1Z7TA

Solution structure of bacillus subtilis blap apo-form
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
TVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKKKEGDFVNEGDVLLELSNSTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Biotin/Lipoyl Attachment Protein
publication title Solution structure of Bacillus subtilis BLAP apo-form
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1z7tA00
4KKUA 2IT1A 3VR3A 1FR3A 2A6HC 1V8QA 2BE5D 3I73A 1O7LA 2A68C 3A8JE 3HGBA 1A6XA 3T53B 2A6ED 4JBWA 4BA1I 5A35A 3SE0A 4XTCS 4OO1G 2EJMA 1QJOA 3PUZA 1K8OA 1HCZA 3PUVA 2E74C 4PV1C 5KNCA 2NN6G 3ND9A 3T56B 1GUTA 2DN8A 3H94A 5C0XH 1GUOA 2QF7A 1GJXA 1YNNC 4DNTB 3OOCA 1E2ZA 3FMCA 4KMUC 3VR4A 1OXSC 3QJYA 3PUWA 5JEAH 4HR7B 4KKTA 3TZUA 3SDZA 1Q1BA 1B9NA 3IFTA 3D4RA 2K32A 4JK1C 2PPBC 1PMRA 3OW7A 1H9MA 1G291 2PCFB 3LNNA 4KN4C 2ZT9C 3VR6A 1VCIA 2EDGA 5BN5A 2JEAI 1EWHA 1CI3M 1IW7C 1HTPA 3BDOA 3QIAA 5KNBA 4IFDH 3P20A 2BA1A 4I7ZC 3GD7A 4KN7C 1V43A 1Y69U 2K7VA 3D31A 3OPOA 1TKWB 1Y8NB 2EJFC 3N6RA 4H44C 4KHZA 3VA7A 1E2WA 1ONLA 2D62A 4TQUS 2NN6I 2A69C 3KLRA 4H0LC 4DNRB 1OXXK 3I4LA 4OO1H 3EQLC 4LJZC 1CFMA 2KCCA 1E2VA 5K36G 1Z7TA 3IKJA 2L5TA 3LWUA 1OXVA 3L7ZC 3RLFA 2R6GA 2D2CC 4DK1A 3DXJC 1IYUA 2F1MA 3FPPA 1SMYC 1H9SB 2NN6H 3VR2A 1I6VC 1OXUA 3CRLC 2EJGC 1VF5C 2A6HD 1YNJC 1BDOA 2A68D 1DD2A 3PV0A 2BE5C 3I72A 3WDNA 2O5IC 1FYCA 1CTMA 1Q90A 2A6EC 1DCZA 2AUJD 3ND8A 3A8IE 2A69D 3GQBA 4TKOB 3T51B 3U9SA 2KA7A 4BA2I 2D5DA 3MXUA 1Q12A 5KNDA 1Z6HA 1ZKOA 3A8KE 2PNRC 2V4DA 2E75C 2K33A 4G7ZC 4RCNA 3M7NA 2DNEA 1T5EA 4G7OC 1O78A 4G7HC 2E76C 4KI0A 5BN4A 4H13C 1K8MA 2B8GA 5K36H 1LABA 3A7LA 1IW7D 1H9SA 3NE5B 2AUKA 2BA0A 1GUGA 2O5JC 3QG1A 2DNCA 5C0XG 1TU2B 1H9JA 2JEBI 3AB9A 4KKSA 2EVBA 2LMCB 3A7AB 3BG3A 4XIGS 1GUSA 1LACA 2B8FA 1GHJA 2YYZA 1Y8OB 3PUYA 4LK1C 3VR5A 5JEAG 4GZYC 1GHKA 1GUNA 3M4YA 3MFYA 3M85A 3CRKC 4IQZA 4L8JA 1VF7A 2JXMB 4OGQC 4DK0A 1OXTA 1ZYRC 1H9KA 2CW0C 3W3AA 4IFDG 2JE6I 5BN3A 2Q8IB 2AWOA 2BDOA 1IYVA 1VDZA 1HPCA 1B9MA 1HQMC 1Y8PB 1H9RA 3PUXA 1DXMA 1Q1EA
chains in the Genus database with same CATH superfamily
1PTOF 3KF8B 2BE5D 3I73A 3HOZB 1BO0A 3TP7A 3G6EA 4Q5VA 4IPGA 1YVCA 4NXML 5JAVA 4K5VA 1HHVA 2UXBQ 2EQSA 2WKCA 2K75A 1LTRD 2RBMA 2E2IB 2EXZA 1EIGA 3EBEA 5JEAH 5JJKA 3IFTA 4A3IH 3D4RA 3DM1A 4RGOS 3OW7A 4JCVE 1XNQQ 3VR6A 4DV4Q 1G8ZD 1LT6D 3U50C 1TS3A 4KN7C 1KIXA 1FJGQ 1SJED 3Q22A 1HR0Q 1MHWC 2MJ8A 2DJGC 2XSCA 3PMFA 2NN6I 3KLRA 4H0LC 3K57A 4ZKCB 4DNRB 1OXXK 2R7ZB 4LJZC 4CKBA 1HZBA 1N32L 2L5TA 1S5FD 1VQPA 4OX9Q 1X9NA 2WAQB 2L0CA 2RDHA 3Q8DA 1C9OA 3GTPB 3WWVA 1SFOH 2TMPA 4B3SQ 3S2DB 4IO9A 4X65Q 1VQKA 4A3GB 4K2LA 3A54A 3ND8A 2NBFA 1L2FA 4K6LA 2XWBB 4CKCA 5KYLA 4JI2Q 1VQAA 4CHTB 5E4XA 1EOTA 3UE1A 1C0AA 4A3DB 2QKIC 1I4QA 3DWQA 3S1RH 4L5RC 3CPWA 4UY8C 3CCUA 2UU9L 1JWUD 5FKAC 5GROA 4JBJA 4C3HB 4OIKA 2O5JC 5C0XI 1RTOA 2K52A 1X56A 3M9BA 3M4QA 2LMCB 4F8MA 3CC4A 1WTXA 4R4IA 2OQ0A 2B8FA 2M00A 1PZKD 1STBA 1CK1A 4UDUC 2WB1E 3HKZE 3DHQA 3MFYA 1ZYRC 2JA6H 1PH9A 3NUCA 1IYJB 1SMYD 2Q8IB 3DWAA 4HJ5A 3QOJA 5EQ0A 3CC2A 1AW7A 1VQGA 4LFAQ 2D2CC 4C2MH 2KENA 5IYBG 4A3CG 5EJWA 4F7XA 1PYBA 4BS9A 1FNUA 1D5MC 5C3EG 2A6ED 2IHFA 3NTHA 4QUFA 1HNWQ 1F9QA 2EJMA 5M5XB 1GXDC 3J81j 5IGGA 1BCPC 5ISRA 3NPPA 4U673 1JICA 3BS1A 4BY7G 2D0PA 4K2KA 1HZCA 2K03A 5EPLA 4FXGC 3VR4A 4LF8Q 1A62A 3R2TA 3KOJA 1RIPA 2LXKA 5C6AA 1M90C 1PZJD 4KHVA 3SK4A 1JC7A 1HXYD 1IBLQ 2PPBC 3NBHB 1I50B 2Z0SA 1NAPA 1U4MA 4CBVA 1I4XA 2ZT9C 2X6GA 1L0WA 3ICEA 1CI3M 4ZLTF 2JA8B 4O2DA 3GD7A 1EIYB 3LX0A 4DR4L 1CKNB 4HIKA 2ZM6Q 1W2BA 1XYIA 2EXDA 2K5WA 2A74C 1YJ9A 4BBSH 1CQFA 1PYWD 2KCNA 4X64L 5IE8A 1VQ9A 2A1AA 4L5SA 5K36G 4B3RQ 3QB3A 2QGQA 5M3MH 2NVXH 1K73C 1X55A 3CD6A 1OXUA 3H09A 1G2SA 4HN7A 4DAYB 4CDFC 5IOCA 1UE5A 3AEVA 4RA8A 5CV5A 1O80A 2ZTDA 4FF3A 4OONA 2DJFC 4R4TA 1YJNA 5KNDA 1NSNS 1CKNA 2V4DA 4H7BA 1LT3D 3OHXC 2B2TC 3M7NA 2RHQB 1VQFA 3FVQA 2R93B 1VQ4A 4R9WA 2ZJQA 1WCMB 2F0QA 1B3QA 4XT1B 1JJCB 2F3IA 1EY4A 4JVZA 4RWSC 1PDQA 5JEAG 2A8VA 3S24A 4A3IG 3GTKB 2EYMA 3KK7A 4PMCA 2WAQE 1VF7A 1GOZA 4FVMA 2VB3X 4A3JB 1K8AC 3GV6A 5LL6S 5AFWA 1H9KA 2E2JB 2F0IA 3W3AA 4A3LH 1U4PA 2K5VA 1QOHA 3MEHA 4IUNA 4M8AA 2HDLA 4POGA 3A8JE 3S15B 4IN3A 4EQPA 1S4ZA 3E5SA 3GTPH 1KLUD 1PFNA 4EGVA 2PMZE 4QIWB 1TWGB 1UUPA 3MXGA 5I9PA 5C0XH 3K59A 2WFWA 2EYJA 2XVSA 4AIMA 4F87A 2XNAC 4RHRA 1M1KC 1N33Q 1J5EQ 1XMQQ 3RZOH 1SMXA 4A3DH 4DUZQ 2M2LA 3SVMA 2MNAA 2F0VA 3QO2A 1C48A 3PGZA 1WTOA 3D31A 2IWHA 2CHBD 1MKHA 2C9OA 1E2WA 3S1NB 3F8TA 5D14A 3H3VI 4KV6A 1LTAD 2G5DA 3PCOB 1YHAA 1CA6A 4YY3Q 2JA5H 4DK1A 4JI4Q 2F0FA 3G4SA 1SYGA 4AH6A 3DEOA 3U4ZA 3S16B 4B3TL 1I4GA 4X62L 1CHQD 3AFPA 3WDNA 1QVFA 5TSSA 1CTMA 3BZCA 4WRDA 4DUYQ 1K9MC 2JA6G 2L9HA 4PQXA 3ULPA 4EX5A 1YBYA 3TP8A 4EQNA 4IZ8A 1EU4A 2E5LQ 3KJPA 2VB2X 1PTOC 2X69A 2WB1G 3HKZG 4LAAA 1KQSA 4QL5A 1O78A 4X66Q 2I07B 4DF7A 1BF4A 1VQEA 2PI2A 2R7FA 4LUVA 1VS0A 1K8MA 3NHHA 2OT2A 4K5XA 4A3FH 3OWEB 1R9TH 2ATWA 1XJVA 1AN8A 4WJWA 4LF4L 1UAPA 4DV0L 1HA6A 1GVPA 1YHQA 2MGSA 1A2TA 2XN9C 3VYSA 1HH2P 2MFIA 4IJLA 1PA6A 1S5DD 1K0SA 4GNXB 3VYTA 3NQIA 1FNWA 2H1EA 1S5ED 3I90A 2XRQD 2VQEQ 1QVGA 4JI6Q 5M3FB 1HQMC 1KNEA 3TBIB 1HNZQ 4CJ0B 4RCOA 4BBSG 3AFQA 4IOCA 5M3MG 4ALPA 3D0FA 3CCJA 2NZHA 4DR6Q 1HUMA 1LT5D 4DK6C 3FMCA 5H1SE 5T1GA 4DU9A 3RMHA 1XNRL 1ENFA 2YTVA 1X3GA 3RUZA 2BOSA 3H0GB 4HAEA 2KEEA 1ML0D 2EDGA 3P75A 4LWCA 2UUCL 2A5HA 4KJNA 4UP7A 2BA1A 4ZKBB 2J0TD 2ID0A 4A4IA 2F0SA 5D3IB 1BUVT 2L12A 1JE5A 1WTQA 1K83B 1ZYRD 4HIMA 2AHOB 4ID6A 3Q24A 2F0TA 3NENA 2PZTA 4DV1Q 1H9SB 4CDCC 1JORA 1I6VC 1RCVD 2R3ZA 4S3SA 2E2JH 2SNMA 4C3IH 5JVG3 2SEBD 4K5WA 5C5MA 4GLVB 5E7NA 2E2HB 2PW7A 1BCPD 1OTCA 4KHPL 4A3LG 4BA2I 2K6AA 3S15H 1PFSA 3TZDA 2HHHL 1YJWA 1B2TA 3E0EA 4FO2A 2SDFA 1EYGA 3AU7A 1W3SA 3BDCA 1O7IA 3M4OB 2UUAQ 2E76C 2WAQG 1EQQA 1TWGH 1A3TA 4JW0A 4C1NK 3RZDH 4JBKA 4K8IA 4NXNQ 2B8GA 5CC4A 5GAGC 1WI5A 1H9SA 1VQLA 2UXDQ 4Y7NB 3ONAB 3M4PA 5C0XG 3GTGB 1HFGA 3J7YW 1F9SA 1UEBA 2G9DA 4QQBX 4Y52H 3W5OA 2PI2E 5FO7B 4P75A 3G7LA 4IPDA 1EY9A 3ITPA 4GLXA 1DYQA 4A3DG 5EGTA 1V1PA 4HTHA 1ENAA 3S1NH 1LV9A 5IY0A 3M3YB 4IUVA 4KKUA 3L0OA 5C4ZA 1SN8A 3HFZB 5IP9H 1F9RA 1JMCA 1A2UA 1QJOA 1NMGA 1G91A 3SEBA 4JI7L 1KHIA 2FJ2A 3GV3A 3HP3A 1A0IA 2JA5G 3S16H 4NP5A 4JI5Q 5IIFA 4GOPA 4V0BA 3QJYA 1RODA 2UUBL 1YIJA 5GAHC 2F3WA 1EU3A 5CV4A 2EY1A 4RHSA 4A3BB 3LNNA 2N8NA 4HIDA 2ENBA 1QUQB 1LM0A 1KDCA 3QWNA 2F4VL 4FXKC 4OL7A 4DR5Q 3S17B 1PH2A 3T1YQ 4DNIA 4GKJL 2TSSA 3OPOA 1EZ8A 4DV7Q 2YV5A 2ZJPA 4GOPC 1IZ6A 1IBML 4RGTA 4DAPA 1E0BA 1K3RA 2JP1A 2KQ3A 5EKKA 1FL0A 3E9HA 4A3FG 4L6TB 4A76A 3RLFA 2EYFA 1MGSA 4DR7Q 4A3KH 3KYHC 5IGDA 4FF1A 4R4OA 1ZXTA 4RG1A 1MIUA 2UXCQ 1F2ZA 5M3FH 1EFID 3G48A 3GQBA 2PW5A 3FHWA 4DGZA 4LF9Q 1QZHA 1LTBD 3PIOA 2FMCA 2I5HA 3EJIA 2DGYA 2K5NA 1S5BD 1KAAA 1EQTA 3KF6B 4DV2L 2K5HA 1A15A 2RDGA 3G71A 4AYBB 1PH7A 3NTIA 1CHPD 2PO4A 3T4AC 4HIOA 1GUGA 4BBRH 2DNCA 4X6AH 2JEBI 4L5TA 5LMUQ 1IBKL 2YU9B 4AQYL 1GHKA 4YIJA 4RMFA 3M4YA 4I65A 1MJEA 2E2DC 4IQZA 1AZPA 3P1HA 4OGQC 5AJ3Q 1KABA 2F0WA 1N34L 1HUNA 2F0OA 2IY5B 1JOOA 2LSSA 2AWOA 1A8VA 1HPCA 3DM3A 1K83H 3HRZC 4DV6Q 3S14H 1SYEA 3KF6A 3M7GA 1FR3A 1F9PA 2NVQB 3HOWB 2A68C 4JI3Q 4CDEC 1QE6A 5J3BA 2WV6D 4ZRZA 2RKSA 1YHBA 2DY7A 1VQ8A 4NPSA 1FVIA 3EROA 2ZJRA 1TIID 2OXPA 3H94A 1PTOD 3CCLA 3AQQA 1FGBD 4C3IG 1BVSA 1HZAA 3CCMA 2EYHA 2PCFB 5KIXA 4A93B 3OSOA 3QR8A 5BN5A 1RKNA 3K6OA 2UXBL 4ZYSA 5KGUA 3M4OH 1EY8A 1EEFD 2P5ZX 1PRTB 3NXWA 1Y8NB 4IOAA 3ERSX 1W6KA 5DNFA 1XNQL 1TWHB 2E8GA 3GTGH 2HCCA 4DV4L 3HOXH 3RLNA 1BKBA 4XQJA 1IHZA 1IYUA 3EA6A 2L55A 3VR2A 1FJGL 3T13A 1HR0L 4DR1Q 1TWAH 4NW2A 2QW7A 5EPJA 4X3TA 3N52A 1PH6A 2QA4A 1K8GA 2F0LA 4DXGA 1SROA 4OX9L 3KF8A 3GTLB 3M3YH 2G9HD 3TSSA 1EY5A 2H5XA 5ELCA 5IGCA 5C4JB 5DM63 1JB7A 4B3SL 3I4NB 1GUWA 4X65L 4G7ZC 3E3XA 5DAUA 1TWFH 5IP9G 4H13C 4JI0Q 5LL6X 4JI2L 5FJ8H 3A74A 5LMNW 3NE5B 5C44H 4GLAC 3Q6SA 3WOEA 4KKSA 2WP8J 3HOYB 3PO2B 1GHJA 1QILA 5FO8B 4IFDJ 4R4QA 3FP9A 2QEXA 2F0GA 4OWWB 1KDBA 4OEMB 5I4DA 1ESRA 3S17H 2NVTB 4G4KA 2K14A 5IWAQ 2C5CA 4YHHQ 3V96A 1WTWA 1Y1WB 1B9MA 1LO5D 3T51B 1Q1EA 1E24A 1T9HA 2A6HC 1HQRD 4FDBA 1T5XD 1E1TA 3K5OA 3OYYA 2CH4W 4LF5Q 4A3MH 4A3KG 3KBXA 2VUMH 4LFAL 4NDXA 1GUTA 4XQNA 1RJTA 3VA5A 3RR5A 3KLSA 4PMBA 1AEXA 3L3OC 5IYDH 5JPMC 2VY3A 3SDZA 1HNWL 2MO1A 5M3FG 4A3EB 4QF4A 1VCIA 2JEAI 3I8ZA 1Y1VH 2HD3A 3FRPB 4JI1Q 3ZJYC 1SNOA 4GN4B 4LF8L 2Y0SB 4RGNA 3N6RA 4IPCA 4CJ1B 5GAEC 1F2YA 3NQTA 1IBLL 