1KAAA

Stress and strain in staphylococcal nuclease
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYAPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Stress and strain in staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 40
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1992-12-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1kaaA00
1JOOA 1TT2A 3H6MA 1STGA 4ID6A 1NSNS 1ENCA 2F0SA 1F2MA 2F0UA 4B9XA 4DFAA 2F0JA 5J1ZA 5HURA 4EQOA 2EYLA 3SXHA 2EYMA 3TP5A 5CC4A 5E1FA 2F0KA 1SNQA 2OF1A 1A2TA 1EY9A 3NXWA 4QB4A 3SK8A 5IGDA 5JOBA 5I9PA 3S9WA 5CV8A 2EYOA 4I65A 4S3SA 1IHZA 3NQTA 4PMBA 5DAUA 3TMEA 2F0LA 1KDAA 3EVQA 1RKNA 2PZTA 5EKLA 4NDXA 5IGFA 1JOQA 4PMCA 3T16A 3D4WA 1STAA 5KEEA 1KAAA 1STYA 3MVVA 3MZ5A 4IALA 4WRDA 3TP6A 2RKSA 3D6CA 4K8IA 3ERQA 1AEXA 1KDBA 2PW7A 4NMZA 4N9TA 4RKLA 4OL7A 4ZUJA 4KTAA 4EVOA 2EYFA 4KHVA 3DMUA 1SYEA 1SYFA 1F2YA 3SK5A 2EYJA 2PQEA 3BDLA 2O4XA 5C5MA 1EYDA 1EZ6A 2LKVA 3DHQA 1A3VA 3TP8A 4H7BA 4F7XA 3C1FA 3D8GA 1ENAA 4J6HA 4WORA 2F0DA 5IOCA 5KYLA 2SNSA 2F0TA 3E5SA 1SNMA 4KV6A 1SYGA 3R3OA 4ODGA 4HMJA 5CV9A 3QOJA 2F0MA 3NP8A 4K8JA 4KY6A 5IGEA 2F0WA 2F0NA 5DEHA 5NUCA 3MXPA 3OMCA 1F2ZA 1STHA 1STNA 2F3WA 2PZWA 3OSOA 4IZ8A 3LX0A 5CR3A 4QMGA 4KJOA 2OEOA 4K5WA 3D4DA 4KD4A 5F2DA 3P75A 4RKBA 1KDCA 4G57A 3V2TA 3SK4A 2RDFA 1EYCA 4MIUA 5JAVA 2EY1A 4KY7A 1EYAA 3NUCA 5E3FA 1EY7A 4DGZA 5IGGA 3HZXA 4EQPA 4PNYA 3OWFA 1EZ8A 4K14A 3EJIA 2ENBA 4N9PA 5C5LA 3TP7A 4EQNA 1EY0A 4K2KA 3RUZA 3QB3A 1SNOA 3SHLA 5CV7A 3T13A 2PYKA 5KGUA 1STBA 2F0VA 3NHHA 2EXZA 4LAAA 5C6AA 5EKKA 3MEHA 1EY4A 2NUCA 2SNMA 4ZUIA 2F0PA 4F8MA 5C4HA 4K5XA 1EQVA 2F0IA 2F0FA 1A2UA 4KJNA 2EY5A 2QDBA 3ITPA 2PZUA 1NUCA 4IUNA 4YIJA 4KD3A 1II3A 1SYDA 5CV6A 5IGCA 1SNCA 2M00A 2F0GA 2SOBA 1EY6A 1JOKA 2F0HA 3NK9A 3QOLA 3OMGA 4ME5A 2F0QA 1SYBA 4DF7A 5C3XA 3P1HA 5CV4A 2RBMA 5C3WA 5M9OA 4K6DA 1SNPA 3SK6A 5EGTA 4KY5A 4B9WA 3BDCA 5I6YA 3VA5A 1U9RA 3SR1A 1TQOA 4HMIA 5KIXA 1TR5A 5KRUA 4R8NA 5I9OA 1EY5A 2F0EA 2OXPA 2F0OA 5IODA 1KABA 4ZQ3A 5CGKA 4NKLA 2WACA 4DU9A 1A3TA 2EY6A 1EY8A 3PMFA 5J39A 5IIFA 2EY2A 1SNDA 2KHSA 4J1MA 5K5PA 2KQ3A 1JORA 5J22A 3HEJA 3MHBA 3U9OA 2PW5A 2HQEA 3EROA 4NP5A 1SYCA 4E6IA 5C4ZA 2EYPA 5HGTA 4QF4A 5KYIA 2F3VA 5I6WA 4TRDA 5IGBA 2EYHA 5ISRA 3C1EA 4K5VA 5CV5A 1A3UA 4K2LA 4HTHA
chains in the Genus database with same CATH superfamily
2VQEL 1VQMA 1UWVA 4CJ1B 3ND8A 4DN4M 1OXSC 3K59A 4DAPA 4DA2A 4CDFC 2MUYA 1V1QA 2EE1A 2EYOA 4A3CH 3HOXG 1Y8OB 2G9DA 3GTQB 2KEEA 3PUZA 5I2YA 1UE5A 3VYSA 1KAAA 1QE6A 3MVVA 1WTVA 2XNAC 5CBEE 2I5MX 4A93H 1Q7YC 2A68D 4PMWA 3KF6A 4YY3Q 4BBRH 4GNXB 1SYEA 1HPCA 3AYHB 1IL8A 1XNRL 5C0XG 4DV4L 3C1FA 5AFWA 2K5HA 2F0DA 1SNMA 1HCZA 2IL8A 1IYJB 4CJ0B 4A4IA 2PMZE 5M5XH 3UE1A 2F0WA 3PUXA 1TIID 1SJED 2UU9L 2B2YA 4FVMA 3FKIG 1NAPA 2X6LA 3RZOH 4ZCKA 1S72A 3HOUB 4UHVA 3PCOB 1RF2D 2JQOA 2DJGC 3I4MB 1E2ZA 1E22A 2L55A 2NVYH 3VR6A 3MWYW 3A7LA 4PNYA 1TWFB 1MHWC 2XGTA 1JJGA 1VF5C 1STBA 5EBCA 2BDOA 3CC4A 2Z4IA 3MEHA 3LWUA 2F0PA 2GN5A 4R4OA 2QEXA 3Q8DA 4P74A 2PZUA 5C3EB 3F2BA 2E2HB 4DV3Q 1EFID 2F0HA 1TWHH 1PTOH 4JI6L 3NBIA 4JC0A 5C3WA 1GUNA 1MSGA 2JA7H 3L9AX 4XQNA 2J0TD 3ULPA 1ENFA 1KC8C 1IBKQ 1I4RA 4HMIA 3PO3H 1H9MA 1TR5A 5KRUA 4A3LG 1YITA 1JMCA 1LTBD 2OXPA 2WB1B 1VQEA 3H91A 4NKLA 1I4QA 3E9IA 5M5YH 4P73A 3RNUA 1R9TB 2VW9A 2ZXOA 3U9OA 5HGTA 3MEFA 4N8FA 4DV2Q 4G7HC 4QGUA 1YHQA 2D0PA 2EYHA 4PZ8A 5CV5A 1EQTA 1A3UA 2Q8TA 3ICEA 3H0GH 3HRZC 2EJGC 1ENCA 3PO2G 1M4VA 1ET6A 4RG1A 3J80L 2C35B 1WJJA 3RZDH 4OELB 2WIIB 3J7ZC 3K7UC 1I3QB 2B2TC 3MXNB 1CKOA 3KBGA 1EUJA 2F0LA 1KDAA 1HA5A 4O2DA 3Q0AA 1JOQA 4IALA 3CCLA 1K83B 2N49A 1K73C 2PW7A 4OL7A 3MXUA 2FJ2A 2YTXA 4BA1I 1GUWA 1SYFA 1PTOC 4I7ZC 3T4AC 2KEDA 2NVXH 4Q0FA 1EYDA 2IX0A 1X3PA 5IOCA 1OXTA 2PI2A 3HG9A 4GN4B 3NWTA 4KV6A 3KLSX 5IYDG 3AQQA 2R61A 4GKKL 3BG3A 2R93H 1B2TA 3F8TA 5FLMG 4OO1I 3HOWG 1AE2A 4GN5A 2BCOA 1SFOB 3I91A 3VR4A 1Y1WH 3HZXA 1FNVA 4IOAA 4N9PA 4MTNA 4WJ4A 5HGQA 1KRSA 2A68C 2K05A 3HS0C 4AQYL 4B3ML 1GHKA 3Q24A 4JI7Q 3L7ZC 2ATWA 1Y1VH 2F0FA 3S2DB 1UE7A 1HFGA 1K8GA 4YIJA 2OWOA 1EWCA 2JA8G 1D1IA 4L5RC 2RBMA 1D8LA 1WTPA 1AZQA 1J6QA 1JWSD 1C7YA 3KLRA 2F4VQ 4JBKA 1DGSA 4A3BH 2RF4A 2B3GA 2WACA 2L12A 1IBKL 4DV6L 4IJLA 3SE0A 4DPGA 3OIQA 2EYPA 5IWAQ 5LMNL 2K1BA 1IW7D 1E1OA 2MJ8A 4HTHA 3FDTA 4BXXH 3WOFA 4DV1Q 4DFAA 1H9KA 1NJIC 2LSSA 1PFSA 4DUYQ 1ESRA 1Q8IA 3T1HQ 4DV0Q 5IYBG 5M3MB 2EJFC 1M90C 1LTID 1CM9A 2CWPA 2B63B 1TS2A 3S1MB 2PO4A 3T16A 3DEOA 2DY7A 5FOBB 4K8IA 4A3GB 1BCPB 1AEXA 1D1KA 2B2VC 4UP9A 4KTAA 2BE5D 2EYFA 1N34L 4J8QA 2WKCA 4IUVA 2IHEA 4LUOA 3UDGA 2HDLA 4J6HA 2L0CA 4IUUA 3NENA 1V9PA 5DNFA 5KNBA 1LUZA 1S5FD 5TSSA 5CV9A 4A3JH 2JA6H 1KIXA 3FPPA 3PQIA 2MO1A 2ZJQA 4UPAA 2PZWA 2F4IA 4JI5L 1Y69U 3KK7A 1CUKA 1D5XC 4XTCS 4X65Q 3S17B 4P71A 5GAEC 1WTHA 3HOYB 1VQ9A 1TWAH 3S1QH 1TY2A 1EYAA 4DGZA 2EZVA 1RHPA 5K36G 2FFKB 2OTJA 2ENBA 3HOVB 3S14B 4DR1L 4BY1B 1MSHA 2EVBA 4BBSG 4B3SL 5CV7A 1QUQA 3J81i 4JBWA 4DAMA 1WTRA 3NHHA 1MKHA 1Q90A 4IFDJ 3P20A 2A6EC 1VQ6A 5COYA 4JI3L 4KJNA 2Z6KC 5AJ3Q 4B3RL 1FNUA 2EPBA 1EQRA 3MA2B 2LXJA 1X9NA 2F0QA 3CF5A 1SYBA 5C4XB 4X64L 2NN6H 3WWVA 1K9MC 3E9HA 3H09A 4JI8Q 4DK1A 1E2WA 4QIWB 1P16A 4R8NA 5IP7H 3R2TA 2PPBC 1A8VA 5BN4A 2RHQB 2N8NA 4A3FH 2ZT9C 1H9SB 3CRLC 2KCNA 2K75A 3MHBA 3JAMc 3HGBA 1D5ZC 1IXRA 1KQSA 3CCEA 2B8FA 5I6WA 2MHVA 4LFAL 2H1EA 1E2VA 1GUTA 4Y7NH 4GOPC 1NSNS 1FVIA 4X3TA 4B9XA 4XT3B 3LGJA 4FO2A 4DUZQ 2CVRA 2EYLA 1B7YB 1BO0A 2R6GA 4KN7C 4DR7Q 3A5ZB 3A74A 4JI2L 3H3VH 1UEAB 1SMYD 5JOBA 4GS3A 5CV8A 4DV5Q 1OXXK 5DM73 1VQDA 2IY5B 4DAYB 2KJXA 4DV1L 1TXYA 3OTOQ 4ZKCB 4A93B 4DUYL 5EKLA 5JJZA 4DV0L 3HOZH 4BBRB 4L6TB 1IKLA 1LTGD 1WD0A 3DMUA 1PRTD 2VUMG 1AE3A 3O13A 2EYJA 2PQEA 5C5MA 2EJMA 3GV6A 3TEHB 5M5XB 4LF8Q 5LMUQ 1Q82C 4NXMQ 3E5SA 3RZOB 1XPOA 2WINB 2K01A 2UUCQ 3MTSA 2A8VA 1TY0A 1ZKOA 2DY8A 2NVYB 4KD4A 1IBMQ 4LF7Q 4XYOA 4ABNA 2I46A 5E3FA 3NUCA 3IAYA 1EY7A 3LWEA 4NXNQ 3RLNA 2ZJPA 1G6ZA 4DR6Q 4EQNA 1LM0A 2KECA 2JA5G 5FJ8G 3GV3A 5A2QE 4A3EH 2OQKA 5KGUA 4KI0A 3H3VC 1N9WA 2L11A 4LAAA 1EIYB 2BE5C 1TWHB 3I72A 2K7VA 1PTOB 1K3BC 2VB3X 3S1NH 4IUNA 1DJRD 1R4QB 1DYQA 2JA7B 3CW2C 4A3MH 1ICWA 5D3DA 5IT9E 2Z6KA 3PO3B 2WFWA 4RH6A 4A3DH 5EGTA 3M4YA 5JPMC 5M5YB 3PUWA 1L1OC 1B53A 1KABA 3G7LA 1A6XA 1GJXA 2XRQD 4HJ5A 1B8AA 2PCFB 4XDXA 3EROA 4BY7G 3H0GB 2DJFC 4NB3A 2HDMA 1QNUA 5EKIA 4C3IG 4LK1C 5ISRA 4YWKA 4K2LA 2LS01 1KNEA 4ID6A 3AEVA 4CKCA 3RZDB 2AUJD 1Q1EA 3QIAA 1IKMA 1TVXA 3I90A 4GN3B 4GLVB 3M9BA 3HKSA 1I4GA 2F0KA 1N36L 2CW0D 4JG2A 3SK8A 2I5LX 2DNEA 4L5QA 1V1OA 5CYUA 1G2TA 1S5BD 4PMBA 3DEPA 4TSSA 3TBIB 3I4OA 1K8MA 1U4RA 2K04A 3MFGA 4CJ2C 2A69C 4DR7L 1GOZA 1Q46A 3D4WA 4DXGA 2KBNA 3EA6A 2NVXB 4YHHQ 4X3KA 1MI2A 2K6AA 1MBYA 5CORA 1KTKA 1AW7A 3BDLA 1ET9A 4X62L 3H15A 2R93B 2EOTA 4YCVA 1EU4A 1SYGA 2XIWA 1HUMA 1BQQT 1C4QA 4ZYSA 2F03A 4K8JA 5JVH3 3MXPA 2O5JC 4C3HG 4LF8L 3HFZB 3OOCA 1MJEA 2AMCB 1Y1WB 1JR0D 2B63H 1N32Q 1EYGA 2Z1CA 1C48A 2A6HC 3PIPA 3J81L 3A7AB 1KLUD 1AFPA 1H95A 1FJGL 4K2KA 3RUZA 1SNOA 1Y1VB 3JC66 3CC7A 1PVOA 2UUBQ 1PH2A 3BVZA 1EY4A 2O5IC 4JV5L 1QNKA 2B2YC 4LMQD 1W6JA 2MP1A 4P75A 1NUCA 1F2LA 1I6VC 3ULJA 2B8GA 1T9HA 2Q2TA 3KJOA 3C2PA 4ME5A 3OMGA 2AWOA 1ICFB 4PV1C 1HNWL 4A3BB 5CV4A 3FVQA 2MNAA 3SK6A 1WTQA 5JEAG 3A5UA 1KL9A 5IP9H 5I9OA 3MC0B 1VQHA 4F87A 3FEWX 4HIDA 3BU2A 4DU9A 4L5TA 4K0KQ 1K8AC 2KQ3A 3HEJA 4NP5A 5C4ZA 1B3QA 1NNXA 4JK1C 2EXDA 3RD4A 3EFXD 3E3XA 3FRPB 4K5XA 4PZ7A 1MD2D 4JI0L 4FXDA 3BS1A 4APVA 5M3FG 1NR4A 5CC4A 1XMQL 2CKZB 5IGDA 1I94Q 1YNND 1JT8A 2VQFQ 1QZGA 2RSOA 1S5ED 5BR8L 1VQ5A 1XWEA 1F9PA 4YWLA 1QVGA 3URYA 4WRDA 5C0XJ 4C1NI 3U50C 4CDEC 1UNSA 1XJVA 3QG1A 1ILPA 5GQOA 2KUMA 3DHQA 2ZM6L 1WYDA 4A3JB 4UP8A 1VQ7A 2JA6B 1V8QA 1CI3M 1BKBA 1BF4A 4DR3L 3CU7A 3F2DA 4LWCA 1YNXA 3R3OA 3HOXH 2NVQH 4ZKBB 2H5XA 2B29A 4DNIA 5DEHA 4FNFA 2BH8A 4QCLA 4GOPB 1NBWA 4HEDA 1VQBA 4MN3A 1TWAB 3S1QB 3T51B 1X6OA 4A3IG 4UY8C 1KXLA 3P75A 2CW0C 1H9RA 3V2TA 1V1PB 1A15A 1EYCA 4HJ7A 3U9SA 1AP0A 5ELOA 3OPOA 4OGQC 2KHJA 3SDZA 1JCKB 3HKZE 5C0XH 4FYDA 2NB0A 4UDUC 4FF4A 3QB3A 4Q5VA 2A74C 4BS9A 4LF9Q 2KOLA 3IFTA 1L2FA 5EKKA 4UP7A 4C56C 2SNMA 4ZUIA 2L1BA 2E2JH 5D14A 1A2UA 2QDBA 1SYDA 3FKIH 4LFCL 1VQFA 2QCPX 1OTCA 3L2PA 4ME3A 5FLXL 4X3SA 4CBVA 1SNPA 4G7OC 1J5EQ 4MHEA 3FP9A 3QJYA 2A19A 3SR1A 4JYAQ 4JI4Q 5I2XA 4A3FB 4HIOA 1E24A 4QUCA 4DV7L 5IODA 1G291 1RTNA 4HCEA 4RWSC 5C4JB 1BXTA 1VQJA 2X6GA 1X3EA 1HJPA 2EIFA 4Y7NB 2E2IH 4E6IA 2CWAA 4IUQA 1HZBA 4DR5Q 2QKIC 5FO9B 4J15A 3UDFA 1NY4A 3SVMA 2AHOB 4A3LH 5CBAE 