1Z7TA

Solution structure of bacillus subtilis blap apo-form
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
72
structure length
72
Chain Sequence
TVSIQMAGNLWKVHVKAGDQIEKGQEVAILESMKMEIPIVADRSGIVKEVKKKEGDFVNEGDVLLELSNSTQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of Bacillus subtilis BLAP apo-form
rcsb
source organism Bacillus subtilis subsp. subtilis str. 168
molecule tags Transport protein
molecule keywords Biotin/Lipoyl Attachment Protein
total genus 13
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2005-03-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1z7tA00
3PUVA 3PUWA 3A7AB 1Q1EA 1LABA 1V8QA 1G291 1K8MA 3OW7A 3GD7A 4OGQC 2Q8IB 1IW7D 5KNBA 5C0XH 4BA2I 3PUYA 2EJGC 1GHJA 4G7HC 2A69D 2K7VA 4KKUA 3CRKC 2A68D 3M85A 2O5IC 3PUZA 2BDOA 3PV0A 2EJMA 4TKOB 4XIGS 1DCZA 1EWHA 3I72A 1ONLA 3ND8A 4BA1I 2EJFC 1H9SB 3VR6A 1Y69U 1OXVA 4KKTA 3U9SA 3VR3A 4DK0A 1GJXA 1T5EA 3T53B 3FPPA 3VR2A 1OXUA 5JEAH 2A6EC 4HR7B 3A8IE 4PV1C 4JK1C 1K8OA 3RLFA 3KLRA 3I4LA 1DD2A 2EVBA 4I7ZC 3LNNA 3EQLC 2EDGA 3W3AA 1B9MA 3DXJC 2JE6I 3WDNA 5BN4A 4DK1A 3P20A 2JEAI 4KI0A 3H94A 1Q12A 1H9RA 2DNEA 1GUNA 2O5JC 4H44C 2BE5C 1IYVA 3SE0A 2LMCB 5BN5A 2K33A 1ZKOA 3VR4A 2AUJD 4KMUC 1OXSC 1GUTA 5C0XG 1V43A 1CFMA 1VF5C 1YNNC 1E2ZA 1Q1BA 2PNRC 1Q90A 3N6RA 1TKWB 4RCNA 4XTCS 4GZYC 1HPCA 1DXMA 3M4YA 2R6GA 4OO1G 1GUGA 2D2CC 2BA0A 3M7NA 2AUKA 1H9KA 1PMRA 4H13C 2IT1A 3A8JE 3D31A 2PCFB 3PUXA 1QJOA 2B8FA 3D4RA 3QIAA 2KA7A 2ZT9C 3QG1A 4DNRB 1Y8OB 5KNDA 4KN7C 4DNTB 1VF7A 4OO1H 3IKJA 1I6VC 4IFDG 1FYCA 1CI3M 1GUOA 1O7LA 1YNJC 1VDZA 1ZYRC 1TU2B 2BA1A 2A6HD 2L5TA 3NE5B 5JEAG 1Z6HA 3GQBA 2F1MA 2JXMB 2JEBI 3OPOA 1CTMA 1IW7C 3ND9A 1Y8NB 3T56B 5KNCA 1A6XA 2E75C 3SDZA 3IFTA 1H9SA 4IFDH 4JBWA 4IQZA 2E76C 3AB9A 2DNCA 2A68C 1FR3A 2YYZA 3I73A 4LJZC 3CRLC 3VA7A 2NN6H 4TQUS 4G7OC 4H0LC 5K36G 1IYUA 2D5DA 1VCIA 3MXUA 5K36H 1Z7TA 2B8GA 2QF7A 2BE5D 2NN6G 1GUSA 2KCCA 1SMYC 2DN8A 4G7ZC 3LWUA 1HQMC 2NN6I 3L7ZC 1BDOA 1E2WA 4KHZA 2CW0C 1H9JA 3QJYA 2PPBC 2AWOA 1E2VA 2E74C 4KKSA 1O78A 5A35A 2A6HC 1GHKA 3A7LA 1B9NA 2K32A 3OOCA 4LK1C 4KN4C 2D62A 3BDOA 2V4DA 3HGBA 2A69C 2A6ED 1HTPA 1Y8PB 3BG3A 1LACA 1OXXK 4L8JA 1OXTA 1H9MA 3FMCA 3T51B 3TZUA 5BN3A 3VR5A 3MFYA 3A8KE 1HCZA
chains in the Genus database with same CATH superfamily
3PUWA 2PW7A 2KJXA 2CFMA 1X6OA 5M3FB 1IW7D 5KNBA 4JW0A 4IPDA 5LMUQ 2F0TA 1DJRD 3Q24A 1FNVA 3NTIA 3W1GA 5LHY1 2WP8J 3GTPH 2B2WA 1BUVT 3FP9A 1TT2A 4ZK9B 4XT3B 3MXNA 1P16A 4CDDC 1NJIC 4K0KQ 3K5MA 1N33L 1CSQA 3L0OA 3GTJB 4PV1C 2RDFA 1X56A 3J80E 5G3LD 1FJGQ 1IXRA 4HJ7A 1SE8A 2AMCB 2ZXOA 2G5DA 2VY3A 1TS3A 2JE6I 4GLXA 1DONA 1JWUD 3KBXA 4POFA 3SE0A 2LMCB 5C4XH 2CWPA 2NWGA 1VQAA 3U4VA 1ZKOA 2N3SA 3GTLB 1GUTA 1TWAH 1WTPA 1Q1BA 2LFNA 1AN8A 2R7ZB 2L11A 4ULLA 1JOOA 2XSCA 3H0GG 1O80A 2PNHA 3ITPA 3J81i 5C3EH 2NTTA 2F52A 3IL8A 1KLUD 3SEBA 2JQOA 4DNRB 4RAUC 4YY3L 4NXNQ 3HKSA 3IKJA 3M7NA 3MA2B 1XWEA 4Z9CB 1KD1C 2K1BA 3JAMi 2F0WA 4DV0Q 1IW7C 3MWYW 5KNCA 5BR8L 4AQYQ 4JI3Q 3HOWH 4DR2Q 5EBCA 4DF7A 3K58A 3MXNB 4DUYQ 2EQSA 4JI2L 5ELEA 1I3QB 4A3BG 5LMNQ 1TWHB 4A3JH 2F0FA 3VYTA 4AYBE 2F4IA 1HFGA 4OEMB 3TP5A 1KLGD 1SMYD 3K59A 1M90C 2BE5D 4KV6A 3D6CA 2CW0D 3RZDB 3STBC 2ALYB 3I4MB 4X64L 3GTMB 3RZOB 4V0BA 4A3DG 1LT4D 4XQJA 4DR7Q 1HUNA 3HP3A 2E5LQ 1BCPD 3HGBA 1I94L 1I4RA 2K6AA 4L8JA 1FD7D 3FMCA 5JJZA 5JVH3 1E7ZA 2E2IB 2WACA 3QR8A 4GLAC 4GLVB 2NYZD 3DHQA 1RCVD 4BA2I 1LTRD 2AWNA 2KBNA 4LNQA 1LT5D 5D14A 1EUJA 1EWHA 3I72A 1EYCA 4RGNA 3WWVA 4R4IA 4BA1I 1U4PA 2UUCL 1H9SB 4JI8Q 5M5WB 1Y69U 1O7IA 4X6AH 4KKTA 3T53B 4A76A 2HIXA 3LGJA 4F8MA 1WJJA 4P2CB 2EZVA 3S1NB 5HGTA 3I4LA 1S5ED 3MEHA 4NPSA 3I4NB 4A3IG 2E2DC 1S72A 2EOTA 1YITA 2LXJA 1B9MA 4H7BA 5FLMH 4ZLTF 1E0BA 2R7ZH 1XJVA 4LFBL 2F4VL 3I90A 1E3PA 4V190 2K75A 3OWEB 3M4YA 3K7AB 3QB3A 1D7QA 5C3EG 2Y0SG 3S1QB 2WB1E 2KCMA 4TSSA 3X3NA 1PH4A 2AQ2B 3G6JB 4FO2A 2ZJPA 4DNTB 1N34L 5NUCA 4IFDG 1FYCA 3I91A 2A6HD 2N55A 4IURA 3KLSX 4RG1A 4DV5Q 4RMFA 1O7YA 2NVTH 1TWHH 3H3VC 5J1ZA 1Y8NB 3S16B 3M7GA 2ZXRA 5I4DA 4LJZC 3PGZA 4EX5A 3M4QA 1BOSA 4BBRH 3RZDH 1KNEA 3F2CA 4R4TA 3T16A 1LUZA 2FINB 2DGYA 1VCIA 1VQMA 2K14A 1Y1WB 2VXWA 5EKKA 1EZ6A 4X62L 1I6HB 1SMYC 1GO3E 5CC4A 1D1KA 2JJQA 2PQEA 4HTHA 1UUPA 1H9JA 2AWOA 1II3A 1X3PA 3OYYA 4LF6L 5IP9G 4JI4L 4DAMA 4HJ9A 4DR1L 3A7LA 3PF5A 1JWMD 1F9SA 1PH1A 2MO1A 2KEEA 3R2IA 1WTRA 4MTKA 3A54A 1PRTD 2OCEA 4CDCC 3ULPA 4ZUIA 4JBKA 4JI5Q 4N9TA 4BY7H 4FDBA 3CQZB 1C7YA 3MXPA 4JI7L 4HCEA 4N9PA 4Q5VA 3CXCA 2KEDA 4JOIC 1EWCA 4LUOA 4A3CG 2K7VA 3DUZA 4X3UA 2B2UA 5FO9B 3PV0A 5M5YH 4POGA 1TIID 3HKZG 5C4JB 1ONLA 3B6YA 2F3VA 3TREA 1A63A 1QB5D 1OXVA 1T5EA 4C3IH 2N8NA 4JI3L 1EU4A 3MXGA 4JK1C 1SYCA 1DD2A 3S24A 2XN9C 4Y7NB 1ZYRD 3NTHA 2DY7A 4C3HB 5IE8A 1FGUA 4H44C 3D0FA 4A3KG 2RCNA 3EROA 1VQJA 3S15B 2KECA 5CV7A 1L1OC 4L5SA 3SHLA 1ILPA 3T13A 2UUBQ 1L1OA 1JOQA 1EY8A 4C3JG 5IP7G 5IGEA 3FPUB 1HRJA 2IL8A 4F87A 1N36L 5E3FA 4IALA 1D8LA 3OIQA 3GTGB 1TWCB 3UDIA 2AUKA 1PMRA 4PQXA 1Q3LA 1QE6A 2ZM6L 3D4RA 1HNWL 2ZT9C 2NVQB 1KQSA 4NMZA 3QOJA 2MO0A 1BBWA 1QOHA 1W2BA 1CI3M 2NVYB 1VDZA 1BBXC 1P8LA 1T5XD 2HUGA 3D4WA 5EJWA 1SE4A 2XRQD 3OPOA 4LF9L 1X65A 1N33Q 4OIJA 5AFWA 1RIPA 1KHIA 1AEXA 2DNCA 2YYZA 4KD4A 4UDUC 1JJGA 1JB7A 3SXHA 3GTQB 4HIOA 3CCVA 1Z7TA 2Z4IA 3VYUA 1EL0A 3CPWA 3SK6A 4HSVA 1D2BA 3BZKA 1LT6D 1KABA 1D1IA 5FKAC 4YWMA 2O4XA 2E2HB 2D0OA 2RA4A 3GTMH 2LY7A 4MZ9A 2EY5A 3CCEA 3RN5A 3Q6SA 2QDBA 3A8KE 1OO9B 1Q86C 3PMFA 3R2TA 4JI5L 5M5YB 5E4WC 5ELOA 1JORA 2YTVA 4X3SA 1W3SA 1HTLD 3S14H 2A69D 2HCCA 3CRKC 2A68D 3M85A 4X64Q 1HR0L 2ES2A 4GN4B 2OXPA 2BDOA 4KJOA 3ICEA 4XIGS 3HOZG 4DR3L 1SNPA 2KHJA 1EY4A 3T1HL 5C6AA 2PZTA 2QILA 3FPPA 4BBSH 5JEAH 1EWIA 3O13A 5LMNL 3J7A5 2B39A 3E9IA 3PSIA 1YHBA 2B29A 1HFNA 1KRTA 1GKHA 4OXPA 5BR8Q 3H6MA 1FL0A 2MP1A 2DUDA 1JE5A 1BBUA 1B70B 1LTTD 3H3VI 5IY0A 4LF7Q 2EY6A 1A0IA 1CKNB 1TWCH 2EYPA 5E4XA 1NAPA 2AUJD 4U673 4KMUC 4A3FH 1G91A 2RHSB 3DWQA 1GUWA 4GZYC 1HNZL 2IJ0A 2R6GA 4FNFA 2OEOA 2C9OA 2BA0A 3W5OA 4APVA 2B2UC 4GKJL 5AJ3Q 1K8AC 1AFPA 1EIFA 2KA7A 2C35B 1LTGD 4PZ8A 1I6VC 1ESFA 3HOXG 1HJPA 1JE4A 4QGUA 3CC2A 4LFBQ 5CBEE 1DM0B 2I07B 1UNSA 1LTBD 2A68C 2HT1A 3MC0B 2NN6H 4JI0Q 1MJCA 4KK7A 1BF4A 3W2DA 4J8QA 5FLMG 4R8IA 4BY1B 1AH9A 3OSOA 1K28A 3MXUA 4DPGA 4A3IH 3JC66 1UWVA 1HNXL 3ERSX 2CCZA 2K4KA 3CF5A 3KFUA 3HKZB 4GN3B 4G57A 5IYDG 2CW0C 5ELNA 1NCVA 2PQAA 2UXCQ 4A3GB 3C1EA 1NBWA 4UAIA 2R61A 3HOYB 3TMEA 2QCPX 2MHVA 1PRTC 4GKKL 1SN8A 1TY0A 1I6HH 1STEA 4DK3C 1VQBA 1GM5A 2BOSA 3K0YA 2VQFQ 4K6DA 1JR0D 5L37A 5M3FG 2N49A 3V2TA 3I4MH 2ICEC 4DV7L 3S1RH 2NTSA 2EYOA 1F9QA 1H9MA 3TZUA 2B2YA 1NMGA 4DV6L 4B3RQ 1PYWD 1PVOA 2F0DA 1MKHA 3K6OA 5IGDA 2EY1A 3CCQA 1K8MA 1QNKA 2R92G 3AEVA 4WJ4A 1KAWA 1WVLA 2F3IA 1EQQA 4NW2A 3CP0A 2Z1CA 2IWHA 1QNUA 3GTLH 4DR7L 2JK8A 4ME5A 4UY8C 1G6PA 2OQ0A 1G51A 3MHBA 1Y1WG 3KJOA 4KJNA 1C4QA 2VB2X 5CV8A 3TP6A 2WIIB 4NP5A 3DMUA 2HQLA 3WOFA 2JA5G 2AHOB 2EYMA 4AH6A 4HIMA 4AYBG 1W6KA 2A8VA 3M4OB 4A4IA 1IZ6A 1NTGA 2PQAB 5KYIA 1VQGA 2K50A 5IYBG 1PH3A 4A3MG 1VQ6A 3I4NH 4BY1G 2QEXA 1RHPA 1WFQA 3VR4A 1CKMA 2KOLA 1WTQA 1EYDA 1VF5C 3CCMA 2DJFC 4NXNL 1HZ9A 1TKWB 2EY2A 2NUCA 2SNSA 3PO3B 3ERQA 1YEZA 1RODA 1F9PA 2G9DA 3NP8A 4PZ6A 4H02A 4IUPA 4LFAQ 1QJOA 2Q8RE 5JPNC 3F2DA 2UU9L 1I4HA 4FXDA 1N32Q 3K7AH 4IUQA 4MHEA 4A3EH 1TU2B 4OONA 3U9OA 1B1ZA 1YIJA 3S1QH 3ND9A 2KQ3A 3U50C 4A3IB 4L6TB 3AB9A 3I73A 1EEFD 1XNRL 2X69A 1SE2A 3HFZB 1VQ7A 1R9TH 4DFAA 4JBMA 1EIYB 1F2ZA 4ILWA 2BCOA 5F2DA 4GNXC 4CHTB 3C2PA 3GV3A 1TWFB 2NN6I 2HD3A 3RD4A 1BDOA 2F0SA 3FVQA 1HUMA 4DAPA 3NHHA 4DV3Q 5M5WH 1IKLA 1Y1VG 1KC8C 1XMQQ 1L0WA 5ELDA 1CHQD 1HQRD 2NBFA 3OTOL 1N34Q 4WRDA 3SK8A 1QVGA 3UE1A 4IUUA 1X9NA 4G7HC 3E0JA 2RDGA 3Q22A 4OWWB 1V9PA 3MAQA 3MEFA 1JT8A 2R92H 2PO4A 5ELFA 3TS2A 2C5CA 3PUYA 5CV4A 5FLXc 1CSPA 4LFCL 4QF4A 2B2TA 1X55A 3TEHB 2F4VQ 3FKIB 1A8VA 5CBAE 3ND8A 1F2YA 4HCSA 4B3ML 1E22A 1VMCA 2Q2HA 3M4OH 5C4JH 4HJ8A 3I70A 3NBIA 4R4QA 3E0EA 3L2PA 2RCFA 4X66L 1KRSA 3EQLC 1MHWC 4BBSB 3DXJC 5KYLA 3BZDB 1XNQQ 1I50H 4Y52H 4HJAA 3K5OA 2SDFA 1J5EQ 1H9RA 4JI0L 1KDAA 1IBML 4JPBW 4XYOA 2M9VA 1STHA 2ID0A 5IGFA 1K8GA 3EFXD 3DEPA 4RCNA 5FJ8G 4XTCS 3IAYA 1HPCA 4MN3A 1EQRA 5IWAL 4A3EB 1VQ4A 3S15H 1SLJA 1BQQT 2LSSA 2K5HA 3A8JE 3PUXA 4F88A 1XTCD 3H0GH 5I2YA 3GTJH 2QDLA 4GKJQ 5KNDA 4FXKC 1B3QA 1ILQA 3CAMA 4RGTA 4U68A 2L5TA 4A3FG 2F1MA 4QQBX 4RFBA 3PIO3 4N8FA 2UXDQ 2NVXH 1G6ZA 4DR1Q 1WD1A 3VA7A 3HKZE 1K3BC 3I7FA 3JAML 5I9OA 2VQEQ 