4TQUS 2JSOA 2Q2IA 4K14A 3GTMH 2FHTA 1WVLA 4JI8Q 3U9OA 3S1MH 1EYCA 1O7YA 4KTAA 4BBRG 2F1MA 2I0QA 5LMNQ 3CRLC 4K0KQ 3MTSA 2ICEC 2ZM6L 1BDOA 2XRSD 1MSGA 1Q90A 4B3RL 3CC7A 2A69D 4TKOB 4O1NA 3U9SA 1ET6A 4BXXH 2NVQH 3HOWH 1B44D 5EBDA 3BYTB 1KLGD 3D6WA 2QILA 2FXQA 1TWCB 2JA7H 2JJQA 1YNXA 5IYCH 3KDFB 4BY1H 3GTJB 1N36Q 2V1CC 3NBHA 3ERQA 5M5YH 3F2CA 4LFCQ 2VNUD 1WFQA 1KDAA 2K50A 1K0RA 3HOZH 4YWMA 4JYAQ 3UE0A 1FNVA 3ER0A 3ULJA 2QDLA 4B3MQ 1HZ9A 3S1QB 5CORA 1W6JA 4R8IA 2ASBA 2PNRC 1TWHH 2Z4IA 4ZUJA 5D65A 3PO3B 4IUQA 4OELB 3K80C 2E2IH 5FLXc 1A6XA 3SGIA 3KDFA 3HOVB 3HOXG 5ELFA 5ELDA 4DAYA 1SE4A 1SNQA 3CPFA 1WD1A 1CT1D 1I94Q 2YTYA 3JAMc 1SLJA 3GTLH 3C1EA 3PUWA 1YITA 2I5MX 3CF5A 5C4XB 2BDNA 2K5QA 3S2HB 1I5FA 2R7ZH 3K5MA 1PYSB 5IT9L 5FOBB 1HTLD 1EZ6A 4DR3Q 2IPKD 3I56A 3L9AX 5KRUA 4E6IA 1Y69U 4P73A 1AFPA 4MIUA 1LTGD 4O42A 2EJFC 4J8QA 3VYUA 4N8X1 1V9PA 2NTTA 1Q8KA 3S2DH 1J5EL 3C3LA 3J7ZC 4UHVA 1LTID 1XMQL 1Q8IA 5FJ8G 4PZ6A 2OEOA 4DUZL 4DV3Q 4A3GH 1Q46A 1QZGA 1ZEQX 1OXVA 2F0HA 5C44G 5FO9B 3KFUA 3EIVA 3BVZA 3DXJC 5DM73 1GO3E 2R7DA 5IGEA 4NMZA 1D6EC 1DONA 2DUDA 2A68D 1XXGA 5IT9c 1V1OA 3K58A 3PV0A 2B2UA 2JA9A 2H4OA 1Y1WH 3TQYA 3BZKA 3JAMi 2F0MA 3TS2A 4YY3L 3TP6A 4JI4L 2IX0A 2F52A 2DY8A 4C3HH 1Z6HA 2K04A 4HJ9A 1VQ6A 1BBUA 3NEMA 4X3SA 3I4OA 2E75C 2JK8A 2KHIA 1NR4A 1CSQA 3BVMA 3SK5A 4DUYL 1TQOA 2MQHA 3TRZA 2B2UC 5DLQE 4XXEA 4A3MG 2EZVA 4N9TA 1LABA 2E5LL 4Z9CB 2Y0SE 2VUMG 4LFBQ 1IKLA 1U9RA 4PMWA 1CKMA 1H9JA 1X3FA 1XWEA 3MC0B 1FD7D 1VQDA 2FINB 4XIGS 4X66L 1LACA 1Y8OB 3FKIB 5IYDG 1LUZA 5M5WB 3RN2A 1SYFA 4UPAA 3HZXA 4QCLA 3DEPA 5BR8Q 1BBWA 1OXTA 3B6YA 3QOLA 1SNDA 2Z8LA 5M5XH 3J80c 4LF7L 4FYDA 1Y1VG 3PF4A 1VQ7A 1NR2A 3LGJA 3VR3A 4K6DA 1KAWA 1QVCA 1V1QA 1CQVA 5NUCA 4J1MA 3MAQA 3SE0A 2PQEA 4F88A 3K5LA 4YCVA 2XIWA 2RDFA 1HCZA 4J6HA 3R3OA 1PH3A 2EE1A 1MI2A 4PV1C 1I50H 1ASYA 4JI6L 2KBNA 4HJ8A 3RLOA 3HOUB 4OIJA 2N49A 1HNZL 4DNTB 3O13A 2JA8H 4X3KA 4CKEA 3K0XA 5EKIA 3NK9A 4JV5Q 1RTNA 1B9NA 3URYA 4LF6Q 4BXXG 4DR6L 3HOWG 1VQCA 5IODA 3MEFA 4PNYA 1HTPA 1P8LA 3CMAA 3HEJA 4GN3B 1GM5A 1EWIA 1TWCH 2XWJB 3VA7A 3J80i 4FNFA 3EN2A 2N78A 3GTJH 2JA7G 4OO1H 1PFMA 5JVH3 4DV0Q 1CFMA 5IYCG 2L4NA 2RSNA 2A73B 4BY1G 1Z7TA 3U4VA 1PRTF 1SEBD 3FPPA 4NKLA 4K8JA 2IHEA 2KEDA 4GNXA 4P2CB 1EYDA 3MXNB 2A6HD 1I6HB 1KXLA 1DGSA 1DD2A 5J22A 2LY7A 2NZOA 5FK9C 3J7AV 3W1GA 1FYCA 3HOZG 1VQJA 1HRJA 2R93H 1E22A 1WCMH 1QWYA 2QDBA 4DV1L 3PO3H 4BY7B 1EEID 2J4XA 1VMPA 1D2BA 2OF1A 1Q82C 4GNXC 1JCKB 5I2XA 1I4HA 1SNMA 5EBCA 4ZQ3A 1SYBA 1IL8A 3GTKH 5IGFA 4A3JH 2K1BA 3MXNA 2KVMA 4IURA 5CR3A 3BG3A 1STYA 4QIWE 1EQVA 5C4XH 5IGBA 5E4WC 3CKIB 2CWAA 1DJRD 4GZYC 3I70A 2UUAL 1BQQT 5I2YA 3GO5A 4NXNL 3K81C 3CRKC 4OXPA 2VQFQ 4DK0A 2R7ZG 4MTKA 2UXDL 4N8FA 1NY4A 1SR3A 1F2LA 2K5DA 2CW0C 3R2IA 3J81c 1IYVA 1Y8PB 4DV5L 1AE2A 4IUPA 2HCIA 4KD3A 4HMJA 1KL9A 5HY6A 1XMOQ 2CQAA 1KRTA 3PUZA 4A3GG 1WTVA 3PUVA 4LUOA 1ILPA 1JT8A 1VQIA 3I4MB 1NBWA 3I3CA 2N3SA 1CSPA 4HEDA 1GJXA 5KEEA 3STBC 1Y14B 2EY2A 1C7YA 2K28A 4KHPQ 2AMCB 2RQXA 4R4CA 5J1ZA 4DN4M 1Y1WG 2HHHQ 1NMFA 3K8AA 3TP5A 3PSIA 3L2PA 2Q8TA 2K05A 2BH8A 3QIAA 4C3HG 1HNXQ 4IFDH 3VYRA 1PXUA 1XX8A 3P20A 5G3LD 1MSHA 1UE1A 1TKWB 4H44C 5C4HA 2ZXOA 3J81i 1TXYA 4A3IB 1ONLA 1UNSA 2A69C 2JN4A 1GKHA 1B8AA 2NYZD 2QEJC 2KCCA 3CQZB 5G3LF 1B3AA 5CBAE 1C4QA 1X65A 3FKIH 4DR5L 5I6WA 4H02A 1YI2A 3NELA 3T1YL 3F1ZA 5T1IA 4DV7L 4M1UB 1U0LA 1WTPA 3RD4A 1EOVA 2Z6KA 1PFBA 1Q7YC 4RAUC 4DR7L 1U5KA 2Y0SG 5HGTA 2RF4A 4YCUA 2WKDA 3T1HQ 5I6YA 3MXUA 5JPNC 1SFOB 1WTHA 5HURA 2UXCL 1L1OB 3HOUH 4P72A 1X6OA 1AH9A 2Z6KC 2IL8A 2EYPA 3CXCA 2UUBQ 3UDIA 1STHA 2OWOA 5CBEE 2JA8G 3CAMA 1QUQA 3S1RB 3AMUA 1EWCA 3SXHA 3IRBA 3CHBD 1CZWA 2F4VQ 2PZWA 1F2MA 2PQAB 4EQ5A 1EY0A 1ICWA 3C2PA 1RDPD 5LMUL 2BDOA 4KI0A 1HFNA 2KUMA 1RHPA 2OTLA 3HGBA 5CYUA 3SHLA 4OO1G 2RCNA 1RD9D 1A3UA 3CU7A 4GKKQ 2R92B 4B9WA 1NTGA 4B08A 3H0GH 4C2MB 2L1BA 4DV6L 1PH4A 3T56B 1XPOA 3OIQA 1GUOA 2LFNA 2WB1B 3HKZB 1B70B 2HQEA 4JI3L 4XQQA 4HR7B 4DR2Q 4A75A 2F0NA 4KY5A 2R93G 4R1JA 1WCMG 2ZTEA 4KN4C 1N9WA 5A2QE 3PO3G 2CCZA 5IP7H 3R8BA 1IW7C 3D8GA 2F0EA 2JYOA 3E0JA 3K7AB 4IPHA 4I7ZC 3CCEA 1V43A 3FPUB 1TT2A 3OW2A 1OO9B 3EQLC 3OMGA 3MXPA 4QB4A 4A3JG 4AQYQ 4IUTA 2E2HH 2OCEA 1STNA 5KYIA 3EFXD 5C4XG 1AZQA 4KLKA 1SDFA 1R4QB 2EIFA 4G57A 4BBSB 2O5IC 1A3VA 1VMCA 1DCZA 2A19A 2PZUA 2HUGA 5M3MB 3NWTA 2NVXB 3A8IE 1IKMA 1A63A 1X54A 2D5DA 3H15A 5EPKA 3J7AF 4DR1L 4Y7NH 4P74A 3NBIA 4RCNA 5GQOA 2CVRA 1JJGA 5BN4A 1ASZA 3GTOB 3I4MH 4JBMA 3TEHB 1TY2A 3OTOQ 3BU2A 2EVBA 5A2QL 1DZ1A 1EYAA 2F3VA 4L5QA 2M9VA 5CGKA 4JI0L 3MWYW 1TS4A 3M85A 4L8JA 3CCVA 1M8AA 4L63B 4NXMQ 4IFDG 2JE6I 4YWKA 1TR5A 3WOFA 3K7UC 3DWPA 1V8QA 3CQZH 1O7LA 1ESFA 4BA1I 2VS1A 1WTRA 2KHJA 2KOLA 5IWAL 1K8OA 2VL6A 4YHHL 1ICFB 4A3BH 3FKIG 2Q2HA 1EUJA 1PRTC 3BVGA 3SK8A 4APVA 4C56C 2DN8A 4ILWA 1WYDA 2QF7A 1YNNC 2J7ZA 3OOCA 1Z47A 1CM9A 4RKLA 1JR0D 4KKTA 1Q1BA 1MJCA 4LF5L 1VQNA 3H91A 3W1BA 1H9MA 1G291 4Q0FA 3J7A5 3A55A 3FDTA 1N32Q 2EYLA 3MZ5A 3A56A 4HSVA 1KTKA 1QG7A 2B2VA 1TS2A 1BCPB 3IAYA 1IL2A 3HOUG 1J9OA 3RZOB 2PMZB 2CW0D 5C5LA 4AYBE 4JI1L 2R6GA 3PQIA 1QNUA 2OQKA 2B63B 4FF4A 1SAPA 3BDLA 5FLXE 3NP8A 4DAVA 1L0YB 3JC66 2B2VC 4JI8L 5E1FA 3PIO3 2AUJD 2IJ0A 5CV8A 3K0YA 3D4DA 1E7ZA 3BJUA 1B1ZA 2UU9Q 2F0UA 2JA5B 1SYDA 1DOLA 4JC0A 2NB0A 2KA7A 5LMNL 3JAME 4K0KL 1KD1C 1ZKOA 4QY7A 2WIIB 3STBD 1BNZA 2RA4A 3IL8A 3D6CA 2O2LD 2FMMA 3PF5A 2ES2A 4MNOA 2VZAA 2R92H 2YU9H 4HJ7A 1YNJD 5E3FA 1NUCA 1JE4A 3A5UA 5DEHA 4O0AA 2BA0A 3H0GG 1WJJA 4MTNA 3F2BA 2Q2UA 2QCPX 3AB9A 2FFKB 5JJIA 4HMIA 4PG3A 2B2WA 2F0DA 3CW2C 3I2ZA 5F2DA 3Q0AA 1SE3A 2KECA 3TN2A 4A3FB 3K7AH 1NCVA 1R9TB 2MPMA 1N36L 5IP7G 1B7YB 1F77A 4P71A 4DXFA 5IT9E 3BDOA 4LFCL 4HJAA 3VR5A 1G6ZA 2NVYB 1CA5A 4JYAL 3F2UA 4JBWA 2B2WC 4XTCS 3U58A 5FLXL 4B3ML 1MD2D 2CKZB 4DA2A 2KCTA 5KNCA 4A93H 3ND9A 3NSWA 1YEZA 1PH1A 4JOIA 1U4RA 1Q3LA 4OHJA 1X32A 4PZ7A 3JAML 2ZXRA 1UEAB 5ELOA 3V05A 4DR4Q 1I3QB 2B2TA 4LW1A 5ELBA 4JK1C 4WJ3M 4X64Q 1XPUA 1EWHA 5KNBA 1I94L 4OO1I 2ICIA 2HDMA 4UP8A 3GTOH 2KJXA 1D5ZC 3W2DA 4JOIC 2MUYA 5CV6A 3J80E 3I4MG 1PH8A 1E2VA 3LWUA 4DFAA 4DR3L 1E1OA 4V190 5C3WA 2BH2A 2NN6H 1STAA 2MP1A 4C3JB 2RVLA 2AKWB 1VF5C 5C4JH 4HSPA 5JOBA 3I4NH 3UI2A 3I72A 3FEWX 2LXJA 1G51A 4PZ8A 4DV3L 1AE3A 2CFMA 1LLRD 1VQBA 3MFGA 1I4PA 3CCSA 2PNHA 1UE7A 1K28A 1Q12A 1N33L 1Q81C 3G6JB 2N55A 1O7ZA 3HOYH 3GP7A 4C3IB 1XTDA 1PH5A 1D8LA 3E9IA 1T5EA 5M9OA 3PIPA 3PO2H 1EL0A 1EFWA 2F03A 1X3QA 5JEAJ 2VXWA 4A3BG 1IW7D 2KCMA 2AQ2B 2AUKA 2C35B 2NVTH 3QG1A 1TU2B 2Z1CA 4TVAB 3A7AB 1PLFA 3KLSX 1S40A 1GUSA 1PHJA 3PUYA 1L0XB 1DOKA 4KY7A 2B2YA 5K5PA 5HGQA 3RZDB 1PTOB 3Q23A 4EQOA 4LFBL 4JPBW 1IXRA 2AWNA 1GD7A 5EKLA 1X3PA 3CCQA 1S3OA 5ELNA 3J80L 1LTLA 4XT3B 2SNSA 1FGUA 2HIVA 4C1NI 1G6PA 2PYKA 5I9OA 5BR8L 3T53B 1BOSA 1SSOA 3HS0C 5A35A 1STEA 2CQOA 2B2YC 4J15A 2B63H 4A3EH 1BBXC 5FLMH 3H6MA 1VQ5A 1M4VA 2EOTA 3ZYYX 4IFDI 4HCSA 1UWVA 4WORA 5J39A 2GVAA 2K32A 4AYBG 2F4IA 4ME3A 4YCWA 1Q86C 1RF2D 4FXDA 1NNXA 2HIXA 1SE8A 2K7VA 4JV5L 1BXTA 1II3A 4KHZA 5C3XA 2R92G 1SXTA 2VQEL 4B3TQ 1P16A 3C1FA 2KHSA 4X62Q 3H3VC 3J81E 4LF6L 3OMCA 3RN5A 1TS5A 2O4XA 3L7ZC 1I4RA 1CUKA 5COYA 4U68A 3MA2B 5JJLA 4HCEA 4X3UA 2BE5C 4LF7Q 4IUUA 4ME5A 2B39A 2LS01 3I91A 1LT4D 4A3KB 1PRTD 4CJ2C 2NVYH 1Z9FA 1YNND 4LMQD 1VQMA 3A8KE 4LF4Q 2NTSA 2K33A 2RSOA 2F0KA 3LWEA 4XDXA 1D1IA 2VW9A 2IW3A 5D3DA 2DNEA 3P7JA 1JOKA 1NJIC 1B53A 2RCFA 2Q2TA 1SNPA 3A7LA 5C3EB 3TDQA 4A93G 2D9UA 2WINB 1I3QH 4WJ4A 5CV9A 4KJOA 3HKSA 3S1QH 3UDXA 4DAMA 4XYOA 1ET9A 4GS3A 2X6LA 2AQ3B 3GTQB 1WOCA 3DMUA 4LNQA 3NTKA 3HOVH 1J6QA 4BBRB 3BZDB 4ULLA 1D1KA 4KD4A 3J81L 2CWPA 1JWSD 3T16A 2ZTCA 1EQRA 4YWLA 1KC8C 1EIHA 2VQFL 2N88A 2NUCA 3DLLA 1XNRQ 2Q8RE 4OWXB 4C3JH 2I46A 1JWMD 4N9PA 4ZCKA 3S2HH 1D5XC 1SYCA 2L11A 5LHY1 1SJHD 3S14B 2NN6G 5JJZA 2UUCQ 1ENCA 1E2ZA 1VQOA 4MZ9A 2IX1A 3I4NG 2EYOA 2ZXPA 1BR9A 4DK3C 1LYLA 1J8IA 1XMOL 3TZUA 4CGYB 4KY6A 4B9XA 1SNCA 2SOBA 3RNUA 1PMRA 1QB5D 2RHSB 3OWFA 1B4OA 2I5LX 1X3EA 5L37A 2Z4HA 4I7AA 4R8NA 2XGTA 3F2DA 5EAYA 3HOYG 3PIP3 1K3BC 3PO2G 1V1PB 2K4KA 4RFBA 1KRSA 2NWGA 1HNXL 1C8CA 1BCPF 3EVQA 4TSSA 1SMYC 3H3VH 2GA4B 1PTOH 4WFN3 1CZGA 1YNJC 1CKOA 4JG2A 3GDEA 3KBGA 4JI5L 1WD0A 3E6ZX 4BWGB 1VQHA 1S72A 2A6EC 3HOXB 3DUZA 3CCRA 1G2TA 4RGMA 4DV5Q 4GOPB 1JOQA 1DOMA 1TWAB 5ELEA 1LTSD 1DM0B 3UDFA 2D0OA 3D3RA 4ZAIA 1S5CD 1B50A 5C0XJ 4XYQA 5M5WH 4RH6A 2B63G 1AP0A 1H95A 3CMEA 3T1HL 3VDYA 4A3EG 5FLMG 5GADC 1E3PA 2EPBA 4TRDA 1EY6A 1QNKA 1XTCD 4UAIA 3KLWA 4MHEA 3D4WA 2EY5A 1TWFB 2AQ1B 1GUNA 3BYYB 2K01A 4MN3A 1D7QA 2LKVA 1JB3A 5C44B 4KK7A 2NZ1D 2R61A 5BN3A 1SRUA 4JI7Q 1STGA 3I4LA 1PV4A 2IT1A 4LF9L 3OIPA 1PVOA 4FP5D 5CMDA 1JQYD 4ZK9B 4NB3A 2E74C 3R93A 3S9WA 3C46A 3KJOA 3MVVA 2B29A 2HT1A 1HA5A 4KMUC 1XPRA 1OXSC 4QUCA 4GKJQ 3AYHB 2OTJA 4A3MB 1IBMQ 4GKKL 4QJFA 3UDGA 4QGUA 2VUMB 3V2TA 2B3GA 1KNAA 2GN5A 1L1OA 2IX3A 2MHVA 1RL2A 5AJ3L 2JA6B 5IYBH 4DR2L 4A3CH 3SK6A 1MBYA 1U4LA 1I6HH 2D62A 5C3EH 1R4PB 1LTTD 3A5ZB 4RKBA 3TMEA 4DPGA 1EY7A 3IKJA 1Y1VB 1SBBB 2F0PA 1TVXA 1TY0A 4ABNA 2PQAA 3I7FA 4BY7H 2CH4A 2EJGC 1L1OC 3X3MA 3GTQH 2L15A 2EY6A 2HQLA 1QCBD 2Z6BA 4EVOA 3GTMB 3TREA 4IJHA 4UP9A 4DV2Q 3S1MB 2MO0A 3HOVG 1JJ2A 3HG9A 1HR0W 2YTXA 3ULLA 1IBKQ 4G7OC 4G7HC 2GVBA 4ZUIA 2ALYB 1SE2A 3A0JA 4POFA 4C3JG 1HJPA 4DKAC 2Z9HA 3NWSA 5K36H 2BCOA 1N34Q 4OWTB 3K5NA 2XTIA 3MHBA 4FF2A 4LUZA 1UE6A 4IALA 3TS0A 4GN5A 2JQOA 1PZID 3CP0A 2YYZA 4LK1C 3I55A 3X3NA 1YZ6A 4ODGA 1NE3A 2JA7B 4BY1B 3SR1A 2JXMB 5CV7A 3OTOL 1N8RC 3IFDA 2WACA 3KUPA 4QMGA 4CDDC 1VDZA 5M5YB 1EIFA 2F0JA 1H9RA 1DXMA 1ILQA 3PUXA
