4X3UA

Crystal structure of chromobox homolog 7 (cbx7) chromodomain with suramin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
FAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Chromobox protein homolog 7
publication title Small-Molecule Modulators of Methyl-Lysine Binding for the CBX7 Chromodomain.
pubmed doi rcsb
source organism Mus musculus
total genus 12
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4x3uA00
4HEDA 1EIHA 2RA4A 2MJ8A 1WTOA 1PDQA 1BBXC 4QUCA 2B2WC 2JYOA 2VXWA 3D6WA 4OIKA 1QE6A 2EOTA 4XT1B 3KBXA 1G91A 2CVRA 1BF4A 4DN4M 1QNKA 2FHTA 5AFWA 1X3PA 1EIGA 2KECA 2NZ1D 3P7JA 4CJ0B 4HAEA 1F9QA 1BO0A 1NCVA 2J7ZA 3H91A 1XYIA 4RA8A 4RWSC 1HHVA 2FJ2A 1SAPA 2B2UC 1HUMA 2K01A 2H1EA 4CJ1B 1PLFA 1B2TA 2DY7A 1RTNA 2B2VC 1RTOA 4X3TA 3R93A 2L11A 1WTVA 2N55A 1WTXA 1B4OA 4X3KA 5EPLA 1NAPA 5EKIA 5EPKA 2NYZD 1NR4A 1F9PA 1PFNA 2N88A 3UI2A 2DY8A 2D9UA 2M2LA 1E0BA 1QG7A 3HP3A 5T1IA 1BNZA 1TVXA 2KUMA 1AP0A 1ILQA 3SVMA 1CA5A 1EQTA 2X6GA 4NW2A 4X3UA 5T1GA 1DOKA 1B3AA 1ESRA 1J8IA 1M8AA 2K03A 2L4NA 2Q8TA 1DZ1A 1NR2A 2JP1A 1A15A 1JE4A 2EE1A 1ZXTA 2IL8A 2EPBA 2RSNA 2X6LA 3N52A 4IUVA 4LMQD 2B2TC 3TN2A 1AZQA 5EQ0A 1KNEA 2B2TA 3MWYW 1X3QA 3DEPA 1AZPA 1U4MA 2HCIA 3QO2A 1C8CA 3IFDA 2NWGA 1DONA 1DOLA 2KEDA 4HSVA 4MHEA 4UAIA 5E4WC 1B50A 3Q6SA 1G2SA 4U68A 1VMCA 1O7YA 4R8IA 1IKMA 2R3ZA 2FINB 3I3CA 1DOMA 1B53A 5CBEE 2K05A 1WTPA 1CA6A 3ONAB 1G2TA 1G6ZA 1HA6A 2FFKB 1RODA 1JICA 3FPUB 2HDLA 4RAUC 5COYA 5E4XA 1XX8A 2K28A 2L12A 1S4ZA 1F2LA 1MGSA 2HCCA 2L9HA 1MI2A 2MPMA 3LWEA 4QUFA 1KNAA 3I90A 1GUWA 1O80A 2XIWA 2X69A 1MSGA 1ML0D 4HCSA 4ZKCB 1U4LA 4ZKBB 1ILPA 1IL8A 2KVMA 1HFGA 2B2YA 1F9SA 2SDFA 4XDXA 1RHPA 4XT3B 1WD0A 1SSOA 4IUQA 3KUPA 4IUTA 1MSHA 3DM1A 1J9OA 1F9RA 5JJZA 1HRJA 3GV3A 3I8ZA 4IUUA 2BDNA 4MN3A 2KEEA 1EL0A 3G7LA 5CBAE 5DNFA 4R9WA 2B2WA 3FDTA 1WTRA 1LV9A 4OIJA 5EJWA 2L1BA 2KOLA 4IURA 1PFMA 1SDFA 1WTQA 1CM9A 4X3SA 5D14A 1VMPA 1PFBA 4CJ2C 2MGSA 3GV6A 5CORA 1HFNA 1WTWA 1HUNA 4ZLTF 2RVLA 2K1BA 4IUPA 3DEOA 1EOTA 1IKLA 2B2UA 4O42A 4ZK9B 5CMDA 3MTSA 2B2VA 5D65A 1RJTA 2MP1A 1ICWA 2RSOA 3IL8A 2B2YC 5EPJA 2HDMA 3TZDA 1WD1A 1U4RA 1X32A 2Q8RE 2FMMA 4ZAIA 1U4PA 2HUGA 1WVLA 2K04A 3F2UA 1O7ZA 3I91A 1Q3LA
chains in the Genus database with same CATH superfamily
1SYEA 2F0GA 4ABNA 1K28A 4OELB 4BBRG 4NXMQ 3HOZH 4KLKA 2K14A 1DGSA 1IL2A 2KECA 1KHIA 4TVAB 1STHA 4ZYSA 4JI0L 4RWSC 1TWGB 2EYJA 3I4NH 1B2TA 1PLFA 4RGMA 5IP7H 2B2VC 5GAHC 1EWHA 4I7AA 4I65A 5M5XH 1NAPA 1K8OA 2IHFA 3AMUA 1PFNA 2ASBA 1IYUA 4HIKA 4HJAA 1GUOA 2BE5D 3S16H 2F0QA 4Y7NB 4NB3A 2PQEA 5KGUA 3T51B 2UUBQ 4K0KL 3BG3A 3L2PA 1DOKA 3QOLA 3I4NB 1EFID 1SE4A 4EX5A 5FO8B 2L4NA 1XTDA 4FF4A 1TU2B 5M5XB 4FVMA 2O5JC 4FP5D 2OT2A 3A8KE 2JK8A 1SE2A 1CFMA 3CRKC 5H1SE 3S16B 1NJIC 1C8CA 3BYYB 1PH3A 1DONA 4XQJA 5EBDA 1BQQT 2XSCA 2E5LL 1JWUD 5JJKA 1D5MC 4Q0FA 2F0PA 1LTGD 3G71A 3MEHA 4R4IA 3RZDH 3KBGA 3J81E 3Q24A 3ND8A 3PO2H 1MJCA 1A62A 1PTOC 2K28A 2OEOA 1LT4D 4B3MQ 3M7GA 1LT3D 2PCFB 2JA5G 2QDBA 2B63H 3J80i 3HFZB 4ZRZA 4DK0A 5DAUA 3CCQA 2YTVA 4WRDA 4DV7L 4IUQA 1FYCA 4EQ5A 1GHJA 3DUZA 1MIUA 4OO1G 4BWGB 3RZDB 2EQSA 2F0EA 3PO2B 3I8ZA 2PQAA 3T16A 4QL5A 1KIXA 4DR3L 3RD4A 2F4VQ 4DGZA 1Q8IA 4IPHA 2B63B 4M8AA 4R4QA 1ZEQX 2QW7A 2EZVA 5BN3A 5JAVA 3BZKA 1H9SA 2NVXH 2LXKA 3FHWA 3MTSA 5GAGC 5M3MG 2JA6B 3I4MG 1BCPC 2KENA 4PMCA 4J1MA 5I2YA 2E8GA 2EY1A 4A3IB 2D0PA 2JA7G 5ELOA 4P72A 4TKOB 1Z7TA 2F4IA 5AJ3Q 5C4XG 1I4HA 4AIMA 1AEXA 4XTCS 4X6AH 3VDYA 1I4GA 1SMYC 5TSSA 3E9HA 4HCEA 3T53B 2NVXB 2WAQB 1T9HA 4KK7A 4CJ0B 2EVBA 1Y8NB 2VQFL 5IGEA 2ID0A 3SGIA 4A3LH 1Z6HA 2H1EA 2IW3A 3V96A 2DGYA 4A3DG 1WTVA 1S5DD 2EDGA 5JVG3 1M1KC 1N36Q 1VQBA 1PYSB 3GTOB 4C3HB 5CYUA 4AYBB 1Q7YC 1E0BA 1SROA 1QG7A 1GKHA 3U4ZA 1VDZA 3OSOA 4K5VA 2CKZB 4KY5A 1PH7A 3SVMA 3GTLH 1K73C 4RKLA 2K5NA 1NBWA 3D4WA 3CPWA 3KLSX 1EU3A 3HKZG 5BN5A 4GZYC 4LMQD 2RSNA 1FR3A 4OHJA 4DV5Q 2CW0D 1H9RA 1UUPA 3EQLC 1LTTD 2GN5A 1B50A 4DXFA 2IY5B 1ONLA 1YNND 1M90C 3E9IA 2OTJA 3GTLB 1IKMA 3VYSA 1K8AC 4XYOA 1QOHA 4DV3Q 1GM5A 3J81i 4LFCL 5IWAL 1VQ6A 1HR0W 1E3PA 1LTLA 2XTIA 5E4XA 1E1TA 4LF9Q 4R1JA 4JG2A 2O4XA 2XGTA 4C3JH 4JBJA 5IYBG 2LS01 3PO3H 5ELDA 1NUCA 1IBLQ 3CCUA 3TRZA 2ENBA 5HY6A 1F9RA 1LABA 3TEHB 4JI4Q 3W1GA 3HZXA 2BDNA 4BXXG 1SE8A 1VQMA 3OW7A 4R9WA 5FLXL 4AQYQ 3STBD 4JI2L 4R8NA 5D3DA 1XNQL 2R7DA 5D14A 3KYHC 1A2TA 2KCTA 3CC4A 1LO5D 3MC0B 5LMNL 1V1OA 2F3VA 4A3CH 1IKLA 5C5MA 1Q1EA 1ICWA 3CC7A 4GKJL 3S15H 2K52A 3D8GA 3DWQA 3C2PA 3ITPA 3UDGA 1GVPA 2MUYA 4GLAC 1XMOQ 1N8RC 4L5SA 4A3GH 1W6JA 2F0DA 5IT9L 4OO1I 2A6HD 3BVMA 1L0WA 1B70B 4HTHA 1PRTF 1MBYA 2A8VA 1TWFH 4JI5L 5FOBB 1ASZA 2JA8H 3HOYG 4YCWA 2HIVA 4PMBA 3K57A 1R4PB 3GTJH 2OXPA 3SDZA 4A3GB 4KN4C 3FKIH 3PV0A 3KLSA 1I94L 4IALA 4KHPQ 5FJ8G 4YY3L 3GTKH 2E2JH 2JEAI 1H95A 3NBHB 4LFBL 4A3FB 2JA8B 5CV7A 1K3RA 1KNEA 4HJ8A 4A3JB 4FF3A 4CGYB 4LUZA 3JAME 1VQOA 4DR2Q 3FKIB 2K33A 1V8QA 1FL0A 1PZID 3T13A 4CHTB 3K81C 1RD9D 3GTKB 2AKWB 2E2JB 4BBRH 1YZ6A 2FFKB 2XVSA 4OX9L 4FDBA 3O13A 2F52A 3OWEB 1SYBA 2ZTDA 4L5TA 1QUQA 4C2MH 4L6TB 3M4OH 2HCCA 1EY7A 5EAYA 1MI2A 1D8LA 3SK4A 3LNNA 2C5CA 3FVQA 1U4LA 5M5YB 5A2QL 3PUWA 1HFGA 3MXGA 4GOPA 1D7QA 1STYA 4BBSB 5KEEA 4ME5A 1A8VA 4B3RL 1NNXA 1EY5A 5JJZA 1LLRD 1BBWA 3I72A 4E6IA 4C2MB 3RLNA 5HURA 2YTYA 2WB1G 1SDFA 3H15A 2DJFC 3T1HQ 1I5FA 1OXSC 3K6OA 1UE5A 3BZCA 4J15A 3JAMc 4X62L 1DYQA 4RCOA 3T1YL 1XPRA 3ZYYX 3S2DH 1IW7C 3K5NA 2RQXA 3ULJA 4B08A 1XNRL 1IBML 2ZT9C 1U4RA 1X32A 2E2IH 1M4VA 5FO7B 4X64L 4JI0Q 5ELEA 4A3MG 4I7ZC 4KD4A 4QUCA 1JORA 4FXKC 4J8QA 4HMJA 4YHHL 1CKMA 1TS2A 1VQ8A 1L1OA 2D62A 4DN4M 1PTOF 2NZ1D 1QZGA 3MFGA 2ZJRA 1F9QA 1BOSA 2J7ZA 2JA5H 1EYDA 2AHOB 2E2IB 1IXRA 1VCIA 2UUCL 3LWUA 4K0KQ 3R93A 1WTXA 1HZ9A 2L0CA 3H0GH 4O0AA 5FLXc 4QIWE 3RUZA 3VR4A 5C3EB 3CW2C 2F0UA 4OO1H 1OO9B 1VQCA 2EYOA 1KDBA 4DV4L 3TS2A 1LYLA 4DNTB 1PYBA 4ZUIA 4EVOA 1I6VC 3PQIA 1SJED 1I4PA 4B3TL 1B9MA 1IZ6A 1NR2A 4P73A 3H0GB 4F87A 4PMWA 1FJGQ 3OHXC 2NN6I 1AN8A 2UXBQ 3I4MH 3MWYW 1BCPF 2MQHA 4GLVB 3K58A 2HCIA 2KEDA 4QQBX 5BN4A 1LTBD 3K59A 4WJ4A 1DOMA 4DV6Q 2QGQA 1RCVD 5E3FA 1EOVA 4HJ7A 4UDUC 4DV7Q 3NELA 3TP7A 1TS4A 2L12A 5NUCA 1S4ZA 2IHEA 1HNWL 3PIOA 4HMIA 1K9MC 3CRLC 4BY7G 4A3DH 1ESFA 1IL8A 2Z6KA 3KDFB 5DM63 1RF2D 3C46A 4OGQC 1PH2A 2V1CC 5ISRA 3CMEA 1CQFA 2KEEA 4B3SQ 5CBAE 1N32L 4X65Q 4DV0L 1JJCB 4X3SA 4CKEA 1GXDC 2Q2TA 1VMPA 1LTAD 2M9VA 3FRPB 5C3WA 4Y52H 4LF6L 3E6ZX 3ULPA 4DR6L 1UWVA 3J80L 1WCMG 3GTMB 3HOUB 2HDMA 4LF8L 2R7ZG 4JYAL 1R4QB 1OXTA 2MJ8A 3L9AX 3UDIA 1DXMA 3H94A 4V190 1CHQD 2A1AA 2PI2E 4A3KH 4JI6L 4HAEA 1QJOA 1EUJA 2DJGC 4KHZA 1SAPA 3VR5A 1HUMA 1SYDA 5C3XA 4DV2L 5EPLA 4IFDI 2E2HB 3W1BA 1QNUA 2BA0A 4GS3A 3S14H 4A3KB 5T1IA 1I4QA 4KKUA 1X3FA 3SK5A 3V2TA 1VF5C 1PVOA 2NZHA 1ILQA 3KFUA 2MHVA 1JR0D 3CAMA 4JV5Q 1EY8A 4H7BA 1A15A 2QEJC 5KNBA 1SXTA 4BY1G 1AZQA 5EQ0A 1I3QH 4K14A 3NQTA 3RNUA 3S14B 1YHAA 1DOLA 3OOCA 4LW1A 1GUTA 2XRSD 1VQEA 5DLQE 1JCKB 4N8FA 2NN6H 4FO2A 3EROA 3F2DA 3MAQA 5COYA 2SEBD 4P2CB 1I3QB 3CCMA 1Y1VB 4JI3L 1ML0D 4H02A 4YWMA 2Q2HA 5IGBA 3OIPA 2SDFA 2RDHA 3GTPH 1WI5A 2DUDA 2EYPA 3AFPA 3HOYH 1SNPA 2B2WA 4K6LA 3J81L 1J6QA 4EQNA 2Q2UA 4IPGA 2UU9Q 2MO0A 4DPGA 2BH2A 5E1FA 5FJ8H 4LF4L 4LF5Q 2D2CC 5JEAJ 3GTPB 3G6EA 1L2FA 1YJ9A 3T56B 1SE3A 5EPJA 3D4RA 5IYCH 3RLFA 2I0QA 2VQEQ 1EQRA 3I91A 1D6EC 4JBWA 4AH6A 3CU7A 1PDQA 4DNRB 1J5EL 2EYHA 3S1MB 1UE7A 2F0IA 2R61A 3KBXA 2HD3A 4WJ3M 2PW7A 4L5QA 1NCVA 3OWFA 1B1ZA 4JBMA 2R93H 3TSSA 4UP7A 5IGDA 2Y0SG 2BE5C 3VR6A 2LKVA 4KJOA 4YY3Q 2VB2X 1VQPA 4HIDA 1RIPA 1V43A 4QIWB 2QCPX 3K80C 3TP5A 4B9XA 4LWCA 3VYUA 1TVXA 2FXQA 1F2ZA 2BCOA 2UXDL 2PO4A 2R93B 3J80c 3F2CA 1C9OA 2Z6BA 4IFDH 4A3BH 4DR1L 3UDFA 4DR5L 1QILA 4EQPA 3CD6A 2CH4W 1XMQQ 1UNSA 4FXDA 2WFWA 4K6DA 1ASYA 1SN8A 5C5LA 1VQKA 5GADC 3KOJA 1DJRD 1UAPA 1TT2A 4P74A 1VMCA 2LSSA 2UXCQ 2I5HA 1HQMC 3HOZB 4A3MH 1HA6A 4A3BB 3NTHA 3FPUB 3HOWG 1WJJA 3KF8A 1XX8A 2CHBD 4N8X1 5I9PA 3KK7A 1VF7A 1GUWA 1KNAA 1B44D 5KYLA 2OF1A 2IX1A 1XPOA 2Z9HA 3ND9A 4K8JA 4ULLA 1JOKA 2VY3A 1HRJA 3GV3A 2F3WA 5JEAG 5EGTA 4BS9A 4LK1C 4LF7L 1LV9A 1Y14B 5EJWA 2L1BA 2KOLA 4DUZQ 1V1QA 4C3IH 2EXZA 1IHZA 2MFIA 4BA1I 3SR1A 3BYTB 1HTPA 1F2MA 2B2UA 5C44G 1JWMD 2PZUA 5D65A 2EY5A 2I5MX 1ENCA 3K0XA 3UE1A 2B2YC 5LMUQ 1VQFA 3BDOA 1O7ZA 4WFN3 5JJLA 3A56A 1WTOA 3S9WA 4RKBA 4C3IB 4J6HA 4JI7Q 4GNXB 2BOSA 1W2BA 1NMGA 4FXGC 1TWCH 4QJFA 1E2ZA 3QWNA 3X3MA 1UEAB 5JPMC 4BA2I 3FEWX 4LJZC 4DV4Q 1HHVA 1TY0A 3NHHA 1GUSA 1RTOA 3KLWA 4KMUC 2CQAA 5CV8A 4FYDA 