4GN3B

Obody am1l10 bound to hen egg-white lysozyme
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
110
structure length
105
Chain Sequence
b'GSVYPKKTHWTAEITPNLHGTEVVVAGWVASLGDYGRVKIVKVSDREGGAAVSVYLEYGKTPDHLFKVFAELSREDVVVIKGIVEASKAAGVEIFPSEIWILNKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Lysozyme C
publication title Tracking Molecular Recognition at the Atomic Level with a New Protein Scaffold Based on the OB-Fold.
pubmed doi rcsb
source organism Pyrobaculum aerophilum
molecule tags Hydrolase/de novo protein
total genus 19
structure length 105
sequence length 110
chains with identical sequence D, F, H, J, L, N, P, R
ec nomenclature
pdb deposition date 2012-08-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gn3B00
4DV4L 1PH1A 4JBKA 4X62Q 1NBWA 1HNXL 3PUXA 3EN2A 1XMQL 3G6EA 2B63G 1W3SA 2E2IH 2VQEL 1R9TH 2AMCB 3HKSA 5M5XH 2DUDA 2D0PA 4YCWA 1N36L 2GVBA 3PO3G 3RN2A 2OTJA 2R93H 4B3TL 5HY6A 1J5EQ 4P72A 2UUBL 3CCRA 1PHJA 1K8AC 4L5QA 3SGIA 1SLJA 1JJ2A 3T1YQ 2JA8H 1S3OA 3CCUA 1I3QH 3OTOL 2IT1A 1VCIA 4PZ8A 3M7NA 3OW2A 1VQOA 1S72A 2PQAA 3PV0A 1YJWA 3UDFA 5AJ3L 2E5LL 3U4ZA 1YVCA 2R93G 2VNUD 2K52A 3BZKA 1P16A 5C4JH 2UUAQ 1C7YA 4QL5A 1Q12A 1Q1EA 4RG1A 1LYLA 1QVGA 4JBMA 3HOUH 2UXDQ 3UE0A 3I4OA 1J6QA 4JOIA 3D0FA 2B3GA 1Y1WH 3CP0A 4DUYQ 1VQPA 1ASZA 4A3CG 3CPWA 3UDXA 2R92H 4OX9L 4LFBQ 4GKKL 2KHIA 2Q2IA 4DR2Q 4NPSA 3CCVA 2A19A 3J81j 4DV2Q 1E24A 5FLMH 3TREA 4DV0L 1YHQA 4DR1L 4DV6Q 1EUJA 1KAWA 4OWTB 3PUZA 2UU9Q 5GAEC 5JJIA 2B29A 5IE8A 2KCMA 1IBLQ 4AIMA 1C0AA 4YCVA 4LF5Q 2WAQG 3CCMA 1GD7A 1XMOQ 3HOUG 2E8GA 2K5HA 4GN5A 4X64L 5BR8L 1DGSA 2KENA 4JI8Q 3RZDH 1Y1WG 1XNQQ 4DR7L 3I7FA 3EBEA 1OXVA 1CSQA 4DR6Q 1EOVA 2QEXA 3F2DA 1VQFA 4GNXA 1QUQB 2PMZE 2OQ0A 3CAMA 5FLMG 2JA6G 4LUOA 2Y0SE 5FJ8G 1LM0A 1WJJA 1HZAA 3RNUA 1IBKL 4QY7A 1YNXA 2JA7G 4GKJQ 1HZCA 2Z6KA 3FP9A 2CKZB 4DV1L 3U4VA 4UP9A 4JI6L 1GVPA 2N3SA 3ULPA 4X62L 1B70B 2CWPA 4KHPQ 1JJCB 3STBC 4BXXG 4OO1G 1PV4A 4HJ7A 2NN6G 1V9PA 1VQKA 2UUBQ 3HOWH 3F1ZA 4UP7A 1HZBA 5JEAJ 3CPFA 4C3JH 4DV3Q 1N33Q 2CQOA 4QJFA 2IHEA 5IYBG 3GTKH 1CKNA 2RCNA 1J5EL 3HOXH 3OTOQ 4LF4Q 5JJKA 2UUCL 3K8AA 3FHWA 3BZCA 3S15H 4A3LH 3T1YL 4LF8Q 1VQIA 1VQEA 3CC7A 2ZTDA 3UE1A 3AYHB 4R4CA 1VQHA 4WJ4A 4LUZA 2F4VQ 5M3FH 5M5WH 1KHIA 3PSIA 3KJOA 2K14A 1YJNA 4BY7H 5H1SE 4IO9A 3JC66 1IBMQ 3S1QH 3AFPA 2YTXA 4L5SA 3HOVH 4GKKQ 2N49A 3KF6B 3I55A 2UUAL 1IXRA 1YI2A 1HR0Q 3HOXG 4JC0A 4A3JG 2E2JH 3ULLA 1VQ4A 4DV5Q 4R4TA 1SRUA 2Q2UA 1HH2P 4LFBL 4LF9Q 4O0AA 1UE7A 1Y14B 1WOCA 3RLNA 1G291 5HGQA 3J80c 1FGUA 4DR2L 4NXMQ 1X55A 2QA4A 5LMUQ 4DV2L 1HR0W 3GTQH 5GROA 3J81c 4A3BG 2UU9L 1Q46A 4BY7G 4C3HH 4R4QA 3I4MG 1HZ9A 2EXDA 1L0WA 1PH2A 1IBLL 1I5FA 3WWVA 1VS0A 3M4PA 4A3DH 3J7A5 4LF5L 4J15A 1Z9FA 1TWFH 4IFDI 2WFWA 2NZOA 3L2PA 4JI8L 1KRSA 1OTCA 1XNQL 1TWGH 4YWLA 2MQHA 4GNXC 4AYBG 4DR6L 1WI5A 4R4OA 3DLLA 4LF6Q 1RIPA 4B3SQ 1TWAH 5LMNQ 4JI3Q 4IPGA 1BBUA 3GO5A 2A8VA 1VQAA 4GKJL 4A3GH 1A62A 5E7NA 4DAYB 3PCOB 2HQLA 1QVCA 1UE6A 4GLXA 4DR5Q 2JQOA 1V43A 3KYHC 1BVSA 4HJ5A 3HFZB 3KDFB 5LMNW 4DK6C 4JV5Q 3CCLA 3G4SA 3S1MH 1YHAA 1X3EA 5DLQE 4A3KH 1BKBA 2OCEA 3W5OA 3RZOH 5IP9H 4DPGA 2UUCQ 3F8TA 4LFAQ 4KI0A 4EQ5A 4DV3L 4A3GG 2KHJA 1N33L 1KRTA 5C0XJ 2JA5H 4A3CH 1Q1BA 4A3FH 4JI5Q 2RHSB 1CUKA 4JI2L 5IY0A 2K75A 1VQJA 1OXTA 1L1OA 4R4IA 4UPAA 1K9MC 1OXUA 1KQSA 4LF4L 2JEAI 2N78A 4YHHQ 4ME3A 2RF4A 4LF8L 4A3KG 3TRZA 1SE8A 2ASBA 3S16H 1Q81C 2NVQH 5IP9G 1WFQA 1X3GA 2UXCQ 4A3MG 2F4VL 3KOJA 1PH6A 3GDEA 4A4IA 5IYDH 2WAQE 2Q2TA 1IBML 3MXNB 2HHHQ 2JA5G 3PO2H 1VQDA 2AWOA 4A3FG 3VDYA 3CD6A 3E9IA 4L5RC 2K5NA 1HR0L 3CCQA 2HT1A 3M4QA 1PH8A 2JA6H 4NB3A 3S1NH 4DV5L 1U0LA 5FJ8H 4LF9L 3NEMA 2JA7H 1JJGA 4XTCS 1BBWA 2DGYA 4BY1G 3TQYA 4A3IG 1KD1C 5C0XG 4NXML 5LMUL 1NMGA 2VQFQ 1K8GA 3GTGH 4GOPA 1N32Q 2OWOA 2AWNA 5IYDG 1UEBA 2WB1G 1MJEA 3PO2G 2IX1A 3W1GA 4OONA 3CQZH 2R7ZG 3ER0A 4BXXH 4C2MH 5FLXc 1D8LA 3HKZG 1X54A 1I6HH 3PF4A 2KCTA 2E2HH 2ALYB 2VL6A 3CF5A 4OWXB 4LF6L 4DR4Q 5IYBH 4BA1I 4B3SL 4BBRG 4DR3Q 4XIGS 5LMNL 4JI3L 1KXLA 1EFWA 1OXXK 3S24A 1K3RA 4AH6A 3KJPA 1AE3A 1SFOH 2ZJQA 2FXQA 2AKWB 3I4NG 4JG2A 2NN6I 3PUYA 1K83H 2UXBQ 4YY3Q 3S2DH 4DR5L 3T1HL 3S17H 2I5LX 1NJIC 4JV5L 1SMXA 4B3RQ 3A5ZB 3AEVA 3K7AH 4K0KQ 4UY8C 3CXCA 2I5HA 4JI2Q 4P73A 1SN8A 1U5KA 3S2HH 3NELA 3KFUA 4A3JH 3D31A 4IPHA 1NTGA 4LFAL 1X9NA 3IRBA 3MEFA 3TEHB 4JI5L 1IZ6A 3HOZH 2XTIA 1CKOA 2PQAB 1WYDA 4YHHL 1A63A 2Z0SA 2F3IA 4X66Q 5IWAQ 3H15A 4ALPA 1VQ7A 2R6GA 4A3BH 4JBWA 4P71A 4L5TA 3I4MH 1NMFA 2GN5A 4POGA 1AE2A 4KHZA 4JI7Q 1A8VA 4JOIC 4LF7Q 2UXCL 1HNZQ 3K80C 4GN4B 5J3BA 1EYGA 5M3MG 4LWCA 1VQBA 3S1RH 2HHHL 4JI0L 3HOZG 1KC8C 4MTNA 1XNRQ 1T9HA 4TVAB 2D62A 4AYBE 1PYSB 1B7YB 4HJAA 2BH8A 1MIUA 3GTOH 4A3DG 4RMFA 1WCMG 1VQGA 2JE6I 1FVIA 3ICEA 4IJLA 4KHPL 3EIVA 1Y1VH 1KIXA 2PI2A 2VQFL 1YHBA 2R7FA 2ZTCA 2MO0A 4GN3B 2ZM6Q 1N32L 3OYYA 3H3VH 2A1AA 1HNWQ 4GNXB 5ELNA 1E1OA 2OTLA 3CW2C 2IY5B 1YJ9A 1X56A 2Q2HA 1X65A 5IYCG 2ZJRA 3CC2A 4NXNL 4X6AH 3M9BA 4MNOA 1QZGA 4OXPA 1G51A 2Z6KC 4DR4L 3K7UC 4PMWA 5K36G 4DR3L 1Y1VG 3LGJA 2NVYH 3PIOA 3T1HQ 4DNIA 1UE5A 5ELOA 1JE5A 4IPCA 4R1JA 3PIPA 3Q8DA 3E9HA 4BBSH 1M90C 1IYJB 1GO3E 4JI1Q 2UXBL 1OXSC 4YY3L 4IJHA 1QUQA 1XPOA 2OQKA 5JJLA 4Y52H 4A3MH 3PGZA 4LNQA 1LUZA 4B3RL 1PVOA 1CKNB 2I5MX 4LFCQ 4K0KL 2D0OA 1Q8KA 1AH9A 4PZ6A 3BJUA 1JB7A 4GLAC 3K0XA 4GS3A 1PH9A 1VQ5A 2YU9H 5C4XH 4JYAL 2KBNA 4BBSG 2CCZA 4YWMA 5IP7G 4OWWB 4A3IH 1YITA 1YZ6A 4BY1H 4POFA 4IOCA 3GD7A 1JMCA 3K81C 1TWHH 2MFIA 4X66L 2JK8A 5IWAL 3U50C 3UDIA 2NZHA 3GTJH 2VY3A 1PYBA 2RHQB 1FL0A 2JEBI 4DV7Q 4JI0Q 4JI7L 3PUWA 1KL9A 1Q86C 4C3IH 3CCSA 5C44H 2WB1E 4LF7L 2R7ZH 4P74A 3GTMH 1HNZL 2WP8J 3TS2A 1I50H 2CWAA 1FJGQ 1E22A 3H0GH 5C4XG 2HIXA 3F2BA 1UWVA 1RL2A 4A75A 2MNAA 5C0XI 2K5VA 3HKZE 1NY4A 1VQLA 1HJPA 2EQSA 3DM3A 4BBRH 1XNRL 4B3MQ 2EIFA 1VQCA 3L0OA 1E1TA 4DUZQ 3J7ZC 4TQUS 4YWKA 4DKAC 2YTYA 5M5YH 3I4NH 1TWCH 5C3EH 3KF6A 5C44G 2JA8G 2VS1A 4UP8A 2ZM6L 2I0QA 4NXNQ 1HNWL 3A0JA 2HIVA 3H0GG 1N34Q 1X3FA 1Z47A 1GM5A 5GQOA 4QGUA 1JT8A 3CCJA 3W1BA 3PF5A 1XPUA 1L2FA 4HIDA 2NVXH 1TXYA 4HJ8A 1LTLA 3GTPH 1V1QA 1E3PA 3L7ZC 4HIKA 4JCVE 4DK3C 3CMAA 4A93H 4GLVB 2VUMH 1D7QA 2LXJA 1I94L 2YV5A 2ATWA 4A76A 4OO1I 4AQYQ 5C3EG 3KF8B 4X65Q 1XJVA 2N8NA 2BH2A 3BU2A 4Y7NH 2R92G 1YBYA 2C35B 1YIJA 1Q7YC 1W2BA 1O7IA 2ES2A 5EAYA 1EQQA 1P8LA 2JA9A 4JI4L 2R7DA 4JI1L 1PFSA 1GKHA 4LUVA 3U58A 1M1KC 1IBKQ 4A93G 2K4KA 1XTDA 1A0IA 3I2ZA 4DV4Q 2VUMG 5M3MH 2QGQA 1HNXQ 2V1CC 1XMQQ 1L1OB 3HOYH 4JYAQ 2YTVA 4LFCL 1L1OC 3RLOA 2VQEQ 1PH5A 1N36Q 3G71A 1Q82C 2VW9A 1VQ8A 1YEZA 3UDGA 1H95A 4QQBX 1EWIA 3STBD 3KDFA 4B3TQ 1NE3A 3RR5A 1QZHA 1C9OA 1B8AA 2H5XA 2ID0A 2Y0SG 3ERSX 3AFQA 1WCMH 4LW1A 4PG3A 2VZAA 3CC4A 1EIFA 1CSPA 3A5UA 4MZ9A 3M85A 4EX5A 3B6YA 4JBJA 1X6OA 1N8RC 3HOYG 1G6PA 4QIWE 1FJGL 2AHOB 4DV7L 2ZJPA 4KLKA 1PH7A 5IYCH 2PI2E 5GAGC 5AJ3Q 3I56A 4A3EH 2E5LQ 4HIOA 2L15A 2MO1A 4H02A 3F2CA 1MJCA 1S40A 1PH4A 4IFDJ 3KLWA 2JJQA 1EQRA 4GOPB 2PNHA 4GOPC 3HOWG 4WJ3M 4IPDA 4B3ML 3CCEA 4HJ9A 4IOAA 1IL2A 2NVTH 1SR3A 3GTLH 4OX9Q 1VQNA 5IT9c 2IX0A 4O2DA 4DUZL 1EIYB 1VQ6A 2UXDL 3A74A 5GADC 4DV0Q 4DR1Q 4DUYL 4A3LG 3FKIH 3NENA 1PH3A 4A3EG 4PZ7A 1UE1A 5JEAG 3CMEA 1N34L 3G48A 4FDBA 1K73C 1MKHA 2K50A 3AQQA 3ZJYC 2LXKA 1I94Q 3J80i 1ASYA 1SROA 5BR8Q 4X64Q 5M3FG 1VQMA 1QVFA 4DV6L 3H3VI 3RLFA 1PA6A 4DR7Q 1E7ZA 4HIMA 3JAMc 2XGTA 3PUVA 3J81i 3HOVG 1K0RA 2ZTEA 3E0EA 3JAMi 1XMOL 1CKMA 2B63H 4P75A 4APVA 5IP7H 4X65L 4AQYL 3RN5A 4DAMA 4JI4Q 3NBHB 2YYZA 2F52A 3M4OH 4IFDG 3FKIG 3ULJA 3PO3H 1VQ9A 2LSSA 2BA0A 3M3YH 2IHFA 3TS0A 2GVAA 4YCUA 2BA1A 1XPRA 1N9WA 4DV1Q 4JI6Q 4BA2I 5GAHC 2CFMA 3S14H
chains in the Genus database with same CATH superfamily
1PH1A 1NBWA 1NUCA 1HNXL 3PUXA 3K7AB 1W3SA 5ELDA 2VQEL 1R9TH 2RKSA 5M5XH 2F3WA 1EYDA 3S2HB 2KA7A 3OW7A 4YCWA 1U4MA 2GVBA 5E4WC 4DAPA 2OTJA 4RHRA 5HY6A 2DNCA 4HMIA 4CJ2C 1SJED 1ENAA 3V96A 3HOZB 4FO2A 3BVMA 4A3DB 3CCUA 5EKIA 1SDFA 2ENBA 1I3QH 3I4MB 1LTID 5LHY1 3M7NA 2V4DA 4KKTA 1STGA 1VQOA 1YJWA 1S72A 3Q24A 1KLUD 3BZKA 2UUAQ 1C7YA 1DXMA 1Q12A 3GV3A 3I4OA 4JOIA 3D0FA 4S3SA 1Y1WH 5CV6A 1YNNC 2F0NA 2R92H 3UDXA 4OX9L 2XRSD 1EY8A 2Q2IA 4NPSA 3VYSA 3SVMA 1K28A 1E24A 3SK6A 2EY6A 1T5EA 1EUJA 1HCZA 2RSOA 3PUZA 4IUTA 2B29A 2A68C 4ZUJA 1IBLQ 4ZAIA 2E8GA 5BR8L 3C1FA 3I4LA 4DR7L 1OXVA 3MVVA 3HEJA 1G6ZA 1EOVA 3F2DA 4KY6A 4GNXA 3VYRA 2PMZE 2OQ0A 2WV6D 4RH6A 5FJ8G 2G9DA 3ND9A 1FD7D 1HZCA 3FP9A 1I6VC 1TKWB 3U4VA 1XWEA 4UP9A 4JI6L 1GVPA 3M7GA 3DUZA 3KBGA 2CWPA 1JJCB 3STBC 3MA2B 2NN6G 2UUBQ 3VR3A 4UP7A 5JEAJ 2N55A 2CQOA 5IYBG 5C4XB 3BDOA 3NSWA 2HUGA 2RCNA 1J5EL 2JSOA 3OTOQ 2UUCL 4BY1B 3K8AA 1BOSA 4G4KA 5CV7A 1KLGD 3BZCA 2Z9HA 3UE1A 4K6DA 3AYHB 5J1ZA 1HHVA 5C44B 2Z8LA 2VB2X 2VXWA 3PSIA 3KJOA 4WORA 2YTXA 3H0GB 4L5SA 2QCPX 5EBCA 1SYEA 3HOXG 3ULLA 4BBRB 1VQ4A 2OT2A 4DV5Q 1BBXC 1ICFB 2Q2UA 3J80c 1G291 3BG3A 1FGUA 5M5YB 1NAPA 3I4NB 2MUYA 4DV2L 5D65A 3J81c 4A3BG 1SEBD 1D6EC 1Y8NB 1B3AA 2BDOA 1PH2A 4CDEC 3WWVA 3OSOA 2NZOA 3GTPB 1DM0B 4A93B 2MQHA 4GNXC 1QWYA 4B3SQ 1JR0D 1PFNA 1KDCA 2CQAA 5G3LF 4GKJL 4Y7NB 4C3HG 2PMZB 3PCOB 4GLXA 1V43A 4HJ5A 1BVSA 1FNUA 4DK6C 2ZXOA 3KF8A 1IW7C 3S1MH 5IODA 2DN8A 5BN4A 4DPGA 1MGSA 2PZTA 4LFAQ 4OL7A 2JA5H 4A3CH 1Q1BA 4P2CB 1I4HA 4JI2L 5IY0A 5IOCA 1K9MC 1KQSA 2JEAI 4YHHQ 2EJMA 3KBXA 4ME3A 4E6IA 2RF4A 2EZVA 2RQXA 4LF8L 1SE8A 3QIAA 1Q81C 4A3MG 2F4VL 1EZ8A 5EPJA 3L9AX 1IBML 