4P2CB

Complex of shiga toxin 2e with a neutralizing single-domain antibody
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
68
structure length
68
Chain Sequence
ADCAKGKIEFSKYNEDNTFTVKVSGREYWTNRWNLQPLLQSAQLTGMTVTIISNTCSSGSGFAQVKFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Shiga toxin 2e, subunit A
publication title The Molecular Mechanism of Shiga Toxin Stx2e Neutralization by a Single-domain Antibody Targeting the Cell Receptor-binding Domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 20
structure length 68
sequence length 68
chains with identical sequence C, D, E, F
ec nomenclature
pdb deposition date 2014-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4p2cB00
2XSCA 4ULLA 1QOHA 2BOSA 1D1KA 1BOSA 4M1UB 1R4PB 1R4QB 3MXGA 1QNUA 1CZGA 2C5CA 1C48A 1C4QA 4P2CB 1CZWA 2GA4B 1CQFA 1DM0B 1D1IA
chains in the Genus database with same CATH superfamily
3UDIA 2XSCA 1KC8C 1X65A 2BOSA 2AKWB 4GLAC 3RNUA 4MTNA 4C56C 4C3HB 4OXPA 3W1GA 2N49A 1JORA 4RHRA 1IL8A 2R93G 3QOJA 1X3QA 2HHHL 1Z9FA 3S1QB 5IIFA 2NTSA 4GN5A 4FVMA 2MO0A 4LFCL 3H0GB 1Y1WG 1CKMA 4HSVA 4WJ3M 2VUMH 2Q2IA 2FMMA 3VDYA 4DV4L 3PIO3 3U50C 2SNMA 2Q8TA 4TSSA 1Q3LA 5I9PA 1A8VA 4OWTB 4DAYB 4LFAL 4A3CG 3FKIH 4A3IH 4NW2A 5DEHA 5BR8Q 4A3JH 1B9MA 4NXML 3E6ZX 1VQEA 3TZUA 3AB9A 3MXGA 4GKKQ 5C3XA 1WYDA 1F2MA 1LO5D 1PXUA 2CCZA 4L5QA 3ULPA 5FO8B 1XPRA 1I6HB 3GTPB 1R9TH 1LTID 4K5XA 2F52A 1PYBA 2A6HC 2MQHA 3KDFA 3K7AB 1RD9D 2Z4IA 3PF4A 1ENFA 4OIKA 1N34Q 4OIJA 4LAAA 4WJWA 1SMYD 3WWVA 3TS0A 2X6GA 4P2CB 4L5RC 2EPBA 1ZYRC 4JI2Q 3DEOA 2A8VA 5EKIA 3U9SA 3HFZB 1PZID 2EYPA 5ELFA 1CKNA 4YHHQ 4GKJQ 4K5WA 2B63B 1ILPA 4KK7A 4DR5L 4JBMA 4K5VA 1BKBA 1E2ZA 4RMFA 2F0TA 4KY5A 2AWOA 1ESFA 3HKZB 2XNAC 3M4OB 1XYIA 1E3PA 3E5SA 1CSQA 2L1BA 4A3BB 1I50B 2KECA 1CZGA 2NZOA 1VQMA 3I4MB 3A54A 2WAQE 1FGBD 4X62L 4JBJA 1O7LA 1GUNA 4IUPA 1HRJA 4KHZA 5HGTA 3MXUA 1Y14B 5D14A 5C4XB 5E4XA 4DKAC 1WTQA 2WKDA 4C3HH 5AJ3L 1GM5A 4M1UB 3RD4A 3PMFA 1JE4A 1QWYA 2WACA 4ZKBB 3H0GH 3S2DH 1XXGA 1H9JA 2F4VQ 1LT5D 2R7ZB 4DK3C 1F2LA 1D6EC 3HS0C 5CV6A 2NWGA 4MTKA 4YCVA 3ULJA 2RA4A 3DMUA 2A6HD 1VF5C 4IN3A 2RDFA 4Y52H 2F03A 2KCNA 3NPPA 1KTKA 1B4OA 2OWOA 3CC4A 2CH4A 2DY7A 2YU9H 5J22A 1Q1BA 4FDBA 1HZAA 4DV1L 3MXNB 2AWNA 2KCTA 1ZYRD 2BDOA 1FJGQ 4ABNA 2JA9A 2OXPA 2IX1A 1I6HH 1QVCA 4OWXB 3GTPH 1Y69U 2EZVA 3K7AH 2NYZD 1K9MC 1G6PA 2NN6G 3MEFA 4XT1B 2QILA 2ZXPA 3DEPA 3OIQA 1YVCA 1HNXQ 4JI7Q 4A3MB 1CHQD 1SYGA 1A63A 4R8IA 4DR2Q 1HR0W 3JAME 4X66L 1B1ZA 2F0QA 3BDLA 2MGSA 1SYBA 2B63H 4TVAB 2D0PA 2JXMB 5JEAG 1VDZA 4BBRG 1SNDA 3KYHC 3K81C 3F2BA 3VYRA 5K36H 1BXTA 3K58A 4POGA 1X3FA 3KLRA 2ZTEA 1I50H 4NMZA 4JOIA 3TBIB 3DM1A 3V2TA 3I3CA 1HTPA 2EDGA 3VA7A 1N36L 4JI6L 1HUMA 1A2UA 1CI3M 4UHVA 4LMQD 4ME5A 3NSWA 2RCNA 4H7BA 2B29A 2RQXA 2YYZA 4DR7L 1ICWA 2Z4HA 1R4PB 1AZQA 5E3FA 4GN4B 2GVAA 1CFMA 5I6WA 2NVXB 3MZ5A 5FJ8H 4QQBX 1EOVA 4AH6A 2PZWA 4POFA 4BBSH 2R7ZH 4K8JA 1UE1A 3TZDA 3VR5A 3KBGA 3HEJA 1TWAB 3M7GA 2K5HA 4H02A 1TU2B 4B3TQ 1PHJA 5EPJA 1D1KA 1XMQQ 2A73B 1VQIA 3QO2A 3WOEA 2Q2UA 5JJIA 4OX9L 2AUJD 2F0VA 5IT9c 2R61A 3F8TA 5KNCA 1H9SB 1U9RA 3T1YL 4J8QA 1PH1A 1I6VC 5CV8A 1H9MA 1U4RA 1HNWQ 1BR9A 3K6OA 3AQQA 3KOJA 5C6AA 4PZ8A 3I4NG 2Y0SB 4UP9A 1S40A 1BOSA 1VQDA 3A55A 2F3IA 2K5DA 2YV5A 2JA7B 1STAA 5FLXc 3E3XA 4JV5L 4A3MH 4OHJA 2LY7A 4DN4M 2WB1E 1U4PA 2K5VA 3MVVA 2EJGC 4X3UA 3B6YA 1R4QB 1II3A 3OW2A 4ZUIA 4KJNA 1IBLL 2L5TA 1YJNA 4YWMA 1MJCA 3HOXG 3R93A 1CK1A 4HIOA 4HTHA 1WD1A 4DR3Q 1KABA 4B9WA 4Y7NH 3E9IA 3NTIA 3CF5A 2RF4A 3A5ZB 4HMIA 4OO1H 5JEAJ 4XQJA 4JI8L 4U673 3I91A 3BZDB 3PQIA 4S3SA 3G6EA 1A3UA 3CC2A 3PGZA 3NTHA 3HOUH 2F0OA 3BVZA 2KQ3A 3SXHA 4LF8L 2X6LA 1B3QA 1WTWA 3S2HB 1Q7YC 1HZCA 5IP7H 4DUYQ 3ER0A 3I4LA 4DAPA 3NTKA 5IGGA 2EJMA 2FHTA 2VQFQ 4FNFA 3HOYG 4A3DB 4R4TA 3H09A 1JOQA 1I94Q 3HOVH 2RSNA 3RMHA 1VMCA 3R3OA 1IBKQ 2LXJA 2J0TD 4CGYB 2UU9Q 1EQTA 4LF5Q 1NMFA 2O4XA 4JI1L 3TRZA 1IW7C 2R92B 4L6TB 2B2UC 1AE2A 1IZ6A 3Q0AA 2NVXH 1D2BA 4H44C 1PLFA 1F9RA 1U5KA 3P75A 3D4RA 2QKIC 2K5WA 1HA6A 3RUZA 5G3LD 2B2VA 3SR1A 1BDOA 2UUCQ 5T1GA 4UPAA 4QIWB 2AQ3B 2D62A 1G2TA 2WAQG 3M3YB 3U58A 1EZ8A 3KF8A 2OQKA 3NQIA 1J6QA 1E0BA 3BG3A 5CMDA 2PZUA 2VZAA 3KFUA 2KOLA 2IW3A 1EYAA 1SYEA 3E9HA 1ENCA 3HOZG 2M00A 1JB3A 1EFWA 1IBMQ 3A7LA 2RHSB 3DWQA 4DV7Q 2VNUD 2Z6KA 3PO3B 1PTOH 1EYCA 1YZ6A 1OXUA 2ZM6L 3KF6B 2F0JA 3G7LA 2UUAQ 3C3LA 3J7AF 3CAMA 3EJIA 2KVMA 1S5ED 1B44D 2JA7H 2L11A 3HKSA 1N33Q 2AMCB 1IXRA 2VS1A 3K5LA 1CUKA 2ATWA 1WCMG 1V1PB 1EU3A 4KD4A 4CDDC 2WV6D 3CHBD 5M3FG 3TP5A 4C3JG 4DAYA 1EFID 2EY6A 3GTOB 1XMOL 2K01A 2PI2A 3C2PA 1WOCA 1PH4A 1VQAA 4HIMA 4F88A 3GTKH 4ZRZA 1FD7D 3CC7A 4GNXA 4AYBB 5CYUA 1L1OB 2N8NA 1IW7D 4KKUA 1VQLA 5CV5A 3NELA 3S16B 3SDZA 1B7YB 2EOTA 4HAEA 4A76A 1K8AC 1LV9A 2A1AA 1WTVA 4MZ9A 3S2HH 2NN6I 4O42A 4PZ7A 1JJ2A 1Q1EA 4C1NK 1UNSA 2B2YC 3ITPA 3AFQA 1EUJA 1EOTA 2H1EA 2D5DA 2JK8A 4X3SA 4RG1A 3VYSA 4IFDG 3K57A 2JA8B 1S3OA 2BA0A 3HP3A 5KYIA 1KXLA 2HCIA 5DNFA 1EYGA 1AZPA 1STHA 2CW0C 1VQHA 3SHLA 4BY1B 3PIP3 1ML0D 5GAHC 2K52A 1LT6D 5ELDA 2IX3A 4XDXA 1V9PA 3HZXA 4OGQC 2HQLA 4L8JA 4RHSA 4DV4Q 3NHHA 1G91A 1OXTA 3GO5A 4LFAQ 4NXMQ 1K0SA 5EQ0A 3A8KE 3CU7A 2MFIA 1K83H 3I2ZA 1KAWA 3F2DA 1Y8OB 4DR6L 2E2DC 1TT2A 1A3VA 3OTOL 2G5DA 1F9PA 3EA6A 3PO3H 4FF1A 3W2DA 3K80C 5F2DA 4A3EB 1RF2D 1DOLA 1RODA 1F9QA 3M9BA 4A3IG 4A3JG 3OW7A 4OL7A 1OXVA 1AEXA 4Z9CB 5H1SE 1SNMA 5J3BA 1AP0A 1EY6A 1J5EL 2DNCA 5I2YA 4N9TA 5IT9L 2QF7A 1UEAB 2KCMA 4NP5A 3TDQA 1JQYD 1NY4A 2N78A 4CKCA 3ICEA 2J4XA 4DR5Q 4R8NA 4XT3B 3NENA 4JI4Q 2Q2HA 2VB3X 4KV6A 2KHJA 3CCUA 4R4OA 3H3VI 5IGFA 5FLXL 2N55A 3MXNA 1TWGB 3S16H 4RGOS 2CW0D 1MHWC 5C4JB 3D4DA 4X62Q 4CJ0B 1GUWA 3T51B 4GLVB 1M90C 3IL8A 2WB1G 3PIOA 4HIDA 4OWWB 2JA6G 3CQZB 4LUOA 5AJ3Q 3ERSX 1C8CA 4NXNL 3RN2A 4A3KB 3KUPA 4IFDJ 1G8ZD 2ICIA 2ES2A 1PTOC 1WJJA 4ZYSA 5CV9A 1VQ5A 2K5NA 2OT2A 3OWEB 2SDFA 4LFBL 4FYDA 4FP5D 4A3GH 1Y8PB 1YJ9A 3A7AB 1EY4A 3K59A 3Q24A 4N8X1 1HZ9A 5JPMC 2M2LA 1YJWA 1WTPA 4G57A 2K6AA 2HDLA 4JYAQ 5IWAL 2ICEC 4DGZA 4KKTA 3SK6A 2ASBA 2C9OA 3I55A 1GJXA 1W6KA 3PO2H 4A3FB 1YIJA 3S1NB 1HHVA 5G3LF 3DUZA 3MXPA 4ZK9B 4WFN3 5IGBA 1CKOA 2CQOA 1K3RA 4K14A 1NAPA 1X6OA 2DNEA 1SJHD 4APVA 2EJFC 2JYOA 4RGTA 4X3KA 2I5HA 1D5XC 3V96A 1XNQL 1S5BD 4K0KL 4PQXA 4ZLTF 4GOPB 2FINB 2XTIA 3RLOA 1E1TA 2F0KA 5C0XG 3BVMA 1QVGA 3T16A 3QWNA 5GAEC 1XNRL 1S5DD 5IYBG 1QG7A 4ALPA 2R7DA 3MTSA 4GNXB 1XWEA 2E2IB 5IGDA 3U9OA 4QUFA 3R8BA 5LMNQ 4LJZC 1LLRD 1H9SA 3F1ZA 4X65L 4X64Q 1KLUD 4NB3A 4BA2I 2EQSA 2R93B 4IPHA 1PTOD 1TWGH 2NVYH 2RCFA 2KA7A 4ZCKA 2B8FA 3CRLC 4DK0A 2C35B 5C4JH 5E1FA 1U4LA 4K6LA 1PH8A 2I5MX 1Y1WB 4BXXH 4JI6Q 1N36Q 4C3IH 2G9HD 3O13A 5KIXA 3NBIA 4EVOA 1PRTC 3CQZH 5K36G 5ELCA 4DR7Q 4HJAA 3TP6A 4DK1A 3K5MA 1HXYD 3FRPB 4DV3L 4P75A 1P16A 4UDUC 3DWAA 4HIKA 4Q0FA 3OPOA 2IX0A 2E2JB 1RTOA 1K8OA 1X3GA 1PYWD 1YHBA 1VQJA 1LTAD 4M8AA 2NB0A 2K5QA 1B3AA 4O0AA 2H4OA 2EY1A 5IT9E 1N32Q 3T53B 1CZWA 1YI2A 4DR1Q 1NSNS 1VCIA 2EYFA 2B2WA 3R2IA 2CKZB 2B8GA 1SFOH 1HTLD 5FJ8G 3AMUA 4IFDI 1I3QB 4BBSG 2PO4A 3MFGA 4RGNA 1SMXA 5ELNA 1VQNA 1K3BC 2FFKB 4JOIC 2F3WA 2TSSA 3V05A 3K0YA 4K6DA 1VS0A 1VMPA 5EKLA 3D6WA 3S1QH 4RFBA 1GUTA 5FLXE 2V1CC 1GUSA 1A62A 4JI0L 2R3ZA 3HOWG 4JV5Q 5A35A 2K4KA 5CV7A 1JOOA 1IBLQ 1BCPC 3RLNA 1G6ZA 2PCFB 2MUYA 1BVSA 2K75A 2PNRC 3C1EA 2CFMA 3T1HL 1WI5A 5C0XJ 3EROA 1XPUA 1PRTD 3I8ZA 3TEHB 1MD2D 3KLWA 4JI8Q 5EGTA 2E2IH 1Q8KA 3CCSA 3P20A 3S24A 1VQ7A 1CQFA 4JI3L 1X3EA 2CH4W 4PMCA 2R93H 1A15A 5GADC 1NUCA 4LF9L 5C3EB 4LF8Q 4EX5A 4LNQA 4EQPA 3BJUA 4DPGA 2E75C 3Q8DA 1G291 1Y1WH 2L55A 4HCEA 4ME3A 4QGUA 2WP8J 3KF6A 3UDXA 3A8JE 4OO1G 3VR2A 1Q81C 3NXWA 5IP9G 3DWPA 4B9XA 1IYVA 1MGSA 4A3CH 2JA5G 4YWLA 1SYDA 3HOUG 3CMAA 2RHQB 1V1PA 4XYOA 4IUQA 1PH5A 4B08A 1DM0B 2E2JH 5IP7G 1AN8A 1SLJA 5EBCA 1W2BA 1NR4A 1FGUA 3M4OH 1WFQA 5FK9C 3HOVG 1X55A 4LF7L 2PQAA 4A3BH 3CCLA 2ALYB 4HJ8A 4XTCS 1QNKA 2A5HA 2M9VA 3I4MH 3VR6A 1L1OA 4BWGB 5BR8L 2OF1A 3D4WA 1IHZA 1TKWB 1HH2P 3FVQA 3ND8A 3DLLA 2XWBB 4GKKL 