H;  3PO3 B;  3OSO A;  1RDP D;  2E2J B;  2WIN B;  1EQR A;  1S5C D;  3PF5 A;  2UUC L;  1QB5 D;  2Q2U A;  1FD7 D;  1SN8 A;  2Q2H A;  1K0S A;  2NUC A;  1SMX A;  2SOB A;  1X54 A;  3J7A F;  4DR4 L;  4R4O A;  3I56 A;  3RLO A;  2PCF B;  3T51 B;  5C44 H;  2E5L Q;  2RVL A;  1O7L A;  5M3M G;  4JI5 L;  1WJJ A;  4YWK A;  5CC4 A;  2IX1 A;  3GTL H;  4IUT A;  3D0F A;  3HOU B;  5C3E G;  1HA5 A;  3DLL A;  1VQC A;  3S14 H;  5JJI A;  1G91 A;  1HNW Q;  5LMN Q;  4DV1 L;  1II3 A;  2QDL A;  3OHX C;  4ULL A;  4JYA L;  2ZXP A;  5IP9 G;  1NCV A;  5JEA G;  4X62 Q;  1GHJ A;  2SDF A;  4PZ7 A;  4RKB A;  3KK7 A;  2PZW A;  4A3F H;  1A2U A;  3TS2 A;  1EY0 A;  1LTA D;  2EOT A;  3A5U A;  1SYG A;  2BA0 A;  1X3F A;  5FJ8 H;  4DR2 L;  3CCJ A;  4A3J G;  1DGS A;  1TII D;  3WOF A;  4K5X A;  4AYB E;  2EY6 A;  2UU9 L;  5FO7 B;  1EYC A;  2EDG A;  4RFB A;  4A3C H;  5C0X J;  1EIY B;  2OT2 A;  2A69 D;  3PIO 3;  3BJU A;  2Z6K A;  5BN4 A;  3T1H L;  1FL0 A;  1V1P A;  1TWA H;  5KYI A;  3P75 A;  1CSQ A;  2X69 A;  2UXC Q;  1WD0 A;  4Y7N B;  2CWA A;  1RJT A;  5IT9 L;  1HJP A;  2LXK A;  2L11 A;  4CKC A;  2ZTC A;  1EWI A;  2JEB I;  4K2K A;  4YY3 L;  1YNN D;  1S3O A;  1SJH D;  5AFW A;  1XJV A;  5C0X H;  2WKD A;  4V0B A;  3FHW A;  1T9H A;  4LUZ A;  5EQ0 A;  3NBH B;  3SK5 A;  5IYB G;  1EEI D;  4U67 3;  3KF6 A;  1W6K A;  1EY8 A;  1MJE A;  1EY6 A;  3PMF A;  2F4V Q;  1TWH B;  2NVY B;  1CT1 D;  5NUC A;  1HNZ L;  3CD6 A;  1HHV A;  3S1Q B;  3M7N A;  1QIL A;  1K83 H;  1JQY D;  3K7A B;  4F88 A;  2F0O A;  1SDF A;  1S72 A;  1JIC A;  1LT3 D;  2F0V A;  3RLF A;  3NTH A;  1NY4 A;  3BU2 A;  3E5S A;  1I6H B;  1IBM Q;  3ND9 A;  4G4K A;  5EKI A;  4HJ9 A;  4C3H H;  4IUN A;  2VQF Q;  1D1I A;  4GKJ Q;  1B9N A;  1SND A;  1Z6H A;  3DHQ A;  4KN4 C;  4BY7 H;  5IYC H;  2A69 C;  2JA6 G;  3CMA A;  2K28 A;  4HED A;  5ELN A;  1KD1 C;  2E8G A;  2F0M A;  2E75 C;  4A93 B;  4J1M A;  3BS1 A;  2E2H H;  3PUX A;  4QIW B;  3I2Z A;  1AEX A;  3M3Y H;  1UAP A;  4BXX G;  2CWP A;  3M9B A;  4N8X 1;  4ZKC B;  2QEX A;  4PV1 C;  3AMU A;  2B2Y A;  2YTV A;  3HOV H;  3HZX A;  1YNN C;  2B63 B;  3C3L A;  4A3M G;  4DN4 M;  5CBA E;  5KND A;  1DM0 B;  1G29 1;  4C3I H;  2LS0 1;  3CPF A;  4LNQ A;  1GO3 E;  4GLV B;  4KTA A;  1GD7 A;  3E0E A;  1SRU A;  3NWS A;  3S9W A;  1Z9F A;  4DF7 A;  3MEH A;  2RDF A;  1QZG A;  1CM9 A;  3TME A;  3KLR A;  3V96 A;  3B6Y A;  2R93 H;  3U4V A;  3JC6 6;  1ASZ A;  5IP7 G;  3RNU A;  3IKJ A;  2F0N A;  4LFA L;  2KHJ A;  2NB0 A;  1GHK A;  4DR7 L;  4WJ4 A;  1TWF H;  4P72 A;  1GJX A;  3NE5 B;  2NZ1 D;  1WFQ A;  3PV0 A;  2SNM A;  4KN7 C;  2QKI C;  3BYT B;  2L12 A;  3OTO Q;  3C46 A;  2MP1 A;  4DGZ A;  2RQX A;  3M4Y A;  1EEF D;  1GUT A;  1K8O A;  4A3K G;  3HOW B;  2F0H A;  2MGS A;  1KDB A;  1Y1V G;  1UE6 A;  1J6Q A;  1PH4 A;  1C8C A;  1U9R A;  1VMC A;  3S17 B;  3CPW A;  3KYH