4QF4A 2NYZD 4A4IA 3J81c 3RZOH 2A68D 4B3TQ 1EY9A 1PH1A 2EJMA 4K5XA 4KTAA 4JOIA 1EWIA 1XXGA 1JQYD 2F1MA 1X55A 1F77A 2F0HA 1CA5A 4NW2A 3A5ZB 5ELFA 3S24A 1NTGA 2K03A 5G3LD 1NY4A 2CW0C 5EBCA 3RZOB 2K5DA 1WCMH 4JVZA 2NVYH 2H4OA 2A69D 3IKJA 4CBVA 1YNNC 3RN5A 3IFTA 1K0RA 3I73A 4MHEA 4JI1L 5E4WC 3PUYA 5ELNA 1ZYRD 4IJLA 3HOVH 3BDLA 4DUYL 2R3ZA 3I3CA 1CA6A 3ONAB 4GLXA 1JICA 3U4VA 3NWTA 1SJHD 2KJXA 4R4OA 3HOXG 3H3VI 1I6HH 2L9HA 3A0JA 4MZ9A 3D4DA 1P8LA 1SYFA 1AE3A 2E76C 2EIFA 2X69A 1E22A 4IN3A 3HOVB 3JAML 1F9SA 1RHPA 1FGUA 2RDGA 1BCPD 5C4JH 1TKWB 3STBC 1QZHA 4MN3A 3G7LA 2B8GA 1HNZL 4OONA 2VUMG 4P75A 1CSPA 5M3FG 4A93H 1KLGD 1WTQA 1CM9A 3CKIB 1HNXL 1SMYD 4CJ2C 1C4QA 3GV6A 2XWJB 1Y1WG 5J39A 2HHHQ 5C4JB 3PIPA 4BY1H 4KN7C 5IGCA 2B2VA 1IBKQ 2K7VA 1AFPA 1B9NA 4JI8L 5IYDG 2CH4A 2M00A 3DLLA 4IUNA 4H13C 1S5FD 5EKLA 3NBIA 4DR7Q 4A93B 1BKBA 3LGJA 2O5IC 3IRBA 2N3SA 3AU7A 3D6WA 4TQUS 1G91A 2A6HC 1IYVA 4X66Q 4C3JB 4YIJA 1X3PA 5BR8Q 3PO3B 3MXNA 3ERSX 2K01A 4DV1L 1CKOA 1T5XD 1JB7A 2N55A 5EKIA 1KRSA 4G7HC 4IZ8A 1BNZA 3HKZE 1H9JA 5C0XJ 1S40A 2EY6A 1V1PA 2G9HD 2PQAB 3AFQA 3N6RA 3P20A 3G4SA 1Q82C 1M8AA 1JE4A 3CCSA 1CZWA 5C4ZA 2IL8A 1B7YB 5M9OA 4H0LC 2TSSA 4M1UB 1VQAA 3S15B 2JN4A 3QO2A 2R7FA 3PCOB 1H9SB 3PSIA 2NUCA 4S3SA 5I6YA 3DWPA 1G2TA 1CKNA 3BJUA 3OMCA 1PXUA 2A74C 2ZTEA 3OPOA 5LMNW 2HDLA 1LTSD 4RHRA 4GKKL 1MJEA 1BXTA 3H09A 1F2LA 4LFAQ 3DXJC 4K2LA 3D31A 4DAYA 1TWFB 2K5HA 3M85A 2HIXA 1JJ2A 1RL2A 4FF1A 2A6ED 1STNA 3I55A 1JE5A 1N33L 3GTJB 3H3VH 4DR4L 1H9KA 3DM1A 1R9TH 5C4HA 1SRUA 1H9MA 3CP0A 3K7AH 3J7ZC 4NXNQ 1JT8A 1WTRA 1Y69U 4ZUJA 1OTCA 2L55A 3S1NH 4DFAA 1HCZA 2AWOA 2MGSA 5CV4A 1WTWA 4GN3B 3NTKA 1EIYB 1XPUA 1J5EQ 1N34Q 1ET9A 3EN2A 3Q22A 2ZXPA 4HR7B 1JMCA 3C3LA 5LL6S 3IL8A 3MFYA 3TZDA 4APVA 1WD1A 1PA6A 4HIOA 2FMMA 4LAAA 2HUGA 3T4AC 3VYTA 2ZM6Q 3AQQA 1CI3M 1BVSA 4N9TA 2N88A 4BBRB 4DKAC 5FLMG 4PZ8A 2F03A 4RHSA 3S1NB 3FMCA 3PIP3 2EYMA 3M4OB 1U5KA 2CVRA 1EYGA 1QNKA 1U0LA 1PFSA 3P7JA 1STAA 4ALPA 3J7AV 1VQ5A 5FK9C 4DXGA 3S1RH 1XYIA 1A63A 2Z4HA 2F0WA 3B6YA 1YBYA 4JPBW 1X3GA 2KCNA 1K3BC 2D9UA 1EIFA 3HP3A 4TRDA 5IE8A 4R4CA 4HIMA 2I5LX 1NSNS 1VQIA 3S1RB 3S2DB 4PV1C 4A3EG 1OXXK 2Z4IA 4HSPA 2B3GA 3CPFA 2KBNA 3I4NG 4OWXB 5IP7G 5C44H 1AP0A 1Q8KA 2B2TA 4DK6C 3DEPA 3I56A 1ENAA 4KD3A 1PTOH 4UHVA 2R92G 5D3IB 4B3ML 3DWAA 4U68A 2QKIC 1GUNA 4QMGA 3OTOL 1WTPA 1SYGA 2K05A 5J3BA 3A55A 3NQIA 3A7AB 4RAUC 2QILA 1EZ8A 1W6KA 2JA5B 4F7XA 3QJYA 4C56C 4PZ6A 1FVIA 2EY2A 1HTLD 2E5LQ 2MPMA 4IOAA 4ZKCB 4DK1A 1PH9A 4LF7Q 2EJFC 1Q12A 2HQLA 5M3MH 1A3UA 1SSOA 1YVCA 4GNXC 2WB1E 2JA7H 2LFNA 4DA2A 1EQVA 1IYJB 3F2BA 3E0EA 4RG1A 1SFOH 5C4XH 5DNFA 2F0FA 2A19A 3W3AA 4V0BA 1S5BD 3PO2G 3HKSA 1CKNB 5E7NA 5M3MB 5AJ3L 1EQQA 4O1NA 3I4MB 4XQQA 5EKKA 2B63G 2PZTA 2Z1CA 2AQ3B 4ZK9B 2WIIB 2SNMA 4PNYA 4DR3Q 2Z0SA 2JA7B 2JE6I 2ICEC 1CQVA 1SFOB 5C4XB 2JA6G 3S2HH 3NENA 3U9OA 1S3OA 2WKDA 1EIHA 4A3IG 3MZ5A 4FF2A 3I4OA 5F2DA 1N36L 3TP6A 3HOXH 1BF4A 5AFWA 2N49A 4A3DB 3NWSA 2XWBB 2YYZA 2WAQG 1QUQB 2F0MA 5CR3A 1VS0A 3U9SA 3URYA 2UUAL 1YNJD 1B4OA 2EYFA 1SNOA 2M2LA 3MXPA 1EYCA 5JVH3 1HXYD 2VQFQ 4GOPB 4DV5L 1UE1A 4C3HG 1OXVA 3AYHB 4AYBG 3GTGH 1SEBD 5CV6A 5T1GA 3HKZB 4KKTA 4RGTA 5C6AA 2ZXRA 1A3TA 1Y1WH 3KF6A 4DV3L 1YI2A 1DD2A 3TN2A 5IYBH 1AZPA 3M4YA 3IFDA 2DN8A 4LF9L 4UY8C 3GTGB 4K2KA 3BVGA 3BS1A 1WFQA 1O7YA 4R8IA 3U50C 2QDLA 2ZXOA 4BXXH 2LMCB 1HJPA 3KJOA 1RODA 2YV5A 4JW0A 3G48A 4XYQA 1IBLL 1E1OA 4JI4L 1TWHH 1LM0A 2RCNA 3F1ZA 3I90A 4C1NI 2XIWA 1L1OB 1MSGA 4AQYL 2HT1A 2ATWA 1K0SA 4LFCQ 5IWAQ 4FNFA 1SNQA 3PF4A 1CT1D 1Q1BA 4Q5VA 1YJWA 1VQ9A 1Q86C 3Q0AA 1X65A 3VA7A 1TWHB 2WP8J 3A8JE 1ICFB 3SK6A 4K8IA 4Z9CB 1PFMA 3S17H 3M3YH 1KD1C 4PZ7A 2ZJQA 1TQOA 2LY7A 2NVTH 2CQOA 3QG1A 4NMZA 1HUNA 4CDDC 3BVZA 2B8FA 4H44C 4JI2Q 3D3RA 1XMOL 1XNQQ 2RSOA 4LUVA 5LMNQ 3S17B 3M3YB 1BBXC 1VQ7A 4HN7A 3BU2A 2JYOA 3PIO3 2NVTB 4OIKA 4GKJQ 3PF5A 1PH6A 4HJ5A 1BO0A 2VW9A 5IGFA 3FP9A 2A5HA 2TMPA 4POFA 5HGQA 4JC0A 1KAAA 3NTIA 4X3TA 5K36G 3HOYB 5I2XA 2CWAA 4KHPL 1CUKA 5EPKA 1F9PA 2AQ2B 4RCNA 3ICEA 3QB3A 2L15A 4JK1C 4KV6A 1KDCA 2F0OA 4DR2L 1YIJA 4A3GG 3AEVA 3D0FA 4JCVE 1NE3A 1VQJA 1CZGA 4JI5Q 1L0YB 3ULLA 1HQRD 1ZXTA 1JC7A 2F0TA 1HPCA 2F0NA 1KRTA 1UEBA 4A3FG 1I94Q 2PMZE 2JA8G 2QEXA 2JQOA 4A3JG 1KC8C 5FLMH 1W3SA 2VZAA 4LFBQ 3FKIG 2AWNA 2NTTA 3VYRA 3G6JB 1Q81C 1EY4A 1K8MA 1NMFA 3H3VC 1I4XA 5J1ZA 1MGSA 3PMFA 3LWEA 3PGZA 4QUFA 2K5WA 1CHPD 5I4DA 3W5OA 1EYAA 4ODGA 1SR3A 1TWGH 3T1HL 4OX9Q 1K83H 1WD0A 1PRTD 2JA9A 3L3OC 4IQZA 2B29A 2P5ZX 4MNOA 2WB1B 3NP8A 4BBSG 3S1QH 3CCEA 2IT1A 5ELCA 3OW2A 4Y7NH 2YU9H 2BH8A 4L8JA 4A3EH 3TDQA 4RGOS 5ELBA 4B3RQ 4NDXA 4ZLTF 2K1BA 1K83B 3DEOA 2KHJA 3MXUA 2E74C 2C9OA 1AW7A 2R6GA 4ZAIA 3ZJYC 2Q8RE 5KYIA 4A3MB 2R92H 3S1QB 4YWKA 3CMAA 1Q3LA 4MTKA 4X62Q 3T1YQ 2YU9B 1BUVT 1TR5A 4ID6A 1JJGA 2RA4A 1RKNA 4A3EB 3HEJA 1G291 5IIFA 2VXWA 1D5XC 1XNRQ 3CCRA 1U9RA 4XT1B 5CV9A 3CCJA 1Q46A 2KCMA 1IBMQ 2Y0SE 3SK8A 1S72A 4KI0A 1E24A 1PZKD 2KHSA 4X64Q 3H91A 2MNAA 4RA8A 4UP8A 4CJ1B 1D2BA 2R92B 2E75C 3RR5A 2DY7A 1RTNA 2A68C 2L11A 4YHHQ 3GD7A 1BBUA 2PPBC 2CWPA 1BDOA 2QF7A 3CHBD 4X3KA 1X3EA 4OXPA 2DY8A 3SXHA 1FJGL 3J7YW 5C3EG 2UXBL 2K75A 2UUCQ 2SOBA 2NVQH 3WWVA 1A2UA 2NTSA 4X3UA 2F0SA 3A54A 1F2YA 2PW5A 1JB3A 2Q8TA 2A69C 4DNIA 4DV6L 2EE1A 2F0JA 3OTOQ 3N52A 1E7ZA 4BY7H 1TS5A 1ZYRC 3H0GG 2DNEA 1B3QA 4KJNA 3GDEA 2JA6H 4UAIA 1VQNA 3SE0A 3Q6SA 3L7ZC 3E0JA 1E2WA 2NVQB 2FINB 4A3IH 1G6ZA 1SYCA 1TWCB 1GUGA 3BDCA 3K5LA 2RF4A 4BY7B 3HRZC 1HA5A 5KIXA 1SMXA 4B3SL 1PTOD 3QIAA 1MHWC 3WOFA 1SNMA 4X65L 2KVMA 4RH6A 4XT3B 2EXDA 2R7ZH 3QR8A 1PZJD 1HNWQ 4G7OC 3D6CA 1EL0A 3GTOH 5GAEC 1FGBD 1YEZA 4C3HH 5L37A 4OIJA 2EYLA 2N8NA 3NBHA 4YCUA 1JWSD 2OWOA 3OIQA 5A35A 4L63B 1GJXA 1HR0L 3NPPA 1WCMB 2V4DA 5KRUA 2NVYB 2JXMB 1X56A 2WACA 5CMDA 2RHSB 2R7ZB 3TS0A 3NK9A 1N32Q 5IODA 4C1NK 1SNDA 3L0OA 3F8TA 4GOPC 4DV0Q 3NXWA 1YJNA 4OEMB 1SBBB 3HOUG 3HS0C 1Z47A 4HEDA 4LF6Q 1S5CD 2XNAC 4DR6Q 2OQ0A 2RKSA 1I6HB 1A3VA 3CCLA 1QE6A 2UUAQ 4QB4A 2K5QA 5IGGA 3J7AF 4LF8Q 1G8ZD 3C1FA 4JYAQ 5IP9G 4CKCA 1EY0A 2FJ2A 3KF8B 1KQSA 3TBIB 5J22A 1EEID 5M5WH 4JV5L 4NPSA 3K0YA 3I7FA 2FMCA 4PG3A 4JI6Q 1ENFA 1G6PA 2BDOA 4G4KA 4OWWB 4N9PA 5I6WA 3J7A5 2KUMA 4UPAA 4DV2Q 1I4RA 1L1OC 1WOCA 4A3KG 1QVGA 2YTXA 5CC4A 1O78A 4BY1B 1DZ1A 1KXLA 2JP1A 5M5WB 1Q90A 3U58A 2B2TC 2K4KA 1MD2D 1X3QA 1JOQA 1D5ZC 2JEBI 4F88A 4JBKA 1VQLA 2PMZB 3CF5A 2K6AA 4IO9A 1K8GA 4IJHA 1D1KA 2KA7A 2VS1A 1C7YA 3GTQH 4KKSA 2OCEA 3HG9A 1PMRA 3NEMA 3TREA 1ET6A 1WTHA 2A6EC 2D0OA 3NE5B 2UU9L 1TXYA 1Y1VG 5K36H 1STBA 2B2YA 2VL6A 4IFDJ 3KUPA 5DM73 1S5ED 4LF5L 2IX0A 2JSOA 2PNRC 2I07B 3GTQB 2H5XA 4CKBA 1VQGA 2NN6G 3M4PA 4JI3Q 4POGA 4WORA 1X6OA 4KY7A 1YHBA 4F8MA 2XRQD 5LHY1 4IURA 4IPDA 2GVAA 4MIUA 4YWLA 2VQEL 2AUKA 1D1IA 5CORA 4IUPA 4K5WA 1SLJA 3PUXA 4A3FH 2Z6KC 1LT5D 1B8AA 1YHQA 3NUCA 5K5PA 1WVLA 4LUOA 1PRTB 3F2UA 4A3JH 3K5OA 3X3NA 4LF4Q 4RMFA 2EOTA 1ZKOA 1TIID 1KDAA 1CTMA 1QCBD 5I9OA 1QB5D 1N9WA 2Y0SB 3KDFA 1KABA 4O2DA 3ERQA 1WYDA 1A0IA 1R9TB 3A8IE 4NXML 4XXEA 1GHKA 5IYCG 2B39A 3K7AB 4G57A 5M5YH 2KCCA 1EEFD 1XMQL 2EJGC 5DEHA 4G7ZC 4BBSH 4MTNA 2AUJD 3WDNA 3HOWH 3HGBA 5IOCA 3R2IA 1J8IA 1KTKA 3QOJA 1VQHA 2XN9C 3Q8DA 2UXCL 1FNVA 2R93G 3A5UA 3M7NA 2UUBL 1STGA 2G9DA 2RCFA 2NWGA 2UXDQ 5C0XG 1E2VA 3LX0A 1DM0B 3FPPA 3C1EA 2MO1A 3HOWB 4DR1Q 4DR5Q 1B53A 2AQ1B 1I50H 2F0KA 3WOEA 5JEAH 5FLXE 3RLOA 1PV4A 4R4TA 1JOOA 2NBFA 3JC66 4TSSA 3HOZG 4ZQ3A 3H6MA 1EY6A 4IOCA 4IFDG 4A3BG 4EQOA 1L0XB 4CDEC 3GQBA 1CSQA 4DU9A 3TP8A 1ILPA 4GN4B 4DUZL 3RMHA 4A76A 3MXNB 1I50B 3RN2A 3SHLA 3EJIA 1MSHA 2Q2IA 5HGTA 5CV5A 2NZOA 5C3EH 4ME3A 2IX3A 4IPCA 4A75A 1LTRD 5LMUL 5G3LF 4LNQA 5C44B 1VQ4A 5IT9E 4P71A 1V1PB 2O2LD 1X9NA 4PQXA 1PTOB 4JI7L 2F4VL 3M9BA 1IW7D 4WJWA 3ER0A 3M4QA 2MP1A 2C35B 2JJQA 1U4PA 1G51A 1FNUA 5FO9B 3DHQA 4DAPA 2B2WC 3P75A 1EWCA 3VR2A 4B9WA 1TS3A 1EFWA 1Z9FA 4C3IG 2L5TA 4DAVA 3TZUA 1YNJC 3R8BA 3JAMi 2WKCA 1C48A 2PZWA 2E2DC 1NR4A 3I70A 1SNCA 4DAYB 3DM3A 3CC2A 1AH9A 2KHIA 3R2TA 1BCPB 1PHJA 5IT9c 3K8AA 3MA2B 2F3IA 1QVFA 1PYWD 1EU4A 2Q8IB 1B3AA 3V05A 5KNDA 1ESRA 4KY6A 1CK1A 3UDXA 4XQNA 2ALYB 1FNWA 5JJIA 2EPBA 2VNUD 1A6XA 2G5DA 3S2HB 2ICIA 1U4MA 5A2QE 4EGVA 2K50A 3GTMH 3HOUH 3HOXB 1LUZA 1KL9A 2DNCA 4QGUA 2VUMH 2RHQB 5M3FH 1FD7D 3AB9A 4JI1Q 3I2ZA 3CXCA 4KHVA 4U673 4DUYQ 2K32A 2IWHA 5IP9H 1II3A 4HCSA 4A3LG 1YNXA 4ZKBB 1LT6D 4CDCC 1DCZA 3W2DA 2LXJA 1GD7A 1BR9A 4XDXA 5IYDH 2OQKA 3EVQA 3K7UC 4IUTA 3MHBA 3HOVG 1HR0Q 4DAMA 2VUMB 3GP7A 2HHHL 4IUUA 5M3FB 4ZCKA 1IBKL 1O7LA 2CCZA 1O7IA 3FDTA 2E2HH 3IAYA 1PH5A 4NP5A 1TWAH 2RBMA 3EIVA 3CCVA 4OWTB 3A7LA 5GROA 1Y1WB 1TY2A 5C0XI 4RGNA 3R3OA 2PNHA 3K5MA 3E3XA 2NB0A 4DR7L 2RVLA 3PUVA 1EOTA 4O42A 4UP9A 2J0TD 2GVBA 2N78A 2WV6D 5CGKA 1HNZQ 1XJVA 4X66L 1MKHA 3SEBA 2ES2A 2GA4B 2BA1A 3CQZH 1RDPD 5BR8L 4ILWA 2RDFA 3A74A 1V9PA 1HNXQ 1TWAB 2D5DA 1LACA 1YITA 4OL7A 3I4LA 1Y8PB 4YCVA 4CDFC 2WAQE 4A93G 5IY0A 1UE6A 4JI8Q 2FHTA 1EIGA 5JPNC 1QVCA 4C3JG 3CQZB 2B2UC 3EBEA 3PO3G 1Y1VH 1HH2P 1P16A 4AYBE 3J81j 3UI2A 1PH4A 1KLUD 1KAWA 4DV1Q 2F0LA 2KQ3A 4XIGS 3KJPA 1EQTA 2X6GA 1C0AA 3KLRA 1PH8A 2VB3X 2AMCB 4A3CG 1EZ6A 2X6LA 3MVVA 4IUVA 1Y8OB 2A73B 5GQOA 3VA5A 3TQYA 1OXUA 4HSVA 4LFAL 2QA4A 2PYKA 2OTLA 4GNXA 1G2SA 4HJ9A 4NKLA 1HZBA 4JOIC 2J4XA 5CBEE 4QCLA 5LL6X 3OYYA 3EA6A 3P1HA 2SNSA 1LTID 2IPKD 2PI2A 3S1MH 3NSWA 1HZAA 2ZTCA 1XWEA 4RFBA 4L5RC 2IJ0A 3EFXD 4NXNL 4GN5A 3TMEA 1O80A 3BZDB 1PRTC 2Z8LA 1XTCD 3J80E 3Q23A 3OMGA 1VQDA 1STEA 2CFMA 1T5EA 4GKKQ 1GO3E 1GOZA 5FKAC 3VR3A 1J9OA 4DF7A 3GO5A 1N34L 2K5VA 3PUZA 5KNCA 5JOBA 1N33Q 2ZM6L 1AE2A 3MEFA 1PFBA 4DR4Q 2F0VA 3UE0A 1HFNA 1QWYA 2HQEA 1HZCA 4DK3C 2WINB 2ZJPA 1RJTA 1X54A 4QY7A 5C0XH 3KF6B 2I46A 3E5SA 2K04A 3DMUA
