1Z7TA

Solution structure of bacillus subtilis blap apo-form
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
TVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKKKEGDFVNEGDVLLELSNSTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Bacillus subtilis BLAP apo-form
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Transport protein
molecule keywords Biotin/Lipoyl Attachment Protein
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1z7tA00
3SDZA 1FYCA 1H9SA 3U9SA 3I73A 4KHZA 2PPBC 1HTPA 2EJGC 3VR5A 1Z6HA 5K36H 1Y8NB 5KNCA 5JEAG 2B8FA 4XTCS 3T56B 3VR6A 1V8QA 3A8IE 3D4RA 5BN3A 1A6XA 5BN4A 2R6GA 2K33A 4G7OC 2BDOA 1GUTA 3VR4A 2O5IC 3LNNA 1DD2A 4KN4C 1EWHA 3L7ZC 2E74C 3FMCA 3CRKC 3MXUA 4JBWA 3OW7A 3I72A 4GZYC 1YNNC 4DNRB 2BE5D 1GHKA 1Z7TA 3I4LA 1DXMA 2ZT9C 1ZKOA 3QG1A 2K7VA 4XIGS 2D2CC 4DK1A 4KI0A 1CFMA 4IFDH 3D31A 2NN6G 3EQLC 4LK1C 5BN5A 2YYZA 5KNBA 4KKSA 4JK1C 4BA1I 3VR2A 2AUJD 2JE6I 4TQUS 2EVBA 1GHJA 1GUSA 4OGQC 1V43A 2JXMB 3A7AB 2A6ED 4KKTA 1ONLA 4KMUC 1HPCA 2E76C 3KLRA 3M7NA 5JEAH 4G7HC 5K36G 2BA1A 1LABA 3PUYA 1G291 2DNEA 4L8JA 1ZYRC 2AWOA 4OO1G 1IW7D 4DK0A 1GUOA 4IQZA 2A69D 2BE5C 1H9SB 1Y8PB 1PMRA 2O5JC 5KNDA 3GD7A 2EDGA 2IT1A 4H44C 2AUKA 2B8GA 1GUGA 1O7LA 4TKOB 2JEAI 1H9KA 1E2VA 3T53B 1Q1BA 1GJXA 1K8OA 2A6HD 3RLFA 3VR3A 2L5TA 3CRLC 1IW7C 2EJFC 1O78A 5C0XG 2KCCA 3OOCA 2A6EC 4BA2I 1H9MA 3IFTA 3PV0A 1TU2B 2A69C 4RCNA 1IYVA 4OO1H 1OXSC 1IYUA 2A68D 1OXUA 3W3AA 1CTMA 3PUZA 3BG3A 1TKWB 1Q1EA 4H13C 3MFYA 1Y69U 3A8JE 1I6VC 2V4DA 1B9MA 2LMCB 2K32A 3LWUA 1E2WA 2DNCA 3H94A 3PUWA 3ND9A 2PCFB 1Y8OB 1QJOA 3ND8A 4H0LC 1DCZA 1VDZA 3SE0A 4DNTB 1OXVA 1B9NA 5A35A 3QJYA 2BA0A 2D5DA 3A8KE 3AB9A 2PNRC 2A68C 3IKJA 1Q12A 2NN6H 1HQMC 1GUNA 3HGBA 1H9RA 2A6HC 2Q8IB 3M85A 3OPOA 4PV1C 2KA7A 3VA7A 1CI3M 1HCZA 1VCIA 4KKUA 3WDNA 1OXTA 2QF7A 3NE5B 1K8MA 2CW0C 2DN8A 2E75C 3P20A 4G7ZC 3DXJC 1YNJC 2EJMA 3M4YA 1VF7A 2F1MA 2JEBI 3T51B 3PUXA 1FR3A 5C0XH 4KN7C 4HR7B 1E2ZA 1VF5C 2NN6I 3N6RA 1LACA 4LJZC 4I7ZC 4IFDG 1Q90A 1SMYC 1T5EA 1BDOA 2D62A 3BDOA 3QIAA 1OXXK 3A7LA 3GQBA 3TZUA 3PUVA 3FPPA 1H9JA
chains in the Genus database with same CATH superfamily
1HTPA 1E7ZA 5K36H 1Y8NB 2XRQD 2B3GA 1RHPA 5DM63 3PMFA 2K33A 2AWNA 3GTQH 1DD2A 3PGZA 1SRUA 3ULLA 1YJ9A 1XMQQ 4KHVA 3EJIA 1PFNA 2H5XA 5FKAC 1F9PA 3G6EA 1ZKOA 1U4LA 4J8QA 4JI7L 5ELEA 1TWCH 4EGVA 3M3YH 1YHBA 2NVQB 2QILA 2I5MX 2YYZA 1A2UA 1EYAA 3CCMA 4BY1G 4HCEA 4POGA 1FL0A 3B6YA 3F2UA 1PYWD 4GKKL 4PZ6A 1TQOA 3DWPA 1B4OA 4GLVB 4FXDA 4L5RC 1TS3A 3FKIH 3SGIA 3CCUA 2WFWA 5JEAH 1YBYA 1Z47A 2A74C 1YITA 2CVRA 2DNEA 2BCOA 2CFMA 4KY5A 4A93G 3C1FA 1PH3A 4HCSA 1UE6A 1LO5D 2D0OA 1PFMA 1H9SB 1SR3A 2KOLA 4TVAB 4DUZQ 4YY3L 1J8IA 5IWAL 2WACA 3I4NB 3VYUA 1KLUD 1TVXA 2CHBD 3TRZA 4RKLA 1AFPA 2A6HD 2Q8RE 1Y1VH 3CRLC 1C0AA 4C3HB 4KHPL 4ME3A 4X62Q 2A6EC 1X9NA 4PMWA 2A69C 3L0OA 1IYVA 1CZWA 2NZHA 4A3MG 2A68D 5EKKA 5IIFA 1J5EL 3NBIA 2NUCA 1A0IA 1YNJD 4H13C 3TN2A 3RD4A 1EFWA 3T1HL 1HRJA 5FK9C 1PH6A 1GVPA 1KD1C 4BWGB 3DM3A 2C35B 4CDCC 1GUWA 4N8FA 2VB3X 1L2FA 4R8IA 5C5MA 4PZ7A 3QJYA 3MHBA 1LTAD 3GTKB 2FXQA 5HGQA 1Q12A 4C2MB 1EIYB 2ICIA 3NQTA 5IT9L 4CDEC 2JP1A 3CQZH 3Q22A 1V1PB 2Y0SE 3WDNA 2IY5B 4O0AA 4OONA 1F9QA 1HR0L 2E5LL 4DV3Q 2OQKA 4IUPA 4FF2A 4JG2A 5ELDA 3H91A 2NB0A 1XMOL 4JBKA 4WRDA 5H1SE 4LFAL 1SE2A 3W2DA 4OWWB 4CKEA 2KVMA 4L63B 1L1OC 2TMPA 4AYBG 1HNWQ 3TSSA 3J81E 3KF8B 1AZPA 3HOWH 4HMJA 3I4MG 3D6CA 4A3BH 3ULJA 4DAPA 1S5ED 5FO9B 4K6DA 1KDBA 2FJ2A 3CCRA 3OW7A 1D6EC 1S3OA 3I72A 1S40A 2PQAB 2CWAA 1RD9D 4A3FB 3J81c 1MIUA 3D31A 1KAWA 4K14A 4EQPA 5C4HA 4A3BB 4HTHA 4HJ7A 4R4OA 5IGGA 2IX3A 4DR1Q 5CORA 1D5ZC 4JYAQ 3S14H 2WAQB 2A19A 1TWHH 2JA9A 2UU9L 1P8LA 4IPCA 5JPNC 2BA1A 3P7JA 2DGYA 1HNWL 1I4QA 5GAHC 1SXTA 1Y8PB 4R4CA 1PH9A 2PYKA 2EDGA 4A3JH 4GN4B 3FRPB 1GOZA 2JA8B 4MHEA 3CXCA 2L5TA 5M5WH 1GO3E 2IHFA 5D3DA 3OOCA 3UE1A 2ZJPA 4IUVA 3IFTA 3PV0A 2CW0D 4A3EH 5M3MG 3BG3A 3V2TA 3A8JE 4Q0FA 3KLSX 3LWUA 3PO2G 3Q23A 5C4XB 3LGJA 4OO1I 5IP7G 3S1MH 3NXWA 1Q82C 2K50A 1Y1WH 5CV7A 2VS1A 3HKZB 4R4TA 1ASYA 4LUZA 3S14B 3I8ZA 3S15B 1T9HA 1WFQA 4B08A 1SFOB 1KLGD 3E0EA 3KLWA 4PNYA 3BU2A 4GOPC 3HOWB 5JOBA 4JV5Q 4JI2Q 5KYIA 1PYSB 5FLXE 4QMGA 1TY0A 1KTKA 2HDLA 5EBCA 1NR2A 2GVAA 3F2CA 5C0XH 1TWCB 3M3YB 4ILWA 5JJIA 1E2ZA 3HOYH 1VQCA 1DJRD 1TY2A 1SMYC 2AQ3B 4DN4M 4NB3A 1OXXK 4JV5L 4DK3C 5LMNW 2HCIA 4CJ0B 4O42A 2I5LX 4FNFA 3DMUA 2A73B 1RIPA 5KNCA 1QVCA 4XQQA 2QEXA 4JBMA 1DGSA 2GA4B 1HNXL 4MTKA 1A6XA 1U5KA 3SVMA 3TREA 2BH2A 2ZTDA 5CGKA 1L0YB 3SK6A 4WFN3 4GKJQ 4N8X1 1CA6A 1STEA 4XQJA 4HSVA 2F0MA 4X64Q 3HRZC 4A3GH 3NEMA 4XIGS 2QKIC 5C3XA 4BBSG 2F0KA 1A8VA 4QGUA 2FHTA 1HFNA 1XPUA 4DR5Q 2UXDL 3BVZA 4NXNL 4BA1I 3HOVH 2EVBA 2A6ED 4KMUC 5EKLA 1EUJA 2L1BA 3T13A 3W1GA 1F2LA 2FMCA 4RWSC 3HOUH 4QQBX 2N88A 2A69D 2N49A 3GD7A 1PRTD 3RUZA 2JSOA 4P74A 4U68A 5IOCA 3K7UC 2E2HB 1U9RA 1K0SA 2LKVA 3CQZB 5CV8A 3OIQA 2XGTA 1F2YA 4IPDA 3JAMi 2B2UC 1EQQA 5JAVA 4KV6A 1EZ8A 1B70B 3BYYB 5M5WB 1QZHA 5ELCA 2HUGA 5IYDH 1O7IA 4FF3A 1E2WA 3PUWA 3ND8A 4DR3L 5IYCG 4QF4A 1CZGA 4L5SA 1N36L 1WCMG 2EZVA 1K0RA 1B1ZA 1WCMH 4NXNQ 2OCEA 1SNPA 2R7FA 1L0WA 3OPOA 1X6OA 3E5SA 4KKUA 1JICA 1UEBA 2YTXA 4KK7A 3DWQA 4U673 1FD7D 2CW0C 1XNQQ 4C3IH 3DXJC 4ZYSA 3T51B 4C56C 4XT3B 2EXDA 3K81C 1HQRD 3F2DA 2F52A 3J80E 2PI2A 3HKZG 2JA6H 4EQOA 4JVZA 1PRTF 1PTOB 4LJZC 3VYTA 1E3PA 1EYDA 1O80A 2R61A 4LUOA 4A3IB 3NK9A 4FVMA 4R4QA 2MHVA 4DAVA 2A1AA 3GTLH 1HA5A 4ABNA 1CHQD 1JE4A 4GOPA 1FJGL 1D8LA 1LT4D 5EAYA 2HDMA 3F8TA 1XPOA 2WAQG 1W2BA 4NKLA 2KECA 1U4MA 1I5FA 2F0JA 3M9BA 3CHBD 2AQ1B 4FDBA 3E9IA 4BBSH 1DXMA 2X6GA 3TS2A 3I90A 2I46A 2JA6G 1R9TB 1VQHA 4KKSA 1ET6A 2EY6A 1UUPA 4QB4A 4ZCKA 1PH4A 4V0BA 1WVLA 1YI2A 4OGQC 5C44H 1STHA 5J1ZA 4L6TB 3S16B 3BYTB 3NENA 3M4PA 4UY8C 1SE3A 1IL8A 1VQ7A 4DK0A 2B2WC 1VQOA 2AHOB 4LF6Q 1PMRA 1EY4A 1PFBA 4TRDA 4DFAA 5I2YA 5GAGC 5IYCH 2SNMA 2UUCL 2WB1B 1SAPA 4JI1Q 3GTMB 2EY2A 1AN8A 2EJFC 5IYDG 2CKZB 5C0XG 4BA2I 3WWVA 1OXUA 4DR7L 3S17B 2B2YC 2LXKA 2ATWA 4QY7A 4DK6C 1NR4A 4BY7H 1SE4A 3S2DH 4IFDJ 4JW0A 5KRUA 2OT2A 4RGMA 4JI2L 1EOVA 1A2TA 2ZM6Q 5IGDA 2PNRC 1CKOA 3H0GG 1HZCA 1Y1WG 2HHHQ 3VA7A 4A4IA 2IWHA 1K83B 4OXPA 3PO3B 3H6MA 2DN8A 4G4KA 2K6AA 2EIFA 1AZQA 1CHPD 1SJED 3EBEA 3KDFA 3EFXD 4HR7B 1TT2A 4QCLA 3S1NH 3S2HB 2MP1A 1J9OA 2LY7A 4A3KB 4GLXA 3QO2A 1T5EA 1VQDA 4A3GG 1DOKA 3CU7A 4QUCA 3RR5A 1BCPB 2EYHA 2QW7A 5FO8B 1HZBA 3NTKA 4RMFA 4KHZA 5ELNA 3GTLB 1UAPA 1AEXA 3KJPA 2UXBQ 5JJZA 4LFBQ 1V8QA 4LFAQ 3S1QH 3EA6A 3QR8A 4PZ8A 3STBD 2B39A 5CV5A 1PH2A 3I70A 4DR7Q 5KIXA 4LF4L 1EZ6A 2Q2TA 1EY5A 3F1ZA 2XNAC 1TR5A 3TS0A 1Z7TA 2Z6KA 5M3FB 4MTNA 1O7YA 3FP9A 1X3FA 1G2SA 3I7FA 1IBMQ 3H0GH 3ULPA 2FINB 2RSNA 3S15H 2RF4A 3A7AB 5JVH3 1SYDA 1A15A 4IN3A 1HPCA 1XMQL 1K73C 4ZRZA 4GLAC 4HIDA 3I4MB 1I6HB 1G6PA 2KBNA 3KF6B 2EYFA 5J39A 1W6JA 2I5HA 1LYLA 1Z9FA 2YV5A 2K01A 1IYJB 3PQIA 4FF1A 1BCPF 1TWFB 3NBHA 3BVMA 2KCCA 5E1FA 1SDFA 3T4AC 3RN2A 1PH8A 1B9MA 4DV2Q 2K32A 3K7AB 5TSSA 5J3BA 4DR6Q 3TMEA 1IBKL 2ZM6L 1UEAB 2Q2UA 1DM0B 1WD1A 3J81i 1ENCA 1JT8A 2XTIA 5BR8Q 1BNZA 4DA2A 3FKIB 3MFGA 1VCIA 3A74A 3BJUA 1XNRL 1F2ZA 4LF7L 1NCVA 4DV4Q 3HOZB 4G7ZC 3NHHA 4JBJA 1HR0W 2ID0A 4OIJA 2G9DA 3ERQA 4KN7C 1XTCD 5C4JB 4LW1A 4DGZA 1VQAA 4LAAA 3KF6A 1UNSA 4IUQA 2UUBQ 3I55A 4IPHA 3BZCA 4CHTB 2RQXA 4LF5Q 4C1NK 4BBRB 4KTAA 3D4WA 3HKZE 1N9WA 1FVIA 3SK8A 2B8FA 4A3GB 4LFBL 1YEZA 4EQNA 1SMYD 5K5PA 3A8IE 1CSPA 2PQAA 1JR0D 4HMIA 5JPMC 2R7DA 2K14A 5LMUL 5GAEC 3UDGA 4DF7A 2JYOA 2E74C 2DUDA 3MXUA 2CWPA 1G8ZD 2IHEA 1VQNA 5IWAQ 1YNNC 4ZUIA 2ZTCA 2ZT9C 4J1MA 3KDFB 2R92H 2ZJQA 3GTJB 1WOCA 1SSOA 1BF4A 4JI6Q 2R7ZG 3H09A 4ALPA 4OWXB 2C9OA 4DV5L 2RA4A 1A62A 2E76C 3KLRA 5K36G 3CPWA 1EYGA 2LFNA 2NVQH 5IT9E 5IODA 2UUAL 2F3WA 1HA6A 2BE5C 4JI8Q 2O5JC 4KD4A 3KYHC 1E24A 5C5LA 3K5OA 1K8GA 1GJXA 1TWAB 4BS9A 3U9OA 5FJ8G 1SFOH 1PTOC 1QOHA 2Z8LA 3I2ZA 3EVQA 5C3WA 3PO2H 1C9OA 4GKJL 2KCMA 1TS5A 1M1KC 2QCPX 1PRTC 1QVFA 3A5UA 1QUQA 4DKAC 2F4IA 4PQXA 2DY8A 3CD6A 1R4PB 3SE0A 3E0JA 5A35A 1N36Q 3HOVG 2RDHA 2E2DC 3G4SA 1BBXC 2K5QA 3UDIA 1SN8A 5DM73 1JOKA 4JI6L 2VQEQ 3K59A 1CI3M 3CW2C 2BDNA 1N34Q 2N78A 3P20A 2K28A 3K80C 1PDQA 3K5MA 1X55A 2EJMA 1JCKB 1B53A 1FR3A 5LMUQ 1IXRA 4RCOA 3FDTA 2R7ZB 2ZTEA 1Q90A 1B3AA 1MSHA 2SNSA 1ICFB 4X65Q 4JCVE 1BKBA 5COYA 3STBC 3TBIB 1ENFA 2WV6D 2RHSB 4JI5L 2PZTA 3T56B 1SE8A 2UXCL 1SNQA 2K05A 5CR3A 1RL2A 1LV9A 3M4QA 4K0KQ 4GNXB 2RCFA 4OELB 3R3OA 4KN4C 5EBDA 3CCEA 3V05A 