1V1OA 5ISRA 5K36H 3S2HB 2NN6G 3HOUB 4ALPA 4L5RC 2R93H 2JA5H 1AW7A 1HQMC 5DM73 4K6LA 1C9OA 4ID6A 5D3IB 2ATWA 1MJEA 1I4GA 2A6HC 1UE1A 4KN4C 5COYA 1EU3A 1VQLA 4PMCA 4X66Q 1SE3A 4IPGA 4ZCKA 1HTPA 4MNOA 4C56C 2VNUD 2BDNA 5BN3A 5GQOA 1EY5A 4B3TQ 4LF9Q 3HS0C 3VYSA 2VUMH 2WB1G 5CR3A 4JV5L 1PFSA 4P72A 5M3MH 4CGYB 1PV4A 5FO7B 5C4ZA 4A93B 4NXML 3H15A 1STYA 3TBIB 4GN5A 2EJMA 2XWBB 4C3JB 1PH5A 1Z9FA 1BNZA 4YWLA 1PLFA 3SGIA 1J6QA 1UE5A 2WAQG 2Z6BA 4DR5Q 4A3KB 3QWNA 3CCRA 2YTXA 1PZJD 1FNWA 1TR5A 4L5TA 4ZYSA 5IYDH 2UUAL 3GV6A 3OTOQ 2LKVA 2OTJA 2M2LA 1HH2P 2JA8B 3DWPA 5EAYA 2ENBA 4BBRG 1V1QA 1Y1VH 1TS2A 4IFDI 3NELA 2F0KA 4HN7A 3K5NA 2OQKA 2H4OA 1X3EA 1ICFB 1SMXA 4RWSC 1CKOA 4DKAC 1FNUA 5C4XB 1O7ZA 2H1EA 5IT9c 2R93G 5ELCA 4LMQD 1RJTA 2WAQB 1H9KA 1PHJA 4M8AA 3NXWA 1CQFA 2I5HA 1A15A 3WOEA 3VDYA 2B63H 1YNJC 2K5WA 2BA1A 3G71A 1IBKQ 4DR6L 2JA7H 3BYTB 2Q2UA 2UU9Q 4JC0A 3DM3A 1EQVA 4XQQA 4TRDA 1F2LA 1B2TA 3NUCA 4JI6Q 2RKSA 2R93B 3SR1A 3V05A 2KUMA 1TWGB 2D5DA 4CKEA 1WOCA 5DNFA 2QF7A 3ER0A 3CCSA 1XPUA 2DN8A 2L15A 1RKNA 2ZTEA 2FFKB 3IRBA 1K83B 4K2LA 1I4PA 5FJ8H 3NK9A 4LK1C 1A3TA 1SNMA 1J5EL 1K73C 1H95A 1Y8PB 2VQEL 1SYBA 5IYCG 2EXZA 1DOLA 3I2ZA 1V8QA 2VZAA 1QZHA 4PMWA 4C2MH 5C44H 3EA6A 4E6IA 1JC7A 5IOCA 2RBMA 2VS1A 4B3MQ 2JA6G 4CJ0B 5JOBA 1PH7A 2UXBL 4A3FB 3PF4A 1QILA 3MTSA 1KL9A 1QUQB 3AQQA 2F0NA 1XPRA 3VR2A 1OXUA 2IHEA 2TSSA 3RUZA 4HR7B 4K5VA 1ET9A 1MBYA 4A3EG 1WTOA 1LM0A 2YTYA 4YCUA 4QIWE 3H91A 1CZGA 1Z47A 5JAVA 1S4ZA 4G4KA 1FJGL 2XGTA 2EYHA 1EQTA 4OL7A 4L63B 2B2VC 2UXCL 1TVXA 1GUNA 2BH2A 4RHRA 5KGUA 1D5XC 3NEMA 3J7YW 4FF1A 3NQIA 4ZAIA 1J9OA 1YNNC 4JG2A 4DU9A 1Q90A 3H3VH 4BY1H 5CV6A 3KBGA 5C0XI 1E24A 2MFIA 2ICIA 3K7UC 1S3OA 3CU7A 1QZGA 2PI2A 5GAEC 1OTCA 1A62A 3S2DB 2A5HA 3PO2G 4GNXB 3NPPA 1GUOA 3S17H 2JA7G 3CCJA 1JJ2A 3H0GB 1CK1A 3A55A 1VQDA 3T56B 5KEEA 1IL2A 4I65A 5AJ3L 1QUQA 3NSWA 3R8BA 1ESRA 2KHIA 3F8TA 4DXGA 4DV1Q 4IOAA 1I94Q 1FR3A 1PRTF 1WTHA 5IGBA 1VS0A 4K5XA 5M5XH 3A74A 4H0LC 1VQKA 4KY5A 1XTDA 1BCPC 2X6LA 4XT1B 3RNUA 1HZAA 1CUKA 2OT2A 1U4MA 1BR9A 5IYCH 2CQOA 2LS01 2A73B 4IJHA 3BDOA 3CCLA 5LL6X 4DAVA 3TS0A 4A3MH 5IYBH 3J81j 3Q8DA 3V96A 1XNRQ 3OMGA 2QKIC 3T1HQ 2ZJRA 1PH8A 1WTXA 1STNA 3F1ZA 4IJLA 2J7ZA 2Q8IB 4IN3A 4BXXH 2RDHA 4QMGA 4GNXA 4KKUA 1GOZA 4JI6L 5FO8B 2EYFA 5KIXA 1X54A 4LFAL 2HQEA 2Q2IA 3GTOH 3KK7A 4KHPL 3VR3A 4DK0A 2B3GA 2DY8A 2L4NA 3OMCA 2A6EC 5M3MG 2Z4HA 1ML0D 4DAYA 2K5VA 3RLFA 1JMCA 4IZ8A 3T1YL 1EFWA 4IUNA 1YJ9A 2EDGA 1D5ZC 3WDNA 4R4CA 1GD7A 1UEAB 4KI0A 2NZ1D 4EQPA 5M3FH 2VQFL 4FF4A 1HZCA 1PTOH 3I3CA 2CKZB 4LF5L 5JJLA 1EIGA 2K33A 2WKCA 2E2JB 3BJUA 4JI1Q 4A3DH 2I0QA 5C0XG 4C3HH 5IT9E 3S1MB 1NUCA 1SYFA 3S17B 4K5WA 3H09A 4UPAA 4BWGB 4DV5L 1HZBA 3KDFB 4QIWB 3T51B 3K5LA 2PW5A 4S3SA 1WTVA 1Y14B 2P5ZX 4OIKA 4CBVA 2JYOA 1JCKB 2MUYA 1T9HA 4DV1L 3M9BA 1M1KC 2TMPA 3MFGA 3C3LA 1TWAB 1SFOH 2ASBA 2E2IH 2KCTA 4DAYB 4QCLA 3AU7A 2B2VA 2GN5A 5EGTA 4A3JG 2UUBL 4HSPA 3CPFA 1GUSA 4G7ZC 1EEID 2XVSA 4ZKBB 1LTLA 1Q8KA 4A3MB 3FKIH 1E2VA 3TP7A 3DLLA 2B2YC 1GHKA 5A2QL 4DV3L 3OOCA 1XX8A 1LYLA 3HOVG 2V4DA 1Q46A 3HOWB 2K5QA 4OO1I 3OHXC 5HGQA 5GADC 3CMEA 1I4QA 2WAQE 3RLOA 2E2HH 4DV4L 4KHVA 4CDFC 2ZTDA 1IBLQ 1JJCB 4X3KA 4RA8A 1LT3D 4X65Q 5LL6S 4O0AA 4DUZL 3GTOB 1FGBD 1HA5A 2SOBA 3I8ZA 4DK6C 3CC4A 5KRUA 1Q7YC 4C2MB 5C44B 3G4SA 3QOLA 3CW2C 3HOYH 2SNMA 2EJFC 3ULJA 2HHHL 2Q8TA 4XYQA 4CJ2C 2X6GA 2IX1A 2IHFA 3GTKB 5A2QE 4GOPC 3S1RB 1CZWA 3P7JA 4A3LH 1PTOB 4KY7A 2M00A 4RGOS 4A93G 1G8ZD 2Q2TA 3U58A 4B9XA 1E1TA 4DK1A 4K2KA 1PRTB 3ZYYX 3I55A 3HOYG 3GP7A 1BO0A 1JOKA 5D3DA 1U9RA 1F77A 4KTAA 5DEHA 1OXSC 3RR5A 2VB3X 3BVMA 3C1FA 1E2ZA 1A3VA 1VQOA 1VMPA 1Q81C 5D65A 2D2CC 4DV0L 2XIWA 3K8AA 4WJWA 4KY6A 1R4PB 3QG1A 1BCPB 2YV5A 3HOUG 3NTKA 4YIJA 1HR0Q 4WFN3 5IIFA 4IPCA 3TP8A 2JXMB 3JAMc 4ABNA 1CTMA 3HOXH 4JBWA 1S5DD 2E76C 5C4HA 1KIXA 4JCVE 1AZPA 2JA7B 1QCBD 2F0JA 2RF4A 1VQIA 4LF4Q 2WKDA 4LUZA 2KCCA 4OELB 1YNJD 4DUZQ 3AFPA 2D0PA 3LWUA 1TWGH 2B2WC 2CHBD 3G6EA 4IO9A 3P1HA 4P74A 4GOPB 2K52A 2NZOA 1QVCA 5EQ0A 4A3KH 2A69C 2Z9HA 2MPMA 4K0KL 3R3OA 1K83H 1GXDC 2L9HA 3AMUA 3PUVA 1Q1EA 1KNAA 1TQOA 1VQ8A 1EY6A 4BS9A 2UUCQ 2JA8H 2GA4B 4OGQC 3C46A 4BBSG 3J80c 5IODA 5E7NA 4RCOA 1GHJA 3GTKH 1TWFH 4ZUJA 2O5IC 4PG3A 5J22A 1XMOL 1SDFA 1VQNA 3T4AC 5CGKA 4ME3A 3T1YQ 1EIHA 2K05A 3BZCA 4P73A 2EE1A 1YNND 1VQFA 2F0EA 4FF2A 4JI7Q 5IGCA 2MNAA 2NVQH 5CMDA 2ZTCA 1PFMA 3D4DA 4YCVA 1HNZQ 1M8AA 5C0XJ 4QB4A 2R3ZA 3FRPB 4PZ7A 4ZQ3A 4DV2L 2K28A 1IYVA 4GOPA 5BN5A 1VQ5A 1QWYA 4JI4Q 3HOVH 4LF7L 2YU9H 1DZ1A 3AYHB 2R7FA 1L0XB 3RN2A 1CFMA 2PNRC 2L55A 4FF3A 3GTQH 1XYIA 5C5MA 2HDLA 1SYDA 1KAAA 2PCFB 1VQ9A 3QIAA 4F7XA 5HY6A 1ENAA 2K03A 1Y8OB 3HEJA 4HJ5A 2K5NA 1O7LA 1ZYRC 4Q0FA 3NBHB 3CD6A 4C1NK 1J8IA 1V1PA 2JP1A 4M1UB 2E75C 2XRSD 2Z6KA 1B53A 3EBEA 3SDZA 3K0XA 2Z6KC 4UP9A 1KDBA 3CRLC 2FXQA 2I5MX 2E8GA 3CMAA 1PH2A 1IBKL 2I5LX 4K14A 4DR6Q 1BXTA 1UAPA 3GTGH 1U5KA 3PCOB 2G9HD 3HG9A 1SFOB 2F0PA 3L7ZC 4QY7A 5ELBA 4KHZA 4UP7A 5IWAQ 2F0GA 3K81C 2KENA 5C4XG 4C3HG 2B2TC 4FXGC 3K57A 3CC7A 2K32A 2AKWB 3PO3G 4QUFA 4X62Q 2RQXA 1NMFA 5JPMC 3FHWA 3F2BA 4DV4Q 3TQYA 2WV6D 1HR0W 1OXXK 3P75A 3GO5A 4HEDA 3A7AB 1TXYA 2JA8G 1MSGA 3OW7A 1HNXQ 1Y1WH 4AYBB 3PQIA 3A5UA 3L9AX 3W1BA 5H1SE 2JA5B 4HMJA 3HOZH 1SNQA 4A3BH 2KCNA 4TKOB 2PMZB 4CKBA 3U9SA 1BCPF 4DNIA 3L3OC 5C3EB 1LTSD 4LF4L 1K8OA 1KXLA 2MGSA 3M4PA 1YVCA 1PYBA 3S2DH 4BY7B 2EVBA 3STBD 3TN2A 2YU9B 1RDPD 3TZDA 4AIMA 4LF8L 3G48A 4QJFA 1SEBD 4RKLA 4EQOA 1GVPA 5C3WA 1ENCA 3F2UA 3J81L 1XMQL 5DLQE 1V43A 2HCIA 3UDGA 3UI2A 1VQCA 1EY9A 5GAHC 5CV5A 1CA5A 4C3IB 1TY2A 2I46A 4A3GG 5GAGC 5K5PA 2NVTB 1B7YB 1UEBA 3D31A 2B8FA 2EPBA 4IFDJ 3S1MH 3S16H 3BVGA 4DUYL 4A3GH 1NSNS 4OO1H 1E1OA 2F0QA 3OW2A 3BYYB 1MI2A 5M9OA 5EKLA 4AQYL 1RF2D 2L1BA 4X3TA 1G2TA 4MIUA 1A6XA 2Y0SB 1C48A 2HDMA 3D8GA 1IL8A 3KLWA 1IYUA 4OWXB 4A75A 3HOXB 1WCMH 2UXBQ 4WORA 4O2DA 1PTOD 3K80C 2F0MA 1WTWA 4JVZA 5FLXL 1K0SA 4GS3A 2PPBC 3EJIA 2E74C 2AQ3B 4KKSA 1K9MC 3CHBD 1EFID 1I4XA 1AE2A 4I7AA 3I4MG 2D62A 5J39A 2F0OA 4KD3A 2FMMA 3I4NG 3BG3A 1LACA 2GVBA 1OXTA 2SEBD 5EPKA 3DEOA 3NQTA 1YI2A 1LABA 1ZXTA 1IBMQ 4A3BB 3CKIB 5EPLA 2K04A 3KDFA 1XNQL 1SR3A 2EIFA 1YJWA 4FVMA 3PUZA 3M3YH 1S5FD 1YHQA 2R7DA 5DAUA 1VQPA 4MTNA 4A3CH 2CH4A 1SROA 2QGQA 3SK4A 1PFBA 5LMUL 1A2UA 1GJXA 3FKIG 1QG7A 5EPJA 1S5CD 1PTOC 1BKBA 3D3RA 2OF1A 3J81E 1PXUA 2N78A 2ZM6Q 1HNWQ 3MVVA 3W3AA 1NNXA 2JEAI 1HXYD 4DV6Q 5CV9A 3RMHA 1PZID 2O5JC 4RKBA 3JAME 1XMOQ 2EXDA 2NVXB 3URYA 1Q82C 3GTPB 3PO2B 2FJ2A 1B50A 4RH6A 5GROA 1Y1VB 4YCWA 5EBDA 1SNOA 4OO1G 4DN4M 3D6WA 3R93A 1R4QB 3KF6B 4KN7C 3I56A 4L5QA 3Q0AA 4N8X1 4JI1L 4IOCA 5I2XA 3BS1A 2O2LD 4RHSA 3X3MA 4EQ5A 2K01A 4IQZA 3NENA 4R1JA 1EY0A 3E3XA 2BH8A 1K3RA 2N88A 1LO5D 1VQEA 1M4VA 4TQUS 4K8JA 1NR2A 2ZXPA 3LX0A 2B8GA 4A93H 2RSOA 2J0TD 2JSOA 1U4RA 4KHPQ 1CA6A 4PNYA 3BDCA 4C3JH 1YZ6A 4HIKA 3BVZA 3UDXA 1JB3A 5TSSA 1CM9A 3VA5A 1B8AA 2JA6B 4JYAQ 3OIPA 3NWSA 4LW1A 1KTKA 1Q8IA 1UE6A 1UE7A 2L12A 1I3QH 1G291 1SXTA 1I50B 3KF6A 4JI2Q 5C0XH 1X3GA 3KJPA 1VQHA 3E9HA 4C3IG 4B08A 1A3UA 1EOTA 4ODGA 3RZOH 4ZKCB 4DR4Q 4FP5D 4DR3Q 3BDLA 2F0VA 5I9PA 5FK9C 1LV9A 2VL6A 3A56A 2RSNA 4LWCA 1NE3A 3E6ZX 1WI5A 1PH6A 4LF8Q 3KUPA 1SRUA 2NVYH 4B9WA 5I6WA 3P20A 2R92B 1WYDA 4BY7G 3TDQA 3VYRA 3H94A 2HHHQ 4LFCQ 4R8NA 1LTAD 1EZ8A 2BE5C 4HIDA 4HMIA 1G2SA 2Z0SA 4XDXA 1SYGA 5DM63 3J80L 4YHHQ 1PTOF 4DV7Q 4UHVA 2IX3A 1ASYA 2F0LA 1EYAA 1ET6A 1JWSD 3S2HH 4YWKA 1YBYA 2QA4A 3HOUH 2A74C 2WINB 4XQNA 4B3SL 4UP8A 3BU2A 2L0CA 5HURA 5T1IA 3EIVA 3E5SA 3KYHC 1XXGA 2K5DA 4JI8L 4IFDH 1H9SA 1W6JA 1ZEQX 2UUAQ 4J1MA 3A0JA 3KOJA 4P71A 5JEAJ 4DA2A 2VUMB 1NY4A 3DWAA 5G3LF 4DR5L 1WCMG 1MSHA 1YNXA 4EQNA 5M3MB 3J81c 3EN2A 2RVLA 4R4OA 4HAEA 2IPKD 4EGVA 2NZHA 1JQYD 1PH9A 4WJ3M 4XXEA 3QJYA 1MD2D 3J7AV 2PZWA 4DXFA 3NWTA 1EY7A 5JVG3 1JICA 2E5LL 2A6ED 5CYUA 1C8CA 4LUVA 3N52A 2F03A 3MFYA 2WB1B 5IT9L 2CH4W 2EYLA 1SJHD 1R9TB 2QEJC 1SNDA 1U0LA 4R9WA 2CWAA 3NBHA 1N8RC 1AZQA 4PMBA 5I6YA 4LF5Q 1DCZA 2CQAA 1V1PB 3S1NH 1TS4A 4DR2L 1ASZA 2D9UA 4OX9L 1LTID 2PZUA 5J3BA 3HOZB 3A5ZB 2F3WA 4TVAB 2LXKA 3A8IE 3MZ5A 5C3XA 2QW7A 1STBA 4I7ZC 4OHJA 3LNNA 3UE0A 4K8IA 5C5LA 2UXDL 2KVMA 1N32L 5BN4A 1C0AA 1Q12A 2DNEA 2PYKA 1L2FA 3PO3H 1SBBB 2PMZE 5IP9H 2IW3A 3TRZA 1X32A 3N6RA 4J15A 1IKMA 4IPHA 1QVFA 4OWTB 4IUTA 2E2JH 3FEWX 1GUGA 1RTOA 2PI2E 3KF8B 3J80i 4A3DB 4KLKA 4CDEC 2IT1A 2OTLA 2A1AA 1IBLL 1ENFA 1CQVA 1IYJB 4FYDA 4O42A 1VF7A 1SJED 3ZJYC 1N9WA 3NE5B 1DYQA 2DJGC 1Z6HA 