4P2CB

Complex of shiga toxin 2e with a neutralizing single-domain antibody
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
ADCAKGKIEFSKYNEDNTFTVKVSGREYWTNRWNLQPLLQSAQLTGMTVTIISNTCSSGSGFAQVKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Molecular Mechanism of Shiga Toxin Stx2e Neutralization by a Single-domain Antibody Targeting the Cell Receptor-binding Domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords Shiga toxin 2e, subunit A
total genus 20
structure length 68
sequence length 68
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2014-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4p2cB00
1D1KA 1R4QB 2BOSA 4P2CB 1CZGA 1QOHA 1R4PB 1D1IA 2C5CA 1C48A 1QNUA 1CQFA 2GA4B 1C4QA 1DM0B 2XSCA 4M1UB 1BOSA 4ULLA 1CZWA 3MXGA
chains in the Genus database with same CATH superfamily
2IWHA 3S15H 1DCZA 1KTKA 1KHIA 1STBA 2HIVA 1LV9A 2R7ZG 5CBEE 4UPAA 3K6OA 1RTNA 1KDBA 2B2YA 2C35B 2N3SA 4ZUIA 1HNXQ 2EYHA 5IGCA 4GKJL 1EU3A 3E6ZX 2WAQG 5BN3A 4U68A 1I4QA 1IBLQ 2K14A 4FF4A 2RSNA 2Y0SG 5IYCH 4GNXC 1Z6HA 1ZYRD 3CCVA 1XPUA 3K7AH 1J6QA 4ZCKA 1Q7YC 3F1ZA 2IL8A 2NVTH 2F0LA 4J8QA 3K5NA 4YCVA 3T53B 2QDBA 2NVXB 4R4CA 4A3FH 4B3SQ 2R7ZH 4A3DB 1KABA 2AWNA 2ENBA 4K2LA 1LT6D 2TMPA 2HHHL 2B8FA 4FF2A 2NTTA 2AUKA 3I4LA 2I5MX 4IURA 4GOPC 3QWNA 3GTMB 2R93B 2N49A 2AHOB 1OO9B 3IAYA 2PW5A 2RSOA 2F0JA 4ZRZA 1YZ6A 1KLUD 3U4ZA 2RVLA 1IBKL 1JICA 4JK1C 5DEHA 3I8ZA 1FGBD 1H9RA 1SYGA 1MHWC 3K58A 2C5CA 4R1JA 1I4RA 4K8JA 3GTQB 1QG7A 1EY8A 2RDGA 2B2TA 2EY6A 4DXFA 5JOBA 1IBML 4DPGA 2EY1A 4RGOS 3HG9A 2VQEQ 2JA5B 4X3TA 4Z9CB 1EU4A 1U4LA 1I50B 3QOJA 3MEHA 1RF2D 3H6MA 4DR3L 1YHQA 5IGDA 4IALA 1U0LA 1L0XB 4A3MH 1NJIC 3NQIA 1VMCA 2EYLA 2QW7A 2CKZB 2NVYB 4R9WA 3TDQA 3VA7A 1QZHA 1TWFB 3MTSA 2VQEL 3I73A 1AZPA 4QL5A 2HCIA 1G91A 1K9MC 4PG3A 5I2YA 3C3LA 2J0TD 3J80c 5FKAC 1MSHA 4P2CB 1WTXA 1IBLL 3QO2A 1N8RC 1HZ9A 1WCMH 1PTOB 1TWAH 2E5LQ 5HURA 4IOAA 2RHSB 3G7LA 2NVYH 3HRZC 3Q22A 1SNMA 2L4NA 2UUAL 1TY0A 3HOWB 4PV1C 1BCPC 2XWJB 3H09A 2WACA 3KDFB 1SROA 4MNOA 1SJHD 5FLMG 1C7YA 2HT1A 2NZOA 3KOJA 4O1NA 2MNAA 2F0GA 3KUPA 5E3FA 4BY7H 4A76A 4A3GG 1WTHA 2KJXA 1KNAA 1TR5A 1EYCA 2YV5A 4FF1A 4OO1H 4MN3A 3A55A 4A3LG 4MTNA 2A6EC 1SDFA 1CSQA 1S5FD 2QEXA 1LM0A 1WTWA 1D5XC 2M9VA 1F2YA 1N34L 1SSOA 4UP7A 1LLRD 1KD1C 2Z4IA 1STEA 5JJKA 4IOCA 3I70A 3DXJC 3S2HH 1WTRA 1CK1A 1X56A 1EOTA 3W1BA 5KYIA 1GVPA 2Q2IA 2SOBA 2ZXRA 3A7LA 1PZJD 5IY0A 2GA4B 1PYBA 2Z6KC 2F0WA 2PI2E 4GN3B 1YJNA 1UE5A 1I94Q 4BS9A 2D62A 2KOLA 4JYAL 4KTAA 1UE1A 4FP5D 4GNXA 2F0OA 1KRSA 4LF4Q 2F0IA 2ID0A 3K57A 2VS1A 3J81E 3PO2B 5LMNL 2A69C 5CV8A 4YHHQ 1HZBA 3OMGA 3M4QA 4A3KB 3F8TA 1GUSA 5KEEA 2RDFA 1D8LA 3PUYA 4FF3A 1NAPA 3UDIA 4KY6A 1EQVA 3J80L 4EQPA 1Q86C 2XWBB 5IOCA 4GOPA 3HKZB 4DK0A 2CH4A 1E7ZA 2PW7A 4RCNA 1N32L 1H9JA 1JCKB 1EY7A 3PO3H 1YNNC 4ZK9B 3GTPH 2R6GA 2K6AA 4C3HG 2MJ8A 3K7UC 4A3JG 1WTOA 1QB5D 4OIKA 2AMCB 4L6TB 4JYAQ 1GUTA 4QMGA 4DKAC 1TS2A 5AJ3L 1U9RA 4GLXA 4AYBG 1WD0A 4KHPQ 5A35A 1AZQA 4DR1L 1G2TA 3VR5A 2HDMA 2I5HA 1V8QA 4IQZA 4RH6A 3AMUA 1Y1VH 5KYLA 1XMOQ 2OTJA 5IT9E 3CHBD 3JAME 1KXLA 4QQBX 1D6EC 4DF7A 2F4IA 1VQ4A 4LF6L 3AFPA 5FOBB 4BWGB 3H0GG 3CP0A 1MJEA 4RHRA 1ENFA 5FJ8G 5FJ8H 3CF5A 2IY5B 1LTRD 1TWFH 1PFMA 4OGQC 4JI0L 1EIYB 1LUZA 1AW7A 2EXZA 1EIHA 4DR5L 2WB1E 5IGEA 3I4OA 1S5BD 1SE4A 2H4OA 4X66L 5IIFA 3I4NG 4A3DH 1XMQQ 5JJLA 1VF7A 1X32A 3G6JB 1TWGH 2KHIA 5FK9C 1TIID 1PH5A 5M5WH 2OCEA 4DNIA 2BDOA 3RD4A 1DZ1A 1DYQA 4PMWA 3MXGA 3PO2H 4IPCA 3IL8A 3T13A 2B2WC 4J1MA 1AE2A 1UEAB 1TVXA 2CWAA 3I4MH 3R2TA 1RL2A 4IPHA 2A6HD 3KLRA 4R4QA 2WB1G 1JWMD 3W1GA 4BBRB 2KCNA 1W3SA 2JA6H 1G51A 2IT1A 1YJWA 5FO9B 2EDGA 3SXHA 2ZJPA 5DAUA 3JAML 3RMHA 2JA5H 4IZ8A 3RZDH 3S1RH 2EE1A 3J81c 1Q8KA 1OXSC 4CJ0B 1S3OA 5ISRA 2BE5C 4FDBA 2CCZA 1XX8A 2G9DA 3GD7A 3EFXD 3O13A 3MC0B 1A15A 5EPJA 4JOIC 2BE5D 3IRBA 3M9BA 4LF7L 1QCBD 1R4PB 1C0AA 3K7AB 1JORA 4PMBA 1B9MA 1I6HB 1B4OA 4DR6L 2Z6KA 1IYVA 2IX0A 3CCRA 5A2QE 4GS3A 2QEJC 4V190 1EEFD 4A3KG 1SN8A 2EYJA 3NEMA 3W3AA 3ER0A 5BN4A 5C3EH 3H0GH 5IGGA 1WCMB 4HMIA 1W6KA 2LMCB 1LTAD 3E3XA 1YVCA 4GKKQ 2HHHQ 2NZHA 1DXMA 1HQMC 3GTLH 4E6IA 1GJXA 1VQIA 3KYHC 1E2VA 3I55A 4KMUC 1BNZA 3AEVA 3H3VH 2UXDQ 1HNZL 1GKHA 4JW0A 3CMAA 3BDCA 1VQKA 1HQRD 2D5DA 1HTPA 2PNRC 2XVSA 5EKIA 3AQQA 1JOOA 4JI1Q 5HGTA 2B39A 2K5QA 2B63B 4A3GH 1PLFA 1YNXA 1YNND 4DK6C 1HNZQ 2OXPA 3C2PA 3TBIB 1V1PB 4IUUA 2N88A 3FDTA 4FVMA 5M3FG 1FYCA 4LFBQ 1A3VA 2FHTA 4C3IG 2R92H 2OEOA 3ERSX 2L0CA 2R7DA 5M9OA 2F0SA 2KVMA 1V43A 5EKKA 1IHZA 3STBC 4TVAB 4C1NK 5IYDH 1KRTA 3MA2B 4F87A 3FEWX 3AB9A 3D31A 3DLLA 1SFOH 2YU9B 1AEXA 4NXML 2XTIA 4DAYA 1JB3A 4Q5VA 3N6RA 1IBMQ 3HOZG 3TS2A 1IW7D 1JJGA 1VQ8A 4CBVA 3CC4A 4X62Q 2EY5A 4PZ7A 3RN2A 5JJIA 3P1HA 1VCIA 4C3IH 4DR4L 2JQOA 3EIVA 3P7JA 1GXDC 4K5XA 5CV4A 1GM5A 4GOPB 3NBIA 4DK3C 3LX0A 4KKSA 5ELEA 1L2FA 1W2BA 4KK7A 2K03A 4CDEC 1BUVT 3CCMA 3WOFA 2K50A 1SYDA 4I65A 4DUYL 1QVFA 3GDEA 2OTLA 3W5OA 2JA8H 5C4XG 3L3OC 1WI5A 3U4VA 1IYUA 5IGBA 1HHVA 1SNDA 2O2LD 4BA2I 1MD2D 1EUJA 5D3DA 4JI1L 1Q3LA 5IP7G 3M4OB 1UEBA 1M90C 4GN5A 4FXDA 3PV0A 5M3MG 3S9WA 5LMUL 4Y7NH 4A3CG 3HOYB 2E2DC 5C4JH 4AQYL 2A6HC 5DLQE 1HNXL 4RKBA 1E24A 2OQ0A 4A3FB 2BCOA 3X3NA 4B3RL 1I4GA 2VUMH 1ENCA 1PFBA 2E2HB 1BCPB 5D65A 4KKTA 5F2DA 4DV7L 3U9OA 1J5EQ 3AYHB 1I4HA 1B7YB 2KCTA 1SE8A 1Z9FA 4CDCC 1X3GA 1XJVA 3MZ5A 3U9SA 3R93A 2EYFA 5LHY1 3C46A 1VQJA 3NBHA 1A0IA 3FVQA 4HIKA 1MBYA 4JI6L 3BZCA 4KJNA 5IYDG 2UXBL 1BCPF 1G6PA 1JE5A 4K2KA 2E2IB 4UHVA 3FKIG 1IL2A 2J7ZA 1S72A 1K3RA 5FLXc 2HQLA 2RQXA 1U5KA 5M3FH 2NZ1D 4JI5L 2EOTA 4MTKA 1D1IA 2O5JC 4FXGC 1YITA 3S1QH 1PTOF 1KDAA 2PNHA 3S1MB 3Q0AA 3KF8A 1BXTA 3I4MG 4CDFC 3HOYG 3BG3A 4X65L 3VDYA 2R7ZB 1B3AA 2R61A 5M5XB 2L15A 1N36L 1UE6A 4NW2A 4IPDA 2PI2A 2LFNA 3VYTA 2R93G 2I5LX 3H3VI 1QVGA 5JEAJ 1EY4A 2ZXOA 4KHZA 1IKMA 1DD2A 4LFCQ 2V1CC 2KBNA 2O5IC 2B2VA 3GTOB 1QUQA 3T1YQ 3PF5A 5CV6A 4LAAA 3WOEA 3I4NH 4A3DG 2M00A 4EQ5A 1TQOA 1T5EA 5ELBA 4KN7C 2Y0SE 3ULPA 1WTVA 2F1MA 1PZID 2Z0SA 3JAMi 3J81j 4P74A 4DAYB 5M3MH 2K5DA 1XPRA 2E74C 3OW2A 2SNSA 4MZ9A 5KNBA 1ZKOA 3AFQA 3E5SA 4F7XA 1I3QB 5EPKA 2C9OA 3UDFA 4TQUS 1UWVA 2UUAQ 4RWSC 4QUFA 2EJMA 1GUWA 1QNUA 3HOUG 4IFDH 5GADC 1V1PA 2MO0A 1XWEA 2MHVA 4LK1C 2XSCA 3HKZE 1EYAA 2A74C 4JI8Q 4L8JA 4B9XA 4P71A 1JJCB 4HMJA 1BF4A 2F03A 2BH2A 1X3PA 4DXGA 3OWFA 2JA7G 2DY7A 1I3QH 1K8OA 2UUBL 3S2HB 1TWHB 2VQFQ 1ILQA 1EWCA 4APVA 3BS1A 2CQOA 3FP9A 3RUZA 3CC7A 1B53A 1V1OA 1PYWD 4R8NA 1B44D 1Y69U 3A56A 1PFNA 1JB7A 4C3HH 2BDNA 4LUOA 4JI8L 1LT4D 4QF4A 3L0OA 3TZUA 1DJRD 1RTOA 4LF6Q 4AQYQ 3ND9A 4K0KL 2SEBD 2F0NA 4KN4C 2JEBI 1EL0A 1EIFA 4DAMA 2UUBQ 1MKHA 4H0LC 1P16A 1AE3A 3ULJA 1STGA 1VQNA 1TU2B 1CTMA 4C3JG 1N32Q 5CMDA 3S15B 3EA6A 4QUCA 2DUDA 4HR7B 1I4XA 1NCVA 2SDFA 3S1MH 4LF9L 1I94L 1SNQA 4HTHA 4C2MB 5C0XH 1WOCA 4C3HB 3NQTA 4K8IA 4TKOB 3J80E 3H91A 5CV5A 4KY7A 4RAUC 5D14A 3C1FA 2JEAI 5H1SE 2HQEA 5J3BA 4LF8L 5FLXE 4XYOA 5CYUA 4IUTA 4DR7L 4C56C 1WFQA 2RDHA 4BA1I 4LUVA 5C3EB 3EBEA 5I9PA 1UAPA 4A3BB 1II3A 4DUZQ 1K8GA 4O42A 3GP7A 5LL6X 3VYUA 2FINB 3H94A 2FFKB 2L55A 1I5FA 3K5OA 1C4QA 4RA8A 2EIFA 3J80i 1YHAA 2H5XA 4XQQA 4DV2Q 4KHVA 3OOCA 1K0SA 1QZGA 4YCUA 4A3BG 1D1KA 3HGBA 4DR2Q 3I90A 1BKBA 4CJ2C 2QCPX 3OHXC 4BBRH 1SE3A 3MXNA 3S17B 3OSOA 3J7AV 3MFGA 2JA7H 3WWVA 3ND8A 5C5LA 5C5MA 3FKIH 1O7IA 1JQYD 5GAEC 3D6CA 2DJFC 2X69A 4DV0L 2KCMA 2WAQB 1S5DD 4IO9A 4WORA 3A8KE 5DNFA 2B2UA 4I7AA 3TEHB 1SR3A 3CRLC 2CFMA 3P20A 4ME5A 5FLMH 3K80C 1SYEA 1BBXC 4JI5Q 1GHKA 3MFYA 4ID6A 2XRQD 4BBSG 5T1IA 5T1GA 1N9WA 1IYJB 1R9TH 3PQIA 4CHTB 4R8IA 3U58A 4RGTA 3MAQA 3RN5A 1ASYA 1TWGB 1KDCA 2VY3A 1LTSD 2VB3X 2QA4A 1PH2A 2VUMG 1LT3D 2GVAA 3UI2A 4O0AA 4HJ5A 2CW0D 2R7FA 2A1AA 4QB4A 1B9NA 3J81L 4RHSA 1JC7A 1YNJC 1PRTC 2I07B 3PUWA 4XIGS 2VNUD 4B3ML 4DV4Q 4ABNA 3KBXA 4KJOA 2D9UA 2CWPA 4DV3L 5C44H 1KAAA 4PQXA 4DAPA 1RHPA 2GVBA 2KEDA 4GKJQ 3RZOB 3MXUA 4PMCA 1PHJA 1DGSA 4PZ6A 1GUOA 2ICEC 3S1NB 3HOWH 2JYOA 2A69D 5ELNA 4XT3B 3LGJA 3CAMA 2NVQB 1OTCA 2FXQA 5TSSA 