chains in the Genus database with same CATH topology
1PTOF 2BE5D 3I73A 3HOZB 1BO0A 3TP7A 4Q5VA 5JAVA 4K5VA 1HHVA 2WKCA 1LTRD 2RBMA 2E2IB 2EXZA 1EIGA 5JEAH 3IFTA 3D4RA 3DM1A 4RGOS 3OW7A 3VR6A 1G8ZD 1LT6D 1TS3A 4KN7C 1SJED 3Q22A 2MJ8A 2XSCA 3PMFA 2NN6I 3KLRA 4H0LC 3K57A 4ZKCB 4DNRB 1OXXK 2R7ZB 4LJZC 4CKBA 2L5TA 1S5FD 2WAQB 2L0CA 2RDHA 3GTPB 2TMPA 3S2DB 4A3GB 4K2LA 3A54A 3ND8A 2NBFA 4K6LA 2XWBB 4CKCA 5KYLA 4CHTB 5E4XA 1EOTA 4A3DB 2QKIC 1I4QA 3DWQA 1JWUD 5FKAC 4C3HB 4OIKA 2O5JC 5C0XI 1RTOA 2LMCB 4F8MA 1WTXA 2B8FA 2M00A 1PZKD 1STBA 1CK1A 4UDUC 3DHQA 3MFYA 1ZYRC 3NUCA 1SMYD 2Q8IB 3DWAA 3QOJA 5EQ0A 1AW7A 2D2CC 5EJWA 4F7XA 4BS9A 1FNUA 1D5MC 2A6ED 3NTHA 4QUFA 1F9QA 2EJMA 5M5XB 1GXDC 5IGGA 1BCPC 5ISRA 3NPPA 4U673 1JICA 3BS1A 4K2KA 2K03A 5EPLA 4FXGC 3VR4A 3R2TA 5C6AA 1PZJD 4KHVA 3SK4A 1JC7A 1HXYD 2PPBC 1I50B 1NAPA 1U4MA 4CBVA 1I4XA 2ZT9C 2X6GA 1CI3M 4ZLTF 2JA8B 3GD7A 3LX0A 1XYIA 2K5WA 2A74C 1CQFA 1PYWD 2KCNA 5K36G 3QB3A 1OXUA 3H09A 1G2SA 4HN7A 5IOCA 4RA8A 5CV5A 1O80A 4FF3A 5KNDA 1NSNS 4H7BA 2V4DA 1LT3D 3OHXC 2B2TC 3M7NA 3FVQA 2R93B 4R9WA 1WCMB 2F0QA 4XT1B 1EY4A 4RWSC 1PDQA 5JEAG 3GTKB 2EYMA 3KK7A 4PMCA 1VF7A 1GOZA 4FVMA 2VB3X 4A3JB 3GV6A 5LL6S 5AFWA 1H9KA 2E2JB 2F0IA 3W3AA 1U4PA 1QOHA 3MEHA 4IUNA 4M8AA 2HDLA 3S15B 3A8JE 4IN3A 4EQPA 1S4ZA 3E5SA 1KLUD 1PFNA 4EGVA 4QIWB 1TWGB 1UUPA 3MXGA 5I9PA 5C0XH 3K59A 2EYJA 2XVSA 4F87A 2XNAC 4RHRA 2M2LA 3SVMA 2F0VA 3QO2A 1C48A 1WTOA 3D31A 2IWHA 2CHBD 2C9OA 1E2WA 3S1NB 5D14A 4KV6A 1LTAD 1CA6A 4DK1A 2F0FA 1SYGA 3DEOA 3S16B 1I4GA 1CHQD 3WDNA 5TSSA 1CTMA 4WRDA 2L9HA 4PQXA 3TP8A 4EQNA 4IZ8A 1EU4A 2VB2X 1PTOC 2X69A 4LAAA 1O78A 2I07B 4DF7A 1BF4A 1K8MA 3NHHA 2OT2A 4K5XA 3OWEB 1AN8A 4WJWA 1UAPA 1HA6A 2MGSA 1A2TA 2XN9C 3VYSA 1S5DD 3VYTA 3NQIA 1FNWA 2H1EA 1S5ED 3I90A 2XRQD 5M3FB 1HQMC 1KNEA 3TBIB 4CJ0B 4RCOA 1HUMA 1LT5D 3FMCA 5T1GA 4DU9A 3RMHA 1ENFA 3RUZA 2BOSA 3H0GB 4HAEA 2KEEA 1ML0D 2EDGA 3P75A 2A5HA 4KJNA 2BA1A 4ZKBB 2J0TD 2ID0A 2F0SA 5D3IB 1BUVT 2L12A 1WTQA 1K83B 1ZYRD 4ID6A 3Q24A 2F0TA 2PZTA 1H9SB 1JORA 1I6VC 1RCVD 2R3ZA 4S3SA 2SNMA 5JVG3 2SEBD 4K5WA 5C5MA 2E2HB 2PW7A 1BCPD 4BA2I 2K6AA 3TZDA 1B2TA 4FO2A 2SDFA 3AU7A 3BDCA 3M4OB 2E76C 1A3TA 4C1NK 4K8IA 2B8GA 5CC4A 1H9SA 4Y7NB 3ONAB 5C0XG 3GTGB 1HFGA 3J7YW 1F9SA 2G9DA 5FO7B 3G7LA 1EY9A 3ITPA 1DYQA 5EGTA 1V1PA 4HTHA 1ENAA 1LV9A 3M3YB 4IUVA 4KKUA 5C4ZA 1F9RA 1A2UA 1QJOA 1G91A 3SEBA 2FJ2A 3GV3A 3HP3A 4NP5A 5IIFA 4V0BA 3QJYA 1RODA 2F3WA 1EU3A 5CV4A 2EY1A 4RHSA 4A3BB 3LNNA 2ENBA 1KDCA 3QWNA 4FXKC 4OL7A 3S17B 2TSSA 3OPOA 1EZ8A 4RGTA 4DAPA 1E0BA 2JP1A 2KQ3A 5EKKA 4L6TB 3RLFA 2EYFA 1MGSA 5IGDA 4FF1A 1ZXTA 1F2ZA 1EFID 3GQBA 2PW5A 4DGZA 1LTBD 2FMCA 3EJIA 1S5BD 1KAAA 1EQTA 1A15A 2RDGA 4AYBB 3NTIA 1CHPD 2PO4A 3T4AC 1GUGA 2DNCA 2JEBI 2YU9B 1GHKA 4YIJA 3M4YA 4I65A 2E2DC 4IQZA 1AZPA 3P1HA 4OGQC 1KABA 2F0WA 1HUNA 2F0OA 1JOOA 2AWOA 1HPCA 3HRZC 1SYEA 3M7GA 1FR3A 1F9PA 2NVQB 3HOWB 2A68C 1QE6A 2WV6D 4ZRZA 2RKSA 2DY7A 3EROA 1TIID 2OXPA 3H94A 1PTOD 1FGBD 4C3IG 2EYHA 2PCFB 5KIXA 4A93B 3OSOA 5BN5A 1RKNA 3K6OA 4ZYSA 5KGUA 1EY8A 1EEFD 1PRTB 3NXWA 1Y8NB 1W6KA 5DNFA 1TWHB 2HCCA 4XQJA 1IHZA 1IYUA 3EA6A 2L55A 3VR2A 3T13A 4NW2A 5EPJA 4X3TA 3N52A 2F0LA 4DXGA 3KF8A 3GTLB 2G9HD 3TSSA 1EY5A 5ELCA 5IGCA 5C4JB 5DM63 3I4NB 1GUWA 4G7ZC 5DAUA 4H13C 5LL6X 3NE5B 3Q6SA 3WOEA 4KKSA 2WP8J 3HOYB 3PO2B 1GHJA 1QILA 5FO8B 4IFDJ 2F0GA 1KDBA 5I4DA 1ESRA 2NVTB 4G4KA 2C5CA 3V96A 1WTWA 1Y1WB 1B9MA 1LO5D 3T51B 1Q1EA 2A6HC 1HQRD 1T5XD 3K5OA 3KBXA 4NDXA 1GUTA 4XQNA 1RJTA 3VA5A 3KLSA 4PMBA 1AEXA 3L3OC 5JPMC 3SDZA 4A3EB 4QF4A 1VCIA 2JEAI 3I8ZA 3FRPB 1SNOA 2Y0SB 4RGNA 3N6RA 4CJ1B 1F2YA 3NQTA 4TQUS 2JSOA 4K14A 2FHTA 1WVLA 3U9OA 1EYCA 1O7YA 4KTAA 2F1MA 3CRLC 3MTSA 2ICEC 1BDOA 2XRSD 1MSGA 1Q90A 2A69D 4TKOB 4O1NA 3U9SA 1ET6A 1B44D 5EBDA 3BYTB 1KLGD 3D6WA 2QILA 1TWCB 3GTJB 3NBHA 3ERQA 2VNUD 1KDAA 1FNVA 3S1QB 5CORA 1W6JA 4R8IA 2PNRC 2Z4IA 4ZUJA 5D65A 3PO3B 4IUQA 1A6XA 3HOVB 5ELFA 5ELDA 4DAYA 1SE4A 1SNQA 1WD1A 1CT1D 3C1EA 3PUWA 5C4XB 2BDNA 2K5QA 3S2HB 3K5MA 5IT9L 5FOBB 1HTLD 1EZ6A 2IPKD 3L9AX 5KRUA 4E6IA 1Y69U 1AFPA 4MIUA 1LTGD 4O42A 2EJFC 4J8QA 3VYUA 2NTTA 3C3LA 1LTID 1Q8IA 2OEOA 1ZEQX 1OXVA 2F0HA 5FO9B 3BVZA 3DXJC 5DM73 5IGEA 4NMZA 1D6EC 1DONA 2A68D 1XXGA 1V1OA 3K58A 3PV0A 2B2UA 2H4OA 2F0MA 3TP6A 2IX0A 2DY8A 1Z6HA 2K04A 4X3SA 2E75C 1NR4A 3BVMA 3SK5A 1TQOA 2B2UC 4XXEA 2EZVA 4N9TA 1LABA 4Z9CB 1IKLA 1U9RA 4PMWA 1H9JA 1XWEA 1FD7D 3MC0B 2FINB 4XIGS 1LACA 1Y8OB 3FKIB 5M5WB 1SYFA 3HZXA 4QCLA 3DEPA 1OXTA 3QOLA 1SNDA 2Z8LA 4FYDA 1NR2A 3VR3A 4K6DA 1CQVA 5NUCA 4J1MA 3MAQA 3SE0A 2PQEA 4F88A 3K5LA 2XIWA 2RDFA 1HCZA 4J6HA 3R3OA 2EE1A 1MI2A 4PV1C 3HOUB 4OIJA 4DNTB 3O13A 4X3KA 4CKEA 5EKIA 3NK9A 1RTNA 1B9NA 3URYA 5IODA 4PNYA 1HTPA 3HEJA 2XWJB 3VA7A 4FNFA 4OO1H 1PFMA 5JVH3 1CFMA 2L4NA 2RSNA 2A73B 1Z7TA 1PRTF 1SEBD 3FPPA 4NKLA 4K8JA 2KEDA 4P2CB 1EYDA 2A6HD 1I6HB 1DD2A 5J22A 2LY7A 5FK9C 3J7AV 1FYCA 1HRJA 1QWYA 2QDBA 4BY7B 1EEID 2J4XA 1VMPA 1D2BA 2OF1A 1JCKB 5I2XA 1I4HA 1SNMA 5EBCA 4ZQ3A 1SYBA 1IL8A 5IGFA 2K1BA 3MXNA 2KVMA 4IURA 5CR3A 3BG3A 1STYA 1EQVA 5IGBA 5E4WC 3CKIB 1DJRD 4GZYC 3I70A 1BQQT 5I2YA 3GO5A 3CRKC 4DK0A 1F2LA 2K5DA 2CW0C 3R2IA 1IYVA 1Y8PB 4IUPA 2HCIA 4KD3A 4HMJA 2CQAA 3PUZA 1WTVA 3PUVA 1ILPA 3I4MB 3I3CA 4HEDA 1GJXA 5KEEA 2EY2A 2K28A 2RQXA 5J1ZA 4DN4M 3TP5A 2Q8TA 2K05A 3QIAA 4C3HG 4IFDH 3VYRA 1PXUA 1XX8A 3P20A 5G3LD 1MSHA 1TKWB 4H44C 5C4HA 2ZXOA 4A3IB 1ONLA 1UNSA 2A69C 2NYZD 2QEJC 2KCCA 3CQZB 5G3LF 1B3AA 5CBAE 1C4QA 5I6WA 5T1IA 4M1UB 1WTPA 3RD4A 1PFBA 4RAUC 5HGTA 2WKDA 5I6YA 3MXUA 5JPNC 1SFOB 5HURA 2IL8A 2EYPA 1STHA 5CBEE 3S1RB 3AMUA 1EWCA 3SXHA 3CHBD 1CZWA 2PZWA 1F2MA 1EY0A 1ICWA 3C2PA 1RDPD 2BDOA 4KI0A 1HFNA 2KUMA 1RHPA 3HGBA 5CYUA 3SHLA 4OO1G 1RD9D 1A3UA 3CU7A 2R92B 4B9WA 4B08A 4C2MB 2L1BA 3T56B 3OIQA 1GUOA 2LFNA 2WB1B 3HKZB 2HQEA 4XQQA 4HR7B 2F0NA 4KY5A 4KN4C 5A2QE 3R8BA 1IW7C 3D8GA 2F0EA 2JYOA 3E0JA 3K7AB 4I7ZC 1V43A 3FPUB 1TT2A 1OO9B 3EQLC 3OMGA 3MXPA 4QB4A 4IUTA 1STNA 5KYIA 3EFXD 1AZQA 1SDFA 1R4QB 4G57A 4BBSB 2O5IC 1A3VA 1VMCA 1DCZA 2PZUA 2HUGA 5M3MB 3NWTA 2NVXB 3A8IE 1IKMA 2D5DA 3J7AF 5EPKA 3NBIA 4RCNA 2CVRA 5BN4A 3GTOB 1TY2A 2EVBA 5A2QL 1DZ1A 1EYAA 2F3VA 2M9VA 5CGKA 3MWYW 1TS4A 3M85A 4L8JA 1M8AA 4L63B 4IFDG 2JE6I 1TR5A 3WOFA 3DWPA 1V8QA 1O7LA 1ESFA 4BA1I 1WTRA 2KOLA 1K8OA 3SK8A 1PRTC 3BVGA 4C56C 2DN8A 4ILWA 2QF7A 1YNNC 2J7ZA 3OOCA 1Z47A 1CM9A 4RKLA 1JR0D 4KKTA 1Q1BA 3H91A 1H9MA 1G291 4Q0FA 3A55A 3FDTA 2EYLA 3MZ5A 3A56A 4HSVA 1KTKA 1QG7A 2B2VA 1TS2A 1BCPB 3IAYA 1J9OA 3RZOB 2PMZB 2CW0D 5C5LA 2R6GA 1QNUA 2B63B 4FF4A 1SAPA 3BDLA 5FLXE 3NP8A 4DAVA 1L0YB 2B2VC 5E1FA 3PIO3 2AUJD 2IJ0A 5CV8A 3K0YA 3D4DA 2JA5B 1B1ZA 2F0UA 1SYDA 1DOLA 2NB0A 2KA7A 3JAME 1ZKOA 2WIIB 1BNZA 2RA4A 3IL8A 3D6CA 2O2LD 2FMMA 1YNJD 5E3FA 1NUCA 1JE4A 5DEHA 2BA0A 2QCPX 3AB9A 2FFKB 4HMIA 2B2WA 2F0DA 5F2DA 3Q0AA 1SE3A 2KECA 3TN2A 4A3FB 1NCVA 1R9TB 2MPMA 1F77A 4DXFA 5IT9E 3BDOA 3VR5A 1G6ZA 2NVYB 1CA5A 3F2UA 4JBWA 2B2WC 4XTCS 5FLXL 1MD2D 4DA2A 5KNCA 3ND9A 3NSWA 1U4RA 1Q3LA 4OHJA 1X32A 3JAML 2ZXRA 1UEAB 3V05A 1I3QB 2B2TA 5ELBA 4JK1C 1EWHA 5KNBA 4OO1I 2ICIA 2HDMA 2KJXA 1D5ZC 3W2DA 2MUYA 5CV6A 3J80E 1E2VA 3LWUA 4DFAA 4V190 5C3WA 2NN6H 1STAA 2MP1A 4C3JB 2RVLA 1VF5C 4HSPA 5JOBA 3UI2A 3I72A 3FEWX 1LLRD 3MFGA 1I4PA 1Q12A 