3GQBA 1IHZA 1HHVA 2JA9A 2IY5B 4P75A 1S40A 2MJ8A 1AP0A 2J4XA 3U4ZA 4DV2Q 4G7OC 4CKCA 1EOVA 4RGMA 2Y0SE 1PYSB 5FLXE 1RL2A 2FHTA 1YJNA 1AE3A 2NB0A 4A3LG 2KHSA 2F0HA 4DGZA 4YHHL 1XPOA 1CT1D 1B3AA 1DOMA 1O78A 2H5XA 3ONAB 1BVSA 1DGSA 1B9NA 4B3RL 3CQZH 1MGSA 4NB3A 1DOKA 3J7ZC 2R7ZG 1L1OB 1CHPD 3CCUA 4NXMQ 2Z8LA 1TS5A 3PIPA 2AQ1B 2V1CC 5EKIA 2VW9A 5C44G 4JV5Q 4GKKQ 1F2MA 3KF8A 3SVMA 3HZXA 2JA6H 2VUMG 4B3TL 3PIP3 1RTNA 4BXXG 3GD7A 1L0YB 1STAA 4QL5A 1KDCA 2EJGC 3SK5A 3OWFA 1X3FA 4DR4L 1PFNA 3IFDA 2F0IA 3G7LA 3VR6A 4B3SQ 1K0RA 2OWOA 1SNCA 3HOWG 3M3YB 4Y7NH 1D5MC 3S9WA 1SYEA 2A19A 1SSOA 2GVAA 3KLRA 1SAPA 4IUVA 4O1NA 5FOBB 2ZJQA 3HRZC 1MIUA 2XTIA 1X3QA 1PA6A 4JYAL 3S14B 2XWJB 1B4OA 1YHAA 1S5BD 4C1NI 2IX0A 1RD9D 3FDTA 5M5XB 2CVRA 3QO2A 1U4LA 1A2TA 1DXMA 4EVOA 1WCMB 5CORA 1WD0A 2B63G 5JJKA 4LF6Q 3PO2H 1ICWA 1B44D 3RLNA 3AFQA 4H13C 3ULLA 4X65L 3TSSA 1NR4A 4OX9Q 1I5FA 2MQHA 4BBRB 4J6HA 4ZRZA 5JEAG 3DM1A 2JEBI 4JOIA 2RHQB 4CJ1B 1FVIA 3GDEA 3IFTA 3HOVB 4JBJA 2HIVA 1PDQA 1HA6A 1F9RA 3PIOA 4NKLA 5T1GA 4NDXA 5K36G 4QUCA 1LLRD 5LMNW 2JN4A 4YY3Q 3Q23A 1STGA 2F0UA 1D6EC 5IP7H 4LAAA 3J7AF 1E2WA 4A3JB 2FMCA 5JJIA 5A35A 5IGGA 1EYGA 2B63B 1CKNA 2WFWA 3I4OA 2XNAC 1PZKD 3LWEA 5E1FA 3EVQA 3KLSA 2EYJA 1N36Q 3UDFA 3VR5A 1HCZA
chains in the Genus database with same CATH topology
3PUWA 2PW7A 2KJXA 5M3FB 1IW7D 5KNBA 2F0TA 1DJRD 3Q24A 1FNVA 3NTIA 5LHY1 2WP8J 2B2WA 1BUVT 1TT2A 4ZK9B 4XT3B 3MXNA 3K5MA 3GTJB 4PV1C 2RDFA 3J80E 5G3LD 2ZXOA 1TS3A 2JE6I 1DONA 1JWUD 3KBXA 3SE0A 2LMCB 2NWGA 1ZKOA 3GTLB 1GUTA 1WTPA 1Q1BA 2LFNA 1AN8A 2R7ZB 2L11A 4ULLA 1JOOA 2XSCA 1O80A 3ITPA 2NTTA 3IL8A 1KLUD 3SEBA 4DNRB 4RAUC 3IKJA 3M7NA 3MA2B 1XWEA 4Z9CB 2K1BA 2F0WA 1IW7C 3MWYW 5KNCA 5EBCA 4DF7A 3K58A 5ELEA 1I3QB 1TWHB 2F0FA 3VYTA 2F4IA 1HFGA 3TP5A 1KLGD 1SMYD 3K59A 2BE5D 4KV6A 3D6CA 2CW0D 3RZDB 3I4MB 3GTMB 3RZOB 4V0BA 1LT4D 4XQJA 1HUNA 3HP3A 1BCPD 3HGBA 1I4RA 2K6AA 4L8JA 1FD7D 3FMCA 5JJZA 5JVH3 2E2IB 2WACA 2NYZD 3DHQA 1RCVD 4BA2I 1LTRD 2AWNA 1LT5D 5D14A 1EWHA 3I72A 1EYCA 4RGNA 4BA1I 1U4PA 1H9SB 5M5WB 1Y69U 4KKTA 3T53B 4F8MA 4P2CB 2EZVA 3S1NB 5HGTA 3I4LA 1S5ED 3MEHA 3I4NB 2E2DC 2EOTA 1B9MA 4H7BA 4ZLTF 1E0BA 3I90A 4V190 3OWEB 3M4YA 3K7AB 3QB3A 3S1QB 4TSSA 3X3NA 2AQ2B 3G6JB 4FO2A 4DNTB 5NUCA 4IFDG 1FYCA 3I91A 2A6HD 2N55A 4IURA 3KLSX 1O7YA 3H3VC 5J1ZA 1Y8NB 3S16B 3M7GA 2ZXRA 5I4DA 4LJZC 1BOSA 1KNEA 3T16A 2FINB 1VCIA 1Y1WB 2VXWA 5EKKA 1EZ6A 1I6HB 1SMYC 5CC4A 1D1KA 2PQEA 4HTHA 1UUPA 1H9JA 2AWOA 1II3A 1X3PA 3A7LA 1JWMD 1F9SA 1WTRA 2KEEA 3R2IA 3A54A 1PRTD 4ZUIA 4N9TA 3CQZB 3MXPA 4HCEA 4N9PA 4Q5VA 2KEDA 1EWCA 2K7VA 3DUZA 4X3UA 2B2UA 5FO9B 3PV0A 1TIID 5C4JB 1ONLA 2F3VA 1QB5D 1OXVA 1T5EA 1EU4A 3MXGA 4JK1C 1SYCA 1DD2A 2XN9C 4Y7NB 1ZYRD 3NTHA 2DY7A 4C3HB 4H44C 3EROA 3S15B 2KECA 5CV7A 3SHLA 1ILPA 3T13A 1JOQA 1EY8A 4C3JG 5IGEA 3FPUB 1HRJA 2IL8A 4F87A 5E3FA 4IALA 3GTGB 3OIQA 1TWCB 2AUKA 1PMRA 4PQXA 1Q3LA 1QE6A 3D4RA 2ZT9C 2NVQB 4NMZA 3QOJA 1QOHA 1CI3M 1BBXC 2NVYB 1VDZA 1T5XD 2HUGA 3D4WA 5EJWA 1SE4A 2XRQD 3OPOA 4OIJA 5AFWA 1AEXA 2DNCA 2YYZA 4KD4A 4UDUC 3SXHA 3GTQB 1Z7TA 2Z4IA 3VYUA 1EL0A 3SK6A 4HSVA 1D2BA 1LT6D 1KABA 1D1IA 5FKAC 2O4XA 2E2HB 2RA4A 2LY7A 2EY5A 3Q6SA 2QDBA 3A8KE 1OO9B 3PMFA 3R2TA 5M5YB 5E4WC 1JORA 4X3SA 1HTLD 2A69D 2HCCA 3CRKC 2A68D 3M85A 2OXPA 2BDOA 4KJOA 4XIGS 1SNPA 1EY4A 5C6AA 2PZTA 2QILA 3FPPA 5JEAH 3O13A 2B39A 1HFNA 3H6MA 2MP1A 1LTTD 2EY6A 2EYPA 4U673 5E4XA 1NAPA 2AUJD 1G91A 4KMUC 3DWQA 1GUWA 4GZYC 2IJ0A 2R6GA 4FNFA 2OEOA 2C9OA 2BA0A 2B2UC 1AFPA 2KA7A 1LTGD 1I6VC 1ESFA 1JE4A 5CBEE 1DM0B 2I07B 1UNSA 1LTBD 2A68C 3MC0B 2NN6H 1BF4A 4KK7A 3W2DA 4J8QA 4R8IA 4BY1B 3OSOA 3MXUA 3HKZB 4G57A 2CW0C 1NCVA 4A3GB 3C1EA 4UAIA 2R61A 3HOYB 3TMEA 2QCPX 2MHVA 1PRTC 1TY0A 1STEA 2BOSA 3K0YA 4K6DA 1JR0D 3V2TA 2ICEC 2NTSA 2EYOA 1F9QA 1H9MA 3TZUA 2B2YA 1PYWD 2F0DA 3K6OA 5IGDA 2EY1A 1K8MA 1QNKA 1WVLA 4NW2A 2Z1CA 2IWHA 1QNUA 4ME5A 3MHBA 4KJNA 1C4QA 2VB2X 5CV8A 3TP6A 2WIIB 4NP5A 3DMUA 3WOFA 2EYMA 1W6KA 3M4OB 5KYIA 1RHPA 3VR4A 2KOLA 1WTQA 1EYDA 1VF5C 1TKWB 2EY2A 2NUCA 2SNSA 3PO3B 3ERQA 1RODA 1F9PA 2G9DA 3NP8A 4IUPA 1QJOA 2Q8RE 5JPNC 1I4HA 4FXDA 4IUQA 4MHEA 1TU2B 3U9OA 1B1ZA 3ND9A 2KQ3A 4A3IB 4L6TB 3AB9A 3I73A 1EEFD 2X69A 1SE2A 4DFAA 1F2ZA 4ILWA 2BCOA 5F2DA 4CHTB 3C2PA 3GV3A 1TWFB 2NN6I 3RD4A 1BDOA 2F0SA 3FVQA 1HUMA 4DAPA 3NHHA 1IKLA 5ELDA 1CHQD 1HQRD 2NBFA 4WRDA 3SK8A 4IUUA 4G7HC 3E0JA 2RDGA 3Q22A 3MAQA 2PO4A 5ELFA 2C5CA 3PUYA 5CV4A 4QF4A 2B2TA 3FKIB 5CBAE 3ND8A 1F2YA 4HCSA 1VMCA 3I70A 3NBIA 3EQLC 4BBSB 3DXJC 5KYLA 3BZDB 3K5OA 2SDFA 1H9RA 1KDAA 4XYOA 2M9VA 1STHA 2ID0A 5IGFA 3EFXD 3DEPA 4RCNA 4XTCS 3IAYA 1HPCA 4MN3A 4A3EB 1BQQT 4F88A 3A8JE 3PUXA 1XTCD 5I2YA 5KNDA 4FXKC 1ILQA 4RGTA 4U68A 2L5TA 2F1MA 4RFBA 3PIO3 1G6ZA 1WD1A 3VA7A 3JAML 5I9OA 1V1OA 5ISRA 5K36H 3S2HB 2NN6G 3HOUB 1AW7A 1HQMC 5DM73 4K6LA 4ID6A 5D3IB 1I4GA 2A6HC 4KN4C 5COYA 1EU3A 4PMCA 1SE3A 1HTPA 4C56C 2VNUD 2BDNA 5BN3A 1EY5A 3HS0C 3VYSA 5CR3A 4CGYB 5FO7B 5C4ZA 4A93B 1STYA 3TBIB 2EJMA 2XWBB 4C3JB 1BNZA 1PLFA 4A3KB 3QWNA 1PZJD 1FNWA 1TR5A 4ZYSA 3GV6A 2LKVA 2M2LA 2JA8B 3DWPA 2ENBA 1TS2A 4IFDI 2F0KA 4HN7A 3K5NA 2H4OA 4RWSC 1FNUA 5C4XB 1O7ZA 2H1EA 5ELCA 4LMQD 1RJTA 2WAQB 1H9KA 3NXWA 4M8AA 1CQFA 1A15A 3WOEA 1YNJC 2K5WA 2BA1A 3BYTB 1EQVA 4XQQA 4TRDA 1F2LA 1B2TA 3NUCA 2RKSA 2R93B 3SR1A 3V05A 2KUMA 1TWGB 2D5DA 4CKEA 5DNFA 2QF7A 2DN8A 1RKNA 2FFKB 1K83B 4K2LA 1I4PA 3NK9A 4LK1C 1A3TA 1SNMA 1Y8PB 1SYBA 2EXZA 1DOLA 1V8QA 4PMWA 3EA6A 4E6IA 1JC7A 5IOCA 2RBMA 4CJ0B 5JOBA 4A3FB 1QILA 3MTSA 2F0NA 3VR2A 1OXUA 2TSSA 3RUZA 4HR7B 1ET9A 4K5VA 1MBYA 1WTOA 3H91A 1CZGA 1Z47A 5JAVA 1S4ZA 4G4KA 2EYHA 1EQTA 4OL7A 4L63B 2B2VC 1TVXA 1GUNA 3J7YW 4FF1A 4RHRA 5KGUA 1D5XC 3NQIA 4ZAIA 1J9OA 1YNNC 4DU9A 1Q90A 5CV6A 3KBGA 5C0XI 2ICIA 3CU7A 3S2DB 2A5HA 3NPPA 1GUOA 3H0GB 1CK1A 3A55A 5KEEA 3T56B 4I65A 3NSWA 3R8BA 1ESRA 4DXGA 1FR3A 1PRTF 5IGBA 4K5XA 4H0LC 4KY5A 1BCPC 2X6LA 4XT1B 2OT2A 1U4MA 1BR9A 2LS01 2A73B 3BDOA 5LL6X 4DAVA 3V96A 3OMGA 2QKIC 1WTXA 1STNA 2J7ZA 2Q8IB 4IN3A 2RDHA 4QMGA 4KKUA 1GOZA 5FO8B 2EYFA 5KIXA 2HQEA 3KK7A 3VR3A 4DK0A 2DY8A 2L4NA 3OMCA 2A6EC 2Z4HA 1ML0D 4DAYA 3RLFA 4IZ8A 4IUNA 2EDGA 1D5ZC 3WDNA 1UEAB 4KI0A 2NZ1D 4EQPA 4FF4A 1PTOH 3I3CA 1EIGA 2K33A 2WKCA 2E2JB 5C0XG 5IT9E 3S1MB 1NUCA 1SYFA 3S17B 4K5WA 3H09A 4BWGB 4QIWB 3T51B 3K5LA 2PW5A 4S3SA 1WTVA 4OIKA 4CBVA 2JYOA 1JCKB 2MUYA 2TMPA 3MFGA 3C3LA 1TWAB 4QCLA 3AU7A 2B2VA 5EGTA 4HSPA 1GUSA 4G7ZC 1EEID 2XVSA 4ZKBB 4A3MB 3TP7A 1E2VA 2B2YC 1GHKA 5A2QL 3OOCA 1XX8A 2V4DA 3HOWB 2K5QA 4OO1I 3OHXC 1I4QA 4KHVA 4X3KA 4RA8A 1LT3D 5LL6S 3GTOB 1FGBD 1HA5A 2SOBA 3I8ZA 5KRUA 5C44B 4C2MB 3QOLA 2SNMA 2EJFC 2Q8TA 4XYQA 4CJ2C 2X6GA 2IX1A 3GTKB 5A2QE 3S1RB 1CZWA 3P7JA 1PTOB 4KY7A 2M00A 4RGOS 1G8ZD 4B9XA 4DK1A 4K2KA 1PRTB 3ZYYX 3GP7A 1BO0A 1JOKA 5D3DA 1U9RA 1F77A 4KTAA 5DEHA 1OXSC 2VB3X 3BVMA 3C1FA 1E2ZA 1A3VA 1VMPA 5D65A 2D2CC 2XIWA 4WJWA 4KY6A 1R4PB 3QG1A 1BCPB 3NTKA 4YIJA 4WFN3 5IIFA 3TP8A 2JXMB 4ABNA 1CTMA 4JBWA 1S5DD 2E76C 5C4HA 1AZPA 2JA7B 1QCBD 2F0JA 2WKDA 2KCCA 1YNJD 3LWUA 2B2WC 2CHBD 3P1HA 5EQ0A 2A69C 2MPMA 3R3OA 1GXDC 2L9HA 3AMUA 3PUVA 1Q1EA 1KNAA 1TQOA 1EY6A 4BS9A 2GA4B 4OGQC 3C46A 5IODA 4RCOA 1GHJA 2O5IC 4ZUJA 5J22A 1SDFA 3T4AC 5CGKA 1EIHA 2K05A 2EE1A 1YNND 2F0EA 4FF2A 5IGCA 5CMDA 1PFMA 3D4DA 1M8AA 5C0XJ 4QB4A 2R3ZA 3FRPB 4ZQ3A 2K28A 1IYVA 5BN5A 1QWYA 1DZ1A 1L0XB 1CFMA 2PNRC 2L55A 4FF3A 1XYIA 5C5MA 2HDLA 1SYDA 1KAAA 2PCFB 3QIAA 4F7XA 1ENAA 2K03A 1Y8OB 3HEJA 1O7LA 1ZYRC 4Q0FA 4C1NK 1J8IA 1V1PA 2JP1A 4M1UB 2E75C 2XRSD 3SDZA 1B53A 1KDBA 3CRLC 4K14A 1BXTA 1UAPA 2G9HD 3HG9A 1SFOB 2F0PA 3L7ZC 5ELBA 4KHZA 2F0GA 4C3HG 2B2TC 4FXGC 3K57A 2K32A 4QUFA 2RQXA 5JPMC 2WV6D 1OXXK 3P75A 3GO5A 4HEDA 3A7AB 1MSGA 3OW7A 4AYBB 3L9AX 2JA5B 4HMJA 1SNQA 2KCNA 4TKOB 2PMZB 4CKBA 3U9SA 1BCPF 3L3OC 5C3EB 1LTSD 1K8OA 2MGSA 4BY7B 2EVBA 3TN2A 2YU9B 1RDPD 3TZDA 1SEBD 4RKLA 4EQOA 5C3WA 1ENCA 3F2UA 3J81L 1V43A 2HCIA 3UI2A 1EY9A 5CV5A 1CA5A 4C3IB 1TY2A 2I46A 5K5PA 2NVTB 3D31A 2B8FA 2EPBA 4IFDJ 3BVGA 1NSNS 4OO1H 2F0QA 3BYYB 1MI2A 5M9OA 5EKLA 1RF2D 2L1BA 4X3TA 1G2TA 4MIUA 1A6XA 2Y0SB 1C48A 2HDMA 3D8GA 1IL8A 1IYUA 3HOXB 4WORA 1PTOD 2F0MA 1WTWA 5FLXL 2PPBC 3EJIA 2E74C 2AQ3B 4KKSA 3CHBD 1EFID 1I4XA 2D62A 5J39A 2F0OA 4KD3A 2FMMA 3BG3A 1LACA 1OXTA 2SEBD 5EPKA 3DEOA 3NQTA 1LABA 1ZXTA 4A3BB 3CKIB 5EPLA 2K04A 4FVMA 3PUZA 1S5FD 5DAUA 3SK4A 1PFBA 1A2UA 1GJXA 1QG7A 5EPJA 1S5CD 1PTOC 3D3RA 2OF1A 3J81E 1PXUA 3MVVA 