1KAAA

Stress and strain in staphylococcal nuclease
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYAPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Stress and strain in staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
total genus 40
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1992-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kaaA00
4K2LA 5IGEA 3V2TA 4KV6A 5CGKA 1EZ6A 1SYCA 5C3WA 1STAA 3SK4A 3DHQA 4K6DA 4DFAA 2PZUA 2QDBA 1SNOA 1EYAA 2PW7A 1SYEA 2F0KA 1F2MA 3D4DA 1KDBA 4NMZA 4WORA 5E3FA 3PMFA 4ZUJA 4LAAA 4B9XA 1JORA 2O4XA 1EYCA 1A2TA 1SNCA 2EY1A 1ENCA 2F0FA 5IGGA 4KD3A 1JOKA 2EY6A 5EGTA 4N9PA 2F0HA 2WACA 4G57A 2EYJA 3TP8A 3QOJA 2F0MA 3HEJA 4K8IA 4HMIA 3TMEA 4ME5A 4YIJA 5IIFA 3EVQA 4IUNA 4KY7A 5K5PA 4ODGA 1IHZA 1JOOA 3OWFA 4IALA 1SYFA 2PW5A 4PMCA 4PMBA 2EYHA 2KQ3A 2F0WA 4J6HA 4K2KA 1F2ZA 4TRDA 3MEHA 2F0JA 1JOQA 1AEXA 5C5LA 4B9WA 4K14A 2OF1A 1STBA 3NK9A 2EYPA 3T13A 1U9RA 1SYBA 4KJNA 5CV5A 5IOCA 5KRUA 4RKLA 4WRDA 2F3WA 4QMGA 4HMJA 3BDLA 3P75A 4KHVA 4K8JA 4KTAA 1SNPA 3D6CA 4E6IA 4EQNA 5C4ZA 2F0PA 3R3OA 1A3UA 1EY9A 1STNA 2F0SA 2F0NA 5JOBA 3QOLA 1KAAA 5CV8A 5IGDA 5IODA 5KIXA 2F0GA 3SHLA 5EKKA 5C5MA 1EY8A 2RKSA 3D4WA 2SNMA 4EQOA 5HURA 1KDAA 2F0LA 2EXZA 2KHSA 1EQVA 5J1ZA 1STYA 5KEEA 5I9PA 3OMGA 4PNYA 5IGBA 2F0OA 5CR3A 3P1HA 5KGUA 2SOBA 5HGTA 2EY5A 1KABA 4K5WA 2PZTA 2PZWA 3NHHA 5M9OA 3VA5A 3QB3A 3EROA 5IGCA 2OEOA 4I65A 5ISRA 5J39A 4F8MA 3C1FA 4KJOA 4MIUA 3SXHA 3E5SA 5EKLA 4DU9A 2RBMA 3U9OA 2OXPA 4QB4A 5DAUA 4RKBA 2PQEA 3BDCA 3EJIA 4NDXA 1SYGA 3SK5A 4OL7A 5C4HA 2EYFA 5CC4A 2EYOA 3HZXA 4R8NA 2EYLA 3D8GA 3DMUA 2F0IA 2HQEA 4KY6A 4EVOA 2F0QA 3OMCA 4QF4A 2M00A 3T16A 1EZ8A 1EY6A 3MVVA 2PYKA 1SNMA 1TT2A 3ERQA 3NQTA 4IZ8A 3RUZA 3TP7A 2EY2A 4HTHA 5CV6A 1II3A 2SNSA 3TP6A 3TP5A 1A2UA 4K5VA 5DEHA 5CV9A 1NSNS 3NXWA 4ZQ3A 3S9WA 2F0EA 3ITPA 1TQOA 1STHA 2F3VA 1TR5A 1SNQA 5KYIA 5J22A 3SK6A 3LX0A 4ID6A 5I9OA 3OSOA 2F0VA 5I6YA 2F0TA 4ZUIA 5C6AA 1EY0A 3H6MA 3NP8A 4F7XA 1ENAA 2ENBA 1NUCA 1EYDA 1F2YA 3MHBA 5CV7A 3SK8A 4DF7A 4NKLA 5IGFA 1SYDA 4J1MA 1EY7A 2RDFA 5NUCA 5F2DA 5C3XA 2F0UA 5I6WA 1RKNA 2NUCA 5CV4A 1EY4A 3MXPA 5JAVA 3C1EA 2LKVA 3MZ5A 4S3SA 4KD4A 3SR1A 4DGZA 4KY5A 1EY5A 1A3VA 1KDCA 1SNDA 4NP5A 5E1FA 4EQPA 1A3TA 5KYLA 2EYMA 4K5XA 2F0DA 3NUCA 1STGA 4N9TA 4H7BA
chains in the Genus database with same CATH superfamily
5ELOA 3H0GH 3D4DA 3TZDA 1ENFA 1FGUA 3OOCA 3CRKC 3HP3A 1A2TA 1EEFD 1SNCA 5IT9c 2EQSA 1JWSD 3SEBA 3S16H 2X6LA 4X64L 4LFAQ 4LFCL 4APVA 4JOIA 4LK1C 1U4PA 3HEJA 4QY7A 1MSGA 2NN6I 3MXNB 2PW5A 4DV6L 1P8LA 3OWEB 4OO1I 4A3LG 4JI5Q 3T13A 2A6EC 2BDOA 3CCSA 3R93A 4JBWA 2ALYB 4HMJA 3GP7A 3P75A 3GTMB 3TN2A 3A5UA 2OQKA 5IODA 3QOLA 1KAAA 1IBKQ 2RSNA 5IP9G 1PRTD 2NYZD 2RKSA 4H13C 4X66L 1DYQA 1PYBA 3VYSA 2EE1A 3P7JA 1BO0A 3MFGA 2AWNA 3NTIA 4X65L 3S2HB 1KABA 5FK9C 3K5LA 3QB3A 4UP7A 1TS5A 1PYSB 2C5CA 1BUVT 3N6RA 3RLFA 3GTGB 2VUMG 1C8CA 4BY7G 1CKNB 3QIAA 1PH9A 3GTMH 2HQEA 3CXCA 3OMCA 3S1MB 5JJLA 1F77A 1WJJA 4LF4Q 1A2UA 4B3RQ 1NSNS 3L7ZC 2VS1A 3A5ZB 3PF5A 2F3VA 3HOWB 3KF6B 3S2HH 2F3IA 4IURA 1ESFA 1N8RC 2F0TA 2A8VA 3A8IE 2UUBQ 4AYBB 3EBEA 2ENBA 4PZ7A 3NBIA 1Q3LA 1L0YB 4GOPC 1PZJD 1PFSA 3RLNA 3D3RA 2KVMA 1G2SA 4JYAQ 2K50A 3TZUA 4DUZQ 2RSOA 2QEXA 3S15B 2IJ0A 3S1MH 3BVGA 4JI6Q 1Q8IA 1K8AC 2XRQD 1PV4A 4UHVA 1QVGA 2K5VA 4XQJA 4G7OC 4P71A 2K75A 2ZXRA 1LT4D 2K7VA 1H9SA 3WOFA 4E6IA 2WKCA 2AHOB 1HNWQ 2CW0C 5JEAG 4N8X1 1V1QA 1GUWA 1TU2B 1LM0A 4Z9CB 5IWAL 1CHQD 2F0MA 3CCLA 3NEMA 3EVQA 5E4XA 4IUNA 1L2FA 4B3SL 1JCKB 1LABA 2H4OA 1HPCA 4A3IB 4A3MH 4K2KA 2C35B 5FLXL 2K05A 3A56A 1H9MA 1YNNC 4JI1L 1D5MC 1SYBA 1Q82C 4GKJL 1YHQA 2Z9HA 4KKSA 3H91A 1PH6A 3DLLA 2FFKB 4CKCA 1VF7A 1EQQA 3CU7A 1N34L 3Q23A 2OQ0A 5COYA 4EQOA 2WAQE 3LWUA 3I8ZA 2JA8G 3K7AB 4OXPA 3R8BA 3W5OA 2K32A 3NPPA 3U9SA 5IGBA 1B7YB 5I4DA 2NVYB 4CDFC 3BVZA 1WTXA 2PPBC 4WJ3M 3KLSX 2Q2IA 3S2DB 1N36Q 3TS0A 4BXXG 1WCMB 1VF5C 5K36G 1JJCB 1I4PA 2V1CC 3VYUA 1EQTA 4RGNA 1QZGA 4GLXA 2EZVA 5FLXE 2NVXB 5CBEE 3HOYH 2HT1A 4DUYL 2EYLA 5CORA 3I91A 1SFOH 1FL0A 3T53B 1TWAB 2PNHA 1C9OA 1I4QA 1K73C 2IY5B 4YY3L 2UXCQ 4Y7NH 5D65A 1A62A 2PMZB 2RHQB 2NVYH 3HOXH 4BS9A 4A3GG 1JJGA 4LF9Q 1BOSA 3U50C 1NTGA 1UE7A 4F7XA 1WCMH 3SK8A 5IY0A 4DF7A 1NR4A 2Z1CA 4QL5A 5DNFA 4F88A 3FMCA 2NVXH 1HNXL 3W2DA 1H95A 1E2VA 2VXWA 3C1EA 1PH7A 3L2PA 4R4CA 2PI2A 4N9TA 2EXDA 2HIXA 3J81L 3V2TA 1XMQL 5LL6X 1Y8OB 2R7FA 4RHRA 4DR3Q 3DWPA 3FKIH 4OHJA 1SNOA 2F03A 1X9NA 1KDBA 5E3FA 3PMFA 1YJWA 4DV2Q 3CCQA 4HJAA 3RR5A 3AU7A 4JCVE 1YITA 3AQQA 4RG1A 2JA5H 3R2TA 1LTGD 2A68D 2EYJA 1GKHA 2BA1A 4C3IG 5LMUL 2YTXA 1IBMQ 2IW3A 2WIIB 1CFMA 1IYUA 3MEFA 1VQ6A 5G3LD 1Y8NB 2WB1B 2KOLA 5BN3A 2UXBQ 3CP0A 3EQLC 1STEA 3BDLA 4FXGC 4L6TB 4K8JA 5C4ZA 2HHHQ 5C0XG 4KMUC 2BE5C 3J81E 3SHLA 5EKKA 3RD4A 1QE6A 1T9HA 2F0LA 4DR1Q 5JPNC 1AH9A 1M1KC 3LWEA 3EN2A 1FR3A 2L0CA 5E4WC 3P1HA 1IL2A 2MNAA 2NZOA 4P72A 2SOBA 2L5TA 1IBLQ 1ASYA 5GAEC 1H9JA 2MPMA 1DZ1A 1E2ZA 5FLMH 5T1IA 4A3BH 1AP0A 1SE4A 1I5FA 3A7LA 1KC8C 3G71A 3GTPB 3BU2A 2PQEA 3SK5A 3HZXA 4H44C 2F0IA 3A7AB 5M3FB 4JI4L 2G9DA 4DPGA 1VCIA 4IZ8A 4R4TA 2UU9L 2JA6B 1JE4A 1PTOC 4ZQ3A 2XSCA 2KHIA 3DM1A 2QDLA 1GM5A 5LMNW 3F2UA 2B2VC 1TR5A 3J81c 1XTCD 1I6HB 5I6YA 1U4LA 4LFBQ 2NZHA 3ERSX 1H9SB 3HKZB 1AN8A 1NUCA 4HN7A 3VR4A 3IAYA 5IP7G 2N8NA 3GTPH 1UEBA 3KF8A 3GTLB 1RKNA 1YVCA 5H1SE 1JWUD 1G2TA 3MZ5A 1SE8A 5M3FH 4O2DA 1WVLA 2E76C 2JA6H 2NVQH 4HCEA 1LTSD 4K2LA 4BWGB 2R6GA 2R3ZA 3GO5A 1VQ4A 4OONA 1I6HH 1EYAA 2RA4A 5T1GA 3WOEA 2B63G 3A8JE 1SN8A 5DM63 1AFPA 4FF4A 1LTBD 2BDNA 3PO3G 3HG9A 3T1YQ 3TMEA 1ILQA 4RMFA 4U673 1QVFA 5K5PA 3GTLH 1CM9A 1OXSC 4IJLA 1AEXA 2O5IC 4K14A 2X6GA 1D7QA 1GOZA 1CQVA 1KQSA 4EQNA 2ICEC 1MJEA 1KIXA 1SRUA 5AJ3Q 3R3OA 2CCZA 1VQDA 4R4IA 5AFWA 3KJPA 1VQPA 3S1NB 4RFBA 4Y52H 2VZAA 3HFZB 1WTOA 3S24A 4C3HB 4JBKA 1X65A 2AKWB 3HOVG 3OMGA 1I3QB 1RIPA 2OT2A 3PUWA 3NHHA 3BVMA 4HJ9A 5IGCA 3CKIB 2OEOA 2MJ8A 3KLSA 1J9OA 4LUVA 5C44H 1K8OA 2RCNA 2C9OA 3C1FA 4KJOA 3E5SA 1HFNA 2CH4A 1B9NA 2EIFA 2ICIA 1R4PB 5M5YH 2JA7G 4KKUA 1EWIA 1DJRD 3S1QB 3CC4A 4YHHQ 1EY6A 2Y0SB 2HCIA 4IPDA 1TT2A 3S1NH 4DR2Q 4C3HH 2N3SA 3L0OA 3I4NB 1CI3M 2F4IA 3SDZA 1BF4A 1G8ZD 3T1HQ 2HQLA 1QB5D 2I5LX 2K04A 1ICFB 1VQNA 4DK1A 4FDBA 2K14A 1Q1EA 1GUGA 4NXNL 3URYA 2Q8TA 2UXDL 4ZUIA 3G6EA 2B29A 3I73A 4IN3A 2FMMA 1DXMA 1TWHB 1Y1VG 3S1RB 3A0JA 2E5LQ 2CKZB 4OELB 2ZXOA 1RD9D 1H9RA 4G7HC 1A3TA 5C4XH 1I4HA 4K5XA 4DV4L 4UP8A 5EKIA 1LTLA 3I4NH 2F4VQ 3K5OA 4ILWA 1CT1D 3ICEA 1ASZA 1JORA 3STBD 4GNXC 5GADC 3VYRA 4JG2A 2UUCQ 3T56B 1V43A 2A1AA 3GTKB 4G57A 4YCUA 1SLJA 1CZWA 3S1RH 1HRJA 1HNZQ 3NWTA 1IHZA 4LF5Q 2R92G 1SAPA 1YHAA 2VQFQ 3U58A 2B2VA 1U9RA 4DV1L 1HCZA 1S40A 4HJ7A 4QMGA 1D1KA 4XT1B 3Q24A 3AB9A 2IWHA 3PIOA 1VQJA 2KCMA 4XDXA 2KHSA 1I94L 4PZ6A 1X3QA 4C1NI 3QJYA 3PO2G 3GTKH 1P16A 5I9PA 1VQHA 3ER0A 5KGUA 5EAYA 1G51A 4FYDA 1HR0L 3KYHC 1KAWA 1DOLA 1RCVD 1PMRA 3PUZA 3J81i 4BBSB 4QGUA 3J81j 4V0BA 3RZDB 1YZ6A 1F9QA 3QWNA 3CCVA 1N32Q 3KF8B 3Q6SA 3KK7A 2ZJRA 3GTOB 1DOMA 1L1OC 2CH4W 3AFPA 4QCLA 1NE3A 3J7A5 1TXYA 2AQ1B 4WJ4A 1BCPF 3CC2A 3DXJC 1SYDA 1T5XD 4GN5A 3GTJB 4JI3L 5C4JB 2F0UA 2NUCA 4RCNA 1F9SA 4FNFA 1D2BA 2LKVA 4A3DH 2KCNA 4ZUJA 2WFWA 2E2JH 3GTOH 3NUCA 5IGEA 1SYCA 5I2YA 3KJOA 4HAEA 1GUTA 1D5ZC 1S4ZA 1EYCA 1B9MA 1WTHA 3DWAA 4LFAL 2Y0SE 2B2TA 1ZYRC 3TP8A 4WFN3 1C48A 3HRZC 1QCBD 3SE0A 2R7ZB 4KY7A 1VMCA 5C4JH 3OWFA 2WAQB 3BZDB 1XXGA 2EYHA 2F0WA 1HTPA 4NW2A 4DV0Q 3MEHA 4JI5L 3LNNA 1S5ED 1E1OA 2B2UC 2Z0SA 1UUPA 4OIJA 4A3JG 1W2BA 1VQ8A 5FKAC 2BA0A 4RA8A 2F0PA 1B44D 1Y8PB 2WV6D 1IBKL 1PH5A 4O1NA 1IW7C 5IGDA 1Y1WB 1G6PA 1TWCB 1PZID 5HURA 4DNRB 1EUJA 1KDAA 1EFWA 1KNEA 4KK7A 5D3IB 5C3EG 1EYGA 5KNDA 2NVTB 2R7ZH 1AW7A 2L55A 4JPBW 3M9BA 3EROA 1X55A 2QILA 2L1BA 4MIUA 4XXEA 1I50B 1X3GA 2DN8A 1WD1A 1V8QA 1OXUA 2RF4A 3AFQA 2R93G 3J7YW 1GO3E 1WFQA 5BR8Q 3MTSA 4GNXA 4KHZA 3M7NA 4RAUC 3T16A 2JP1A 1Y1WH 3NBHA 4UPAA 3NQTA 2PYKA 3A54A 3OIQA 4LF4L 1TWCH 4HTHA 4LF6Q 2X69A 4B3RL 4K5VA 4C3JB 4A3MG 3RN2A 1VQIA 1W6JA 1J8IA 3ULPA 1BVSA 4PZ8A 3ND8A 1KRSA 3EA6A 1S5CD 2M9VA 2UUBL 2QGQA 3Q22A 1F2YA 3J7ZC 1BBWA 2XGTA 1EY7A 4JYAL 4UDUC 3BDOA 3E3XA 4DUZL 2I46A 1EY4A 1M90C 1VQ7A 4JI6L 4HIDA 3HOUB 1S5FD 1X6OA 2JYOA 2ZM6Q 5D14A 4C3JH 1CTMA 1DOKA 1RDPD 2AMCB 4DR5Q 4DV5Q 4DAPA 1MIUA 2NN6G 3OW2A 1A8VA 4TVAB 2MHVA 4WORA 1HNWL 4A93G 4X3UA 4OO1G 3CCJA 4KN4C 3HOYG 3ND9A 2EY6A 3GTGH 1ZXTA 4DXFA 4JK1C 1KD1C 3D0FA 1R9TB 2NZ1D 1SYFA 4ME3A 2Z6KA 1K28A 3HOXG 3GV3A 2RHSB 1SXTA 1STBA 3AEVA 2KEDA 1KRTA 4ZCKA 3HOWH 