5D3IB 2R3ZA 3NTIA 1F77A 1ZEQX 1XMOQ 1J8IA 2HT1A 2YU9H 3HOZB 3CC2A 1MIUA 1IHZA 3RR5A 3PIP3 4KKUA 2XN9C 3GTLH 2YYZA 3CCJA 4IN3A 1X3GA 4KMUC 1RIPA 3QO2A 3CCMA 2Q2IA 3J81j 4RKLA 1L1OB 1PH3A 3PIO3 1EFWA 2JSOA 2VXWA 3C3LA 3UE0A 1ZYRC 2YV5A 3SK5A 3PO2H 2RCNA 3D8GA 4WORA 4O1NA 1VDZA 5EPKA 1S40A 4MNOA 1Y8NB 2D9UA 3ERSX 2F52A 2PQAA 2ZTDA 2KHIA 1D7QA 1U0LA 1XPRA 1B9NA 4KKTA 5CR3A 4R9WA 1HTLD 4AIMA 2ZJRA 1DZ1A 3K7AH 5FO7B 4MIUA 1QB5D 5JAVA 4A3EB 2HUGA 5C44G 3KDFB 3GDEA 5FO8B 5IYDH 1SAPA 4FXKC 2CHBD 3S1NB 4KLKA 4CDDC 3I73A 2WAQB 4YY3L 2IWHA 4A3MB 5LL6X 1VQGA 3KLSA 5FLMH 3C46A 4DAVA 4A3DB 1LTRD 2M00A 3HOWH 4HR7B 4Z9CB 3KFUA 2FMMA 3EN2A 3N52A 2OTLA 2KVMA 4OEMB 3DWAA 2K32A 3A56A 4K6DA 3A8JE 1XXGA 3CAMA 3BZKA 3BDCA 4LW1A 1SXTA 3CRKC 2J7ZA 1EY5A 4BWGB 1T5XD 3JAME 1U4MA 2F0EA 1PH5A 3KF6B 3HKZG 1A3TA 1QILA 2IHFA 1PH4A 3U58A 2JXMB 2R7ZG 1PA6A 5KYIA 2JA8H 2BDNA 2NBFA 1SEBD 1VMCA 3TZUA 1C9OA 1DXMA 4RGTA 3U4VA 4HJ8A 3T56B 3K81C 2R92G 3J7AV 3MXGA 1ASYA 2X69A 4DR4Q 1CZGA 4DV3L 1CKMA 5GAHC 1SE3A 3I4NG 1WVLA 4HIKA 3KF8A 1KD1C 2ZTCA 1GKHA 2PZTA 2HIVA 4NDXA 4LNQA 2D5DA 3RMHA 1ML0D 4QL5A 2Q8RE 2K5NA 1NTGA 4N9TA 4OO1G 3U4ZA 4YCUA 3CMAA 1EQQA 1SJHD 4C3JG 4H7BA 4DV2L 2VB2X 5IYBH 1WCMG 4UAIA 5J3BA 3A8KE 4ODGA 2A73B 3J7YW 3K5LA 1NMGA 2F0NA 2ZXRA 4MZ9A 3PF4A 2XWBB 1PXUA 4A3KG 2XTIA 5JJKA 1JB7A 2XWJB 2RDFA 1JICA 1ZXTA 1EZ8A 3TP7A 2I0QA 1EY0A 4R4QA 1E7ZA 2Y0SG 4U68A 5E7NA 5C6AA 1HQMC 2JEBI 1LTAD 2NUCA 3KJPA 4EX5A 1B1ZA 4OIKA 1YHAA 4EQ5A 1I4HA 5E4XA 1DOMA 1WFQA 3R8BA 1PFMA 1SNCA 1L0YB 3NK9A 1CT1D 1BVSA 4X66Q 1XPUA 4AYBB 4KN4C 1X54A 2NN6I 1Q1BA 2PQAB 4X3UA 1EIHA 2N55A 1GUGA 4OWTB 1I4PA 4KY5A 2ZXPA 5KIXA 1I5FA 3R2IA 3TRZA 1ASZA 4BBSH 2RCFA 2Z6BA 5FLXc 3CKIB 3RLOA 5J39A 3V96A 4HJ9A 3A54A 5J22A 3ZYYX 4POGA 2CH4A 4C2MH 4IFDI 2E76C 5A35A 1QOHA 4JI7L 3AFPA 1EIFA 3E0EA 3VA7A 1U4LA 3K57A 1J9OA 3H3VI 3VR5A 4WJ3M 3M4QA 3J7AF 2RA4A 3DWPA 2NTSA 3DUZA 4I7AA 5LHY1 4LF5Q 3PUVA 5HY6A 1BBWA 1TS5A 2F4VL 2DUDA 1IBLQ 5GAGC 2Q2UA 3EVQA 1GD7A 3A0JA 1HZ9A 2RSNA 1HR0W 5C4JH 2NYZD 5KNCA 5IYCG 4ZAIA 2BOSA 1SRUA 5EPLA 2C9OA 3HOXB 5A2QL 2NVQB 4JW0A 5IWAL 1R4PB 3S16H 2M9VA 3HOUG 3WDNA 1NE3A 1DONA 1W3SA 1FNWA 3I4MG 1EIGA 2VL6A 2SDFA 1CQVA 4JOIA 2RDGA 1Q8KA 4DXFA 3D31A 4XIGS 3T1HL 4WJWA 3J80c 4IFDG 4KHPQ 3KF8B 4ZRZA 1DOLA 2VUMH 2MO0A 5C3EG 4GKJQ 4O0AA 4HJAA 1E1TA 1BBUA 4EQPA 4IUTA 3NELA 4JI1Q 3OWFA 1I6HH 1HNXQ 2E2JB 3SHLA 3D0FA 3TSSA 4ILWA 1PH6A 4P72A 2MFIA 1GM5A 1IW7C 3ULLA 3FKIB 1T5EA 1RDPD 1LTLA 4CHTB 4KD3A 2WB1G 1HXYD 1CFMA 1QG7A 2F0GA 1JOKA 3Q6SA 3GTKH 4R8IA 4L63B 1CQFA 1EL0A 1G51A 1N33Q 1IL2A 5I6YA 2JA5H 4X65L 5FJ8H 5JVG3 1RJTA 1STEA 3S1RB 2E2IB 1PFBA 5EQ0A 1VQPA 4MTKA 3DWQA 3TQYA 2HHHQ 5IIFA 2K5QA 5EPJA 2CCZA 3CXCA 3NEMA 1W2BA 4PG3A 4QF4A 4DKAC 1HH2P 2RHSB 1K28A 1A63A 2UUAQ 3BVMA 4HN7A 1I4XA 4LFBQ 2NVTH 2YU9B 5AJ3L 1RODA 2NZOA 4LF4Q 3GTGH 3SGIA 3GTLB 2I5HA 2WV6D 3I4LA 5T1GA 1GO3E 4S3SA 1IYUA 4JI8L 1JB3A 3TMEA 2B2UC 3KYHC 5IGFA 1GVPA 2LXKA 4BY7H 1BCPD 4PMCA 4XYQA 3MZ5A 1QUQB 1HFNA 5I4DA 3PO2B 2KENA 3D6CA 4C3IH 3ERQA 3G48A 2TMPA 4KHVA 1MGSA 2V1CC 2LKVA 4TQUS 4F7XA 2D62A 1CKNA 1HA6A 3T1YQ 3QOJA 3NP8A 3T53B 3K6OA 3LNNA 1BCPF 3A8IE 4DUZL 2F3WA 4OX9Q 4IZ8A 3K7AB 1O7ZA 4PQXA 5JJLA 3CCQA 4FF2A 1HR0Q 4H44C 4DV5L 2G9HD 5GADC 4OIJA 2PNHA 2E5LQ 3OTOL 2HIXA 3WOEA 1UAPA 2AKWB 1FR3A 3CQZH 3B6YA 3ND9A 2RQXA 1XX8A 4IPHA 2CQOA 3TS2A 2KCCA 4LF6Q 5ELEA 3JAMi 2M2LA 1UE6A 1WTXA 1PH8A 3HOWB 4C3HH 2VQEQ 4F8MA 1XYIA 4GNXA 3ITPA 1SE8A 5LMUL 2VNUD 1AH9A 4NXML 5JEAJ 2RDHA 1PZKD 2KCTA 4ZLTF 1PH1A 3CPFA 1VMPA 1H9JA 1SMYC 5T1IA 3EBEA 4XXEA 2QILA 1Q86C 4OXPA 2UUCL 1TQOA 1UE1A 1X3FA 3GP7A 3GTPH 1IBML 2K52A 4LF7L 2F1MA 5G3LD 1OO9B 2JA8B 5DLQE 3GTMH 3PIOA 2PMZB 3PMFA 4NXNL 4YCWA 1XNRQ 1PRTC 3EIVA 3GQBA 4DR6L 5M3MG 4DV4Q 1WI5A 1I50H 2A1AA 3R93A 2JK8A 2H4OA 5EBDA 5E4WC 5JEAH 3BDOA 1SR3A 4A3GG 3BZDB 3D6WA 4XQQA 2UU9Q 4RCNA 1VQAA 5G3LF 1EY9A 4JPBW 3VYUA 1B44D 4I65A 3J7A5 4RHSA 1K3RA 5IY0A 2QGQA 1NMFA 2EDGA 3TP6A 2B2UA 4CGYB 1VCIA 4NMZA 2MPMA 4NW2A 3I2ZA 1HUNA 1B9MA 2PNRC 5M3FH 3RLFA 2AUKA 3HOYG 1CK1A 1YJNA 3G71A 3Q23A 5LMNW 2LFNA 4HMJA 2ID0A 4WFN3 2F0MA 3K80C 2VS1A 4KY6A 4M1UB 4R4TA 3ER0A 4G4KA 3HOVG 4V190 4BY1G 1STHA 1O80A 2RVLA 2OEOA 2OQ0A 3DXJC 4JCVE 1SE4A 1RL2A 2LMCB 3FHWA 1F9SA 4R4CA 2P5ZX 5C0XI 5EAYA 5M5WH 3MXNA 3K58A 2L9HA 1HR0L 2AQ1B 3TDQA 5C4XG 4YHHL 1YJWA 1BBXC 2PYKA 2K50A 1PTOD 3PUYA 2BA1A 5LL6S 3STBD 1Y8PB 4HSPA 3M4OH 3PF5A 4A3IH 4IQZA 4B3TQ 1HNZQ 3NTKA 3OW2A 4BBSB 1OXVA 1EWHA 3OHXC 2N88A 2R7DA 3G6JB 2K03A 3OWEB 1GXDC 3W1GA 4QQBX 3S15H 3N6RA 2Z8LA 1N32L 1PTOF 2ICEC 2ASBA 1YVCA 1PMRA 4C2MB 4A3CG 4DNRB 1KNAA 5DM63 1EWIA 4NPSA 3IRBA 2QA4A 2K28A 1JWMD 4M8AA 4HIMA 3TREA 3C1EA 2ALYB 2UUBL 4A93G 1RTOA 4DK3C 1JOOA 4GKKQ 1STGA 1VQ8A 4BBRG 2F0SA 1Z47A 5BN5A 2F0JA 1JQYD 5J1ZA 2EQSA 4EQOA 4LUVA 3TP5A 4GLXA 1JJCB 2NTTA 3VYTA 2MQHA 5I9PA 1SN8A 4H0LC 3X3MA 3GTOH 2XRSD 1M1KC 1AN8A 5DAUA 3FPUB 3AFQA 2OCEA 5BN3A 4CKBA 3AB9A 5KEEA 3S1RH 2RKSA 3KLWA 2FINB 1LT3D 2JJQA 2D0OA 5JJIA 3F2CA 2GVBA 3S16B 4K0KL 1Y14B 1IZ6A 4AQYQ 3W2DA 4B3MQ 1LLRD 1A3VA 3CCSA 4HCSA 1BDOA 3CPWA 2NWGA 3I3CA 3W3AA 2O2LD 1CTMA 3QWNA 1JJ2A 4FXGC 3S2HH 3OMCA 2IJ0A 3OSOA 2FHTA 2L15A 3CCRA 1SSOA 1PZID 2VUMB 4QMGA 1I94L 3D4DA 4H13C 2K5WA 4RKBA 2VQFL 3SK4A 1I6HB 4H02A 1PV4A 4JBMA 3NTHA 2JA7G 2Y0SE 3JAML 4DV6Q 2JP1A 1LABA 3CCUA 1Z9FA 3CCVA 5C5LA 3PO3G 2GA4B 5LMNQ 2KA7A 1LTTD 4OWWB 3OYYA 3GTKB 1VF7A 2E74C 2L5TA 2JYOA 1BOSA 5IGCA 2SOBA 1D6EC 5KNDA 3A55A 1IYVA 4JBJA 4RA8A 2JA5B 5JPNC 3I56A 1YNNC 3M7NA 4K6LA 5FLXE 3H0GG 5C44H 1RCVD 3W5OA 1HRJA 1U9RA 2E8GA 4B3TL 1HNZL 3UDIA 3VDYA 3VR3A 3GTJH 1N34Q 1EY8A 2JE6I 5ELDA 5EJWA 1PDQA 4J1MA 4TKOB 5K5PA 3J81c 4XQJA 3M3YH 3BJUA 1TWCH 4LF9L 2NVTB 3MFYA 2HCIA 2AQ3B 2A6ED 3CMEA 3GTGB 3D4RA 3NQIA 4KK7A 3STBC 3CP0A 4JI5Q 3I70A 1FL0A 1BUVT 2AWNA 4BY7B 3I55A 2CFMA 3KUPA 1TU2B 4C3IB 1RD9D 1J5EL 2R7ZH 2R93G 1E3PA 4JYAL 4JI4L 2XVSA 4DR1Q 1X56A 4EVOA 4B3SQ 1Z6HA 2R92H 3UDXA 1BR9A 1Y1WG 4JI3Q 1S5CD 1H9SA 1PRTB 1CZWA 1UEBA 1YEZA 1ENAA 3G6EA 4DR5L 3AMUA 4B3RQ 1OXUA 1P8LA 1X55A 4QUFA 3I4NH 4RHRA 1TWGH 3J80E 2BA0A 4CKEA 4X64Q 1LT5D 1KLGD 2ES2A 3BYYB 4O42A 3NE5B 1Y1VG 4ULLA 1XMOL 4IURA 4OO1H 2YTVA 3CQZB 4GZYC 5H1SE 4C3JH 4POFA 4DAYA 1TKWB 3CHBD 1WCMH 1PZJD 3EJIA 1VQNA 5FKAC 2Z4HA 4C3HB 4A3BG 4EGVA 4JOIC 1A0IA 5ELFA 2Z0SA 1B3AA 3K0YA 3K5OA 2WB1E 4LFAQ 1SROA 4ALPA 4L5SA 1VQOA 1PH7A 5FK9C 1YZ6A 2CH4W 4QJFA 4A3KH 2VZAA 2BH2A 4JI2Q 2LY7A 1DM0B 2NZHA 4FF1A 3GTPB 5M9OA 2WKDA 4BXXG 2C5CA 4RAUC 3Q22A 1SMXA 3GTMB 2MGSA 1CSPA 1EOTA 3L3OC 1WOCA 2UXDQ 4A75A 3TS0A 3TN2A 4B08A 1I50B 2B2TA 4FDBA 2DN8A 1EOVA 2R7FA 1YJ9A 1K8OA 4R4IA 5K36H 5HURA 1X65A 2EYMA 3SXHA 5E1FA 2OF1A 3S9WA 4QB4A 3QR8A 2IT1A 1N8RC 2WAQE 3OW7A 1QVCA 2F3IA 3NQTA 4TVAB 4A3JG 3IFDA 1U4PA 2JA6G 2L4NA 1Q12A 3RN5A 4OHJA 1STYA 3GTQH 1PLFA 5GROA 2JEAI 1C0AA 3W1BA 4KHZA 1O7IA 1K0RA 1PYWD 3VR2A 5M3FB 1B50A 3PGZA 2CQAA 3OIPA 4LUZA 2K4KA 1F2YA 3TZDA 2VY3A 1YIJA 2D2CC 2O4XA 1GUOA 2Q8IB 2HQLA 2F0TA 1YNJD 4FP5D 5ELNA 4ZK9B 3BZCA 1G8ZD 2IX3A 1F2ZA 1V43A 4DR4L 3LX0A 1AZPA 2FXQA 4K5WA 2FMCA 1YBYA 5M5WB 3D3RA 5F2DA 1JE5A 1TS3A 4G57A 2AQ2B 5IYCH 1X3QA 1O7YA 2NN6G 2A69D 3MAQA 2NZ1D 4KY7A 5IGGA 3M85A 2I07B 1PH9A 3HOUH 5L37A 3I4MH 5IP7G 3M4OB 2EXZA 4A3IB 1TWFH 2K5VA 1EQVA 2F0IA 4A3FG 1KAWA 1B70B 1F9QA 1DCZA 4IFDH 5IT9L 1II3A 5CV6A 5ELCA 1EY6A 1N36Q 3F1ZA 4V0BA 5C3XA 3P1HA 5C3EH 3S15B 1LACA 2E2HH 1FD7D 2UXCQ 1JWUD 4C1NK 1QZHA 4IUPA 1DOKA 1EEID 1G91A 4OONA 4RGNA 3NBHA 2A6HD 2IW3A 3DLLA 4ZQ3A 4GNXC 1BNZA 1SNDA 2KHSA 1LYLA 4IPDA 1E0BA 1FYCA 2HQEA 2PW5A 1SYCA 4X62Q 2JA9A 3HOZG 2UXDL 4TRDA 4DNTB 4K5VA 1R9TH 2Z9HA 1W6KA 2B2VA 3H6MA 3K5NA 1Q81C 1LO5D 3CD6A 3FMCA 1F2MA 3GTOB 1VS0A 1S4ZA 1HZCA 1HHVA 1DD2A 1VQCA 2N3SA 3F2UA 4X66L 1MJCA 1QWYA 2Q2HA 2HD3A 1L0WA 2N78A 3VYRA 3UI2A 2QF7A 5ELBA 5D65A 3ZJYC 1STAA 1I3QH 1D2BA 4OWXB 1FJGQ 4IPGA 3K5MA 1PRTF 4AYBE 1G2SA 2IPKD 3X3NA 3NWSA 4JV5Q 1K83H 2OT2A 2ZTEA 3TP8A 1TS4A 3KOJA 3S2HB 1G6PA 4A3EG 1CSQA 4RMFA 1HNWQ 1KHIA 5IGEA 4DR2Q 1CHQD 1GHJA 1YHBA 2PI2E 1STNA 2HCCA 4N8X1 1WD1A 3G4SA 2WAQG 4LF5L 4A3MG 3IKJA 4XT1B 2QW7A 5IE8A 1IBLL 3S24A 2EY1A 2K33A 4A3DG 3I8ZA 1HTPA 1B4OA 4QIWE 1SFOH 4RFBA 1S5DD 3RN2A 2B2WC 2YTYA 5C4HA 4JI0Q 2UXBQ 1EEFD 1Q3LA 5C44B 4LJZC 4RGOS 4U673 1XMQQ 3S2DH 2ICIA 1YNJC 1O78A 1XNQQ 3HP3A 3GTJB 5BR8Q 3VA5A 4AH6A 1VQ4A 4FF3A 4GOPA 2B39A 4KHPL 1L0XB 1M8AA 1SE2A 1A62A 3M3YB 5CGKA 1QVFA 2UXCL 1TWCB 4GKJL 1QJOA 2EY2A 1V1PA 4F88A 4JI1L 1QCBD 3PV0A 2ZM6Q 4L8JA 1HNXL 2JN4A 1WTWA 4DR3Q 1EU3A 2E75C 3KBXA 1JORA 1SLJA 2WP8J 1TT2A 4HSVA 1GUSA 3HKZB 2F0UA 4A76A 1F9RA 1VQIA 1HZAA 1Z7TA 1O7LA 3I7FA 1SNQA 3NXWA 1A2TA 2R7ZB 4BA2I 4KKSA 4P2CB 1PHJA 2G5DA 1XTDA 2K5DA 3J80i 4IOCA 1N33L 4X6AH 1YI2A 3L0OA 1RKNA 5M3MH 2TSSA 3PSIA 1FGUA 3NBHB 4IPCA 3NSWA 2R92B 1LTSD 1NR2A 3S1MH 1KDBA 4ZUJA 2B63G 1UUPA 3GD7A 2HHHL 1JE4A 1PYSB 3I4NB 4A3GH 1EZ6A 1TWGB 2QDLA 4GLAC 5KYLA 1XTCD 1VQKA 3BVGA 2SNSA 3GO5A 4LFCQ 1CA6A 2UUAL 2DGYA 3AU7A 4IJHA 4JVZA 5NUCA 4LFBL 3EQLC 1C8CA 4QY7A 4LF4L 4C3JB 1LV9A 4KJOA 4RGMA 1KDCA 4R1JA 1WCMB 4DK6C 2XSCA 4DV7Q 4DR2L 2J4XA 3S17H 4RCOA 2V4DA 3H94A 2QEJC 1LT6D 4K14A 4AYBG 3HOYH 5IP9G 1K0SA 3DM1A 1ZYRD 3NPPA 3T13A 2KCMA 2F0VA 4A3KB 1PYBA 1L1OA 3DM3A 1JC7A 1CHPD 2K14A 5CMDA 4JI6Q 3HOVH 3S14H 4BY1H 1FGBD 1HQRD 1WTOA 1NCVA 2EY5A 4Y52H 2B2WA 3V05A 3M4PA 3IL8A 3QOLA 4CDCC 3T1YL 1SDFA 1U5KA 4DF7A 2UXBL 4DK0A 1LT4D 3P7JA 1ESFA 1CA5A 1D5MC 1X32A 2Y0SB 4B9WA 1KRTA 4OX9L 4PZ6A 5IT9c 5C4XH 2DNCA 3M7GA 3J81E 1BCPC 1ONLA 4YWMA 3SEBA 1PFNA 2F0OA 1ILQA 1XNQL 4G7ZC 2GVAA 2E5LL 3ONAB 2SEBD 3E0JA 2EY6A 3E6ZX 3K8AA 1SBBB 3BYTB 1CKNB 4IO9A 1VQLA 2A5HA 1S3OA 2IX1A 2F3VA 4LF6L 4HAEA 3K0XA 3KDFA 5IGBA 2E2DC
