4X3UA

Crystal structure of chromobox homolog 7 (cbx7) chromodomain with suramin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
FAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Small-Molecule Modulators of Methyl-Lysine Binding for the CBX7 Chromodomain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords Chromobox protein homolog 7
total genus 12
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4x3uA00
2MGSA 1CA6A 1B2TA 2CVRA 2B2UC 2VXWA 4ZAIA 3I90A 3SVMA 1B3AA 3FPUB 5CBEE 2IL8A 3DEPA 1KNAA 2B2VC 2JP1A 4R9WA 1HRJA 1PFBA 4X3SA 2FMMA 2RSNA 4XT1B 5T1IA 4X3TA 1RJTA 1VMPA 2HDMA 4X3UA 1F9SA 1NR4A 5EKIA 5AFWA 1MSHA 2EPBA 1MI2A 1WD1A 1WTRA 1ML0D 1ICWA 1DOKA 1O7YA 4RWSC 5COYA 5CBAE 1WVLA 2Q8RE 2FFKB 1EIHA 2B2TA 2K01A 2K05A 1S4ZA 4U68A 1BF4A 3P7JA 1SDFA 1HUMA 5CMDA 5EPJA 1EL0A 3F2UA 1BNZA 4MN3A 2NYZD 1KNEA 2HCIA 4OIJA 1F9RA 1F2LA 2X69A 1RODA 3MTSA 1HA6A 3R93A 1PDQA 2RVLA 1IKLA 3I3CA 1F9QA 1WTVA 1HFNA 3GV6A 3IFDA 4IUUA 5D14A 4HEDA 1XYIA 1G2TA 3D6WA 1PFNA 2KVMA 3QO2A 2HDLA 5T1GA 4IUTA 3DM1A 1EQTA 3Q6SA 2FHTA 1ILQA 4QUCA 5E4WC 2KOLA 1X3QA 1RHPA 5EQ0A 2MP1A 1DOLA 4OIKA 1AZQA 5EPKA 4O42A 3KBXA 4X3KA 3MWYW 4CJ2C 1WTPA 3H91A 5EPLA 1EOTA 1ZXTA 2H1EA 4R8IA 1BBXC 1X3PA 2B2UA 2B2WA 1J9OA 1IL8A 2X6GA 3IL8A 2KECA 2KEDA 2KEEA 1A15A 1AZPA 1B4OA 1XX8A 2KUMA 2L4NA 4XT3B 1TVXA 5DNFA 2K28A 3UI2A 4XDXA 1G91A 4QUFA 4MHEA 5D65A 3TZDA 2XIWA 2X6LA 1HFGA 1QG7A 2JYOA 2L12A 2MJ8A 3N52A 3GV3A 4HCSA 3I91A 2K04A 5EJWA 2BDNA 2J7ZA 3HP3A 2B2TC 1U4PA 3LWEA 1IKMA 1VMCA 2K1BA 1HUNA 2DY7A 1WTOA 1JE4A 1F9PA 4IUPA 1E0BA 1SAPA 4ZK9B 1EIGA 2L11A 2M2LA 1O80A 3I8ZA 1B50A 1NR2A 2SDFA 2NWGA 1DONA 2FINB 2NZ1D 4RA8A 4CJ0B 2RSOA 1J8IA 1BO0A 1U4MA 1U4RA 1ESRA 2N55A 2N88A 1O7ZA 1M8AA 1Q3LA 2R3ZA 4HSVA 1X32A 1JICA 4LMQD 1NAPA 1DOMA 2K03A 4ZLTF 1NCVA 1LV9A 2MPMA 3DEOA 3TN2A 4RAUC 2D9UA 1WTXA 4DN4M 1WD0A 2B2YC 1G2SA 1CM9A 4CJ1B 2HUGA 1DZ1A 1PLFA 3KUPA 1QNKA 1CA5A 1G6ZA 1MGSA 3FDTA 2L9HA 1U4LA 1MSGA 4IUQA 2FJ2A 2B2YA 2HCCA 2EOTA 2B2WC 1WTQA 2L1BA 4IUVA 1C8CA 4ZKCB 1QE6A 3G7LA 3ONAB 5CORA 1RTOA 1GUWA 1AP0A 5E4XA 1WTWA 2DY8A 1SSOA 5JJZA 1B53A 4NW2A 4HAEA 2Q8TA 1ILPA 2EE1A 2RA4A 2B2VA 1RTNA 1PFMA 4ZKBB 4IURA 4UAIA 1HHVA
chains in the Genus database with same CATH superfamily
3PQIA 2MGSA 4XIGS 3TQYA 4E6IA 1I3QB 1P16A 3NQIA 3FHWA 4WJ4A 2B2VC 5K36G 3S2HH 2CFMA 2V1CC 3MHBA 2R7ZG 4YIJA 1CHQD 4NXMQ 2JQOA 1EEFD 3MAQA 1F9SA 4A75A 3H6MA 1K73C 1WD1A 5C0XI 2E75C 3PGZA 2QILA 4DF7A 4U68A 1PH3A 3I4OA 1SDFA 1C7YA 4JI4Q 3CRKC 1YI2A 1I3QH 1A3VA 3GTPH 3R93A 2F0NA 3S1QH 4F7XA 1N32L 3NTKA 3L9AX 3NTIA 1PFNA 1TR5A 1JCKB 2VQFQ 1JJCB 2KOLA 5CV5A 1RHPA 1VQMA 4KKUA 4X64L 3GTQH 3MC0B 3CQZB 1TWFB 3MWYW 2K5QA 2QDBA 3G6JB 4IN3A 1M90C 1BBXC 3SK6A 3G71A 4JCVE 2F0FA 4B3RQ 2K75A 2KJXA 4JI1L 3K5NA 3Q23A 1EIYB 3HOYG 2UXDQ 1Z7TA 1F2YA 1HFGA 3QG1A 3HS0C 3ICEA 2MJ8A 4A3GB 1SFOB 1EY4A 1XJVA 3VDYA 1BCPC 1VQ5A 4JBWA 4KHPQ 1SNMA 2E8GA 1ENAA 1B50A 1EY5A 1NR2A 2QW7A 2C35B 4AIMA 2KQ3A 4KN7C 2NVYH 5IWAL 5BN5A 2JEAI 2UUAQ 2NTTA 1EUJA 1ESRA 2YTVA 3S15H 3S17B 2XWBB 1SMYD 2OTJA 2WACA 2NUCA 1VQGA 2Z0SA 2EYPA 3A7LA 2CKZB 3R3OA 2EIFA 3KJOA 4DA2A 1Q81C 1WTQA 3CXCA 2K32A 1B1ZA 3G7LA 1Z6HA 4QF4A 1L0YB 1HZ9A 1ILPA 3D31A 4GNXC 2RDFA 2XGTA 4ALPA 1ZYRD 2VXWA 3A5UA 1MJEA 1D1KA 1K9MC 4LUVA 1BCPB 2M00A 4K6LA 4JI1Q 5C4HA 3IFTA 2ATWA 3S2DB 2E74C 4U673 3K5LA 1A3TA 4LNQA 5AFWA 4DK3C 1FJGL 3BYYB 2JE6I 1Q1BA 1A8VA 2I5HA 3OW2A 1K3RA 1LM0A 1QZGA 1HTPA 1T5XD 3MTSA 5J1ZA 3U9SA 5C3WA 3J7A5 1IHZA 3P1HA 3SK5A 2GA4B 4UP9A 3FMCA 1RIPA 2WKDA 1L1OA 3FEWX 1EU4A 4FXDA 2D0PA 2IW3A 4BS9A 4L5QA 4OIKA 5M5XH 1VQ9A 5JJKA 3K0YA 4BA2I 3O13A 2B8FA 2IPKD 1YNJD 4DR7L 1DYQA 2H4OA 1BKBA 1SLJA 1X3PA 2SOBA 2F0HA 2F4VL 1VQJA 2QKIC 2VZAA 1AZPA 3HOXG 4KK7A 1VQLA 5EBCA 3QR8A 4BBSH 1G91A 2PMZB 5FO9B 4IZ8A 4P71A 3HG9A 3F8TA 1E2ZA 2DN8A 3PCOB 1FNVA 3GTGH 2IX0A 4ZQ3A 1NTGA 1A62A 1D6EC 2Q2IA 2B63B 4GKKQ 1SAPA 1YVCA 1OXVA 3J81j 2JA8B 2L11A 4K2LA 3J80i 5TSSA 4C3HB 2WB1B 5JEAH 4Y7NB 4DAYB 1VQIA 2TMPA 1J8IA 1OO9B 4DK0A 3W1BA 4RCNA 1WI5A 1HNWQ 1LACA 2JA9A 4KLKA 4FNFA 4ME3A 1CQFA 1QVFA 5IYCG 5ELDA 4YWMA 1AH9A 1Y1VB 4C2MB 1EOVA 1TWGH 4OXPA 1K83B 2PZWA 1QNKA 1YHQA 5DLQE 4IUVA 1Y1WH 4HJ5A 1KABA 1PH4A 1FR3A 4JI5L 5JJZA 1B53A 1E7ZA 1IL8A 4ZKBB 4RG1A 3NQTA 4H0LC 3L7ZC 2CQAA 1YJ9A 4DAPA 3PUZA 4C3HH 4X3TA 1RJTA 1ZYRC 2MFIA 5IP9H 2NB0A 2O4XA 1FYCA 1NR4A 4BA1I 3J80c 4GKJQ 4A3GG 4UP8A 2IX3A 3HOZH 1ML0D 5IODA 2R7ZB 1X54A 1CI3M 4JI8L 3V05A 2F0DA 3UE1A 3AEVA 3TSSA 4PZ7A 3I73A 4QJFA 5A2QE 2I5MX 5LMUQ 2ZJRA 1A0IA 3E0EA 5EKLA 4XYOA 3K6OA 4KTAA 5KYLA 3DUZA 3IFDA 4S3SA 1F2MA 3S1RB 1N8RC 1FNWA 1EZ6A 1HXYD 1UAPA 1JJGA 4BXXG 2D5DA 2YYZA 3NPPA 2R92B 4QIWB 4IALA 5J3BA 1QVGA 5EKKA 4PMWA 1VQPA 3HOXB 2MO1A 4OGQC 4V0BA 5K5PA 4FF4A 2JA8H 2K7VA 2JEBI 1QNUA 2ZTEA 1I50B 1EQQA 2UUCL 2R93G 3H15A 3SGIA 3MZ5A 3AYHB 3VA7A 3UI2A 1ASYA 1JB7A 4CDDC 3G6EA 3A5ZB 4HIMA 5GADC 1KRSA 5KNDA 3OHXC 1JR0D 4C3HG 3K7AB 4OEMB 2B63H 5IP9G 2Z6KA 4B3SQ 4KY7A 1B70B 3E9IA 4K0KQ 4PG3A 4LF4Q 5DEHA 3S2DH 3BVZA 3RZOH 4XQJA 3I8ZA 5CV4A 3IRBA 1ZKOA 1C48A 2QDLA 2SDFA 2LFNA 4QQBX 5C3EB 4GNXB 4A3FH 5M3FG 1V1QA 2N55A 1SR3A 4LFCL 3GTLB 2AUJD 2NVYB 1LV9A 4DR2Q 5JEAJ 1JOKA 3PO3B 4K8IA 4A3EB 1I4RA 3BZCA 4I65A 2OCEA 2LXKA 3H3VI 3CRLC 1N33L 1NNXA 1ICFB 1I94L 1Q8KA 1WYDA 1WOCA 5I2YA 1SNOA 4DV7L 1NBWA 1Q12A 1V1PB 3OOCA 3GTJB 2IJ0A 5A35A 2KCTA 1DCZA 1AW7A 2Q8TA 2JA6H 4ABNA 1CA6A 1B2TA 1M4VA 4ZAIA 3TP6A 5IE8A 2EYMA 2FMMA 1GHJA 5A2QL 5FLXc 4IFDH 1TWFH 4LF7Q 2VY3A 1HZBA 1MSHA 1MI2A 3ERSX 1Y69U 3WWVA 1W3SA 3VA5A 2EJMA 1DJRD 2B63G 1BNZA 2JA8G 4HIDA 2NVQH 5KRUA 4GN5A 2F0EA 1WCMB 2J4XA 1QWYA 2DNCA 1BCPF 2EQSA 2F0MA 2F0WA 3D6WA 4DUYL 1DXMA 1L2FA 2K50A 2V4DA 4AH6A 4KY6A 4O1NA 3L3OC 4QUCA 2JA5H 2CW0D 3S9WA 5BN4A 1XPUA 2R93B 5J39A 4BY7G 1LT5D 2PZUA 1ZXTA 2A69D 2EY5A 3CMAA 3QB3A 4LW1A 1E2WA 2SEBD 3TDQA 5M3FH 4UPAA 3WOFA 4EQ5A 2R7FA 3F1ZA 3LWUA 1IXRA 4OWTB 1SJED 3CPWA 3KF8A 1S40A 3MEHA 1H9JA 1UWVA 2BDNA 3H0GG 2DGYA 3H94A 1X9NA 5FK9C 2A6ED 1LT6D 2NWGA 3J7ZC 5JVH3 3AFPA 1CSQA 3GD7A 1BO0A 1N32Q 4ZYSA 4H44C 4DV1L 2I0QA 1PRTD 5ELEA 3KLSA 4JW0A 4ID6A 1VCIA 2F52A 4JBJA 4NMZA 3TN2A 5LMNQ 4POGA 1LUZA 3OYYA 2RCFA 4M8AA 4DAMA 3TRZA 1DZ1A 4GS3A 1HCZA 2UUBL 4LWCA 1Q1EA 4WRDA 1X3FA 3DLLA 4A3LG 2FJ2A 3J81L 2IX1A 4HMIA 1Y1VG 4ZKCB 3K81C 3CF5A 3OTOL 3PMFA 2K6AA 1C9OA 2DY8A 4P72A 5JOBA 2B3GA 3NUCA 5C4XH 2EXDA 4HN7A 4GKJL 3RLOA 1B3AA 3FP9A 4DV3Q 4Q0FA 3T1YL 4EX5A 1XNQQ 1CZWA 4JI8Q 1W6JA 3NXWA 4X3UA 1NMGA 3KF6A 3S15B 2FXQA 3ULJA 2VQEL 1PTOF 1R4QB 2XWJB 3NK9A 1PH2A 1ICWA 2E2JH 1WVLA 5CBAE 2Q8RE 2NBFA 1BF4A 4YWLA 4IFDJ 3ND9A 4JG2A 2Z6BA 2E5LL 4C56C 4DK6C 1SNCA 1PH8A 2AMCB 2X69A 4TQUS 1SMXA 3GTPB 1KAAA 1GO3E 5M3FB 4I7ZC 2AWNA 3KLSX 4CDCC 1XTCD 4HEDA 4DV1Q 1IBMQ 2F0KA 3GO5A 3NBIA 5T1GA 1GUTA 2KBNA 2F4IA 2N49A 2ZT9C 2UUCQ 4PQXA 4G57A 3T13A 3I4MG 1JT8A 3MXNA 4RKLA 1QJOA 3S24A 1I4XA 4QIWE 3H3VC 1LT4D 2HHHQ 5JJLA 1D5XC 1D7QA 1CZGA 3I70A 2EJGC 1I6HB 1STBA 1VQDA 1YNXA 1UE6A 5EJWA 3HP3A 4ZUJA 2DNEA 2R61A 1VMCA 1D5ZC 2DY7A 1UE7A 3A74A 1TY2A 1EIGA 2M2LA 1N9WA 3T1HQ 3F2BA 2L15A 1LTID 2A5HA 4RA8A 1HZCA 2E5LQ 4G7OC 1L0XB 1ASZA 3I4LA 2ES2A 3TP8A 4XQNA 2CH4A 1ET9A 4L63B 4POFA 1N33Q 3RUZA 1CM9A 4K14A 1UNSA 1PTOH 3KUPA 4DV7Q 1DGSA 1TXYA 4IUQA 2B2YA 1L1OB 1V1OA 2L1BA 2VS1A 5D3IB 2K4KA 2LKVA 3PO3G 3BJUA 4BY7B 4A3EG 1AP0A 2YU9H 3DMUA 3DXJC 4C1NK 5HGTA 1D5MC 4ZUIA 2VB2X 4KHVA 4ZCKA 2UU9L 1K0RA 5KGUA 4Y7NH 2Z6KC 1CTMA 2F0PA 4K5VA 3HOYB 1OTCA 5C4JB 1T5EA 1YNND 3NP8A 5FO8B 5IP7G 2E2JB 4P73A 4Z9CB 5C44H 1SJHD 4UY8C 3P7JA 2K5HA 3CMEA 4JI6Q 4YCUA 3T1HL 3CCMA 1EYCA 1F2LA 1F9RA 1SEBD 3CHBD 2ZM6L 3HKZE 2SNSA 2ZXRA 1IKLA 3DWPA 2EYOA 5I6WA 4JI0L 4F87A 5IOCA 2UXCQ 2HDLA 1JWMD 4QMGA 3I4MB 3GTKH 1HNZQ 3NELA 2NVTH 3CC7A 2IHEA 2EY6A 2XN9C 4FP5D 1DOLA 3HGBA 3CPFA 3OMGA 3S1NB 1VQFA 4WFN3 3M4OB 3D4DA 1TQOA 4A3JG 4LUOA 5JEAG 2WFWA 4HMJA 2A69C 1GKHA 1Y8NB 2KEDA 5ELBA 5E3FA 2O5IC 3HOVB 2AHOB 4A3EH 2O2LD 1UE1A 3ZJYC 2F0GA 1BDOA 1QB5D 3P20A 4C3IB 4B3TL 1ZEQX 5HGQA 1JE5A 1EYDA 5NUCA 4DXGA 1WTOA 1F9PA 1TY0A 1IBLL 3RLFA 1R9TH 3K0XA 3HOUG 4CJ0B 1IBKQ 2VL6A 3BU2A 1DOMA 2UUBQ 3EIVA 3V2TA 5HURA 1I5FA 2LY7A 1A2UA 1G2SA 3HOXH 2UXCL 1IL2A 4N9PA 1EYGA 1I50H 2BA0A 2RF4A 1GUWA 1L0WA 1B9NA 5CV9A 3SHLA 4RCOA 1RTNA 2ZTCA 1D1IA 3BZKA 5EAYA 1JB3A 2CVRA 3PIPA 2EVBA 3WOEA 4C1NI 3TZUA 4DAYA 4JI5Q 4R9WA 1KNAA 3QIAA 2F0TA 2RSNA 3E5SA 4X66L 4FDBA 2E2HB 1SYBA 2CWPA 1SXTA 3R8BA 5IGFA 3CU7A 2NZOA 3R2IA 