2VNUD 1EL0A 4F87A 1MSHA 1SNPA 1PTOF 3KBGA 4WJWA 3K59A 3TEHB 4L5QA 2CQAA 4L63B 1CK1A 5EPJA 1QNKA 1EY8A 5LHY1 2VL6A 2CHBD 1Z47A 1F9RA 2GA4B 4MNOA 5GAHC 1BCPC 2GVBA 2A6HC 2HDMA 3S15H 1R9TH 4L5RC 4A3LH 3RLOA 1N36L 1B2TA 2K5HA 3FKIG 1ET9A 3CW2C 1OTCA 2VUMB 4BY7B 3SXHA 1SMYD 3BS1A 2LMCB 4QB4A 2RDGA 2JA5G 1TWGB 1JWMD 1OXTA 4CDDC 3J80L 1SYGA 4IUTA 4OL7A 3CMEA 1DD2A 1YJ9A 3FPPA 4DV3Q 1EZ8A 3RUZA 4TSSA 4A3CG 3ULJA 3TP5A 1TWFB 3E0EA 4LUZA 2UXCL 1TQOA 4P75A 1VQEA 2MP1A 2AWOA 1BNZA 1O7LA 4ID6A 4AH6A 3VDYA 3NWSA 4A3IH 2A69C 5A2QL 4LF9L 1JB3A 3TRZA 4B3TQ 1SEBD 1EQRA 4A3FG 4NXMQ 2VUMH 1ENAA 4BY7H 5CV7A 4GKKQ 3PIP3 1XX8A 4CHTB 4Q0FA 1GUOA 5NUCA 1HHVA 4XYOA 4IPGA 2JSOA 4FF2A 5LL6S 5IYCH 3J80E 4MTNA 1KDCA 2H1EA 1TWFH 2LSSA 3K7AH 3H09A 1E3PA 3KLWA 3CCUA 4A3BG 4DR3L 4DV7Q 4JV5Q 3DEPA 1O7YA 3H3VH 1H9KA 1UEAB 2R61A 3RNUA 3K80C 2OWOA 1F2MA 4B9XA 2J0TD 4NMZA 3S2DH 4DV2L 1E2WA 2EY1A 3O13A 3VR3A 4QUFA 4N9PA 2WACA 3FP9A 1X3FA 5A2QE 4K8IA 1IBML 4H02A 3M4OB 4EX5A 3MFYA 1VQFA 4J6HA 4O0AA 1TWAH 5FLXc 4QUCA 2F0JA 1D1IA 3PGZA 2UXBL 1XMOQ 3U4VA 4OWTB 4IJHA 2F3WA 3S17B 4BBRG 2R7DA 2HHHL 1BR9A 2AQ3B 1CKOA 3J80c 5M9OA 2SEBD 2JA8B 3B6YA 4GNXB 4DR1L 1XJVA 1N9WA 4FF1A 2EXZA 2PQAA 3NBHB 5J1ZA 1YIJA 5IE8A 2AQ2B 1VS0A 4PNYA 2QW7A 1IBLL 4YCWA 3K0XA 2IPKD 1O80A 3A74A 1HXYD 1FYCA 2A68C 1XNRQ 2EJGC 4HSPA 4IPCA 2N78A 1TY0A 5EKLA 2RBMA 2VQEQ 1Y14B 2XIWA 5C4HA 4NDXA 2EYOA 4OWXB 3PUXA 2MQHA 1QVCA 3W1BA 1HA6A 1TY2A 3GDEA 4QF4A 1I4GA 1PFNA 3TP7A 3ERQA 4GOPA 5CC4A 4KHPQ 2JA8H 1G6ZA 2BE5D 1WI5A 3S14B 1S5DD 3CD6A 4A3GB 4IUUA 2I5HA 1PH2A 1EU3A 4JI7Q 3K58A 4L5SA 2KEEA 3CC7A 4LFBL 1XNQQ 5JPMC 3PSIA 4LJZC 2ZXPA 1HUMA 1IYVA 4IQZA 3TBIB 4C1NK 5I6WA 1G91A 3U4ZA 4NB3A 4XT3B 2NWGA 3KUPA 2EPBA 2KUMA 1N33Q 1KLGD 4NP5A 2QEJC 5CV9A 2GN5A 2DJFC 4L8JA 1ZKOA 5C44G 5JJZA 3S14H 3M3YB 2K52A 3FEWX 3SK4A 1HR0W 4A3GH 3F8TA 5EBDA 3J7AF 3FRPB 3OPOA 3UDGA 2A19A 2F0FA 1GHJA 3I72A 5IGGA 3V05A 2TSSA 4C3IB 2I07B 4BY1G 4A76A 1J5EQ 3QOJA 3T1YL 3RZOB 1CA5A 3OTOQ 4GLAC 1TS4A 3CCEA 2H5XA 1JOOA 2IX3A 1RHPA 4I7AA 1B50A 4MZ9A 2A74C 3I90A 5C5LA 4CBVA 2EYPA 5KRUA 1FJGQ 2K5DA 3M3YH 2E8GA 3T4AC 1LTTD 2JQOA 5AJ3L 1V9PA 2F0NA 1GUSA 2KECA 1S3OA 4A3KG 1K8MA 3V96A 1B1ZA 1DGSA 1VQKA 4C3IH 3M4QA 1Q81C 1EQVA 1STYA 3T51B 5C4XG 2F0OA 2LXKA 5CR3A 3RZOH 1GD7A 3DUZA 2EY5A 2PZWA 1IL8A 3GTQB 3K0YA 4IFDI 4AIMA 1IKMA 1K9MC 4RGMA 2EJFC 4V190 5C0XH 4DAYA 4YHHL 2Q2HA 1MKHA 3K5NA 3MVVA 4HSVA 4JBJA 4I7ZC 2IHFA 4LMQD 3ULLA 4DR2L 1MD2D 2SNSA 4FXDA 1CZGA 3ZJYC 4HIOA 2F0EA 3T1HL 1DCZA 2JJQA 5KYIA 4POGA 1VQLA 4UY8C 5ELDA 3OSOA 3GTQH 1YNJC 1M8AA 1VQOA 2ASBA 1B3AA 1HQMC 1D5XC 2KENA 2LXJA 2E5LL 1GUNA 2K33A 2NTTA 1I4XA 3MXPA 4LF8Q 1X32A 4P2CB 4HIMA 1JICA 2GVAA 5FO7B 3QG1A 3IRBA 3I4LA 2F4VL 4R4OA 2O5JC 5CGKA 1I3QH 1CSPA 1X3EA 4DR7Q 1MGSA 1E22A 3K5MA 4IFDJ 3HGBA 2B63B 3VA7A 4X6AH 2MO1A 4BA2I 2YU9B 4IO9A 4KD3A 2UUCL 5JJKA 3PO3B 5IP7H 4A3EG 1AE2A 2XRSD 3HOZG 3J80i 3MAQA 1HNZL 5M3MG 3KOJA 4LF5L 2PQAB 4ODGA 3S1QH 4R4QA 2ZJPA 1BBXC 3I4MG 2PO4A 2VQFL 1XWEA 3G7LA 1KXLA 1K8GA 4B9WA 4K0KQ 4ZLTF 4DR6Q 1LO5D 2N49A 4H0LC 3Q8DA 1EIFA 4YCVA 3NSWA 1B3QA 4ULLA 1A3UA 1EY9A 1STNA 2F0SA 1VQ5A 1I6VC 4OWWB 3FVQA 2B63H 1PRTF 4G7ZC 2EOTA 2YU9H 1CUKA 2SNMA 1PH8A 3HOVB 4A3DG 3K57A 3PO3H 1A0IA 1TWHH 2EJMA 1PFBA 4GOPB 2I5MX 4Q5VA 4FVMA 3STBC 1TS2A 5M5XB 4JI0Q 1D6EC 3KLRA 5HGTA 2ZTEA 4GN3B 5ISRA 4CKBA 2SDFA 2YTVA 3RMHA 1VQAA 3U9OA 2OXPA 3KFUA 2B8GA 4IUVA 2JA7B 4IPHA 3EJIA 4AQYQ 1N32L 4PV1C 1AZQA 1NY4A 2F0QA 1Q8KA 3FHWA 2UUAQ 3CHBD 1VQMA 3I7FA 2DNEA 5KNCA 2CFMA 5IYBG 1HQRD 4DK0A 3BZCA 4RHSA 3CCRA 4HCSA 3MC0B 5GAGC 1QWYA 1SBBB 1BCPB 3H0GG 1WD0A 4RGOS 1RJTA 2AUJD 2BOSA 3CRLC 3NP8A 1Y1VB 5IGFA 2L9HA 4NKLA 1PVOA 1QZHA 1SJHD 1J6QA 4IFDH 3DEOA 1UNSA 3SR1A 1MHWC 1HZAA 1LUZA 1LTID 5HY6A 2K5NA 2L11A 3SVMA 4B3MQ 4FXKC 2F0DA 3TDQA 3K7UC 4ABNA 5HGQA 2QDBA 1XPOA 4DR4Q 3DWQA 4LAAA 3PV0A 4LF7Q 5L37A 1A15A 1Y1VH 4BBSH 4DAVA 2K03A 3X3NA 3UI2A 2KCCA 1NBWA 1LTAD 2G9HD 3RZDH 4ME5A 2R92B 2B2WC 1HZBA 3LGJA 1XYIA 5LMNQ 4DV0L 1NNXA 3M7GA 1I4RA 4HR7B 1ML0D 2BH8A 4FP5D 5IYDH 1WTVA 3G4SA 4KJNA 5IOCA 3E9IA 3OW7A 1NCVA 2J4XA 4KHVA 2A73B 4X62Q 3QO2A 4CJ0B 2F0GA 4DAYB 3WDNA 1C0AA 3PO2B 3A8KE 2CWPA 4DK3C 3GTJH 1AE3A 5FJ8H 3K6OA 1ZYRD 3JAML 2B39A 1TS3A 3VYTA 3P20A 3IKJA 4MTKA 5DAUA 1IKLA 5CYUA 1WTWA 2D0OA 4C2MB 5BR8L 3I55A 2EYFA 3D31A 1PDQA 2YV5A 4JI8Q 3BJUA 1BDOA 3H94A 3KDFA 1X54A 4DGZA 4LF6L 3PO2H 2ES2A 1CKMA 1K3RA 4OX9Q 3ITPA 1WTRA 1IW7D 1B53A 1C4QA 1PLFA 4JI2Q 3SK6A 1XPUA 3HOWG 1IXRA 4XQNA 1SE3A 2KA7A 2HDLA 1KL9A 5DLQE 3H6MA 1EY0A 1RTNA 1HH2P 4AYBG 4J1MA 3C46A 1ONLA 2RDFA 3JAME 4C2MH 3D6WA 5C3XA 2ATWA 2A6ED 1A6XA 2ZTCA 3H3VI 4S3SA 4YWKA 2MGSA 2ZM6L 2WINB 4ZK9B 1STGA 4DR5L 1PRTC 4DV5L 4KV6A 1O7IA 1STAA 2NVTH 3DHQA 1U0LA 1LV9A 2K1BA 2DY8A 2L12A 5EBCA 1DM0B 2MUYA 1I50H 3MA2B 4ZYSA 1K3BC 4X64Q 2MO0A 4LFCQ 4LWCA 3OHXC 1WYDA 4YIJA 1E1TA 4ZKCB 2PNRC 4DV6Q 5G3LF 4DAMA 5ELCA 1L0WA 4A3IG 4O42A 1YHBA 4A3JB 3JAMc 1PTOB 3DM3A 2KCTA 1UAPA 4J8QA 3PUVA 1E0BA 4KTAA 2FMCA 1KLUD 1Q86C 5CV8A 3OIPA 1BBUA 5KIXA 3G6JB 5C5MA 3TQYA 1U4MA 4K6LA 5EQ0A 3F2BA 4X66Q 5IYCG 1MBYA 5C3EB 5KEEA 1UE1A 4MHEA 2RVLA 2RCFA 1OO9B 2VW9A 1JE5A 1Q12A 4P73A 4X65Q 4XYQA 2OCEA 1EIGA 1L1OA 3C3LA 2QA4A 3HOUH 1E24A 4I65A 5J39A 1HA5A 3Q0AA 2R93B 4A3JH 1PTOH 1WCMG 3I4OA 3TS2A 3L9AX 3OYYA 4LUOA 4R8NA 5ELEA 4DV3L 4CJ1B 2BH2A 2MFIA 3UDIA 1FGBD 4A3MB 2EY2A 5TSSA 3S9WA 2CW0D 4QIWE 1SJED 2B2WA 2XWBB 5C3EH 1HZCA 1TVXA 3D4RA 3NTKA 5JEAJ 4B3TL 1FVIA 1FNWA 4NXML 1BCPD 1W6KA 4XQQA 1RTOA 2CVRA 2A6HD 4JBMA 4GKKL 1KNAA 2R93H 4UAIA 3G48A 1VDZA 2B2YC 2VB3X 1YNND 5IP9H 1QILA 2D62A 1SMYC 1UE5A 2D9UA 3I2ZA 4N8FA 4KKTA 1EY5A 1WTPA 1B70B 1PHJA 2L15A 1LACA 1HTLD 4H7BA 4DV7L 4JV5L 1GVPA 2NB0A 2IX1A 1ET6A 4A93B 1VQBA 2PZUA 1G291 2JXMB 2F0KA 3HOYB 3CPFA 2B2UA 4EQ5A 1VQ9A 1SFOB 2JN4A 2K5QA 1XTDA 1TWGH 4Y7NB 2A69D 5IWAQ 1K83B 4HMIA 5IIFA 2VY3A 1YI2A 3QR8A 1NR2A 1F2LA 5BN5A 4PMBA 4B3SQ 3HOXB 4YWMA 2FINB 1XMOL 2D5DA 1ZEQX 3IFDA 1Q46A 3GV6A 5FLMG 2XNAC 1JB7A 3NTHA 2JEBI 4JI1Q 4RKLA 2NN6H 2K01A 1T5EA 2WB1G 2Z8LA 4L5TA 4GKJQ 4A93H 1QUQA 4OO1H 2Q2TA 5D3DA 1JR0D 4RGTA 1N34Q 4G4KA 2K4KA 1LT5D 3D4WA 1JQYD 1ESRA 3E9HA 1Q7YC 3C2PA 3PCOB 2JA9A 3KDFB 5E7NA 3IL8A 4TKOB 1K83H 4CDEC 3L3OC 1Q1BA 4XIGS 3FKIB 5C0XI 4A75A 2B3GA 3TREA 3M85A 1XNRL 4X3TA 2E2IB 1PZKD 2JA5B 4R1JA 2VQEL 2LS01 3MWYW 1PH1A 3UDFA 1D8LA 3NELA 5JEAH 1GJXA 4KY6A 4DUYQ 2K5WA 3AYHB 2NTSA 4KHPL 1CSQA 5M3FG 1II3A 4YY3Q 2D0PA 2KBNA 2JA6G 5A35A 1SE2A 1STHA 3M4OH 1KHIA 3ONAB 2ZJQA 4JI7L 4IOCA 5CBAE 4A3FB 1Z7TA 1XNQL 2O2LD 3K81C 4EGVA 2E2IH 1EIHA 4GS3A 1SROA 2QCPX 3MHBA 2VB2X 2I0QA 1YEZA 3S17H 3HKZG 4IOAA 1MI2A 3W1GA 3VR5A 1HNXQ 1N33L 4A3CH 4KY5A 5E1FA 4A3BB 4CKEA 3NENA 1NAPA 1IZ6A 5C0XJ 2WP8J 4AYBE 4GLVB 1YBYA 4DFAA 1XMQQ 4KI0A 1SYEA 4BXXH 2NBFA 4PMWA 5K36H 4DNTB 4A3FH 2O4XA 3JAMi 1EOVA 1ENCA 1RL2A 4DNIA 2E2HB 3PIO3 4B08A 1J5EL 1CHPD 1SR3A 1U5KA 3OTOL 3N52A 5LMUQ 1BXTA 4MN3A 1JMCA 3BYTB 1F2ZA 2IL8A 1BQQT 1S5BD 2FHTA 2OF1A 1L1OB 4BBRB 1PH3A 2DGYA 1L0XB 1FJGL 2DJGC 3CAMA 2EDGA 1GHKA 3D6CA 1PTOD 1EEID 2J7ZA 5JOBA 5EJWA 4FF3A 1YJNA 1FNUA 1HUNA 2K28A 2E2HH 3BYYB 2B2YA 2NVQB 5FOBB 5BN4A 4C3HG 2E75C 4IUPA 1NJIC 4LW1A 2CQOA 1PH4A 1ILPA 2XVSA 1EWHA 4ALPA 4QJFA 4CJ2C 4BBRH 4ZAIA 2IHEA 3M4PA 2QF7A 4P74A 4RH6A 5EPLA 1SNMA 5EPKA 4JI4Q 3EFXD 2UU9Q 2Y0SG 1YNXA 3NXWA 2A5HA 2RDHA 4C56C 3I4NG 1O7ZA 3LX0A 1LT6D 3E6ZX 1OXXK 4J15A 1V1PA 2ZTDA 2F0VA 2FXQA 3HS0C 3K8AA 3JC66 1B4OA 1EOTA 3CMAA 4TQUS 2N88A 1FNVA 3CQZB 4HJ8A 3UE1A 1NMFA 2EVBA 4CGYB 4DN4M 1HFGA 4LF8L 2BCOA 1F9PA 1LTRD 2PMZE 2ZT9C 5JAVA 5JVG3 1FD7D 3SGIA 1EFID 3J7AV 4UP9A 5C44B 1EU4A 2EYMA 3TSSA 4DR7L 2RQXA 2QKIC 2M2LA 4JVZA 4LNQA 4ZKBB 2PW7A 5M5YB 4PQXA 2DY7A 1LT3D 1TKWB 2DNCA 1EIYB 4BY1B 1JJ2A 1QUQB 1JOKA 2F0HA 3PIPA 3E0JA 5FO9B 2HD3A 4POFA 4QQBX 3EIVA 3CQZH 3FPUB 1YNJD 3H3VC 1X56A 4YWLA 1CQFA 4PG3A 1SMXA 5GROA 2KQ3A 2YTYA 4TRDA 4K0KL 4DR6L 2AUKA 4U68A 3NK9A 1V1OA 1DONA 1VMPA 1PRTB 4X3SA 3CF5A 1VQCA 2B2TC 2G5DA 4A3KB 4IFDG 1OXVA 2KJXA 2OTLA 4DKAC 4BY1H 3GQBA 1VQGA 4HEDA 5C4XB 3MXNA 3ZYYX 1QJOA 2WB1E 4JI0L 2CWAA 2DUDA 2E2DC 1UWVA 3PQIA 4R8IA 2PCFB 4K5WA 3VA5A 3X3MA 1K0SA 5FO8B 4F8MA 1EWCA 1TIID 4XTCS 4RKBA 1U4RA 2N55A 4DA2A 2E74C 4AQYL 4BBSG 4RWSC 4JOIC 4JW0A 3BG3A 3D8GA 3DMUA 3WWVA 2UUAL 4A3KH 2LFNA 3TP6A 3PF4A 4HJ5A 5GQOA 2P5ZX 2Z4HA 4FO2A 5KNBA 1Z6HA 2LY7A 4RCOA 1Z9FA 5IYDG 1LLRD 1PFMA 3CCMA 5I9OA 1BKBA 1Q90A 3BZKA 3NQIA 2Q2UA 4NXNQ 2UXDQ 2FJ2A 1CKNA 1RODA 1EYDA 3FDTA 4JC0A 1SDFA 5F2DA 3F1ZA 2ID0A 3GD7A 3AMUA 5CV4A 3KBXA 1R4QB 2WKDA 1O78A 3NE5B 1JT8A 2HIVA 2OTJA 1QNUA 4OGQC 2HUGA 5FJ8G 4M8AA 1A3VA 4B3ML 3HOVH 4EQPA 4GZYC 5KYLA 3R2IA 3KF6A 5DM73 3F2CA 4DXGA 3MXUA 4DV4Q 1EZ6A 5C3WA 3HKZE 5JVH3 3M4YA 4K6DA 1LYLA 4M1UB 5M5XH 3VR2A 4DR4L 1XPRA 1IYJB 4DK6C 4LF7L 2XTIA 3VR6A 2JE6I 5M5WB 5I2XA 1M4VA 5EGTA 4A3EB 3HOZB 3A55A 5M3MB 2JA7H 2YYZA 1AZPA 2TMPA 1X3PA 3I4MB 1KTKA 1SSOA 5LMNL 1C7YA 1MJCA 3W3AA 4IALA 4PMCA 3RN5A 2R7ZG 3UE0A 4OEMB 4CDCC 2WAQG 4GN4B 4R9WA 1JOQA 2D2CC 5CV5A 4DV1Q 4WRDA 2F1MA 3IFTA 1E7ZA 1ICWA 4X62L 2V4DA 1JC7A 5IT9L 2Z4IA 4HIKA 4A3DB 4ZRZA 5M5WH 1Y1WG 1WOCA 5CMDA 4A3EH 3HOZH 3PUYA 2E2JB 2Z6KC 3I70A 1I94Q 5M3MH 3I4MH 4OIKA 1WTQA 5ELBA 4KN7C 2PZTA 3CPWA 3F2DA 1HR0Q 3MXGA 2XWJB 4KLKA 1PYWD 4QIWB 5ELFA 3I3CA 1V1PB 4DU9A 5J3BA 1QG7A 1PXUA 3BDCA 2B8FA 2JEAI 1S72A 4NPSA 3I56A 4JI8L 2KHJA 2IX0A 4EVOA 1QOHA 2L4NA 1Y69U 3H15A 2M00A 1GXDC 4IUQA 4A4IA 5CV6A 1NMGA 4OX9L 5DEHA 1HZ9A 2Q8RE 5IT9E 4C3JG 4JI2L 5JJIA 2R92H 3H0GB 5ELNA 1SNQA 5J22A 1PA6A 1A63A 2K6AA 2HCCA 2JK8A 3UDXA 1CA6A 1HJPA 1UE6A 1K0RA 2F52A 4X3KA 3S16B 2Z6BA 2XN9C 5C6AA 4BA1I 1RF2D 1B8AA 1W3SA 3HKSA 4JI3Q 2IT1A 5IYBH 2PI2E 1SNDA 4KD4A 3HOUG 2Q8IB
