4X3UA

Crystal structure of chromobox homolog 7 (cbx7) chromodomain with suramin
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
56
structure length
56
Chain Sequence
FAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERDRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromobox protein homolog 7
publication title Small-Molecule Modulators of Methyl-Lysine Binding for the CBX7 Chromodomain.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 12
structure length 56
sequence length 56
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4x3uA00
1ILQA 2MGSA 2X6GA 1B50A 2HDLA 4NW2A 1RHPA 2B2UC 2B2YC 1RTNA 2DY8A 4RWSC 1WD0A 2CVRA 1B4OA 1E0BA 5EPJA 1SDFA 1G2TA 1MGSA 3DM1A 4R8IA 1LV9A 2KVMA 4XDXA 2JYOA 2Q8TA 3TN2A 1WTQA 5D14A 2MP1A 1M8AA 3IFDA 3Q6SA 1JICA 1A15A 1G6ZA 4XT1B 4ZK9B 1HUNA 1J9OA 4MN3A 5EPKA 1C8CA 1SSOA 2K28A 1NAPA 1F9PA 2NYZD 1Q3LA 2KOLA 3I8ZA 1EL0A 2K01A 4QUFA 3F2UA 5E4XA 1G91A 1HHVA 3DEPA 1BO0A 1MSHA 3GV3A 4XT3B 5EJWA 3FDTA 1WTRA 3ONAB 4CJ2C 2IL8A 2FINB 1SAPA 5EKIA 2RSOA 3D6WA 1XYIA 1HFNA 3TZDA 2L12A 4RA8A 1KNAA 4OIKA 4CJ1B 3I91A 1HUMA 2L11A 1WTXA 4RAUC 5CBEE 1QE6A 1PDQA 1PFNA 1ML0D 2BDNA 2KUMA 4DN4M 1WTVA 1ICWA 1DZ1A 1GUWA 2B2TC 1EQTA 2HUGA 1KNEA 4QUCA 2MPMA 1S4ZA 4IUTA 5T1GA 1NCVA 2EE1A 2L4NA 1U4PA 4ZKBB 1IKMA 3LWEA 3IL8A 5AFWA 3KBXA 2L9HA 5COYA 1QG7A 5E4WC 1F2LA 5CMDA 5JJZA 3FPUB 4IUVA 3QO2A 4X3UA 5DNFA 1HRJA 1PLFA 1O7YA 1F9SA 4HAEA 2K03A 3G7LA 4HCSA 2X6LA 1DOLA 4ZAIA 1BNZA 2J7ZA 5EQ0A 3KUPA 1WD1A 2B2VA 1EIHA 2Q8RE 4IUPA 1MSGA 1J8IA 3HP3A 1WTPA 1ZXTA 2FFKB 2RSNA 1NR2A 3MWYW 2KEEA 1U4RA 1JE4A 3I3CA 3I90A 2DY7A 1O80A 1U4LA 2JP1A 4ZKCB 4MHEA 1MI2A 3GV6A 1AP0A 2NZ1D 2N55A 1CA5A 1BBXC 2B2VC 1EOTA 2FMMA 2FHTA 4IUQA 5CORA 3P7JA 1WTOA 4ZLTF 1HFGA 1CM9A 1O7ZA 1RJTA 2K05A 2K1BA 2M2LA 4X3KA 2R3ZA 5T1IA 3R93A 1B3AA 2D9UA 4LMQD 1AZQA 1AZPA 1IL8A 4IUUA 5D65A 3MTSA 1PFMA 1VMPA 2B2WA 3H91A 1CA6A 1ILPA 1IKLA 2EOTA 4X3SA 2NWGA 4IURA 1F9QA 4OIJA 1DONA 1VMCA 2N88A 2X69A 1WVLA 5EPLA 2VXWA 1G2SA 2KECA 2L1BA 1RODA 1F9RA 1DOMA 1RTOA 1X3QA 2SDFA 4X3TA 5CBAE 1WTWA 2MJ8A 4U68A 4CJ0B 1XX8A 1B53A 1TVXA 1X32A 1X3PA 2B2UA 2B2YA 2KEDA 2RVLA 2HCCA 1QNKA 2XIWA 4HSVA 1HA6A 1B2TA 2RA4A 4UAIA 2FJ2A 2HCIA 2B2WC 4O42A 3UI2A 4HEDA 1U4MA 1EIGA 2B2TA 4R9WA 1DOKA 2EPBA 1BF4A 3SVMA 2K04A 3N52A 1PFBA 3DEOA 2H1EA 2HDMA 1NR4A 1ESRA
chains in the Genus database with same CATH superfamily
3FPPA 3D31A 4ODGA 4KHVA 3BJUA 2BDOA 5IYCG 1B7YB 1VQBA 1HNWQ 4I7ZC 1A8VA 2PNHA 1JCKB 3CCJA 2I46A 4FF4A 4B3RQ 4DK1A 1WTHA 1EZ6A 2UUAL 5M5WH 4C3JH 1JE5A 5DM63 3GO5A 4X62L 4JI4L 2EYFA 4HCEA 4B9XA 1E2ZA 1H9JA 4CKCA 2F0QA 5G3LD 3UDIA 3FDTA 2TSSA 3KLRA 1L1OA 3HOWH 3KJPA 3S14B 1I6HB 2YU9B 2JA5B 1PMRA 4CDFC 1PTOF 2SNSA 1L0XB 3TBIB 2MPMA 4L8JA 4PZ7A 2JA7G 1QVFA 3U4ZA 2HIVA 3BZKA 3M7NA 2MO1A 3GTPH 1A3UA 2N3SA 3S9WA 1SNDA 1FGUA 4IZ8A 5LL6S 1Z7TA 2D0OA 4X62Q 5IP9G 4JI4Q 1PH5A 1DJRD 3NUCA 1C7YA 3VYRA 1X54A 5AJ3L 1EU4A 4DXFA 3HP3A 5BR8L 1SYEA 2KCMA 2NUCA 4GZYC 2Q2HA 1BDOA 1OTCA 2F1MA 2XRQD 3R2TA 1K3RA 1JJ2A 3PV0A 1AP0A 3JC66 4IUQA 3J7AF 4QQBX 1HPCA 4X3KA 4LMQD 5I2YA 1AZPA 1S5CD 2QEXA 3K58A 2E2DC 1VF5C 3RZDH 2R61A 4G57A 3J80c 2QDLA 2KHJA 4J15A 2VXWA 1HNZL 1F9RA 1WTWA 1TT2A 4IJHA 1SYFA 3S17H 2EIFA 5AJ3Q 4DPGA 2NN6H 2ZXOA 5BR8Q 5C4XH 4DK6C 3PGZA 4HSVA 2FJ2A 1IZ6A 1I4GA 4LUOA 4GKKL 1XPUA 1EIGA 3CQZB 3SVMA 4A93G 1EOVA 4BBSG 1CHPD 2EZVA 3W1BA 4A3LG 2H1EA 1SN8A 3H3VI 1QZGA 4NB3A 2TMPA 1E24A 3VYSA 4IO9A 4GN3B 3QR8A 2UUCL 1BKBA 4RKBA 3PUXA 4OX9L 4CDEC 2JEAI 5BN4A 1VQDA 1A15A 1HA5A 1V1OA 3WOFA 1Q82C 5I9OA 1EIYB 5A35A 1X56A 3GTOH 4ULLA 1Q3LA 2IX3A 3KF6B 1AH9A 3RR5A 2D2CC 4GNXA 4HJ5A 4BY1H 4JI0Q 1SAPA 4HTHA 3D6WA 2D5DA 1N34L 1YVCA 3I91A 4NXNL 2L11A 4L5RC 1TWFB 1Y1WG 4A3BB 2K6AA 3K5MA 3OWEB 2Z4HA 4DR1L 2HUGA 2WACA 2UUCQ 4OX9Q 2JA8B 4UHVA 1B44D 1SNQA 3NBHB 3CXCA 4HIDA 2KHIA 4OWXB 4H13C 5D3DA 5EGTA 3VR5A 1PH3A 2QW7A 2ZJPA 2EDGA 4HCSA 1TWHB 2PI2A 4R4QA 4A3CH 1J8IA 5IGEA 4IFDH 2E76C 1L0WA 3Q24A 1N34Q 2BA1A 4GOPB 1QVGA 3KLWA 4NXNQ 2IHFA 5L37A 1WI5A 4ZCKA 4DR1Q 1IBML 3SDZA 1YHQA 5BN3A 3S14H 3D3RA 2FMMA 4B3SL 3IFTA 2YU9H 4OWTB 2JA5H 4J1MA 4N8FA 1H9SA 5C3EB 3VR2A 3S1NB 1Z47A 4IURA 2N88A 1A62A 2QKIC 4IJLA 2K14A 3EJIA 1X3QA 3UE0A 1VQNA 3CCEA 4LF8L 1X3PA 1E1TA 3BS1A 3NWSA 1G291 2F3WA 5JEAG 3CCQA 5LMUL 3DHQA 4HIOA 2JA6G 3CKIB 1IBMQ 1YHBA 4B3SQ 1X6OA 2PZTA 5LMNQ 4R8NA 2ZXRA 1KRTA 1RTNA 4G7ZC 2J0TD 4LFCL 5GAHC 4EQ5A 2KVMA 3S16B 1GUTA 4DV0L 4ZK9B 2E2HB 2K32A 1CKMA 1S40A 4DR5L 3FKIB 1EWHA 2Z6BA 1WYDA 3TQYA 4LF8Q 1X3FA 2I5LX 2HQEA 1MD2D 1XXGA 5IP9H 1BQQT 4DFAA 4CJ2C 4HJ7A 2XRSD 3I73A 2FINB 2E2IH 5LMUQ 5I4DA 5C0XI 4YWKA 1B1ZA 4LJZC 3BVMA 4C3IG 4QY7A 3M4PA 4LFCQ 4HIKA 3MZ5A 4C1NI 4LFBL 4OONA 4DV0Q 4JI1L 4P71A 3Q8DA 3KBXA 4DR5Q 2ZTEA 2CFMA 3HZXA 4CHTB 3H0GB 2A1AA 5FOBB 5J39A 3A0JA 4HAEA 4AIMA 1VQ6A 1GUGA 5IGDA 2QEJC 1PH8A 2D62A 4E6IA 4GLXA 4FF2A 2ZTCA 4A3KG 3UDFA 3AFPA 4IOCA 4LF4L 2V1CC 2ICIA 3W5OA 3E3XA 4DNTB 3GV6A 1Y8PB 4DR2L 4RGMA 3KLSA 2F0FA 3Q0AA 4LFBQ 4XYQA 1CKNB 1O7ZA 2N8NA 5M3FG 2R3ZA 4JI1Q 4A3BH 2R93G 2B2WA 4ALPA 5JJKA 4JK1C 5GQOA 3KF8A 4F88A 3ULPA 2JA8H 1XTDA 3F2UA 2L1BA 5CGKA 1DOMA 4LF6L 1QILA 1HR0L 3RZOB 2RF4A 3QJYA 3PO3B 1B53A 1DM0B 3PUZA 4RHSA 1F2MA 1HZAA 3T13A 1IYVA 1Y1VB 5ELEA 2KQ3A 2PO4A 4LF4Q 3VA5A 1N8RC 2F0PA 1TS3A 4DR2Q 4JI2L 3P75A 4FDBA 1OXSC 3S2DH 3Q23A 1NBWA 4KTAA 1CI3M 1SYCA 1B50A 3LGJA 1BCPD 2CH4A 1RDPD 3NEMA 2EYHA 1B4OA 4DV3L 4NPSA 2F0DA 4XTCS 4R8IA 4R4IA 1O7LA 1EQRA 5D14A 3I4LA 3HFZB 1Q8KA 3LX0A 2HIXA 1HUNA 1K28A 3S1RH 3DWAA 4LF6Q 5C3EH 2LSSA 1C8CA 2K28A 1HR0Q 3S1NH 2E75C 5J1ZA 1AEXA 1A2TA 1QCBD 1TWAB 4CDDC 1SRUA 2XWBB 5EJWA 3C1EA 1EY8A 4BXXG 1OXVA 3A7AB 4AH6A 1HFNA 1PH1A 1N36L 4JI2Q 4L5TA 4RA8A 1YJ9A 1BCPC 2JN4A 3AMUA 2XSCA 1PFNA 2FMCA 2ALYB 5G3LF 4DV3Q 3TP6A 3I4MG 2HQLA 1HCZA 3MFGA 4K8JA 1IXRA 3DWPA 3HEJA 4HSPA 4OXPA 1CT1D 4A3IB 1K3BC 3S16H 2IX1A 1DOLA 3L9AX 1HTPA 1TS4A 5KNDA 5HGTA 2B2VA 2NVYH 3TP5A 1STHA 3FKIH 3VR3A 3UE1A 1ONLA 2Q2TA 1CZWA 2YYZA 3CMAA 1N36Q 1PVOA 2QF7A 4GS3A 3S15B 5M3MB 3X3MA 1PA6A 1Q12A 1AE2A 4G4KA 4C3JG 4LFAL 4FF1A 3AYHB 2V4DA 1EWIA 2JJQA 1IL8A 2AQ1B 3E9HA 5D65A 1BVSA 4WORA 1IKLA 5CYUA 2NWGA 4DAPA 2AHOB 2WB1B 3RLOA 3KLSX 3I72A 1HH2P 1PZJD 2CKZB 2HHHL 2EXZA 2K4KA 1HJPA 4LW1A 3PUYA 2B2YA 3H0GH 2Y0SB 4FF3A 4WFN3 1D7QA 3SK6A 1CSPA 3HKSA 3CF5A 2Z0SA 1II3A 3NTKA 4KHPL 2EPBA 1F77A 3KJOA 3OOCA 2WB1E 3QG1A 1NR4A 3QOLA 4LFAQ 3KF6A 3GTGB 4WRDA 2R7ZB 1HZCA 4P2CB 1W3SA 4K14A 1D6EC 4A3MB 1I4PA 3CHBD 3DM1A 1I4QA 2Y0SE 3SK4A 3V2TA 1KC8C 4DR3L 3T4AC 2MP1A 1BBWA 2F0UA 2F0VA 5J3BA 1I4RA 3VYTA 2PQAB 4DV4L 4LF9L 4MN3A 4DAYB 3TEHB 2I5HA 4RCOA 4ME3A 2HHHQ 2KOLA 1SE2A 1LYLA 1BO0A 4TVAB 3NBHA 1A3VA 3ONAB 4KHPQ 3FEWX 4DR4L 4S3SA 1IBLL 1Y1VH 2WAQB 2OTJA 5KEEA 3HOVB 4R1JA 1EQTA 2F4VL 1KXLA 3D4WA 4YHHL 2JEBI 5JAVA 2PQEA 2NN6G 4DR3Q 1MIUA 1K8AC 4RKLA 4DV4Q 4LF9Q 5M5YH 1FL0A 4X3UA 4UY8C 3J7ZC 2WAQE 2O2LD 2NVQB 1TXYA 1B9MA 2HD3A 5IGGA 2J7ZA 1A6XA 1SE4A 1EIHA 2F0JA 3E0EA 3SGIA 5IYBH 4F87A 4DR4Q 5DLQE 1I94L 1IBLQ 4QJFA 3HOZG 4KY7A 4XQQA 4IPCA 4B9WA 5KRUA 4DV7L 1ICFB 4OO1H 5ELFA 4KY6A 2F4VQ 4YHHQ 2PZWA 4H44C 1QWYA 1KDAA 1R9TB 3FMCA 1DD2A 1VQJA 1TS2A 1NUCA 5C5LA 5FO7B 4BY1G 4M8AA 4EX5A 4GLAC 3SR1A 3EFXD 5KNBA 1DYQA 2SDFA 4PMCA 1RTOA 4PMBA 1WFQA 4U68A 1T9HA 4CJ0B 4B3TL 1SR3A 2CH4W 1M1KC 1LTID 4HJ8A 1I94Q 3I4OA 2B2WC 3OWFA 4AYBE 3ERQA 3NE5B 3HOZB 1GUOA 1XNQQ 1UWVA 4IUNA 5GAEC 3S15H 5M3MH 1JOKA 2Z9HA 2AQ2B 3NWTA 4A3CG 2LS01 1EYGA 4WJ4A 5JVH3 3TDQA 3R8BA 3D8GA 5HY6A 4RH6A 2J4XA 4JI3L 1F9PA 4B3TQ 1OXTA 5JPMC 2M00A 1KQSA 4KN7C 3GV3A 1FYCA 1PHJA 1MBYA 2CHBD 2JA5G 3S2HH 5LMNW 4YWLA 5EKIA 2VQEQ 1ENFA 1OXUA 3BDLA 1WTXA 2H5XA 4J8QA 4FVMA 3D6CA 4QUCA 4KD3A 1NCVA 1QVCA 3C2PA 2R7ZH 1QG7A 4A3EB 4JI3Q 1ET6A 1EY5A 3CC2A 2K5DA 3TZUA 1FGBD 1EIFA 1CKNA 3GTQB 4RG1A 2FFKB 3GTMB 1FR3A 1S5FD 3W1GA 2BOSA 2IY5B 2LMCB 2CQAA 3I3CA 1VS0A 2DY7A 1YJWA 1U4LA 4PG3A 3NSWA 5CR3A 2N55A 1WCMB 3SK5A 4HN7A 2B2VC 2UUAQ 2FHTA 1IHZA 3OMGA 3HKZE 3HOVH 1GD7A 5FLXL 1PH4A 1ZEQX 1B3AA 3OSOA 3BYTB 4FNFA 3NXWA 3C3LA 3C46A 1MJEA 2DJFC 2JXMB 2WV6D 5CV9A 5IT9E 1G51A 1VQAA 3D0FA 4WJWA 3C1FA 3S24A 2KEDA 3QB3A 1VQKA 3F1ZA 2WIIB 4JOIA 1FNVA 3A74A 4FP5D 3FP9A 1TKWB 2DUDA 2K50A 4JBJA 5IIFA 5H1SE 4JVZA 3DEOA 4K6LA 3SE0A 4F7XA 2SOBA 4PNYA 2B2YC 3WDNA 2DY8A 4IPDA 2NZOA 1EUJA 2VB3X 1P8LA 1SDFA 3D4RA 5IODA 4XDXA 1PV4A 1Q90A 2F0OA 5IGFA 2DNEA 1R9TH 2KBNA 3M7GA 2EYMA 1NAPA 1BCPF 5IOCA 3P1HA 3IAYA 5C4HA 3BU2A 3PCOB 4DR6L 3QWNA 