4P2CB

Complex of shiga toxin 2e with a neutralizing single-domain antibody
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
ADCAKGKIEFSKYNEDNTFTVKVSGREYWTNRWNLQPLLQSAQLTGMTVTIISNTCSSGSGFAQVKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Shiga toxin 2e, subunit A
publication title The Molecular Mechanism of Shiga Toxin Stx2e Neutralization by a Single-domain Antibody Targeting the Cell Receptor-binding Domain.
pubmed doi rcsb
source organism Escherichia coli
total genus 20
structure length 68
sequence length 68
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2014-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4p2cB00
3MXGA 2XSCA 2GA4B 4M1UB 1BOSA 1CZGA 4P2CB 2BOSA 1C48A 1C4QA 1CZWA 1QNUA 1CQFA 4ULLA 1D1IA 1DM0B 1QOHA 1R4PB 1D1KA 2C5CA 1R4QB
chains in the Genus database with same CATH superfamily
1RTOA 1PYWD 1OXTA 4CHTB 4GZYC 4E6IA 5FO8B 4A3LH 1AEXA 1K8MA 1G2TA 2RBMA 5IWAL 4LFBL 1TWHB 4RGNA 2OTLA 4Y7NH 4RCNA 5C4JH 5IGFA 4X65Q 3M7NA 2RDGA 1MKHA 4DR5L 3AMUA 3S9WA 4GLAC 1I94Q 5GADC 1CKNA 5EBDA 4FF3A 1SYFA 1KRSA 3S1RB 4A3CG 2NVXH 4F88A 2CW0C 3ER0A 3MXGA 1MIUA 3D4WA 1SYCA 5C5MA 2B2VC 1F2ZA 2NZOA 2PZTA 1BVSA 5M9OA 4DFAA 1J8IA 1TIID 1OXUA 2PQAB 1HHVA 1PTOD 5IYDG 4EQOA 2OXPA 4DNIA 2JA8G 1YBYA 3E9IA 1UEBA 1T5EA 1Z47A 1D6EC 1JICA 2BH2A 4R4CA 3HOUG 4DV4Q 3CQZB 1R4QB 1BBWA 1BCPC 3DEPA 2G9DA 2AUKA 4V190 3PSIA 3I3CA 4QIWE 1S72A 4IUVA 4F8MA 2GVBA 2A73B 4A3MH 2D9UA 4C56C 4DV0Q 2ES2A 2ALYB 3TS2A 4FXGC 1G8ZD 3OSOA 3ULJA 2VUMB 3KF6B 1BQQT 1N9WA 5CV8A 3GP7A 3NBHB 2QA4A 4ZQ3A 3I4LA 3QIAA 1LTTD 3I2ZA 3DMUA 5GAGC 2EQSA 1BOSA 4C3IH 4RAUC 4LFAL 3HKZB 4QJFA 4N9PA 3A7LA 1M1KC 4IPCA 2DGYA 4EQNA 1WTHA 4HAEA 5IP9H 1IBMQ 5ELCA 5E7NA 4A3EH 1EIHA 2ASBA 2F0QA 1XXGA 2MUYA 1VQNA 3J80E 2RHQB 5FKAC 1UE1A 3CCEA 2F3VA 1EUJA 2UUAL 2I5LX 1ZKOA 3F2DA 2YU9H 4KHPL 1GO3E 3L2PA 2ZXPA 3CCUA 4ZYSA 1C4QA 2OCEA 5IT9c 4JI0Q 5IGCA 4GOPA 1VDZA 1W6JA 1LLRD 3U9OA 4RKBA 3OIPA 4H02A 5DM63 5M5WH 1HNWQ 3CC4A 2R93B 1YI2A 2R7ZH 5M3MG 1RODA 1KRTA 1DGSA 2AQ3B 4ME3A 1SR3A 1I5FA 1JQYD 1V1PA 5C3EG 4ZUJA 2L12A 2QGQA 2Z9HA 3HOXH 1O7IA 3T1YL 2E5LL 4GN3B 4POGA 3PV0A 1DOKA 4PZ8A 1F2MA 2BA1A 2K01A 4YHHQ 1WTWA 1O7ZA 5G3LF 4BS9A 5K36G 1SNQA 4LF5Q 1M90C 1CTMA 3FDTA 1BXTA 2BE5D 4DK1A 3S17H 2MO0A 4DUZL 5IE8A 4BXXG 4POFA 3Q23A 3EQLC 5JEAJ 3CAMA 2WV6D 1JWSD 4NP5A 4RG1A 3GO5A 2B2TC 3J7YW 1DM0B 1TU2B 4A3IH 1GOZA 1SAPA 4CBVA 5EGTA 2PQEA 1LTID 4G57A 1TS5A 2A69D 1ESRA 5E4XA 1D5MC 1PRTF 3TRZA 1TVXA 2BDOA 3A56A 4JI1L 4JYAL 1EQQA 4B3SL 4OO1I 3D8GA 3A5UA 4B3RQ 3NQIA 3JAME 1AFPA 1C9OA 4UPAA 3AB9A 1E2WA 4LF8Q 2J0TD 5FLXL 1HNZQ 2EZVA 1EY0A 2L55A 2JA8B 1CKNB 1Y14B 2ZT9C 2UUCQ 3I4NH 4DR4L 1WI5A 2VQEL 1A3TA 1DONA 3M4QA 3KLWA 1PFSA 4FDBA 2K5NA 3QR8A 4KMUC 3S14B 5C5LA 4JBKA 3CMAA 2K5QA 1K83H 1XJVA 4YCWA 1WTRA 3PUXA 2K4KA 5M5YB 4YWLA 1Q82C 1E2VA 1FNWA 2Z6KC 1E0BA 4DA2A 2J4XA 5AJ3L 2UXDQ 3DUZA 3U4VA 2A19A 4BY1B 2HQLA 1EY4A 2NVYB 4PV1C 4K0KQ 1X54A 5FLXc 2R6GA 1RTNA 3K5MA 1SRUA 2F4IA 2EY2A 3A5ZB 1LT5D 1XPOA 3D4RA 3FKIG 4A3GH 4JI3Q 2F0FA 4O2DA 4GKJQ 3HEJA 4QUCA 3GTOH 5IGEA 4TSSA 4UDUC 2EYOA 2BCOA 3CPFA 4GS3A 2XIWA 3TP8A 5A2QE 4P73A 5BN3A 3ERSX 1PRTB 4DR6Q 3PUWA 4DNTB 3CMEA 2Q2UA 3K59A 2M00A 4X62Q 1NBWA 5JJZA 1BNZA 1FJGL 1K8OA 4IJHA 3R2TA 2A68C 2VQFL 1C48A 5M5XH 2N49A 4DAMA 3K5NA 4FF2A 3TN2A 1AW7A 1IKLA 2E2JH 5IP7H 5CV5A 4FYDA 2VXWA 3AFPA 1KIXA 1UAPA 1N33L 4HN7A 4L5QA 4LNQA 4MIUA 1GUNA 1SEBD 4A3BH 1XMOL 4YY3Q 2F4VL 2UXBQ 1IW7D 3JC66 2F0HA 1VF5C 4ZAIA 1XNQL 1Y1WH 2SOBA 2JA7B 2IY5B 1MSHA 2X69A 4DK0A 1MI2A 1Y1VB 1G291 1XMQQ 2XVSA 3H3VI 1NY4A 1EQVA 4IUQA 4A75A 4HSPA 1EWIA 3HOVH 3J81j 3MHBA 4XT1B 4JI6Q 4RGTA 2X6LA 3QOLA 2Z8LA 3UE0A 2JA5B 3RNUA 2EIFA 1UEAB 1M8AA 3HOZG 1HFNA 1YNJD 5IYBH 1VS0A 3I73A 1KABA 1GJXA 3U50C 1SYBA 4WJ3M 2I5HA 2EYHA 1L2FA 1LT6D 4BBSB 3P7JA 5C44G 1LTAD 3NWSA 1QE6A 4ZKBB 3PUZA 4KV6A 2Q8TA 4IUPA 3HGBA 3M85A 1A2TA 1N34L 1HR0L 3PIO3 3J81L 4LF9Q 2VNUD 2L5TA 5G3LD 2WB1B 4HJ9A 3J81i 3MVVA 3F1ZA 3VYRA 4AYBB 4UP7A 1UE6A 4JI4Q 5EPJA 4LF4Q 1I4RA 4JI2L 4NXML 2CFMA 3VR5A 3M4OB 2VB2X 5FLMG 4TQUS 4CDFC 3RLFA 1GXDC 1PMRA 1RD9D 3S1NH 3KLSX 1P8LA 2NZHA 2Z4HA 1VQFA 3A8KE 2UUBQ 1B9MA 3LGJA 3VR2A 2UU9Q 3J81c 3W1BA 1PRTD 2EYLA 1E22A 1QVCA 1VQBA 3K7AH 2PNHA 1TWFB 1VMCA 3GTMB 3CKIB 1G6PA 2ZM6L 4JI7Q 3ND9A 2JP1A 4EQPA 1CHPD 2R92B 1G51A 1IZ6A 1L1OA 3LX0A 2KENA 4DR2Q 2B2YA 3IFTA 4WJWA 4K2LA 1VQMA 4HCEA 4BY7G 4LF6L 1X6OA 3GTJB 4TVAB 2L11A 4DR1Q 1EY8A 4DPGA 1IL2A 1OXSC 1EY7A 1PXUA 1A3UA 1SMXA 3N52A 4BBRB 1V1OA 2PQAA 1YJ9A 3C1FA 1UNSA 5IOCA 3RR5A 5E4WC 3PO3G 1ZYRC 1LACA 1Q7YC 4N8FA 4LJZC 1R9TB 4R8NA 5GQOA 5LMUQ 4KJNA 3GTGH 3BJUA 2GA4B 4DV6L 3X3MA 1MBYA 1PHJA 5FJ8G 3K0YA 4JPBW 2B63G 3K0XA 3HOYB 5M3FH 4C3JH 3M4PA 2EXZA 5LMNW 1HRJA 4CKEA 5ELEA 1JJGA 3RZDH 4EGVA 5J22A 1AZQA 1HZAA 4A3FH 2RVLA 1ILQA 2I07B 1Q12A 1J5EL 1B3AA 4UAIA 2IT1A 3PF5A 2YTYA 4KTAA 3U4ZA 2RF4A 3NBHA 3MFGA 1VCIA 4OWTB 1YIJA 5D3IB 2AUJD 1CHQD 4AH6A 1CZGA 4ME5A 1GUOA 3HP3A 1A6XA 2EXDA 1Q90A 2F1MA 4EVOA 4LFCQ 1X3EA 2K1BA 3BDLA 4DAVA 2K6AA 4JW0A 4WORA 2L4NA 1EZ8A 4P75A 4KD3A 1J9OA 4DNRB 3TP6A 1GHKA 3S2HH 1HZ9A 3W3AA 3PO2H 1B9NA 5IWAQ 2RDHA 4JI5L 4JBWA 4JI8L 5C6AA 2K14A 3TP5A 5IT9E 3T51B 2XTIA 1PFMA 4ZLTF 1SROA 5JJKA 3DEOA 3SE0A 1LTLA 2NBFA 4RFBA 1BCPF 2UXCL 1VQPA 1UWVA 2RCNA 5C44B 4LF7L 1QOHA 5IGGA 1HFGA 4OHJA 2IHFA 1FGBD 2F0WA 2KECA 4Y7NB 1YEZA 4ODGA 3KFUA 1JE4A 1PH6A 1LO5D 2DNEA 2SDFA 4XT3B 1QWYA 1A8VA 4GNXC 1O7YA 3MA2B 1XPRA 2NYZD 2NVXB 2D0PA 4N9TA 3E0EA 2QW7A 4ZKCB 1TWGH 1TY2A 1VQ8A 1G6ZA 1SXTA 3G71A 3HKZE 5EJWA 5BR8L 1TXYA 1PH4A 1FD7D 3I8ZA 3VYTA 5TSSA 2Y0SB 2N78A 3FEWX 5KGUA 4AQYL 3TMEA 2E2IH 4IPDA 2OQKA 3Q6SA 2QDLA 4I7ZC 1JB3A 3C2PA 1H9MA 1L0YB 1SNCA 5D14A 5IYCH 5HY6A 4C3HH 1I4QA 3S16H 5FO9B 1BBXC 1XNRQ 3RN5A 4G7HC 5C0XG 4KHVA 1ENFA 4A3MB 3NE5B 1XPUA 2AHOB 5E3FA 4BY7B 2EJMA 2HT1A 3PCOB 1XYIA 1EU3A 3ITPA 1BCPB 1PTOH 3VR4A 4CKCA 3CCSA 1EY5A 1EQTA 1LTBD 1PVOA 1HQRD 1I50B 4XQJA 2KCMA 4HR7B 4KY6A 3P1HA 2K28A 2SEBD 4EQ5A 4C3IB 2K7VA 4KD4A 1X65A 4KK7A 1QZHA 3PO3B 3Q8DA 1KXLA 1L1OB 2MNAA 1SFOH 2JK8A 4BA1I 2JA6H 1B2TA 2O5IC 1RDPD 1F2YA 1CK1A 2JA9A 3RZOH 3LWUA 2B63B 1F9RA 2I0QA 1AP0A 3T56B 1LTRD 5J3BA 3K7UC 1E3PA 4DV3L 2BH8A 1IBKL 3M3YB 3AQQA 3MWYW 3QJYA 2YV5A 2YU9B 5ELFA 4X3KA 4DU9A 2CQAA 3EVQA 3OWEB 3J7A5 5FLXE 2VZAA 4NXNL 3GD7A 3G6EA 3OMCA 2E2DC 2PW5A 1HA5A 4HMIA 4EX5A 1SBBB 1TS2A 4DUYL 4HJAA 3QB3A 4CDCC 1KLGD 1VQCA 2ZTCA 3T1YQ 2E5LQ 1PZID 1HA6A 3I70A 5CV7A 4BY1G 2GVAA 4C1NK 4FVMA 4CJ2C 4DXGA 4L63B 3LWEA 4ALPA 4TRDA 5KIXA 3HFZB 3S2DH 4DR7Q 4QUFA 1TS4A 1SJED 1SDFA 3HOXB 3R3OA 1FNVA 1O80A 2AWOA 5DLQE 5IT9L 1F9SA 2MP1A 2WKDA 1D2BA 3PIOA 3V2TA 1A63A 4JVZA 2LMCB 4A4IA 5LL6S 1D5XC 4XYQA 2B2WC 3PF4A 2L0CA 5JVG3 1TWAH 1LUZA 5LHY1 3KUPA 1VQIA 2CW0D 1I3QH 1C7YA 3S17B 2VL6A 4WFN3 3S1MB 3IFDA 3IAYA 4MZ9A 1F2LA 2PI2A 4LUZA 3S1RH 5IGBA 3TZDA 4OIJA 3NTKA 1SYEA 2PO4A 4B3SQ 4OO1H 4R4TA 3PUVA 2BE5C 2K5HA 4A3IB 1Q1BA 4CJ1B 2B39A 2DY8A 4OGQC 4A3KH 4X65L 1JE5A 3IRBA 3K5OA 4P71A 4QY7A 1II3A 4CGYB 1I94L 1CT1D 1EQRA 5A35A 1IYUA 4JG2A 4DR4Q 1D5ZC 3FPUB 2VQEQ 1BCPD 2EYMA 2WFWA 4ILWA 2JE6I 2E2HH 2B2UC 2A69C 1WFQA 1Y69U 1YJWA 3D0FA 5JEAH 3G7LA 1N8RC 3I4MH 4DXFA 4Q0FA 4R4QA 1TKWB 1D7QA 5KYLA 4C2MH 2JA7G 1Y1VG 3I4NB 1V43A 4JV5L 4K5XA 4AIMA 2NVTB 1FYCA 1CKMA 3S15H 3OOCA 5I4DA 5I6YA 1ESFA 3CW2C 1X3FA 3OW7A 1JOKA 2JA5G 3IL8A 5C4HA 3SDZA 3SK4A 1K83B 3FP9A 1S5DD 3C1EA 1JOOA 4MTNA 4A3DH 2OTJA 1CA6A 2VUMH 4RGMA 1HZCA 1STHA 1STYA 4RH6A 4C1NI 5EQ0A 3A7AB 5I9OA 3NK9A 1K0RA 2L1BA 3UDFA 2KOLA 2N8NA 3CHBD 1NAPA 3MAQA 1WTVA 2RSOA 4IQZA 3SK5A 1OTCA 1EIFA 4BBSG 4DV0L 1PLFA 1PYSB 3RMHA 3HOWH 3SHLA 3GTQH 2LXKA 4HSVA 1VQGA 4FF1A 4LW1A 4M8AA 2PI2E 1GHJA 4LMQD 3VDYA 1CKOA 2EJFC 4A3GB 2PW7A 1A2UA 3GTOB 2WB1G 1FJGQ 4KJOA 3HG9A 1KC8C 4CDEC 2PZUA 1T9HA 3J81E 1S40A 4AYBG 4KKTA 1VQDA 4DV5Q 1NJIC 1H9RA 1ASZA 1O7LA 3PGZA 5E1FA 4NB3A 3BU2A 2SNSA 2B8GA 2D2CC 2FMMA 4DR3Q 1IBML 3AFQA 4R4OA 3GV3A 1SMYD 3H6MA 3H0GH 