1RKNA 1BCPD 5C4XH 4MNOA 1VQ8A 4GLXA 4WORA 3FPUB 1Y1VG 4IJLA 3SE0A 1L0WA 3GP7A 2NZHA 2Z1CA 1PZKD 1E7ZA 1SE2A 2B2TC 2ZM6Q 2Q8RE 2UUBL 1QB5D 1KAAA 1Q86C 1JJGA 2DY8A 5FOBB 1QNUA 3H91A 4BBRB 4HJ5A 1BBXC 3F2CA 1WTXA 3QJYA 1N34L 1JT8A 1I5FA 2RKSA 1D5ZC 1RHPA 1GKHA 2PMZB 1BO0A 1SNOA 1HFGA 1VQPA 3SK5A 4I7AA 4JI2L 1LT3D 2O2LD 5C44G 3AYHB 2ZJRA 2P5ZX 1XMOQ 1K8MA 2B2VC 3IKJA 3GD7A 1B53A 2EYLA 1ILQA 2IT1A 4BY7G 4KJOA 5C3EH 3RLFA 1B8AA 1H95A 4CJ2C 3BS1A 2IHEA 4DAVA 3GTLB 2ID0A 1NJIC 1LYLA 4CDCC 4DV5L 4MHEA 4IOAA 4YY3L 1NMGA 2QW7A 1STYA 1K73C 2NVQB 1F2ZA 1U4MA 2Z6KC 4RGMA 1PDQA 3OWFA 1EEFD 5IE8A 4NDXA 2IJ0A 1DOKA 1HCZA 5C0XI 3MC0B 5M9OA 2I46A 1PFBA 1SE4A 3PV0A 2JJQA 5FO7B 3L7ZC 2HUGA 4AQYQ 3IRBA 3M4YA 4GS3A 2ZJPA 4KHPL 3NE5B 5I9OA 4U68A 1SRUA 2UXBQ 1DCZA 4KN4C 3C46A 1UAPA 2Z6BA 3J81i 5CBAE 1E1OA 1PFNA 2PW5A 1F2YA 4JI5L 1TXYA 3D0FA 2EVBA 2PQEA 3S1MB 1ZKOA 2NN6H 3I4NB 4RA8A 1EWIA 1S4ZA 2JEBI 1BNZA 4DR6Q 2CVRA 1AFPA 3OTOQ 4B3ML 1WVLA 2F0MA 2KENA 2FMCA 2DUDA 1D5MC 1FJGL 3HG9A 1NBWA 4A93B 1E2VA 3HOXB 2YTXA 4UP7A 4J1MA 1EYDA 4KHVA 2OEOA 3W1BA 1SYCA 2UXDL 2RDHA 4H13C 4OELB 4FXDA 2PI2E 4DNIA 3CCRA 4JC0A 1SN8A 1JICA 2SEBD 3GV6A 1J5EQ 1L0YB 3KLSA 3D3RA 4V0BA 1LTLA 5KRUA 1HR0Q 4V190 3Q6SA 4JI7L 2UXCQ 1TWAH 5FLMH 3VA5A 1I4GA 2VW9A 1LUZA 4LF6L 3MFYA 4CBVA 2WFWA 3SK8A 3HOYB 4DFAA 3VR3A 4F7XA 3BZCA 4X3TA 1PH7A 2LKVA 2K05A 1W3SA 1DJRD 3W3AA 5L37A 3U4ZA 1NE3A 1STGA 4N8FA 3J81c 3PIPA 1IYJB 2CHBD 4C2MB 2A74C 4YCWA 1DD2A 4X6AH 1PMRA 4NXNQ 3HKZE 2RDGA 3ND9A 4DU9A 4IPDA 3H6MA 4DXFA 1PRTF 2WAQB 1YHQA 1FL0A 1CM9A 1QVFA 4GOPA 1RCVD 4IOCA 2PQAB 1PH3A 1D1IA 3KJPA 2NVTB 4K8IA 3FMCA 3HOZB 3OHXC 1QOHA 2VXWA 3GTQB 1TS4A 2A69C 3H3VH 4QL5A 3SEBA 2YTYA 2F0IA 1GOZA 2MHVA 4KTAA 3FPPA 4B3SL 1TR5A 5IWAQ 3S1MH 4B3TL 2EYMA 5HGQA 3NWTA 3I4NH 1X56A 4A3DH 4YIJA 4OO1I 3WDNA 2K7VA 4ZQ3A 1I4PA 4LUZA 2TMPA 4HN7A 5CR3A 4YWKA 1HNZL 3OIPA 2EXDA 3OYYA 2HCCA 1B2TA 4A3GG 1WCMB 2BE5C 3EFXD 1KQSA 1ICFB 2QA4A 1PA6A 2IWHA 4A93H 3HOXH 2HHHQ 2R92H 4C1NI 5M3FB 2PNHA 3KK7A 4C3JB 4LFCQ 1T5EA 4ID6A 4BA1I 3EN2A 3NK9A 3TQYA 4EQOA 4OEMB 1SSOA 4YCUA 2GA4B 1SROA 4K0KQ 1I4RA 4KY6A 3VYTA 2KUMA 5M5WB 1Q8IA 3PO2G 4CKEA 4CHTB 2FJ2A 3M3YH 4J6HA 5I6YA 1K0RA 1TWFB 1XNRQ 3G48A 4DR3L 1IL2A 4KI0A 4KN7C 5LMUL 2VUMG 3SVMA 3D6CA 2LXKA 3TP8A 4DAMA 1TIID 3T4AC 3FKIG 2NZ1D 5I2XA 3RN5A 4H0LC 3AU7A 4C2MH 5FO9B 1A3TA 2VY3A 1K8GA 5DLQE 3A0JA 3URYA 4K2KA 4JBKA 2ZT9C 1I94L 2A69D 1OXXK 3LNNA 1SE8A 1EEID 3L0OA 3CCEA 1PFSA 1QJOA 1EZ6A 2MPMA 2KHIA 3MEHA 5IYDH 1KRTA 1HJPA 1N8RC 3AEVA 4E6IA 5BN5A 2KEDA 3GTOH 5E7NA 4LW1A 4BXXG 1ONLA 4TKOB 4C3IG 2BE5D 1TVXA 2NVTH 1RTNA 2VB2X 2JEAI 3HOZH 3GTQH 3G71A 1X32A 2ZXOA 3UE1A 2SNSA 2Z0SA 1TS3A 5CV4A 1SYFA 1BUVT 1I4XA 4A3IB 4A3JB 1FNWA 4FO2A 1PV4A 2SOBA 1Y8NB 2O5IC 3X3NA 2VQEL 3QG1A 3K0XA 4RCOA 1C4QA 2L0CA 1VQGA 2XRSD 2L4NA 2JA8H 4PNYA 1MSHA 3HRZC 4RCNA 4DV7L 1E2WA 4PZ6A 4CJ1B 2HQEA 2HIXA 2JQOA 1GHKA 2PW7A 5EKKA 2UUAL 4BY1H 3Q22A 2E76C 5JPNC 1MBYA 2EYJA 4IUVA 3GTJB 2MO1A 1HQRD 3SK4A 3OMGA 3P7JA 1KNAA 3NEMA 4RAUC 4C3HG 4PV1C 4ZUJA 4L63B 3J80i 2EYOA 1EY9A 1KL9A 2WIIB 4ODGA 4DV6L 1HUNA 2A68C 2N88A 3I73A 5K5PA 1OTCA 2RBMA 1F9SA 5AFWA 2NUCA 5M3MB 4G7HC 3H0GG 2R6GA 3K5NA 4DV1Q 2WB1B 1PYSB 1HPCA 1UE5A 3BYTB 2JA6B 1YNXA 3J7AV 2Y0SE 4JI3Q 3UDGA 4LF9Q 5J39A 4DA2A 5LL6S 3CCJA 1JB7A 4HMJA 2GVBA 1WD0A 4A3EH 2B2WC 1STEA 3L2PA 1BF4A 1H9KA 2IHFA 1KHIA 4UP8A 3IFTA 1SAPA 1TWHB 2EIFA 2QEJC 1RJTA 4JK1C 2K1BA 1UE7A 4X66Q 1MI2A 4HCSA 1CSPA 3P1HA 2F0UA 1AE3A 3I70A 4WRDA 4DUZL 1CTMA 2DJGC 1O7IA 3C1FA 4OONA 3J81L 3S2DB 4IUUA 1JWSD 4LF4L 1ET9A 1SNQA 2XWJB 4LF7Q 4DF7A 4XYQA 2AUKA 3GQBA 2QDLA 3BDCA 3PUYA 1S5FD 4XQNA 3D31A 5EPKA 3J80c 4P71A 4DR4L 1N9WA 1B9NA 1RDPD 3I4OA 3UDFA 2B63G 1CHPD 2K28A 2RVLA 5CGKA 1IYUA 2NBFA 1Q82C 2YU9B 4P74A 4IJHA 1MIUA 2L12A 3WOFA 3J7YW 1A0IA 2PYKA 1CT1D 2HDMA 3HKZG 4A3KH 4DV2L 4A3BG 1JWUD 5C4ZA 2A68D 2UUBQ 4G7ZC 4QIWE 5IYCH 3I4MG 1STNA 3H15A 2EY5A 4IALA 4JVZA 3Q23A 1KD1C 1SE3A 2MP1A 2DN8A 1V8QA 2MNAA 5M5XB 1ENAA 3GTJH 4PMBA 3GTGB 2RSOA 5C4XG 1TS5A 3GDEA 1HZBA 3CPWA 2B3GA 1LTRD 1YEZA 2WINB 3DXJC 4I65A 1S5CD 4OX9Q 2X69A 3CMEA 5M3MH 2F3VA 4CDFC 4JI4L 3T1YQ 2JA6H 2ZJQA 1A6XA 2V4DA 2R7ZG 1L2FA 1V43A 1WTRA 5C4HA 1X9NA 2CWAA 1TY0A 1YITA 1T5XD 3FP9A 1L1OC 2F0WA 5CORA 5COYA 1LTBD 1AH9A 1O80A 5EPLA 4DV0L 4A3FH 2A19A 3K8AA 3S1NH 2I0QA 1G2SA 4A3LH 2D0OA 2XRQD 1VF7A 4DV5Q 4HJ7A 1LM0A 3A5UA 4YY3Q 4B3RL 5M5YB 1TWHH 4LK1C 2QDBA 5JAVA 5JVH3 5DM63 1GO3E 2LFNA 2N3SA 4AIMA 3CRKC 2F0NA 2QGQA 4R9WA 3W5OA 4AYBE 1QUQB 3DHQA 5C3EG 1O78A 3DM3A 2F0HA 1VQ6A 4QY7A 4XQQA 1V1QA 3ZYYX 4HEDA 1JR0D 1UUPA 1C48A 4KHPQ 3TREA 2BH8A 1GVPA 2BCOA 1FNUA 3PCOB 4BBSB 2OCEA 4LWCA 1CA5A 3L9AX 2JSOA 1NNXA 5A2QL 2D9UA 4A3MG 1PH2A 3T13A 2J7ZA 2HD3A 3KLSX 1B70B 4KMUC 4JI5Q 1DONA 2EXZA 2E5LL 1XX8A 5HURA 3KBXA 4FF4A 4L5SA 4HSPA 2B39A 2F0SA 3MHBA 1LTSD 5JVG3 4JYAL 3M4PA 5IGEA 1SNCA 3HOWB 4B3MQ 3BVGA 3S9WA 3CCQA 3LWEA 4JI1Q 3NBHB 3NP8A 1VQKA 1CA6A 1Q12A 5C0XH 2UXDQ 4IQZA 1HA5A 3CPFA 3ZJYC 5CC4A 5IYBH 3M7NA 3RZDB 4BS9A 1JOKA 1X54A 5M5XH 3GTGH 4P72A 5CBEE 1JC7A 1GUOA 2PPBC 2R7FA 4LF6Q 3F2UA 3EIVA 5KNBA 3G6JB 3S14B 1DZ1A 3D8GA 3G4SA 2A6EC 4Y7NB 1YHAA 1NR2A 3LGJA 4JW0A 1H9RA 1I3QH 3K5OA 2JP1A 1KRSA 2K50A 2YTVA 3EVQA 2MJ8A 5IOCA 5LMNL 3J81E 3MA2B 2IY5B 2JA5B 3ULLA 4X64L 5FLMG 3HOUB 5FKAC 4N9PA 3S1RB 3EQLC 2QEXA 4IUTA 1QZGA 1DOMA 4FF3A 4QJFA 5BN3A 4FXGC 1KIXA 2AQ2B 5M5YH 3HOVB 3X3MA 3OOCA 1QILA 1M4VA 4O1NA 1YNJC 3GTMB 4ZAIA 3R2TA 3PSIA 1TQOA 5C5LA 2F0PA 4EQNA 4G7OC 4EQ5A 4A75A 5IGCA 1EIHA 4GKJL 4YHHL 5ELEA 3HGBA 3CKIB 5JJZA 2VL6A 5EJWA 2K03A 1SDFA 2Y0SG 5KEEA 2G9DA 3ERQA 2JA7G 4Q5VA 1Y1VB 1M8AA 2FXQA 1PZJD 4UAIA 5IODA 1X3PA 2XVSA 1GXDC 1SBBB 1ASYA 4B3SQ 1W6JA 5GQOA 3NWSA 1V1OA 1QE6A 1N32L 1FR3A 2Z8LA 3I90A 4DR1L 1EU4A 1TS2A 3CP0A 3HOWH 2F0GA 4RKBA 2JE6I 5JOBA 1HNZQ 4O2DA 1EWHA 4NPSA 3CCVA 2JN4A 4KD3A 3KDFB 1GD7A 5JJLA 5GAGC 3JAMi 3J81j 3S15B 3OSOA 5C44B 1PTOB 2K14A 2A6ED 3PF5A 1E22A 2WKCA 1D7QA 4R4IA 3J80L 3RZDH 1PTOF 1WTHA 4A3DG 4JG2A 2KCCA 2F4VL 4R1JA 3H94A 4QMGA 4QUCA 4UY8C 4BY7B 2E8GA 3JC66 4MN3A 1O7YA 2K33A 1CKNB 3A8IE 1TWCB 3K7UC 1QCBD 4PMWA 4GOPC 4A93G 4HR7B 5D3DA 3BYYB 1Z47A 2R92G 3S14H 1KDAA 2AHOB 4XIGS 1M1KC 4RWSC 3TN2A 1PH9A 4GNXC 2KHSA 3GTKB 1VQBA 1YNJD 5IP9H 5KNDA 5LMUQ 1XTDA 4JPBW 4QF4A 4P73A 5KGUA 2JA5H 1KDBA 1YNNC 4IZ8A 2OTLA 1TY2A 5IY0A 2PZTA 5A2QE 3U4VA 3S1RH 3TP7A 4R4QA 3J7A5 1I4QA 2CQAA 5JEAH 4BBRH 1XPOA 2B2TA 1LTGD 1CQVA 5TSSA 3N6RA 2XGTA 4JCVE 1HNXL 3I72A 3STBC 3GTMH 4DR2L 2L15A 3KJOA 2I5LX 1K28A 1KDCA 2NTTA 3PO3G 1PVOA 2F0DA 3EBEA 3PUWA 3JAMc 4IPGA 1LABA 3AFPA 2LMCB 1SNPA 1Y1VH 1ESRA 4L5TA 5T1IA 4LUVA 1EIFA 3LWUA 4F87A 1Q90A 3M85A 3RZOB 5IYDG 4KLKA 5C5MA 2D2CC 2IL8A 3I7FA 1YBYA 2XN9C 2VQEQ 1K83B 4QCLA 3GTLH 2F0EA 4ULLA 4MIUA 3TMEA 5I4DA 3I56A 3GV3A 2F1MA 3VR4A 2L9HA 4IO9A 1VQCA 2NVQH 2OQ0A 1PRTB 2Q8IB 4K2LA 4DK6C 4DNRB 3S17B 3BDOA 5ISRA 4AYBG 3QR8A 2K32A 4ILWA 3E0EA 3N52A 3S15H 5C44H 1XJVA 4TQUS 4LFBQ 1EIGA 1RIPA 3MWYW 1BQQT 3CW2C 4A4IA 1YNND 5EBDA 4BY7H 1Z7TA 1LTTD 2O5JC 4F8MA 4DV6Q 1EQRA 3IFDA 2QCPX 4EGVA 2EY2A 1DYQA 1TWCH 4CDEC 1OO9B 2JA8G 3TS2A 1QZHA 3TSSA 2F0LA 2E2HB 2IPKD 1GHJA 2ZTCA 4ZKCB 3BU2A 1XMQL 1L0XB 1ET6A 5D65A 4BY1G 3STBD 4GZYC 5DAUA 1Z6HA 2AQ1B 3M4QA 3CD6A 4NKLA 5D3IB 1KNEA 1EIYB 3NUCA 3UI2A 1S72A 1EQQA 1HNWL 3QB3A 2KEEA 3BZKA 2Q2TA 1C7YA 2B2UA 4I7ZC 1EWCA 1LT4D 1JJCB 1ZXTA 1PFMA 4XXEA 4DXGA 5JJKA 1DGSA 3L3OC 1BCPB 1STBA 1XNQQ 2KBNA 1GUGA 2DJFC 4WJ4A 1SJED 1C9OA 1JWMD 4DUZQ 2DGYA 3E0JA 1BCPF 1OXSC 1HQMC 4A3EG 3HOYH 3PUZA 1P8LA 2F0FA 3VYUA 3T56B 4AQYL 4LF4Q 1J9OA 1JE5A 3PUXA 1F77A 1T9HA 4A3GB 4R4CA 3IAYA 4X65Q 4GN3B 3RR5A 2C5CA 3FEWX 2UXBL 1UE6A 2Z9HA 3J80E 3FHWA 5LMNW 1B50A 4RH6A 5LL6X 5KYLA 1G51A 3RZOH 2OTJA 1LACA 1BBWA 1VQFA 5C3WA 1AW7A 2XIWA 1FYCA 4FF2A 3A74A 4DR4Q 1MJEA 1WTOA 1U0LA 1KLGD 4DUYL 2K04A 1XTCD 5J1ZA 1VQOA 5ELOA 4IURA 2VQFL 1EY7A 2E74C 4DV2Q 1ZEQX 1FVIA 3S17H 1A2TA 1MSGA 5EAYA 2LSSA 1IBKL 1EY5A 1EY0A 1O7ZA 4CKBA 4DV3Q 5BN4A 1VQ4A 4KKSA 2UU9L 3PO2B 1IKMA 4LF5L 3A56A 3CXCA 1EL0A 1NTGA 1QUQA 2HT1A 1MKHA 1UEBA 1I4HA 4TRDA 4PG3A 4QB4A 1D8LA 2ZTDA 2VUMB 3FDTA 1RL2A 2H5XA 1PH6A 3CCMA 1HR0L 2UUCL 4A3KG 2UXCL 2CWPA 1VQ9A 2GN5A 2I07B 2BA1A 3FKIB 1SXTA 1JMCA 3QIAA 2E2HH 5IYCG 4IPCA 3SGIA 4HJ9A 5LHY1 2B2YA 4J15A 5E4WC 5NUCA 1SR3A 1WCMH 1C0AA 1DXMA 4DV0Q 2NVYB 3MAQA 1R9TB 1IBML 3QOLA 2PMZE 1HFNA 1IKLA 3LX0A 5M3FH 4C3JH 2F4IA 2BH2A 2EE1A 2EYHA 3NBHA 4IUNA 1NCVA 4B3RQ 5GROA 4JI0Q 4C3IB 1UWVA 5M3MG 5HY6A 2LS01 2KJXA 1N33L 2ZXRA 4JBWA 1E24A 5M5WH 4FXKC 1J8IA 3ONAB 3T1HQ 1BBUA 2ENBA 4A3FG 1FNVA 3J7ZC 4DNTB 3PUVA 1TWFH 2HIVA 4G4KA 4A3LG 1Q46A 1EQVA 1ASZA 1SEBD 4KY7A 4IFDH 2BDNA 1JCKB 3H3VC 3OMCA 3UE0A 1SMYC 5DM73 3NQTA 2E5LQ 4RKLA 3KF8B 1EY8A 1SFOB 5ELBA 3JAML