chains in the Genus database with same CATH topology
1SYEA 2F0GA 4ABNA 2KECA 1STHA 4ZYSA 4RWSC 1TWGB 2EYJA 1B2TA 1PLFA 4RGMA 2B2VC 1EWHA 4I65A 1NAPA 1K8OA 3AMUA 1PFNA 1IYUA 1GUOA 2BE5D 2F0QA 4Y7NB 2PQEA 5KGUA 3T51B 3BG3A 1DOKA 3QOLA 3I4NB 1EFID 1SE4A 5FO8B 2L4NA 4FF4A 1TU2B 5M5XB 4FVMA 2O5JC 4FP5D 2OT2A 3A8KE 1SE2A 1CFMA 3CRKC 3S16B 1C8CA 3BYYB 1DONA 4XQJA 5EBDA 1BQQT 2XSCA 1JWUD 1D5MC 4Q0FA 2F0PA 1LTGD 3MEHA 3KBGA 3J81E 3Q24A 3ND8A 1PTOC 2K28A 2OEOA 1LT4D 3M7GA 1LT3D 2PCFB 2QDBA 4ZRZA 4DK0A 5DAUA 4WRDA 4IUQA 1FYCA 1GHJA 3DUZA 4OO1G 4BWGB 3RZDB 2F0EA 3PO2B 3I8ZA 3T16A 3RD4A 4DGZA 1Q8IA 2B63B 4M8AA 1ZEQX 2EZVA 5BN3A 5JAVA 1H9SA 3MTSA 2JA6B 1BCPC 4PMCA 4J1MA 5I2YA 2EY1A 4A3IB 4TKOB 1Z7TA 2F4IA 1I4HA 1AEXA 4XTCS 1I4GA 1SMYC 5TSSA 4HCEA 3T53B 2NVXB 2WAQB 4KK7A 4CJ0B 2EVBA 1Y8NB 5IGEA 2ID0A 1Z6HA 2H1EA 2IW3A 3V96A 1WTVA 1S5DD 2EDGA 5JVG3 3GTOB 4C3HB 5CYUA 4AYBB 1E0BA 1QG7A 1VDZA 3OSOA 4K5VA 4KY5A 3SVMA 4RKLA 3D4WA 3KLSX 1EU3A 5BN5A 4GZYC 4LMQD 2RSNA 1FR3A 4OHJA 2CW0D 1H9RA 1UUPA 3EQLC 1LTTD 1B50A 4DXFA 1ONLA 1YNND 3GTLB 1IKMA 3VYSA 4XYOA 1QOHA 5E4XA 2O4XA 2LS01 5ELDA 1NUCA 2ENBA 1F9RA 1LABA 3HZXA 2BDNA 3OW7A 4R9WA 5FLXL 4R8NA 5D3DA 5D14A 1A2TA 1LO5D 3MC0B 1V1OA 2F3VA 1IKLA 5C5MA 1Q1EA 1ICWA 3D8GA 3DWQA 3C2PA 3ITPA 2MUYA 1W6JA 2F0DA 5IT9L 4OO1I 2A6HD 3BVMA 4HTHA 1PRTF 1MBYA 5FOBB 3K57A 4PMBA 1R4PB 2OXPA 3SDZA 4A3GB 4KN4C 3PV0A 3KLSA 4IALA 2JEAI 4A3FB 2JA8B 5CV7A 1KNEA 4FF3A 4A3JB 4CGYB 3JAME 3FKIB 2K33A 1V8QA 4CHTB 1PZID 3T13A 1RD9D 3GTKB 2E2JB 2FFKB 2XVSA 3O13A 3OWEB 1SYBA 4L6TB 2HCCA 1EY7A 1MI2A 3SK4A 3LNNA 2C5CA 3FVQA 1U4LA 5M5YB 5A2QL 3PUWA 1HFGA 3MXGA 1STYA 4BBSB 5KEEA 4ME5A 1EY5A 5JJZA 1LLRD 3I72A 4E6IA 4C2MB 5HURA 1SDFA 1OXSC 3K6OA 1DYQA 4RCOA 3ZYYX 1IW7C 3K5NA 2RQXA 4B08A 2ZT9C 1U4RA 1X32A 1M4VA 5FO7B 5ELEA 4I7ZC 4KD4A 4QUCA 1JORA 4FXKC 4J8QA 4HMJA 1TS2A 2D62A 4DN4M 1PTOF 2NZ1D 3MFGA 1F9QA 1BOSA 2J7ZA 1EYDA 2E2IB 1VCIA 3LWUA 3R93A 1WTXA 2L0CA 3RUZA 3VR4A 5C3EB 2F0UA 4OO1H 1OO9B 2EYOA 1KDBA 4DNTB 4ZUIA 4EVOA 1I6VC 1SJED 1I4PA 1B9MA 1NR2A 3H0GB 4F87A 4PMWA 3OHXC 2NN6I 1AN8A 3MWYW 1BCPF 3K58A 2HCIA 2KEDA 5BN4A 1LTBD 3K59A 1DOMA 1RCVD 5E3FA 4UDUC 3TP7A 1TS4A 2L12A 5NUCA 1S4ZA 4HMIA 3CRLC 1ESFA 1IL8A 5DM63 1RF2D 3C46A 4OGQC 5ISRA 1CQFA 2KEEA 5CBAE 4X3SA 4CKEA 1GXDC 1VMPA 1LTAD 2M9VA 3FRPB 5C3WA 3E6ZX 3J80L 3GTMB 3HOUB 2HDMA 1R4QB 1OXTA 2MJ8A 3L9AX 1DXMA 3H94A 4V190 1CHQD 4HAEA 1QJOA 4KHZA 1SAPA 3VR5A 1HUMA 1SYDA 5C3XA 5EPLA 4IFDI 2E2HB 1QNUA 2BA0A 4A3KB 5T1IA 1I4QA 4KKUA 3SK5A 3V2TA 1VF5C 1ILQA 2MHVA 1JR0D 1EY8A 4H7BA 1A15A 2QEJC 5KNBA 1SXTA 1AZQA 5EQ0A 4K14A 3NQTA 3S14B 1DOLA 3OOCA 1GUTA 2XRSD 1JCKB 2NN6H 4FO2A 3EROA 3MAQA 5COYA 2SEBD 4P2CB 1I3QB 1Y1VB 1ML0D 5IGBA 3OIPA 2SDFA 2RDHA 2EYPA 1SNPA 2B2WA 4K6LA 3J81L 4EQNA 5E1FA 2D2CC 5JEAJ 3GTPB 3T56B 1SE3A 5EPJA 3D4RA 3RLFA 3I91A 1D6EC 4JBWA 3CU7A 1PDQA 4DNRB 2EYHA 3S1MB 2F0IA 2R61A 3KBXA 2PW7A 1NCVA 3OWFA 1B1ZA 3TSSA 5IGDA 2BE5C 3VR6A 2LKVA 4KJOA 2VB2X 1V43A 4QIWB 2QCPX 3TP5A 4B9XA 3VYUA 1TVXA 1F2ZA 2BCOA 2PO4A 2R93B 4IFDH 1QILA 4EQPA 1UNSA 4FXDA 4K6DA 5C5LA 1DJRD 1UAPA 1TT2A 1VMCA 3HOZB 1HQMC 1HA6A 4A3BB 3NTHA 3FPUB 3KF8A 1XX8A 2CHBD 5I9PA 3KK7A 1VF7A 1GUWA 1KNAA 1B44D 5KYLA 2OF1A 2IX1A 3ND9A 4K8JA 4ULLA 1JOKA 1HRJA 3GV3A 2F3WA 5JEAG 5EGTA 4BS9A 4LK1C 1LV9A 5EJWA 2L1BA 2KOLA 2EXZA 1IHZA 4BA1I 3SR1A 3BYTB 1HTPA 1F2MA 2B2UA 1JWMD 2PZUA 5D65A 2EY5A 1ENCA 2B2YC 3BDOA 1O7ZA 4WFN3 3A56A 1WTOA 3S9WA 4RKBA 4C3IB 4J6HA 2BOSA 4FXGC 1E2ZA 3QWNA 3X3MA 1UEAB 5JPMC 4BA2I 3FEWX 4LJZC 1HHVA 1TY0A 3NHHA 1GUSA 1RTOA 4KMUC 2CQAA 5CV8A 4FYDA 4QF4A 2NYZD 2A68D 1EY9A 2EJMA 4K5XA 4KTAA 1XXGA 1JQYD 2F1MA 1F77A 2F0HA 1CA5A 4NW2A 5ELFA 2K03A 5G3LD 2CW0C 5EBCA 3RZOB 2K5DA 2H4OA 2A69D 3IKJA 4CBVA 1YNNC 3IFTA 4MHEA 3I73A 5E4WC 3PUYA 1ZYRD 3BDLA 2R3ZA 3I3CA 1CA6A 3ONAB 1JICA 3NWTA 1SJHD 2KJXA 2L9HA 3D4DA 1SYFA 2E76C 2X69A 4IN3A 3HOVB 3JAML 1F9SA 1RHPA 2RDGA 1BCPD 1TKWB 4MN3A 3G7LA 2B8GA 1KLGD 1WTQA 1CM9A 3CKIB 1SMYD 4CJ2C 1C4QA 3GV6A 2XWJB 5J39A 5C4JB 4KN7C 5IGCA 2B2VA 2K7VA 1AFPA 1B9NA 2M00A 4IUNA 4H13C 1S5FD 5EKLA 3NBIA 4A93B 2O5IC 3AU7A 3D6WA 4TQUS 1G91A 2A6HC 1IYVA 4C3JB 4YIJA 1X3PA 3PO3B 3MXNA 2K01A 1T5XD 2N55A 5EKIA 4G7HC 4IZ8A 1BNZA 1H9JA 5C0XJ 2EY6A 1V1PA 2G9HD 3N6RA 3P20A 1M8AA 1JE4A 1CZWA 5C4ZA 2IL8A 5M9OA 4H0LC 2TSSA 4M1UB 3S15B 3QO2A 1H9SB 2NUCA 4S3SA 5I6YA 3DWPA 1G2TA 3OMCA 1PXUA 2A74C 3OPOA 2HDLA 1LTSD 4RHRA 1BXTA 3H09A 1F2LA 3DXJC 4K2LA 3D31A 4DAYA 1TWFB 3M85A 4FF1A 2A6ED 1STNA 3GTJB 1H9KA 3DM1A 5C4HA 1H9MA 1WTRA 1Y69U 4ZUJA 2L55A 4DFAA 5CV4A 1HCZA 2AWOA 2MGSA 1WTWA 3NTKA 1ET9A 3Q22A 3C3LA 2ZXPA 4HR7B 5LL6S 3IL8A 3MFYA 3TZDA 1WD1A 2FMMA 4LAAA 2HUGA 3T4AC 3VYTA 1CI3M 4N9TA 2N88A 4BBRB 2F03A 4RHSA 3S1NB 3FMCA 3PIP3 2EYMA 3M4OB 2CVRA 1QNKA 3P7JA 1STAA 3J7AV 5FK9C 4DXGA 1XYIA 2Z4HA 2F0WA 2KCNA 2D9UA 3HP3A 4TRDA 1NSNS 3S1RB 3S2DB 4PV1C 1OXXK 2Z4IA 4HSPA 1AP0A 2B2TA 3DEPA 1ENAA 4KD3A 1PTOH 5D3IB 3DWAA 4U68A 2QKIC 1GUNA 4QMGA 1WTPA 1SYGA 2K05A 3A55A 3NQIA 3A7AB 4RAUC 2QILA 1EZ8A 1W6KA 2JA5B 4F7XA 3QJYA 4C56C 2EY2A 1HTLD 2MPMA 4ZKCB 4DK1A 2EJFC 1Q12A 1A3UA 1SSOA 2LFNA 4DA2A 1EQVA 5DNFA 2F0FA 3W3AA 4V0BA 1S5BD 5M3MB 4O1NA 3I4MB 4XQQA 5EKKA 2PZTA 2Z1CA 2AQ3B 4ZK9B 2WIIB 2SNMA 4PNYA 2JA7B 2JE6I 2ICEC 1CQVA 1SFOB 5C4XB 3U9OA 2WKDA 1EIHA 3MZ5A 4FF2A 5F2DA 3TP6A 1BF4A 5AFWA 4A3DB 3NWSA 2XWBB 2YYZA 2F0MA 5CR3A 3U9SA 3URYA 1YNJD 1B4OA 2EYFA 1SNOA 2M2LA 3MXPA 1EYCA 5JVH3 1HXYD 4C3HG 1OXVA 1SEBD 5CV6A 5T1GA 3HKZB 4KKTA 4RGTA 5C6AA 2ZXRA 1A3TA 1DD2A 3TN2A 1AZPA 3M4YA 3IFDA 2DN8A 3GTGB 4K2KA 3BVGA 3BS1A 1O7YA 4R8IA 2ZXOA 2LMCB 1RODA 4XYQA 3I90A 4C1NI 2XIWA 1MSGA 4FNFA 1SNQA 1CT1D 1Q1BA 4Q5VA 3Q0AA 3VA7A 1TWHB 2WP8J 3A8JE 3SK6A 4K8IA 4Z9CB 1PFMA 1TQOA 2LY7A 3QG1A 4NMZA 1HUNA 3BVZA 2B8FA 4H44C 3D3RA 2RSOA 3S17B 3M3YB 1BBXC 4HN7A 2JYOA 3PIO3 2NVTB 4OIKA 1BO0A 5IGFA 2A5HA 2TMPA 1KAAA 3NTIA 4X3TA 5K36G 3HOYB 5I2XA 5EPKA 1F9PA 2AQ2B 4RCNA 3QB3A 4JK1C 4KV6A 1KDCA 2F0OA 1CZGA 1L0YB 1HQRD 1ZXTA 1JC7A 2F0TA 1HPCA 2F0NA 2AWNA 2NTTA 3VYRA 3G6JB 1EY4A 1K8MA 3H3VC 1I4XA 5J1ZA 1MGSA 3PMFA 3LWEA 4QUFA 2K5WA 1CHPD 5I4DA 1EYAA 4ODGA 1WD0A 1PRTD 3L3OC 4IQZA 2WB1B 3NP8A 2IT1A 5ELCA 4L8JA 3TDQA 4RGOS 5ELBA 4NDXA 4ZLTF 2K1BA 1K83B 3DEOA 3MXUA 2E74C 2C9OA 1AW7A 2R6GA 4ZAIA 5KYIA 2Q8RE 4A3MB 3S1QB 1Q3LA 2YU9B 1BUVT 1TR5A 4ID6A 2RA4A 1RKNA 4A3EB 3HEJA 1G291 5IIFA 2VXWA 1D5XC 1U9RA 4XT1B 5CV9A 3SK8A 4KI0A 1PZKD 2KHSA 3H91A 4RA8A 4CJ1B 1D2BA 2R92B 2E75C 2DY7A 1RTNA 2A68C 2L11A 2PPBC 3GD7A 1BDOA 2QF7A 3CHBD 4X3KA 2DY8A 3SXHA 3J7YW 2SOBA 1A2UA 2NTSA 4X3UA 2F0SA 3A54A 1F2YA 2PW5A 1JB3A 2Q8TA 2A69C 2EE1A 2F0JA 3N52A 1TS5A 1ZYRC 2DNEA 4KJNA 4UAIA 3SE0A 3Q6SA 3L7ZC 3E0JA 1E2WA 2NVQB 2FINB 1G6ZA 1SYCA 1TWCB 1GUGA 3BDCA 3K5LA 4BY7B 3HRZC 1HA5A 5KIXA 1PTOD 3QIAA 3WOFA 1SNMA 2KVMA 4RH6A 4XT3B 1PZJD 4G7OC 3D6CA 1EL0A 1FGBD 4OIJA 2EYLA 3NBHA 1JWSD 3OIQA 5A35A 4L63B 1GJXA 3NPPA 1WCMB 5KRUA 2V4DA 2NVYB 2JXMB 2WACA 5CMDA 2R7ZB 3NK9A 5IODA 4C1NK 1SNDA 3NXWA 1SBBB 3HS0C 1Z47A 4HEDA 1S5CD 2XNAC 2RKSA 1I6HB 1A3VA 1QE6A 4QB4A 2K5QA 5IGGA 3J7AF 1G8ZD 3C1FA 4CKCA 1EY0A 2FJ2A 3TBIB 5J22A 1EEID 3K0YA 2FMCA 1ENFA 2BDOA 4G4KA 4N9PA 5I6WA 2KUMA 1I4RA 4BY1B 5CC4A 1O78A 1DZ1A 2JP1A 5M5WB 1Q90A 