3MXGA

Structure of shiga toxin type 2 (stx2) b pentamer mutant q40l
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
70
structure length
70
Chain Sequence
ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLLSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of differential B-pentamer stability of Shiga toxins 1 and 2.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
molecule keywords Shiga-like toxin 2 subunit B
total genus 18
structure length 70
sequence length 70
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2010-05-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mxgA00
1CQFA 1CZGA 1R4QB 3MXGA 1D1KA 1QOHA 4ULLA 1CZWA 1DM0B 4M1UB 2BOSA 1C48A 1QNUA 2C5CA 1BOSA 1D1IA 2GA4B 1R4PB 4P2CB 2XSCA 1C4QA
chains in the Genus database with same CATH superfamily
3D4DA 1VQIA 1I50H 3SEBA 4C2MB 4HIDA 1XYIA 2R92B 1CZGA 4LJZC 5C5MA 3T1YL 3Q0AA 1X6OA 4GN3B 4X3TA 4DK0A 2R92G 1YJWA 2D5DA 2B63H 5ELBA 4ZUIA 1U4LA 2K32A 1K83H 3GTJH 1G51A 2BE5D 2Y0SB 3E9IA 4LAAA 1K8OA 4KTAA 4X64Q 1GKHA 3J80c 1WTQA 2WAQG 1BXTA 5FLXc 1QNKA 2RCFA 4L8JA 1HH2P 1YEZA 1W6JA 2Z0SA 4G7ZC 5A35A 1X65A 1SFOH 3S15H 4DV3L 2P5ZX 3DLLA 2K4KA 3G4SA 2FMMA 1TWHH 4YWLA 1HUMA 3VR3A 4JI4L 1VQAA 1V1QA 4OXPA 1CKMA 4X3KA 4OX9Q 2F3IA 4UY8C 5C4JH 4X65Q 1IW7D 4XXEA 4F88A 5JJKA 1PTOB 3S14H 1JE5A 2N88A 4JK1C 4DPGA 1KL9A 2X6GA 1XMOQ 3EBEA 2MQHA 4JI5Q 2IX0A 1E1OA 1EIFA 1D1KA 4P75A 1O7ZA 3M4QA 1TU2B 4HIOA 1DOLA 4KHPQ 4PZ6A 2F1MA 1FVIA 2N78A 5JVG3 3NK9A 1WVLA 2WB1E 2R7DA 4K5XA 3TS2A 4JI3L 3Q8DA 2B8GA 1Q7YC 2A74C 3PUYA 4AIMA 1Q12A 1Q8KA 1QE6A 4A3KB 3C1EA 3HEJA 3AU7A 1QVGA 1H9JA 4M1UB 1ET9A 2JA7G 1Q1BA 1CSPA 2JEBI 1A3UA 2C9OA 1NMGA 2PW5A 1L0XB 1PRTB 2L4NA 4EQOA 2F0HA 4DK1A 1M90C 3W5OA 3K80C 2UUBL 4RG1A 4ME3A 2J7ZA 2LKVA 4ILWA 4IFDG 1B9NA 2JA8B 5DLQE 2YTYA 4A76A 3KUPA 3CQZB 2KCNA 4RCOA 4V0BA 3CMAA 3CAMA 2JEAI 1HUNA 4GLAC 3GTPH 1FL0A 3BDLA 4DF7A 3KBXA 4JBKA 3SE0A 1A15A 3J81E 4BY1H 5LHY1 4JW0A 1WTXA 4IUUA 4DUYQ 3HKZE 4JI0Q 2B63G 1M4VA 1TWGH 1R9TH 5EGTA 3I4NG 3VYRA 4HJ5A 2CVRA 1RD9D 5JEAG 4LF5Q 4I7ZC 1RTOA 1IW7C 1U5KA 1SBBB 2RDHA 1MIUA 5L37A 2CQAA 5EKIA 4DNRB 2M00A 4B9XA 1FGUA 2F0JA 3LX0A 1XMQQ 2Z6KC 4LF8L 1DCZA 1HPCA 1CTMA 3CXCA 3T13A 3G7LA 2R7ZG 1J8IA 1G8ZD 1JB3A 1I4HA 3NXWA 1PA6A 4OEMB 1IZ6A 4JI1L 5IGEA 4XQJA 1Q8IA 2LXJA 4CDCC 3A5UA 3PIO3 2J4XA 1M1KC 4OO1H 1PZJD 3NPPA 2G5DA 1AEXA 2D62A 3AYHB 2JA8H 1IKMA 2VL6A 2FMCA 3NSWA 1CHPD 4L5SA 3S2DB 2F0NA 4LK1C 5ELOA 1TWAH 3RLNA 4GS3A 4LUOA 4WJWA 4LMQD 4GOPC 1SMYD 3J7AV 3FPPA 4LWCA 2AQ3B 3FDTA 5GAHC 1F9PA 3CCSA 2K50A 5IP7H 4A3MG 1IYUA 1F2LA 1R4QB 4DR3Q 2SOBA 5JJLA 1EOVA 3STBC 2B2VC 2NZOA 3M7NA 1Q90A 5I2YA 1SJHD 3GTJB 2XRSD 1ZYRD 1PTOH 3D31A 3S14B 1Q46A 5CV5A 1K28A 2RHSB 4DR2L 3WWVA 1LT5D 2IW3A 2CW0D 5C4HA 3OTOL 3S1RH 1XNQL 3JAML 1SNCA 4GZYC 2EYMA 2NVTH 4GOPB 1X56A 2EY1A 4GN5A 2WFWA 2PNRC 3UE0A 1DOMA 4P74A 5CGKA 4LF9L 5IYDH 2JP1A 1B3AA 3CP0A 4RKLA 1OXUA 5C4JB 3NWTA 3BVZA 3IAYA 3M7GA 1SAPA 5E4XA 3NWSA 3T53B 4MTKA 4BBRG 3GTMH 4B08A 4NW2A 5IYCH 1G291 