4XYQA

Structure of agra lyttr domain in complex with promoters
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
MDNSVETIELKRGSNSVYVQYDDIMFFESSTKSHRLIAHLDNRQIEFYGNLKELSQLDDRFFRCHNSFVVNRHNIESIDSKERIVYFKNKEHCYASVRNVKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*TP*TP*TP*AP*AP*CP*AP*GP*TP*TP*AP*AP*GP*TP*AP*T)-3
publication title Conformational features of the Staphylococcus aureus AgrA-promoter interactions rationalize quorum-sensing triggered gene expression
doi rcsb
source organism Staphylococcus aureus (strain col)
molecule tags Dna/dna binding protein
total genus 27
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2015-02-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04397 LytTR LytTr DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.1020 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4xyqA00
4XQNA 3BS1A 4XQJA 4CBVA 4XYOA 4XYQA 4XQQA 4G4KA 4XXEA
chains in the Genus database with same CATH superfamily
1LYLA 2BE5C 5M5WH 1XNQQ 3S1QB 1UE6A 2E75C 3NWTA 1LT4D 2DY7A 2VUMH 4BBSG 4J1MA 1SJHD 4GLVB 3GDEA 5C3WA 3ZJYC 2UUCQ 3X3MA 3CPWA 3K5MA 4RHRA 2FJ2A 3M4OB 5BR8L 3PSIA 4R4CA 4RCOA 3PUYA 4U673 2B2VC 3KUPA 2EY2A 3CXCA 1XMQL 1NTGA 3RZDB 3VR4A 1IYJB 2A6EC 3BZDB 1PH1A 2Q2UA 4ZCKA 4JV5Q 1HTPA 2OQ0A 1SNQA 4MIUA 2R3ZA 4DUYQ 3T53B 2ZXRA 2F4VQ 2NTSA 2HD3A 3J80c 3TP6A 1U5KA 3SVMA 3S1NB 1JOOA 2UU9Q 1XNRL 3DM1A 4OO1I 1F9QA 1KNAA 1WYDA 3MC0B 2IX1A 1VQFA 5GADC 1EFID 5FKAC 1TS2A 1HTLD 4C3IH 5KNCA 1YHAA 3J80i 2B63G 4XQJA 4LF9Q 1V1QA 3HOYH 3W3AA 4P71A 5FO9B 1A63A 2KCCA 4G7OC 3D0FA 4KK7A 1C7YA 1TIID 2K03A 2Y0SE 4B3SQ 3NQIA 1PH3A 2Y0SB 4G4KA 4IURA 3VR5A 1VQIA 1WVLA 2UUBQ 1RDPD 2P5ZX 3CRLC 3HRZC 3TN2A 5E3FA 4BA2I 3BZCA 2NVQH 1QUQB 2UXBL 2Z8LA 1BCPD 3KLSA 2L11A 5C4XH 5D3DA 2K5QA 1X55A 2VB3X 3SK4A 4A3EH 4A3KB 1EYAA 4JBKA 4IPCA 3J7A5 4YCUA 5EKKA 4FDBA 2A68C 1CKMA 3K5NA 2BA0A 4OIKA 1I3QB 1NR4A 5M3MB 1AEXA 2I5LX 4K6DA 2XWBB 1JR0D 3GTQB 5IYBH 1E1TA 3RNUA 1H9MA 3TREA 3IFDA 4POFA 3S2HB 5IYDH 4YY3L 3MXPA 1N33L 2NVTB 3OTOQ 1SBBB 2VW9A 4DR1Q 2K05A 4YIJA 3CCJA 4K6LA 1LTTD 3ONAB 5K36H 1K73C 4A3FG 5BN4A 3NWSA 1BF4A 4KHZA 3PF4A 2XTIA 5M5YH 3STBD 2FMCA 3J81c 5LMNQ 2H1EA 1JQYD 3S14B 1SR3A 1U4PA 3UE1A 1ICFB 3L0OA 4BBRG 1SMXA 4MN3A 3E6ZX 1Y1WB 2AWNA 2K7VA 3G6EA 5E4WC 2WB1B 3I72A 4F7XA 3J81i 1SRUA 3IFTA 1I94Q 4JYAL 1NBWA 1B4OA 4JBJA 1RODA 1UE7A 4KD3A 1VQBA 3RZOH 1PXUA 2CW0C 1S5CD 4JI2L 4GOPA 3AB9A 1PRTF 2O2LD 2PQEA 1A0IA 2LS01 1LO5D 2Z1CA 1HCZA 3S16B 1VQOA 3NXWA 3SEBA 5KGUA 3AMUA 2A74C 4NP5A 1X54A 4X6AH 3G48A 2F0PA 1FVIA 3KLSX 4J8QA 4B3TQ 3D4RA 2F0NA 1HNZQ 1YNNC 1K3BC 4X65L 1XNQL 1KDBA 4DR3Q 1W2BA 5FO7B 3Q6SA 1S40A 3MA2B 4AYBE 1XJVA 1ENFA 2JK8A 4AYBB 1EEFD 1NR2A 1VF7A 5M5WB 4OX9Q 5IGGA 3GTKH 2Z4HA 2VUMB 2CQOA 2DY8A 1IKLA 5COYA 4IJHA 1V1PB 2ES2A 3PO3H 1U4RA 4PG3A 4APVA 4NXNL 3MFGA 3N6RA 2JA8H 1XTDA 4HMIA 1OXXK 4JPBW 2EJMA 4DR7L 2DN8A 3NELA 1ML0D 3TS0A 1KABA 1L1OB 1Q90A 1VS0A 2K5WA 2K5VA 1PTOD 1IL2A 1EYDA 1RIPA 2B2TA 2E2JB 2E2DC 1AP0A 2WIIB 1OXUA 5J3BA 3BZKA 4AQYQ 1V43A 4QMGA 4RFBA 1NSNS 3HGBA 3A7LA 4DR2L 1NUCA 2B39A 3HKZB 5FK9C 5IP9G 2MNAA 2WAQE 1G6PA 4CJ0B 3JAMc 2WAQB 2RQXA 5BN5A 3UDGA 1AN8A 4C1NK 3CAMA 3A0JA 5LL6X 2EDGA 1S72A 1EQQA 1STBA 3TSSA 2R7ZH 1M8AA 2G9HD 1PZID 3JAMi 4DV2L 2IHFA 4NXML 1AW7A 2KHSA 4KMUC 4OONA 4JI4Q 1UNSA 2RKSA 5JPMC 3RD4A 2DNEA 3EN2A 4A3JG 4ILWA 1BKBA 3ULJA 2B2VA 2JA5H 2NVQB 3OIQA 1HZ9A 4HEDA 1SYDA 1ZXTA 2Z9HA 4PMBA 4NW2A 4IPHA 3OHXC 2CQAA 2RSOA 3H3VH 5C4XB 2BA1A 3QOLA 1QWYA 4OIJA 5EPLA 3RLNA 1TWHH 1EIFA 5IGCA 4A3EB 1SLJA 3CCUA 4A3MB 3A56A 4KJNA 1NE3A 1RTOA 5T1GA 1GUTA 3CCSA 1KDAA 1EUJA 3WOEA 4QGUA 4KLKA 5EGTA 5LMUQ 3CHBD 5KNBA 3OTOL 2ICEC 4RA8A 4XQNA 5H1SE 1DGSA 2PQAB 2LFNA 2GN5A 1D2BA 1ESRA 1DXMA 4X64Q 1E2VA 1DONA 4DV6Q 4ZUIA 1F9SA 1EWHA 1EY5A 4JW0A 4C3HG 3S9WA 5GAEC 1EU3A 1XMOL 3HOUG 4JI5Q 5C5MA 3E3XA 5M5YB 2BH2A 2MP1A 3J7ZC 3N52A 3KJPA 4A3GH 1A2TA 2NVXB 2KVMA 3GP7A 5LMNW 4Y52H 1FD7D 1IBMQ 4TSSA 5ELNA 3GO5A 2XRQD 1D6EC 1H9KA 4DK1A 3K58A 3I4NG 3RZOB 4FNFA 4ZUJA 4DV7Q 1EWIA 4A3IG 4B3ML 1X3GA 3EFXD 4ODGA 3T1HQ 3KFUA 4KHPL 1VQMA 1HR0L 1Q8KA 3I4MH 4DR3L 2M00A 3OOCA 4YCVA 4HIDA 1IYVA 1Y8PB 2XGTA 1FGUA 3GTPH 3U4ZA 4J15A 1QUQA 4GS3A 2PW5A 4QIWB 1SYBA 5IGBA 4LFBQ 3OWFA 2RBMA 3B6YA 4LF5Q 4KD4A 1CSPA 1JORA 5KNDA 4NPSA 4CJ2C 5C0XJ 1EIGA 1SNMA 4A76A 3A8KE 3TP8A 3S1MH 4IFDI 4DAMA 1PH5A 4UP9A 2JA6G 1SMYD 2WFWA 1EU4A 5C44H 3PO3B 2FINB 3FHWA 4PNYA 2LY7A 5C4HA 2EYJA 4DV5Q 2Q2IA 5C0XH 5CGKA 4ME5A 4MNOA 3Q22A 1IW7D 1AH9A 1K28A 1SNCA 5FJ8H 1F9PA 2VL6A 5FLXE 4HN7A 4BY1G 3GTMH 4KV6A 1BCPF 1EOVA 2AQ3B 1FYCA 4EX5A 4GKKL 1CHPD 2XIWA 4FO2A 1PYSB 2DJFC 4OO1G 1MJEA 2HIXA 4DK6C 3NK9A 2D5DA 2B2WA 4LJZC 2EYFA 5IGDA 1Q81C 3CCVA 1LTGD 5IP7H 1Z47A 1Y1VH 2K04A 1JJGA 2PCFB 4QL5A 2R7DA 4JK1C 3MXUA 5ELFA 2VQFL 2ZJPA 4JG2A 1CA6A 3I56A 5DAUA 1CUKA 5JAVA 1R4QB 3T4AC 1PH7A 4A3BG 4XIGS 4WORA 1R4PB 4IJLA 1MHWC 2L4NA 2L1BA 2GVBA 3KBXA 2JP1A 2R7ZB 4IPDA 1SE8A 1QZHA 1PH4A 1ENAA 5E7NA 4KJOA 2H4OA 1IKMA 3VYSA 1SDFA 4IUPA 3J81j 1SYCA 2EE1A 1L0YB 5BN3A 2F0DA 5FOBB 1M1KC 1PFMA 2MUYA 1X6OA 2VNUD 4JI3L 4JI6Q 2KEEA 3PIO3 4HSVA 1KXLA 1PZKD 3K8AA 3LWEA 1E0BA 3E5SA 4IUUA 1A3UA 1JWMD 3H0GH 3M4YA 5LMUL 1V1PA 1HFGA 4L5QA 4C3JG 2BE5D 3I7FA 3T16A 2KCMA 2YV5A 1LABA 1BOSA 1LTSD 2M9VA 1VQ6A 4DV6L 1SROA 4KHVA 4IUNA 3K59A 2LXKA 4ABNA 1K8AC 1L1OA 2QCPX 1N36Q 2EJFC 2IX0A 3DLLA 1NNXA 1II3A 2N8NA 2I5MX 4DR4Q 3BS1A 1DZ1A 3H3VC 2WP8J 5EQ0A 2OCEA 5JEAG 1VMPA 2A5HA 1SFOH 2A6ED 1YITA 4BY7H 1IBKQ 1XXGA 3HOXG 1ZEQX 2KOLA 4RKBA 1W3SA 4GN3B 4RG1A 4F8MA 1A3VA 1D5MC 1IYUA 2IPKD 3HOZG 1VQCA 5IYCH 1EY8A 4DA2A 4A3GB 4X66Q 4LF4L 3NENA 1C4QA 2CH4W 4LUOA 3FEWX 3KLWA 3GTJH 4FXDA 3T1HL 1LM0A 4R4IA 4PZ8A 1PTOF 2LKVA 2QDLA 3I70A 2R92B 1VF5C 2F0WA 3MHBA 2BCOA 4LF8Q 4LFBL 3PO2G 1XPUA 3I4MB 4A3LG 4LF5L 1Q8IA 3GTPB 2NVYH 1LT3D 3PUWA 3G4SA 5IT9L 4POGA 4LK1C 3MEFA 4JC0A 5HGQA 3C3LA 2B29A 2K4KA 4H13C 1OXVA 2ASBA 3UE0A 1PA6A 1WTWA 5C44B 2QILA 1UUPA 1DM0B 4KN4C 2HQEA 2SDFA 2N55A 2PQAA 2A68D 3VR6A 4A3FH 1I50H 2G9DA 1CKOA 3SK5A 1EY6A 4NKLA 4LFCQ 4H02A 1HA5A 1STYA 1JB3A 4DNTB 1QNUA 1B3AA 3GTMB 1WCMG 3EBEA 1PH9A 2YTXA 5C4JH 1K0RA 1X3PA 2XNAC 1HZBA 5EBDA 2FFKB 1EIHA 4YWLA 1YHQA 2MGSA 2RDFA 1AE3A 2QKIC 1Y1VB 1Q86C 1YBYA 2XWJB 3QO2A 3OPOA 2EYPA 4JVZA 3GTGH 4GKJQ 3J80L 2X69A 1B7YB 4QUFA 5CMDA 4LF7L 1GO3E 2L12A 2IY5B 3BVZA 3K7UC 1Q12A 1B50A 2CW0D 1X3QA 1TWAH 2Z6BA 1LV9A 2BDOA 2F1MA 3BDCA 2OXPA 1EFWA 2FMMA 3SHLA 2NN6I 2C9OA 3DWQA 3PUVA 1AE2A 1I6HB 1XX8A 3EVQA 1PRTC 4K5WA 2PZUA 3G71A 1LT5D 1EQTA 1OO9B 2F3VA 1RKNA 5HGTA 2YU9H 1YNND 3KF6B 4DV3Q 5JJIA 4OXPA 4XT3B 3H0GB 1SJED 1TKWB 4IZ8A 1TXYA 2AQ2B 3GV6A 2UXCQ 1EEID 1N36L 3HOWH 4B3RQ 4DV1L 5FLXc 1VQPA 2EZVA 4L5SA 3A74A 3DXJC 4C2MH 3F2DA 3A8IE 3ERSX 1YJNA 3O13A 1WTQA 3KLRA 2WKDA 4G7HC 5CV6A 1SFOB 4X3UA 4BY7B 4LWCA 1YEZA 3GQBA 1VQ4A 4RHSA 4X3TA 1EQRA 4X66L 3TBIB 1SNPA 4IO9A 2PMZB 1RJTA 1PFSA 3HFZB 4CHTB 2Z6KA 3KBGA 1VQHA 2Y0SG 1EOTA 3MAQA 1CA5A 3J81L 2AHOB 3A5UA 3FPUB 4R8NA 4H44C 1MBYA 2K52A 3GTJB 1HUMA 5IGEA 1ASYA 2F0QA 2QGQA 4LF8L 3OIPA 4X62Q 3HOVB 1K9MC 4HSPA 4MTKA 3PCOB 1IHZA 1A2UA 1DOKA 4A3KG 5JJZA 2R93H 2AMCB 2EVBA 1WTHA 5DM73 2CKZB 2IL8A 2Z4IA 4IFDG 1M4VA 3HEJA 3WOFA 4KTAA 2IT1A 1K83H 2Z0SA 4PZ6A 5M3MG 3I55A 4DUZL 3OYYA 2C5CA 4V0BA 2JQOA 1JT8A 5J1ZA 1QVGA 4U68A 1OXTA 2RCFA 3AFPA 3LGJA 2NZOA 1RF2D 1P8LA 5KYLA 1WTXA 5K5PA 1ZYRC 1OTCA 1JOQA 2RA4A 4GN4B 2EYMA 2JXMB 5DEHA 4C3HH 1SSOA 4HJAA 3FKIH 3TZDA 2R6GA 1JWUD 3C1EA 1ZKOA 5CORA 1IZ6A 1ESFA 2MJ8A 3RN5A 1FNUA 3RN2A 3GTLH 4A3CG 2DJGC 2WB1E 1F2MA 1CKNB 1WOCA 2B2UC 3EROA 2AKWB 3S17H 3T1YL 5M3FH 1D1IA 3W1GA 1Y1WG 2K01A 5C4JB 1TQOA 2WB1G 4K5VA 1X3EA 4KI0A 2K5HA 1QG7A 2UXDQ 1O7LA 1JJCB 2XVSA 4YHHQ 4B08A 3I4NH 3FVQA 1E7ZA 2ZXOA 3IRBA 2WINB 3GTGB 2QF7A 4L63B 2XRSD 3LNNA 4LUVA 4O2DA 1CQVA 5ELDA 1D7QA 3P20A 1VQKA 1GJXA 3C46A 1TY0A 2ENBA 5GAHC 2I46A 4FYDA 2UUCL 1PFBA 3PGZA 4KY7A 3U58A 1VQEA 1FJGQ 1TWAB 1LTAD 1OXSC 4AYBG 4CJ1B 1QZGA 