2AUKA 3FRPB 4L5RC 2K5NA 4HSVA 2HT1A 4C56C 3PIP3 3S1NH 3A8JE 1F9PA 2A74C 2JA7H 5I6YA 3TQYA 3TP6A 4NXML 1C4QA 5LMUL 4HAEA 2F0TA 2OWOA 1S5CD 3PO2G 4IZ8A 3W2DA 4IUUA 2R7ZG 4BXXH 3SK4A 5FLXc 4O42A 3HKZG 1X54A 2KCNA 4WRDA 2FJ2A 1EFWA 3T51B 3M4OB 1K3RA 3H94A 4KKSA 2ZJQA 3IFTA 2O5IC 3SHLA 5K5PA 1ENFA 2R61A 3VR4A 1AZQA 3S2DH 3D4WA 5I9OA 3C1EA 3R93A 3MXUA 3S14B 2X6LA 3CXCA 2EYJA 1SN8A 2RDGA 1W6JA 3NELA 2E2IB 4JPBW 2F0WA 4RFBA 4RWSC 3BS1A 4JK1C 2R93B 5CMDA 3IRBA 3MEFA 1GUOA 2FHTA 3MWYW 1B1ZA 2EY2A 2PQAB 2QILA 3U9OA 2LFNA 2PYKA 1A63A 1HA5A 1U4PA 2R6GA 2FINB 4JBWA 1WTHA 3HGBA 4KHZA 2KECA 1ICWA 3K80C 2WINB 2CH4W 1VQBA 3S1RH 5C4JB 1HUMA 3HOZG 2D62A 1PYSB 4MIUA 4B9WA 1MSGA 3E5SA 4A3DG 4K5XA 5DAUA 4I65A 1WCMG 1ZEQX 4XQJA 3FVQA 1QNKA 1VQGA 1VMCA 1TVXA 2IJ0A 3X3MA 1KIXA 2RSNA 2ZTCA 4GN3B 1BCPF 4R8IA 4OGQC 2B2TA 1EYAA 1E1OA 1YJ9A 2B2UC 2OF1A 4X6AH 3J80L 2F0GA 1G51A 2Z6KC 4DR4L 3K7UC 4PMWA 3J81L 3BVZA 2PW5A 2NVYH 3T1HQ 4DNIA 1VF7A 1O7LA 5JPMC 4CBVA 3DXJC 1EY4A 1M90C 4JI1Q 2UXBL 2B2VA 5JJLA 4LNQA 3SXHA 1QILA 2I5MX 5DM63 1IKLA 2K33A 1HRJA 4LFCQ 4K0KL 2D0OA 2Q8IB 1Q8KA 5EQ0A 1AH9A 1JB7A 4GLAC 1PH9A 5CGKA 4BBSG 3FDTA 3GTKB 4OWWB 1YZ6A 4CJ1B 1JMCA 1SYGA 1TWHH 5IWAL 1A3TA 2RHQB 4RGMA 3E0JA 1C8CA 4ZK9B 4JI7L 1FJGQ 3PUWA 1KL9A 4LF7L 3GTMH 3TS2A 1HNZL 1I50H 5M3FB 5M5WB 1LT6D 5C4XG 1KNEA 4DXFA 3GTLB 2HIXA 3F2BA 3S1QB 1UWVA 5FO9B 4A75A 3HOVB 4GZYC 4BS9A 1NY4A 4HTHA 1SSOA 4YIJA 3L0OA 4J6HA 2HDMA 4DKAC 3J7ZC 3DWPA 1HFNA 1TWCH 2NYZD 2L0CA 5C44G 2ZXPA 2ZM6L 2B2TC 1N34Q 4MN3A 3H0GG 1X3FA 1JT8A 2I07B 5GQOA 4QGUA 2HD3A 3OHXC 1D5ZC 1XPUA 4HIDA 1G91A 4HJ8A 2KEEA 3K5MA 1TU2B 3L7ZC 1F9RA 2A6HC 1D7QA 2LXJA 2ATWA 4RGNA 4OO1I 2BH2A 2N8NA 5CORA 5CBAE 2HQEA 1BR9A 2R92G 1YBYA 2A69D 5KNCA 1BCPC 4A3GB 5EAYA 5FLXL 4LUVA 2K1BA 1M1KC 4A93G 1XTDA 4DV4Q 2Z4IA 4KTAA 5M3MH 1XMQQ 2YTVA 4DAYA 1L1OC 1KTKA 3SDZA 4DN4M 3IAYA 1PRTB 1NE3A 2H5XA 3ERSX 1V8QA 1K8MA 1CSPA 4MZ9A 1H9MA 3M85A 4EX5A 1F2ZA 4JBJA 4I7ZC 3MFYA 2NVQB 1BXTA 5IYCH 2PI2E 4TRDA 1ZXTA 3I56A 1PZJD 2NTTA 4HIOA 4IFDJ 4GOPB 2JJQA 4IOAA 3RMHA 4EQNA 1Q8IA 4LJZC 2XWJB 1YNJD 2IX0A 5IT9c 1EIYB 2A5HA 4HCSA 2PZWA 5GADC 2DJGC 2K01A 1LTSD 1HUNA 3MXPA 1AZPA 1I94Q 1K73C 3NP8A 2K50A 4UAIA 1VQMA 2TSSA 3H3VI 1EEFD 1PA6A 3JAMc 1M4VA 2PQEA 3KLSX 3N6RA 4CDDC 1EY7A 4KD4A 2ZTEA 2B63H 2B2YC 4JI4Q 3RN5A 4X65L 3NPPA 1HA6A 2F52A 3ULJA 3K0YA 1WD1A 4PMCA 3EROA 2CHBD 4DNTB 1IBKL 1HTPA 4JBKA 1FNWA 4IN3A 4RHSA 3D4RA 1QOHA 3MEHA 4B3TL 1FNVA 4ABNA 2K5QA 3DHQA 4ZUIA 2WKDA 1HTLD 2UUBL 4LK1C 3IFDA 1B9NA 3SGIA 2O5JC 3T1YQ 4A3BB 3TZDA 1S3OA 3OTOL 3R2IA 1VCIA 4DA2A 4TSSA 1STYA 3K5LA 3OW2A 4F88A 2R93G 1YVCA 2K52A 5CYUA 3J7AF 4QL5A 1Q1EA 4JBMA 3HOUH 3CP0A 1VQPA 4FF1A 4A3CG 3CPWA 1LTAD 2XNAC 4FF3A 4LFBQ 1CT1D 2KHIA 1CZGA 1TY0A 2FFKB 2XIWA 2O2LD 3LX0A 2F0DA 3CCVA 1SYCA 3J81j 4KY7A 5FLMH 4ULLA 3TREA 1KAWA 5IE8A 2BE5D 2KCMA 2PZUA 3NWTA 4LF5Q 1GD7A 4X64L 5CR3A 2G5DA 3QWNA 1XNQQ 1II3A 1IYVA 4ILWA 1TY2A 1U4RA 1LM0A 1HZAA 3ITPA 1EIHA 2JA7G 3CRKC 1TS5A 5KIXA 4ZCKA 3QJYA 4ME5A 5IGCA 5T1IA 4U673 4A3MB 3PMFA 4KK7A 4X62L 4BXXG 1BO0A 4HJ7A 4DGZA 4L63B 3HOWH 3F1ZA 4DV3Q 4C3JH 3LWEA 4HSPA 4M1UB 1CKNA 4UHVA 1WTWA 5JJKA 3ERQA 4LAAA 3FHWA 4KHVA 4K5WA 3BVGA 3MXGA 5JEAH 3GTJB 1EZ6A 3CHBD 1VQHA 4QMGA 2R7ZB 3NUCA 1KHIA 3EA6A 2K14A 3OIQA 4BY7H 4IO9A 3HKZB 1MBYA 1PXUA 4GKKQ 2N49A 3KF6B 5D3IB 1YI2A 1HR0Q 1HFGA 1CTMA 1STEA 2L12A 4LF9Q 4O0AA 1UE7A 5HGQA 5C3XA 4DR2L 1X55A 4MHEA 5C3EB 3GTQH 2UU9L 3P20A 4R4QA 2CW0D 4R8NA 5A2QL 1HZ9A 1I5FA 4J15A 3GV6A 1UUPA 4IFDI 3L2PA 3Q22A 4JI8L 5IT9L 1TWGH 1RF2D 3NWSA 4DR6L 4QF4A 2VUMB 1RIPA 4CKEA 2BCOA 1I4XA 5LMNQ 1BBUA 5ELCA 2E2DC 2HQLA 3TDQA 1CHPD 2F0IA 2M2LA 3EQLC 3JAML 4JV5Q 4ZKCB 3HFZB 3KDFB 5KNBA 2QDLA 2F3VA 2OEOA 3U9SA 3G4SA 2KUMA 5DLQE 4A3KH 1BKBA 2OCEA 1MI2A 3W5OA 1SNPA 3HOYB 5IP9H 4DU9A 3SEBA 4XQNA 1MSHA 3F8TA 4KI0A 4A3GG 4KJNA 1N33L 1KRTA 4H7BA 4A3FH 1EY6A 1EU3A 4R4IA 1VQJA 1WCMB 4UPAA 4LF4L 3J7AV 1NCVA 1TS2A 2N78A 1HPCA 3MFGA 4QIWB 1Y69U 4G7OC 5C4HA 4KJOA 1IHZA 5HURA 1PTOD 3GDEA 1D5MC 2P5ZX 1V1PB 3MXNB 1VQDA 4CKCA 2Z1CA 1GUSA 3A55A 1WTQA 1PH8A 4NB3A 1C48A 1U0LA 2NVTB 1JJGA 4XTCS 4PV1C 1EQTA 4KHPQ 5C0XG 3GTGH 1NMGA 2VQFQ 1K8GA 5M9OA 2AWNA 2F0HA 3FKIB 1UEBA 3MTSA 5C5LA 5IYDG 3W1GA 4OONA 4HCEA 1R4PB 3I72A 4C2MH 4OO1H 1DOKA 1D8LA 2I46A 1I6HH 2KCTA 2E2HH 3CF5A 4OWXB 1WTOA 4LF6L 4DR3Q 4XIGS 4JI3L 4BBSB 1KXLA 3R8BA 1AE3A 4DXGA 3PO3B 2J0TD 2KEDA 4JG2A 2NN6I 4RKBA 1K83H 4YY3Q 4DR5L 2K32A 3T1HL 2I5LX 1NJIC 1SMYD 1SMXA 3NBHA 1CK1A 1CZWA 2KCCA 4P73A 1R9TB 5M5XB 3KFUA 1ONLA 4A3JH 3J81E 4LMQD 4JI5L 1IZ6A 3QOLA 2XTIA 3NQTA 1RHPA 1A3UA 1EU4A 1RTOA 3D3RA 1KABA 2F3IA 4FP5D 2JYOA 1I3QB 4JOIC 2NZ1D 2F0PA 2L55A 2UXCL 5M3MG 1I4QA 2HHHL 2B8GA 2F1MA 4MTNA 4XT3B 4TVAB 4BWGB 4AYBE 3FPUB 1Y1WB 2BH8A 3GTOH 1PYWD 2R92B 1H9SB 5FKAC 2EYMA 5K36H 4IJLA 4B9XA 1Y1VH 2VB3X 2Q8RE 1YHBA 1ILPA 2DNEA 3P7JA 1N32L 3OYYA 3H3VH 4OELB 3NTHA 2F0SA 5ELNA 2CH4A 2IY5B 2OTLA 1X56A 5IYCG 1CA5A 3CC2A 4HR7B 4PQXA 2F0VA 1Z6HA 4KN4C 5I2YA 1B4OA 1GUWA 1UE5A 3PIPA 2QW7A 3R2TA 4RCOA 1QNUA 4DF7A 1OXSC 4ZYSA 3EJIA 4IJHA 2OQKA 4L6TB 4B3RL 1X32A 5IIFA 3VA7A 1GHKA 4PZ6A 3BJUA 3OMCA 2BOSA 2EOTA 3K0XA 4ZRZA 2YU9H 4H13C 1TR5A 2CCZA 1O80A 4A3IH 2KJXA 3GD7A 1EQVA 1PMRA 1JOOA 4X66L 2NZHA 2VY3A 1TIID 2JEBI 4JI0Q 4C3IH 2WB1E 1WD0A 2QEJC 1XX8A 3TSSA 3BDLA 1V1OA 4IUVA 1RL2A 1XNRL 3D8GA 4RAUC 2EIFA 4EVOA 3NXWA 4DUZQ 4AYBB 2EE1A 3O13A 1O78A 3BYYB 3S9WA 1SNQA 2FMMA 1EL0A 4NXNQ 1HNWL 3A0JA 1GM5A 3PF5A 1GOZA 2JP1A 1SYFA 2NVXH 1LTLA 1D5XC 2C5CA 3CMAA 4F8MA 1RD9D 1I94L 5AFWA 1STHA 3SK8A 1SXTA 3UI2A 5C3EG 4AQYQ 1XJVA 1BCPB 4K8JA 3TN2A 3NK9A 5IGBA 2C35B 1W2BA 2ES2A 1EQQA 4JI4L 3FEWX 3NTIA 3TP7A 3HS0C 1A0IA 3QR8A 2VUMG 3S1MB 1HNXQ 1L1OB 4XDXA 1A15A 3RLOA 1PH5A 2VQEQ 3E3XA 1WTRA 2XSCA 2VW9A 1H95A 1YEZA 3UDGA 2RCFA 4N9TA 3V05A 1QZHA 1ENCA 1F2YA 2JA5B 1R4QB 3KK7A 4PG3A 5E1FA 1CHQD 4OIKA 3CC4A 1AP0A 3B6YA 5G3LD 3HOYG 1G6PA 5TSSA 2G9HD 4DV7L 2ZJPA 4KN7C 4KLKA 2GA4B 3IKJA 5GAGC 4A3EH 3A7LA 4H02A 3F2CA 1MJCA 3KLWA 2PNHA 3HOWG 4C3JG 4H0LC 4WJ3M 3HP3A 4B3ML 3GTLH 1SR3A 3S1NB 4OX9Q 4O2DA 1DOMA 1D2BA 3A74A 3K5NA 2JA7B 1ESFA 4IFDH 1PDQA 3NENA 3MAQA 1UE1A 5JEAG 3RZDB 1LT3D 4FDBA 4DAVA 2LXKA 3J80i 5BR8Q 2WIIB 5JPNC 4XYQA 3RLFA 4DR7Q 5C4ZA 3J81i 1LACA 3E0EA 1CKMA 1CI3M 4DK1A 3FKIG 5E4XA 1VQ9A 2LSSA 5LL6S 3M3YH 3P1HA 1DOLA 4CGYB 5T1GA 1JWSD 1N9WA 3S2DB 1ZYRD 4JI6Q 1VQNA 5GAHC 3HG9A 5CV5A 3G6EA 2J7ZA 2E75C 1L0XB 3HKSA 4V190 1N36L 1QCBD 3PO3G 3RN2A 2X6GA 5HGTA 4OEMB 4QB4A 1J5EQ 2AQ1B 3CCRA 1PHJA 1K8AC 5FO7B 4L5QA 4XYOA 2B8FA 2JA8H 4KKUA 1EY0A 4RKLA 5KYIA 4WFN3 3NQIA 2PQAA 3PV0A 5AJ3L 2E5LL 3U4ZA 1BDOA 2VNUD 1P16A 3VA5A 5I2XA 3S1RB 1I4GA 4FXKC 2UXDQ 3LWUA 2DY7A 1RODA 4EGVA 1J6QA 5L37A 2B3GA 1SE3A 4DUYQ 2MPMA 4GKKL 4OHJA 1S5BD 2A19A 3K58A 1EFID 3Q0AA 4DV2Q 2KHSA 4DV0L 4X3KA 4DR1L 2KVMA 4DV6Q 4OWTB 5JJIA 3H3VC 1T5XD 4YCVA 5I4DA 3CCMA 1XMOQ 2NB0A 2K5HA 4GN5A 2F0MA 1Y1WG 2XRQD 1H9KA 3I7FA 1STAA 1CQFA 4FNFA 2QEXA 2A69C 1VQFA 1QUQB 2B2VC 2K5DA 2NN6H 3CAMA 5D3DA 2NVYB 4GKJQ 1WJJA 5CV4A 4QY7A 1YNXA 2L9HA 1ZKOA 3A8IE 2EYOA 2M00A 4C1NI 5A2QE 5KRUA 4DV1L 1SNCA 2N3SA 1STNA 3ULPA 4OO1G 4H44C 2AQ2B 1HZBA 3CPFA 4IUQA 4QJFA 2IHEA 2F0JA 4F87A 2R3ZA 4CDFC 3HOXH 3PQIA 4U68A 1PTOH 1F2LA 3S15H 4K5VA 4LF8Q 1TWHB 1VQEA 3TBIB 1F77A 4RGTA 2A6ED 2Z4HA 4R4CA 4WJ4A 2F4VQ 3GTMB 2WKCA 3JC66 1IBMQ 2UUAL 1E0BA 3A7AB 1YNJC 4JC0A 4A3JG 2E2JH 4R4TA 1SRUA 1H9RA 2E74C 4ZLTF 1Y14B 1WOCA 2NBFA 4NXMQ 1TWCB 2QA4A 5LMUQ 1FYCA 1HR0W 1Q46A 4C3HH 2EYPA 4UDUC 2EXDA 1IBLL 1VS0A 2QDBA 4IURA 3J7A5 4N8FA 1TWFH 2WFWA 2PO4A 1OTCA 1Q90A 4YWLA 5KNDA 4AYBG 1WI5A 3DLLA 1TWAH 3I70A 1XYIA 4DK0A 1A62A 3CRLC 2F0FA 5JAVA 1QVCA 4NP5A 5NUCA 2SDFA 5LMNW 2KQ3A 4K8IA 3CCLA 2TMPA 4KD3A 4K14A 5M3MB 3RZOH 1VMPA 1WTXA 1G2SA 2KHJA 5C0XJ 3Q23A 2RHSB 2K75A 4F7XA 1OXTA 4DNRB 4K6LA 1PZID 4DFAA 3TRZA 2ASBA 3S16H 3K59A 4HN7A 1NSNS 3IL8A 1AEXA 1WFQA 1SNDA 1X3PA 1UAPA 3KOJA 1PH6A 4A4IA 2WAQE 3PO2H 2JA5G 3PIO3 2AWOA 1LT4D 3VDYA 3CD6A 3E9IA 3CCQA 3VR5A 2EY5A 2JA6H 4DV5L 4O1NA 4A3IG 1BUVT 2DGYA 1DJRD 2BE5C 2F0LA 4GOPA 5IGEA 1MD2D 5LL6X 4X3TA 2WB1G 1MJEA 2MHVA 3CQZH 3K6OA 4C3IG 3ER0A 5D14A 4NKLA 4DR4Q 4BA1I 4B3SL 2B63B 3RUZA 3NBIA 2RBMA 3S24A 1SFOH 1U4LA 3EFXD 3I73A 4NDXA 2UXBQ 5I6WA 3S17H 3MC0B 4ODGA 1DD2A 1B2TA 3AEVA 1PTOF 3K7AH 4K0KQ 4UY8C 1JORA 3S2HH 3ND8A 3D31A 4IPHA 1NTGA 4LFAL 4HMJA 3HOZH 2MGSA 5F2DA 1PRTD 4YHHL 2Z0SA 4A3DH 5IWAQ 2KOLA 4P71A 3I4MH 1NMFA 2F0QA 4JI7Q 1LTGD 1A8VA 2EXZA 4LF7Q 2F0EA 1HNZQ 4GN4B 1EYGA 2LKVA 4LWCA 2AQ3B 2NUCA 4JI0L 5EKKA 4G7HC 3D4DA 3HOUB 5DM73 1K3BC 1B7YB 4HJAA 1MIUA 4IUPA 4RMFA 5CV9A 2JE6I 3A8KE 3ICEA 2CW0C 2PI2A 1E2ZA 2MO0A 2ZM6Q 1QB5D 4GNXB 3GQBA 1TS4A 3CW2C 3SR1A 2MP1A 2Q2HA 2ZJRA 4NXNL 3D6WA 1QJOA 3KUPA 1QZGA 4OXPA 4QCLA 3LGJA 1RTNA 5ELOA 1JE5A 4IPCA 4R1JA 3Q8DA 3E9HA 4BBSH 1IYUA 1IYJB 2H1EA 5IGFA 3VR6A 4Y52H 1LTTD 3PGZA 5BN5A 5BN3A 2LMCB 2RA4A 1RCVD 2A73B 3HOWB 4C3JB 4GS3A 5KEEA 5C4XH 5EPKA 1DCZA 2KBNA 2PNRC 2IX3A 4BY1H 3AMUA 1JWMD 4I7AA 2MFIA 1GUTA 3U50C 1PTOC 1RDPD 1PYBA 5EBDA 1Q86C 2Z6BA 3CCSA 5C44H 4XQQA 4CJ0B 2CWAA 2LS01 2DY8A 3H0GH 4NMZA 4BY7B 1NR4A 2MNAA 1EWCA 5C0XI 1VQLA 3DM3A 4BBRH 1NR2A 2CVRA 3BYTB 1VQCA 1AN8A 4YWKA 2D5DA 5M5YH 3I4NH 1YNND 3KF6A 4EQOA 2JA8G 3GTQB 2I0QA 1Z47A 1IKMA 1MHWC 3BDCA 1L2FA 2A68D 3GTPH 1V1QA 4A93H 1KDBA 4JCVE 1TWGB 1A6XA 2YV5A 