chains in the Genus database with same CATH topology
3D4DA 3TZDA 1ENFA 3OOCA 3CRKC 3HP3A 1A2TA 1EEFD 1SNCA 1JWSD 3SEBA 2X6LA 4LK1C 1U4PA 3HEJA 1MSGA 2NN6I 2PW5A 3OWEB 4OO1I 3T13A 2A6EC 2BDOA 3R93A 4JBWA 4HMJA 3GP7A 3P75A 3GTMB 3TN2A 5IODA 3QOLA 1KAAA 2RSNA 1PRTD 2NYZD 2RKSA 4H13C 1DYQA 3VYSA 2EE1A 3P7JA 1BO0A 3MFGA 2AWNA 3NTIA 3S2HB 1KABA 5FK9C 3K5LA 3QB3A 1TS5A 2C5CA 1BUVT 3N6RA 3RLFA 3GTGB 1C8CA 3QIAA 2HQEA 3OMCA 3S1MB 1F77A 1A2UA 1NSNS 3L7ZC 2F3VA 3HOWB 4IURA 1ESFA 2F0TA 3A8IE 4AYBB 2ENBA 3NBIA 1Q3LA 1L0YB 1PZJD 3D3RA 2KVMA 1G2SA 3TZUA 2RSOA 3S15B 2IJ0A 3BVGA 1Q8IA 2XRQD 4XQJA 4G7OC 2ZXRA 1LT4D 2K7VA 1H9SA 3WOFA 4E6IA 2WKCA 2CW0C 5JEAG 1GUWA 1TU2B 4Z9CB 1CHQD 2F0MA 3EVQA 5E4XA 4IUNA 1JCKB 1LABA 2H4OA 1HPCA 4A3IB 4K2KA 5FLXL 2K05A 3A56A 1H9MA 1YNNC 1D5MC 1SYBA 4KKSA 3H91A 2FFKB 4CKCA 1VF7A 3CU7A 3Q23A 5COYA 4EQOA 3LWUA 3I8ZA 3K7AB 3R8BA 2K32A 3NPPA 3U9SA 5IGBA 5I4DA 2NVYB 3BVZA 1WTXA 2PPBC 3KLSX 3S2DB 1WCMB 1VF5C 5K36G 1I4PA 3VYUA 1EQTA 4RGNA 2EZVA 5FLXE 2NVXB 5CBEE 2EYLA 5CORA 3I91A 3T53B 1TWAB 1I4QA 5D65A 2PMZB 4BS9A 1BOSA 4F7XA 3SK8A 4DF7A 1NR4A 2Z1CA 5DNFA 4F88A 3FMCA 3W2DA 1E2VA 2VXWA 3C1EA 4N9TA 3J81L 3V2TA 5LL6X 1Y8OB 4RHRA 3DWPA 4OHJA 1SNOA 2F03A 1KDBA 5E3FA 3PMFA 3AU7A 3R2TA 1LTGD 2A68D 2EYJA 2BA1A 4C3IG 2IW3A 2WIIB 1CFMA 1IYUA 5G3LD 1Y8NB 2WB1B 2KOLA 5BN3A 3EQLC 1STEA 3BDLA 4FXGC 4L6TB 4K8JA 5C4ZA 5C0XG 4KMUC 2BE5C 3J81E 3SHLA 5EKKA 3RD4A 1QE6A 2F0LA 5JPNC 3LWEA 1FR3A 2L0CA 5E4WC 3P1HA 2SOBA 2L5TA 1H9JA 2MPMA 1DZ1A 1E2ZA 5T1IA 1AP0A 1SE4A 3A7LA 3GTPB 2PQEA 3SK5A 3HZXA 4H44C 2F0IA 3A7AB 5M3FB 2G9DA 1VCIA 4IZ8A 2JA6B 1JE4A 1PTOC 4ZQ3A 2XSCA 3DM1A 3F2UA 2B2VC 1TR5A 1XTCD 1I6HB 5I6YA 1U4LA 1H9SB 3HKZB 1AN8A 1NUCA 4HN7A 3VR4A 3IAYA 3KF8A 3GTLB 1RKNA 1JWUD 1G2TA 3MZ5A 1WVLA 2E76C 4HCEA 1LTSD 4K2LA 4BWGB 2R6GA 2R3ZA 3GO5A 1EYAA 2RA4A 5T1GA 3WOEA 3A8JE 5DM63 1AFPA 4FF4A 1LTBD 2BDNA 3HG9A 3TMEA 1ILQA 4U673 5K5PA 1CM9A 1OXSC 1AEXA 2O5IC 4K14A 2X6GA 1GOZA 1CQVA 4EQNA 2ICEC 3R3OA 5AFWA 3S1NB 4RFBA 1WTOA 4C3HB 3OMGA 1I3QB 2OT2A 3PUWA 3NHHA 3BVMA 5IGCA 3CKIB 2OEOA 2MJ8A 3KLSA 1J9OA 1K8OA 3C1FA 2C9OA 4KJOA 3E5SA 1HFNA 1B9NA 2ICIA 1R4PB 4KKUA 3S1QB 1DJRD 1EY6A 2Y0SB 2HCIA 1TT2A 3I4NB 1CI3M 2F4IA 3SDZA 1BF4A 1G8ZD 1QB5D 2K04A 4DK1A 1Q1EA 1GUGA 3URYA 2Q8TA 4ZUIA 3I73A 4IN3A 2FMMA 1DXMA 1TWHB 3S1RB 2ZXOA 1RD9D 1H9RA 4G7HC 1A3TA 4K5XA 1I4HA 5EKIA 3K5OA 4ILWA 1CT1D 1JORA 3VYRA 3T56B 1V43A 3GTKB 4G57A 1CZWA 1HRJA 3NWTA 1IHZA 1SAPA 2B2VA 1U9RA 1HCZA 4QMGA 1D1KA 4XT1B 3Q24A 3AB9A 2IWHA 4XDXA 2KHSA 4C1NI 1X3QA 3QJYA 5I9PA 5KGUA 4FYDA 1DOLA 1RCVD 1PMRA 3PUZA 4BBSB 4V0BA 3RZDB 1F9QA 3QWNA 3Q6SA 3KK7A 3GTOB 1DOMA 4QCLA 2AQ1B 1BCPF 3DXJC 1SYDA 1T5XD 3GTJB 5C4JB 2F0UA 2NUCA 4RCNA 1F9SA 4FNFA 1D2BA 2LKVA 2KCNA 4ZUJA 3NUCA 5IGEA 1SYCA 5I2YA 4HAEA 1GUTA 1D5ZC 1S4ZA 1EYCA 1B9MA 3DWAA 2B2TA 1ZYRC 3TP8A 4WFN3 1C48A 3HRZC 1QCBD 3SE0A 2R7ZB 4KY7A 1VMCA 3OWFA 2WAQB 3BZDB 1XXGA 2EYHA 2F0WA 1HTPA 4NW2A 3MEHA 3LNNA 1S5ED 2B2UC 1UUPA 4OIJA 5FKAC 2BA0A 4RA8A 2F0PA 1B44D 1Y8PB 2WV6D 4O1NA 1IW7C 5IGDA 1Y1WB 1TWCB 1PZID 5HURA 4DNRB 1KDAA 1KNEA 4KK7A 5D3IB 5KNDA 2NVTB 1AW7A 2L55A 3EROA 2QILA 2L1BA 4MIUA 4XXEA 1I50B 2DN8A 1WD1A 1V8QA 1OXUA 3J7YW 3MTSA 4KHZA 3M7NA 4RAUC 3T16A 2JP1A 3NBHA 2PYKA 3NQTA 3A54A 3OIQA 4HTHA 2X69A 4K5VA 4C3JB 1W6JA 1J8IA 3ND8A 3EA6A 1S5CD 2M9VA 3Q22A 1F2YA 1EY7A 4UDUC 3BDOA 2I46A 1EY4A 3HOUB 1S5FD 2JYOA 5D14A 1CTMA 1DOKA 1RDPD 4DAPA 2NN6G 2MHVA 4WORA 4X3UA 4OO1G 4KN4C 3ND9A 2EY6A 1ZXTA 4DXFA 4JK1C 1R9TB 2NZ1D 1SYFA 3GV3A 1SXTA 1STBA 2KEDA 2VNUD 1EL0A 4F87A 1MSHA 1SNPA 1PTOF 3KBGA 4WJWA 3K59A 2CQAA 4L63B 1CK1A 5EPJA 1QNKA 1EY8A 5LHY1 2CHBD 1Z47A 1F9RA 2GA4B 1BCPC 2A6HC 2HDMA 1B2TA 1ET9A 2VUMB 4BY7B 3SXHA 1SMYD 3BS1A 2LMCB 4QB4A 2RDGA 1TWGB 1JWMD 1OXTA 3J80L 1SYGA 4IUTA 4OL7A 1DD2A 3FPPA 1EZ8A 3RUZA 4TSSA 3TP5A 1TWFB 1TQOA 2MP1A 2AWOA 1BNZA 1O7LA 4ID6A 3NWSA 2A69C 5A2QL 1JB3A 1SEBD 1ENAA 5CV7A 3PIP3 1XX8A 4CHTB 4Q0FA 1GUOA 5NUCA 1HHVA 4XYOA 2JSOA 4FF2A 5LL6S 3J80E 1KDCA 2H1EA 3H09A 3DEPA 1O7YA 1H9KA 1UEAB 2R61A 1F2MA 4B9XA 2J0TD 4NMZA 1E2WA 2EY1A 3O13A 3VR3A 4QUFA 4N9PA 2WACA 5A2QE 4K8IA 3M4OB 3MFYA 4J6HA 4QUCA 2F0JA 1D1IA 2F3WA 3S17B 1BR9A 2AQ3B 5M9OA 2SEBD 2JA8B 4FF1A 2EXZA 5J1ZA 2AQ2B 4PNYA 2IPKD 1O80A 1HXYD 1FYCA 2A68C 2EJGC 4HSPA 1TY0A 5EKLA 2RBMA 2XIWA 5C4HA 4NDXA 2EYOA 3PUXA 1HA6A 1TY2A 4QF4A 1I4GA 1PFNA 3TP7A 3ERQA 5CC4A 1G6ZA 2BE5D 3S14B 1S5DD 4A3GB 4IUUA 1EU3A 3K58A 2KEEA 5JPMC 4LJZC 2ZXPA 1HUMA 1IYVA 4IQZA 3TBIB 4C1NK 5I6WA 1G91A 4XT3B 2NWGA 3KUPA 2EPBA 2KUMA 1KLGD 4NP5A 2QEJC 5CV9A 4L8JA 1ZKOA 5JJZA 3M3YB 3FEWX 3SK4A 5EBDA 3J7AF 3FRPB 3OPOA 2F0FA 1GHJA 3I72A 5IGGA 3V05A 2TSSA 4C3IB 2I07B 3QOJA 3RZOB 1CA5A 1TS4A 1JOOA 2IX3A 1RHPA 1B50A 2A74C 3I90A 5C5LA 4CBVA 2EYPA 5KRUA 2K5DA 3T4AC 1LTTD 2F0NA 1GUSA 2KECA 1K8MA 3V96A 1B1ZA 1EQVA 1STYA 3T51B 2F0OA 5CR3A 3DUZA 2EY5A 2PZWA 1IL8A 3GTQB 3K0YA 4IFDI 1IKMA 4RGMA 2EJFC 4V190 5C0XH 4DAYA 3K5NA 3MVVA 4HSVA 4I7ZC 4LMQD 1MD2D 2SNSA 4FXDA 1CZGA 2F0EA 1DCZA 5KYIA 5ELDA 3OSOA 1YNJC 1M8AA 1B3AA 1HQMC 1D5XC 1GUNA 2K33A 2NTTA 1I4XA 3MXPA 1X32A 4P2CB 1JICA 5FO7B 3QG1A 3I4LA 2O5JC 5CGKA 1MGSA 3K5MA 4IFDJ 3HGBA 2B63B 3VA7A 4BA2I 2YU9B 4KD3A 3PO3B 2XRSD 3MAQA 4ODGA 1BBXC 2PO4A 1XWEA 3G7LA 4B9WA 4ZLTF 1LO5D 4H0LC 3NSWA 4ULLA 1A3UA 1EY9A 1STNA 2F0SA 1I6VC 3FVQA 1PRTF 4G7ZC 2EOTA 2SNMA 3HOVB 3K57A 2EJMA 1PFBA 4Q5VA 4FVMA 1TS2A 5M5XB 1D6EC 3KLRA 5HGTA 5ISRA 4CKBA 2SDFA 3RMHA 3U9OA 2OXPA 2B8GA 4IUVA 2JA7B 3EJIA 4PV1C 1AZQA 2F0QA 3CHBD 2DNEA 5KNCA 1HQRD 4DK0A 4RHSA 4HCSA 3MC0B 1QWYA 1SBBB 1BCPB 1WD0A 4RGOS 1RJTA 2AUJD 2BOSA 3CRLC 3NP8A 1Y1VB 5IGFA 2L9HA 4NKLA 1SJHD 4IFDH 3DEOA 1UNSA 3SR1A 1LTID 3SVMA 2L11A 4FXKC 2F0DA 3TDQA 4ABNA 2QDBA 3DWQA 4LAAA 3PV0A 1A15A 4DAVA 2K03A 3X3NA 3UI2A 2KCCA 1LTAD 2G9HD 4ME5A 2R92B 2B2WC 1XYIA 3M7GA 1I4RA 4HR7B 1ML0D 4FP5D 1WTVA 4KJNA 5IOCA 3OW7A 1NCVA 2J4XA 4KHVA 2A73B 3QO2A 4CJ0B 2F0GA 3WDNA 3PO2B 3A8KE 3K6OA 1ZYRD 3JAML 2B39A 1TS3A 3VYTA 3P20A 3IKJA 5DAUA 1IKLA 5CYUA 1WTWA 4C2MB 2EYFA 3D31A 1PDQA 1BDOA 3H94A 4DGZA 3ITPA 1WTRA 1IW7D 1B53A 1C4QA 1PLFA 3SK6A 4XQNA 1SE3A 2KA7A 2HDLA 1EY0A 3H6MA 1RTNA 4J1MA 3C46A 1ONLA 2RDFA 3JAME 3D6WA 5C3XA 2A6ED 1A6XA 4S3SA 2MGSA 2WINB 4ZK9B 1STGA 1PRTC 4KV6A 1STAA 3DHQA 1LV9A 2K1BA 2DY8A 2L12A 5EBCA 1DM0B 2MUYA 4ZYSA 3MA2B 3OHXC 4YIJA 4ZKCB 2PNRC 5G3LF 5ELCA 4O42A 4A3JB 1PTOB 1UAPA 4J8QA 3PUVA 1E0BA 4KTAA 2FMCA 1KLUD 5CV8A 3OIPA 5KIXA 3G6JB 5C5MA 1U4MA 4K6LA 5EQ0A 1MBYA 5C3EB 5KEEA 4MHEA 2RVLA 1OO9B 1Q12A 4XYQA 1EIGA 3C3LA 5J39A 4I65A 1HA5A 3Q0AA 2R93B 1PTOH 3L9AX 4R8NA 5ELEA 4CJ1B 1FGBD 4A3MB 2EY2A 5TSSA 3S9WA 2CW0D 1SJED 2B2WA 2XWBB 1TVXA 3D4RA 3NTKA 5JEAJ 1FNWA 1BCPD 1W6KA 4XQQA 1RTOA 2CVRA 2A6HD 1KNAA 4UAIA 1VDZA 2B2YC 2VB3X 1YNND 1QILA 2D62A 1SMYC 2D9UA 4KKTA 1EY5A 1WTPA 1LACA 1HTLD 4H7BA 2NB0A 2IX1A 1ET6A 4A93B 2PZUA 1G291 2JXMB 2F0KA 3HOYB 2B2UA 1SFOB 2K5QA 4Y7NB 2A69D 1K83B 4HMIA 5IIFA 1NR2A 1F2LA 5BN5A 4PMBA 3HOXB 2FINB 2D5DA 1ZEQX 3IFDA 3GV6A 2XNAC 3NTHA 2JEBI 4RKLA 2NN6H 2K01A 1T5EA 2Z8LA 4OO1H 5D3DA 1JR0D 4RGTA 4G4KA 1LT5D 3D4WA 1JQYD 1ESRA 3C2PA 3IL8A 4TKOB 3L3OC 1Q1BA 4XIGS 3FKIB 5C0XI 3M85A 4X3TA 2E2IB 1PZKD 2JA5B 2LS01 3MWYW 5JEAH 1GJXA 4KY6A 2K5WA 2NTSA 1II3A 5A35A 1SE2A 1STHA 3ONAB 