chains in the Genus database with same CATH topology
4CJ1B 3ND8A 4DN4M 1OXSC 3K59A 4DAPA 4DA2A 2MUYA 2EE1A 2EYOA 1Y8OB 2G9DA 3GTQB 2KEEA 3PUZA 5I2YA 3VYSA 1KAAA 1QE6A 3MVVA 1WTVA 2XNAC 5CBEE 2A68D 4PMWA 1SYEA 1HPCA 1IL8A 5C0XG 3C1FA 5AFWA 2F0DA 1SNMA 1HCZA 2IL8A 4CJ0B 2F0WA 3PUXA 1TIID 1SJED 2B2YA 4FVMA 1NAPA 2X6LA 3HOUB 1RF2D 3I4MB 1E2ZA 2L55A 3VR6A 3MWYW 3A7LA 4PNYA 1TWFB 1VF5C 1STBA 5EBCA 2BDOA 2Z4IA 3MEHA 3LWUA 2F0PA 2PZUA 5C3EB 2E2HB 1EFID 2F0HA 1PTOH 3NBIA 5C3WA 1GUNA 1MSGA 3L9AX 4XQNA 2J0TD 1ENFA 1I4RA 4HMIA 1H9MA 1TR5A 5KRUA 1LTBD 2OXPA 2WB1B 3H91A 4NKLA 1I4QA 1R9TB 2ZXOA 3U9OA 5HGTA 4G7HC 2EYHA 5CV5A 1EQTA 1A3UA 2Q8TA 3HRZC 2EJGC 1ENCA 1M4VA 1ET6A 3J80L 2WIIB 1I3QB 2B2TC 3KBGA 2F0LA 1KDAA 1HA5A 3Q0AA 1JOQA 4IALA 1K83B 2PW7A 4OL7A 3MXUA 2FJ2A 4BA1I 1GUWA 1SYFA 1PTOC 4I7ZC 3T4AC 2KEDA 4Q0FA 1EYDA 2IX0A 1X3PA 5IOCA 1OXTA 3HG9A 3NWTA 4KV6A 3KLSX 2R61A 3BG3A 1B2TA 4OO1I 2BCOA 1SFOB 3I91A 3VR4A 3HZXA 1FNVA 4N9PA 2A68C 2K05A 3HS0C 1GHKA 3Q24A 3L7ZC 2F0FA 3S2DB 1HFGA 4YIJA 1EWCA 1D1IA 2RBMA 1WTPA 1AZQA 1JWSD 3KLRA 2WACA 2L12A 3SE0A 3OIQA 2EYPA 2K1BA 1IW7D 2MJ8A 4HTHA 3FDTA 3WOFA 4DFAA 1H9KA 1ESRA 1Q8IA 5M3MB 2EJFC 1LTID 1CM9A 2B63B 1TS2A 3S1MB 2PO4A 3T16A 3DEOA 2DY7A 5FOBB 4K8IA 4A3GB 1BCPB 1AEXA 1D1KA 2B2VC 4KTAA 2BE5D 2EYFA 4J8QA 2WKCA 4IUVA 2HDLA 4J6HA 2L0CA 4IUUA 5DNFA 5KNBA 1S5FD 5TSSA 5CV9A 3FPPA 2PZWA 2F4IA 1Y69U 3KK7A 1D5XC 4XTCS 3S17B 3HOYB 1TY2A 1EYAA 4DGZA 2EZVA 1RHPA 5K36G 2FFKB 2ENBA 3HOVB 3S14B 4BY1B 1MSHA 2EVBA 5CV7A 4JBWA 1WTRA 3NHHA 1Q90A 4IFDJ 3P20A 2A6EC 5COYA 4KJNA 1FNUA 2EPBA 3MA2B 2F0QA 1SYBA 5C4XB 2NN6H 3H09A 4DK1A 1E2WA 4QIWB 4R8NA 3R2TA 2PPBC 5BN4A 2ZT9C 1H9SB 3CRLC 2KCNA 3MHBA 3HGBA 1D5ZC 2B8FA 5I6WA 2MHVA 2H1EA 1E2VA 1GUTA 1NSNS 4X3TA 4B9XA 4XT3B 4FO2A 2CVRA 2EYLA 1BO0A 2R6GA 4KN7C 1UEAB 1SMYD 5JOBA 5CV8A 1OXXK 5DM73 2KJXA 4ZKCB 4A93B 5EKLA 5JJZA 4BBRB 4L6TB 1IKLA 1LTGD 1WD0A 3DMUA 1PRTD 3O13A 2EYJA 2PQEA 5C5MA 2EJMA 3GV6A 5M5XB 3E5SA 3RZOB 2WINB 2K01A 3MTSA 1TY0A 1ZKOA 2DY8A 2NVYB 4KD4A 4XYOA 4ABNA 2I46A 5E3FA 3NUCA 3IAYA 1EY7A 3LWEA 1G6ZA 4EQNA 2KECA 3GV3A 5A2QE 5KGUA 4KI0A 3H3VC 2L11A 4LAAA 2BE5C 1TWHB 3I72A 2K7VA 1PTOB 2VB3X 4IUNA 1DJRD 1R4QB 1DYQA 2JA7B 1ICWA 5D3DA 5IT9E 3PO3B 4RH6A 5EGTA 3M4YA 5JPMC 5M5YB 3PUWA 1B53A 1KABA 3G7LA 1A6XA 1GJXA 2XRQD 2PCFB 4XDXA 3EROA 3H0GB 2HDMA 1QNUA 5EKIA 4C3IG 4LK1C 5ISRA 4K2LA 2LS01 1KNEA 4ID6A 4CKCA 3RZDB 2AUJD 1Q1EA 3QIAA 1IKMA 1TVXA 3I90A 1I4GA 2F0KA 2CW0D 3SK8A 2DNEA 1V1OA 5CYUA 1G2TA 1S5BD 4PMBA 3DEPA 4TSSA 3TBIB 1K8MA 1U4RA 2K04A 3MFGA 4CJ2C 2A69C 1GOZA 3D4WA 4DXGA 3EA6A 2NVXB 4X3KA 1MI2A 2K6AA 1MBYA 5CORA 1KTKA 1AW7A 3BDLA 1ET9A 2R93B 2EOTA 1EU4A 1SYGA 2XIWA 1HUMA 1BQQT 1C4QA 4ZYSA 2F03A 4K8JA 5JVH3 3MXPA 2O5JC 4C3HG 3OOCA 1Y1WB 1JR0D 2Z1CA 1C48A 2A6HC 3J81L 3A7AB 1KLUD 1AFPA 4K2KA 3RUZA 1SNOA 1Y1VB 3BVZA 1EY4A 2O5IC 1QNKA 2B2YC 4LMQD 1W6JA 2MP1A 1NUCA 1F2LA 1I6VC 2B8GA 3C2PA 4ME5A 3OMGA 2AWOA 4PV1C 4A3BB 5CV4A 3FVQA 3SK6A 1WTQA 5JEAG 5I9OA 3MC0B 4F87A 3FEWX 4DU9A 2KQ3A 3HEJA 4NP5A 5C4ZA 4JK1C 3RD4A 3EFXD 3FRPB 4K5XA 1MD2D 4FXDA 3BS1A 1NR4A 5CC4A 5IGDA 1YNND 2RSOA 1S5ED 1XWEA 1F9PA 3URYA 4WRDA 5C0XJ 4C1NI 1UNSA 3QG1A 1ILPA 2KUMA 3DHQA 4A3JB 2JA6B 1V8QA 1CI3M 1BF4A 3CU7A 3R3OA 4ZKBB 4QCLA 5DEHA 4FNFA 4HEDA 4MN3A 1TWAB 3S1QB 3T51B 3P75A 2CW0C 1H9RA 3V2TA 1V1PB 1A15A 1EYCA 1AP0A 3U9SA 3OPOA 4OGQC 5C0XH 3SDZA 1JCKB 4FYDA 2NB0A 4UDUC 4FF4A 3QB3A 4Q5VA 2A74C 4BS9A 2KOLA 3IFTA 5EKKA 4C56C 2SNMA 4ZUIA 2L1BA 5D14A 1A2UA 2QDBA 1SYDA 2QCPX 5FLXL 4X3SA 4CBVA 1SNPA 4G7OC 4MHEA 3QJYA 3SR1A 5I2XA 4A3FB 4QUCA 5IODA 1G291 1RTNA 4HCEA 4RWSC 5C4JB 1BXTA 2X6GA 4Y7NB 4E6IA 4IUQA 2QKIC 5FO9B 3SVMA 5CBAE 5D3IB 2R3ZA 3NTIA 1F77A 1ZEQX 1J8IA 3HOZB 1IHZA 3PIP3 4KKUA 2XN9C 2YYZA 4IN3A 4KMUC 3QO2A 4RKLA 3PIO3 2JSOA 2VXWA 3C3LA 1ZYRC 3SK5A 3D8GA 4WORA 4O1NA 1VDZA 5EPKA 1Y8NB 2D9UA 1B9NA 4KKTA 5CR3A 4R9WA 1HTLD 1DZ1A 5FO7B 4MIUA 1QB5D 5JAVA 4A3EB 2HUGA 5FO8B 1SAPA 4FXKC 2CHBD 3S1NB 3I73A 2WAQB 2IWHA 4A3MB 5LL6X 3KLSA 3C46A 4DAVA 4A3DB 1LTRD 2M00A 4HR7B 4Z9CB 2FMMA 3N52A 2KVMA 3DWAA 2K32A 3A56A 4K6DA 3A8JE 1XXGA 3BDCA 1SXTA 3CRKC 4BWGB 2J7ZA 1EY5A 1T5XD 3JAME 1U4MA 2F0EA 1A3TA 1QILA 2JXMB 5KYIA 2BDNA 2NBFA 1SEBD 1VMCA 3TZUA 1DXMA 4RGTA 3T56B 3J7AV 3MXGA 2X69A 1CZGA 1SE3A 1WVLA 3KF8A 2PZTA 4NDXA 2D5DA 3RMHA 1ML0D 2Q8RE 4N9TA 4OO1G 1SJHD 4C3JG 4H7BA 2VB2X 4UAIA 3A8KE 4ODGA 2A73B 3J7YW 3K5LA 2F0NA 2ZXRA 2XWBB 1PXUA 2XWJB 2RDFA 1JICA 1ZXTA 1EZ8A 3TP7A 1EY0A 4U68A 5C6AA 1HQMC 2JEBI 1LTAD 2NUCA 1B1ZA 4OIKA 1I4HA 5E4XA 1DOMA 3R8BA 1PFMA 1SNCA 1CT1D 1L0YB 3NK9A 4AYBB 4KN4C 2NN6I 1Q1BA 4X3UA 1EIHA 2N55A 1GUGA 1I4PA 4KY5A 2ZXPA 5KIXA 3R2IA 3CKIB 5J39A 3V96A 3A54A 5J22A 3ZYYX 4IFDI 2E76C 5A35A 1QOHA 3VA7A 1U4LA 3K57A 1J9OA 3VR5A 3J7AF 2RA4A 3DWPA 2NTSA 3DUZA 5LHY1 3PUVA 1TS5A 3EVQA 2RSNA 2NYZD 5KNCA 4ZAIA 2BOSA 5EPLA 3HOXB 2C9OA 5A2QL 2NVQB 1R4PB 2M9VA 3WDNA 1DONA 1FNWA 1EIGA 2SDFA 1CQVA 2RDGA 4DXFA 3D31A 4XIGS 4WJWA 4IFDG 4ZRZA 1DOLA 4EQPA 4IUTA 3OWFA 2E2JB 3SHLA 3TSSA 4ILWA 1IW7C 3FKIB 1T5EA 1RDPD 4CHTB 4KD3A 1HXYD 1CFMA 1QG7A 2F0GA 1JOKA 3Q6SA 4R8IA 4L63B 1CQFA 1EL0A 5I6YA 5JVG3 1RJTA 1STEA 3S1RB 2E2IB 1PFBA 5EQ0A 3DWQA 5IIFA 2K5QA 5EPJA 4QF4A 3BVMA 4HN7A 1I4XA 2YU9B 1RODA 3GTLB 2WV6D 3I4LA 5T1GA 4S3SA 1IYUA 1JB3A 3TMEA 2B2UC 5IGFA 1BCPD 4PMCA 4XYQA 3MZ5A 1HFNA 5I4DA 3PO2B 3D6CA 3ERQA 2TMPA 4KHVA 1MGSA 2LKVA 4TQUS 4F7XA 2D62A 1HA6A 3QOJA 3NP8A 3T53B 3K6OA 3LNNA 1BCPF 3A8IE 2F3WA 4IZ8A 3K7AB 1O7ZA 4PQXA 4FF2A 4H44C 2G9HD 4OIJA 3WOEA 1UAPA 1FR3A 3ND9A 2RQXA 1XX8A 2KCCA 5ELEA 2M2LA 1WTXA 3HOWB 4F8MA 1XYIA 3ITPA 2VNUD 5JEAJ 2RDHA 1PZKD 4ZLTF 1VMPA 1H9JA 1SMYC 5T1IA 4XXEA 2QILA 1TQOA 3GP7A 2F1MA 5G3LD 1OO9B 2JA8B 2PMZB 3PMFA 1PRTC 3GQBA 3R93A 2H4OA 5EBDA 5E4WC 5JEAH 3BDOA 3BZDB 3D6WA 4XQQA 4RCNA 5G3LF 1EY9A 3VYUA 1B44D 4I65A 4RHSA 2EDGA 3TP6A 2B2UA 4CGYB 1VCIA 4NMZA 2MPMA 4NW2A 1HUNA 1B9MA 2PNRC 3RLFA 2AUKA 1CK1A 3Q23A 2LFNA 4HMJA 2ID0A 4WFN3 2F0MA 4KY6A 4M1UB 4G4KA 4V190 1STHA 1O80A 2RVLA 2OEOA 3DXJC 1SE4A 2LMCB 1F9SA 5C0XI 3MXNA 3K58A 2L9HA 2AQ1B 3TDQA 1BBXC 2PYKA 1PTOD 3PUYA 2BA1A 5LL6S 1Y8PB 4HSPA 4IQZA 3NTKA 4BBSB 1OXVA 1EWHA 2N88A 3OHXC 3G6JB 2K03A 3OWEB 1GXDC 3N6RA 2Z8LA 1PTOF 2ICEC 1PMRA 4C2MB 4DNRB 1KNAA 5DM63 2K28A 1JWMD 4M8AA 3C1EA 1RTOA 1JOOA 1STGA 2F0SA 1Z47A 5BN5A 5J1ZA 2F0JA 1JQYD 4EQOA 3TP5A 2NTTA 3VYTA 5I9PA 4H0LC 3X3MA 2XRSD 1AN8A 5DAUA 3FPUB 5BN3A 4CKBA 3AB9A 5KEEA 2RKSA 2FINB 1LT3D 3S16B 3W2DA 1LLRD 1A3VA 4HCSA 1BDOA 2NWGA 3I3CA 3W3AA 2O2LD 1CTMA 3QWNA 4FXGC 3OMCA 2IJ0A 3OSOA 2FHTA 1SSOA 1PZID 2VUMB 4QMGA 3D4DA 4H13C 2K5WA 4RKBA 3SK4A 1I6HB 3NTHA 3JAML 2JP1A 1LABA 5C5LA 2GA4B 2KA7A 1LTTD 3GTKB 1VF7A 2E74C 1BOSA 2JYOA 5IGCA 2L5TA 2SOBA 1D6EC 5KNDA 3A55A 1IYVA 2JA5B 4RA8A 5JPNC 1YNNC 3M7NA 4K6LA 5FLXE 1RCVD 1HRJA 1U9RA 3VR3A 1EY8A 2JE6I 5ELDA 5EJWA 1PDQA 4J1MA 4TKOB 5K5PA 4XQJA 2NVTB 3MFYA 2HCIA 2AQ3B 2A6ED 3GTGB 3D4RA 3NQIA 4KK7A 3I70A 1BUVT 2AWNA 4BY7B 3KUPA 1TU2B 4C3IB 1RD9D 2XVSA 4EVOA 1Z6HA 1BR9A 1S5CD 1H9SA 1PRTB 1CZWA 3AMUA 1ENAA 1OXUA 4QUFA 4RHRA 3J80E 2BA0A 4CKEA 1LT5D 1KLGD 3BYYB 4O42A 3NE5B 4ULLA 4IURA 4OO1H 3CQZB 4GZYC 4DAYA 1TKWB 3CHBD 1PZJD 3EJIA 5FKAC 2Z4HA 4C3HB 4EGVA 5ELFA 1B3AA 3K0YA 3K5OA 5FK9C 2LY7A 1DM0B 4FF1A 3GTPB 