1A3VA 4M8AA 4A76A 4V0BA 4RA8A 3KF8B 4X65Q 2SOBA 1JQYD 3BU2A 4Y7NH 2EDGA 1Q7YC 1O7IA 1SMYC 2JA9A 2R7DA 4JI1L 3J80E 1PFSA 3D6CA 1IBKQ 3I2ZA 4OIJA 4A3KB 4JYAQ 4LFCL 3N52A 5IGDA 2SNMA 2L11A 3G71A 1EYCA 1VQ8A 1ET9A 3VYUA 1EWIA 3STBD 1UNSA 3KDFA 4B3TQ 4QUFA 1B8AA 3I3CA 4A3FB 1E2WA 4LW1A 1F9QA 3GP7A 3V2TA 1O7ZA 2K04A 2VZAA 4K2LA 1EIFA 1S5ED 5EJWA 1N8RC 5JJZA 1FJGL 1IL8A 2AHOB 2ZT9C 1AFPA 3RD4A 3K5OA 3NE5B 2MO1A 1EQRA 3EVQA 2IW3A 4Z9CB 3CCEA 5C6AA 4HJ9A 3AU7A 3QG1A 3MZ5A 4X3UA 2NTSA 1VQ6A 1V1PA 1JCKB 2UXDL 3MXNA 3T16A 3GTGB 2ICEC 4DUYL 2JXMB 5DNFA 1GJXA 1PH3A 1BQQT 1N34L 3I90A 3CMEA 4K2KA 1MKHA 3MHBA 3AQQA 2H4OA 3ZJYC 1ASYA 3SE0A 4X64Q 4C2MB 4DV6L 3T4AC 2EPBA 1E7ZA 4HIMA 3G7LA 2XGTA 1I6HB 5ELBA 1JOQA 2E2HB 3SK5A 1XMOL 1HQMC 4APVA 5IP7H 2HDLA 1X3QA 1JICA 3M4OH 3I8ZA 1SNOA 1LO5D 2BA0A 2LY7A 2IHFA 4L8JA 1K83B 1XPRA 3URYA 4MTKA 3S14H 4DV4L 4X62Q 4Q5VA 3P75A 3EN2A 1XMQL 2B63G 2E2IH 1IW7D 2AMCB 3OOCA 3LNNA 2DUDA 1TQOA 2D0PA 2M9VA 1G8ZD 3E6ZX 4RCNA 4A3JB 2RDHA 1TS3A 5FLXE 2R93H 2RVLA 2K7VA 1NNXA 4CHTB 3L3OC 5I9PA 1KNAA 3QO2A 4P72A 2HCCA 1JJ2A 1SLJA 3HRZC 3DWAA 2IT1A 4PZ8A 3UDFA 5C4JH 5J39A 2JN4A 4RG1A 1LYLA 1QVGA 3UE0A 1ASZA 3GTOB 1PZKD 4DR2Q 2EJGC 1Y1VB 4N9PA 1YHQA 3WDNA 2UU9Q 5GAEC 4ZQ3A 2AUJD 4FVMA 4AIMA 1C0AA 3HOUG 1H9SA 2WAQG 1ET6A 1F2MA 1DGSA 2KENA 4JI8Q 3RZDH 4J8QA 3EBEA 4TKOB 1CSQA 4DR6Q 5J22A 5EGTA 5FLMG 2JA6G 3R3OA 2X69A 4LUOA 2Y0SE 2B2UA 3RNUA 1SYBA 1A2UA 3DM1A 2NWGA 2Z6KA 5IGGA 2CKZB 3H09A 1B70B 1EEID 1PV4A 1V9PA 1VQKA 2EYFA 4G57A 1N33Q 5FO8B 2YU9B 4RGOS 5EKLA 3GTKH 3ONAB 3DEPA 4LF4Q 1UEAB 1H9JA 4A3IB 1EY9A 1JWUD 1KDAA 4A3LH 3T1YL 1VQIA 3CC7A 2ZTDA 2N88A 1KAAA 2WB1B 3J7YW 4LUZA 2PCFB 4C3IB 2ZXRA 5M3FH 5M5WH 2FMCA 1YJNA 1S4ZA 5H1SE 3S1QH 3AFPA 4FXGC 4R9WA 3HOVH 3I91A 3I55A 3X3NA 1IXRA 1J8IA 1SNMA 3Q6SA 1G2TA 1HH2P 4LFBL 3RLNA 1SE2A 4IALA 2WACA 5GROA 5ELEA 4ID6A 2PPBC 1QG7A 2HCIA 4BY7G 3I4MG 1L0WA 3M4PA 4LF5L 1Z9FA 1XXGA 2MJ8A 2NVXB 1KRSA 5JOBA 1XNQL 1JOKA 4R4OA 4LF6Q 3TP8A 2EYLA 3QOJA 4JI3Q 4IPGA 2RDFA 3GO5A 2A8VA 1VQAA 3G6JB 1AW7A 4A3GH 5E7NA 3W3AA 4DAYB 1TT2A 1ZYRC 1UE6A 2Y0SB 5CC4A 4DR5Q 2JQOA 3M4YA 3KYHC 1YHAA 1X3EA 3AB9A 1OO9B 2IL8A 2UUCQ 4EQ5A 4DV3L 1JE4A 1W6KA 1SBBB 3NTKA 4JI5Q 1CUKA 2IPKD 1DONA 1L1OA 1I4RA 1OXUA 3CU7A 2D9UA 4A3KG 4CDCC 4XT1B 2IWHA 2NVQH 5C0XH 5IP9G 1X3GA 2UXCQ 5IYDH 1J9OA 2SNSA 4A3EB 2Q2TA 2HHHQ 2F0UA 4A3FG 1HR0L 3M4QA 1GHJA 5FJ8H 4LF9L 3NEMA 1CA6A 1BBWA 4BY1G 1KD1C 1EY5A 1N32Q 3OWFA 2EVBA 4KMUC 1B9MA 1JC7A 1WVLA 3OMGA 1I4PA 2IX1A 1RJTA 5E3FA 2EY1A 1LTBD 4WJWA 2L1BA 3K57A 3PF4A 2ALYB 2VL6A 2E76C 1Y8PB 5IYBH 4BBRG 5LMNL 5ELFA 4IUNA 2A6HD 1S5FD 3OIPA 1OXXK 1B50A 4CKBA 4N8X1 4AH6A 3KJPA 1BNZA 2FXQA 2AKWB 3I4NG 5C3WA 5IT9E 1S5DD 3PUYA 3M3YB 3VYTA 1BCPD 2B2YA 4ZKBB 4JV5L 2XVSA 2C9OA 1PLFA 4B3RQ 3A5ZB 3A54A 2B2WA 2I5HA 4JI2Q 1VF5C 1U5KA 3T13A 2J4XA 3NHHA 5C5MA 1X9NA 2K5WA 3JAME 1EIGA 3TEHB 1E2VA 3DEOA 1XTCD 1CKOA 4IQZA 1WYDA 2K05A 2A6EC 4X66Q 1SAPA 3H15A 4ALPA 1VQ7A 4A3BH 2JA8B 1I50B 1BF4A 4L5TA 2F4IA 4JW0A 2GN5A 4POGA 1AE2A 3TZUA 5J3BA 3F2UA 5FK9C 4PMBA 3C46A 1KC8C 1XNRQ 1T9HA 5COYA 2QF7A 3WOFA 1U9RA 5A35A 1FVIA 4NW2A 4B08A 4KHPL 1K8OA 3EIVA 2VQFL 2R7FA 3CKIB 1HNWQ 2A1AA 1SE4A 1X65A 1SJHD 3M9BA 1WTPA 4HEDA 4MNOA 1HXYD 5K36G 2BDNA 4DR3L 1GUGA 1Y1VG 2O4XA 3PIOA 1ESRA 5DEHA 1PRTF 2QKIC 3DWQA 1GO3E 4YY3L 1EWHA 1QUQA 1XPOA 4A3MH 3TP5A 2OXPA 1PVOA 1LUZA 3OPOA 1CKNB 1D1IA 2B2WC 1CFMA 1K0SA 1CM9A 1B44D 1VQ5A 4FF2A 4JYAL 2L4NA 1ILQA 2ICIA 1HQRD 3C3LA 4YWMA 1B3QA 5IP7G 3H91A 1YITA 4FYDA 3HOXB 4POFA 3VR2A 4IOCA 2Q8TA 3K81C 3T56B 1STBA 1PTOB 2JK8A 3S15B 4J1MA 3UDIA 3GTJH 1GXDC 1FL0A 4DV7Q 2R7ZH 3H6MA 4P74A 2WP8J 4G7ZC 1E22A 1B53A 2XN9C 2K5VA 3HKZE 1HJPA 2EQSA 4B3MQ 2E2JB 3KLRA 1E1TA 1M8AA 4TQUS 4JVZA 2YTYA 3BZDB 4XXEA 5C3EH 2XWBB 4KV6A 1VDZA 2VS1A 4UP8A 2F0KA 1RKNA 2HIVA 1LV9A 4C3HB 5EPLA 2PW7A 4KY5A 3CCJA 3W1BA 1JB3A 1Y8OB 1TXYA 1TWFB 1F9SA 1LT5D 1E3PA 4HIKA 1D1KA 2L5TA 4DK3C 4GLVB 2VUMH 4EQPA 2F0OA 3DMUA 1TWAB 2D2CC 1YIJA 1DYQA 4Q0FA 1P8LA 2K03A 5JVH3 3HZXA 1GKHA 3U58A 1FGBD 2K4KA 2QGQA 2V1CC 3HOYH 1QE6A 2EJFC 3RZOB 1LTRD 1N36Q 1Q82C 3ZYYX 4QQBX 2K6AA 3RR5A 1PRTC 1C9OA 1PFBA 2ID0A 2Y0SG 5CBEE 3AFQA 1WCMH 5JVG3 1Q3LA 1CQVA 1GUNA 3A5UA 2SEBD 5KGUA 5ISRA 2B39A 1X6OA 3QB3A 4QIWE 3S16B 4FXDA 3A56A 3C2PA 1PH7A 1O7YA 2WAQB 4PNYA 5AJ3Q 2E5LQ 1LABA 2L15A 3TMEA 1ML0D 3PO2B 1S40A 1PH4A 1LLRD 2DJFC 4GOPC 4IPDA 5CV8A 2EYHA 4QUCA 1IL2A 2NVTH 5FOBB 2JA6B 5KYLA 4DUZL 3FPPA 4DV0Q 4DR1Q 4A3LG 3FKIH 4A3EG 4PZ7A 3G48A 1SYDA 2K28A 3CQZB 1DZ1A 1SROA 5M3FG 1WTVA 1QVFA 3KLSA 3PUVA 2F03A 3HOVG 1FR3A 1PFMA 1K0RA 3JAMi 3FMCA 1A2TA 4P75A 4AQYL 4DAMA 3NBHB 2YYZA 3WOEA 4IFDG 3PO3H 1SFOB 1EOTA 4X3SA 3T53B 3OWEB 3TS0A 2GVAA 4YCUA 4FF4A 2BA1A 1L0YB 1Z7TA 4DV1Q 3S17B 4C1NK 4BA2I 2CFMA
chains in the Genus database with same CATH topology
4DV4L 1PH1A 4JBKA 4X62Q 1NBWA 1HNXL 3PUXA 3EN2A 1XMQL 3G6EA 2B63G 1W3SA 2E2IH 2VQEL 1R9TH 2AMCB 3HKSA 5M5XH 2DUDA 2D0PA 4YCWA 1N36L 2GVBA 3PO3G 3RN2A 2OTJA 2R93H 4B3TL 5HY6A 1J5EQ 4P72A 2UUBL 3CCRA 1PHJA 1K8AC 4L5QA 3SGIA 1SLJA 1JJ2A 3T1YQ 2JA8H 1S3OA 3CCUA 1I3QH 3OTOL 2IT1A 1VCIA 4PZ8A 3M7NA 3OW2A 1VQOA 1S72A 2PQAA 3PV0A 1YJWA 3UDFA 5AJ3L 2E5LL 3U4ZA 1YVCA 2R93G 2VNUD 2K52A 3BZKA 1P16A 5C4JH 2UUAQ 1C7YA 4QL5A 1Q12A 1Q1EA 4RG1A 1LYLA 1QVGA 4JBMA 3HOUH 2UXDQ 3UE0A 3I4OA 1J6QA 4JOIA 3D0FA 2B3GA 1Y1WH 3CP0A 4DUYQ 1VQPA 1ASZA 4A3CG 3CPWA 3UDXA 2R92H 4OX9L 4LFBQ 4GKKL 2KHIA 2Q2IA 4DR2Q 4NPSA 3CCVA 2A19A 3J81j 4DV2Q 1E24A 5FLMH 3TREA 4DV0L 1YHQA 4DR1L 4DV6Q 1EUJA 1KAWA 4OWTB 3PUZA 2UU9Q 5GAEC 5JJIA 2B29A 5IE8A 2KCMA 1IBLQ 4AIMA 1C0AA 4YCVA 4LF5Q 2WAQG 3CCMA 1GD7A 1XMOQ 3HOUG 2E8GA 2K5HA 4GN5A 4X64L 5BR8L 1DGSA 2KENA 4JI8Q 3RZDH 1Y1WG 1XNQQ 4DR7L 3I7FA 3EBEA 1OXVA 1CSQA 4DR6Q 1EOVA 2QEXA 3F2DA 1VQFA 4GNXA 1QUQB 2PMZE 2OQ0A 3CAMA 5FLMG 2JA6G 4LUOA 2Y0SE 5FJ8G 1LM0A 1WJJA 1HZAA 3RNUA 1IBKL 4QY7A 1YNXA 2JA7G 4GKJQ 1HZCA 2Z6KA 3FP9A 2CKZB 4DV1L 3U4VA 4UP9A 4JI6L 1GVPA 2N3SA 3ULPA 4X62L 1B70B 2CWPA 4KHPQ 1JJCB 3STBC 4BXXG 4OO1G 1PV4A 4HJ7A 2NN6G 1V9PA 1VQKA 2UUBQ 3HOWH 3F1ZA 4UP7A 1HZBA 5JEAJ 3CPFA 4C3JH 4DV3Q 1N33Q 2CQOA 4QJFA 2IHEA 5IYBG 3GTKH 1CKNA 2RCNA 1J5EL 3HOXH 3OTOQ 4LF4Q 5JJKA 2UUCL 3K8AA 3FHWA 3BZCA 3S15H 4A3LH 3T1YL 4LF8Q 1VQIA 1VQEA 3CC7A 2ZTDA 3UE1A 3AYHB 4R4CA 1VQHA 4WJ4A 4LUZA 2F4VQ 5M3FH 5M5WH 1KHIA 3PSIA 3KJOA 2K14A 1YJNA 4BY7H 5H1SE 4IO9A 3JC66 1IBMQ 3S1QH 3AFPA 2YTXA 4L5SA 3HOVH 4GKKQ 2N49A 3KF6B 3I55A 2UUAL 1IXRA 1YI2A 1HR0Q 3HOXG 4JC0A 4A3JG 2E2JH 3ULLA 1VQ4A 4DV5Q 4R4TA 1SRUA 2Q2UA 1HH2P 4LFBL 4LF9Q 4O0AA 1UE7A 1Y14B 1WOCA 3RLNA 1G291 5HGQA 3J80c 1FGUA 4DR2L 4NXMQ 1X55A 2QA4A 5LMUQ 4DV2L 1HR0W 3GTQH 5GROA 3J81c 4A3BG 2UU9L 1Q46A 4BY7G 4C3HH 4R4QA 3I4MG 1HZ9A 2EXDA 1L0WA 1PH2A 1IBLL 1I5FA 3WWVA 1VS0A 3M4PA 4A3DH 3J7A5 4LF5L 4J15A 1Z9FA 1TWFH 4IFDI 2WFWA 2NZOA 3L2PA 4JI8L 1KRSA 1OTCA 1XNQL 1TWGH 4YWLA 2MQHA 4GNXC 4AYBG 4DR6L 1WI5A 4R4OA 3DLLA 4LF6Q 1RIPA 4B3SQ 1TWAH 5LMNQ 4JI3Q 4IPGA 1BBUA 3GO5A 2A8VA 1VQAA 4GKJL 4A3GH 1A62A 5E7NA 4DAYB 3PCOB 2HQLA 1QVCA 1UE6A 4GLXA 4DR5Q 2JQOA 1V43A 3KYHC 1BVSA 4HJ5A 3HFZB 3KDFB 5LMNW 4DK6C 4JV5Q 3CCLA 3G4SA 3S1MH 1YHAA 1X3EA 5DLQE 4A3KH 1BKBA 2OCEA 3W5OA 3RZOH 5IP9H 4DPGA 2UUCQ 3F8TA 4LFAQ 4KI0A 4EQ5A 4DV3L 4A3GG 2KHJA 1N33L 1KRTA 5C0XJ 2JA5H 4A3CH 1Q1BA 4A3FH 4JI5Q 2RHSB 1CUKA 4JI2L 5IY0A 2K75A 1VQJA 1OXTA 1L1OA 4R4IA 4UPAA 1K9MC 1OXUA 1KQSA 4LF4L 2JEAI 2N78A 4YHHQ 4ME3A 2RF4A 4LF8L 4A3KG 3TRZA 1SE8A 2ASBA 3S16H 1Q81C 2NVQH 5IP9G 1WFQA 1X3GA 2UXCQ 4A3MG 2F4VL 3KOJA 1PH6A 3GDEA 4A4IA 5IYDH 2WAQE 2Q2TA 1IBML 3MXNB 2HHHQ 2JA5G 3PO2H 1VQDA 2AWOA 4A3FG 3VDYA 3CD6A 3E9IA 4L5RC 2K5NA 1HR0L 3CCQA 2HT1A 3M4QA 1PH8A 2JA6H 4NB3A 3S1NH 4DV5L 1U0LA 5FJ8H 4LF9L 3NEMA 2JA7H 1JJGA 4XTCS 1BBWA 2DGYA 4BY1G 3TQYA 4A3IG 1KD1C 5C0XG 4NXML 5LMUL 1NMGA 2VQFQ 1K8GA 3GTGH 4GOPA 1N32Q 2OWOA 2AWNA 5IYDG 1UEBA 2WB1G 1MJEA 3PO2G 2IX1A 3W1GA 4OONA 3CQZH 2R7ZG 3ER0A 4BXXH 4C2MH 5FLXc 1D8LA 3HKZG 1X54A 1I6HH 3PF4A 2KCTA 2E2HH 2ALYB 2VL6A 3CF5A 4OWXB 4LF6L 4DR4Q 5IYBH 4BA1I 4B3SL 4BBRG 4DR3Q 4XIGS 5LMNL 4JI3L 1KXLA 1EFWA 1OXXK 3S24A 1K3RA 4AH6A 3KJPA 1AE3A 1SFOH 2ZJQA 2FXQA 2AKWB 3I4NG 4JG2A 2NN6I 3PUYA 1K83H 2UXBQ 4YY3Q 3S2DH 4DR5L 3T1HL 3S17H 2I5LX 1NJIC 4JV5L 1SMXA 4B3RQ 3A5ZB 3AEVA 3K7AH 4K0KQ 4UY8C 3CXCA 2I5HA 4JI2Q 4P73A 1SN8A 1U5KA 3S2HH 3NELA 3KFUA 4A3JH 3D31A 4IPHA 1NTGA 4LFAL 1X9NA 3IRBA 3MEFA 3TEHB 4JI5L 1IZ6A 3HOZH 2XTIA 1CKOA 2PQAB 1WYDA 4YHHL 1A63A 2Z0SA 2F3IA 4X66Q 5IWAQ 3H15A 4ALPA 1VQ7A 2R6GA 4A3BH 4JBWA 4P71A 4L5TA 3I4MH 1NMFA 2GN5A 4POGA 1AE2A 4KHZA 4JI7Q 1A8VA 4JOIC 4LF7Q 2UXCL 1HNZQ 3K80C 4GN4B 5J3BA 1EYGA 5M3MG 4LWCA 1VQBA 3S1RH 2HHHL 4JI0L 3HOZG 1KC8C 4MTNA 1XNRQ 1T9HA 4TVAB 2D62A 4AYBE 1PYSB 1B7YB 4HJAA 2BH8A 1MIUA 3GTOH 4A3DG 4RMFA 1WCMG 1VQGA 2JE6I 1FVIA 3ICEA 4IJLA 4KHPL 3EIVA 1Y1VH 1KIXA 2PI2A 2VQFL 1YHBA 2R7FA 2ZTCA 2MO0A 4GN3B 2ZM6Q 1N32L 3OYYA 3H3VH 2A1AA 1HNWQ 4GNXB 5ELNA 1E1OA 2OTLA 3CW2C 2IY5B 1YJ9A 1X56A 2Q2HA 1X65A 5IYCG 2ZJRA 3CC2A 4NXNL 4X6AH 3M9BA 4MNOA 1QZGA 4OXPA 1G51A 2Z6KC 4DR4L 3K7UC 4PMWA 5K36G 4DR3L 1Y1VG 3LGJA 2NVYH 3PIOA 3T1HQ 4DNIA 1UE5A 5ELOA 1JE5A 4IPCA 4R1JA 3PIPA 3Q8DA 3E9HA 4BBSH 1M90C 1IYJB 1GO3E 4JI1Q 2UXBL 1OXSC 4YY3L 4IJHA 1QUQA 1XPOA 2OQKA 5JJLA 4Y52H 4A3MH 3PGZA 4LNQA 1LUZA 4B3RL 1PVOA 1CKNB 2I5MX 4LFCQ 4K0KL 2D0OA 