2WB1E 3H3VC 4A93B 4BBRG 1STAA 2IW3A 3KBGA 4B3TL 4HEDA 3I4LA 3IL8A 1WTWA 2K7VA 2XWJB 1JWSD 1BBWA 5G3LD 4F88A 5IE8A 4LK1C 4A3IG 4JOIC 2E2IH 1DOLA 4IZ8A 1J6QA 4A3FG 4RKBA 3Q6SA 1JORA 2IX0A 3PUYA 2VUMH 2AWOA 3R2IA 2UU9Q 1STBA 4X6AH 1AW7A 1B7YB 1YNND 4DV5Q 4F7XA 4HSPA 4LF6L 2JA6B 4A3MB 1QVGA 3HOVB 1ICWA 3HOXG 3JAML 3RLNA 5CV4A 3A5ZB 4NXML 4HJ9A 4YCUA 2L0CA 1OO9B 4IALA 3DM1A 3GP7A 3MFYA 3J7AV 3MXPA 1TS2A 5IT9c 3ND9A 1QJOA 3BZDB 3DHQA 3DEPA 4K5XA 2K4KA 2HQLA 4J6HA 4R4IA 3A8KE 2A68C 3A55A 1PZJD 4BXXG 2HQEA 2MFIA 1KIXA 1I50B 5E4XA 2PI2E 1PFSA 4GNXC 1MI2A 3PIOA 2UUBL 4LUVA 4HJ8A 1X3QA 1B3QA 1ILQA 3PUXA 4BY7B 2JA8H 3FKIG 1O7ZA 3A56A 3OIPA 1FGUA 3S16H 3HOXH 4BY1H 1R4QB 4DXGA 5CBEE 4B3ML 2UXBL 3HOWG 1YNXA 3DEOA 4DNTB 3WOFA 4JI4Q 3GTOH 1A63A 5GROA 4OX9Q 2VUMG 2F0TA 2VB2X 4X3KA 4DU9A 1EEFD 1E1TA 2PZUA 2MQHA 2IX1A 2C5CA 2Z9HA 1SNCA 2AQ2B 1SNOA 2EY5A 2NVXH 4I65A 2RDGA 1ZYRD 2OQ0A 1LTID 4KJNA 3GTGH 3CRKC 4WJ3M 4GZYC 3KLSA 4X62L 3W1BA 1GHKA 3NSWA 2XVSA 4QIWB 4KI0A 4IFDH 1DONA 2EQSA 4POFA 1AE2A 2FFKB 1B2TA 4DNIA 1K9MC 5FLMH 5C0XJ 5JEAJ 1GUSA 5ISRA 3RLOA 5I4DA 1ONLA 2F0NA 3GTGB 2JA7G 4DR5L 5EPJA 1IL2A 5C6AA 4OO1G 2JA5H 1GUOA 4HJ5A 4HIOA 4BXXH 3BZKA 2J7ZA 4CJ1B 5KNDA 1NMGA 1VQ4A 2NVTH 2JA7B 4HN7A 1GUGA 4TKOB 3GTPH 4DAYB 3N52A 3J7YW 3AYHB 3T53B 2F0FA 2E2HH 1PZID 1NTGA 5EQ0A 3I4NG 1IBKQ 3PO3H 4DAYA 4LF4Q 1ZEQX 2G9HD 4JC0A 3I4NH 1QCBD 1E1OA 5JJLA 1ZXTA 3S1QB 3H15A 1QNUA 1EL0A 4DV6Q 1N34L 2BA0A 3K0XA 2EY1A 3Q8DA 3IKJA 1JOQA 3HGBA 4PV1C 5BR8L 3CCJA 2KQ3A 5CV9A 4DV7L 3SHLA 2ALYB 2K5WA 1YIJA 2F0WA 4M1UB 1FGBD 2SEBD 1V1QA 3KK7A 3GTPB 1B50A 4YCWA 1Y1WB 3F2BA 4H7BA 1UE7A 3ICEA 1AH9A 3BDOA 1CT1D 2UUCQ 1K83H 1FNUA 2F0OA 2L55A 2VXWA 3RZOB 1EY9A 3PIO3 4O2DA 3CMAA 5ELOA 5HY6A 3G7LA 1D7QA 1Q81C 4DV0L 4HIKA 2A8VA 3C1EA 1PA6A 1TWGH 5I9PA 2RKSA 1Q8KA 5I6WA 3IFDA 3L7ZC 1I4XA 1PZKD 4JBWA 4ZAIA 1PH7A 3H3VH 4IOAA 5IGBA 2D2CC 5E4WC 3QOJA 1ESRA 5I6YA 1Q3LA 5FLXL 1SNDA 1WTXA 1AP0A 3K5NA 2RBMA 3GV3A 4Z9CB 3UI2A 1V1PA 4DUYL 4PG3A 4UP9A 4UP7A 2M00A 3L3OC 4UDUC 3M7NA 3PCOB 2B63G 1YZ6A 4NPSA 5KYLA 2VY3A 3AQQA 4XQNA 2F3VA 3PO3G 1IW7D 3FEWX 4ZK9B 4EVOA 5E7NA 3P1HA 4X66L 1H9KA 1B44D 4KJOA 3M7GA 1E2VA 4YCVA 2DY7A 3MA2B 3T1HQ 4DV1Q 3HS0C 1JB3A 3J7ZC 5EKIA 5DLQE 1EY0A 4OO1H 4UP8A 1CTMA 1TKWB 3S1MB 3J81j 2LMCB 2ZXPA 4ULLA 2NBFA 2HIXA 2VQEL 3OWFA 4X66Q 2XSCA 2MO1A 4DV6L 3S2DB 1X56A 1QILA 2Y0SG 1HZ9A 2H4OA 2ASBA 3T1YL 3Q24A 1IZ6A 1TWFH 2EXZA 1H9RA 4K0KL 4XT1B 3PIP3 2KA7A 2N3SA 2RDFA 3M4OB 4A76A 1OXTA 2E75C 4OHJA 3TEHB 3R8BA 3MAQA 1WJJA 3E9HA 1HJPA 3OWEB 2R7ZH 1A3TA 1DOMA 1MBYA 1VF5C 4JI4L 1EQRA 1SYGA 4B3SL 1EWIA 4I7ZC 2R92G 4IURA 1X65A 2AKWB 1YJNA 1Q86C 2K03A 2L9HA 3CC2A 2Z6BA 5IYBH 1NNXA 1NE3A 4XDXA 4JI1L 3NBHB 3HG9A 1TXYA 4K8JA 2B2UA 2PPBC 2ZXRA 1EIFA 2BOSA 2EE1A 3GO5A 1RKNA 1RODA 2K5VA 3NTHA 1S5CD 3J7A5 3BS1A 2LSSA 3U58A 5E3FA 3T1YQ 5G3LF 3S24A 4ME5A 3TDQA 4DNRB 1I3QB 1GD7A 2VUMB 1RCVD 3CC4A 4AYBB 5C3EG 2MGSA 4CKBA 2F0PA 5BN5A 1KAAA 2BH8A 3ER0A 1BOSA 1KRSA 3NP8A 5LL6X 1NAPA 1U0LA 1Q8IA 2F0QA 3D0FA 5EJWA 3X3NA 3MVVA 1EY7A 4ID6A 2RSOA 2B2VA 2B2WA 1I4PA 1HNZQ 3D6WA 4UPAA 3IAYA 4BBSB 1HZAA 4IOCA 1SYFA 4NDXA 4P2CB 2AUKA 2B8GA 1RDPD 4DR4Q 3MZ5A 3GV6A 3QOLA 1NBWA 4X3SA 4RFBA 1C4QA 3J80c 3FPUB 4K2KA 3AFQA 2UXCQ 5C4XG 1XWEA 2F3IA 1TU2B 2MPMA 3D4DA 3W3AA 2L4NA 2OTJA 4JI3L 4IPGA 2GVBA 3H0GB 4K2LA 5FO7B 4A3FH 2WKDA 3SXHA 4A3JB 3C46A 4C3HG 2X69A 2NVYB 1KQSA 2QDLA 5IP9H 1X32A 1J5EQ 1TIID 1WYDA 1Q46A 1BQQT 3A0JA 3CP0A 2A6HC 3M85A 1MJCA 1I6HH 4DR2L 4ZQ3A 4BBRH 1DZ1A 4WJWA 2NWGA 3NE5B 2KUMA 5A2QL 1MHWC 4N9PA 4NP5A 1LLRD 4UAIA 1X54A 1W6KA 4YWMA 2WIIB 3JC66 2LXJA 5HURA 1U4RA 1HHVA 3DUZA 1XJVA 2XN9C 2D62A 2KEEA 1FJGQ 1HXYD 1V9PA 2KHJA 1JB7A 4FO2A 3H3VI 1II3A 4AIMA 3PO2B 4C3IB 4XTCS 2PMZB 1LT5D 1SJHD 3J80L 1WTVA 2F4VQ 4G7OC 3VR4A 3MC0B 1ML0D 3NQIA 3MWYW 4LMQD 1HNXQ 1HR0Q 2E5LQ 4Y7NB 5FLXc 1BUVT 2NTTA 1KNEA 3SEBA 1VQEA 5EGTA 2CH4A 1EU3A 1N33Q 1ET9A 4B3RL 2FMMA 1I4HA 1E0BA 2JXMB 3CC7A 2OXPA 5CBAE 1VMPA 2WAQE 1K3RA 4C2MH 3GTJH 4L8JA 1F9SA 1SBBB 1PTOD 1A3VA 1LTTD 2J0TD 5HGTA 4X65L 3O13A 5FJ8H 4QIWE 3MEHA 4O1NA 2UUAQ 4AQYL 1PLFA 4A3CG 4CDFC 4B9XA 4GN5A 4APVA 4YY3Q 2F0GA 1D1KA 2NZOA 5M3FH 1OXSC 5M9OA 1HUMA 2O2LD 1WTRA 3MXNB 1Q1EA 1GKHA 3CCVA 3CCSA 3T16A 2V4DA 4H0LC 4G57A 1VQFA 1B9NA 5M5YH 4GS3A 4ODGA 3HOYB 2PZWA 2NN6H 1HQMC 2EYMA 2X6LA 2UXDQ 2O4XA 5IGCA 3R93A 4A3DH 1ESFA 4DPGA 3OTOL 3RN5A 3MEFA 2QF7A 1KC8C 1LTLA 1X3GA 4IJHA 4DV4L 2YU9B 5CC4A 1MD2D 4CBVA 1VF7A 2F1MA 2EYLA 4LFCQ 3K57A 2QEJC 3EROA 5C4JH 1LACA 2QGQA 3HZXA 2F0IA 4LNQA 1N32Q 3OTOQ 2JA5B 1VQBA 1BVSA 1VQLA 3PUVA 3FPPA 1H9JA 1F77A 2F0LA 1H9SA 1KXLA 3U9SA 3I73A 1ILPA 3HFZB 2EJGC 5NUCA 1STGA 1Z6HA 2Z4HA 1K28A 2KEDA 4LF9L 2AMCB 3OW2A 1PYBA 2KENA 1XTDA 2B2TC 1IHZA 1JWUD 3PSIA 5M5XB 2PO4A 1WTQA 4QUFA 2DJFC 3MXGA 2O5IC 1Q7YC 1UE1A 1EWHA 3VYSA 4GOPB 1VQ6A 3PIPA 3S1RB 2F0SA 1XPRA 1CQFA 2K5NA 2N8NA 3QG1A 4DV7Q 4RG1A 4DR2Q 4JI0L 1N33L 3I91A 3D8GA 4DV2L 5KNBA 1BO0A 2ICEC 2CQAA 3TP5A 4RHSA 4RGTA 1JWMD 2L15A 2J4XA 4PMCA 3I3CA 3GDEA 4C3IG 1LABA 2YTVA 4IFDI 5DEHA 4B3MQ 2F03A 1EQVA 4WJ4A 4HIMA 4A3LG 1I4RA 3HOUB 1VQGA 2JEAI 1BCPD 1CK1A 4NW2A 4H02A 1Q1BA 1U4PA 2EOTA 4KY7A 2JN4A 1PH5A 2EYJA 4FF4A 1IW7C 3CPFA 2ENBA 2K75A 1E22A 1F2MA 3ZYYX 4RCNA 1X3EA 4RGNA 4BY7G 3PUZA 2VQFL 5M3FG 4MIUA 4E6IA 1VQMA 4LF8L 3SK5A 5AJ3L 4A3CH 1EEID 3HEJA 1VDZA 3WOEA 1OXVA 3TZDA 3AEVA 1BR9A 3HP3A 2D5DA 1SROA 1JE5A 4ZKBB 2Q8IB 1TWAH 1M90C 3CAMA 2DJGC 1HUNA 2H1EA 2R93G 3X3MA 1KABA 3U4ZA 3AMUA 1L1OA 5C3EB 2L11A 1LTGD 1S5FD 5LHY1 1FNWA 5C4ZA 2OTLA 3CCLA 2PNHA 2K04A 5C44G 4P75A 5JJKA 4A3JG 2F0VA 2D9UA 2MUYA 3MXNA 4QL5A 1QB5D 1L1OB 5KEEA 2L12A 1XXGA 1N8RC 3SDZA 2Q2IA 3S17H 2K1BA 2XWBB 3ZJYC 4K8IA 3VR5A 2RHQB 1S5BD 1L0XB 1D5XC 1QG7A 3OYYA 4IUNA 3RZDH 4BY1B 4B3SQ 2NZ1D 3HKSA 3LX0A 1GUTA 1NUCA 2NYZD 3LNNA 1SYCA 4RA8A 2VQFQ 1JOOA 2R93H 4N9TA 5CYUA 2EYPA 4LWCA 1SMXA 3TQYA 1EU4A 2VZAA 3L9AX 2BE5D 1QUQB 4DR6L 2B63B 2F0EA 3SK4A 1NJIC 2AUJD 1CUKA 1B8AA 3NTIA 4TQUS 2MNAA 1GHJA 1WTOA 3NPPA 4IJLA 4KD3A 3VDYA 1D1IA 1IKMA 3AU7A 4R9WA 4LF7Q 1T5XD 3U4VA 5I2XA 3D3RA 2E8GA 2Y0SB 2CQOA 2KCTA 1DYQA 3ERSX 4HJAA 4OL7A 3SR1A 4A3DG 2YU9H 4H44C 1VS0A 4K6LA 1O7LA 2YTYA 5IY0A 1H95A 3E6ZX 5IP9G 5IP7H 1MGSA 2E2IB 3RLFA 2TSSA 1WD0A 4R8NA 4A3LH 4DUZL 1EY6A 1PVOA 4A3EB 2IPKD 1CKNA 4DAMA 1JJ2A 1JC7A 1IBLL 3G48A 5D65A 2KJXA 2HD3A 3BDCA 2Q2HA 5C4XH 2PMZE 3OSOA 2A5HA 1CQVA 1NSNS 2DNCA 2PCFB 3AFPA 1QWYA 1Y8OB 3EIVA 2OF1A 1HH2P 2K52A 2E2JB 2Z4IA 1Y1VB 5AJ3Q 1PH1A 1EIHA 1LTSD 1KDAA 4KLKA 4LFCL 4JI7Q 5T1IA 1HCZA 2WINB 5KGUA 4GNXA 4JI3Q 3NELA 3CF5A 1K8MA 1X3PA 4Y7NH 5DAUA 3M4YA 2JEBI 2PW5A 1I94Q 4B9WA 2PW7A 3JAMc 1XX8A 3GTQB 5C3EH 3CKIB 4DV3L 4ZKCB 3CMEA 1PTOF 1PRTB 3A7LA 1JQYD 4YIJA 5J22A 3P75A 1R9TH 1FYCA 2KCNA 4DR4L 1I94L 5I9OA 2QA4A 5JEAG 3TP7A 2I07B 3K8AA 4A3BG 3QB3A 2SOBA 4J15A 5BN3A 2R6GA 1LT6D 5JVG3 1Y14B 2OEOA 1V1OA 4JI0Q 2E2JH 4AQYQ 4JPBW 1SYEA 3G6JB 3K0YA 4F87A 3S9WA 4GN3B 4FP5D 2PQEA 4A75A 2JQOA 2JK8A 1SEBD 4DK1A 2R93B 3R2TA 2QDBA 1CSQA 2NN6G 2R3ZA 3EQLC 4JK1C 5CMDA 2VW9A 5L37A 1WCMB 3NUCA 5C44B 1VQ5A 4JOIA 4KKTA 1YHAA 1KRTA 2MJ8A 3HOYG 1BCPC 1CA5A 1QNKA 1CKNB 3E3XA 3RZOH 2CH4W 5D3IB 2HHHL 1G291 1ZYRC 1I3QH 1KDCA 3I4OA 5FOBB 5D14A 2NVYH 4B3RQ 4X64L 2IT1A 2B2TA 3M4OH 1M8AA 2EYOA 4QJFA 1AE3A 1VQ9A 1K8OA 4DXFA 1D2BA 4LF8Q 3VR3A 1WTPA 4YWKA 2F0UA 2GN5A 1H9MA 1BXTA 3HOUG 4C3HH 1BBUA 4IUTA 4P71A 3J81L 2Q8TA 1I6VC 3S1NB 5M3MH 3S2HH 1STYA 2Z1CA 4A3EG 3LWEA 4CKCA 3RNUA 5M5YB 1IBLQ 3KBXA 4Q5VA 3PF5A 1FNVA 3DWAA 4UHVA 4K5WA 1EY8A 1SNMA 1GUNA 4YWLA 4A3DB 4XYOA 5IGFA 5LMNQ 4P73A 3PF4A 4X3UA 2JJQA 3BDLA 4MZ9A 1K8AC 1VMCA 5EPLA 1IKLA 3OHXC 1N32L 4S3SA 4OX9L 1BDOA 4EQ5A 3GQBA 3TZUA 1SYBA 4ZLTF 1UWVA 3W5OA 2G5DA 1RJTA 4IO9A 1PV4A 4C1NI 1A3UA 4LF5L 4TSSA 2F0HA 2JA7H 2NVTB 4FYDA 1XNQL 1HTLD 4LF9Q 2EPBA 1RTNA 2F0DA 3QWNA 3UDFA 4CJ2C 5BN4A 3G71A 1WI5A 2P5ZX 1GXDC 1KL9A 2M9VA 3S1RH 3K58A 3FMCA 1UE5A 2VNUD 4FXGC 1JMCA 4V190 1VQPA 3KFUA 2CCZA 1NY4A 1XMOQ 5IYBG 3ITPA 3K5LA 2F4VL 3L2PA 3EN2A 2I0QA 3KF8A 4RH6A 1I50H 4PMBA 1I4GA 4YHHQ 1D5MC 5AFWA 2N55A 3FVQA 4DV0Q 5A2QE 1C48A 4Y52H 4X3TA 1SLJA 4NXMQ 3NWSA 5ELBA 4DR3Q 4JI5Q 1TWGB 3I56A 1HNZL 4L5TA 3OMGA 1MJEA 3IRBA 3C2PA 1VQJA 2VL6A 1CKMA 4C3JH 4GKKQ 5IGEA 1IYUA 2WKCA 3TP6A 3GTOB 1LTBD 1Y69U 3HOZG 1YJWA 1XYIA 2LS01 1G2TA 3K7AH 5CV6A 4P72A 1S72A 2R92B 3NWTA 4A3MH 3J80i 1OTCA 3RMHA 1DCZA 1YHQA 2Z0SA 4DUYQ 2SDFA 1TWHB 3DLLA 1LM0A 4K5VA 1K3BC 1ASZA 2KHIA 5GADC 5LMNL 1F9RA 2K5HA 2JA5G 1VQIA 3UE0A 5C0XI 3HOZH 4JI8L 3BVGA 1VQKA 4L5QA 1KHIA 1YNJC 4C3JG 1G91A 2HT1A 5ELFA 2B63H 1M4VA 1RTOA 5FLMG 4AH6A 2NN6I 2XRSD 3N6RA 5M5XH 1ENAA 1G51A 1EYCA 3I4MH 4RHRA 4IFDG 2WP8J 1NMFA 4KY6A 4AYBE 5LL6S 2IL8A 4I7AA 1HFGA 4EX5A 3KUPA 5GQOA 1EFID 3RZDB 4MN3A 3VR6A 5DNFA 5T1GA 3D4RA 1WTHA 3Q0AA 1YVCA 3HOXB 4RAUC 1TS4A 1S5DD 2BDOA 4OWTB 1CM9A 4A3IH 4OEMB 1JJGA 3FHWA 2V1CC 4DV1L 1MKHA 2B2VC 4ZUJA 1EOTA 3VYRA 4RGOS 2HIVA 2RVLA 1CFMA 3MTSA 4F8MA 3VR2A 1STNA 4B3TQ 2JA8G 3K6OA 2JE6I 3TP8A 1VQ8A 2RCNA 1C7YA 1V43A 4WORA 2ES2A 4CGYB 1LTRD 3U50C 4G7HC 1C8CA 5F2DA 2Z6KC 4YHHL 5M3MB 4IQZA 1GM5A 1Y1VG 1RF2D 2MO0A 1LT3D 2NVXB 4A3KG 3JAME 1IBML 3OMCA 2OWOA 3ONAB 1EQTA 4CDDC 4NMZA 1O78A 1QZGA 4FXKC 4JYAL 1KNAA 4A93H 2M2LA 2B29A 4OIKA 1EWCA 3H94A 4IUUA 4XXEA 1MSGA 3A54A 4HAEA 2XIWA 1JJCB 1PTOH 4A3KH 3AB9A 1XNRQ 3J7AF 2KHSA 3GTMH 2K5DA 2ZJRA 1P16A 1PHJA 2ZXOA 2IJ0A 1QE6A 1S4ZA 3URYA 3UDXA 1G6ZA 4MNOA 4KHPQ 4DR1L 5EPKA 1PXUA 3KOJA 3CCQA 2HCCA 3C3LA 2NTSA 3GTKH 2WB1G 4M8AA 3KJOA 1W3SA 2D0PA 3V96A 4C3JB 3QIAA 1LUZA 2B2YA 4XYQA 4R1JA 1EIGA 3VA5A