2ENBA 3Q22A 2XNAC 3S1MB 1A2TA 4GLVB 1EIHA 2B2TA 2EY2A 4A3DH 3A55A 1YNNC 4LK1C 3PUWA 3E9HA 1I6HH 4LF5Q 4RGTA 3ULPA 2R93H 4BBSB 2WB1G 3HOUH 3NWTA 5IGCA 2CCZA 1B44D 4A3KH 1GD7A 4A3MH 3T53B 2D0OA 3S1MH 4A3JB 1IYVA 4RKBA 3ULLA 1PH7A 3M4PA 3E0JA 2JK8A 3HOVG 2E2DC 1GUSA 5C4XG 3TS2A 1J5EQ 4NDXA 4DR6L 1JORA 1J9OA 2MQHA 4EQPA 1SYCA 4NP5A 4KD3A 4AYBG 2A8VA 3UDIA 1PTOB 1UE5A 5D3DA 4C3JB 1Z9FA 3T4AC 2UXBL 4J15A 4MHEA 4LF7L 3HKSA 2O5JC 4OL7A 5LL6S 3EQLC 3MXPA 3OPOA 4HR7B 3MA2B 3NTHA 3HOUB 1IKMA 1JC7A 1I4PA 4H02A 2E76C 3VYRA 5C4JH 1STAA 4A3IG 1G8ZD 1QZHA 1R9TB 1VQBA 3C46A 1ET6A 4BXXH 2Z1CA 4DV5Q 4DR4L 4GLAC 4C3JH 1CKNA 1EU3A 1FNUA 1QILA 4YHHL 4LF5L 1U4RA 1GUNA 4LMQD 1LYLA 2PYKA 3RN5A 3J7AF 3LGJA 4KHZA 4A3KG 2PMZE 4DV0L 4FYDA 4UP7A 1WD0A 1RD9D 1HNXQ 2G9HD 2LXJA 5IGGA 2L9HA 2OQ0A 1MSGA 3U4ZA 2EOTA 4JI3Q 2A74C 2A6EC 2R92G 3IAYA 3R2TA 1CSPA 2UU9Q 4DR1L 2DUDA 2EE1A 1NJIC 1I94Q 1HHVA 1SYFA 5C5MA 2B2UC 4LF8L 2E2HH 3PUVA 3NENA 3ND8A 1KHIA 2A68C 4XT1B 3KF8B 5JJIA 2XTIA 5G3LF 3S1NH 4K8JA 3AU7A 5EKIA 2DJFC 3DM3A 5M5YH 1N34L 4R4IA 2EPBA 5GAGC 1HQRD 1RKNA 4KN4C 4RWSC 1K83H 3VYTA 5C6AA 1SFOH 1PTOC 1P8LA 3SDZA 1XNRL 1QUQA 1SE2A 4DFAA 5I2XA 1EL0A 2OT2A 4DV6Q 4QB4A 3S1QB 2ZJPA 2AQ3B 5IGEA 4DV5L 4DR4Q 2ID0A 2UUAL 4IUUA 2OQKA 5FOBB 1XYIA 4F88A 3GQBA 2F0LA 3CAMA 5AJ3L 1T9HA 4GOPA 3EA6A 3RD4A 1TS4A 1ILQA 4HTHA 3X3NA 1X3QA 3H0GH 5C4XB 2Q2TA 4JOIA 4OO1I 4DUYQ 3GTGB 1XTDA 4AYBB 4JK1C 1PFSA 1BUVT 1HR0W 4LF9Q 5FJ8H 2PZTA 3JAMi 2R92H 2KECA 1D2BA 1XX8A 2L4NA 3HEJA 1PH1A 3TMEA 2NN6G 2K28A 2RDGA 4WJWA 3M85A 2XIWA 5HY6A 4GN3B 5IP7H 3T51B 4DK1A 3RN2A 1MHWC 4LFAQ 2OTLA 2WB1E 1LTTD 4A3LH 5EBDA 5BN3A 1XMQQ 5IYBH 4JV5L 2EYLA 4C3IG 2JXMB 4GN4B 4A4IA 1KD1C 2WAQG 2NVXH 5JVG3 2A19A 2JA7G 4DR3Q 5I9OA 3HKZG 2KHJA 3HOVH 1O7ZA 1M8AA 2PNRC 2ALYB 1WCMG 2F0UA 2K03A 3DEOA 1PZJD 1I4QA 1TWAB 3CCVA 2A73B 2EY1A 4QCLA 5I6YA 5AJ3Q 2F0VA 2Q8IB 5LMNL 2C5CA 4EQOA 2QEXA 2ZJQA 3D3RA 1S5FD 1NE3A 4QGUA 4X66Q 2QEJC 4FF3A 3MEFA 2LMCB 4RMFA 4NXML 3E3XA 1A3UA 3WDNA 3A8JE 2LS01 1RL2A 3BVMA 5M9OA 1VMPA 2XSCA 1Z47A 5L37A 1QVCA 1RF2D 4RGMA 1E22A 1QOHA 4DGZA 2K5VA 1C4QA 2EYFA 5KIXA 1X65A 3A54A 3H0GB 3U58A 4LFAL 1FGUA 1QCBD 2K01A 1JMCA 1EEID 5CGKA 2NYZD 4DV2Q 2HCIA 1RODA 1LTAD 1EY0A 4LJZC 3K59A 2BH2A 2YU9B 1E2VA 3S2HB 1UEAB 2OXPA 1EQTA 5EGTA 4A3KB 3PIO3 3M7NA 2OEOA 3GDEA 4CBVA 4X65L 4GOPB 4JI2L 3K58A 4B3RL 4FF1A 1RCVD 4R8IA 2F03A 5M3MH 5IY0A 2RDHA 3MVVA 5C5LA 2K52A 4FO2A 2QA4A 3EJIA 4A76A 5CC4A 1VQOA 2RQXA 4B3SL 1S5CD 1R4PB 1ESFA 1QG7A 1QUQB 4HCSA 3M9BA 3I91A 3HZXA 5I4DA 2P5ZX 4A3DG 1YHAA 4UDUC 3CCUA 3AB9A 1TS2A 2WKCA 1PH6A 3DWAA 1E0BA 1EWIA 1PRTB 4TSSA 4ZK9B 4HJ7A 2NVXB 1Q90A 2JN4A 2BOSA 3I56A 4DR2L 3NEMA 4R1JA 1Y8PB 2MO0A 1MKHA 4CGYB 5FO7B 4DV0Q 4GLXA 4JI0Q 2R3ZA 3TEHB 1XMOL 1L1OC 1CKMA 4RAUC 2WIIB 3KBGA 1FL0A 5FJ8G 1WTXA 2OWOA 1X55A 3FKIB 3A7AB 1U0LA 1KDAA 2HUGA 1TWCB 5JPMC 1IYUA 4IPDA 3PO2B 1KXLA 2AKWB 3MFGA 2B2WC 2L55A 2RHSB 1HH2P 1VDZA 1IYJB 3PV0A 3CW2C 4JI2Q 3OWEB 1YITA 3X3MA 4A3JH 4C3IH 4XXEA 3I4NB 5I9PA 4A93G 2JP1A 1FJGQ 1HRJA 3RZDB 4BY7H 2QGQA 4K2KA 2VUMH 2A68D 4P75A 3J81E 4NKLA 1O7YA 4CKBA 5CV8A 2K05A 3K7UC 3F2UA 4FF2A 4O2DA 2JA7B 4DV4Q 2GVAA 4TRDA 2PNHA 1UEBA 3HKZB 1K8MA 3STBC 4IPHA 4HIOA 5CYUA 1EY7A 4LUZA 4LFCQ 3G4SA 3Q6SA 2VNUD 1G6PA 2PI2A 5ISRA 1CHPD 4KKTA 1STNA 3TREA 4A3CH 3KBXA 4LF6L 1YBYA 1TS5A 2IY5B 4HIKA 3S1RH 3AQQA 1EYAA 1XPRA 2BE5C 2F3VA 3SK8A 1TWHB 1B4OA 1TKWB 1TVXA 1NSNS 1TWGB 3FRPB 3E6ZX 4IUNA 4JBMA 3Q24A 3J7YW 3NBHA 3GTMH 3FPPA 1ENCA 1HUNA 3GP7A 1XXGA 1BVSA 4JI4L 4CKCA 4DNRB 2Z4IA 2K33A 4ZRZA 3C1EA 4RFBA 2ICEC 3PSIA 3J80L 4DU9A 5FLMH 1LTRD 3ERQA 1Y14B 1U4MA 2B8GA 3K7AH 1IBML 3HFZB 4ZLTF 1NAPA 3CCRA 2AUKA 3PO2G 1TU2B 1V8QA 3MXNB 4JOIC 4L5TA 2VUMG 3RLNA 2PW5A 1CK1A 4O0AA 3OTOQ 2K5WA 4X62L 1G51A 1STGA 2HT1A 1VQCA 3PUXA 4ULLA 3GTJH 1PHJA 2KCMA 2K5NA 5IT9L 2EXZA 3M4OH 3EVQA 4A93B 4J8QA 3S14H 4AQYQ 1VQHA 2F1MA 2UXBQ 4NXNL 5IYDH 1LT3D 1EIFA 3N6RA 4CDFC 1PMRA 3SVMA 3M3YH 3DEPA 4JBKA 1GUOA 3OSOA 3JAMc 4X3SA 4BY1G 1EY6A 2C9OA 3G48A 4DUZL 1JWSD 4GZYC 1M1KC 2Y0SB 3J81i 5IYBG 4DV2L 3MFYA 2JA6B 5M3MB 4A3CG 2E2IH 3CCEA 1YNJC 2I5LX 3NSWA 1KC8C 4DXFA 1HUMA 2VW9A 2RBMA 1HPCA 1EWHA 2HIXA 3EN2A 2MHVA 1TS3A 3K80C 5D14A 2CW0C 3QO2A 1HA5A 3RZOB 1BBWA 5E4WC 4OWXB 3FKIG 3M4YA 4YWKA 3HOZB 4CDEC 5EQ0A 1Q7YC 1KDCA 1HR0L 3QOLA 4A3IH 4EVOA 1PTOD 4X62Q 4K5WA 4KJOA 3KFUA 1KLUD 3L0OA 4IOAA 4MNOA 5J22A 2B2WA 2VB3X 3KLRA 1HZAA 5IYCH 4X64Q 2SNMA 2X6GA 3IL8A 4IOCA 3JC66 2KUMA 1A63A 1VQAA 1NUCA 2CWAA 3NBHB 4XDXA 1PXUA 1PYSB 3TZDA 4LF4L 4IFDI 3I4NG 3T1YQ 1XNQL 1JOQA 4YY3L 5IIFA 1XNRQ 1JE4A 1YHBA 3F2DA 4YCVA 1Y1VH 1EY8A 1O80A 1E3PA 4DV6L 3IKJA 4A3DB 1DONA 2NZ1D 2YV5A 5C3XA 5IT9c 2DJGC 2RSOA 5IGDA 4KHPL 3CP0A 2KENA 4BBSG 1X32A 1JICA 4A3GH 2D2CC 3VR6A 2F0OA 5KEEA 1F77A 3A0JA 1MD2D 2YTXA 4JYAQ 3CKIB 3M3YB 1H9MA 1W2BA 1PLFA 1PH5A 3DWQA 1CA5A 1X6OA 2JA5G 4LFBQ 2B29A 4JI7L 3K5MA 1TWCH 2J0TD 1BXTA 1Q8IA 4Y52H 1QE6A 3W3AA 3U50C 1RTOA 2F4VQ 4NW2A 1FD7D 1WTHA 1VF7A 4Q5VA 1S5ED 4XTCS 2IL8A 1YIJA 2EYHA 4C3JG 1JQYD 2A1AA 4LF8Q 3GTQB 4ME5A 1STHA 1WTRA 5COYA 3MXUA 1Y1WG 5GROA 3PO3H 1X3EA 4PV1C 2NN6I 3W1GA 1HTLD 4A3IB 1PH9A 4TKOB 4BBRH 2M9VA 1MBYA 4RHSA 4BWGB 1S72A 3UDFA 1HNZL 4MZ9A 4GOPC 4ODGA 1F9QA 3SE0A 2IT1A 2F3IA 2ZTDA 1SE4A 4P2CB 1HJPA 4OO1G 5E7NA 4DR5Q 5IT9E 3GTOH 1MJCA 2GVBA 4H13C 2IHFA 1O78A 4LFBL 4DAVA 1RDPD 1SYGA 1BQQT 1II3A 4CJ2C 3H91A 2H1EA 3HRZC 1IW7D 4OONA 1MIUA 2B2UA 3D6CA 4IQZA 4OX9Q 2PI2E 3OWFA 1EY9A 3U9OA 2KEEA 4PNYA 1A15A 2PPBC 3UDXA 4XT3B 5CV6A 5DNFA 2F0IA 2NVQB 4HSPA 2HD3A 4QUFA 5D65A 2GN5A 3PF4A 3J80E 1PYBA 1KTKA 3GV3A 1EQRA 4KV6A 2Q2HA 5JPNC 2QCPX 2RKSA 3UE0A 3BG3A 1IBKL 2BDOA 1STEA 5LMUL 3QOJA 4J6HA 4HCEA 2OF1A 2E2IB 3ZYYX 5KNCA 3JAME 2N88A 3FVQA 4HSVA 4EGVA 1C0AA 3M7GA 4X6AH 1K0SA 2I07B 3B6YA 3C1FA 1SYDA 1K8OA 4L8JA 3VR5A 2D9UA 2B2YC 3CCSA 4IO9A 2A6HD 1SBBB 2F0SA 3KDFB 4CKEA 3CCLA 4RGNA 1N36L 1PZID 1KLGD 5FLXE 4AQYL 2NVTB 1O7IA 2VUMB 1SNQA 2KHSA 4DR7Q 4DV3L 1E1OA 3OIPA 1B9MA 2MUYA 5H1SE 1PFMA 1B8AA 3CCQA 2B39A 1YZ6A 4XQQA 3I90A 4C2MH 3FPUB 2PW7A 1LTSD 1SMYC 3CC4A 4MTKA 3S14B 4KI0A 1VQNA 2Z8LA 3VR2A 2H5XA 2CHBD 3NE5B 3BYTB 4MIUA 1CQVA 3AMUA 1H95A 1S4ZA 1V1PA 2Y0SG 3K5OA 2VQEQ 2ASBA 4MN3A 1PZKD 1KNEA 2EYJA 4YHHQ 2JA6G 4NPSA 4OIJA 5M3MG 3PO2H 1XMOQ 2WAQB 1PDQA 1OXSC 3GTMB 3PF5A 3I3CA 1JWUD 3GV6A 1H9RA 3GTKB 1HNWL 2Z4HA 1AEXA 1I4HA 1VQ6A 3EFXD 2G5DA 4G4KA 3Q8DA 1GOZA 2MP1A 5M5YB 2JSOA 4GNXA 2BCOA 2BE5D 3VR3A 5EPLA 5IYDG 1X3GA 1B7YB 3HOZG 4TVAB 5FLXL 3A8KE 4X65Q 1GUGA 3P75A 3RR5A 2JJQA 4OHJA 1JJ2A 1SE8A 1GVPA 3S16H 3CC2A 4WJ3M 2X6LA 3MXGA 5C4ZA 3DHQA 3SR1A 3VR4A 2B2TC 1H9KA 5DM73 1K8GA 3V96A 3W5OA 4FXKC 1BR9A 3QJYA 4K5XA 1E24A 2FINB 3I72A 1Y1WB 5C44B 4DV4L 2WAQE 3HOWG 2L5TA 1SYEA 3CCJA 5ELNA 1YJNA 1Q82C 4A93H 4A3BH 2ZXPA 2ZXOA 5GQOA 2Y0SE 4JI7Q 4CJ1B 3S17H 1GHKA 4PZ8A 1BBUA 3NWSA 3PIP3 1B3QA 1Q86C 4KMUC 3ONAB 4PMBA 3UDGA 3J7AV 3RNUA 5E4XA 1WTWA 1SSOA 4J1MA 1F2ZA 3GTLH 3I7FA 1E1TA 2RA4A 1LTBD 5IGBA 2MNAA 2HQEA 3ITPA 3OW7A 4L5RC 1A6XA 4EQNA 5CBEE 1N34Q 2NTSA 3BS1A 5T1IA 1I4GA 1U5KA 2EDGA 2F0JA 2PO4A 4YCWA 4HJ8A 1XMQL 2EZVA 4JV5Q 3SEBA 4G7ZC 1DOKA 3KF6B 2FFKB 3PIOA 4DR3L 5EPJA 1STYA 1KQSA 5KNBA 3M4QA 1I6VC 1ENFA 2KHIA 4K6DA 3RMHA 1WTVA 1HFNA 3HOWH 5GAEC 4JI6L 4PZ6A 4IJHA 4F8MA 2D62A 1VQ4A 4N8X1 1LTLA 2FHTA 1D8LA 1S5BD 2XRQD 1AE3A 4RH6A 2JA7H 4A3BG 1HNXL 4DNTB 5LMNW 1AE2A 2WINB 4JVZA 1O7LA 5C3EH 4A3FB 5JAVA 1LO5D 4R8NA 1XWEA 1VQ7A 4UHVA 4WORA 5FLMG 3T56B 4L6TB 4DR1Q 2K14A 4H7BA 1VQ8A 3KOJA 2Q2UA 1KL9A 1DM0B 4DUZQ 5CR3A 4OELB 3CQZH 3AFQA 2K04A 2HIVA 3EROA 5C44G 4IFDG 2KA7A 3H09A 4A3MG 1X56A 4JPBW 1TT2A 1J6QA 4G7HC 4PMCA 3TP7A 2R7DA 2NZHA 4XYQA 1K3BC 1V9PA 1N36Q 2I46A 2MPMA 1SRUA 1KRTA 3ER0A 3URYA 3D4RA 3C3LA 4V190 1NMFA 1MGSA 2A6HC 1YEZA 4N9TA 2CQOA 2L0CA 1VQEA 5ELCA 4AYBE 4B3MQ 3FKIH 2HHHL 1UUPA 3NHHA 1VF5C 3KJPA 2PQAB 1S3OA 1S5DD 4HAEA 1SNDA 1LLRD 4IURA 1Q46A 5E1FA 1TWHH 1WCMH 3H3VH 3LX0A 2Z9HA 3STBD 2LSSA 1AN8A 3QWNA 4YY3Q 1ONLA 1IZ6A 4KKSA 4NXNQ 1NY4A 4DPGA 5LL6X 1KDBA 3K8AA 5C3EG 1XPOA 1W6KA 4GKKL 5CMDA 3F2CA 3VYSA 3JAML 4ILWA 3VYUA 4HJAA 2RVLA 1CFMA 1PV4A 3TS0A 1G2TA 3J81c 3DM1A 3I4NH 5FKAC 1DD2A 1WFQA 2WP8J 4LAAA 2PCFB 5M5WB 1J5EL 1IW7C 4DR6Q 4OWWB 4KY5A 1CKOA 1SNPA 4IJLA 2VQFL 4BY1H 4X3KA 2XVSA 1PYWD 1K28A 2FMCA 4B3ML 3OMCA 5BR8Q 1LABA 1HR0Q 5C0XG 3BZDB 2N78A 2G9DA 4A3MB 1Y8OB 2L12A 3N52A 1H9SA 3K57A 4BY1B 1U4PA 1GXDC 2UXDL 2K1BA 1WJJA 1EQVA 5DAUA 4BBRB 4DNIA 3BDLA 1BCPD 1PRTF 3W2DA 2ZM6Q 5ELFA 2R7ZH 3PUYA 1SROA 3KYHC 5M5WH 1G291 1SN8A 1Q3LA 1NCVA 1TWAH 5GAHC 4R4CA 4DR5L 5IWAQ 2TSSA 2HQLA 4JI3L 3HOWB 2AQ1B 1G6ZA 3FDTA 3BDOA 1PVOA 4JYAL 4OO1H 1CKNB 3KDFA 2HCCA 1K8AC 3A56A 1OXTA 3BVGA 3KLWA 2N8NA 3I4MH 4CHTB 4A3FG 2CH4W 1OXXK 2AWOA 4UAIA 4B08A 1V43A 5BR8L 1PRTC 1FVIA 1PFBA 2NN6H 2YTYA 4QY7A 2HDMA 3TBIB 5F2DA 3Q0AA 4N8FA 1JOOA 3A8IE 1TIID 1IBLQ 3D0FA 1CUKA 3D4WA 2BA1A 2KCNA 4K0KL 2K5DA 4MTNA 2AQ2B 3S16B 4R4TA 4I7AA 1HA6A 1KAWA 1EWCA 3I55A 3GTOB 4RHRA 1EZ8A 2RHQB 1YJWA 2KVMA 4IUTA 3SXHA 3LNNA 4JC0A 4LF6Q 5ELOA 4RGOS 1EFID 3U4VA 1BOSA 4QL5A 4LF9L 4KD4A 5EPKA 1AZQA 1VQKA 4O42A 2JA5B 4FVMA 5DM63 1EFWA 1WTPA 4P74A 1GJXA 1CT1D 1EOTA 3RZDH 4R4OA 4A3BB 1KIXA 4DKAC 2QF7A 1GM5A 5K36H 4NB3A 2EJFC 4HJ9A 3OIQA 4OX9L 4BBRG 3C2PA 2JYOA 1AFPA 3BDCA 2F3WA 2RCNA 4FXGC 3SK4A 2J7ZA 1FGBD 2R6GA 3LWEA 1LTGD 3I2ZA 2PQAA 4IUPA 2XRSD 1OXUA 1H9SB 1VS0A 4B3TQ 3TP5A 3T16A 4IPCA 2F0QA 5M5XB 4KJNA 5C0XJ 3KK7A 2IWHA 1PA6A 2BH8A 1SE3A 3HOYH 5CV7A 3D8GA 4DN4M 5G3LD 5KYIA 5C0XH 1U4LA 4B9WA 4M1UB 2N3SA 4IPGA 1C8CA 2ICIA 4APVA 2KCCA 5LHY1 4R4QA 5CORA 2PQEA 1U9RA 3CD6A 3L2PA 3EBEA 2B2VA 2WV6D 1HQMC 4L5SA 4B9XA