C;  1F2L A;  4LF5 Q;  1SEB D;  1SMY D;  5KNC A;  4DUY Q;  5JJK A;  3S1R H;  2OWO A;  3DWA A;  4BBR H;  1BKB A;  3CF5 A;  2ZXR A;  3M85 A;  3H94 A;  4AYB B;  3CRL C;  4X64 Q;  1TVX A;  1STN A;  1KTK A;  2CW0 C;  5M3F G;  4DR5 Q;  1Y69 U;  3J80 c;  3NSW A;  1P8L A;  3EQL C;  3T4A C;  1W2B A;  4JBK A;  1J8I A;  1A3T A;  3DEP A;  1LUZ A;  4OXP A;  1MI2 A;  1JR0 D;  1HRJ A;  1RTO A;  2GVA A;  2ZXO A;  2R92 G;  1CZW A;  1U5K A;  3SDZ A;  4TQU S;  1STE A;  5JEA J;  4KHV A;  5M3M H;  2HT1 A;  4HID A;  2G9H D;  1WTH A;  4KHP L;  1E2V A;  4IUR A;  3HOZ G;  3S2D H;  3RN2 A;  1NNX A;  5J39 A;  2K04 A;  3TSS A;  5C3E H;  4NMZ A;  2MJ8 A;  2WAC A;  4L63 B;  2NZO A;  3CCU A;  4B3R L;  3J80 i;  1VQO A;  1M90 C;  2KCT A;  5IGD A;  1KAW A;  1K3R A;  1Y1W B;  3AYH B;  2WB1 E;  3L7Z C;  4HMI A;  5IP9 H;  1DON A;  1ILQ A;  5JEA H;  1VF5 C;  3V2T A;  3MWY W;  3VA7 A;  1EFI D;  5ELO A;  4ZQ3 A;  4I7A A;  3HOX B;  4B08 A;  4N8F A;  1AP0 A;  2IX0 A;  1N32 Q;  1K8M A;  1VQH A;  2D62 A;  4DV4 Q;  2FXQ A;  1K3B C;  4H44 C;  2F52 A;  3I8Z A;  4IUP A;  2PW5 A;  3RZO B;  2CQA A;  4B9W A;  4A3J H;  4AQY L;  1JWU D;  4F8M A;  4QL5 A;  4J15 A;  2EXZ A;  3NUC A;  2ZT9 C;  4TVA B;  3PO3 G;  3NQT A;  2RSN A;  2Q2T A;  5IGB A;  1BVS A;  5ELE A;  2K52 A;  1OXX K;  1Z7T A;  1BUV T;  2EY1 A;  2L9H A;  3VYR A;  4IJH A;  1BCP D;  5JVH 3;  5AJ3 Q;  3J7A 5;  1FNU A;  1M4V A;  1XTC D;  5FO8 B;  2JYO A;  2VW9 A;  2ENB A;  3OIP A;  1WYD A;  2X6G A;  3S2H H;  1IYJ B;  5I9O A;  4ZUI A;  1BR9 A;  5A2Q E;  4IOA A;  1EUJ A;  2RCF A;  5H1S E;  1VQM A;  3RD4 A;  2A19 A;  1WCM H;  4ZAI A;  4IPD A;  3HOU G;  3PQI A;  1K28 A;  4C3J H;  3K5O A;  3I70 A;  1EU3 A;  1BNZ A;  2AWO A;  2K4K A;  1FR3 A;  1X56 A;  1L0W A;  3H3V I;  4DAV A;  3QB3 A;  2EYL A;  3QIA A;  3W1B A;  1A3U A;  1BCP B;  2D0O A;  2F0P A;  1Y8O B;  2QGQ A;  1C9O A;  2VNU D;  3RUZ A;  1CK1 A;  3URY A;  5D14 A;  3D6C A;  1B2T A;  2E2D C;  4XXE A;  1RIP A;  1W6J A;  5IOD A;  2I5M X;  1LT6 D;  1RHP A;  5IWA Q;  2O2L D;  2EXD A;  2FFK B;  3D8G A;  4GN5 A;  4JI3 L;  4QGU A;  3ITP A;  1YEZ A;  1MBY A;  1EFW A;  3FEW X;  3A54 A;  2Q8I B;  5JPN C;  3J81 E;  2B2W A;  3Q6S A;  2WAQ E;  1AFP A;  3FDT A;  5FLX c;  5CYU A;  4ZK9 B;  4JI2 Q;  1E24 A;  3SE0 A;  2JA6 H;  1KDC A;  1BCP C;  1D8L A;  1SNO A;  4LFC L;  3H3V H;  4TSS A;  2XGT A;  2PNH A;  4NW2 A;  3OWE B;  2OCE A;  2EIF A;  1N33 Q;  4GKK Q;  1I94 Q;  3IFT A;  3GTQ H;  2MHV A;  4C1N K;  5E4X A;  2YU9 H;  4BXX H;  4OO1 I;  1U0L A;  1B9M A;  1VMP A;  3H15 A;  3S1M B;  3FVQ A;  3S16 B;  1GKH A;  2PZT A;  2C35 B;  1ILP A;  1RF2 D;  1I3Q H;  3VYS A;  1XMO L;  2A5H A;  4PMB A;  1SNM A;  1JT8 A;  2NZH A;  2RDH A;  2F0U A;  3MFY A;  3P1H A;  1F77 A;  2M00 A;  1YHQ A;  4DA2 A;  4YWM A;  3F2C A;  2CHB D;  3H91 A;  1ZYR D;  1CUK A;  2XSC