4IUPA 2VB2X 3NBIA 3M3YB 1YJ9A 3MHBA 2MO0A 2HHHL 2F0DA 3KLSX 1BF4A 1N33L 3M3YH 2BOSA 3M4OH 2KEEA 2QDBA 2QKIC 1GVPA 3G71A 3H09A 4IO9A 4GKJQ 4IPCA 4DR3L 2F0KA 1I4XA 1EEFD 3HOZH 4BY7H 2X69A 5K36G 2HT1A 4H7BA 4AQYL 1VF5C 3P7JA 2NVQB 1PH6A 5AJ3L 2E2DC 4A3CG 2KENA 3QG1A 1MI2A 1S4ZA 2N49A 5JEAH 3CCQA 1QZGA 4DA2A 3OMGA 1YNND 4LF7L 4HCEA 2PI2A 4V190 1IKLA 4KI0A 5C0XI 3QJYA 4APVA 3G48A 4LFBL 4QMGA 1SYGA 2I0QA 3ERQA 1SMXA 1YVCA 1R9TB 2Q2TA 4G7OC 3FKIH 1OTCA 1EY6A 4P73A 4B3SL 1J9OA 3ONAB 1QZHA 3F2UA 4RWSC 1PFNA 3I4LA 2B3GA 4JBMA 1O78A 5T1IA 2EXDA 1JT8A 1JICA 3BZCA 1ASZA 4DV1Q 1B53A 1KNEA 1EOTA 2K33A 4TVAB 3JAMi 1RF2D 3PO2H 1DOKA 1VQNA 3M4OB 1QCBD 3J81c 1VQMA 2F0VA 3I56A 2UU9Q 1HCZA 1S5ED 5IYDG 3VYTA 2B2VA 3CPFA 1JCKB 3KJPA 3KLWA 1WD0A 5M5WH 3QB3A 4C3JH 3NQIA 3S2DH 1E22A 1NAPA 1JC7A 1P8LA 5C5LA 3RLFA 1B4OA 2HIXA 4GKKQ 3H91A 3RN2A 3NUCA 2YTXA 2ZM6L 1SE2A 2XWJB 3FMCA 3K8AA 2B2TC 1SR3A 1VQLA 1S5DD 2EIFA 3S1RB 4F87A 1PVOA 1G2SA 3OIQA 1U4MA 1RDPD 5JAVA 3SHLA 1V9PA 2OF1A 1FYCA 3AB9A 4IALA 4ME5A 1DONA 3IL8A 4Y7NB 1NBWA 1SYEA 3HGBA 2PPBC 4XT3B 4HIMA 1C0AA 2Z4IA 2F4VL 2I07B 4K0KL 3FRPB 5CC4A 1KLGD 1C8CA 4HR7B 5AJ3Q 4DR5Q 1RJTA 2YU9B 5IYBH 1HTPA 3I3CA 4DV1L 3I70A 1EWIA 2SNMA 3K7AH 2JA8G 5FOBB 2GN5A 3J80L 1EZ6A 2RDGA 3GTLB 4YIJA 1C7YA 3GTLH 1VMCA 4HMIA 5EPJA 4NXNQ 4EGVA 4J8QA 3VA7A 3M85A 5IGGA 1UAPA 1X3FA 4QCLA 1UE1A 4NB3A 1TQOA 4PG3A 1IL8A 4ALPA 5LMNW 1P16A 3MXNB 3G6JB 5IODA 2DJFC 3RZOB 1A6XA 1TT2A 5M5YH 4A93H 4ODGA 2ZXPA 4IUNA 2QA4A 4X64L 2NTTA 1CKOA 3BZKA 1S5CD 2F52A 3H0GB 1EQVA 4ULLA 5LMNL 4UP8A 4R4OA 2QILA 3I91A 2E76C 3PO3B 2JSOA 2Z6KA 1KAAA 2M9VA 3LGJA 2K7VA 1KDAA 5CV7A 5FLXE 1ZXTA 4QB4A 2F0GA 4FXKC 1EIYB 1PTOC 3CCEA 5LMUQ 3OSOA 3J80E 5FJ8H 2NTSA 3G6EA 2KHJA 1PZKD 3KYHC 2B2WA 3GV3A 2JA5G 2UXDL 2O5JC 1ESRA 4DR2Q 3OPOA 3SVMA 3E3XA 4DR5L 4BY7G 2F4IA 3UDFA 2B39A 3J7A5 4B3RQ 4DAVA 1LTRD 1EWCA 2ASBA 2ZTEA 1PYWD 2DUDA 5IGDA 3PO2G 2Q2IA 3HP3A 4LF9Q 3RMHA 4LF4Q 4HSPA 1F2ZA 4DR7Q 3MXGA 2H4OA 2MHVA 1BCPF 5C44H 2NZHA 3A8IE 4JVZA 2KHSA 3FHWA 2NBFA 1ILQA 4JI3Q 1HQMC 4OIKA 1PH7A 3F2DA 4JI8L 5EBDA 1EY0A 3SK4A 2MPMA 4A3GB 1A63A 2VQEL 2RQXA 5C3EG 1LTID 3OW2A 4AYBG 1FR3A 4XQQA 1MKHA 3SXHA 1LACA 3V96A 1E24A 1RL2A 1MHWC 1VQPA 5M9OA 1H95A 1LTGD 1M8AA 4XTCS 2PMZB 4MIUA 4BA1I 1X3PA 2DNEA 2EVBA 3T4AC 5KYLA 2Q2UA 1TXYA 1MSGA 1L1OB 3KF8A 4A3IG 4L5RC 4Y7NH 1ET6A 1VQFA 2LFNA 3MEFA 1NR4A 2WP8J 2F0OA 3C46A 3RNUA 1RIPA 4IUQA 3QIAA 1MBYA 2PQEA 2G9DA 3ZJYC 5I6YA 1STBA 3CKIB 3HRZC 2CHBD 3DMUA 1RODA 2L0CA 2ZJRA 4A3BB 3H6MA 1VQ5A 1HNZL 1J5EL 5I4DA 5ELEA 3EFXD 4O0AA 5HY6A 4X3SA 5A2QE 1PDQA 2KCTA 1HXYD 2JK8A 2QCPX 1I94L 2LY7A 1ENFA 3FVQA 4B3SQ 1LT3D 1DJRD 4JI6Q 1JWSD 1D5MC 1HFNA 3BS1A 1KIXA 3L9AX 4CKCA 4HJ8A 1XMQL 2CW0C 1W3SA 5ELDA 4NKLA 5KNDA 1Z6HA 2B2TA 2E5LQ 4RAUC 4KJOA 2IWHA 5CR3A 3NQTA 2XWBB 5BR8L 2K5QA 1EL0A 2A69D 3DWAA 1TVXA 2EJGC 1PTOF 4FF1A 2E74C 4BWGB 1UE5A 1HNXQ 3K57A 4KN7C 3ND9A 4YY3Q 1I6HB 1RHPA 4LFCL 4C3IB 2K5DA 1VQHA 4IUVA 1CQFA 3I4NB 1Q82C 1TS5A 1S5BD 5EJWA 4IJHA 2VQEQ 1YITA 2F0QA 