1KAAA

Stress and strain in staphylococcal nuclease
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYAPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Stress and strain in staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 40
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1992-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kaaA00
5IIFA 2EYOA 5E1FA 4EVOA 4YIJA 2RBMA 1F2ZA 5CV7A 3SK6A 4R8NA 4DGZA 1STAA 1EZ6A 2EXZA 4NKLA 1SNQA 2ENBA 2F0QA 4K5VA 4KD3A 5C4ZA 1JORA 4DF7A 5J1ZA 1STYA 3TP5A 2F3VA 2F0MA 4K5XA 3NHHA 2F0DA 2RDFA 1A2TA 5ISRA 3HZXA 5KYIA 4KJOA 3SXHA 1KDCA 4KJNA 4EQNA 5KGUA 4RKLA 2O4XA 2RKSA 1EY6A 4F7XA 4PMCA 4N9PA 3OSOA 4MIUA 5C5MA 1RKNA 5M9OA 5I9PA 3MZ5A 3BDLA 5JAVA 4IALA 4IUNA 3SK4A 1SYEA 2F0UA 4K2KA 4WORA 5NUCA 2PYKA 2EYJA 3NXWA 3QB3A 4WRDA 3MVVA 5CV8A 2F0TA 5EGTA 4KY6A 5JOBA 2PW7A 4NDXA 4RKBA 4ODGA 4DU9A 1U9RA 2F0SA 2F0HA 1EYDA 4LAAA 5DAUA 1ENAA 3TP8A 4EQPA 1EY4A 3TMEA 1SYFA 5CR3A 1NUCA 3QOLA 1SNDA 3OMCA 2PZWA 1NSNS 3OWFA 2EYPA 3D4DA 4ZUJA 1STNA 2F0OA 5IOCA 5J39A 3VA5A 3S9WA 2EYFA 4KY7A 3EVQA 3H6MA 4S3SA 5IGDA 2EYLA 4I65A 2PZTA 4KTAA 5EKKA 5I6YA 2OEOA 2SNMA 4ME5A 5E3FA 3D8GA 3SR1A 2F0WA 4DFAA 1TQOA 1SYBA 2M00A 5CGKA 5I9OA 5KYLA 4G57A 1SNMA 2EY2A 4TRDA 3LX0A 5C5LA 3RUZA 2F0LA 2PZUA 1SYDA 4QB4A 5CV6A 4HMIA 1A3UA 1A3TA 1A2UA 5DEHA 3SHLA 1SNCA 1STBA 1TR5A 4H7BA 5IGEA 2F0JA 2WACA 5IGGA 5KIXA 2F0VA 3C1EA 1EY8A 2F0FA 3T13A 3ITPA 3DHQA 3NK9A 4EQOA 1KAAA 4B9WA 2KQ3A 1EYAA 4K8IA 4NMZA 4E6IA 1STGA 5CC4A 4N9TA 1KDAA 2EY5A 4NP5A 1SYCA 4J6HA 4KV6A 5IGBA 2NUCA 3EJIA 4F8MA 2EY1A 3TP7A 1STHA 3P1HA 3NUCA 2EYMA 2LKVA 2SOBA 5CV5A 3U9OA 1SNOA 1AEXA 3QOJA 4QMGA 1F2YA 5I6WA 4QF4A 2SNSA 5EKLA 2PQEA 3HEJA 4K8JA 4B9XA 5C3XA 1JOOA 1SNPA 1SYGA 2HQEA 4ZUIA 5HGTA 2F3WA 5IODA 3R3OA 4K2LA 1EYCA 5K5PA 3E5SA 1ENCA 1JOKA 4PNYA 3C1FA 2QDBA 3D4WA 5KRUA 4PMBA 1A3VA 4KD4A 4KHVA 3SK5A 1KDBA 1EZ8A 5J22A 5KEEA 5C3WA 1EQVA 3OMGA 5HURA 3T16A 4ID6A 4HTHA 5CV4A 1II3A 1F2MA 3SK8A 1EY0A 4J1MA 1KABA 1TT2A 4IZ8A 2KHSA 3MXPA 4KY5A 5C4HA 2F0KA 1EY9A 5CV9A 1EY7A 5F2DA 4K14A 3EROA 3D6CA 2F0GA 1IHZA 4HMJA 4ZQ3A 2OF1A 2PW5A 2F0NA 4K6DA 3P75A 4OL7A 2F0PA 2OXPA 2F0IA 3V2TA 5C6AA 5IGCA 2F0EA 3MEHA 4K5WA 3TP6A 5IGFA 3PMFA 3NP8A 1JOQA 2EY6A 3BDCA 3DMUA 3NQTA 1EY5A 2EYHA 3MHBA 3ERQA
chains in the Genus database with same CATH superfamily
3PIPA 4DV2Q 4YIJA 3M4OB 2YU9B 1PZJD 3PSIA 1LTID 1XTDA 4DR4L 3KJPA 2EJGC 4OO1I 1XNRL 3HOUB 2EDGA 2K5NA 3FVQA 3VYTA 5M5WB 5C0XH 2KBNA 1B70B 3J81c 1UE5A 5JOBA 3K6OA 2UUCQ 2ZM6L 3BVMA 2G5DA 1EYDA 3S17B 4HJAA 1SYFA 4JI7Q 3J7YW 4A3CG 3W3AA 2AQ1B 2NB0A 1DYQA 2XVSA 1CKNA 2O5JC 4BBRG 3S9WA 4KY7A 4PV1C 3U9SA 1XWEA 4G7ZC 1MJEA 3KJOA 1LTAD 1SE8A 3KBGA 1I5FA 3K8AA 2A8VA 4PMWA 2B2WC 1H9MA 2F0LA 2KEDA 2PMZB 1AE2A 1ASYA 3K81C 4X62Q 4UPAA 4HN7A 1HXYD 3CCEA 1QVCA 2X6GA 2JA7G 1BBXC 1EYGA 4JBJA 4UP9A 4B9WA 1Y14B 4K8IA 2E75C 1KDAA 2R6GA 5JJLA 2HCCA 3STBD 1I94L 4JI3L 2LKVA 4NW2A 5IP9H 5C3EB 2AHOB 3GTGB 2D0OA 4A3JG 2WKDA 1HQRD 2VW9A 4B3SQ 4QJFA 4IQZA 4AYBB 2B29A 1P8LA 3F2BA 1N36Q 3PO2G 4OO1H 1E3PA 2MJ8A 5DM73 4K0KQ 5M3FG 5C3WA 2CWPA 1XMQL 1JC7A 4G7HC 3KFUA 5C4XH 4JI5L 1L1OA 3GTQB 5CYUA 2CQOA 3S2HB 3EROA 3D6CA 2F0GA 4KMUC 1R9TH 5M3MG 3V2TA 1K3RA 1VQHA 1Q81C 1QCBD 4DNIA 1BR9A 1FJGL 4M1UB 2VUMH 3IKJA 5CV7A 4ABNA 2Q8RE 1Q12A 1I4HA 1OXUA 1T5EA 4AIMA 4HJ8A 4BXXH 1JORA 2JA6H 3CC2A 1VQAA 2RVLA 3D4RA 2K28A 4CHTB 1X6OA 1AW7A 3CQZH 3HZXA 5FK9C 1VMCA 4DK1A 1E1OA 2B39A 4RKLA 4AH6A 4F7XA 3IFDA 3C46A 3I90A 2A73B 1B3QA 3FDTA 2K50A 5IE8A 3KYHC 5NUCA 4BBSH 1XMOL 2EYJA 3QB3A 3MVVA 4P73A 5M5XH 1BBWA 4ODGA 4QQBX 3HOYH 1X55A 4C3IG 3ULJA 3TMEA 3O13A 1F9QA 4A3EG 1EIGA 2LFNA 2K5VA 2ICIA 2XSCA 5JVH3 2VY3A 4WJ3M 2B8FA 1VMPA 2PNRC 3GO5A 3D8GA 2ALYB 1OXXK 3GDEA 3T53B 3J81E 1VQLA 3Q0AA 1PYBA 2XRSD 1DCZA 1EOTA 1WTOA 5IYDH 2KCCA 4LF4L 4IUQA 3ZJYC 3SEBA 5IGEA 3KLRA 1Q8KA 4ZKBB 2ATWA 3C1EA 3HRZC 3T13A 1RD9D 2L0CA 4RGMA 3F8TA 1GUSA 3HOWB 4IPCA 5KNDA 4J6HA 5EBDA 3OTOL 1VDZA 1JMCA 3U4ZA 4B3TL 2B2TC 2YTXA 2FMMA 3C2PA 3GTKH 4ZAIA 1S5BD 3HFZB 3LGJA 2MQHA 4FF4A 1JJ2A 2SNSA 3DWPA 3R3OA 4YCVA 1RTNA 4HSVA 5KRUA 5L37A 4HCEA 1BOSA 2ZXPA 1TWGB 1I3QH 1SRUA 1JWUD 1M90C 2RF4A 1Q86C 4FXDA 4IZ8A 2RHQB 1G2TA 4DXFA 4I7ZC 4X64L 2N78A 3S2DH 1JE4A 4B08A 2R92B 2K7VA 4NXNQ 3HS0C 1Y8NB 3NEMA 1QUQB 3KK7A 1FGUA 5E1FA 1Q1BA 4CJ0B 5GADC 1LLRD 1V1PA 1VQBA 2I5LX 3GD7A 3HOUG 4TVAB 2F0DA 4CDDC 1KDCA 3HKZE 2JN4A 4OHJA 4A93B 1BCPD 3OSOA 5C5MA 4DV3L 5M9OA 5D3IB 3BDLA 2TMPA 1PRTD 3KLSA 1RTOA 4B3RL 4BBRH 2PW7A 3OW7A 1PMRA 3NBHA 5E4WC 5ELCA 3OOCA 5JEAJ 3D6WA 1IYJB 4DV5L 2K4KA 4QUFA 4B3MQ 2Z4IA 2CH4A 2A69D 4YCUA 1VCIA 3OHXC 5J39A 1TKWB 3CAMA 3BYYB 2GN5A 4H02A 2WB1B 4AQYL 4A3IG 2XN9C 2ZTEA 5C44H 4BY7B 2F0WA 1SYBA 4ZRZA 3RZOB 1L0WA 1HNXQ 2E8GA 1X54A 2PZUA 2OQKA 2HHHL 3AQQA 4GKJL 2K5QA 4A3GB 1BNZA 3ULLA 2CKZB 1N33L 4EQOA 4P2CB 3URYA 3HKZB 4JI0L 3R2TA 4A3JH 3S1MB 3ZYYX 2P5ZX 4DAVA 1Q46A 4LFBL 4CKBA 2Q8IB 1GVPA 4LUOA 1Y1WB 5T1IA 3U9OA 3PUZA 2UXDQ 1AEXA 5M3FH 4JI8Q 1AZPA 3K59A 1B9NA 2XRQD 1WJJA 4OIJA 4ZUIA 1NR4A 1YIJA 5IY0A 3C1FA 2QDBA 4HJ5A 2Z1CA 2ASBA 1MBYA 5M3MH 2WIIB 2TSSA 4OX9L 5CV4A 1H9SB 2A1AA 5BN4A 1II3A 3SK8A 4LFCQ 2ZTCA 4HR7B 4GN5A 1TT2A 1YNND 3K7AB 3DM1A 4LF6L 4FO2A 4APVA 3UE1A 1BXTA 4GS3A 1GOZA 4K6DA 3I4MB 1K8AC 3P75A 2ES2A 2ZTDA 1AN8A 3HOZH 4TQUS 2EY6A 2B63B 1U4PA 3L9AX 3PQIA 1TWHB 3HOXG 1C4QA 4DGZA 4JI7L 3RZDH 1RIPA 3M7GA 4K5VA 3ULPA 1NAPA 4DF7A 2UXCQ 1STYA 1PH7A 4LF7L 1CZGA 4DR1Q 3HOVB 1T9HA 4H13C 3JAML 2FINB 3ONAB 3SXHA 5LL6X 1P16A 1WOCA 1PH3A 3IRBA 4C3IH 4GLAC 2NWGA 3I4NB 2GVAA 3DEPA 1VF5C 4GLXA 1CQFA 3I70A 3JAMi 4A3EH 3NXWA 5LHY1 1CM9A 4RWSC 3GTPH 1DZ1A 1G51A 2IX1A 4FXGC 1U9RA 5IT9L 1N32L 1EY4A 4RH6A 1CA6A 1B4OA 3OWFA 1ESRA 1LT6D 4GOPA 3BJUA 1K9MC 4DV7Q 3RN5A 4IPHA 2B2YC 1JCKB 3H94A 1SLJA 1X65A 1SDFA 3K5LA 4PZ7A 2E2IH 3A74A 4BY1G 2WFWA 1O7IA 1A3TA 5I2YA 4DR2Q 3AU7A 1U0LA 3SHLA 4CBVA 1CKMA 3ERSX 1S5CD 4A3DH 1S5ED 3HGBA 2WACA 1PTOF 4CJ1B 1F77A 1SROA 4JV5Q 4RGTA 3R93A 4HJ7A 2KEEA 4LF9Q 5C0XG 4PG3A 4M8AA 1EU4A 4KV6A 2CW0C 1JR0D 1HZ9A 3T1YL 1ILPA 3V05A 4FYDA 3S1QH 1H9KA 2D5DA 2K32A 4NPSA 1F2YA 5BR8Q 3VR4A 2PQAA 2A74C 2ZJRA 3MXUA 4QL5A 3I2ZA 3PF4A 2L11A 3SK5A 5E7NA 1EZ8A 1LTLA 2E2JB 1PH9A 3KF8B 3FP9A 2A6HD 3PGZA 2NVQB 1PLFA 4X66L 4RG1A 1O7YA 2YU9H 1WFQA 1I4RA 2B2WA 2B8GA 1VQOA 5JJZA 1QZHA 2B2UC 4C3JG 1DGSA 1EY7A 4XQQA 4CJ2C 4C1NK 2OWOA 1S72A 4DR5Q 1PVOA 2F0IA 3K7UC 1ENFA 3HOUH 1IBKL 3NQTA 3ERQA 3M7NA 2IW3A 1VQPA 1GUOA 1STEA 5M5WH 4A76A 1VQKA 1GM5A 2XWJB 4R4IA 2UUBQ 3FHWA 5J1ZA 1EU3A 4K5XA 5IP7G 1I50H 3S17H 4OGQC 3BS1A 4KKUA 2L5TA 3I4OA 5KGUA 3VR2A 5LMUQ 2VB3X 1KXLA 1QJOA 4PMCA 3MZ5A 2RCFA 4CGYB 3S16B 4KLKA 4IFDG 2HT1A 4CKEA 3MEFA 3QWNA 4KY6A 1VQGA 4JBMA 4NDXA 4GNXB 4A3IH 4EQPA 1EOVA 1CUKA 1FL0A 1HA5A 2A6ED 3BZDB 3WDNA 2MO0A 3PO3B 2MGSA 2MNAA 4JYAQ 1F9RA 1OXVA 4MTNA 2X6LA 3PIP3 4X3UA 1UE7A 4IPGA 1TY2A 1DJRD 1HUNA 2J7ZA 4MZ9A 3PIOA 2F4VL 4A3GG 3CCUA 1RCVD 1SNCA 1TR5A 2JA5G 3HKZG 5A2QE 3GTGH 1B9MA 5JJIA 1KAAA 1W3SA 2HDMA 1STGA 1Y1WG 1WTHA 4C1NI 4KN4C 5LMNQ 3VYUA 5FLXL 4A3KG 4Y52H 3PV0A 3A56A 1W6KA 1FD7D 1FNWA 1LT3D 1J5EL 2CWAA 2CH4W 5ELDA 2K14A 1XNQQ 3GTQH 5AJ3Q 4GNXC 3S2HH 3K80C 1SNPA 4ZCKA 2WP8J 4K2LA 1EYCA 3LWUA 3E5SA 5IWAQ 4XXEA 1PA6A 5C0XI 1UNSA 3PCOB 3QIAA 5KEEA 4OEMB 1YJ9A 3VR6A 1F9SA 1B53A 1IBLL 1YNXA 2K5WA 4KHZA 3TDQA 3I4MG 3P7JA 3HOXH 4MN3A 3NTHA 1YITA 2FXQA 2B63G 4A3MB 2OXPA 2R7ZB 2R93G 1IYVA 3R2IA 1JT8A 2DNEA 4X3TA 2RHSB 1O80A 4F88A 1HZAA 3T1HQ 2EYHA 5DNFA 2PNHA 4QIWB 1EIFA 1EZ6A 2UU9Q 1T5XD 4EGVA 2G9HD 2K1BA 3EFXD 2B2TA 4DN4M 4LK1C 3I4NG 4A3LG 2R3ZA 4G4KA 1PYSB 3MC0B 3CCSA 1KRSA 3FMCA 1Y1VB 3QR8A 1XPRA 1X3QA 3CMEA 1WTQA 4ZK9B 4WORA 4K2KA 1VQEA 1JQYD 1JWSD 2B2VC 1N34Q 1KRTA 1NTGA 2AQ2B 1KNAA 1NUCA 2E5LQ 4H0LC 2Q2TA 3G71A 3G48A 2PMZE 1JJCB 2MHVA 3A5ZB 3FEWX 1IKLA 4BY1H 2EYFA 1QNUA 2LSSA 5GAEC 4L5SA 2O5IC 5CBAE 3QG1A 2HIVA 2K52A 4OONA 1HR0Q 2YTVA 1E0BA 1VQJA 3EA6A 2QILA 3MFYA 4ILWA 4IFDI 2M00A 4ULLA 4DAYB 2IX0A 1JB7A 2KCNA 3S1NB 1EL0A 3GTJB 2H4OA 1SFOB 3Q23A 1PXUA 3CRKC 2VQFQ 4C2MB 1LACA 1FVIA 1X3FA 2QKIC 3DHQA 1BUVT 4OWTB 3UE0A 1GUGA 1XPUA 1XPOA 2JA8B 1B7YB 4AYBE 3ICEA 4CKCA 2Q2UA 1G6PA 1TWGH 3FKIG 2KUMA 4X65L 1EEFD 1OXTA 2PQEA 1SYGA 4NB3A 2F3WA 3W1BA 2RSOA 1FYCA 5C44G 2AUKA 1HTLD 4C3JH 2E2HB 5J22A 4JVZA 1WTVA 4UP8A 3J7AV 4A3BB 1OO9B 1ET6A 2GVBA 4KY5A 2KHSA 3NENA 1XYIA 1V9PA 4LFAL 4ZQ3A 2OF1A 3MA2B 1QUQA 1D5XC 5C4JH 3F1ZA 5G3LD 2J0TD 4DR7Q 5IP7H 1PH6A 1EY6A 1EY5A 5LL6S 5IIFA 2NVXB 