chains in the Genus database with same CATH topology
2MGSA 4XIGS 4E6IA 1I3QB 3NQIA 2B2VC 5K36G 3MHBA 4YIJA 1CHQD 1EEFD 3MAQA 1F9SA 3H6MA 1WD1A 5C0XI 2E75C 2QILA 4DF7A 4U68A 1SDFA 3CRKC 1A3VA 3R93A 2F0NA 4F7XA 3NTKA 3L9AX 3NTIA 1PFNA 1TR5A 1JCKB 2KOLA 5CV5A 1RHPA 4KKUA 3MC0B 3CQZB 1TWFB 3MWYW 2K5QA 2QDBA 3G6JB 4IN3A 1BBXC 3SK6A 2F0FA 2KJXA 3K5NA 3Q23A 1Z7TA 1F2YA 1HFGA 3QG1A 3HS0C 2MJ8A 4A3GB 1SFOB 1EY4A 1BCPC 4JBWA 1SNMA 1ENAA 1B50A 1EY5A 1NR2A 2KQ3A 4KN7C 5BN5A 2JEAI 2NTTA 1ESRA 3S17B 2XWBB 1SMYD 2WACA 2NUCA 2EYPA 3A7LA 3R3OA 4DA2A 1WTQA 2K32A 1B1ZA 3G7LA 1Z6HA 4QF4A 1L0YB 1ILPA 3D31A 2RDFA 1ZYRD 2VXWA 1D1KA 1BCPB 2M00A 4K6LA 5C4HA 3IFTA 3S2DB 2E74C 4U673 3K5LA 1A3TA 5AFWA 3BYYB 2JE6I 1Q1BA 1HTPA 1T5XD 3MTSA 5J1ZA 3U9SA 5C3WA 1IHZA 3P1HA 3SK5A 2GA4B 3FMCA 2WKDA 3FEWX 1EU4A 4FXDA 2IW3A 4BS9A 4OIKA 3K0YA 4BA2I 3O13A 2B8FA 2IPKD 1YNJD 1DYQA 2H4OA 1X3PA 2SOBA 2F0HA 2QKIC 1AZPA 4KK7A 5EBCA 1G91A 2PMZB 5FO9B 4IZ8A 3HG9A 1E2ZA 2DN8A 1FNVA 2IX0A 4ZQ3A 1D6EC 2B63B 1SAPA 1OXVA 2JA8B 2L11A 4K2LA 5TSSA 4C3HB 2WB1B 5JEAH 4Y7NB 2TMPA 1J8IA 1OO9B 4DK0A 4RCNA 1LACA 4FNFA 1CQFA 5ELDA 1Y1VB 4C2MB 1K83B 2PZWA 1QNKA 4IUVA 1KABA 1FR3A 5JJZA 1B53A 1IL8A 4ZKBB 3NQTA 4H0LC 3L7ZC 2CQAA 4DAPA 3PUZA 4X3TA 1RJTA 1ZYRC 2NB0A 2O4XA 1FYCA 1NR4A 4BA1I 2IX3A 1ML0D 5IODA 2R7ZB 1CI3M 3V05A 2F0DA 3TSSA 3I73A 5A2QE 5EKLA 4XYOA 3K6OA 4KTAA 5KYLA 3DUZA 3IFDA 4S3SA 1F2MA 3S1RB 1FNWA 1EZ6A 1HXYD 1UAPA 2D5DA 2YYZA 3NPPA 2R92B 4QIWB 4IALA 5EKKA 4PMWA 3HOXB 4V0BA 4OGQC 5K5PA 4FF4A 2K7VA 2JEBI 1QNUA 1I50B 3MZ5A 3VA7A 3UI2A 5KNDA 3OHXC 1JR0D 4C3HG 3K7AB 4KY7A 5DEHA 3BVZA 4XQJA 3I8ZA 5CV4A 1ZKOA 1C48A 2SDFA 2LFNA 5C3EB 2N55A 3GTLB 2AUJD 2NVYB 1LV9A 5JEAJ 1JOKA 3PO3B 4K8IA 4A3EB 1I4RA 4I65A 3CRLC 5I2YA 1SNOA 1Q12A 1V1PB 3OOCA 3GTJB 2IJ0A 5A35A 1DCZA 1AW7A 2Q8TA 4ABNA 1CA6A 1B2TA 1M4VA 4ZAIA 3TP6A 2EYMA 2FMMA 1GHJA 5A2QL 4IFDH 1MSHA 1MI2A 1Y69U 3VA5A 2EJMA 1DJRD 1BNZA 5KRUA 2F0EA 1WCMB 2J4XA 1QWYA 2DNCA 1BCPF 2F0MA 2F0WA 3D6WA 1DXMA 2V4DA 3L3OC 4KY6A 4O1NA 4QUCA 2CW0D 3S9WA 5BN4A 2R93B 5J39A 1LT5D 2PZUA 1ZXTA 2A69D 2EY5A 3QB3A 1E2WA 2SEBD 3TDQA 3WOFA 3LWUA 1SJED 3KF8A 3MEHA 1H9JA 2BDNA 3H94A 5FK9C 2A6ED 1LT6D 2NWGA 5JVH3 3GD7A 1BO0A 4ZYSA 4H44C 1PRTD 5ELEA 3KLSA 4ID6A 1VCIA 4NMZA 3TN2A 4M8AA 1DZ1A 1HCZA 1Q1EA 4WRDA 2FJ2A 3J81L 2IX1A 4HMIA 4ZKCB 3PMFA 2K6AA 2DY8A 5JOBA 3NUCA 4HN7A 1B3AA 4Q0FA 1CZWA 1W6JA 3NXWA 4X3UA 3S15B 1PTOF 1R4QB 2XWJB 3NK9A 1ICWA 1WVLA 5CBAE 2Q8RE 2NBFA 1BF4A 4IFDJ 3ND9A 4C56C 1SNCA 2X69A 4TQUS 3GTPB 1KAAA 5M3FB 4I7ZC 2AWNA 3KLSX 1XTCD 4HEDA 2F0KA 3GO5A 3NBIA 5T1GA 1GUTA 2F4IA 2ZT9C 4PQXA 4G57A 3T13A 3MXNA 4RKLA 1QJOA 1I4XA 3H3VC 1LT4D 1D5XC 1CZGA 3I70A 2EJGC 1I6HB 1STBA 5EJWA 3HP3A 4ZUJA 2DNEA 2R61A 1VMCA 1D5ZC 2DY7A 1TY2A 1EIGA 2M2LA 1LTID 2A5HA 4RA8A 4G7OC 1L0XB 3I4LA 3TP8A 4XQNA 1ET9A 4L63B 3RUZA 1CM9A 4K14A 1UNSA 1PTOH 3KUPA 4IUQA 2B2YA 1V1OA 2L1BA 5D3IB 2LKVA 4BY7B 1AP0A 3DMUA 3DXJC 4C1NK 5HGTA 1D5MC 4ZUIA 2VB2X 4KHVA 5KGUA 1CTMA 2F0PA 4K5VA 3HOYB 5C4JB 1T5EA 1YNND 3NP8A 5FO8B 2E2JB 4Z9CB 1SJHD 3P7JA 1EYCA 1F2LA 1F9RA 1SEBD 3CHBD 2SNSA 2ZXRA 1IKLA 3DWPA 2EYOA 5I6WA 4F87A 5IOCA 2HDLA 1JWMD 4QMGA 3I4MB 2EY6A 2XN9C 4FP5D 1DOLA 3HGBA 3OMGA 3S1NB 4WFN3 3M4OB 3D4DA 1TQOA 5JEAG 4HMJA 2A69C 1Y8NB 2KEDA 5ELBA 5E3FA 2O5IC 3HOVB 2O2LD 2F0GA 1BDOA 1QB5D 3P20A 4C3IB 1ZEQX 1EYDA 5NUCA 4DXGA 1WTOA 1F9PA 1TY0A 3RLFA 4CJ0B 1DOMA 3V2TA 5HURA 2LY7A 1A2UA 1G2SA 4N9PA 2BA0A 1GUWA 1B9NA 5CV9A 3SHLA 4RCOA 1RTNA 1D1IA 1JB3A 2CVRA 2EVBA 4C1NI 3WOEA 4DAYA 3TZUA 4R9WA 1KNAA 3QIAA 2F0TA 2RSNA 3E5SA 2E2HB 1SYBA 3R8BA 1SXTA 5IGFA 3CU7A 3R2IA 2ENBA 3Q22A 2XNAC 3S1MB 1A2TA 1EIHA 2B2TA 2EY2A 3A55A 1YNNC 4LK1C 3PUWA 4RGTA 4BBSB 3NWTA 5IGCA 1B44D 3T53B 4A3JB 1IYVA 4RKBA 3E0JA 2E2DC 1GUSA 4NDXA 1JORA 1J9OA 4EQPA 1SYCA 4NP5A 4KD3A 1PTOB 5D3DA 4C3JB 3T4AC 4MHEA 2O5JC 4OL7A 5LL6S 3EQLC 3MXPA 3OPOA 4HR7B 3MA2B 3NTHA 3HOUB 1IKMA 1JC7A 1I4PA 2E76C 3VYRA 1STAA 1G8ZD 1R9TB 3C46A 1ET6A 2Z1CA 1EU3A 1FNUA 1QILA 1U4RA 1GUNA 2PYKA 4LMQD 3J7AF 4KHZA 4FYDA 1WD0A 1RD9D 2G9HD 5IGGA 2L9HA 1MSGA 2EOTA 2A74C 2A6EC 3IAYA 3R2TA 2EE1A 1HHVA 1SYFA 5C5MA 2B2UC 3PUVA 3ND8A 2A68C 4XT1B 5G3LF 4K8JA 3AU7A 5EKIA 2EPBA 1HQRD 1RKNA 4KN4C 4RWSC 3VYTA 5C6AA 1PTOC 3SDZA 1SE2A 4DFAA 5I2XA 1EL0A 2OT2A 4QB4A 3S1QB 2AQ3B 5IGEA 2ID0A 4IUUA 5FOBB 1XYIA 4F88A 3GQBA 2F0LA 3EA6A 3RD4A 1TS4A 1ILQA 4HTHA 3X3NA 1X3QA 5C4XB 4OO1I 3GTGB 4AYBB 4JK1C 1BUVT 2PZTA 1D2BA 2KECA 1XX8A 2L4NA 3HEJA 3TMEA 2NN6G 2K28A 2RDGA 4WJWA 3M85A 2XIWA 3T51B 4DK1A 1LTTD 5EBDA 5BN3A 2EYLA 4C3IG 2JXMB 5JVG3 5I9OA 1O7ZA 1M8AA 2PNRC 2F0UA 2K03A 3DEOA 1PZJD 1I4QA 1TWAB 2A73B 2EY1A 4QCLA 5I6YA 2F0VA 2Q8IB 2C5CA 4EQOA 3D3RA 1S5FD 2QEJC 4FF3A 2LMCB 1A3UA 3WDNA 3A8JE 2LS01 3BVMA 5M9OA 1VMPA 2XSCA 1Z47A 1RF2D 4RGMA 1QOHA 4DGZA 1C4QA 2EYFA 5KIXA 3A54A 3H0GB 1QCBD 2K01A 1EEID 5CGKA 2NYZD 2HCIA 1RODA 1LTAD 1EY0A 4LJZC 3K59A 2YU9B 1E2VA 3S2HB 1UEAB 2OXPA 1EQTA 5EGTA 4A3KB 3PIO3 3M7NA 2OEOA 4CBVA 3K58A 4FF1A 1RCVD 4R8IA 2F03A 2RDHA 3MVVA 5C5LA 4FO2A 3EJIA 5CC4A 2RQXA 1S5CD 1R4PB 1ESFA 1QG7A 4HCSA 3I91A 3HZXA 5I4DA 4UDUC 3AB9A 1TS2A 2WKCA 3DWAA 1E0BA 1PRTB 4TSSA 4ZK9B 2NVXB 1Q90A 2BOSA 1Y8PB 4CGYB 5FO7B 2R3ZA 4RAUC 2WIIB 3KBGA 1WTXA 3FKIB 3A7AB 1KDAA 2HUGA 1TWCB 5JPMC 1IYUA 3PO2B 3MFGA 2B2WC 2L55A 1VDZA 3PV0A 3OWEB 3X3MA 4XXEA 3I4NB 5I9PA 2JP1A 1HRJA 3RZDB 4K2KA 2A68D 3J81E 4NKLA 1O7YA 4CKBA 5CV8A 2K05A 3F2UA 4FF2A 2JA7B 4TRDA 3HKZB 1K8MA 5CYUA 1EY7A 3Q6SA 2VNUD 5ISRA 1CHPD 4KKTA 1STNA 3KBXA 1TS5A 1EYAA 2BE5C 2F3VA 3SK8A 1TWHB 1B4OA 1TKWB 1TVXA 1NSNS 1TWGB 3FRPB 3E6ZX 4IUNA 3Q24A 3J7YW 3NBHA 3FPPA 1ENCA 1HUNA 3GP7A 1XXGA 4CKCA 4DNRB 2Z4IA 2K33A 4ZRZA 3C1EA 4RFBA 2ICEC 3J80L 4DU9A 1LTRD 3ERQA 1U4MA 2B8GA 4ZLTF 1NAPA 2AUKA 1TU2B 1V8QA 2PW5A 1CK1A 2K5WA 1STGA 3PUXA 4ULLA 5IT9L 2EXZA 3EVQA 4A93B 4J8QA 2F1MA 1LT3D 3N6RA 1PMRA 3SVMA 3DEPA 1GUOA 3OSOA 4X3SA 1EY6A 2C9OA 4GZYC 1JWSD 2Y0SB 3MFYA 2JA6B 5M3MB 1YNJC 3NSWA 4DXFA 1HUMA 2RBMA 1HPCA 1EWHA 2MHVA 1TS3A 5D14A 2CW0C 3QO2A 1HA5A 3RZOB 5E4WC 3M4YA 3HOZB 5EQ0A 1KDCA 3QOLA 4EVOA 1PTOD 4K5WA 4KJOA 1KLUD 5J22A 2B2WA 2VB3X 3KLRA 2SNMA 2X6GA 3IL8A 2KUMA 1NUCA 4XDXA 1PXUA 3TZDA 4IFDI 1JOQA 5IIFA 1JE4A 1EY8A 1O80A 3IKJA 4A3DB 1DONA 2NZ1D 5C3XA 2RSOA 5IGDA 1X32A 1JICA 2D2CC 3VR6A 2F0OA 5KEEA 1F77A 1MD2D 3CKIB 3M3YB 1H9MA 1PLFA 3DWQA 1CA5A 3K5MA 2J0TD 1BXTA 1Q8IA 1QE6A 3W3AA 1RTOA 4NW2A 1FD7D 1VF7A 4Q5VA 1S5ED 4XTCS 2IL8A 2EYHA 4C3JG 1JQYD 3GTQB 4ME5A 1STHA 1WTRA 5COYA 3MXUA 4PV1C 2NN6I 1HTLD 4A3IB 4TKOB 2M9VA 1MBYA 4RHSA 4BWGB 4ODGA 1F9QA 3SE0A 2IT1A 1SE4A 4P2CB 4OO1G 5IT9E 4H13C 1O78A 4DAVA 1RDPD 1SYGA 1BQQT 1II3A 4CJ2C 3H91A 2H1EA 3HRZC 1IW7D 2B2UA 3D6CA 4IQZA 3OWFA 1EY9A 3U9OA 2KEEA 4PNYA 1A15A 2PPBC 4XT3B 5CV6A 5DNFA 2F0IA 2NVQB 4HSPA 4QUFA 5D65A 3J80E 1KTKA 3GV3A 4KV6A 5JPNC 2QCPX 2RKSA 3BG3A 2BDOA 1STEA 3QOJA 4J6HA 4HCEA 2OF1A 2E2IB 3ZYYX 5KNCA 3JAME 2N88A 4EGVA 3FVQA 4HSVA 3M7GA 2I07B 3C1FA 1SYDA 1K8OA 4L8JA 3VR5A 2D9UA 2B2YC 2A6HD 1SBBB 2F0SA 4CKEA 4RGNA 1PZID 1KLGD 5FLXE 2NVTB 2VUMB 1SNQA 2KHSA 3OIPA 1B9MA 2MUYA 1PFMA 2B39A 4XQQA 3I90A 3FPUB 2PW7A 1LTSD 1SMYC 3S14B 4KI0A 2Z8LA 3VR2A 2CHBD 3NE5B 3BYTB 4MIUA 1CQVA 3AMUA 1S4ZA 1V1PA 3K5OA 4MN3A 1PZKD 1KNEA 