4Z9CB 1B8AA 4IFDI 1SE3A 2FXQA 2K75A 3S1NB 1YNJD 4HN7A 3DM3A 3I4MB 1DGSA 1F9SA 4FF3A 5G3LF 4DNIA 4XIGS 4F7XA 2HIVA 2ZTDA 2KECA 3KF6B 1I94Q 3DXJC 2AWOA 1U4PA 4PMBA 2MUYA 1VDZA 1B1ZA 4JV5L 3MFYA 4KKUA 1I3QH 4HAEA 5KNBA 2CWPA 5FLMG 3HOVG 2XRQD 2OEOA 1NY4A 4DV4L 4KY7A 5KGUA 1DXMA 3CCMA 1NCVA 5JPNC 1ZYRC 1BNZA 1PRTF 3NBHA 1SROA 3I55A 5F2DA 5IWAQ 5IOCA 4JC0A 1K73C 3CC2A 4JI6L 1KD1C 4WFN3 1BCPB 3DHQA 4A3EG 4A3FG 1HNXL 5JPMC 3BDCA 4JI2L 4BBRH 1CK1A 1C48A 4XYQA 1BOSA 2KCCA 1EU4A 2N55A 2RVLA 1AN8A 1FJGL 2QDLA 4WRDA 4NMZA 2L5TA 1KTKA 4OL7A 4C2MH 2MNAA 2R92H 1S3OA 2RHQB 1U0LA 1FNUA 5HURA 3FEWX 3EA6A 4C1NK 1IBLL 3M4PA 3KF6A 3VR5A 2VZAA 1UE6A 1WTPA 2FINB 5LMUL 4YY3L 1A8VA 1B3QA 3W3AA 1JOQA 1LTSD 1Y14B 2ALYB 3VYSA 3KJOA 2E2HH 3NTHA 3S16B 5GROA 4QF4A 2D0PA 1E0BA 3L0OA 4A4IA 4DR6L 3S1QB 4HCSA 1QWYA 4CDFC 4LF6L 2K05A 1V1PA 4B3RL 4EQ5A 2AQ2B 4JOIA 1TKWB 4RA8A 1Z9FA 4DUZQ 3S17B 1GOZA 3D8GA 1BQQT 2Q8RE 3PIOA 1SYCA 4LUVA 5C4XG 1BVSA 3R2IA 1K83B 3ULPA 3OHXC 4RGNA 2UXBL 1LTAD 2JJQA 3W1GA 3L2PA 1KDBA 2JA6G 1X3QA 5H1SE 3K0XA 4YCWA 1HR0W 4DR7L 4OWWB 1Y1VH 2LSSA 2IT1A 4DAPA 3NENA 1W2BA 3DWQA 1VQ7A 1Y1VB 4H13C 2BA0A 3VR2A 1WTOA 1TWFH 2ICIA 2PZWA 4S3SA 4IOAA 3J81j 2UU9L 2Y0SG 5IE8A 1GUOA 3E6ZX 4DR4L 1V1OA 3D6CA 2NVYH 2Q8IB 4JBJA 4ZK9B 1XNRL 1E1TA 1D7QA 4DV3Q 1GXDC 1AW7A 1WTVA 3TBIB 1BR9A 4C3IH 5FO7B 3OYYA 1CI3M 2QW7A 3KBGA 1E7ZA 1NUCA 4GLVB 3Q23A 4A3FB 4X66Q 2Q2HA 3K6OA 1KXLA 5ELFA 3TEHB 1QJOA 1KRTA 1Y8NB 2EOTA 1L1OC 2N3SA 2RA4A 1CZWA 1BUVT 4JYAQ 3QWNA 1BBWA 1DM0B 3A54A 2EYHA 1KRSA 4A3GG 1Q81C 3H3VC 2PZUA 5I6WA 4A93G 2VQFL 1TS3A 4DUZL 2OWOA 1GD7A 4R4QA 3SK5A 2FFKB 4K2LA 5EKKA 4A3FH 5DNFA 1EQQA 3C3LA 3T51B 1B44D 5E7NA 3RLOA 5C3XA 2VUMG 3U50C 1YZ6A 5KEEA 1JOKA 1SNMA 1PFMA 4O2DA 3PUVA 3VYUA 2F0TA 1ICFB 2XTIA 3TP8A 1PRTD 3FP9A 4CGYB 2E75C 4CBVA 3PO3H 2NVYB 2VS1A 4C3HG 2C5CA 3BDOA 4IN3A 4QUCA 4HEDA 1WFQA 2OXPA 4EX5A 3HOYG 3I7FA 4GLXA 2A8VA 3HKZG 5C3EH 4WORA 3PV0A 3E5SA 5IT9L 4FF4A 4N8X1 1LTLA 2I5MX 3UDIA 1PMRA 1LT4D 3SK8A 5D3IB 3E9HA 1EY8A 3KDFA 1YHBA 1SNDA 1WCMG 2MJ8A 2A6HD 4DR4Q 5LMNQ 1WD1A 2R93B 3PUWA 4KLKA 1T5XD 2I5HA 3GTGH 1X3EA 2AWNA 3HZXA 2WAQB 2YYZA 3VR4A 1VQJA 1LTBD 1PXUA 3CRLC 2UUCL 1HTLD 1SNOA 3BG3A 1SN8A 2CH4A 2ES2A 1IXRA 2EE1A 4L63B 1VQ9A 2OTJA 1SJED 1STYA 3S2HH 4DU9A 5CMDA 1VQ4A 2UXCL 1J6QA 1W6KA 3OMCA 5DM73 2VUMH 4LF8Q 3A5ZB 1SXTA 3P20A 4U673 4A3JB 4OONA 3D4RA 4A3DB 1O80A 5C4ZA 4MN3A 3FKIG 3T1YQ 3CCVA 4ZKCB 1PH1A 2E2HB 4DK3C 2PQAA 1SYBA 1X32A 4ABNA 5C4XH 4RGTA 5TSSA 4KMUC 4UAIA 5KIXA 1K8MA 4JI2Q 1XX8A 1SSOA 1AFPA 1HZAA 2WV6D 1K0SA 3NEMA 2HUGA 3L7ZC 4IOCA 4R1JA 3TMEA 1WTHA 4G4KA 4LUZA 5EQ0A 1HZBA 2ZJPA 5M3FH 3HOUG 1A3VA 1FJGQ 3IFDA 4MNOA 3AFQA 3URYA 2KUMA 4ZKBB 3T56B 4POFA 4MHEA 3K5MA 4ZUJA 4B3MQ 3PGZA 1UNSA 1BKBA 2A69C 3QOJA 2F3VA 4FP5D 3B6YA 4KJNA 4DR1L 1SYDA 3S16H 4HJ7A 2XNAC 3K7AB 3F2BA 3GDEA 3MVVA 5J1ZA 4KY5A 1JB7A 3VA5A 3WOEA 4HJAA 1ZKOA 2AQ1B 1DZ1A 2E2JB 2R7FA 2PNHA 4YCVA 4FNFA 1I4PA 1HZ9A 5CBAE 3A74A 4LW1A 1AE3A 3GTOB 2QEXA 2F0EA 1RCVD 2ZJQA 1IBML 