chains in the Genus database with same CATH topology
2XSCA 2BOSA 4C56C 4C3HB 1JORA 4RHRA 1IL8A 3QOJA 1X3QA 3S1QB 5IIFA 2NTSA 4FVMA 3H0GB 4HSVA 2FMMA 3PIO3 2SNMA 2Q8TA 4TSSA 1Q3LA 5I9PA 4NW2A 5DEHA 1B9MA 3E6ZX 3TZUA 3AB9A 3MXGA 5C3XA 1F2MA 1PXUA 1LO5D 5FO8B 1I6HB 3GTPB 1LTID 4K5XA 2A6HC 3K7AB 1RD9D 2Z4IA 1ENFA 4OIKA 4OIJA 4LAAA 4WJWA 1SMYD 2X6GA 4P2CB 2EPBA 1ZYRC 3DEOA 5EKIA 3U9SA 1PZID 2EYPA 5ELFA 4K5WA 2B63B 1ILPA 4KK7A 4K5VA 1E2ZA 2F0TA 4KY5A 2AWOA 1ESFA 3HKZB 2XNAC 3M4OB 1XYIA 3E5SA 2L1BA 4A3BB 1I50B 2KECA 1CZGA 3I4MB 3A54A 1FGBD 1O7LA 1GUNA 4IUPA 1HRJA 4KHZA 5HGTA 3MXUA 5D14A 5C4XB 5E4XA 1WTQA 2WKDA 4M1UB 3RD4A 3PMFA 1JE4A 1QWYA 2WACA 4ZKBB 1XXGA 1H9JA 1LT5D 2R7ZB 1F2LA 1D6EC 3HS0C 5CV6A 2NWGA 2RA4A 3DMUA 2A6HD 1VF5C 4IN3A 2RDFA 2F03A 2KCNA 3NPPA 1KTKA 1B4OA 2DY7A 5J22A 1Q1BA 2AWNA 1ZYRD 2BDOA 4ABNA 2OXPA 2IX1A 1Y69U 2EZVA 2NYZD 2NN6G 4XT1B 2QILA 2ZXPA 3DEPA 3OIQA 4A3MB 1CHQD 1SYGA 4R8IA 3JAME 1B1ZA 2F0QA 3BDLA 2MGSA 1SYBA 2JXMB 5JEAG 1VDZA 1SNDA 3VYRA 5K36H 1BXTA 3K58A 3KLRA 4NMZA 3TBIB 3DM1A 3V2TA 3I3CA 1HTPA 2EDGA 3VA7A 1HUMA 1A2UA 1CI3M 4LMQD 4ME5A 3NSWA 4H7BA 2RQXA 2YYZA 1ICWA 2Z4HA 1R4PB 1AZQA 5E3FA 1CFMA 5I6WA 2NVXB 3MZ5A 2PZWA 4K8JA 3TZDA 3VR5A 3KBGA 3HEJA 1TWAB 3M7GA 1TU2B 5EPJA 1D1KA 2A73B 3QO2A 3WOEA 2AUJD 2F0VA 2R61A 5KNCA 1H9SB 1U9RA 4J8QA 1I6VC 5CV8A 1H9MA 1U4RA 1BR9A 3K6OA 5C6AA 2Y0SB 1BOSA 3A55A 2K5DA 2JA7B 1STAA 4OHJA 2LY7A 4DN4M 1U4PA 4X3UA 3MVVA 2EJGC 1R4QB 1II3A 4ZUIA 4KJNA 2L5TA 3R93A 1CK1A 4HTHA 1WD1A 1KABA 4B9WA 3NTIA 4HMIA 4OO1H 5JEAJ 4XQJA 4U673 3I91A 3BZDB 4S3SA 1A3UA 3NTHA 2F0OA 3BVZA 2KQ3A 3SXHA 2X6LA 1WTWA 3S2HB 3I4LA 4DAPA 3NTKA 5IGGA 2EJMA 2FHTA 4FNFA 4A3DB 1JOQA 3H09A 2RSNA 3RMHA 1VMCA 3R3OA 2J0TD 4CGYB 1EQTA 2O4XA 1IW7C 2R92B 4L6TB 2B2UC 3Q0AA 1D2BA 4H44C 1PLFA 1F9RA 3P75A 1HA6A 3D4RA 2QKIC 2K5WA 3RUZA 5G3LD 2B2VA 3SR1A 1BDOA 5T1GA 4QIWB 2AQ3B 2D62A 1G2TA 3M3YB 1EZ8A 3KF8A 3NQIA 1E0BA 3BG3A 5CMDA 2PZUA 2KOLA 2IW3A 1EYAA 1SYEA 1ENCA 2M00A 1JB3A 3A7LA 3DWQA 2VNUD 3PO3B 1PTOH 1EYCA 1OXUA 2F0JA 3G7LA 3C3LA 3J7AF 3EJIA 2KVMA 1S5ED 1B44D 2L11A 3K5LA 1V1PB 1EU3A 4KD4A 2WV6D 3CHBD 3TP5A 4C3JG 4DAYA 1EFID 2EY6A 3GTOB 2K01A 3C2PA 4F88A 4ZRZA 1FD7D 4AYBB 5CYUA 1IW7D 4KKUA 5CV5A 3S16B 3SDZA 2EOTA 4HAEA 1LV9A 1WTVA 2NN6I 4O42A 1Q1EA 4C1NK 1UNSA 2B2YC 3ITPA 1EOTA 2H1EA 2D5DA 4X3SA 3VYSA 4IFDG 3K57A 2JA8B 2BA0A 3HP3A 5KYIA 2HCIA 5DNFA 1AZPA 1STHA 2CW0C 3SHLA 4BY1B 3PIP3 1ML0D 1LT6D 5ELDA 2IX3A 4XDXA 4OGQC 3HZXA 4L8JA 4RHSA 3NHHA 1G91A 1OXTA 3GO5A 5EQ0A 3A8KE 3CU7A 1Y8OB 2E2DC 1TT2A 1A3VA 1F9PA 3EA6A 4FF1A 3W2DA 5F2DA 4A3EB 1RF2D 1DOLA 1RODA 1F9QA 3OW7A 4OL7A 1OXVA 1AEXA 4Z9CB 1SNMA 1AP0A 1EY6A 2DNCA 5I2YA 4N9TA 5IT9L 2QF7A 1UEAB 4NP5A 3TDQA 1JQYD 4CKCA 2J4XA 4R8NA 4XT3B 2VB3X 4KV6A 5IGFA 5FLXL 2N55A 3MXNA 1TWGB 4RGOS 2CW0D 5C4JB 3D4DA 4CJ0B 1GUWA 3T51B 3IL8A 3CQZB 1C8CA 4A3KB 3KUPA 4IFDJ 1G8ZD 2ICIA 1PTOC 4ZYSA 5CV9A 2OT2A 3OWEB 2SDFA 4FYDA 4FP5D 1Y8PB 3A7AB 1EY4A 3K59A 3Q24A 5JPMC 2M2LA 1WTPA 4G57A 2K6AA 2HDLA 2ICEC 4DGZA 4KKTA 3SK6A 2C9OA 1GJXA 1W6KA 4A3FB 3S1NB 1HHVA 5G3LF 3DUZA 3MXPA 4ZK9B 4WFN3 5IGBA 4K14A 1NAPA 2DNEA 1SJHD 2EJFC 2JYOA 4RGTA 4X3KA 1D5XC 3V96A 1S5BD 4PQXA 4ZLTF 2FINB 2F0KA 5C0XG 3BVMA 3T16A 3QWNA 1S5DD 1QG7A 3MTSA 1XWEA 2E2IB 5IGDA 3U9OA 4QUFA 3R8BA 4LJZC 1LLRD 1H9SA 4BA2I 1KLUD 2R93B 1PTOD 2KA7A 2B8FA 3CRLC 4DK0A 5E1FA 1U4LA 4K6LA 1Y1WB 2G9HD 3O13A 5KIXA 3NBIA 4EVOA 1PRTC 5K36G 5ELCA 3TP6A 4DK1A 3K5MA 1HXYD 3FRPB 4UDUC 3DWAA 4Q0FA 3OPOA 2IX0A 2E2JB 1RTOA 1K8OA 1PYWD 4M8AA 1LTAD 2NB0A 2K5QA 1B3AA 2H4OA 2EY1A 5IT9E 3T53B 1CZWA 1NSNS 1VCIA 2EYFA 2B2WA 3R2IA 2B8GA 1HTLD 3AMUA 4IFDI 1I3QB 2PO4A 3MFGA 4RGNA 2FFKB 3V05A 2F3WA 2TSSA 3K0YA 4K6DA 1VMPA 5EKLA 3D6WA 4RFBA 1GUTA 5FLXE 1GUSA 2R3ZA 5A35A 5CV7A 1JOOA 1BCPC 1G6ZA 2PCFB 2MUYA 2PNRC 3C1EA 5C0XJ 3EROA 1PRTD 3I8ZA 1MD2D 5EGTA 3P20A 1CQFA 4PMCA 1A15A 1NUCA 5C3EB 4EQPA 2E75C 1G291 2L55A 4HCEA 2WP8J 3A8JE 4OO1G 3VR2A 3NXWA 3DWPA 4B9XA 1IYVA 1MGSA 1SYDA 1V1PA 4XYOA 4IUQA 4B08A 1DM0B 1AN8A 5EBCA 1NR4A 5FK9C 4XTCS 1QNKA 2A5HA 2M9VA 3VR6A 4BWGB 2OF1A 3D4WA 1IHZA 1TKWB 3FVQA 3ND8A 2XWBB 1RKNA 1BCPD 4WORA 3FPUB 3SE0A 3GP7A 2Z1CA 1PZKD 1SE2A 2B2TC 2Q8RE 1QB5D 1KAAA 2DY8A 5FOBB 1QNUA 3H91A 4BBRB 1BBXC 1WTXA 3QJYA 2RKSA 1D5ZC 1RHPA 2PMZB 1BO0A 1SNOA 1HFGA 3SK5A 1LT3D 2O2LD 1K8MA 2B2VC 3IKJA 3GD7A 1B53A 2EYLA 1ILQA 2IT1A 4KJOA 3RLFA 4CJ2C 3BS1A 4DAVA 3GTLB 2ID0A 4MHEA 2NVQB 1STYA 1F2ZA 1U4MA 4RGMA 1PDQA 3OWFA 1EEFD 4NDXA 2IJ0A 1DOKA 1HCZA 5C0XI 3MC0B 5M9OA 2I46A 1PFBA 1SE4A 3PV0A 5FO7B 3L7ZC 2HUGA 3M4YA 3NE5B 5I9OA 4U68A 1DCZA 4KN4C 3C46A 1UAPA 5CBAE 1PFNA 2PW5A 1F2YA 2EVBA 2PQEA 3S1MB 1ZKOA 2NN6H 3I4NB 4RA8A 1S4ZA 2JEBI 1BNZA 2CVRA 1AFPA 1WVLA 2F0MA 2FMCA 1D5MC 3HG9A 4A93B 1E2VA 3HOXB 4J1MA 1EYDA 4KHVA 2OEOA 1SYCA 2RDHA 4H13C 4FXDA 1JICA 2SEBD 3GV6A 1L0YB 3KLSA 3D3RA 4V0BA 5KRUA 4V190 3Q6SA 3VA5A 1I4GA 3MFYA 4CBVA 3SK8A 3HOYB 4DFAA 3VR3A 4F7XA 4X3TA 2LKVA 2K05A 1DJRD 3W3AA 1STGA 2CHBD 4C2MB 2A74C 1DD2A 1PMRA 2RDGA 3ND9A 4DU9A 3H6MA 4DXFA 1PRTF 2WAQB 1CM9A 1RCVD 1D1IA 2NVTB 4K8IA 3FMCA 3HOZB 3OHXC 1QOHA 2VXWA 3GTQB 1TS4A 2A69C 3SEBA 2F0IA 1GOZA 2MHVA 4KTAA 3FPPA 1TR5A 2EYMA 3NWTA 4YIJA 4OO1I 3WDNA 2K7VA 4ZQ3A 1I4PA 2TMPA 4HN7A 5CR3A 3OIPA 2HCCA 1B2TA 1WCMB 2BE5C 3EFXD 2IWHA 4C1NI 5M3FB 3KK7A 4C3JB 1T5EA 4ID6A 4BA1I 3NK9A 4EQOA 1SSOA 2GA4B 1I4RA 4KY6A 3VYTA 2KUMA 5M5WB 1Q8IA 4CKEA 4CHTB 2FJ2A 4J6HA 5I6YA 1TWFB 4KI0A 4KN7C 3SVMA 3D6CA 3TP8A 1TIID 3T4AC 2NZ1D 5I2XA 4H0LC 3AU7A 5FO9B 1A3TA 3URYA 4K2KA 2ZT9C 2A69D 1OXXK 3LNNA 1EEID 1QJOA 1EZ6A 2MPMA 3MEHA 4E6IA 5BN5A 2KEDA 1ONLA 4TKOB 4C3IG 2BE5D 1TVXA 1RTNA 2VB2X 2JEAI 1X32A 2ZXOA 2SNSA 1TS3A 5CV4A 1SYFA 1BUVT 1I4XA 4A3IB 4A3JB 1FNWA 4FO2A 2SOBA 1Y8NB 2O5IC 3X3NA 3QG1A 4RCOA 1C4QA 2L0CA 2XRSD 2L4NA 4PNYA 1MSHA 3HRZC 4RCNA 1E2WA 4CJ1B 2HQEA 1GHKA 2PW7A 5EKKA 3Q22A 2E76C 5JPNC 1MBYA 2EYJA 4IUVA 3GTJB 3SK4A 1HQRD 3OMGA 3P7JA 1KNAA 4RAUC 4C3HG 4PV1C 4ZUJA 4L63B 2EYOA 1EY9A 4ODGA 2WIIB 1HUNA 2A68C 2N88A 3I73A 5K5PA 2RBMA 1F9SA 5AFWA 2NUCA 5M3MB 4G7HC 2R6GA 3K5NA 2WB1B 1HPCA 2JA6B 3BYTB 3J7AV 5J39A 4DA2A 5LL6S 4HMJA 1WD0A 2B2WC 1STEA 1BF4A 1H9KA 3IFTA 1SAPA 1TWHB 2QEJC 1RJTA 4JK1C 2K1BA 1MI2A 4HCSA 3P1HA 2F0UA 3I70A 4WRDA 1CTMA 3C1FA 3J81L 3S2DB 4IUUA 1JWSD 1SNQA 1ET9A 2XWJB 4DF7A 4XYQA 2AUKA 3GQBA 3BDCA 3PUYA 1S5FD 4XQNA 3D31A 5EPKA 1B9NA 1RDPD 1CHPD 2K28A 2RVLA 5CGKA 1IYUA 2NBFA 2YU9B 3J7YW 2L12A 3WOFA 2PYKA 1CT1D 2HDMA 1JWUD 5C4ZA 2A68D 4G7ZC 1STNA 2EY5A 4IALA 3Q23A 1SE3A 2MP1A 2DN8A 1V8QA 5M5XB 1ENAA 3GTGB 4PMBA 2RSOA 1TS5A 1LTRD 2WINB 3DXJC 4I65A 1S5CD 2X69A 2F3VA 1A6XA 2V4DA 1V43A 1WTRA 5C4HA 1TY0A 1T5XD 5CORA 2F0WA 5COYA 1LTBD 1O80A 5EPLA 1G2SA 2XRQD 1VF7A 5M5YB 4LK1C 2QDBA 5JAVA 5JVH3 5DM63 2LFNA 3CRKC 2F0NA 4R9WA 3DHQA 1O78A 2F0HA 4XQQA 3ZYYX 4HEDA 1JR0D 1UUPA 1C48A 2BCOA 1FNUA 4BBSB 1CA5A 3L9AX 2JSOA 5A2QL 2D9UA 3T13A 2J7ZA 3KLSX 4KMUC 1DONA 2EXZA 1XX8A 5HURA 3KBXA 4FF4A 4HSPA 2B39A 2F0SA 3MHBA 1LTSD 5JVG3 5IGEA 1SNCA 3HOWB 3BVGA 3S9WA 3LWEA 3NP8A 1CA6A 1Q12A 5C0XH 4IQZA 1HA5A 5CC4A 3M7NA 3RZDB 4BS9A 1JOKA 5CBEE 1JC7A 1GUOA 2PPBC 3F2UA 5KNBA 3G6JB 3S14B 1DZ1A 