1TWCH

Rna polymerase ii complexed with gtp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1twcH00
1S72A 3KLWA 4AYBE 2NZHA 3I7FA 4R4OA 4GOPC 2IHEA 3PIOA 1IBKQ 2VL6A 3H3VI 4DV0L 4JI6Q 1KQSA 2E5LL 3HOWH 2QGQA 4A3BG 4PZ6A 3I4NH 3T1YL 2N49A 2K75A 3KDFA 2K4KA 2BA1A 4LW1A 4A3DH 2Q2HA 4OX9L 3M4OH 2JA7H 2NN6G 4A3LH 1SFOH 4IFDG 3GTPH 3U58A 3HOVH 1VQ6A 1YEZA 1VQCA 4DR3Q 3WWVA 1A8VA 4LFAQ 2UU9L 4YHHQ 2B63G 1E1TA 3FP9A 1IBMQ 5IT9c 1ASYA 1B7YB 1EWIA 1QVGA 4JBKA 1O7IA 1VQEA 1WJJA 5GQOA 4IPDA 5BR8Q 4DAYB 4LF4L 1YJNA 4QIWE 4GKKL 3K8AA 2N3SA 4DV6L 2RCNA 5HY6A 3U4VA 3HOUH 3PO3H 1OXXK 1VQLA 2ATWA 2NVQH 3ULJA 1PH6A 2R93G 4KI0A 1K73C 4K0KL 1H95A 2HHHQ 2ZTDA 2R92G 2ZTEA 1N33L 4DR2Q 1VQFA 1L1OB 4B3SL 4BBSH 4JI2L 4DR1L 1HJPA 1I50H 5IYBG 4DUYL 4A3IH 4HIOA 1X56A 4LUVA 3HFZB 2PQAA 2VY3A 2ES2A 1XTDA 4KHZA 3J80c 3I4MH 5LMUQ 4A76A 1Q1BA 4XIGS 2IY5B 1JJ2A 1EQRA 3MXNB 3M9BA 3ICEA 2Z6KC 1HNXQ 3ZJYC 2IX0A 2R7FA 4OONA 1P16A 3KF6A 1FVIA 2KCTA 3F2BA 1IL2A 4X6AH 2PNHA 2EIFA 5IP9H 2WAQG 2AWOA 5GAHC 1SN8A 5M5WH 1HZCA 4A3KG 2KBNA 1K8AC 3CCRA 1VQ5A 5C3EG 1VQ8A 1J6QA 2YU9H 1BBWA 1I94L 4YCWA 4C3IH 4OO1G 1FJGL 5K36G 2LXJA 1WCMG 1V43A 2WB1E 4PMWA 5IP7H 5FLMH 4YCVA 2F4VL 4B3ML 5IP7G 4C3HH 4LUOA 5GROA 1YITA 2UUBQ 4JI4L 4JI5L 3OYYA 2JA8H 4P73A 2Y0SG 4APVA 4DKAC 4GKJQ 2F52A 3J7A5 2KHIA 4LF8Q 2NZOA 3EN2A 4DV1Q 4BA1I 4A3MG 4BXXG 1XMOQ 4L5SA 2NN6I 4AQYL 2MQHA 5GAEC 3G48A 2K50A 2I5MX 4JI7L 1PH7A 4DR4Q 4YCUA 3TS0A 1PV4A 3HOYH 3RZDH 1J5EQ 4R4CA 3K7UC 3BZKA 3BZCA 1L1OC 2KCMA 3H15A 3CCVA 4GLXA 1YVCA 3I4MG 4LF5Q 1G6PA 1N8RC 4JI3L 3A5ZB 4DPGA 3I56A 1IBML 2E2IH 2JA5H 1AE3A 5IYBH 2RF4A 4A3IG 1JB7A 2VQFL 4HJ5A 3RLOA 4B3RL 2FXQA 5M3FH 3W1GA 4IJHA 4LF9Q 3S2DH 3GO5A 4DR6Q 2VW9A 1EOVA 1U5KA 4JBMA 1MIUA 4DR5L 3CD6A 2UUCQ 3PO2G 4X66Q 1VQDA 3RR5A 4ALPA 4GKKQ 3UE1A 3HOXG 4A3JH 3PO3G 1KL9A 3HOUG 4X64L 2E8GA 2XGTA 2UXCL 4KHPQ 1FL0A 1VQJA 4LNQA 1I6HH 2UXBL 2OQKA 2YTYA 3PCOB 5C4XG 1VS0A 3M4PA 1BBUA 1TWCH 2YV5A 1GD7A 3PUVA 3GTJH 3CCQA 4DR2L 1HR0W 4B3TQ 1XNQL 4GLAC 1KXLA 4HIKA 3ULPA 1XNRL 1DGSA 5ELOA 1X3FA 2CQOA 2WP8J 4JI1L 3KYHC 1Z9FA 4X62Q 1E24A 3PUXA 1N32Q 1WI5A 4GN4B 4IFDI 2ZJRA 4NXNL 4JBWA 2RHQB 4R1JA 1K9MC 4HJ8A 1SROA 2OWOA 1BKBA 5IWAL 1C0AA 2GVBA 2VQEL 1V1QA 2LSSA 5C0XG 1QUQB 1Z47A 3I4NG 1YHQA 2UU9Q 4DK3C 4LFAL 4LFBQ 2AWNA 1KHIA 3J81c 5M5XH 2CCZA 4L5RC 3HOWG 1NTGA 4WJ4A 1Y14B 2Q2IA 4JCVE 3IRBA 2D0PA 2DUDA 1FJGQ 1HR0Q 4JV5L 5BR8L 4HJ9A 1CUKA 4UP8A 3S24A 2Q2TA 2VNUD 4MNOA 4A93H 3CCJA 1Y1WG 2VUMH 4JYAQ 2ZM6Q 4DV6Q 1VQ4A 3JAMc 2UUBL 3MEFA 3A0JA 2HQLA 5M5YH 1L2FA 3BU2A 3SGIA 1N36L 3TS2A 3K80C 4WJ3M 3FKIH 1SE8A 3J81j 2Q2UA 2JEAI 2CKZB 3PUZA 1PVOA 3NBHB 4JI0L 1SRUA 4OWXB 3CC7A 4JI2Q 4H02A 4JG2A 5AJ3Q 2ZJQA 1D7QA 1GVPA 1X6OA 4TQUS 2F3IA 1JT8A 4GNXC 3G6EA 1GO3E 1XPUA 1EFWA 3H3VH 3W1BA 4BY1G 1J5EL 3S15H 4NB3A 1HNWL 2LXKA 1SMXA 1VQ7A 3ER0A 4JI8L 3CMEA 3PO2H 2MO0A 2OCEA 4P75A 3K81C 5IYDG 4YY3Q 5LMNL 4POGA 1CKNB 1NJIC 2VQFQ 4Y7NH 4B3RQ 5M3FG 1U0LA 3AYHB 4DR6L 1PFSA 3GTOH 3K7AH 2JA5G 2KENA 4DR5Q 3HOZG 3J7ZC 3I55A 2UUAQ 3DM3A 2IT1A 5IYCG 1CSQA 4LWCA 1GKHA 1IBKL 2EQSA 4GS3A 1X3EA 4A3EG 1QZGA 3K0XA 1VQIA 4DV0Q 1L1OA 3EBEA 4GLVB 1NY4A 1RIPA 1L0WA 5ELNA 1TWHH 3GD7A 3J80i 3KFUA 4A3MH 2PQAB 2WAQE 2AKWB 4DV3Q 1Q86C 1W3SA 4LF8L 4OX9Q 4A3FG 2I5LX 2JE6I 1AH9A 4JI1Q 1QZHA 3ERSX 2JJQA 2JA8G 3S1MH 1XMOL 1CKMA 2A8VA 1N32L 5JJLA 3KF6B 1UE5A 1YJ9A 3A74A 3NEMA 3STBC 3RLFA 5FLMG 4IOCA 3T1HL 4LF7Q 3S1QH 3HKSA 4Y52H 2JEBI 4QL5A 2JQOA 2Z0SA 1M1KC 3S1RH 1T9HA 3PIPA 4OWWB 1X9NA 4JI3Q 5C3EH 2MO1A 4DV2L 3GTMH 3HOYG 2D62A 4GNXA 1V9PA 4BBRH 3H0GH 3CPFA 4LF9L 5M3MH 1C9OA 2HIXA 4DK6C 5M3MG 3CCLA 2V1CC 1YHBA 4K0KQ 4X66L 3KDFB 4BBRG 1X54A 1UE6A 2JK8A 2ZM6L 2EXDA 3RLNA 2HT1A 3F2CA 2UXDQ 3F1ZA 1VCIA 2Z6KA 3E9HA 1X55A 4EQ5A 1UE7A 2K52A 1Y1VH 3JC66 2ZJPA 3T1YQ 5LMNW 1EUJA 2K14A 1NMGA 1XMQQ 1N9WA 3GTQH 1HZAA 3A5UA 3I4OA 1NE3A 4B3TL 4NXMQ 3PV0A 1XNQQ 5J3BA 2QEXA 3OTOL 5JJKA 3UDIA 2AHOB 5JEAJ 3S16H 1UE1A 1VQMA 3EIVA 3B6YA 1Q8KA 1LTLA 2N8NA 4DV5Q 5C0XI 3STBD 4MTNA 3DLLA 1TWAH 4DV4L 2OQ0A 3S17H 5IP9G 1N34L 2WB1G 2ALYB 3UDXA 3CCUA 2I0QA 2NVTH 2L15A 3NENA 4A3EH 4A75A 2BH8A 3M3YH 1CKNA 4JI6L 2E5LQ 2CWPA 3E0EA 4YWKA 4QGUA 4OXPA 2F4VQ 4YWLA 4RMFA 2I5HA 4HJ7A 1OTCA 2K5NA 5C44H 2BH2A 1HR0L 4JV5Q 5FJ8G 4C2MH 3U4ZA 5HGQA 2WFWA 4BBSG 4GKJL 1OXUA 5JEAG 5H1SE 4A3DG 2JA6G 3I2ZA 1LYLA 2GN5A 1N33Q 4A3CH 2MFIA 1SLJA 3TQYA 4X65L 1GM5A 4R4IA 1EIYB 5IYDH 2ID0A 1A62A 5EAYA 2GVAA 4BY1H 1K83H 2BA0A 5DLQE 1Q82C 1CSPA 1QVCA 1I94Q 1XPOA 3CCEA 5GAGC 2DGYA 2PI2E 4IPHA 4LUZA 4DV7L 4BY7H 1SR3A 4A3GG 1KAWA 4P72A 4GOPA 3PSIA 3E9IA 1OXSC 1VQ9A 4BXXH 3RN2A 1LM0A 4P74A 3BJUA 3CCSA 1R9TH 3M7NA 1YJWA 2CWAA 2B3GA 3HOVG 3KJOA 3TREA 4DV1L 3TEHB 1Y1WH 1G51A 4R4QA 1EYGA 3CC2A 2VUMG 4A93G 1X65A 1P8LA 3CMAA 4X64Q 3L7ZC 2YYZA 5C0XJ 4DAMA 1MJCA 2K5VA 1UEBA 4QJFA 4DUYQ 3CC4A 1QVFA 1VQKA 2R6GA 4A3BH 4ME3A 3PGZA 3GDEA 2UXDL 1G291 2OTLA 2VS1A 1HNXL 3PUWA 3Q8DA 3AFQA 4LF6L 1ASZA 2AMCB 1IBLL 3LGJA 4L5QA 3L2PA 4RG1A 4JBJA 4A3CG 1XMQL 1HH2P 1RL2A 3RNUA 2JA6H 2N78A 4OO1I 4UPAA 4LFCQ 4DR7L 1E7ZA 3UDGA 1NMFA 5FJ8H 1W2BA 2IX1A 4HJAA 5C44G 4AYBG 4MZ9A 4LFBL 3U50C 2VZAA 3G4SA 5C4XH 4DNIA 1EIFA 1NBWA 1M90C 2K5HA 1IXRA 1AE2A 4IPCA 1D8LA 4UY8C 2ASBA 2CFMA 1E3PA 3CXCA 4AH6A 1TWGH 2HIVA 4C3JH 4KLKA 4JC0A 4R4TA 1UWVA 3HOXH 4A3JG 1XNRQ 2R7ZH 4UP9A 4GNXB 3OW2A 2B29A 4HIDA 5IY0A 3F2DA 4AQYQ 4BA2I 2UXCQ 1JJCB 4YHHL 4PG3A 4YWMA 1EQQA 1N36Q 1IYJB 1PH3A 5IWAQ 2PMZE 1E22A 2VQEQ 3AFPA 1VQOA 4X65Q 1JMCA 3M85A 2NVXH 1FGUA 4PZ8A 1PH9A 4GN5A 3KJPA 4LF5L 4IFDJ 1Y1VG 1K8GA 4LF4Q 1Q7YC 3RN5A 1HNZQ 1I5FA 3F8TA 4OWTB 2Y0SE 4O2DA 4X62L 3J81i 1PH4A 1HZ9A 3NELA 1VQHA 2YTXA 4JOIA 3UE0A 1K3RA 2JA9A 1YIJA 2HHHL 5GADC 3D0FA 4DUZL 1VQNA 3S1NH 2MNAA 3CCMA 1JE5A 3GTLH 4QY7A 3CF5A 3H0GG 4B3SQ 1PYBA 1WFQA 4JOIC 2UXBQ 4DV4Q 3PF4A 3PF5A 4GN3B 2QA4A 1TXYA 1PYSB 3FHWA 1VQPA 2PI2A 1Q81C 1A0IA 2OTJA 1WCMH 3M4QA 1BVSA 3KF8B 4PZ7A 3HKZG 4DR3L 1YI2A 1PH1A 1A63A 4NXNQ 4A3KH 3CP0A 5FLXc 4DV3L 4A3FH 1KD1C 2R7ZG 4IOAA 2NVYH 3AQQA 1OXVA 4NPSA 1IBLQ 1Q12A 2IHFA 1LUZA 4L5TA 1PA6A 1N34Q 4O0AA 1YZ6A 3VDYA 2E2HH 2UUAL 1HNWQ 1B70B 1K0RA 4J15A 3G71A 1Q1EA 1WYDA 5IYCH 4DV7Q 3S14H 3HOZH 4JYAL 1KRTA 2KHJA 5JJIA 3W5OA 1YBYA 2R92H 2D0OA 3CQZH 1PH8A 3S2HH 1MKHA 1VQAA 3TRZA 1E1OA 3CAMA 3ULLA 4DR1Q 3D31A 2R93H 2ZTCA 4JI7Q 4IJLA 4POFA 4HIMA 2XTIA 1VQBA 2A1AA 4DR4L 2A19A 1JJGA 1XJVA 1HZBA 1WOCA 1PH2A 5LMUL 1MJEA 4JI0Q 1X3GA 3GTGH 4XTCS 2H5XA 5AJ3L 5IE8A 1C7YA 1QUQA 1PHJA 3UDFA 4P71A 1KIXA 4TVAB 1KRSA 4IO9A 1VQGA 4QQBX 3CW2C 2B63H 1OXTA 2R7DA 1TWFH 4JI8Q 1KC8C 3JAMi 1Q46A 3HKZE 3FKIG 4IPGA 1S40A 2E2JH 4LF6Q 4NXML 4YY3L 1B8AA 5LMNQ 2C35B 1YHAA 3CPWA 4UP7A 1PH5A 2UUCL 4A4IA 4EX5A 3OTOQ 4DV2Q 2JA7G 1HNZL 3RZOH 4A3LG 2RHSB 1YNXA 2YTVA 5C4JH 1S3OA 4GOPB 4AIMA 1IZ6A 4DV5L 4KHPL 4LFCL 1I3QH 3PUYA 3AEVA 1CKOA 3GTKH 4B3MQ 4DR7Q 4A3GH 4BY7G 5E7NA 3T1HQ 3L0OA 4LF7L 4DUZQ 1XPRA 4JI4Q 4JI5Q 3KOJA 4FDBA
chains in the Genus database with same CATH superfamily
1DJRD 1S72A 4AYBE 3MAQA 3PIOA 2VL6A 1BCPB 5F2DA 3GTLB 1S5CD 3C46A 1SXTA 3HOYB 4A3BG 1W6JA 1PFNA 4XQJA 2K75A 5EGTA 4A3DH 2Q2HA 3U58A 1LABA 1VQ6A 1YEZA 3WWVA 3C1FA 3FP9A 4CKBA 1IBMQ 3I8ZA 4GZYC 2AQ3B 3QIAA 1Y8PB 2FJ2A 5GQOA 1KAAA 1YJNA 4QIWE 3K8AA 4MIUA 5J22A 4DV6L 3HOUH 1VQLA 3MEHA 2NVQH 1PH6A 1H9KA 1K73C 1H95A 5ELBA 2QF7A 4DR2Q 3OWEB 1F9QA 4BBSH 1BF4A 1HJPA 1I50H 4DUYL 3ND9A 1BBXC 4HIOA 2DY8A 4KHZA 5I6YA 5LMUQ 4A76A 2A6HD 1JJ2A 1EQRA 3MXNB 3K5MA 1HTLD 3ZJYC 5I2YA 2QEJC 1FVIA 2KCTA 2EIFA 4U68A 2WAQG 5M5WH 1HZCA 2LFNA 2FHTA 2KBNA 1VQ5A 2B2YA 2JN4A 4RH6A 4YCWA 4C3IH 2LXJA 2OT2A 4N9PA 4PMWA 5IP7H 5FLMH 1U4PA 2KEEA 1E2WA 4B3ML 4X3KA 5K36H 4P73A 2ZXPA 4APVA 2KHIA 2NZOA 5M5XB 1HPCA 3EJIA 4BA1I 3D6WA 4A3MG 1XMOQ 3EVQA 2WINB 4A3DB 2K50A 2I5MX 3VR4A 4S3SA 2EYOA 3TS0A 1EU3A 2EOTA 4R4CA 3K7UC 3BZKA 2KCMA 3K0YA 3KF8A 4GLXA 2PYKA 2JA5H 3AB9A 1JB7A 4B3RL 1ILQA 3PIO3 4DR6Q 5HGTA 1S5FD 1B44D 3SVMA 1MIUA 4DR5L 2UUCQ 3DEPA 1O7YA 5D3IB 1K0SA 3UE1A 3PO3G 5E1FA 1F9RA 3T53B 1WD1A 2LY7A 1VDZA 2UXCL 1VQJA 4LNQA 3HOXB 2UXBL 3DWAA 3GTJH 1HR0W 2PPBC 3D4DA 2MGSA 2KOLA 1C8CA 4B3TQ 1BCPD 4CDEC 1DOMA 1DGSA 2CQOA 2WP8J 2Y0SB 4QB4A 1I6VC 2F0MA 4GN4B 4WFN3 4JBWA 2RHQB 4OHJA 1SROA 3K5NA 2LSSA 2F0TA 5C0XG 4A3IB 3AMUA 5CV5A 4LFAL 4K8JA 2AWNA 4LFBQ 2CCZA 2K5WA 1Y14B 2Q2IA 2WACA 2E2HB 1KNAA 1SNOA 2D0PA 1EWCA 1CM9A 1CUKA 3S24A 4FF4A 1QJOA 2VUMH 4DV6Q 3GV6A 3KUPA 1CA6A 2UUBL 3C3LA 3MEFA 1KTKA 3A0JA 2SNSA 3T16A 3TS2A 1L2FA 2RBMA 2PZTA 1PVOA 1SRUA 5D65A 2WKDA 5JPNC 5CBAE 1HXYD 1U4RA 3S16B 1GVPA 1XPUA 3H3VH 3S15H 4NB3A 1SMXA 3ER0A 4A3MB 1B1ZA 3KBXA 3CMEA 4P75A 5CC4A 3K81C 4OIKA 1NJIC 2K5QA 4BBSB 4G4KA 1JOOA 1U0LA 3AYHB 3HOZG 3WDNA 2IT1A 1CSQA 4OELB 4HTHA 1ILPA 5M9OA 1LTAD 3EBEA 5ELNA 3J80i 4A3KB 2WAQE 2FMMA 3VYTA 2KEDA 1JOQA 3VR2A 4OX9Q 2RDGA 4A3FG 2CHBD 2I5LX 2K03A 5CV8A 2F0DA 4JI1Q 1QZHA 1UEAB 3ERSX 1XMOL 5A2QL 4C3HG 3STBC 2KECA 3RLFA 3BDOA 4DU9A 3J81E 1VF7A 2EY5A 4JPBW 1NAPA 3FVQA 4OWWB 1X9NA 4C56C 2MO1A 3S1NB 2D62A 1QNUA 4BBRH 2KCCA 5M3MG 2MHVA 4K5VA 1I3QB 4J6HA 3GTKB 2ZM6L 1S4ZA 1J9OA 1MI2A 1KDAA 1HTPA 1PTOF 2C5CA 3F1ZA 1EY8A 3H91A 3JC66 1KDCA 1JICA 2AUKA 2BCOA 3T1YQ 5LMNW 2NBFA 1EUJA 1XMQQ 1NMGA 5C6AA 3A5UA 4B3TL 2B2YC 3S17B 4NDXA 1WTRA 5J3BA 4FF1A 5FO8B 