2UU9L 2I0QA 4B3MQ 1K83H 3CMEA 4JC0A 2UXCL 1ESFA 4HSVA 3KFUA 4OO1G 2CQAA 2JJQA 4DR2L 4H13C 4BXXH 1SYCA 3F2BA 4RKLA 3HOXG 3RLFA 3DM3A 1IL8A 3RNUA 2JK8A 1A6XA 2AQ3B 1EIGA 1DOLA 1HUMA 2OT2A 1PH7A 4K14A 5D3IB 2ES2A 5GQOA 1N33Q 2RKSA 4L5SA 4DK1A 1BDOA 2NVQH 3PO3B 1QUQB 2Z4HA 3LWEA 1TS5A 4IJHA 1A62A 1WJJA 4CKBA 4NXNL 3NE5B 2K05A 4P73A 2F0TA 2A68C 3HOZB 1PZKD 5FLXL 4K0KQ 1VQHA 3T1YL 5M3MB 3TS0A 3ONAB 1A2UA 3HKSA 3F2DA 4ZAIA 3KF8B 1Q82C 3SK6A 1Y1VB 1PFSA 1QE6A 2K5HA 5EPLA 1IBKQ 3BU2A 2B2TC 2YYZA 4DV4L 4JI2Q 3V05A 4WJ4A 2WAQE 1QOHA 3ZYYX 5EAYA 4AH6A 3BDOA 2EQSA 4DGZA 4OXPA 3TZDA 2WINB 3UDGA 1UUPA 4C3JB 4O2DA 3K0YA 3OMCA 1PH9A 3S14B 1SNPA 1LTID 1ET6A 1HJPA 4J6HA 4HCEA 1QJOA 4FNFA 3SHLA 1LYLA 1SMXA 3DEPA 1H9SB 2BA0A 3NK9A 3T4AC 1FD7D 1SXTA 5JPNC 4X3KA 3SK5A 5I6WA 3FPUB 3MEFA 1SMYC 5M5WB 3GQBA 2A73B 1VMPA 1XMQL 3V2TA 4LF5L 3M3YB 1H95A 4CJ1B 5JPMC 1SMYD 2QILA 1XMOL 5JVG3 1AP0A 1JOKA 4EX5A 3KLWA 2F4VQ 2F0VA 3G6EA 1HXYD 4NP5A 4UAIA 1NUCA 1F2MA 3PGZA 1VS0A 1DONA 2GN5A 3GTJB 5K36H 1B50A 3VR2A 2B63G 5LMUQ 3HKZG 3TP8A 3I7FA 5I4DA 3Q24A 1F2ZA 1KQSA 2ZTDA 2PO4A 4ZUJA 4EVOA 5C4ZA 4DN4M 3H3VC 4A93G 2F4VL 1XPOA 3VYSA 1QVCA 3MHBA 3BVMA 4LFCL 2VW9A 1OXXK 1R4QB 2KHJA 2PYKA 3KLSA 3R2IA 2B2WA 1TWHH 2K5VA 4F88A 1Q1BA 1FR3A 3PO2G 4ZKCB 1PTOC 3AU7A 2N8NA 4TRDA 2DN8A 2TSSA 3CQZH 1S4ZA 5EKLA 1PH8A 5J39A 3NWTA 2EJGC 2DNCA 2BA1A 3ERQA 1X54A 1STHA 1B1ZA 4R4TA 2KHSA 3NXWA 1H9KA 3BYYB 1PVOA 1HCZA 2B8GA 3U50C 2IHFA 4C3IB 1Q81C 2MUYA 1A63A 1STYA 3S14H 2NVXH 4EQNA 3TN2A 1X3EA 2XIWA 1QILA 2NN6H 5COYA 4DV1Q 3FHWA 5GAGC 2EY2A 3CCEA 3EJIA 4NDXA 1CHQD 1SYFA 3EVQA 1TWCH 3CKIB 2AWOA 4LFAQ 5IWAQ 1B8AA 1N36Q 1UE7A 4A3GB 4XDXA 3T1HL 1RIPA 4H02A 2HD3A 2Y0SB 4A3LH 4IUNA 3MXPA 3K0XA 4BY1B 2NN6G 2PQEA 4WFN3 2X6LA 2YTVA 3DEOA 2A68D 2JA5G 4PNYA 3VR4A 1STNA 3M3YH 2ZTCA 1LACA 3CCUA 4A3IH 4ILWA 4G7HC 1TWCB 1B70B 3IKJA 3BZDB 1M8AA 2PPBC 3F2CA 2H1EA 4IPGA 4F8MA 4HN7A 3GO5A 1X3QA 5C3WA 2ZTEA 3D8GA 3R8BA 3M7NA 4YHHL 1IW7C 2B3GA 1E1TA 3I2ZA 4GLVB 1N34Q 3UE1A 5C4HA 4BY1H 3I4NB 4QCLA 2ZJQA 4B3RQ 1UNSA 3J7A5 2UUCL 3NENA 1A8VA 4KD3A 3QJYA 1K83B 5KRUA 1EYDA 2B29A 1Y1WG 2PZUA 2VZAA 3S24A 4DNTB 1FVIA 2X6GA 4HJ8A 3BVGA 3D4WA 4XTCS 1EQRA 2BOSA 1K8MA 4XT1B 2K33A 2EJFC 2NVTB 3HFZB 3K8AA 2UU9Q 4DU9A 3CRKC 4OWXB 3CW2C 3SEBA 2F0HA 1F9PA 1H9MA 2IX1A 4YIJA 4X65Q 4LNQA 4OO1I 3HOXH 3DM1A 1CQFA 4DAVA 1CKNB 5K36G 2CVRA 4UY8C 4BBRG 3HS0C 2JSOA 4A3MG 2VL6A 1EZ8A 3HZXA 1J9OA 2KQ3A 3Q8DA 4QY7A 1CHPD 1RDPD 4A3BH 1CA5A 1VQAA 1VQCA 1CUKA 4G4KA 4G57A 1G8ZD 1F2LA 3NWSA 4Y7NB 4K6LA 3P75A 3PIP3 4JV5L 4RCOA 4X64Q 4LF4L 1PH3A 3JC66 3GTQH 1PXUA 1F9SA 3HOXB 5ELOA 2D0PA 3X3MA 4U673 2E2HH 3CPWA 1JOQA 3A7AB 5K5PA 4X6AH 1EOVA 2MP1A 5E1FA 1CI3M 4L5RC 2P5ZX 4JV5Q 3E0EA 1O7ZA 1O7YA 3NTKA 2Q8TA 5A2QL 5KGUA 4C1NI 1L0YB 2PZTA 2F3VA 1A2TA 5C3XA 2Q2UA 1T5XD 2WKDA 3A5UA 2WP8J 1L1OB 1MGSA 3PUXA 3I4MB 4JI3Q 3GTPB 4GN4B 4WJWA 1GUGA 4HIOA 2G5DA 4K5VA 5IGFA 2HCCA 1S5CD 2A19A 2IPKD 4QIWB 4C2MH 5ELFA 4AIMA 2MGSA 4OWTB 1PTOD 3OTOQ 4BBSH 1HNWL 2QKIC 4WJ3M 2PCFB 1OXVA 4JBKA 3TQYA 4GLAC 4YWKA 2K52A 1RODA 2L1BA 1H9SA 1TWAB 5G3LF 4NB3A 1ICFB 3UE0A 3S2DH 1LTTD 1Z47A 3QG1A 4OHJA 2Q2TA 3M4YA 1BBUA 3SVMA 1U4PA 3OTOL 2K5NA 1HNWQ 3SR1A 4N8X1 2I46A 1TS3A 1X3FA 5M5XH 4L63B 1SE2A 3QIAA 3S16H 2NUCA 2XGTA 1NMFA 2RCFA 5CORA 4DUZL 4JI3L 3OW7A 3DUZA 4X64L 5C44B 1A3UA 3T16A 1CZGA 1LABA 2UXCQ 3ITPA 4LWCA 3GTOH 5GROA 1E22A 2HUGA 4IFDG 4N8FA 1CFMA 3CC2A 3A0JA 1PDQA 1V9PA 5GAHC 2YTYA 5C3EG 2NYZD 3MWYW 5EBCA 3VYRA 4RFBA 3RLNA 1ET9A 1AFPA 2IHEA 3T1HQ 3M7GA 1J8IA 4GKKL 3EQLC 4OX9Q 1XNQQ 4BY7G 1R9TB 4CKEA 3E0JA 3HOWG 3CCSA 5M3FB 3K59A 1XTCD 4LFBL 1VQ5A 2A8VA 3GTKB 1B3QA 1PTOH 3TP7A 1NSNS 1L0WA 3TMEA 5KNDA 3Q23A 1EFWA 2Z6BA 1MIUA 5BN5A 1T9HA 2E8GA 1X55A 3OPOA 1SLJA 2JA6G 3HOYH 1ESRA 2LS01 3H15A 1QNKA 5JVH3 2L11A 4DV5Q 3BZKA 4B08A 1KAWA 1TKWB 4A3IG 5EBDA 3GTKH 2HIXA 1JT8A 4A93H 3CD6A 4X62L 1ZXTA 2ZT9C 4LUZA 4JI4L 4ZKBB 2ZJRA 4HAEA 5IT9c 2KCCA 4P72A 1RKNA 1ICWA 3UDXA 4JCVE 4POFA 1D5ZC 1S40A 1Q46A 2N78A 4A3MB 2NWGA 1MSGA 1IZ6A 5C0XJ 1E0BA 2F0DA 4Y52H 4JVZA 5E7NA 1ZYRC 4DV6L 3QOLA 4JBJA 1WD1A 2LKVA 4HJAA 4A93B 2E2JB 1CKMA 3TP6A 2AQ1B 4S3SA 2J4XA 3SK4A 3GV6A 4ZQ3A 4BXXG 4MIUA 3GTMH 3KF6A 1O7LA 2EXDA 1Y1WB 4HEDA 4NMZA 4LF7Q 1Q1EA 4UP8A 3A8JE 3N52A 4LMQD 1SEBD 4OEMB 1E1OA 1JWSD 1LO5D 4IJLA 4JBWA 5C4JB 4IUVA 4FYDA 3K81C 4FXKC 1K8AC 4A3EH 2WB1B 1ENAA 3NTHA 1PMRA 1VQ6A 3D6WA 1Q12A 2Q2HA 4A3FG 4NKLA 3VR6A 1JE4A 3PCOB 1HRJA 1A3TA 3D4RA 2BH8A 2M2LA 4I7ZC 2JA8G 4OELB 4GNXB 4LW1A 3NTIA 3PUZA 1F9QA 2EYOA 2SNMA 1JJ2A 4IN3A 1VQPA 3NHHA 3FKIB 1BCPD 4YCWA 1BR9A 1YHBA 3PO3G 3HOVG 4DV5L 5C0XG 1XNRL 2F0KA 2LY7A 3VA5A 3SGIA 2K1BA 4RMFA 4M1UB 2K32A 1HTLD 1WYDA 4KKUA 1S5ED 2KEEA 4A3IB 4DV7Q 4JI7Q 3LNNA 4BY1G 1NR2A 2DY8A 2A5HA 3FPPA 5HGQA 3HOVB 5CGKA 1C48A 2JA6B 4DV1L 2FJ2A 1GO3E 2F0UA 2N55A 1NTGA 4H7BA 1X9NA 4HJ9A 5IP9H 1CQVA 1VDZA 4YY3L 3OWEB 2NTSA 2QGQA 5L37A 1EY5A 3KBGA 4KLKA 3G4SA 1VQBA 1PV4A 2B2UC 1FL0A 1XXGA 4JOIA 1KLGD 4P75A 1K3BC 3NPPA 2ATWA 1BO0A 1I4PA 3TRZA 3WDNA 3BJUA 1WTPA 1VQ7A 1EWHA 5LMNQ 3D4DA 2AKWB 1GD7A 2D2CC 4QGUA 1NBWA 3RZOH 2B2YC 3GTJH 3IFDA 1U4MA 4DNRB 1EY0A 3SK8A 2DJGC 5M5YB 4H44C 4X3SA 1F77A 4DR4Q 1LT5D 4FO2A 2OQKA 2LXKA 2NBFA 1HZCA 2YTXA 5EGTA 2XNAC 1Q8IA 3DWAA 4CGYB 3PMFA 5EJWA 1EQTA 2HDLA 4JI2L 4ZLTF 2JE6I 1KIXA 4HJ7A 4LF5Q 1FNUA 3W2DA 3PF4A 3DWPA 2FMMA 3E9IA 3GV3A 2JA8B 1Q90A 2NB0A 2KECA 2LSSA 2Q8IB 2IX3A 3CU7A 5ELCA 2K75A 5IYBH 3FRPB 2R93H 4ODGA 1PYSB 4POGA 1Z7TA 3J7AF 2VB2X 3I56A 3A54A 3PIOA 3PSIA 2KUMA 1WCMG 5DM63 1HPCA 2L12A 4XXEA 1RD9D 4JG2A 5JEAG 2QF7A 2EVBA 4JI4Q 1HUNA 1ONLA 1CKNA 2Z8LA 5LL6S 2K28A 1W6JA 1DOKA 2L9HA 1CA6A 2E5LL 1QWYA 2VUMB 2G9HD 2RBMA 5KNCA 5JAVA 2K4KA 3S17H 2ZXPA 1FGUA 1EQQA 1EEID 1CZWA 4B9WA 3J81i 4HSPA 1JR0D 3BVZA 3EN2A 1BBWA 2YU9H 5I9OA 4WRDA 1IXRA 3S2DB 3SE0A 5I6YA 2D0OA 1PH1A 1D7QA 1E3PA 2F3IA 2MQHA 1WTQA 4DUYQ 1N33L 3ICEA 1NR4A 1FNWA 4IUPA 2RA4A 5C0XI 1G6ZA 5CV9A 3R3OA 4RGNA 4KV6A 4DR3Q 4B3TQ 1LTBD 1SJED 5IYBG 4L5TA 4AYBE 5CV7A 3CPFA 1YBYA 2PMZB 1SNCA 1ASZA 1YI2A 1G2SA 1O78A 2ICIA 1NMGA 2F3WA 4DV2L 3M85A 4R4IA 2K7VA 1MI2A 5AFWA 3T51B 4B3SL 1HA5A 5M5YH 2AUJD 1F9RA 4XYQA 5EQ0A 4GZYC 3BYTB 4KD4A 3I3CA 3VR3A 1B2TA 4M8AA 1VQFA 2O4XA 3CXCA 2F52A 4DV0Q 2JA7B 4A75A 1GUNA 1ZEQX 2R3ZA 1HFNA 5I2XA 5JJZA 3QB3A 2MO1A 1DOMA 5IYCG 5LMNW 3NELA 1Y8OB 1EY9A 2PQAA 5E4XA 3J7ZC 4LF9Q 1TS4A 1CM9A 1VF5C 3H0GB 2Z9HA 2ASBA 1ILPA 3A74A 1SNOA 3M4PA 2ZM6L 2EYPA 5IWAL 4LFAL 3KDFA 4ALPA 3TREA 3CQZB 1OXUA 3KJPA 5IP9G 1Y8NB 2JA9A 2E75C 1K28A 1GOZA 1PH6A 1HH2P 3RZDB 3S1RB 4YWLA 1NY4A 3RLOA 2JP1A 2DGYA 4ULLA 2VQFL 1JWUD 2ZM6Q 1RCVD 4JBMA 4DR5Q 1X6OA 2F0QA 1KC8C 4EQOA 4TSSA 3B6YA 2RHQB 3V96A 2OF1A 3PIO3 3K5MA 4JPBW 2CH4W 5J1ZA 5G3LD 4OL7A 1I6HH 4XQJA 3HP3A 4A3CH 3NP8A 4IUQA 1EWIA 4BBSB 1SBBB 5IE8A 4UP9A 3HOUB 5CBAE 1HFGA 1AH9A 4XQNA 1I50H 5IP7H 1V1QA 1D2BA 1CSPA 1RJTA 1Y14B 4C3JH 4DR1Q 5IODA 2QDLA 1G291 3I91A 5C6AA 1FJGQ 2FMCA 2WIIB 1VQ9A 2UXDL 4V0BA 2AQ2B 1IKLA 3GTLB 2XRSD 3S16B 3TSSA 4J15A 1WVLA 2F0MA 1VQOA 3A8IE 3K5LA 3DMUA 4CKCA 5IT9L 3SDZA 2E2IH 2DNEA 2WFWA 1STAA 4B3TL 2ALYB 4OX9L 1XNQL 4G7OC 2E76C 1O80A 3MVVA 3CCQA 1HR0W 4A3JH 4LF8Q 3OIQA 2CW0C 5BR8L 3D3RA 5NUCA 3HOZH 2L5TA 3L2PA 1TXYA 1DM0B 1TT2A 3S1QB 1PRTD 4X66Q 1EYGA 1BOSA 1GHJA 2UUCQ 4PZ8A 4HIDA 5JEAH 2K01A 2JN4A 5HY6A 1HZAA 3CCLA 1ML0D 1I6VC 2JXMB 2MPMA 1MJCA 3I72A 4BY7B 1P8LA 2R92G 1SFOB 5AJ3Q 1KL9A 1L1OC 3A5ZB 3HEJA 3STBD 1HR0L 4A3JB 2PZWA 4L5QA 3L9AX 3HOVH 4R4OA 5E4WC 4RG1A 1CKOA 5FO8B 4K5WA 5C4XB 4AYBB 1E2WA 5DM73 3L7ZC 4QIWE 2Q8RE 3OIPA 3PIPA 3NUCA 2MFIA 2KA7A 4HCSA 1VQEA 5C44G 1J5EL 3RR5A 4YY3Q 3QR8A 4A3EB 1M1KC 3NSWA 4Q0FA 4A3EG 2VXWA 3LWUA 1XNRQ 3G48A 1PRTF 3ZJYC 1PRTB 2EYMA 1Y8PB 4EGVA 2PQAB 1YIJA 5CC4A 2PMZE 4DR6Q 3FMCA 1YJ9A 3NBHB 1BQQT 2K5WA 2XN9C 3G71A 1EY6A 2RCNA 2WKCA 4K6DA 3URYA 4IFDJ 2Z1CA 1U4RA 4A3KH 4MHEA 2OWOA 4X3UA 4DA2A 3IFTA 4JI7L 1YNJD 3M4OH 4DR7Q 1NNXA 1NE3A 1X65A 2B2VC 1VQMA 3J7YW 2E2JH 1KNEA 2F0FA 1PH4A 4N9PA 3DHQA 4KI0A 1D5MC 1Y1WH 1L1OA 2KENA 3F2UA 3KLSX 4HIMA 1K0RA 1EZ6A 4YWMA 4DFAA 3KF6B 4KHPL 2LXJA 2F0EA 2EPBA 2IW3A 3CCJA 1XYIA 1VQDA 4LJZC 1C8CA 4OWWB 1SYBA 5FO7B 1M4VA 1C9OA 5CR3A 3E9HA 4NPSA 1TY2A 4N9TA 1VQLA 4OIJA 2RF4A 5BR8Q 1LTLA 3Q6SA 1BVSA 1SAPA 4DV6Q 2WV6D 3HOUH 3JAMc 4ME3A 1CT1D 4ZYSA 2B63H 3PUVA 4JI0Q 3KK7A 3BDLA 1XTDA 4A4IA 4CDDC 3T56B 3GTGH 4DV3Q 1HA6A 1YEZA 1VQGA 3C1EA 4NXMQ 5ELDA 5C4XH 5KIXA 2R92B 1HR0Q 4RGMA 3ULLA 3KJOA 1K73C 4NXNQ 3MXNB 2CHBD 2NN6I 1PA6A 1JMCA 1FJGL 1AN8A 3OYYA 1OXTA 3D0FA 4IFDI 1LTGD 3TP5A 2V4DA 1E2ZA 3GTGB 4UDUC 2A6ED 2IJ0A 3S1NH 4JI6Q 1SRUA 4OONA 5J22A 2F0PA 4QJFA 1FNVA 4G7ZC 2UXBQ 2K04A 2EZVA 1EFID 3DWQA 3EROA 4KY5A 1Y1VG
