1TWCH

Rna polymerase ii complexed with gtp
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 21
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2004-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1twcH00
2IHFA 3L7ZC 2CQOA 3U50C 1PV4A 2CFMA 2VY3A 2VL6A 3E9HA 2CCZA 2V1CC 4GLVB 4A3JG 2MO1A 1I6HH 5ELOA 2RCNA 4A3FH 4L5QA 3AYHB 1K9MC 4QY7A 4HJ9A 4OO1I 2VS1A 1C0AA 1EIFA 1YHAA 4APVA 2OWOA 4GN4B 5IY0A 3A0JA 3J81j 2ZTCA 1T9HA 2YV5A 3K81C 3OTOL 2VQFL 2Z0SA 4X62L 2NZHA 1JJ2A 1BVSA 2N49A 1YJWA 1M90C 1XPUA 5C3EH 1MIUA 2Q2HA 1IYJB 1AE2A 3FKIH 3MXNB 4DV5Q 1VQNA 4DR6Q 3PO3H 5HY6A 2R92H 2JEAI 4DV4L 4X64L 1XMQL 4IOAA 2F4VQ 1UE6A 2I5LX 4JI3Q 1N34Q 1QUQB 1EOVA 5LMUQ 2A8VA 2JK8A 1TWGH 2HQLA 2Y0SG 3K0XA 3CPWA 4A3MG 1S72A 1E22A 4JI7L 4TQUS 2YTVA 1EFWA 1IBMQ 4LFCL 1HNZL 3ICEA 1I3QH 4IPGA 3CP0A 1L1OA 4EX5A 3F2BA 5GAHC 5M3FH 2UU9Q 4DK3C 2HHHL 4BBRH 5C0XI 2UUAL 2NZOA 1E3PA 4ALPA 2UUCQ 1J6QA 1UWVA 1HR0W 4TVAB 3RN5A 4P71A 4O2DA 5IYDH 4BXXG 4OWXB 3I4MH 4AH6A 1PH2A 4A93H 3HOYH 2CWPA 1KC8C 1L0WA 3E9IA 4QJFA 1KXLA 1WI5A 3LGJA 2QA4A 2BH8A 3OYYA 5IWAL 4DV3Q 1VQJA 1K8GA 4AQYL 1HNXL 1HZBA 4YCUA 3D0FA 1YNXA 1ASZA 4PZ6A 4DV2Q 1XPOA 3S1QH 4HJ5A 2IX0A 1EQQA 4B3TL 3HOWG 3UDFA 1H95A 4X65Q 4O0AA 2AWNA 2NN6I 1AH9A 5M3MG 3K8AA 2K5NA 1LM0A 4JCVE 4QGUA 3U4ZA 1EWIA 3HKSA 4P75A 1QVGA 1N32L 1TWAH 4OWTB 1HR0L 1Q12A 1EIYB 4LF7L 4A4IA 4A3IG 4OX9Q 1FJGL 1XNQQ 4JV5L 1UE1A 4B3SL 4JI4L 2R7FA 1AE3A 4LFAL 1A62A 1KAWA 3M9BA 1HZ9A 4DUZQ 1FGUA 1K73C 2VUMG 2WP8J 2JA6H 3I4NG 4WJ4A 5IP9H 3RR5A 2ZJQA 3K7UC 4DV6Q 3PUZA 3HOVG 1N36L 2RHSB 4BY1H 2R7DA 4C3HH 4GOPC 4KHZA 1YJNA 1A63A 1B70B 2ZM6L 4NXML 4YY3Q 4BBSH 2K50A 2MQHA 2MNAA 3AFPA 3EBEA 3A5UA 2JA8H 2Z6KC 4XTCS 5JEAJ 3GDEA 4DV1L 5AJ3L 1EYGA 4B3RQ 2LSSA 3JAMc 2L15A 1EUJA 3HOZG 1R9TH 4KHPQ 3S2DH 1GM5A 5JEAG 3CCLA 4GNXB 2R7ZH 1OXVA 4JOIA 4JI1L 2VNUD 3GTMH 2N78A 5FLMG 2B63H 2PI2A 3RLNA 3CCMA 3T1HL 1XNRQ 2F3IA 3G4SA 1OXSC 1TWFH 1VQCA 2YTYA 1MKHA 1WCMH 1GD7A 4HJAA 3TRZA 1IBKL 1SR3A 3OW2A 4JI6L 2KBNA 2LXKA 5C4XH 3W1BA 4KHPL 3I55A 3JAMi 4A3LG 2KHJA 3TS0A 2QEXA 4DUYL 2UXDL 4J15A 4MZ9A 1CSQA 5GROA 5IYBH 4Y52H 5IP7H 4BA1I 2EIFA 2N3SA 1X65A 3GD7A 4KI0A 3CCJA 4A3EG 5J3BA 2VQEQ 3STBC 3NEMA 2YTXA 4LF9Q 4C3IH 3HOXH 1KRTA 1X9NA 4DV0Q 1SMXA 1YHQA 4LUVA 3PF4A 4BY7H 2UUBL 3CC4A 4A3DH 4A3GH 3BZKA 2A19A 2NVXH 1SRUA 2GVAA 3H0GH 1S3OA 3K7AH 3A74A 2VQEL 1YBYA 4JI8Q 1PH8A 3UDIA 3CCUA 4A3KG 1HZAA 1U5KA 2KCMA 2E5LL 1JB7A 4DV0L 1VQ8A 1VQBA 2R93H 4IPDA 3S1RH 2OQ0A 2Y0SE 4MTNA 1K0RA 4NB3A 3CMAA 4DR3Q 1XMOQ 1Y1WG 1I94Q 4A3JH 2HT1A 1E7ZA 3ULPA 1PHJA 2XTIA 3GTLH 1PH3A 2HIXA 4JBJA 4HIOA 4L5SA 4DR4Q 4JOIC 3KDFB 3KJOA 3STBD 2OTLA 2RF4A 2R6GA 1PFSA 1L1OB 1SLJA 2PMZE 3IRBA 1MJCA 4GKKQ 4QL5A 3KFUA 1NY4A 4UP9A 2PQAA 5FJ8G 4LFBQ 1VS0A 1V9PA 1VQDA 4P73A 4UP7A 5GAEC 4LF4Q 3DM3A 4IFDI 2IY5B 1RL2A 2K5VA 1X3FA 1Q1BA 2AWOA 1MJEA 3G71A 1JJGA 4DV5L 4DR6L 1VQPA 4YWMA 2E2JH 4AIMA 3CW2C 2E2IH 1FVIA 1N33Q 1OXUA 4IO9A 4A3MH 1Q46A 3KF6B 4JI3L 4POGA 2F4VL 1N34L 5JJLA 4HJ8A 3HKZG 4WJ3M 5LMUL 3S14H 4GKJQ 1Q81C 4A3CG 1IBML 1GKHA 3KF8B 1VQ9A 4MNOA 3F2CA 4GOPA 2UU9L 4R1JA 1KRSA 4OWWB 4IJHA 1B7YB 1UEBA 2AKWB 2C35B 2ZJPA 3T1YQ 2UUCL 4BXXH 1CKMA 2Z6KA 4BA2I 1VQIA 2KENA 1NJIC 3W1GA 4IOCA 3S1NH 5C4JH 2B29A 1YHBA 3HFZB 1Q1EA 4DNIA 1X55A 1KQSA 4PZ7A 4UP8A 1UE7A 2KHIA 1SFOH 3E0EA 4DV3L 4LF5Q 3HOWH 3PCOB 4DV2L 2D0OA 2K75A 1N9WA 1X56A 3HOUG 4DR7Q 5M3MH 3RZOH 4R4QA 5ELNA 1JE5A 2UXBQ 4K0KQ 1GVPA 4X65L 4C3JH 3S1MH 4DV7Q 2ZTEA 4LW1A 1JMCA 1VQ6A 1P8LA 1IBLQ 1Z47A 3KLWA 3RLOA 1QVFA 4A3IH 4OONA 3EIVA 3PIOA 1S40A 2UXBL 4FDBA 4NXNQ 3TS2A 4OX9L 1XNQL 3TEHB 2VZAA 3UDXA 3H15A 3UDGA 1NBWA 4GLXA 1X6OA 3WWVA 1IZ6A 3TREA 2MFIA 4YHHQ 1J5EQ 3GTOH 4DR5Q 5JJKA 2VUMH 3I4NH 5IE8A 1A0IA 1SROA 4NXNL 1YIJA 4DUZL 1NMFA 3CCEA 4JYAQ 2NVQH 3HOVH 4POFA 1KIXA 3ZJYC 1IL2A 1WOCA 1Z9FA 3JC66 5BR8Q 4DV6L 3GTJH 5IYCG 1J5EL 1PA6A 3PSIA 4JBKA 4JI0Q 2LXJA 4HIDA 4PG3A 3NENA 3J80c 4YY3L 1VQLA 2JA7G 1B8AA 1TWCH 1TXYA 1PYSB 1XJVA 1KHIA 5LMNQ 3NBHB 2EXDA 1LUZA 2YYZA 1YZ6A 3F8TA 3CCVA 4OO1G 4DR2Q 3HOZH 1Y14B 2H5XA 2ID0A 3M4OH 4B3RL 2IT1A 1K8AC 2E8GA 5FLMH 3FP9A 2I0QA 1YJ9A 4JI5Q 4JG2A 2DUDA 4Y7NH 1A8VA 3AQQA 3RZDH 3J80i 4JI2Q 4LWCA 3MEFA 4LF8Q 1XNRL 3M4PA 3PUXA 2UXCQ 4IPCA 2ATWA 3ER0A 2BA0A 1LYLA 1VQAA 5DLQE 3FHWA 4UY8C 3PO2G 4A3LH 4AYBG 4JI5L 5C44G 3F1ZA 2XGTA 5H1SE 1VQMA 3VDYA 3KOJA 2JA5G 5HGQA 1Y1VG 4A3BG 1YEZA 4A3EH 5C0XJ 4XIGS 2UXCL 4HIKA 2FXQA 3EN2A 1HJPA 4DKAC 1V1QA 4LF9L 4X6AH 3I2ZA 3CMEA 3J81c 4X66Q 3GTGH 2Q2TA 5C0XG 2PQAB 1HH2P 5FLXc 2JA9A 2IHEA 4DR1Q 4HJ7A 1G51A 1FL0A 1HNWQ 4GS3A 4LUOA 4A3KH 3UE1A 3GTQH 3CAMA 2WB1G 4HIMA 2DGYA 4JI8L 4ME3A 1L2FA 1K83H 1PH4A 4GLAC 1IXRA 3Q8DA 1DGSA 2GVBA 3CC7A 2WAQG 1Y1WH 3S17H 3HKZE 3J81i 1EQRA 2NVTH 1XMOL 4DR3L 1HZCA 1C9OA 2OCEA 4A3FG 1I94L 3M3YH 5GAGC 2ES2A 1OXXK 3OTOQ 4B3MQ 2VQFQ 4X62Q 1QZGA 4DR4L 1X3GA 3BZCA 3CXCA 3W5OA 2NN6G 4LNQA 2ZJRA 2K14A 3U4VA 4EQ5A 1VCIA 4A75A 4GOPB 2JQOA 5FJ8H 4GKKL 1E1TA 4UPAA 4R4OA 2B63G 5C3EG 1CKNA 1E1OA 2HIVA 3FKIG 4OXPA 3G48A 1M1KC 5GQOA 4YWLA 4B3ML 4LFBL 1VQGA 4LF4L 3PO3G 4DV4Q 2CKZB 4X64Q 1XMQQ 2R92G 4DAMA 3RLFA 3G6EA 3PV0A 2JE6I 4DK6C 1JJCB 4JI7Q 3BJUA 2CWAA 1NE3A 4NPSA 3CPFA 1XPRA 1W3SA 1HNZQ 1D8LA 1P16A 1SE8A 4LFCQ 4KLKA 3PIPA 2BH2A 2IX1A 5JJIA 1N33L 2HHHQ 4A3CH 2UUAQ 1Q82C 5M3FG 4GKJL 4YCVA 2D62A 2B3GA 2N8NA 3ULLA 4BBRG 1C7YA 4GNXC 2ASBA 3KDFA 5K36G 3J7A5 1NTGA 4GN5A 1KD1C 5IYDG 1PH1A 1G6PA 3I4MG 4JBWA 3GO5A 3RN2A 4A93G 3HOYG 3T1YL 3L2PA 3M7NA 1VQFA 5IT9c 5IWAQ 3A5ZB 1HNXQ 4AQYQ 1UE5A 3PF5A 3M4QA 1QUQA 4RMFA 3F2DA 1I50H 3CF5A 3KJPA 4A3GG 4B3TQ 3GTPH 3ERSX 3L0OA 3CCSA 1YITA 3S15H 3K80C 1QZHA 1D7QA 2PNHA 4R4IA 2WFWA 3RNUA 3HOUH 2EQSA 4LF5L 3D31A 3KF6A 1BKBA 3PGZA 1QVCA 1N8RC 1N32Q 3GTKH 3BU2A 4JBMA 1PH5A 1HR0Q 4DR7L 1OXTA 2QGQA 1VQOA 2F52A 2RHQB 1FJGQ 4LF7Q 4K0KL 4DAYB 3J7ZC 3PUWA 4DV7L 1X54A 4JV5Q 2Q2IA 1V43A 4B3SQ 1PH7A 4JI4Q 4LFAQ 2K4KA 3PUYA 1IBLL 4LUZA 2A1AA 4L5TA 4LF6Q 3U58A 4H02A 2K5HA 4JC0A 4YCWA 1CUKA 5LMNW 1PH9A 3B6YA 2AHOB 1JT8A 3CCQA 2ALYB 4YWKA 1BBWA 1VQKA 2JA6G 1N36Q 1VQHA 5IP9G 4YHHL 2YU9H 1Q7YC 1L1OC 2D0PA 4DR5L 4LF6L 3CC2A 1NMGA 2E2HH 2OTJA 2ZM6Q 4NXMQ 1PYBA 4BY1G 3TQYA 4AYBE 5GADC 3H3VH 4JYAL 3KYHC 1O7IA 4GN3B 5IYCH 1E24A 2JEBI 5BR8L 2BA1A 4BBSG 4DPGA 1YVCA 1WYDA 4DV1Q 1SN8A 1WJJA 5AJ3Q 2JA7H 1U0LA 2JA8G 1Q86C 5E7NA 4JI0L 2PI2E 1K3RA 4L5RC 1YI2A 1I5FA 2Q2UA 3PUVA 1CSPA 4P74A 4IFDJ 4JI1Q 5LMNL 5EAYA 2K52A 3M85A 3T1HQ 2R7ZG 4DR2L 1XTDA 1TWHH 2KCTA 5M5YH 3NELA 4P72A 4QIWE 1KL9A 4PZ8A 3CCRA 1VQ5A 1BBUA 2GN5A 2I5MX 2WB1E 3AFQA 4PMWA 1IBKQ 5M5XH 2VW9A 4JI6Q 4IFDG 1WCMG 1VQ4A 3SGIA 2ZTDA 2UXDQ 2JJQA 1X3EA 2WAQE 3CQZH 3ULJA 4DUYQ 3I7FA 4JI2L 4A76A 1RIPA 3PO2H 3S2HH 5C4XG 4LF8L 4R4TA 5C44H 3UE0A 2AMCB 5IYBG 2JA5H 5IP7G 1Y1VH 4A3BH 2OQKA 1VQ7A 4IJLA 4IPHA 1GO3E 1ASYA 1W2BA 4C2MH 2UUBQ 3HOXG 3DLLA 1WFQA 3S16H 2NVYH 4BY7G 4RG1A 3S24A 4GNXA 4A3DG 1PVOA 1LTLA 3H0GG 1CKNB 4R4CA 2MO0A 1G291 4X66L 1PH6A 2E5LQ 3I4OA 1Q8KA 1VQEA 3CD6A 4QQBX 1OTCA 1CKOA 3AEVA 4DR1L 3H3VI 5M5WH 2I5HA 1HNWL 2R93G 3I56A
chains in the Genus database with same CATH superfamily
3TZUA 4CKCA 2CQOA 1SYDA 1PV4A 2CFMA 2MO1A 1V1PA 5ELOA 4BS9A 2B8FA 4A3FH 4L5QA 3CRLC 1K9MC 4QY7A 4OO1I 1C0AA 1YNNC 3I4LA 4CDEC 1SFOB 3OTOL 3K81C 1BUVT 2VQFL 1M90C 1SNCA 4OHJA 3RZOB 5C3EH 5IODA 2F0PA 2G9DA 3GTPB 2RVLA 4DR6Q 3S15B 5EJWA 4DU9A 1SNOA 3ND8A 1XMQL 5NUCA 2QCPX 4JI3Q 1PMRA 1QUQB 1EOVA 2XN9C 4A3MG 2D5DA 3CPWA 2YTVA 1IBMQ 4LFCL 1HNZL 3OIQA 2RSNA 2HHHL 4I7ZC 2UUAL 2NZOA 5K36H 2FINB 3L9AX 1UUPA 3RN5A 4P71A 4O2DA 5IYDH 4IUTA 3I4MH 4AH6A 4A93H 2AUKA 2CWPA 4FO2A 1PLFA 2MP1A 2E74C 1DJRD 3C2PA 5IWAL 1PRTF 1YNXA 3DM1A 1XPOA 5CV6A 2NVTB 1VMPA 3A8KE 2EJGC 2NN6I 2A6EC 2B8GA 3KF8A 2K5NA 1LM0A 4Y7NB 1EWIA 3TDQA 4Q5VA 4OWTB 1TWHB 4LF7L 2KVMA 4A4IA 4OX9Q 2KEEA 4JI4L 2AUJD 2KECA 1R4PB 1KAWA 3PO2B 2DN8A 1D5MC 1WTRA 1K73C 1QCBD 2WP8J 1Y1VB 4IUVA 5DAUA 5IP9H 2IWHA 2F0OA 4KKTA 2VB3X 4XYQA 4C3HH 1A63A 1B70B 4HAEA 4NXML 3GTQB 2K50A 3HZXA 4XTCS 5JEAJ 1O7YA 1KLUD 4LJZC 1EYGA 4B3RQ 3FMCA 4KHPQ 4C56C 1KNAA 5JEAG 1NR2A 1F2MA 2VNUD 3GTMH 5FLMG 3BDOA 2B63H 2AQ3B 3T1HL 3S9WA 2F3IA 3ITPA 1C48A 1LTSD 2KJXA 1GD7A 5FO9B 3OW2A 2KBNA 2LXKA 3W1BA 1TQOA 4DUYL 4MZ9A 4K2KA 4Y52H 1V1PB 4BA1I 4KI0A 3FKIB 3CRKC 1LTTD 2YTXA 4U68A 4LAAA 4C3IH 2QDBA 2MPMA 1T5EA 1BCPD 1YHQA 3QOLA 3PF4A 3SR1A 4MHEA 1TWGB 3E6ZX 5TSSA 1FD7D 4S3SA 1YBYA 4JI8Q 1QWYA 1KAAA 1JB7A 3BG3A 4IPDA 2Y0SE 1SXTA 3CMAA 4A3JH 1E7ZA 1QNUA 1PHJA 3EFXD 3A55A 1PH3A 2HIXA 4DR4Q 4F88A 3KDFB 5COYA 1NNXA 3STBD 1PFSA 3MC0B 1SLJA 2PMZE 3IRBA 4MN3A 5CBEE 1MD2D 4GKKQ 4TRDA 3W3AA 4P73A 1V9PA 2KUMA 1EU3A 5GAEC 4IFDI 3GTKB 3BZDB 1BR9A 1JJGA 2CH4A 3A7AB 4YWMA 1IW7C 3E0JA 3CW2C 3FRPB 3A8IE 4RCNA 4IO9A 1Q46A 3KF6B 1N34L 1J9OA 4WJ3M 5LMUL 1TKWB 1CHQD 1WD0A 4A3CG 5CV5A 5KIXA 3KF8B 3BDLA 3F2CA 1TR5A 1KDAA 4R1JA 1KRSA 1SNMA 1CM9A 1ML0D 1UEBA 1EY9A 2UUCL 2LY7A 1WTPA 2JA6B 2Z6KA 4BA2I 1VQIA 2KENA 1XTCD 3ND9A 2EYMA 1GOZA 2L11A 5EPJA 2P5ZX 3HFZB 5G3LD 1I4HA 4DNIA 1KQSA 1NR4A 4PZ7A 3RD4A 3E0EA 1PTOD 4DV3L 1NSNS 2NB0A 3HOUG 4DR7Q 1LACA 4ULLA 3N6RA 4DV7Q 1JWSD 1R9TB 2ZTEA 1JMCA 3KBGA 1Z47A 2FMCA 1GXDC 1S5FD 4B9WA 4OONA 3PIOA 2UXBL 3TEHB 5EQ0A 2VZAA 3H15A 4A3BB 3UDGA 1NBWA 4GLXA 3SEBA 3TREA 2MFIA 3I72A 5C6AA 2XIWA 1RODA 2VUMH 