1KAAA

Stress and strain in staphylococcal nuclease
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYAPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Stress and strain in staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 40
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1992-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kaaA00
2F0LA 2O4XA 2EY5A 1EY4A 3SXHA 1KDBA 3HEJA 3TP5A 4RKLA 3C1EA 3SK8A 1JORA 3MEHA 5CV5A 5I9OA 1TT2A 4IZ8A 5JAVA 1SNCA 3MXPA 4ZUIA 2WACA 5ISRA 1SYGA 2EYPA 1STNA 1EQVA 2PQEA 4TRDA 3SK4A 5KGUA 5EGTA 3HZXA 3NUCA 5E3FA 5C4HA 4YIJA 2F0WA 5J39A 1EY7A 5IGDA 1F2MA 3ITPA 4PMCA 4ZUJA 1II3A 4ID6A 5DEHA 2F0FA 4PMBA 5C4ZA 5KIXA 5EKLA 3RUZA 4K2LA 2EXZA 4QF4A 4K5WA 1F2ZA 3BDLA 1SYEA 4KY6A 3NK9A 5CR3A 2EY1A 3V2TA 5CC4A 3TMEA 2PYKA 5J22A 4HTHA 1AEXA 4K14A 4WORA 3TP8A 2F0HA 3D8GA 3S9WA 3SHLA 2OXPA 1SYDA 3DHQA 3LX0A 4EQPA 2PZWA 5IIFA 3T13A 3EROA 5CV8A 2RKSA 5KRUA 5C3WA 2F0PA 1A3UA 1EY9A 1F2YA 3D4WA 4I65A 1A2TA 5CGKA 1KABA 1KDAA 2SNMA 5JOBA 2F0NA 2RBMA 3ERQA 1TQOA 4EVOA 3EVQA 1EZ8A 4NDXA 4ODGA 5J1ZA 2F0EA 4K5VA 1EY0A 1KDCA 2F0KA 1EZ6A 4NKLA 2LKVA 1SYFA 5M9OA 4QMGA 4DU9A 1TR5A 1EYDA 3OSOA 3OMGA 4WRDA 4G57A 5E1FA 1JOKA 5IGEA 3T16A 4K2KA 4K5XA 4KY7A 1STAA 2PW5A 1EY8A 2EYHA 3H6MA 2F0VA 4K6DA 3MHBA 1SYCA 3OMCA 3BDCA 2EYJA 4LAAA 1JOOA 3MZ5A 3P1HA 3QOJA 2QDBA 1EY6A 1SYBA 4B9XA 4EQNA 5KYLA 1NSNS 2F0OA 2EY6A 1A3VA 2EYFA 5IOCA 3D4DA 5IGFA 5C6AA 1NUCA 2KQ3A 3DMUA 2SNSA 2EYMA 3NP8A 4H7BA 1KAAA 4OL7A 2F0QA 1SNPA 4J1MA 4F8MA 2OEOA 3TP7A 1ENAA 4J6HA 1STYA 2F3VA 4E6IA 3OWFA 4QB4A 5EKKA 3QB3A 4KD4A 2F3WA 2KHSA 5C3XA 4IALA 5KEEA 1STGA 4KJOA 5F2DA 4HMJA 5CV9A 3P75A 4B9WA 4NMZA 4EQOA 2HQEA 2F0GA 1JOQA 4KV6A 1SNQA 4ZQ3A 2F0TA 5IGBA 4DFAA 4KHVA 2F0UA 3U9OA 4DF7A 1EYAA 4S3SA 4N9TA 5IGGA 2F0IA 5CV7A 3EJIA 3PMFA 3NHHA 2EY2A 4DGZA 3NXWA 4KTAA 3D6CA 2EYOA 1U9RA 5C5LA 3R3OA 1STHA 1SNMA 4RKBA 4F7XA 2F0DA 5I6WA 5KYIA 4K8IA 5CV4A 3QOLA 1ENCA 4PNYA 2PZUA 2PW7A 3NQTA 5K5PA 3SK5A 4KY5A 1A2UA 4K8JA 5IODA 2OF1A 2PZTA 5NUCA 3MVVA 3VA5A 1A3TA 3C1FA 1IHZA 2ENBA 4N9PA 2NUCA 5I9PA 2F0SA 5HURA 4R8NA 2F0JA 3SR1A 3TP6A 4KD3A 5CV6A 1SNDA 2SOBA 4MIUA 5HGTA 1RKNA 4KJNA 4ME5A 1SNOA 3E5SA 1STBA 2EYLA 2F0MA 4NP5A 5C5MA 1EY5A 5IGCA 2RDFA 1EYCA 5I6YA 4IUNA 2M00A 5DAUA 4HMIA 3SK6A
chains in the Genus database with same CATH superfamily
4DXGA 1TWFB 5J3BA 2DY8A 3CCMA 1G291 1SNCA 4C3HH 2K5DA 3KFUA 2B2VA 1STNA 1HNWQ 3RN2A 1S3OA 4ZUJA 4OIJA 4PMCA 1STEA 3IAYA 1T5EA 5DEHA 5KIXA 2F0FA 3AFPA 2RHSB 1IBLL 4LF9Q 3CCRA 4K2LA 2EXZA 4DV6Q 1FJGQ 1NY4A 3KF8A 3MTSA 4FXGC 4X64Q 4R4QA 1ENFA 3NEMA 4P72A 3T1YQ 4A3FG 1KDAA 2WV6D 5LHY1 2BCOA 2Z6KC 3GP7A 2IX0A 3K8AA 3BZCA 1TVXA 1EZ8A 3EVQA 4A93B 4A3IG 3HOVG 2WP8J 2LKVA 4XXEA 5T1IA 4R4TA 1HJPA 4GLAC 1E22A 1QG7A 1X3FA 5H1SE 2XWJB 4YHHQ 3OMCA 4EQNA 4POGA 2QDBA 4P71A 4OXPA 2ZTCA 5CBEE 3CRKC 4IN3A 5LMUQ 1U0LA 1VQNA 1GO3E 4OL7A 2C35B 5FLXc 1I6VC 1SXTA 4C3IB 1H9SA 2NTTA 1J9OA 1STYA 3S1NH 2NN6I 2NVTH 4B9WA 3D4RA 3U4VA 2L9HA 2EE1A 4CJ1B 2ALYB 4CDCC 1IBLQ 4ZQ3A 2K4KA 4MHEA 1AFPA 2K28A 3UDIA 4JI2Q 4O1NA 1K73C 2J0TD 2QA4A 3NXWA 2B2VC 2AQ2B 2B2UA 3IRBA 2A1AA 4Y7NH 3H91A 1IZ6A 1STHA 4RKBA 2F0DA 3F2UA 4X65Q 3CMAA 1U4RA 4JVZA 5IWAL 4JG2A 2E2IH 4LF8L 4UY8C 4KHPL 4KD3A 1GVPA 2Z4IA 1PA6A 1BXTA 2G9HD 4XQJA 4ME5A 2MUYA 2N55A 4HEDA 2X6LA 2HCIA 4B3ML 1WTOA 3KF6A 1PH9A 2NVQH 1HQMC 3H09A 3BVGA 1I50B 2L12A 2JE6I 1O7LA 2M9VA 1JWUD 1KDBA 3NBHB 2R7ZH 4RKLA 3SK8A 2CFMA 2NVQB 1IYVA 2O2LD 5EPLA 1SE8A 3NTHA 1K9MC 3B6YA 2ZTDA 1KC8C 3IFTA 4DUZQ 5J39A 3HOXB 3OIPA 1FNUA 4PMBA 1UE5A 4HR7B 4QF4A 2EY1A 1H9MA 4A3GH 4X3SA 1QJOA 3S2HH 2E2DC 3P7JA 1SFOH 4LUVA 1X55A 4DK6C 3KLSA 1WTPA 2CHBD 4Y7NB 2VZAA 4X64L 3AYHB 1HNZL 4AQYL 1BCPD 1Y1VB 4U673 2I5LX 1BKBA 2WKDA 1DONA 4RHRA 5C4JH 1Q82C 2K14A 3Q8DA 1TR5A 3OSOA 3CPWA 4O2DA 4TKOB 3PO2H 4BBSH 5EKIA 5KNDA 4RAUC 5KYLA 1SYBA 4F88A 4FO2A 4DK1A 4LK1C 4R9WA 5GQOA 2A6HC 2K32A 2EOTA 2JSOA 2K6AA 5LMNQ 1MD2D 5IYDG 1M1KC 3NBHA 2B2TC 3TZDA 4UP7A 1E24A 5ELEA 1J8IA 3SDZA 3OW7A 3CCEA 3L2PA 2L55A 1X3PA 3MA2B 1SE2A 1TS5A 2F0UA 1JC7A 5IYBH 5M3FB 4C1NI 2D62A 1FL0A 1QNUA 3G48A 1PMRA 1XMOL 4A3BG 4JOIA 1MSHA 4PNYA 5ELOA 1SAPA 1E7ZA 1SSOA 3CF5A 3ND9A 4QL5A 2WINB 1B2TA 3JAML 2QW7A 4I7AA 4JYAQ 3TP6A 2E2IB 1E2WA 5IP9H 5K36H 2A6ED 2FMCA 4CKCA 4RGTA 3GTGB 3O13A 1JWSD 2VXWA 2HDLA 1BBUA 1PZKD 4ABNA 1TWFH 5DAUA 3AQQA 3ZYYX 1DOMA 1V43A 3MEHA 2IWHA 4M1UB 2A73B 4IZ8A 2JXMB 2ATWA 1JB3A 3A7LA 2Q2HA 4DAYB 4LFCL 2ZXRA 2UUCQ 1Y8OB 3MXNB 4OO1G 4DR1L 1EY7A 1HTPA 4X6AH 4X3TA 4ID6A 4GNXA 1W3SA 1JJ2A 2AUKA 1CKNA 1ZKOA 5EJWA 5IYDH 5FK9C 5J22A 4XQNA 1KNAA 2XGTA 1L1OB 5M3MH 1CSPA 1WYDA 1RTOA 4IPHA 1VQJA 4DV1L 2F0PA 4B3SL 1B3AA 3D4WA 3QR8A 4NXML 4IJHA 1Z7TA 3T1YL 1H9JA 3S1RH 2R7ZB 5I2XA 1XX8A 2XRSD 2SEBD 4IJLA 4JK1C 1PV4A 3PO2B 3U9SA 1ASYA 4KY7A 4XT1B 3URYA 1BNZA 1GUNA 1HZAA 4ILWA 2L15A 1JOOA 3A55A 3VA7A 2CH4W 4PG3A 2EYFA 3D0FA 3K59A 2K01A 1GHKA 1MGSA 4L5QA 2PNHA 1X3GA 2B2YA 3M4PA 1KAAA 1S72A 2P5ZX 1SNPA 4M8AA 2R61A 4X66L 3PIPA 3T51B 4A3GB 4HMJA 3VR5A 4NMZA 5CORA 2F0GA 2CW0D 1H9SB 2E2JH 1XJVA 3HRZC 3D31A 2NVTB 4XQQA 3GTMB 4OWXB 2Y0SE 1PZJD 3G7LA 4A3CH 2DNEA 3KOJA 4F7XA 1EFID 3JC66 1FNWA 1LT4D 3OTOL 3J7A5 3TDQA 1GUWA 1GM5A 1I4HA 3W1BA 1F2LA 1PTOD 1I94L 3VA5A 3J80E 1U4LA 4IFDJ 2JA6G 3SR1A 1BF4A 1SR3A 1CKMA 2EZVA 5KNCA 4MTNA 1YNJC 1I94Q 1IYJB 2CWPA 2DY7A 3R8BA 5JJKA 4BBRH 5I6YA 1L2FA 3QIAA 4GZYC 5FO7B 2K52A 4GNXB 2ZJRA 3PCOB 5ISRA 1WD1A 1YHBA 5KGUA 1MJCA 1LACA 3J81L 1VQFA 2LXKA 1PXUA 3RUZA 2KCNA 4HSVA 1JR0D 1DJRD 1KNEA 1X54A 1X56A 2UUAQ 2AQ3B 1F9SA 4EQPA 4A3MG 4LUOA 2UXDQ 1Y1VH 3MXGA 3GTLB 3SE0A 3PUVA 3S17H 2EJMA 3ONAB 2KEDA 1V9PA 1RF2D 4QIWE 4DR3L 1MSGA 1XYIA 1Z47A 2B8FA 3HP3A 1KDCA 3S2DB 3JAME 4WRDA 4IQZA 5E1FA 3T16A 1WCMH 3DEOA 3C46A 1E2VA 4A3DH 1PTOH 1LT5D 3T56B 3L9AX 4QCLA 3M4OH 2K5HA 2NN6G 4J6HA 2BE5D 5C44G 1YJNA 4JI6Q 4BBSG 4WJ4A 3LGJA 3MEFA 3PUYA 4GS3A 5CV9A 4DR7L 4IURA 3PV0A 4EQOA 1C7YA 4NXNQ 3UI2A 3L0OA 3K80C 4A3EG 3IL8A 1ESFA 4GOPA 3NELA 3CCSA 1E0BA 4C3HB 1VQOA 2PI2A 4GKJL 4LNQA 3HOZB 4C2MB 4JI5L 4U68A 2HDMA 2E5LQ 1B70B 2PQAA 3R2IA 4A3JB 2PW7A 5K5PA 1K8MA 3PF5A 1QVFA 2A5HA 2UU9Q 1YHQA 4FXKC 4DKAC 1GKHA 3G6EA 3P20A 2Z9HA 1LT3D 3M85A 4JI5Q 3TBIB 4A3GG 1LLRD 1PH5A 3E5SA 1FNVA 3MXNA 5C5MA 1EY5A 3N6RA 3T1HQ 1I3QB 3GTJH 4UAIA 3PO3G 3BU2A 3KBGA 2HT1A 2QF7A 3L3OC 1KL9A 1GD7A 2PMZB 3MXPA 3A7AB 1I6HB 4FDBA 5EGTA 2I46A 1Q81C 1GJXA 1II3A 4R8IA 2WIIB 3A56A 4QUFA 4DV3Q 4L6TB 4K0KL 4HAEA 3TP8A 5FLMG 1YITA 4JI4L 3H94A 2J7ZA 2PO4A 1SE4A 4JOIC 1D2BA 3ERSX 1SMXA 3CQZH 2LS01 1IXRA 1CT1D 2E75C 4DUYQ 1VQ8A 1CA5A 1FJGL 4LF7Q 2BE5C 2F0NA 3GD7A 1O7ZA 4KKUA 1DM0B 5J1ZA 4NKLA 1Q8KA 4ZAIA 1EYDA 2B2TA 3CC7A 5JEAJ 3FVQA 4LF7L 2XRQD 1IKMA 3K0YA 1STAA 4YCWA 2AWNA 1OXXK 4DNIA 3P1HA 2IW3A 4RG1A 4YY3L 1LTBD 1Y1WH 1I4PA 2XN9C 3D4DA 2VUMG 1N34Q 3WOEA 1TWHB 1B50A 2MO0A 2LMCB 2EYMA 2VNUD 1RJTA 4F8MA 2K5VA 1KIXA 3I4MB 1WCMG 3RZDH 4A3LH 4ME3A 3QB3A 1HNWL 2CKZB 4CBVA 3VYRA 2V4DA 3M4QA 2EQSA 3HOVB 4CDDC 1D5ZC 4CHTB 3H0GB 1BOSA 4G7HC 1BVSA 1ASZA 1SJHD 2QCPX 1N36Q 4CKBA 1VCIA 2B8GA 4B3MQ 2JN4A 5ELCA 1PYWD 3RN5A 3PGZA 1A2UA 4DNTB 3VYUA 3MVVA 2K05A 2ICEC 1NJIC 2UU9L 2IT1A 3C2PA 1TWGB 1RKNA 2EVBA 5JJZA 3QO2A 4G7OC 4A3JH 2BDOA 4X62Q 4X3KA 4IUNA 4JBMA 1LV9A 2O4XA 1WD0A 2EY5A 4ZKCB 3M7NA 3VR3A 1D1KA 1JWMD 1BBXC 1UAPA 1A8VA 2Q2IA 1B9NA 1PTOC 2WACA 4AH6A 3FRPB 2ASBA 2VQFL 2JA8B 2NVXB 3F8TA 1ML0D 2L5TA 5C4ZA 3S1QH 2J4XA 3WOFA 4A3LG 1ZEQX 3DWPA 5I4DA 4DV4Q 2B3GA 3TMEA 2UXCQ 4K14A 4O0AA 4WORA 4MN3A 3ULLA 4DAPA 3F2BA 2NTSA 1UNSA 3GV3A 2JA5B 5M3MG 4JI1L 2B2WA 5KRUA 1PFBA 1E1OA 3CQZB 2UXBL 1WJJA 3OYYA 1PFSA 4ZK9B 4H0LC 1IBML 2RCNA 1TQOA 3LWEA 1LO5D 2BH2A 1GUGA 4A3KB 1EY0A 4RA8A 2UXBQ 4P75A 3MFYA 4GOPC 4A3KH 3I90A 3A0JA 3RZDB 4G57A 3E0JA 2PW5A 3H0GG 3H6MA 1S4ZA 2I0QA 5FO9B 3I8ZA 1GUSA 3M3YH 5EPKA 1ONLA 1YVCA 2KQ3A 2SNSA 1HQRD 3GTKB 1NE3A 3E3XA 1CQFA 3IKJA 4DR1Q 3T1HL 1HUNA 2VQFQ 2F3WA 2KHSA 1NBWA 4IALA 4A3MH 3PIP3 3FKIG 1J6QA 4R1JA 2AQ1B 3PO3B 2A19A 1CHPD 2KHIA 4HSPA 2YYZA 3HOYH 3FPUB 5L37A 4PZ7A 4O42A 4LW1A 4OONA 1NTGA 3M4YA 4JI7L 3PSIA 2N49A 3EN2A 1K83B 1JMCA 3KLRA 4YWKA 4PZ6A 1FGUA 2GN5A 4P73A 4R8NA 3KBXA 1AZPA 4C56C 3L7ZC 3K7UC 2R92H 1G2TA 3UDGA 1CZWA 4KJNA 1SROA 2F4IA 5IE8A 2XVSA 5JVH3 2L11A 3TP5A 1U4MA 1MHWC 1DCZA 4UP8A 1TWHH 4KLKA 4TRDA 5IT9L 1Q1BA 1UE6A 2ZTEA 2Z1CA 3NQIA 5M5YB 5D14A 3S15H 1HFGA 3GDEA 5EKLA 4DK0A 4PMWA 4JPBW 3S1QB 2PQAB 1L1OC 4L8JA 4C1NK 4C2MH 3LX0A 4H02A 1HZCA 2Y0SB 1J5EQ 5CMDA 