chains in the Genus database with same CATH topology
2IWHA 1DCZA 1KTKA 1STBA 1LV9A 5CBEE 3K6OA 1RTNA 1KDBA 2B2YA 4ZUIA 2EYHA 5IGCA 1EU3A 3E6ZX 5BN3A 4U68A 1I4QA 4FF4A 2RSNA 1Z6HA 1ZYRD 2IL8A 2F0LA 4J8QA 3K5NA 3T53B 2QDBA 2NVXB 4A3DB 1KABA 2AWNA 2ENBA 4K2LA 1LT6D 2TMPA 2B8FA 4FF2A 2NTTA 2AUKA 3I4LA 4IURA 3QWNA 3GTMB 2R93B 1OO9B 3IAYA 2PW5A 2RSOA 2F0JA 4ZRZA 1KLUD 2RVLA 1JICA 4JK1C 5DEHA 1FGBD 1H9RA 1SYGA 3I8ZA 3K58A 2C5CA 1I4RA 4K8JA 3GTQB 1QG7A 1EY8A 2RDGA 4DXFA 2B2TA 2EY6A 5JOBA 2EY1A 4RGOS 3HG9A 2JA5B 4X3TA 4Z9CB 1U4LA 1EU4A 1I50B 3QOJA 3MEHA 1RF2D 3H6MA 5IGDA 4IALA 1L0XB 3NQIA 1VMCA 2EYLA 2NVYB 4R9WA 3TDQA 3VA7A 1TWFB 3MTSA 3I73A 1AZPA 2HCIA 1G91A 5I2YA 3C3LA 2J0TD 5FKAC 1MSHA 4P2CB 1WTXA 3QO2A 1PTOB 5HURA 3G7LA 3HRZC 3Q22A 1SNMA 2L4NA 1TY0A 3HOWB 4PV1C 1BCPC 2XWJB 3H09A 2WACA 1SJHD 4O1NA 2F0GA 3KUPA 5E3FA 2KJXA 1KNAA 1TR5A 1EYCA 4FF1A 4OO1H 3A55A 4MN3A 2A6EC 1SDFA 1S5FD 1WTWA 1D5XC 2M9VA 1F2YA 1SSOA 1LLRD 2Z4IA 1STEA 3I70A 3DXJC 1WTRA 1CK1A 1EOTA 5KYIA 2ZXRA 2SOBA 3A7LA 1PZJD 2GA4B 2F0WA 4BS9A 2D62A 2KOLA 4KTAA 4FP5D 2F0OA 2F0IA 2ID0A 3K57A 3J81E 3PO2B 2A69C 5CV8A 3OMGA 4A3KB 1GUSA 5KEEA 2RDFA 3PUYA 4FF3A 1NAPA 4KY6A 1EQVA 3J80L 4EQPA 2XWBB 5IOCA 3HKZB 4DK0A 2PW7A 4RCNA 1H9JA 1JCKB 1EY7A 1YNNC 4ZK9B 2R6GA 2K6AA 4C3HG 2MJ8A 1WTOA 1QB5D 4OIKA 4L6TB 1GUTA 4QMGA 1TS2A 1U9RA 1WD0A 5A35A 1AZQA 1G2TA 3VR5A 2HDMA 4IQZA 1V8QA 4RH6A 3AMUA 5KYLA 5IT9E 3CHBD 3JAME 1D6EC 4DF7A 2F4IA 5FOBB 4BWGB 4RHRA 1ENFA 1LTRD 1PFMA 4OGQC 1AW7A 2EXZA 1EIHA 5IGEA 1S5BD 1SE4A 2H4OA 5IIFA 1VF7A 1X32A 3G6JB 5FK9C 1TIID 1DZ1A 2BDOA 3RD4A 1DYQA 4PMWA 3MXGA 3IL8A 3T13A 2B2WC 4J1MA 1UEAB 1TVXA 3R2TA 2A6HD 3KLRA 1JWMD 4BBRB 2KCNA 2IT1A 5FO9B 2EDGA 3SXHA 5DAUA 3JAML 3RMHA 4IZ8A 2EE1A 1OXSC 4CJ0B 5ISRA 2BE5C 1XX8A 2G9DA 3GD7A 3EFXD 3O13A 3MC0B 1A15A 5EPJA 2BE5D 1QCBD 1R4PB 3K7AB 1JORA 4PMBA 1B9MA 1I6HB 1B4OA 1IYVA 2IX0A 5A2QE 2QEJC 4V190 1EEFD 2EYJA 3W3AA 5BN4A 5IGGA 1WCMB 4HMIA 1W6KA 2LMCB 1LTAD 1DXMA 1HQMC 4E6IA 1GJXA 1E2VA 4KMUC 1BNZA 3BDCA 1HQRD 2D5DA 1HTPA 2PNRC 2XVSA 5EKIA 1JOOA 5HGTA 2B39A 2K5QA 2B63B 1PLFA 1YNND 2OXPA 3C2PA 3TBIB 1V1PB 4IUUA 2N88A 3FDTA 4FVMA 1FYCA 1A3VA 2FHTA 4C3IG 2OEOA 2L0CA 5M9OA 2F0SA 2KVMA 1V43A 5EKKA 1IHZA 4C1NK 3MA2B 4F87A 3FEWX 3AB9A 3D31A 2YU9B 1AEXA 4DAYA 1JB3A 4Q5VA 3N6RA 1IW7D 4CBVA 2EY5A 3P1HA 1VCIA 3P7JA 1GXDC 4K5XA 5CV4A 3NBIA 3LX0A 4KKSA 5ELEA 4KK7A 2K03A 1BUVT 3WOFA 4I65A 1SYDA 3L3OC 1IYUA 5IGBA 1HHVA 1SNDA 2O2LD 4BA2I 1MD2D 5D3DA 1Q3LA 3M4OB 4FXDA 3PV0A 3S9WA 3HOYB 2E2DC 2A6HC 4RKBA 4A3FB 2BCOA 3X3NA 1I4GA 1ENCA 1PFBA 2E2HB 1BCPB 5D65A 4KKTA 5F2DA 3U9OA 1I4HA 3MZ5A 3U9SA 3R93A 2EYFA 5LHY1 3C46A 3NBHA 3FVQA 1MBYA 4KJNA 1BCPF 4K2KA 2E2IB 2J7ZA 2RQXA 2NZ1D 2EOTA 1D1IA 2O5JC 4FXGC 1PTOF 1KDAA 3S1MB 3Q0AA 3KF8A 1BXTA 3BG3A 2R7ZB 1B3AA 2R61A 5M5XB 4NW2A 2LFNA 3VYTA 5JEAJ 1EY4A 2ZXOA 4KHZA 1IKMA 1DD2A 2O5IC 2B2VA 3GTOB 5CV6A 4LAAA 3WOEA 2M00A 1TQOA 1T5EA 5ELBA 4KN7C 1WTVA 2F1MA 1PZID 2K5DA 2E74C 2SNSA 5KNBA 1ZKOA 3E5SA 4F7XA 1I3QB 5EPKA 2C9OA 4TQUS 4RWSC 4QUFA 2EJMA 1GUWA 1QNUA 4IFDH 1V1PA 1XWEA 2MHVA 4LK1C 2XSCA 1EYAA 2A74C 4L8JA 4B9XA 4HMJA 1BF4A 2F03A 1X3PA 4DXGA 3OWFA 2DY7A 1K8OA 3S2HB 1TWHB 1ILQA 1EWCA 3BS1A 3RUZA 1V1OA 1B53A 1PYWD 4R8NA 1B44D 1Y69U 3A56A 1PFNA 2BDNA 1LT4D 4QF4A 3TZUA 1DJRD 1RTOA 3ND9A 2SEBD 2F0NA 4KN4C 2JEBI 1EL0A 4H0LC 1STGA 1TU2B 1CTMA 4C3JG 5CMDA 3S15B 3EA6A 4QUCA 4HR7B 1I4XA 1NCVA 2SDFA 1SNQA 4HTHA 5C0XH 4C2MB 4C3HB 3NQTA 4K8IA 4TKOB 3J80E 3H91A 5CV5A 4KY7A 4RAUC 5D14A 3C1FA 2JEAI 2HQEA 5FLXE 4XYOA 5CYUA 4IUTA 4C56C 2RDHA 4BA1I 5C3EB 5I9PA 1UAPA 4A3BB 1II3A 4O42A 3GP7A 5LL6X 3VYUA 2FINB 3H94A 2FFKB 2L55A 3K5OA 1C4QA 4RA8A 4XQQA 4KHVA 3OOCA 1D1KA 3HGBA 3I90A 4CJ2C 2QCPX 3OHXC 1SE3A 3MXNA 3S17B 3OSOA 3J7AV 3MFGA 3ND8A 5C5LA 5C5MA 1JQYD 3D6CA 2X69A 2WAQB 1S5DD 4WORA 3A8KE 5DNFA 2B2UA 3CRLC 3P20A 4ME5A 1BBXC 1SYEA 1GHKA 3MFYA 4ID6A 2XRQD 5T1IA 5T1GA 4CHTB 4R8IA 4RGTA 3MAQA 1TWGB 1KDCA 1LTSD 2VB3X 1LT3D 3UI2A 2CW0D 4QB4A 1B9NA 3J81L 4RHSA 1JC7A 1YNJC 1PRTC 2I07B 3PUWA 4XIGS 2VNUD 4ABNA 3KBXA 4KJOA 2D9UA 1KAAA 4PQXA 4DAPA 1RHPA 2KEDA 3RZOB 3MXUA 4PMCA 1GUOA 2ICEC 3S1NB 2JYOA 2A69D 4XT3B 2NVQB 5TSSA 1ESFA 4HSVA 4OO1G 2CQAA 4H13C 1SYCA 4RKLA 3RLFA 1IL8A 1A6XA 2AQ3B 1EIGA 1DOLA 1HUMA 2OT2A 4K14A 5D3IB 2RKSA 4DK1A 1BDOA 3PO3B 2Z4HA 3LWEA 1TS5A 4CKBA 3NE5B 2K05A 2F0TA 2A68C 3HOZB 1PZKD 5FLXL 5M3MB 3ONAB 1A2UA 4ZAIA 3SK6A 1Y1VB 1QE6A 5EPLA 2B2TC 2YYZA 3V05A 1QOHA 3ZYYX 3BDOA 4DGZA 3TZDA 2WINB 1UUPA 4C3JB 3K0YA 3OMCA 3S14B 1SNPA 1LTID 1ET6A 4J6HA 4HCEA 1QJOA 4FNFA 3SHLA 3DEPA 1H9SB 2BA0A 3NK9A 3T4AC 1FD7D 1SXTA 5JPNC 4X3KA 3SK5A 5I6WA 3FPUB 1SMYC 5M5WB 3GQBA 2A73B 1VMPA 3V2TA 3M3YB 4CJ1B 5JPMC 1SMYD 2QILA 5JVG3 1AP0A 1JOKA 2F0VA 1HXYD 4NP5A 4UAIA 1NUCA 1F2MA 1DONA 3GTJB 5K36H 1B50A 3VR2A 3TP8A 5I4DA 3Q24A 1F2ZA 4ZUJA 2PO4A 4EVOA 5C4ZA 4DN4M 3H3VC 3VYSA 3MHBA 3BVMA 1OXXK 1R4QB 2PYKA 3KLSA 3R2IA 2B2WA 4F88A 1Q1BA 1FR3A 4ZKCB 1PTOC 3AU7A 4TRDA 2DN8A 2TSSA 1S4ZA 5EKLA 5J39A 3NWTA 2EJGC 2DNCA 2BA1A 3ERQA 1STHA 1B1ZA 2KHSA 3NXWA 1H9KA 3BYYB 1HCZA 2B8GA 4C3IB 2MUYA 1STYA 4EQNA 3TN2A 2XIWA 1QILA 2NN6H 5COYA 2EY2A 3EJIA 4NDXA 1CHQD 1SYFA 3EVQA 3CKIB 2AWOA 4A3GB 4XDXA 2Y0SB 4IUNA 3MXPA 4BY1B 2NN6G 2PQEA 4WFN3 2X6LA 3DEOA 2A68D 4PNYA 3VR4A 1STNA 1LACA 4ILWA 4G7HC 1TWCB 3IKJA 3BZDB 1M8AA 2PPBC 2H1EA 4F8MA 4HN7A 3GO5A 1X3QA 5C3WA 3D8GA 3R8BA 3M7NA 1IW7C 5C4HA 3I4NB 4QCLA 1UNSA 4KD3A 3QJYA 1K83B 5KRUA 1EYDA 2PZUA 4DNTB 2X6GA 3BVGA 3D4WA 4XTCS 2BOSA 1K8MA 4XT1B 2K33A 2EJFC 2NVTB 4DU9A 3CRKC 3SEBA 2F0HA 1F9PA 1H9MA 2IX1A 4YIJA 4OO1I 3DM1A 1CQFA 4DAVA 5K36G 2CVRA 3HS0C 2JSOA 1EZ8A 3HZXA 1J9OA 2KQ3A 1CHPD 1RDPD 1CA5A 4G4KA 4G57A 1G8ZD 1F2LA 3NWSA 4Y7NB 4K6LA 3P75A 3PIP3 4RCOA 1PXUA 1F9SA 3HOXB 3X3MA 4U673 1JOQA 3A7AB 5K5PA 2MP1A 5E1FA 1CI3M 1O7ZA 1O7YA 3NTKA 2Q8TA 5A2QL 5KGUA 4C1NI 1L0YB 2PZTA 2F3VA 5C3XA 1A2TA 1T5XD 2WKDA 2WP8J 1MGSA 3PUXA 3I4MB 3GTPB 4WJWA 1GUGA 4K5VA 5IGFA 2HCCA 1S5CD 4QIWB 2IPKD 5ELFA 2MGSA 1PTOD 2QKIC 2PCFB 1OXVA 1RODA 2L1BA 1H9SA 1TWAB 5G3LF 1LTTD 1Z47A 3QG1A 4OHJA 3M4YA 3SVMA 1U4PA 3SR1A 2I46A 1TS3A 4L63B 1SE2A 3QIAA 2NUCA 5CORA 3OW7A 3DUZA 5C44B 1A3UA 3T16A 1CZGA 1LABA 3ITPA 2HUGA 4IFDG 1CFMA 1PDQA 2NYZD 3MWYW 5EBCA 3VYRA 4RFBA 1ET9A 1AFPA 3M7GA 1J8IA 3EQLC 1R9TB 4CKEA 3E0JA 5M3FB 3K59A 1XTCD 3GTKB 1PTOH 3TP7A 1NSNS 3TMEA 5KNDA 3Q23A 5BN5A 3OPOA 1ESRA 2LS01 1QNKA 5JVH3 2L11A 4B08A 1TKWB 5EBDA 1ZXTA 2ZT9C 4ZKBB 4HAEA 2KCCA 1RKNA 1ICWA 1D5ZC 4A3MB 2NWGA 1MSGA 5C0XJ 1E0BA 2F0DA 1ZYRC 3QOLA 1WD1A 2LKVA 4A93B 2E2JB 3TP6A 2AQ1B 4S3SA 2J4XA 3SK4A 3GV6A 4ZQ3A 4MIUA 1O7LA 1Y1WB 4HEDA 4NMZA 1Q1EA 3A8JE 3N52A 4LMQD 1SEBD 1JWSD 1LO5D 4JBWA 5C4JB 4IUVA 4FYDA 4FXKC 2WB1B 1ENAA 3NTHA 1PMRA 3D6WA 1Q12A 4NKLA 3VR6A 1JE4A 1HRJA 1A3TA 3D4RA 2M2LA 4I7ZC 3NTIA 3PUZA 1F9QA 2EYOA 2SNMA 4IN3A 3NHHA 3FKIB 1BCPD 1BR9A 5C0XG 2F0KA 2LY7A 3VA5A 2K1BA 4M1UB 2K32A 1HTLD 4KKUA 1S5ED 2KEEA 4A3IB 3LNNA 1NR2A 2DY8A 2A5HA 3FPPA 3HOVB 5CGKA 1C48A 2JA6B 2FJ2A 2N55A 2F0UA 4H7BA 1CQVA 1VDZA 3OWEB 2NTSA 1EY5A 3KBGA 2B2UC 1KLGD 1XXGA 3NPPA 1BO0A 1I4PA 3WDNA 1WTPA 1EWHA 3D4DA 2D2CC 2B2YC 3IFDA 1U4MA 4DNRB 1EY0A 3SK8A 5M5YB 4H44C 4X3SA 1F77A 1LT5D 