chains in the Genus database with same CATH topology
1HTPA 5K36H 1Y8NB 2XRQD 1RHPA 5DM63 3PMFA 2K33A 2AWNA 1DD2A 4KHVA 3EJIA 1PFNA 5FKAC 1F9PA 1ZKOA 1U4LA 4J8QA 5ELEA 4EGVA 2NVQB 2QILA 2YYZA 1A2UA 1EYAA 4HCEA 3F2UA 1PYWD 1TQOA 3DWPA 1B4OA 4FXDA 1TS3A 5JEAH 1Z47A 2A74C 2CVRA 2DNEA 2BCOA 4KY5A 3C1FA 4HCSA 1LO5D 1PFMA 1H9SB 2KOLA 1J8IA 2WACA 3I4NB 3VYUA 1KLUD 1TVXA 2CHBD 4RKLA 1AFPA 2A6HD 2Q8RE 3CRLC 4C3HB 2A6EC 4PMWA 2A69C 1IYVA 1CZWA 2A68D 5EKKA 5IIFA 3NBIA 2NUCA 1YNJD 4H13C 3TN2A 3RD4A 1HRJA 5FK9C 4BWGB 1GUWA 2VB3X 4R8IA 5C5MA 3QJYA 3MHBA 1LTAD 3GTKB 1Q12A 4C2MB 2ICIA 3NQTA 5IT9L 2JP1A 3Q22A 1V1PB 3WDNA 1F9QA 4IUPA 4FF2A 5ELDA 3H91A 2NB0A 4WRDA 1SE2A 3W2DA 4CKEA 2KVMA 4L63B 2TMPA 3TSSA 3J81E 1AZPA 4HMJA 3D6CA 4DAPA 1S5ED 5FO9B 4K6DA 1KDBA 2FJ2A 3OW7A 1D6EC 3I72A 1RD9D 4A3FB 3D31A 4K14A 4EQPA 5C4HA 4A3BB 4HTHA 5IGGA 2IX3A 5CORA 1D5ZC 2WAQB 5JPNC 2BA1A 3P7JA 1I4QA 1SXTA 1Y8PB 2PYKA 2EDGA 3FRPB 1GOZA 2JA8B 4MHEA 2L5TA 5D3DA 3OOCA 4IUVA 3IFTA 3PV0A 2CW0D 3BG3A 3V2TA 3A8JE 4Q0FA 3KLSX 3LWUA 3Q23A 5C4XB 4OO1I 3NXWA 5CV7A 3HKZB 3S14B 3I8ZA 3S15B 1SFOB 4B08A 1KLGD 4PNYA 3HOWB 5JOBA 5KYIA 5FLXE 4QMGA 1TY0A 1KTKA 2HDLA 5EBCA 1NR2A 5C0XH 1TWCB 3M3YB 4ILWA 1E2ZA 1DJRD 1TY2A 1SMYC 2AQ3B 4DN4M 1OXXK 2HCIA 4CJ0B 4O42A 4FNFA 3DMUA 2A73B 5KNCA 4XQQA 2GA4B 1A6XA 3SVMA 5CGKA 1L0YB 3SK6A 4WFN3 1CA6A 1STEA 4XQJA 4HSVA 2F0MA 3HRZC 4XIGS 2QKIC 5C3XA 2F0KA 2FHTA 1HFNA 3BVZA 4BA1I 2EVBA 2A6ED 4KMUC 5EKLA 2L1BA 3T13A 1F2LA 2FMCA 4RWSC 2N88A 2A69D 3GD7A 1PRTD 3RUZA 2JSOA 4U68A 5IOCA 2E2HB 1U9RA 2LKVA 3CQZB 5CV8A 3OIQA 1F2YA 2B2UC 5JAVA 4KV6A 1EZ8A 3BYYB 5M5WB 5ELCA 2HUGA 4FF3A 1E2WA 3PUWA 3ND8A 4QF4A 1CZGA 2EZVA 1B1ZA 1SNPA 3OPOA 3E5SA 4KKUA 1JICA 4KK7A 3DWQA 4U673 1FD7D 2CW0C 3DXJC 4ZYSA 3T51B 4C56C 4XT3B 1HQRD 3J80E 4EQOA 1PRTF 1PTOB 4LJZC 3VYTA 1EYDA 1O80A 2R61A 4A3IB 3NK9A 4FVMA 2MHVA 4DAVA 1HA5A 4ABNA 1CHQD 1JE4A 1LT4D 2HDMA 4NKLA 2KECA 1U4MA 2F0JA 3CHBD 2AQ1B 1DXMA 2X6GA 3I90A 2I46A 1R9TB 4KKSA 1ET6A 2EY6A 1UUPA 4QB4A 4V0BA 1WVLA 4OGQC 1STHA 5J1ZA 4L6TB 3S16B 3BYTB 1SE3A 1IL8A 4DK0A 2B2WC 1PMRA 1EY4A 1PFBA 4TRDA 4DFAA 5I2YA 2SNMA 2WB1B 1SAPA 3GTMB 2EY2A 1AN8A 2EJFC 5C0XG 4BA2I 1OXUA 3S17B 2B2YC 1NR4A 1SE4A 4IFDJ 5KRUA 2OT2A 4RGMA 1A2TA 5IGDA 2PNRC 3VA7A 2IWHA 1K83B 3PO3B 3H6MA 2DN8A 4G4KA 2K6AA 1AZQA 1CHPD 1SJED 3EFXD 1TT2A 4HR7B 4QCLA 3S2HB 2MP1A 1J9OA 2LY7A 4A3KB 3QO2A 1T5EA 1DOKA 3CU7A 4QUCA 1BCPB 2EYHA 5FO8B 3NTKA 4KHZA 3GTLB 1UAPA 1AEXA 5JJZA 1V8QA 3EA6A 2B39A 5CV5A 3I70A 5KIXA 1EZ6A 1EY5A 2XNAC 1TR5A 1Z7TA 5M3FB 1O7YA 1G2SA 2FINB 2RSNA 3A7AB 5JVH3 1SYDA 1A15A 4IN3A 1HPCA 1I6HB 4ZRZA 3I4MB 2EYFA 5J39A 1W6JA 2K01A 4FF1A 1BCPF 1TWFB 3NBHA 3BVMA 2KCCA 5E1FA 1SDFA 3T4AC 1B9MA 2K32A 3K7AB 5TSSA 3TMEA 1UEAB 1DM0B 1WD1A 1ENCA 1BNZA 4DA2A 3FKIB 3MFGA 1VCIA 1F2ZA 1NCVA 3HOZB 4G7ZC 3NHHA 2ID0A 4OIJA 2G9DA 3ERQA 4KN7C 1XTCD 5C4JB 4DGZA 4LAAA 1UNSA 4IUQA 4CHTB 2RQXA 4C1NK 4BBRB 4KTAA 3D4WA 3SK8A 2B8FA 4A3GB 4EQNA 1SMYD 5K5PA 3A8IE 1JR0D 4HMIA 5JPMC 4DF7A 2JYOA 2E74C 3MXUA 1G8ZD 1YNNC 4ZUIA 2ZT9C 4J1MA 3GTJB 1SSOA 1BF4A 3H09A 2C9OA 2RA4A 2E76C 3KLRA 5K36G 2LFNA 5IT9E 5IODA 2F3WA 1HA6A 2BE5C 2O5JC 4KD4A 5C5LA 3K5OA 1GJXA 1TWAB 4BS9A 3U9OA 1PTOC 1QOHA 2Z8LA 3EVQA 5C3WA 1TS5A 2QCPX 1PRTC 2F4IA 4PQXA 2DY8A 1R4PB 3SE0A 3E0JA 5A35A 2RDHA 2E2DC 1BBXC 2K5QA 5DM73 1JOKA 3K59A 1CI3M 2BDNA 3P20A 2K28A 1PDQA 3K5MA 2EJMA 1JCKB 1B53A 1FR3A 4RCOA 3FDTA 2R7ZB 1Q90A 1B3AA 1MSHA 2SNSA 5COYA 3TBIB 1ENFA 2WV6D 2PZTA 3T56B 1SNQA 2K05A 5CR3A 1LV9A 3R3OA 4KN4C 5EBDA 3V05A 3H3VC 4A93B 1STAA 2IW3A 3KBGA 4HEDA 3I4LA 3IL8A 1WTWA 2K7VA 2XWJB 1JWSD 5G3LD 4F88A 4LK1C 1DOLA 4IZ8A 4RKBA 3Q6SA 1JORA 2IX0A 3PUYA 2AWOA 3R2IA 1STBA 1AW7A 1YNND 4F7XA 4HSPA 2JA6B 4A3MB 3HOVB 1ICWA 3JAML 5CV4A 2L0CA 1OO9B 4IALA 3DM1A 3GP7A 3MFYA 3J7AV 3MXPA 1TS2A 3ND9A 1QJOA 3BZDB 3DHQA 3DEPA 4K5XA 4J6HA 3A8KE 2A68C 3A55A 1PZJD 2HQEA 1I50B 5E4XA 1MI2A 1X3QA 1ILQA 3PUXA 4BY7B 1O7ZA 3A56A 3OIPA 1R4QB 4DXGA 5CBEE 3DEOA 4DNTB 3WOFA 2F0TA 2VB2X 4X3KA 4DU9A 1EEFD 2PZUA 2IX1A 2C5CA 1SNCA 2AQ2B 1SNOA 2EY5A 4I65A 2RDGA 1ZYRD 1LTID 4KJNA 3CRKC 4GZYC 3KLSA 1GHKA 3NSWA 2XVSA 4QIWB 4KI0A 4IFDH 1DONA 2FFKB 1B2TA 5C0XJ 5JEAJ 1GUSA 5ISRA 5I4DA 1ONLA 2F0NA 3GTGB 5EPJA 5C6AA 4OO1G 1GUOA 2J7ZA 4CJ1B 5KNDA 2JA7B 4HN7A 1GUGA 4TKOB 3J7YW 3N52A 3T53B 2F0FA 1PZID 5EQ0A 4DAYA 1ZEQX 2G9HD 1QCBD 1ZXTA 3S1QB 1QNUA 1EL0A 2BA0A 2EY1A 3IKJA 1JOQA 3HGBA 4PV1C 2KQ3A 5CV9A 3SHLA 2K5WA 2F0WA 4M1UB 1FGBD 2SEBD 3KK7A 3GTPB 1B50A 1Y1WB 4H7BA 3BDOA 1CT1D 2F0OA 1FNUA 2L55A 2VXWA 3RZOB 1EY9A 3PIO3 3G7LA 3C1EA 5I9PA 2RKSA 5I6WA 3IFDA 3L7ZC 1I4XA 1PZKD 4JBWA 4ZAIA 5IGBA 2D2CC 5E4WC 3QOJA 1ESRA 5I6YA 1Q3LA 5FLXL 1SNDA 1WTXA 1AP0A 3K5NA 2RBMA 3GV3A 4Z9CB 3UI2A 1V1PA 2M00A 3L3OC 4UDUC 3M7NA 5KYLA 4XQNA 2F3VA 1IW7D 3FEWX 4ZK9B 4EVOA 3P1HA 1H9KA 1B44D 4KJOA 3M7GA 1E2VA 2DY7A 3MA2B 3HS0C 1JB3A 5EKIA 1EY0A 4OO1H 1CTMA 1TKWB 3S1MB 2LMCB 2ZXPA 4ULLA 2NBFA 3OWFA 2XSCA 3S2DB 1QILA 2H4OA 3Q24A 2EXZA 1H9RA 4XT1B 3PIP3 2KA7A 2RDFA 3M4OB 1OXTA 2E75C 4OHJA 3R8BA 3MAQA 3OWEB 1A3TA 1DOMA 1MBYA 1VF5C 1SYGA 4I7ZC 4IURA 2K03A 2L9HA 4XDXA 3HG9A 4K8JA 2PPBC 2B2UA 2ZXRA 2BOSA 2EE1A 3GO5A 1RKNA 1RODA 3NTHA 1S5CD 3BS1A 5E3FA 5G3LF 4ME5A 3TDQA 4DNRB 1I3QB 2VUMB 1RCVD 4AYBB 2MGSA 4CKBA 2F0PA 5BN5A 1KAAA 1BOSA 3NP8A 5LL6X 1NAPA 1Q8IA 2F0QA 3X3NA 5EJWA 3MVVA 1EY7A 4ID6A 2RSOA 2B2VA 2B2WA 1I4PA 3D6WA 3IAYA 4BBSB 1SYFA 4NDXA 4P2CB 2AUKA 2B8GA 1RDPD 3MZ5A 3GV6A 3QOLA 4X3SA 4RFBA 1C4QA 3FPUB 4K2KA 1XWEA 2MPMA 1TU2B 3D4DA 3W3AA 2L4NA 3H0GB 4K2LA 5FO7B 2WKDA 3C46A 4A3JB 3SXHA 4C3HG 2X69A 2NVYB 1X32A 1TIID 1BQQT 2A6HC 3M85A 4ZQ3A 1DZ1A 4WJWA 2NWGA 3NE5B 2KUMA 5A2QL 4N9PA 4NP5A 1LLRD 4UAIA 1W6KA 2WIIB 5HURA 1U4RA 1HHVA 3DUZA 2XN9C 2D62A 2KEEA 1HXYD 4FO2A 1II3A 3PO2B 4C3IB 4XTCS 2PMZB 1LT5D 1SJHD 3J80L 1WTVA 4G7OC 3VR4A 3MC0B 1ML0D 3NQIA 3MWYW 4LMQD 4Y7NB 1BUVT 2NTTA 1KNEA 3SEBA 5EGTA 1EU3A 1ET9A 2FMMA 1I4HA 1E0BA 2JXMB 2OXPA 5CBAE 1VMPA 4L8JA 1F9SA 1SBBB 1PTOD 1A3VA 1LTTD 2J0TD 5HGTA 3O13A 3MEHA 4O1NA 1PLFA 4B9XA 2F0GA 1D1KA 5M9OA 1OXSC 1HUMA 2O2LD 1WTRA 1Q1EA 3T16A 2V4DA 4H0LC 4G57A 1B9NA 4ODGA 3HOYB 2PZWA 2NN6H 1HQMC 2EYMA 2X6LA 2O4XA 5IGCA 3R93A 1ESFA 2QF7A 2YU9B 5CC4A 1MD2D 4CBVA 1VF7A 2F1MA 2EYLA 3K57A 2QEJC 3EROA 1LACA 3HZXA 2F0IA 2JA5B 3PUVA 3FPPA 1H9JA 1F77A 2F0LA 1H9SA 3U9SA 3I73A 1ILPA 2EJGC 5NUCA 1STGA 1Z6HA 2Z4HA 2KEDA 2B2TC 1IHZA 1JWUD 5M5XB 2PO4A 1WTQA 4QUFA 3MXGA 2O5IC 1EWHA 3VYSA 3S1RB 2F0SA 1CQFA 3QG1A 3I91A 3D8GA 5KNBA 1BO0A 2ICEC 2CQAA 3TP5A 4RHSA 4RGTA 1JWMD 2J4XA 4PMCA 3I3CA 4C3IG 1LABA 4IFDI 5DEHA 2F03A 1EQVA 1I4RA 3HOUB 2JEAI 1BCPD 1CK1A 4NW2A 1Q1BA 1U4PA 2EOTA 4KY7A 2EYJA 4FF4A 1IW7C 2ENBA 1F2MA 3ZYYX 4RCNA 4RGNA 3PUZA 4MIUA 4E6IA 3SK5A 1EEID 3HEJA 1VDZA 3WOEA 1OXVA 3TZDA 1BR9A 3HP3A 2D5DA 4ZKBB 2Q8IB 1HUNA 2H1EA 3X3MA 1KABA 3AMUA 5C3EB 2L11A 1LTGD 1S5FD 5LHY1 1FNWA 5C4ZA 2K04A 2F0VA 2D9UA 2MUYA 3MXNA 1QB5D 5KEEA 2L12A 1XXGA 3SDZA 2K1BA 2XWBB 4K8IA 3VR5A 1S5BD 1L0XB 1D5XC 1QG7A 4IUNA 4BY1B 2NZ1D 3LX0A 1GUTA 1NUCA 2NYZD 3LNNA 1SYCA 4RA8A 1JOOA 4N9TA 5CYUA 2EYPA 1EU4A 3L9AX 2BE5D 2B63B 2F0EA 3SK4A 2AUJD 3NTIA 4TQUS 1GHJA 1WTOA 3NPPA 4KD3A 1IKMA 1D1IA 3AU7A 4R9WA 1T5XD 5I2XA 3D3RA 2Y0SB 