2Z6BA 1A3UA 2WAQE 4HCEA 4LFBQ 1IW7C 5CGKA 3BYYB 5JOBA 4V190 4AQYQ 2RBMA 1J5EL 3KF6B 1EU4A 1O78A 3HOYG 2KA7A 3V96A 3OMGA 1RCVD 2K5NA 1CTMA 1MIUA 2MJ8A 3KK7A 1W2BA 4LAAA 4PQXA 2EDGA 1NSNS 2ZXPA 3J80c 3K57A 1NUCA 1C4QA 5GAHC 1W6KA 5IP7H 4A3DG 1LTLA 2FMMA 3I2ZA 1AW7A 3CMEA 1V8QA 5IYCG 1WCMB 1F9PA 2A69D 3BYTB 3KJPA 2Q8TA 5ELNA 1E1TA 3BVMA 1OO9B 3UE1A 1MJEA 2KJXA 4BXXH 2IY5B 1RL2A 1AZQA 2WB1E 4N9TA 4BY7G 4CJ0B 4GN3B 1YJWA 4LFBL 5GADC 4HJ5A 1NCVA 1XXGA 5CV4A 1B53A 2TSSA 1K8GA 5EQ0A 5G3LF 2PZTA 3BVZA 1EFWA 3F2CA 4LFAL 5HGTA 2N88A 1RHPA 5IYCH 2JEBI 4JYAL 4L63B 3HFZB 2I5MX 4A3MB 1MBYA 3CRLC 2L4NA 3DWAA 2YU9B 3J7AF 3I70A 3MFGA 2OT2A 3VR4A 2F0LA 3GTKH 3AMUA 4L5TA 4HJ8A 1B8AA 3JAMc 3OPOA 2C9OA 1QVGA 1EUJA 2GVAA 4IFDH 1NMFA 1R9TH 4JBJA 3K5NA 4DV2L 4LUZA 3CW2C 4G4KA 1F2MA 4OEMB 1TWCB 4Q0FA 4UDUC 2AUJD 4KKTA 1D7QA 4IFDI 2K7VA 2M2LA 4HTHA 1AEXA 4A3IH 2K04A 1BCPC 2F0HA 1BCPB 1TWAB 3K81C 4UP9A 2F03A 5C3EH 3A5ZB 1CM9A 3VR6A 4XTCS 4TVAB 1Q1EA 4BY7H 3S17B 3RLNA 3HKZE 3WDNA 2O5JC 4ODGA 5BN3A 4OO1H 1C0AA 4DV7L 1C48A 5I2YA 5IGEA 4C3HG 3S16H 4A3EB 2JA6H 2RVLA 2RDGA 1JE4A 5IWAQ 1SDFA 3HG9A 4QQBX 5TSSA 1EY6A 2F0OA 3GQBA 2UUCL 4LFCQ 2VB3X 1KLGD 1Q90A 1H9KA 4IPCA 4LF4L 1JJCB 3HOZH 4JBWA 1AH9A 3GTGH 4AYBG 4DV0L 1V1PA 2EIFA 4OGQC 1ILQA 1B3QA 2WKCA 4BXXG 2NWGA 1IL2A 2KVMA 4KV6A 1HR0L 3CKIB 1B1ZA 4DF7A 3SVMA 1IL8A 4QJFA 4DK3C 4A76A 5C0XG 1PH6A 2EYOA 2HD3A 4HIMA 1SE3A 2IX3A 3GTPH 5IP7G 1MKHA 3QG1A 3NPPA 2LY7A 1ENCA 1CQVA 2PZUA 4N8FA 4DR2L 2NZHA 2R7FA 1CZGA 1PTOB 2R7ZG 2VQEL 1X9NA 4KI0A 1A3TA 1YZ6A 2KCTA 5I9PA 4QY7A 5AFWA 4A3BB 1LT6D 4Y52H 1VQ6A 1M90C 1V1PB 2B39A 2RDFA 3CP0A 3I4MH 4HMIA 3HOWH 1A0IA 4WFN3 3GTMH 4CKEA 1B7YB 5M5XH 4B08A 3RNUA 1BUVT 1HZ9A 2KECA 3FKIH 2F4VQ 1EQTA 5DM63 1VQEA 3E9IA 3CCJA 1N33Q 1S5CD 3H15A 2N78A 3QJYA 3NK9A 3HKSA 1N32Q 1FVIA 3BG3A 2MQHA 4DPGA 3S9WA 1X6OA 3GTQH 5JEAH 1TY2A 4I65A 2PCFB 1WI5A 1YI2A 2OQKA 1DXMA 4JI4Q 4QUCA 1UE1A 4JI3L 4KN4C 2RA4A 4K5XA 3CHBD 1PFMA 3S2DH 1EY8A 4PV1C 2EYJA 2HUGA 4FF4A 1YHAA 3KLWA 5C6AA 1I50H 2CCZA 4A3CG 2JA5G 4J1MA 3FEWX 4YY3Q 1ENAA 1CI3M 2VB2X 5DNFA 3RMHA 4IOCA 4JV5L 3PUWA 5KEEA 4DV6L 1VMPA 5EAYA 2B63G 3ICEA 1R4PB 1N33L 2AKWB 1GUOA 2OQ0A 1HZBA 1F9QA 3S24A 1EYAA 1K8OA 1K3BC 2F0IA 2HIXA 2EY2A 3EA6A 1HH2P 1UEAB 4NPSA 1HR0W 2X69A 4L5RC 4KK7A 4XDXA 2E5LL 3S1MH 3A8IE 2ZT9C 2G5DA 1D8LA 2OF1A 5ELBA 2MHVA 1LUZA 2CQAA 3J81i 4DR6Q 1B44D 1U5KA 3Q0AA 4BWGB 4UHVA 2DJFC 4HJAA 2RDHA 3HOUG 1STBA 5E4XA 1BCPF 4YHHL 2CWAA 5IGCA 1YNXA 4IO9A 4JI6L 1Q8IA 2R3ZA 1XPUA 1LTGD 2PNRC 1SN8A 1JORA 5D3IB 3CCVA 2Z4HA 1JCKB 1NMGA 1XTCD 4ZUIA 1EQVA 1K0RA 3M7GA 4P74A 3HZXA 4C3IG 1QB5D 3A5UA 1L1OA 1V1QA 2RSOA 2L0CA 2E2JB 1VQ5A 2ZM6L 3CU7A 1VQLA 4K5WA 5CR3A 1EQRA 2RSNA 3KJOA 4Z9CB 2TMPA 1EQQA 4DV0Q 2NZ1D 3FP9A 3I3CA 3EROA 5CV8A 4IUUA 1E3PA 2ICIA 1RIPA 4IUTA 1EY9A 2DGYA 2MGSA 1S5ED 2A69C 1YJ9A 1I4XA 5CYUA 1TKWB 4OHJA 5C4JB 1W6JA 1PRTC 4DU9A 5BN4A 5C0XI 2KUMA 3CCUA 1D5MC 3C3LA 2EYHA 5D65A 1SYCA 1C8CA 3MZ5A 4WJWA 5M5XB 1LABA 2VL6A 2EY6A 1A3VA 4LFAQ 3HOUB 1UE7A 4GLXA 1XPOA 1VQGA 1JT8A 1VF5C 3TSSA 3RZOB 3RR5A 1R4QB 3TP7A 1L0YB 4LF5L 1YNJD 3OWFA 5LL6X 3PUZA 5C3XA 4FF3A 1CFMA 2NYZD 2HQEA 3PF4A 1SLJA 2F0TA 1EIFA 3U9OA 2JJQA 1WTXA 3CCLA 1IKLA 5E7NA 3NHHA 4LWCA 3GTPB 1XTDA 4MNOA 5AJ3L 1HCZA 3FMCA 1KRSA 4TQUS 4ZCKA 4CDEC 3QOLA 1EYGA 4DR4L 3HOUH 1HRJA 1ET9A 1IHZA 1TS3A 2B2UC 2F0JA 4RHSA 5BR8Q 1VQPA 3NE5B 2LSSA 4FP5D 4LF4Q 3OHXC 5C4XB 1EWIA 1WTQA 1AP0A 2D9UA 2F0MA 3AU7A 2JK8A 5M3FG 4EQ5A 3HOWB 3CPFA 1LTID 3SXHA 3HEJA 4C3IH 1HXYD 3U50C 2H5XA 5CV5A 1IBKQ 2NVYB 1G8ZD 1NAPA 3A8KE 1H95A 2FXQA 1XNRQ 5C4HA 2K5WA 3ITPA 4FXDA 1G6PA 3J80i 3S2HB 2DUDA 2RF4A 3S1NB 3HOXH 1Q7YC 4RCOA 3I4OA 1KXLA 3SHLA 1SYDA 2WB1B 4DUYL 1KAWA 2RKSA 1K28A 4ZYSA 3D6WA 5EBDA 1HA5A 1QUQA 2G9DA 5JPNC 1PH3A 5ELFA 1N8RC 1Q46A 1MI2A 2D0OA 3BJUA 3FHWA 3H3VC 3PUXA 4DV1Q 4JI3Q 1HHVA 2D5DA 3CAMA 2F0KA 5M9OA 2NBFA 4JI8Q 2IHFA 4QMGA 2BH8A 2E74C 4A93H 2KCCA 2Z0SA 1L0WA 3UDXA 3K5MA 1Y69U 3VYSA 3FDTA 4TSSA 2IPKD 3E6ZX 4QIWB 1D1IA 4F87A 4UPAA 1O7YA 2H1EA 2RQXA 1IW7D 3S1MB 5IGFA 1TU2B 2NVYH 4L5SA 2BOSA 1G2SA 2FINB 3WWVA 1UUPA 2B29A 1P8LA 4CGYB 1QCBD 2K75A 4N8X1 1HPCA 2UXCL 1STGA 5F2DA 3FKIB 2E76C 3J81j 3G4SA 4V0BA 3JAMi 4DV5L 5C0XJ 1VQKA 1TY0A 1QZHA 4A3BH 4BY7B 3E9HA 4GKKQ 1IBMQ 5C3EB 3FPPA 1WOCA 2F52A 1U9RA 2KBNA 3RLFA 1CSQA 1SNMA 3X3MA 2CH4A 2D2CC 4A3IB 4B3TL 3NBIA 1T9HA 1N36L 3S14H 4GKKL 2EJGC 4JI7Q 1LTAD 3EFXD 1TWCH 3HKZB 1KLUD 1D6EC 1GOZA 4KHPQ 4N9PA 4IPDA 5HURA 2KCMA 2E2HH 1S5DD 4LF8Q 1SNDA 2SOBA 4DAVA 2R93H 4LF6Q 4A3KG 2BA1A 4IPGA 4NP5A 4RH6A 1I4RA 3K6OA 1ICWA 4R4CA 5LMNL 3A8JE 3CXCA 1A63A 2R7DA 4DR5L 1UEBA 5ELDA 3RZOH 3RD4A 3I72A 3AB9A 4IFDG 3HOYB 1TS4A 1EEFD 3KF8B 4MZ9A 4APVA 1HA6A 2EYPA 1VQIA 1AE2A 3NUCA 5E3FA 1OXVA 3NSWA 3OIQA 1LTRD 2MP1A 3ND8A 1QVCA 4BY1G 3BDLA 1VDZA 2MO1A 4XIGS 3V2TA 3HKZG 2N3SA 2PYKA 1EOTA 4JI0Q 2HIVA 1PTOF 3LWUA 3I4NB 3TN2A 5LL6S 1HFNA 3DHQA 4AYBE 4DV7Q 3NTIA 2JP1A 1F2YA 4ZKBB 5C3EG 4IOAA 2UUAL 1XWEA 4GLVB 1HNZQ 2XIWA 1ICFB 4NXMQ 4AYBB 3A54A 3PIOA 1TWAH 4XT3B 2AHOB 1JOKA 4JI8L 4K2KA 5A35A 4FVMA 4BS9A 3QOJA 3D3RA 3UE0A 1OXTA 1X3EA 2VW9A 1SBBB 4J8QA 2DNCA 4RMFA 3LNNA 2V1CC 2PPBC 2EPBA 4E6IA 2VUMH 5EKKA 2QEXA 1A6XA 3J80L 3P75A 2YU9H 1RD9D 1GHJA 4EX5A 1LYLA 2OTLA 1SNQA 1CHQD 1IBKL 4HCSA 4DFAA 1AE3A 5M5WH 2UXDL 5IGGA 4DAYA 2JYOA 2QILA 3Q23A 1M4VA 3TQYA 3D6CA 2MFIA 2ES2A 1U4PA 4X65L 2KENA 4GN4B 4IUQA 4HJ7A 2O5IC 1SEBD 2WB1G 3W2DA 3ULJA 4MTKA 3G71A 4K8JA 5IODA 2HCCA 2YTYA 3TREA 4HN7A 2FFKB 4RGMA 2D0PA 3NTKA 3TS0A 2JA6B 4NW2A 1LTSD 4KHZA 4KMUC 4HIDA 1K8AC 4LF6L 2EYLA 2JQOA 3MAQA 1YNNC 2FHTA 1TIID 1CUKA 3C1EA 1TT2A 3T53B 5LMUL 3ER0A 1H9RA 4XYOA 1FD7D 4C3JB 1LM0A 3SK4A 3TEHB 2L1BA 1YBYA 4JV5Q 1PZID 3HOVH 4CDFC 3F2DA 5K36G 3N52A 2QDLA 2K1BA 1O7IA 4DR7Q 3GO5A 1PRTB 1BDOA 1SYEA 2X6GA 1SJED 4KY6A 1HR0Q 1JICA 1VQMA 2DN8A 1A62A 4ALPA 3D8GA 5IT9c 3T13A 1WTRA 1CKOA 5C0XH 1O80A 3GTQB 3J81c 2SNMA 3TS2A 4JCVE 4RWSC 4DXFA 4BY1B 3BS1A 4A3EH 1SYFA 4RFBA 3S16B 3NENA 4BY1H 5EPJA 3X3NA 1D5XC 2F0VA 2VY3A 3I91A 3MHBA 1YIJA 5GAGC 5IOCA 4X62L 3DM1A 1JE5A 3DWQA 2WAQG 3V05A 1LTTD 1T5XD 3HOWG 1NR2A 4A75A 5JEAG 2OEOA 1JJGA 2F4VL 2F3VA 2ID0A 3K7AB 1PH8A 2IL8A 4OWTB 4DV3L 4K0KQ 2ZJPA 2K03A 3Q22A 1YEZA 4R4OA 3F1ZA 1ZXTA 1QUQB 5C44B 5FO8B 4NXNL 1E2ZA 3EBEA 3EJIA 3PMFA 3E0EA 1XMOQ 1QILA 1CKNB 4FYDA 4YWMA 4ZLTF 2B2YC 2XNAC 3AEVA 4WJ3M 3H0GH 1VF7A 5I6WA 4K8IA 5HY6A 4FNFA 1XPRA 2K5QA 3K5OA 1Q12A 5D3DA 2R92B 2ENBA 1BBWA 1Y8NB 2F0SA 5EBCA 3U58A 1K83H 2KEEA 2PMZE 2HHHQ 3T4AC 2B63H 4X66Q 1ET6A 2I07B 3GTOB 2DJGC 1EYCA 3DLLA 2H4OA 1HNXQ 1N34L 1Z9FA 5LMNW 3K58A 1EY4A 5G3LD 3I7FA 2MNAA 1I5FA 1Y1WG 2JA7G 2UUBL 3M3YB 5JJLA 2IHEA 1WVLA 2JA7B 3ZJYC 4LMQD 3W5OA 5JVG3 1ESRA 4A4IA 2A8VA 1DOLA 2K50A 4EGVA 3NWSA 5IYBG 5FKAC 3VDYA 3S15B 1OXUA 4P2CB 2ZM6Q 3G6JB 2CW0C 3KYHC 1QWYA 1SMYD 5C3WA 3HGBA 1ZYRD 3CD6A 1PFNA 2Q8RE 2XWBB 4H13C 2JA8G 2R92G 2BA0A 3DXJC 1WFQA 1XMQL 1EU3A 1K3RA 2F0EA 3BZDB 4K5VA 3J7AV 5FLMH 4GOPB 2YTXA 1VQHA 1RDPD 2GA4B 1NR4A 4YIJA 2QGQA 4GN5A 3PIO3 1QOHA 4A93G 2RCFA 2OTJA 1R9TB 1PVOA 1GXDC 1B9MA 2BDNA 2HQLA 3DMUA 3NP8A 2UUBQ 3J81E 2F0QA 4A3FH 2F3IA 4A3JG 2AMCB 4KD4A 1VQ9A 5C4XG 4DV5Q 2XSCA 2NVXH 2WAQB 2EXDA 5HGQA 2Q2UA 3HOXG 1JOQA 5IGBA 4DR4Q 1EIHA 1KRTA 1PDQA 2KOLA 4S3SA 4B3RQ 4GKJQ 2NN6H 1DZ1A 4KTAA 3IFDA 5BR8L 1FR3A 4DA2A 4B3SQ 1AN8A 1HTLD 1CK1A 2VS1A 1WTHA 1DD2A 4ZRZA 1VS0A 4YWLA 4KY5A 3SK5A 1TWGH 3DUZA 1VQ4A 5E4WC 5AJ3Q 2VQEQ 3SEBA 5BN5A 1G51A 3W1GA 1L0XB 2MPMA 3BZKA 1N9WA 1EWCA 1OXSC 1VMCA 4J15A 2R93G 5CBAE 1RODA 2Q8IB 3J7ZC 2A6EC 2F1MA 1PH1A 3QWNA 5IY0A 1I3QH 1EOVA 1JQYD 3I56A 4OELB 2K33A 1PH4A 1Y1WB 3OOCA 4LF5Q 4H44C 5IGDA 3PO3H 5T1GA 4LF9L 4G7ZC 3KUPA 2Z8LA 4X3UA 1N32L 2R6GA 3VR2A 1XNRL 4DV4L 1PHJA 4OIKA 4DNRB 4B3RL 2JA7H 3Q24A 1EEID 4OO1I 2NB0A 3H3VI 1VQDA 4XYQA 4JC0A 1DOKA 3A74A 3I55A 3I4NH 1VQAA 3ERQA 4NDXA 3STBC 4IUPA 3GV6A 1V1OA 3H3VH 5COYA 2VUMB 5JJIA 1GUTA 4HJ9A 1EIYB 1VQCA 4K6DA 3VYTA 2OCEA 3M9BA 4K6LA 4DN4M 5M5YH 1TS2A 2KHJA 3BDCA 2GVBA 4JBKA 4PZ8A 1Y8PB 4DUZL 4A3DB 1PRTD 1VQBA 4BA2I 4BBRB 2Q2TA 4H7BA 2HHHL 2LFNA 2XTIA 3HS0C 3MWYW 5IT9E 4QB4A 1EL0A 1F9RA 2FJ2A 1ZYRC 4DV2Q 5C44H 5A2QE 1KD1C 4LJZC 3HOZG 4OWWB 3NWTA 4GNXC 4JI0L 1XNQQ 1X32A 3K0XA 1WTWA 4KHVA 3UDFA 3OTOQ 3OW2A 3K7AH 5KNBA 2CQOA 4NB3A 3PQIA 1KHIA 3I73A 2AWOA 4FF1A 1G6ZA 5KYIA 3MXUA 4YCVA 1X65A 1BQQT 1PH2A 3K5LA 4OX9L 4DR6L 4Q5VA 2C5CA 1S40A 5C4XH 4DR5Q 2NZOA 3KDFB 3C1FA 2JEAI 4HIKA 2NUCA 4KKSA 2B63B 4DAMA 3Q6SA 3CC4A 1SNOA 2E8GA 2IJ0A 3TRZA 5DM73 1KTKA 1Y1VG 2CVRA 3CCQA 4OX9Q 3I4NG 3CC2A 2OWOA 2Z6KA 4A3FB 3M4OB 2I5HA 2YV5A 3R2TA 1Z6HA 5I9OA 1HUMA 1RTNA 4AIMA 3PO2G 1EIGA 5JAVA 2A74C 1K0SA 1PYSB 1SYGA 4JI2L 1QE6A 2PQEA 1M8AA 1FGBD 2JA9A 3STBD 4POFA 1WTVA 5GAEC 2F0WA 4QGUA 1XNQL 1IYUA 1F2ZA 1PYBA 1QNKA 5CC4A 1TXYA 5FLXL 4CJ2C 4JW0A 2OXPA 3SGIA 1BR9A 2PZWA 5IIFA 2B2WC 1FYCA 1SMYC 4JI1Q 4BBRG 4C3JH 5FJ8H 1P16A 5FLXE 1A2TA 1KABA 2JA5H 4R4IA 3GTLH 3I4MG 1I4GA 4EVOA 4BBSB 2IX1A 4RGOS 2N8NA 3W3AA 4FF2A 1EZ6A 3TZUA 3EIVA 4DR3Q 5DLQE 2LXJA 3DEPA 2QKIC 2ZXOA 2JA8H 4B9XA 1F77A 3KDFA 1VQ7A 2EJFC 1EWHA 1PRTF 2ZJQA 1NNXA 4IUVA 3DM3A 3EQLC 4YCUA 1DYQA 1SFOB 1X3QA 1HNXL 2RHQB 5JPMC 1S5FD 1G91A 4I7ZC 4C3JG 3GTOH 2QEJC 4HIOA 1KQSA 1OTCA 4KJOA 5M5WB 2SDFA 1S5BD 4BA1I 1PLFA 3AFQA 1SRUA 3KLSX 5IP9G 3S1RB 3BDOA 4DR2Q 3MC0B 3R93A 1XMQQ 1QZGA 1Q3LA 3ULPA 5CV7A 1I6HH 1B4OA 2WFWA 4DGZA 3J7YW 2PI2E 3I4LA 4ULLA 3S14B 1C9OA 3R3OA 5C5LA 2Y0SG 5M3MB 1BO0A 5M3FH 1A15A 3NQTA 5FOBB 1Q86C 4B3TQ 3GTJB 2R93B 5FJ8G 5A2QL 3RLOA 1Y14B 5NUCA 2E2HB 2YTVA 1DGSA 2A6HD 5CV6A 4MIUA 4RGNA 3U4ZA 5GROA 4RCNA 1UWVA 1YNND 1CA6A 4KN7C 3OWEB 2A68D 1ILPA 2A68C 1JB7A 1I4QA 2M00A 1PH7A 3SK6A