4JC0A 4EX5A 4UAIA 3CCJA 2BDOA 2AUJD 3WWVA 1VQ6A 1X3EA 1B44D 3NHHA 4IFDH 4JBWA 5GAGC 3J81L 5JPMC 3GTOH 1FNUA 4MIUA 2FFKB 1ML0D 1GUWA 1PYWD 4JI6L 3J81i 4R4TA 2ZXRA 3H0GG 1SE2A 3PUXA 1WCMG 4BY7H 2Q2HA 1HNZQ 3RZOH 2QDLA 4DV1L 4DUZQ 4L63B 1M8AA 3OMCA 2WINB 4LNQA 5BN5A 4KN7C 4A3GH 4HEDA 3AFQA 3K0XA 3HOZG 4A75A 2JA5H 2UXBL 1RJTA 1KD1C 3L2PA 5I9OA 1C9OA 1SMYC 1VQ4A 1EWHA 1D2BA 2V4DA 2NBFA 1IBMQ 1AH9A 2BOSA 3A8JE 1RF2D 4U68A 1ICFB 3UDGA 1Y1WH 4Z9CB 3KLWA 3NTIA 1ZYRD 2BDNA 2F3IA 3ITPA 1K0RA 4A3KH 3UDIA 1S4ZA 4JCVE 2YTYA 2LY7A 4IN3A 2CHBD 2EY5A 5C0XJ 4LUZA 1CHPD 1NMGA 2NZHA 1LM0A 3X3MA 1G8ZD 1X9NA 1FR3A 1TWCB 1IW7C 2K03A 3M4YA 4XIGS 1C8CA 1STHA 4YHHL 1HA6A 4RHSA 4FVMA 4HAEA 3QOJA 2ZJQA 3RNUA 2B3GA 1IXRA 2F1MA 4L5TA 4B9XA 3IFTA 1VQ5A 3A7LA 3I4MH 1XXGA 1H9SA 4G7OC 4PNYA 2Z9HA 3TZDA 4KD4A 2B2YA 1V8QA 3KDFB 3OMGA 2B63H 2UUBL 2R93H 3S14H 2QW7A 2DY7A 4HTHA 1F2MA 4A3DG 2Q8TA 1EY9A 5CBEE 3E3XA 4DV4L 1VQ8A 3B6YA 1YHAA 3J7ZC 4JI2Q 1G91A 2MO1A 2K04A 4PZ6A 3I4NH 4A3LH 4QF4A 4R9WA 4C3HB 2RBMA 4WJ4A 1SBBB 1NJIC 4HIKA 2OTJA 2N88A 1KL9A 3I73A 1SR3A 4F87A 1HNWQ 3CMAA 2NVTH 4XDXA 1SJHD 3W1GA 5ELOA 2DUDA 1D7QA 2NZOA 3CF5A 1KIXA 1EWCA 1RKNA 4IALA 1K8MA 3D31A 3NBIA 2WB1E 3EN2A 4X3KA 1ENAA 3G6JB 2OCEA 3V96A 3A5UA 2EIFA 2BE5D 1K73C 2B2UA 1SSOA 5FO7B 1EFWA 1LT4D 2KA7A 4DV6Q 2PZTA 1VQCA 2BA1A 3E6ZX 2OT2A 4DR6L 3TREA 1EQQA 5KYLA 1TWAH 3RLFA 2EPBA 4POFA 4JOIC 3NWTA 3GTLB 1A2UA 4JI1L 2VQEL 1PFBA 1YVCA 4LF5Q 1Y69U 2WKCA 1EY8A 3HP3A 2GA4B 1QZGA 3M3YH 2ZXOA 1EYAA 3F2UA 1HFNA 3FKIH 1WD0A 2PPBC 1PRTB 4P71A 4U673 4DPGA 5CORA 2NVQH 5M5YH 5JVG3 3D3RA 1I4XA 1UUPA 3H3VC 5IOCA 4I7AA 1S5FD 5HGTA 3KF8A 4L5QA 3NPPA 5C4XB 3A0JA 3M85A 4R4OA 3S24A 4L6TB 1TWFH 4IJHA 1PTOB 2ID0A 3SGIA 4DUYQ 1YNJC 1EY0A 4J1MA 2MUYA 5C3EG 3EIVA 3U4VA 1CQVA 1HH2P 3AFPA 4KKTA 2Z6BA 1IHZA 4TSSA 4CDCC 2VUMB 1LTSD 2JXMB 4AYBG 4K5WA 3SVMA 2JA6B 1EIYB 3BVZA 3S16H 4R4QA 3GTMB 1JB3A 3CCMA 4DR4Q 2CCZA 4DV2L 1XNRQ 2F3VA 1CHQD 1EFID 3H0GH 1WCMH 4BBSB 4OWXB 2DNCA 1PH2A 2O4XA 3PO3H 4GNXA 3HOYB 5E4XA 2WAQB 4GZYC 3SK4A 3VDYA 2PYKA 2A69C 2ZM6Q 2A68D 3I4LA 4ALPA 1MSHA 4RMFA 2KHJA 2UUCL 3QOLA 1HJPA 3CCLA 1PTOC 4QY7A 2JK8A 3K57A 4S3SA 2VXWA 2EYLA 4QUCA 1WTWA 1R4QB 2ZT9C 5I6YA 5E3FA 2SNMA 4ME5A 1TVXA 2CQAA 3RLNA 5K36G 2EY2A 3K58A 2CW0D 1I4GA 4QB4A 4HMIA 5D3DA 4KK7A 2M2LA 3H09A 1BCPF 3OWEB 4X62L 1Y8PB 1B1ZA 3BG3A 3OIPA 3GTKB 1EQRA 1PRTF 1KC8C 3E0EA 1I94Q 4JI3Q 1HUMA 4N8FA 1Q8IA 1E2VA 4GLVB 2SOBA 2B2VA 2RCNA 1ZEQX 3QO2A 4K8JA 4DR7L 2OQ0A 1I3QB 4Q0FA 4B3SL 3H91A 4A3MH 2R7ZH 3D4WA 3HOWG 1YNNC 2E74C 1N36L 1LTBD 3PIO3 1XMQQ 4JBKA 1YHQA 1A8VA 4K0KL 3I91A 4JI5Q 2QEJC 1K83B 3E9HA 3GV6A 3TZUA 1K0SA 4K14A 1Z7TA 4RAUC 5AFWA 1A0IA 1H9RA 1FJGQ 2J4XA 4RCNA 5EPKA 5IYBG 2Z6KC 1AP0A 1KQSA 1KAWA 1SNQA 2ENBA 1OTCA 4C56C 1X3GA 4HCSA 1A2TA 1NBWA 1S40A 3TS2A 3M4OH 1AE3A 2NN6H 4BBRB 3T56B 5D65A 1RDPD 2N3SA 1X56A 4KI0A 1M1KC 2HUGA 1K8OA 1QVGA 4IUUA 3VR3A 1XMOQ 2R92G 3L7ZC 5FKAC 1VQFA 5CV8A 4HIMA 5DAUA 2K6AA 3TP8A 1KHIA 1SFOH 4L5RC 2EJFC 3D4DA 1TU2B 2JA7B 4C2MH 4DAYA 1UE1A 2M9VA 4PZ8A 2QGQA 3KF6B 4A93G 2JEAI 1G6ZA 4X6AH 1WTRA 4GKKQ 1RHPA 1TQOA 3Q8DA 5LMNW 3OPOA 5C5LA 1M4VA 1SN8A 1I4PA 2RA4A 3KUPA 1HZCA 5HGQA 4A3JB 2VL6A 4OELB 5KIXA 2F0VA 3S1RB 3G7LA 1U4LA 4YWKA 4OWWB 4XTCS 3I8ZA 1B8AA 3PO2B 2WB1G 3CXCA 1H95A 3VYRA 2PO4A 5M3FB 4BY7G 3OTOQ 1BF4A 2NUCA 4UY8C 1J6QA 4YY3Q 4B3TQ 1NR2A 2JYOA 5I4DA 4A3BH 3MXNB 1GUTA 1MIUA 2MFIA 2EVBA 3HEJA 2A6HC 5IODA 2L4NA 4LUVA 3J80c 3R8BA 5C3EH 1XJVA 1JOKA 2FJ2A 3I56A 1ONLA 1EQVA 4DV0Q 2HIXA 3F2DA 4ID6A 1Q82C 1NY4A 1Q3LA 1VS0A 5IYCG 4QIWE 4X64Q 1C0AA 3MXPA 2F0KA 1XTCD 1WTXA 3SR1A 1PH8A 1Y8OB 2F0NA 1C7YA 2QF7A 3TP6A 3RZDB 2R7DA 1D8LA 5JEAG 3DMUA 2KCMA 3MHBA 1QNKA 5ELBA 1F2ZA 4R8NA 1O7ZA 4NXNL 2IY5B 2EXZA 5C4ZA 1W2BA 2BH2A 4J15A 1N9WA 1LABA 3TP5A 2C35B 3CKIB 3UDXA 5KYIA 4A3EB 1HFGA 2EQSA 1HTPA 1SE4A 4DV3Q 4N9PA 2AWNA 1HR0W 2A6EC 4QGUA 1TIID 4B3RQ 4IUNA 4NXMQ 2L9HA 2F4IA 1MI2A 1Z9FA 1A62A 2AQ3B 3TSSA 1JWMD 1YHBA 4RKBA 4DV5Q 4LF5L 4LAAA 2EJMA 3CC4A 1SJED 1H9JA 1HCZA 2KJXA 4HIDA 1RODA 3HOVG 4XT3B 2I5HA 1STNA 5K36H 2K05A 2E76C 4B3ML 1CI3M 4AQYQ 2E2IB 5T1GA 3WOEA 5IGDA 4ZKCB 1J9OA 1QWYA 1DONA 1GHKA 3VR5A 1KLUD 2HHHQ 4GKJQ 1O7LA 1SYDA 4DK3C 1HNXL 1R4PB 1TY0A 3EBEA 1STBA 5FO8B 1N33Q 2F0JA 4BA1I 1PZID 5EPJA 2EXDA 4JI0Q 1FGBD 3DLLA 3EQLC 4NMZA 2HQLA 4LFBQ 4NP5A 3MWYW 3IAYA 1YJWA 5FOBB 1HZBA 3HOWH 1PHJA 2DGYA 4POGA 1AFPA 2UXDL 3E9IA 2JEBI 1GUNA 4JI8L 1JOOA 3KDFA 3VYSA 4LF8Q 2E2DC 4XYQA 2DN8A 5DM63 4OX9Q 1I6HB 4DAMA 1BDOA 2ICEC 3T16A 3A55A 4C3HH 4LF6Q 1KABA 1YI2A 4LFCL 5IYBH 4JOIA 2F52A 1Q7YC 1CFMA 1HHVA 3J80E 2C9OA 3RN2A 3SE0A 2LMCB 2EZVA 5A35A 1TS5A 4H44C 1JOQA 1S5DD 1I50B 4RGOS 2EYOA 3J7A5 2RDHA 4NKLA 1V1QA 2F0QA 4LF7Q 4IOAA 5EKIA 1PZKD 3H3VH 1FNVA 3ND9A 2R92H 1VQIA 2K75A 2UXCL 1OXSC 1YEZA 4KJOA 4DR1L 3S15B 1IYUA 1E22A 4A3IB 2CFMA 4MTKA 2F0UA 4Y7NB 2XWBB 4P72A 1N32Q 4A93H 2F0SA 1SMYD 2NVYB 1ET9A 1VF7A 3GTLH 2KENA 2PZWA 4HJ9A 3LNNA 2RQXA 4A3FB 1NNXA 3G4SA 2LS01 3NELA 3I3CA 4DV7L 4KHPQ 5DLQE 4O2DA 1D5ZC 4DFAA 3CP0A 5H1SE 2Q2IA 1PFMA 4G57A 1SNMA 1DD2A 4LWCA 1IW7D 3Q24A 4DR2L 3PF5A 1UAPA 1BO0A 2F0FA 3PO3G 3NK9A 1V43A 1PH5A 2I46A 2K33A 4JV5L 2QCPX 4N9TA 1SYCA 3T1YQ 4LF9L 4DNTB 4RCOA 1ESFA 3J81j 2L15A 4R1JA 4WFN3 2EY1A 2RDGA 1PTOH 3P1HA 1QILA 3S1MH 1EEID 1SNOA 1PFNA 3CW2C 2D2CC 4YWLA 4LJZC 1ILQA 2H5XA 5BR8L 3AB9A 5IYCH 1PFSA 5FJ8H 2QA4A 4KHVA 1MD2D 3STBC 2Y0SE 3HOXB 4X66Q 3NQIA 2BA0A 3PUYA 3GTMH 1IZ6A 1N8RC 5JEAH 5EBCA 4HMJA 5IGCA 4OL7A 3KLSX 5C6AA 2F0PA 3TBIB 1HPCA 3F2CA 1IBKQ 4A4IA 2UUAQ 3MEHA 4DR5L 2G9DA 3K7AH 2R7FA 1E1TA 1B50A 4EVOA 1A63A 1EQTA 3OYYA 1E2ZA 4UP7A 4P75A 3DM3A 1MSGA 1VQ7A 2HDLA 2RDFA 1BVSA 1TWHH 5ISRA 1GKHA 2FHTA 4FP5D 3BVGA 1SMXA 4A3MG 2R7ZG 4GKKL 1CA5A 5LMUL 1F9PA 3HOVH 5JAVA 3LWEA 3Q6SA 4UDUC 2Y0SB 3N52A 4GN3B 1WI5A 3JC66 4BY1B 1C48A 2F0HA 3MFGA 3CCVA 1LYLA 3G6EA 2N49A 3CPFA 1SNDA 1A15A 1NSNS 1KNEA 5JPNC 5G3LF 2F0OA 4BWGB 2JP1A 3ER0A 4J8QA 1VQNA 2PI2A 4JI4Q 4ME3A 3BU2A 4QCLA 1Y1VG 2A19A 4JYAL 4OIKA 4KTAA 1D1KA 1SEBD 4YY3L 3RLOA 1ZYRC 2F4VQ 1SAPA 3SDZA 4L8JA 1CKNB 4XYOA 1CSPA 2L12A 2SDFA 2Z6KA 5CV6A 5ELNA 2AWOA 5DEHA 4IFDJ 2D62A 2NN6G 2VB2X 4CDFC 2IHEA 3N6RA 1B2TA 3A8KE 1PH4A 4FF1A 4RHRA 4P74A 5KNCA 4E6IA 3K5NA 4DV0L 3NE5B 3EJIA 5LMNL 4OXPA 1J5EQ 3NUCA 1IL8A 1K83H 1L0XB 2VZAA 1L2FA 1ASZA 4C3JB 1YNJD 5FLMG 4JW0A 1XNQL 1HRJA 5ELFA 5AJ3L 5K5PA 3A8IE 1BQQT 2EE1A 5HY6A 2BH8A 4XQJA 5IWAL 2JA8G 1HQMC 2X69A 1IBLQ 4DR3Q 4MNOA 1U4MA 1KTKA 1QE6A 1BCPB 2N8NA 5C4JB 1XX8A 3U50C 1TS4A 1Z6HA 3KOJA 2Z4HA 3KBXA 3MXGA 3DWQA 2E2JH 2WV6D 1D1IA 4A3CH 1VQ9A 1SE3A 1NCVA 1W6JA 2DY8A 1L1OB 4IUTA 3PMFA 3GP7A 5EJWA 3W2DA 4NXML 4CDEC 3BDCA 2KCTA 1LV9A 2PCFB 4YCWA 4EQ5A 3T1HL 2WAQE 3SK6A 1STAA 3GTOB 4GN4B 4A3BG 3K0YA 4YWMA 4KD3A 2JA9A 2UU9L 1CZWA 3GV3A 2QEXA 1R9TB 1G291 3PUWA 1CKOA 2O2LD 1PTOD 1DOLA 3AMUA 2JA7H 2Z0SA 1F2LA 2YYZA 3IL8A 1YBYA 1G2SA 1SYEA 2BE5C 3MAQA 4RA8A 3CD6A 3JAMc 3CCRA 2Z8LA 4R8IA 3TEHB 3BZKA 4IUPA 1PH1A 2PI2E 4A3FG 3KF6A 1N34L 5CR3A 3CQZB 2JA5B 2EYPA 1J8IA 1ZKOA 2IT1A 2KHIA 2E5LL 1BCPC 1MGSA 1V1OA 3VA5A 3S1RH 1DOMA 1LO5D 1MKHA 1PRTC 5IT9c 4I65A 3PO2H 2OEOA 3X3NA 1PDQA 2JQOA 5CGKA 5M5XB 1HR0L 1K8GA 3TN2A 1L1OC 3T51B 4A3KB 4R4CA 1DM0B 5KNBA 5TSSA 3TQYA 4IJLA 3DUZA 4ZYSA 4LF8L 2HCIA 2KECA 2VQFL 1WYDA 2XGTA 2NYZD 3MXNA 1WD1A 3K5MA 3TS0A 5GQOA 3TP7A 3BZCA 2EYMA 4JG2A 2DJFC 3DEOA 5CV5A 4X65Q 3WOFA 3MTSA 5GROA 2NN6I 3A7AB 5EKLA 2R93B 3S14B 1YJNA 3NWSA 5BN3A 2L1BA 1A6XA 2LXKA 3FPPA 3RMHA 1LUZA 2XIWA 5HURA 1NE3A 3K5OA 1NMFA 1WVLA 1MJCA 4O1NA 4KKSA 4LW1A 3C3LA 1IKMA 4LFAQ 1EUJA 1CTMA 1TXYA 1RL2A 5CV9A 5F2DA 4JPBW 5D14A 4DK6C 1TS2A 1TS3A 4XT1B 4IOCA 2F0EA 5IGFA 1JE5A 1UEAB 3NTKA 2NVTB 1DXMA 1GHJA 5EPLA 1BKBA 2F0MA 2MPMA 4HIOA 2F03A 2A68C 4KJNA 3S2DB 4KHPL 1V1PB 2RKSA 2V1CC 2Y0SG 4JI6Q 2NZ1D 5I9PA 2KOLA 1U5KA 3CHBD 1CK1A 3L3OC 1D5MC 1E7ZA 1K3BC 3T4AC 4WRDA 4C3HG 5EGTA 4HSPA 4DV1Q 3PUVA 4BS9A 1Y1VH 2D9UA 1GO3E 5CMDA 1UEBA 1LT5D 1VQMA 2IL8A 1HNZL 4IPDA 4DUZL 1LTGD 4Q5VA 4ZUJA 4FF3A 4O0AA 1GJXA 3NBHB 1TWAB 5GAHC 2RSNA 2NTTA 1K28A 2UXBQ 3M4QA 3OIQA 4IUVA 2LXJA 4DK0A 2IX3A 4LMQD 3JAME 3RUZA 5A2QL 1A3UA 1JICA 1IBML 3M3YB 3ND8A 1QB5D 4DNRB 3J7AF 2EOTA 3FKIB 5IGGA 3W5OA 1VQDA 3BYTB 1B3AA 3CC7A 3S1NH 5JJKA 3AEVA 1GD7A 3HKSA 3GTJH 4BA2I 5C44B 4DXGA 2JE6I 2MP1A 1IL2A 3CPWA 5M5YB 5IT9E 2IJ0A 5FLMH 2R61A 4RFBA 4IURA 2FMCA 1QOHA 4XQNA 4YHHQ 1I6HH 2HD3A 2JA8H 1EWIA 4LF4Q 4QMGA 5I6WA 5FO9B 1UWVA 2UUAL 3A54A 1TWFB 4JK1C 1X32A 4DAPA 5C3XA 4WJWA 3Q22A 5FLXc 4DA2A 1ENCA 1CSQA 3M4PA 3GQBA 5IP9G 1A3VA 1O78A 2H1EA 3HG9A 3RR5A 1I4QA 1E2WA 2VS1A 4OO1G 2E2HH 2KVMA 4DV4Q 3U58A 2PW5A 3E0JA 2ZJPA 4K6LA 3S15H 5C4XG 2A5HA 4DKAC 4V0BA 5M3MB 4JI2L 3H0GB 3I55A 1WCMB 1Q90A 1Z47A 5EQ0A 4Y7NH 1Q1EA 4FNFA 3VA7A 1EIHA 2AKWB 2BCOA 1YZ6A 4UHVA 2NVYH 1UE6A 2XTIA 3CRLC 2I0QA 2NVXH 4JI4L 1HNWL 1QVFA 2VUMG 3I72A 3HOZB 4EQNA 3TRZA 5FJ8G 3UI2A 4PQXA 4A3FH 5COYA 3P20A 4BXXG 2JA6G 1AZQA 1JJGA 2F0TA 4X3SA 1CT1D 4DU9A 1PV4A 5EAYA 3D0FA 1KLGD 2N55A 1GXDC 2D0PA 4BBSG 1I6VC 2XNAC 4C3IB 3FPUB 1X3PA 2JJQA 3EVQA 3H6MA 3HOYG 2WAQG 5EKKA 4DR6Q 4GOPB 4DV6L 1L0YB 3GTPB 1ZXTA 4TRDA 3LX0A 3UDFA 4JI1Q 2VQEQ 1WTPA 3I7FA 2IPKD 3QJYA 4FDBA 1D6EC 4H7BA 4RGNA 2K5HA 2NTSA 2CVRA 4FF2A 2YV5A 4ZLTF 3BDOA 2KQ3A 1S3OA 2K5DA 5IYDG 5CC4A 4DR3L 3NSWA 2K01A 4TKOB 5IGBA 4IO9A 4F8MA 2C5CA 3J80L 2IHFA 3DWAA 3H3VI 1E24A 4A3DB 3L0OA 5ELEA 1ICWA 1TWCH 4N8X1 3J80i 2OTLA 2HQEA 1LTTD 3AYHB 1QG7A 1LTRD 3FRPB 2VNUD 4PMBA 2I07B 2I5MX 2PQAB 1KDBA 3RD4A 1BBUA 1SXTA 3H15A 5J3BA 4O42A 2JSOA 1U4RA 2IWHA 3S1QB 4DUYL 4GOPC 4V190 2DJGC 4FXKC 2L55A 1DOKA 2SEBD 3DXJC 5C4HA 2AMCB 5I2XA 3CU7A 1MHWC 5FLXE 4MHEA 3M9BA 3OW2A 3CCQA 3NP8A
