4GN3B

Obody am1l10 bound to hen egg-white lysozyme
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
105
Chain Sequence
GSVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEYGKTPDHLFKVFAELSREDVVVIKGIVEASKAAGVEIFPSEIWILNKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/de novo protein
molecule keywords Lysozyme C
publication title Tracking Molecular Recognition at the Atomic Level with a New Protein Scaffold Based on the OB-Fold.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
total genus 19
structure length 105
sequence length 110
chains with identical sequence D, F, H, J, L, N, P, R
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gn3B00
1NBWA 2QGQA 4X65L 2WAQE 4DV3Q 3UDGA 2Q2UA 2D62A 2D0PA 3GTQH 4H02A 4P75A 4A3JH 1I94L 4A3DH 1E24A 3IRBA 2JA8H 4UPAA 1VQFA 2IY5B 1VQIA 1OTCA 4IFDJ 1Y1VG 5M3MH 4JG2A 3T1YL 5FJ8H 4LF5Q 3S2HH 2B29A 3A74A 4JI2L 2UUBL 1MIUA 2K52A 1XPRA 3BJUA 1PYSB 5C0XI 2VQFQ 2NN6G 4A3KH 4A3MG 2JJQA 3KOJA 3CC4A 2DGYA 5IY0A 4MNOA 1XPOA 2E2HH 1LTLA 4JI0Q 2A8VA 1HZBA 3LGJA 2VY3A 2I5MX 2HHHQ 4YCUA 2AMCB 2KCMA 5C4XG 4GNXC 2MO1A 2R92G 2ID0A 4LFAL 2CWAA 1VQ9A 3PGZA 4JC0A 3AFPA 4LF9Q 1HZCA 2R7FA 5AJ3L 1IBKL 4DV6L 1X56A 1QUQB 3CD6A 3G6EA 3W1GA 4B3SL 3GO5A 2EXDA 1N34L 2UUCL 2N49A 3RR5A 5C44H 1LYLA 3TEHB 1AE3A 4DUYQ 5GROA 4QQBX 1W3SA 1HNZL 4HIKA 1Q8KA 4GKJQ 4LUZA 4IJLA 5LMUQ 2F4VQ 1NY4A 2Q2HA 4A3CH 3I4OA 4A3GG 2OCEA 4AYBG 2VW9A 3U50C 2VUMH 1VQGA 3PO2G 2AKWB 1KRSA 1NMFA 1V43A 1OXTA 1SMXA 1HR0Q 1I5FA 4IPGA 2ZTCA 1Z47A 1TXYA 3PSIA 3HOUG 1S3OA 4DV1L 1RIPA 3K7UC 1WI5A 1EOVA 2ZJQA 4UP9A 4KHPQ 2JA6H 2HQLA 1XNRL 2NVTH 3KF8B 1EIYB 2VS1A 4UY8C 1YHBA 4LF6Q 4QL5A 1VCIA 1BBWA 2PI2E 3Q8DA 1SLJA 5LMNQ 2E5LL 2KENA 1IBLL 2ZTDA 2CQOA 2MO0A 3GTLH 4JYAQ 2R6GA 4P72A 1A0IA 5M3FH 4OO1I 1JJCB 3RLOA 4DR4Q 3OTOQ 4NB3A 1Y1WG 3CCRA 3UDXA 1N9WA 2PMZE 5H1SE 1HNXQ 5JEAJ 5ELOA 2XTIA 1X9NA 1UE6A 3J81c 3CCMA 3CCVA 3FKIH 4GLVB 1L2FA 2WFWA 4EQ5A 2DUDA 4OXPA 4APVA 3S17H 4MZ9A 3HOVH 1HJPA 3GDEA 4DUZQ 1QVGA 1CKMA 3TS2A 2BA1A 4A3EH 5IP9H 4X66Q 3H15A 4LF8L 1VQ6A 1SR3A 1VQOA 4DV4L 2Q2IA 1YHQA 1N36L 1JE5A 3FP9A 5IP7G 4HJAA 4LF7Q 2QA4A 5E7NA 1X6OA 3H0GH 1PH9A 4JI5Q 4A3LH 1FJGQ 4LFBQ 1UE7A 2JA7G 3H3VI 2JA5G 2K75A 1EQRA 4B3MQ 1Q1BA 4AYBE 5IWAL 3I55A 4DR6Q 5IT9c 2VZAA 2PQAA 4JI4Q 1BKBA 1EWIA 2NVYH 4LUVA 2UXDL 2NVXH 1PVOA 3D31A 5IYCG 1KD1C 4HJ7A 4X6AH 3S24A 1FL0A 1EYGA 1OXSC 1HZAA 2H5XA 1Z9FA 2CCZA 3I2ZA 1AE2A 4YWLA 3ZJYC 4JOIA 1L1OC 4DV7Q 1Q82C 3HKSA 3PF5A 3JAMi 3S1MH 3H3VH 4JI7L 2UXBL 1WJJA 1K8AC 1N32L 2Q2TA 3HOYG 5EAYA 1HR0W 3GTGH 4DV2L 4Y7NH 1Y1VH 5GAEC 4PZ8A 3HOZG 4JBWA 2KCTA 1XTDA 4DR3Q 2EQSA 1JT8A 3F1ZA 4HJ9A 1L1OB 2I5LX 2PQAB 2QEXA 2KHJA 1YITA 1EIFA 1PH2A 4JI8L 4NPSA 2BA0A 3W5OA 2K14A 4DR1L 3K8AA 5LMNW 3NELA 4BA2I 4A3MH 3PCOB 1XMQQ 3CW2C 4JI1L 1LUZA 1K3RA 4X62Q 1M1KC 4LNQA 3U58A 2YU9H 2UU9L 1P8LA 4PZ6A 1A8VA 3CCLA 2NZHA 3NEMA 2Y0SG 5C4XH 4X65Q 4BY7G 1VQAA 4OWTB 2MNAA 4IFDI 1A63A 4POFA 3AYHB 1G6PA 2R92H 1VQHA 1B8AA 2LXJA 3KF6A 1PFSA 1PH7A 4BY1H 2N3SA 1T9HA 5IYBG 1PV4A 4WJ3M 4FDBA 1XMOQ 1PH6A 2B3GA 5C4JH 3RLNA 4A3IG 1HH2P 3AQQA 4LFCL 4JI2Q 1GM5A 2UUBQ 4PZ7A 2R7ZG 2Z0SA 1NMGA 1G51A 2UUAL 4B3RL 5IE8A 2XGTA 5IYDH 3M4OH 1UWVA 3K0XA 4DR2L 4OX9Q 3CAMA 1X3GA 3PUVA 3TS0A 4B3TL 4UP7A 1K73C 3SGIA 3HOXG 1VQLA 4K0KQ 4GLXA 3PF4A 3UDFA 3L2PA 3WWVA 3KF6B 4DPGA 1D8LA 2BH2A 1ASZA 4LFAQ 4JI6L 1YNXA 4BBSG 1SRUA 2HT1A 1HNWL 1IBKQ 2OWOA 5AJ3Q 3HOUH 4DV6Q 1IBML 4LF4Q 1N33L 4RG1A 3KJPA 5BR8Q 1N34Q 1X3FA 2UUCQ 4O0AA 4DAYB 2JEAI 4QIWE 3J80c 3KFUA 1J5EL 1S72A 1HNZQ 4LF5L 1P16A 1X54A 3T1HL 2PNHA 1Q46A 4IPDA 1D7QA 2CFMA 2NZOA 3E9IA 5K36G 4BA1I 1KL9A 1Y1WH 5C3EG 1WCMG 1PH3A 3L0OA 4HIOA 3F2DA 2ZM6L 1EFWA 3J7ZC 2RHSB 2LXKA 4DKAC 4NXMQ 2Y0SE 3PIPA 2HHHL 2MQHA 3G4SA 3G48A 1JJGA 1GVPA 2VL6A 3U4ZA 4DV1Q 4YHHQ 3M7NA 1PH8A 2E2IH 4A3DG 4A93G 1MKHA 2HIXA 1SE8A 3KDFA 4YCWA 1FGUA 1B70B 2JA8G 4DV5L 1XPUA 4LF9L 4JI3Q 2OQKA 3ERSX 2B63G 4C3JH 3CPFA 2HIVA 3F2CA 3S15H 1VQ7A 2E5LQ 4IOAA 1IBLQ 1PHJA 3ULJA 1K9MC 2OTJA 5IP7H 3EN2A 1VQJA 1NTGA 1MJEA 4RMFA 2L15A 3CC2A 3KLWA 5LMUL 2JA5H 4OWWB 1Q81C 4JBMA 3TREA 4DNIA 2F3IA 1Q1EA 3GTJH 3J81j 3CF5A 1JB7A 4HIMA 1Y14B 4A75A 3PO3G 4GN4B 3RNUA 4YCVA 3ULPA 1V1QA 4IPHA 3UE0A 5IYCH 1ASYA 3CCJA 4GLAC 1VQMA 3HOWH 1YVCA 2GVAA 4YY3L 1JJ2A 1BVSA 1XNQQ 3J7A5 4X64L 4KHPL 3CCUA 3A0JA 5C0XG 5ELNA 1W2BA 4LF8Q 5C44G 4DV0L 4DV4Q 1N36Q 2E2JH 3K80C 4J15A 2JE6I 3HOYH 5M5YH 1C0AA 3HOZH 5M5XH 3TQYA 4DR7Q 4GOPA 4R4CA 4DR5L 1VQKA 2UXCL 4KLKA 1WOCA 4R4IA 1NJIC 1HNXL 4JCVE 2IHFA 1YEZA 2ALYB 4R4OA 3U4VA 1YJNA 1SN8A 4BXXG 3F8TA 2OTLA 1UE1A 3M9BA 4P73A 2AWNA 1YJ9A 2FXQA 3CMAA 2WP8J 1U0LA 3D0FA 4IPCA 4BY7H 2JA6G 3PUZA 1YI2A 3NBHB 4YWKA 4GN3B 4MTNA 1OXXK 1Q86C 2UXBQ 1VQEA 1N32Q 4HJ8A 2NN6I 4IOCA 4X66L 3F2BA 1M90C 1VQNA 2ZJPA 1YIJA 4GOPB 4GKKQ 5IYBH 2VQEQ 3I7FA 2VNUD 3UE1A 2Z6KA 4LF7L 4A3IH 1I6HH 3L7ZC 2AWOA 4JI8Q 1K8GA 4LFBL 3PUXA 4PG3A 3I4NG 1KHIA 1X3EA 4L5RC 4P74A 4DR6L 3GTPH 3S1QH 3AFQA 4JI1Q 1VQ4A 2A19A 1L0WA 4JBJA 1PH1A 2YV5A 2D0OA 5JEAG 2UU9Q 4NXNL 3HKZG 3KYHC 2LSSA 3GD7A 3OYYA 2BH8A 3CC7A 1PH5A 5JJIA 1SROA 3M4PA 4KI0A 1PA6A 4A4IA 1I94Q 2AHOB 2IT1A 1CKOA 1GD7A 1TWCH 4LWCA 1Q7YC 1KIXA 1CKNA 1PYBA 2K5NA 4L5QA 2K50A 3RN5A 2IX0A 5GAHC 1R9TH 3STBD 4LW1A 4A3BG 4OWXB 3T1YQ 1JMCA 4JV5L 5FLMG 1IXRA 4AQYL 4KHZA 2UUAQ 4B3RQ 2A1AA 2CWPA 2ATWA 1X55A 2IHEA 1VQ5A 3PV0A 1KRTA 3J80i 2JQOA 3RZDH 4B3TQ 2R93G 2F52A 2K5VA 3NENA 5C3EH 1WCMH 4A3GH 2WB1G 4QY7A 1CSPA 4BBRG 3CMEA 3PO2H 3CCSA 3G71A 1E3PA 2OQ0A 1HNWQ 4JI6Q 1CKNB 1IBMQ 1N33Q 4A93H 1YBYA 4DV3L 2KHIA 1XJVA 4GKJL 4R4QA 4IO9A 4GS3A 1Q12A 4B3SQ 4DAMA 2B63H 4A3FG 3AEVA 1XMOL 1J5EQ 3CPWA 3CCEA 2YTVA 1QUQA 4TQUS 3HFZB 3T1HQ 3I4MG 3RZOH 4GNXA 3GTKH 1KAWA 1HZ9A 4DK6C 3E9HA 1C9OA 3MXNB 3ULLA 4OX9L 3ICEA 4R1JA 2ZM6Q 1B7YB 2VQFL 5JJLA 3HKZE 2JEBI 1C7YA 4JI0L 3PO3H 3S1RH 4K0KL 2RHQB 4UP8A 3STBC 4XIGS 5C0XJ 2KBNA 3PUYA 1V9PA 3J81i 4DV5Q 2JK8A 1VS0A 2MFIA 4BY1G 3PIOA 1IYJB 4HIDA 3OW2A 1QVCA 4A3JG 1YJWA 2RF4A 4LF4L 1XNRQ 4QJFA 3S2DH 3I56A 2EIFA 4EX5A 5BR8L 3A5UA 4LUOA 5M3MG 3M4QA 3UDIA 3W1BA 5FJ8G 1YHAA 4GNXB 3DLLA 1CUKA 1G291 2I5HA 4DUYL 1TWHH 5IYDG 3M3YH 1GO3E 4IFDG 1EUJA 2JA7H 4A3KG 2F4VL 2WB1E 3BU2A 3KJOA 2I0QA 1NE3A 1AH9A 4WJ4A 1OXVA 4NXML 1FVIA 3KDFB 4BXXH 4L5SA 1RL2A 2K4KA 1HR0L 1OXUA 4YY3Q 4YHHL 4XTCS 4X64Q 1E22A 4DV0Q 4PMWA 4JI3L 2YTYA 1E7ZA 2YYZA 4OONA 3M85A 4AH6A 4DK3C 4C3IH 1VQ8A 3GTOH 1SFOH 4LF6L 1KQSA 2N8NA 5FLXc 5LMNL 4YWMA 4R4TA 3S14H 4DR5Q 2UXCQ 4JBKA 2N78A 1U5KA 2JA9A 4JYAL 2GVBA 1VQPA 3I4NH 1QZHA 4A3CG 5IWAQ 1UE5A 4DR4L 3OTOL 5GQOA 1VQCA 4O2DA 1K0RA 3CP0A 4A76A 2VUMG 2UXDQ 1CSQA 3MEFA 3RLFA 2NVQH 2V1CC 2ASBA 1DGSA 5M5WH 4GOPC 1TWGH 2ZJRA 3TRZA 1J6QA 1MJCA 3FHWA 5DLQE 1I3QH 1XNQL 3JC66 4JI7Q 3E0EA 2WAQG 4ME3A 4DUZL 4POGA 4TVAB 1WYDA 2CKZB 3B6YA 4IJHA 4C2MH 5GADC 1S40A 4DV2Q 1BBUA 1VQDA 4A3BH 1YZ6A 5FLMH 5M3FG 4JI5L 4HJ5A 4DR7L 2R7ZH 1FJGL 3S1NH 4JOIC 1QZGA 1L1OA 3BZCA 3RN2A 2C35B 4GN5A 4DR1Q 1PH4A 4B3ML 3GTMH 3ER0A 1QVFA 2R93H 2GN5A 1VQBA 4JI4L 3FKIG 4NXNQ 2Z6KC 1EQQA 3K81C 3HOWG 2E8GA 3HOXH 4BBRH 3EIVA 3HOVG 4AIMA 2IX1A 4OO1G 3K7AH 1TWAH 1E1TA 4P71A 4BBSH 3EBEA 5JJKA 4DV7L 5IP9G 3BZKA 4A3EG 1KXLA 2ES2A 1IL2A 2RCNA 4ALPA 4GKKL 4JV5Q 3DM3A 2VQEL 4A3FH 4AQYQ 4Y52H 3H0GG 1X65A 4A3LG 1O7IA 1IZ6A 1WFQA 2YTXA 2ZTEA 4LFCQ 1N8RC 3S16H 4DR3L 3I4MH 1GKHA 2PI2A 1I50H 3CXCA 3VDYA 1E1OA 3CQZH 4DR2Q 1KC8C 1LM0A 3A5ZB 5HY6A 1A62A 4C3HH 4L5TA 1TWFH 1UEBA 2K5HA 3PUWA 5HGQA 4QGUA 3JAMc 1K83H 1XMQL 5GAGC 3CCQA 5J3BA 4X62L 2R7DA 1H95A
chains in the Genus database with same CATH superfamily
2QW7A 3K7AB 3UDGA 3GTQH 3TP7A 3IRBA 2IY5B 1VQIA 1EEFD 1M8AA 3VR5A 5FJ8H 1QG7A 5JPNC 2UUBL 4IFDH 3CQZB 2HDMA 3U9SA 1W6JA 1PYSB 3BS1A 4A3KH 3TP5A 2FJ2A 2E2HH 4JI0Q 1LTLA 2YU9B 3JAME 3T13A 4H0LC 2CVRA 4GNXC 3OWFA 3K6OA 5K5PA 2R92B 5CV6A 4BY1B 2ID0A 4JC0A 4LF9Q 1IBKL 5AJ3L 2CH4A 5C4JB 1A3UA 4HEDA 3G6EA 2EY6A 4B3SL 1PZJD 4IN3A 1N34L 1STEA 2N49A 3RR5A 5C44H 1LYLA 4DUYQ 5D3IB 2F3WA 4LUZA 4IJLA 5LMUQ 3R8BA 2Q2HA 1QNUA 2N55A 4A3KB 3I4OA 4A3GG 5I4DA 2E2HB 5G3LF 3DWQA 2AKWB 1NMFA 1V43A 2D9UA 4KN4C 1SMXA 1TKWB 1TXYA 1STBA 4XDXA 3HOUG 4DV1L 2EZVA 3QOLA 1WI5A 1EOVA 2JA6H 3KUPA 4O42A 1XNRL 2NVTH 4RGTA 1WTXA 5LMNQ 2ZTDA 2MO0A 4P72A 1S5CD 5IGDA 5M3FH 4OO1I 4DR4Q 3OTOQ 3CCRA 3UDXA 2BCOA 2XTIA 4HR7B 3EQLC 4M1UB 3MEHA 3ONAB 1L2FA 5JEAH 3S17H 4DK1A 3K5MA 2NVTB 4C3JB 3GDEA 1DXMA 4LF8L 1VQ6A 1SR3A 2Q2IA 4F8MA 4HJAA 4CJ0B 5E7NA 2JN4A 5M3FB 3C2PA 4LFBQ 3W2DA 1UE7A 3H3VI 2K75A 1U4RA 4AYBE 5IWAL 4DR6Q 2VZAA 3J81E 1SAPA 2A6ED 1GOZA 2K03A 3HOWB 4RH6A 2H5XA 4JOIA 1H9KA 2CH4W 4ZYSA 3Q23A 3S1MH 2L4NA 1STHA 4FXKC 1SE3A 4C3IG 5M5YB 2Q2TA 3HOYG 2K1BA 2VXWA 1Y1VH 5C6AA 4PZ8A 4JBWA 3F1ZA 4RKBA 2PQAB 4DR1L 1NNXA 5LMNW 5C5LA 4BA2I 3PCOB 3CW2C 2RSOA 4JI1L 3DEPA 4WORA 4LNQA 3PMFA 2UU9L 1G91A 5I9OA 3NHHA 5C4XH 1M4VA 4IFDI 1VQAA 1A63A 2MP1A 3S1MB 3Q6SA 4DGZA 4UAIA 5CV9A 4NKLA 1SYCA 4FDBA 1XMOQ 1I4XA 4PMBA 3SVMA 3BG3A 1LO5D 4F88A 5L37A 1HH2P 1PTOF 4JI2Q 2R7ZG 1MSGA 4PZ7A 4DAYA 1NMGA 4KD3A 5EPLA 3GTPB 2XGTA 4JK1C 5IYDH 1UWVA 3R93A 3FDTA 3BDOA 5C4XB 4ZKCB 3KF6B 1D8LA 1ASZA 2EXZA 4KY7A 1LTID 1VF5C 4DV6Q 4LF4Q 1NR4A 3E0JA 1TIID 2A6HC 1NCVA 5JJZA 2UUCQ 1XYIA 4QIWE 3KFUA 5C4HA 2EYPA 2KCNA 1TY0A 3K57A 4IPDA 3HEJA 5J39A 5C3EG 2DY7A 1WCMG 4AYBB 2MUYA 3L0OA 4HIOA 3F2DA 3PO2B 1FNVA 1EQTA 