chains in the Genus database with same CATH topology
4DXGA 1TWFB 2DY8A 1G291 1SNCA 2K5DA 2B2VA 1STNA 4ZUJA 4OIJA 4PMCA 1STEA 3IAYA 1T5EA 5DEHA 5KIXA 2F0FA 4K2LA 2EXZA 3KF8A 3MTSA 4FXGC 1ENFA 1KDAA 2WV6D 5LHY1 2BCOA 3GP7A 2IX0A 1TVXA 1EZ8A 3EVQA 4A93B 2WP8J 2LKVA 4XXEA 5T1IA 1QG7A 2XWJB 3OMCA 4EQNA 2QDBA 5CBEE 3CRKC 4IN3A 4OL7A 1I6VC 1SXTA 4C3IB 1H9SA 2NTTA 1J9OA 1STYA 2NN6I 4B9WA 3D4RA 2L9HA 2EE1A 4CJ1B 4ZQ3A 4MHEA 1AFPA 2K28A 4O1NA 2J0TD 3NXWA 2B2VC 2AQ2B 2B2UA 3H91A 1STHA 4RKBA 2F0DA 3F2UA 1U4RA 4KD3A 2Z4IA 1BXTA 2G9HD 4XQJA 4ME5A 2MUYA 2N55A 4HEDA 2X6LA 2HCIA 1WTOA 1HQMC 3H09A 3BVGA 1I50B 2L12A 2JE6I 1O7LA 2M9VA 1JWUD 1KDBA 4RKLA 3SK8A 1IYVA 2NVQB 2O2LD 5EPLA 3NTHA 3IFTA 5J39A 3HOXB 3OIPA 1FNUA 4PMBA 4HR7B 4QF4A 2EY1A 1H9MA 4X3SA 1QJOA 2E2DC 3P7JA 3KLSA 1WTPA 2CHBD 4Y7NB 1BCPD 1Y1VB 4U673 2WKDA 1DONA 4RHRA 1TR5A 3OSOA 4TKOB 5EKIA 5KNDA 4RAUC 5KYLA 1SYBA 4F88A 4FO2A 4DK1A 4LK1C 4R9WA 2A6HC 2K32A 2EOTA 2JSOA 2K6AA 1MD2D 3NBHA 2B2TC 3TZDA 5ELEA 1J8IA 3SDZA 3OW7A 2L55A 1X3PA 3MA2B 1SE2A 1TS5A 2F0UA 1JC7A 5M3FB 4C1NI 2D62A 1QNUA 1PMRA 1MSHA 4PNYA 1SAPA 1SSOA 3ND9A 2WINB 1B2TA 3JAML 3TP6A 2E2IB 1E2WA 5K36H 2A6ED 2FMCA 4CKCA 4RGTA 3GTGB 3O13A 1JWSD 2VXWA 2HDLA 1PZKD 4ABNA 5DAUA 3ZYYX 1DOMA 1V43A 3MEHA 2IWHA 4M1UB 2A73B 4IZ8A 2JXMB 1JB3A 3A7LA 2ZXRA 1Y8OB 4OO1G 1EY7A 1HTPA 4X3TA 4ID6A 2AUKA 1ZKOA 5EJWA 5FK9C 5J22A 4XQNA 1KNAA 1RTOA 2F0PA 1B3AA 3D4WA 1Z7TA 1H9JA 2R7ZB 5I2XA 1XX8A 2XRSD 2SEBD 4JK1C 3PO2B 3U9SA 4KY7A 4XT1B 3URYA 1BNZA 1GUNA 4ILWA 1JOOA 3A55A 3VA7A 2EYFA 3K59A 2K01A 1GHKA 1MGSA 2B2YA 1KAAA 1SNPA 4M8AA 2R61A 3T51B 4A3GB 4HMJA 3VR5A 4NMZA 5CORA 2F0GA 2CW0D 1H9SB 3HRZC 3D31A 2NVTB 4XQQA 3GTMB 1PZJD 3G7LA 2DNEA 4F7XA 1EFID 1FNWA 1LT4D 3TDQA 1GUWA 1I4HA 1F2LA 1PTOD 3VA5A 3J80E 1U4LA 4IFDJ 3SR1A 1BF4A 2EZVA 5KNCA 1YNJC 2DY7A 3R8BA 5I6YA 3QIAA 4GZYC 5FO7B 5ISRA 1WD1A 5KGUA 1LACA 3J81L 1PXUA 3RUZA 2KCNA 4HSVA 1JR0D 1DJRD 1KNEA 2AQ3B 1F9SA 4EQPA 3MXGA 3GTLB 3SE0A 3PUVA 2EJMA 3ONAB 2KEDA 1RF2D 1MSGA 1XYIA 1Z47A 2B8FA 3HP3A 1KDCA 3S2DB 3JAME 4WRDA 4IQZA 5E1FA 3T16A 3DEOA 3C46A 1E2VA 1PTOH 1LT5D 3T56B 3L9AX 4QCLA 2NN6G 4J6HA 2BE5D 3PUYA 5CV9A 4IURA 3PV0A 4EQOA 3UI2A 3IL8A 1ESFA 1E0BA 4C3HB 3HOZB 4C2MB 4U68A 2HDMA 3R2IA 4A3JB 2PW7A 5K5PA 1K8MA 2A5HA 4FXKC 3P20A 1LT3D 3M85A 3TBIB 1LLRD 5C5MA 3E5SA 1FNVA 3MXNA 1EY5A 3N6RA 1I3QB 4UAIA 3KBGA 2QF7A 3L3OC 2PMZB 3MXPA 3A7AB 1I6HB 5EGTA 2I46A 1GJXA 1II3A 4R8IA 2WIIB 3A56A 4QUFA 4L6TB 4HAEA 3TP8A 3H94A 2J7ZA 2PO4A 1SE4A 1D2BA 2LS01 1CT1D 2E75C 1CA5A 2BE5C 2F0NA 3GD7A 1O7ZA 4KKUA 1DM0B 5J1ZA 4NKLA 4ZAIA 1EYDA 2B2TA 5JEAJ 3FVQA 2XRQD 1IKMA 3K0YA 1STAA 2AWNA 1OXXK 3P1HA 2IW3A 1LTBD 1I4PA 2XN9C 3D4DA 3WOEA 1TWHB 1B50A 2LMCB 2EYMA 2VNUD 1RJTA 4F8MA 3I4MB 3QB3A 4CBVA 3VYRA 2V4DA 3HOVB 1D5ZC 4CHTB 1BOSA 3H0GB 4G7HC 1SJHD 2QCPX 4CKBA 1VCIA 2B8GA 5ELCA 1PYWD 4DNTB 1A2UA 3VYUA 3MVVA 2K05A 2ICEC 2IT1A 3C2PA 1TWGB 1RKNA 2EVBA 5JJZA 3QO2A 4G7OC 2BDOA 4X3KA 4IUNA 1LV9A 2O4XA 1WD0A 2EY5A 4ZKCB 3M7NA 3VR3A 1D1KA 1JWMD 1BBXC 1UAPA 1B9NA 1PTOC 2WACA 3FRPB 2JA8B 2NVXB 1ML0D 2L5TA 5C4ZA 2J4XA 3WOFA 1ZEQX 3DWPA 5I4DA 3TMEA 4K14A 4WORA 4MN3A 4DAPA 2NTSA 1UNSA 3GV3A 2JA5B 2B2WA 5KRUA 1PFBA 3CQZB 4ZK9B 4H0LC 1TQOA 3LWEA 1LO5D 1GUGA 4A3KB 1EY0A 4RA8A 3MFYA 3I90A 3RZDB 4G57A 3E0JA 2PW5A 3H6MA 1S4ZA 5FO9B 3I8ZA 1GUSA 5EPKA 1ONLA 2KQ3A 2SNSA 1HQRD 3GTKB 1CQFA 3IKJA 1HUNA 2F3WA 2KHSA 4IALA 3PIP3 2AQ1B 3PO3B 1CHPD 4HSPA 2YYZA 3FPUB 4O42A 3M4YA 1K83B 3KLRA 4R8NA 3KBXA 1AZPA 4C56C 3L7ZC 1G2TA 1CZWA 4KJNA 2F4IA 2XVSA 5JVH3 2L11A 3TP5A 1U4MA 1DCZA 4TRDA 5IT9L 1Q1BA 2Z1CA 3NQIA 5M5YB 5D14A 1HFGA 5EKLA 4DK0A 4PMWA 3S1QB 4L8JA 4C1NK 3LX0A 2Y0SB 5CMDA 1A3UA 4HCEA 1IW7C 5CGKA 3BYYB 5JOBA 4V190 2RBMA 1EU4A 1O78A 2KA7A 3V96A 3OMGA 1RCVD 1CTMA 2MJ8A 3KK7A 4LAAA 4PQXA 2EDGA 1NSNS 2ZXPA 3K57A 1NUCA 1C4QA 1W6KA 2FMMA 1AW7A 1V8QA 1WCMB 1F9PA 2A69D 3BYTB 2Q8TA 3BVMA 1OO9B 2KJXA 1AZQA 4N9TA 4CJ0B 1NCVA 1XXGA 5CV4A 1B53A 2TSSA 5EQ0A 5G3LF 2PZTA 3BVZA 5HGTA 2N88A 1RHPA 2JEBI 4L63B 4A3MB 1MBYA 3CRLC 2L4NA 3DWAA 3J7AF 2YU9B 3I70A 3MFGA 2OT2A 3VR4A 2F0LA 3AMUA 3OPOA 2C9OA 4IFDH 3K5NA 4G4KA 1F2MA 1TWCB 4Q0FA 4UDUC 2AUJD 4KKTA 4IFDI 2K7VA 2M2LA 4HTHA 1AEXA 2K04A 1BCPC 2F0HA 1BCPB 1TWAB 2F03A 3VR6A 1CM9A 4XTCS 1Q1EA 3S17B 3WDNA 2O5JC 4ODGA 5BN3A 4OO1H 1C48A 5I2YA 5IGEA 4C3HG 4A3EB 2RVLA 2RDGA 1JE4A 1SDFA 3HG9A 5TSSA 1EY6A 2F0OA 3GQBA 2VB3X 1KLGD 1Q90A 1H9KA 4JBWA 1V1PA 4OGQC 1ILQA 2WKCA 2NWGA 2KVMA 4KV6A 3CKIB 1B1ZA 4DF7A 3SVMA 1IL8A 5C0XG 2EYOA 1SE3A 2IX3A 3QG1A 3NPPA 2LY7A 1ENCA 1CQVA 2PZUA 1CZGA 1PTOB 4KI0A 1A3TA 5I9PA 5AFWA 4A3BB 1LT6D 1V1PB 2B39A 2RDFA 4HMIA 4WFN3 4CKEA 4B08A 1BUVT 2KECA 1EQTA 5DM63 1S5CD 3QJYA 3NK9A 3BG3A 3S9WA 5JEAH 1TY2A 4I65A 2PCFB 1DXMA 4QUCA 4KN4C 2RA4A 4K5XA 3CHBD 1PFMA 1EY8A 4PV1C 2EYJA 2HUGA 4FF4A 5C6AA 4J1MA 3FEWX 1ENAA 1CI3M 2VB2X 5DNFA 3RMHA 3PUWA 5KEEA 1VMPA 1R4PB 1GUOA 1F9QA 1K8OA 1EYAA 2F0IA 2EY2A 3EA6A 1UEAB 2X69A 4KK7A 4XDXA 3A8IE 2ZT9C 2OF1A 5ELBA 2MHVA 2CQAA 1B44D 3Q0AA 4BWGB 2RDHA 1STBA 5E4XA 1BCPF 5IGCA 1Q8IA 2R3ZA 1LTGD 2PNRC 1JORA 5D3IB 2Z4HA 1JCKB 4ZUIA 1XTCD 1EQVA 3M7GA 4C3IG 3HZXA 1QB5D 2RSOA 2L0CA 2E2JB 3CU7A 4K5WA 5CR3A 2RSNA 4Z9CB 2TMPA 2NZ1D 3I3CA 3EROA 5CV8A 4IUUA 2ICIA 4IUTA 1EY9A 2MGSA 1S5ED 2A69C 1I4XA 5CYUA 1TKWB 4OHJA 5C4JB 1W6JA 1PRTC 4DU9A 5BN4A 5C0XI 2KUMA 1D5MC 3C3LA 2EYHA 5D65A 1SYCA 1C8CA 3MZ5A 4WJWA 5M5XB 1LABA 2EY6A 1A3VA 3HOUB 1VF5C 3TSSA 3RZOB 1R4QB 3TP7A 1L0YB 1YNJD 3OWFA 5LL6X 3PUZA 5C3XA 4FF3A 1CFMA 2NYZD 2HQEA 2F0TA 3U9OA 1WTXA 1IKLA 3NHHA 3GTPB 1HCZA 3FMCA 4TQUS 3QOLA 1HRJA 1ET9A 1IHZA 1TS3A 2B2UC 2F0JA 4RHSA 3NE5B 4FP5D 3OHXC 5C4XB 1WTQA 1AP0A 2D9UA 2F0MA 3AU7A 3HOWB 1LTID 3SXHA 3HEJA 1HXYD 5CV5A 2NVYB 1G8ZD 1NAPA 3A8KE 5C4HA 2K5WA 3ITPA 4FXDA 3S2HB 3S1NB 4RCOA 3SHLA 1SYDA 2WB1B 2RKSA 4ZYSA 3D6WA 5EBDA 1HA5A 2G9DA 5JPNC 5ELFA 1MI2A 3H3VC 3PUXA 1HHVA 2D5DA 2F0KA 5M9OA 2NBFA 4QMGA 2E74C 2KCCA 3K5MA 1Y69U 3VYSA 3FDTA 4TSSA 2IPKD 3E6ZX 4QIWB 1D1IA 4F87A 1O7YA 2H1EA 2RQXA 1IW7D 3S1MB 5IGFA 1TU2B 2BOSA 1G2SA 2FINB 1UUPA 4CGYB 1QCBD 1HPCA 5F2DA 1STGA 3FKIB 2E76C 4V0BA 5C0XJ 1TY0A 4BY7B 5C3EB 3FPPA 1U9RA 3RLFA 1SNMA 3X3MA 2D2CC 4A3IB 3NBIA 2EJGC 1LTAD 3EFXD 3HKZB 1KLUD 1D6EC 1GOZA 4N9PA 5HURA 1S5DD 1SNDA 2SOBA 4DAVA 2BA1A 4NP5A 4RH6A 1I4RA 3K6OA 1ICWA 3A8JE 5ELDA 3RD4A 3I72A 3AB9A 4IFDG 3HOYB 1TS4A 1EEFD 1HA6A 2EYPA 3NUCA 5E3FA 1OXVA 3NSWA 3OIQA 1LTRD 2MP1A 3ND8A 3BDLA 1VDZA 4XIGS 3V2TA 1EOTA 3I4NB 2PYKA 1PTOF 3LWUA 3TN2A 5LL6S 1HFNA 3DHQA 3NTIA 2JP1A 1F2YA 4ZKBB 1XWEA 2XIWA 4AYBB 3A54A 4XT3B 1JOKA 4K2KA 5A35A 4FVMA 4BS9A 3QOJA 3D3RA 1OXTA 1SBBB 4J8QA 2DNCA 3LNNA 2PPBC 2EPBA 4E6IA 5EKKA 1A6XA 3J80L 3P75A 1RD9D 1GHJA 1SNQA 1CHQD 4HCSA 4DFAA 5IGGA 4DAYA 2JYOA 3Q23A 2QILA 1M4VA 3D6CA 1U4PA 4IUQA 2O5IC 1SEBD 3W2DA 4K8JA 5IODA 2HCCA 4HN7A 2FFKB 4RGMA 3NTKA 2JA6B 4NW2A 1LTSD 4KHZA 4KMUC 2EYLA 3MAQA 1YNNC 2FHTA 1TIID 3C1EA 1TT2A 3T53B 1H9RA 4XYOA 1FD7D 4C3JB 3SK4A 2L1BA 1PZID 5K36G 3N52A 2K1BA 3GO5A 1PRTB 1BDOA 1SYEA 2X6GA 1SJED 4KY6A 1JICA 2DN8A 3D8GA 3T13A 1WTRA 5C0XH 1O80A 3GTQB 2SNMA 4RWSC 4DXFA 4BY1B 3BS1A 1SYFA 4RFBA 3S16B 5EPJA 3X3NA 1D5XC 2F0VA 3I91A 3MHBA 5IOCA 3DM1A 3DWQA 3V05A 1LTTD 1T5XD 1NR2A 5JEAG 2OEOA 2F3VA 2ID0A 3K7AB 2IL8A 2K03A 