A;  2EJG C;  3KBX A;  1YJN A;  5EKK A;  2F03 A;  4K0K Q;  3GTG B;  3A8I E;  5LMU Q;  1PZJ D;  3K59 A;  2J4X A;  5IP7 H;  5IYD G;  4O1N A;  1HZ9 A;  4LWC A;  4LFB L;  3U4Z A;  3MHB A;  4OEL B;  4CHT B;  1L1O B;  2P5Z X;  4ZRZ A;  1PH9 A;  4K8J A;  1KC8 C;  5C5M A;  1JOK A;  3MAQ A;  3NXW A;  1VQG A;  3KF8 B;  1NTG A;  4RCN A;  1XXG A;  3GTJ B;  4JI6 L;  4HIO A;  4OIK A;  3R2T A;  4PQX A;  1YBY A;  1YNJ D;  3S24 A;  4LF8 L;  4JI5 Q;  1SNQ A;  1Y1V H;  1U4R A;  5CBE E;  1JB3 A;  1TS4 A;  3PO2 B;  3MXG A;  2FMM A;  4A93 G;  1CI3 M;  3OOC A;  4O42 A;  1FJG L;  4DV1 Q;  1LTI D;  4G57 A;  3L3O C;  4JYA Q;  3BVG A;  2N78 A;  3T16 A;  1F9S A;  2LFN A;  3BVZ A;  4DV5 L;  3OIQ A;  1WD1 A;  2B63 G;  1SE4 A;  2NVT H;  2HDL A;  4Y52 H;  5M3F H;  3PF4 A;  1O7I A;  1ZXT A;  1YIT A;  2F3W A;  1HZB A;  4DK6 C;  4LF9 Q;  2EY5 A;  1ZYR C;  3D6W A;  2MPM A;  4HJ7 A;  1PH7 A;  2JSO A;  4A3D B;  3DEO A;  4NXN Q;  4JV5 Q;  2KBN A;  4KHZ A;  2K5N A;  4CDE C;  3RZD H;  2R92 H;  2H1E A;  2AQ1 B;  5FLM G;  2WV6 D;  1V1Q A;  4DR1 L;  1PTO D;  1F9R A;  3KDF A;  1VQF A;  4LF4 Q;  1PZK D;  1W3S A;  4ZCK A;  3HOZ H;  5LL6 X;  1TR5 A;  3I4O A;  4F87 A;  2F0D A;  4XIG S;  4IQZ A;  1YIJ A;  4JK1 C;  1IBL Q;  3M4Q A;  3ULP A;  4IUU A;  3ICE A;  1PTO H;  1G2S A;  1H9K A;  2QIL A;  1DOK A;  1KAB A;  4FVM A;  2Z4I A;  1YNJ C;  3HOW G;  4IZ8 A;  5M5X B;  1JJG A;  2NVQ H;  2VXW A;  1SE2 A;  4CBV A;  2CH4 A;  3FP9 A;  2XWB B;  2A6E D;  1U4M A;  2Z8L A;  1LAB A;  2LMC B;  2NN6 I;  2YYZ A;  3KJO A;  4XYO A;  1S5E D;  1LT5 D;  4P75 A;  1HQR D;  3PO3 H;  2AMC B;  2KHI A;  1ENA A;  2XNA C;  5E4W C;  2WAQ B;  2E2J H;  1CZG A;  4KKU A;  1VQ9 A;  3RR5 A;  4DNI A;  4RA8 A;  1HFN A;  5HY6 A;  1IYU A;  4DAP A;  4BWG B;  3HOY B;  1QZH A;  1XPO A;  2XN9 C;  2WFW A;  2JP1 A;  1VQD A;  4PMC A;  1DZ1 A;  5ELC A;  2K05 A;  3UE0 A;  1IZ6 A;  5CGK A;  2L4N A;  2ICI A;  2PMZ E;  3I55 A;  1E2Z A;  2AUJ D;  1IYV A;  5EPJ A;  5E3F A;  1PTO C;  4HCE A;  4OX9 L;  2NVX B;  3OWF A;  2PW7 A;  3WDN A;  1EQQ A;  2NN6 H;  1P16 A;  1IBK L;  4C2M B;  4P74 A;  4B3M L;  4J6H A;  1VQB A;  2N8N A;  3Q22 A;  3GV3 A;  2KCN A;  4FF1 A;  1FYC A;  3HOU H;  3CQZ B;  4OWX B;  1QE6 A;  5JJZ A;  4DV3 Q;  2XVS A;  4P71 A;  4YHH L;  1DOL A;  1D7Q A;  1XMQ L;  1A2T A;  1Y1W G;  1HR0 W;  2UUB L;  1C48 A;  3R8B A;  3IFD A;  2D2C C;  1VF7 A;  1PA6 A;  3HOX G;  1TS5 A;  2DY7 A;  5C3W A;  5GRO A;  3WWV A;  5E1F A;  4RHR A;  2ZTD A;  2JEA I;  2A6E C;  2E74 C;  3ONA B;  2F3I A;  3AEV A;  3RLN A;  5DEH A;  3K0X A;  2Y0S E;  1PH2 A;  5ELB A;  1VQA A;  3AFP A;  1N36 Q;  4R8I A;  4IUV A;  4R1J A;  2I5H A;  3DWP A;  4L8J A;  3MFG A;  4ODG A;  2XRS D;  1SRO A;  1PMR A;  2PI2 E;  3VDY A;  1VQ8 A;  1SE8 A;  1CTM A;  4MIU A;  4KY6 A;  4R4T A;  3I4M B;  3TP5 A;  2F0S A;  1QVF A;  