3G6JB 2N55A 1O7ZA 3GP7A 4C3IB 5M9OA 1T5EA 1EL0A 2F03A 1X3QA 5JEAJ 2VXWA 1IW7D 2AQ2B 2AUKA 3QG1A 1TU2B 2Z1CA 3A7AB 1PLFA 3KLSX 1GUSA 3PUYA 1L0XB 1DOKA 4KY7A 2B2YA 5K5PA 3RZDB 1PTOB 3Q23A 4EQOA 2AWNA 5EKLA 1X3PA 3J80L 4XT3B 2SNSA 4C1NI 2PYKA 5I9OA 3T53B 1BOSA 1SSOA 3HS0C 5A35A 1STEA 2B2YC 1BBXC 3H6MA 1M4VA 2EOTA 3ZYYX 4IFDI 4HCSA 4WORA 5J39A 2K32A 2F4IA 1RF2D 4FXDA 2K7VA 1BXTA 1II3A 4KHZA 5C3XA 1SXTA 3C1FA 2KHSA 3H3VC 3J81E 3OMCA 1TS5A 2O4XA 3L7ZC 1I4RA 5COYA 4U68A 3MA2B 4HCEA 4X3UA 2BE5C 4IUUA 4ME5A 2B39A 2LS01 3I91A 1LT4D 4A3KB 1PRTD 4CJ2C 1YNND 4LMQD 3A8KE 2NTSA 2K33A 2RSOA 2F0KA 3LWEA 4XDXA 1D1IA 2IW3A 5D3DA 2DNEA 3P7JA 1JOKA 1B53A 1SNPA 3A7LA 5C3EB 3TDQA 2D9UA 2WINB 5CV9A 4KJOA 4XYOA 1ET9A 2X6LA 2AQ3B 3GTQB 3DMUA 3NTKA 4BBRB 3BZDB 4ULLA 1D1KA 4KD4A 3J81L 1JWSD 3T16A 1EIHA 2N88A 2NUCA 2Q8RE 2I46A 1JWMD 4N9PA 1D5XC 1SYCA 2L11A 5LHY1 1SJHD 3S14B 2NN6G 5JJZA 1ENCA 1E2ZA 2IX1A 2EYOA 2ZXPA 1BR9A 1J8IA 3TZUA 4CGYB 4KY6A 4B9XA 1SNCA 2SOBA 1PMRA 1QB5D 3OWFA 1B4OA 2Z4HA 4R8NA 3PIP3 1V1PB 4RFBA 2NWGA 1C8CA 1BCPF 3EVQA 4TSSA 1SMYC 2GA4B 1PTOH 4WFN3 1CZGA 1YNJC 3KBGA 1WD0A 3E6ZX 4BWGB 3HOXB 2A6EC 3DUZA 1G2TA 4RGMA 1JOQA 1DOMA 1TWAB 5ELEA 1LTSD 1DM0B 3D3RA 4ZAIA 1S5CD 1B50A 5C0XJ 4XYQA 4RH6A 1AP0A 2EPBA 4TRDA 1EY6A 1QNKA 1XTCD 4UAIA 4MHEA 3D4WA 2EY5A 1TWFB 2AQ1B 1GUNA 3BYYB 2K01A 4MN3A 2LKVA 1JB3A 5C44B 4KK7A 2NZ1D 2R61A 5BN3A 1STGA 3I4LA 2IT1A 3OIPA 4FP5D 5CMDA 1JQYD 4ZK9B 2E74C 3R93A 3S9WA 3C46A 3MVVA 1HA5A 4KMUC 1OXSC 4QUCA 4A3MB 2VUMB 3V2TA 1KNAA 2IX3A 2MHVA 2JA6B 3SK6A 1MBYA 1U4LA 2D62A 1R4PB 1LTTD 4RKBA 3TMEA 1EY7A 3IKJA 1Y1VB 1SBBB 2F0PA 1TVXA 1TY0A 4ABNA 2EJGC 3X3MA 2EY6A 1QCBD 4EVOA 3GTMB 3S1MB 3HG9A 4G7OC 4G7HC 4ZUIA 1SE2A 4C3JG 3NWSA 5K36H 2BCOA 3K5NA 3MHBA 4FF2A 4IALA 1PZID 2YYZA 4LK1C 3X3NA 4ODGA 2JA7B 4BY1B 3SR1A 2JXMB 5CV7A 3IFDA 2WACA 3KUPA 4QMGA 1VDZA 5M5YB 2F0JA 1H9RA 1DXMA 1ILQA 3PUXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KKU A;  2IT1 A;  3VR3 A;  1FR3 A;  2A6H C;  1V8Q A;  2BE5 D;  3I73 A;  1O7L A;  2A68 C;  3A8J E;  3HGB A;  1A6X A;  3T53 B;  2A6E D;  4JBW A;  4BA1 I;  5A35 A;  3SE0 A;  4XTC S;  4OO1 G;  2EJM A;  1QJO A;  3PUZ A;  1K8O A;  1HCZ A;  3PUV A;  2E74 C;  4PV1 C;  5KNC A;  2NN6 G;  3ND9 A;  3T56 B;  1GUT A;  2DN8 A;  3H94 A;  5C0X H;  1GUO A;  2QF7 A;  1GJX A;  1YNN C;  4DNT B;  3OOC A;  1E2Z A;  3FMC A;  4KMU C;  3VR4 A;  1OXS C;  3QJY A;  3PUW A;  5JEA H;  4HR7 B;  4KKT A;  3TZU A;  3SDZ A;  1Q1B A;  1B9N A;  3IFT A;  3D4R A;  2K32 A;  4JK1 C;  2PPB C;  1PMR A;  3OW7 A;  1H9M A;  1G29 1;  2PCF B;  3LNN A;  4KN4 C;  2ZT9 C;  3VR6 A;  1VCI A;  2EDG A;  5BN5 A;  2JEA I;  1EWH A;  1CI3 M;  1IW7 C;  1HTP A;  3BDO A;  3QIA A;  5KNB A;  4IFD H;  3P20 A;  2BA1 A;  4I7Z C;  3GD7 A;  4KN7 C;  1V43 A;  1Y69 U;  2K7V A;  3D31 A;  3OPO A;  1TKW B;  1Y8N B;  2EJF C;  3N6R A;  4H44 C;  4KHZ A;  3VA7 A;  1E2W A;  1ONL A;  2D62 A;  4TQU S;  2NN6 I;  2A69 C;  3KLR A;  4H0L C;  4DNR B;  1OXX K;  3I4L A;  4OO1 H;  3EQL C;  4LJZ C;  1CFM A;  2KCC A;  1E2V A;  5K36 G;  1Z7T A;  3IKJ A;  2L5T A;  3LWU A;  1OXV A;  3L7Z C;  3RLF A;  2R6G A;  2D2C C;  4DK1 A;  3DXJ C;  1IYU A;  2F1M A;  3FPP A;  1SMY C;  1H9S B;  2NN6 H;  3VR2 A;  1I6V C;  1OXU A;  3CRL C;  2EJG C;  1VF5 C;  2A6H D;  1YNJ C;  1BDO A;  2A68 D;  1DD2 A;  3PV0 A;  2BE5 C;  3I72 A;  3WDN A;  2O5I C;  1FYC A;  1CTM A;  1Q90 A;  2A6E C;  1DCZ A;  2AUJ D;  3ND8 A;  3A8I E;  2A69 D;  3GQB A;  4TKO B;  3T51 B;  3U9S A;  2KA7 A;  4BA2 I;  2D5D A;  3MXU A;  1Q12 A;  5KND A;  1Z6H A;  1ZKO A;  3A8K E;  2PNR C;  2V4D A;  2E75 C;  2K33 A;  4G7Z C;  4RCN A;  3M7N A;  2DNE A;  1T5E A;  4G7O C;  1O78 A;  4G7H C;  2E76 C;  4KI0 A;  5BN4 A;  4H13 C;  1K8M A;  2B8G A;  5K36 H;  1LAB A;  3A7L A;  1IW7 D;  1H9S A;  3NE5 B;  2AUK A;  2BA0 A;  1GUG A;  2O5J C;  3QG1 A;  2DNC A;  5C0X G;  1TU2 B;  1H9J A;  2JEB I;  3AB9 A;  4KKS A;  2EVB A;  2LMC B;  3A7A B;  3BG3 A;  4XIG S;  1GUS A;  1LAC A;  2B8F A;  1GHJ A;  2YYZ A;  1Y8O B;  3PUY A;  4LK1 C;  3VR5 A;  5JEA G;  4GZY C;  1GHK A;  1GUN A;  3M4Y A;  3MFY A;  3M85 A;  3CRK C;  4IQZ A;  4L8J A;  1VF7 A;  2JXM B;  4OGQ C;  4DK0 A;  1OXT A;  1ZYR C;  1H9K A;  2CW0 C;  3W3A A;  4IFD G;  2JE6 I;  5BN3 A;  2Q8I B;  2AWO A;  2BDO A;  1IYV A;  1VDZ A;  1HPC A;  1B9M A;  1HQM C;  1Y8P B;  1H9R A;  3PUX A;  1DXM A;  1Q1E A; 
#chains in the Genus database with same CATH topology
 1PTO F;  3KF8 B;  2BE5 D;  3I73 A;  3HOZ B;  1BO0 A;  3TP7 A;  3G6E A;  4Q5V A;  4IPG A;  1YVC A;  4NXM L;  5JAV A;  4K5V A;  1HHV A;  2UXB Q;  2EQS A;  2WKC A;  2K75 A;  1LTR D;  2RBM A;  2E2I B;  2EXZ A;  1EIG A;  3EBE A;  5JEA H;  5JJK A;  3IFT A;  4A3I H;  3D4R A;  3DM1 A;  4RGO S;  3OW7 A;  4JCV E;  1XNQ Q;  3VR6 A;  4DV4 Q;  1G8Z D;  1LT6 D;  3U50 C;  1TS3 A;  4KN7 C;  1KIX A;  1FJG Q;  1SJE D;  3Q22 A;  1HR0 Q;  1MHW C;  2MJ8 A;  2DJG C;  2XSC A;  3PMF A;  2NN6 I;  3KLR A;  4H0L C;  3K57 A;  4ZKC B;  4DNR B;  1OXX K;  2R7Z B;  4LJZ C;  4CKB A;  1HZB A;  1N32 L;  2L5T A;  1S5F D;  1VQP A;  4OX9 Q;  1X9N A;  2WAQ B;  2L0C A;  2RDH A;  3Q8D A;  1C9O A;  3GTP B;  3WWV A;  1SFO H;  2TMP A;  4B3S Q;  3S2D B;  4IO9 A;  4X65 Q;  1VQK A;  4A3G B;  4K2L A;  3A54 A;  3ND8 A;  2NBF A;  1L2F A;  4K6L A;  2XWB B;  4CKC A;  5KYL A;  4JI2 Q;  1VQA A;  4CHT B;  5E4X A;  1EOT A;  3UE1 A;  1C0A A;  4A3D B;  2QKI C;  1I4Q A;  3DWQ A;  3S1R H;  4L5R C;  3CPW A;  4UY8 C;  3CCU A;  2UU9 L;  1JWU D;  5FKA C;  5GRO A;  4JBJ A;  4C3H B;  4OIK A;  2O5J C;  5C0X I;  1RTO A;  2K52 A;  1X56 A;  3M9B A;  3M4Q A;  2LMC B;  4F8M A;  3CC4 A;  1WTX A;  4R4I A;  2OQ0 A;  2B8F A;  2M00 A;  1PZK D;  1STB A;  1CK1 A;  4UDU C;  2WB1 E;  3HKZ E;  3DHQ A;  3MFY A;  1ZYR C;  2JA6 H;  1PH9 A;  3NUC A;  1IYJ B;  1SMY D;  2Q8I B;  3DWA A;  4HJ5 A;  3QOJ A;  5EQ0 A;  3CC2 A;  1AW7 A;  1VQG A;  4LFA Q;  2D2C C;  4C2M H;  2KEN A;  5IYB G;  4A3C G;  5EJW A;  4F7X A;  1PYB A;  4BS9 A;  1FNU A;  1D5M C;  5C3E G;  2A6E D;  2IHF A;  3NTH A;  4QUF A;  1HNW Q;  1F9Q A;  2EJM A;  5M5X B;  1GXD C;  3J81 j;  5IGG A;  1BCP C;  5ISR A;  3NPP A;  4U67 3;  1JIC A;  3BS1 A;  4BY7 G;  2D0P A;  4K2K A;  1HZC A;  2K03 A;  5EPL A;  4FXG C;  3VR4 A;  4LF8 Q;  1A62 A;  3R2T A;  3KOJ A;  1RIP A;  2LXK A;  5C6A A;  1M90 C;  1PZJ D;  4KHV A;  3SK4 A;  1JC7 A;  1HXY D;  1IBL Q;  2PPB C;  3NBH B;  1I50 B;  2Z0S A;  1NAP A;  1U4M A;  4CBV A;  1I4X A;  2ZT9 C;  2X6G A;  1L0W A;  3ICE A;  1CI3 M;  4ZLT F;  2JA8 B;  4O2D A;  3GD7 A;  1EIY B;  3LX0 A;  4DR4 L;  1CKN B;  4HIK A;  2ZM6 Q;  1W2B A;  1XYI A;  2EXD A;  2K5W A;  2A74 C;  1YJ9 A;  4BBS H;  1CQF A;  1PYW D;  2KCN A;  4X64 L;  5IE8 A;  1VQ9 A;  2A1A A;  4L5S A;  5K36 G;  4B3R Q;  3QB3 A;  2QGQ A;  5M3M H;  2NVX H;  1K73 C;  1X55 A;  3CD6 A;  1OXU A;  3H09 A;  1G2S A;  4HN7 A;  4DAY B;  4CDF C;  5IOC A;  1UE5 A;  3AEV A;  4RA8 A;  5CV5 A;  1O80 A;  2ZTD A;  4FF3 A;  4OON A;  2DJF C;  4R4T A;  1YJN A;  5KND A;  1NSN S;  1CKN A;  2V4D A;  4H7B A;  1LT3 D;  3OHX C;  2B2T C;  3M7N A;  2RHQ B;  1VQF A;  3FVQ A;  2R93 B;  1VQ4 A;  4R9W A;  2ZJQ A;  1WCM B;  2F0Q A;  1B3Q A;  4XT1 B;  1JJC B;  2F3I A;  1EY4 A;  4JVZ A;  4RWS C;  1PDQ A;  5JEA G;  2A8V A;  3S24 A;  4A3I G;  3GTK B;  2EYM A;  3KK7 A;  4PMC A;  2WAQ E;  1VF7 A;  1GOZ A;  4FVM A;  2VB3 X;  4A3J B;  1K8A C;  3GV6 A;  5LL6 S;  5AFW A;  1H9K A;  2E2J B;  2F0I A;  3W3A A;  4A3L H;  1U4P A;  2K5V A;  1QOH A;  3MEH A;  4IUN A;  4M8A A;  2HDL A;  4POG A;  3A8J E;  3S15 B;  4IN3 A;  4EQP A;  1S4Z A;  3E5S A;  3GTP H;  1KLU D;  1PFN A;  4EGV A;  2PMZ E;  4QIW B;  1TWG B;  1UUP A;  3MXG A;  5I9P A;  5C0X H;  3K59 A;  2WFW A;  2EYJ A;  2XVS A;  4AIM A;  4F87 A;  2XNA C;  4RHR A;  1M1K C;  1N33 Q;  1J5E Q;  1XMQ Q;  3RZO H;  1SMX A;  4A3D H;  4DUZ Q;  2M2L A;  3SVM A;  2MNA A;  2F0V A;  3QO2 A;  1C48 A;  3PGZ A;  1WTO A;  3D31 A;  2IWH A;  2CHB D;  1MKH A;  2C9O A;  1E2W A;  3S1N B;  3F8T A;  5D14 A;  3H3V I;  4KV6 A;  1LTA D;  2G5D A;  3PCO B;  1YHA A;  1CA6 A;  4YY3 Q;  2JA5 H;  4DK1 A;  4JI4 Q;  2F0F A;  3G4S A;  1SYG A;  4AH6 A;  3DEO A;  3U4Z A;  3S16 B;  4B3T L;  1I4G A;  4X62 L;  1CHQ D;  3AFP A;  3WDN A;  1QVF A;  5TSS A;  1CTM A;  3BZC A;  4WRD A;  4DUY Q;  1K9M C;  2JA6 G;  2L9H A;  4PQX A;  3ULP A;  4EX5 A;  1YBY A;  