5M9OA 2WKDA 2C5CA 4RAUC 3Q22A 3GTMB 2MGSA 1EOTA 3L3OC 3TN2A 4B08A 1I50B 2B2TA 2DN8A 1K8OA 5K36H 5HURA 3SXHA 2EYMA 5E1FA 2OF1A 3S9WA 4QB4A 2IT1A 3OW7A 3NQTA 3IFDA 1U4PA 2L4NA 1Q12A 4OHJA 1STYA 1PLFA 2JEAI 4KHZA 1PYWD 5M3FB 3VR2A 1B50A 2CQAA 3OIPA 1F2YA 3TZDA 2D2CC 2O4XA 1GUOA 2Q8IB 2F0TA 1YNJD 4FP5D 4ZK9B 1G8ZD 2IX3A 1F2ZA 1V43A 3LX0A 1AZPA 4K5WA 2FMCA 5M5WB 3D3RA 5F2DA 1TS3A 4G57A 2AQ2B 1X3QA 1O7YA 2NN6G 2A69D 3MAQA 2NZ1D 4KY7A 5IGGA 3M85A 2I07B 3M4OB 2EXZA 4A3IB 1EQVA 2F0IA 1F9QA 1DCZA 4IFDH 5IT9L 1II3A 5CV6A 5ELCA 1EY6A 4V0BA 5C3XA 3P1HA 3S15B 1LACA 1FD7D 1JWUD 4C1NK 4IUPA 1DOKA 1EEID 1G91A 4RGNA 3NBHA 2A6HD 2IW3A 4ZQ3A 1BNZA 1SNDA 2KHSA 1E0BA 1FYCA 2HQEA 2PW5A 1SYCA 4TRDA 4DNTB 4K5VA 1W6KA 2B2VA 3H6MA 3K5NA 1LO5D 3FMCA 1F2MA 3GTOB 1S4ZA 1HHVA 1DD2A 3F2UA 1QWYA 3VYRA 3UI2A 2QF7A 5ELBA 5D65A 1STAA 1D2BA 3K5MA 1PRTF 1G2SA 2IPKD 3X3NA 3NWSA 2OT2A 3TP8A 1TS4A 3S2HB 5IGEA 1CHQD 1GHJA 1STNA 2HCCA 1WD1A 3IKJA 4XT1B 2EY1A 2K33A 3I8ZA 1HTPA 1B4OA 4RFBA 1S5DD 2B2WC 5C4HA 1EEFD 1Q3LA 5C44B 4LJZC 4RGOS 4U673 2ICIA 1YNJC 1O78A 3HP3A 3GTJB 3VA5A 4FF3A 2B39A 1L0XB 1M8AA 1SE2A 3M3YB 5CGKA 1TWCB 1QJOA 2EY2A 1V1PA 4F88A 1QCBD 3PV0A 4L8JA 1WTWA 1EU3A 2E75C 3KBXA 1JORA 2WP8J 1TT2A 4HSVA 1GUSA 3HKZB 2F0UA 1F9RA 1Z7TA 1O7LA 1SNQA 3NXWA 1A2TA 2R7ZB 4BA2I 4KKSA 4P2CB 2K5DA 1RKNA 2TSSA 3NSWA 2R92B 1LTSD 1NR2A 1KDBA 4ZUJA 1UUPA 3GD7A 1JE4A 3I4NB 1EZ6A 1TWGB 5KYLA 1XTCD 3BVGA 2SNSA 3GO5A 1CA6A 3AU7A 5NUCA 3EQLC 1C8CA 4C3JB 1LV9A 4KJOA 4RGMA 1KDCA 1WCMB 2XSCA 2J4XA 4RCOA 2V4DA 3H94A 2QEJC 1LT6D 4K14A 3DM1A 1ZYRD 3NPPA 3T13A 2F0VA 4A3KB 1JC7A 1CHPD 5CMDA 1FGBD 1HQRD 1WTOA 1NCVA 2EY5A 2B2WA 3V05A 3IL8A 3QOLA 1SDFA 4DF7A 4DK0A 1LT4D 3P7JA 1ESFA 1CA5A 1D5MC 1X32A 2Y0SB 4B9WA 2DNCA 3M7GA 3J81E 1BCPC 1ONLA 3SEBA 1PFNA 2F0OA 1ILQA 4G7ZC 3ONAB 2SEBD 3E0JA 2EY6A 3E6ZX 1SBBB 3BYTB 2A5HA 2IX1A 2F3VA 5IGBA 4HAEA 2E2DC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JOO A;  1TT2 A;  3H6M A;  1STG A;  4ID6 A;  1NSN S;  1ENC A;  2F0S A;  1F2M A;  2F0U A;  4B9X A;  4DFA A;  2F0J A;  5J1Z A;  5HUR A;  4EQO A;  2EYL A;  3SXH A;  2EYM A;  3TP5 A;  5CC4 A;  5E1F A;  2F0K A;  1SNQ A;  2OF1 A;  1A2T A;  1EY9 A;  3NXW A;  4QB4 A;  3SK8 A;  5IGD A;  5JOB A;  5I9P A;  3S9W A;  5CV8 A;  2EYO A;  4I65 A;  4S3S A;  1IHZ A;  3NQT A;  4PMB A;  5DAU A;  3TME A;  2F0L A;  1KDA A;  3EVQ A;  1RKN A;  2PZT A;  5EKL A;  4NDX A;  5IGF A;  1JOQ A;  4PMC A;  3T16 A;  3D4W A;  1STA A;  5KEE A;  1KAA A;  1STY A;  3MVV A;  3MZ5 A;  4IAL A;  4WRD A;  3TP6 A;  2RKS A;  3D6C A;  4K8I A;  3ERQ A;  1AEX A;  1KDB A;  2PW7 A;  4NMZ A;  4N9T A;  4RKL A;  4OL7 A;  4ZUJ A;  4KTA A;  4EVO A;  2EYF A;  4KHV A;  3DMU A;  1SYE A;  1SYF A;  1F2Y A;  3SK5 A;  2EYJ A;  2PQE A;  3BDL A;  2O4X A;  5C5M A;  1EYD A;  1EZ6 A;  2LKV A;  3DHQ A;  1A3V A;  3TP8 A;  4H7B A;  4F7X A;  3C1F A;  3D8G A;  1ENA A;  4J6H A;  4WOR A;  2F0D A;  5IOC A;  5KYL A;  2SNS A;  2F0T A;  3E5S A;  1SNM A;  4KV6 A;  1SYG A;  3R3O A;  4ODG A;  4HMJ A;  5CV9 A;  3QOJ A;  2F0M A;  3NP8 A;  4K8J A;  4KY6 A;  5IGE A;  2F0W A;  2F0N A;  5DEH A;  5NUC A;  3MXP A;  3OMC A;  1F2Z A;  1STH A;  1STN A;  2F3W A;  2PZW A;  3OSO A;  4IZ8 A;  3LX0 A;  5CR3 A;  4QMG A;  4KJO A;  2OEO A;  4K5W A;  3D4D A;  4KD4 A;  5F2D A;  3P75 A;  4RKB A;  1KDC A;  4G57 A;  3V2T A;  3SK4 A;  2RDF A;  1EYC A;  4MIU A;  5JAV A;  2EY1 A;  4KY7 A;  1EYA A;  3NUC A;  5E3F A;  1EY7 A;  4DGZ A;  5IGG A;  3HZX A;  4EQP A;  4PNY A;  3OWF A;  1EZ8 A;  4K14 A;  3EJI A;  2ENB A;  4N9P A;  5C5L A;  3TP7 A;  4EQN A;  1EY0 A;  4K2K A;  3RUZ A;  3QB3 A;  1SNO A;  3SHL A;  5CV7 A;  3T13 A;  2PYK A;  5KGU A;  1STB A;  2F0V A;  3NHH A;  2EXZ A;  4LAA A;  5C6A A;  5EKK A;  3MEH A;  1EY4 A;  2NUC A;  2SNM A;  4ZUI A;  2F0P A;  4F8M A;  5C4H A;  4K5X A;  1EQV A;  2F0I A;  2F0F A;  1A2U A;  4KJN A;  2EY5 A;  2QDB A;  3ITP A;  2PZU A;  1NUC A;  4IUN A;  4YIJ A;  4KD3 A;  1II3 A;  1SYD A;  5CV6 A;  5IGC A;  1SNC A;  2M00 A;  2F0G A;  2SOB A;  1EY6 A;  1JOK A;  2F0H A;  3NK9 A;  3QOL A;  3OMG A;  4ME5 A;  2F0Q A;  1SYB A;  4DF7 A;  5C3X A;  3P1H A;  5CV4 A;  2RBM A;  5C3W A;  5M9O A;  4K6D A;  1SNP A;  3SK6 A;  5EGT A;  4KY5 A;  4B9W A;  3BDC A;  5I6Y A;  3VA5 A;  1U9R A;  3SR1 A;  1TQO A;  4HMI A;  5KIX A;  1TR5 A;  5KRU A;  4R8N A;  5I9O A;  1EY5 A;  2F0E A;  2OXP A;  2F0O A;  5IOD A;  1KAB A;  4ZQ3 A;  5CGK A;  4NKL A;  2WAC A;  4DU9 A;  1A3T A;  2EY6 A;  1EY8 A;  3PMF A;  5J39 A;  5IIF A;  2EY2 A;  1SND A;  2KHS A;  4J1M A;  5K5P A;  2KQ3 A;  1JOR A;  5J22 A;  3HEJ A;  3MHB A;  3U9O A;  2PW5 A;  2HQE A;  3ERO A;  4NP5 A;  1SYC A;  4E6I A;  5C4Z A;  2EYP A;  5HGT A;  4QF4 A;  5KYI A;  2F3V A;  5I6W A;  4TRD A;  5IGB A;  2EYH A;  5ISR A;  3C1E A;  4K5V A;  5CV5 A;  1A3U A;  4K2L A;  4HTH A; 
#chains in the Genus database with same CATH topology
 2VQE L;  1VQM A;  1UWV A;  4CJ1 B;  3ND8 A;  4DN4 M;  1OXS C;  3K59 A;  4DAP A;  4DA2 A;  4CDF C;  2MUY A;  1V1Q A;  2EE1 A;  2EYO A;  4A3C H;  3HOX G;  1Y8O B;  2G9D A;  3GTQ B;  2KEE A;  3PUZ A;  5I2Y A;  1UE5 A;  3VYS A;  1KAA A;  1QE6 A;  3MVV A;  1WTV A;  2XNA C;  5CBE E;  2I5M X;  4A93 H;  1Q7Y C;  2A68 D;  4PMW A;  3KF6 A;  4YY3 Q;  4BBR H;  4GNX B;  1SYE A;  1HPC A;  3AYH B;  1IL8 A;  1XNR L;  5C0X G;  4DV4 L;  3C1F A;  5AFW A;  2K5H A;  2F0D A;  1SNM A;  1HCZ A;  2IL8 A;  1IYJ B;  4CJ0 B;  4A4I A;  2PMZ E;  5M5X H;  3UE1 A;  2F0W A;  3PUX A;  1TII D;  1SJE D;  2UU9 L;  2B2Y A;  4FVM A;  3FKI G;  1NAP A;  2X6L A;  3RZO H;  4ZCK A;  1S72 A;  3HOU B;  4UHV A;  3PCO B;  1RF2 D;  2JQO A;  2DJG C;  3I4M B;  1E2Z A;  1E22 A;  2L55 A;  2NVY H;  3VR6 A;  3MWY W;  3A7L A;  4PNY A;  1TWF B;  1MHW C;  2XGT A;  1JJG A;  1VF5 C;  1STB A;  5EBC A;  2BDO A;  3CC4 A;  2Z4I A;  3MEH A;  3LWU A;  2F0P A;  2GN5 A;  4R4O A;  2QEX A;  3Q8D A;  4P74 A;  2PZU A;  5C3E B;  3F2B A;  2E2H B;  4DV3 Q;  1EFI D;  2F0H A;  1TWH H;  1PTO H;  4JI6 L;  3NBI A;  4JC0 A;  5C3W A;  1GUN A;  1MSG A;  2JA7 H;  3L9A X;  4XQN A;  2J0T D;  3ULP A;  1ENF A;  1KC8 C;  1IBK Q;  1I4R A;  4HMI A;  3PO3 H;  1H9M A;  1TR5 A;  5KRU A;  4A3L G;  1YIT A;  1JMC A;  1LTB D;  2OXP A;  2WB1 B;  1VQE A;  3H91 A;  4NKL A;  1I4Q A;  3E9I A;  5M5Y H;  4P73 A;  3RNU A;  1R9T B;  2VW9 A;  2ZXO A;  3U9O A;  5HGT A;  3MEF A;  4N8F A;  4DV2 Q;  4G7H C;  4QGU A;  1YHQ A;  2D0P A;  2EYH A;  4PZ8 A;  5CV5 A;  1EQT A;  1A3U A;  2Q8T A;  3ICE A;  3H0G H;  3HRZ C;  2EJG C;  1ENC A;  3PO2 G;  1M4V A;  1ET6 A;  4RG1 A;  3J80 L;  2C35 B;  1WJJ A;  3RZD H;  4OEL B;  2WII B;  3J7Z C;  3K7U C;  1I3Q B;  2B2T C;  3MXN B;  1CKO A;  3KBG A;  1EUJ A;  2F0L A;  1KDA A;  1HA5 A;  4O2D A;  3Q0A A;  1JOQ A;  4IAL A;  3CCL A;  1K83 B;  2N49 A;  1K73 C;  2PW7 A;  4OL7 A;  3MXU A;  2FJ2 A;  2YTX A;  4BA1 I;  1GUW A;  1SYF A;  1PTO C;  4I7Z C;  3T4A C;  2KED A;  2NVX H;  4Q0F A;  1EYD A;  2IX0 A;  1X3P A;  5IOC A;  1OXT A;  2PI2 A;  3HG9 A;  4GN4 B;  3NWT A;  4KV6 A;  3KLS X;  5IYD G;  3AQQ A;  2R61 A;  4GKK L;  3BG3 A;  2R93 H;  1B2T A;  3F8T A;  5FLM G;  4OO1 I;  3HOW G;  1AE2 A;  4GN5 A;  2BCO A;  1SFO B;  3I91 A;  3VR4 A;  1Y1W H;  3HZX A;  1FNV A;  4IOA A;  4N9P A;  4MTN A;  4WJ4 A;  5HGQ A;  1KRS A;  2A68 C;  2K05 A;  3HS0 C;  4AQY L;  4B3M L;  1GHK A;  3Q24 A;  4JI7 Q;  3L7Z C;  2ATW A;  1Y1V H;  2F0F A;  3S2D B;  1UE7 A;  1HFG A;  1K8G A;  4YIJ A;  2OWO A;  1EWC A;  2JA8 G;  1D1I A;  4L5R C;  2RBM A;  1D8L A;  1WTP A;  1AZQ A;  1J6Q A;  1JWS D;  1C7Y A;  3KLR A;  2F4V Q;  4JBK A;  1DGS A;  4A3B H;  2RF4 A;  2B3G A;  2WAC A;  2L12 A;  1IBK L;  4DV6 L;  4IJL A;  3SE0 A;  4DPG A;  3OIQ A;  2EYP A;  5IWA Q;  5LMN L;  2K1B A;  1IW7 D;  1E1O A;  2MJ8 A;  4HTH A;  3FDT A;  4BXX H;  3WOF A;  4DV1 Q;  4DFA A;  1H9K A;  1NJI C;  2LSS A;  1PFS A;  4DUY Q;  1ESR A;  1Q8I A;  3T1H Q;  4DV0 Q;  5IYB G;  5M3M B;  2EJF C;  1M90 C;  1LTI D;  1CM9 A;  2CWP A;  2B63 B;  1TS2 A;  3S1M B;  2PO4 A;  3T16 A;  3DEO A;  2DY7 A;  5FOB B;  4K8I A;  4A3G B;  1BCP B;  1AEX A;  1D1K A;  2B2V C;  4UP9 A;  4KTA A;  2BE5 D;  2EYF A;  1N34 L;  4J8Q A;  2WKC A;  4IUV A;  2IHE A;  4LUO A;  3UDG A;  2HDL A;  4J6H A;  2L0C A;  4IUU A;  3NEN A;  1V9P A;  5DNF A;  5KNB A;  1LUZ A;  1S5F D;  5TSS A;  5CV9 A;  4A3J H;  2JA6 H;  1KIX A;  3FPP A;  3PQI A;  2MO1 A;  2ZJQ A;  4UPA A;  2PZW A;  2F4I A;  4JI5 L;  1Y69 U;  3KK7 A;  1CUK A;  1D5X