5KEE A;  1SYE A;  4Y7N H;  1PH1 A;  5C0X I;  3K8A A;  3MZ5 A;  1EIH A;  2B2W C;  5EGT A;  3K5L A;  1QUQ A;  3SHL A;  1Y8P B;  3E6Z X;  3TBI B;  5DM6 3;  4POF A;  5IT9 E;  1X55 A;  5JAV A;  3GP7 A;  5I6W A;  3F1Z A;  1XNR L;  5J22 A;  3S14 B;  1UNS A;  3TP7 A;  4DV7 L;  2IX3 A;  5DM7 3;  4QJF A;  3FMC A;  2NVY H;  4IFD G;  1JWS D;  4MZ9 A;  1JE5 A;  3KOJ A;  3NEM A;  3QO2 A;  4IPH A;  1X3E A;  3X3M A;  3U9O A;  1L0X B;  5EPL A;  2HQE A;  3K0Y A;  5IYD H;  3S1Q H;  3OW2 A;  4A3F B;  1H95 A;  3K7A H;  4PZ6 A;  4JBJ A;  3J80 E;  1EY7 A;  2K75 A;  2KCC A;  4X66 L;  2A73 B;  2UUA L;  1B8A A;  1XNQ Q;  1R9T B;  3DWQ A;  2YTX A;  4TRD A;  3GO5 A;  3J80 L;  1PFN A;  2FIN B;  2PZU A;  4AIM A;  1RCV D;  1JE4 A;  4GN3 B;  4NPS A;  4L5S A;  4A3B B;  2WII B;  4BS9 A;  4XQJ A;  1DD2 A;  3SK4 A;  4C56 C;  1Q12 A;  3NTK A;  3RMH A;  1JC7 A;  3CXC A;  1U4L A;  3PUZ A;  3BDL A;  2MNA A;  4DR6 L;  5IGF A;  1N34 Q;  5JPM C;  1KXL A;  4IO9 A;  3HRZ C;  3G48 A;  3I91 A;  3J7Y W;  1EWC A;  2HHH L;  2K50 A;  1DOM A;  2B63 H;  1X32 A;  1EQV A;  2EY2 A;  2PPB C;  1ML0 D;  2OF1 A;  4ME5 A;  4GNX B;  1X3P A;  4JG2 A;  1WI5 A;  3I72 A;  4DV2 L;  4DK3 C;  2PNR C;  1OXT A;  1CA5 A;  1LTR D;  3I4N G;  2SEB D;  3R3O A;  3M4O B;  3NP8 A;  4H13 C;  4QUC A;  2PMZ B;  1KRS A;  1HNX Q;  3TRE A;  5FLM H;  3UDF A;  4KK7 A;  1WTQ A;  1K0R A;  1WTR A;  1K8A C;  3GQB A;  4BY1 B;  1FNV A;  1DYQ A;  2F0T A;  5BR8 Q;  1VS0 A;  1B3Q A;  2IW3 A;  1AE2 A;  1K83 B;  1QCB D;  1GM5 A;  3CP0 A;  5EBC A;  2B29 A;  1G6P A;  3E0J A;  3AB9 A;  3EJI A;  2BCO A;  2R7F A;  4DV0 L;  4LAA A;  4A3I B;  2BOS A;  1PXU A;  2VL6 A;  3HOW H;  4DNT B;  2E5L L;  2R7Z B;  1JWM D;  3ULL A;  2HDM A;  2ICE C;  3NEN A;  4H7B A;  3S17 H;  2ZTE A;  3FPU B;  3PO2 G;  5J3B A;  3Q24 A;  1NAP A;  4I65 A;  1HNW L;  5LMN L;  2Y0S B;  2F0G A;  5C5L A;  4C1N I;  4EX5 A;  2E2I B;  1GUW A;  1V43 A;  5COY A;  2DNE A;  2OTL A;  1B50 A;  2F0L A;  4GLX A;  1NJI C;  1YJ9 A;  5C4J H;  3TN2 A;  4X62 L;  1EIG A;  2OXP A;  4EQO A;  5GAG C;  3MXP A;  4WJ3 M;  2I07 B;  3T13 A;  2B2V C;  1PRT F;  1VQE A;  5IY0 A;  4WRD A;  4OGQ C;  4C3I B;  3VYU A;  1ONL A;  1TQO A;  1DXM A;  4A3D G;  4FXG C;  2K5V A;  4JI3 Q;  1STG A;  2GN5 A;  2ZM6 L;  1PZI D;  2LKV A;  1EY4 A;  2EYM A;  1D5Z C;  3P20 A;  5F2D A;  5CV4 A;  3ND8 A;  4ALP A;  3L0O A;  1TWF B;  2L55 A;  4LFC Q;  3EIV A;  3ER0 A;  4JI1 L;  4JI4 Q;  3DMU A;  4RGT A;  4JI0 L;  5FLX L;  2OTJ A;  2A1A A;  1WTW A;  2QEJ C;  1C4Q A;  1A63 A;  3GTM H;  2R7D A;  1Y1W H;  2XRQ D;  1ICF B;  5HGT A;  4RGO S;  2EYJ A;  1ESF A;  5C4X B;  3UDX A;  2KVM A;  4OIJ A;  3K58 A;  3W2D A;  3HOX H;  1AZP A;  2F0J A;  2HIV A;  2QA4 A;  4WFN 3;  4JBW A;  4G7O C;  5M5Y B;  1HQM C;  1SNC A;  1PYS B;  2VQE Q;  1U4P A;  2F4V L;  2NBF A;  3D3R A;  3RZO H;  