5CBAE 4A3FB 1Z7TA 2O2LD 4EGVA 1EIHA 2QCPX 3MHBA 2VB2X 1MI2A 3VR5A 4KY5A 5E1FA 4A3BB 4CKEA 1NAPA 5C0XJ 2WP8J 4DFAA 4KI0A 1SYEA 2NBFA 4PMWA 5K36H 4DNTB 2O4XA 1ENCA 2E2HB 3PIO3 4B08A 1CHPD 3N52A 1BXTA 4MN3A 3BYTB 1F2ZA 2IL8A 1BQQT 1S5BD 2FHTA 2OF1A 4BBRB 1L0XB 2EDGA 1GHKA 3D6CA 1PTOD 1EEID 2J7ZA 5JOBA 5EJWA 4FF3A 1FNUA 1HUNA 2K28A 3BYYB 2B2YA 2NVQB 5FOBB 5BN4A 4C3HG 2E75C 4IUPA 1ILPA 2XVSA 1EWHA 4CJ2C 4ZAIA 2QF7A 4RH6A 5EPLA 1SNMA 5EPKA 3EFXD 3NXWA 2A5HA 2RDHA 4C56C 1O7ZA 3LX0A 1LT6D 3E6ZX 1OXXK 1V1PA 2F0VA 3HS0C 1B4OA 1EOTA 4TQUS 2N88A 1FNVA 3CQZB 2EVBA 4CGYB 4DN4M 1HFGA 2BCOA 1F9PA 1LTRD 2ZT9C 5JAVA 5JVG3 1FD7D 1EFID 3J7AV 5C44B 1EU4A 2EYMA 3TSSA 2RQXA 2QKIC 2M2LA 4ZKBB 2PW7A 5M5YB 4PQXA 2DY7A 1LT3D 1TKWB 2DNCA 4BY1B 1JOKA 2F0HA 3E0JA 5FO9B 3FPUB 1YNJD 3H3VC 1CQFA 2KQ3A 4TRDA 2AUKA 4U68A 3NK9A 1V1OA 1DONA 1VMPA 1PRTB 4X3SA 2B2TC 4A3KB 4IFDG 1OXVA 2KJXA 3GQBA 4HEDA 5C4XB 3MXNA 3ZYYX 1QJOA 2E2DC 4R8IA 2PCFB 4K5WA 3VA5A 3X3MA 5FO8B 4F8MA 1EWCA 1TIID 4XTCS 4RKBA 1U4RA 2N55A 4DA2A 2E74C 4RWSC 3BG3A 3D8GA 3DMUA 2LFNA 3TP6A 2Z4HA 4FO2A 5KNBA 1Z6HA 2LY7A 4RCOA 1LLRD 1PFMA 5I9OA 1Q90A 3NQIA 2FJ2A 1RODA 1EYDA 3FDTA 1SDFA 5F2DA 2ID0A 3GD7A 3AMUA 5CV4A 3KBXA 1R4QB 2WKDA 1O78A 3NE5B 1QNUA 4OGQC 2HUGA 4M8AA 1A3VA 4EQPA 4GZYC 5KYLA 3R2IA 5DM73 4DXGA 3MXUA 1EZ6A 5C3WA 5JVH3 3M4YA 4K6DA 4M1UB 3VR2A 3VR6A 2JE6I 5M5WB 5I2XA 1M4VA 5EGTA 4A3EB 3HOZB 3A55A 5M3MB 2YYZA 1AZPA 2TMPA 1X3PA 3I4MB 1KTKA 1SSOA 3W3AA 4IALA 4PMCA 4R9WA 1JOQA 2D2CC 5CV5A 4WRDA 2F1MA 3IFTA 1ICWA 2V4DA 1JC7A 5IT9L 2Z4IA 4A3DB 4ZRZA 5CMDA 3PUYA 2E2JB 3I70A 4OIKA 1WTQA 5ELBA 4KN7C 2PZTA 3MXGA 2XWJB 1PYWD 5ELFA 4QIWB 3I3CA 1V1PB 4DU9A 1QG7A 1PXUA 3BDCA 2B8FA 2JEAI 2IX0A 4EVOA 1QOHA 2L4NA 1Y69U 2M00A 1GXDC 4IUQA 5CV6A 5DEHA 2Q8RE 5IT9E 4C3JG 3H0GB 1SNQA 5J22A 2K6AA 2HCCA 1CA6A 4X3KA 3S16B 5C6AA 2XN9C 4BA1I 1RF2D 2IT1A 1SNDA 4KD4A 2Q8IB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4K2L A;  5IGE A;  3V2T A;  4KV6 A;  5CGK A;  1EZ6 A;  1SYC A;  5C3W A;  1STA A;  3SK4 A;  3DHQ A;  4K6D A;  4DFA A;  2PZU A;  2QDB A;  1SNO A;  1EYA A;  2PW7 A;  1SYE A;  2F0K A;  1F2M A;  3D4D A;  1KDB A;  4NMZ A;  4WOR A;  5E3F A;  3PMF A;  4ZUJ A;  4LAA A;  4B9X A;  1JOR A;  2O4X A;  1EYC A;  1A2T A;  1SNC A;  2EY1 A;  1ENC A;  2F0F A;  5IGG A;  4KD3 A;  1JOK A;  2EY6 A;  5EGT A;  4N9P A;  2F0H A;  2WAC A;  4G57 A;  2EYJ A;  3TP8 A;  3QOJ A;  2F0M A;  3HEJ A;  4K8I A;  4HMI A;  3TME A;  4ME5 A;  4YIJ A;  5IIF A;  3EVQ A;  4IUN A;  4KY7 A;  5K5P A;  4ODG A;  1IHZ A;  1JOO A;  3OWF A;  4IAL A;  1SYF A;  2PW5 A;  4PMC A;  4PMB A;  2EYH A;  2KQ3 A;  2F0W A;  4J6H A;  4K2K A;  1F2Z A;  4TRD A;  3MEH A;  2F0J A;  1JOQ A;  1AEX A;  5C5L A;  4B9W A;  4K14 A;  2OF1 A;  1STB A;  3NK9 A;  2EYP A;  3T13 A;  1U9R A;  1SYB A;  4KJN A;  5CV5 A;  5IOC A;  5KRU A;  4RKL A;  4WRD A;  2F3W A;  4QMG A;  4HMJ A;  3BDL A;  3P75 A;  4KHV A;  4K8J A;  4KTA A;  1SNP A;  3D6C A;  4E6I A;  4EQN A;  5C4Z A;  2F0P A;  3R3O A;  1A3U A;  1EY9 A;  1STN A;  2F0S A;  2F0N A;  5JOB A;  3QOL A;  1KAA A;  5CV8 A;  5IGD A;  5IOD A;  5KIX A;  2F0G A;  3SHL A;  5EKK A;  5C5M A;  1EY8 A;  2RKS A;  3D4W A;  2SNM A;  4EQO A;  5HUR A;  1KDA A;  2F0L A;  2EXZ A;  2KHS A;  1EQV A;  5J1Z A;  1STY A;  5KEE A;  5I9P A;  3OMG A;  4PNY A;  5IGB A;  2F0O A;  5CR3 A;  3P1H A;  5KGU A;  2SOB A;  5HGT A;  2EY5 A;  1KAB A;  4K5W A;  2PZT A;  2PZW A;  3NHH A;  5M9O A;  3VA5 A;  3QB3 A;  3ERO A;  5IGC A;  2OEO A;  4I65 A;  5ISR A;  5J39 A;  4F8M A;  3C1F A;  4KJO A;  4MIU A;  3SXH A;  3E5S A;  5EKL A;  4DU9 A;  2RBM A;  3U9O A;  2OXP A;  4QB4 A;  5DAU A;  4RKB A;  2PQE A;  3BDC A;  3EJI A;  4NDX A;  1SYG A;  3SK5 A;  4OL7 A;  5C4H A;  2EYF A;  5CC4 A;  2EYO A;  3HZX A;  4R8N A;  2EYL A;  3D8G A;  3DMU A;  2F0I A;  2HQE A;  4KY6 A;  4EVO A;  2F0Q A;  3OMC A;  4QF4 A;  2M00 A;  3T16 A;  1EZ8 A;  1EY6 A;  3MVV A;  2PYK A;  1SNM A;  1TT2 A;  3ERQ A;  3NQT A;  4IZ8 A;  3RUZ A;  3TP7 A;  2EY2 A;  4HTH A;  5CV6 A;  1II3 A;  2SNS A;  3TP6 A;  3TP5 A;  1A2U A;  4K5V A;  5DEH A;  5CV9 A;  1NSN S;  3NXW A;  4ZQ3 A;  3S9W A;  2F0E A;  3ITP A;  1TQO A;  1STH A;  2F3V A;  1TR5 A;  1SNQ A;  5KYI A;  5J22 A;  3SK6 A;  3LX0 A;  4ID6 A;  5I9O A;  3OSO A;  2F0V A;  5I6Y A;  2F0T A;  4ZUI A;  5C6A A;  1EY0 A;  3H6M A;  3NP8 A;  4F7X A;  1ENA A;  2ENB A;  1NUC A;  1EYD A;  1F2Y A;  3MHB A;  5CV7 A;  3SK8 A;  4DF7 A;  4NKL A;  5IGF A;  1SYD A;  4J1M A;  1EY7 A;  2RDF A;  5NUC A;  5F2D A;  5C3X A;  2F0U A;  5I6W A;  1RKN A;  2NUC A;  5CV4 A;  1EY4 A;  3MXP A;  5JAV A;  3C1E A;  2LKV A;  3MZ5 A;  4S3S A;  4KD4 A;  3SR1 A;  4DGZ A;  4KY5 A;  1EY5 A;  1A3V A;  1KDC A;  1SND A;  4NP5 A;  5E1F A;  4EQP A;  1A3T A;  5KYL A;  2EYM A;  4K5X A;  2F0D A;  3NUC A;  1STG A;  4N9T A;  4H7B A; 
#chains in the Genus database with same CATH topology
 5ELO A;  3H0G H;  3D4D A;  3TZD A;  1ENF A;  1FGU A;  3OOC A;  3CRK C;  3HP3 A;  1A2T A;  1EEF D;  1SNC A;  5IT9 c;  2EQS A;  1JWS D;  3SEB A;  3S16 H;  2X6L A;  4X64 L;  4LFA Q;  4LFC L;  4APV A;  4JOI A;  4LK1 C;  1U4P A;  3HEJ A;  4QY7 A;  1MSG A;  2NN6 I;  3MXN B;  2PW5 A;  4DV6 L;  1P8L A;  3OWE B;  4OO1 I;  4A3L G;  4JI5 Q;  3T13 A;  2A6E C;  2BDO A;  3CCS A;  3R93 A;  4JBW A;  2ALY B;  4HMJ A;  3GP7 A;  3P75 A;  3GTM B;  3TN2 A;  3A5U A;  2OQK A;  5IOD A;  3QOL A;  1KAA A;  1IBK Q;  2RSN A;  5IP9 G;  1PRT D;  2NYZ D;  2RKS A;  4H13 C;  4X66 L;  1DYQ A;  1PYB A;  3VYS A;  2EE1 A;  3P7J A;  1BO0 A;  3MFG A;  2AWN A;  3NTI A;  4X65 L;  3S2H B;  1KAB A;  5FK9 C;  3K5L A;  3QB3 A;  4UP7 A;  1TS5 A;  1PYS B;  2C5C A;  1BUV T;  3N6R A;  3RLF A;  3GTG B;  2VUM G;  1C8C A;  4BY7 G;  1CKN B;  3QIA A;  1PH9 A;  3GTM H;  2HQE A;  3CXC A;  3OMC A;  3S1M B;  5JJL A;  1F77 A;  1WJJ A;  4LF4 Q;  1A2U A;  4B3R Q;  1NSN S;  3L7Z C;  2VS1 A;  3A5Z B;  3PF5 A;  2F3V A;  3HOW B;  3KF6 B;  3S2H H;  2F3I A;  4IUR A;  1ESF A;  1N8R C;  2F0T A;  2A8V A;  3A8I E;  2UUB Q;  4AYB B;  3EBE A;  2ENB A;  4PZ7 A;  3NBI A;  1Q3L A;  1L0Y B;  4GOP C;  1PZJ D;  1PFS A;  3RLN A;  3D3R A;  2KVM A;  1G2S A;  4JYA Q;  2K50 A;  3TZU A;  4DUZ Q;  2RSO A;  2QEX A;  3S15 B;  2IJ0 A;  3S1M H;  3BVG A;  4JI6 Q;  1Q8I A;  1K8A C;  2XRQ D;  1PV4 A;  4UHV A;  1QVG A;  2K5V A;  4XQJ A;  4G7O C;  4P71 A;  2K75 A;  2ZXR A;  1LT4 D;  2K7V A;  1H9S A;  3WOF A;  4E6I A;  2WKC A;  2AHO B;  1HNW Q;  2CW0 C;  5JEA G;  4N8X 1;  1V1Q A;  1GUW A;  1TU2 B;  1LM0 A;  4Z9C B;  5IWA L;  1CHQ D;  2F0M A;  3CCL A;  3NEM A;  3EVQ A;  5E4X A;  4IUN A;  1L2F A;  4B3S L;  1JCK B;  1LAB A;  2H4O A;  1HPC A;  4A3I B;  4A3M H;  4K2K A;  2C35 B;  5FLX L;  2K05 A;  3A56 A;  1H9M A;  1YNN C;  4JI1 L;  1D5M C;  1SYB A;  1Q82 C;  4GKJ L;  1YHQ A;  2Z9H A;  4KKS A;  3H91 A;  1PH6 A;  3DLL A;  2FFK B;  4CKC A;  1VF7 A;  1EQQ A;  3CU7 A;  1N34 L;  3Q23 A;  2OQ0 A;  5COY A;  4EQO A;  2WAQ E;  3LWU A;  3I8Z A;  2JA8 G;  3K7A B;  4OXP A;  3R8B A;  3W5O A;  2K32 A;  3NPP A;  3U9S A;  5IGB A;  1B7Y B;  5I4D A;  2NVY B;  4CDF C;  3BVZ A;  1WTX A;  2PPB C;  4WJ3 M;  3KLS X;  2Q2I A;  3S2D B;  1N36 Q;  3TS0 A;  4BXX G;  1WCM B;  1VF5 C;  5K36 G;  1JJC B;  1I4P A;  2V1C C;  3VYU A;  1EQT A;  4RGN A;  1QZG A;  4GLX A;  2EZV A;  5FLX E;  2NVX B;  5CBE E;  3HOY H;  2HT1 A;  4DUY L;  2EYL A;  5COR A;  3I91 A;  1SFO H;  1FL0 A;  3T53 B;  1TWA B;  2PNH A;  1C9O A;  1I4Q A;  1K73 C;  2IY5 B;  4YY3 L;  2UXC Q;  4Y7N H;  5D65 A;  1A62 A;  2PMZ B;  2RHQ B;  2NVY H;  3HOX H;  4BS9 A;  4A3G G;  1JJG A;  4LF9 Q;  1BOS A;  3U50 C;  1NTG A;  1UE7 A;  4F7X A;  1WCM H;  3SK8 A;  5IY0 A;  4DF7 A;  1NR4 A;  2Z1C A;  4QL5 A;  5DNF A;  4F88 A;  3FMC A;  2NVX H;  1HNX L;  3W2D A;  1H95 A;  1E2V A;  2VXW A;  3C1E A;  1PH7 A;  3L2P A;  4R4C A;  2PI2 A;  4N9T A;  2EXD A;  2HIX A;  3J81 L;  3V2T A;  1XMQ L;  5LL6 X;  1Y8O B;  2R7F A;  4RHR A;  4DR3 Q;  3DWP A;  3FKI H;  4OHJ A;  1SNO A;  2F03 A;  1X9N A;  1KDB A;  5E3F A;  3PMF A;  1YJW A;  4DV2 Q;  3CCQ A;  4HJA A;  3RR5 A;  3AU7 A;  4JCV E;  1YIT A;  3AQQ A;  4RG1 A;  2JA5 H;  3R2T A;  1LTG D;  2A68 D;  2EYJ A;  1GKH A;  2BA1 A;  4C3I G;  5LMU L;  2YTX A;  1IBM Q;  2IW3 A;  2WII B;  1CFM A;  1IYU A;  3MEF A;  1VQ6 A;  5G3L D;  1Y8N B;  2WB1 B;  2KOL A;  5BN3 A;  2UXB Q;  3CP0 A;  3EQL C;  1STE A;  3BDL A;  4FXG C;  4L6T B;  4K8J A;  5C4Z A;  2HHH Q;  5C0X G;  4KMU C;  2BE5 C;  