2LKVA 4A3BG 1BOSA 4NKLA 3URYA 4CBVA 2JSOA 2UU9L 3BYYB 3AU7A 4RGNA 3HOUB 3QOJA 2JA8G 2ZXPA 3J7YW 4AQYL 2KUMA 1STGA 4OHJA 5IE8A 3HOZH 1FNWA 4IFDI 2EY1A 2F52A 3CCSA 2NBFA 4R4OA 1HNZQ 2ZT9C 3GTKB 4KKSA 4O2DA 3PSIA 1JJCB 1D2BA 2L9HA 3S1MH 1UE6A 2OEOA 2QDBA 2BCOA 1X3GA 4IUVA 3K5NA 4GKKQ 3GDEA 3H94A 3ER0A 3CCVA 1VQ5A 2LFNA 2ENBA 4ZAIA 4DR6Q 4HJ9A 3TRZA 3OMCA 1WTPA 4A3DB 3TS0A 1PRTF 2UU9Q 4JI8L 2K5WA 2A69D 2NTSA 4UP8A 2EXDA 4Q0FA 4AQYQ 1XJVA 4O1NA 2BH8A 1JWMD 5C3EG 3L7ZC 1PH9A 1SNPA 4PZ6A 4I7AA 2JK8A 3EBEA 1EFWA 4LUZA 4EQNA 5IT9L 2B8GA 3MTSA 2R92B 3H91A 3N6RA 4B3ML 2F0GA 1EQQA 3PO2B 1F9QA 1DONA 5C44B 1WVLA 2OQKA 5JVG3 1MKHA 1QUQB 2VUMB 2F0NA 2I0QA 2A69C 4A3EH 2ZTDA 2XIWA 2CQOA 4RGTA 2B63B 1TY2A 1CSQA 4JI8Q 1AW7A 3RN2A 4P72A 2LXJA 2PQAA 4DAYA 1I6HH 3GTQH 1CQVA 3NP8A 1BF4A 4QL5A 3A55A 2PYKA 5A2QL 3X3NA 1FNUA 5KNCA 3E6ZX 1YITA 3PMFA 1E7ZA 3NTHA 1SNCA 3G48A 3K7AB 3T53B 1RIPA 1JC7A 1YNXA 5ELDA 4ZUJA 1T5EA 2R7FA 3FKIG 4NXML 2Q8TA 3TSSA 1EY7A 3I4NB 1U9RA 3IFDA 5FKAC 5HURA 3M3YB 4QIWB 5IY0A 3DMUA 1BBUA 1DGSA 4K5XA 3G6EA 4OWWB 1TQOA 5GADC 1UEBA 4Y7NB 1P16A 3A8IE 3ZYYX 5K5PA 2F4IA 3E5SA 2E74C 2L12A 1N33L 3AEVA 1C0AA 4RHRA 5I9PA 4JI7L 1EY0A 2Q8IB 1N32L 5CBEE 4YCVA 4C3HB 1XNRL 4QIWE 2E2JB 3RD4A 1KNEA 1S4ZA 1CTMA 4X65L 4NXMQ 1LUZA 3H0GG 2EY2A 3HOXB 1HZBA 3M4OB 3DXJC 4BBRG 3HG9A 1NTGA 3CCMA 3OHXC 1H9MA 1I3QB 4C56C 3G7LA 3G4SA 3HOYB 1LT3D 2Z8LA 3KUPA 3CC7A 4A3JB 2LY7A 3M4YA 2I5MX 3KDFB 2AMCB 1VQ4A 1BR9A 4JI7Q 2IT1A 3CQZH 1A3TA 1N32Q 4H0LC 3RLNA 4DK0A 4ZKCB 1F2YA 2Z4IA 3K0YA 4ZQ3A 3HS0C 1L1OC 4Q5VA 4X65Q 1AZQA 3A56A 3OW2A 1NSNS 2Z6KA 4EQPA 1S3OA 1VMPA 4X66L 1ILPA 2BE5D 4BBRB 1NJIC 3K6OA 4JBKA 3PO3G 1ZYRD 4YCWA 2VY3A 1OO9B 1Y1VG 5EPLA 1O7IA 5CBAE 5IT9c 4RFBA 1JWUD 2UXCL 1J6QA 4LAAA 1SYDA 2RA4A 4P73A 4ME5A 2B2TA 4N9TA 4LK1C 4DNRB 5C5MA 3TS2A 3BZCA 1TWFH 3SHLA 4DV6L 3V96A 2KCCA 2BE5C 2NVTB 2K5NA 2CVRA 4IN3A 1ZYRC 4JOIC 1SROA 1G8ZD 1KHIA 4G7OC 2VL6A 3PF4A 5IYBG 3R2IA 2DJGC 4TKOB 2KCNA 2VW9A 3KK7A 4DKAC 4EGVA 3VR4A 1J9OA 2UXCQ 2R92H 3RMHA 4C1NK 4OO1G 1EL0A 1TWHH 2K01A 2AKWB 3JAMi 1SYBA 5C44H 1YZ6A 4BY7G 1IYJB 1UUPA 1V8QA 1TWGB 4L63B 5JPNC 3MC0B 3OTOL 4L6TB 4OEMB 2LXKA 4DV6Q 2MQHA 2N78A 1ICWA 2MO0A 1BUVT 4YIJA 2C5CA 3A8KE 2ES2A 1XMOL 1D5MC 1B70B 5E7NA 4A3IG 4L5QA 3F2DA 1Q1EA 3DM3A 1TU2B 1IL2A 1XWEA 5ELCA 5FLMG 2EYLA 3CAMA 4POFA 1L2FA 1S5BD 2F0MA 1KAWA 2A68D 1I50B 1PTOB 2K03A 2OTLA 2X6LA 2RDHA 2EQSA 2UXDL 4BS9A 5M3MG 4BY7B 3ZJYC 5M5XB 2L5TA 1V1PB 4JV5L 4ZRZA 1YIJA 2YV5A 4K6DA 5HGQA 3I90A 2AWOA 4YY3L 4Y7NH 4A3GB 4GNXC 3MAQA 1CQFA 3MHBA 1ENCA 2QA4A 1XMOQ 1EYCA 4A3FB 1SFOB 4JPBW 2WB1G 1PRTD 3MVVA 5T1IA 3K57A 2CWPA 2A68C 1D5XC 1JB7A 1W2BA 1M90C 2E2HH 1Q8IA 2Y0SG 3M4OH 1SMYC 2UXDQ 1JR0D 1Y69U 2B2UA 3GTLB 1IW7D 4JV5Q 1B2TA 4O42A 4IALA 4YY3Q 4R9WA 1IYUA 2R7ZG 1STBA 1PFBA 1PRTC 4KHZA 3JAML 4A3MG 3M85A 3MXUA 1CHQD 1UE5A 3PF5A 1VQLA 3S1QB 1M8AA 2F0WA 2DNCA 1VQPA 2D0PA 4CKBA 1IW7C 3ULLA 2WINB 1X55A 3ULJA 1AN8A 2AUJD 1K73C 4BBRH 5CV7A 2EY6A 2GA4B 2XWJB 2WAQG 4LF7L 3HOVG 5IGBA 3NQIA 1WTRA 2K5VA 2F3IA 3T51B 2RSOA 3CC4A 1RL2A 1CZGA 2WKCA 3NENA 3PIPA 1PXUA 4WJ3M 2E8GA 1QE6A 4DXGA 5E3FA 2K75A 4KV6A 1VQMA 5IP7G 4GLVB 1Q86C 4NMZA 2ICEC 2HT1A 3CD6A 1PZKD 2NVXB 3OPOA 1VQFA 4OO1I 1F2LA 3QO2A 2PW7A 1PLFA 3Q22A 4O0AA 3CCRA 3RZOH 2VS1A 3T1HL 3J80E 3PO3H 1YI2A 2KHSA 1ASZA 2E5LL 2PPBC 1ZXTA 1JWSD 4ID6A 5J22A 1E2WA 3EIVA 3HOWB 2MUYA 1PZID 5JJLA 5EKLA 1QUQA 4GOPA 1CA5A 3J80i 3BVGA 3CCUA 2B8FA 1SYGA 1KABA 3I55A 2P5ZX 1D1KA 1CK1A 3TP7A 3WOEA 1YNND 1B9NA 1TIID 3K5LA 4ZKBB 4JI6L 3T1HQ 1W6JA 5LL6X 4K0KL 2E5LQ 1TWAH 2RVLA 1I50H 1PTOH 2QGQA 1HA6A 2HCIA 2FXQA 2K5HA 1EY6A 4P75A 2K7VA 2NB0A 4BY7H 2BA0A 4AYBB 3G71A 1HNXL 4V190 1ESRA 1BXTA 4DV2L 5M9OA 4NW2A 4A3GH 1YNNC 5EPJA 5K36G 5FLXE 1TWCB 1VQCA 2PNRC 1KIXA 3U58A 4A3FH 1SFOH 4DUZL 1JICA 1EFID 2WFWA 5KGUA 3RZDB 4JI6Q 5EPKA 1EQVA 1PYBA 4A3IH 5JJIA 1LT4D 1LTSD 4KN4C 3I8ZA 5FLMH 4DV7Q 5C4XB 1MSHA 1EEID 3OIPA 1Q7YC 1CFMA 4MTKA 1EY9A 2K5QA 5ELNA 2OWOA 3H15A 2OCEA 3GTLH 3K5OA 3M9BA 1VQ9A 4L5SA 4FXDA 3VR6A 3D4DA 1HNXQ 1XMQL 3K7UC 1TS5A 3MXPA 3U4VA 5C0XJ 1WTVA 3EN2A 4RCNA 1Y8OB 4A3EG 3KDFA 1A0IA 2G5DA 2EE1A 4DUZQ 1U4PA 1XPOA 3W2DA 3HKZG 1JQYD 3J80L 2L55A 1LT6D 3BG3A 1B8AA 3E9IA 5FO9B 1HRJA 4Y52H 1O7YA 2C9OA 1PH6A 3NELA 2YTXA 3CRLC 4FXKC 2IX0A 2AWNA 3BDCA 4XYOA 3PIOA 2KA7A 2R7DA 1QNUA 2L15A 4JI5L 1WCMG 1U4RA 1JE4A 2IHEA 4DA2A 1YJNA 3GTGH 1EYDA 4A76A 3K81C 1UE1A 1HZ9A 3FVQA 1A63A 4ZLTF 1GUNA 3KF8B 1CM9A 3L0OA 1DXMA 1RCVD 2K05A 2M2LA 4A3MH 1I4XA 2B39A 1ASYA 1A2UA 2ASBA 1SE3A 3K8AA 2DGYA 3U9SA 2EOTA 3HKZB 3ND8A 4K5VA 3U50C 2X69A 4PMWA 4J6HA 1Y14B 4MTNA 3GQBA 1PH7A 4M1UB 2NVXH 4OELB 2Q2IA 5EAYA 5D3IB 1LTAD 1U5KA 4JI5Q 2GVBA 2EYOA 2RHQB 4HEDA 1K8MA 2EVBA 1XPRA 2NZHA 1X3EA 2KCTA 2NN6I 5ELBA 2CWAA 3PQIA 1VCIA 1E3PA 4JBWA 4R4TA 4QB4A 1K9MC 2B2UC 1WD0A 4JBMA 4FYDA 5LHY1 1VQHA 4DU9A 1G2TA 2YTVA 2JYOA 3TN2A 2O5IC 4MZ9A 1NNXA 1RF2D 2A5HA 5IP7H 3KOJA 4KK7A 1J5EL 4FO2A 4UP7A 3I7FA 3UDGA 2NYZD 4IPGA 4YCUA 2NVQH 3U9OA 2SEBD 5FK9C 3TREA 4POGA 5E4XA 2EYPA 1QZHA 5JEAJ 3HOUG 2IJ0A 3GP7A 1O78A 4X64L 5CV5A 1ZKOA 2XN9C 1R4QB 1Q46A 3CMEA 5A2QE 2F0LA 2JE6I 2L0CA 1V1PA 1K83B 5AFWA 4DR7L 1JORA 1GOZA 1WOCA 1J5EQ 5E4WC 2QILA 2O5JC 3FPUB 1TWCH 2JA7B 1LACA 2IWHA 2ZJRA 1LTGD 4A3DG 2RCNA 1X9NA 1BNZA 4X64Q 2E2IB 4MIUA 1ESFA 3ND9A 3A8JE 1K0RA 4TSSA 3T16A 3BVZA 4HR7B 1NMFA 4RMFA 1HR0W 4KI0A 4JI0L 2NTTA 2R92G 1HFGA 3PO2G 2OT2A 4QCLA 4ILWA 5C44G 1Z9FA 4FXGC 4DR7Q 3IKJA 1SNOA 3KYHC 5C0XG 3PUWA 1CA6A 2VUMG 3MXGA 4X3SA 2A19A 5EKKA 2YTYA 1LTRD 1OXXK 2RDFA 4H02A 5ISRA 5K36H 1PFSA 4GOPC 2B63G 1RODA 1M4VA 4A4IA 4JG2A 5C4JB 2PCFB 2WKDA 4A75A 1CUKA 1V9PA 4UAIA 1LO5D 4LWCA 2A6ED 1STNA 4GKJL 3N52A 1VDZA 1STEA 3MA2B 2HDMA 2MGSA 2K33A 2HDLA 4B08A 3I4NG 1RHPA 2B3GA 4A93B 4BBSB 5FLXc 2VQFL 1LV9A 3GD7A 2F0HA 3HRZC 2GVAA 4HMIA 2VNUD 1NY4A 1SJHD 3NHHA 4XXEA 4LNQA 3IRBA 1T5XD 4QMGA 1SSOA 1EZ8A 1S72A 1C9OA 1EU3A 5JOBA 3H3VH 4QUFA 3I2ZA 1GHJA 3CW2C 2A6EC 3DEPA 3KFUA 5IWAL 3F2BA 1F2ZA 4C3HG 3GTJB 3GTMH 5ELOA 4GKJQ 4OIKA 2MFIA 3SK8A 4CJ1B 5C6AA 5NUCA 3S2DB 1V1QA 1PDQA 2BDNA 1WCMH 1NE3A 1TY0A 4H7BA 3HOXG 4B3MQ 1GUWA 4NP5A 1SE8A 1JMCA 3J81E 3NPPA 4CGYB 2VQFQ 2F0KA 1UE7A 1N9WA 1Y1WB 4KJOA 2EY5A 3IL8A 2F0TA 3HOYG 3J7AV 5LMNL 2SNMA 4P74A 3DWQA 4N9PA 1SEBD 5DNFA 3S1RB 4X6AH 2RCFA 4A3JG 1UAPA 1EWCA 2EJMA 3J81i 1SBBB 5IYCH 5EQ0A 3ITPA 3VYUA 1WD1A 4IUPA 5GROA 5IWAQ 1STYA 1ENAA 2F0EA 2O4XA 2RSNA 3MXNB 3P20A 2JA9A 2KEEA 1C48A 4KMUC 1U0LA 3T56B 1O80A 1R4PB 2JP1A 1K0SA 3EROA 4DAMA 2VB2X 4KKTA 3FRPB 1PYSB 3AFQA 3CP0A 1BBXC 4U673 4XIGS 3FHWA 3P7JA 1VQ7A 2F0SA 5E1FA 1S5ED 4N8X1 3KBGA 2I07B 2VZAA 4HMJA 1K83H 1JJGA 4X3TA 1E2VA 2MJ8A 1N33Q 3EVQA 2NVYB 1TVXA 2A6HD 2JA7H 4TQUS 2HCCA 3PUVA 1XNRQ 4GN4B 2PMZB 4DV5L 4I65A 2RBMA 4F8MA 1V43A 4KD4A 3HOUH 1Q1BA 1GO3E 1ILQA 2X6GA 1XTCD 1EEFD 2JA6B 1E0BA 1LM0A 2RQXA 3GTKH 4KY5A 3B6YA 1WTQA 2RHSB 3BDOA 3Q6SA 2RDGA 1G6ZA 1IBKL 3CPWA 2PMZE 2A6HC 4XQNA 4Z9CB 1KDBA 1YHAA 5IYDG 1FJGL 2CCZA 1GKHA 1D5ZC 1KD1C 1HHVA 3EA6A 1PTOD 3CPFA 1FVIA 3RN5A 2OXPA 4ZUIA 4DV5Q 4A3DH 4DGZA 1XYIA 1JB3A 5C4JH 1KNAA 5DEHA 3J81L 4GN5A 4PV1C 3WWVA 4YWMA 4X66Q 3JAME 2AQ3B 2Z1CA 1SJED 5DAUA 5CV4A 4IUTA 2OF1A 4DNIA 5TSSA 4C3IB 1KAAA 1IBKQ 1IKMA 4PQXA 4A93H 3PO2H 4BBSH 1PTOC 1L1OB 5CMDA 4A3LH 1LLRD 1FJGQ 3DUZA 5C0XH 2MHVA 2UUBL 2DN8A 2EYJA 2VUMH 1KLUD 2QCPX 1YBYA 4OGQC 1G6PA 1YEZA 1UNSA 2B63H 4A3GG 1GHKA 2KJXA 3E0JA 1NR2A 1AFPA 1LTLA 2F0IA 3A7LA 2ID0A 4A3FG 1KL9A 4IPHA 4EVOA 4MHEA 1MI2A 3GTJH 4A3KB 2XVSA 2ATWA 1K8OA 3K7AH 3RNUA 1VQIA 2N49A 2K52A 4JCVE 2XTIA 5CV6A 1PFMA 4ZYSA 2ZJQA 3I4NH 3M4QA 5M5YB 4MNOA 1HQRD 5M3FB 4OIJA 1H9KA 1VMCA 1KDCA 1Y1WH 3M3YH 2G9DA 2UUBQ 2R93B 1E1OA 1H9RA 3PIP3 1VQEA 4KJNA 3OTOQ 1SMYD 1YNJD 4QGUA 1CKOA 1LT5D 4K2KA 2IW3A 3UI2A 4DUYL 1RD9D 1D8LA 1LABA 4PZ8A 3SXHA 1K8GA 2WP8J 1LTTD 2K04A 4UP9A 3UDXA 4C3HH 1S5DD 4CDCC 2E2JH 5EBDA 4DAVA 4HJAA 3BZDB 3SEBA 5FJ8G 1MJCA 4QF4A 3J81j 1MGSA 3HOXH 1YNJC 4RGOS 1SMXA 2PZUA 2F3VA 1H95A 1I3QH 1RKNA 3HOYH 2C35B 1G91A 3NK9A 3CU7A 1Q81C 4DUYQ 4A3JH 5EBCA 1VQ8A 4JW0A 2IL8A 3RUZA 3TZDA 3O13A 4LF5L 3V05A 1BCPB 1DCZA 4DN4M 3EQLC 2GN5A 2G9HD 2XGTA 4C2MB 1I6VC 1SXTA 3J81c 5JEAH 3L3OC 2F03A 2MNAA 4IFDJ 2A8VA 2L4NA 4GNXB 1VQGA 2JA6H 3NTIA 1JOQA 5JJZA 2RKSA 1HQMC 3I4MB 1JT8A 1F9SA 3K80C 4DF7A 3J7A5 1I5FA 4ABNA 3HOWG 1E22A 2Q8RE 5I6YA 3RLFA 1SLJA 3W3AA 5I2XA 1KTKA 3LNNA 3S2HB 2EJFC 4LF5Q 3CRKC 1C4QA 3AQQA 3A5UA 1STAA 3VDYA 3OIQA 2CW0D 