4NMZA 1N33Q 5CMDA 2KEDA 3EA6A 2YTXA 4L5RC 1A15A 5M5XB 3GTPH 3L3OC 2F4VQ 1GUWA 2E2JB 4RGOS 3V05A 5EBCA 1XNQQ 2ATWA 1WCMH 1YVCA 1QVGA 4HTHA 2R93H 2EOTA 1X55A 3SK6A 2B29A 3H3VH 1YITA 1CQFA 1U4RA 3P75A 2Z0SA 4P72A 4A3BB 4IZ8A 2V4DA 1HUMA 3UDXA 4A93H 3F2BA 5C4XH 2WB1E 1DOLA 2R92G 1Y1WB 3B6YA 3VA5A 4AYBE 4I65A 1I6HH 1GVPA 4ID6A 1KDBA 2LY7A 2N88A 4DV7L 4KY7A 4ZRZA 1J6QA 3BDOA 1EZ6A 3O13A 4K2KA 1Q81C 1M4VA 3ICEA 3HOVB 1JCKB 4PMBA 4BBRG 4Q5VA 4GLXA 4IFDG 2JXMB 1NSNS 3QG1A 2HHHL 3NWTA 4YWMA 1SYDA 4KLKA 5C3XA 1TS3A 4U68A 2A6EC 2CWAA 4RHSA 1S5BD 2KHSA 3K80C 2XGTA 1N34Q 1HR0Q 4FXKC 5CR3A 3QO2A 3QOJA 2NVQB 1EFID 4Z9CB 1K73C 4LF5L 3BZCA 1WD1A 3HOYG 3I56A 2ICEC 1BO0A 1SNPA 1IXRA 4A3CH 4GKKL 4X64L 1MD2D 1JOQA 2P5ZX 4CKBA 3H15A 1CM9A 5IGDA 5C0XJ 1X56A 1K28A 1STNA 2CHBD 3NUCA 1X3QA 4JOIA 2KHJA 1H9KA 4G7ZC 1W6KA 2NZ1D 5IYDH 3OIQA 2VS1A 5C3WA 2JA8H 2K52A 5CORA 1SNMA 2F0OA 2FJ2A 2F0SA 1VQ9A 2HCCA 4OWWB 3HOUH 3S14H 4O1NA 2AQ1B 3S1NB 4IPGA 1DJRD 1BBUA 2ZM6Q 1HNZL 1CI3M 5FOBB 1IYJB 1B50A 1KNAA 2O4XA 4H13C 3UDIA 3K6OA 2CKZB 3GTKH 4R1JA 2NB0A 4N8X1 1NUCA 3K7AB 1LTSD 2EY5A 4YCVA 1LABA 4H7BA 2EYPA 4LUVA 5I2XA 1N32L 2IJ0A 3J7ZC 3MTSA 2IWHA 5C0XI 1AZPA 4R4IA 3W1GA 1WTXA 4JBMA 4A3LG 3Q22A 1NNXA 1HJPA 1RF2D 1UE7A 1ASYA 4K0KL 3Q0AA 1VQ4A 4H44C 4A3JB 4DK6C 5IY0A 4DV6Q 4DV2L 1AE3A 5JJLA 3OWFA 1HPCA 3BVZA 4JI3L 2KEEA 3J7AV 3CCQA 2TMPA 2R61A 1S5ED 2B2VA 1XX8A 2K5DA 2RKSA 3NXWA 5COYA 3DHQA 3KBXA 4I7AA 4PZ7A 3GTGB 3U9SA 2N55A 1PZJD 1J5EQ 2M9VA 1Y8OB 3BYYB 2WAQB 1C8CA 1U0LA 2Q2IA 4MNOA 4KKUA 4UP9A 1H95A 2EY6A 1OXVA 3KJOA 4DR6L 3G48A 2NN6I 1WTQA 2E75C 3RZDB 2X6GA 1Y8NB 2Y0SG 4GOPC 2YTVA 2LXJA 2F0VA 1WOCA 1QG7A 5M3MH 1SE2A 3DWPA 1YNXA 3SVMA 3NELA 4PMWA 1NR2A 5C3EH 2ENBA 2AKWB 3ONAB 2IPKD 2VW9A 2A1AA 3SXHA 1KD1C 1X3GA 3E9HA 4QQBX 3RD4A 4A3MG 2G9HD 4YY3L 4JI5Q 1QB5D 3MXNA 2L9HA 1EWHA 3T1HL 3I90A 5K36H 3X3NA 5LMNL 1FGUA 3MXUA 4CDDC 3CCJA 2UXCQ 1TY0A 2PYKA 4FXDA 1NR4A 4S3SA 4BXXH 4JI6L 3PO2B 4C3IG 4LF7Q 5HGQA 2K5WA 3LNNA 2GN5A 1QVFA 3H94A 1B8AA 4QMGA 2ZTEA 4F7XA 5IP9G 4HJ5A 2LS01 4G4KA 4A3EG 2D62A 4IURA 1STGA 2CWPA 2ZXOA 2Q8RE 4QB4A 3KJPA 1HNXQ 1QJOA 1EIGA 2A6HC 1DXMA 5ELBA 3EN2A 4OIKA 1ICFB 1SE3A 1Z6HA 2O2LD 1EEID 5CV6A 5BR8Q 3M4OH 3CP0A 3F2UA 3L0OA 5KNCA 2H1EA 1Q86C 2WP8J 3OTOQ 1YNNC 2WKCA 4FO2A 4RMFA 4JI4L 2IL8A 1LT3D 1TWCH 1QNUA 1LV9A 1GD7A 2BA0A 3G4SA 5EKKA 2R7ZG 5FO7B 2NTSA 2KA7A 4MTKA 3TQYA 3S24A 5HGTA 4GNXB 4L6TB 3E3XA 5CGKA 1G2SA 2DJGC 5ELOA 3HOXG 2E2IB 2F3IA 3MEFA 2AWNA 4F87A 1ZXTA 2UUBL 3TREA 1UUPA 2DUDA 4LFBQ 1EU4A 2HIXA 1CUKA 3S16B 4DV1L 4DK3C 3S1QB 2EPBA 2I5MX 4DR5Q 2H5XA 5GAEC 5J1ZA 1GUGA 3FKIH 4XQQA 1ILPA 2AQ2B 1VQ6A 1E1OA 5K5PA 5FK9C 2FINB 1IHZA 2B2TA 2IW3A 5C4JB 3VR3A 3STBD 2F0NA 1SE4A 1R9TH 1PFNA 2JN4A 3TZUA 4A3IG 3M7GA 4X66L 1VQJA 4DV3Q 4RKLA 1UE5A 1RKNA 1IBKQ 1X3PA 3DXJC 2F3WA 2RCFA 1Q1EA 2JA6B 3UE1A 4RCOA 2RHSB 3SGIA 4NXNQ 4DAYB 3RZOB 3CRLC 1XTDA 1BDOA 3KF8B 4R9WA 4KHZA 3C46A 4IUNA 2KBNA 1MJCA 2DY7A 4NDXA 4IFDJ 4OXPA 5DNFA 4PG3A 2IX3A 2NUCA 4DUYQ 4Y52H 1WTPA 2JEAI 4B3TL 2KUMA 3I4NG 1QILA 1B70B 3NENA 3W5OA 3DM3A 4LK1C 1IBLL 1PYBA 1DZ1A 1K3BC 2Z6KA 2K75A 1PTOC 1V9PA 1WTOA 1R4PB 4X6AH 1E24A 2EVBA 1KDAA 1Q46A 1U4MA 2XNAC 3GTLH 3RUZA 1GKHA 4LFAQ 4WRDA 4K5VA 1N36L 1STAA 1VQEA 3T16A 3UDGA 2VY3A 4K5WA 1YZ6A 3T4AC 3HOZH 1FR3A 3S2DB 4IUTA 4LFCL 2FXQA 3DWAA 4B3ML 2JQOA 1VMPA 4B08A 2G5DA 3KYHC 4A3GG 1RHPA 4IFDI 2D5DA 3T53B 2UUAQ 2MO1A 5C44H 4WJ4A 1PH9A 1WD0A 1TWAB 3FHWA 4KHPQ 3MXNB 4A3EB 1I3QB 2BOSA 5JJIA 4OX9L 2F0JA 2YYZA 2I46A 3G6JB 3URYA 2RQXA 1AN8A 1Z9FA 5DEHA 4KN4C 1SNOA 2NN6G 4QL5A 3E0JA 1VQOA 2XWBB 1KAAA 1PFBA 1B1ZA 4PNYA 3HS0C 5ELDA 2PCFB 2HCIA 1T5XD 3CF5A 4A3KB 5IP7G 4NW2A 3NQTA 5FLMH 2CCZA 1D8LA 2F0DA 3TP7A 3D4DA 3OYYA 1EL0A 2QEJC 4JV5Q 5GROA 1U5KA 5H1SE 2EJGC 3PIP3 5EPKA 5M5WB 1IL8A 3AU7A 1QUQB 4A3BG 2E2HB 4OWXB 3ND8A 2R7ZB 4J8QA 4JBJA 2AMCB 4YWKA 1F9QA 1Y1WG 3I4MB 4K6LA 4XQNA 1CA5A 1JMCA 4C2MB 3CD6A 3EIVA 3BZDB 3CRKC 3UI2A 2XSCA 1SE8A 4IOAA 1OXXK 1EIYB 4XDXA 3HOVG 3S15B 4DUZQ 2EDGA 2VB3X 2DN8A 1Y8PB 1NMFA 5HURA 4BY7H 1H9JA 3DM1A 1L1OC 2ZXRA 4X3SA 1TWHH 4A3DB 3EROA 4J1MA 1GM5A 2B2YC 1OO9B 2MJ8A 4PQXA 5I2YA 5IYBG 1ZEQX 3A8JE 3RLOA 2LFNA 1XNRL 2PPBC 1I50H 1GUSA 3D6WA 2Z6BA 5L37A 2QKIC 3DLLA 3CXCA 3PO3H 3HOWB 4JI1Q 3GTQB 4JYAQ 4UP8A 3WOFA 1JT8A 1I6VC 1HCZA 5ISRA 1PH8A 5DAUA 1ET9A 3U58A 3L7ZC 2CQOA 3SK8A 5FJ8H 1G91A 3MXPA 4J15A 2B63H 2OF1A 2KJXA 1RCVD 2CH4W 3D6CA 3R93A 4U673 5LL6X 1Q3LA 2JJQA 2XRSD 3HRZC 4GLVB 3NBIA 4OELB 4L5SA 3M3YH 4JCVE 5D65A 1NE3A 3D31A 1WYDA 4KI0A 1K8GA 1HTPA 4A76A 2ZJPA 1JB7A 1I4HA 3H0GB 1S5CD 2PMZB 3CQZH 1EYGA 3BDCA 1LTGD 4FF4A 4HEDA 5AJ3Q 3RLNA 2JYOA 4MN3A 4LWCA 3GTPB 3NSWA 5D3DA 5ELNA 1SMYC 1FVIA 4HJ7A 1WCMB 5EKLA 3SEBA 2TSSA 2A5HA 2C5CA 4DV4L 1JWMD 4DV7Q 1RIPA 4HJ8A 3ZYYX 3OMGA 1NTGA 1EYDA 1QCBD 1S5FD 5JPNC 4A93B 5C4XB 1H9SB 3TS0A 1JJCB 1SJHD 4K14A 4YIJA 2HHHQ 3CCLA 4FNFA 2K04A 1MHWC 1I6HB 3Q24A 2A8VA 4XTCS 3FRPB 4UY8C 2OEOA 3H09A 1S4ZA 1GUTA 4KKSA 4A3JG 1YHBA 4DR7L 4RA8A 2FMCA 3NTHA 4MHEA 4NKLA 2MQHA 3S1MH 2HQEA 1FL0A 1TR5A 4IUUA 4GKKQ 4X64Q 4APVA 2VQFQ 3CCMA 2B3GA 4IOCA 1DD2A 1STBA 2M2LA 2QILA 1MJEA 1RJTA 5JVH3 1X9NA 1E1TA 3M9BA 1QNKA 2MPMA 1VF7A 1KAWA 2EE1A 2WAQG 4QIWB 3H3VC 1HZBA 5M3FG 4C3JG 3V96A 1E2ZA 2C35B 1K9MC 3K81C 2NWGA 1F9PA 1LYLA 1XMOQ 4X3TA 4A3FG 3M4YA 1KDCA 3KDFA 2EYFA 1TT2A 2FHTA 4B9WA 2K50A 5EKIA 4JI0L 2LKVA 3AYHB 2MFIA 3CU7A 5CC4A 3A54A 2HUGA 3PMFA 2EYJA 2NVTH 1A62A 4XIGS 1HNWL 1MGSA 3HOUB 2F0TA 1VQHA 2BDNA 2Q8IB 5KNBA 1N32Q 5NUCA 5KYIA 3FVQA 1IW7C 5C0XH 2WAQE 2KCCA 3EFXD 3GTKB 2HDMA 5I6WA 3NPPA 3WWVA 2IX1A 2KQ3A 1NCVA 3PO2G 2CVRA 4OONA 2O5JC 4LAAA 2OWOA 2OQ0A 4YHHL 1W2BA 4LUOA 2KCNA 1CQVA 1PA6A 3NHHA 2Z4IA 1D1KA 1CZWA 1O78A 4DV2Q 4M1UB 4G7OC 3D3RA 1VQLA 4X3UA 4UHVA 1YNJC 3CCVA 5CBEE 2JSOA 2K05A 4JI2Q 4NXMQ 3EJIA 3HKSA 5AFWA 3CC2A 4ABNA 2PZWA 2IX0A 1L0XB 2F52A 3WDNA 4DAPA 3J80L 1IYVA 4GNXA 5CBAE 1BUVT 3J80i 3F2CA 1HH2P 2K03A 1I4XA 1PH1A 4BWGB 4QGUA 4GN4B 2LSSA 2NN6H 1U4LA 1VQKA 2F03A 2N3SA 1WVLA 4DV5L 4K8JA 2FFKB 4B3RL 3GQBA 4DR3L 3FPPA 4OEMB 1C0AA 1XTCD 4LF8L 2E76C 3K8AA 2RA4A 2A74C 3QWNA 1KQSA 5M5YH 1YHQA 2UUCL 1KHIA 3J80c 2RDFA 1PZKD 2F0EA 5BN4A 3NP8A 5EPLA 4BY1H 5M3MB 1JR0D 4LF6Q 4IO9A 4ZCKA 2NVYH 4JC0A 4OL7A 5IYCG 4PMCA 3VYSA 3T1HQ 5C3EB 4C3HG 5LMNQ 1BKBA 1SYGA 1JJ2A 2A6ED 5EAYA 4XXEA 4GOPB 2DNCA 1A0IA 4GN5A 2UXDL 1PRTC 3TEHB 3F8TA 4B9XA 1CSPA 1F77A 1VQ7A 1U4PA 1FNUA 3EBEA 3AEVA 4DAYA 1PDQA 3I7FA 3KF8A 2F0UA 4DGZA 1Q8IA 1V8QA 3BG3A 4BA2I 5JOBA 3BS1A 2A68D 2EY1A 4K6DA 2JEBI 3E6ZX 1V1PB 2NVQH 5KNDA 1EFWA 3PQIA 1HTLD 3BYTB 4GKJL 2ZJQA 1SNDA 1P16A 4IALA 2JA6G 2DJFC 3MEHA 1DYQA 3PIPA 1Z7TA 4L8JA 1PH3A 1TQOA 5M3FB 4C3JB 1EEFD 5CV4A 2V1CC 2XN9C 2HIVA 1EOTA 4X62L 4A3FB 4P2CB 3JAML 3DWQA 4TKOB 3JAMi 2K5VA 5F2DA 1L0WA 1SLJA 2IHEA 1KL9A 2JA7H 3E5SA 1HR0W 1ONLA 1Y1VH 1ET6A 2PNRC 2K32A 4CJ0B 3ZJYC 1PH2A 5KRUA 4RHRA 3VR6A 1TWCB 1HUNA 2OT2A 3SR1A 4QCLA 2E8GA 2UXBL 3OPOA 1K8AC 4JI8Q 4PZ6A 1PH7A 2JA5H 4ZUIA 1SSOA 2WACA 1HXYD 1CFMA 3KDFB 2F0GA 4DV1Q 1XMQL 4HIMA 1E7ZA 1ML0D 5IIFA 3JAMc 4XYOA 1B44D 1D1IA 3S2HB 1JC7A 5JAVA 1YJNA 2B2WA 2Y0SE 1I4GA 4BBSH 3I4OA 3C3LA 3KBGA 3MC0B 5DM73 1MSGA 1SN8A 4A3JH 3A8IE 2CH4A 1B7YB 1PTOF 2NTTA 3FKIB 4X66Q 2J7ZA 4HMJA 1QUQA 4KY5A 5A2QL 1KTKA 2R7FA 4KN7C 3TBIB 1ENCA 4OO1G 4JK1C 4HIOA 1K3RA 2WIIB 4YCUA 1VQAA 3K58A 4A3KG 3BVMA 4LF9L 3GDEA 2ICIA 3TSSA 4DKAC 1EYCA 4B3TQ 3STBC 2F0KA 1STEA 4AQYQ 2B2UA 1TWGB 4LF4L 2F0PA 1VQ5A 1DOMA 1IBLQ 4HIKA 3H91A 3KF6A 1U9RA 2K33A 1B3QA 2MGSA 4J6HA 5JEAG 3I4MG 3RN2A 3WOEA 3CPWA 1TWFH 1HQMC 5GAHC 3GTMH 1AH9A 4IN3A 1A3VA 3GV6A 1W3SA 3PUYA 4R8IA 2R92H 2R3ZA 1N36Q 2UU9L 4FP5D 1QZGA 1BF4A 3FMCA 1EWCA 4H0LC 3HZXA 4C3HB 3GTJH 1NMGA 1ZYRD 4A3DG 4QF4A 4B3MQ 2VUMG 2MHVA 3GTLB 4BBRH 4JI7L 1K0SA 4DF7A 3I91A 3VYUA 4V0BA 3CCRA 4IFDH 5T1IA 3T13A 1YHAA 1PH5A 2B8FA 4DR2L 4HCSA 3HOZB 1LM0A 2ZJRA 1EYAA 3HKZG 3HOWG 3A74A 3I55A 3MFYA 1PTOB 2H4OA 2D0OA 2WINB 3KOJA 4DR1L 5T1GA 3K5LA 4OX9Q 2A6HD 2KHIA 4O42A 1Q8KA 4IJLA 3KLSA 2RSNA 2QCPX 4ULLA 5C4ZA 4K8IA 3HOYH 4O0AA 1DCZA 2SNMA 4HIDA 3K57A 1SFOB 1JWUD 1IKMA 1AE2A 2KVMA 2Z1CA 2HD3A 5KEEA 2XWJB 2QDBA 4DN4M 3IKJA 1KNEA 1YNND 3L9AX 1WJJA 5IODA 5LMUL 4RWSC 1V1QA 2Q2TA 5JPMC 1PV4A 2ZTDA 3N6RA 1RL2A 1XWEA 3H0GG 3I72A 2R7DA 1X32A 1H9SA 4JOIC 1KLUD 3A55A 5CV9A 1HNXL 3J7AF 2QEXA 3CC7A 3BZKA 1B53A 2ID0A 5J39A 3BVGA 3MZ5A 1WCMG 2Q2HA 2R93G 3ULPA 3TDQA 1I4PA 2L15A 2F0IA 1EY9A 4ZK9B 4L5TA 3ERQA 2F0MA 3NTIA 2F0LA 3NEMA 3KLRA 3OTOL 3KK7A 2KCTA 2C9OA 3P20A 4P74A 4A93G 1ENAA 3R8BA 2QF7A 4IPHA 4NPSA 5C4XG 1B4OA 2XRQD 1JORA 1ICWA 1S3OA 3VA7A 5BN5A 1LT4D 1BR9A 2HDLA 1EY6A 3OW2A 3A0JA 1CSQA 3ULLA 3OHXC 3R2IA 3S1QH 5CYUA 2E74C 1EOVA 2PMZE 3W2DA 5I9PA