2B2TC 1MD2D 1X3QA 1JOQA 1D5ZC 2JEBI 4F88A 2PMZB 2K6AA 1D1KA 2KA7A 4KKSA 3HG9A 1PMRA 1ET6A 2A6EC 3NE5B 5K36H 1STBA 2B2YA 4IFDJ 3KUPA 5DM73 1S5ED 2IX0A 2JSOA 2PNRC 2I07B 3GTQB 4CKBA 2NN6G 4WORA 4KY7A 4F8MA 2XRQD 5LHY1 4IURA 4MIUA 2AUKA 1D1IA 5CORA 4IUPA 4K5WA 3PUXA 1LT5D 3NUCA 5K5PA 1WVLA 1PRTB 3F2UA 3K5OA 3X3NA 2EOTA 1ZKOA 1TIID 1KDAA 1CTMA 1QCBD 5I9OA 1QB5D 2Y0SB 1KABA 3ERQA 1R9TB 3A8IE 4XXEA 1GHKA 2B39A 3K7AB 4G57A 2KCCA 1EEFD 2EJGC 5DEHA 4G7ZC 2AUJD 3WDNA 3HGBA 5IOCA 3R2IA 1J8IA 1KTKA 3QOJA 2XN9C 1FNVA 3M7NA 1STGA 2G9DA 2NWGA 5C0XG 1E2VA 3LX0A 1DM0B 3FPPA 3C1EA 3HOWB 1B53A 2AQ1B 2F0KA 3WOEA 5JEAH 5FLXE 1JOOA 2NBFA 4TSSA 4ZQ3A 3H6MA 1EY6A 4IFDG 4EQOA 1L0XB 3GQBA 4DU9A 3TP8A 1ILPA 3RMHA 1I50B 3SHLA 3EJIA 1MSHA 5HGTA 5CV5A 2IX3A 1LTRD 5G3LF 5C44B 5IT9E 1V1PB 2O2LD 4PQXA 1PTOB 1IW7D 4WJWA 2MP1A 1U4PA 1FNUA 5FO9B 3DHQA 4DAPA 2B2WC 3P75A 1EWCA 3VR2A 4B9WA 1TS3A 4C3IG 2L5TA 4DAVA 3TZUA 1YNJC 3R8BA 2WKCA 1C48A 2PZWA 2E2DC 1NR4A 3I70A 1SNCA 3R2TA 1BCPB 3MA2B 1PYWD 1EU4A 2Q8IB 1B3AA 3V05A 5KNDA 1ESRA 4KY6A 1CK1A 4XQNA 1FNWA 2EPBA 2VNUD 1A6XA 3S2HB 2ICIA 1U4MA 5A2QE 4EGVA 3HOXB 2DNCA 1FD7D 3AB9A 4KHVA 4U673 2K32A 2IWHA 1II3A 4HCSA 4ZKBB 1LT6D 1DCZA 3W2DA 1BR9A 4XDXA 3EVQA 4IUTA 3MHBA 2VUMB 3GP7A 4IUUA 5M3FB 1O7LA 3FDTA 3IAYA 4NP5A 2RBMA 3A7LA 1Y1WB 1TY2A 5C0XI 4RGNA 3R3OA 3K5MA 2NB0A 2RVLA 3PUVA 1EOTA 4O42A 2J0TD 5CGKA 2WV6D 3SEBA 2GA4B 2BA1A 1RDPD 4ILWA 2RDFA 1TWAB 2D5DA 1LACA 4OL7A 3I4LA 1Y8PB 2FHTA 1EIGA 5JPNC 4C3JG 3CQZB 2B2UC 3UI2A 1KLUD 2F0LA 2KQ3A 4XIGS 1EQTA 2X6GA 3KLRA 2VB3X 1EZ6A 2X6LA 3MVVA 4IUVA 1Y8OB 2A73B 3VA5A 1OXUA 4HSVA 2PYKA 1G2SA 4NKLA 2J4XA 5CBEE 4QCLA 5LL6X 3EA6A 2SNSA 3P1HA 1LTID 2IPKD 4RFBA 3NSWA 1XWEA 2IJ0A 3EFXD 3TMEA 1O80A 3BZDB 1PRTC 2Z8LA 1XTCD 3J80E 3Q23A 3OMGA 1STEA 1T5EA 1GOZA 5FKAC 3VR3A 1J9OA 4DF7A 3GO5A 3PUZA 5KNCA 5JOBA 1PFBA 2F0VA 1HFNA 1QWYA 2HQEA 2WINB 1RJTA 5C0XH 2I46A 3E5SA 2K04A 3DMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HED A;  1EIH A;  2RA4 A;  2MJ8 A;  1WTO A;  1PDQ A;  1BBX C;  4QUC A;  2B2W C;  2JYO A;  2VXW A;  3D6W A;  4OIK A;  1QE6 A;  2EOT A;  4XT1 B;  3KBX A;  1G91 A;  2CVR A;  1BF4 A;  4DN4 M;  1QNK A;  2FHT A;  5AFW A;  1X3P A;  1EIG A;  2KEC A;  2NZ1 D;  3P7J A;  4CJ0 B;  4HAE A;  1F9Q A;  1BO0 A;  1NCV A;  2J7Z A;  3H91 A;  1XYI A;  4RA8 A;  4RWS C;  1HHV A;  2FJ2 A;  1SAP A;  2B2U C;  1HUM A;  2K01 A;  2H1E A;  4CJ1 B;  1PLF A;  1B2T A;  2DY7 A;  1RTN A;  2B2V C;  1RTO A;  4X3T A;  3R93 A;  2L11 A;  1WTV A;  2N55 A;  1WTX A;  1B4O A;  4X3K A;  5EPL A;  1NAP A;  5EKI A;  5EPK A;  2NYZ D;  1NR4 A;  1F9P A;  1PFN A;  2N88 A;  3UI2 A;  2DY8 A;  2D9U A;  2M2L A;  1E0B A;  1QG7 A;  3HP3 A;  5T1I A;  1BNZ A;  1TVX A;  2KUM A;  1AP0 A;  1ILQ A;  3SVM A;  1CA5 A;  1EQT A;  2X6G A;  4NW2 A;  4X3U A;  5T1G A;  1DOK A;  1B3A A;  1ESR A;  1J8I A;  1M8A A;  2K03 A;  2L4N A;  2Q8T A;  1DZ1 A;  1NR2 A;  2JP1 A;  1A15 A;  1JE4 A;  2EE1 A;  1ZXT A;  2IL8 A;  2EPB A;  2RSN A;  2X6L A;  3N52 A;  4IUV A;  4LMQ D;  2B2T C;  3TN2 A;  1AZQ A;  5EQ0 A;  1KNE A;  2B2T A;  3MWY W;  1X3Q A;  3DEP A;  1AZP A;  1U4M A;  2HCI A;  3QO2 A;  1C8C A;  3IFD A;  2NWG A;  1DON A;  1DOL A;  2KED A;  4HSV A;  4MHE A;  4UAI A;  5E4W C;  1B50 A;  3Q6S A;  1G2S A;  4U68 A;  1VMC A;  1O7Y A;  4R8I A;  1IKM A;  2R3Z A;  2FIN B;  3I3C A;  1DOM A;  1B53 A;  5CBE E;  2K05 A;  1WTP A;  1CA6 A;  3ONA B;  1G2T A;  1G6Z A;  1HA6 A;  2FFK B;  1ROD A;  1JIC A;  3FPU B;  2HDL A;  4RAU C;  5COY A;  5E4X A;  1XX8 A;  2K28 A;  2L12 A;  1S4Z A;  1F2L A;  1MGS A;  2HCC A;  2L9H A;  1MI2 A;  2MPM A;  3LWE A;  4QUF A;  1KNA A;  3I90 A;  1GUW A;  1O80 A;  2XIW A;  2X69 A;  1MSG A;  1ML0 D;  4HCS A;  4ZKC B;  1U4L A;  4ZKB B;  1ILP A;  1IL8 A;  2KVM A;  1HFG A;  2B2Y A;  1F9S A;  2SDF A;  4XDX A;  1RHP A;  4XT3 B;  1WD0 A;  1SSO A;  4IUQ A;  3KUP A;  4IUT A;  1MSH A;  3DM1 A;  1J9O A;  1F9R A;  5JJZ A;  1HRJ A;  3GV3 A;  3I8Z A;  4IUU A;  2BDN A;  4MN3 A;  2KEE A;  1EL0 A;  3G7L A;  5CBA E;  5DNF A;  4R9W A;  2B2W A;  3FDT A;  1WTR A;  1LV9 A;  4OIJ A;  5EJW A;  2L1B A;  2KOL A;  4IUR A;  1PFM A;  1SDF A;  1WTQ A;  1CM9 A;  4X3S A;  5D14 A;  1VMP A;  1PFB A;  4CJ2 C;  2MGS A;  3GV6 A;  5COR A;  1HFN A;  1WTW A;  1HUN A;  4ZLT F;  2RVL A;  2K1B A;  4IUP A;  3DEO A;  1EOT A;  1IKL A;  2B2U A;  4O42 A;  4ZK9 B;  5CMD A;  3MTS A;  2B2V A;  5D65 A;  1RJT A;  2MP1 A;  1ICW A;  2RSO A;  3IL8 A;  2B2Y C;  5EPJ A;  2HDM A;  3TZD A;  1WD1 A;  1U4R A;  1X32 A;  2Q8R E;  2FMM A;  4ZAI A;  1U4P A;  2HUG A;  1WVL A;  2K04 A;  3F2U A;  1O7Z A;  3I91 A;  1Q3L A; 
#chains in the Genus database with same CATH topology
 1SYE A;  2F0G A;  4ABN A;  1K28 A;  4OEL B;  4BBR G;  4NXM Q;  3HOZ H;  4KLK A;  2K14 A;  1DGS A;  1IL2 A;  2KEC A;  1KHI A;  4TVA B;  1STH A;  4ZYS A;  4JI0 L;  4RWS C;  1TWG B;  2EYJ A;  3I4N H;  1B2T A;  1PLF A;  4RGM A;  5IP7 H;  2B2V C;  5GAH C;  1EWH A;  4I7A A;  4I65 A;  5M5X H;  1NAP A;  1K8O A;  2IHF A;  3AMU A;  1PFN A;  2ASB A;  1IYU A;  4HIK A;  4HJA A;  1GUO A;  2BE5 D;  3S16 H;  2F0Q A;  4Y7N B;  4NB3 A;  2PQE A;  5KGU A;  3T51 B;  2UUB Q;  4K0K L;  3BG3 A;  3L2P A;  1DOK A;  3QOL A;  3I4N B;  1EFI D;  1SE4 A;  4EX5 A;  5FO8 B;  2L4N A;  1XTD A;  4FF4 A;  1TU2 B;  5M5X B;  4FVM A;  2O5J C;  4FP5 D;  2OT2 A;  3A8K E;  2JK8 A;  1SE2 A;  1CFM A;  3CRK C;  5H1S E;  3S16 B;  1NJI C;  1C8C A;  3BYY B;  1PH3 A;  1DON A;  4XQJ A;  5EBD A;  1BQQ T;  2XSC A;  2E5L L;  1JWU D;  5JJK A;  1D5M C;  4Q0F A;  2F0P A;  1LTG D;  3G71 A;  3MEH A;  4R4I A;  3RZD H;  3KBG A;  3J81 E;  3Q24 A;  3ND8 A;  3PO2 H;  1MJC A;  1A62 A;  1PTO C;  2K28 A;  2OEO A;  1LT4 D;  4B3M Q;  3M7G A;  1LT3 D;  2PCF B;  2JA5 G;  2QDB A;  2B63 H;  3J80 i;  3HFZ B;  4ZRZ A;  4DK0 A;  5DAU A;  3CCQ A;  2YTV A;  4WRD A;  4DV7 L;  4IUQ A;  1FYC A;  4EQ5 A;  1GHJ A;  3DUZ A;  1MIU A;  4OO1 G;  4BWG B;  3RZD B;  2EQS A;  2F0E A;  3PO2 B;  3I8Z A;  2PQA A;  3T16 A;  4QL5 A;  1KIX A;  4DR3 L;  3RD4 A;  2F4V Q;  4DGZ A;  1Q8I A;  4IPH A;  2B63 B;  4M8A A;  4R4Q A;  1ZEQ X;  2QW7 A;  2EZV A;  5BN3 A;  5JAV A;  3BZK A;  1H9S A;  2NVX H;  2LXK A;  3FHW A;  3MTS A;  5GAG C;  5M3M G;  2JA6 B;  3I4M G;  1BCP C;  2KEN A;  4PMC A;  4J1M A;  5I2Y A;  2E8G A;  2EY1 A;  4A3I B;  2D0P A;  2JA7 G;  5ELO A;  4P72 A;  4TKO B;  1Z7T A;  2F4I A;  5AJ3 Q;  5C4X G;  1I4H A;  4AIM A;  1AEX A;  4XTC S;  4X6A H;  3VDY A;  1I4G A;  1SMY C;  5TSS A;  3E9H A;  4HCE A;  3T53 B;  2NVX B;  2WAQ B;  1T9H A;  4KK7 A;  4CJ0 B;  2EVB A;  1Y8N B;  2VQF L;  5IGE A;  2ID0 A;  3SGI A;  4A3L H;  1Z6H A;  2H1E A;  2IW3 A;  3V96 A;  2DGY A;  4A3D G;  1WTV A;  1S5D D;  2EDG A;  5JVG 3;  1M1K C;  1N36 Q;  1VQB A;  1PYS B;  3GTO B;  4C3H B;  5CYU A;  4AYB B;  1Q7Y C;  1E0B A;  1SRO A;  1QG7 A;  1GKH A;  3U4Z A;  1VDZ A;  3OSO A;  4K5V A;  2CKZ B;  4KY5 A;  1PH7 A;  3SVM A;  3GTL H;  1K73 C;  4RKL A;  2K5N A;  1NBW A;  3D4W A;  3CPW A;  3KLS X;  1EU3 A;  3HKZ G;  5BN5 A;  4GZY C;  4LMQ D;  2RSN A;  1FR3 A;  4OHJ A;  4DV5 Q;  2CW0 D;  1H9R A;  1UUP A;  3EQL C;  1LTT D;  2GN5 A;  1B50 A;  4DXF A;  2IY5 B;  1ONL A;  1YNN D;  1M90 C;  3E9I A;  2OTJ A;  3GTL B;  1IKM A;  3VYS A;  1K8A C;  4XYO A;  1QOH A;  4DV3 Q;  1GM5 A;  3J81 i;  4LFC L;  5IWA L;  1VQ6 A;  1HR0 W;  1E3P A;  1LTL A;  2XTI A;  5E4X A;  1E1T A;  4LF9 Q;  4R1J A;  4JG2 A;  2O4X A;  2XGT A;  4C3J H;  4JBJ A;  5IYB G;  2LS0 1;  3PO3 H;  5ELD A;  1NUC A;  1IBL Q;  3CCU A;  3TRZ A;  2ENB A;  5HY6 A;  1F9R A;  1LAB A;  3TEH B;  4JI4 Q;  3W1G A;  3HZX A;  2BDN A;  4BXX G;  1SE8 A;  1VQM A;  3OW7 A;  4R9W A;  5FLX L;  4AQY Q;  3STB D;  4JI2 L;  4R8N A;  5D3D A;  1XNQ L;  2R7D A;  5D14 A;  3KYH C;  1A2T A;  2KCT A;  3CC4 A;  1LO5 D;  3MC0 B;  5LMN L;  1V1O A;  2F3V A;  4A3C H;  1IKL A;  5C5M A;  1Q1E A;  1ICW A;  3CC7 A;  4GKJ L;  3S15 H;  2K52 A;  3D8G A;  3DWQ A;  3C2P A;  3ITP A;  3UDG A;  1GVP A;  2MUY A;  4GLA C;  1XMO Q;  1N8R C;  4L5S A;  4A3G H;  1W6J A;  2F0D A;  5IT9 L;  4OO1 I;  2A6H D;  3BVM A;  1L0W A;  1B70 B;  4HTH A;  1PRT F;  1MBY A;  2A8V A;  1TWF H;  4JI5 L;  5FOB B;  1ASZ A;  2JA8 H;  3HOY G;  4YCW A;  2HIV A;  4PMB A;  3K57 A;  1R4P B;  3GTJ H;  2OXP A;  3SDZ A;  4A3G B;  4KN4 C;  3FKI H;  3PV0 A;  3KLS A;  1I94 L;  4IAL A;  4KHP Q;  5FJ8 G;  4YY3 L;  3GTK H;  2E2J H;  2JEA I;  1H95 