3HOZB 4DN4M 4JI4Q 4YHHQ 4U68A 4KHPL 1TIID 4L5QA 5HGQA 5I9OA 2WACA 1D5ZC 3UI2A 2UXCQ 4JCVE 5D65A 3JC66 1S40A 2KJXA 2JN4A 2AHOB 3NBHB 4BBSG 4GNXA 2N8NA 4ZRZA 2SEBD 2E5LL 2V1CC 4CHTB 3E0JA 4Y52H 4K8JA 1ZEQX 4ZLTF 1L0YB 5IP9G 2BCOA 1HA6A 3RD4A 1N8RC 3QR8A 4YWMA 4QGUA 2IL8A 2UUAL 1GJXA 3GP7A 3HKZB 3U9SA 3R93A 2K6AA 4POGA 2SDFA 1I4QA 1TS2A 4O42A 4OWTB 1EQTA 3TZDA 3PO2B 2NVXB 2E2IB 2F0WA 4DV7L 4DAYB 1EYGA 4K6LA 1B70B 5JJZA 2KOLA 1EIGA 2ID0A 3EJIA 1A2UA 1A62A 2EYJA 2B2YC 1HR0Q 3A7LA 2GVBA 2IHFA 2JXMB 1CUKA 3M4YA 1PV4A 1VF7A 1Y1WG 1JQYD 3V2TA 1Y1WB 4C56C 1PFSA 3A8JE 1ASYA 4LF7Q 1Y1WH 2NYZD 3TP6A 4I7AA 2VQFQ 2F0LA 5C44B 4R9WA 1U9RA 1E2ZA 1G2TA 3TN2A 5C6AA 4H44C 2A1AA 3NTKA 2K01A 4DUYL 1CHQD 1LO5D 4CKBA 4A3DH 3TP7A 1OO9B 4IPHA 3S1MB 1GHKA 4OELB 3UDGA 2JA9A 2EJFC 5T1GA 3S1MH 4P2CB 2R93H 3BJUA 4DV6Q 4N8FA 2H1EA 2HD3A 1CT1D 1EY4A 2KCMA 4L5TA 1YHAA 1BBUA 3CC7A 4PQXA 1HNWL 4A3KH 4X62L 4X6AH 5IGFA 2KQ3A 4DV5L 3OW7A 5E4WC 4K14A 5COYA 3KDFB 2A19A 3K59A 1E2WA 4FDBA 1EYCA 1T5EA 4K5WA 1H9SA 3MC0B 4QL5A 2DJGC 2O4XA 3D0FA 2L11A 5JEAJ 4QY7A 1KHIA 2AUJD 1S5FD 2JYOA 1Y69U 1FD7D 2QF7A 2MO1A 4H02A 4JBWA 4B3TL 4QIWE 1KNAA 2KA7A 3TS0A 3CCJA 3U58A 1EY5A 5EPKA 3GO5A 2OQ0A 1LM0A 1PLFA 2IPKD 2MFIA 3J7ZC 4MZ9A 1GUGA 3K0YA 5HGTA 1K3BC 4R4IA 4BXXH 4R4TA 1XPUA 1D5XC 1KABA 1SFOB 3S15B 5C0XG 3MTSA 2F4VQ 1K9MC 3HOXG 1K8GA 3ER0A 2IHEA 2R6GA 2IX3A 3GTOH 3GTQB 1YIJA 3K7UC 2CQOA 3J7AF 3BU2A 2A73B 4K2KA 1ENAA 2A6HC 1D2BA 1OXSC 1J5EQ 3KFUA 2PCFB 4X62Q 3AFPA 2YV5A 4XQNA 3I4NH 3HG9A 1EYDA 3I2ZA 2Z6BA 3I72A 2KBNA 4K0KQ 1NNXA 4QUFA 4BY1G 1SLJA 3I73A 1PH3A 1Q86C 3STBD 3CW2C 2WKCA 2F0PA 5CV9A 4CJ1B 3K58A 1QVFA 2D0OA 5E1FA 1JMCA 5I9PA 5ELNA 4NXMQ 3K5NA 3ITPA 4A3CH 1NMFA 2EY2A 1PH9A 1XTDA 2EPBA 4F8MA 3PF5A 2K1BA 2GVAA 4DV5Q 2NVTB 3H94A 4B3ML 2R7ZH 5LL6S 2DNCA 4DV0Q 2NB0A 4ZCKA 1GUTA 3CCRA 4LFCQ 1TWCB 3D4WA 1YNNC 2D9UA 4UP7A 1ILPA 1BCPC 2F3WA 4G57A 4FYDA 1H9MA 2DN8A 5J22A 3PCOB 3AQQA 2HHHQ 5M5YB 2D2CC 2K5VA 4P71A 1JJCB 1SE8A 5AFWA 4A3LG 1NJIC 3GV6A 2XIWA 1IBMQ 3TRZA 2I5LX 2FJ2A 3BYTB 4JG2A 1GUSA 1PH4A 5E3FA 2ZXRA 4YHHL 1D6EC 1STAA 2UUBQ 2EYPA 3U9OA 4IPGA 4JI0L 2RBMA 1NTGA 2WB1B 1VQ6A 4JV5Q 1JORA 2WB1G 1QB5D 3AEVA 2CWAA 3N52A 1PTOD 4R4CA 1EQRA 1S72A 4JI7L 4A3BH 2CCZA 3NELA 2G9HD 1KC8C 1JE4A 4PV1C 2XVSA 2F0FA 1YBYA 1CFMA 3CQZH 1XWEA 5FO8B 1PRTC 3OOCA 2UUAQ 5FLMH 1TWAB 4DV0L 2A68C 2VXWA 5KNCA 2JA7H 3GTPB 1SMYC 4DXGA 4LF5L 3MAQA 2PI2E 5CORA 5IYCG 1SNPA 2R3ZA 1G6ZA 2X6LA 4M8AA 1FGBD 1STGA 3T16A 1EUJA 1A0IA 2VUMB 2O5IC 2M2LA 1T9HA 3KOJA 3T1HL 1WJJA 3GD7A 2MGSA 1AE2A 2WAQE 2EXZA 1STNA 1JJ2A 3GTQH 4C3HB 1UUPA 5EKLA 4JPBW 4G7HC 3A56A 1YI2A 4DAYA 4HJ9A 3PQIA 1BDOA 3LWEA 3DM1A 3PO3G 4NPSA 2RSOA 3NTIA 5C4XB 1QG7A 3HS0C 4OX9L 1WTWA 1G6PA 5NUCA 2HCIA 3E0EA 4HMJA 3CU7A 1Y8PB 4N9TA 3M9BA 3EQLC 3DWPA 2JA5H 4PZ7A 2BDOA 4UPAA 2JA5B 1DYQA 3A0JA 4PZ8A 2XN9C 1I6HH 1HNWQ 1VQGA 3F1ZA 5GADC 1CSQA 3PIPA 3X3NA 4A75A 1N36L 4UP9A 3MWYW 3TP5A 3GTMB 4IJLA 2V4DA 1PFBA 1RTNA 3VR6A 5CYUA 2O2LD 3TSSA 5IT9E 1K8AC 3EIVA 5C3WA 1VQBA 