5JEAJ 1IKMA 4I65A 1VQMA 4ZYSA 3S1MB 2A6ED 5C0XI 5I9PA 1TWAH 4DV4L 3H3VC 3S17H 4N8FA 5IP9G 1QCBD 4HN7A 4NP5A 1N34L 1SE3A 1ICWA 4IZ8A 2I0QA 3GP7A 2BH8A 3M3YH 5I9OA 4ZK9B 2E5LQ 2CWPA 3E0EA 5CGKA 1WTWA 1B3AA 4DK1A 2KQ3A 2I5HA 4RMFA 1AZPA 4RFBA 5FJ8G 4C2MH 3U4ZA 1XX8A 5IGDA 3MXNA 3LX0A 3OW7A 3NBIA 1LYLA 2GN5A 4A3CH 3MFGA 3GTMB 5EAYA 5C44B 4J1MA 1ZXTA 3I90A 3V96A 1XPOA 5GAGC 1SSOA 4LUZA 1ZYRD 4C1NK 5JVG3 1WCMB 3K58A 3WOFA 2N88A 3BVMA 3BJUA 4P74A 1R9TH 3ND8A 2B3GA 1LTSD 3TREA 1SYEA 3NTIA 3TDQA 3CC2A 1DXMA 1X65A 4BWGB 1B2TA 3L7ZC 4NKLA 4DAMA 5IIFA 5T1GA 3CC4A 3DUZA 1VQKA 4QUFA 3D8GA 3VYRA 2OTLA 4FNFA 1HNXL 5COYA 3DXJC 1IBLL 3K7AB 4RG1A 4A3CG 1HH2P 1D6EC 3OMGA 1E2VA 1NMFA 5FJ8H 5JJZA 3PQIA 1TR5A 4XXEA 1ZYRC 4LFBL 5E4XA 2VZAA 3G4SA 4B9XA 1NBWA 1M90C 4RCNA 1AE2A 4IPCA 2CFMA 1E3PA 3H09A 4AH6A 1TWGH 3HOUB 4JC0A 1XNRQ 3OW2A 1TQOA 4AQYQ 2UXCQ 1JJCB 4PG3A 3FRPB 1IYJB 1BOSA 2AQ2B 4RGOS 5ELCA 2ZXOA 3RN5A 1HNZQ 4EQNA 4X62L 3NTHA 2D9UA 4K8IA 1PH4A 2QW7A 3HS0C 3EQLC 2A69C 3K6OA 1ESRA 2YTXA 1YIJA 2HHHL 5GADC 2L9HA 1JE5A 3GTLH 2SNMA 4B3SQ 2EYFA 4DV4Q 3TMEA 1TWAB 2QA4A 1TXYA 1PYSB 2OTJA 1WCMH 3BG3A 1EZ8A 3KK7A 1IW7D 4PZ7A 3FKIB 3J7AF 1D5XC 1PH1A 1A63A 4Q5VA 4NXNQ 4A3FH 1K3BC 1Q12A 5EBDA 4A93B 1LUZA 4L5TA 2SEBD 1STEA 3HOVB 2EYPA 3SHLA 5I2XA 1EIHA 3G71A 1WYDA 3SK4A 3S14H 4U673 3HOZH 3CQZB 4B08A 4JYAL 1CZWA 2R92H 1A3VA 2D0OA 1PH8A 3S2HH 2IJ0A 1PTOH 3SE0A 3ULLA 1WTQA 4HIMA 3F2UA 1VQBA 2A19A 2L5TA 2EPBA 1WOCA 3HZXA 3GTGH 1GUOA 1QUQA 1PHJA 3UDFA 2AUJD 4P71A 4DAPA 1KIXA 5IGFA 3FPPA 3K5OA 4QQBX 3CW2C 2B63H 1OXTA 4JI8Q 1KC8C 3JAMi 3HKZE 1MSHA 4NXML 1RTNA 4YY3L 2F0NA 1PH5A 2JA7G 1GUSA 5M5WB 4DGZA 3S2DB 1I3QH 3AEVA 3GTKH 1CKOA 1O7ZA 4BY7G 4LF7L 1RD9D 1Q8IA 1N34Q 4JI5Q 3KOJA 4FYDA 1IKLA 3KLWA 3I7FA 1EQTA 4Y7NB 3H3VI 4JI6Q 1KQSA 2E5LL 2ZXRA 2QGQA 3PO2B 4QF4A 3T1YL 3KDFA 4KN7C 4AYBB 1F9PA 3DHQA 1DOKA 2NN6G 4A3LH 2NVQB 3GTPH 4XQNA 4XT1B 4DR3Q 1A8VA 4L8JA 1TWCB 1SYCA 2KHSA 3CRLC 2F0VA 1QVGA 1O7IA 2B63B 3QOLA 4IURA 4ZQ3A 1EU4A 4A3JB 1YNNC 4LF4L 3S9WA 2N3SA 3A7LA 3C1EA 3VR3A 3PO3H 1B4OA 3UI2A 2ATWA 4KI0A 3SXHA 2HHHQ 4ABNA 1JR0D 5J1ZA 1L0XB 1L1OB 4B3SL 3K57A 4DR1L 5I6WA 3R8BA 4KD3A 1X56A 1Z7TA 3HFZB 4RA8A 1XTDA 4KHVA 4ZCKA 4XIGS 1IHZA 3M9BA 3VA5A 4IUUA 3ZYYX 2EJGC 2ZT9C 1P16A 4X6AH 1AW7A 5IP9H 1SN8A 2I46A 3GTJB 1K8AC 2HCCA 2JA8B 5C3EG 1VQ8A 1BBWA 4L63B 4A3FB 1FJGL 5K36G 2WV6D 3NE5B 1DZ1A 5IP7G 4LUOA 3OMCA 1PZKD 2JA8H 3IAYA 4GKJQ 2F52A 2HUGA 2WB1B 1STBA 1SFOB 1JE4A 2O4XA 4AQYL 2SOBA 1PH7A 5CV7A 3QR8A 1SNPA 3BZCA 1YNND 5LL6S 3NSWA 1G6PA 4LF5Q 1JCKB 4JI3L 1N8RC 1IBML 1AE3A 2VQFL 1SJED 4HJ5A 5M3FH 2VW9A 1U5KA 4TKOB 4JBMA 3CD6A 4HR7B 4IUTA 3HOUG 2F03A 2E8GA 4KHPQ 1FL0A 1LV9A 1UNSA 4MHEA 2YTYA 3PCOB 5C4XG 3M4PA 4RGMA 2YV5A 1GD7A 4DR2L 1RJTA 3CCQA 1O80A 1XNQL 1XNRL 4X62Q 4DK0A 3PUXA 1N32Q 1WI5A 2L1BA 2XWBB 2ZJRA 3CU7A 3FPUB 4NXNL 4R1JA 1K9MC 5BN5A 2OWOA 1KLUD 1QUQB 1Z47A 4XT3B 4Q0FA 1YHQA 4DK3C 2EVBA 4IN3A 1GHKA 5M5XH 4WJ4A 4KK7A 3PIP3 4JCVE 1H9MA 3IRBA 2BOSA 4JV5L 5ELDA 4UP8A 2Q2TA 3CCJA 4JYAQ 1VQ4A 2F4IA 2HQLA 4J8QA 3BU2A 1N36L 3S1QB 2Q2UA 3PUZA 1DONA 3NBHB 2RSNA 2FINB 4OWXB 2IWHA 1D7QA 4TQUS 1LTID 2F3IA 1JT8A 4BY1G 1J5EL 4H13C 3KLSX 3GTQB 5BN3A 1LT3D 1STYA 2FMCA 3PO2H 5IYDG 2OCEA 2H1EA 4POGA 1OO9B 4Y7NH 2PW7A 2V4DA 5EPLA 4DR6L 3K7AH 1H9JA 3NQTA 3I55A 2Z6BA 1GKHA 1QG7A 2EQSA 1X3EA 4A3EG 1L0WA 5C3EB 1G6ZA 2QKIC 1STAA 1TWHH 1FR3A 1EOTA 1Y8NB 4DV3Q 1SNQA 5IGEA 2EYMA 5EBCA 2RDHA 1BUVT 1CKMA 1U4LA 1UE5A 3A74A 3NEMA 3SEBA 2K05A 4LF7Q 2M9VA 3NP8A 2JEBI 1CT1D 2EYJA 3MFYA 2CVRA 1M1KC 2WIIB 4JI3Q 2R92B 5JPMC 2D5DA 3J81L 3GTMH 3H0GH 2TMPA 3R3OA 1NR2A 2HIXA 2V1CC 1X54A 2HT1A 3MXUA 2UXDQ 3P20A 3H0GB 3RZOB 3E9HA 1X55A 4KJNA 4EQ5A 1FYCA 4JK1C 1PFBA 1BQQT 1D5ZC 2K14A 1EFID 2K04A 1N9WA 5KEEA 1XNQQ 1NE3A 1SYDA 4C3IG 5JJKA 2BE5C 1SYBA 1UE1A 1CQFA 1SE4A 3EIVA 4C3JB 1LTLA 2N8NA 4DV5Q 4O1NA 4JVZA 1DOLA 3DLLA 3I70A 4R9WA 1LTRD 3NHHA 3UDXA 3CCUA 1I4RA 3NENA 5JAVA 4A75A 1CKNA 4TRDA 1MGSA 3DWPA 1EY4A 4YWKA 3I72A 4OXPA 1B9MA 1K28A 1RF2D 1F2ZA 1OTCA 2BH2A 5HGQA 1A3UA 4BBSG 5JEAG 5H1SE 2JA6G 1SLJA 4RKBA 1A62A 2BA0A 1WD0A 5K5PA 1BXTA 1QVCA 1I94Q 1WTOA 2K1BA 4DV7L 4IUNA 1SR3A 1Y1WB 1VQ9A 3PSIA 3E9IA 2PNRC 3MA2B 3RN2A 3TN2A 1RHPA 3BZDB 2RVLA 5CV9A 1WVLA 4M8AA 1STNA 1Y1WH 3E0JA 1EYGA 4A93G 2F3VA 1XWEA 4OGQC 2DNEA 5ELFA 4BXXG 5C0XJ 4FF2A 1UEBA 1GJXA 2VUMB 5ISRA 4I7AA 4A3BH 4ME3A 1XTCD 2QILA 1LO5D 2R3ZA 1LLRD 2VS1A 5A35A 4LF6L 1ASZA 5C4ZA 3LGJA 4L5QA 3GTOB 3L2PA 1XMQL 4OO1I 3RNUA 4UPAA 4DR7L 3H6MA 2GA4B 2A6EC 3UDGA 4HJAA 4IUPA 4AYBG 4MZ9A 3M3YB 4CJ0B 3SK6A 2PO4A 5AFWA 1EIFA 3LWUA 3EFXD 4DXGA 1PTOD 1AN8A 2WKCA 1ZKOA 1E0BA 1V1PB 4R4TA 4C3JH 3HOXH 4A3JG 4QCLA 4UP9A 4HIDA 1DCZA 2LKVA 4YHHL 1EQQA 1N36Q 3CRKC 1PH3A 4CJ2C 4G7HC 1GOZA 1FNWA 4HEDA 4X65Q 1PH9A 3KJPA 1EY0A 1Y1VG 2JA5B 5LL6X 1M4VA 2PMZB 3TP7A 1HHVA 3NELA 1DD2A 3D4RA 3UE0A 4BBRB 4B9WA 3S1NH 4DUZL 4DF7A 1VQNA 2Z8LA 1CZGA 1Q90A 4QY7A 3CF5A 1WFQA 3N6RA 3PF5A 1SJHD 2MUYA 1ENFA 1I4PA 3VR6A 1A0IA 1SAPA 4ID6A 3M4QA 1BVSA 4BY7B 3IKJA 4A3KH 3CP0A 5FLXc 4DV3L 1KD1C 3NBHA 2NVYH 3AQQA 3HRZC 3P75A 1IBLQ 4HCSA 5KNDA 2IHFA 4ZKBB 4DXFA 1YZ6A 4ULLA 2PZUA 3GTPB 3FEWX 4HAEA 1HRJA 2K32A 1B70B 1HNWQ 3X3NA 3R2IA 5CYUA 2KHJA 1KRTA 3HOWB 3W5OA 3KBGA 2K33A 4A3EB 2JYOA 4XQQA 4OL7A 1E1OA 2R93H 2NVTB 4CDCC 2ZTCA 2RDFA 4JI7Q 3D3RA 4DR4L 2XTIA 3R2TA 2A1AA 1R4PB 1BO0A 1CFMA 3DWQA 3HG9A 5FLXL 1PH2A 4JI0Q 5AJ3L 1ONLA 2PQEA 4MTKA 4FXDA 4F88A 1KRSA 4IO9A 1VQGA 2XRSD 2R7DA 1Q46A 3FKIG 1DYQA 1S40A 2YU9B 4LF6Q 1TT2A 2C35B 1YHAA 3CPWA 4IFDH 4DV2Q 4EX5A 3TZDA 1HNZL 3L9AX 2YTVA 5C4JH 1S3OA 2EZVA 5KRUA 1IZ6A 1V1OA 1I4XA 1NR4A 2G5DA 4HMIA 1HUNA 5E7NA 2X6GA 1KDBA 3T1HQ 4FDBA 5M3MB 4CGYB 1IBKQ 4R4OA 4GOPC 2JSOA 2NB0A 3KLRA 2XRQD 1PFMA 1EIGA 5EJWA 4F7XA 3HOWH 2K28A 1S5DD 3A55A 3I4NH 3VR5A 2K4KA 2BA1A 4LW1A 4KV6A 4IUVA 2RA4A 1PYWD 5E3FA 3BYTB 5JEAH 3M4OH 5CMDA 5JVH3 1SFOH 4IFDG 3HOVH 1O7LA 1VQCA 3BVGA 1E1TA 2VB3X 1ASYA 3M4YA 1B7YB 3QJYA 4N9TA 4JBKA 4H0LC 5BR8Q 4K5WA 4IPDA 1VMPA 4DAYB 4GKKL 5JOBA 1JB3A 5IODA 3OSOA 5HY6A 3U4VA 2R93G 4K0KL 2DNCA 5C4XB 1V1PA 1TS3A 4JI2L 4A3IH 4NMZA 3E3XA 3J80c 3I4LA 1EZ6A 3I4MH 2G9DA 4WJWA 3BDCA 5I4DA 1HNXQ 1I4QA 3KF6A 3G7LA 3T51B 5GAHC 2AWOA 3A7AB 3X3MA 4A3KG 5BN4A 3CCRA 2Z9HA 4ZRZA 1I94L 2SDFA 3J7YW 3A54A 1ML0D 1FNUA 1V43A 4K6LA 1WTHA 2F3WA 5ELEA 1A3TA 4KN4C 2UUBQ 4F87A 4JI4L 4JI5L 3OOCA 2Y0SG 4JW0A 3EN2A 2B8GA 2PW5A 2CH4W 3AU7A 4L5SA 2NN6I 3G48A 1PDQA 4IQZA 4YCUA 1D1KA 1PV4A 2F0FA 3I73A 2KJXA 2LMCB 4FXGC 3H15A 1XXGA 3CCVA 5D3DA 2HQEA 4PQXA 3I56A 3A5ZB 1U9RA 1QNKA 5IYBH 2E76C 3RLOA 2EY1A 2FXQA 4KJOA 3V05A 3BS1A 4IJHA 1HUMA 4LF9Q 3S2DH 3PO3B 1EOVA 3PO2G 4X66Q 1VQDA 4ALPA 5EQ0A 3HOXG 4A3JH 4C3JG 3BDLA 4X64L 1X3QA 4ZLTF 2EJMA 2RKSA 4UHVA 1TWGB 1VS0A 1BBUA 1LT5D 1TWCH 3PUVA 5DM63 2Z4HA 2F0PA 4GLAC 1KXLA 5ELOA 1X3FA 3VYSA 4JI1L 3KYHC 4ME5A 1Z9FA 4LJZC 4IFDI 5LHY1 2R93B 2NYZD 3D4WA 2EY2A 3RD4A 1I50B 3U9SA 3J81c 1QWYA 4L5RC 1NNXA 2F1MA 3IFDA 1EWHA 2DUDA 1FJGQ 2L12A 1HR0Q 5BR8L 4HJ9A 2A74C 1HCZA 4MNOA 4A93H 1CA5A 1Y1WG 1VMCA 2G9HD 4P2CB 3JAMc 2NVYB 1S5ED 5CV4A 4PNYA 4WJ3M 3SGIA 1O78A 3CKIB 3MTSA 3J81j 2JEAI 4JI0L 5J39A 4JI2Q 4H02A 1BCPC 1LT4D 2JA7B 5C4HA 4GNXC 1GO3E 1HNWL 3QG1A 1EFWA 1G8ZD 2LXKA 2XVSA 1VQ7A 3I4MB 4JI8L 1PRTF 2E75C 2F0LA 4KY7A 4YY3Q 1BNZA 1CKNB 4B3RQ 5M3FG 2F0IA 4EQPA 1A2TA 1PFSA 2F0HA 4DR5Q 1BDOA 4BS9A 3H94A 2N55A 3J7ZC 1I4HA 5IYCG 2C9OA 1K8MA 1S5BD 2PZWA 3NUCA 1QZGA 3K0XA 4EGVA 1L1OA 1NY4A 1RIPA 3DM1A 1X32A 1Q86C 1W3SA 1U4MA 1LTGD 1R4QB 1BCPF 2JE6I 1LACA 1NCVA 1AH9A 2JJQA 1ENAA 2JA8G 3S1MH 1N32L 2DY7A 3KF6B 5EPKA 3TSSA 3T1HL 4Y52H 3HKSA 4KY5A 3S1RH 2QCPX 5C3EH 4DV2L 3HOYG 1V9PA 2OF1A 4LF9L 3HGBA 3M7GA 3NTKA 4DAVA 3KDFB 2A5HA 4X3TA 1UE6A 2JK8A 1SNDA 3F2CA 2DJGC 4CDDC 1VCIA 1UE7A 2K52A 3MXPA 1EYDA 3QB3A 3IL8A 2ZJPA 4H7BA 2L55A 3GTQH 1HZAA 5DNFA 4KKSA 3PV0A 4R8NA 3A8KE 4OO1H 2EXZA 1VF5C 1EYAA 1PRTC 2OXPA 4KY6A 4MTNA 3Q23A 2OQ0A 3FDTA 2ALYB 1IL8A 4DN4M 2F0JA 4A3EH 4KMUC 1AP0A 1A2UA 4PV1C 4YWLA 4HJ7A 2HDLA 5C44H 4JV5Q 4CKEA 1ZEQX 1II3A 4GKJL 1GHJA 1OXUA 3W2DA 1W6KA 1F77A 3LWEA 1H9SA 2MFIA 5FK9C 3TQYA 1EIYB 4CHTB 4R4IA 5IYDH 2GVAA 3VA7A 4BY1H 5DLQE 4PMCA 4DNRB 3NQIA 1LT6D 3MC0B 1AZQA 2XSCA 3CCEA 2DGYA 2ICIA 1PXUA 4BY7H 1KAWA 4GOPA 1SYFA 1LM0A 2H4OA 3CCSA 1R9TB 3M7NA 1D5MC 1YJWA 1RODA 2Q8TA 4DV1L 3TEHB 4R4QA 4RAUC 3P7JA 1P8LA 3CMAA 2YYZA 3EROA 3DMUA 4OEMB 4ZUJA 1QVFA 3URYA 1CHPD 5TSSA 3PGZA 3GDEA 2CW0C 2F0SA 1G291 1IW7C 3PUWA 1CHQD 2B2WA 2Q8RE 2KVMA 4K2LA 4RKLA 4JBJA 1GUWA 1RL2A 1JC7A 3A8JE 4LFCQ 1FD7D 3MHBA 4O42A 2CQAA 3MWYW 2BE5D 5C44G 4KD4A 2BDNA 3U50C 3IFTA 5C4XH 4V0BA 4DNIA 5FOBB 4UY8C 2IPKD 2K5HA 1SNMA 1D8LA 2ASBA 3J80L 3CXCA 2HIVA 2NWGA 4NW2A 1UWVA 1I6HB 4GNXB 2B29A 4XYOA 1H9RA 4R8IA 2RSOA 2K5DA 2Z1CA 4YWMA 3J7AV 1K83B 1Y1VB 1E22A 2VQEQ 4WORA 3AFPA 1TY2A 2NVXH 3M85A 1FGUA 4GN5A 4IFDJ 1Q7YC 4CJ1B 3F8TA 3J81i 3TP6A 1HFGA 4JOIA 1VQHA 3I4NB 1HFNA 3CCMA 5DM73 3PF4A 2B2UA 1VQPA 1Q81C 5C4JB 2VB2X 2L4NA 2F0KA 3HKZG 4DR3L 4IOAA 4NPSA 1MD2D 2O2LD 5A2QE 1PA6A 4O0AA 2E2HH 2K7VA 3OIPA 4DNTB 1TKWB 5IYCH 3U9OA 5CORA 4DV7Q 1TU2B 1EL0A 1KNEA 1YBYA 3CQZH 4DA2A 5C3XA 1RTOA 2A73B 1JWMD 3DEOA 3GQBA 3MZ5A 1JJGA 4A3GB 1XJVA 5LMUL 2EYHA 1D1IA 1X3GA 3HKZB 4XTCS 2B2WC 5IE8A 2NTSA 