5FO8B 4LUVA 4UDUC 5CV8A 1GXDC 2UXBL 1EOTA 4UPAA 2NVTH 5F2DA 3HGBA 1RJTA 3ERSX 4BWGB 2D9UA 5M5WB 1W6KA 2M9VA 4C3JB 1PRTB 2A74C 1PYWD 3QIAA 3LWUA 4LF7Q 3F2CA 4C3IH 1G2SA 2KECA 3MEFA 1WJJA 3T1YL 1X32A 5KYLA 2CW0C 3H6MA 3CCLA 4JC0A 1HTLD 2PI2E 4AYBG 5IYDH 2KENA 1TWGH 1H9SB 4EQOA 3A54A 1QOHA 5KIXA 1DOKA 4R4CA 5GAGC 1JOOA 3A5ZB 2UXBQ 2ZM6L 4IQZA 3GTPB 4RWSC 2A73B 4A3KH 3PIO3 4TRDA 2JQOA 1GUSA 4K8IA 4KLKA 4CKEA 4XT1B 1EYAA 1ET9A 1SNMA 4OL7A 3NQTA 4NDXA 5C4XG 4K5WA 1EY4A 2Z6KC 1QB5D 1X65A 1KLGD 3T1YQ 2OQ0A 5M3FH 4XT3B 2R93H 3STBD 3G6JB 5M5XH 3TP8A 2R6GA 1KRSA 1NMGA 4APVA 3VA7A 4JYAL 2ZM6Q 3NBIA 1FD7D 1HUMA 4RAUC 3H09A 1MHWC 4V0BA 2Q2UA 5BN5A 3JAMc 1DZ1A 1ML0D 1VF7A 4BA2I 2B2TC 3MEHA 1B3QA 5T1GA 1TR5A 1XNQL 3R3OA 3MXNA 4G7HC 3LWEA 4K0KQ 2XNAC 3S17B 5COYA 3I56A 5C3WA 3F8TA 2H4OA 4DK3C 3STBC 1VQOA 5C3XA 3L2PA 1I4HA 3OYYA 1MSGA 1AE3A 3OW7A 3DLLA 4DV2Q 1Y8NB 4JYAQ 5CC4A 4DV1L 3ICEA 3MWYW 1GVPA 5KYIA 2IPKD 2EJGC 1L0YB 1LTBD 2NZ1D 4HIMA 5CORA 2VQEL 1WTOA 4BXXH 1UEAB 2K1BA 2PW5A 3R93A 4IUUA 1HNWL 3S1QH 3H3VC 3GTOB 4C2MH 1GM5A 3MFYA 1PH2A 3S1MB 5FJ8H 2B29A 4B3RL 1HXYD 4IFDG 4BY1B 3TMEA 1QJOA 5C4ZA 3I70A 1XX8A 4BA1I 1D1IA 1XMQQ 3I4MH 5I6WA 2AUKA 4K2LA 1QNKA 1Z6HA 4IOAA 4DV1Q 3K0XA 2BH2A 1GJXA 1U4MA 5IGCA 4XQJA 3K59A 4KKUA 3AB9A 5DM73
chains in the Genus database with same CATH topology
3FPPA 3D31A 4ODGA 4KHVA 2BDOA 4I7ZC 1JCKB 2I46A 4FF4A 4DK1A 1EZ6A 5DM63 3GO5A 2EYFA 4HCEA 4B9XA 1E2ZA 1H9JA 4CKCA 2F0QA 5G3LD 3FDTA 2TSSA 3KLRA 3S14B 1I6HB 2YU9B 2JA5B 1PMRA 1PTOF 2SNSA 1L0XB 3TBIB 2MPMA 4L8JA 3M7NA 1A3UA 3S9WA 1SNDA 4IZ8A 5LL6S 1Z7TA 1DJRD 3NUCA 3VYRA 1EU4A 4DXFA 3HP3A 1SYEA 2NUCA 4GZYC 1BDOA 2F1MA 2XRQD 3R2TA 1AP0A 3PV0A 4IUQA 3J7AF 1HPCA 4X3KA 4LMQD 5I2YA 1AZPA 1S5CD 3K58A 2E2DC 1VF5C 2R61A 4G57A 2VXWA 1F9RA 1WTWA 1TT2A 1SYFA 2NN6H 2ZXOA 4HSVA 2FJ2A 1I4GA 1EIGA 3CQZB 3SVMA 1CHPD 2EZVA 2H1EA 2TMPA 3VYSA 4RKBA 3PUXA 2JEAI 5BN4A 1A15A 1HA5A 1V1OA 3WOFA 5I9OA 5A35A 4ULLA 1Q3LA 2IX3A 2D2CC 1SAPA 4HTHA 3D6WA 2D5DA 3I91A 2L11A 1TWFB 4A3BB 2K6AA 3K5MA 3OWEB 2Z4HA 2HUGA 2WACA 2JA8B 1B44D 1SNQA 4H13C 5D3DA 5EGTA 3VR5A 2EDGA 4HCSA 1TWHB 1J8IA 5IGEA 4IFDH 2E76C 3Q24A 2BA1A 3SDZA 5BN3A 3D3RA 2FMMA 3IFTA 4J1MA 1H9SA 5C3EB 3VR2A 3S1NB 1Z47A 4IURA 2N88A 2QKIC 3EJIA 1X3QA 1X3PA 3BS1A 3NWSA 1G291 2F3WA 5JEAG 3DHQA 3CKIB 2PZTA 4R8NA 2ZXRA 1RTNA 4G7ZC 2J0TD 2KVMA 3S16B 1GUTA 4ZK9B 2E2HB 2K32A 3FKIB 1EWHA 2HQEA 1MD2D 1XXGA 1BQQT 4DFAA 4CJ2C 2XRSD 3I73A 2FINB 5I4DA 5C0XI 1B1ZA 4LJZC 3BVMA 4C3IG 3MZ5A 4C1NI 3KBXA 3HZXA 4CHTB 3H0GB 5FOBB 5J39A 4HAEA 1GUGA 5IGDA 2QEJC 2D62A 4E6IA 4FF2A 2ICIA 4DNTB 3GV6A 1Y8PB 4RGMA 3KLSA 2F0FA 3Q0AA 4XYQA 1O7ZA 2R3ZA 2B2WA 4JK1C 3KF8A 4F88A 3F2UA 2L1BA 5CGKA 1DOMA 1QILA 3RZOB 3QJYA 3PO3B 1B53A 1DM0B 3PUZA 4RHSA 1F2MA 3T13A 1IYVA 1Y1VB 5ELEA 2KQ3A 2PO4A 3VA5A 2F0PA 1TS3A 3P75A 1OXSC 3Q23A 4KTAA 1CI3M 1SYCA 1B50A 1BCPD 1RDPD 2EYHA 1B4OA 4XTCS 2F0DA 4R8IA 1O7LA 5D14A 3I4LA 3LX0A 1HUNA 3DWAA 1C8CA 2K28A 2E75C 5J1ZA 1AEXA 1A2TA 1QCBD 1TWAB 2XWBB 5EJWA 3C1EA 1EY8A 1OXVA 3A7AB 1HFNA 4RA8A 1BCPC 3AMUA 2XSCA 1PFNA 2FMCA 5G3LF 3TP6A 1HCZA 3MFGA 4K8JA 3DWPA 3HEJA 4HSPA 1CT1D 4A3IB 2IX1A 1DOLA 3L9AX 1HTPA 1TS4A 5KNDA 5HGTA 2B2VA 3TP5A 1STHA 3VR3A 1ONLA 1CZWA 2YYZA 2QF7A 3S15B 5M3MB 3X3MA 1Q12A 4G4KA 4C3JG 4FF1A 2V4DA 1IL8A 2AQ1B 5D65A 4WORA 1IKLA 5CYUA 2NWGA 4DAPA 2WB1B 3KLSX 3I72A 1PZJD 2EXZA 3PUYA 2B2YA 2Y0SB 4FF3A 4WFN3 3SK6A 1II3A 3NTKA 2EPBA 1F77A 3OOCA 3QG1A 1NR4A 3QOLA 3GTGB 4WRDA 2R7ZB 4P2CB 4K14A 1D6EC 4A3MB 1I4PA 3CHBD 3DM1A 1I4QA 3SK4A 3V2TA 3T4AC 2MP1A 2F0UA 2F0VA 3VYTA 1I4RA 4MN3A 4RCOA 2KOLA 1SE2A 1BO0A 3NBHA 1A3VA 3ONAB 3FEWX 4S3SA 2WAQB 5KEEA 3HOVB 1EQTA 3D4WA 2JEBI 5JAVA 2PQEA 2NN6G 4RKLA 4X3UA 2O2LD 2NVQB 1B9MA 5IGGA 2J7ZA 1A6XA 1SE4A 1EIHA 2F0JA 4F87A 4KY7A 4XQQA 4B9WA 5KRUA 4OO1H 5ELFA 4KY6A 2PZWA 4H44C 1QWYA 1KDAA 1R9TB 3FMCA 1DD2A 1TS2A 1NUCA 5C5LA 5FO7B 4M8AA 3SR1A 3EFXD 5KNBA 1DYQA 2SDFA 4PMCA 1RTOA 4PMBA 4U68A 4CJ0B 1LTID 2B2WC 3OWFA 3ERQA 3NE5B 3HOZB 1GUOA 4IUNA 1JOKA 2AQ2B 3NWTA 2LS01 5JVH3 3TDQA 3R8BA 3D8GA 4RH6A 2J4XA 1F9PA 1OXTA 5JPMC 2M00A 4KN7C 3GV3A 1FYCA 1MBYA 2CHBD 5EKIA 1ENFA 1OXUA 3BDLA 1WTXA 4J8QA 4FVMA 3D6CA 4QUCA 4KD3A 1NCVA 3C2PA 1QG7A 4A3EB 1ET6A 1EY5A 2K5DA 3TZUA 1FGBD 3GTQB 2FFKB 3GTMB 1FR3A 1S5FD 2BOSA 2LMCB 2CQAA 3I3CA 2DY7A 1U4LA 3NSWA 5CR3A 2N55A 1WCMB 3SK5A 4HN7A 2B2VC 2FHTA 1IHZA 3OMGA 5FLXL 1ZEQX 1B3AA 3OSOA 3BYTB 4FNFA 3NXWA 3C3LA 3C46A 2JXMB 2WV6D 5CV9A 5IT9E 4WJWA 3C1FA 2KEDA 3QB3A 2WIIB 1FNVA 4FP5D 1TKWB 5IIFA 3DEOA 4K6LA 3SE0A 4F7XA 2SOBA 4PNYA 2B2YC 3WDNA 2DY8A 2VB3X 1SDFA 3D4RA 5IODA 4XDXA 1Q90A 2F0OA 5IGFA 2DNEA 3M7GA 2EYMA 1NAPA 1BCPF 5IOCA 3P1HA 3IAYA 5C4HA 3QWNA 2LKVA 1BOSA 4NKLA 3URYA 4CBVA 2JSOA 3BYYB 3AU7A 4RGNA 3HOUB 3QOJA 2ZXPA 3J7YW 2KUMA 1STGA 4OHJA 1FNWA 4IFDI 2EY1A 2NBFA 2ZT9C 3GTKB 4KKSA 1D2BA 2L9HA 2OEOA 2QDBA 2BCOA 4IUVA 3K5NA 3H94A 2LFNA 2ENBA 4ZAIA 3OMCA 1WTPA 4A3DB 1PRTF 2K5WA 2A69D 2NTSA 4Q0FA 4O1NA 1JWMD 3L7ZC 1SNPA 4EQNA 5IT9L 2B8GA 3MTSA 2R92B 3H91A 3N6RA 2F0GA 3PO2B 1F9QA 1DONA 5C44B 1WVLA 5JVG3 2VUMB 2F0NA 2A69C 2XIWA 4RGTA 2B63B 1TY2A 1AW7A 4DAYA 1CQVA 3NP8A 1BF4A 3A55A 2PYKA 5A2QL 3X3NA 1FNUA 5KNCA 3E6ZX 3PMFA 3NTHA 1SNCA 3K7AB 3T53B 1JC7A 5ELDA 4ZUJA 1T5EA 2Q8TA 3TSSA 1EY7A 3I4NB 1U9RA 3IFDA 5FKAC 5HURA 3M3YB 4QIWB 3DMUA 4K5XA 1TQOA 4Y7NB 3A8IE 3ZYYX 5K5PA 2F4IA 3E5SA 2E74C 2L12A 4RHRA 5I9PA 1EY0A 2Q8IB 5CBEE 4C3HB 2E2JB 3RD4A 1KNEA 1S4ZA 1CTMA 2EY2A 3HOXB 3M4OB 3DXJC 3HG9A 3OHXC 1H9MA 1I3QB 4C56C 3G7LA 3HOYB 1LT3D 2Z8LA 3KUPA 4A3JB 2LY7A 3M4YA 1BR9A 2IT1A 1A3TA 4H0LC 4DK0A 4ZKCB 1F2YA 2Z4IA 3K0YA 4ZQ3A 3HS0C 4Q5VA 1AZQA 3A56A 1NSNS 4EQPA 1VMPA 1ILPA 2BE5D 4BBRB 3K6OA 1ZYRD 1OO9B 5EPLA 5CBAE 4RFBA 1JWUD 4LAAA 1SYDA 2RA4A 4ME5A 2B2TA 4N9TA 4LK1C 4DNRB 5C5MA 3SHLA 3V96A 2KCCA 2BE5C 2NVTB 2CVRA 4IN3A 1ZYRC 1G8ZD 4G7OC 3R2IA 4TKOB 2KCNA 3KK7A 4EGVA 3VR4A 1J9OA 3RMHA 4C1NK 4OO1G 1EL0A 2K01A 1SYBA 1UUPA 1V8QA 1TWGB 4L63B 5JPNC 3MC0B 4L6TB 1ICWA 4YIJA 1BUVT 2C5CA 3A8KE 1D5MC 1Q1EA 1TU2B 1XWEA 5ELCA 2EYLA 1S5BD 2F0MA 2A68D 1I50B 1PTOB 2K03A 2X6LA 2RDHA 4BS9A 4BY7B 5M5XB 2L5TA 1V1PB 4ZRZA 4K6DA 3I90A 2AWOA 4A3GB 3MAQA 1CQFA 3MHBA 1ENCA 1EYCA 4A3FB 1SFOB 1PRTD 3MVVA 5T1IA 3K57A 2A68C 1D5XC 1Q8IA 1SMYC 1JR0D 1Y69U 2B2UA 3GTLB 1IW7D 1B2TA 4O42A 4IALA 4R9WA 1IYUA 1STBA 1PFBA 1PRTC 4KHZA 3JAML 3M85A 3MXUA 1CHQD 3S1QB 1M8AA 2F0WA 2DNCA 4CKBA 1IW7C 2WINB 1AN8A 2AUJD 5CV7A 2EY6A 2GA4B 2XWJB 5IGBA 3NQIA 1WTRA 3T51B 2RSOA 1CZGA 2WKCA 1PXUA 1QE6A 4DXGA 5E3FA 4KV6A 4NMZA 2ICEC 1PZKD 2NVXB 3OPOA 4OO1I 1F2LA 3QO2A 2PW7A 1PLFA 3Q22A 3J80E 2KHSA 2PPBC 1ZXTA 1JWSD 4ID6A 5J22A 1E2WA 3HOWB 2MUYA 1PZID 5EKLA 1CA5A 3BVGA 2B8FA 1SYGA 1KABA 1D1KA 1CK1A 3TP7A 3WOEA 1YNND 1B9NA 1TIID 3K5LA 4ZKBB 1W6JA 5LL6X 2RVLA 1PTOH 1HA6A 2HCIA 1EY6A 2K7VA 2NB0A 2BA0A 4AYBB 4V190 1ESRA 1BXTA 5M9OA 4NW2A 1YNNC 5EPJA 5K36G 5FLXE 1TWCB 2PNRC 1JICA 1EFID 5KGUA 3RZDB 5EPKA 1EQVA 1LT4D 1LTSD 4KN4C 3I8ZA 5C4XB 1MSHA 1EEID 3OIPA 1CFMA 1EY9A 2K5QA 3K5OA 4FXDA 3VR6A 3D4DA 1TS5A 3MXPA 1WTVA 5C0XJ 4RCNA 1Y8OB 2EE1A 1U4PA 3W2DA 1JQYD 3J80L 2L55A 1LT6D 3BG3A 5FO9B 1HRJA 1O7YA 2C9OA 3CRLC 4FXKC 2IX0A 2AWNA 3BDCA 4XYOA 2KA7A 1QNUA 1U4RA 1JE4A 4DA2A 1EYDA 3FVQA 4ZLTF 1GUNA 1CM9A 1DXMA 1RCVD 2K05A 2M2LA 1I4XA 2B39A 1A2UA 1SE3A 3U9SA 2EOTA 3HKZB 3ND8A 4K5VA 2X69A 4PMWA 4J6HA 3GQBA 4M1UB 5D3IB 1LTAD 2EYOA 4HEDA 1K8MA 2EVBA 2NN6I 5ELBA 1VCIA 4JBWA 4QB4A 2B2UC 1WD0A 4FYDA 5LHY1 1G2TA 4DU9A 2JYOA 3TN2A 2O5IC 1RF2D 2A5HA 4KK7A 4FO2A 2NYZD 3U9OA 2SEBD 5FK9C 5E4XA 2EYPA 5JEAJ 2IJ0A 3GP7A 1O78A 5CV5A 1ZKOA 2XN9C 1R4QB 5A2QE 2F0LA 2JE6I 2L0CA 1V1PA 1K83B 5AFWA 1JORA 1GOZA 5E4WC 2QILA 2O5JC 3FPUB 2JA7B 1LACA 2IWHA 1LTGD 1BNZA 2E2IB 4MIUA 1ESFA 3ND9A 3A8JE 4TSSA 3T16A 3BVZA 4HR7B 4KI0A 2NTTA 1HFGA 2OT2A 4QCLA 4ILWA 4FXGC 3IKJA 1SNOA 5C0XG 3PUWA 1CA6A 3MXGA 4X3SA 5EKKA 1LTRD 1OXXK 2RDFA 5K36H 5ISRA 1RODA 1M4VA 5C4JB 2PCFB 2WKDA 4UAIA 1LO5D 2A6ED 1STNA 3N52A 1VDZA 1STEA 3MA2B 2HDMA 2MGSA 2K33A 2HDLA 4B08A 1RHPA 4A93B 4BBSB 1LV9A 3GD7A 2F0HA 3HRZC 4HMIA 2VNUD 1SJHD 3NHHA 4XXEA 1T5XD 4QMGA 1SSOA 1EZ8A 1EU3A 5JOBA 4QUFA 1GHJA 2A6EC 3DEPA 1F2ZA 4C3HG 3GTJB 4OIKA 4CJ1B 3SK8A 5C6AA 5NUCA 3S2DB 1PDQA 2BDNA 1GUWA 1TY0A 4H7BA 4NP5A 3J81E 3NPPA 4CGYB 2F0KA 1Y1WB 4KJOA 2EY5A 3IL8A 2F0TA 3J7AV 2SNMA 3DWQA 4N9PA 1SEBD 5DNFA 3S1RB 1UAPA 1EWCA 2EJMA 1SBBB 5EQ0A 3ITPA 3VYUA 1WD1A 4IUPA 1STYA 1ENAA 2F0EA 2O4XA 2RSNA 