2KUM A;  2AQ2 B;  4JOI A;  1A6X A;  1IW7 D;  3HEJ A;  1B3A A;  3ERO A;  2WAQ G;  5DAU A;  2JA7 B;  1QNU A;  1V1O A;  4LFB Q;  1I4R A;  3M4P A;  1TXY A;  5GAH C;  1VQP A;  1WTO A;  4RWS C;  4JI7 Q;  1QJO A;  3NPP A;  4K14 A;  1SMY C;  4L5Q A;  4NP5 A;  1H9M A;  3HKZ E;  2LXJ A;  4B3T Q;  4JI8 Q;  2KEE A;  1FVI A;  3CU7 A;  1AW7 A;  3VR6 A;  1TWG B;  2RKS A;  1EWH A;  2UXD Q;  4IFD J;  3NBI A;  5LMN W;  4R8N A;  1PHJ A;  2VQF L;  4GKJ L;  3GV6 A;  2DJG C;  4LF8 Q;  3EN2 A;  1HH2 P;  5EJW A;  5M3M B;  1UWV A;  1J5E Q;  1CKN B;  2O5I C;  5CR3 A;  2B2T C;  2RDG A;  4ZKB B;  4KJN A;  2I46 A;  4BBS B;  4FF2 A;  4A3E B;  3S1N B;  2BA1 A;  3VR2 A;  4DV6 Q;  2F0E A;  4IFD H;  1F2Y A;  1YI2 A;  5K36 G;  5IE8 A;  1I4H A;  1UEB A;  2UXB Q;  2MQH A;  3NWT A;  1S5D D;  3IRB A;  4HCS A;  4HSV A;  3KLS X;  4DUZ L;  4HJ8 A;  1Q7Y C;  1OO9 B;  1BQQ T;  1BXT A;  1LLR D;  2F0K A;  2RA4 A;  1CQF A;  4H02 A;  5IYB H;  2CCZ A;  3T1Y Q;  1TWC B;  4HIK A;  1HR0 Q;  1B70 B;  1PH5 A;  1KL9 A;  4UDU C;  3BDO A;  1I4X A;  3A8K E;  4FDB A;  1LV9 A;  3VR5 A;  3S15 B;  1IW7 C;  5CV8 A;  1Q81 C;  3A7A B;  3CHB D; 
#chains in the Genus database with same CATH homology
 2BA0 A;  3AFQ A;  4GOP B;  1X3F A;  1VQ6 A;  5FLM G;  3KF6 B;  3K80 C;  5FJ8 H;  4DR2 L;  3CCJ A;  1V1Q A;  3U50 C;  4DR1 L;  3TRZ A;  1A8V A;  3KDF A;  1DGS A;  4A3J G;  1VQF A;  4LF4 Q;  3PUW A;  4MNO A;  1W3S A;  4KI0 A;  4AYB E;  5GAD C;  3PIO A;  3HOZ H;  1ASY A;  3I4M G;  4X6A H;  2UU9 L;  3I4O A;  1I50 H;  3SGI A;  2D0P A;  4QY7 A;  5C4X H;  4HJA A;  3BZK A;  4LF6 Q;  5C0X J;  4XIG S;  1Q1E A;  1EIY B;  1YIJ A;  1IBL Q;  3S16 H;  3M4Q A;  4IPG A;  3ULP A;  4B3S Q;  3ICE A;  3S1M H;  1XPR A;  2JJQ A;  2Z6K A;  3BJU A;  3T1H L;  3J81 j;  1FL0 A;  2JA8 G;  3I7F A;  1CKO A;  3BZC A;  4GLA C;  1VQL A;  3CCL A;  1TWA H;  5IT9 c;  1PH8 A;  2ZJQ A;  3G71 A;  1CSQ A;  5M5Y H;  2UXC Q;  1X65 A;  4GOP C;  2CWA A;  1HJP A;  2LXK A;  3HOW G;  3A5Z B;  2ZTC A;  1EWI A;  1YVC A;  1JJG A;  2NVQ H;  2UXC L;  2JEB I;  4YY3 L;  1LM0 A;  4LF5 L;  3I4N H;  3FP9 A;  1OXV A;  1S3O A;  4DUY L;  1JJC B;  1XJV A;  3UDG A;  1NE3 A;  3FHW A;  1T9H A;  4LUZ A;  2JA7 H;  3NBH B;  5IYB G;  1XMO Q;  1E1T A;  3GTG H;  2NN6 I;  2YYZ A;  3KF6 A;  3KJO A;  3PSI A;  4R4C A;  1MJE A;  2F4V Q;  2CQO A;  4PG3 A;  4P75 A;  4A3M H;  1BBU A;  3PO3 H;  2AMC B;  2KHI A;  1XNQ L;  4DR5 L;  2E2J H;  1VQ9 A;  3RR5 A;  4DNI A;  1TWG H;  1FGU A;  1HNZ L;  4JBM A;  3CD6 A;  5HY6 A;  3PUV A;  1VQ4 A;  4POG A;  1QZH A;  1XPO A;  3GDE A;  1VQI A;  3M7N A;  2VUM G;  1K83 H;  2WFW A;  3PGZ A;  4MTN A;  1PH3 A;  1VQD A;  1PV4 A;  1S40 A;  1S72 A;  3UE0 A;  1IZ6 A;  2YTY A;  2OQ0 A;  4UPA A;  3RLF A;  2PMZ E;  3I55 A;  1LYL A;  3HOY G;  4A3B G;  1NY4 A;  2KEN A;  3BU2 A;  4IFD I;  1K8G A;  2HIX A;  