3W3AA 2JEAI 1HXYD 5CV9A 3RMHA 1PZID 2O5JC 4RKBA 3JAME 2NVXB 3URYA 3GTPB 3PO2B 2FJ2A 1B50A 4RH6A 1Y1VB 5EBDA 1SNOA 4OO1G 4DN4M 3D6WA 3R93A 1R4QB 4KN7C 3Q0AA 5I2XA 3BS1A 2O2LD 4RHSA 3X3MA 2K01A 4IQZA 1EY0A 2N88A 1LO5D 4TQUS 1M4VA 4K8JA 1NR2A 2ZXPA 3LX0A 2B8GA 2RSOA 2J0TD 2JSOA 1U4RA 1CA6A 4PNYA 3BDCA 3BVZA 1JB3A 5TSSA 1CM9A 3VA5A 2JA6B 3OIPA 3NWSA 1KTKA 1Q8IA 2L12A 1G291 1SXTA 1I50B 5C0XH 4C3IG 4B08A 1A3UA 1EOTA 4ODGA 4ZKCB 4FP5D 3BDLA 2F0VA 5I9PA 5FK9C 1LV9A 3A56A 2RSNA 3E6ZX 3KUPA 4B9WA 5I6WA 3P20A 2R92B 3TDQA 3VYRA 3H94A 4R8NA 1LTAD 1EZ8A 2BE5C 4HMIA 1G2SA 4XDXA 1SYGA 5DM63 3J80L 1PTOF 2IX3A 2F0LA 1EYAA 1ET6A 1JWSD 2A74C 2WINB 4XQNA 2L0CA 5HURA 5T1IA 3E5SA 1XXGA 2K5DA 4IFDH 1H9SA 1W6JA 1ZEQX 4J1MA 4DA2A 5JEAJ 2VUMB 3DWAA 5G3LF 1MSHA 4EQNA 5M3MB 2RVLA 4HAEA 2IPKD 4EGVA 1JQYD 4XXEA 3QJYA 1MD2D 3J7AV 2PZWA 4DXFA 3NWTA 1EY7A 5JVG3 1JICA 2A6ED 5CYUA 1C8CA 3N52A 2F03A 3MFYA 2WB1B 5IT9L 2EYLA 1SJHD 1R9TB 2QEJC 1SNDA 4R9WA 3NBHA 1AZQA 4PMBA 5I6YA 1DCZA 2CQAA 1V1PB 1TS4A 2D9UA 1LTID 2PZUA 3HOZB 2F3WA 3A8IE 3MZ5A 5C3XA 1STBA 4I7ZC 4OHJA 3LNNA 4K8IA 5C5LA 2KVMA 5BN4A 1Q12A 2DNEA 2PYKA 1SBBB 2IW3A 1X32A 3N6RA 1IKMA 4IUTA 3FEWX 1GUGA 1RTOA 4A3DB 2IT1A 1ENFA 1CQVA 4FYDA 4O42A 1VF7A 1SJED 3NE5B 1DYQA 1Z6HA 3GQBA 1IHZA 1HHVA 2MJ8A 1AP0A 2J4XA 4G7OC 4CKCA 4RGMA 5FLXE 2FHTA 2NB0A 2KHSA 2F0HA 4DGZA 1CT1D 1B3AA 1DOMA 1O78A 3ONAB 1B9NA 1MGSA 1DOKA 1CHPD 2Z8LA 1TS5A 2AQ1B 5EKIA 1F2MA 3KF8A 3SVMA 3HZXA 3PIP3 1RTNA 3GD7A 1L0YB 1STAA 1KDCA 2EJGC 3SK5A 3OWFA 1PFNA 3IFDA 2F0IA 3G7LA 3VR6A 1SNCA 3M3YB 1D5MC 3S9WA 1SYEA 1SSOA 3KLRA 1SAPA 4IUVA 4O1NA 5FOBB 3HRZC 1X3QA 3S14B 2XWJB 1B4OA 1S5BD 4C1NI 2IX0A 1RD9D 3FDTA 5M5XB 2CVRA 3QO2A 1U4LA 1A2TA 1DXMA 4EVOA 1WCMB 5CORA 1WD0A 1ICWA 1B44D 4H13C 3TSSA 1NR4A 4BBRB 4J6HA 4ZRZA 5JEAG 3DM1A 2JEBI 4CJ1B 3IFTA 3HOVB 1HA6A 1PDQA 1F9RA 4NKLA 5T1GA 4NDXA 5K36G 4QUCA 1LLRD 3Q23A 1STGA 2F0UA 1D6EC 4LAAA 3J7AF 1E2WA 4A3JB 2FMCA 5A35A 5IGGA 2B63B 2XNAC 1PZKD 3LWEA 5E1FA 3EVQA 3KLSA 2EYJA 3VR5A 1HCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PUV A;  3PUW A;  3A7A B;  1Q1E A;  1LAB A;  1V8Q A;  1G29 1;  1K8M A;  3OW7 A;  3GD7 A;  4OGQ C;  2Q8I B;  1IW7 D;  5KNB A;  5C0X H;  4BA2 I;  3PUY A;  2EJG C;  1GHJ A;  4G7H C;  2A69 D;  2K7V A;  4KKU A;  3CRK C;  2A68 D;  3M85 A;  2O5I C;  3PUZ A;  2BDO A;  3PV0 A;  2EJM A;  4TKO B;  4XIG S;  1DCZ A;  1EWH A;  3I72 A;  1ONL A;  3ND8 A;  4BA1 I;  2EJF C;  1H9S B;  3VR6 A;  1Y69 U;  1OXV A;  4KKT A;  3U9S A;  3VR3 A;  4DK0 A;  1GJX A;  1T5E A;  3T53 B;  3FPP A;  3VR2 A;  1OXU A;  5JEA H;  2A6E C;  4HR7 B;  3A8I E;  4PV1 C;  4JK1 C;  1K8O A;  3RLF A;  3KLR A;  3I4L A;  1DD2 A;  2EVB A;  4I7Z C;  3LNN A;  3EQL C;  2EDG A;  3W3A A;  1B9M A;  3DXJ C;  2JE6 I;  3WDN A;  5BN4 A;  4DK1 A;  3P20 A;  2JEA I;  4KI0 A;  3H94 A;  1Q12 A;  1H9R A;  2DNE A;  1GUN A;  2O5J C;  4H44 C;  2BE5 C;  1IYV A;  3SE0 A;  2LMC B;  5BN5 A;  2K33 A;  1ZKO A;  3VR4 A;  2AUJ D;  4KMU C;  1OXS C;  1GUT A;  5C0X G;  1V43 A;  1CFM A;  1VF5 C;  1YNN C;  1E2Z A;  1Q1B A;  2PNR C;  1Q90 A;  3N6R A;  1TKW B;  4RCN A;  4XTC S;  4GZY C;  1HPC A;  1DXM A;  3M4Y A;  2R6G A;  4OO1 G;  1GUG A;  2D2C C;  2BA0 A;  3M7N A;  2AUK A;  1H9K A;  1PMR A;  4H13 C;  2IT1 A;  3A8J E;  3D31 A;  2PCF B;  3PUX A;  1QJO A;  2B8F A;  3D4R A;  3QIA A;  2KA7 A;  2ZT9 C;  3QG1 A;  4DNR B;  1Y8O B;  5KND A;  4KN7 C;  4DNT B;  1VF7 A;  4OO1 H;  3IKJ A;  1I6V C;  4IFD G;  1FYC A;  1CI3 M;  1GUO A;  1O7L A;  1YNJ C;  1VDZ A;  1ZYR C;  1TU2 B;  2BA1 A;  2A6H D;  2L5T A;  3NE5 B;  5JEA G;  1Z6H A;  3GQB A;  2F1M A;  2JXM B;  2JEB I;  3OPO A;  1CTM A;  1IW7 C;  3ND9 A;  1Y8N B;  3T56 B;  5KNC A;  1A6X A;  2E75 C;  3SDZ A;  3IFT A;  1H9S A;  4IFD H;  4JBW A;  4IQZ A;  2E76 C;  3AB9 A;  2DNC A;  2A68 C;  1FR3 A;  2YYZ A;  3I73 A;  4LJZ C;  3CRL C;  3VA7 A;  2NN6 H;  4TQU S;  4G7O C;  4H0L C;  5K36 G;  1IYU A;  2D5D A;  1VCI A;  3MXU A;  5K36 H;  1Z7T A;  2B8G A;  2QF7 A;  2BE5 D;  2NN6 G;  1GUS A;  2KCC A;  1SMY C;  2DN8 A;  4G7Z C;  3LWU A;  1HQM C;  2NN6 I;  3L7Z C;  1BDO A;  1E2W A;  4KHZ A;  2CW0 C;  1H9J A;  3QJY A;  2PPB C;  2AWO A;  1E2V A;  2E74 C;  4KKS A;  1O78 A;  5A35 A;  2A6H C;  1GHK A;  3A7L A;  1B9N A;  2K32 A;  3OOC A;  4LK1 C;  4KN4 C;  2D62 A;  3BDO A;  2V4D A;  3HGB A;  2A69 C;  2A6E D;  1HTP A;  1Y8P B;  3BG3 A;  1LAC A;  1OXX K;  4L8J A;  1OXT A;  1H9M A;  3FMC A;  3T51 B;  3TZU A;  5BN3 A;  3VR5 A;  3MFY A;  3A8K E;  1HCZ A; 
#chains in the Genus database with same CATH topology
 3PUW A;  2PW7 A;  2KJX A;  2CFM A;  1X6O A;  5M3F B;  1IW7 D;  5KNB A;  4JW0 A;  4IPD A;  5LMU Q;  2F0T A;  1DJR D;  3Q24 A;  1FNV A;  3NTI A;  3W1G A;  5LHY 1;  2WP8 J;  3GTP H;  2B2W A;  1BUV T;  3FP9 A;  1TT2 A;  4ZK9 B;  4XT3 B;  3MXN A;  1P16 A;  4CDD C;  1NJI C;  4K0K Q;  3K5M A;  1N33 L;  1CSQ A;  3L0O A;  3GTJ B;  4PV1 C;  2RDF A;  1X56 A;  3J80 E;  5G3L D;  1FJG Q;  1IXR A;  4HJ7 A;  1SE8 A;  2AMC B;  2ZXO A;  2G5D A;  2VY3 A;  1TS3 A;  2JE6 I;  4GLX A;  1DON A;  1JWU D;  3KBX A;  4POF A;  3SE0 A;  2LMC B;  5C4X H;  2CWP A;  2NWG A;  1VQA A;  3U4V A;  1ZKO A;  2N3S A;  3GTL B;  1GUT A;  1TWA H;  1WTP A;  1Q1B A;  2LFN A;  1AN8 A;  2R7Z B;  2L11 A;  4ULL A;  1JOO A;  2XSC A;  3H0G G;  1O80 A;  2PNH A;  3ITP A;  3J81 i;  5C3E H;  2NTT A;  2F52 A;  3IL8 A;  1KLU D;  3SEB A;  2JQO A;  4DNR B;  4RAU C;  4YY3 L;  4NXN Q;  3HKS A;  3IKJ A;  3M7N A;  3MA2 B;  1XWE A;  4Z9C B;  1KD1 C;  2K1B A;  3JAM i;  2F0W A;  4DV0 Q;  1IW7 C;  3MWY W;  5KNC A;  5BR8 L;  4AQY Q;  4JI3 Q;  3HOW H;  4DR2 Q;  5EBC A;  4DF7 A;  3K58 A;  3MXN B;  4DUY Q;  2EQS A;  4JI2 L;  5ELE A;  1I3Q B;  4A3B G;  5LMN Q;  1TWH B;  4A3J H;  2F0F A;  3VYT A;  4AYB E;  2F4I A;  1HFG A;  4OEM B;  3TP5 A;  1KLG D;  1SMY D;  3K59 A;  1M90 C;  2BE5 D;  4KV6 A;  3D6C A;  2CW0 D;  3RZD B;  3STB C;  2ALY B;  3I4M B;  4X64 L;  3GTM B;  3RZO B;  4V0B A;  4A3D G;  1LT4 D;  4XQJ A;  4DR7 Q;  1HUN A;  3HP3 A;  2E5L Q;  1BCP D;  3HGB A;  1I94 L;  1I4R A;  2K6A A;  4L8J A;  1FD7 D;  3FMC A;  5JJZ A;  5JVH 3;  1E7Z A;  2E2I B;  2WAC A;  3QR8 A;  4GLA C;  4GLV B;  2NYZ D;  3DHQ A;  1RCV D;  4BA2 I;  1LTR D;  2AWN A;  2KBN A;  4LNQ A;  1LT5 D;  5D14 A;  1EUJ A;  1EWH A;  3I72 A;  1EYC A;  4RGN A;  3WWV A;  4R4I A;  4BA1 I;  1U4P A;  2UUC L;  1H9S B;  4JI8 Q;  5M5W B;  1Y69 U;  1O7I A;  4X6A H;  4KKT A;  3T53 B;  4A76 A;  2HIX A;  3LGJ A;  4F8M A;  1WJJ A;  4P2C B;  2EZV A;  3S1N B;  5HGT A;  3I4L A;  1S5E D;  3MEH A;  4NPS A;  3I4N B;  4A3I G;  2E2D C;  1S72 A;  2EOT A;  1YIT A;  2LXJ A;  1B9M A;  4H7B A;  5FLM H;  4ZLT F;  1E0B A;  2R7Z H;  1XJV A;  4LFB L;  2F4V L;  3I90 A;  1E3P A;  4V19 0;  2K75 A;  3OWE B;  3M4Y A;  3K7A B;  3QB3 A;  1D7Q A;  5C3E G;  2Y0S G;  3S1Q B;  2WB1 E;  2KCM A;  4TSS A;  3X3N A;  1PH4 A;  2AQ2 B;  3G6J B;  4FO2 A;  2ZJP A;  4DNT B;  1N34 L;  5NUC A;  4IFD G;  1FYC A;  3I91 A;  2A6H D;  2N55 A;  4IUR A;  3KLS X;  4RG1 A;  4DV5 Q;  4RMF A;  1O7Y A;  2NVT H;  1TWH H;  3H3V C;  5J1Z A;  1Y8N B;  3S16 B;  3M7G A;  2ZXR A;  5I4D A;  4LJZ C;  3PGZ A;  4EX5 A;  3M4Q A;  1BOS A;  4BBR H;  3RZD H;  1KNE A;  3F2C A;  4R4T A;  3T16 A;  1LUZ A;  2FIN B;  2DGY A;  1VCI A;  1VQM A;  2K14 A;  1Y1W B;  2VXW A;  5EKK A;  1EZ6 A;  4X62 L;  1I6H B;  1SMY C;  1GO3 E;  5CC4 A;  1D1K A;  2JJQ A;  2PQE A;  4HTH A;  1UUP A;  1H9J A;  2AWO A;  1II3 A;  1X3P A;  3OYY A;  4LF6 L;  5IP9 G;  4JI4 L;  4DAM A;  4HJ9 A;  4DR1 L;  3A7L A;  3PF5 A;  1JWM D;  1F9S A;  1PH1 A;  2MO1 A;  2KEE A;  3R2I A;  1WTR A;  4MTK A;  3A54 A;  1PRT D;  2OCE A;  4CDC C;  3ULP A;  4ZUI A;  4JBK A;  4JI5 Q;  4N9T A;  4BY7 H;  4FDB A;  3CQZ B;  1C7Y A;  3MXP A;  4JI7 L;  4HCE A;  4N9P A;  4Q5V A;  3CXC A;  2KED A;  4JOI C;  1EWC A;  4LUO A;  4A3C G;  2K7V A;  3DUZ A;  4X3U A;  2B2U A;  5FO9 B;  3PV0 A;  5M5Y H;  4POG A;  1TII D;  3HKZ G;  5C4J B;  1ONL A;  3B6Y A;  2F3V A;  3TRE A;  1A63 A;  1QB5 D;  1OXV A;  1T5E A;  4C3I H;  2N8N A;  4JI3 L;  1EU4 A;  3MXG A;  4JK1 C;  1SYC A;  1DD2 A;  3S24 A;  2XN9 C;  4Y7N B;  1ZYR D;  3NTH A;  2DY7 A;  4C3H B;  5IE8 A;  1FGU A;  4H44 C;  3D0F A;  4A3K G;  2RCN A;  3ERO A;  1VQJ A;  3S15 B;  2KEC A;  5CV7 A;  1L1O C;  4L5S A;  3SHL A;  1ILP A;  3T13 A;  2UUB Q;  1L1O A;  1JOQ A;  1EY8 A;  4C3J G;  5IP7 