C;  4XTC S;  4X65 Q;  3S17 B;  4P71 A;  5GAE C;  1WTH A;  3HOY B;  1VQ9 A;  1TWA H;  3S1Q H;  1TY2 A;  1EYA A;  4DGZ A;  2EZV A;  1RHP A;  5K36 G;  2FFK B;  2OTJ A;  2ENB A;  3HOV B;  3S14 B;  4DR1 L;  4BY1 B;  1MSH A;  2EVB A;  4BBS G;  4B3S L;  5CV7 A;  1QUQ A;  3J81 i;  4JBW A;  4DAM A;  1WTR A;  3NHH A;  1MKH A;  1Q90 A;  4IFD J;  3P20 A;  2A6E C;  1VQ6 A;  5COY A;  4JI3 L;  4KJN A;  2Z6K C;  5AJ3 Q;  4B3R L;  1FNU A;  2EPB A;  1EQR A;  3MA2 B;  2LXJ A;  1X9N A;  2F0Q A;  3CF5 A;  1SYB A;  5C4X B;  4X64 L;  2NN6 H;  3WWV A;  1K9M C;  3E9H A;  3H09 A;  4JI8 Q;  4DK1 A;  1E2W A;  4QIW B;  1P16 A;  4R8N A;  5IP7 H;  3R2T A;  2PPB C;  1A8V A;  5BN4 A;  2RHQ B;  2N8N A;  4A3F H;  2ZT9 C;  1H9S B;  3CRL C;  2KCN A;  2K75 A;  3MHB A;  3JAM c;  3HGB A;  1D5Z C;  1IXR A;  1KQS A;  3CCE A;  2B8F A;  5I6W A;  2MHV A;  4LFA L;  2H1E A;  1E2V A;  1GUT A;  4Y7N H;  4GOP C;  1NSN S;  1FVI A;  4X3T A;  4B9X A;  4XT3 B;  3LGJ A;  4FO2 A;  4DUZ Q;  2CVR A;  2EYL A;  1B7Y B;  1BO0 A;  2R6G A;  4KN7 C;  4DR7 Q;  3A5Z B;  3A74 A;  4JI2 L;  3H3V H;  1UEA B;  1SMY D;  5JOB A;  4GS3 A;  5CV8 A;  4DV5 Q;  1OXX K;  5DM7 3;  1VQD A;  2IY5 B;  4DAY B;  2KJX A;  4DV1 L;  1TXY A;  3OTO Q;  4ZKC B;  4A93 B;  4DUY L;  5EKL A;  5JJZ A;  4DV0 L;  3HOZ H;  4BBR B;  4L6T B;  1IKL A;  1LTG D;  1WD0 A;  3DMU A;  1PRT D;  2VUM G;  1AE3 A;  3O13 A;  2EYJ A;  2PQE A;  5C5M A;  2EJM A;  3GV6 A;  3TEH B;  5M5X B;  4LF8 Q;  5LMU Q;  1Q82 C;  4NXM Q;  3E5S A;  3RZO B;  1XPO A;  2WIN B;  2K01 A;  2UUC Q;  3MTS A;  2A8V A;  1TY0 A;  1ZKO A;  2DY8 A;  2NVY B;  4KD4 A;  1IBM Q;  4LF7 Q;  4XYO A;  4ABN A;  2I46 A;  5E3F A;  3NUC A;  3IAY A;  1EY7 A;  3LWE A;  4NXN Q;  3RLN A;  2ZJP A;  1G6Z A;  4DR6 Q;  4EQN A;  1LM0 A;  2KEC A;  2JA5 G;  5FJ8 G;  3GV3 A;  5A2Q E;  4A3E H;  2OQK A;  5KGU A;  4KI0 A;  3H3V C;  1N9W A;  2L11 A;  4LAA A;  1EIY B;  2BE5 C;  1TWH B;  3I72 A;  2K7V A;  1PTO B;  1K3B C;  2VB3 X;  3S1N H;  4IUN A;  1DJR D;  1R4Q B;  1DYQ A;  2JA7 B;  3CW2 C;  4A3M H;  1ICW A;  5D3D A;  5IT9 E;  2Z6K A;  3PO3 B;  2WFW A;  4RH6 A;  4A3D H;  5EGT A;  3M4Y A;  5JPM C;  5M5Y B;  3PUW A;  1L1O C;  1B53 A;  1KAB A;  3G7L A;  1A6X A;  1GJX A;  2XRQ D;  4HJ5 A;  1B8A A;  2PCF B;  4XDX A;  3ERO A;  4BY7 G;  3H0G B;  2DJF C;  4NB3 A;  2HDM A;  1QNU A;  5EKI A;  4C3I G;  4LK1 C;  5ISR A;  4YWK A;  4K2L A;  2LS0 1;  1KNE A;  4ID6 A;  3AEV A;  4CKC A;  3RZD B;  2AUJ D;  1Q1E A;  3QIA A;  1IKM A;  1TVX A;  3I90 A;  4GN3 B;  4GLV B;  3M9B A;  3HKS A;  1I4G A;  2F0K A;  1N36 L;  2CW0 D;  4JG2 A;  3SK8 A;  2I5L X;  2DNE A;  4L5Q A;  1V1O A;  5CYU A;  1G2T A;  1S5B D;  4PMB A;  3DEP A;  4TSS A;  3TBI B;  3I4O A;  1K8M A;  1U4R A;  2K04 A;  3MFG A;  4CJ2 C;  2A69 C;  4DR7 L;  1GOZ A;  1Q46 A;  3D4W A;  4DXG A;  2KBN A;  3EA6 A;  2NVX B;  4YHH Q;  4X3K A;  1MI2 A;  2K6A A;  1MBY A;  5COR A;  1KTK A;  1AW7 A;  3BDL A;  1ET9 A;  4X62 L;  3H15 A;  2R93 B;  2EOT A;  4YCV A;  1EU4 A;  1SYG A;  2XIW A;  1HUM A;  1BQQ T;  1C4Q A;  4ZYS A;  2F03 A;  4K8J A;  5JVH 3;  3MXP A;  2O5J C;  4C3H G;  4LF8 L;  3HFZ B;  3OOC A;  1MJE A;  2AMC B;  1Y1W B;  1JR0 D;  2B63 H;  1N32 Q;  1EYG A;  2Z1C A;  1C48 A;  2A6H C;  3PIP A;  3J81 L;  3A7A B;  1KLU D;  1AFP A;  1H95 A;  1FJG L;  4K2K A;  3RUZ A;  1SNO A;  1Y1V B;  3JC6 6;  3CC7 A;  1PVO A;  2UUB Q;  1PH2 A;  3BVZ A;  1EY4 A;  2O5I C;  4JV5 L;  1QNK A;  2B2Y C;  4LMQ D;  1W6J A;  2MP1 A;  4P75 A;  1NUC A;  1F2L A;  1I6V C;  3ULJ A;  2B8G A;  1T9H A;  2Q2T A;  3KJO A;  3C2P A;  4ME5 A;  3OMG A;  2AWO A;  1ICF B;  4PV1 C;  1HNW L;  4A3B B;  5CV4 A;  3FVQ A;  2MNA A;  3SK6 A;  1WTQ A;  5JEA G;  3A5U A;  1KL9 A;  5IP9 H;  5I9O A;  3MC0 B;  1VQH A;  4F87 A;  3FEW X;  4HID A;  3BU2 A;  4DU9 A;  4L5T A;  4K0K Q;  1K8A C;  2KQ3 A;  3HEJ A;  4NP5 A;  5C4Z A;  1B3Q A;  1NNX A;  4JK1 C;  2EXD A;  3RD4 A;  3EFX D;  3E3X A;  3FRP B;  4K5X A;  4PZ7 A;  1MD2 D;  4JI0 L;  4FXD A;  3BS1 A;  4APV A;  5M3F G;  1NR4 A;  5CC4 A;  1XMQ L;  2CKZ B;  5IGD A;  1I94 Q;  1YNN D;  1JT8 A;  2VQF Q;  1QZG A;  2RSO A;  1S5E D;  5BR8 L;  1VQ5 A;  1XWE A;  1F9P A;  4YWL A;  1QVG A;  3URY A;  4WRD A;  5C0X J;  4C1N I;  3U50 C;  4CDE C;  1UNS A;  1XJV A;  3QG1 A;  1ILP A;  5GQO A;  2KUM A;  3DHQ A;  2ZM6 L;  1WYD A;  4A3J B;  4UP8 A;  1VQ7 A;  2JA6 B;  1V8Q A;  1CI3 M;  1BKB A;  1BF4 A;  4DR3 L;  3CU7 A;  3F2D A;  4LWC A;  1YNX A;  3R3O A;  3HOX H;  2NVQ H;  4ZKB B;  2H5X A;  2B29 A;  4DNI A;  5DEH A;  4FNF A;  2BH8 A;  4QCL A;  4GOP B;  1NBW A;  4HED A;  1VQB A;  4MN3 A;  1TWA B;  3S1Q B;  3T51 B;  1X6O A;  4A3I G;  4UY8 C;  1KXL A;  3P75 A;  2CW0 C;  1H9R A;  3V2T A;  1V1P B;  1A15 A;  1EYC A;  4HJ7 A;  3U9S A;  1AP0 A;  5ELO A;  3OPO A;  4OGQ C;  2KHJ A;  3SDZ A;  1JCK B;  3HKZ E;  5C0X H;  4FYD A;  2NB0 A;  4UDU C;  4FF4 A;  3QB3 A;  4Q5V A;  2A74 C;  4BS9 A;  4LF9 Q;  2KOL A;  3IFT A;  1L2F A;  5EKK A;  4UP7 A;  4C56 C;  2SNM A;  4ZUI A;  2L1B A;  2E2J H;  5D14 A;  1A2U A;  2QDB A;  1SYD A;  3FKI H;  4LFC L;  1VQF A;  2QCP X;  1OTC A;  3L2P A;  4ME3 A;  5FLX L;  4X3S A;  4CBV A;  1SNP A;  4G7O C;  1J5E Q;  4MHE A;  3FP9 A;  3QJY A;  2A19 A;  3SR1 A;  4JYA Q;  4JI4 Q;  5I2X A;  4A3F B;  4HIO A;  1E24 A;  4QUC A;  4DV7 L;  5IOD A;  1G29 1;  1RTN A;  4HCE A;  4RWS C;  5C4J B;  1BXT A;  1VQJ A;  2X6G A;  1X3E A;  1HJP A;  2EIF A;  4Y7N B;  2E2I H;  4E6I A;  2CWA A;  4IUQ A;  1HZB A;  4DR5 Q;  2QKI C;  5FO9 B;  4J15 A;  3UDF A;  1NY4 A;  3SVM A;  2AHO B;  4A3L H;  5CBA E;  5D3I B;  2R3Z A;  3NTI A;  1F77 A;  1ZEQ X;  1XMO Q;  1J8I A;  2HT1 A;  2YU9 H;  3HOZ B;  3CC2 A;  1MIU A;  1IHZ A;  3RR5 A;  3PIP 3;  4KKU A;  2XN9 C;  3GTL H;  2YYZ A;  3CCJ A;  4IN3 A;  1X3G A;  4KMU C;  1RIP A;  3QO2 A;  3CCM A;  2Q2I A;  3J81 j;  4RKL A;  1L1O B;  1PH3 A;  3PIO 3;  1EFW A;  2JSO A;  2VXW A;  3C3L A;  3UE0 A;  1ZYR C;  2YV5 A;  3SK5 A;  3PO2 H;  2RCN A;  3D8G A;  4WOR A;  4O1N A;  1VDZ A;  5EPK A;  1S40 A;  4MNO A;  1Y8N B;  2D9U A;  3ERS X;  2F52 A;  2PQA A;  2ZTD A;  2KHI A;  1D7Q A;  1U0L A;  1XPR A;  1B9N A;  4KKT A;  5CR3 A;  4R9W A;  1HTL D;  4AIM A;  2ZJR A;  1DZ1 A;  3K7A H;  5FO7 B;  4MIU A;  1QB5 D;  5JAV A;  4A3E B;  2HUG A;  5C44 G;  3KDF B;  3GDE A;  5FO8 B;  5IYD H;  1SAP A;  4FXK C;  2CHB D;  3S1N B;  4KLK A;  4CDD C;  3I73 A;  2WAQ B;  4YY3 L;  2IWH A;  4A3M B;  5LL6 X;  1VQG A;  3KLS A;  5FLM H;  3C46 A;  4DAV A;  4A3D B;  1LTR D;  2M00 A;  3HOW H;  4HR7 B;  4Z9C B;  3KFU A;  2FMM A;  3EN2 A;  3N52 A;  2OTL A;  2KVM A;  4OEM B;  3DWA A;  2K32 A;  3A56 A;  4K6D A;  3A8J E;  1XXG A;  3CAM A;  3BZK A;  3BDC A;  4LW1 A;  1SXT A;  3CRK C;  2J7Z A;  1EY5 A;  4BWG B;  1T5X D;  3JAM E;  1U4M A;  2F0E A;  1PH5 A;  3KF6 B;  3HKZ G;  1A3T A;  1QIL A;  2IHF A;  1PH4 A;  3U58 A;  2JXM B;  2R7Z G;  1PA6 A;  5KYI A;  2JA8 H;  2BDN A;  2NBF A;  1SEB D;  1VMC A;  3TZU A;  1C9O A;  1DXM A;  4RGT A;  3U4V A;  4HJ8 A;  3T56 B;  3K81 C;  2R92 G;  3J7A V;  3MXG A;  1ASY A;  2X69 A;  4DR4 Q;  1CZG A;  4DV3 L;  1CKM A;  5GAH C;  1SE3 A;  3I4N G;  1WVL A;  4HIK A;  3KF8 A;  1KD1 C;  2ZTC A;  1GKH A;  2PZT A;  2HIV A;  4NDX A;  4LNQ A;  2D5D A;  3RMH A;  1ML0 D;  4QL5 A;  2Q8R E;  2K5N A;  1NTG A;  4N9T A;  4OO1 G;  3U4Z A;  4YCU A;  3CMA A;  1EQQ A;  1SJH D;  4C3J G;  4H7B A;  4DV2 L;  2VB2 X;  5IYB H;  1WCM G;  4UAI A;  5J3B A;  3A8K E;  4ODG A;  2A73 B;  3J7Y W;  3K5L A;  1NMG A;  2F0N A;  2ZXR A;  4MZ9 A;  3PF4 A;  2XWB B;  1PXU A;  4A3K G;  2XTI A;  5JJK A;  1JB7 A;  2XWJ B;  2RDF A;  1JIC A;  1ZXT A;  1EZ8 A;  3TP7 A;  2I0Q A;  1EY0 A;  4R4Q A;  1E7Z A;  2Y0S G;  4U68 A;  5E7N A;  5C6A A;  1HQM C;  2JEB I;  1LTA D;  2NUC A;  3KJP A;  4EX5 A;  1B1Z A;  4OIK A;  1YHA A;  4EQ5 A;  1I4H A;  5E4X A;  1DOM A;  1WFQ A;  3R8B A;  1PFM A;  1SNC A;  1L0Y B;  3NK9 A;  1CT1 D;  1BVS A;  4X66 Q;  1XPU A;  4AYB B;  4KN4 C;  1X54 A;  2NN6 I;  1Q1B A;  2PQA B;  4X3U A;  1EIH A;  2N55 A;  1GUG A;  4OWT B;  1I4P A;  4KY5 A;  2ZXP A;  5KIX A;  1I5F A;  3R2I A;  3TRZ A;  1ASZ A;  4BBS H;  2RCF A;  2Z6B A;  5FLX c;  3CKI B;  3RLO A;  5J39 A;  3V96 A;  4HJ9 A;  3A54 A;  5J22 A;  3ZYY X;  4POG A;  2CH4 A;  4C2M H;  4IFD I;  2E76 C;  5A35 A;  1QOH A;  4JI7 L;  3AFP A;  1EIF A;  3E0E A;  3VA7 A;  1U4L A;  3K57 A;  1J9O A;  3H3V I;  3VR5 A;  4WJ3 M;  3M4Q A;  3J7A F;  2RA4 A;  3DWP A;  2NTS A;  3DUZ A;  