chains in the Genus database with same CATH topology
4YIJA 3M4OB 2YU9B 1PZJD 1LTID 2EJGC 4OO1I 3HOUB 2EDGA 3FVQA 3VYTA 5M5WB 5C0XH 5JOBA 3K6OA 3BVMA 1EYDA 3S17B 1SYFA 3J7YW 3W3AA 2AQ1B 2NB0A 1DYQA 2XVSA 2O5JC 3S9WA 4KY7A 4PV1C 3U9SA 1XWEA 4G7ZC 1LTAD 3KBGA 4PMWA 2B2WC 1H9MA 2F0LA 2KEDA 2PMZB 4HN7A 1HXYD 2X6GA 1BBXC 4B9WA 4K8IA 2E75C 1KDAA 2R6GA 2HCCA 2LKVA 4NW2A 5C3EB 3GTGB 2WKDA 1HQRD 4IQZA 4AYBB 4OO1H 2MJ8A 5DM73 5C3WA 1JC7A 4G7HC 3GTQB 5CYUA 3S2HB 3EROA 3D6CA 2F0GA 4KMUC 3V2TA 1QCBD 1BR9A 4M1UB 3IKJA 5CV7A 4ABNA 2Q8RE 1Q12A 1I4HA 1OXUA 1T5EA 1JORA 3D4RA 2RVLA 2K28A 4CHTB 1AW7A 3HZXA 5FK9C 1VMCA 4DK1A 2B39A 4RKLA 4F7XA 3IFDA 3C46A 3I90A 2A73B 3FDTA 5NUCA 2EYJA 3QB3A 3MVVA 4ODGA 4C3IG 3TMEA 3O13A 1F9QA 1EIGA 2LFNA 2XSCA 2ICIA 5JVH3 2B8FA 1VMPA 2PNRC 3GO5A 3D8GA 1OXXK 3T53B 3J81E 3Q0AA 2XRSD 1DCZA 1EOTA 1WTOA 2KCCA 4IUQA 3SEBA 5IGEA 3KLRA 4ZKBB 3C1EA 3HRZC 3T13A 1RD9D 2L0CA 4RGMA 1GUSA 3HOWB 5KNDA 4J6HA 5EBDA 1VDZA 2B2TC 2FMMA 3C2PA 4ZAIA 1S5BD 4FF4A 2SNSA 3DWPA 3R3OA 1RTNA 4HSVA 5KRUA 4HCEA 1BOSA 2ZXPA 1TWGB 1JWUD 4FXDA 4IZ8A 1G2TA 4DXFA 4I7ZC 1JE4A 4B08A 2R92B 2K7VA 3HS0C 1Y8NB 3KK7A 5E1FA 4CJ0B 1Q1BA 1LLRD 1V1PA 3GD7A 2F0DA 1KDCA 4OHJA 4A93B 1BCPD 3OSOA 5C5MA 5M9OA 5D3IB 3BDLA 2TMPA 1PRTD 3KLSA 1RTOA 2PW7A 3OW7A 1PMRA 3NBHA 5E4WC 5ELCA 3OOCA 5JEAJ 3D6WA 4QUFA 2Z4IA 2A69D 1VCIA 3OHXC 5J39A 1TKWB 3BYYB 2WB1B 2XN9C 4BY7B 2F0WA 1SYBA 4ZRZA 3RZOB 2PZUA 2K5QA 4A3GB 1BNZA 4EQOA 4P2CB 3URYA 3HKZB 3R2TA 3S1MB 3ZYYX 4DAVA 4CKBA 2Q8IB 1Y1WB 5T1IA 3U9OA 3PUZA 1AEXA 1AZPA 3K59A 1B9NA 2XRQD 4OIJA 4ZUIA 1NR4A 3C1FA 2QDBA 2Z1CA 1MBYA 2WIIB 2TSSA 5CV4A 1H9SB 5BN4A 1II3A 3SK8A 4HR7B 1TT2A 1YNND 3K7AB 3DM1A 4FO2A 1BXTA 1GOZA 4K6DA 3I4MB 3P75A 1AN8A 4TQUS 2EY6A 2B63B 1U4PA 3L9AX 1TWHB 1C4QA 4DGZA 3M7GA 4K5VA 1NAPA 4DF7A 1STYA 1CZGA 3HOVB 4H13C 3JAML 2FINB 3ONAB 3SXHA 5LL6X 2NWGA 3I4NB 3DEPA 1VF5C 1CQFA 3I70A 3NXWA 5LHY1 1CM9A 4RWSC 1DZ1A 2IX1A 4FXGC 1U9RA 5IT9L 1EY4A 4RH6A 1CA6A 1B4OA 3OWFA 1ESRA 1LT6D 2B2YC 1JCKB 3H94A 1SDFA 3K5LA 1A3TA 5I2YA 3AU7A 3SHLA 4CBVA 1S5CD 1S5ED 3HGBA 2WACA 1PTOF 4CJ1B 1F77A 4RGTA 3R93A 2KEEA 5C0XG 4M8AA 1EU4A 4KV6A 2CW0C 1JR0D 1ILPA 3V05A 4FYDA 1H9KA 2D5DA 2K32A 1F2YA 3VR4A 2A74C 3MXUA 2L11A 3SK5A 1EZ8A 2E2JB 2A6HD 2NVQB 1PLFA 1O7YA 1I4RA 2B2WA 2B8GA 5JJZA 2B2UC 4C3JG 1EY7A 4XQQA 4CJ2C 4C1NK 2F0IA 1ENFA 3NQTA 3ERQA 3M7NA 2IW3A 1GUOA 1STEA 2XWJB 5J1ZA 1EU3A 4K5XA 4OGQC 3BS1A 4KKUA 2L5TA 5KGUA 3VR2A 2VB3X 1QJOA 4PMCA 3MZ5A 4CGYB 3S16B 4IFDG 4CKEA 3QWNA 4KY6A 4NDXA 4EQPA 1HA5A 2A6ED 3BZDB 3WDNA 3PO3B 2MGSA 1F9RA 1OXVA 2X6LA 3PIP3 4X3UA 1TY2A 1DJRD 1HUNA 2J7ZA 1RCVD 1SNCA 1TR5A 5A2QE 1B9MA 1KAAA 2HDMA 1STGA 4C1NI 4KN4C 3VYUA 5FLXL 3PV0A 3A56A 1W6KA 1FD7D 1FNWA 1LT3D 5ELDA 1SNPA 2WP8J 4K2LA 1EYCA 3LWUA 3E5SA 4XXEA 5C0XI 1UNSA 3QIAA 5KEEA 3VR6A 1F9SA 1B53A 2K5WA 4KHZA 3TDQA 3P7JA 4MN3A 3NTHA 4A3MB 2OXPA 2R7ZB 1IYVA 3R2IA 2DNEA 4X3TA 4F88A 1O80A 2EYHA 5DNFA 4QIWB 1EZ6A 1T5XD 4EGVA 2G9HD 2K1BA 3EFXD 2B2TA 4DN4M 4LK1C 2R3ZA 4G4KA 3MC0B 3FMCA 1Y1VB 1X3QA 1WTQA 4ZK9B 4WORA 4K2KA 1JQYD 1JWSD 2B2VC 2AQ2B 1KNAA 1NUCA 4H0LC 2MHVA 3FEWX 1IKLA 2EYFA 1QNUA 2O5IC 5CBAE 3QG1A 3EA6A 1E0BA 2QILA 3MFYA 4ILWA 4IFDI 2M00A 4ULLA 2IX0A 2KCNA 3S1NB 1EL0A 3GTJB 2H4OA 1SFOB 3Q23A 1PXUA 3CRKC 4C2MB 1LACA 2QKIC 3DHQA 1BUVT 1GUGA 2JA8B 4CKCA 2KUMA 1EEFD 1OXTA 2PQEA 1SYGA 2F3WA 2RSOA 1FYCA 2AUKA 1HTLD 2E2HB 5J22A 1WTVA 3J7AV 4A3BB 1OO9B 1ET6A 4KY5A 2KHSA 1XYIA 4ZQ3A 2OF1A 3MA2B 1D5XC 5G3LD 2J0TD 1EY6A 1EY5A 5LL6S 5IIFA 2NVXB 4UAIA 2BDOA 2AUJD 1B44D 3NHHA 4IFDH 4JBWA 3J81L 5JPMC 1FNUA 4MIUA 2FFKB 1ML0D 1GUWA 1PYWD 2ZXRA 1SE2A 3PUXA 4L63B 1M8AA 3OMCA 2WINB 5BN5A 4KN7C 4HEDA 1RJTA 5I9OA 1SMYC 1EWHA 1D2BA 2V4DA 2NBFA 2BOSA 3A8JE 1RF2D 4U68A 4Z9CB 3NTIA 1ZYRD 2BDNA 3ITPA 1S4ZA 2LY7A 4IN3A 2CHBD 2EY5A 5C0XJ 1CHPD 3X3MA 1G8ZD 1FR3A 1TWCB 1IW7C 2K03A 3M4YA 4XIGS 1C8CA 1STHA 1HA6A 4RHSA 4FVMA 4HAEA 3QOJA 4B9XA 2F1MA 3IFTA 3A7LA 1XXGA 1H9SA 4G7OC 4PNYA 3TZDA 4KD4A 2B2YA 1V8QA 3OMGA 2DY7A 4HTHA 1F2MA 2Q8TA 1EY9A 5CBEE 1G91A 2K04A 4QF4A 4R9WA 4C3HB 2RBMA 1SBBB 2N88A 3I73A 4F87A 4XDXA 1SJHD 1EWCA 1RKNA 4IALA 1K8MA 3D31A 3NBIA 4X3KA 1ENAA 3G6JB 3V96A 2BE5D 2B2UA 1SSOA 5FO7B 1LT4D 2KA7A 2PZTA 2BA1A 3E6ZX 2OT2A 5KYLA 3RLFA 2EPBA 3NWTA 3GTLB 1A2UA 1PFBA 1Y69U 2WKCA 1EY8A 3HP3A 2GA4B 2ZXOA 1EYAA 3F2UA 1HFNA 1WD0A 2PPBC 1PRTB 4U673 5CORA 5JVG3 3D3RA 1I4XA 1UUPA 3H3VC 5IOCA 5HGTA 1S5FD 3KF8A 3NPPA 5C4XB 3M85A 4L6TB 1PTOB 2ID0A 1YNJC 1EY0A 4J1MA 2MUYA 1CQVA 4KKTA 1IHZA 4TSSA 2VUMB 1LTSD 2JXMB 4K5WA 3SVMA 2JA6B 3BVZA 3GTMB 1JB3A 2F3VA 1CHQD 1EFID 4BBSB 2DNCA 2O4XA 3HOYB 5E4XA 2WAQB 4GZYC 3SK4A 2PYKA 2A69C 2A68D 3I4LA 1MSHA 3QOLA 1PTOC 3K57A 4S3SA 2VXWA 2EYLA 4QUCA 1WTWA 1R4QB 2ZT9C 5I6YA 5E3FA 2SNMA 4ME5A 1TVXA 2CQAA 5K36G 2EY2A 3K58A 2CW0D 1I4GA 4QB4A 4HMIA 5D3DA 4KK7A 2M2LA 3H09A 1BCPF 3OWEB 1Y8PB 1B1ZA 3BG3A 3OIPA 3GTKB 1PRTF 1HUMA 1Q8IA 1E2VA 2SOBA 2B2VA 1ZEQX 3QO2A 4K8JA 1I3QB 4Q0FA 3H91A 3D4WA 1YNNC 2E74C 1LTBD 3PIO3 3I91A 2QEJC 1K83B 3GV6A 3TZUA 4K14A 1Z7TA 4RAUC 5AFWA 1H9RA 2J4XA 4RCNA 5EPKA 1AP0A 1SNQA 2ENBA 4C56C 4HCSA 1A2TA 2NN6H 4BBRB 3T56B 5D65A 1RDPD 4KI0A 2HUGA 1K8OA 4IUUA 3VR3A 3L7ZC 5FKAC 5CV8A 5DAUA 2K6AA 3TP8A 2EJFC 3D4DA 1TU2B 2JA7B 4DAYA 2M9VA 2JEAI 1G6ZA 1WTRA 1RHPA 1TQOA 3OPOA 5C5LA 1M4VA 1I4PA 2RA4A 3KUPA 4A3JB 5KIXA 2F0VA 3S1RB 3G7LA 1U4LA 4XTCS 3I8ZA 3PO2B 3VYRA 2PO4A 5M3FB 1BF4A 2NUCA 1NR2A 2JYOA 5I4DA 1GUTA 2EVBA 3HEJA 2A6HC 5IODA 2L4NA 3R8BA 1JOKA 2FJ2A 1ONLA 1EQVA 4ID6A 1Q3LA 3MXPA 2F0KA 1XTCD 3SR1A 1Y8OB 2F0NA 2QF7A 3TP6A 3RZDB 5JEAG 3DMUA 3MHBA 1QNKA 5ELBA 1F2ZA 4R8NA 1O7ZA 2EXZA 5C4ZA 1LABA 3TP5A 3CKIB 5KYIA 4A3EB 1HFGA 1HTPA 1SE4A 4N9PA 2AWNA 2A6EC 1TIID 4IUNA 2L9HA 2F4IA 1MI2A 2AQ3B 3TSSA 1JWMD 4RKBA 4LAAA 2EJMA 1SJED 1H9JA 1HCZA 2KJXA 1RODA 4XT3B 1STNA 5K36H 2K05A 2E76C 2E2IB 1CI3M 5T1GA 3WOEA 5IGDA 4ZKCB 1J9OA 1QWYA 1DONA 1GHKA 3VR5A 1KLUD 1O7LA 1SYDA 1R4PB 1TY0A 1STBA 5FO8B 2F0JA 4BA1I 1PZID 5EPJA 1FGBD 3EQLC 4NMZA 4NP5A 3MWYW 3IAYA 5FOBB 1AFPA 2JEBI 1GUNA 1JOOA 3VYSA 2E2DC 4XYQA 2DN8A 5DM63 1I6HB 1BDOA 2ICEC 3T16A 3A55A 1KABA 1CFMA 1HHVA 3J80E 2C9OA 3SE0A 2LMCB 2EZVA 5A35A 1TS5A 4H44C 1JOQA 1S5DD 1I50B 4RGOS 2EYOA 2RDHA 4NKLA 2F0QA 5EKIA 1PZKD 1FNVA 3ND9A 1OXSC 4KJOA 3S15B 1IYUA 4A3IB 2F0UA 4Y7NB 2XWBB 2F0SA 1SMYD 2NVYB 1ET9A 1VF7A 2PZWA 3LNNA 2RQXA 4A3FB 2LS01 3I3CA 1D5ZC 4DFAA 1PFMA 4G57A 1SNMA 1DD2A 1IW7D 3Q24A 1UAPA 1BO0A 2F0FA 3NK9A 1V43A 2I46A 2K33A 2QCPX 4N9TA 1SYCA 4DNTB 4RCOA 1ESFA 4WFN3 2EY1A 2RDGA 1PTOH 3P1HA 1QILA 1SNOA 1EEID 1PFNA 2D2CC 4LJZC 1ILQA 3AB9A 4KHVA 1MD2D 3HOXB 3NQIA 2BA0A 3PUYA 5JEAH 5EBCA 4HMJA 5IGCA 4OL7A 3KLSX 5C6AA 2F0PA 3TBIB 1HPCA 3MEHA 2G9DA 1B50A 4EVOA 1EQTA 1E2ZA 1MSGA 2HDLA 2RDFA 5ISRA 2FHTA 4FP5D 3BVGA 1CA5A 1F9PA 5JAVA 3LWEA 3Q6SA 4UDUC 2Y0SB 3N52A 4BY1B 1C48A 2F0HA 3MFGA 1SNDA 1A15A 1NSNS 1KNEA 5JPNC 5G3LF 2F0OA 4BWGB 2JP1A 4J8QA 4QCLA 4OIKA 4KTAA 1D1KA 1SEBD 1ZYRC 1SAPA 3SDZA 4L8JA 4XYOA 2L12A 2SDFA 5CV6A 2AWOA 5DEHA 4IFDJ 2D62A 2NN6G 2VB2X 3N6RA 1B2TA 3A8KE 4FF1A 4RHRA 5KNCA 4E6IA 3K5NA 3NE5B 3EJIA 3NUCA 1IL8A 1L0XB 4C3JB 1YNJD 1HRJA 5ELFA 5K5PA 3A8IE 1BQQT 2EE1A 4XQJA 1HQMC 2X69A 1U4MA 1QE6A 1KTKA 1BCPB 5C4JB 1XX8A 1TS4A 1Z6HA 3MXGA 2Z4HA 3KBXA 3DWQA 