4FO2A 2NBFA 5EGTA 2XNAC 1Q8IA 3DWAA 4CGYB 3PMFA 5EJWA 1EQTA 2HDLA 4ZLTF 2JE6I 1FNUA 3W2DA 3DWPA 2FMMA 3GV3A 2JA8B 1Q90A 2NB0A 2KECA 2Q8IB 2IX3A 3CU7A 5ELCA 3FRPB 4ODGA 1Z7TA 3J7AF 2VB2X 3A54A 2KUMA 5DM63 1HPCA 2L12A 4XXEA 1RD9D 5JEAG 2QF7A 2EVBA 1HUNA 1ONLA 2Z8LA 5LL6S 2K28A 1W6JA 1DOKA 2L9HA 1CA6A 1QWYA 2VUMB 2G9HD 2RBMA 5KNCA 5JAVA 2ZXPA 1EEID 1CZWA 4B9WA 4HSPA 1JR0D 3BVZA 5I9OA 4WRDA 3S2DB 3SE0A 5I6YA 1WTQA 1NR4A 1FNWA 4IUPA 2RA4A 5C0XI 1G6ZA 5CV9A 3R3OA 4RGNA 4KV6A 1LTBD 1SJED 5CV7A 2PMZB 1SNCA 1G2SA 1O78A 2ICIA 2F3WA 3M85A 2K7VA 1MI2A 5AFWA 3T51B 1HA5A 2AUJD 1F9RA 4XYQA 5EQ0A 4GZYC 3BYTB 4KD4A 3I3CA 3VR3A 1B2TA 4M8AA 2O4XA 2JA7B 1GUNA 1ZEQX 2R3ZA 1HFNA 5I2XA 5JJZA 3QB3A 1DOMA 1Y8OB 1EY9A 5E4XA 1TS4A 1CM9A 1VF5C 3H0GB 1ILPA 1SNOA 2EYPA 3CQZB 1OXUA 1Y8NB 2E75C 1GOZA 3RZDB 3S1RB 2JP1A 4ULLA 1JWUD 1RCVD 2F0QA 4EQOA 4TSSA 3V96A 2OF1A 3PIO3 3K5MA 5J1ZA 5G3LD 4OL7A 4XQJA 3HP3A 3NP8A 4IUQA 4BBSB 1SBBB 3HOUB 5CBAE 1HFGA 4XQNA 1D2BA 1RJTA 5IODA 1G291 3I91A 5C6AA 2FMCA 2WIIB 4V0BA 2AQ2B 1IKLA 3GTLB 2XRSD 3S16B 3TSSA 1WVLA 2F0MA 3A8IE 3K5LA 3DMUA 4CKCA 5IT9L 3SDZA 2DNEA 1STAA 4G7OC 2E76C 1O80A 3MVVA 3OIQA 2CW0C 3D3RA 5NUCA 2L5TA 1DM0B 1TT2A 3S1QB 1PRTD 1BOSA 1GHJA 5JEAH 2K01A 1ML0D 1I6VC 2JXMB 2MPMA 3I72A 4BY7B 1SFOB 3HEJA 4A3JB 2PZWA 3L9AX 5E4WC 5FO8B 4K5WA 5C4XB 4AYBB 1E2WA 5DM73 3L7ZC 2Q8RE 3OIPA 3NUCA 2KA7A 4HCSA 4A3EB 3NSWA 4Q0FA 2VXWA 3LWUA 1PRTF 1PRTB 2EYMA 1Y8PB 4EGVA 5CC4A 3FMCA 1BQQT 2K5WA 2XN9C 1EY6A 2WKCA 4K6DA 3URYA 4IFDJ 2Z1CA 1U4RA 4MHEA 4X3UA 4DA2A 3IFTA 1YNJD 2B2VC 3J7YW 1KNEA 2F0FA 4N9PA 3DHQA 4KI0A 1D5MC 3F2UA 3KLSX 1EZ6A 4DFAA 2F0EA 2EPBA 2IW3A 1XYIA 4LJZC 1C8CA 1SYBA 5FO7B 1M4VA 5CR3A 1TY2A 4N9TA 4OIJA 3Q6SA 1SAPA 2WV6D 1CT1D 4ZYSA 3PUVA 3KK7A 3BDLA 3T56B 1HA6A 3C1EA 5ELDA 5KIXA 2R92B 4RGMA 2CHBD 2NN6I 1AN8A 1OXTA 4IFDI 1LTGD 3TP5A 2V4DA 1E2ZA 3GTGB 4UDUC 2A6ED 2IJ0A 5J22A 2F0PA 4G7ZC 1FNVA 2K04A 2EZVA 1EFID 3DWQA 3EROA 4KY5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1K A;  1R4Q B;  2BOS A;  4P2C B;  1CZG A;  1QOH A;  1R4P B;  1D1I A;  2C5C A;  1C48 A;  1QNU A;  1CQF A;  2GA4 B;  1C4Q A;  1DM0 B;  2XSC A;  4M1U B;  1BOS A;  4ULL A;  1CZW A;  3MXG A; 
#chains in the Genus database with same CATH topology
 2IWH A;  3S15 H;  1DCZ A;  1KTK A;  1KHI A;  1STB A;  2HIV A;  1LV9 A;  2R7Z G;  5CBE E;  4UPA A;  3K6O A;  1RTN A;  1KDB A;  2B2Y A;  2C35 B;  2N3S A;  4ZUI A;  1HNX Q;  2EYH A;  5IGC A;  4GKJ L;  1EU3 A;  3E6Z X;  2WAQ G;  5BN3 A;  4U68 A;  1I4Q A;  1IBL Q;  2K14 A;  4FF4 A;  2RSN A;  2Y0S G;  5IYC H;  4GNX C;  1Z6H A;  1ZYR D;  3CCV A;  1XPU A;  3K7A H;  1J6Q A;  4ZCK A;  1Q7Y C;  3F1Z A;  2IL8 A;  2NVT H;  2F0L A;  4J8Q A;  3K5N A;  4YCV A;  3T53 B;  2QDB A;  2NVX B;  4R4C A;  4A3F H;  4B3S Q;  2R7Z H;  4A3D B;  1KAB A;  2AWN A;  2ENB A;  4K2L A;  1LT6 D;  2TMP A;  2HHH L;  2B8F A;  4FF2 A;  2NTT A;  2AUK A;  3I4L A;  2I5M X;  4IUR A;  4GOP C;  3QWN A;  3GTM B;  2R93 B;  2N49 A;  2AHO B;  1OO9 B;  3IAY A;  2PW5 A;  2RSO A;  2F0J A;  4ZRZ A;  1YZ6 A;  1KLU D;  3U4Z A;  2RVL A;  1IBK L;  1JIC A;  4JK1 C;  5DEH A;  3I8Z A;  1FGB D;  1H9R A;  1SYG A;  1MHW C;  3K58 A;  2C5C A;  4R1J A;  1I4R A;  4K8J A;  3GTQ B;  1QG7 A;  1EY8 A;  2RDG A;  2B2T A;  2EY6 A;  4DXF A;  5JOB A;  1IBM L;  4DPG A;  2EY1 A;  4RGO S;  3HG9 A;  2VQE Q;  2JA5 B;  4X3T A;  4Z9C B;  1EU4 A;  1U4L A;  1I50 B;  3QOJ A;  3MEH A;  1RF2 D;  3H6M A;  4DR3 L;  1YHQ A;  5IGD A;  4IAL A;  1U0L A;  1L0X B;  4A3M H;  1NJI C;  3NQI A;  1VMC A;  2EYL A;  2QW7 A;  2CKZ B;  2NVY B;  4R9W A;  3TDQ A;  3VA7 A;  1QZH A;  1TWF B;  3MTS A;  2VQE L;  3I73 A;  1AZP A;  4QL5 A;  2HCI A;  1G91 A;  1K9M C;  4PG3 A;  5I2Y A;  3C3L A;  2J0T D;  3J80 c;  5FKA C;  1MSH A;  4P2C B;  1WTX A;  1IBL L;  3QO2 A;  1N8R C;  1HZ9 A;  1WCM H;  1PTO B;  1TWA H;  2E5L Q;  5HUR A;  4IOA A;  2RHS B;  3G7L A;  2NVY H;  3HRZ C;  3Q22 A;  1SNM A;  2L4N A;  2UUA L;  1TY0 A;  3HOW B;  4PV1 C;  1BCP C;  2XWJ B;  3H09 A;  2WAC A;  3KDF B;  1SRO A;  4MNO A;  1SJH D;  5FLM G;  1C7Y A;  2HT1 A;  2NZO A;  3KOJ A;  4O1N A;  2MNA A;  2F0G A;  3KUP A;  5E3F A;  4BY7 H;  4A76 A;  4A3G G;  1WTH A;  2KJX A;  1KNA A;  1TR5 A;  1EYC A;  2YV5 A;  4FF1 A;  4OO1 H;  4MN3 A;  3A55 A;  4A3L G;  4MTN A;  2A6E C;  1SDF A;  1CSQ A;  1S5F D;  2QEX A;  1LM0 A;  1WTW A;  1D5X C;  2M9V A;  1F2Y A;  1N34 L;  1SSO A;  4UP7 A;  1LLR D;  1KD1 C;  2Z4I A;  1STE A;  5JJK A;  4IOC A;  3I70 A;  3DXJ C;  3S2H H;  1WTR A;  1CK1 A;  1X56 A;  1EOT A;  3W1B A;  5KYI A;  1GVP A;  2Q2I A;  2SOB A;  2ZXR A;  3A7L A;  1PZJ D;  5IY0 A;  2GA4 B;  1PYB A;  2Z6K C;  2F0W A;  2PI2 E;  4GN3 B;  1YJN A;  1UE5 A;  1I94 Q;  4BS9 A;  2D62 A;  2KOL A;  4JYA L;  4KTA A;  1UE1 A;  4FP5 D;  4GNX A;  2F0O A;  1KRS A;  4LF4 Q;  2F0I A;  2ID0 A;  3K57 A;  2VS1 A;  3J81 E;  3PO2 B;  5LMN L;  2A69 C;  5CV8 A;  4YHH Q;  1HZB A;  3OMG A;  3M4Q A;  4A3K B;  3F8T A;  1GUS A;  5KEE A;  2RDF A;  1D8L A;  3PUY A;  4FF3 A;  1NAP A;  3UDI A;  4KY6 A;  1EQV A;  3J80 L;  4EQP A;  1Q86 C;  2XWB B;  5IOC A;  4GOP A;  3HKZ B;  4DK0 A;  2CH4 A;  1E7Z A;  2PW7 A;  4RCN A;  1N32 L;  1H9J A;  1JCK B;  1EY7 A;  3PO3 H;  1YNN C;  4ZK9 B;  3GTP H;  2R6G A;  2K6A A;  4C3H G;  2MJ8 A;  3K7U C;  4A3J G;  1WTO A;  1QB5 D;  4OIK A;  2AMC B;  4L6T B;  4JYA Q;  1GUT A;  4QMG A;  4DKA C;  1TS2 A;  5AJ3 L;  1U9R A;  4GLX A;  4AYB G;  1WD0 A;  4KHP Q;  5A35 A;  1AZQ A;  4DR1 L;  1G2T A;  3VR5 A;  2HDM A;  2I5H A;  1V8Q A;  4IQZ A;  4RH6 A;  3AMU A;  1Y1V H;  5KYL A;  1XMO Q;  2OTJ A;  5IT9 E;  3CHB D;  3JAM E;  1KXL A;  4QQB X;  1D6E C;  4DF7 A;  2F4I A;  1VQ4 A;  4LF6 L;  3AFP A;  5FOB B;  4BWG B;  3H0G G;  3CP0 A;  1MJE A;  4RHR A;  1ENF A;  5FJ8 G;  5FJ8 H;  3CF5 A;  2IY5 B;  1LTR D;  1TWF H;  1PFM A;  4OGQ C;  4JI0 L;  1EIY B;  1LUZ A;  1AW7 A;  2EXZ A;  1EIH A;  4DR5 L;  2WB1 E;  5IGE A;  3I4O A;  1S5B D;  1SE4 A;  2H4O A;  4X66 L;  5IIF A;  3I4N G;  4A3D H;  1XMQ Q;  5JJL A;  1VF7 A;  1X32 A;  3G6J B;  1TWG H;  2KHI A;  5FK9 C;  1TII D;  1PH5 A;  5M5W H;  2OCE A;  4DNI A;  2BDO A;  3RD4 A;  1DZ1 A;  1DYQ A;  4PMW A;  3MXG A;  3PO2 H;  4IPC A;  3IL8 A;  3T13 A;  2B2W C;  4J1M A;  1AE2 A;  1UEA B;  1TVX A;  2CWA A;  3I4M H;  3R2T A;  1RL2 A;  4IPH A;  2A6H D;  3KLR A;  4R4Q A;  2WB1 G;  1JWM D;  3W1G A;  4BBR B;  2KCN A;  1W3S A;  2JA6 H;  1G51 A;  2IT1 A;  1YJW A;  5FO9 B;  2EDG A;  3SXH A;  2ZJP A;  5DAU A;  3JAM L;  3RMH A;  2JA5 H;  4IZ8 A;  3RZD H;  3S1R H;  2EE1 A;  3J81 c;  1Q8K A;  1OXS C;  4CJ0 B;  1S3O A;  5ISR A;  2BE5 C;  4FDB A;  2CCZ A;  1XX8 A;  2G9D A;  3GD7 A;  3EFX D;  3O13 A;  3MC0 B;  1A15 A;  5EPJ A;  4JOI C;  2BE5 D;  3IRB A;  3M9B A;  4LF7 L;  1QCB D;  1R4P B;  1C0A A;  3K7A B;  1JOR A;  4PMB A;  1B9M A;  1I6H B;  1B4O A;  4DR6 L;  2Z6K A;  1IYV A;  2IX0 A;  3CCR A;  5A2Q E;  4GS3 A;  2QEJ C;  4V19 0;  1EEF D;  4A3K G;  1SN8 A;  2EYJ A;  3NEM A;  3W3A A;  3ER0 A;  5BN4 A;  5C3E H;  3H0G H;  5IGG A;  1WCM B;  4HMI A;  1W6K A;  2LMC B;  1LTA D;  3E3X A;  1YVC A;  4GKK Q;  2HHH Q;  2NZH A;  1DXM A;  1HQM C;  3GTL H;  4E6I A;  1GJX A;  1VQI A;  3KYH C;  1E2V A;  3I55 A;  4KMU C;  1BNZ A;  3AEV A;  3H3V H;  2UXD Q;  1HNZ L;  1GKH A;  4JW0 A;  3CMA A;  3BDC A;  1VQK A;  1HQR D;  2D5D A;  1HTP A;  2PNR C;  2XVS A;  5EKI A;  3AQQ A;  1JOO A;  4JI1 Q;  5HGT A;  2B39 A;  2K5Q A;  2B63 B;  4A3G H;  1PLF A;  1YNX A;  1YNN D;  4DK6 C;  1HNZ Q;  2OXP A;  3C2P A;  3TBI B;  1V1P B;  4IUU A;  2N88 A;  3FDT A;  4FVM A;  5M3F G;  1FYC A;  4LFB Q;  1A3V A;  2FHT A;  4C3I G;  2R92 H;  2OEO A;  3ERS X;  2L0C A;  2R7D A;  5M9O A;  2F0S A;  2KVM A;  1V43 A;  5EKK A;  1IHZ A;  3STB C;  4TVA B;  4C1N K;  5IYD H;  1KRT A;  3MA2 B;  4F87 A;  3FEW X;  3AB9 A;  3D31 A;  3DLL A;  1SFO H;  2YU9 B;  1AEX A;  4NXM L;  2XTI A;  4DAY A;  1JB3 A;  4Q5V A;  3N6R A;  1IBM