3A8JE 5JJKA 1X3PA 5IE8A 5C4HA 1ONLA 2NVYB 1KIXA 3ZJYC 1EEID 4DV6L 5IYCG 1J5EL 4RA8A 1FGBD 4FF4A 2NVXB 4L8JA 3J80c 3M7GA 1TWCH 3E3XA 2WAQB 3J7AV 1YZ6A 1AW7A 3HOZH 3M4OH 3NHHA 2EJFC 3SK6A 2GA4B 1M8AA 1ZYRC 4JG2A 2F0VA 3AQQA 2XSCA 3ER0A 3MFGA 3FHWA 3PO3B 4JI5L 4A3BG 3R93A 2NBFA 5FK9C 4A3EH 4RGTA 2NYZD 2UXCL 3TP5A 1HJPA 1AEXA 5KNDA 4IUNA 1TY2A 4X66Q 3GTGH 4IURA 2Q2TA 3G6JB 5FLXc 4HTHA 3TSSA 2IHEA 4HJ7A 4BBRB 4ME3A 2EYFA 4GLAC 4DK1A 2GVBA 2WAQG 1ZKOA 3J81i 1EQRA 4DR3L 1XYIA 3PIO3 5IGCA 1ENAA 3DWPA 2CHBD 2ES2A 1QOHA 3OTOQ 2VQFQ 1IKLA 1TIID 4LNQA 2J4XA 5ELCA 2AQ2B 4CDDC 2ICEC 1E1OA 2RKSA 4OXPA 3G48A 4B3ML 3PO3G 4CGYB 1XMQQ 1TWAB 4DAMA 3RLFA 3G6EA 2K03A 1BCPB 4LFCQ 1HNZQ 4KLKA 5JJIA 2BH2A 3SK5A 3KLSX 2HHHQ 5C3XA 1D5XC 4PMBA 3SXHA 2UUAQ 1Q82C 1H9JA 4BWGB 3ULLA 4BBRG 1K8OA 2ASBA 4HCEA 2B2WC 1FNWA 1SYEA 1KD1C 1G6PA 3P20A 2F0FA 3GO5A 1EZ8A 5I2YA 2KCCA 3H09A 2PW5A 3HP3A 5IWAQ 3AU7A 1SYGA 4RMFA 3F2DA 1QZHA 3K6OA 3S2DB 5K5PA 4LF5L 3D31A 3BU2A 1VQOA 3NWSA 4LF7Q 4K0KL 1EEFD 2Q2IA 1G6ZA 1PH7A 4JI4Q 5C4XB 5FOBB 2LMCB 1IBLL 3HS0C 4L5TA 5KEEA 3U58A 2K5HA 4JC0A 4YCWA 4OEMB 1JICA 2AHOB 5I6WA 5DNFA 1B1ZA 4TKOB 2ALYB 1VQKA 1VQHA 1PFBA 2QILA 4YHHL 1Q7YC 1GHJA 4DR5L 4A3DB 3CC2A 2E2HH 4NXMQ 1PYBA 1RTNA 4AYBE 3H0GB 4JYAL 1O7IA 4N9TA 2JEBI 1BBXC 4BBSG 2EY5A 2QDLA 1WYDA 1WJJA 2JA7H 1U0LA 5I4DA 1K3RA 1PTOB 2DNEA 5DM63 3HRZC 4C1NI 4P74A 5LMNL 5EAYA 3M85A 3T1HQ 3S17B 3R3OA 4P72A 1EY0A 4PMWA 1WCMG 2ZTDA 2JJQA 1X3EA 4DUYQ 4JI2L 5C4XG 4A76A 3EROA 3H3VC 3UE0A 1MI2A 1CZWA 2JA5H 3CKIB 5IP7G 1VQ7A 1ASYA 1W2BA 4C2MH 1PZKD 2CQAA 1Q90A 2MJ8A 2F0GA 5IT9E 3S24A 4A3DG 5C0XH 1PVOA 1STYA 1LTLA 3H0GG 5E4WC 1Q8KA 3CD6A 1SMYD 4DR1L 1HNWL 3UI2A 4RGNA 3I56A 3FVQA 5JOBA 1RHPA 3U50C 1G2TA 3E9HA 3QR8A 1ESRA 4MTKA 2RCNA 3AYHB 5C4JB 1EIFA 1RCVD 1YHAA 2OWOA 3J81j 2ZTCA 4IZ8A 4ZUIA 2B2VC 2YV5A 3HOWB 3OSOA 1IL8A 1BVSA 3BDCA 2IX3A 5M3MB 4QB4A 4K6LA 3MXNB 1VQNA 1AE2A 1ILQA 4NDXA 4Z9CB 4X64L 1N34Q 5E1FA 3MXUA 1GHKA 1DOMA 1PDQA 2NTSA 5LMUQ 2HQLA 3K0XA 1S72A 1E22A 4TQUS 3A7LA 4PMCA 1I3QH 4IPGA 3CP0A 4JVZA 5GAHC 3A54A 3NP8A 3I4NB 1AN8A 4DK3C 3NBIA 4RGMA 5EGTA 4L63B 1E3PA 3N52A 4ALPA 2UUCQ 1J6QA 1UWVA 1HR0W 3RUZA 5D3DA 2A5HA 4OWXB 3T13A 4KN7C 3HOYH 1TY0A 1L0WA 1WI5A 2BH8A 3OYYA 4DV3Q 4A3GH 4YCUA 1E0BA 3S1QH 1Y69U 3HOWG 3UDFA 5HGTA 2XVSA 3J81E 2B2UA 5M3MG 4QGUA 4JCVE 1JOQA 1U9RA 4QF4A 4RHSA 1QVGA 5M5YB 1Q12A 1FJGL 4RCOA 4I65A 2R7FA 3W2DA 2PCFB 3DWQA 3M9BA 3VYRA 1FGUA 3I4NG 2NWGA 2TMPA 1JOOA 3RR5A 4DV6Q 2EYJA 3PUZA 4PNYA 4DA2A 4BY1H 4IQZA 1MBYA 4HN7A 2OEOA 4KHZA 5EBDA 2K6AA 2ZM6L 1LABA 3A5UA 3AFPA 3EBEA 1K83B 1E2VA 1SE3A 2K33A 2PW7A 5A2QE 2Z6KC 1BO0A 5I6YA 4OL7A 1Y1WB 4KD4A 4DAYA 2WB1B 4K5VA 2JN4A 2L15A 1BCPC 3M3YB 5IT9L 2R7ZH 3CCLA 1B2TA 5I2XA 4JOIA 2B2TA 2N78A 2PI2A 3G4SA 1STNA 1TWFH 1VQCA 1MKHA 1RF2D 1E2WA 4HJAA 1ESFA 1SR3A 1SE4A 3JAMi 4U673 2UXDL 4ZUJA 1O7LA 1KTKA 4PQXA 2N3SA 3KLSA 2VQEQ 3STBC 2E75C 2F03A 4LMQD 3HOXH 1X9NA 3HKZB 4LUVA 3CU7A 1FNVA 3K7AH 3CCUA 4KKSA 1I4RA 1HZAA 1U5KA 3VYTA 2PYKA 1C4QA 4DV0L 3S1RH 1TVXA 2HDMA 2F0IA 4IUPA 1TS4A 2OQ0A 4MTNA 4DR3Q 1Y1WG 1SYFA 1SAPA 3GTLH 2KA7A 4HIOA 4L5SA 3KJOA 1I50B 2OTLA 2R6GA 1G8ZD 1F9RA 1MJCA 2F3VA 1AP0A 3SVMA 1F77A 1Z6HA 4UP7A 5AFWA 3DM3A 3Q6SA 4NP5A 3DWAA 3T16A 2K5VA 1X3FA 1Q1BA 3G71A 3OMGA 4DV5L 2R61A 2E2JH 2E2IH 1D2BA 2KOLA 1OXUA 4A3MH 5JJLA 4WORA 3HKZG 5FO8B 1B4OA 1PTOC 3S14H 3J81L 3LNNA 2M9VA 1F2ZA 4M8AA 4MNOA 4GOPA 1LO5D 2UU9L 3I3CA 2IPKD 1LTAD 1DONA 2C35B 4H44C 1QILA 5C5LA 4G4KA 4WFN3 4C3HB 3S1NH 1X55A 3SHLA 5E3FA 3NWTA 1SFOH 2QEJC 4LF5Q 4HSVA 3K5LA 5EPKA 3VR6A 1TS5A 4DV2L 1FYCA 3RZOH 1JE5A 5LL6X 3R2IA 4K0KQ 4JW0A 5M5XB 5CV8A 1MSHA 2OXPA 3IL8A 1P8LA 1EY8A 1IBLQ 3CQZB 2EYHA 3S2HB 2B63B 1BCPF 5A2QL 4CJ2C 1SDFA 2O4XA 1DCZA 4FDBA 3TS2A 1XXGA 1XNQL 1HCZA 5HURA 4YHHQ 1UAPA 3T4AC 4DR5Q 1PFMA 3E5SA 4F87A 3OOCA 4NXNL 1A15A 4DUZL 1NAPA 1NMFA 5ELDA 3CCEA 4JYAQ 1IL2A 1Z9FA 3JC66 5DM73 4N9PA 2KCNA 4M1UB 5M5WB 4PG3A 1H9RA 4YY3L 1VQLA 3VR5A 1PYSB 4ABNA 4XT1B 5LMNQ 3NBHB 1I6HB 1LUZA 2YYZA 3F8TA 3CCVA 4OO1G 1Y14B 2ID0A 4DK0A 5JEAH 2Z9HA 1K8AC 2E8GA 4A3JB 5FLMH 2B39A 2SDFA 1YJ9A 3OMCA 1UNSA 4Y7NH 4FXKC 4JI2Q 1G2SA 2X69A 1XNRL 5D14A 3PUXA 2ATWA 1I6VC 3IKJA 3PO2G 1GJXA 4MIUA 2VXWA 1LLRD 2R92B 1PRTD 3OWFA 3SK4A 1Y1VG 2NUCA 2F0UA 4XIGS 2PQEA 2FXQA 4HMIA 3D6CA 3Q0AA 3ZYYX 1X32A 3VA7A 1SSOA 2JYOA 1HH2P 1RJTA 3Q22A 5M3FB 2XWBB 4DR1Q 1R4QB 1HNWQ 4LUOA 4KN4C 3GTQH 3CAMA 4HIMA 2DGYA 2JSOA 1PTOF 1DGSA 3CC7A 1W6JA 1EIHA 4FXDA 4ZKBB 2OCEA 4QMGA 2V4DA 3R2TA 1X3GA 5KRUA 3D4DA 2NN6G 2K14A 3U4VA 4DXFA 4EQ5A 4A75A 1IYUA 4GOPB 1E1TA 1L0YB 1CKNA 1LT3D 2HIVA 3FKIG 4LFBL 2EVBA 1M1KC 4LF4L 2CKZB 4X64Q 2R92G 1B3QA 5ISRA 2LFNA 3PV0A 1NE3A 3CPFA 3TP7A 1W3SA 1P16A 2DY8A 1KLGD 3JAME 2O2LD 2KQ3A 4A3CH 5M3FG 4GKJL 2D62A 3NQTA 3J7A5 4J6HA 2RDGA 1DYQA 3DEOA 3L2PA 2JA8B 3A5ZB 1D1IA 3CF5A 1PFNA 1CFMA 4ZYSA 3QOJA 2CVRA 1YITA 2A68D 4KJNA 2PNHA 2WFWA 3Q23A 5EPLA 4DFAA 3HOUH 2EQSA 3PGZA 1QVCA 3H6MA 3GTKH 3HOZB 1FJGQ 5C4ZA 1X54A 1A2TA 1V43A 1JQYD 1H9KA 2A1AA 3P75A 1SJED 2K5DA 4DAVA 3B6YA 4C1NK 5ELFA 2JA6G 4BY7B 2D0PA 4LF6L 1U4LA 4ZQ3A 2OTJA 2ZM6Q 3TQYA 3BS1A 3H3VH 2BE5D 3KYHC 3J7AF 5JPMC 5IYCH 1E24A 2EZVA 2BA1A 1CK1A 2R93B 1O80A 4DPGA 2JA8G 1JWMD 1WTWA 2Z4IA 1I5FA 3PUVA 4KKUA 4I7AA 4IFDJ 1STEA 4DR2L 2KCTA 2HQEA 3NELA 4LK1C 4QIWE 1KL9A 1VQ5A 2GN5A 1ICWA 2VW9A 4IFDG 2B2UC 2PNRC 1SMYC 2EJMA 2UXDQ 2WAQE 4ID6A 3URYA 2AMCB 5IYBG 4A3BH 2OQKA 5D3IB 4V0BA 4TSSA 3DLLA 1WFQA 1I4GA 2F4IA 2NVYH 4BY7G 4CDFC 1CKNB 4RWSC 4OIKA 1QG7A 3AEVA 2R93G 2IHFA 3VR4A 2VY3A 5I9OA 1FR3A 1VF5C 4XDXA 3JAML 3NTKA 3MHBA 4HJ9A 4UAIA 3A0JA 2XWJB 1T9HA 2FJ2A 2MGSA 3K58A 1L0XB 2Z0SA 4X62L 1GUNA 3K57A 2B2TC 1XPUA 1YJWA 4CJ1B 1STHA 1B9MA 1G91A 2PZWA 2Q2HA 4DV5Q 2RQXA 3S1MB 1PRTB 4C3JB 2WINB 1TS3A 3PO3H 3GV3A 1LT5D 5LHY1 2K04A 4CKEA 4A3IB 1UE6A 2I5LX 2M2LA 4DXGA 1FNUA 4IOAA 1F2YA 2JK8A 1HPCA 2A69D 1BF4A 2EYLA 1EFWA 2F0JA 3Q24A 3ICEA 1K28A 4EX5A 3GTOB 2UU9Q 4BBRH 5C0XI 2NVQB 4ZCKA 3HOVB 1STBA 4BXXG 1PH2A 1KC8C 3TN2A 3E9IA 3NUCA 4QJFA 2E2HB 4IUQA 4OGQC 2EPBA 2WV6D 1K8GA 1HNXL 1VQJA 1ASZA 3D0FA 4PZ6A 4DV2Q 2G5DA 5IIFA 4HJ5A 1EQQA 3A56A 4B3TL 5IGGA 1H95A 3K0YA 1JCKB 2EE1A 3K8AA 2M00A 5CV9A 4C3JG 3HKSA 2E2DC 4P75A 1N32L 1TWAH 3KLRA 1HR0L 2SNSA 1EIYB 4A3IG 3WOEA 1XNQQ 1EQVA 1UE1A 4B3SL 1AE3A 4LFAL 1F9SA 1HZ9A 4DUZQ 1IHZA 3DHQA 1HXYD 5EKKA 2ZJQA 5KYLA 1EYDA 3HOVG 5KGUA 2RHSB 4RKLA 2R7DA 3EVQA 4GOPC 1YJNA 2H4OA 4A3KB 4G7OC 4YY3Q 4BBSH 5FO7B 3I90A 2ZXOA 5D65A 3H94A 2DNCA 3GDEA 2PZUA 4DV1L 1EIGA 1EUJA 3S2DH 1OXVA 1QE6A 4JI1L 1JE4A 3RLNA 3CCMA 3BVMA 1XNRQ 1BOSA 2RSOA 1OXSC 1WCMH 4CKBA 1QNKA 5J1ZA 5C4XH 4KHPL 3I55A 1D5ZC 3EJIA 4A3LG 2KHJA 3TS0A 4J15A 5GROA 1CSQA 1U4RA 2EOTA 1CA6A 5IP7H 2EIFA 3CCJA 1SNPA 1X65A 2RCFA 4WJWA 5J3BA 3IAYA 4FYDA 4UHVA 2UUBL 3CC4A 1BQQT 4A3DH 2A19A 2HD3A 3H0GH 1LTGD 1PH8A 4R8IA 4A3KG 2EYPA 1I3QB 1ZYRD 4H7BA 1K0RA 2MHVA 4NB3A 3SDZA 1PTOH 2HT1A 3ULPA 2XTIA 3FPUB 3HOYB 5J22A 2O5JC 4ZKCB 1B9NA 4YIJA 3KFUA 5JVH3 5FJ8G 4LFBQ 4A3GB 4LF4Q 2IY5B 1RL2A 2AWOA 1DZ1A 4ZK9B 4AIMA 3IFDA 2KHSA 1FVIA 3H91A 5CBAE 1GUSA 3LWEA 4CJ0B 2F4VL 4FVMA 4HJ8A 4EGVA 4GKJQ 1Q81C 4DGZA 4R8NA 1BNZA 1JC7A 4WRDA 2L1BA 1GKHA 1VQ9A 2YU9B 4OWWB 2B2YA 4IJHA 4IUUA 2AKWB 3C46A 1DD2A 2ZJPA 3MA2B 4FP5D 5JJZA 1YNJD 1SBBB 4J8QA 1ICFB 3W1GA 1ET6A 1U4PA 3VR2A 5C4JH 2B29A 1YHBA 2SOBA 1Q1EA 2A6HD 2JXMB 5L37A 3K5NA 1UE7A 2CW0D 2KHIA 3SK8A 1S4ZA 1VF7A 3HOWH 5JVG3 2D0OA 2K75A 5M3MH 2UXBQ 5ELNA 1GVPA 4X65L 2KEDA 1SNQA 2VB2X 3HEJA 4DF7A 4LW1A 5CC4A 1A2UA 1QVFA 3RLOA 1S40A 5T1GA 5C44B 3DEPA 1Y8PB 1D6EC 3WWVA 4DN4M 1J5EQ 3KUPA 5M9OA 2EY1A 3I4NH 3OHXC 3S16B 1SROA 4K2LA 1AZQA 1CI3M 4POFA 3ERQA 3FEWX 5IGEA 4K5WA 3GTJH 2I46A 1WTOA 3PSIA 4HMJA 1PRTC 2LXJA 3I8ZA 4HIDA 4FF3A 2CH4W 1PXUA 1B8AA 3K7AB 1TXYA 1XJVA 2BOSA 3MFYA 2EXDA 1CT1D 4OIJA 4DR2Q 1WVLA 4A3FB 1LV9A 4JI5Q 4EQOA 2DUDA 3GTLB 5LL6S 3RZDH 3J80i 1B3AA 3MWYW 4LWCA 2UXCQ 2QF7A 3M4PA 5C3EB 4G7ZC 1EY5A 3D6WA 3D3RA 1DOKA 5C44G 1VQMA 3F1ZA 5H1SE 1CTMA 3VDYA 1HFGA 4JPBW 1YEZA 5EKLA 3QG1A 2WKDA 3I91A 3QJYA 5KNBA 1V1QA 4LF9L 4X6AH 4PV1C 5EBCA 3J81c 1T5XD 1SNDA 2JA9A 1G51A 4GS3A 1EZ6A 1HTPA 2WB1G 1L2FA 1K83H 1HHVA 1SJHD 1II3A 1IXRA 2B2WA 1DOLA 2F0KA 3I4MB 3MZ5A 4A93B 2HCCA 1Y1WH 3HKZE 1JB3A 5CORA 2NTTA 1XMOL 4A3FG 1I94L 3U9SA 3M3YH 1SYBA 1OXXK 4B3MQ 1ENCA 4X62Q 1QZGA 3CXCA 1PZJD 3BZCA 3AB9A 3W5OA 1GUTA 2ZJRA 3S1NB 1VCIA 2JQOA 1A3VA 4R4OA 5C3EG 2FHTA 1SYCA 5GQOA 3K59A 5ELBA 3KK7A 1HRJA 1GUWA 1I4QA 1JJCB 2F0TA 3BJUA 2CWAA 4KJOA 2RDHA 1KDBA 2IX1A 2A68C 3PIPA 1SEBD 1N33L 1VDZA 1HA5A 4KHVA 1C7YA 4P2CB 3KDFA 1NUCA 5K36G 1K8MA 4IALA 4KD3A 3DXJC 2ZXPA 3VYSA 5IYDG 1PH1A 3BVGA 3EQLC 1H9SA 3I4MG 4JBWA 4F7XA 4A93G 5CR3A 1V8QA 1NCVA 3T1YL 3M7NA 3TP8A 1VQFA 1HNXQ 1WTVA 3PF5A 1I50H 3KJPA 2A73B 2F3WA 4B3TQ 3GTPH 3ERSX 3S15H 3V96A 3K80C 1EFID 3TMEA 4R4IA 1Y8OB 3RNUA 3GTMB 3KF6A 1N8RC 1N32Q 2X6LA 2BE5C 1HR0Q 1OXTA 3CHBD 3P7JA 2F52A 2RHQB 1VMCA 4DAYB 3J7ZC 3PUWA 2R3ZA 4RAUC 4XT3B 4B3SQ 4LFAQ 2K4KA 2HCIA 4ZLTF 4H02A 4ILWA 1CUKA 3NTIA 1PH9A 4C3IB 2QKIC 1BBWA 4YWKA 1QB5D 1HUNA 5IP9G 4E6IA 2K5WA 3OWEB 4O42A 5GADC 4C3HG 1KABA 5BR8L 1Z7TA 2ICIA 3I70A 3VYUA 1YVCA 2NVTH 4DV1Q 1B53A 1Q86C 5E7NA 4JI0L 2EY6A 2Z4HA 2PI2E 3NK9A 1LTRD 4OO1H 1O7ZA 1CSPA 1STGA 1TT2A 