2WV6D 1D1IA 1SE3A 1NCVA 1W6JA 2DY8A 4IUTA 3PMFA 3GP7A 5EJWA 3W2DA 3BDCA 1LV9A 2PCFB 3SK6A 1STAA 3GTOB 3K0YA 4KD3A 1CZWA 3GV3A 1R9TB 1G291 3PUWA 2O2LD 1PTOD 1DOLA 3AMUA 1F2LA 2YYZA 3IL8A 1G2SA 1SYEA 2BE5C 3MAQA 4RA8A 2Z8LA 4R8IA 4IUPA 5CR3A 3CQZB 2JA5B 2EYPA 1J8IA 1ZKOA 2IT1A 1BCPC 1MGSA 1V1OA 3VA5A 1DOMA 1LO5D 1PRTC 4I65A 2OEOA 3X3NA 1PDQA 5CGKA 5M5XB 3TN2A 3T51B 4A3KB 1DM0B 5KNBA 5TSSA 3DUZA 4ZYSA 2HCIA 2KECA 2NYZD 3MXNA 1WD1A 3K5MA 3TP7A 2EYMA 5CV5A 3DEOA 3WOFA 3MTSA 2NN6I 3A7AB 5EKLA 2R93B 3S14B 3NWSA 5BN3A 2L1BA 1A6XA 3FPPA 3RMHA 2XIWA 5HURA 3K5OA 1WVLA 4O1NA 4KKSA 1IKMA 3C3LA 1CTMA 5CV9A 5F2DA 5D14A 1TS2A 1TS3A 4XT1B 2F0EA 5IGFA 1UEAB 3NTKA 2NVTB 1DXMA 1GHJA 5EPLA 2F0MA 2MPMA 2F03A 2A68C 4KJNA 3S2DB 1V1PB 2RKSA 2NZ1D 5I9PA 2KOLA 1CK1A 3CHBD 3L3OC 1D5MC 3T4AC 4WRDA 4C3HG 5EGTA 4HSPA 3PUVA 4BS9A 2D9UA 5CMDA 1LT5D 2IL8A 1LTGD 4Q5VA 4ZUJA 4FF3A 1GJXA 1TWAB 2RSNA 2NTTA 3OIQA 4IUVA 4DK0A 2IX3A 4LMQD 3JAME 3RUZA 5A2QL 1A3UA 1JICA 3M3YB 3ND8A 1QB5D 4DNRB 3J7AF 2EOTA 3FKIB 5IGGA 3BYTB 1B3AA 4BA2I 5C44B 4DXGA 2JE6I 2MP1A 5M5YB 5IT9E 2IJ0A 2R61A 4RFBA 4IURA 2FMCA 1QOHA 4XQNA 4QMGA 5I6WA 5FO9B 3A54A 4DAPA 5C3XA 1TWFB 1X32A 4JK1C 4WJWA 3Q22A 4DA2A 1ENCA 3GQBA 1A3VA 1O78A 2H1EA 3HG9A 1I4QA 1E2WA 4OO1G 2KVMA 2PW5A 3E0JA 4K6LA 2A5HA 4V0BA 5M3MB 3H0GB 1WCMB 1Q90A 1Z47A 5EQ0A 1Q1EA 4FNFA 3VA7A 1EIHA 2BCOA 3CRLC 3I72A 3HOZB 4EQNA 3UI2A 4PQXA 5COYA 3P20A 1AZQA 2F0TA 4X3SA 1CT1D 4DU9A 1KLGD 2N55A 1GXDC 1I6VC 2XNAC 4C3IB 3FPUB 1X3PA 3EVQA 3H6MA 5EKKA 1L0YB 3GTPB 1ZXTA 4TRDA 3LX0A 1WTPA 2IPKD 3QJYA 1D6EC 4H7BA 4RGNA 2NTSA 2CVRA 4FF2A 4ZLTF 3BDOA 2KQ3A 2K5DA 5CC4A 3NSWA 2K01A 4TKOB 5IGBA 4F8MA 2C5CA 3J80L 3DWAA 4A3DB 5ELEA 1ICWA 2HQEA 1LTTD 1QG7A 1LTRD 3FRPB 2VNUD 4PMBA 2I07B 1KDBA 3RD4A 1SXTA 4O42A 2JSOA 1U4RA 2IWHA 3S1QB 4V190 4FXKC 2L55A 1DOKA 2SEBD 3DXJC 5C4HA 5I2XA 3CU7A 5FLXE 4MHEA 1WTXA 3NP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IIF A;  2EYO A;  5E1F A;  4EVO A;  4YIJ A;  2RBM A;  1F2Z A;  5CV7 A;  3SK6 A;  4R8N A;  4DGZ A;  1STA A;  1EZ6 A;  2EXZ A;  4NKL A;  1SNQ A;  2ENB A;  2F0Q A;  4K5V A;  4KD3 A;  5C4Z A;  1JOR A;  4DF7 A;  5J1Z A;  1STY A;  3TP5 A;  2F3V A;  2F0M A;  4K5X A;  3NHH A;  2F0D A;  2RDF A;  1A2T A;  5ISR A;  3HZX A;  5KYI A;  4KJO A;  3SXH A;  1KDC A;  4KJN A;  4EQN A;  5KGU A;  4RKL A;  2O4X A;  2RKS A;  1EY6 A;  4F7X A;  4PMC A;  4N9P A;  3OSO A;  4MIU A;  5C5M A;  1RKN A;  5M9O A;  5I9P A;  3MZ5 A;  3BDL A;  5JAV A;  4IAL A;  4IUN A;  3SK4 A;  1SYE A;  2F0U A;  4K2K A;  4WOR A;  5NUC A;  2PYK A;  2EYJ A;  3NXW A;  3QB3 A;  4WRD A;  3MVV A;  5CV8 A;  2F0T A;  5EGT A;  4KY6 A;  5JOB A;  2PW7 A;  4NDX A;  4RKB A;  4ODG A;  4DU9 A;  1U9R A;  2F0S A;  2F0H A;  1EYD A;  4LAA A;  5DAU A;  1ENA A;  3TP8 A;  4EQP A;  1EY4 A;  3TME A;  1SYF A;  5CR3 A;  1NUC A;  3QOL A;  1SND A;  3OMC A;  2PZW A;  1NSN S;  3OWF A;  2EYP A;  3D4D A;  4ZUJ A;  1STN A;  2F0O A;  5IOC A;  5J39 A;  3VA5 A;  3S9W A;  2EYF A;  4KY7 A;  3EVQ A;  3H6M A;  4S3S A;  5IGD A;  2EYL A;  4I65 A;  2PZT A;  4KTA A;  5EKK A;  5I6Y A;  2OEO A;  2SNM A;  4ME5 A;  5E3F A;  3D8G A;  3SR1 A;  2F0W A;  4DFA A;  1TQO A;  1SYB A;  2M00 A;  5CGK A;  5I9O A;  5KYL A;  4G57 A;  1SNM A;  2EY2 A;  4TRD A;  3LX0 A;  5C5L A;  3RUZ A;  2F0L A;  2PZU A;  1SYD A;  4QB4 A;  5CV6 A;  4HMI A;  1A3U A;  1A3T A;  1A2U A;  5DEH A;  3SHL A;  1SNC A;  1STB A;  1TR5 A;  4H7B A;  5IGE A;  2F0J A;  2WAC A;  5IGG A;  5KIX A;  2F0V A;  3C1E A;  1EY8 A;  2F0F A;  3T13 A;  3ITP A;  3DHQ A;  3NK9 A;  4EQO A;  1KAA A;  4B9W A;  2KQ3 A;  1EYA A;  4K8I A;  4NMZ A;  4E6I A;  1STG A;  5CC4 A;  4N9T A;  1KDA A;  2EY5 A;  4NP5 A;  1SYC A;  4J6H A;  4KV6 A;  5IGB A;  2NUC A;  3EJI A;  4F8M A;  2EY1 A;  3TP7 A;  1STH A;  3P1H A;  3NUC A;  2EYM A;  2LKV A;  2SOB A;  5CV5 A;  3U9O A;  1SNO A;  1AEX A;  3QOJ A;  4QMG A;  1F2Y A;  5I6W A;  4QF4 A;  2SNS A;  5EKL A;  2PQE A;  3HEJ A;  4K8J A;  4B9X A;  5C3X A;  1JOO A;  1SNP A;  1SYG A;  2HQE A;  4ZUI A;  5HGT A;  2F3W A;  5IOD A;  3R3O A;  4K2L A;  1EYC A;  5K5P A;  3E5S A;  1ENC A;  1JOK A;  4PNY A;  3C1F A;  2QDB A;  3D4W A;  5KRU A;  4PMB A;  1A3V A;  4KD4 A;  4KHV A;  3SK5 A;  1KDB A;  1EZ8 A;  5J22 A;  5KEE A;  5C3W A;  1EQV A;  3OMG A;  5HUR A;  3T16 A;  4ID6 A;  4HTH A;  5CV4 A;  1II3 A;  1F2M A;  3SK8 A;  1EY0 A;  4J1M A;  1KAB A;  1TT2 A;  4IZ8 A;  2KHS A;  3MXP A;  4KY5 A;  5C4H A;  2F0K A;  1EY9 A;  5CV9 A;  1EY7 A;  5F2D A;  4K14 A;  3ERO A;  3D6C A;  2F0G A;  1IHZ A;  4HMJ A;  4ZQ3 A;  2OF1 A;  2PW5 A;  2F0N A;  4K6D A;  3P75 A;  4OL7 A;  2F0P A;  2OXP A;  2F0I A;  3V2T A;  5C6A A;  5IGC A;  2F0E A;  3MEH A;  4K5W A;  3TP6 A;  5IGF A;  3PMF A;  3NP8 A;  1JOQ A;  2EY6 A;  3BDC A;  3DMU A;  3NQT A;  1EY5 A;  2EYH A;  3MHB A;  3ERQ A; 
#chains in the Genus database with same CATH topology
 3PIP A;  4DV2 Q;  4YIJ A;  3M4O B;  2YU9 B;  1PZJ D;  3PSI A;  1LTI D;  1XTD A;  4DR4 L;  3KJP A;  2EJG C;  4OO1 I;  1XNR L;  3HOU B;  2EDG A;  2K5N A;  3FVQ A;  3VYT A;  5M5W B;  5C0X H;  2KBN A;  1B70 B;  3J81 c;  1UE5 A;  5JOB A;  3K6O A;  2UUC Q;  2ZM6 L;  3BVM A;  2G5D A;  1EYD A;  3S17 B;  4HJA A;  1SYF A;  4JI7 Q;  3J7Y W;  4A3C G;  3W3A A;  2AQ1 B;  2NB0 A;  1DYQ A;  2XVS A;  1CKN A;  2O5J C;  4BBR G;  3S9W A;  4KY7 A;  4PV1 C;  3U9S A;  1XWE A;  4G7Z C;  1MJE A;  3KJO A;  1LTA D;  1SE8 A;  3KBG A;  1I5F A;  3K8A A;  2A8V A;  4PMW A;  2B2W C;  1H9M A;  2F0L A;  2KED A;  2PMZ B;  1AE2 A;  1ASY A;  3K81 C;  4X62 Q;  4UPA A;  4HN7 A;  1HXY D;  3CCE A;  1QVC A;  2X6G A;  2JA7 G;  1BBX C;  1EYG A;  4JBJ A;  4UP9 A;  4B9W A;  1Y14 B;  4K8I A;  2E75 C;  1KDA A;  2R6G A;  5JJL A;  2HCC A;  3STB D;  1I94 L;  4JI3 L;  2LKV A;  4NW2 A;  5IP9 H;  5C3E B;  2AHO B;  3GTG B;  2D0O A;  4A3J G;  2WKD A;  1HQR D;  2VW9 A;  4B3S Q;  4QJF A;  4IQZ A;  4AYB B;  2B29 A;  1P8L A;  3F2B A;  1N36 Q;  3PO2 G;  4OO1 H;  1E3P A;  2MJ8 A;  5DM7 3;  4K0K Q;  5M3F G;  5C3W A;  2CWP A;  1XMQ L;  1JC7 A;  4G7H C;  3KFU A;  5C4X H;  4JI5 L;  1L1O A;  3GTQ B;  5CYU A;  2CQO A;  3S2H B;  3ERO A;  3D6C A;  2F0G A;  4KMU C;  1R9T H;  5M3M G;  3V2T A;  1K3R A;  1VQH A;  1Q81 C;  1QCB D;  4DNI A;  1BR9 A;  1FJG L;  4M1U B;  2VUM H;  3IKJ A;  5CV7 A;  4ABN A;  2Q8R E;  1Q12 A;  1I4H A;  1OXU A;  1T5E A;  4AIM A;  4HJ8 A;  4BXX H;  1JOR A;  2JA6 H;  3CC2 A;  1VQA A;  2RVL A;  3D4R A;  2K28 A;  4CHT B;  1X6O A;  1AW7 A;  3CQZ H;  3HZX A;  5FK9 C;  1VMC A;  4DK1 A;  1E1O A;  2B39 A;  4RKL A;  4AH6 A;  4F7X A;  3IFD A;  3C46 A;  3I90 A;  2A73 B;  1B3Q A;  3FDT A;  2K50 A;  5IE8 A;  3KYH C;  5NUC A;  4BBS H;  1XMO L;  2EYJ A;  3QB3 A;  3MVV A;  4P73 A;  5M5X H;  1BBW A;  4ODG A;  4QQB X;  3HOY H;  1X55 A;  4C3I G;  3ULJ A;  3TME A;  3O13 A;  1F9Q A;  4A3E G;  1EIG A;  2LFN A;  2K5V A;  2ICI A;  2XSC A;  5JVH 3;  2VY3 A;  4WJ3 M;  2B8F A;  1VMP A;  2PNR C;  3GO5 A;  3D8G A;  2ALY B;  1OXX K;  3GDE A;  3T53 B;  3J81 E;  1VQL A;  3Q0A A;  1PYB A;  2XRS D;  1DCZ A;  1EOT A;  1WTO A;  5IYD H;  2KCC A;  4LF4 L;  4IUQ A;  3ZJY C;  3SEB A;  5IGE A;  3KLR A;  1Q8K A;  4ZKB B;  2ATW A;  3C1E A;  3HRZ C;  3T13 A;  1RD9 D;  2L0C A;  4RGM A;  3F8T A;  1GUS A;  3HOW B;  4IPC A;  5KND A;  4J6H A;  5EBD A;  3OTO L;  1VDZ A;  1JMC A;  3U4Z A;  4B3T L;  2B2T C;  2YTX A;  2FMM A;  3C2P A;  3GTK H;  4ZAI A;  1S5B D;  3HFZ B;  3LGJ A;  2MQH A;  4FF4 A;  1JJ2 A;  2SNS A;  3DWP A;  3R3O A;  4YCV A;  1RTN A;  4HSV A;  5KRU A;  5L37 A;  4HCE A;  1BOS A;  2ZXP A;  1TWG B;  1I3Q H;  1SRU A;  1JWU D;  1M90 C;  2RF4 A;  1Q86 C;  4FXD A;  4IZ8 A;  2RHQ B;  1G2T A;  4DXF A;  4I7Z C;  4X64 L;  2N78 A;  3S2D H;  1JE4 A;  4B08 A;  2R92 B;  2K7V A;  4NXN Q;  3HS0 C;  1Y8N B;  3NEM A;  1QUQ B;  3KK7 A;  1FGU A;  5E1F A;  1Q1B A;  4CJ0 B;  5GAD C;  1LLR D;  1V1P A;  1VQB A;  2I5L X;  3GD7 A;  3HOU G;  4TVA B;  2F0D A;  4CDD C;  1KDC A;  3HKZ E;  2JN4 A;  4OHJ A;  4A93 B;  1BCP D;  3OSO A;  5C5M A;  4DV3 L;  5M9O A;  5D3I B;  3BDL A;  2TMP A;  1PRT D;  3KLS A;  1RTO A;  4B3R L;  4BBR H;  2PW7 A;  3OW7 A;  1PMR A;  3NBH A;  5E4W C;  5ELC A;  3OOC A;  5JEA J;  3D6W A;  1IYJ B;  4DV5 L;  2K4K A;  4QUF A;  4B3M Q;  2Z4I A;  2CH4 A;  2A69 D;  4YCU A;  1VCI A;  3OHX C;  5J39 A;  1TKW B;  3CAM A;  3BYY B;  2GN5 A;  4H02 A;  2WB1 B;  4AQY L;  4A3I G;  2XN9 C;  2ZTE A;  5C44 H;  4BY7 B;  2F0W A;  1SYB A;  4ZRZ A;  