2EYJA 4OIJA 2WAQB 1PDQA 1OXSC 3GTMB 3I3CA 1JWUD 3GV6A 1H9RA 3GTKB 2Z4HA 1AEXA 1I4HA 3EFXD 4G4KA 1GOZA 2MP1A 5M5YB 2JSOA 2BCOA 2BE5D 3VR3A 5EPLA 5FLXL 3A8KE 1GUGA 3P75A 4OHJA 2X6LA 3MXGA 5C4ZA 3DHQA 3SR1A 3VR4A 2B2TC 1H9KA 5DM73 3V96A 4FXKC 1BR9A 3QJYA 4K5XA 2FINB 3I72A 1Y1WB 5C44B 2L5TA 1SYEA 2ZXPA 2ZXOA 4CJ1B 1GHKA 3NWSA 3PIP3 4KMUC 3ONAB 4PMBA 3J7AV 5E4XA 1WTWA 1SSOA 4J1MA 1F2ZA 2RA4A 1LTBD 5IGBA 2HQEA 3ITPA 3OW7A 1A6XA 4EQNA 5CBEE 2NTSA 3BS1A 5T1IA 1I4GA 2EDGA 2F0JA 2PO4A 2EZVA 3SEBA 4G7ZC 1DOKA 2FFKB 5EPJA 1STYA 5KNBA 1I6VC 1ENFA 4K6DA 3RMHA 1WTVA 1HFNA 4F8MA 2D62A 2FHTA 1S5BD 2XRQD 4RH6A 4DNTB 2WINB 1O7LA 4A3FB 5JAVA 1LO5D 4R8NA 1XWEA 4WORA 3T56B 4L6TB 4H7BA 1DM0B 5CR3A 2K04A 3EROA 4IFDG 2KA7A 3H09A 1TT2A 4G7HC 4PMCA 3TP7A 4XYQA 2I46A 2MPMA 3URYA 3D4RA 3C3LA 4V190 1MGSA 2A6HC 4N9TA 2L0CA 5ELCA 1UUPA 3NHHA 1VF5C 1S5DD 4HAEA 1SNDA 1LLRD 4IURA 5E1FA 3LX0A 1AN8A 3QWNA 1ONLA 4KKSA 5LL6X 1KDBA 1W6KA 5CMDA 3VYSA 3JAML 4ILWA 3VYUA 2RVLA 1CFMA 1G2TA 3DM1A 5FKAC 1DD2A 2WP8J 4LAAA 2PCFB 5M5WB 1IW7C 4KY5A 1SNPA 4X3KA 2XVSA 1PYWD 2FMCA 3OMCA 1LABA 5C0XG 3BZDB 2G9DA 4A3MB 1Y8OB 2L12A 3N52A 1H9SA 3K57A 4BY1B 1U4PA 1GXDC 2K1BA 1EQVA 5DAUA 4BBRB 3BDLA 1BCPD 1PRTF 3W2DA 5ELFA 3PUYA 1G291 1Q3LA 1NCVA 2TSSA 3HOWB 2AQ1B 1G6ZA 3FDTA 3BDOA 4OO1H 2HCCA 1OXTA 3A56A 3BVGA 4CHTB 1OXXK 2AWOA 4UAIA 4B08A 1V43A 1PRTC 1PFBA 2NN6H 2HDMA 3TBIB 5F2DA 3Q0AA 1JOOA 3A8IE 1TIID 3D4WA 2BA1A 2KCNA 2K5DA 2AQ2B 3S16B 1HA6A 1EWCA 3GTOB 4RHRA 1EZ8A 2KVMA 4IUTA 3SXHA 3LNNA 4RGOS 1EFID 1BOSA 4KD4A 5EPKA 1AZQA 4O42A 2JA5B 4FVMA 5DM63 1WTPA 1GJXA 1CT1D 1EOTA 4A3BB 2QF7A 5K36H 2EJFC 3OIQA 3C2PA 2JYOA 1AFPA 3BDCA 2F3WA 4FXGC 3SK4A 2J7ZA 1FGBD 2R6GA 3LWEA 1LTGD 4IUPA 2XRSD 1OXUA 1H9SB 3TP5A 3T16A 2F0QA 5M5XB 4KJNA 5C0XJ 3KK7A 2IWHA 1SE3A 5CV7A 3D8GA 4DN4M 5G3LD 5KYIA 5C0XH 1U4LA 4B9WA 4M1UB 1C8CA 2ICIA 2KCCA 5LHY1 5CORA 2PQEA 1U9RA 2B2VA 2WV6D 1HQMC 4B9XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MGS A;  1CA6 A;  1B2T A;  2CVR A;  2B2U C;  2VXW A;  4ZAI A;  3I90 A;  3SVM A;  1B3A A;  3FPU B;  5CBE E;  2IL8 A;  3DEP A;  1KNA A;  2B2V C;  2JP1 A;  4R9W A;  1HRJ A;  1PFB A;  4X3S A;  2FMM A;  2RSN A;  4XT1 B;  5T1I A;  4X3T A;  1RJT A;  1VMP A;  2HDM A;  4X3U A;  1F9S A;  1NR4 A;  5EKI A;  5AFW A;  1MSH A;  2EPB A;  1MI2 A;  1WD1 A;  1WTR A;  1ML0 D;  1ICW A;  1DOK A;  1O7Y A;  4RWS C;  5COY A;  5CBA E;  1WVL A;  2Q8R E;  2FFK B;  1EIH A;  2B2T A;  2K01 A;  2K05 A;  1S4Z A;  4U68 A;  1BF4 A;  3P7J A;  1SDF A;  1HUM A;  5CMD A;  5EPJ A;  1EL0 A;  3F2U A;  1BNZ A;  4MN3 A;  2NYZ D;  1KNE A;  2HCI A;  4OIJ A;  1F9R A;  1F2L A;  2X69 A;  1ROD A;  3MTS A;  1HA6 A;  3R93 A;  1PDQ A;  2RVL A;  1IKL A;  3I3C A;  1F9Q A;  1WTV A;  1HFN A;  3GV6 A;  3IFD A;  4IUU A;  5D14 A;  4HED A;  1XYI A;  1G2T A;  3D6W A;  1PFN A;  2KVM A;  3QO2 A;  2HDL A;  5T1G A;  4IUT A;  3DM1 A;  1EQT A;  3Q6S A;  2FHT A;  1ILQ A;  4QUC A;  5E4W C;  2KOL A;  1X3Q A;  1RHP A;  5EQ0 A;  2MP1 A;  1DOL A;  4OIK A;  1AZQ A;  5EPK A;  4O42 A;  3KBX A;  4X3K A;  3MWY W;  4CJ2 C;  1WTP A;  3H91 A;  5EPL A;  1EOT A;  1ZXT A;  2H1E A;  4R8I A;  1BBX C;  1X3P A;  2B2U A;  2B2W A;  1J9O A;  1IL8 A;  2X6G A;  3IL8 A;  2KEC A;  2KED A;  2KEE A;  1A15 A;  1AZP A;  1B4O A;  1XX8 A;  2KUM A;  2L4N A;  4XT3 B;  1TVX A;  5DNF A;  2K28 A;  3UI2 A;  4XDX A;  1G91 A;  4QUF A;  4MHE A;  5D65 A;  3TZD A;  2XIW A;  2X6L A;  1HFG A;  1QG7 A;  2JYO A;  2L12 A;  2MJ8 A;  3N52 A;  3GV3 A;  4HCS A;  3I91 A;  2K04 A;  5EJW A;  2BDN A;  2J7Z A;  3HP3 A;  2B2T C;  1U4P A;  3LWE A;  1IKM A;  1VMC A;  2K1B A;  1HUN A;  2DY7 A;  1WTO A;  1JE4 A;  1F9P A;  4IUP A;  1E0B A;  1SAP A;  4ZK9 B;  1EIG A;  2L11 A;  2M2L A;  1O80 A;  3I8Z A;  1B50 A;  1NR2 A;  2SDF A;  2NWG A;  1DON A;  2FIN B;  2NZ1 D;  4RA8 A;  4CJ0 B;  2RSO A;  1J8I A;  1BO0 A;  1U4M A;  1U4R A;  1ESR A;  2N55 A;  2N88 A;  1O7Z A;  1M8A A;  1Q3L A;  2R3Z A;  4HSV A;  1X32 A;  1JIC A;  4LMQ D;  1NAP A;  1DOM A;  2K03 A;  4ZLT F;  1NCV A;  1LV9 A;  2MPM A;  3DEO A;  3TN2 A;  4RAU C;  2D9U A;  1WTX A;  4DN4 M;  1WD0 A;  2B2Y C;  1G2S A;  1CM9 A;  4CJ1 B;  2HUG A;  1DZ1 A;  1PLF A;  3KUP A;  1QNK A;  1CA5 A;  1G6Z A;  1MGS A;  3FDT A;  2L9H A;  1U4L A;  1MSG A;  4IUQ A;  2FJ2 A;  2B2Y A;  2HCC A;  2EOT A;  2B2W C;  1WTQ A;  2L1B A;  4IUV A;  1C8C A;  4ZKC B;  1QE6 A;  3G7L A;  3ONA B;  5COR A;  1RTO A;  1GUW A;  1AP0 A;  5E4X A;  1WTW A;  2DY8 A;  1SSO A;  5JJZ A;  1B53 A;  4NW2 A;  4HAE A;  2Q8T A;  1ILP A;  2EE1 A;  2RA4 A;  2B2V A;  1RTN A;  1PFM A;  4ZKB B;  4IUR A;  4UAI A;  1HHV A; 
#chains in the Genus database with same CATH topology
 3PQI A;  2MGS A;  4XIG S;  3TQY A;  4E6I A;  1I3Q B;  1P16 A;  3NQI A;  3FHW A;  4WJ4 A;  2B2V C;  5K36 G;  3S2H H;  2CFM A;  2V1C C;  3MHB A;  2R7Z G;  4YIJ A;  1CHQ D;  4NXM Q;  2JQO A;  1EEF D;  3MAQ A;  1F9S A;  4A75 A;  3H6M A;  1K73 C;  1WD1 A;  5C0X I;  2E75 C;  3PGZ A;  2QIL A;  4DF7 A;  4U68 A;  1PH3 A;  3I4O A;  1SDF A;  1C7Y A;  4JI4 Q;  3CRK C;  1YI2 A;  1I3Q H;  1A3V A;  3GTP H;  3R93 A;  2F0N A;  3S1Q H;  4F7X A;  1N32 L;  3NTK A;  3L9A X;  3NTI A;  1PFN A;  1TR5 A;  1JCK B;  2VQF Q;  1JJC B;  2KOL A;  5CV5 A;  1RHP A;  1VQM A;  4KKU A;  4X64 L;  3GTQ H;  3MC0 B;  3CQZ B;  1TWF B;  3MWY W;  2K5Q A;  2QDB A;  3G6J B;  4IN3 A;  1M90 C;  1BBX C;  3SK6 A;  3G71 A;  4JCV E;  2F0F A;  4B3R Q;  2K75 A;  2KJX A;  4JI1 L;  3K5N A;  3Q23 A;  1EIY B;  3HOY G;  2UXD Q;  1Z7T A;  1F2Y A;  1HFG A;  3QG1 A;  3HS0 C;  3ICE A;  2MJ8 A;  4A3G B;  1SFO B;  1EY4 A;  1XJV A;  3VDY A;  1BCP C;  1VQ5 A;  4JBW A;  4KHP Q;  1SNM A;  2E8G A;  1ENA A;  1B50 A;  1EY5 A;  1NR2 A;  2QW7 A;  2C35 B;  4AIM A;  2KQ3 A;  4KN7 C;  2NVY H;  5IWA L;  5BN5 A;  2JEA I;  2UUA Q;  2NTT A;  1EUJ A;  1ESR A;  2YTV A;  3S15 H;  3S17 B;  2XWB B;  1SMY D;  2OTJ A;  2WAC A;  2NUC A;  1VQG A;  2Z0S A;  2EYP A;  3A7L A;  2CKZ B;  3R3O A;  2EIF A;  3KJO A;  4DA2 A;  1Q81 C;  1WTQ A;  3CXC A;  2K32 A;  1B1Z A;  3G7L A;  1Z6H A;  4QF4 A;  1L0Y B;  1HZ9 A;  1ILP A;  3D31 A;  4GNX C;  2RDF A;  2XGT A;  4ALP A;  1ZYR D;  2VXW A;  3A5U A;  1MJE A;  1D1K A;  1K9M C;  4LUV A;  1BCP B;  2M00 A;  4K6L A;  4JI1 Q;  5C4H A;  3IFT A;  2ATW A;  3S2D B;  2E74 C;  4U67 3;  3K5L A;  1A3T A;  4LNQ A;  5AFW A;  4DK3 C;  1FJG L;  3BYY B;  2JE6 I;  1Q1B A;  1A8V A;  2I5H A;  3OW2 A;  1K3R A;  1LM0 A;  1QZG A;  1HTP A;  1T5X D;  3MTS A;  5J1Z A;  3U9S A;  5C3W A;  3J7A 5;  1IHZ A;  3P1H A;  3SK5 A;  2GA4 B;  4UP9 A;  3FMC A;  1RIP A;  2WKD A;  1L1O A;  3FEW X;  1EU4 A;  4FXD A;  2D0P A;  2IW3 A;  4BS9 A;  4L5Q A;  4OIK A;  5M5X H;  1VQ9 A;  5JJK A;  3K0Y A;  4BA2 I;  3O13 A;  2B8F A;  2IPK D;  1YNJ D;  4DR7 L;  1DYQ A;  2H4O A;  1BKB A;  1SLJ A;  1X3P A;  2SOB A;  2F0H A;  2F4V L;  1VQJ A;  2QKI C;  2VZA A;  1AZP A;  3HOX G;  4KK7 A;  1VQL A;  5EBC A;  3QR8 A;  4BBS H;  1G91 A;  2PMZ B;  5FO9 B;  4IZ8 A;  4P71 A;  3HG9 A;  3F8T A;  1E2Z A;  2DN8 A;  3PCO B;  1FNV A;  3GTG H;  2IX0 A;  4ZQ3 A;  1NTG A;  1A62 A;  1D6E C;  2Q2I A;  2B63 B;  4GKK Q;  1SAP A;  1YVC A;  1OXV A;  3J81 j;  2JA8 B;  2L11 A;  4K2L A;  3J80 i;  5TSS A;  4C3H B;  2WB1 B;  5JEA H;  4Y7N B;  4DAY B;  1VQI A;  2TMP A;  1J8I A;  1OO9 B;  4DK0 A;  3W1B A;  4RCN A;  1WI5 A;  1HNW Q;  1LAC A;  2JA9 A;  4KLK A;  4FNF A;  4ME3 A;  1CQF A;  1QVF A;  5IYC G;  5ELD A;  4YWM A;  1AH9 A;  1Y1V B;  4C2M B;  1EOV A;  1TWG H;  4OXP A;  1K83 B;  2PZW A;  1QNK A;  1YHQ A;  5DLQ E;  4IUV A;  1Y1W H;  4HJ5 A;  1KAB A;  1PH4 A;  1FR3 A;  4JI5 L;  5JJZ A;  1B53 A;  1E7Z A;  1IL8 A;  4ZKB B;  4RG1 A;  3NQT A;  4H0L C;  3L7Z C;  2CQA A;  1YJ9 A;  4DAP A;  3PUZ A;  4C3H H;  4X3T A;  1RJT A;  1ZYR C;  2MFI A;  5IP9 H;  2NB0 A;  2O4X A;  1FYC A;  1NR4 A;  4BA1 I;  3J80 c;  4GKJ Q;  4A3G G;  4UP8 A;  2IX3 A;  3HOZ H;  1ML0 D;  5IOD A;  2R7Z B;  1X54 A;  1CI3 M;  4JI8 L;  3V05 A;  2F0D A;  3UE1 A;  3AEV A;  3TSS A;  4PZ7 A;  3I73 A;  4QJF A;  5A2Q E;  2I5M X;  5LMU Q;  2ZJR A;  1A0I A;  3E0E A;  5EKL A;  4XYO A;  3K6O A;  4KTA A;  5KYL A;  3DUZ A;  3IFD A;  4S3S A;  1F2M A;  3S1R B;  1N8R C;  1FNW A;  1EZ6 A;  1HXY D;  1UAP A;  1JJG A;  4BXX G;  2D5D A;  2YYZ A;  3NPP A;  2R92 B;  4QIW B;  4IAL A;  5J3B A;  1QVG A;  5EKK A;  4PMW A;  1VQP A;  3HOX B;  2MO1 A;  4OGQ C;  4V0B A;  5K5P A;  4FF4 A;  