4NXMQ 3MXPA 3SEBA 1ZYRD 4YHHQ 3KDFA 1SE8A 4YCWA 1B70B 3CPFA 3S15H 2E5LQ 2RDGA 1PLFA 3J80E 1PHJA 3ULJA 1ENCA 1K9MC 3CRKC 2OTJA 5IP7H 1EY6A 2F0TA 4G7OC 1LT5D 1MJEA 2L9HA 2F0DA 2JA5H 1TVXA 2PZWA 2F3IA 3J81j 1HTLD 1U4MA 4A75A 3PO3G 4RCNA 4TSSA 2CW0D 2PZUA 4HSPA 4JW0A 3A7AB 3OOCA 1XX8A 1EL0A 2RDFA 1XNQQ 1B4OA 4KHPL 3CCUA 5C0XG 3S15B 1B3AA 5C44G 3CRLC 1N36Q 4RGMA 3K80C 4B9XA 1FNUA 5M5XH 2FMMA 5I6WA 5IOCA 2JA7B 1B9NA 2UXCL 2JA5B 4R4IA 3VYRA 1SJHD 3IFTA 3K5NA 2B2TA 2ALYB 4R4OA 5J22A 1GHKA 4BXXG 1EY8A 4FP5D 3D0FA 2JA6G 1IKMA 1CZGA 4MTNA 5FO8B 2K6AA 1HHVA 4HJ8A 3F2BA 1YIJA 4L6TB 4LF7L 4JI8Q 4PG3A 1SMYC 1KAAA 1EIHA 1TS5A 3JAML 1B44D 3V05A 4L5RC 5DM73 1SNCA 1STGA 1VQ4A 1TWGB 5JEAG 3R3OA 3BYYB 3KYHC 3OYYA 1PH5A 1IKLA 5JJIA 5KNCA 4QMGA 3HZXA 4KI0A 3M4PA 3RMHA 1ILQA 2LKVA 2IT1A 1Q7YC 1DOMA 3QJYA 1CKNA 2EJFC 4L5QA 4N8X1 3RN5A 4A3BB 1F2MA 3M4YA 2ICEC 4B3RQ 1X55A 1F2ZA 3GTMB 1A6XA 3NXWA 2NWGA 3CKIB 1KRTA 2JQOA 1ICWA 2F52A 2K5VA 3NENA 1R4PB 1WVLA 1FNWA 1QB5D 1D6EC 4ID6A 1IW7C 4QY7A 3X3NA 1DCZA 1O7LA 4EVOA 4FXGC 4ZKBB 2OQ0A 1HNWQ 1F2LA 4BBSB 1YBYA 2QDLA 2KHIA 1B2TA 4WFN3 4GS3A 4B3SQ 2DY8A 4KK7A 3SK8A 2YTVA 1QUQA 3BZDB 4TQUS 2XVSA 1BCPB 1FGBD 4C3HB 3MXNB 3ULLA 3E6ZX 4OX9L 4G7ZC 3HKZE 2JEBI 4JI0L 4K0KL 1AZPA 4UP8A 4JVZA 4XYOA 2Q8IB 2KBNA 3PUYA 1AFPA 2MFIA 4A3JG 3EVQA 4U673 3DXJC 1XNRQ 1HFNA 2EIFA 2O5JC 1RF2D 5BR8L 4ZQ3A 3UDIA 1V8QA 1G8ZD 1G291 4DUYL 5IYDG 4QCLA 2RBMA 2C5CA 3NQIA 3BU2A 3KJOA 2IPKD 3G7LA 4WJ4A 1OXVA 1FVIA 3KDFB 1I4PA 1SYBA 2PPBC 3VYUA 4DK3C 3GTOH 3C46A 5LMNL 2RDHA 5BN4A 2N78A 2JA9A 1LTSD 1YNJD 2GVBA 3I4NH 1QZHA 2XIWA 5IWAQ 1UE5A 4DR4L 3OTOL 4A3CG 1VQCA 3RLFA 2NTTA 5KNBA 5IGEA 1F9SA 5M5WH 2I07B 5E3FA 2ZJRA 3TRZA 2K04A 1I3QH 5E4XA 3JC66 2F0KA 2WAQG 5FO7B 2B2TC 1Y8NB 1B1ZA 4C2MH 4IJHA 4FXDA 2WACA 5FLXE 3KBGA 5FLMH 4XQNA 1L0YB 2F0GA 4E6IA 1CA6A 3I4NB 1RD9D 3MA2B 5A2QE 4DR1Q 1PH4A 3MHBA 1PZID 4NXNQ 4KY5A 2RKSA 2RVLA 3HKZB 2LFNA 2E8GA 4BBRH 3HOVG 3N6RA 2A69C 1I3QB 2SOBA 1TWAH 1E1TA 5JJKA 1F9PA 4XQJA 1PTOD 1T5XD 2ES2A 1IL2A 4JV5Q 2O4XA 4AQYQ 1BBXC 2J4XA 3L3OC 4A3LG 1O7IA 2FFKB 1WFQA 5DEHA 1E1OA 5JPMC 3FEWX 5HY6A 3PUWA 4K8IA 3JAMc 4BBRB 5J3BA 5BN3A 1H95A 1QJOA 2QGQA 1EY9A 2D0PA 3J80L 4P75A 4DXFA 1GUGA 4UPAA 4IFDJ 4XT3B 1V1OA 5M3MH 1QOHA 1ZKOA 2B29A 2KJXA 4JI2L 1XPRA 3BJUA 2DN8A 5LL6S 3BYTB 5CBAE 1XPOA 2A8VA 1HZBA 3MTSA 2AMCB 2KCMA 4NP5A 4CJ1B 3A7LA 2CWAA 3PGZA 1HZCA 1RTOA 4DV6L 1QUQB 1PMRA 3W1GA 2EXDA 2X6LA 2UUCL 3TEHB 1X3PA 5GROA 4QQBX 1W3SA 2ENBA 5DNFA 1LT6D 3D4RA 2L5TA 1U9RA 3R2IA 1NY4A 3VYSA 2OCEA 3U50C 3DMUA 3I70A 3T16A 1HR0Q 1SYGA 2HDLA 1YNND 3MFGA 3HOUB 1R4QB 1ESRA 1BXTA 1RIPA 4IUPA 4UP9A 4KHPQ 2HQLA 3KF8B 1S5BD 2VS1A 5TSSA 1EIYB 1W6KA 4LF6Q 1VCIA 1SLJA 2E5LL 2F0LA 2CQOA 2HUGA 5E1FA 2AUJD 1JJCB 4K2LA 3RLOA 2F0WA 1Y1WG 1O7YA 3T4AC 1HUNA 1ZXTA 5JEAJ 5ELOA 1X9NA 2A68C 1TR5A 3P75A 3MZ5A 3J81c 1SXTA 3T53B 5KYIA 3FKIH 1SMYD 1CQFA 2B2UA 1E2VA 2DUDA 4APVA 4MZ9A 2F3VA 3E5SA 2KUMA 1HJPA 4IZ8A 4OO1H 2BA1A 1GUOA 5IP9H 2AUKA 3NBHA 3H15A 2RSNA 2B2VA 1N36L 4LF7Q 4X3KA 1X6OA 1PH9A 5ISRA 1D5ZC 4ZRZA 4B3MQ 3I55A 1E0BA 4PMCA 3GP7A 2PQAA 1BKBA 4LUVA 4DU9A 3FKIB 3K0YA 1PVOA 1KD1C 1SBBB 3S24A 1PRTC 2BE5C 1Z9FA 2CHBD 4K2KA 4PQXA 4DV7Q 3HKSA 4XYQA 3JAMi 3H3VH 2E2JB 1IYVA 4QB4A 1HR0W 2A73B 4DV2L 3MWYW 5GAEC 3HOZG 4QUFA 5CGKA 2X69A 4DR3Q 1JT8A 4HJ9A 1LTAD 2KHJA 2PNRC 1YITA 4JI8L 2BA0A 2F0SA 5IT9E 3H3VC 3NELA 2NN6H 4A3MH 4LJZC 4X62Q 1M1KC 1K3RA 4ZK9B 2YU9H 3CCLA 2KA7A 4BY7G 4X65Q 4GZYC 3QR8A 2F0VA 4POFA 2R92H 1B8AA 4IALA 3KF6A 4BY1H 3K59A 2N3SA 1PV4A 1PH6A 5C4JH 2PZTA 1J8IA 1QILA 4LFCL 1GM5A 2Z0SA 2OF1A 4V190 3M7GA 4KKTA 5I2YA 4B3RL 3M4OH 3K0XA 3FPUB 4J8QA 2KOLA 4OX9Q 3CAMA 4A3MB 2EJMA 4UP7A 2SEBD 2EJGC 3D8GA 4K0KQ 4FYDA 3WOFA 3PF4A 1PZKD 4K14A 1HNWL 4LFAQ 4V0BA 1YNXA 1KABA 3BVZA 1BF4A 1R9TB 5BR8Q 1X3FA 4CJ2C 3J80c 4LF5L 1HNZQ 3P20A 1H9SB 2BDOA 3PQIA 1Q46A 5KIXA 3E9IA 3M4OB 1KL9A 3A56A 2V4DA 2Z4HA 3J7ZC 2K5DA 2Y0SE 1JQYD 2HHHL 3G48A 4P2CB 5C5MA 1PH8A 3K5LA 2HIXA 1FGUA 4M8AA 2ICIA 1TQOA 2OQKA 2LS01 2B63G 4C3JH 3KLSA 3F2CA 1VQ7A 2ZXRA 1EY5A 4QUCA 1VQJA 2F0NA 3OWEB 2L15A 1AP0A 3KLWA 1WD0A 3OIQA 2PW5A 4OWWB 3G6JB 4HIMA 3PO3B 2JSOA 4YCVA 3UE0A 5IYCH 3SK4A 1ASYA 4GLAC 3HOWH 2GVAA 2E76C 4FF4A 1W2BA 4DV4Q 4ZUJA 4Q5VA 4CKEA 2JXMB 1IYUA 2A69D 4J15A 3PIP3 5M5YH 3D4WA 3QB3A 2B2UC 5EKIA 1GUWA 3TQYA 3VR4A 4R4CA 1MBYA 3TZDA 2F0FA 4KLKA 1WOCA 4WJWA 3R2TA 4JCVE 1KDCA 2B2VC 1G6ZA 1SN8A 2OTLA 1UE1A 3M9BA 4P73A 4UHVA 1O80A 1YJ9A 2FXQA 1U0LA 1Q86C 1GXDC 3NBHB 2UXBQ 3A8IE 1OXXK 4MHEA 1ET6A 1N32Q 1CFMA 2NN6I 4X66L 1D1KA 2C9OA 1VQNA 2ZJPA 5IYBH 1SNPA 3I7FA 4FVMA 4A3IH 1DD2A 3GV6A 2AWOA 2EYMA 1X3EA 4IQZA 5CR3A 3VR3A 1KTKA 2A74C 3GTPH 3S1QH 2NVQB 4IUQA 5NUCA 2A19A 3WOEA 5FK9C 1H9MA 4NXNL 2B8FA 2LSSA 3GD7A 1DOKA 1D1IA 1D5MC 1CTMA 4H13C 2Y0SB 4RHSA 1JB3A 1KDBA 1S5ED 1SROA 3SDZA 2AHOB 2RA4A 1RHPA 3STBD 4LW1A 4JV5L 4A3IB 4AQYL 3S1NB 4KHZA 2UUAQ 2CWPA 1VQ5A 3NTIA 2EE1A 3J80i 3S1QB 5K36H 4B3TQ 2R93G 4RFBA 2F03A 2WB1G 3HOXB 3MXNA 1CSPA 3CMEA 5FKAC 2D5DA 3PO2H 3TN2A 3CCSA 3NWSA 4A93H 1N33Q 5IODA 1LLRD 2EY1A 3RUZA 1UNSA 2SDFA 3CCEA 1O78A 2MHVA 1I50B 3RZOH 1GUTA 1JR0D 1PDQA 2PCFB 1WTHA 3TBIB 4XQQA 3URYA 3X3MA 4DK6C 4K6DA 5JAVA 1C7YA 3OSOA 3MC0B 2F0UA 2RHQB 5D65A 4A93B 1V9PA 5C3XA 4A3DB 2BOSA 4DV5Q 2JK8A 1EU4A 4BY1G 2JA8B 2TMPA 3S2DH 3SHLA 2RF4A 1PTOB 5EKLA 1K8OA 1IL8A 3NE5B 3M4QA 5FJ8G 1ESFA 5CYUA 2L55A 3RZOB 3M3YH 5C3WA 1GO3E 4IFDG 1EUJA 2JA7H 4A3KG 3OHXC 4YIJA 2K4KA 1HR0L 3F2UA 4YY3Q 5I6YA 4XTCS 3S2DB 1BDOA 2ZXPA 2QEJC 4PMWA 1PFMA 3M85A 5I9PA 1PRTD 1EYAA 1SFOH 4LF6L 5FLXc 1A2UA 3M3YB 3S14H 4DR5Q 4BS9A 3DEOA 1VQPA 5GQOA 3A8JE 2Q8TA 1AEXA 1JOKA 2V1CC 4N9TA 1DGSA 4EGVA 2ASBA 1TWGH 2EYFA 5CC4A 2HQEA 2K05A 3SK6A 5DLQE 1TS3A 4C3JG 1STYA 4ME3A 4POGA 5GADC 1SFOB 4DV2Q 1K8MA 4CKCA 4XT1B 2KECA 3S14B 4A3BH 4RCOA 5M3FG 4QIWB 1AN8A 3GQBA 4JOIC 3HS0C 1QZGA 1L1OA 4C56C 3NBIA 4HMJA 4F7XA 4B3ML 5FOBB 3GTMH 2GN5A 1VQBA 1XTCD 3V96A 3K81C 3HOWG 3EIVA 3EROA 3LWEA 1BR9A 4P71A 4BBSH 4FF2A 4DV7L 3BZKA 2KQ3A 1F2YA 1LTGD 1SNOA 2RCNA 4ALPA 2VQEL 4A3FH 1X65A 2G9HD 4LFCQ 4ODGA 1N8RC 4K5XA 4DR3L 3I4MH 3MVVA 3VYTA 2P5ZX 1EZ8A 1SEBD 3KK7A 1Z7TA 4MIUA 1LM0A 2NVXB 1A62A 4C3HH 3IAYA 3MAQA 2XNAC 4EQOA 1K83H 3MFYA 4PV1C 2QDBA 4X62L 1KLGD 2HCCA 4X65L 4DV3Q 4GKJQ 2D62A 2Z6BA 1I94L 4U68A 1BCPC 1E24A 5ELDA 1VQFA 1VF7A 4A3FB 3NUCA 1Y1VG 1CHQD 3T1YL 3IL8A 4LF5Q 3A74A 3I4MB 3S9WA 1MIUA 5D3DA 3H6MA 3QOJA 1A15A 1A3TA 1FR3A 1GJXA 2VQFQ 3EA6A 2JJQA 3KOJA 2DGYA 5IY0A 4MNOA 1K83B 4RKLA 4CDFC 1RKNA 2VY3A 1DYQA 2I5MX 2HHHQ 1LACA 5C4XG 3A55A 3AB9A 2MO1A 1FYCA 2Z1CA 3ND9A 1WD1A 4LFAL 1VQ9A 1F9QA 4H44C 3CD6A 1C48A 3GO5A 3KF8A 1MSHA 3WDNA 1HNZL 5JVG3 3J81L 2F4VQ 3NPPA 4AYBG 2VW9A 2NYZD 2VUMH 1SNQA 1VQGA 3PO2G 3C1EA 1KRSA 1OXTA 4IPGA 1Z47A 5AFWA 3PSIA 1LTTD 1AW7A 3K7UC 2O5IC 1MHWC 1QCBD 4UY8C 1YHBA 4QL5A 4ZLTF 1DOLA 2EYJA 3GTLH 4DF7A 2R6GA 3TP8A 2F0QA 4RAUC 1A0IA 2QKIC 4NB3A 5H1SE 3GV3A 1HA5A 4RGOS 2DNCA 1UE6A 3CCMA 2VUMB 3CCVA 1JWMD 1TS2A 1BO0A 1RCVD 2WFWA 4CDDC 2XRSD 4OXPA 3TMEA 3DWPA 3QO2A 4LAAA 1WTRA 4DUZQ 1QVGA 3TS2A 1B3QA 4A3EH 4K6LA 4X66Q 4ZCKA 4DV4L 1YHQA 4DNTB 3GTLB 1JE5A 3VR6A 3FP9A 4L63B 5IP7G 2QA4A 3H0GH 4IUTA 1HTPA 1FJGQ 2JA7G 2JA5G 4KN7C 1EQRA 1FD7D 5IT9c 4EQPA 3QIAA 2NVYH 5J1ZA 2UXDL 3D31A 4HJ7A 2R61A 1F9RA 1OXSC 1HZAA 4NMZA 2CCZA 4Q0FA 4YWLA 1KNAA 3ZJYC 2E74C 3ND8A 1L1OC 3PF5A 1TU2B 4A3EB 2UXBL 1WJJA 1K8AC 3RD4A 1N32L 3ERQA 3H0GB 2KCTA 1XTDA 1L1OB 1EYDA 4R8NA 4J6HA 2A6HD 4KKUA 3I4LA 2NVYB 2F0MA 4RA8A 1LUZA 3BDCA 3U58A 1B9MA 2NZHA 4OWTB 1KLUD 3D6WA 5I2XA 1VQHA 1PH7A 1T9HA 2XN9C 1LTBD 5DM63 2A6EC 1UAPA 2L12A 1EQVA 2UUAL 5IE8A 3OIPA 4HTHA 4DK0A 1H9SA 1X3GA 4B3TL 1CI3M 3SGIA 4GLXA 2FHTA 1G2TA 3UDFA 3NTHA 1DM0B 4C1NI 1WTOA 4DPGA 4BBSG 1SSOA 4DAVA 1SRUA 2OWOA 5IGCA 3HOUH 1N33L 4RG1A 1NSNS 3H94A 4OHJA 5T1GA 1P16A 2PNHA 1I6VC 1D7QA 1JCKB 2F0IA 1A3VA 2NZOA 4C3HG 1UUPA 2MJ8A 4A3GB 1Q90A 1PH3A 1EFWA 2NUCA 3DM1A 3PIPA 2MQHA 1BNZA 1JJGA 2VL6A 2OT2A 2E2IH 2WINB 4DV5L 1DONA 1JWUD 4X3TA 2K5WA 3LX0A 1Y8PB 3FRPB 4KKSA 4IOAA 1IBLQ 1CQVA 3EN2A 1NTGA 4RMFA 2EPBA 1HQMC 3Q24A 1Q81C 1D5XC 3CF5A 4ME5A 1EU3A 1ICFB 3KLSX 3RNUA 3ULPA 1V1QA 1NAPA 2E2IB 1VQMA 4OIKA 1YVCA 1QWYA 4YY3L 1PYWD 5ELNA 4DN4M 2E2JH 2TSSA 4F87A 1C0AA 3I3CA 3HOYH 1JOOA 2KEDA 1II3A 3I90A 4HSVA 1X32A 4G7HC 1PRTF 3ZYYX 4K8JA 4DR5L 1VQKA 5CV8A 1S5FD 4B08A 1NJIC 1BQQT 1ZYRC 1HNXL 2ZT9C 4R9WA 3U4VA 1YJNA 1F77A 3J7YW 4X3UA 3I91A 2WP8J 4YWKA 4GN3B 5BN5A 1ML0D 3LNNA 1IW7D 4C3IB 3FMCA 5KYLA 4GOPB 3HOYB 2VQEQ 1A2TA 4QF4A 3UE1A 1NR2A 5ELEA 2CW0C 1BCPD 2XRQD 1K8GA 4R8IA 3KLRA 3I4NG 1G2SA 4P74A 3T51B 1HCZA 3P7JA 1V1PB 2YV5A 3L9AX 3HKZG 4KHVA 5EGTA 2SNMA 3IFDA 3OW7A 3I72A 5COYA 1I94Q 1B50A 1ONLA 1DZ1A 2EY2A 2K5NA 1R9TH 2IX0A 5GAHC 3T1YQ 1JMCA 5FLMG 1IXRA 2R7ZB 4X3SA 2JYOA 2A1AA 2ATWA 2EYOA 2IHEA 1ENAA 4I7ZC 3RZDH 4KTAA 2KVMA 5C3EH 1WCMH 4BBRG 4ULLA 4RWSC 1SJED 4JI6Q 1Y8OB 3Q22A 1IBMQ 3VA7A 4DV3L 4GKJL 1K0SA 2LMCB 4DAMA 3AEVA 1J5EQ 3CPWA 3S16B 3HFZB 3T1HQ 4RGNA 1KAWA 1HZ9A 2M2LA 3RZDB 4H7BA 3E9HA 3H09A 5C3EB 4KJOA 1BOSA 1WCMB 4R1JA 2ZM6Q 1B7YB 2VQFL 1EOTA 1XWEA 3PO3H 4HMIA 4XIGS 3GTQB 3J81i 3OW2A 4HIDA 1IYJB 1QVCA 3NTKA 5EBDA 4CKBA 4QJFA 2B8GA 3I56A 5FLXL 3U9OA 3A5UA 5C0XH 5M3MG 4HAEA 3W1BA 4GNXB 2G9DA 2I5HA 5A2QL 1HPCA 2F4VL 2RQXA 2I0QA 2PYKA 1LV9A 1AH9A 2FMCA 4DA2A 