4JI1Q 3J7YW 2K52A 4ZRZA 1XTDA 1TWHH 3KBXA 3PIP3 1XWEA 3CCRA 4PZ8A 2I0QA 2B63G 3NXWA 3AFQA 5E4XA 5M5XH 2B2VA 1A6XA 1VQ4A 2XRSD 3BYTB 1KNEA 3CQZH 3ULJA 3S2HH 4IN3A 3PO2H 3WDNA 4G7HC 4LF8L 4R4TA 4V190 1Y1VH 2EDGA 2Z6BA 4ZAIA 1I4PA 4F8MA 4QUFA 2Y0SB 4C3IG 2UUBQ 1ET9A 1JOKA 1CQFA 1O78A 2WIIB 4RG1A 5G3LF 4GNXA 3QWNA 2RBMA 3I4OA 2Z8LA 2PMZB 1I4XA 4DNRB 4QQBX 1CKOA 3H3VI 5M5WH 4X3KA 2HUGA 3L7ZC 5CV4A 4B08A 2L12A 2VL6A 2CCZA 2V1CC 3GV6A 4GLVB 2XRQD 1TU2B 4KY6A 1F9QA 4A3JG 1I6HH 2A69C 5FKAC 4RGOS 2VS1A 4APVA 4GN4B 4KTAA 5IY0A 3D4WA 2NN6H 2NZHA 1JJ2A 4UDUC 2F0QA 2N49A 1MIUA 1IYJB 3FKIH 3IFTA 2E76C 1H9SB 4RH6A 2K5QA 5HY6A 2R92H 4X3UA 3HOUB 1EWHA 2K01A 2JEAI 1F2LA 4DV4L 2D9UA 3J80E 2F4VQ 1EY4A 2A8VA 1LTBD 1TWGH 2Y0SG 4K8IA 4JI7L 1X3QA 2K05A 3F2BA 1L1OA 1YNND 5M3FH 2VUMB 5IGFA 1K0SA 2XNAC 4TVAB 1HQMC 3C1FA 3NE5B 3VA5A 1D1KA 2F0WA 1EOTA 1KXLA 2F0LA 1ILPA 3LGJA 2QA4A 1B50A 1TWCB 3K5OA 4FF1A 4AQYL 1HZBA 1TS2A 3M4OB 2IX0A 4X65Q 4O0AA 2AWNA 5CYUA 1AH9A 5FLXE 2EXZA 2F0MA 3U4ZA 5KYIA 4JV5L 1A62A 4X3TA 4A3EB 2VUMG 1CQVA 2JA6H 4WJ4A 3K7UC 3GTGB 2A6ED 2L9HA 1N36L 2QW7A 2B2YC 3U9OA 2MQHA 2MNAA 2L0CA 2JA8H 1EY6A 4XQQA 3DUZA 3TZDA 4QIWB 5AJ3L 2SEBD 2LSSA 1QJOA 2AQ1B 4DNTB 3JAMc 3HOZG 1R9TH 3MXPA 2C9OA 1RD9D 1GM5A 1BDOA 4GNXB 1S5DD 3PMFA 2TSSA 4IFDH 2YTYA 3MTSA 3TRZA 1IBKL 2EYOA 3TBIB 4JI6L 3NSWA 2QEXA 5IYBH 3EA6A 2DJFC 3GD7A 3X3MA 4A3EG 2N55A 2WACA 4LF9Q 3NEMA 1KRTA 5C3WA 4DV0Q 1SMXA 2LS01 1M4VA 4BY7H 3BZKA 2FFKB 2HDLA 2X6GA 2NVXH 1SRUA 2C5CA 2GVAA 5F2DA 1DXMA 1S3OA 2BDOA 2JP1A 3A74A 4H0LC 2VQEL 3UDIA 2KCMA 1KDCA 2E5LL 2R93H 1VQ8A 1EQTA 1VQBA 2G9HD 3BVZA 1XMOQ 3NTHA 3J80L 3QB3A 1H9MA 1W6KA 1I94Q 4HEDA 4JBJA 1MSGA 4JOIC 2RF4A 2F0HA 1L1OB 2NZ1D 1CA5A 4QL5A 1NY4A 3I73A 2PQAA 3QIAA 4UP9A 1VS0A 1VQDA 1SE2A 5IOCA 1MJEA 4DR6L 4J1MA 1VQPA 1YNJC 2A74C 1EY7A 1V1OA 4KK7A 2F1MA 2IL8A 2A6HC 1N33Q 4POGA 1IYVA 4JI3L 2CW0C 2PZTA 2Q8IB 4XQNA 2F0SA 1IBML 3P1HA 2EY2A 5FLXL 2F0NA 2IW3A 3V2TA 1B7YB 3MXGA 1EYAA 1U4MA 4BXXH 3T1YQ 2RDFA 1CKMA 1B44D 3O13A 1IW7D 2SNMA 4XXEA 1NJIC 5CMDA 3MXNA 2JA7B 1MHWC 4IOCA 1GUGA 3TP6A 4KV6A 4BBSB 4UP8A 3PCOB 1CHPD 1N9WA 1X56A 4O1NA 1A3UA 1WTXA 4R4QA 2L5TA 3S1MH 4C3JH 1S5BD 3HGBA 3MEHA 1VQ6A 3PQIA 3KLWA 1HFNA 4A3IH 3EIVA 4AYBB 4NXNQ 1WCMB 4OX9L 2JA5B 4HR7B 3UDXA 1X6OA 2D2CC 1IZ6A 1S5ED 2DY7A 3VR3A 4C2MB 1BXTA 3GTOH 3WOFA 4EQNA 5JPNC 1OO9B 1A0IA 2OF1A 3D4RA 1YIJA 3C3LA 2NVQH 3HOVH 1WOCA 5BR8Q 1Q3LA 2PPBC 1PA6A 4JBKA 4JI0Q 4JK1C 3NENA 2JA7G 1KHIA 1HQRD 1AFPA 3T51B 5BN3A 2IJ0A 2H5XA 4B3RL 2IT1A 4H13C 4K14A 1C8CA 3FP9A 3C1EA 1MGSA 1A8VA 2J7ZA 4HSPA 5I9PA 3MEFA 1ZEQX 4LF8Q 4IPCA 4RKBA 4RFBA 2BA0A 1LYLA 1VQAA 5DLQE 4UY8C 1Y8NB 4A3LH 4AYBG 1HTLD 2XGTA 4FNFA 3KOJA 2JA5G 5HGQA 1XX8A 4XQJA 5C0XJ 1JWUD 1AZPA 4FXGC 4HIKA 3EN2A 4DAPA 4DKAC 3FDTA 3I2ZA 3CMEA 5ELEA 5C0XG 2PQAB 1ENFA 4HCSA 4NKLA 1EWCA 1HUMA 1FL0A 2ENBA 4A3KH 5JAVA 3UE1A 4CBVA 2K32A 1RDPD 1GUOA 4JI8L 4QCLA 3MAQA 1PH4A 3BYYB 4N8FA 3Q8DA 3LX0A 3S17H 2J0TD 1EYCA 1HZCA 4K6DA 1C9OA 3SE0A 1PYWD 4EQPA 5GAGC 4EVOA 2Z1CA 5IGDA 4DR4L 4NMZA 3S1QB 2ZT9C 4GKKL 5FJ8H 4UPAA 5CV7A 1UEAB 2H1EA 5BN5A 4N8X1 3HG9A 4YWLA 2Q8TA 1VQGA 3OPOA 4DV4Q 4DK6C 2JE6I 2FMMA 4JI7Q 1S5CD 5DEHA 1STAA 4NPSA 1LTID 1LT4D 1XPRA 1D8LA 1SE8A 3QO2A 4RHRA 1JR0D 2DJGC 2WKCA 5IGBA 4ODGA 3DMUA 4YCVA 2B3GA 2N8NA 4X3SA 1WD1A 4GNXC 3L3OC 3FPPA 1NTGA 1WTHA 4BY1B 4GN5A 2L55A 4Q0FA 1JORA 4R9WA 3RN2A 3HOYG 2F0EA 5IT9c 5BN4A 3T53B 2K1BA 4AQYQ 1UE5A 3M4QA 1QUQA 3GTJB 4B9XA 3OW7A 4A3GG 3L0OA 3CCSA 1D7QA 4K5XA 1PZID 1DM0B 3RMHA 2R7ZB 1K3BC 4K8JA 5KNCA 4NW2A 1BKBA 4KY7A 2O5IC 4DR7L 4JBMA 1PH5A 1TWFB 2QGQA 5CGKA 1A3TA 1WTQA 4DV7L 4JV5Q 5EKIA 4L6TB 3PUYA 4LUZA 3RZDB 2Q8RE 2PO4A 4LF6Q 1EU4A 5LMNW 4QUCA 2K7VA 3OIPA 2K28A 1JT8A 2BCOA 3V05A 3CCQA 2I07B 3ONAB 3R8BA 3HOXB 1N36Q 5T1IA 2YU9H 1RKNA 3D8GA 1L1OC 2BDNA 2OT2A 4G57A 1J8IA 1EL0A 3NPPA 1NMGA 4BY1G 4KMUC 3T56B 3F2UA 4GN3B 1ZXTA 1E2ZA 1HA6A 1RTOA 5C5MA 3S1RB 5A35A 1SN8A 5AJ3Q 4ME5A 4L5RC 1YI2A 4GZYC 2Q2UA 2N88A 3GP7A 5J39A 2R7ZG 5M5YH 2ZXRA 2RA4A 1BBUA 2I5MX 2WB1E 1IBKQ 1IKMA 4JI6Q 3SGIA 2MUYA 3K5MA 3I7FA 1RIPA 3GQBA 5C44H 4FF2A 1Q8IA 2F0DA 2E2JB 2LKVA 3M4YA 4IJLA 1GO3E 4IPHA 2E2IB 4A3MB 3AMUA 3HOXG 1LT6D 3S16H 3S14B 3MVVA 4KY5A 2L4NA 3NBHA 3X3NA 1F9PA 3G7LA 4R4CA 4X66L 2E5LQ 2MO0A 1G291 3NQIA 1CZGA 1PH6A 4OELB 1VQEA 3LWUA 4XYOA 4CHTB 1OTCA 2I5HA 4CDCC
chains in the Genus database with same CATH topology
2IHFA 3L7ZC 2CQOA 3U50C 1PV4A 2CFMA 2VY3A 2VL6A 3E9HA 2CCZA 2V1CC 4GLVB 4A3JG 2MO1A 1I6HH 5ELOA 2RCNA 4A3FH 4L5QA 3AYHB 1K9MC 4QY7A 4HJ9A 4OO1I 2VS1A 1C0AA 1EIFA 1YHAA 4APVA 2OWOA 4GN4B 5IY0A 3A0JA 3J81j 2ZTCA 1T9HA 2YV5A 3K81C 3OTOL 2VQFL 2Z0SA 4X62L 2NZHA 1JJ2A 1BVSA 2N49A 1YJWA 1M90C 1XPUA 5C3EH 1MIUA 2Q2HA 1IYJB 1AE2A 3FKIH 3MXNB 4DV5Q 1VQNA 4DR6Q 3PO3H 5HY6A 2R92H 2JEAI 4DV4L 4X64L 1XMQL 4IOAA 2F4VQ 1UE6A 2I5LX 4JI3Q 1N34Q 1QUQB 1EOVA 5LMUQ 2A8VA 2JK8A 1TWGH 2HQLA 2Y0SG 3K0XA 3CPWA 4A3MG 1S72A 1E22A 4JI7L 4TQUS 2YTVA 1EFWA 1IBMQ 4LFCL 1HNZL 3ICEA 1I3QH 4IPGA 3CP0A 1L1OA 4EX5A 3F2BA 5GAHC 5M3FH 2UU9Q 4DK3C 2HHHL 4BBRH 5C0XI 2UUAL 2NZOA 1E3PA 4ALPA 2UUCQ 1J6QA 1UWVA 1HR0W 4TVAB 3RN5A 4P71A 4O2DA 5IYDH 4BXXG 4OWXB 3I4MH 4AH6A 1PH2A 4A93H 3HOYH 2CWPA 1KC8C 1L0WA 3E9IA 4QJFA 1KXLA 1WI5A 3LGJA 2QA4A 2BH8A 3OYYA 5IWAL 4DV3Q 1VQJA 1K8GA 4AQYL 1HNXL 1HZBA 4YCUA 3D0FA 1YNXA 1ASZA 4PZ6A 4DV2Q 1XPOA 3S1QH 4HJ5A 2IX0A 1EQQA 4B3TL 3HOWG 3UDFA 1H95A 4X65Q 4O0AA 2AWNA 2NN6I 1AH9A 5M3MG 3K8AA 2K5NA 1LM0A 4JCVE 4QGUA 3U4ZA 1EWIA 3HKSA 4P75A 1QVGA 1N32L 1TWAH 4OWTB 1HR0L 1Q12A 1EIYB 4LF7L 4A4IA 4A3IG 4OX9Q 1FJGL 1XNQQ 4JV5L 1UE1A 4B3SL 4JI4L 2R7FA 1AE3A 4LFAL 1A62A 1KAWA 3M9BA 1HZ9A 4DUZQ 1FGUA 1K73C 2VUMG 2WP8J 2JA6H 3I4NG 4WJ4A 5IP9H 3RR5A 2ZJQA 3K7UC 4DV6Q 3PUZA 3HOVG 1N36L 2RHSB 4BY1H 2R7DA 4C3HH 4GOPC 4KHZA 1YJNA 1A63A 1B70B 2ZM6L 4NXML 4YY3Q 4BBSH 2K50A 2MQHA 2MNAA 3AFPA 3EBEA 3A5UA 2JA8H 2Z6KC 4XTCS 5JEAJ 3GDEA 4DV1L 5AJ3L 1EYGA 4B3RQ 2LSSA 3JAMc 2L15A 1EUJA 3HOZG 1R9TH 4KHPQ 3S2DH 1GM5A 5JEAG 3CCLA 4GNXB 2R7ZH 1OXVA 4JOIA 4JI1L 2VNUD 3GTMH 2N78A 5FLMG 2B63H 2PI2A 3RLNA 3CCMA 3T1HL 1XNRQ 2F3IA 3G4SA 1OXSC 1TWFH 1VQCA 2YTYA 1MKHA 1WCMH 1GD7A 4HJAA 3TRZA 1IBKL 1SR3A 3OW2A 4JI6L 2KBNA 2LXKA 5C4XH 3W1BA 4KHPL 3I55A 3JAMi 4A3LG 2KHJA 3TS0A 2QEXA 4DUYL 2UXDL 4J15A 4MZ9A 1CSQA 5GROA 5IYBH 4Y52H 5IP7H 4BA1I 2EIFA 2N3SA 1X65A 3GD7A 4KI0A 3CCJA 4A3EG 5J3BA 2VQEQ 3STBC 3NEMA 2YTXA 4LF9Q 4C3IH 3HOXH 1KRTA 1X9NA 4DV0Q 1SMXA 1YHQA 4LUVA 3PF4A 4BY7H 2UUBL 3CC4A 4A3DH 4A3GH 3BZKA 2A19A 2NVXH 1SRUA 2GVAA 3H0GH 1S3OA 3K7AH 3A74A 2VQEL 1YBYA 4JI8Q 1PH8A 3UDIA 3CCUA 4A3KG 1HZAA 1U5KA 2KCMA 2E5LL 1JB7A 4DV0L 1VQ8A 1VQBA 2R93H 4IPDA 3S1RH 2OQ0A 2Y0SE 4MTNA 1K0RA 4NB3A 3CMAA 4DR3Q 1XMOQ 1Y1WG 1I94Q 4A3JH 2HT1A 1E7ZA 3ULPA 1PHJA 2XTIA 3GTLH 1PH3A 2HIXA 4JBJA 4HIOA 4L5SA 4DR4Q 4JOIC 3KDFB 3KJOA 3STBD 2OTLA 2RF4A 2R6GA 1PFSA 1L1OB 1SLJA 2PMZE 3IRBA 1MJCA 4GKKQ 4QL5A 3KFUA 1NY4A 4UP9A 2PQAA 5FJ8G 4LFBQ 1VS0A 1V9PA 1VQDA 4P73A 4UP7A 5GAEC 4LF4Q 3DM3A 4IFDI 2IY5B 1RL2A 2K5VA 1X3FA 1Q1BA 2AWOA 1MJEA 3G71A 1JJGA 4DV5L 4DR6L 1VQPA 4YWMA 2E2JH 4AIMA 3CW2C 2E2IH 1FVIA 1N33Q 1OXUA 4IO9A 4A3MH 1Q46A 3KF6B 4JI3L 4POGA 2F4VL 1N34L 5JJLA 4HJ8A 3HKZG 4WJ3M 5LMUL 3S14H 4GKJQ 1Q81C 4A3CG 1IBML 1GKHA 3KF8B 1VQ9A 4MNOA 3F2CA 4GOPA 2UU9L 4R1JA 1KRSA 4OWWB 4IJHA 1B7YB 1UEBA 2AKWB 2C35B 2ZJPA 3T1YQ 2UUCL 4BXXH 1CKMA 2Z6KA 4BA2I 1VQIA 2KENA 1NJIC 3W1GA 4IOCA 3S1NH 5C4JH 2B29A 1YHBA 3HFZB 1Q1EA 4DNIA 1X55A 1KQSA 4PZ7A 4UP8A 1UE7A 2KHIA 1SFOH 3E0EA 4DV3L 4LF5Q 3HOWH 3PCOB 4DV2L 2D0OA 2K75A 1N9WA 1X56A 3HOUG 4DR7Q 5M3MH 3RZOH 4R4QA 5ELNA 1JE5A 2UXBQ 4K0KQ 1GVPA 4X65L 4C3JH 3S1MH 4DV7Q 2ZTEA 4LW1A 1JMCA 1VQ6A 1P8LA 1IBLQ 1Z47A 3KLWA 3RLOA 1QVFA 4A3IH 4OONA 3EIVA 3PIOA 1S40A 2UXBL 4FDBA 4NXNQ 3TS2A 4OX9L 1XNQL 3TEHB 2VZAA 3UDXA 3H15A 3UDGA 1NBWA 4GLXA 1X6OA 3WWVA 1IZ6A 3TREA 2MFIA 4YHHQ 1J5EQ 3GTOH 4DR5Q 5JJKA 2VUMH 3I4NH 5IE8A 1A0IA 1SROA 4NXNL 1YIJA 4DUZL 1NMFA 3CCEA 4JYAQ 2NVQH 3HOVH 4POFA 1KIXA 3ZJYC 1IL2A 1WOCA 1Z9FA 3JC66 5BR8Q 4DV6L 3GTJH 5IYCG 1J5EL 1PA6A 3PSIA 4JBKA 4JI0Q 2LXJA 4HIDA 4PG3A 3NENA 3J80c 4YY3L 1VQLA 2JA7G 1B8AA 1TWCH 1TXYA 1PYSB 1XJVA 1KHIA 5LMNQ 3NBHB 2EXDA 1LUZA 2YYZA 1YZ6A 3F8TA 3CCVA 4OO1G 4DR2Q 3HOZH 1Y14B 2H5XA 2ID0A 3M4OH 4B3RL 2IT1A 1K8AC 2E8GA 5FLMH 3FP9A 2I0QA 1YJ9A 4JI5Q 4JG2A 2DUDA 4Y7NH 1A8VA 3AQQA 3RZDH 3J80i 4JI2Q 4LWCA 3MEFA 4LF8Q 1XNRL 3M4PA 3PUXA 2UXCQ 4IPCA 2ATWA 3ER0A 2BA0A 1LYLA 1VQAA 5DLQE 3FHWA 4UY8C 3PO2G 4A3LH 4AYBG 4JI5L 5C44G 3F1ZA 2XGTA 5H1SE 1VQMA 3VDYA 3KOJA 2JA5G 5HGQA 1Y1VG 4A3BG 1YEZA 4A3EH 5C0XJ 4XIGS 2UXCL 4HIKA 2FXQA 3EN2A 1HJPA 4DKAC 1V1QA 4LF9L 4X6AH 3I2ZA 3CMEA 3J81c 4X66Q 3GTGH 2Q2TA 5C0XG 2PQAB 1HH2P 5FLXc 2JA9A 2IHEA 4DR1Q 4HJ7A 1G51A 1FL0A 1HNWQ 4GS3A 4LUOA 4A3KH 3UE1A 3GTQH 3CAMA 2WB1G 4HIMA 2DGYA 4JI8L 4ME3A 1L2FA 1K83H 1PH4A 4GLAC 1IXRA 3Q8DA 1DGSA 2GVBA 3CC7A 2WAQG 1Y1WH 3S17H 3HKZE 3J81i 1EQRA 2NVTH 1XMOL 4DR3L 1HZCA 1C9OA 2OCEA 4A3FG 1I94L 3M3YH 5GAGC 2ES2A 1OXXK 3OTOQ 4B3MQ 2VQFQ 4X62Q 1QZGA 4DR4L 1X3GA 3BZCA 3CXCA 3W5OA 2NN6G 4LNQA 2ZJRA 2K14A 3U4VA 4EQ5A 1VCIA 4A75A 4GOPB 2JQOA 5FJ8H 4GKKL 1E1TA 4UPAA 4R4OA 2B63G 5C3EG 1CKNA 1E1OA 2HIVA 3FKIG 4OXPA 3G48A 1M1KC 5GQOA 4YWLA 4B3ML 4LFBL 1VQGA 4LF4L 