3Q22A 1ZXTA 5C44B 5FO8B 1E2ZA 3EJIA 3PMFA 1QILA 4FYDA 4ZLTF 2B2YC 2XNAC 1VF7A 5I6WA 4K8IA 4FNFA 2K5QA 3K5OA 1Q12A 5D3DA 2R92B 2ENBA 1Y8NB 2F0SA 5EBCA 2KEEA 3T4AC 1ET6A 2I07B 3GTOB 1EYCA 2H4OA 3K58A 1EY4A 5G3LD 3M3YB 1WVLA 2JA7B 4LMQD 5JVG3 1ESRA 1DOLA 4EGVA 3NWSA 5FKAC 3S15B 1OXUA 4P2CB 3G6JB 2CW0C 1QWYA 5C3WA 1SMYD 3HGBA 1ZYRD 1PFNA 2Q8RE 2XWBB 4H13C 2BA0A 3DXJC 1EU3A 2F0EA 3BZDB 4K5VA 3J7AV 1RDPD 2GA4B 1NR4A 4YIJA 3PIO3 1QOHA 1R9TB 1GXDC 1B9MA 2BDNA 3DMUA 3NP8A 3J81E 2F0QA 4KD4A 2XSCA 2WAQB 1JOQA 5IGBA 1EIHA 1PDQA 2KOLA 4S3SA 2NN6H 1DZ1A 4KTAA 3IFDA 1FR3A 4DA2A 1AN8A 1HTLD 1CK1A 1DD2A 4ZRZA 3SK5A 4KY5A 3DUZA 5E4WC 3SEBA 5BN5A 1L0XB 2MPMA 1EWCA 1OXSC 1VMCA 5CBAE 1RODA 2Q8IB 2A6EC 2F1MA 3QWNA 1JQYD 2K33A 1Y1WB 3OOCA 4H44C 5IGDA 5T1GA 4G7ZC 3KUPA 2Z8LA 4X3UA 2R6GA 3VR2A 4OIKA 4DNRB 3Q24A 1EEID 4OO1I 2NB0A 4XYQA 1DOKA 3ERQA 4NDXA 4IUPA 3GV6A 1V1OA 5COYA 2VUMB 1GUTA 4K6DA 3VYTA 4DN4M 4K6LA 1TS2A 3BDCA 1Y8PB 4A3DB 1PRTD 4BA2I 4BBRB 4H7BA 2LFNA 3HS0C 3MWYW 5IT9E 4QB4A 1EL0A 1F9RA 2FJ2A 1ZYRC 5A2QE 4LJZC 3NWTA 1X32A 1WTWA 4KHVA 5KNBA 3I73A 2AWOA 4FF1A 1G6ZA 5KYIA 3MXUA 1BQQT 3K5LA 4Q5VA 2C5CA 3C1FA 2JEAI 2NUCA 4KKSA 2B63B 3Q6SA 1SNOA 2IJ0A 5DM73 1KTKA 2CVRA 4A3FB 3M4OB 1Z6HA 3R2TA 5I9OA 1HUMA 1RTNA 1EIGA 5JAVA 2A74C 1SYGA 1QE6A 2PQEA 1M8AA 1FGBD 1WTVA 2F0WA 1IYUA 1F2ZA 5CC4A 1QNKA 5FLXL 4CJ2C 2OXPA 1BR9A 2PZWA 5IIFA 2B2WC 1FYCA 1SMYC 5FLXE 1A2TA 1KABA 1I4GA 4EVOA 4BBSB 2IX1A 4RGOS 3W3AA 4FF2A 1EZ6A 3TZUA 3DEPA 2QKIC 2ZXOA 4B9XA 1F77A 2EJFC 1EWHA 1PRTF 4IUVA 3EQLC 1DYQA 1SFOB 1X3QA 5JPMC 1S5FD 1G91A 4I7ZC 4C3JG 2QEJC 4KJOA 5M5WB 2SDFA 1S5BD 4BA1I 1PLFA 3KLSX 3S1RB 3BDOA 3MC0B 3R93A 1Q3LA 5CV7A 1B4OA 4DGZA 3J7YW 3I4LA 4ULLA 3S14B 5C5LA 3R3OA 5M3MB 1BO0A 1A15A 3NQTA 5FOBB 3GTJB 2R93B 5A2QL 5NUCA 2E2HB 2A6HD 5CV6A 4MIUA 4RGNA 4RCNA 1YNND 1CA6A 4KN7C 3OWEB 2A68D 1ILPA 2A68C 1I4QA 2M00A 3SK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0L A;  2O4X A;  2EY5 A;  1EY4 A;  3SXH A;  1KDB A;  3HEJ A;  3TP5 A;  4RKL A;  3C1E A;  3SK8 A;  1JOR A;  3MEH A;  5CV5 A;  5I9O A;  1TT2 A;  4IZ8 A;  5JAV A;  1SNC A;  3MXP A;  4ZUI A;  2WAC A;  5ISR A;  1SYG A;  2EYP A;  1STN A;  1EQV A;  2PQE A;  4TRD A;  3SK4 A;  5KGU A;  5EGT A;  3HZX A;  3NUC A;  5E3F A;  5C4H A;  4YIJ A;  2F0W A;  5J39 A;  1EY7 A;  5IGD A;  1F2M A;  3ITP A;  4PMC A;  4ZUJ A;  1II3 A;  4ID6 A;  5DEH A;  2F0F A;  4PMB A;  5C4Z A;  5KIX A;  5EKL A;  3RUZ A;  4K2L A;  2EXZ A;  4QF4 A;  4K5W A;  1F2Z A;  3BDL A;  1SYE A;  4KY6 A;  3NK9 A;  5CR3 A;  2EY1 A;  3V2T A;  5CC4 A;  3TME A;  2PYK A;  5J22 A;  4HTH A;  1AEX A;  4K14 A;  4WOR A;  3TP8 A;  2F0H A;  3D8G A;  3S9W A;  3SHL A;  2OXP A;  1SYD A;  3DHQ A;  3LX0 A;  4EQP A;  2PZW A;  5IIF A;  3T13 A;  3ERO A;  5CV8 A;  2RKS A;  5KRU A;  5C3W A;  2F0P A;  1A3U A;  1EY9 A;  1F2Y A;  3D4W A;  4I65 A;  1A2T A;  5CGK A;  1KAB A;  1KDA A;  2SNM A;  5JOB A;  2F0N A;  2RBM A;  3ERQ A;  1TQO A;  4EVO A;  3EVQ A;  1EZ8 A;  4NDX A;  4ODG A;  5J1Z A;  2F0E A;  4K5V A;  1EY0 A;  1KDC A;  2F0K A;  1EZ6 A;  4NKL A;  2LKV A;  1SYF A;  5M9O A;  4QMG A;  4DU9 A;  1TR5 A;  1EYD A;  3OSO A;  3OMG A;  4WRD A;  4G57 A;  5E1F A;  1JOK A;  5IGE A;  3T16 A;  4K2K A;  4K5X A;  4KY7 A;  1STA A;  2PW5 A;  1EY8 A;  2EYH A;  3H6M A;  2F0V A;  4K6D A;  3MHB A;  1SYC A;  3OMC A;  3BDC A;  2EYJ A;  4LAA A;  1JOO A;  3MZ5 A;  3P1H A;  3QOJ A;  2QDB A;  1EY6 A;  1SYB A;  4B9X A;  4EQN A;  5KYL A;  1NSN S;  2F0O A;  2EY6 A;  1A3V A;  2EYF A;  5IOC A;  3D4D A;  5IGF A;  5C6A A;  1NUC A;  2KQ3 A;  3DMU A;  2SNS A;  2EYM A;  3NP8 A;  4H7B A;  1KAA A;  4OL7 A;  2F0Q A;  1SNP A;  4J1M A;  4F8M A;  2OEO A;  3TP7 A;  1ENA A;  4J6H A;  1STY A;  2F3V A;  4E6I A;  3OWF A;  4QB4 A;  5EKK A;  3QB3 A;  4KD4 A;  2F3W A;  2KHS A;  5C3X A;  4IAL A;  5KEE A;  1STG A;  4KJO A;  5F2D A;  4HMJ A;  5CV9 A;  3P75 A;  4B9W A;  4NMZ A;  4EQO A;  2HQE A;  2F0G A;  1JOQ A;  4KV6 A;  1SNQ A;  4ZQ3 A;  2F0T A;  5IGB A;  4DFA A;  4KHV A;  2F0U A;  3U9O A;  4DF7 A;  1EYA A;  4S3S A;  4N9T A;  5IGG A;  2F0I A;  5CV7 A;  3EJI A;  3PMF A;  3NHH A;  2EY2 A;  4DGZ A;  3NXW A;  4KTA A;  3D6C A;  2EYO A;  1U9R A;  5C5L A;  3R3O A;  1STH A;  1SNM A;  4RKB A;  4F7X A;  2F0D A;  5I6W A;  5KYI A;  4K8I A;  5CV4 A;  3QOL A;  1ENC A;  4PNY A;  2PZU A;  2PW7 A;  3NQT A;  5K5P A;  3SK5 A;  4KY5 A;  1A2U A;  4K8J A;  5IOD A;  2OF1 A;  2PZT A;  5NUC A;  3MVV A;  3VA5 A;  1A3T A;  3C1F A;  1IHZ A;  2ENB A;  4N9P A;  2NUC A;  5I9P A;  2F0S A;  5HUR A;  4R8N A;  2F0J A;  3SR1 A;  3TP6 A;  4KD3 A;  5CV6 A;  1SND A;  2SOB A;  4MIU A;  5HGT A;  1RKN A;  4KJN A;  4ME5 A;  1SNO A;  3E5S A;  1STB A;  2EYL A;  2F0M A;  4NP5 A;  5C5M A;  1EY5 A;  5IGC A;  2RDF A;  1EYC A;  5I6Y A;  4IUN A;  2M00 A;  5DAU A;  4HMI A;  3SK6 A; 
#chains in the Genus database with same CATH topology
 4DXG A;  1TWF B;  5J3B A;  2DY8 A;  3CCM A;  1G29 1;  1SNC A;  4C3H H;  2K5D A;  3KFU A;  2B2V A;  1STN A;  1HNW Q;  3RN2 A;  1S3O A;  4ZUJ A;  4OIJ A;  4PMC A;  1STE A;  3IAY A;  1T5E A;  5DEH A;  5KIX A;  2F0F A;  3AFP A;  2RHS B;  1IBL L;  4LF9 Q;  3CCR A;  4K2L A;  2EXZ A;  4DV6 Q;  1FJG Q;  1NY4 A;  3KF8 A;  3MTS A;  4FXG C;  4X64 Q;  4R4Q A;  1ENF A;  3NEM A;  4P72 A;  3T1Y Q;  4A3F G;  1KDA A;  2WV6 D;  5LHY 1;  2BCO A;  2Z6K C;  3GP7 A;  2IX0 A;  3K8A A;  3BZC A;  1TVX A;  1EZ8 A;  3EVQ A;  4A93 B;  4A3I G;  3HOV G;  2WP8 J;  2LKV A;  4XXE A;  5T1I A;  4R4T A;  1HJP A;  4GLA C;  1E22 A;  1QG7 A;  1X3F A;  5H1S E;  2XWJ B;  4YHH Q;  3OMC A;  4EQN A;  4POG A;  2QDB A;  4P71 A;  4OXP A;  2ZTC A;  5CBE E;  3CRK C;  4IN3 A;  5LMU Q;  1U0L A;  1VQN A;  1GO3 E;  4OL7 A;  2C35 B;  5FLX c;  1I6V C;  1SXT A;  4C3I B;  1H9S A;  2NTT A;  1J9O A;  1STY A;  3S1N H;  2NN6 I;  2NVT H;  4B9W A;  3D4R A;  3U4V A;  2L9H A;  2EE1 A;  4CJ1 B;  2ALY B;  4CDC C;  1IBL Q;  4ZQ3 A;  2K4K A;  4MHE A;  1AFP A;  2K28 A;  3UDI A;  4JI2 Q;  4O1N A;  1K73 C;  2J0T D;  2QA4 A;  3NXW A;  2B2V C;  2AQ2 B;  2B2U A;  3IRB A;  2A1A A;  4Y7N H;  3H91 A;  1IZ6 A;  1STH A;  4RKB A;  2F0D A;  3F2U A;  4X65 Q;  3CMA A;  1U4R A;  4JVZ A;  5IWA L;  4JG2 A;  2E2I H;  4LF8 L;  4UY8 C;  4KHP L;  4KD3 A;  1GVP A;  2Z4I A;  1PA6 A;  1BXT A;  2G9H D;  4XQJ A;  4ME5 A;  2MUY A;  2N55 A;  4HED A;  2X6L A;  2HCI A;  4B3M L;  1WTO A;  3KF6 A;  1PH9 A;  2NVQ H;  1HQM C;  3H09 A;  3BVG A;  1I50 B;  2L12 A;  2JE6 I;  1O7L A;  2M9V A;  1JWU D;  1KDB A;  3NBH B;  2R7Z H;  4RKL A;  3SK8 A;  2CFM A;  2NVQ B;  1IYV A;  2O2L D;  5EPL A;  1SE8 A;  3NTH A;  1K9M C;  3B6Y A;  2ZTD A;  1KC8 C;  3IFT A;  4DUZ Q;  5J39 A;  3HOX B;  3OIP A;  1FNU A;  4PMB A;  1UE5 A;  4HR7 B;  4QF4 A;  2EY1 A;  1H9M A;  4A3G H;  4X3S A;  1QJO A;  3S2H H;  2E2D C;  3P7J A;  1SFO H;  4LUV A;  1X55 A;  4DK6 C;  3KLS A;  1WTP A;  2CHB D;  4Y7N B;  2VZA A;  4X64 L;  3AYH B;  1HNZ L;  4AQY L;  1BCP D;  1Y1V B;  4U67 3;  2I5L X;  1BKB A;  2WKD A;  1DON A;  4RHR A;  5C4J H;  1Q82 C;  2K14 A;  3Q8D A;  1TR5 A;  3OSO A;  3CPW A;  4O2D A;  4TKO B;  3PO2 H;  4BBS H;  5EKI A;  5KND A;  4RAU C;  5KYL A;  1SYB A;  4F88 A;  4FO2 A;  4DK1 A;  4LK1 C;  4R9W A;  5GQO A;  2A6H C;  2K32 A;  2EOT A;  2JSO A;  2K6A A;  5LMN Q;  1MD2 D;  5IYD G;  1M1K C;  3NBH A;  2B2T C;  3TZD A;  4UP7 A;  1E24 A;  5ELE A;  1J8I A;  3SDZ A;  3OW7 A;  3CCE A;  3L2P A;  2L55 A;  1X3P A;  3MA2 B;  1SE2 A;  1TS5 A;  2F0U A;  1JC7 A;  5IYB H;  5M3F B;  4C1N I;  2D62 A;  1FL0 A;  1QNU A;  3G48 A;  1PMR A;  1XMO L;  4A3B G;  4JOI A;  1MSH A;  4PNY A;  5ELO A;  1SAP A;  1E7Z A;  1SSO A;  3CF5 A;  3ND9 A;  4QL5 A;  2WIN B;  1B2T A;  3JAM L;  2QW7 A;  4I7A A;  4JYA Q;  3TP6 A;  2E2I B;  1E2W A;  5IP9 H;  5K36 H;  2A6E D;  2FMC A;  4CKC A;  4RGT A;  3GTG B;  3O13 A;  1JWS D;  2VXW A;  2HDL A;  1BBU A;  1PZK D;  4ABN A;  1TWF H;  5DAU A;  3AQQ A;  3ZYY X;  1DOM A;  1V43 A;  3MEH A;  2IWH A;  4M1U B;  2A73 B;  4IZ8 A;  2JXM B;  2ATW A;  1JB3 A;  3A7L A;  2Q2H A;  4DAY B;  4LFC L;  2ZXR A;  2UUC Q;  1Y8O B;  3MXN B;  4OO1 G;  4DR1 L;  1EY7 A;  1HTP A;  4X6A H;  4X3T A;  4ID6 A;  4GNX A;  1W3S A;  1JJ2 A;  2AUK A;  1CKN A;  1ZKO A;  5EJW A;  5IYD H;  5FK9 C;  5J22 A;  4XQN A;  1KNA A;  2XGT A;  1L1O B;  5M3M H;  1CSP A;  1WYD A;  1RTO A;  4IPH A;  1VQJ A;  4DV1 L;  2F0P A;  4B3S L;  1B3A A;  3D4W A;  3QR8 A;  4NXM L;  4IJH A;  1Z7T A;  3T1Y L;  1H9J A;  3S1R H;  