3MXGA

Structure of shiga toxin type 2 (stx2) b pentamer mutant q40l
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
70
structure length
70
Chain Sequence
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLLSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Shiga-like toxin 2 subunit B
publication title Molecular basis of differential B-pentamer stability of Shiga toxins 1 and 2.
pubmed doi rcsb
source organism Escherichia coli
total genus 18
structure length 70
sequence length 70
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mxgA00
1QOHA 2XSCA 1DM0B 4P2CB 2BOSA 1D1KA 1R4QB 1CQFA 1BOSA 4ULLA 3MXGA 1D1IA 1C4QA 1QNUA 1C48A 1CZGA 2C5CA 1CZWA 2GA4B 1R4PB 4M1UB
chains in the Genus database with same CATH superfamily
4HCSA 2AWNA 1OXXK 1QOHA 2I5LX 4AYBB 4R4TA 1F9PA 3RMHA 1IHZA 1B9MA 1VQ7A 1A2UA 1JWUD 3CU7A 2IY5B 1SRUA 1VQIA 1QG7A 3OOCA 1LYLA 3AFQA 4NXNL 4IFDJ 5IIFA 2EYOA 3PF5A 2EYHA 4FF3A 4C3HB 1Q90A 1JOKA 2A8VA 4MNOA 3H09A 4I7AA 1I50H 4NB3A 2VQFQ 1GVPA 2IL8A 3HP3A 4HTHA 1A3UA 1AN8A 1ET9A 4GKKL 1AH9A 2JQOA 5ELEA 1Y1VH 1ESRA 1WYDA 4FF1A 1JCKB 2F0JA 2CQOA 5IGFA 5I2XA 1SNQA 5DM63 1PTOH 1B9NA 1K83H 2JA9A 3GTKH 4IN3A 4GLVB 3H15A 3OTOL 4KHZA 1LLRD 4R4IA 4HJ8A 2K4KA 1WI5A 4QGUA 2O2LD 2B39A 1I50B 4H02A 1QNKA 3VR2A 4ZYSA 3HZXA 1ZXTA 1RD9D 1HA6A 2I5HA 5T1IA 1PMRA 2EZVA 1VQLA 4KKSA 1TY2A 1BBXC 3PMFA 1EU3A 1PFBA 5DLQE 3ULPA 1Y1VB 5JPNC 3I56A 4DUYQ 5FK9C 3U50C 4NXML 4H7BA 2JEAI 1G6ZA 1D6EC 5C4ZA 1U4MA 1XTDA 1PTOB 5IE8A 1XMOL 1EFID 1K83B 4EGVA 4IFDI 4N8X1 3GTKB 1F2YA 1L0YB 4KY5A 1G6PA 1XWEA 1XNQL 1TWHH 4K8IA 1D1KA 1EIFA 4DV2L 2CKZB 3I4LA 2CW0D 4U673 4LF8L 4XQNA 3D8GA 4B3RL 2MP1A 4L5QA 1EWCA 1KDCA 4LF9Q 4GNXB 5LMUL 3TBIB 2F0PA 1VQHA 3KLRA 1KAWA 2B2YA 1T5EA 3HKZE 1VQGA 1JQYD 3ZJYC 2B2WA 2A6HC 3MFGA 4JVZA 4RHSA 1TWHB 2PNRC 3QB3A 3C46A 2WB1B 5DEHA 3AEVA 4GN4B 4YHHL 4X3UA 3M9BA 4JI6L 4YCWA 4DV0L 1VQ8A 3CMEA 3TZDA 2E5LQ 1LTAD 3FEWX 3A74A 1Q1BA 3T13A 1HZAA 3GTLB 5IYCG 2E2IH 1SBBB 3NP8A 2C9OA 4CKBA 2R7ZB 1PDQA 5DNFA 4ALPA 1A3VA 5C0XJ 3P1HA 1CA6A 1DCZA 4A3JH 4DR6L 2ZXPA 3MZ5A 4LFCL 2IX1A 1E2ZA 2B2TA 1IBLL 1PFMA 1BUVT 5M3MH 4KJOA 2ALYB 4Y7NH 4UP8A 1EIGA 2KBNA 2YV5A 5HURA 1BF4A 4LFBQ 1GUTA 3HOZH 4DV5Q 3CHBD 1WTQA 1LABA 3A8JE 4DNIA 2E2IB 2QDBA 3K8AA 3K57A 3R93A 4BXXG 5JJZA 2JSOA 3E9HA 1Q3LA 1LTRD 2KUMA 2Z6BA 4ZK9B 3BZKA 3P75A 2CH4W 4HMIA 4UDUC 1YNJC 3OIQA 3N6RA 1Q1EA 1E1OA 1SE4A 4NP5A 2EJGC 1IYJB 4BY7H 1Q46A 2JYOA 4LAAA 1EY4A 2LS01 5ELOA 2WAQG 4QL5A 5M3MB 1IYUA 4Y7NB 1U4PA 2B2UA 4UHVA 4UY8C 1G51A 3DEOA 2PW7A 1I6HH 2EQSA 1GUGA 5FJ8G 4C3IB 3HOZB 1I3QB 1BVSA 1PLFA 1KLGD 4U68A 3GDEA 3CF5A 5C0XI 2RHQB 2EPBA 2N8NA 1ZKOA 2CQAA 3MWYW 2F3VA 2DN8A 2ZTDA 4UP9A 1HZBA 2RA4A 1K8MA 3KUPA 4FO2A 2M2LA 4YWKA 3RZOH 4BY7B 3AFPA 3A54A 1L1OA 3S2DH 3PO2H 2AKWB 1S5DD 5CORA 1STGA 1I6HB 1RKNA 2NVQH 3E6ZX 3KBGA 1DD2A 5ISRA 2L5TA 4B3SQ 4HAEA 3HKZB 3CRLC 3AYHB 3IFDA 1IL8A 5AJ3Q 4L5RC 4QUFA 3MXNA 1E7ZA 3OSOA 1ILPA 1QCBD 4ZUJA 3SK4A 2FMCA 1B4OA 3H3VC 4IUTA 1NMFA 1VQDA 2DJFC 1IXRA 4AQYL 4C3JG 2VUMG 3EJIA 1IKLA 2NN6I 1KQSA 3RZOB 3LNNA 1N33L 2PQAA 2EJFC 3G6EA 3CCLA 1K9MC 5KNDA 3PUVA 3S2DB 3PO2B 2IHFA 1JOOA 5M5WH 1SYGA 3HRZC 4NKLA 2L15A 1CTMA 2NVQB 1SNMA 4ODGA 4JBKA 2A6EC 4A3GG 1TT2A 2K5DA 1KDBA 2ZT9C 2HHHL 3A55A 5JEAG 1HA5A 3NELA 1PXUA 5IYBG 3F2DA 1CK1A 2A69D 1I94L 3CCEA 3MXGA 3RLOA 1RTNA 3P20A 3GP7A 4KI0A 1HNXL 1HNZL 2N78A 2R93G 1NBWA 2PW5A 1DGSA 3S1QH 4Z9CB 4LF4L 5G3LD 2L9HA 3S17H 4LFAQ 1HFGA 5CGKA 2O5JC 2MPMA 4YY3Q 1PYBA 1P8LA 3J7AV 5BR8Q 4WJWA 4KJNA 5M5WB 1S72A 1PHJA 2K75A 4ILWA 3FHWA 1SXTA 5IP9G 2BH8A 1PFNA 1MBYA 2L0CA 2EYLA 1MJCA 4DR1L 1KLUD 1WTXA 4A3MG 1S5CD 1M8AA 4DR4Q 2B2WC 3S1QB 3ND9A 5M3FG 1YNNC 3I8ZA 2F0GA 2F0IA 1I4RA 1EZ8A 4K6LA 1B3AA 4GZYC 3S17B 3DWPA 4IALA 3H6MA 2LFNA 5C4HA 2JP1A 2UUAL 4JK1C 3KF8B 3NBIA 4N8FA 4K5XA 4QIWE 4RGNA 2C35B 3I70A 4BWGB 2A69C 1SNPA 1JICA 2MHVA 4X65L 4QQBX 3VR4A 2IPKD 5C3EG 3I73A 4I7ZC 5C4JH 1RCVD 5M5XH 1I5FA 1Y1WH 1GM5A 1STBA 1LT3D 3CP0A 4UPAA 1UNSA 1EYCA 3H3VI 4HSVA 2HIXA 1NTGA 2KEEA 3I4MG 3UDGA 2RDHA 1SJHD 5FLXL 2UU9Q 1KRSA 2Z4IA 5C44H 2L1BA 1HFNA 1SYEA 4GOPB 2N88A 5J22A 2M9VA 2VQFL 2CWAA 3H94A 4IPDA 3X3MA 1F9QA 4X62Q 1PH6A 1EY7A 1EY9A 4G7OC 2PI2E 4JW0A 1TS3A 3TS2A 1YJWA 1VQJA 1OXVA 4R8NA 5C4JB 1C48A 3T51B 5M5XB 2YTVA 1EEID 4BBSH 1FNUA 1Y1WB 1MJEA 2MO1A 4DR5Q 2B2UC 2WKDA 3DM1A 1B3QA 3NHHA 4A93H 4HCEA 5C44B 4QUCA 3SXHA 1STYA 2Y0SG 3FKIH 1Y69U 4DFAA 4L5TA 3I3CA 1JT8A 3R3OA 1EU4A 3V96A 3C3LA 1PV4A 1WTOA 2CHBD 1T5XD 2ZTEA 1NR2A 5IGGA 5D3IB 1Y8PB 3CMAA 1X3FA 1EEFD 4EVOA 3HOYB 4BBSB 4DUYL 1IBMQ 4BS9A 1RODA 3NK9A 4DR7Q 3VYRA 2OQKA 2K28A 1N32Q 2F0HA 1SN8A 3H91A 4A93B 2RBMA 2A68D 3JAMi 1AEXA 2KCTA 3FKIB 1YI2A 1A2TA 2JA7B 3E3XA 1TS5A 2OTLA 1H9JA 1Z47A 3QO2A 2KCNA 3DXJC 3MTSA 1BR9A 5G3LF 2JA8B 5JPMC 1ET6A 5IP7G 4LF9L 2L12A 2XSCA 3CCRA 5KYIA 4FF2A 2UXBQ 1XPUA 4KD4A 1O80A 4DV3L 1JB7A 1B44D 2TMPA 1PH4A 1RIPA 2A73B 3F2CA 3TEHB 4TRDA 3LWEA 1CZGA 4K2KA 1O7IA 3WOFA 4QIWB 4A76A 4JBMA 3HS0C 5CBEE 5C4XH 5IY0A 4KHPQ 3CXCA 3PIPA 5FLXE 4FVMA 5EKLA 4B9XA 2XTIA 3WOEA 4J1MA 2E5LL 2V4DA 2VZAA 4O42A 1BCPC 4A3DH 4WJ3M 2NYZD 5C0XH 4XT1B 2F0WA 5FLMH 4OELB 1NNXA 3EQLC 5JEAJ 1F9SA 4F88A 4V190 3A5ZB 4GN5A 1DJRD 1XJVA 4FF4A 4JI4Q 1OXSC 3QIAA 1SYCA 2RCNA 4XQQA 1JC7A 1CHQD 2F0MA 2NVTH 3VYSA 1FGUA 3BS1A 3PV0A 3J81j 3DHQA 1D2BA 2K14A 5C4XB 1DXMA 4KK7A 2RCFA 2F0DA 3BVMA 1QZGA 2VNUD 5EBCA 3BYYB 2JA6G 3GTJH 3EVQA 4L63B 4LFBL 2PCFB 2G9HD 1YVCA 4DV5L 4P73A 1G2TA 4X3SA 4A3DB 3J81E 3TZUA 1QUQB 2QDLA 5E4WC 5CMDA 1CZWA 1WTHA 1D5MC 5A2QL 3D6WA 4H44C 4F7XA 4B3MQ 2NN6H 3OPOA 5FOBB 5K36H 1DM0B 2NVTB 1V43A 3GO5A 2O4XA 2A74C 4CKEA 2HT1A 5E4XA 4B08A 4DV1Q 3MXUA 4DF7A 1G2SA 3NBHB 2KENA 1QE6A 1TS4A 4DAVA 3GTJB 1GUSA 2MUYA 4ZLTF 2OCEA 4KD3A 5IT9E 2ZXOA 1I6VC 2B8FA 3STBC 3GTMH 4G7HC 2I46A 1MHWC 1WVLA 4PMBA 4DAMA 3IL8A 1PZID 4YCUA 3EROA 1YHBA 1JJGA 2Q8RE 4TVAB 4OEMB 1L2FA 2NVYH 3M4OH 4XXEA 3I4NG 3GTQH 4XYOA 4DAYB 2VW9A 5KIXA 5D14A 2F52A 2JK8A 3KJOA 4IPCA 2K01A 2IX0A 4P71A 1VQEA 3J7A5 5J39A 4B3SL 4LF6Q 4RA8A 5ELFA 3L7ZC 1ICWA 3GTMB 1VMCA 3KYHC 2QKIC 2CH4A 1TXYA 5AJ3L 1Z7TA 3QOLA 3KDFB 1FYCA 3V05A 3S1RH 2UUCQ 2K05A 4ZQ3A 1EZ6A 3WDNA 2FMMA 4YWLA 2UXCQ 1D7QA 2NVYB 3M4OB 2NTTA 5FO8B 1VCIA 2R3ZA 1V8QA 3TDQA 1EY5A 4G4KA 1TWGH 1V1PB 1TY0A 1JE4A 3OYYA 2A6HD 2HDLA 3D4DA 4LW1A 4JC0A 5KGUA 2KHJA 2WV6D 1CI3M 1OTCA 3PUWA 3M3YH 1B2TA 1X56A 2EOTA 4P72A 1I4PA 3DLLA 1W6KA 3K81C 1BOSA 4GNXA 3NENA 1WTRA 2X6LA 1C4QA 4PMWA 1A6XA 3VR6A 5KNBA 2DNCA 5TSSA 3S1RB 3VA5A 1HNWQ 4DUZQ 1S3OA 3ITPA 2XWBB 4IUQA 1V1QA 4DXFA 2EYPA 3H3VH 4QB4A 1SFOH 1CQVA 1KNAA 1TWGB 3SEBA 1M4VA 3AB9A 4LFAL 4IZ8A 5IGDA 4YY3L 4R1JA 4A75A 2F0FA 5T1GA 5BR8L 1CFMA 2Q8IB 5GAHC 4DK1A 1DYQA 4DV7Q 5C3XA 3M3YB 2N3SA 3UDXA 5BN4A 2D62A 3K5MA 2J4XA 1ENFA 1PZJD 2WAQE 2H5XA 1S5FD 2H1EA 3BDOA 3M4PA 2MNAA 2HDMA 2JA5G 2K33A 1WJJA 3AU7A 3RD4A 4A3FH 4DR4L 3HOWH 1SYFA 3KOJA 4ME3A 1R4QB 1SFOB 1ZYRC 2NBFA 4G57A 4RKLA 1X3QA 2K7VA 2YYZA 1X3GA 4X64Q 2DY8A 2RKSA 3OW2A 4CGYB 1YNJD 5IGEA 1HXYD 2D5DA 1I4GA 4IO9A 2D0OA 1SE3A 4FNFA 2XWJB 3EA6A 4OGQC 3CKIB 5IYCH 1PH7A 3EN2A 3T53B 2R7ZG 3T56B 4OO1G 4A3FB 5KEEA 4HR7B 3F8TA 1EWHA 5I9OA 1Y8OB 3HOWB 2N49A 5E3FA 2VQEQ 5FO7B 3BU2A 2PYKA 3BVZA 4RFBA 2HCIA 4NDXA 1VQ6A 2AHOB 1SMYC 1TQOA 2DJGC 3J80L 1VQ9A 5COYA 1SLJA 2UU9L 5F2DA 1HHVA 4I65A 4DAPA 2WKCA 2XVSA 3HOVH 2DUDA 4IJLA 3ZYYX 4X62L 1RF2D 2NUCA 4HEDA 4ZKBB 3HG9A 3K59A 1H9SA 4A3BG 2ES2A 1A62A 3TS0A 4DR5L 3BDLA 5M3MG 1V9PA 1UWVA 4CDDC 4A3JB 1YJNA 2FINB 3EBEA 4ZAIA 3RR5A 4C3IG 1UE6A 1O7LA 3ONAB 2WINB 2JN4A 1F2ZA 4OIKA 5FJ8H 4IQZA 2HD3A 3UE0A 3HOVB 4RHRA 2F4VQ 3R2IA 1Q8IA 4PV1C 2A6ED 3T1YQ 3Q22A 2AQ3B 4JI8Q 4R4CA 4BA1I 2WFWA 3A5UA 2E75C 1D5ZC 4LK1C 4PG3A 4QMGA 1IBML 1PYWD 4HSPA 4HMJA 1JJCB 2VY3A 4DR7L 4ZKCB 3NWSA 4CDFC 1FVIA 2B63G 1EQTA 1GUNA 1N32L 5BN5A 4JI1Q 3VYTA 4S3SA 3Q6SA 2LSSA 1PH9A 3ICEA 1Q7YC 1EIHA 4GLAC 1IW7C 3A8IE 3JAML 2OWOA 1PTOC 4R4QA 2F1MA 3MEFA 1Q12A 