3D8GA 2A6EC 4Y7NB 1NR2A 1H9RA 3K5OA 2JP1A 3EVQA 2MJ8A 5IOCA 3J81E 3MA2B 2JA5B 3HOUB 5FKAC 4N9PA 3S1RB 3EQLC 4IUTA 1DOMA 4FF3A 5BN3A 4FXGC 2AQ2B 3HOVB 3X3MA 3OOCA 1QILA 1M4VA 4O1NA 1YNJC 3GTMB 4ZAIA 3R2TA 1TQOA 5C5LA 2F0PA 4EQNA 4G7OC 5IGCA 1EIHA 5ELEA 3HGBA 3CKIB 5JJZA 5EJWA 2K03A 1SDFA 5KEEA 2G9DA 3ERQA 4Q5VA 1Y1VB 1M8AA 1PZJD 4UAIA 5IODA 1X3PA 2XVSA 1GXDC 1SBBB 1W6JA 3NWSA 1V1OA 1QE6A 1FR3A 2Z8LA 3I90A 1EU4A 1TS2A 2F0GA 4RKBA 2JE6I 5JOBA 1EWHA 4KD3A 3S15B 3OSOA 5C44B 1PTOB 2A6ED 2WKCA 3J80L 1PTOF 2KCCA 3H94A 4QMGA 4QUCA 4BY7B 4MN3A 1O7YA 2K33A 3A8IE 1TWCB 4PMWA 1QCBD 4HR7B 5D3DA 3BYYB 1Z47A 1KDAA 4XIGS 4RWSC 3TN2A 2KHSA 3GTKB 1YNJD 5KNDA 4QF4A 5KGUA 1KDBA 1YNNC 4IZ8A 1TY2A 2PZTA 5A2QE 3TP7A 1I4QA 2CQAA 5JEAH 2B2TA 5TSSA 1LTGD 1CQVA 3N6RA 3I72A 1KDCA 2NTTA 2F0DA 3PUWA 1LABA 2LMCB 1SNPA 5T1IA 1ESRA 3LWUA 4F87A 1Q90A 3M85A 3RZOB 5C5MA 2D2CC 2IL8A 2XN9C 1K83B 4QCLA 2F0EA 4ULLA 4MIUA 3TMEA 5I4DA 3GV3A 2F1MA 3VR4A 2L9HA 1PRTB 2Q8IB 4K2LA 4DNRB 3S17B 3BDOA 5ISRA 2K32A 4ILWA 3N52A 4TQUS 1EIGA 3MWYW 1BQQT 1YNND 5EBDA 1Z7TA 1LTTD 2O5JC 4F8MA 3IFDA 2QCPX 4EGVA 2EY2A 1DYQA 1OO9B 3TSSA 2F0LA 2E2HB 2IPKD 1GHJA 4ZKCB 1L0XB 1ET6A 5D65A 4GZYC 5DAUA 1Z6HA 2AQ1B 4NKLA 5D3IB 1KNEA 3NUCA 3UI2A 3QB3A 2KEEA 2B2UA 4I7ZC 1EWCA 1LT4D 1ZXTA 1PFMA 4XXEA 4DXGA 3L3OC 1BCPB 1STBA 1GUGA 1SJED 1JWMD 3E0JA 1BCPF 1OXSC 1HQMC 3PUZA 2F0FA 3VYUA 3T56B 1J9OA 3PUXA 1F77A 4A3GB 3IAYA 2C5CA 3FEWX 3J80E 1B50A 4RH6A 5LL6X 5KYLA 1LACA 5C3WA 1AW7A 2XIWA 1FYCA 4FF2A 1WTOA 1KLGD 2K04A 1XTCD 5J1ZA 4IURA 1EY7A 2E74C 1ZEQX 1A2TA 1MSGA 1EY5A 1EY0A 1O7ZA 4CKBA 5BN4A 4KKSA 3PO2B 1IKMA 3A56A 1EL0A 1I4HA 4TRDA 4QB4A 2VUMB 3FDTA 2I07B 2BA1A 3FKIB 1SXTA 3QIAA 5LHY1 2B2YA 5E4WC 5NUCA 1DXMA 2NVYB 3MAQA 1R9TB 3QOLA 1HFNA 1IKLA 3LX0A 2F4IA 2EE1A 2EYHA 3NBHA 4IUNA 1NCVA 4C3IB 2LS01 2KJXA 2ZXRA 4JBWA 4FXKC 1J8IA 3ONAB 2ENBA 1FNVA 4DNTB 3PUVA 4G4KA 1EQVA 1SEBD 4KY7A 4IFDH 2BDNA 1JCKB 3H3VC 3OMCA 5DM73 1SMYC 3NQTA 4RKLA 1EY8A 1SFOB 5ELBA 3JAML
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XSC A;  4ULL A;  1QOH A;  2BOS A;  1D1K A;  1BOS A;  4M1U B;  1R4P B;  1R4Q B;  3MXG A;  1QNU A;  1CZG A;  2C5C A;  1C48 A;  1C4Q A;  4P2C B;  1CZW A;  2GA4 B;  1CQF A;  1DM0 B;  1D1I A; 
#chains in the Genus database with same CATH topology
 3UDI A;  2XSC A;  1KC8 C;  1X65 A;  2BOS A;  2AKW B;  4GLA C;  3RNU A;  4MTN A;  4C56 C;  4C3H B;  4OXP A;  3W1G A;  2N49 A;  1JOR A;  4RHR A;  1IL8 A;  2R93 G;  3QOJ A;  1X3Q A;  2HHH L;  1Z9F A;  3S1Q B;  5IIF A;  2NTS A;  4GN5 A;  4FVM A;  2MO0 A;  4LFC L;  3H0G B;  1Y1W G;  1CKM A;  4HSV A;  4WJ3 M;  2VUM H;  2Q2I A;  2FMM A;  3VDY A;  4DV4 L;  3PIO 3;  3U50 C;  2SNM A;  2Q8T A;  4TSS A;  1Q3L A;  5I9P A;  1A8V A;  4OWT B;  4DAY B;  4LFA L;  4A3C G;  3FKI H;  4A3I H;  4NW2 A;  5DEH A;  5BR8 Q;  4A3J H;  1B9M A;  4NXM L;  3E6Z X;  1VQE A;  3TZU A;  3AB9 A;  3MXG A;  4GKK Q;  5C3X A;  1WYD A;  1F2M A;  1LO5 D;  1PXU A;  2CCZ A;  4L5Q A;  3ULP A;  5FO8 B;  1XPR A;  1I6H B;  3GTP B;  1R9T H;  1LTI D;  4K5X A;  2F52 A;  1PYB A;  2A6H C;  2MQH A;  3KDF A;  3K7A B;  1RD9 D;  2Z4I A;  3PF4 A;  1ENF A;  4OIK A;  1N34 Q;  4OIJ A;  4LAA A;  4WJW A;  1SMY D;  3WWV A;  3TS0 A;  2X6G A;  4P2C B;  4L5R C;  2EPB A;  1ZYR C;  4JI2 Q;  3DEO A;  2A8V A;  5EKI A;  3U9S A;  3HFZ B;  1PZI D;  2EYP A;  5ELF A;  1CKN A;  4YHH Q;  4GKJ Q;  4K5W A;  2B63 B;  1ILP A;  4KK7 A;  4DR5 L;  4JBM A;  4K5V A;  1BKB A;  1E2Z A;  4RMF A;  2F0T A;  4KY5 A;  2AWO A;  1ESF A;  3HKZ B;  2XNA C;  3M4O B;  1XYI A;  1E3P A;  3E5S A;  1CSQ A;  2L1B A;  4A3B B;  1I50 B;  2KEC A;  1CZG A;  2NZO A;  1VQM A;  3I4M B;  3A54 A;  2WAQ E;  1FGB D;  4X62 L;  4JBJ A;  1O7L A;  1GUN A;  4IUP A;  1HRJ A;  4KHZ A;  5HGT A;  3MXU A;  1Y14 B;  5D14 A;  5C4X B;  5E4X A;  4DKA C;  1WTQ A;  2WKD A;  4C3H H;  5AJ3 L;  1GM5 A;  4M1U B;  3RD4 A;  3PMF A;  1JE4 A;  1QWY A;  2WAC A;  4ZKB B;  3H0G H;  3S2D H;  1XXG A;  1H9J A;  2F4V Q;  1LT5 D;  2R7Z B;  4DK3 C;  1F2L A;  1D6E C;  3HS0 C;  5CV6 A;  2NWG A;  4MTK A;  4YCV A;  3ULJ A;  2RA4 A;  3DMU A;  2A6H D;  1VF5 C;  4IN3 A;  2RDF A;  4Y52 H;  2F03 A;  2KCN A;  3NPP A;  1KTK A;  1B4O A;  2OWO A;  3CC4 A;  2CH4 A;  2DY7 A;  2YU9 H;  5J22 A;  1Q1B A;  4FDB A;  1HZA A;  4DV1 L;  3MXN B;  2AWN A;  2KCT A;  1ZYR D;  2BDO A;  1FJG Q;  4ABN A;  2JA9 A;  2OXP A;  2IX1 A;  1I6H H;  1QVC A;  4OWX B;  3GTP H;  1Y69 U;  2EZV A;  3K7A H;  2NYZ D;  1K9M C;  1G6P A;  2NN6 G;  3MEF A;  4XT1 B;  2QIL A;  2ZXP A;  3DEP A;  3OIQ A;  1YVC A;  1HNX Q;  4JI7 Q;  4A3M B;  1CHQ D;  1SYG A;  1A63 A;  4R8I A;  4DR2 Q;  1HR0 W;  3JAM E;  4X66 L;  1B1Z A;  2F0Q A;  3BDL A;  2MGS A;  1SYB A;  2B63 H;  4TVA B;  2D0P A;  2JXM B;  5JEA G;  1VDZ A;  4BBR G;  1SND A;  3KYH C;  3K81 C;  3F2B A;  3VYR A;  5K36 H;  1BXT A;  3K58 A;  4POG A;  1X3F A;  3KLR A;  2ZTE A;  1I50 H;  4NMZ A;  4JOI A;  3TBI B;  3DM1 A;  3V2T A;  3I3C A;  1HTP A;  2EDG A;  3VA7 A;  1N36 L;  4JI6 L;  1HUM A;  1A2U A;  1CI3 M;  4UHV A;  4LMQ D;  4ME5 A;  3NSW A;  2RCN A;  4H7B A;  2B29 A;  2RQX A;  2YYZ A;  4DR7 L;  1ICW A;  2Z4H A;  1R4P B;  1AZQ A;  5E3F A;  4GN4 B;  2GVA A;  1CFM A;  5I6W A;  2NVX B;  3MZ5 A;  5FJ8 H;  4QQB X;  1EOV A;  4AH6 A;  2PZW A;  4POF A;  4BBS H;  2R7Z H;  4K8J A;  1UE1 A;  3TZD A;  3VR5 A;  3KBG A;  3HEJ A;  1TWA B;  3M7G A;  2K5H A;  4H02 A;  1TU2 B;  4B3T Q;  1PHJ A;  5EPJ A;  1D1K A;  1XMQ Q;  2A73 B;  1VQI A;  3QO2 A;  3WOE A;  2Q2U A;  5JJI A;  4OX9 L;  2AUJ D;  2F0V A;  5IT9 c;  2R61 A;  3F8T A;  5KNC A;  1H9S B;  1U9R A;  3T1Y L;  4J8Q A;  1PH1 A;  1I6V C;  5CV8 A;  1H9M A;  1U4R A;  1HNW Q;  1BR9 A;  3K6O A;  3AQQ A;  3KOJ A;  5C6A A;  4PZ8 A;  3I4N G;  2Y0S B;  4UP9 A;  1S40 A;  1BOS A;  1VQD A;  3A55 A;  2F3I A;  2K5D A;  2YV5 A;  2JA7 B;  1STA A;  5FLX c;  3E3X A;  4JV5 L;  4A3M H;  4OHJ A;  2LY7 A;  4DN4 M;  2WB1 E;  1U4P A;  2K5V A;  3MVV A;  2EJG C;  4X3U A;  3B6Y A;  1R4Q B;  1II3 A;  3OW2 A;  4ZUI A;  4KJN A;  1IBL L;  2L5T A;  1YJN A;  4YWM A;  1MJC A;  3HOX G;  3R93 A;  1CK1 A;  4HIO A;  4HTH A;  1WD1 A;  4DR3 Q;  1KAB A;  4B9W A;  4Y7N H;  3E9I A;  3NTI A;  3CF5 A;  2RF4 A;  3A5Z B;  4HMI A;  4OO1 H;  5JEA J;  4XQJ A;  4JI8 L;  4U67 3;  3I91 A;  3BZD B;  3PQI A;  4S3S A;  3G6E A;  1A3U A;  3CC2 A;  3PGZ A;  3NTH A;  3HOU H;  2F0O A;  3BVZ A;  2KQ3 A;  3SXH A;  4LF8 L;  2X6L A;  1B3Q A;  1WTW A;  3S2H B;  1Q7Y C;  1HZC A;  5IP7 H;  4DUY Q;  3ER0 A;  3I4L A;  4DAP A;  3NTK A;  5IGG A;  2EJM A;  2FHT A;  2VQF Q;  4FNF A;  3HOY G;  4A3D B;  4R4T A;  3H09 A;  1JOQ A;  1I94 Q;  3HOV H;  2RSN A;  3RMH A;  1VMC A;  3R3O A;  1IBK Q;  2LXJ A;  2J0T D;  4CGY B;  2UU9 Q;  1EQT A;  4LF5 Q;  1NMF A;  2O4X A;  4JI1 L;  3TRZ A;  1IW7 C;  2R92 B;  4L6T B;  2B2U C;  1AE2 A;  1IZ6 A;  3Q0A A;  2NVX H;  1D2B A;  4H44 C;  1PLF A;  1F9R A;  1U5K A;  3P75 A;  3D4R A;  2QKI C;  2K5W A;  1HA6 A;  3RUZ A;  5G3L D;  2B2V A;  3SR1 A;  1BDO A;  2UUC Q;  5T1G A;  4UPA A;  4QIW B;  2AQ3 B;  2D62 A;  1G2T A;  2WAQ G;  3M3Y B;  3U58 A;  1EZ8 A;  3KF8 A;  2OQK A;  3NQI A;  1J6Q A;  1E0B A;  3BG3 A;  5CMD A;  2PZU A;  2VZA A;  3KFU A;  2KOL A;  2IW3 A;  1EYA A;  1SYE A;  3E9H A;  1ENC A;  3HOZ G;  2M00 A;  1JB3 A;  1EFW A;  1IBM Q;  3A7L A;  2RHS B;  3DWQ A;  4DV7 Q;  2VNU D;  2Z6K A;  3PO3 B;  1PTO H;  1EYC A;  1YZ6 A;  1OXU A;  2ZM6 L;  3KF6 B;  2F0J A;  3G7L A;  2UUA Q;  3C3L A;  3J7A F;  3CAM A;  3EJI A;  2KVM A;  1S5E D;  1B44 D;  2JA7 H;  2L11 A;  3HKS A;  1N33 Q;  2AMC B;  1IXR A;  2VS1 A;  3K5L A;  1CUK A;  2ATW A;  1WCM G;  1V1P B;  1EU3 A;  4KD4 A;  4CDD C;  2WV6 D;  3CHB D;  5M3F G;  3TP5 A;  4C3J G;  4DAY A;  1EFI D;  2EY6 A;  3GTO B;  1XMO L;  2K01 A;  2PI2 A;  3C2P A;  1WOC A;  1PH4 A;  1VQA A;  4HIM A;  4F88 A;  3GTK H;  4ZRZ A;  1FD7 D;  3CC7 A;  4GNX A;  4AYB B;  5CYU A;  1L1O B;  2N8N A;  1IW7 D;  4KKU