A;  3NBH B;  4LFB L;  4A3F B;  2JA8 B;  5CV7 A;  1K3R A;  1KNE A;  4HJ8 A;  4A3J B;  4FF3 A;  4CGY B;  4LUZ A;  3JAM E;  1VQO A;  4DR2 Q;  3FKI B;  2K33 A;  1V8Q A;  1FL0 A;  1PZI D;  3T13 A;  4CHT B;  3K81 C;  1RD9 D;  3GTK B;  2AKW B;  2E2J B;  4BBR H;  1YZ6 A;  2FFK B;  2XVS A;  4OX9 L;  4FDB A;  3O13 A;  2F52 A;  3OWE B;  1SYB A;  2ZTD A;  4L5T A;  1QUQ A;  4C2M H;  4L6T B;  3M4O H;  2HCC A;  1EY7 A;  5EAY A;  1MI2 A;  1D8L A;  3SK4 A;  3LNN A;  2C5C A;  3FVQ A;  1U4L A;  5M5Y B;  5A2Q L;  3PUW A;  1HFG A;  3MXG A;  4GOP A;  1D7Q A;  1STY A;  4BBS B;  5KEE A;  4ME5 A;  1A8V A;  4B3R L;  1NNX A;  1EY5 A;  5JJZ A;  1LLR D;  1BBW A;  3I72 A;  4E6I A;  4C2M B;  3RLN A;  5HUR A;  2YTY A;  2WB1 G;  1SDF A;  3H15 A;  2DJF C;  3T1H Q;  1I5F A;  1OXS C;  3K6O A;  1UE5 A;  3BZC A;  4J15 A;  3JAM c;  4X62 L;  1DYQ A;  4RCO A;  3T1Y L;  1XPR A;  3ZYY X;  3S2D H;  1IW7 C;  3K5N A;  2RQX A;  3ULJ A;  4B08 A;  1XNR L;  1IBM L;  2ZT9 C;  1U4R A;  1X32 A;  2E2I H;  1M4V A;  5FO7 B;  4X64 L;  4JI0 Q;  5ELE A;  4A3M G;  4I7Z C;  4KD4 A;  4QUC A;  1JOR A;  4FXK C;  4J8Q A;  4HMJ A;  4YHH L;  1CKM A;  1TS2 A;  1VQ8 A;  1L1O A;  2D62 A;  4DN4 M;  1PTO F;  2NZ1 D;  1QZG A;  3MFG A;  2ZJR A;  1F9Q A;  1BOS A;  2J7Z A;  2JA5 H;  1EYD A;  2AHO B;  2E2I B;  1IXR A;  1VCI A;  2UUC L;  3LWU A;  4K0K Q;  3R93 A;  1WTX A;  1HZ9 A;  2L0C A;  3H0G H;  4O0A A;  5FLX c;  4QIW E;  3RUZ A;  3VR4 A;  5C3E B;  3CW2 C;  2F0U A;  4OO1 H;  1OO9 B;  1VQC A;  2EYO A;  1KDB A;  4DV4 L;  3TS2 A;  1LYL A;  4DNT B;  1PYB A;  4ZUI A;  4EVO A;  1I6V C;  3PQI A;  1SJE D;  1I4P A;  4B3T L;  1B9M A;  1IZ6 A;  1NR2 A;  4P73 A;  3H0G B;  4F87 A;  4PMW A;  1FJG Q;  3OHX C;  2NN6 I;  1AN8 A;  2UXB Q;  3I4M H;  3MWY W;  1BCP F;  2MQH A;  4GLV B;  3K58 A;  2HCI A;  2KED A;  4QQB X;  5BN4 A;  1LTB D;  3K59 A;  4WJ4 A;  1DOM A;  4DV6 Q;  2QGQ A;  1RCV D;  5E3F A;  1EOV A;  4HJ7 A;  4UDU C;  4DV7 Q;  3NEL A;  3TP7 A;  1TS4 A;  2L12 A;  5NUC A;  1S4Z A;  2IHE A;  1HNW L;  3PIO A;  4HMI A;  1K9M C;  3CRL C;  4BY7 G;  4A3D H;  1ESF A;  1IL8 A;  2Z6K A;  3KDF B;  5DM6 3;  1RF2 D;  3C46 A;  4OGQ C;  1PH2 A;  2V1C C;  5ISR A;  3CME A;  1CQF A;  2KEE A;  4B3S Q;  5CBA E;  1N32 L;  4X65 Q;  4DV0 L;  1JJC B;  4X3S A;  4CKE A;  1GXD C;  2Q2T A;  1VMP A;  1LTA D;  2M9V A;  3FRP B;  5C3W A;  4Y52 H;  4LF6 L;  3E6Z X;  3ULP A;  4DR6 L;  1UWV A;  3J80 L;  1WCM G;  3GTM B;  3HOU B;  2HDM A;  4LF8 L;  2R7Z G;  4JYA L;  1R4Q B;  1OXT A;  2MJ8 A;  3L9A X;  3UDI A;  1DXM A;  3H94 A;  4V19 0;  1CHQ D;  2A1A A;  2PI2 E;  4A3K H;  4JI6 L;  4HAE A;  1QJO A;  1EUJ A;  2DJG C;  4KHZ A;  1SAP A;  3VR5 A;  1HUM A;  1SYD A;  5C3X A;  4DV2 L;  5EPL A;  4IFD I;  2E2H B;  3W1B A;  1QNU A;  2BA0 A;  4GS3 A;  3S14 H;  4A3K B;  5T1I A;  1I4Q A;  4KKU A;  1X3F A;  3SK5 A;  3V2T A;  1VF5 C;  1PVO A;  2NZH A;  1ILQ A;  3KFU A;  2MHV A;  1JR0 D;  3CAM A;  4JV5 Q;  1EY8 A;  4H7B A;  1A15 A;  2QEJ C;  5KNB A;  1SXT A;  4BY1 G;  1AZQ A;  5EQ0 A;  1I3Q H;  4K14 A;  3NQT A;  3RNU A;  3S14 B;  1YHA A;  1DOL A;  3OOC A;  4LW1 A;  1GUT A;  2XRS D;  1VQE A;  5DLQ E;  1JCK B;  4N8F A;  2NN6 H;  4FO2 A;  3ERO A;  3F2D A;  3MAQ A;  5COY A;  2SEB D;  4P2C B;  1I3Q B;  3CCM A;  1Y1V B;  4JI3 L;  1ML0 D;  4H02 A;  4YWM A;  2Q2H A;  5IGB A;  3OIP A;  2SDF A;  2RDH A;  3GTP H;  1WI5 A;  2DUD A;  2EYP A;  3AFP A;  3HOY H;  1SNP A;  2B2W A;  4K6L A;  3J81 L;  1J6Q A;  4EQN A;  2Q2U A;  4IPG A;  2UU9 Q;  2MO0 A;  4DPG A;  2BH2 A;  5E1F A;  5FJ8 H;  4LF4 L;  4LF5 Q;  2D2C C;  5JEA J;  3GTP B;  3G6E A;  1L2F A;  1YJ9 A;  3T56 B;  1SE3 A;  5EPJ A;  3D4R A;  5IYC H;  3RLF A;  2I0Q A;  2VQE Q;  1EQR A;  3I91 A;  1D6E C;  4JBW A;  4AH6 A;  3CU7 A;  1PDQ A;  4DNR B;  1J5E L;  2EYH A;  3S1M B;  1UE7 A;  2F0I A;  2R61 A;  3KBX A;  2HD3 A;  4WJ3 M;  2PW7 A;  4L5Q A;  1NCV A;  3OWF A;  1B1Z A;  4JBM A;  2R93 H;  3TSS A;  4UP7 A;  5IGD A;  2Y0S G;  2BE5 C;  3VR6 A;  2LKV A;  4KJO A;  4YY3 Q;  2VB2 X;  1VQP A;  4HID A;  1RIP A;  1V43 A;  4QIW B;  2QCP X;  3K80 C;  3TP5 A;  4B9X A;  4LWC A;  3VYU A;  1TVX A;  2FXQ A;  1F2Z A;  2BCO A;  2UXD L;  2PO4 A;  2R93 B;  3J80 c;  3F2C A;  1C9O A;  2Z6B A;  4IFD H;  4A3B H;  4DR1 L;  3UDF A;  4DR5 L;  1QIL A;  4EQP A;  3CD6 A;  2CH4 W;  1XMQ Q;  1UNS A;  4FXD A;  2WFW A;  4K6D A;  1ASY A;  1SN8 A;  5C5L A;  1VQK A;  5GAD C;  3KOJ A;  1DJR D;  1UAP A;  1TT2 A;  4P74 A;  1VMC A;  2LSS A;  2UXC Q;  2I5H A;  1HQM C;  3HOZ B;  4A3M H;  1HA6 A;  4A3B B;  3NTH A;  3FPU B;  3HOW G;  1WJJ A;  3KF8 A;  1XX8 A;  2CHB D;  4N8X 1;  5I9P A;  3KK7 A;  1VF7 A;  1GUW A;  1KNA A;  1B44 D;  5KYL A;  2OF1 A;  2IX1 A;  1XPO A;  2Z9H A;  3ND9 A;  4K8J A;  4ULL A;  1JOK A;  2VY3 A;  1HRJ A;  3GV3 A;  2F3W A;  5JEA G;  5EGT A;  4BS9 A;  4LK1 C;  4LF7 L;  1LV9 A;  1Y14 B;  5EJW A;  2L1B A;  2KOL A;  4DUZ Q;  1V1Q A;  4C3I H;  2EXZ A;  1IHZ A;  2MFI A;  4BA1 I;  3SR1 A;  3BYT B;  1HTP A;  1F2M A;  2B2U A;  5C44 G;  1JWM D;  2PZU A;  5D65 A;  2EY5 A;  2I5M X;  1ENC A;  3K0X A;  3UE1 A;  2B2Y C;  5LMU Q;  1VQF A;  3BDO A;  1O7Z A;  4WFN 3;  5JJL A;  3A56 A;  1WTO A;  3S9W A;  4RKB A;  4C3I B;  4J6H A;  4JI7 Q;  4GNX B;  2BOS A;  1W2B A;  1NMG A;  4FXG C;  1TWC H;  4QJF A;  1E2Z A;  3QWN A;  3X3M A;  1UEA B;  5JPM C;  4BA2 I;  3FEW X;  4LJZ C;  4DV4 Q;  1HHV A;  1TY0 A;  3NHH A;  1GUS A;  1RTO A;  3KLW A;  4KMU C;  2CQA A;  5CV8 A;  4FYD A;  4QF4 A;  2NYZ D;  4A4I A;  3J81 c;  3RZO H;  2A68 D;  4B3T Q;  1EY9 A;  1PH1 A;  2EJM A;  4K5X A;  4KTA A;  4JOI A;  1EWI A;  1XXG A;  1JQY D;  2F1M A;  1X55 A;  1F77 A;  2F0H A;  1CA5 A;  4NW2 A;  3A5Z B;  5ELF A;  3S24 A;  1NTG A;  2K03 A;  5G3L D;  1NY4 A;  2CW0 C;  5EBC A;  3RZO B;  2K5D A;  1WCM H;  4JVZ A;  2NVY H;  2H4O A;  2A69 D;  3IKJ A;  4CBV A;  1YNN C;  3RN5 A;  3IFT A;  1K0R A;  3I73 A;  4MHE A;  4JI1 L;  5E4W C;  3PUY A;  5ELN A;  1ZYR D;  4IJL A;  3HOV H;  3BDL A;  4DUY L;  2R3Z A;  3I3C A;  1CA6 A;  3ONA B;  4GLX A;  1JIC A;  3U4V A;  3NWT A;  1SJH D;  2KJX A;  4R4O A;  3HOX G;  3H3V I;  1I6H H;  2L9H A;  3A0J A;  4MZ9 A;  3D4D A;  1P8L A;  1SYF A;  1AE3 A;  2E76 C;  2EIF A;  2X69 A;  1E22 A;  4IN3 A;  3HOV B;  3JAM L;  1F9S A;  1RHP A;  1FGU A;  2RDG A;  1BCP D;  5C4J H;  1TKW B;  3STB C;  1QZH A;  4MN3 A;  3G7L A;  2B8G A;  1HNZ L;  4OON A;  2VUM G;  4P75 A;  1CSP A;  5M3F G;  4A93 H;  1KLG D;  1WTQ A;  1CM9 A;  3CKI B;  1HNX L;  1SMY D;  4CJ2 C;  1C4Q A;  3GV6 A;  2XWJ B;  1Y1W G;  5J39 A;  2HHH Q;  5C4J B;  3PIP A;  4BY1 H;  4KN7 C;  5IGC A;  2B2V A;  1IBK Q;  2K7V A;  1AFP A;  1B9N A;  4JI8 L;  5IYD G;  2CH4 A;  2M00 A;  3DLL A;  4IUN A;  4H13 C;  1S5F D;  5EKL A;  3NBI A;  4DR7 Q;  4A93 B;  1BKB A;  3LGJ A;  2O5I C;  3IRB A;  2N3S A;  3AU7 A;  3D6W A;  4TQU S;  1G91 A;  2A6H C;  1IYV A;  4X66 Q;  4C3J B;  4YIJ A;  1X3P A;  5BR8 Q;  3PO3 B;  3MXN A;  3ERS X;  2K01 A;  4DV1 L;  1CKO A;  1T5X D;  1JB7 A;  2N55 A;  5EKI A;  1KRS A;  4G7H C;  4IZ8 A;  1BNZ A;  3HKZ E;  1H9J A;  5C0X J;  1S40 A;  2EY6 A;  1V1P A;  2G9H D;  2PQA B;  3AFQ A;  3N6R A;  3P20 A;  3G4S A;  1Q82 C;  1M8A A;  1JE4 A;  3CCS A;  1CZW A;  5C4Z A;  2IL8 A;  1B7Y B;  5M9O A;  4H0L C;  2TSS A;  4M1U B;  1VQA A;  3S15 B;  2JN4 A;  3QO2 A;  2R7F A;  3PCO B;  1H9S B;  3PSI A;  2NUC A;  4S3S A;  5I6Y A;  3DWP A;  1G2T A;  1CKN A;  3BJU A;  3OMC A;  1PXU A;  2A74 C;  2ZTE A;  3OPO A;  5LMN W;  2HDL A;  1LTS D;  4RHR A;  4GKK L;  1MJE A;  1BXT A;  3H09 A;  1F2L A;  4LFA Q;  3DXJ C;  4K2L A;  3D31 A;  4DAY A;  1TWF B;  2K5H A;  3M85 A;  2HIX A;  1JJ2 A;  1RL2 A;  4FF1 A;  2A6E D;  1STN A;  3I55 A;  1JE5 A;  1N33 L;  3GTJ B;  3H3V H;  4DR4 L;  1H9K A;  3DM1 A;  1R9T H;  5C4H A;  1SRU A;  1H9M A;  3CP0 A;  3K7A H;  3J7Z C;  4NXN Q;  1JT8 A;  1WTR A;  1Y69 U;  4ZUJ A;  1OTC A;  2L55 A;  3S1N H;  4DFA A;  1HCZ A;  2AWO A;  2MGS A;  5CV4 A;  1WTW A;  4GN3 B;  3NTK A;  1EIY B;  1XPU A;  1J5E Q;  1N34 Q;  1ET9 A;  3EN2 A;  3Q22 A;  2ZXP A;  4HR7 B;  1JMC A;  3C3L A;  5LL6 S;  3IL8 A;  3MFY A;  3TZD A;  4APV A;  1WD1 A;  1PA6 A;  4HIO A;  2FMM A;  4LAA A;  2HUG A;  3T4A C;  3VYT A;  2ZM6 Q;  3AQQ A;  1CI3 M;  1BVS A;  4N9T A;  2N88 A;  4BBR B;  4DKA C;  5FLM G;  4PZ8 A;  2F03 A;  4RHS A;  3S1N B;  3FMC A;  3PIP 3;  2EYM A;  3M4O B;  1U5K A;  2CVR A;  1EYG A;  1QNK A;  1U0L A;  