3RZO B;  1L0W A;  1HNX Q;  2E8G A;  1X54 A;  2PZU A;  2OQK A;  2HHH L;  3AQQ A;  4GKJ L;  2K5Q A;  4A3G B;  1BNZ A;  3ULL A;  2CKZ B;  1N33 L;  4EQO A;  4P2C B;  3URY A;  3HKZ B;  4JI0 L;  3R2T A;  4A3J H;  3S1M B;  3ZYY X;  2P5Z X;  4DAV A;  1Q46 A;  4LFB L;  4CKB A;  2Q8I B;  1GVP A;  4LUO A;  1Y1W B;  5T1I A;  3U9O A;  3PUZ A;  2UXD Q;  1AEX A;  5M3F H;  4JI8 Q;  1AZP A;  3K59 A;  1B9N A;  2XRQ D;  1WJJ A;  4OIJ A;  4ZUI A;  1NR4 A;  1YIJ A;  5IY0 A;  3C1F A;  2QDB A;  4HJ5 A;  2Z1C A;  2ASB A;  1MBY A;  5M3M H;  2WII B;  2TSS A;  4OX9 L;  5CV4 A;  1H9S B;  2A1A A;  5BN4 A;  1II3 A;  3SK8 A;  4LFC Q;  2ZTC A;  4HR7 B;  4GN5 A;  1TT2 A;  1YNN D;  3K7A B;  3DM1 A;  4LF6 L;  4FO2 A;  4APV A;  3UE1 A;  1BXT A;  4GS3 A;  1GOZ A;  4K6D A;  3I4M B;  1K8A C;  3P75 A;  2ES2 A;  2ZTD A;  1AN8 A;  3HOZ H;  4TQU S;  2EY6 A;  2B63 B;  1U4P A;  3L9A X;  3PQI A;  1TWH B;  3HOX G;  1C4Q A;  4DGZ A;  4JI7 L;  3RZD H;  1RIP A;  3M7G A;  4K5V A;  3ULP A;  1NAP A;  4DF7 A;  2UXC Q;  1STY A;  1PH7 A;  4LF7 L;  1CZG A;  4DR1 Q;  3HOV B;  1T9H A;  4H13 C;  3JAM L;  2FIN B;  3ONA B;  3SXH A;  5LL6 X;  1P16 A;  1WOC A;  1PH3 A;  3IRB A;  4C3I H;  4GLA C;  2NWG A;  3I4N B;  2GVA A;  3DEP A;  1VF5 C;  4GLX A;  1CQF A;  3I70 A;  3JAM i;  4A3E H;  3NXW A;  5LHY 1;  1CM9 A;  4RWS C;  3GTP H;  1DZ1 A;  1G51 A;  2IX1 A;  4FXG C;  1U9R A;  5IT9 L;  1N32 L;  1EY4 A;  4RH6 A;  1CA6 A;  1B4O A;  3OWF A;  1ESR A;  1LT6 D;  4GOP A;  3BJU A;  1K9M C;  4DV7 Q;  3RN5 A;  4IPH A;  2B2Y C;  1JCK B;  3H94 A;  1SLJ A;  1X65 A;  1SDF A;  3K5L A;  4PZ7 A;  2E2I H;  3A74 A;  4BY1 G;  2WFW A;  1O7I A;  1A3T A;  5I2Y A;  4DR2 Q;  3AU7 A;  1U0L A;  3SHL A;  4CBV A;  1CKM A;  3ERS X;  1S5C D;  4A3D H;  1S5E D;  3HGB A;  2WAC A;  1PTO F;  4CJ1 B;  1F77 A;  1SRO A;  4JV5 Q;  4RGT A;  3R93 A;  4HJ7 A;  2KEE A;  4LF9 Q;  5C0X G;  4PG3 A;  4M8A A;  1EU4 A;  4KV6 A;  2CW0 C;  1JR0 D;  1HZ9 A;  3T1Y L;  1ILP A;  3V05 A;  4FYD A;  3S1Q H;  1H9K A;  2D5D A;  2K32 A;  4NPS A;  1F2Y A;  5BR8 Q;  3VR4 A;  2PQA A;  2A74 C;  2ZJR A;  3MXU A;  4QL5 A;  3I2Z A;  3PF4 A;  2L11 A;  3SK5 A;  5E7N A;  1EZ8 A;  1LTL A;  2E2J B;  1PH9 A;  3KF8 B;  3FP9 A;  2A6H D;  3PGZ A;  2NVQ B;  1PLF A;  4X66 L;  4RG1 A;  1O7Y A;  2YU9 H;  1WFQ A;  1I4R A;  2B2W A;  2B8G A;  1VQO A;  5JJZ A;  1QZH A;  2B2U C;  4C3J G;  1DGS A;  1EY7 A;  4XQQ A;  4CJ2 C;  4C1N K;  2OWO A;  1S72 A;  4DR5 Q;  1PVO A;  2F0I A;  3K7U C;  1ENF A;  3HOU H;  1IBK L;  3NQT A;  3ERQ A;  3M7N A;  2IW3 A;  1VQP A;  1GUO A;  1STE A;  5M5W H;  4A76 A;  1VQK A;  1GM5 A;  2XWJ B;  4R4I A;  2UUB Q;  3FHW A;  5J1Z A;  1EU3 A;  4K5X A;  5IP7 G;  1I50 H;  3S17 H;  4OGQ C;  3BS1 A;  4KKU A;  2L5T A;  3I4O A;  5KGU A;  3VR2 A;  5LMU Q;  2VB3 X;  1KXL A;  1QJO A;  4PMC A;  3MZ5 A;  2RCF A;  4CGY B;  3S16 B;  4KLK A;  4IFD G;  2HT1 A;  4CKE A;  3MEF A;  3QWN A;  4KY6 A;  1VQG A;  4JBM A;  4NDX A;  4GNX B;  4A3I H;  4EQP A;  1EOV A;  1CUK A;  1FL0 A;  1HA5 A;  2A6E D;  3BZD B;  3WDN A;  2MO0 A;  3PO3 B;  2MGS A;  2MNA A;  4JYA Q;  1F9R A;  1OXV A;  4MTN A;  2X6L A;  3PIP 3;  4X3U A;  1UE7 A;  4IPG A;  1TY2 A;  1DJR D;  1HUN A;  2J7Z A;  4MZ9 A;  3PIO A;  2F4V L;  4A3G G;  3CCU A;  1RCV D;  1SNC A;  1TR5 A;  2JA5 G;  3HKZ G;  5A2Q E;  3GTG H;  1B9M A;  5JJI A;  1KAA A;  1W3S A;  2HDM A;  1STG A;  1Y1W G;  1WTH A;  4C1N I;  4KN4 C;  5LMN Q;  3VYU A;  5FLX L;  4A3K G;  4Y52 H;  3PV0 A;  3A56 A;  1W6K A;  1FD7 D;  1FNW A;  1LT3 D;  1J5E L;  2CWA A;  2CH4 W;  5ELD A;  2K14 A;  1XNQ Q;  3GTQ H;  5AJ3 Q;  4GNX C;  3S2H H;  3K80 C;  1SNP A;  4ZCK A;  2WP8 J;  4K2L A;  1EYC A;  3LWU A;  3E5S A;  5IWA Q;  4XXE A;  1PA6 A;  5C0X I;  1UNS A;  3PCO B;  3QIA A;  5KEE A;  4OEM B;  1YJ9 A;  3VR6 A;  1F9S A;  1B53 A;  1IBL L;  1YNX A;  2K5W A;  4KHZ A;  3TDQ A;  3I4M G;  3P7J A;  3HOX H;  4MN3 A;  3NTH A;  1YIT A;  2FXQ A;  2B63 G;  4A3M B;  2OXP A;  2R7Z B;  2R93 G;  1IYV A;  3R2I A;  1JT8 A;  2DNE A;  4X3T A;  2RHS B;  1O80 A;  4F88 A;  1HZA A;  3T1H Q;  2EYH A;  5DNF A;  2PNH A;  4QIW B;  1EIF A;  1EZ6 A;  2UU9 Q;  1T5X D;  4EGV A;  2G9H D;  2K1B A;  3EFX D;  2B2T A;  4DN4 M;  4LK1 C;  3I4N G;  4A3L G;  2R3Z A;  4G4K A;  1PYS B;  3MC0 B;  3CCS A;  1KRS A;  3FMC A;  1Y1V B;  3QR8 A;  1XPR A;  1X3Q A;  3CME A;  1WTQ A;  4ZK9 B;  4WOR A;  4K2K A;  1VQE A;  1JQY D;  1JWS D;  2B2V C;  1N34 Q;  1KRT A;  1NTG A;  2AQ2 B;  1KNA A;  1NUC A;  2E5L Q;  4H0L C;  2Q2T A;  3G71 A;  3G48 A;  2PMZ E;  1JJC B;  2MHV A;  3A5Z B;  3FEW X;  1IKL A;  4BY1 H;  2EYF A;  1QNU A;  2LSS A;  5GAE C;  4L5S A;  2O5I C;  5CBA E;  3QG1 A;  2HIV A;  2K52 A;  4OON A;  1HR0 Q;  2YTV A;  1E0B A;  1VQJ A;  3EA6 A;  2QIL A;  3MFY A;  4ILW A;  4IFD I;  2M00 A;  4ULL A;  4DAY B;  2IX0 A;  1JB7 A;  2KCN A;  3S1N B;  1EL0 A;  3GTJ B;  2H4O A;  1SFO B;  3Q23 A;  1PXU A;  3CRK C;  2VQF Q;  4C2M B;  1LAC A;  1FVI A;  1X3F A;  2QKI C;  3DHQ A;  1BUV T;  4OWT B;  3UE0 A;  1GUG A;  1XPU A;  1XPO A;  2JA8 B;  1B7Y B;  4AYB E;  3ICE A;  4CKC A;  2Q2U A;  1G6P A;  1TWG H;  3FKI G;  2KUM A;  4X65 L;  1EEF D;  1OXT A;  2PQE A;  1SYG A;  4NB3 A;  2F3W A;  3W1B A;  2RSO A;  1FYC A;  5C44 G;  2AUK A;  1HTL D;  4C3J H;  2E2H B;  5J22 A;  4JVZ A;  1WTV A;  4UP8 A;  3J7A V;  4A3B B;  1OO9 B;  1ET6 A;  2GVB A;  4KY5 A;  2KHS A;  3NEN A;  1XYI A;  1V9P A;  4LFA L;  4ZQ3 A;  2OF1 A;  3MA2 B;  1QUQ A;  1D5X C;  5C4J H;  3F1Z A;  5G3L D;  2J0T D;  4DR7 Q;  5IP7 H;  1PH6 A;  1EY6 A;  1EY5 A;  5LL6 S;  5IIF A;  2NVX B;  4JC0 A;  4EX5 A;  4UAI A;  3CCJ A;  2BDO A;  2AUJ D;  3WWV A;  1VQ6 A;  1X3E A;  1B44 D;  3NHH A;  4IFD H;  4JBW A;  5GAG C;  3J81 L;  5JPM C;  3GTO H;  1FNU A;  4MIU A;  2FFK B;  1ML0 D;  1GUW A;  1PYW D;  4JI6 L;  3J81 i;  4R4T A;  2ZXR A;  3H0G G;  1SE2 A;  3PUX A;  1WCM G;  4BY7 H;  2Q2H A;  1HNZ Q;  3RZO H;  2QDL A;  4DV1 L;  4DUZ Q;  4L63 B;  1M8A A;  3OMC A;  2WIN B;  4LNQ A;  5BN5 A;  4KN7 C;  4A3G H;  4HED A;  3AFQ A;  3K0X A;  3HOZ G;  4A75 A;  2JA5 H;  2UXB L;  1RJT A;  1KD1 C;  3L2P A;  5I9O A;  1C9O A;  1SMY C;  1VQ4 A;  1EWH A;  1D2B A;  2V4D A;  2NBF A;  1IBM Q;  1AH9 A;  2BOS A;  3A8J E;  1RF2 D;  4U68 A;  1ICF B;  3UDG A;  1Y1W H;  4Z9C B;  3KLW A;  3NTI A;  1ZYR D;  2BDN A;  2F3I A;  3ITP A;  1K0R A;  4A3K H;  3UDI A;  1S4Z A;  4JCV E;  2YTY A;  2LY7 A;  4IN3 A;  2CHB D;  2EY5 A;  5C0X J;  4LUZ A;  1CHP D;  1NMG A;  2NZH A;  1LM0 A;  3X3M A;  1G8Z D;  1X9N A;  1FR3 A;  1TWC B;  1IW7 C;  2K03 A;  3M4Y A;  4XIG S;  1C8C A;  1STH A;  4YHH L;  1HA6 A;  4RHS A;  4FVM A;  4HAE A;  3QOJ A;  2ZJQ A;  3RNU A;  2B3G A;  1IXR A;  2F1M A;  4L5T A;  4B9X A;  3IFT A;  1VQ5 A;  3A7L A;  3I4M H;  1XXG A;  1H9S A;  4G7O C;  4PNY A;  2Z9H A;  3TZD A;  4KD4 A;  2B2Y A;  1V8Q A;  3KDF B;  3OMG A;  2B63 H;  2UUB L;  2R93 H;  3S14 H;  2QW7 A;  2DY7 A;  4HTH A;  1F2M A;  4A3D G;  2Q8T A;  1EY9 A;  5CBE E;  3E3X A;  4DV4 L;  1VQ8 A;  3B6Y A;  1YHA A;  3J7Z C;  4JI2 Q;  1G91 A;  2MO1 A;  2K04 A;  4PZ6 A;  3I4N H;  4A3L H;  4QF4 A;  4R9W A;  4C3H B;  2RBM A;  4WJ4 A;  1SBB B;  1NJI C;  4HIK A;  2OTJ A;  2N88 A;  1KL9 A;  3I73 A;  1SR3 A;  4F87 A;  1HNW Q;  3CMA A;  2NVT H;  4XDX A;  1SJH D;  3W1G A;  5ELO A;  2DUD A;  1D7Q A;  2NZO A;  3CF5 A;  1KIX A;  1EWC A;  1RKN A;  4IAL A;  1K8M A;  3D31 A;  3NBI A;  2WB1 E;  3EN2 A;  4X3K A;  1ENA A;  3G6J B;  2OCE A;  3V96 A;  3A5U A;  2EIF A;  2BE5 D;  1K73 C;  2B2U A;  1SSO A;  5FO7 B;  1EFW A;  1LT4 D;  2KA7 A;  4DV6 Q;  2PZT A;  1VQC A;  2BA1 A;  3E6Z X;  2OT2 A;  4DR6 L;  3TRE A;  1EQQ A;  5KYL A;  1TWA H;  3RLF A;  2EPB A;  4POF A;  4JOI C;  3NWT A;  3GTL B;  1A2U A;  4JI1 L;  2VQE L;  1PFB A;  1YVC A;  4LF5 Q;  1Y69 U;  2WKC A;  1EY8 A;  3HP3 A;  2GA4 B;  1QZG A;  3M3Y H;  2ZXO A;  1EYA A;  3F2U A;  1HFN A;  3FKI H;  1WD0 A;  2PPB C;  1PRT B;  4P71 A;  4U67 3;  4DPG A;  5COR A;  2NVQ H;  5M5Y H;  5JVG 3;  3D3R A;  1I4X A;  1UUP A;  3H3V C;  5IOC A;  4I7A A;  1S5F D;  5HGT A;  3KF8 A;  4L5Q A;  3NPP A;  5C4X B;  3A0J A;  3M85 A;  4R4O A;  3S24 A;  4L6T B;  1TWF H;  4IJH A;  1PTO B;  2ID0 A;  3SGI A;  4DUY Q;  1YNJ C;  1EY0 A;  4J1M A;  2MUY A;  5C3E G;  3EIV A;  3U4V A;  1CQV A;  1HH2 P;  3AFP A;  4KKT A;  2Z6B A;  1IHZ A;  4TSS A;  4CDC C;  2VUM B;  1LTS D;  2JXM B;  4AYB G;  4K5W A;  3SVM A;  2JA6 B;  1EIY B;  3BVZ A;  3S16 H;  4R4Q A;  3GTM B;  1JB3 