G;  5IGE A;  3FPU B;  1HRJ A;  2IL8 A;  4F87 A;  1N36 L;  5E3F A;  4IAL A;  1D8L A;  3OIQ A;  3GTG B;  1TWC B;  3UDI A;  2AUK A;  1PMR A;  4PQX A;  1Q3L A;  1QE6 A;  2ZM6 L;  3D4R A;  1HNW L;  2ZT9 C;  2NVQ B;  1KQS A;  4NMZ A;  3QOJ A;  2MO0 A;  1BBW A;  1QOH A;  1W2B A;  1CI3 M;  2NVY B;  1VDZ A;  1BBX C;  1P8L A;  1T5X D;  2HUG A;  3D4W A;  5EJW A;  1SE4 A;  2XRQ D;  3OPO A;  4LF9 L;  1X65 A;  1N33 Q;  4OIJ A;  5AFW A;  1RIP A;  1KHI A;  1AEX A;  2DNC A;  2YYZ A;  4KD4 A;  4UDU C;  1JJG A;  1JB7 A;  3SXH A;  3GTQ B;  4HIO A;  3CCV A;  1Z7T A;  2Z4I A;  3VYU A;  1EL0 A;  3CPW A;  3SK6 A;  4HSV A;  1D2B A;  3BZK A;  1LT6 D;  1KAB A;  1D1I A;  5FKA C;  4YWM A;  2O4X A;  2E2H B;  2D0O A;  2RA4 A;  3GTM H;  2LY7 A;  4MZ9 A;  2EY5 A;  3CCE A;  3RN5 A;  3Q6S A;  2QDB A;  3A8K E;  1OO9 B;  1Q86 C;  3PMF A;  3R2T A;  4JI5 L;  5M5Y B;  5E4W C;  5ELO A;  1JOR A;  2YTV A;  4X3S A;  1W3S A;  1HTL D;  3S14 H;  2A69 D;  2HCC A;  3CRK C;  2A68 D;  3M85 A;  4X64 Q;  1HR0 L;  2ES2 A;  4GN4 B;  2OXP A;  2BDO A;  4KJO A;  3ICE A;  4XIG S;  3HOZ G;  4DR3 L;  1SNP A;  2KHJ A;  1EY4 A;  3T1H L;  5C6A A;  2PZT A;  2QIL A;  3FPP A;  4BBS H;  5JEA H;  1EWI A;  3O13 A;  5LMN L;  3J7A 5;  2B39 A;  3E9I A;  3PSI A;  1YHB A;  2B29 A;  1HFN A;  1KRT A;  1GKH A;  4OXP A;  5BR8 Q;  3H6M A;  1FL0 A;  2MP1 A;  2DUD A;  1JE5 A;  1BBU A;  1B70 B;  1LTT D;  3H3V I;  5IY0 A;  4LF7 Q;  2EY6 A;  1A0I A;  1CKN B;  1TWC H;  2EYP A;  5E4X A;  1NAP A;  2AUJ D;  4U67 3;  4KMU C;  4A3F H;  1G91 A;  2RHS B;  3DWQ A;  1GUW A;  4GZY C;  1HNZ L;  2IJ0 A;  2R6G A;  4FNF A;  2OEO A;  2C9O A;  2BA0 A;  3W5O A;  4APV A;  2B2U C;  4GKJ L;  5AJ3 Q;  1K8A C;  1AFP A;  1EIF A;  2KA7 A;  2C35 B;  1LTG D;  4PZ8 A;  1I6V C;  1ESF A;  3HOX G;  1HJP A;  1JE4 A;  4QGU A;  3CC2 A;  4LFB Q;  5CBE E;  1DM0 B;  2I07 B;  1UNS A;  1LTB D;  2A68 C;  2HT1 A;  3MC0 B;  2NN6 H;  4JI0 Q;  1MJC A;  4KK7 A;  1BF4 A;  3W2D A;  4J8Q A;  5FLM G;  4R8I A;  4BY1 B;  1AH9 A;  3OSO A;  1K28 A;  3MXU A;  4DPG A;  4A3I H;  3JC6 6;  1UWV A;  1HNX L;  3ERS X;  2CCZ A;  2K4K A;  3CF5 A;  3KFU A;  3HKZ B;  4GN3 B;  4G57 A;  5IYD G;  2CW0 C;  5ELN A;  1NCV A;  2PQA A;  2UXC Q;  4A3G B;  3C1E A;  1NBW A;  4UAI A;  2R61 A;  3HOY B;  3TME A;  2QCP X;  2MHV A;  1PRT C;  4GKK L;  1SN8 A;  1TY0 A;  1I6H H;  1STE A;  4DK3 C;  1VQB A;  1GM5 A;  2BOS A;  3K0Y A;  2VQF Q;  4K6D A;  1JR0 D;  5L37 A;  5M3F G;  2N49 A;  3V2T A;  3I4M H;  2ICE C;  4DV7 L;  3S1R H;  2NTS A;  2EYO A;  1F9Q A;  1H9M A;  3TZU A;  2B2Y A;  1NMG A;  4DV6 L;  4B3R Q;  1PYW D;  1PVO A;  2F0D A;  1MKH A;  3K6O A;  5IGD A;  2EY1 A;  3CCQ A;  1K8M A;  1QNK A;  2R92 G;  3AEV A;  4WJ4 A;  1KAW A;  1WVL A;  2F3I A;  1EQQ A;  4NW2 A;  3CP0 A;  2Z1C A;  2IWH A;  1QNU A;  3GTL H;  4DR7 L;  2JK8 A;  4ME5 A;  4UY8 C;  1G6P A;  2OQ0 A;  1G51 A;  3MHB A;  1Y1W G;  3KJO A;  4KJN A;  1C4Q A;  2VB2 X;  5CV8 A;  3TP6 A;  2WII B;  4NP5 A;  3DMU A;  2HQL A;  3WOF A;  2JA5 G;  2AHO B;  2EYM A;  4AH6 A;  4HIM A;  4AYB G;  1W6K A;  2A8V A;  3M4O B;  4A4I A;  1IZ6 A;  1NTG A;  2PQA B;  5KYI A;  1VQG A;  2K50 A;  5IYB G;  1PH3 A;  4A3M G;  1VQ6 A;  3I4N H;  4BY1 G;  2QEX A;  1RHP A;  1WFQ A;  3VR4 A;  1CKM A;  2KOL A;  1WTQ A;  1EYD A;  1VF5 C;  3CCM A;  2DJF C;  4NXN L;  1HZ9 A;  1TKW B;  2EY2 A;  2NUC A;  2SNS A;  3PO3 B;  3ERQ A;  1YEZ A;  1ROD A;  1F9P A;  2G9D A;  3NP8 A;  4PZ6 A;  4H02 A;  4IUP A;  4LFA Q;  1QJO A;  2Q8R E;  5JPN C;  3F2D A;  2UU9 L;  1I4H A;  4FXD A;  1N32 Q;  3K7A H;  4IUQ A;  4MHE A;  4A3E H;  1TU2 B;  4OON A;  3U9O A;  1B1Z A;  1YIJ A;  3S1Q H;  3ND9 A;  2KQ3 A;  3U50 C;  4A3I B;  4L6T B;  3AB9 A;  3I73 A;  1EEF D;  1XNR L;  2X69 A;  1SE2 A;  3HFZ B;  1VQ7 A;  1R9T H;  4DFA A;  4JBM A;  1EIY B;  1F2Z A;  4ILW A;  2BCO A;  5F2D A;  4GNX C;  4CHT B;  3C2P A;  3GV3 A;  1TWF B;  2NN6 I;  2HD3 A;  3RD4 A;  1BDO A;  2F0S A;  3FVQ A;  1HUM A;  4DAP A;  3NHH A;  4DV3 Q;  5M5W H;  1IKL A;  1Y1V G;  1KC8 C;  1XMQ Q;  1L0W A;  5ELD A;  1CHQ D;  1HQR D;  2NBF A;  3OTO L;  1N34 Q;  4WRD A;  3SK8 A;  1QVG A;  3UE1 A;  4IUU A;  1X9N A;  4G7H C;  3E0J A;  2RDG A;  3Q22 A;  4OWW B;  1V9P A;  3MAQ A;  3MEF A;  1JT8 A;  2R92 H;  2PO4 A;  5ELF A;  3TS2 A;  2C5C A;  3PUY A;  5CV4 A;  5FLX c;  1CSP A;  4LFC L;  4QF4 A;  2B2T A;  1X55 A;  3TEH B;  2F4V Q;  3FKI B;  1A8V A;  5CBA E;  3ND8 A;  1F2Y A;  4HCS A;  4B3M L;  1E22 A;  1VMC A;  2Q2H A;  3M4O H;  5C4J H;  4HJ8 A;  3I70 A;  3NBI A;  4R4Q A;  3E0E A;  3L2P A;  2RCF A;  4X66 L;  1KRS A;  3EQL C;  1MHW C;  4BBS B;  3DXJ C;  5KYL A;  3BZD B;  1XNQ Q;  1I50 H;  4Y52 H;  4HJA A;  3K5O A;  2SDF A;  1J5E Q;  1H9R A;  4JI0 L;  1KDA A;  1IBM L;  4JPB W;  4XYO A;  2M9V A;  1STH A;  2ID0 A;  5IGF A;  1K8G A;  3EFX D;  3DEP A;  4RCN A;  5FJ8 G;  4XTC S;  3IAY A;  1HPC A;  4MN3 A;  1EQR A;  5IWA L;  4A3E B;  1VQ4 A;  3S15 H;  1SLJ A;  1BQQ T;  2LSS A;  2K5H A;  3A8J E;  3PUX A;  4F88 A;  1XTC D;  3H0G H;  5I2Y A;  3GTJ H;  2QDL A;  4GKJ Q;  5KND A;  4FXK C;  1B3Q A;  1ILQ A;  3CAM A;  4RGT A;  4U68 A;  2L5T A;  4A3F G;  2F1M A;  4QQB X;  4RFB A;  3PIO 3;  4N8F A;  2UXD Q;  2NVX H;  1G6Z A;  4DR1 Q;  1WD1 A;  3VA7 A;  3HKZ E;  1K3B C;  3I7F A;  3JAM L;  5I9O A;  2VQE Q;  1V1O A;  5ISR A;  5K36 H;  3S2H B;  2NN6 G;  3HOU B;  4ALP A;  4L5R C;  2R93 H;  2JA5 H;  1AW7 A;  1HQM C;  5DM7 3;  4K6L A;  1C9O A;  4ID6 A;  5D3I B;  2ATW A;  1MJE A;  1I4G A;  2A6H C;  1UE1 A;  4KN4 C;  5COY A;  1EU3 A;  1VQL A;  4PMC A;  4X66 Q;  1SE3 A;  4IPG A;  4ZCK A;  1HTP A;  4MNO A;  4C56 C;  2VNU D;  2BDN A;  5BN3 A;  5GQO A;  1EY5 A;  4B3T Q;  4LF9 Q;  3HS0 C;  3VYS A;  2VUM H;  2WB1 G;  5CR3 A;  4JV5 L;  1PFS A;  4P72 A;  5M3M H;  4CGY B;  1PV4 A;  5FO7 B;  5C4Z A;  4A93 B;  4NXM L;  3H15 A;  1STY A;  3TBI B;  4GN5 A;  2EJM A;  2XWB B;  4C3J B;  1PH5 A;  1Z9F A;  1BNZ A;  4YWL A;  1PLF A;  3SGI A;  1J6Q A;  1UE5 A;  2WAQ G;  2Z6B A;  4DR5 Q;  4A3K B;  3QWN A;  3CCR A;  2YTX A;  1PZJ D;  1FNW A;  1TR5 A;  4L5T A;  4ZYS A;  5IYD H;  2UUA L;  3GV6 A;  3OTO Q;  2LKV A;  2OTJ A;  2M2L A;  1HH2 P;  2JA8 B;  3DWP A;  5EAY A;  2ENB A;  4BBR G;  1V1Q A;  1Y1V H;  1TS2 A;  4IFD I;  3NEL A;  2F0K A;  4HN7 A;  3K5N A;  2OQK A;  2H4O A;  1X3E A;  1ICF B;  1SMX A;  4RWS C;  1CKO A;  4DKA C;  1FNU A;  5C4X B;  1O7Z A;  2H1E A;  5IT9 c;  2R93 G;  5ELC A;  4LMQ D;  1RJT A;  2WAQ B;  1H9K A;  1PHJ A;  4M8A A;  3NXW A;  1CQF A;  2I5H A;  1A15 A;  3WOE A;  3VDY A;  2B63 H;  1YNJ C;  2K5W A;  2BA1 A;  3G71 A;  1IBK Q;  4DR6 L;  2JA7 H;  3BYT B;  2Q2U A;  2UU9 Q;  4JC0 A;  3DM3 A;  1EQV A;  4XQQ A;  4TRD A;  1F2L A;  1B2T A;  3NUC A;  4JI6 Q;  2RKS A;  2R93 B;  3SR1 A;  3V05 A;  2KUM A;  1TWG B;  2D5D A;  4CKE A;  1WOC A;  5DNF A;  2QF7 A;  3ER0 A;  3CCS A;  1XPU A;  2DN8 A;  2L15 A;  1RKN A;  2ZTE A;  2FFK B;  3IRB A;  1K83 B;  4K2L A;  1I4P A;  5FJ8 H;  3NK9 A;  4LK1 C;  1A3T A;  1SNM A;  1J5E L;  1K73 C;  1H95 A;  1Y8P B;  2VQE L;  1SYB A;  5IYC G;  2EXZ A;  1DOL A;  3I2Z A;  1V8Q A;  2VZA A;  1QZH A;  4PMW A;  4C2M H;  5C44 H;  3EA6 A;  4E6I A;  1JC7 A;  5IOC A;  2RBM A;  2VS1 A;  4B3M Q;  2JA6 G;  4CJ0 B;  5JOB A;  1PH7 A;  2UXB L;  4A3F B;  3PF4 A;  1QIL A;  3MTS A;  1KL9 A;  1QUQ B;  3AQQ A;  2F0N A;  1XPR A;  3VR2 A;  1OXU A;  2IHE A;  2TSS A;  3RUZ A;  4HR7 B;  4K5V A;  1ET9 A;  1MBY A;  4A3E G;  1WTO A;  1LM0 A;  2YTY A;  4YCU A;  4QIW E;  3H91 A;  1CZG A;  1Z47 A;  5JAV A;  1S4Z A;  4G4K A;  1FJG L;  2XGT A;  2EYH A;  1EQT A;  4OL7 A;  4L63 B;  2B2V C;  2UXC L;  1TVX A;  1GUN A;  2BH2 A;  4RHR A;  5KGU A;  1D5X C;  3NEM A;  3J7Y W;  4FF1 A;  3NQI A;  4ZAI A;  1J9O A;  1YNN C;  4JG2 A;  4DU9 A;  1Q90 A;  3H3V H;  4BY1 H;  5CV6 A;  3KBG A;  5C0X I;  1E24 A;  2MFI A;  2ICI A;  3K7U C;  1S3O A;  3CU7 A;  1QZG A;  2PI2 A;  5GAE C;  1OTC A;  1A62 A;  3S2D B;  2A5H A;  3PO2 G;  4GNX B;  3NPP A;  1GUO A;  3S17 H;  2JA7 G;  3CCJ A;  1JJ2 A;  3H0G B;  1CK1 A;  3A55 A;  1VQD A;  3T56 B;  5KEE A;  1IL2 A;  4I65 A;  5AJ3 L;  1QUQ A;  3NSW A;  3R8B A;  1ESR A;  2KHI A;  3F8T A;  4DXG A;  4DV1 Q;  4IOA A;  1I94 Q;  1FR3 A;  1PRT F;  1WTH A;  5IGB A;  1VS0 A;  4K5X A;  5M5X H;  3A74 A;  4H0L C;  1VQK A;  4KY5 A;  1XTD A;  1BCP C;  2X6L A;  4XT1 B;  3RNU A;  1HZA A;  1CUK A;  2OT2 A;  1U4M A;  1BR9 