Q;  3HOZ G;  3TS2 A;  1IW7 D;  1JJG A;  1VQ8 A;  4CBV A;  3CC4 A;  4X62 Q;  2EY5 A;  4PZ7 A;  3RN2 A;  5JJI A;  3P1H A;  1VCI A;  4C3I H;  4DR4 L;  2JQO A;  3EIV A;  3P7J A;  1GXD C;  4K5X A;  5CV4 A;  1GM5 A;  4GOP B;  3NBI A;  4DK3 C;  3LX0 A;  4KKS A;  5ELE A;  1L2F A;  1W2B A;  4KK7 A;  2K03 A;  4CDE C;  1BUV T;  3CCM A;  3WOF A;  2K50 A;  1SYD A;  4I65 A;  4DUY L;  1QVF A;  3GDE A;  2OTL A;  3W5O A;  2JA8 H;  5C4X G;  3L3O C;  1WI5 A;  3U4V A;  1IYU A;  5IGB A;  1HHV A;  1SND A;  2O2L D;  4BA2 I;  1MD2 D;  1EUJ A;  5D3D A;  4JI1 L;  1Q3L A;  5IP7 G;  3M4O B;  1UEB A;  1M90 C;  4GN5 A;  4FXD A;  3PV0 A;  5M3M G;  3S9W A;  5LMU L;  4Y7N H;  4A3C G;  3HOY B;  2E2D C;  5C4J H;  4AQY L;  2A6H C;  5DLQ E;  1HNX L;  4RKB A;  1E24 A;  2OQ0 A;  4A3F B;  2BCO A;  3X3N A;  4B3R L;  1I4G A;  2VUM H;  1ENC A;  1PFB A;  2E2H B;  1BCP B;  5D65 A;  4KKT A;  5F2D A;  4DV7 L;  3U9O A;  1J5E Q;  3AYH B;  1I4H A;  1B7Y B;  2KCT A;  1SE8 A;  1Z9F A;  4CDC C;  1X3G A;  1XJV A;  3MZ5 A;  3U9S A;  3R93 A;  2EYF A;  5LHY 1;  3C46 A;  1VQJ A;  3NBH A;  1A0I A;  3FVQ A;  4HIK A;  1MBY A;  4JI6 L;  3BZC A;  4KJN A;  5IYD G;  2UXB L;  1BCP F;  1G6P A;  1JE5 A;  4K2K A;  2E2I B;  4UHV A;  3FKI G;  1IL2 A;  2J7Z A;  1S72 A;  1K3R A;  5FLX c;  2HQL A;  2RQX A;  1U5K A;  5M3F H;  2NZ1 D;  4JI5 L;  2EOT A;  4MTK A;  1D1I A;  2O5J C;  4FXG C;  1YIT A;  3S1Q H;  1PTO F;  1KDA A;  2PNH A;  3S1M B;  3Q0A A;  3KF8 A;  1BXT A;  3I4M G;  4CDF C;  3HOY G;  3BG3 A;  4X65 L;  3VDY A;  2R7Z B;  1B3A A;  2R61 A;  5M5X B;  2L15 A;  1N36 L;  1UE6 A;  4NW2 A;  4IPD A;  2PI2 A;  2LFN A;  3VYT A;  2R93 G;  2I5L X;  3H3V I;  1QVG A;  5JEA J;  1EY4 A;  2ZXO A;  4KHZ A;  1IKM A;  1DD2 A;  4LFC Q;  2V1C C;  2KBN A;  2O5I C;  2B2V A;  3GTO B;  1QUQ A;  3T1Y Q;  3PF5 A;  5CV6 A;  4LAA A;  3WOE A;  3I4N H;  4A3D G;  2M00 A;  4EQ5 A;  1TQO A;  1T5E A;  5ELB A;  4KN7 C;  2Y0S E;  3ULP A;  1WTV A;  2F1M A;  1PZI D;  2Z0S A;  3JAM i;  3J81 j;  4P74 A;  4DAY B;  5M3M H;  2K5D A;  1XPR A;  2E74 C;  3OW2 A;  2SNS A;  4MZ9 A;  5KNB A;  1ZKO A;  3AFQ A;  3E5S A;  4F7X A;  1I3Q B;  5EPK A;  2C9O A;  3UDF A;  4TQU S;  1UWV A;  2UUA Q;  4RWS C;  4QUF A;  2EJM A;  1GUW A;  1QNU A;  3HOU G;  4IFD H;  5GAD C;  1V1P A;  2MO0 A;  1XWE A;  2MHV A;  4LK1 C;  2XSC A;  3HKZ E;  1EYA A;  2A74 C;  4JI8 Q;  4L8J A;  4B9X A;  4P71 A;  1JJC B;  4HMJ A;  1BF4 A;  2F03 A;  2BH2 A;  1X3P A;  4DXG A;  3OWF A;  2JA7 G;  2DY7 A;  1I3Q H;  1K8O A;  2UUB L;  3S2H B;  1TWH B;  2VQF Q;  1ILQ A;  1EWC A;  4APV A;  3BS1 A;  2CQO A;  3FP9 A;  3RUZ A;  3CC7 A;  1B53 A;  1V1O A;  1PYW D;  4R8N A;  1B44 D;  1Y69 U;  3A56 A;  1PFN A;  1JB7 A;  4C3H H;  2BDN A;  4LUO A;  4JI8 L;  1LT4 D;  4QF4 A;  3L0O A;  3TZU A;  1DJR D;  1RTO A;  4LF6 Q;  4AQY Q;  3ND9 A;  4K0K L;  2SEB D;  2F0N A;  4KN4 C;  2JEB I;  1EL0 A;  1EIF A;  4DAM A;  2UUB Q;  1MKH A;  4H0L C;  1P16 A;  1AE3 A;  3ULJ A;  1STG A;  1VQN A;  1TU2 B;  1CTM A;  4C3J G;  1N32 Q;  5CMD A;  3S15 B;  3EA6 A;  4QUC A;  2DUD A;  4HR7 B;  1I4X A;  1NCV A;  2SDF A;  3S1M H;  4LF9 L;  1I94 L;  1SNQ A;  4HTH A;  4C2M B;  5C0X H;  1WOC A;  4C3H B;  3NQT A;  4K8I A;  4TKO B;  3J80 E;  3H91 A;  5CV5 A;  4KY7 A;  4RAU C;  5D14 A;  3C1F A;  2JEA I;  5H1S E;  2HQE A;  5J3B A;  4LF8 L;  5FLX E;  4XYO A;  5CYU A;  4IUT A;  4DR7 L;  4C56 C;  1WFQ A;  2RDH A;  4BA1 I;  4LUV A;  5C3E B;  3EBE A;  5I9P A;  1UAP A;  4A3B B;  1II3 A;  4DUZ Q;  1K8G A;  4O42 A;  3GP7 A;  5LL6 X;  3VYU A;  2FIN B;  3H94 A;  2FFK B;  2L55 A;  1I5F A;  3K5O A;  1C4Q A;  4RA8 A;  2EIF A;  3J80 i;  1YHA A;  2H5X A;  4XQQ A;  4DV2 Q;  4KHV A;  3OOC A;  1K0S A;  1QZG A;  4YCU A;  4A3B G;  1D1K A;  3HGB A;  4DR2 Q;  3I90 A;  1BKB A;  4CJ2 C;  2QCP X;  3OHX C;  4BBR H;  1SE3 A;  3MXN A;  3S17 B;  3OSO A;  3J7A V;  3MFG A;  2JA7 H;  3WWV A;  3ND8 A;  5C5L A;  5C5M A;  3FKI H;  1O7I A;  1JQY D;  5GAE C;  3D6C A;  2DJF C;  2X69 A;  4DV0 L;  2KCM A;  2WAQ B;  1S5D D;  4IO9 A;  4WOR A;  3A8K E;  5DNF A;  2B2U A;  4I7A A;  3TEH B;  1SR3 A;  3CRL C;  2CFM A;  3P20 A;  4ME5 A;  5FLM H;  3K80 C;  1SYE A;  1BBX C;  4JI5 Q;  1GHK A;  3MFY A;  4ID6 A;  2XRQ D;  4BBS G;  5T1I A;  5T1G A;  1N9W A;  1IYJ B;  1R9T H;  3PQI A;  4CHT B;  4R8I A;  3U58 A;  4RGT A;  3MAQ A;  3RN5 A;  1ASY A;  1TWG B;  1KDC A;  2VY3 A;  1LTS D;  2VB3 X;  2QA4 A;  1PH2 A;  2VUM G;  1LT3 D;  2GVA A;  3UI2 A;  4O0A A;  4HJ5 A;  2CW0 D;  2R7F A;  2A1A A;  4QB4 A;  1B9N A;  3J81 L;  4RHS A;  1JC7 A;  1YNJ C;  1PRT C;  2I07 B;  3PUW A;  4XIG S;  2VNU D;  4B3M L;  4DV4 Q;  4ABN A;  3KBX A;  4KJO A;  2D9U A;  2CWP A;  4DV3 L;  5C44 H;  1KAA A;  4PQX A;  4DAP A;  1RHP A;  2GVB A;  2KED A;  4GKJ Q;  3RZO B;  3MXU A;  4PMC A;  1PHJ A;  1DGS A;  4PZ6 A;  1GUO A;  2ICE C;  3S1N B;  3HOW H;  2JYO A;  2A69 D;  5ELN A;  4XT3 B;  3LGJ A;  3CAM A;  2NVQ B;  1OTC A;  2FXQ A;  5TSS A;  2UU9 L;  2I0Q A;  4B3M Q;  1K83 H;  3CME A;  4JC0 A;  2UXC L;  1ESF A;  4HSV A;  3KFU A;  4OO1 G;  2CQA A;  2JJQ A;  4DR2 L;  4H13 C;  4BXX H;  1SYC A;  3F2B A;  4RKL A;  3HOX G;  3RLF A;  3DM3 A;  1IL8 A;  3RNU A;  2JK8 A;  1A6X A;  2AQ3 B;  1EIG A;  1DOL A;  1HUM A;  2OT2 A;  1PH7 A;  4K14 A;  5D3I B;  2ES2 A;  5GQO A;  1N33 Q;  2RKS A;  4L5S A;  4DK1 A;  1BDO A;  2NVQ H;  3PO3 B;  1QUQ B;  2Z4H A;  3LWE A;  1TS5 A;  4IJH A;  1A62 A;  1WJJ A;  4CKB A;  4NXN L;  3NE5 B;  2K05 A;  4P73 A;  2F0T A;  2A68 C;  3HOZ B;  1PZK D;  5FLX L;  4K0K Q;  1VQH A;  3T1Y L;  5M3M B;  3TS0 A;  3ONA B;  1A2U A;  3HKS A;  3F2D A;  4ZAI A;  3KF8 B;  1Q82 C;  3SK6 A;  1Y1V B;  1PFS A;  1QE6 A;  2K5H A;  5EPL A;  1IBK Q;  3BU2 A;  2B2T C;  2YYZ A;  4DV4 L;  4JI2 Q;  3V05 A;  4WJ4 A;  2WAQ E;  1QOH A;  3ZYY X;  5EAY A;  4AH6 A;  3BDO A;  2EQS A;  4DGZ A;  4OXP A;  3TZD A;  2WIN B;  3UDG A;  1UUP A;  4C3J B;  4O2D A;  3K0Y A;  3OMC A;  1PH9 A;  3S14 B;  1SNP A;  1LTI D;  1ET6 A;  1HJP A;  4J6H A;  4HCE A;  1QJO A;  4FNF A;  3SHL A;  1LYL A;  1SMX A;  3DEP A;  1H9S B;  2BA0 A;  3NK9 A;  3T4A C;  1FD7 D;  1SXT A;  5JPN C;  4X3K A;  3SK5 A;  5I6W A;  3FPU B;  3MEF A;  1SMY C;  5M5W B;  3GQB A;  2A73 B;  1VMP A;  1XMQ L;  3V2T A;  4LF5 L;  3M3Y B;  1H95 A;  4CJ1 B;  5JPM C;  1SMY D;  2QIL A;  1XMO L;  5JVG 3;  1AP0 A;  1JOK A;  4EX5 A;  3KLW A;  2F4V Q;  2F0V A;  3G6E A;  1HXY D;  4NP5 A;  4UAI A;  1NUC A;  1F2M A;  3PGZ A;  1VS0 A;  1DON A;  2GN5 A;  3GTJ B;  5K36 H;  1B50 A;  3VR2 A;  2B63 G;  5LMU Q;  3HKZ G;  3TP8 A;  3I7F A;  5I4D A;  3Q24 A;  1F2Z A;  1KQS A;  2ZTD A;  2PO4 A;  4ZUJ A;  4EVO A;  5C4Z A;  4DN4 M;  3H3V C;  4A93 G;  2F4V L;  1XPO A;  3VYS A;  1QVC A;  3MHB A;  3BVM A;  4LFC L;  2VW9 A;  1OXX K;  1R4Q B;  2KHJ A;  2PYK A;  3KLS A;  3R2I A;  2B2W A;  1TWH H;  2K5V A;  4F88 A;  1Q1B A;  1FR3 A;  3PO2 G;  4ZKC B;  1PTO C;  3AU7 A;  2N8N A;  4TRD A;  2DN8 A;  2TSS A;  3CQZ H;  1S4Z A;  5EKL A;  1PH8 A;  5J39 A;  3NWT A;  2EJG C;  2DNC A;  2BA1 A;  3ERQ A;  1X54 A;  1STH A;  1B1Z A;  4R4T A;  2KHS A;  3NXW A;  1H9K A;  3BYY B;  1PVO A;  1HCZ A;  2B8G A;  3U50 C;  2IHF A;  4C3I B;  1Q81 C;  2MUY A;  1A63 A;  1STY A;  3S14 H;  2NVX H;  4EQN A;  3TN2 A;  1X3E A;  2XIW A;  1QIL A;  2NN6 H;  5COY A;  4DV1 Q;  3FHW A;  5GAG C;  2EY2 A;  3CCE A;  3EJI A;  4NDX A;  1CHQ D;  1SYF A;  3EVQ A;  1TWC H;  3CKI B;  2AWO A;  4LFA Q;  5IWA Q;  1B8A A;  1N36 Q;  1UE7 A;  4A3G B;  4XDX A;  3T1H L;  1RIP A;  4H02 A;  2HD3 A;  2Y0S B;  4A3L H;  4IUN A;  3MXP A;  3K0X A;  4BY1 B;  2NN6 G;  2PQE A;  4WFN 3;  2X6L A;  2YTV A;  3DEO A;  2A68 D;  2JA5 G;  4PNY A;  3VR4 A;  1STN A;  3M3Y H;  2ZTC A;  1LAC A;  3CCU A;  4A3I H;  4ILW A;  4G7H C;  1TWC B;  1B70 B;  3IKJ A;  3BZD B;  1M8A A;  2PPB C;  3F2C A;  2H1E A;  4IPG A;  4F8M A;  4HN7 A;  3GO5 A;  1X3Q A;  5C3W A;  2ZTE A;  3D8G A;  3R8B A;  3M7N A;  4YHH L;  