1I4GA 2KECA 1E3PA 2RF4A 2VUMG 1M90C 2SOBA 2YYZA 4JV5L 3J7AV 5DM63 1WTPA 2YU9B 1STEA 3MFYA 4DUYL 4OWTB 4GNXB 4CKBA 1YIJA 3HP3A 2Q2HA 1GVPA 1EL0A 2F4VL 3PMFA 4A93H 3ER0A 1SN8A 4ALPA 2ZXPA 3V96A 2UU9L 3HOWB 2R7FA 4IN3A 5CV8A 3MVVA 4A3DH 2O5IC 2BH8A 3TZUA 1S5FD 3GTOH 1E2WA 4TKOB 2M2LA 3HKZE 5FLMH 1JWSD 3D4WA 3DWPA 4LF9L 1WI5A 1KQSA 4GNXC 3I4OA 4C3IB 3HKZG 5CV5A 1C8CA 4B3SL 1TWCH 3HOYB 1CHQD 2VY3A 2F52A 2WAQG 1SYEA 1WD1A 4I7ZC 2UUBL 5DLQE 4DK0A 4QB4A 1EWCA 1YNJC 3DM3A 4OL7A 4R8IA 4NDXA 1N32Q 3AYHB 3SXHA 4QF4A 3QB3A 1MSHA 1T5XD 1H9RA 3EA6A 4B9WA 4GLAC 3M7NA 2QDBA 2Q8TA 5C3EH 3PIP3 3A8JE 2EY6A 3JC66 2EXDA 5G3LF 2WV6D 2E2HH 1K8GA 3CF5A 1VDZA 5C4XG 5AJ3Q 4HMJA 1J5EQ 4JI1Q 5CYUA 4LFAQ 1NMFA 4A3EG 4JI0Q 5I2XA 3GD7A 4A75A 4UDUC 4DXFA 1IBLQ 4A3MG 2R93B 4DR1L 3VYRA 2I07B 3WWVA 1K83B 3VYTA 3KF6A 4B9XA 4C3JH 4JI7Q 4DN4M 5IYDG 1XWEA 2F0JA 2HHHQ 2ICIA 4DNIA 1XPOA 5LMNL 4HJ8A 2RDGA 1PH2A 2BOSA 5K36G 3RMHA 1QE6A 3F2CA 3J7YW 1PHJA 1TT2A 2SNMA 3FKIB 4DU9A 3NSWA 1I94L 3TMEA 3S2DH 3H6MA 1D1KA 2KA7A 3GTLB 2ZM6Q 2EY1A 1X56A 3Q0AA 4DV0Q 4IALA 2IWHA 3S17B 3IL8A 5D65A 1YVCA 5EBCA 5M3FB 3U4VA 2PZWA 3CD6A 3PIOA 5GROA 1HNXQ 2K33A 1HFNA 1ENCA 1GOZA 4K8JA 4B3TL 2G5DA 4RAUC 1HZAA 1HNZL 1F2YA 1IXRA 3NBIA 2JYOA 2OTLA 1KL9A 2B2YC 4RH6A 4QIWE 2JA7H 5IT9E 2DUDA 2CWAA 4G7ZC 4OX9L 4QY7A 4PV1C 2K50A 4AH6A 1CM9A 3PO2H 1LLRD 1BBXC 4LF6Q 2HCCA 2NN6G 3GTKB 4DR6Q 2ZJQA 3S15H 3D8GA 3DMUA 1D5XC 3ND9A 1STAA 2JA8B 1LTID 4RGMA 4K5XA 4OELB 3SE0A 3X3NA 4QCLA 2D9UA 3CQZH 4OGQC 3PO3G 1TR5A 3CU7A 2PPBC 1AFPA 3MTSA 1FL0A 5EKIA 4XQQA 4KKUA 1GUNA 3UDIA 2B2UA 4JI8Q 5M9OA 4AQYL 1D8LA 2F0TA 1BO0A 4X3SA 4DAPA 1GUOA 1VQAA 3ERQA 4A93B 4RCNA 3NPPA 4L8JA 4LNQA 2D0OA 3U9OA 1G6ZA 5FO8B 3CC2A 2E5LQ 1GKHA 4A3DB 1KNEA 3ZYYX 1U0LA 3H09A 1EY4A 1WCMH 3S1RH 1HZCA 1HXYD 4RMFA 1WFQA 3TP5A 1KDCA 2NZ1D 1C0AA 1CKNA 3ICEA 3ULLA 1A6XA 1KLUD 4LW1A 3D6CA 1TWCB 4LMQD 3D4DA 2JJQA 1Z6HA 4DAYB 1N9WA 1XPRA 4JI4L 4PMWA 1MKHA 3VDYA 3I4LA 4DKAC 1TU2B 4DXGA 4P72A 2L0CA 2AUJD 2X6GA 3IAYA 4YCWA 2R7ZG 3S24A 1Q82C 1HA6A 1FGBD 1UEBA 4ZKCB 2MO1A 2JA5B 4BBSH 5IE8A 3BVMA 3PUZA 3CKIB 1SE4A 5JOBA 5C3EB 1ICWA 5AJ3L 1PMRA 2R61A 3S1QH 1TWHB 4JI1L 5KIXA 4CGYB 2ZTEA 4JI0L 1IBLL 4QQBX 2LMCB 3ITPA 2MPMA 3W1BA 3NEMA 5CBAE 4NMZA 1NMGA 1G2TA 4QJFA 1CZWA 4CBVA 3DEPA 4CDFC 1H9SB 4X64L 3M4OH 3EJIA 1I6VC 3BYTB 1QVFA 2RSNA 2KBNA 3R93A 4KKSA 3RZDH 4OWXB 5BR8Q 4GNXA 1CQFA 1PRTD 2JEBI 4JI5L 2J4XA 1GXDC 1XMQQ 1RTNA 2KENA 1S5DD 4HIMA 1HQMC 2C35B 1BXTA 1PV4A 1B44D 1VQNA 2AQ1B 3PF5A 2H5XA 2F0VA 2QEJC 4QUCA 4FF1A 4HCEA 4I7AA 1IBML 5CV9A 4DV0L 2B63H 4RKLA 2OT2A 5CV4A 4HCSA 1XNRQ 3F1ZA 2LSSA 1LTBD 2F3IA 4EGVA 4DV7L 4A3GG 3TS2A 2K28A 1EZ8A 3F8TA 1GM5A 3F2BA 1EZ6A 3LX0A 1MD2D 3K80C 1WJJA 2R92G 2JA7B 3NTIA 3I4MG 5LHY1 3CC4A 5JJKA 1YZ6A 2D2CC 2CWPA 3U50C 2KEDA 5M5XH 2UXBQ 3S1MB 4R1JA 5I6YA 3S15B 2F0KA 1HNWQ 1MIUA 3MEHA 3AEVA 1Q1BA 4DV5L 5M3MH 1A15A 4OHJA 2KHIA 1T5EA 5A2QL 3S2HH 4R9WA 4JI8L 3I8ZA 5C44G 1PH6A 1JMCA 4BXXG 5T1IA 2YTVA 2F0OA 2ZJRA 4RGNA 3VA5A 3Q8DA 2K5DA 4G57A 2KUMA 2XSCA 3BG3A 4Z9CB 2XN9C 4DFAA 1JICA 2AWOA 4UP7A 2NUCA 1BUVT 5GQOA 1U4LA 3QIAA 4RGTA 1VQ7A 1HQRD 1B53A 3U9SA 4BBRH 4DGZA 1YJ9A 5EPKA 4FVMA 4PQXA 2B2YA 1RD9D 1ZYRD 3K57A 1Y1WH 3K6OA 4KN7C 4MZ9A 4TRDA 2K1BA 2E2IH 1PRTB 1K0SA 1I4QA 1FR3A 2QW7A 3EIVA 5IP7G 1Y1VG 3KF8B 3V2TA 2WACA 1QOHA 5EPJA 1WTVA 1TWGH 1JCKB 1BQQT 1S4ZA 5IT9c 4ZAIA 1S5ED 4JYAQ 2NB0A 5ELCA 4RWSC 4MHEA 4JI2Q 4IUVA 3SK6A 2F3WA 2EJGC 5J22A 3T13A 5EJWA 1F77A 4JI6L 4XDXA 1B8AA 3MWYW 3OWEB 1CI3M 4BBSB 1JC7A 3NTKA 3A5ZB 4X65Q 5EAYA 1K8MA 4EVOA 2E74C 5D3IB 3A7AB 3D6WA 3HKSA 3VR3A 4GZYC 2RDHA 4YWMA 4Q5VA 3H0GG 1F2ZA 3HG9A 4NXNQ 1Z7TA 4DR4L 1L2FA 2SEBD 4DR7Q 1O7IA 2F0UA 2RHQB 2VZAA 5F2DA 1K3RA 1IBKL 1CK1A 2E2JH 1S5BD 1VQGA 4R4OA 2N88A 3NTHA 2B8FA 1XTCD 1TS4A 5IP9H 1MSGA 2F4IA 1DCZA 4A4IA 2SNSA 2D62A 2NBFA 2JN4A 2PMZE 1WTOA 4BY7G 1H95A 4EQ5A 3T56B 2B63B 2EQSA 3M7GA 4DR2Q 3C1FA 1HRJA 3I90A 2VS1A 4K0KQ 3MXGA 1GHJA 3MXNB 5IYCG 4I65A 4EQPA 2HDMA 3VR2A 2K75A 4DAYA 5TSSA 1O7YA 1SE2A 3CP0A 5IGFA 4A3JH 4KY5A 4R4QA 1R9TH 4WFN3 5J39A 2A69C 5KEEA 1ILQA 5C4ZA 4JBWA 4K14A 2I5HA 3HZXA 2HIVA 2PNRC 4DV2Q 4NXMQ 1KLGD 3HOVG 4N9TA 1YNJD 1EQVA 2A6HC 3L2PA 2NVYB 3H3VI 5CR3A 1BBUA 1KC8C 1SEBD 3Q23A 1G8ZD 4E6IA 2BDNA 1HNWL 3KDFB 5M5XB 3J7AF 2OQKA 2PW7A 5ELOA 4IUTA 4A3MH 2EY5A 1KAWA 1C48A 4MTNA 5HY6A 1S3OA 1H9SA 1G291 1VQ9A 3KYHC 4X3KA 1UEAB 4XXEA 4LFCL 1C9OA 1RHPA 1PLFA 4ZKBB 4C1NI 4A3FB 1I50B 5I9OA 4L5RC 2ATWA 2VB2X 3HOUH 4DPGA 4ZYSA 4CDCC 2F03A 1L0XB 1V8QA 1TS3A 4R4TA 4HJ7A 1L0WA 1B70B 3E9HA 2EXZA 1A8VA 1Q7YC 1STGA 2F0IA 1DJRD 3FPPA 1X3FA 3TQYA 3ULPA 1GHKA 2HDLA 2GA4B 3URYA 4BBRB 1XMOQ 3PIPA 4N9PA 1B9MA 3QWNA 4KKTA 1TVXA 2JSOA 1VMCA 2L5TA 2AUKA 1U4MA 3P1HA 4GKJL 1Y14B 1Y8OB 3OMCA 4OWWB 4WJ4A 2NVXH 2NYZD 1V9PA 5ELEA 1B2TA 4ZLTF 3M3YH 2E2IB 1PTOH 5ELBA 4A3IH 4H7BA 1X9NA 4C56C 1BNZA 4WJ3M 1TWGB 2A73B 3SGIA 3JAML 1NAPA 5JVH3 4JBMA 4XYOA 1A3TA 2B2WC 4FXGC 3BYYB 1J9OA 3M85A 4KY6A 3RR5A 1ET6A 1SNOA 2PZTA 4B3MQ 4KHPQ 2F0GA 3P7JA 3A55A 1CT1D 2J7ZA 2NN6H 2Q8IB 1HR0Q 4DV3L 1Q46A 3P75A 2JA6H 1G2SA 2N3SA 1E1OA 1YI2A 1E24A 3DUZA 2UXCL 2PI2E 4TQUS 3AU7A 4B3RL 2CHBD 2V1CC 1BR9A 2X6LA 3CMAA 3BJUA 2ZT9C 3R2TA 1EIYB 1K8OA 3CRKC 5C0XI 2OEOA 1STHA 2KHJA 1VQJA 3BDLA 4BY1H 2F0MA 1EY0A 1HUNA 3HOWG 1BCPB 1YJWA 1V1OA 2MFIA 1GUGA 2GVAA 4C2MB 1JJ2A 4OO1H 2OF1A 4N8X1 2OTJA 2FXQA 1WTRA 4JCVE 2A1AA 5JJLA 1KD1C 4ZK9B 4ULLA 1EY7A 4C3IG 4GKKQ 4WJWA 2Q8RE 2JA9A 4K0KL 3HOYG 1DOLA 4EQNA 1TS5A 3NBHB 1PDQA 1L1OC 4A3BH 2F0EA 1BCPC 3K7AH 5GAGC 5I2YA 1J6QA 1STNA 4XT1B 2B3GA 3KF8A 4X62L 4K2KA 2A19A 2VQFQ 3I2ZA 3LWUA 1PZJD 1NY4A 3QJYA 3FDTA 4A3JB 1KRSA 1R9TB 4LAAA 4UPAA 3T51B 4BWGB 4L6TB 3M9BA 3RLOA 4BS9A 1SNDA 2YTYA 4JOIC 3TDQA 1JB7A 2L9HA 5C3XA 3CCEA 3K0YA 3Q24A 1EYGA 1MI2A 3W5OA 3H94A 5E4XA 1MGSA 3R2IA 1I4HA 2DNCA 2RVLA 3DWAA 3NUCA 2IHEA 1QVCA 4LUZA 2MO0A 3PV0A 4F88A 5JEAJ 3UDFA 3CW2C 2R93G 5IYBG 1ILPA 1BBWA 4OEMB 3SDZA 3STBC 2N49A 3QR8A 4JI3Q 5D14A 1PVOA 4GLXA 2LXJA 3I91A 3NP8A 5L37A 2JEAI 5JPNC 3DHQA 4P2CB 1UE1A 5A35A 5JEAH 1W6JA 4EQOA 4C3HB 1DD2A 4P73A 1GUSA 3MZ5A 3G6JB 2HCIA 3HOUB 3HOXH 3R3OA 5IWAQ 4IQZA 5IY0A 4L5TA 3CPFA 3FKIG 1FNWA 1W6KA 3FMCA 1NJIC 1LUZA 1SYFA 3CCQA 5I6WA 3HOZH 4M8AA 4N8FA 2N78A 2UXDL 4CDEC 3K81C 4YHHL 5HURA 4FF2A 2TMPA 3BDOA 2CFMA 4HJ5A 3CCLA 4IOAA 2K32A 5M3FG 2CCZA 1PH8A 2NWGA 4WRDA 3I4NB 3DEOA 2KJXA 1T9HA 3M3YB 3MXNA 4BA1I 1PTOB 3FP9A 4A3IB 3A54A 2JE6I 3I3CA 4LF4Q 3AFQA 1FJGL 1JOKA 4K8IA 5EKLA 4V190 2O5JC 2R92H 4A3LH 2NTTA 4DR5Q 4YWKA 4Y7NH 4FF3A 1CFMA 2HUGA 4CKCA 2NZHA 4TVAB 1E2ZA 4HIOA 3PUXA 1JE4A 3QG1A 5A2QE 1SXTA 1VQDA 3TRZA 1PTOC 2RCNA 2ID0A 1BDOA 2JA6B 2K5NA 1SE3A 2JA8G 3KDFA 1QJOA 1VCIA 2TSSA 1B1ZA 1I4RA 1HR0W 3OW2A 4ME3A 4PMCA 3WDNA 5IIFA 4ZQ3A 4BXXH 1A62A 4IPGA 3PQIA 4ID6A 3M4QA 3OMGA 1X65A 1UAPA 4DV4Q 1GUWA 5DNFA 4A93G 4HTHA 2ZTCA 3V05A 3FRPB 3RLFA 2HQLA 3M4PA 4IOCA 3UI2A 4HJ9A 4BY1B 3GTOB 2L15A 2MHVA 1CSQA 3VA7A 4A3DG 2VQEQ 3BU2A 1TWFH 5IODA 2PYKA 1N8RC 3J80E 2VXWA 5AFWA 5I4DA 4J6HA 5FLMG 3E0EA 2OWOA 3F2UA 3CC7A 3NHHA 1O7ZA 1QNKA 1YHBA 3L7ZC 4AIMA 3L9AX 2MQHA 1CTMA 2O4XA 4DF7A 1N32L 4UP8A 3AQQA 1LTLA 4HR7B 3SK8A 1VQ5A 2IJ0A 1I5FA 1AZPA 1ASZA 4A3BB 3K7AB 1I4XA 1WD0A 2EIFA 3VYUA 4HIKA 4UAIA 1QCBD 1UWVA 3IKJA 4CDDC 4PZ7A 1B9NA 3K0XA 2JA5G 3R8BA 1J5EL 1CZGA 2E2HB 4LFAL 1N34Q 2Q2TA 4CKEA 4P75A 2UUAQ 5C6AA 3TP7A 4LF7Q 5C3EG 2B8GA 2E76C 3CCMA 1VQLA 2KQ3A 2EOTA 2IW3A 1E22A 2L55A 1QILA 2Z6KC 4JI7L 1AZQA 1I6HH 4H0LC 1P16A 3I73A 4P74A 4UY8C 4IUQA 2HHHL 4C3JB 1RCVD 2K14A 1Q1EA 2PI2A 2PNHA 3HS0C 5ISRA 3OSOA 1HHVA 1QB5D 4ZRZA 1ONLA 3RUZA 5IWAL 3S1NH 2RHSB 4DV1Q 5I9PA 3QOJA 2ZM6L 3KK7A 5CC4A 2EPBA 1YNXA 4K2LA 1XYIA 3K5OA 4Q0FA 3HOXB 3KJOA 3S2DB 1HJPA 4DK3C 3J81E 2F0LA 4F87A 2F0FA 2HT1A 1HNXL 1ET9A 1DOMA 4FXKC 3HOZB 4M1UB 1DYQA 3TEHB 4GOPB 2WKCA 2K6AA 2F0HA 4JOIA 4GN5A 5E1FA 2QEXA 3KOJA 3NBHA 1KIXA 1O78A 1HH2P 2D0PA 1HPCA 4DAVA 2DGYA 3BVGA 4NB3A 4S3SA 1PYBA 4IFDJ 1H9JA 4HAEA 5JVG3 4LF6L 1D5ZC 3ND8A 1PFNA 1TY2A 4DR6L 5CV7A 1UE5A 3E0JA 1SMYC 4DR5L 1G51A 1VQ8A 1F9RA 2FHTA 1FNVA 2KCTA 2JA7G 3PO2B 1U9RA 2A8VA 4A3KH 3HOVH 4GOPC 1B3QA 1EY9A 2EYOA 4DNRB 3D31A 3SR1A 4IFDH 1LACA 2EYLA 4Y7NB 1I3QH 3H91A 3EQLC 1JE5A 2A69D 5CBEE 3GTQH 3W2DA 1IW7C 2E8GA 3CQZB 3G7LA 2NVTH 2A6HD 3H15A 2KCNA 5IOCA 2ALYB 1SAPA 4YY3Q 1N33Q 2CVRA 4DUZQ 5C0XG 2E5LL 4DV4L 1LTRD 4O0AA 1KHIA 2CH4A 1GD7A 1KAAA 2QA4A 5FJ8G 3NQTA 1KRTA 1G91A 1Y69U 4O1NA 3E9IA 4FP5D 4A3CH 2VQEL 3S14H 1KTKA 1Z9FA 2F0SA 1BVSA 1WCMB 3S1RB 4FF4A 5KRUA 2ZTDA 5KYIA 5G3LD 1TWFB 3L3OC 3CMEA 5FLXL 1PYWD 2PO4A 4XYQA 1I4PA 3CCRA 2J0TD 1NCVA 1RL2A 4XTCS 2B2TC 1SYGA 1Y8NB 1MJCA 1IL8A 2V4DA 1Q3LA 3S16H 3D3RA 5NUCA 5LL6S 1X32A 2IX3A 3T1YQ 3JAME 1LT6D 1EYCA 2EYHA 1O80A 3K5LA 3C2PA 4O42A 4UHVA 3UDXA 1J8IA 5C5LA 1F2LA 3NE5B 3GV3A 1N34L 3OW7A 4RGOS 2UUAL 2I0QA