chains in the Genus database with same CATH topology
1RTOA 1PYWD 1OXTA 4CHTB 4GZYC 4E6IA 5FO8B 1AEXA 1K8MA 1G2TA 2RBMA 1TWHB 4RGNA 4RCNA 5IGFA 3M7NA 2RDGA 3AMUA 3S9WA 5EBDA 4FF3A 1SYFA 3S1RB 4F88A 2CW0C 3MXGA 3D4WA 1SYCA 5C5MA 2B2VC 1F2ZA 2PZTA 5M9OA 4DFAA 1J8IA 1TIID 1OXUA 1HHVA 1PTOD 4EQOA 2OXPA 1T5EA 1Z47A 1D6EC 1JICA 3CQZB 1R4QB 1BCPC 3DEPA 2G9DA 2AUKA 4V190 3I3CA 4IUVA 4F8MA 2A73B 2D9UA 4C56C 4FXGC 1G8ZD 3OSOA 2VUMB 1BQQT 5CV8A 3GP7A 4ZQ3A 3I4LA 3QIAA 1LTTD 3DMUA 1BOSA 4RAUC 3HKZB 4N9PA 3A7LA 4EQNA 4HAEA 5ELCA 1EIHA 2F0QA 1XXGA 2MUYA 3J80E 5FKAC 2F3VA 1ZKOA 2ZXPA 4ZYSA 1C4QA 5IGCA 1VDZA 1W6JA 1LLRD 3U9OA 4RKBA 3OIPA 5DM63 2R93B 1RODA 2AQ3B 1JQYD 1V1PA 4ZUJA 2L12A 3PV0A 1DOKA 1F2MA 2BA1A 2K01A 1WTWA 1O7ZA 5G3LF 4BS9A 5K36G 1SNQA 1CTMA 3FDTA 1BXTA 2BE5D 4DK1A 3Q23A 3EQLC 5JEAJ 2WV6D 1JWSD 4NP5A 3GO5A 2B2TC 3J7YW 1DM0B 1TU2B 1GOZA 4CBVA 1SAPA 5EGTA 2PQEA 1LTID 4G57A 1TS5A 2A69D 1ESRA 5E4XA 1D5MC 1PRTF 1TVXA 2BDOA 3A56A 4OO1I 3D8GA 3NQIA 3JAME 1AFPA 3AB9A 1E2WA 2J0TD 5FLXL 2EZVA 1EY0A 2L55A 2JA8B 2ZT9C 1A3TA 1DONA 4KMUC 3S14B 5C5LA 2K5QA 1WTRA 3PUXA 5M5YB 1E2VA 1FNWA 1E0BA 4DA2A 2J4XA 3DUZA 4BY1B 1EY4A 2NVYB 4PV1C 2R6GA 1RTNA 3K5MA 2F4IA 2EY2A 1LT5D 3D4RA 2F0FA 3HEJA 4QUCA 5IGEA 4TSSA 4UDUC 2EYOA 2BCOA 3TP8A 2XIWA 5A2QE 5BN3A 1PRTB 3PUWA 4DNTB 3K59A 2M00A 1BNZA 5JJZA 1K8OA 3R2TA 2A68C 1C48A 3K5NA 4FF2A 3TN2A 1AW7A 1IKLA 5CV5A 4FYDA 2VXWA 1UAPA 4HN7A 4MIUA 1GUNA 1SEBD 1IW7D 2F0HA 1VF5C 4ZAIA 2SOBA 2JA7B 1MSHA 4DK0A 2X69A 1MI2A 1Y1VB 1G291 2XVSA 1EQVA 4IUQA 4HSPA 3MHBA 4XT1B 4RGTA 2X6LA 3QOLA 2Z8LA 2JA5B 1UEAB 1M8AA 1YNJD 3I73A 1KABA 1GJXA 1SYBA 2EYHA 1LT6D 4BBSB 3P7JA 1LTAD 3NWSA 1QE6A 4ZKBB 3PUZA 4KV6A 2Q8TA 4IUPA 3HGBA 3M85A 1A2TA 3PIO3 3J81L 2VNUD 2L5TA 5G3LD 2WB1B 3MVVA 3VYRA 4AYBB 5EPJA 1I4RA 3VR5A 3M4OB 2VB2X 4TQUS 3RLFA 1GXDC 1PMRA 1RD9D 3KLSX 2Z4HA 3A8KE 1B9MA 3VR2A 1PRTD 2EYLA 1TWFB 1VMCA 3GTMB 3CKIB 3ND9A 2JP1A 4EQPA 1CHPD 2R92B 3LX0A 2B2YA 3IFTA 4WJWA 4K2LA 4HCEA 3GTJB 2L11A 1EY8A 1OXSC 1EY7A 1PXUA 1A3UA 3N52A 4BBRB 1V1OA 3C1FA 1UNSA 5IOCA 5E4WC 1ZYRC 1LACA 4LJZC 1R9TB 4R8NA 4KJNA 2GA4B 3X3MA 1MBYA 3K0YA 3HOYB 2EXZA 1HRJA 4CKEA 5ELEA 4EGVA 5J22A 1AZQA 2RVLA 1ILQA 2I07B 1Q12A 1B3AA 4UAIA 2IT1A 4KTAA 3NBHA 3MFGA 1VCIA 5D3IB 2AUJD 1CHQD 1CZGA 4ME5A 1GUOA 3HP3A 1A6XA 1Q90A 2F1MA 4EVOA 2K1BA 3BDLA 4DAVA 2K6AA 4WORA 2L4NA 1EZ8A 4KD3A 1J9OA 4DNRB 3TP6A 1GHKA 3W3AA 1B9NA 2RDHA 4JBWA 5C6AA 3TP5A 5IT9E 3T51B 1PFMA 4ZLTF 3DEOA 3SE0A 2NBFA 4RFBA 1BCPF 5C44B 1QOHA 5IGGA 1HFGA 4OHJA 1FGBD 2F0WA 2KECA 4Y7NB 4ODGA 1JE4A 1LO5D 2DNEA 2SDFA 4XT3B 1QWYA 1O7YA 3MA2B 2NYZD 2NVXB 4N9TA 4ZKCB 1TY2A 1G6ZA 1SXTA 5EJWA 1FD7D 3I8ZA 3VYTA 5TSSA 2Y0SB 3FEWX 5KGUA 3TMEA 3Q6SA 4I7ZC 3C2PA 1JB3A 1H9MA 5D14A 1L0YB 1SNCA 1I4QA 5FO9B 1BBXC 4G7HC 5C0XG 4KHVA 1ENFA 4A3MB 3NE5B 4BY7B 5E3FA 2EJMA 1XYIA 1EU3A 3ITPA 1BCPB 1PTOH 3VR4A 4CKCA 1EY5A 1EQTA 1LTBD 1HQRD 1I50B 4XQJA 4HR7B 4KY6A 3P1HA 2K28A 2SEBD 4C3IB 2K7VA 4KD4A 4KK7A 3PO3B 4BA1I 1B2TA 2O5IC 1RDPD 1F2YA 1CK1A 3LWUA 2B63B 1F9RA 1AP0A 3T56B 1LTRD 3M3YB 3MWYW 3QJYA 2YU9B 5ELFA 4X3KA 4DU9A 2CQAA 3EVQA 3OWEB 5FLXE 3GD7A 3OMCA 2E2DC 2PW5A 1HA5A 4HMIA 1SBBB 1TS2A 3QB3A 1KLGD 1PZID 1HA6A 3I70A 5CV7A 4C1NK 4FVMA 4DXGA 4CJ2C 4L63B 3LWEA 4TRDA 5KIXA 4QUFA 1TS4A 1SJED 1SDFA 3HOXB 3R3OA 1FNVA 1O80A 2AWOA 5IT9L 1F9SA 2MP1A 2WKDA 1D2BA 3V2TA 2LMCB 5LL6S 1D5XC 4XYQA 2B2WC 2L0CA 5JVG3 5LHY1 3KUPA 2CW0D 3S17B 4WFN3 3S1MB 3IFDA 3IAYA 1F2LA 5IGBA 3TZDA 4OIJA 3NTKA 1SYEA 2PO4A 4OO1H 3PUVA 2BE5C 4A3IB 1Q1BA 4CJ1B 2B39A 2DY8A 4OGQC 3K5OA 1II3A 4CGYB 1CT1D 5A35A 1IYUA 1D5ZC 3FPUB 1BCPD 2EYMA 4ILWA 2JE6I 2B2UC 2A69C 1Y69U 5JEAH 3G7LA 4DXFA 4Q0FA 1TKWB 5KYLA 3I4NB 1V43A 4K5XA 2NVTB 1FYCA 3OOCA 5I4DA 5I6YA 1ESFA 3OW7A 1JOKA 3IL8A 5C4HA 3SDZA 3SK4A 1K83B 1S5DD 3C1EA 1JOOA 1CA6A 4RGMA 1STHA 4RH6A 1STYA 4C1NI 5EQ0A 3A7AB 5I9OA 3NK9A 2L1BA 2KOLA 3CHBD 1NAPA 3MAQA 1WTVA 2RSOA 4IQZA 3SK5A 1PLFA 3RMHA 3SHLA 4HSVA 4FF1A 4M8AA 1GHJA 4LMQD 2EJFC 4A3GB 2PW7A 1A2UA 3GTOB 4KJOA 3HG9A 2PZUA 3J81E 4KKTA 1H9RA 1O7LA 5E1FA 2SNSA 2B8GA 2D2CC 2FMMA 3GV3A 1SMYD 3H6MA 4NMZA 5CMDA 2KEDA 3EA6A 1A15A 5M5XB 3L3OC 1GUWA 2E2JB 4RGOS 3V05A 5EBCA 4HTHA 2EOTA 3SK6A 1CQFA 1U4RA 3P75A 4A3BB 4IZ8A 2V4DA 1HUMA 1DOLA 1Y1WB 3VA5A 4I65A 4ID6A 1KDBA 2LY7A 2N88A 4KY7A 4ZRZA 3BDOA 3O13A 1EZ6A 4K2KA 3HOVB 1HFNA 1M4VA 1JCKB 4PMBA 4Q5VA 4IFDG 2JXMB 1NSNS 3QG1A 3NWTA 1SYDA 5C3XA 4U68A 1TS3A 2A6EC 4RHSA 1S5BD 2KHSA 4FXKC 5CR3A 3QO2A 3QOJA 2NVQB 1EFID 4Z9CB 1WD1A 2ICEC 1BO0A 1SNPA 1MD2D 1JOQA 4CKBA 1CM9A 5IGDA 5C0XJ 1STNA 2CHBD 3NUCA 1X3QA 1H9KA 4G7ZC 1W6KA 2NZ1D 3OIQA 5C3WA 5CORA 1SNMA 2F0OA 2FJ2A 2F0SA 2HCCA 4O1NA 2AQ1B 3S1NB 1DJRD 1CI3M 5FOBB 1B50A 1KNAA 2O4XA 4H13C 3K6OA 2NB0A 1NUCA 3K7AB 1LTSD 2EY5A 1LABA 4H7BA 2EYPA 5I2XA 2IJ0A 3MTSA 2IWHA 5C0XI 1AZPA 1WTXA 3Q22A 1RF2D 3Q0AA 4H44C 4A3JB 3OWFA 1HPCA 3BVZA 3J7AV 2KEEA 2TMPA 2R61A 1S5ED 2B2VA 1XX8A 2K5DA 2RKSA 3NXWA 5COYA 3DHQA 3KBXA 3GTGB 3U9SA 2N55A 1PZJD 2M9VA 1Y8OB 3BYYB 2WAQB 1C8CA 4KKUA 2EY6A 1OXVA 2NN6I 1WTQA 2E75C 3RZDB 2X6GA 1Y8NB 2F0VA 1QG7A 1SE2A 3DWPA 3SVMA 4PMWA 1NR2A 2ENBA 3ONAB 2IPKD 3SXHA 3RD4A 2G9HD 1QB5D 3MXNA 2L9HA 1EWHA 3I90A 5K36H 3X3NA 3MXUA 1TY0A 2PYKA 4FXDA 1NR4A 4S3SA 3PO2B 4C3IG 2K5WA 3LNNA 3H94A 4QMGA 4F7XA 2LS01 4G4KA 2D62A 4IURA 1STGA 2ZXOA 2Q8RE 4QB4A 1QJOA 1EIGA 2A6HC 1DXMA 5ELBA 4OIKA 1SE3A 1Z6HA 2O2LD 1EEID 5CV6A 3F2UA 5KNCA 2H1EA 2WP8J 1YNNC 2WKCA 4FO2A 2IL8A 1LT3D 1QNUA 1LV9A 2BA0A 5EKKA 5FO7B 2NTSA 2KA7A 5HGTA 4L6TB 5CGKA 1G2SA 2E2IB 2AWNA 4F87A 1ZXTA 1UUPA 1EU4A 3S16B 3S1QB 2EPBA 5J1ZA 1GUGA 4XQQA 1ILPA 2AQ2B 5K5PA 5FK9C 2FINB 1IHZA 2B2TA 2IW3A 5C4JB 3VR3A 2F0NA 1SE4A 1PFNA 3TZUA 3M7GA 4RKLA 1RKNA 1X3PA 3DXJC 2F3WA 1Q1EA 2JA6B 4RCOA 3RZOB 3CRLC 1BDOA 4R9WA 4KHZA 3C46A 4IUNA 2DY7A 4IFDJ 4NDXA 5DNFA 2IX3A 2NUCA 1WTPA 2JEAI 2KUMA 1QILA 4LK1C 1DZ1A 1PTOC 1WTOA 1R4PB 2EVBA 1KDAA 1U4MA 2XNAC 3RUZA 4WRDA 4K5VA 1STAA 3T16A 4K5WA 3T4AC 1FR3A 3S2DB 4IUTA 3DWAA 1VMPA 4B08A 1RHPA 4IFDI 2D5DA 3T53B 1WD0A 1TWAB 4A3EB 1I3QB 2BOSA 2F0JA 2YYZA 2I46A 3G6JB 3URYA 2RQXA 1AN8A 5DEHA 4KN4C 1SNOA 2NN6G 3E0JA 2XWBB 1KAAA 1PFBA 1B1ZA 4PNYA 3HS0C 5ELDA 2PCFB 2HCIA 1T5XD 4A3KB 4NW2A 3NQTA 2F0DA 3TP7A 3D4DA 1EL0A 2QEJC 2EJGC 3PIP3 5EPKA 5M5WB 1IL8A 3AU7A 2E2HB 3ND8A 2R7ZB 4J8QA 3I4MB 1F9QA 4K6LA 4XQNA 1CA5A 4C2MB 3BZDB 3CRKC 3UI2A 2XSCA 1OXXK 4XDXA 3S15B 2EDGA 2VB3X 2DN8A 1Y8PB 5HURA 1H9JA 3DM1A 2ZXRA 4X3SA 4A3DB 3EROA 4J1MA 2B2YC 1OO9B 2MJ8A 4PQXA 5I2YA 1ZEQX 3A8JE 2LFNA 2PPBC 1GUSA 3D6WA 2QKIC 3HOWB 3GTQB 3WOFA 1I6VC 1HCZA 5ISRA 5DAUA 1ET9A 3L7ZC 3SK8A 1G91A 3MXPA 2OF1A 2KJXA 1RCVD 3D6CA 3R93A 4U673 5LL6X 1Q3LA 2XRSD 3HRZC 3NBIA 5D65A 3D31A 4KI0A 1HTPA 1I4HA 3H0GB 1S5CD 2PMZB 3BDCA 1LTGD 4FF4A 4HEDA 2JYOA 4MN3A 3GTPB 3NSWA 5D3DA 1SMYC 1WCMB 5EKLA 3SEBA 2TSSA 2A5HA 2C5CA 1JWMD 3ZYYX 3OMGA 1EYDA 1QCBD 1S5FD 5JPNC 4A93B 5C4XB 1H9SB 4YIJA 1SJHD 4K14A 4FNFA 2K04A 1I6HB 3Q24A 4XTCS 3FRPB 2OEOA 3H09A 1S4ZA 1GUTA 4KKSA 4RA8A 2FMCA 3NTHA 4MHEA 4NKLA 2HQEA 4IUUA 1TR5A 1DD2A 1STBA 2M2LA 2QILA 1RJTA 5JVH3 1QNKA 2MPMA 1VF7A 2EE1A 4QIWB 3H3VC 4C3JG 3V96A 1E2ZA 2NWGA 1F9PA 4X3TA 3M4YA 1KDCA 2EYFA 1TT2A 2FHTA 