1PFS A;  3P7J A;  1STA A;  4ALP A;  3J7A V;  1VQ5 A;  5FK9 C;  4DXG A;  3S1R H;  1XYI A;  1A63 A;  2Z4H A;  2F0W A;  3B6Y A;  1YBY A;  4JPB W;  1X3G A;  2KCN A;  1K3B C;  2D9U A;  1EIF A;  3HP3 A;  4TRD A;  5IE8 A;  4R4C A;  4HIM A;  2I5L X;  1NSN S;  1VQI A;  3S1R B;  3S2D B;  4PV1 C;  4A3E G;  1OXX K;  2Z4I A;  4HSP A;  2B3G A;  3CPF A;  2KBN A;  3I4N G;  4OWX B;  5IP7 G;  5C44 H;  1AP0 A;  1Q8K A;  2B2T A;  4DK6 C;  3DEP A;  3I56 A;  1ENA A;  4KD3 A;  1PTO H;  4UHV A;  2R92 G;  5D3I B;  4B3M L;  3DWA A;  4U68 A;  2QKI C;  1GUN A;  4QMG A;  3OTO L;  1WTP A;  1SYG A;  2K05 A;  5J3B A;  3A55 A;  3NQI A;  3A7A B;  4RAU C;  2QIL A;  1EZ8 A;  1W6K A;  2JA5 B;  4F7X A;  3QJY A;  4C56 C;  4PZ6 A;  1FVI A;  2EY2 A;  1HTL D;  2E5L Q;  2MPM A;  4IOA A;  4ZKC B;  4DK1 A;  1PH9 A;  4LF7 Q;  2EJF C;  1Q12 A;  2HQL A;  5M3M H;  1A3U A;  1SSO A;  1YVC A;  4GNX C;  2WB1 E;  2JA7 H;  2LFN A;  4DA2 A;  1EQV A;  1IYJ B;  3F2B A;  3E0E A;  4RG1 A;  1SFO H;  5C4X H;  5DNF A;  2F0F A;  2A19 A;  3W3A A;  4V0B A;  1S5B D;  3PO2 G;  3HKS A;  1CKN B;  5E7N A;  5M3M B;  5AJ3 L;  1EQQ A;  4O1N A;  3I4M B;  4XQQ A;  5EKK A;  2B63 G;  2PZT A;  2Z1C A;  2AQ3 B;  4ZK9 B;  2WII B;  2SNM A;  4PNY A;  4DR3 Q;  2Z0S A;  2JA7 B;  2JE6 I;  2ICE C;  1CQV A;  1SFO B;  5C4X B;  2JA6 G;  3S2H H;  3NEN A;  3U9O A;  1S3O A;  2WKD A;  1EIH A;  4A3I G;  3MZ5 A;  4FF2 A;  3I4O A;  5F2D A;  1N36 L;  3TP6 A;  3HOX H;  1BF4 A;  5AFW A;  2N49 A;  4A3D B;  3NWS A;  2XWB B;  2YYZ A;  2WAQ G;  1QUQ B;  2F0M A;  5CR3 A;  1VS0 A;  3U9S A;  3URY A;  2UUA L;  1YNJ D;  1B4O A;  2EYF A;  1SNO A;  2M2L A;  3MXP A;  1EYC A;  5JVH 3;  1HXY D;  2VQF Q;  4GOP B;  4DV5 L;  1UE1 A;  4C3H G;  1OXV A;  3AYH B;  4AYB G;  3GTG H;  1SEB D;  5CV6 A;  5T1G A;  3HKZ B;  4KKT A;  4RGT A;  5C6A A;  2ZXR A;  1A3T A;  1Y1W H;  3KF6 A;  4DV3 L;  1YI2 A;  1DD2 A;  3TN2 A;  5IYB H;  1AZP A;  3M4Y A;  3IFD A;  2DN8 A;  4LF9 L;  4UY8 C;  3GTG B;  4K2K A;  3BVG A;  3BS1 A;  1WFQ A;  1O7Y A;  4R8I A;  3U50 C;  2QDL A;  2ZXO A;  4BXX H;  2LMC B;  1HJP A;  3KJO A;  1ROD A;  2YV5 A;  4JW0 A;  3G48 A;  4XYQ A;  1IBL L;  1E1O A;  4JI4 L;  1TWH H;  1LM0 A;  2RCN A;  3F1Z A;  3I90 A;  4C1N I;  2XIW A;  1L1O B;  1MSG A;  4AQY L;  2HT1 A;  2ATW A;  1K0S A;  4LFC Q;  5IWA Q;  4FNF A;  1SNQ A;  3PF4 A;  1CT1 D;  1Q1B A;  4Q5V A;  1YJW A;  1VQ9 A;  1Q86 C;  3Q0A A;  1X65 A;  3VA7 A;  1TWH B;  2WP8 J;  3A8J E;  1ICF B;  3SK6 A;  4K8I A;  4Z9C B;  1PFM A;  3S17 H;  3M3Y H;  1KD1 C;  4PZ7 A;  2ZJQ A;  1TQO A;  2LY7 A;  2NVT H;  2CQO A;  3QG1 A;  4NMZ A;  1HUN A;  4CDD C;  3BVZ A;  2B8F A;  4H44 C;  4JI2 Q;  3D3R A;  1XMO L;  1XNQ Q;  2RSO A;  4LUV A;  5LMN Q;  3S17 B;  3M3Y B;  1BBX C;  1VQ7 A;  4HN7 A;  3BU2 A;  2JYO A;  3PIO 3;  2NVT B;  4OIK A;  4GKJ Q;  3PF5 A;  1PH6 A;  4HJ5 A;  1BO0 A;  2VW9 A;  5IGF A;  3FP9 A;  2A5H A;  2TMP A;  4POF A;  5HGQ A;  4JC0 A;  1KAA A;  3NTI A;  4X3T A;  5K36 G;  3HOY B;  5I2X A;  2CWA A;  4KHP L;  1CUK A;  5EPK A;  1F9P A;  2AQ2 B;  4RCN A;  3ICE A;  3QB3 A;  2L15 A;  4JK1 C;  4KV6 A;  1KDC A;  2F0O A;  4DR2 L;  1YIJ A;  4A3G G;  3AEV A;  3D0F A;  4JCV E;  1NE3 A;  1VQJ A;  1CZG A;  4JI5 Q;  1L0Y B;  3ULL A;  1HQR D;  1ZXT A;  1JC7 A;  2F0T A;  1HPC A;  2F0N A;  1KRT A;  1UEB A;  4A3F G;  1I94 Q;  2PMZ E;  2JA8 G;  2QEX A;  2JQO A;  4A3J G;  1KC8 C;  5FLM H;  1W3S A;  2VZA A;  4LFB Q;  3FKI G;  2AWN A;  2NTT A;  3VYR A;  3G6J B;  1Q81 C;  1EY4 A;  1K8M A;  1NMF A;  3H3V C;  1I4X A;  5J1Z A;  1MGS A;  3PMF A;  3LWE A;  3PGZ A;  4QUF A;  2K5W A;  1CHP D;  5I4D A;  3W5O A;  1EYA A;  4ODG A;  1SR3 A;  1TWG H;  3T1H L;  4OX9 Q;  1K83 H;  1WD0 A;  1PRT D;  2JA9 A;  3L3O C;  4IQZ A;  2B29 A;  2P5Z X;  4MNO A;  2WB1 B;  3NP8 A;  4BBS G;  3S1Q H;  3CCE A;  2IT1 A;  5ELC A;  3OW2 A;  4Y7N H;  2YU9 H;  2BH8 A;  4L8J A;  4A3E H;  3TDQ A;  4RGO S;  5ELB A;  4B3R Q;  4NDX A;  4ZLT F;  2K1B A;  1K83 B;  3DEO A;  2KHJ A;  3MXU A;  2E74 C;  2C9O A;  1AW7 A;  2R6G A;  4ZAI A;  3ZJY C;  2Q8R E;  5KYI A;  4A3M B;  2R92 H;  3S1Q B;  4YWK A;  3CMA A;  1Q3L A;  4MTK A;  4X62 Q;  3T1Y Q;  2YU9 B;  1BUV T;  1TR5 A;  4ID6 A;  1JJG A;  2RA4 A;  1RKN A;  4A3E B;  3HEJ A;  1G29 1;  5IIF A;  2VXW A;  1D5X C;  1XNR Q;  3CCR A;  1U9R A;  4XT1 B;  5CV9 A;  3CCJ A;  1Q46 A;  2KCM A;  1IBM Q;  2Y0S E;  3SK8 A;  1S72 A;  4KI0 A;  1E24 A;  1PZK D;  2KHS A;  4X64 Q;  3H91 A;  2MNA A;  4RA8 A;  4UP8 A;  4CJ1 B;  1D2B A;  2R92 B;  2E75 C;  3RR5 A;  2DY7 A;  1RTN A;  2A68 C;  2L11 A;  4YHH Q;  3GD7 A;  1BBU A;  2PPB C;  2CWP A;  1BDO A;  2QF7 A;  3CHB D;  4X3K A;  1X3E A;  4OXP A;  2DY8 A;  3SXH A;  1FJG L;  3J7Y W;  5C3E G;  2UXB L;  2K75 A;  2UUC Q;  2SOB A;  2NVQ H;  3WWV A;  1A2U A;  2NTS A;  4X3U A;  2F0S A;  3A54 A;  1F2Y A;  2PW5 A;  1JB3 A;  2Q8T A;  2A69 C;  4DNI A;  4DV6 L;  2EE1 A;  2F0J A;  3OTO Q;  3N52 A;  1E7Z A;  4BY7 H;  1TS5 A;  1ZYR C;  3H0G G;  2DNE A;  1B3Q A;  4KJN A;  3GDE A;  2JA6 H;  4UAI A;  1VQN A;  3SE0 A;  3Q6S A;  3L7Z C;  3E0J A;  1E2W A;  2NVQ B;  2FIN B;  4A3I H;  1G6Z A;  1SYC A;  1TWC B;  1GUG A;  3BDC A;  3K5L A;  2RF4 A;  4BY7 B;  3HRZ C;  1HA5 A;  5KIX A;  1SMX A;  4B3S L;  1PTO D;  3QIA A;  1MHW C;  3WOF A;  1SNM A;  4X65 L;  2KVM A;  4RH6 A;  4XT3 B;  2EXD A;  2R7Z H;  3QR8 A;  1PZJ D;  1HNW Q;  4G7O C;  3D6C A;  1EL0 A;  3GTO H;  5GAE C;  1FGB D;  1YEZ A;  4C3H H;  5L37 A;  4OIJ A;  2EYL A;  2N8N A;  3NBH A;  4YCU A;  1JWS D;  2OWO A;  3OIQ A;  5A35 A;  4L63 B;  1GJX A;  1HR0 L;  3NPP A;  1WCM B;  2V4D A;  5KRU A;  2NVY B;  2JXM B;  1X56 A;  2WAC A;  5CMD A;  2RHS B;  2R7Z B;  3TS0 A;  3NK9 A;  1N32 Q;  5IOD A;  4C1N K;  1SND A;  3L0O A;  3F8T A;  4GOP C;  4DV0 Q;  3NXW A;  1YJN A;  4OEM B;  1SBB B;  3HOU G;  3HS0 C;  1Z47 A;  4HED A;  4LF6 Q;  1S5C D;  2XNA C;  4DR6 Q;  2OQ0 A;  2RKS A;  1I6H B;  1A3V A;  3CCL A;  1QE6 A;  2UUA Q;  4QB4 A;  2K5Q A;  5IGG A;  3J7A F;  4LF8 Q;  1G8Z D;  3C1F A;  4JYA Q;  5IP9 G;  4CKC A;  1EY0 A;  2FJ2 A;  3KF8 B;  1KQS A;  3TBI B;  5J22 A;  1EEI D;  5M5W H;  4JV5 L;  4NPS A;  3K0Y A;  3I7F A;  2FMC A;  4PG3 A;  4JI6 Q;  1ENF A;  1G6P A;  2BDO A;  4G4K A;  4OWW B;  4N9P A;  5I6W A;  3J7A 5;  2KUM A;  4UPA A;  4DV2 Q;  1I4R A;  1L1O C;  1WOC A;  4A3K G;  1QVG A;  2YTX A;  5CC4 A;  1O78 A;  4BY1 B;  1DZ1 A;  1KXL A;  2JP1 A;  5M5W B;  1Q90 A;  3U58 A;  2B2T C;  2K4K A;  1MD2 D;  1X3Q A;  1JOQ A;  1D5Z C;  2JEB I;  4F88 A;  4JBK A;  1VQL A;  2PMZ B;  3CF5 A;  2K6A A;  4IO9 A;  1K8G A;  4IJH A;  1D1K A;  2KA7 A;  2VS1 A;  1C7Y A;  3GTQ H;  4KKS A;  2OCE A;  3HG9 A;  1PMR A;  3NEM A;  3TRE A;  1ET6 A;  1WTH A;  2A6E C;  2D0O A;  3NE5 B;  2UU9 L;  1TXY A;  1Y1V G;  5K36 H;  1STB A;  2B2Y A;  2VL6 A;  4IFD J;  3KUP A;  5DM7 3;  1S5E D;  4LF5 L;  2IX0 A;  2JSO A;  2PNR C;  2I07 B;  3GTQ B;  2H5X A;  4CKB A;  1VQG A;  2NN6 G;  3M4P A;  4JI3 Q;  4POG A;  4WOR A;  1X6O A;  4KY7 A;  1YHB A;  4F8M A;  2XRQ D;  5LHY 1;  4IUR A;  4IPD A;  2GVA A;  4MIU A;  4YWL A;  2VQE L;  2AUK A;  1D1I A;  5COR A;  4IUP A;  4K5W A;  1SLJ A;  3PUX A;  4A3F H;  2Z6K C;  1LT5 D;  1B8A A;  1YHQ A;  3NUC A;  5K5P A;  1WVL A;  4LUO A;  1PRT B;  3F2U A;  4A3J H;  3K5O A;  3X3N A;  4LF4 Q;  4RMF A;  2EOT A;  1ZKO A;  1TII D;  1KDA A;  1CTM A;  1QCB D;  5I9O A;  1QB5 D;  1N9W A;  2Y0S B;  3KDF A;  1KAB A;  4O2D A;  3ERQ A;  1WYD A;  1A0I A;  1R9T B;  3A8I E;  4NXM L;  4XXE A;  1GHK A;  5IYC G;  2B39 A;  3K7A B;  4G57 A;  5M5Y H;  2KCC A;  1EEF D;  1XMQ L;  2EJG C;  5DEH A;  4G7Z C;  4BBS H;  4MTN A;  2AUJ D;  3WDN A;  3HOW H;  3HGB A;  5IOC A;  3R2I A;  1J8I A;  1KTK A;  3QOJ A;  1VQH A;  2XN9 C;  3Q8D A;  2UXC L;  1FNV A;  2R93 G;  3A5U A;  3M7N A;  2UUB L;  1STG A;  2G9D A;  2RCF A;  2NWG A;  2UXD Q;  5C0X G;  1E2V A;  3LX0 A;  1DM0 B;  3FPP A;  3C1E A;  2MO1 A;  3HOW B;  4DR1 Q;  4DR5 Q;  1B53 A;  2AQ1 B;  1I50 H;  2F0K A;  3WOE A;  5JEA H;  5FLX E;  3RLO A;  1PV4 A;  4R4T A;  1JOO A;  2NBF A;  3JC6 6;  4TSS A;  3HOZ G;  4ZQ3 A;  3H6M A;  1EY6 A;  4IOC A;  4IFD G;  4A3B G;  4EQO A;  1L0X B;  4CDE C;  3GQB A;  1CSQ A;  4DU9 A;  3TP8 A;  1ILP A;  4GN4 B;  4DUZ L;  3RMH A;  4A76 A;  3MXN B;  1I50 B;  3RN2 A;  3SHL A;  3EJI A;  1MSH A;  2Q2I A;  5HGT A;  5CV5 A;  2NZO A;  5C3E H;  4ME3 A;  2IX3 A;  4IPC A;  4A75 A;  1LTR D;  5LMU L;  