chains in the Genus database with same CATH topology
2BE5C 3S1QB 3NWTA 2E75C 1LT4D 2DY7A 4J1MA 1SJHD 5C3WA 3X3MA 3K5MA 4RHRA 2FJ2A 3M4OB 4RCOA 3PUYA 4U673 2B2VC 3KUPA 2EY2A 3RZDB 3VR4A 2A6EC 3BZDB 1HTPA 1SNQA 4MIUA 2R3ZA 3T53B 2ZXRA 2NTSA 3TP6A 3SVMA 3S1NB 1JOOA 3DM1A 4OO1I 1F9QA 1KNAA 3MC0B 2IX1A 1EFID 5FKAC 1TS2A 1HTLD 5KNCA 4XQJA 3W3AA 5FO9B 2KCCA 4G7OC 4KK7A 1TIID 2K03A 3NQIA 2Y0SB 4G4KA 4IURA 3VR5A 1WVLA 1RDPD 3CRLC 3HRZC 3TN2A 5E3FA 4BA2I 2Z8LA 1BCPD 3KLSA 2L11A 5D3DA 2K5QA 3SK4A 2VB3X 4A3KB 1EYAA 5EKKA 2A68C 3K5NA 2BA0A 4OIKA 1I3QB 1NR4A 5M3MB 1AEXA 4K6DA 2XWBB 1JR0D 3GTQB 1H9MA 3IFDA 3S2HB 3MXPA 2NVTB 1SBBB 2K05A 4YIJA 4K6LA 1LTTD 3ONAB 5K36H 5BN4A 3NWSA 1BF4A 4KHZA 2FMCA 2H1EA 1JQYD 3S14B 1U4PA 4MN3A 3E6ZX 1Y1WB 2AWNA 2K7VA 5E4WC 2WB1B 3I72A 4F7XA 3IFTA 1B4OA 1RODA 4KD3A 1PXUA 2CW0C 1S5CD 3AB9A 1PRTF 2O2LD 2PQEA 2LS01 2Z1CA 1LO5D 3S16B 1HCZA 3NXWA 3SEBA 5KGUA 3AMUA 2A74C 4NP5A 2F0PA 3KLSX 4J8QA 3D4RA 2F0NA 1YNNC 1KDBA 5FO7B 3Q6SA 3MA2B 1ENFA 4AYBB 1EEFD 1NR2A 1VF7A 5M5WB 5IGGA 2Z4HA 2VUMB 2DY8A 1IKLA 5COYA 1V1PB 1U4RA 3MFGA 3N6RA 4HMIA 1OXXK 2EJMA 2DN8A 1ML0D 1KABA 1Q90A 2K5WA 1PTOD 1EYDA 2B2TA 2E2JB 2E2DC 1AP0A 2WIIB 1OXUA 1V43A 4QMGA 4RFBA 1NSNS 3HGBA 3A7LA 1NUCA 2B39A 3HKZB 5FK9C 4CJ0B 2WAQB 2RQXA 5BN5A 1AN8A 4C1NK 5LL6X 2EDGA 1STBA 3TSSA 1M8AA 2G9HD 1PZID 1AW7A 2KHSA 4KMUC 1UNSA 2RKSA 5JPMC 3RD4A 2DNEA 4ILWA 2B2VA 2NVQB 3OIQA 4HEDA 1SYDA 1ZXTA 4PMBA 4NW2A 3OHXC 2CQAA 2RSOA 5C4XB 2BA1A 3QOLA 1QWYA 4OIJA 5EPLA 5IGCA 4A3EB 4A3MB 3A56A 4KJNA 1RTOA 5T1GA 1GUTA 1KDAA 3WOEA 5EGTA 3CHBD 5KNBA 2ICEC 4RA8A 4XQNA 2LFNA 1D2BA 1ESRA 1DXMA 1E2VA 1DONA 4ZUIA 1F9SA 1EWHA 1EY5A 4C3HG 3S9WA 1EU3A 5C5MA 5M5YB 2MP1A 3N52A 1A2TA 2NVXB 2KVMA 3GP7A 1FD7D 4TSSA 3GO5A 2XRQD 1D6EC 1H9KA 4DK1A 3K58A 3RZOB 4FNFA 4ZUJA 3EFXD 4ODGA 2M00A 3OOCA 1IYVA 1Y8PB 2PW5A 4QIWB 1SYBA 5IGBA 3OWFA 2RBMA 4KD4A 1JORA 5KNDA 4CJ2C 5C0XJ 1EIGA 1SNMA 3A8KE 3TP8A 4IFDI 1SMYD 3PO3B 1EU4A 2FINB 4PNYA 2LY7A 5C4HA 2EYJA 5C0XH 5CGKA 4ME5A 3Q22A 1IW7D 1SNCA 1F9PA 5FLXE 4HN7A 4KV6A 1BCPF 2AQ3B 1FYCA 1CHPD 2XIWA 4FO2A 4OO1G 3NK9A 2D5DA 2B2WA 4LJZC 2EYFA 5IGDA 1LTGD 1Z47A 2K04A 2PCFB 4JK1C 3MXUA 5ELFA 1CA6A 5DAUA 5JAVA 1R4QB 3T4AC 4XIGS 4WORA 1R4PB 2L4NA 2L1BA 3KBXA 2JP1A 2R7ZB 1ENAA 4KJOA 2H4OA 1IKMA 3VYSA 1SDFA 4IUPA 1SYCA 2EE1A 1L0YB 5BN3A 2F0DA 5FOBB 1PFMA 2MUYA 2VNUD 2KEEA 3PIO3 4HSVA 1PZKD 3LWEA 1E0BA 3E5SA 4IUUA 1A3UA 1JWMD 3M4YA 1V1PA 1HFGA 4C3JG 2BE5D 3T16A 1LABA 1BOSA 1LTSD 2M9VA 4KHVA 4IUNA 3K59A 4ABNA 2QCPX 2EJFC 2IX0A 1II3A 3BS1A 1DZ1A 3H3VC 2WP8J 5EQ0A 5JEAG 1VMPA 2A5HA 2A6ED 1XXGA 1ZEQX 2KOLA 4RKBA 4F8MA 1A3VA 1D5MC 1IYUA 2IPKD 1EY8A 4DA2A 4A3GB 1C4QA 3FEWX 4FXDA 1PTOF 2LKVA 3I70A 2R92B 1VF5C 2F0WA 3MHBA 2BCOA 3I4MB 1Q8IA 3GTPB 1LT3D 3PUWA 5IT9L 4LK1C 3C3LA 4H13C 1OXVA 1WTWA 5C44B 2QILA 1UUPA 1DM0B 4KN4C 2HQEA 2SDFA 2N55A 2A68D 3VR6A 2G9DA 3SK5A 1EY6A 4NKLA 1HA5A 1STYA 1JB3A 4DNTB 1QNUA 1B3AA 3GTMB 1X3PA 2XNAC 1EIHA 5EBDA 2FFKB 2MGSA 2RDFA 2QKIC 1Y1VB 2XWJB 3QO2A 3OPOA 2EYPA 3J80L 2X69A 4QUFA 5CMDA 2L12A 3BVZA 1Q12A 1B50A 2CW0D 1X3QA 1LV9A 2BDOA 2F1MA 3BDCA 2OXPA 2FMMA 3SHLA 2NN6I 2C9OA 3DWQA 3PUVA 1I6HB 1XX8A 3EVQA 1PRTC 4K5WA 2PZUA 1LT5D 1EQTA 1OO9B 2F3VA 1RKNA 5HGTA 1YNND 4XT3B 3H0GB 1SJED 1TKWB 4IZ8A 2AQ2B 3GV6A 1EEID 2EZVA 3DXJC 3A8IE 3O13A 1WTQA 3KLRA 2WKDA 4G7HC 5CV6A 1SFOB 4X3UA 4BY7B 3GQBA 4RHSA 4X3TA 3TBIB 1SNPA 2PMZB 1RJTA 4CHTB 3KBGA 1EOTA 3MAQA 1CA5A 3J81L 3FPUB 4R8NA 4H44C 1MBYA 3GTJB 1HUMA 5IGEA 2F0QA 3OIPA 3HOVB 4HSPA 1IHZA 1A2UA 1DOKA 5JJZA 2EVBA 5DM73 2IL8A 2Z4IA 4IFDG 3WOFA 1M4VA 3HEJA 4KTAA 2IT1A 2C5CA 4V0BA 5J1ZA 4U68A 1OXTA 1RF2D 5KYLA 1WTXA 5K5PA 1ZYRC 1JOQA 2RA4A 2EYMA 2JXMB 5DEHA 1SSOA 3TZDA 2R6GA 1JWUD 3C1EA 1ZKOA 5CORA 1ESFA 2MJ8A 1FNUA 1F2MA 2B2UC 3EROA 1D1IA 2K01A 5C4JB 1TQOA 4K5VA 4KI0A 1QG7A 1O7LA 2XVSA 4B08A 3FVQA 2ZXOA 2WINB 3GTGB 2QF7A 4L63B 2XRSD 3LNNA 1CQVA 5ELDA 3P20A 1GJXA 3C46A 1TY0A 2ENBA 2I46A 4FYDA 1PFBA 4KY7A 1TWAB 1LTAD 1OXSC 4CJ1B 1I4GA 2KECA 2SOBA 2YYZA 3J7AV 5DM63 1WTPA 2YU9B 1STEA 3MFYA 4CKBA 3HP3A 1EL0A 3PMFA 2ZXPA 3V96A 3HOWB 4IN3A 5CV8A 3MVVA 2O5IC 3TZUA 1S5FD 1E2WA 4TKOB 2M2LA 1JWSD 3D4WA 3DWPA 4C3IB 5CV5A 1C8CA 3HOYB 1CHQD 1SYEA 1WD1A 4I7ZC 4DK0A 4QB4A 1EWCA 1YNJC 4OL7A 4R8IA 4NDXA 3SXHA 4QF4A 3QB3A 1MSHA 1T5XD 1H9RA 3EA6A 4B9WA 3M7NA 2QDBA 2Q8TA 3PIP3 3A8JE 2EY6A 5G3LF 2WV6D 1VDZA 4HMJA 5CYUA 5I2XA 3GD7A 4UDUC 4DXFA 2R93B 3VYRA 2I07B 1K83B 3VYTA 4B9XA 4DN4M 1XWEA 2F0JA 2ICIA 2RDGA 2BOSA 5K36G 3RMHA 1QE6A 3J7YW 1TT2A 2SNMA 3FKIB 4DU9A 3NSWA 3TMEA 3H6MA 1D1KA 2KA7A 3GTLB 2EY1A 3Q0AA 4IALA 2IWHA 3S17B 3IL8A 5D65A 5EBCA 5M3FB 2PZWA 1HFNA 2K33A 1ENCA 1GOZA 4K8JA 4RAUC 1F2YA 3NBIA 2JYOA 2B2YC 4RH6A 5IT9E 4G7ZC 4PV1C 1CM9A 1LLRD 1BBXC 2HCCA 2NN6G 3GTKB 3D8GA 3DMUA 1D5XC 3ND9A 1STAA 2JA8B 1LTID 4RGMA 4K5XA 3SE0A 3X3NA 4QCLA 2D9UA 4OGQC 1TR5A 3CU7A 2PPBC 1AFPA 3MTSA 5EKIA 4XQQA 4KKUA 1GUNA 2B2UA 5M9OA 2F0TA 1BO0A 4X3SA 4DAPA 1GUOA 3ERQA 4A93B 4RCNA 3NPPA 4L8JA 3U9OA 1G6ZA 5FO8B 4A3DB 1KNEA 3ZYYX 3H09A 1EY4A 1HXYD 3TP5A 1KDCA 2NZ1D 1A6XA 1KLUD 3D6CA 1TWCB 4LMQD 3D4DA 1Z6HA 4PMWA 3I4LA 1TU2B 4DXGA 2L0CA 2AUJD 2X6GA 3IAYA 1HA6A 1FGBD 4ZKCB 2JA5B 3BVMA 3PUZA 3CKIB 1SE4A 5JOBA 5C3EB 1ICWA 1PMRA 2R61A 1TWHB 5KIXA 4CGYB 2LMCB 3ITPA 2MPMA 5CBAE 4NMZA 1G2TA 1CZWA 4CBVA 3DEPA 1H9SB 3EJIA 1I6VC 3BYTB 2RSNA 3R93A 4KKSA 1CQFA 1PRTD 2JEBI 2J4XA 1GXDC 1RTNA 1S5DD 1HQMC 1BXTA 1B44D 2AQ1B 2F0VA 2QEJC 4QUCA 4FF1A 4HCEA 5CV9A 4RKLA 2OT2A 5CV4A 4HCSA 1LTBD 4EGVA 2K28A 1EZ8A 1EZ6A 3LX0A 1MD2D 2JA7B 3NTIA 5LHY1 2D2CC 2KEDA 3S1MB 5I6YA 3S15B 2F0KA 3MEHA 1Q1BA 1A15A 4OHJA 1T5EA 5A2QL 4R9WA 3I8ZA 5T1IA 2F0OA 4RGNA 3VA5A 2K5DA 4G57A 2KUMA 2XSCA 3BG3A 4Z9CB 2XN9C 4DFAA 1JICA 2AWOA 2NUCA 1BUVT 1U4LA 3QIAA 4RGTA 1HQRD 1B53A 3U9SA 4DGZA 5EPKA 4FVMA 4PQXA 2B2YA 1RD9D 1ZYRD 3K57A 3K6OA 4KN7C 4TRDA 2K1BA 1PRTB 1I4QA 1FR3A 3V2TA 2WACA 1QOHA 5EPJA 1WTVA 1JCKB 1BQQT 1S4ZA 4ZAIA 1S5ED 2NB0A 5ELCA 4RWSC 4MHEA 4IUVA 3SK6A 2F3WA 2EJGC 5J22A 3T13A 5EJWA 1F77A 4XDXA 3MWYW 3OWEB 1CI3M 4BBSB 1JC7A 3NTKA 1K8MA 4EVOA 2E74C 5D3IB 3A7AB 3D6WA 3VR3A 4GZYC 2RDHA 4Q5VA 1F2ZA 3HG9A 1Z7TA 2SEBD 2F0UA 5F2DA 1CK1A 1S5BD 2N88A 3NTHA 2B8FA 1XTCD 1TS4A 1MSGA 2F4IA 1DCZA 2SNSA 2D62A 2NBFA 1WTOA 3T56B 2B63B 3M7GA 3C1FA 1HRJA 3I90A 3MXGA 1GHJA 4I65A 4EQPA 2HDMA 3VR2A 4DAYA 5TSSA 1O7YA 1SE2A 5IGFA 4KY5A 4WFN3 5J39A 2A69C 5KEEA 1ILQA 5C4ZA 4JBWA 4K14A 3HZXA 2PNRC 1KLGD 4N9TA 1YNJD 1EQVA 2A6HC 2NVYB 5CR3A 1SEBD 3Q23A 1G8ZD 4E6IA 2BDNA 5M5XB 3J7AF 2PW7A 4IUTA 2EY5A 1C48A 1H9SA 1G291 4X3KA 1UEAB 4XXEA 1RHPA 1PLFA 4ZKBB 4C1NI 4A3FB 1I50B 5I9OA 2VB2X 4ZYSA 2F03A 1L0XB 1V8QA 1TS3A 2EXZA 1STGA 2F0IA 1DJRD 3FPPA 1GHKA 2HDLA 2GA4B 3URYA 4BBRB 4N9PA 1B9MA 3QWNA 4KKTA 1TVXA 2JSOA 1VMCA 2L5TA 2AUKA 1U4MA 3P1HA 1Y8OB 3OMCA 2NYZD 5ELEA 1B2TA 4ZLTF 2E2IB 1PTOH 5ELBA 4H7BA 4C56C 1BNZA 1TWGB 2A73B 3JAML 1NAPA 5JVH3 4XYOA 1A3TA 2B2WC 4FXGC 3BYYB 1J9OA 3M85A 4KY6A 1ET6A 1SNOA 2PZTA 2F0GA 3P7JA 3A55A 1CT1D 2J7ZA 2NN6H 2Q8IB 3P75A 1G2SA 3DUZA 4TQUS 3AU7A 2CHBD 1BR9A 2X6LA 