4A3C G;  1N8R C;  2RCN A;  4OX9 L;  1IBM Q;  2Z0S A;  4GN4 B;  4HJ9 A;  1EQQ A;  2UUC Q;  4BBS H;  4C3H H;  1P16 A;  1QVG A;  1N34 L;  2VQF Q;  4A3E H;  1IBK L;  1OXS C;  4P74 A;  4B3M L;  3PO2 H;  3S1N H;  4GKJ Q;  1VQB A;  3OYY A;  2N8N A;  1KQS A;  1NMF A;  1IBM L;  3HOU H;  4BY7 H;  4JI6 Q;  4OWX B;  5IYC H;  1G51 A;  4DV3 Q;  1RL2 A;  3W1G A;  4P71 A;  3CMA A;  4YHH L;  2UUB Q;  2JA6 G;  4DR4 Q;  1Q1B A;  1D7Q A;  1XMQ L;  5ELN A;  1KD1 C;  2E8G A;  4HIM A;  1UE1 A;  1Y1W G;  1HR0 W;  2E2H H;  3PUX A;  2DUD A;  4APV A;  4A3K H;  2UUB L;  3I2Z A;  3A0J A;  1TWC H;  3M3Y H;  4R4Q A;  4BXX G;  1FJG Q;  2CWP A;  3M9B A;  3H0G G;  2ASB A;  2QEX A;  2YTV A;  1PA6 A;  3HOV H;  3KFU A;  3HOX G;  1N32 L;  3S15 H;  5GRO A;  3WWV A;  1HNX L;  1L1O C;  4DV5 Q;  4A3M G;  2ZTD A;  1YHB A;  2JEA I;  1QUQ B;  2F3I A;  4PZ8 A;  4DAY B;  1E7Z A;  1G29 1;  3AEV A;  5GAE C;  4C3I H;  3CPF A;  3RLN A;  5BR8 L;  4LNQ A;  3K0X A;  1GO3 E;  2Y0S E;  4GLV B;  4BY1 G;  1GD7 A;  3E0E A;  1X9N A;  1SRU A;  1PH2 A;  1VQA A;  3AFP A;  1N36 Q;  1Z9F A;  4R1J A;  3F8T A;  2KCM A;  3K81 C;  2I0Q A;  1QZG A;  4RG1 A;  2I5H A;  1UE7 A;  3Q8D A;  3B6Y A;  3CAM A;  3U4V A;  5AJ3 L;  4GNX A;  3PIP A;  3JC6 6;  2R93 H;  1VCI A;  1ASZ A;  5IP7 G;  3RNU A;  1YZ6 A;  1SRO A;  4DR2 Q;  4LFA L;  2KHJ A;  2PI2 E;  3DM3 A;  4DR1 Q;  3VDY A;  1VQ8 A;  1SE8 A;  4DR7 L;  3PCO B;  1TWF H;  4WJ4 A;  4P72 A;  4R4T A;  4A3I G;  2NN6 G;  3W5O A;  1VQN A;  3GTO H;  3L2P A;  1QVF A;  1WFQ A;  4BA2 I;  3E9I A;  3PV0 A;  4Y7N H;  1PH1 A;  3E9H A;  1Q8K A;  4KLK A;  2UU9 Q;  5C0X I;  1MIU A;  2Z6K C;  3K8A A;  3OTO Q;  2R7Z G;  2MFI A;  4A75 A;  2CKZ B;  1IL2 A;  1EOV A;  1PYB A;  3G6E A;  1I5F A;  2B3G A;  2JE6 I;  3T1H Q;  2BH2 A;  4A3L G;  3OTO L;  1QUQ A;  4A3K G;  3GTP H;  4A76 A;  2PQA A;  4POF A;  2Y0S G;  1X55 A;  1EYG A;  1L2F A;  4UP7 A;  2VY3 A;  5EAY A;  4JCV E;  1Y1V G;  3F1Z A;  4UP8 A;  1UE6 A;  1J6Q A;  3ULJ A;  1PH4 A;  4DV7 L;  1XNR L;  3CW2 C;  5C44 G;  3CCE A;  2JA5 H;  3G4S A;  3CPW A;  3KYH C;  4LUO A;  1VQJ A;  4QJF A;  4YY3 Q;  4LF5 Q;  3EBE A;  4X65 Q;  2NVY H;  4IFD G;  4DUY Q;  4MZ9 A;  5JJK A;  1JE5 A;  3KOJ A;  3NEM A;  4IPH A;  4OON A;  1X3E A;  3S1R H;  2OWO A;  4BBR H;  1X6O A;  1OTC A;  1BKB A;  4ME3 A;  3CF5 A;  2JQO A;  4X65 L;  5IYD H;  3S1Q H;  2N49 A;  3M85 A;  4UP9 A;  3OW2 A;  1H95 A;  3K7A H;  4PZ6 A;  4JBJ A;  4X64 Q;  1YNX A;  3HKS A;  4B3S L;  4IJL A;  5IWA L;  2K75 A;  4X66 L;  2UUA L;  4QQB X;  1B8A A;  1XNQ Q;  4JOI C;  5M3F G;  2LSS A;  4DKA C;  4DR5 Q;  4YCW A;  4X64 L;  3J80 c;  1V9P A;  1P8L A;  1YJW A;  2YTX A;  1W2B A;  4AYB G;  3GO5 A;  4A3F G;  1HNZ Q;  4JBK A;  4DPG A;  2N3S A;  1LUZ A;  2RF4 A;  4OXP A;  3STB D;  3J81 c;  3J7Z C;  5DLQ E;  2GVA A;  4AIM A;  1XTD A;  4JI2 L;  