3TP8 A;  4EQN A;  4IZ8 A;  1EU4 A;  2E5L Q;  3KJP A;  2VB2 X;  1PTO C;  2X69 A;  2WB1 G;  3HKZ G;  4LAA A;  1KQS A;  4QL5 A;  1O78 A;  4X66 Q;  2I07 B;  4DF7 A;  1BF4 A;  1VQE A;  2PI2 A;  2R7F A;  4LUV A;  1VS0 A;  1K8M A;  3NHH A;  2OT2 A;  4K5X A;  4A3F H;  3OWE B;  1R9T H;  2ATW A;  1XJV A;  1AN8 A;  4WJW A;  4LF4 L;  1UAP A;  4DV0 L;  1HA6 A;  1GVP A;  1YHQ A;  2MGS A;  1A2T A;  2XN9 C;  3VYS A;  1HH2 P;  2MFI A;  4IJL A;  1PA6 A;  1S5D D;  1K0S A;  4GNX B;  3VYT A;  3NQI A;  1FNW A;  2H1E A;  1S5E D;  3I90 A;  2XRQ D;  2VQE Q;  1QVG A;  4JI6 Q;  5M3F B;  1HQM C;  1KNE A;  3TBI B;  1HNZ Q;  4CJ0 B;  4RCO A;  4BBS G;  3AFQ A;  4IOC A;  5M3M G;  4ALP A;  3D0F A;  3CCJ A;  2NZH A;  4DR6 Q;  1HUM A;  1LT5 D;  4DK6 C;  3FMC A;  5H1S E;  5T1G A;  4DU9 A;  3RMH A;  1XNR L;  1ENF A;  2YTV A;  1X3G A;  3RUZ A;  2BOS A;  3H0G B;  4HAE A;  2KEE A;  1ML0 D;  2EDG A;  3P75 A;  4LWC A;  2UUC L;  2A5H A;  4KJN A;  4UP7 A;  2BA1 A;  4ZKB B;  2J0T D;  2ID0 A;  4A4I A;  2F0S A;  5D3I B;  1BUV T;  2L12 A;  1JE5 A;  1WTQ A;  1K83 B;  1ZYR D;  4HIM A;  2AHO B;  4ID6 A;  3Q24 A;  2F0T A;  3NEN A;  2PZT A;  4DV1 Q;  1H9S B;  4CDC C;  1JOR A;  1I6V C;  1RCV D;  2R3Z A;  4S3S A;  2E2J H;  2SNM A;  4C3I H;  5JVG 3;  2SEB D;  4K5W A;  5C5M A;  4GLV B;  5E7N A;  2E2H B;  2PW7 A;  1BCP D;  1OTC A;  4KHP L;  4A3L G;  4BA2 I;  2K6A A;  3S15 H;  1PFS A;  3TZD A;  2HHH L;  1YJW A;  1B2T A;  3E0E A;  4FO2 A;  2SDF A;  1EYG A;  3AU7 A;  1W3S A;  3BDC A;  1O7I A;  3M4O B;  2UUA Q;  2E76 C;  2WAQ G;  1EQQ A;  1TWG H;  1A3T A;  4JW0 A;  4C1N K;  3RZD H;  4JBK A;  4K8I A;  4NXN Q;  2B8G A;  5CC4 A;  5GAG C;  1WI5 A;  1H9S A;  1VQL A;  2UXD Q;  4Y7N B;  3ONA B;  3M4P A;  5C0X G;  3GTG B;  1HFG A;  3J7Y W;  1F9S A;  1UEB A;  2G9D A;  4QQB X;  4Y52 H;  3W5O A;  2PI2 E;  5FO7 B;  4P75 A;  3G7L A;  4IPD A;  1EY9 A;  3ITP A;  4GLX A;  1DYQ A;  4A3D G;  5EGT A;  1V1P A;  4HTH A;  1ENA A;  3S1N H;  1LV9 A;  5IY0 A;  3M3Y B;  4IUV A;  4KKU A;  3L0O A;  5C4Z A;  1SN8 A;  3HFZ B;  5IP9 H;  1F9R A;  1JMC A;  1A2U A;  1QJO A;  1NMG A;  1G91 A;  3SEB A;  4JI7 L;  1KHI A;  2FJ2 A;  3GV3 A;  3HP3 A;  1A0I A;  2JA5 G;  3S16 H;  4NP5 A;  4JI5 Q;  5IIF A;  4GOP A;  4V0B A;  3QJY A;  1ROD A;  2UUB L;  1YIJ A;  5GAH C;  2F3W A;  1EU3 A;  5CV4 A;  2EY1 A;  4RHS A;  4A3B B;  3LNN A;  2N8N A;  4HID A;  2ENB A;  1QUQ B;  1LM0 A;  1KDC A;  3QWN A;  2F4V L;  4FXK C;  4OL7 A;  4DR5 Q;  3S17 B;  1PH2 A;  3T1Y Q;  4DNI A;  4GKJ L;  2TSS A;  3OPO A;  1EZ8 A;  4DV7 Q;  2YV5 A;  2ZJP A;  4GOP C;  1IZ6 A;  1IBM L;  4RGT A;  4DAP A;  1E0B A;  1K3R A;  2JP1 A;  2KQ3 A;  5EKK A;  1FL0 A;  3E9H A;  4A3F G;  4L6T B;  4A76 A;  3RLF A;  2EYF A;  1MGS A;  4DR7 Q;  4A3K H;  3KYH C;  5IGD A;  4FF1 A;  4R4O A;  1ZXT A;  4RG1 A;  1MIU A;  2UXC Q;  1F2Z A;  5M3F H;  1EFI D;  3G48 A;  3GQB A;  2PW5 A;  3FHW A;  4DGZ A;  4LF9 Q;  1QZH A;  1LTB D;  3PIO A;  2FMC A;  2I5H A;  3EJI A;  2DGY A;  2K5N A;  1S5B D;  1KAA A;  1EQT A;  3KF6 B;  4DV2 L;  2K5H A;  1A15 A;  2RDG A;  3G71 A;  4AYB B;  1PH7 A;  3NTI A;  1CHP D;  2PO4 A;  3T4A C;  4HIO A;  1GUG A;  4BBR H;  2DNC A;  4X6A H;  2JEB I;  4L5T A;  5LMU Q;  1IBK L;  2YU9 B;  4AQY L;  1GHK A;  4YIJ A;  4RMF A;  3M4Y A;  4I65 A;  1MJE A;  2E2D C;  4IQZ A;  1AZP A;  3P1H A;  4OGQ C;  5AJ3 Q;  1KAB A;  2F0W A;  1N34 L;  1HUN A;  2F0O A;  2IY5 B;  1JOO A;  2LSS A;  2AWO A;  1A8V A;  1HPC A;  3DM3 A;  1K83 H;  3HRZ C;  4DV6 Q;  3S14 H;  1SYE A;  3KF6 A;  3M7G A;  1FR3 A;  1F9P A;  2NVQ B;  3HOW B;  2A68 C;  4JI3 Q;  4CDE C;  1QE6 A;  5J3B A;  2WV6 D;  4ZRZ A;  2RKS A;  1YHB A;  2DY7 A;  1VQ8 A;  4NPS A;  1FVI A;  3ERO A;  2ZJR A;  1TII D;  2OXP A;  3H94 A;  1PTO D;  3CCL A;  3AQQ A;  1FGB D;  4C3I G;  1BVS A;  1HZA A;  3CCM A;  2EYH A;  2PCF B;  5KIX A;  4A93 B;  3OSO A;  3QR8 A;  5BN5 A;  1RKN A;  3K6O A;  2UXB L;  4ZYS A;  5KGU A;  3M4O H;  1EY8 A;  1EEF D;  2P5Z X;  1PRT B;  3NXW A;  1Y8N B;  4IOA A;  3ERS X;  1W6K A;  5DNF A;  1XNQ L;  1TWH B;  2E8G A;  3GTG H;  2HCC A;  4DV4 L;  3HOX H;  3RLN A;  1BKB A;  4XQJ A;  1IHZ A;  1IYU A;  3EA6 A;  2L55 A;  3VR2 A;  1FJG L;  3T13 A;  1HR0 L;  4DR1 Q;  1TWA H;  4NW2 A;  2QW7 A;  5EPJ A;  4X3T A;  3N52 A;  1PH6 A;  2QA4 A;  1K8G A;  2F0L A;  4DXG A;  1SRO A;  4OX9 L;  3KF8 A;  3GTL B;  3M3Y H;  2G9H D;  3TSS A;  1EY5 A;  2H5X A;  5ELC A;  5IGC A;  5C4J B;  5DM6 3;  1JB7 A;  4B3S L;  3I4N B;  1GUW A;  4X65 L;  4G7Z C;  3E3X A;  5DAU A;  1TWF H;  5IP9 G;  4H13 C;  4JI0 Q;  5LL6 X;  4JI2 L;  5FJ8 H;  3A74 A;  5LMN W;  3NE5 B;  5C44 H;  4GLA C;  3Q6S A;  3WOE A;  4KKS A;  2WP8 J;  3HOY B;  3PO2 B;  1GHJ A;  1QIL A;  5FO8 B;  4IFD J;  4R4Q A;  3FP9 A;  2QEX A;  2F0G A;  4OWW B;  1KDB A;  4OEM B;  5I4D A;  1ESR A;  3S17 H;  2NVT B;  4G4K A;  2K14 A;  5IWA Q;  2C5C A;  4YHH Q;  3V96 A;  1WTW A;  1Y1W B;  1B9M A;  1LO5 D;  3T51 B;  1Q1E A;  1E24 A;  1T9H A;  2A6H C;  1HQR D;  4FDB A;  1T5X D;  1E1T A;  3K5O A;  3OYY A;  2CH4 W;  4LF5 Q;  4A3M H;  4A3K G;  3KBX A;  2VUM H;  4LFA L;  4NDX A;  1GUT A;  4XQN A;  1RJT A;  3VA5 A;  3RR5 A;  3KLS A;  4PMB A;  1AEX A;  3L3O C;  5IYD H;  5JPM C;  2VY3 A;  3SDZ A;  1HNW L;  2MO1 A;  5M3F G;  4A3E B;  4QF4 A;  1VCI A;  2JEA I;  3I8Z A;  1Y1V H;  2HD3 A;  3FRP B;  4JI1 Q;  3ZJY C;  1SNO A;  4GN4 B;  4LF8 L;  2Y0S B;  4RGN A;  3N6R A;  4IPC A;  4CJ1 B;  5GAE C;  1F2Y A;  3NQT A;  1IBL L;  4TQU S;  2JSO A;  2Q2I A;  4K14 A;  3GTM H;  2FHT A;  1WVL A;  4JI8 Q;  3U9O A;  3S1M H;  1EYC A;  1O7Y A;  4KTA A;  4BBR G;  2F1M A;  2I0Q A;  5LMN Q;  3CRL C;  4K0K Q;  3MTS A;  2ICE C;  2ZM6 L;  1BDO A;  2XRS D;  1MSG A;  1Q90 A;  4B3R L;  3CC7 A;  2A69 D;  4TKO B;  4O1N A;  3U9S A;  1ET6 A;  4BXX H;  2NVQ H;  3HOW H;  1B44 D;  5EBD A;  3BYT B;  1KLG D;  3D6W A;  2QIL A;  2FXQ A;  1TWC B;  2JA7 H;  2JJQ A;  1YNX A;  5IYC H;  3KDF B;  4BY1 H;  3GTJ B;  1N36 Q;  2V1C C;  3NBH A;  3ERQ A;  5M5Y H;  3F2C A;  4LFC Q;  2VNU D;  1WFQ A;  1KDA A;  2K50 A;  1K0R A;  3HOZ H;  4YWM A;  4JYA Q;  3UE0 A;  1FNV A;  3ER0 A;  3ULJ A;  2QDL A;  4B3M Q;  1HZ9 A;  3S1Q B;  5COR A;  1W6J A;  4R8I A;  2ASB A;  2PNR C;  1TWH H;  2Z4I A;  4ZUJ A;  5D65 A;  3PO3 B;  4IUQ A;  4OEL B;  3K80 C;  2E2I H;  5FLX c;  1A6X A;  3SGI A;  3KDF A;  3HOV B;  3HOX G;  5ELF A;  5ELD A;  4DAY A;  1SE4 A;  1SNQ A;  3CPF A;  1WD1 A;  1CT1 D;  1I94 Q;  2YTY A;  3JAM c;  1SLJ A;  3GTL H;  3C1E A;  3PUW A;  1YIT A;  2I5M X;  3CF5 A;  5C4X B;  2BDN A;  2K5Q A;  3S2H B;  1I5F A;  2R7Z H;  3K5M A;  1PYS B;  5IT9 L;  5FOB B;  1HTL D;  1EZ6 A;  4DR3 Q;  2IPK D;  3I56 A;  3L9A X;  5KRU A;  4E6I A;  1Y69 U;  4P73 A;  1AFP A;  4MIU A;  1LTG D;  4O42 A;  2EJF C;  4J8Q A;  3VYU A;  4N8X 1;  1V9P A;  2NTT A;  1Q8K A;  3S2D H;  1J5E L;  3C3L A;  3J7Z C;  4UHV A;  1LTI D;  1XMQ L;  1Q8I A;  5FJ8 G;  4PZ6 A;  2OEO A;  4DUZ L;  4DV3 Q;  4A3G H;  1Q46 A;  1QZG A;  1ZEQ X;  1OXV A;  2F0H A;  5C44 G;  5FO9 B;  3KFU A;  3EIV A;  3BVZ A;  3DXJ C;  5DM7 3;  1GO3 E;  2R7D A;  5IGE A;  4NMZ A;  1D6E C;  1DON A;  2DUD A;  2A68 D;  1XXG A;  5IT9 c;  1V1O A;  3K58 A;  3PV0 A;  2B2U A;  2JA9 A;  2H4O A;  1Y1W H;  3TQY A;  3BZK A;  3JAM i;  2F0M A;  3TS2 A;  4YY3 L;  3TP6 A;  4JI4 L;  2IX0 A;  2F52 A;  2DY8 A;  4C3H H;  1Z6H A;  2K04 A;  4HJ9 A;  1VQ6 A;  1BBU A;  3NEM A;  4X3S A;  3I4O A;  2E75 C;  2JK8 A;  2KHI A;  1NR4 A;  1CSQ A;  3BVM A;  3SK5 A;  4DUY L;  1TQO A;  2MQH A;  3TRZ A;  2B2U C;  5DLQ E;  4XXE A;  4A3M G;  2EZV A;  4N9T A;  1LAB A;  2E5L L;  4Z9C B;  2Y0S E;  2VUM G;  4LFB Q;  1IKL A;  1U9R A;  4PMW A;  1CKM A;  1H9J A;  1X3F A;  1XWE A;  3MC0 B;  1FD7 D;  1VQD A;  2FIN B;  4XIG S;  4X66 L;  1LAC A;  1Y8O B;  3FKI B;  5IYD G;  1LUZ A;  5M5W B;  3RN2 A;  1SYF A;  4UPA A;  3HZX A;  4QCL A;  3DEP A;  5BR8 Q;  1BBW A;  1OXT A;  3B6Y A;  3QOL A;  1SND A;  2Z8L A;  5M5X H;  3J80 c;  4LF7 L;  4FYD A;  1Y1V G;  3PF4 A;  1VQ7 A;  1NR2 A;  3LGJ A;  3VR3 A;  4K6D A;  1KAW A;  1QVC A;  1V1Q A;  1CQV A;  5NUC A;  4J1M A;  3MAQ A;  3SE0 A;  2PQE A;  4F88 A;  3K5L A;  4YCV A;  2XIW A;  2RDF A;  1HCZ A;  4J6H A;  3R3O A;  1PH3 A;  2EE1 A;  1MI2 A;  4PV1 C;  1I50 H;  1ASY A;  4JI6 L;  2KBN A;  4HJ8 A;  3RLO A;  3HOU B;  4OIJ A;  2N49 A;  1HNZ L;  4DNT B;  3O13 A;  2JA8 H;  