3J81 E;  3SHL A;  5EKK A;  3RD4 A;  1QE6 A;  1T9H A;  2F0L A;  4DR1 Q;  5JPN C;  1AH9 A;  1M1K C;  3LWE A;  3EN2 A;  1FR3 A;  2L0C A;  5E4W C;  3P1H A;  1IL2 A;  2MNA A;  2NZO A;  4P72 A;  2SOB A;  2L5T A;  1IBL Q;  1ASY A;  5GAE C;  1H9J A;  2MPM A;  1DZ1 A;  1E2Z A;  5FLM H;  5T1I A;  4A3B H;  1AP0 A;  1SE4 A;  1I5F A;  3A7L A;  1KC8 C;  3G71 A;  3GTP B;  3BU2 A;  2PQE A;  3SK5 A;  3HZX A;  4H44 C;  2F0I A;  3A7A B;  5M3F B;  4JI4 L;  2G9D A;  4DPG A;  1VCI A;  4IZ8 A;  4R4T A;  2UU9 L;  2JA6 B;  1JE4 A;  1PTO C;  4ZQ3 A;  2XSC A;  2KHI A;  3DM1 A;  2QDL A;  1GM5 A;  5LMN W;  3F2U A;  2B2V C;  1TR5 A;  3J81 c;  1XTC D;  1I6H B;  5I6Y A;  1U4L A;  4LFB Q;  2NZH A;  3ERS X;  1H9S B;  3HKZ B;  1AN8 A;  1NUC A;  4HN7 A;  3VR4 A;  3IAY A;  5IP7 G;  2N8N A;  3GTP H;  1UEB A;  3KF8 A;  3GTL B;  1RKN A;  1YVC A;  5H1S E;  1JWU D;  1G2T A;  3MZ5 A;  1SE8 A;  5M3F H;  4O2D A;  1WVL A;  2E76 C;  2JA6 H;  2NVQ H;  4HCE A;  1LTS D;  4K2L A;  4BWG B;  2R6G A;  2R3Z A;  3GO5 A;  1VQ4 A;  4OON A;  1I6H H;  1EYA A;  2RA4 A;  5T1G A;  3WOE A;  2B63 G;  3A8J E;  1SN8 A;  5DM6 3;  1AFP A;  4FF4 A;  1LTB D;  2BDN A;  3PO3 G;  3HG9 A;  3T1Y Q;  3TME A;  1ILQ A;  4RMF A;  4U67 3;  1QVF A;  5K5P A;  3GTL H;  1CM9 A;  1OXS C;  4IJL A;  1AEX A;  2O5I C;  4K14 A;  2X6G A;  1D7Q A;  1GOZ A;  1CQV A;  1KQS A;  4EQN A;  2ICE C;  1MJE A;  1KIX A;  1SRU A;  5AJ3 Q;  3R3O A;  2CCZ A;  1VQD A;  4R4I A;  5AFW A;  3KJP A;  1VQP A;  3S1N B;  4RFB A;  4Y52 H;  2VZA A;  3HFZ B;  1WTO A;  3S24 A;  4C3H B;  4JBK A;  1X65 A;  2AKW B;  3HOV G;  3OMG A;  1I3Q B;  1RIP A;  2OT2 A;  3PUW A;  3NHH A;  3BVM A;  4HJ9 A;  5IGC A;  3CKI B;  2OEO A;  2MJ8 A;  3KLS A;  1J9O A;  4LUV A;  5C44 H;  1K8O A;  2RCN A;  2C9O A;  3C1F A;  4KJO A;  3E5S A;  1HFN A;  2CH4 A;  1B9N A;  2EIF A;  2ICI A;  1R4P B;  5M5Y H;  2JA7 G;  4KKU A;  1EWI A;  1DJR D;  3S1Q B;  3CC4 A;  4YHH Q;  1EY6 A;  2Y0S B;  2HCI A;  4IPD A;  1TT2 A;  3S1N H;  4DR2 Q;  4C3H H;  2N3S A;  3L0O A;  3I4N B;  1CI3 M;  2F4I A;  3SDZ A;  1BF4 A;  1G8Z D;  3T1H Q;  2HQL A;  1QB5 D;  2I5L X;  2K04 A;  1ICF B;  1VQN A;  4DK1 A;  4FDB A;  2K14 A;  1Q1E A;  1GUG A;  4NXN L;  3URY A;  2Q8T A;  2UXD L;  4ZUI A;  3G6E A;  2B29 A;  3I73 A;  4IN3 A;  2FMM A;  1DXM A;  1TWH B;  1Y1V G;  3S1R B;  3A0J A;  2E5L Q;  2CKZ B;  4OEL B;  2ZXO A;  1RD9 D;  1H9R A;  4G7H C;  1A3T A;  5C4X H;  1I4H A;  4K5X A;  4DV4 L;  4UP8 A;  5EKI A;  1LTL A;  3I4N H;  2F4V Q;  3K5O A;  4ILW A;  1CT1 D;  3ICE A;  1ASZ A;  1JOR A;  3STB D;  4GNX C;  5GAD C;  3VYR A;  4JG2 A;  2UUC Q;  3T56 B;  1V43 A;  2A1A A;  3GTK B;  4G57 A;  4YCU A;  1SLJ A;  1CZW A;  3S1R H;  1HRJ A;  1HNZ Q;  3NWT A;  1IHZ A;  4LF5 Q;  2R92 G;  1SAP A;  1YHA A;  2VQF Q;  3U58 A;  2B2V A;  1U9R A;  4DV1 L;  1HCZ A;  1S40 A;  4HJ7 A;  4QMG A;  1D1K A;  4XT1 B;  3Q24 A;  3AB9 A;  2IWH A;  3PIO A;  1VQJ A;  2KCM A;  4XDX A;  2KHS A;  1I94 L;  4PZ6 A;  1X3Q A;  4C1N I;  3QJY A;  3PO2 G;  3GTK H;  1P16 A;  5I9P A;  1VQH A;  3ER0 A;  5KGU A;  5EAY A;  1G51 A;  4FYD A;  1HR0 L;  3KYH C;  1KAW A;  1DOL A;  1RCV D;  1PMR A;  3PUZ A;  3J81 i;  4BBS B;  4QGU A;  3J81 j;  4V0B A;  3RZD B;  1YZ6 A;  1F9Q A;  3QWN A;  3CCV A;  1N32 Q;  3KF8 B;  3Q6S A;  3KK7 A;  2ZJR A;  3GTO B;  1DOM A;  1L1O C;  2CH4 W;  3AFP A;  4QCL A;  1NE3 A;  3J7A 5;  1TXY A;  2AQ1 B;  4WJ4 A;  1BCP F;  3CC2 A;  3DXJ C;  1SYD A;  1T5X D;  4GN5 A;  3GTJ B;  4JI3 L;  5C4J B;  2F0U A;  2NUC A;  4RCN A;  1F9S A;  4FNF A;  1D2B A;  2LKV A;  4A3D H;  2KCN A;  4ZUJ A;  2WFW A;  2E2J H;  3GTO H;  3NUC A;  5IGE A;  1SYC A;  5I2Y A;  3KJO A;  4HAE A;  1GUT A;  1D5Z C;  1S4Z A;  1EYC A;  1B9M A;  1WTH A;  3DWA A;  4LFA L;  2Y0S E;  2B2T A;  1ZYR C;  3TP8 A;  4WFN 3;  1C48 A;  3HRZ C;  1QCB D;  3SE0 A;  2R7Z B;  4KY7 A;  1VMC A;  5C4J H;  3OWF A;  2WAQ B;  3BZD B;  1XXG A;  2EYH A;  2F0W A;  1HTP A;  4NW2 A;  4DV0 Q;  3MEH A;  4JI5 L;  3LNN A;  1S5E D;  1E1O A;  2B2U C;  2Z0S A;  1UUP A;  4OIJ A;  4A3J G;  1W2B A;  1VQ8 A;  5FKA C;  2BA0 A;  4RA8 A;  2F0P A;  1B44 D;  1Y8P B;  2WV6 D;  1IBK L;  1PH5 A;  4O1N A;  1IW7 C;  5IGD A;  1Y1W B;  1G6P A;  1TWC B;  1PZI D;  5HUR A;  4DNR B;  1EUJ A;  1KDA A;  1EFW A;  1KNE A;  4KK7 A;  5D3I B;  5C3E G;  1EYG A;  5KND A;  2NVT B;  2R7Z H;  1AW7 A;  2L55 A;  4JPB W;  3M9B A;  3ERO A;  1X55 A;  2QIL A;  2L1B A;  4MIU A;  4XXE A;  1I50 B;  1X3G A;  2DN8 A;  1WD1 A;  1V8Q A;  1OXU A;  2RF4 A;  3AFQ A;  2R93 G;  3J7Y W;  1GO3 E;  1WFQ A;  5BR8 Q;  3MTS A;  4GNX A;  4KHZ A;  3M7N A;  4RAU C;  3T16 A;  2JP1 A;  1Y1W H;  3NBH A;  4UPA A;  3NQT A;  2PYK A;  3A54 A;  3OIQ A;  4LF4 L;  1TWC H;  4HTH A;  4LF6 Q;  2X69 A;  4B3R L;  4K5V A;  4C3J B;  4A3M G;  3RN2 A;  1VQI A;  1W6J A;  1J8I A;  3ULP A;  1BVS A;  4PZ8 A;  3ND8 A;  1KRS A;  3EA6 A;  1S5C D;  2M9V A;  2UUB L;  2QGQ A;  3Q22 A;  1F2Y A;  3J7Z C;  1BBW A;  2XGT A;  1EY7 A;  4JYA L;  4UDU C;  3BDO A;  3E3X A;  4DUZ L;  2I46 A;  1EY4 A;  1M90 C;  1VQ7 A;  4JI6 L;  4HID A;  3HOU B;  1S5F D;  1X6O A;  2JYO A;  2ZM6 Q;  5D14 A;  4C3J H;  1CTM A;  1DOK A;  1RDP D;  2AMC B;  4DR5 Q;  4DV5 Q;  4DAP A;  1MIU A;  2NN6 G;  3OW2 A;  1A8V A;  4TVA B;  2MHV A;  4WOR A;  1HNW L;  4A93 G;  4X3U A;  4OO1 G;  3CCJ A;  4KN4 C;  3HOY G;  3ND9 A;  2EY6 A;  3GTG H;  1ZXT A;  4DXF A;  4JK1 C;  1KD1 C;  3D0F A;  1R9T B;  2NZ1 D;  1SYF A;  4ME3 A;  2Z6K A;  1K28 A;  3HOX G;  3GV3 A;  2RHS B;  1SXT A;  1STB A;  3AEV A;  2KED A;  1KRT A;  4ZCK A;  3HOW H;  2VNU D;  1EL0 A;  4F87 A;  1MSH A;  1SNP A;  1PTO F;  3KBG A;  4WJW A;  3K59 A;  3TEH B;  4L5Q A;  2CQA A;  4L63 B;  1CK1 A;  5EPJ A;  1QNK A;  1EY8 A;  5LHY 1;  2VL6 A;  2CHB D;  1Z47 A;  1F9R A;  2GA4 B;  4MNO A;  5GAH C;  1BCP C;  2GVB A;  2A6H C;  2HDM A;  3S15 H;  1R9T H;  4L5R C;  4A3L H;  3RLO A;  1N36 L;  1B2T A;  2K5H A;  3FKI G;  1ET9 A;  3CW2 C;  1OTC A;  2VUM B;  4BY7 B;  3SXH A;  1SMY D;  3BS1 A;  2LMC B;  4QB4 A;  2RDG A;  2JA5 G;  1TWG B;  1JWM D;  1OXT A;  4CDD C;  3J80 L;  1SYG A;  4IUT A;  4OL7 A;  3CME A;  1DD2 A;  1YJ9 A;  3FPP A;  4DV3 Q;  1EZ8 A;  3RUZ A;  4TSS A;  4A3C G;  3ULJ A;  3TP5 A;  1TWF B;  3E0E A;  4LUZ A;  2UXC L;  1TQO A;  4P75 A;  1VQE A;  2MP1 A;  2AWO A;  1BNZ A;  1O7L A;  4ID6 A;  4AH6 A;  3VDY A;  3NWS A;  4A3I H;  2A69 C;  5A2Q L;  4LF9 L;  1JB3 A;  3TRZ A;  4B3T Q;  1SEB D;  1EQR A;  4A3F G;  4NXM Q;  2VUM H;  1ENA A;  4BY7 H;  5CV7 A;  4GKK Q;  3PIP 3;  1XX8 A;  4CHT B;  4Q0F A;  1GUO A;  5NUC A;  1HHV A;  4XYO A;  4IPG A;  2JSO A;  4FF2 A;  5LL6 S;  5IYC H;  3J80 E;  4MTN A;  1KDC A;  2H1E A;  1TWF H;  2LSS A;  3K7A H;  3H09 A;  1E3P A;  3KLW A;  3CCU A;  4A3B G;  4DR3 L;  4DV7 Q;  4JV5 Q;  3DEP A;  1O7Y A;  3H3V H;  1H9K A;  1UEA B;  2R61 A;  3RNU A;  3K80 C;  2OWO A;  1F2M A;  4B9X A;  2J0T D;  4NMZ A;  3S2D H;  4DV2 L;  1E2W A;  2EY1 A;  3O13 A;  3VR3 A;  4QUF A;  4N9P A;  2WAC A;  3FP9 A;  1X3F A;  5A2Q E;  4K8I A;  1IBM L;  4H02 A;  3M4O B;  4EX5 A;  3MFY A;  1VQF A;  4J6H A;  4O0A A;  1TWA H;  5FLX c;  4QUC A;  2F0J A;  1D1I A;  3PGZ A;  2UXB L;  1XMO Q;  3U4V A;  4OWT B;  4IJH A;  2F3W A;  3S17 B;  4BBR G;  2R7D A;  2HHH L;  1BR9 A;  2AQ3 B;  1CKO A;  3J80 c;  5M9O A;  2SEB D;  2JA8 B;  3B6Y A;  4GNX B;  4DR1 L;  1XJV A;  1N9W A;  4FF1 A;  2EXZ A;  2PQA A;  3NBH B;  5J1Z A;  1YIJ A;  5IE8 A;  2AQ2 B;  1VS0 A;  4PNY A;  2QW7 A;  1IBL L;  4YCW A;  3K0X A;  2IPK D;  1O80 A;  3A74 A;  1HXY D;  1FYC A;  2A68 C;  1XNR Q;  2EJG C;  4HSP A;  4IPC A;  2N78 A;  1TY0 A;  5EKL A;  2RBM A;  2VQE Q;  1Y14 B;  2XIW A;  5C4H A;  4NDX A;  2EYO A;  4OWX B;  3PUX A;  2MQH A;  1QVC A;  3W1B A;  1HA6 A;  1TY2 A;  3GDE A;  4QF4 A;  1I4G A;  1PFN A;  3TP7 A;  3ERQ A;  4GOP A;  5CC4 A;  4KHP Q;  2JA8 H;  1G6Z A;  2BE5 D;  1WI5 A;  3S14 B;  1S5D D;  3CD6 A;  4A3G B;  4IUU A;  2I5H A;  1PH2 A;  1EU3 A;  4JI7 Q;  3K58 A;  4L5S A;  2KEE A;  3CC7 A;  4LFB L;  1XNQ Q;  5JPM C;  3PSI A;  4LJZ C;  2ZXP A;  1HUM A;  1IYV A;  4IQZ A;  3TBI B;  4C1N K;  5I6W A;  1G91 A;  3U4Z A;  4NB3 A;  4XT3 B;  2NWG A;  3KUP A;  2EPB A;  2KUM A;  1N33 Q;  1KLG D;  4NP5 A;  2QEJ C;  5CV9 A;  2GN5 A;  2DJF C;  4L8J A;  1ZKO A;  5C44 G;  5JJZ A;  3S14 H;  3M3Y B;  2K52 A;  3FEW X;  3SK4 A;  1HR0 W;  4A3G H;  3F8T A;  5EBD A;  3J7A F;  3FRP B;  3OPO A;  3UDG A;  2A19 A;  2F0F A;  1GHJ A;  3I72 A;  5IGG A;  