1Q8KA 1AH9A 4PZ6A 3BJUA 1JB7A 4GLAC 3K0XA 4GS3A 1PH9A 1VQ5A 2YU9H 5C4XH 4JYAL 2KBNA 4BBSG 2CCZA 4YWMA 5IP7G 4OWWB 4A3IH 1YITA 1YZ6A 4BY1H 4POFA 4IOCA 3GD7A 1JMCA 3K81C 1TWHH 2MFIA 4X66L 2JK8A 5IWAL 3U50C 3UDIA 2NZHA 3GTJH 2VY3A 1PYBA 2RHQB 1FL0A 2JEBI 4DV7Q 4JI0Q 4JI7L 3PUWA 1KL9A 1Q86C 4C3IH 3CCSA 5C44H 2WB1E 4LF7L 2R7ZH 4P74A 3GTMH 1HNZL 2WP8J 3TS2A 1I50H 2CWAA 1FJGQ 1E22A 3H0GH 5C4XG 2HIXA 3F2BA 1UWVA 1RL2A 4A75A 2MNAA 5C0XI 2K5VA 3HKZE 1NY4A 1VQLA 1HJPA 2EQSA 3DM3A 4BBRH 1XNRL 4B3MQ 2EIFA 1VQCA 3L0OA 1E1TA 4DUZQ 3J7ZC 4TQUS 4YWKA 4DKAC 2YTYA 5M5YH 3I4NH 1TWCH 5C3EH 3KF6A 5C44G 2JA8G 2VS1A 4UP8A 2ZM6L 2I0QA 4NXNQ 1HNWL 3A0JA 2HIVA 3H0GG 1N34Q 1X3FA 1Z47A 1GM5A 5GQOA 4QGUA 1JT8A 3CCJA 3W1BA 3PF5A 1XPUA 1L2FA 4HIDA 2NVXH 1TXYA 4HJ8A 1LTLA 3GTPH 1V1QA 1E3PA 3L7ZC 4HIKA 4JCVE 4DK3C 3CMAA 4A93H 4GLVB 2VUMH 1D7QA 2LXJA 1I94L 2YV5A 2ATWA 4A76A 4OO1I 4AQYQ 5C3EG 3KF8B 4X65Q 1XJVA 2N8NA 2BH2A 3BU2A 4Y7NH 2R92G 1YBYA 2C35B 1YIJA 1Q7YC 1W2BA 1O7IA 2ES2A 5EAYA 1EQQA 1P8LA 2JA9A 4JI4L 2R7DA 4JI1L 1PFSA 1GKHA 4LUVA 3U58A 1M1KC 1IBKQ 4A93G 2K4KA 1XTDA 1A0IA 3I2ZA 4DV4Q 2VUMG 5M3MH 2QGQA 1HNXQ 2V1CC 1XMQQ 1L1OB 3HOYH 4JYAQ 2YTVA 4LFCL 1L1OC 3RLOA 2VQEQ 1PH5A 1N36Q 3G71A 1Q82C 2VW9A 1VQ8A 1YEZA 3UDGA 1H95A 4QQBX 1EWIA 3STBD 3KDFA 4B3TQ 1NE3A 3RR5A 1QZHA 1C9OA 1B8AA 2H5XA 2ID0A 2Y0SG 3ERSX 3AFQA 1WCMH 4LW1A 4PG3A 2VZAA 3CC4A 1EIFA 1CSPA 3A5UA 4MZ9A 3M85A 4EX5A 3B6YA 4JBJA 1X6OA 1N8RC 3HOYG 1G6PA 4QIWE 1FJGL 2AHOB 4DV7L 2ZJPA 4KLKA 1PH7A 5IYCH 2PI2E 5GAGC 5AJ3Q 3I56A 4A3EH 2E5LQ 4HIOA 2L15A 2MO1A 4H02A 3F2CA 1MJCA 1S40A 1PH4A 4IFDJ 3KLWA 2JJQA 1EQRA 4GOPB 2PNHA 4GOPC 3HOWG 4WJ3M 4IPDA 4B3ML 3CCEA 4HJ9A 4IOAA 1IL2A 2NVTH 1SR3A 3GTLH 4OX9Q 1VQNA 5IT9c 2IX0A 4O2DA 4DUZL 1EIYB 1VQ6A 2UXDL 3A74A 5GADC 4DV0Q 4DR1Q 4DUYL 4A3LG 3FKIH 3NENA 1PH3A 4A3EG 4PZ7A 1UE1A 5JEAG 3CMEA 1N34L 3G48A 4FDBA 1K73C 1MKHA 2K50A 3AQQA 3ZJYC 2LXKA 1I94Q 3J80i 1ASYA 1SROA 5BR8Q 4X64Q 5M3FG 1VQMA 1QVFA 4DV6L 3H3VI 3RLFA 1PA6A 4DR7Q 1E7ZA 4HIMA 3JAMc 2XGTA 3PUVA 3J81i 3HOVG 1K0RA 2ZTEA 3E0EA 3JAMi 1XMOL 1CKMA 2B63H 4P75A 4APVA 5IP7H 4X65L 4AQYL 3RN5A 4DAMA 4JI4Q 3NBHB 2YYZA 2F52A 3M4OH 4IFDG 3FKIG 3ULJA 3PO3H 1VQ9A 2LSSA 2BA0A 3M3YH 2IHFA 3TS0A 2GVAA 4YCUA 2BA1A 1XPRA 1N9WA 4DV1Q 4JI6Q 4BA2I 5GAHC 2CFMA 3S14H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV4 L;  1PH1 A;  4JBK A;  4X62 Q;  1NBW A;  1HNX L;  3PUX A;  3EN2 A;  1XMQ L;  3G6E A;  2B63 G;  1W3S A;  2E2I H;  2VQE L;  1R9T H;  2AMC B;  3HKS A;  5M5X H;  2DUD A;  2D0P A;  4YCW A;  1N36 L;  2GVB A;  3PO3 G;  3RN2 A;  2OTJ A;  2R93 H;  4B3T L;  5HY6 A;  1J5E Q;  4P72 A;  2UUB L;  3CCR A;  1PHJ A;  1K8A C;  4L5Q A;  3SGI A;  1SLJ A;  1JJ2 A;  3T1Y Q;  2JA8 H;  1S3O A;  3CCU A;  1I3Q H;  3OTO L;  2IT1 A;  1VCI A;  4PZ8 A;  3M7N A;  3OW2 A;  1VQO A;  1S72 A;  2PQA A;  3PV0 A;  1YJW A;  3UDF A;  5AJ3 L;  2E5L L;  3U4Z A;  1YVC A;  2R93 G;  2VNU D;  2K52 A;  3BZK A;  1P16 A;  5C4J H;  2UUA Q;  1C7Y A;  4QL5 A;  1Q12 A;  1Q1E A;  4RG1 A;  1LYL A;  1QVG A;  4JBM A;  3HOU H;  2UXD Q;  3UE0 A;  3I4O A;  1J6Q A;  4JOI A;  3D0F A;  2B3G A;  1Y1W H;  3CP0 A;  4DUY Q;  1VQP A;  1ASZ A;  4A3C G;  3CPW A;  3UDX A;  2R92 H;  4OX9 L;  4LFB Q;  4GKK L;  2KHI A;  2Q2I A;  4DR2 Q;  4NPS A;  3CCV A;  2A19 A;  3J81 j;  4DV2 Q;  1E24 A;  5FLM H;  3TRE A;  4DV0 L;  1YHQ A;  4DR1 L;  4DV6 Q;  1EUJ A;  1KAW A;  4OWT B;  3PUZ A;  2UU9 Q;  5GAE C;  5JJI A;  2B29 A;  5IE8 A;  2KCM A;  1IBL Q;  4AIM A;  1C0A A;  4YCV A;  4LF5 Q;  2WAQ G;  3CCM A;  1GD7 A;  1XMO Q;  3HOU G;  2E8G A;  2K5H A;  4GN5 A;  4X64 L;  5BR8 L;  1DGS A;  2KEN A;  4JI8 Q;  3RZD H;  1Y1W G;  1XNQ Q;  4DR7 L;  3I7F A;  3EBE A;  1OXV A;  1CSQ A;  4DR6 Q;  1EOV A;  2QEX A;  3F2D A;  1VQF A;  4GNX A;  1QUQ B;  2PMZ E;  2OQ0 A;  3CAM A;  5FLM G;  2JA6 G;  4LUO A;  2Y0S E;  5FJ8 G;  1LM0 A;  1WJJ A;  1HZA A;  3RNU A;  1IBK L;  4QY7 A;  1YNX A;  2JA7 G;  4GKJ Q;  1HZC A;  2Z6K A;  3FP9 A;  2CKZ B;  4DV1 L;  3U4V A;  4UP9 A;  4JI6 L;  1GVP A;  2N3S A;  3ULP A;  4X62 L;  1B70 B;  2CWP A;  4KHP Q;  1JJC B;  3STB C;  4BXX G;  4OO1 G;  1PV4 A;  4HJ7 A;  2NN6 G;  1V9P A;  1VQK A;  2UUB Q;  3HOW H;  3F1Z A;  4UP7 A;  1HZB A;  5JEA J;  3CPF A;  4C3J H;  4DV3 Q;  1N33 Q;  2CQO A;  4QJF A;  2IHE A;  5IYB G;  3GTK H;  1CKN A;  2RCN A;  1J5E L;  3HOX H;  3OTO Q;  4LF4 Q;  5JJK A;  2UUC L;  3K8A A;  3FHW A;  3BZC A;  3S15 H;  4A3L H;  3T1Y L;  4LF8 Q;  1VQI A;  1VQE A;  3CC7 A;  2ZTD A;  3UE1 A;  3AYH B;  4R4C A;  1VQH A;  4WJ4 A;  4LUZ A;  2F4V Q;  5M3F H;  5M5W H;  1KHI A;  3PSI A;  3KJO A;  2K14 A;  1YJN A;  4BY7 H;  5H1S E;  4IO9 A;  3JC6 6;  1IBM Q;  3S1Q H;  3AFP A;  2YTX A;  4L5S A;  3HOV H;  4GKK Q;  2N49 A;  3KF6 B;  3I55 A;  2UUA L;  1IXR A;  1YI2 A;  1HR0 Q;  3HOX G;  4JC0 A;  4A3J G;  2E2J H;  3ULL A;  1VQ4 A;  4DV5 Q;  4R4T A;  1SRU A;  2Q2U A;  1HH2 P;  4LFB L;  4LF9 Q;  4O0A A;  1UE7 A;  1Y14 B;  1WOC A;  3RLN A;  1G29 1;  5HGQ A;  3J80 c;  1FGU A;  4DR2 L;  4NXM Q;  1X55 A;  2QA4 A;  5LMU Q;  4DV2 L;  1HR0 W;  3GTQ H;  5GRO A;  3J81 c;  4A3B G;  2UU9 L;  1Q46 A;  4BY7 G;  4C3H H;  4R4Q A;  3I4M G;  1HZ9 A;  2EXD A;  1L0W A;  1PH2 A;  1IBL L;  1I5F A;  3WWV A;  1VS0 A;  3M4P A;  4A3D H;  3J7A 5;  4LF5 L;  4J15 A;  1Z9F A;  1TWF H;  4IFD I;  2WFW A;  2NZO A;  3L2P A;  4JI8 L;  1KRS A;  1OTC A;  1XNQ L;  1TWG H;  4YWL A;  2MQH A;  4GNX C;  4AYB G;  4DR6 L;  1WI5 A;  4R4O A;  3DLL A;  4LF6 Q;  1RIP A;  4B3S Q;  1TWA H;  5LMN Q;  4JI3 Q;  4IPG A;  1BBU A;  3GO5 A;  2A8V A;  1VQA A;  4GKJ L;  4A3G H;  1A62 A;  5E7N A;  4DAY B;  3PCO B;  2HQL A;  1QVC A;  1UE6 A;  4GLX A;  4DR5 Q;  2JQO A;  1V43 A;  3KYH C;  1BVS A;  4HJ5 A;  3HFZ B;  3KDF B;  5LMN W;  4DK6 C;  4JV5 Q;  3CCL A;  3G4S A;  3S1M H;  1YHA A;  1X3E A;  5DLQ E;  4A3K H;  1BKB A;  2OCE A;  3W5O A;  3RZO H;  5IP9 H;  4DPG A;  2UUC Q;  3F8T A;  4LFA Q;  4KI0 A;  4EQ5 A;  4DV3 L;  4A3G G;  2KHJ A;  1N33 L;  1KRT A;  5C0X J;  2JA5 H;  4A3C H;  1Q1B A;  4A3F H;  4JI5 Q;  2RHS B;  1CUK A;  4JI2 L;  5IY0 A;  2K75 A;  1VQJ A;  1OXT A;  1L1O A;  4R4I A;  4UPA A;  1K9M C;  1OXU A;  1KQS A;  4LF4 L;  2JEA I;  2N78 A;  4YHH Q;  4ME3 A;  2RF4 A;  4LF8 L;  4A3K G;  3TRZ A;  1SE8 A;  2ASB A;  3S16 H;  1Q81 C;  2NVQ H;  5IP9 G;  1WFQ A;  1X3G A;  2UXC Q;  4A3M G;  2F4V L;  3KOJ A;  1PH6 A;  3GDE A;  4A4I A;  5IYD H;  2WAQ E;  2Q2T A;  1IBM L;  3MXN B;  2HHH Q;  2JA5 G;  3PO2 H;  1VQD A;  2AWO A;  4A3F G;  3VDY A;  3CD6 A;  3E9I A;  4L5R C;  2K5N A;  1HR0 L;  3CCQ A;  2HT1 A;  3M4Q A;  1PH8 A;  2JA6 H;  4NB3 A;  3S1N H;  4DV5 L;  1U0L A;  5FJ8 H;  4LF9 L;  3NEM A;  2JA7 H;  1JJG A;  4XTC S;  1BBW A;  2DGY A;  4BY1 G;  3TQY A;  4A3I G;  1KD1 C;  5C0X G;  4NXM L;  5LMU L;  1NMG A;  2VQF Q;  1K8G A;  3GTG H;  4GOP A;  1N32 Q;  2OWO A;  2AWN A;  5IYD G;  1UEB A;  2WB1 G;  1MJE A;  3PO2 G;  2IX1 A;  3W1G A;  4OON A;  3CQZ H;  2R7Z G;  3ER0 A;  4BXX H;  4C2M H;  5FLX c;  1D8L A;  3HKZ G;  1X54 A;  1I6H H;  3PF4 A;  2KCT A;  2E2H H;  2ALY B;  2VL6 A;  3CF5 A;  4OWX B;  4LF6 L;  4DR4 Q;  5IYB H;  4BA1 I;  4B3S L;  4BBR G;  4DR3 Q;  4XIG S;  5LMN L;  4JI3 L;  1KXL A;  1EFW A;  1OXX K;  3S24 A;  1K3R A;  4AH6 A;  3KJP A;  1AE3 A;  1SFO H;  2ZJQ A;  2FXQ A;  2AKW B;  3I4N G;  4JG2 A;  2NN6 I;  3PUY A;  1K83 H;  2UXB Q;  4YY3 Q;  3S2D H;  4DR5 L;  3T1H L;  3S17 H;  2I5L X;  1NJI C;  4JV5 L;  1SMX A;  4B3R Q;  3A5Z B;  3AEV A;  3K7A H;  4K0K Q;  4UY8 C;  3CXC A;  2I5H A;  4JI2 Q;  4P73 A;  1SN8 A;  1U5K A;  3S2H H;  3NEL A;  3KFU A;  4A3J H;  3D31 A;  4IPH A;  1NTG A;  4LFA L;  1X9N A;  3IRB A;  3MEF A;  3TEH B;  4JI5 L;  1IZ6 A;  3HOZ H;  2XTI A;  1CKO A;  2PQA B;  1WYD A;  4YHH L;  1A63 A;  2Z0S A;  2F3I A;  4X66 Q;  5IWA Q;  3H15 A;  4ALP A;  1VQ7 A;  2R6G A;  4A3B H;  4JBW A;  4P71 A;  4L5T A;  3I4M H;  1NMF A;  2GN5 A;  4POG A;  1AE2 A;  4KHZ A;  4JI7 Q;  1A8V A;  4JOI C;  4LF7 Q;  2UXC L;  1HNZ Q;  3K80 C;  4GN4 B;  5J3B A;  1EYG A;  5M3M G;  4LWC A;  1VQB A;  3S1R H;  2HHH L;  4JI0 L;  3HOZ G;  1KC8 C;  4MTN A;  1XNR Q;  1T9H A;  4TVA B;  2D62 A;  4AYB E;  1PYS B;  1B7Y B;  4HJA A;  2BH8 A;  1MIU A;  3GTO H;  4A3D G;  4RMF A;  1WCM G;  1VQG A;  2JE6 I;  1FVI A;  3ICE A;  4IJL A;  4KHP L;  3EIV A;  1Y1V H;  1KIX A;  2PI2 A;  2VQF L;  1YHB A;  2R7F A;  2ZTC A;  2MO0 A;  4GN3 B;  2ZM6 Q;  1N32 L;  3OYY A;  3H3V H;  2A1A A;  1HNW Q;  4GNX B;  5ELN A;  1E1O A;  2OTL A;  3CW2 C;  2IY5 B;  1YJ9 A;  1X56 A;  2Q2H A;  1X65 A;  5IYC G;  2ZJR A;  3CC2 A;  4NXN L;  4X6A H;  3M9B A;  4MNO A;  1QZG A;  4OXP A;  1G51 A;  2Z6K C;  4DR4 L;  3K7U C;  4PMW A;  5K36 G;  4DR3 L;  1Y1V G;  3LGJ A;  2NVY H;  3PIO A;  3T1H Q;  4DNI A;  1UE5 A;  5ELO A;  1JE5 A;  4IPC A;  4R1J A;  3PIP A;  3Q8D A;  3E9H A;  4BBS H;  1M90 C;  1IYJ B;  1GO3 E;  4JI1 Q;  2UXB L;  1OXS C;  4YY3 L;  4IJH A;  1QUQ A;  1XPO A;  2OQK A;  5JJL A;  4Y52 H;  4A3M H;  3PGZ A;  4LNQ A;  1LUZ A;  4B3R L;  1PVO A;  1CKN B;  2I5M X;  4LFC Q;  4K0K L;  2D0O A;  1Q8K A;  1AH9 A;  4PZ6 A;  3BJU A;  1JB7 A;  4GLA C;  3K0X A;  4GS3 A;  1PH9 A;  1VQ5 A;  2YU9 H;  5C4X H;  4JYA L;  2KBN A;  4BBS G;  2CCZ A;  4YWM A;  5IP7 G;  4OWW B;  4A3I H;  1YIT A;  1YZ6 A;  4BY1 H;  4POF A;  