3P20A 2KEEA 1C48A 4KMUC 3T56B 1O80A 1R4PB 2JP1A 3EROA 2VB2X 4KKTA 3FRPB 1BBXC 4U673 4XIGS 3P7JA 2F0SA 5E1FA 1S5ED 3KBGA 2I07B 4HMJA 4X3TA 1E2VA 2MJ8A 3EVQA 2NVYB 1TVXA 2A6HD 4TQUS 2HCCA 3PUVA 2PMZB 4I65A 2RBMA 4F8MA 1V43A 4KD4A 1Q1BA 1ILQA 2X6GA 1XTCD 1EEFD 2JA6B 1E0BA 2RQXA 4KY5A 1WTQA 3BDOA 3Q6SA 2RDGA 1G6ZA 2A6HC 4XQNA 4Z9CB 1KDBA 1D5ZC 1HHVA 3EA6A 1PTOD 2OXPA 4ZUIA 4DGZA 1XYIA 1JB3A 1KNAA 5DEHA 3J81L 4PV1C 3JAME 2AQ3B 2Z1CA 1SJED 5DAUA 5CV4A 4IUTA 2OF1A 5TSSA 4C3IB 1KAAA 1IKMA 4PQXA 1PTOC 5CMDA 1LLRD 3DUZA 5C0XH 2MHVA 2DN8A 2EYJA 1KLUD 2QCPX 4OGQC 1UNSA 1GHKA 2KJXA 3E0JA 1NR2A 1AFPA 2F0IA 3A7LA 2ID0A 4EVOA 4MHEA 1MI2A 4A3KB 2XVSA 1K8OA 5CV6A 1PFMA 4ZYSA 5M5YB 1HQRD 5M3FB 4OIJA 1H9KA 1VMCA 1KDCA 2G9DA 2R93B 1H9RA 3PIP3 4KJNA 1SMYD 1YNJD 1LT5D 4K2KA 2IW3A 3UI2A 1RD9D 1LABA 3SXHA 2WP8J 1LTTD 2K04A 1S5DD 5EBDA 4DAVA 3BZDB 3SEBA 4QF4A 1MGSA 1YNJC 4RGOS 2PZUA 2F3VA 1RKNA 1G91A 3NK9A 3CU7A 5EBCA 2IL8A 3RUZA 3TZDA 3O13A 3V05A 1BCPB 1DCZA 4DN4M 3EQLC 2G9HD 4C2MB 1I6VC 1SXTA 5JEAH 3L3OC 2F03A 4IFDJ 2L4NA 3NTIA 1JOQA 5JJZA 2RKSA 1HQMC 3I4MB 1F9SA 4DF7A 4ABNA 2Q8RE 5I6YA 3RLFA 3W3AA 5I2XA 1KTKA 3LNNA 3S2HB 2EJFC 3CRKC 1C4QA 1STAA 3OIQA 2CW0D 5FO8B 4UDUC 5CV8A 1GXDC 1EOTA 5F2DA 3HGBA 1RJTA 4BWGB 2D9UA 5M5WB 1W6KA 2M9VA 4C3JB 1PRTB 2A74C 1PYWD 3QIAA 3LWUA 1G2SA 2KECA 1X32A 5KYLA 2CW0C 3H6MA 1HTLD 1H9SB 4EQOA 3A54A 1QOHA 5KIXA 1DOKA 1JOOA 4IQZA 3GTPB 4RWSC 2A73B 3PIO3 4TRDA 4CKEA 1GUSA 4K8IA 4XT1B 1EYAA 1ET9A 1SNMA 4OL7A 3NQTA 4NDXA 4K5WA 1EY4A 1QB5D 1KLGD 4XT3B 3G6JB 3TP8A 2R6GA 3VA7A 3NBIA 1FD7D 1HUMA 4RAUC 3H09A 4V0BA 5BN5A 1DZ1A 1ML0D 1VF7A 4BA2I 2B2TC 3MEHA 5T1GA 1TR5A 3R3OA 3MXNA 4G7HC 3LWEA 2XNAC 3S17B 5COYA 5C3WA 2H4OA 5C3XA 1I4HA 1MSGA 3OW7A 1Y8NB 5CC4A 3MWYW 5KYIA 2IPKD 2EJGC 1L0YB 1LTBD 2NZ1D 5CORA 1WTOA 1UEAB 2K1BA 2PW5A 3R93A 4IUUA 3H3VC 3GTOB 3MFYA 3S1MB 1HXYD 4IFDG 4BY1B 3TMEA 1QJOA 5C4ZA 3I70A 1XX8A 4BA1I 1D1IA 5I6WA 2AUKA 4K2LA 1QNKA 1Z6HA 1GJXA 1U4MA 5IGCA 4XQJA 3K59A 4KKUA 3AB9A 5DM73
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ILQ A;  2MGS A;  2X6G A;  1B50 A;  2HDL A;  4NW2 A;  1RHP A;  2B2U C;  2B2Y C;  1RTN A;  2DY8 A;  4RWS C;  1WD0 A;  2CVR A;  1B4O A;  1E0B A;  5EPJ A;  1SDF A;  1G2T A;  1MGS A;  3DM1 A;  4R8I A;  1LV9 A;  2KVM A;  4XDX A;  2JYO A;  2Q8T A;  3TN2 A;  1WTQ A;  5D14 A;  2MP1 A;  1M8A A;  3IFD A;  3Q6S A;  1JIC A;  1A15 A;  1G6Z A;  4XT1 B;  4ZK9 B;  1HUN A;  1J9O A;  4MN3 A;  5EPK A;  1C8C A;  1SSO A;  2K28 A;  1NAP A;  1F9P A;  2NYZ D;  1Q3L A;  2KOL A;  3I8Z A;  1EL0 A;  2K01 A;  4QUF A;  3F2U A;  5E4X A;  1G91 A;  1HHV A;  3DEP A;  1BO0 A;  1MSH A;  3GV3 A;  4XT3 B;  5EJW A;  3FDT A;  1WTR A;  3ONA B;  4CJ2 C;  2IL8 A;  2FIN B;  1SAP A;  5EKI A;  2RSO A;  3D6W A;  1XYI A;  1HFN A;  3TZD A;  2L12 A;  4RA8 A;  1KNA A;  4OIK A;  4CJ1 B;  3I91 A;  1HUM A;  2L11 A;  1WTX A;  4RAU C;  5CBE E;  1QE6 A;  1PDQ A;  1PFN A;  1ML0 D;  2BDN A;  2KUM A;  4DN4 M;  1WTV A;  1ICW A;  1DZ1 A;  1GUW A;  2B2T C;  1EQT A;  2HUG A;  1KNE A;  4QUC A;  2MPM A;  1S4Z A;  4IUT A;  5T1G A;  1NCV A;  2EE1 A;  2L4N A;  1U4P A;  4ZKB B;  1IKM A;  3LWE A;  3IL8 A;  5AFW A;  3KBX A;  2L9H A;  5COY A;  1QG7 A;  5E4W C;  1F2L A;  5CMD A;  5JJZ A;  3FPU B;  4IUV A;  3QO2 A;  4X3U A;  5DNF A;  1HRJ A;  1PLF A;  1O7Y A;  1F9S A;  4HAE A;  2K03 A;  3G7L A;  4HCS A;  2X6L A;  1DOL A;  4ZAI A;  1BNZ A;  2J7Z A;  5EQ0 A;  3KUP A;  1WD1 A;  2B2V A;  1EIH A;  2Q8R E;  4IUP A;  1MSG A;  1J8I A;  3HP3 A;  1WTP A;  1ZXT A;  2FFK B;  2RSN A;  1NR2 A;  3MWY W;  2KEE A;  1U4R A;  1JE4 A;  3I3C A;  3I90 A;  2DY7 A;  1O80 A;  1U4L A;  2JP1 A;  4ZKC B;  4MHE A;  1MI2 A;  3GV6 A;  1AP0 A;  2NZ1 D;  2N55 A;  1CA5 A;  1BBX C;  2B2V C;  1EOT A;  2FMM A;  2FHT A;  4IUQ A;  5COR A;  3P7J A;  1WTO A;  4ZLT F;  1HFG A;  1CM9 A;  1O7Z A;  1RJT A;  2K05 A;  2K1B A;  2M2L A;  4X3K A;  2R3Z A;  5T1I A;  3R93 A;  1B3A A;  2D9U A;  4LMQ D;  1AZQ A;  1AZP A;  1IL8 A;  4IUU A;  5D65 A;  3MTS A;  1PFM A;  1VMP A;  2B2W A;  3H91 A;  1CA6 A;  1ILP A;  1IKL A;  2EOT A;  4X3S A;  2NWG A;  4IUR A;  1F9Q A;  4OIJ A;  1DON A;  1VMC A;  2N88 A;  2X69 A;  1WVL A;  5EPL A;  2VXW A;  1G2S A;  2KEC A;  2L1B A;  1ROD A;  1F9R A;  1DOM A;  1RTO A;  1X3Q A;  2SDF A;  4X3T A;  5CBA E;  1WTW A;  2MJ8 A;  4U68 A;  4CJ0 B;  1XX8 A;  1B53 A;  1TVX A;  1X32 A;  1X3P A;  2B2U A;  2B2Y A;  2KED A;  2RVL A;  2HCC A;  1QNK A;  2XIW A;  4HSV A;  1HA6 A;  1B2T A;  2RA4 A;  4UAI A;  2FJ2 A;  2HCI A;  2B2W C;  4O42 A;  3UI2 A;  4HED A;  1U4M A;  1EIG A;  2B2T A;  4R9W A;  1DOK A;  2EPB A;  1BF4 A;  3SVM A;  2K04 A;  3N52 A;  1PFB A;  3DEO A;  2H1E A;  2HDM A;  1NR4 A;  1ESR A; 
#chains in the Genus database with same CATH topology
 3FPP A;  3D31 A;  4ODG A;  4KHV A;  3BJU A;  2BDO A;  5IYC G;  1B7Y B;  1VQB A;  1HNW Q;  4I7Z C;  1A8V A;  2PNH A;  1JCK B;  3CCJ A;  2I46 A;  4FF4 A;  4B3R Q;  4DK1 A;  1WTH A;  1EZ6 A;  2UUA L;  5M5W H;  4C3J H;  1JE5 A;  5DM6 3;  3GO5 A;  4X62 L;  4JI4 L;  2EYF A;  4HCE A;  4B9X A;  1E2Z A;  1H9J A;  4CKC A;  2F0Q A;  5G3L D;  3UDI A;  3FDT A;  2TSS A;  3KLR A;  1L1O A;  3HOW H;  3KJP A;  3S14 B;  1I6H B;  2YU9 B;  2JA5 B;  1PMR A;  4CDF C;  1PTO F;  2SNS A;  1L0X B;  3TBI B;  2MPM A;  4L8J A;  4PZ7 A;  2JA7 G;  1QVF A;  3U4Z A;  2HIV A;  3BZK A;  3M7N A;  2MO1 A;  3GTP H;  1A3U A;  2N3S A;  3S9W A;  1SND A;  1FGU A;  4IZ8 A;  5LL6 S;  1Z7T A;  2D0O A;  4X62 Q;  5IP9 G;  4JI4 Q;  1PH5 A;  1DJR D;  3NUC A;  1C7Y A;  3VYR A;  1X54 A;  5AJ3 L;  1EU4 A;  4DXF A;  3HP3 A;  5BR8 L;  1SYE A;  2KCM A;  2NUC A;  4GZY C;  2Q2H A;  1BDO A;  1OTC A;  2F1M A;  2XRQ D;  3R2T A;  1K3R A;  1JJ2 A;  3PV0 A;  1AP0 A;  3JC6 6;  4IUQ A;  3J7A F;  4QQB X;  1HPC A;  4X3K A;  4LMQ D;  5I2Y A;  1AZP A;  1S5C D;  2QEX A;  3K58 A;  2E2D C;  1VF5 C;  3RZD H;  2R61 A;  4G57 A;  3J80 c;  2QDL A;  2KHJ A;  4J15 A;  2VXW A;  1HNZ L;  1F9R A;  1WTW A;  1TT2 A;  4IJH A;  1SYF A;  3S17 H;  2EIF A;  5AJ3 Q;  4DPG A;  2NN6 H;  2ZXO A;  5BR8 Q;  5C4X H;  4DK6 C;  3PGZ A;  4HSV A;  2FJ2 A;  1IZ6 A;  1I4G A;  4LUO A;  4GKK L;  1XPU A;  1EIG A;  3CQZ B;  3SVM A;  4A93 G;  1EOV A;  4BBS G;  1CHP D;  2EZV A;  3W1B A;  4A3L G;  2H1E A;  1SN8 A;  3H3V I;  1QZG A;  4NB3 A;  2TMP A;  1E24 A;  3VYS A;  4IO9 A;  4GN3 B;  3QR8 A;  2UUC L;  1BKB A;  4RKB A;  3PUX A;  4OX9 L;  4CDE C;  2JEA I;  5BN4 A;  1VQD A;  1A15 A;  1HA5 A;  1V1O A;  3WOF A;  1Q82 C;  5I9O A;  1EIY B;  5A35 A;  1X56 A;  3GTO H;  4ULL A;  1Q3L A;  2IX3 A;  3KF6 B;  1AH9 A;  3RR5 A;  2D2C C;  4GNX A;  4HJ5 A;  4BY1 H;  4JI0 Q;  1SAP A;  4HTH A;  3D6W A;  2D5D A;  1N34 L;  1YVC A;  3I91 A;  4NXN L;  2L11 A;  4L5R C;  1TWF B;  1Y1W G;  4A3B B;  2K6A A;  3K5M A;  3OWE B;  2Z4H A;  4DR1 L;  2HUG A;  2WAC A;  2UUC Q;  4OX9 Q;  2JA8 B;  4UHV A;  1B44 D;  1SNQ A;  3NBH B;  3CXC A;  4HID A;  2KHI A;  4OWX B;  4H13 C;  5D3D A;  5EGT A;  3VR5 A;  1PH3 A;  2QW7 A;  2ZJP A;  2EDG A;  4HCS A;  1TWH B;  2PI2 A;  4R4Q A;  4A3C H;  1J8I A;  5IGE A;  4IFD H;  2E76 C;  1L0W A;  3Q24 A;  1N34 Q;  2BA1 A;  4GOP B;  1QVG A;  3KLW A;  4NXN Q;  2IHF A;  5L37 A;  1WI5 A;  4ZCK A;  4DR1 Q;  1IBM L;  3SDZ A;  1YHQ A;  5BN3 A;  3S14 H;  3D3R A;  2FMM A;  4B3S L;  3IFT A;  2YU9 H;  4OWT B;  2JA5 H;  4J1M A;  4N8F A;  1H9S A;  5C3E B;  3VR2 A;  3S1N B;  1Z47 A;  4IUR A;  2N88 A;  1A62 A;  2QKI C;  4IJL A;  2K14 A;  3EJI A;  1X3Q A;  3UE0 A;  1VQN A;  3CCE A;  4LF8 L;  1X3P A;  1E1T A;  3BS1 A;  3NWS A;  1G29 1;  2F3W A;  5JEA G;  3CCQ A;  5LMU L;  3DHQ A;  4HIO A;  2JA6 G;  3CKI B;  1IBM Q;  1YHB A;  4B3S Q;  1X6O A;  2PZT A;  5LMN Q;  4R8N A;  2ZXR A;  1KRT A;  1RTN A;  4G7Z C;  2J0T D;  4LFC L;  5GAH C;  4EQ5 A;  2KVM A;  3S16 B;  1GUT A;  4DV0 L;  4ZK9 B;  2E2H B;  2K32 A;  1CKM A;  1S40 A;  4DR5 L;  3FKI B;  1EWH A;  2Z6B A;  1WYD A;  3TQY A;  4LF8 Q;  1X3F A;  2I5L X;  2HQE A;  1MD2 D;  1XXG A;  5IP9 H;  1BQQ T;  4DFA A;  4CJ2 C;  4HJ7 A;  2XRS D;  3I73 A;  2FIN B;  2E2I H;  5LMU Q;  5I4D A;  5C0X I;  4YWK A;  1B1Z A;  4LJZ C;  3BVM A;  4C3I G;  4QY7 A;  3M4P A;  4LFC Q;  4HIK A;  3MZ5 A;  4C1N I;  4LFB L;  4OON A;  4DV0 Q;  4JI1 L;  4P71 A;  3Q8D A;  3KBX A;  4DR5 Q;  2ZTE A;  2CFM A;  3HZX A;  4CHT B;  3H0G B;  2A1A A;  5FOB B;  5J39 A;  3A0J A;  4HAE A;  4AIM A;  1VQ6 A;  1GUG A;  5IGD A;  2QEJ C;  1PH8 A;  2D62 