4B9WA 5EKIA 2LKVA 3CU7A 5CC4A 3A54A 2HUGA 3PMFA 2EYJA 4XIGS 1MGSA 3HOUB 2F0TA 2BDNA 2Q8IB 5KNBA 5NUCA 5KYIA 3FVQA 1IW7C 5C0XH 2KCCA 3EFXD 3GTKB 2HDMA 5I6WA 3NPPA 2IX1A 2KQ3A 1NCVA 2CVRA 2O5JC 4LAAA 2KCNA 1CQVA 3NHHA 2Z4IA 1D1KA 1CZWA 1O78A 4M1UB 4G7OC 3D3RA 4X3UA 1YNJC 5CBEE 2JSOA 2K05A 3EJIA 5AFWA 4ABNA 2PZWA 2IX0A 1L0XB 3WDNA 4DAPA 3J80L 1IYVA 5CBAE 1BUVT 2K03A 1I4XA 4BWGB 2NN6H 1U4LA 2F03A 1WVLA 4K8JA 2FFKB 3GQBA 3FPPA 1XTCD 2E76C 2RA4A 2A74C 3QWNA 2RDFA 1PZKD 2F0EA 5BN4A 3NP8A 5EPLA 5M3MB 1JR0D 4OL7A 4PMCA 3VYSA 5C3EB 4C3HG 1SYGA 2A6ED 4XXEA 2DNCA 1PRTC 4B9XA 1F77A 1U4PA 1FNUA 4DAYA 1PDQA 3KF8A 2F0UA 4DGZA 1Q8IA 1V8QA 3BG3A 4BA2I 5JOBA 3BS1A 2A68D 2EY1A 4K6DA 2JEBI 3E6ZX 1V1PB 5KNDA 1HTLD 3BYTB 1SNDA 4IALA 3MEHA 1DYQA 1Z7TA 4L8JA 1TQOA 5M3FB 4C3JB 1EEFD 5CV4A 2XN9C 1EOTA 4A3FB 4P2CB 3JAML 3DWQA 4TKOB 5F2DA 3E5SA 1ONLA 1ET6A 2PNRC 2K32A 4CJ0B 5KRUA 4RHRA 3VR6A 1TWCB 1HUNA 2OT2A 3SR1A 4QCLA 3OPOA 4ZUIA 1SSOA 2WACA 1HXYD 1CFMA 2F0GA 1ML0D 5IIFA 4XYOA 1B44D 1D1IA 3S2HB 1JC7A 5JAVA 2B2WA 1I4GA 3C3LA 3KBGA 3MC0B 5DM73 1MSGA 3A8IE 1PTOF 3FKIB 2NTTA 2J7ZA 4HMJA 4KY5A 5A2QL 1KTKA 4KN7C 3TBIB 1ENCA 4OO1G 4JK1C 2WIIB 3K58A 3BVMA 2ICIA 3TSSA 1EYCA 2F0KA 1STEA 2B2UA 1TWGB 2F0PA 1DOMA 3H91A 1U9RA 2K33A 2MGSA 4J6HA 5JEAG 3WOEA 1HQMC 4IN3A 1A3VA 3GV6A 3PUYA 4R8IA 2R3ZA 4FP5D 1BF4A 3FMCA 1EWCA 4H0LC 3HZXA 4C3HB 1ZYRD 4QF4A 2MHVA 3GTLB 4DF7A 3I91A 3VYUA 4V0BA 4IFDH 5T1IA 3T13A 2B8FA 4HCSA 3HOZB 1EYAA 3MFYA 1PTOB 2H4OA 2WINB 5T1GA 3K5LA 2A6HD 4O42A 3KLSA 2RSNA 2QCPX 4ULLA 5C4ZA 4K8IA 1DCZA 2SNMA 3K57A 1SFOB 1JWUD 1IKMA 2KVMA 2Z1CA 5KEEA 2XWJB 2QDBA 4DN4M 3IKJA 1KNEA 1YNND 3L9AX 5IODA 4RWSC 5JPMC 3N6RA 1XWEA 3I72A 1X32A 1H9SA 5CV9A 1KLUD 3A55A 3J7AF 1B53A 2ID0A 5J39A 3BVGA 3MZ5A 3TDQA 1I4PA 2F0IA 1EY9A 4ZK9B 3ERQA 2F0MA 3NTIA 2F0LA 3KLRA 3KK7A 2C9OA 3P20A 1ENAA 3R8BA 2QF7A 1B4OA 2XRQD 1JORA 1ICWA 3VA7A 5BN5A 1LT4D 1BR9A 2HDLA 1EY6A 3OHXC 3R2IA 5CYUA 2E74C 3W2DA 5I9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXG A;  2XSC A;  2GA4 B;  4M1U B;  1BOS A;  1CZG A;  4P2C B;  2BOS A;  1C48 A;  1C4Q A;  1CZW A;  1QNU A;  1CQF A;  4ULL A;  1D1I A;  1DM0 B;  1QOH A;  1R4P B;  1D1K A;  2C5C A;  1R4Q B; 
#chains in the Genus database with same CATH topology
 1RTO A;  1PYW D;  1OXT A;  4CHT B;  4GZY C;  4E6I A;  5FO8 B;  4A3L H;  1AEX A;  1K8M A;  1G2T A;  2RBM A;  5IWA L;  4LFB L;  1TWH B;  4RGN A;  2OTL A;  4Y7N H;  4RCN A;  5C4J H;  5IGF A;  4X65 Q;  3M7N A;  2RDG A;  1MKH A;  4DR5 L;  3AMU A;  3S9W A;  4GLA C;  1I94 Q;  5GAD C;  1CKN A;  5EBD A;  4FF3 A;  1SYF A;  1KRS A;  3S1R B;  4A3C G;  2NVX H;  4F88 A;  2CW0 C;  3ER0 A;  3MXG A;  1MIU A;  3D4W A;  1SYC A;  5C5M A;  2B2V C;  1F2Z A;  2NZO A;  2PZT A;  1BVS A;  5M9O A;  4DFA A;  1J8I A;  1TII D;  1OXU A;  2PQA B;  1HHV A;  1PTO D;  5IYD G;  4EQO A;  2OXP A;  4DNI A;  2JA8 G;  1YBY A;  3E9I A;  1UEB A;  1T5E A;  1Z47 A;  1D6E C;  1JIC A;  2BH2 A;  4R4C A;  3HOU G;  4DV4 Q;  3CQZ B;  1R4Q B;  1BBW A;  1BCP C;  3DEP A;  2G9D A;  2AUK A;  4V19 0;  3PSI A;  3I3C A;  4QIW E;  1S72 A;  4IUV A;  4F8M A;  2GVB A;  2A73 B;  4A3M H;  2D9U A;  4C56 C;  4DV0 Q;  2ES2 A;  2ALY B;  3TS2 A;  4FXG C;  1G8Z D;  3OSO A;  3ULJ A;  2VUM B;  3KF6 B;  1BQQ T;  1N9W A;  5CV8 A;  3GP7 A;  3NBH B;  2QA4 A;  4ZQ3 A;  3I4L A;  3QIA A;  1LTT D;  3I2Z A;  3DMU A;  5GAG C;  2EQS A;  1BOS A;  4C3I H;  4RAU C;  4LFA L;  3HKZ B;  4QJF A;  4N9P A;  3A7L A;  1M1K C;  4IPC A;  2DGY A;  4EQN A;  1WTH A;  4HAE A;  5IP9 H;  1IBM Q;  5ELC A;  5E7N A;  4A3E H;  1EIH A;  2ASB A;  2F0Q A;  1XXG A;  2MUY A;  1VQN A;  3J80 E;  2RHQ B;  5FKA C;  1UE1 A;  3CCE A;  2F3V A;  1EUJ A;  2UUA L;  2I5L X;  1ZKO A;  3F2D A;  2YU9 H;  4KHP L;  1GO3 E;  3L2P A;  2ZXP A;  3CCU A;  4ZYS A;  1C4Q A;  2OCE A;  5IT9 c;  4JI0 Q;  5IGC A;  4GOP A;  1VDZ A;  1W6J A;  1LLR D;  3U9O A;  4RKB A;  3OIP A;  4H02 A;  5DM6 3;  5M5W H;  1HNW Q;  3CC4 A;  2R93 B;  1YI2 A;  2R7Z H;  5M3M G;  1ROD A;  1KRT A;  1DGS A;  2AQ3 B;  4ME3 A;  1SR3 A;  1I5F A;  1JQY D;  1V1P A;  5C3E G;  4ZUJ A;  2L12 A;  2QGQ A;  2Z9H A;  3HOX H;  1O7I A;  3T1Y L;  2E5L L;  4GN3 B;  4POG A;  3PV0 A;  1DOK A;  4PZ8 A;  1F2M A;  2BA1 A;  2K01 A;  4YHH Q;  1WTW A;  1O7Z A;  5G3L F;  4BS9 A;  5K36 G;  1SNQ A;  4LF5 Q;  1M90 C;  1CTM A;  3FDT A;  1BXT A;  2BE5 D;  4DK1 A;  3S17 H;  2MO0 A;  4DUZ L;  5IE8 A;  4BXX G;  4POF A;  3Q23 A;  3EQL C;  5JEA J;  3CAM A;  2WV6 D;  1JWS D;  4NP5 A;  4RG1 A;  3GO5 A;  2B2T C;  3J7Y W;  1DM0 B;  1TU2 B;  4A3I H;  1GOZ A;  1SAP A;  4CBV A;  5EGT A;  2PQE A;  1LTI D;  4G57 A;  1TS5 A;  2A69 D;  1ESR A;  5E4X A;  1D5M C;  1PRT F;  3TRZ A;  1TVX A;  2BDO A;  3A56 A;  4JI1 L;  4JYA L;  1EQQ A;  4B3S L;  4OO1 I;  3D8G A;  3A5U A;  4B3R Q;  3NQI A;  3JAM E;  1AFP A;  1C9O A;  4UPA A;  3AB9 A;  1E2W A;  4LF8 Q;  2J0T D;  5FLX L;  1HNZ Q;  2EZV A;  1EY0 A;  2L55 A;  2JA8 B;  1CKN B;  1Y14 B;  2ZT9 C;  2UUC Q;  3I4N H;  4DR4 L;  1WI5 A;  2VQE L;  1A3T A;  1DON A;  3M4Q A;  3KLW A;  1PFS A;  4FDB A;  2K5N A;  3QR8 A;  4KMU C;  3S14 B;  5C5L A;  4JBK A;  3CMA A;  2K5Q A;  1K83 H;  1XJV A;  4YCW A;  1WTR A;  3PUX A;  2K4K A;  5M5Y B;  4YWL A;  1Q82 C;  1E2V A;  1FNW A;  2Z6K C;  1E0B A;  4DA2 A;  2J4X A;  5AJ3 L;  2UXD Q;  3DUZ A;  3U4V A;  2A19 A;  4BY1 B;  2HQL A;  1EY4 A;  2NVY B;  4PV1 C;  4K0K Q;  1X54 A;  5FLX c;  2R6G A;  1RTN A;  3K5M A;  1SRU A;  2F4I A;  2EY2 A;  3A5Z B;  1LT5 D;  1XPO A;  3D4R A;  3FKI G;  4A3G H;  4JI3 Q;  2F0F A;  4O2D A;  4GKJ Q;  3HEJ A;  4QUC A;  3GTO H;  5IGE A;  4TSS A;  4UDU C;  2EYO A;  2BCO A;  3CPF A;  4GS3 A;  2XIW A;  3TP8 A;  5A2Q E;  4P73 A;  5BN3 A;  3ERS X;  1PRT B;  4DR6 Q;  3PUW A;  4DNT B;  3CME A;  2Q2U A;  3K59 A;  2M00 A;  4X62 Q;  1NBW A;  5JJZ A;  1BNZ A;  1FJG L;  1K8O A;  4IJH A;  3R2T A;  2A68 C;  2VQF L;  1C48 A;  5M5X H;  2N49 A;  4DAM A;  3K5N A;  4FF2 A;  3TN2 A;  1AW7 A;  1IKL A;  2E2J H;  5IP7 H;  5CV5 A;  4FYD A;  2VXW A;  3AFP A;  1KIX A;  1UAP A;  1N33 L;  4HN7 A;  4L5Q A;  4LNQ A;  4MIU A;  1GUN A;  1SEB D;  4A3B H;  1XMO L;  4YY3 Q;  2F4V L;  2UXB Q;  1IW7 D;  3JC6 6;  2F0H A;  1VF5 C;  4ZAI A;  1XNQ L;  1Y1W H;  2SOB A;  2JA7 B;  2IY5 B;  1MSH A;  2X69 A;  4DK0 A;  1MI2 A;  1Y1V B;  1G29 1;  1XMQ Q;  2XVS A;  3H3V I;  1NY4 A;  1EQV A;  4IUQ A;  4A75 A;  4HSP A;  1EWI A;  3HOV H;  3J81 j;  3MHB A;  4XT1 B;  4JI6 Q;  4RGT A;  2X6L A;  3QOL A;  2Z8L A;  3UE0 A;  2JA5 B;  3RNU A;  2EIF A;  1UEA B;  1M8A A;  3HOZ G;  1HFN A;  1YNJ D;  5IYB H;  1VS0 A;  3I73 A;  1KAB A;  1GJX A;  3U50 C;  1SYB A;  4WJ3 M;  2I5H A;  2EYH A;  1L2F A;  1LT6 D;  4BBS B;  3P7J A;  5C44 G;  1LTA D;  3NWS A;  1QE6 A;  4ZKB B;  3PUZ A;  4KV6 A;  2Q8T A;  4IUP A;  3HGB A;  3M85 A;  1A2T A;  1N34 L;  1HR0 L;  3PIO 3;  3J81 L;  4LF9 Q;  2VNU D;  2L5T A;  5G3L D;  2WB1 B;  4HJ9 A;  3J81 i;  3MVV A;  3F1Z A;  3VYR A;  4AYB B;  4UP7 A;  1UE6 A;  4JI4 Q;  5EPJ A;  4LF4 Q;  1I4R A;  4JI2 L;  4NXM L;  2CFM A;  3VR5 A;  3M4O B;  2VB2 X;  5FLM G;  4TQU S;  4CDF C;  3RLF A;  1GXD C;  1PMR A;  1RD9 D;  3S1N H;  3KLS X;  1P8L A;  2NZH A;  2Z4H A;  1VQF A;  3A8K E;  2UUB Q;  1B9M A;  3LGJ A;  3VR2 A;  2UU9 Q;  3J81 c;  3W1B A;  1PRT D;  2EYL A;  1E22 A;  1QVC A;  1VQB A;  3K7A H;  2PNH A;  1TWF B;  1VMC A;  3GTM B;  3CKI B;  1G6P A;  2ZM6 L;  4JI7 Q;  3ND9 A;  2JP1 A;  4EQP A;  1CHP D;  2R92 B;  1G51 A;  1IZ6 A;  1L1O A;  3LX0 A;  2KEN A;  4DR2 Q;  2B2Y A;  3IFT A;  4WJW A;  4K2L A;  1VQM A;  4HCE A;  4BY7 G;  4LF6 L;  1X6O A;  3GTJ B;  4TVA B;  2L11 A;  4DR1 Q;  1EY8 A;  4DPG A;  1IL2 A;  1OXS C;  1EY7 A;  1PXU A;  1A3U A;  1SMX A;  3N52 A;  4BBR B;  1V1O A;  2PQA A;  1YJ9 A;  3C1F A;  1UNS A;  5IOC A;  3RR5 A;  5E4W C;  3PO3 G;  1ZYR C;  1LAC A;  1Q7Y C;  4N8F A;  4LJZ C;  1R9T B;  4R8N A;  5GQO A;  5LMU Q;  4KJN A;  3GTG H;  3BJU A;  2GA4 