3R2TA 2ZT9C 1K8OA 3CRKC 5C0XI 2OEOA 1STHA 3BDLA 2F0MA 1EY0A 1HUNA 1BCPB 1V1OA 1GUGA 4C2MB 4OO1H 2OF1A 1WTRA 4ZK9B 4ULLA 1EY7A 4C3IG 4WJWA 2Q8RE 1DOLA 4EQNA 1TS5A 1PDQA 2F0EA 1BCPC 5I2YA 1STNA 4XT1B 3KF8A 4K2KA 3LWUA 1PZJD 3QJYA 3FDTA 4A3JB 1R9TB 4LAAA 3T51B 4BWGB 4L6TB 4BS9A 1SNDA 3TDQA 2L9HA 5C3XA 3K0YA 3Q24A 1MI2A 3H94A 5E4XA 1MGSA 3R2IA 1I4HA 2DNCA 2RVLA 3DWAA 3NUCA 3PV0A 4F88A 5JEAJ 1ILPA 3SDZA 5D14A 3I91A 3NP8A 2JEAI 5JPNC 3DHQA 4P2CB 5A35A 5JEAH 1W6JA 4EQOA 4C3HB 1DD2A 1GUSA 3MZ5A 3G6JB 2HCIA 3HOUB 3R3OA 4IQZA 1FNWA 1W6KA 3FMCA 1SYFA 5I6WA 4M8AA 5HURA 4FF2A 2TMPA 3BDOA 2K32A 2NWGA 4WRDA 3I4NB 3DEOA 2KJXA 3M3YB 3MXNA 4BA1I 1PTOB 4A3IB 3A54A 2JE6I 3I3CA 1JOKA 4K8IA 5EKLA 4V190 2O5JC 2NTTA 4FF3A 1CFMA 2HUGA 4CKCA 1E2ZA 3PUXA 1JE4A 3QG1A 5A2QE 1SXTA 1PTOC 2ID0A 1BDOA 2JA6B 1SE3A 1QJOA 1VCIA 2TSSA 1B1ZA 1I4RA 4PMCA 3WDNA 5IIFA 4ZQ3A 4ID6A 3OMGA 1UAPA 1GUWA 5DNFA 4HTHA 3V05A 3FRPB 3RLFA 3UI2A 4BY1B 3GTOB 2MHVA 3VA7A 5IODA 2PYKA 3J80E 2VXWA 5AFWA 5I4DA 4J6HA 3F2UA 3NHHA 1O7ZA 1QNKA 3L7ZC 3L9AX 1CTMA 2O4XA 4DF7A 4HR7B 3SK8A 2IJ0A 1AZPA 4A3BB 3K7AB 1I4XA 1WD0A 3VYUA 4UAIA 1QCBD 3IKJA 1B9NA 3R8BA 1CZGA 2E2HB 4CKEA 5C6AA 3TP7A 2B8GA 2E76C 2EOTA 2KQ3A 2IW3A 2L55A 1QILA 1AZQA 4H0LC 3I73A 4IUQA 4C3JB 1RCVD 1Q1EA 3HS0C 5ISRA 3OSOA 1HHVA 1QB5D 4ZRZA 1ONLA 3RUZA 5I9PA 3QOJA 3KK7A 5CC4A 2EPBA 4K2LA 1XYIA 3K5OA 4Q0FA 3HOXB 3S2DB 3J81E 2F0LA 4F87A 2F0FA 1ET9A 1DOMA 4FXKC 3HOZB 4M1UB 1DYQA 2WKCA 2K6AA 2F0HA 5E1FA 3NBHA 1O78A 1HPCA 4DAVA 4S3SA 3BVGA 4IFDJ 1H9JA 4HAEA 5JVG3 1D5ZC 3ND8A 1PFNA 1TY2A 5CV7A 3E0JA 1SMYC 1F9RA 2FHTA 1FNVA 3PO2B 1U9RA 1EY9A 2EYOA 4DNRB 3D31A 3SR1A 4IFDH 1LACA 2EYLA 4Y7NB 3H91A 3EQLC 2A69D 5CBEE 3W2DA 1IW7C 3CQZB 3G7LA 2A6HD 2KCNA 5IOCA 1SAPA 2CVRA 5C0XG 1LTRD 1KAAA 3NQTA 1G91A 1Y69U 4O1NA 4FP5D 1KTKA 2F0SA 1WCMB 3S1RB 4FF4A 5KRUA 5KYIA 5G3LD 1TWFB 3L3OC 5FLXL 1PYWD 2PO4A 4XYQA 1I4PA 2J0TD 1NCVA 4XTCS 2B2TC 1SYGA 1Y8NB 1IL8A 2V4DA 1Q3LA 3D3RA 5NUCA 5LL6S 1X32A 2IX3A 3JAME 1LT6D 1EYCA 2EYHA 1O80A 3K5LA 3C2PA 4O42A 1J8IA 5C5LA 1F2LA 3NE5B 3GV3A 3OW7A 4RGOS
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XQN A;  3BS1 A;  4XQJ A;  4CBV A;  4XYO A;  4XYQ A;  4XQQ A;  4G4K A;  4XXE A; 
#chains in the Genus database with same CATH topology
 1LYL A;  2BE5 C;  5M5W H;  1XNQ Q;  3S1Q B;  1UE6 A;  2E75 C;  3NWT A;  1LT4 D;  2DY7 A;  2VUM H;  4BBS G;  4J1M A;  1SJH D;  4GLV B;  3GDE A;  5C3W A;  3ZJY C;  2UUC Q;  3X3M A;  3CPW A;  3K5M A;  4RHR A;  2FJ2 A;  3M4O B;  5BR8 L;  3PSI A;  4R4C A;  4RCO A;  3PUY A;  4U67 3;  2B2V C;  3KUP A;  2EY2 A;  3CXC A;  1XMQ L;  1NTG A;  3RZD B;  3VR4 A;  1IYJ B;  2A6E C;  3BZD B;  1PH1 A;  2Q2U A;  4ZCK A;  4JV5 Q;  1HTP A;  2OQ0 A;  1SNQ A;  4MIU A;  2R3Z A;  4DUY Q;  3T53 B;  2ZXR A;  2F4V Q;  2NTS A;  2HD3 A;  3J80 c;  3TP6 A;  1U5K A;  3SVM A;  3S1N B;  1JOO A;  2UU9 Q;  1XNR L;  3DM1 A;  4OO1 I;  1F9Q A;  1KNA A;  1WYD A;  3MC0 B;  2IX1 A;  1VQF A;  5GAD C;  1EFI D;  5FKA C;  1TS2 A;  1HTL D;  4C3I H;  5KNC A;  1YHA A;  3J80 i;  2B63 G;  4XQJ A;  4LF9 Q;  1V1Q A;  3HOY H;  3W3A A;  4P71 A;  5FO9 B;  1A63 A;  2KCC A;  4G7O C;  3D0F A;  4KK7 A;  1C7Y A;  1TII D;  2K03 A;  2Y0S E;  4B3S Q;  3NQI A;  1PH3 A;  2Y0S B;  4G4K A;  4IUR A;  3VR5 A;  1VQI A;  1WVL A;  2UUB Q;  1RDP D;  2P5Z X;  3CRL C;  3HRZ C;  3TN2 A;  5E3F A;  4BA2 I;  3BZC A;  2NVQ H;  1QUQ B;  2UXB L;  2Z8L A;  1BCP D;  3KLS A;  2L11 A;  5C4X H;  5D3D A;  2K5Q A;  1X55 A;  2VB3 X;  3SK4 A;  4A3E H;  4A3K B;  1EYA A;  4JBK A;  4IPC A;  3J7A 5;  4YCU A;  5EKK A;  4FDB A;  2A68 C;  1CKM A;  3K5N A;  2BA0 A;  4OIK A;  1I3Q B;  1NR4 A;  5M3M B;  1AEX A;  2I5L X;  4K6D A;  2XWB B;  1JR0 D;  3GTQ B;  5IYB H;  1E1T A;  3RNU A;  1H9M A;  3TRE A;  3IFD A;  4POF A;  3S2H B;  5IYD H;  4YY3 L;  3MXP A;  1N33 L;  2NVT B;  3OTO Q;  1SBB B;  2VW9 A;  4DR1 Q;  2K05 A;  4YIJ A;  3CCJ A;  4K6L A;  1LTT D;  3ONA B;  5K36 H;  1K73 C;  4A3F G;  5BN4 A;  3NWS A;  1BF4 A;  4KHZ A;  3PF4 A;  2XTI A;  5M5Y H;  3STB D;  2FMC A;  3J81 c;  5LMN Q;  2H1E A;  1JQY D;  3S14 B;  1SR3 A;  1U4P A;  3UE1 A;  1ICF B;  3L0O A;  4BBR G;  1SMX A;  4MN3 A;  3E6Z X;  1Y1W B;  2AWN A;  2K7V A;  3G6E A;  5E4W C;  2WB1 B;  3I72 A;  4F7X A;  3J81 i;  1SRU A;  3IFT A;  1I94 Q;  4JYA L;  1NBW A;  1B4O A;  4JBJ A;  1ROD A;  1UE7 A;  4KD3 A;  1VQB A;  3RZO H;  1PXU A;  2CW0 C;  1S5C D;  4JI2 L;  4GOP A;  3AB9 A;  1PRT F;  2O2L D;  2PQE A;  1A0I A;  2LS0 1;  1LO5 D;  2Z1C A;  1HCZ A;  3S16 B;  1VQO A;  3NXW A;  3SEB A;  5KGU A;  3AMU A;  2A74 C;  4NP5 A;  1X54 A;  4X6A H;  3G48 A;  2F0P A;  1FVI A;  3KLS X;  4J8Q A;  4B3T Q;  3D4R A;  2F0N A;  1HNZ Q;  1YNN C;  1K3B C;  4X65 L;  1XNQ L;  1KDB A;  4DR3 Q;  1W2B A;  5FO7 B;  3Q6S A;  1S40 A;  3MA2 B;  4AYB E;  1XJV A;  1ENF A;  2JK8 A;  4AYB B;  1EEF D;  1NR2 A;  1VF7 A;  5M5W B;  4OX9 Q;  5IGG A;  3GTK H;  2Z4H A;  2VUM B;  2CQO A;  2DY8 A;  1IKL A;  5COY A;  4IJH A;  1V1P B;  2ES2 A;  3PO3 H;  1U4R A;  4PG3 A;  4APV A;  4NXN L;  3MFG A;  3N6R A;  2JA8 H;  1XTD A;  4HMI A;  1OXX K;  4JPB W;  2EJM A;  4DR7 L;  2DN8 A;  3NEL A;  1ML0 D;  3TS0 A;  1KAB A;  1L1O B;  1Q90 A;  1VS0 A;  2K5W A;  2K5V A;  1PTO D;  1IL2 A;  1EYD A;  1RIP A;  2B2T A;  2E2J B;  2E2D C;  1AP0 A;  2WII B;  1OXU A;  5J3B A;  3BZK A;  4AQY Q;  1V43 A;  4QMG A;  4RFB A;  1NSN S;  3HGB A;  3A7L A;  4DR2 L;  1NUC A;  2B39 A;  3HKZ B;  5FK9 C;  5IP9 G;  2MNA A;  2WAQ E;  1G6P A;  4CJ0 B;  3JAM c;  2WAQ B;  2RQX A;  5BN5 A;  3UDG A;  1AN8 A;  4C1N K;  3CAM A;  3A0J A;  5LL6 X;  2EDG A;  1S72 A;  1EQQ A;  1STB A;  3TSS A;  2R7Z H;  1M8A A;  2G9H D;  1PZI D;  3JAM i;  4DV2 L;  2IHF A;  4NXM L;  1AW7 A;  2KHS A;  4KMU C;  4OON A;  4JI4 Q;  1UNS A;  2RKS A;  5JPM C;  3RD4 A;  2DNE A;  3EN2 A;  4A3J G;  4ILW A;  1BKB A;  3ULJ A;  2B2V A;  2JA5 H;  2NVQ B;  3OIQ A;  1HZ9 A;  4HED A;  1SYD A;  1ZXT A;  2Z9H A;  4PMB A;  4NW2 A;  4IPH A;  3OHX C;  2CQA A;  2RSO A;  3H3V H;  5C4X B;  2BA1 A;  3QOL A;  1QWY A;  4OIJ A;  5EPL A;  3RLN A;  1TWH H;  1EIF A;  5IGC A;  4A3E B;  1SLJ A;  3CCU A;  4A3M B;  3A56 A;  4KJN A;  1NE3 A;  1RTO A;  5T1G A;  1GUT A;  3CCS A;  1KDA A;  1EUJ A;  3WOE A;  4QGU A;  4KLK A;  5EGT A;  5LMU Q;  3CHB D;  5KNB A;  3OTO L;  2ICE C;  4RA8 A;  4XQN A;  5H1S E;  1DGS A;  2PQA B;  2LFN A;  2GN5 A;  1D2B A;  1ESR A;  1DXM A;  4X64 Q;  1E2V A;  1DON A;  4DV6 Q;  4ZUI A;  1F9S A;  1EWH A;  1EY5 A;  4JW0 A;  4C3H G;  3S9W A;  5GAE C;  1EU3 A;  1XMO L;  3HOU G;  4JI5 Q;  5C5M A;  3E3X A;  5M5Y B;  2BH2 A;  2MP1 A;  3J7Z C;  3N52 A;  3KJP A;  4A3G H;  1A2T A;  2NVX B;  2KVM A;  3GP7 A;  5LMN W;  4Y52 H;  1FD7 D;  1IBM Q;  4TSS A;  5ELN A;  3GO5 A;  2XRQ D;  1D6E C;  1H9K A;  4DK1 A;  3K58 A;  3I4N G;  3RZO B;  4FNF A;  4ZUJ A;  4DV7 Q;  1EWI A;  4A3I G;  4B3M L;  1X3G A;  3EFX D;  4ODG A;  3T1H Q;  3KFU A;  4KHP L;  1VQM A;  1HR0 L;  1Q8K A;  3I4M H;  4DR3 L;  2M00 A;  3OOC A;  4YCV A;  4HID A;  1IYV A;  1Y8P B;  2XGT A;  1FGU A;  3GTP H;  3U4Z A;  4J15 A;  1QUQ A;  4GS3 A;  2PW5 A;  4QIW B;  1SYB A;  5IGB A;  4LFB Q;  3OWF A;  2RBM A;  3B6Y A;  4LF5 Q;  4KD4 A;  1CSP A;  1JOR A;  5KND A;  4NPS A;  4CJ2 C;  5C0X J;  1EIG A;  1SNM A;  4A76 A;  3A8K E;  3TP8 A;  3S1M H;  4IFD I;  4DAM A;  1PH5 A;  4UP9 A;  2JA6 G;  1SMY D;  2WFW A;  1EU4 A;  5C44 H;  3PO3 B;  2FIN B;  3FHW A;  4PNY A;  2LY7 A;  5C4H A;  2EYJ A;  4DV5 Q;  2Q2I A;  5C0X H;  5CGK A;  4ME5 A;  4MNO A;  3Q22 A;  1IW7 D;  1AH9 A;  1K28 A;  1SNC A;  5FJ8 H;  1F9P A;  2VL6 A;  5FLX E;  4HN7 A;  4BY1 G;  3GTM H;  4KV6 A;  1BCP F;  1EOV A;  2AQ3 B;  1FYC A;  4EX5 A;  4GKK L;  1CHP D;  2XIW A;  4FO2 A;  1PYS B;  2DJF C;  4OO1 G;  1MJE A;  2HIX A;  4DK6 C;  3NK9 A;  2D5D A;  2B2W A;  4LJZ C;  2EYF A;  5IGD A;  1Q81 C;  3CCV A;  1LTG D;  5IP7 H;  1Z47 A;  1Y1V H;  2K04 A;  1JJG A;  2PCF B;  4QL5 