1IW7 C;  2B3G A;  1E1T A;  3I2Z A;  4GLV B;  1N34 Q;  3UE1 A;  5C4H A;  4BY1 H;  3I4N B;  4QCL A;  2ZJQ A;  4B3R Q;  1UNS A;  3J7A 5;  2UUC L;  3NEN A;  1A8V A;  4KD3 A;  3QJY A;  1K83 B;  5KRU A;  1EYD A;  2B29 A;  1Y1W G;  2PZU A;  2VZA A;  3S24 A;  4DNT B;  1FVI A;  2X6G A;  4HJ8 A;  3BVG A;  3D4W A;  4XTC S;  1EQR A;  2BOS A;  1K8M A;  4XT1 B;  2K33 A;  2EJF C;  2NVT B;  3HFZ B;  3K8A A;  2UU9 Q;  4DU9 A;  3CRK C;  4OWX B;  3CW2 C;  3SEB A;  2F0H A;  1F9P A;  1H9M A;  2IX1 A;  4YIJ A;  4X65 Q;  4LNQ A;  4OO1 I;  3HOX H;  3DM1 A;  1CQF A;  4DAV A;  1CKN B;  5K36 G;  2CVR A;  4UY8 C;  4BBR G;  3HS0 C;  2JSO A;  4A3M G;  2VL6 A;  1EZ8 A;  3HZX A;  1J9O A;  2KQ3 A;  3Q8D A;  4QY7 A;  1CHP D;  1RDP D;  4A3B H;  1CA5 A;  1VQA A;  1VQC A;  1CUK A;  4G4K A;  4G57 A;  1G8Z D;  1F2L A;  3NWS A;  4Y7N B;  4K6L A;  3P75 A;  3PIP 3;  4JV5 L;  4RCO A;  4X64 Q;  4LF4 L;  1PH3 A;  3JC6 6;  3GTQ H;  1PXU A;  1F9S A;  3HOX B;  5ELO A;  2D0P A;  3X3M A;  4U67 3;  2E2H H;  3CPW A;  1JOQ A;  3A7A B;  5K5P A;  4X6A H;  1EOV A;  2MP1 A;  5E1F A;  1CI3 M;  4L5R C;  2P5Z X;  4JV5 Q;  3E0E A;  1O7Z A;  1O7Y A;  3NTK A;  2Q8T A;  5A2Q L;  5KGU A;  4C1N I;  1L0Y B;  2PZT A;  2F3V A;  1A2T A;  5C3X A;  2Q2U A;  1T5X D;  2WKD A;  3A5U A;  2WP8 J;  1L1O B;  1MGS A;  3PUX A;  3I4M B;  4JI3 Q;  3GTP B;  4GN4 B;  4WJW A;  1GUG A;  4HIO A;  2G5D A;  4K5V A;  5IGF A;  2HCC A;  1S5C D;  2A19 A;  2IPK D;  4QIW B;  4C2M H;  5ELF A;  4AIM A;  2MGS A;  4OWT B;  1PTO D;  3OTO Q;  4BBS H;  1HNW L;  2QKI C;  4WJ3 M;  2PCF B;  1OXV A;  4JBK A;  3TQY A;  4GLA C;  4YWK A;  2K52 A;  1ROD A;  2L1B A;  1H9S A;  1TWA B;  5G3L F;  4NB3 A;  1ICF B;  3UE0 A;  3S2D H;  1LTT D;  1Z47 A;  3QG1 A;  4OHJ A;  2Q2T A;  3M4Y A;  1BBU A;  3SVM A;  1U4P A;  3OTO L;  2K5N A;  1HNW Q;  3SR1 A;  4N8X 1;  2I46 A;  1TS3 A;  1X3F A;  5M5X H;  4L63 B;  1SE2 A;  3QIA A;  3S16 H;  2NUC A;  2XGT A;  1NMF A;  2RCF A;  5COR A;  4DUZ L;  4JI3 L;  3OW7 A;  3DUZ A;  4X64 L;  5C44 B;  1A3U A;  3T16 A;  1CZG A;  1LAB A;  2UXC Q;  3ITP A;  4LWC A;  3GTO H;  5GRO A;  1E22 A;  2HUG A;  4IFD G;  4N8F A;  1CFM A;  3CC2 A;  3A0J A;  1PDQ A;  1V9P A;  5GAH C;  2YTY A;  5C3E G;  2NYZ D;  3MWY W;  5EBC A;  3VYR A;  4RFB A;  3RLN A;  1ET9 A;  1AFP A;  2IHE A;  3T1H Q;  3M7G A;  1J8I A;  4GKK L;  3EQL C;  4OX9 Q;  1XNQ Q;  4BY7 G;  1R9T B;  4CKE A;  3E0J A;  3HOW G;  3CCS A;  5M3F B;  3K59 A;  1XTC D;  4LFB L;  1VQ5 A;  2A8V A;  3GTK B;  1B3Q A;  1PTO H;  3TP7 A;  1NSN S;  1L0W A;  3TME A;  5KND A;  3Q23 A;  1EFW A;  2Z6B A;  1MIU A;  5BN5 A;  1T9H A;  2E8G A;  1X55 A;  3OPO A;  1SLJ A;  2JA6 G;  3HOY H;  1ESR A;  2LS0 1;  3H15 A;  1QNK A;  5JVH 3;  2L11 A;  4DV5 Q;  3BZK A;  4B08 A;  1KAW A;  1TKW B;  4A3I G;  5EBD A;  3GTK H;  2HIX A;  1JT8 A;  4A93 H;  3CD6 A;  4X62 L;  1ZXT A;  2ZT9 C;  4LUZ A;  4JI4 L;  4ZKB B;  2ZJR A;  4HAE A;  5IT9 c;  2KCC A;  4P72 A;  1RKN A;  1ICW A;  3UDX A;  4JCV E;  4POF A;  1D5Z C;  1S40 A;  1Q46 A;  2N78 A;  4A3M B;  2NWG A;  1MSG A;  1IZ6 A;  5C0X J;  1E0B A;  2F0D A;  4Y52 H;  4JVZ A;  5E7N A;  1ZYR C;  4DV6 L;  3QOL A;  4JBJ A;  1WD1 A;  2LKV A;  4HJA A;  4A93 B;  2E2J B;  1CKM A;  3TP6 A;  2AQ1 B;  4S3S A;  2J4X A;  3SK4 A;  3GV6 A;  4ZQ3 A;  4BXX G;  4MIU A;  3GTM H;  3KF6 A;  1O7L A;  2EXD A;  1Y1W B;  4HED A;  4NMZ A;  4LF7 Q;  1Q1E A;  4UP8 A;  3A8J E;  3N52 A;  4LMQ D;  1SEB D;  4OEM B;  1E1O A;  1JWS D;  1LO5 D;  4IJL A;  4JBW A;  5C4J B;  4IUV A;  4FYD A;  3K81 C;  4FXK C;  1K8A C;  4A3E H;  2WB1 B;  1ENA A;  3NTH A;  1PMR A;  1VQ6 A;  3D6W A;  1Q12 A;  2Q2H A;  4A3F G;  4NKL A;  3VR6 A;  1JE4 A;  3PCO B;  1HRJ A;  1A3T A;  3D4R A;  2BH8 A;  2M2L A;  4I7Z C;  2JA8 G;  4OEL B;  4GNX B;  4LW1 A;  3NTI A;  3PUZ A;  1F9Q A;  2EYO A;  2SNM A;  1JJ2 A;  4IN3 A;  1VQP A;  3NHH A;  3FKI B;  1BCP D;  4YCW A;  1BR9 A;  1YHB A;  3PO3 G;  3HOV G;  4DV5 L;  5C0X G;  1XNR L;  2F0K A;  2LY7 A;  3VA5 A;  3SGI A;  2K1B A;  4RMF A;  4M1U B;  2K32 A;  1HTL D;  1WYD A;  4KKU A;  1S5E D;  2KEE A;  4A3I B;  4DV7 Q;  4JI7 Q;  3LNN A;  4BY1 G;  1NR2 A;  2DY8 A;  2A5H A;  3FPP A;  5HGQ A;  3HOV B;  5CGK A;  1C48 A;  2JA6 B;  4DV1 L;  2FJ2 A;  1GO3 E;  2F0U A;  2N55 A;  1NTG A;  4H7B A;  1X9N A;  4HJ9 A;  5IP9 H;  1CQV A;  1VDZ A;  4YY3 L;  3OWE B;  2NTS A;  2QGQ A;  5L37 A;  1EY5 A;  3KBG A;  4KLK A;  3G4S A;  1VQB A;  1PV4 A;  2B2U C;  1FL0 A;  1XXG A;  4JOI A;  1KLG D;  4P75 A;  1K3B C;  3NPP A;  2ATW A;  1BO0 A;  1I4P A;  3TRZ A;  3WDN A;  3BJU A;  1WTP A;  1VQ7 A;  1EWH A;  5LMN Q;  3D4D A;  2AKW B;  1GD7 A;  2D2C C;  4QGU A;  1NBW A;  3RZO H;  2B2Y C;  3GTJ H;  3IFD A;  1U4M A;  4DNR B;  1EY0 A;  3SK8 A;  2DJG C;  5M5Y B;  4H44 C;  4X3S A;  1F77 A;  4DR4 Q;  1LT5 D;  4FO2 A;  2OQK A;  2LXK A;  2NBF A;  1HZC A;  2YTX A;  5EGT A;  2XNA C;  1Q8I A;  3DWA A;  4CGY B;  3PMF A;  5EJW A;  1EQT A;  2HDL A;  4JI2 L;  4ZLT F;  2JE6 I;  1KIX A;  4HJ7 A;  4LF5 Q;  1FNU A;  3W2D A;  3PF4 A;  3DWP A;  2FMM A;  3E9I A;  3GV3 A;  2JA8 B;  1Q90 A;  2NB0 A;  2KEC A;  2LSS A;  2Q8I B;  2IX3 A;  3CU7 A;  5ELC A;  2K75 A;  5IYB H;  3FRP B;  2R93 H;  4ODG A;  1PYS B;  4POG A;  1Z7T A;  3J7A F;  2VB2 X;  3I56 A;  3A54 A;  3PIO A;  3PSI A;  2KUM A;  1WCM G;  5DM6 3;  1HPC A;  2L12 A;  4XXE A;  1RD9 D;  4JG2 A;  5JEA G;  2QF7 A;  2EVB A;  4JI4 Q;  1HUN A;  1ONL A;  1CKN A;  2Z8L A;  5LL6 S;  2K28 A;  1W6J A;  1DOK A;  2L9H A;  1CA6 A;  2E5L L;  1QWY A;  2VUM B;  2G9H D;  2RBM A;  5KNC A;  5JAV A;  2K4K A;  3S17 H;  2ZXP A;  1FGU A;  1EQQ A;  1EEI D;  1CZW A;  4B9W A;  3J81 i;  4HSP A;  1JR0 D;  3BVZ A;  3EN2 A;  1BBW A;  2YU9 H;  5I9O A;  4WRD A;  1IXR A;  3S2D B;  3SE0 A;  5I6Y A;  2D0O A;  1PH1 A;  1D7Q A;  1E3P A;  2F3I A;  2MQH A;  1WTQ A;  4DUY Q;  1N33 L;  3ICE A;  1NR4 A;  1FNW A;  4IUP A;  2RA4 A;  5C0X I;  1G6Z A;  5CV9 A;  3R3O A;  4RGN A;  4KV6 A;  4DR3 Q;  4B3T Q;  1LTB D;  1SJE D;  5IYB G;  4L5T A;  4AYB E;  5CV7 A;  3CPF A;  1YBY A;  2PMZ B;  1SNC A;  1ASZ A;  1YI2 A;  1G2S A;  1O78 A;  2ICI A;  1NMG A;  2F3W A;  4DV2 L;  3M85 A;  4R4I A;  2K7V A;  1MI2 A;  5AFW A;  3T51 B;  4B3S L;  1HA5 A;  5M5Y H;  2AUJ D;  1F9R A;  4XYQ A;  5EQ0 A;  4GZY C;  3BYT B;  4KD4 A;  3I3C A;  3VR3 A;  1B2T A;  4M8A A;  1VQF A;  2O4X A;  3CXC A;  2F52 A;  4DV0 Q;  2JA7 B;  4A75 A;  1GUN A;  1ZEQ X;  2R3Z A;  1HFN A;  5I2X A;  5JJZ A;  3QB3 A;  2MO1 A;  1DOM A;  5IYC G;  5LMN W;  3NEL A;  1Y8O B;  1EY9 A;  2PQA A;  5E4X A;  3J7Z C;  4LF9 Q;  1TS4 A;  1CM9 A;  1VF5 C;  3H0G B;  2Z9H A;  2ASB A;  1ILP A;  3A74 A;  1SNO A;  3M4P A;  2ZM6 L;  2EYP A;  5IWA L;  4LFA L;  3KDF A;  4ALP A;  3TRE A;  3CQZ B;  1OXU A;  3KJP A;  5IP9 G;  1Y8N B;  2JA9 A;  2E75 C;  1K28 A;  1GOZ A;  1PH6 A;  1HH2 P;  3RZD B;  3S1R B;  4YWL A;  1NY4 A;  3RLO A;  2JP1 A;  2DGY A;  4ULL A;  2VQF L;  1JWU D;  2ZM6 Q;  1RCV D;  4JBM A;  4DR5 Q;  1X6O A;  2F0Q A;  1KC8 C;  4EQO A;  4TSS A;  3B6Y A;  2RHQ B;  3V96 A;  2OF1 A;  3PIO 3;  3K5M A;  4JPB W;  2CH4 W;  5J1Z A;  5G3L D;  4OL7 A;  1I6H H;  4XQJ A;  3HP3 A;  4A3C H;  3NP8 A;  4IUQ A;  1EWI A;  4BBS B;  1SBB B;  5IE8 A;  4UP9 A;  3HOU B;  5CBA E;  1HFG A;  1AH9 A;  4XQN A;  1I50 H;  5IP7 H;  1V1Q A;  1D2B A;  1CSP A;  1RJT A;  1Y14 B;  4C3J H;  4DR1 Q;  5IOD A;  2QDL A;  1G29 1;  3I91 A;  5C6A A;  1FJG Q;  2FMC A;  2WII B;  1VQ9 A;  2UXD L;  4V0B A;  2AQ2 B;  1IKL A;  3GTL B;  2XRS D;  3S16 B;  3TSS A;  4J15 A;  1WVL A;  2F0M A;  1VQO A;  3A8I E;  3K5L A;  3DMU A;  4CKC A;  5IT9 L;  3SDZ A;  2E2I H;  2DNE A;  2WFW A;  1STA A;  4B3T L;  2ALY B;  4OX9 L;  1XNQ L;  4G7O C;  2E76 C;  1O80 A;  3MVV A;  3CCQ A;  1HR0 W;  4A3J H;  4LF8 Q;  3OIQ A;  2CW0 C;  5BR8 L;  3D3R A;  5NUC A;  3HOZ H;  2L5T A;  3L2P A;  1TXY A;  1DM0 B;  1TT2 A;  3S1Q B;  1PRT D;  4X66 Q;  1EYG A;  1BOS A;  1GHJ A;  2UUC Q;  