3PO3G 4DV4Q 2CKZB 4X64Q 1XMQQ 2R92G 4DAMA 3RLFA 3G6EA 3PV0A 2JE6I 4DK6C 1JJCB 4JI7Q 3BJUA 2CWAA 1NE3A 4NPSA 3CPFA 1XPRA 1W3SA 1HNZQ 1D8LA 1P16A 1SE8A 4LFCQ 4KLKA 3PIPA 2BH2A 2IX1A 5JJIA 1N33L 2HHHQ 4A3CH 2UUAQ 1Q82C 5M3FG 4GKJL 4YCVA 2D62A 2B3GA 2N8NA 3ULLA 4BBRG 1C7YA 4GNXC 2ASBA 3KDFA 5K36G 3J7A5 1NTGA 4GN5A 1KD1C 5IYDG 1PH1A 1G6PA 3I4MG 4JBWA 3GO5A 3RN2A 4A93G 3HOYG 3T1YL 3L2PA 3M7NA 1VQFA 5IT9c 5IWAQ 3A5ZB 1HNXQ 4AQYQ 1UE5A 3PF5A 3M4QA 1QUQA 4RMFA 3F2DA 1I50H 3CF5A 3KJPA 4A3GG 4B3TQ 3GTPH 3ERSX 3L0OA 3CCSA 1YITA 3S15H 3K80C 1QZHA 1D7QA 2PNHA 4R4IA 2WFWA 3RNUA 3HOUH 2EQSA 4LF5L 3D31A 3KF6A 1BKBA 3PGZA 1QVCA 1N8RC 1N32Q 3GTKH 3BU2A 4JBMA 1PH5A 1HR0Q 4DR7L 1OXTA 2QGQA 1VQOA 2F52A 2RHQB 1FJGQ 4LF7Q 4K0KL 4DAYB 3J7ZC 3PUWA 4DV7L 1X54A 4JV5Q 2Q2IA 1V43A 4B3SQ 1PH7A 4JI4Q 4LFAQ 2K4KA 3PUYA 1IBLL 4LUZA 2A1AA 4L5TA 4LF6Q 3U58A 4H02A 2K5HA 4JC0A 4YCWA 1CUKA 5LMNW 1PH9A 3B6YA 2AHOB 1JT8A 3CCQA 2ALYB 4YWKA 1BBWA 1VQKA 2JA6G 1N36Q 1VQHA 5IP9G 4YHHL 2YU9H 1Q7YC 1L1OC 2D0PA 4DR5L 4LF6L 3CC2A 1NMGA 2E2HH 2OTJA 2ZM6Q 4NXMQ 1PYBA 4BY1G 3TQYA 4AYBE 5GADC 3H3VH 4JYAL 3KYHC 1O7IA 4GN3B 5IYCH 1E24A 2JEBI 5BR8L 2BA1A 4BBSG 4DPGA 1YVCA 1WYDA 4DV1Q 1SN8A 1WJJA 5AJ3Q 2JA7H 1U0LA 2JA8G 1Q86C 5E7NA 4JI0L 2PI2E 1K3RA 4L5RC 1YI2A 1I5FA 2Q2UA 3PUVA 1CSPA 4P74A 4IFDJ 4JI1Q 5LMNL 5EAYA 2K52A 3M85A 3T1HQ 2R7ZG 4DR2L 1XTDA 1TWHH 2KCTA 5M5YH 3NELA 4P72A 4QIWE 1KL9A 4PZ8A 3CCRA 1VQ5A 1BBUA 2GN5A 2I5MX 2WB1E 3AFQA 4PMWA 1IBKQ 5M5XH 2VW9A 4JI6Q 4IFDG 1WCMG 1VQ4A 3SGIA 2ZTDA 2UXDQ 2JJQA 1X3EA 2WAQE 3CQZH 3ULJA 4DUYQ 3I7FA 4JI2L 4A76A 1RIPA 3PO2H 3S2HH 5C4XG 4LF8L 4R4TA 5C44H 3UE0A 2AMCB 5IYBG 2JA5H 5IP7G 1Y1VH 4A3BH 2OQKA 1VQ7A 4IJLA 4IPHA 1GO3E 1ASYA 1W2BA 4C2MH 2UUBQ 3HOXG 3DLLA 1WFQA 3S16H 2NVYH 4BY7G 4RG1A 3S24A 4GNXA 4A3DG 1PVOA 1LTLA 3H0GG 1CKNB 4R4CA 2MO0A 1G291 4X66L 1PH6A 2E5LQ 3I4OA 1Q8KA 1VQEA 3CD6A 4QQBX 1OTCA 1CKOA 3AEVA 4DR1L 3H3VI 5M5WH 2I5HA 1HNWL 2R93G 3I56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IHF A;  3L7Z C;  2CQO A;  3U50 C;  1PV4 A;  2CFM A;  2VY3 A;  2VL6 A;  3E9H A;  2CCZ A;  2V1C C;  4GLV B;  4A3J G;  2MO1 A;  1I6H H;  5ELO A;  2RCN A;  4A3F H;  4L5Q A;  3AYH B;  1K9M C;  4QY7 A;  4HJ9 A;  4OO1 I;  2VS1 A;  1C0A A;  1EIF A;  1YHA A;  4APV A;  2OWO A;  4GN4 B;  5IY0 A;  3A0J A;  3J81 j;  2ZTC A;  1T9H A;  2YV5 A;  3K81 C;  3OTO L;  2VQF L;  2Z0S A;  4X62 L;  2NZH A;  1JJ2 A;  1BVS A;  2N49 A;  1YJW A;  1M90 C;  1XPU A;  5C3E H;  1MIU A;  2Q2H A;  1IYJ B;  1AE2 A;  3FKI H;  3MXN B;  4DV5 Q;  1VQN A;  4DR6 Q;  3PO3 H;  5HY6 A;  2R92 H;  2JEA I;  4DV4 L;  4X64 L;  1XMQ L;  4IOA A;  2F4V Q;  1UE6 A;  2I5L X;  4JI3 Q;  1N34 Q;  1QUQ B;  1EOV A;  5LMU Q;  2A8V A;  2JK8 A;  1TWG H;  2HQL A;  2Y0S G;  3K0X A;  3CPW A;  4A3M G;  1S72 A;  1E22 A;  4JI7 L;  4TQU S;  2YTV A;  1EFW A;  1IBM Q;  4LFC L;  1HNZ L;  3ICE A;  1I3Q H;  4IPG A;  3CP0 A;  1L1O A;  4EX5 A;  3F2B A;  5GAH C;  5M3F H;  2UU9 Q;  4DK3 C;  2HHH L;  4BBR H;  5C0X I;  2UUA L;  2NZO A;  1E3P A;  4ALP A;  2UUC Q;  1J6Q A;  1UWV A;  1HR0 W;  4TVA B;  3RN5 A;  4P71 A;  4O2D A;  5IYD H;  4BXX G;  4OWX B;  3I4M H;  4AH6 A;  1PH2 A;  4A93 H;  3HOY H;  2CWP A;  1KC8 C;  1L0W A;  3E9I A;  4QJF A;  1KXL A;  1WI5 A;  3LGJ A;  2QA4 A;  2BH8 A;  3OYY A;  5IWA L;  4DV3 Q;  1VQJ A;  1K8G A;  4AQY L;  1HNX L;  1HZB A;  4YCU A;  3D0F A;  1YNX A;  1ASZ A;  4PZ6 A;  4DV2 Q;  1XPO A;  3S1Q H;  4HJ5 A;  2IX0 A;  1EQQ A;  4B3T L;  3HOW G;  3UDF A;  1H95 A;  4X65 Q;  4O0A A;  2AWN A;  2NN6 I;  1AH9 A;  5M3M G;  3K8A A;  2K5N A;  1LM0 A;  4JCV E;  4QGU A;  3U4Z A;  1EWI A;  3HKS A;  4P75 A;  1QVG A;  1N32 L;  1TWA H;  4OWT B;  1HR0 L;  1Q12 A;  1EIY B;  4LF7 L;  4A4I A;  4A3I G;  4OX9 Q;  1FJG L;  1XNQ Q;  4JV5 L;  1UE1 A;  4B3S L;  4JI4 L;  2R7F A;  1AE3 A;  4LFA L;  1A62 A;  1KAW A;  3M9B A;  1HZ9 A;  4DUZ Q;  1FGU A;  1K73 C;  2VUM G;  2WP8 J;  2JA6 H;  3I4N G;  4WJ4 A;  5IP9 H;  3RR5 A;  2ZJQ A;  3K7U C;  4DV6 Q;  3PUZ A;  3HOV G;  1N36 L;  2RHS B;  4BY1 H;  2R7D A;  4C3H H;  4GOP C;  4KHZ A;  1YJN A;  1A63 A;  1B70 B;  2ZM6 L;  4NXM L;  4YY3 Q;  4BBS H;  2K50 A;  2MQH A;  2MNA A;  3AFP A;  3EBE A;  3A5U A;  2JA8 H;  2Z6K C;  4XTC S;  5JEA J;  3GDE A;  4DV1 L;  5AJ3 L;  1EYG A;  4B3R Q;  2LSS A;  3JAM c;  2L15 A;  1EUJ A;  3HOZ G;  1R9T H;  4KHP Q;  3S2D H;  1GM5 A;  5JEA G;  3CCL A;  4GNX B;  2R7Z H;  1OXV A;  4JOI A;  4JI1 L;  2VNU D;  3GTM H;  2N78 A;  5FLM G;  2B63 H;  2PI2 A;  3RLN A;  3CCM A;  3T1H L;  1XNR Q;  2F3I A;  3G4S A;  1OXS C;  1TWF H;  1VQC A;  2YTY A;  1MKH A;  1WCM H;  1GD7 A;  4HJA A;  3TRZ A;  1IBK L;  1SR3 A;  3OW2 A;  4JI6 L;  2KBN A;  2LXK A;  5C4X H;  3W1B A;  4KHP L;  3I55 A;  3JAM i;  4A3L G;  2KHJ A;  3TS0 A;  2QEX A;  4DUY L;  2UXD L;  4J15 A;  4MZ9 A;  1CSQ A;  5GRO A;  5IYB H;  4Y52 H;  5IP7 H;  4BA1 I;  2EIF A;  2N3S A;  1X65 A;  3GD7 A;  4KI0 A;  3CCJ A;  4A3E G;  5J3B A;  2VQE Q;  3STB C;  3NEM A;  2YTX A;  4LF9 Q;  4C3I H;  3HOX H;  1KRT A;  1X9N A;  4DV0 Q;  1SMX A;  1YHQ A;  4LUV A;  3PF4 A;  4BY7 H;  2UUB L;  3CC4 A;  4A3D H;  4A3G H;  3BZK A;  2A19 A;  2NVX H;  1SRU A;  2GVA A;  3H0G H;  1S3O A;  3K7A H;  3A74 A;  2VQE L;  1YBY A;  4JI8 Q;  1PH8 A;  3UDI A;  3CCU A;  4A3K G;  1HZA A;  1U5K A;  2KCM A;  2E5L L;  1JB7 A;  4DV0 L;  1VQ8 A;  1VQB A;  2R93 H;  4IPD A;  3S1R H;  2OQ0 A;  2Y0S E;  4MTN A;  1K0R A;  4NB3 A;  3CMA A;  4DR3 Q;  1XMO Q;  1Y1W G;  1I94 Q;  4A3J H;  2HT1 A;  1E7Z A;  3ULP A;  1PHJ A;  2XTI A;  3GTL H;  1PH3 A;  2HIX A;  4JBJ A;  4HIO A;  4L5S A;  4DR4 Q;  4JOI C;  3KDF B;  3KJO A;  3STB D;  2OTL A;  2RF4 A;  2R6G A;  1PFS A;  1L1O B;  1SLJ A;  2PMZ E;  3IRB A;  1MJC A;  4GKK Q;  4QL5 A;  3KFU A;  1NY4 A;  4UP9 A;  2PQA A;  5FJ8 G;  4LFB Q;  1VS0 A;  1V9P A;  1VQD A;  4P73 A;  4UP7 A;  5GAE C;  4LF4 Q;  3DM3 A;  4IFD I;  2IY5 B;  1RL2 A;  2K5V A;  1X3F A;  1Q1B A;  2AWO A;  1MJE A;  3G71 A;  1JJG A;  4DV5 L;  4DR6 L;  1VQP A;  4YWM A;  2E2J H;  4AIM A;  3CW2 C;  2E2I H;  1FVI A;  1N33 Q;  1OXU A;  4IO9 A;  4A3M H;  1Q46 A;  3KF6 B;  4JI3 L;  4POG A;  2F4V L;  1N34 L;  5JJL A;  4HJ8 A;  3HKZ G;  4WJ3 M;  5LMU L;  3S14 H;  4GKJ Q;  1Q81 C;  4A3C G;  1IBM L;  1GKH A;  3KF8 B;  1VQ9 A;  4MNO A;  3F2C A;  4GOP A;  2UU9 L;  4R1J A;  1KRS A;  4OWW B;  4IJH A;  1B7Y B;  1UEB A;  2AKW B;  2C35 B;  2ZJP A;  3T1Y Q;  2UUC L;  4BXX H;  1CKM A;  2Z6K A;  4BA2 I;  1VQI A;  2KEN A;  1NJI C;  3W1G A;  4IOC A;  3S1N H;  5C4J H;  2B29 A;  1YHB A;  3HFZ B;  1Q1E A;  4DNI A;  1X55 A;  1KQS A;  4PZ7 A;  4UP8 A;  1UE7 A;  2KHI A;  1SFO H;  3E0E A;  4DV3 L;  4LF5 Q;  3HOW H;  3PCO B;  4DV2 L;  2D0O A;  2K75 A;  1N9W A;  1X56 A;  3HOU G;  4DR7 Q;  5M3M H;  3RZO H;  4R4Q A;  5ELN A;  1JE5 A;  2UXB Q;  4K0K Q;  1GVP A;  4X65 L;  4C3J H;  3S1M H;  4DV7 Q;  2ZTE A;  4LW1 A;  1JMC A;  1VQ6 A;  1P8L A;  1IBL Q;  1Z47 A;  3KLW A;  3RLO A;  1QVF A;  4A3I H;  4OON A;  3EIV A;  3PIO A;  1S40 A;  2UXB L;  4FDB A;  4NXN Q;  3TS2 A;  4OX9 L;  1XNQ L;  3TEH B;  2VZA A;  3UDX A;  3H15 A;  3UDG A;  1NBW A;  4GLX A;  1X6O A;  3WWV A;  1IZ6 A;  3TRE A;  2MFI A;  4YHH Q;  1J5E Q;  3GTO H;  4DR5 Q;  5JJK A;  2VUM H;  3I4N H;  5IE8 A;  1A0I A;  1SRO A;  4NXN L;  1YIJ A;  4DUZ L;  1NMF A;  3CCE A;  4JYA Q;  2NVQ H;  3HOV H;  4POF A;  1KIX A;  3ZJY C;  1IL2 A;  1WOC A;  1Z9F A;  3JC6 6;  5BR8 Q;  4DV6 L;  3GTJ H;  5IYC G;  1J5E L;  1PA6 A;  3PSI A;  4JBK A;  4JI0 Q;  2LXJ A;  4HID A;  4PG3 A;  3NEN A;  3J80 c;  4YY3 L;  1VQL A;  2JA7 G;  1B8A A;  1TWC H;  1TXY A;  1PYS B;  1XJV A;  1KHI A;  5LMN Q;  3NBH B;  2EXD A;  1LUZ A;  2YYZ A;  1YZ6 A;  3F8T A;  3CCV A;  4OO1 G;  4DR2 Q;  3HOZ H;  1Y14 B;  2H5X A;  2ID0 A;  3M4O H;  4B3R L;  2IT1 A;  1K8A C;  2E8G A;  5FLM H;  3FP9 A;  2I0Q A;  1YJ9 A;  4JI5 Q;  4JG2 A;  2DUD A;  4Y7N H;  1A8V A;  3AQQ A;  3RZD H;  3J80 i;  4JI2 Q;  4LWC A;  3MEF A;  4LF8 Q;  1XNR L;  3M4P A;  3PUX A;  2UXC Q;  4IPC A;  2ATW A;  3ER0 A;  2BA0 A;  1LYL A;  1VQA A;  5DLQ E;  3FHW A;  4UY8 C;  3PO2 G;  4A3L H;  4AYB G;  4JI5 L;  5C44 G;  3F1Z A;  2XGT A;  5H1S E;  1VQM A;  3VDY A;  3KOJ A;  2JA5 G;  5HGQ A;  1Y1V G;  4A3B G;  1YEZ A;  4A3E H;  5C0X J;  4XIG S;  2UXC L;  4HIK A;  2FXQ A;  3EN2 A;  1HJP A;  4DKA C;  1V1Q A;  4LF9 L;  4X6A H;  3I2Z A;  3CME A;  3J81 c;  4X66 Q;  3GTG H;  2Q2T A;  5C0X G;  2PQA B;  1HH2 P;  5FLX c;  2JA9 A;  2IHE A;  4DR1 Q;  4HJ7 A;  1G51 A;  1FL0 A;  1HNW Q;  4GS3 A;  4LUO A;  4A3K H;  3UE1 A;  3GTQ H;  3CAM A;  2WB1 G;  4HIM A;  2DGY A;  4JI8 L;  4ME3 A;  1L2F A;  1K83 H;  1PH4 A;  4GLA C;  1IXR A;  3Q8D A;  1DGS A;  2GVB A;  3CC7 A;  2WAQ G;  1Y1W H;  3S17 H;  3HKZ E;  3J81 i;  1EQR A;  2NVT H;  1XMO L;  4DR3 L;  1HZC A;  1C9O A;  2OCE A;  4A3F G;  1I94 L;  3M3Y H;  5GAG C;  2ES2 A;  1OXX K;  3OTO Q;  4B3M Q;  2VQF Q;  4X62 Q;  1QZG A;  4DR4 L;  1X3G A;  3BZC A;  3CXC A;  3W5O A;  2NN6 G;  4LNQ A;  2ZJR A;  2K14 A;  3U4V A;  4EQ5 A;  1VCI A;  4A75 A;  4GOP B;  2JQO A;  5FJ8 H;  4GKK L;  1E1T A;  4UPA A;  4R4O A;  2B63 G;  5C3E G;  1CKN A;  1E1O A;  2HIV A;  3FKI G;  4OXP A;  3G48 A;  1M1K C;  5GQO A;  4YWL A;  4B3M L;  4LFB L;  