1CK1A 4BXXH 1RL2A 1TS4A 1MI2A 1HQRD 4X64Q 1ET9A 4DV0Q 1STNA 4JI3L 1E7ZA 3E3XA 5C44B 2HCIA 4AH6A 5CBEE 2N8NA 1XXGA 2M00A 3PIO3 4JBKA 1U5KA 5ELCA 3N52A 2WV6D 2O2LD 2WIIB 1K0RA 3CP0A 3OMCA 4O2DA 4A76A 3C3LA 2UXDQ 2Z9HA 2NVQH 1J9OA 2R3ZA 1EY0A 3HRZC 2DJGC 3FHWA 2JA6B 4ILWA 3BDLA 2E2DC 4WRDA 3E0EA 4DUZL 1S40A 3B6YA 2MPMA 4DNRB 1TT2A 1BBUA 4IURA 1YZ6A 4N9PA 4KV6A 4FO2A 2H1EA 4HJ5A 4DR7L 1FJGL 3S1NH 1CZWA 1I4QA 3RN2A 2C35B 3ER0A 3FKIG 5JOBA 1SE4A 4ABNA 1EQQA 3S17B 2QCPX 3HOXH 2IW3A 1PFBA 4MN3A 2IX1A 4OO1G 3EBEA 5IP9G 1YNJC 1EYCA 4GKKL 3NSWA 3DM3A 4Y52H 1RJTA 2QF7A 1IZ6A 2YTXA 2ZTEA 2PI2A 1I50H 3CXCA 3NP8A 2K01A 1KC8C 3A5ZB 3TSSA 2NZ1D 1TWFH 1UEBA 5HGQA 5EPJA 3CCQA 5IGGA 4HN7A 3BVGA 2R7DA 1Y69U 1NBWA 1PXUA 2Q2UA 2WAQE 1EY7A 1HA6A 2K5QA 4H02A 4A3JH 4A3DH 2JA8H 4DAPA 1Y1VB 1OTCA 1PTOH 2I46A 4JG2A 3S2HH 1SE2A 2AQ3B 2B2WA 2K52A 5KEEA 4C1NK 1KNEA 2J7ZA 1AZQA 1JOQA 5C0XI 1TWFB 2NN6G 1X3QA 4A3MG 3CC4A 1JE4A 1PTOC 1RODA 3LGJA 5EBCA 4YCUA 2SNSA 5A35A 3SK5A 5ELFA 1Q8IA 4A3JB 2R92G 2A68D 3I8ZA 1S5DD 3AFPA 2R7FA 1X56A 2IJ0A 3OPOA 3S2HB 2D2CC 1AE3A 2K7VA 4HIKA 1Q8KA 4O1NA 2FINB 4A3CH 2A5HA 5EPKA 3FVQA 4B9WA 2ZXOA 2X6GA 1I5FA 2ZTCA 1B53A 1S3OA 2ZJQA 2L0CA 1BBWA 2BE5D 2PI2E 3Q8DA 2KENA 1IBLL 2XSCA 5HURA 1JC7A 4JYAQ 5KNDA 5IT9L 3T56B 2B39A 1HRJA 1N9WA 2PMZE 5CV4A 1HNXQ 2F1MA 1RTNA 1SYDA 2OXPA 5LL6X 4GLVB 2N88A 3SE0A 4EQ5A 1SNDA 3HOVH 1DJRD 2NTSA 1GHJA 3VA5A 1CKMA 1TY2A 2F0JA 2WAQB 3AMUA 1VQOA 5M9OA 2IWHA 4JI5Q 4A3LH 3TZUA 2IL8A 1YNNC 1Q1BA 4TKOB 4I7AA 4JI4Q 1EWIA 5JVH3 4G57A 2NVXH 5IYCG 4X6AH 3NK9A 1FL0A 3OMGA 1EYGA 4TRDA 3HOVB 2NBFA 1AE2A 3I2ZA 2Z4IA 5LHY1 5ELBA 1Q82C 1STAA 1CHPD 1K28A 4JI7L 1CA5A 4I65A 4EQNA 5EAYA 3GTGH 1VMCA 2K32A 5M5XB 4Y7NH 3CU7A 2EQSA 2I5LX 2QEXA 5FO9B 1EFID 1EIFA 1PH2A 1E2WA 1E2ZA 3MXUA 2KHSA 4NPSA 1CT1D 3W5OA 2K14A 3K8AA 1BCPF 4CHTB 1EY4A 1XMQQ 4OELB 1NUCA 1MD2D 1SYEA 1P8LA 4PZ6A 1A8VA 3NEMA 2Y0SG 2L1BA 2F0EA 2MNAA 3AYHB 1U4LA 1G6PA 2LXJA 3KBXA 1PFSA 4G4KA 1RDPD 5IYBG 3GTGB 4WJ3M 4Y7NB 2B3GA 3RLNA 4A3IG 3UI2A 3AQQA 2DNEA 2UUBQ 2B2YA 1G51A 4CDEC 4JPBW 4K5VA 5KRUA 2Z8LA 4DR2L 2PMZB 3PUVA 3TS0A 4HCSA 1K73C 5D14A 2KEEA 3HOXG 1VQLA 1C8CA 3A8KE 4ZAIA 2B2WC 4DFAA 2H4OA 3L2PA 1K3BC 1Z6HA 3WWVA 2BH2A 4JI6L 2HT1A 5IGBA 1IBKQ 5AJ3Q 1IBML 1WTQA 2VB3X 3KJPA 1N34Q 4O0AA 4DAYB 2JEAI 1EWCA 5HGTA 1J5EL 1S72A 1JWSD 1X54A 5C4ZA 5G3LD 3T1HL 4J1MA 3BVMA 2CFMA 3TDQA 5K36G 4BA1I 4PNYA 1Y1WH 4IUUA 2PO4A 3D3RA 2IX3A 2ZM6L 2RHSB 2LXKA 3ITPA 4DKAC 2EDGA 3G4SA 2MGSA 1GVPA 3U4ZA 2K33A 4DV1Q 3M7NA 3I73A 4A3DG 4A93G 1MKHA 1I4GA 3D6CA 3TP6A 2K28A 4CBVA 2JA8G 2XWJB 1XPUA 4L8JA 4JI3Q 4LF9L 3ERSX 3CHBD 2HIVA 3QG1A 5CORA 3CC2A 5LMUL 4MTKA 1Y1WB 2EYHA 4JBMA 1ENFA 3TREA 4DNIA 1Q1EA 3GTJH 1JB7A 1Y14B 4GN4B 1S4ZA 4IPHA 4N8FA 3CCJA 2JP1A 2G5DA 4FNFA 1JJ2A 3J7A5 1BVSA 4X64L 2F0OA 3A0JA 4LF8Q 1JORA 4DV0L 1LT4D 4LK1C 1OO9B 2JE6I 1VDZA 3C1FA 2F0HA 3HOZH 4DR7Q 4GOPA 1HXYD 3GTJB 2NB0A 4OL7A 4BWGB 2IHFA 1YEZA 3F8TA 4FF3A 3FPPA 1GUNA 2AWNA 3CMAA 1V1PA 3MXGA 4KJNA 4IPCA 4BY7H 1JICA 3PUZA 1YI2A 4Z9CB 1VQEA 4IOCA 3GTOB 1M90C 2BDNA 4GKKQ 2VNUD 1H9RA 2Z6KA 5KGUA 3HOZB 1I6HH 2LY7A 3L7ZC 4LFBL 3PUXA 1SYFA 1KHIA 4KMUC 1KDAA 1QNKA 2CQAA 3D4DA 4DR6L 2EOTA 3AFQA 4UDUC 4JI1Q 4CGYB 1WTVA 1L0WA 4JBJA 1PH1A 5M5WB 2D0OA 2UU9Q 2BH8A 3CC7A 4BY7B 4XXEA 1WTWA 3H91A 4A4IA 1LT3D 1PA6A 2AQ1B 1CKOA 1GD7A 1HFGA 1TWCH 2J0TD 4LWCA 4C2MB 1PYBA 1KIXA 5F2DA 1H9JA 1UEAB 2K50A 2EYLA 4A3BG 4OWXB 1I6HB 1VMPA 4NW2A 3PV0A 2VB2X 1HUMA 1U4PA 1EEID 3Q0AA 3IKJA 4DXGA 4A3GH 4ZUIA 2B2YC 1EIGA 3G71A 1E3PA 4KD4A 1TWAB 1CKNB 2DJFC 1GUSA 2HD3A 1TWCB 4K5WA 3NQTA 1XJVA 4R4QA 5T1IA 2WKDA 4IO9A 1Q12A 4S3SA 3K5OA 2B63H 4A3FG 4HCEA 1XMOL 5EQ0A 1O7ZA 1WTPA 3EJIA 3I4MG 2F4IA 1I4HA 3HG9A 4FF1A 4GNXA 3GTKH 1C9OA 1C4QA 3SR1A 4OEMB 3ICEA 1ILPA 2PQEA 1LABA 5JJLA 3S1RH 2M9VA 3STBC 5C0XJ 1VS0A 3PIOA 1PFNA 1YJWA 4LF4L 5M3MB 4EX5A 2B63B 4LUOA 1YHAA 1EWHA 2EVBA 3DWAA 1CUKA 3DLLA 1TWHH 5IIFA 3GTKB 3HGBA 2PW7A 2WB1E 4NDXA 3HP3A 1NE3A 3S1RB 2WKCA 4KY6A 4NXML 4L5SA 4OGQC 1OXUA 4YHHL 1MGSA 1E22A 3EFXD 2YTYA 2YYZA 3QWNA 3NWTA 4OONA 4IUVA 1VQ8A 4C3IH 2RCFA 1KQSA 1Q3LA 1T5EA 1TWHB 4R4TA 4YWMA 1D2BA 2UXCQ 4JYAL 1ZEQX 2L11A 2VUMG 2QILA 1CSQA 3DUZA 3MEFA 3J7AF 2AQ2B 5EJWA 3J7AV 4CDCC 5EKKA 4GOPC 1J6QA 1MJCA 3W3AA 2E75C 1XNQL 4JI7Q 5DAUA 4TVAB 1WYDA 1QE6A 2CKZB 1CM9A 3K58A 1VQDA 5CMDA 3V2TA 4OIJA 4JI5L 2OEOA 2R7ZH 3O13A 5E4WC 3BZCA 4GN5A 1QVFA 2R93H 1L0XB 2GA4B 3SXHA 4JI4L 4LMQD 1SNMA 2Z6KC 4RHRA 1EZ6A 4AIMA 3K7AH 5IGFA 4A3EG 1KXLA 1LTRD 1I4RA 1PRTB 1IHZA 2EY5A 3DHQA 3H0GG 3A54A 3AU7A 2XWBB 4IUNA 3S16H 1GKHA 2Q8RE 1SDFA 2F0PA 3VDYA 3CQZH 4DR2Q 2R93B 3VR2A 5CV5A 4L5TA 2K5HA 2WB1B 4QGUA 2KCCA 3LWUA 1XMQL 5GAGC 1BUVT 5CV7A 3P1HA
chains in the Genus database with same CATH topology
1NBWA 2QGQA 4X65L 2WAQE 4DV3Q 3UDGA 2Q2UA 2D62A 2D0PA 3GTQH 4H02A 4P75A 4A3JH 1I94L 4A3DH 1E24A 3IRBA 2JA8H 4UPAA 1VQFA 2IY5B 1VQIA 1OTCA 4IFDJ 1Y1VG 5M3MH 4JG2A 3T1YL 5FJ8H 4LF5Q 3S2HH 2B29A 3A74A 4JI2L 2UUBL 1MIUA 2K52A 1XPRA 3BJUA 1PYSB 5C0XI 2VQFQ 2NN6G 4A3KH 4A3MG 2JJQA 3KOJA 3CC4A 2DGYA 5IY0A 4MNOA 1XPOA 2E2HH 1LTLA 4JI0Q 2A8VA 1HZBA 3LGJA 2VY3A 2I5MX 2HHHQ 4YCUA 2AMCB 2KCMA 5C4XG 4GNXC 2MO1A 2R92G 2ID0A 4LFAL 2CWAA 1VQ9A 3PGZA 4JC0A 3AFPA 4LF9Q 1HZCA 2R7FA 5AJ3L 1IBKL 4DV6L 1X56A 1QUQB 3CD6A 3G6EA 3W1GA 4B3SL 3GO5A 2EXDA 1N34L 2UUCL 2N49A 3RR5A 5C44H 1LYLA 3TEHB 1AE3A 4DUYQ 5GROA 4QQBX 1W3SA 1HNZL 4HIKA 1Q8KA 4GKJQ 4LUZA 4IJLA 5LMUQ 2F4VQ 1NY4A 2Q2HA 4A3CH 3I4OA 4A3GG 2OCEA 4AYBG 2VW9A 3U50C 2VUMH 1VQGA 3PO2G 2AKWB 1KRSA 1NMFA 1V43A 1OXTA 1SMXA 1HR0Q 1I5FA 4IPGA 2ZTCA 1Z47A 1TXYA 3PSIA 3HOUG 1S3OA 4DV1L 1RIPA 3K7UC 1WI5A 1EOVA 2ZJQA 4UP9A 4KHPQ 2JA6H 2HQLA 1XNRL 2NVTH 3KF8B 1EIYB 2VS1A 4UY8C 1YHBA 4LF6Q 4QL5A 1VCIA 1BBWA 2PI2E 3Q8DA 1SLJA 5LMNQ 2E5LL 2KENA 1IBLL 2ZTDA 2CQOA 2MO0A 3GTLH 4JYAQ 2R6GA 4P72A 1A0IA 5M3FH 4OO1I 1JJCB 3RLOA 4DR4Q 3OTOQ 4NB3A 1Y1WG 3CCRA 3UDXA 1N9WA 2PMZE 5H1SE 1HNXQ 5JEAJ 5ELOA 2XTIA 1X9NA 1UE6A 3J81c 3CCMA 3CCVA 3FKIH 4GLVB 1L2FA 2WFWA 4EQ5A 2DUDA 4OXPA 4APVA 3S17H 4MZ9A 3HOVH 1HJPA 3GDEA 4DUZQ 1QVGA 1CKMA 3TS2A 2BA1A 4A3EH 5IP9H 4X66Q 3H15A 4LF8L 1VQ6A 1SR3A 1VQOA 4DV4L 2Q2IA 1YHQA 1N36L 1JE5A 3FP9A 5IP7G 4HJAA 4LF7Q 2QA4A 5E7NA 1X6OA 3H0GH 1PH9A 4JI5Q 4A3LH 1FJGQ 4LFBQ 1UE7A 2JA7G 3H3VI 2JA5G 2K75A 1EQRA 4B3MQ 1Q1BA 4AYBE 5IWAL 3I55A 4DR6Q 5IT9c 2VZAA 2PQAA 4JI4Q 1BKBA 1EWIA 2NVYH 4LUVA 2UXDL 2NVXH 1PVOA 3D31A 5IYCG 1KD1C 4HJ7A 4X6AH 3S24A 1FL0A 1EYGA 1OXSC 1HZAA 2H5XA 1Z9FA 2CCZA 3I2ZA 1AE2A 4YWLA 3ZJYC 4JOIA 1L1OC 4DV7Q 1Q82C 3HKSA 3PF5A 3JAMi 3S1MH 3H3VH 4JI7L 2UXBL 1WJJA 1K8AC 1N32L 2Q2TA 3HOYG 5EAYA 1HR0W 3GTGH 4DV2L 4Y7NH 1Y1VH 5GAEC 4PZ8A 3HOZG 4JBWA 2KCTA 1XTDA 4DR3Q 2EQSA 1JT8A 3F1ZA 4HJ9A 1L1OB 2I5LX 2PQAB 2QEXA 2KHJA 1YITA 1EIFA 1PH2A 4JI8L 4NPSA 2BA0A 3W5OA 2K14A 4DR1L 3K8AA 5LMNW 3NELA 4BA2I 4A3MH 3PCOB 1XMQQ 3CW2C 4JI1L 1LUZA 1K3RA 4X62Q 1M1KC 4LNQA 3U58A 2YU9H 2UU9L 1P8LA 4PZ6A 1A8VA 3CCLA 2NZHA 3NEMA 2Y0SG 5C4XH 4X65Q 4BY7G 1VQAA 4OWTB 2MNAA 4IFDI 1A63A 4POFA 3AYHB 1G6PA 2R92H 1VQHA 1B8AA 2LXJA 3KF6A 1PFSA 1PH7A 4BY1H 2N3SA 1T9HA 5IYBG 1PV4A 4WJ3M 4FDBA 1XMOQ 1PH6A 2B3GA 5C4JH 3RLNA 4A3IG 1HH2P 3AQQA 4LFCL 4JI2Q 1GM5A 2UUBQ 4PZ7A 2R7ZG 2Z0SA 1NMGA 1G51A 2UUAL 4B3RL 5IE8A 2XGTA 5IYDH 3M4OH 1UWVA 3K0XA 4DR2L 4OX9Q 3CAMA 1X3GA 3PUVA 3TS0A 4B3TL 4UP7A 1K73C 3SGIA 3HOXG 1VQLA 4K0KQ 4GLXA 3PF4A 3UDFA 3L2PA 3WWVA 3KF6B 4DPGA 1D8LA 2BH2A 1ASZA 4LFAQ 4JI6L 1YNXA 4BBSG 1SRUA 2HT1A 1HNWL 1IBKQ 2OWOA 5AJ3Q 3HOUH 4DV6Q 1IBML 4LF4Q 1N33L 4RG1A 3KJPA 5BR8Q 1N34Q 1X3FA 2UUCQ 4O0AA 4DAYB 2JEAI 4QIWE 3J80c 3KFUA 1J5EL 1S72A 1HNZQ 4LF5L 1P16A 1X54A 3T1HL 2PNHA 1Q46A 4IPDA 1D7QA 2CFMA 2NZOA 3E9IA 5K36G 4BA1I 1KL9A 1Y1WH 5C3EG 1WCMG 1PH3A 3L0OA 4HIOA 3F2DA 2ZM6L 1EFWA 3J7ZC 2RHSB 2LXKA 4DKAC 4NXMQ 2Y0SE 3PIPA 2HHHL 2MQHA 3G4SA 3G48A 1JJGA 1GVPA 2VL6A 3U4ZA 4DV1Q 4YHHQ 3M7NA 1PH8A 2E2IH 4A3DG 4A93G 1MKHA 2HIXA 1SE8A 3KDFA 4YCWA 1FGUA 1B70B 2JA8G 4DV5L 1XPUA 4LF9L 4JI3Q 2OQKA 3ERSX 2B63G 4C3JH 3CPFA 2HIVA 3F2CA 3S15H 1VQ7A 2E5LQ 4IOAA 1IBLQ 1PHJA 3ULJA 1K9MC 2OTJA 5IP7H 3EN2A 1VQJA 1NTGA 1MJEA 4RMFA 2L15A 3CC2A 3KLWA 5LMUL 2JA5H 4OWWB 1Q81C 4JBMA 3TREA 4DNIA 2F3IA 1Q1EA 3GTJH 3J81j 3CF5A 1JB7A 4HIMA 1Y14B 4A75A 3PO3G 4GN4B 3RNUA 4YCVA 3ULPA 1V1QA 4IPHA 3UE0A 5IYCH 1ASYA 3CCJA 4GLAC 1VQMA 3HOWH 1YVCA 2GVAA 4YY3L 1JJ2A 1BVSA 1XNQQ 3J7A5 4X64L 4KHPL 3CCUA 3A0JA 5C0XG 5ELNA 1W2BA 4LF8Q 5C44G 4DV0L 4DV4Q 1N36Q 2E2JH 3K80C 4J15A 2JE6I 3HOYH 5M5YH 1C0AA 3HOZH 5M5XH 3TQYA 4DR7Q 4GOPA 4R4CA 4DR5L 1VQKA 2UXCL 4KLKA 1WOCA 4R4IA 1NJIC 1HNXL 4JCVE 2IHFA 1YEZA 2ALYB 4R4OA 3U4VA 1YJNA 1SN8A 4BXXG 3F8TA 2OTLA 1UE1A 3M9BA 4P73A 2AWNA 1YJ9A 2FXQA 3CMAA 2WP8J 1U0LA 3D0FA 4IPCA 4BY7H 2JA6G 3PUZA 1YI2A 3NBHB 4YWKA 4GN3B 4MTNA 1OXXK 1Q86C 2UXBQ 1VQEA 1N32Q 4HJ8A 2NN6I 4IOCA 4X66L 3F2BA 1M90C 1VQNA 2ZJPA 1YIJA 4GOPB 4GKKQ 5IYBH 2VQEQ 3I7FA 2VNUD 3UE1A 2Z6KA 4LF7L 4A3IH 1I6HH 3L7ZC 2AWOA 4JI8Q 1K8GA 4LFBL 3PUXA 4PG3A 3I4NG 1KHIA 1X3EA 4L5RC 4P74A 4DR6L 3GTPH 3S1QH 3AFQA 4JI1Q 1VQ4A 2A19A 1L0WA 4JBJA 1PH1A 2YV5A 2D0OA 5JEAG 2UU9Q 4NXNL 3HKZG 3KYHC 2LSSA 3GD7A 3OYYA 2BH8A 3CC7A 1PH5A 5JJIA 1SROA 3M4PA 4KI0A 1PA6A 4A4IA 1I94Q 2AHOB 2IT1A 1CKOA 1GD7A 1TWCH 4LWCA 1Q7YC 1KIXA 1CKNA 1PYBA 2K5NA 4L5QA 2K50A 3RN5A 2IX0A 5GAHC 1R9TH 3STBD 