4IOC A;  3GD7 A;  1JMC A;  3K81 C;  1TWH H;  2MFI A;  4X66 L;  2JK8 A;  5IWA L;  3U50 C;  3UDI A;  2NZH A;  3GTJ H;  2VY3 A;  1PYB A;  2RHQ B;  1FL0 A;  2JEB I;  4DV7 Q;  4JI0 Q;  4JI7 L;  3PUW A;  1KL9 A;  1Q86 C;  4C3I H;  3CCS A;  5C44 H;  2WB1 E;  4LF7 L;  2R7Z H;  4P74 A;  3GTM H;  1HNZ L;  2WP8 J;  3TS2 A;  1I50 H;  2CWA A;  1FJG Q;  1E22 A;  3H0G H;  5C4X G;  2HIX A;  3F2B A;  1UWV A;  1RL2 A;  4A75 A;  2MNA A;  5C0X I;  2K5V A;  3HKZ E;  1NY4 A;  1VQL A;  1HJP A;  2EQS A;  3DM3 A;  4BBR H;  1XNR L;  4B3M Q;  2EIF A;  1VQC A;  3L0O A;  1E1T A;  4DUZ Q;  3J7Z C;  4TQU S;  4YWK A;  4DKA C;  2YTY A;  5M5Y H;  3I4N H;  1TWC H;  5C3E H;  3KF6 A;  5C44 G;  2JA8 G;  2VS1 A;  4UP8 A;  2ZM6 L;  2I0Q A;  4NXN Q;  1HNW L;  3A0J A;  2HIV A;  3H0G G;  1N34 Q;  1X3F A;  1Z47 A;  1GM5 A;  5GQO A;  4QGU A;  1JT8 A;  3CCJ A;  3W1B A;  3PF5 A;  1XPU A;  1L2F A;  4HID A;  2NVX H;  1TXY A;  4HJ8 A;  1LTL A;  3GTP H;  1V1Q A;  1E3P A;  3L7Z C;  4HIK A;  4JCV E;  4DK3 C;  3CMA A;  4A93 H;  4GLV B;  2VUM H;  1D7Q A;  2LXJ A;  1I94 L;  2YV5 A;  2ATW A;  4A76 A;  4OO1 I;  4AQY Q;  5C3E G;  3KF8 B;  4X65 Q;  1XJV A;  2N8N A;  2BH2 A;  3BU2 A;  4Y7N H;  2R92 G;  1YBY A;  2C35 B;  1YIJ A;  1Q7Y C;  1W2B A;  1O7I A;  2ES2 A;  5EAY A;  1EQQ A;  1P8L A;  2JA9 A;  4JI4 L;  2R7D A;  4JI1 L;  1PFS A;  1GKH A;  4LUV A;  3U58 A;  1M1K C;  1IBK Q;  4A93 G;  2K4K A;  1XTD A;  1A0I A;  3I2Z A;  4DV4 Q;  2VUM G;  5M3M H;  2QGQ A;  1HNX Q;  2V1C C;  1XMQ Q;  1L1O B;  3HOY H;  4JYA Q;  2YTV A;  4LFC L;  1L1O C;  3RLO A;  2VQE Q;  1PH5 A;  1N36 Q;  3G71 A;  1Q82 C;  2VW9 A;  1VQ8 A;  1YEZ A;  3UDG A;  1H95 A;  4QQB X;  1EWI A;  3STB D;  3KDF A;  4B3T Q;  1NE3 A;  3RR5 A;  1QZH A;  1C9O A;  1B8A A;  2H5X A;  2ID0 A;  2Y0S G;  3ERS X;  3AFQ A;  1WCM H;  4LW1 A;  4PG3 A;  2VZA A;  3CC4 A;  1EIF A;  1CSP A;  3A5U A;  4MZ9 A;  3M85 A;  4EX5 A;  3B6Y A;  4JBJ A;  1X6O A;  1N8R C;  3HOY G;  1G6P A;  4QIW E;  1FJG L;  2AHO B;  4DV7 L;  2ZJP A;  4KLK A;  1PH7 A;  5IYC H;  2PI2 E;  5GAG C;  5AJ3 Q;  3I56 A;  4A3E H;  2E5L Q;  4HIO A;  2L15 A;  2MO1 A;  4H02 A;  3F2C A;  1MJC A;  1S40 A;  1PH4 A;  4IFD J;  3KLW A;  2JJQ A;  1EQR A;  4GOP B;  2PNH A;  4GOP C;  3HOW G;  4WJ3 M;  4IPD A;  4B3M L;  3CCE A;  4HJ9 A;  4IOA A;  1IL2 A;  2NVT H;  1SR3 A;  3GTL H;  4OX9 Q;  1VQN A;  5IT9 c;  2IX0 A;  4O2D A;  4DUZ L;  1EIY B;  1VQ6 A;  2UXD L;  3A74 A;  5GAD C;  4DV0 Q;  4DR1 Q;  4DUY L;  4A3L G;  3FKI H;  3NEN A;  1PH3 A;  4A3E G;  4PZ7 A;  1UE1 A;  5JEA G;  3CME A;  1N34 L;  3G48 A;  4FDB A;  1K73 C;  1MKH A;  2K50 A;  3AQQ A;  3ZJY C;  2LXK A;  1I94 Q;  3J80 i;  1ASY A;  1SRO A;  5BR8 Q;  4X64 Q;  5M3F G;  1VQM A;  1QVF A;  4DV6 L;  3H3V I;  3RLF A;  1PA6 A;  4DR7 Q;  1E7Z A;  4HIM A;  3JAM c;  2XGT A;  3PUV A;  3J81 i;  3HOV G;  1K0R A;  2ZTE A;  3E0E A;  3JAM i;  1XMO L;  1CKM A;  2B63 H;  4P75 A;  4APV A;  5IP7 H;  4X65 L;  4AQY L;  3RN5 A;  4DAM A;  4JI4 Q;  3NBH B;  2YYZ A;  2F52 A;  3M4O H;  4IFD G;  3FKI G;  3ULJ A;  3PO3 H;  1VQ9 A;  2LSS A;  2BA0 A;  3M3Y H;  2IHF A;  3TS0 A;  2GVA A;  4YCU A;  2BA1 A;  1XPR A;  1N9W A;  4DV1 Q;  4JI6 Q;  4BA2 I;  5GAH C;  2CFM A;  3S14 H; 
#chains in the Genus database with same CATH topology
 1PH1 A;  1NBW A;  1NUC A;  1HNX L;  3PUX A;  3K7A B;  1W3S A;  5ELD A;  2VQE L;  1R9T H;  2RKS A;  5M5X H;  2F3W A;  1EYD A;  3S2H B;  2KA7 A;  3OW7 A;  4YCW A;  1U4M A;  2GVB A;  5E4W C;  4DAP A;  2OTJ A;  4RHR A;  5HY6 A;  2DNC A;  4HMI A;  4CJ2 C;  1SJE D;  1ENA A;  3V96 A;  3HOZ B;  4FO2 A;  3BVM A;  4A3D B;  3CCU A;  5EKI A;  1SDF A;  2ENB A;  1I3Q H;  3I4M B;  1LTI D;  5LHY 1;  3M7N A;  2V4D A;  4KKT A;  1STG A;  1VQO A;  1YJW A;  1S72 A;  3Q24 A;  1KLU D;  3BZK A;  2UUA Q;  1C7Y A;  1DXM A;  1Q12 A;  3GV3 A;  3I4O A;  4JOI A;  3D0F A;  4S3S A;  1Y1W H;  5CV6 A;  1YNN C;  2F0N A;  2R92 H;  3UDX A;  4OX9 L;  2XRS D;  1EY8 A;  2Q2I A;  4NPS A;  3VYS A;  3SVM A;  1K28 A;  1E24 A;  3SK6 A;  2EY6 A;  1T5E A;  1EUJ A;  1HCZ A;  2RSO A;  3PUZ A;  4IUT A;  2B29 A;  2A68 C;  4ZUJ A;  1IBL Q;  4ZAI A;  2E8G A;  5BR8 L;  3C1F A;  3I4L A;  4DR7 L;  1OXV A;  3MVV A;  3HEJ A;  1G6Z A;  1EOV A;  3F2D A;  4KY6 A;  4GNX A;  3VYR A;  2PMZ E;  2OQ0 A;  2WV6 D;  4RH6 A;  5FJ8 G;  2G9D A;  3ND9 A;  1FD7 D;  1HZC A;  3FP9 A;  1I6V C;  1TKW B;  3U4V A;  1XWE A;  4UP9 A;  4JI6 L;  1GVP A;  3M7G A;  3DUZ A;  3KBG A;  2CWP A;  1JJC B;  3STB C;  3MA2 B;  2NN6 G;  2UUB Q;  3VR3 A;  4UP7 A;  5JEA J;  2N55 A;  2CQO A;  5IYB G;  5C4X B;  3BDO A;  3NSW A;  2HUG A;  2RCN A;  1J5E L;  2JSO A;  3OTO Q;  2UUC L;  4BY1 B;  3K8A A;  1BOS A;  4G4K A;  5CV7 A;  1KLG D;  3BZC A;  2Z9H A;  3UE1 A;  4K6D A;  3AYH B;  5J1Z A;  1HHV A;  5C44 B;  2Z8L A;  2VB2 X;  2VXW A;  3PSI A;  3KJO A;  4WOR A;  2YTX A;  3H0G B;  4L5S A;  2QCP X;  5EBC A;  1SYE A;  3HOX G;  3ULL A;  4BBR B;  1VQ4 A;  2OT2 A;  4DV5 Q;  1BBX C;  1ICF B;  2Q2U A;  3J80 c;  1G29 1;  3BG3 A;  1FGU A;  5M5Y B;  1NAP A;  3I4N B;  2MUY A;  4DV2 L;  5D65 A;  3J81 c;  4A3B G;  1SEB D;  1D6E C;  1Y8N B;  1B3A A;  2BDO A;  1PH2 A;  4CDE C;  3WWV A;  3OSO A;  2NZO A;  3GTP B;  1DM0 B;  4A93 B;  2MQH A;  4GNX C;  1QWY A;  4B3S Q;  1JR0 D;  1PFN A;  1KDC A;  2CQA A;  5G3L F;  4GKJ L;  4Y7N B;  4C3H G;  2PMZ B;  3PCO B;  4GLX A;  1V43 A;  4HJ5 A;  1BVS A;  1FNU A;  4DK6 C;  2ZXO A;  3KF8 A;  1IW7 C;  3S1M H;  5IOD A;  2DN8 A;  5BN4 A;  4DPG A;  1MGS A;  2PZT A;  4LFA Q;  4OL7 A;  2JA5 H;  4A3C H;  1Q1B A;  4P2C B;  1I4H A;  4JI2 L;  5IY0 A;  5IOC A;  1K9M C;  1KQS A;  2JEA I;  4YHH Q;  2EJM A;  3KBX A;  4ME3 A;  4E6I A;  2RF4 A;  2EZV A;  2RQX A;  4LF8 L;  1SE8 A;  3QIA A;  1Q81 C;  4A3M G;  2F4V L;  1EZ8 A;  5EPJ A;  3L9A X;  1IBM L;  2AUK A;  3FRP B;  4L5R C;  2K5N A;  4HSV A;  2HT1 A;  4C56 C;  3PIP 3;  3S1N H;  3A8J E;  1F9P A;  2A74 C;  2JA7 H;  5I6Y A;  3TQY A;  3TP6 A;  4NXM L;  1C4Q A;  5LMU L;  4HAE A;  2F0T A;  2OWO A;  1S5C D;  3PO2 G;  4IZ8 A;  3W2D A;  4IUU A;  2R7Z G;  4BXX H;  3SK4 A;  5FLX c;  4O42 A;  3HKZ G;  1X54 A;  2KCN A;  4WRD A;  2FJ2 A;  1EFW A;  3T51 B;  3M4O B;  1K3R A;  3H94 A;  4KKS A;  2ZJQ A;  3IFT A;  2O5I C;  3SHL A;  5K5P A;  1ENF A;  2R61 A;  3VR4 A;  1AZQ A;  3S2D H;  3D4W A;  5I9O A;  3C1E A;  3R93 A;  3MXU A;  3S14 B;  2X6L A;  3CXC A;  2EYJ A;  1SN8 A;  2RDG A;  1W6J A;  3NEL A;  2E2I B;  4JPB W;  2F0W A;  4RFB A;  4RWS C;  3BS1 A;  4JK1 C;  2R93 B;  5CMD A;  3IRB A;  3MEF A;  1GUO A;  2FHT A;  3MWY W;  1B1Z A;  2EY2 A;  2PQA B;  2QIL A;  3U9O A;  2LFN A;  2PYK A;  1A63 A;  1HA5 A;  1U4P A;  2R6G A;  2FIN B;  4JBW A;  1WTH A;  3HGB A;  4KHZ A;  2KEC A;  1ICW A;  3K80 C;  2WIN B;  2CH4 W;  1VQB A;  3S1R H;  5C4J B;  1HUM A;  3HOZ G;  2D62 A;  1PYS B;  4MIU A;  4B9W A;  1MSG A;  3E5S A;  4A3D G;  4K5X A;  5DAU A;  4I65 A;  1WCM G;  1ZEQ X;  4XQJ A;  3FVQ A;  1QNK A;  1VQG A;  1VMC A;  1TVX A;  2IJ0 A;  3X3M A;  1KIX A;  2RSN A;  2ZTC A;  4GN3 B;  1BCP F;  4R8I A;  4OGQ C;  2B2T A;  1EYA A;  1E1O A;  1YJ9 A;  2B2U C;  2OF1 A;  4X6A H;  3J80 L;  2F0G A;  1G51 A;  2Z6K C;  4DR4 L;  3K7U C;  4PMW A;  3J81 L;  3BVZ A;  2PW5 A;  2NVY H;  3T1H Q;  4DNI A;  1VF7 A;  1O7L A;  5JPM C;  4CBV A;  3DXJ C;  1EY4 A;  1M90 C;  4JI1 Q;  2UXB L;  2B2V A;  5JJL A;  4LNQ A;  3SXH A;  1QIL A;  2I5M X;  5DM6 3;  1IKL A;  2K33 A;  1HRJ A;  4LFC Q;  4K0K L;  2D0O A;  2Q8I B;  1Q8K A;  5EQ0 A;  1AH9 A;  1JB7 A;  4GLA C;  1PH9 A;  5CGK A;  4BBS G;  3FDT A;  3GTK B;  4OWW B;  1YZ6 A;  4CJ1 B;  1JMC A;  1SYG A;  1TWH H;  5IWA L;  1A3T A;  2RHQ B;  4RGM A;  3E0J A;  1C8C A;  4ZK9 B;  4JI7 L;  1FJG Q;  3PUW A;  1KL9 A;  4LF7 L;  3GTM H;  3TS2 A;  1HNZ L;  1I50 H;  5M3F B;  5M5W B;  1LT6 D;  5C4X G;  1KNE A;  4DXF A;  3GTL B;  2HIX A;  3F2B A;  3S1Q B;  1UWV A;  5FO9 B;  4A75 A;  3HOV B;  4GZY C;  4BS9 A;  1NY4 A;  4HTH A;  1SSO A;  4YIJ A;  3L0O A;  4J6H A;  2HDM A;  4DKA C;  3J7Z C;  3DWP A;  1HFN A;  1TWC H;  2NYZ D;  2L0C A;  5C44 G;  2ZXP A;  2ZM6 L;  2B2T C;  1N34 Q;  4MN3 A;  3H0G G;  1X3F A;  1JT8 A;  2I07 B;  5GQO A;  4QGU A;  2HD3 A;  3OHX C;  1D5Z C;  1XPU A;  4HID A;  1G91 A;  4HJ8 A;  2KEE A;  3K5M A;  1TU2 B;  3L7Z C;  1F9R A;  2A6H C;  1D7Q A;  2LXJ A;  2ATW A;  4RGN A;  4OO1 I;  2BH2 A;  2N8N A;  5COR A;  5CBA E;  2HQE A;  1BR9 A;  2R92 G;  1YBY A;  2A69 D;  5KNC A;  1BCP C;  4A3G B;  5EAY A;  5FLX L;  4LUV A;  2K1B A;  1M1K C;  4A93 G;  1XTD A;  4DV4 Q;  2Z4I A;  4KTA A;  5M3M H;  1XMQ Q;  2YTV A;  4DAY A;  1L1O C;  1KTK A;  3SDZ A;  4DN4 M;  3IAY A;  1PRT B;  1NE3 A;  2H5X A;  3ERS X;  1V8Q A;  1K8M A;  1CSP A;  4MZ9 A;  1H9M A;  3M85 A;  4EX5 A;  1F2Z A;  4JBJ A;  4I7Z C;  3MFY A;  2NVQ B;  1BXT A;  5IYC H;  2PI2 E;  4TRD A;  1ZXT A;  3I56 A;  1PZJ D;  2NTT A;  4HIO A;  4IFD J;  4GOP B;  2JJQ A;  4IOA A;  3RMH A;  4EQN A;  1Q8I A;  4LJZ C;  2XWJ B;  1YNJ D;  2IX0 A;  5IT9 c;  1EIY B;  2A5H A;  4HCS A;  2PZW A;  5GAD C;  2DJG C;  2K01 A;  1LTS D;  1HUN A;  3MXP A;  1AZP A;  1I94 Q;  1K73 C;  3NP8 A;  2K50 A;  4UAI A;  1VQM A;  2TSS A;  3H3V I;  1EEF D;  1PA6 A;  3JAM c;  1M4V A;  2PQE A;  3KLS X;  3N6R A;  4CDD C;  1EY7 A;  4KD4 A;  2ZTE A;  2B63 H;  2B2Y C;  4JI4 Q;  3RN5 A;  