2R7Z B;  5I2X A;  1XX8 A;  2XRS D;  2SEB D;  4IJL A;  4JK1 C;  1PV4 A;  3PO2 B;  3U9S A;  1ASY A;  4KY7 A;  4XT1 B;  3URY A;  1BNZ A;  1GUN A;  1HZA A;  4ILW A;  2L15 A;  1JOO A;  3A55 A;  3VA7 A;  2CH4 W;  4PG3 A;  2EYF A;  3D0F A;  3K59 A;  2K01 A;  1GHK A;  1MGS A;  4L5Q A;  2PNH A;  1X3G A;  2B2Y A;  3M4P A;  1KAA A;  1S72 A;  2P5Z X;  1SNP A;  4M8A A;  2R61 A;  4X66 L;  3PIP A;  3T51 B;  4A3G B;  4HMJ A;  3VR5 A;  4NMZ A;  5COR A;  2F0G A;  2CW0 D;  1H9S B;  2E2J H;  1XJV A;  3HRZ C;  3D31 A;  2NVT B;  4XQQ A;  3GTM B;  4OWX B;  2Y0S E;  1PZJ D;  3G7L A;  4A3C H;  2DNE A;  3KOJ A;  4F7X A;  1EFI D;  3JC6 6;  1FNW A;  1LT4 D;  3OTO L;  3J7A 5;  3TDQ A;  1GUW A;  1GM5 A;  1I4H A;  3W1B A;  1F2L A;  1PTO D;  1I94 L;  3VA5 A;  3J80 E;  1U4L A;  4IFD J;  2JA6 G;  3SR1 A;  1BF4 A;  1SR3 A;  1CKM A;  2EZV A;  5KNC A;  4MTN A;  1YNJ C;  1I94 Q;  1IYJ B;  2CWP A;  2DY7 A;  3R8B A;  5JJK A;  4BBR H;  5I6Y A;  1L2F A;  3QIA A;  4GZY C;  5FO7 B;  2K52 A;  4GNX B;  2ZJR A;  3PCO B;  5ISR A;  1WD1 A;  1YHB A;  5KGU A;  1MJC A;  1LAC A;  3J81 L;  1VQF A;  2LXK A;  1PXU A;  3RUZ A;  2KCN A;  4HSV A;  1JR0 D;  1DJR D;  1KNE A;  1X54 A;  1X56 A;  2UUA Q;  2AQ3 B;  1F9S A;  4EQP A;  4A3M G;  4LUO A;  2UXD Q;  1Y1V H;  3MXG A;  3GTL B;  3SE0 A;  3PUV A;  3S17 H;  2EJM A;  3ONA B;  2KED A;  1V9P A;  1RF2 D;  4QIW E;  4DR3 L;  1MSG A;  1XYI A;  1Z47 A;  2B8F A;  3HP3 A;  1KDC A;  3S2D B;  3JAM E;  4WRD A;  4IQZ A;  5E1F A;  3T16 A;  1WCM H;  3DEO A;  3C46 A;  1E2V A;  4A3D H;  1PTO H;  1LT5 D;  3T56 B;  3L9A X;  4QCL A;  3M4O H;  2K5H A;  2NN6 G;  4J6H A;  2BE5 D;  5C44 G;  1YJN A;  4JI6 Q;  4BBS G;  4WJ4 A;  3LGJ A;  3MEF A;  3PUY A;  4GS3 A;  5CV9 A;  4DR7 L;  4IUR A;  3PV0 A;  4EQO A;  1C7Y A;  4NXN Q;  3UI2 A;  3L0O A;  3K80 C;  4A3E G;  3IL8 A;  1ESF A;  4GOP A;  3NEL A;  3CCS A;  1E0B A;  4C3H B;  1VQO A;  2PI2 A;  4GKJ L;  4LNQ A;  3HOZ B;  4C2M B;  4JI5 L;  4U68 A;  2HDM A;  2E5L Q;  1B70 B;  2PQA A;  3R2I A;  4A3J B;  2PW7 A;  5K5P A;  1K8M A;  3PF5 A;  1QVF A;  2A5H A;  2UU9 Q;  1YHQ A;  4FXK C;  4DKA C;  1GKH A;  3G6E A;  3P20 A;  2Z9H A;  1LT3 D;  3M85 A;  4JI5 Q;  3TBI B;  4A3G G;  1LLR D;  1PH5 A;  3E5S A;  1FNV A;  3MXN A;  5C5M A;  1EY5 A;  3N6R A;  3T1H Q;  1I3Q B;  3GTJ H;  4UAI A;  3PO3 G;  3BU2 A;  3KBG A;  2HT1 A;  2QF7 A;  3L3O C;  1KL9 A;  1GD7 A;  2PMZ B;  3MXP A;  3A7A B;  1I6H B;  4FDB A;  5EGT A;  2I46 A;  1Q81 C;  1GJX A;  1II3 A;  4R8I A;  2WII B;  3A56 A;  4QUF A;  4DV3 Q;  4L6T B;  4K0K L;  4HAE A;  3TP8 A;  5FLM G;  1YIT A;  4JI4 L;  3H94 A;  2J7Z A;  2PO4 A;  1SE4 A;  4JOI C;  1D2B A;  3ERS X;  1SMX A;  3CQZ H;  2LS0 1;  1IXR A;  1CT1 D;  2E75 C;  4DUY Q;  1VQ8 A;  1CA5 A;  1FJG L;  4LF7 Q;  2BE5 C;  2F0N A;  3GD7 A;  1O7Z A;  4KKU A;  1DM0 B;  5J1Z A;  4NKL A;  1Q8K A;  4ZAI A;  1EYD A;  2B2T A;  3CC7 A;  5JEA J;  3FVQ A;  4LF7 L;  2XRQ D;  1IKM A;  3K0Y A;  1STA A;  4YCW A;  2AWN A;  1OXX K;  4DNI A;  3P1H A;  2IW3 A;  4RG1 A;  4YY3 L;  1LTB D;  1Y1W H;  1I4P A;  2XN9 C;  3D4D A;  2VUM G;  1N34 Q;  3WOE A;  1TWH B;  1B50 A;  2MO0 A;  2LMC B;  2EYM A;  2VNU D;  1RJT A;  4F8M A;  2K5V A;  1KIX A;  3I4M B;  1WCM G;  3RZD H;  4A3L H;  4ME3 A;  3QB3 A;  1HNW L;  2CKZ B;  4CBV A;  3VYR A;  2V4D A;  3M4Q A;  2EQS A;  3HOV B;  4CDD C;  1D5Z C;  4CHT B;  3H0G B;  1BOS A;  4G7H C;  1BVS A;  1ASZ A;  1SJH D;  2QCP X;  1N36 Q;  4CKB A;  1VCI A;  2B8G A;  4B3M Q;  2JN4 A;  5ELC A;  1PYW D;  3RN5 A;  3PGZ A;  1A2U A;  4DNT B;  3VYU A;  3MVV A;  2K05 A;  2ICE C;  1NJI C;  2UU9 L;  2IT1 A;  3C2P A;  1TWG B;  1RKN A;  2EVB A;  5JJZ A;  3QO2 A;  4G7O C;  4A3J H;  2BDO A;  4X62 Q;  4X3K A;  4IUN A;  4JBM A;  1LV9 A;  2O4X A;  1WD0 A;  2EY5 A;  4ZKC B;  3M7N A;  3VR3 A;  1D1K A;  1JWM D;  1BBX C;  1UAP A;  1A8V A;  2Q2I A;  1B9N A;  1PTO C;  2WAC A;  4AH6 A;  3FRP B;  2ASB A;  2VQF L;  2JA8 B;  2NVX B;  3F8T A;  1ML0 D;  2L5T A;  5C4Z A;  3S1Q H;  2J4X A;  3WOF A;  4A3L G;  1ZEQ X;  3DWP A;  5I4D A;  4DV4 Q;  2B3G A;  3TME A;  2UXC Q;  4K14 A;  4O0A A;  4WOR A;  4MN3 A;  3ULL A;  4DAP A;  3F2B A;  2NTS A;  1UNS A;  3GV3 A;  2JA5 B;  5M3M G;  4JI1 L;  2B2W A;  5KRU A;  1PFB A;  1E1O A;  3CQZ B;  2UXB L;  1WJJ A;  3OYY A;  1PFS A;  4ZK9 B;  4H0L C;  1IBM L;  2RCN A;  1TQO A;  3LWE A;  1LO5 D;  2BH2 A;  1GUG A;  4A3K B;  1EY0 A;  4RA8 A;  2UXB Q;  4P75 A;  3MFY A;  4GOP C;  4A3K H;  3I90 A;  3A0J A;  3RZD B;  4G57 A;  3E0J A;  2PW5 A;  3H0G G;  3H6M A;  1S4Z A;  2I0Q A;  5FO9 B;  3I8Z A;  1GUS A;  3M3Y H;  5EPK A;  1ONL A;  1YVC A;  2KQ3 A;  2SNS A;  1HQR D;  3GTK B;  1NE3 A;  3E3X A;  1CQF A;  3IKJ A;  4DR1 Q;  3T1H L;  1HUN A;  2VQF Q;  2F3W A;  2KHS A;  1NBW A;  4IAL A;  4A3M H;  3PIP 3;  3FKI G;  1J6Q A;  4R1J A;  2AQ1 B;  3PO3 B;  2A19 A;  1CHP D;  2KHI A;  4HSP A;  2YYZ A;  3HOY H;  3FPU B;  5L37 A;  4PZ7 A;  4O42 A;  4LW1 A;  4OON A;  1NTG A;  3M4Y A;  4JI7 L;  3PSI A;  2N49 A;  3EN2 A;  1K83 B;  1JMC A;  3KLR A;  4YWK A;  4PZ6 A;  1FGU A;  2GN5 A;  4P73 A;  4R8N A;  3KBX A;  1AZP A;  4C56 C;  3L7Z C;  3K7U C;  2R92 H;  1G2T A;  3UDG A;  1CZW A;  4KJN A;  1SRO A;  2F4I A;  5IE8 A;  2XVS A;  5JVH 3;  2L11 A;  3TP5 A;  1U4M A;  1MHW C;  1DCZ A;  4UP8 A;  1TWH H;  4KLK A;  4TRD A;  5IT9 L;  1Q1B A;  1UE6 A;  2ZTE A;  2Z1C A;  3NQI A;  5M5Y B;  5D14 A;  3S15 H;  1HFG A;  3GDE A;  5EKL A;  4DK0 A;  4PMW A;  4JPB W;  3S1Q B;  2PQA B;  1L1O C;  4L8J A;  4C1N K;  4C2M H;  3LX0 A;  4H02 A;  1HZC A;  2Y0S B;  1J5E Q;  5CMD A;  2Z6B A;  1A3U A;  2WAQ E;  4HCE A;  4LFB Q;  1IW7 C;  5CGK A;  3BYY B;  5JOB A;  4V19 0;  4AQY Q;  2RBM A;  1J5E L;  3KF6 B;  1EU4 A;  1O78 A;  3HOY G;  2KA7 A;  3V96 A;  3OMG A;  1RCV D;  2K5N A;  1CTM A;  1MIU A;  2MJ8 A;  3KK7 A;  1W2B A;  4LAA A;  4PQX A;  2EDG A;  1NSN S;  2ZXP A;  3J80 c;  3K57 A;  1NUC A;  1C4Q A;  5GAH C;  1W6K A;  5IP7 H;  4A3D G;  1LTL A;  2FMM A;  3I2Z A;  1AW7 A;  3CME A;  1V8Q A;  5IYC G;  1WCM B;  1F9P A;  2A69 D;  3BYT B;  3KJP A;  2Q8T A;  5ELN A;  1E1T A;  3BVM A;  1OO9 B;  3UE1 A;  1MJE A;  2KJX A;  4BXX H;  2IY5 B;  1RL2 A;  1AZQ A;  2WB1 E;  4N9T A;  4BY7 G;  4CJ0 B;  4GN3 B;  1YJW A;  4LFB L;  5GAD C;  4HJ5 A;  1NCV A;  1XXG A;  5CV4 A;  1B53 A;  2TSS A;  1K8G A;  5EQ0 A;  5G3L F;  2PZT A;  3BVZ A;  1EFW A;  3F2C A;  4LFA L;  5HGT A;  2N88 A;  1RHP A;  5IYC H;  2JEB I;  4JYA L;  4L63 B;  3HFZ B;  2I5M X;  4A3M B;  1MBY A;  3CRL C;  2L4N A;  3DWA A;  2YU9 B;  3J7A F;  3I70 A;  3MFG A;  2OT2 A;  3VR4 A;  2F0L A;  3GTK H;  3AMU A;  4L5T A;  4HJ8 A;  1B8A A;  3JAM c;  3OPO A;  2C9O A;  1QVG A;  1EUJ A;  2GVA A;  4IFD H;  1NMF A;  1R9T H;  4JBJ A;  3K5N A;  4DV2 L;  4LUZ A;  3CW2 C;  4G4K A;  1F2M A;  4OEM B;  1TWC B;  4Q0F A;  4UDU C;  2AUJ D;  4KKT A;  1D7Q A;  4IFD I;  2K7V A;  2M2L A;  4HTH A;  1AEX A;  4A3I H;  2K04 A;  1BCP C;  2F0H A;  1BCP B;  1TWA B;  3K81 C;  4UP9 A;  2F03 A;  5C3E H;  3A5Z B;  1CM9 A;  3VR6 A;  4XTC S;  4TVA B;  1Q1E A;  4BY7 H;  3S17 B;  3RLN A;  3HKZ E;  3WDN A;  2O5J C;  4ODG A;  5BN3 A;  4OO1 H;  1C0A A;  4DV7 L;  1C48 A;  5I2Y A;  5IGE A;  4C3H G;  3S16 H;  4A3E B;  2JA6 H;  2RVL A;  2RDG A;  1JE4 A;  5IWA Q;  1SDF A;  3HG9 A;  4QQB X;  5TSS A;  1EY6 A;  2F0O A;  3GQB A;  2UUC L;  4LFC Q;  2VB3 X;  1KLG D;  1Q90 A;  1H9K A;  4IPC A;  4LF4 L;  1JJC B;  3HOZ H;  4JBW A;  1AH9 A;  3GTG H;  4AYB G;  4DV0 L;  1V1P A;  2EIF A;  4OGQ C;  1ILQ A;  1B3Q A;  2WKC A;  4BXX G;  2NWG A;  1IL2 A;  2KVM A;  4KV6 A;  1HR0 L;  3CKI B;  1B1Z A;  4DF7 A;  3SVM A;  1IL8 A;  4QJF A;  4DK3 C;  4A76 A;  5C0X G;  1PH6 A;  2EYO A;  2HD3 A;  4HIM A;  1SE3 A;  2IX3 A;  3GTP H;  5IP7 G;  1MKH A;  3QG1 A;  3NPP A;  2LY7 A;  1ENC A;  1CQV A;  2PZU A;  4N8F A;  4DR2 L;  2NZH A;  2R7F A;  1CZG A;  1PTO B;  2R7Z G;  2VQE L;  1X9N A;  4KI0 A;  1A3T A;  1YZ6 A;  2KCT A;  5I9P A;  4QY7 A;  5AFW A;  4A3B B;  1LT6 D;  4Y52 H;  1VQ6 A;  1M90 C;  1V1P B;  2B39 A;  2RDF A;  3CP0 A;  3I4M H;  4HMI A;  3HOW H;  1A0I A;  4WFN 3;  3GTM H;  4CKE A;  1B7Y B;  5M5X H;  4B08 A;  3RNU A;  1BUV T;  1HZ9 A;  2KEC A;  3FKI H;  2F4V Q;  1EQT A;  5DM6 3;  1VQE A;  3E9I A;  3CCJ A;  1N33 Q;  1S5C D;  3H15 A;  2N78 A;  3QJY A;  3NK9 A;  3HKS A;  1N32 Q;  1FVI A;  3BG3 A;  2MQH A;  4DPG A;  3S9W A;  1X6O A;  3GTQ H;  5JEA H;  1TY2 A;  4I65 A;  2PCF B;  1WI5 A;  1YI2 A;  2OQK A;  1DXM