4LW1A 4A3BG 4OWXB 3T1YQ 1JMCA 4JV5L 5FLMG 1IXRA 4AQYL 4KHZA 2UUAQ 4B3RQ 2A1AA 2CWPA 2ATWA 1X55A 2IHEA 1VQ5A 3PV0A 1KRTA 3J80i 2JQOA 3RZDH 4B3TQ 2R93G 2F52A 2K5VA 3NENA 5C3EH 1WCMH 4A3GH 2WB1G 4QY7A 1CSPA 4BBRG 3CMEA 3PO2H 3CCSA 3G71A 1E3PA 2OQ0A 1HNWQ 4JI6Q 1CKNB 1IBMQ 1N33Q 4A93H 1YBYA 4DV3L 2KHIA 1XJVA 4GKJL 4R4QA 4IO9A 4GS3A 1Q12A 4B3SQ 4DAMA 2B63H 4A3FG 3AEVA 1XMOL 1J5EQ 3CPWA 3CCEA 2YTVA 1QUQA 4TQUS 3HFZB 3T1HQ 3I4MG 3RZOH 4GNXA 3GTKH 1KAWA 1HZ9A 4DK6C 3E9HA 1C9OA 3MXNB 3ULLA 4OX9L 3ICEA 4R1JA 2ZM6Q 1B7YB 2VQFL 5JJLA 3HKZE 2JEBI 1C7YA 4JI0L 3PO3H 3S1RH 4K0KL 2RHQB 4UP8A 3STBC 4XIGS 5C0XJ 2KBNA 3PUYA 1V9PA 3J81i 4DV5Q 2JK8A 1VS0A 2MFIA 4BY1G 3PIOA 1IYJB 4HIDA 3OW2A 1QVCA 4A3JG 1YJWA 2RF4A 4LF4L 1XNRQ 4QJFA 3S2DH 3I56A 2EIFA 4EX5A 5BR8L 3A5UA 4LUOA 5M3MG 3M4QA 3UDIA 3W1BA 5FJ8G 1YHAA 4GNXB 3DLLA 1CUKA 1G291 2I5HA 4DUYL 1TWHH 5IYDG 3M3YH 1GO3E 4IFDG 1EUJA 2JA7H 4A3KG 2F4VL 2WB1E 3BU2A 3KJOA 2I0QA 1NE3A 1AH9A 4WJ4A 1OXVA 4NXML 1FVIA 3KDFB 4BXXH 4L5SA 1RL2A 2K4KA 1HR0L 1OXUA 4YY3Q 4YHHL 4XTCS 4X64Q 1E22A 4DV0Q 4PMWA 4JI3L 2YTYA 1E7ZA 2YYZA 4OONA 3M85A 4AH6A 4DK3C 4C3IH 1VQ8A 3GTOH 1SFOH 4LF6L 1KQSA 2N8NA 5FLXc 5LMNL 4YWMA 4R4TA 3S14H 4DR5Q 2UXCQ 4JBKA 2N78A 1U5KA 2JA9A 4JYAL 2GVBA 1VQPA 3I4NH 1QZHA 4A3CG 5IWAQ 1UE5A 4DR4L 3OTOL 5GQOA 1VQCA 4O2DA 1K0RA 3CP0A 4A76A 2VUMG 2UXDQ 1CSQA 3MEFA 3RLFA 2NVQH 2V1CC 2ASBA 1DGSA 5M5WH 4GOPC 1TWGH 2ZJRA 3TRZA 1J6QA 1MJCA 3FHWA 5DLQE 1I3QH 1XNQL 3JC66 4JI7Q 3E0EA 2WAQG 4ME3A 4DUZL 4POGA 4TVAB 1WYDA 2CKZB 3B6YA 4IJHA 4C2MH 5GADC 1S40A 4DV2Q 1BBUA 1VQDA 4A3BH 1YZ6A 5FLMH 5M3FG 4JI5L 4HJ5A 4DR7L 2R7ZH 1FJGL 3S1NH 4JOIC 1QZGA 1L1OA 3BZCA 3RN2A 2C35B 4GN5A 4DR1Q 1PH4A 4B3ML 3GTMH 3ER0A 1QVFA 2R93H 2GN5A 1VQBA 4JI4L 3FKIG 4NXNQ 2Z6KC 1EQQA 3K81C 3HOWG 2E8GA 3HOXH 4BBRH 3EIVA 3HOVG 4AIMA 2IX1A 4OO1G 3K7AH 1TWAH 1E1TA 4P71A 4BBSH 3EBEA 5JJKA 4DV7L 5IP9G 3BZKA 4A3EG 1KXLA 2ES2A 1IL2A 2RCNA 4ALPA 4GKKL 4JV5Q 3DM3A 2VQEL 4A3FH 4AQYQ 4Y52H 3H0GG 1X65A 4A3LG 1O7IA 1IZ6A 1WFQA 2YTXA 2ZTEA 4LFCQ 1N8RC 3S16H 4DR3L 3I4MH 1GKHA 2PI2A 1I50H 3CXCA 3VDYA 1E1OA 3CQZH 4DR2Q 1KC8C 1LM0A 3A5ZB 5HY6A 1A62A 4C3HH 4L5TA 1TWFH 1UEBA 2K5HA 3PUWA 5HGQA 4QGUA 3JAMc 1K83H 1XMQL 5GAGC 3CCQA 5J3BA 4X62L 2R7DA 1H95A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NBW A;  2QGQ A;  4X65 L;  2WAQ E;  4DV3 Q;  3UDG A;  2Q2U A;  2D62 A;  2D0P A;  3GTQ H;  4H02 A;  4P75 A;  4A3J H;  1I94 L;  4A3D H;  1E24 A;  3IRB A;  2JA8 H;  4UPA A;  1VQF A;  2IY5 B;  1VQI A;  1OTC A;  4IFD J;  1Y1V G;  5M3M H;  4JG2 A;  3T1Y L;  5FJ8 H;  4LF5 Q;  3S2H H;  2B29 A;  3A74 A;  4JI2 L;  2UUB L;  1MIU A;  2K52 A;  1XPR A;  3BJU A;  1PYS B;  5C0X I;  2VQF Q;  2NN6 G;  4A3K H;  4A3M G;  2JJQ A;  3KOJ A;  3CC4 A;  2DGY A;  5IY0 A;  4MNO A;  1XPO A;  2E2H H;  1LTL A;  4JI0 Q;  2A8V A;  1HZB A;  3LGJ A;  2VY3 A;  2I5M X;  2HHH Q;  4YCU A;  2AMC B;  2KCM A;  5C4X G;  4GNX C;  2MO1 A;  2R92 G;  2ID0 A;  4LFA L;  2CWA A;  1VQ9 A;  3PGZ A;  4JC0 A;  3AFP A;  4LF9 Q;  1HZC A;  2R7F A;  5AJ3 L;  1IBK L;  4DV6 L;  1X56 A;  1QUQ B;  3CD6 A;  3G6E A;  3W1G A;  4B3S L;  3GO5 A;  2EXD A;  1N34 L;  2UUC L;  2N49 A;  3RR5 A;  5C44 H;  1LYL A;  3TEH B;  1AE3 A;  4DUY Q;  5GRO A;  4QQB X;  1W3S A;  1HNZ L;  4HIK A;  1Q8K A;  4GKJ Q;  4LUZ A;  4IJL A;  5LMU Q;  2F4V Q;  1NY4 A;  2Q2H A;  4A3C H;  3I4O A;  4A3G G;  2OCE A;  4AYB G;  2VW9 A;  3U50 C;  2VUM H;  1VQG A;  3PO2 G;  2AKW B;  1KRS A;  1NMF A;  1V43 A;  1OXT A;  1SMX A;  1HR0 Q;  1I5F A;  4IPG A;  2ZTC A;  1Z47 A;  1TXY A;  3PSI A;  3HOU G;  1S3O A;  4DV1 L;  1RIP A;  3K7U C;  1WI5 A;  1EOV A;  2ZJQ A;  4UP9 A;  4KHP Q;  2JA6 H;  2HQL A;  1XNR L;  2NVT H;  3KF8 B;  1EIY B;  2VS1 A;  4UY8 C;  1YHB A;  4LF6 Q;  4QL5 A;  1VCI A;  1BBW A;  2PI2 E;  3Q8D A;  1SLJ A;  5LMN Q;  2E5L L;  2KEN A;  1IBL L;  2ZTD A;  2CQO A;  2MO0 A;  3GTL H;  4JYA Q;  2R6G A;  4P72 A;  1A0I A;  5M3F H;  4OO1 I;  1JJC B;  3RLO A;  4DR4 Q;  3OTO Q;  4NB3 A;  1Y1W G;  3CCR A;  3UDX A;  1N9W A;  2PMZ E;  5H1S E;  1HNX Q;  5JEA J;  5ELO A;  2XTI A;  1X9N A;  1UE6 A;  3J81 c;  3CCM A;  3CCV A;  3FKI H;  4GLV B;  1L2F A;  2WFW A;  4EQ5 A;  2DUD A;  4OXP A;  4APV A;  3S17 H;  4MZ9 A;  3HOV H;  1HJP A;  3GDE A;  4DUZ Q;  1QVG A;  1CKM A;  3TS2 A;  2BA1 A;  4A3E H;  5IP9 H;  4X66 Q;  3H15 A;  4LF8 L;  1VQ6 A;  1SR3 A;  1VQO A;  4DV4 L;  2Q2I A;  1YHQ A;  1N36 L;  1JE5 A;  3FP9 A;  5IP7 G;  4HJA A;  4LF7 Q;  2QA4 A;  5E7N A;  1X6O A;  3H0G H;  1PH9 A;  4JI5 Q;  4A3L H;  1FJG Q;  4LFB Q;  1UE7 A;  2JA7 G;  3H3V I;  2JA5 G;  2K75 A;  1EQR A;  4B3M Q;  1Q1B A;  4AYB E;  5IWA L;  3I55 A;  4DR6 Q;  5IT9 c;  2VZA A;  2PQA A;  4JI4 Q;  1BKB A;  1EWI A;  2NVY H;  4LUV A;  2UXD L;  2NVX H;  1PVO A;  3D31 A;  5IYC G;  1KD1 C;  4HJ7 A;  4X6A H;  3S24 A;  1FL0 A;  1EYG A;  1OXS C;  1HZA A;  2H5X A;  1Z9F A;  2CCZ A;  3I2Z A;  1AE2 A;  4YWL A;  3ZJY C;  4JOI A;  1L1O C;  4DV7 Q;  1Q82 C;  3HKS A;  3PF5 A;  3JAM i;  3S1M H;  3H3V H;  4JI7 L;  2UXB L;  1WJJ A;  1K8A C;  1N32 L;  2Q2T A;  3HOY G;  5EAY A;  1HR0 W;  3GTG H;  4DV2 L;  4Y7N H;  1Y1V H;  5GAE C;  4PZ8 A;  3HOZ G;  4JBW A;  2KCT A;  1XTD A;  4DR3 Q;  2EQS A;  1JT8 A;  3F1Z A;  4HJ9 A;  1L1O B;  2I5L X;  2PQA B;  2QEX A;  2KHJ A;  1YIT A;  1EIF A;  1PH2 A;  4JI8 L;  4NPS A;  2BA0 A;  3W5O A;  2K14 A;  4DR1 L;  3K8A A;  5LMN W;  3NEL A;  4BA2 I;  4A3M H;  3PCO B;  1XMQ Q;  3CW2 C;  4JI1 L;  1LUZ A;  1K3R A;  4X62 Q;  1M1K C;  4LNQ A;  3U58 A;  2YU9 H;  2UU9 L;  1P8L A;  4PZ6 A;  1A8V A;  3CCL A;  2NZH A;  3NEM A;  2Y0S G;  5C4X H;  4X65 Q;  4BY7 G;  1VQA A;  4OWT B;  2MNA A;  4IFD I;  1A63 A;  4POF A;  3AYH B;  1G6P A;  2R92 H;  1VQH A;  1B8A A;  2LXJ A;  3KF6 A;  1PFS A;  1PH7 A;  4BY1 H;  2N3S A;  1T9H A;  5IYB G;  1PV4 A;  4WJ3 M;  4FDB A;  1XMO Q;  1PH6 A;  2B3G A;  5C4J H;  3RLN A;  4A3I G;  1HH2 P;  3AQQ A;  4LFC L;  4JI2 Q;  1GM5 A;  2UUB Q;  4PZ7 A;  2R7Z G;  2Z0S A;  1NMG A;  1G51 A;  2UUA L;  4B3R L;  5IE8 A;  2XGT A;  5IYD H;  3M4O H;  1UWV A;  3K0X A;  4DR2 L;  4OX9 Q;  3CAM A;  1X3G A;  3PUV A;  3TS0 A;  4B3T L;  4UP7 A;  1K73 C;  3SGI A;  3HOX G;  1VQL A;  4K0K Q;  4GLX A;  3PF4 A;  3UDF A;  3L2P A;  3WWV A;  3KF6 B;  4DPG A;  1D8L A;  2BH2 A;  1ASZ A;  4LFA Q;  4JI6 L;  1YNX A;  4BBS G;  1SRU A;  2HT1 A;  1HNW L;  1IBK Q;  2OWO A;  5AJ3 Q;  3HOU H;  4DV6 Q;  1IBM L;  4LF4 Q;  1N33 L;  4RG1 A;  3KJP A;  5BR8 Q;  1N34 Q;  1X3F A;  2UUC Q;  4O0A A;  4DAY B;  2JEA I;  4QIW E;  3J80 c;  3KFU A;  1J5E L;  1S72 A;  1HNZ Q;  4LF5 L;  1P16 A;  1X54 A;  3T1H L;  2PNH A;  1Q46 A;  4IPD A;  1D7Q A;  2CFM A;  2NZO A;  3E9I A;  5K36 G;  4BA1 I;  1KL9 A;  1Y1W H;  5C3E G;  1WCM G;  1PH3 A;  3L0O A;  4HIO A;  3F2D A;  2ZM6 L;  1EFW A;  3J7Z C;  2RHS B;  2LXK A;  4DKA C;  4NXM Q;  2Y0S E;  3PIP A;  2HHH L;  2MQH A;  3G4S A;  3G48 A;  1JJG A;  1GVP A;  2VL6 A;  3U4Z A;  4DV1 Q;  4YHH Q;  3M7N A;  1PH8 A;  2E2I H;  4A3D G;  4A93 G;  1MKH A;  2HIX A;  1SE8 A;  3KDF A;  4YCW A;  1FGU A;  1B70 B;  2JA8 G;  4DV5 L;  1XPU A;  4LF9 L;  4JI3 Q;  2OQK A;  3ERS X;  2B63 G;  4C3J H;  3CPF A;  2HIV A;  3F2C A;  3S15 H;  1VQ7 A;  2E5L Q;  4IOA A;  1IBL Q;  1PHJ A;  3ULJ A;  1K9M C;  2OTJ A;  5IP7 H;  3EN2 A;  1VQJ A;  1NTG A;  1MJE A;  4RMF A;  2L15 A;  3CC2 A;  3KLW A;  5LMU L;  2JA5 H;  4OWW B;  1Q81 C;  4JBM A;  3TRE A;  4DNI A;  2F3I A;  1Q1E A;  3GTJ H;  3J81 j;  3CF5 A;  1JB7 A;  4HIM A;  1Y14 B;  4A75 A;  3PO3 G;  4GN4 B;  3RNU A;  4YCV A;  3ULP A;  1V1Q A;  4IPH A;  3UE0 A;  5IYC H;  1ASY A;  3CCJ A;  4GLA C;  1VQM A;  3HOW H;  1YVC A;  2GVA A;  4YY3 L;  1JJ2 A;  1BVS A;  1XNQ Q;  3J7A 5;  4X64 L;  4KHP L;  3CCU A;  3A0J A;  5C0X G;  5ELN A;  1W2B A;  4LF8 Q;  5C44 G;  4DV0 L;  4DV4 Q;  1N36 Q;  2E2J H;  3K80 C;  4J15 A;  2JE6 I;  3HOY H;  5M5Y H;  1C0A A;  3HOZ H;  5M5X H;  3TQY A;  4DR7 Q;  4GOP A;  4R4C A;  4DR5 L;  1VQK A;  2UXC L;  4KLK A;  1WOC A;  4R4I A;  1NJI C;  1HNX L;  4JCV E;  2IHF A;  1YEZ A;  2ALY B;  4R4O A;  3U4V A;  1YJN A;  1SN8 A;  4BXX G;  3F8T A;  2OTL A;  1UE1 A;  3M9B A;  4P73 A;  2AWN A;  1YJ9 A;  2FXQ A;  3CMA A;  2WP8 J;  1U0L A;  3D0F A;  4IPC A;  4BY7 H;  2JA6 G;  3PUZ A;  1YI2 A;  3NBH B;  4YWK A;  4GN3 B;  4MTN A;  1OXX K;  1Q86 C;  2UXB Q;  1VQE A;  1N32 Q;  4HJ8 A;  2NN6 I;  4IOC A;  4X66 L;  3F2B A;  1M90 C;  1VQN A;  2ZJP A;  1YIJ A;  4GOP B;  4GKK Q;  5IYB H;  2VQE Q;  3I7F A;  2VNU D;  3UE1 A;  2Z6K A;  4LF7 L;  4A3I H;  1I6H H;  3L7Z C;  2AWO A;  4JI8 Q;  1K8G A;  4LFB L;  3PUX A;  4PG3 A;  3I4N G;  1KHI A;  1X3E A;  4L5R C;  4P74 A;  4DR6 L;  3GTP H;  3S1Q H;  3AFQ A;  4JI1 Q;  1VQ4 A;  2A19 A;  1L0W A;  4JBJ A;  1PH1 A;  2YV5 A;  2D0O A;  5JEA G;  2UU9 Q;  4NXN L;  3HKZ G;  3KYH C;  2LSS A;  3GD7 A;  3OYY A;  2BH8 A;  3CC7 A;  1PH5 A;  5JJI A;  1SRO A;  3M4P A;  4KI0 A;  1PA6 A;  4A4I A;  1I94 Q;  2AHO B;  2IT1 A;  1CKO A;  1GD7 A;  1TWC H;  4LWC A;  1Q7Y C;  1KIX A;  1CKN A;  1PYB A;  2K5N A;  4L5Q A;  2K50 A;  3RN5 A;  2IX0 A;  5GAH C;  1R9T H;  3STB D;  4LW1 A;  4A3B G;  4OWX B;  3T1Y Q;  1JMC A;  4JV5 L;  5FLM G;  1IXR A;  4AQY L;  4KHZ A;  2UUA Q;  4B3R Q;  2A1A A;  2CWP A;  2ATW A;  1X55 A;  2IHE A;  1VQ5 A;  3PV0 A;  1KRT A;  