3D31 A;  4JI4 L;  2R92 G;  1U5K A;  1HZA A;  3MEF A;  4GN3 B;  4NPS A;  4L5S A;  4TQU S;  4LF7 Q;  4YCV A;  5FJ8 G;  4OWT B;  4YWL A;  5JEA J;  3UE1 A;  1SLJ A;  1Q12 A;  3K7U C;  3GTJ H;  1N33 L;  4LF7 L;  4GKK L;  5E7N A;  3CXC A;  1I94 L;  4OX9 Q;  3PUZ A;  5M3M H;  2MNA A;  4HID A;  2HT1 A;  4KHP L;  1PVO A;  3CCV A;  1MJC A;  3HFZ B;  3CCQ A;  3HOZ G;  3S2D H;  4DR6 L;  1N34 Q;  1IBK Q;  3RN2 A;  1XPU A;  4LUV A;  4B3M Q;  4L5R C;  2HHH Q;  5C4X G;  5C3E H;  1SR3 A;  2ATW A;  2XTI A;  1KXL A;  4IO9 A;  2NZO A;  3CCU A;  3G48 A;  4B3R L;  3J80 i;  1VQO A;  1M90 C;  2KCT A;  4L5T A;  2HHH L;  4YHH Q;  1KAW A;  1K3R A;  2K50 A;  2B63 H;  3AYH B;  2WB1 E;  1XMQ Q;  1A0I A;  3L7Z C;  5IP9 H;  2VQE L;  1SFO H;  4GNX B;  3FKI H;  1LTL A;  4JG2 A;  3NEL A;  1WI5 A;  3CCR A;  1VQK A;  4DV2 L;  4DK3 C;  1OXT A;  5ELO A;  3KLW A;  4PMW A;  1KIX A;  4A3G H;  1OXU A;  3I4N G;  4NB3 A;  4K0K L;  1E22 A;  3TEH B;  2IX0 A;  3CC2 A;  1N32 Q;  1VQH A;  3CCS A;  2K14 A;  2D62 A;  5C0X G;  1KRS A;  2FXQ A;  4DV4 Q;  1K9M C;  1A62 A;  5LMU L;  1HNX Q;  2JA7 G;  3TRE A;  2F52 A;  4JI7 L;  5FLM H;  3UDF A;  1K0R A;  1K8A C;  5HGQ A;  4R4I A;  1Q86 C;  4A3J H;  4AQY L;  4DV4 L;  4A3D H;  5BR8 Q;  4QL5 A;  4J15 A;  1VS0 A;  4JI8 L;  4B3T L;  2JK8 A;  1AE2 A;  4TVA B;  1GM5 A;  3PO3 G;  1JMC A;  3CP0 A;  3I4M H;  2PQA B;  4AH6 A;  2UXD L;  2Q2T A;  1BVS A;  1EIF A;  2B29 A;  4DV0 Q;  1K73 C;  2R92 H;  2K52 A;  1OXX K;  2CFM A;  1G6P A;  1BBW A;  3CC7 A;  4IJH A;  3CME A;  5AJ3 Q;  3PUY A;  3STB C;  3J7A 5;  2R7F A;  4DV0 L;  5M5W H;  2H5X A;  2JA8 H;  1J5E L;  2VW9 A;  3U58 A;  4LFA Q;  2ZJR A;  2EQS A;  4DR7 Q;  1WYD A;  3CC4 A;  2VL6 A;  3S2H H;  1IYJ B;  3KJP A;  3HOW H;  3MXN B;  4IOA A;  2E5L L;  1EUJ A;  3ULL A;  4HJ5 A;  3NEN A;  5H1S E;  4DV6 L;  4BA1 I;  3S17 H;  2ZTE A;  4BBS G;  1VQM A;  3PO2 G;  2A19 A;  4A3E G;  5J3B A;  1WCM H;  2UXB L;  4IPD A;  3HOU G;  1HNW L;  4EQ5 A;  4BY7 G;  5LMN L;  2WP8 J;  4EX5 A;  5M5X H;  5IYC G;  4C3J H;  1PFS A;  1WOC A;  1V43 A;  1YHA A;  3CCM A;  2IHF A;  2OTL A;  3T1Y L;  4GLX A;  2GVB A;  1NJI C;  1YJ9 A;  1HR0 L;  4DV7 Q;  1XNR Q;  5C4J H;  2BH8 A;  2AWO A;  2K4K A;  4X62 L;  1X56 A;  2RHS B;  5GAG C;  1JJ2 A;  1JB7 A;  1L0W A;  4LF9 L;  3H3V I;  4WJ3 M;  1CSP A;  1KRT A;  3W1B A;  1VQE A;  5IY0 A;  1R9T H;  1CKN A;  2D0O A;  3HOV G;  1TWH H;  1C9O A;  2QGQ A;  4NXN L;  2VUM H;  4JV5 L;  2ZM6 Q;  2VNU D;  1IXR A;  1VQ5 A;  2MO1 A;  4A3D G;  3TQY A;  2AHO B;  1Y14 B;  4XTC S;  1RIP A;  1MKH A;  2K5V A;  4JI3 Q;  2I5M X;  2GN5 A;  4P73 A;  4DAM A;  2ZM6 L;  4RMF A;  5IWA Q;  3HOY H;  4A3B H;  2YV5 A;  4LF4 L;  4X66 Q;  2UUA Q;  1VQ7 A;  4NXM Q;  2EXD A;  4DR3 Q;  2VZA A;  4GN5 A;  1B7Y B;  4JI3 L;  4QGU A;  4JI1 Q;  1NMG A;  4JI0 Q;  2IHE A;  4O0A