A;  5IYC H;  2CQO A;  2LS0 1;  2A73 B;  4IJH A;  3BDO A;  3CCL A;  5LL6 X;  4DAV A;  3TS0 A;  4A3M H;  5IYB H;  3J81 j;  3Q8D A;  3V96 A;  1XNR Q;  3OMG A;  2QKI C;  3T1H Q;  2ZJR A;  1PH8 A;  1WTX A;  1STN A;  3F1Z A;  4IJL A;  2J7Z A;  2Q8I B;  4IN3 A;  4BXX H;  2RDH A;  4QMG A;  4GNX A;  4KKU A;  1GOZ A;  4JI6 L;  5FO8 B;  2EYF A;  5KIX A;  1X54 A;  4LFA L;  2HQE A;  2Q2I A;  3GTO H;  3KK7 A;  4KHP L;  3VR3 A;  4DK0 A;  2B3G A;  2DY8 A;  2L4N A;  3OMC A;  2A6E C;  5M3M G;  2Z4H A;  1ML0 D;  4DAY A;  2K5V A;  3RLF A;  1JMC A;  4IZ8 A;  3T1Y L;  1EFW A;  4IUN A;  1YJ9 A;  2EDG A;  1D5Z C;  3WDN A;  4R4C A;  1GD7 A;  1UEA B;  4KI0 A;  2NZ1 D;  4EQP A;  5M3F H;  2VQF L;  4FF4 A;  1HZC A;  1PTO H;  3I3C A;  2CKZ B;  4LF5 L;  5JJL A;  1EIG A;  2K33 A;  2WKC A;  2E2J B;  3BJU A;  4JI1 Q;  4A3D H;  2I0Q A;  5C0X G;  4C3H H;  5IT9 E;  3S1M B;  1NUC A;  1SYF A;  3S17 B;  4K5W A;  3H09 A;  4UPA A;  4BWG B;  4DV5 L;  1HZB A;  3KDF B;  4QIW B;  3T51 B;  3K5L A;  2PW5 A;  4S3S A;  1WTV A;  1Y14 B;  2P5Z X;  4OIK A;  4CBV A;  2JYO A;  1JCK B;  2MUY A;  1T9H A;  4DV1 L;  3M9B A;  1M1K C;  2TMP A;  3MFG A;  3C3L A;  1TWA B;  1SFO H;  2ASB A;  2E2I H;  2KCT A;  4DAY B;  4QCL A;  3AU7 A;  2B2V A;  2GN5 A;  5EGT A;  4A3J G;  2UUB L;  4HSP A;  3CPF A;  1GUS A;  4G7Z C;  1EEI D;  2XVS A;  4ZKB B;  1LTL A;  1Q8K A;  4A3M B;  3FKI H;  1E2V A;  3TP7 A;  3DLL A;  2B2Y C;  1GHK A;  5A2Q L;  4DV3 L;  3OOC A;  1XX8 A;  1LYL A;  3HOV G;  2V4D A;  1Q46 A;  3HOW B;  2K5Q A;  4OO1 I;  3OHX C;  5HGQ A;  5GAD C;  3CME A;  1I4Q A;  2WAQ E;  3RLO A;  2E2H H;  4DV4 L;  4KHV A;  4CDF C;  2ZTD A;  1IBL Q;  1JJC B;  4X3K A;  4RA8 A;  1LT3 D;  4X65 Q;  5LL6 S;  4O0A A;  4DUZ L;  3GTO B;  1FGB D;  1HA5 A;  2SOB A;  3I8Z A;  4DK6 C;  3CC4 A;  5KRU A;  1Q7Y C;  4C2M B;  5C44 B;  3G4S A;  3QOL A;  3CW2 C;  3HOY H;  2SNM A;  2EJF C;  3ULJ A;  2HHH L;  2Q8T A;  4XYQ A;  4CJ2 C;  2X6G A;  2IX1 A;  2IHF A;  3GTK B;  5A2Q E;  4GOP C;  3S1R B;  1CZW A;  3P7J A;  4A3L H;  1PTO B;  4KY7 A;  2M00 A;  4RGO S;  4A93 G;  1G8Z D;  2Q2T A;  3U58 A;  4B9X A;  1E1T A;  4DK1 A;  4K2K A;  1PRT B;  3ZYY X;  3I55 A;  3HOY G;  3GP7 A;  1BO0 A;  1JOK A;  5D3D A;  1U9R A;  1F77 A;  4KTA A;  5DEH A;  1OXS C;  3RR5 A;  2VB3 X;  3BVM A;  3C1F A;  1E2Z A;  1A3V A;  1VQO A;  1VMP A;  1Q81 C;  5D65 A;  2D2C C;  4DV0 L;  2XIW A;  3K8A A;  4WJW A;  4KY6 A;  1R4P B;  3QG1 A;  1BCP B;  2YV5 A;  3HOU G;  3NTK A;  4YIJ A;  1HR0 Q;  4WFN 3;  5IIF A;  4IPC A;  3TP8 A;  2JXM B;  3JAM c;  4ABN A;  1CTM A;  3HOX H;  4JBW A;  1S5D D;  2E76 C;  5C4H A;  1KIX A;  4JCV E;  1AZP A;  2JA7 B;  1QCB D;  2F0J A;  2RF4 A;  1VQI A;  4LF4 Q;  2WKD A;  4LUZ A;  2KCC A;  4OEL B;  1YNJ D;  4DUZ Q;  3AFP A;  2D0P A;  3LWU A;  1TWG H;  2B2W C;  2CHB D;  3G6E A;  4IO9 A;  3P1H A;  4P74 A;  4GOP B;  2K52 A;  2NZO A;  1QVC A;  5EQ0 A;  4A3K H;  2A69 C;  2Z9H A;  2MPM A;  4K0K L;  3R3O A;  1K83 H;  1GXD C;  2L9H A;  3AMU A;  3PUV A;  1Q1E A;  1KNA A;  1TQO A;  1VQ8 A;  1EY6 A;  4BS9 A;  2UUC Q;  2JA8 H;  2GA4 B;  4OGQ C;  3C46 A;  4BBS G;  3J80 c;  5IOD A;  5E7N A;  4RCO A;  1GHJ A;  3GTK H;  1TWF H;  4ZUJ A;  2O5I C;  4PG3 A;  5J22 A;  1XMO L;  1SDF A;  1VQN A;  3T4A C;  5CGK A;  4ME3 A;  3T1Y Q;  1EIH A;  2K05 A;  3BZC A;  4P73 A;  2EE1 A;  1YNN D;  1VQF A;  2F0E A;  4FF2 A;  4JI7 Q;  5IGC A;  2MNA A;  2NVQ H;  5CMD A;  2ZTC A;  1PFM A;  3D4D A;  4YCV A;  1HNZ Q;  1M8A A;  5C0X J;  4QB4 A;  2R3Z A;  3FRP B;  4PZ7 A;  4ZQ3 A;  4DV2 L;  2K28 A;  1IYV A;  4GOP A;  5BN5 A;  1VQ5 A;  1QWY A;  4JI4 Q;  3HOV H;  4LF7 L;  2YU9 H;  1DZ1 A;  3AYH B;  2R7F A;  1L0X B;  3RN2 A;  1CFM A;  2PNR C;  2L55 A;  4FF3 A;  3GTQ H;  1XYI A;  5C5M A;  2HDL A;  1SYD A;  1KAA A;  2PCF B;  1VQ9 A;  3QIA A;  4F7X A;  5HY6 A;  1ENA A;  2K03 A;  1Y8O B;  3HEJ A;  4HJ5 A;  2K5N A;  1O7L A;  1ZYR C;  4Q0F A;  3NBH B;  3CD6 A;  4C1N K;  1J8I A;  1V1P A;  2JP1 A;  4M1U B;  2E75 C;  2XRS D;  2Z6K A;  1B53 A;  3EBE A;  3SDZ A;  3K0X A;  2Z6K C;  4UP9 A;  1KDB A;  3CRL C;  2FXQ A;  2I5M X;  2E8G A;  3CMA A;  1PH2 A;  1IBK L;  2I5L X;  4K14 A;  4DR6 Q;  1BXT A;  1UAP A;  3GTG H;  1U5K A;  3PCO B;  2G9H D;  3HG9 A;  1SFO B;  2F0P A;  3L7Z C;  4QY7 A;  5ELB A;  4KHZ A;  4UP7 A;  5IWA Q;  2F0G A;  3K81 C;  2KEN A;  5C4X G;  4C3H G;  2B2T C;  4FXG C;  3K57 A;  3CC7 A;  2K32 A;  2AKW B;  3PO3 G;  4QUF A;  4X62 Q;  2RQX A;  1NMF A;  5JPM C;  3FHW A;  3F2B A;  4DV4 Q;  3TQY A;  2WV6 D;  1HR0 W;  1OXX K;  3P75 A;  3GO5 A;  4HED A;  3A7A B;  1TXY A;  2JA8 G;  1MSG A;  3OW7 A;  1HNX Q;  1Y1W H;  4AYB B;  3PQI A;  3A5U A;  3L9A X;  3W1B A;  5H1S E;  2JA5 B;  4HMJ A;  3HOZ H;  1SNQ A;  4A3B H;  2KCN A;  4TKO B;  2PMZ B;  4CKB A;  3U9S A;  1BCP F;  4DNI A;  3L3O C;  5C3E B;  1LTS D;  4LF4 L;  1K8O A;  1KXL A;  2MGS A;  3M4P A;  1YVC A;  1PYB A;  3S2D H;  4BY7 B;  2EVB A;  3STB D;  3TN2 A;  2YU9 B;  1RDP D;  3TZD A;  4AIM A;  4LF8 L;  3G48 A;  4QJF A;  1SEB D;  4RKL A;  4EQO A;  1GVP A;  5C3W A;  1ENC A;  3F2U A;  3J81 L;  1XMQ L;  5DLQ E;  1V43 A;  2HCI A;  3UDG A;  3UI2 A;  1VQC A;  1EY9 A;  5GAH C;  5CV5 A;  1CA5 A;  4C3I B;  1TY2 A;  2I46 A;  4A3G G;  5GAG C;  5K5P A;  2NVT B;  1B7Y B;  1UEB A;  3D31 A;  2B8F A;  2EPB A;  4IFD J;  3S1M H;  3S16 H;  3BVG A;  4DUY L;  4A3G H;  1NSN S;  4OO1 H;  1E1O A;  2F0Q A;  3OW2 A;  3BYY B;  1MI2 A;  5M9O A;  5EKL A;  4AQY L;  1RF2 D;  2L1B A;  4X3T A;  1G2T A;  4MIU A;  1A6X A;  2Y0S B;  1C48 A;  2HDM A;  3D8G A;  1IL8 A;  3KLW A;  1IYU A;  4OWX B;  4A75 A;  3HOX B;  1WCM H;  2UXB Q;  4WOR A;  4O2D A;  1PTO D;  3K80 C;  2F0M A;  1WTW A;  4JVZ A;  5FLX L;  1K0S A;  4GS3 A;  2PPB C;  3EJI A;  2E74 C;  2AQ3 B;  4KKS A;  1K9M C;  3CHB D;  1EFI D;  1I4X A;  1AE2 A;  4I7A A;  3I4M G;  2D62 A;  5J39 A;  2F0O A;  4KD3 A;  2FMM A;  3I4N G;  3BG3 A;  1LAC A;  2GVB A;  1OXT A;  2SEB D;  5EPK A;  3DEO A;  3NQT A;  1YI2 A;  1LAB A;  1ZXT A;  1IBM Q;  4A3B B;  3CKI B;  5EPL A;  2K04 A;  3KDF A;  1XNQ L;  1SR3 A;  2EIF A;  1YJW A;  4FVM A;  3PUZ A;  3M3Y H;  1S5F D;  1YHQ A;  2R7D A;  5DAU A;  1VQP A;  4MTN A;  4A3C H;  2CH4 A;  1SRO A;  2QGQ A;  3SK4 A;  1PFB A;  5LMU L;  1A2U A;  1GJX A;  3FKI G;  1QG7 A;  5EPJ A;  1S5C D;  1PTO C;  1BKB A;  3D3R A;  2OF1 A;  3J81 E;  1PXU A;  2N78 A;  2ZM6 Q;  1HNW Q;  3MVV A;  3W3A A;  1NNX A;  2JEA I;  1HXY D;  4DV6 Q;  5CV9 A;  3RMH A;  1PZI D;  2O5J C;  4RKB A;  3JAM E;  1XMO Q;  2EXD A;  2NVX B;  3URY A;  1Q82 C;  3GTP B;  3PO2 B;  2FJ2 A;  1B50 A;  4RH6 A;  5GRO A;  1Y1V B;  4YCW A;  5EBD A;  1SNO A;  4OO1 G;  4DN4 M;  3D6W A;  3R93 A;  1R4Q B;  3KF6 B;  4KN7 C;  3I56 A;  4L5Q A;  3Q0A A;  4N8X 1;  4JI1 L;  4IOC A;  5I2X A;  3BS1 A;  2O2L D;  4RHS A;  3X3M A;  4EQ5 A;  2K01 A;  4IQZ A;  3NEN A;  4R1J A;  1EY0 A;  3E3X A;  2BH8 A;  1K3R A;  2N88 A;  1LO5 D;  1VQE A;  1M4V A;  4TQU S;  4K8J A;  1NR2 A;  2ZXP A;  3LX0 A;  2B8G A;  4A93 H;  2RSO A;  2J0T D;  2JSO A;  1U4R A;  4KHP Q;  1CA6 A;  4PNY A;  3BDC A;  4C3J H;  1YZ6 A;  4HIK A;  3BVZ A;  3UDX A;  1JB3 A;  5TSS A;  1CM9 A;  3VA5 A;  1B8A A;  2JA6 B;  4JYA Q;  3OIP A;  3NWS A;  4LW1 A;  1KTK A;  1Q8I A;  1UE6 A;  1UE7 A;  2L12 A;  1I3Q H;  1G29 1;  1SXT A;  1I50 B;  3KF6 A;  4JI2 Q;  5C0X H;  1X3G A;  3KJP A;  1VQH A;  3E9H A;  4C3I G;  4B08 A;  1A3U A;  1EOT A;  4ODG A;  3RZO H;  4ZKC B;  4DR4 Q;  4FP5 D;  4DR3 Q;  3BDL A;  2F0V A;  5I9P A;  5FK9 C;  1LV9 A;  2VL6 A;  3A56 A;  2RSN A;  4LWC A;  1NE3 A;  3E6Z X;  1WI5 A;  1PH6 A;  4LF8 Q;  3KUP A;  1SRU A;  2NVY H;  4B9W A;  5I6W A;  3P20 A;  2R92 B;  1WYD A;  4BY7 G;  3TDQ A;  3VYR A;  3H94 A;  2HHH Q;  4LFC Q;  4R8N A;  1LTA D;  1EZ8 A;  2BE5 C;  4HID A;  4HMI A;  1G2S A;  2Z0S A;  4XDX A;  1SYG A;  5DM6 3;  3J80 L;  4YHH Q;  1PTO F;  4DV7 Q;  4UHV A;  2IX3 A;  1ASY A;  2F0L A;  1EYA A;  1ET6 A;  1JWS D;  3S2H H;  4YWK A;  1YBY A;  2QA4 A;  3HOU H;  2A74 C;  2WIN B;  4XQN A;  4B3S L;  4UP8 A;  3BU2 A;  2L0C A;  5HUR A;  5T1I A;  3EIV A;  3E5S A;  3KYH C;  1XXG A;  2K5D A;  4JI8 L;  4IFD H;  1H9S A;  1W6J A;  1ZEQ X;  2UUA Q;  4J1M A;  3A0J A;  3KOJ A;  4P71 A;  5JEA J;  4DA2 A;  2VUM B;  1NY4 A;  3DWA A;  5G3L F;  4DR5 L;  1WCM G;  1MSH A;  1YNX A;  4EQN A;  5M3M B;  3J81 c;  3EN2 A;  2RVL A;  4R4O A;  4HAE A;  2IPK D;  