1KLGD 2M2LA 5EKIA 3SDZA 4TVAB 2IX3A 1TIID 3E6ZX 5IGCA 2E2JH 4IPGA 2L0CA 5LMNQ 4RWSC 2UUCL 2MJ8A 2NN6H 4A3LG 3E5SA 2RHSB 1YNXA 4KTAA 1F9SA 4DV5L 3QOJA 1ESFA 4DR7Q 3PUYA 2A69D 1EQVA 4B3MQ 1HQMC 3HP3A 3L0OA 4DUZQ 3RZDH 2EDGA 2E2DC 2F0OA 2NZHA 2IHEA 4Z9CB 4HSPA 4DV0L 1JQYD 2AQ1B 1SDFA 4PZ6A 2N49A 2B8FA 4K2KA 1AFPA 3RZDB 4OX9L 2JA7H 3O13A 2UU9L 4LFAQ 5T1IA 4YHHQ 2B63G 5IT9c 1UAPA 1T5EA 3J80E 1EWIA 5IT9E 1WTVA 4L6TB 5M5YB 1TS5A 1VQEA 3ERQA 1TWHB 3W3AA 4ZKCB 1WJJA 5C5MA 2E74C 1EY6A 1SE2A 2RCNA 1GUNA 1OXXK 4K14A 3ULJA 1GUTA 1B3QA 3M4OB 4FF3A 4KKTA 2ZTDA 2R92G 2ZTEA 3NPPA 4H44C 5G3LF 1N33L 1VQFA 2EYLA 1EEFD 4PMBA 5G3LD 2DJFC 5IYBG 2D2CC 4LUVA 5IOCA 2PQAA 2VY3A 5FKAC 2ES2A 1JOKA 1Q1BA 2IY5B 3ICEA 2Z6KC 1B53A 2X6LA 2IX0A 2R7FA 4OONA 1BR9A 1A6XA 1PMRA 3F2BA 1IL2A 2PNHA 1RKNA 3OPOA 3GV3A 3V2TA 3MVVA 1J6QA 3MXGA 2YU9H 3OWFA 4RCOA 2CH4A 4OO1G 1D2BA 1WCMG 2F0GA 2XNAC 2WB1E 4CKCA 4E6IA 2KUMA 4YCVA 5C3WA 2F4VL 4C3HH 5GROA 1YITA 3OYYA 1B50A 4LMQD 4DKAC 3J7A5 4LF8Q 2ICEC 4DV1Q 1CTMA 1PZID 2M00A 3Q22A 2MQHA 5GAEC 4JI7L 4DR4Q 3HOYH 1CK1A 1J5EQ 1L1OC 3I4MG 4FXKC 1YVCA 4DPGA 2HD3A 2E2IH 4A3IG 2RF4A 4K5XA 1NSNS 4RHSA 3W1GA 3GO5A 1PZJD 4RHRA 1SEBD 1DM0B 2CW0D 4C3HB 3RR5A 4GKKQ 5E4WC 1KL9A 1EY9A 2XGTA 4HCEA 4KKUA 2F0UA 1I6HH 2OQKA 4ZAIA 1JORA 1M8AA 5D14A 1TS4A 1PTOC 2NZ1D 4IUQA 3JAML 4HIKA 3ULPA 2A6HC 2QDBA 4TSSA 1E24A 3SK5A 1JWSD 1PTOB 4HJ8A 2JXMB 1BKBA 5IWAL 1C0AA 2GVBA 2VQEL 1V1QA 5KGUA 1J8IA 5KYIA 3I4NG 3S14B 2UU9Q 5EKLA 1KHIA 1MSGA 3HOWG 3OHXC 1NTGA 3VYUA 1QILA 4UAIA 4N8X1 1K8OA 1Z6HA 2XIWA 3A8IE 3TZUA 2F0EA 3G6JB 2VNUD 1FNVA 2ZM6Q 1PRTD 2B2TC 2B2TA 1H9SB 1LTBD 3LNNA 5M5YH 3K80C 1RCVD 3FKIH 2F0QA 1SE8A 4ZUIA 2CKZB 3CC7A 1B9NA 3A56A 4JG2A 5AJ3Q 2ZJQA 1X6OA 3G6EA 2B39A 1MHWC 5FO7B 5C5LA 3W1BA 5KIXA 2MO0A 3P1HA 3CHBD 5LMNL 4BY1B 2VQFQ 4RGNA 2FFKB 2DN8A 1A15A 3FMCA 4K6DA 3GTOH 1CI3M 5KYLA 2JA5G 1TVXA 4FP5D 2KENA 5FLXE 4LAAA 2OEOA 2UUAQ 3DM3A 4DAYA 3QO2A 2TSSA 4LWCA 4ILWA 1IBKL 1T5XD 4GS3A 2JP1A 2NTTA 1VQIA 4UDUC 4DV0Q 1G2TA 4GLVB 1CQVA 2E2JB 1AEXA 3GD7A 3KFUA 4A3MH 2PQAB 1HA5A 2AKWB 4LF8L 4CDFC 3OIQA 2R7ZB 4HSVA 3RMHA 2A8VA 2KA7A 5JJLA 1YJ9A 4QUCA 5FLMG 4IOCA 1STGA 3S1QH 1UUPA 4QL5A 1X3PA 4G7OC 2BDOA 2JQOA 2Z0SA 1T9HA 4LK1C 3PIPA 3T56B 1C48A 1QB5D 4GNXA 2O5IC 3CPFA 5M3MH 3N52A 1C9OA 4DK6C 3CCLA 1G91A 1EY5A 1Y8OB 1YHBA 2MP1A 4K0KQ 4X66L 4BBRG 1YNJD 2EXDA 3RLNA 2MPMA 2Z6KA 2J7ZA 1Y1VH 2PCFB 3I4OA 4NXMQ 1F2LA 2KCNA 3OTOL 2QEXA 3UDIA 2AHOB 3S16H 4RGTA 2J4XA 1PLFA 3B6YA 1Q8KA 3STBD 4I7ZC 3SK8A 2ENBA 3TP5A 2WB1G 2L11A 2NVTH 3TBIB 2L15A 3S2HB 3BVZA 3T13A 1GUGA 4JI6L 5CV6A 2F4VQ 4QGUA 3HOZB 2P5ZX 4QIWB 1LTTD 2K5NA 2JA6B 1HR0L 2I07B 1ET6A 5CR3A 5M3FB 2WFWA 4A3DG 1YNJC 3NK9A 1MBYA 3I2ZA 1N33Q 4X65L 1GM5A 2NVXB 1JWUD 2ID0A 5EPJA 2B2UC 3D6CA 1K83H 1Q82C 3S1RB 1CSPA 5IT9L 3SR1A 2B2VA 4IPHA 2PI2E 2K01A 2HDMA 1WTPA 4A3GG 4P72A 1SNCA 1OXSC 4WRDA 4BXXH 2QDLA 2CWAA 3NXWA 3HOVG 3KJOA 1WTXA 2VUMG 1G51A 3ONAB 5DAUA 4FVMA 4CBVA 4X64Q 1TY0A 2EE1A 4DUYQ 1MJCA 2K5VA 1SYGA 4QJFA 4X3SA 4FO2A 4C3IB 2XWJB 2R6GA 2R61A 1IYVA 2UXDL 2Q8IB 4G57A 2EY6A 3Q8DA 3AFQA 2RCFA 2AMCB 5FO9B 5C0XH 1Q3LA 2JA6H 2N78A 1EY7A 4A3BB 1E7ZA 3Q24A 5IGGA 1W2BA 3C2PA 2IX1A 1F2MA 1SMYC 5EKKA 2K6AA 2HCIA 1G2SA 2LS01 3WOEA 3L3OC 1ICFB 1IXRA 4M1UB 3KLSA 4KLKA 2R7ZH 3PMFA 3K5LA 5IY0A 4QMGA 3F2DA 1E2ZA 4BA2I 5NUCA 1XYIA 1C4QA 1SBBB 3I91A 4HMJA 5IWAQ 2PMZE 4XYQA 1VQOA 1JMCA 4LF5L 2VXWA 4PZ8A 2Z4IA 4C1NI 1K8GA 4LF4Q 2RQXA 3T4AC 4EQOA 1ET9A 1I5FA 4OWTB 2Y0SE 4O2DA 3Q0AA 1HZ9A 1TS2A 1K3RA 1V8QA 2JA9A 3D0FA 2B2VC 4F8MA 5DEHA 2MNAA 1SMYD 4IALA 1STHA 3R93A 3H0GG 1QE6A 1PYBA 4JOIC 5IGBA 5KNBA 5CBEE 2UXBQ 3S15B 1QOHA 1ENCA 1EEID 4GN3B 3FHWA 2PI2A 4DFAA 1EYCA 3HEJA 3KF8B 3JAME 1YI2A 2R7ZG 2O5JC 3EA6A 1OXVA 2NUCA 4ODGA 1KABA 1IYUA 3I3CA 3GTGB 3VDYA 2A68C 3BYYB 4MN3A 2UUAL 1HQRD 4C2MB 1K0RA 5HURA 4J15A 1Q1EA 2A68D 5JJIA 2XN9C 4EVOA 2WAQB 2F0WA 3NWTA 1MKHA 1VQAA 3TRZA 4DR1Q 3CAMA 3D31A 4IJLA 4POFA 5L37A 2IW3A 1Y69U 1HZBA 1MJEA 1PRTB 4G7ZC 2H5XA 1GXDC 1C7YA 3TP8A 4OIJA 2J0TD 4YIJA 1TWFB 3NWSA 5KNCA 1TWFH 2IL8A 1NUCA 3ITPA 1B8AA 3Q6SA 2X69A 4UP7A 3K59A 4A4IA 1I4GA 3OTOQ 1FGBD 4V190 3RZOH 3QWNA 1F2YA 3RUZA 4GOPB 4AIMA 4KHPL 4LFCL 2EJFC 1HA6A 4A3GH 4X3UA 1L0YB 4XDXA 1XPRA 4JI4Q 1RDPD 2E2IB
chains in the Genus database with same CATH topology
1S72A 3KLWA 4AYBE 2NZHA 3I7FA 4R4OA 4GOPC 2IHEA 3PIOA 1IBKQ 2VL6A 3H3VI 4DV0L 4JI6Q 1KQSA 2E5LL 3HOWH 2QGQA 4A3BG 4PZ6A 3I4NH 3T1YL 2N49A 2K75A 3KDFA 2K4KA 2BA1A 4LW1A 4A3DH 2Q2HA 4OX9L 3M4OH 2JA7H 2NN6G 4A3LH 1SFOH 4IFDG 3GTPH 3U58A 3HOVH 1VQ6A 1YEZA 1VQCA 4DR3Q 3WWVA 1A8VA 4LFAQ 2UU9L 4YHHQ 2B63G 1E1TA 3FP9A 1IBMQ 5IT9c 1ASYA 1B7YB 1EWIA 1QVGA 4JBKA 1O7IA 1VQEA 1WJJA 5GQOA 4IPDA 5BR8Q 4DAYB 4LF4L 1YJNA 4QIWE 4GKKL 3K8AA 2N3SA 4DV6L 2RCNA 5HY6A 3U4VA 3HOUH 3PO3H 1OXXK 1VQLA 2ATWA 2NVQH 3ULJA 1PH6A 2R93G 4KI0A 1K73C 4K0KL 1H95A 2HHHQ 2ZTDA 2R92G 2ZTEA 1N33L 4DR2Q 1VQFA 1L1OB 4B3SL 4BBSH 4JI2L 4DR1L 1HJPA 1I50H 5IYBG 4DUYL 4A3IH 4HIOA 1X56A 4LUVA 3HFZB 2PQAA 2VY3A 2ES2A 1XTDA 4KHZA 3J80c 3I4MH 5LMUQ 4A76A 1Q1BA 4XIGS 2IY5B 1JJ2A 1EQRA 3MXNB 3M9BA 3ICEA 2Z6KC 1HNXQ 3ZJYC 2IX0A 2R7FA 4OONA 1P16A 3KF6A 1FVIA 2KCTA 3F2BA 1IL2A 4X6AH 2PNHA 2EIFA 5IP9H 2WAQG 2AWOA 5GAHC 1SN8A 5M5WH 1HZCA 4A3KG 2KBNA 1K8AC 3CCRA 1VQ5A 5C3EG 1VQ8A 1J6QA 2YU9H 1BBWA 1I94L 4YCWA 4C3IH 4OO1G 1FJGL 5K36G 2LXJA 1WCMG 1V43A 2WB1E 4PMWA 5IP7H 5FLMH 4YCVA 2F4VL 4B3ML 5IP7G 4C3HH 4LUOA 5GROA 1YITA 2UUBQ 4JI4L 4JI5L 3OYYA 2JA8H 4P73A 2Y0SG 4APVA 4DKAC 4GKJQ 2F52A 3J7A5 2KHIA 4LF8Q 2NZOA 3EN2A 4DV1Q 4BA1I 4A3MG 4BXXG 1XMOQ 4L5SA 2NN6I 4AQYL 2MQHA 5GAEC 3G48A 2K50A 2I5MX 4JI7L 1PH7A 4DR4Q 4YCUA 3TS0A 1PV4A 3HOYH 3RZDH 1J5EQ 4R4CA 3K7UC 3BZKA 3BZCA 1L1OC 2KCMA 3H15A 3CCVA 4GLXA 1YVCA 3I4MG 4LF5Q 1G6PA 1N8RC 4JI3L 3A5ZB 4DPGA 3I56A 1IBML 2E2IH 2JA5H 1AE3A 5IYBH 2RF4A 4A3IG 1JB7A 2VQFL 4HJ5A 3RLOA 4B3RL 2FXQA 5M3FH 3W1GA 4IJHA 4LF9Q 3S2DH 3GO5A 4DR6Q 2VW9A 1EOVA 1U5KA 4JBMA 1MIUA 4DR5L 3CD6A 2UUCQ 3PO2G 4X66Q 1VQDA 3RR5A 4ALPA 4GKKQ 3UE1A 3HOXG 4A3JH 3PO3G 1KL9A 3HOUG 4X64L 2E8GA 2XGTA 2UXCL 4KHPQ 1FL0A 1VQJA 4LNQA 1I6HH 2UXBL 2OQKA 2YTYA 3PCOB 5C4XG 1VS0A 3M4PA 1BBUA 1TWCH 2YV5A 1GD7A 3PUVA 3GTJH 3CCQA 4DR2L 1HR0W 4B3TQ 1XNQL 4GLAC 1KXLA 4HIKA 3ULPA 1XNRL 1DGSA 5ELOA 1X3FA 2CQOA 2WP8J 4JI1L 3KYHC 1Z9FA 4X62Q 1E24A 3PUXA 1N32Q 1WI5A 4GN4B 4IFDI 2ZJRA 4NXNL 4JBWA 2RHQB 4R1JA 1K9MC 4HJ8A 1SROA 2OWOA 1BKBA 5IWAL 1C0AA 2GVBA 2VQEL 1V1QA 2LSSA 5C0XG 1QUQB 1Z47A 3I4NG 1YHQA 2UU9Q 4DK3C 4LFAL 4LFBQ 2AWNA 1KHIA 3J81c 5M5XH 2CCZA 4L5RC 3HOWG 1NTGA 4WJ4A 1Y14B 2Q2IA 4JCVE 3IRBA 2D0PA 2DUDA 1FJGQ 1HR0Q 4JV5L 5BR8L 4HJ9A 1CUKA 4UP8A 3S24A 2Q2TA 2VNUD 4MNOA 4A93H 3CCJA 1Y1WG 2VUMH 4JYAQ 2ZM6Q 4DV6Q 1VQ4A 3JAMc 2UUBL 3MEFA 3A0JA 2HQLA 5M5YH 1L2FA 3BU2A 3SGIA 1N36L 3TS2A 3K80C 4WJ3M 3FKIH 1SE8A 3J81j 2Q2UA 2JEAI 2CKZB 3PUZA 1PVOA 3NBHB 4JI0L 1SRUA 4OWXB 3CC7A 4JI2Q 4H02A 4JG2A 5AJ3Q 2ZJQA 1D7QA 1GVPA 1X6OA 4TQUS 2F3IA 1JT8A 4GNXC 3G6EA 1GO3E 1XPUA 1EFWA 3H3VH 3W1BA 4BY1G 1J5EL 3S15H 4NB3A 1HNWL 2LXKA 1SMXA 1VQ7A 3ER0A 4JI8L 3CMEA 3PO2H 2MO0A 2OCEA 4P75A 3K81C 5IYDG 4YY3Q 5LMNL 4POGA 1CKNB 1NJIC 2VQFQ 4Y7NH 4B3RQ 5M3FG 1U0LA 3AYHB 4DR6L 1PFSA 3GTOH 3K7AH 2JA5G 2KENA 4DR5Q 3HOZG 3J7ZC 3I55A 2UUAQ 3DM3A 2IT1A 5IYCG 1CSQA 4LWCA 1GKHA 1IBKL 2EQSA 4GS3A 1X3EA 4A3EG 1QZGA 3K0XA 1VQIA 4DV0Q 1L1OA 3EBEA 4GLVB 1NY4A 1RIPA 1L0WA 5ELNA 1TWHH 3GD7A 3J80i 3KFUA 4A3MH 2PQAB 2WAQE 2AKWB 4DV3Q 1Q86C 1W3SA 4LF8L 4OX9Q 4A3FG 2I5LX 2JE6I 1AH9A 4JI1Q 1QZHA 3ERSX 2JJQA 2JA8G 3S1MH 1XMOL 1CKMA 2A8VA 1N32L 5JJLA 3KF6B 1UE5A 1YJ9A 3A74A 3NEMA 3STBC 3RLFA 5FLMG 4IOCA 3T1HL 4LF7Q 3S1QH 3HKSA 4Y52H 2JEBI 4QL5A 2JQOA 2Z0SA 1M1KC 3S1RH 1T9HA 3PIPA 4OWWB 1X9NA 4JI3Q 5C3EH 2MO1A 4DV2L 3GTMH 3HOYG 2D62A 4GNXA 1V9PA 4BBRH 3H0GH 3CPFA 4LF9L 5M3MH 1C9OA 2HIXA 4DK6C 5M3MG 3CCLA 2V1CC 1YHBA 4K0KQ 4X66L 3KDFB 4BBRG 1X54A 1UE6A 2JK8A 2ZM6L 2EXDA 3RLNA 2HT1A 3F2CA 2UXDQ 3F1ZA 1VCIA 2Z6KA 3E9HA 1X55A 4EQ5A 1UE7A 2K52A 1Y1VH 3JC66 2ZJPA 3T1YQ 5LMNW 1EUJA 2K14A 1NMGA 1XMQQ 1N9WA 3GTQH 1HZAA 3A5UA 3I4OA 1NE3A 4B3TL 4NXMQ 3PV0A 1XNQQ 5J3BA 2QEXA 3OTOL 5JJKA 3UDIA 2AHOB 5JEAJ 3S16H 1UE1A 1VQMA 3EIVA 3B6YA 1Q8KA 1LTLA 2N8NA 4DV5Q 5C0XI 3STBD 4MTNA 3DLLA 1TWAH 4DV4L 2OQ0A 3S17H 5IP9G 1N34L 2WB1G 2ALYB 3UDXA 3CCUA 2I0QA 2NVTH 2L15A 3NENA 4A3EH 4A75A 2BH8A 3M3YH 1CKNA 4JI6L 2E5LQ 2CWPA 3E0EA 4YWKA 4QGUA 4OXPA 2F4VQ 4YWLA 4RMFA 2I5HA 4HJ7A 1OTCA 2K5NA 5C44H 2BH2A 1HR0L 4JV5Q 5FJ8G 4C2MH 3U4ZA 5HGQA 2WFWA 4BBSG 4GKJL 1OXUA 5JEAG 5H1SE 4A3DG 2JA6G 3I2ZA 1LYLA 2GN5A 1N33Q 4A3CH 2MFIA 1SLJA 3TQYA 4X65L 1GM5A 4R4IA 1EIYB 5IYDH 2ID0A 1A62A 5EAYA 2GVAA 4BY1H 1K83H 2BA0A 5DLQE 1Q82C 1CSPA 1QVCA 1I94Q 1XPOA 3CCEA 5GAGC 2DGYA 2PI2E 4IPHA 4LUZA 4DV7L 4BY7H 1SR3A 4A3GG 1KAWA 4P72A 4GOPA 3PSIA 3E9IA 1OXSC 1VQ9A 4BXXH 3RN2A 1LM0A 4P74A 3BJUA 3CCSA 1R9TH 3M7NA 1YJWA 2CWAA 2B3GA 3HOVG 3KJOA 3TREA 4DV1L 3TEHB 1Y1WH 1G51A 4R4QA 1EYGA 3CC2A 2VUMG 4A93G 1X65A 1P8LA 3CMAA 4X64Q 3L7ZC 2YYZA 5C0XJ 4DAMA 1MJCA 2K5VA 1UEBA 4QJFA 4DUYQ 3CC4A 1QVFA 1VQKA 2R6GA 4A3BH 4ME3A 3PGZA 3GDEA 2UXDL 1G291 2OTLA 2VS1A 1HNXL 3PUWA 3Q8DA 3AFQA 4LF6L 1ASZA 2AMCB 1IBLL 3LGJA 4L5QA 3L2PA 4RG1A 4JBJA 4A3CG 1XMQL 1HH2P 1RL2A 3RNUA 