4I7A A;  5LHY 1;  4LF5 Q;  3PUV A;  5HY6 A;  1BBW A;  1TS5 A;  2F4V L;  2DUD A;  1IBL Q;  5GAG C;  2Q2U A;  3EVQ A;  1GD7 A;  3A0J A;  1HZ9 A;  2RSN A;  1HR0 W;  5C4J H;  2NYZ D;  5KNC A;  5IYC G;  4ZAI A;  2BOS A;  1SRU A;  5EPL A;  2C9O A;  3HOX B;  5A2Q L;  2NVQ B;  4JW0 A;  5IWA L;  1R4P B;  3S16 H;  2M9V A;  3HOU G;  3WDN A;  1NE3 A;  1DON A;  1W3S A;  1FNW A;  3I4M G;  1EIG A;  2VL6 A;  2SDF A;  1CQV A;  4JOI A;  2RDG A;  1Q8K A;  4DXF A;  3D31 A;  4XIG S;  3T1H L;  4WJW A;  3J80 c;  4IFD G;  4KHP Q;  3KF8 B;  4ZRZ A;  1DOL A;  2VUM H;  2MO0 A;  5C3E G;  4GKJ Q;  4O0A A;  4HJA A;  1E1T A;  1BBU A;  4EQP A;  4IUT A;  3NEL A;  4JI1 Q;  3OWF A;  1I6H H;  1HNX Q;  2E2J B;  3SHL A;  3D0F A;  3TSS A;  4ILW A;  1PH6 A;  4P72 A;  2MFI A;  1GM5 A;  1IW7 C;  3ULL A;  3FKI B;  1T5E A;  1RDP D;  1LTL A;  4CHT B;  4KD3 A;  2WB1 G;  1HXY D;  1CFM A;  1QG7 A;  2F0G A;  1JOK A;  3Q6S A;  3GTK H;  4R8I A;  4L63 B;  1CQF A;  1EL0 A;  1G51 A;  1N33 Q;  1IL2 A;  5I6Y A;  2JA5 H;  4X65 L;  5FJ8 H;  5JVG 3;  1RJT A;  1STE A;  3S1R B;  2E2I B;  1PFB A;  5EQ0 A;  1VQP A;  4MTK A;  3DWQ A;  3TQY A;  2HHH Q;  5IIF A;  2K5Q A;  5EPJ A;  2CCZ A;  3CXC A;  3NEM A;  1W2B A;  4PG3 A;  4QF4 A;  4DKA C;  1HH2 P;  2RHS B;  1K28 A;  1A63 A;  2UUA Q;  3BVM A;  4HN7 A;  1I4X A;  4LFB Q;  2NVT H;  2YU9 B;  5AJ3 L;  1ROD A;  2NZO A;  4LF4 Q;  3GTG H;  3SGI A;  3GTL B;  2I5H A;  2WV6 D;  3I4L A;  5T1G A;  1GO3 E;  4S3S A;  1IYU A;  4JI8 L;  1JB3 A;  3TME A;  2B2U C;  3KYH C;  5IGF A;  1GVP A;  2LXK A;  4BY7 H;  1BCP D;  4PMC A;  4XYQ A;  3MZ5 A;  1QUQ B;  1HFN A;  5I4D A;  3PO2 B;  2KEN A;  3D6C A;  4C3I H;  3ERQ A;  3G48 A;  2TMP A;  4KHV A;  1MGS A;  2V1C C;  2LKV A;  4TQU S;  4F7X A;  2D62 A;  1CKN A;  1HA6 A;  3T1Y Q;  3QOJ A;  3NP8 A;  3T53 B;  3K6O A;  3LNN A;  1BCP F;  3A8I E;  4DUZ L;  2F3W A;  4OX9 Q;  4IZ8 A;  3K7A B;  1O7Z A;  4PQX A;  5JJL A;  3CCQ A;  4FF2 A;  1HR0 Q;  4H44 C;  4DV5 L;  2G9H D;  5GAD C;  4OIJ A;  2PNH A;  2E5L Q;  3OTO L;  2HIX A;  3WOE A;  1UAP A;  2AKW B;  1FR3 A;  3CQZ H;  3B6Y A;  3ND9 A;  2RQX A;  1XX8 A;  4IPH A;  2CQO A;  3TS2 A;  2KCC A;  4LF6 Q;  5ELE A;  3JAM i;  2M2L A;  1UE6 A;  1WTX A;  1PH8 A;  3HOW B;  4C3H H;  2VQE Q;  4F8M A;  1XYI A;  4GNX A;  3ITP A;  1SE8 A;  5LMU L;  2VNU D;  1AH9 A;  4NXM L;  5JEA J;  2RDH A;  1PZK D;  2KCT A;  4ZLT F;  1PH1 A;  3CPF A;  1VMP A;  1H9J A;  1SMY C;  5T1I A;  3EBE A;  4XXE A;  2QIL A;  1Q86 C;  4OXP A;  2UUC L;  1TQO A;  1UE1 A;  1X3F A;  3GP7 A;  3GTP H;  1IBM L;  2K52 A;  4LF7 L;  2F1M A;  5G3L D;  1OO9 B;  2JA8 B;  5DLQ E;  3GTM H;  3PIO A;  2PMZ B;  3PMF A;  4NXN L;  4YCW A;  1XNR Q;  1PRT C;  3EIV A;  3GQB A;  4DR6 L;  5M3M G;  4DV4 Q;  1WI5 A;  1I50 H;  2A1A A;  3R93 A;  2JK8 A;  2H4O A;  5EBD A;  5E4W C;  5JEA H;  3BDO A;  1SR3 A;  4A3G G;  3BZD B;  3D6W A;  4XQQ A;  2UU9 Q;  4RCN A;  1VQA A;  5G3L F;  1EY9 A;  4JPB W;  3VYU A;  1B44 D;  4I65 A;  3J7A 5;  4RHS A;  1K3R A;  5IY0 A;  2QGQ A;  1NMF A;  2EDG A;  3TP6 A;  2B2U A;  4CGY B;  1VCI A;  4NMZ A;  2MPM A;  4NW2 A;  3I2Z A;  1HUN A;  1B9M A;  2PNR C;  5M3F H;  3RLF A;  2AUK A;  3HOY G;  1CK1 A;  1YJN A;  3G71 A;  3Q23 A;  5LMN W;  2LFN A;  4HMJ A;  2ID0 A;  4WFN 3;  2F0M A;  3K80 C;  2VS1 A;  4KY6 A;  4M1U B;  4R4T A;  3ER0 A;  4G4K A;  3HOV G;  4V19 0;  4BY1 G;  1STH A;  1O80 A;  2RVL A;  2OEO A;  2OQ0 A;  3DXJ C;  4JCV E;  1SE4 A;  1RL2 A;  2LMC B;  3FHW A;  1F9S A;  4R4C A;  2P5Z X;  5C0X I;  5EAY A;  5M5W H;  3MXN A;  3K58 A;  2L9H A;  1HR0 L;  2AQ1 B;  3TDQ A;  5C4X G;  4YHH L;  1YJW A;  1BBX C;  2PYK A;  2K50 A;  1PTO D;  3PUY A;  2BA1 A;  5LL6 S;  3STB D;  1Y8P B;  4HSP A;  3M4O H;  3PF5 A;  4A3I H;  4IQZ A;  4B3T Q;  1HNZ Q;  3NTK A;  3OW2 A;  4BBS B;  1OXV A;  1EWH A;  3OHX C;  2N88 A;  2R7D A;  3G6J B;  2K03 A;  3OWE B;  1GXD C;  3W1G A;  4QQB X;  3S15 H;  3N6R A;  2Z8L A;  1N32 L;  1PTO F;  2ICE C;  2ASB A;  1YVC A;  1PMR A;  4C2M B;  4A3C G;  4DNR B;  1KNA A;  5DM6 3;  1EWI A;  4NPS A;  3IRB A;  2QA4 A;  2K28 A;  1JWM D;  4M8A A;  4HIM A;  3TRE A;  3C1E A;  2ALY B;  2UUB L;  4A93 G;  1RTO A;  4DK3 C;  1JOO A;  4GKK Q;  1STG A;  1VQ8 A;  4BBR G;  2F0S A;  1Z47 A;  5BN5 A;  2F0J A;  1JQY D;  5J1Z A;  2EQS A;  4EQO A;  4LUV A;  3TP5 A;  4GLX A;  1JJC B;  2NTT A;  3VYT A;  2MQH A;  5I9P A;  1SN8 A;  4H0L C;  3X3M A;  3GTO H;  2XRS D;  1M1K C;  1AN8 A;  5DAU A;  3FPU B;  3AFQ A;  2OCE A;  5BN3 A;  4CKB A;  3AB9 A;  5KEE A;  3S1R H;  2RKS A;  3KLW A;  2FIN B;  1LT3 D;  2JJQ A;  2D0O A;  5JJI A;  3F2C A;  2GVB A;  3S16 B;  4K0K L;  1Y14 B;  1IZ6 A;  4AQY Q;  3W2D A;  4B3M Q;  1LLR D;  1A3V A;  3CCS A;  4HCS A;  1BDO A;  3CPW A;  2NWG A;  3I3C A;  3W3A A;  2O2L D;  1CTM A;  3QWN A;  1JJ2 A;  4FXG C;  3S2H H;  3OMC A;  2IJ0 A;  3OSO A;  2FHT A;  2L15 A;  3CCR A;  1SSO A;  1PZI D;  2VUM B;  4QMG A;  1I94 L;  3D4D A;  4H13 C;  2K5W A;  4RKB A;  2VQF L;  3SK4 A;  1I6H B;  4H02 A;  1PV4 A;  4JBM A;  3NTH A;  2JA7 G;  2Y0S E;  3JAM L;  4DV6 Q;  2JP1 A;  1LAB A;  3CCU A;  1Z9F A;  3CCV A;  5C5L A;  3PO3 G;  2GA4 B;  5LMN Q;  2KA7 A;  1LTT D;  4OWW B;  3OYY A;  3GTK B;  1VF7 A;  2E74 C;  2L5T A;  2JYO A;  1BOS A;  5IGC A;  2SOB A;  1D6E C;  5KND A;  3A55 A;  1IYV A;  4JBJ A;  4RA8 A;  2JA5 B;  5JPN C;  3I56 A;  1YNN C;  3M7N A;  4K6L A;  5FLX E;  3H0G G;  5C44 H;  1RCV D;  3W5O A;  1HRJ A;  1U9R A;  2E8G A;  4B3T L;  1HNZ L;  3UDI A;  3VDY A;  3VR3 A;  3GTJ H;  1N34 Q;  1EY8 A;  2JE6 I;  5ELD A;  5EJW A;  1PDQ A;  4J1M A;  4TKO B;  5K5P A;  3J81 c;  4XQJ A;  3M3Y H;  3BJU A;  1TWC H;  4LF9 L;  2NVT B;  3MFY A;  2HCI A;  2AQ3 B;  2A6E D;  3CME A;  3GTG B;  3D4R A;  3NQI A;  4KK7 A;  3STB C;  3CP0 A;  4JI5 Q;  3I70 A;  1FL0 A;  1BUV T;  2AWN A;  4BY7 B;  3I55 A;  2CFM A;  3KUP A;  1TU2 B;  4C3I B;  1RD9 D;  1J5E L;  2R7Z H;  2R93 G;  1E3P A;  4JYA L;  4JI4 L;  2XVS A;  4DR1 Q;  1X56 A;  4EVO A;  4B3S Q;  1Z6H A;  2R92 H;  3UDX A;  1BR9 A;  1Y1W G;  4JI3 Q;  1S5C D;  1H9S A;  1PRT B;  1CZW A;  1UEB A;  1YEZ A;  1ENA A;  3G6E A;  4DR5 L;  3AMU A;  4B3R Q;  1OXU A;  1P8L A;  1X55 A;  4QUF A;  3I4N H;  4RHR A;  1TWG H;  3J80 E;  2BA0 A;  4CKE A;  4X64 Q;  1LT5 D;  1KLG D;  2ES2 A;  3BYY B;  4O42 A;  3NE5 B;  1Y1V G;  4ULL A;  1XMO L;  4IUR A;  4OO1 H;  2YTV A;  3CQZ B;  4GZY C;  5H1S E;  4C3J H;  4POF A;  4DAY A;  1TKW B;  3CHB D;  1WCM H;  1PZJ D;  3EJI A;  1VQN A;  5FKA C;  2Z4H A;  4C3H B;  4A3B G;  4EGV A;  4JOI C;  1A0I A;  5ELF A;  2Z0S A;  1B3A A;  3K0Y A;  3K5O A;  2WB1 E;  4LFA Q;  1SRO A;  4ALP A;  4L5S A;  1VQO A;  1PH7 A;  5FK9 C;  1YZ6 A;  2CH4 W;  4QJF A;  4A3K H;  2VZA A;  2BH2 A;  4JI2 Q;  2LY7 A;  1DM0 B;  2NZH A;  4FF1 A;  3GTP B;  5M9O A;  2WKD A;  4BXX G;  2C5C A;  4RAU C;  3Q22 A;  1SMX A;  3GTM B;  2MGS A;  1CSP A;  1EOT A;  3L3O C;  1WOC A;  2UXD Q;  4A75 A;  3TS0 A;  3TN2 A;  4B08 A;  1I50 B;  2B2T A;  4FDB A;  2DN8 A;  1EOV A;  2R7F A;  1YJ9 A;  1K8O A;  4R4I A;  5K36 H;  5HUR A;  1X65 A;  2EYM A;  3SXH A;  5E1F A;  2OF1 A;  3S9W A;  4QB4 A;  3QR8 A;  2IT1 A;  1N8R C;  2WAQ E;  3OW7 A;  1QVC A;  2F3I A;  3NQT A;  4TVA B;  4A3J G;  3IFD A;  1U4P A;  2JA6 G;  2L4N A;  1Q12 A;  3RN5 A;  4OHJ A;  1STY A;  3GTQ H;  1PLF A;  5GRO A;  2JEA I;  1C0A A;  3W1B A;  4KHZ A;  1O7I A;  1K0R A;  1PYW D;  3VR2 A;  5M3F B;  1B50 A;  3PGZ A;  2CQA A;  3OIP A;  4LUZ A;  2K4K A;  1F2Y A;  3TZD A;  2VY3 A;  1YIJ A;  2D2C C;  2O4X A;  1GUO A;  2Q8I B;  2HQL A;  2F0T A;  1YNJ D;  4FP5 D;  5ELN A;  4ZK9 B;  3BZC A;  1G8Z D;  2IX3 A;  1F2Z A;  1V43 A;  4DR4 L;  3LX0 A;  1AZP A;  2FXQ A;  4K5W A;  2FMC A;  1YBY A;  5M5W B;  3D3R A;  5F2D A;  1JE5 A;  1TS3 A;  4G57 A;  2AQ2 B;  5IYC H;  1X3Q A;  1O7Y A;  2NN6 G;  2A69 D;  3MAQ A;  2NZ1 D;  4KY7 A;  5IGG A;  3M85 A;  2I07 B;  1PH9 A;  3HOU H;  5L37 A;  3I4M H;  5IP7 G;  3M4O B;  2EXZ A;  4A3I B;  1TWF H;  2K5V A;  1EQV A;  2F0I A;  4A3F G;  1KAW A;  1B70 B;  1F9Q A;  1DCZ A;  4IFD H;  5IT9 L;  1II3 A;  5CV6 A;  5ELC A;  1EY6 A;  1N36 Q;  3F1Z A;  4V0B A;  5C3X A;  3P1H A;  5C3E H;  3S15 B;  1LAC A;  2E2H H;  1FD7 D;  2UXC Q;  1JWU D;  4C1N K;  1QZH A;  4IUP A;  1DOK A;  1EEI D;  1G91 A;  4OON A;  4RGN A;  3NBH A;  2A6H D;  2IW3 A;  3DLL A;  4ZQ3 A;  4GNX C;  1BNZ A;  1SND A;  2KHS A;  1LYL A;  4IPD A;  1E0B A;  1FYC A;  2HQE A;  2PW5 A;  1SYC A;  4X62 Q;  2JA9 A;  