1DYQA 4OL7A 3SR1A 4H44C 4K6LA 1O7LA 3E6ZX 1MGSA 2E2IB 3RLFA 2TSSA 1WD0A 4R8NA 1EY6A 4A3EB 2IPKD 1JC7A 5D65A 2KJXA 3BDCA 3OSOA 2A5HA 1CQVA 1NSNS 2DNCA 2PCFB 1QWYA 1Y8OB 2OF1A 2E2JB 2Z4IA 1Y1VB 1EIHA 1LTSD 1KDAA 5T1IA 1HCZA 2WINB 5KGUA 1K8MA 1X3PA 5DAUA 3M4YA 2JEBI 2PW5A 4B9WA 2PW7A 1XX8A 3GTQB 3CKIB 4ZKCB 1PTOF 1PRTB 3A7LA 1JQYD 4YIJA 5J22A 3P75A 1FYCA 2KCNA 5I9OA 5JEAG 3TP7A 2I07B 3QB3A 2SOBA 5BN3A 2R6GA 1LT6D 5JVG3 2OEOA 1V1OA 1SYEA 3G6JB 3K0YA 4F87A 3S9WA 4FP5D 2PQEA 1SEBD 4DK1A 2R93B 3R2TA 2QDBA 2R3ZA 2NN6G 3EQLC 4JK1C 5CMDA 1WCMB 3NUCA 5C44B 4KKTA 2MJ8A 1BCPC 1CA5A 1QNKA 5D3IB 1G291 1ZYRC 1KDCA 5FOBB 5D14A 2IT1A 2B2TA 1M8AA 2EYOA 1K8OA 4DXFA 1D2BA 3VR3A 1WTPA 2F0UA 1H9MA 1BXTA 4IUTA 3J81L 2Q8TA 1I6VC 3S1NB 1STYA 2Z1CA 3LWEA 4CKCA 5M5YB 3KBXA 4Q5VA 1FNVA 3DWAA 4K5WA 1EY8A 1SNMA 1GUNA 4A3DB 4XYOA 5IGFA 4X3UA 3BDLA 1VMCA 5EPLA 1IKLA 3OHXC 4S3SA 1BDOA 3GQBA 3TZUA 1SYBA 4ZLTF 1RJTA 4C1NI 1A3UA 4TSSA 2F0HA 2NVTB 4FYDA 1HTLD 2EPBA 1RTNA 2F0DA 3QWNA 4CJ2C 5BN4A 1GXDC 2M9VA 3K58A 3FMCA 2VNUD 4FXGC 4V190 3ITPA 3K5LA 3KF8A 4RH6A 4PMBA 1I4GA 1D5MC 5AFWA 2N55A 3FVQA 5A2QE 1C48A 4X3TA 3NWSA 5ELBA 1TWGB 3OMGA 3C2PA 5IGEA 1IYUA 2WKCA 3TP6A 3GTOB 1LTBD 1Y69U 1XYIA 2LS01 1G2TA 5CV6A 2R92B 3NWTA 3RMHA 1DCZA 2SDFA 1TWHB 4K5VA 1F9RA 5C0XI 3BVGA 1YNJC 4C3JG 1G91A 5ELFA 1M4VA 1RTOA 2NN6I 2XRSD 3N6RA 1ENAA 1EYCA 4RHRA 4IFDG 2WP8J 4KY6A 5LL6S 2IL8A 1HFGA 3KUPA 1EFID 3RZDB 4MN3A 3VR6A 5DNFA 5T1GA 3D4RA 3Q0AA 3HOXB 4RAUC 1TS4A 1S5DD 2BDOA 1CM9A 2B2VC 4ZUJA 1EOTA 3VYRA 4RGOS 2RVLA 1CFMA 3MTSA 4F8MA 3VR2A 1STNA 3K6OA 2JE6I 3TP8A 1V43A 4WORA 4CGYB 1LTRD 4G7HC 1C8CA 5F2DA 5M3MB 4IQZA 1RF2D 1LT3D 2NVXB 3JAME 3OMCA 3ONAB 1EQTA 4NMZA 1O78A 4FXKC 1KNAA 2M2LA 4OIKA 1EWCA 3H94A 4IUUA 4XXEA 1MSGA 3A54A 4HAEA 2XIWA 1PTOH 3AB9A 3J7AF 2KHSA 2K5DA 2ZXOA 2IJ0A 1QE6A 1S4ZA 3URYA 1G6ZA 5EPKA 1PXUA 2HCCA 3C3LA 2NTSA 4M8AA 3V96A 4C3JB 3QIAA 2B2YA 4XYQA 1EIGA 3VA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SDZ A;  1FYC A;  1H9S A;  3U9S A;  3I73 A;  4KHZ A;  2PPB C;  1HTP A;  2EJG C;  3VR5 A;  1Z6H A;  5K36 H;  1Y8N B;  5KNC A;  5JEA G;  2B8F A;  4XTC S;  3T56 B;  3VR6 A;  1V8Q A;  3A8I E;  3D4R A;  5BN3 A;  1A6X A;  5BN4 A;  2R6G A;  2K33 A;  4G7O C;  2BDO A;  1GUT A;  3VR4 A;  2O5I C;  3LNN A;  1DD2 A;  4KN4 C;  1EWH A;  3L7Z C;  2E74 C;  3FMC A;  3CRK C;  3MXU A;  4JBW A;  3OW7 A;  3I72 A;  4GZY C;  1YNN C;  4DNR B;  2BE5 D;  1GHK A;  1Z7T A;  3I4L A;  1DXM A;  2ZT9 C;  1ZKO A;  3QG1 A;  2K7V A;  4XIG S;  2D2C C;  4DK1 A;  4KI0 A;  1CFM A;  4IFD H;  3D31 A;  2NN6 G;  3EQL C;  4LK1 C;  5BN5 A;  2YYZ A;  5KNB A;  4KKS A;  4JK1 C;  4BA1 I;  3VR2 A;  2AUJ D;  2JE6 I;  4TQU S;  2EVB A;  1GHJ A;  1GUS A;  4OGQ C;  1V43 A;  2JXM B;  3A7A B;  2A6E D;  4KKT A;  1ONL A;  4KMU C;  1HPC A;  2E76 C;  3KLR A;  3M7N A;  5JEA H;  4G7H C;  5K36 G;  2BA1 A;  1LAB A;  3PUY A;  1G29 1;  2DNE A;  4L8J A;  1ZYR C;  2AWO A;  4OO1 G;  1IW7 D;  4DK0 A;  1GUO A;  4IQZ A;  2A69 D;  2BE5 C;  1H9S B;  1Y8P B;  1PMR A;  2O5J C;  5KND A;  3GD7 A;  2EDG A;  2IT1 A;  4H44 C;  2AUK A;  2B8G A;  1GUG A;  1O7L A;  4TKO B;  2JEA I;  1H9K A;  1E2V A;  3T53 B;  1Q1B A;  1GJX A;  1K8O A;  2A6H D;  3RLF A;  3VR3 A;  2L5T A;  3CRL C;  1IW7 C;  2EJF C;  1O78 A;  5C0X G;  2KCC A;  3OOC A;  2A6E C;  4BA2 I;  1H9M A;  3IFT A;  3PV0 A;  1TU2 B;  2A69 C;  4RCN A;  1IYV A;  4OO1 H;  1OXS C;  1IYU A;  2A68 D;  1OXU A;  3W3A A;  1CTM A;  3PUZ A;  3BG3 A;  1TKW B;  1Q1E A;  4H13 C;  3MFY A;  1Y69 U;  3A8J E;  1I6V C;  2V4D A;  1B9M A;  2LMC B;  2K32 A;  3LWU A;  1E2W A;  2DNC A;  3H94 A;  3PUW A;  3ND9 A;  2PCF B;  1Y8O B;  1QJO A;  3ND8 A;  4H0L C;  1DCZ A;  1VDZ A;  3SE0 A;  4DNT B;  1OXV A;  1B9N A;  5A35 A;  3QJY A;  2BA0 A;  2D5D A;  3A8K E;  3AB9 A;  2PNR C;  2A68 C;  3IKJ A;  1Q12 A;  2NN6 H;  1HQM C;  1GUN A;  3HGB A;  1H9R A;  2A6H C;  2Q8I B;  3M85 A;  3OPO A;  4PV1 C;  2KA7 A;  3VA7 A;  1CI3 M;  1HCZ A;  1VCI A;  4KKU A;  3WDN A;  1OXT A;  2QF7 A;  3NE5 B;  1K8M A;  2CW0 C;  2DN8 A;  2E75 C;  3P20 A;  4G7Z C;  3DXJ C;  1YNJ C;  2EJM A;  3M4Y A;  1VF7 A;  2F1M A;  2JEB I;  3T51 B;  3PUX A;  1FR3 A;  5C0X H;  4KN7 C;  4HR7 B;  1E2Z A;  1VF5 C;  2NN6 I;  3N6R A;  1LAC A;  4LJZ C;  4I7Z C;  4IFD G;  1Q90 A;  1SMY C;  1T5E A;  1BDO A;  2D62 A;  3BDO A;  3QIA A;  1OXX K;  3A7L A;  3GQB A;  3TZU A;  3PUV A;  3FPP A;  1H9J A; 
#chains in the Genus database with same CATH topology
 1HTP A;  1E7Z A;  5K36 H;  1Y8N B;  2XRQ D;  2B3G A;  1RHP A;  5DM6 3;  3PMF A;  2K33 A;  2AWN A;  3GTQ H;  1DD2 A;  3PGZ A;  1SRU A;  3ULL A;  1YJ9 A;  1XMQ Q;  4KHV A;  3EJI A;  1PFN A;  2H5X A;  5FKA C;  1F9P A;  3G6E A;  1ZKO A;  1U4L A;  4J8Q A;  4JI7 L;  5ELE A;  1TWC H;  4EGV A;  3M3Y H;  1YHB A;  2NVQ B;  2QIL A;  2I5M X;  2YYZ A;  1A2U A;  1EYA A;  3CCM A;  4BY1 G;  4HCE A;  4POG A;  1FL0 A;  3B6Y A;  3F2U A;  1PYW D;  4GKK L;  4PZ6 A;  1TQO A;  3DWP A;  1B4O A;  4GLV B;  4FXD A;  4L5R C;  1TS3 A;  3FKI H;  3SGI A;  3CCU A;  2WFW A;  5JEA H;  1YBY A;  1Z47 A;  2A74 C;  1YIT A;  2CVR A;  2DNE A;  2BCO A;  2CFM A;  4KY5 A;  4A93 G;  3C1F A;  1PH3 A;  4HCS A;  1UE6 A;  1LO5 D;  2D0O A;  1PFM A;  1H9S B;  1SR3 A;  2KOL A;  4TVA B;  4DUZ Q;  4YY3 L;  1J8I A;  5IWA L;  2WAC A;  3I4N B;  3VYU A;  1KLU D;  1TVX A;  2CHB D;  3TRZ A;  4RKL A;  1AFP A;  2A6H D;  2Q8R E;  1Y1V H;  3CRL C;  1C0A A;  4C3H B;  4KHP L;  4ME3 A;  4X62 Q;  2A6E C;  1X9N A;  4PMW A;  2A69 C;  3L0O A;  1IYV A;  1CZW A;  2NZH A;  4A3M G;  2A68 D;  5EKK A;  5IIF A;  1J5E L;  3NBI A;  2NUC A;  1A0I A;  1YNJ D;  4H13 C;  3TN2 A;  3RD4 A;  1EFW A;  3T1H L;  1HRJ A;  5FK9 C;  1PH6 A;  1GVP A;  1KD1 C;  4BWG B;  3DM3 A;  2C35 B;  4CDC C;  1GUW A;  4N8F A;  2VB3 X;  1L2F A;  4R8I A;  5C5M A;  4PZ7 A;  3QJY A;  3MHB A;  1LTA D;  3GTK B;  2FXQ A;  5HGQ A;  1Q12 A;  4C2M B;  1EIY B;  2ICI A;  3NQT A;  5IT9 L;  4CDE C;  2JP1 A;  3CQZ H;  3Q22 A;  1V1P B;  2Y0S E;  3WDN A;  2IY5 B;  4O0A A;  4OON A;  1F9Q A;  1HR0 L;  2E5L L;  4DV3 Q;  2OQK A;  4IUP A;  4FF2 A;  4JG2 A;  5ELD A;  3H91 A;  2NB0 A;  1XMO L;  4JBK A;  4WRD A;  5H1S E;  4LFA L;  1SE2 A;  3W2D A;  4OWW B;  4CKE A;  2KVM A;  4L63 B;  1L1O C;  2TMP A;  4AYB G;  1HNW Q;  3TSS A;  3J81 E;  3KF8 B;  1AZP A;  3HOW H;  4HMJ A;  3I4M G;  3D6C A;  4A3B H;  3ULJ A;  4DAP A;  1S5E D;  5FO9 B;  4K6D A;  1KDB A;  2FJ2 A;  3CCR A;  3OW7 A;  1D6E C;  1S3O A;  3I72 A;  1S40 A;  2PQA B;  2CWA A;  1RD9 D;  4A3F B;  3J81 c;  1MIU A;  3D31 A;  1KAW A;  4K14 A;  4EQP A;  5C4H A;  4A3B B;  4HTH A;  4HJ7 A;  4R4O A;  5IGG A;  2IX3 A;  4DR1 Q;  5COR A;  1D5Z C;  4JYA Q;  3S14 H;  2WAQ B;  2A19 A;  1TWH H;  2JA9 A;  2UU9 L;  1P8L A;  4IPC A;  5JPN C;  2BA1 A;  3P7J A;  2DGY A;  1HNW L;  1I4Q A;  5GAH C;  1SXT A;  1Y8P B;  4R4C A;  1PH9 A;  2PYK A;  2EDG A;  4A3J H;  4GN4 B;  3FRP B;  1GOZ A;  2JA8 B;  4MHE A;  3CXC A;  2L5T A;  5M5W H;  1GO3 E;  2IHF A;  5D3D A;  3OOC A;  3UE1 A;  2ZJP A;  4IUV A;  3IFT A;  3PV0 A;  2CW0 D;  4A3E H;  5M3M G;  3BG3 A;  3V2T A;  3A8J E;  4Q0F A;  3KLS X;  3LWU A;  3PO2 G;  3Q23 A;  5C4X B;  3LGJ A;  4OO1 I;  5IP7 G;  3S1M H;  3NXW A;  1Q82 C;  2K50 A;  1Y1W H;  5CV7 A;  2VS1 A;  3HKZ B;  4R4T A;  1ASY A;  4LUZ A;  3S14 B;  3I8Z A;  3S15 B;  1T9H A;  1WFQ A;  4B08 A;  1SFO B;  1KLG D;  3E0E A;  3KLW A;  4PNY A;  3BU2 A;  4GOP C;  3HOW B;  5JOB A;  4JV5 Q;  4JI2 Q;  5KYI A;  1PYS B;  5FLX E;  4QMG A;  1TY0 A;  1KTK A;  2HDL A;  5EBC A;  1NR2 A;  2GVA A;  3F2C A;  5C0X H;  1TWC B;  3M3Y B;  4ILW A;  5JJI A;  1E2Z A;  3HOY H;  1VQC A;  1DJR D;  1TY2 A;  1SMY C;  2AQ3 B;  4DN4 M;  4NB3 A;  1OXX K;  4JV5 L;  4DK3 C;  5LMN W;  2HCI A;  4CJ0 B;  4O42 A;  2I5L X;  4FNF A;  3DMU A;  2A73 B;  1RIP A;  5KNC A;  1QVC A;  4XQQ A;  2QEX A;  4JBM A;  1DGS A;  2GA4 B;  1HNX L;  4MTK A;  1A6X A;  1U5K A;  3SVM A;  3TRE A;  2BH2 A;  2ZTD A;  5CGK A;  1L0Y B;  3SK6 A;  4WFN 3;  4GKJ Q;  4N8X 1;  1CA6 A;  1STE A;  4XQJ A;  4HSV A;  2F0M A;  4X64 Q;  3HRZ C;  4A3G H;  3NEM A;  4XIG S;  2QKI C;  5C3X A;  4BBS G;  2F0K A;  1A8V A;  4QGU A;  2FHT A;  1HFN A;  1XPU A;  4DR5 Q;  2UXD L;  3BVZ A;  4NXN L;  4BA1 I;  3HOV H;  2EVB A;  2A6E D;  4KMU C;  5EKL A;  1EUJ A;  2L1B A;  3T13 A;  3W1G A;  1F2L A;  2FMC A;  4RWS C;  3HOU H;  4QQB