A;  1VQL A;  5CV5 A;  3NEL A;  3S16 B;  3SDZ A;  1B7Y B;  2EOT A;  4HAE A;  4A76 A;  1K8A C;  1LV9 A;  2A1A A;  1WTV A;  4MZ9 A;  3S2H H;  2NN6 I;  4O42 A;  4PZ7 A;  1JJ2 A;  1Q1E A;  4C1N K;  1UNS A;  2B2Y C;  3ITP A;  3AFQ A;  1EUJ A;  1EOT A;  2H1E A;  2D5D A;  2JK8 A;  4X3S A;  4RG1 A;  3VYS A;  4IFD G;  3K57 A;  2JA8 B;  1S3O A;  2BA0 A;  3HP3 A;  5KYI A;  1KXL A;  2HCI A;  5DNF A;  1EYG A;  1AZP A;  1STH A;  2CW0 C;  1VQH A;  3SHL A;  4BY1 B;  3PIP 3;  1ML0 D;  5GAH C;  2K52 A;  1LT6 D;  5ELD A;  2IX3 A;  4XDX A;  1V9P A;  3HZX A;  4OGQ C;  2HQL A;  4L8J A;  4RHS A;  4DV4 Q;  3NHH A;  1G91 A;  1OXT A;  3GO5 A;  4LFA Q;  4NXM Q;  1K0S A;  5EQ0 A;  3A8K E;  3CU7 A;  2MFI A;  1K83 H;  3I2Z A;  1KAW A;  3F2D A;  1Y8O B;  4DR6 L;  2E2D C;  1TT2 A;  1A3V A;  3OTO L;  2G5D A;  1F9P A;  3EA6 A;  3PO3 H;  4FF1 A;  3W2D A;  3K80 C;  5F2D A;  4A3E B;  1RF2 D;  1DOL A;  1ROD A;  1F9Q A;  3M9B A;  4A3I G;  4A3J G;  3OW7 A;  4OL7 A;  1OXV A;  1AEX A;  4Z9C B;  5H1S E;  1SNM A;  5J3B A;  1AP0 A;  1EY6 A;  1J5E L;  2DNC A;  5I2Y A;  4N9T A;  5IT9 L;  2QF7 A;  1UEA B;  2KCM A;  4NP5 A;  3TDQ A;  1JQY D;  1NY4 A;  2N78 A;  4CKC A;  3ICE A;  2J4X A;  4DR5 Q;  4R8N A;  4XT3 B;  3NEN A;  4JI4 Q;  2Q2H A;  2VB3 X;  4KV6 A;  2KHJ A;  3CCU A;  4R4O A;  3H3V I;  5IGF A;  5FLX L;  2N55 A;  3MXN A;  1TWG B;  3S16 H;  4RGO S;  2CW0 D;  1MHW C;  5C4J B;  3D4D A;  4X62 Q;  4CJ0 B;  1GUW A;  3T51 B;  4GLV B;  1M90 C;  3IL8 A;  2WB1 G;  3PIO A;  4HID A;  4OWW B;  2JA6 G;  3CQZ B;  4LUO A;  5AJ3 Q;  3ERS X;  1C8C A;  4NXN L;  3RN2 A;  4A3K B;  3KUP A;  4IFD J;  1G8Z D;  2ICI A;  2ES2 A;  1PTO C;  1WJJ A;  4ZYS A;  5CV9 A;  1VQ5 A;  2K5N A;  2OT2 A;  3OWE B;  2SDF A;  4LFB L;  4FYD A;  4FP5 D;  4A3G H;  1Y8P B;  1YJ9 A;  3A7A B;  1EY4 A;  3K59 A;  3Q24 A;  4N8X 1;  1HZ9 A;  5JPM C;  2M2L A;  1YJW A;  1WTP A;  4G57 A;  2K6A A;  2HDL A;  4JYA Q;  5IWA L;  2ICE C;  4DGZ A;  4KKT A;  3SK6 A;  2ASB A;  2C9O A;  3I55 A;  1GJX A;  1W6K A;  3PO2 H;  4A3F B;  1YIJ A;  3S1N B;  1HHV A;  5G3L F;  3DUZ A;  3MXP A;  4ZK9 B;  4WFN 3;  5IGB A;  1CKO A;  2CQO A;  1K3R A;  4K14 A;  1NAP A;  1X6O A;  2DNE A;  1SJH D;  4APV A;  2EJF C;  2JYO A;  4RGT A;  4X3K A;  2I5H A;  1D5X C;  3V96 A;  1XNQ L;  1S5B D;  4K0K L;  4PQX A;  4ZLT F;  4GOP B;  2FIN B;  2XTI A;  3RLO A;  1E1T A;  2F0K A;  5C0X G;  3BVM A;  1QVG A;  3T16 A;  3QWN A;  5GAE C;  1XNR L;  1S5D D;  5IYB G;  1QG7 A;  4ALP A;  2R7D A;  3MTS A;  4GNX B;  1XWE A;  2E2I B;  5IGD A;  3U9O A;  4QUF A;  3R8B A;  5LMN Q;  4LJZ C;  1LLR D;  1H9S A;  3F1Z A;  4X65 L;  4X64 Q;  1KLU D;  4NB3 A;  4BA2 I;  2EQS A;  2R93 B;  4IPH A;  1PTO D;  1TWG H;  2NVY H;  2RCF A;  2KA7 A;  4ZCK A;  2B8F A;  3CRL C;  4DK0 A;  2C35 B;  5C4J H;  5E1F A;  1U4L A;  4K6L A;  1PH8 A;  2I5M X;  1Y1W B;  4BXX H;  4JI6 Q;  1N36 Q;  4C3I H;  2G9H D;  3O13 A;  5KIX A;  3NBI A;  4EVO A;  1PRT C;  3CQZ H;  5K36 G;  5ELC A;  4DR7 Q;  4HJA A;  3TP6 A;  4DK1 A;  3K5M A;  1HXY D;  3FRP B;  4DV3 L;  4P75 A;  1P16 A;  4UDU C;  3DWA A;  4HIK A;  4Q0F A;  3OPO A;  2IX0 A;  2E2J B;  1RTO A;  1K8O A;  1X3G A;  1PYW D;  1YHB A;  1VQJ A;  1LTA D;  4M8A A;  2NB0 A;  2K5Q A;  1B3A A;  4O0A A;  2H4O A;  2EY1 A;  5IT9 E;  1N32 Q;  3T53 B;  1CZW A;  1YI2 A;  4DR1 Q;  1NSN S;  1VCI A;  2EYF A;  2B2W A;  3R2I A;  2CKZ B;  2B8G A;  1SFO H;  1HTL D;  5FJ8 G;  3AMU A;  4IFD I;  1I3Q B;  4BBS G;  2PO4 A;  3MFG A;  4RGN A;  1SMX A;  5ELN A;  1VQN A;  1K3B C;  2FFK B;  4JOI C;  2F3W A;  2TSS A;  3V05 A;  3K0Y A;  4K6D A;  1VS0 A;  1VMP A;  5EKL A;  3D6W A;  3S1Q H;  4RFB A;  1GUT A;  5FLX E;  2V1C C;  1GUS A;  1A62 A;  4JI0 L;  2R3Z A;  3HOW G;  4JV5 Q;  5A35 A;  2K4K A;  5CV7 A;  1JOO A;  1IBL Q;  1BCP C;  3RLN A;  1G6Z A;  2PCF B;  2MUY A;  1BVS A;  2K75 A;  2PNR C;  3C1E A;  2CFM A;  3T1H L;  1WI5 A;  5C0X J;  3ERO A;  1XPU A;  1PRT D;  3I8Z A;  3TEH B;  1MD2 D;  3KLW A;  4JI8 Q;  5EGT A;  2E2I H;  1Q8K A;  3CCS A;  3P20 A;  3S24 A;  1VQ7 A;  1CQF A;  4JI3 L;  1X3E A;  2CH4 W;  4PMC A;  2R93 H;  1A15 A;  5GAD C;  1NUC A;  4LF9 L;  5C3E B;  4LF8 Q;  4EX5 A;  4LNQ A;  4EQP A;  3BJU A;  4DPG A;  2E75 C;  3Q8D A;  1G29 1;  1Y1W H;  2L55 A;  4HCE A;  4ME3 A;  4QGU A;  2WP8 J;  3KF6 A;  3UDX A;  3A8J E;  4OO1 G;  3VR2 A;  1Q81 C;  3NXW A;  5IP9 G;  3DWP A;  4B9X A;  1IYV A;  1MGS A;  4A3C H;  2JA5 G;  4YWL A;  1SYD A;  3HOU G;  3CMA A;  2RHQ B;  1V1P A;  4XYO A;  4IUQ A;  1PH5 A;  4B08 A;  1DM0 B;  2E2J H;  5IP7 G;  1AN8 A;  1SLJ A;  5EBC A;  1W2B A;  1NR4 A;  1FGU A;  3M4O H;  1WFQ A;  5FK9 C;  3HOV G;  1X55 A;  4LF7 L;  2PQA A;  4A3B H;  3CCL A;  2ALY B;  4HJ8 A;  4XTC S;  1QNK A;  2A5H A;  2M9V A;  3I4M H;  3VR6 A;  1L1O A;  4BWG B;  5BR8 L;  2OF1 A;  3D4W A;  1IHZ A;  1TKW B;  1HH2 P;  3FVQ A;  3ND8 A;  3DLL A;  2XWB B;  4GKK L;  1RKN A;  1BCP D;  5C4X H;  4MNO A;  1VQ8 A;  4GLX A;  4WOR A;  3FPU B;  1Y1V G;  4IJL A;  3SE0 A;  1L0W A;  3GP7 A;  2NZH A;  2Z1C A;  1PZK D;  1E7Z A;  1SE2 A;  2B2T C;  2ZM6 Q;  2Q8R E;  2UUB L;  1QB5 D;  1KAA A;  1Q86 C;  1JJG A;  2DY8 A;  5FOB B;  1QNU A;  3H91 A;  4BBR B;  4HJ5 A;  1BBX C;  3F2C A;  1WTX A;  3QJY A;  1N34 L;  1JT8 A;  1I5F A;  2RKS A;  1D5Z C;  1RHP A;  1GKH A;  2PMZ B;  1BO0 A;  1SNO A;  1HFG A;  1VQP A;  3SK5 A;  4I7A A;  4JI2 L;  1LT3 D;  2O2L D;  5C44 G;  3AYH B;  2ZJR A;  2P5Z X;  1XMO Q;  1K8M A;  2B2V C;  3IKJ A;  3GD7 A;  1B53 A;  2EYL A;  1ILQ A;  2IT1 A;  4BY7 G;  4KJO A;  5C3E H;  3RLF A;  1B8A A;  1H95 A;  4CJ2 C;  3BS1 A;  2IHE A;  4DAV A;  3GTL B;  2ID0 A;  1NJI C;  1LYL A;  4CDC C;  4DV5 L;  4MHE A;  4IOA A;  4YY3 L;  1NMG A;  2QW7 A;  1STY A;  1K73 C;  2NVQ B;  1F2Z A;  1U4M A;  2Z6K C;  4RGM A;  1PDQ A;  3OWF A;  1EEF D;  5IE8 A;  4NDX A;  2IJ0 A;  1DOK A;  1HCZ A;  5C0X I;  3MC0 B;  5M9O A;  2I46 A;  1PFB A;  1SE4 A;  3PV0 A;  2JJQ A;  5FO7 B;  3L7Z C;  2HUG A;  4AQY Q;  3IRB A;  3M4Y A;  4GS3 A;  2ZJP A;  4KHP L;  3NE5 B;  5I9O A;  4U68 A;  1SRU A;  2UXB Q;  1DCZ A;  4KN4 C;  3C46 A;  1UAP A;  2Z6B A;  3J81 i;  5CBA E;  1E1O A;  1PFN A;  2PW5 A;  1F2Y A;  4JI5 L;  1TXY A;  3D0F A;  2EVB A;  2PQE A;  3S1M B;  1ZKO A;  2NN6 H;  3I4N B;  4RA8 A;  1EWI A;  1S4Z A;  2JEB I;  1BNZ A;  4DR6 Q;  2CVR A;  1AFP A;  3OTO Q;  4B3M L;  1WVL A;  2F0M A;  2KEN A;  2FMC A;  2DUD A;  1D5M C;  1FJG L;  3HG9 A;  1NBW A;  4A93 B;  1E2V A;  3HOX B;  2YTX A;  4UP7 A;  4J1M A;  1EYD A;  4KHV A;  2OEO A;  3W1B A;  1SYC A;  2UXD L;  2RDH A;  4H13 C;  4OEL B;  4FXD A;  2PI2 E;  4DNI A;  3CCR A;  4JC0 A;  1SN8 A;  1JIC A;  2SEB D;  3GV6 A;  1J5E Q;  1L0Y B;  3KLS A;  3D3R A;  4V0B A;  1LTL A;  5KRU A;  1HR0 Q;  4V19 0;  3Q6S A;  4JI7 L;  2UXC Q;  1TWA H;  5FLM H;  3VA5 A;  1I4G A;  2VW9 A;  1LUZ A;  4LF6 L;  3MFY A;  4CBV A;  2WFW A;  3SK8 A;  3HOY B;  4DFA A;  3VR3 A;  4F7X A;  3BZC A;  4X3T A;  1PH7 A;  2LKV A;  2K05 A;  1W3S A;  1DJR D;  3W3A A;  5L37 A;  3U4Z A;  1NE3 A;  1STG A;  4N8F A;  3J81 c;  3PIP A;  1IYJ B;  2CHB D;  4C2M B;  2A74 C;  4YCW A;  1DD2 A;  4X6A H;  1PMR A;  4NXN Q;  3HKZ E;  2RDG A;  3ND9 A;  4DU9 A;  4IPD A;  3H6M A;  4DXF A;  1PRT F;  2WAQ B;  1YHQ A;  1FL0 A;  1CM9 A;  1QVF A;  4GOP A;  1RCV D;  4IOC A;  2PQA B;  1PH3 A;  1D1I A;  3KJP A;  2NVT B;  4K8I A;  3FMC A;  3HOZ B;  3OHX C;  1QOH A;  2VXW A;  3GTQ B;  1TS4 A;  2A69 C;  3H3V H;  4QL5 A;  3SEB A;  2YTY A;  2F0I A;  1GOZ A;  2MHV A;  4KTA A;  3FPP A;  4B3S L;  1TR5 A;  5IWA Q;  3S1M H;  4B3T L;  2EYM A;  5HGQ A;  3NWT A;  3I4N H;  1X56 A;  4A3D H;  4YIJ A;  4OO1 I;  3WDN A;  2K7V A;  4ZQ3 A;  1I4P A;  4LUZ A;  2TMP A;  4HN7 A;  5CR3 A;  4YWK A;  1HNZ L;  3OIP A;  2EXD A;  3OYY A;  2HCC A;  1B2T A;  4A3G G;  1WCM B;  2BE5 C;  3EFX D;  1KQS A;  1ICF B;  2QA4 A;  1PA6 A;  2IWH A;  4A93 H;  3HOX H;  2HHH Q;  2R92 H;  4C1N I;  5M3F B;  2PNH A;  3KK7 A;  4C3J