B;  4DV6 L;  3X3M A;  1MBY A;  1PHJ A;  5FJ8 G;  3K0Y A;  4JPB W;  2B63 G;  3K0X A;  3HOY B;  5M3F H;  4C3J H;  3M4P A;  2EXZ A;  5LMN W;  1HRJ A;  4CKE A;  5ELE A;  1JJG A;  3RZD H;  4EGV A;  5J22 A;  1AZQ A;  1HZA A;  4A3F H;  2RVL A;  1ILQ A;  2I07 B;  1Q12 A;  1J5E L;  1B3A A;  4UAI A;  2IT1 A;  3PF5 A;  2YTY A;  4KTA A;  3U4Z A;  2RF4 A;  3NBH A;  3MFG A;  1VCI A;  4OWT B;  1YIJ A;  5D3I B;  2AUJ D;  1CHQ D;  4AH6 A;  1CZG A;  4ME5 A;  1GUO A;  3HP3 A;  1A6X A;  2EXD A;  1Q90 A;  2F1M A;  4EVO A;  4LFC Q;  1X3E A;  2K1B A;  3BDL A;  4DAV A;  2K6A A;  4JW0 A;  4WOR A;  2L4N A;  1EZ8 A;  4P75 A;  4KD3 A;  1J9O A;  4DNR B;  3TP6 A;  1GHK A;  3S2H H;  1HZ9 A;  3W3A A;  3PO2 H;  1B9N A;  5IWA Q;  2RDH A;  4JI5 L;  4JBW A;  4JI8 L;  5C6A A;  2K14 A;  3TP5 A;  5IT9 E;  3T51 B;  2XTI A;  1PFM A;  4ZLT F;  1SRO A;  5JJK A;  3DEO A;  3SE0 A;  1LTL A;  2NBF A;  4RFB A;  1BCP F;  2UXC L;  1VQP A;  1UWV A;  2RCN A;  5C44 B;  4LF7 L;  1QOH A;  5IGG A;  1HFG A;  4OHJ A;  2IHF A;  1FGB D;  2F0W A;  2KEC A;  4Y7N B;  1YEZ A;  4ODG A;  3KFU A;  1JE4 A;  1PH6 A;  1LO5 D;  2DNE A;  2SDF A;  4XT3 B;  1QWY A;  1A8V A;  4GNX C;  1O7Y A;  3MA2 B;  1XPR A;  2NYZ D;  2NVX B;  2D0P A;  4N9T A;  3E0E A;  2QW7 A;  4ZKC B;  1TWG H;  1TY2 A;  1VQ8 A;  1G6Z A;  1SXT A;  3G71 A;  3HKZ E;  5EJW A;  5BR8 L;  1TXY A;  1PH4 A;  1FD7 D;  3I8Z A;  3VYT A;  5TSS A;  2Y0S B;  2N78 A;  3FEW X;  5KGU A;  4AQY L;  3TME A;  2E2I H;  4IPD A;  2OQK A;  3Q6S A;  2QDL A;  4I7Z C;  1JB3 A;  3C2P A;  1H9M A;  1L0Y B;  1SNC A;  5D14 A;  5IYC H;  5HY6 A;  4C3H H;  1I4Q A;  3S16 H;  5FO9 B;  1BBX C;  1XNR Q;  3RN5 A;  4G7H C;  5C0X G;  4KHV A;  1ENF A;  4A3M B;  3NE5 B;  1XPU A;  2AHO B;  5E3F A;  4BY7 B;  2EJM A;  2HT1 A;  3PCO B;  1XYI A;  1EU3 A;  3ITP A;  1BCP B;  1PTO H;  3VR4 A;  4CKC A;  3CCS A;  1EY5 A;  1EQT A;  1LTB D;  1PVO A;  1HQR D;  1I50 B;  4XQJ A;  2KCM A;  4HR7 B;  4KY6 A;  3P1H A;  2K28 A;  2SEB D;  4EQ5 A;  4C3I B;  2K7V A;  4KD4 A;  1X65 A;  4KK7 A;  1QZH A;  3PO3 B;  3Q8D A;  1KXL A;  1L1O B;  2MNA A;  1SFO H;  2JK8 A;  4BA1 I;  2JA6 H;  1B2T A;  2O5I C;  1RDP D;  1F2Y A;  1CK1 A;  2JA9 A;  3RZO H;  3LWU A;  2B63 B;  1F9R A;  2I0Q A;  1AP0 A;  3T56 B;  1LTR D;  5J3B A;  3K7U C;  1E3P A;  4DV3 L;  2BH8 A;  1IBK L;  3M3Y B;  3AQQ A;  3MWY W;  3QJY A;  2YV5 A;  2YU9 B;  5ELF A;  4X3K A;  4DU9 A;  2CQA A;  3EVQ A;  3OWE B;  3J7A 5;  5FLX E;  2VZA A;  4NXN L;  3GD7 A;  3G6E A;  3OMC A;  2E2D C;  2PW5 A;  1HA5 A;  4HMI A;  4EX5 A;  1SBB B;  1TS2 A;  4DUY L;  4HJA A;  3QB3 A;  4CDC C;  1KLG D;  1VQC A;  2ZTC A;  3T1Y Q;  2E5L Q;  1PZI D;  1HA6 A;  3I70 A;  5CV7 A;  4BY1 G;  2GVA A;  4C1N K;  4FVM A;  4CJ2 C;  4DXG A;  4L63 B;  3LWE A;  4ALP A;  4TRD A;  5KIX A;  3HFZ B;  3S2D H;  4DR7 Q;  4QUF A;  1TS4 A;  1SJE D;  1SDF A;  3HOX B;  3R3O A;  1FNV A;  1O80 A;  2AWO A;  5DLQ E;  5IT9 L;  1F9S A;  2MP1 A;  2WKD A;  1D2B A;  3PIO A;  3V2T A;  1A63 A;  4JVZ A;  2LMC B;  4A4I A;  5LL6 S;  1D5X C;  4XYQ A;  2B2W C;  3PF4 A;  2L0C A;  5JVG 3;  1TWA H;  1LUZ A;  5LHY 1;  3KUP A;  1VQI A;  2CW0 D;  1I3Q H;  1C7Y A;  3S17 B;  2VL6 A;  4WFN 3;  3S1M B;  3IFD A;  3IAY A;  4MZ9 A;  1F2L A;  2PI2 A;  4LUZ A;  3S1R H;  5IGB A;  3TZD A;  4OIJ A;  3NTK A;  1SYE A;  2PO4 A;  4B3S Q;  4OO1 H;  4R4T A;  3PUV A;  2BE5 C;  2K5H A;  4A3I B;  1Q1B A;  4CJ1 B;  2B39 A;  2DY8 A;  4OGQ C;  4A3K H;  4X65 L;  1JE5 A;  3IRB A;  3K5O A;  4P71 A;  4QY7 A;  1II3 A;  4CGY B;  1I94 L;  1CT1 D;  1EQR A;  5A35 A;  1IYU A;  4JG2 A;  4DR4 Q;  1D5Z C;  3FPU B;  2VQE Q;  1BCP D;  2EYM A;  2WFW A;  4ILW A;  2JE6 I;  2E2H H;  2B2U C;  2A69 C;  1WFQ A;  1Y69 U;  1YJW A;  3D0F A;  5JEA H;  3G7L A;  1N8R C;  3I4M H;  4DXF A;  4Q0F A;  4R4Q A;  1TKW B;  1D7Q A;  5KYL A;  4C2M H;  2JA7 G;  1Y1V G;  3I4N B;  1V43 A;  4JV5 L;  4K5X A;  4AIM A;  2NVT B;  1FYC A;  1CKM A;  3S15 H;  3OOC A;  5I4D A;  5I6Y A;  1ESF A;  3CW2 C;  1X3F A;  3OW7 A;  1JOK A;  2JA5 G;  3IL8 A;  5C4H A;  3SDZ A;  3SK4 A;  1K83 B;  3FP9 A;  1S5D D;  3C1E A;  1JOO A;  4MTN A;  4A3D H;  2OTJ A;  1CA6 A;  2VUM H;  4RGM A;  1HZC A;  1STH A;  1STY A;  4RH6 A;  4C1N I;  5EQ0 A;  3A7A B;  5I9O A;  3NK9 A;  1K0R A;  2L1B A;  3UDF A;  2KOL A;  2N8N A;  3CHB D;  1NAP A;  3MAQ A;  1WTV A;  2RSO A;  4IQZ A;  3SK5 A;  1OTC A;  1EIF A;  4BBS G;  4DV0 L;  1PLF A;  1PYS B;  3RMH A;  3HOW H;  3SHL A;  3GTQ H;  2LXK A;  4HSV A;  1VQG A;  4FF1 A;  4LW1 A;  4M8A A;  2PI2 E;  1GHJ A;  4LMQ D;  3VDY A;  1CKO A;  2EJF C;  4A3G B;  2PW7 A;  1A2U A;  3GTO B;  2WB1 G;  1FJG Q;  4KJO A;  3HG9 A;  1KC8 C;  4CDE C;  2PZU A;  1T9H A;  3J81 E;  1S40 A;  4AYB G;  4KKT A;  1VQD A;  4DV5 Q;  1NJI C;  1H9R A;  1ASZ A;  1O7L A;  3PGZ A;  5E1F A;  4NB3 A;  3BU2 A;  2SNS A;  2B8G A;  2D2C C;  2FMM A;  4DR3 Q;  1IBM L;  3AFQ A;  4R4O A;  3GV3 A;  1SMY D;  3H6M A;  3H0G H;  4NMZ A;  1N33 Q;  5CMD A;  2KED A;  3EA6 A;  2YTX A;  4L5R C;  1A15 A;  5M5X B;  3GTP H;  3L3O C;  2F4V Q;  1GUW A;  2E2J B;  4RGO S;  3V05 A;  5EBC A;  1XNQ Q;  2ATW A;  1WCM H;  1YVC A;  1QVG A;  4HTH A;  2R93 H;  2EOT A;  1X55 A;  3SK6 A;  2B29 A;  3H3V H;  1YIT A;  1CQF A;  1U4R A;  3P75 A;  2Z0S A;  4P72 A;  4A3B B;  4IZ8 A;  2V4D A;  1HUM A;  3UDX A;  4A93 H;  3F2B A;  5C4X H;  2WB1 E;  1DOL A;  2R92 G;  1Y1W B;  3B6Y A;  3VA5 A;  4AYB E;  4I65 A;  1I6H H;  1GVP A;  4ID6 A;  1KDB A;  2LY7 A;  2N88 A;  4DV7 L;  4KY7 A;  4ZRZ A;  1J6Q A;  3BDO A;  1EZ6 A;  3O13 A;  4K2K A;  1Q81 C;  1M4V A;  3ICE A;  3HOV B;  1JCK B;  4PMB A;  4BBR G;  4Q5V A;  4GLX A;  4IFD G;  2JXM B;  1NSN S;  3QG1 A;  2HHH L;  3NWT A;  4YWM A;  1SYD A;  4KLK A;  5C3X A;  1TS3 A;  4U68 A;  2A6E C;  2CWA A;  4RHS A;  1S5B D;  2KHS A;  3K80 C;  2XGT A;  1N34 Q;  1HR0 Q;  4FXK C;  5CR3 A;  3QO2 A;  3QOJ A;  2NVQ B;  1EFI D;  4Z9C B;  1K73 C;  4LF5 L;  3BZC A;  1WD1 A;  3HOY G;  3I56 A;  2ICE C;  1BO0 A;  1SNP A;  1IXR A;  4A3C H;  4GKK L;  4X64 L;  1MD2 D;  1JOQ A;  2P5Z X;  4CKB A;  3H15 A;  1CM9 A;  5IGD A;  5C0X J;  1X56 A;  1K28 A;  1STN A;  2CHB D;  3NUC A;  1X3Q A;  4JOI A;  2KHJ A;  1H9K A;  4G7Z C;  1W6K A;  2NZ1 D;  5IYD H;  3OIQ A;  2VS1 A;  5C3W A;  2JA8 H;  2K52 A;  5COR A;  1SNM A;  2F0O A;  2FJ2 A;  2F0S A;  1VQ9 A;  2HCC A;  4OWW B;  3HOU H;  3S14 H;  4O1N A;  2AQ1 B;  3S1N B;  4IPG A;  1DJR D;  1BBU A;  2ZM6 Q;  1HNZ L;  1CI3 M;  5FOB B;  1IYJ B;  1B50 A;  1KNA A;  2O4X A;  4H13 C;  3UDI A;  3K6O A;  2CKZ B;  3GTK H;  4R1J A;  2NB0 A;  4N8X 1;  1NUC A;  3K7A B;  1LTS D;  2EY5 A;  4YCV A;  1LAB A;  4H7B A;  2EYP A;  4LUV A;  5I2X A;  1N32 L;  2IJ0 A;  3J7Z C;  3MTS A;  2IWH A;  5C0X I;  1AZP A;  4R4I A;  3W1G A;  1WTX A;  4JBM A;  4A3L G;  3Q22 A;  1NNX A;  1HJP A;  1RF2 D;  1UE7 A;  1ASY A;  4K0K L;  3Q0A A;  1VQ4 A;  4H44 C;  4A3J B;  4DK6 C;  5IY0 A;  4DV6 Q;  4DV2 L;  1AE3 A;  5JJL A;  3OWF A;  1HPC A;  3BVZ A;  4JI3 L;  2KEE A;  3J7A V;  3CCQ A;  2TMP A;  2R61 A;  1S5E D;  2B2V A;  1XX8 A;  2K5D A;  2RKS A;  3NXW A;  5COY A;  3DHQ A;  3KBX A;  4I7A A;  4PZ7 A;  3GTG B;  3U9S A;  2N55 A;  1PZJ D;  1J5E Q;  2M9V A;  1Y8O B;  3BYY B;  2WAQ B;  1C8C A;  1U0L A;  2Q2I A;  4MNO A;  4KKU A;  4UP9 A;  1H95 A;  2EY6 A;  1OXV A;  3KJO A;  4DR6 L;  3G48 A;  2NN6 I;  1WTQ A;  2E75 C;  3RZD B;  2X6G A;  1Y8N B;  2Y0S G;  4GOP C;  2YTV A;  2LXJ A;  2F0V A;  1WOC A;  1QG7 A;  5M3M H;  1SE2 A;  3DWP A;  1YNX A;  3SVM A;  3NEL A;  4PMW A;  1NR2 A;  5C3E H;  2ENB A;  2AKW B;  3ONA B;  2IPK D;  2VW9 A;  2A1A A;  3SXH A;  1KD1 C;  1X3G A;  3E9H A;  4QQB X;  3RD4 A;  4A3M G;  2G9H D;  4YY3 L;  4JI5 Q;  1QB5 D;  3MXN A;  2L9H A;  1EWH A;  3T1H L;  3I90 A;  5K36 H;  3X3N A;  5LMN L;  1FGU A;  3MXU A;  4CDD C;  3CCJ A;  2UXC Q;  1TY0 A;  2PYK A;  4FXD A;  1NR4 A;  4S3S A;  4BXX H;  4JI6 L;  3PO2 B;  4C3I G;  4LF7 Q;  5HGQ A;  2K5W