3J80 i;  2JQO A;  3RZD H;  4B3T Q;  2R93 G;  2F52 A;  2K5V A;  3NEN A;  5C3E H;  1WCM H;  4A3G H;  2WB1 G;  4QY7 A;  1CSP A;  4BBR G;  3CME A;  3PO2 H;  3CCS A;  3G71 A;  1E3P A;  2OQ0 A;  1HNW Q;  4JI6 Q;  1CKN B;  1IBM Q;  1N33 Q;  4A93 H;  1YBY A;  4DV3 L;  2KHI A;  1XJV A;  4GKJ L;  4R4Q A;  4IO9 A;  4GS3 A;  1Q12 A;  4B3S Q;  4DAM A;  2B63 H;  4A3F G;  3AEV A;  1XMO L;  1J5E Q;  3CPW A;  3CCE A;  2YTV A;  1QUQ A;  4TQU S;  3HFZ B;  3T1H Q;  3I4M G;  3RZO H;  4GNX A;  3GTK H;  1KAW A;  1HZ9 A;  4DK6 C;  3E9H A;  1C9O A;  3MXN B;  3ULL A;  4OX9 L;  3ICE A;  4R1J A;  2ZM6 Q;  1B7Y B;  2VQF L;  5JJL A;  3HKZ E;  2JEB I;  1C7Y A;  4JI0 L;  3PO3 H;  3S1R H;  4K0K L;  2RHQ B;  4UP8 A;  3STB C;  4XIG S;  5C0X J;  2KBN A;  3PUY A;  1V9P A;  3J81 i;  4DV5 Q;  2JK8 A;  1VS0 A;  2MFI A;  4BY1 G;  3PIO A;  1IYJ B;  4HID A;  3OW2 A;  1QVC A;  4A3J G;  1YJW A;  2RF4 A;  4LF4 L;  1XNR Q;  4QJF A;  3S2D H;  3I56 A;  2EIF A;  4EX5 A;  5BR8 L;  3A5U A;  4LUO A;  5M3M G;  3M4Q A;  3UDI A;  3W1B A;  5FJ8 G;  1YHA A;  4GNX B;  3DLL A;  1CUK A;  1G29 1;  2I5H A;  4DUY L;  1TWH H;  5IYD G;  3M3Y H;  1GO3 E;  4IFD G;  1EUJ A;  2JA7 H;  4A3K G;  2F4V L;  2WB1 E;  3BU2 A;  3KJO A;  2I0Q A;  1NE3 A;  1AH9 A;  4WJ4 A;  1OXV A;  4NXM L;  1FVI A;  3KDF B;  4BXX H;  4L5S A;  1RL2 A;  2K4K A;  1HR0 L;  1OXU A;  4YY3 Q;  4YHH L;  4XTC S;  4X64 Q;  1E22 A;  4DV0 Q;  4PMW A;  4JI3 L;  2YTY A;  1E7Z A;  2YYZ A;  4OON A;  3M85 A;  4AH6 A;  4DK3 C;  4C3I H;  1VQ8 A;  3GTO H;  1SFO H;  4LF6 L;  1KQS A;  2N8N A;  5FLX c;  5LMN L;  4YWM A;  4R4T A;  3S14 H;  4DR5 Q;  2UXC Q;  4JBK A;  2N78 A;  1U5K A;  2JA9 A;  4JYA L;  2GVB A;  1VQP A;  3I4N H;  1QZH A;  4A3C G;  5IWA Q;  1UE5 A;  4DR4 L;  3OTO L;  5GQO A;  1VQC A;  4O2D A;  1K0R A;  3CP0 A;  4A76 A;  2VUM G;  2UXD Q;  1CSQ A;  3MEF A;  3RLF A;  2NVQ H;  2V1C C;  2ASB A;  1DGS A;  5M5W H;  4GOP C;  1TWG H;  2ZJR A;  3TRZ A;  1J6Q A;  1MJC A;  3FHW A;  5DLQ E;  1I3Q H;  1XNQ L;  3JC6 6;  4JI7 Q;  3E0E A;  2WAQ G;  4ME3 A;  4DUZ L;  4POG A;  4TVA B;  1WYD A;  2CKZ B;  3B6Y A;  4IJH A;  4C2M H;  5GAD C;  1S40 A;  4DV2 Q;  1BBU A;  1VQD A;  4A3B H;  1YZ6 A;  5FLM H;  5M3F G;  4JI5 L;  4HJ5 A;  4DR7 L;  2R7Z H;  1FJG L;  3S1N H;  4JOI C;  1QZG A;  1L1O A;  3BZC A;  3RN2 A;  2C35 B;  4GN5 A;  4DR1 Q;  1PH4 A;  4B3M L;  3GTM H;  3ER0 A;  1QVF A;  2R93 H;  2GN5 A;  1VQB A;  4JI4 L;  3FKI G;  4NXN Q;  2Z6K C;  1EQQ A;  3K81 C;  3HOW G;  2E8G A;  3HOX H;  4BBR H;  3EIV A;  3HOV G;  4AIM A;  2IX1 A;  4OO1 G;  3K7A H;  1TWA H;  1E1T A;  4P71 A;  4BBS H;  3EBE A;  5JJK A;  4DV7 L;  5IP9 G;  3BZK A;  4A3E G;  1KXL A;  2ES2 A;  1IL2 A;  2RCN A;  4ALP A;  4GKK L;  4JV5 Q;  3DM3 A;  2VQE L;  4A3F H;  4AQY Q;  4Y52 H;  3H0G G;  1X65 A;  4A3L G;  1O7I A;  1IZ6 A;  1WFQ A;  2YTX A;  2ZTE A;  4LFC Q;  1N8R C;  3S16 H;  4DR3 L;  3I4M H;  1GKH A;  2PI2 A;  1I50 H;  3CXC A;  3VDY A;  1E1O A;  3CQZ H;  4DR2 Q;  1KC8 C;  1LM0 A;  3A5Z B;  5HY6 A;  1A62 A;  4C3H H;  4L5T A;  1TWF H;  1UEB A;  2K5H A;  3PUW A;  5HGQ A;  4QGU A;  3JAM c;  1K83 H;  1XMQ L;  5GAG C;  3CCQ A;  5J3B A;  4X62 L;  2R7D A;  1H95 A; 
#chains in the Genus database with same CATH topology
 2QW7 A;  3K7A B;  3UDG A;  3GTQ H;  3TP7 A;  3IRB A;  2IY5 B;  1VQI A;  1EEF D;  1M8A A;  3VR5 A;  5FJ8 H;  1QG7 A;  5JPN C;  2UUB L;  4IFD H;  3CQZ B;  2HDM A;  3U9S A;  1W6J A;  1PYS B;  3BS1 A;  4A3K H;  3TP5 A;  2FJ2 A;  2E2H H;  4JI0 Q;  1LTL A;  2YU9 B;  3JAM E;  3T13 A;  4H0L C;  2CVR A;  4GNX C;  3OWF A;  3K6O A;  5K5P A;  2R92 B;  5CV6 A;  4BY1 B;  2ID0 A;  4JC0 A;  4LF9 Q;  1IBK L;  5AJ3 L;  2CH4 A;  5C4J B;  1A3U A;  4HED A;  3G6E A;  2EY6 A;  4B3S L;  1PZJ D;  4IN3 A;  1N34 L;  1STE A;  2N49 A;  3RR5 A;  5C44 H;  1LYL A;  4DUY Q;  5D3I B;  2F3W A;  4LUZ A;  4IJL A;  5LMU Q;  3R8B A;  2Q2H A;  1QNU A;  2N55 A;  4A3K B;  3I4O A;  4A3G G;  5I4D A;  2E2H B;  5G3L F;  3DWQ A;  2AKW B;  1NMF A;  1V43 A;  2D9U A;  4KN4 C;  1SMX A;  1TKW B;  1TXY A;  1STB A;  4XDX A;  3HOU G;  4DV1 L;  2EZV A;  3QOL A;  1WI5 A;  1EOV A;  2JA6 H;  3KUP A;  4O42 A;  1XNR L;  2NVT H;  4RGT A;  1WTX A;  5LMN Q;  2ZTD A;  2MO0 A;  4P72 A;  1S5C D;  5IGD A;  5M3F H;  4OO1 I;  4DR4 Q;  3OTO Q;  3CCR A;  3UDX A;  2BCO A;  2XTI A;  4HR7 B;  3EQL C;  4M1U B;  3MEH A;  3ONA B;  1L2F A;  5JEA H;  3S17 H;  4DK1 A;  3K5M A;  2NVT B;  4C3J B;  3GDE A;  1DXM A;  4LF8 L;  1VQ6 A;  1SR3 A;  2Q2I A;  4F8M A;  4HJA A;  4CJ0 B;  5E7N A;  2JN4 A;  5M3F B;  3C2P A;  4LFB Q;  3W2D A;  1UE7 A;  3H3V I;  2K75 A;  1U4R A;  4AYB E;  5IWA L;  4DR6 Q;  2VZA A;  3J81 E;  1SAP A;  2A6E D;  1GOZ A;  2K03 A;  3HOW B;  4RH6 A;  2H5X A;  4JOI A;  1H9K A;  2CH4 W;  4ZYS A;  3Q23 A;  3S1M H;  2L4N A;  1STH A;  4FXK C;  1SE3 A;  4C3I G;  5M5Y B;  2Q2T A;  3HOY G;  2K1B A;  2VXW A;  1Y1V H;  5C6A A;  4PZ8 A;  4JBW A;  3F1Z A;  4RKB A;  2PQA B;  4DR1 L;  1NNX A;  5LMN W;  5C5L A;  4BA2 I;  3PCO B;  3CW2 C;  2RSO A;  4JI1 L;  3DEP A;  4WOR A;  4LNQ A;  3PMF A;  2UU9 L;  1G91 A;  5I9O A;  3NHH A;  5C4X H;  1M4V A;  4IFD I;  1VQA A;  1A63 A;  2MP1 A;  3S1M B;  3Q6S A;  4DGZ A;  4UAI A;  5CV9 A;  4NKL A;  1SYC A;  4FDB A;  1XMO Q;  1I4X A;  4PMB A;  3SVM A;  3BG3 A;  1LO5 D;  4F88 A;  5L37 A;  1HH2 P;  1PTO F;  4JI2 Q;  2R7Z G;  1MSG A;  4PZ7 A;  4DAY A;  1NMG A;  4KD3 A;  5EPL A;  3GTP B;  2XGT A;  4JK1 C;  5IYD H;  1UWV A;  3R93 A;  3FDT A;  3BDO A;  5C4X B;  4ZKC B;  3KF6 B;  1D8L A;  1ASZ A;  2EXZ A;  4KY7 A;  1LTI D;  1VF5 C;  4DV6 Q;  4LF4 Q;  1NR4 A;  3E0J A;  1TII D;  2A6H C;  1NCV A;  5JJZ A;  2UUC Q;  1XYI A;  4QIW E;  3KFU A;  5C4H A;  2EYP A;  2KCN A;  1TY0 A;  3K57 A;  4IPD A;  3HEJ A;  5J39 A;  5C3E G;  2DY7 A;  1WCM G;  4AYB B;  2MUY A;  3L0O A;  4HIO A;  3F2D A;  3PO2 B;  1FNV A;  1EQT A;  4NXM Q;  3MXP A;  3SEB A;  1ZYR D;  4YHH Q;  3KDF A;  1SE8 A;  4YCW A;  1B70 B;  3CPF A;  3S15 H;  2E5L Q;  2RDG A;  1PLF A;  3J80 E;  1PHJ A;  3ULJ A;  1ENC A;  1K9M C;  3CRK C;  2OTJ A;  5IP7 H;  1EY6 A;  2F0T A;  4G7O C;  1LT5 D;  1MJE A;  2L9H A;  2F0D A;  2JA5 H;  1TVX A;  2PZW A;  2F3I A;  3J81 j;  1HTL D;  1U4M A;  4A75 A;  3PO3 G;  4RCN A;  4TSS A;  2CW0 D;  2PZU A;  4HSP A;  4JW0 A;  3A7A B;  3OOC A;  1XX8 A;  1EL0 A;  2RDF A;  1XNQ Q;  1B4O A;  4KHP L;  3CCU A;  5C0X G;  3S15 B;  1B3A A;  5C44 G;  3CRL C;  1N36 Q;  4RGM A;  3K80 C;  4B9X A;  1FNU A;  5M5X H;  2FMM A;  5I6W A;  5IOC A;  2JA7 B;  1B9N A;  2UXC L;  2JA5 B;  4R4I A;  3VYR A;  1SJH D;  3IFT A;  3K5N A;  2B2T A;  2ALY B;  4R4O A;  5J22 A;  1GHK A;  4BXX G;  1EY8 A;  4FP5 D;  3D0F A;  2JA6 G;  1IKM A;  1CZG A;  4MTN A;  5FO8 B;  2K6A A;  1HHV A;  4HJ8 A;  3F2B A;  1YIJ A;  4L6T B;  4LF7 L;  4JI8 Q;  4PG3 A;  1SMY C;  1KAA A;  1EIH A;  1TS5 A;  3JAM L;  1B44 D;  3V05 A;  4L5R C;  5DM7 3;  1SNC A;  1STG A;  1VQ4 A;  1TWG B;  5JEA G;  3R3O A;  3BYY B;  3KYH C;  3OYY A;  1PH5 A;  1IKL A;  5JJI A;  5KNC A;  4QMG A;  3HZX A;  4KI0 A;  3M4P A;  3RMH A;  1ILQ A;  2LKV A;  2IT1 A;  1Q7Y C;  1DOM A;  3QJY A;  1CKN A;  2EJF C;  4L5Q A;  4N8X 1;  3RN5 A;  4A3B B;  1F2M A;  3M4Y A;  2ICE C;  4B3R Q;  1X55 A;  1F2Z A;  3GTM B;  1A6X A;  3NXW A;  2NWG A;  3CKI B;  1KRT A;  2JQO A;  1ICW A;  2F52 A;  2K5V A;  3NEN A;  1R4P B;  1WVL A;  1FNW A;  1QB5 D;  1D6E C;  4ID6 A;  1IW7 C;  4QY7 A;  3X3N A;  1DCZ A;  1O7L A;  4EVO A;  4FXG C;  4ZKB B;  2OQ0 A;  1HNW Q;  1F2L A;  4BBS B;  1YBY A;  2QDL A;  2KHI A;  1B2T A;  4WFN 3;  4GS3 A;  4B3S Q;  2DY8 A;  4KK7 A;  3SK8 A;  2YTV A;  1QUQ A;  3BZD B;  4TQU S;  2XVS A;  1BCP B;  1FGB D;  4C3H B;  3MXN B;  3ULL A;  3E6Z X;  4OX9 L;  4G7Z C;  3HKZ E;  2JEB I;  4JI0 L;  4K0K L;  1AZP A;  4UP8 A;  4JVZ A;  4XYO A;  2Q8I B;  2KBN A;  3PUY A;  1AFP A;  2MFI A;  4A3J G;  3EVQ A;  4U67 3;  3DXJ C;  1XNR Q;  1HFN A;  2EIF A;  2O5J C;  1RF2 D;  5BR8 L;  4ZQ3 A;  3UDI A;  1V8Q A;  1G8Z D;  1G29 1;  4DUY L;  5IYD G;  4QCL A;  2RBM A;  2C5C A;  3NQI A;  3BU2 A;  3KJO A;  2IPK D;  3G7L A;  4WJ4 A;  1OXV A;  1FVI A;  3KDF B;  1I4P A;  1SYB A;  2PPB C;  3VYU A;  4DK3 C;  3GTO H;  3C46 A;  5LMN L;  2RDH A;  5BN4 A;  2N78 A;  2JA9 A;  1LTS D;  1YNJ D;  2GVB A;  3I4N H;  1QZH A;  2XIW A;  5IWA Q;  1UE5 A;  4DR4 L;  3OTO L;  4A3C G;  1VQC A;  3RLF A;  2NTT A;  5KNB A;  5IGE A;  1F9S A;  5M5W H;  2I07 B;  5E3F A;  2ZJR A;  3TRZ A;  2K04 A;  1I3Q H;  5E4X A;  3JC6 6;  2F0K A;  2WAQ G;  5FO7 B;  2B2T C;  1Y8N B;  1B1Z A;  4C2M H;  4IJH A;  4FXD A;  2WAC A;  5FLX E;  3KBG A;  5FLM H;  4XQN A;  1L0Y B;  2F0G A;  4E6I A;  1CA6 A;  3I4N B;  1RD9 D;  3MA2 B;  5A2Q E;  4DR1 Q;  1PH4 A;  3MHB A;  1PZI D;  4NXN Q;  4KY5 A;  2RKS A;  2RVL A;  3HKZ B;  2LFN A;  2E8G A;  4BBR H;  3HOV G;  3N6R A;  2A69 C;  1I3Q B;  2SOB A;  1TWA H;  1E1T A;  5JJK A;  1F9P A;  4XQJ A;  1PTO D;  1T5X D;  2ES2 A;  1IL2 A;  4JV5 Q;  2O4X A;  4AQY Q;  1BBX C;  2J4X A;  3L3O C;  4A3L G;  1O7I A;  2FFK B;  1WFQ A;  5DEH A;  1E1O A;  5JPM C;  3FEW X;  5HY6 A;  3PUW A;  4K8I A;  3JAM c;  4BBR B;  5J3B A;  5BN3 A;  1H95 A;  1QJO A;  2QGQ A;  1EY9 A;  2D0P A;  3J80 L;  4P75 A;  4DXF A;  1GUG A;  4UPA A;  4IFD J;  4XT3 B;  1V1O A;  5M3M H;  1QOH A;  1ZKO A;  2B29 A;  