3V05 A;  2TSS A;  4C3I B;  2I07 B;  4BY1 G;  4A76 A;  1J5E Q;  3QOJ A;  3T1Y L;  3RZO B;  1CA5 A;  3OTO Q;  4GLA C;  1TS4 A;  3CCE A;  2H5X A;  1JOO A;  2IX3 A;  1RHP A;  4I7A A;  1B50 A;  4MZ9 A;  2A74 C;  3I90 A;  5C5L A;  4CBV A;  2EYP A;  5KRU A;  1FJG Q;  2K5D A;  3M3Y H;  2E8G A;  3T4A C;  1LTT D;  2JQO A;  5AJ3 L;  1V9P A;  2F0N A;  1GUS A;  2KEC A;  1S3O A;  4A3K G;  1K8M A;  3V96 A;  1B1Z A;  1DGS A;  1VQK A;  4C3I H;  3M4Q A;  1Q81 C;  1EQV A;  1STY A;  3T51 B;  5C4X G;  2F0O A;  2LXK A;  5CR3 A;  3RZO H;  1GD7 A;  3DUZ A;  2EY5 A;  2PZW A;  1IL8 A;  3GTQ B;  3K0Y A;  4IFD I;  4AIM A;  1IKM A;  1K9M C;  4RGM A;  2EJF C;  4V19 0;  5C0X H;  4DAY A;  4YHH L;  2Q2H A;  1MKH A;  3K5N A;  3MVV A;  4HSV A;  4JBJ A;  4I7Z C;  2IHF A;  4LMQ D;  3ULL A;  4DR2 L;  1MD2 D;  2SNS A;  4FXD A;  1CZG A;  3ZJY C;  4HIO A;  2F0E A;  3T1H L;  1DCZ A;  2JJQ A;  5KYI A;  4POG A;  1VQL A;  4UY8 C;  5ELD A;  3OSO A;  3GTQ H;  1YNJ C;  1M8A A;  1VQO A;  2ASB A;  1B3A A;  1HQM C;  1D5X C;  2KEN A;  2LXJ A;  2E5L L;  1GUN A;  2K33 A;  2NTT A;  1I4X A;  3MXP A;  4LF8 Q;  1X32 A;  4P2C B;  4HIM A;  1JIC A;  2GVA A;  5FO7 B;  3QG1 A;  3IRB A;  3I4L A;  2F4V L;  4R4O A;  2O5J C;  5CGK A;  1I3Q H;  1CSP A;  1X3E A;  4DR7 Q;  1MGS A;  1E22 A;  3K5M A;  4IFD J;  3HGB A;  2B63 B;  3VA7 A;  4X6A H;  2MO1 A;  4BA2 I;  2YU9 B;  4IO9 A;  4KD3 A;  2UUC L;  5JJK A;  3PO3 B;  5IP7 H;  4A3E G;  1AE2 A;  2XRS D;  3HOZ G;  3J80 i;  3MAQ A;  1HNZ L;  5M3M G;  3KOJ A;  4LF5 L;  2PQA B;  4ODG A;  3S1Q H;  4R4Q A;  2ZJP A;  1BBX C;  3I4M G;  2PO4 A;  2VQF L;  1XWE A;  3G7L A;  1KXL A;  1K8G A;  4B9W A;  4K0K Q;  4ZLT F;  4DR6 Q;  1LO5 D;  2N49 A;  4H0L C;  3Q8D A;  1EIF A;  4YCV A;  3NSW A;  1B3Q A;  4ULL A;  1A3U A;  1EY9 A;  1STN A;  2F0S A;  1VQ5 A;  1I6V C;  4OWW B;  3FVQ A;  2B63 H;  1PRT F;  4G7Z C;  2EOT A;  2YU9 H;  1CUK A;  2SNM A;  1PH8 A;  3HOV B;  4A3D G;  3K57 A;  3PO3 H;  1A0I A;  1TWH H;  2EJM A;  1PFB A;  4GOP B;  2I5M X;  4Q5V A;  4FVM A;  3STB C;  1TS2 A;  5M5X B;  4JI0 Q;  1D6E C;  3KLR A;  5HGT A;  2ZTE A;  4GN3 B;  5ISR A;  4CKB A;  2SDF A;  2YTV A;  3RMH A;  1VQA A;  3U9O A;  2OXP A;  3KFU A;  2B8G A;  4IUV A;  2JA7 B;  4IPH A;  3EJI A;  4AQY Q;  1N32 L;  4PV1 C;  1AZQ A;  1NY4 A;  2F0Q A;  1Q8K A;  3FHW A;  2UUA Q;  3CHB D;  1VQM A;  3I7F A;  2DNE A;  5KNC A;  2CFM A;  5IYB G;  1HQR D;  4DK0 A;  3BZC A;  4RHS A;  3CCR A;  4HCS A;  3MC0 B;  5GAG C;  1QWY A;  1SBB B;  1BCP B;  3H0G G;  1WD0 A;  4RGO S;  1RJT A;  2AUJ D;  2BOS A;  3CRL C;  3NP8 A;  1Y1V B;  5IGF A;  2L9H A;  4NKL A;  1PVO A;  1QZH A;  1SJH D;  1J6Q A;  4IFD H;  3DEO A;  1UNS A;  3SR1 A;  1MHW C;  1HZA A;  1LUZ A;  1LTI D;  5HY6 A;  2K5N A;  2L11 A;  3SVM A;  4B3M Q;  4FXK C;  2F0D A;  3TDQ A;  3K7U C;  4ABN A;  5HGQ A;  2QDB A;  1XPO A;  4DR4 Q;  3DWQ A;  4LAA A;  3PV0 A;  4LF7 Q;  5L37 A;  1A15 A;  1Y1V H;  4BBS H;  4DAV A;  2K03 A;  3X3N A;  3UI2 A;  2KCC A;  1NBW A;  1LTA D;  2G9H D;  3RZD H;  4ME5 A;  2R92 B;  2B2W C;  1HZB A;  3LGJ A;  1XYI A;  5LMN Q;  4DV0 L;  1NNX A;  3M7G A;  1I4R A;  4HR7 B;  1ML0 D;  2BH8 A;  4FP5 D;  5IYD H;  1WTV A;  3G4S A;  4KJN A;  5IOC A;  3E9I A;  3OW7 A;  1NCV A;  2J4X A;  4KHV A;  2A73 B;  4X62 Q;  3QO2 A;  4CJ0 B;  2F0G A;  4DAY B;  3WDN A;  1C0A A;  3PO2 B;  3A8K E;  2CWP A;  4DK3 C;  3GTJ H;  1AE3 A;  5FJ8 H;  3K6O A;  1ZYR D;  3JAM L;  2B39 A;  1TS3 A;  3VYT A;  3P20 A;  3IKJ A;  4MTK A;  5DAU A;  1IKL A;  5CYU A;  1WTW A;  2D0O A;  4C2M B;  5BR8 L;  3I55 A;  2EYF A;  3D31 A;  1PDQ A;  2YV5 A;  4JI8 Q;  3BJU A;  1BDO A;  3H94 A;  3KDF A;  1X54 A;  4DGZ A;  4LF6 L;  3PO2 H;  2ES2 A;  1CKM A;  1K3R A;  4OX9 Q;  3ITP A;  1WTR A;  1IW7 D;  1B53 A;  1C4Q A;  1PLF A;  4JI2 Q;  3SK6 A;  1XPU A;  3HOW G;  1IXR A;  4XQN A;  1SE3 A;  2KA7 A;  2HDL A;  1KL9 A;  5DLQ E;  3H6M A;  1EY0 A;  1RTN A;  1HH2 P;  4AYB G;  4J1M A;  3C46 A;  1ONL A;  2RDF A;  3JAM E;  4C2M H;  3D6W A;  5C3X A;  2ATW A;  2A6E D;  1A6X A;  2ZTC A;  3H3V I;  4S3S A;  4YWK A;  2MGS A;  2ZM6 L;  2WIN B;  4ZK9 B;  1STG A;  4DR5 L;  1PRT C;  4DV5 L;  4KV6 A;  1O7I A;  1STA A;  2NVT H;  3DHQ A;  1U0L A;  1LV9 A;  2K1B A;  2DY8 A;  2L12 A;  5EBC A;  1DM0 B;  2MUY A;  1I50 H;  3MA2 B;  4ZYS A;  1K3B C;  4X64 Q;  2MO0 A;  4LFC Q;  4LWC A;  3OHX C;  1WYD A;  4YIJ A;  1E1T A;  4ZKC B;  2PNR C;  4DV6 Q;  5G3L F;  4DAM A;  5ELC A;  1L0W A;  4A3I G;  4O42 A;  1YHB A;  4A3J B;  3JAM c;  1PTO B;  3DM3 A;  2KCT A;  1UAP A;  4J8Q A;  3PUV A;  1E0B A;  4KTA A;  2FMC A;  1KLU D;  1Q86 C;  5CV8 A;  3OIP A;  1BBU A;  5KIX A;  3G6J B;  5C5M A;  3TQY A;  1U4M A;  4K6L A;  5EQ0 A;  3F2B A;  4X66 Q;  5IYC G;  1MBY A;  5C3E B;  5KEE A;  1UE1 A;  4MHE A;  2RVL A;  2RCF A;  1OO9 B;  2VW9 A;  1JE5 A;  1Q12 A;  4P73 A;  4X65 Q;  4XYQ A;  2OCE A;  1EIG A;  1L1O A;  3C3L A;  2QA4 A;  3HOU H;  1E24 A;  4I65 A;  5J39 A;  1HA5 A;  3Q0A A;  2R93 B;  4A3J H;  1PTO H;  1WCM G;  3I4O A;  3TS2 A;  3L9A X;  3OYY A;  4LUO A;  4R8N A;  5ELE A;  4DV3 L;  4CJ1 B;  2BH2 A;  2MFI A;  3UDI A;  1FGB D;  4A3M B;  2EY2 A;  5TSS A;  3S9W A;  2CW0 D;  4QIW E;  1SJE D;  2B2W A;  2XWB B;  5C3E H;  1HZC A;  1TVX A;  3D4R A;  3NTK A;  5JEA J;  4B3T L;  1FVI A;  1FNW A;  4NXM L;  1BCP D;  1W6K A;  4XQQ A;  1RTO A;  2CVR A;  2A6H D;  4JBM A;  4GKK L;  1KNA A;  2R93 H;  4UAI A;  3G48 A;  1VDZ A;  2B2Y C;  2VB3 X;  1YNN D;  5IP9 H;  1QIL A;  2D62 A;  1SMY C;  1UE5 A;  2D9U A;  3I2Z A;  4N8F A;  4KKT A;  1EY5 A;  1WTP A;  1B70 B;  1PHJ A;  2L15 A;  1LAC A;  1HTL D;  4H7B A;  4DV7 L;  4JV5 L;  1GVP A;  2NB0 A;  2IX1 A;  1ET6 A;  4A93 B;  1VQB A;  2PZU A;  1G29 1;  2JXM B;  2F0K A;  3HOY B;  3CPF A;  2B2U A;  4EQ5 A;  1VQ9 A;  1SFO B;  2JN4 A;  2K5Q A;  1XTD A;  1TWG H;  4Y7N B;  2A69 D;  5IWA Q;  1K83 B;  4HMI A;  5IIF A;  2VY3 A;  1YI2 A;  3QR8 A;  1NR2 A;  1F2L A;  5BN5 A;  4PMB A;  4B3S Q;  3HOX B;  4YWM A;  2FIN B;  1XMO L;  2D5D A;  1ZEQ X;  3IFD A;  1Q46 A;  3GV6 A;  5FLM G;  2XNA C;  1JB7 A;  3NTH A;  2JEB I;  4JI1 Q;  4RKL A;  2NN6 H;  2K01 A;  1T5E A;  2WB1 G;  2Z8L A;  4L5T A;  4GKJ Q;  4A93 H;  1QUQ A;  4OO1 H;  2Q2T A;  5D3D A;  1JR0 D;  4RGT A;  1N34 Q;  4G4K A;  2K4K A;  1LT5 D;  3D4W A;  1JQY D;  1ESR A;  3E9H A;  1Q7Y C;  3C2P A;  3PCO B;  2JA9 A;  3KDF B;  5E7N A;  3IL8 A;  4TKO B;  1K83 H;  4CDE C;  3L3O C;  1Q1B A;  4XIG S;  3FKI B;  5C0X I;  4A75 A;  2B3G A;  3TRE A;  3M85 A;  1XNR L;  4X3T A;  2E2I B;  1PZK D;  2JA5 B;  4R1J A;  2VQE L;  2LS0 1;  3MWY W;  1PH1 A;  3UDF A;  1D8L A;  3NEL A;  5JEA H;  1GJX A;  4KY6 A;  4DUY Q;  2K5W A;  3AYH B;  2NTS A;  4KHP L;  1CSQ A;  5M3F G;  1II3 A;  4YY3 Q;  2D0P A;  2KBN A;  2JA6 G;  5A35 A;  1SE2 A;  1STH A;  3M4O H;  1KHI A;  3ONA B;  2ZJQ A;  4JI7 L;  4IOC A;  5CBA E;  4A3F B;  1Z7T A;  1XNQ L;  2O2L D;  3K81 C;  4EGV A;  2E2I H;  1EIH A;  4GS3 A;  1SRO A;  2QCP X;  3MHB A;  2VB2 X;  2I0Q A;  1YEZ A;  3S17 H;  3HKZ G;  4IOA A;  1MI2 A;  3W1G A;  3VR5 A;  1HNX Q;  1N33 L;  4A3C H;  4KY5 A;  5E1F A;  4A3B B;  4CKE A;  3NEN A;  1NAP A;  1IZ6 A;  5C0X J;  2WP8 J;  4AYB E;  4GLV B;  1YBY A;  4DFA A;  1XMQ Q;  4KI0 A;  1SYE A;  4BXX H;  2NBF A;  4PMW A;  5K36 H;  4DNT B;  4A3F H;  2O4X A;  3JAM i;  1EOV A;  1ENC A;  1RL2 A;  4DNI A;  2E2H B;  3PIO 3;  4B08 A;  1J5E L;  1CHP D;  1SR3 A;  1U5K A;  3OTO L;  3N52 A;  5LMU Q;  1BXT A;  4MN3 A;  1JMC A;  3BYT B;  1F2Z A;  2IL8 A;  1BQQ T;  1S5B D;  2FHT A;  2OF1 A;  1L1O B;  4BBR B;  1PH3 A;  2DGY A;  1L0X B;  1FJG L;  2DJG C;  3CAM A;  2EDG A;  1GHK A;  3D6C A;  1PTO D;  1EEI D;  2J7Z A;  5JOB A;  5EJW A;  4FF3 A;  1YJN A;  1FNU A;  1HUN A;  2K28 A;  2E2H H;  3BYY B;  2B2Y A;  2NVQ B;  5FOB B;  5BN4 A;  4C3H G;  2E75 C;  4IUP A;  1NJI C;  4LW1 A;  2CQO A;  1PH4 A;  1ILP A;  2XVS A;  1EWH A;  4ALP A;  4QJF A;  4CJ2 C;  4BBR H;  4ZAI A;  2IHE A;  3M4P A;  2QF7 A;  4P74 A;  4RH6 A;  5EPL A;  1SNM A;  5EPK A;  4JI4 Q;  3EFX D;  2UU9 Q;  2Y0S G;  1YNX A;  3NXW A;  2A5H A;  2RDH A;  4C56 C;  3I4N G;  1O7Z A;  3LX0 A;  1LT6 D;  3E6Z X;  1OXX K;  4J15 A;  1V1P A;  2ZTD A;  2F0V A;  2FXQ A;  3HS0 C;  3K8A A;  3JC6 6;  1B4O A;  1EOT A;  3CMA A;  4TQU S;  2N88 A;  1FNV A;  3CQZ B;  4HJ8 A;  3UE1 A;  1NMF A;  2EVB A;  4CGY B;  4DN4 M;  1HFG A;  4LF8 L;  2BCO A;  1F9P A;  1LTR D;  2PMZ E;  2ZT9 C;  5JAV A;  5JVG 3;  1FD7 D;  3SGI