2JA8 H;  2K7V A;  2JEB I;  1QNU A;  2ZTE A;  1I50 B;  1EQQ A;  2UUC L;  2R93 G;  3H15 A;  3SGI A;  3MZ5 A;  3AYH B;  3VA7 A;  3UI2 A;  1ASY A;  1JB7 A;  4CDD C;  3G6E A;  3A5Z B;  4HIM A;  5GAD C;  1KRS A;  5KND A;  3OHX C;  1JR0 D;  4C3H G;  3K7A B;  4OEM B;  2B63 H;  5IP9 G;  2Z6K A;  4B3S Q;  4KY7 A;  1B70 B;  3E9I A;  4K0K Q;  4PG3 A;  4LF4 Q;  5DEH A;  3S2D H;  3BVZ A;  3RZO H;  4XQJ A;  3I8Z A;  5CV4 A;  3IRB A;  1ZKO A;  1C48 A;  2QDL A;  2SDF A;  2LFN A;  4QQB X;  5C3E B;  4GNX B;  4A3F H;  5M3F G;  1V1Q A;  2N55 A;  1SR3 A;  4LFC L;  3GTL B;  2AUJ D;  2NVY B;  1LV9 A;  4DR2 Q;  5JEA J;  1JOK A;  3PO3 B;  4K8I A;  4A3E B;  1I4R A;  3BZC A;  4I65 A;  2OCE A;  2LXK A;  3H3V I;  3CRL C;  1N33 L;  1NNX A;  1ICF B;  1I94 L;  1Q8K A;  1WYD A;  1WOC A;  5I2Y A;  1SNO A;  4DV7 L;  1NBW A;  1Q12 A;  1V1P B;  3OOC A;  3GTJ B;  2IJ0 A;  5A35 A;  2KCT A;  1DCZ A;  1AW7 A;  2Q8T A;  2JA6 H;  4ABN A;  1CA6 A;  1B2T A;  1M4V A;  4ZAI A;  3TP6 A;  5IE8 A;  2EYM A;  2FMM A;  1GHJ A;  5A2Q L;  5FLX c;  4IFD H;  1TWF H;  4LF7 Q;  2VY3 A;  1HZB A;  1MSH A;  1MI2 A;  3ERS X;  1Y69 U;  3WWV A;  1W3S A;  3VA5 A;  2EJM A;  1DJR D;  2B63 G;  1BNZ A;  2JA8 G;  4HID A;  2NVQ H;  5KRU A;  4GN5 A;  2F0E A;  1WCM B;  2J4X A;  1QWY A;  2DNC A;  1BCP F;  2EQS A;  2F0M A;  2F0W A;  3D6W A;  4DUY L;  1DXM A;  1L2F A;  2K50 A;  2V4D A;  4AH6 A;  4KY6 A;  4O1N A;  3L3O C;  4QUC A;  2JA5 H;  2CW0 D;  3S9W A;  5BN4 A;  1XPU A;  2R93 B;  5J39 A;  4BY7 G;  1LT5 D;  2PZU A;  1ZXT A;  2A69 D;  2EY5 A;  3CMA A;  3QB3 A;  4LW1 A;  1E2W A;  2SEB D;  3TDQ A;  5M3F H;  4UPA A;  3WOF A;  4EQ5 A;  2R7F A;  3F1Z A;  3LWU A;  1IXR A;  4OWT B;  1SJE D;  3CPW A;  3KF8 A;  1S40 A;  3MEH A;  1H9J A;  1UWV A;  2BDN A;  3H0G G;  2DGY A;  3H94 A;  1X9N A;  5FK9 C;  2A6E D;  1LT6 D;  2NWG A;  3J7Z C;  5JVH 3;  3AFP A;  1CSQ A;  3GD7 A;  1BO0 A;  1N32 Q;  4ZYS A;  4H44 C;  4DV1 L;  2I0Q A;  1PRT D;  5ELE A;  3KLS A;  4JW0 A;  4ID6 A;  1VCI A;  2F52 A;  4JBJ A;  4NMZ A;  3TN2 A;  5LMN Q;  4POG A;  1LUZ A;  3OYY A;  2RCF A;  4M8A A;  4DAM A;  3TRZ A;  1DZ1 A;  4GS3 A;  1HCZ A;  2UUB L;  4LWC A;  1Q1E A;  4WRD A;  1X3F A;  3DLL A;  4A3L G;  2FJ2 A;  3J81 L;  2IX1 A;  4HMI A;  1Y1V G;  4ZKC B;  3K81 C;  3CF5 A;  3OTO L;  3PMF A;  2K6A A;  1C9O A;  2DY8 A;  4P72 A;  5JOB A;  2B3G A;  3NUC A;  5C4X H;  2EXD A;  4HN7 A;  4GKJ L;  3RLO A;  1B3A A;  3FP9 A;  4DV3 Q;  4Q0F A;  3T1Y L;  4EX5 A;  1XNQ Q;  1CZW A;  4JI8 Q;  1W6J A;  3NXW A;  4X3U A;  1NMG A;  3KF6 A;  3S15 B;  2FXQ A;  3ULJ A;  2VQE L;  1PTO F;  1R4Q B;  2XWJ B;  3NK9 A;  1PH2 A;  1ICW A;  2E2J H;  1WVL A;  5CBA E;  2Q8R E;  2NBF A;  1BF4 A;  4YWL A;  4IFD J;  3ND9 A;  4JG2 A;  2Z6B A;  2E5L L;  4C56 C;  4DK6 C;  1SNC A;  1PH8 A;  2AMC B;  2X69 A;  4TQU S;  1SMX A;  3GTP B;  1KAA A;  1GO3 E;  5M3F B;  4I7Z C;  2AWN A;  3KLS X;  4CDC C;  1XTC D;  4HED A;  4DV1 Q;  1IBM Q;  2F0K A;  3GO5 A;  3NBI A;  5T1G A;  1GUT A;  2KBN A;  2F4I A;  2N49 A;  2ZT9 C;  2UUC Q;  4PQX A;  4G57 A;  3T13 A;  3I4M G;  1JT8 A;  3MXN A;  4RKL A;  1QJO A;  3S24 A;  1I4X A;  4QIW E;  3H3V C;  1LT4 D;  2HHH Q;  5JJL A;  1D5X C;  1D7Q A;  1CZG A;  3I70 A;  2EJG C;  1I6H B;  1STB A;  1VQD A;  1YNX A;  1UE6 A;  5EJW A;  3HP3 A;  4ZUJ A;  2DNE A;  2R61 A;  1VMC A;  1D5Z C;  2DY7 A;  1UE7 A;  3A74 A;  1TY2 A;  1EIG A;  2M2L A;  1N9W A;  3T1H Q;  3F2B A;  2L15 A;  1LTI D;  2A5H A;  4RA8 A;  1HZC A;  2E5L Q;  4G7O C;  1L0X B;  1ASZ A;  3I4L A;  2ES2 A;  3TP8 A;  4XQN A;  2CH4 A;  1ET9 A;  4L63 B;  4POF A;  1N33 Q;  3RUZ A;  1CM9 A;  4K14 A;  1UNS A;  1PTO H;  3KUP A;  4DV7 Q;  1DGS A;  1TXY A;  4IUQ A;  2B2Y A;  1L1O B;  1V1O A;  2L1B A;  2VS1 A;  5D3I B;  2K4K A;  2LKV A;  3PO3 G;  3BJU A;  4BY7 B;  4A3E G;  1AP0 A;  2YU9 H;  3DMU A;  3DXJ C;  4C1N K;  5HGT A;  1D5M C;  4ZUI A;  2VB2 X;  4KHV A;  4ZCK A;  2UU9 L;  1K0R A;  5KGU A;  4Y7N H;  2Z6K C;  1CTM A;  2F0P A;  4K5V A;  3HOY B;  1OTC A;  5C4J B;  1T5E A;  1YNN D;  3NP8 A;  5FO8 B;  5IP7 G;  2E2J B;  4P73 A;  4Z9C B;  5C44 H;  1SJH D;  4UY8 C;  3P7J A;  2K5H A;  3CME A;  4JI6 Q;  4YCU A;  3T1H L;  3CCM A;  1EYC A;  1F2L A;  1F9R A;  1SEB D;  3CHB D;  2ZM6 L;  3HKZ E;  2SNS A;  2ZXR A;  1IKL A;  3DWP A;  2EYO A;  5I6W A;  4JI0 L;  4F87 A;  5IOC A;  2UXC Q;  2HDL A;  1JWM D;  4QMG A;  3I4M B;  3GTK H;  1HNZ Q;  3NEL A;  2NVT H;  3CC7 A;  2IHE A;  2EY6 A;  2XN9 C;  4FP5 D;  1DOL A;  3HGB A;  3CPF A;  3OMG A;  3S1N B;  1VQF A;  4WFN 3;  3M4O B;  3D4D A;  1TQO A;  4A3J G;  4LUO A;  5JEA G;  2WFW A;  4HMJ A;  2A69 C;  1GKH A;  1Y8N B;  2KED A;  5ELB A;  5E3F A;  2O5I C;  3HOV B;  2AHO B;  4A3E H;  2O2L D;  1UE1 A;  3ZJY C;  2F0G A;  1BDO A;  1QB5 D;  3P20 A;  4C3I B;  4B3T L;  1ZEQ X;  5HGQ A;  1JE5 A;  1EYD A;  5NUC A;  4DXG A;  1WTO A;  1F9P A;  1TY0 A;  1IBL L;  3RLF A;  1R9T H;  3K0X A;  3HOU G;  4CJ0 B;  1IBK Q;  2VL6 A;  3BU2 A;  1DOM A;  2UUB Q;  3EIV A;  3V2T A;  5HUR A;  1I5F A;  2LY7 A;  1A2U A;  1G2S A;  3HOX H;  2UXC L;  1IL2 A;  4N9P A;  1EYG A;  1I50 H;  2BA0 A;  2RF4 A;  1GUW A;  1L0W A;  1B9N A;  5CV9 A;  3SHL A;  4RCO A;  1RTN A;  2ZTC A;  1D1I A;  3BZK A;  5EAY A;  1JB3 A;  2CVR A;  3PIP A;  2EVB A;  3WOE A;  4C1N I;  3TZU A;  4DAY A;  4JI5 Q;  4R9W A;  1KNA A;  3QIA A;  2F0T A;  2RSN A;  3E5S A;  4X66 L;  4FDB A;  2E2H B;  1SYB A;  2CWP A;  1SXT A;  3R8B A;  5IGF A;  3CU7 A;  2NZO A;  3R2I A;  2ENB A;  3Q22 A;  2XNA C;  3S1M B;  1A2T A;  4GLV B;  1EIH A;  2B2T A;  2EY2 A;  4A3D H;  3A55 A;  1YNN C;  4LK1 C;  3PUW A;  3E9H A;  1I6H H;  4LF5 Q;  4RGT A;  3ULP A;  2R93 H;  4BBS B;  2WB1 G;  3HOU H;  3NWT A;  5IGC A;  2CCZ A;  1B44 D;  4A3K H;  1GD7 A;  4A3M H;  3T53 B;  2D0O A;  3S1M H;  4A3J B;  1IYV A;  4RKB A;  3ULL A;  1PH7 A;  3M4P A;  3E0J A;  2JK8 A;  3HOV G;  2E2D C;  1GUS A;  5C4X G;  3TS2 A;  1J5E Q;  4NDX A;  4DR6 L;  1JOR A;  1J9O A;  2MQH A;  4EQP A;  1SYC A;  4NP5 A;  4KD3 A;  4AYB G;  2A8V A;  3UDI A;  1PTO B;  1UE5 A;  5D3D A;  4C3J B;  1Z9F A;  3T4A C;  2UXB L;  4J15 A;  4MHE A;  4LF7 L;  3HKS A;  2O5J C;  4OL7 A;  5LL6 S;  3EQL C;  3MXP A;  3OPO A;  4HR7 B;  3MA2 B;  3NTH A;  3HOU B;  1IKM A;  1JC7 A;  1I4P A;  4H02 A;  2E76 C;  3VYR A;  5C4J H;  1STA A;  4A3I G;  1G8Z D;  1QZH A;  1R9T B;  1VQB A;  3C46 A;  1ET6 A;  4BXX H;  2Z1C A;  4DV5 Q;  4DR4 L;  4GLA C;  4C3J H;  1CKN A;  1EU3 A;  1FNU A;  1QIL A;  4YHH L;  4LF5 L;  1U4R A;  1GUN A;  4LMQ D;  1LYL A;  2PYK A;  3RN5 A;  3J7A F;  3LGJ A;  4KHZ A;  4A3K G;  2PMZ E;  4DV0 L;  4FYD A;  4UP7 A;  1WD0 A;  1RD9 D;  1HNX Q;  2G9H D;  2LXJ A;  5IGG A;  2L9H A;  2OQ0 A;  1MSG A;  3U4Z A;  2EOT A;  4JI3 Q;  2A74 C;  2A6E C;  2R92 G;  3IAY A;  3R2T A;  1CSP A;  2UU9 Q;  4DR1 L;  2DUD A;  2EE1 A;  1NJI C;  1I94 Q;  1HHV A;  1SYF A;  5C5M A;  2B2U C;  4LF8 L;  2E2H H;  3PUV A;  3NEN A;  3ND8 A;  1KHI A;  2A68 C;  4XT1 B;  3KF8 B;  5JJI A;  2XTI A;  5G3L F;  3S1N H;  4K8J A;  3AU7 A;  5EKI A;  2DJF C;  3DM3 A;  5M5Y H;  1N34 L;  4R4I A;  2EPB A;  5GAG C;  1HQR D;  1RKN A;  4KN4 C;  4RWS C;  1K83 H;  3VYT A;  5C6A A;  1SFO H;  1PTO C;  1P8L A;  3SDZ A;  1XNR L;  1QUQ A;  1SE2 A;  4DFA A;  5I2X A;  1EL0 A;  2OT2 A;  4DV6 Q;  4QB4 A;  3S1Q B;  2ZJP A;  2AQ3 B;  5IGE A;  4DV5 L;  4DR4 Q;  2ID0 A;  2UUA L;  4IUU A;  2OQK A;  5FOB B;  1XYI A;  4F88 A;  3GQB A;  2F0L A;  3CAM A;  5AJ3 L;  1T9H A;  4GOP A;  3EA6 A;  3RD4 A;  1TS4 A;  1ILQ A;  4HTH A;  3X3N A;  1X3Q A;  3H0G H;  5C4X B;  2Q2T A;  4JOI A;  4OO1 I;  4DUY Q;  3GTG B;  1XTD A;  4AYB B;  4JK1 C;  1PFS A;  1BUV T;  1HR0 W;  4LF9 Q;  5FJ8 H;  2PZT A;  3JAM i;  2R92 H;  2KEC A;  1D2B A;  1XX8 A;  2L4N A;  3HEJ A;  1PH1 A;  3TME A;  2NN6 G;  2K28 A;  2RDG A;  4WJW A;  3M85 A;  2XIW A;  5HY6 A;  4GN3 B;  5IP7 H;  3T51 B;  4DK1 A;  3RN2 A;  1MHW C;  4LFA Q;  2OTL A;  2WB1 E;  1LTT D;  4A3L H;  5EBD A;  5BN3 A;  1XMQ Q;  5IYB H;  4JV5 L;  2EYL A;  4C3I G;  2JXM B;  4GN4 B;  4A4I A;  1KD1 C;  2WAQ G;  2NVX H;  5JVG 3;  2A19 A;  2JA7 G;  4DR3 Q;  5I9O A;  3HKZ G;  2KHJ A;  3HOV H;  1O7Z A;  1M8A A;  2PNR C;  2ALY B;  1WCM G;  2F0U A;  2K03 A;  3DEO A;  1PZJ D;  1I4Q A;  1TWA B;  3CCV A;  2A73 B;  2EY1 A;  4QCL A;  5I6Y A;  5AJ3 Q;  2F0V A;  2Q8I B;  5LMN L;  2C5C A;  4EQO A;  2QEX A;  2ZJQ A;  3D3R A;  1S5F D;  1NE3 A;  4QGU A;  