3HOZ G;  2UXD L;  4TRD A;  4DNT B;  4K5V A;  1R9T H;  2Z9H A;  1W6K A;  2B2V A;  3H6M A;  3K5N A;  1Q81 C;  1LO5 D;  3CD6 A;  3FMC A;  1F2M A;  3GTO B;  1VS0 A;  1S4Z A;  1HZC A;  1HHV A;  1DD2 A;  1VQC A;  2N3S A;  3F2U A;  4X66 L;  1MJC A;  1QWY A;  2Q2H A;  2HD3 A;  1L0W A;  2N78 A;  3VYR A;  3UI2 A;  2QF7 A;  5ELB A;  5D65 A;  3ZJY C;  1STA A;  1I3Q H;  1D2B A;  4OWX B;  1FJG Q;  4IPG A;  3K5M A;  1PRT F;  4AYB E;  1G2S A;  2IPK D;  3X3N A;  3NWS A;  4JV5 Q;  1K83 H;  2OT2 A;  2ZTE A;  3TP8 A;  1TS4 A;  3KOJ A;  3S2H B;  1G6P A;  4A3E G;  1CSQ A;  4RMF A;  1HNW Q;  1KHI A;  5IGE A;  4DR2 Q;  1CHQ D;  1GHJ A;  1YHB A;  2PI2 E;  1STN A;  2HCC A;  4N8X 1;  1WD1 A;  3G4S A;  2WAQ G;  4LF5 L;  4A3M G;  3IKJ A;  4XT1 B;  2QW7 A;  5IE8 A;  1IBL L;  3S24 A;  2EY1 A;  2K33 A;  4A3D G;  3I8Z A;  1HTP A;  1B4O A;  4QIW E;  1SFO H;  4RFB A;  1S5D D;  3RN2 A;  2B2W C;  2YTY A;  5C4H A;  4JI0 Q;  2UXB Q;  1EEF D;  1Q3L A;  5C44 B;  4LJZ C;  4RGO S;  4U67 3;  1XMQ Q;  3S2D H;  2ICI A;  1YNJ C;  1O78 A;  1XNQ Q;  3HP3 A;  3GTJ B;  5BR8 Q;  3VA5 A;  4AH6 A;  1VQ4 A;  4FF3 A;  4GOP A;  2B39 A;  4KHP L;  1L0X B;  1M8A A;  1SE2 A;  1A62 A;  3M3Y B;  5CGK A;  1QVF A;  2UXC L;  1TWC B;  4GKJ L;  1QJO A;  2EY2 A;  1V1P A;  4F88 A;  4JI1 L;  1QCB D;  3PV0 A;  2ZM6 Q;  4L8J A;  1HNX L;  2JN4 A;  1WTW A;  4DR3 Q;  1EU3 A;  2E75 C;  3KBX A;  1JOR A;  1SLJ A;  2WP8 J;  1TT2 A;  4HSV A;  1GUS A;  3HKZ B;  2F0U A;  4A76 A;  1F9R A;  1VQI A;  1HZA A;  1Z7T A;  1O7L A;  3I7F A;  1SNQ A;  3NXW A;  1A2T A;  2R7Z B;  4BA2 I;  4KKS A;  4P2C B;  1PHJ A;  2G5D A;  1XTD A;  2K5D A;  3J80 i;  4IOC A;  1N33 L;  4X6A H;  1YI2 A;  3L0O A;  1RKN A;  5M3M H;  2TSS A;  3PSI A;  1FGU A;  3NBH B;  4IPC A;  3NSW A;  2R92 B;  1LTS D;  1NR2 A;  3S1M H;  1KDB A;  4ZUJ A;  2B63 G;  1UUP A;  3GD7 A;  2HHH L;  1JE4 A;  1PYS B;  3I4N B;  4A3G H;  1EZ6 A;  1TWG B;  2QDL A;  4GLA C;  5KYL A;  1XTC D;  1VQK A;  3BVG A;  2SNS A;  3GO5 A;  4LFC Q;  1CA6 A;  2UUA L;  2DGY A;  3AU7 A;  4IJH A;  4JVZ A;  5NUC A;  4LFB L;  3EQL C;  1C8C A;  4QY7 A;  4LF4 L;  4C3J B;  1LV9 A;  4KJO A;  4RGM A;  1KDC A;  4R1J A;  1WCM B;  4DK6 C;  2XSC A;  4DV7 Q;  4DR2 L;  2J4X A;  3S17 H;  4RCO A;  2V4D A;  3H94 A;  2QEJ C;  1LT6 D;  4K14 A;  4AYB G;  3HOY H;  5IP9 G;  1K0S A;  3DM1 A;  1ZYR D;  3NPP A;  3T13 A;  2KCM A;  2F0V A;  4A3K B;  1PYB A;  1L1O A;  3DM3 A;  1JC7 A;  1CHP D;  2K14 A;  5CMD A;  4JI6 Q;  3HOV H;  3S14 H;  4BY1 H;  1FGB D;  1HQR D;  1WTO A;  1NCV A;  2EY5 A;  4Y52 H;  2B2W A;  3V05 A;  3M4P A;  3IL8 A;  3QOL A;  4CDC C;  3T1Y L;  1SDF A;  1U5K A;  4DF7 A;  2UXB L;  4DK0 A;  1LT4 D;  3P7J A;  1ESF A;  1CA5 A;  1D5M C;  1X32 A;  2Y0S B;  4B9W A;  1KRT A;  4OX9 L;  4PZ6 A;  5IT9 c;  5C4X H;  2DNC A;  3M7G A;  3J81 E;  1BCP C;  1ONL A;  4YWM A;  3SEB A;  1PFN A;  2F0O A;  1ILQ A;  1XNQ L;  4G7Z C;  2GVA A;  2E5L L;  3ONA B;  2SEB D;  3E0J A;  2EY6 A;  3E6Z X;  3K8A A;  1SBB B;  3BYT B;  1CKN B;  4IO9 A;  1VQL A;  2A5H A;  1S3O A;  2IX1 A;  2F3V A;  4LF6 L;  4HAE A;  3K0X A;  3KDF A;  5IGB A;  2E2D C; 
#chains in the Genus database with same CATH homology
 4CJ1 B;  3ND8 A;  4DN4 M;  1OXS C;  3K59 A;  4DAP A;  4DA2 A;  2MUY A;  2EE1 A;  2EYO A;  1Y8O B;  2G9D A;  3GTQ B;  2KEE A;  3PUZ A;  5I2Y A;  3VYS A;  1KAA A;  1QE6 A;  3MVV A;  1WTV A;  2XNA C;  5CBE E;  2A68 D;  4PMW A;  1SYE A;  1HPC A;  1IL8 A;  5C0X G;  3C1F A;  5AFW A;  2F0D A;  1SNM A;  1HCZ A;  2IL8 A;  4CJ0 B;  2F0W A;  3PUX A;  1TII D;  1SJE D;  2B2Y A;  4FVM A;  1NAP A;  2X6L A;  3HOU B;  1RF2 D;  3I4M B;  1E2Z A;  2L55 A;  3VR6 A;  3MWY W;  3A7L A;  4PNY A;  1TWF B;  1VF5 C;  1STB A;  5EBC A;  2BDO A;  2Z4I A;  3MEH A;  3LWU A;  2F0P A;  2PZU A;  5C3E B;  2E2H B;  1EFI D;  2F0H A;  1PTO H;  3NBI A;  5C3W A;  1GUN A;  1MSG A;  3L9A X;  4XQN A;  2J0T D;  1ENF A;  1I4R A;  4HMI A;  1H9M A;  1TR5 A;  5KRU A;  1LTB D;  2OXP A;  2WB1 B;  3H91 A;  4NKL A;  1I4Q A;  1R9T B;  2ZXO A;  3U9O A;  5HGT A;  4G7H C;  2EYH A;  5CV5 A;  1EQT A;  1A3U A;  2Q8T A;  3HRZ C;  2EJG C;  1ENC A;  1M4V A;  1ET6 A;  3J80 L;  2WII B;  1I3Q B;  2B2T C;  3KBG A;  2F0L A;  1KDA A;  1HA5 A;  3Q0A A;  1JOQ A;  4IAL A;  1K83 B;  2PW7 A;  4OL7 A;  3MXU A;  2FJ2 A;  4BA1 I;  1GUW A;  1SYF A;  1PTO C;  4I7Z C;  3T4A C;  2KED A;  4Q0F A;  1EYD A;  2IX0 A;  1X3P A;  5IOC A;  1OXT A;  3HG9 A;  3NWT A;  4KV6 A;  3KLS X;  2R61 A;  3BG3 A;  1B2T A;  4OO1 I;  2BCO A;  1SFO B;  3I91 A;  3VR4 A;  3HZX A;  1FNV A;  4N9P A;  2A68 C;  2K05 A;  3HS0 C;  1GHK A;  3Q24 A;  3L7Z C;  2F0F A;  3S2D B;  1HFG A;  4YIJ A;  1EWC A;  1D1I A;  2RBM A;  1WTP A;  1AZQ A;  1JWS D;  3KLR A;  2WAC A;  2L12 A;  3SE0 A;  3OIQ A;  2EYP A;  2K1B A;  1IW7 D;  2MJ8 A;  4HTH A;  3FDT A;  3WOF A;  4DFA A;  1H9K A;  1ESR A;  1Q8I A;  5M3M B;  2EJF C;  1LTI D;  1CM9 A;  2B63 B;  1TS2 A;  3S1M B;  2PO4 A;  3T16 A;  3DEO A;  2DY7 A;  5FOB B;  4K8I A;  4A3G B;  1BCP B;  1AEX A;  1D1K A;  2B2V C;  4KTA A;  2BE5 D;  2EYF A;  4J8Q A;  2WKC A;  4IUV A;  2HDL A;  4J6H A;  2L0C A;  4IUU A;  5DNF A;  5KNB A;  1S5F D;  5TSS A;  5CV9 A;  3FPP A;  2PZW A;  2F4I A;  1Y69 U;  3KK7 A;  1D5X C;  4XTC S;  3S17 B;  3HOY B;  1TY2 A;  1EYA A;  4DGZ A;  2EZV A;  1RHP A;  5K36 G;  2FFK B;  2ENB A;  3HOV B;  3S14 B;  4BY1 B;  1MSH A;  2EVB A;  5CV7 A;  4JBW A;  1WTR A;  3NHH A;  1Q90 A;  4IFD J;  3P20 A;  2A6E C;  5COY A;  4KJN A;  1FNU A;  2EPB A;  3MA2 B;  2F0Q A;  1SYB A;  5C4X B;  2NN6 H;  3H09 A;  4DK1 A;  1E2W A;  4QIW B;  4R8N A;  3R2T A;  2PPB C;  5BN4 A;  2ZT9 C;  1H9S B;  3CRL C;  2KCN A;  3MHB A;  3HGB A;  1D5Z C;  2B8F A;  5I6W A;  2MHV A;  2H1E A;  1E2V A;  1GUT A;  1NSN S;  4X3T A;  4B9X A;  4XT3 B;  4FO2 A;  2CVR A;  2EYL A;  1BO0 A;  2R6G A;  4KN7 C;  1UEA B;  1SMY D;  5JOB A;  5CV8 A;  1OXX K;  5DM7 3;  2KJX A;  4ZKC B;  4A93 B;  5EKL A;  5JJZ A;  4BBR B;  4L6T B;  1IKL A;  1LTG D;  1WD0 A;  3DMU A;  1PRT D;  3O13 A;  2EYJ A;  2PQE A;  5C5M A;  2EJM A;  3GV6 A;  5M5X B;  3E5S A;  3RZO B;  2WIN B;  2K01 A;  3MTS A;  1TY0 A;  1ZKO A;  2DY8 A;  2NVY B;  4KD4 A;  4XYO A;  4ABN A;  2I46 A;  5E3F A;  3NUC A;  3IAY A;  1EY7 A;  3LWE A;  1G6Z A;  4EQN A;  2KEC A;  3GV3 A;  5A2Q E;  5KGU A;  4KI0 A;  3H3V C;  2L11 A;  4LAA A;  2BE5 C;  1TWH B;  3I72 A;  2K7V A;  1PTO B;  2VB3 X;  4IUN A;  1DJR D;  1R4Q B;  1DYQ A;  2JA7 B;  1ICW A;  5D3D A;  5IT9 E;  3PO3 B;  4RH6 A;  5EGT A;  3M4Y A;  5JPM C;  5M5Y B;  3PUW A;  1B53 A;  1KAB A;  3G7L A;  1A6X A;  1GJX A;  2XRQ D;  2PCF B;  4XDX A;  3ERO A;  3H0G B;  2HDM A;  1QNU A;  5EKI A;  4C3I G;  4LK1 C;  5ISR A;  4K2L A;  2LS0 1;  1KNE A;  4ID6 A;  4CKC A;  3RZD B;  2AUJ D;  1Q1E A;  3QIA A;  1IKM A;  1TVX A;  3I90 A;  1I4G A;  2F0K A;  2CW0 D;  3SK8 A;  2DNE A;  1V1O A;  5CYU A;  1G2T A;  1S5B D;  4PMB A;  3DEP A;  4TSS A;  3TBI B;  1K8M A;  1U4R A;  2K04 A;  3MFG A;  4CJ2 C;  2A69 C;  1GOZ A;  3D4W A;  4DXG A;  3EA6 A;  2NVX B;  4X3K A;  1MI2 A;  2K6A A;  1MBY A;  5COR A;  1KTK A;  1AW7 A;  3BDL A;  1ET9 A;  2R93 B;  2EOT A;  1EU4 A;  1SYG A;  2XIW A;  1HUM A;  1BQQ T;  1C4Q A;  4ZYS A;  2F03 A;  4K8J A;  5JVH 3;  3MXP A;  2O5J C;  4C3H G;  3OOC A;  1Y1W B;  1JR0 D;  2Z1C A;  1C48 A;  2A6H C;  3J81 L;  3A7A B;  1KLU D;  1AFP A;  4K2K A;  3RUZ A;  1SNO A;  1Y1V B;  3BVZ A;  1EY4 A;  2O5I C;  1QNK A;  2B2Y C;  4LMQ D;  1W6J A;  2MP1 A;  1NUC A;  1F2L A;  1I6V C;  2B8G A;  3C2P A;  4ME5 A;  3OMG A;  2AWO A;  4PV1 C;  4A3B B;  5CV4 A;  3FVQ A;  3SK6 A;  1WTQ A;  5JEA G;  5I9O A;  3MC0 B;  4F87 A;  3FEW X;  4DU9 A;  2KQ3 A;  3HEJ A;  4NP5 A;  5C4Z A;  4JK1 C;  3RD4 A;  3EFX D;  3FRP B;  4K5X A;  1MD2 D;  4FXD A;  3BS1 A;  1NR4 A;  5CC4 A;  5IGD A;  1YNN D;  2RSO A;  1S5E D;  1XWE A;  1F9P A;  3URY A;  4WRD A;  5C0X J;  4C1N I;  1UNS A;  3QG1 A;  1ILP A;  2KUM A;  3DHQ A;  4A3J B;  2JA6 B;  1V8Q A;  1CI3 M;  1BF4 A;  3CU7 A;  3R3O A;  4ZKB B;  4QCL A;  5DEH A;  4FNF A;  4HED A;  4MN3 A;  1TWA B;  3S1Q B;  3T51 B;  3P75 A;  2CW0 C;  1H9R A;  3V2T A;  1V1P B;  1A15 A;  1EYC A;  1AP0 A;  3U9S A;  3OPO A;  4OGQ C;  5C0X H;  3SDZ A;  1JCK B;  4FYD A;  2NB0 A;  4UDU C;  4FF4 A;  3QB3 A;  4Q5V A;  2A74 C;  4BS9 A;  2KOL A;  3IFT A;  5EKK A;  4C56 C;  2SNM A;  4ZUI A;  2L1B A;  5D14 A;  1A2U A;  2QDB A;  1SYD A;  2QCP X;  5FLX L;  4X3S A;  4CBV A;  1SNP A;  4G7O