4EGV A;  2NZH A;  1JQY D;  1PH9 A;  4WJ3 M;  4XXE A;  3QJY A;  1MD2 D;  3J7A V;  2PZW A;  4DXF A;  3NWT A;  1EY7 A;  5JVG 3;  1JIC A;  2E5L L;  2A6E D;  5CYU A;  1C8C A;  4LUV A;  3N52 A;  2F03 A;  3MFY A;  2WB1 B;  5IT9 L;  2CH4 W;  2EYL A;  1SJH D;  1R9T B;  2QEJ C;  1SND A;  1U0L A;  4R9W A;  2CWA A;  3NBH A;  1N8R C;  1AZQ A;  4PMB A;  5I6Y A;  4LF5 Q;  1DCZ A;  2CQA A;  1V1P B;  3S1N H;  1TS4 A;  4DR2 L;  1ASZ A;  2D9U A;  4OX9 L;  1LTI D;  2PZU A;  5J3B A;  3HOZ B;  3A5Z B;  2F3W A;  4TVA B;  2LXK A;  3A8I E;  3MZ5 A;  5C3X A;  2QW7 A;  1STB A;  4I7Z C;  4OHJ A;  3LNN A;  3UE0 A;  4K8I A;  5C5L A;  2UXD L;  2KVM A;  1N32 L;  5BN4 A;  1C0A A;  1Q12 A;  2DNE A;  2PYK A;  1L2F A;  3PO3 H;  1SBB B;  2PMZ E;  5IP9 H;  2IW3 A;  3TRZ A;  1X32 A;  3N6R A;  4J15 A;  1IKM A;  4IPH A;  1QVF A;  4OWT B;  4IUT A;  2E2J H;  3FEW X;  1GUG A;  1RTO A;  2PI2 E;  3KF8 B;  3J80 i;  4A3D B;  4KLK A;  4CDE C;  2IT1 A;  2OTL A;  2A1A A;  1IBL L;  1ENF A;  1CQV A;  1IYJ B;  4FYD A;  4O42 A;  1VF7 A;  1SJE D;  3ZJY C;  1N9W A;  3NE5 B;  1DYQ A;  2DJG C;  1Z6H A;  3GQB A;  1IHZ A;  1HHV A;  2JA9 A;  2IY5 B;  4P75 A;  1S40 A;  2MJ8 A;  1AP0 A;  2J4X A;  3U4Z A;  4DV2 Q;  4G7O C;  4CKC A;  1EOV A;  4RGM A;  2Y0S E;  1PYS B;  5FLX E;  1RL2 A;  2FHT A;  1YJN A;  1AE3 A;  2NB0 A;  4A3L G;  2KHS A;  2F0H A;  4DGZ A;  4YHH L;  1XPO A;  1CT1 D;  1B3A A;  1DOM A;  1O78 A;  2H5X A;  3ONA B;  1BVS A;  1DGS A;  1B9N A;  4B3R L;  3CQZ H;  1MGS A;  4NB3 A;  1DOK A;  3J7Z C;  2R7Z G;  1L1O B;  1CHP D;  3CCU A;  4NXM Q;  2Z8L A;  1TS5 A;  3PIP A;  2AQ1 B;  2V1C C;  5EKI A;  2VW9 A;  5C44 G;  4JV5 Q;  4GKK Q;  1F2M A;  3KF8 A;  3SVM A;  3HZX A;  2JA6 H;  2VUM G;  4B3T L;  3PIP 3;  1RTN A;  4BXX G;  3GD7 A;  1L0Y B;  1STA A;  4QL5 A;  1KDC A;  2EJG C;  3SK5 A;  3OWF A;  1X3F A;  4DR4 L;  1PFN A;  3IFD A;  2F0I A;  3G7L A;  3VR6 A;  4B3S Q;  1K0R A;  2OWO A;  1SNC A;  3HOW G;  3M3Y B;  4Y7N H;  1D5M C;  3S9W A;  1SYE A;  2A19 A;  1SSO A;  2GVA A;  3KLR A;  1SAP A;  4IUV A;  4O1N A;  5FOB B;  2ZJQ A;  3HRZ C;  1MIU A;  2XTI A;  1X3Q A;  1PA6 A;  4JYA L;  3S14 B;  2XWJ B;  1B4O A;  1YHA A;  1S5B D;  4C1N I;  2IX0 A;  1RD9 D;  3FDT A;  5M5X B;  2CVR A;  3QO2 A;  1U4L A;  1A2T A;  1DXM A;  4EVO A;  1WCM B;  5COR A;  1WD0 A;  2B63 G;  5JJK A;  4LF6 Q;  3PO2 H;  1ICW A;  1B44 D;  3RLN A;  3AFQ A;  4H13 C;  3ULL A;  4X65 L;  3TSS A;  1NR4 A;  4OX9 Q;  1I5F A;  2MQH A;  4BBR B;  4J6H A;  4ZRZ A;  5JEA G;  3DM1 A;  2JEB I;  4JOI A;  2RHQ B;  4CJ1 B;  1FVI A;  3GDE A;  3IFT A;  3HOV B;  4JBJ A;  2HIV A;  1PDQ A;  1HA6 A;  1F9R A;  3PIO A;  4NKL A;  5T1G A;  4NDX A;  5K36 G;  4QUC A;  1LLR D;  5LMN W;  2JN4 A;  4YY3 Q;  3Q23 A;  1STG A;  2F0U A;  1D6E C;  5IP7 H;  4LAA A;  3J7A F;  1E2W A;  4A3J B;  2FMC A;  5JJI A;  5A35 A;  5IGG A;  1EYG A;  2B63 B;  1CKN A;  2WFW A;  3I4O A;  2XNA C;  1PZK D;  3LWE A;  5E1F A;  3EVQ A;  3KLS A;  2EYJ A;  1N36 Q;  3UDF A;  3VR5 A;  1HCZ A; 
#chains in the Genus database with same CATH homology
 3PUW A;  2PW7 A;  2KJX A;  5M3F B;  1IW7 D;  5KNB A;  2F0T A;  1DJR D;  3Q24 A;  1FNV A;  3NTI A;  5LHY 1;  2WP8 J;  2B2W A;  1BUV T;  1TT2 A;  4ZK9 B;  4XT3 B;  3MXN A;  3K5M A;  3GTJ B;  4PV1 C;  2RDF A;  3J80 E;  5G3L D;  2ZXO A;  1TS3 A;  2JE6 I;  1DON A;  1JWU D;  3KBX A;  3SE0 A;  2LMC B;  2NWG A;  1ZKO A;  3GTL B;  1GUT A;  1WTP A;  1Q1B A;  2LFN A;  1AN8 A;  2R7Z B;  2L11 A;  4ULL A;  1JOO A;  2XSC A;  1O80 A;  3ITP A;  2NTT A;  3IL8 A;  1KLU D;  3SEB A;  4DNR B;  4RAU C;  3IKJ A;  3M7N A;  3MA2 B;  1XWE A;  4Z9C B;  2K1B A;  2F0W A;  1IW7 C;  3MWY W;  5KNC A;  5EBC A;  4DF7 A;  3K58 A;  5ELE A;  1I3Q B;  1TWH B;  2F0F A;  3VYT A;  2F4I A;  1HFG A;  3TP5 A;  1KLG D;  1SMY D;  3K59 A;  2BE5 D;  4KV6 A;  3D6C A;  2CW0 D;  3RZD B;  3I4M B;  3GTM B;  3RZO B;  4V0B A;  1LT4 D;  4XQJ A;  1HUN A;  3HP3 A;  1BCP D;  3HGB A;  1I4R A;  2K6A A;  4L8J A;  1FD7 D;  3FMC A;  5JJZ A;  5JVH 3;  2E2I B;  2WAC A;  2NYZ D;  3DHQ A;  1RCV D;  4BA2 I;  1LTR D;  2AWN A;  1LT5 D;  5D14 A;  1EWH A;  3I72 A;  1EYC A;  4RGN A;  4BA1 I;  1U4P A;  1H9S B;  5M5W B;  1Y69 U;  4KKT A;  3T53 B;  4F8M A;  4P2C B;  2EZV A;  3S1N B;  5HGT A;  3I4L A;  1S5E D;  3MEH A;  3I4N B;  2E2D C;  2EOT A;  1B9M A;  4H7B A;  4ZLT F;  1E0B A;  3I90 A;  4V19 0;  3OWE B;  3M4Y A;  3K7A B;  3QB3 A;  3S1Q B;  4TSS A;  3X3N A;  2AQ2 B;  3G6J B;  4FO2 A;  4DNT B;  5NUC A;  4IFD G;  1FYC A;  3I91 A;  2A6H D;  2N55 A;  4IUR A;  3KLS X;  1O7Y A;  3H3V C;  5J1Z A;  1Y8N B;  3S16 B;  3M7G A;  2ZXR A;  5I4D A;  4LJZ C;  1BOS A;  1KNE A;  3T16 A;  2FIN B;  1VCI A;  1Y1W B;  2VXW A;  5EKK A;  1EZ6 A;  1I6H B;  1SMY C;  5CC4 A;  1D1K A;  2PQE A;  4HTH A;  1UUP A;  1H9J A;  2AWO A;  1II3 A;  1X3P A;  3A7L A;  1JWM D;  1F9S A;  1WTR A;  2KEE A;  3R2I A;  3A54 A;  1PRT D;  4ZUI A;  4N9T A;  3CQZ B;  3MXP A;  4HCE A;  4N9P A;  4Q5V A;  2KED A;  1EWC A;  2K7V A;  3DUZ A;  4X3U A;  2B2U A;  5FO9 B;  3PV0 A;  1TII D;  5C4J B;  1ONL A;  2F3V A;  1QB5 D;  1OXV A;  1T5E A;  1EU4 A;  3MXG A;  4JK1 C;  1SYC A;  1DD2 A;  2XN9 C;  4Y7N B;  1ZYR D;  3NTH A;  2DY7 A;  4C3H B;  4H44 C;  3ERO A;  3S15 B;  2KEC A;  5CV7 A;  3SHL A;  1ILP A;  3T13 A;  1JOQ A;  1EY8 A;  4C3J G;  5IGE A;  3FPU B;  1HRJ A;  2IL8 A;  4F87 A;  5E3F A;  4IAL A;  3GTG B;  3OIQ A;  1TWC B;  2AUK A;  1PMR A;  4PQX A;  1Q3L A;  1QE6 A;  3D4R A;  2ZT9 C;  2NVQ B;  4NMZ A;  3QOJ A;  1QOH A;  1CI3 M;  1BBX C;  2NVY B;  1VDZ A;  1T5X D;  2HUG A;  3D4W A;  5EJW A;  1SE4 A;  2XRQ D;  3OPO A;  4OIJ A;  5AFW A;  1AEX A;  2DNC A;  2YYZ A;  4KD4 A;  4UDU C;  3SXH A;  3GTQ B;  1Z7T A;  2Z4I A;  3VYU A;  1EL0 A;  3SK6 A;  4HSV A;  1D2B A;  1LT6 D;  1KAB A;  1D1I A;  5FKA C;  2O4X A;  2E2H B;  2RA4 A;  2LY7 A;  2EY5 A;  3Q6S A;  2QDB A;  3A8K E;  1OO9 B;  3PMF A;  3R2T A;  5M5Y B;  5E4W C;  1JOR A;  4X3S A;  1HTL D;  2A69 D;  2HCC A;  3CRK C;  2A68 D;  3M85 A;  2OXP A;  2BDO A;  4KJO A;  4XIG S;  1SNP A;  1EY4 A;  5C6A A;  2PZT A;  2QIL A;  3FPP A;  5JEA H;  3O13 A;  2B39 A;  1HFN A;  3H6M A;  2MP1 A;  1LTT D;  2EY6 A;  2EYP A;  4U67 3;  5E4X A;  1NAP A;  2AUJ D;  1G91 A;  4KMU C;  3DWQ A;  1GUW A;  4GZY C;  2IJ0 A;  2R6G A;  4FNF A;  2OEO A;  2C9O A;  2BA0 A;  2B2U C;  1AFP A;  2KA7 A;  1LTG D;  1I6V C;  1ESF A;  1JE4 A;  5CBE E;  1DM0 B;  2I07 B;  1UNS A;  1LTB D;  2A68 C;  3MC0 B;  2NN6 H;  1BF4 A;  4KK7 A;  3W2D A;  4J8Q A;  4R8I A;  4BY1 B;  3OSO A;  3MXU A;  3HKZ B;  4G57 A;  2CW0 C;  1NCV A;  4A3G B;  3C1E A;  4UAI A;  2R61 A;  3HOY B;  3TME A;  2QCP X;  2MHV A;  1PRT C;  1TY0 A;  1STE A;  2BOS A;  3K0Y A;  4K6D A;  1JR0 D;  3V2T A;  2ICE C;  2NTS A;  2EYO A;  1F9Q A;  1H9M A;  3TZU A;  2B2Y A;  1PYW D;  2F0D A;  3K6O A;  5IGD A;  2EY1 A;  1K8M A;  1QNK A;  1WVL A;  4NW2 A;  2Z1C A;  2IWH A;  1QNU A;  4ME5 A;  3MHB A;  4KJN A;  1C4Q A;  2VB2 X;  5CV8 A;  3TP6 A;  2WII B;  4NP5 A;  3DMU A;  3WOF A;  2EYM A;  1W6K A;  3M4O B;  5KYI A;  1RHP A;  3VR4 A;  2KOL A;  1WTQ A;  1EYD A;  1VF5 C;  1TKW B;  2EY2 A;  2NUC A;  2SNS A;  3PO3 B;  3ERQ A;  1ROD A;  1F9P A;  2G9D A;  3NP8 A;  4IUP A;  1QJO A;  2Q8R E;  5JPN C;  1I4H A;  4FXD A;  4IUQ A;  4MHE A;  1TU2 B;  3U9O A;  1B1Z A;  3ND9 A;  2KQ3 A;  4A3I B;  4L6T B;  3AB9 A;  3I73 A;  1EEF D;  2X69 A;  1SE2 A;  4DFA A;  1F2Z A;  4ILW A;  2BCO A;  5F2D A;  4CHT B;  3C2P A;  3GV3 A;  1TWF B;  2NN6 I;  3RD4 A;  1BDO A;  2F0S A;  3FVQ A;  1HUM A;  4DAP A;  3NHH A;  1IKL A;  5ELD A;  1CHQ D;  1HQR D;  2NBF A;  4WRD A;  3SK8 A;  4IUU A;  4G7H C;  3E0J A;  2RDG A;  3Q22 A;  3MAQ A;  2PO4 A;  5ELF A;  2C5C A;  3PUY A;  5CV4 A;  4QF4 A;  2B2T A;  3FKI B;  5CBA E;  3ND8 A;  1F2Y A;  4HCS A;  1VMC A;  3I70 A;  3NBI A;  3EQL C;  4BBS B;  3DXJ C;  5KYL A;  3BZD B;  3K5O A;  2SDF A;  1H9R A;  1KDA A;  4XYO A;  2M9V A;  1STH A;  2ID0 A;  5IGF A;  3EFX D;  3DEP A;  4RCN A;  4XTC S;  3IAY A;  1HPC A;  4MN3 A;  4A3E B;  1BQQ T;  4F88 A;  3A8J E;  3PUX A;  1XTC D;  5I2Y A;  5KND A;  4FXK C;  1ILQ A;  4RGT A;  4U68 A;  2L5T A;  2F1M A;  4RFB A;  3PIO 3;  1G6Z A;  1WD1 A;  3VA7 A;  3JAM L;  5I9O A;  1V1O A;  5ISR A;  5K36 H;  3S2H B;  2NN6 G;  3HOU B;  1AW7 A;  1HQM C;  5DM7 3;  4K6L A;  4ID6 A;  5D3I B;  1I4G A;  2A6H C;  4KN4 C;  5COY A;  1EU3 A;  4PMC A;  