2KJX A;  4JI2 L;  1XPR A;  3BJU A;  2DN8 A;  5LL6 S;  3BYT B;  5CBA E;  1XPO A;  2A8V A;  1HZB A;  3MTS A;  2AMC B;  2KCM A;  4NP5 A;  4CJ1 B;  3A7L A;  2CWA A;  3PGZ A;  1HZC A;  1RTO A;  4DV6 L;  1QUQ B;  1PMR A;  3W1G A;  2EXD A;  2X6L A;  2UUC L;  3TEH B;  1X3P A;  5GRO A;  4QQB X;  1W3S A;  2ENB A;  5DNF A;  1LT6 D;  3D4R A;  2L5T A;  1U9R A;  3R2I A;  1NY4 A;  3VYS A;  2OCE A;  3U50 C;  3DMU A;  3I70 A;  3T16 A;  1HR0 Q;  1SYG A;  2HDL A;  1YNN D;  3MFG A;  3HOU B;  1R4Q B;  1ESR A;  1BXT A;  1RIP A;  4IUP A;  4UP9 A;  4KHP Q;  2HQL A;  3KF8 B;  1S5B D;  2VS1 A;  5TSS A;  1EIY B;  1W6K A;  4LF6 Q;  1VCI A;  1SLJ A;  2E5L L;  2F0L A;  2CQO A;  2HUG A;  5E1F A;  2AUJ D;  1JJC B;  4K2L A;  3RLO A;  2F0W A;  1Y1W G;  1O7Y A;  3T4A C;  1HUN A;  1ZXT A;  5JEA J;  5ELO A;  1X9N A;  2A68 C;  1TR5 A;  3P75 A;  3MZ5 A;  3J81 c;  1SXT A;  3T53 B;  5KYI A;  3FKI H;  1SMY D;  1CQF A;  2B2U A;  1E2V A;  2DUD A;  4APV A;  4MZ9 A;  2F3V A;  3E5S A;  2KUM A;  1HJP A;  4IZ8 A;  4OO1 H;  2BA1 A;  1GUO A;  5IP9 H;  2AUK A;  3NBH A;  3H15 A;  2RSN A;  2B2V A;  1N36 L;  4LF7 Q;  4X3K A;  1X6O A;  1PH9 A;  5ISR A;  1D5Z C;  4ZRZ A;  4B3M Q;  3I55 A;  1E0B A;  4PMC A;  3GP7 A;  2PQA A;  1BKB A;  4LUV A;  4DU9 A;  3FKI B;  3K0Y A;  1PVO A;  1KD1 C;  1SBB B;  3S24 A;  1PRT C;  2BE5 C;  1Z9F A;  2CHB D;  4K2K A;  4PQX A;  4DV7 Q;  3HKS A;  4XYQ A;  3JAM i;  3H3V H;  2E2J B;  1IYV A;  4QB4 A;  1HR0 W;  2A73 B;  4DV2 L;  3MWY W;  5GAE C;  3HOZ G;  4QUF A;  5CGK A;  2X69 A;  4DR3 Q;  1JT8 A;  4HJ9 A;  1LTA D;  2KHJ A;  2PNR C;  1YIT A;  4JI8 L;  2BA0 A;  2F0S A;  5IT9 E;  3H3V C;  3NEL A;  2NN6 H;  4A3M H;  4LJZ C;  4X62 Q;  1M1K C;  1K3R A;  4ZK9 B;  2YU9 H;  3CCL A;  2KA7 A;  4BY7 G;  4X65 Q;  4GZY C;  3QR8 A;  2F0V A;  4POF A;  2R92 H;  1B8A A;  4IAL A;  3KF6 A;  4BY1 H;  3K59 A;  2N3S A;  1PV4 A;  1PH6 A;  5C4J H;  2PZT A;  1J8I A;  1QIL A;  4LFC L;  1GM5 A;  2Z0S A;  2OF1 A;  4V19 0;  3M7G A;  4KKT A;  5I2Y A;  4B3R L;  3M4O H;  3K0X A;  3FPU B;  4J8Q A;  2KOL A;  4OX9 Q;  3CAM A;  4A3M B;  2EJM A;  4UP7 A;  2SEB D;  2EJG C;  3D8G A;  4K0K Q;  4FYD A;  3WOF A;  3PF4 A;  1PZK D;  4K14 A;  1HNW L;  4LFA Q;  4V0B A;  1YNX A;  1KAB A;  3BVZ A;  1BF4 A;  1R9T B;  5BR8 Q;  1X3F A;  4CJ2 C;  3J80 c;  4LF5 L;  1HNZ Q;  3P20 A;  1H9S B;  2BDO A;  3PQI A;  1Q46 A;  5KIX A;  3E9I A;  3M4O B;  1KL9 A;  3A56 A;  2V4D A;  2Z4H A;  3J7Z C;  2K5D A;  2Y0S E;  1JQY D;  2HHH L;  3G48 A;  4P2C B;  5C5M A;  1PH8 A;  3K5L A;  2HIX A;  1FGU A;  4M8A A;  2ICI A;  1TQO A;  2OQK A;  2LS0 1;  2B63 G;  4C3J H;  3KLS A;  3F2C A;  1VQ7 A;  2ZXR A;  1EY5 A;  4QUC A;  1VQJ A;  2F0N A;  3OWE B;  2L15 A;  1AP0 A;  3KLW A;  1WD0 A;  3OIQ A;  2PW5 A;  4OWW B;  3G6J B;  4HIM A;  3PO3 B;  2JSO A;  4YCV A;  3UE0 A;  5IYC H;  3SK4 A;  1ASY A;  4GLA C;  3HOW H;  2GVA A;  2E76 C;  4FF4 A;  1W2B A;  4DV4 Q;  4ZUJ A;  4Q5V A;  4CKE A;  2JXM B;  1IYU A;  2A69 D;  4J15 A;  3PIP 3;  5M5Y H;  3D4W A;  3QB3 A;  2B2U C;  5EKI A;  1GUW A;  3TQY A;  3VR4 A;  4R4C A;  1MBY A;  3TZD A;  2F0F A;  4KLK A;  1WOC A;  4WJW A;  3R2T A;  4JCV E;  1KDC A;  2B2V C;  1G6Z A;  1SN8 A;  2OTL A;  1UE1 A;  3M9B A;  4P73 A;  4UHV A;  1O80 A;  1YJ9 A;  2FXQ A;  1U0L A;  1Q86 C;  1GXD C;  3NBH B;  2UXB Q;  3A8I E;  1OXX K;  4MHE A;  1ET6 A;  1N32 Q;  1CFM A;  2NN6 I;  4X66 L;  1D1K A;  2C9O A;  1VQN A;  2ZJP A;  5IYB H;  1SNP A;  3I7F A;  4FVM A;  4A3I H;  1DD2 A;  3GV6 A;  2AWO A;  2EYM A;  1X3E A;  4IQZ A;  5CR3 A;  3VR3 A;  1KTK A;  2A74 C;  3GTP H;  3S1Q H;  2NVQ B;  4IUQ A;  5NUC A;  2A19 A;  3WOE A;  5FK9 C;  1H9M A;  4NXN L;  2B8F A;  2LSS A;  3GD7 A;  1DOK A;  1D1I A;  1D5M C;  1CTM A;  4H13 C;  2Y0S B;  4RHS A;  1JB3 A;  1KDB A;  1S5E D;  1SRO A;  3SDZ A;  2AHO B;  2RA4 A;  1RHP A;  3STB D;  4LW1 A;  4JV5 L;  4A3I B;  4AQY L;  3S1N B;  4KHZ A;  2UUA Q;  2CWP A;  1VQ5 A;  3NTI A;  2EE1 A;  3J80 i;  3S1Q B;  5K36 H;  4B3T Q;  2R93 G;  4RFB A;  2F03 A;  2WB1 G;  3HOX B;  3MXN A;  1CSP A;  3CME A;  5FKA C;  2D5D A;  3PO2 H;  3TN2 A;  3CCS A;  3NWS A;  4A93 H;  1N33 Q;  5IOD A;  1LLR D;  2EY1 A;  3RUZ A;  1UNS A;  2SDF A;  3CCE A;  1O78 A;  2MHV A;  1I50 B;  3RZO H;  1GUT A;  1JR0 D;  1PDQ A;  2PCF B;  1WTH A;  3TBI B;  4XQQ A;  3URY A;  3X3M A;  4DK6 C;  4K6D A;  5JAV A;  1C7Y A;  3OSO A;  3MC0 B;  2F0U A;  2RHQ B;  5D65 A;  4A93 B;  1V9P A;  5C3X A;  4A3D B;  2BOS A;  4DV5 Q;  2JK8 A;  1EU4 A;  4BY1 G;  2JA8 B;  2TMP A;  3S2D H;  3SHL A;  2RF4 A;  1PTO B;  5EKL A;  1K8O A;  1IL8 A;  3NE5 B;  3M4Q A;  5FJ8 G;  1ESF A;  5CYU A;  2L55 A;  3RZO B;  3M3Y H;  5C3W A;  1GO3 E;  4IFD G;  1EUJ A;  2JA7 H;  4A3K G;  3OHX C;  4YIJ A;  2K4K A;  1HR0 L;  3F2U A;  4YY3 Q;  5I6Y A;  4XTC S;  3S2D B;  1BDO A;  2ZXP A;  2QEJ C;  4PMW A;  1PFM A;  3M85 A;  5I9P A;  1PRT D;  1EYA A;  1SFO H;  4LF6 L;  5FLX c;  1A2U A;  3M3Y B;  3S14 H;  4DR5 Q;  4BS9 A;  3DEO A;  1VQP A;  5GQO A;  3A8J E;  2Q8T A;  1AEX A;  1JOK A;  2V1C C;  4N9T A;  1DGS A;  4EGV A;  2ASB A;  1TWG H;  2EYF A;  5CC4 A;  2HQE A;  2K05 A;  3SK6 A;  5DLQ E;  1TS3 A;  4C3J G;  1STY A;  4ME3 A;  4POG A;  5GAD C;  1SFO B;  4DV2 Q;  1K8M A;  4CKC A;  4XT1 B;  2KEC A;  3S14 B;  4A3B H;  4RCO A;  5M3F G;  4QIW B;  1AN8 A;  3GQB A;  4JOI C;  3HS0 C;  1QZG A;  1L1O A;  4C56 C;  3NBI A;  4HMJ A;  4F7X A;  4B3M L;  5FOB B;  3GTM H;  2GN5 A;  1VQB A;  1XTC D;  3V96 A;  3K81 C;  3HOW G;  3EIV A;  3ERO A;  3LWE A;  1BR9 A;  4P71 A;  4BBS H;  4FF2 A;  4DV7 L;  3BZK A;  2KQ3 A;  1F2Y A;  1LTG D;  1SNO A;  2RCN A;  4ALP A;  2VQE L;  4A3F H;  1X65 A;  2G9H D;  4LFC Q;  4ODG A;  1N8R C;  4K5X A;  4DR3 L;  3I4M H;  3MVV A;  3VYT A;  2P5Z X;  1EZ8 A;  1SEB D;  3KK7 A;  1Z7T A;  4MIU A;  1LM0 A;  2NVX B;  1A62 A;  4C3H H;  3IAY A;  3MAQ A;  2XNA C;  4EQO A;  1K83 H;  3MFY A;  4PV1 C;  2QDB A;  4X62 L;  1KLG D;  2HCC A;  4X65 L;  4DV3 Q;  4GKJ Q;  2D62 A;  2Z6B A;  1I94 L;  4U68 A;  1BCP C;  1E24 A;  5ELD A;  1VQF A;  1VF7 A;  4A3F B;  3NUC A;  1Y1V G;  1CHQ D;  3T1Y L;  3IL8 A;  4LF5 Q;  3A74 A;  3I4M B;  3S9W A;  1MIU A;  5D3D A;  3H6M A;  3QOJ A;  1A15 A;  1A3T A;  1FR3 A;  1GJX A;  2VQF Q;  3EA6 A;  2JJQ A;  3KOJ A;  2DGY A;  5IY0 A;  4MNO A;  1K83 B;  4RKL A;  4CDF C;  1RKN A;  2VY3 A;  1DYQ A;  2I5M X;  2HHH Q;  1LAC A;  5C4X G;  3A55 A;  3AB9 A;  2MO1 A;  1FYC A;  2Z1C A;  3ND9 A;  1WD1 A;  4LFA L;  1VQ9 A;  1F9Q A;  4H44 C;  3CD6 A;  1C48 A;  3GO5 A;  3KF8 A;  1MSH A;  3WDN A;  1HNZ L;  5JVG 3;  3J81 L;  2F4V Q;  3NPP A;  4AYB G;  2VW9 A;  2NYZ D;  2VUM H;  1SNQ A;  1VQG A;  3PO2 G;  3C1E A;  1KRS A;  1OXT A;  4IPG A;  1Z47 A;  5AFW A;  3PSI A;  1LTT D;  1AW7 A;  3K7U C;  2O5I C;  1MHW C;  1QCB D;  4UY8 C;  1YHB A;  4QL5 A;  4ZLT F;  1DOL A;  2EYJ A;  3GTL H;  4DF7 A;  2R6G A;  3TP8 A;  2F0Q A;  4RAU C;  1A0I A;  2QKI C;  4NB3 A;  5H1S E;  3GV3 A;  1HA5 A;  4RGO S;  2DNC A;  1UE6 A;  3CCM A;  2VUM B;  3CCV A;  1JWM D;  1TS2 A;  1BO0 A;  1RCV D;  2WFW A;  4CDD C;  2XRS D;  4OXP A;  3TME A;  3DWP A;  3QO2 A;  4LAA A;  1WTR A;  4DUZ Q;  1QVG A;  3TS2 A;  1B3Q A;  4A3E H;  4K6L A;  4X66 Q;  4ZCK A;  4DV4 L;  1YHQ A;  4DNT B;  3GTL B;  1JE5 A;  3VR6 A;  3FP9 A;  4L63 B;  5IP7 G;  2QA4 A;  3H0G H;  4IUT A;  1HTP A;  1FJG Q;  2JA7 G;  2JA5 G;  4KN7 C;  1EQR A;  1FD7 D;  5IT9 c;  4EQP A;  3QIA A;  2NVY H;  5J1Z A;  2UXD L;  3D31 A;  4HJ7 A;  2R61 A;  1F9R A;  1OXS C;  1HZA A;  4NMZ A;  2CCZ A;  4Q0F A;  4YWL A;  1KNA A;  3ZJY C;  2E74 C;  3ND8 A;  1L1O C;  3PF5 A;  1TU2 B;  4A3E B;  2UXB L;  1WJJ A;  1K8A C;  3RD4 A;  1N32 L;  3ERQ A;  3H0G B;  2KCT A;  1XTD A;  1L1O B;  1EYD A;  4R8N A;  4J6H A;  2A6H D;  4KKU A;  3I4L A;  2NVY B;  2F0M A;  4RA8 A;  1LUZ A;  3BDC A;  3U58 A;  1B9M A;  2NZH A;  4OWT B;  1KLU D;  3D6W A;  5I2X A;  1VQH A;  1PH7 A;  1T9H A;  2XN9 C;  1LTB D;  5DM6 3;  2A6E C;  1UAP A;  2L12 A;  1EQV A;  2UUA L;  5IE8 A;  3OIP A;  4HTH A;  4DK0 A;  1H9S A;  1X3G A;  4B3T L;  1CI3 M;  3SGI A;  4GLX A;  2FHT A;  1G2T A;  3UDF A;  3NTH A;  1DM0 B;  4C1N I;  1WTO A;  4DPG A;  4BBS G;  1SSO A;  4DAV A;  1SRU A;  2OWO A;  5IGC A;  3HOU H;  1N33 L;  4RG1 A;  1NSN S;  3H94 A;  4OHJ A;  5T1G A;  1P16 A;  2PNH A;  1I6V C;  1D7Q A;  1JCK B;  2F0I A;  1A3V A;  2NZO A;  4C3H G;  1UUP A;  2MJ8 A;  4A3G B;  1Q90 A;  1PH3 A;  1EFW A;  2NUC A;  3DM1 A;  3PIP A;  2MQH A;  1BNZ A;  1JJG A;  2VL6 A;  2OT2 A;  2E2I H;  2WIN B;  4DV5 L;  1DON A;  1JWU D;  4X3T A;  2K5W A;  3LX0 A;  1Y8P B;  3FRP B;  4KKS A;  4IOA A;  1IBL Q;  1CQV A;  3EN2 A;  1NTG A;  4RMF A;  2EPB A;  1HQM C;  3Q24 A;  1Q81 C;  1D5X C;  3CF5 A;  4ME5 A;  1EU3 A;  1ICF B;  3KLS X;  3RNU A;  3ULP A;  1V1Q A;  1NAP A;  2E2I B;  1VQM A;  4OIK A;  1YVC A;  1QWY A;  4YY3 L;  1PYW D;  5ELN A;  4DN4 M;  2E2J H;  2TSS A;  4F87 A;  1C0A A;  3I3C A;  3HOY H;  1JOO A;  2KED A;  1II3 A;  3I90 A;  4HSV A;  1X32 A;  4G7H C;  1PRT F;  3ZYY X;  4K8J A;  4DR5 L;  1VQK A;  5CV8 A;  1S5F D;  4B08 A;  1NJI C;  1BQQ T;  1ZYR C;  1HNX L;  2ZT9 C;  4R9W A;  3U4V A;  1YJN A;  1F77 A;  3J7Y W;  4X3U A;  3I91 A;  2WP8 J;  4YWK A;  4GN3 B;  5BN5 A;  1ML0 D;  3LNN A;  1IW7 D;  4C3I B;  3FMC A;  5KYL A;  4GOP B;  