A;  1EFI D;  3J7A V;  4UP9 A;  5C44 B;  1EU4 A;  2EYM A;  3TSS A;  4DR7 L;  2RQX A;  2QKI C;  2M2L A;  4JVZ A;  4LNQ A;  4ZKB B;  2PW7 A;  5M5Y B;  4PQX A;  2DY7 A;  1LT3 D;  1TKW B;  2DNC A;  1EIY B;  4BY1 B;  1JJ2 A;  1QUQ B;  1JOK A;  2F0H A;  3PIP A;  3E0J A;  5FO9 B;  2HD3 A;  4POF A;  4QQB X;  3EIV A;  3CQZ H;  3FPU B;  1YNJ D;  3H3V C;  1X56 A;  4YWL A;  1CQF A;  4PG3 A;  1SMX A;  5GRO A;  2KQ3 A;  2YTY A;  4TRD A;  4K0K L;  4DR6 L;  2AUK A;  4U68 A;  3NK9 A;  1V1O A;  1DON A;  1VMP A;  1PRT B;  4X3S A;  3CF5 A;  1VQC A;  2B2T C;  2G5D A;  4A3K B;  4IFD G;  1OXV A;  2KJX A;  2OTL A;  4DKA C;  4BY1 H;  3GQB A;  1VQG A;  4HED A;  5C4X B;  3MXN A;  3ZYY X;  1QJO A;  2WB1 E;  4JI0 L;  2CWA A;  2DUD A;  2E2D C;  1UWV A;  3PQI A;  4R8I A;  2PCF B;  4K5W A;  3VA5 A;  3X3M A;  1K0S A;  5FO8 B;  4F8M A;  1EWC A;  1TII D;  4XTC S;  4RKB A;  1U4R A;  2N55 A;  4DA2 A;  2E74 C;  4AQY L;  4BBS G;  4RWS C;  4JOI C;  4JW0 A;  3BG3 A;  3D8G A;  3DMU A;  3WWV A;  2UUA L;  4A3K H;  2LFN A;  3TP6 A;  3PF4 A;  4HJ5 A;  5GQO A;  2P5Z X;  2Z4H A;  4FO2 A;  5KNB A;  1Z6H A;  2LY7 A;  4RCO A;  1Z9F A;  5IYD G;  1LLR D;  1PFM A;  3CCM A;  5I9O A;  1BKB A;  1Q90 A;  3BZK A;  3NQI A;  2Q2U A;  4NXN Q;  2UXD Q;  2FJ2 A;  1CKN A;  1ROD A;  1EYD A;  3FDT A;  4JC0 A;  1SDF A;  5F2D A;  3F1Z A;  2ID0 A;  3GD7 A;  3AMU A;  5CV4 A;  3KBX A;  1R4Q B;  2WKD A;  1O78 A;  3NE5 B;  1JT8 A;  2HIV A;  2OTJ A;  1QNU A;  4OGQ C;  2HUG A;  5FJ8 G;  4M8A A;  1A3V A;  4B3M L;  3HOV H;  4EQP A;  4GZY C;  5KYL A;  3R2I A;  3KF6 A;  5DM7 3;  3F2C A;  4DXG A;  3MXU A;  4DV4 Q;  1EZ6 A;  5C3W A;  3HKZ E;  5JVH 3;  3M4Y A;  4K6D A;  1LYL A;  4M1U B;  5M5X H;  3VR2 A;  4DR4 L;  1XPR A;  1IYJ B;  4DK6 C;  4LF7 L;  2XTI A;  3VR6 A;  2JE6 I;  5M5W B;  5I2X A;  1M4V A;  5EGT A;  4A3E B;  3HOZ B;  3A55 A;  5M3M B;  2JA7 H;  2YYZ A;  1AZP A;  2TMP A;  1X3P A;  3I4M B;  1KTK A;  1SSO A;  5LMN L;  1C7Y A;  1MJC A;  3W3A A;  4IAL A;  4PMC A;  3RN5 A;  2R7Z G;  3UE0 A;  4OEM B;  4CDC C;  2WAQ G;  4GN4 B;  4R9W A;  1JOQ A;  2D2C C;  5CV5 A;  4DV1 Q;  4WRD A;  2F1M A;  3IFT A;  1E7Z A;  1ICW A;  4X62 L;  2V4D A;  1JC7 A;  5IT9 L;  2Z4I A;  4HIK A;  4A3D B;  4ZRZ A;  5M5W H;  1Y1W G;  1WOC A;  5CMD A;  4A3E H;  3HOZ H;  3PUY A;  2E2J B;  2Z6K C;  3I70 A;  1I94 Q;  5M3M H;  3I4M H;  4OIK A;  1WTQ A;  5ELB A;  4KN7 C;  2PZT A;  3CPW A;  3F2D A;  1HR0 Q;  3MXG A;  2XWJ B;  4KLK A;  1PYW D;  4QIW B;  5ELF A;  3I3C A;  1V1P B;  4DU9 A;  5J3B A;  1QG7 A;  1PXU A;  3BDC A;  2B8F A;  2JEA I;  1S72 A;  4NPS A;  3I56 A;  4JI8 L;  2KHJ A;  2IX0 A;  4EVO A;  1QOH A;  2L4N A;  1Y69 U;  3H15 A;  2M00 A;  1GXD C;  4IUQ A;  4A4I A;  5CV6 A;  1NMG A;  4OX9 L;  5DEH A;  1HZ9 A;  2Q8R E;  5IT9 E;  4C3J G;  4JI2 L;  5JJI A;  2R92 H;  3H0G B;  5ELN A;  1SNQ A;  5J22 A;  1PA6 A;  1A63 A;  2K6A A;  2HCC A;  2JK8 A;  3UDX A;  1CA6 A;  1HJP A;  1UE6 A;  1K0R A;  2F52 A;  4X3K A;  3S16 B;  2Z6B A;  2XN9 C;  5C6A A;  4BA1 I;  1RF2 D;  1B8A A;  1W3S A;  3HKS A;  4JI3 Q;  2IT1 A;  5IYB H;  2PI2 E;  1SND A;  4KD4 A;  3HOU G;  2Q8I B; 
#chains in the Genus database with same CATH homology
 3D4D A;  3TZD A;  1ENF A;  3OOC A;  3CRK C;  3HP3 A;  1A2T A;  1EEF D;  1SNC A;  1JWS D;  3SEB A;  2X6L A;  4LK1 C;  1U4P A;  3HEJ A;  1MSG A;  2NN6 I;  2PW5 A;  3OWE B;  4OO1 I;  3T13 A;  2A6E C;  2BDO A;  3R93 A;  4JBW A;  4HMJ A;  3GP7 A;  3P75 A;  3GTM B;  3TN2 A;  5IOD A;  3QOL A;  1KAA A;  2RSN A;  1PRT D;  2NYZ D;  2RKS A;  4H13 C;  1DYQ A;  3VYS A;  2EE1 A;  3P7J A;  1BO0 A;  3MFG A;  2AWN A;  3NTI A;  3S2H B;  1KAB A;  5FK9 C;  3K5L A;  3QB3 A;  1TS5 A;  2C5C A;  1BUV T;  3N6R A;  3RLF A;  3GTG B;  1C8C A;  3QIA A;  2HQE A;  3OMC A;  3S1M B;  1F77 A;  1A2U A;  1NSN S;  3L7Z C;  2F3V A;  3HOW B;  4IUR A;  1ESF A;  2F0T A;  3A8I E;  4AYB B;  2ENB A;  3NBI A;  1Q3L A;  1L0Y B;  1PZJ D;  3D3R A;  2KVM A;  1G2S A;  3TZU A;  2RSO A;  3S15 B;  2IJ0 A;  3BVG A;  1Q8I A;  2XRQ D;  4XQJ A;  4G7O C;  2ZXR A;  1LT4 D;  2K7V A;  1H9S A;  3WOF A;  4E6I A;  2WKC A;  2CW0 C;  5JEA G;  1GUW A;  1TU2 B;  4Z9C B;  1CHQ D;  2F0M A;  3EVQ A;  5E4X A;  4IUN A;  1JCK B;  1LAB A;  2H4O A;  1HPC A;  4A3I B;  4K2K A;  5FLX L;  2K05 A;  3A56 A;  1H9M A;  1YNN C;  1D5M C;  1SYB A;  4KKS A;  3H91 A;  2FFK B;  4CKC A;  1VF7 A;  3CU7 A;  3Q23 A;  5COY A;  4EQO A;  3LWU A;  3I8Z A;  3K7A B;  3R8B A;  2K32 A;  3NPP A;  3U9S A;  5IGB A;  5I4D A;  2NVY B;  3BVZ A;  1WTX A;  2PPB C;  3KLS X;  3S2D B;  1WCM B;  1VF5 C;  5K36 G;  1I4P A;  3VYU A;  1EQT A;  4RGN A;  2EZV A;  5FLX E;  2NVX B;  5CBE E;  2EYL A;  5COR A;  3I91 A;  3T53 B;  1TWA B;  1I4Q A;  5D65 A;  2PMZ B;  4BS9 A;  1BOS A;  4F7X A;  3SK8 A;  4DF7 A;  1NR4 A;  2Z1C A;  5DNF A;  4F88 A;  3FMC A;  3W2D A;  1E2V A;  2VXW A;  3C1E A;  4N9T A;  3J81 L;  3V2T A;  5LL6 X;  1Y8O B;  4RHR A;  3DWP A;  4OHJ A;  1SNO A;  2F03 A;  1KDB A;  5E3F A;  3PMF A;  3AU7 A;  3R2T A;  1LTG D;  2A68 D;  2EYJ A;  2BA1 A;  4C3I G;  2IW3 A;  2WII B;  1CFM A;  1IYU A;  5G3L D;  1Y8N B;  2WB1 B;  2KOL A;  5BN3 A;  3EQL C;  1STE A;  3BDL A;  4FXG C;  4L6T B;  4K8J A;  5C4Z A;  5C0X G;  4KMU C;  2BE5 C;  3J81 E;  3SHL A;  5EKK A;  3RD4 A;  1QE6 A;  2F0L A;  5JPN C;  3LWE A;  1FR3 A;  2L0C A;  5E4W C;  3P1H A;  2SOB A;  2L5T A;  1H9J A;  2MPM A;  1DZ1 A;  1E2Z A;  5T1I A;  1AP0 A;  1SE4 A;  3A7L A;  3GTP B;  2PQE A;  3SK5 A;  3HZX A;  4H44 C;  2F0I A;  3A7A B;  5M3F B;  2G9D A;  1VCI A;  4IZ8 A;  2JA6 B;  1JE4 A;  1PTO C;  4ZQ3 A;  2XSC A;  3DM1 A;  3F2U A;  2B2V C;  1TR5 A;  1XTC D;  1I6H B;  5I6Y A;  1U4L A;  1H9S B;  3HKZ B;  1AN8 A;  1NUC A;  4HN7 A;  3VR4 A;  3IAY A;  3KF8 A;  3GTL B;  1RKN A;  1JWU D;  1G2T A;  3MZ5 A;  1WVL A;  2E76 C;  4HCE A;  1LTS D;  4K2L A;  4BWG B;  2R6G A;  2R3Z A;  3GO5 A;  1EYA A;  2RA4 A;  5T1G A;  3WOE A;  3A8J E;  5DM6 3;  1AFP A;  4FF4 A;  1LTB D;  2BDN A;  3HG9 A;  3TME A;  1ILQ A;  4U67 3;  5K5P A;  1CM9 A;  1OXS C;  1AEX A;  2O5I C;  4K14 A;  2X6G A;  1GOZ A;  1CQV A;  4EQN A;  2ICE C;  3R3O A;  5AFW A;  3S1N B;  4RFB A;  1WTO A;  4C3H B;  3OMG A;  1I3Q B;  2OT2 A;  3PUW A;  3NHH A;  3BVM A;  5IGC A;  3CKI B;  2OEO A;  2MJ8 A;  3KLS A;  1J9O A;  1K8O A;  3C1F A;  2C9O A;  4KJO A;  3E5S A;  1HFN A;  1B9N A;  2ICI A;  1R4P B;  4KKU A;  3S1Q B;  1DJR D;  1EY6 A;  2Y0S B;  2HCI A;  1TT2 A;  3I4N B;  1CI3 M;  2F4I A;  3SDZ A;  1BF4 A;  1G8Z D;  1QB5 D;  2K04 A;  4DK1 A;  1Q1E A;  1GUG A;  3URY A;  2Q8T A;  4ZUI A;  3I73 A;  4IN3 A;  2FMM A;  1DXM A;  1TWH B;  3S1R B;  2ZXO A;  1RD9 D;  1H9R A;  4G7H C;  1A3T A;  4K5X A;  1I4H A;  5EKI A;  3K5O A;  4ILW A;  1CT1 D;  1JOR A;  3VYR A;  3T56 B;  1V43 A;  3GTK B;  4G57 A;  1CZW A;  1HRJ A;  3NWT A;  1IHZ A;  1SAP A;  2B2V A;  1U9R A;  1HCZ A;  4QMG A;  1D1K A;  4XT1 B;  3Q24 A;  3AB9 A;  2IWH A;  4XDX A;  2KHS A;  4C1N I;  1X3Q A;  3QJY A;  5I9P A;  5KGU A;  4FYD A;  1DOL A;  1RCV D;  1PMR A;  3PUZ A;  4BBS B;  4V0B A;  3RZD B;  1F9Q A;  3QWN A;  3Q6S A;  3KK7 A;  3GTO B;  1DOM A;  4QCL A;  2AQ1 B;  1BCP F;  3DXJ C;  1SYD A;  1T5X D;  3GTJ B;  5C4J B;  2F0U A;  2NUC A;  4RCN A;  1F9S A;  4FNF A;  1D2B A;  2LKV A;  2KCN A;  4ZUJ A;  3NUC A;  5IGE A;  1SYC A;  5I2Y A;  4HAE A;  1GUT A;  1D5Z C;  1S4Z A;  1EYC A;  1B9M A;  3DWA A;  2B2T A;  1ZYR C;  3TP8 A;  4WFN 3;  1C48 A;  3HRZ C;  1QCB D;  3SE0 A;  2R7Z B;  4KY7 A;  1VMC A;  3OWF A;  2WAQ B;  3BZD B;  1XXG A;  2EYH A;  2F0W A;  1HTP A;  4NW2 A;  3MEH A;  3LNN A;  1S5E D;  2B2U C;  1UUP A;  4OIJ A;  5FKA C;  2BA0 A;  4RA8 A;  2F0P A;  1B44 D;  1Y8P B;  2WV6 D;  4O1N A;  1IW7 C;  5IGD A;  1Y1W B;  1TWC B;  1PZI D;  5HUR A;  4DNR B;  1KDA A;  1KNE A;  4KK7 A;  5D3I B;  5KND A;  2NVT B;  1AW7 A;  2L55 A;  3ERO A;  2QIL A;  2L1B A;  4MIU A;  4XXE A;  1I50 B;  2DN8 A;  1WD1 A;  1V8Q A;  1OXU A;  3J7Y W;  3MTS A;  4KHZ A;  3M7N A;  4RAU C;  3T16 A;  2JP1 A;  3NBH A;  2PYK A;  3NQT A;  3A54 A;  3OIQ A;  4HTH A;  2X69 A;  4K5V A;  4C3J B;  1W6J A;  1J8I A;  3ND8 A;  3EA6 A;  1S5C D;  2M9V A;  3Q22 A;  1F2Y A;  1EY7 A;  4UDU C;  3BDO A;  2I46 A;  1EY4 A;  3HOU B;  1S5F D;  2JYO A;  5D14 A;  1CTM A;  1DOK A;  1RDP D;  4DAP A;  2NN6 G;  2MHV A;  4WOR A;  4X3U A;  4OO1 G;  4KN4 C;  3ND9 A;  2EY6 A;  1ZXT A;  4DXF A;  4JK1 C;  1R9T B;  2NZ1 D;  1SYF A;  3GV3 A;  1SXT A;  1STB A;  2KED A;  