X;  2N88 A;  2A69 D;  2N49 A;  3GD7 A;  1PRT D;  3RUZ A;  2JSO A;  4P74 A;  4U68 A;  5IOC A;  3K7U C;  2E2H B;  1U9R A;  1K0S A;  2LKV A;  3CQZ B;  5CV8 A;  3OIQ A;  2XGT A;  1F2Y A;  4IPD A;  3JAM i;  2B2U C;  1EQQ A;  5JAV A;  4KV6 A;  1EZ8 A;  1B70 B;  3BYY B;  5M5W B;  1QZH A;  5ELC A;  2HUG A;  5IYD H;  1O7I A;  4FF3 A;  1E2W A;  3PUW A;  3ND8 A;  4DR3 L;  5IYC G;  4QF4 A;  1CZG A;  4L5S A;  1N36 L;  1WCM G;  2EZV A;  1K0R A;  1B1Z A;  1WCM H;  4NXN Q;  2OCE A;  1SNP A;  2R7F A;  1L0W A;  3OPO A;  1X6O A;  3E5S A;  4KKU A;  1JIC A;  1UEB A;  2YTX A;  4KK7 A;  3DWQ A;  4U67 3;  1FD7 D;  2CW0 C;  1XNQ Q;  4C3I H;  3DXJ C;  4ZYS A;  3T51 B;  4C56 C;  4XT3 B;  2EXD A;  3K81 C;  1HQR D;  3F2D A;  2F52 A;  3J80 E;  2PI2 A;  3HKZ G;  2JA6 H;  4EQO A;  4JVZ A;  1PRT F;  1PTO B;  4LJZ C;  3VYT A;  1E3P A;  1EYD A;  1O80 A;  2R61 A;  4LUO A;  4A3I B;  3NK9 A;  4FVM A;  4R4Q A;  2MHV A;  4DAV A;  2A1A A;  3GTL H;  1HA5 A;  4ABN A;  1CHQ D;  1JE4 A;  4GOP A;  1FJG L;  1D8L A;  1LT4 D;  5EAY A;  2HDM A;  3F8T A;  1XPO A;  2WAQ G;  1W2B A;  4NKL A;  2KEC A;  1U4M A;  1I5F A;  2F0J A;  3M9B A;  3CHB D;  2AQ1 B;  4FDB A;  3E9I A;  4BBS H;  1DXM A;  2X6G A;  3TS2 A;  3I90 A;  2I46 A;  2JA6 G;  1R9T B;  1VQH A;  4KKS A;  1ET6 A;  2EY6 A;  1UUP A;  4QB4 A;  4ZCK A;  1PH4 A;  4V0B A;  1WVL A;  1YI2 A;  4OGQ C;  5C44 H;  1STH A;  5J1Z A;  4L6T B;  3S16 B;  3BYT B;  3NEN A;  3M4P A;  4UY8 C;  1SE3 A;  1IL8 A;  1VQ7 A;  4DK0 A;  2B2W C;  1VQO A;  2AHO B;  4LF6 Q;  1PMR A;  1EY4 A;  1PFB A;  4TRD A;  4DFA A;  5I2Y A;  5GAG C;  5IYC H;  2SNM A;  2UUC L;  2WB1 B;  1SAP A;  4JI1 Q;  3GTM B;  2EY2 A;  1AN8 A;  2EJF C;  5IYD G;  2CKZ B;  5C0X G;  4BA2 I;  3WWV A;  1OXU A;  4DR7 L;  3S17 B;  2B2Y C;  2LXK A;  2ATW A;  4QY7 A;  4DK6 C;  1NR4 A;  4BY7 H;  1SE4 A;  3S2D H;  4IFD J;  4JW0 A;  5KRU A;  2OT2 A;  4RGM A;  4JI2 L;  1EOV A;  1A2T A;  2ZM6 Q;  5IGD A;  2PNR C;  1CKO A;  3H0G G;  1HZC A;  1Y1W G;  2HHH Q;  3VA7 A;  4A4I A;  2IWH A;  1K83 B;  4OXP A;  3PO3 B;  3H6M A;  2DN8 A;  4G4K A;  2K6A A;  2EIF A;  1AZQ A;  1CHP D;  1SJE D;  3EBE A;  3KDF A;  3EFX D;  4HR7 B;  1TT2 A;  4QCL A;  3S1N H;  3S2H B;  2MP1 A;  1J9O A;  2LY7 A;  4A3K B;  4GLX A;  3QO2 A;  1T5E A;  1VQD A;  4A3G G;  1DOK A;  3CU7 A;  4QUC A;  3RR5 A;  1BCP B;  2EYH A;  2QW7 A;  5FO8 B;  1HZB A;  3NTK A;  4RMF A;  4KHZ A;  5ELN A;  3GTL B;  1UAP A;  1AEX A;  3KJP A;  2UXB Q;  5JJZ A;  4LFB Q;  1V8Q A;  4LFA Q;  3S1Q H;  3EA6 A;  3QR8 A;  4PZ8 A;  3STB D;  2B39 A;  5CV5 A;  1PH2 A;  3I70 A;  4DR7 Q;  5KIX A;  4LF4 L;  1EZ6 A;  2Q2T A;  1EY5 A;  3F1Z A;  2XNA C;  1TR5 A;  3TS0 A;  1Z7T A;  2Z6K A;  5M3F B;  4MTN A;  1O7Y A;  3FP9 A;  1X3F A;  1G2S A;  3I7F A;  1IBM Q;  3H0G H;  3ULP A;  2FIN B;  2RSN A;  3S15 H;  2RF4 A;  3A7A B;  5JVH 3;  1SYD A;  1A15 A;  4IN3 A;  1HPC A;  1XMQ L;  1K73 C;  4ZRZ A;  4GLA C;  4HID A;  3I4M B;  1I6H B;  1G6P A;  2KBN A;  3KF6 B;  2EYF A;  5J39 A;  1W6J A;  2I5H A;  1LYL A;  1Z9F A;  2YV5 A;  2K01 A;  1IYJ B;  3PQI A;  4FF1 A;  1BCP F;  1TWF B;  3NBH A;  3BVM A;  2KCC A;  5E1F A;  1SDF A;  3T4A C;  3RN2 A;  1PH8 A;  1B9M A;  4DV2 Q;  2K32 A;  3K7A B;  5TSS A;  5J3B A;  4DR6 Q;  3TME A;  1IBK L;  2ZM6 L;  1UEA B;  2Q2U A;  1DM0 B;  1WD1 A;  3J81 i;  1ENC A;  1JT8 A;  2XTI A;  5BR8 Q;  1BNZ A;  4DA2 A;  3FKI B;  3MFG A;  1VCI A;  3A74 A;  3BJU A;  1XNR L;  1F2Z A;  4LF7 L;  1NCV A;  4DV4 Q;  3HOZ B;  4G7Z C;  3NHH A;  4JBJ A;  1HR0 W;  2ID0 A;  4OIJ A;  2G9D A;  3ERQ A;  4KN7 C;  1XTC D;  5C4J B;  4LW1 A;  4DGZ A;  1VQA A;  4LAA A;  3KF6 A;  1UNS A;  4IUQ A;  2UUB Q;  3I55 A;  4IPH A;  3BZC A;  4CHT B;  2RQX A;  4LF5 Q;  4C1N K;  4BBR B;  4KTA A;  3D4W A;  3HKZ E;  1N9W A;  1FVI A;  3SK8 A;  2B8F A;  4A3G B;  4LFB L;  1YEZ A;  4EQN A;  1SMY D;  5K5P A;  3A8I E;  1CSP A;  2PQA A;  1JR0 D;  4HMI A;  5JPM C;  2R7D A;  2K14 A;  5LMU L;  5GAE C;  3UDG A;  4DF7 A;  2JYO A;  2E74 C;  2DUD A;  3MXU A;  2CWP A;  1G8Z D;  2IHE A;  1VQN A;  5IWA Q;  1YNN C;  4ZUI A;  2ZTC A;  2ZT9 C;  4J1M A;  3KDF B;  2R92 H;  2ZJQ A;  3GTJ B;  1WOC A;  1SSO A;  1BF4 A;  4JI6 Q;  2R7Z G;  3H09 A;  4ALP A;  4OWX B;  2C9O A;  4DV5 L;  2RA4 A;  1A62 A;  2E76 C;  3KLR A;  5K36 G;  3CPW A;  1EYG A;  2LFN A;  2NVQ H;  5IT9 E;  5IOD A;  2UUA L;  2F3W A;  1HA6 A;  2BE5 C;  4JI8 Q;  2O5J C;  4KD4 A;  3KYH C;  1E24 A;  5C5L A;  3K5O A;  1K8G A;  1GJX A;  1TWA B;  4BS9 A;  3U9O A;  5FJ8 G;  1SFO H;  1PTO C;  1QOH A;  2Z8L A;  3I2Z A;  3EVQ A;  5C3W A;  3PO2 H;  1C9O A;  4GKJ L;  2KCM A;  1TS5 A;  1M1K C;  2QCP X;  1PRT C;  1QVF A;  3A5U A;  1QUQ A;  4DKA C;  2F4I A;  4PQX A;  2DY8 A;  3CD6 A;  1R4P B;  3SE0 A;  3E0J A;  5A35 A;  1N36 Q;  3HOV G;  2RDH A;  2E2D C;  3G4S A;  1BBX C;  2K5Q A;  3UDI A;  1SN8 A;  5DM7 3;  1JOK A;  4JI6 L;  2VQE Q;  3K59 A;  1CI3 M;  3CW2 C;  2BDN A;  1N34 Q;  2N78 A;  3P20 A;  2K28 A;  3K80 C;  1PDQ A;  3K5M A;  1X55 A;  2EJM A;  1JCK B;  1B53 A;  1FR3 A;  5LMU Q;  1IXR A;  4RCO A;  3FDT A;  2R7Z B;  2ZTE A;  1Q90 A;  1B3A A;  1MSH A;  2SNS A;  1ICF B;  4X65 Q;  4JCV E;  1BKB A;  5COY A;  3STB C;  3TBI B;  1ENF A;  2WV6 D;  2RHS B;  4JI5 L;  2PZT A;  3T56 B;  1SE8 A;  2UXC L;  1SNQ A;  2K05 A;  5CR3 A;  1RL2 A;  1LV9 A;  3M4Q A;  4K0K Q;  4GNX B;  2RCF A;  4OEL B;  3R3O A;  4KN4 C;  5EBD A;  3CCE A;  3V05 A;  2WB1 E;  3H3V C;  4A93 B;  4BBR G;  1STA A;  2IW3 A;  3KBG A;  4B3T L;  4HED A;  3I4L A;  3IL8 A;  1WTW A;  2K7V A;  2XWJ B;  1JWS D;  1BBW A;  5G3L D;  4F88 A;  5IE8 A;  4LK1 C;  4A3I G;  4JOI C;  2E2I H;  1DOL A;  4IZ8 A;  1J6Q A;  4A3F G;  4RKB A;  3Q6S A;  1JOR A;  2IX0 A;  3PUY A;  2VUM H;  2AWO A;  3R2I A;  2UU9 Q;  1STB A;  4X6A H;  1AW7 A;  1B7Y B;  1YNN D;  4DV5 Q;  4F7X A;  4HSP A;  4LF6 L;  2JA6 B;  4A3M B;  1QVG A;  3HOV B;  1ICW A;  3HOX G;  3JAM L;  3RLN A;  5CV4 A;  3A5Z B;  4NXM L;  4HJ9 A;  4YCU A;  2L0C A;  1OO9 B;  4IAL A;  3DM1 A;  3GP7 A;  3MFY A;  3J7A V;  3MXP A;  1TS2 A;  5IT9 c;  3ND9 A;  1QJO A;  3BZD B;  3DHQ A;  3DEP A;  4K5X A;  2K4K A;  2HQL A;  4J6H A;  4R4I A;  3A8K E;  2A68 C;  3A55 A;  1PZJ D;  4BXX G;  2HQE A;  2MFI A;  1KIX A;  1I50 B;  5E4X A;  2PI2 E;  1PFS A;  4GNX C;  1MI2 A;  3PIO A;  2UUB L;  4LUV A;  4HJ8 A;  1X3Q A;  1B3Q A;  1ILQ A;  3PUX A;  4BY7 B;  2JA8 H;  3FKI G;  1O7Z A;  3A56 A;  3OIP A;  1FGU A;  3S16 H;  3HOX H;  4BY1 H;  1R4Q B;  4DXG A;  5CBE E;  4B3M L;  2UXB L;  3HOW G;  1YNX A;  3DEO A;  4DNT B;  3WOF A;  4JI4 Q;  3GTO H;  1A63 A;  5GRO A;  4OX9 Q;  2VUM G;  2F0T A;  2VB2 X;  4X3K A;  4DU9 A;  1EEF D;  1E1T A;  2PZU A;  2MQH A;  2IX1 A;  2C5C A;  2Z9H A;  1SNC A;  2AQ2 B;  1SNO A;  2EY5 A;  2NVX H;  4I65 A;  2RDG A;  1ZYR D;  2OQ0 A;  1LTI D;  4KJN A;  3GTG H;  3CRK C;  4WJ3 M;  4GZY C;  3KLS A;  4X62 L;  3W1B A;  1GHK A;  3NSW A;  2XVS A;  4QIW B;  4KI0 A;  4IFD H;  1DON A;  2EQS A;  4POF A;  1AE2 A;  2FFK B;  1B2T A;  4DNI A;  1K9M C;  5FLM H;  5C0X J;  5JEA J;  1GUS A;  5ISR A;  3RLO A;  5I4D A;  1ONL A;  2F0N A;  3GTG B;  2JA7 G;  4DR5 L;  5EPJ A;  1IL2 A;  5C6A A;  4OO1 G;  2JA5 H;  1GUO A;  4HJ5 A;  4HIO A;  4BXX H;  3BZK A;  2J7Z A;  4CJ1 B;  5KND A;  1NMG A;  1VQ4 A;  2NVT H;  2JA7 B;  4HN7 A;  1GUG A;  4TKO B;  3GTP H;  4DAY B;  3N52 A;  3J7Y W;  3AYH B;  3T53 B;  2F0F A;  2E2H H;  1PZI D;  1NTG A;  5EQ0 A;  3I4N G;  1IBK Q;  3PO3 H;  4DAY A;  4LF4 Q;  1ZEQ X;  2G9H D;  4JC0 A;  3I4N H;  1QCB D;  1E1O A;  5JJL A;  1ZXT A;  3S1Q B;  3H15 A;  1QNU A;  1EL0 A;  4DV6 Q;  1N34 L;  2BA0 A;  3K0X A;  2EY1 A;  3Q8D A;  3IKJ A;  1JOQ A;  3HGB A;  4PV1 C;  5BR8 L;  3CCJ A;  2KQ3 A;  5CV9 A;  4DV7 L;  3SHL A;  2ALY B;  2K5W A;  1YIJ A;  2F0W A;  4M1U B;  1FGB D;  2SEB D;  1V1Q A;  3KK7 A;  3GTP B;  1B50 A;  4YCW A;  1Y1W B;  3F2B A;  4H7B A;  1UE7 A;  3ICE A;  1AH9 A;  3BDO A;  1CT1 D;  2UUC Q;  1K83 H;  1FNU A;  2F0O A;  2L55 A;  2VXW A;  3RZO B;  1EY9 A;  3PIO 3;  4O2D A;  3CMA A;  5ELO A;  5HY6 A;  3G7L A;  1D7Q A;  1Q81 C;  4DV0 L;  4HIK A;  2A8V A;  3C1E A;  1PA6 A;  1TWG H;  5I9P A;  2RKS A;  1Q8K A;  5I6W A;  3IFD A;  3L7Z C;  1I4X A;  1PZK D;  4JBW A;  4ZAI A;  1PH7 A;  3H3V H;  4IOA A;  5IGB A;  2D2C C;  5E4W C;  3QOJ A;  1ESR A;  5I6Y A;  1Q3L A;  5FLX L;  1SND A;  1WTX A;  1AP0 A;  3K5N A;  