4X65 L;  3NPP A;  1HA6 A;  2F52 A;  3ULJ A;  3K0Y A;  1WD1 A;  4PMC A;  3ERO A;  2CHB D;  4DNT B;  1IBK L;  1HTP A;  4JBK A;  1FNW A;  4IN3 A;  4RHS A;  3D4R A;  1QOH A;  3MEH A;  4B3T L;  1FNV A;  4ABN A;  2K5Q A;  3DHQ A;  4ZUI A;  2WKD A;  1HTL D;  2UUB L;  4LK1 C;  3IFD A;  1B9N A;  3SGI A;  2O5J C;  3T1Y Q;  4A3B B;  3TZD A;  1S3O A;  3OTO L;  3R2I A;  1VCI A;  4DA2 A;  4TSS A;  1STY A;  3K5L A;  3OW2 A;  4F88 A;  2R93 G;  1YVC A;  2K52 A;  5CYU A;  3J7A F;  4QL5 A;  1Q1E A;  4JBM A;  3HOU H;  3CP0 A;  1VQP A;  4FF1 A;  4A3C G;  3CPW A;  1LTA D;  2XNA C;  4FF3 A;  4LFB Q;  1CT1 D;  2KHI A;  1CZG A;  1TY0 A;  2FFK B;  2XIW A;  2O2L D;  3LX0 A;  2F0D A;  3CCV A;  1SYC A;  3J81 j;  4KY7 A;  5FLM H;  4ULL A;  3TRE A;  1KAW A;  5IE8 A;  2BE5 D;  2KCM A;  2PZU A;  3NWT A;  4LF5 Q;  1GD7 A;  4X64 L;  5CR3 A;  2G5D A;  3QWN A;  1XNQ Q;  1II3 A;  1IYV A;  4ILW A;  1TY2 A;  1U4R A;  1LM0 A;  1HZA A;  3ITP A;  1EIH A;  2JA7 G;  3CRK C;  1TS5 A;  5KIX A;  4ZCK A;  3QJY A;  4ME5 A;  5IGC A;  5T1I A;  4U67 3;  4A3M B;  3PMF A;  4KK7 A;  4X62 L;  4BXX G;  1BO0 A;  4HJ7 A;  4DGZ A;  4L63 B;  3HOW H;  3F1Z A;  4DV3 Q;  4C3J H;  3LWE A;  4HSP A;  4M1U B;  1CKN A;  4UHV A;  1WTW A;  5JJK A;  3ERQ A;  4LAA A;  3FHW A;  4KHV A;  4K5W A;  3BVG A;  3MXG A;  5JEA H;  3GTJ B;  1EZ6 A;  3CHB D;  1VQH A;  4QMG A;  2R7Z B;  3NUC A;  1KHI A;  3EA6 A;  2K14 A;  3OIQ A;  4BY7 H;  4IO9 A;  3HKZ B;  1MBY A;  1PXU A;  4GKK Q;  2N49 A;  3KF6 B;  5D3I B;  1YI2 A;  1HR0 Q;  1HFG A;  1CTM A;  1STE A;  2L12 A;  4LF9 Q;  4O0A A;  1UE7 A;  5HGQ A;  5C3X A;  4DR2 L;  1X55 A;  4MHE A;  5C3E B;  3GTQ H;  2UU9 L;  3P20 A;  4R4Q A;  2CW0 D;  4R8N A;  5A2Q L;  1HZ9 A;  1I5F A;  4J15 A;  3GV6 A;  1UUP A;  4IFD I;  3L2P A;  3Q22 A;  4JI8 L;  5IT9 L;  1TWG H;  1RF2 D;  3NWS A;  4DR6 L;  4QF4 A;  2VUM B;  1RIP A;  4CKE A;  2BCO A;  1I4X A;  5LMN Q;  1BBU A;  5ELC A;  2E2D C;  2HQL A;  3TDQ A;  1CHP D;  2F0I A;  2M2L A;  3EQL C;  3JAM L;  4JV5 Q;  4ZKC B;  3HFZ B;  3KDF B;  5KNB A;  2QDL A;  2F3V A;  2OEO A;  3U9S A;  3G4S A;  2KUM A;  5DLQ E;  4A3K H;  1BKB A;  2OCE A;  1MI2 A;  3W5O A;  1SNP A;  3HOY B;  5IP9 H;  4DU9 A;  3SEB A;  4XQN A;  1MSH A;  3F8T A;  4KI0 A;  4A3G G;  4KJN A;  1N33 L;  1KRT A;  4H7B A;  4A3F H;  1EY6 A;  1EU3 A;  4R4I A;  1VQJ A;  1WCM B;  4UPA A;  4LF4 L;  3J7A V;  1NCV A;  1TS2 A;  2N78 A;  1HPC A;  3MFG A;  4QIW B;  1Y69 U;  4G7O C;  5C4H A;  4KJO A;  1IHZ A;  5HUR A;  1PTO D;  3GDE A;  1D5M C;  2P5Z X;  1V1P B;  3MXN B;  1VQD A;  4CKC A;  2Z1C A;  1GUS A;  3A55 A;  1WTQ A;  1PH8 A;  4NB3 A;  1C48 A;  1U0L A;  2NVT B;  1JJG A;  4XTC S;  4PV1 C;  1EQT A;  4KHP Q;  5C0X G;  3GTG H;  1NMG A;  2VQF Q;  1K8G A;  5M9O A;  2AWN A;  2F0H A;  3FKI B;  1UEB A;  3MTS A;  5C5L A;  5IYD G;  3W1G A;  4OON A;  4HCE A;  1R4P B;  3I72 A;  4C2M H;  4OO1 H;  1DOK A;  1D8L A;  2I46 A;  1I6H H;  2KCT A;  2E2H H;  3CF5 A;  4OWX B;  1WTO A;  4LF6 L;  4DR3 Q;  4XIG S;  4JI3 L;  4BBS B;  1KXL A;  3R8B A;  1AE3 A;  4DXG A;  3PO3 B;  2J0T D;  2KED A;  4JG2 A;  2NN6 I;  4RKB A;  1K83 H;  4YY3 Q;  4DR5 L;  2K32 A;  3T1H L;  2I5L X;  1NJI C;  1SMY D;  1SMX A;  3NBH A;  1CK1 A;  1CZW A;  2KCC A;  4P73 A;  1R9T B;  5M5X B;  3KFU A;  1ONL A;  4A3J H;  3J81 E;  4LMQ D;  4JI5 L;  1IZ6 A;  3QOL A;  2XTI A;  3NQT A;  1RHP A;  1A3U A;  1EU4 A;  1RTO A;  3D3R A;  1KAB A;  2F3I A;  4FP5 D;  2JYO A;  1I3Q B;  4JOI C;  2NZ1 D;  2F0P A;  2L55 A;  2UXC L;  5M3M G;  1I4Q A;  2HHH L;  2B8G A;  2F1M A;  4MTN A;  4XT3 B;  4TVA B;  4BWG B;  4AYB E;  3FPU B;  1Y1W B;  2BH8 A;  3GTO H;  1PYW D;  2R92 B;  1H9S B;  5FKA C;  2EYM A;  5K36 H;  4IJL A;  4B9X A;  1Y1V H;  2VB3 X;  2Q8R E;  1YHB A;  1ILP A;  2DNE A;  3P7J A;  1N32 L;  3OYY A;  3H3V H;  4OEL B;  3NTH A;  2F0S A;  5ELN A;  2CH4 A;  2IY5 B;  2OTL A;  1X56 A;  5IYC G;  1CA5 A;  3CC2 A;  4HR7 B;  4PQX A;  2F0V A;  1Z6H A;  4KN4 C;  5I2Y A;  1B4O A;  1GUW A;  1UE5 A;  3PIP A;  2QW7 A;  3R2T A;  4RCO A;  1QNU A;  4DF7 A;  1OXS C;  4ZYS A;  3EJI A;  4IJH A;  2OQK A;  4L6T B;  4B3R L;  1X32 A;  5IIF A;  3VA7 A;  1GHK A;  4PZ6 A;  3BJU A;  3OMC A;  2BOS A;  2EOT A;  3K0X A;  4ZRZ A;  2YU9 H;  4H13 C;  1TR5 A;  2CCZ A;  1O80 A;  4A3I H;  2KJX A;  3GD7 A;  1EQV A;  1PMR A;  1JOO A;  4X66 L;  2NZH A;  2VY3 A;  1TII D;  2JEB I;  4JI0 Q;  4C3I H;  2WB1 E;  1WD0 A;  2QEJ C;  1XX8 A;  3TSS A;  3BDL A;  1V1O A;  4IUV A;  1RL2 A;  1XNR L;  3D8G A;  4RAU C;  2EIF A;  4EVO A;  3NXW A;  4DUZ Q;  4AYB B;  2EE1 A;  3O13 A;  1O78 A;  3BYY B;  3S9W A;  1SNQ A;  2FMM A;  1EL0 A;  4NXN Q;  1HNW L;  3A0J A;  1GM5 A;  3PF5 A;  1GOZ A;  2JP1 A;  1SYF A;  2NVX H;  1LTL A;  1D5X C;  2C5C A;  3CMA A;  4F8M A;  1RD9 D;  1I94 L;  5AFW A;  1STH A;  3SK8 A;  1SXT A;  3UI2 A;  5C3E G;  4AQY Q;  1XJV A;  1BCP B;  4K8J A;  3TN2 A;  3NK9 A;  5IGB A;  2C35 B;  1W2B A;  2ES2 A;  1EQQ A;  4JI4 L;  3FEW X;  3NTI A;  3TP7 A;  3HS0 C;  1A0I A;  3QR8 A;  2VUM G;  3S1M B;  1HNX Q;  1L1O B;  4XDX A;  1A15 A;  3RLO A;  1PH5 A;  2VQE Q;  3E3X A;  1WTR A;  2XSC A;  2VW9 A;  1H95 A;  1YEZ A;  3UDG A;  2RCF A;  4N9T A;  3V05 A;  1QZH A;  1ENC A;  1F2Y A;  2JA5 B;  1R4Q B;  3KK7 A;  4PG3 A;  5E1F A;  1CHQ D;  4OIK A;  3CC4 A;  1AP0 A;  3B6Y A;  5G3L D;  3HOY G;  1G6P A;  5TSS A;  2G9H D;  4DV7 L;  2ZJP A;  4KN7 C;  4KLK A;  2GA4 B;  3IKJ A;  5GAG C;  4A3E H;  3A7L A;  4H02 A;  3F2C A;  1MJC A;  3KLW A;  2PNH A;  3HOW G;  4C3J G;  4H0L C;  4WJ3 M;  3HP3 A;  4B3M L;  3GTL H;  1SR3 A;  3S1N B;  4OX9 Q;  4O2D A;  1DOM A;  1D2B A;  3A74 A;  3K5N A;  2JA7 B;  1ESF A;  4IFD H;  1PDQ A;  3NEN A;  3MAQ A;  1UE1 A;  5JEA G;  3RZD B;  1LT3 D;  4FDB A;  4DAV A;  2LXK A;  3J80 i;  5BR8 Q;  2WII B;  5JPN C;  4XYQ A;  3RLF A;  4DR7 Q;  5C4Z A;  3J81 i;  1LAC A;  3E0E A;  1CKM A;  1CI3 M;  4DK1 A;  3FKI G;  5E4X A;  1VQ9 A;  2LSS A;  5LL6 S;  3M3Y H;  3P1H A;  1DOL A;  4CGY B;  5T1G A;  1JWS D;  1N9W A;  3S2D B;  1ZYR D;  4JI6 Q;  1VQN A;  5GAH C;  3HG9 A;  5CV5 A;  3G6E A;  2J7Z A;  2E75 C;  1L0X B;  3HKS A;  4V19 0;  1N36 L;  1QCB D;  3PO3 G;  3RN2 A;  2X6G A;  5HGT A;  4OEM B;  4QB4 A;  1J5E Q;  2AQ1 B;  3CCR A;  1PHJ A;  1K8A C;  5FO7 B;  4L5Q A;  4XYO A;  2B8F A;  2JA8 H;  4KKU A;  1EY0 A;  4RKL A;  5KYI A;  4WFN 3;  3NQI A;  2PQA A;  3PV0 A;  5AJ3 L;  2E5L L;  3U4Z A;  1BDO A;  2VNU D;  1P16 A;  3VA5 A;  5I2X A;  3S1R B;  1I4G A;  4FXK C;  2UXD Q;  3LWU A;  2DY7 A;  1ROD A;  4EGV A;  1J6Q A;  5L37 A;  2B3G A;  1SE3 A;  4DUY Q;  2MPM A;  4GKK L;  4OHJ A;  1S5B D;  2A19 A;  3K58 A;  1EFI D;  3Q0A A;  4DV2 Q;  2KHS A;  4DV0 L;  4X3K A;  4DR1 L;  2KVM A;  4DV6 Q;  4OWT B;  5JJI A;  3H3V C;  1T5X D;  4YCV A;  5I4D A;  3CCM A;  1XMO Q;  2NB0 A;  2K5H A;  4GN5 A;  2F0M A;  1Y1W G;  2XRQ D;  1H9K A;  3I7F A;  1STA A;  1CQF A;  4FNF A;  2QEX A;  2A69 C;  1VQF A;  1QUQ B;  2B2V C;  2K5D A;  2NN6 H;  3CAM A;  5D3D A;  2NVY B;  4GKJ Q;  1WJJ A;  5CV4 A;  4QY7 A;  1YNX A;  2L9H A;  1ZKO A;  3A8I E;  2EYO A;  2M00 A;  4C1N I;  5A2Q E;  5KRU A;  4DV1 L;  1SNC A;  2N3S A;  1STN A;  3ULP A;  4OO1 G;  4H44 C;  2AQ2 B;  1HZB A;  3CPF A;  4IUQ A;  4QJF A;  2IHE A;  2F0J A;  4F87 A;  2R3Z A;  4CDF C;  3HOX H;  3PQI A;  4U68 A;  1PTO H;  1F2L A;  3S15 H;  4K5V A;  4LF8 Q;  1TWH B;  1VQE A;  3TBI B;  1F77 A;  4RGT A;  2A6E D;  2Z4H A;  4R4C A;  4WJ4 A;  2F4V Q;  3GTM B;  2WKC A;  3JC6 6;  1IBM Q;  2UUA L;  1E0B A;  3A7A B;  1YNJ C;  4JC0 A;  4A3J G;  2E2J H;  4R4T A;  1SRU A;  1H9R A;  2E74 C;  4ZLT F;  1Y14 B;  1WOC A;  2NBF A;  4NXM Q;  1TWC B;  2QA4 A;  5LMU Q;  1FYC A;  1HR0 W;  1Q46 A;  4C3H H;  2EYP A;  4UDU C;  2EXD A;  1IBL L;  1VS0 A;  2QDB A;  4IUR A;  3J7A 5;  4N8F A;  1TWF H;  2WFW A;  2PO4 A;  1OTC A;  1Q90 A;  4YWL A;  5KND A;  4AYB G;  1WI5 A;  3DLL A;  1TWA H;  3I70 A;  1XYI A;  4DK0 A;  1A62 A;  3CRL C;  2F0F A;  5JAV A;  1QVC A;  4NP5 A;  5NUC A;  2SDF A;  5LMN W;  2KQ3 A;  4K8I A;  3CCL A;  2TMP A;  4KD3 A;  4K14 A;  5M3M B;  3RZO H;  1VMP A;  1WTX A;  1G2S A;  2KHJ A;  5C0X J;  3Q23 A;  2RHS B;  2K75 A;  4F7X A;  1OXT A;  4DNR B;  4K6L A;  1PZI D;  4DFA A;  3TRZ A;  2ASB A;  3S16 H;  3K59 A;  4HN7 A;  1NSN S;  3IL8 A;  1AEX A;  1WFQ A;  1SND A;  1X3P A;  1UAP A;  3KOJ A;  1PH6 A;  4A4I A;  2WAQ E;  3PO2 H;  2JA5 G;  3PIO 3;  2AWO A;  1LT4 D;  3VDY A;  3CD6 A;  3E9I A;  3CCQ A;  3VR5 A;  2EY5 A;  2JA6 H;  4DV5 L;  4O1N A;  4A3I G;  1BUV T;  2DGY A;  1DJR D;  2BE5 C;  2F0L A;  4GOP A;  5IGE A;  1MD2 D;  5LL6 X;  4X3T A;  2WB1 G;  1MJE A;  2MHV A;  3CQZ H;  3K6O A;  4C3I G;  3ER0 A;  5D14 A;  4NKL A;  4DR4 Q;  4BA1 I;  4B3S L;  2B63 B;  3RUZ A;  3NBI A;  2RBM A;  3S24 A;  1SFO H;  1U4L A;  3EFX D;  3I73 A;  4NDX A;  2UXB Q;  5I6W A;  3S17 H;  3MC0 B;  4ODG A;  1DD2 A;  1B2T A;  3AEV A;  1PTO F;  3K7A H;  4K0K Q;  4UY8 C;  1JOR A;  3S2H H;  3ND8 A;  3D31 A;  4IPH A;  1NTG A;  4LFA L;  4HMJ A;  3HOZ H;  2MGS A;  5F2D A;  1PRT D;  4YHH L;  2Z0S A;  4A3D H;  5IWA Q;  2KOL A;  4P71 A;  3I4M H;  1NMF A;  2F0Q A;  4JI7 Q;  1LTG D;  1A8V A;  2EXZ A;  4LF7 Q;  2F0E A;  1HNZ Q;  4GN4 B;  1EYG A;  2LKV A;  4LWC A;  2AQ3 B;  2NUC A;  4JI0 L;  5EKK A;  4G7H C;  3D4D A;  3HOU B;  5DM7 3;  