A;  4JI4 Q;  4QUC A;  1UE1 A;  4JI3 L;  4KN4 C;  2RA4 A;  4K5X A;  3CHB D;  1PFM A;  3S2D H;  1EY8 A;  4PV1 C;  2EYJ A;  2HUG A;  4FF4 A;  1YHA A;  3KLW A;  5C6A A;  1I50 H;  2CCZ A;  4A3C G;  2JA5 G;  4J1M A;  3FEW X;  4YY3 Q;  1ENA A;  1CI3 M;  2VB2 X;  5DNF A;  3RMH A;  4IOC A;  4JV5 L;  3PUW A;  5KEE A;  4DV6 L;  1VMP A;  5EAY A;  2B63 G;  3ICE A;  1R4P B;  1N33 L;  2AKW B;  1GUO A;  2OQ0 A;  1HZB A;  1F9Q A;  3S24 A;  1EYA A;  1K8O A;  1K3B C;  2F0I A;  2HIX A;  2EY2 A;  3EA6 A;  1HH2 P;  1UEA B;  4NPS A;  1HR0 W;  2X69 A;  4L5R C;  4KK7 A;  4XDX A;  2E5L L;  3S1M H;  3A8I E;  2ZT9 C;  2G5D A;  1D8L A;  2OF1 A;  5ELB A;  2MHV A;  1LUZ A;  2CQA A;  3J81 i;  4DR6 Q;  1B44 D;  1U5K A;  3Q0A A;  4BWG B;  4UHV A;  2DJF C;  4HJA A;  2RDH A;  3HOU G;  1STB A;  5E4X A;  1BCP F;  4YHH L;  2CWA A;  5IGC A;  1YNX A;  4IO9 A;  4JI6 L;  1Q8I A;  2R3Z A;  1XPU A;  1LTG D;  2PNR C;  1SN8 A;  1JOR A;  5D3I B;  3CCV A;  2Z4H A;  1JCK B;  1NMG A;  1XTC D;  4ZUI A;  1EQV A;  1K0R A;  3M7G A;  4P74 A;  3HZX A;  4C3I G;  1QB5 D;  3A5U A;  1L1O A;  1V1Q A;  2RSO A;  2L0C A;  2E2J B;  1VQ5 A;  2ZM6 L;  3CU7 A;  1VQL A;  4K5W A;  5CR3 A;  1EQR A;  2RSN A;  3KJO A;  4Z9C B;  2TMP A;  1EQQ A;  4DV0 Q;  2NZ1 D;  3FP9 A;  3I3C A;  3ERO A;  5CV8 A;  4IUU A;  1E3P A;  2ICI A;  1RIP A;  4IUT A;  1EY9 A;  2DGY A;  2MGS A;  1S5E D;  2A69 C;  1YJ9 A;  1I4X A;  5CYU A;  1TKW B;  4OHJ A;  5C4J B;  1W6J A;  1PRT C;  4DU9 A;  5BN4 A;  5C0X I;  2KUM A;  3CCU A;  1D5M C;  3C3L A;  2EYH A;  5D65 A;  1SYC A;  1C8C A;  3MZ5 A;  4WJW A;  5M5X B;  1LAB A;  2VL6 A;  2EY6 A;  1A3V A;  4LFA Q;  3HOU B;  1UE7 A;  4GLX A;  1XPO A;  1VQG A;  1JT8 A;  1VF5 C;  3TSS A;  3RZO B;  3RR5 A;  1R4Q B;  3TP7 A;  1L0Y B;  4LF5 L;  1YNJ D;  3OWF A;  5LL6 X;  3PUZ A;  5C3X A;  4FF3 A;  1CFM A;  2NYZ D;  2HQE A;  3PF4 A;  1SLJ A;  2F0T A;  1EIF A;  3U9O A;  2JJQ A;  1WTX A;  3CCL A;  1IKL A;  5E7N A;  3NHH A;  4LWC A;  3GTP B;  1XTD A;  4MNO A;  5AJ3 L;  1HCZ A;  3FMC A;  1KRS A;  4TQU S;  4ZCK A;  4CDE C;  3QOL A;  1EYG A;  4DR4 L;  3HOU H;  1HRJ A;  1ET9 A;  1IHZ A;  1TS3 A;  2B2U C;  2F0J A;  4RHS A;  5BR8 Q;  1VQP A;  3NE5 B;  2LSS A;  4FP5 D;  4LF4 Q;  3OHX C;  5C4X B;  1EWI A;  1WTQ A;  1AP0 A;  2D9U A;  2F0M A;  3AU7 A;  2JK8 A;  5M3F G;  4EQ5 A;  3HOW B;  3CPF A;  1LTI D;  3SXH A;  3HEJ A;  4C3I H;  1HXY D;  3U50 C;  2H5X A;  5CV5 A;  1IBK Q;  2NVY B;  1G8Z D;  1NAP A;  3A8K E;  1H95 A;  2FXQ A;  1XNR Q;  5C4H A;  2K5W A;  3ITP A;  4FXD A;  1G6P A;  3J80 i;  3S2H B;  2DUD A;  2RF4 A;  3S1N B;  3HOX H;  1Q7Y C;  4RCO A;  3I4O A;  1KXL A;  3SHL A;  1SYD A;  2WB1 B;  4DUY L;  1KAW A;  2RKS A;  1K28 A;  4ZYS A;  3D6W A;  5EBD A;  1HA5 A;  1QUQ A;  2G9D A;  5JPN C;  1PH3 A;  5ELF A;  1N8R C;  1Q46 A;  1MI2 A;  2D0O A;  3BJU A;  3FHW A;  3H3V C;  3PUX A;  4DV1 Q;  4JI3 Q;  1HHV A;  2D5D A;  3CAM A;  2F0K A;  5M9O A;  2NBF A;  4JI8 Q;  2IHF A;  4QMG A;  2BH8 A;  2E74 C;  4A93 H;  2KCC A;  2Z0S A;  1L0W A;  3UDX A;  3K5M A;  1Y69 U;  3VYS A;  3FDT A;  4TSS A;  2IPK D;  3E6Z X;  4QIW B;  1D1I A;  4F87 A;  4UPA A;  1O7Y A;  2H1E A;  2RQX A;  1IW7 D;  3S1M B;  5IGF A;  1TU2 B;  2NVY H;  4L5S A;  2BOS A;  1G2S A;  2FIN B;  3WWV A;  1UUP A;  2B29 A;  1P8L A;  4CGY B;  1QCB D;  2K75 A;  4N8X 1;  1HPC A;  2UXC L;  1STG A;  5F2D A;  3FKI B;  2E76 C;  3J81 j;  3G4S A;  4V0B A;  3JAM i;  4DV5 L;  5C0X J;  1VQK A;  1TY0 A;  1QZH A;  4A3B H;  4BY7 B;  3E9H A;  4GKK Q;  1IBM Q;  5C3E B;  3FPP A;  1WOC A;  2F52 A;  1U9R A;  2KBN A;  3RLF A;  1CSQ A;  1SNM A;  3X3M A;  2CH4 A;  2D2C C;  4A3I B;  4B3T L;  3NBI A;  1T9H A;  1N36 L;  3S14 H;  4GKK L;  2EJG C;  4JI7 Q;  1LTA D;  3EFX D;  1TWC H;  3HKZ B;  1KLU D;  1D6E C;  1GOZ A;  4KHP Q;  4N9P A;  4IPD A;  5HUR A;  2KCM A;  2E2H H;  1S5D D;  4LF8 Q;  1SND A;  2SOB A;  4DAV A;  2R93 H;  4LF6 Q;  4A3K G;  2BA1 A;  4IPG A;  4NP5 A;  4RH6 A;  1I4R A;  3K6O A;  1ICW A;  4R4C A;  5LMN L;  3A8J E;  3CXC A;  1A63 A;  2R7D A;  4DR5 L;  1UEB A;  5ELD A;  3RZO H;  3RD4 A;  3I72 A;  3AB9 A;  4IFD G;  3HOY B;  1TS4 A;  1EEF D;  3KF8 B;  4MZ9 A;  4APV A;  1HA6 A;  2EYP A;  1VQI A;  1AE2 A;  3NUC A;  5E3F A;  1OXV A;  3NSW A;  3OIQ A;  1LTR D;  2MP1 A;  3ND8 A;  1QVC A;  4BY1 G;  3BDL A;  1VDZ A;  2MO1 A;  4XIG S;  3V2T A;  3HKZ G;  2N3S A;  2PYK A;  1EOT A;  4JI0 Q;  2HIV A;  1PTO F;  3LWU A;  3I4N B;  3TN2 A;  5LL6 S;  1HFN A;  3DHQ A;  4AYB E;  4DV7 Q;  3NTI A;  2JP1 A;  1F2Y A;  4ZKB B;  5C3E G;  4IOA A;  2UUA L;  1XWE A;  4GLV B;  1HNZ Q;  2XIW A;  1ICF B;  4NXM Q;  4AYB B;  3A54 A;  3PIO A;  1TWA H;  4XT3 B;  2AHO B;  1JOK A;  4JI8 L;  4K2K A;  5A35 A;  4FVM A;  4BS9 A;  3QOJ A;  3D3R A;  3UE0 A;  1OXT A;  1X3E A;  2VW9 A;  1SBB B;  4J8Q A;  2DNC A;  4RMF A;  3LNN A;  2V1C C;  2PPB C;  2EPB A;  4E6I A;  2VUM H;  5EKK A;  2QEX A;  1A6X A;  3J80 L;  3P75 A;  2YU9 H;  1RD9 D;  1GHJ A;  4EX5 A;  1LYL A;  2OTL A;  1SNQ A;  1CHQ D;  1IBK L;  4HCS A;  4DFA A;  1AE3 A;  5M5W H;  2UXD L;  5IGG A;  4DAY A;  2JYO A;  2QIL A;  3Q23 A;  1M4V A;  3TQY A;  3D6C A;  2MFI A;  2ES2 A;  1U4P A;  4X65 L;  2KEN A;  4GN4 B;  4IUQ A;  4HJ7 A;  2O5I C;  1SEB D;  2WB1 G;  3W2D A;  3ULJ A;  4MTK A;  3G71 A;  4K8J A;  5IOD A;  2HCC A;  2YTY A;  3TRE A;  4HN7 A;  2FFK B;  4RGM A;  2D0P A;  3NTK A;  3TS0 A;  2JA6 B;  4NW2 A;  1LTS D;  4KHZ A;  4KMU C;  4HID A;  1K8A C;  4LF6 L;  2EYL A;  2JQO A;  3MAQ A;  1YNN C;  2FHT A;  1TII D;  1CUK A;  3C1E A;  1TT2 A;  3T53 B;  5LMU L;  3ER0 A;  1H9R A;  4XYO A;  1FD7 D;  4C3J B;  1LM0 A;  3SK4 A;  3TEH B;  2L1B A;  1YBY A;  4JV5 Q;  1PZI D;  3HOV H;  4CDF C;  3F2D A;  5K36 G;  3N52 A;  2QDL A;  2K1B A;  1O7I A;  4DR7 Q;  3GO5 A;  1PRT B;  1BDO A;  1SYE A;  2X6G A;  1SJE D;  4KY6 A;  1HR0 Q;  1JIC A;  1VQM A;  2DN8 A;  1A62 A;  4ALP A;  3D8G A;  5IT9 c;  3T13 A;  1WTR A;  1CKO A;  5C0X H;  1O80 A;  3GTQ B;  3J81 c;  2SNM A;  3TS2 A;  4JCV E;  4RWS C;  4DXF A;  4BY1 B;  3BS1 A;  4A3E H;  1SYF A;  4RFB A;  3S16 B;  3NEN A;  4BY1 H;  5EPJ A;  3X3N A;  1D5X C;  2F0V A;  2VY3 A;  3I91 A;  3MHB A;  1YIJ A;  5GAG C;  5IOC A;  4X62 L;  3DM1 A;  1JE5 A;  3DWQ A;  2WAQ G;  3V05 A;  1LTT D;  1T5X D;  3HOW G;  1NR2 A;  4A75 A;  5JEA G;  2OEO A;  1JJG A;  2F4V L;  2F3V A;  2ID0 A;  3K7A B;  1PH8 A;  2IL8 A;  4OWT B;  4DV3 L;  4K0K Q;  2ZJP A;  2K03 A;  3Q22 A;  1YEZ A;  4R4O A;  3F1Z A;  1ZXT A;  1QUQ B;  5C44 B;  5FO8 B;  4NXN L;  1E2Z A;  3EBE A;  3EJI A;  3PMF A;  3E0E A;  1XMO Q;  1QIL A;  1CKN B;  4FYD A;  4YWM A;  4ZLT F;  2B2Y C;  2XNA C;  3AEV A;  4WJ3 M;  3H0G H;  1VF7 A;  5I6W A;  4K8I A;  5HY6 A;  4FNF A;  1XPR A;  2K5Q A;  3K5O A;  1Q12 A;  5D3D A;  2R92 B;  2ENB A;  1BBW A;  1Y8N B;  2F0S A;  5EBC A;  3U58 A;  1K83 H;  2KEE A;  2PMZ E;  2HHH Q;  3T4A C;  2B63 H;  4X66 Q;  1ET6 A;  2I07 B;  3GTO B;  2DJG C;  1EYC A;  3DLL A;  2H4O A;  1HNX Q;  1N34 L;  1Z9F A;  5LMN W;  3K58 A;  1EY4 A;  5G3L D;  3I7F A;  2MNA A;  1I5F A;  1Y1W G;  2JA7 G;  2UUB L;  3M3Y B;  5JJL A;  2IHE A;  1WVL A;  2JA7 B;  3ZJY C;  4LMQ D;  3W5O A;  5JVG 3;  1ESR A;  4A4I A;  2A8V A;  1DOL A;  2K50 A;  4EGV A;  3NWS A;  5IYB G;  5FKA C;  3VDY A;  3S15 B;  1OXU A;  4P2C B;  2ZM6 Q;  3G6J B;  2CW0 C;  3KYH C;  1QWY A;  1SMY D;  5C3W A;  3HGB A;  1ZYR D;  3CD6 A;  1PFN A;  2Q8R E;  2XWB B;  4H13 C;  2JA8 G;  2R92 G;  2BA0 A;  3DXJ C;  1WFQ A;  1XMQ L;  1EU3 A;  1K3R A;  2F0E A;  3BZD B;  4K5V A;  3J7A V;  5FLM H;  4GOP B;  2YTX A;  1VQH A;  1RDP D;  2GA4 B;  1NR4 A;  4YIJ A;  2QGQ A;  4GN5 A;  3PIO 3;  1QOH A;  4A93 G;  2RCF A;  2OTJ A;  1R9T B;  1PVO A;  1GXD C;  1B9M A;  2BDN A;  2HQL A;  3DMU A;  3NP8 A;  2UUB Q;  3J81 E;  2F0Q A;  4A3F H;  2F3I A;  4A3J G;  2AMC B;  4KD4 A;  1VQ9 A;  5C4X G;  4DV5 Q;  2XSC A;  2NVX H;  2WAQ B;  2EXD A;  5HGQ A;  2Q2U A;  3HOX G;  1JOQ A;  5IGB A;  4DR4 Q;  1EIH A;  1KRT A;  1PDQ A;  2KOL A;  4S3S A;  4B3R Q;  4GKJ Q;  2NN6 H;  1DZ1 A;  4KTA A;  3IFD A;  5BR8 L;  1FR3 A;  4DA2 A;  4B3S Q;  1AN8 A;  1HTL D;  1CK1 A;  2VS1 A;  1WTH A;  1DD2 A;  4ZRZ A;  1VS0 A;  4YWL A;  4KY5 A;  3SK5 A;  1TWG H;  3DUZ A;  1VQ4 A;  5E4W C;  5AJ3 Q;  2VQE Q;  3SEB A;  5BN5 A;  1G51 A;  3W1G A;  1L0X B;  2MPM A;  3BZK A;  1N9W A;  1EWC A;  1OXS C;  1VMC A;  4J15 A;  2R93 G;  5CBA E;  1ROD A;  2Q8I B;  3J7Z C;  2A6E C;  2F1M A;  1PH1 A;  3QWN