B;  4LFC Q;  1T5E A;  4ID6 A;  4BA1 I;  3EN2 A;  3NK9 A;  3TQY A;  4EQO A;  4OEM B;  1SSO A;  4YCU A;  2GA4 B;  1SRO A;  4K0K Q;  1I4R A;  4KY6 A;  3VYT A;  2KUM A;  5M5W B;  1Q8I A;  3PO2 G;  4CKE A;  4CHT B;  2FJ2 A;  3M3Y H;  4J6H A;  5I6Y A;  1K0R A;  1TWF B;  1XNR Q;  3G48 A;  4DR3 L;  1IL2 A;  4KI0 A;  4KN7 C;  5LMU L;  2VUM G;  3SVM A;  3D6C A;  2LXK A;  3TP8 A;  4DAM A;  1TII D;  3T4A C;  3FKI G;  2NZ1 D;  5I2X A;  3RN5 A;  4H0L C;  3AU7 A;  4C2M H;  5FO9 B;  1A3T A;  2VY3 A;  1K8G A;  5DLQ E;  3A0J A;  3URY A;  4K2K A;  4JBK A;  2ZT9 C;  1I94 L;  2A69 D;  1OXX K;  3LNN A;  1SE8 A;  1EEI D;  3L0O A;  3CCE A;  1PFS A;  1QJO A;  1EZ6 A;  2MPM A;  2KHI A;  3MEH A;  5IYD H;  1KRT A;  1HJP A;  1N8R C;  3AEV A;  4E6I A;  5BN5 A;  2KED A;  3GTO H;  5E7N A;  4LW1 A;  4BXX G;  1ONL A;  4TKO B;  4C3I G;  2BE5 D;  1TVX A;  2NVT H;  1RTN A;  2VB2 X;  2JEA I;  3HOZ H;  3GTQ H;  3G71 A;  1X32 A;  2ZXO A;  3UE1 A;  2SNS A;  2Z0S A;  1TS3 A;  5CV4 A;  1SYF A;  1BUV T;  1I4X A;  4A3I B;  4A3J B;  1FNW A;  4FO2 A;  1PV4 A;  2SOB A;  1Y8N B;  2O5I C;  3X3N A;  2VQE L;  3QG1 A;  3K0X A;  4RCO A;  1C4Q A;  2L0C A;  1VQG A;  2XRS D;  2L4N A;  2JA8 H;  4PNY A;  1MSH A;  3HRZ C;  4RCN A;  4DV7 L;  1E2W A;  4PZ6 A;  4CJ1 B;  2HQE A;  2HIX A;  2JQO A;  1GHK A;  2PW7 A;  5EKK A;  2UUA L;  4BY1 H;  3Q22 A;  2E76 C;  5JPN C;  1MBY A;  2EYJ A;  4IUV A;  3GTJ B;  2MO1 A;  1HQR D;  3SK4 A;  3OMG A;  3P7J A;  1KNA A;  3NEM A;  4RAU C;  4C3H G;  4PV1 C;  4ZUJ A;  4L63 B;  3J80 i;  2EYO A;  1EY9 A;  1KL9 A;  2WII B;  4ODG A;  4DV6 L;  1HUN A;  2A68 C;  2N88 A;  3I73 A;  5K5P A;  1OTC A;  2RBM A;  1F9S A;  5AFW A;  2NUC A;  5M3M B;  4G7H C;  3H0G G;  2R6G A;  3K5N A;  4DV1 Q;  2WB1 B;  1PYS B;  1HPC A;  1UE5 A;  3BYT B;  2JA6 B;  1YNX A;  3J7A V;  2Y0S E;  4JI3 Q;  3UDG A;  4LF9 Q;  5J39 A;  4DA2 A;  5LL6 S;  3CCJ A;  1JB7 A;  4HMJ A;  2GVB A;  1WD0 A;  4A3E H;  2B2W C;  1STE A;  3L2P A;  1BF4 A;  1H9K A;  2IHF A;  1KHI A;  4UP8 A;  3IFT A;  1SAP A;  1TWH B;  2EIF A;  2QEJ C;  1RJT A;  4JK1 C;  2K1B A;  1UE7 A;  4X66 Q;  1MI2 A;  4HCS A;  1CSP A;  3P1H A;  2F0U A;  1AE3 A;  3I70 A;  4WRD A;  4DUZ L;  1CTM A;  2DJG C;  1O7I A;  3C1F A;  4OON A;  3J81 L;  3S2D B;  4IUU A;  1JWS D;  4LF4 L;  1ET9 A;  1SNQ A;  2XWJ B;  4LF7 Q;  4DF7 A;  4XYQ A;  2AUK A;  3GQB A;  2QDL A;  3BDC A;  3PUY A;  1S5F D;  4XQN A;  3D31 A;  5EPK A;  3J80 c;  4P71 A;  4DR4 L;  1N9W A;  1B9N A;  1RDP D;  3I4O A;  3UDF A;  2B63 G;  1CHP D;  2K28 A;  2RVL A;  5CGK A;  1IYU A;  2NBF A;  1Q82 C;  2YU9 B;  4P74 A;  4IJH A;  1MIU A;  2L12 A;  3WOF A;  3J7Y W;  1A0I A;  2PYK A;  1CT1 D;  2HDM A;  3HKZ G;  4A3K H;  4DV2 L;  4A3B G;  1JWU D;  5C4Z A;  2A68 D;  2UUB Q;  4G7Z C;  4QIW E;  5IYC H;  3I4M G;  1STN A;  3H15 A;  2EY5 A;  4IAL A;  4JVZ A;  3Q23 A;  1KD1 C;  1SE3 A;  2MP1 A;  2DN8 A;  1V8Q A;  2MNA A;  5M5X B;  1ENA A;  3GTJ H;  4PMB A;  3GTG B;  2RSO A;  5C4X G;  1TS5 A;  3GDE A;  1HZB A;  3CPW A;  2B3G A;  1LTR D;  1YEZ A;  2WIN B;  3DXJ C;  4I65 A;  1S5C D;  4OX9 Q;  2X69 A;  3CME A;  5M3M H;  2F3V A;  4CDF C;  4JI4 L;  3T1Y Q;  2JA6 H;  2ZJQ A;  1A6X A;  2V4D A;  2R7Z G;  1L2F A;  1V43 A;  1WTR A;  5C4H A;  1X9N A;  2CWA A;  1TY0 A;  1YIT A;  1T5X D;  3FP9 A;  1L1O C;  2F0W A;  5COR A;  5COY A;  1LTB D;  1AH9 A;  1O80 A;  5EPL A;  4DV0 L;  4A3F H;  2A19 A;  3K8A A;  3S1N H;  2I0Q A;  1G2S A;  4A3L H;  2D0O A;  2XRQ D;  1VF7 A;  4DV5 Q;  4HJ7 A;  1LM0 A;  3A5U A;  4YY3 Q;  4B3R L;  5M5Y B;  1TWH H;  4LK1 C;  2QDB A;  5JAV A;  5JVH 3;  5DM6 3;  1GO3 E;  2LFN A;  2N3S A;  4AIM A;  3CRK C;  2F0N A;  2QGQ A;  4R9W A;  3W5O A;  4AYB E;  1QUQ B;  3DHQ A;  5C3E G;  1O78 A;  3DM3 A;  2F0H A;  1VQ6 A;  4QY7 A;  4XQQ A;  1V1Q A;  3ZYY X;  4HED A;  1JR0 D;  1UUP A;  1C48 A;  4KHP Q;  3TRE A;  2BH8 A;  1GVP A;  2BCO A;  1FNU A;  3PCO B;  4BBS B;  2OCE A;  4LWC A;  1CA5 A;  3L9A X;  2JSO A;  1NNX A;  5A2Q L;  2D9U A;  4A3M G;  1PH2 A;  3T13 A;  2J7Z A;  2HD3 A;  3KLS X;  1B70 B;  4KMU C;  4JI5 Q;  1DON A;  2EXZ A;  2E5L L;  1XX8 A;  5HUR A;  3KBX A;  4FF4 A;  4L5S A;  4HSP A;  2B39 A;  2F0S A;  3MHB A;  1LTS D;  5JVG 3;  4JYA L;  3M4P A;  5IGE A;  1SNC A;  3HOW B;  4B3M Q;  3BVG A;  3S9W A;  3CCQ A;  3LWE A;  4JI1 Q;  3NBH B;  3NP8 A;  1VQK A;  1CA6 A;  1Q12 A;  5C0X H;  2UXD Q;  4IQZ A;  1HA5 A;  3CPF A;  3ZJY C;  5CC4 A;  5IYB H;  3M7N A;  3RZD B;  4BS9 A;  1JOK A;  1X54 A;  5M5X H;  3GTG H;  4P72 A;  5CBE E;  1JC7 A;  1GUO A;  2PPB C;  2R7F A;  4LF6 Q;  3F2U A;  3EIV A;  5KNB A;  3G6J B;  3S14 B;  1DZ1 A;  3D8G A;  3G4S A;  2A6E C;  4Y7N B;  1YHA A;  1NR2 A;  3LGJ A;  4JW0 A;  1H9R A;  1I3Q H;  3K5O A;  2JP1 A;  1KRS A;  2K50 A;  2YTV A;  3EVQ A;  2MJ8 A;  5IOC A;  5LMN L;  3J81 E;  3MA2 B;  2IY5 B;  2JA5 B;  3ULL A;  4X64 L;  5FLM G;  3HOU B;  5FKA C;  4N9P A;  3S1R B;  3EQL C;  2QEX A;  4IUT A;  1QZG A;  1DOM A;  4FF3 A;  4QJF A;  5BN3 A;  4FXG C;  1KIX A;  2AQ2 B;  5M5Y H;  3HOV B;  3X3M A;  3OOC A;  1QIL A;  1M4V A;  4O1N A;  1YNJ C;  3GTM B;  4ZAI A;  3R2T A;  3PSI A;  1TQO A;  5C5L A;  2F0P A;  4EQN A;  4G7O C;  4EQ5 A;  4A75 A;  5IGC A;  1EIH A;  4GKJ L;  4YHH L;  5ELE A;  3HGB A;  3CKI B;  5JJZ A;  2VL6 A;  5EJW A;  2K03 A;  1SDF A;  2Y0S G;  5KEE A;  2G9D A;  3ERQ A;  2JA7 G;  4Q5V A;  1Y1V B;  1M8A A;  2FXQ A;  1PZJ D;  4UAI A;  5IOD A;  1X3P A;  2XVS A;  1GXD C;  1SBB B;  1ASY A;  4B3S Q;  1W6J A;  5GQO A;  3NWS A;  1V1O A;  1QE6 A;  1N32 L;  1FR3 A;  2Z8L A;  3I90 A;  4DR1 L;  1EU4 A;  1TS2 A;  3CP0 A;  3HOW H;  2F0G A;  4RKB A;  2JE6 I;  5JOB A;  1HNZ Q;  4O2D A;  1EWH A;  4NPS A;  3CCV A;  2JN4 A;  4KD3 A;  3KDF B;  1GD7 A;  5JJL A;  5GAG C;  3JAM i;  3J81 j;  3S15 B;  3OSO A;  5C44 B;  1PTO B;  2K14 A;  2A6E D;  3PF5 A;  1E22 A;  2WKC A;  1D7Q A;  4R4I A;  3J80 L;  3RZD H;  1PTO F;  1WTH A;  4A3D G;  4JG2 A;  2KCC A;  2F4V L;  4R1J A;  3H94 A;  4QMG A;  4QUC A;  4UY8 C;  4BY7 B;  2E8G A;  3JC6 6;  4MN3 A;  1O7Y A;  2K33 A;  1CKN B;  3A8I E;  1TWC B;  3K7U C;  1QCB D;  4PMW A;  4GOP C;  4A93 G;  4HR7 B;  5D3D A;  3BYY B;  1Z47 A;  2R92 G;  3S14 H;  1KDA A;  2AHO B;  4XIG S;  1M1K C;  4RWS C;  3TN2 A;  1PH9 A;  4GNX C;  2KHS A;  3GTK B;  1VQB A;  1YNJ D;  5IP9 H;  5KND A;  5LMU Q;  1XTD A;  4JPB W;  4QF4 A;  4P73 A;  5KGU A;  2JA5 H;  1KDB A;  1YNN C;  4IZ8 A;  2OTL A;  1TY2 A;  5IY0 A;  2PZT A;  5A2Q E;  3U4V A;  3S1R H;  3TP7 A;  4R4Q A;  3J7A 5;  1I4Q A;  2CQA A;  5JEA H;  4BBR H;  1XPO A;  2B2T A;  1LTG D;  1CQV A;  5TSS A;  3N6R A;  2XGT A;  4JCV E;  1HNX L;  3I72 A;  3STB C;  3GTM H;  4DR2 L;  2L15 A;  3KJO A;  2I5L X;  1K28 A;  1KDC A;  2NTT A;  3PO3 G;  1PVO A;  2F0D A;  3EBE A;  3PUW A;  3JAM c;  4IPG A;  1LAB A;  3AFP A;  2LMC B;  1SNP A;  1Y1V H;  1ESR A;  4L5T A;  5T1I A;  4LUV A;  1EIF A;  3LWU A;  4F87 A;  1Q90 A;  3M85 A;  3RZO B;  5IYD G;  4KLK A;  5C5M A;  2D2C C;  2IL8 A;  3I7F A;  1YBY A;  2XN9 C;  2VQE Q;  1K83 B;  4QCL A;  3GTL H;  2F0E A;  4ULL A;  4MIU A;  3TME A;  5I4D A;  3I56 A;  3GV3 A;  2F1M A;  3VR4 A;  2L9H A;  4IO9 A;  1VQC A;  2NVQ H;  2OQ0 A;  1PRT B;  2Q8I B;  4K2L A;  4DK6 C;  4DNR B;  3S17 B;  3BDO A;  5ISR A;  4AYB G;  3QR8 A;  2K32 A;  4ILW A;  3E0E A;  3N52 A;  3S15 H;  5C44 H;  1XJV A;  4TQU S;  4LFB Q;  1EIG A;  1RIP A;  3MWY W;  1BQQ T;  3CW2 C;  4A4I A;  1YNN D;  5EBD A;  4BY7 H;  1Z7T A;  1LTT D;  2O5J C;  4F8M A;  4DV6 Q;  1EQR A;  3IFD A;  2QCP X;  4EGV A;  2EY2 A;  1DYQ A;  1TWC H;  4CDE C;  1OO9 B;  2JA8 G;  3TS2 A;  1QZH A;  3TSS A;  2F0L A;  2E2H B;  2IPK D;  1GHJ A;  2ZTC A;  4ZKC B;  3BU2 A;  1XMQ L;  1L0X B;  1ET6 A;  5D65 A;  4BY1 G;  3STB D;  4GZY C;  5DAU A;  1Z6H A;  2AQ1 B;  3M4Q A;  3CD6 A;  4NKL A;  5D3I B;  1KNE A;  1EIY B;  3NUC A;  3UI2 A;  1S72 A;  1EQQ A;  1HNW L;  3QB3 A;  2KEE A;  3BZK A;  2Q2T A;  1C7Y A;  