4PZ8 A;  4HID A;  5JEA H;  2K01 A;  2JN4 A;  5HY6 A;  1HZA A;  3CCL A;  1ML0 D;  1I6V C;  2JXM B;  2MPM A;  1MJC A;  3I72 A;  4BY7 B;  1P8L A;  2R92 G;  1SFO B;  5AJ3 Q;  1KL9 A;  1L1O C;  3A5Z B;  3HEJ A;  3STB D;  1HR0 L;  4A3J B;  2PZW A;  4L5Q A;  3L9A X;  3HOV H;  4R4O A;  5E4W C;  4RG1 A;  1CKO A;  5FO8 B;  4K5W A;  5C4X B;  4AYB B;  1E2W A;  5DM7 3;  3L7Z C;  4QIW E;  2Q8R E;  3OIP A;  3PIP A;  3NUC A;  2MFI A;  2KA7 A;  4HCS A;  1VQE A;  5C44 G;  1J5E L;  3RR5 A;  4YY3 Q;  3QR8 A;  4A3E B;  1M1K C;  3NSW A;  4Q0F A;  4A3E G;  2VXW A;  3LWU A;  1XNR Q;  3G48 A;  1PRT F;  3ZJY C;  1PRT B;  2EYM A;  1Y8P B;  4EGV A;  2PQA B;  1YIJ A;  5CC4 A;  2PMZ E;  4DR6 Q;  3FMC A;  1YJ9 A;  3NBH B;  1BQQ T;  2K5W A;  2XN9 C;  3G71 A;  1EY6 A;  2RCN A;  2WKC A;  4K6D A;  3URY A;  4IFD J;  2Z1C A;  1U4R A;  4A3K H;  4MHE A;  2OWO A;  4X3U A;  4DA2 A;  3IFT A;  4JI7 L;  1YNJ D;  3M4O H;  4DR7 Q;  1NNX A;  1NE3 A;  1X65 A;  2B2V C;  1VQM A;  3J7Y W;  2E2J H;  1KNE A;  2F0F A;  1PH4 A;  4N9P A;  3DHQ A;  4KI0 A;  1D5M C;  1Y1W H;  1L1O A;  2KEN A;  3F2U A;  3KLS X;  4HIM A;  1K0R A;  1EZ6 A;  4YWM A;  4DFA A;  3KF6 B;  4KHP L;  2LXJ A;  2F0E A;  2EPB A;  2IW3 A;  3CCJ A;  1XYI A;  1VQD A;  4LJZ C;  1C8C A;  4OWW B;  1SYB A;  5FO7 B;  1M4V A;  1C9O A;  5CR3 A;  3E9H A;  4NPS A;  1TY2 A;  4N9T A;  1VQL A;  4OIJ A;  2RF4 A;  5BR8 Q;  1LTL A;  3Q6S A;  1BVS A;  1SAP A;  4DV6 Q;  2WV6 D;  3HOU H;  3JAM c;  4ME3 A;  1CT1 D;  4ZYS A;  2B63 H;  3PUV A;  4JI0 Q;  3KK7 A;  3BDL A;  1XTD A;  4A4I A;  4CDD C;  3T56 B;  3GTG H;  4DV3 Q;  1HA6 A;  1YEZ A;  1VQG A;  3C1E A;  4NXM Q;  5ELD A;  5C4X H;  5KIX A;  2R92 B;  1HR0 Q;  4RGM A;  3ULL A;  3KJO A;  1K73 C;  4NXN Q;  3MXN B;  2CHB D;  2NN6 I;  1PA6 A;  1JMC A;  1FJG L;  1AN8 A;  3OYY A;  1OXT A;  3D0F A;  4IFD I;  1LTG D;  3TP5 A;  2V4D A;  1E2Z A;  3GTG B;  4UDU C;  2A6E D;  2IJ0 A;  3S1N H;  4JI6 Q;  1SRU A;  4OON A;  5J22 A;  2F0P A;  4QJF A;  1FNV A;  4G7Z C;  2UXB Q;  2K04 A;  2EZV A;  1EFI D;  3DWQ A;  3ERO A;  4KY5 A;  1Y1V G; 
#chains in the Genus database with same CATH homology
 2IWH A;  1DCZ A;  1KTK A;  1STB A;  1LV9 A;  5CBE E;  3K6O A;  1RTN A;  1KDB A;  2B2Y A;  4ZUI A;  2EYH A;  5IGC A;  1EU3 A;  3E6Z X;  5BN3 A;  4U68 A;  1I4Q A;  4FF4 A;  2RSN A;  1Z6H A;  1ZYR D;  2IL8 A;  2F0L A;  4J8Q A;  3K5N A;  3T53 B;  2QDB A;  2NVX B;  4A3D B;  1KAB A;  2AWN A;  2ENB A;  4K2L A;  1LT6 D;  2TMP A;  2B8F A;  4FF2 A;  2NTT A;  2AUK A;  3I4L A;  4IUR A;  3QWN A;  3GTM B;  2R93 B;  1OO9 B;  3IAY A;  2PW5 A;  2RSO A;  2F0J A;  4ZRZ A;  1KLU D;  2RVL A;  1JIC A;  4JK1 C;  5DEH A;  1FGB D;  1H9R A;  1SYG A;  3I8Z A;  3K58 A;  2C5C A;  1I4R A;  4K8J A;  3GTQ B;  1QG7 A;  1EY8 A;  2RDG A;  4DXF A;  2B2T A;  2EY6 A;  5JOB A;  2EY1 A;  4RGO S;  3HG9 A;  2JA5 B;  4X3T A;  4Z9C B;  1U4L A;  1EU4 A;  1I50 B;  3QOJ A;  3MEH A;  1RF2 D;  3H6M A;  5IGD A;  4IAL A;  1L0X B;  3NQI A;  1VMC A;  2EYL A;  2NVY B;  4R9W A;  3TDQ A;  3VA7 A;  1TWF B;  3MTS A;  3I73 A;  1AZP A;  2HCI A;  1G91 A;  5I2Y A;  3C3L A;  2J0T D;  5FKA C;  1MSH A;  4P2C B;  1WTX A;  3QO2 A;  1PTO B;  5HUR A;  3G7L A;  3HRZ C;  3Q22 A;  1SNM A;  2L4N A;  1TY0 A;  3HOW B;  4PV1 C;  1BCP C;  2XWJ B;  3H09 A;  2WAC A;  1SJH D;  4O1N A;  2F0G A;  3KUP A;  5E3F A;  2KJX A;  1KNA A;  1TR5 A;  1EYC A;  4FF1 A;  4OO1 H;  3A55 A;  4MN3 A;  2A6E C;  1SDF A;  1S5F D;  1WTW A;  1D5X C;  2M9V A;  1F2Y A;  1SSO A;  1LLR D;  2Z4I A;  1STE A;  3I70 A;  3DXJ C;  1WTR A;  1CK1 A;  1EOT A;  5KYI A;  2ZXR A;  2SOB A;  3A7L A;  1PZJ D;  2GA4 B;  2F0W A;  4BS9 A;  2D62 A;  2KOL A;  4KTA A;  4FP5 D;  2F0O A;  2F0I A;  2ID0 A;  3K57 A;  3J81 E;  3PO2 B;  2A69 C;  5CV8 A;  3OMG A;  4A3K B;  1GUS A;  5KEE A;  2RDF A;  3PUY A;  4FF3 A;  1NAP A;  4KY6 A;  1EQV A;  3J80 L;  4EQP A;  2XWB B;  5IOC A;  3HKZ B;  4DK0 A;  2PW7 A;  4RCN A;  1H9J A;  1JCK B;  1EY7 A;  1YNN C;  4ZK9 B;  2R6G A;  2K6A A;  4C3H G;  2MJ8 A;  1WTO A;  1QB5 D;  4OIK A;  4L6T B;  1GUT A;  4QMG A;  1TS2 A;  1U9R A;  1WD0 A;  5A35 A;  1AZQ A;  1G2T A;  3VR5 A;  2HDM A;  4IQZ A;  1V8Q A;  4RH6 A;  3AMU A;  5KYL A;  5IT9 E;  3CHB D;  3JAM E;  1D6E C;  4DF7 A;  2F4I A;  5FOB B;  4BWG B;  4RHR A;  1ENF A;  1LTR D;  1PFM A;  4OGQ C;  1AW7 A;  2EXZ A;  1EIH A;  5IGE A;  1S5B D;  1SE4 A;  2H4O A;  5IIF A;  1VF7 A;  1X32 A;  3G6J B;  5FK9 C;  1TII D;  1DZ1 A;  2BDO A;  3RD4 A;  1DYQ A;  4PMW A;  3MXG A;  3IL8 A;  3T13 A;  2B2W C;  4J1M A;  1UEA B;  1TVX A;  3R2T A;  2A6H D;  3KLR A;  1JWM D;  4BBR B;  2KCN A;  2IT1 A;  5FO9 B;  2EDG A;  3SXH A;  5DAU A;  3JAM L;  3RMH A;  4IZ8 A;  2EE1 A;  1OXS C;  4CJ0 B;  5ISR A;  2BE5 C;  1XX8 A;  2G9D A;  3GD7 A;  3EFX D;  3O13 A;  3MC0 B;  1A15 A;  5EPJ A;  2BE5 D;  1QCB D;  1R4P B;  3K7A B;  1JOR A;  4PMB A;  1B9M A;  1I6H B;  1B4O A;  1IYV A;  2IX0 A;  5A2Q E;  2QEJ C;  4V19 0;  1EEF D;  2EYJ A;  3W3A A;  5BN4 A;  5IGG A;  1WCM B;  4HMI A;  1W6K A;  2LMC B;  1LTA D;  1DXM A;  1HQM C;  4E6I A;  1GJX A;  1E2V A;  4KMU C;  1BNZ A;  3BDC A;  1HQR D;  2D5D A;  1HTP A;  2PNR C;  2XVS A;  5EKI A;  1JOO A;  5HGT A;  2B39 A;  2K5Q A;  2B63 B;  1PLF A;  1YNN D;  2OXP A;  3C2P A;  3TBI B;  1V1P B;  4IUU A;  2N88 A;  3FDT A;  4FVM A;  1FYC A;  1A3V A;  2FHT A;  4C3I G;  2OEO A;  2L0C A;  5M9O A;  2F0S A;  2KVM A;  1V43 A;  5EKK A;  1IHZ A;  4C1N K;  3MA2 B;  4F87 A;  3FEW X;  3AB9 A;  3D31 A;  2YU9 B;  1AEX A;  4DAY A;  1JB3 A;  4Q5V A;  3N6R A;  1IW7 D;  4CBV A;  2EY5 A;  3P1H A;  1VCI A;  3P7J A;  1GXD C;  4K5X A;  5CV4 A;  3NBI A;  3LX0 A;  4KKS A;  5ELE A;  4KK7 A;  2K03 A;  1BUV T;  3WOF A;  4I65 A;  1SYD A;  3L3O C;  1IYU A;  5IGB A;  1HHV A;  1SND A;  2O2L D;  4BA2 I;  1MD2 D;  5D3D A;  1Q3L A;  3M4O B;  4FXD A;  3PV0 A;  3S9W A;  3HOY B;  2E2D C;  2A6H C;  4RKB A;  4A3F B;  2BCO A;  3X3N A;  1I4G A;  1ENC A;  1PFB A;  2E2H B;  1BCP B;  5D65 A;  4KKT A;  5F2D A;  3U9O A;  1I4H A;  3MZ5 A;  3U9S A;  3R93 A;  2EYF A;  5LHY 1;  3C46 A;  3NBH A;  3FVQ A;  1MBY A;  4KJN A;  1BCP F;  4K2K A;  2E2I B;  2J7Z A;  2RQX A;  2NZ1 D;  2EOT A;  1D1I A;  2O5J C;  4FXG C;  1PTO F;  1KDA A;  3S1M B;  3Q0A A;  3KF8 A;  1BXT A;  3BG3 A;  2R7Z B;  1B3A A;  2R61 A;  5M5X B;  4NW2 A;  2LFN A;  3VYT A;  5JEA J;  1EY4 A;  2ZXO A;  4KHZ A;  1IKM A;  1DD2 A;  2O5I C;  2B2V A;  3GTO B;  5CV6 A;  4LAA A;  3WOE A;  2M00 A;  1TQO A;  1T5E A;  5ELB A;  4KN7 C;  1WTV A;  2F1M A;  1PZI D;  2K5D A;  2E74 C;  2SNS A;  5KNB A;  1ZKO A;  3E5S A;  4F7X A;  1I3Q B;  5EPK A;  2C9O A;  4TQU S;  4RWS C;  4QUF A;  2EJM A;  1GUW A;  1QNU A;  4IFD H;  1V1P A;  1XWE A;  2MHV A;  4LK1 C;  2XSC A;  1EYA A;  2A74 C;  4L8J A;  4B9X A;  4HMJ A;  1BF4 A;  2F03 A;  1X3P A;  4DXG A;  3OWF A;  2DY7 A;  1K8O A;  3S2H B;  1TWH B;  1ILQ A;  1EWC A;  3BS1 A;  3RUZ A;  1V1O A;  1B53 A;  1PYW D;  4R8N A;  1B44 D;  1Y69 U;  3A56 A;  1PFN A;  2BDN A;  1LT4 D;  4QF4 A;  3TZU A;  1DJR D;  1RTO A;  3ND9 A;  2SEB D;  2F0N A;  4KN4 C;  2JEB I;  1EL0 A;  4H0L C;  1STG A;  1TU2 B;  1CTM A;  4C3J G;  5CMD A;  3S15 B;  3EA6 A;  4QUC A;  4HR7 B;  1I4X A;  1NCV A;  2SDF A;  1SNQ A;  4HTH A;  5C0X H;  4C2M B;  4C3H B;  3NQT A;  4K8I A;  4TKO B;  3J80 E;  3H91 A;  5CV5 A;  4KY7 A;  4RAU C;  5D14 A;  3C1F A;  2JEA I;  2HQE A;  5FLX E;  4XYO A;  5CYU A;  4IUT A;  4C56 C;  2RDH A;  4BA1 I;  5C3E B;  5I9P A;  1UAP A;  4A3B B;  1II3 A;  4O42 A;  3GP7 A;  5LL6 X;  3VYU A;  2FIN B;  3H94 A;  2FFK B;  2L55 A;  3K5O A;  1C4Q A;  4RA8 A;  4XQQ A;  4KHV A;  3OOC A;  1D1K A;  3HGB A;  3I90 A;  4CJ2 C;  2QCP X;  3OHX C;  1SE3 A;  3MXN A;  3S17 B;  3OSO A;  3J7A V;  3MFG A;  3ND8 A;  5C5L A;  5C5M A;  1JQY D;  3D6C A;  2X69 A;  2WAQ B;  1S5D D;  4WOR A;  3A8K E;  5DNF A;  2B2U A;  3CRL C;  3P20 A;  4ME5 A;  1BBX C;  1SYE A;  1GHK A;  3MFY A;  4ID6 A;  