A;  3CCM A;  4DR4 Q;  2CCZ A;  4DV2 L;  1XNR Q;  2F3V A;  1CHQ D;  1EFI D;  3H0G H;  1WCM H;  4BBS B;  4OWX B;  2DNC A;  1PH2 A;  2O4X A;  3PO3 H;  4GNX A;  3HOY B;  5E4X A;  2WAQ B;  4GZY C;  3SK4 A;  3VDY A;  2PYK A;  2A69 C;  2ZM6 Q;  2A68 D;  3I4L A;  4ALP A;  1MSH A;  4RMF A;  2KHJ A;  2UUC L;  3QOL A;  1HJP A;  3CCL A;  1PTO C;  4QY7 A;  2JK8 A;  3K57 A;  4S3S A;  2VXW A;  2EYL A;  4QUC A;  1WTW A;  1R4Q B;  2ZT9 C;  5I6Y A;  5E3F A;  2SNM A;  4ME5 A;  1TVX A;  2CQA A;  3RLN A;  5K36 G;  2EY2 A;  3K58 A;  2CW0 D;  1I4G A;  4QB4 A;  4HMI A;  5D3D A;  4KK7 A;  2M2L A;  3H09 A;  1BCP F;  3OWE B;  4X62 L;  1Y8P B;  1B1Z A;  3BG3 A;  3OIP A;  3GTK B;  1EQR A;  1PRT F;  1KC8 C;  3E0E A;  1I94 Q;  4JI3 Q;  1HUM A;  4N8F A;  1Q8I A;  1E2V A;  4GLV B;  2SOB A;  2B2V A;  2RCN A;  1ZEQ X;  3QO2 A;  4K8J A;  4DR7 L;  2OQ0 A;  1I3Q B;  4Q0F A;  4B3S L;  3H91 A;  4A3M H;  2R7Z H;  3D4W A;  3HOW G;  1YNN C;  2E74 C;  1N36 L;  1LTB D;  3PIO 3;  1XMQ Q;  4JBK A;  1YHQ A;  1A8V A;  4K0K L;  3I91 A;  4JI5 Q;  2QEJ C;  1K83 B;  3E9H A;  3GV6 A;  3TZU A;  1K0S A;  4K14 A;  1Z7T A;  4RAU C;  5AFW A;  1A0I A;  1H9R A;  1FJG Q;  2J4X A;  4RCN A;  5EPK A;  5IYB G;  2Z6K C;  1AP0 A;  1KQS A;  1KAW A;  1SNQ A;  2ENB A;  1OTC A;  4C56 C;  1X3G A;  4HCS A;  1A2T A;  1NBW A;  1S40 A;  3TS2 A;  3M4O H;  1AE3 A;  2NN6 H;  4BBR B;  3T56 B;  5D65 A;  1RDP D;  2N3S A;  1X56 A;  4KI0 A;  1M1K C;  2HUG A;  1K8O A;  1QVG A;  4IUU A;  3VR3 A;  1XMO Q;  2R92 G;  3L7Z C;  5FKA C;  1VQF A;  5CV8 A;  4HIM A;  5DAU A;  2K6A A;  3TP8 A;  1KHI A;  1SFO H;  4L5R C;  2EJF C;  3D4D A;  1TU2 B;  2JA7 B;  4C2M H;  4DAY A;  1UE1 A;  2M9V A;  4PZ8 A;  2QGQ A;  3KF6 B;  4A93 G;  2JEA I;  1G6Z A;  4X6A H;  1WTR A;  4GKK Q;  1RHP A;  1TQO A;  3Q8D A;  5LMN W;  3OPO A;  5C5L A;  1M4V A;  1SN8 A;  1I4P A;  2RA4 A;  3KUP A;  1HZC A;  5HGQ A;  4A3J B;  2VL6 A;  4OEL B;  5KIX A;  2F0V A;  3S1R B;  3G7L A;  1U4L A;  4YWK A;  4OWW B;  4XTC S;  3I8Z A;  1B8A A;  3PO2 B;  2WB1 G;  3CXC A;  1H95 A;  3VYR A;  2PO4 A;  5M3F B;  4BY7 G;  3OTO Q;  1BF4 A;  2NUC A;  4UY8 C;  1J6Q A;  4YY3 Q;  4B3T Q;  1NR2 A;  2JYO A;  5I4D A;  4A3B H;  3MXN B;  1GUT A;  1MIU A;  2MFI A;  2EVB A;  3HEJ A;  2A6H C;  5IOD A;  2L4N A;  4LUV A;  3J80 c;  3R8B A;  5C3E H;  1XJV A;  1JOK A;  2FJ2 A;  3I56 A;  1ONL A;  1EQV A;  4DV0 Q;  2HIX A;  3F2D A;  4ID6 A;  1Q82 C;  1NY4 A;  1Q3L A;  1VS0 A;  5IYC G;  4QIW E;  4X64 Q;  1C0A A;  3MXP A;  2F0K A;  1XTC D;  1WTX A;  3SR1 A;  1PH8 A;  1Y8O B;  2F0N A;  1C7Y A;  2QF7 A;  3TP6 A;  3RZD B;  2R7D A;  1D8L A;  5JEA G;  3DMU A;  2KCM A;  3MHB A;  1QNK A;  5ELB A;  1F2Z A;  4R8N A;  1O7Z A;  4NXN L;  2IY5 B;  2EXZ A;  5C4Z A;  1W2B A;  2BH2 A;  4J15 A;  1N9W A;  1LAB A;  3TP5 A;  2C35 B;  3CKI B;  3UDX A;  5KYI A;  4A3E B;  1HFG A;  2EQS A;  1HTP A;  1SE4 A;  4DV3 Q;  4N9P A;  2AWN A;  1HR0 W;  2A6E C;  4QGU A;  1TII D;  4B3R Q;  4IUN A;  4NXM Q;  2L9H A;  2F4I A;  1MI2 A;  1Z9F A;  1A62 A;  2AQ3 B;  3TSS A;  1JWM D;  1YHB A;  4RKB A;  4DV5 Q;  4LF5 L;  4LAA A;  2EJM A;  3CC4 A;  1SJE D;  1H9J A;  1HCZ A;  2KJX A;  4HID A;  1ROD A;  3HOV G;  4XT3 B;  2I5H A;  1STN A;  5K36 H;  2K05 A;  2E76 C;  4B3M L;  1CI3 M;  4AQY Q;  2E2I B;  5T1G A;  3WOE A;  5IGD A;  4ZKC B;  1J9O A;  1QWY A;  1DON A;  1GHK A;  3VR5 A;  1KLU D;  2HHH Q;  4GKJ Q;  1O7L A;  1SYD A;  4DK3 C;  1HNX L;  1R4P B;  1TY0 A;  3EBE A;  1STB A;  5FO8 B;  1N33 Q;  2F0J A;  4BA1 I;  1PZI D;  5EPJ A;  2EXD A;  4JI0 Q;  1FGB D;  3DLL A;  3EQL C;  4NMZ A;  2HQL A;  4LFB Q;  4NP5 A;  3MWY W;  3IAY A;  1YJW A;  5FOB B;  1HZB A;  3HOW H;  1PHJ A;  2DGY A;  4POG A;  1AFP A;  2UXD L;  3E9I A;  2JEB I;  1GUN A;  4JI8 L;  1JOO A;  3KDF A;  3VYS A;  4LF8 Q;  2E2D C;  4XYQ A;  2DN8 A;  5DM6 3;  4OX9 Q;  1I6H B;  4DAM A;  1BDO A;  2ICE C;  3T16 A;  3A55 A;  4C3H H;  4LF6 Q;  1KAB A;  1YI2 A;  4LFC L;  5IYB H;  4JOI A;  2F52 A;  1Q7Y C;  1CFM A;  1HHV A;  3J80 E;  2C9O A;  3RN2 A;  3SE0 A;  2LMC B;  2EZV A;  5A35 A;  1TS5 A;  4H44 C;  1JOQ A;  1S5D D;  1I50 B;  4RGO S;  2EYO A;  3J7A 5;  2RDH A;  4NKL A;  1V1Q A;  2F0Q A;  4LF7 Q;  4IOA A;  5EKI A;  1PZK D;  3H3V H;  1FNV A;  3ND9 A;  2R92 H;  1VQI A;  2K75 A;  2UXC L;  1OXS C;  1YEZ A;  4KJO A;  4DR1 L;  3S15 B;  1IYU A;  1E22 A;  4A3I B;  2CFM A;  4MTK A;  2F0U A;  4Y7N B;  2XWB B;  4P72 A;  1N32 Q;  4A93 H;  2F0S A;  1SMY D;  2NVY B;  1ET9 A;  1VF7 A;  3GTL H;  2KEN A;  2PZW A;  4HJ9 A;  3LNN A;  2RQX A;  4A3F B;  1NNX A;  3G4S A;  2LS0 1;  3NEL A;  3I3C A;  4DV7 L;  4KHP Q;  5DLQ E;  4O2D A;  1D5Z C;  4DFA A;  3CP0 A;  5H1S E;  2Q2I A;  1PFM A;  4G57 A;  1SNM A;  1DD2 A;  4LWC A;  1IW7 D;  3Q24 A;  4DR2 L;  3PF5 A;  1UAP A;  1BO0 A;  2F0F A;  3PO3 G;  3NK9 A;  1V43 A;  1PH5 A;  2I46 A;  2K33 A;  4JV5 L;  2QCP X;  4N9T A;  1SYC A;  3T1Y Q;  4LF9 L;  4DNT B;  4RCO A;  1ESF A;  3J81 j;  2L15 A;  4R1J A;  4WFN 3;  2EY1 A;  2RDG A;  1PTO H;  3P1H A;  1QIL A;  3S1M H;  1EEI D;  1SNO A;  1PFN A;  3CW2 C;  2D2C C;  4YWL A;  4LJZ C;  1ILQ A;  2H5X A;  5BR8 L;  3AB9 A;  5IYC H;  1PFS A;  5FJ8 H;  2QA4 A;  4KHV A;  1MD2 D;  3STB C;  2Y0S E;  3HOX B;  4X66 Q;  3NQI A;  2BA0 A;  3PUY A;  3GTM H;  1IZ6 A;  1N8R C;  5JEA H;  5EBC A;  4HMJ A;  5IGC A;  4OL7 A;  3KLS X;  5C6A A;  2F0P A;  3TBI B;  1HPC A;  3F2C A;  1IBK Q;  4A4I A;  2UUA Q;  3MEH A;  4DR5 L;  2G9D A;  3K7A H;  2R7F A;  1E1T A;  1B50 A;  4EVO A;  1A63 A;  1EQT A;  3OYY A;  1E2Z A;  4UP7 A;  4P75 A;  3DM3 A;  1MSG A;  1VQ7 A;  2HDL A;  2RDF A;  1BVS A;  1TWH H;  5ISR A;  1GKH A;  2FHT A;  4FP5 D;  3BVG A;  1SMX A;  4A3M G;  2R7Z G;  4GKK L;  1CA5 A;  5LMU L;  1F9P A;  3HOV H;  5JAV A;  3LWE A;  3Q6S A;  4UDU C;  2Y0S B;  3N52 A;  4GN3 B;  1WI5 A;  3JC6 6;  4BY1 B;  1C48 A;  2F0H A;  3MFG A;  3CCV A;  1LYL A;  3G6E A;  2N49 A;  3CPF A;  1SND A;  1A15 A;  1NSN S;  1KNE A;  5JPN C;  5G3L F;  2F0O A;  4BWG B;  2JP1 A;  3ER0 A;  4J8Q A;  1VQN A;  2PI2 A;  4JI4 Q;  4ME3 A;  3BU2 A;  4QCL A;  1Y1V G;  2A19 A;  4JYA L;  4OIK A;  4KTA A;  1D1K A;  1SEB D;  4YY3 L;  3RLO A;  1ZYR C;  2F4V Q;  1SAP A;  3SDZ A;  4L8J A;  1CKN B;  4XYO A;  1CSP A;  2L12 A;  2SDF A;  2Z6K A;  5CV6 A;  5ELN A;  2AWO A;  5DEH A;  4IFD J;  2D62 A;  2NN6 G;  2VB2 X;  4CDF C;  2IHE A;  3N6R A;  1B2T A;  3A8K E;  1PH4 A;  4FF1 A;  4RHR A;  4P74 A;  5KNC A;  4E6I A;  3K5N A;  4DV0 L;  3NE5 B;  3EJI A;  5LMN L;  4OXP A;  1J5E Q;  3NUC A;  1IL8 A;  1K83 H;  1L0X B;  2VZA A;  1L2F A;  1ASZ A;  4C3J B;  1YNJ D;  5FLM G;  4JW0 A;  1XNQ L;  1HRJ A;  5ELF A;  5AJ3 L;  5K5P A;  3A8I E;  1BQQ T;  2EE1 A;  5HY6 A;  2BH8 A;  4XQJ A;  5IWA L;  2JA8 G;  1HQM C;  2X69 A;  1IBL Q;  4DR3 Q;  4MNO A;  1U4M A;  1KTK A;  1QE6 A;  1BCP B;  2N8N A;  5C4J B;  1XX8 A;  3U50 C;  1TS4 A;  1Z6H A;  3KOJ A;  2Z4H A;  3KBX A;  3MXG A;  3DWQ A;  2E2J H;  2WV6 D;  1D1I A;  4A3C H;  1VQ9 A;  1SE3 A;  1NCV A;  1W6J A;  2DY8 A;  1L1O B;  4IUT A;  3PMF A;  3GP7 A;  5EJW A;  3W2D A;  4NXM L;  4CDE C;  3BDC A;  2KCT A;  1LV9 A;  2PCF B;  4YCW A;  4EQ5 A;  3T1H L;  2WAQ E;  3SK6 A;  1STA A;  3GTO B;  4GN4 B;  4A3B G;  3K0Y A;  4YWM A;  4KD3 A;  2JA9 A;  2UU9 L;  1CZW A;  3GV3 A;  2QEX A;  1R9T B;  1G29 1;  3PUW A;  1CKO A;  2O2L D;  1PTO D;  1DOL A;  3AMU A;  2JA7 H;  2Z0S A;  1F2L A;  2YYZ A;  3IL8 A;  1YBY A;  1G2S A;  1SYE A;  2BE5 C;  3MAQ A;  4RA8 A;  3CD6 A;  3JAM c;  3CCR A;  2Z8L A;  4R8I A;  3TEH B;  3BZK A;  4IUP A;  1PH1 A;  2PI2 E;  4A3F G;  3KF6 A;  1N34 L;  5CR3 A;  3CQZ B;  2JA5 B;  2EYP A;  1J8I A;  1ZKO A;  2IT1 A;  2KHI A;  2E5L L;  1BCP C;  1MGS A;  1V1O A;  3VA5 A;  3S1R H;  1DOM A;  1LO5 D;  1MKH A;  1PRT C;  5IT9 c;  4I65 A;  3PO2 H;  2OEO A;  3X3N A;  1PDQ A;  2JQO A;  5CGK A;  5M5X B;  1HR0 L;  1K8G A;  3TN2 A;  1L1O C;  3T51 B;  4A3K B;  4R4C A;  1DM0 B;  5KNB A;  5TSS A;  3TQY A;  4IJL A;  3DUZ A;  4ZYS A;  4LF8 L;  2HCI A;  2KEC A;  2VQF L;  1WYD A;  2XGT A;  2NYZ D;  3MXN A;  1WD1 A;  3K5M A;  3TS0 A;  5GQO A;  3TP7 A;  3BZC A;  2EYM A;  4JG2 A;  2DJF C;  3DEO A;  5CV5 A;  4X65 Q;  3WOF A;  3MTS A;  5GRO A;  2NN6 I;  3A7A B;  5EKL A;  2R93 B;  3S14 B;  1YJN A;  3NWS A;  5BN3 A;  2L1B A;  1A6X A;  2LXK A;  3FPP A;  3RMH A;  1LUZ A;  2XIW A;  5HUR A;  1NE3 A;  3K5O A;  1NMF A;  1WVL A;  1MJC A;  4O1N A;  4KKS A;  4LW1 A;  3C3L A;  1IKM A;  4LFA