2B2U A;  4I7Z C;  1EWC A;  1LT4 D;  1JJC B;  1ZXT A;  1PFM A;  4XXE A;  4DXG A;  5JJK A;  1DGS A;  3L3O C;  1BCP B;  1STB A;  1XNQ Q;  2KBN A;  1GUG A;  2DJF C;  4WJ4 A;  1SJE D;  1C9O A;  1JWM D;  4DUZ Q;  2DGY A;  3E0J A;  1BCP F;  1OXS C;  1HQM C;  4A3E G;  3HOY H;  3PUZ A;  1P8L A;  2F0F A;  3VYU A;  3T56 B;  4AQY L;  4LF4 Q;  1J9O A;  1JE5 A;  3PUX A;  1F77 A;  1T9H A;  4A3G B;  4R4C A;  3IAY A;  4X65 Q;  4GN3 B;  3RR5 A;  2C5C A;  3FEW X;  2UXB L;  1UE6 A;  2Z9H A;  3J80 E;  3FHW A;  5LMN W;  1B50 A;  4RH6 A;  5LL6 X;  5KYL A;  1G51 A;  3RZO H;  2OTJ A;  1LAC A;  1BBW A;  1VQF A;  5C3W A;  1AW7 A;  2XIW A;  1FYC A;  4FF2 A;  3A74 A;  4DR4 Q;  1MJE A;  1WTO A;  1U0L A;  1KLG D;  4DUY L;  2K04 A;  1XTC D;  5J1Z A;  1VQO A;  5ELO A;  4IUR A;  2VQF L;  1EY7 A;  2E74 C;  4DV2 Q;  1ZEQ X;  1FVI A;  3S17 H;  1A2T A;  1MSG A;  5EAY A;  2LSS A;  1IBK L;  1EY5 A;  1EY0 A;  1O7Z A;  4CKB A;  4DV3 Q;  5BN4 A;  1VQ4 A;  4KKS A;  2UU9 L;  3PO2 B;  1IKM A;  4LF5 L;  3A56 A;  3CXC A;  1EL0 A;  1NTG A;  1QUQ A;  2HT1 A;  1MKH A;  1UEB A;  1I4H A;  4TRD A;  4PG3 A;  4QB4 A;  1D8L A;  2ZTD A;  2VUM B;  3FDT A;  1RL2 A;  2H5X A;  1PH6 A;  3CCM A;  1HR0 L;  2UUC L;  4A3K G;  2UXC L;  2CWP A;  1VQ9 A;  2GN5 A;  2I07 B;  2BA1 A;  3FKI B;  1SXT A;  1JMC A;  3QIA A;  2E2H H;  5IYC G;  4IPC A;  3SGI A;  4HJ9 A;  5LHY 1;  2B2Y A;  4J15 A;  5E4W C;  5NUC A;  1SR3 A;  1WCM H;  1C0A A;  1DXM A;  4DV0 Q;  2NVY B;  3MAQ A;  1R9T B;  1IBM L;  3QOL A;  2PMZ E;  1HFN A;  1IKL A;  3LX0 A;  5M3F H;  4C3J H;  2F4I A;  2BH2 A;  2EE1 A;  2EYH A;  3NBH A;  4IUN A;  1NCV A;  4B3R Q;  5GRO A;  4JI0 Q;  4C3I B;  1UWV A;  5M3M G;  5HY6 A;  2LS0 1;  2KJX A;  1N33 L;  2ZXR A;  4JBW A;  1E24 A;  5M5W H;  4FXK C;  1J8I A;  3ONA B;  3T1H Q;  1BBU A;  2ENB A;  4A3F G;  1FNV A;  3J7Z C;  4DNT B;  3PUV A;  1TWF H;  2HIV A;  4G4K A;  4A3L G;  1Q46 A;  1EQV A;  1ASZ A;  1SEB D;  4KY7 A;  4IFD H;  2BDN A;  1JCK B;  3H3V C;  3OMC A;  3UE0 A;  1SMY C;  5DM7 3;  3NQT A;  2E5L Q;  4RKL A;  3KF8 B;  1EY8 A;  1SFO B;  5ELB A;  3JAM L; 
#chains in the Genus database with same CATH homology
 2XSC A;  2BOS A;  4C56 C;  4C3H B;  1JOR A;  4RHR A;  1IL8 A;  3QOJ A;  1X3Q A;  3S1Q B;  5IIF A;  2NTS A;  4FVM A;  3H0G B;  4HSV A;  2FMM A;  3PIO 3;  2SNM A;  2Q8T A;  4TSS A;  1Q3L A;  5I9P A;  4NW2 A;  5DEH A;  1B9M A;  3E6Z X;  3TZU A;  3AB9 A;  3MXG A;  5C3X A;  1F2M A;  1PXU A;  1LO5 D;  5FO8 B;  1I6H B;  3GTP B;  1LTI D;  4K5X A;  2A6H C;  3K7A B;  1RD9 D;  2Z4I A;  1ENF A;  4OIK A;  4OIJ A;  4LAA A;  4WJW A;  1SMY D;  2X6G A;  4P2C B;  2EPB A;  1ZYR C;  3DEO A;  5EKI A;  3U9S A;  1PZI D;  2EYP A;  5ELF A;  4K5W A;  2B63 B;  1ILP A;  4KK7 A;  4K5V A;  1E2Z A;  2F0T A;  4KY5 A;  2AWO A;  1ESF A;  3HKZ B;  2XNA C;  3M4O B;  1XYI A;  3E5S A;  2L1B A;  4A3B B;  1I50 B;  2KEC A;  1CZG A;  3I4M B;  3A54 A;  1FGB D;  1O7L A;  1GUN A;  4IUP A;  1HRJ A;  4KHZ A;  5HGT A;  3MXU A;  5D14 A;  5C4X B;  5E4X A;  1WTQ A;  2WKD A;  4M1U B;  3RD4 A;  3PMF A;  1JE4 A;  1QWY A;  2WAC A;  4ZKB B;  1XXG A;  1H9J A;  1LT5 D;  2R7Z B;  1F2L A;  1D6E C;  3HS0 C;  5CV6 A;  2NWG A;  2RA4 A;  3DMU A;  2A6H D;  1VF5 C;  4IN3 A;  2RDF A;  2F03 A;  2KCN A;  3NPP A;  1KTK A;  1B4O A;  2DY7 A;  5J22 A;  1Q1B A;  2AWN A;  1ZYR D;  2BDO A;  4ABN A;  2OXP A;  2IX1 A;  1Y69 U;  2EZV A;  2NYZ D;  2NN6 G;  4XT1 B;  2QIL A;  2ZXP A;  3DEP A;  3OIQ A;  4A3M B;  1CHQ D;  1SYG A;  4R8I A;  3JAM E;  1B1Z A;  2F0Q A;  3BDL A;  2MGS A;  1SYB A;  2JXM B;  5JEA G;  1VDZ A;  1SND A;  3VYR A;  5K36 H;  1BXT A;  3K58 A;  3KLR A;  4NMZ A;  3TBI B;  3DM1 A;  3V2T A;  3I3C A;  1HTP A;  2EDG A;  3VA7 A;  1HUM A;  1A2U A;  1CI3 M;  4LMQ D;  4ME5 A;  3NSW A;  4H7B A;  2RQX A;  2YYZ A;  1ICW A;  2Z4H A;  1R4P B;  1AZQ A;  5E3F A;  1CFM A;  5I6W A;  2NVX B;  3MZ5 A;  2PZW A;  4K8J A;  3TZD A;  3VR5 A;  3KBG A;  3HEJ A;  1TWA B;  3M7G A;  1TU2 B;  5EPJ A;  1D1K A;  2A73 B;  3QO2 A;  3WOE A;  2AUJ D;  2F0V A;  2R61 A;  5KNC A;  1H9S B;  1U9R A;  4J8Q A;  1I6V C;  5CV8 A;  1H9M A;  1U4R A;  1BR9 A;  3K6O A;  5C6A A;  2Y0S B;  1BOS A;  3A55 A;  2K5D A;  2JA7 B;  1STA A;  4OHJ A;  2LY7 A;  4DN4 M;  1U4P A;  4X3U A;  3MVV A;  2EJG C;  1R4Q B;  1II3 A;  4ZUI A;  4KJN A;  2L5T A;  3R93 A;  1CK1 A;  4HTH A;  1WD1 A;  1KAB A;  4B9W A;  3NTI A;  4HMI A;  4OO1 H;  5JEA J;  4XQJ A;  4U67 3;  3I91 A;  3BZD B;  4S3S A;  1A3U A;  3NTH A;  2F0O A;  3BVZ A;  2KQ3 A;  3SXH A;  2X6L A;  1WTW A;  3S2H B;  3I4L A;  4DAP A;  3NTK A;  5IGG A;  2EJM A;  2FHT A;  4FNF A;  4A3D B;  1JOQ A;  3H09 A;  2RSN A;  3RMH A;  1VMC A;  3R3O A;  2J0T D;  4CGY B;  1EQT A;  2O4X A;  1IW7 C;  2R92 B;  4L6T B;  2B2U C;  3Q0A A;  1D2B A;  4H44 C;  1PLF A;  1F9R A;  3P75 A;  1HA6 A;  3D4R A;  2QKI C;  2K5W A;  3RUZ A;  5G3L D;  2B2V A;  3SR1 A;  1BDO A;  5T1G A;  4QIW B;  2AQ3 B;  2D62 A;  1G2T A;  3M3Y B;  1EZ8 A;  3KF8 A;  3NQI A;  1E0B A;  3BG3 A;  5CMD A;  2PZU A;  2KOL A;  2IW3 A;  1EYA A;  1SYE A;  1ENC A;  2M00 A;  1JB3 A;  3A7L A;  3DWQ A;  2VNU D;  3PO3 B;  1PTO H;  1EYC A;  1OXU A;  2F0J A;  3G7L A;  3C3L A;  3J7A F;  3EJI A;  2KVM A;  1S5E D;  1B44 D;  2L11 A;  3K5L A;  1V1P B;  1EU3 A;  4KD4 A;  2WV6 D;  3CHB D;  3TP5 A;  4C3J G;  4DAY A;  1EFI D;  2EY6 A;  3GTO B;  2K01 A;  3C2P A;  4F88 A;  4ZRZ A;  1FD7 D;  4AYB B;  5CYU A;  1IW7 D;  4KKU A;  5CV5 A;  3S16 B;  3SDZ A;  2EOT A;  4HAE A;  1LV9 A;  1WTV A;  2NN6 I;  4O42 A;  1Q1E A;  4C1N K;  1UNS A;  2B2Y C;  3ITP A;  1EOT A;  2H1E A;  2D5D A;  4X3S A;  3VYS A;  4IFD G;  3K57 A;  2JA8 B;  2BA0 A;  3HP3 A;  5KYI A;  2HCI A;  5DNF A;  1AZP A;  1STH A;  2CW0 C;  3SHL A;  4BY1 B;  3PIP 3;  1ML0 D;  1LT6 D;  5ELD A;  2IX3 A;  4XDX A;  4OGQ C;  3HZX A;  4L8J A;  4RHS A;  3NHH A;  1G91 A;  1OXT A;  3GO5 A;  5EQ0 A;  3A8K E;  3CU7 A;  1Y8O B;  2E2D C;  1TT2 A;  1A3V A;  1F9P A;  3EA6 A;  4FF1 A;  3W2D A;  5F2D A;  4A3E B;  1RF2 D;  1DOL A;  1ROD A;  1F9Q A;  3OW7 A;  4OL7 A;  1OXV A;  1AEX A;  4Z9C B;  1SNM A;  1AP0 A;  1EY6 A;  2DNC A;  5I2Y A;  4N9T A;  5IT9 L;  2QF7 A;  1UEA B;  4NP5 A;  3TDQ A;  1JQY D;  4CKC A;  2J4X A;  4R8N A;  4XT3 B;  2VB3 X;  4KV6 A;  5IGF A;  5FLX L;  2N55 A;  3MXN A;  1TWG B;  4RGO S;  2CW0 D;  5C4J B;  3D4D A;  4CJ0 B;  1GUW A;  3T51 B;  3IL8 A;  3CQZ B;  1C8C A;  4A3K B;  3KUP A;  4IFD J;  1G8Z D;  2ICI A;  1PTO C;  4ZYS A;  5CV9 A;  2OT2 A;  3OWE B;  2SDF A;  4FYD A;  4FP5 D;  1Y8P B;  3A7A B;  1EY4 A;  3K59 A;  3Q24 A;  5JPM C;  2M2L A;  1WTP A;  4G57 A;  2K6A A;  2HDL A;  2ICE C;  4DGZ A;  4KKT A;  3SK6 A;  2C9O A;  1GJX A;  1W6K A;  4A3F B;  3S1N B;  1HHV A;  5G3L F;  3DUZ A;  3MXP A;  4ZK9 B;  4WFN 3;  5IGB A;  4K14 A;  1NAP A;  2DNE A;  1SJH D;  2EJF C;  2JYO A;  4RGT A;  4X3K A;  1D5X C;  3V96 A;  1S5B D;  4PQX A;  4ZLT F;  2FIN B;  2F0K A;  5C0X G;  3BVM A;  3T16 A;  3QWN A;  1S5D D;  1QG7 A;  3MTS A;  1XWE A;  2E2I B;  5IGD A;  3U9O A;  4QUF A;  3R8B A;  4LJZ C;  1LLR D;  1H9S A;  4BA2 I;  1KLU D;  2R93 B;  1PTO D;  2KA7 A;  2B8F A;  3CRL C;  4DK0 A;  5E1F A;  1U4L A;  4K6L A;  1Y1W B;  2G9H D;  3O13 A;  5KIX A;  3NBI A;  4EVO A;  1PRT C;  5K36 G;  5ELC A;  3TP6 A;  4DK1 A;  3K5M A;  1HXY D;  3FRP B;  4UDU C;  3DWA A;  4Q0F A;  3OPO A;  2IX0 A;  2E2J B;  1RTO A;  1K8O A;  1PYW D;  4M8A A;  1LTA D;  2NB0 A;  2K5Q A;  1B3A A;  2H4O A;  2EY1 A;  5IT9 E;  3T53 B;  1CZW A;  1NSN S;  1VCI A;  2EYF A;  2B2W A;  3R2I A;  2B8G A;  1HTL D;  3AMU A;  4IFD I;  1I3Q B;  2PO4 A;  3MFG A;  4RGN A;  2FFK B;  3V05 A;  2F3W A;  2TSS A;  3K0Y A;  4K6D A;  1VMP A;  5EKL A;  3D6W A;  4RFB A;  1GUT A;  5FLX E;  1GUS A;  2R3Z A;  5A35 A;  5CV7 A;  1JOO A;  1BCP C;  1G6Z A;  2PCF B;  2MUY A;  2PNR C;  3C1E A;  5C0X J;  3ERO A;  1PRT D;  3I8Z A;  1MD2 D;  5EGT A;  3P20 A;  1CQF A;  4PMC A;  1A15 A;  1NUC A;  5C3E B;  