4X3K A;  4CKE A;  3K0X A;  5EKI A;  3NK9 A;  4JV5 Q;  1RTN A;  1B9N A;  3URY A;  4LF6 Q;  4BXX G;  4DR6 L;  3HOW G;  1VQC A;  5IOD A;  3MEF A;  4PNY A;  1HTP A;  1P8L A;  3CMA A;  3HEJ A;  4GN3 B;  1GM5 A;  1EWI A;  1TWC H;  2XWJ B;  3VA7 A;  3J80 i;  4FNF A;  3EN2 A;  2N78 A;  3GTJ H;  2JA7 G;  4OO1 H;  1PFM A;  5JVH 3;  4DV0 Q;  1CFM A;  5IYC G;  2L4N A;  2RSN A;  2A73 B;  4BY1 G;  1Z7T A;  3U4V A;  1PRT F;  1SEB D;  3FPP A;  4NKL A;  4K8J A;  2IHE A;  2KED A;  4GNX A;  4P2C B;  1EYD A;  3MXN B;  2A6H D;  1I6H B;  1KXL A;  1DGS A;  1DD2 A;  5J22 A;  2LY7 A;  2NZO A;  5FK9 C;  3J7A V;  3W1G A;  1FYC A;  3HOZ G;  1VQJ A;  1HRJ A;  2R93 H;  1E22 A;  1WCM H;  1QWY A;  2QDB A;  4DV1 L;  3PO3 H;  4BY7 B;  1EEI D;  2J4X A;  1VMP A;  1D2B A;  2OF1 A;  1Q82 C;  4GNX C;  1JCK B;  5I2X A;  1I4H A;  1SNM A;  5EBC A;  4ZQ3 A;  1SYB A;  1IL8 A;  3GTK H;  5IGF A;  4A3J H;  2K1B A;  3MXN A;  2KVM A;  4IUR A;  5CR3 A;  3BG3 A;  1STY A;  4QIW E;  1EQV A;  5C4X H;  5IGB A;  5E4W C;  3CKI B;  2CWA A;  1DJR D;  4GZY C;  3I70 A;  2UUA L;  1BQQ T;  5I2Y A;  3GO5 A;  4NXN L;  3K81 C;  3CRK C;  4OXP A;  2VQF Q;  4DK0 A;  2R7Z G;  4MTK A;  2UXD L;  4N8F A;  1NY4 A;  1SR3 A;  1F2L A;  2K5D A;  2CW0 C;  3R2I A;  3J81 c;  1IYV A;  1Y8P B;  4DV5 L;  1AE2 A;  4IUP A;  2HCI A;  4KD3 A;  4HMJ A;  1KL9 A;  5HY6 A;  1XMO Q;  2CQA A;  1KRT A;  3PUZ A;  4A3G G;  1WTV A;  3PUV A;  4LUO A;  1ILP A;  1JT8 A;  1VQI A;  3I4M B;  1NBW A;  3I3C A;  2N3S A;  1CSP A;  4HED A;  1GJX A;  5KEE A;  3STB C;  1Y14 B;  2EY2 A;  1C7Y A;  2K28 A;  4KHP Q;  2AMC B;  2RQX A;  4R4C A;  5J1Z A;  4DN4 M;  1Y1W G;  2HHH Q;  1NMF A;  3K8A A;  3TP5 A;  3PSI A;  3L2P A;  2Q8T A;  2K05 A;  2BH8 A;  3QIA A;  4C3H G;  1HNX Q;  4IFD H;  3VYR A;  1PXU A;  1XX8 A;  3P20 A;  5G3L D;  1MSH A;  1UE1 A;  1TKW B;  4H44 C;  5C4H A;  2ZXO A;  3J81 i;  1TXY A;  4A3I B;  1ONL A;  1UNS A;  2A69 C;  2JN4 A;  1GKH A;  1B8A A;  2NYZ D;  2QEJ C;  2KCC A;  3CQZ B;  5G3L F;  1B3A A;  5CBA E;  1C4Q A;  1X65 A;  3FKI H;  4DR5 L;  5I6W A;  4H02 A;  1YI2 A;  3NEL A;  3T1Y L;  3F1Z A;  5T1I A;  4DV7 L;  4M1U B;  1U0L A;  1WTP A;  3RD4 A;  1EOV A;  2Z6K A;  1PFB A;  1Q7Y C;  4RAU C;  4DR7 L;  1U5K A;  2Y0S G;  5HGT A;  2RF4 A;  4YCU A;  2WKD A;  3T1H Q;  5I6Y A;  3MXU A;  5JPN C;  1SFO B;  1WTH A;  5HUR A;  2UXC L;  1L1O B;  3HOU H;  4P72 A;  1X6O A;  1AH9 A;  2Z6K C;  2IL8 A;  2EYP A;  3CXC A;  2UUB Q;  3UDI A;  1STH A;  2OWO A;  5CBE E;  2JA8 G;  3CAM A;  1QUQ A;  3S1R B;  3AMU A;  1EWC A;  3SXH A;  3IRB A;  3CHB D;  1CZW A;  2F4V Q;  2PZW A;  1F2M A;  2PQA B;  4EQ5 A;  1EY0 A;  1ICW A;  3C2P A;  1RDP D;  5LMU L;  2BDO A;  4KI0 A;  1HFN A;  2KUM A;  1RHP A;  2OTL A;  3HGB A;  5CYU A;  3SHL A;  4OO1 G;  2RCN A;  1RD9 D;  1A3U A;  3CU7 A;  4GKK Q;  2R92 B;  4B9W A;  1NTG A;  4B08 A;  3H0G H;  4C2M B;  2L1B A;  4DV6 L;  1PH4 A;  3T56 B;  1XPO A;  3OIQ A;  1GUO A;  2LFN A;  2WB1 B;  3HKZ B;  1B70 B;  2HQE A;  4JI3 L;  4XQQ A;  4HR7 B;  4DR2 Q;  4A75 A;  2F0N A;  4KY5 A;  2R93 G;  4R1J A;  1WCM G;  2ZTE A;  4KN4 C;  1N9W A;  5A2Q E;  3PO3 G;  2CCZ A;  5IP7 H;  3R8B A;  1IW7 C;  3D8G A;  2F0E A;  2JYO A;  3E0J A;  3K7A B;  4IPH A;  4I7Z C;  3CCE A;  1V43 A;  3FPU B;  1TT2 A;  3OW2 A;  1OO9 B;  3EQL C;  3OMG A;  3MXP A;  4QB4 A;  4A3J G;  4AQY Q;  4IUT A;  2E2H H;  2OCE A;  1STN A;  5KYI A;  3EFX D;  5C4X G;  1AZQ A;  4KLK A;  1SDF A;  1R4Q B;  2EIF A;  4G57 A;  4BBS B;  2O5I C;  1A3V A;  1VMC A;  1DCZ A;  2A19 A;  2PZU A;  2HUG A;  5M3M B;  3NWT A;  2NVX B;  3A8I E;  1IKM A;  1A63 A;  1X54 A;  2D5D A;  3H15 A;  5EPK A;  3J7A F;  4DR1 L;  4Y7N H;  4P74 A;  3NBI A;  4RCN A;  5GQO A;  2CVR A;  1JJG A;  5BN4 A;  1ASZ A;  3GTO B;  3I4M H;  4JBM A;  3TEH B;  1TY2 A;  3OTO Q;  3BU2 A;  2EVB A;  5A2Q L;  1DZ1 A;  1EYA A;  2F3V A;  4L5Q A;  2M9V A;  5CGK A;  4JI0 L;  3MWY W;  1TS4 A;  3M85 A;  4L8J A;  3CCV A;  1M8A A;  4L63 B;  4NXM Q;  4IFD G;  2JE6 I;  4YWK A;  1TR5 A;  3WOF A;  3K7U C;  3DWP A;  1V8Q A;  3CQZ H;  1O7L A;  1ESF A;  4BA1 I;  2VS1 A;  1WTR A;  2KHJ A;  2KOL A;  5IWA L;  1K8O A;  2VL6 A;  4YHH L;  1ICF B;  4A3B H;  3FKI G;  2Q2H A;  1EUJ A;  1PRT C;  3BVG A;  3SK8 A;  4APV A;  4C56 C;  2DN8 A;  4ILW A;  1WYD A;  2QF7 A;  1YNN C;  2J7Z A;  3OOC A;  1Z47 A;  1CM9 A;  4RKL A;  1JR0 D;  4KKT A;  1Q1B A;  1MJC A;  4LF5 L;  1VQN A;  3H91 A;  3W1B A;  1H9M A;  1G29 1;  4Q0F A;  3J7A 5;  3A55 A;  3FDT A;  1N32 Q;  2EYL A;  3MZ5 A;  3A56 A;  4HSV A;  1KTK A;  1QG7 A;  2B2V A;  1TS2 A;  1BCP B;  3IAY A;  1IL2 A;  3HOU G;  1J9O A;  3RZO B;  2PMZ B;  2CW0 D;  5C5L A;  4AYB E;  4JI1 L;  2R6G A;  3PQI A;  1QNU A;  2OQK A;  2B63 B;  4FF4 A;  1SAP A;  3BDL A;  5FLX E;  3NP8 A;  4DAV A;  1L0Y B;  3JC6 6;  2B2V C;  4JI8 L;  5E1F A;  3PIO 3;  2AUJ D;  2IJ0 A;  5CV8 A;  3K0Y A;  3D4D A;  1E7Z A;  3BJU A;  1B1Z A;  2UU9 Q;  2F0U A;  2JA5 B;  1SYD A;  1DOL A;  4JC0 A;  2NB0 A;  2KA7 A;  5LMN L;  3JAM E;  4K0K L;  1KD1 C;  1ZKO A;  4QY7 A;  2WII B;  3STB D;  1BNZ A;  2RA4 A;  3IL8 A;  3D6C A;  2O2L D;  2FMM A;  3PF5 A;  2ES2 A;  4MNO A;  2VZA A;  2R92 H;  2YU9 H;  4HJ7 A;  1YNJ D;  5E3F A;  1NUC A;  1JE4 A;  3A5U A;  5DEH A;  4O0A A;  2BA0 A;  3H0G G;  1WJJ A;  4MTN A;  3F2B A;  2Q2U A;  2QCP X;  3AB9 A;  2FFK B;  5JJI A;  4HMI A;  4PG3 A;  2B2W A;  2F0D A;  3CW2 C;  3I2Z A;  5F2D A;  3Q0A A;  1SE3 A;  2KEC A;  3TN2 A;  4A3F B;  3K7A H;  1NCV A;  1R9T B;  2MPM A;  1N36 L;  5IP7 G;  1B7Y B;  1F77 A;  4P71 A;  4DXF A;  5IT9 E;  3BDO A;  4LFC L;  4HJA A;  3VR5 A;  1G6Z A;  2NVY B;  1CA5 A;  4JYA L;  3F2U A;  4JBW A;  2B2W C;  4XTC S;  3U58 A;  5FLX L;  4B3M L;  1MD2 D;  2CKZ B;  4DA2 A;  2KCT A;  5KNC A;  4A93 H;  3ND9 A;  3NSW A;  1YEZ A;  1PH1 A;  4JOI A;  1U4R A;  1Q3L A;  4OHJ A;  1X32 A;  4PZ7 A;  3JAM L;  2ZXR A;  1UEA B;  5ELO A;  3V05 A;  4DR4 Q;  1I3Q B;  2B2T A;  4LW1 A;  5ELB A;  4JK1 C;  4WJ3 M;  4X64 Q;  1XPU A;  1EWH A;  5KNB A;  1I94 L;  4OO1 I;  2ICI A;  2HDM A;  4UP8 A;  3GTO H;  2KJX A;  1D5Z C;  3W2D A;  4JOI C;  2MUY A;  5CV6 A;  3J80 E;  3I4M G;  1PH8 A;  1E2V A;  3LWU A;  4DFA A;  4DR3 L;  1E1O A;  4V19 0;  5C3W A;  2BH2 A;  2NN6 H;  1STA A;  2MP1 A;  4C3J B;  2RVL A;  2AKW B;  1VF5 C;  5C4J H;  4HSP A;  5JOB A;  3I4N H;  3UI2 A;  3I72 A;  3FEW X;  2LXJ A;  1G51 A;  4PZ8 A;  4DV3 L;  1AE3 A;  2CFM A;  1LLR D;  1VQB A;  3MFG A;  1I4P A;  3CCS A;  2PNH A;  1UE7 A;  1K28 A;  1Q12 A;  1N33 L;  1Q81 C;  3G6J B;  2N55 A;  1O7Z A;  3HOY H;  3GP7 A;  4C3I B;  1XTD A;  1PH5 A;  1D8L A;  3E9I A;  1T5E A;  5M9O A;  3PIP A;  3PO2 H;  1EL0 A;  1EFW A;  2F03 A;  1X3Q A;  5JEA J;  2VXW A;  4A3B G;  1IW7 D;  2KCM A;  2AQ2 B;  2AUK A;  2C35 B;  2NVT H;  3QG1 A;  1TU2 B;  2Z1C A;  4TVA B;  3A7A B;  1PLF A;  3KLS X;  1S40 A;  1GUS A;  1PHJ A;  3PUY A;  1L0X B;  1DOK A;  4KY7 A;  2B2Y A;  5K5P A;  5HGQ A;  3RZD B;  1PTO B;  3Q23 A;  4EQO A;  4LFB L;  4JPB W;  1IXR A;  2AWN A;  1GD7 A;  5EKL A;  1X3P A;  3CCQ A;  1S3O A;  5ELN A;  3J80 L;  1LTL A;  4XT3 B;  2SNS A;  1FGU A;  2HIV A;  4C1N I;  1G6P A;  2PYK A;  5I9O A;  5BR8 L;  3T53 B;  1BOS A;  1SSO A;  3HS0 C;  5A35 A;  1STE A;  2CQO A;  2B2Y C;  4J15 A;  2B63 H;  4A3E H;  1BBX C;  5FLM H;  3H6M A;  1VQ5 A;  1M4V A;  2EOT A;  3ZYY X;  4IFD I;  4HCS A;  1UWV A;  4WOR A;  5J39 A;  2GVA A;  2K32 A;  4AYB G;  2F4I A;  4ME3 A;  4YCW A;  1Q86 C;  1RF2 D;  4FXD A;  1NNX A;  2HIX A;  1SE8 A;  2K7V A;  4JV5 L;  1BXT A;  1II3 A;  4KHZ A;  5C3X A;  2R92 G;  1SXT A;  2VQE L;  4B3T Q;  1P16 A;  3C1F A;  2KHS A;  4X62 Q;  3H3V C;  3J81 E;  4LF6 L;  3OMC A;  3RN5 A;  1TS5 A;  2O4X A;  3L7Z C;  1I4R A;  1CUK A;  5COY A;  4U68 A;  3MA2 B;  5JJL A;  4HCE A;  4X3U A;  2BE5 C;  4LF7 Q;  4IUU A;  4ME5 A;  2B39 A;  2LS0 1;  3I91 A;  1LT4 D;  4A3K B;  1PRT D;  4CJ2 C;  2NVY H;  1Z9F A;  1YNN D;  4LMQ D;  1VQM A;  3A8K E;  4LF4 Q;  2NTS A;  2K33 A;  2RSO A;  2F0K A;  3LWE A;  4XDX A;  1D1I A;  2VW9 A;  2IW3 A;  5D3D A;  2DNE A;  3P7J A;  1JOK A;  1NJI C;  1B53 A;  2RCF A;  2Q2T A;  1SNP A;  3A7L A;  5C3E B;  3TDQ A;  4A93 G;  2D9U A;  2WIN B;  1I3Q H;  4WJ4 A;  5CV9 A;  4KJO A;  3HKS A;  3S1Q H;  3UDX A;  4DAM A;  4XYO A;  1ET9 A;  4GS3 A;  2X6L A;  2AQ3 B;  3GTQ B;  1WOC A;  3DMU A;  4LNQ A;  3NTK A;  3HOV