2JA6H 2N78A 4OO1I 4UPAA 4LFCQ 4DR7L 1E7ZA 3UDGA 1NMFA 5FJ8H 1W2BA 2IX1A 4HJAA 5C44G 4AYBG 4MZ9A 4LFBL 3U50C 2VZAA 3G4SA 5C4XH 4DNIA 1EIFA 1NBWA 1M90C 2K5HA 1IXRA 1AE2A 4IPCA 1D8LA 4UY8C 2ASBA 2CFMA 1E3PA 3CXCA 4AH6A 1TWGH 2HIVA 4C3JH 4KLKA 4JC0A 4R4TA 1UWVA 3HOXH 4A3JG 1XNRQ 2R7ZH 4UP9A 4GNXB 3OW2A 2B29A 4HIDA 5IY0A 3F2DA 4AQYQ 4BA2I 2UXCQ 1JJCB 4YHHL 4PG3A 4YWMA 1EQQA 1N36Q 1IYJB 1PH3A 5IWAQ 2PMZE 1E22A 2VQEQ 3AFPA 1VQOA 4X65Q 1JMCA 3M85A 2NVXH 1FGUA 4PZ8A 1PH9A 4GN5A 3KJPA 4LF5L 4IFDJ 1Y1VG 1K8GA 4LF4Q 1Q7YC 3RN5A 1HNZQ 1I5FA 3F8TA 4OWTB 2Y0SE 4O2DA 4X62L 3J81i 1PH4A 1HZ9A 3NELA 1VQHA 2YTXA 4JOIA 3UE0A 1K3RA 2JA9A 1YIJA 2HHHL 5GADC 3D0FA 4DUZL 1VQNA 3S1NH 2MNAA 3CCMA 1JE5A 3GTLH 4QY7A 3CF5A 3H0GG 4B3SQ 1PYBA 1WFQA 4JOIC 2UXBQ 4DV4Q 3PF4A 3PF5A 4GN3B 2QA4A 1TXYA 1PYSB 3FHWA 1VQPA 2PI2A 1Q81C 1A0IA 2OTJA 1WCMH 3M4QA 1BVSA 3KF8B 4PZ7A 3HKZG 4DR3L 1YI2A 1PH1A 1A63A 4NXNQ 4A3KH 3CP0A 5FLXc 4DV3L 4A3FH 1KD1C 2R7ZG 4IOAA 2NVYH 3AQQA 1OXVA 4NPSA 1IBLQ 1Q12A 2IHFA 1LUZA 4L5TA 1PA6A 1N34Q 4O0AA 1YZ6A 3VDYA 2E2HH 2UUAL 1HNWQ 1B70B 1K0RA 4J15A 3G71A 1Q1EA 1WYDA 5IYCH 4DV7Q 3S14H 3HOZH 4JYAL 1KRTA 2KHJA 5JJIA 3W5OA 1YBYA 2R92H 2D0OA 3CQZH 1PH8A 3S2HH 1MKHA 1VQAA 3TRZA 1E1OA 3CAMA 3ULLA 4DR1Q 3D31A 2R93H 2ZTCA 4JI7Q 4IJLA 4POFA 4HIMA 2XTIA 1VQBA 2A1AA 4DR4L 2A19A 1JJGA 1XJVA 1HZBA 1WOCA 1PH2A 5LMUL 1MJEA 4JI0Q 1X3GA 3GTGH 4XTCS 2H5XA 5AJ3L 5IE8A 1C7YA 1QUQA 1PHJA 3UDFA 4P71A 1KIXA 4TVAB 1KRSA 4IO9A 1VQGA 4QQBX 3CW2C 2B63H 1OXTA 2R7DA 1TWFH 4JI8Q 1KC8C 3JAMi 1Q46A 3HKZE 3FKIG 4IPGA 1S40A 2E2JH 4LF6Q 4NXML 4YY3L 1B8AA 5LMNQ 2C35B 1YHAA 3CPWA 4UP7A 1PH5A 2UUCL 4A4IA 4EX5A 3OTOQ 4DV2Q 2JA7G 1HNZL 3RZOH 4A3LG 2RHSB 1YNXA 2YTVA 5C4JH 1S3OA 4GOPB 4AIMA 1IZ6A 4DV5L 4KHPL 4LFCL 1I3QH 3PUYA 3AEVA 1CKOA 3GTKH 4B3MQ 4DR7Q 4A3GH 4BY7G 5E7NA 3T1HQ 3L0OA 4LF7L 4DUZQ 1XPRA 4JI4Q 4JI5Q 3KOJA 4FDBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S72 A;  3KLW A;  4AYB E;  2NZH A;  3I7F A;  4R4O A;  4GOP C;  2IHE A;  3PIO A;  1IBK Q;  2VL6 A;  3H3V I;  4DV0 L;  4JI6 Q;  1KQS A;  2E5L L;  3HOW H;  2QGQ A;  4A3B G;  4PZ6 A;  3I4N H;  3T1Y L;  2N49 A;  2K75 A;  3KDF A;  2K4K A;  2BA1 A;  4LW1 A;  4A3D H;  2Q2H A;  4OX9 L;  3M4O H;  2JA7 H;  2NN6 G;  4A3L H;  1SFO H;  4IFD G;  3GTP H;  3U58 A;  3HOV H;  1VQ6 A;  1YEZ A;  1VQC A;  4DR3 Q;  3WWV A;  1A8V A;  4LFA Q;  2UU9 L;  4YHH Q;  2B63 G;  1E1T A;  3FP9 A;  1IBM Q;  5IT9 c;  1ASY A;  1B7Y B;  1EWI A;  1QVG A;  4JBK A;  1O7I A;  1VQE A;  1WJJ A;  5GQO A;  4IPD A;  5BR8 Q;  4DAY B;  4LF4 L;  1YJN A;  4QIW E;  4GKK L;  3K8A A;  2N3S A;  4DV6 L;  2RCN A;  5HY6 A;  3U4V A;  3HOU H;  3PO3 H;  1OXX K;  1VQL A;  2ATW A;  2NVQ H;  3ULJ A;  1PH6 A;  2R93 G;  4KI0 A;  1K73 C;  4K0K L;  1H95 A;  2HHH Q;  2ZTD A;  2R92 G;  2ZTE A;  1N33 L;  4DR2 Q;  1VQF A;  1L1O B;  4B3S L;  4BBS H;  4JI2 L;  4DR1 L;  1HJP A;  1I50 H;  5IYB G;  4DUY L;  4A3I H;  4HIO A;  1X56 A;  4LUV A;  3HFZ B;  2PQA A;  2VY3 A;  2ES2 A;  1XTD A;  4KHZ A;  3J80 c;  3I4M H;  5LMU Q;  4A76 A;  1Q1B A;  4XIG S;  2IY5 B;  1JJ2 A;  1EQR A;  3MXN B;  3M9B A;  3ICE A;  2Z6K C;  1HNX Q;  3ZJY C;  2IX0 A;  2R7F A;  4OON A;  1P16 A;  3KF6 A;  1FVI A;  2KCT A;  3F2B A;  1IL2 A;  4X6A H;  2PNH A;  2EIF A;  5IP9 H;  2WAQ G;  2AWO A;  5GAH C;  1SN8 A;  5M5W H;  1HZC A;  4A3K G;  2KBN A;  1K8A C;  3CCR A;  1VQ5 A;  5C3E G;  1VQ8 A;  1J6Q A;  2YU9 H;  1BBW A;  1I94 L;  4YCW A;  4C3I H;  4OO1 G;  1FJG L;  5K36 G;  2LXJ A;  1WCM G;  1V43 A;  2WB1 E;  4PMW A;  5IP7 H;  5FLM H;  4YCV A;  2F4V L;  4B3M L;  5IP7 G;  4C3H H;  4LUO A;  5GRO A;  1YIT A;  2UUB Q;  4JI4 L;  4JI5 L;  3OYY A;  2JA8 H;  4P73 A;  2Y0S G;  4APV A;  4DKA C;  4GKJ Q;  2F52 A;  3J7A 5;  2KHI A;  4LF8 Q;  2NZO A;  3EN2 A;  4DV1 Q;  4BA1 I;  4A3M G;  4BXX G;  1XMO Q;  4L5S A;  2NN6 I;  4AQY L;  2MQH A;  5GAE C;  3G48 A;  2K50 A;  2I5M X;  4JI7 L;  1PH7 A;  4DR4 Q;  4YCU A;  3TS0 A;  1PV4 A;  3HOY H;  3RZD H;  1J5E Q;  4R4C A;  3K7U C;  3BZK A;  3BZC A;  1L1O C;  2KCM A;  3H15 A;  3CCV A;  4GLX A;  1YVC A;  3I4M G;  4LF5 Q;  1G6P A;  1N8R C;  4JI3 L;  3A5Z B;  4DPG A;  3I56 A;  1IBM L;  2E2I H;  2JA5 H;  1AE3 A;  5IYB H;  2RF4 A;  4A3I G;  1JB7 A;  2VQF L;  4HJ5 A;  3RLO A;  4B3R L;  2FXQ A;  5M3F H;  3W1G A;  4IJH A;  4LF9 Q;  3S2D H;  3GO5 A;  4DR6 Q;  2VW9 A;  1EOV A;  1U5K A;  4JBM A;  1MIU A;  4DR5 L;  3CD6 A;  2UUC Q;  3PO2 G;  4X66 Q;  1VQD A;  3RR5 A;  4ALP A;  4GKK Q;  3UE1 A;  3HOX G;  4A3J H;  3PO3 G;  1KL9 A;  3HOU G;  4X64 L;  2E8G A;  2XGT A;  2UXC L;  4KHP Q;  1FL0 A;  1VQJ A;  4LNQ A;  1I6H H;  2UXB L;  2OQK A;  2YTY A;  3PCO B;  5C4X G;  1VS0 A;  3M4P A;  1BBU A;  1TWC H;  2YV5 A;  1GD7 A;  3PUV A;  3GTJ H;  3CCQ A;  4DR2 L;  1HR0 W;  4B3T Q;  1XNQ L;  4GLA C;  1KXL A;  4HIK A;  3ULP A;  1XNR L;  1DGS A;  5ELO A;  1X3F A;  2CQO A;  2WP8 J;  4JI1 L;  3KYH C;  1Z9F A;  4X62 Q;  1E24 A;  3PUX A;  1N32 Q;  1WI5 A;  4GN4 B;  4IFD I;  2ZJR A;  4NXN L;  4JBW A;  2RHQ B;  4R1J A;  1K9M C;  4HJ8 A;  1SRO A;  2OWO A;  1BKB A;  5IWA L;  1C0A A;  2GVB A;  2VQE L;  1V1Q A;  2LSS A;  5C0X G;  1QUQ B;  1Z47 A;  3I4N G;  1YHQ A;  2UU9 Q;  4DK3 C;  4LFA L;  4LFB Q;  2AWN A;  1KHI A;  3J81 c;  5M5X H;  2CCZ A;  4L5R C;  3HOW G;  1NTG A;  4WJ4 A;  1Y14 B;  2Q2I A;  4JCV E;  3IRB A;  2D0P A;  2DUD A;  1FJG Q;  1HR0 Q;  4JV5 L;  5BR8 L;  4HJ9 A;  1CUK A;  4UP8 A;  3S24 A;  2Q2T A;  2VNU D;  4MNO A;  4A93 H;  3CCJ A;  1Y1W G;  2VUM H;  4JYA Q;  2ZM6 Q;  4DV6 Q;  1VQ4 A;  3JAM c;  2UUB L;  3MEF A;  3A0J A;  2HQL A;  5M5Y H;  1L2F A;  3BU2 A;  3SGI A;  1N36 L;  3TS2 A;  3K80 C;  4WJ3 M;  3FKI H;  1SE8 A;  3J81 j;  2Q2U A;  2JEA I;  2CKZ B;  3PUZ A;  1PVO A;  3NBH B;  4JI0 L;  1SRU A;  4OWX B;  3CC7 A;  4JI2 Q;  4H02 A;  4JG2 A;  5AJ3 Q;  2ZJQ A;  1D7Q A;  1GVP A;  1X6O A;  4TQU S;  2F3I A;  1JT8 A;  4GNX C;  3G6E A;  1GO3 E;  1XPU A;  1EFW A;  3H3V H;  3W1B A;  4BY1 G;  1J5E L;  3S15 H;  4NB3 A;  1HNW L;  2LXK A;  1SMX A;  1VQ7 A;  3ER0 A;  4JI8 L;  3CME A;  3PO2 H;  2MO0 A;  2OCE A;  4P75 A;  3K81 C;  5IYD G;  4YY3 Q;  5LMN L;  4POG A;  1CKN B;  1NJI C;  2VQF Q;  4Y7N H;  4B3R Q;  5M3F G;  1U0L A;  3AYH B;  4DR6 L;  1PFS A;  3GTO H;  3K7A H;  2JA5 G;  2KEN A;  4DR5 Q;  3HOZ G;  3J7Z C;  3I55 A;  2UUA Q;  3DM3 A;  2IT1 A;  5IYC G;  1CSQ A;  4LWC A;  1GKH A;  1IBK L;  2EQS A;  4GS3 A;  1X3E A;  4A3E G;  1QZG A;  3K0X A;  1VQI A;  4DV0 Q;  1L1O A;  3EBE A;  4GLV B;  1NY4 A;  1RIP A;  1L0W A;  5ELN A;  1TWH H;  3GD7 A;  3J80 i;  3KFU A;  4A3M H;  2PQA B;  2WAQ E;  2AKW B;  4DV3 Q;  1Q86 C;  1W3S A;  4LF8 L;  4OX9 Q;  4A3F G;  2I5L X;  2JE6 I;  1AH9 A;  4JI1 Q;  1QZH A;  3ERS X;  2JJQ A;  2JA8 G;  3S1M H;  1XMO L;  1CKM A;  2A8V A;  1N32 L;  5JJL A;  3KF6 B;  1UE5 A;  1YJ9 A;  3A74 A;  3NEM A;  3STB C;  3RLF A;  5FLM G;  4IOC A;  3T1H L;  4LF7 Q;  3S1Q H;  3HKS A;  4Y52 H;  2JEB I;  4QL5 A;  2JQO A;  2Z0S A;  1M1K C;  3S1R H;  1T9H A;  3PIP A;  4OWW B;  1X9N A;  4JI3 Q;  5C3E H;  2MO1 A;  4DV2 L;  3GTM H;  3HOY G;  2D62 A;  4GNX A;  1V9P A;  4BBR H;  3H0G H;  3CPF A;  4LF9 L;  5M3M H;  1C9O A;  2HIX A;  4DK6 C;  5M3M G;  3CCL A;  2V1C C;  1YHB A;  4K0K Q;  4X66 L;  3KDF B;  4BBR G;  1X54 A;  1UE6 A;  2JK8 A;  2ZM6 L;  2EXD A;  3RLN A;  2HT1 A;  3F2C A;  2UXD Q;  3F1Z A;  1VCI A;  2Z6K A;  3E9H A;  1X55 A;  4EQ5 A;  1UE7 A;  2K52 A;  1Y1V H;  3JC6 6;  2ZJP A;  3T1Y Q;  5LMN W;  1EUJ A;  2K14 A;  1NMG A;  1XMQ Q;  1N9W A;  3GTQ H;  1HZA A;  3A5U A;  3I4O A;  1NE3 A;  4B3T L;  4NXM Q;  3PV0 A;  1XNQ Q;  5J3B A;  2QEX A;  3OTO L;  5JJK A;  3UDI A;  2AHO B;  5JEA J;  3S16 H;  1UE1 A;  1VQM A;  3EIV A;  3B6Y A;  1Q8K A;  1LTL A;  2N8N A;  4DV5 Q;  5C0X I;  3STB D;  4MTN A;  3DLL A;  1TWA H;  4DV4 L;  2OQ0 A;  3S17 H;  5IP9 G;  1N34 L;  2WB1 G;  2ALY B;  3UDX A;  3CCU A;  2I0Q A;  2NVT H;  2L15 A;  3NEN A;  4A3E H;  4A75 A;  2BH8 A;  3M3Y H;  1CKN A;  4JI6 L;  2E5L Q;  2CWP A;  3E0E A;  4YWK A;  4QGU A;  4OXP A;  2F4V Q;  4YWL A;  4RMF A;  2I5H A;  4HJ7 A;  1OTC A;  2K5N A;  5C44 H;  2BH2 A;  1HR0 L;  4JV5 Q;  5FJ8 G;  4C2M H;  3U4Z A;  5HGQ A;  2WFW A;  4BBS G;  4GKJ L;  1OXU A;  5JEA G;  5H1S E;  4A3D G;  2JA6 G;  3I2Z A;  1LYL A;  2GN5 A;  1N33 Q;  4A3C H;  2MFI A;  1SLJ A;  3TQY A;  4X65 L;  1GM5 A;  4R4I A;  1EIY B;  5IYD H;  2ID0 A;  1A62 A;  5EAY A;  2GVA A;  4BY1 H;  1K83 H;  2BA0 A;  5DLQ E;  1Q82 C;  1CSP A;  1QVC A;  1I94 Q;  1XPO A;  3CCE A;  5GAG C;  2DGY A;  2PI2 E;  4IPH A;  4LUZ A;  4DV7 L;  4BY7 H;  1SR3 A;  4A3G G;  1KAW A;  4P72 A;  4GOP A;  3PSI A;  3E9I A;  1OXS C;  1VQ9 A;  4BXX H;  3RN2 A;  1LM0 A;  4P74 A;  3BJU A;  3CCS A;  1R9T H;  3M7N A;  1YJW A;  2CWA A;  2B3G A;  3HOV G;  3KJO A;  3TRE A;  4DV1 L;  3TEH B;  1Y1W H;  1G51 A;  4R4Q A;  1EYG A;  3CC2 A;  2VUM G;  4A93 G;  1X65 A;  1P8L A;  3CMA A;  4X64 Q;  3L7Z C;  2YYZ A;  5C0X J;  4DAM A;  1MJC A;  2K5V A;  1UEB A;  4QJF A;  4DUY Q;  3CC4 A;  1QVF A;  1VQK A;  2R6G A;  4A3B H;  4ME3 A;  3PGZ A;  3GDE A;  2UXD L;  1G29 1;  2OTL A;  2VS1 A;  1HNX L;  3PUW A;  3Q8D A;  3AFQ A;  4LF6 L;  1ASZ A;  2AMC B;  1IBL L;  3LGJ A;  4L5Q A;  3L2P