A;  4E6I A;  4GLX A;  4FF2 A;  2ZTC A;  4A3K G;  3UDF A;  3AFP A;  4IOC A;  4LF4 L;  2V1C C;  2ICI A;  3W5O A;  3E3X A;  4DNT B;  3GV6 A;  1Y8P B;  4DR2 L;  4RGM A;  3KLS A;  2F0F A;  3Q0A A;  4LFB Q;  4XYQ A;  1CKN B;  1O7Z A;  2N8N A;  5M3F G;  2R3Z A;  4JI1 Q;  4A3B H;  2R93 G;  2B2W A;  4ALP A;  5JJK A;  4JK1 C;  5GQO A;  3KF8 A;  4F88 A;  3ULP A;  2JA8 H;  1XTD A;  3F2U A;  2L1B A;  5CGK A;  1DOM A;  4LF6 L;  1QIL A;  1HR0 L;  3RZO B;  2RF4 A;  3QJY A;  3PO3 B;  1B53 A;  1DM0 B;  3PUZ A;  4RHS A;  1F2M A;  1HZA A;  3T13 A;  1IYV A;  1Y1V B;  5ELE A;  2KQ3 A;  2PO4 A;  4LF4 Q;  3VA5 A;  1N8R C;  2F0P A;  1TS3 A;  4DR2 Q;  4JI2 L;  3P75 A;  4FDB A;  1OXS C;  3S2D H;  3Q23 A;  1NBW A;  4KTA A;  1CI3 M;  1SYC A;  1B50 A;  3LGJ A;  1BCP D;  2CH4 A;  1RDP D;  3NEM A;  2EYH A;  1B4O A;  4DV3 L;  4NPS A;  2F0D A;  4XTC S;  4R8I A;  4R4I A;  1O7L A;  1EQR A;  5D14 A;  3I4L A;  3HFZ B;  1Q8K A;  3LX0 A;  2HIX A;  1HUN A;  1K28 A;  3S1R H;  3DWA A;  4LF6 Q;  5C3E H;  2LSS A;  1C8C A;  2K28 A;  1HR0 Q;  3S1N H;  2E75 C;  5J1Z A;  1AEX A;  1A2T A;  1QCB D;  1TWA B;  4CDD C;  1SRU A;  2XWB B;  5EJW A;  3C1E A;  1EY8 A;  4BXX G;  1OXV A;  3A7A B;  4AH6 A;  1HFN A;  1PH1 A;  1N36 L;  4JI2 Q;  4L5T A;  4RA8 A;  1YJ9 A;  1BCP C;  2JN4 A;  3AMU A;  2XSC A;  1PFN A;  2FMC A;  2ALY B;  5G3L F;  4DV3 Q;  3TP6 A;  3I4M G;  2HQL A;  1HCZ A;  3MFG A;  4K8J A;  1IXR A;  3DWP A;  3HEJ A;  4HSP A;  4OXP A;  1CT1 D;  4A3I B;  1K3B C;  3S16 H;  2IX1 A;  1DOL A;  3L9A X;  1HTP A;  1TS4 A;  5KND A;  5HGT A;  2B2V A;  2NVY H;  3TP5 A;  1STH A;  3FKI H;  3VR3 A;  3UE1 A;  1ONL A;  2Q2T A;  1CZW A;  2YYZ A;  3CMA A;  1N36 Q;  1PVO A;  2QF7 A;  4GS3 A;  3S15 B;  5M3M B;  3X3M A;  1PA6 A;  1Q12 A;  1AE2 A;  4G4K A;  4C3J G;  4LFA L;  4FF1 A;  3AYH B;  2V4D A;  1EWI A;  2JJQ A;  1IL8 A;  2AQ1 B;  3E9H A;  5D65 A;  1BVS A;  4WOR A;  1IKL A;  5CYU A;  2NWG A;  4DAP A;  2AHO B;  2WB1 B;  3RLO A;  3KLS X;  3I72 A;  1HH2 P;  1PZJ D;  2CKZ B;  2HHH L;  2EXZ A;  2K4K A;  1HJP A;  4LW1 A;  3PUY A;  2B2Y A;  3H0G H;  2Y0S B;  4FF3 A;  4WFN 3;  1D7Q A;  3SK6 A;  1CSP A;  3HKS A;  3CF5 A;  2Z0S A;  1II3 A;  3NTK A;  4KHP L;  2EPB A;  1F77 A;  3KJO A;  3OOC A;  2WB1 E;  3QG1 A;  1NR4 A;  3QOL A;  4LFA Q;  3KF6 A;  3GTG B;  4WRD A;  2R7Z B;  1HZC A;  4P2C B;  1W3S A;  4K14 A;  1D6E C;  4A3M B;  1I4P A;  3CHB D;  3DM1 A;  1I4Q A;  2Y0S E;  3SK4 A;  3V2T A;  1KC8 C;  4DR3 L;  3T4A C;  2MP1 A;  1BBW A;  2F0U A;  2F0V A;  5J3B A;  1I4R A;  3VYT A;  2PQA B;  4DV4 L;  4LF9 L;  4MN3 A;  4DAY B;  3TEH B;  2I5H A;  4RCO A;  4ME3 A;  2HHH Q;  2KOL A;  1SE2 A;  1LYL A;  1BO0 A;  4TVA B;  3NBH A;  1A3V A;  3ONA B;  4KHP Q;  3FEW X;  4DR4 L;  4S3S A;  1IBL L;  1Y1V H;  2WAQ B;  2OTJ A;  5KEE A;  3HOV B;  4R1J A;  1EQT A;  2F4V L;  1KXL A;  3D4W A;  4YHH L;  2JEB I;  5JAV A;  2PQE A;  2NN6 G;  4DR3 Q;  1MIU A;  1K8A C;  4RKL A;  4DV4 Q;  4LF9 Q;  5M5Y H;  1FL0 A;  4X3U A;  4UY8 C;  3J7Z C;  2WAQ E;  2O2L D;  2NVQ B;  1TXY A;  1B9M A;  2HD3 A;  5IGG A;  2J7Z A;  1A6X A;  1SE4 A;  1EIH A;  2F0J A;  3E0E A;  3SGI A;  5IYB H;  4F87 A;  4DR4 Q;  5DLQ E;  1I94 L;  1IBL Q;  4QJF A;  3HOZ G;  4KY7 A;  4XQQ A;  4IPC A;  4B9W A;  5KRU A;  4DV7 L;  1ICF B;  4OO1 H;  5ELF A;  4KY6 A;  2F4V Q;  4YHH Q;  2PZW A;  4H44 C;  1QWY A;  1KDA A;  1R9T B;  3FMC A;  1DD2 A;  1VQJ A;  1TS2 A;  1NUC A;  5C5L A;  5FO7 B;  4BY1 G;  4M8A A;  4EX5 A;  4GLA C;  3SR1 A;  3EFX D;  5KNB A;  1DYQ A;  2SDF A;  4PMC A;  1RTO A;  4PMB A;  1WFQ A;  4U68 A;  1T9H A;  4CJ0 B;  4B3T L;  1SR3 A;  2CH4 W;  1M1K C;  1LTI D;  4HJ8 A;  1I94 Q;  3I4O A;  2B2W C;  3OWF A;  4AYB E;  3ERQ A;  3NE5 B;  3HOZ B;  1GUO A;  1XNQ Q;  1UWV A;  4IUN A;  5GAE C;  3S15 H;  5M3M H;  1JOK A;  2Z9H A;  2AQ2 B;  3NWT A;  4A3C G;  2LS0 1;  1EYG A;  4WJ4 A;  5JVH 3;  3TDQ A;  3R8B A;  3D8G A;  5HY6 A;  4RH6 A;  2J4X A;  4JI3 L;  1F9P A;  4B3T Q;  1OXT A;  5JPM C;  2M00 A;  1KQS A;  4KN7 C;  3GV3 A;  1FYC A;  1PHJ A;  1MBY A;  2CHB D;  2JA5 G;  3S2H H;  5LMN W;  4YWL A;  5EKI A;  2VQE Q;  1ENF A;  1OXU A;  3BDL A;  1WTX A;  2H5X A;  4J8Q A;  4FVM A;  3D6C A;  4QUC A;  4KD3 A;  1NCV A;  1QVC A;  3C2P A;  2R7Z H;  1QG7 A;  4A3E B;  4JI3 Q;  1ET6 A;  1EY5 A;  3CC2 A;  2K5D A;  3TZU A;  1FGB D;  1EIF A;  1CKN A;  3GTQ B;  4RG1 A;  2FFK B;  3GTM B;  1FR3 A;  1S5F D;  3W1G A;  2BOS A;  2IY5 B;  2LMC B;  2CQA A;  3I3C A;  1VS0 A;  2DY7 A;  1YJW A;  1U4L A;  4PG3 A;  3NSW A;  5CR3 A;  2N55 A;  1WCM B;  3SK5 A;  4HN7 A;  2B2V C;  2UUA Q;  2FHT A;  1IHZ A;  3OMG A;  3HKZ E;  3HOV H;  1GD7 A;  5FLX L;  1PH4 A;  1ZEQ X;  1B3A A;  3OSO A;  3BYT B;  4FNF A;  3NXW A;  3C3L A;  3C46 A;  1MJE A;  2DJF C;  2JXM B;  2WV6 D;  5CV9 A;  5IT9 E;  1G51 A;  1VQA A;  3D0F A;  4WJW A;  3C1F A;  3S24 A;  2KED A;  3QB3 A;  1VQK A;  3F1Z A;  2WII B;  4JOI A;  1FNV A;  3A74 A;  4FP5 D;  3FP9 A;  1TKW B;  2DUD A;  2K50 A;  4JBJ A;  5IIF A;  5H1S E;  4JVZ A;  3DEO A;  4K6L A;  3SE0 A;  4F7X A;  2SOB A;  4PNY A;  2B2Y C;  3WDN A;  2DY8 A;  4IPD A;  2NZO A;  1EUJ A;  2VB3 X;  1P8L A;  1SDF A;  3D4R A;  5IOD A;  4XDX A;  1PV4 A;  1Q90 A;  2F0O A;  5IGF A;  2DNE A;  1R9T H;  2KBN A;  3M7G A;  2EYM A;  1NAP A;  1BCP F;  5IOC A;  3P1H A;  3IAY A;  5C4H A;  3BU2 A;  3PCO B;  4DR6 L;  3QWN A;  2LKV A;  4A3B G;  1BOS A;  4NKL A;  3URY A;  4CBV A;  2JSO A;  2UU9 L;  3BYY B;  3AU7 A;  4RGN A;  3HOU B;  3QOJ A;  2JA8 G;  2ZXP A;  3J7Y W;  4AQY L;  2KUM A;  1STG A;  4OHJ A;  5IE8 A;  3HOZ H;  1FNW A;  4IFD I;  2EY1 A;  2F52 A;  3CCS A;  2NBF A;  4R4O A;  1HNZ Q;  2ZT9 C;  3GTK B;  4KKS A;  4O2D A;  3PSI A;  1JJC B;  1D2B A;  2L9H A;  3S1M H;  1UE6 A;  2OEO A;  2QDB A;  2BCO A;  1X3G A;  4IUV A;  3K5N A;  4GKK Q;  3GDE A;  3H94 A;  3ER0 A;  3CCV A;  1VQ5 A;  2LFN A;  2ENB A;  4ZAI A;  4DR6 Q;  4HJ9 A;  3TRZ A;  3OMC A;  1WTP A;  4A3D B;  3TS0 A;  1PRT F;  2UU9 Q;  4JI8 L;  2K5W A;  2A69 D;  2NTS A;  4UP8 A;  2EXD A;  4Q0F A;  4AQY Q;  1XJV A;  4O1N A;  2BH8 A;  1JWM D;  5C3E G;  3L7Z C;  1PH9 A;  1SNP A;  4PZ6 A;  4I7A A;  2JK8 A;  3EBE A;  1EFW A;  4LUZ A;  4EQN A;  5IT9 L;  2B8G A;  3MTS A;  2R92 B;  3H91 A;  3N6R A;  4B3M L;  2F0G A;  1EQQ A;  3PO2 B;  1F9Q A;  1DON A;  5C44 B;  1WVL A;  2OQK A;  5JVG 3;  1MKH A;  1QUQ B;  2VUM B;  2F0N A;  2I0Q A;  2A69 C;  4A3E H;  2ZTD A;  2XIW A;  2CQO A;  4RGT A;  2B63 B;  1TY2 A;  1CSQ A;  4JI8 Q;  1AW7 A;  3RN2 A;  4P72 A;  2LXJ A;  2PQA A;  4DAY A;  1I6H H;  3GTQ H;  1CQV A;  3NP8 A;  1BF4 A;  4QL5 A;  3A55 A;  2PYK A;  5A2Q L;  3X3N A;  1FNU A;  5KNC A;  3E6Z X;  1YIT A;  3PMF A;  1E7Z A;  3NTH A;  1SNC A;  3G48 A;  3K7A B;  3T53 B;  1RIP A;  1JC7 A;  1YNX A;  5ELD A;  4ZUJ A;  1T5E A;  2R7F A;  3FKI G;  4NXM L;  2Q8T A;  3TSS A;  1EY7 A;  3I4N B;  1U9R A;  3IFD A;  5FKA C;  5HUR A;  3M3Y B;  4QIW B;  5IY0 A;  3DMU A;  1BBU A;  1DGS A;  4K5X A;  3G6E A;  4OWW B;  1TQO A;  5GAD C;  1UEB A;  4Y7N B;  1P16 A;  3A8I E;  3ZYY X;  5K5P A;  2F4I A;  3E5S A;  2E74 C;  2L12 A;  1N33 L;  3AEV A;  1C0A A;  4RHR A;  5I9P A;  4JI7 L;  1EY0 A;  2Q8I B;  1N32 L;  5CBE E;  4YCV A;  4C3H B;  1XNR L;  4QIW E;  2E2J B;  3RD4 A;  1KNE A;  1S4Z A;  1CTM A;  4X65 L;  4NXM Q;  1LUZ A;  3H0G G;  2EY2 A;  3HOX B;  1HZB A;  3M4O B;  3DXJ C;  4BBR G;  3HG9 A;  1NTG A;  3CCM A;  3OHX C;  1H9M A;  1I3Q B;  4C56 C;  3G7L A;  3G4S A;  3HOY B;  1LT3 D;  2Z8L A;  3KUP A;  3CC7 A;  4A3J B;  2LY7 A;  3M4Y A;  2I5M X;  3KDF B;  2AMC B;  1VQ4 A;  1BR9 A;  4JI7 Q;  2IT1 A;  3CQZ H;  1A3T A;  1N32 Q;  4H0L C;  3RLN A;  4DK0 A;  4ZKC B;  1F2Y A;  2Z4I A;  3K0Y A;  4ZQ3 A;  3HS0 C;  1L1O C;  4Q5V A;  4X65 Q;  1AZQ A;  3A56 A;  3OW2 A;  1NSN S;  2Z6K A;  4EQP A;  1S3O A;  1VMP A;  4X66 L;  1ILP A;  2BE5 D;  4BBR B;  1NJI C;  3K6O A;  4JBK A;  3PO3 G;  1ZYR D;  4YCW A;  2VY3 A;  1OO9 B;  1Y1V G;  5EPL A;  1O7I A;  5CBA E;  5IT9 c;  4RFB A;  1JWU D;  2UXC L;  1J6Q A;  4LAA A;  1SYD A;  2RA4 A;  4P73 A;  4ME5 A;  2B2T A;  4N9T A;  4LK1 C;  4DNR B;  5C5M A;  3TS2 A;  3BZC A;  1TWF H;  3SHL A;  4DV6 L;  3V96 A;  2KCC A;  2BE5 C;  2NVT B;  2K5N A;  2CVR A;  4IN3 A;  1ZYR C;  4JOI C;  1SRO A;  1G8Z D;  1KHI A;  4G7O C;  2VL6 A;  3PF4 A;  5IYB G;  3R2I A;  2DJG C;  4TKO B;  2KCN A;  2VW9 A;  3KK7 A;  4DKA C;  4EGV A;  3VR4 A;  1J9O A;  2UXC Q;  2R92 H;  3RMH