A;  2R7D A;  4JK1 C;  3MXU A;  5ELF A;  2VQF L;  2ZJP A;  4JG2 A;  1CA6 A;  3I56 A;  5DAU A;  1CUK A;  5JAV A;  1R4Q B;  3T4A C;  1PH7 A;  4A3B G;  4XIG S;  4WOR A;  1R4P B;  4IJL A;  1MHW C;  2L4N A;  2L1B A;  2GVB A;  3KBX A;  2JP1 A;  2R7Z B;  4IPD A;  1SE8 A;  1QZH A;  1PH4 A;  1ENA A;  5E7N A;  4KJO A;  2H4O A;  1IKM A;  3VYS A;  1SDF A;  4IUP A;  3J81 j;  1SYC A;  2EE1 A;  1L0Y B;  5BN3 A;  2F0D A;  5FOB B;  1M1K C;  1PFM A;  2MUY A;  1X6O A;  2VNU D;  4JI3 L;  4JI6 Q;  2KEE A;  3PIO 3;  4HSV A;  1KXL A;  1PZK D;  3K8A A;  3LWE A;  1E0B A;  3E5S A;  4IUU A;  1A3U A;  1JWM D;  3H0G H;  3M4Y A;  5LMU L;  1V1P A;  1HFG A;  4L5Q A;  4C3J G;  2BE5 D;  3I7F A;  3T16 A;  2KCM A;  2YV5 A;  1LAB A;  1BOS A;  1LTS D;  2M9V A;  1VQ6 A;  4DV6 L;  1SRO A;  4KHV A;  4IUN A;  3K59 A;  2LXK A;  4ABN A;  1K8A C;  1L1O A;  2QCP X;  1N36 Q;  2EJF C;  2IX0 A;  3DLL A;  1NNX A;  1II3 A;  2N8N A;  2I5M X;  4DR4 Q;  3BS1 A;  1DZ1 A;  3H3V C;  2WP8 J;  5EQ0 A;  2OCE A;  5JEA G;  1VMP A;  2A5H A;  1SFO H;  2A6E D;  1YIT A;  4BY7 H;  1IBK Q;  1XXG A;  3HOX G;  1ZEQ X;  2KOL A;  4RKB A;  1W3S A;  4GN3 B;  4RG1 A;  4F8M A;  1A3V A;  1D5M C;  1IYU A;  2IPK D;  3HOZ G;  1VQC A;  5IYC H;  1EY8 A;  4DA2 A;  4A3G B;  4X66 Q;  4LF4 L;  3NEN A;  1C4Q A;  2CH4 W;  4LUO A;  3FEW X;  3KLW A;  3GTJ H;  4FXD A;  3T1H L;  1LM0 A;  4R4I A;  4PZ8 A;  1PTO F;  2LKV A;  2QDL A;  3I70 A;  2R92 B;  1VF5 C;  2F0W A;  3MHB A;  2BCO A;  4LF8 Q;  4LFB L;  3PO2 G;  1XPU A;  3I4M B;  4A3L G;  4LF5 L;  1Q8I A;  3GTP B;  2NVY H;  1LT3 D;  3PUW A;  3G4S A;  5IT9 L;  4POG A;  4LK1 C;  3MEF A;  4JC0 A;  5HGQ A;  3C3L A;  2B29 A;  2K4K A;  4H13 C;  1OXV A;  2ASB A;  3UE0 A;  1PA6 A;  1WTW A;  5C44 B;  2QIL A;  1UUP A;  1DM0 B;  4KN4 C;  2HQE A;  2SDF A;  2N55 A;  2PQA A;  2A68 D;  3VR6 A;  4A3F H;  1I50 H;  2G9D A;  1CKO A;  3SK5 A;  1EY6 A;  4NKL A;  4LFC Q;  4H02 A;  1HA5 A;  1STY A;  1JB3 A;  4DNT B;  1QNU A;  1B3A A;  3GTM B;  1WCM G;  3EBE A;  1PH9 A;  2YTX A;  5C4J H;  1K0R A;  1X3P A;  2XNA C;  1HZB A;  5EBD A;  2FFK B;  1EIH A;  4YWL A;  1YHQ A;  2MGS A;  2RDF A;  1AE3 A;  2QKI C;  1Y1V B;  1Q86 C;  1YBY A;  2XWJ B;  3QO2 A;  3OPO A;  2EYP A;  4JVZ A;  3GTG H;  4GKJ Q;  3J80 L;  2X69 A;  1B7Y B;  4QUF A;  5CMD A;  4LF7 L;  1GO3 E;  2L12 A;  2IY5 B;  3BVZ A;  3K7U C;  1Q12 A;  1B50 A;  2CW0 D;  1X3Q A;  1TWA H;  2Z6B A;  1LV9 A;  2BDO A;  2F1M A;  3BDC A;  2OXP A;  1EFW A;  2FMM A;  3SHL A;  2NN6 I;  2C9O A;  3DWQ A;  3PUV A;  1AE2 A;  1I6H B;  1XX8 A;  3EVQ A;  1PRT C;  4K5W A;  2PZU A;  3G71 A;  1LT5 D;  1EQT A;  1OO9 B;  2F3V A;  1RKN A;  5HGT A;  2YU9 H;  1YNN D;  3KF6 B;  4DV3 Q;  5JJI A;  4OXP A;  4XT3 B;  3H0G B;  1SJE D;  1TKW B;  4IZ8 A;  1TXY A;  2AQ2 B;  3GV6 A;  2UXC Q;  1EEI D;  1N36 L;  3HOW H;  4B3R Q;  4DV1 L;  5FLX c;  1VQP A;  2EZV A;  4L5S A;  3A74 A;  3DXJ C;  4C2M H;  3F2D A;  3A8I E;  3ERS X;  1YJN A;  3O13 A;  1WTQ A;  3KLR A;  2WKD A;  4G7H C;  5CV6 A;  1SFO B;  4X3U A;  4BY7 B;  4LWC A;  1YEZ A;  3GQB A;  1VQ4 A;  4RHS A;  4X3T A;  1EQR A;  4X66 L;  3TBI B;  1SNP A;  4IO9 A;  2PMZ B;  1RJT A;  1PFS A;  3HFZ B;  4CHT B;  2Z6K A;  3KBG A;  1VQH A;  2Y0S G;  1EOT A;  3MAQ A;  1CA5 A;  3J81 L;  2AHO B;  3A5U A;  3FPU B;  4R8N A;  4H44 C;  1MBY A;  2K52 A;  3GTJ B;  1HUM A;  5IGE A;  1ASY A;  2F0Q A;  2QGQ A;  4LF8 L;  3OIP A;  4X62 Q;  3HOV B;  1K9M C;  4HSP A;  4MTK A;  3PCO B;  1IHZ A;  1A2U A;  1DOK A;  4A3K G;  5JJZ A;  2R93 H;  2AMC B;  2EVB A;  1WTH A;  5DM7 3;  2CKZ B;  2IL8 A;  2Z4I A;  4IFD G;  1M4V A;  3HEJ A;  3WOF A;  4KTA A;  2IT1 A;  1K83 H;  2Z0S A;  4PZ6 A;  5M3M G;  3I55 A;  4DUZ L;  3OYY A;  2C5C A;  4V0B A;  2JQO A;  1JT8 A;  5J1Z A;  1QVG A;  4U68 A;  1OXT A;  2RCF A;  3AFP A;  3LGJ A;  2NZO A;  1RF2 D;  1P8L A;  5KYL A;  1WTX A;  5K5P A;  1ZYR C;  1OTC A;  1JOQ A;  2RA4 A;  4GN4 B;  2EYM A;  2JXM B;  5DEH A;  4C3H H;  1SSO A;  4HJA A;  3FKI H;  3TZD A;  2R6G A;  1JWU D;  3C1E A;  1ZKO A;  5COR A;  1IZ6 A;  1ESF A;  2MJ8 A;  3RN5 A;  1FNU A;  3RN2 A;  3GTL H;  4A3C G;  2DJG C;  2WB1 E;  1F2M A;  1CKN B;  1WOC A;  2B2U C;  3ERO A;  2AKW B;  3S17 H;  3T1Y L;  5M3F H;  1D1I A;  3W1G A;  1Y1W G;  2K01 A;  5C4J B;  1TQO A;  2WB1 G;  4K5V A;  1X3E A;  4KI0 A;  2K5H A;  1QG7 A;  2UXD Q;  1O7L A;  1JJC B;  2XVS A;  4YHH Q;  4B08 A;  3I4N H;  3FVQ A;  1E7Z A;  2ZXO A;  3IRB A;  2WIN B;  3GTG B;  2QF7 A;  4L63 B;  2XRS D;  3LNN A;  4LUV A;  4O2D A;  1CQV A;  5ELD A;  1D7Q A;  3P20 A;  1VQK A;  1GJX A;  3C46 A;  1TY0 A;  2ENB A;  5GAH C;  2I46 A;  4FYD A;  2UUC L;  1PFB A;  3PGZ A;  4KY7 A;  3U58 A;  1VQE A;  1FJG Q;  1TWA B;  1LTA D;  1OXS C;  4AYB G;  4CJ1 B;  1QZG A;  1I4G A;  2KEC A;  1E3P A;  2RF4 A;  2VUM G;  1M90 C;  2SOB A;  2YYZ A;  4JV5 L;  3J7A V;  5DM6 3;  1WTP A;  2YU9 B;  1STE A;  3MFY A;  4DUY L;  4OWT B;  4GNX B;  4CKB A;  1YIJ A;  3HP3 A;  2Q2H A;  1GVP A;  1EL0 A;  2F4V L;  3PMF A;  4A93 H;  3ER0 A;  1SN8 A;  4ALP A;  2ZXP A;  3V96 A;  2UU9 L;  3HOW B;  2R7F A;  4IN3 A;  5CV8 A;  3MVV A;  4A3D H;  2O5I C;  2BH8 A;  3TZU A;  1S5F D;  3GTO H;  1E2W A;  4TKO B;  2M2L A;  3HKZ E;  5FLM H;  1JWS D;  3D4W A;  3DWP A;  4LF9 L;  1WI5 A;  1KQS A;  4GNX C;  3I4O A;  4C3I B;  3HKZ G;  5CV5 A;  1C8C A;  4B3S L;  1TWC H;  3HOY B;  1CHQ D;  2VY3 A;  2F52 A;  2WAQ G;  1SYE A;  1WD1 A;  4I7Z C;  2UUB L;  5DLQ E;  4DK0 A;  4QB4 A;  1EWC A;  1YNJ C;  3DM3 A;  4OL7 A;  4R8I A;  4NDX A;  1N32 Q;  3AYH B;  3SXH A;  4QF4 A;  3QB3 A;  1MSH A;  1T5X D;  1H9R A;  3EA6 A;  4B9W A;  4GLA C;  3M7N A;  2QDB A;  2Q8T A;  5C3E H;  3PIP 3;  3A8J E;  2EY6 A;  3JC6 6;  2EXD A;  5G3L F;  2WV6 D;  2E2H H;  1K8G A;  3CF5 A;  1VDZ A;  5C4X G;  5AJ3 Q;  4HMJ A;  1J5E Q;  4JI1 Q;  5CYU A;  4LFA Q;  1NMF A;  4A3E G;  4JI0 Q;  5I2X A;  3GD7 A;  4A75 A;  4UDU C;  4DXF A;  1IBL Q;  4A3M G;  2R93 B;  4DR1 L;  3VYR A;  2I07 B;  3WWV A;  1K83 B;  3VYT A;  3KF6 A;  4B9X A;  4C3J H;  4JI7 Q;  4DN4 M;  5IYD G;  1XWE A;  2F0J A;  2HHH Q;  2ICI A;  4DNI A;  1XPO A;  5LMN L;  4HJ8 A;  2RDG A;  1PH2 A;  2BOS A;  5K36 G;  3RMH A;  1QE6 A;  3F2C A;  3J7Y W;  1PHJ A;  1TT2 A;  2SNM A;  3FKI B;  4DU9 A;  3NSW A;  1I94 L;  3TME A;  3S2D H;  3H6M A;  1D1K A;  2KA7 A;  3GTL B;  2ZM6 Q;  2EY1 A;  1X56 A;  3Q0A A;  4DV0 Q;  4IAL A;  2IWH A;  3S17 B;  3IL8 A;  5D65 A;  1YVC A;  5EBC A;  5M3F B;  3U4V A;  2PZW A;  3CD6 A;  3PIO A;  5GRO A;  1HNX Q;  2K33 A;  1HFN A;  1ENC A;  1GOZ A;  4K8J A;  4B3T L;  2G5D A;  4RAU C;  1HZA A;  1HNZ L;  1F2Y A;  1IXR A;  3NBI A;  2JYO A;  2OTL A;  1KL9 A;  2B2Y C;  4RH6 A;  4QIW E;  2JA7 H;  5IT9 E;  2DUD A;  2CWA A;  4G7Z C;  4OX9 L;  4QY7 A;  4PV1 C;  2K50 A;  4AH6 A;  1CM9 A;  3PO2 H;  1LLR D;  1BBX C;  4LF6 Q;  2HCC A;  2NN6 G;  3GTK B;  4DR6 Q;  2ZJQ A;  3S15 H;  3D8G A;  3DMU A;  1D5X C;  3ND9 A;  1STA A;  2JA8 B;  1LTI D;  4RGM A;  4K5X A;  4OEL B;  3SE0 A;  3X3N A;  4QCL A;  2D9U A;  3CQZ H;  4OGQ C;  3PO3 G;  1TR5 A;  3CU7 A;  2PPB C;  1AFP A;  3MTS A;  1FL0 A;  5EKI A;  4XQQ A;  4KKU A;  1GUN A;  3UDI A;  2B2U A;  4JI8 Q;  5M9O A;  4AQY L;  1D8L A;  2F0T A;  1BO0 A;  4X3S A;  4DAP A;  1GUO A;  1VQA A;  3ERQ A;  4A93 B;  4RCN A;  3NPP A;  4L8J A;  4LNQ A;  2D0O A;  3U9O A;  1G6Z A;  5FO8 B;  3CC2 A;  2E5L Q;  1GKH A;  4A3D B;  1KNE A;  3ZYY X;  1U0L A;  3H09 A;  1EY4 A;  1WCM H;  3S1R H;  1HZC A;  1HXY D;  4RMF A;  1WFQ A;  3TP5 A;  1KDC A;  2NZ1 D;  1C0A A;  1CKN A;  3ICE A;  3ULL A;  1A6X A;  1KLU D;  4LW1 A;  3D6C A;  1TWC B;  4LMQ D;  3D4D A;  2JJQ A;  1Z6H A;  4DAY B;  1N9W A;  1XPR A;  4JI4 L;  4PMW A;  1MKH A;  3VDY A;  3I4L A;  4DKA C;  1TU2 B;  4DXG A;  4P72 A;  2L0C A;  2AUJ D;  2X6G A;  3IAY A;  4YCW A;  2R7Z G;  3S24 A;  1Q82 C;  1HA6 A;  1FGB D;  1UEB A;  4ZKC B;  2MO1 A;  2JA5 B;  4BBS H;  5IE8 A;  3BVM A;  3PUZ A;  3CKI B;  