A;  4RG1 A;  4JBJ A;  4A3C G;  1XMQ L;  1HH2 P;  1RL2 A;  3RNU A;  2JA6 H;  2N78 A;  4OO1 I;  4UPA A;  4LFC Q;  4DR7 L;  1E7Z A;  3UDG A;  1NMF A;  5FJ8 H;  1W2B A;  2IX1 A;  4HJA A;  5C44 G;  4AYB G;  4MZ9 A;  4LFB L;  3U50 C;  2VZA A;  3G4S A;  5C4X H;  4DNI A;  1EIF A;  1NBW A;  1M90 C;  2K5H A;  1IXR A;  1AE2 A;  4IPC A;  1D8L A;  4UY8 C;  2ASB A;  2CFM A;  1E3P A;  3CXC A;  4AH6 A;  1TWG H;  2HIV A;  4C3J H;  4KLK A;  4JC0 A;  4R4T A;  1UWV A;  3HOX H;  4A3J G;  1XNR Q;  2R7Z H;  4UP9 A;  4GNX B;  3OW2 A;  2B29 A;  4HID A;  5IY0 A;  3F2D A;  4AQY Q;  4BA2 I;  2UXC Q;  1JJC B;  4YHH L;  4PG3 A;  4YWM A;  1EQQ A;  1N36 Q;  1IYJ B;  1PH3 A;  5IWA Q;  2PMZ E;  1E22 A;  2VQE Q;  3AFP A;  1VQO A;  4X65 Q;  1JMC A;  3M85 A;  2NVX H;  1FGU A;  4PZ8 A;  1PH9 A;  4GN5 A;  3KJP A;  4LF5 L;  4IFD J;  1Y1V G;  1K8G A;  4LF4 Q;  1Q7Y C;  3RN5 A;  1HNZ Q;  1I5F A;  3F8T A;  4OWT B;  2Y0S E;  4O2D A;  4X62 L;  3J81 i;  1PH4 A;  1HZ9 A;  3NEL A;  1VQH A;  2YTX A;  4JOI A;  3UE0 A;  1K3R A;  2JA9 A;  1YIJ A;  2HHH L;  5GAD C;  3D0F A;  4DUZ L;  1VQN A;  3S1N H;  2MNA A;  3CCM A;  1JE5 A;  3GTL H;  4QY7 A;  3CF5 A;  3H0G G;  4B3S Q;  1PYB A;  1WFQ A;  4JOI C;  2UXB Q;  4DV4 Q;  3PF4 A;  3PF5 A;  4GN3 B;  2QA4 A;  1TXY A;  1PYS B;  3FHW A;  1VQP A;  2PI2 A;  1Q81 C;  1A0I A;  2OTJ A;  1WCM H;  3M4Q A;  1BVS A;  3KF8 B;  4PZ7 A;  3HKZ G;  4DR3 L;  1YI2 A;  1PH1 A;  1A63 A;  4NXN Q;  4A3K H;  3CP0 A;  5FLX c;  4DV3 L;  4A3F H;  1KD1 C;  2R7Z G;  4IOA A;  2NVY H;  3AQQ A;  1OXV A;  4NPS A;  1IBL Q;  1Q12 A;  2IHF A;  1LUZ A;  4L5T A;  1PA6 A;  1N34 Q;  4O0A A;  1YZ6 A;  3VDY A;  2E2H H;  2UUA L;  1HNW Q;  1B70 B;  1K0R A;  4J15 A;  3G71 A;  1Q1E A;  1WYD A;  5IYC H;  4DV7 Q;  3S14 H;  3HOZ H;  4JYA L;  1KRT A;  2KHJ A;  5JJI A;  3W5O A;  1YBY A;  2R92 H;  2D0O A;  3CQZ H;  1PH8 A;  3S2H H;  1MKH A;  1VQA A;  3TRZ A;  1E1O A;  3CAM A;  3ULL A;  4DR1 Q;  3D31 A;  2R93 H;  2ZTC A;  4JI7 Q;  4IJL A;  4POF A;  4HIM A;  2XTI A;  1VQB A;  2A1A A;  4DR4 L;  2A19 A;  1JJG A;  1XJV A;  1HZB A;  1WOC A;  1PH2 A;  5LMU L;  1MJE A;  4JI0 Q;  1X3G A;  3GTG H;  4XTC S;  2H5X A;  5AJ3 L;  5IE8 A;  1C7Y A;  1QUQ A;  1PHJ A;  3UDF A;  4P71 A;  1KIX A;  4TVA B;  1KRS A;  4IO9 A;  1VQG A;  4QQB X;  3CW2 C;  2B63 H;  1OXT A;  2R7D A;  1TWF H;  4JI8 Q;  1KC8 C;  3JAM i;  1Q46 A;  3HKZ E;  3FKI G;  4IPG A;  1S40 A;  2E2J H;  4LF6 Q;  4NXM L;  4YY3 L;  1B8A A;  5LMN Q;  2C35 B;  1YHA A;  3CPW A;  4UP7 A;  1PH5 A;  2UUC L;  4A4I A;  4EX5 A;  3OTO Q;  4DV2 Q;  2JA7 G;  1HNZ L;  3RZO H;  4A3L G;  2RHS B;  1YNX A;  2YTV A;  5C4J H;  1S3O A;  4GOP B;  4AIM A;  1IZ6 A;  4DV5 L;  4KHP L;  4LFC L;  1I3Q H;  3PUY A;  3AEV A;  1CKO A;  3GTK H;  4B3M Q;  4DR7 Q;  4A3G H;  4BY7 G;  5E7N A;  3T1H Q;  3L0O A;  4LF7 L;  4DUZ Q;  1XPR A;  4JI4 Q;  4JI5 Q;  3KOJ A;  4FDB A; 
#chains in the Genus database with same CATH topology
 1DJR D;  1S72 A;  4AYB E;  3MAQ A;  3PIO A;  2VL6 A;  1BCP B;  5F2D A;  3GTL B;  1S5C D;  3C46 A;  1SXT A;  3HOY B;  4A3B G;  1W6J A;  1PFN A;  4XQJ A;  2K75 A;  5EGT A;  4A3D H;  2Q2H A;  3U58 A;  1LAB A;  1VQ6 A;  1YEZ A;  3WWV A;  3C1F A;  3FP9 A;  4CKB A;  1IBM Q;  3I8Z A;  4GZY C;  2AQ3 B;  3QIA A;  1Y8P B;  2FJ2 A;  5GQO A;  1KAA A;  1YJN A;  4QIW E;  3K8A A;  4MIU A;  5J22 A;  4DV6 L;  3HOU H;  1VQL A;  3MEH A;  2NVQ H;  1PH6 A;  1H9K A;  1K73 C;  1H95 A;  5ELB A;  2QF7 A;  4DR2 Q;  3OWE B;  1F9Q A;  4BBS H;  1BF4 A;  1HJP A;  1I50 H;  4DUY L;  3ND9 A;  1BBX C;  4HIO A;  2DY8 A;  4KHZ A;  5I6Y A;  5LMU Q;  4A76 A;  2A6H D;  1JJ2 A;  1EQR A;  3MXN B;  3K5M A;  1HTL D;  3ZJY C;  5I2Y A;  2QEJ C;  1FVI A;  2KCT A;  2EIF A;  4U68 A;  2WAQ G;  5M5W H;  1HZC A;  2LFN A;  2FHT A;  2KBN A;  1VQ5 A;  2B2Y A;  2JN4 A;  4RH6 A;  4YCW A;  4C3I H;  2LXJ A;  2OT2 A;  4N9P A;  4PMW A;  5IP7 H;  5FLM H;  1U4P A;  2KEE A;  1E2W A;  4B3M L;  4X3K A;  5K36 H;  4P73 A;  2ZXP A;  4APV A;  2KHI A;  2NZO A;  5M5X B;  1HPC A;  3EJI A;  4BA1 I;  3D6W A;  4A3M G;  1XMO Q;  3EVQ A;  2WIN B;  4A3D B;  2K50 A;  2I5M X;  3VR4 A;  4S3S A;  2EYO A;  3TS0 A;  1EU3 A;  2EOT A;  4R4C A;  3K7U C;  3BZK A;  2KCM A;  3K0Y A;  3KF8 A;  4GLX A;  2PYK A;  2JA5 H;  3AB9 A;  1JB7 A;  4B3R L;  1ILQ A;  3PIO 3;  4DR6 Q;  5HGT A;  1S5F D;  1B44 D;  3SVM A;  1MIU A;  4DR5 L;  2UUC Q;  3DEP A;  1O7Y A;  5D3I B;  1K0S A;  3UE1 A;  3PO3 G;  5E1F A;  1F9R A;  3T53 B;  1WD1 A;  2LY7 A;  1VDZ A;  2UXC L;  1VQJ A;  4LNQ A;  3HOX B;  2UXB L;  3DWA A;  3GTJ H;  1HR0 W;  2PPB C;  3D4D A;  2MGS A;  2KOL A;  1C8C A;  4B3T Q;  1BCP D;  4CDE C;  1DOM A;  1DGS A;  2CQO A;  2WP8 J;  2Y0S B;  4QB4 A;  1I6V C;  2F0M A;  4GN4 B;  4WFN 3;  4JBW A;  2RHQ B;  4OHJ A;  1SRO A;  3K5N A;  2LSS A;  2F0T A;  5C0X G;  4A3I B;  3AMU A;  5CV5 A;  4LFA L;  4K8J A;  2AWN A;  4LFB Q;  2CCZ A;  2K5W A;  1Y14 B;  2Q2I A;  2WAC A;  2E2H B;  1KNA A;  1SNO A;  2D0P A;  1EWC A;  1CM9 A;  1CUK A;  3S24 A;  4FF4 A;  1QJO A;  2VUM H;  4DV6 Q;  3GV6 A;  3KUP A;  1CA6 A;  2UUB L;  3C3L A;  3MEF A;  1KTK A;  3A0J A;  2SNS A;  3T16 A;  3TS2 A;  1L2F A;  2RBM A;  2PZT A;  1PVO A;  1SRU A;  5D65 A;  2WKD A;  5JPN C;  5CBA E;  1HXY D;  1U4R A;  3S16 B;  1GVP A;  1XPU A;  3H3V H;  3S15 H;  4NB3 A;  1SMX A;  3ER0 A;  4A3M B;  1B1Z A;  3KBX A;  3CME A;  4P75 A;  5CC4 A;  3K81 C;  4OIK A;  1NJI C;  2K5Q A;  4BBS B;  4G4K A;  1JOO A;  1U0L A;  3AYH B;  3HOZ G;  3WDN A;  2IT1 A;  1CSQ A;  4OEL B;  4HTH A;  1ILP A;  5M9O A;  1LTA D;  3EBE A;  5ELN A;  3J80 i;  4A3K B;  2WAQ E;  2FMM A;  3VYT A;  2KED A;  1JOQ A;  3VR2 A;  4OX9 Q;  2RDG A;  4A3F G;  2CHB D;  2I5L X;  2K03 A;  5CV8 A;  2F0D A;  4JI1 Q;  1QZH A;  1UEA B;  3ERS X;  1XMO L;  5A2Q L;  4C3H G;  3STB C;  2KEC A;  3RLF A;  3BDO A;  4DU9 A;  3J81 E;  1VF7 A;  2EY5 A;  4JPB W;  1NAP A;  3FVQ A;  4OWW B;  1X9N A;  4C56 C;  2MO1 A;  3S1N B;  2D62 A;  1QNU A;  4BBR H;  2KCC A;  5M3M G;  2MHV A;  4K5V A;  1I3Q B;  4J6H A;  3GTK B;  2ZM6 L;  1S4Z A;  1J9O A;  1MI2 A;  1KDA A;  1HTP A;  1PTO F;  2C5C A;  3F1Z A;  1EY8 A;  3H91 A;  3JC6 6;  1KDC A;  1JIC A;  2AUK A;  2BCO A;  3T1Y Q;  5LMN W;  2NBF A;  1EUJ A;  1XMQ Q;  1NMG A;  5C6A A;  3A5U A;  4B3T L;  2B2Y C;  3S17 B;  4NDX A;  1WTR A;  5J3B A;  4FF1 A;  5FO8 B;  5JEA J;  1IKM A;  4I65 A;  1VQM A;  4ZYS A;  3S1M B;  2A6E D;  5C0X I;  5I9P A;  1TWA H;  4DV4 L;  3H3V C;  3S17 H;  4N8F A;  5IP9 G;  1QCB D;  4HN7 A;  4NP5 A;  1N34 L;  1SE3 A;  1ICW A;  4IZ8 A;  2I0Q A;  3GP7 A;  2BH8 A;  3M3Y H;  5I9O A;  4ZK9 B;  2E5L Q;  2CWP A;  3E0E A;  5CGK A;  1WTW A;  1B3A A;  4DK1 A;  2KQ3 A;  2I5H A;  4RMF A;  1AZP A;  4RFB A;  5FJ8 G;  4C2M H;  3U4Z A;  1XX8 A;  5IGD A;  3MXN A;  3LX0 A;  3OW7 A;  3NBI A;  1LYL A;  2GN5 A;  4A3C H;  3MFG A;  3GTM B;  5EAY A;  5C44 B;  4J1M A;  1ZXT A;  3I90 A;  3V96 A;  1XPO A;  5GAG C;  1SSO A;  4LUZ A;  1ZYR D;  4C1N K;  5JVG 3;  1WCM B;  3K58 A;  3WOF A;  2N88 A;  3BVM A;  3BJU A;  4P74 A;  1R9T H;  3ND8 A;  2B3G A;  1LTS D;  3TRE A;  1SYE A;  3NTI A;  3TDQ A;  3CC2 A;  1DXM A;  1X65 A;  4BWG B;  1B2T A;  3L7Z C;  4NKL A;  4DAM A;  5IIF A;  5T1G A;  3CC4 A;  3DUZ A;  1VQK A;  4QUF A;  3D8G A;  3VYR A;  2OTL A;  4FNF A;  1HNX L;  5COY A;  3DXJ C;  1IBL L;  3K7A B;  4RG1 A;  4A3C G;  1HH2 P;  1D6E C;  3OMG A;  1E2V A;  1NMF A;  5FJ8 H;  5JJZ A;  3PQI A;  1TR5 A;  4XXE A;  1ZYR C;  4LFB L;  5E4X A;  2VZA A;  3G4S A;  4B9X A;  1NBW A;  1M90 C;  4RCN A;  1AE2 A;  4IPC A;  2CFM A;  1E3P A;  3H09 A;  4AH6 A;  1TWG H;  3HOU B;  4JC0 A;  1XNR Q;  3OW2 A;  1TQO A;  4AQY Q;  2UXC Q;  1JJC B;  4PG3 A;  3FRP B;  1IYJ B;  1BOS A;  2AQ2 B;  4RGO S;  5ELC A;  2ZXO A;  3RN5 A;  1HNZ Q;  4EQN A;  4X62 L;  3NTH A;  2D9U A;  4K8I A;  1PH4 A;  2QW7 A;  3HS0 C;  3EQL C;  2A69 C;  3K6O A;  1ESR A;  2YTX A;  1YIJ A;  2HHH L;  5GAD C;  2L9H A;  1JE5 A;  3GTL H;  2SNM A;  4B3S Q;  2EYF A;  4DV4 Q;  3TME A;  1TWA B;  2QA4 A;  1TXY A;  1PYS B;  2OTJ A;  1WCM H;  3BG3 A;  1EZ8 A;  3KK7 A;  1IW7 D;  4PZ7 A;  3FKI B;  3J7A F;  1D5X C;  1PH1 A;  1A63 A;  4Q5V A;  4NXN Q;  4A3F H;  1K3B C;  1Q12 A;  5EBD A;  4A93 B;  1LUZ A;  4L5T A;  2SEB D;  1STE A;  3HOV B;  2EYP A;  3SHL A;  5I2X A;  1EIH A;  3G71 A;  1WYD A;  3SK4 A;  3S14 H;  4U67 3;  3HOZ H;  3CQZ B;  4B08 A;  4JYA L;  1CZW A;  2R92 H;  1A3V A;  2D0O A;  1PH8 A;  3S2H H;  2IJ0 A;  1PTO H;  3SE0 A;  3ULL A;  1WTQ A;  4HIM A;  3F2U A;  1VQB A;  2A19 A;  2L5T A;  2EPB A;  1WOC A;  3HZX A;  3GTG H;  1GUO A;  1QUQ A;  1PHJ A;  3UDF A;  2AUJ D;  4P71 A;  4DAP A;  1KIX A;  5IGF A;  3FPP A;  3K5O A;  4QQB X;  3CW2 C;  2B63 H;  1OXT A;  4JI8 Q;  1KC8 C;  3JAM i;  3HKZ E;  1MSH A;  4NXM L;  1RTN A;  4YY3 L;  2F0N A;  1PH5 A;  2JA7 G;  1GUS A;  5M5W B;  4DGZ A;  3S2D B;  1I3Q H;  3AEV A;  3GTK H;  1CKO A;  1O7Z A;  4BY7 G;  4LF7 L;  1RD9 D;  1Q8I A;  1N34 Q;  4JI5 Q;  3KOJ A;  4FYD A;  1IKL A;  3KLW A;  3I7F A;  1EQT A;  4Y7N B;  3H3V I;  4JI6 Q;  1KQS A;  2E5L L;  2ZXR A;  2QGQ A;  3PO2 B;  4QF4 A;  3T1Y L;  3KDF A;  4KN7 C;  4AYB B;  1F9P A;  3DHQ A;  1DOK A;  2NN6 G;  4A3L H;  2NVQ B;  3GTP H;  4XQN