1QVGA 2CWPA 1W3SA 3L3OC 4K0KQ 2EY6A 3OHXC 1ONLA 3L9AX 3Q0AA 3SK8A 1HR0Q 4JI0Q 2UXBL 2EY1A 5K5PA 3S14H 4C3JH 2PQEA 4RKBA 5EQ0A 1JR0D 3PO2G 3QWNA 1HZ9A 2XN9C 1R4PB 1STHA 2EVBA 1YNND 4PZ8A 1LUZA 2R6GA 3J80E 1RL2A 4KHPL 5I2YA 3HOUG 4GNXC 4PZ7A 3HOXH 1YNXA 3D3RA 1G91A 1E1TA 4JI5Q 4A3GH 4YIJA 5JEAH 3CPFA 4GLXA 1BO0A 5IYBH 1CT1D 1AE2A 4Y52H 3PIO3 1BNZA 2OQ0A 4FXGC 1K0RA 1WOCA 4XYQA 2Q2UA 2ICEC 2XIWA 1PRTC 4PZ6A 4C3JB 1S4ZA 2HUGA 5J1ZA 3L0OA 1DOMA 3PSIA 1C9OA 5CC4A 1QVFA 2RQXA 3B6YA 4HJ7A 4JI4L 3PF4A 2D0PA 1L1OB 1VQ5A 3FPUB 3SK6A 2BDNA 3KF8A 1IYVA 2JE6I 1O78A 3MXPA 1DOKA 2F0OA 5JAVA 1N8RC 3HOXB 4RMFA 3S24A 4A3GB 4HIOA 2BH2A 1C8CA 2F0VA 2Y0SE 1SDFA 1QJOA 2OTJA 1G8ZD 3MXNB 3NXWA 4ZRZA 2PPBC 4JI7Q 1HUMA 4LMQD 3MHBA 1XNRQ 2OEOA 4OONA 4KY6A 5EJWA 1W6JA 5M3FH 3TREA 4B3ML 1GHKA 1I4QA 2PQAB 2RF4A 3F2BA 5D3DA 1TS2A 1TU2B 1VMPA 2BE5C 4JBWA 5CV6A 1NCVA 4DV1L 1CA5A 3KK7A 4L8JA 1KHIA 4BBRG 5NUCA 4EQ5A 5C3EH 1KC8C 3JAME 2FJ2A 2H4OA 1ESFA 3K0XA 5C5MA 1U4LA 5IWAQ 3I55A 4G7ZC 2PZTA 4TKOB 2GVBA 1O7ZA 1CKNA 5M3FB 4IFDH 4ZUIA 1VQFA 4DR3Q 1GHJA 2NZHA 2EY2A 2AUKA 4R9WA 1F77A 3I4MH 1EQRA 2AQ2B 1H95A 1HR0W 2LKVA 4XT3B 1TWCH 4YWMA 2UXDQ 3CW2C 4KN4C 4EQNA 3MC0B 1TKWB 1B50A 4OX9Q 4DKAC 3HFZB 4K14A 5IYDG 2Q2TA 1XPOA 3F2UA 3SVMA 1SE2A 3FRPB 2A19A 3NTKA 4LF6L 1C0AA 2KJXA 4XTCS 1E0BA 2SOBA 3NQTA 3FP9A 4JI2Q 5JJLA 4UAIA 3UE1A 1S5ED 1SMXA 2UUCL 2BCOA 2C5CA 1HCZA 1V1OA 2UXCL 4DNTB 5C44G 1TR5A 4DA2A 1H9MA 1FD7D 3I4MB 1CKOA 3C1FA 3TSSA 2K5VA 1MGSA 1TWCB 3CD6A 3V2TA 4RGTA 1H9RA 3A56A 3SK5A 1RHPA 4F8MA 2NTSA 3MA2B 2EYMA 2YTXA 1B8AA 5JVH3 4DGZA 3A7AB 2EY5A 5M5YH 3DMUA 1JOQA 3HOYG 4KHVA 3PO3G 5ELBA 5CV5A 3T4AC 2B2VA 3MEHA 1BCPD 2FHTA 4A3EG 1HNWL 1EOTA 4OO1I 5FKAC 4DUZL 2F4IA 2SNSA 4WORA 2PZUA 5M9OA 3CCJA 4A93G 3N52A 1KAAA 4RG1A 4OL7A 4RGMA 1EL0A 3FKIG 2I5MX 1SNOA 4PQXA 2JA7G 3BJUA 5GQOA 1Z6HA 3S9WA 3E0JA 3TP8A 4IUVA 3NE5B 3J7YW 2X6GA 3CRKC 5LMNQ 1KD1C 3A8KE 1EY6A 4XQJA 2K50A 4DPGA 2JA8G 1PYSB 4LF5Q 1ASZA 4JOIA 4DV7L 2I07B 5EPJA 2K6AA 1K3RA 2TSSA 2EJMA 2R7DA 4IPHA 3PUYA 4QF4A 2R92G 4C56C 4A3IH 1LTGD 3DM3A 1BKBA 3CCMA 4A3CG 2GVAA 1VS0A 2D9UA 5IGBA 4A3LG 3DUZA 2F0NA 1HH2P 1LTLA 1ENCA 2LXKA 1DOLA 3G7LA 3I72A 1LT6D 1CSQA 2E74C 4K8JA 4JG2A 5HGTA 3RN5A 1NR4A 4F87A 4X64L 2VL6A 3K80C 1HTPA 1A15A 2K5QA 1WFQA 2E76C 3G4SA 2EE1A 1EIYB 1ILQA 3SE0A 3AMUA 4DV6Q 4IOCA 1KNEA 2KEDA 4JCVE 2ID0A 1ENAA 4MN3A 2E2JH 3STBD 4A3IB 3GD7A 3TN2A 5CYUA 5ELNA 4BY1G 1ASYA 2DY7A 2B29A 2Z8LA 2VQEL 2L11A 1KRTA 2K52A 3CQZH 4YCVA 1HZCA 5C4XG 4IURA 4M8AA 4QCLA 2BDOA 2E2DC 4MTNA 1UUPA 5J3BA 5IGCA 1LO5D 1WCMG 2JA6H 4C1NK 3GV6A 2MGSA 1MKHA 4LWCA 4TSSA 1VF5C 2VB3X 3NTIA 3CC7A 4K2LA 1QNUA 3UI2A 1FJGQ 1OXTA 3E0EA 4LUVA 1CUKA 4PMCA 3URYA 2E2JB 2A5HA 1STAA 5KYLA 1KDAA 1OO9B 2UUBQ 1X54A 1WD0A 1PFSA 2IW3A 2SDFA 5GROA 3Q24A 4GOPC 1VQNA 1KABA 1Z9FA 1MI2A 4HIDA 1E3PA 2XGTA 1LTID 4ID6A 1II3A 3GTGH 4JPBW 2ZJPA 1JWMD 5CV4A 3TQYA 3W5OA 2L4NA 4A3KG 1RTOA 2JA6B 3CCQA 4QY7A 3H0GG 3NQIA 3I2ZA 5H1SE 4LUOA 4AYBG 2F4VL 2JEBI 2ZTCA 5LMNW 3T1YL 2QEXA 3IAYA 3W2DA 1QVCA 4JI8L 5KRUA 1F2MA 2F0KA 2VXWA 5I6WA 5FLXc 5EKKA 2MO0A 1YHQA 3KLWA 1JWSD 1V1PA 3I4NH 4MIUA 1NMGA 3KF6B 1NJIC 4C3HG 3GTGB 3W1BA 2ZJQA 4JI1L 4OHJA 3WWVA 3R8BA 1LTTD 3RN2A 1VQAA 1BCPF 1Q8KA 5EPLA 3ND8A 5JJIA 1PA6A 3QOJA 3MFYA 4K0KL 3PUXA 4MHEA 3Q8DA 3VA7A 1T9HA 3GTPH 4ME5A 1HR0L 4JI0L 2F0LA 3LX0A 4NMZA 5EKIA 2Z6KA 4B3TQ 2RVLA 3Q23A 3I4NB 1NSNS 3J81c 1FNWA 1UEBA 4NW2A 3GTQB 1YBYA 1LTBD 4KY7A 1S40A 2MQHA 1KXLA 1N36Q 4O1NA 2Q2HA 4TQUS 4V0BA 1ZYRD 4JV5Q 2QEJC 4K5VA 1VDZA 5GADC 2ZM6Q 2MFIA 4RCOA 4J15A 1J9OA 4L5SA 2DNEA 3K5OA 1F9RA 2EYFA 4JI5L 3U9SA 2B2VC 3ULLA 4KN7C 2EDGA 4HN7A 4CDCC 2RSNA 1Y1VG 2PMZE 5EAYA 1HQMC 4X3TA 3KLSX 4XDXA 3VYUA 4RAUC 1M1KC 2AUJD 3KFUA 3GTPB 1HTLD 1HUNA 4OXPA 2WP8J 1N34Q 2EXDA 5IT9c 5HY6A 3J81i 3U4VA 2D2CC 2Z1CA 3P7JA 1XPRA 5A2QE 3M4QA 1TWFH 3KLSA 5D65A 1YIJA 4JOIC 1SMYD 3BYTB 1CQFA 4AIMA 2ENBA 3R2TA 3K5NA 2NWGA 2JA5H 4FP5D 3M7GA 4JI7L 4LF7Q 3NPPA 1XNRL 3C2PA 1KL9A 3OMCA 3RZDH 3BG3A 1K8AC 1GO3E 5CBAE 1SAPA 5LL6X 1QZHA 1A63A 5L37A 5LL6S 2HQEA 1K3BC 2WB1G 1TWFB 1CSPA 5EBDA 1M90C 2RDGA 3K7UC 1MIUA 1SE8A 3SHLA 1LTSD 4OWXB 2HQLA 3GTLH 1VQBA 3TMEA 2Z9HA 4DV4Q 4A3FG 1NUCA 3RLFA 2IX3A 2F0QA 4FYDA 2QILA 2P5ZX 4X66Q 2R7ZH 4DV3Q 3HOWG 2JA5B 4OO1H 3T16A 3BZCA 3AQQA 3K7AH 1Q82C 3IFTA 5IWAL 3RZDB 2E2HH 2GN5A 2IJ0A 1X6OA 4E6IA 4R4OA 2PNHA 2SEBD 4KKUA 1PRTB 1Y8NB 4DR3L 5ELCA 1HJPA 2F3IA 1PH3A 4IUPA 3J7ZC 1HQRD 3C1EA 1LT5D 1Y14B 2KCMA 3G48A 4CJ0B 1E2WA 2UXDL 5C5LA 4OX9L 5IODA 5DM73 3W1GA 1WD1A 1XTCD 1PH5A 1K0SA 1AE3A 2KOLA 1IW7D 3U9OA 4GKJQ 1PTOD 1HRJA 3DEPA 1J5EQ 4JI2L 3FPPA 4BXXH 2RSOA 3K7AB 4N9PA 2E2HB 1SSOA 1XMQQ 1X3EA 2F03A 4EX5A 1U4RA 1UE5A 4A3JG 4A3BH 3S1NH 5A35A 3U58A 4BA2I 2CW0C 3IKJA 5KNCA 2ICIA 4DK0A 2EYJA 2N55A 4DNRB 3I91A 1LM0A 1UE7A 4DXGA 4CHTB 4C3IH 3HOVG 3T1HQ 2A1AA 1I3QH 2PMZB 3HOZG 1GXDC 4C1NI 4ZCKA 1XXGA 2Z4HA 4IPGA 1BXTA 4ABNA 4JI3Q 1STNA 4HJ5A 3TP6A 1KIXA 2EXZA 3M85A 1PH1A 1GOZA 3CC4A 1STEA 3DWAA 1FNVA 1SYBA 1EFWA 4A3BB 3UDFA 3S1NB 4BY7G 1PRTD 3GV3A 1JORA 1WTWA 2ZXRA 2B63H 1K28A 4JYAQ 2NZOA 1D1IA 3BVGA 1IBKQ 2AWOA 2WAQB 3GTOH 4DK3C 5ELDA 4DR2Q 1SYDA 1HPCA 1EWIA 2LY7A 2SNMA 3OIPA 5LMNL 3S15H 2G5DA 1B7YB 4LF5L 3HKZG 1X65A 4JBJA 1JJ2A 3D6CA 5IOCA 2F3WA 1I4XA 3D4WA 1VQPA 3MVVA 2KA7A 4LUZA 2Z6KC 4H0LC 1H9SB 1LACA 5EPKA 1CM9A 4MZ9A 1JE5A 2O5IC 3ER0A 2VUMH 4NXNQ 2K32A 1VQ4A 1GUOA 2B63B 4K6DA 2QGQA 2KHIA 1H9KA 3HKSA 1C7YA 4CJ2C 1J6QA 4POGA 3HOUH 3GTOB 2G9DA 2KVMA 3S15B 1NAPA 5JOBA 2BE5D 4NPSA 3ERQA 4HJAA 4GKKQ 2XRSD 3I4OA 2WACA 2YTYA 3S1MH 4DV6L 4WFN3 2BOSA 4OWWB 1PH2A 3BDCA 4Q5VA 4XIGS 3EIVA 2R93H 1IL2A 1J8IA 3OTOQ 3S14B 1RDPD 2VUMB 1OXUA 3M4YA 2K03A 4PNYA 1YEZA 2EIFA 1B70B 3HOXG 5I6YA 1UE1A 3K6OA 3HOUB 3F1ZA 1PH8A 3PUZA 1VF7A 1FL0A 1RJTA 4WJ4A 1UAPA 1EQQA 5IP9H 3S1MB 4L6TB 1I4HA 3PIOA 2F0UA 5GAGC 4KV6A 1AFPA 1FJGL 4NXMQ 1YHAA 1XMOQ 4A3MH 1EYAA 2FFKB 2R93B 2XNAC 2UUBL 2RDFA 4POFA 4OWTB 3G6JB 1XNQQ 1K8GA 3LGJA 5JJKA 1YZ6A 3VDYA 3OMGA 4DV2Q 3DWQA 4KKTA 1YITA 3ULJA 2QW7A 1BQQT 3CCVA 1AW7A 3SGIA 4GOPA 4MTKA 4LF8Q 1BBUA 2FXQA 1PTOF 4B3RQ 4BBRH 2X69A 2B2YC 1GUWA 5LMUQ 1CKMA 1MSHA 4R8IA 3K58A 2KQ3A 1Q86C 1SR3A 1ZEQX 3OW7A 2B8GA 2QCPX 3J80c 1QB5D 1XX8A 2QA4A 5GAEC 2BA1A 4A3MB 5C6AA 2KECA 1BCPB 3FMCA 4H13C 4P2CB 1U0LA 1XYIA 3A0JA 3U4ZA 3TP7A 1S5BD 4ULLA 3SDZA 3KBXA 1EQVA 5DAUA 1G291 2B3GA 4YHHQ 1VQMA 2LXJA 4JI6Q 1UEAB 4HJ9A 4DV0Q 3JC66 1NE3A 1ML0D 2DGYA 1FR3A 3LWUA 2YU9H 4FXDA 1A8VA 1N9WA 3QR8A 5IYDH 2F0EA 1X9NA 4BBRB 2CVRA 2V1CC 1X3PA 1EYDA 1P16A 3NEMA 3ERSX 3J80i 4P75A 1PRTF 4O0AA 1IZ6A 5C3EB 4CJ1B 2B2TC 1B1ZA 4IFDG 1Y1WG 2F0TA 1L0XB 2QF7A 4GS3A 5BN3A 4HIMA 4LFCQ 4DR6Q 1EUJA 1Q81C 4B3TL 1IBLQ 3CCUA 3FVQA 3TRZA 2K5WA 4DU9A 4OIJA 1MSGA 1N36L 2YU9B 1JMCA 3CPWA 4JV5L 4X3KA 5E1FA 4AH6A 5LHY1 2J7ZA 1DZ1A 2L55A 2ZM6L 3G71A 3RLNA 1X55A 2M00A 2Z0SA 5I9PA 3OWEB 2F0SA 1VQOA 3L2PA 3KJPA 1EY0A 3HOYH 3PO3H 1BBWA 1B53A 3D31A 4BBSG 1JB3A 4B9WA 1U9RA 2K5NA 4A3EH 3NWTA 1K8OA 2NB0A 1CKNB 2BA0A 1SROA 2CCZA 1A0IA 1N34L 3MAQA 1MD2D 3NUCA 4IUNA 2JXMB 2KHSA 2MJ8A 3M7NA 1TIID 4RCNA 2JA7H 3JAMc 5CV8A 4KTAA 1U5KA 2HCCA 2ZJRA 4IOAA 3J81L 2OF1A 1TVXA 1O7YA 2Y0SB 4RGOS 2JA8H 1AZQA 3D0FA 3VR5A 2GA4B 3VR3A 5CR3A 1WTVA 5M5YB 3PO3B 1W2BA 3K0YA 2I0QA 3NTHA 4EQPA 1SNCA 2R92H 2IHEA 5IP7H 4LF7L 1L1OC 3UDIA 3E9IA 3SR1A 4CBVA 4A3EB 1VQCA 2PO4A 4Q0FA 3S2HH 4A3CH 4A3LH 4AYBE 3NSWA 1DONA 1EY8A 2K5HA 3FDTA 4WRDA 3X3NA 3PQIA 2KCCA 5IT9L 4O2DA 3PIP3 4GN3B 2PI2A 3CAMA 3CCSA 2HIVA 5EGTA 3IRBA 2PZWA 1PVOA 5AFWA 4CKCA 3A7LA 4X6AH 2Q2IA 4RWSC 1AZPA 4DV4L 4A3IG 1QWYA 4N9TA 3PCOB 2K04A 1X32A 1QUQA 3BZDB 1R9TH 4X66L 2R92B 1WTPA 4AQYQ 2XRQD 1GKHA 3E5SA 1TWAH 3S2HB 1GJXA 4BY1H 3D4RA 3TP5A 1EOVA 2AQ1B 3EFXD 1N33Q 2ASBA 2R7FA 4RH6A 4FXKC 4DK6C 3I7FA 1L0WA 3QG1A 2J0TD 2OT2A 3NBHA 4C2MH 1WCMH 1VQKA 2RHSB 2Q8TA 2HHHQ 3CC2A 3PGZA 1ICFB 2OXPA 2VS1A 1I94Q 4A3DG 2VB2X 2K1BA 5C0XG 5CV9A 1K73C 4KLKA 1HNXQ 2E8GA 2WIIB 1QILA 5FLMG 1HNZQ 4LNQA 2IWHA 1R9TB 1YJ9A 2R61A 2AMCB 2ATWA 1CHPD 1SNDA 3O13A 3J7AF 1TWAB 4LF4Q 4GKJL 1BDOA 4QJFA 4BY1B 3K5LA 5E7NA 1J5EL 4M1UB 4J6HA 4CDEC 5C3WA 3KF6A 3W3AA 5FO9B 1XMQL 2A68C 3RNUA 4KMUC 4DAYA 1GD7A 3CQZB 1AP0A 1SJED 4K5WA 4UP7A 2NVXH 1LT4D 4C2MB 2CFMA 1FGBD 4A3KH 1WCMB 1IKMA 3T1HL 5CV7A 3S16H 1EYGA 4IUUA 4HIKA 1NY4A 3H0GH 4DR1Q 3QJYA 3HEJA 1E2VA 1E22A 1F2LA 2JJQA 4JI3L 1A3TA 1SEBD 3KDFA 4J8QA 1E24A 4P74A 3HGBA 4EQOA 3I90A 2NN6G 5K36G 4A4IA 1KTKA 2IT1A 4IJHA 2NZ1D 3OWFA 4C3HH 4LJZC 2UUAQ 5I4DA 4JYAL 2NVXB 4APVA 3RUZA 2LMCB 5HGQA 4FDBA 4A3KB 3GQBA 1IBKL 3S16B 1D5XC 4DR2L 1PZKD 4DN4M 1LV9A 2WB1E 4X65Q 3H0GB 5JVG3 1D8LA