Q;  1EUJ A;  1CTM A;  1TXY A;  1RL2 A;  5CV9 A;  5F2D A;  4JPB W;  5D14 A;  4DK6 C;  1TS2 A;  1TS3 A;  4XT1 B;  4IOC A;  2F0E A;  5IGF A;  1JE5 A;  1UEA B;  3NTK A;  2NVT B;  1DXM A;  1GHJ A;  5EPL A;  1BKB A;  2F0M A;  2MPM A;  4HIO A;  2F03 A;  2A68 C;  4KJN A;  3S2D B;  4KHP L;  1V1P B;  2RKS A;  2V1C C;  2Y0S G;  4JI6 Q;  2NZ1 D;  5I9P A;  2KOL A;  1U5K A;  3CHB D;  1CK1 A;  3L3O C;  1D5M C;  1E7Z A;  1K3B C;  3T4A C;  4WRD A;  4C3H G;  5EGT A;  4HSP A;  4DV1 Q;  3PUV A;  4BS9 A;  1Y1V H;  2D9U A;  1GO3 E;  5CMD A;  1UEB A;  1LT5 D;  1VQM A;  2IL8 A;  1HNZ L;  4IPD A;  4DUZ L;  1LTG D;  4Q5V A;  4ZUJ A;  4FF3 A;  4O0A A;  1GJX A;  3NBH B;  1TWA B;  5GAH C;  2RSN A;  2NTT A;  1K28 A;  2UXB Q;  3M4Q A;  3OIQ A;  4IUV A;  2LXJ A;  4DK0 A;  2IX3 A;  4LMQ D;  3JAM E;  3RUZ A;  5A2Q L;  1A3U A;  1JIC A;  1IBM L;  3M3Y B;  3ND8 A;  1QB5 D;  4DNR B;  3J7A F;  2EOT A;  3FKI B;  5IGG A;  3W5O A;  1VQD A;  3BYT B;  1B3A A;  3CC7 A;  3S1N H;  5JJK A;  3AEV A;  1GD7 A;  3HKS A;  3GTJ H;  4BA2 I;  5C44 B;  4DXG A;  2JE6 I;  2MP1 A;  1IL2 A;  3CPW A;  5M5Y B;  5IT9 E;  2IJ0 A;  5FLM H;  2R61 A;  4RFB A;  4IUR A;  2FMC A;  1QOH A;  4XQN A;  4YHH Q;  1I6H H;  2HD3 A;  2JA8 H;  1EWI A;  4LF4 Q;  4QMG A;  5I6W A;  5FO9 B;  1UWV A;  2UUA L;  3A54 A;  1TWF B;  4JK1 C;  1X32 A;  4DAP A;  5C3X A;  4WJW A;  3Q22 A;  5FLX c;  4DA2 A;  1ENC A;  1CSQ A;  3M4P A;  3GQB A;  5IP9 G;  1A3V A;  1O78 A;  2H1E A;  3HG9 A;  3RR5 A;  1I4Q A;  1E2W A;  2VS1 A;  4OO1 G;  2E2H H;  2KVM A;  4DV4 Q;  3U58 A;  2PW5 A;  3E0J A;  2ZJP A;  4K6L A;  3S15 H;  5C4X G;  2A5H A;  4DKA C;  4V0B A;  5M3M B;  4JI2 L;  3H0G B;  3I55 A;  1WCM B;  1Q90 A;  1Z47 A;  5EQ0 A;  4Y7N H;  1Q1E A;  4FNF A;  3VA7 A;  1EIH A;  2AKW B;  2BCO A;  1YZ6 A;  4UHV A;  2NVY H;  1UE6 A;  2XTI A;  3CRL C;  2I0Q A;  2NVX H;  4JI4 L;  1HNW L;  1QVF A;  2VUM G;  3I72 A;  3HOZ B;  4EQN A;  3TRZ A;  5FJ8 G;  3UI2 A;  4PQX A;  4A3F H;  5COY A;  3P20 A;  4BXX G;  2JA6 G;  1AZQ A;  1JJG A;  2F0T A;  4X3S A;  1CT1 D;  4DU9 A;  1PV4 A;  5EAY A;  3D0F A;  1KLG D;  2N55 A;  1GXD C;  2D0P A;  4BBS G;  1I6V C;  2XNA C;  4C3I B;  3FPU B;  1X3P A;  2JJQ A;  3EVQ A;  3H6M A;  3HOY G;  2WAQ G;  5EKK A;  4DR6 Q;  4GOP B;  4DV6 L;  1L0Y B;  3GTP B;  1ZXT A;  4TRD A;  3LX0 A;  3UDF A;  4JI1 Q;  2VQE Q;  1WTP A;  3I7F A;  2IPK D;  3QJY A;  4FDB A;  1D6E C;  4H7B A;  4RGN A;  2K5H A;  2NTS A;  2CVR A;  4FF2 A;  2YV5 A;  4ZLT F;  3BDO A;  2KQ3 A;  1S3O A;  2K5D A;  5IYD G;  5CC4 A;  4DR3 L;  3NSW A;  2K01 A;  4TKO B;  5IGB A;  4IO9 A;  4F8M A;  2C5C A;  3J80 L;  2IHF A;  3DWA A;  3H3V I;  1E24 A;  4A3D B;  3L0O A;  5ELE A;  1ICW A;  1TWC H;  4N8X 1;  3J80 i;  2OTL A;  2HQE A;  1LTT D;  3AYH B;  1QG7 A;  1LTR D;  3FRP B;  2VNU D;  4PMB A;  2I07 B;  2I5M X;  2PQA B;  1KDB A;  3RD4 A;  1BBU A;  1SXT A;  3H15 A;  5J3B A;  4O42 A;  2JSO A;  1U4R A;  2IWH A;  3S1Q B;  4DUY L;  4GOP C;  4V19 0;  2DJG C;  4FXK C;  2L55 A;  1DOK A;  2SEB D;  3DXJ C;  5C4H A;  2AMC B;  5I2X A;  3CU7 A;  1MHW C;  5FLX E;  4MHE A;  3M9B A;  3OW2 A;  3CCQ A;  3NP8 A; 
#chains in the Genus database with same CATH homology
 4YIJ A;  3M4O B;  2YU9 B;  1PZJ D;  1LTI D;  2EJG C;  4OO1 I;  3HOU B;  2EDG A;  3FVQ A;  3VYT A;  5M5W B;  5C0X H;  5JOB A;  3K6O A;  3BVM A;  1EYD A;  3S17 B;  1SYF A;  3J7Y W;  3W3A A;  2AQ1 B;  2NB0 A;  1DYQ A;  2XVS A;  2O5J C;  3S9W A;  4KY7 A;  4PV1 C;  3U9S A;  1XWE A;  4G7Z C;  1LTA D;  3KBG A;  4PMW A;  2B2W C;  1H9M A;  2F0L A;  2KED A;  2PMZ B;  4HN7 A;  1HXY D;  2X6G A;  1BBX C;  4B9W A;  4K8I A;  2E75 C;  1KDA A;  2R6G A;  2HCC A;  2LKV A;  4NW2 A;  5C3E B;  3GTG B;  2WKD A;  1HQR D;  4IQZ A;  4AYB B;  4OO1 H;  2MJ8 A;  5DM7 3;  5C3W A;  1JC7 A;  4G7H C;  3GTQ B;  5CYU A;  3S2H B;  3ERO A;  3D6C A;  2F0G A;  4KMU C;  3V2T A;  1QCB D;  1BR9 A;  4M1U B;  3IKJ A;  5CV7 A;  4ABN A;  2Q8R E;  1Q12 A;  1I4H A;  1OXU A;  1T5E A;  1JOR A;  3D4R A;  2RVL A;  2K28 A;  4CHT B;  1AW7 A;  3HZX A;  5FK9 C;  1VMC A;  4DK1 A;  2B39 A;  4RKL A;  4F7X A;  3IFD A;  3C46 A;  3I90 A;  2A73 B;  3FDT A;  5NUC A;  2EYJ A;  3QB3 A;  3MVV A;  4ODG A;  4C3I G;  3TME A;  3O13 A;  1F9Q A;  1EIG A;  2LFN A;  2XSC A;  2ICI A;  5JVH 3;  2B8F A;  1VMP A;  2PNR C;  3GO5 A;  3D8G A;  1OXX K;  3T53 B;  3J81 E;  3Q0A A;  2XRS D;  1DCZ A;  1EOT A;  1WTO A;  2KCC A;  4IUQ A;  3SEB A;  5IGE A;  3KLR A;  4ZKB B;  3C1E A;  3HRZ C;  3T13 A;  1RD9 D;  2L0C A;  4RGM A;  1GUS A;  3HOW B;  5KND A;  4J6H A;  5EBD A;  1VDZ A;  2B2T C;  2FMM A;  3C2P A;  4ZAI A;  1S5B D;  4FF4 A;  2SNS A;  3DWP A;  3R3O A;  1RTN A;  4HSV A;  5KRU A;  4HCE A;  1BOS A;  2ZXP A;  1TWG B;  1JWU D;  4FXD A;  4IZ8 A;  1G2T A;  4DXF A;  4I7Z C;  1JE4 A;  4B08 A;  2R92 B;  2K7V A;  3HS0 C;  1Y8N B;  3KK7 A;  5E1F A;  4CJ0 B;  1Q1B A;  1LLR D;  1V1P A;  3GD7 A;  2F0D A;  1KDC A;  4OHJ A;  4A93 B;  1BCP D;  3OSO A;  5C5M A;  5M9O A;  5D3I B;  3BDL A;  2TMP A;  1PRT D;  3KLS A;  1RTO A;  2PW7 A;  3OW7 A;  1PMR A;  3NBH A;  5E4W C;  5ELC A;  3OOC A;  5JEA J;  3D6W A;  4QUF A;  2Z4I A;  2A69 D;  1VCI A;  3OHX C;  5J39 A;  1TKW B;  3BYY B;  2WB1 B;  2XN9 C;  4BY7 B;  2F0W A;  1SYB A;  4ZRZ A;  3RZO B;  2PZU A;  2K5Q A;  4A3G B;  1BNZ A;  4EQO A;  4P2C B;  3URY A;  3HKZ B;  3R2T A;  3S1M B;  3ZYY X;  4DAV A;  4CKB A;  2Q8I B;  1Y1W B;  5T1I A;  3U9O A;  3PUZ A;  1AEX A;  1AZP A;  3K59 A;  1B9N A;  2XRQ D;  4OIJ A;  4ZUI A;  1NR4 A;  3C1F A;  2QDB A;  2Z1C A;  1MBY A;  2WII B;  2TSS A;  5CV4 A;  1H9S B;  5BN4 A;  1II3 A;  3SK8 A;  4HR7 B;  1TT2 A;  1YNN D;  3K7A B;  3DM1 A;  4FO2 A;  1BXT A;  1GOZ A;  4K6D A;  3I4M B;  3P75 A;  1AN8 A;  4TQU S;  2EY6 A;  2B63 B;  1U4P A;  3L9A X;  1TWH B;  1C4Q A;  4DGZ A;  3M7G A;  4K5V A;  1NAP A;  4DF7 A;  1STY A;  1CZG A;  3HOV B;  4H13 C;  3JAM L;  2FIN B;  3ONA B;  3SXH A;  5LL6 X;  2NWG A;  3I4N B;  3DEP A;  1VF5 C;  1CQF A;  3I70 A;  3NXW A;  5LHY 1;  1CM9 A;  4RWS C;  1DZ1 A;  2IX1 A;  4FXG C;  1U9R A;  5IT9 L;  1EY4 A;  4RH6 A;  1CA6 A;  1B4O A;  3OWF A;  1ESR A;  1LT6 D;  2B2Y C;  1JCK B;  3H94 A;  1SDF A;  3K5L A;  1A3T A;  5I2Y A;  3AU7 A;  3SHL A;  4CBV A;  1S5C D;  1S5E D;  3HGB A;  2WAC A;  1PTO F;  4CJ1 B;  1F77 A;  4RGT A;  3R93 A;  2KEE A;  5C0X G;  4M8A A;  1EU4 A;  4KV6 A;  2CW0 C;  1JR0 D;  1ILP A;  3V05 A;  4FYD A;  1H9K A;  2D5D A;  2K32 A;  1F2Y A;  3VR4 A;  2A74 C;  3MXU A;  2L11 A;  3SK5 A;  1EZ8 A;  2E2J B;  2A6H D;  2NVQ B;  1PLF A;  1O7Y A;  1I4R A;  2B2W A;  2B8G A;  5JJZ A;  2B2U C;  4C3J G;  1EY7 A;  4XQQ A;  4CJ2 C;  4C1N K;  2F0I A;  1ENF A;  3NQT A;  3ERQ A;  3M7N A;  2IW3 A;  1GUO A;  1STE A;  2XWJ B;  5J1Z A;  1EU3 A;  4K5X A;  4OGQ C;  3BS1 A;  4KKU A;  2L5T A;  5KGU A;  3VR2 A;  2VB3 X;  1QJO A;  4PMC A;  3MZ5 A;  4CGY B;  3S16 B;  4IFD G;  4CKE A;  3QWN A;  4KY6 A;  4NDX A;  4EQP A;  1HA5 A;  2A6E D;  3BZD B;  3WDN A;  3PO3 B;  2MGS A;  1F9R A;  1OXV A;  2X6L A;  3PIP 3;  4X3U A;  1TY2 A;  1DJR D;  1HUN A;  2J7Z A;  1RCV D;  1SNC A;  1TR5 A;  5A2Q E;  1B9M A;  1KAA A;  2HDM A;  1STG A;  4C1N I;  4KN4 C;  3VYU A;  5FLX L;  3PV0 A;  3A56 A;  1W6K A;  1FD7 D;  1FNW A;  1LT3 D;  5ELD A;  1SNP A;  2WP8 J;  4K2L A;  1EYC A;  3LWU A;  3E5S A;  4XXE A;  5C0X I;  1UNS A;  3QIA A;  5KEE A;  3VR6 A;  1F9S A;  1B53 A;  2K5W A;  4KHZ A;  3TDQ A;  3P7J A;  4MN3 A;  3NTH A;  4A3M B;  2OXP A;  2R7Z B;  1IYV A;  3R2I A;  2DNE A;  4X3T A;  4F88 A;  1O80 A;  2EYH A;  5DNF A;  4QIW B;  1EZ6 A;  1T5X D;  4EGV A;  2G9H D;  2K1B A;  3EFX D;  2B2T A;  4DN4 M;  4LK1 C;  2R3Z A;  4G4K A;  3MC0 B;  3FMC A;  1Y1V B;  1X3Q A;  1WTQ A;  4ZK9 B;  4WOR A;  4K2K A;  1JQY D;  1JWS D;  2B2V C;  2AQ2 B;  1KNA A;  1NUC A;  4H0L C;  2MHV A;  3FEW X;  1IKL A;  2EYF A;  1QNU A;  2O5I C;  5CBA E;  3QG1 A;  3EA6 A;  1E0B A;  2QIL A;  3MFY A;  4ILW A;  4IFD I;  2M00 A;  4ULL A;  2IX0 A;  2KCN A;  3S1N B;  1EL0 A;  3GTJ B;  2H4O A;  1SFO B;  3Q23 A;  1PXU A;  3CRK C;  4C2M B;  1LAC A;  2QKI C;  3DHQ A;  1BUV T;  1GUG A;  2JA8 B;  4CKC A;  2KUM A;  1EEF D;  1OXT A;  2PQE A;  1SYG A;  2F3W A;  2RSO A;  1FYC A;  2AUK A;  1HTL D;  2E2H B;  5J22 A;  1WTV A;  3J7A V;  4A3B B;  1OO9 B;  1ET6 A;  4KY5 A;  2KHS A;  1XYI A;  4ZQ3 A;  2OF1 A;  3MA2 B;  1D5X C;  5G3L D;  2J0T D;  1EY6 A;  1EY5 A;  5LL6 S;  5IIF A;  2NVX B;  4UAI A;  2BDO A;  2AUJ D;  1B44 D;  