4X66 Q;  2QEJ C;  4FF3 A;  3MEF A;  2LMC B;  4RMF A;  4NXM L;  3E3X A;  1A3U A;  3WDN A;  3A8J E;  2LS0 1;  1RL2 A;  3BVM A;  5M9O A;  1VMP A;  2XSC A;  1Z47 A;  5L37 A;  1QVC A;  1RF2 D;  4RGM A;  1E22 A;  1QOH A;  4DGZ A;  2K5V A;  1C4Q A;  2EYF A;  5KIX A;  1X65 A;  3A54 A;  3H0G B;  3U58 A;  4LFA L;  1FGU A;  1QCB D;  2K01 A;  1JMC A;  1EEI D;  5CGK A;  2NYZ D;  4DV2 Q;  2HCI A;  1ROD A;  1LTA D;  1EY0 A;  4LJZ C;  3K59 A;  2BH2 A;  2YU9 B;  1E2V A;  3S2H B;  1UEA B;  2OXP A;  1EQT A;  5EGT A;  4A3K B;  3PIO 3;  3M7N A;  2OEO A;  3GDE A;  4CBV A;  4X65 L;  4GOP B;  4JI2 L;  3K58 A;  4B3R L;  4FF1 A;  1RCV D;  4R8I A;  2F03 A;  5M3M H;  5IY0 A;  2RDH A;  3MVV A;  5C5L A;  2K52 A;  4FO2 A;  2QA4 A;  3EJI A;  4A76 A;  5CC4 A;  1VQO A;  2RQX A;  4B3S L;  1S5C D;  1R4P B;  1ESF A;  1QG7 A;  1QUQ B;  4HCS A;  3M9B A;  3I91 A;  3HZX A;  5I4D A;  2P5Z X;  4A3D G;  1YHA A;  4UDU C;  3CCU A;  3AB9 A;  1TS2 A;  2WKC A;  1PH6 A;  3DWA A;  1E0B A;  1EWI A;  1PRT B;  4TSS A;  4ZK9 B;  4HJ7 A;  2NVX B;  1Q90 A;  2JN4 A;  2BOS A;  3I56 A;  4DR2 L;  3NEM A;  4R1J A;  1Y8P B;  2MO0 A;  1MKH A;  4CGY B;  5FO7 B;  4DV0 Q;  4GLX A;  4JI0 Q;  2R3Z A;  3TEH B;  1XMO L;  1L1O C;  1CKM A;  4RAU C;  2WII B;  3KBG A;  1FL0 A;  5FJ8 G;  1WTX A;  2OWO A;  1X55 A;  3FKI B;  3A7A B;  1U0L A;  1KDA A;  2HUG A;  1TWC B;  5JPM C;  1IYU A;  4IPD A;  3PO2 B;  1KXL A;  2AKW B;  3MFG A;  2B2W C;  2L55 A;  2RHS B;  1HH2 P;  1VDZ A;  1IYJ B;  3PV0 A;  3CW2 C;  4JI2 Q;  3OWE B;  1YIT A;  3X3M A;  4A3J H;  4C3I H;  4XXE A;  3I4N B;  5I9P A;  4A93 G;  2JP1 A;  1FJG Q;  1HRJ A;  3RZD B;  4BY7 H;  2QGQ A;  4K2K A;  2VUM H;  2A68 D;  4P75 A;  3J81 E;  4NKL A;  1O7Y A;  4CKB A;  5CV8 A;  2K05 A;  3K7U C;  3F2U A;  4FF2 A;  4O2D A;  2JA7 B;  4DV4 Q;  2GVA A;  4TRD A;  2PNH A;  1UEB A;  3HKZ B;  1K8M A;  3STB C;  4IPH A;  4HIO A;  5CYU A;  1EY7 A;  4LUZ A;  4LFC Q;  3G4S A;  3Q6S A;  2VNU D;  1G6P A;  2PI2 A;  5ISR A;  1CHP D;  4KKT A;  1STN A;  3TRE A;  4A3C H;  3KBX A;  4LF6 L;  1YBY A;  1TS5 A;  2IY5 B;  4HIK A;  3S1R H;  3AQQ A;  1EYA A;  1XPR A;  2BE5 C;  2F3V A;  3SK8 A;  1TWH B;  1B4O A;  1TKW B;  1TVX A;  1NSN S;  1TWG B;  3FRP B;  3E6Z X;  4IUN A;  4JBM A;  3Q24 A;  3J7Y W;  3NBH A;  3GTM H;  3FPP A;  1ENC A;  1HUN A;  3GP7 A;  1XXG A;  1BVS A;  4JI4 L;  4CKC A;  4DNR B;  2Z4I A;  2K33 A;  4ZRZ A;  3C1E A;  4RFB A;  2ICE C;  3PSI A;  3J80 L;  4DU9 A;  5FLM H;  1LTR D;  3ERQ A;  1Y14 B;  1U4M A;  2B8G A;  3K7A H;  1IBM L;  3HFZ B;  4ZLT F;  1NAP A;  3CCR A;  2AUK A;  3PO2 G;  1TU2 B;  1V8Q A;  3MXN B;  4JOI C;  4L5T A;  2VUM G;  3RLN A;  2PW5 A;  1CK1 A;  4O0A A;  3OTO Q;  2K5W A;  4X62 L;  1G51 A;  1STG A;  2HT1 A;  1VQC A;  3PUX A;  4ULL A;  3GTJ H;  1PHJ A;  2KCM A;  2K5N A;  5IT9 L;  2EXZ A;  3M4O H;  3EVQ A;  4A93 B;  4J8Q A;  3S14 H;  4AQY Q;  1VQH A;  2F1M A;  2UXB Q;  4NXN L;  5IYD H;  1LT3 D;  1EIF A;  3N6R A;  4CDF C;  1PMR A;  3SVM A;  3M3Y H;  3DEP A;  4JBK A;  1GUO A;  3OSO A;  3JAM c;  4X3S A;  4BY1 G;  1EY6 A;  2C9O A;  3G48 A;  4DUZ L;  1JWS D;  4GZY C;  1M1K C;  2Y0S B;  3J81 i;  5IYB G;  4DV2 L;  3MFY A;  2JA6 B;  5M3M B;  4A3C G;  2E2I H;  3CCE A;  1YNJ C;  2I5L X;  3NSW A;  1KC8 C;  4DXF A;  1HUM A;  2VW9 A;  2RBM A;  1HPC A;  1EWH A;  2HIX A;  3EN2 A;  2MHV A;  1TS3 A;  3K80 C;  5D14 A;  2CW0 C;  3QO2 A;  1HA5 A;  3RZO B;  1BBW A;  5E4W C;  4OWX B;  3FKI G;  3M4Y A;  4YWK A;  3HOZ B;  4CDE C;  5EQ0 A;  1Q7Y C;  1KDC A;  1HR0 L;  3QOL A;  4A3I H;  4EVO A;  1PTO D;  4X62 Q;  4K5W A;  4KJO A;  3KFU A;  1KLU D;  3L0O A;  4IOA A;  4MNO A;  5J22 A;  2B2W A;  2VB3 X;  3KLR A;  1HZA A;  5IYC H;  4X64 Q;  2SNM A;  2X6G A;  3IL8 A;  4IOC A;  3JC6 6;  2KUM A;  1A63 A;  1VQA A;  1NUC A;  2CWA A;  3NBH B;  4XDX A;  1PXU A;  1PYS B;  3TZD A;  4LF4 L;  4IFD I;  3I4N G;  3T1Y Q;  1XNQ L;  1JOQ A;  4YY3 L;  5IIF A;  1XNR Q;  1JE4 A;  1YHB A;  3F2D A;  4YCV A;  1Y1V H;  1EY8 A;  1O80 A;  1E3P A;  4DV6 L;  3IKJ A;  4A3D B;  1DON A;  2NZ1 D;  2YV5 A;  5C3X A;  5IT9 c;  2DJG C;  2RSO A;  5IGD A;  4KHP L;  3CP0 A;  2KEN A;  4BBS G;  1X32 A;  1JIC A;  4A3G H;  2D2C C;  3VR6 A;  2F0O A;  5KEE A;  1F77 A;  3A0J A;  1MD2 D;  2YTX A;  4JYA Q;  3CKI B;  3M3Y B;  1H9M A;  1W2B A;  1PLF A;  1PH5 A;  3DWQ A;  1CA5 A;  1X6O A;  2JA5 G;  4LFB Q;  2B29 A;  4JI7 L;  3K5M A;  1TWC H;  2J0T D;  1BXT A;  1Q8I A;  4Y52 H;  1QE6 A;  3W3A A;  3U50 C;  1RTO A;  2F4V Q;  4NW2 A;  1FD7 D;  1WTH A;  1VF7 A;  4Q5V A;  1S5E D;  4XTC S;  2IL8 A;  1YIJ A;  2EYH A;  4C3J G;  1JQY D;  2A1A A;  4LF8 Q;  3GTQ B;  4ME5 A;  1STH A;  1WTR A;  5COY A;  3MXU A;  1Y1W G;  5GRO A;  3PO3 H;  1X3E A;  4PV1 C;  2NN6 I;  3W1G A;  1HTL D;  4A3I B;  1PH9 A;  4TKO B;  4BBR H;  2M9V A;  1MBY A;  4RHS A;  4BWG B;  1S72 A;  3UDF A;  1HNZ L;  4MZ9 A;  4GOP C;  4ODG A;  1F9Q A;  3SE0 A;  2IT1 A;  2F3I A;  2ZTD A;  1SE4 A;  4P2C B;  1HJP A;  4OO1 G;  5E7N A;  4DR5 Q;  5IT9 E;  3GTO H;  1MJC A;  2GVB A;  4H13 C;  2IHF A;  1O78 A;  4LFB L;  4DAV A;  1RDP D;  1SYG A;  1BQQ T;  1II3 A;  4CJ2 C;  3H91 A;  2H1E A;  3HRZ C;  1IW7 D;  4OON A;  1MIU A;  2B2U A;  3D6C A;  4IQZ A;  4OX9 Q;  2PI2 E;  3OWF A;  1EY9 A;  3U9O A;  2KEE A;  4PNY A;  1A15 A;  2PPB C;  3UDX A;  4XT3 B;  5CV6 A;  5DNF A;  2F0I A;  2NVQ B;  4HSP A;  2HD3 A;  4QUF A;  5D65 A;  2GN5 A;  3PF4 A;  3J80 E;  1PYB A;  1KTK A;  3GV3 A;  1EQR A;  4KV6 A;  2Q2H A;  5JPN C;  2QCP X;  2RKS A;  3UE0 A;  3BG3 A;  1IBK L;  2BDO A;  1STE A;  5LMU L;  3QOJ A;  4J6H A;  4HCE A;  2OF1 A;  2E2I B;  3ZYY X;  5KNC A;  3JAM E;  2N88 A;  3FVQ A;  4HSV A;  4EGV A;  1C0A A;  3M7G A;  4X6A H;  1K0S A;  2I07 B;  3B6Y A;  3C1F A;  1SYD A;  1K8O A;  4L8J A;  3VR5 A;  2D9U A;  2B2Y C;  3CCS A;  4IO9 A;  2A6H D;  1SBB B;  2F0S A;  3KDF B;  4CKE A;  3CCL A;  4RGN A;  1N36 L;  1PZI D;  1KLG D;  5FLX E;  4AQY L;  2NVT B;  1O7I A;  2VUM B;  1SNQ A;  2KHS A;  4DR7 Q;  4DV3 L;  1E1O A;  3OIP A;  1B9M A;  2MUY A;  5H1S E;  1PFM A;  1B8A A;  3CCQ A;  2B39 A;  1YZ6 A;  4XQQ A;  3I90 A;  4C2M H;  3FPU B;  2PW7 A;  1LTS D;  1SMY C;  3CC4 A;  4MTK A;  3S14 B;  4KI0 A;  1VQN A;  2Z8L A;  3VR2 A;  2H5X A;  2CHB D;  3NE5 B;  3BYT B;  4MIU A;  1CQV A;  3AMU A;  1H95 A;  1S4Z A;  1V1P A;  2Y0S G;  3K5O A;  2VQE Q;  2ASB A;  4MN3 A;  1PZK D;  1KNE A;  2EYJ A;  4YHH Q;  2JA6 G;  4NPS A;  4OIJ A;  5M3M G;  3PO2 H;  1XMO Q;  2WAQ B;  1PDQ A;  1OXS C;  3GTM B;  3PF5 A;  3I3C A;  1JWU D;  3GV6 A;  1H9R A;  3GTK B;  1HNW L;  2Z4H A;  1AEX A;  1I4H A;  1VQ6 A;  3EFX D;  2G5D A;  4G4K A;  3Q8D A;  1GOZ A;  2MP1 A;  5M5Y B;  2JSO A;  4GNX A;  2BCO A;  2BE5 D;  3VR3 A;  5EPL A;  5IYD G;  1X3G A;  1B7Y B;  3HOZ G;  4TVA B;  5FLX L;  3A8K E;  4X65 Q;  1GUG A;  3P75 A;  3RR5 A;  2JJQ A;  4OHJ A;  1JJ2 A;  1SE8 A;  1GVP A;  3S16 H;  3CC2 A;  4WJ3 M;  2X6L A;  3MXG A;  5C4Z A;  3DHQ A;  3SR1 A;  3VR4 A;  2B2T C;  1H9K A;  5DM7 3;  1K8G A;  3V96 A;  3W5O A;  4FXK C;  1BR9 A;  3QJY A;  4K5X A;  1E24 A;  2FIN B;  3I72 A;  1Y1W B;  5C44 B;  4DV4 L;  2WAQ E;  3HOW G;  2L5T A;  1SYE A;  3CCJ A;  5ELN A;  1YJN A;  1Q82 C;  4A93 H;  4A3B H;  2ZXP A;  2ZXO A;  5GQO A;  2Y0S E;  4JI7 Q;  4CJ1 B;  3S17 H;  1GHK A;  4PZ8 A;  1BBU A;  3NWS A;  3PIP 3;  1B3Q A;  1Q86 C;  4KMU C;  3ONA B;  4PMB A;  3UDG A;  3J7A V;  3RNU A;  5E4X A;  1WTW A;  1SSO A;  4J1M A;  1F2Z A;  3GTL H;  3I7F A;  1E1T A;  2RA4 A;  1LTB D;  5IGB A;  2MNA A;  2HQE A;  3ITP A;  3OW7 A;  4L5R C;  1A6X A;  4EQN A;  5CBE E;  1N34 Q;  2NTS A;  3BS1 A;  5T1I A;  1I4G A;  1U5K A;  2EDG A;  2F0J A;  2PO4 A;  4YCW A;  4HJ8 A;  1XMQ L;  2EZV A;  4JV5 Q;  3SEB A;  4G7Z C;  1DOK A;  3KF6 B;  2FFK B;  3PIO A;  4DR3 L;  5EPJ A;  1STY A;  1KQS A;  5KNB A;  3M4Q A;  1I6V C;  1ENF A;  2KHI A;  4K6D A;  3RMH A;  1WTV A;  1HFN A;  3HOW H;  5GAE C;  4JI6 L;  4PZ6 A;  4IJH A;  4F8M A;  2D62 A;  1VQ4 A;  4N8X 1;  1LTL A;  2FHT A;  1D8L A;  1S5B D;  2XRQ D;  1AE3 A;  4RH6 A;  2JA7 H;  4A3B G;  1HNX L;  4DNT B;  5LMN W;  1AE2 A;  2WIN B;  4JVZ A;  1O7L A;  5C3E H;  4A3F B;  5JAV A;  1LO5 D;  4R8N A;  1XWE A;  1VQ7 A;  4UHV A;  4WOR A;  5FLM G;  3T56 B;  4L6T B;  4DR1 Q;  2K14 A;  4H7B A;  1VQ8 A;  3KOJ A;  2Q2U A;  1KL9 A;  1DM0 B;  4DUZ Q;  5CR3 A;  4OEL B;  3CQZ H;  3AFQ A;  2K04 A;  2HIV A;  3ERO A;  5C44 G;  4IFD G;  2KA7 