2JQOA 3I4MH 5CV8A 2IJ0A 1TWCH 1OXVA 1HZCA 2VW9A 3H15A 4H0LC 2K52A 2XGTA 4BA2I 2K5NA 3T1HQ 2F0IA 1KDCA 5JOBA 2Z1CA 4KD4A 2EYOA 1N33Q 3R2TA 2OCEA 3V05A 4JOIC 4A93B 4IPDA 1SDFA 2NVQH 2L1BA 2YTVA 1XJVA 1WI5A 4A3DG 3KK7A 1JR0D 1H9SB 1L0WA 2KHIA 3IKJA 4EVOA 3MFGA 3Q6SA 3SDZA 2J0TD 4AQYQ 4A3BG 1XXGA 1HA5A 1V8QA 1D1IA 4PMCA 3VDYA 3CD6A 3I90A 4WJ4A 1N32L 3J81i 3A7AB 3PUZA 2JA6H 2B2WC 3CCUA 3HOWH 1NR2A 1B9MA 2EYFA 5LL6X 3ULJA 1IYJB 5BN3A 2EY5A 2NVXH 1B2TA 2KVMA 3BYYB 4L6TB 3PSIA 4IUTA 4CDDC 1VQ8A 4J6HA 3EROA 3OWEB 1AP0A 4IFDH 1N9WA 2JA7B 4RCNA 4IZ8A 5BN5A 3S17H 4TRDA 3HOWB 4X3UA 1HFGA 5KYIA 3HOXB 1I4GA 2Y0SE 1OXTA 1VMPA 1TR5A 2FHTA 1I5FA 4RGMA 1PH2A 3GTKB 2NN6I 1LUZA 4J15A 2R93G 1L2FA 3CPWA 4CJ0B 4OWXB 1QUQA 2HCCA 3OIPA 3L3OC 2K28A 2DGYA 3P75A 5M3FG 2A6EC 3HOUH 1TWFB 2K14A 4BY1B 2K5WA 4GKKL 2Q8TA 4C3JB 1YNXA 4DV7Q 1EU3A 1UWVA 2ZTCA 2BH2A 1JWUD 2EJMA 3RZDH 1TY2A 1VQKA 1WCMH 3EVQA 3DEPA 2BDNA 3SK6A 4PNYA 2F0MA 4ID6A 4RHRA 1EIHA 4GNXC 1O7LA 1HNZQ 2EQSA 2C35B 3HOVB 1LTTD 4LFAL 4O1NA 2XSCA 4UHVA 3HOVH 4CKEA 3FKIB 1V1PB 2F03A 1B7YB 4IQZA 3MEHA 4IFDJ 1BCPD 4FXDA 4P72A 1E3PA 5A2QL 3GQBA 1XMOL 2H5XA 2IY5B 1H9KA 4YWKA 5C0XH 5G3LD 1LLRD 1WYDA 4AH6A 3Q24A 3MA2B 1B50A 1KQSA 3KLSA 2LS01 4RKBA 1ENCA 2WIIB 3ZYYX 3HOUB 1VCIA 2OQKA 4RH6A 3DEOA 5C44G 2PW7A 4GN4B 1TWHB 4XYOA 2K5HA 1HHVA 5M5WB 2QGQA 2OT2A 4AYBB 5ELCA 2I46A 4DV2Q 3RZDB 1YNJC 5M5XB 4DNTB 3AMUA 1HJPA 2L9HA 4N9PA 4X66L 1D8LA 4KHVA 3KLRA 1ONLA 2CH4W 2EZVA 1VQCA 2NWGA 3UDXA 3HOWG 2NN6H 2ATWA 3CHBD 3MXPA 1E2VA 4LNQA 2TSSA 1X55A 3H0GH 3JAME 3F2CA 4HSVA 4ZAIA 4EQNA 4BBSB 4GOPA 4BBRB 1II3A 2B29A 4BBSH 2A5HA 4LFAQ 2E8GA 2F0SA 1FNWA 1HRJA 2A68D 3FPUB 1SE4A 5ISRA 1GM5A 1EEID 1QNUA 3I4OA 1QUQB 3K5LA 4C3JG 1JJGA 4RMFA 1STEA 4KKTA 4TKOB 3A55A 1CKNB 1AH9A 3RZOH 1UEBA 4DKAC 1KLUD 3ERSX 3ICEA 1V43A 4TQUS 1QILA 1ICWA 1MJCA 1MD2D 2Z9HA 3HFZB 2CKZB 4LFBQ 4Q5VA 1LYLA 1Y1VG 4E6IA 4RFBA 3MXNA 1N36Q 4DXFA 2HDMA 1OXXK 5M5XH 1VQDA 1I6VC 4A3LH 2NZ1D 4AYBE 2UXDQ 1EY7A 5IY0A 1F9RA 4YCUA 1R4PB 1MJEA 3HOXH 5BN4A 3O13A 3TZUA 5IT9c 1EYAA 1GHJA 1N34L 4MTNA 4OO1I 1IBKQ 3IFTA 2AUKA 3W1BA 1I3QB 2PYKA 4NXML 1O7YA 1EFID 1F77A 4C3IG 3H3VI 4ZQ3A 1WCMB 5M3MB 4LF4L 4FO2A 2VY3A 1DD2A 1X9NA 1MSHA 3CMEA 2HQEA 3S24A 5FJ8G 1IBLQ 4BS9A 1JOOA 1XTCD 5D14A 5J39A 1C9OA 2SNSA 4DV2L 1STHA 2DY7A 3TQYA 3J80i 4A3JG 4HTHA 5C3EB 1TY0A 3SGIA 1SNQA 1GO3E 1HR0L 5DAUA 1CA6A 4KHZA 4DR6Q 1CKNA 1YHQA 1F2YA 5DM63 2DY8A 3RN5A 4R8IA 1KAWA 2QEJC 1EFWA 4KY6A 1JWMD 4RGOS 1SRUA 2OTLA 1VS0A 4NP5A 2L15A 2GA4B 5FK9C 1RKNA 2RSNA 1IYVA 5GAEC 2Z8LA 4A3GH 4KKSA 1Q3LA 2NUCA 1FNVA 4PMWA 1IL2A 1U4RA 2CFMA 4Q0FA 2Z4HA 2RKSA 1MGSA 4X65L 3QOLA 5DEHA 2AKWB 2B8FA 1QOHA 2WINB 1LT6D 5CBEE 4KK7A 1O7IA 1SEBD 3BVGA 4DV6L 4JI7Q 4NDXA 3HOYH 3GTKH 1N34Q 4BXXG 1IBKL 5M3MH 4C1NI 5K36H 3CF5A 2B2YA 1Z47A 1PHJA 4A3IB 1L1OA 1I4RA 4NXNL 1ESFA 1WTRA 1XNRQ 2NN6G 4KN4C 2EY6A 2VB3X 5C0XJ 1A2TA 3N6RA 1UE7A 4OGQC 2WKDA 3ND8A 2L55A 5I2XA 3R8BA 1SYFA 2JE6I 5EBCA 4RHSA 1QVCA 2AMCB 2TMPA 4QIWB 3U4VA 1VQEA 1EY9A 2PO4A 