1SE4 A;  5JOB A;  5C3E B;  1ICW A;  5AJ3 L;  1PMR A;  2R61 A;  3S1Q H;  1TWH B;  4JI1 L;  5KIX A;  4CGY B;  2ZTE A;  4JI0 L;  1IBL L;  4QQB X;  2LMC B;  3ITP A;  2MPM A;  3W1B A;  3NEM A;  5CBA E;  4NMZ A;  1NMG A;  1G2T A;  4QJF A;  1CZW A;  4CBV A;  3DEP A;  4CDF C;  1H9S B;  4X64 L;  3M4O H;  3EJI A;  1I6V C;  3BYT B;  1QVF A;  2RSN A;  2KBN A;  3R93 A;  4KKS A;  3RZD H;  4OWX B;  5BR8 Q;  4GNX A;  1CQF A;  1PRT D;  2JEB I;  4JI5 L;  2J4X A;  1GXD C;  1XMQ Q;  1RTN A;  2KEN A;  1S5D D;  4HIM A;  1HQM C;  2C35 B;  1BXT A;  1PV4 A;  1B44 D;  1VQN A;  2AQ1 B;  3PF5 A;  2H5X A;  2F0V A;  2QEJ C;  4QUC A;  4FF1 A;  4HCE A;  4I7A A;  1IBM L;  5CV9 A;  4DV0 L;  2B63 H;  4RKL A;  2OT2 A;  5CV4 A;  4HCS A;  1XNR Q;  3F1Z A;  2LSS A;  1LTB D;  2F3I A;  4EGV A;  4DV7 L;  4A3G G;  3TS2 A;  2K28 A;  1EZ8 A;  3F8T A;  1GM5 A;  3F2B A;  1EZ6 A;  3LX0 A;  1MD2 D;  3K80 C;  1WJJ A;  2R92 G;  2JA7 B;  3NTI A;  3I4M G;  5LHY 1;  3CC4 A;  5JJK A;  1YZ6 A;  2D2C C;  2CWP A;  3U50 C;  2KED A;  5M5X H;  2UXB Q;  3S1M B;  4R1J A;  5I6Y A;  3S15 B;  2F0K A;  1HNW Q;  1MIU A;  3MEH A;  3AEV A;  1Q1B A;  4DV5 L;  5M3M H;  1A15 A;  4OHJ A;  2KHI A;  1T5E A;  5A2Q L;  3S2H H;  4R9W A;  4JI8 L;  3I8Z A;  5C44 G;  1PH6 A;  1JMC A;  4BXX G;  5T1I A;  2YTV A;  2F0O A;  2ZJR A;  4RGN A;  3VA5 A;  3Q8D A;  2K5D A;  4G57 A;  2KUM A;  2XSC A;  3BG3 A;  4Z9C B;  2XN9 C;  4DFA A;  1JIC A;  2AWO A;  4UP7 A;  2NUC A;  1BUV T;  5GQO A;  1U4L A;  3QIA A;  4RGT A;  1VQ7 A;  1HQR D;  1B53 A;  3U9S A;  4BBR H;  4DGZ A;  1YJ9 A;  5EPK A;  4FVM A;  4PQX A;  2B2Y A;  1RD9 D;  1ZYR D;  3K57 A;  1Y1W H;  3K6O A;  4KN7 C;  4MZ9 A;  4TRD A;  2K1B A;  2E2I H;  1PRT B;  1K0S A;  1I4Q A;  1FR3 A;  2QW7 A;  3EIV A;  5IP7 G;  1Y1V G;  3KF8 B;  3V2T A;  2WAC A;  1QOH A;  5EPJ A;  1WTV A;  1TWG H;  1JCK B;  1BQQ T;  1S4Z A;  5IT9 c;  4ZAI A;  1S5E D;  4JYA Q;  2NB0 A;  5ELC A;  4RWS C;  4MHE A;  4JI2 Q;  4IUV A;  3SK6 A;  2F3W A;  2EJG C;  5J22 A;  3T13 A;  5EJW A;  1F77 A;  4JI6 L;  4XDX A;  1B8A A;  3MWY W;  3OWE B;  1CI3 M;  4BBS B;  1JC7 A;  3NTK A;  3A5Z B;  4X65 Q;  5EAY A;  1K8M A;  4EVO A;  2E74 C;  5D3I B;  3A7A B;  3D6W A;  3HKS A;  3VR3 A;  4GZY C;  2RDH A;  4YWM A;  4Q5V A;  3H0G G;  1F2Z A;  3HG9 A;  4NXN Q;  1Z7T A;  4DR4 L;  1L2F A;  2SEB D;  4DR7 Q;  1O7I A;  2F0U A;  2RHQ B;  2VZA A;  5F2D A;  1K3R A;  1IBK L;  1CK1 A;  2E2J H;  1S5B D;  1VQG A;  4R4O A;  2N88 A;  3NTH A;  2B8F A;  1XTC D;  1TS4 A;  5IP9 H;  1MSG A;  2F4I A;  1DCZ A;  4A4I A;  2SNS A;  2D62 A;  2NBF A;  2JN4 A;  2PMZ E;  1WTO A;  4BY7 G;  1H95 A;  4EQ5 A;  3T56 B;  2B63 B;  2EQS A;  3M7G A;  4DR2 Q;  3C1F A;  1HRJ A;  3I90 A;  2VS1 A;  4K0K Q;  3MXG A;  1GHJ A;  3MXN B;  5IYC G;  4I65 A;  4EQP A;  2HDM A;  3VR2 A;  2K75 A;  4DAY A;  5TSS A;  1O7Y A;  1SE2 A;  3CP0 A;  5IGF A;  4A3J H;  4KY5 A;  4R4Q A;  1R9T H;  4WFN 3;  5J39 A;  2A69 C;  5KEE A;  1ILQ A;  5C4Z A;  4JBW A;  4K14 A;  2I5H A;  3HZX A;  2HIV A;  2PNR C;  4DV2 Q;  4NXM Q;  1KLG D;  3HOV G;  4N9T A;  1YNJ D;  1EQV A;  2A6H C;  3L2P A;  2NVY B;  3H3V I;  5CR3 A;  1BBU A;  1KC8 C;  1SEB D;  3Q23 A;  1G8Z D;  4E6I A;  2BDN A;  1HNW L;  3KDF B;  5M5X B;  3J7A F;  2OQK A;  2PW7 A;  5ELO A;  4IUT A;  4A3M H;  2EY5 A;  1KAW A;  1C48 A;  4MTN A;  5HY6 A;  1S3O A;  1H9S A;  1G29 1;  1VQ9 A;  3KYH C;  4X3K A;  1UEA B;  4XXE A;  4LFC L;  1C9O A;  1RHP A;  1PLF A;  4ZKB B;  4C1N I;  4A3F B;  1I50 B;  5I9O A;  4L5R C;  2ATW A;  2VB2 X;  3HOU H;  4DPG A;  4ZYS A;  4CDC C;  2F03 A;  1L0X B;  1V8Q A;  1TS3 A;  4R4T A;  4HJ7 A;  1L0W A;  1B70 B;  3E9H A;  2EXZ A;  1A8V A;  1Q7Y C;  1STG A;  2F0I A;  1DJR D;  3FPP A;  1X3F A;  3TQY A;  3ULP A;  1GHK A;  2HDL A;  2GA4 B;  3URY A;  4BBR B;  1XMO Q;  3PIP A;  4N9P A;  1B9M A;  3QWN A;  4KKT A;  1TVX A;  2JSO A;  1VMC A;  2L5T A;  2AUK A;  1U4M A;  3P1H A;  4GKJ L;  1Y14 B;  1Y8O B;  3OMC A;  4OWW B;  4WJ4 A;  2NVX H;  2NYZ D;  1V9P A;  5ELE A;  1B2T A;  4ZLT F;  3M3Y H;  2E2I B;  1PTO H;  5ELB A;  4A3I H;  4H7B A;  1X9N A;  4C56 C;  1BNZ A;  4WJ3 M;  1TWG B;  2A73 B;  3SGI A;  3JAM L;  1NAP A;  5JVH 3;  4JBM A;  4XYO A;  1A3T A;  2B2W C;  4FXG C;  3BYY B;  1J9O A;  3M85 A;  4KY6 A;  3RR5 A;  1ET6 A;  1SNO A;  2PZT A;  4B3M Q;  4KHP Q;  2F0G A;  3P7J A;  3A55 A;  1CT1 D;  2J7Z A;  2NN6 H;  2Q8I B;  1HR0 Q;  4DV3 L;  1Q46 A;  3P75 A;  2JA6 H;  1G2S A;  2N3S A;  1E1O A;  1YI2 A;  1E24 A;  3DUZ A;  2UXC L;  2PI2 E;  4TQU S;  3AU7 A;  4B3R L;  2CHB D;  2V1C C;  1BR9 A;  2X6L A;  3CMA A;  3BJU A;  2ZT9 C;  3R2T A;  1EIY B;  1K8O A;  3CRK C;  5C0X I;  2OEO A;  1STH A;  2KHJ A;  1VQJ A;  3BDL A;  4BY1 H;  2F0M A;  1EY0 A;  1HUN A;  3HOW G;  1BCP B;  1YJW A;  1V1O A;  2MFI A;  1GUG A;  2GVA A;  4C2M B;  1JJ2 A;  4OO1 H;  2OF1 A;  4N8X 1;  2OTJ A;  2FXQ A;  1WTR A;  4JCV E;  2A1A A;  5JJL A;  1KD1 C;  4ZK9 B;  4ULL A;  1EY7 A;  4C3I G;  4GKK Q;  4WJW A;  2Q8R E;  2JA9 A;  4K0K L;  3HOY G;  1DOL A;  4EQN A;  1TS5 A;  3NBH B;  1PDQ A;  1L1O C;  4A3B H;  2F0E A;  1BCP C;  3K7A H;  5GAG C;  5I2Y A;  1J6Q A;  1STN A;  4XT1 B;  2B3G A;  3KF8 A;  4X62 L;  4K2K A;  2A19 A;  2VQF Q;  3I2Z A;  3LWU A;  1PZJ D;  1NY4 A;  3QJY A;  3FDT A;  4A3J B;  1KRS A;  1R9T B;  4LAA A;  4UPA A;  3T51 B;  4BWG B;  4L6T B;  3M9B A;  3RLO A;  4BS9 A;  1SND A;  2YTY A;  4JOI C;  3TDQ A;  1JB7 A;  2L9H A;  5C3X A;  3CCE A;  3K0Y A;  3Q24 A;  1EYG A;  1MI2 A;  3W5O A;  3H94 A;  5E4X A;  1MGS A;  3R2I A;  1I4H A;  2DNC A;  2RVL A;  3DWA A;  3NUC A;  2IHE A;  1QVC A;  4LUZ A;  2MO0 A;  3PV0 A;  4F88 A;  5JEA J;  3UDF A;  3CW2 C;  2R93 G;  5IYB G;  1ILP A;  1BBW A;  4OEM B;  3SDZ A;  3STB C;  2N49 A;  3QR8 A;  4JI3 Q;  5D14 A;  1PVO A;  4GLX A;  2LXJ A;  3I91 A;  3NP8 A;  5L37 A;  2JEA I;  5JPN C;  3DHQ A;  4P2C B;  1UE1 A;  5A35 A;  5JEA H;  1W6J A;  4EQO A;  4C3H B;  1DD2 A;  4P73 A;  1GUS A;  3MZ5 A;  3G6J B;  2HCI A;  3HOU B;  3HOX H;  3R3O A;  5IWA Q;  4IQZ A;  5IY0 A;  4L5T A;  3CPF A;  3FKI G;  1FNW A;  1W6K A;  3FMC A;  1NJI C;  1LUZ A;  1SYF A;  3CCQ A;  5I6W A;  3HOZ H;  4M8A A;  4N8F A;  2N78 A;  2UXD L;  4CDE C;  3K81 C;  4YHH L;  5HUR A;  4FF2 A;  2TMP A;  3BDO A;  2CFM A;  4HJ5 A;  3CCL A;  4IOA A;  2K32 A;  5M3F G;  2CCZ A;  1PH8 A;  2NWG A;  4WRD A;  3I4N B;  3DEO A;  2KJX A;  1T9H A;  3M3Y B;  3MXN A;  4BA1 I;  1PTO B;  3FP9 A;  4A3I B;  3A54 A;  2JE6 I;  3I3C A;  4LF4 Q;  3AFQ A;  1FJG L;  1JOK A;  4K8I A;  5EKL A;  4V19 0;  2O5J C;  2R92 H;  4A3L H;  2NTT A;  4DR5 Q;  4YWK A;  4Y7N H;  4FF3 A;  1CFM A;  2HUG A;  4CKC A;  2NZH A;  4TVA B;  1E2Z A;  4HIO A;  3PUX A;  1JE4 A;  3QG1 A;  5A2Q E;  1SXT A;  1VQD A;  3TRZ A;  1PTO C;  2RCN A;  2ID0 A;  1BDO A;  2JA6 B;  2K5N A;  1SE3 A;  2JA8 G;  3KDF A;  1QJO A;  1VCI A;  2TSS A;  1B1Z A;  1I4R A;  1HR0 W;  3OW2 A;  4ME3 A;  4PMC A;  3WDN A;  5IIF A;  4ZQ3 A;  4BXX H;  1A62 A;  4IPG A;  3PQI A;  4ID6 A;  3M4Q A;  3OMG A;  1X65 A;  1UAP A;  4DV4 Q;  1GUW A;  5DNF A;  4A93 G;  4HTH A;  2ZTC A;  3V05 A;  3FRP B;  3RLF A;  2HQL A;  3M4P A;  4IOC A;  3UI2 A;  4HJ9 A;  4BY1 B;  3GTO B;  2L15 A;  2MHV A;  1CSQ A;  3VA7 A;  4A3D G;  2VQE Q;  3BU2 A;  1TWF H;  5IOD A;  2PYK A;  1N8R C;  3J80 E;  2VXW A;  5AFW A;  5I4D A;  4J6H A;  5FLM G;  3E0E A;  2OWO A;  3F2U A;  3CC7 A;  3NHH A;  1O7Z A;  1QNK A;  1YHB A;  3L7Z C;  4AIM A;  3L9A X;  2MQH A;  1CTM A;  2O4X A;  4DF7 A;  1N32 L;  4UP8 A;  3AQQ A;  1LTL A;  4HR7 B;  3SK8 A;  1VQ5 A;  2IJ0 A;  1I5F A;  1AZP A;  1ASZ A;  4A3B B;  3K7A B;  1I4X A;  1WD0 A;  2EIF A;  3VYU A;  4HIK A;  4UAI A;  1QCB D;  1UWV A;  3IKJ A;  4CDD C;  4PZ7 A;  1B9N A;  3K0X A;  2JA5 G;  3R8B A;  1J5E L;  1CZG A;  2E2H B;  4LFA L;  1N34 Q;  2Q2T A;  4CKE A;  4P75 A;  2UUA Q;  5C6A A;  3TP7 A;  4LF7 Q;  5C3E G;  2B8G A;  2E76 C;  3CCM A;  1VQL A;  2KQ3 A;  2EOT A;  2IW3 