3NHH A;  4IFD H;  4JBW A;  3J81 L;  5JPM C;  1FNU A;  4MIU A;  2FFK B;  1ML0 D;  1GUW A;  1PYW D;  2ZXR A;  1SE2 A;  3PUX A;  4L63 B;  1M8A A;  3OMC A;  2WIN B;  5BN5 A;  4KN7 C;  4HED A;  1RJT A;  5I9O A;  1SMY C;  1EWH A;  1D2B A;  2V4D A;  2NBF A;  2BOS A;  3A8J E;  1RF2 D;  4U68 A;  4Z9C B;  3NTI A;  1ZYR D;  2BDN A;  3ITP A;  1S4Z A;  2LY7 A;  4IN3 A;  2CHB D;  2EY5 A;  5C0X J;  1CHP D;  3X3M A;  1G8Z D;  1FR3 A;  1TWC B;  1IW7 C;  2K03 A;  3M4Y A;  4XIG S;  1C8C A;  1STH A;  1HA6 A;  4RHS A;  4FVM A;  4HAE A;  3QOJ A;  4B9X A;  2F1M A;  3IFT A;  3A7L A;  1XXG A;  1H9S A;  4G7O C;  4PNY A;  3TZD A;  4KD4 A;  2B2Y A;  1V8Q A;  3OMG A;  2DY7 A;  4HTH A;  1F2M A;  2Q8T A;  1EY9 A;  5CBE E;  1G91 A;  2K04 A;  4QF4 A;  4R9W A;  4C3H B;  2RBM A;  1SBB B;  2N88 A;  3I73 A;  4F87 A;  4XDX A;  1SJH D;  1EWC A;  1RKN A;  4IAL A;  1K8M A;  3D31 A;  3NBI A;  4X3K A;  1ENA A;  3G6J B;  3V96 A;  2BE5 D;  2B2U A;  1SSO A;  5FO7 B;  1LT4 D;  2KA7 A;  2PZT A;  2BA1 A;  3E6Z X;  2OT2 A;  5KYL A;  3RLF A;  2EPB A;  3NWT A;  3GTL B;  1A2U A;  1PFB A;  1Y69 U;  2WKC A;  1EY8 A;  3HP3 A;  2GA4 B;  2ZXO A;  1EYA A;  3F2U A;  1HFN A;  1WD0 A;  2PPB C;  1PRT B;  4U67 3;  5COR A;  5JVG 3;  3D3R A;  1I4X A;  1UUP A;  3H3V C;  5IOC A;  5HGT A;  1S5F D;  3KF8 A;  3NPP A;  5C4X B;  3M85 A;  4L6T B;  1PTO B;  2ID0 A;  1YNJ C;  1EY0 A;  4J1M A;  2MUY A;  1CQV A;  4KKT A;  1IHZ A;  4TSS A;  2VUM B;  1LTS D;  2JXM B;  4K5W A;  3SVM A;  2JA6 B;  3BVZ A;  3GTM B;  1JB3 A;  2F3V A;  1CHQ D;  1EFI D;  4BBS B;  2DNC A;  2O4X A;  3HOY B;  5E4X A;  2WAQ B;  4GZY C;  3SK4 A;  2PYK A;  2A69 C;  2A68 D;  3I4L A;  1MSH A;  3QOL A;  1PTO C;  3K57 A;  4S3S A;  2VXW A;  2EYL A;  4QUC A;  1WTW A;  1R4Q B;  2ZT9 C;  5I6Y A;  5E3F A;  2SNM A;  4ME5 A;  1TVX A;  2CQA A;  5K36 G;  2EY2 A;  3K58 A;  2CW0 D;  1I4G A;  4QB4 A;  4HMI A;  5D3D A;  4KK7 A;  2M2L A;  3H09 A;  1BCP F;  3OWE B;  1Y8P B;  1B1Z A;  3BG3 A;  3OIP A;  3GTK B;  1PRT F;  1HUM A;  1Q8I A;  1E2V A;  2SOB A;  2B2V A;  1ZEQ X;  3QO2 A;  4K8J A;  1I3Q B;  4Q0F A;  3H91 A;  3D4W A;  1YNN C;  2E74 C;  1LTB D;  3PIO 3;  3I91 A;  2QEJ C;  1K83 B;  3GV6 A;  3TZU A;  4K14 A;  1Z7T A;  4RAU C;  5AFW A;  1H9R A;  2J4X A;  4RCN A;  5EPK A;  1AP0 A;  1SNQ A;  2ENB A;  4C56 C;  4HCS A;  1A2T A;  2NN6 H;  4BBR B;  3T56 B;  5D65 A;  1RDP D;  4KI0 A;  2HUG A;  1K8O A;  4IUU A;  3VR3 A;  3L7Z C;  5FKA C;  5CV8 A;  5DAU A;  2K6A A;  3TP8 A;  2EJF C;  3D4D A;  1TU2 B;  2JA7 B;  4DAY A;  2M9V A;  2JEA I;  1G6Z A;  1WTR A;  1RHP A;  1TQO A;  3OPO A;  5C5L A;  1M4V A;  1I4P A;  2RA4 A;  3KUP A;  4A3J B;  5KIX A;  2F0V A;  3S1R B;  3G7L A;  1U4L A;  4XTC S;  3I8Z A;  3PO2 B;  3VYR A;  2PO4 A;  5M3F B;  1BF4 A;  2NUC A;  1NR2 A;  2JYO A;  5I4D A;  1GUT A;  2EVB A;  3HEJ A;  2A6H C;  5IOD A;  2L4N A;  3R8B A;  1JOK A;  2FJ2 A;  1ONL A;  1EQV A;  4ID6 A;  1Q3L A;  3MXP A;  2F0K A;  1XTC D;  3SR1 A;  1Y8O B;  2F0N A;  2QF7 A;  3TP6 A;  3RZD B;  5JEA G;  3DMU A;  3MHB A;  1QNK A;  5ELB A;  1F2Z A;  4R8N A;  1O7Z A;  2EXZ A;  5C4Z A;  1LAB A;  3TP5 A;  3CKI B;  5KYI A;  4A3E B;  1HFG A;  1HTP A;  1SE4 A;  4N9P A;  2AWN A;  2A6E C;  1TII D;  4IUN A;  2L9H A;  2F4I A;  1MI2 A;  2AQ3 B;  3TSS A;  1JWM D;  4RKB A;  4LAA A;  2EJM A;  1SJE D;  1H9J A;  1HCZ A;  2KJX A;  1ROD A;  4XT3 B;  1STN A;  5K36 H;  2K05 A;  2E76 C;  2E2I B;  1CI3 M;  5T1G A;  3WOE A;  5IGD A;  4ZKC B;  1J9O A;  1QWY A;  1DON A;  1GHK A;  3VR5 A;  1KLU D;  1O7L A;  1SYD A;  1R4P B;  1TY0 A;  1STB A;  5FO8 B;  2F0J A;  4BA1 I;  1PZI D;  5EPJ A;  1FGB D;  3EQL C;  4NMZ A;  4NP5 A;  3MWY W;  3IAY A;  5FOB B;  1AFP A;  2JEB I;  1GUN A;  1JOO A;  3VYS A;  2E2D C;  4XYQ A;  2DN8 A;  5DM6 3;  1I6H B;  1BDO A;  2ICE C;  3T16 A;  3A55 A;  1KAB A;  1CFM A;  1HHV A;  3J80 E;  2C9O A;  3SE0 A;  2LMC B;  2EZV A;  5A35 A;  1TS5 A;  4H44 C;  1JOQ A;  1S5D D;  1I50 B;  4RGO S;  2EYO A;  2RDH A;  4NKL A;  2F0Q A;  5EKI A;  1PZK D;  1FNV A;  3ND9 A;  1OXS C;  4KJO A;  3S15 B;  1IYU A;  4A3I B;  2F0U A;  4Y7N B;  2XWB B;  2F0S A;  1SMY D;  2NVY B;  1ET9 A;  1VF7 A;  2PZW A;  3LNN A;  2RQX A;  4A3F B;  2LS0 1;  3I3C A;  1D5Z C;  4DFA A;  1PFM A;  4G57 A;  1SNM A;  1DD2 A;  1IW7 D;  3Q24 A;  1UAP A;  1BO0 A;  2F0F A;  3NK9 A;  1V43 A;  2I46 A;  2K33 A;  2QCP X;  4N9T A;  1SYC A;  4DNT B;  4RCO A;  1ESF A;  4WFN 3;  2EY1 A;  2RDG A;  1PTO H;  3P1H A;  1QIL A;  1SNO A;  1EEI D;  1PFN A;  2D2C C;  4LJZ C;  1ILQ A;  3AB9 A;  4KHV A;  1MD2 D;  3HOX B;  3NQI A;  2BA0 A;  3PUY A;  5JEA H;  5EBC A;  4HMJ A;  5IGC A;  4OL7 A;  3KLS X;  5C6A A;  2F0P A;  3TBI B;  1HPC A;  3MEH A;  2G9D A;  1B50 A;  4EVO A;  1EQT A;  1E2Z A;  1MSG A;  2HDL A;  2RDF A;  5ISR A;  2FHT A;  4FP5 D;  3BVG A;  1CA5 A;  1F9P A;  5JAV A;  3LWE A;  3Q6S A;  4UDU C;  2Y0S B;  3N52 A;  4BY1 B;  1C48 A;  2F0H A;  3MFG A;  1SND A;  1A15 A;  1NSN S;  1KNE A;  5JPN C;  5G3L F;  2F0O A;  4BWG B;  2JP1 A;  4J8Q A;  4QCL A;  4OIK A;  4KTA A;  1D1K A;  1SEB D;  1ZYR C;  1SAP A;  3SDZ A;  4L8J A;  4XYO A;  2L12 A;  2SDF A;  5CV6 A;  2AWO A;  5DEH A;  4IFD J;  2D62 A;  2NN6 G;  2VB2 X;  3N6R A;  1B2T A;  3A8K E;  4FF1 A;  4RHR A;  5KNC A;  4E6I A;  3K5N A;  3NE5 B;  3EJI A;  3NUC A;  1IL8 A;  1L0X B;  4C3J B;  1YNJ D;  1HRJ A;  5ELF A;  5K5P A;  3A8I E;  1BQQ T;  2EE1 A;  4XQJ A;  1HQM C;  2X69 A;  1U4M A;  1QE6 A;  1KTK A;  1BCP B;  5C4J B;  1XX8 A;  1TS4 A;  1Z6H A;  3MXG A;  2Z4H A;  3KBX A;  3DWQ A;  2WV6 D;  1D1I A;  1SE3 A;  1NCV A;  1W6J A;  2DY8 A;  4IUT A;  3PMF A;  3GP7 A;  5EJW A;  3W2D A;  3BDC A;  1LV9 A;  2PCF B;  3SK6 A;  1STA A;  3GTO B;  3K0Y A;  4KD3 A;  1CZW A;  3GV3 A;  1R9T B;  1G29 1;  3PUW A;  2O2L D;  1PTO D;  1DOL A;  3AMU A;  1F2L A;  2YYZ A;  3IL8 A;  1G2S A;  1SYE A;  2BE5 C;  3MAQ A;  4RA8 A;  2Z8L A;  4R8I A;  4IUP A;  5CR3 A;  3CQZ B;  2JA5 B;  2EYP A;  1J8I A;  1ZKO A;  2IT1 A;  1BCP C;  1MGS A;  1V1O A;  3VA5 A;  1DOM A;  1LO5 D;  1PRT C;  4I65 A;  2OEO A;  3X3N A;  1PDQ A;  5CGK A;  5M5X B;  3TN2 A;  3T51 B;  4A3K B;  1DM0 B;  5KNB A;  5TSS A;  3DUZ A;  4ZYS A;  2HCI A;  2KEC A;  2NYZ D;  3MXN A;  1WD1 A;  3K5M A;  3TP7 A;  2EYM A;  5CV5 A;  3DEO A;  3WOF A;  3MTS A;  2NN6 I;  3A7A B;  5EKL A;  2R93 B;  3S14 B;  3NWS A;  5BN3 A;  2L1B A;  1A6X A;  3FPP A;  3RMH A;  2XIW A;  5HUR A;  3K5O A;  1WVL A;  4O1N A;  4KKS A;  1IKM A;  3C3L A;  1CTM A;  5CV9 A;  5F2D A;  5D14 A;  1TS2 A;  1TS3 A;  4XT1 B;  2F0E A;  5IGF A;  1UEA B;  3NTK A;  2NVT B;  1DXM A;  1GHJ A;  5EPL A;  2F0M A;  2MPM A;  2F03 A;  2A68 C;  4KJN A;  3S2D B;  1V1P B;  2RKS A;  2NZ1 D;  5I9P A;  2KOL A;  1CK1 A;  3CHB D;  3L3O C;  1D5M C;  3T4A C;  4WRD A;  4C3H G;  5EGT A;  4HSP A;  3PUV A;  4BS9 A;  2D9U A;  5CMD A;  1LT5 D;  2IL8 A;  1LTG D;  4Q5V A;  4ZUJ A;  4FF3 A;  1GJX A;  1TWA B;  2RSN A;  2NTT A;  3OIQ A;  4IUV A;  4DK0 A;  2IX3 A;  4LMQ D;  3JAM E;  3RUZ A;  5A2Q L;  1A3U A;  1JIC A;  3M3Y B;  3ND8 A;  1QB5 D;  4DNR B;  3J7A F;  2EOT A;  3FKI B;  5IGG A;  3BYT B;  1B3A A;  4BA2 I;  5C44 B;  4DXG A;  2JE6 I;  2MP1 A;  5M5Y B;  5IT9 E;  2IJ0 A;  2R61 A;  4RFB A;  4IUR A;  2FMC A;  1QOH A;  4XQN A;  4QMG A;  5I6W A;  5FO9 B;  3A54 A;  4DAP A;  5C3X A;  1TWF B;  1X32 A;  4JK1 C;  4WJW A;  3Q22 A;  4DA2 A;  1ENC A;  3GQB A;  1A3V A;  1O78 A;  2H1E A;  3HG9 A;  1I4Q A;  1E2W A;  4OO1 G;  2KVM A;  2PW5 A;  3E0J A;  4K6L A;  2A5H A;  4V0B A;  5M3M B;  3H0G B;  1WCM B;  1Q90 A;  1Z47 A;  5EQ0 A;  1Q1E A;  4FNF A;  3VA7 A;  1EIH A;  2BCO A;  3CRL C;  3I72 A;  3HOZ B;  4EQN A;  3UI2 A;  4PQX A;  5COY A;  3P20 A;  1AZQ A;  2F0T A;  4X3S A;  1CT1 D;  4DU9 A;  1KLG D;  2N55 A;  1GXD C;  1I6V C;  2XNA C;  4C3I B;  3FPU B;  1X3P A;  3EVQ A;  3H6M A;  5EKK A;  1L0Y B;  3GTP B;  1ZXT A;  4TRD A;  3LX0 A;  1WTP A;  2IPK D;  3QJY A;  1D6E C;  4H7B A;  4RGN A;  2NTS A;  2CVR A;  4FF2 A;  4ZLT F;  3BDO A;  2KQ3 A;  2K5D A;  5CC4 A;  3NSW A;  2K01 A;  4TKO B;  5IGB A;  4F8M A;  2C5C A;  3J80 L;  3DWA A;  4A3D B;  5ELE A;  1ICW A;  2HQE A;  1LTT D;  1QG7 A;  1LTR D;  3FRP B;  2VNU D;  4PMB A;  2I07 B;  1KDB A;  3RD4 A;  1SXT A;  4O42 A;  2JSO A;  1U4R A;  2IWH A;  3S1Q B;  4V19 0;  4FXK C;  2L55 A;  1DOK A;  2SEB D;  3DXJ C;  5C4H A;  5I2X A;  3CU7 A;  5FLX E;  4MHE A;  1WTX A;  3NP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...