3NP8A 3K81C 3PIP3 4DFAA 4B3TQ 1TS4A 2MP1A 3H3VH 3BVMA 4K5VA 2LMCB 2YU9H 4HIKA 1CQVA 1I50B 3F8TA 3X3MA 2L12A 1PYBA 3D3RA 3SR1A 4OIJA 4GKJL 4DR1Q 5M3MG 1F9QA 1K0RA 4R8NA 3S1NH 1UEAB 5IGCA 4QQBX 2B63B 3DUZA 3C1FA 3HOZG 5KRUA 3BZDB 3H0GG 3LNNA 4GNXB 1NE3A 1NSNS 2A6ED 1Q1EA 1IHZA 1XPRA 3QO2A 3RUZA 3GTGB 4JYAL 3D6WA 3TREA 2R7ZB 3C2PA 1CM9A 4DGZA 2E2JH 5IP7G 3WDNA 3JAMc 4A3MH 2VNUD 5JJIA 3J7YW 3CRKC 1BO0A 4CDEC 4A3EH 1WOCA 3NE5B 4OHJA 4TSSA 4FVMA 1VQOA 2PQAB 1PYSB 4WJ3M 5EPLA 5IWAL 3R3OA 1G91A 1PH5A 3S2HB 1F2MA 2BE5C 2LXKA 4BY7B 4I65A 4J1MA 2B2UA 3KF8B 4DV4Q 5FKAC 1C4QA 2HDLA 3LWUA 1LABA 2RCNA 4JI8Q 3U4ZA 4A3KG 4QJFA 2JA6B 4A3JH 4DK6C 4A3MB 1AZPA 3W2DA 2K03A 3ULLA 2ENBA 2ICEC 5J3BA 3RR5A 4JI1Q 4K6DA 3OWFA 2PMZE 4DAMA 2BH8A 3PUXA 3TDQA 1PZID 4K8IA 3Q22A 2E2IH 2RDFA 5IP9H 2UUCQ 3HKSA 4FXGC 2HQLA 4IURA 4EQPA 1EZ8A 1YJNA 5GQOA 2EYLA 2ZM6Q 2PZTA 2EDGA 3MZ5A 5IYBG 4KD3A 3I4MG 5IIFA 1HQRD 2B2UC 4LF6Q 1X54A 1N32Q 3PMFA 1EWHA 1H9RA 1XPOA 3NHHA 4A3EB 4XDXA 4UDUC 3S1QH 2F0UA 4JI5L 1Y8OB 4ZYSA 1CA5A 1LV9A 3UE1A 2BA1A 2ZXOA 1Z7TA 4KV6A 2K04A 2UXBQ 3CCLA 4CJ2C 3I8ZA 3MXUA 1K3RA 5K5PA 4XT1B 1A3TA 3P1HA 1TWGB 3IRBA 3HOYB 5JVH3 3K5OA 2KEDA 5M3FB 3OTOQ 1XNQQ 4B9WA 1ML0D 3EN2A 4C3HH 1BBXC 1GUWA 2RF4A 2ZT9C 3S9WA 4A3IH 3A8KE 2R61A 5FO9B 4OO1G 3WOFA 5D3DA 1AZQA 1X3GA 5IGBA 3CC4A 5CV4A 2IX1A 5FLXL 1GUNA 4FF2A 1PH8A 5CV6A 5EAYA 5BR8Q 3J81L 3PF4A 5GAGC
chains in the Genus database with same CATH topology
3D4DA 3SEBA 4C2MB 1XYIA 2R92B 1CZGA 4LJZC 5C5MA 3Q0AA 4X3TA 4DK0A 2D5DA 5ELBA 4ZUIA 1U4LA 2K32A 2BE5D 2Y0SB 4LAAA 1K8OA 4KTAA 1WTQA 1BXTA 1QNKA 4L8JA 1W6JA 4G7ZC 5A35A 2FMMA 1HUMA 3VR3A 4X3KA 1IW7D 4XXEA 4F88A 1PTOB 2N88A 4JK1C 2X6GA 2IX0A 1D1KA 1O7ZA 1TU2B 1DOLA 2F1MA 5JVG3 3NK9A 1WVLA 4K5XA 2B8GA 2A74C 3PUYA 1Q12A 1QE6A 4A3KB 3C1EA 3HEJA 3AU7A 1H9JA 4M1UB 1ET9A 1Q1BA 2JEBI 1A3UA 2C9OA 2PW5A 1L0XB 1PRTB 2L4NA 4EQOA 2F0HA 4DK1A 2J7ZA 2LKVA 4ILWA 4IFDG 1B9NA 2JA8B 3KUPA 3CQZB 2KCNA 4RCOA 4V0BA 2JEAI 1HUNA 3BDLA 4DF7A 3KBXA 3SE0A 1A15A 3J81E 5LHY1 1WTXA 4IUUA 1M4VA 5EGTA 3VYRA 2CVRA 1RD9D 5JEAG 4I7ZC 1RTOA 1IW7C 1SBBB 2RDHA 2CQAA 5EKIA 4DNRB 2M00A 4B9XA 2F0JA 3LX0A 1DCZA 1HPCA 1CTMA 3T13A 3G7LA 1J8IA 1G8ZD 1JB3A 1I4HA 3NXWA 5IGEA 4XQJA 1Q8IA 3PIO3 2J4XA 4OO1H 1PZJD 3NPPA 1AEXA 2D62A 1IKMA 2FMCA 3NSWA 1CHPD 3S2DB 2F0NA 4LK1C 4WJWA 4LMQD 1SMYD 3J7AV 3FPPA 2AQ3B 3FDTA 1F9PA 1IYUA 1F2LA 1R4QB 2SOBA 2B2VC 3M7NA 1Q90A 5I2YA 1SJHD 3GTJB 2XRSD 1ZYRD 1PTOH 3D31A 3S14B 5CV5A 1LT5D 2IW3A 2CW0D 5C4HA 3JAML 1SNCA 4GZYC 2EYMA 2EY1A 2PNRC 1DOMA 5CGKA 2JP1A 1B3AA 4RKLA 1OXUA 5C4JB 3NWTA 3BVZA 3IAYA 3M7GA 1SAPA 5E4XA 3NWSA 3T53B 4B08A 4NW2A 1G291 4IUPA 2VB2X 3NBIA 3M3YB 3MHBA 2F0DA 3KLSX 1BF4A 2BOSA 2KEEA 2QDBA 2QKIC 3H09A 2F0KA 1I4XA 1EEFD 2X69A 5K36G 4H7BA 1VF5C 3P7JA 2NVQB 2E2DC 3QG1A 1MI2A 5JEAH 1S4ZA 4DA2A 3OMGA 1YNND 4HCEA 4V190 1IKLA 4KI0A 5C0XI 3QJYA 4QMGA 1SYGA 3ERQA 1R9TB 4G7OC 1EY6A 1J9OA 3ONAB 3F2UA 4RWSC 1PFNA 3I4LA 1O78A 5T1IA 1JICA 1B53A 1KNEA 1EOTA 2K33A 1RF2D 1DOKA 3M4OB 