A;  1YEZ A;  4NXM L;  4DR3 L;  2HQL A;  3L0O A;  2V1C C;  4ALP A;  1EFW A;  4LF6 L;  4LFC Q;  2K5H A;  3EIV A;  1KHI A;  2WAQ E;  3AQQ A;  3ER0 A;  5FLX c;  3TS0 A;  4JI1 L;  1IBL L;  3A74 A;  1E1O A;  2AWN A;  4JI2 Q;  2ES2 A;  2NVX H;  1E24 A;  4JI0 L;  4JI4 Q;  4A3C H;  2JA6 H;  1I6H H;  2OTJ A;  1QVC A;  2R93 G;  1D8L A;  2A1A A;  1M1K C;  4LFC L;  3H3V H;  1A63 A;  4C2M H;  3GTM H;  2R7D A;  2XGT A;  2PNH A;  1Y1W H;  2OCE A;  2EIF A;  1N33 Q;  4GKK Q;  3CQZ H;  1I94 Q;  3ZJY C;  3GTQ H;  1WCM G;  2YU9 H;  4BXX H;  4DR6 Q;  3UDX A;  3H0G H;  4KHP Q;  4OO1 I;  1U0L A;  2IY5 B;  4GOP A;  2RHQ B;  3H15 A;  3F2D A;  1GVP A;  3HOX H;  2PI2 A;  4A93 H;  1GKH A;  3RN5 A;  2IT1 A;  2HIV A;  2C35 B;  2I5L X;  2QA4 A;  4JBW A;  4B3R Q;  1AE3 A;  1I3Q H;  3ERS X;  3M4O H;  2MO0 A;  1X3G A;  1XMO L;  1CKM A;  2L15 A;  1JT8 A;  2NZH A;  1PYS B;  2VQE Q;  2F4V L;  1AH9 A;  2DGY A;  3RZO H;  1Z47 A;  1YHQ A;  4YWM A;  3F2C A;  4BY1 H;  4DV2 Q;  4JOI A;  5JJL A;  1CUK A;  2JA5 G;  1Q82 C;  3J81 i;  1C7Y A;  1YJN A;  4K0K Q;  2WAQ G;  4QIW E;  1NBW A;  4LFB Q;  3M4P A;  1TXY A;  5GAH C;  4BBR G;  1VQP A;  5LMU Q;  2VS1 A;  4GS3 A;  4JI7 Q;  5IP7 H;  5IYD G;  4OWW B;  1PH6 A;  1HZ9 A;  4LWC A;  4L5Q A;  3GTK H;  4LFB L;  2ALY B;  3U4Z A;  4LW1 A;  4AQY Q;  4A3I H;  3HKZ E;  1L1O B;  2LXJ A;  4B3T Q;  4JI8 Q;  1FVI A;  1EQR A;  1PH9 A;  3JAM c;  4A4I A;  3PF5 A;  1HZC A;  2UXD Q;  4IFD J;  1KC8 C;  2ID0 A;  5LMN W;  3LGJ A;  1PHJ A;  2Q2U A;  2UUC L;  2R7Z H;  1C0A A;  2VQF L;  4GKJ L;  1VQG A;  1SN8 A;  2Q2H A;  3KF8 B;  4LF8 Q;  2OQK A;  1NTG A;  1E3P A;  3EN2 A;  1HH2 P;  4GNX C;  4JI6 L;  4A3L H;  4HIO A;  1UWV A;  1Q46 A;  4DV3 L;  1J5E Q;  1CKN B;  4UY8 C;  1SMX A;  4DR4 L;  1X54 A;  1YBY A;  3S24 A;  4LF8 L;  4JI5 Q;  4R4O A;  3I56 A;  2E2I H;  3RLO A;  2A8V A;  1Y1V H;  3KDF B;  2WB1 G;  5C44 H;  2Q2I A;  2E5L Q;  4A93 G;  5M3M G;  4JI5 L;  2BA1 A;  4DV6 Q;  1WJJ A;  1FJG L;  4YWK A;  4DV1 Q;  1YI2 A;  2IX1 A;  5IE8 A;  3GTL H;  3D0F A;  5K36 G;  1UEB A;  4DUZ Q;  2UXB Q;  2JA9 A;  2MQH A;  5C3E G;  3JAM i;  1VQC A;  5GQO A;  3DLL A;  3F2B A;  3S14 H;  4JYA Q;  2N78 A;  1HNW Q;  4IPC A;  5JJI A;  5LMN Q;  3IRB A;  4DV1 L;  4DV5 L;  3UDI A;  4JC0 A;  4DUZ L;  3HKZ G;  4HJ8 A;  1Q7Y C;  2B63 G;  4JYA L;  2NVT H;  2CCZ A;  4H02 A;  5IYB H;  1UE5 A;  5IP9 G;  1L1O A;  3T1Y Q;  4HIK A;  2AKW B;  4YCU A;  3FKI G;  5JEA G;  1N9W A;  1HR0 Q;  1B70 B;  5M3F H;  4Y52 H;  3PF4 A;  4X62 Q;  1PH5 A;  1KL9 A;  1O7I A;  1YIT A;  4PZ7 A;  1HZB A;  4DK6 C;  1N36 L;  4LF9 Q;  4FDB A;  4IOC A;  4A3F H;  4HJ7 A;  1PH7 A;  4A3G G;  4O2D A;  3TS2 A;  4NXN Q;  3GD7 A;  4JV5 Q;  4OO1 G;  2KBN A;  4KHZ A;  3A5U A;  2ZJP A;  1Q81 C;  2K5N A;  3RZD H;  2R6G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...