A;  3H09 A;  4A3M G;  1X56 A;  4JPB W;  1TT2 A;  1J6Q A;  4G7H C;  4PMC A;  3TP7 A;  2R7D A;  2NZH A;  4XYQ A;  1K3B C;  1V9P A;  1N36 Q;  2I46 A;  2MPM A;  1SRU A;  1KRT A;  3ER0 A;  3URY A;  3D4R A;  3C3L A;  4V19 0;  1NMF A;  1MGS A;  2A6H C;  1YEZ A;  4N9T A;  2CQO A;  2L0C A;  1VQE A;  5ELC A;  4AYB E;  4B3M Q;  3FKI H;  2HHH L;  1UUP A;  3NHH A;  1VF5 C;  3KJP A;  2PQA B;  1S3O A;  1S5D D;  4HAE A;  1SND A;  1LLR D;  4IUR A;  1Q46 A;  5E1F A;  1TWH H;  1WCM H;  3H3V H;  3LX0 A;  2Z9H A;  3STB D;  2LSS A;  1AN8 A;  3QWN A;  4YY3 Q;  1ONL A;  1IZ6 A;  4KKS A;  4NXN Q;  1NY4 A;  4DPG A;  5LL6 X;  1KDB A;  3K8A A;  5C3E G;  1XPO A;  1W6K A;  4GKK L;  5CMD A;  3F2C A;  3VYS A;  3JAM L;  4ILW A;  3VYU A;  4HJA A;  2RVL A;  1CFM A;  1PV4 A;  3TS0 A;  1G2T A;  3J81 c;  3DM1 A;  3I4N H;  5FKA C;  1DD2 A;  1WFQ A;  2WP8 J;  4LAA A;  2PCF B;  5M5W B;  1J5E L;  1IW7 C;  4DR6 Q;  4OWW B;  4KY5 A;  1CKO A;  1SNP A;  4IJL A;  2VQF L;  4BY1 H;  4X3K A;  2XVS A;  1PYW D;  1K28 A;  2FMC A;  4B3M L;  3OMC A;  5BR8 Q;  1LAB A;  1HR0 Q;  5C0X G;  3BZD B;  2N78 A;  2G9D A;  4A3M B;  1Y8O B;  2L12 A;  3N52 A;  1H9S A;  3K57 A;  4BY1 B;  1U4P A;  1GXD C;  2UXD L;  2K1B A;  1WJJ A;  1EQV A;  5DAU A;  4BBR B;  4DNI A;  3BDL A;  1BCP D;  1PRT F;  3W2D A;  2ZM6 Q;  5ELF A;  2R7Z H;  3PUY A;  1SRO A;  3KYH C;  5M5W H;  1G29 1;  1SN8 A;  1Q3L A;  1NCV A;  1TWA H;  5GAH C;  4R4C A;  4DR5 L;  5IWA Q;  2TSS A;  2HQL A;  4JI3 L;  3HOW B;  2AQ1 B;  1G6Z A;  3FDT A;  3BDO A;  1PVO A;  4JYA L;  4OO1 H;  1CKN B;  3KDF A;  2HCC A;  1K8A C;  3A56 A;  1OXT A;  3BVG A;  3KLW A;  2N8N A;  3I4M H;  4CHT B;  4A3F G;  2CH4 W;  1OXX K;  2AWO A;  4UAI A;  4B08 A;  1V43 A;  5BR8 L;  1PRT C;  1FVI A;  1PFB A;  2NN6 H;  2YTY A;  4QY7 A;  2HDM A;  3TBI B;  5F2D A;  3Q0A A;  4N8F A;  1JOO A;  3A8I E;  1TII D;  1IBL Q;  3D0F A;  1CUK A;  3D4W A;  2BA1 A;  2KCN A;  4K0K L;  2K5D A;  4MTN A;  2AQ2 B;  3S16 B;  4R4T A;  4I7A A;  1HA6 A;  1KAW A;  1EWC A;  3I55 A;  3GTO B;  4RHR A;  1EZ8 A;  2RHQ B;  1YJW A;  2KVM A;  4IUT A;  3SXH A;  3LNN A;  4JC0 A;  4LF6 Q;  5ELO A;  4RGO S;  1EFI D;  3U4V A;  1BOS A;  4QL5 A;  4LF9 L;  4KD4 A;  5EPK A;  1AZQ A;  1VQK A;  4O42 A;  2JA5 B;  4FVM A;  5DM6 3;  1EFW A;  1WTP A;  4P74 A;  1GJX A;  1CT1 D;  1EOT A;  3RZD H;  4R4O A;  4A3B B;  1KIX A;  4DKA C;  2QF7 A;  1GM5 A;  5K36 H;  4NB3 A;  2EJF C;  4HJ9 A;  3OIQ A;  4OX9 L;  4BBR G;  3C2P A;  2JYO A;  1AFP A;  3BDC A;  2F3W A;  2RCN A;  4FXG C;  3SK4 A;  2J7Z A;  1FGB D;  2R6G A;  3LWE A;  1LTG D;  3I2Z A;  2PQA A;  4IUP A;  2XRS D;  1OXU A;  1H9S B;  1VS0 A;  4B3T Q;  3TP5 A;  3T16 A;  4IPC A;  2F0Q A;  5M5X B;  4KJN A;  5C0X J;  3KK7 A;  2IWH A;  1PA6 A;  2BH8 A;  1SE3 A;  3HOY H;  5CV7 A;  3D8G A;  4DN4 M;  5G3L D;  5KYI A;  5C0X H;  1U4L A;  4B9W A;  4M1U B;  2N3S A;  4IPG A;  1C8C A;  2ICI A;  4APV A;  2KCC A;  5LHY 1;  4R4Q A;  5COR A;  2PQE A;  1U9R A;  3CD6 A;  3L2P A;  3EBE A;  2B2V A;  2WV6 D;  1HQM C;  4L5S A;  4B9X A; 
#chains in the Genus database with same CATH homology
 2MGS A;  4XIG S;  4E6I A;  1I3Q B;  3NQI A;  2B2V C;  5K36 G;  3MHB A;  4YIJ A;  1CHQ D;  1EEF D;  3MAQ A;  1F9S A;  3H6M A;  1WD1 A;  5C0X I;  2E75 C;  2QIL A;  4DF7 A;  4U68 A;  1SDF A;  3CRK C;  1A3V A;  3R93 A;  2F0N A;  4F7X A;  3NTK A;  3L9A X;  3NTI A;  1PFN A;  1TR5 A;  1JCK B;  2KOL A;  5CV5 A;  1RHP A;  4KKU A;  3MC0 B;  3CQZ B;  1TWF B;  3MWY W;  2K5Q A;  2QDB A;  3G6J B;  4IN3 A;  1BBX C;  3SK6 A;  2F0F A;  2KJX A;  3K5N A;  3Q23 A;  1Z7T A;  1F2Y A;  1HFG A;  3QG1 A;  3HS0 C;  2MJ8 A;  4A3G B;  1SFO B;  1EY4 A;  1BCP C;  4JBW A;  1SNM A;  1ENA A;  1B50 A;  1EY5 A;  1NR2 A;  2KQ3 A;  4KN7 C;  5BN5 A;  2JEA I;  2NTT A;  1ESR A;  3S17 B;  2XWB B;  1SMY D;  2WAC A;  2NUC A;  2EYP A;  3A7L A;  3R3O A;  4DA2 A;  1WTQ A;  2K32 A;  1B1Z A;  3G7L A;  1Z6H A;  4QF4 A;  1L0Y B;  1ILP A;  3D31 A;  2RDF A;  1ZYR D;  2VXW A;  1D1K A;  1BCP B;  2M00 A;  4K6L A;  5C4H A;  3IFT A;  3S2D B;  2E74 C;  4U67 3;  3K5L A;  1A3T A;  5AFW A;  3BYY B;  2JE6 I;  1Q1B A;  1HTP A;  1T5X D;  3MTS A;  5J1Z A;  3U9S A;  5C3W A;  1IHZ A;  3P1H A;  3SK5 A;  2GA4 B;  3FMC A;  2WKD A;  3FEW X;  1EU4 A;  4FXD A;  2IW3 A;  4BS9 A;  4OIK A;  3K0Y A;  4BA2 I;  3O13 A;  2B8F A;  2IPK D;  1YNJ D;  1DYQ A;  2H4O A;  1X3P A;  2SOB A;  2F0H A;  2QKI C;  1AZP A;  4KK7 A;  5EBC A;  1G91 A;  2PMZ B;  5FO9 B;  4IZ8 A;  3HG9 A;  1E2Z A;  2DN8 A;  1FNV A;  2IX0 A;  4ZQ3 A;  1D6E C;  2B63 B;  1SAP A;  1OXV A;  2JA8 B;  2L11 A;  4K2L A;  5TSS A;  4C3H B;  2WB1 B;  5JEA H;  4Y7N B;  2TMP A;  1J8I A;  1OO9 B;  4DK0 A;  4RCN A;  1LAC A;  4FNF A;  1CQF A;  5ELD A;  1Y1V B;  4C2M B;  1K83 B;  2PZW A;  1QNK A;  4IUV A;  1KAB A;  1FR3 A;  5JJZ A;  1B53 A;  1IL8 A;  4ZKB B;  3NQT A;  4H0L C;  3L7Z C;  2CQA A;  4DAP A;  3PUZ A;  4X3T A;  1RJT A;  1ZYR C;  2NB0 A;  2O4X A;  1FYC A;  1NR4 A;  4BA1 I;  2IX3 A;  1ML0 D;  5IOD A;  2R7Z B;  1CI3 M;  3V05 A;  2F0D A;  3TSS A;  3I73 A;  5A2Q E;  5EKL A;  4XYO A;  3K6O A;  4KTA A;  5KYL A;  3DUZ A;  3IFD A;  4S3S A;  1F2M A;  3S1R B;  1FNW A;  1EZ6 A;  1HXY D;  1UAP A;  2D5D A;  2YYZ A;  3NPP A;  2R92 B;  4QIW B;  4IAL A;  5EKK A;  4PMW A;  3HOX B;  4V0B A;  4OGQ C;  5K5P A;  4FF4 A;  2K7V A;  2JEB I;  1QNU A;  1I50 B;  3MZ5 A;  3VA7 A;  3UI2 A;  5KND A;  3OHX C;  1JR0 D;  4C3H G;  3K7A B;  4KY7 A;  5DEH A;  3BVZ A;  4XQJ A;  3I8Z A;  5CV4 A;  1ZKO A;  1C48 A;  2SDF A;  2LFN A;  5C3E B;  2N55 A;  3GTL B;  2AUJ D;  2NVY B;  1LV9 A;  5JEA J;  1JOK A;  3PO3 B;  4K8I A;  4A3E B;  1I4R A;  4I65 A;  3CRL C;  5I2Y A;  1SNO A;  1Q12 A;  1V1P B;  3OOC A;  3GTJ B;  2IJ0 A;  5A35 A;  1DCZ A;  1AW7 A;  2Q8T A;  4ABN A;  1CA6 A;  1B2T A;  1M4V A;  4ZAI A;  3TP6 A;  2EYM A;  2FMM A;  1GHJ A;  5A2Q L;  4IFD H;  1MSH A;  1MI2 A;  1Y69 U;  3VA5 A;  2EJM A;  1DJR D;  1BNZ A;  5KRU A;  2F0E A;  1WCM B;  2J4X A;  1QWY A;  2DNC A;  1BCP F;  2F0M A;  2F0W A;  3D6W A;  1DXM A;  2V4D A;  3L3O C;  4KY6 A;  4O1N A;  4QUC A;  2CW0 D;  3S9W A;  5BN4 A;  2R93 B;  5J39 A;  1LT5 D;  2PZU A;  1ZXT A;  2A69 D;  2EY5 A;  3QB3 A;  1E2W A;  2SEB D;  3TDQ A;  3WOF A;  3LWU A;  1SJE D;  3KF8 A;  3MEH A;  1H9J A;  2BDN A;  3H94 A;  5FK9 C;  2A6E D;  1LT6 D;  2NWG A;  5JVH 3;  3GD7 A;  1BO0 A;  4ZYS A;  4H44 C;  1PRT D;  5ELE A;  3KLS A;  4ID6 A;  1VCI A;  4NMZ A;  3TN2 A;  4M8A A;  1DZ1 A;  1HCZ A;  1Q1E A;  4WRD A;  2FJ2 A;  3J81 L;  2IX1 A;  4HMI A;  4ZKC B;  3PMF A;  2K6A A;  2DY8 A;  5JOB A;  3NUC A;  4HN7 A;  1B3A A;  4Q0F A;  1CZW A;  1W6J A;  3NXW A;  4X3U A;  3S15 B;  1PTO F;  1R4Q B;  2XWJ B;  3NK9 A;  1ICW A;  1WVL A;  5CBA E;  2Q8R E;  2NBF A;  1BF4 A;  4IFD J;  3ND9 A;  4C56 C;  1SNC A;  2X69 A;  4TQU S;  3GTP B;  1KAA A;  5M3F B;  4I7Z C;  2AWN A;  3KLS X;  1XTC D;  4HED A;  2F0K A;  3GO5 A;  3NBI A;  5T1G A;  1GUT A;  2F4I A;  2ZT9 C;  4PQX A;  4G57 A;  3T13 A;  3MXN A;  4RKL A;  1QJO A;  1I4X A;  3H3V C;  1LT4 D;  1D5X C;  1CZG A;  3I70 A;  2EJG C;  1I6H B;  1STB A;  5EJW A;  3HP3 A;  4ZUJ A;  2DNE A;  2R61 A;  1VMC A;  1D5Z C;  2DY7 A;  1TY2 A;  1EIG A;  2M2L A;  1LTI D;  2A5H A;  4RA8 A;  4G7O C;  1L0X B;  3I4L A;  3TP8 A;  4XQN A;  1ET9 A;  4L63 B;  3RUZ A;  1CM9 A;  4K14 A;  1UNS A;  1PTO H;  3KUP A;  4IUQ A;  2B2Y A;  1V1O A;  2L1B A;  5D3I B;  2LKV A;  4BY7 B;  1AP0 A;  3DMU A;  3DXJ C;  4C1N K;  5HGT A;  1D5M C;  4ZUI A;  2VB2 X;  4KHV A;  5KGU A;  1CTM A;  2F0P A;  4K5V A;  3HOY B;  5C4J B;  1T5E A;  1YNN D;  3NP8 A;  5FO8 B;  2E2J B;  4Z9C B;  1SJH D;  3P7J A;  1EYC A;  1F2L A;  1F9R A;  1SEB D;  3CHB D;  2SNS A;  2ZXR A;  1IKL A;  3DWP A;  2EYO A;  5I6W A;  4F87 A;  5IOC A;  2HDL A;  1JWM D;  4QMG A;  3I4M B;  2EY6 A;  2XN9 C;  4FP5 D;  1DOL A;  3HGB A;  3OMG A;  3S1N B;  4WFN 3;  3M4O B;  3D4D A;  1TQO A;  5JEA G;  4HMJ A;  2A69 C;  1Y8N B;  2KED A;  5ELB A;  5E3F A;  2O5I C;  3HOV B;  2O2L D;  2F0G A;  1BDO A;  1QB5 D;  3P20 A;  4C3I B;  1ZEQ X;  1EYD A;  5NUC A;  4DXG A;  1WTO A;  1F9P A;  1TY0 A;  3RLF A;  4CJ0 B;  1DOM A;  3V2T A;  5HUR A;  2LY7 A;  1A2U A;  1G2S A;  4N9P A;  2BA0 A;  1GUW A;  1B9N A;  5CV9 A;  3SHL A;  4RCO A;  1RTN A;  1D1I A;  1JB3 A;  2CVR A;  2EVB A;  4C1N I;  3WOE A;  4DAY A;  3TZU A;  4R9W A;  1KNA A;  3QIA A;  2F0T A;  2RSN A;  3E5S A;  2E2H