3HOY B;  2VQE Q;  1A2T A;  4QF4 A;  3UE1 A;  1NR2 A;  5ELE A;  2CW0 C;  1BCP D;  2XRQ D;  1K8G A;  4R8I A;  3KLR A;  3I4N G;  1G2S A;  4P74 A;  3T51 B;  1HCZ A;  3P7J A;  1V1P B;  2YV5 A;  3L9A X;  3HKZ G;  4KHV A;  5EGT A;  2SNM A;  3IFD A;  3OW7 A;  3I72 A;  5COY A;  1I94 Q;  1B50 A;  1ONL A;  1DZ1 A;  2EY2 A;  2K5N A;  1R9T H;  2IX0 A;  5GAH C;  3T1Y Q;  1JMC A;  5FLM G;  1IXR A;  2R7Z B;  4X3S A;  2JYO A;  2A1A A;  2ATW A;  2EYO A;  2IHE A;  1ENA A;  4I7Z C;  3RZD H;  4KTA A;  2KVM A;  5C3E H;  1WCM H;  4BBR G;  4ULL A;  4RWS C;  1SJE D;  4JI6 Q;  1Y8O B;  3Q22 A;  1IBM Q;  3VA7 A;  4DV3 L;  4GKJ L;  1K0S A;  2LMC B;  4DAM A;  3AEV A;  1J5E Q;  3CPW A;  3S16 B;  3HFZ B;  3T1H Q;  4RGN A;  1KAW A;  1HZ9 A;  2M2L A;  3RZD B;  4H7B A;  3E9H A;  3H09 A;  5C3E B;  4KJO A;  1BOS A;  1WCM B;  4R1J A;  2ZM6 Q;  1B7Y B;  2VQF L;  1EOT A;  1XWE A;  3PO3 H;  4HMI A;  4XIG S;  3GTQ B;  3J81 i;  3OW2 A;  4HID A;  1IYJ B;  1QVC A;  3NTK A;  5EBD A;  4CKB A;  4QJF A;  2B8G A;  3I56 A;  5FLX L;  3U9O A;  3A5U A;  5C0X H;  5M3M G;  4HAE A;  3W1B A;  4GNX B;  2G9D A;  2I5H A;  5A2Q L;  1HPC A;  2F4V L;  2RQX A;  2I0Q A;  2PYK A;  1LV9 A;  1AH9 A;  2FMC A;  4DA2 A;  1CK1 A;  4BXX H;  1RL2 A;  1TS4 A;  1MI2 A;  1HQR D;  4X64 Q;  1ET9 A;  4DV0 Q;  1STN A;  4JI3 L;  1E7Z A;  3E3X A;  5C44 B;  2HCI A;  4AH6 A;  5CBE E;  2N8N A;  1XXG A;  2M00 A;  3PIO 3;  4JBK A;  1U5K A;  5ELC A;  3N52 A;  2WV6 D;  2O2L D;  2WII B;  1K0R A;  3CP0 A;  3OMC A;  4O2D A;  4A76 A;  3C3L A;  2UXD Q;  2Z9H A;  2NVQ H;  1J9O A;  2R3Z A;  1EY0 A;  3HRZ C;  2DJG C;  3FHW A;  2JA6 B;  4ILW A;  3BDL A;  2E2D C;  4WRD A;  3E0E A;  4DUZ L;  1S40 A;  3B6Y A;  2MPM A;  4DNR B;  1TT2 A;  1BBU A;  4IUR A;  1YZ6 A;  4N9P A;  4KV6 A;  4FO2 A;  2H1E A;  4HJ5 A;  4DR7 L;  1FJG L;  3S1N H;  1CZW A;  1I4Q A;  3RN2 A;  2C35 B;  3ER0 A;  3FKI G;  5JOB A;  1SE4 A;  4ABN A;  1EQQ A;  3S17 B;  2QCP X;  3HOX H;  2IW3 A;  1PFB A;  4MN3 A;  2IX1 A;  4OO1 G;  3EBE A;  5IP9 G;  1YNJ C;  1EYC A;  4GKK L;  3NSW A;  3DM3 A;  4Y52 H;  1RJT A;  2QF7 A;  1IZ6 A;  2YTX A;  2ZTE A;  2PI2 A;  1I50 H;  3CXC A;  3NP8 A;  2K01 A;  1KC8 C;  3A5Z B;  3TSS A;  2NZ1 D;  1TWF H;  1UEB A;  5HGQ A;  5EPJ A;  3CCQ A;  5IGG A;  4HN7 A;  3BVG A;  2R7D A;  1Y69 U;  1NBW A;  1PXU A;  2Q2U A;  2WAQ E;  1EY7 A;  1HA6 A;  2K5Q A;  4H02 A;  4A3J H;  4A3D H;  2JA8 H;  4DAP A;  1Y1V B;  1OTC A;  1PTO H;  2I46 A;  4JG2 A;  3S2H H;  1SE2 A;  2AQ3 B;  2B2W A;  2K52 A;  5KEE A;  4C1N K;  1KNE A;  2J7Z A;  1AZQ A;  1JOQ A;  5C0X I;  1TWF B;  2NN6 G;  1X3Q A;  4A3M G;  3CC4 A;  1JE4 A;  1PTO C;  1ROD A;  3LGJ A;  5EBC A;  4YCU A;  2SNS A;  5A35 A;  3SK5 A;  5ELF A;  1Q8I A;  4A3J B;  2R92 G;  2A68 D;  3I8Z A;  1S5D D;  3AFP A;  2R7F A;  1X56 A;  2IJ0 A;  3OPO A;  3S2H B;  2D2C C;  1AE3 A;  2K7V A;  4HIK A;  1Q8K A;  4O1N A;  2FIN B;  4A3C H;  2A5H A;  5EPK A;  3FVQ A;  4B9W A;  2ZXO A;  2X6G A;  1I5F A;  2ZTC A;  1B53 A;  1S3O A;  2ZJQ A;  2L0C A;  1BBW A;  2BE5 D;  2PI2 E;  3Q8D A;  2KEN A;  1IBL L;  2XSC A;  5HUR A;  1JC7 A;  4JYA Q;  5KND A;  5IT9 L;  3T56 B;  2B39 A;  1HRJ A;  1N9W A;  2PMZ E;  5CV4 A;  1HNX Q;  2F1M A;  1RTN A;  1SYD A;  2OXP A;  5LL6 X;  4GLV B;  2N88 A;  3SE0 A;  4EQ5 A;  1SND A;  3HOV H;  1DJR D;  2NTS A;  1GHJ A;  3VA5 A;  1CKM A;  1TY2 A;  2F0J A;  2WAQ B;  3AMU A;  1VQO A;  5M9O A;  2IWH A;  4JI5 Q;  4A3L H;  3TZU A;  2IL8 A;  1YNN C;  1Q1B A;  4TKO B;  4I7A A;  4JI4 Q;  1EWI A;  5JVH 3;  4G57 A;  2NVX H;  5IYC G;  4X6A H;  3NK9 A;  1FL0 A;  3OMG A;  1EYG A;  4TRD A;  3HOV B;  2NBF A;  1AE2 A;  3I2Z A;  2Z4I A;  5LHY 1;  5ELB A;  1Q82 C;  1STA A;  1CHP D;  1K28 A;  4JI7 L;  1CA5 A;  4I65 A;  4EQN A;  5EAY A;  3GTG H;  1VMC A;  2K32 A;  5M5X B;  4Y7N H;  3CU7 A;  2EQS A;  2I5L X;  2QEX A;  5FO9 B;  1EFI D;  1EIF A;  1PH2 A;  1E2W A;  1E2Z A;  3MXU A;  2KHS A;  4NPS A;  1CT1 D;  3W5O A;  2K14 A;  3K8A A;  1BCP F;  4CHT B;  1EY4 A;  1XMQ Q;  4OEL B;  1NUC A;  1MD2 D;  1SYE A;  1P8L A;  4PZ6 A;  1A8V A;  3NEM A;  2Y0S G;  2L1B A;  2F0E A;  2MNA A;  3AYH B;  1U4L A;  1G6P A;  2LXJ A;  3KBX A;  1PFS A;  4G4K A;  1RDP D;  5IYB G;  3GTG B;  4WJ3 M;  4Y7N B;  2B3G A;  3RLN A;  4A3I G;  3UI2 A;  3AQQ A;  2DNE A;  2UUB Q;  2B2Y A;  1G51 A;  4CDE C;  4JPB W;  4K5V A;  5KRU A;  2Z8L A;  4DR2 L;  2PMZ B;  3PUV A;  3TS0 A;  4HCS A;  1K73 C;  5D14 A;  2KEE A;  3HOX G;  1VQL A;  1C8C A;  3A8K E;  4ZAI A;  2B2W C;  4DFA A;  2H4O A;  3L2P A;  1K3B C;  1Z6H A;  3WWV A;  2BH2 A;  4JI6 L;  2HT1 A;  5IGB A;  1IBK Q;  5AJ3 Q;  1IBM L;  1WTQ A;  2VB3 X;  3KJP A;  1N34 Q;  4O0A A;  4DAY B;  2JEA I;  1EWC A;  5HGT A;  1J5E L;  1S72 A;  1JWS D;  1X54 A;  5C4Z A;  5G3L D;  3T1H L;  4J1M A;  3BVM A;  2CFM A;  3TDQ A;  5K36 G;  4BA1 I;  4PNY A;  1Y1W H;  4IUU A;  2PO4 A;  3D3R A;  2IX3 A;  2ZM6 L;  2RHS B;  2LXK A;  3ITP A;  4DKA C;  2EDG A;  3G4S A;  2MGS A;  1GVP A;  3U4Z A;  2K33 A;  4DV1 Q;  3M7N A;  3I73 A;  4A3D G;  4A93 G;  1MKH A;  1I4G A;  3D6C A;  3TP6 A;  2K28 A;  4CBV A;  2JA8 G;  2XWJ B;  1XPU A;  4L8J A;  4JI3 Q;  4LF9 L;  3ERS X;  3CHB D;  2HIV A;  3QG1 A;  5COR A;  3CC2 A;  5LMU L;  4MTK A;  1Y1W B;  2EYH A;  4JBM A;  1ENF A;  3TRE A;  4DNI A;  1Q1E A;  3GTJ H;  1JB7 A;  1Y14 B;  4GN4 B;  1S4Z A;  4IPH A;  4N8F A;  3CCJ A;  2JP1 A;  2G5D A;  4FNF A;  1JJ2 A;  3J7A 5;  1BVS A;  4X64 L;  2F0O A;  3A0J A;  4LF8 Q;  1JOR A;  4DV0 L;  1LT4 D;  4LK1 C;  1OO9 B;  2JE6 I;  1VDZ A;  3C1F A;  2F0H A;  3HOZ H;  4DR7 Q;  4GOP A;  1HXY D;  3GTJ B;  2NB0 A;  4OL7 A;  4BWG B;  2IHF A;  1YEZ A;  3F8T A;  4FF3 A;  3FPP A;  1GUN A;  2AWN A;  3CMA A;  1V1P A;  3MXG A;  4KJN A;  4IPC A;  4BY7 H;  1JIC A;  3PUZ A;  1YI2 A;  4Z9C B;  1VQE A;  4IOC A;  3GTO B;  1M90 C;  2BDN A;  4GKK Q;  2VNU D;  1H9R A;  2Z6K A;  5KGU A;  3HOZ B;  1I6H H;  2LY7 A;  3L7Z C;  4LFB L;  3PUX A;  1SYF A;  1KHI A;  4KMU C;  1KDA A;  1QNK A;  2CQA A;  3D4D A;  4DR6 L;  2EOT A;  3AFQ A;  4UDU C;  4JI1 Q;  4CGY B;  1WTV A;  1L0W A;  4JBJ A;  1PH1 A;  5M5W B;  2D0O A;  2UU9 Q;  2BH8 A;  3CC7 A;  4BY7 B;  4XXE A;  1WTW A;  3H91 A;  4A4I A;  1LT3 D;  1PA6 A;  2AQ1 B;  1CKO A;  1GD7 A;  1HFG A;  1TWC H;  2J0T D;  4LWC A;  4C2M B;  1PYB A;  1KIX A;  5F2D A;  1H9J A;  1UEA B;  2K50 A;  2EYL A;  4A3B G;  4OWX B;  1I6H B;  1VMP A;  4NW2 A;  3PV0 A;  2VB2 X;  1HUM A;  1U4P A;  1EEI D;  3Q0A A;  3IKJ A;  4DXG A;  4A3G H;  4ZUI A;  2B2Y C;  1EIG A;  3G71 A;  1E3P A;  4KD4 A;  1TWA B;  1CKN B;  2DJF C;  1GUS A;  2HD3 A;  1TWC B;  4K5W A;  3NQT A;  1XJV A;  4R4Q A;  5T1I A;  2WKD A;  4IO9 A;  1Q12 A;  4S3S A;  3K5O A;  2B63 H;  4A3F G;  4HCE A;  1XMO L;  5EQ0 A;  1O7Z A;  1WTP A;  3EJI A;  3I4M G;  2F4I A;  1I4H A;  3HG9 A;  4FF1 A;  4GNX A;  3GTK H;  1C9O A;  1C4Q A;  3SR1 A;  4OEM B;  3ICE A;  1ILP A;  2PQE A;  1LAB A;  5JJL A;  3S1R H;  2M9V A;  3STB C;  5C0X J;  1VS0 A;  3PIO A;  1PFN A;  1YJW A;  4LF4 L;  5M3M B;  4EX5 A;  2B63 B;  4LUO A;  1YHA A;  1EWH A;  2EVB A;  3DWA A;  1CUK A;  3DLL A;  1TWH H;  5IIF A;  3GTK B;  3HGB A;  2PW7 A;  2WB1 E;  4NDX A;  3HP3 A;  1NE3 A;  3S1R B;  2WKC A;  4KY6 A;  4NXM L;  4L5S A;  4OGQ C;  1OXU A;  4YHH L;  1MGS A;  1E22 A;  3EFX D;  2YTY A;  2YYZ A;  3QWN A;  3NWT A;  4OON A;  4IUV A;  1VQ8 A;  4C3I H;  2RCF A;  1KQS A;  1Q3L A;  1T5E A;  1TWH B;  4R4T A;  4YWM A;  1D2B A;  2UXC Q;  4JYA L;  1ZEQ X;  2L11 A;  2VUM G;  2QIL A;  1CSQ A;  3DUZ A;  3MEF A;  3J7A F;  2AQ2 B;  5EJW A;  3J7A V;  4CDC C;  5EKK A;  4GOP C;  1J6Q A;  1MJC A;  3W3A A;  2E75 C;  1XNQ L;  4JI7 Q;  5DAU A;  4TVA B;  1WYD A;  1QE6 A;  2CKZ B;  1CM9 A;  3K58 A;  1VQD A;  5CMD A;  3V2T A;  4OIJ A;  4JI5 L;  2OEO A;  2R7Z H;  3O13 A;  5E4W C;  3BZC A;  4GN5 A;  1QVF A;  2R93 H;  1L0X B;  2GA4 B;  3SXH A;  4JI4 L;  4LMQ D;  1SNM A;  2Z6K C;  4RHR A;  1EZ6 A;  4AIM A;  3K7A H;  5IGF A;  4A3E G;  1KXL A;  1LTR D;  1I4R A;  1PRT B;  1IHZ A;  2EY5 A;  3DHQ A;  3H0G G;  3A54 A;  3AU7 A;  2XWB B;  4IUN A;  3S16 H;  1GKH A;  2Q8R E;  1SDF A;  2F0P A;  3VDY A;  3CQZ H;  4DR2 Q;  2R93 B;  3VR2 A;  5CV5 A;  4L5T A;  2K5H A;  2WB1 B;  4QGU A;  2KCC A;  3LWU A;  1XMQ L;  5GAG C;  1BUV T;  5CV7 A;  3P1H A; 
#chains in the Genus database with same CATH homology