A;  1E22 A;  2L55 A;  1QIL A;  2Z6K C;  4JI7 L;  1AZQ A;  1I6H H;  4H0L C;  1P16 A;  3I73 A;  4P74 A;  4UY8 C;  4IUQ A;  2HHH L;  4C3J B;  1RCV D;  2K14 A;  1Q1E A;  2PI2 A;  2PNH A;  3HS0 C;  5ISR A;  3OSO A;  1HHV A;  1QB5 D;  4ZRZ A;  1ONL A;  3RUZ A;  5IWA L;  3S1N H;  2RHS B;  4DV1 Q;  5I9P A;  3QOJ A;  2ZM6 L;  3KK7 A;  5CC4 A;  2EPB A;  1YNX A;  4K2L A;  1XYI A;  3K5O A;  4Q0F A;  3HOX B;  3KJO A;  3S2D B;  1HJP A;  4DK3 C;  3J81 E;  2F0L A;  4F87 A;  2F0F A;  2HT1 A;  1HNX L;  1ET9 A;  1DOM A;  4FXK C;  3HOZ B;  4M1U B;  1DYQ A;  3TEH B;  4GOP B;  2WKC A;  2K6A A;  2F0H A;  4JOI A;  4GN5 A;  5E1F A;  2QEX A;  3KOJ A;  3NBH A;  1KIX A;  1O78 A;  1HH2 P;  2D0P A;  1HPC A;  4DAV A;  2DGY A;  3BVG A;  4NB3 A;  4S3S A;  1PYB A;  4IFD J;  1H9J A;  4HAE A;  5JVG 3;  4LF6 L;  1D5Z C;  3ND8 A;  1PFN A;  1TY2 A;  4DR6 L;  5CV7 A;  1UE5 A;  3E0J A;  1SMY C;  4DR5 L;  1G51 A;  1VQ8 A;  1F9R A;  2FHT A;  1FNV A;  2KCT A;  2JA7 G;  3PO2 B;  1U9R A;  2A8V A;  4A3K H;  3HOV H;  4GOP C;  1B3Q A;  1EY9 A;  2EYO A;  4DNR B;  3D31 A;  3SR1 A;  4IFD H;  1LAC A;  2EYL A;  4Y7N B;  1I3Q H;  3H91 A;  3EQL C;  1JE5 A;  2A69 D;  5CBE E;  3GTQ H;  3W2D A;  1IW7 C;  2E8G A;  3CQZ B;  3G7L A;  2NVT H;  2A6H D;  3H15 A;  2KCN A;  5IOC A;  2ALY B;  1SAP A;  4YY3 Q;  1N33 Q;  2CVR A;  4DUZ Q;  5C0X G;  2E5L L;  4DV4 L;  1LTR D;  4O0A A;  1KHI A;  2CH4 A;  1GD7 A;  1KAA A;  2QA4 A;  5FJ8 G;  3NQT A;  1KRT A;  1G91 A;  1Y69 U;  4O1N A;  3E9I A;  4FP5 D;  4A3C H;  2VQE L;  3S14 H;  1KTK A;  1Z9F A;  2F0S A;  1BVS A;  1WCM B;  3S1R B;  4FF4 A;  5KRU A;  2ZTD A;  5KYI A;  5G3L D;  1TWF B;  3L3O C;  3CME A;  5FLX L;  1PYW D;  2PO4 A;  4XYQ A;  1I4P A;  3CCR A;  2J0T D;  1NCV A;  1RL2 A;  4XTC S;  2B2T C;  1SYG A;  1Y8N B;  1MJC A;  1IL8 A;  2V4D A;  1Q3L A;  3S16 H;  3D3R A;  5NUC A;  5LL6 S;  1X32 A;  2IX3 A;  3T1Y Q;  3JAM E;  1LT6 D;  1EYC A;  2EYH A;  1O80 A;  3K5L A;  3C2P A;  4O42 A;  4UHV A;  3UDX A;  1J8I A;  5C5L A;  1F2L A;  3NE5 B;  3GV3 A;  1N34 L;  3OW7 A;  4RGO S;  2UUA L;  2I0Q A; 
#chains in the Genus database with same CATH homology
 2BE5 C;  3S1Q B;  3NWT A;  2E75 C;  1LT4 D;  2DY7 A;  4J1M A;  1SJH D;  5C3W A;  3X3M A;  3K5M A;  4RHR A;  2FJ2 A;  3M4O B;  4RCO A;  3PUY A;  4U67 3;  2B2V C;  3KUP A;  2EY2 A;  3RZD B;  3VR4 A;  2A6E C;  3BZD B;  1HTP A;  1SNQ A;  4MIU A;  2R3Z A;  3T53 B;  2ZXR A;  2NTS A;  3TP6 A;  3SVM A;  3S1N B;  1JOO A;  3DM1 A;  4OO1 I;  1F9Q A;  1KNA A;  3MC0 B;  2IX1 A;  1EFI D;  5FKA C;  1TS2 A;  1HTL D;  5KNC A;  4XQJ A;  3W3A A;  5FO9 B;  2KCC A;  4G7O C;  4KK7 A;  1TII D;  2K03 A;  3NQI A;  2Y0S B;  4G4K A;  4IUR A;  3VR5 A;  1WVL A;  1RDP D;  3CRL C;  3HRZ C;  3TN2 A;  5E3F A;  4BA2 I;  2Z8L A;  1BCP D;  3KLS A;  2L11 A;  5D3D A;  2K5Q A;  3SK4 A;  2VB3 X;  4A3K B;  1EYA A;  5EKK A;  2A68 C;  3K5N A;  2BA0 A;  4OIK A;  1I3Q B;  1NR4 A;  5M3M B;  1AEX A;  4K6D A;  2XWB B;  1JR0 D;  3GTQ B;  1H9M A;  3IFD A;  3S2H B;  3MXP A;  2NVT B;  1SBB B;  2K05 A;  4YIJ A;  4K6L A;  1LTT D;  3ONA B;  5K36 H;  5BN4 A;  3NWS A;  1BF4 A;  4KHZ A;  2FMC A;  2H1E A;  1JQY D;  3S14 B;  1U4P A;  4MN3 A;  3E6Z X;  1Y1W B;  2AWN A;  2K7V A;  5E4W C;  2WB1 B;  3I72 A;  4F7X A;  3IFT A;  1B4O A;  1ROD A;  4KD3 A;  1PXU A;  2CW0 C;  1S5C D;  3AB9 A;  1PRT F;  2O2L D;  2PQE A;  2LS0 1;  2Z1C A;  1LO5 D;  3S16 B;  1HCZ A;  3NXW A;  3SEB A;  5KGU A;  3AMU A;  2A74 C;  4NP5 A;  2F0P A;  3KLS X;  4J8Q A;  3D4R A;  2F0N A;  1YNN C;  1KDB A;  5FO7 B;  3Q6S A;  3MA2 B;  1ENF A;  4AYB B;  1EEF D;  1NR2 A;  1VF7 A;  5M5W B;  5IGG A;  2Z4H A;  2VUM B;  2DY8 A;  1IKL A;  5COY A;  1V1P B;  1U4R A;  3MFG A;  3N6R A;  4HMI A;  1OXX K;  2EJM A;  2DN8 A;  1ML0 D;  1KAB A;  1Q90 A;  2K5W A;  1PTO D;  1EYD A;  2B2T A;  2E2J B;  2E2D C;  1AP0 A;  2WII B;  1OXU A;  1V43 A;  4QMG A;  4RFB A;  1NSN S;  3HGB A;  3A7L A;  1NUC A;  2B39 A;  3HKZ B;  5FK9 C;  4CJ0 B;  2WAQ B;  2RQX A;  5BN5 A;  1AN8 A;  4C1N K;  5LL6 X;  2EDG A;  1STB A;  3TSS A;  1M8A A;  2G9H D;  1PZI D;  1AW7 A;  2KHS A;  4KMU C;  1UNS A;  2RKS A;  5JPM C;  3RD4 A;  2DNE A;  4ILW A;  2B2V A;  2NVQ B;  3OIQ A;  4HED A;  1SYD A;  1ZXT A;  4PMB A;  4NW2 A;  3OHX C;  2CQA A;  2RSO A;  5C4X B;  2BA1 A;  3QOL A;  1QWY A;  4OIJ A;  5EPL A;  5IGC A;  4A3E B;  4A3M B;  3A56 A;  4KJN A;  1RTO A;  5T1G A;  1GUT A;  1KDA A;  3WOE A;  5EGT A;  3CHB D;  5KNB A;  2ICE C;  4RA8 A;  4XQN A;  2LFN A;  1D2B A;  1ESR A;  1DXM A;  1E2V A;  1DON A;  4ZUI A;  1F9S A;  1EWH A;  1EY5 A;  4C3H G;  3S9W A;  1EU3 A;  5C5M A;  5M5Y B;  2MP1 A;  3N52 A;  1A2T A;  2NVX B;  2KVM A;  3GP7 A;  1FD7 D;  4TSS A;  3GO5 A;  2XRQ D;  1D6E C;  1H9K A;  4DK1 A;  3K58 A;  3RZO B;  4FNF A;  4ZUJ A;  3EFX D;  4ODG A;  2M00 A;  3OOC A;  1IYV A;  1Y8P B;  2PW5 A;  4QIW B;  1SYB A;  5IGB A;  3OWF A;  2RBM A;  4KD4 A;  1JOR A;  5KND A;  4CJ2 C;  5C0X J;  1EIG A;  1SNM A;  3A8K E;  3TP8 A;  4IFD I;  1SMY D;  3PO3 B;  1EU4 A;  2FIN B;  4PNY A;  2LY7 A;  5C4H A;  2EYJ A;  5C0X H;  5CGK A;  4ME5 A;  3Q22 A;  1IW7 D;  1SNC A;  1F9P A;  5FLX E;  4HN7 A;  4KV6 A;  1BCP F;  2AQ3 B;  1FYC A;  1CHP D;  2XIW A;  4FO2 A;  4OO1 G;  3NK9 A;  2D5D A;  2B2W A;  4LJZ C;  2EYF A;  5IGD A;  1LTG D;  1Z47 A;  2K04 A;  2PCF B;  4JK1 C;  3MXU A;  5ELF A;  1CA6 A;  5DAU A;  5JAV A;  1R4Q B;  3T4A C;  4XIG S;  4WOR A;  1R4P B;  2L4N A;  2L1B A;  3KBX A;  2JP1 A;  2R7Z B;  1ENA A;  4KJO A;  2H4O A;  1IKM A;  3VYS A;  1SDF A;  4IUP A;  1SYC A;  2EE1 A;  1L0Y B;  5BN3 A;  2F0D A;  5FOB B;  1PFM A;  2MUY A;  2VNU D;  2KEE A;  3PIO 3;  4HSV A;  1PZK D;  3LWE A;  1E0B A;  3E5S A;  4IUU A;  1A3U A;  1JWM D;  3M4Y A;  1V1P A;  1HFG A;  4C3J G;  2BE5 D;  3T16 A;  1LAB A;  1BOS A;  1LTS D;  2M9V A;  4KHV A;  4IUN A;  3K59 A;  4ABN A;  2QCP X;  2EJF C;  2IX0 A;  1II3 A;  3BS1 A;  1DZ1 A;  3H3V C;  2WP8 J;  5EQ0 A;  5JEA G;  1VMP A;  2A5H A;  2A6E D;  1XXG A;  1ZEQ X;  2KOL A;  4RKB A;  4F8M A;  1A3V A;  1D5M C;  1IYU A;  2IPK D;  1EY8 A;  4DA2 A;  4A3G B;  1C4Q A;  3FEW X;  4FXD A;  1PTO F;  2LKV A;  3I70 A;  2R92 B;  1VF5 C;  2F0W A;  3MHB A;  2BCO A;  3I4M B;  1Q8I A;  3GTP B;  1LT3 D;  3PUW A;  5IT9 L;  4LK1 C;  3C3L A;  4H13 C;  1OXV A;  1WTW A;  5C44 B;  2QIL A;  1UUP A;  1DM0 B;  4KN4 C;  2HQE A;  2SDF A;  2N55 A;  2A68 D;  3VR6 A;  2G9D A;  3SK5 A;  1EY6 A;  4NKL A;  1HA5 A;  1STY A;  1JB3 A;  4DNT B;  1QNU A;  1B3A A;  3GTM B;  1X3P A;  2XNA C;  1EIH A;  5EBD A;  2FFK B;  2MGS A;  2RDF A;  2QKI C;  1Y1V B;  2XWJ B;  3QO2 A;  3OPO A;  2EYP A;  3J80 L;  2X69 A;  4QUF A;  5CMD A;  2L12 A;  3BVZ A;  1Q12 A;  1B50 A;  2CW0 D;  1X3Q A;  1LV9 A;  2BDO A;  2F1M A;  3BDC A;  2OXP A;  2FMM A;  3SHL A;  2NN6 I;  2C9O A;  3DWQ A;  3PUV A;  1I6H B;  1XX8 A;  3EVQ A;  1PRT C;  4K5W A;  2PZU A;  1LT5 D;  1EQT A;  1OO9 B;  2F3V A;  1RKN A;  5HGT A;  1YNN D;  4XT3 B;  3H0G B;  1SJE D;  1TKW B;  4IZ8 A;  2AQ2 B;  3GV6 A;  1EEI D;  2EZV A;  3DXJ C;  3A8I E;  3O13 A;  1WTQ A;  3KLR A;  2WKD A;  4G7H C;  5CV6 A;  1SFO B;  4X3U A;  4BY7 B;  3GQB A;  4RHS A;  4X3T A;  3TBI B;  1SNP A;  2PMZ B;  1RJT A;  4CHT B;  3KBG A;  1EOT A;  3MAQ A;  1CA5 A;  3J81 L;  3FPU B;  4R8N A;  4H44 C;  1MBY A;  3GTJ B;  1HUM A;  5IGE A;  2F0Q A;  3OIP A;  3HOV B;  4HSP A;  1IHZ A;  1A2U A;  1DOK A;  5JJZ A;  2EVB A;  5DM7 3;  2IL8 A;  2Z4I A;  4IFD G;  3WOF A;  1M4V A;  3HEJ A;  4KTA A;  2IT1 A;  2C5C A;  4V0B A;  5J1Z A;  4U68 A;  1OXT A;  1RF2 D;  5KYL A;  1WTX A;  5K5P A;  1ZYR C;  1JOQ A;  2RA4 A;  2EYM A;  2JXM B;  5DEH A;  1SSO A;  3TZD A;  2R6G A;  1JWU D;  3C1E A;  1ZKO A;  5COR A;  1ESF A;  2MJ8 A;  1FNU A;  1F2M A;  2B2U C;  3ERO A;  1D1I A;  2K01 A;  5C4J B;  1TQO A;  4K5V A;  4KI0 A;  1QG7 A;  1O7L A;  2XVS A;  4B08 A;  3FVQ A;  2ZXO A;  2WIN B;  3GTG B;  2QF7 A;  4L63 B;  2XRS D;  3LNN