2RBM A;  3GV3 A;  4Z9C B;  3UI2 A;  1V1P A;  4DUY L;  4PG3 A;  4UP9 A;  4UP7 A;  2M00 A;  3L3O C;  4UDU C;  3M7N A;  3PCO B;  2B63 G;  1YZ6 A;  4NPS A;  5KYL A;  2VY3 A;  3AQQ A;  4XQN A;  2F3V A;  3PO3 G;  1IW7 D;  3FEW X;  4ZK9 B;  4EVO A;  5E7N A;  3P1H A;  4X66 L;  1H9K A;  1B44 D;  4KJO A;  3M7G A;  1E2V A;  4YCV A;  2DY7 A;  3MA2 B;  3T1H Q;  4DV1 Q;  3HS0 C;  1JB3 A;  3J7Z C;  5EKI A;  5DLQ E;  1EY0 A;  4OO1 H;  4UP8 A;  1CTM A;  1TKW B;  3S1M B;  3J81 j;  2LMC B;  2ZXP A;  4ULL A;  2NBF A;  2HIX A;  2VQE L;  3OWF A;  4X66 Q;  2XSC A;  2MO1 A;  4DV6 L;  3S2D B;  1X56 A;  1QIL A;  2Y0S G;  1HZ9 A;  2H4O A;  2ASB A;  3T1Y L;  3Q24 A;  1IZ6 A;  1TWF H;  2EXZ A;  1H9R A;  4K0K L;  4XT1 B;  3PIP 3;  2KA7 A;  2N3S A;  2RDF A;  3M4O B;  4A76 A;  1OXT A;  2E75 C;  4OHJ A;  3TEH B;  3R8B A;  3MAQ A;  1WJJ A;  3E9H A;  1HJP A;  3OWE B;  2R7Z H;  1A3T A;  1DOM A;  1MBY A;  1VF5 C;  4JI4 L;  1EQR A;  1SYG A;  4B3S L;  1EWI A;  4I7Z C;  2R92 G;  4IUR A;  1X65 A;  2AKW B;  1YJN A;  1Q86 C;  2K03 A;  2L9H A;  3CC2 A;  2Z6B A;  5IYB H;  1NNX A;  1NE3 A;  4XDX A;  4JI1 L;  3NBH B;  3HG9 A;  1TXY A;  4K8J A;  2B2U A;  2PPB C;  2ZXR A;  1EIF A;  2BOS A;  2EE1 A;  3GO5 A;  1RKN A;  1ROD A;  2K5V A;  3NTH A;  1S5C D;  3J7A 5;  3BS1 A;  2LSS A;  3U58 A;  5E3F A;  3T1Y Q;  5G3L F;  3S24 A;  4ME5 A;  3TDQ A;  4DNR B;  1I3Q B;  1GD7 A;  2VUM B;  1RCV D;  3CC4 A;  4AYB B;  5C3E G;  2MGS A;  4CKB A;  2F0P A;  5BN5 A;  1KAA A;  2BH8 A;  3ER0 A;  1BOS A;  1KRS A;  3NP8 A;  5LL6 X;  1NAP A;  1U0L A;  1Q8I A;  2F0Q A;  3D0F A;  5EJW A;  3X3N A;  3MVV A;  1EY7 A;  4ID6 A;  2RSO A;  2B2V A;  2B2W A;  1I4P A;  1HNZ Q;  3D6W A;  4UPA A;  3IAY A;  4BBS B;  1HZA A;  4IOC A;  1SYF A;  4NDX A;  4P2C B;  2AUK A;  2B8G A;  1RDP D;  4DR4 Q;  3MZ5 A;  3GV6 A;  3QOL A;  1NBW A;  4X3S A;  4RFB A;  1C4Q A;  3J80 c;  3FPU B;  4K2K A;  3AFQ A;  2UXC Q;  5C4X G;  1XWE A;  2F3I A;  1TU2 B;  2MPM A;  3D4D A;  3W3A A;  2L4N A;  2OTJ A;  4JI3 L;  4IPG A;  2GVB A;  3H0G B;  4K2L A;  5FO7 B;  4A3F H;  2WKD A;  3SXH A;  4A3J B;  3C46 A;  4C3H G;  2X69 A;  2NVY B;  1KQS A;  2QDL A;  5IP9 H;  1X32 A;  1J5E Q;  1TII D;  1WYD A;  1Q46 A;  1BQQ T;  3A0J A;  3CP0 A;  2A6H C;  3M85 A;  1MJC A;  1I6H H;  4DR2 L;  4ZQ3 A;  4BBR H;  1DZ1 A;  4WJW A;  2NWG A;  3NE5 B;  2KUM A;  5A2Q L;  1MHW C;  4N9P A;  4NP5 A;  1LLR D;  4UAI A;  1X54 A;  1W6K A;  4YWM A;  2WII B;  3JC6 6;  2LXJ A;  5HUR A;  1U4R A;  1HHV A;  3DUZ A;  1XJV A;  2XN9 C;  2D62 A;  2KEE A;  1FJG Q;  1HXY D;  1V9P A;  2KHJ A;  1JB7 A;  4FO2 A;  3H3V I;  1II3 A;  4AIM A;  3PO2 B;  4C3I B;  4XTC S;  2PMZ B;  1LT5 D;  1SJH D;  3J80 L;  1WTV A;  2F4V Q;  4G7O C;  3VR4 A;  3MC0 B;  1ML0 D;  3NQI A;  3MWY W;  4LMQ D;  1HNX Q;  1HR0 Q;  2E5L Q;  4Y7N B;  5FLX c;  1BUV T;  2NTT A;  1KNE A;  3SEB A;  1VQE A;  5EGT A;  2CH4 A;  1EU3 A;  1N33 Q;  1ET9 A;  4B3R L;  2FMM A;  1I4H A;  1E0B A;  2JXM B;  3CC7 A;  2OXP A;  5CBA E;  1VMP A;  2WAQ E;  1K3R A;  4C2M H;  3GTJ H;  4L8J A;  1F9S A;  1SBB B;  1PTO D;  1A3V A;  1LTT D;  2J0T D;  5HGT A;  4X65 L;  3O13 A;  5FJ8 H;  4QIW E;  3MEH A;  4O1N A;  2UUA Q;  4AQY L;  1PLF A;  4A3C G;  4CDF C;  4B9X A;  4GN5 A;  4APV A;  4YY3 Q;  2F0G A;  1D1K A;  2NZO A;  5M3F H;  1OXS C;  5M9O A;  1HUM A;  2O2L D;  1WTR A;  3MXN B;  1Q1E A;  1GKH A;  3CCV A;  3CCS A;  3T16 A;  2V4D A;  4H0L C;  4G57 A;  1VQF A;  1B9N A;  5M5Y H;  4GS3 A;  4ODG A;  3HOY B;  2PZW A;  2NN6 H;  1HQM C;  2EYM A;  2X6L A;  2UXD Q;  2O4X A;  5IGC A;  3R93 A;  4A3D H;  1ESF A;  4DPG A;  3OTO L;  3RN5 A;  3MEF A;  2QF7 A;  1KC8 C;  1LTL A;  1X3G A;  4IJH A;  4DV4 L;  2YU9 B;  5CC4 A;  1MD2 D;  4CBV A;  1VF7 A;  2F1M A;  2EYL A;  4LFC Q;  3K57 A;  2QEJ C;  3ERO A;  5C4J H;  1LAC A;  2QGQ A;  3HZX A;  2F0I A;  4LNQ A;  1N32 Q;  3OTO Q;  2JA5 B;  1VQB A;  1BVS A;  1VQL A;  3PUV A;  3FPP A;  1H9J A;  1F77 A;  2F0L A;  1H9S A;  1KXL A;  3U9S A;  3I73 A;  1ILP A;  3HFZ B;  2EJG C;  5NUC A;  1STG A;  1Z6H A;  2Z4H A;  1K28 A;  2KED A;  4LF9 L;  2AMC B;  3OW2 A;  1PYB A;  2KEN A;  1XTD A;  2B2T C;  1IHZ A;  1JWU D;  3PSI A;  5M5X B;  2PO4 A;  1WTQ A;  4QUF A;  2DJF C;  3MXG A;  2O5I C;  1Q7Y C;  1UE1 A;  1EWH A;  3VYS A;  4GOP B;  1VQ6 A;  3PIP A;  3S1R B;  2F0S A;  1XPR A;  1CQF A;  2K5N A;  2N8N A;  3QG1 A;  4DV7 Q;  4RG1 A;  4DR2 Q;  4JI0 L;  1N33 L;  3I91 A;  3D8G A;  4DV2 L;  5KNB A;  1BO0 A;  2ICE C;  2CQA A;  3TP5 A;  4RHS A;  4RGT A;  1JWM D;  2L15 A;  2J4X A;  4PMC A;  3I3C A;  3GDE A;  4C3I G;  1LAB A;  2YTV A;  4IFD I;  5DEH A;  4B3M Q;  2F03 A;  1EQV A;  4WJ4 A;  4HIM A;  4A3L G;  1I4R A;  3HOU B;  1VQG A;  2JEA I;  1BCP D;  1CK1 A;  4NW2 A;  4H02 A;  1Q1B A;  1U4P A;  2EOT A;  4KY7 A;  2JN4 A;  1PH5 A;  2EYJ A;  4FF4 A;  1IW7 C;  3CPF A;  2ENB A;  2K75 A;  1E22 A;  1F2M A;  3ZYY X;  4RCN A;  1X3E A;  4RGN A;  4BY7 G;  3PUZ A;  2VQF L;  5M3F G;  4MIU A;  4E6I A;  1VQM A;  4LF8 L;  3SK5 A;  5AJ3 L;  4A3C H;  1EEI D;  3HEJ A;  1VDZ A;  3WOE A;  1OXV A;  3TZD A;  3AEV A;  1BR9 A;  3HP3 A;  2D5D A;  1SRO A;  1JE5 A;  4ZKB B;  2Q8I B;  1TWA H;  1M90 C;  3CAM A;  2DJG C;  1HUN A;  2H1E A;  2R93 G;  3X3M A;  1KAB A;  3U4Z A;  3AMU A;  1L1O A;  5C3E B;  2L11 A;  1LTG D;  1S5F D;  5LHY 1;  1FNW A;  5C4Z A;  2OTL A;  3CCL A;  2PNH A;  2K04 A;  5C44 G;  4P75 A;  5JJK A;  4A3J G;  2F0V A;  2D9U A;  2MUY A;  3MXN A;  4QL5 A;  1QB5 D;  1L1O B;  5KEE A;  2L12 A;  1XXG A;  1N8R C;  3SDZ A;  2Q2I A;  3S17 H;  2K1B A;  2XWB B;  3ZJY C;  4K8I A;  3VR5 A;  2RHQ B;  1S5B D;  1L0X B;  1D5X C;  1QG7 A;  3OYY A;  4IUN A;  3RZD H;  4BY1 B;  4B3S Q;  2NZ1 D;  3HKS A;  3LX0 A;  1GUT A;  1NUC A;  2NYZ D;  3LNN A;  1SYC A;  4RA8 A;  2VQF Q;  1JOO A;  2R93 H;  4N9T A;  5CYU A;  2EYP A;  4LWC A;  1SMX A;  3TQY A;  1EU4 A;  2VZA A;  3L9A X;  2BE5 D;  1QUQ B;  4DR6 L;  2B63 B;  2F0E A;  3SK4 A;  1NJI C;  2AUJ D;  1CUK A;  1B8A A;  3NTI A;  4TQU S;  2MNA A;  1GHJ A;  1WTO A;  3NPP A;  4IJL A;  4KD3 A;  3VDY A;  1D1I A;  1IKM A;  3AU7 A;  4R9W A;  4LF7 Q;  1T5X D;  3U4V A;  5I2X A;  3D3R A;  2E8G A;  2Y0S B;  2CQO A;  2KCT A;  1DYQ A;  3ERS X;  4HJA A;  4OL7 A;  3SR1 A;  4A3D G;  2YU9 H;  4H44 C;  1VS0 A;  4K6L A;  1O7L A;  2YTY A;  5IY0 A;  1H95 A;  3E6Z X;  5IP9 G;  5IP7 H;  1MGS A;  2E2I B;  3RLF A;  2TSS A;  1WD0 A;  4R8N A;  4A3L H;  4DUZ L;  1EY6 A;  1PVO A;  4A3E B;  2IPK D;  1CKN A;  4DAM A;  1JJ2 A;  1JC7 A;  1IBL L;  3G48 A;  5D65 A;  2KJX A;  2HD3 A;  3BDC A;  2Q2H A;  5C4X H;  2PMZ E;  3OSO A;  2A5H A;  1CQV A;  1NSN S;  2DNC A;  2PCF B;  3AFP A;  1QWY A;  1Y8O B;  3EIV A;  2OF1 A;  1HH2 P;  2K52 A;  2E2J B;  2Z4I A;  1Y1V B;  5AJ3 Q;  1PH1 A;  1EIH A;  1LTS D;  1KDA A;  4KLK A;  4LFC L;  4JI7 Q;  5T1I A;  1HCZ A;  2WIN B;  5KGU A;  4GNX A;  4JI3 Q;  3NEL A;  3CF5 A;  1K8M A;  1X3P A;  4Y7N H;  5DAU A;  3M4Y A;  2JEB I;  2PW5 A;  1I94 Q;  4B9W A;  2PW7 A;  3JAM c;  1XX8 A;  3GTQ B;  5C3E H;  3CKI B;  4DV3 L;  4ZKC B;  3CME A;  1PTO F;  1PRT B;  3A7L A;  1JQY D;  4YIJ A;  5J22 A;  3P75 A;  1R9T H;  1FYC A;  2KCN A;  4DR4 L;  1I94 L;  5I9O A;  2QA4 A;  5JEA G;  3TP7 A;  2I07 B;  3K8A A;  4A3B G;  3QB3 A;  2SOB A;  4J15 A;  5BN3 A;  2R6G A;  1LT6 D;  5JVG 3;  1Y14 B;  2OEO A;  1V1O A;  4JI0 Q;  2E2J H;  4AQY Q;  4JPB W;  1SYE A;  3G6J B;  3K0Y A;  4F87 A;  3S9W A;  4GN3 B;  4FP5 D;  2PQE A;  4A75 A;  2JQO A;  2JK8 A;  1SEB D;  4DK1 A;  2R93 B;  3R2T A;  2QDB A;  1CSQ A;  2NN6 G;  2R3Z A;  3EQL C;  4JK1 C;  5CMD A;  2VW9 A;  5L37 A;  1WCM B;  3NUC A;  5C44 B;  1VQ5 A;  4JOI A;  4KKT A;  1YHA A;  1KRT A;  2MJ8 A;  3HOY G;  1BCP C;  1CA5 A;  1QNK A;  1CKN B;  3E3X A;  3RZO H;  2CH4 W;  5D3I B;  2HHH L;  1G29 1;  1ZYR C;  1I3Q H;  1KDC A;  3I4O A;  5FOB B;  5D14 A;  2NVY H;  4B3R Q;  4X64 L;  2IT1 A;  2B2T A;  3M4O H;  1M8A A;  2EYO A;  4QJF A;  1AE3 A;  1VQ9 A;  1K8O A;  4DXF A;  1D2B A;  4LF8 Q;  3VR3 A;  1WTP A;  4YWK A;  2F0U A;  2GN5 A;  1H9M A;  1BXT A;  3HOU G;  4C3H H;  1BBU A;  4IUT A;  4P71 A;  3J81 L;  2Q8T A;  1I6V C;  3S1N B;  5M3M H;  3S2H H;  1STY A;  2Z1C A;  4A3E G;  3LWE A;  4CKC A;  3RNU A;  5M5Y B;  1IBL Q;  3KBX A;  4Q5V A;  3PF5 A;  1FNV A;  3DWA A;  4UHV A;  4K5W A;  1EY8 A;  1SNM A;  1GUN A;  4YWL A;  4A3D B;  4XYO A;  5IGF A;  5LMN Q;  