 1NBW A;  2QGQ A;  4X65 L;  2WAQ E;  4DV3 Q;  3UDG A;  2Q2U A;  2D62 A;  2D0P A;  3GTQ H;  4H02 A;  4P75 A;  4A3J H;  1I94 L;  4A3D H;  1E24 A;  3IRB A;  2JA8 H;  4UPA A;  1VQF A;  2IY5 B;  1VQI A;  1OTC A;  4IFD J;  1Y1V G;  5M3M H;  4JG2 A;  3T1Y L;  5FJ8 H;  4LF5 Q;  3S2H H;  2B29 A;  3A74 A;  4JI2 L;  2UUB L;  1MIU A;  2K52 A;  1XPR A;  3BJU A;  1PYS B;  5C0X I;  2VQF Q;  2NN6 G;  4A3K H;  4A3M G;  2JJQ A;  3KOJ A;  3CC4 A;  2DGY A;  5IY0 A;  4MNO A;  1XPO A;  2E2H H;  1LTL A;  4JI0 Q;  2A8V A;  1HZB A;  3LGJ A;  2VY3 A;  2I5M X;  2HHH Q;  4YCU A;  2AMC B;  2KCM A;  5C4X G;  4GNX C;  2MO1 A;  2R92 G;  2ID0 A;  4LFA L;  2CWA A;  1VQ9 A;  3PGZ A;  4JC0 A;  3AFP A;  4LF9 Q;  1HZC A;  2R7F A;  5AJ3 L;  1IBK L;  4DV6 L;  1X56 A;  1QUQ B;  3CD6 A;  3G6E A;  3W1G A;  4B3S L;  3GO5 A;  2EXD A;  1N34 L;  2UUC L;  2N49 A;  3RR5 A;  5C44 H;  1LYL A;  3TEH B;  1AE3 A;  4DUY Q;  5GRO A;  4QQB X;  1W3S A;  1HNZ L;  4HIK A;  1Q8K A;  4GKJ Q;  4LUZ A;  4IJL A;  5LMU Q;  2F4V Q;  1NY4 A;  2Q2H A;  4A3C H;  3I4O A;  4A3G G;  2OCE A;  4AYB G;  2VW9 A;  3U50 C;  2VUM H;  1VQG A;  3PO2 G;  2AKW B;  1KRS A;  1NMF A;  1V43 A;  1OXT A;  1SMX A;  1HR0 Q;  1I5F A;  4IPG A;  2ZTC A;  1Z47 A;  1TXY A;  3PSI A;  3HOU G;  1S3O A;  4DV1 L;  1RIP A;  3K7U C;  1WI5 A;  1EOV A;  2ZJQ A;  4UP9 A;  4KHP Q;  2JA6 H;  2HQL A;  1XNR L;  2NVT H;  3KF8 B;  1EIY B;  2VS1 A;  4UY8 C;  1YHB A;  4LF6 Q;  4QL5 A;  1VCI A;  1BBW A;  2PI2 E;  3Q8D A;  1SLJ A;  5LMN Q;  2E5L L;  2KEN A;  1IBL L;  2ZTD A;  2CQO A;  2MO0 A;  3GTL H;  4JYA Q;  2R6G A;  4P72 A;  1A0I A;  5M3F H;  4OO1 I;  1JJC B;  3RLO A;  4DR4 Q;  3OTO Q;  4NB3 A;  1Y1W G;  3CCR A;  3UDX A;  1N9W A;  2PMZ E;  5H1S E;  1HNX Q;  5JEA J;  5ELO A;  2XTI A;  1X9N A;  1UE6 A;  3J81 c;  3CCM A;  3CCV A;  3FKI H;  4GLV B;  1L2F A;  2WFW A;  4EQ5 A;  2DUD A;  4OXP A;  4APV A;  3S17 H;  4MZ9 A;  3HOV H;  1HJP A;  3GDE A;  4DUZ Q;  1QVG A;  1CKM A;  3TS2 A;  2BA1 A;  4A3E H;  5IP9 H;  4X66 Q;  3H15 A;  4LF8 L;  1VQ6 A;  1SR3 A;  1VQO A;  4DV4 L;  2Q2I A;  1YHQ A;  1N36 L;  1JE5 A;  3FP9 A;  5IP7 G;  4HJA A;  4LF7 Q;  2QA4 A;  5E7N A;  1X6O A;  3H0G H;  1PH9 A;  4JI5 Q;  4A3L H;  1FJG Q;  4LFB Q;  1UE7 A;  2JA7 G;  3H3V I;  2JA5 G;  2K75 A;  1EQR A;  4B3M Q;  1Q1B A;  4AYB E;  5IWA L;  3I55 A;  4DR6 Q;  5IT9 c;  2VZA A;  2PQA A;  4JI4 Q;  1BKB A;  1EWI A;  2NVY H;  4LUV A;  2UXD L;  2NVX H;  1PVO A;  3D31 A;  5IYC G;  1KD1 C;  4HJ7 A;  4X6A H;  3S24 A;  1FL0 A;  1EYG A;  1OXS C;  1HZA A;  2H5X A;  1Z9F A;  2CCZ A;  3I2Z A;  1AE2 A;  4YWL A;  3ZJY C;  4JOI A;  1L1O C;  4DV7 Q;  1Q82 C;  3HKS A;  3PF5 A;  3JAM i;  3S1M H;  3H3V H;  4JI7 L;  2UXB L;  1WJJ A;  1K8A C;  1N32 L;  2Q2T A;  3HOY G;  5EAY A;  1HR0 W;  3GTG H;  4DV2 L;  4Y7N H;  1Y1V H;  5GAE C;  4PZ8 A;  3HOZ G;  4JBW A;  2KCT A;  1XTD A;  4DR3 Q;  2EQS A;  1JT8 A;  3F1Z A;  4HJ9 A;  1L1O B;  2I5L X;  2PQA B;  2QEX A;  2KHJ A;  1YIT A;  1EIF A;  1PH2 A;  4JI8 L;  4NPS A;  2BA0 A;  3W5O A;  2K14 A;  4DR1 L;  3K8A A;  5LMN W;  3NEL A;  4BA2 I;  4A3M H;  3PCO B;  1XMQ Q;  3CW2 C;  4JI1 L;  1LUZ A;  1K3R A;  4X62 Q;  1M1K C;  4LNQ A;  3U58 A;  2YU9 H;  2UU9 L;  1P8L A;  4PZ6 A;  1A8V A;  3CCL A;  2NZH A;  3NEM A;  2Y0S G;  5C4X H;  4X65 Q;  4BY7 G;  1VQA A;  4OWT B;  2MNA A;  4IFD I;  1A63 A;  4POF A;  3AYH B;  1G6P A;  2R92 H;  1VQH A;  1B8A A;  2LXJ A;  3KF6 A;  1PFS A;  1PH7 A;  4BY1 H;  2N3S A;  1T9H A;  5IYB G;  1PV4 A;  4WJ3 M;  4FDB A;  1XMO Q;  1PH6 A;  2B3G A;  5C4J H;  3RLN A;  4A3I G;  1HH2 P;  3AQQ A;  4LFC L;  4JI2 Q;  1GM5 A;  2UUB Q;  4PZ7 A;  2R7Z G;  2Z0S A;  1NMG A;  1G51 A;  2UUA L;  4B3R L;  5IE8 A;  2XGT A;  5IYD H;  3M4O H;  1UWV A;  3K0X A;  4DR2 L;  4OX9 Q;  3CAM A;  1X3G A;  3PUV A;  3TS0 A;  4B3T L;  4UP7 A;  1K73 C;  3SGI A;  3HOX G;  1VQL A;  4K0K Q;  4GLX A;  3PF4 A;  3UDF A;  3L2P A;  3WWV A;  3KF6 B;  4DPG A;  1D8L A;  2BH2 A;  1ASZ A;  4LFA Q;  4JI6 L;  1YNX A;  4BBS G;  1SRU A;  2HT1 A;  1HNW L;  1IBK Q;  2OWO A;  5AJ3 Q;  3HOU H;  4DV6 Q;  1IBM L;  4LF4 Q;  1N33 L;  4RG1 A;  3KJP A;  5BR8 Q;  1N34 Q;  1X3F A;  2UUC Q;  4O0A A;  4DAY B;  2JEA I;  4QIW E;  3J80 c;  3KFU A;  1J5E L;  1S72 A;  1HNZ Q;  4LF5 L;  1P16 A;  1X54 A;  3T1H L;  2PNH A;  1Q46 A;  4IPD A;  1D7Q A;  2CFM A;  2NZO A;  3E9I A;  5K36 G;  4BA1 I;  1KL9 A;  1Y1W H;  5C3E G;  1WCM G;  1PH3 A;  3L0O A;  4HIO A;  3F2D A;  2ZM6 L;  1EFW A;  3J7Z C;  2RHS B;  2LXK A;  4DKA C;  4NXM Q;  2Y0S E;  3PIP A;  2HHH L;  2MQH A;  3G4S A;  3G48 A;  1JJG A;  1GVP A;  2VL6 A;  3U4Z A;  4DV1 Q;  4YHH Q;  3M7N A;  1PH8 A;  2E2I H;  4A3D G;  4A93 G;  1MKH A;  2HIX A;  1SE8 A;  3KDF A;  4YCW A;  1FGU A;  1B70 B;  2JA8 G;  4DV5 L;  1XPU A;  4LF9 L;  4JI3 Q;  2OQK A;  3ERS X;  2B63 G;  4C3J H;  3CPF A;  2HIV A;  3F2C A;  3S15 H;  1VQ7 A;  2E5L Q;  4IOA A;  1IBL Q;  1PHJ A;  3ULJ A;  1K9M C;  2OTJ A;  5IP7 H;  3EN2 A;  1VQJ A;  1NTG A;  1MJE A;  4RMF A;  2L15 A;  3CC2 A;  3KLW A;  5LMU L;  2JA5 H;  4OWW B;  1Q81 C;  4JBM A;  3TRE A;  4DNI A;  2F3I A;  1Q1E A;  3GTJ H;  3J81 j;  3CF5 A;  1JB7 A;  4HIM A;  1Y14 B;  4A75 A;  3PO3 G;  4GN4 B;  3RNU A;  4YCV A;  3ULP A;  1V1Q A;  4IPH A;  3UE0 A;  5IYC H;  1ASY A;  3CCJ A;  4GLA C;  1VQM A;  3HOW H;  1YVC A;  2GVA A;  4YY3 L;  1JJ2 A;  1BVS A;  1XNQ Q;  3J7A 5;  4X64 L;  4KHP L;  3CCU A;  3A0J A;  5C0X G;  5ELN A;  1W2B A;  4LF8 Q;  5C44 G;  4DV0 L;  4DV4 Q;  1N36 Q;  2E2J H;  3K80 C;  4J15 A;  2JE6 I;  3HOY H;  5M5Y H;  1C0A A;  3HOZ H;  5M5X H;  3TQY A;  4DR7 Q;  4GOP A;  4R4C A;  4DR5 L;  1VQK A;  2UXC L;  4KLK A;  1WOC A;  4R4I A;  1NJI C;  1HNX L;  4JCV E;  2IHF A;  1YEZ A;  2ALY B;  4R4O A;  3U4V A;  1YJN A;  1SN8 A;  4BXX G;  3F8T A;  2OTL A;  1UE1 A;  3M9B A;  4P73 A;  2AWN A;  1YJ9 A;  2FXQ A;  3CMA A;  2WP8 J;  1U0L A;  3D0F A;  4IPC A;  4BY7 H;  2JA6 G;  3PUZ A;  1YI2 A;  3NBH B;  4YWK A;  4GN3 B;  4MTN A;  1OXX K;  1Q86 C;  2UXB Q;  1VQE A;  1N32 Q;  4HJ8 A;  2NN6 I;  4IOC A;  4X66 L;  3F2B A;  1M90 C;  1VQN A;  2ZJP A;  1YIJ A;  4GOP B;  4GKK Q;  5IYB H;  2VQE Q;  3I7F A;  2VNU D;  3UE1 A;  2Z6K A;  4LF7 L;  4A3I H;  1I6H H;  3L7Z C;  2AWO A;  4JI8 Q;  1K8G A;  4LFB L;  3PUX A;  4PG3 A;  3I4N G;  1KHI A;  1X3E A;  4L5R C;  4P74 A;  4DR6 L;  3GTP H;  3S1Q H;  3AFQ A;  4JI1 Q;  1VQ4 A;  2A19 A;  1L0W A;  4JBJ A;  1PH1 A;  2YV5 A;  2D0O A;  5JEA G;  2UU9 Q;  4NXN L;  3HKZ G;  3KYH C;  2LSS A;  3GD7 A;  3OYY A;  2BH8 A;  3CC7 A;  1PH5 A;  5JJI A;  1SRO A;  3M4P A;  4KI0 A;  1PA6 A;  4A4I A;  1I94 Q;  2AHO B;  2IT1 A;  1CKO A;  1GD7 A;  1TWC H;  4LWC A;  1Q7Y C;  1KIX A;  1CKN A;  1PYB A;  2K5N A;  4L5Q A;  2K50 A;  3RN5 A;  2IX0 A;  5GAH C;  1R9T H;  3STB D;  4LW1 A;  4A3B G;  4OWX B;  3T1Y Q;  1JMC A;  4JV5 L;  5FLM G;  1IXR A;  4AQY L;  4KHZ A;  2UUA Q;  4B3R Q;  2A1A A;  2CWP A;  2ATW A;  1X55 A;  2IHE A;  1VQ5 A;  3PV0 A;  1KRT A;  3J80 i;  2JQO A;  3RZD H;  4B3T Q;  2R93 G;  2F52 A;  2K5V A;  3NEN A;  5C3E H;  1WCM H;  4A3G H;  2WB1 G;  4QY7 A;  1CSP A;  4BBR G;  3CME A;  3PO2 H;  3CCS A;  3G71 A;  1E3P A;  2OQ0 A;  1HNW Q;  4JI6 Q;  1CKN B;  1IBM Q;  1N33 Q;  4A93 H;  1YBY A;  4DV3 L;  2KHI A;  1XJV A;  4GKJ L;  4R4Q A;  4IO9 A;  4GS3 A;  1Q12 A;  4B3S Q;  4DAM A;  2B63 H;  4A3F G;  3AEV A;  1XMO L;  1J5E Q;  3CPW A;  3CCE A;  2YTV A;  1QUQ A;  4TQU S;  3HFZ B;  3T1H Q;  3I4M G;  3RZO H;  4GNX A;  3GTK H;  1KAW A;  1HZ9 A;  4DK6 C;  3E9H A;  1C9O A;  3MXN B;  3ULL A;  4OX9 L;  3ICE A;  4R1J A;  2ZM6 Q;  1B7Y B;  2VQF L;  5JJL A;  3HKZ E;  2JEB I;  1C7Y A;  4JI0 L;  3PO3 H;  3S1R H;  4K0K L;  2RHQ B;  4UP8 A;  3STB C;  4XIG S;  5C0X J;  2KBN A;  3PUY A;  1V9P A;  3J81 i;  4DV5 Q;  2JK8 A;  1VS0 A;  2MFI A;  4BY1 G;  3PIO A;  1IYJ B;  4HID A;  3OW2 A;  1QVC A;  4A3J G;  1YJW A;  2RF4 A;  4LF4 L;  1XNR Q;  4QJF A;  3S2D H;  3I56 A;  2EIF A;  4EX5 A;  5BR8 L;  3A5U A;  4LUO A;  5M3M G;  3M4Q A;  3UDI A;  3W1B A;  5FJ8 G;  1YHA A;  4GNX B;  3DLL A;  1CUK A;  1G29 1;  2I5H A;  4DUY L;  1TWH H;  5IYD G;  3M3Y H;  1GO3 E;  4IFD G;  1EUJ A;  2JA7 H;  4A3K G;  2F4V L;  2WB1 E;  3BU2 A;  3KJO A;  2I0Q A;  1NE3 A;  1AH9 A;  4WJ4 A;  1OXV A;  4NXM L;  1FVI A;  3KDF B;  4BXX H;  4L5S A;  1RL2 A;  2K4K A;  1HR0 L;  1OXU A;  4YY3 Q;  4YHH L;  4XTC S;  4X64 Q;  1E22 A;  4DV0 Q;  4PMW A;  4JI3 L;  2YTY A;  1E7Z A;  2YYZ A;  4OON A;  3M85 A;  4AH6 A;  4DK3 C;  4C3I H;  1VQ8 A;  3GTO H;  1SFO H;  4LF6 L;  1KQS A;  2N8N A;  5FLX c;  5LMN L;  4YWM A;  4R4T A;  3S14 H;  4DR5 Q;  2UXC Q;  4JBK A;  2N78 A;  1U5K A;  2JA9 A;  4JYA L;  2GVB A;  1VQP A;  3I4N H;  1QZH A;  4A3C G;  5IWA Q;  1UE5 A;  4DR4 L;  3OTO L;  5GQO A;  1VQC A;  4O2D A;  1K0R A;  3CP0 A;  4A76 A;  2VUM G;  2UXD Q;  1CSQ A;  3MEF A;  3RLF A;  2NVQ H;  2V1C C;  2ASB A;  1DGS A;  5M5W H;  4GOP C;  1TWG H;  2ZJR A;  3TRZ A;  1J6Q A;  1MJC A;  3FHW A;  5DLQ E;  1I3Q H;  1XNQ L;  3JC6 6;  4JI7 Q;  3E0E A;  2WAQ G;  4ME3 A;  4DUZ L;  4POG A;  4TVA B;  1WYD A;  2CKZ B;  3B6Y A;  4IJH A;  4C2M H;  5GAD C;  1S40 A;  4DV2 Q;  1BBU A;  1VQD A;  4A3B H;  1YZ6 A;  5FLM H;  5M3F G;  4JI5 L;  4HJ5 A;  4DR7 L;  2R7Z H;  1FJG L;  3S1N H;  4JOI C;  1QZG A;  1L1O A;  3BZC A;  3RN2 A;  2C35 B;  4GN5 A;  4DR1 Q;  1PH4 A;  4B3M L;  3GTM H;  3ER0 A;  1QVF A;  2R93 H;  2GN5 A;  1VQB A;  4JI4 L;  3FKI G;  4NXN Q;  2Z6K C;  1EQQ A;  3K81 C;  3HOW G;  2E8G A;  3HOX H;  4BBR H;  3EIV A;  3HOV G;  4AIM A;  2IX1 A;  4OO1 G;  3K7A H;  1TWA H;  1E1T A;  4P71 A;  4BBS H;  3EBE A;  5JJK A;  4DV7 L;  5IP9 G;  3BZK A;  4A3E G;  1KXL A;  2ES2 A;  1IL2 A;  2RCN A;  4ALP A;  4GKK L;  4JV5 Q;  3DM3 A;  2VQE L;  4A3F H;  4AQY Q;  4Y52 H;  3H0G G;  1X65 A;  4A3L G;  1O7I A;  1IZ6 A;  1WFQ A;  2YTX A;  2ZTE A;  4LFC Q;  1N8R C;  3S16 H;  4DR3 L;  3I4M H;  1GKH A;  2PI2 A;  1I50 H;  3CXC A;  3VDY A;  1E1O A;  3CQZ H;  4DR2 Q;  1KC8 C;  1LM0 A;  3A5Z B;  5HY6 A;  1A62 A;  4C3H H;  4L5T A;  1TWF H;  1UEB A;  2K5H A;  3PUW A;  5HGQ A;  4QGU A;  3JAM c;  1K83 H;  1XMQ L;  5GAG C;  3CCQ A;  5J3B A;  4X62 L;  2R7D A;  1H95 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...