A;  3LNN A;  2GN5 A;  1QVF A;  3H94 A;  1B8A A;  4QMG A;  2ZTE A;  4F7X A;  5IP9 G;  4HJ5 A;  2LS0 1;  4G4K A;  4A3E G;  2D62 A;  4IUR A;  1STG A;  2CWP A;  2ZXO A;  2Q8R E;  4QB4 A;  3KJP A;  1HNX Q;  1QJO A;  1EIG A;  2A6H C;  1DXM A;  5ELB A;  3EN2 A;  4OIK A;  1ICF B;  1SE3 A;  1Z6H A;  2O2L D;  1EEI D;  5CV6 A;  5BR8 Q;  3M4O H;  3CP0 A;  3F2U A;  3L0O A;  5KNC A;  2H1E A;  1Q86 C;  2WP8 J;  3OTO Q;  1YNN C;  2WKC A;  4FO2 A;  4RMF A;  4JI4 L;  2IL8 A;  1LT3 D;  1TWC H;  1QNU A;  1LV9 A;  1GD7 A;  2BA0 A;  3G4S A;  5EKK A;  2R7Z G;  5FO7 B;  2NTS A;  2KA7 A;  4MTK A;  3TQY A;  3S24 A;  5HGT A;  4GNX B;  4L6T B;  3E3X A;  5CGK A;  1G2S A;  2DJG C;  5ELO A;  3HOX G;  2E2I B;  2F3I A;  3MEF A;  2AWN A;  4F87 A;  1ZXT A;  2UUB L;  3TRE A;  1UUP A;  2DUD A;  4LFB Q;  1EU4 A;  2HIX A;  1CUK A;  3S16 B;  4DV1 L;  4DK3 C;  3S1Q B;  2EPB A;  2I5M X;  4DR5 Q;  2H5X A;  5GAE C;  5J1Z A;  1GUG A;  3FKI H;  4XQQ A;  1ILP A;  2AQ2 B;  1VQ6 A;  1E1O A;  5K5P A;  5FK9 C;  2FIN B;  1IHZ A;  2B2T A;  2IW3 A;  5C4J B;  3VR3 A;  3STB D;  2F0N A;  1SE4 A;  1R9T H;  1PFN A;  2JN4 A;  3TZU A;  4A3I G;  3M7G A;  4X66 L;  1VQJ A;  4DV3 Q;  4RKL A;  1UE5 A;  1RKN A;  1IBK Q;  1X3P A;  3DXJ C;  2F3W A;  2RCF A;  1Q1E A;  2JA6 B;  3UE1 A;  4RCO A;  2RHS B;  3SGI A;  4NXN Q;  4DAY B;  3RZO B;  3CRL C;  1XTD A;  1BDO A;  3KF8 B;  4R9W A;  4KHZ A;  3C46 A;  4IUN A;  2KBN A;  1MJC A;  2DY7 A;  4NDX A;  4IFD J;  4OXP A;  5DNF A;  4PG3 A;  2IX3 A;  2NUC A;  4DUY Q;  4Y52 H;  1WTP A;  2JEA I;  4B3T L;  2KUM A;  3I4N G;  1QIL A;  1B70 B;  3NEN A;  3W5O A;  3DM3 A;  4LK1 C;  1IBL L;  1PYB A;  1DZ1 A;  1K3B C;  2Z6K A;  2K75 A;  1PTO C;  1V9P A;  1WTO A;  1R4P B;  4X6A H;  1E24 A;  2EVB A;  1KDA A;  1Q46 A;  1U4M A;  2XNA C;  3GTL H;  3RUZ A;  1GKH A;  4LFA Q;  4WRD A;  4K5V A;  1N36 L;  1STA A;  1VQE A;  3T16 A;  3UDG A;  2VY3 A;  4K5W A;  1YZ6 A;  3T4A C;  3HOZ H;  1FR3 A;  3S2D B;  4IUT A;  4LFC L;  2FXQ A;  3DWA A;  4B3M L;  2JQO A;  1VMP A;  4B08 A;  2G5D A;  3KYH C;  4A3G G;  1RHP A;  4IFD I;  2D5D A;  3T53 B;  2UUA Q;  2MO1 A;  5C44 H;  4WJ4 A;  1PH9 A;  1WD0 A;  1TWA B;  3FHW A;  4KHP Q;  3MXN B;  4A3E B;  1I3Q B;  2BOS A;  5JJI A;  4OX9 L;  2F0J A;  2YYZ A;  2I46 A;  3G6J B;  3URY A;  2RQX A;  1AN8 A;  1Z9F A;  5DEH A;  4KN4 C;  1SNO A;  2NN6 G;  4QL5 A;  3E0J A;  1VQO A;  2XWB B;  1KAA A;  1PFB A;  1B1Z A;  4PNY A;  3HS0 C;  5ELD A;  2PCF B;  2HCI A;  1T5X D;  3CF5 A;  4A3K B;  5IP7 G;  4NW2 A;  3NQT A;  5FLM H;  2CCZ A;  1D8L A;  2F0D A;  3TP7 A;  3D4D A;  3OYY A;  1EL0 A;  2QEJ C;  4JV5 Q;  5GRO A;  1U5K A;  5H1S E;  2EJG C;  3PIP 3;  5EPK A;  5M5W B;  1IL8 A;  3AU7 A;  1QUQ B;  4A3B G;  2E2H B;  4OWX B;  3ND8 A;  2R7Z B;  4J8Q A;  4JBJ A;  2AMC B;  4YWK A;  1F9Q A;  1Y1W G;  3I4M B;  4K6L A;  4XQN A;  1CA5 A;  1JMC A;  4C2M B;  3CD6 A;  3EIV A;  3BZD B;  3CRK C;  3UI2 A;  2XSC A;  1SE8 A;  4IOA A;  1OXX K;  1EIY B;  4XDX A;  3HOV G;  3S15 B;  4DUZ Q;  2EDG A;  2VB3 X;  2DN8 A;  1Y8P B;  1NMF A;  5HUR A;  4BY7 H;  1H9J A;  3DM1 A;  1L1O C;  2ZXR A;  4X3S A;  1TWH H;  4A3D B;  3ERO A;  4J1M A;  1GM5 A;  2B2Y C;  1OO9 B;  2MJ8 A;  4PQX A;  5I2Y A;  5IYB G;  1ZEQ X;  3A8J E;  3RLO A;  2LFN A;  1XNR L;  2PPB C;  1I50 H;  1GUS A;  3D6W A;  2Z6B A;  5L37 A;  2QKI C;  3DLL A;  3CXC A;  3PO3 H;  3HOW B;  4JI1 Q;  3GTQ B;  4JYA Q;  4UP8 A;  3WOF A;  1JT8 A;  1I6V C;  1HCZ A;  5ISR A;  1PH8 A;  5DAU A;  1ET9 A;  3U58 A;  3L7Z C;  2CQO A;  3SK8 A;  5FJ8 H;  1G91 A;  3MXP A;  4J15 A;  2B63 H;  2OF1 A;  2KJX A;  1RCV D;  2CH4 W;  3D6C A;  3R93 A;  4U67 3;  5LL6 X;  1Q3L A;  2JJQ A;  2XRS D;  3HRZ C;  4GLV B;  3NBI A;  4OEL B;  4L5S A;  3M3Y H;  4JCV E;  5D65 A;  1NE3 A;  3D31 A;  1WYD A;  4KI0 A;  1K8G A;  1HTP A;  4A76 A;  2ZJP A;  1JB7 A;  1I4H A;  3H0G B;  1S5C D;  2PMZ B;  3CQZ H;  1EYG A;  3BDC A;  1LTG D;  4FF4 A;  4HED A;  5AJ3 Q;  3RLN A;  2JYO A;  4MN3 A;  4LWC A;  3GTP B;  3NSW A;  5D3D A;  5ELN A;  1SMY C;  1FVI A;  4HJ7 A;  1WCM B;  5EKL A;  3SEB A;  2TSS A;  2A5H A;  2C5C A;  4DV4 L;  1JWM D;  4DV7 Q;  1RIP A;  4HJ8 A;  3ZYY X;  3OMG A;  1NTG A;  1EYD A;  1QCB D;  1S5F D;  5JPN C;  4A93 B;  5C4X B;  1H9S B;  3TS0 A;  1JJC B;  1SJH D;  4K14 A;  4YIJ A;  2HHH Q;  3CCL A;  4FNF A;  2K04 A;  1MHW C;  1I6H B;  3Q24 A;  2A8V A;  4XTC S;  3FRP B;  4UY8 C;  2OEO A;  3H09 A;  1S4Z A;  1GUT A;  4KKS A;  4A3J G;  1YHB A;  4DR7 L;  4RA8 A;  2FMC A;  3NTH A;  4MHE A;  4NKL A;  2MQH A;  3S1M H;  2HQE A;  1FL0 A;  1TR5 A;  4IUU A;  4GKK Q;  4X64 Q;  4APV A;  2VQF Q;  3CCM A;  2B3G A;  4IOC A;  1DD2 A;  1STB A;  2M2L A;  2QIL A;  1MJE A;  1RJT A;  5JVH 3;  1X9N A;  1E1T A;  3M9B A;  1QNK A;  2MPM A;  1VF7 A;  1KAW A;  2EE1 A;  2WAQ G;  4QIW B;  3H3V C;  1HZB A;  5M3F G;  4C3J G;  3V96 A;  1E2Z A;  2C35 B;  1K9M C;  3K81 C;  2NWG A;  1F9P A;  1LYL A;  1XMO Q;  4X3T A;  4A3F G;  3M4Y A;  1KDC A;  3KDF A;  2EYF A;  1TT2 A;  2FHT A;  4B9W A;  2K50 A;  5EKI A;  4JI0 L;  2LKV A;  3AYH B;  2MFI A;  3CU7 A;  5CC4 A;  3A54 A;  2HUG A;  3PMF A;  2EYJ A;  2NVT H;  1A62 A;  4XIG S;  1HNW L;  1MGS A;  3HOU B;  2F0T A;  1VQH A;  2BDN A;  2Q8I B;  5KNB A;  1N32 Q;  5NUC A;  5KYI A;  3FVQ A;  1IW7 C;  5C0X H;  2WAQ E;  2KCC A;  3EFX D;  3GTK B;  2HDM A;  5I6W A;  3NPP A;  3WWV A;  2IX1 A;  2KQ3 A;  1NCV A;  3PO2 G;  2CVR A;  4OON A;  2O5J C;  4LAA A;  2OWO A;  2OQ0 A;  4YHH L;  1W2B A;  4LUO A;  2KCN A;  1CQV A;  1PA6 A;  3NHH A;  2Z4I A;  1D1K A;  1CZW A;  1O78 A;  4DV2 Q;  4M1U B;  4G7O C;  3D3R A;  1VQL A;  4X3U A;  4UHV A;  1YNJ C;  3CCV A;  5CBE E;  2JSO A;  2K05 A;  4JI2 Q;  4NXM Q;  3EJI A;  3HKS A;  5AFW A;  3CC2 A;  4ABN A;  2PZW A;  2IX0 A;  1L0X B;  2F52 A;  3WDN A;  4DAP A;  3J80 L;  1IYV A;  4GNX A;  5CBA E;  1BUV T;  3J80 i;  3F2C A;  1HH2 P;  2K03 A;  1I4X A;  1PH1 A;  4BWG B;  4QGU A;  4GN4 B;  2LSS A;  2NN6 H;  1U4L A;  1VQK A;  2F03 A;  2N3S A;  1WVL A;  4DV5 L;  4K8J A;  2FFK B;  4B3R L;  3GQB A;  4DR3 L;  3FPP A;  4OEM B;  1C0A A;  1XTC D;  4LF8 L;  2E76 C;  3K8A A;  2RA4 A;  2A74 C;  3QWN A;  1KQS A;  5M5Y H;  1YHQ A;  2UUC L;  1KHI A;  3J80 c;  2RDF A;  1PZK D;  2F0E A;  5BN4 A;  3NP8 A;  5EPL A;  4BY1 H;  5M3M B;  1JR0 D;  4LF6 Q;  4IO9 A;  4ZCK A;  2NVY H;  4JC0 A;  4OL7 A;  5IYC G;  4PMC A;  3VYS A;  3T1H Q;  5C3E B;  4C3H G;  5LMN Q;  1BKB A;  1SYG A;  1JJ2 A;  2A6E D;  5EAY A;  4XXE A;  4GOP B;  2DNC A;  1A0I A;  4GN5 A;  2UXD L;  1PRT C;  3TEH B;  3F8T A;  4B9X A;  1CSP A;  1F77 A;  1VQ7 A;  1U4P A;  1FNU A;  3EBE A;  3AEV A;  4DAY A;  1PDQ A;  3I7F A;  3KF8 A;  2F0U A;  4DGZ A;  1Q8I A;  1V8Q A;  3BG3 A;  4BA2 I;  5JOB A;  3BS1 A;  2A68 D;  2EY1 A;  4K6D A;  2JEB I;  3E6Z X;  1V1P B;  2NVQ H;  5KND A;  1EFW A;  3PQI A;  1HTL D;  3BYT B;  4GKJ L;  2ZJQ A;  1SND A;  1P16 A;  4IAL A;  2JA6 G;  2DJF C;  3MEH A;  1DYQ A;  3PIP A;  1Z7T A;  4L8J A;  1PH3 A;  1TQO A;  5M3F B;  4C3J B;  1EEF D;  5CV4 A;  2V1C C;  2XN9 C;  2HIV A;  1EOT A;  4X62 L;  4A3F B;  4P2C B;  3JAM L;  3DWQ A;  4TKO B;  3JAM i;  2K5V A;  5F2D A;  1L0W A;  1SLJ A;  2IHE A;  1KL9 A;  2JA7 H;  3E5S A;  1HR0 W;  1ONL A;  1Y1V H;  1ET6 A;  2PNR C;  2K32 A;  4CJ0 B;  3ZJY C;  1PH2 A;  5KRU A;  4RHR A;  3VR6 A;  1TWC B;  1HUN A;  2OT2 A;  3SR1 A;  4QCL A;  2E8G A;  2UXB L;  3OPO A;  1K8A C;  4JI8 Q;  4PZ6 A;  1PH7 A;  2JA5 H;  4ZUI A;  1SSO A;  2WAC A;  1HXY D;  1CFM A;  3KDF B;  2F0G A;  4DV1 Q;  1XMQ L;  4HIM A;  1E7Z A;  1ML0 D;  5IIF A;  3JAM c;  4XYO A;  1B44 D;  1D1I A;  3S2H B;  1JC7 A;  5JAV A;  1YJN A;  2B2W A;  2Y0S E;  1I4G A;  4BBS H;  3I4O A;  3C3L A;  3KBG A;  3MC0 B;  5DM7 3;  1MSG A;  1SN8 A;  4A3J H;  3A8I E;  2CH4 A;  1B7Y B;  1PTO F;  2NTT A;  3FKI B;  4X66 Q;  2J7Z A;  4HMJ A;  1QUQ A;  4KY5 A;  5A2Q L;  1KTK A;  2R7F A;  4KN7 C;  3TBI B;  1ENC A;  4OO1 G;  4JK1 