4P73 A;  3PF4 A;  4X3U A;  2JJQ A;  3BDL A;  4MZ9 A;  1K8A C;  1VMC A;  5EPL A;  1IKL A;  3OHX C;  1N32 L;  4S3S A;  4OX9 L;  1BDO A;  4EQ5 A;  3GQB A;  3TZU A;  1SYB A;  4ZLT F;  1UWV A;  3W5O A;  2G5D A;  1RJT A;  4IO9 A;  1PV4 A;  4C1N I;  1A3U A;  4LF5 L;  4TSS A;  2F0H A;  2JA7 H;  2NVT B;  4FYD A;  1XNQ L;  1HTL D;  4LF9 Q;  2EPB A;  1RTN A;  2F0D A;  3QWN A;  3UDF A;  4CJ2 C;  5BN4 A;  3G71 A;  1WI5 A;  2P5Z X;  1GXD C;  1KL9 A;  2M9V A;  3S1R H;  3K58 A;  3FMC A;  1UE5 A;  2VNU D;  4FXG C;  1JMC A;  4V19 0;  1VQP A;  3KFU A;  2CCZ A;  1NY4 A;  1XMO Q;  5IYB G;  3ITP A;  3K5L A;  2F4V L;  3L2P A;  3EN2 A;  2I0Q A;  3KF8 A;  4RH6 A;  1I50 H;  4PMB A;  1I4G A;  4YHH Q;  1D5M C;  5AFW A;  2N55 A;  3FVQ A;  4DV0 Q;  5A2Q E;  1C48 A;  4Y52 H;  4X3T A;  1SLJ A;  4NXM Q;  3NWS A;  5ELB A;  4DR3 Q;  4JI5 Q;  1TWG B;  3I56 A;  1HNZ L;  4L5T A;  3OMG A;  1MJE A;  3IRB A;  3C2P A;  1VQJ A;  2VL6 A;  1CKM A;  4C3J H;  4GKK Q;  5IGE A;  1IYU A;  2WKC A;  3TP6 A;  3GTO B;  1LTB D;  1Y69 U;  3HOZ G;  1YJW A;  1XYI A;  2LS0 1;  1G2T A;  3K7A H;  5CV6 A;  4P72 A;  1S72 A;  2R92 B;  3NWT A;  4A3M H;  3J80 i;  1OTC A;  3RMH A;  1DCZ A;  1YHQ A;  2Z0S A;  4DUY Q;  2SDF A;  1TWH B;  3DLL A;  1LM0 A;  4K5V A;  1K3B C;  1ASZ A;  2KHI A;  5GAD C;  5LMN L;  1F9R A;  2K5H A;  2JA5 G;  1VQI A;  3UE0 A;  5C0X I;  3HOZ H;  4JI8 L;  3BVG A;  1VQK A;  4L5Q A;  1KHI A;  1YNJ C;  4C3J G;  1G91 A;  2HT1 A;  5ELF A;  2B63 H;  1M4V A;  1RTO A;  5FLM G;  4AH6 A;  2NN6 I;  2XRS D;  3N6R A;  5M5X H;  1ENA A;  1G51 A;  1EYC A;  3I4M H;  4RHR A;  4IFD G;  2WP8 J;  1NMF A;  4KY6 A;  4AYB E;  5LL6 S;  2IL8 A;  4I7A A;  1HFG A;  4EX5 A;  3KUP A;  5GQO A;  1EFI D;  3RZD B;  4MN3 A;  3VR6 A;  5DNF A;  5T1G A;  3D4R A;  1WTH A;  3Q0A A;  1YVC A;  3HOX B;  4RAU C;  1TS4 A;  1S5D D;  2BDO A;  4OWT B;  1CM9 A;  4A3I H;  4OEM B;  1JJG A;  3FHW A;  2V1C C;  4DV1 L;  1MKH A;  2B2V C;  4ZUJ A;  1EOT A;  3VYR A;  4RGO S;  2HIV A;  2RVL A;  1CFM A;  3MTS A;  4F8M A;  3VR2 A;  1STN A;  4B3T Q;  2JA8 G;  3K6O A;  2JE6 I;  3TP8 A;  1VQ8 A;  2RCN A;  1C7Y A;  1V43 A;  4WOR A;  2ES2 A;  4CGY B;  1LTR D;  3U50 C;  4G7H C;  1C8C A;  5F2D A;  2Z6K C;  4YHH L;  5M3M B;  4IQZ A;  1GM5 A;  1Y1V G;  1RF2 D;  2MO0 A;  1LT3 D;  2NVX B;  4A3K G;  3JAM E;  1IBM L;  3OMC A;  2OWO A;  3ONA B;  1EQT A;  4CDD C;  4NMZ A;  1O78 A;  1QZG A;  4FXK C;  4JYA L;  1KNA A;  4A93 H;  2M2L A;  2B29 A;  4OIK A;  1EWC A;  3H94 A;  4IUU A;  4XXE A;  1MSG A;  3A54 A;  4HAE A;  2XIW A;  1JJC B;  1PTO H;  4A3K H;  3AB9 A;  1XNR Q;  3J7A F;  2KHS A;  3GTM H;  2K5D A;  2ZJR A;  1P16 A;  1PHJ A;  2ZXO A;  2IJ0 A;  1QE6 A;  1S4Z A;  3URY A;  3UDX A;  1G6Z A;  4MNO A;  4KHP Q;  4DR1 L;  5EPK A;  1PXU A;  3KOJ A;  3CCQ A;  2HCC A;  3C3L A;  2NTS A;  3GTK H;  2WB1 G;  4M8A A;  3KJO A;  1W3S A;  2D0P A;  3V96 A;  4C3J B;  3QIA A;  1LUZ A;  2B2Y A;  4XYQ A;  4R1J A;  1EIG A;  3VA5 A; 
#chains in the Genus database with same CATH homology
 1HTP A;  5K36 H;  1Y8N B;  2XRQ D;  1RHP A;  5DM6 3;  3PMF A;  2K33 A;  2AWN A;  1DD2 A;  4KHV A;  3EJI A;  1PFN A;  5FKA C;  1F9P A;  1ZKO A;  1U4L A;  4J8Q A;  5ELE A;  4EGV A;  2NVQ B;  2QIL A;  2YYZ A;  1A2U A;  1EYA A;  4HCE A;  3F2U A;  1PYW D;  1TQO A;  3DWP A;  1B4O A;  4FXD A;  1TS3 A;  5JEA H;  1Z47 A;  2A74 C;  2CVR A;  2DNE A;  2BCO A;  4KY5 A;  3C1F A;  4HCS A;  1LO5 D;  1PFM A;  1H9S B;  2KOL A;  1J8I A;  2WAC A;  3I4N B;  3VYU A;  1KLU D;  1TVX A;  2CHB D;  4RKL A;  1AFP A;  2A6H D;  2Q8R E;  3CRL C;  4C3H B;  2A6E C;  4PMW A;  2A69 C;  1IYV A;  1CZW A;  2A68 D;  5EKK A;  5IIF A;  3NBI A;  2NUC A;  1YNJ D;  4H13 C;  3TN2 A;  3RD4 A;  1HRJ A;  5FK9 C;  4BWG B;  1GUW A;  2VB3 X;  4R8I A;  5C5M A;  3QJY A;  3MHB A;  1LTA D;  3GTK B;  1Q12 A;  4C2M B;  2ICI A;  3NQT A;  5IT9 L;  2JP1 A;  3Q22 A;  1V1P B;  3WDN A;  1F9Q A;  4IUP A;  4FF2 A;  5ELD A;  3H91 A;  2NB0 A;  4WRD A;  1SE2 A;  3W2D A;  4CKE A;  2KVM A;  4L63 B;  2TMP A;  3TSS A;  3J81 E;  1AZP A;  4HMJ A;  3D6C A;  4DAP A;  1S5E D;  5FO9 B;  4K6D A;  1KDB A;  2FJ2 A;  3OW7 A;  1D6E C;  3I72 A;  1RD9 D;  4A3F B;  3D31 A;  4K14 A;  4EQP A;  5C4H A;  4A3B B;  4HTH A;  5IGG A;  2IX3 A;  5COR A;  1D5Z C;  2WAQ B;  5JPN C;  2BA1 A;  3P7J A;  1I4Q A;  1SXT A;  1Y8P B;  2PYK A;  2EDG A;  3FRP B;  1GOZ A;  2JA8 B;  4MHE A;  2L5T A;  5D3D A;  3OOC A;  4IUV A;  3IFT A;  3PV0 A;  2CW0 D;  3BG3 A;  3V2T A;  3A8J E;  4Q0F A;  3KLS X;  3LWU A;  3Q23 A;  5C4X B;  4OO1 I;  3NXW A;  5CV7 A;  3HKZ B;  3S14 B;  3I8Z A;  3S15 B;  1SFO B;  4B08 A;  1KLG D;  4PNY A;  3HOW B;  5JOB A;  5KYI A;  5FLX E;  4QMG A;  1TY0 A;  1KTK A;  2HDL A;  5EBC A;  1NR2 A;  5C0X H;  1TWC B;  3M3Y B;  4ILW A;  1E2Z A;  1DJR D;  1TY2 A;  1SMY C;  2AQ3 B;  4DN4 M;  1OXX K;  2HCI A;  4CJ0 B;  4O42 A;  4FNF A;  3DMU A;  2A73 B;  5KNC A;  4XQQ A;  2GA4 B;  1A6X A;  3SVM A;  5CGK A;  1L0Y B;  3SK6 A;  4WFN 3;  1CA6 A;  1STE A;  4XQJ A;  4HSV A;  2F0M A;  3HRZ C;  4XIG S;  2QKI C;  5C3X A;  2F0K A;  2FHT A;  1HFN A;  3BVZ A;  4BA1 I;  2EVB A;  2A6E D;  4KMU C;  5EKL A;  2L1B A;  3T13 A;  1F2L A;  2FMC A;  4RWS C;  2N88 A;  2A69 D;  3GD7 A;  1PRT D;  3RUZ A;  2JSO A;  4U68 A;  5IOC A;  2E2H B;  1U9R A;  2LKV A;  3CQZ B;  5CV8 A;  3OIQ A;  1F2Y A;  2B2U C;  5JAV A;  4KV6 A;  1EZ8 A;  3BYY B;  5M5W B;  5ELC A;  2HUG A;  4FF3 A;  1E2W A;  3PUW A;  3ND8 A;  4QF4 A;  1CZG A;  2EZV A;  1B1Z A;  1SNP A;  3OPO A;  3E5S A;  4KKU A;  1JIC A;  4KK7 A;  3DWQ A;  4U67 3;  1FD7 D;  2CW0 C;  3DXJ C;  4ZYS A;  3T51 B;  4C56 C;  4XT3 B;  1HQR D;  3J80 E;  4EQO A;  1PRT F;  1PTO B;  4LJZ C;  3VYT A;  1EYD A;  1O80 A;  2R61 A;  4A3I B;  3NK9 A;  4FVM A;  2MHV A;  4DAV A;  1HA5 A;  4ABN A;  1CHQ D;  1JE4 A;  1LT4 D;  2HDM A;  4NKL A;  2KEC A;  1U4M A;  2F0J A;  3CHB D;  2AQ1 B;  1DXM A;  2X6G A;  3I90 A;  2I46 A;  1R9T B;  4KKS A;  1ET6 A;  2EY6 A;  1UUP A;  4QB4 A;  4V0B A;  1WVL A;  4OGQ C;  1STH A;  5J1Z A;  4L6T B;  3S16 B;  3BYT B;  1SE3 A;  1IL8 A;  4DK0 A;  2B2W C;  1PMR A;  1EY4 A;  1PFB A;  4TRD A;  4DFA A;  5I2Y A;  2SNM A;  2WB1 B;  1SAP A;  3GTM B;  2EY2 A;  1AN8 A;  2EJF C;  5C0X G;  4BA2 I;  1OXU A;  3S17 B;  2B2Y C;  1NR4 A;  1SE4 A;  4IFD J;  5KRU A;  2OT2 A;  4RGM A;  1A2T A;  5IGD A;  2PNR C;  3VA7 A;  2IWH A;  1K83 B;  3PO3 B;  3H6M A;  2DN8 A;  4G4K A;  2K6A A;  1AZQ A;  1CHP D;  1SJE D;  3EFX D;  1TT2 A;  4HR7 B;  4QCL A;  3S2H B;  2MP1 A;  1J9O A;  2LY7 A;  4A3K B;  3QO2 A;  1T5E A;  1DOK A;  3CU7 A;  4QUC A;  1BCP B;  2EYH A;  5FO8 B;  3NTK A;  4KHZ A;  3GTL B;  1UAP A;  1AEX A;  5JJZ A;  1V8Q A;  3EA6 A;  2B39 A;  5CV5 A;  3I70 A;  5KIX A;  1EZ6 A;  1EY5 A;  2XNA C;  1TR5 A;  1Z7T A;  5M3F B;  1O7Y A;  1G2S A;  2FIN B;  2RSN A;  3A7A B;  5JVH 3;  1SYD A;  1A15 A;  4IN3 A;  1HPC A;  1I6H B;  4ZRZ A;  3I4M B;  2EYF A;  5J39 A;  1W6J A;  2K01 A;  4FF1 A;  1BCP F;  1TWF B;  3NBH A;  3BVM A;  2KCC A;  5E1F A;  1SDF A;  3T4A C;  1B9M A;  2K32 A;  3K7A B;  5TSS A;  3TME A;  1UEA B;  1DM0 B;  1WD1 A;  1ENC A;  1BNZ A;  4DA2 A;  3FKI B;  3MFG A;  1VCI A;  1F2Z A;  1NCV A;  3HOZ B;  4G7Z C;  3NHH A;  2ID0 A;  4OIJ A;  2G9D A;  3ERQ A;  4KN7 C;  1XTC D;  5C4J B;  4DGZ A;  4LAA A;  1UNS A;  4IUQ A;  4CHT B;  2RQX A;  4C1N K;  4BBR B;  4KTA A;  3D4W A;  3SK8 A;  2B8F A;  4A3G B;  4EQN A;  1SMY D;  5K5P A;  3A8I E;  1JR0 D;  4HMI A;  5JPM C;  4DF7 A;  2JYO A;  2E74 C;  3MXU A;  1G8Z D;  1YNN C;  4ZUI A;  2ZT9 C;  4J1M A;  3GTJ B;  1SSO A;  1BF4 A;  3H09 A;  2C9O A;  2RA4 A;  2E76 C;  3KLR A;  5K36 G;  2LFN A;  5IT9 E;  5IOD A;  2F3W A;  1HA6 A;  2BE5 C;  2O5J C;  4KD4 A;  5C5L A;  3K5O A;  1GJX A;  1TWA B;  4BS9 A;  3U9O A;  1PTO C;  1QOH A;  2Z8L A;  3EVQ A;  5C3W A;  1TS5 A;  2QCP X;  1PRT C;  2F4I A;  4PQX A;  2DY8 A;  1R4P B;  3SE0 A;  3E0J A;  5A35 A;  2RDH A;  2E2D C;  1BBX C;  2K5Q A;  5DM7 3;  1JOK A;  3K59 A;  1CI3 M;  2BDN A;  3P20 A;  2K28 A;  1PDQ A;  3K5M A;  2EJM A;  1JCK B;  1B53 A;  1FR3 A;  4RCO A;  3FDT A;  2R7Z B;  1Q90 A;  1B3A A;  1MSH A;  2SNS A;  5COY A;  3TBI B;  1ENF A;  2WV6 D;  2PZT A;  3T56 B;  1SNQ A;  2K05 A;  5CR3 A;  1LV9 A;  3R3O A;  4KN4 C;  5EBD A;  3V05 A;  3H3V C;  4A93 B;  1STA A;  2IW3 A;  3KBG A;  4HED A;  3I4L A;  3IL8 A;  1WTW A;  2K7V