1VQG A;  4LF4 L;  3PO3 G;  4DV4 Q;  2CKZ B;  4X64 Q;  1XMQ Q;  2R92 G;  4DAM A;  3RLF A;  3G6E A;  3PV0 A;  2JE6 I;  4DK6 C;  1JJC B;  4JI7 Q;  3BJU A;  2CWA A;  1NE3 A;  4NPS A;  3CPF A;  1XPR A;  1W3S A;  1HNZ Q;  1D8L A;  1P16 A;  1SE8 A;  4LFC Q;  4KLK A;  3PIP A;  2BH2 A;  2IX1 A;  5JJI A;  1N33 L;  2HHH Q;  4A3C H;  2UUA Q;  1Q82 C;  5M3F G;  4GKJ L;  4YCV A;  2D62 A;  2B3G A;  2N8N A;  3ULL A;  4BBR G;  1C7Y A;  4GNX C;  2ASB A;  3KDF A;  5K36 G;  3J7A 5;  1NTG A;  4GN5 A;  1KD1 C;  5IYD G;  1PH1 A;  1G6P A;  3I4M G;  4JBW A;  3GO5 A;  3RN2 A;  4A93 G;  3HOY G;  3T1Y L;  3L2P A;  3M7N A;  1VQF A;  5IT9 c;  5IWA Q;  3A5Z B;  1HNX Q;  4AQY Q;  1UE5 A;  3PF5 A;  3M4Q A;  1QUQ A;  4RMF A;  3F2D A;  1I50 H;  3CF5 A;  3KJP A;  4A3G G;  4B3T Q;  3GTP H;  3ERS X;  3L0O A;  3CCS A;  1YIT A;  3S15 H;  3K80 C;  1QZH A;  1D7Q A;  2PNH A;  4R4I A;  2WFW A;  3RNU A;  3HOU H;  2EQS A;  4LF5 L;  3D31 A;  3KF6 A;  1BKB A;  3PGZ A;  1QVC A;  1N8R C;  1N32 Q;  3GTK H;  3BU2 A;  4JBM A;  1PH5 A;  1HR0 Q;  4DR7 L;  1OXT A;  2QGQ A;  1VQO A;  2F52 A;  2RHQ B;  1FJG Q;  4LF7 Q;  4K0K L;  4DAY B;  3J7Z C;  3PUW A;  4DV7 L;  1X54 A;  4JV5 Q;  2Q2I A;  1V43 A;  4B3S Q;  1PH7 A;  4JI4 Q;  4LFA Q;  2K4K A;  3PUY A;  1IBL L;  4LUZ A;  2A1A A;  4L5T A;  4LF6 Q;  3U58 A;  4H02 A;  2K5H A;  4JC0 A;  4YCW A;  1CUK A;  5LMN W;  1PH9 A;  3B6Y A;  2AHO B;  1JT8 A;  3CCQ A;  2ALY B;  4YWK A;  1BBW A;  1VQK A;  2JA6 G;  1N36 Q;  1VQH A;  5IP9 G;  4YHH L;  2YU9 H;  1Q7Y C;  1L1O C;  2D0P A;  4DR5 L;  4LF6 L;  3CC2 A;  1NMG A;  2E2H H;  2OTJ A;  2ZM6 Q;  4NXM Q;  1PYB A;  4BY1 G;  3TQY A;  4AYB E;  5GAD C;  3H3V H;  4JYA L;  3KYH C;  1O7I A;  4GN3 B;  5IYC H;  1E24 A;  2JEB I;  5BR8 L;  2BA1 A;  4BBS G;  4DPG A;  1YVC A;  1WYD A;  4DV1 Q;  1SN8 A;  1WJJ A;  5AJ3 Q;  2JA7 H;  1U0L A;  2JA8 G;  1Q86 C;  5E7N A;  4JI0 L;  2PI2 E;  1K3R A;  4L5R C;  1YI2 A;  1I5F A;  2Q2U A;  3PUV A;  1CSP A;  4P74 A;  4IFD J;  4JI1 Q;  5LMN L;  5EAY A;  2K52 A;  3M85 A;  3T1H Q;  2R7Z G;  4DR2 L;  1XTD A;  1TWH H;  2KCT A;  5M5Y H;  3NEL A;  4P72 A;  4QIW E;  1KL9 A;  4PZ8 A;  3CCR A;  1VQ5 A;  1BBU A;  2GN5 A;  2I5M X;  2WB1 E;  3AFQ A;  4PMW A;  1IBK Q;  5M5X H;  2VW9 A;  4JI6 Q;  4IFD G;  1WCM G;  1VQ4 A;  3SGI A;  2ZTD A;  2UXD Q;  2JJQ A;  1X3E A;  2WAQ E;  3CQZ H;  3ULJ A;  4DUY Q;  3I7F A;  4JI2 L;  4A76 A;  1RIP A;  3PO2 H;  3S2H H;  5C4X G;  4LF8 L;  4R4T A;  5C44 H;  3UE0 A;  2AMC B;  5IYB G;  2JA5 H;  5IP7 G;  1Y1V H;  4A3B H;  2OQK A;  1VQ7 A;  4IJL A;  4IPH A;  1GO3 E;  1ASY A;  1W2B A;  4C2M H;  2UUB Q;  3HOX G;  3DLL A;  1WFQ A;  3S16 H;  2NVY H;  4BY7 G;  4RG1 A;  3S24 A;  4GNX A;  4A3D G;  1PVO A;  1LTL A;  3H0G G;  1CKN B;  4R4C A;  2MO0 A;  1G29 1;  4X66 L;  1PH6 A;  2E5L Q;  3I4O A;  1Q8K A;  1VQE A;  3CD6 A;  4QQB X;  1OTC A;  1CKO A;  3AEV A;  4DR1 L;  3H3V I;  5M5W H;  2I5H A;  1HNW L;  2R93 G;  3I56 A; 
#chains in the Genus database with same CATH topology
 3TZU A;  4CKC A;  2CQO A;  1SYD A;  1PV4 A;  2CFM A;  2MO1 A;  1V1P A;  5ELO A;  4BS9 A;  2B8F A;  4A3F H;  4L5Q A;  3CRL C;  1K9M C;  4QY7 A;  4OO1 I;  1C0A A;  1YNN C;  3I4L A;  4CDE C;  1SFO B;  3OTO L;  3K81 C;  1BUV T;  2VQF L;  1M90 C;  1SNC A;  4OHJ A;  3RZO B;  5C3E H;  5IOD A;  2F0P A;  2G9D A;  3GTP B;  2RVL A;  4DR6 Q;  3S15 B;  5EJW A;  4DU9 A;  1SNO A;  3ND8 A;  1XMQ L;  5NUC A;  2QCP X;  4JI3 Q;  1PMR A;  1QUQ B;  1EOV A;  2XN9 C;  4A3M G;  2D5D A;  3CPW A;  2YTV A;  1IBM Q;  4LFC L;  1HNZ L;  3OIQ A;  2RSN A;  2HHH L;  4I7Z C;  2UUA L;  2NZO A;  5K36 H;  2FIN B;  3L9A X;  1UUP A;  3RN5 A;  4P71 A;  4O2D A;  5IYD H;  4IUT A;  3I4M H;  4AH6 A;  4A93 H;  2AUK A;  2CWP A;  4FO2 A;  1PLF A;  2MP1 A;  2E74 C;  1DJR D;  3C2P A;  5IWA L;  1PRT F;  1YNX A;  3DM1 A;  1XPO A;  5CV6 A;  2NVT B;  1VMP A;  3A8K E;  2EJG C;  2NN6 I;  2A6E C;  2B8G A;  3KF8 A;  2K5N A;  1LM0 A;  4Y7N B;  1EWI A;  3TDQ A;  4Q5V A;  4OWT B;  1TWH B;  4LF7 L;  2KVM A;  4A4I A;  4OX9 Q;  2KEE A;  4JI4 L;  2AUJ D;  2KEC A;  1R4P B;  1KAW A;  3PO2 B;  2DN8 A;  1D5M C;  1WTR A;  1K73 C;  1QCB D;  2WP8 J;  1Y1V B;  4IUV A;  5DAU A;  5IP9 H;  2IWH A;  2F0O A;  4KKT A;  2VB3 X;  4XYQ A;  4C3H H;  1A63 A;  1B70 B;  4HAE A;  4NXM L;  3GTQ B;  2K50 A;  3HZX A;  4XTC S;  5JEA J;  1O7Y A;  1KLU D;  4LJZ C;  1EYG A;  4B3R Q;  3FMC A;  4KHP Q;  4C56 C;  1KNA A;  5JEA G;  1NR2 A;  1F2M A;  2VNU D;  3GTM H;  5FLM G;  3BDO A;  2B63 H;  2AQ3 B;  3T1H L;  3S9W A;  2F3I A;  3ITP A;  1C48 A;  1LTS D;  2KJX A;  1GD7 A;  5FO9 B;  3OW2 A;  2KBN A;  2LXK A;  3W1B A;  1TQO A;  4DUY L;  4MZ9 A;  4K2K A;  4Y52 H;  1V1P B;  4BA1 I;  4KI0 A;  3FKI B;  3CRK C;  1LTT D;  2YTX A;  4U68 A;  4LAA A;  4C3I H;  2QDB A;  2MPM A;  1T5E A;  1BCP D;  1YHQ A;  3QOL A;  3PF4 A;  3SR1 A;  4MHE A;  1TWG B;  3E6Z X;  5TSS A;  1FD7 D;  4S3S A;  1YBY A;  4JI8 Q;  1QWY A;  1KAA A;  1JB7 A;  3BG3 A;  4IPD A;  2Y0S E;  1SXT A;  3CMA A;  4A3J H;  1E7Z A;  1QNU A;  1PHJ A;  3EFX D;  3A55 A;  1PH3 A;  2HIX A;  4DR4 Q;  4F88 A;  3KDF B;  5COY A;  1NNX A;  3STB D;  1PFS A;  3MC0 B;  1SLJ A;  2PMZ E;  3IRB A;  4MN3 A;  5CBE E;  1MD2 D;  4GKK Q;  4TRD A;  3W3A A;  4P73 A;  1V9P A;  2KUM A;  1EU3 A;  5GAE C;  4IFD I;  3GTK B;  3BZD B;  1BR9 A;  1JJG A;  2CH4 A;  3A7A B;  4YWM A;  1IW7 C;  3E0J A;  3CW2 C;  3FRP B;  3A8I E;  4RCN A;  4IO9 A;  1Q46 A;  3KF6 B;  1N34 L;  1J9O A;  4WJ3 M;  5LMU L;  1TKW B;  1CHQ D;  1WD0 A;  4A3C G;  5CV5 A;  5KIX A;  3KF8 B;  3BDL A;  3F2C A;  1TR5 A;  1KDA A;  4R1J A;  1KRS A;  1SNM A;  1CM9 A;  1ML0 D;  1UEB A;  1EY9 A;  2UUC L;  2LY7 A;  1WTP A;  2JA6 B;  2Z6K A;  4BA2 I;  1VQI A;  2KEN A;  1XTC D;  3ND9 A;  2EYM A;  1GOZ A;  2L11 A;  5EPJ A;  2P5Z X;  3HFZ B;  5G3L D;  1I4H A;  4DNI A;  1KQS A;  1NR4 A;  4PZ7 A;  3RD4 A;  3E0E A;  1PTO D;  4DV3 L;  1NSN S;  2NB0 A;  3HOU G;  4DR7 Q;  1LAC A;  4ULL A;  3N6R A;  4DV7 Q;  1JWS D;  1R9T B;  2ZTE A;  1JMC A;  3KBG A;  1Z47 A;  2FMC A;  1GXD C;  1S5F D;  4B9W A;  4OON A;  3PIO A;  2UXB L;  3TEH B;  5EQ0 A;  2VZA A;  3H15 A;  4A3B B;  3UDG A;  1NBW A;  4GLX A;  3SEB A;  3TRE A;  2MFI A;  3I72 A;  5C6A A;  2XIW A;  1ROD A;  2VUM H;  3A8J E;  5JJK A;  1X3P A;  5IE8 A;  5C4H A;  1ONL A;  2NVY B;  1KIX A;  3ZJY C;  1EEI D;  4DV6 L;  5IYC G;  1J5E L;  4RA8 A;  1FGB D;  4FF4 A;  2NVX B;  4L8J A;  3J80 c;  3M7G A;  1TWC H;  3E3X A;  2WAQ B;  3J7A V;  1YZ6 A;  1AW7 A;  3HOZ H;  3M4O H;  3NHH A;  2EJF C;  3SK6 A;  2GA4 B;  1M8A A;  1ZYR C;  4JG2 A;  2F0V A;  3AQQ A;  2XSC A;  3ER0 A;  3MFG A;  3FHW A;  3PO3 B;  4JI5 L;  4A3B G;  3R93 A;  2NBF A;  5FK9 C;  4A3E H;  4RGT A;  2NYZ D;  2UXC L;  3TP5 A;  1HJP A;  1AEX A;  5KND A;  4IUN A;  1TY2 A;  4X66 Q;  3GTG H;  4IUR A;  2Q2T A;  3G6J B;  5FLX c;  4HTH A;  3TSS A;  2IHE A;  4HJ7 A;  4BBR B;  4ME3 A;  2EYF A;  4GLA C;  4DK1 A;  2GVB A;  2WAQ G;  1ZKO A;  3J81 i;  1EQR A;  4DR3 L;  1XYI A;  3PIO 3;  5IGC A;  1ENA A;  3DWP A;  2CHB D;  2ES2 A;  1QOH A;  3OTO Q;  2VQF Q;  1IKL A;  1TII D;  4LNQ A;  2J4X A;  5ELC A;  2AQ2 B;  4CDD C;  2ICE C;  1E1O A;  2RKS A;  4OXP A;  3G48 A;  4B3M L;  3PO3 G;  4CGY B;  1XMQ Q;  1TWA B;  4DAM A;  3RLF A;  3G6E A;  2K03 A;  1BCP B;  4LFC Q;  1HNZ Q;  4KLK A;  5JJI A;  2BH2 A;  3SK5 A;  3KLS X;  2HHH Q;  5C3X A;  1D5X C;  4PMB A;  3SXH A;  2UUA Q;  1Q82 C;  1H9J A;  4BWG B;  3ULL A;  4BBR G;  1K8O A;  2ASB A;  4HCE A;  2B2W C;  1FNW A;  1SYE A;  1KD1 C;  1G6P A;  3P20 A;  2F0F A;  3GO5 A;  1EZ8 A;  5I2Y A;  2KCC A;  3H09 A;  2PW5 A;  3HP3 A;  5IWA Q;  3AU7 A;  1SYG A;  4RMF A;  3F2D A;  1QZH A;  3K6O A;  3S2D B;  5K5P A;  4LF5 L;  3D31 A;  3BU2 A;  1VQO A;  3NWS A;  4LF7 Q;  4K0K L;  1EEF D;  2Q2I A;  1G6Z A;  1PH7 A;  4JI4 Q;  5C4X B;  5FOB B;  2LMC B;  1IBL L;  3HS0 C;  4L5T A;  5KEE A;  3U58 A;  2K5H A;  4JC0 A;  4YCW A;  4OEM B;  1JIC A;  2AHO B;  5I6W A;  5DNF A;  1B1Z A;  4TKO B;  2ALY B;  1VQK A;  1VQH A;  1PFB A;  2QIL A;  4YHH L;  1Q7Y C;  1GHJ A;  4DR5 L;  4A3D B;  3CC2 A;  2E2H H;  4NXM Q;  1PYB A;  1RTN A;  4AYB E;  3H0G B;  4JYA L;  1O7I A;  4N9T A;  2JEB I;  1BBX C;  4BBS G;  2EY5 A;  2QDL A;  1WYD A;  1WJJ A;  2JA7 H;  1U0L A;  5I4D A;  1K3R A;  1PTO B;  2DNE A;  5DM6 3;  3HRZ C;  4C1N I;  4P74 A;  5LMN L;  5EAY A;  3M85 A;  3T1H Q;  3S17 B;  3R3O A;  4P72 A;  1EY0 A;  4PMW A;  1WCM G;  2ZTD A;  2JJQ A;  1X3E A;  4DUY Q;  4JI2 L;  5C4X G;  4A76 A;  3ERO A;  3H3V C;  3UE0 A;  1MI2 A;  1CZW A;  2JA5 H;  3CKI B;  5IP7 G;  1VQ7 A;  1ASY A;  1W2B A;  4C2M H;  1PZK D;  2CQA A;  1Q90 A;  2MJ8 A;  2F0G A;  5IT9 E;  3S24 A;  4A3D G;  5C0X H;  1PVO A;  1STY A;  1LTL A;  3H0G G;  5E4W C;  1Q8K A;  3CD6 A;  1SMY D;  4DR1 L;  1HNW L;  3UI2 A;  4RGN A;  3I56 A;  3FVQ A;  5JOB A;  1RHP A;  3U50 C;  1G2T A;  3E9H A;  3QR8 A;  1ESR A;  4MTK A;  2RCN A;  3AYH B;  5C4J B;  1EIF A;  1RCV D;  1YHA A;  2OWO A;  3J81 j;  2ZTC A;  4IZ8 A;  4ZUI A;  2B2V C;  2YV5 A;  3HOW B;  3OSO A;  1IL8 A;  1BVS A;  3BDC A;  2IX3 A;  5M3M B;  4QB4 A;  4K6L A;  3MXN B;  1VQN A;  1AE2 A;  1ILQ A;  4NDX A;  4Z9C B;  4X64 L;  1N34 Q;  5E1F A;  3MXU A;  1GHK A;  1DOM