A;  4XT1 B;  4DR3 Q;  1A8V A;  4L8J A;  1TWC B;  1SYC A;  2KHS A;  3CRL C;  2F0V A;  1QVG A;  1O7I A;  2B63 B;  3QOL A;  4IUR A;  4ZQ3 A;  1EU4 A;  4A3J B;  1YNN C;  4LF4 L;  3S9W A;  2N3S A;  3A7L A;  3C1E A;  3VR3 A;  3PO3 H;  1B4O A;  3UI2 A;  2ATW A;  4KI0 A;  3SXH A;  2HHH Q;  4ABN A;  1JR0 D;  5J1Z A;  1L0X B;  1L1O B;  4B3S L;  3K57 A;  4DR1 L;  5I6W A;  3R8B A;  4KD3 A;  1X56 A;  1Z7T A;  3HFZ B;  4RA8 A;  1XTD A;  4KHV A;  4ZCK A;  4XIG S;  1IHZ A;  3M9B A;  3VA5 A;  4IUU A;  3ZYY X;  2EJG C;  2ZT9 C;  1P16 A;  4X6A H;  1AW7 A;  5IP9 H;  1SN8 A;  2I46 A;  3GTJ B;  1K8A C;  2HCC A;  2JA8 B;  5C3E G;  1VQ8 A;  1BBW A;  4L63 B;  4A3F B;  1FJG L;  5K36 G;  2WV6 D;  3NE5 B;  1DZ1 A;  5IP7 G;  4LUO A;  3OMC A;  1PZK D;  2JA8 H;  3IAY A;  4GKJ Q;  2F52 A;  2HUG A;  2WB1 B;  1STB A;  1SFO B;  1JE4 A;  2O4X A;  4AQY L;  2SOB A;  1PH7 A;  5CV7 A;  3QR8 A;  1SNP A;  3BZC A;  1YNN D;  5LL6 S;  3NSW A;  1G6P A;  4LF5 Q;  1JCK B;  4JI3 L;  1N8R C;  1IBM L;  1AE3 A;  2VQF L;  1SJE D;  4HJ5 A;  5M3F H;  2VW9 A;  1U5K A;  4TKO B;  4JBM A;  3CD6 A;  4HR7 B;  4IUT A;  3HOU G;  2F03 A;  2E8G A;  4KHP Q;  1FL0 A;  1LV9 A;  1UNS A;  4MHE A;  2YTY A;  3PCO B;  5C4X G;  3M4P A;  4RGM A;  2YV5 A;  1GD7 A;  4DR2 L;  1RJT A;  3CCQ A;  1O80 A;  1XNQ L;  1XNR L;  4X62 Q;  4DK0 A;  3PUX A;  1N32 Q;  1WI5 A;  2L1B A;  2XWB B;  2ZJR A;  3CU7 A;  3FPU B;  4NXN L;  4R1J A;  1K9M C;  5BN5 A;  2OWO A;  1KLU D;  1QUQ B;  1Z47 A;  4XT3 B;  4Q0F A;  1YHQ A;  4DK3 C;  2EVB A;  4IN3 A;  1GHK A;  5M5X H;  4WJ4 A;  4KK7 A;  3PIP 3;  4JCV E;  1H9M A;  3IRB A;  2BOS A;  4JV5 L;  5ELD A;  4UP8 A;  2Q2T A;  3CCJ A;  4JYA Q;  1VQ4 A;  2F4I A;  2HQL A;  4J8Q A;  3BU2 A;  1N36 L;  3S1Q B;  2Q2U A;  3PUZ A;  1DON A;  3NBH B;  2RSN A;  2FIN B;  4OWX B;  2IWH A;  1D7Q A;  4TQU S;  1LTI D;  2F3I A;  1JT8 A;  4BY1 G;  1J5E L;  4H13 C;  3KLS X;  3GTQ B;  5BN3 A;  1LT3 D;  1STY A;  2FMC A;  3PO2 H;  5IYD G;  2OCE A;  2H1E A;  4POG A;  1OO9 B;  4Y7N H;  2PW7 A;  2V4D A;  5EPL A;  4DR6 L;  3K7A H;  1H9J A;  3NQT A;  3I55 A;  2Z6B A;  1GKH A;  1QG7 A;  2EQS A;  1X3E A;  4A3E G;  1L0W A;  5C3E B;  1G6Z A;  2QKI C;  1STA A;  1TWH H;  1FR3 A;  1EOT A;  1Y8N B;  4DV3 Q;  1SNQ A;  5IGE A;  2EYM A;  5EBC A;  2RDH A;  1BUV T;  1CKM A;  1U4L A;  1UE5 A;  3A74 A;  3NEM A;  3SEB A;  2K05 A;  4LF7 Q;  2M9V A;  3NP8 A;  2JEB I;  1CT1 D;  2EYJ A;  3MFY A;  2CVR A;  1M1K C;  2WII B;  4JI3 Q;  2R92 B;  5JPM C;  2D5D A;  3J81 L;  3GTM H;  3H0G H;  2TMP A;  3R3O A;  1NR2 A;  2HIX A;  2V1C C;  1X54 A;  2HT1 A;  3MXU A;  2UXD Q;  3P20 A;  3H0G B;  3RZO B;  3E9H A;  1X55 A;  4KJN A;  4EQ5 A;  1FYC A;  4JK1 C;  1PFB A;  1BQQ T;  1D5Z C;  2K14 A;  1EFI D;  2K04 A;  1N9W A;  5KEE A;  1XNQ Q;  1NE3 A;  1SYD A;  4C3I G;  5JJK A;  2BE5 C;  1SYB A;  1UE1 A;  1CQF A;  1SE4 A;  3EIV A;  4C3J B;  1LTL A;  2N8N A;  4DV5 Q;  4O1N A;  4JVZ A;  1DOL A;  3DLL A;  3I70 A;  4R9W A;  1LTR D;  3NHH A;  3UDX A;  3CCU A;  1I4R A;  3NEN A;  5JAV A;  4A75 A;  1CKN A;  4TRD A;  1MGS A;  3DWP A;  1EY4 A;  4YWK A;  3I72 A;  4OXP A;  1B9M A;  1K28 A;  1RF2 D;  1F2Z A;  1OTC A;  2BH2 A;  5HGQ A;  1A3U A;  4BBS G;  5JEA G;  5H1S E;  2JA6 G;  1SLJ A;  4RKB A;  1A62 A;  2BA0 A;  1WD0 A;  5K5P A;  1BXT A;  1QVC A;  1I94 Q;  1WTO A;  2K1B A;  4DV7 L;  4IUN A;  1SR3 A;  1Y1W B;  1VQ9 A;  3PSI A;  3E9I A;  2PNR C;  3MA2 B;  3RN2 A;  3TN2 A;  1RHP A;  3BZD B;  2RVL A;  5CV9 A;  1WVL A;  4M8A A;  1STN A;  1Y1W H;  3E0J A;  1EYG A;  4A93 G;  2F3V A;  1XWE A;  4OGQ C;  2DNE A;  5ELF A;  4BXX G;  5C0X J;  4FF2 A;  1UEB A;  1GJX A;  2VUM B;  5ISR A;  4I7A A;  4A3B H;  4ME3 A;  1XTC D;  2QIL A;  1LO5 D;  2R3Z A;  1LLR D;  2VS1 A;  5A35 A;  4LF6 L;  1ASZ A;  5C4Z A;  3LGJ A;  4L5Q A;  3GTO B;  3L2P A;  1XMQ L;  4OO1 I;  3RNU A;  4UPA A;  4DR7 L;  3H6M A;  2GA4 B;  2A6E C;  3UDG A;  4HJA A;  4IUP A;  4AYB G;  4MZ9 A;  3M3Y B;  4CJ0 B;  3SK6 A;  2PO4 A;  5AFW A;  1EIF A;  3LWU A;  3EFX D;  4DXG A;  1PTO D;  1AN8 A;  2WKC A;  1ZKO A;  1E0B A;  1V1P B;  4R4T A;  4C3J H;  3HOX H;  4A3J G;  4QCL A;  4UP9 A;  4HID A;  1DCZ A;  2LKV A;  4YHH L;  1EQQ A;  1N36 Q;  3CRK C;  1PH3 A;  4CJ2 C;  4G7H C;  1GOZ A;  1FNW A;  4HED A;  4X65 Q;  1PH9 A;  3KJP A;  1EY0 A;  1Y1V G;  2JA5 B;  5LL6 X;  1M4V A;  2PMZ B;  3TP7 A;  1HHV A;  3NEL A;  1DD2 A;  3D4R A;  3UE0 A;  4BBR B;  4B9W A;  3S1N H;  4DUZ L;  4DF7 A;  1VQN A;  2Z8L A;  1CZG A;  1Q90 A;  4QY7 A;  3CF5 A;  1WFQ A;  3N6R A;  3PF5 A;  1SJH D;  2MUY A;  1ENF A;  1I4P A;  3VR6 A;  1A0I A;  1SAP A;  4ID6 A;  3M4Q A;  1BVS A;  4BY7 B;  3IKJ A;  4A3K H;  3CP0 A;  5FLX c;  4DV3 L;  1KD1 C;  3NBH A;  2NVY H;  3AQQ A;  3HRZ C;  3P75 A;  1IBL Q;  4HCS A;  5KND A;  2IHF A;  4ZKB B;  4DXF A;  1YZ6 A;  4ULL A;  2PZU A;  3GTP B;  3FEW X;  4HAE A;  1HRJ A;  2K32 A;  1B70 B;  1HNW Q;  3X3N A;  3R2I A;  5CYU A;  2KHJ A;  1KRT A;  3HOW B;  3W5O A;  3KBG A;  2K33 A;  4A3E B;  2JYO A;  4XQQ A;  4OL7 A;  1E1O A;  2R93 H;  2NVT B;  4CDC C;  2ZTC A;  2RDF A;  4JI7 Q;  3D3R A;  4DR4 L;  2XTI A;  3R2T A;  2A1A A;  1R4P B;  1BO0 A;  1CFM A;  3DWQ A;  3HG9 A;  5FLX L;  1PH2 A;  4JI0 Q;  5AJ3 L;  1ONL A;  2PQE A;  4MTK A;  4FXD A;  4F88 A;  1KRS A;  4IO9 A;  1VQG A;  2XRS D;  2R7D A;  1Q46 A;  3FKI G;  1DYQ A;  1S40 A;  2YU9 B;  4LF6 Q;  1TT2 A;  2C35 B;  1YHA A;  3CPW A;  4IFD H;  4DV2 Q;  4EX5 A;  3TZD A;  1HNZ L;  3L9A X;  2YTV A;  5C4J H;  1S3O A;  2EZV A;  5KRU A;  1IZ6 A;  1V1O A;  1I4X A;  1NR4 A;  2G5D A;  4HMI A;  1HUN A;  5E7N A;  2X6G A;  1KDB A;  3T1H Q;  4FDB A;  5M3M B;  4CGY B;  1IBK Q;  4R4O A;  4GOP C;  2JSO A;  2NB0 A;  3KLR A;  2XRQ D;  1PFM A;  1EIG A;  5EJW A;  4F7X A;  3HOW H;  2K28 A;  1S5D D;  3A55 A;  3I4N H;  3VR5 A;  2K4K A;  2BA1 A;  4LW1 A;  4KV6 A;  4IUV A;  2RA4 A;  1PYW D;  5E3F A;  3BYT B;  5JEA H;  3M4O H;  5CMD A;  5JVH 3;  1SFO H;  4IFD G;  3HOV H;  1O7L A;  1VQC A;  3BVG A;  1E1T A;  2VB3 X;  1ASY A;  3M4Y A;  1B7Y B;  3QJY A;  4N9T A;  4JBK A;  4H0L C;  5BR8 Q;  4K5W A;  4IPD A;  1VMP A;  4DAY B;  4GKK L;  5JOB A;  1JB3 A;  5IOD A;  3OSO A;  5HY6 A;  3U4V A;  2R93 G;  4K0K L;  2DNC A;  5C4X B;  1V1P A;  1TS3 A;  4JI2 L;  4A3I H;  4NMZ A;  3E3X A;  3J80 c;  3I4L A;  1EZ6 A;  3I4M H;  2G9D A;  4WJW A;  3BDC A;  5I4D A;  1HNX Q;  1I4Q A;  3KF6 A;  3G7L A;  3T51 B;  5GAH C;  2AWO A;  3A7A B;  3X3M A;  4A3K G;  5BN4 A;  3CCR A;  2Z9H A;  4ZRZ A;  1I94 L;  2SDF A;  3J7Y W;  3A54 A;  1ML0 D;  1FNU A;  1V43 A;  4K6L A;  1WTH A;  2F3W A;  5ELE A;  1A3T A;  4KN4 C;  2UUB Q;  4F87 A;  4JI4 L;  4JI5 L;  3OOC A;  2Y0S G;  4JW0 A;  3EN2 A;  2B8G A;  2PW5 A;  2CH4 W;  3AU7 A;  4L5S A;  2NN6 I;  3G48 A;  1PDQ A;  4IQZ A;  4YCU A;  1D1K A;  1PV4 A;  2F0F A;  3I73 A;  2KJX A;  2LMC B;  4FXG C;  3H15 A;  1XXG A;  3CCV A;  5D3D A;  2HQE A;  4PQX A;  3I56 A;  3A5Z B;  1U9R A;  1QNK A;  5IYB H;  2E76 C;  3RLO A;  2EY1 A;  2FXQ A;  4KJO A;  3V05 A;  3BS1 A;  4IJH A;  1HUM A;  4LF9 Q;  3S2D H;  3PO3 B;  1EOV A;  3PO2 G;  4X66 Q;  1VQD A;  4ALP A;  5EQ0 A;  3HOX G;  4A3J H;  4C3J G;  3BDL A;  4X64 L;  1X3Q A;  4ZLT F;  2EJM A;  2RKS A;  4UHV A;  1TWG B;  1VS0 A;  1BBU A;  1LT5 D;  1TWC H;  3PUV A;  5DM6 3;  2Z4H A;  2F0P A;  4GLA C;  1KXL A;  5ELO A;  1X3F A;  3VYS A;  4JI1 L;  3KYH C;  4ME5 A;  1Z9F A;  4LJZ C;  4IFD I;  5LHY 1;  2R93 B;  2NYZ D;  3D4W A;  2EY2 A;  3RD4 A;  1I50 B;  3U9S A;  3J81 c;  1QWY A;  4L5R C;  1NNX A;  2F1M A;  3IFD A;  1EWH A;  2DUD A;  1FJG Q;  2L12 A;  1HR0 Q;  5BR8 L;  4HJ9 A;  2A74 C;  1HCZ A;  4MNO A;  4A93 H;  1CA5 A;  1Y1W G;  1VMC A;  2G9H D;  4P2C B;  3JAM c;  2NVY B;  1S5E D;  5CV4 A;  4PNY A;  4WJ3 M;  3SGI A;  1O78 A;  3CKI B;  3MTS A;  3J81 j;  2JEA I;  4JI0 L;  5J39 A;  4JI2 Q;  4H02 A;  1BCP C;  1LT4 D;  2JA7 B;  5C4H A;  4GNX C;  1GO3 E;  1HNW L;  3QG1 A;  1EFW A;  1G8Z D;  2LXK A;  2XVS A;  1VQ7 A;  3I4M B;  4JI8 L;  1PRT F;  2E75 C;  2F0L A;  4KY7 A;  4YY3 Q;  1BNZ A;  1CKN B;  4B3R Q;  5M3F G;  2F0I A;  4EQP A;  1A2T A;  1PFS A;  2F0H A;  4DR5 Q;  1BDO A;  4BS9 A;  3H94 A;  2N55 A;  3J7Z C;  1I4H A;  5IYC G;  2C9O A;  1K8M A;  1S5B D;  2PZW A;  3NUC A;  1QZG A;  3K0X A;  4EGV A;  1L1O A;  1NY4 A;  1RIP A;  3DM1 A;  1X32 A;  1Q86 C;  1W3S A;  1U4M A;  1LTG D;  1R4Q B;  1BCP F;  2JE6 I;  1LAC A;  1NCV A;  1AH9 A;  2JJQ A;  1ENA A;  2JA8 G;  3S1M H;  1N32 L;  2DY7 A;  3KF6 B;  5EPK A;  3TSS A;  3T1H L;  4Y52 H;  3HKS A;  4KY5 A;  3S1R H;  2QCP X;  5C3E H;  4DV2 L;  3HOY G;  1V9P A;  2OF1 A;  4LF9 L;  3HGB A;  3M7G A;  3NTK A;  4DAV A;  3KDF B;  2A5H A;  4X3T A;  1UE6 A;  2JK8 A;  1SND A;  3F2C A;  2DJG C;  4CDD C;  1VCI A;  1UE7 A;  2K52 A;  3MXP A;  1EYD A;  3QB3 A;  3IL8 A;  2ZJP A;  4H7B A;  2L55 A;  3GTQ H;  1HZA A;  5DNF A;  4KKS A;  3PV0 A;  4R8N A;  3A8K E;  4OO1 H;  2EXZ A;  1VF5 C;  1EYA A;  1PRT C;  2OXP A;  4KY6 A;  4MTN A;  3Q23 A;  2OQ0 A;  3FDT A;  2ALY B;  1IL8 A;  4DN4 M;  2F0J A;  4A3E H;  4KMU C;  1AP0 A;  1A2U A;  4PV1 C;  4YWL A;  4HJ7 A;  2HDL A;  5C44 H;  4JV5 Q;  4CKE A;  1ZEQ X;  1II3 A;  4GKJ L;  1GHJ A;  1OXU A;  3W2D A;  1W6K A;  1F77 