2XRQ D;  5T1I A;  5T1G A;  4CHT B;  4R8I A;  4RGT A;  3MAQ A;  1TWG B;  1KDC A;  1LTS D;  2VB3 X;  1LT3 D;  3UI2 A;  2CW0 D;  4QB4 A;  1B9N A;  3J81 L;  4RHS A;  1JC7 A;  1YNJ C;  1PRT C;  2I07 B;  3PUW A;  4XIG S;  2VNU D;  4ABN A;  3KBX A;  4KJO A;  2D9U A;  1KAA A;  4PQX A;  4DAP A;  1RHP A;  2KED A;  3RZO B;  3MXU A;  4PMC A;  1GUO A;  2ICE C;  3S1N B;  2JYO A;  2A69 D;  4XT3 B;  2NVQ B;  5TSS A;  1ESF A;  4HSV A;  4OO1 G;  2CQA A;  4H13 C;  1SYC A;  4RKL A;  3RLF A;  1IL8 A;  1A6X A;  2AQ3 B;  1EIG A;  1DOL A;  1HUM A;  2OT2 A;  4K14 A;  5D3I B;  2RKS A;  4DK1 A;  1BDO A;  3PO3 B;  2Z4H A;  3LWE A;  1TS5 A;  4CKB A;  3NE5 B;  2K05 A;  2F0T A;  2A68 C;  3HOZ B;  1PZK D;  5FLX L;  5M3M B;  3ONA B;  1A2U A;  4ZAI A;  3SK6 A;  1Y1V B;  1QE6 A;  5EPL A;  2B2T C;  2YYZ A;  3V05 A;  1QOH A;  3ZYY X;  3BDO A;  4DGZ A;  3TZD A;  2WIN B;  1UUP A;  4C3J B;  3K0Y A;  3OMC A;  3S14 B;  1SNP A;  1LTI D;  1ET6 A;  4J6H A;  4HCE A;  1QJO A;  4FNF A;  3SHL A;  3DEP A;  1H9S B;  2BA0 A;  3NK9 A;  3T4A C;  1FD7 D;  1SXT A;  5JPN C;  4X3K A;  3SK5 A;  5I6W A;  3FPU B;  1SMY C;  5M5W B;  3GQB A;  2A73 B;  1VMP A;  3V2T A;  3M3Y B;  4CJ1 B;  5JPM C;  1SMY D;  2QIL A;  5JVG 3;  1AP0 A;  1JOK A;  2F0V A;  1HXY D;  4NP5 A;  4UAI A;  1NUC A;  1F2M A;  1DON A;  3GTJ B;  5K36 H;  1B50 A;  3VR2 A;  3TP8 A;  5I4D A;  3Q24 A;  1F2Z A;  4ZUJ A;  2PO4 A;  4EVO A;  5C4Z A;  4DN4 M;  3H3V C;  3VYS A;  3MHB A;  3BVM A;  1OXX K;  1R4Q B;  2PYK A;  3KLS A;  3R2I A;  2B2W A;  4F88 A;  1Q1B A;  1FR3 A;  4ZKC B;  1PTO C;  3AU7 A;  4TRD A;  2DN8 A;  2TSS A;  1S4Z A;  5EKL A;  5J39 A;  3NWT A;  2EJG C;  2DNC A;  2BA1 A;  3ERQ A;  1STH A;  1B1Z A;  2KHS A;  3NXW A;  1H9K A;  3BYY B;  1HCZ A;  2B8G A;  4C3I B;  2MUY A;  1STY A;  4EQN A;  3TN2 A;  2XIW A;  1QIL A;  2NN6 H;  5COY A;  2EY2 A;  3EJI A;  4NDX A;  1CHQ D;  1SYF A;  3EVQ A;  3CKI B;  2AWO A;  4A3G B;  4XDX A;  2Y0S B;  4IUN A;  3MXP A;  4BY1 B;  2NN6 G;  2PQE A;  4WFN 3;  2X6L A;  3DEO A;  2A68 D;  4PNY A;  3VR4 A;  1STN A;  1LAC A;  4ILW A;  4G7H C;  1TWC B;  3IKJ A;  3BZD B;  1M8A A;  2PPB C;  2H1E A;  4F8M A;  4HN7 A;  3GO5 A;  1X3Q A;  5C3W A;  3D8G A;  3R8B A;  3M7N A;  1IW7 C;  5C4H A;  3I4N B;  4QCL A;  1UNS A;  4KD3 A;  3QJY A;  1K83 B;  5KRU A;  1EYD A;  2PZU A;  4DNT B;  2X6G A;  3BVG A;  3D4W A;  4XTC S;  2BOS A;  1K8M A;  4XT1 B;  2K33 A;  2EJF C;  2NVT B;  4DU9 A;  3CRK C;  3SEB A;  2F0H A;  1F9P A;  1H9M A;  2IX1 A;  4YIJ A;  4OO1 I;  3DM1 A;  1CQF A;  4DAV A;  5K36 G;  2CVR A;  3HS0 C;  2JSO A;  1EZ8 A;  3HZX A;  1J9O A;  2KQ3 A;  1CHP D;  1RDP D;  1CA5 A;  4G4K A;  4G57 A;  1G8Z D;  1F2L A;  3NWS A;  4Y7N B;  4K6L A;  3P75 A;  3PIP 3;  4RCO A;  1PXU A;  1F9S A;  3HOX B;  3X3M A;  4U67 3;  1JOQ A;  3A7A B;  5K5P A;  2MP1 A;  5E1F A;  1CI3 M;  1O7Z A;  1O7Y A;  3NTK A;  2Q8T A;  5A2Q L;  5KGU A;  4C1N I;  1L0Y B;  2PZT A;  2F3V A;  5C3X A;  1A2T A;  1T5X D;  2WKD A;  2WP8 J;  1MGS A;  3PUX A;  3I4M B;  3GTP B;  4WJW A;  1GUG A;  4K5V A;  5IGF A;  2HCC A;  1S5C D;  4QIW B;  2IPK D;  5ELF A;  2MGS A;  1PTO D;  2QKI C;  2PCF B;  1OXV A;  1ROD A;  2L1B A;  1H9S A;  1TWA B;  5G3L F;  1LTT D;  1Z47 A;  3QG1 A;  4OHJ A;  3M4Y A;  3SVM A;  1U4P A;  3SR1 A;  2I46 A;  1TS3 A;  4L63 B;  1SE2 A;  3QIA A;  2NUC A;  5COR A;  3OW7 A;  3DUZ A;  5C44 B;  1A3U A;  3T16 A;  1CZG A;  1LAB A;  3ITP A;  2HUG A;  4IFD G;  1CFM A;  1PDQ A;  2NYZ D;  3MWY W;  5EBC A;  3VYR A;  4RFB A;  1ET9 A;  1AFP A;  3M7G A;  1J8I A;  3EQL C;  1R9T B;  4CKE A;  3E0J A;  5M3F B;  3K59 A;  1XTC D;  3GTK B;  1PTO H;  3TP7 A;  1NSN S;  3TME A;  5KND A;  3Q23 A;  5BN5 A;  3OPO A;  1ESR A;  2LS0 1;  1QNK A;  5JVH 3;  2L11 A;  4B08 A;  1TKW B;  5EBD A;  1ZXT A;  2ZT9 C;  4ZKB B;  4HAE A;  2KCC A;  1RKN A;  1ICW A;  1D5Z C;  4A3M B;  2NWG A;  1MSG A;  5C0X J;  1E0B A;  2F0D A;  1ZYR C;  3QOL A;  1WD1 A;  2LKV A;  4A93 B;  2E2J B;  3TP6 A;  2AQ1 B;  4S3S A;  2J4X A;  3SK4 A;  3GV6 A;  4ZQ3 A;  4MIU A;  1O7L A;  1Y1W B;  4HED A;  4NMZ A;  1Q1E A;  3A8J E;  3N52 A;  4LMQ D;  1SEB D;  1JWS D;  1LO5 D;  4JBW A;  5C4J B;  4IUV A;  4FYD A;  4FXK C;  2WB1 B;  1ENA A;  3NTH A;  1PMR A;  3D6W A;  1Q12 A;  4NKL A;  3VR6 A;  1JE4 A;  1HRJ A;  1A3T A;  3D4R A;  2M2L A;  4I7Z C;  3NTI A;  3PUZ A;  1F9Q A;  2EYO A;  2SNM A;  4IN3 A;  3NHH A;  3FKI B;  1BCP D;  1BR9 A;  5C0X G;  2F0K A;  2LY7 A;  3VA5 A;  2K1B A;  4M1U B;  2K32 A;  1HTL D;  4KKU A;  1S5E D;  2KEE A;  4A3I B;  3LNN A;  1NR2 A;  2DY8 A;  2A5H A;  3FPP A;  3HOV B;  5CGK A;  1C48 A;  2JA6 B;  2FJ2 A;  2N55 A;  2F0U A;  4H7B A;  1CQV A;  1VDZ A;  3OWE B;  2NTS A;  1EY5 A;  3KBG A;  2B2U C;  1KLG D;  1XXG A;  3NPP A;  1BO0 A;  1I4P A;  3WDN A;  1WTP A;  1EWH A;  3D4D A;  2D2C C;  2B2Y C;  3IFD A;  1U4M A;  4DNR B;  1EY0 A;  3SK8 A;  5M5Y B;  4H44 C;  4X3S A;  1F77 A;  1LT5 D;  4FO2 A;  2NBF A;  5EGT A;  2XNA C;  1Q8I A;  3DWA A;  4CGY B;  3PMF A;  5EJW A;  1EQT A;  2HDL A;  4ZLT F;  2JE6 I;  1FNU A;  3W2D A;  3DWP A;  2FMM A;  3GV3 A;  2JA8 B;  1Q90 A;  2NB0 A;  2KEC A;  2Q8I B;  2IX3 A;  3CU7 A;  5ELC A;  3FRP B;  4ODG A;  1Z7T A;  3J7A F;  2VB2 X;  3A54 A;  2KUM A;  5DM6 3;  1HPC A;  2L12 A;  4XXE A;  1RD9 D;  5JEA G;  2QF7 A;  2EVB A;  1HUN A;  1ONL A;  2Z8L A;  5LL6 S;  2K28 A;  1W6J A;  1DOK A;  2L9H A;  1CA6 A;  1QWY A;  2VUM B;  2G9H D;  2RBM A;  5KNC A;  5JAV A;  2ZXP A;  1EEI D;  1CZW A;  4B9W A;  4HSP A;  1JR0 D;  3BVZ A;  5I9O A;  4WRD A;  3S2D B;  3SE0 A;  5I6Y A;  1WTQ A;  1NR4 A;  1FNW A;  4IUP A;  2RA4 A;  5C0X I;  1G6Z A;  5CV9 A;  3R3O A;  4RGN A;  4KV6 A;  1LTB D;  1SJE D;  5CV7 A;  2PMZ B;  1SNC A;  1G2S A;  1O78 A;  2ICI A;  2F3W A;  3M85 A;  2K7V A;  1MI2 A;  5AFW A;  3T51 B;  1HA5 A;  2AUJ D;  1F9R A;  4XYQ A;  5EQ0 A;  4GZY C;  3BYT B;  4KD4 A;  3I3C A;  3VR3 A;  1B2T A;  4M8A A;  2O4X A;  2JA7 B;  1GUN A;  1ZEQ X;  2R3Z A;  1HFN A;  5I2X A;  5JJZ A;  3QB3 A;  1DOM A;  1Y8O B;  1EY9 A;  5E4X A;  1TS4 A;  1CM9 A;  1VF5 C;  3H0G B;  1ILP A;  1SNO A;  2EYP A;  3CQZ B;  1OXU A;  1Y8N B;  2E75 C;  1GOZ A;  3RZD B;  3S1R B;  2JP1 A;  4ULL A;  1JWU D;  1RCV D;  2F0Q A;  4EQO A;  4TSS A;  3V96 A;  2OF1 A;  3PIO 3;  3K5M A;  5J1Z A;  5G3L D;  4OL7 A;  4XQJ A;  3HP3 A;  3NP8 A;  4IUQ A;  4BBS B;  1SBB B;  3HOU B;  5CBA E;  1HFG A;  4XQN A;  1D2B A;  1RJT A;  5IOD A;  1G29 1;  3I91 A;  5C6A A;  2FMC A;  2WII B;  4V0B A;  2AQ2 B;  1IKL A;  3GTL B;  2XRS D;  3S16 B;  3TSS A;  1WVL A;  2F0M A;  3A8I E;  3K5L A;  3DMU A;  4CKC A;  5IT9 L;  3SDZ A;  2DNE A;  1STA A;  4G7O C;  2E76 C;  1O80 A;  3MVV A;  3OIQ A;  2CW0 C;  3D3R A;  5NUC A;  2L5T A;  1DM0 B;  1TT2 A;  3S1Q B;  1PRT D;  1BOS A;  1GHJ A;  5JEA H;  2K01 A;  1ML0 D;  1I6V C;  2JXM B;  2MPM A;  3I72 A;  4BY7 B;  1SFO B;  3HEJ A;  4A3J B;  2PZW A;  3L9A X;  5E4W C;  5FO8 B;  4K5W A;  5C4X B;  4AYB B;  1E2W A;  5DM7 3;  3L7Z C;  2Q8R E;  3OIP A;  3NUC A;  2KA7 A;  4HCS A;  4A3E B;  3NSW A;  4Q0F A;  2VXW A;  3LWU A;  1PRT F;  1PRT B;  2EYM A;  1Y8P B;  4EGV A;  5CC4 A;  3FMC A;  1BQQ T;  2K5W A;  2XN9 C;  1EY6 A;  2WKC A;  4K6D A;  3URY A;  4IFD J;  2Z1C A;  1U4R A;  4MHE A;  4X3U A;  4DA2 A;  3IFT A;  1YNJ D;  2B2V C;  3J7Y W;  1KNE A;  2F0F A;  4N9P A;  3DHQ A;  4KI0 A;  1D5M C;  3F2U A;  3KLS X;  1EZ6 A;  4DFA A;  2F0E A;  2EPB A;  2IW3 A;  1XYI A;  4LJZ C;  1C8C A;  1SYB A;  5FO7 B;  1M4V A;  5CR3 A;  1TY2 A;  4N9T A;  4OIJ A;  3Q6S A;  1SAP A;  2WV6 D;  1CT1 D;  4ZYS A;  3PUV A;  3KK7 A;  3BDL A;  3T56 B;  1HA6 A;  3C1E A;  5ELD A;  5KIX A;  2R92 B;  4RGM A;  2CHB D;  2NN6 I;  1AN8 A;  1OXT A;  4IFD I;  1LTG D;  3TP5 A;  2V4D A;  1E2Z A;  3GTG B;  4UDU C;  2A6E D;  2IJ0 A;  5J22 A;  2F0P A;  4G7Z C;  1FNV A;  2K04 A;  2EZV A;  1EFI D;  3DWQ A;  3ERO A;  4KY5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...