A;  1PDQ A;  2NTS A;  5LMU Q;  2HQL A;  3K0X A;  1S72 A;  1E22 A;  4TQU S;  3A7L A;  4PMC A;  1I3Q H;  4IPG A;  3CP0 A;  4JVZ A;  5GAH C;  3A54 A;  3NP8 A;  3I4N B;  1AN8 A;  4DK3 C;  3NBI A;  4RGM A;  5EGT A;  4L63 B;  1E3P A;  3N52 A;  4ALP A;  2UUC Q;  1J6Q A;  1UWV A;  1HR0 W;  3RUZ A;  5D3D A;  2A5H A;  4OWX B;  3T13 A;  4KN7 C;  3HOY H;  1TY0 A;  1L0W A;  1WI5 A;  2BH8 A;  3OYY A;  4DV3 Q;  4A3G H;  4YCU A;  1E0B A;  3S1Q H;  1Y69 U;  3HOW G;  3UDF A;  5HGT A;  2XVS A;  3J81 E;  2B2U A;  5M3M G;  4QGU A;  4JCV E;  1JOQ A;  1U9R A;  4QF4 A;  4RHS A;  1QVG A;  5M5Y B;  1Q12 A;  1FJG L;  4RCO A;  4I65 A;  2R7F A;  3W2D A;  2PCF B;  3DWQ A;  3M9B A;  3VYR A;  1FGU A;  3I4N G;  2NWG A;  2TMP A;  1JOO A;  3RR5 A;  4DV6 Q;  2EYJ A;  3PUZ A;  4PNY A;  4DA2 A;  4BY1 H;  4IQZ A;  1MBY A;  4HN7 A;  2OEO A;  4KHZ A;  5EBD A;  2K6A A;  2ZM6 L;  1LAB A;  3A5U A;  3AFP A;  3EBE A;  1K83 B;  1E2V A;  1SE3 A;  2K33 A;  2PW7 A;  5A2Q E;  2Z6K C;  1BO0 A;  5I6Y A;  4OL7 A;  1Y1W B;  4KD4 A;  4DAY A;  2WB1 B;  4K5V A;  2JN4 A;  2L15 A;  1BCP C;  3M3Y B;  5IT9 L;  2R7Z H;  3CCL A;  1B2T A;  5I2X A;  4JOI A;  2B2T A;  2N78 A;  2PI2 A;  3G4S A;  1STN A;  1TWF H;  1VQC A;  1MKH A;  1RF2 D;  1E2W A;  4HJA A;  1ESF A;  1SR3 A;  1SE4 A;  3JAM i;  4U67 3;  2UXD L;  4ZUJ A;  1O7L A;  1KTK A;  4PQX A;  2N3S A;  3KLS A;  2VQE Q;  3STB C;  2E75 C;  2F03 A;  4LMQ D;  3HOX H;  1X9N A;  3HKZ B;  4LUV A;  3CU7 A;  1FNV A;  3K7A H;  3CCU A;  4KKS A;  1I4R A;  1HZA A;  1U5K A;  3VYT A;  2PYK A;  1C4Q A;  4DV0 L;  3S1R H;  1TVX A;  2HDM A;  2F0I A;  4IUP A;  1TS4 A;  2OQ0 A;  4MTN A;  4DR3 Q;  1Y1W G;  1SYF A;  1SAP A;  3GTL H;  2KA7 A;  4HIO A;  4L5S A;  3KJO A;  1I50 B;  2OTL A;  2R6G A;  1G8Z D;  1F9R A;  1MJC A;  2F3V A;  1AP0 A;  3SVM A;  1F77 A;  1Z6H A;  4UP7 A;  5AFW A;  3DM3 A;  3Q6S A;  4NP5 A;  3DWA A;  3T16 A;  2K5V A;  1X3F A;  1Q1B A;  3G71 A;  3OMG A;  4DV5 L;  2R61 A;  2E2J H;  2E2I H;  1D2B A;  2KOL A;  1OXU A;  4A3M H;  5JJL A;  4WOR A;  3HKZ G;  5FO8 B;  1B4O A;  1PTO C;  3S14 H;  3J81 L;  3LNN A;  2M9V A;  1F2Z A;  4M8A A;  4MNO A;  4GOP A;  1LO5 D;  2UU9 L;  3I3C A;  2IPK D;  1LTA D;  1DON A;  2C35 B;  4H44 C;  1QIL A;  5C5L A;  4G4K A;  4WFN 3;  4C3H B;  3S1N H;  1X55 A;  3SHL A;  5E3F A;  3NWT A;  1SFO H;  2QEJ C;  4LF5 Q;  4HSV A;  3K5L A;  5EPK A;  3VR6 A;  1TS5 A;  4DV2 L;  1FYC A;  3RZO H;  1JE5 A;  5LL6 X;  3R2I A;  4K0K Q;  4JW0 A;  5M5X B;  5CV8 A;  1MSH A;  2OXP A;  3IL8 A;  1P8L A;  1EY8 A;  1IBL Q;  3CQZ B;  2EYH A;  3S2H B;  2B63 B;  1BCP F;  5A2Q L;  4CJ2 C;  1SDF A;  2O4X A;  1DCZ A;  4FDB A;  3TS2 A;  1XXG A;  1XNQ L;  1HCZ A;  5HUR A;  4YHH Q;  1UAP A;  3T4A C;  4DR5 Q;  1PFM A;  3E5S A;  4F87 A;  3OOC A;  4NXN L;  1A15 A;  4DUZ L;  1NAP A;  1NMF A;  5ELD A;  3CCE A;  4JYA Q;  1IL2 A;  1Z9F A;  3JC6 6;  5DM7 3;  4N9P A;  2KCN A;  4M1U B;  5M5W B;  4PG3 A;  1H9R A;  4YY3 L;  1VQL A;  3VR5 A;  1PYS B;  4ABN A;  4XT1 B;  5LMN Q;  3NBH B;  1I6H B;  1LUZ A;  2YYZ A;  3F8T A;  3CCV A;  4OO1 G;  1Y14 B;  2ID0 A;  4DK0 A;  5JEA H;  2Z9H A;  1K8A C;  2E8G A;  4A3J B;  5FLM H;  2B39 A;  2SDF A;  1YJ9 A;  3OMC A;  1UNS A;  4Y7N H;  4FXK C;  4JI2 Q;  1G2S A;  2X69 A;  1XNR L;  5D14 A;  3PUX A;  2ATW A;  1I6V C;  3IKJ A;  3PO2 G;  1GJX A;  4MIU A;  2VXW A;  1LLR D;  2R92 B;  1PRT D;  3OWF A;  3SK4 A;  1Y1V G;  2NUC A;  2F0U A;  4XIG S;  2PQE A;  2FXQ A;  4HMI A;  3D6C A;  3Q0A A;  3ZYY X;  1X32 A;  3VA7 A;  1SSO A;  2JYO A;  1HH2 P;  1RJT A;  3Q22 A;  5M3F B;  2XWB B;  4DR1 Q;  1R4Q B;  1HNW Q;  4LUO A;  4KN4 C;  3GTQ H;  3CAM A;  4HIM A;  2DGY A;  2JSO A;  1PTO F;  1DGS A;  3CC7 A;  1W6J A;  1EIH A;  4FXD A;  4ZKB B;  2OCE A;  4QMG A;  2V4D A;  3R2T A;  1X3G A;  5KRU A;  3D4D A;  2NN6 G;  2K14 A;  3U4V A;  4DXF A;  4EQ5 A;  4A75 A;  1IYU A;  4GOP B;  1E1T A;  1L0Y B;  1CKN A;  1LT3 D;  2HIV A;  3FKI G;  4LFB L;  2EVB A;  1M1K C;  4LF4 L;  2CKZ B;  4X64 Q;  2R92 G;  1B3Q A;  5ISR A;  2LFN A;  3PV0 A;  1NE3 A;  3CPF A;  3TP7 A;  1W3S A;  1P16 A;  2DY8 A;  1KLG D;  3JAM E;  2O2L D;  2KQ3 A;  4A3C H;  5M3F G;  4GKJ L;  2D62 A;  3NQT A;  3J7A 5;  4J6H A;  2RDG A;  1DYQ A;  3DEO A;  3L2P A;  2JA8 B;  3A5Z B;  1D1I A;  3CF5 A;  1PFN A;  1CFM A;  4ZYS A;  3QOJ A;  2CVR A;  1YIT A;  2A68 D;  4KJN A;  2PNH A;  2WFW A;  3Q23 A;  5EPL A;  4DFA A;  3HOU H;  2EQS A;  3PGZ A;  1QVC A;  3H6M A;  3GTK H;  3HOZ B;  1FJG Q;  5C4Z A;  1X54 A;  1A2T A;  1V43 A;  1JQY D;  1H9K A;  2A1A A;  3P75 A;  1SJE D;  2K5D A;  4DAV A;  3B6Y A;  4C1N K;  5ELF A;  2JA6 G;  4BY7 B;  2D0P A;  4LF6 L;  1U4L A;  4ZQ3 A;  2OTJ A;  2ZM6 Q;  3TQY A;  3BS1 A;  3H3V H;  2BE5 D;  3KYH C;  3J7A F;  5JPM C;  5IYC H;  1E24 A;  2EZV A;  2BA1 A;  1CK1 A;  2R93 B;  1O80 A;  4DPG A;  2JA8 G;  1JWM D;  1WTW A;  2Z4I A;  1I5F A;  3PUV A;  4KKU A;  4I7A A;  4IFD J;  1STE A;  4DR2 L;  2KCT A;  2HQE A;  3NEL A;  4LK1 C;  4QIW E;  1KL9 A;  1VQ5 A;  2GN5 A;  1ICW A;  2VW9 A;  4IFD G;  2B2U C;  2PNR C;  1SMY C;  2EJM A;  2UXD Q;  2WAQ E;  4ID6 A;  3URY A;  2AMC B;  5IYB G;  4A3B H;  2OQK A;  5D3I B;  4V0B A;  4TSS A;  3DLL A;  1WFQ A;  1I4G A;  2F4I A;  2NVY H;  4BY7 G;  4CDF C;  1CKN B;  4RWS C;  4OIK A;  1QG7 A;  3AEV A;  2R93 G;  2IHF A;  3VR4 A;  2VY3 A;  5I9O A;  1FR3 A;  1VF5 C;  4XDX A;  3JAM L;  3NTK A;  3MHB A;  4HJ9 A;  4UAI A;  3A0J A;  2XWJ B;  1T9H A;  2FJ2 A;  2MGS A;  3K58 A;  1L0X B;  2Z0S A;  4X62 L;  1GUN A;  3K57 A;  2B2T C;  1XPU A;  1YJW A;  4CJ1 B;  1STH A;  1B9M A;  1G91 A;  2PZW A;  2Q2H A;  4DV5 Q;  2RQX A;  3S1M B;  1PRT B;  4C3J B;  2WIN B;  1TS3 A;  3PO3 H;  3GV3 A;  1LT5 D;  5LHY 1;  2K04 A;  4CKE A;  4A3I B;  1UE6 A;  2I5L X;  2M2L A;  4DXG A;  1FNU A;  4IOA A;  1F2Y A;  2JK8 A;  1HPC A;  2A69 D;  1BF4 A;  2EYL A;  1EFW A;  2F0J A;  3Q24 A;  3ICE A;  1K28 A;  4EX5 A;  3GTO B;  2UU9 Q;  4BBR H;  5C0X I;  2NVQ B;  4ZCK A;  3HOV B;  1STB A;  4BXX G;  1PH2 A;  1KC8 C;  3TN2 A;  3E9I A;  3NUC A;  4QJF A;  2E2H B;  4IUQ A;  4OGQ C;  2EPB A;  2WV6 D;  1K8G A;  1HNX L;  1VQJ A;  1ASZ A;  3D0F A;  4PZ6 A;  4DV2 Q;  2G5D A;  5IIF A;  4HJ5 A;  1EQQ A;  3A56 A;  4B3T L;  5IGG A;  1H95 A;  3K0Y A;  1JCK B;  2EE1 A;  3K8A A;  2M00 A;  5CV9 A;  4C3J G;  3HKS A;  2E2D C;  4P75 A;  1N32 L;  1TWA H;  3KLR A;  1HR0 L;  2SNS A;  1EIY B;  4A3I G;  3WOE A;  1XNQ Q;  1EQV A;  1UE1 A;  4B3S L;  1AE3 A;  4LFA L;  1F9S A;  1HZ9 A;  4DUZ Q;  1IHZ A;  3DHQ A;  1HXY D;  5EKK A;  2ZJQ A;  5KYL A;  1EYD A;  3HOV G;  5KGU A;  2RHS B;  4RKL A;  2R7D A;  3EVQ A;  4GOP C;  1YJN A;  2H4O A;  4A3K B;  4G7O C;  4YY3 Q;  4BBS H;  5FO7 B;  3I90 A;  2ZXO A;  5D65 A;  3H94 A;  2DNC A;  3GDE A;  2PZU A;  4DV1 L;  1EIG A;  1EUJ A;  3S2D H;  1OXV A;  1QE6 A;  4JI1 L;  1JE4 A;  3RLN A;  3CCM A;  3BVM A;  1XNR Q;  1BOS A;  2RSO A;  1OXS C;  1WCM H;  4CKB A;  1QNK A;  5J1Z A;  5C4X H;  4KHP L;  3I55 A;  1D5Z C;  3EJI A;  4A3L G;  2KHJ A;  3TS0 A;  4J15 A;  5GRO A;  1CSQ A;  1U4R A;  2EOT A;  1CA6 A;  5IP7 H;  2EIF A;  3CCJ A;  1SNP A;  1X65 A;  2RCF A;  4WJW A;  5J3B A;  3IAY A;  4FYD A;  4UHV A;  2UUB L;  3CC4 A;  1BQQ T;  4A3D H;  2A19 A;  2HD3 A;  3H0G H;  1LTG D;  1PH8 A;  4R8I A;  4A3K G;  2EYP A;  1I3Q B;  1ZYR D;  4H7B A;  1K0R A;  2MHV A;  4NB3 A;  3SDZ A;  1PTO H;  2HT1 A;  3ULP A;  2XTI A;  3FPU B;  3HOY B;  5J22 A;  2O5J C;  4ZKC B;  1B9N A;  4YIJ A;  3KFU A;  5JVH 3;  5FJ8 G;  4LFB Q;  4A3G B;  4LF4 Q;  2IY5 B;  1RL2 A;  2AWO A;  1DZ1 A;  4ZK9 B;  4AIM A;  3IFD A;  2KHS A;  1FVI A;  3H91 A;  5CBA E;  1GUS A;  3LWE A;  4CJ0 B;  2F4V L;  4FVM A;  4HJ8 A;  4EGV A;  4GKJ Q;  1Q81 C;  4DGZ A;  4R8N A;  1BNZ A;  1JC7 A;  4WRD A;  2L1B A;  1GKH A;  1VQ9 A;  2YU9 B;  4OWW B;  2B2Y A;  4IJH A;  4IUU A;  2AKW B;  3C46 A;  1DD2 A;  2ZJP A;  3MA2 B;  4FP5 D;  5JJZ A;  1YNJ D;  1SBB B;  4J8Q A;  1ICF B;  3W1G A;  1ET6 A;  1U4P A;  3VR2 A;  5C4J H;  2B29 A;  1YHB A;  2SOB A;  1Q1E A;  2A6H D;  2JXM B;  5L37 A;  3K5N A;  1UE7 A;  2CW0 D;  2KHI A;  3SK8 A;  1S4Z A;  1VF7 A;  3HOW H;  5JVG 3;  2D0O A;  2K75 A;  5M3M H;  2UXB Q;  5ELN A;  1GVP A;  4X65 L;  2KED A;  1SNQ A;  2VB2 X;  3HEJ A;  4DF7 A;  4LW1 A;  5CC4 A;  1A2U A;  1QVF A;  3RLO A;  1S40 A;  5T1G A;  5C44 B;  3DEP A;  1Y8P B;  1D6E C;  3WWV A;  4DN4 M;  1J5E Q;  3KUP A;  5M9O A;  2EY1 A;  3I4N H;  3OHX C;  3S16 B;  1SRO A;  4K2L A;  1AZQ A;  1CI3 M;  4POF A;  3ERQ A;  3FEW X;  5IGE A;  4K5W A;  3GTJ H;  2I46 A;  1WTO A;  3PSI A;  4HMJ A;  1PRT C;  2LXJ A;  3I8Z A;  4HID A;  4FF3 A;  2CH4 W;  1PXU A;  1B8A A;  3K7A B;  1TXY A;  1XJV A;  2BOS A;  3MFY A;  2EXD A;  1CT1 D;  4OIJ A;  4DR2 Q;  1WVL A;  4A3F B;  1LV9 A;  4JI5 Q;  4EQO A;  2DUD A;  3GTL B;  5LL6 S;  3RZD H;  3J80 i;  1B3A A;  3MWY W;  4LWC A;  2UXC Q;  2QF7 A;  3M4P A;  5C3E B;  4G7Z C;  1EY5 A;  3D6W A;  3D3R A;  1DOK A;  5C44 G;  1VQM A;  3F1Z A;  5H1S E;  1CTM A;  3VDY A;  1HFG A;  4JPB W;  1YEZ A;  5EKL A;  3QG1 A;  2WKD A;  3I91 A;  3QJY A;  5KNB A;  1V1Q A;  4LF9 L;  4X6A H;  4PV1 C;  5EBC A;  3J81 c;  1T5X D;  1SND A;  2JA9 A;  1G51 A;  4GS3 A;  1EZ6 A;  1HTP A;  2WB1 G;  1L2F A;  1K83 H;  1HHV