1SE3 A;  1HTP A;  4C56 C;  2VNU D;  2BDN A;  5BN3 A;  1EY5 A;  3HS0 C;  3VYS A;  5CR3 A;  4CGY B;  5FO7 B;  5C4Z A;  4A93 B;  1STY A;  3TBI B;  2EJM A;  2XWB B;  4C3J B;  1BNZ A;  1PLF A;  4A3K B;  3QWN A;  1PZJ D;  1FNW A;  1TR5 A;  4ZYS A;  3GV6 A;  2LKV A;  2M2L A;  2JA8 B;  3DWP A;  2ENB A;  1TS2 A;  4IFD I;  2F0K A;  4HN7 A;  3K5N A;  2H4O A;  4RWS C;  1FNU A;  5C4X B;  1O7Z A;  2H1E A;  5ELC A;  4LMQ D;  1RJT A;  2WAQ B;  1H9K A;  3NXW A;  4M8A A;  1CQF A;  1A15 A;  3WOE A;  1YNJ C;  2K5W A;  2BA1 A;  3BYT B;  1EQV A;  4XQQ A;  4TRD A;  1F2L A;  1B2T A;  3NUC A;  2RKS A;  2R93 B;  3SR1 A;  3V05 A;  2KUM A;  1TWG B;  2D5D A;  4CKE A;  5DNF A;  2QF7 A;  2DN8 A;  1RKN A;  2FFK B;  1K83 B;  4K2L A;  1I4P A;  3NK9 A;  4LK1 C;  1A3T A;  1SNM A;  1Y8P B;  1SYB A;  2EXZ A;  1DOL A;  1V8Q A;  4PMW A;  3EA6 A;  4E6I A;  1JC7 A;  5IOC A;  2RBM A;  4CJ0 B;  5JOB A;  4A3F B;  1QIL A;  3MTS A;  2F0N A;  3VR2 A;  1OXU A;  2TSS A;  3RUZ A;  4HR7 B;  1ET9 A;  4K5V A;  1MBY A;  1WTO A;  3H91 A;  1CZG A;  1Z47 A;  5JAV A;  1S4Z A;  4G4K A;  2EYH A;  1EQT A;  4OL7 A;  4L63 B;  2B2V C;  1TVX A;  1GUN A;  3J7Y W;  4FF1 A;  4RHR A;  5KGU A;  1D5X C;  3NQI A;  4ZAI A;  1J9O A;  1YNN C;  4DU9 A;  1Q90 A;  5CV6 A;  3KBG A;  5C0X I;  2ICI A;  3CU7 A;  3S2D B;  2A5H A;  3NPP A;  1GUO A;  3H0G B;  1CK1 A;  3A55 A;  5KEE A;  3T56 B;  4I65 A;  3NSW A;  3R8B A;  1ESR A;  4DXG A;  1FR3 A;  1PRT F;  5IGB A;  4K5X A;  4H0L C;  4KY5 A;  1BCP C;  2X6L A;  4XT1 B;  2OT2 A;  1U4M A;  1BR9 A;  2LS0 1;  2A73 B;  3BDO A;  5LL6 X;  4DAV A;  3V96 A;  3OMG A;  2QKI C;  1WTX A;  1STN A;  2J7Z A;  2Q8I B;  4IN3 A;  2RDH A;  4QMG A;  4KKU A;  1GOZ A;  5FO8 B;  2EYF A;  5KIX A;  2HQE A;  3KK7 A;  3VR3 A;  4DK0 A;  2DY8 A;  2L4N A;  3OMC A;  2A6E C;  2Z4H A;  1ML0 D;  4DAY A;  3RLF A;  4IZ8 A;  4IUN A;  2EDG A;  1D5Z C;  3WDN A;  1UEA B;  4KI0 A;  2NZ1 D;  4EQP A;  4FF4 A;  1PTO H;  3I3C A;  1EIG A;  2K33 A;  2WKC A;  2E2J B;  5C0X G;  5IT9 E;  3S1M B;  1NUC A;  1SYF A;  3S17 B;  4K5W A;  3H09 A;  4BWG B;  4QIW B;  3T51 B;  3K5L A;  2PW5 A;  4S3S A;  1WTV A;  4OIK A;  4CBV A;  2JYO A;  1JCK B;  2MUY A;  2TMP A;  3MFG A;  3C3L A;  1TWA B;  4QCL A;  3AU7 A;  2B2V A;  5EGT A;  4HSP A;  1GUS A;  4G7Z C;  1EEI D;  2XVS A;  4ZKB B;  4A3M B;  3TP7 A;  1E2V A;  2B2Y C;  1GHK A;  5A2Q L;  3OOC A;  1XX8 A;  2V4D A;  3HOW B;  2K5Q A;  4OO1 I;  3OHX C;  1I4Q A;  4KHV A;  4X3K A;  4RA8 A;  1LT3 D;  5LL6 S;  3GTO B;  1FGB D;  1HA5 A;  2SOB A;  3I8Z A;  5KRU A;  5C44 B;  4C2M B;  3QOL A;  2SNM A;  2EJF C;  2Q8T A;  4XYQ A;  4CJ2 C;  2X6G A;  2IX1 A;  3GTK B;  5A2Q E;  3S1R B;  1CZW A;  3P7J A;  1PTO B;  4KY7 A;  2M00 A;  4RGO S;  1G8Z D;  4B9X A;  4DK1 A;  4K2K A;  1PRT B;  3ZYY X;  3GP7 A;  1BO0 A;  1JOK A;  5D3D A;  1U9R A;  1F77 A;  4KTA A;  5DEH A;  1OXS C;  2VB3 X;  3BVM A;  3C1F A;  1E2Z A;  1A3V A;  1VMP A;  5D65 A;  2D2C C;  2XIW A;  4WJW A;  4KY6 A;  1R4P B;  3QG1 A;  1BCP B;  3NTK A;  4YIJ A;  4WFN 3;  5IIF A;  3TP8 A;  2JXM B;  4ABN A;  1CTM A;  4JBW A;  1S5D D;  2E76 C;  5C4H A;  1AZP A;  2JA7 B;  1QCB D;  2F0J A;  2WKD A;  2KCC A;  1YNJ D;  3LWU A;  2B2W C;  2CHB D;  3P1H A;  5EQ0 A;  2A69 C;  2MPM A;  3R3O A;  1GXD C;  2L9H A;  3AMU A;  3PUV A;  1Q1E A;  1KNA A;  1TQO A;  1EY6 A;  4BS9 A;  2GA4 B;  4OGQ C;  3C46 A;  5IOD A;  4RCO A;  1GHJ A;  2O5I C;  4ZUJ A;  5J22 A;  1SDF A;  3T4A C;  5CGK A;  1EIH A;  2K05 A;  2EE1 A;  1YNN D;  2F0E A;  4FF2 A;  5IGC A;  5CMD A;  1PFM A;  3D4D A;  1M8A A;  5C0X J;  4QB4 A;  2R3Z A;  3FRP B;  4ZQ3 A;  2K28 A;  1IYV A;  5BN5 A;  1QWY A;  1DZ1 A;  1L0X B;  1CFM A;  2PNR C;  2L55 A;  4FF3 A;  1XYI A;  5C5M A;  2HDL A;  1SYD A;  1KAA A;  2PCF B;  3QIA A;  4F7X A;  1ENA A;  2K03 A;  1Y8O B;  3HEJ A;  1O7L A;  1ZYR C;  4Q0F A;  4C1N K;  1J8I A;  1V1P A;  2JP1 A;  4M1U B;  2E75 C;  2XRS D;  3SDZ A;  1B53 A;  1KDB A;  3CRL C;  4K14 A;  1BXT A;  1UAP A;  2G9H D;  3HG9 A;  1SFO B;  2F0P A;  3L7Z C;  5ELB A;  4KHZ A;  2F0G A;  4C3H G;  2B2T C;  4FXG C;  3K57 A;  2K32 A;  4QUF A;  2RQX A;  5JPM C;  2WV6 D;  1OXX K;  3P75 A;  3GO5 A;  4HED A;  3A7A B;  1MSG A;  3OW7 A;  4AYB B;  3L9A X;  2JA5 B;  4HMJ A;  1SNQ A;  2KCN A;  4TKO B;  2PMZ B;  4CKB A;  3U9S A;  1BCP F;  3L3O C;  5C3E B;  1LTS D;  1K8O A;  2MGS A;  4BY7 B;  2EVB A;  3TN2 A;  2YU9 B;  1RDP D;  3TZD A;  1SEB D;  4RKL A;  4EQO A;  5C3W A;  1ENC A;  3F2U A;  3J81 L;  1V43 A;  2HCI A;  3UI2 A;  1EY9 A;  5CV5 A;  1CA5 A;  4C3I B;  1TY2 A;  2I46 A;  5K5P A;  2NVT B;  3D31 A;  2B8F A;  2EPB A;  4IFD J;  3BVG A;  1NSN S;  4OO1 H;  2F0Q A;  3BYY B;  1MI2 A;  5M9O A;  5EKL A;  1RF2 D;  2L1B A;  4X3T A;  1G2T A;  4MIU A;  1A6X A;  2Y0S B;  1C48 A;  2HDM A;  3D8G A;  1IL8 A;  1IYU A;  3HOX B;  4WOR A;  1PTO D;  2F0M A;  1WTW A;  5FLX L;  2PPB C;  3EJI A;  2E74 C;  2AQ3 B;  4KKS A;  3CHB D;  1EFI D;  1I4X A;  2D62 A;  5J39 A;  2F0O A;  4KD3 A;  2FMM A;  3BG3 A;  1LAC A;  1OXT A;  2SEB D;  5EPK A;  3DEO A;  3NQT A;  1LAB A;  1ZXT A;  4A3B B;  3CKI B;  5EPL A;  2K04 A;  4FVM A;  3PUZ A;  1S5F D;  5DAU A;  3SK4 A;  1PFB A;  1A2U A;  1GJX A;  1QG7 A;  5EPJ A;  1S5C D;  1PTO C;  3D3R A;  2OF1 A;  3J81 E;  1PXU A;  3MVV A;  3W3A A;  2JEA I;  1HXY D;  5CV9 A;  3RMH A;  1PZI D;  2O5J C;  4RKB A;  3JAM E;  2NVX B;  3URY A;  3GTP B;  3PO2 B;  2FJ2 A;  1B50 A;  4RH6 A;  1Y1V B;  5EBD A;  1SNO A;  4OO1 G;  4DN4 M;  3D6W A;  3R93 A;  1R4Q B;  4KN7 C;  3Q0A A;  5I2X A;  3BS1 A;  2O2L D;  4RHS A;  3X3M A;  2K01 A;  4IQZ A;  1EY0 A;  2N88 A;  1LO5 D;  4TQU S;  1M4V A;  4K8J A;  1NR2 A;  2ZXP A;  3LX0 A;  2B8G A;  2RSO A;  2J0T D;  2JSO A;  1U4R A;  1CA6 A;  4PNY A;  3BDC A;  3BVZ A;  1JB3 A;  5TSS A;  1CM9 A;  3VA5 A;  2JA6 B;  3OIP A;  3NWS A;  1KTK A;  1Q8I A;  2L12 A;  1G29 1;  1SXT A;  1I50 B;  5C0X H;  4C3I G;  4B08 A;  1A3U A;  1EOT A;  4ODG A;  4ZKC B;  4FP5 D;  3BDL A;  2F0V A;  5I9P A;  5FK9 C;  1LV9 A;  3A56 A;  2RSN A;  3E6Z X;  3KUP A;  4B9W A;  5I6W A;  3P20 A;  2R92 B;  3TDQ A;  3VYR A;  3H94 A;  4R8N A;  1LTA D;  1EZ8 A;  2BE5 C;  4HMI A;  1G2S A;  4XDX A;  1SYG A;  5DM6 3;  3J80 L;  1PTO F;  2IX3 A;  2F0L A;  1EYA A;  1ET6 A;  1JWS D;  2A74 C;  2WIN B;  4XQN A;  2L0C A;  5HUR A;  5T1I A;  3E5S A;  1XXG A;  2K5D A;  4IFD H;  1H9S A;  1W6J A;  1ZEQ X;  4J1M A;  4DA2 A;  5JEA J;  2VUM B;  3DWA A;  5G3L F;  1MSH A;  4EQN A;  5M3M B;  2RVL A;  4HAE A;  2IPK D;  4EGV A;  1JQY D;  4XXE A;  3QJY A;  1MD2 D;  3J7A V;  2PZW A;  4DXF A;  3NWT A;  1EY7 A;  5JVG 3;  1JIC A;  2A6E D;  5CYU A;  1C8C A;  3N52 A;  2F03 A;  3MFY A;  2WB1 B;  5IT9 L;  2EYL A;  1SJH D;  1R9T B;  2QEJ C;  1SND A;  4R9W A;  3NBH A;  1AZQ A;  4PMB A;  5I6Y A;  1DCZ A;  2CQA A;  1V1P B;  1TS4 A;  2D9U A;  1LTI D;  2PZU A;  3HOZ B;  2F3W A;  3A8I E;  3MZ5 A;  5C3X A;  1STB A;  4I7Z C;  4OHJ A;  3LNN A;  4K8I A;  5C5L A;  2KVM A;  5BN4 A;  1Q12 A;  2DNE A;  2PYK A;  1SBB B;  2IW3 A;  1X32 A;  3N6R A;  1IKM A;  4IUT A;  3FEW X;  1GUG A;  1RTO A;  4A3D B;  2IT1 A;  1ENF A;  1CQV A;  4FYD A;  4O42 A;  1VF7 A;  1SJE D;  3NE5 B;  1DYQ A;  1Z6H A;  3GQB A;  1IHZ A;  1HHV A;  2MJ8 A;  1AP0 A;  2J4X A;  4G7O C;  4CKC A;  4RGM A;  5FLX E;  2FHT A;  2NB0 A;  2KHS A;  2F0H A;  4DGZ A;  1CT1 D;  1B3A A;  1DOM A;  1O78 A;  3ONA B;  1B9N A;  1MGS A;  1DOK A;  1CHP D;  2Z8L A;  1TS5 A;  2AQ1 B;  5EKI A;  1F2M A;  3KF8 A;  3SVM A;  3HZX A;  3PIP 3;  1RTN A;  3GD7 A;  1L0Y B;  1STA A;  1KDC A;  2EJG C;  3SK5 A;  3OWF A;  1PFN A;  3IFD A;  2F0I A;  3G7L A;  3VR6 A;  1SNC A;  3M3Y B;  1D5M C;  3S9W A;  1SYE A;  1SSO A;  3KLR A;  1SAP A;  4IUV A;  4O1N A;  5FOB B;  3HRZ C;  1X3Q A;  3S14 B;  2XWJ B;  1B4O A;  1S5B D;  4C1N I;  2IX0 A;  1RD9 D;  3FDT A;  5M5X B;  2CVR A;  3QO2 A;  1U4L A;  1A2T A;  1DXM A;  4EVO A;  1WCM B;  5COR A;  1WD0 A;  1ICW A;  1B44 D;  4H13 C;  3TSS A;  1NR4 A;  4BBR B;  4J6H A;  4ZRZ A;  5JEA G;  3DM1 A;  2JEB I;  4CJ1 B;  3IFT A;  3HOV B;  1HA6 A;  1PDQ A;  1F9R A;  4NKL A;  5T1G A;  4NDX A;  5K36 G;  4QUC A;  1LLR D;  3Q23 A;  1STG A;  2F0U A;  1D6E C;  4LAA A;  3J7A F;  1E2W A;  4A3J B;  2FMC A;  5A35 A;  5IGG A;  2B63 B;  2XNA C;  1PZK D;  3LWE A;  5E1F A;  3EVQ A;  3KLS A;  2EYJ A;  3VR5 A;  1HCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...