4EQP A;  2E75 C;  1G29 1;  2L55 A;  4HCE A;  2WP8 J;  3A8J E;  4OO1 G;  3VR2 A;  3NXW A;  3DWP A;  4B9X A;  1IYV A;  1MGS A;  1SYD A;  1V1P A;  4XYO A;  4IUQ A;  4B08 A;  1DM0 B;  1AN8 A;  5EBC A;  1NR4 A;  5FK9 C;  4XTC S;  1QNK A;  2A5H A;  2M9V A;  3VR6 A;  4BWG B;  2OF1 A;  3D4W A;  1IHZ A;  1TKW B;  3FVQ A;  3ND8 A;  2XWB B;  1RKN A;  1BCP D;  4WOR A;  3FPU B;  3SE0 A;  3GP7 A;  2Z1C A;  1PZK D;  1SE2 A;  2B2T C;  2Q8R E;  1QB5 D;  1KAA A;  2DY8 A;  5FOB B;  1QNU A;  3H91 A;  4BBR B;  1BBX C;  1WTX A;  3QJY A;  2RKS A;  1D5Z C;  1RHP A;  2PMZ B;  1BO0 A;  1SNO A;  1HFG A;  3SK5 A;  1LT3 D;  2O2L D;  1K8M A;  2B2V C;  3IKJ A;  3GD7 A;  1B53 A;  2EYL A;  1ILQ A;  2IT1 A;  4KJO A;  3RLF A;  4CJ2 C;  3BS1 A;  4DAV A;  3GTL B;  2ID0 A;  4MHE A;  2NVQ B;  1STY A;  1F2Z A;  1U4M A;  4RGM A;  1PDQ A;  3OWF A;  1EEF D;  4NDX A;  2IJ0 A;  1DOK A;  1HCZ A;  5C0X I;  3MC0 B;  5M9O A;  2I46 A;  1PFB A;  1SE4 A;  3PV0 A;  5FO7 B;  3L7Z C;  2HUG A;  3M4Y A;  3NE5 B;  5I9O A;  4U68 A;  1DCZ A;  4KN4 C;  3C46 A;  1UAP A;  5CBA E;  1PFN A;  2PW5 A;  1F2Y A;  2EVB A;  2PQE A;  3S1M B;  1ZKO A;  2NN6 H;  3I4N B;  4RA8 A;  1S4Z A;  2JEB I;  1BNZ A;  2CVR A;  1AFP A;  1WVL A;  2F0M A;  2FMC A;  1D5M C;  3HG9 A;  4A93 B;  1E2V A;  3HOX B;  4J1M A;  1EYD A;  4KHV A;  2OEO A;  1SYC A;  2RDH A;  4H13 C;  4FXD A;  1JIC A;  2SEB D;  3GV6 A;  1L0Y B;  3KLS A;  3D3R A;  4V0B A;  5KRU A;  4V19 0;  3Q6S A;  3VA5 A;  1I4G A;  3MFY A;  4CBV A;  3SK8 A;  3HOY B;  4DFA A;  3VR3 A;  4F7X A;  4X3T A;  2LKV A;  2K05 A;  1DJR D;  3W3A A;  1STG A;  2CHB D;  4C2M B;  2A74 C;  1DD2 A;  1PMR A;  2RDG A;  3ND9 A;  4DU9 A;  3H6M A;  4DXF A;  1PRT F;  2WAQ B;  1CM9 A;  1RCV D;  1D1I A;  2NVT B;  4K8I A;  3FMC A;  3HOZ B;  3OHX C;  1QOH A;  2VXW A;  3GTQ B;  1TS4 A;  2A69 C;  3SEB A;  2F0I A;  1GOZ A;  2MHV A;  4KTA A;  3FPP A;  1TR5 A;  2EYM A;  3NWT A;  4YIJ A;  4OO1 I;  3WDN A;  2K7V A;  4ZQ3 A;  1I4P A;  2TMP A;  4HN7 A;  5CR3 A;  3OIP A;  2HCC A;  1B2T A;  1WCM B;  2BE5 C;  3EFX D;  2IWH A;  4C1N I;  5M3F B;  3KK7 A;  4C3J B;  1T5E A;  4ID6 A;  4BA1 I;  3NK9 A;  4EQO A;  1SSO A;  2GA4 B;  1I4R A;  4KY6 A;  3VYT A;  2KUM A;  5M5W B;  1Q8I A;  4CKE A;  4CHT B;  2FJ2 A;  4J6H A;  5I6Y A;  1TWF B;  4KI0 A;  4KN7 C;  3SVM A;  3D6C A;  3TP8 A;  1TII D;  3T4A C;  2NZ1 D;  5I2X A;  4H0L C;  3AU7 A;  5FO9 B;  1A3T A;  3URY A;  4K2K A;  2ZT9 C;  2A69 D;  1OXX K;  3LNN A;  1EEI D;  1QJO A;  1EZ6 A;  2MPM A;  3MEH A;  4E6I A;  5BN5 A;  2KED A;  1ONL A;  4TKO B;  4C3I G;  2BE5 D;  1TVX A;  1RTN A;  2VB2 X;  2JEA I;  1X32 A;  2ZXO A;  2SNS A;  1TS3 A;  5CV4 A;  1SYF A;  1BUV T;  1I4X A;  4A3I B;  4A3J B;  1FNW A;  4FO2 A;  2SOB A;  1Y8N B;  2O5I C;  3X3N A;  3QG1 A;  4RCO A;  1C4Q A;  2L0C A;  2XRS D;  2L4N A;  4PNY A;  1MSH A;  3HRZ C;  4RCN A;  1E2W A;  4CJ1 B;  2HQE A;  1GHK A;  2PW7 A;  5EKK A;  3Q22 A;  2E76 C;  5JPN C;  1MBY A;  2EYJ A;  4IUV A;  3GTJ B;  3SK4 A;  1HQR D;  3OMG A;  3P7J A;  1KNA A;  4RAU C;  4C3H G;  4PV1 C;  4ZUJ A;  4L63 B;  2EYO A;  1EY9 A;  4ODG A;  2WII B;  1HUN A;  2A68 C;  2N88 A;  3I73 A;  5K5P A;  2RBM A;  1F9S A;  5AFW A;  2NUC A;  5M3M B;  4G7H C;  2R6G A;  3K5N A;  2WB1 B;  1HPC A;  2JA6 B;  3BYT B;  3J7A V;  5J39 A;  4DA2 A;  5LL6 S;  4HMJ A;  1WD0 A;  2B2W C;  1STE A;  1BF4 A;  1H9K A;  3IFT A;  1SAP A;  1TWH B;  2QEJ C;  1RJT A;  4JK1 C;  2K1B A;  1MI2 A;  4HCS A;  3P1H A;  2F0U A;  3I70 A;  4WRD A;  1CTM A;  3C1F A;  3J81 L;  3S2D B;  4IUU A;  1JWS D;  1SNQ A;  1ET9 A;  2XWJ B;  4DF7 A;  4XYQ A;  2AUK A;  3GQB A;  3BDC A;  3PUY A;  1S5F D;  4XQN A;  3D31 A;  5EPK A;  1B9N A;  1RDP D;  1CHP D;  2K28 A;  2RVL A;  5CGK A;  1IYU A;  2NBF A;  2YU9 B;  3J7Y W;  2L12 A;  3WOF A;  2PYK A;  1CT1 D;  2HDM A;  1JWU D;  5C4Z A;  2A68 D;  4G7Z C;  1STN A;  2EY5 A;  4IAL A;  3Q23 A;  1SE3 A;  2MP1 A;  2DN8 A;  1V8Q A;  5M5X B;  1ENA A;  3GTG B;  4PMB A;  2RSO A;  1TS5 A;  1LTR D;  2WIN B;  3DXJ C;  4I65 A;  1S5C D;  2X69 A;  2F3V A;  1A6X A;  2V4D A;  1V43 A;  1WTR A;  5C4H A;  1TY0 A;  1T5X D;  5COR A;  2F0W A;  5COY A;  1LTB D;  1O80 A;  5EPL A;  1G2S A;  2XRQ D;  1VF7 A;  5M5Y B;  4LK1 C;  2QDB A;  5JAV A;  5JVH 3;  5DM6 3;  2LFN A;  3CRK C;  2F0N A;  4R9W A;  3DHQ A;  1O78 A;  2F0H A;  4XQQ A;  3ZYY X;  4HED A;  1JR0 D;  1UUP A;  1C48 A;  2BCO A;  1FNU A;  4BBS B;  1CA5 A;  3L9A X;  2JSO A;  5A2Q L;  2D9U A;  3T13 A;  2J7Z A;  3KLS X;  4KMU C;  1DON A;  2EXZ A;  1XX8 A;  5HUR A;  3KBX A;  4FF4 A;  4HSP A;  2B39 A;  2F0S A;  3MHB A;  1LTS D;  5JVG 3;  5IGE A;  1SNC A;  3HOW B;  3BVG A;  3S9W A;  3LWE A;  3NP8 A;  1CA6 A;  1Q12 A;  5C0X H;  4IQZ A;  1HA5 A;  5CC4 A;  3M7N A;  3RZD B;  4BS9 A;  1JOK A;  5CBE E;  1JC7 A;  1GUO A;  2PPB C;  3F2U A;  5KNB A;  3G6J B;  3S14 B;  1DZ1 A;  3D8G A;  2A6E C;  4Y7N B;  1NR2 A;  1H9R A;  3K5O A;  2JP1 A;  3EVQ A;  2MJ8 A;  5IOC A;  3J81 E;  3MA2 B;  2JA5 B;  3HOU B;  5FKA C;  4N9P A;  3S1R B;  3EQL C;  4IUT A;  1DOM A;  4FF3 A;  5BN3 A;  4FXG C;  2AQ2 B;  3HOV B;  3X3M A;  3OOC A;  1QIL A;  1M4V A;  4O1N A;  1YNJ C;  3GTM B;  4ZAI A;  3R2T A;  1TQO A;  5C5L A;  2F0P A;  4EQN A;  4G7O C;  5IGC A;  1EIH A;  5ELE A;  3HGB A;  3CKI B;  5JJZ A;  5EJW A;  2K03 A;  1SDF A;  5KEE A;  2G9D A;  3ERQ A;  4Q5V A;  1Y1V B;  1M8A A;  1PZJ D;  4UAI A;  5IOD A;  1X3P A;  2XVS A;  1GXD C;  1SBB B;  1W6J A;  3NWS A;  1V1O A;  1QE6 A;  1FR3 A;  2Z8L A;  3I90 A;  1EU4 A;  1TS2 A;  2F0G A;  4RKB A;  2JE6 I;  5JOB A;  1EWH A;  4KD3 A;  3S15 B;  3OSO A;  5C44 B;  1PTO B;  2A6E D;  2WKC A;  3J80 L;  1PTO F;  2KCC A;  3H94 A;  4QMG A;  4QUC A;  4BY7 B;  4MN3 A;  1O7Y A;  2K33 A;  3A8I E;  1TWC B;  4PMW A;  1QCB D;  4HR7 B;  5D3D A;  3BYY B;  1Z47 A;  1KDA A;  4XIG S;  4RWS C;  3TN2 A;  2KHS A;  3GTK B;  1YNJ D;  5KND A;  4QF4 A;  5KGU A;  1KDB A;  1YNN C;  4IZ8 A;  1TY2 A;  2PZT A;  5A2Q E;  3TP7 A;  1I4Q A;  2CQA A;  5JEA H;  2B2T A;  5TSS A;  1LTG D;  1CQV A;  3N6R A;  3I72 A;  1KDC A;  2NTT A;  2F0D A;  3PUW A;  1LAB A;  2LMC B;  1SNP A;  5T1I A;  1ESR A;  3LWU A;  4F87 A;  1Q90 A;  3M85 A;  3RZO B;  5C5M A;  2D2C C;  2IL8 A;  2XN9 C;  1K83 B;  4QCL A;  2F0E A;  4ULL A;  4MIU A;  3TME A;  5I4D A;  3GV3 A;  2F1M A;  3VR4 A;  2L9H A;  1PRT B;  2Q8I B;  4K2L A;  4DNR B;  3S17 B;  3BDO A;  5ISR A;  2K32 A;  4ILW A;  3N52 A;  4TQU S;  1EIG A;  3MWY W;  1BQQ T;  1YNN D;  5EBD A;  1Z7T A;  1LTT D;  2O5J C;  4F8M A;  3IFD A;  2QCP X;  4EGV A;  2EY2 A;  1DYQ A;  1OO9 B;  3TSS A;  2F0L A;  2E2H B;  2IPK D;  1GHJ A;  4ZKC B;  1L0X B;  1ET6 A;  5D65 A;  4GZY C;  5DAU A;  1Z6H A;  2AQ1 B;  4NKL A;  5D3I B;  1KNE A;  3NUC A;  3UI2 A;  3QB3 A;  2KEE A;  2B2U A;  4I7Z C;  1EWC A;  1LT4 D;  1ZXT A;  1PFM A;  4XXE A;  4DXG A;  3L3O C;  1BCP B;  1STB A;  1GUG A;  1SJE D;  1JWM D;  3E0J A;  1BCP F;  1OXS C;  1HQM C;  3PUZ A;  2F0F A;  3VYU A;  3T56 B;  1J9O A;  3PUX A;  1F77 A;  4A3G B;  3IAY A;  2C5C A;  3FEW X;  3J80 E;  1B50 A;  4RH6 A;  5LL6 X;  5KYL A;  1LAC A;  5C3W A;  1AW7 A;  2XIW A;  1FYC A;  4FF2 A;  1WTO A;  1KLG D;  2K04 A;  1XTC D;  5J1Z A;  4IUR A;  1EY7 A;  2E74 C;  1ZEQ X;  1A2T A;  1MSG A;  1EY5 A;  1EY0 A;  1O7Z A;  4CKB A;  5BN4 A;  4KKS A;  3PO2 B;  1IKM A;  3A56 A;  1EL0 A;  1I4H A;  4TRD A;  4QB4 A;  2VUM B;  3FDT A;  2I07 B;  2BA1 A;  3FKI B;  1SXT A;  3QIA A;  5LHY 1;  2B2Y A;  5E4W C;  5NUC A;  1DXM A;  2NVY B;  3MAQ A;  1R9T B;  3QOL A;  1HFN A;  1IKL A;  3LX0 A;  2F4I A;  2EE1 A;  2EYH A;  3NBH A;  4IUN A;  1NCV A;  4C3I B;  2LS0 1;  2KJX A;  2ZXR A;  4JBW A;  4FXK C;  1J8I A;  3ONA B;  2ENB A;  1FNV A;  4DNT B;  3PUV A;  4G4K A;  1EQV A;  1SEB D;  4KY7 A;  4IFD H;  2BDN A;  1JCK B;  3H3V C;  3OMC A;  5DM7 3;  1SMY C;  3NQT A;  4RKL A;  1EY8 A;  1SFO B;  5ELB A;  3JAM L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...