A;  1SJH D;  1II3 A;  1IXR A;  2B2W A;  1DOL A;  2F0K A;  3I4M B;  3MZ5 A;  4A93 B;  2HCC A;  1Y1W H;  3HKZ E;  1JB3 A;  5COR A;  2NTT A;  1XMO L;  4A3F G;  1I94 L;  3U9S A;  3M3Y H;  1SYB A;  1OXX K;  4B3M Q;  1ENC A;  4X62 Q;  1QZG A;  3CXC A;  1PZJ D;  3BZC A;  3AB9 A;  3W5O A;  1GUT A;  2ZJR A;  3S1N B;  1VCI A;  2JQO A;  1A3V A;  4R4O A;  5C3E G;  2FHT A;  1SYC A;  5GQO A;  3K59 A;  5ELB A;  3KK7 A;  1HRJ A;  1GUW A;  1I4Q A;  1JJC B;  2F0T A;  3BJU A;  2CWA A;  4KJO A;  2RDH A;  1KDB A;  2IX1 A;  2A68 C;  3PIP A;  1SEB D;  1N33 L;  1VDZ A;  1HA5 A;  4KHV A;  1C7Y A;  4P2C B;  3KDF A;  1NUC A;  5K36 G;  1K8M A;  4IAL A;  4KD3 A;  3DXJ C;  2ZXP A;  3VYS A;  5IYD G;  1PH1 A;  3BVG A;  3EQL C;  1H9S A;  3I4M G;  4JBW A;  4F7X A;  4A93 G;  5CR3 A;  1V8Q A;  1NCV A;  3T1Y L;  3M7N A;  3TP8 A;  1VQF A;  1HNX Q;  1WTV A;  3PF5 A;  1I50 H;  3KJP A;  2A73 B;  2F3W A;  4B3T Q;  3GTP H;  3ERS X;  3S15 H;  3V96 A;  3K80 C;  1EFI D;  3TME A;  4R4I A;  1Y8O B;  3RNU A;  3GTM B;  3KF6 A;  1N8R C;  1N32 Q;  2X6L A;  2BE5 C;  1HR0 Q;  1OXT A;  3CHB D;  3P7J A;  2F52 A;  2RHQ B;  1VMC A;  4DAY B;  3J7Z C;  3PUW A;  2R3Z A;  4RAU C;  4XT3 B;  4B3S Q;  4LFA Q;  2K4K A;  2HCI A;  4ZLT F;  4H02 A;  4ILW A;  1CUK A;  3NTI A;  1PH9 A;  4C3I B;  2QKI C;  1BBW A;  4YWK A;  1QB5 D;  1HUN A;  5IP9 G;  4E6I A;  2K5W A;  3OWE B;  4O42 A;  5GAD C;  4C3H G;  1KAB A;  5BR8 L;  1Z7T A;  2ICI A;  3I70 A;  3VYU A;  1YVC A;  2NVT H;  4DV1 Q;  1B53 A;  1Q86 C;  5E7N A;  4JI0 L;  2EY6 A;  2Z4H A;  2PI2 E;  3NK9 A;  1LTR D;  4OO1 H;  1O7Z A;  1CSP A;  1STG A;  1TT2 A;  4JI1 Q;  3J7Y W;  2K52 A;  4ZRZ A;  1XTD A;  1TWH H;  3KBX A;  3PIP 3;  1XWE A;  3CCR A;  4PZ8 A;  2I0Q A;  2B63 G;  3NXW A;  3AFQ A;  5E4X A;  5M5X H;  2B2V A;  1A6X A;  1VQ4 A;  2XRS D;  3BYT B;  1KNE A;  3CQZ H;  3ULJ A;  3S2H H;  4IN3 A;  3PO2 H;  3WDN A;  4G7H C;  4LF8 L;  4R4T A;  4V19 0;  1Y1V H;  2EDG A;  2Z6B A;  4ZAI A;  1I4P A;  4F8M A;  4QUF A;  2Y0S B;  4C3I G;  2UUB Q;  1ET9 A;  1JOK A;  1CQF A;  1O78 A;  2WII B;  4RG1 A;  5G3L F;  4GNX A;  3QWN A;  2RBM A;  3I4O A;  2Z8L A;  2PMZ B;  1I4X A;  4DNR B;  4QQB X;  1CKO A;  3H3V I;  5M5W H;  4X3K A;  2HUG A;  3L7Z C;  5CV4 A;  4B08 A;  2L12 A;  2VL6 A;  2CCZ A;  2V1C C;  3GV6 A;  4GLV B;  2XRQ D;  1TU2 B;  4KY6 A;  1F9Q A;  4A3J G;  1I6H H;  2A69 C;  5FKA C;  4RGO S;  2VS1 A;  4APV A;  4GN4 B;  4KTA A;  5IY0 A;  3D4W A;  2NN6 H;  2NZH A;  1JJ2 A;  4UDU C;  2F0Q A;  2N49 A;  1MIU A;  1IYJ B;  3FKI H;  3IFT A;  2E76 C;  1H9S B;  4RH6 A;  2K5Q A;  5HY6 A;  2R92 H;  4X3U A;  3HOU B;  1EWH A;  2K01 A;  2JEA I;  1F2L A;  4DV4 L;  2D9U A;  3J80 E;  2F4V Q;  1EY4 A;  2A8V A;  1LTB D;  1TWG H;  2Y0S G;  4K8I A;  4JI7 L;  1X3Q A;  2K05 A;  3F2B A;  1L1O A;  1YNN D;  5M3F H;  2VUM B;  5IGF A;  1K0S A;  2XNA C;  4TVA B;  1HQM C;  3C1F A;  3NE5 B;  3VA5 A;  1D1K A;  2F0W A;  1EOT A;  1KXL A;  2F0L A;  1ILP A;  3LGJ A;  2QA4 A;  1B50 A;  1TWC B;  3K5O A;  4FF1 A;  4AQY L;  1HZB A;  1TS2 A;  3M4O B;  2IX0 A;  4X65 Q;  4O0A A;  2AWN A;  5CYU A;  1AH9 A;  5FLX E;  2EXZ A;  2F0M A;  3U4Z A;  5KYI A;  4JV5 L;  1A62 A;  4X3T A;  4A3E B;  2VUM G;  1CQV A;  2JA6 H;  4WJ4 A;  3K7U C;  3GTG B;  2A6E D;  2L9H A;  1N36 L;  2QW7 A;  2B2Y C;  3U9O A;  2MQH A;  2MNA A;  2L0C A;  2JA8 H;  1EY6 A;  4XQQ A;  3DUZ A;  3TZD A;  4QIW B;  5AJ3 L;  2SEB D;  2LSS A;  1QJO A;  2AQ1 B;  4DNT B;  3JAM c;  3HOZ G;  1R9T H;  3MXP A;  2C9O A;  1RD9 D;  1GM5 A;  1BDO A;  4GNX B;  1S5D D;  3PMF A;  2TSS A;  4IFD H;  2YTY A;  3MTS A;  3TRZ A;  1IBK L;  2EYO A;  3TBI B;  4JI6 L;  3NSW A;  2QEX A;  5IYB H;  3EA6 A;  2DJF C;  3GD7 A;  3X3M A;  4A3E G;  2N55 A;  2WAC A;  4LF9 Q;  3NEM A;  1KRT A;  5C3W A;  4DV0 Q;  1SMX A;  2LS0 1;  1M4V A;  4BY7 H;  3BZK A;  2FFK B;  2HDL A;  2X6G A;  2NVX H;  1SRU A;  2C5C A;  2GVA A;  5F2D A;  1DXM A;  1S3O A;  2BDO A;  2JP1 A;  3A74 A;  4H0L C;  2VQE L;  3UDI A;  2KCM A;  1KDC A;  2E5L L;  2R93 H;  1VQ8 A;  1EQT A;  1VQB A;  2G9H D;  3BVZ A;  1XMO Q;  3NTH A;  3J80 L;  3QB3 A;  1H9M A;  1W6K A;  1I94 Q;  4HED A;  4JBJ A;  1MSG A;  4JOI C;  2RF4 A;  2F0H A;  1L1O B;  2NZ1 D;  1CA5 A;  4QL5 A;  1NY4 A;  3I73 A;  2PQA A;  3QIA A;  4UP9 A;  1VS0 A;  1VQD A;  1SE2 A;  5IOC A;  1MJE A;  4DR6 L;  4J1M A;  1VQP A;  1YNJ C;  2A74 C;  1EY7 A;  1V1O A;  4KK7 A;  2F1M A;  2IL8 A;  2A6H C;  1N33 Q;  4POG A;  1IYV A;  4JI3 L;  2CW0 C;  2PZT A;  2Q8I B;  4XQN A;  2F0S A;  1IBM L;  3P1H A;  2EY2 A;  5FLX L;  2F0N A;  2IW3 A;  3V2T A;  1B7Y B;  3MXG A;  1EYA A;  1U4M A;  4BXX H;  3T1Y Q;  2RDF A;  1CKM A;  1B44 D;  3O13 A;  1IW7 D;  2SNM A;  4XXE A;  1NJI C;  5CMD A;  3MXN A;  2JA7 B;  1MHW C;  4IOC A;  1GUG A;  3TP6 A;  4KV6 A;  4BBS B;  4UP8 A;  3PCO B;  1CHP D;  1N9W A;  1X56 A;  4O1N A;  1A3U A;  1WTX A;  4R4Q A;  2L5T A;  3S1M H;  4C3J H;  1S5B D;  3HGB A;  3MEH A;  1VQ6 A;  3PQI A;  3KLW A;  1HFN A;  4A3I H;  3EIV A;  4AYB B;  4NXN Q;  1WCM B;  4OX9 L;  2JA5 B;  4HR7 B;  3UDX A;  1X6O A;  2D2C C;  1IZ6 A;  1S5E D;  2DY7 A;  3VR3 A;  4C2M B;  1BXT A;  3GTO H;  3WOF A;  4EQN A;  5JPN C;  1OO9 B;  1A0I A;  2OF1 A;  3D4R A;  1YIJ A;  3C3L A;  2NVQ H;  3HOV H;  1WOC A;  5BR8 Q;  1Q3L A;  2PPB C;  1PA6 A;  4JBK A;  4JI0 Q;  4JK1 C;  3NEN A;  2JA7 G;  1KHI A;  1HQR D;  1AFP A;  3T51 B;  5BN3 A;  2IJ0 A;  2H5X A;  4B3R L;  2IT1 A;  4H13 C;  4K14 A;  1C8C A;  3FP9 A;  3C1E A;  1MGS A;  1A8V A;  2J7Z A;  4HSP A;  5I9P A;  3MEF A;  1ZEQ X;  4LF8 Q;  4IPC A;  4RKB A;  4RFB A;  2BA0 A;  1LYL A;  1VQA A;  5DLQ E;  4UY8 C;  1Y8N B;  4A3L H;  4AYB G;  1HTL D;  2XGT A;  4FNF A;  3KOJ A;  2JA5 G;  5HGQ A;  1XX8 A;  4XQJ A;  5C0X J;  1JWU D;  1AZP A;  4FXG C;  4HIK A;  3EN2 A;  4DAP A;  4DKA C;  3FDT A;  3I2Z A;  3CME A;  5ELE A;  5C0X G;  2PQA B;  1ENF A;  4HCS A;  4NKL A;  1EWC A;  1HUM A;  1FL0 A;  2ENB A;  4A3K H;  5JAV A;  3UE1 A;  4CBV A;  2K32 A;  1RDP D;  1GUO A;  4JI8 L;  4QCL A;  3MAQ A;  1PH4 A;  3BYY B;  4N8F A;  3Q8D A;  3LX0 A;  3S17 H;  2J0T D;  1EYC A;  1HZC A;  4K6D A;  1C9O A;  3SE0 A;  1PYW D;  4EQP A;  5GAG C;  4EVO A;  2Z1C A;  5IGD A;  4DR4 L;  4NMZ A;  3S1Q B;  2ZT9 C;  4GKK L;  5FJ8 H;  4UPA A;  5CV7 A;  1UEA B;  2H1E A;  5BN5 A;  4N8X 1;  3HG9 A;  4YWL A;  2Q8T A;  1VQG A;  3OPO A;  4DV4 Q;  4DK6 C;  2JE6 I;  2FMM A;  4JI7 Q;  1S5C D;  5DEH A;  1STA A;  4NPS A;  1LTI D;  1LT4 D;  1XPR A;  1D8L A;  1SE8 A;  3QO2 A;  4RHR A;  1JR0 D;  2DJG C;  2WKC A;  5IGB A;  4ODG A;  3DMU A;  4YCV A;  2B3G A;  2N8N A;  4X3S A;  1WD1 A;  4GNX C;  3L3O C;  3FPP A;  1NTG A;  1WTH A;  4BY1 B;  4GN5 A;  2L55 A;  4Q0F A;  1JOR A;  4R9W A;  3RN2 A;  3HOY G;  2F0E A;  5IT9 c;  5BN4 A;  3T53 B;  2K1B A;  4AQY Q;  1UE5 A;  3M4Q A;  1QUQ A;  3GTJ B;  4B9X A;  3OW7 A;  4A3G G;  3L0O A;  3CCS A;  1D7Q A;  4K5X A;  1PZI D;  1DM0 B;  3RMH A;  2R7Z B;  1K3B C;  4K8J A;  5KNC A;  4NW2 A;  1BKB A;  4KY7 A;  2O5I C;  4DR7 L;  4JBM A;  1PH5 A;  1TWF B;  2QGQ A;  5CGK A;  1A3T A;  1WTQ A;  4DV7 L;  4JV5 Q;  5EKI A;  4L6T B;  3PUY A;  4LUZ A;  3RZD B;  2Q8R E;  2PO4 A;  4LF6 Q;  1EU4 A;  5LMN W;  4QUC A;  2K7V A;  3OIP A;  2K28 A;  1JT8 A;  2BCO A;  3V05 A;  3CCQ A;  2I07 B;  3ONA B;  3R8B A;  3HOX B;  1N36 Q;  5T1I A;  2YU9 H;  1RKN A;  3D8G A;  1L1O C;  2BDN A;  2OT2 A;  4G57 A;  1J8I A;  1EL0 A;  3NPP A;  1NMG A;  4BY1 G;  4KMU C;  3T56 B;  3F2U A;  4GN3 B;  1ZXT A;  1E2Z A;  1HA6 A;  1RTO A;  5C5M A;  3S1R B;  5A35 A;  1SN8 A;  5AJ3 Q;  4ME5 A;  4L5R C;  1YI2 A;  4GZY C;  2Q2U A;  2N88 A;  3GP7 A;  5J39 A;  2R7Z G;  5M5Y H;  2ZXR A;  2RA4 A;  1BBU A;  2I5M X;  2WB1 E;  1IBK Q;  1IKM A;  4JI6 Q;  3SGI A;  2MUY A;  3K5M A;  3I7F A;  1RIP A;  3GQB A;  5C44 H;  4FF2 A;  1Q8I A;  2F0D A;  2E2J B;  2LKV A;  3M4Y A;  4IJL A;  1GO3 E;  4IPH A;  2E2I B;  4A3M B;  3AMU A;  3HOX G;  1LT6 D;  3S16 H;  3S14 B;  3MVV A;  4KY5 A;  2L4N A;  3NBH A;  3X3N A;  1F9P A;  3G7L A;  4R4C A;  4X66 L;  2E5L Q;  2MO0 A;  1G29 1;  3NQI A;  1CZG A;  1PH6 A;  4OEL B;  1VQE A;  3LWU A;  4XYO A;  4CHT B;  1OTC A;  2I5H A;  4CDC C; 
#chains in the Genus database with same CATH homology