C;  4HIO A;  1K3R A;  2WII B;  4YCU A;  1VQA A;  3K58 A;  4A3K G;  3BVM A;  4LF9 L;  3GDE A;  2ICI A;  3TSS A;  4DKA C;  1EYC A;  4B3T Q;  3STB C;  2F0K A;  1STE A;  4AQY Q;  2B2U A;  1TWG B;  4LF4 L;  2F0P A;  1VQ5 A;  1DOM A;  1IBL Q;  4HIK A;  3H91 A;  3KF6 A;  1U9R A;  2K33 A;  1B3Q A;  2MGS A;  4J6H A;  5JEA G;  3I4M G;  3RN2 A;  3WOE A;  3CPW A;  1TWF H;  1HQM C;  5GAH C;  3GTM H;  1AH9 A;  4IN3 A;  1A3V A;  3GV6 A;  1W3S A;  3PUY A;  4R8I A;  2R92 H;  2R3Z A;  1N36 Q;  2UU9 L;  4FP5 D;  1QZG A;  1BF4 A;  3FMC A;  1EWC A;  4H0L C;  3HZX A;  4C3H B;  3GTJ H;  1NMG A;  1ZYR D;  4A3D G;  4QF4 A;  4B3M Q;  2VUM G;  2MHV A;  3GTL B;  4BBR H;  4JI7 L;  1K0S A;  4DF7 A;  3I91 A;  3VYU A;  4V0B A;  3CCR A;  4IFD H;  5T1I A;  3T13 A;  1YHA A;  1PH5 A;  2B8F A;  4DR2 L;  4HCS A;  3HOZ B;  1LM0 A;  2ZJR A;  1EYA A;  3HKZ G;  3HOW G;  3A74 A;  3I55 A;  3MFY A;  1PTO B;  2H4O A;  2D0O A;  2WIN B;  3KOJ A;  4DR1 L;  5T1G A;  3K5L A;  4OX9 Q;  2A6H D;  2KHI A;  4O42 A;  1Q8K A;  4IJL A;  3KLS A;  2RSN A;  2QCP X;  4ULL A;  5C4Z A;  4K8I A;  3HOY H;  4O0A A;  1DCZ A;  2SNM A;  4HID A;  3K57 A;  1SFO B;  1JWU D;  1IKM A;  1AE2 A;  2KVM A;  2Z1C A;  2HD3 A;  5KEE A;  2XWJ B;  2QDB A;  4DN4 M;  3IKJ A;  1KNE A;  1YNN D;  3L9A X;  1WJJ A;  5IOD A;  5LMU L;  4RWS C;  1V1Q A;  2Q2T A;  5JPM C;  1PV4 A;  2ZTD A;  3N6R A;  1RL2 A;  1XWE A;  3H0G G;  3I72 A;  2R7D A;  1X32 A;  1H9S A;  4JOI C;  1KLU D;  3A55 A;  5CV9 A;  1HNX L;  3J7A F;  2QEX A;  3CC7 A;  3BZK A;  1B53 A;  2ID0 A;  5J39 A;  3BVG A;  3MZ5 A;  1WCM G;  2Q2H A;  2R93 G;  3ULP A;  3TDQ A;  1I4P A;  2L15 A;  2F0I A;  1EY9 A;  4ZK9 B;  4L5T A;  3ERQ A;  2F0M A;  3NTI A;  2F0L A;  3NEM A;  3KLR A;  3OTO L;  3KK7 A;  2KCT A;  2C9O A;  3P20 A;  4P74 A;  4A93 G;  1ENA A;  3R8B A;  2QF7 A;  4IPH A;  4NPS A;  5C4X G;  1B4O A;  2XRQ D;  1JOR A;  1ICW A;  1S3O A;  3VA7 A;  5BN5 A;  1LT4 D;  1BR9 A;  2HDL A;  1EY6 A;  3OW2 A;  3A0J A;  1CSQ A;  3ULL A;  3OHX C;  3R2I A;  3S1Q H;  5CYU A;  2E74 C;  1EOV A;  2PMZ E;  3W2D A;  5I9P A; 
#chains in the Genus database with same CATH homology
 1RTO A;  1PYW D;  1OXT A;  4CHT B;  4GZY C;  4E6I A;  5FO8 B;  1AEX A;  1K8M A;  1G2T A;  2RBM A;  1TWH B;  4RGN A;  4RCN A;  5IGF A;  3M7N A;  2RDG A;  3AMU A;  3S9W A;  5EBD A;  4FF3 A;  1SYF A;  3S1R B;  4F88 A;  2CW0 C;  3MXG A;  3D4W A;  1SYC A;  5C5M A;  2B2V C;  1F2Z A;  2PZT A;  5M9O A;  4DFA A;  1J8I A;  1TII D;  1OXU A;  1HHV A;  1PTO D;  4EQO A;  2OXP A;  1T5E A;  1Z47 A;  1D6E C;  1JIC A;  3CQZ B;  1R4Q B;  1BCP C;  3DEP A;  2G9D A;  2AUK A;  4V19 0;  3I3C A;  4IUV A;  4F8M A;  2A73 B;  2D9U A;  4C56 C;  4FXG C;  1G8Z D;  3OSO A;  2VUM B;  1BQQ T;  5CV8 A;  3GP7 A;  4ZQ3 A;  3I4L A;  3QIA A;  1LTT D;  3DMU A;  1BOS A;  4RAU C;  3HKZ B;  4N9P A;  3A7L A;  4EQN A;  4HAE A;  5ELC A;  1EIH A;  2F0Q A;  1XXG A;  2MUY A;  3J80 E;  5FKA C;  2F3V A;  1ZKO A;  2ZXP A;  4ZYS A;  1C4Q A;  5IGC A;  1VDZ A;  1W6J A;  1LLR D;  3U9O A;  4RKB A;  3OIP A;  5DM6 3;  2R93 B;  1ROD A;  2AQ3 B;  1JQY D;  1V1P A;  4ZUJ A;  2L12 A;  3PV0 A;  1DOK A;  1F2M A;  2BA1 A;  2K01 A;  1WTW A;  1O7Z A;  5G3L F;  4BS9 A;  5K36 G;  1SNQ A;  1CTM A;  3FDT A;  1BXT A;  2BE5 D;  4DK1 A;  3Q23 A;  3EQL C;  5JEA J;  2WV6 D;  1JWS D;  4NP5 A;  3GO5 A;  2B2T C;  3J7Y W;  1DM0 B;  1TU2 B;  1GOZ A;  4CBV A;  1SAP A;  5EGT A;  2PQE A;  1LTI D;  4G57 A;  1TS5 A;  2A69 D;  1ESR A;  5E4X A;  1D5M C;  1PRT F;  1TVX A;  2BDO A;  3A56 A;  4OO1 I;  3D8G A;  3NQI A;  3JAM E;  1AFP A;  3AB9 A;  1E2W A;  2J0T D;  5FLX L;  2EZV A;  1EY0 A;  2L55 A;  2JA8 B;  2ZT9 C;  1A3T A;  1DON A;  4KMU C;  3S14 B;  5C5L A;  2K5Q A;  1WTR A;  3PUX A;  5M5Y B;  1E2V A;  1FNW A;  1E0B A;  4DA2 A;  2J4X A;  3DUZ A;  4BY1 B;  1EY4 A;  2NVY B;  4PV1 C;  2R6G A;  1RTN A;  3K5M A;  2F4I A;  2EY2 A;  1LT5 D;  3D4R A;  2F0F A;  3HEJ A;  4QUC A;  5IGE A;  4TSS A;  4UDU C;  2EYO A;  2BCO A;  3TP8 A;  2XIW A;  5A2Q E;  5BN3 A;  1PRT B;  3PUW A;  4DNT B;  3K59 A;  2M00 A;  1BNZ A;  5JJZ A;  1K8O A;  3R2T A;  2A68 C;  1C48 A;  3K5N A;  4FF2 A;  3TN2 A;  1AW7 A;  1IKL A;  5CV5 A;  4FYD A;  2VXW A;  1UAP A;  4HN7 A;  4MIU A;  1GUN A;  1SEB D;  1IW7 D;  2F0H A;  1VF5 C;  4ZAI A;  2SOB A;  2JA7 B;  1MSH A;  4DK0 A;  2X69 A;  1MI2 A;  1Y1V B;  1G29 1;  2XVS A;  1EQV A;  4IUQ A;  4HSP A;  3MHB A;  4XT1 B;  4RGT A;  2X6L A;  3QOL A;  2Z8L A;  2JA5 B;  1UEA B;  1M8A A;  1YNJ D;  3I73 A;  1KAB A;  1GJX A;  1SYB A;  2EYH A;  1LT6 D;  4BBS B;  3P7J A;  1LTA D;  3NWS A;  1QE6 A;  4ZKB B;  3PUZ A;  4KV6 A;  2Q8T A;  4IUP A;  3HGB A;  3M85 A;  1A2T A;  3PIO 3;  3J81 L;  2VNU D;  2L5T A;  5G3L D;  2WB1 B;  3MVV A;  3VYR A;  4AYB B;  5EPJ A;  1I4R A;  3VR5 A;  3M4O B;  2VB2 X;  4TQU S;  3RLF A;  1GXD C;  1PMR A;  1RD9 D;  3KLS X;  2Z4H A;  3A8K E;  1B9M A;  3VR2 A;  1PRT D;  2EYL A;  1TWF B;  1VMC A;  3GTM B;  3CKI B;  3ND9 A;  2JP1 A;  4EQP A;  1CHP D;  2R92 B;  3LX0 A;  2B2Y A;  3IFT A;  4WJW A;  4K2L A;  4HCE A;  3GTJ B;  2L11 A;  1EY8 A;  1OXS C;  1EY7 A;  1PXU A;  1A3U A;  3N52 A;  4BBR B;  1V1O A;  3C1F A;  1UNS A;  5IOC A;  5E4W C;  1ZYR C;  1LAC A;  4LJZ C;  1R9T B;  4R8N A;  4KJN A;  2GA4 B;  3X3M A;  1MBY A;  3K0Y A;  3HOY B;  2EXZ A;  1HRJ A;  4CKE A;  5ELE A;  4EGV A;  5J22 A;  1AZQ A;  2RVL A;  1ILQ A;  2I07 B;  1Q12 A;  1B3A A;  4UAI A;  2IT1 A;  4KTA A;  3NBH A;  3MFG A;  1VCI A;  5D3I B;  2AUJ D;  1CHQ D;  1CZG A;  4ME5 A;  1GUO A;  3HP3 A;  1A6X A;  1Q90 A;  2F1M A;  4EVO A;  2K1B A;  3BDL A;  4DAV A;  2K6A A;  4WOR A;  2L4N A;  1EZ8 A;  4KD3 A;  1J9O A;  4DNR B;  3TP6 A;  1GHK A;  3W3A A;  1B9N A;  2RDH A;  4JBW A;  5C6A A;  3TP5 A;  5IT9 E;  3T51 B;  1PFM A;  4ZLT F;  3DEO A;  3SE0 A;  2NBF A;  4RFB A;  1BCP F;  5C44 B;  1QOH A;  5IGG A;  1HFG A;  4OHJ A;  1FGB D;  2F0W A;  2KEC A;  4Y7N B;  4ODG A;  1JE4 A;  1LO5 D;  2DNE A;  2SDF A;  4XT3 B;  1QWY A;  1O7Y A;  3MA2 B;  2NYZ D;  2NVX B;  4N9T A;  4ZKC B;  1TY2 A;  1G6Z A;  1SXT A;  5EJW A;  1FD7 D;  3I8Z A;  3VYT A;  5TSS A;  2Y0S B;  3FEW X;  5KGU A;  3TME A;  3Q6S A;  4I7Z C;  3C2P A;  1JB3 A;  1H9M A;  5D14 A;  1L0Y B;  1SNC A;  1I4Q A;  5FO9 B;  1BBX C;  4G7H C;  5C0X G;  4KHV A;  1ENF A;  4A3M B;  3NE5 B;  4BY7 B;  5E3F A;  2EJM A;  1XYI A;  1EU3 A;  3ITP A;  1BCP B;  1PTO H;  3VR4 A;  4CKC A;  1EY5 A;  1EQT A;  1LTB D;  1HQR D;  1I50 B;  4XQJ A;  4HR7 B;  4KY6 A;  3P1H A;  2K28 A;  2SEB D;  4C3I B;  2K7V A;  4KD4 A;  4KK7 A;  3PO3 B;  4BA1 I;  1B2T A;  2O5I C;  1RDP D;  1F2Y A;  1CK1 A;  3LWU A;  2B63 B;  1F9R A;  1AP0 A;  3T56 B;  1LTR D;  3M3Y B;  3MWY W;  3QJY A;  2YU9 B;  5ELF A;  4X3K A;  4DU9 A;  2CQA A;  3EVQ A;  3OWE B;  5FLX E;  3GD7 A;  3OMC A;  2E2D C;  2PW5 A;  1HA5 A;  4HMI A;  1SBB B;  1TS2 A;  3QB3 A;  1KLG D;  1PZI D;  1HA6 A;  3I70 A;  5CV7 A;  4C1N K;  4FVM A;  4DXG A;  4CJ2 C;  4L63 B;  3LWE A;  4TRD A;  5KIX A;  4QUF A;  1TS4 A;  1SJE D;  1SDF A;  3HOX B;  3R3O A;  1FNV A;  1O80 A;  2AWO A;  5IT9 L;  1F9S A;  2MP1 A;  2WKD A;  1D2B A;  3V2T A;  2LMC B;  5LL6 S;  1D5X C;  4XYQ A;  2B2W C;  2L0C A;  5JVG 3;  5LHY 1;  3KUP A;  2CW0 D;  3S17 B;  4WFN 3;  3S1M B;  3IFD A;  3IAY A;  1F2L A;  5IGB A;  3TZD A;  4OIJ A;  3NTK A;  1SYE A;  2PO4 A;  4OO1 H;  3PUV A;  2BE5 C;  4A3I B;  1Q1B A;  4CJ1 B;  2B39 A;  2DY8 A;  4OGQ C;  3K5O A;  1II3 A;  4CGY B;  1CT1 D;  5A35 A;  1IYU A;  1D5Z C;  3FPU B;  1BCP D;  2EYM A;  4ILW A;  2JE6 I;  2B2U C;  2A69 C;  1Y69 U;  5JEA H;  3G7L A;  4DXF A;  4Q0F A;  1TKW B;  5KYL A;  3I4N B;  1V43 A;  4K5X A;  2NVT B;  1FYC A;  3OOC A;  5I4D A;  5I6Y A;  1ESF A;  3OW7 A;  1JOK A;  3IL8 A;  5C4H A;  3SDZ A;  3SK4 A;  1K83 B;  1S5D D;  3C1E A;  1JOO A;  1CA6 A;  4RGM A;  1STH A;  4RH6 A;  1STY A;  4C1N I;  5EQ0 A;  3A7A B;  5I9O A;  3NK9 A;  2L1B A;  2KOL A;  3CHB D;  1NAP