1K3B C;  1B7Y B;  4HJA A;  1MIU A;  4IUP A;  4RMF A;  5CV9 A;  2JE6 I;  3A8K E;  3ICE A;  2CW0 C;  2PI2 A;  1E2Z A;  2MO0 A;  2ZM6 Q;  1QB5 D;  4GNX B;  3GQB A;  1TS4 A;  3CW2 C;  3SR1 A;  2MP1 A;  2Q2H A;  2ZJR A;  4NXN L;  3D6W A;  1QJO A;  3KUP A;  1QZG A;  4OXP A;  4QCL A;  3LGJ A;  1RTN A;  5ELO A;  1JE5 A;  4IPC A;  4R1J A;  3Q8D A;  3E9H A;  4BBS H;  1IYU A;  1IYJ B;  2H1E A;  5IGF A;  3VR6 A;  4Y52 H;  1LTT D;  3PGZ A;  5BN5 A;  5BN3 A;  2LMC B;  2RA4 A;  1RCV D;  2A73 B;  3HOW B;  4C3J B;  4GS3 A;  5KEE A;  5C4X H;  5EPK A;  1DCZ A;  2KBN A;  2PNR C;  2IX3 A;  4BY1 H;  3AMU A;  1JWM D;  4I7A A;  2MFI A;  1GUT A;  3U50 C;  1PTO C;  1RDP D;  1PYB A;  5EBD A;  1Q86 C;  2Z6B A;  3CCS A;  5C44 H;  4XQQ A;  4CJ0 B;  2CWA A;  2LS0 1;  2DY8 A;  3H0G H;  4NMZ A;  4BY7 B;  1NR4 A;  2MNA A;  1EWC A;  5C0X I;  1VQL A;  3DM3 A;  4BBR H;  1NR2 A;  2CVR A;  3BYT B;  1VQC A;  1AN8 A;  4YWK A;  2D5D A;  5M5Y H;  3I4N H;  1YNN D;  3KF6 A;  4EQO A;  2JA8 G;  3GTQ B;  2I0Q A;  1Z47 A;  1IKM A;  1MHW C;  3BDC A;  1L2F A;  2A68 D;  3GTP H;  1V1Q A;  4A93 H;  1KDB A;  4JCV E;  1TWG B;  1A6X A;  2YV5 A;  1A3V A;  4M8A A;  4A76 A;  4V0B A;  4RA8 A;  3KF8 B;  4X65 Q;  2SOB A;  1JQY D;  3BU2 A;  4Y7N H;  2EDG A;  1Q7Y C;  1O7I A;  1SMY C;  2JA9 A;  2R7D A;  4JI1 L;  3J80 E;  1PFS A;  3D6C A;  1IBK Q;  3I2Z A;  4OIJ A;  4A3K B;  4JYA Q;  4LFC L;  3N52 A;  5IGD A;  2SNM A;  2L11 A;  3G71 A;  1EYC A;  1VQ8 A;  1ET9 A;  3VYU A;  1EWI A;  3STB D;  1UNS A;  3KDF A;  4B3T Q;  4QUF A;  1B8A A;  3I3C A;  4A3F B;  1E2W A;  4LW1 A;  1F9Q A;  3GP7 A;  3V2T A;  1O7Z A;  2K04 A;  2VZA A;  4K2L A;  1EIF A;  1S5E D;  5EJW A;  1N8R C;  5JJZ A;  1FJG L;  1IL8 A;  2AHO B;  2ZT9 C;  1AFP A;  3RD4 A;  3K5O A;  3NE5 B;  2MO1 A;  1EQR A;  3EVQ A;  2IW3 A;  4Z9C B;  3CCE A;  5C6A A;  4HJ9 A;  3AU7 A;  3QG1 A;  3MZ5 A;  4X3U A;  2NTS A;  1VQ6 A;  1V1P A;  1JCK B;  2UXD L;  3MXN A;  3T16 A;  3GTG B;  2ICE C;  4DUY L;  2JXM B;  5DNF A;  1GJX A;  1PH3 A;  1BQQ T;  1N34 L;  3I90 A;  3CME A;  4K2K A;  1MKH A;  3MHB A;  3AQQ A;  2H4O A;  3ZJY C;  1ASY A;  3SE0 A;  4X64 Q;  4C2M B;  4DV6 L;  3T4A C;  2EPB A;  1E7Z A;  4HIM A;  3G7L A;  2XGT A;  1I6H B;  5ELB A;  1JOQ A;  2E2H B;  3SK5 A;  1XMO L;  1HQM C;  4APV A;  5IP7 H;  2HDL A;  1X3Q A;  1JIC A;  3M4O H;  3I8Z A;  1SNO A;  1LO5 D;  2BA0 A;  2LY7 A;  2IHF A;  4L8J A;  1K83 B;  1XPR A;  3URY A;  4MTK A;  3S14 H;  4DV4 L;  4X62 Q;  4Q5V A;  3P75 A;  3EN2 A;  1XMQ L;  2B63 G;  2E2I H;  1IW7 D;  2AMC B;  3OOC A;  3LNN A;  2DUD A;  1TQO A;  2D0P A;  2M9V A;  1G8Z D;  3E6Z X;  4RCN A;  4A3J B;  2RDH A;  1TS3 A;  5FLX E;  2R93 H;  2RVL A;  2K7V A;  1NNX A;  4CHT B;  3L3O C;  5I9P A;  1KNA A;  3QO2 A;  4P72 A;  2HCC A;  1JJ2 A;  1SLJ A;  3HRZ C;  3DWA A;  2IT1 A;  4PZ8 A;  3UDF A;  5C4J H;  5J39 A;  2JN4 A;  4RG1 A;  1LYL A;  1QVG A;  3UE0 A;  1ASZ A;  3GTO B;  1PZK D;  4DR2 Q;  2EJG C;  1Y1V B;  4N9P A;  1YHQ A;  3WDN A;  2UU9 Q;  5GAE C;  4ZQ3 A;  2AUJ D;  4FVM A;  4AIM A;  1C0A A;  3HOU G;  1H9S A;  2WAQ G;  1ET6 A;  1F2M A;  1DGS A;  2KEN A;  4JI8 Q;  3RZD H;  4J8Q A;  3EBE A;  4TKO B;  1CSQ A;  4DR6 Q;  5J22 A;  5EGT A;  5FLM G;  2JA6 G;  3R3O A;  2X69 A;  4LUO A;  2Y0S E;  2B2U A;  3RNU A;  1SYB A;  1A2U A;  3DM1 A;  2NWG A;  2Z6K A;  5IGG A;  2CKZ B;  3H09 A;  1B70 B;  1EEI D;  1PV4 A;  1V9P A;  1VQK A;  2EYF A;  4G57 A;  1N33 Q;  5FO8 B;  2YU9 B;  4RGO S;  5EKL A;  3GTK H;  3ONA B;  3DEP A;  4LF4 Q;  1UEA B;  1H9J A;  4A3I B;  1EY9 A;  1JWU D;  1KDA A;  4A3L H;  3T1Y L;  1VQI A;  3CC7 A;  2ZTD A;  2N88 A;  1KAA A;  2WB1 B;  3J7Y W;  4LUZ A;  2PCF B;  4C3I B;  2ZXR A;  5M3F H;  5M5W H;  2FMC A;  1YJN A;  1S4Z A;  5H1S E;  3S1Q H;  3AFP A;  4FXG C;  4R9W A;  3HOV H;  3I91 A;  3I55 A;  3X3N A;  1IXR A;  1J8I A;  1SNM A;  3Q6S A;  1G2T A;  1HH2 P;  4LFB L;  3RLN A;  1SE2 A;  4IAL A;  2WAC A;  5GRO A;  5ELE A;  4ID6 A;  2PPB C;  1QG7 A;  2HCI A;  4BY7 G;  3I4M G;  1L0W A;  3M4P A;  4LF5 L;  1Z9F A;  1XXG A;  2MJ8 A;  2NVX B;  1KRS A;  5JOB A;  1XNQ L;  1JOK A;  4R4O A;  4LF6 Q;  3TP8 A;  2EYL A;  3QOJ A;  4JI3 Q;  4IPG A;  2RDF A;  3GO5 A;  2A8V A;  1VQA A;  3G6J B;  1AW7 A;  4A3G H;  5E7N A;  3W3A A;  4DAY B;  1TT2 A;  1ZYR C;  1UE6 A;  2Y0S B;  5CC4 A;  4DR5 Q;  2JQO A;  3M4Y A;  3KYH C;  1YHA A;  1X3E A;  3AB9 A;  1OO9 B;  2IL8 A;  2UUC Q;  4EQ5 A;  4DV3 L;  1JE4 A;  1W6K A;  1SBB B;  3NTK A;  4JI5 Q;  1CUK A;  2IPK D;  1DON A;  1L1O A;  1I4R A;  1OXU A;  3CU7 A;  2D9U A;  4A3K G;  4CDC C;  4XT1 B;  2IWH A;  2NVQ H;  5C0X H;  5IP9 G;  1X3G A;  2UXC Q;  5IYD H;  1J9O A;  2SNS A;  4A3E B;  2Q2T A;  2HHH Q;  2F0U A;  4A3F G;  1HR0 L;  3M4Q A;  1GHJ A;  5FJ8 H;  4LF9 L;  3NEM A;  1CA6 A;  1BBW A;  4BY1 G;  1KD1 C;  1EY5 A;  1N32 Q;  3OWF A;  2EVB A;  4KMU C;  1B9M A;  1JC7 A;  1WVL A;  3OMG A;  1I4P A;  2IX1 A;  1RJT A;  5E3F A;  2EY1 A;  1LTB D;  4WJW A;  2L1B A;  3K57 A;  3PF4 A;  2ALY B;  2VL6 A;  2E76 C;  1Y8P B;  5IYB H;  4BBR G;  5LMN L;  5ELF A;  4IUN A;  2A6H D;  1S5F D;  3OIP A;  1OXX K;  1B50 A;  4CKB A;  4N8X 1;  4AH6 A;  3KJP A;  1BNZ A;  2FXQ A;  2AKW B;  3I4N G;  5C3W A;  5IT9 E;  1S5D D;  3PUY A;  3M3Y B;  3VYT A;  1BCP D;  2B2Y A;  4ZKB B;  4JV5 L;  2XVS A;  2C9O A;  1PLF A;  4B3R Q;  3A5Z B;  3A54 A;  2B2W A;  2I5H A;  4JI2 Q;  1VF5 C;  1U5K A;  3T13 A;  2J4X A;  3NHH A;  5C5M A;  1X9N A;  2K5W A;  3JAM E;  1EIG A;  3TEH B;  1E2V A;  3DEO A;  1XTC D;  1CKO A;  4IQZ A;  1WYD A;  2K05 A;  2A6E C;  4X66 Q;  1SAP A;  3H15 A;  4ALP A;  1VQ7 A;  4A3B H;  2JA8 B;  1I50 B;  1BF4 A;  4L5T A;  2F4I A;  4JW0 A;  2GN5 A;  4POG A;  1AE2 A;  3TZU A;  5J3B A;  3F2U A;  5FK9 C;  4PMB A;  3C46 A;  1KC8 C;  1XNR Q;  1T9H A;  5COY A;  2QF7 A;  3WOF A;  1U9R A;  5A35 A;  1FVI A;  4NW2 A;  4B08 A;  4KHP L;  1K8O A;  3EIV A;  2VQF L;  2R7F A;  3CKI B;  1HNW Q;  2A1A A;  1SE4 A;  1X65 A;  1SJH D;  3M9B A;  1WTP A;  4HED A;  4MNO A;  1HXY D;  5K36 G;  2BDN A;  4DR3 L;  1GUG A;  1Y1V G;  2O4X A;  3PIO A;  1ESR A;  5DEH A;  1PRT F;  2QKI C;  3DWQ A;  1GO3 E;  4YY3 L;  1EWH A;  1QUQ A;  1XPO A;  4A3M H;  3TP5 A;  2OXP A;  1PVO A;  1LUZ A;  3OPO A;  1CKN B;  1D1I A;  2B2W C;  1CFM A;  1K0S A;  1CM9 A;  1B44 D;  1VQ5 A;  4FF2 A;  4JYA L;  2L4N A;  1ILQ A;  2ICI A;  1HQR D;  3C3L A;  4YWM A;  1B3Q A;  5IP7 G;  3H91 A;  1YIT A;  4FYD A;  3HOX B;  4POF A;  3VR2 A;  4IOC A;  2Q8T A;  3K81 C;  3T56 B;  1STB A;  1PTO B;  2JK8 A;  3S15 B;  4J1M A;  3UDI A;  3GTJ H;  1GXD C;  1FL0 A;  4DV7 Q;  2R7Z H;  3H6M A;  4P74 A;  2WP8 J;  4G7Z C;  1E22 A;  1B53 A;  2XN9 C;  2K5V A;  3HKZ E;  1HJP A;  2EQS A;  4B3M Q;  2E2J B;  3KLR A;  1E1T A;  1M8A A;  4TQU S;  4JVZ A;  2YTY A;  3BZD B;  4XXE A;  5C3E H;  2XWB B;  4KV6 A;  1VDZ A;  2VS1 A;  4UP8 A;  2F0K A;  1RKN A;  2HIV A;  1LV9 A;  4C3H B;  5EPL A;  2PW7 A;  4KY5 A;  3CCJ A;  3W1B A;  1JB3 A;  1Y8O B;  1TXY A;  1TWF B;  1F9S A;  1LT5 D;  1E3P A;  4HIK A;  1D1K A;  2L5T A;  4DK3 C;  4GLV B;  2VUM H;  4EQP A;  2F0O A;  3DMU A;  1TWA B;  2D2C C;  1YIJ A;  1DYQ A;  4Q0F A;  1P8L A;  2K03 A;  5JVH 3;  3HZX A;  1GKH A;  3U58 A;  1FGB D;  2K4K A;  2QGQ A;  2V1C C;  3HOY H;  1QE6 A;  2EJF C;  3RZO B;  1LTR D;  1N36 Q;  1Q82 C;  3ZYY X;  4QQB X;  2K6A A;  3RR5 A;  1PRT C;  1C9O A;  1PFB A;  2ID0 A;  2Y0S G;  5CBE E;  3AFQ A;  1WCM H;  5JVG 3;  1Q3L A;  1CQV A;  1GUN A;  3A5U A;  2SEB D;  5KGU A;  5ISR A;  2B39 A;  1X6O A;  3QB3 A;  4QIW E;  3S16 B;  4FXD A;  3A56 A;  3C2P A;  1PH7 A;  1O7Y A;  2WAQ B;  4PNY A;  5AJ3 Q;  2E5L Q;  1LAB A;  2L15 A;  3TME A;  1ML0 D;  3PO2 B;  1S40 A;  1PH4 A;  1LLR D;  2DJF C;  4GOP C;  4IPD A;  5CV8 A;  2EYH A;  4QUC A;  1IL2 A;  2NVT H;  5FOB B;  2JA6 B;  5KYL A;  4DUZ L;  3FPP A;  4DV0 Q;  4DR1 Q;  4A3L G;  3FKI H;  4A3E G;  4PZ7 A;  3G48 A;  1SYD A;  2K28 A;  3CQZ B;  1DZ1 A;  1SRO A;  5M3F G;  1WTV A;  1QVF A;  3KLS A;  3PUV A;  2F03 A;  3HOV G;  1FR3 A;  1PFM A;  1K0R A;  3JAM i;  3FMC A;  1A2T A;  4P75 A;  4AQY L;  4DAM A;  3NBH B;  2YYZ A;  3WOE A;  4IFD G;  3PO3 H;  1SFO B;  1EOT A;  4X3S A;  3T53 B;  3OWE B;  3TS0 A;  2GVA A;  4YCU A;  4FF4 A;  2BA1 A;  1L0Y B;  1Z7T A;  4DV1 Q;  3S17 B;  4C1N K;  4BA2 I;  2CFM A; 
#chains in the Genus database with same CATH homology