A;  4C1N K;  4OO1 G;  1EL0 A;  1TWH H;  2K01 A;  2AKW B;  3JAM i;  1SYB A;  5C44 H;  1YZ6 A;  4BY7 G;  1IYJ B;  1UUP A;  1V8Q A;  1TWG B;  4L63 B;  5JPN C;  3MC0 B;  3OTO L;  4L6T B;  4OEM B;  2LXK A;  4DV6 Q;  2MQH A;  2N78 A;  1ICW A;  2MO0 A;  1BUV T;  4YIJ A;  2C5C A;  3A8K E;  2ES2 A;  1XMO L;  1D5M C;  1B70 B;  5E7N A;  4A3I G;  4L5Q A;  3F2D A;  1Q1E A;  3DM3 A;  1TU2 B;  1IL2 A;  1XWE A;  5ELC A;  5FLM G;  2EYL A;  3CAM A;  4POF A;  1L2F A;  1S5B D;  2F0M A;  1KAW A;  2A68 D;  1I50 B;  1PTO B;  2K03 A;  2OTL A;  2X6L A;  2RDH A;  2EQS A;  2UXD L;  4BS9 A;  5M3M G;  4BY7 B;  3ZJY C;  5M5X B;  2L5T A;  1V1P B;  4JV5 L;  4ZRZ A;  1YIJ A;  2YV5 A;  4K6D A;  5HGQ A;  3I90 A;  2AWO A;  4YY3 L;  4Y7N H;  4A3G B;  4GNX C;  3MAQ A;  1CQF A;  3MHB A;  1ENC A;  2QA4 A;  1XMO Q;  1EYC A;  4A3F B;  1SFO B;  4JPB W;  2WB1 G;  1PRT D;  3MVV A;  5T1I A;  3K57 A;  2CWP A;  2A68 C;  1D5X C;  1JB7 A;  1W2B A;  1M90 C;  2E2H H;  1Q8I A;  2Y0S G;  3M4O H;  1SMY C;  2UXD Q;  1JR0 D;  1Y69 U;  2B2U A;  3GTL B;  1IW7 D;  4JV5 Q;  1B2T A;  4O42 A;  4IAL A;  4YY3 Q;  4R9W A;  1IYU A;  2R7Z G;  1STB A;  1PFB A;  1PRT C;  4KHZ A;  3JAM L;  4A3M G;  3M85 A;  3MXU A;  1CHQ D;  1UE5 A;  3PF5 A;  1VQL A;  3S1Q B;  1M8A A;  2F0W A;  2DNC A;  1VQP A;  2D0P A;  4CKB A;  1IW7 C;  3ULL A;  2WIN B;  1X55 A;  3ULJ A;  1AN8 A;  2AUJ D;  1K73 C;  4BBR H;  5CV7 A;  2EY6 A;  2GA4 B;  2XWJ B;  2WAQ G;  4LF7 L;  3HOV G;  5IGB A;  3NQI A;  1WTR A;  2K5V A;  2F3I A;  3T51 B;  2RSO A;  3CC4 A;  1RL2 A;  1CZG A;  2WKC A;  3NEN A;  3PIP A;  1PXU A;  4WJ3 M;  2E8G A;  1QE6 A;  4DXG A;  5E3F A;  2K75 A;  4KV6 A;  1VQM A;  5IP7 G;  4GLV B;  1Q86 C;  4NMZ A;  2ICE C;  2HT1 A;  3CD6 A;  1PZK D;  2NVX B;  3OPO A;  1VQF A;  4OO1 I;  1F2L A;  3QO2 A;  2PW7 A;  1PLF A;  3Q22 A;  4O0A A;  3CCR A;  3RZO H;  2VS1 A;  3T1H L;  3J80 E;  3PO3 H;  1YI2 A;  2KHS A;  1ASZ A;  2E5L L;  2PPB C;  1ZXT A;  1JWS D;  4ID6 A;  5J22 A;  1E2W A;  3EIV A;  3HOW B;  2MUY A;  1PZI D;  5JJL A;  5EKL A;  1QUQ A;  4GOP A;  1CA5 A;  3J80 i;  3BVG A;  3CCU A;  2B8F A;  1SYG A;  1KAB A;  3I55 A;  2P5Z X;  1D1K A;  1CK1 A;  3TP7 A;  3WOE A;  1YNN D;  1B9N A;  1TII D;  3K5L A;  4ZKB B;  4JI6 L;  3T1H Q;  1W6J A;  5LL6 X;  4K0K L;  2E5L Q;  1TWA H;  2RVL A;  1I50 H;  1PTO H;  2QGQ A;  1HA6 A;  2HCI A;  2FXQ A;  2K5H A;  1EY6 A;  4P75 A;  2K7V A;  2NB0 A;  4BY7 H;  2BA0 A;  4AYB B;  3G71 A;  1HNX L;  4V19 0;  1ESR A;  1BXT A;  4DV2 L;  5M9O A;  4NW2 A;  4A3G H;  1YNN C;  5EPJ A;  5K36 G;  5FLX E;  1TWC B;  1VQC A;  2PNR C;  1KIX A;  3U58 A;  4A3F H;  1SFO H;  4DUZ L;  1JIC A;  1EFI D;  2WFW A;  5KGU A;  3RZD B;  4JI6 Q;  5EPK A;  1EQV A;  1PYB A;  4A3I H;  5JJI A;  1LT4 D;  1LTS D;  4KN4 C;  3I8Z A;  5FLM H;  4DV7 Q;  5C4X B;  1MSH A;  1EEI D;  3OIP A;  1Q7Y C;  1CFM A;  4MTK A;  1EY9 A;  2K5Q A;  5ELN A;  2OWO A;  3H15 A;  2OCE A;  3GTL H;  3K5O A;  3M9B A;  1VQ9 A;  4L5S A;  4FXD A;  3VR6 A;  3D4D A;  1HNX Q;  1XMQ L;  3K7U C;  1TS5 A;  3MXP A;  3U4V A;  5C0X J;  1WTV A;  3EN2 A;  4RCN A;  1Y8O B;  4A3E G;  3KDF A;  1A0I A;  2G5D A;  2EE1 A;  4DUZ Q;  1U4P A;  1XPO A;  3W2D A;  3HKZ G;  1JQY D;  3J80 L;  2L55 A;  1LT6 D;  3BG3 A;  1B8A A;  3E9I A;  5FO9 B;  1HRJ A;  4Y52 H;  1O7Y A;  2C9O A;  1PH6 A;  3NEL A;  2YTX A;  3CRL C;  4FXK C;  2IX0 A;  2AWN A;  3BDC A;  4XYO A;  3PIO A;  2KA7 A;  2R7D A;  1QNU A;  2L15 A;  4JI5 L;  1WCM G;  1U4R A;  1JE4 A;  2IHE A;  4DA2 A;  1YJN A;  3GTG H;  1EYD A;  4A76 A;  3K81 C;  1UE1 A;  1HZ9 A;  3FVQ A;  1A63 A;  4ZLT F;  1GUN A;  3KF8 B;  1CM9 A;  3L0O A;  1DXM A;  1RCV D;  2K05 A;  2M2L A;  4A3M H;  1I4X A;  2B39 A;  1ASY A;  1A2U A;  2ASB A;  1SE3 A;  3K8A A;  2DGY A;  3U9S A;  2EOT A;  3HKZ B;  3ND8 A;  4K5V A;  3U50 C;  2X69 A;  4PMW A;  4J6H A;  1Y14 B;  4MTN A;  3GQB A;  1PH7 A;  4M1U B;  2NVX H;  4OEL B;  2Q2I A;  5EAY A;  5D3I B;  1LTA D;  1U5K A;  4JI5 Q;  2GVB A;  2EYO A;  2RHQ B;  4HED A;  1K8M A;  2EVB A;  1XPR A;  2NZH A;  1X3E A;  2KCT A;  2NN6 I;  5ELB A;  2CWA A;  3PQI A;  1VCI A;  1E3P A;  4JBW A;  4R4T A;  4QB4 A;  1K9M C;  2B2U C;  1WD0 A;  4JBM A;  4FYD A;  5LHY 1;  1VQH A;  4DU9 A;  1G2T A;  2YTV A;  2JYO A;  3TN2 A;  2O5I C;  4MZ9 A;  1NNX A;  1RF2 D;  2A5H A;  5IP7 H;  3KOJ A;  4KK7 A;  1J5E L;  4FO2 A;  4UP7 A;  3I7F A;  3UDG A;  2NYZ D;  4IPG A;  4YCU A;  2NVQ H;  3U9O A;  2SEB D;  5FK9 C;  3TRE A;  4POG A;  5E4X A;  2EYP A;  1QZH A;  5JEA J;  3HOU G;  2IJ0 A;  3GP7 A;  1O78 A;  4X64 L;  5CV5 A;  1ZKO A;  2XN9 C;  1R4Q B;  1Q46 A;  3CME A;  5A2Q E;  2F0L A;  2JE6 I;  2L0C A;  1V1P A;  1K83 B;  5AFW A;  4DR7 L;  1JOR A;  1GOZ A;  1WOC A;  1J5E Q;  5E4W C;  2QIL A;  2O5J C;  3FPU B;  1TWC H;  2JA7 B;  1LAC A;  2IWH A;  2ZJR A;  1LTG D;  4A3D G;  2RCN A;  1X9N A;  1BNZ A;  4X64 Q;  2E2I B;  4MIU A;  1ESF A;  3ND9 A;  3A8J E;  1K0R A;  4TSS A;  3T16 A;  3BVZ A;  4HR7 B;  1NMF A;  4RMF A;  1HR0 W;  4KI0 A;  4JI0 L;  2NTT A;  2R92 G;  1HFG A;  3PO2 G;  2OT2 A;  4QCL A;  4ILW A;  5C44 G;  1Z9F A;  4FXG C;  4DR7 Q;  3IKJ A;  1SNO A;  3KYH C;  5C0X G;  3PUW A;  1CA6 A;  2VUM G;  3MXG A;  4X3S A;  2A19 A;  5EKK A;  2YTY A;  1LTR D;  1OXX K;  2RDF A;  4H02 A;  5ISR A;  5K36 H;  1PFS A;  4GOP C;  2B63 G;  1ROD A;  1M4V A;  4A4I A;  4JG2 A;  5C4J B;  2PCF B;  2WKD A;  4A75 A;  1CUK A;  1V9P A;  4UAI A;  1LO5 D;  4LWC A;  2A6E D;  1STN A;  4GKJ L;  3N52 A;  1VDZ A;  1STE A;  3MA2 B;  2HDM A;  2MGS A;  2K33 A;  2HDL A;  4B08 A;  3I4N G;  1RHP A;  2B3G A;  4A93 B;  4BBS B;  5FLX c;  2VQF L;  1LV9 A;  3GD7 A;  2F0H A;  3HRZ C;  2GVA A;  4HMI A;  2VNU D;  1NY4 A;  1SJH D;  3NHH A;  4XXE A;  4LNQ A;  3IRB A;  1T5X D;  4QMG A;  1SSO A;  1EZ8 A;  1S72 A;  1C9O A;  1EU3 A;  5JOB A;  3H3V H;  4QUF A;  3I2Z A;  1GHJ A;  3CW2 C;  2A6E C;  3DEP A;  3KFU A;  5IWA L;  3F2B A;  1F2Z A;  4C3H G;  3GTJ B;  3GTM H;  5ELO A;  4GKJ Q;  4OIK A;  2MFI A;  3SK8 A;  4CJ1 B;  5C6A A;  5NUC A;  3S2D B;  1V1Q A;  1PDQ A;  2BDN A;  1WCM H;  1NE3 A;  1TY0 A;  4H7B A;  3HOX G;  4B3M Q;  1GUW A;  4NP5 A;  1SE8 A;  1JMC A;  3J81 E;  3NPP A;  4CGY B;  2VQF Q;  2F0K A;  1UE7 A;  1N9W A;  1Y1W B;  4KJO A;  2EY5 A;  3IL8 A;  2F0T A;  3HOY G;  3J7A V;  5LMN L;  2SNM A;  4P74 A;  3DWQ A;  4N9P A;  1SEB D;  5DNF A;  3S1R B;  4X6A H;  2RCF A;  4A3J G;  1UAP A;  1EWC A;  2EJM A;  3J81 i;  1SBB B;  5IYC H;  5EQ0 A;  3ITP A;  3VYU A;  1WD1 A;  4IUP A;  5GRO A;  5IWA Q;  1STY A;  1ENA A;  2F0E A;  2O4X A;  2RSN A;  3MXN B;  3P20 A;  2JA9 A;  2KEE A;  1C48 A;  4KMU C;  1U0L A;  3T56 B;  1O80 A;  1R4P B;  2JP1 A;  1K0S A;  3ERO A;  4DAM A;  2VB2 X;  4KKT A;  3FRP B;  1PYS B;  3AFQ A;  3CP0 A;  1BBX C;  4U67 3;  4XIG S;  3FHW A;  3P7J A;  1VQ7 A;  2F0S A;  5E1F A;  1S5E D;  4N8X 1;  3KBG A;  2I07 B;  2VZA A;  4HMJ A;  1K83 H;  1JJG A;  4X3T A;  1E2V A;  2MJ8 A;  1N33 Q;  3EVQ A;  2NVY B;  1TVX A;  2A6H D;  2JA7 H;  4TQU S;  2HCC A;  3PUV A;  1XNR Q;  4GN4 B;  2PMZ B;  4DV5 L;  4I65 A;  2RBM A;  4F8M A;  1V43 A;  4KD4 A;  3HOU H;  1Q1B A;  1GO3 E;  1ILQ A;  2X6G A;  1XTC D;  1EEF D;  2JA6 B;  1E0B A;  1LM0 A;  2RQX A;  3GTK H;  4KY5 A;  3B6Y A;  1WTQ A;  2RHS B;  3BDO A;  3Q6S A;  2RDG A;  1G6Z A;  1IBK L;  3CPW A;  2PMZ E;  2A6H C;  4XQN A;  4Z9C B;  1KDB A;  1YHA A;  5IYD G;  1FJG L;  2CCZ A;  1GKH A;  1D5Z C;  1KD1 C;  1HHV A;  3EA6 A;  1PTO D;  3CPF A;  1FVI A;  3RN5 A;  2OXP A;  4ZUI A;  4DV5 Q;  4A3D H;  4DGZ A;  1XYI A;  1JB3 A;  5C4J H;  1KNA A;  5DEH A;  3J81 L;  4GN5 A;  4PV1 C;  3WWV A;  4YWM A;  4X66 Q;  3JAM E;  2AQ3 B;  2Z1C A;  1SJE D;  5DAU A;  5CV4 A;  4IUT A;  2OF1 A;  4DNI A;  5TSS A;  4C3I B;  1KAA A;  1IBK Q;  1IKM A;  4PQX A;  4A93 H;  3PO2 H;  4BBS H;  1PTO C;  1L1O B;  5CMD A;  4A3L H;  1LLR D;  1FJG Q;  3DUZ A;  5C0X H;  2MHV A;  2UUB L;  2DN8 A;  2EYJ A;  2VUM H;  1KLU D;  2QCP X;  1YBY A;  4OGQ C;  1G6P A;  1YEZ A;  1UNS A;  2B63 H;  4A3G G;  1GHK A;  2KJX A;  3E0J A;  1NR2 A;  1AFP A;  1LTL A;  2F0I A;  3A7L A;  2ID0 A;  4A3F G;  1KL9 A;  4IPH A;  4EVO A;  4MHE A;  1MI2 A;  3GTJ H;  4A3K B;  2XVS A;  2ATW A;  1K8O A;  3K7A H;  3RNU A;  1VQI A;  2N49 A;  2K52 A;  4JCV E;  2XTI A;  5CV6 A;  1PFM A;  4ZYS A;  2ZJQ A;  3I4N H;  3M4Q A;  5M5Y B;  4MNO A;  1HQR D;  5M3F B;  4OIJ A;  1H9K A;  1VMC A;  1KDC A;  1Y1W H;  3M3Y H;  2G9D A;  2UUB