1QCBD 2F0VA 1HCZA 1S5ED 3VYTA 2B2VA 1JCKB 1WD0A 3QB3A 3NQIA 1NAPA 1JC7A 5C5LA 3RLFA 1B4OA 3H91A 3NUCA 1SE2A 2XWJB 3FMCA 2B2TC 1S5DD 3S1RB 4F87A 1G2SA 3OIQA 1U4MA 1RDPD 5JAVA 3SHLA 2OF1A 1FYCA 3AB9A 4IALA 4ME5A 1DONA 3IL8A 4Y7NB 1SYEA 3HGBA 2PPBC 4XT3B 2Z4IA 2I07B 3FRPB 5CC4A 1KLGD 1C8CA 4HR7B 1RJTA 2YU9B 1HTPA 3I3CA 3I70A 2SNMA 5FOBB 3J80L 1EZ6A 2RDGA 3GTLB 4YIJA 1VMCA 4HMIA 5EPJA 4EGVA 4J8QA 3VA7A 3M85A 5IGGA 1UAPA 4QCLA 1TQOA 1IL8A 5IODA 3G6JB 3RZOB 1A6XA 1TT2A 4ODGA 2ZXPA 4IUNA 2NTTA 1S5CD 3H0GB 1EQVA 4ULLA 2QILA 3I91A 2E76C 3PO3B 2JSOA 1KAAA 2M9VA 2K7VA 1KDAA 5CV7A 5FLXE 1ZXTA 4QB4A 2F0GA 4FXKC 1PTOC 3OSOA 3J80E 2NTSA 1PZKD 2B2WA 3GV3A 2O5JC 1ESRA 3OPOA 3SVMA 2F4IA 2B39A 4DAVA 1LTRD 1EWCA 1PYWD 5IGDA 3HP3A 3RMHA 4HSPA 1F2ZA 3MXGA 2H4OA 2MHVA 1BCPF 3A8IE 2KHSA 2NBFA 1ILQA 1HQMC 4OIKA 5EBDA 1EY0A 3SK4A 2MPMA 4A3GB 2RQXA 1LTID 1FR3A 4XQQA 3SXHA 1LACA 3V96A 5M9OA 1LTGD 1M8AA 4XTCS 2PMZB 4MIUA 4BA1I 1X3PA 2DNEA 2EVBA 3T4AC 5KYLA 1MSGA 3KF8A 1ET6A 2LFNA 1NR4A 2WP8J 2F0OA 3C46A 4IUQA 3QIAA 1MBYA 2PQEA 2G9DA 5I6YA 1STBA 3CKIB 3HRZC 2CHBD 3DMUA 1RODA 2L0CA 4A3BB 3H6MA 5I4DA 5ELEA 3EFXD 4X3SA 5A2QE 1PDQA 1HXYD 2QCPX 2LY7A 1ENFA 3FVQA 1LT3D 1DJRD 1JWSD 1D5MC 1HFNA 3BS1A 3L9AX 4CKCA 2CW0C 5ELDA 4NKLA 5KNDA 1Z6HA 2B2TA 4RAUC 4KJOA 2IWHA 5CR3A 3NQTA 2XWBB 2K5QA 1EL0A 2A69D 3DWAA 1TVXA 2EJGC 1PTOF 4FF1A 2E74C 4BWGB 3K57A 4KN7C 3ND9A 1I6HB 1RHPA 4C3IB 2K5DA 4IUVA 1CQFA 3I4NB 1TS5A 1S5BD 5EJWA 2F0QA 4Z9CB 4IFDI 1SE3A 3S1NB 1YNJD 4HN7A 3I4MB 1F9SA 4FF3A 5G3LF 4XIGS 4F7XA 2KECA 3DXJC 2AWOA 1U4PA 4PMBA 2MUYA 1VDZA 1B1ZA 3MFYA 4KKUA 4HAEA 5KNBA 2XRQD 2OEOA 4KY7A 5KGUA 1DXMA 1NCVA 5JPNC 1ZYRC 1BNZA 1PRTF 3NBHA 5F2DA 5IOCA 4WFN3 1BCPB 3DHQA 5JPMC 3BDCA 1CK1A 1C48A 4XYQA 1BOSA 2KCCA 1EU4A 2N55A 2RVLA 1AN8A 4WRDA 4NMZA 2L5TA 1KTKA 4OL7A 1FNUA 5HURA 3FEWX 3EA6A 4C1NK 3VR5A 1WTPA 2FINB 3W3AA 1JOQA 1LTSD 3VYSA 3NTHA 3S16B 4QF4A 1E0BA 3S1QB 4HCSA 1QWYA 2K05A 1V1PA 2AQ2B 1TKWB 4RA8A 3S17B 1GOZA 3D8GA 1BQQT 2Q8RE 1SYCA 3R2IA 1K83B 3OHXC 4RGNA 1LTAD 1KDBA 1X3QA 2IT1A 4DAPA 3DWQA 1Y1VB 4H13C 2BA0A 3VR2A 1WTOA 2ICIA 2PZWA 4S3SA 1GUOA 3E6ZX 1V1OA 3D6CA 2Q8IB 4ZK9B 1GXDC 1AW7A 1WTVA 3TBIB 1BR9A 5FO7B 1CI3M 3KBGA 3Q23A 1NUCA 4A3FB 3K6OA 5ELFA 1QJOA 1Y8NB 2EOTA 2RA4A 1CZWA 1BUVT 3QWNA 1DM0B 3A54A 2EYHA 3H3VC 2PZUA 5I6WA 1TS3A 3SK5A 2FFKB 4K2LA 5EKKA 5DNFA 3C3LA 3T51B 1B44D 5C3XA 5KEEA 1JOKA 1SNMA 1PFMA 3PUVA 3VYUA 2F0TA 3TP8A 1PRTD 4CGYB 2E75C 4CBVA 2NVYB 4C3HG 2C5CA 3BDOA 4IN3A 4QUCA 4HEDA 2OXPA 4WORA 3PV0A 3E5SA 4FF4A 5IT9L 1PMRA 1LT4D 3SK8A 5D3IB 1EY8A 1SNDA 2MJ8A 2A6HD 2R93B 1WD1A 3PUWA 1T5XD 2AWNA 3HZXA 2WAQB 2YYZA 3VR4A 1LTBD 1PXUA 3CRLC 1HTLD 1SNOA 3BG3A 2EE1A 4L63B 1SJED 1STYA 4DU9A 5CMDA 1W6KA 3OMCA 5DM73 1SXTA 3P20A 4U673 4A3JB 3D4RA 4A3DB 1O80A 5C4ZA 4MN3A 4ZKCB 2E2HB 1SYBA 1X32A 4ABNA 4RGTA 5TSSA 4KMUC 4UAIA 5KIXA 1K8MA 1XX8A 1SSOA 1AFPA 2WV6D 2HUGA 3L7ZC 3TMEA 4G4KA 5EQ0A 1A3VA 3IFDA 3URYA 2KUMA 4ZKBB 3T56B 4MHEA 3K5MA 4ZUJA 1UNSA 2A69C 3QOJA 2F3VA 4FP5D 