H;  1J6Q A;  4BBR B;  3BZD B;  4ULL A;  1D1K A;  4KD4 A;  3J81 L;  2CWP A;  1JWS D;  3T16 A;  2ZTC A;  1EQR A;  4YWL A;  1KC8 C;  1EIH A;  2VQF L;  2N88 A;  2NUC A;  3DLL A;  1XNR Q;  2Q8R E;  4OWX B;  4C3J H;  2I46 A;  1JWM D;  4N9P A;  4ZCK A;  3S2H H;  1D5X C;  1SYC A;  2L11 A;  5LHY 1;  1SJH D;  3S14 B;  2NN6 G;  5JJZ A;  2UUC Q;  1ENC A;  1E2Z A;  1VQO A;  4MZ9 A;  2IX1 A;  3I4N G;  2EYO A;  2ZXP A;  1BR9 A;  4DK3 C;  1LYL A;  1J8I A;  1XMO L;  3TZU A;  4CGY B;  4KY6 A;  4B9X A;  1SNC A;  2SOB A;  3RNU A;  1PMR A;  1QB5 D;  2RHS B;  3OWF A;  1B4O A;  2I5L X;  1X3E A;  5L37 A;  2Z4H A;  4I7A A;  4R8N A;  2XGT A;  3F2D A;  5EAY A;  3HOY G;  3PIP 3;  1K3B C;  3PO2 G;  1V1P B;  2K4K A;  4RFB A;  1KRS A;  2NWG A;  1HNX L;  1C8C A;  1BCP F;  3EVQ A;  4TSS A;  1SMY C;  3H3V H;  2GA4 B;  1PTO H;  4WFN 3;  1CZG A;  1YNJ C;  1CKO A;  4JG2 A;  3GDE A;  3KBG A;  4JI5 L;  1WD0 A;  3E6Z X;  4BWG B;  1VQH A;  1S72 A;  2A6E C;  3HOX B;  3DUZ A;  3CCR A;  1G2T A;  4RGM A;  4DV5 Q;  4GOP B;  1JOQ A;  1DOM A;  1TWA B;  5ELE A;  1LTS D;  1DM0 B;  3UDF A;  2D0O A;  3D3R A;  4ZAI A;  1S5C D;  1B50 A;  5C0X J;  4XYQ A;  5M5W H;  4RH6 A;  2B63 G;  1AP0 A;  1H95 A;  3CME A;  3T1H L;  3VDY A;  4A3E G;  5FLM G;  5GAD C;  1E3P A;  2EPB A;  4TRD A;  1EY6 A;  1QNK A;  1XTC D;  4UAI A;  3KLW A;  4MHE A;  3D4W A;  2EY5 A;  1TWF B;  2AQ1 B;  1GUN A;  3BYY B;  2K01 A;  4MN3 A;  1D7Q A;  2LKV A;  1JB3 A;  5C44 B;  4KK7 A;  2NZ1 D;  2R61 A;  5BN3 A;  1SRU A;  4JI7 Q;  1STG A;  3I4L A;  1PV4 A;  2IT1 A;  4LF9 L;  3OIP A;  1PVO A;  4FP5 D;  5CMD A;  1JQY D;  4ZK9 B;  4NB3 A;  2E74 C;  3R93 A;  3S9W A;  3C46 A;  3KJO A;  3MVV A;  2B29 A;  2HT1 A;  1HA5 A;  4KMU C;  1XPR A;  1OXS C;  4QUC A;  4GKJ Q;  3AYH B;  2OTJ A;  4A3M B;  1IBM Q;  4GKK L;  4QJF A;  3UDG A;  4QGU A;  2VUM B;  3V2T A;  2B3G A;  1KNA A;  2GN5 A;  1L1O A;  2IX3 A;  2MHV A;  1RL2 A;  5AJ3 L;  2JA6 B;  5IYB H;  4DR2 L;  4A3C H;  3SK6 A;  1MBY A;  1U4L A;  1I6H H;  2D62 A;  5C3E H;  1R4P B;  1LTT D;  3A5Z B;  4RKB A;  3TME A;  4DPG A;  1EY7 A;  3IKJ A;  1Y1V B;  1SBB B;  2F0P A;  1TVX A;  1TY0 A;  4ABN A;  2PQA A;  3I7F A;  4BY7 H;  2CH4 A;  2EJG C;  1L1O C;  3X3M A;  3GTQ H;  2L15 A;  2EY6 A;  2HQL A;  1QCB D;  2Z6B A;  4EVO A;  3GTM B;  3TRE A;  4IJH A;  4UP9 A;  4DV2 Q;  3S1M B;  2MO0 A;  3HOV G;  1JJ2 A;  3HG9 A;  1HR0 W;  2YTX A;  3ULL A;  1IBK Q;  4G7O C;  4G7H C;  2GVB A;  4ZUI A;  2ALY B;  1SE2 A;  3A0J A;  4POF A;  4C3J G;  1HJP A;  4DKA C;  2Z9H A;  3NWS A;  5K36 H;  2BCO A;  1N34 Q;  4OWT B;  3K5N A;  2XTI A;  3MHB A;  4FF2 A;  4LUZ A;  1UE6 A;  4IAL A;  3TS0 A;  4GN5 A;  2JQO A;  1PZI D;  3CP0 A;  2YYZ A;  4LK1 C;  3I55 A;  3X3N A;  1YZ6 A;  4ODG A;  1NE3 A;  2JA7 B;  4BY1 B;  3SR1 A;  2JXM B;  5CV7 A;  3OTO L;  1N8R C;  3IFD A;  2WAC A;  3KUP A;  4QMG A;  4CDD C;  1VDZ A;  5M5Y B;  1EIF A;  2F0J A;  1H9R A;  1DXM A;  1ILQ A;  3PUX A; 
#chains in the Genus database with same CATH homology
 1PTO F;  2BE5 D;  3I73 A;  3HOZ B;  1BO0 A;  3TP7 A;  4Q5V A;  5JAV A;  4K5V A;  1HHV A;  2WKC A;  1LTR D;  2RBM A;  2E2I B;  2EXZ A;  1EIG A;  5JEA H;  3IFT A;  3D4R A;  3DM1 A;  4RGO S;  3OW7 A;  3VR6 A;  1G8Z D;  1LT6 D;  1TS3 A;  4KN7 C;  1SJE D;  3Q22 A;  2MJ8 A;  2XSC A;  3PMF A;  2NN6 I;  3KLR A;  4H0L C;  3K57 A;  4ZKC B;  4DNR B;  1OXX K;  2R7Z B;  4LJZ C;  4CKB A;  2L5T A;  1S5F D;  2WAQ B;  2L0C A;  2RDH A;  3GTP B;  2TMP A;  3S2D B;  4A3G B;  4K2L A;  3A54 A;  3ND8 A;  2NBF A;  4K6L A;  2XWB B;  4CKC A;  5KYL A;  4CHT B;  5E4X A;  1EOT A;  4A3D B;  2QKI C;  1I4Q A;  3DWQ A;  1JWU D;  5FKA C;  4C3H B;  4OIK A;  2O5J C;  5C0X I;  1RTO A;  2LMC B;  4F8M A;  1WTX A;  2B8F A;  2M00 A;  1PZK D;  1STB A;  1CK1 A;  4UDU C;  3DHQ A;  3MFY A;  1ZYR C;  3NUC A;  1SMY D;  2Q8I B;  3DWA A;  3QOJ A;  5EQ0 A;  1AW7 A;  2D2C C;  5EJW A;  4F7X A;  4BS9 A;  1FNU A;  1D5M C;  2A6E D;  3NTH A;  4QUF A;  1F9Q A;  2EJM A;  5M5X B;  1GXD C;  5IGG A;  1BCP C;  5ISR A;  3NPP A;  4U67 3;  1JIC A;  3BS1 A;  4K2K A;  2K03 A;  5EPL A;  4FXG C;  3VR4 A;  3R2T A;  5C6A A;  1PZJ D;  4KHV A;  3SK4 A;  1JC7 A;  1HXY D;  2PPB C;  1I50 B;  1NAP A;  1U4M A;  4CBV A;  1I4X A;  2ZT9 C;  2X6G A;  1CI3 M;  4ZLT F;  2JA8 B;  3GD7 A;  3LX0 A;  1XYI A;  2K5W A;  2A74 C;  1CQF A;  1PYW D;  2KCN A;  5K36 G;  3QB3 A;  1OXU A;  3H09 A;  1G2S A;  4HN7 A;  5IOC A;  4RA8 A;  5CV5 A;  1O80 A;  4FF3 A;  5KND A;  1NSN S;  4H7B A;  2V4D A;  1LT3 D;  3OHX C;  2B2T C;  3M7N A;  3FVQ A;  2R93 B;  4R9W A;  1WCM B;  2F0Q A;  4XT1 B;  1EY4 A;  4RWS C;  1PDQ A;  5JEA G;  3GTK B;  2EYM A;  3KK7 A;  4PMC A;  1VF7 A;  1GOZ A;  4FVM A;  2VB3 X;  4A3J B;  3GV6 A;  5LL6 S;  5AFW A;  1H9K A;  2E2J B;  2F0I A;  3W3A A;  1U4P A;  1QOH A;  3MEH A;  4IUN A;  4M8A A;  2HDL A;  3S15 B;  3A8J E;  4IN3 A;  4EQP A;  1S4Z A;  3E5S A;  1KLU D;  1PFN A;  4EGV A;  4QIW B;  1TWG B;  1UUP A;  3MXG A;  5I9P A;  5C0X H;  3K59 A;  2EYJ A;  2XVS A;  4F87 A;  2XNA C;  4RHR A;  2M2L A;  3SVM A;  2F0V A;  3QO2 A;  1C48 A;  1WTO A;  3D31 A;  2IWH A;  2CHB D;  2C9O A;  1E2W A;  3S1N B;  5D14 A;  4KV6 A;  1LTA D;  1CA6 A;  4DK1 A;  2F0F A;  1SYG A;  3DEO A;  3S16 B;  1I4G A;  1CHQ D;  3WDN A;  5TSS A;  1CTM A;  4WRD A;  2L9H A;  4PQX A;  3TP8 A;  4EQN A;  4IZ8 A;  1EU4 A;  2VB2 X;  1PTO C;  2X69 A;  4LAA A;  1O78 A;  2I07 B;  4DF7 A;  1BF4 A;  1K8M A;  3NHH A;  2OT2 A;  4K5X A;  3OWE B;  1AN8 A;  4WJW A;  1UAP A;  1HA6 A;  2MGS A;  1A2T A;  2XN9 C;  3VYS A;  1S5D D;  3VYT A;  3NQI A;  1FNW A;  2H1E A;  1S5E D;  3I90 A;  2XRQ D;  5M3F B;  1HQM C;  1KNE A;  3TBI B;  4CJ0 B;  4RCO A;  1HUM A;  1LT5 D;  3FMC A;  5T1G A;  4DU9 A;  3RMH A;  1ENF A;  3RUZ A;  2BOS A;  3H0G B;  4HAE A;  2KEE A;  1ML0 D;  2EDG A;  3P75 A;  2A5H A;  4KJN A;  2BA1 A;  4ZKB B;  2J0T D;  2ID0 A;  2F0S A;  5D3I B;  1BUV T;  2L12 A;  1WTQ A;  1K83 B;  1ZYR D;  4ID6 A;  3Q24 A;  2F0T A;  2PZT A;  1H9S B;  1JOR A;  1I6V C;  1RCV D;  2R3Z A;  4S3S A;  2SNM A;  5JVG 3;  2SEB D;  4K5W A;  5C5M A;  2E2H B;  2PW7 A;  1BCP D;  4BA2 I;  2K6A A;  3TZD A;  1B2T A;  4FO2 A;  2SDF A;  3AU7 A;  3BDC A;  3M4O B;  2E76 C;  1A3T A;  4C1N K;  4K8I A;  2B8G A;  5CC4 A;  1H9S A;  4Y7N B;  3ONA B;  5C0X G;  3GTG B;  1HFG A;  3J7Y W;  1F9S A;  2G9D A;  5FO7 B;  3G7L A;  1EY9 A;  3ITP A;  1DYQ A;  5EGT A;  1V1P A;  4HTH A;  1ENA A;  1LV9 A;  3M3Y B;  4IUV A;  4KKU A;  5C4Z A;  1F9R A;  1A2U A;  1QJO A;  1G91 A;  3SEB A;  2FJ2 A;  3GV3 A;  3HP3 A;  4NP5 A;  5IIF A;  4V0B A;  3QJY A;  1ROD A;  2F3W A;  1EU3 A;  5CV4 A;  2EY1 A;  4RHS A;  4A3B B;  3LNN A;  2ENB A;  1KDC A;  3QWN A;  4FXK C;  4OL7 A;  3S17 B;  2TSS A;  3OPO A;  1EZ8 A;  4RGT A;  4DAP A;  1E0B A;  2JP1 A;  2KQ3 A;  5EKK A;  4L6T B;  3RLF A;  2EYF A;  1MGS A;  5IGD A;  4FF1 A;  1ZXT A;  1F2Z A;  1EFI D;  3GQB A;  2PW5 A;  4DGZ A;  1LTB D;  2FMC A;  3EJI A;  1S5B D;  1KAA A;  1EQT A;  1A15 A;  2RDG A;  4AYB B;  3NTI A;  1CHP D;  2PO4 A;  3T4A C;  1GUG A;  2DNC A;  2JEB I;  2YU9 B;  1GHK A;  4YIJ A;  3M4Y A;  4I65 A;  2E2D C;  4IQZ A;  1AZP A;  3P1H A;  4OGQ C;  1KAB A;  2F0W A;  1HUN A;  2F0O A;  1JOO A;  2AWO A;  1HPC A;  3HRZ C;  1SYE A;  3M7G A;  1FR3 A;  1F9P A;  2NVQ B;  3HOW B;  2A68 C;  1QE6 A;  2WV6 D;  4ZRZ A;  2RKS A;  2DY7 A;  3ERO A;  1TII D;  2OXP A;  3H94 A;  1PTO D;  1FGB D;  4C3I G;  2EYH A;  2PCF B;  5KIX A;  4A93 B;  3OSO A;  5BN5 A;  1RKN A;  3K6O A;  4ZYS A;  5KGU A;  1EY8 A;  1EEF D;  1PRT B;  3NXW A;  1Y8N B;  1W6K A;  5DNF A;  1TWH B;  2HCC A;  4XQJ A;  1IHZ A;  1IYU A;  3EA6 A;  2L55 A;  3VR2 A;  3T13 A;  4NW2 A;  5EPJ A;  4X3T A;  3N52 A;  2F0L A;  4DXG A;  3KF8 A;  3GTL B;  2G9H D;  3TSS A;  1EY5 A;  5ELC A;  5IGC A;  5C4J B;  5DM6 3;  3I4N B;  1GUW A;  4G7Z C;  5DAU A;  4H13 C;  5LL6 X;  3NE5 B;  3Q6S A;  3WOE A;  4KKS A;  2WP8 J;  3HOY B;  3PO2 B;  1GHJ A;  1QIL A;  5FO8 B;  4IFD J;  2F0G A;  1KDB A;  5I4D A;  1ESR A;  2NVT B;  4G4K A;  2C5C A;  3V96 A;  1WTW A;  1Y1W B;  1B9M A;  1LO5 D;  3T51 B;  1Q1E A;  2A6H C;  1HQR D;  1T5X D;  3K5O A;  3KBX A;  4NDX A;  1GUT A;  4XQN A;  1RJT A;  3VA5 A;  3KLS A;  4PMB A;  1AEX A;  3L3O C;  5JPM C;  3SDZ A;  4A3E B;  4QF4 A;  1VCI A;  2JEA I;  3I8Z A;  3FRP B;  1SNO A;  2Y0S B;  4RGN A;  3N6R A;  4CJ1 