2VNU D;  1EL0 A;  4F87 A;  1MSH A;  1SNP A;  1PTO F;  3KBG A;  4WJW A;  3K59 A;  2CQA A;  4L63 B;  1CK1 A;  5EPJ A;  1QNK A;  1EY8 A;  5LHY 1;  2CHB D;  1Z47 A;  1F9R A;  2GA4 B;  1BCP C;  2A6H C;  2HDM A;  1B2T A;  1ET9 A;  2VUM B;  4BY7 B;  3SXH A;  1SMY D;  3BS1 A;  2LMC B;  4QB4 A;  2RDG A;  1TWG B;  1JWM D;  1OXT A;  3J80 L;  1SYG A;  4IUT A;  4OL7 A;  1DD2 A;  3FPP A;  1EZ8 A;  3RUZ A;  4TSS A;  3TP5 A;  1TWF B;  1TQO A;  2MP1 A;  2AWO A;  1BNZ A;  1O7L A;  4ID6 A;  3NWS A;  2A69 C;  5A2Q L;  1JB3 A;  1SEB D;  1ENA A;  5CV7 A;  3PIP 3;  1XX8 A;  4CHT B;  4Q0F A;  1GUO A;  5NUC A;  1HHV A;  4XYO A;  2JSO A;  4FF2 A;  5LL6 S;  3J80 E;  1KDC A;  2H1E A;  3H09 A;  3DEP A;  1O7Y A;  1H9K A;  1UEA B;  2R61 A;  1F2M A;  4B9X A;  2J0T D;  4NMZ A;  1E2W A;  2EY1 A;  3O13 A;  3VR3 A;  4QUF A;  4N9P A;  2WAC A;  5A2Q E;  4K8I A;  3M4O B;  3MFY A;  4J6H A;  4QUC A;  2F0J A;  1D1I A;  2F3W A;  3S17 B;  1BR9 A;  2AQ3 B;  5M9O A;  2SEB D;  2JA8 B;  4FF1 A;  2EXZ A;  5J1Z A;  2AQ2 B;  4PNY A;  2IPK D;  1O80 A;  1HXY D;  1FYC A;  2A68 C;  2EJG C;  4HSP A;  1TY0 A;  5EKL A;  2RBM A;  2XIW A;  5C4H A;  4NDX A;  2EYO A;  3PUX A;  1HA6 A;  1TY2 A;  4QF4 A;  1I4G A;  1PFN A;  3TP7 A;  3ERQ A;  5CC4 A;  1G6Z A;  2BE5 D;  3S14 B;  1S5D D;  4A3G B;  4IUU A;  1EU3 A;  3K58 A;  2KEE A;  5JPM C;  4LJZ C;  2ZXP A;  1HUM A;  1IYV A;  4IQZ A;  3TBI B;  4C1N K;  5I6W A;  1G91 A;  4XT3 B;  2NWG A;  3KUP A;  2EPB A;  2KUM A;  1KLG D;  4NP5 A;  2QEJ C;  5CV9 A;  4L8J A;  1ZKO A;  5JJZ A;  3M3Y B;  3FEW X;  3SK4 A;  5EBD A;  3J7A F;  3FRP B;  3OPO A;  2F0F A;  1GHJ A;  3I72 A;  5IGG A;  3V05 A;  2TSS A;  4C3I B;  2I07 B;  3QOJ A;  3RZO B;  1CA5 A;  1TS4 A;  1JOO A;  2IX3 A;  1RHP A;  1B50 A;  2A74 C;  3I90 A;  5C5L A;  4CBV A;  2EYP A;  5KRU A;  2K5D A;  3T4A C;  1LTT D;  2F0N A;  1GUS A;  2KEC A;  1K8M A;  3V96 A;  1B1Z A;  1EQV A;  1STY A;  3T51 B;  2F0O A;  5CR3 A;  3DUZ A;  2EY5 A;  2PZW A;  1IL8 A;  3GTQ B;  3K0Y A;  4IFD I;  1IKM A;  4RGM A;  2EJF C;  4V19 0;  5C0X H;  4DAY A;  3K5N A;  3MVV A;  4HSV A;  4I7Z C;  4LMQ D;  1MD2 D;  2SNS A;  4FXD A;  1CZG A;  2F0E A;  1DCZ A;  5KYI A;  5ELD A;  3OSO A;  1YNJ C;  1M8A A;  1B3A A;  1HQM C;  1D5X C;  1GUN A;  2K33 A;  2NTT A;  1I4X A;  3MXP A;  1X32 A;  4P2C B;  1JIC A;  5FO7 B;  3QG1 A;  3I4L A;  2O5J C;  5CGK A;  1MGS A;  3K5M A;  4IFD J;  3HGB A;  2B63 B;  3VA7 A;  4BA2 I;  2YU9 B;  4KD3 A;  3PO3 B;  2XRS D;  3MAQ A;  4ODG A;  1BBX C;  2PO4 A;  1XWE A;  3G7L A;  4B9W A;  4ZLT F;  1LO5 D;  4H0L C;  3NSW A;  4ULL A;  1A3U A;  1EY9 A;  1STN A;  2F0S A;  1I6V C;  3FVQ A;  1PRT F;  4G7Z C;  2EOT A;  2SNM A;  3HOV B;  3K57 A;  2EJM A;  1PFB A;  4Q5V A;  4FVM A;  1TS2 A;  5M5X B;  1D6E C;  3KLR A;  5HGT A;  5ISR A;  4CKB A;  2SDF A;  3RMH A;  3U9O A;  2OXP A;  2B8G A;  4IUV A;  2JA7 B;  3EJI A;  4PV1 C;  1AZQ A;  2F0Q A;  3CHB D;  2DNE A;  5KNC A;  1HQR D;  4DK0 A;  4RHS A;  4HCS A;  3MC0 B;  1QWY A;  1SBB B;  1BCP B;  1WD0 A;  4RGO S;  1RJT A;  2AUJ D;  2BOS A;  3CRL C;  3NP8 A;  1Y1V B;  5IGF A;  2L9H A;  4NKL A;  1SJH D;  4IFD H;  3DEO A;  1UNS A;  3SR1 A;  1LTI D;  3SVM A;  2L11 A;  4FXK C;  2F0D A;  3TDQ A;  4ABN A;  2QDB A;  3DWQ A;  4LAA A;  3PV0 A;  1A15 A;  4DAV A;  2K03 A;  3X3N A;  3UI2 A;  2KCC A;  1LTA D;  2G9H D;  4ME5 A;  2R92 B;  2B2W C;  1XYI A;  3M7G A;  1I4R A;  4HR7 B;  1ML0 D;  4FP5 D;  1WTV A;  4KJN A;  5IOC A;  3OW7 A;  1NCV A;  2J4X A;  4KHV A;  2A73 B;  3QO2 A;  4CJ0 B;  2F0G A;  3WDN A;  3PO2 B;  3A8K E;  3K6O A;  1ZYR D;  3JAM L;  2B39 A;  1TS3 A;  3VYT A;  3P20 A;  3IKJ A;  5DAU A;  1IKL A;  5CYU A;  1WTW A;  4C2M B;  2EYF A;  3D31 A;  1PDQ A;  1BDO A;  3H94 A;  4DGZ A;  3ITP A;  1WTR A;  1IW7 D;  1B53 A;  1C4Q A;  1PLF A;  3SK6 A;  4XQN A;  1SE3 A;  2KA7 A;  2HDL A;  1EY0 A;  3H6M A;  1RTN A;  4J1M A;  3C46 A;  1ONL A;  2RDF A;  3JAM E;  3D6W A;  5C3X A;  2A6E D;  1A6X A;  4S3S A;  2MGS A;  2WIN B;  4ZK9 B;  1STG A;  1PRT C;  4KV6 A;  1STA A;  3DHQ A;  1LV9 A;  2K1B A;  2DY8 A;  2L12 A;  5EBC A;  1DM0 B;  2MUY A;  4ZYS A;  3MA2 B;  3OHX C;  4YIJ A;  4ZKC B;  2PNR C;  5G3L F;  5ELC A;  4O42 A;  4A3J B;  1PTO B;  1UAP A;  4J8Q A;  3PUV A;  1E0B A;  4KTA A;  2FMC A;  1KLU D;  5CV8 A;  3OIP A;  5KIX A;  3G6J B;  5C5M A;  1U4M A;  4K6L A;  5EQ0 A;  1MBY A;  5C3E B;  5KEE A;  4MHE A;  2RVL A;  1OO9 B;  1Q12 A;  4XYQ A;  1EIG A;  3C3L A;  5J39 A;  4I65 A;  1HA5 A;  3Q0A A;  2R93 B;  1PTO H;  3L9A X;  4R8N A;  5ELE A;  4CJ1 B;  1FGB D;  4A3M B;  2EY2 A;  5TSS A;  3S9W A;  2CW0 D;  1SJE D;  2B2W A;  2XWB B;  1TVX A;  3D4R A;  3NTK A;  5JEA J;  1FNW A;  1BCP D;  1W6K A;  4XQQ A;  1RTO A;  2CVR A;  2A6H D;  1KNA A;  4UAI A;  1VDZ A;  2B2Y C;  2VB3 X;  1YNN D;  1QIL A;  2D62 A;  1SMY C;  2D9U A;  4KKT A;  1EY5 A;  1WTP A;  1LAC A;  1HTL D;  4H7B A;  2NB0 A;  2IX1 A;  1ET6 A;  4A93 B;  2PZU A;  1G29 1;  2JXM B;  2F0K A;  3HOY B;  2B2U A;  1SFO B;  2K5Q A;  4Y7N B;  2A69 D;  1K83 B;  4HMI A;  5IIF A;  1NR2 A;  1F2L A;  5BN5 A;  4PMB A;  3HOX B;  2FIN B;  2D5D A;  1ZEQ X;  3IFD A;  3GV6 A;  2XNA C;  3NTH A;  2JEB I;  4RKL A;  2NN6 H;  2K01 A;  1T5E A;  2Z8L A;  4OO1 H;  5D3D A;  1JR0 D;  4RGT A;  4G4K A;  1LT5 D;  3D4W A;  1JQY D;  1ESR A;  3C2P A;  3IL8 A;  4TKO B;  3L3O C;  1Q1B A;  4XIG S;  3FKI B;  5C0X I;  3M85 A;  4X3T A;  2E2I B;  1PZK D;  2JA5 B;  2LS0 1;  3MWY W;  5JEA H;  1GJX A;  4KY6 A;  2K5W A;  2NTS A;  1II3 A;  5A35 A;  1SE2 A;  1STH A;  3ONA B;  5CBA E;  4A3F B;  1Z7T A;  2O2L D;  4EGV A;  1EIH A;  2QCP X;  3MHB A;  2VB2 X;  1MI2 A;  3VR5 A;  4KY5 A;  5E1F A;  4A3B B;  4CKE A;  1NAP A;  5C0X J;  2WP8 J;  4DFA A;  4KI0 A;  1SYE A;  2NBF A;  4PMW A;  5K36 H;  4DNT B;  2O4X A;  1ENC A;  2E2H B;  3PIO 3;  4B08 A;  1CHP D;  3N52 A;  1BXT A;  4MN3 A;  3BYT B;  1F2Z A;  2IL8 A;  1BQQ T;  1S5B D;  2FHT A;  2OF1 A;  4BBR B;  1L0X B;  2EDG A;  1GHK A;  3D6C A;  1PTO D;  1EEI D;  2J7Z A;  5JOB A;  5EJW A;  4FF3 A;  1FNU A;  1HUN A;  2K28 A;  3BYY B;  2B2Y A;  2NVQ B;  5FOB B;  5BN4 A;  4C3H G;  2E75 C;  4IUP A;  1ILP A;  2XVS A;  1EWH A;  4CJ2 C;  4ZAI A;  2QF7 A;  4RH6 A;  5EPL A;  1SNM A;  5EPK A;  3EFX D;  3NXW A;  2A5H A;  2RDH A;  4C56 C;  1O7Z A;  3LX0 A;  1LT6 D;  3E6Z X;  1OXX K;  1V1P A;  2F0V A;  3HS0 C;  1B4O A;  1EOT A;  4TQU S;  2N88 A;  1FNV A;  3CQZ B;  2EVB A;  4CGY B;  4DN4 M;  1HFG A;  2BCO A;  1F9P A;  1LTR D;  2ZT9 C;  5JAV A;  5JVG 3;  1FD7 D;  1EFI D;  3J7A V;  5C44 B;  1EU4 A;  2EYM A;  3TSS A;  2RQX A;  2QKI C;  2M2L A;  4ZKB B;  2PW7 A;  5M5Y B;  4PQX A;  2DY7 A;  1LT3 D;  1TKW B;  2DNC A;  4BY1 B;  1JOK A;  2F0H A;  3E0J A;  5FO9 B;  3FPU B;  1YNJ D;  3H3V C;  1CQF A;  2KQ3 A;  4TRD A;  2AUK A;  4U68 A;  3NK9 A;  1V1O A;  1DON A;  1VMP A;  1PRT B;  4X3S A;  2B2T C;  4A3K B;  4IFD G;  1OXV A;  2KJX A;  3GQB A;  4HED A;  5C4X B;  3MXN A;  3ZYY X;  1QJO A;  2E2D C;  4R8I A;  2PCF B;  4K5W A;  3VA5 A;  3X3M A;  5FO8 B;  4F8M A;  1EWC A;  1TII D;  4XTC S;  4RKB A;  1U4R A;  2N55 A;  4DA2 A;  2E74 C;  4RWS C;  3BG3 A;  3D8G A;  3DMU A;  2LFN A;  3TP6 A;  2Z4H A;  4FO2 A;  5KNB A;  1Z6H A;  2LY7 A;  4RCO A;  1LLR D;  1PFM A;  5I9O A;  1Q90 A;  3NQI A;  2FJ2 A;  1ROD A;  1EYD A;  3FDT A;  1SDF A;  5F2D A;  2ID0 A;  3GD7 A;  3AMU A;  5CV4 A;  3KBX A;  1R4Q B;  2WKD A;  1O78 A;  3NE5 B;  1QNU A;  4OGQ C;  2HUG A;  4M8A A;  1A3V A;  4EQP A;  4GZY C;  5KYL A;  3R2I A;  5DM7 3;  4DXG A;  3MXU A;  1EZ6 A;  5C3W A;  5JVH 3;  3M4Y A;  4K6D A;  4M1U B;  3VR2 A;  3VR6 A;  2JE6 I;  5M5W B;  5I2X A;  1M4V A;  5EGT A;  4A3E B;  3HOZ B;  3A55 A;  5M3M B;  2YYZ A;  1AZP A;  2TMP A;  1X3P A;  3I4M B;  1KTK A;  1SSO A;  3W3A A;  4IAL A;  4PMC A;  4R9W A;  1JOQ A;  2D2C C;  5CV5 A;  4WRD A;  2F1M A;  3IFT A;  1ICW A;  2V4D A;  1JC7 A;  5IT9 L;  2Z4I A;  4A3D B;  4ZRZ A;  5CMD A;  3PUY A;  2E2J B;  3I70 A;  4OIK A;  1WTQ A;  5ELB A;  4KN7 C;  2PZT A;  3MXG A;  2XWJ B;  1PYW D;  5ELF A;  4QIW B;  3I3C A;  1V1P B;  4DU9 A;  1QG7 A;  1PXU A;  3BDC A;  2B8F A;  2JEA I;  2IX0 A;  4EVO A;  1QOH A;  2L4N A;  1Y69 U;  2M00 A;  1GXD C;  4IUQ A;  5CV6 A;  5DEH A;  2Q8R E;  5IT9 E;  4C3J G;  3H0G B;  1SNQ A;  5J22 A;  2K6A A;  2HCC A;  1CA6 A;  4X3K A;  3S16 B;  5C6A A;  2XN9 C;  4BA1 I;  1RF2 D;  2IT1 A;  1SND A;  4KD4 A;  2Q8I B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...