A;  3LWE A;  1H9S A;  2MFI A;  5FK9 C;  3TQY A;  1EIY B;  4CHT B;  4R4I A;  5IYD H;  2GVA A;  3VA7 A;  4BY1 H;  5DLQ E;  4PMC A;  4DNR B;  3NQI A;  1LT6 D;  3MC0 B;  1AZQ A;  2XSC A;  3CCE A;  2DGY A;  2ICI A;  1PXU A;  4BY7 H;  1KAW A;  4GOP A;  1SYF A;  1LM0 A;  2H4O A;  3CCS A;  1R9T B;  3M7N A;  1D5M C;  1YJW A;  1ROD A;  2Q8T A;  4DV1 L;  3TEH B;  4R4Q A;  4RAU C;  3P7J A;  1P8L A;  3CMA A;  2YYZ A;  3ERO A;  3DMU A;  4OEM B;  4ZUJ A;  1QVF A;  3URY A;  1CHP D;  5TSS A;  3PGZ A;  3GDE A;  2CW0 C;  2F0S A;  1G29 1;  1IW7 C;  3PUW A;  1CHQ D;  2B2W A;  2Q8R E;  2KVM A;  4K2L A;  4RKL A;  4JBJ A;  1GUW A;  1RL2 A;  1JC7 A;  3A8J E;  4LFC Q;  1FD7 D;  3MHB A;  4O42 A;  2CQA A;  3MWY W;  2BE5 D;  5C44 G;  4KD4 A;  2BDN A;  3U50 C;  3IFT A;  5C4X H;  4V0B A;  4DNI A;  5FOB B;  4UY8 C;  2IPK D;  2K5H A;  1SNM A;  1D8L A;  2ASB A;  3J80 L;  3CXC A;  2HIV A;  2NWG A;  4NW2 A;  1UWV A;  1I6H B;  4GNX B;  2B29 A;  4XYO A;  1H9R A;  4R8I A;  2RSO A;  2K5D A;  2Z1C A;  4YWM A;  3J7A V;  1K83 B;  1Y1V B;  1E22 A;  2VQE Q;  4WOR A;  3AFP A;  1TY2 A;  2NVX H;  3M85 A;  1FGU A;  4GN5 A;  4IFD J;  1Q7Y C;  4CJ1 B;  3F8T A;  3J81 i;  3TP6 A;  1HFG A;  4JOI A;  1VQH A;  3I4N B;  1HFN A;  3CCM A;  5DM7 3;  3PF4 A;  2B2U A;  1VQP A;  1Q81 C;  5C4J B;  2VB2 X;  2L4N A;  2F0K A;  3HKZ G;  4DR3 L;  4IOA A;  4NPS A;  1MD2 D;  2O2L D;  5A2Q E;  1PA6 A;  4O0A A;  2E2H H;  2K7V A;  3OIP A;  4DNT B;  1TKW B;  5IYC H;  3U9O A;  5COR A;  4DV7 Q;  1TU2 B;  1EL0 A;  1KNE A;  1YBY A;  3CQZ H;  4DA2 A;  5C3X A;  1RTO A;  2A73 B;  1JWM D;  3DEO A;  3GQB A;  3MZ5 A;  1JJG A;  4A3G B;  1XJV A;  5LMU L;  2EYH A;  1D1I A;  1X3G A;  3HKZ B;  4XTC S;  2B2W C;  5IE8 A;  2NTS A;  1KLG D;  2M2L A;  5EKI A;  3SDZ A;  4TVA B;  2IX3 A;  1TII D;  3E6Z X;  5IGC A;  2E2J H;  4IPG A;  2L0C A;  5LMN Q;  4RWS C;  2UUC L;  2MJ8 A;  2NN6 H;  4A3L G;  3E5S A;  2RHS B;  1YNX A;  4KTA A;  1F9S A;  4DV5 L;  3QOJ A;  1ESF A;  4DR7 Q;  3PUY A;  2A69 D;  1EQV A;  4B3M Q;  1HQM C;  3HP3 A;  3L0O A;  4DUZ Q;  3RZD H;  2EDG A;  2E2D C;  2F0O A;  2NZH A;  2IHE A;  4Z9C B;  4HSP A;  4DV0 L;  1JQY D;  2AQ1 B;  1SDF A;  4PZ6 A;  2N49 A;  2B8F A;  4K2K A;  1AFP A;  3RZD B;  4OX9 L;  2JA7 H;  3O13 A;  2UU9 L;  4LFA Q;  5T1I A;  4YHH Q;  2B63 G;  5IT9 c;  1UAP A;  1T5E A;  3J80 E;  1EWI A;  5IT9 E;  1WTV A;  4L6T B;  5M5Y B;  1TS5 A;  1VQE A;  3ERQ A;  1TWH B;  3W3A A;  4ZKC B;  1WJJ A;  5C5M A;  2E74 C;  1EY6 A;  1SE2 A;  2RCN A;  1GUN A;  1OXX K;  4K14 A;  3ULJ A;  1GUT A;  1B3Q A;  3M4O B;  4FF3 A;  4KKT A;  2ZTD A;  2R92 G;  2ZTE A;  3NPP A;  4H44 C;  5G3L F;  1N33 L;  1VQF A;  2EYL A;  1EEF D;  4PMB A;  5G3L D;  2DJF C;  5IYB G;  2D2C C;  4LUV A;  5IOC A;  2PQA A;  2VY3 A;  5FKA C;  2ES2 A;  1JOK A;  1Q1B A;  2IY5 B;  3ICE A;  2Z6K C;  1B53 A;  2X6L A;  2IX0 A;  2R7F A;  4OON A;  1BR9 A;  1A6X A;  1PMR A;  3F2B A;  1IL2 A;  2PNH A;  1RKN A;  3OPO A;  3GV3 A;  3V2T A;  3MVV A;  1J6Q A;  3MXG A;  2YU9 H;  3OWF A;  4RCO A;  2CH4 A;  4OO1 G;  1D2B A;  1WCM G;  2F0G A;  2XNA C;  2WB1 E;  4CKC A;  4E6I A;  2KUM A;  4YCV A;  5C3W A;  2F4V L;  4C3H H;  5GRO A;  1YIT A;  3OYY A;  1B50 A;  4LMQ D;  4DKA C;  3J7A 5;  4LF8 Q;  2ICE C;  4DV1 Q;  1CTM A;  1PZI D;  2M00 A;  3Q22 A;  2MQH A;  5GAE C;  4JI7 L;  4DR4 Q;  3HOY H;  1CK1 A;  1J5E Q;  1L1O C;  3I4M G;  4FXK C;  1YVC A;  4DPG A;  2HD3 A;  2E2I H;  4A3I G;  2RF4 A;  4K5X A;  1NSN S;  4RHS A;  3W1G A;  3GO5 A;  1PZJ D;  4RHR A;  1SEB D;  1DM0 B;  2CW0 D;  4C3H B;  3RR5 A;  4GKK Q;  5E4W C;  1KL9 A;  1EY9 A;  2XGT A;  4HCE A;  4KKU A;  2F0U A;  1I6H H;  2OQK A;  4ZAI A;  1JOR A;  1M8A A;  5D14 A;  1TS4 A;  1PTO C;  2NZ1 D;  4IUQ A;  3JAM L;  4HIK A;  3ULP A;  2A6H C;  2QDB A;  4TSS A;  1E24 A;  3SK5 A;  1JWS D;  1PTO B;  4HJ8 A;  2JXM B;  1BKB A;  5IWA L;  1C0A A;  2GVB A;  2VQE L;  1V1Q A;  5KGU A;  1J8I A;  5KYI A;  3I4N G;  3S14 B;  2UU9 Q;  5EKL A;  1KHI A;  1MSG A;  3HOW G;  3OHX C;  1NTG A;  3VYU A;  1QIL A;  4UAI A;  4N8X 1;  1K8O A;  1Z6H A;  2XIW A;  3A8I E;  3TZU A;  2F0E A;  3G6J B;  2VNU D;  1FNV A;  2ZM6 Q;  1PRT D;  2B2T C;  2B2T A;  1H9S B;  1LTB D;  3LNN A;  5M5Y H;  3K80 C;  1RCV D;  3FKI H;  2F0Q A;  1SE8 A;  4ZUI A;  2CKZ B;  3CC7 A;  1B9N A;  3A56 A;  4JG2 A;  5AJ3 Q;  2ZJQ A;  1X6O A;  3G6E A;  2B39 A;  1MHW C;  5FO7 B;  5C5L A;  3W1B A;  5KIX A;  2MO0 A;  3P1H A;  3CHB D;  5LMN L;  4BY1 B;  2VQF Q;  4RGN A;  2FFK B;  2DN8 A;  1A15 A;  3FMC A;  4K6D A;  3GTO H;  1CI3 M;  5KYL A;  2JA5 G;  1TVX A;  4FP5 D;  2KEN A;  5FLX E;  4LAA A;  2OEO A;  2UUA Q;  3DM3 A;  4DAY A;  3QO2 A;  2TSS A;  4LWC A;  4ILW A;  1IBK L;  1T5X D;  4GS3 A;  2JP1 A;  2NTT A;  1VQI A;  4UDU C;  4DV0 Q;  1G2T A;  4GLV B;  1CQV A;  2E2J B;  1AEX A;  3GD7 A;  3KFU A;  4A3M H;  2PQA B;  1HA5 A;  2AKW B;  4LF8 L;  4CDF C;  3OIQ A;  2R7Z B;  4HSV A;  3RMH A;  2A8V A;  2KA7 A;  5JJL A;  1YJ9 A;  4QUC A;  5FLM G;  4IOC A;  1STG A;  3S1Q H;  1UUP A;  4QL5 A;  1X3P A;  4G7O C;  2BDO A;  2JQO A;  2Z0S A;  1T9H A;  4LK1 C;  3PIP A;  3T56 B;  1C48 A;  1QB5 D;  4GNX A;  2O5I C;  3CPF A;  5M3M H;  3N52 A;  1C9O A;  4DK6 C;  3CCL A;  1G91 A;  1EY5 A;  1Y8O B;  1YHB A;  2MP1 A;  4K0K Q;  4X66 L;  4BBR G;  1YNJ D;  2EXD A;  3RLN A;  2MPM A;  2Z6K A;  2J7Z A;  1Y1V H;  2PCF B;  3I4O A;  4NXM Q;  1F2L A;  2KCN A;  3OTO L;  2QEX A;  3UDI A;  2AHO B;  3S16 H;  4RGT A;  2J4X A;  1PLF A;  3B6Y A;  1Q8K A;  3STB D;  4I7Z C;  3SK8 A;  2ENB A;  3TP5 A;  2WB1 G;  2L11 A;  2NVT H;  3TBI B;  2L15 A;  3S2H B;  3BVZ A;  3T13 A;  1GUG A;  4JI6 L;  5CV6 A;  2F4V Q;  4QGU A;  3HOZ B;  2P5Z X;  4QIW B;  1LTT D;  2K5N A;  2JA6 B;  1HR0 L;  2I07 B;  1ET6 A;  5CR3 A;  5M3F B;  2WFW A;  4A3D G;  1YNJ C;  3NK9 A;  1MBY A;  3I2Z A;  1N33 Q;  4X65 L;  1GM5 A;  2NVX B;  1JWU D;  2ID0 A;  5EPJ A;  2B2U C;  3D6C A;  1K83 H;  1Q82 C;  3S1R B;  1CSP A;  5IT9 L;  3SR1 A;  2B2V A;  4IPH A;  2PI2 E;  2K01 A;  2HDM A;  1WTP A;  4A3G G;  4P72 A;  1SNC A;  1OXS C;  4WRD A;  4BXX H;  2QDL A;  2CWA A;  3NXW A;  3HOV G;  3KJO A;  1WTX A;  2VUM G;  1G51 A;  3ONA B;  5DAU A;  4FVM A;  4CBV A;  4X64 Q;  1TY0 A;  2EE1 A;  4DUY Q;  1MJC A;  2K5V A;  1SYG A;  4QJF A;  4X3S A;  4FO2 A;  4C3I B;  2XWJ B;  2R6G A;  2R61 A;  1IYV A;  2UXD L;  2Q8I B;  4G57 A;  2EY6 A;  3Q8D A;  3AFQ A;  2RCF A;  2AMC B;  5FO9 B;  5C0X H;  1Q3L A;  2JA6 H;  2N78 A;  1EY7 A;  4A3B B;  1E7Z A;  3Q24 A;  5IGG A;  1W2B A;  3C2P A;  2IX1 A;  1F2M A;  1SMY C;  5EKK A;  2K6A A;  2HCI A;  1G2S A;  2LS0 1;  3WOE A;  3L3O C;  1ICF B;  1IXR A;  4M1U B;  3KLS A;  4KLK A;  2R7Z H;  3PMF A;  3K5L A;  5IY0 A;  4QMG A;  3F2D A;  1E2Z A;  4BA2 I;  5NUC A;  1XYI A;  1C4Q A;  1SBB B;  3I91 A;  4HMJ A;  5IWA Q;  2PMZ E;  4XYQ A;  1VQO A;  1JMC A;  4LF5 L;  2VXW A;  4PZ8 A;  2Z4I A;  4C1N I;  1K8G A;  4LF4 Q;  2RQX A;  3T4A C;  4EQO A;  1ET9 A;  1I5F A;  4OWT B;  2Y0S E;  4O2D A;  3Q0A A;  1HZ9 A;  1TS2 A;  1K3R A;  1V8Q A;  2JA9 A;  3D0F A;  2B2V C;  4F8M A;  5DEH A;  2MNA A;  1SMY D;  4IAL A;  1STH A;  3R93 A;  3H0G G;  1QE6 A;  1PYB A;  4JOI C;  5IGB A;  5KNB A;  5CBE E;  2UXB Q;  3S15 B;  1QOH A;  1ENC A;  1EEI D;  4GN3 B;  3FHW A;  2PI2 A;  4DFA A;  1EYC A;  3HEJ A;  3KF8 B;  3JAM E;  1YI2 A;  2R7Z G;  2O5J C;  3EA6 A;  1OXV A;  2NUC A;  4ODG A;  1KAB A;  1IYU A;  3I3C A;  3GTG B;  3VDY A;  2A68 C;  3BYY B;  4MN3 A;  2UUA L;  1HQR D;  4C2M B;  1K0R A;  5HUR A;  4J15 A;  1Q1E A;  2A68 D;  5JJI A;  2XN9 C;  4EVO A;  2WAQ B;  2F0W A;  3NWT A;  1MKH A;  1VQA A;  3TRZ A;  4DR1 Q;  3CAM A;  3D31 A;  4IJL A;  4POF A;  5L37 A;  2IW3 A;  1Y69 U;  1HZB A;  1MJE A;  1PRT B;  4G7Z C;  2H5X A;  1GXD C;  1C7Y A;  3TP8 A;  4OIJ A;  2J0T D;  4YIJ A;  1TWF B;  3NWS A;  5KNC A;  1TWF H;  2IL8 A;  1NUC A;  3ITP A;  1B8A A;  3Q6S A;  2X69 A;  4UP7 A;  3K59 A;  4A4I A;  1I4G A;  3OTO Q;  1FGB D;  4V19 0;  3RZO H;  3QWN A;  1F2Y A;  3RUZ A;  4GOP B;  4AIM A;  4KHP L;  4LFC L;  2EJF C;  1HA6 A;  4A3G H;  4X3U A;  1L0Y B;  4XDX A;  1XPR A;  4JI4 Q;  1RDP D;  2E2I B; 
#chains in the Genus database with same CATH homology