B;  1SYB A;  3R8B A;  1SXT A;  5IGF A;  3CU7 A;  3R2I A;  2ENB A;  3Q22 A;  2XNA C;  3S1M B;  1A2T A;  1EIH A;  2B2T A;  2EY2 A;  3A55 A;  1YNN C;  4LK1 C;  3PUW A;  4RGT A;  4BBS B;  3NWT A;  5IGC A;  1B44 D;  3T53 B;  4A3J B;  1IYV A;  4RKB A;  3E0J A;  2E2D C;  1GUS A;  4NDX A;  1JOR A;  1J9O A;  4EQP A;  1SYC A;  4NP5 A;  4KD3 A;  1PTO B;  5D3D A;  4C3J B;  3T4A C;  4MHE A;  2O5J C;  4OL7 A;  5LL6 S;  3EQL C;  3MXP A;  3OPO A;  4HR7 B;  3MA2 B;  3NTH A;  3HOU B;  1IKM A;  1JC7 A;  1I4P A;  2E76 C;  3VYR A;  1STA A;  1G8Z D;  1R9T B;  3C46 A;  1ET6 A;  2Z1C A;  1EU3 A;  1FNU A;  1QIL A;  1U4R A;  1GUN A;  2PYK A;  4LMQ D;  3J7A F;  4KHZ A;  4FYD A;  1WD0 A;  1RD9 D;  2G9H D;  5IGG A;  2L9H A;  1MSG A;  2EOT A;  2A74 C;  2A6E C;  3IAY A;  3R2T A;  2EE1 A;  1HHV A;  1SYF A;  5C5M A;  2B2U C;  3PUV A;  3ND8 A;  2A68 C;  4XT1 B;  5G3L F;  4K8J A;  3AU7 A;  5EKI A;  2EPB A;  1HQR D;  1RKN A;  4KN4 C;  4RWS C;  3VYT A;  5C6A A;  1PTO C;  3SDZ A;  1SE2 A;  4DFA A;  5I2X A;  1EL0 A;  2OT2 A;  4QB4 A;  3S1Q B;  2AQ3 B;  5IGE A;  2ID0 A;  4IUU A;  5FOB B;  1XYI A;  4F88 A;  3GQB A;  2F0L A;  3EA6 A;  3RD4 A;  1TS4 A;  1ILQ A;  4HTH A;  3X3N A;  1X3Q A;  5C4X B;  4OO1 I;  3GTG B;  4AYB B;  4JK1 C;  1BUV T;  2PZT A;  1D2B A;  2KEC A;  1XX8 A;  2L4N A;  3HEJ A;  3TME A;  2NN6 G;  2K28 A;  2RDG A;  4WJW A;  3M85 A;  2XIW A;  3T51 B;  4DK1 A;  1LTT D;  5EBD A;  5BN3 A;  2EYL A;  4C3I G;  2JXM B;  5JVG 3;  5I9O A;  1O7Z A;  1M8A A;  2PNR C;  2F0U A;  2K03 A;  3DEO A;  1PZJ D;  1I4Q A;  1TWA B;  2A73 B;  2EY1 A;  4QCL A;  5I6Y A;  2F0V A;  2Q8I B;  2C5C A;  4EQO A;  3D3R A;  1S5F D;  2QEJ C;  4FF3 A;  2LMC B;  1A3U A;  3WDN A;  3A8J E;  2LS0 1;  3BVM A;  5M9O A;  1VMP A;  2XSC A;  1Z47 A;  1RF2 D;  4RGM A;  1QOH A;  4DGZ A;  1C4Q A;  2EYF A;  5KIX A;  3A54 A;  3H0G B;  1QCB D;  2K01 A;  1EEI D;  5CGK A;  2NYZ D;  2HCI A;  1ROD A;  1LTA D;  1EY0 A;  4LJZ C;  3K59 A;  2YU9 B;  1E2V A;  3S2H B;  1UEA B;  2OXP A;  1EQT A;  5EGT A;  4A3K B;  3PIO 3;  3M7N A;  2OEO A;  4CBV A;  3K58 A;  4FF1 A;  1RCV D;  4R8I A;  2F03 A;  2RDH A;  3MVV A;  5C5L A;  4FO2 A;  3EJI A;  5CC4 A;  2RQX A;  1S5C D;  1R4P B;  1ESF A;  1QG7 A;  4HCS A;  3I91 A;  3HZX A;  5I4D A;  4UDU C;  3AB9 A;  1TS2 A;  2WKC A;  3DWA A;  1E0B A;  1PRT B;  4TSS A;  4ZK9 B;  2NVX B;  1Q90 A;  2BOS A;  1Y8P B;  4CGY B;  5FO7 B;  2R3Z A;  4RAU C;  2WII B;  3KBG A;  1WTX A;  3FKI B;  3A7A B;  1KDA A;  2HUG A;  1TWC B;  5JPM C;  1IYU A;  3PO2 B;  3MFG A;  2B2W C;  2L55 A;  1VDZ A;  3PV0 A;  3OWE B;  3X3M A;  4XXE A;  3I4N B;  5I9P A;  2JP1 A;  1HRJ A;  3RZD B;  4K2K A;  2A68 D;  3J81 E;  4NKL A;  1O7Y A;  4CKB A;  5CV8 A;  2K05 A;  3F2U A;  4FF2 A;  2JA7 B;  4TRD A;  3HKZ B;  1K8M A;  5CYU A;  1EY7 A;  3Q6S A;  2VNU D;  5ISR A;  1CHP D;  4KKT A;  1STN A;  3KBX A;  1TS5 A;  1EYA A;  2BE5 C;  2F3V A;  3SK8 A;  1TWH B;  1B4O A;  1TKW B;  1TVX A;  1NSN S;  1TWG B;  3FRP B;  3E6Z X;  4IUN A;  3Q24 A;  3J7Y W;  3NBH A;  3FPP A;  1ENC A;  1HUN A;  3GP7 A;  1XXG A;  4CKC A;  4DNR B;  2Z4I A;  2K33 A;  4ZRZ A;  3C1E A;  4RFB A;  2ICE C;  3J80 L;  4DU9 A;  1LTR D;  3ERQ A;  1U4M A;  2B8G A;  4ZLT F;  1NAP A;  2AUK A;  1TU2 B;  1V8Q A;  2PW5 A;  1CK1 A;  2K5W A;  1STG A;  3PUX A;  4ULL A;  5IT9 L;  2EXZ A;  3EVQ A;  4A93 B;  4J8Q A;  2F1M A;  1LT3 D;  3N6R A;  1PMR A;  3SVM A;  3DEP A;  1GUO A;  3OSO A;  4X3S A;  1EY6 A;  2C9O A;  4GZY C;  1JWS D;  2Y0S B;  3MFY A;  2JA6 B;  5M3M B;  1YNJ C;  3NSW A;  4DXF A;  1HUM A;  2RBM A;  1HPC A;  1EWH A;  2MHV A;  1TS3 A;  5D14 A;  2CW0 C;  3QO2 A;  1HA5 A;  3RZO B;  5E4W C;  3M4Y A;  3HOZ B;  5EQ0 A;  1KDC A;  3QOL A;  4EVO A;  1PTO D;  4K5W A;  4KJO A;  1KLU D;  5J22 A;  2B2W A;  2VB3 X;  3KLR A;  2SNM A;  2X6G A;  3IL8 A;  2KUM A;  1NUC A;  4XDX A;  1PXU A;  3TZD A;  4IFD I;  1JOQ A;  5IIF A;  1JE4 A;  1EY8 A;  1O80 A;  3IKJ A;  4A3D B;  1DON A;  2NZ1 D;  5C3X A;  2RSO A;  5IGD A;  1X32 A;  1JIC A;  2D2C C;  3VR6 A;  2F0O A;  5KEE A;  1F77 A;  1MD2 D;  3CKI B;  3M3Y B;  1H9M A;  1PLF A;  3DWQ A;  1CA5 A;  3K5M A;  2J0T D;  1BXT A;  1Q8I A;  1QE6 A;  3W3A A;  1RTO A;  4NW2 A;  1FD7 D;  1VF7 A;  4Q5V A;  1S5E D;  4XTC S;  2IL8 A;  2EYH A;  4C3J G;  1JQY D;  3GTQ B;  4ME5 A;  1STH A;  1WTR A;  5COY A;  3MXU A;  4PV1 C;  2NN6 I;  1HTL D;  4A3I B;  4TKO B;  2M9V A;  1MBY A;  4RHS A;  4BWG B;  4ODG A;  1F9Q A;  3SE0 A;  2IT1 A;  1SE4 A;  4P2C B;  4OO1 G;  5IT9 E;  4H13 C;  1O78 A;  4DAV A;  1RDP D;  1SYG A;  1BQQ T;  1II3 A;  4CJ2 C;  3H91 A;  2H1E A;  3HRZ C;  1IW7 D;  2B2U A;  3D6C A;  4IQZ A;  3OWF A;  1EY9 A;  3U9O A;  2KEE A;  4PNY A;  1A15 A;  2PPB C;  4XT3 B;  5CV6 A;  5DNF A;  2F0I A;  2NVQ B;  4HSP A;  4QUF A;  5D65 A;  3J80 E;  1KTK A;  3GV3 A;  4KV6 A;  5JPN C;  2QCP X;  2RKS A;  3BG3 A;  2BDO A;  1STE A;  3QOJ A;  4J6H A;  4HCE A;  2OF1 A;  2E2I B;  3ZYY X;  5KNC A;  3JAM E;  2N88 A;  4EGV A;  3FVQ A;  4HSV A;  3M7G A;  2I07 B;  3C1F A;  1SYD A;  1K8O A;  4L8J A;  3VR5 A;  2D9U A;  2B2Y C;  2A6H D;  1SBB B;  2F0S A;  4CKE A;  4RGN A;  1PZI D;  1KLG D;  5FLX E;  2NVT B;  2VUM B;  1SNQ A;  2KHS A;  3OIP A;  1B9M A;  2MUY A;  1PFM A;  2B39 A;  4XQQ A;  3I90 A;  3FPU B;  2PW7 A;  1LTS D;  1SMY C;  3S14 B;  4KI0 A;  2Z8L A;  3VR2 A;  2CHB D;  3NE5 B;  3BYT B;  4MIU A;  1CQV A;  3AMU A;  1S4Z A;  1V1P A;  3K5O A;  4MN3 A;  1PZK D;  1KNE A;  2EYJ A;  4OIJ A;  2WAQ B;  1PDQ A;  1OXS C;  3GTM B;  3I3C A;  1JWU D;  3GV6 A;  1H9R A;  3GTK B;  2Z4H A;  1AEX A;  1I4H A;  3EFX D;  4G4K A;  1GOZ A;  2MP1 A;  5M5Y B;  2JSO A;  2BCO A;  2BE5 D;  3VR3 A;  5EPL A;  5FLX L;  3A8K E;  1GUG A;  3P75 A;  4OHJ A;  2X6L A;  3MXG A;  5C4Z A;  3DHQ A;  3SR1 A;  3VR4 A;  2B2T C;  1H9K A;  5DM7 3;  3V96 A;  4FXK C;  1BR9 A;  3QJY A;  4K5X A;  2FIN B;  3I72 A;  1Y1W B;  5C44 B;  2L5T A;  1SYE A;  2ZXP A;  2ZXO A;  4CJ1 B;  1GHK A;  3NWS A;  3PIP 3;  4KMU C;  3ONA B;  4PMB A;  3J7A V;  5E4X A;  1WTW A;  1SSO A;  4J1M A;  1F2Z A;  2RA4 A;  1LTB D;  5IGB A;  2HQE A;  3ITP A;  3OW7 A;  1A6X A;  4EQN A;  5CBE E;  2NTS A;  3BS1 A;  5T1I A;  1I4G A;  2EDG A;  2F0J A;  2PO4 A;  2EZV A;  3SEB A;  4G7Z C;  1DOK A;  2FFK B;  5EPJ A;  1STY A;  5KNB A;  1I6V C;  1ENF A;  4K6D A;  3RMH A;  1WTV A;  1HFN A;  4F8M A;  2D62 A;  2FHT A;  1S5B D;  2XRQ D;  4RH6 A;  4DNT B;  2WIN B;  1O7L A;  4A3F B;  5JAV A;  1LO5 D;  4R8N A;  1XWE A;  4WOR A;  3T56 B;  4L6T B;  4H7B A;  1DM0 B;  5CR3 A;  2K04 A;  3ERO A;  4IFD G;  2KA7 A;  3H09 A;  1TT2 A;  4G7H C;  4PMC A;  3TP7 A;  4XYQ A;  2I46 A;  2MPM A;  3URY A;  3D4R A;  3C3L A;  4V19 0;  1MGS A;  2A6H C;  4N9T A;  2L0C A;  5ELC A;  1UUP A;  3NHH A;  1VF5 C;  1S5D D;  4HAE A;  1SND A;  1LLR D;  4IUR A;  5E1F A;  3LX0 A;  1AN8 A;  3QWN A;  1ONL A;  4KKS A;  5LL6 X;  1KDB A;  1W6K A;  5CMD A;  3VYS A;  3JAM L;  4ILW A;  3VYU A;  2RVL A;  1CFM A;  1G2T A;  3DM1 A;  5FKA C;  1DD2 A;  2WP8 J;  4LAA A;  2PCF B;  5M5W B;  1IW7 C;  4KY5 A;  1SNP A;  4X3K A;  2XVS A;  1PYW D;  2FMC A;  3OMC A;  1LAB A;  5C0X G;  3BZD B;  2G9D A;  4A3M B;  1Y8O B;  2L12 A;  3N52 A;  1H9S A;  3K57 A;  4BY1 B;  1U4P A;  1GXD C;  2K1B A;  1EQV A;  5DAU A;  4BBR B;  3BDL A;  1BCP D;  1PRT F;  3W2D A;  5ELF A;  3PUY A;  1G29 1;  1Q3L A;  1NCV A;  2TSS A;  3HOW B;  2AQ1 B;  1G6Z A;  3FDT A;  3BDO A;  4OO1 H;  2HCC A;  1OXT A;  3A56 A;  3BVG A;  4CHT B;  1OXX K;  2AWO A;  4UAI A;  4B08 A;  1V43 A;  1PRT C;  1PFB A;  2NN6 H;  2HDM A;  3TBI B;  5F2D A;  3Q0A A;  1JOO A;  3A8I E;  1TII D;  3D4W A;  2BA1 A;  2KCN A;  2K5D A;  2AQ2 B;  3S16 B;  1HA6 A;  1EWC A;  3GTO B;  4RHR A;  1EZ8 A;  2KVM A;  4IUT A;  3SXH A;  3LNN A;  4RGO S;  1EFI D;  1BOS A;  4KD4 A;  5EPK A;  1AZQ A;  4O42 A;  2JA5 B;  4FVM A;  5DM6 3;  1WTP A;  1GJX A;  1CT1 D;  1EOT A;  4A3B B;  2QF7 A;  5K36 H;  2EJF C;  3OIQ A;  3C2P A;  2JYO A;  1AFP A;  3BDC A;  2F3W A;  4FXG C;  3SK4 A;  2J7Z A;  1FGB D;  2R6G A;  3LWE A;  1LTG D;  4IUP A;  2XRS D;  1OXU A;  1H9S B;  3TP5 A;  3T16 A;  2F0Q A;  5M5X B;  4KJN A;  5C0X J;  3KK7 A;  2IWH A;  1SE3 A;  5CV7 A;  3D8G A;  4DN4 M;  5G3L D;  5KYI A;  5C0X H;  1U4L A;  4B9W A;  4M1U B;  1C8C A;  2ICI A;  2KCC A;  5LHY 1;  5COR A;  2PQE A;  1U9R A;  2B2V A;  2WV6 D;  1HQM C;  4B9X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...