chains in the Genus database with same CATH topology
4HCSA 2AWNA 1OXXK 1QOHA 4AYBB 1F9PA 3RMHA 1IHZA 1B9MA 1A2UA 1JWUD 3CU7A 1QG7A 3OOCA 4IFDJ 5IIFA 2EYOA 2EYHA 4FF3A 4C3HB 1Q90A 1JOKA 3H09A 2IL8A 3HP3A 4HTHA 1A3UA 1AN8A 1ET9A 5ELEA 1ESRA 4FF1A 1JCKB 2F0JA 5IGFA 5I2XA 1SNQA 5DM63 1PTOH 1B9NA 4IN3A 4KHZA 1LLRD 2O2LD 2B39A 1I50B 4ZYSA 1QNKA 3VR2A 3HZXA 1ZXTA 1RD9D 1HA6A 5T1IA 2EZVA 1PMRA 4KKSA 1TY2A 1BBXC 3PMFA 1EU3A 1PFBA 1Y1VB 5JPNC 5FK9C 2JEAI 1G6ZA 4H7BA 1D6EC 5C4ZA 1U4MA 1PTOB 1EFID 1K83B 4EGVA 4IFDI 3GTKB 1F2YA 1L0YB 4KY5A 1XWEA 4K8IA 1D1KA 3I4LA 2CW0D 4U673 4XQNA 3D8GA 2MP1A 1KDCA 1EWCA 3TBIB 2F0PA 3KLRA 2B2YA 1T5EA 1JQYD 2B2WA 2A6HC 3MFGA 4RHSA 1TWHB 2PNRC 3QB3A 3C46A 2WB1B 5DEHA 4X3UA 3TZDA 1LTAD 3FEWX 1Q1BA 3T13A 3GTLB 1SBBB 3NP8A 2C9OA 4CKBA 2R7ZB 1PDQA 5DNFA 1A3VA 5C0XJ 3P1HA 1CA6A 1DCZA 2ZXPA 3MZ5A 2IX1A 1E2ZA 2B2TA 1PFMA 1BUVT 4KJOA 1EIGA 5HURA 1BF4A 1GUTA 3CHBD 1WTQA 1LABA 3A8JE 2E2IB 2QDBA 3K57A 3R93A 5JJZA 2JSOA 1Q3LA 1LTRD 2KUMA 4ZK9B 3P75A 4HMIA 4UDUC 1YNJC 3OIQA 3N6RA 1Q1EA 4NP5A 1SE4A 2EJGC 2JYOA 4LAAA 1EY4A 2LS01 5M3MB 1IYUA 4Y7NB 1U4PA 2B2UA 3DEOA 2PW7A 1GUGA 4C3IB 3HOZB 1I3QB 1PLFA 1KLGD 4U68A 5C0XI 2EPBA 1ZKOA 2CQAA 3MWYW 2F3VA 2DN8A 2RA4A 1K8MA 3KUPA 4FO2A 2M2LA 4BY7B 3A54A 1S5DD 5CORA 1STGA 1I6HB 1RKNA 3E6ZX 3KBGA 1DD2A 5ISRA 2L5TA 4HAEA 3HKZB 3CRLC 3IFDA 1IL8A 4QUFA 3MXNA 3OSOA 1ILPA 1QCBD 4ZUJA 3SK4A 2FMCA 1B4OA 3H3VC 4IUTA 4C3JG 3EJIA 1IKLA 2NN6I 3RZOB 3LNNA 2EJFC 5KNDA 3PUVA 3S2DB 3PO2B 1JOOA 1SYGA 3HRZC 4NKLA 1CTMA 2NVQB 1SNMA 4ODGA 2A6EC 1TT2A 2K5DA 1KDBA 2ZT9C 3A55A 5JEAG 1HA5A 1PXUA 1CK1A 2A69D 3MXGA 1RTNA 3P20A 3GP7A 4KI0A 2PW5A 4Z9CB 5G3LD 2L9HA 1HFGA 5CGKA 2O5JC 2MPMA 3J7AV 4WJWA 4KJNA 5M5WB 4ILWA 1SXTA 1PFNA 1MBYA 2L0CA 2EYLA 1KLUD 1WTXA 1S5CD 1M8AA 2B2WC 3S1QB 3ND9A 1YNNC 3I8ZA 2F0GA 2F0IA 1I4RA 1EZ8A 4K6LA 1B3AA 4GZYC 3S17B 3DWPA 4IALA 3H6MA 2LFNA 5C4HA 2JP1A 4JK1C 3NBIA 4K5XA 4RGNA 3I70A 4BWGB 2A69C 1SNPA 1JICA 2MHVA 3VR4A 2IPKD 3I73A 4I7ZC 1RCVD 1STBA 1LT3D 1UNSA 1EYCA 4HSVA 2KEEA 2RDHA 1SJHD 5FLXL 2Z4IA 2L1BA 1HFNA 1SYEA 2N88A 5J22A 2M9VA 3H94A 3X3MA 1F9QA 1EY7A 1EY9A 4G7OC 1TS3A 1OXVA 4R8NA 5C4JB 1C48A 3T51B 5M5XB 1EEID 1FNUA 1Y1WB 2B2UC 2WKDA 3DM1A 3NHHA 4HCEA 5C44B 4QUCA 3SXHA 1STYA 1Y69U 4DFAA 3I3CA 3R3OA 1EU4A 3V96A 3C3LA 1WTOA 2CHBD 1T5XD 1NR2A 5IGGA 5D3IB 1Y8PB 1EEFD 4EVOA 3HOYB 4BBSB 4BS9A 1RODA 3NK9A 3VYRA 2K28A 2F0HA 3H91A 4A93B 2RBMA 2A68D 1AEXA 3FKIB 1A2TA 2JA7B 1TS5A 1H9JA 1Z47A 3QO2A 2KCNA 3DXJC 3MTSA 1BR9A 5G3LF 2JA8B 5JPMC 1ET6A 2L12A 2XSCA 5KYIA 4FF2A 4KD4A 1O80A 1B44D 2TMPA 2A73B 4TRDA 3LWEA 1CZGA 4K2KA 3WOFA 4QIWB 3HS0C 5CBEE 5FLXE 4FVMA 5EKLA 4B9XA 3WOEA 4J1MA 2V4DA 4O42A 1BCPC 2NYZD 5C0XH 4XT1B 2F0WA 3EQLC 5JEAJ 1F9SA 4F88A 4V190 1DJRD 4FF4A 1OXSC 3QIAA 1SYCA 4XQQA 1JC7A 1CHQD 2F0MA 3VYSA 3BS1A 3PV0A 1D2BA 3DHQA 5C4XB 1DXMA 4KK7A 2F0DA 3BVMA 2VNUD 5EBCA 3BYYB 3EVQA 4L63B 2PCFB 2G9HD 1G2TA 4X3SA 4A3DB 3J81E 3TZUA 5E4WC 5CMDA 1CZWA 1D5MC 5A2QL 3D6WA 4H44C 4F7XA 2NN6H 3OPOA 5FOBB 5K36H 1DM0B 2NVTB 1V43A 3GO5A 2O4XA 2A74C 4CKEA 5E4XA 4B08A 3MXUA 4DF7A 1G2SA 1QE6A 1TS4A 4DAVA 3GTJB 1GUSA 2MUYA 4ZLTF 5IT9E 4KD3A 2ZXOA 1I6VC 2B8FA 4G7HC 2I46A 1WVLA 4PMBA 3IL8A 1PZID 3EROA 2Q8RE 4XXEA 4XYOA 5KIXA 5D14A 2K01A 2IX0A 5J39A 4RA8A 5ELFA 3L7ZC 1ICWA 3GTMB 1VMCA 2QKIC 1Z7TA 3QOLA 1FYCA 3V05A 2K05A 4ZQ3A 1EZ6A 3WDNA 2FMMA 2NVYB 3M4OB 2NTTA 5FO8B 1VCIA 2R3ZA 1V8QA 3TDQA 1EY5A 4G4KA 1V1PB 1TY0A 1JE4A 2A6HD 2HDLA 3D4DA 5KGUA 2WV6D 1CI3M 3PUWA 1B2TA 2EOTA 1I4PA 1W6KA 1BOSA 1WTRA 2X6LA 1C4QA 4PMWA 1A6XA 3VR6A 5KNBA 2DNCA 5TSSA 3S1RB 3VA5A 3ITPA 2XWBB 4IUQA 4DXFA 2EYPA 4QB4A 1CQVA 1KNAA 1TWGB 3SEBA 1M4VA 3AB9A 4IZ8A 5IGDA 2F0FA 5T1GA 1CFMA 2Q8IB 4DK1A 1DYQA 3M3YB 5C3XA 5BN4A 2D62A 3K5MA 2J4XA 1ENFA 1PZJD 3BDOA 1S5FD 2H1EA 2HDMA 2K33A 3AU7A 3RD4A 1SYFA 1R4QB 1SFOB 1ZYRC 2NBFA 4G57A 4RKLA 1X3QA 2K7VA 2YYZA 2DY8A 2RKSA 4CGYB 1YNJD 5IGEA 1HXYD 2D5DA 1I4GA 1SE3A 4FNFA 2XWJB 3EA6A 4OGQC 3CKIB 3T53B 3T56B 4OO1G 4A3FB 5KEEA 4HR7B 1EWHA 5I9OA 1Y8OB 3HOWB 5E3FA 5FO7B 2PYKA 3BVZA 4RFBA 2HCIA 4NDXA 1SMYC 1TQOA 3J80L 5COYA 5F2DA 1HHVA 4I65A 4DAPA 2WKCA 2XVSA 3ZYYX 1RF2D 2NUCA 4HEDA 4ZKBB 3HG9A 3K59A 1H9SA 3BDLA 4A3JB 2FINB 4ZAIA 4C3IG 1O7LA 3ONAB 2WINB 1F2ZA 4OIKA 4IQZA 3HOVB 4RHRA 3R2IA 1Q8IA 4PV1C 2A6ED 3Q22A 2AQ3B 4BA1I 2E75C 1D5ZC 4LK1C 4QMGA 1PYWD 4HSPA 4HMJA 4ZKCB 3NWSA 1EQTA 1GUNA 5BN5A 3VYTA 4S3SA 3Q6SA 1EIHA 1IW7C 3A8IE 3JAML 1PTOC 2F1MA 1Q12A 3L3OC 2EY6A 3OHXC 1ONLA 3L9AX 3Q0AA 3SK8A 2EY1A 5K5PA 2PQEA 4RKBA 5EQ0A 1JR0D 3QWNA 2EVBA 2XN9C 1R4PB 1STHA 1YNND 2R6GA 3J80E 5I2YA 3D3RA 1G91A 4YIJA 5JEAH 1BO0A 1CT1D 3PIO3 1BNZA 4FXGC 4XYQA 2ICEC 2XIWA 1PRTC 4C3JB 1S4ZA 2HUGA 5J1ZA 1DOMA 5CC4A 2RQXA 3FPUB 3SK6A 2BDNA 3KF8A 1IYVA 2JE6I 1O78A 3MXPA 1DOKA 2F0OA 5JAVA 3HOXB 4A3GB 1C8CA 2F0VA 1SDFA 1QJOA 1G8ZD 4ZRZA 3NXWA 2PPBC 1HUMA 4LMQD 3MHBA 2OEOA 4KY6A 5EJWA 1W6JA 1GHKA 1I4QA 5D3DA 1TS2A 1TU2B 1VMPA 2BE5C 4JBWA 5CV6A 1NCVA 1CA5A 3KK7A 4L8JA 5NUCA 3JAME 2FJ2A 2H4OA 1ESFA 5C5MA 1U4LA 4G7ZC 2PZTA 4TKOB 1O7ZA 5M3FB 4IFDH 4ZUIA 1GHJA 2EY2A 2AUKA 4R9WA 1F77A 2AQ2B 2LKVA 4XT3B 4KN4C 4EQNA 3MC0B 1TKWB 1B50A 4K14A 3F2UA 3SVMA 1SE2A 3FRPB 3NTKA 2KJXA 4XTCS 1E0BA 2SOBA 3NQTA 4UAIA 1S5ED 2BCOA 2C5CA 1HCZA 1V1OA 4DNTB 1TR5A 4DA2A 1H9MA 1FD7D 3I4MB 3C1FA 3TSSA 1MGSA 1TWCB 3V2TA 4RGTA 1H9RA 3A56A 3SK5A 1RHPA 4F8MA 2NTSA 3MA2B 2EYMA 5JVH3 4DGZA 3A7AB 2EY5A 3DMUA 1JOQA 4KHVA 5ELBA 5CV5A 3T4AC 2B2VA 3MEHA 1BCPD 2FHTA 1EOTA 4OO1I 5FKAC 2F4IA 2SNSA 4WORA 2PZUA 5M9OA 3N52A 1KAAA 4OL7A 4RGMA 1EL0A 4PQXA 1SNOA 1Z6HA 3S9WA 3E0JA 3TP8A 4IUVA 3NE5B 3J7YW 2X6GA 3CRKC 3A8KE 1EY6A 4XQJA 2I07B 5EPJA 2K6AA 2TSSA 2EJMA 3PUYA 4QF4A 4C56C 1LTGD 2D9UA 5IGBA 3DUZA 2F0NA 1ENCA 1DOLA 3G7LA 3I72A 1LT6D 2E74C 4K8JA 5HGTA 1NR4A 4F87A 1HTPA 1A15A 2K5QA 2E76C 2EE1A 1ILQA 3SE0A 3AMUA 1KNEA 2KEDA 2ID0A 1ENAA 4MN3A 4A3IB 3GD7A 3TN2A 5CYUA 2DY7A 2Z8LA 2L11A 4IURA 4M8AA 4QCLA 2BDOA 2E2DC 1UUPA 5IGCA 1LO5D 4C1NK 3GV6A 2MGSA 4TSSA 1VF5C 2VB3X 3NTIA 4K2LA 1QNUA 3UI2A 1OXTA 4PMCA 3URYA 2E2JB 2A5HA 1STAA 5KYLA 1KDAA 1OO9B 1WD0A 2IW3A 2SDFA 3Q24A 1KABA 1MI2A 1LTID 4ID6A 1II3A 1JWMD 5CV4A 2L4NA 1RTOA 2JA6B 3NQIA 2JEBI 3IAYA 3W2DA 5KRUA 1F2MA 2F0KA 2VXWA 5I6WA 5EKKA 1JWSD 1V1PA 4MIUA 4C3HG 3GTGB 4OHJA 3R8BA 1LTTD 1BCPF 5EPLA 3ND8A 3QOJA 3MFYA 3PUXA 4MHEA 3VA7A 4ME5A 2F0LA 3LX0A 4NMZA 5EKIA 2RVLA 3Q23A 3I4NB 1NSNS 1FNWA 4NW2A 3GTQB 1LTBD 4KY7A 4O1NA 4TQUS 4V0BA 1ZYRD 2QEJC 4K5VA 1VDZA 4RCOA 1J9OA 2DNEA 3K5OA 1F9RA 2EYFA 3U9SA 2B2VC 4KN7C 2EDGA 4HN7A 2RSNA 1HQMC 4X3TA 3KLSX 4XDXA 3VYUA 4RAUC 2AUJD 3GTPB 1HTLD 1HUNA 2WP8J 2D2CC 2Z1CA 3P7JA 5A2QE 3KLSA 5D65A 1SMYD 3BYTB 1CQFA 2ENBA 3R2TA 3K5NA 2NWGA 4FP5D 3M7GA 3NPPA 3C2PA 3OMCA 3BG3A 5CBAE 1SAPA 5LL6X 5LL6S 2HQEA 5EBDA 1TWFB 2RDGA 3SHLA 1LTSD 3TMEA 1NUCA 3RLFA 2IX3A 2F0QA 4FYDA 2QILA 2JA5B 4OO1H 3T16A 3IFTA 3RZDB 2IJ0A 4E6IA 2SEBD 4KKUA 1PRTB 1Y8NB 5ELCA 4IUPA 1HQRD 3C1EA 1LT5D 4CJ0B 1E2WA 5C5LA 5IODA 5DM73 1WD1A 1XTCD 2KOLA 1IW7D 3U9OA 1PTOD 1HRJA 3DEPA 3FPPA 2RSOA 3K7AB 4N9PA 2E2HB 1SSOA 2F03A 1U4RA 5A35A 4BA2I 2CW0C 3IKJA 5KNCA 2ICIA 4DK0A 2EYJA 2N55A 4DNRB 3I91A 4DXGA 4CHTB 2PMZB 1GXDC 4C1NI 1XXGA 2Z4HA 1BXTA 4ABNA 1STNA 3TP6A 2EXZA 3M85A 1GOZA 1STEA 