A;  5IY0 A;  1I3Q H;  1EOV A;  1JQY D;  3I56 A;  4OEL B;  2K33 A;  1PH4 A;  1Y1W B;  3OOC A;  4LF5 Q;  4H44 C;  5IGD A;  3PO3 H;  5T1G A;  4LF9 L;  4G7Z C;  3KUP A;  2Z8L A;  4X3U A;  1N32 L;  2R6G A;  3VR2 A;  1XNR L;  4DV4 L;  1PHJ A;  4OIK A;  4DNR B;  4B3R L;  2JA7 H;  3Q24 A;  1EEI D;  4OO1 I;  2NB0 A;  3H3V I;  1VQD A;  4XYQ A;  4JC0 A;  1DOK A;  3A74 A;  3I55 A;  3I4N H;  1VQA A;  3ERQ A;  4NDX A;  3STB C;  4IUP A;  3GV6 A;  1V1O A;  3H3V H;  5COY A;  2VUM B;  5JJI A;  1GUT A;  4HJ9 A;  1EIY B;  1VQC A;  4K6D A;  3VYT A;  2OCE A;  3M9B A;  4K6L A;  4DN4 M;  5M5Y H;  1TS2 A;  2KHJ A;  3BDC A;  2GVB A;  4JBK A;  4PZ8 A;  1Y8P B;  4DUZ L;  4A3D B;  1PRT D;  1VQB A;  4BA2 I;  4BBR B;  2Q2T A;  4H7B A;  2HHH L;  2LFN A;  2XTI A;  3HS0 C;  3MWY W;  5IT9 E;  4QB4 A;  1EL0 A;  1F9R A;  2FJ2 A;  1ZYR C;  4DV2 Q;  5C44 H;  5A2Q E;  1KD1 C;  4LJZ C;  3HOZ G;  4OWW B;  3NWT A;  4GNX C;  4JI0 L;  1XNQ Q;  1X32 A;  3K0X A;  1WTW A;  4KHV A;  3UDF A;  3OTO Q;  3OW2 A;  3K7A H;  5KNB A;  2CQO A;  4NB3 A;  3PQI A;  1KHI A;  3I73 A;  2AWO A;  4FF1 A;  1G6Z A;  5KYI A;  3MXU A;  4YCV A;  1X65 A;  1BQQ T;  1PH2 A;  3K5L A;  4OX9 L;  4DR6 L;  4Q5V A;  2C5C A;  1S40 A;  5C4X H;  4DR5 Q;  2NZO A;  3KDF B;  3C1F A;  2JEA I;  4HIK A;  2NUC A;  4KKS A;  2B63 B;  4DAM A;  3Q6S A;  3CC4 A;  1SNO A;  2E8G A;  2IJ0 A;  3TRZ A;  5DM7 3;  1KTK A;  1Y1V G;  2CVR A;  3CCQ A;  4OX9 Q;  3I4N G;  3CC2 A;  2OWO A;  2Z6K A;  4A3F B;  3M4O B;  2I5H A;  2YV5 A;  3R2T A;  1Z6H A;  5I9O A;  1HUM A;  1RTN A;  4AIM A;  3PO2 G;  1EIG A;  5JAV A;  2A74 C;  1K0S A;  1PYS B;  1SYG A;  4JI2 L;  1QE6 A;  2PQE A;  1M8A A;  1FGB D;  2JA9 A;  3STB D;  4POF A;  1WTV A;  5GAE C;  2F0W A;  4QGU A;  1XNQ L;  1IYU A;  1F2Z A;  1PYB A;  1QNK A;  5CC4 A;  1TXY A;  5FLX L;  4CJ2 C;  4JW0 A;  2OXP A;  3SGI A;  1BR9 A;  2PZW A;  5IIF A;  2B2W C;  1FYC A;  1SMY C;  4JI1 Q;  4BBR G;  4C3J H;  5FJ8 H;  1P16 A;  5FLX E;  1A2T A;  1KAB A;  2JA5 H;  4R4I A;  3GTL H;  3I4M G;  1I4G A;  4EVO A;  4BBS B;  2IX1 A;  4RGO S;  2N8N A;  3W3A A;  4FF2 A;  1EZ6 A;  3TZU A;  3EIV A;  4DR3 Q;  5DLQ E;  2LXJ A;  3DEP A;  2QKI C;  2ZXO A;  2JA8 H;  4B9X A;  1F77 A;  3KDF A;  1VQ7 A;  2EJF C;  1EWH A;  1PRT F;  2ZJQ A;  1NNX A;  4IUV A;  3DM3 A;  3EQL C;  4YCU A;  1DYQ A;  1SFO B;  1X3Q A;  1HNX L;  2RHQ B;  5JPM C;  1S5F D;  1G91 A;  4I7Z C;  4C3J G;  3GTO H;  2QEJ C;  4HIO A;  1KQS A;  1OTC A;  4KJO A;  5M5W B;  2SDF A;  1S5B D;  4BA1 I;  1PLF A;  3AFQ A;  1SRU A;  3KLS X;  5IP9 G;  3S1R B;  3BDO A;  4DR2 Q;  3MC0 B;  3R93 A;  1XMQ Q;  1QZG A;  1Q3L A;  3ULP A;  5CV7 A;  1I6H H;  1B4O A;  2WFW A;  4DGZ A;  3J7Y W;  2PI2 E;  3I4L A;  4ULL A;  3S14 B;  1C9O A;  3R3O A;  5C5L A;  2Y0S G;  5M3M B;  1BO0 A;  5M3F H;  1A15 A;  3NQT A;  5FOB B;  1Q86 C;  4B3T Q;  3GTJ B;  2R93 B;  5FJ8 G;  5A2Q L;  3RLO A;  1Y14 B;  5NUC A;  2E2H B;  2YTV A;  1DGS A;  2A6H D;  5CV6 A;  4MIU A;  4RGN A;  3U4Z A;  5GRO A;  4RCN A;  1UWV A;  1YNN D;  1CA6 A;  4KN7 C;  3OWE B;  2A68 D;  1ILP A;  2A68 C;  1JB7 A;  1I4Q A;  2M00 A;  1PH7 A;  3SK6 A; 
#chains in the Genus database with same CATH homology
 4DXG A;  1TWF B;  2DY8 A;  1G29 1;  1SNC A;  2K5D A;  2B2V A;  1STN A;  4ZUJ A;  4OIJ A;  4PMC A;  1STE A;  3IAY A;  1T5E A;  5DEH A;  5KIX A;  2F0F A;  4K2L A;  2EXZ A;  3KF8 A;  3MTS A;  4FXG C;  1ENF A;  1KDA A;  2WV6 D;  5LHY 1;  2BCO A;  3GP7 A;  2IX0 A;  1TVX A;  1EZ8 A;  3EVQ A;  4A93 B;  2WP8 J;  2LKV A;  4XXE A;  5T1I A;  1QG7 A;  2XWJ B;  3OMC A;  4EQN A;  2QDB A;  5CBE E;  3CRK C;  4IN3 A;  4OL7 A;  1I6V C;  1SXT A;  4C3I B;  1H9S A;  2NTT A;  1J9O A;  1STY A;  2NN6 I;  4B9W A;  3D4R A;  2L9H A;  2EE1 A;  4CJ1 B;  4ZQ3 A;  4MHE A;  1AFP A;  2K28 A;  4O1N A;  2J0T D;  3NXW A;  2B2V C;  2AQ2 B;  2B2U A;  3H91 A;  1STH A;  4RKB A;  2F0D A;  3F2U A;  1U4R A;  4KD3 A;  2Z4I A;  1BXT A;  2G9H D;  4XQJ A;  4ME5 A;  2MUY A;  2N55 A;  4HED A;  2X6L A;  2HCI A;  1WTO A;  1HQM C;  3H09 A;  3BVG A;  1I50 B;  2L12 A;  2JE6 I;  1O7L A;  2M9V A;  1JWU D;  1KDB A;  4RKL A;  3SK8 A;  1IYV A;  2NVQ B;  2O2L D;  5EPL A;  3NTH A;  3IFT A;  5J39 A;  3HOX B;  3OIP A;  1FNU A;  4PMB A;  4HR7 B;  4QF4 A;  2EY1 A;  1H9M A;  4X3S A;  1QJO A;  2E2D C;  3P7J A;  3KLS A;  1WTP A;  2CHB D;  4Y7N B;  1BCP D;  1Y1V B;  4U67 3;  2WKD A;  1DON A;  4RHR A;  1TR5 A;  3OSO A;  4TKO B;  5EKI A;  5KND A;  4RAU C;  5KYL A;  1SYB A;  4F88 A;  4FO2 A;  4DK1 A;  4LK1 C;  4R9W A;  2A6H C;  2K32 A;  2EOT A;  2JSO A;  2K6A A;  1MD2 D;  3NBH A;  2B2T C;  3TZD A;  5ELE A;  1J8I A;  3SDZ A;  3OW7 A;  2L55 A;  1X3P A;  3MA2 B;  1SE2 A;  1TS5 A;  2F0U A;  1JC7 A;  5M3F B;  4C1N I;  2D62 A;  1QNU A;  1PMR A;  1MSH A;  4PNY A;  1SAP A;  1SSO A;  3ND9 A;  2WIN B;  1B2T A;  3JAM L;  3TP6 A;  2E2I B;  1E2W A;  5K36 H;  2A6E D;  2FMC A;  4CKC A;  4RGT A;  3GTG B;  3O13 A;  1JWS D;  2VXW A;  2HDL A;  1PZK D;  4ABN A;  5DAU A;  3ZYY X;  1DOM A;  1V43 A;  3MEH A;  2IWH A;  4M1U B;  2A73 B;  4IZ8 A;  2JXM B;  1JB3 A;  3A7L A;  2ZXR A;  1Y8O B;  4OO1 G;  1EY7 A;  1HTP A;  4X3T A;  4ID6 A;  2AUK A;  1ZKO A;  5EJW A;  5FK9 C;  5J22 A;  4XQN A;  1KNA A;  1RTO A;  2F0P A;  1B3A A;  3D4W A;  1Z7T A;  1H9J A;  2R7Z B;  5I2X A;  1XX8 A;  2XRS D;  2SEB D;  4JK1 C;  3PO2 B;  3U9S A;  4KY7 A;  4XT1 B;  3URY A;  1BNZ A;  1GUN A;  4ILW A;  1JOO A;  3A55 A;  3VA7 A;  2EYF A;  3K59 A;  2K01 A;  1GHK A;  1MGS A;  2B2Y A;  1KAA A;  1SNP A;  4M8A A;  2R61 A;  3T51 B;  4A3G B;  4HMJ A;  3VR5 A;  4NMZ A;  5COR A;  2F0G A;  2CW0 D;  1H9S B;  3HRZ C;  3D31 A;  2NVT B;  4XQQ A;  3GTM B;  1PZJ D;  3G7L A;  2DNE A;  4F7X A;  1EFI D;  1FNW A;  1LT4 D;  3TDQ A;  1GUW A;  1I4H A;  1F2L A;  1PTO D;  3VA5 A;  3J80 E;  1U4L A;  4IFD J;  3SR1 A;  1BF4 A;  2EZV A;  5KNC A;  1YNJ C;  2DY7 A;  3R8B A;  5I6Y A;  3QIA A;  4GZY C;  5FO7 B;  5ISR A;  1WD1 A;  5KGU A;  1LAC A;  3J81 L;  1PXU A;  3RUZ A;  2KCN A;  4HSV A;  1JR0 D;  1DJR D;  1KNE A;  2AQ3 B;  1F9S A;  4EQP A;  3MXG A;  3GTL B;  3SE0 A;  3PUV A;  2EJM A;  3ONA B;  2KED A;  1RF2 D;  1MSG A;  1XYI A;  1Z47 A;  2B8F A;  3HP3 A;  1KDC A;  3S2D B;  3JAM E;  4WRD A;  4IQZ A;  5E1F A;  3T16 A;  3DEO A;  3C46 A;  1E2V A;  1PTO H;  1LT5 D;  3T56 B;  3L9A X;  4QCL A;  2NN6 G;  4J6H A;  2BE5 D;  3PUY A;  5CV9 A;  4IUR A;  3PV0 A;  4EQO A;  3UI2 A;  3IL8 A;  1ESF A;  1E0B A;  4C3H B;  3HOZ B;  4C2M B;  4U68 A;  2HDM A;  3R2I A;  4A3J B;  2PW7 A;  5K5P A;  1K8M A;  2A5H A;  4FXK C;  3P20 A;  1LT3 D;  3M85 A;  3TBI B;  1LLR D;  5C5M A;  3E5S A;  1FNV A;  3MXN A;  1EY5 A;  3N6R A;  1I3Q B;  4UAI A;  3KBG A;  2QF7 A;  3L3O C;  2PMZ B;  3MXP A;  3A7A B;  1I6H B;  5EGT A;  2I46 A;  1GJX A;  1II3 A;  4R8I A;  2WII B;  3A56 A;  4QUF A;  4L6T B;  4HAE A;  3TP8 A;  3H94 A;  2J7Z A;  2PO4 A;  1SE4 A;  1D2B A;  2LS0 1;  1CT1 D;  2E75 C;  1CA5 A;  2BE5 C;  2F0N A;  3GD7 A;  1O7Z A;  4KKU A;  1DM0 B;  5J1Z A;  4NKL A;  4ZAI A;  1EYD A;  2B2T A;  5JEA J;  3FVQ A;  2XRQ D;  1IKM A;  3K0Y A;  1STA A;  2AWN A;  1OXX K;  3P1H A;  2IW3 A;  1LTB D;  1I4P A;  2XN9 C;  3D4D A;  3WOE A;  1TWH B;  1B50 A;  2LMC B;  2EYM A;  2VNU D;  1RJT A;  4F8M A;  3I4M B;  3QB3 A;  4CBV A;  3VYR A;  2V4D A;  3HOV B;  1D5Z C;  4CHT B;  1BOS A;  3H0G B;  4G7H C;  1SJH D;  2QCP X;  4CKB A;  1VCI A;  2B8G A;  5ELC A;  1PYW D;  4DNT B;  1A2U A;  3VYU A;  3MVV A;  2K05 A;  2ICE C;  2IT1 A;  3C2P A;  1TWG B;  1RKN A;  2EVB A;  5JJZ A;  3QO2 A;  4G7O C;  2BDO A;  4X3K A;  4IUN A;  1LV9 A;  2O4X A;  1WD0 A;  2EY5 A;  4ZKC B;  3M7N A;  3VR3 A;  1D1K A;  1JWM D;  1BBX C;  1UAP A;  1B9N A;  1PTO C;  2WAC A;  3FRP B;  2JA8 B;  2NVX B;  1ML0 D;  2L5T A;  5C4Z A;  2J4X A;  3WOF A;  1ZEQ X;  3DWP A;  5I4D A;  3TME A;  4K14 A;  4WOR A;  4MN3 A;  4DAP A;  2NTS A;  1UNS A;  3GV3 A;  2JA5 B;  2B2W A;  5KRU A;  1PFB A;  3CQZ B;  4ZK9 B;  4H0L C;  1TQO A;  3LWE A;  1LO5 D;  1GUG A;  4A3K B;  1EY0 A;  4RA8 A;  3MFY A;  3I90 A;  3RZD B;  4G57 A;  3E0J A;  2PW5 A;  3H6M A;  1S4Z A;  5FO9 B;  3I8Z A;  1GUS A;  5EPK A;  1ONL A;  2KQ3 A;  2SNS A;  1HQR D;  3GTK B;  1CQF A;  3IKJ A;  1HUN A;  2F3W A;  2KHS A;  4IAL A;  3PIP 3;  2AQ1 B;  3PO3 B;  1CHP D;  4HSP A;  2YYZ A;  3FPU B;  4O42 A;  3M4Y A;  1K83 B;  3KLR A;  4R8N A;  3KBX A;  1AZP A;  4C56 C;  3L7Z C;  1G2T A;  1CZW A;  4KJN A;  2F4I A;  2XVS A;  5JVH 3;  