B;  1F2Y A;  3NQT A;  4TQU S;  2JSO A;  4K14 A;  2FHT A;  1WVL A;  3U9O A;  1EYC A;  1O7Y A;  4KTA A;  2F1M A;  3CRL C;  3MTS A;  2ICE C;  1BDO A;  2XRS D;  1MSG A;  1Q90 A;  2A69 D;  4TKO B;  4O1N A;  3U9S A;  1ET6 A;  1B44 D;  5EBD A;  3BYT B;  1KLG D;  3D6W A;  2QIL A;  1TWC B;  3GTJ B;  3NBH A;  3ERQ A;  2VNU D;  1KDA A;  1FNV A;  3S1Q B;  5COR A;  1W6J A;  4R8I A;  2PNR C;  2Z4I A;  4ZUJ A;  5D65 A;  3PO3 B;  4IUQ A;  1A6X A;  3HOV B;  5ELF A;  5ELD A;  4DAY A;  1SE4 A;  1SNQ A;  1WD1 A;  1CT1 D;  3C1E A;  3PUW A;  5C4X B;  2BDN A;  2K5Q A;  3S2H B;  3K5M A;  5IT9 L;  5FOB B;  1HTL D;  1EZ6 A;  2IPK D;  3L9A X;  5KRU A;  4E6I A;  1Y69 U;  1AFP A;  4MIU A;  1LTG D;  4O42 A;  2EJF C;  4J8Q A;  3VYU A;  2NTT A;  3C3L A;  1LTI D;  1Q8I A;  2OEO A;  1ZEQ X;  1OXV A;  2F0H A;  5FO9 B;  3BVZ A;  3DXJ C;  5DM7 3;  5IGE A;  4NMZ A;  1D6E C;  1DON A;  2A68 D;  1XXG A;  1V1O A;  3K58 A;  3PV0 A;  2B2U A;  2H4O A;  2F0M A;  3TP6 A;  2IX0 A;  2DY8 A;  1Z6H A;  2K04 A;  4X3S A;  2E75 C;  1NR4 A;  3BVM A;  3SK5 A;  1TQO A;  2B2U C;  4XXE A;  2EZV A;  4N9T A;  1LAB A;  4Z9C B;  1IKL A;  1U9R A;  4PMW A;  1H9J A;  1XWE A;  1FD7 D;  3MC0 B;  2FIN B;  4XIG S;  1LAC A;  1Y8O B;  3FKI B;  5M5W B;  1SYF A;  3HZX A;  4QCL A;  3DEP A;  1OXT A;  3QOL A;  1SND A;  2Z8L A;  4FYD A;  1NR2 A;  3VR3 A;  4K6D A;  1CQV A;  5NUC A;  4J1M A;  3MAQ A;  3SE0 A;  2PQE A;  4F88 A;  3K5L A;  2XIW A;  2RDF A;  1HCZ A;  4J6H A;  3R3O A;  2EE1 A;  1MI2 A;  4PV1 C;  3HOU B;  4OIJ A;  4DNT B;  3O13 A;  4X3K A;  4CKE A;  5EKI A;  3NK9 A;  1RTN A;  1B9N A;  3URY A;  5IOD A;  4PNY A;  1HTP A;  3HEJ A;  2XWJ B;  3VA7 A;  4FNF A;  4OO1 H;  1PFM A;  5JVH 3;  1CFM A;  2L4N A;  2RSN A;  2A73 B;  1Z7T A;  1PRT F;  1SEB D;  3FPP A;  4NKL A;  4K8J A;  2KED A;  4P2C B;  1EYD A;  2A6H D;  1I6H B;  1DD2 A;  5J22 A;  2LY7 A;  5FK9 C;  3J7A V;  1FYC A;  1HRJ A;  1QWY A;  2QDB A;  4BY7 B;  1EEI D;  2J4X A;  1VMP A;  1D2B A;  2OF1 A;  1JCK B;  5I2X A;  1I4H A;  1SNM A;  5EBC A;  4ZQ3 A;  1SYB A;  1IL8 A;  5IGF A;  2K1B A;  3MXN A;  2KVM A;  4IUR A;  5CR3 A;  3BG3 A;  1STY A;  1EQV A;  5IGB A;  5E4W C;  3CKI B;  1DJR D;  4GZY C;  3I70 A;  1BQQ T;  5I2Y A;  3GO5 A;  3CRK C;  4DK0 A;  1F2L A;  2K5D A;  2CW0 C;  3R2I A;  1IYV A;  1Y8P B;  4IUP A;  2HCI A;  4KD3 A;  4HMJ A;  2CQA A;  3PUZ A;  1WTV A;  3PUV A;  1ILP A;  3I4M B;  3I3C A;  4HED A;  1GJX A;  5KEE A;  2EY2 A;  2K28 A;  2RQX A;  5J1Z A;  4DN4 M;  3TP5 A;  2Q8T A;  2K05 A;  3QIA A;  4C3H G;  4IFD H;  3VYR A;  1PXU A;  1XX8 A;  3P20 A;  5G3L D;  1MSH A;  1TKW B;  4H44 C;  5C4H A;  2ZXO A;  4A3I B;  1ONL A;  1UNS A;  2A69 C;  2NYZ D;  2QEJ C;  2KCC A;  3CQZ B;  5G3L F;  1B3A A;  5CBA E;  1C4Q A;  5I6W A;  5T1I A;  4M1U B;  1WTP A;  3RD4 A;  1PFB A;  4RAU C;  5HGT A;  2WKD A;  5I6Y A;  3MXU A;  5JPN C;  1SFO B;  5HUR A;  2IL8 A;  2EYP A;  1STH A;  5CBE E;  3S1R B;  3AMU A;  1EWC A;  3SXH A;  3CHB D;  1CZW A;  2PZW A;  1F2M A;  1EY0 A;  1ICW A;  3C2P A;  1RDP D;  2BDO A;  4KI0 A;  1HFN A;  2KUM A;  1RHP A;  3HGB A;  5CYU A;  3SHL A;  4OO1 G;  1RD9 D;  1A3U A;  3CU7 A;  2R92 B;  4B9W A;  4B08 A;  4C2M B;  2L1B A;  3T56 B;  3OIQ A;  1GUO A;  2LFN A;  2WB1 B;  3HKZ B;  2HQE A;  4XQQ A;  4HR7 B;  2F0N A;  4KY5 A;  4KN4 C;  5A2Q E;  3R8B A;  1IW7 C;  3D8G A;  2F0E A;  2JYO A;  3E0J A;  3K7A B;  4I7Z C;  1V43 A;  3FPU B;  1TT2 A;  1OO9 B;  3EQL C;  3OMG A;  3MXP A;  4QB4 A;  4IUT A;  1STN A;  5KYI A;  3EFX D;  1AZQ A;  1SDF A;  1R4Q B;  4G57 A;  4BBS B;  2O5I C;  1A3V A;  1VMC A;  1DCZ A;  2PZU A;  2HUG A;  5M3M B;  3NWT A;  2NVX B;  3A8I E;  1IKM A;  2D5D A;  3J7A F;  5EPK A;  3NBI A;  4RCN A;  2CVR A;  5BN4 A;  3GTO B;  1TY2 A;  2EVB A;  5A2Q L;  1DZ1 A;  1EYA A;  2F3V A;  2M9V A;  5CGK A;  3MWY W;  1TS4 A;  3M85 A;  4L8J A;  1M8A A;  4L63 B;  4IFD G;  2JE6 I;  1TR5 A;  3WOF A;  3DWP A;  1V8Q A;  1O7L A;  1ESF A;  4BA1 I;  1WTR A;  2KOL A;  1K8O A;  3SK8 A;  1PRT C;  3BVG A;  4C56 C;  2DN8 A;  4ILW A;  2QF7 A;  1YNN C;  2J7Z A;  3OOC A;  1Z47 A;  1CM9 A;  4RKL A;  1JR0 D;  4KKT A;  1Q1B A;  3H91 A;  1H9M A;  1G29 1;  4Q0F A;  3A55 A;  3FDT A;  2EYL A;  3MZ5 A;  3A56 A;  4HSV A;  1KTK A;  1QG7 A;  2B2V A;  1TS2 A;  1BCP B;  3IAY A;  1J9O A;  3RZO B;  2PMZ B;  2CW0 D;  5C5L A;  2R6G A;  1QNU A;  2B63 B;  4FF4 A;  1SAP A;  3BDL A;  5FLX E;  3NP8 A;  4DAV A;  1L0Y B;  2B2V C;  5E1F A;  3PIO 3;  2AUJ D;  2IJ0 A;  5CV8 A;  3K0Y A;  3D4D A;  2JA5 B;  1B1Z A;  2F0U A;  1SYD A;  1DOL A;  2NB0 A;  2KA7 A;  3JAM E;  1ZKO A;  2WII B;  1BNZ A;  2RA4 A;  3IL8 A;  3D6C A;  2O2L D;  2FMM A;  1YNJ D;  5E3F A;  1NUC A;  1JE4 A;  5DEH A;  2BA0 A;  2QCP X;  3AB9 A;  2FFK B;  4HMI A;  2B2W A;  2F0D A;  5F2D A;  3Q0A A;  1SE3 A;  2KEC A;  3TN2 A;  4A3F B;  1NCV A;  1R9T B;  2MPM A;  1F77 A;  4DXF A;  5IT9 E;  3BDO A;  3VR5 A;  1G6Z A;  2NVY B;  1CA5 A;  3F2U A;  4JBW A;  2B2W C;  4XTC S;  5FLX L;  1MD2 D;  4DA2 A;  5KNC A;  3ND9 A;  3NSW A;  1U4R A;  1Q3L A;  4OHJ A;  1X32 A;  3JAM L;  2ZXR A;  1UEA B;  3V05 A;  1I3Q B;  2B2T A;  5ELB A;  4JK1 C;  1EWH A;  5KNB A;  4OO1 I;  2ICI A;  2HDM A;  2KJX A;  1D5Z C;  3W2D A;  2MUY A;  5CV6 A;  3J80 E;  1E2V A;  3LWU A;  4DFA A;  4V19 0;  5C3W A;  2NN6 H;  1STA A;  2MP1 A;  4C3J B;  2RVL A;  1VF5 C;  4HSP A;  5JOB A;  3UI2 A;  3I72 A;  3FEW X;  1LLR D;  3MFG A;  1I4P A;  1Q12 A;  3G6J B;  2N55 A;  1O7Z A;  3GP7 A;  4C3I B;  5M9O A;  1T5E A;  1EL0 A;  2F03 A;  1X3Q A;  5JEA J;  2VXW A;  1IW7 D;  2AQ2 B;  2AUK A;  3QG1 A;  1TU2 B;  2Z1C A;  3A7A B;  1PLF A;  3KLS X;  1GUS A;  3PUY A;  1L0X B;  1DOK A;  4KY7 A;  2B2Y A;  5K5P A;  3RZD B;  1PTO B;  3Q23 A;  4EQO A;  2AWN A;  5EKL A;  1X3P A;  3J80 L;  4XT3 B;  2SNS A;  4C1N I;  2PYK A;  5I9O A;  3T53 B;  1BOS A;  1SSO A;  3HS0 C;  5A35 A;  1STE A;  2B2Y C;  1BBX C;  3H6M A;  1M4V A;  2EOT A;  3ZYY X;  4IFD I;  4HCS A;  4WOR A;  5J39 A;  2K32 A;  2F4I A;  1RF2 D;  4FXD A;  2K7V A;  1BXT A;  1II3 A;  4KHZ A;  5C3X A;  1SXT A;  3C1F A;  2KHS A;  3H3V C;  3J81 E;  3OMC A;  1TS5 A;  2O4X A;  3L7Z C;  1I4R A;  5COY A;  4U68 A;  3MA2 B;  4HCE A;  4X3U A;  2BE5 C;  4IUU A;  4ME5 A;  2B39 A;  2LS0 1;  3I91 A;  1LT4 D;  4A3K B;  1PRT D;  4CJ2 C;  1YNN D;  4LMQ D;  3A8K E;  2NTS A;  2K33 A;  2RSO A;  2F0K A;  3LWE A;  4XDX A;  1D1I A;  2IW3 A;  5D3D A;  2DNE A;  3P7J A;  1JOK A;  1B53 A;  1SNP A;  3A7L A;  5C3E B;  3TDQ A;  2D9U A;  2WIN B;  5CV9 A;  4KJO A;  4XYO A;  1ET9 A;  2X6L A;  2AQ3 B;  3GTQ B;  3DMU A;  3NTK A;  4BBR B;  3BZD B;  4ULL A;  1D1K A;  4KD4 A;  3J81 L;  1JWS D;  3T16 A;  1EIH A;  2N88 A;  2NUC A;  2Q8R E;  2I46 A;  1JWM D;  4N9P A;  1D5X C;  1SYC A;  2L11 A;  5LHY 1;  1SJH D;  3S14 B;  2NN6 G;  5JJZ A;  1ENC A;  1E2Z A;  2IX1 A;  2EYO A;  2ZXP A;  1BR9 A;  1J8I A;  3TZU A;  4CGY B;  4KY6 A;  4B9X A;  1SNC A;  2SOB A;  1PMR A;  1QB5 D;  3OWF A;  1B4O A;  2Z4H A;  4R8N A;  3PIP 3;  1V1P B;  4RFB A;  2NWG A;  1C8C A;  1BCP F;  3EVQ A;  4TSS A;  1SMY C;  2GA4 B;  1PTO H;  4WFN 3;  1CZG A;  1YNJ C;  3KBG A;  1WD0 A;  3E6Z X;  4BWG B;  3HOX B;  2A6E C;  3DUZ A;  1G2T A;  4RGM A;  1JOQ A;  1DOM A;  1TWA B;  5ELE A;  1LTS D;  1DM0 B;  3D3R A;  4ZAI A;  1S5C D;  1B50 A;  5C0X J;  4XYQ A;  4RH6 A;  1AP0 A;  2EPB A;  4TRD A;  1EY6 A;  1QNK A;  1XTC D;  4UAI A;  4MHE A;  3D4W A;  2EY5 A;  1TWF B;  2AQ1 B;  1GUN A;  3BYY B;  2K01 A;  4MN3 A;  2LKV A;  1JB3 A;  5C44 B;  4KK7 A;  2NZ1 D;  2R61 A;  5BN3 A;  1STG A;  3I4L A;  2IT1 A;  3OIP A;  4FP5 D;  5CMD A;  1JQY D;  4ZK9 B;  2E74 C;  3R93 A;  3S9W A;  3C46 A;  3MVV A;  1HA5 A;  4KMU C;  1OXS C;  4QUC A;  4A3M B;  2VUM B;  3V2T A;  1KNA A;  2IX3 A;  2MHV A;  2JA6 B;  3SK6 A;  1MBY A;  1U4L A;  2D62 A;  1R4P B;  1LTT D;  4RKB A;  3TME A;  1EY7 A;  3IKJ A;  1Y1V B;  1SBB B;  2F0P A;  1TVX A;  1TY0 A;  4ABN A;  2EJG C;  3X3M A;  2EY6 A;  1QCB D;  4EVO A;  3GTM B;  3S1M B;  3HG9 A;  4G7O C;  4G7H C;  4ZUI A;  1SE2 A;  4C3J G;  3NWS A;  5K36 H;  2BCO A;  3K5N A;  3MHB A;  4FF2 A;  4IAL A;  1PZI D;  2YYZ A;  4LK1 C;  3X3N A;  4ODG A;  2JA7 B;  4BY1 B;  3SR1 A;  2JXM B;  5CV7 A;  3IFD A;  2WAC A;  3KUP A;  4QMG A;  1VDZ A;  5M5Y B;  2F0J A;  1H9R A;  1DXM A;  1ILQ A;  3PUX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...