3DWAA 1FNVA 1SYBA 4A3BB 3S1NB 1PRTD 3GV3A 1JORA 1WTWA 2ZXRA 1D1IA 3BVGA 2AWOA 2WAQB 5ELDA 1SYDA 1HPCA 2LY7A 2SNMA 3OIPA 3D6CA 5IOCA 2F3WA 1I4XA 3D4WA 3MVVA 2KA7A 4H0LC 1H9SB 1LACA 5EPKA 1CM9A 2O5IC 2K32A 1GUOA 2B63B 4K6DA 1H9KA 4CJ2C 3GTOB 2G9DA 2KVMA 3S15B 1NAPA 5JOBA 2BE5D 3ERQA 2XRSD 2WACA 4WFN3 2BOSA 3BDCA 4Q5VA 4XIGS 1J8IA 3S14B 1RDPD 2VUMB 1OXUA 3M4YA 2K03A 4PNYA 5I6YA 3K6OA 3HOUB 3PUZA 1VF7A 1RJTA 1UAPA 3S1MB 4L6TB 1I4HA 2F0UA 4KV6A 1AFPA 1EYAA 2FFKB 2R93B 2XNAC 2RDFA 3G6JB 3OMGA 3DWQA 4KKTA 1BQQT 1AW7A 1PTOF 2X69A 2B2YC 1GUWA 1MSHA 4R8IA 3K58A 2KQ3A 3OW7A 1ZEQX 2B8GA 2QCPX 1QB5D 1XX8A 2BA1A 4A3MB 5C6AA 2KECA 1BCPB 3FMCA 4H13C 4P2CB 1XYIA 3TP7A 1S5BD 4ULLA 3SDZA 3KBXA 1EQVA 5DAUA 1G291 1UEAB 1ML0D 1FR3A 3LWUA 4FXDA 2F0EA 4BBRB 2CVRA 1X3PA 1EYDA 1PRTF 5C3EB 4CJ1B 2B2TC 1B1ZA 4IFDG 2F0TA 1L0XB 2QF7A 5BN3A 3FVQA 2K5WA 4DU9A 4OIJA 1MSGA 2YU9B 4X3KA 5E1FA 5LHY1 2J7ZA 1DZ1A 2L55A 2M00A 5I9PA 3OWEB 2F0SA 1EY0A 1B53A 3D31A 1JB3A 4B9WA 1U9RA 3NWTA 1K8OA 2NB0A 2BA0A 3MAQA 1MD2D 3NUCA 4IUNA 2JXMB 2KHSA 2MJ8A 3M7NA 1TIID 4RCNA 5CV8A 4KTAA 2HCCA 3J81L 2OF1A 1TVXA 1O7YA 2Y0SB 4RGOS 1AZQA 3VR5A 2GA4B 3VR3A 5CR3A 1WTVA 5M5YB 3PO3B 3K0YA 3NTHA 4EQPA 1SNCA 3SR1A 4CBVA 4A3EB 2PO4A 4Q0FA 3NSWA 1DONA 1EY8A 3FDTA 4WRDA 3X3NA 2KCCA 5IT9L 3PIP3 5EGTA 2PZWA 5AFWA 4CKCA 3A7LA 4RWSC 1AZPA 1QWYA 4N9TA 2K04A 1X32A 3BZDB 2R92B 1WTPA 2XRQD 3E5SA 3S2HB 1GJXA 3D4RA 3TP5A 2AQ1B 3EFXD 4RH6A 4FXKC 3QG1A 2J0TD 2OT2A 3NBHA 2Q8TA 2OXPA 2VB2X 2K1BA 5C0XG 5CV9A 2WIIB 1QILA 2IWHA 1R9TB 2R61A 1CHPD 1SNDA 3O13A 3J7AF 1TWAB 1BDOA 4BY1B 3K5LA 4M1UB 4J6HA 5C3WA 3W3AA 5FO9B 2A68C 4KMUC 4DAYA 3CQZB 1AP0A 1SJED 4K5WA 1LT4D 4C2MB 1FGBD 1WCMB 1IKMA 5CV7A 4IUUA 3QJYA 3HEJA 1E2VA 1F2LA 1A3TA 1SEBD 4J8QA 3HGBA 4EQOA 3I90A 2NN6G 5K36G 1KTKA 2IT1A 2NZ1D 3OWFA 4LJZC 5I4DA 2NVXB 3RUZA 2LMCB 4A3KB 3GQBA 3S16B 1D5XC 1PZKD 4DN4M 1LV9A 3H0GB 5JVG3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QOH A;  2XSC A;  1DM0 B;  4P2C B;  2BOS A;  1D1K A;  1R4Q B;  1CQF A;  1BOS A;  4ULL A;  3MXG A;  1D1I A;  1C4Q A;  1QNU A;  1C48 A;  1CZG A;  2C5C A;  1CZW A;  2GA4 B;  1R4P B;  4M1U B; 
#chains in the Genus database with same CATH topology
 4HCS A;  2AWN A;  1OXX K;  1QOH A;  2I5L X;  4AYB B;  4R4T A;  1F9P A;  3RMH A;  1IHZ A;  1B9M A;  1VQ7 A;  1A2U A;  1JWU D;  3CU7 A;  2IY5 B;  1SRU A;  1VQI A;  1QG7 A;  3OOC A;  1LYL A;  3AFQ A;  4NXN L;  4IFD J;  5IIF A;  2EYO A;  3PF5 A;  2EYH A;  4FF3 A;  4C3H B;  1Q90 A;  1JOK A;  2A8V A;  4MNO A;  3H09 A;  4I7A A;  1I50 H;  4NB3 A;  2VQF Q;  1GVP A;  2IL8 A;  3HP3 A;  4HTH A;  1A3U A;  1AN8 A;  1ET9 A;  4GKK L;  1AH9 A;  2JQO A;  5ELE A;  1Y1V H;  1ESR A;  1WYD A;  4FF1 A;  1JCK B;  2F0J A;  2CQO A;  5IGF A;  5I2X A;  1SNQ A;  5DM6 3;  1PTO H;  1B9N A;  1K83 H;  2JA9 A;  3GTK H;  4IN3 A;  4GLV B;  3H15 A;  3OTO L;  4KHZ A;  1LLR D;  4R4I A;  4HJ8 A;  2K4K A;  1WI5 A;  4QGU A;  2O2L D;  2B39 A;  1I50 B;  4H02 A;  1QNK A;  3VR2 A;  4ZYS A;  3HZX A;  1ZXT A;  1RD9 D;  1HA6 A;  2I5H A;  5T1I A;  1PMR A;  2EZV A;  1VQL A;  4KKS A;  1TY2 A;  1BBX C;  3PMF A;  1EU3 A;  1PFB A;  5DLQ E;  3ULP A;  1Y1V B;  5JPN C;  3I56 A;  4DUY Q;  5FK9 C;  3U50 C;  4NXM L;  4H7B A;  2JEA I;  1G6Z A;  1D6E C;  5C4Z A;  1U4M A;  1XTD A;  1PTO B;  5IE8 A;  1XMO L;  1EFI D;  1K83 B;  4EGV A;  4IFD I;  4N8X 1;  3GTK B;  1F2Y A;  1L0Y B;  4KY5 A;  1G6P A;  1XWE A;  1XNQ L;  1TWH H;  4K8I A;  1D1K A;  1EIF A;  4DV2 L;  2CKZ B;  3I4L A;  2CW0 D;  4U67 3;  4LF8 L;  4XQN A;  3D8G A;  4B3R L;  2MP1 A;  4L5Q A;  1EWC A;  1KDC A;  4LF9 Q;  4GNX B;  5LMU L;  3TBI B;  2F0P A;  1VQH A;  3KLR A;  1KAW A;  2B2Y A;  1T5E A;  3HKZ E;  1VQG A;  1JQY D;  3ZJY C;  2B2W A;  2A6H C;  3MFG A;  4JVZ A;  4RHS A;  1TWH B;  2PNR C;  3QB3 A;  3C46 A;  2WB1 B;  5DEH A;  3AEV A;  4GN4 B;  4YHH L;  4X3U A;  3M9B A;  4JI6 L;  4YCW A;  4DV0 L;  1VQ8 A;  3CME A;  3TZD A;  2E5L Q;  1LTA D;  3FEW X;  3A74 A;  1Q1B A;  3T13 A;  1HZA A;  3GTL B;  5IYC G;  2E2I H;  1SBB B;  3NP8 A;  2C9O A;  4CKB A;  2R7Z B;  1PDQ A;  5DNF A;  4ALP A;  1A3V A;  5C0X J;  3P1H A;  1CA6 A;  1DCZ A;  4A3J H;  4DR6 L;  2ZXP A;  3MZ5 A;  4LFC L;  2IX1 A;  1E2Z A;  2B2T A;  1IBL L;  1PFM A;  1BUV T;  5M3M H;  4KJO A;  2ALY B;  4Y7N H;  4UP8 A;  1EIG A;  2KBN A;  2YV5 A;  5HUR A;  1BF4 A;  4LFB Q;  1GUT A;  3HOZ H;  4DV5 Q;  3CHB D;  1WTQ A;  1LAB A;  3A8J E;  4DNI A;  2E2I B;  2QDB A;  3K8A A;  3K57 A;  3R93 A;  4BXX G;  5JJZ A;  2JSO A;  3E9H A;  1Q3L A;  1LTR D;  2KUM A;  2Z6B A;  4ZK9 B;  3BZK A;  3P75 A;  2CH4 W;  4HMI A;  4UDU C;  1YNJ C;  3OIQ A;  3N6R A;  1Q1E A;  1E1O A;  1SE4 A;  4NP5 A;  2EJG C;  1IYJ B;  4BY7 H;  1Q46 A;  2JYO A;  4LAA A;  1EY4 A;  2LS0 1;  5ELO A;  2WAQ G;  4QL5 A;  5M3M B;  1IYU A;  4Y7N B;  1U4P A;  2B2U A;  4UHV A;  4UY8 C;  1G51 A;  3DEO A;  2PW7 A;  1I6H H;  2EQS A;  1GUG A;  5FJ8 G;  4C3I B;  3HOZ B;  1I3Q B;  1BVS A;  1PLF A;  1KLG D;  4U68 A;  3GDE A;  3CF5 A;  5C0X I;  2RHQ B;  2EPB A;  2N8N A;  1ZKO A;  2CQA A;  3MWY W;  2F3V A;  2DN8 A;  2ZTD A;  4UP9 A;  1HZB A;  2RA4 A;  1K8M A;  3KUP A;  4FO2 A;  2M2L A;  4YWK A;  3RZO H;  4BY7 B;  3AFP A;  3A54 A;  1L1O A;  3S2D H;  3PO2 H;  2AKW B;  1S5D D;  5COR A;  1STG A;  1I6H B;  1RKN A;  2NVQ H;  3E6Z X;  3KBG A;  1DD2 A;  5ISR A;  2L5T A;  4B3S Q;  4HAE A;  3HKZ B;  3CRL C;  3AYH B;  3IFD A;  1IL8 A;  5AJ3 Q;  4L5R C;  4QUF A;  3MXN A;  1E7Z A;  3OSO A;  1ILP A;  1QCB D;  4ZUJ A;  3SK4 A;  2FMC A;  1B4O A;  3H3V C;  4IUT A;  1NMF A;  1VQD A;  2DJF C;  1IXR A;  4AQY L;  4C3J G;  2VUM G;  3EJI A;  1IKL A;  2NN6 I;  1KQS A;  3RZO B;  3LNN A;  1N33 L;  2PQA A;  2EJF C;  3G6E A;  3CCL A;  1K9M C;  5KND A;  3PUV A;  3S2D B;  3PO2 B;  2IHF A;  1JOO A;  5M5W H;  1SYG A;  3HRZ C;  4NKL A;  2L15 A;  1CTM A;  2NVQ B;  1SNM A;  4ODG A;  4JBK A;  2A6E C;  4A3G G;  1TT2 A;  2K5D A;  1KDB A;  2ZT9 C;  2HHH L;  3A55 A;  5JEA G;  1HA5 A;  3NEL A;  1PXU A;  5IYB G;  3F2D A;  1CK1 A;  2A69 D;  1I94 L;  3CCE A;  3MXG A;  3RLO A;  1RTN A;  3P20 A;  3GP7 A;  4KI0 A;  1HNX L;  1HNZ L;  2N78 A;  2R93 G;  1NBW A;  2PW5 A;  1DGS A;  3S1Q H;  4Z9C B;  4LF4 L;  5G3L D;  2L9H A;  3S17 H;  4LFA Q;  1HFG A;  5CGK A;  2O5J C;  2MPM A;  4YY3 Q;  1PYB A;  1P8L A;  3J7A V;  5BR8 Q;  4WJW A;  4KJN A;  5M5W B;  1S72 A;  1PHJ A;  2K75 A;  4ILW A;  3FHW A;  1SXT A;  5IP9 G;  2BH8 A;  1PFN A;  1MBY A;  2L0C A;  2EYL A;  1MJC A;  4DR1 L;  1KLU D;  1WTX A;  4A3M G;  1S5C D;  1M8A A;  4DR4 Q;  2B2W C;  3S1Q B;  3ND9 A;  5M3F G;  1YNN C;  3I8Z A;  2F0G A;  2F0I A;  1I4R A;  1EZ8 A;  4K6L A;  1B3A A;  4GZY C;  3S17 B;  3DWP A;  4IAL A;  3H6M A;  2LFN A;  5C4H A;  2JP1 A;  2UUA L;  4JK1 C;  3KF8 B;  3NBI A;  4N8F A;  4K5X A;  4QIW E;  4RGN A;  2C35 B;  3I70 A;  4BWG B;  2A69 C;  1SNP A;  1JIC A;  2MHV A;  4X65 L;  4QQB X;  3VR4 A;  2IPK D;  5C3E G;  3I73 A;  4I7Z C;  5C4J H;  1RCV D;  5M5X H;  1I5F A;  1Y1W H;  1GM5 A;  1STB A;  1LT3 D;  3CP0 A;  4UPA A;  1UNS A;  1EYC A;  3H3V I;  4HSV A;  2HIX A;  1NTG A;  2KEE A;  3I4M G;  3UDG A;  2RDH A;  1SJH D;  5FLX L;  2UU9 Q;  1KRS A;  2Z4I A;  5C44 H;  2L1B A;  1HFN A;  1SYE A;  4GOP B;  2N88 A;  5J22 A;  2M9V A;  2VQF L;  2CWA A;  3H94 A;  4IPD A;  3X3M A;  1F9Q A;  4X62 Q;  1PH6 A;  1EY7 A;  1EY9 A;  4G7O C;  2PI2 E;  4JW0 A;  1TS3 A;  3TS2 A;  1YJW A;  1VQJ A;  1OXV A;  4R8N A;  5C4J B;  1C48 A;  3T51 B;  5M5X B;  2YTV A;  1EEI D;  4BBS H;  1FNU A;  1Y1W B;  1MJE A;  2MO1 A;  4DR5 Q;  2B2U C;  2WKD A;  3DM1 A;  1B3Q A;  3NHH A;  4A93 H;  4HCE A;  5C44 B;  4QUC A;  3SXH A;  1STY A;  2Y0S G;  3FKI H;  1Y69 U;  4DFA A;  4L5T A;  3I3C A;  1JT8 A;  3R3O A;  1EU4 A;  3V96 A;  3C3L A;  1PV4 A;  1WTO A;  2CHB D;  1T5X D;  2ZTE A;  1NR2 A;  5IGG A;  5D3I B;  1Y8P B;  3CMA A;  1X3F A;  1EEF D;  4EVO A;  3HOY B;  4BBS B;  4DUY L;  1IBM