2L11 A;  3TP5 A;  1U4M A;  1DCZ A;  4TRD A;  5IT9 L;  1Q1B A;  2Z1C A;  3NQI A;  5M5Y B;  5D14 A;  1HFG A;  5EKL A;  4DK0 A;  4PMW A;  3S1Q B;  4L8J A;  4C1N K;  3LX0 A;  2Y0S B;  5CMD A;  1A3U A;  4HCE A;  1IW7 C;  5CGK A;  3BYY B;  5JOB A;  4V19 0;  2RBM A;  1EU4 A;  1O78 A;  2KA7 A;  3V96 A;  3OMG A;  1RCV D;  1CTM A;  2MJ8 A;  3KK7 A;  4LAA A;  4PQX A;  2EDG A;  1NSN S;  2ZXP A;  3K57 A;  1NUC A;  1C4Q A;  1W6K A;  2FMM A;  1AW7 A;  1V8Q A;  1WCM B;  1F9P A;  2A69 D;  3BYT B;  2Q8T A;  3BVM A;  1OO9 B;  2KJX A;  1AZQ A;  4N9T A;  4CJ0 B;  1NCV A;  1XXG A;  5CV4 A;  1B53 A;  2TSS A;  5EQ0 A;  5G3L F;  2PZT A;  3BVZ A;  5HGT A;  2N88 A;  1RHP A;  2JEB I;  4L63 B;  4A3M B;  1MBY A;  3CRL C;  2L4N A;  3DWA A;  3J7A F;  2YU9 B;  3I70 A;  3MFG A;  2OT2 A;  3VR4 A;  2F0L A;  3AMU A;  3OPO A;  2C9O A;  4IFD H;  3K5N A;  4G4K A;  1F2M A;  1TWC B;  4Q0F A;  4UDU C;  2AUJ D;  4KKT A;  4IFD I;  2K7V A;  2M2L A;  4HTH A;  1AEX A;  2K04 A;  1BCP C;  2F0H A;  1BCP B;  1TWA B;  2F03 A;  3VR6 A;  1CM9 A;  4XTC S;  1Q1E A;  3S17 B;  3WDN A;  2O5J C;  4ODG A;  5BN3 A;  4OO1 H;  1C48 A;  5I2Y A;  5IGE A;  4C3H G;  4A3E B;  2RVL A;  2RDG A;  1JE4 A;  1SDF A;  3HG9 A;  5TSS A;  1EY6 A;  2F0O A;  3GQB A;  2VB3 X;  1KLG D;  1Q90 A;  1H9K A;  4JBW A;  1V1P A;  4OGQ C;  1ILQ A;  2WKC A;  2NWG A;  2KVM A;  4KV6 A;  3CKI B;  1B1Z A;  4DF7 A;  3SVM A;  1IL8 A;  5C0X G;  2EYO A;  1SE3 A;  2IX3 A;  3QG1 A;  3NPP A;  2LY7 A;  1ENC A;  1CQV A;  2PZU A;  1CZG A;  1PTO B;  4KI0 A;  1A3T A;  5I9P A;  5AFW A;  4A3B B;  1LT6 D;  1V1P B;  2B39 A;  2RDF A;  4HMI A;  4WFN 3;  4CKE A;  4B08 A;  1BUV T;  2KEC A;  1EQT A;  5DM6 3;  1S5C D;  3QJY A;  3NK9 A;  3BG3 A;  3S9W A;  5JEA H;  1TY2 A;  4I65 A;  2PCF B;  1DXM A;  4QUC A;  4KN4 C;  2RA4 A;  4K5X A;  3CHB D;  1PFM A;  1EY8 A;  4PV1 C;  2EYJ A;  2HUG A;  4FF4 A;  5C6A A;  4J1M A;  3FEW X;  1ENA A;  1CI3 M;  2VB2 X;  5DNF A;  3RMH A;  3PUW A;  5KEE A;  1VMP A;  1R4P B;  1GUO A;  1F9Q A;  1K8O A;  1EYA A;  2F0I A;  2EY2 A;  3EA6 A;  1UEA B;  2X69 A;  4KK7 A;  4XDX A;  3A8I E;  2ZT9 C;  2OF1 A;  5ELB A;  2MHV A;  2CQA A;  1B44 D;  3Q0A A;  4BWG B;  2RDH A;  1STB A;  5E4X A;  1BCP F;  5IGC A;  1Q8I A;  2R3Z A;  1LTG D;  2PNR C;  1JOR A;  5D3I B;  2Z4H A;  1JCK B;  4ZUI A;  1XTC D;  1EQV A;  3M7G A;  4C3I G;  3HZX A;  1QB5 D;  2RSO A;  2L0C A;  2E2J B;  3CU7 A;  4K5W A;  5CR3 A;  2RSN A;  4Z9C B;  2TMP A;  2NZ1 D;  3I3C A;  3ERO A;  5CV8 A;  4IUU A;  2ICI A;  4IUT A;  1EY9 A;  2MGS A;  1S5E D;  2A69 C;  1I4X A;  5CYU A;  1TKW B;  4OHJ A;  5C4J B;  1W6J A;  1PRT C;  4DU9 A;  5BN4 A;  5C0X I;  2KUM A;  1D5M C;  3C3L A;  2EYH A;  5D65 A;  1SYC A;  1C8C A;  3MZ5 A;  4WJW A;  5M5X B;  1LAB A;  2EY6 A;  1A3V A;  3HOU B;  1VF5 C;  3TSS A;  3RZO B;  1R4Q B;  3TP7 A;  1L0Y B;  1YNJ D;  3OWF A;  5LL6 X;  3PUZ A;  5C3X A;  4FF3 A;  1CFM A;  2NYZ D;  2HQE A;  2F0T A;  3U9O A;  1WTX A;  1IKL A;  3NHH A;  3GTP B;  1HCZ A;  3FMC A;  4TQU S;  3QOL A;  1HRJ A;  1ET9 A;  1IHZ A;  1TS3 A;  2B2U C;  2F0J A;  4RHS A;  3NE5 B;  4FP5 D;  3OHX C;  5C4X B;  1WTQ A;  1AP0 A;  2D9U A;  2F0M A;  3AU7 A;  3HOW B;  1LTI D;  3SXH A;  3HEJ A;  1HXY D;  5CV5 A;  2NVY B;  1G8Z D;  1NAP A;  3A8K E;  5C4H A;  2K5W A;  3ITP A;  4FXD A;  3S2H B;  3S1N B;  4RCO A;  3SHL A;  1SYD A;  2WB1 B;  2RKS A;  4ZYS A;  3D6W A;  5EBD A;  1HA5 A;  2G9D A;  5JPN C;  5ELF A;  1MI2 A;  3H3V C;  3PUX A;  1HHV A;  2D5D A;  2F0K A;  5M9O A;  2NBF A;  4QMG A;  2E74 C;  2KCC A;  3K5M A;  1Y69 U;  3VYS A;  3FDT A;  4TSS A;  2IPK D;  3E6Z X;  4QIW B;  1D1I A;  4F87 A;  1O7Y A;  2H1E A;  2RQX A;  1IW7 D;  3S1M B;  5IGF A;  1TU2 B;  2BOS A;  1G2S A;  2FIN B;  1UUP A;  4CGY B;  1QCB D;  1HPC A;  5F2D A;  1STG A;  3FKI B;  2E76 C;  4V0B A;  5C0X J;  1TY0 A;  4BY7 B;  5C3E B;  3FPP A;  1U9R A;  3RLF A;  1SNM A;  3X3M A;  2D2C C;  4A3I B;  3NBI A;  2EJG C;  1LTA D;  3EFX D;  3HKZ B;  1KLU D;  1D6E C;  1GOZ A;  4N9P A;  5HUR A;  1S5D D;  1SND A;  2SOB A;  4DAV A;  2BA1 A;  4NP5 A;  4RH6 A;  1I4R A;  3K6O A;  1ICW A;  3A8J E;  5ELD A;  3RD4 A;  3I72 A;  3AB9 A;  4IFD G;  3HOY B;  1TS4 A;  1EEF D;  1HA6 A;  2EYP A;  3NUC A;  5E3F A;  1OXV A;  3NSW A;  3OIQ A;  1LTR D;  2MP1 A;  3ND8 A;  3BDL A;  1VDZ A;  4XIG S;  3V2T A;  1EOT A;  3I4N B;  2PYK A;  1PTO F;  3LWU A;  3TN2 A;  5LL6 S;  1HFN A;  3DHQ A;  3NTI A;  2JP1 A;  1F2Y A;  4ZKB B;  1XWE A;  2XIW A;  4AYB B;  3A54 A;  4XT3 B;  1JOK A;  4K2K A;  5A35 A;  4FVM A;  4BS9 A;  3QOJ A;  3D3R A;  1OXT A;  1SBB B;  4J8Q A;  2DNC A;  3LNN A;  2PPB C;  2EPB A;  4E6I A;  5EKK A;  1A6X A;  3J80 L;  3P75 A;  1RD9 D;  1GHJ A;  1SNQ A;  1CHQ D;  4HCS A;  4DFA A;  5IGG A;  4DAY A;  2JYO A;  3Q23 A;  2QIL A;  1M4V A;  3D6C A;  1U4P A;  4IUQ A;  2O5I C;  1SEB D;  3W2D A;  4K8J A;  5IOD A;  2HCC A;  4HN7 A;  2FFK B;  4RGM A;  3NTK A;  2JA6 B;  4NW2 A;  1LTS D;  4KHZ A;  4KMU C;  2EYL A;  3MAQ A;  1YNN C;  2FHT A;  1TII D;  3C1E A;  1TT2 A;  3T53 B;  1H9R A;  4XYO A;  1FD7 D;  4C3J B;  3SK4 A;  2L1B A;  1PZI D;  5K36 G;  3N52 A;  2K1B A;  3GO5 A;  1PRT B;  1BDO A;  1SYE A;  2X6G A;  1SJE D;  4KY6 A;  1JIC A;  2DN8 A;  3D8G A;  3T13 A;  1WTR A;  5C0X H;  1O80 A;  3GTQ B;  2SNM A;  4RWS C;  4DXF A;  4BY1 B;  3BS1 A;  1SYF A;  4RFB A;  3S16 B;  5EPJ A;  3X3N A;  1D5X C;  2F0V A;  3I91 A;  3MHB A;  5IOC A;  3DM1 A;  3DWQ A;  3V05 A;  1LTT D;  1T5X D;  1NR2 A;  5JEA G;  2OEO A;  2F3V A;  2ID0 A;  3K7A B;  2IL8 A;  2K03 A;  3Q22 A;  1ZXT A;  5C44 B;  5FO8 B;  1E2Z A;  3EJI A;  3PMF A;  1QIL A;  4FYD A;  4ZLT F;  2B2Y C;  2XNA C;  1VF7 A;  5I6W A;  4K8I A;  4FNF A;  2K5Q A;  3K5O A;  1Q12 A;  5D3D A;  2R92 B;  2ENB A;  1Y8N B;  2F0S A;  5EBC A;  2KEE A;  3T4A C;  1ET6 A;  2I07 B;  3GTO B;  1EYC A;  2H4O A;  3K58 A;  1EY4 A;  5G3L D;  3M3Y B;  1WVL A;  2JA7 B;  4LMQ D;  5JVG 3;  1ESR A;  1DOL A;  4EGV A;  3NWS A;  5FKA C;  3S15 B;  1OXU A;  4P2C B;  3G6J B;  2CW0 C;  1QWY A;  5C3W A;  1SMY D;  3HGB A;  1ZYR D;  1PFN A;  2Q8R E;  2XWB B;  4H13 C;  2BA0 A;  3DXJ C;  1EU3 A;  2F0E A;  3BZD B;  4K5V A;  3J7A V;  1RDP D;  2GA4 B;  1NR4 A;  4YIJ A;  3PIO 3;  1QOH A;  1R9T B;  1GXD C;  1B9M A;  2BDN A;  3DMU A;  3NP8 A;  3J81 E;  2F0Q A;  4KD4 A;  2XSC A;  2WAQ B;  1JOQ A;  5IGB A;  1EIH A;  1PDQ A;  2KOL A;  4S3S A;  2NN6 H;  1DZ1 A;  4KTA A;  3IFD A;  1FR3 A;  4DA2 A;  1AN8 A;  1HTL D;  1CK1 A;  1DD2 A;  4ZRZ A;  3SK5 A;  4KY5 A;  3DUZ A;  5E4W C;  3SEB A;  5BN5 A;  1L0X B;  2MPM A;  1EWC A;  1OXS C;  1VMC A;  5CBA E;  1ROD A;  2Q8I B;  2A6E C;  2F1M A;  3QWN A;  1JQY D;  2K33 A;  1Y1W B;  3OOC A;  4H44 C;  5IGD A;  5T1G A;  4G7Z C;  3KUP A;  2Z8L A;  4X3U A;  2R6G A;  3VR2 A;  4OIK A;  4DNR B;  3Q24 A;  1EEI D;  4OO1 I;  2NB0 A;  4XYQ A;  1DOK A;  3ERQ A;  4NDX A;  4IUP A;  3GV6 A;  1V1O A;  5COY A;  2VUM B;  1GUT A;  4K6D A;  3VYT A;  4DN4 M;  4K6L A;  1TS2 A;  3BDC A;  1Y8P B;  4A3D B;  1PRT D;  4BA2 I;  4BBR B;  4H7B A;  2LFN A;  3HS0 C;  3MWY W;  5IT9 E;  4QB4 A;  1EL0 A;  1F9R A;  2FJ2 A;  1ZYR C;  5A2Q E;  4LJZ C;  3NWT A;  1X32 A;  1WTW A;  4KHV A;  5KNB A;  3I73 A;  2AWO A;  4FF1 A;  1G6Z A;  5KYI A;  3MXU A;  1BQQ T;  3K5L A;  4Q5V A;  2C5C A;  3C1F A;  2JEA I;  2NUC A;  4KKS A;  2B63 B;  3Q6S A;  1SNO A;  2IJ0 A;  5DM7 3;  1KTK A;  2CVR A;  4A3F B;  3M4O B;  1Z6H A;  3R2T A;  5I9O A;  1HUM A;  1RTN A;  1EIG A;  5JAV A;  2A74 C;  1SYG A;  1QE6 A;  2PQE A;  1M8A A;  1FGB D;  1WTV A;  2F0W A;  1IYU A;  1F2Z A;  5CC4 A;  1QNK A;  5FLX L;  4CJ2 C;  2OXP A;  1BR9 A;  2PZW A;  5IIF A;  2B2W C;  1FYC A;  1SMY C;  5FLX E;  1A2T A;  1KAB A;  1I4G A;  4EVO A;  4BBS B;  2IX1 A;  4RGO S;  3W3A A;  4FF2 A;  1EZ6 A;  3TZU A;  3DEP A;  2QKI C;  2ZXO A;  4B9X A;  1F77 A;  2EJF C;  1EWH A;  1PRT F;  4IUV A;  3EQL C;  1DYQ A;  1SFO B;  1X3Q A;  5JPM C;  1S5F D;  1G91 A;  4I7Z C;  4C3J G;  2QEJ C;  4KJO A;  5M5W B;  2SDF A;  1S5B D;  4BA1 I;  1PLF A;  3KLS X;  3S1R B;  3BDO A;  3MC0 B;  3R93 A;  1Q3L A;  5CV7 A;  1B4O A;  4DGZ A;  3J7Y W;  3I4L A;  4ULL A;  3S14 B;  5C5L A;  3R3O A;  5M3M B;  1BO0 A;  1A15 A;  3NQT A;  5FOB B;  3GTJ B;  2R93 B;  5A2Q L;  5NUC A;  2E2H B;  2A6H D;  5CV6 A;  4MIU A;  4RGN A;  4RCN A;  1YNN D;  1CA6 A;  4KN7 C;  3OWE B;  2A68 D;  1ILP A;  2A68 C;  1I4Q A;  2M00 A;  3SK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...