C;  4MHE A;  3QJY A;  3SR1 A;  5I2X A;  4A3F B;  4QUC A;  5IOD A;  1G29 1;  1RTN A;  4HCE A;  4RWS C;  5C4J B;  1BXT A;  2X6G A;  4Y7N B;  4E6I A;  4IUQ A;  2QKI C;  5FO9 B;  3SVM A;  5CBA E;  5D3I B;  2R3Z A;  3NTI A;  1F77 A;  1ZEQ X;  1J8I A;  3HOZ B;  1IHZ A;  3PIP 3;  4KKU A;  2XN9 C;  2YYZ A;  4IN3 A;  4KMU C;  3QO2 A;  4RKL A;  3PIO 3;  2JSO A;  2VXW A;  3C3L A;  1ZYR C;  3SK5 A;  3D8G A;  4WOR A;  4O1N A;  1VDZ A;  5EPK A;  1Y8N B;  2D9U A;  1B9N A;  4KKT A;  5CR3 A;  4R9W A;  1HTL D;  1DZ1 A;  5FO7 B;  4MIU A;  1QB5 D;  5JAV A;  4A3E B;  2HUG A;  5FO8 B;  1SAP A;  4FXK C;  2CHB D;  3S1N B;  3I73 A;  2WAQ B;  2IWH A;  4A3M B;  5LL6 X;  3KLS A;  3C46 A;  4DAV A;  4A3D B;  1LTR D;  2M00 A;  4HR7 B;  4Z9C B;  2FMM A;  3N52 A;  2KVM A;  3DWA A;  2K32 A;  3A56 A;  4K6D A;  3A8J E;  1XXG A;  3BDC A;  1SXT A;  3CRK C;  4BWG B;  2J7Z A;  1EY5 A;  1T5X D;  3JAM E;  1U4M A;  2F0E A;  1A3T A;  1QIL A;  2JXM B;  5KYI A;  2BDN A;  2NBF A;  1SEB D;  1VMC A;  3TZU A;  1DXM A;  4RGT A;  3T56 B;  3J7A V;  3MXG A;  2X69 A;  1CZG A;  1SE3 A;  1WVL A;  3KF8 A;  2PZT A;  4NDX A;  2D5D A;  3RMH A;  1ML0 D;  2Q8R E;  4N9T A;  4OO1 G;  1SJH D;  4C3J G;  4H7B A;  2VB2 X;  4UAI A;  3A8K E;  4ODG A;  2A73 B;  3J7Y W;  3K5L A;  2F0N A;  2ZXR A;  2XWB B;  1PXU A;  2XWJ B;  2RDF A;  1JIC A;  1ZXT A;  1EZ8 A;  3TP7 A;  1EY0 A;  4U68 A;  5C6A A;  1HQM C;  2JEB I;  1LTA D;  2NUC A;  1B1Z A;  4OIK A;  1I4H A;  5E4X A;  1DOM A;  3R8B A;  1PFM A;  1SNC A;  1CT1 D;  1L0Y B;  3NK9 A;  4AYB B;  4KN4 C;  2NN6 I;  1Q1B A;  4X3U A;  1EIH A;  2N55 A;  1GUG A;  1I4P A;  4KY5 A;  2ZXP A;  5KIX A;  3R2I A;  3CKI B;  5J39 A;  3V96 A;  3A54 A;  5J22 A;  3ZYY X;  4IFD I;  2E76 C;  5A35 A;  1QOH A;  3VA7 A;  1U4L A;  3K57 A;  1J9O A;  3VR5 A;  3J7A F;  2RA4 A;  3DWP A;  2NTS A;  3DUZ A;  5LHY 1;  3PUV A;  1TS5 A;  3EVQ A;  2RSN A;  2NYZ D;  5KNC A;  4ZAI A;  2BOS A;  5EPL A;  3HOX B;  2C9O A;  5A2Q L;  2NVQ B;  1R4P B;  2M9V A;  3WDN A;  1DON A;  1FNW A;  1EIG A;  2SDF A;  1CQV A;  2RDG A;  4DXF A;  3D31 A;  4XIG S;  4WJW A;  4IFD G;  4ZRZ A;  1DOL A;  4EQP A;  4IUT A;  3OWF A;  2E2J B;  3SHL A;  3TSS A;  4ILW A;  1IW7 C;  3FKI B;  1T5E A;  1RDP D;  4CHT B;  4KD3 A;  1HXY D;  1CFM A;  1QG7 A;  2F0G A;  1JOK A;  3Q6S A;  4R8I A;  4L63 B;  1CQF A;  1EL0 A;  5I6Y A;  5JVG 3;  1RJT A;  1STE A;  3S1R B;  2E2I B;  1PFB A;  5EQ0 A;  3DWQ A;  5IIF A;  2K5Q A;  5EPJ A;  4QF4 A;  3BVM A;  4HN7 A;  1I4X A;  2YU9 B;  1ROD A;  3GTL B;  2WV6 D;  3I4L A;  5T1G A;  4S3S A;  1IYU A;  1JB3 A;  3TME A;  2B2U C;  5IGF A;  1BCP D;  4PMC A;  4XYQ A;  3MZ5 A;  1HFN A;  5I4D A;  3PO2 B;  3D6C A;  3ERQ A;  2TMP A;  4KHV A;  1MGS A;  2LKV A;  4TQU S;  4F7X A;  2D62 A;  1HA6 A;  3QOJ A;  3NP8 A;  3T53 B;  3K6O A;  3LNN A;  1BCP F;  3A8I E;  2F3W A;  4IZ8 A;  3K7A B;  1O7Z A;  4PQX A;  4FF2 A;  4H44 C;  2G9H D;  4OIJ A;  3WOE A;  1UAP A;  1FR3 A;  3ND9 A;  2RQX A;  1XX8 A;  2KCC A;  5ELE A;  2M2L A;  1WTX A;  3HOW B;  4F8M A;  1XYI A;  3ITP A;  2VNU D;  5JEA J;  2RDH A;  1PZK D;  4ZLT F;  1VMP A;  1H9J A;  1SMY C;  5T1I A;  4XXE A;  2QIL A;  1TQO A;  3GP7 A;  2F1M A;  5G3L D;  1OO9 B;  2JA8 B;  2PMZ B;  3PMF A;  1PRT C;  3GQB A;  3R93 A;  2H4O A;  5EBD A;  5E4W C;  5JEA H;  3BDO A;  3BZD B;  3D6W A;  4XQQ A;  4RCN A;  5G3L F;  1EY9 A;  3VYU A;  1B44 D;  4I65 A;  4RHS A;  2EDG A;  3TP6 A;  2B2U A;  4CGY B;  1VCI A;  4NMZ A;  2MPM A;  4NW2 A;  1HUN A;  1B9M A;  2PNR C;  3RLF A;  2AUK A;  1CK1 A;  3Q23 A;  2LFN A;  4HMJ A;  2ID0 A;  4WFN 3;  2F0M A;  4KY6 A;  4M1U B;  4G4K A;  4V19 0;  1STH A;  1O80 A;  2RVL A;  2OEO A;  3DXJ C;  1SE4 A;  2LMC B;  1F9S A;  5C0X I;  3MXN A;  3K58 A;  2L9H A;  2AQ1 B;  3TDQ A;  1BBX C;  2PYK A;  1PTO D;  3PUY A;  2BA1 A;  5LL6 S;  1Y8P B;  4HSP A;  4IQZ A;  3NTK A;  4BBS B;  1OXV A;  1EWH A;  2N88 A;  3OHX C;  3G6J B;  2K03 A;  3OWE B;  1GXD C;  3N6R A;  2Z8L A;  1PTO F;  2ICE C;  1PMR A;  4C2M B;  4DNR B;  1KNA A;  5DM6 3;  2K28 A;  1JWM D;  4M8A A;  3C1E A;  1RTO A;  1JOO A;  1STG A;  2F0S A;  1Z47 A;  5BN5 A;  5J1Z A;  2F0J A;  1JQY D;  4EQO A;  3TP5 A;  2NTT A;  3VYT A;  5I9P A;  4H0L C;  3X3M A;  2XRS D;  1AN8 A;  5DAU A;  3FPU B;  5BN3 A;  4CKB A;  3AB9 A;  5KEE A;  2RKS A;  2FIN B;  1LT3 D;  3S16 B;  3W2D A;  1LLR D;  1A3V A;  4HCS A;  1BDO A;  2NWG A;  3I3C A;  3W3A A;  2O2L D;  1CTM A;  3QWN A;  4FXG C;  3OMC A;  2IJ0 A;  3OSO A;  2FHT A;  1SSO A;  1PZI D;  2VUM B;  4QMG A;  3D4D A;  4H13 C;  2K5W A;  4RKB A;  3SK4 A;  1I6H B;  3NTH A;  3JAM L;  2JP1 A;  1LAB A;  5C5L A;  2GA4 B;  2KA7 A;  1LTT D;  3GTK B;  1VF7 A;  2E74 C;  1BOS A;  2JYO A;  5IGC A;  2L5T A;  2SOB A;  1D6E C;  5KND A;  3A55 A;  1IYV A;  2JA5 B;  4RA8 A;  5JPN C;  1YNN C;  3M7N A;  4K6L A;  5FLX E;  1RCV D;  1HRJ A;  1U9R A;  3VR3 A;  1EY8 A;  2JE6 I;  5ELD A;  5EJW A;  1PDQ A;  4J1M A;  4TKO B;  5K5P A;  4XQJ A;  2NVT B;  3MFY A;  2HCI A;  2AQ3 B;  2A6E D;  3GTG B;  3D4R A;  3NQI A;  4KK7 A;  3I70 A;  1BUV T;  2AWN A;  4BY7 B;  3KUP A;  1TU2 B;  4C3I B;  1RD9 D;  2XVS A;  4EVO A;  1Z6H A;  1BR9 A;  1S5C D;  1H9S A;  1PRT B;  1CZW A;  3AMU A;  1ENA A;  1OXU A;  4QUF A;  4RHR A;  3J80 E;  2BA0 A;  4CKE A;  1LT5 D;  1KLG D;  3BYY B;  4O42 A;  3NE5 B;  4ULL A;  4IUR A;  4OO1 H;  3CQZ B;  4GZY C;  4DAY A;  1TKW B;  3CHB D;  1PZJ D;  3EJI A;  5FKA C;  2Z4H A;  4C3H B;  4EGV A;  5ELF A;  1B3A A;  3K0Y A;  3K5O A;  5FK9 C;  2LY7 A;  1DM0 B;  4FF1 A;  3GTP B;  5M9O A;  2WKD A;  2C5C A;  4RAU C;  3Q22 A;  3GTM B;  2MGS A;  1EOT A;  3L3O C;  3TN2 A;  4B08 A;  1I50 B;  2B2T A;  2DN8 A;  1K8O A;  5K36 H;  5HUR A;  3SXH A;  2EYM A;  5E1F A;  2OF1 A;  3S9W A;  4QB4 A;  2IT1 A;  3OW7 A;  3NQT A;  3IFD A;  1U4P A;  2L4N A;  1Q12 A;  4OHJ A;  1STY A;  1PLF A;  2JEA I;  4KHZ A;  1PYW D;  5M3F B;  3VR2 A;  1B50 A;  2CQA A;  3OIP A;  1F2Y A;  3TZD A;  2D2C C;  2O4X A;  1GUO A;  2Q8I B;  2F0T A;  1YNJ D;  4FP5 D;  4ZK9 B;  1G8Z D;  2IX3 A;  1F2Z A;  1V43 A;  3LX0 A;  1AZP A;  4K5W A;  2FMC A;  5M5W B;  3D3R A;  5F2D A;  1TS3 A;  4G57 A;  2AQ2 B;  1X3Q A;  1O7Y A;  2NN6 G;  2A69 D;  3MAQ A;  2NZ1 D;  4KY7 A;  5IGG A;  3M85 A;  2I07 B;  3M4O B;  2EXZ A;  4A3I B;  1EQV A;  2F0I A;  1F9Q A;  1DCZ A;  4IFD H;  5IT9 L;  1II3 A;  5CV6 A;  5ELC A;  1EY6 A;  4V0B A;  5C3X A;  3P1H A;  3S15 B;  1LAC A;  1FD7 D;  1JWU D;  4C1N K;  4IUP A;  1DOK A;  1EEI D;  1G91 A;  4RGN A;  3NBH A;  2A6H D;  2IW3 A;  4ZQ3 A;  1BNZ A;  1SND A;  2KHS A;  1E0B A;  1FYC A;  2HQE A;  2PW5 A;  1SYC A;  4TRD A;  4DNT B;  4K5V A;  1W6K A;  2B2V A;  3H6M A;  3K5N A;  1LO5 D;  3FMC A;  1F2M A;  3GTO B;  1S4Z A;  1HHV A;  1DD2 A;  3F2U A;  1QWY A;  3VYR A;  3UI2 A;  2QF7 A;  5ELB A;  5D65 A;  1STA A;  1D2B A;  3K5M A;  1PRT F;  1G2S A;  2IPK D;  3X3N A;  3NWS A;  2OT2 A;  3TP8 A;  1TS4 A;  3S2H B;  5IGE A;  1CHQ D;  1GHJ A;  1STN A;  2HCC A;  1WD1 A;  3IKJ A;  4XT1 B;  2EY1 A;  2K33 A;  3I8Z A;  1HTP A;  1B4O A;  4RFB A;  1S5D D;  2B2W C;  5C4H A;  1EEF D;  1Q3L A;  5C44 B;  4LJZ C;  4RGO S;  4U67 3;  2ICI A;  1YNJ C;  1O78 A;  3HP3 A;  3GTJ B;  3VA5 A;  4FF3 A;  2B39 A;  1L0X B;  1M8A A;  1SE2 A;  3M3Y B;  5CGK A;  1TWC B;  1QJO A;  2EY2 A;  1V1P A;  4F88 A;  1QCB D;  3PV0 A;  4L8J A;  1WTW A;  1EU3 A;  2E75 C;  3KBX A;  1JOR A;  2WP8 J;  1TT2 A;  4HSV A;  1GUS A;  3HKZ B;  2F0U A;  1F9R A;  1Z7T A;  1O7L A;  1SNQ A;  3NXW A;  1A2T A;  2R7Z B;  4BA2 I;  4KKS A;  4P2C B;  2K5D A;  1RKN A;  2TSS A;  3NSW A;  2R92 B;  1LTS D;  1NR2 A;  1KDB A;  4ZUJ A;  1UUP A;  3GD7 A;  1JE4 A;  3I4N B;  1EZ6 A;  1TWG B;  5KYL A;  1XTC D;  3BVG A;  2SNS A;  3GO5 A;  1CA6 A;  3AU7 A;  5NUC A;  3EQL C;  1C8C A;  4C3J B;  1LV9 A;  4KJO A;  4RGM A;  1KDC A;  1WCM B;  2XSC A;  2J4X A;  4RCO A;  2V4D A;  3H94 A;  2QEJ C;  1LT6 D;  4K14 A;  3DM1 A;  1ZYR D;  3NPP A;  3T13 A;  2F0V A;  4A3K B;  1JC7 A;  1CHP D;  5CMD A;  1FGB D;  1HQR D;  1WTO A;  1NCV A;  2EY5 A;  2B2W A;  3V05 A;  3IL8 A;  3QOL A;  1SDF A;  4DF7 A;  4DK0 A;  1LT4 D;  3P7J A;  1ESF A;  1CA5 A;  1D5M C;  1X32 A;  2Y0S B;  4B9W A;  2DNC A;  3M7G A;  3J81 E;  1BCP C;  1ONL A;  3SEB A;  1PFN A;  2F0O A;  1ILQ A;  4G7Z C;  3ONA B;  2SEB D;  3E0J A;  2EY6 A;  3E6Z X;  1SBB B;  3BYT B;  2A5H A;  2IX1 A;  2F3V A;  5IGB A;  4HAE A;  2E2D C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...