Q;  4BS9 A;  1ROD A;  3NK9 A;  4DR7 Q;  3VYR A;  2OQK A;  2K28 A;  1N32 Q;  2F0H A;  1SN8 A;  3H91 A;  4A93 B;  2RBM A;  2A68 D;  3JAM i;  1AEX A;  2KCT A;  3FKI B;  1YI2 A;  1A2T A;  2JA7 B;  3E3X A;  1TS5 A;  2OTL A;  1H9J A;  1Z47 A;  3QO2 A;  2KCN A;  3DXJ C;  3MTS A;  1BR9 A;  5G3L F;  2JA8 B;  5JPM C;  1ET6 A;  5IP7 G;  4LF9 L;  2L12 A;  2XSC A;  3CCR A;  5KYI A;  4FF2 A;  2UXB Q;  1XPU A;  4KD4 A;  1O80 A;  4DV3 L;  1JB7 A;  1B44 D;  2TMP A;  1PH4 A;  1RIP A;  2A73 B;  3F2C A;  3TEH B;  4TRD A;  3LWE A;  1CZG A;  4K2K A;  1O7I A;  3WOF A;  4QIW B;  4A76 A;  4JBM A;  3HS0 C;  5CBE E;  5C4X H;  5IY0 A;  4KHP Q;  3CXC A;  3PIP A;  5FLX E;  4FVM A;  5EKL A;  4B9X A;  2XTI A;  3WOE A;  4J1M A;  2E5L L;  2V4D A;  2VZA A;  4O42 A;  1BCP C;  4A3D H;  4WJ3 M;  2NYZ D;  5C0X H;  4XT1 B;  2F0W A;  5FLM H;  4OEL B;  1NNX A;  3EQL C;  5JEA J;  1F9S A;  4F88 A;  4V19 0;  3A5Z B;  4GN5 A;  1DJR D;  1XJV A;  4FF4 A;  4JI4 Q;  1OXS C;  3QIA A;  1SYC A;  2RCN A;  4XQQ A;  1JC7 A;  1CHQ D;  2F0M A;  2NVT H;  3VYS A;  1FGU A;  3BS1 A;  3PV0 A;  3J81 j;  3DHQ A;  1D2B A;  2K14 A;  5C4X B;  1DXM A;  4KK7 A;  2RCF A;  2F0D A;  3BVM A;  1QZG A;  2VNU D;  5EBC A;  3BYY B;  2JA6 G;  3GTJ H;  3EVQ A;  4L63 B;  4LFB L;  2PCF B;  2G9H D;  1YVC A;  4DV5 L;  4P73 A;  1G2T A;  4X3S A;  4A3D B;  3J81 E;  3TZU A;  1QUQ B;  2QDL A;  5E4W C;  5CMD A;  1CZW A;  1WTH A;  1D5M C;  5A2Q L;  3D6W A;  4H44 C;  4F7X A;  4B3M Q;  2NN6 H;  3OPO A;  5FOB B;  5K36 H;  1DM0 B;  2NVT B;  1V43 A;  3GO5 A;  2O4X A;  2A74 C;  4CKE A;  2HT1 A;  5E4X A;  4B08 A;  4DV1 Q;  3MXU A;  4DF7 A;  1G2S A;  3NBH B;  2KEN A;  1QE6 A;  1TS4 A;  4DAV A;  3GTJ B;  1GUS A;  2MUY A;  4ZLT F;  2OCE A;  4KD3 A;  5IT9 E;  2ZXO A;  1I6V C;  2B8F A;  3STB C;  3GTM H;  4G7H C;  2I46 A;  1MHW C;  1WVL A;  4PMB A;  4DAM A;  3IL8 A;  1PZI D;  4YCU A;  3ERO A;  1YHB A;  1JJG A;  2Q8R E;  4TVA B;  4OEM B;  1L2F A;  2NVY H;  3M4O H;  4XXE A;  3I4N G;  3GTQ H;  4XYO A;  4DAY B;  2VW9 A;  5KIX A;  5D14 A;  2F52 A;  2JK8 A;  3KJO A;  4IPC A;  2K01 A;  2IX0 A;  4P71 A;  1VQE A;  3J7A 5;  5J39 A;  4B3S L;  4LF6 Q;  4RA8 A;  5ELF A;  3L7Z C;  1ICW A;  3GTM B;  1VMC A;  3KYH C;  2QKI C;  2CH4 A;  1TXY A;  5AJ3 L;  1Z7T A;  3QOL A;  3KDF B;  1FYC A;  3V05 A;  3S1R H;  2UUC Q;  2K05 A;  4ZQ3 A;  1EZ6 A;  3WDN A;  2FMM A;  4YWL A;  2UXC Q;  1D7Q A;  2NVY B;  3M4O B;  2NTT A;  5FO8 B;  1VCI A;  2R3Z A;  1V8Q A;  3TDQ A;  1EY5 A;  4G4K A;  1TWG H;  1V1P B;  1TY0 A;  1JE4 A;  3OYY A;  2A6H D;  2HDL A;  3D4D A;  4LW1 A;  4JC0 A;  5KGU A;  2KHJ A;  2WV6 D;  1CI3 M;  1OTC A;  3PUW A;  3M3Y H;  1B2T A;  1X56 A;  2EOT A;  4P72 A;  1I4P A;  3DLL A;  1W6K A;  3K81 C;  1BOS A;  4GNX A;  3NEN A;  1WTR A;  2X6L A;  1C4Q A;  4PMW A;  1A6X A;  3VR6 A;  5KNB A;  2DNC A;  5TSS A;  3S1R B;  3VA5 A;  1HNW Q;  4DUZ Q;  1S3O A;  3ITP A;  2XWB B;  4IUQ A;  1V1Q A;  4DXF A;  2EYP A;  3H3V H;  4QB4 A;  1SFO H;  1CQV A;  1KNA A;  1TWG B;  3SEB A;  1M4V A;  3AB9 A;  4LFA L;  4IZ8 A;  5IGD A;  4YY3 L;  4R1J A;  4A75 A;  2F0F A;  5T1G A;  5BR8 L;  1CFM A;  2Q8I B;  5GAH C;  4DK1 A;  1DYQ A;  4DV7 Q;  5C3X A;  3M3Y B;  2N3S A;  3UDX A;  5BN4 A;  2D62 A;  3K5M A;  2J4X A;  1ENF A;  1PZJ D;  2WAQ E;  2H5X A;  1S5F D;  2H1E A;  3BDO A;  3M4P A;  2MNA A;  2HDM A;  2JA5 G;  2K33 A;  1WJJ A;  3AU7 A;  3RD4 A;  4A3F H;  4DR4 L;  3HOW H;  1SYF A;  3KOJ A;  4ME3 A;  1R4Q B;  1SFO B;  1ZYR C;  2NBF A;  4G57 A;  4RKL A;  1X3Q A;  2K7V A;  2YYZ A;  1X3G A;  4X64 Q;  2DY8 A;  2RKS A;  3OW2 A;  4CGY B;  1YNJ D;  5IGE A;  1HXY D;  2D5D A;  1I4G A;  4IO9 A;  2D0O A;  1SE3 A;  4FNF A;  2XWJ B;  3EA6 A;  4OGQ C;  3CKI B;  5IYC H;  1PH7 A;  3EN2 A;  3T53 B;  2R7Z G;  3T56 B;  4OO1 G;  4A3F B;  5KEE A;  4HR7 B;  3F8T A;  1EWH A;  5I9O A;  1Y8O B;  3HOW B;  2N49 A;  5E3F A;  2VQE Q;  5FO7 B;  3BU2 A;  2PYK A;  3BVZ A;  4RFB A;  2HCI A;  4NDX A;  1VQ6 A;  2AHO B;  1SMY C;  1TQO A;  2DJG C;  3J80 L;  1VQ9 A;  5COY A;  1SLJ A;  2UU9 L;  5F2D A;  1HHV A;  4I65 A;  4DAP A;  2WKC A;  2XVS A;  3HOV H;  2DUD A;  4IJL A;  3ZYY X;  4X62 L;  1RF2 D;  2NUC A;  4HED A;  4ZKB B;  3HG9 A;  3K59 A;  1H9S A;  4A3B G;  2ES2 A;  1A62 A;  3TS0 A;  4DR5 L;  3BDL A;  5M3M G;  1V9P A;  1UWV A;  4CDD C;  4A3J B;  1YJN A;  2FIN B;  3EBE A;  4ZAI A;  3RR5 A;  4C3I G;  1UE6 A;  1O7L A;  3ONA B;  2WIN B;  2JN4 A;  1F2Z A;  4OIK A;  5FJ8 H;  4IQZ A;  2HD3 A;  3UE0 A;  3HOV B;  4RHR A;  2F4V Q;  3R2I A;  1Q8I A;  4PV1 C;  2A6E D;  3T1Y Q;  3Q22 A;  2AQ3 B;  4JI8 Q;  4R4C A;  4BA1 I;  2WFW A;  3A5U A;  2E75 C;  1D5Z C;  4LK1 C;  4PG3 A;  4QMG A;  1IBM L;  1PYW D;  4HSP A;  4HMJ A;  1JJC B;  2VY3 A;  4DR7 L;  4ZKC B;  3NWS A;  4CDF C;  1FVI A;  2B63 G;  1EQT A;  1GUN A;  1N32 L;  5BN5 A;  4JI1 Q;  3VYT A;  4S3S A;  3Q6S A;  2LSS A;  1PH9 A;  3ICE A;  1Q7Y C;  1EIH A;  4GLA C;  1IW7 C;  3A8I E;  3JAM L;  2OWO A;  1PTO C;  4R4Q A;  2F1M A;  3MEF A;  1Q12 A;  1QVG A;  2CWP A;  1W3S A;  3L3O C;  4K0K Q;  2EY6 A;  3OHX C;  1ONL A;  3L9A X;  3Q0A A;  3SK8 A;  1HR0 Q;  4JI0 Q;  2UXB L;  2EY1 A;  5K5P A;  3S14 H;  4C3J H;  2PQE A;  4RKB A;  5EQ0 A;  1JR0 D;  3PO2 G;  3QWN A;  1HZ9 A;  2XN9 C;  1R4P B;  1STH A;  2EVB A;  1YNN D;  4PZ8 A;  1LUZ A;  2R6G A;  3J80 E;  1RL2 A;  4KHP L;  5I2Y A;  3HOU G;  4GNX C;  4PZ7 A;  3HOX H;  1YNX A;  3D3R A;  1G91 A;  1E1T A;  4JI5 Q;  4A3G H;  4YIJ A;  5JEA H;  3CPF A;  4GLX A;  1BO0 A;  5IYB H;  1CT1 D;  1AE2 A;  4Y52 H;  3PIO 3;  1BNZ A;  2OQ0 A;  4FXG C;  1K0R A;  1WOC A;  4XYQ A;  2Q2U A;  2ICE C;  2XIW A;  1PRT C;  4PZ6 A;  4C3J B;  1S4Z A;  2HUG A;  5J1Z A;  3L0O A;  1DOM A;  3PSI A;  1C9O A;  5CC4 A;  1QVF A;  2RQX A;  3B6Y A;  4HJ7 A;  4JI4 L;  3PF4 A;  2D0P A;  1L1O B;  1VQ5 A;  3FPU B;  3SK6 A;  2BDN A;  3KF8 A;  1IYV A;  2JE6 I;  1O78 A;  3MXP A;  1DOK A;  2F0O A;  5JAV A;  1N8R C;  3HOX B;  4RMF A;  3S24 A;  4A3G B;  4HIO A;  2BH2 A;  1C8C A;  2F0V A;  2Y0S E;  1SDF A;  1QJO A;  2OTJ A;  1G8Z D;  3MXN B;  3NXW A;  4ZRZ A;  2PPB C;  4JI7 Q;  1HUM A;  4LMQ D;  3MHB A;  1XNR Q;  2OEO A;  4OON A;  4KY6 A;  5EJW A;  1W6J A;  5M3F H;  3TRE A;  4B3M L;  1GHK A;  1I4Q A;  2PQA B;  2RF4 A;  3F2B A;  5D3D A;  1TS2 A;  1TU2 B;  1VMP A;  2BE5 C;  4JBW A;  5CV6 A;  1NCV A;  4DV1 L;  1CA5 A;  3KK7 A;  4L8J A;  1KHI A;  4BBR G;  5NUC A;  4EQ5 A;  5C3E H;  1KC8 C;  3JAM E;  2FJ2 A;  2H4O A;  1ESF A;  3K0X A;  5C5M A;  1U4L A;  5IWA Q;  3I55 A;  4G7Z C;  2PZT A;  4TKO B;  2GVB A;  1O7Z A;  1CKN A;  5M3F B;  4IFD H;  4ZUI A;  1VQF A;  4DR3 Q;  1GHJ A;  2NZH A;  2EY2 A;  2AUK A;  4R9W A;  1F77 A;  3I4M H;  1EQR A;  2AQ2 B;  1H95 A;  1HR0 W;  2LKV A;  4XT3 B;  1TWC H;  4YWM A;  2UXD Q;  3CW2 C;  4KN4 C;  4EQN A;  3MC0 B;  1TKW B;  1B50 A;  4OX9 Q;  4DKA C;  3HFZ B;  4K14 A;  5IYD G;  2Q2T A;  1XPO A;  3F2U A;  3SVM A;  1SE2 A;  3FRP B;  2A19 A;  3NTK A;  4LF6 L;  1C0A A;  2KJX A;  4XTC S;  1E0B A;  2SOB A;  3NQT A;  3FP9 A;  4JI2 Q;  5JJL A;  4UAI A;  3UE1 A;  1S5E D;  1SMX A;  2UUC L;  2BCO A;  2C5C A;  1HCZ A;  1V1O A;  2UXC L;  4DNT B;  5C44 G;  1TR5 A;  4DA2 A;  1H9M A;  1FD7 D;  3I4M B;  1CKO A;  3C1F A;  3TSS A;  2K5V A;  1MGS A;  1TWC B;  3CD6 A;  3V2T A;  4RGT A;  1H9R A;  3A56 A;  3SK5 A;  1RHP A;  4F8M A;  2NTS A;  3MA2 B;  2EYM A;  2YTX A;  1B8A A;  5JVH 3;  4DGZ A;  3A7A B;  2EY5 A;  5M5Y H;  3DMU A;  1JOQ A;  3HOY G;  4KHV A;  3PO3 G;  5ELB A;  5CV5 A;  3T4A C;  2B2V A;  3MEH A;  1BCP D;  2FHT A;  4A3E G;  1HNW L;  1EOT A;  4OO1 I;  5FKA C;  4DUZ L;  2F4I A;  2SNS A;  4WOR A;  2PZU A;  5M9O A;  3CCJ A;  4A93 G;  3N52 A;  1KAA A;  4RG1 A;  4OL7 A;  4RGM A;  1EL0 A;  3FKI G;  2I5M X;  1SNO A;  4PQX A;  2JA7 G;  3BJU A;  5GQO A;  1Z6H A;  3S9W A;  3E0J A;  3TP8 A;  4IUV A;  3NE5 B;  3J7Y W;  2X6G A;  3CRK C;  5LMN Q;  1KD1 C;  3A8K E;  