A;  2XWJ B;  1JWS D;  5G3L D;  4F88 A;  4LK1 C;  1DOL A;  4IZ8 A;  4RKB A;  3Q6S A;  1JOR A;  2IX0 A;  3PUY A;  2AWO A;  3R2I A;  1STB A;  1AW7 A;  1YNN D;  4F7X A;  4HSP A;  2JA6 B;  4A3M B;  3HOV B;  1ICW A;  3JAM L;  5CV4 A;  2L0C A;  1OO9 B;  4IAL A;  3DM1 A;  3GP7 A;  3MFY A;  3J7A V;  3MXP A;  1TS2 A;  3ND9 A;  1QJO A;  3BZD B;  3DHQ A;  3DEP A;  4K5X A;  4J6H A;  3A8K E;  2A68 C;  3A55 A;  1PZJ D;  2HQE A;  1I50 B;  5E4X A;  1MI2 A;  1X3Q A;  1ILQ A;  3PUX A;  4BY7 B;  1O7Z A;  3A56 A;  3OIP A;  1R4Q B;  4DXG A;  5CBE E;  3DEO A;  4DNT B;  3WOF A;  2F0T A;  2VB2 X;  4X3K A;  4DU9 A;  1EEF D;  2PZU A;  2IX1 A;  2C5C A;  1SNC A;  2AQ2 B;  1SNO A;  2EY5 A;  4I65 A;  2RDG A;  1ZYR D;  1LTI D;  4KJN A;  3CRK C;  4GZY C;  3KLS A;  1GHK A;  3NSW A;  2XVS A;  4QIW B;  4KI0 A;  4IFD H;  1DON A;  2FFK B;  1B2T A;  5C0X J;  5JEA J;  1GUS A;  5ISR A;  5I4D A;  1ONL A;  2F0N A;  3GTG B;  5EPJ A;  5C6A A;  4OO1 G;  1GUO A;  2J7Z A;  4CJ1 B;  5KND A;  2JA7 B;  4HN7 A;  1GUG A;  4TKO B;  3J7Y W;  3N52 A;  3T53 B;  2F0F A;  1PZI D;  5EQ0 A;  4DAY A;  1ZEQ X;  2G9H D;  1QCB D;  1ZXT A;  3S1Q B;  1QNU A;  1EL0 A;  2BA0 A;  2EY1 A;  3IKJ A;  1JOQ A;  3HGB A;  4PV1 C;  2KQ3 A;  5CV9 A;  3SHL A;  2K5W A;  2F0W A;  4M1U B;  1FGB D;  2SEB D;  3KK7 A;  3GTP B;  1B50 A;  1Y1W B;  4H7B A;  3BDO A;  1CT1 D;  2F0O A;  1FNU A;  2L55 A;  2VXW A;  3RZO B;  1EY9 A;  3PIO 3;  3G7L A;  3C1E A;  5I9P A;  2RKS A;  5I6W A;  3IFD A;  3L7Z C;  1I4X A;  1PZK D;  4JBW A;  4ZAI A;  5IGB A;  2D2C C;  5E4W C;  3QOJ A;  1ESR A;  5I6Y A;  1Q3L A;  5FLX L;  1SND A;  1WTX A;  1AP0 A;  3K5N A;  2RBM A;  3GV3 A;  4Z9C B;  3UI2 A;  1V1P A;  2M00 A;  3L3O C;  4UDU C;  3M7N A;  5KYL A;  4XQN A;  2F3V A;  1IW7 D;  3FEW X;  4ZK9 B;  4EVO A;  3P1H A;  1H9K A;  1B44 D;  4KJO A;  3M7G A;  1E2V A;  2DY7 A;  3MA2 B;  3HS0 C;  1JB3 A;  5EKI A;  1EY0 A;  4OO1 H;  1CTM A;  1TKW B;  3S1M B;  2LMC B;  2ZXP A;  4ULL A;  2NBF A;  3OWF A;  2XSC A;  3S2D B;  1QIL A;  2H4O A;  3Q24 A;  2EXZ A;  1H9R A;  4XT1 B;  3PIP 3;  2KA7 A;  2RDF A;  3M4O B;  1OXT A;  2E75 C;  4OHJ A;  3R8B A;  3MAQ A;  3OWE B;  1A3T A;  1DOM A;  1MBY A;  1VF5 C;  1SYG A;  4I7Z C;  4IUR A;  2K03 A;  2L9H A;  4XDX A;  3HG9 A;  4K8J A;  2PPB C;  2B2U A;  2ZXR A;  2BOS A;  2EE1 A;  3GO5 A;  1RKN A;  1ROD A;  3NTH A;  1S5C D;  3BS1 A;  5E3F A;  5G3L F;  4ME5 A;  3TDQ A;  4DNR B;  1I3Q B;  2VUM B;  1RCV D;  4AYB B;  2MGS A;  4CKB A;  2F0P A;  5BN5 A;  1KAA A;  1BOS A;  3NP8 A;  5LL6 X;  1NAP A;  1Q8I A;  2F0Q A;  3X3N A;  5EJW A;  3MVV A;  1EY7 A;  4ID6 A;  2RSO A;  2B2V A;  2B2W A;  1I4P A;  3D6W A;  3IAY A;  4BBS B;  1SYF A;  4NDX A;  4P2C B;  2AUK A;  2B8G A;  1RDP D;  3MZ5 A;  3GV6 A;  3QOL A;  4X3S A;  4RFB A;  1C4Q A;  3FPU B;  4K2K A;  1XWE A;  2MPM A;  1TU2 B;  3D4D A;  3W3A A;  2L4N A;  3H0G B;  4K2L A;  5FO7 B;  2WKD A;  3C46 A;  4A3J B;  3SXH A;  4C3H G;  2X69 A;  2NVY B;  1X32 A;  1TII D;  1BQQ T;  2A6H C;  3M85 A;  4ZQ3 A;  1DZ1 A;  4WJW A;  2NWG A;  3NE5 B;  2KUM A;  5A2Q L;  4N9P A;  4NP5 A;  1LLR D;  4UAI A;  1W6K A;  2WII B;  5HUR A;  1U4R A;  1HHV A;  3DUZ A;  2XN9 C;  2D62 A;  2KEE A;  1HXY D;  4FO2 A;  1II3 A;  3PO2 B;  4C3I B;  4XTC S;  2PMZ B;  1LT5 D;  1SJH D;  3J80 L;  1WTV A;  4G7O C;  3VR4 A;  3MC0 B;  1ML0 D;  3NQI A;  3MWY W;  4LMQ D;  4Y7N B;  1BUV T;  2NTT A;  1KNE A;  3SEB A;  5EGT A;  1EU3 A;  1ET9 A;  2FMM A;  1I4H A;  1E0B A;  2JXM B;  2OXP A;  5CBA E;  1VMP A;  4L8J A;  1F9S A;  1SBB B;  1PTO D;  1A3V A;  1LTT D;  2J0T D;  5HGT A;  3O13 A;  3MEH A;  4O1N A;  1PLF A;  4B9X A;  2F0G A;  1D1K A;  5M9O A;  1OXS C;  1HUM A;  2O2L D;  1WTR A;  1Q1E A;  3T16 A;  2V4D A;  4H0L C;  4G57 A;  1B9N A;  4ODG A;  3HOY B;  2PZW A;  2NN6 H;  1HQM C;  2EYM A;  2X6L A;  2O4X A;  5IGC A;  3R93 A;  1ESF A;  2QF7 A;  2YU9 B;  5CC4 A;  1MD2 D;  4CBV A;  1VF7 A;  2F1M A;  2EYL A;  3K57 A;  2QEJ C;  3ERO A;  1LAC A;  3HZX A;  2F0I A;  2JA5 B;  3PUV A;  3FPP A;  1H9J A;  1F77 A;  2F0L A;  1H9S A;  3U9S A;  3I73 A;  1ILP A;  2EJG C;  5NUC A;  1STG A;  1Z6H A;  2Z4H A;  2KED A;  2B2T C;  1IHZ A;  1JWU D;  5M5X B;  2PO4 A;  1WTQ A;  4QUF A;  3MXG A;  2O5I C;  1EWH A;  3VYS A;  3S1R B;  2F0S A;  1CQF A;  3QG1 A;  3I91 A;  3D8G A;  5KNB A;  1BO0 A;  2ICE C;  2CQA A;  3TP5 A;  4RHS A;  4RGT A;  1JWM D;  2J4X A;  4PMC A;  3I3C A;  4C3I G;  1LAB A;  4IFD I;  5DEH A;  2F03 A;  1EQV A;  1I4R A;  3HOU B;  2JEA I;  1BCP D;  1CK1 A;  4NW2 A;  1Q1B A;  1U4P A;  2EOT A;  4KY7 A;  2EYJ A;  4FF4 A;  1IW7 C;  2ENB A;  1F2M A;  3ZYY X;  4RCN A;  4RGN A;  3PUZ A;  4MIU A;  4E6I A;  3SK5 A;  1EEI D;  3HEJ A;  1VDZ A;  3WOE A;  1OXV A;  3TZD A;  1BR9 A;  3HP3 A;  2D5D A;  4ZKB B;  2Q8I B;  1HUN A;  2H1E A;  3X3M A;  1KAB A;  3AMU A;  5C3E B;  2L11 A;  1LTG D;  1S5F D;  5LHY 1;  1FNW A;  5C4Z A;  2K04 A;  2F0V A;  2D9U A;  2MUY A;  3MXN A;  1QB5 D;  5KEE A;  2L12 A;  1XXG A;  3SDZ A;  2K1B A;  2XWB B;  4K8I A;  3VR5 A;  1S5B D;  1L0X B;  1D5X C;  1QG7 A;  4IUN A;  4BY1 B;  2NZ1 D;  3LX0 A;  1GUT A;  1NUC A;  2NYZ D;  3LNN A;  1SYC A;  4RA8 A;  1JOO A;  4N9T A;  5CYU A;  2EYP A;  1EU4 A;  3L9A X;  2BE5 D;  2B63 B;  2F0E A;  3SK4 A;  2AUJ D;  3NTI A;  4TQU S;  1GHJ A;  1WTO A;  3NPP A;  4KD3 A;  1IKM A;  1D1I A;  3AU7 A;  4R9W A;  1T5X D;  5I2X A;  3D3R A;  2Y0S B;  1DYQ A;  4OL7 A;  3SR1 A;  4H44 C;  4K6L A;  1O7L A;  3E6Z X;  1MGS A;  2E2I B;  3RLF A;  2TSS A;  1WD0 A;  4R8N A;  1EY6 A;  4A3E B;  2IPK D;  1JC7 A;  5D65 A;  2KJX A;  3BDC A;  3OSO A;  2A5H A;  1CQV A;  1NSN S;  2DNC A;  2PCF B;  1QWY A;  1Y8O B;  2OF1 A;  2E2J B;  2Z4I A;  1Y1V B;  1EIH A;  1LTS D;  1KDA A;  5T1I A;  1HCZ A;  2WIN B;  5KGU A;  1K8M A;  1X3P A;  5DAU A;  3M4Y A;  2JEB I;  2PW5 A;  4B9W A;  2PW7 A;  1XX8 A;  3GTQ B;  3CKI B;  4ZKC B;  1PTO F;  1PRT B;  3A7L A;  1JQY D;  4YIJ A;  5J22 A;  3P75 A;  1FYC A;  2KCN A;  5I9O A;  5JEA G;  3TP7 A;  2I07 B;  3QB3 A;  2SOB A;  5BN3 A;  2R6G A;  1LT6 D;  5JVG 3;  2OEO A;  1V1O A;  1SYE A;  3G6J B;  3K0Y A;  4F87 A;  3S9W A;  4FP5 D;  2PQE A;  1SEB D;  4DK1 A;  2R93 B;  3R2T A;  2QDB A;  2R3Z A;  2NN6 G;  3EQL C;  4JK1 C;  5CMD A;  1WCM B;  3NUC A;  5C44 B;  4KKT A;  2MJ8 A;  1BCP C;  1CA5 A;  1QNK A;  5D3I B;  1G29 1;  1ZYR C;  1KDC A;  5FOB B;  5D14 A;  2IT1 A;  2B2T A;  1M8A A;  2EYO A;  1K8O A;  4DXF A;  1D2B A;  3VR3 A;  1WTP A;  2F0U A;  1H9M A;  1BXT A;  4IUT A;  3J81 L;  2Q8T A;  1I6V C;  3S1N B;  1STY A;  2Z1C A;  3LWE A;  4CKC A;  5M5Y B;  3KBX A;  4Q5V A;  1FNV A;  3DWA A;  4K5W A;  1EY8 A;  1SNM A;  1GUN A;  4A3D B;  4XYO A;  5IGF A;  4X3U A;  3BDL A;  1VMC A;  5EPL A;  1IKL A;  3OHX C;  4S3S A;  1BDO A;  3GQB A;  3TZU A;  1SYB A;  4ZLT F;  1RJT A;  4C1N I;  1A3U A;  4TSS A;  2F0H A;  2NVT B;  4FYD A;  1HTL D;  2EPB A;  1RTN A;  2F0D A;  3QWN A;  4CJ2 C;  5BN4 A;  1GXD C;  2M9V A;  3K58 A;  3FMC A;  2VNU D;  4FXG C;  4V19 0;  3ITP A;  3K5L A;  3KF8 A;  4RH6 A;  4PMB A;  1I4G A;  1D5M C;  5AFW A;  2N55 A;  3FVQ A;  5A2Q E;  1C48 A;  4X3T A;  3NWS A;  5ELB A;  1TWG B;  3OMG A;  3C2P A;  5IGE A;  1IYU A;  2WKC A;  3TP6 A;  3GTO B;  1LTB D;  1Y69 U;  1XYI A;  2LS0 1;  1G2T A;  5CV6 A;  2R92 B;  3NWT A;  3RMH A;  1DCZ A;  2SDF A;  1TWH B;  4K5V A;  1F9R A;  5C0X I;  3BVG A;  1YNJ C;  4C3J G;  1G91 A;  5ELF A;  1M4V A;  1RTO A;  2NN6 I;  2XRS D;  3N6R A;  1ENA A;  1EYC A;  4RHR A;  4IFD G;  2WP8 J;  4KY6 A;  5LL6 S;  2IL8 A;  1HFG A;  3KUP A;  1EFI D;  3RZD B;  4MN3 A;  3VR6 A;  5DNF A;  5T1G A;  3D4R A;  3Q0A A;  3HOX B;  4RAU C;  1TS4 A;  1S5D D;  2BDO A;  1CM9 A;  2B2V C;  4ZUJ A;  1EOT A;  3VYR A;  4RGO S;  2RVL A;  1CFM A;  3MTS A;  4F8M A;  3VR2 A;  1STN A;  3K6O A;  2JE6 I;  3TP8 A;  1V43 A;  4WOR A;  4CGY B;  1LTR D;  4G7H C;  1C8C A;  5F2D A;  5M3M B;  4IQZ A;  1RF2 D;  1LT3 D;  2NVX B;  3JAM E;  3OMC A;  3ONA B;  1EQT A;  4NMZ A;  1O78 A;  4FXK C;  1KNA A;  2M2L A;  4OIK A;  1EWC A;  3H94 A;  4IUU A;  4XXE A;  1MSG A;  3A54 A;  4HAE A;  2XIW A;  1PTO H;  3AB9 A;  3J7A F;  2KHS A;  2K5D A;  2ZXO A;  2IJ0 A;  1QE6 A;  1S4Z A;  3URY A;  1G6Z A;  5EPK A;  1PXU A;  2HCC A;  3C3L A;  2NTS A;  4M8A A;  3V96 A;  4C3J B;  3QIA A;  2B2Y A;  4XYQ A;  1EIG A;  3VA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...