Q;  2R93 B;  1E1O A;  1H9R A;  3PIP 3;  1VQE A;  4KJN A;  3OTO Q;  1SMY D;  1YNJ D;  4QGU A;  1CKO A;  1LT5 D;  4K2K A;  2IW3 A;  3UI2 A;  4DUY L;  1RD9 D;  1D8L A;  1LAB A;  4PZ8 A;  3SXH A;  1K8G A;  2WP8 J;  1LTT D;  2K04 A;  4UP9 A;  3UDX A;  4C3H H;  1S5D D;  4CDC C;  2E2J H;  5EBD A;  4DAV A;  4HJA A;  3BZD B;  3SEB A;  5FJ8 G;  1MJC A;  4QF4 A;  3J81 j;  1MGS A;  3HOX H;  1YNJ C;  4RGO S;  1SMX A;  2PZU A;  2F3V A;  1H95 A;  1I3Q H;  1RKN A;  3HOY H;  2C35 B;  1G91 A;  3NK9 A;  3CU7 A;  1Q81 C;  4DUY Q;  4A3J H;  5EBC A;  1VQ8 A;  4JW0 A;  2IL8 A;  3RUZ A;  3TZD A;  3O13 A;  4LF5 L;  3V05 A;  1BCP B;  1DCZ A;  4DN4 M;  3EQL C;  2GN5 A;  2G9H D;  2XGT A;  4C2M B;  1I6V C;  1SXT A;  3J81 c;  5JEA H;  3L3O C;  2F03 A;  2MNA A;  4IFD J;  2A8V A;  2L4N A;  4GNX B;  1VQG A;  2JA6 H;  3NTI A;  1JOQ A;  5JJZ A;  2RKS A;  1HQM C;  3I4M B;  1JT8 A;  1F9S A;  3K80 C;  4DF7 A;  3J7A 5;  1I5F A;  4ABN A;  3HOW G;  1E22 A;  2Q8R E;  5I6Y A;  3RLF A;  1SLJ A;  3W3A A;  5I2X A;  1KTK A;  3LNN A;  3S2H B;  2EJF C;  4LF5 Q;  3CRK C;  1C4Q A;  3AQQ A;  3A5U A;  1STA A;  3VDY A;  3OIQ A;  2CW0 D;  5FO8 B;  4LUV A;  4UDU C;  5CV8 A;  1GXD C;  2UXB L;  1EOT A;  4UPA A;  2NVT H;  5F2D A;  3HGB A;  1RJT A;  3ERS X;  4BWG B;  2D9U A;  5M5W B;  1W6K A;  2M9V A;  4C3J B;  1PRT B;  2A74 C;  1PYW D;  3QIA A;  3LWU A;  4LF7 Q;  3F2C A;  4C3I H;  1G2S A;  2KEC A;  3MEF A;  1WJJ A;  3T1Y L;  1X32 A;  5KYL A;  2CW0 C;  3H6M A;  3CCL A;  4JC0 A;  1HTL D;  2PI2 E;  4AYB G;  5IYD H;  2KEN A;  1TWG H;  1H9S B;  4EQO A;  3A54 A;  1QOH A;  5KIX A;  1DOK A;  4R4C A;  5GAG C;  1JOO A;  3A5Z B;  2UXB Q;  2ZM6 L;  4IQZ A;  3GTP B;  4RWS C;  2A73 B;  4A3K H;  3PIO 3;  4TRD A;  2JQO A;  1GUS A;  4K8I A;  4KLK A;  4CKE A;  4XT1 B;  1EYA A;  1ET9 A;  1SNM A;  4OL7 A;  3NQT A;  4NDX A;  5C4X G;  4K5W A;  1EY4 A;  2Z6K C;  1QB5 D;  1X65 A;  1KLG D;  3T1Y Q;  2OQ0 A;  5M3F H;  4XT3 B;  2R93 H;  3STB D;  3G6J B;  5M5X H;  3TP8 A;  2R6G A;  1KRS A;  1NMG A;  4APV A;  3VA7 A;  4JYA L;  2ZM6 Q;  3NBI A;  1FD7 D;  1HUM A;  4RAU C;  3H09 A;  1MHW C;  4V0B A;  2Q2U A;  5BN5 A;  3JAM c;  1DZ1 A;  1ML0 D;  1VF7 A;  4BA2 I;  2B2T C;  3MEH A;  1B3Q A;  5T1G A;  1TR5 A;  1XNQ L;  3R3O A;  3MXN A;  4G7H C;  3LWE A;  4K0K Q;  2XNA C;  3S17 B;  5COY A;  3I56 A;  5C3W A;  3F8T A;  2H4O A;  4DK3 C;  3STB C;  1VQO A;  5C3X A;  3L2P A;  1I4H A;  3OYY A;  1MSG A;  1AE3 A;  3OW7 A;  3DLL A;  4DV2 Q;  1Y8N B;  4JYA Q;  5CC4 A;  4DV1 L;  3ICE A;  3MWY W;  1GVP A;  5KYI A;  2IPK D;  2EJG C;  1L0Y B;  1LTB D;  2NZ1 D;  4HIM A;  5COR A;  2VQE L;  1WTO A;  4BXX H;  1UEA B;  2K1B A;  2PW5 A;  3R93 A;  4IUU A;  1HNW L;  3S1Q H;  3H3V C;  3GTO B;  4C2M H;  1GM5 A;  3MFY A;  1PH2 A;  3S1M B;  5FJ8 H;  2B29 A;  4B3R L;  1HXY D;  4IFD G;  4BY1 B;  3TME A;  1QJO A;  5C4Z A;  3I70 A;  1XX8 A;  4BA1 I;  1D1I A;  1XMQ Q;  3I4M H;  5I6W A;  2AUK A;  4K2L A;  1QNK A;  1Z6H A;  4IOA A;  4DV1 Q;  3K0X A;  2BH2 A;  1GJX A;  1U4M A;  5IGC A;  4XQJ A;  3K59 A;  4KKU A;  3AB9 A;  5DM7 3; 
#chains in the Genus database with same CATH homology
 3FPP A;  3D31 A;  4ODG A;  4KHV A;  2BDO A;  4I7Z C;  1JCK B;  2I46 A;  4FF4 A;  4DK1 A;  1EZ6 A;  5DM6 3;  3GO5 A;  2EYF A;  4HCE A;  4B9X A;  1E2Z A;  1H9J A;  4CKC A;  2F0Q A;  5G3L D;  3FDT A;  2TSS A;  3KLR A;  3S14 B;  1I6H B;  2YU9 B;  2JA5 B;  1PMR A;  1PTO F;  2SNS A;  1L0X B;  3TBI B;  2MPM A;  4L8J A;  3M7N A;  1A3U A;  3S9W A;  1SND A;  4IZ8 A;  5LL6 S;  1Z7T A;  1DJR D;  3NUC A;  3VYR A;  1EU4 A;  4DXF A;  3HP3 A;  1SYE A;  2NUC A;  4GZY C;  1BDO A;  2F1M A;  2XRQ D;  3R2T A;  1AP0 A;  3PV0 A;  4IUQ A;  3J7A F;  1HPC A;  4X3K A;  4LMQ D;  5I2Y A;  1AZP A;  1S5C D;  3K58 A;  2E2D C;  1VF5 C;  2R61 A;  4G57 A;  2VXW A;  1F9R A;  1WTW A;  1TT2 A;  1SYF A;  2NN6 H;  2ZXO A;  4HSV A;  2FJ2 A;  1I4G A;  1EIG A;  3CQZ B;  3SVM A;  1CHP D;  2EZV A;  2H1E A;  2TMP A;  3VYS A;  4RKB A;  3PUX A;  2JEA I;  5BN4 A;  1A15 A;  1HA5 A;  1V1O A;  3WOF A;  5I9O A;  5A35 A;  4ULL A;  1Q3L A;  2IX3 A;  2D2C C;  1SAP A;  4HTH A;  3D6W A;  2D5D A;  3I91 A;  2L11 A;  1TWF B;  4A3B B;  2K6A A;  3K5M A;  3OWE B;  2Z4H A;  2HUG A;  2WAC A;  2JA8 B;  1B44 D;  1SNQ A;  4H13 C;  5D3D A;  5EGT A;  3VR5 A;  2EDG A;  4HCS A;  1TWH B;  1J8I A;  5IGE A;  4IFD H;  2E76 C;  3Q24 A;  2BA1 A;  3SDZ A;  5BN3 A;  3D3R A;  2FMM A;  3IFT A;  4J1M A;  1H9S A;  5C3E B;  3VR2 A;  3S1N B;  1Z47 A;  4IUR A;  2N88 A;  2QKI C;  3EJI A;  1X3Q A;  1X3P A;  3BS1 A;  3NWS A;  1G29 1;  2F3W A;  5JEA G;  3DHQ A;  3CKI B;  2PZT A;  4R8N A;  2ZXR A;  1RTN A;  4G7Z C;  2J0T D;  2KVM A;  3S16 B;  1GUT A;  4ZK9 B;  2E2H B;  2K32 A;  3FKI B;  1EWH A;  2HQE A;  1MD2 D;  1XXG A;  1BQQ T;  4DFA A;  4CJ2 C;  2XRS D;  3I73 A;  2FIN B;  5I4D A;  5C0X I;  1B1Z A;  4LJZ C;  3BVM A;  4C3I G;  3MZ5 A;  4C1N I;  3KBX A;  3HZX A;  4CHT B;  3H0G B;  5FOB B;  5J39 A;  4HAE A;  1GUG A;  5IGD A;  2QEJ C;  2D62 A;  4E6I A;  4FF2 A;  2ICI A;  4DNT B;  3GV6 A;  1Y8P B;  4RGM A;  3KLS A;  2F0F A;  3Q0A A;  4XYQ A;  1O7Z A;  2R3Z A;  2B2W A;  4JK1 C;  3KF8 A;  4F88 A;  3F2U A;  2L1B A;  5CGK A;  1DOM A;  1QIL A;  3RZO B;  3QJY A;  3PO3 B;  1B53 A;  1DM0 B;  3PUZ A;  4RHS A;  1F2M A;  3T13 A;  1IYV A;  1Y1V B;  5ELE A;  2KQ3 A;  2PO4 A;  3VA5 A;  2F0P A;  1TS3 A;  3P75 A;  1OXS C;  3Q23 A;  4KTA A;  1CI3 M;  1SYC A;  1B50 A;  1BCP D;  1RDP D;  2EYH A;  1B4O A;  4XTC S;  2F0D A;  4R8I A;  1O7L A;  5D14 A;  3I4L A;  3LX0 A;  1HUN A;  3DWA A;  1C8C A;  2K28 A;  2E75 C;  5J1Z A;  1AEX A;  1A2T A;  1QCB D;  1TWA B;  2XWB B;  5EJW A;  3C1E A;  1EY8 A;  1OXV A;  3A7A B;  1HFN A;  4RA8 A;  1BCP C;  3AMU A;  2XSC A;  1PFN A;  2FMC A;  5G3L F;  3TP6 A;  1HCZ A;  3MFG A;  4K8J A;  3DWP A;  3HEJ A;  4HSP A;  1CT1 D;  4A3I B;  2IX1 A;  1DOL A;  3L9A X;  1HTP A;  1TS4 A;  5KND A;  5HGT A;  2B2V A;  3TP5 A;  1STH A;  3VR3 A;  1ONL A;  1CZW A;  2YYZ A;  2QF7 A;  3S15 B;  5M3M B;  3X3M A;  1Q12 A;  4G4K A;  4C3J G;  4FF1 A;  2V4D A;  1IL8 A;  2AQ1 B;  5D65 A;  4WOR A;  1IKL A;  5CYU A;  2NWG A;  4DAP A;  2WB1 B;  3KLS X;  3I72 A;  1PZJ D;  2EXZ A;  3PUY A;  2B2Y A;  2Y0S B;  4FF3 A;  4WFN 3;  3SK6 A;  1II3 A;  3NTK A;  2EPB A;  1F77 A;  3OOC A;  3QG1 A;  1NR4 A;  3QOL A;  3GTG B;  4WRD A;  2R7Z B;  4P2C B;  4K14 A;  1D6E C;  4A3M B;  1I4P A;  3CHB D;  3DM1 A;  1I4Q A;  3SK4 A;  3V2T A;  3T4A C;  2MP1 A;  2F0U A;  2F0V A;  3VYT A;  1I4R A;  4MN3 A;  4RCO A;  2KOL A;  1SE2 A;  1BO0 A;  3NBH A;  1A3V A;  3ONA B;  3FEW X;  4S3S A;  2WAQ B;  5KEE A;  3HOV B;  1EQT A;  3D4W A;  2JEB I;  5JAV A;  2PQE A;  2NN6 G;  4RKL A;  4X3U A;  2O2L D;  2NVQ B;  1B9M A;  5IGG A;  2J7Z A;  1A6X A;  1SE4 A;  1EIH A;  2F0J A;  4F87 A;  4KY7 A;  4XQQ A;  4B9W A;  5KRU A;  4OO1 H;  5ELF A;  4KY6 A;  2PZW A;  4H44 C;  1QWY A;  1KDA A;  1R9T B;  3FMC A;  1DD2 A;  1TS2 A;  1NUC A;  5C5L A;  5FO7 B;  4M8A A;  3SR1 A;  3EFX D;  5KNB A;  1DYQ A;  2SDF A;  4PMC A;  1RTO A;  4PMB A;  4U68 A;  4CJ0 B;  1LTI D;  2B2W C;  3OWF A;  3ERQ A;  3NE5 B;  3HOZ B;  1GUO A;  4IUN A;  1JOK A;  2AQ2 B;  3NWT A;  2LS0 1;  5JVH 3;  3TDQ A;  3R8B A;  3D8G A;  4RH6 A;  2J4X A;  1F9P A;  1OXT A;  5JPM C;  2M00 A;  4KN7 C;  3GV3 A;  1FYC A;  1MBY A;  2CHB D;  5EKI A;  1ENF A;  1OXU A;  3BDL A;  1WTX A;  4J8Q A;  4FVM A;  3D6C A;  4QUC A;  4KD3 A;  1NCV A;  3C2P A;  1QG7 A;  4A3E B;  1ET6 A;  1EY5 A;  2K5D A;  3TZU A;  1FGB D;  3GTQ B;  2FFK B;  3GTM B;  1FR3 A;  1S5F D;  2BOS A;  2LMC B;  2CQA A;  3I3C A;  2DY7 A;  1U4L A;  3NSW A;  5CR3 A;  2N55 A;  1WCM B;  3SK5 A;  4HN7 A;  2B2V C;  2FHT A;  1IHZ A;  3OMG A;  5FLX L;  1ZEQ X;  1B3A A;  3OSO A;  3BYT B;  4FNF A;  3NXW A;  3C3L A;  3C46 A;  2JXM B;  2WV6 D;  5CV9 A;  5IT9 E;  4WJW A;  3C1F A;  2KED A;  3QB3 A;  2WII B;  1FNV A;  4FP5 D;  1TKW B;  5IIF A;  3DEO A;  4K6L A;  3SE0 A;  4F7X A;  2SOB A;  4PNY A;  2B2Y C;  3WDN A;  2DY8 A;  2VB3 X;  1SDF A;  3D4R A;  5IOD A;  4XDX A;  1Q90 A;  2F0O A;  5IGF A;  2DNE A;  3M7G A;  2EYM A;  1NAP A;  1BCP F;  5IOC A;  3P1H A;  3IAY A;  5C4H A;  3QWN A;  2LKV A;  1BOS A;  4NKL A;  3URY A;  4CBV A;  2JSO A;  3BYY B;  3AU7 A;  4RGN A;  3HOU B;  3QOJ A;  2ZXP A;  3J7Y W;  2KUM A;  1STG A;  4OHJ A;  1FNW A;  4IFD I;  2EY1 A;  2NBF A;  2ZT9 C;  3GTK B;  4KKS A;  1D2B A;  2L9H A;  2OEO