1EY6 A;  4XQJ A;  2K50 A;  4DPG A;  2JA8 G;  1PYS B;  4LF5 Q;  1ASZ A;  4JOI A;  4DV7 L;  2I07 B;  5EPJ A;  2K6A A;  1K3R A;  2TSS A;  2EJM A;  2R7D A;  4IPH A;  3PUY A;  4QF4 A;  2R92 G;  4C56 C;  4A3I H;  1LTG D;  3DM3 A;  1BKB A;  3CCM A;  4A3C G;  2GVA A;  1VS0 A;  2D9U A;  5IGB A;  4A3L G;  3DUZ A;  2F0N A;  1HH2 P;  1LTL A;  1ENC A;  2LXK A;  1DOL A;  3G7L A;  3I72 A;  1LT6 D;  1CSQ A;  2E74 C;  4K8J A;  4JG2 A;  5HGT A;  3RN5 A;  1NR4 A;  4F87 A;  4X64 L;  2VL6 A;  3K80 C;  1HTP A;  1A15 A;  2K5Q A;  1WFQ A;  2E76 C;  3G4S A;  2EE1 A;  1EIY B;  1ILQ A;  3SE0 A;  3AMU A;  4DV6 Q;  4IOC A;  1KNE A;  2KED A;  4JCV E;  2ID0 A;  1ENA A;  4MN3 A;  2E2J H;  3STB D;  4A3I B;  3GD7 A;  3TN2 A;  5CYU A;  5ELN A;  4BY1 G;  1ASY A;  2DY7 A;  2B29 A;  2Z8L A;  2VQE L;  2L11 A;  1KRT A;  2K52 A;  3CQZ H;  4YCV A;  1HZC A;  5C4X G;  4IUR A;  4M8A A;  4QCL A;  2BDO A;  2E2D C;  4MTN A;  1UUP A;  5J3B A;  5IGC A;  1LO5 D;  1WCM G;  2JA6 H;  4C1N K;  3GV6 A;  2MGS A;  1MKH A;  4LWC A;  4TSS A;  1VF5 C;  2VB3 X;  3NTI A;  3CC7 A;  4K2L A;  1QNU A;  3UI2 A;  1FJG Q;  1OXT A;  3E0E A;  4LUV A;  1CUK A;  4PMC A;  3URY A;  2E2J B;  2A5H A;  1STA A;  5KYL A;  1KDA A;  1OO9 B;  2UUB Q;  1X54 A;  1WD0 A;  1PFS A;  2IW3 A;  2SDF A;  5GRO A;  3Q24 A;  4GOP C;  1VQN A;  1KAB A;  1Z9F A;  1MI2 A;  4HID A;  1E3P A;  2XGT A;  1LTI D;  4ID6 A;  1II3 A;  3GTG H;  4JPB W;  2ZJP A;  1JWM D;  5CV4 A;  3TQY A;  3W5O A;  2L4N A;  4A3K G;  1RTO A;  2JA6 B;  3CCQ A;  4QY7 A;  3H0G G;  3NQI A;  3I2Z A;  5H1S E;  4LUO A;  4AYB G;  2F4V L;  2JEB I;  2ZTC A;  5LMN W;  3T1Y L;  2QEX A;  3IAY A;  3W2D A;  1QVC A;  4JI8 L;  5KRU A;  1F2M A;  2F0K A;  2VXW A;  5I6W A;  5FLX c;  5EKK A;  2MO0 A;  1YHQ A;  3KLW A;  1JWS D;  1V1P A;  3I4N H;  4MIU A;  1NMG A;  3KF6 B;  1NJI C;  4C3H G;  3GTG B;  3W1B A;  2ZJQ A;  4JI1 L;  4OHJ A;  3WWV A;  3R8B A;  1LTT D;  3RN2 A;  1VQA A;  1BCP F;  1Q8K A;  5EPL A;  3ND8 A;  5JJI A;  1PA6 A;  3QOJ A;  3MFY A;  4K0K L;  3PUX A;  4MHE A;  3Q8D A;  3VA7 A;  1T9H A;  3GTP H;  4ME5 A;  1HR0 L;  4JI0 L;  2F0L A;  3LX0 A;  4NMZ A;  5EKI A;  2Z6K A;  4B3T Q;  2RVL A;  3Q23 A;  3I4N B;  1NSN S;  3J81 c;  1FNW A;  1UEB A;  4NW2 A;  3GTQ B;  1YBY A;  1LTB D;  4KY7 A;  1S40 A;  2MQH A;  1KXL A;  1N36 Q;  4O1N A;  2Q2H A;  4TQU S;  4V0B A;  1ZYR D;  4JV5 Q;  2QEJ C;  4K5V A;  1VDZ A;  5GAD C;  2ZM6 Q;  2MFI A;  4RCO A;  4J15 A;  1J9O A;  4L5S A;  2DNE A;  3K5O A;  1F9R A;  2EYF A;  4JI5 L;  3U9S A;  2B2V C;  3ULL A;  4KN7 C;  2EDG A;  4HN7 A;  4CDC C;  2RSN A;  1Y1V G;  2PMZ E;  5EAY A;  1HQM C;  4X3T A;  3KLS X;  4XDX A;  3VYU A;  4RAU C;  1M1K C;  2AUJ D;  3KFU A;  3GTP B;  1HTL D;  1HUN A;  4OXP A;  2WP8 J;  1N34 Q;  2EXD A;  5IT9 c;  5HY6 A;  3J81 i;  3U4V A;  2D2C C;  2Z1C A;  3P7J A;  1XPR A;  5A2Q E;  3M4Q A;  1TWF H;  3KLS A;  5D65 A;  1YIJ A;  4JOI C;  1SMY D;  3BYT B;  1CQF A;  4AIM A;  2ENB A;  3R2T A;  3K5N A;  2NWG A;  2JA5 H;  4FP5 D;  3M7G A;  4JI7 L;  4LF7 Q;  3NPP A;  1XNR L;  3C2P A;  1KL9 A;  3OMC A;  3RZD H;  3BG3 A;  1K8A C;  1GO3 E;  5CBA E;  1SAP A;  5LL6 X;  1QZH A;  1A63 A;  5L37 A;  5LL6 S;  2HQE A;  1K3B C;  2WB1 G;  1TWF B;  1CSP A;  5EBD A;  1M90 C;  2RDG A;  3K7U C;  1MIU A;  1SE8 A;  3SHL A;  1LTS D;  4OWX B;  2HQL A;  3GTL H;  1VQB A;  3TME A;  2Z9H A;  4DV4 Q;  4A3F G;  1NUC A;  3RLF A;  2IX3 A;  2F0Q A;  4FYD A;  2QIL A;  2P5Z X;  4X66 Q;  2R7Z H;  4DV3 Q;  3HOW G;  2JA5 B;  4OO1 H;  3T16 A;  3BZC A;  3AQQ A;  3K7A H;  1Q82 C;  3IFT A;  5IWA L;  3RZD B;  2E2H H;  2GN5 A;  2IJ0 A;  1X6O A;  4E6I A;  4R4O A;  2PNH A;  2SEB D;  4KKU A;  1PRT B;  1Y8N B;  4DR3 L;  5ELC A;  1HJP A;  2F3I A;  1PH3 A;  4IUP A;  3J7Z C;  1HQR D;  3C1E A;  1LT5 D;  1Y14 B;  2KCM A;  3G48 A;  4CJ0 B;  1E2W A;  2UXD L;  5C5L A;  4OX9 L;  5IOD A;  5DM7 3;  3W1G A;  1WD1 A;  1XTC D;  1PH5 A;  1K0S A;  1AE3 A;  2KOL A;  1IW7 D;  3U9O A;  4GKJ Q;  1PTO D;  1HRJ A;  3DEP A;  1J5E Q;  4JI2 L;  3FPP A;  4BXX H;  2RSO A;  3K7A B;  4N9P A;  2E2H B;  1SSO A;  1XMQ Q;  1X3E A;  2F03 A;  4EX5 A;  1U4R A;  1UE5 A;  4A3J G;  4A3B H;  3S1N H;  5A35 A;  3U58 A;  4BA2 I;  2CW0 C;  3IKJ A;  5KNC A;  2ICI A;  4DK0 A;  2EYJ A;  2N55 A;  4DNR B;  3I91 A;  1LM0 A;  1UE7 A;  4DXG A;  4CHT B;  4C3I H;  3HOV G;  3T1H Q;  2A1A A;  1I3Q H;  2PMZ B;  3HOZ G;  1GXD C;  4C1N I;  4ZCK A;  1XXG A;  2Z4H A;  4IPG A;  1BXT A;  4ABN A;  4JI3 Q;  1STN A;  4HJ5 A;  3TP6 A;  1KIX A;  2EXZ A;  3M85 A;  1PH1 A;  1GOZ A;  3CC4 A;  1STE A;  3DWA A;  1FNV A;  1SYB A;  1EFW A;  4A3B B;  3UDF A;  3S1N B;  4BY7 G;  1PRT D;  3GV3 A;  1JOR A;  1WTW A;  2ZXR A;  2B63 H;  1K28 A;  4JYA Q;  2NZO A;  1D1I A;  3BVG A;  1IBK Q;  2AWO A;  2WAQ B;  3GTO H;  4DK3 C;  5ELD A;  4DR2 Q;  1SYD A;  1HPC A;  1EWI A;  2LY7 A;  2SNM A;  3OIP A;  5LMN L;  3S15 H;  2G5D A;  1B7Y B;  4LF5 L;  3HKZ G;  1X65 A;  4JBJ A;  1JJ2 A;  3D6C A;  5IOC A;  2F3W A;  1I4X A;  3D4W A;  1VQP A;  3MVV A;  2KA7 A;  4LUZ A;  2Z6K C;  4H0L C;  1H9S B;  1LAC A;  5EPK A;  1CM9 A;  4MZ9 A;  1JE5 A;  2O5I C;  3ER0 A;  2VUM H;  4NXN Q;  2K32 A;  1VQ4 A;  1GUO A;  2B63 B;  4K6D A;  2QGQ A;  2KHI A;  1H9K A;  3HKS A;  1C7Y A;  4CJ2 C;  1J6Q A;  4POG A;  3HOU H;  3GTO B;  2G9D A;  2KVM A;  3S15 B;  1NAP A;  5JOB A;  2BE5 D;  4NPS A;  3ERQ A;  4HJA A;  4GKK Q;  2XRS D;  3I4O A;  2WAC A;  2YTY A;  3S1M H;  4DV6 L;  4WFN 3;  2BOS A;  4OWW B;  1PH2 A;  3BDC A;  4Q5V A;  4XIG S;  3EIV A;  2R93 H;  1IL2 A;  1J8I A;  3OTO Q;  3S14 B;  1RDP D;  2VUM B;  1OXU A;  3M4Y A;  2K03 A;  4PNY A;  1YEZ A;  2EIF A;  1B70 B;  3HOX G;  5I6Y A;  1UE1 A;  3K6O A;  3HOU B;  3F1Z A;  1PH8 A;  3PUZ A;  1VF7 A;  1FL0 A;  1RJT A;  4WJ4 A;  1UAP A;  1EQQ A;  5IP9 H;  3S1M B;  4L6T B;  1I4H A;  3PIO A;  2F0U A;  5GAG C;  4KV6 A;  1AFP A;  1FJG L;  4NXM Q;  1YHA A;  1XMO Q;  4A3M H;  1EYA A;  2FFK B;  2R93 B;  2XNA C;  2UUB L;  2RDF A;  4POF A;  4OWT B;  3G6J B;  1XNQ Q;  1K8G A;  3LGJ A;  5JJK A;  1YZ6 A;  3VDY A;  3OMG A;  4DV2 Q;  3DWQ A;  4KKT A;  1YIT A;  3ULJ A;  2QW7 A;  1BQQ T;  3CCV A;  1AW7 A;  3SGI A;  4GOP A;  4MTK A;  4LF8 Q;  1BBU A;  2FXQ A;  1PTO F;  4B3R Q;  4BBR H;  2X69 A;  2B2Y C;  1GUW A;  5LMU Q;  1CKM A;  1MSH A;  4R8I A;  3K58 A;  2KQ3 A;  1Q86 C;  1SR3 A;  1ZEQ X;  3OW7 A;  2B8G A;  2QCP X;  3J80 c;  1QB5 D;  1XX8 A;  2QA4 A;  5GAE C;  2BA1 A;  4A3M B;  5C6A A;  2KEC A;  1BCP B;  3FMC A;  4H13 C;  4P2C B;  1U0L A;  1XYI A;  3A0J A;  3U4Z A;  3TP7 A;  1S5B D;  4ULL A;  3SDZ A;  3KBX A;  1EQV A;  5DAU A;  1G29 1;  2B3G A;  4YHH Q;  1VQM A;  2LXJ A;  4JI6 Q;  1UEA B;  4HJ9 A;  4DV0 Q;  3JC6 6;  1NE3 A;  1ML0 D;  2DGY A;  1FR3 A;  3LWU A;  2YU9 H;  4FXD A;  1A8V A;  1N9W A;  3QR8 A;  5IYD H;  2F0E A;  1X9N A;  4BBR B;  2CVR A;  2V1C C;  1X3P A;  1EYD A;  1P16 A;  3NEM A;  3ERS X;  3J80 i;  4P75 A;  1PRT F;  4O0A A;  1IZ6 A;  5C3E B;  4CJ1 B;  2B2T C;  1B1Z A;  4IFD G;  1Y1W G;  2F0T A;  1L0X B;  2QF7 A;  4GS3 A;  5BN3 A;  4HIM A;  4LFC Q;  4DR6 Q;  1EUJ A;  1Q81 C;  4B3T L;  1IBL Q;  3CCU A;  3FVQ A;  3TRZ A;  2K5W A;  4DU9 A;  4OIJ A;  1MSG A;  1N36 L;  2YU9 B;  1JMC A;  3CPW A;  4JV5 L;  4X3K A;  5E1F A;  4AH6 A;  5LHY 1;  2J7Z A;  1DZ1 A;  2L55 A;  2ZM6 L;  3G71 A;  3RLN A;  1X55 A;  2M00 A;  2Z0S A;  5I9P A;  3OWE B;  2F0S A;  1VQO A;  3L2P A;  3KJP A;  1EY0 A;  3HOY H;  3PO3 H;  1BBW A;  1B53 A;  3D31 A;  4BBS G;  1JB3 A;  4B9W A;  1U9R A;  2K5N A;  4A3E H;  3NWT A;  1K8O A;  2NB0 A;  1CKN B;  2BA0 A;  1SRO A;  2CCZ A;  1A0I A;  1N34 L;  3MAQ A;  1MD2 D;  3NUC A;  4IUN A;  2JXM B;  2KHS A;  2MJ8 A;  3M7N A;  1TII D;  4RCN A;  2JA7 H;  3JAM c;  5CV8 A;  4KTA A;  1U5K A;  2HCC A;  2ZJR A;  4IOA A;  3J81 L;  2OF1 A;  1TVX A;  1O7Y A;  2Y0S B;  4RGO S;  2JA8 H;  1AZQ A;  3D0F A;  3VR5 A;  2GA4 B;  3VR3 A;  5CR3 A;  1WTV A;  