 2IHF A;  3L7Z C;  2CQO A;  3U50 C;  1PV4 A;  2CFM A;  2VY3 A;  2VL6 A;  3E9H A;  2CCZ A;  2V1C C;  4GLV B;  4A3J G;  2MO1 A;  1I6H H;  5ELO A;  2RCN A;  4A3F H;  4L5Q A;  3AYH B;  1K9M C;  4QY7 A;  4HJ9 A;  4OO1 I;  2VS1 A;  1C0A A;  1EIF A;  1YHA A;  4APV A;  2OWO A;  4GN4 B;  5IY0 A;  3A0J A;  3J81 j;  2ZTC A;  1T9H A;  2YV5 A;  3K81 C;  3OTO L;  2VQF L;  2Z0S A;  4X62 L;  2NZH A;  1JJ2 A;  1BVS A;  2N49 A;  1YJW A;  1M90 C;  1XPU A;  5C3E H;  1MIU A;  2Q2H A;  1IYJ B;  1AE2 A;  3FKI H;  3MXN B;  4DV5 Q;  1VQN A;  4DR6 Q;  3PO3 H;  5HY6 A;  2R92 H;  2JEA I;  4DV4 L;  4X64 L;  1XMQ L;  4IOA A;  2F4V Q;  1UE6 A;  2I5L X;  4JI3 Q;  1N34 Q;  1QUQ B;  1EOV A;  5LMU Q;  2A8V A;  2JK8 A;  1TWG H;  2HQL A;  2Y0S G;  3K0X A;  3CPW A;  4A3M G;  1S72 A;  1E22 A;  4JI7 L;  4TQU S;  2YTV A;  1EFW A;  1IBM Q;  4LFC L;  1HNZ L;  3ICE A;  1I3Q H;  4IPG A;  3CP0 A;  1L1O A;  4EX5 A;  3F2B A;  5GAH C;  5M3F H;  2UU9 Q;  4DK3 C;  2HHH L;  4BBR H;  5C0X I;  2UUA L;  2NZO A;  1E3P A;  4ALP A;  2UUC Q;  1J6Q A;  1UWV A;  1HR0 W;  4TVA B;  3RN5 A;  4P71 A;  4O2D A;  5IYD H;  4BXX G;  4OWX B;  3I4M H;  4AH6 A;  1PH2 A;  4A93 H;  3HOY H;  2CWP A;  1KC8 C;  1L0W A;  3E9I A;  4QJF A;  1KXL A;  1WI5 A;  3LGJ A;  2QA4 A;  2BH8 A;  3OYY A;  5IWA L;  4DV3 Q;  1VQJ A;  1K8G A;  4AQY L;  1HNX L;  1HZB A;  4YCU A;  3D0F A;  1YNX A;  1ASZ A;  4PZ6 A;  4DV2 Q;  1XPO A;  3S1Q H;  4HJ5 A;  2IX0 A;  1EQQ A;  4B3T L;  3HOW G;  3UDF A;  1H95 A;  4X65 Q;  4O0A A;  2AWN A;  2NN6 I;  1AH9 A;  5M3M G;  3K8A A;  2K5N A;  1LM0 A;  4JCV E;  4QGU A;  3U4Z A;  1EWI A;  3HKS A;  4P75 A;  1QVG A;  1N32 L;  1TWA H;  4OWT B;  1HR0 L;  1Q12 A;  1EIY B;  4LF7 L;  4A4I A;  4A3I G;  4OX9 Q;  1FJG L;  1XNQ Q;  4JV5 L;  1UE1 A;  4B3S L;  4JI4 L;  2R7F A;  1AE3 A;  4LFA L;  1A62 A;  1KAW A;  3M9B A;  1HZ9 A;  4DUZ Q;  1FGU A;  1K73 C;  2VUM G;  2WP8 J;  2JA6 H;  3I4N G;  4WJ4 A;  5IP9 H;  3RR5 A;  2ZJQ A;  3K7U C;  4DV6 Q;  3PUZ A;  3HOV G;  1N36 L;  2RHS B;  4BY1 H;  2R7D A;  4C3H H;  4GOP C;  4KHZ A;  1YJN A;  1A63 A;  1B70 B;  2ZM6 L;  4NXM L;  4YY3 Q;  4BBS H;  2K50 A;  2MQH A;  2MNA A;  3AFP A;  3EBE A;  3A5U A;  2JA8 H;  2Z6K C;  4XTC S;  5JEA J;  3GDE A;  4DV1 L;  5AJ3 L;  1EYG A;  4B3R Q;  2LSS A;  3JAM c;  2L15 A;  1EUJ A;  3HOZ G;  1R9T H;  4KHP Q;  3S2D H;  1GM5 A;  5JEA G;  3CCL A;  4GNX B;  2R7Z H;  1OXV A;  4JOI A;  4JI1 L;  2VNU D;  3GTM H;  2N78 A;  5FLM G;  2B63 H;  2PI2 A;  3RLN A;  3CCM A;  3T1H L;  1XNR Q;  2F3I A;  3G4S A;  1OXS C;  1TWF H;  1VQC A;  2YTY A;  1MKH A;  1WCM H;  1GD7 A;  4HJA A;  3TRZ A;  1IBK L;  1SR3 A;  3OW2 A;  4JI6 L;  2KBN A;  2LXK A;  5C4X H;  3W1B A;  4KHP L;  3I55 A;  3JAM i;  4A3L G;  2KHJ A;  3TS0 A;  2QEX A;  4DUY L;  2UXD L;  4J15 A;  4MZ9 A;  1CSQ A;  5GRO A;  5IYB H;  4Y52 H;  5IP7 H;  4BA1 I;  2EIF A;  2N3S A;  1X65 A;  3GD7 A;  4KI0 A;  3CCJ A;  4A3E G;  5J3B A;  2VQE Q;  3STB C;  3NEM A;  2YTX A;  4LF9 Q;  4C3I H;  3HOX H;  1KRT A;  1X9N A;  4DV0 Q;  1SMX A;  1YHQ A;  4LUV A;  3PF4 A;  4BY7 H;  2UUB L;  3CC4 A;  4A3D H;  4A3G H;  3BZK A;  2A19 A;  2NVX H;  1SRU A;  2GVA A;  3H0G H;  1S3O A;  3K7A H;  3A74 A;  2VQE L;  1YBY A;  4JI8 Q;  1PH8 A;  3UDI A;  3CCU A;  4A3K G;  1HZA A;  1U5K A;  2KCM A;  2E5L L;  1JB7 A;  4DV0 L;  1VQ8 A;  1VQB A;  2R93 H;  4IPD A;  3S1R H;  2OQ0 A;  2Y0S E;  4MTN A;  1K0R A;  4NB3 A;  3CMA A;  4DR3 Q;  1XMO Q;  1Y1W G;  1I94 Q;  4A3J H;  2HT1 A;  1E7Z A;  3ULP A;  1PHJ A;  2XTI A;  3GTL H;  1PH3 A;  2HIX A;  4JBJ A;  4HIO A;  4L5S A;  4DR4 Q;  4JOI C;  3KDF B;  3KJO A;  3STB D;  2OTL A;  2RF4 A;  2R6G A;  1PFS A;  1L1O B;  1SLJ A;  2PMZ E;  3IRB A;  1MJC A;  4GKK Q;  4QL5 A;  3KFU A;  1NY4 A;  4UP9 A;  2PQA A;  5FJ8 G;  4LFB Q;  1VS0 A;  1V9P A;  1VQD A;  4P73 A;  4UP7 A;  5GAE C;  4LF4 Q;  3DM3 A;  4IFD I;  2IY5 B;  1RL2 A;  2K5V A;  1X3F A;  1Q1B A;  2AWO A;  1MJE A;  3G71 A;  1JJG A;  4DV5 L;  4DR6 L;  1VQP A;  4YWM A;  2E2J H;  4AIM A;  3CW2 C;  2E2I H;  1FVI A;  1N33 Q;  1OXU A;  4IO9 A;  4A3M H;  1Q46 A;  3KF6 B;  4JI3 L;  4POG A;  2F4V L;  1N34 L;  5JJL A;  4HJ8 A;  3HKZ G;  4WJ3 M;  5LMU L;  3S14 H;  4GKJ Q;  1Q81 C;  4A3C G;  1IBM L;  1GKH A;  3KF8 B;  1VQ9 A;  4MNO A;  3F2C A;  4GOP A;  2UU9 L;  4R1J A;  1KRS A;  4OWW B;  4IJH A;  1B7Y B;  1UEB A;  2AKW B;  2C35 B;  2ZJP A;  3T1Y Q;  2UUC L;  4BXX H;  1CKM A;  2Z6K A;  4BA2 I;  1VQI A;  2KEN A;  1NJI C;  3W1G A;  4IOC A;  3S1N H;  5C4J H;  2B29 A;  1YHB A;  3HFZ B;  1Q1E A;  4DNI A;  1X55 A;  1KQS A;  4PZ7 A;  4UP8 A;  1UE7 A;  2KHI A;  1SFO H;  3E0E A;  4DV3 L;  4LF5 Q;  3HOW H;  3PCO B;  4DV2 L;  2D0O A;  2K75 A;  1N9W A;  1X56 A;  3HOU G;  4DR7 Q;  5M3M H;  3RZO H;  4R4Q A;  5ELN A;  1JE5 A;  2UXB Q;  4K0K Q;  1GVP A;  4X65 L;  4C3J H;  3S1M H;  4DV7 Q;  2ZTE A;  4LW1 A;  1JMC A;  1VQ6 A;  1P8L A;  1IBL Q;  1Z47 A;  3KLW A;  3RLO A;  1QVF A;  4A3I H;  4OON A;  3EIV A;  3PIO A;  1S40 A;  2UXB L;  4FDB A;  4NXN Q;  3TS2 A;  4OX9 L;  1XNQ L;  3TEH B;  2VZA A;  3UDX A;  3H15 A;  3UDG A;  1NBW A;  4GLX A;  1X6O A;  3WWV A;  1IZ6 A;  3TRE A;  2MFI A;  4YHH Q;  1J5E Q;  3GTO H;  4DR5 Q;  5JJK A;  2VUM H;  3I4N H;  5IE8 A;  1A0I A;  1SRO A;  4NXN L;  1YIJ A;  4DUZ L;  1NMF A;  3CCE A;  4JYA Q;  2NVQ H;  3HOV H;  4POF A;  1KIX A;  3ZJY C;  1IL2 A;  1WOC A;  1Z9F A;  3JC6 6;  5BR8 Q;  4DV6 L;  3GTJ H;  5IYC G;  1J5E L;  1PA6 A;  3PSI A;  4JBK A;  4JI0 Q;  2LXJ A;  4HID A;  4PG3 A;  3NEN A;  3J80 c;  4YY3 L;  1VQL A;  2JA7 G;  1B8A A;  1TWC H;  1TXY A;  1PYS B;  1XJV A;  1KHI A;  5LMN Q;  3NBH B;  2EXD A;  1LUZ A;  2YYZ A;  1YZ6 A;  3F8T A;  3CCV A;  4OO1 G;  4DR2 Q;  3HOZ H;  1Y14 B;  2H5X A;  2ID0 A;  3M4O H;  4B3R L;  2IT1 A;  1K8A C;  2E8G A;  5FLM H;  3FP9 A;  2I0Q A;  1YJ9 A;  4JI5 Q;  4JG2 A;  2DUD A;  4Y7N H;  1A8V A;  3AQQ A;  3RZD H;  3J80 i;  4JI2 Q;  4LWC A;  3MEF A;  4LF8 Q;  1XNR L;  3M4P A;  3PUX A;  2UXC Q;  4IPC A;  2ATW A;  3ER0 A;  2BA0 A;  1LYL A;  1VQA A;  5DLQ E;  3FHW A;  4UY8 C;  3PO2 G;  4A3L H;  4AYB G;  4JI5 L;  5C44 G;  3F1Z A;  2XGT A;  5H1S E;  1VQM A;  3VDY A;  3KOJ A;  2JA5 G;  5HGQ A;  1Y1V G;  4A3B G;  1YEZ A;  4A3E H;  5C0X J;  4XIG S;  2UXC L;  4HIK A;  2FXQ A;  3EN2 A;  1HJP A;  4DKA C;  1V1Q A;  4LF9 L;  4X6A H;  3I2Z A;  3CME A;  3J81 c;  4X66 Q;  3GTG H;  2Q2T A;  5C0X G;  2PQA B;  1HH2 P;  5FLX c;  2JA9 A;  2IHE A;  4DR1 Q;  4HJ7 A;  1G51 A;  1FL0 A;  1HNW Q;  4GS3 A;  4LUO A;  4A3K H;  3UE1 A;  3GTQ H;  3CAM A;  2WB1 G;  4HIM A;  2DGY A;  4JI8 L;  4ME3 A;  1L2F A;  1K83 H;  1PH4 A;  4GLA C;  1IXR A;  3Q8D A;  1DGS A;  2GVB A;  3CC7 A;  2WAQ G;  1Y1W H;  3S17 H;  3HKZ E;  3J81 i;  1EQR A;  2NVT H;  1XMO L;  4DR3 L;  1HZC A;  1C9O A;  2OCE A;  4A3F G;  1I94 L;  3M3Y H;  5GAG C;  2ES2 A;  1OXX K;  3OTO Q;  4B3M Q;  2VQF Q;  4X62 Q;  1QZG A;  4DR4 L;  1X3G A;  3BZC A;  3CXC A;  3W5O A;  2NN6 G;  4LNQ A;  2ZJR A;  2K14 A;  3U4V A;  4EQ5 A;  1VCI A;  4A75 A;  4GOP B;  2JQO A;  5FJ8 H;  4GKK L;  1E1T A;  4UPA A;  4R4O A;  2B63 G;  5C3E G;  1CKN A;  1E1O A;  2HIV A;  3FKI G;  4OXP A;  3G48 A;  1M1K C;  5GQO A;  4YWL A;  4B3M L;  4LFB L;  1VQG A;  4LF4 L;  3PO3 G;  4DV4 Q;  2CKZ B;  4X64 Q;  1XMQ Q;  2R92 G;  4DAM A;  3RLF A;  3G6E A;  3PV0 A;  2JE6 I;  4DK6 C;  1JJC B;  4JI7 Q;  3BJU A;  2CWA A;  1NE3 A;  4NPS A;  3CPF A;  1XPR A;  1W3S A;  1HNZ Q;  1D8L A;  1P16 A;  1SE8 A;  4LFC Q;  4KLK A;  3PIP A;  2BH2 A;  2IX1 A;  5JJI A;  1N33 L;  2HHH Q;  4A3C H;  2UUA Q;  1Q82 C;  5M3F G;  4GKJ L;  4YCV A;  2D62 A;  2B3G A;  2N8N A;  3ULL A;  4BBR G;  1C7Y A;  4GNX C;  2ASB A;  3KDF A;  5K36 G;  3J7A 5;  1NTG A;  4GN5 A;  1KD1 C;  5IYD G;  1PH1 A;  1G6P A;  3I4M G;  4JBW A;  3GO5 A;  3RN2 A;  4A93 G;  3HOY G;  3T1Y L;  3L2P A;  3M7N A;  1VQF A;  5IT9 c;  5IWA Q;  3A5Z B;  1HNX Q;  4AQY Q;  1UE5 A;  3PF5 A;  3M4Q A;  1QUQ A;  4RMF A;  3F2D A;  1I50 H;  3CF5 A;  3KJP A;  4A3G G;  4B3T Q;  3GTP H;  3ERS X;  3L0O A;  3CCS A;  1YIT A;  3S15 H;  3K80 C;  1QZH A;  1D7Q A;  2PNH A;  4R4I A;  2WFW A;  3RNU A;  3HOU H;  2EQS A;  4LF5 L;  3D31 A;  3KF6 A;  1BKB A;  3PGZ A;  1QVC A;  1N8R C;  1N32 Q;  3GTK H;  3BU2 A;  4JBM A;  1PH5 A;  1HR0 Q;  4DR7 L;  1OXT A;  2QGQ A;  1VQO A;  2F52 A;  2RHQ B;  1FJG Q;  4LF7 Q;  4K0K L;  4DAY B;  3J7Z C;  3PUW A;  4DV7 L;  1X54 A;  4JV5 Q;  2Q2I A;  1V43 A;  4B3S Q;  1PH7 A;  4JI4 Q;  4LFA Q;  2K4K A;  3PUY A;  1IBL L;  4LUZ A;  2A1A A;  4L5T A;  4LF6 Q;  3U58 A;  4H02 A;  2K5H A;  4JC0 A;  4YCW A;  1CUK A;  5LMN W;  1PH9 A;  3B6Y A;  2AHO B;  1JT8 A;  3CCQ A;  2ALY B;  4YWK A;  1BBW A;  1VQK A;  2JA6 G;  1N36 Q;  1VQH A;  5IP9 G;  4YHH L;  2YU9 H;  1Q7Y C;  1L1O C;  2D0P A;  4DR5 L;  4LF6 L;  3CC2 A;  1NMG A;  2E2H H;  2OTJ A;  2ZM6 Q;  4NXM Q;  1PYB A;  4BY1 G;  3TQY A;  4AYB E;  5GAD C;  3H3V H;  4JYA L;  3KYH C;  1O7I A;  4GN3 B;  5IYC H;  1E24 A;  2JEB I;  5BR8 L;  2BA1 A;  4BBS G;  4DPG A;  1YVC A;  1WYD A;  4DV1 Q;  1SN8 A;  1WJJ A;  5AJ3 Q;  2JA7 H;  1U0L A;  2JA8 G;  1Q86 C;  5E7N A;  4JI0 L;  2PI2 E;  1K3R A;  4L5R C;  1YI2 A;  1I5F A;  2Q2U A;  3PUV A;  1CSP A;  4P74 A;  4IFD J;  4JI1 Q;  5LMN L;  5EAY A;  2K52 A;  3M85 A;  3T1H Q;  2R7Z G;  4DR2 L;  1XTD A;  1TWH H;  2KCT A;  5M5Y H;  3NEL A;  4P72 A;  4QIW E;  1KL9 A;  4PZ8 A;  3CCR A;  1VQ5 A;  1BBU A;  2GN5 A;  2I5M X;  2WB1 E;  3AFQ A;  4PMW A;  1IBK Q;  5M5X H;  2VW9 A;  4JI6 Q;  4IFD G;  1WCM G;  1VQ4 A;  3SGI A;  2ZTD A;  2UXD Q;  2JJQ A;  1X3E A;  2WAQ E;  3CQZ H;  3ULJ A;  4DUY Q;  3I7F A;  4JI2 L;  4A76 A;  1RIP A;  3PO2 H;  3S2H H;  5C4X G;  4LF8 L;  4R4T A;  5C44 H;  3UE0 A;  2AMC B;  5IYB G;  2JA5 H;  5IP7 G;  1Y1V H;  4A3B H;  2OQK A;  1VQ7 A;  4IJL A;  4IPH A;  1GO3 E;  1ASY A;  1W2B A;  4C2M H;  2UUB Q;  3HOX G;  3DLL A;  1WFQ A;  3S16 H;  2NVY H;  4BY7 G;  4RG1 A;  3S24 A;  4GNX A;  4A3D G;  1PVO A;  1LTL A;  3H0G G;  1CKN B;  4R4C A;  2MO0 A;  1G29 1;  4X66 L;  1PH6 A;  2E5L Q;  3I4O A;  1Q8K A;  1VQE A;  3CD6 A;  4QQB X;  1OTC A;  1CKO A;  3AEV A;  4DR1 L;  3H3V I;  5M5W H;  2I5H A;  1HNW L;  2R93 G;  3I56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...