A;  2QDB A;  2BCO A;  4IUV A;  3K5N A;  3H94 A;  2LFN A;  2ENB A;  4ZAI A;  3OMC A;  1WTP A;  4A3D B;  1PRT F;  2K5W A;  2A69 D;  2NTS A;  4Q0F A;  4O1N A;  1JWM D;  3L7Z C;  1SNP A;  4EQN A;  5IT9 L;  2B8G A;  3MTS A;  2R92 B;  3H91 A;  3N6R A;  2F0G A;  3PO2 B;  1F9Q A;  1DON A;  5C44 B;  1WVL A;  5JVG 3;  2VUM B;  2F0N A;  2A69 C;  2XIW A;  4RGT A;  2B63 B;  1TY2 A;  1AW7 A;  4DAY A;  1CQV A;  3NP8 A;  1BF4 A;  3A55 A;  2PYK A;  5A2Q L;  3X3N A;  1FNU A;  5KNC A;  3E6Z X;  3PMF A;  3NTH A;  1SNC A;  3K7A B;  3T53 B;  1JC7 A;  5ELD A;  4ZUJ A;  1T5E A;  2Q8T A;  3TSS A;  1EY7 A;  3I4N B;  1U9R A;  3IFD A;  5FKA C;  5HUR A;  3M3Y B;  4QIW B;  3DMU A;  4K5X A;  1TQO A;  4Y7N B;  3A8I E;  3ZYY X;  5K5P A;  2F4I A;  3E5S A;  2E74 C;  2L12 A;  4RHR A;  5I9P A;  1EY0 A;  2Q8I B;  5CBE E;  4C3H B;  2E2J B;  3RD4 A;  1KNE A;  1S4Z A;  1CTM A;  2EY2 A;  3HOX B;  3M4O B;  3DXJ C;  3HG9 A;  3OHX C;  1H9M A;  1I3Q B;  4C56 C;  3G7L A;  3HOY B;  1LT3 D;  2Z8L A;  3KUP A;  4A3J B;  2LY7 A;  3M4Y A;  1BR9 A;  2IT1 A;  1A3T A;  4H0L C;  4DK0 A;  4ZKC B;  1F2Y A;  2Z4I A;  3K0Y A;  4ZQ3 A;  3HS0 C;  4Q5V A;  1AZQ A;  3A56 A;  1NSN S;  4EQP A;  1VMP A;  1ILP A;  2BE5 D;  4BBR B;  3K6O A;  1ZYR D;  1OO9 B;  5EPL A;  5CBA E;  4RFB A;  1JWU D;  4LAA A;  1SYD A;  2RA4 A;  4ME5 A;  2B2T A;  4N9T A;  4LK1 C;  4DNR B;  5C5M A;  3SHL A;  3V96 A;  2KCC A;  2BE5 C;  2NVT B;  2CVR A;  4IN3 A;  1ZYR C;  1G8Z D;  4G7O C;  3R2I A;  4TKO B;  2KCN A;  3KK7 A;  4EGV A;  3VR4 A;  1J9O A;  3RMH A;  4C1N K;  4OO1 G;  1EL0 A;  2K01 A;  1SYB A;  1UUP A;  1V8Q A;  1TWG B;  4L63 B;  5JPN C;  3MC0 B;  4L6T B;  1ICW A;  4YIJ A;  1BUV T;  2C5C A;  3A8K E;  1D5M C;  1Q1E A;  1TU2 B;  1XWE A;  5ELC A;  2EYL A;  1S5B D;  2F0M A;  2A68 D;  1I50 B;  1PTO B;  2K03 A;  2X6L A;  2RDH A;  4BS9 A;  4BY7 B;  5M5X B;  2L5T A;  1V1P B;  4ZRZ A;  4K6D A;  3I90 A;  2AWO A;  4A3G B;  3MAQ A;  1CQF A;  3MHB A;  1ENC A;  1EYC A;  4A3F B;  1SFO B;  1PRT D;  3MVV A;  5T1I A;  3K57 A;  2A68 C;  1D5X C;  1Q8I A;  1SMY C;  1JR0 D;  1Y69 U;  2B2U A;  3GTL B;  1IW7 D;  1B2T A;  4O42 A;  4IAL A;  4R9W A;  1IYU A;  1STB A;  1PFB A;  1PRT C;  4KHZ A;  3JAM L;  3M85 A;  3MXU A;  1CHQ D;  3S1Q B;  1M8A A;  2F0W A;  2DNC A;  4CKB A;  1IW7 C;  2WIN B;  1AN8 A;  2AUJ D;  5CV7 A;  2EY6 A;  2GA4 B;  2XWJ B;  5IGB A;  3NQI A;  1WTR A;  3T51 B;  2RSO A;  1CZG A;  2WKC A;  1PXU A;  1QE6 A;  4DXG A;  5E3F A;  4KV6 A;  4NMZ A;  2ICE C;  1PZK D;  2NVX B;  3OPO A;  4OO1 I;  1F2L A;  3QO2 A;  2PW7 A;  1PLF A;  3Q22 A;  3J80 E;  2KHS A;  2PPB C;  1ZXT A;  1JWS D;  4ID6 A;  5J22 A;  1E2W A;  3HOW B;  2MUY A;  1PZI D;  5EKL A;  1CA5 A;  3BVG A;  2B8F A;  1SYG A;  1KAB A;  1D1K A;  1CK1 A;  3TP7 A;  3WOE A;  1YNN D;  1B9N A;  1TII D;  3K5L A;  4ZKB B;  1W6J A;  5LL6 X;  2RVL A;  1PTO H;  1HA6 A;  2HCI A;  1EY6 A;  2K7V A;  2NB0 A;  2BA0 A;  4AYB B;  4V19 0;  1ESR A;  1BXT A;  5M9O A;  4NW2 A;  1YNN C;  5EPJ A;  5K36 G;  5FLX E;  1TWC B;  2PNR C;  1JIC A;  1EFI D;  5KGU A;  3RZD B;  5EPK A;  1EQV A;  1LT4 D;  1LTS D;  4KN4 C;  3I8Z A;  5C4X B;  1MSH A;  1EEI D;  3OIP A;  1CFM A;  1EY9 A;  2K5Q A;  3K5O A;  4FXD A;  3VR6 A;  3D4D A;  1TS5 A;  3MXP A;  1WTV A;  5C0X J;  4RCN A;  1Y8O B;  2EE1 A;  1U4P A;  3W2D A;  1JQY D;  3J80 L;  2L55 A;  1LT6 D;  3BG3 A;  5FO9 B;  1HRJ A;  1O7Y A;  2C9O A;  3CRL C;  4FXK C;  2IX0 A;  2AWN A;  3BDC A;  4XYO A;  2KA7 A;  1QNU A;  1U4R A;  1JE4 A;  4DA2 A;  1EYD A;  3FVQ A;  4ZLT F;  1GUN A;  1CM9 A;  1DXM A;  1RCV D;  2K05 A;  2M2L A;  1I4X A;  2B39 A;  1A2U A;  1SE3 A;  3U9S A;  2EOT A;  3HKZ B;  3ND8 A;  4K5V A;  2X69 A;  4PMW A;  4J6H A;  3GQB A;  4M1U B;  5D3I B;  1LTA D;  2EYO A;  4HED A;  1K8M A;  2EVB A;  2NN6 I;  5ELB A;  1VCI A;  4JBW A;  4QB4 A;  2B2U C;  1WD0 A;  4FYD A;  5LHY 1;  1G2T A;  4DU9 A;  2JYO A;  3TN2 A;  2O5I C;  1RF2 D;  2A5H A;  4KK7 A;  4FO2 A;  2NYZ D;  3U9O A;  2SEB D;  5FK9 C;  5E4X A;  2EYP A;  5JEA J;  2IJ0 A;  3GP7 A;  1O78 A;  5CV5 A;  1ZKO A;  2XN9 C;  1R4Q B;  5A2Q E;  2F0L A;  2JE6 I;  2L0C A;  1V1P A;  1K83 B;  5AFW A;  1JOR A;  1GOZ A;  5E4W C;  2QIL A;  2O5J C;  3FPU B;  2JA7 B;  1LAC A;  2IWH A;  1LTG D;  1BNZ A;  2E2I B;  4MIU A;  1ESF A;  3ND9 A;  3A8J E;  4TSS A;  3T16 A;  3BVZ A;  4HR7 B;  4KI0 A;  2NTT A;  1HFG A;  2OT2 A;  4QCL A;  4ILW A;  4FXG C;  3IKJ A;  1SNO A;  5C0X G;  3PUW A;  1CA6 A;  3MXG A;  4X3S A;  5EKK A;  1LTR D;  1OXX K;  2RDF A;  5K36 H;  5ISR A;  1ROD A;  1M4V A;  5C4J B;  2PCF B;  2WKD A;  4UAI A;  1LO5 D;  2A6E D;  1STN A;  3N52 A;  1VDZ A;  1STE A;  3MA2 B;  2HDM A;  2MGS A;  2K33 A;  2HDL A;  4B08 A;  1RHP A;  4A93 B;  4BBS B;  1LV9 A;  3GD7 A;  2F0H A;  3HRZ C;  4HMI A;  2VNU D;  1SJH D;  3NHH A;  4XXE A;  1T5X D;  4QMG A;  1SSO A;  1EZ8 A;  1EU3 A;  5JOB A;  4QUF A;  1GHJ A;  2A6E C;  3DEP A;  1F2Z A;  4C3H G;  3GTJ B;  4OIK A;  4CJ1 B;  3SK8 A;  5C6A A;  5NUC A;  3S2D B;  1PDQ A;  2BDN A;  1GUW A;  1TY0 A;  4H7B A;  4NP5 A;  3J81 E;  3NPP A;  4CGY B;  2F0K A;  1Y1W B;  4KJO A;  2EY5 A;  3IL8 A;  2F0T A;  3J7A V;  2SNM A;  3DWQ A;  4N9P A;  1SEB D;  5DNF A;  3S1R B;  1UAP A;  1EWC A;  2EJM A;  1SBB B;  5EQ0 A;  3ITP A;  3VYU A;  1WD1 A;  4IUP A;  1STY A;  1ENA A;  2F0E A;  2O4X A;  2RSN A;  3P20 A;  2KEE A;  1C48 A;  4KMU C;  3T56 B;  1O80 A;  1R4P B;  2JP1 A;  3ERO A;  2VB2 X;  4KKT A;  3FRP B;  1BBX C;  4U67 3;  4XIG S;  3P7J A;  2F0S A;  5E1F A;  1S5E D;  3KBG A;  2I07 B;  4HMJ A;  4X3T A;  1E2V A;  2MJ8 A;  3EVQ A;  2NVY B;  1TVX A;  2A6H D;  4TQU S;  2HCC A;  3PUV A;  2PMZ B;  4I65 A;  2RBM A;  4F8M A;  1V43 A;  4KD4 A;  1Q1B A;  1ILQ A;  2X6G A;  1XTC D;  1EEF D;  2JA6 B;  1E0B A;  2RQX A;  4KY5 A;  1WTQ A;  3BDO A;  3Q6S A;  2RDG A;  1G6Z A;  2A6H C;  4XQN A;  4Z9C B;  1KDB A;  1D5Z C;  1HHV A;  3EA6 A;  1PTO D;  2OXP A;  4ZUI A;  4DGZ A;  1XYI A;  1JB3 A;  1KNA A;  5DEH A;  3J81 L;  4PV1 C;  3JAM E;  2AQ3 B;  2Z1C A;  1SJE D;  5DAU A;  5CV4 A;  4IUT A;  2OF1 A;  5TSS A;  4C3I B;  1KAA A;  1IKM A;  4PQX A;  1PTO C;  5CMD A;  1LLR D;  3DUZ A;  5C0X H;  2MHV A;  2DN8 A;  2EYJ A;  1KLU D;  2QCP X;  4OGQ C;  1UNS A;  1GHK A;  2KJX A;  3E0J A;  1NR2 A;  1AFP A;  2F0I A;  3A7L A;  2ID0 A;  4EVO A;  4MHE A;  1MI2 A;  4A3K B;  2XVS A;  1K8O A;  5CV6 A;  1PFM A;  4ZYS A;  5M5Y B;  1HQR D;  5M3F B;  4OIJ A;  1H9K A;  1VMC A;  1KDC A;  2G9D A;  2R93 B;  1H9R A;  3PIP 3;  4KJN A;  1SMY D;  1YNJ D;  1LT5 D;  4K2K A;  2IW3 A;  3UI2 A;  1RD9 D;  1LAB A;  3SXH A;  2WP8 J;  1LTT D;  2K04 A;  1S5D D;  5EBD A;  4DAV A;  3BZD B;  3SEB A;  4QF4 A;  1MGS A;  1YNJ C;  4RGO S;  2PZU A;  2F3V A;  1RKN A;  1G91 A;  3NK9 A;  3CU7 A;  5EBC A;  2IL8 A;  3RUZ A;  3TZD A;  3O13 A;  3V05 A;  1BCP B;  1DCZ A;  4DN4 M;  3EQL C;  2G9H D;  4C2M B;  1I6V C;  1SXT A;  5JEA H;  3L3O C;  2F03 A;  4IFD J;  2L4N A;  3NTI A;  1JOQ A;  5JJZ A;  2RKS A;  1HQM C;  3I4M B;  1F9S A;  4DF7 A;  4ABN A;  2Q8R E;  5I6Y A;  3RLF A;  3W3A A;  5I2X A;  1KTK A;  3LNN A;  3S2H B;  2EJF C;  3CRK C;  1C4Q A;  1STA A;  3OIQ A;  2CW0 D;  5FO8 B;  4UDU C;  5CV8 A;  1GXD C;  1EOT A;  5F2D A;  3HGB A;  1RJT A;  4BWG B;  2D9U A;  5M5W B;  1W6K A;  2M9V A;  4C3J B;  1PRT B;  2A74 C;  1PYW D;  3QIA A;  3LWU A;  1G2S A;  2KEC A;  1X32 A;  5KYL A;  2CW0 C;  3H6M A;  1HTL D;  1H9S B;  4EQO A;  3A54 A;  1QOH A;  5KIX A;  1DOK A;  1JOO A;  4IQZ A;  3GTP B;  4RWS C;  2A73 B;  3PIO 3;  4TRD A;  4CKE A;  1GUS A;  4K8I A;  4XT1 B;  1EYA A;  1ET9 A;  1SNM A;  4OL7 A;  3NQT A;  4NDX A;  4K5W A;  1EY4 A;  1QB5 D;  1KLG D;  4XT3 B;  3G6J B;  3TP8 A;  2R6G A;  3VA7 A;  3NBI A;  1FD7 D;  1HUM A;  4RAU C;  3H09 A;  4V0B A;  5BN5 A;  1DZ1 A;  1ML0 D;  1VF7 A;  4BA2 I;  2B2T C;  3MEH A;  5T1G A;  1TR5 A;  3R3O A;  3MXN A;  4G7H C;  3LWE A;  2XNA C;  3S17 B;  5COY A;  5C3W A;  2H4O A;  5C3X A;  1I4H A;  1MSG A;  3OW7 A;  1Y8N B;  5CC4 A;  3MWY W;  5KYI A;  2IPK D;  2EJG C;  1L0Y B;  1LTB D;  2NZ1 D;  5COR A;  1WTO A;  1UEA B;  2K1B A;  2PW5 A;  3R93 A;  4IUU A;  3H3V C;  3GTO B;  3MFY A;  3S1M B;  1HXY D;  4IFD G;  4BY1 B;  3TME A;  1QJO A;  5C4Z A;  3I70 A;  1XX8 A;  4BA1 I;  1D1I A;  5I6W A;  2AUK A;  4K2L A;  1QNK A;  1Z6H A;  1GJX A;  1U4M A;  5IGC A;  4XQJ A;  3K59 A;  4KKU A;  3AB9 A;  5DM7 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...