A;  1CQV A;  5ELD A;  3P20 A;  1GJX A;  3C46 A;  1TY0 A;  2ENB A;  2I46 A;  4FYD A;  1PFB A;  4KY7 A;  1TWA B;  1LTA D;  1OXS C;  4CJ1 B;  1I4G A;  2KEC A;  2SOB A;  2YYZ A;  3J7A V;  5DM6 3;  1WTP A;  2YU9 B;  1STE A;  3MFY A;  4CKB A;  3HP3 A;  1EL0 A;  3PMF A;  2ZXP A;  3V96 A;  3HOW B;  4IN3 A;  5CV8 A;  3MVV A;  2O5I C;  3TZU A;  1S5F D;  1E2W A;  4TKO B;  2M2L A;  1JWS D;  3D4W A;  3DWP A;  4C3I B;  5CV5 A;  1C8C A;  3HOY B;  1CHQ D;  1SYE A;  1WD1 A;  4I7Z C;  4DK0 A;  4QB4 A;  1EWC A;  1YNJ C;  4OL7 A;  4R8I A;  4NDX A;  3SXH A;  4QF4 A;  3QB3 A;  1MSH A;  1T5X D;  1H9R A;  3EA6 A;  4B9W A;  3M7N A;  2QDB A;  2Q8T A;  3PIP 3;  3A8J E;  2EY6 A;  5G3L F;  2WV6 D;  1VDZ A;  4HMJ A;  5CYU A;  5I2X A;  3GD7 A;  4UDU C;  4DXF A;  2R93 B;  3VYR A;  2I07 B;  1K83 B;  3VYT A;  4B9X A;  4DN4 M;  1XWE A;  2F0J A;  2ICI A;  2RDG A;  2BOS A;  5K36 G;  3RMH A;  1QE6 A;  3J7Y W;  1TT2 A;  2SNM A;  3FKI B;  4DU9 A;  3NSW A;  3TME A;  3H6M A;  1D1K A;  2KA7 A;  3GTL B;  2EY1 A;  3Q0A A;  4IAL A;  2IWH A;  3S17 B;  3IL8 A;  5D65 A;  5EBC A;  5M3F B;  2PZW A;  1HFN A;  2K33 A;  1ENC A;  1GOZ A;  4K8J A;  4RAU C;  1F2Y A;  3NBI A;  2JYO A;  2B2Y C;  4RH6 A;  5IT9 E;  4G7Z C;  4PV1 C;  1CM9 A;  1LLR D;  1BBX C;  2HCC A;  2NN6 G;  3GTK B;  3D8G A;  3DMU A;  1D5X C;  3ND9 A;  1STA A;  2JA8 B;  1LTI D;  4RGM A;  4K5X A;  3SE0 A;  3X3N A;  4QCL A;  2D9U A;  4OGQ C;  1TR5 A;  3CU7 A;  2PPB C;  1AFP A;  3MTS A;  5EKI A;  4XQQ A;  4KKU A;  1GUN A;  2B2U A;  5M9O A;  2F0T A;  1BO0 A;  4X3S A;  4DAP A;  1GUO A;  3ERQ A;  4A93 B;  4RCN A;  3NPP A;  4L8J A;  3U9O A;  1G6Z A;  5FO8 B;  4A3D B;  1KNE A;  3ZYY X;  3H09 A;  1EY4 A;  1HXY D;  3TP5 A;  1KDC A;  2NZ1 D;  1A6X A;  1KLU D;  3D6C A;  1TWC B;  4LMQ D;  3D4D A;  1Z6H A;  4PMW A;  3I4L A;  1TU2 B;  4DXG A;  2L0C A;  2AUJ D;  2X6G A;  3IAY A;  1HA6 A;  1FGB D;  4ZKC B;  2JA5 B;  3BVM A;  3PUZ A;  3CKI B;  1SE4 A;  5JOB A;  5C3E B;  1ICW A;  1PMR A;  2R61 A;  1TWH B;  5KIX A;  4CGY B;  2LMC B;  3ITP A;  2MPM A;  5CBA E;  4NMZ A;  1G2T A;  1CZW A;  4CBV A;  3DEP A;  1H9S B;  3EJI A;  1I6V C;  3BYT B;  2RSN A;  3R93 A;  4KKS A;  1CQF A;  1PRT D;  2JEB I;  2J4X A;  1GXD C;  1RTN A;  1S5D D;  1HQM C;  1BXT A;  1B44 D;  2AQ1 B;  2F0V A;  2QEJ C;  4QUC A;  4FF1 A;  4HCE A;  5CV9 A;  4RKL A;  2OT2 A;  5CV4 A;  4HCS A;  1LTB D;  4EGV A;  2K28 A;  1EZ8 A;  1EZ6 A;  3LX0 A;  1MD2 D;  2JA7 B;  3NTI A;  5LHY 1;  2D2C C;  2KED A;  3S1M B;  5I6Y A;  3S15 B;  2F0K A;  3MEH A;  1Q1B A;  1A15 A;  4OHJ A;  1T5E A;  5A2Q L;  4R9W A;  3I8Z A;  5T1I A;  2F0O A;  4RGN A;  3VA5 A;  2K5D A;  4G57 A;  2KUM A;  2XSC A;  3BG3 A;  4Z9C B;  2XN9 C;  4DFA A;  1JIC A;  2AWO A;  2NUC A;  1BUV T;  1U4L A;  3QIA A;  4RGT A;  1HQR D;  1B53 A;  3U9S A;  4DGZ A;  5EPK A;  4FVM A;  4PQX A;  2B2Y A;  1RD9 D;  1ZYR D;  3K57 A;  3K6O A;  4KN7 C;  4TRD A;  2K1B A;  1PRT B;  1I4Q A;  1FR3 A;  3V2T A;  2WAC A;  1QOH A;  5EPJ A;  1WTV A;  1JCK B;  1BQQ T;  1S4Z A;  4ZAI A;  1S5E D;  2NB0 A;  5ELC A;  4RWS C;  4MHE A;  4IUV A;  3SK6 A;  2F3W A;  2EJG C;  5J22 A;  3T13 A;  5EJW A;  1F77 A;  4XDX A;  3MWY W;  3OWE B;  1CI3 M;  4BBS B;  1JC7 A;  3NTK A;  1K8M A;  4EVO A;  2E74 C;  5D3I B;  3A7A B;  3D6W A;  3VR3 A;  4GZY C;  2RDH A;  4Q5V A;  1F2Z A;  3HG9 A;  1Z7T A;  2SEB D;  2F0U A;  5F2D A;  1CK1 A;  1S5B D;  2N88 A;  3NTH A;  2B8F A;  1XTC D;  1TS4 A;  1MSG A;  2F4I A;  1DCZ A;  2SNS A;  2D62 A;  2NBF A;  1WTO A;  3T56 B;  2B63 B;  3M7G A;  3C1F A;  1HRJ A;  3I90 A;  3MXG A;  1GHJ A;  4I65 A;  4EQP A;  2HDM A;  3VR2 A;  4DAY A;  5TSS A;  1O7Y A;  1SE2 A;  5IGF A;  4KY5 A;  4WFN 3;  5J39 A;  2A69 C;  5KEE A;  1ILQ A;  5C4Z A;  4JBW A;  4K14 A;  3HZX A;  2PNR C;  1KLG D;  4N9T A;  1YNJ D;  1EQV A;  2A6H C;  2NVY B;  5CR3 A;  1SEB D;  3Q23 A;  1G8Z D;  4E6I A;  2BDN A;  5M5X B;  3J7A F;  2PW7 A;  4IUT A;  2EY5 A;  1C48 A;  1H9S A;  1G29 1;  4X3K A;  1UEA B;  4XXE A;  1RHP A;  1PLF A;  4ZKB B;  4C1N I;  4A3F B;  1I50 B;  5I9O A;  2VB2 X;  4ZYS A;  2F03 A;  1L0X B;  1V8Q A;  1TS3 A;  2EXZ A;  1STG A;  2F0I A;  1DJR D;  3FPP A;  1GHK A;  2HDL A;  2GA4 B;  3URY A;  4BBR B;  4N9P A;  1B9M A;  3QWN A;  4KKT A;  1TVX A;  2JSO A;  1VMC A;  2L5T A;  2AUK A;  1U4M A;  3P1H A;  1Y8O B;  3OMC A;  2NYZ D;  5ELE A;  1B2T A;  4ZLT F;  2E2I B;  1PTO H;  5ELB A;  4H7B A;  4C56 C;  1BNZ A;  1TWG B;  2A73 B;  3JAM L;  1NAP A;  5JVH 3;  4XYO A;  1A3T A;  2B2W C;  4FXG C;  3BYY B;  1J9O A;  3M85 A;  4KY6 A;  1ET6 A;  1SNO A;  2PZT A;  2F0G A;  3P7J A;  3A55 A;  1CT1 D;  2J7Z A;  2NN6 H;  2Q8I B;  3P75 A;  1G2S A;  3DUZ A;  4TQU S;  3AU7 A;  2CHB D;  1BR9 A;  2X6L A;  3R2T A;  2ZT9 C;  1K8O A;  3CRK C;  5C0X I;  2OEO A;  1STH A;  3BDL A;  2F0M A;  1EY0 A;  1HUN A;  1BCP B;  1V1O A;  1GUG A;  4C2M B;  4OO1 H;  2OF1 A;  1WTR A;  4ZK9 B;  4ULL A;  1EY7 A;  4C3I G;  4WJW A;  2Q8R E;  1DOL A;  4EQN A;  1TS5 A;  1PDQ A;  2F0E A;  1BCP C;  5I2Y A;  1STN A;  4XT1 B;  3KF8 A;  4K2K A;  3LWU A;  1PZJ D;  3QJY A;  3FDT A;  4A3J B;  1R9T B;  4LAA A;  3T51 B;  4BWG B;  4L6T B;  4BS9 A;  1SND A;  3TDQ A;  2L9H A;  5C3X A;  3K0Y A;  3Q24 A;  1MI2 A;  3H94 A;  5E4X A;  1MGS A;  3R2I A;  1I4H A;  2DNC A;  2RVL A;  3DWA A;  3NUC A;  3PV0 A;  4F88 A;  5JEA J;  1ILP A;  3SDZ A;  5D14 A;  3I91 A;  3NP8 A;  2JEA I;  5JPN C;  3DHQ A;  4P2C B;  5A35 A;  5JEA H;  1W6J A;  4EQO A;  4C3H B;  1DD2 A;  1GUS A;  3MZ5 A;  3G6J B;  2HCI A;  3HOU B;  3R3O A;  4IQZ A;  1FNW A;  1W6K A;  3FMC A;  1SYF A;  5I6W A;  4M8A A;  5HUR A;  4FF2 A;  2TMP A;  3BDO A;  2K32 A;  2NWG A;  4WRD A;  3I4N B;  3DEO A;  2KJX A;  3M3Y B;  3MXN A;  4BA1 I;  1PTO B;  4A3I B;  3A54 A;  2JE6 I;  3I3C A;  1JOK A;  4K8I A;  5EKL A;  4V19 0;  2O5J C;  2NTT A;  4FF3 A;  1CFM A;  2HUG A;  4CKC A;  1E2Z A;  3PUX A;  1JE4 A;  3QG1 A;  5A2Q E;  1SXT A;  1PTO C;  2ID0 A;  1BDO A;  2JA6 B;  1SE3 A;  1QJO A;  1VCI A;  2TSS A;  1B1Z A;  1I4R A;  4PMC A;  3WDN A;  5IIF A;  4ZQ3 A;  4ID6 A;  3OMG A;  1UAP A;  1GUW A;  5DNF A;  4HTH A;  3V05 A;  3FRP B;  3RLF A;  3UI2 A;  4BY1 B;  3GTO B;  2MHV A;  3VA7 A;  5IOD A;  2PYK A;  3J80 E;  2VXW A;  5AFW A;  5I4D A;  4J6H A;  3F2U A;  3NHH A;  1O7Z A;  1QNK A;  3L7Z C;  3L9A X;  1CTM A;  2O4X A;  4DF7 A;  4HR7 B;  3SK8 A;  2IJ0 A;  1AZP A;  4A3B B;  3K7A B;  1I4X A;  1WD0 A;  3VYU A;  4UAI A;  1QCB D;  3IKJ A;  1B9N A;  3R8B A;  1CZG A;  2E2H B;  4CKE A;  5C6A A;  3TP7 A;  2B8G A;  2E76 C;  2EOT A;  2KQ3 A;  2IW3 A;  2L55 A;  1QIL A;  1AZQ A;  4H0L C;  3I73 A;  4IUQ A;  4C3J B;  1RCV D;  1Q1E A;  3HS0 C;  5ISR A;  3OSO A;  1HHV A;  1QB5 D;  4ZRZ A;  1ONL A;  3RUZ A;  5I9P A;  3QOJ A;  3KK7 A;  5CC4 A;  2EPB A;  4K2L A;  1XYI A;  3K5O A;  4Q0F A;  3HOX B;  3S2D B;  3J81 E;  2F0L A;  4F87 A;  2F0F A;  1ET9 A;  1DOM A;  4FXK C;  3HOZ B;  4M1U B;  1DYQ A;  2WKC A;  2K6A A;  2F0H A;  5E1F A;  3NBH A;  1O78 A;  1HPC A;  4DAV A;  4S3S A;  3BVG A;  4IFD J;  1H9J A;  4HAE A;  5JVG 3;  1D5Z C;  3ND8 A;  1PFN A;  1TY2 A;  5CV7 A;  3E0J A;  1SMY C;  1F9R A;  2FHT A;  1FNV A;  3PO2 B;  1U9R A;  1EY9 A;  2EYO A;  4DNR B;  3D31 A;  3SR1 A;  4IFD H;  1LAC A;  2EYL A;  4Y7N B;  3H91 A;  3EQL C;  2A69 D;  5CBE E;  3W2D A;  1IW7 C;  3CQZ B;  3G7L A;  2A6H D;  2KCN A;  5IOC A;  1SAP A;  2CVR A;  5C0X G;  1LTR D;  1KAA A;  3NQT A;  1G91 A;  1Y69 U;  4O1N A;  4FP5 D;  1KTK A;  2F0S A;  1WCM B;  3S1R B;  4FF4 A;  5KRU A;  5KYI A;  5G3L D;  1TWF B;  3L3O C;  5FLX L;  1PYW D;  2PO4 A;  4XYQ A;  1I4P A;  2J0T D;  1NCV A;  4XTC S;  2B2T C;  1SYG A;  1Y8N B;  1IL8 A;  2V4D A;  1Q3L A;  3D3R A;  5NUC A;  5LL6 S;  1X32 A;  2IX3 A;  3JAM E;  1LT6 D;  1EYC A;  2EYH A;  1O80 A;  3K5L A;  3C2P A;  4O42 A;  1J8I A;  5C5L A;  1F2L A;  3NE5 B;  3GV3 A;  3OW7 A;  4RGO S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...