5M5Y B;  3PO3 B;  1W2B A;  3K0Y A;  2I0Q A;  3NTH A;  4EQP A;  1SNC A;  2R92 H;  2IHE A;  5IP7 H;  4LF7 L;  1L1O C;  3UDI A;  3E9I A;  3SR1 A;  4CBV A;  4A3E B;  1VQC A;  2PO4 A;  4Q0F A;  3S2H H;  4A3C H;  4A3L H;  4AYB E;  3NSW A;  1DON A;  1EY8 A;  2K5H A;  3FDT A;  4WRD A;  3X3N A;  3PQI A;  2KCC A;  5IT9 L;  4O2D A;  3PIP 3;  4GN3 B;  2PI2 A;  3CAM A;  3CCS A;  2HIV A;  5EGT A;  3IRB A;  2PZW A;  1PVO A;  5AFW A;  4CKC A;  3A7L A;  4X6A H;  2Q2I A;  4RWS C;  1AZP A;  4DV4 L;  4A3I G;  1QWY A;  4N9T A;  3PCO B;  2K04 A;  1X32 A;  1QUQ A;  3BZD B;  1R9T H;  4X66 L;  2R92 B;  1WTP A;  4AQY Q;  2XRQ D;  1GKH A;  3E5S A;  1TWA H;  3S2H B;  1GJX A;  4BY1 H;  3D4R A;  3TP5 A;  1EOV A;  2AQ1 B;  3EFX D;  1N33 Q;  2ASB A;  2R7F A;  4RH6 A;  4FXK C;  4DK6 C;  3I7F A;  1L0W A;  3QG1 A;  2J0T D;  2OT2 A;  3NBH A;  4C2M H;  1WCM H;  1VQK A;  2RHS B;  2Q8T A;  2HHH Q;  3CC2 A;  3PGZ A;  1ICF B;  2OXP A;  2VS1 A;  1I94 Q;  4A3D G;  2VB2 X;  2K1B A;  5C0X G;  5CV9 A;  1K73 C;  4KLK A;  1HNX Q;  2E8G A;  2WII B;  1QIL A;  5FLM G;  1HNZ Q;  4LNQ A;  2IWH A;  1R9T B;  1YJ9 A;  2R61 A;  2AMC B;  2ATW A;  1CHP D;  1SND A;  3O13 A;  3J7A F;  1TWA B;  4LF4 Q;  4GKJ L;  1BDO A;  4QJF A;  4BY1 B;  3K5L A;  5E7N A;  1J5E L;  4M1U B;  4J6H A;  4CDE C;  5C3W A;  3KF6 A;  3W3A A;  5FO9 B;  1XMQ L;  2A68 C;  3RNU A;  4KMU C;  4DAY A;  1GD7 A;  3CQZ B;  1AP0 A;  1SJE D;  4K5W A;  4UP7 A;  2NVX H;  1LT4 D;  4C2M B;  2CFM A;  1FGB D;  4A3K H;  1WCM B;  1IKM A;  3T1H L;  5CV7 A;  3S16 H;  1EYG A;  4IUU A;  4HIK A;  1NY4 A;  3H0G H;  4DR1 Q;  3QJY A;  3HEJ A;  1E2V A;  1E22 A;  1F2L A;  2JJQ A;  4JI3 L;  1A3T A;  1SEB D;  3KDF A;  4J8Q A;  1E24 A;  4P74 A;  3HGB A;  4EQO A;  3I90 A;  2NN6 G;  5K36 G;  4A4I A;  1KTK A;  2IT1 A;  4IJH A;  2NZ1 D;  3OWF A;  4C3H H;  4LJZ C;  2UUA Q;  5I4D A;  4JYA L;  2NVX B;  4APV A;  3RUZ A;  2LMC B;  5HGQ A;  4FDB A;  4A3K B;  3GQB A;  1IBK L;  3S16 B;  1D5X C;  4DR2 L;  1PZK D;  4DN4 M;  1LV9 A;  2WB1 E;  4X65 Q;  3H0G B;  5JVG 3;  1D8L A; 
#chains in the Genus database with same CATH homology
 4HCS A;  2AWN A;  1OXX K;  1QOH A;  4AYB B;  1F9P A;  3RMH A;  1IHZ A;  1B9M A;  1A2U A;  1JWU D;  3CU7 A;  1QG7 A;  3OOC A;  4IFD J;  5IIF A;  2EYO A;  2EYH A;  4FF3 A;  4C3H B;  1Q90 A;  1JOK A;  3H09 A;  2IL8 A;  3HP3 A;  4HTH A;  1A3U A;  1AN8 A;  1ET9 A;  5ELE A;  1ESR A;  4FF1 A;  1JCK B;  2F0J A;  5IGF A;  5I2X A;  1SNQ A;  5DM6 3;  1PTO H;  1B9N A;  4IN3 A;  4KHZ A;  1LLR D;  2O2L D;  2B39 A;  1I50 B;  4ZYS A;  1QNK A;  3VR2 A;  3HZX A;  1ZXT A;  1RD9 D;  1HA6 A;  5T1I A;  2EZV A;  1PMR A;  4KKS A;  1TY2 A;  1BBX C;  3PMF A;  1EU3 A;  1PFB A;  1Y1V B;  5JPN C;  5FK9 C;  2JEA I;  1G6Z A;  4H7B A;  1D6E C;  5C4Z A;  1U4M A;  1PTO B;  1EFI D;  1K83 B;  4EGV A;  4IFD I;  3GTK B;  1F2Y A;  1L0Y B;  4KY5 A;  1XWE A;  4K8I A;  1D1K A;  3I4L A;  2CW0 D;  4U67 3;  4XQN A;  3D8G A;  2MP1 A;  1KDC A;  1EWC A;  3TBI B;  2F0P A;  3KLR A;  2B2Y A;  1T5E A;  1JQY D;  2B2W A;  2A6H C;  3MFG A;  4RHS A;  1TWH B;  2PNR C;  3QB3 A;  3C46 A;  2WB1 B;  5DEH A;  4X3U A;  3TZD A;  1LTA D;  3FEW X;  1Q1B A;  3T13 A;  3GTL B;  1SBB B;  3NP8 A;  2C9O A;  4CKB A;  2R7Z B;  1PDQ A;  5DNF A;  1A3V A;  5C0X J;  3P1H A;  1CA6 A;  1DCZ A;  2ZXP A;  3MZ5 A;  2IX1 A;  1E2Z A;  2B2T A;  1PFM A;  1BUV T;  4KJO A;  1EIG A;  5HUR A;  1BF4 A;  1GUT A;  3CHB D;  1WTQ A;  1LAB A;  3A8J E;  2E2I B;  2QDB A;  3K57 A;  3R93 A;  5JJZ A;  2JSO A;  1Q3L A;  1LTR D;  2KUM A;  4ZK9 B;  3P75 A;  4HMI A;  4UDU C;  1YNJ C;  3OIQ A;  3N6R A;  1Q1E A;  4NP5 A;  1SE4 A;  2EJG C;  2JYO A;  4LAA A;  1EY4 A;  2LS0 1;  5M3M B;  1IYU A;  4Y7N B;  1U4P A;  2B2U A;  3DEO A;  2PW7 A;  1GUG A;  4C3I B;  3HOZ B;  1I3Q B;  1PLF A;  1KLG D;  4U68 A;  5C0X I;  2EPB A;  1ZKO A;  2CQA A;  3MWY W;  2F3V A;  2DN8 A;  2RA4 A;  1K8M A;  3KUP A;  4FO2 A;  2M2L A;  4BY7 B;  3A54 A;  1S5D D;  5COR A;  1STG A;  1I6H B;  1RKN A;  3E6Z X;  3KBG A;  1DD2 A;  5ISR A;  2L5T A;  4HAE A;  3HKZ B;  3CRL C;  3IFD A;  1IL8 A;  4QUF A;  3MXN A;  3OSO A;  1ILP A;  1QCB D;  4ZUJ A;  3SK4 A;  2FMC A;  1B4O A;  3H3V C;  4IUT A;  4C3J G;  3EJI A;  1IKL A;  2NN6 I;  3RZO B;  3LNN A;  2EJF C;  5KND A;  3PUV A;  3S2D B;  3PO2 B;  1JOO A;  1SYG A;  3HRZ C;  4NKL A;  1CTM A;  2NVQ B;  1SNM A;  4ODG A;  2A6E C;  1TT2 A;  2K5D A;  1KDB A;  2ZT9 C;  3A55 A;  5JEA G;  1HA5 A;  1PXU A;  1CK1 A;  2A69 D;  3MXG A;  1RTN A;  3P20 A;  3GP7 A;  4KI0 A;  2PW5 A;  4Z9C B;  5G3L D;  2L9H A;  1HFG A;  5CGK A;  2O5J C;  2MPM A;  3J7A V;  4WJW A;  4KJN A;  5M5W B;  4ILW A;  1SXT A;  1PFN A;  1MBY A;  2L0C A;  2EYL A;  1KLU D;  1WTX A;  1S5C D;  1M8A A;  2B2W C;  3S1Q B;  3ND9 A;  1YNN C;  3I8Z A;  2F0G A;  2F0I A;  1I4R A;  1EZ8 A;  4K6L A;  1B3A A;  4GZY C;  3S17 B;  3DWP A;  4IAL A;  3H6M A;  2LFN A;  5C4H A;  2JP1 A;  4JK1 C;  3NBI A;  4K5X A;  4RGN A;  3I70 A;  4BWG B;  2A69 C;  1SNP A;  1JIC A;  2MHV A;  3VR4 A;  2IPK D;  3I73 A;  4I7Z C;  1RCV D;  1STB A;  1LT3 D;  1UNS A;  1EYC A;  4HSV A;  2KEE A;  2RDH A;  1SJH D;  5FLX L;  2Z4I A;  2L1B A;  1HFN A;  1SYE A;  2N88 A;  5J22 A;  2M9V A;  3H94 A;  3X3M A;  1F9Q A;  1EY7 A;  1EY9 A;  4G7O C;  1TS3 A;  1OXV A;  4R8N A;  5C4J B;  1C48 A;  3T51 B;  5M5X B;  1EEI D;  1FNU A;  1Y1W B;  2B2U C;  2WKD A;  3DM1 A;  3NHH A;  4HCE A;  5C44 B;  4QUC A;  3SXH A;  1STY A;  1Y69 U;  4DFA A;  3I3C A;  3R3O A;  1EU4 A;  3V96 A;  3C3L A;  1WTO A;  2CHB D;  1T5X D;  1NR2 A;  5IGG A;  5D3I B;  1Y8P B;  1EEF D;  4EVO A;  3HOY B;  4BBS B;  4BS9 A;  1ROD A;  3NK9 A;  3VYR A;  2K28 A;  2F0H A;  3H91 A;  4A93 B;  2RBM A;  2A68 D;  1AEX A;  3FKI B;  1A2T A;  2JA7 B;  1TS5 A;  1H9J A;  1Z47 A;  3QO2 A;  2KCN A;  3DXJ C;  3MTS A;  1BR9 A;  5G3L F;  2JA8 B;  5JPM C;  1ET6 A;  2L12 A;  2XSC A;  5KYI A;  4FF2 A;  4KD4 A;  1O80 A;  1B44 D;  2TMP A;  2A73 B;  4TRD A;  3LWE A;  1CZG A;  4K2K A;  3WOF A;  4QIW B;  3HS0 C;  5CBE E;  5FLX E;  4FVM A;  5EKL A;  4B9X A;  3WOE A;  4J1M A;  2V4D A;  4O42 A;  1BCP C;  2NYZ D;  5C0X H;  4XT1 B;  2F0W A;  3EQL C;  5JEA J;  1F9S A;  4F88 A;  4V19 0;  1DJR D;  4FF4 A;  1OXS C;  3QIA A;  1SYC A;  4XQQ A;  1JC7 A;  1CHQ D;  2F0M A;  3VYS A;  3BS1 A;  3PV0 A;  1D2B A;  3DHQ A;  5C4X B;  1DXM A;  4KK7 A;  2F0D A;  3BVM A;  2VNU D;  5EBC A;  3BYY B;  3EVQ A;  4L63 B;  2PCF B;  2G9H D;  1G2T A;  4X3S A;  4A3D B;  3J81 E;  3TZU A;  5E4W C;  5CMD A;  1CZW A;  1D5M C;  5A2Q L;  3D6W A;  4H44 C;  4F7X A;  2NN6 H;  3OPO A;  5FOB B;  5K36 H;  1DM0 B;  2NVT B;  1V43 A;  3GO5 A;  2O4X A;  2A74 C;  4CKE A;  5E4X A;  4B08 A;  3MXU A;  4DF7 A;  1G2S A;  1QE6 A;  1TS4 A;  4DAV A;  3GTJ B;  1GUS A;  2MUY A;  4ZLT F;  5IT9 E;  4KD3 A;  2ZXO A;  1I6V C;  2B8F A;  4G7H C;  2I46 A;  1WVL A;  4PMB A;  3IL8 A;  1PZI D;  3ERO A;  2Q8R E;  4XXE A;  4XYO A;  5KIX A;  5D14 A;  2K01 A;  2IX0 A;  5J39 A;  4RA8 A;  5ELF A;  3L7Z C;  1ICW A;  3GTM B;  1VMC A;  2QKI C;  1Z7T A;  3QOL A;  1FYC A;  3V05 A;  2K05 A;  4ZQ3 A;  1EZ6 A;  3WDN A;  2FMM A;  2NVY B;  3M4O B;  2NTT A;  5FO8 B;  1VCI A;  2R3Z A;  1V8Q A;  3TDQ A;  1EY5 A;  4G4K A;  1V1P B;  1TY0 A;  1JE4 A;  2A6H D;  2HDL A;  3D4D A;  5KGU A;  2WV6 D;  1CI3 M;  3PUW A;  1B2T A;  2EOT A;  1I4P A;  1W6K A;  1BOS A;  1WTR A;  2X6L A;  1C4Q A;  4PMW A;  1A6X A;  3VR6 A;  5KNB A;  2DNC A;  5TSS A;  3S1R B;  3VA5 A;  3ITP A;  2XWB B;  4IUQ A;  4DXF A;  2EYP A;  4QB4 A;  1CQV A;  1KNA A;  1TWG B;  3SEB A;  1M4V A;  3AB9 A;  4IZ8 A;  5IGD A;  2F0F A;  5T1G A;  1CFM A;  2Q8I B;  4DK1 A;  1DYQ A;  3M3Y B;  5C3X A;  5BN4 A;  2D62 A;  3K5M A;  2J4X A;  1ENF A;  1PZJ D;  3BDO A;  1S5F D;  2H1E A;  2HDM A;  2K33 A;  3AU7 A;  3RD4 A;  1SYF A;  1R4Q B;  1SFO B;  1ZYR C;  2NBF A;  4G57 A;  4RKL A;  1X3Q A;  2K7V A;  2YYZ A;  2DY8 A;  2RKS A;  4CGY B;  