 1S72 A;  3KLW A;  4AYB E;  2NZH A;  3I7F A;  4R4O A;  4GOP C;  2IHE A;  3PIO A;  1IBK Q;  2VL6 A;  3H3V I;  4DV0 L;  4JI6 Q;  1KQS A;  2E5L L;  3HOW H;  2QGQ A;  4A3B G;  4PZ6 A;  3I4N H;  3T1Y L;  2N49 A;  2K75 A;  3KDF A;  2K4K A;  2BA1 A;  4LW1 A;  4A3D H;  2Q2H A;  4OX9 L;  3M4O H;  2JA7 H;  2NN6 G;  4A3L H;  1SFO H;  4IFD G;  3GTP H;  3U58 A;  3HOV H;  1VQ6 A;  1YEZ A;  1VQC A;  4DR3 Q;  3WWV A;  1A8V A;  4LFA Q;  2UU9 L;  4YHH Q;  2B63 G;  1E1T A;  3FP9 A;  1IBM Q;  5IT9 c;  1ASY A;  1B7Y B;  1EWI A;  1QVG A;  4JBK A;  1O7I A;  1VQE A;  1WJJ A;  5GQO A;  4IPD A;  5BR8 Q;  4DAY B;  4LF4 L;  1YJN A;  4QIW E;  4GKK L;  3K8A A;  2N3S A;  4DV6 L;  2RCN A;  5HY6 A;  3U4V A;  3HOU H;  3PO3 H;  1OXX K;  1VQL A;  2ATW A;  2NVQ H;  3ULJ A;  1PH6 A;  2R93 G;  4KI0 A;  1K73 C;  4K0K L;  1H95 A;  2HHH Q;  2ZTD A;  2R92 G;  2ZTE A;  1N33 L;  4DR2 Q;  1VQF A;  1L1O B;  4B3S L;  4BBS H;  4JI2 L;  4DR1 L;  1HJP A;  1I50 H;  5IYB G;  4DUY L;  4A3I H;  4HIO A;  1X56 A;  4LUV A;  3HFZ B;  2PQA A;  2VY3 A;  2ES2 A;  1XTD A;  4KHZ A;  3J80 c;  3I4M H;  5LMU Q;  4A76 A;  1Q1B A;  4XIG S;  2IY5 B;  1JJ2 A;  1EQR A;  3MXN B;  3M9B A;  3ICE A;  2Z6K C;  1HNX Q;  3ZJY C;  2IX0 A;  2R7F A;  4OON A;  1P16 A;  3KF6 A;  1FVI A;  2KCT A;  3F2B A;  1IL2 A;  4X6A H;  2PNH A;  2EIF A;  5IP9 H;  2WAQ G;  2AWO A;  5GAH C;  1SN8 A;  5M5W H;  1HZC A;  4A3K G;  2KBN A;  1K8A C;  3CCR A;  1VQ5 A;  5C3E G;  1VQ8 A;  1J6Q A;  2YU9 H;  1BBW A;  1I94 L;  4YCW A;  4C3I H;  4OO1 G;  1FJG L;  5K36 G;  2LXJ A;  1WCM G;  1V43 A;  2WB1 E;  4PMW A;  5IP7 H;  5FLM H;  4YCV A;  2F4V L;  4B3M L;  5IP7 G;  4C3H H;  4LUO A;  5GRO A;  1YIT A;  2UUB Q;  4JI4 L;  4JI5 L;  3OYY A;  2JA8 H;  4P73 A;  2Y0S G;  4APV A;  4DKA C;  4GKJ Q;  2F52 A;  3J7A 5;  2KHI A;  4LF8 Q;  2NZO A;  3EN2 A;  4DV1 Q;  4BA1 I;  4A3M G;  4BXX G;  1XMO Q;  4L5S A;  2NN6 I;  4AQY L;  2MQH A;  5GAE C;  3G48 A;  2K50 A;  2I5M X;  4JI7 L;  1PH7 A;  4DR4 Q;  4YCU A;  3TS0 A;  1PV4 A;  3HOY H;  3RZD H;  1J5E Q;  4R4C A;  3K7U C;  3BZK A;  3BZC A;  1L1O C;  2KCM A;  3H15 A;  3CCV A;  4GLX A;  1YVC A;  3I4M G;  4LF5 Q;  1G6P A;  1N8R C;  4JI3 L;  3A5Z B;  4DPG A;  3I56 A;  1IBM L;  2E2I H;  2JA5 H;  1AE3 A;  5IYB H;  2RF4 A;  4A3I G;  1JB7 A;  2VQF L;  4HJ5 A;  3RLO A;  4B3R L;  2FXQ A;  5M3F H;  3W1G A;  4IJH A;  4LF9 Q;  3S2D H;  3GO5 A;  4DR6 Q;  2VW9 A;  1EOV A;  1U5K A;  4JBM A;  1MIU A;  4DR5 L;  3CD6 A;  2UUC Q;  3PO2 G;  4X66 Q;  1VQD A;  3RR5 A;  4ALP A;  4GKK Q;  3UE1 A;  3HOX G;  4A3J H;  3PO3 G;  1KL9 A;  3HOU G;  4X64 L;  2E8G A;  2XGT A;  2UXC L;  4KHP Q;  1FL0 A;  1VQJ A;  4LNQ A;  1I6H H;  2UXB L;  2OQK A;  2YTY A;  3PCO B;  5C4X G;  1VS0 A;  3M4P A;  1BBU A;  1TWC H;  2YV5 A;  1GD7 A;  3PUV A;  3GTJ H;  3CCQ A;  4DR2 L;  1HR0 W;  4B3T Q;  1XNQ L;  4GLA C;  1KXL A;  4HIK A;  3ULP A;  1XNR L;  1DGS A;  5ELO A;  1X3F A;  2CQO A;  2WP8 J;  4JI1 L;  3KYH C;  1Z9F A;  4X62 Q;  1E24 A;  3PUX A;  1N32 Q;  1WI5 A;  4GN4 B;  4IFD I;  2ZJR A;  4NXN L;  4JBW A;  2RHQ B;  4R1J A;  1K9M C;  4HJ8 A;  1SRO A;  2OWO A;  1BKB A;  5IWA L;  1C0A A;  2GVB A;  2VQE L;  1V1Q A;  2LSS A;  5C0X G;  1QUQ B;  1Z47 A;  3I4N G;  1YHQ A;  2UU9 Q;  4DK3 C;  4LFA L;  4LFB Q;  2AWN A;  1KHI A;  3J81 c;  5M5X H;  2CCZ A;  4L5R C;  3HOW G;  1NTG A;  4WJ4 A;  1Y14 B;  2Q2I A;  4JCV E;  3IRB A;  2D0P A;  2DUD A;  1FJG Q;  1HR0 Q;  4JV5 L;  5BR8 L;  4HJ9 A;  1CUK A;  4UP8 A;  3S24 A;  2Q2T A;  2VNU D;  4MNO A;  4A93 H;  3CCJ A;  1Y1W G;  2VUM H;  4JYA Q;  2ZM6 Q;  4DV6 Q;  1VQ4 A;  3JAM c;  2UUB L;  3MEF A;  3A0J A;  2HQL A;  5M5Y H;  1L2F A;  3BU2 A;  3SGI A;  1N36 L;  3TS2 A;  3K80 C;  4WJ3 M;  3FKI H;  1SE8 A;  3J81 j;  2Q2U A;  2JEA I;  2CKZ B;  3PUZ A;  1PVO A;  3NBH B;  4JI0 L;  1SRU A;  4OWX B;  3CC7 A;  4JI2 Q;  4H02 A;  4JG2 A;  5AJ3 Q;  2ZJQ A;  1D7Q A;  1GVP A;  1X6O A;  4TQU S;  2F3I A;  1JT8 A;  4GNX C;  3G6E A;  1GO3 E;  1XPU A;  1EFW A;  3H3V H;  3W1B A;  4BY1 G;  1J5E L;  3S15 H;  4NB3 A;  1HNW L;  2LXK A;  1SMX A;  1VQ7 A;  3ER0 A;  4JI8 L;  3CME A;  3PO2 H;  2MO0 A;  2OCE A;  4P75 A;  3K81 C;  5IYD G;  4YY3 Q;  5LMN L;  4POG A;  1CKN B;  1NJI C;  2VQF Q;  4Y7N H;  4B3R Q;  5M3F G;  1U0L A;  3AYH B;  4DR6 L;  1PFS A;  3GTO H;  3K7A H;  2JA5 G;  2KEN A;  4DR5 Q;  3HOZ G;  3J7Z C;  3I55 A;  2UUA Q;  3DM3 A;  2IT1 A;  5IYC G;  1CSQ A;  4LWC A;  1GKH A;  1IBK L;  2EQS A;  4GS3 A;  1X3E A;  4A3E G;  1QZG A;  3K0X A;  1VQI A;  4DV0 Q;  1L1O A;  3EBE A;  4GLV B;  1NY4 A;  1RIP A;  1L0W A;  5ELN A;  1TWH H;  3GD7 A;  3J80 i;  3KFU A;  4A3M H;  2PQA B;  2WAQ E;  2AKW B;  4DV3 Q;  1Q86 C;  1W3S A;  4LF8 L;  4OX9 Q;  4A3F G;  2I5L X;  2JE6 I;  1AH9 A;  4JI1 Q;  1QZH A;  3ERS X;  2JJQ A;  2JA8 G;  3S1M H;  1XMO L;  1CKM A;  2A8V A;  1N32 L;  5JJL A;  3KF6 B;  1UE5 A;  1YJ9 A;  3A74 A;  3NEM A;  3STB C;  3RLF A;  5FLM G;  4IOC A;  3T1H L;  4LF7 Q;  3S1Q H;  3HKS A;  4Y52 H;  2JEB I;  4QL5 A;  2JQO A;  2Z0S A;  1M1K C;  3S1R H;  1T9H A;  3PIP A;  4OWW B;  1X9N A;  4JI3 Q;  5C3E H;  2MO1 A;  4DV2 L;  3GTM H;  3HOY G;  2D62 A;  4GNX A;  1V9P A;  4BBR H;  3H0G H;  3CPF A;  4LF9 L;  5M3M H;  1C9O A;  2HIX A;  4DK6 C;  5M3M G;  3CCL A;  2V1C C;  1YHB A;  4K0K Q;  4X66 L;  3KDF B;  4BBR G;  1X54 A;  1UE6 A;  2JK8 A;  2ZM6 L;  2EXD A;  3RLN A;  2HT1 A;  3F2C A;  2UXD Q;  3F1Z A;  1VCI A;  2Z6K A;  3E9H A;  1X55 A;  4EQ5 A;  1UE7 A;  2K52 A;  1Y1V H;  3JC6 6;  2ZJP A;  3T1Y Q;  5LMN W;  1EUJ A;  2K14 A;  1NMG A;  1XMQ Q;  1N9W A;  3GTQ H;  1HZA A;  3A5U A;  3I4O A;  1NE3 A;  4B3T L;  4NXM Q;  3PV0 A;  1XNQ Q;  5J3B A;  2QEX A;  3OTO L;  5JJK A;  3UDI A;  2AHO B;  5JEA J;  3S16 H;  1UE1 A;  1VQM A;  3EIV A;  3B6Y A;  1Q8K A;  1LTL A;  2N8N A;  4DV5 Q;  5C0X I;  3STB D;  4MTN A;  3DLL A;  1TWA H;  4DV4 L;  2OQ0 A;  3S17 H;  5IP9 G;  1N34 L;  2WB1 G;  2ALY B;  3UDX A;  3CCU A;  2I0Q A;  2NVT H;  2L15 A;  3NEN A;  4A3E H;  4A75 A;  2BH8 A;  3M3Y H;  1CKN A;  4JI6 L;  2E5L Q;  2CWP A;  3E0E A;  4YWK A;  4QGU A;  4OXP A;  2F4V Q;  4YWL A;  4RMF A;  2I5H A;  4HJ7 A;  1OTC A;  2K5N A;  5C44 H;  2BH2 A;  1HR0 L;  4JV5 Q;  5FJ8 G;  4C2M H;  3U4Z A;  5HGQ A;  2WFW A;  4BBS G;  4GKJ L;  1OXU A;  5JEA G;  5H1S E;  4A3D G;  2JA6 G;  3I2Z A;  1LYL A;  2GN5 A;  1N33 Q;  4A3C H;  2MFI A;  1SLJ A;  3TQY A;  4X65 L;  1GM5 A;  4R4I A;  1EIY B;  5IYD H;  2ID0 A;  1A62 A;  5EAY A;  2GVA A;  4BY1 H;  1K83 H;  2BA0 A;  5DLQ E;  1Q82 C;  1CSP A;  1QVC A;  1I94 Q;  1XPO A;  3CCE A;  5GAG C;  2DGY A;  2PI2 E;  4IPH A;  4LUZ A;  4DV7 L;  4BY7 H;  1SR3 A;  4A3G G;  1KAW A;  4P72 A;  4GOP A;  3PSI A;  3E9I A;  1OXS C;  1VQ9 A;  4BXX H;  3RN2 A;  1LM0 A;  4P74 A;  3BJU A;  3CCS A;  1R9T H;  3M7N A;  1YJW A;  2CWA A;  2B3G A;  3HOV G;  3KJO A;  3TRE A;  4DV1 L;  3TEH B;  1Y1W H;  1G51 A;  4R4Q A;  1EYG A;  3CC2 A;  2VUM G;  4A93 G;  1X65 A;  1P8L A;  3CMA A;  4X64 Q;  3L7Z C;  2YYZ A;  5C0X J;  4DAM A;  1MJC A;  2K5V A;  1UEB A;  4QJF A;  4DUY Q;  3CC4 A;  1QVF A;  1VQK A;  2R6G A;  4A3B H;  4ME3 A;  3PGZ A;  3GDE A;  2UXD L;  1G29 1;  2OTL A;  2VS1 A;  1HNX L;  3PUW A;  3Q8D A;  3AFQ A;  4LF6 L;  1ASZ A;  2AMC B;  1IBL L;  3LGJ A;  4L5Q A;  3L2P A;  4RG1 A;  4JBJ A;  4A3C G;  1XMQ L;  1HH2 P;  1RL2 A;  3RNU A;  2JA6 H;  2N78 A;  4OO1 I;  4UPA A;  4LFC Q;  4DR7 L;  1E7Z A;  3UDG A;  1NMF A;  5FJ8 H;  1W2B A;  2IX1 A;  4HJA A;  5C44 G;  4AYB G;  4MZ9 A;  4LFB L;  3U50 C;  2VZA A;  3G4S A;  5C4X H;  4DNI A;  1EIF A;  1NBW A;  1M90 C;  2K5H A;  1IXR A;  1AE2 A;  4IPC A;  1D8L A;  4UY8 C;  2ASB A;  2CFM A;  1E3P A;  3CXC A;  4AH6 A;  1TWG H;  2HIV A;  4C3J H;  4KLK A;  4JC0 A;  4R4T A;  1UWV A;  3HOX H;  4A3J G;  1XNR Q;  2R7Z H;  4UP9 A;  4GNX B;  3OW2 A;  2B29 A;  4HID A;  5IY0 A;  3F2D A;  4AQY Q;  4BA2 I;  2UXC Q;  1JJC B;  4YHH L;  4PG3 A;  4YWM A;  1EQQ A;  1N36 Q;  1IYJ B;  1PH3 A;  5IWA Q;  2PMZ E;  1E22 A;  2VQE Q;  3AFP A;  1VQO A;  4X65 Q;  1JMC A;  3M85 A;  2NVX H;  1FGU A;  4PZ8 A;  1PH9 A;  4GN5 A;  3KJP A;  4LF5 L;  4IFD J;  1Y1V G;  1K8G A;  4LF4 Q;  1Q7Y C;  3RN5 A;  1HNZ Q;  1I5F A;  3F8T A;  4OWT B;  2Y0S E;  4O2D A;  4X62 L;  3J81 i;  1PH4 A;  1HZ9 A;  3NEL A;  1VQH A;  2YTX A;  4JOI A;  3UE0 A;  1K3R A;  2JA9 A;  1YIJ A;  2HHH L;  5GAD C;  3D0F A;  4DUZ L;  1VQN A;  3S1N H;  2MNA A;  3CCM A;  1JE5 A;  3GTL H;  4QY7 A;  3CF5 A;  3H0G G;  4B3S Q;  1PYB A;  1WFQ A;  4JOI C;  2UXB Q;  4DV4 Q;  3PF4 A;  3PF5 A;  4GN3 B;  2QA4 A;  1TXY A;  1PYS B;  3FHW A;  1VQP A;  2PI2 A;  1Q81 C;  1A0I A;  2OTJ A;  1WCM H;  3M4Q A;  1BVS A;  3KF8 B;  4PZ7 A;  3HKZ G;  4DR3 L;  1YI2 A;  1PH1 A;  1A63 A;  4NXN Q;  4A3K H;  3CP0 A;  5FLX c;  4DV3 L;  4A3F H;  1KD1 C;  2R7Z G;  4IOA A;  2NVY H;  3AQQ A;  1OXV A;  4NPS A;  1IBL Q;  1Q12 A;  2IHF A;  1LUZ A;  4L5T A;  1PA6 A;  1N34 Q;  4O0A A;  1YZ6 A;  3VDY A;  2E2H H;  2UUA L;  1HNW Q;  1B70 B;  1K0R A;  4J15 A;  3G71 A;  1Q1E A;  1WYD A;  5IYC H;  4DV7 Q;  3S14 H;  3HOZ H;  4JYA L;  1KRT A;  2KHJ A;  5JJI A;  3W5O A;  1YBY A;  2R92 H;  2D0O A;  3CQZ H;  1PH8 A;  3S2H H;  1MKH A;  1VQA A;  3TRZ A;  1E1O A;  3CAM A;  3ULL A;  4DR1 Q;  3D31 A;  2R93 H;  2ZTC A;  4JI7 Q;  4IJL A;  4POF A;  4HIM A;  2XTI A;  1VQB A;  2A1A A;  4DR4 L;  2A19 A;  1JJG A;  1XJV A;  1HZB A;  1WOC A;  1PH2 A;  5LMU L;  1MJE A;  4JI0 Q;  1X3G A;  3GTG H;  4XTC S;  2H5X A;  5AJ3 L;  5IE8 A;  1C7Y A;  1QUQ A;  1PHJ A;  3UDF A;  4P71 A;  1KIX A;  4TVA B;  1KRS A;  4IO9 A;  1VQG A;  4QQB X;  3CW2 C;  2B63 H;  1OXT A;  2R7D A;  1TWF H;  4JI8 Q;  1KC8 C;  3JAM i;  1Q46 A;  3HKZ E;  3FKI G;  4IPG A;  1S40 A;  2E2J H;  4LF6 Q;  4NXM L;  4YY3 L;  1B8A A;  5LMN Q;  2C35 B;  1YHA A;  3CPW A;  4UP7 A;  1PH5 A;  2UUC L;  4A4I A;  4EX5 A;  3OTO Q;  4DV2 Q;  2JA7 G;  1HNZ L;  3RZO H;  4A3L G;  2RHS B;  1YNX A;  2YTV A;  5C4J H;  1S3O A;  4GOP B;  4AIM A;  1IZ6 A;  4DV5 L;  4KHP L;  4LFC L;  1I3Q H;  3PUY A;  3AEV A;  1CKO A;  3GTK H;  4B3M Q;  4DR7 Q;  4A3G H;  4BY7 G;  5E7N A;  3T1H Q;  3L0O A;  4LF7 L;  4DUZ Q;  1XPR A;  4JI4 Q;  4JI5 Q;  3KOJ A;  4FDB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...