5G3L F;  4LNQ A;  5C44 B;  1VQ4 A;  5IT9 E;  4P71 A;  1V1P B;  2O2L D;  1X9N A;  4PQX A;  1PTO B;  4JI7 L;  2F4V L;  3M9B A;  1IW7 D;  4WJW A;  3ER0 A;  3M4Q A;  2MP1 A;  2C35 B;  2JJQ A;  1U4P A;  1G51 A;  1FNU A;  5FO9 B;  3DHQ A;  4DAP A;  2B2W C;  3P75 A;  1EWC A;  3VR2 A;  4B9W A;  1TS3 A;  1EFW A;  1Z9F A;  4C3I G;  2L5T A;  4DAV A;  3TZU A;  1YNJ C;  3R8B A;  3JAM i;  2WKC A;  1C48 A;  2PZW A;  2E2D C;  1NR4 A;  3I70 A;  1SNC A;  4DAY B;  3DM3 A;  3CC2 A;  1AH9 A;  2KHI A;  3R2T A;  1BCP B;  1PHJ A;  5IT9 c;  3K8A A;  3MA2 B;  2F3I A;  1QVF A;  1PYW D;  1EU4 A;  2Q8I B;  1B3A A;  3V05 A;  5KND A;  1ESR A;  4KY6 A;  1CK1 A;  3UDX A;  4XQN A;  2ALY B;  1FNW A;  5JJI A;  2EPB A;  2VNU D;  1A6X A;  2G5D A;  3S2H B;  2ICI A;  1U4M A;  5A2Q E;  4EGV A;  2K50 A;  3GTM H;  3HOU H;  3HOX B;  1LUZ A;  1KL9 A;  2DNC A;  4QGU A;  2VUM H;  2RHQ B;  5M3F H;  1FD7 D;  3AB9 A;  4JI1 Q;  3I2Z A;  3CXC A;  4KHV A;  4U67 3;  4DUY Q;  2K32 A;  2IWH A;  5IP9 H;  1II3 A;  4HCS A;  4A3L G;  1YNX A;  4ZKB B;  1LT6 D;  4CDC C;  1DCZ A;  3W2D A;  2LXJ A;  1GD7 A;  1BR9 A;  4XDX A;  5IYD H;  2OQK A;  3EVQ A;  3K7U C;  4IUT A;  3MHB A;  3HOV G;  1HR0 Q;  4DAM A;  2VUM B;  3GP7 A;  2HHH L;  4IUU A;  5M3F B;  4ZCK A;  1IBK L;  1O7L A;  2CCZ A;  1O7I A;  3FDT A;  2E2H H;  3IAY A;  1PH5 A;  4NP5 A;  1TWA H;  2RBM A;  3EIV A;  3CCV A;  4OWT B;  3A7L A;  5GRO A;  1Y1W B;  1TY2 A;  5C0X I;  4RGN A;  3R3O A;  2PNH A;  3K5M A;  3E3X A;  2NB0 A;  4DR7 L;  2RVL A;  3PUV A;  1EOT A;  4O42 A;  4UP9 A;  2J0T D;  2GVB A;  2N78 A;  2WV6 D;  5CGK A;  1HNZ Q;  1XJV A;  4X66 L;  1MKH A;  3SEB A;  2ES2 A;  2GA4 B;  2BA1 A;  3CQZ H;  1RDP D;  5BR8 L;  4ILW A;  2RDF A;  3A74 A;  1V9P A;  1HNX Q;  1TWA B;  2D5D A;  1LAC A;  1YIT A;  4OL7 A;  3I4L A;  1Y8P B;  4YCV A;  4CDF C;  2WAQ E;  4A93 G;  5IY0 A;  1UE6 A;  4JI8 Q;  2FHT A;  1EIG A;  5JPN C;  1QVC A;  4C3J G;  3CQZ B;  2B2U C;  3EBE A;  3PO3 G;  1Y1V H;  1HH2 P;  1P16 A;  4AYB E;  3J81 j;  3UI2 A;  1PH4 A;  1KLU D;  1KAW A;  4DV1 Q;  2F0L A;  2KQ3 A;  4XIG S;  3KJP A;  1EQT A;  2X6G A;  1C0A A;  3KLR A;  1PH8 A;  2VB3 X;  2AMC B;  4A3C G;  1EZ6 A;  2X6L A;  3MVV A;  4IUV A;  1Y8O B;  2A73 B;  5GQO A;  3VA5 A;  3TQY A;  1OXU A;  4HSV A;  4LFA L;  2QA4 A;  2PYK A;  2OTL A;  4GNX A;  1G2S A;  4HJ9 A;  4NKL A;  1HZB A;  4JOI C;  2J4X A;  5CBE E;  4QCL A;  5LL6 X;  3OYY A;  3EA6 A;  3P1H A;  2SNS A;  1LTI D;  2IPK D;  2PI2 A;  3S1M H;  3NSW A;  1HZA A;  2ZTC A;  1XWE A;  4RFB A;  4L5R C;  2IJ0 A;  3EFX D;  4NXN L;  4GN5 A;  3TME A;  1O80 A;  3BZD B;  1PRT C;  2Z8L A;  1XTC D;  3J80 E;  3Q23 A;  3OMG A;  1VQD A;  1STE A;  2CFM A;  1T5E A;  4GKK Q;  1GO3 E;  1GOZ A;  5FKA C;  3VR3 A;  1J9O A;  4DF7 A;  3GO5 A;  1N34 L;  2K5V A;  3PUZ A;  5KNC A;  5JOB A;  1N33 Q;  2ZM6 L;  1AE2 A;  3MEF A;  1PFB A;  4DR4 Q;  2F0V A;  3UE0 A;  1HFN A;  1QWY A;  2HQE A;  1HZC A;  4DK3 C;  2WIN B;  2ZJP A;  1RJT A;  1X54 A;  4QY7 A;  5C0X H;  3KF6 B;  2I46 A;  3E5S A;  2K04 A;  3DMU A; 
#chains in the Genus database with same CATH homology
 1SYE A;  2F0G A;  4ABN A;  2KEC A;  1STH A;  4ZYS A;  4RWS C;  1TWG B;  2EYJ A;  1B2T A;  1PLF A;  4RGM A;  2B2V C;  1EWH A;  4I65 A;  1NAP A;  1K8O A;  3AMU A;  1PFN A;  1IYU A;  1GUO A;  2BE5 D;  2F0Q A;  4Y7N B;  2PQE A;  5KGU A;  3T51 B;  3BG3 A;  1DOK A;  3QOL A;  3I4N B;  1EFI D;  1SE4 A;  5FO8 B;  2L4N A;  4FF4 A;  1TU2 B;  5M5X B;  4FVM A;  2O5J C;  4FP5 D;  2OT2 A;  3A8K E;  1SE2 A;  1CFM A;  3CRK C;  3S16 B;  1C8C A;  3BYY B;  1DON A;  4XQJ A;  5EBD A;  1BQQ T;  2XSC A;  1JWU D;  1D5M C;  4Q0F A;  2F0P A;  1LTG D;  3MEH A;  3KBG A;  3J81 E;  3Q24 A;  3ND8 A;  1PTO C;  2K28 A;  2OEO A;  1LT4 D;  3M7G A;  1LT3 D;  2PCF B;  2QDB A;  4ZRZ A;  4DK0 A;  5DAU A;  4WRD A;  4IUQ A;  1FYC A;  1GHJ A;  3DUZ A;  4OO1 G;  4BWG B;  3RZD B;  2F0E A;  3PO2 B;  3I8Z A;  3T16 A;  3RD4 A;  4DGZ A;  1Q8I A;  2B63 B;  4M8A A;  1ZEQ X;  2EZV A;  5BN3 A;  5JAV A;  1H9S A;  3MTS A;  2JA6 B;  1BCP C;  4PMC A;  4J1M A;  5I2Y A;  2EY1 A;  4A3I B;  4TKO B;  1Z7T A;  2F4I A;  1I4H A;  1AEX A;  4XTC S;  1I4G A;  1SMY C;  5TSS A;  4HCE A;  3T53 B;  2NVX B;  2WAQ B;  4KK7 A;  4CJ0 B;  2EVB A;  1Y8N B;  5IGE A;  2ID0 A;  1Z6H A;  2H1E A;  2IW3 A;  3V96 A;  1WTV A;  1S5D D;  2EDG A;  5JVG 3;  3GTO B;  4C3H B;  5CYU A;  4AYB B;  1E0B A;  1QG7 A;  1VDZ A;  3OSO A;  4K5V A;  4KY5 A;  3SVM A;  4RKL A;  3D4W A;  3KLS X;  1EU3 A;  5BN5 A;  4GZY C;  4LMQ D;  2RSN A;  1FR3 A;  4OHJ A;  2CW0 D;  1H9R A;  1UUP A;  3EQL C;  1LTT D;  1B50 A;  4DXF A;  1ONL A;  1YNN D;  3GTL B;  1IKM A;  3VYS A;  4XYO A;  1QOH A;  5E4X A;  2O4X A;  2LS0 1;  5ELD A;  1NUC A;  2ENB A;  1F9R A;  1LAB A;  3HZX A;  2BDN A;  3OW7 A;  4R9W A;  5FLX L;  4R8N A;  5D3D A;  5D14 A;  1A2T A;  1LO5 D;  3MC0 B;  1V1O A;  2F3V A;  1IKL A;  5C5M A;  1Q1E A;  1ICW A;  3D8G A;  3DWQ A;  3C2P A;  3ITP A;  2MUY A;  1W6J A;  2F0D A;  5IT9 L;  4OO1 I;  2A6H D;  3BVM A;  4HTH A;  1PRT F;  1MBY A;  5FOB B;  3K57 A;  4PMB A;  1R4P B;  2OXP A;  3SDZ A;  4A3G B;  4KN4 C;  3PV0 A;  3KLS A;  4IAL A;  2JEA I;  4A3F B;  2JA8 B;  5CV7 A;  1KNE A;  4FF3 A;  4A3J B;  4CGY B;  3JAM E;  3FKI B;  2K33 A;  1V8Q A;  4CHT B;  1PZI D;  3T13 A;  1RD9 D;  3GTK B;  2E2J B;  2FFK B;  2XVS A;  3O13 A;  3OWE B;  1SYB A;  4L6T B;  2HCC A;  1EY7 A;  1MI2 A;  3SK4 A;  3LNN A;  2C5C A;  3FVQ A;  1U4L A;  5M5Y B;  5A2Q L;  3PUW A;  1HFG A;  3MXG A;  1STY A;  4BBS B;  5KEE A;  4ME5 A;  1EY5 A;  5JJZ A;  1LLR D;  3I72 A;  4E6I A;  4C2M B;  5HUR A;  1SDF A;  1OXS C;  3K6O A;  1DYQ A;  4RCO A;  3ZYY X;  1IW7 C;  3K5N A;  2RQX A;  4B08 A;  2ZT9 C;  1U4R A;  1X32 A;  1M4V A;  5FO7 B;  5ELE A;  4I7Z C;  4KD4 A;  4QUC A;  1JOR A;  4FXK C;  4J8Q A;  4HMJ A;  1TS2 A;  2D62 A;  4DN4 M;  1PTO F;  2NZ1 D;  3MFG A;  1F9Q A;  1BOS A;  2J7Z A;  1EYD A;  2E2I B;  1VCI A;  3LWU A;  3R93 A;  1WTX A;  2L0C A;  3RUZ A;  3VR4 A;  5C3E B;  2F0U A;  4OO1 H;  1OO9 B;  2EYO A;  1KDB A;  4DNT B;  4ZUI A;  4EVO A;  1I6V C;  1SJE D;  1I4P A;  1B9M A;  1NR2 A;  3H0G B;  4F87 A;  4PMW A;  3OHX C;  2NN6 I;  1AN8 A;  3MWY W;  1BCP F;  3K58 A;  2HCI A;  2KED A;  5BN4 A;  1LTB D;  3K59 A;  1DOM A;  1RCV D;  5E3F A;  4UDU C;  3TP7 A;  1TS4 A;  2L12 A;  5NUC A;  1S4Z A;  4HMI A;  3CRL C;  1ESF A;  1IL8 A;  5DM6 3;  1RF2 D;  3C46 A;  4OGQ C;  5ISR A;  1CQF A;  2KEE A;  5CBA E;  4X3S A;  4CKE A;  1GXD C;  1VMP A;  1LTA D;  2M9V A;  3FRP B;  5C3W A;  3E6Z X;  3J80 L;  3GTM B;  3HOU B;  2HDM A;  1R4Q B;  1OXT A;  2MJ8 A;  3L9A X;  1DXM A;  3H94 A;  4V19 0;  1CHQ D;  4HAE A;  1QJO A;  4KHZ A;  1SAP A;  3VR5 A;  1HUM A;  1SYD A;  5C3X A;  5EPL A;  4IFD I;  2E2H B;  1QNU A;  2BA0 A;  4A3K B;  5T1I A;  1I4Q A;  4KKU A;  3SK5 A;  3V2T A;  1VF5 C;  1ILQ A;  2MHV A;  1JR0 D;  1EY8 A;  4H7B A;  1A15 A;  2QEJ C;  5KNB A;  1SXT A;  1AZQ A;  5EQ0 A;  4K14 A;  3NQT A;  3S14 B;  1DOL A;  3OOC A;  1GUT A;  2XRS D;  1JCK B;  2NN6 H;  4FO2 A;  3ERO A;  3MAQ A;  5COY A;  2SEB D;  4P2C B;  1I3Q B;  1Y1V B;  1ML0 D;  5IGB A;  3OIP A;  2SDF A;  2RDH A;  2EYP A;  1SNP A;  2B2W A;  4K6L A;  3J81 L;  4EQN A;  5E1F A;  2D2C C;  5JEA J;  3GTP B;  3T56 B;  1SE3 A;  5EPJ A;  3D4R A;  3RLF A;  3I91 A;  1D6E C;  4JBW A;  3CU7 A;  1PDQ A;  4DNR B;  2EYH A;  3S1M B;  2F0I A;  2R61 A;  3KBX A;  2PW7 A;  1NCV A;  3OWF A;  1B1Z A;  3TSS A;  5IGD A;  2BE5 C;  3VR6 A;  2LKV A;  4KJO A;  2VB2 X;  1V43 A;  4QIW B;  2QCP X;  3TP5 A;  4B9X A;  3VYU A;  1TVX A;  1F2Z A;  2BCO A;  2PO4 A;  2R93 B;  4IFD H;  1QIL A;  4EQP A;  1UNS A;  4FXD A;  4K6D A;  5C5L A;  1DJR D;  1UAP A;  1TT2 A;  1VMC A;  3HOZ B;  1HQM C;  1HA6 A;  4A3B B;  3NTH A;  3FPU B;  3KF8 A;  1XX8 A;  2CHB D;  5I9P A;  3KK7 A;  1VF7 A;  1GUW A;  1KNA A;  1B44 D;  5KYL A;  2OF1 A;  2IX1 A;  3ND9 A;  4K8J A;  4ULL A;  1JOK A;  1HRJ A;  3GV3 A;  2F3W A;  5JEA G;  5EGT A;  4BS9 A;  4LK1 C;  1LV9 A;  5EJW A;  2L1B A;  2KOL A;  2EXZ A;  1IHZ A;  4BA1 I;  3SR1 A;  3BYT B;  1HTP A;  1F2M A;  2B2U A;  1JWM D;  2PZU A;  5D65 A;  2EY5 A;  1ENC A;  2B2Y C;  3BDO A;  1O7Z A;  4WFN 3;  3A56 A;  1WTO A;  3S9W A;  4RKB A;  4C3I B;  4J6H A;  2BOS A;  4FXG C;  1E2Z A;  3QWN A;  3X3M A;  1UEA B;  5JPM C;  4BA2 I;  3FEW X;  4LJZ C;  1HHV A;  1TY0 A;  3NHH A;  1GUS A;  1RTO A;  4KMU C;  