1YNJ D;  5IGE A;  1HXY D;  2D5D A;  1I4G A;  1SE3 A;  4FNF A;  2XWJ B;  3EA6 A;  4OGQ C;  3CKI B;  3T53 B;  3T56 B;  4OO1 G;  4A3F B;  5KEE A;  4HR7 B;  1EWH A;  5I9O A;  1Y8O B;  3HOW B;  5E3F A;  5FO7 B;  2PYK A;  3BVZ A;  4RFB A;  2HCI A;  4NDX A;  1SMY C;  1TQO A;  3J80 L;  5COY A;  5F2D A;  1HHV A;  4I65 A;  4DAP A;  2WKC A;  2XVS A;  3ZYY X;  1RF2 D;  2NUC A;  4HED A;  4ZKB B;  3HG9 A;  3K59 A;  1H9S A;  3BDL A;  4A3J B;  2FIN B;  4ZAI A;  4C3I G;  1O7L A;  3ONA B;  2WIN B;  1F2Z A;  4OIK A;  4IQZ A;  3HOV B;  4RHR A;  3R2I A;  1Q8I A;  4PV1 C;  2A6E D;  3Q22 A;  2AQ3 B;  4BA1 I;  2E75 C;  1D5Z C;  4LK1 C;  4QMG A;  1PYW D;  4HSP A;  4HMJ A;  4ZKC B;  3NWS A;  1EQT A;  1GUN A;  5BN5 A;  3VYT A;  4S3S A;  3Q6S A;  1EIH A;  1IW7 C;  3A8I E;  3JAM L;  1PTO C;  2F1M A;  1Q12 A;  3L3O C;  2EY6 A;  3OHX C;  1ONL A;  3L9A X;  3Q0A A;  3SK8 A;  2EY1 A;  5K5P A;  2PQE A;  4RKB A;  5EQ0 A;  1JR0 D;  3QWN A;  2EVB A;  2XN9 C;  1R4P B;  1STH A;  1YNN D;  2R6G A;  3J80 E;  5I2Y A;  3D3R A;  1G91 A;  4YIJ A;  5JEA H;  1BO0 A;  1CT1 D;  3PIO 3;  1BNZ A;  4FXG C;  4XYQ A;  2ICE C;  2XIW A;  1PRT C;  4C3J B;  1S4Z A;  2HUG A;  5J1Z A;  1DOM A;  5CC4 A;  2RQX A;  3FPU B;  3SK6 A;  2BDN A;  3KF8 A;  1IYV A;  2JE6 I;  1O78 A;  3MXP A;  1DOK A;  2F0O A;  5JAV A;  3HOX B;  4A3G B;  1C8C A;  2F0V A;  1SDF A;  1QJO A;  1G8Z D;  4ZRZ A;  3NXW A;  2PPB C;  1HUM A;  4LMQ D;  3MHB A;  2OEO A;  4KY6 A;  5EJW A;  1W6J A;  1GHK A;  1I4Q A;  5D3D A;  1TS2 A;  1TU2 B;  1VMP A;  2BE5 C;  4JBW A;  5CV6 A;  1NCV A;  1CA5 A;  3KK7 A;  4L8J A;  5NUC A;  3JAM E;  2FJ2 A;  2H4O A;  1ESF A;  5C5M A;  1U4L A;  4G7Z C;  2PZT A;  4TKO B;  1O7Z A;  5M3F B;  4IFD H;  4ZUI A;  1GHJ A;  2EY2 A;  2AUK A;  4R9W A;  1F77 A;  2AQ2 B;  2LKV A;  4XT3 B;  4KN4 C;  4EQN A;  3MC0 B;  1TKW B;  1B50 A;  4K14 A;  3F2U A;  3SVM A;  1SE2 A;  3FRP B;  3NTK A;  2KJX A;  4XTC S;  1E0B A;  2SOB A;  3NQT A;  4UAI A;  1S5E D;  2BCO A;  2C5C A;  1HCZ A;  1V1O A;  4DNT B;  1TR5 A;  4DA2 A;  1H9M A;  1FD7 D;  3I4M B;  3C1F A;  3TSS A;  1MGS A;  1TWC B;  3V2T A;  4RGT A;  1H9R A;  3A56 A;  3SK5 A;  1RHP A;  4F8M A;  2NTS A;  3MA2 B;  2EYM A;  5JVH 3;  4DGZ A;  3A7A B;  2EY5 A;  3DMU A;  1JOQ A;  4KHV A;  5ELB A;  5CV5 A;  3T4A C;  2B2V A;  3MEH A;  1BCP D;  2FHT A;  1EOT A;  4OO1 I;  5FKA C;  2F4I A;  2SNS A;  4WOR A;  2PZU A;  5M9O A;  3N52 A;  1KAA A;  4OL7 A;  4RGM A;  1EL0 A;  4PQX A;  1SNO A;  1Z6H A;  3S9W A;  3E0J A;  3TP8 A;  4IUV A;  3NE5 B;  3J7Y W;  2X6G A;  3CRK C;  3A8K E;  1EY6 A;  4XQJ A;  2I07 B;  5EPJ A;  2K6A A;  2TSS A;  2EJM A;  3PUY A;  4QF4 A;  4C56 C;  1LTG D;  2D9U A;  5IGB A;  3DUZ A;  2F0N A;  1ENC A;  1DOL A;  3G7L A;  3I72 A;  1LT6 D;  2E74 C;  4K8J A;  5HGT A;  1NR4 A;  4F87 A;  1HTP A;  1A15 A;  2K5Q A;  2E76 C;  2EE1 A;  1ILQ A;  3SE0 A;  3AMU A;  1KNE A;  2KED A;  2ID0 A;  1ENA A;  4MN3 A;  4A3I B;  3GD7 A;  3TN2 A;  5CYU A;  2DY7 A;  2Z8L A;  2L11 A;  4IUR A;  4M8A A;  4QCL A;  2BDO A;  2E2D C;  1UUP A;  5IGC A;  1LO5 D;  4C1N K;  3GV6 A;  2MGS A;  4TSS A;  1VF5 C;  2VB3 X;  3NTI A;  4K2L A;  1QNU A;  3UI2 A;  1OXT A;  4PMC A;  3URY A;  2E2J B;  2A5H A;  1STA A;  5KYL A;  1KDA A;  1OO9 B;  1WD0 A;  2IW3 A;  2SDF A;  3Q24 A;  1KAB A;  1MI2 A;  1LTI D;  4ID6 A;  1II3 A;  1JWM D;  5CV4 A;  2L4N A;  1RTO A;  2JA6 B;  3NQI A;  2JEB I;  3IAY A;  3W2D A;  5KRU A;  1F2M A;  2F0K A;  2VXW A;  5I6W A;  5EKK A;  1JWS D;  1V1P A;  4MIU A;  4C3H G;  3GTG B;  4OHJ A;  3R8B A;  1LTT D;  1BCP F;  5EPL A;  3ND8 A;  3QOJ A;  3MFY A;  3PUX A;  4MHE A;  3VA7 A;  4ME5 A;  2F0L A;  3LX0 A;  4NMZ A;  5EKI A;  2RVL A;  3Q23 A;  3I4N B;  1NSN S;  1FNW A;  4NW2 A;  3GTQ B;  1LTB D;  4KY7 A;  4O1N A;  4TQU S;  4V0B A;  1ZYR D;  2QEJ C;  4K5V A;  1VDZ A;  4RCO A;  1J9O A;  2DNE A;  3K5O A;  1F9R A;  2EYF A;  3U9S A;  2B2V C;  4KN7 C;  2EDG A;  4HN7 A;  2RSN A;  1HQM C;  4X3T A;  3KLS X;  4XDX A;  3VYU A;  4RAU C;  2AUJ D;  3GTP B;  1HTL D;  1HUN A;  2WP8 J;  2D2C C;  2Z1C A;  3P7J A;  5A2Q E;  3KLS A;  5D65 A;  1SMY D;  3BYT B;  1CQF A;  2ENB A;  3R2T A;  3K5N A;  2NWG A;  4FP5 D;  3M7G A;  3NPP A;  3C2P A;  3OMC A;  3BG3 A;  5CBA E;  1SAP A;  5LL6 X;  5LL6 S;  2HQE A;  5EBD A;  1TWF B;  2RDG A;  3SHL A;  1LTS D;  3TME A;  1NUC A;  3RLF A;  2IX3 A;  2F0Q A;  4FYD A;  2QIL A;  2JA5 B;  4OO1 H;  3T16 A;  3IFT A;  3RZD B;  2IJ0 A;  4E6I A;  2SEB D;  4KKU A;  1PRT B;  1Y8N B;  5ELC A;  4IUP A;  1HQR D;  3C1E A;  1LT5 D;  4CJ0 B;  1E2W A;  5C5L A;  5IOD A;  5DM7 3;  1WD1 A;  1XTC D;  2KOL A;  1IW7 D;  3U9O A;  1PTO D;  1HRJ A;  3DEP A;  3FPP A;  2RSO A;  3K7A B;  4N9P A;  2E2H B;  1SSO A;  2F03 A;  1U4R A;  5A35 A;  4BA2 I;  2CW0 C;  3IKJ A;  5KNC A;  2ICI A;  4DK0 A;  2EYJ A;  2N55 A;  4DNR B;  3I91 A;  4DXG A;  4CHT B;  2PMZ B;  1GXD C;  4C1N I;  1XXG A;  2Z4H A;  1BXT A;  4ABN A;  1STN A;  3TP6 A;  2EXZ A;  3M85 A;  1GOZ A;  1STE A;  3DWA A;  1FNV A;  1SYB A;  4A3B B;  3S1N B;  1PRT D;  3GV3 A;  1JOR A;  1WTW A;  2ZXR A;  1D1I A;  3BVG A;  2AWO A;  2WAQ B;  5ELD A;  1SYD A;  1HPC A;  2LY7 A;  2SNM A;  3OIP A;  3D6C A;  5IOC A;  2F3W A;  1I4X A;  3D4W A;  3MVV A;  2KA7 A;  4H0L C;  1H9S B;  1LAC A;  5EPK A;  1CM9 A;  2O5I C;  2K32 A;  1GUO A;  2B63 B;  4K6D A;  1H9K A;  4CJ2 C;  3GTO B;  2G9D A;  2KVM A;  3S15 B;  1NAP A;  5JOB A;  2BE5 D;  3ERQ A;  2XRS D;  2WAC A;  4WFN 3;  2BOS A;  3BDC A;  4Q5V A;  4XIG S;  1J8I A;  3S14 B;  1RDP D;  2VUM B;  1OXU A;  3M4Y A;  2K03 A;  4PNY A;  5I6Y A;  3K6O A;  3HOU B;  3PUZ A;  1VF7 A;  1RJT A;  1UAP A;  3S1M B;  4L6T B;  1I4H A;  2F0U A;  4KV6 A;  1AFP A;  1EYA A;  2FFK B;  2R93 B;  2XNA C;  2RDF A;  3G6J B;  3OMG A;  3DWQ A;  4KKT A;  1BQQ T;  1AW7 A;  1PTO F;  2X69 A;  2B2Y C;  1GUW A;  1MSH A;  4R8I A;  3K58 A;  2KQ3 A;  3OW7 A;  1ZEQ X;  2B8G A;  2QCP X;  1QB5 D;  1XX8 A;  2BA1 A;  4A3M B;  5C6A A;  2KEC A;  1BCP B;  3FMC A;  4H13 C;  4P2C B;  1XYI A;  3TP7 A;  1S5B D;  4ULL A;  3SDZ A;  3KBX A;  1EQV A;  5DAU A;  1G29 1;  1UEA B;  1ML0 D;  1FR3 A;  3LWU A;  4FXD A;  2F0E A;  4BBR B;  2CVR A;  1X3P A;  1EYD A;  1PRT F;  5C3E B;  4CJ1 B;  2B2T C;  1B1Z A;  4IFD G;  2F0T A;  1L0X B;  2QF7 A;  5BN3 A;  3FVQ A;  2K5W A;  4DU9 A;  4OIJ A;  1MSG A;  2YU9 B;  4X3K A;  5E1F A;  5LHY 1;  2J7Z A;  1DZ1 A;  2L55 A;  2M00 A;  5I9P A;  3OWE B;  2F0S A;  1EY0 A;  1B53 A;  3D31 A;  1JB3 A;  4B9W A;  1U9R A;  3NWT A;  1K8O A;  2NB0 A;  2BA0 A;  3MAQ A;  1MD2 D;  3NUC A;  4IUN A;  2JXM B;  2KHS A;  2MJ8 A;  3M7N A;  1TII D;  4RCN A;  5CV8 A;  4KTA A;  2HCC A;  3J81 L;  2OF1 A;  1TVX A;  1O7Y A;  2Y0S B;  4RGO S;  1AZQ A;  3VR5 A;  2GA4 B;  3VR3 A;  5CR3 A;  1WTV A;  5M5Y B;  3PO3 B;  3K0Y A;  3NTH A;  4EQP A;  1SNC A;  3SR1 A;  4CBV A;  4A3E B;  2PO4 A;  4Q0F A;  3NSW A;  1DON A;  1EY8 A;  3FDT A;  4WRD A;  3X3N A;  2KCC A;  5IT9 L;  3PIP 3;  5EGT A;  2PZW A;  5AFW A;  4CKC A;  3A7L A;  4RWS C;  1AZP A;  1QWY A;  4N9T A;  2K04 A;  1X32 A;  3BZD B;  2R92 B;  1WTP A;  2XRQ D;  3E5S A;  3S2H B;  1GJX A;  3D4R A;  3TP5 A;  2AQ1 B;  3EFX D;  4RH6 A;  4FXK C;  3QG1 A;  2J0T D;  2OT2 A;  3NBH A;  2Q8T A;  2OXP A;  2VB2 X;  2K1B A;  5C0X G;  5CV9 A;  2WII B;  1QIL A;  2IWH A;  1R9T B;  2R61 A;  1CHP D;  1SND A;  3O13 A;  3J7A F;  1TWA B;  1BDO A;  4BY1 B;  3K5L A;  4M1U B;  4J6H A;  5C3W A;  3W3A A;  5FO9 B;  2A68 C;  4KMU C;  4DAY A;  3CQZ B;  1AP0 A;  1SJE D;  4K5W A;  1LT4 D;  4C2M B;  1FGB D;  1WCM B;  1IKM A;  5CV7 A;  4IUU A;  3QJY A;  3HEJ A;  1E2V A;  1F2L A;  1A3T A;  1SEB D;  4J8Q A;  3HGB A;  4EQO A;  3I90 A;  2NN6 G;  5K36 G;  1KTK A;  2IT1 A;  2NZ1 D;  3OWF A;  4LJZ C;  5I4D A;  2NVX B;  3RUZ A;  2LMC B;  4A3K B;  3GQB A;  3S16 B;  1D5X C;  1PZK D;  4DN4 M;  1LV9 A;  3H0G B;  5JVG 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...