 4DV4 L;  1PH1 A;  4JBK A;  4X62 Q;  1NBW A;  1HNX L;  3PUX A;  3EN2 A;  1XMQ L;  3G6E A;  2B63 G;  1W3S A;  2E2I H;  2VQE L;  1R9T H;  2AMC B;  3HKS A;  5M5X H;  2DUD A;  2D0P A;  4YCW A;  1N36 L;  2GVB A;  3PO3 G;  3RN2 A;  2OTJ A;  2R93 H;  4B3T L;  5HY6 A;  1J5E Q;  4P72 A;  2UUB L;  3CCR A;  1PHJ A;  1K8A C;  4L5Q A;  3SGI A;  1SLJ A;  1JJ2 A;  3T1Y Q;  2JA8 H;  1S3O A;  3CCU A;  1I3Q H;  3OTO L;  2IT1 A;  1VCI A;  4PZ8 A;  3M7N A;  3OW2 A;  1VQO A;  1S72 A;  2PQA A;  3PV0 A;  1YJW A;  3UDF A;  5AJ3 L;  2E5L L;  3U4Z A;  1YVC A;  2R93 G;  2VNU D;  2K52 A;  3BZK A;  1P16 A;  5C4J H;  2UUA Q;  1C7Y A;  4QL5 A;  1Q12 A;  1Q1E A;  4RG1 A;  1LYL A;  1QVG A;  4JBM A;  3HOU H;  2UXD Q;  3UE0 A;  3I4O A;  1J6Q A;  4JOI A;  3D0F A;  2B3G A;  1Y1W H;  3CP0 A;  4DUY Q;  1VQP A;  1ASZ A;  4A3C G;  3CPW A;  3UDX A;  2R92 H;  4OX9 L;  4LFB Q;  4GKK L;  2KHI A;  2Q2I A;  4DR2 Q;  4NPS A;  3CCV A;  2A19 A;  3J81 j;  4DV2 Q;  1E24 A;  5FLM H;  3TRE A;  4DV0 L;  1YHQ A;  4DR1 L;  4DV6 Q;  1EUJ A;  1KAW A;  4OWT B;  3PUZ A;  2UU9 Q;  5GAE C;  5JJI A;  2B29 A;  5IE8 A;  2KCM A;  1IBL Q;  4AIM A;  1C0A A;  4YCV A;  4LF5 Q;  2WAQ G;  3CCM A;  1GD7 A;  1XMO Q;  3HOU G;  2E8G A;  2K5H A;  4GN5 A;  4X64 L;  5BR8 L;  1DGS A;  2KEN A;  4JI8 Q;  3RZD H;  1Y1W G;  1XNQ Q;  4DR7 L;  3I7F A;  3EBE A;  1OXV A;  1CSQ A;  4DR6 Q;  1EOV A;  2QEX A;  3F2D A;  1VQF A;  4GNX A;  1QUQ B;  2PMZ E;  2OQ0 A;  3CAM A;  5FLM G;  2JA6 G;  4LUO A;  2Y0S E;  5FJ8 G;  1LM0 A;  1WJJ A;  1HZA A;  3RNU A;  1IBK L;  4QY7 A;  1YNX A;  2JA7 G;  4GKJ Q;  1HZC A;  2Z6K A;  3FP9 A;  2CKZ B;  4DV1 L;  3U4V A;  4UP9 A;  4JI6 L;  1GVP A;  2N3S A;  3ULP A;  4X62 L;  1B70 B;  2CWP A;  4KHP Q;  1JJC B;  3STB C;  4BXX G;  4OO1 G;  1PV4 A;  4HJ7 A;  2NN6 G;  1V9P A;  1VQK A;  2UUB Q;  3HOW H;  3F1Z A;  4UP7 A;  1HZB A;  5JEA J;  3CPF A;  4C3J H;  4DV3 Q;  1N33 Q;  2CQO A;  4QJF A;  2IHE A;  5IYB G;  3GTK H;  1CKN A;  2RCN A;  1J5E L;  3HOX H;  3OTO Q;  4LF4 Q;  5JJK A;  2UUC L;  3K8A A;  3FHW A;  3BZC A;  3S15 H;  4A3L H;  3T1Y L;  4LF8 Q;  1VQI A;  1VQE A;  3CC7 A;  2ZTD A;  3UE1 A;  3AYH B;  4R4C A;  1VQH A;  4WJ4 A;  4LUZ A;  2F4V Q;  5M3F H;  5M5W H;  1KHI A;  3PSI A;  3KJO A;  2K14 A;  1YJN A;  4BY7 H;  5H1S E;  4IO9 A;  3JC6 6;  1IBM Q;  3S1Q H;  3AFP A;  2YTX A;  4L5S A;  3HOV H;  4GKK Q;  2N49 A;  3KF6 B;  3I55 A;  2UUA L;  1IXR A;  1YI2 A;  1HR0 Q;  3HOX G;  4JC0 A;  4A3J G;  2E2J H;  3ULL A;  1VQ4 A;  4DV5 Q;  4R4T A;  1SRU A;  2Q2U A;  1HH2 P;  4LFB L;  4LF9 Q;  4O0A A;  1UE7 A;  1Y14 B;  1WOC A;  3RLN A;  1G29 1;  5HGQ A;  3J80 c;  1FGU A;  4DR2 L;  4NXM Q;  1X55 A;  2QA4 A;  5LMU Q;  4DV2 L;  1HR0 W;  3GTQ H;  5GRO A;  3J81 c;  4A3B G;  2UU9 L;  1Q46 A;  4BY7 G;  4C3H H;  4R4Q A;  3I4M G;  1HZ9 A;  2EXD A;  1L0W A;  1PH2 A;  1IBL L;  1I5F A;  3WWV A;  1VS0 A;  3M4P A;  4A3D H;  3J7A 5;  4LF5 L;  4J15 A;  1Z9F A;  1TWF H;  4IFD I;  2WFW A;  2NZO A;  3L2P A;  4JI8 L;  1KRS A;  1OTC A;  1XNQ L;  1TWG H;  4YWL A;  2MQH A;  4GNX C;  4AYB G;  4DR6 L;  1WI5 A;  4R4O A;  3DLL A;  4LF6 Q;  1RIP A;  4B3S Q;  1TWA H;  5LMN Q;  4JI3 Q;  4IPG A;  1BBU A;  3GO5 A;  2A8V A;  1VQA A;  4GKJ L;  4A3G H;  1A62 A;  5E7N A;  4DAY B;  3PCO B;  2HQL A;  1QVC A;  1UE6 A;  4GLX A;  4DR5 Q;  2JQO A;  1V43 A;  3KYH C;  1BVS A;  4HJ5 A;  3HFZ B;  3KDF B;  5LMN W;  4DK6 C;  4JV5 Q;  3CCL A;  3G4S A;  3S1M H;  1YHA A;  1X3E A;  5DLQ E;  4A3K H;  1BKB A;  2OCE A;  3W5O A;  3RZO H;  5IP9 H;  4DPG A;  2UUC Q;  3F8T A;  4LFA Q;  4KI0 A;  4EQ5 A;  4DV3 L;  4A3G G;  2KHJ A;  1N33 L;  1KRT A;  5C0X J;  2JA5 H;  4A3C H;  1Q1B A;  4A3F H;  4JI5 Q;  2RHS B;  1CUK A;  4JI2 L;  5IY0 A;  2K75 A;  1VQJ A;  1OXT A;  1L1O A;  4R4I A;  4UPA A;  1K9M C;  1OXU A;  1KQS A;  4LF4 L;  2JEA I;  2N78 A;  4YHH Q;  4ME3 A;  2RF4 A;  4LF8 L;  4A3K G;  3TRZ A;  1SE8 A;  2ASB A;  3S16 H;  1Q81 C;  2NVQ H;  5IP9 G;  1WFQ A;  1X3G A;  2UXC Q;  4A3M G;  2F4V L;  3KOJ A;  1PH6 A;  3GDE A;  4A4I A;  5IYD H;  2WAQ E;  2Q2T A;  1IBM L;  3MXN B;  2HHH Q;  2JA5 G;  3PO2 H;  1VQD A;  2AWO A;  4A3F G;  3VDY A;  3CD6 A;  3E9I A;  4L5R C;  2K5N A;  1HR0 L;  3CCQ A;  2HT1 A;  3M4Q A;  1PH8 A;  2JA6 H;  4NB3 A;  3S1N H;  4DV5 L;  1U0L A;  5FJ8 H;  4LF9 L;  3NEM A;  2JA7 H;  1JJG A;  4XTC S;  1BBW A;  2DGY A;  4BY1 G;  3TQY A;  4A3I G;  1KD1 C;  5C0X G;  4NXM L;  5LMU L;  1NMG A;  2VQF Q;  1K8G A;  3GTG H;  4GOP A;  1N32 Q;  2OWO A;  2AWN A;  5IYD G;  1UEB A;  2WB1 G;  1MJE A;  3PO2 G;  2IX1 A;  3W1G A;  4OON A;  3CQZ H;  2R7Z G;  3ER0 A;  4BXX H;  4C2M H;  5FLX c;  1D8L A;  3HKZ G;  1X54 A;  1I6H H;  3PF4 A;  2KCT A;  2E2H H;  2ALY B;  2VL6 A;  3CF5 A;  4OWX B;  4LF6 L;  4DR4 Q;  5IYB H;  4BA1 I;  4B3S L;  4BBR G;  4DR3 Q;  4XIG S;  5LMN L;  4JI3 L;  1KXL A;  1EFW A;  1OXX K;  3S24 A;  1K3R A;  4AH6 A;  3KJP A;  1AE3 A;  1SFO H;  2ZJQ A;  2FXQ A;  2AKW B;  3I4N G;  4JG2 A;  2NN6 I;  3PUY A;  1K83 H;  2UXB Q;  4YY3 Q;  3S2D H;  4DR5 L;  3T1H L;  3S17 H;  2I5L X;  1NJI C;  4JV5 L;  1SMX A;  4B3R Q;  3A5Z B;  3AEV A;  3K7A H;  4K0K Q;  4UY8 C;  3CXC A;  2I5H A;  4JI2 Q;  4P73 A;  1SN8 A;  1U5K A;  3S2H H;  3NEL A;  3KFU A;  4A3J H;  3D31 A;  4IPH A;  1NTG A;  4LFA L;  1X9N A;  3IRB A;  3MEF A;  3TEH B;  4JI5 L;  1IZ6 A;  3HOZ H;  2XTI A;  1CKO A;  2PQA B;  1WYD A;  4YHH L;  1A63 A;  2Z0S A;  2F3I A;  4X66 Q;  5IWA Q;  3H15 A;  4ALP A;  1VQ7 A;  2R6G A;  4A3B H;  4JBW A;  4P71 A;  4L5T A;  3I4M H;  1NMF A;  2GN5 A;  4POG A;  1AE2 A;  4KHZ A;  4JI7 Q;  1A8V A;  4JOI C;  4LF7 Q;  2UXC L;  1HNZ Q;  3K80 C;  4GN4 B;  5J3B A;  1EYG A;  5M3M G;  4LWC A;  1VQB A;  3S1R H;  2HHH L;  4JI0 L;  3HOZ G;  1KC8 C;  4MTN A;  1XNR Q;  1T9H A;  4TVA B;  2D62 A;  4AYB E;  1PYS B;  1B7Y B;  4HJA A;  2BH8 A;  1MIU A;  3GTO H;  4A3D G;  4RMF A;  1WCM G;  1VQG A;  2JE6 I;  1FVI A;  3ICE A;  4IJL A;  4KHP L;  3EIV A;  1Y1V H;  1KIX A;  2PI2 A;  2VQF L;  1YHB A;  2R7F A;  2ZTC A;  2MO0 A;  4GN3 B;  2ZM6 Q;  1N32 L;  3OYY A;  3H3V H;  2A1A A;  1HNW Q;  4GNX B;  5ELN A;  1E1O A;  2OTL A;  3CW2 C;  2IY5 B;  1YJ9 A;  1X56 A;  2Q2H A;  1X65 A;  5IYC G;  2ZJR A;  3CC2 A;  4NXN L;  4X6A H;  3M9B A;  4MNO A;  1QZG A;  4OXP A;  1G51 A;  2Z6K C;  4DR4 L;  3K7U C;  4PMW A;  5K36 G;  4DR3 L;  1Y1V G;  3LGJ A;  2NVY H;  3PIO A;  3T1H Q;  4DNI A;  1UE5 A;  5ELO A;  1JE5 A;  4IPC A;  4R1J A;  3PIP A;  3Q8D A;  3E9H A;  4BBS H;  1M90 C;  1IYJ B;  1GO3 E;  4JI1 Q;  2UXB L;  1OXS C;  4YY3 L;  4IJH A;  1QUQ A;  1XPO A;  2OQK A;  5JJL A;  4Y52 H;  4A3M H;  3PGZ A;  4LNQ A;  1LUZ A;  4B3R L;  1PVO A;  1CKN B;  2I5M X;  4LFC Q;  4K0K L;  2D0O A;  1Q8K A;  1AH9 A;  4PZ6 A;  3BJU A;  1JB7 A;  4GLA C;  3K0X A;  4GS3 A;  1PH9 A;  1VQ5 A;  2YU9 H;  5C4X H;  4JYA L;  2KBN A;  4BBS G;  2CCZ A;  4YWM A;  5IP7 G;  4OWW B;  4A3I H;  1YIT A;  1YZ6 A;  4BY1 H;  4POF A;  4IOC A;  3GD7 A;  1JMC A;  3K81 C;  1TWH H;  2MFI A;  4X66 L;  2JK8 A;  5IWA L;  3U50 C;  3UDI A;  2NZH A;  3GTJ H;  2VY3 A;  1PYB A;  2RHQ B;  1FL0 A;  2JEB I;  4DV7 Q;  4JI0 Q;  4JI7 L;  3PUW A;  1KL9 A;  1Q86 C;  4C3I H;  3CCS A;  5C44 H;  2WB1 E;  4LF7 L;  2R7Z H;  4P74 A;  3GTM H;  1HNZ L;  2WP8 J;  3TS2 A;  1I50 H;  2CWA A;  1FJG Q;  1E22 A;  3H0G H;  5C4X G;  2HIX A;  3F2B A;  1UWV A;  1RL2 A;  4A75 A;  2MNA A;  5C0X I;  2K5V A;  3HKZ E;  1NY4 A;  1VQL A;  1HJP A;  2EQS A;  3DM3 A;  4BBR H;  1XNR L;  4B3M Q;  2EIF A;  1VQC A;  3L0O A;  1E1T A;  4DUZ Q;  3J7Z C;  4TQU S;  4YWK A;  4DKA C;  2YTY A;  5M5Y H;  3I4N H;  1TWC H;  5C3E H;  3KF6 A;  5C44 G;  2JA8 G;  2VS1 A;  4UP8 A;  2ZM6 L;  2I0Q A;  4NXN Q;  1HNW L;  3A0J A;  2HIV A;  3H0G G;  1N34 Q;  1X3F A;  1Z47 A;  1GM5 A;  5GQO A;  4QGU A;  1JT8 A;  3CCJ A;  3W1B A;  3PF5 A;  1XPU A;  1L2F A;  4HID A;  2NVX H;  1TXY A;  4HJ8 A;  1LTL A;  3GTP H;  1V1Q A;  1E3P A;  3L7Z C;  4HIK A;  4JCV E;  4DK3 C;  3CMA A;  4A93 H;  4GLV B;  2VUM H;  1D7Q A;  2LXJ A;  1I94 L;  2YV5 A;  2ATW A;  4A76 A;  4OO1 I;  4AQY Q;  5C3E G;  3KF8 B;  4X65 Q;  1XJV A;  2N8N A;  2BH2 A;  3BU2 A;  4Y7N H;  2R92 G;  1YBY A;  2C35 B;  1YIJ A;  1Q7Y C;  1W2B A;  1O7I A;  2ES2 A;  5EAY A;  1EQQ A;  1P8L A;  2JA9 A;  4JI4 L;  2R7D A;  4JI1 L;  1PFS A;  1GKH A;  4LUV A;  3U58 A;  1M1K C;  1IBK Q;  4A93 G;  2K4K A;  1XTD A;  1A0I A;  3I2Z A;  4DV4 Q;  2VUM G;  5M3M H;  2QGQ A;  1HNX Q;  2V1C C;  1XMQ Q;  1L1O B;  3HOY H;  4JYA Q;  2YTV A;  4LFC L;  1L1O C;  3RLO A;  2VQE Q;  1PH5 A;  1N36 Q;  3G71 A;  1Q82 C;  2VW9 A;  1VQ8 A;  1YEZ A;  3UDG A;  1H95 A;  4QQB X;  1EWI A;  3STB D;  3KDF A;  4B3T Q;  1NE3 A;  3RR5 A;  1QZH A;  1C9O A;  1B8A A;  2H5X A;  2ID0 A;  2Y0S G;  3ERS X;  3AFQ A;  1WCM H;  4LW1 A;  4PG3 A;  2VZA A;  3CC4 A;  1EIF A;  1CSP A;  3A5U A;  4MZ9 A;  3M85 A;  4EX5 A;  3B6Y A;  4JBJ A;  1X6O A;  1N8R C;  3HOY G;  1G6P A;  4QIW E;  1FJG L;  2AHO B;  4DV7 L;  2ZJP A;  4KLK A;  1PH7 A;  5IYC H;  2PI2 E;  5GAG C;  5AJ3 Q;  3I56 A;  4A3E H;  2E5L Q;  4HIO A;  2L15 A;  2MO1 A;  4H02 A;  3F2C A;  1MJC A;  1S40 A;  1PH4 A;  4IFD J;  3KLW A;  2JJQ A;  1EQR A;  4GOP B;  2PNH A;  4GOP C;  3HOW G;  4WJ3 M;  4IPD A;  4B3M L;  3CCE A;  4HJ9 A;  4IOA A;  1IL2 A;  2NVT H;  1SR3 A;  3GTL H;  4OX9 Q;  1VQN A;  5IT9 c;  2IX0 A;  4O2D A;  4DUZ L;  1EIY B;  1VQ6 A;  2UXD L;  3A74 A;  5GAD C;  4DV0 Q;  4DR1 Q;  4DUY L;  4A3L G;  3FKI H;  3NEN A;  1PH3 A;  4A3E G;  4PZ7 A;  1UE1 A;  5JEA G;  3CME A;  1N34 L;  3G48 A;  4FDB A;  1K73 C;  1MKH A;  2K50 A;  3AQQ A;  3ZJY C;  2LXK A;  1I94 Q;  3J80 i;  1ASY A;  1SRO A;  5BR8 Q;  4X64 Q;  5M3F G;  1VQM A;  1QVF A;  4DV6 L;  3H3V I;  3RLF A;  1PA6 A;  4DR7 Q;  1E7Z A;  4HIM A;  3JAM c;  2XGT A;  3PUV A;  3J81 i;  3HOV G;  1K0R A;  2ZTE A;  3E0E A;  3JAM i;  1XMO L;  1CKM A;  2B63 H;  4P75 A;  4APV A;  5IP7 H;  4X65 L;  4AQY L;  3RN5 A;  4DAM A;  4JI4 Q;  3NBH B;  2YYZ A;  2F52 A;  3M4O H;  4IFD G;  3FKI G;  3ULJ A;  3PO3 H;  1VQ9 A;  2LSS A;  2BA0 A;  3M3Y H;  2IHF A;  3TS0 A;  2GVA A;  4YCU A;  2BA1 A;  1XPR A;  1N9W A;  4DV1 Q;  4JI6 Q;  4BA2 I;  5GAH C;  2CFM A;  3S14 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...