A;  3MAQ A;  1WTV A;  2RSO A;  4IQZ A;  3SK5 A;  1PLF A;  3RMH A;  3SHL A;  4HSV A;  4FF1 A;  4M8A A;  1GHJ A;  4LMQ D;  2EJF C;  4A3G B;  2PW7 A;  1A2U A;  3GTO B;  4KJO A;  3HG9 A;  2PZU A;  3J81 E;  4KKT A;  1H9R A;  1O7L A;  5E1F A;  2SNS A;  2B8G A;  2D2C C;  2FMM A;  3GV3 A;  1SMY D;  3H6M A;  4NMZ A;  5CMD A;  2KED A;  3EA6 A;  1A15 A;  5M5X B;  3L3O C;  1GUW A;  2E2J B;  4RGO S;  3V05 A;  5EBC A;  4HTH A;  2EOT A;  3SK6 A;  1CQF A;  1U4R A;  3P75 A;  4A3B B;  4IZ8 A;  2V4D A;  1HUM A;  1DOL A;  1Y1W B;  3VA5 A;  4I65 A;  4ID6 A;  1KDB A;  2LY7 A;  2N88 A;  4KY7 A;  4ZRZ A;  3BDO A;  3O13 A;  1EZ6 A;  4K2K A;  3HOV B;  1HFN A;  1M4V A;  1JCK B;  4PMB A;  4Q5V A;  4IFD G;  2JXM B;  1NSN S;  3QG1 A;  3NWT A;  1SYD A;  5C3X A;  4U68 A;  1TS3 A;  2A6E C;  4RHS A;  1S5B D;  2KHS A;  4FXK C;  5CR3 A;  3QO2 A;  3QOJ A;  2NVQ B;  1EFI D;  4Z9C B;  1WD1 A;  2ICE C;  1BO0 A;  1SNP A;  1MD2 D;  1JOQ A;  4CKB A;  1CM9 A;  5IGD A;  5C0X J;  1STN A;  2CHB D;  3NUC A;  1X3Q A;  1H9K A;  4G7Z C;  1W6K A;  2NZ1 D;  3OIQ A;  5C3W A;  5COR A;  1SNM A;  2F0O A;  2FJ2 A;  2F0S A;  2HCC A;  4O1N A;  2AQ1 B;  3S1N B;  1DJR D;  1CI3 M;  5FOB B;  1B50 A;  1KNA A;  2O4X A;  4H13 C;  3K6O A;  2NB0 A;  1NUC A;  3K7A B;  1LTS D;  2EY5 A;  1LAB A;  4H7B A;  2EYP A;  5I2X A;  2IJ0 A;  3MTS A;  2IWH A;  5C0X I;  1AZP A;  1WTX A;  3Q22 A;  1RF2 D;  3Q0A A;  4H44 C;  4A3J B;  3OWF A;  1HPC A;  3BVZ A;  3J7A V;  2KEE A;  2TMP A;  2R61 A;  1S5E D;  2B2V A;  1XX8 A;  2K5D A;  2RKS A;  3NXW A;  5COY A;  3DHQ A;  3KBX A;  3GTG B;  3U9S A;  2N55 A;  1PZJ D;  2M9V A;  1Y8O B;  3BYY B;  2WAQ B;  1C8C A;  4KKU A;  2EY6 A;  1OXV A;  2NN6 I;  1WTQ A;  2E75 C;  3RZD B;  2X6G A;  1Y8N B;  2F0V A;  1QG7 A;  1SE2 A;  3DWP A;  3SVM A;  4PMW A;  1NR2 A;  2ENB A;  3ONA B;  2IPK D;  3SXH A;  3RD4 A;  2G9H D;  1QB5 D;  3MXN A;  2L9H A;  1EWH A;  3I90 A;  5K36 H;  3X3N A;  3MXU A;  1TY0 A;  2PYK A;  4FXD A;  1NR4 A;  4S3S A;  3PO2 B;  4C3I G;  2K5W A;  3LNN A;  3H94 A;  4QMG A;  4F7X A;  2LS0 1;  4G4K A;  2D62 A;  4IUR A;  1STG A;  2ZXO A;  2Q8R E;  4QB4 A;  1QJO A;  1EIG A;  2A6H C;  1DXM A;  5ELB A;  4OIK A;  1SE3 A;  1Z6H A;  2O2L D;  1EEI D;  5CV6 A;  3F2U A;  5KNC A;  2H1E A;  2WP8 J;  1YNN C;  2WKC A;  4FO2 A;  2IL8 A;  1LT3 D;  1QNU A;  1LV9 A;  2BA0 A;  5EKK A;  5FO7 B;  2NTS A;  2KA7 A;  5HGT A;  4L6T B;  5CGK A;  1G2S A;  2E2I B;  2AWN A;  4F87 A;  1ZXT A;  1UUP A;  1EU4 A;  3S16 B;  3S1Q B;  2EPB A;  5J1Z A;  1GUG A;  4XQQ A;  1ILP A;  2AQ2 B;  5K5P A;  5FK9 C;  2FIN B;  1IHZ A;  2B2T A;  2IW3 A;  5C4J B;  3VR3 A;  2F0N A;  1SE4 A;  1PFN A;  3TZU A;  3M7G A;  4RKL A;  1RKN A;  1X3P A;  3DXJ C;  2F3W A;  1Q1E A;  2JA6 B;  4RCO A;  3RZO B;  3CRL C;  1BDO A;  4R9W A;  4KHZ A;  3C46 A;  4IUN A;  2DY7 A;  4IFD J;  4NDX A;  5DNF A;  2IX3 A;  2NUC A;  1WTP A;  2JEA I;  2KUM A;  1QIL A;  4LK1 C;  1DZ1 A;  1PTO C;  1WTO A;  1R4P B;  2EVB A;  1KDA A;  1U4M A;  2XNA C;  3RUZ A;  4WRD A;  4K5V A;  1STA A;  3T16 A;  4K5W A;  3T4A C;  1FR3 A;  3S2D B;  4IUT A;  3DWA A;  1VMP A;  4B08 A;  1RHP A;  4IFD I;  2D5D A;  3T53 B;  1WD0 A;  1TWA B;  4A3E B;  1I3Q B;  2BOS A;  2F0J A;  2YYZ A;  2I46 A;  3G6J B;  3URY A;  2RQX A;  1AN8 A;  5DEH A;  4KN4 C;  1SNO A;  2NN6 G;  3E0J A;  2XWB B;  1KAA A;  1PFB A;  1B1Z A;  4PNY A;  3HS0 C;  5ELD A;  2PCF B;  2HCI A;  1T5X D;  4A3K B;  4NW2 A;  3NQT A;  2F0D A;  3TP7 A;  3D4D A;  1EL0 A;  2QEJ C;  2EJG C;  3PIP 3;  5EPK A;  5M5W B;  1IL8 A;  3AU7 A;  2E2H B;  3ND8 A;  2R7Z B;  4J8Q A;  3I4M B;  1F9Q A;  4K6L A;  4XQN A;  1CA5 A;  4C2M B;  3BZD B;  3CRK C;  3UI2 A;  2XSC A;  1OXX K;  4XDX A;  3S15 B;  2EDG A;  2VB3 X;  2DN8 A;  1Y8P B;  5HUR A;  1H9J A;  3DM1 A;  2ZXR A;  4X3S A;  4A3D B;  3ERO A;  4J1M A;  2B2Y C;  1OO9 B;  2MJ8 A;  4PQX A;  5I2Y A;  1ZEQ X;  3A8J E;  2LFN A;  2PPB C;  1GUS A;  3D6W A;  2QKI C;  3HOW B;  3GTQ B;  3WOF A;  1I6V C;  1HCZ A;  5ISR A;  5DAU A;  1ET9 A;  3L7Z C;  3SK8 A;  1G91 A;  3MXP A;  2OF1 A;  2KJX A;  1RCV D;  3D6C A;  3R93 A;  4U67 3;  5LL6 X;  1Q3L A;  2XRS D;  3HRZ C;  3NBI A;  5D65 A;  3D31 A;  4KI0 A;  1HTP A;  1I4H A;  3H0G B;  1S5C D;  2PMZ B;  3BDC A;  1LTG D;  4FF4 A;  4HED A;  2JYO A;  4MN3 A;  3GTP B;  3NSW A;  5D3D A;  1SMY C;  1WCM B;  5EKL A;  3SEB A;  2TSS A;  2A5H A;  2C5C A;  1JWM D;  3ZYY X;  3OMG A;  1EYD A;  1QCB D;  1S5F D;  5JPN C;  4A93 B;  5C4X B;  1H9S B;  4YIJ A;  1SJH D;  4K14 A;  4FNF A;  2K04 A;  1I6H B;  3Q24 A;  4XTC S;  3FRP B;  2OEO A;  3H09 A;  1S4Z A;  1GUT A;  4KKS A;  4RA8 A;  2FMC A;  3NTH A;  4MHE A;  4NKL A;  2HQE A;  4IUU A;  1TR5 A;  1DD2 A;  1STB A;  2M2L A;  2QIL A;  1RJT A;  5JVH 3;  1QNK A;  2MPM A;  1VF7 A;  2EE1 A;  4QIW B;  3H3V C;  4C3J G;  3V96 A;  1E2Z A;  2NWG A;  1F9P A;  4X3T A;  3M4Y A;  1KDC A;  2EYF A;  1TT2 A;  2FHT A;  4B9W A;  5EKI A;  2LKV A;  3CU7 A;  5CC4 A;  3A54 A;  2HUG A;  3PMF A;  2EYJ A;  4XIG S;  1MGS A;  3HOU B;  2F0T A;  2BDN A;  2Q8I B;  5KNB A;  5NUC A;  5KYI A;  3FVQ A;  1IW7 C;  5C0X H;  2KCC A;  3EFX D;  3GTK B;  2HDM A;  5I6W A;  3NPP A;  2IX1 A;  2KQ3 A;  1NCV A;  2CVR A;  2O5J C;  4LAA A;  2KCN A;  1CQV A;  3NHH A;  2Z4I A;  1D1K A;  1CZW A;  1O78 A;  4M1U B;  4G7O C;  3D3R A;  4X3U A;  1YNJ C;  5CBE E;  2JSO A;  2K05 A;  3EJI A;  5AFW A;  4ABN A;  2PZW A;  2IX0 A;  1L0X B;  3WDN A;  4DAP A;  3J80 L;  1IYV A;  5CBA E;  1BUV T;  2K03 A;  1I4X A;  4BWG B;  2NN6 H;  1U4L A;  2F03 A;  1WVL A;  4K8J A;  2FFK B;  3GQB A;  3FPP A;  1XTC D;  2E76 C;  2RA4 A;  2A74 C;  3QWN A;  2RDF A;  1PZK D;  2F0E A;  5BN4 A;  3NP8 A;  5EPL A;  5M3M B;  1JR0 D;  4OL7 A;  4PMC A;  3VYS A;  5C3E B;  4C3H G;  1SYG A;  2A6E D;  4XXE A;  2DNC A;  1PRT C;  4B9X A;  1F77 A;  1U4P A;  1FNU A;  4DAY A;  1PDQ A;  3KF8 A;  2F0U A;  4DGZ A;  1Q8I A;  1V8Q A;  3BG3 A;  4BA2 I;  5JOB A;  3BS1 A;  2A68 D;  2EY1 A;  4K6D A;  2JEB I;  3E6Z X;  1V1P B;  5KND A;  1HTL D;  3BYT B;  1SND A;  4IAL A;  3MEH A;  1DYQ A;  1Z7T A;  4L8J A;  1TQO A;  5M3F B;  4C3J B;  1EEF D;  5CV4 A;  2XN9 C;  1EOT A;  4A3F B;  4P2C B;  3JAM L;  3DWQ A;  4TKO B;  5F2D A;  3E5S A;  1ONL A;  1ET6 A;  2PNR C;  2K32 A;  4CJ0 B;  5KRU A;  4RHR A;  3VR6 A;  1TWC B;  1HUN A;  2OT2 A;  3SR1 A;  4QCL A;  3OPO A;  4ZUI A;  1SSO A;  2WAC A;  1HXY D;  1CFM A;  2F0G A;  1ML0 D;  5IIF A;  4XYO A;  1B44 D;  1D1I A;  3S2H B;  1JC7 A;  5JAV A;  2B2W A;  1I4G A;  3C3L A;  3KBG A;  3MC0 B;  5DM7 3;  1MSG A;  3A8I E;  1PTO F;  3FKI B;  2NTT A;  2J7Z A;  4HMJ A;  4KY5 A;  5A2Q L;  1KTK A;  4KN7 C;  3TBI B;  1ENC A;  4OO1 G;  4JK1 C;  2WII B;  3K58 A;  3BVM A;  2ICI A;  3TSS A;  1EYC A;  2F0K A;  1STE A;  2B2U A;  1TWG B;  2F0P A;  1DOM A;  3H91 A;  1U9R A;  2K33 A;  2MGS A;  4J6H A;  5JEA G;  3WOE A;  1HQM C;  4IN3 A;  1A3V A;  3GV6 A;  3PUY A;  4R8I A;  2R3Z A;  4FP5 D;  1BF4 A;  3FMC A;  1EWC A;  4H0L C;  3HZX A;  4C3H B;  1ZYR D;  4QF4 A;  2MHV A;  3GTL B;  4DF7 A;  3I91 A;  3VYU A;  4V0B A;  4IFD H;  5T1I A;  3T13 A;  2B8F A;  4HCS A;  3HOZ B;  1EYA A;  3MFY A;  1PTO B;  2H4O A;  2WIN B;  5T1G A;  3K5L A;  2A6H D;  4O42 A;  3KLS A;  2RSN A;  2QCP X;  4ULL A;  5C4Z A;  4K8I A;  1DCZ A;  2SNM A;  3K57 A;  1SFO B;  1JWU D;  1IKM A;  2KVM A;  2Z1C A;  5KEE A;  2XWJ B;  2QDB A;  4DN4 M;  3IKJ A;  1KNE A;  1YNN D;  3L9A X;  5IOD A;  4RWS C;  5JPM C;  3N6R A;  1XWE A;  3I72 A;  1X32 A;  1H9S A;  5CV9 A;  1KLU D;  3A55 A;  3J7A F;  1B53 A;  2ID0 A;  5J39 A;  3BVG A;  3MZ5 A;  3TDQ A;  1I4P A;  2F0I A;  1EY9 A;  4ZK9 B;  3ERQ A;  2F0M A;  3NTI A;  2F0L A;  3KLR A;  3KK7 A;  2C9O A;  3P20 A;  1ENA A;  3R8B A;  2QF7 A;  1B4O A;  2XRQ D;  1JOR A;  1ICW A;  3VA7 A;  5BN5 A;  1LT4 D;  1BR9 A;  2HDL A;  1EY6 A;  3OHX C;  3R2I A;  5CYU A;  2E74 C;  3W2D A;  5I9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...