2CQA A;  5CV8 A;  4FYD A;  4QF4 A;  2NYZ D;  2A68 D;  1EY9 A;  2EJM A;  4K5X A;  4KTA A;  1XXG A;  1JQY D;  2F1M A;  1F77 A;  2F0H A;  1CA5 A;  4NW2 A;  5ELF A;  2K03 A;  5G3L D;  2CW0 C;  5EBC A;  3RZO B;  2K5D A;  2H4O A;  2A69 D;  3IKJ A;  4CBV A;  1YNN C;  3IFT A;  4MHE A;  3I73 A;  5E4W C;  3PUY A;  1ZYR D;  3BDL A;  2R3Z A;  3I3C A;  1CA6 A;  3ONA B;  1JIC A;  3NWT A;  1SJH D;  2KJX A;  2L9H A;  3D4D A;  1SYF A;  2E76 C;  2X69 A;  4IN3 A;  3HOV B;  3JAM L;  1F9S A;  1RHP A;  2RDG A;  1BCP D;  1TKW B;  4MN3 A;  3G7L A;  2B8G A;  1KLG D;  1WTQ A;  1CM9 A;  3CKI B;  1SMY D;  4CJ2 C;  1C4Q A;  3GV6 A;  2XWJ B;  5J39 A;  5C4J B;  4KN7 C;  5IGC A;  2B2V A;  2K7V A;  1AFP A;  1B9N A;  2M00 A;  4IUN A;  4H13 C;  1S5F D;  5EKL A;  3NBI A;  4A93 B;  2O5I C;  3AU7 A;  3D6W A;  4TQU S;  1G91 A;  2A6H C;  1IYV A;  4C3J B;  4YIJ A;  1X3P A;  3PO3 B;  3MXN A;  2K01 A;  1T5X D;  2N55 A;  5EKI A;  4G7H C;  4IZ8 A;  1BNZ A;  1H9J A;  5C0X J;  2EY6 A;  1V1P A;  2G9H D;  3N6R A;  3P20 A;  1M8A A;  1JE4 A;  1CZW A;  5C4Z A;  2IL8 A;  5M9O A;  4H0L C;  2TSS A;  4M1U B;  3S15 B;  3QO2 A;  1H9S B;  2NUC A;  4S3S A;  5I6Y A;  3DWP A;  1G2T A;  3OMC A;  1PXU A;  2A74 C;  3OPO A;  2HDL A;  1LTS D;  4RHR A;  1BXT A;  3H09 A;  1F2L A;  3DXJ C;  4K2L A;  3D31 A;  4DAY A;  1TWF B;  3M85 A;  4FF1 A;  2A6E D;  1STN A;  3GTJ B;  1H9K A;  3DM1 A;  5C4H A;  1H9M A;  1WTR A;  1Y69 U;  4ZUJ A;  2L55 A;  4DFA A;  5CV4 A;  1HCZ A;  2AWO A;  2MGS A;  1WTW A;  3NTK A;  1ET9 A;  3Q22 A;  3C3L A;  2ZXP A;  4HR7 B;  5LL6 S;  3IL8 A;  3MFY A;  3TZD A;  1WD1 A;  2FMM A;  4LAA A;  2HUG A;  3T4A C;  3VYT A;  1CI3 M;  4N9T A;  2N88 A;  4BBR B;  2F03 A;  4RHS A;  3S1N B;  3FMC A;  3PIP 3;  2EYM A;  3M4O B;  2CVR A;  1QNK A;  3P7J A;  1STA A;  3J7A V;  5FK9 C;  4DXG A;  1XYI A;  2Z4H A;  2F0W A;  2KCN A;  2D9U A;  3HP3 A;  4TRD A;  1NSN S;  3S1R B;  3S2D B;  4PV1 C;  1OXX K;  2Z4I A;  4HSP A;  1AP0 A;  2B2T A;  3DEP A;  1ENA A;  4KD3 A;  1PTO H;  5D3I B;  3DWA A;  4U68 A;  2QKI C;  1GUN A;  4QMG A;  1WTP A;  1SYG A;  2K05 A;  3A55 A;  3NQI A;  3A7A B;  4RAU C;  2QIL A;  1EZ8 A;  1W6K A;  2JA5 B;  4F7X A;  3QJY A;  4C56 C;  2EY2 A;  1HTL D;  2MPM A;  4ZKC B;  4DK1 A;  2EJF C;  1Q12 A;  1A3U A;  1SSO A;  2LFN A;  4DA2 A;  1EQV A;  5DNF A;  2F0F A;  3W3A A;  4V0B A;  1S5B D;  5M3M B;  4O1N A;  3I4M B;  4XQQ A;  5EKK A;  2PZT A;  2Z1C A;  2AQ3 B;  4ZK9 B;  2WII B;  2SNM A;  4PNY A;  2JA7 B;  2JE6 I;  2ICE C;  1CQV A;  1SFO B;  5C4X B;  3U9O A;  2WKD A;  1EIH A;  3MZ5 A;  4FF2 A;  5F2D A;  3TP6 A;  1BF4 A;  5AFW A;  4A3D B;  3NWS A;  2XWB B;  2YYZ A;  2F0M A;  5CR3 A;  3U9S A;  3URY A;  1YNJ D;  1B4O A;  2EYF A;  1SNO A;  2M2L A;  3MXP A;  1EYC A;  5JVH 3;  1HXY D;  4C3H G;  1OXV A;  1SEB D;  5CV6 A;  5T1G A;  3HKZ B;  4KKT A;  4RGT A;  5C6A A;  2ZXR A;  1A3T A;  1DD2 A;  3TN2 A;  1AZP A;  3M4Y A;  3IFD A;  2DN8 A;  3GTG B;  4K2K A;  3BVG A;  3BS1 A;  1O7Y A;  4R8I A;  2ZXO A;  2LMC B;  1ROD A;  4XYQ A;  3I90 A;  4C1N I;  2XIW A;  1MSG A;  4FNF A;  1SNQ A;  1CT1 D;  1Q1B A;  4Q5V A;  3Q0A A;  3VA7 A;  1TWH B;  2WP8 J;  3A8J E;  3SK6 A;  4K8I A;  4Z9C B;  1PFM A;  1TQO A;  2LY7 A;  3QG1 A;  4NMZ A;  1HUN A;  3BVZ A;  2B8F A;  4H44 C;  3D3R A;  2RSO A;  3S17 B;  3M3Y B;  1BBX C;  4HN7 A;  2JYO A;  3PIO 3;  2NVT B;  4OIK A;  1BO0 A;  5IGF A;  2A5H A;  2TMP A;  1KAA A;  3NTI A;  4X3T A;  5K36 G;  3HOY B;  5I2X A;  5EPK A;  1F9P A;  2AQ2 B;  4RCN A;  3QB3 A;  4JK1 C;  4KV6 A;  1KDC A;  2F0O A;  1CZG A;  1L0Y B;  1HQR D;  1ZXT A;  1JC7 A;  2F0T A;  1HPC A;  2F0N A;  2AWN A;  2NTT A;  3VYR A;  3G6J B;  1EY4 A;  1K8M A;  3H3V C;  1I4X A;  5J1Z A;  1MGS A;  3PMF A;  3LWE A;  4QUF A;  2K5W A;  1CHP D;  5I4D A;  1EYA A;  4ODG A;  1WD0 A;  1PRT D;  3L3O C;  4IQZ A;  2WB1 B;  3NP8 A;  2IT1 A;  5ELC A;  4L8J A;  3TDQ A;  4RGO S;  5ELB A;  4NDX A;  4ZLT F;  2K1B A;  1K83 B;  3DEO A;  3MXU A;  2E74 C;  2C9O A;  1AW7 A;  2R6G A;  4ZAI A;  5KYI A;  2Q8R E;  4A3M B;  3S1Q B;  1Q3L A;  2YU9 B;  1BUV T;  1TR5 A;  4ID6 A;  2RA4 A;  1RKN A;  4A3E B;  3HEJ A;  1G29 1;  5IIF A;  2VXW A;  1D5X C;  1U9R A;  4XT1 B;  5CV9 A;  3SK8 A;  4KI0 A;  1PZK D;  2KHS A;  3H91 A;  4RA8 A;  4CJ1 B;  1D2B A;  2R92 B;  2E75 C;  2DY7 A;  1RTN A;  2A68 C;  2L11 A;  2PPB C;  3GD7 A;  1BDO A;  2QF7 A;  3CHB D;  4X3K A;  2DY8 A;  3SXH A;  3J7Y W;  2SOB A;  1A2U A;  2NTS A;  4X3U A;  2F0S A;  3A54 A;  1F2Y A;  2PW5 A;  1JB3 A;  2Q8T A;  2A69 C;  2EE1 A;  2F0J A;  3N52 A;  1TS5 A;  1ZYR C;  2DNE A;  4KJN A;  4UAI A;  3SE0 A;  3Q6S A;  3L7Z C;  3E0J A;  1E2W A;  2NVQ B;  2FIN B;  1G6Z A;  1SYC A;  1TWC B;  1GUG A;  3BDC A;  3K5L A;  4BY7 B;  3HRZ C;  1HA5 A;  5KIX A;  1PTO D;  3QIA A;  3WOF A;  1SNM A;  2KVM A;  4RH6 A;  4XT3 B;  1PZJ D;  4G7O C;  3D6C A;  1EL0 A;  1FGB D;  4OIJ A;  2EYL A;  3NBH A;  1JWS D;  3OIQ A;  5A35 A;  4L63 B;  1GJX A;  3NPP A;  1WCM B;  5KRU A;  2V4D A;  2NVY B;  2JXM B;  2WAC A;  5CMD A;  2R7Z B;  3NK9 A;  5IOD A;  4C1N K;  1SND A;  3NXW A;  1SBB B;  3HS0 C;  1Z47 A;  4HED A;  1S5C D;  2XNA C;  2RKS A;  1I6H B;  1A3V A;  1QE6 A;  4QB4 A;  2K5Q A;  5IGG A;  3J7A F;  1G8Z D;  3C1F A;  4CKC A;  1EY0 A;  2FJ2 A;  3TBI B;  5J22 A;  1EEI D;  3K0Y A;  2FMC A;  1ENF A;  2BDO A;  4G4K A;  4N9P A;  5I6W A;  2KUM A;  1I4R A;  4BY1 B;  5CC4 A;  1O78 A;  1DZ1 A;  2JP1 A;  5M5W B;  1Q90 A;  2B2T C;  1MD2 D;  1X3Q A;  1JOQ A;  1D5Z C;  2JEB I;  4F88 A;  2PMZ B;  2K6A A;  1D1K A;  2KA7 A;  4KKS A;  3HG9 A;  1PMR A;  1ET6 A;  2A6E C;  3NE5 B;  5K36 H;  1STB A;  2B2Y A;  4IFD J;  3KUP A;  5DM7 3;  1S5E D;  2IX0 A;  2JSO A;  2PNR C;  2I07 B;  3GTQ B;  4CKB A;  2NN6 G;  4WOR A;  4KY7 A;  4F8M A;  2XRQ D;  5LHY 1;  4IUR A;  4MIU A;  2AUK A;  1D1I A;  5COR A;  4IUP A;  4K5W A;  3PUX A;  1LT5 D;  3NUC A;  5K5P A;  1WVL A;  1PRT B;  3F2U A;  3K5O A;  3X3N A;  2EOT A;  1ZKO A;  1TII D;  1KDA A;  1CTM A;  1QCB D;  5I9O A;  1QB5 D;  2Y0S B;  1KAB A;  3ERQ A;  1R9T B;  3A8I E;  4XXE A;  1GHK A;  2B39 A;  3K7A B;  4G57 A;  2KCC A;  1EEF D;  2EJG C;  5DEH A;  4G7Z C;  2AUJ D;  3WDN A;  3HGB A;  5IOC A;  3R2I A;  1J8I A;  1KTK A;  3QOJ A;  2XN9 C;  1FNV A;  3M7N A;  1STG A;  2G9D A;  2NWG A;  5C0X G;  1E2V A;  3LX0 A;  1DM0 B;  3FPP A;  3C1E A;  3HOW B;  1B53 A;  2AQ1 B;  2F0K A;  3WOE A;  5JEA H;  5FLX E;  1JOO A;  2NBF A;  4TSS A;  4ZQ3 A;  3H6M A;  1EY6 A;  4IFD G;  4EQO A;  1L0X B;  3GQB A;  4DU9 A;  3TP8 A;  1ILP A;  3RMH A;  1I50 B;  3SHL A;  3EJI A;  1MSH A;  5HGT A;  5CV5 A;  2IX3 A;  1LTR D;  5G3L F;  5C44 B;  5IT9 E;  1V1P B;  2O2L D;  4PQX A;  1PTO B;  1IW7 D;  4WJW A;  2MP1 A;  1U4P A;  1FNU A;  5FO9 B;  3DHQ A;  4DAP A;  2B2W C;  3P75 A;  1EWC A;  3VR2 A;  4B9W A;  1TS3 A;  4C3I G;  2L5T A;  4DAV A;  3TZU A;  1YNJ C;  3R8B A;  2WKC A;  1C48 A;  2PZW A;  2E2D C;  1NR4 A;  3I70 A;  1SNC A;  3R2T A;  1BCP B;  3MA2 B;  1PYW D;  1EU4 A;  2Q8I B;  1B3A A;  3V05 A;  5KND A;  1ESR A;  4KY6 A;  1CK1 A;  4XQN A;  1FNW A;  2EPB A;  2VNU D;  1A6X A;  3S2H B;  2ICI A;  1U4M A;  5A2Q E;  4EGV A;  3HOX B;  2DNC A;  1FD7 D;  3AB9 A;  4KHV A;  4U67 3;  2K32 A;  2IWH A;  1II3 A;  4HCS A;  4ZKB B;  1LT6 D;  1DCZ A;  3W2D A;  1BR9 A;  4XDX A;  3EVQ A;  4IUT A;  3MHB A;  2VUM B;  3GP7 A;  4IUU A;  5M3F B;  1O7L A;  3FDT A;  3IAY A;  4NP5 A;  2RBM A;  3A7L A;  1Y1W B;  1TY2 A;  5C0X I;  4RGN A;  3R3O A;  3K5M A;  2NB0 A;  2RVL A;  3PUV A;  1EOT A;  4O42 A;  2J0T D;  5CGK A;  2WV6 D;  3SEB A;  2GA4 B;  2BA1 A;  1RDP D;  4ILW A;  2RDF A;  1TWA B;  2D5D A;  1LAC A;  4OL7 A;  3I4L A;  1Y8P B;  2FHT A;  1EIG A;  5JPN C;  4C3J G;  3CQZ B;  2B2U C;  3UI2 A;  1KLU D;  2F0L A;  2KQ3 A;  4XIG S;  1EQT A;  2X6G A;  3KLR A;  2VB3 X;  1EZ6 A;  2X6L A;  3MVV A;  4IUV A;  1Y8O B;  2A73 B;  3VA5 A;  1OXU A;  4HSV A;  2PYK A;  1G2S A;  4NKL A;  2J4X A;  5CBE E;  4QCL A;  5LL6 X;  3EA6 A;  2SNS A;  3P1H A;  1LTI D;  2IPK D;  4RFB A;  3NSW A;  1XWE A;  2IJ0 A;  3EFX D;  3TME A;  1O80 A;  3BZD B;  1PRT C;  2Z8L A;  1XTC D;  3J80 E;  3Q23 A;  3OMG A;  1STE A;  1T5E A;  1GOZ A;  5FKA C;  3VR3 A;  1J9O A;  4DF7 A;  3GO5 A;  3PUZ A;  5KNC A;  5JOB A;  1PFB A;  2F0V A;  1HFN A;  1QWY A;  2HQE A;  2WIN B;  1RJT A;  5C0X H;  2I46 A;  3E5S A;  2K04 A;  3DMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...