4KJNA 1SYDA 2XNAC 3K7AB 3MVVA 5J1ZA 4KY5A 3VA5A 3WOEA 1ZKOA 2AQ1B 1DZ1A 2E2JB 4FNFA 1I4PA 5CBAE 3GTOB 2F0EA 1RCVD 3HOZB 4DN4M 4U68A 1TIID 5I9OA 2WACA 1D5ZC 3UI2A 5D65A 2KJXA 4ZRZA 2SEBD 4CHTB 3E0JA 4K8JA 1ZEQX 4ZLTF 1L0YB 2BCOA 1HA6A 3RD4A 2IL8A 1GJXA 3GP7A 3HKZB 3U9SA 3R93A 2K6AA 2SDFA 1I4QA 1TS2A 4O42A 1EQTA 3TZDA 3PO2B 2NVXB 2E2IB 2F0WA 4K6LA 5JJZA 2KOLA 1EIGA 2ID0A 3EJIA 1A2UA 2EYJA 2B2YC 3A7LA 2JXMB 3M4YA 1VF7A 1JQYD 3V2TA 1Y1WB 4C56C 3A8JE 2NYZD 3TP6A 2F0LA 5C44B 4R9WA 1U9RA 1E2ZA 1G2TA 3TN2A 5C6AA 4H44C 3NTKA 2K01A 1CHQD 1LO5D 4CKBA 3TP7A 1OO9B 3S1MB 1GHKA 2EJFC 5T1GA 4P2CB 2H1EA 1CT1D 1EY4A 4PQXA 5IGFA 2KQ3A 3OW7A 5E4WC 4K14A 5COYA 3K59A 1E2WA 1EYCA 1T5EA 4K5WA 1H9SA 3MC0B 2O4XA 2L11A 5JEAJ 2AUJD 1S5FD 2JYOA 1Y69U 1FD7D 2QF7A 4JBWA 1KNAA 2KA7A 1EY5A 5EPKA 3GO5A 1PLFA 2IPKD 1GUGA 3K0YA 5HGTA 1D5XC 1KABA 1SFOB 3S15B 5C0XG 3MTSA 2R6GA 2IX3A 3GTQB 3J7AF 4K2KA 2A73B 1ENAA 2A6HC 1D2BA 1OXSC 2PCFB 4XQNA 3HG9A 1EYDA 3I72A 4QUFA 3I73A 2WKCA 2F0PA 5CV9A 4CJ1B 3K58A 5E1FA 5I9PA 3K5NA 3ITPA 2EY2A 2EPBA 4F8MA 2K1BA 2NVTB 3H94A 5LL6S 2DNCA 2NB0A 1GUTA 1TWCB 3D4WA 1YNNC 2D9UA 1ILPA 1BCPC 2F3WA 4G57A 4FYDA 1H9MA 2DN8A 5J22A 5M5YB 2D2CC 5AFWA 3GV6A 2XIWA 3BYTB 2FJ2A 1GUSA 5E3FA 2ZXRA 1D6EC 1STAA 2EYPA 3U9OA 2RBMA 2WB1B 1JORA 1QB5D 3N52A 1PTOD 2G9HD 1JE4A 4PV1C 2XVSA 2F0FA 1CFMA 1XWEA 5FO8B 1PRTC 3OOCA 1TWAB 2A68C 2VXWA 5KNCA 3GTPB 1SMYC 4DXGA 3MAQA 5CORA 1SNPA 2R3ZA 1G6ZA 2X6LA 4M8AA 1FGBD 1STGA 3T16A 2VUMB 2O5IC 2M2LA 3GD7A 2MGSA 2EXZA 1STNA 4C3HB 1UUPA 5EKLA 4G7HC 3A56A 4DAYA 1BDOA 3LWEA 3DM1A 2RSOA 3NTIA 5C4XB 1QG7A 3HS0C 1WTWA 5NUCA 2HCIA 4HMJA 3CU7A 1Y8PB 4N9TA 3EQLC 3DWPA 2BDOA 2JA5B 1DYQA 2XN9C 3X3NA 3MWYW 3GTMB 3TP5A 2V4DA 1PFBA 1RTNA 3VR6A 5CYUA 2O2LD 3TSSA 5IT9E 5C3WA 5CV8A 2IJ0A 1OXVA 4H0LC 4BA2I 2F0IA 1KDCA 5JOBA 2Z1CA 4KD4A 2EYOA 3R2TA 3V05A 4A93B 1SDFA 2L1BA 3KK7A 1JR0D 1H9SB 3IKJA 4EVOA 3MFGA 3Q6SA 3SDZA 2J0TD 1XXGA 1HA5A 1V8QA 1D1IA 4PMCA 3I90A 3A7AB 3PUZA 2B2WC 1NR2A 1B9MA 2EYFA 5LL6X 5BN3A 2EY5A 1B2TA 2KVMA 3BYYB 4L6TB 4IUTA 4J6HA 3EROA 3OWEB 1AP0A 4IFDH 2JA7B 4RCNA 4IZ8A 5BN5A 4TRDA 3HOWB 4X3UA 1HFGA 5KYIA 3HOXB 1I4GA 1OXTA 1VMPA 1TR5A 2FHTA 4RGMA 3GTKB 2NN6I 4CJ0B 2HCCA 3OIPA 3L3OC 2K28A 3P75A 2A6EC 1TWFB 4BY1B 2K5WA 2Q8TA 4C3JB 1EU3A 1JWUD 2EJMA 1TY2A 3EVQA 3DEPA 2BDNA 3SK6A 4PNYA 2F0MA 4ID6A 4RHRA 1EIHA 1O7LA 3HOVB 1LTTD 4O1NA 2XSCA 4CKEA 3FKIB 1V1PB 2F03A 4IQZA 3MEHA 4IFDJ 1BCPD 4FXDA 5A2QL 3GQBA 1H9KA 5C0XH 5G3LD 1LLRD 3Q24A 3MA2B 1B50A 3KLSA 2LS01 4RKBA 1ENCA 2WIIB 3ZYYX 3HOUB 1VCIA 4RH6A 3DEOA 2PW7A 1TWHB 4XYOA 1HHVA 5M5WB 2OT2A 4AYBB 5ELCA 2I46A 3RZDB 1YNJC 5M5XB 4DNTB 3AMUA 2L9HA 4N9PA 4KHVA 3KLRA 1ONLA 2EZVA 2NWGA 2NN6H 3CHBD 3MXPA 1E2VA 2TSSA 3JAME 4HSVA 4ZAIA 4EQNA 4BBSB 4BBRB 1II3A 2A5HA 2F0SA 1FNWA 1HRJA 2A68D 3FPUB 1SE4A 5ISRA 1EEID 1QNUA 3K5LA 4C3JG 1STEA 4KKTA 4TKOB 3A55A 1KLUD 1V43A 4TQUS 1QILA 1ICWA 1MD2D 4Q5VA 4E6IA 4RFBA 3MXNA 4DXFA 2HDMA 1OXXK 1I6VC 2NZ1D 1EY7A 1F9RA 1R4PB 5BN4A 3O13A 3TZUA 1EYAA 1GHJA 4OO1I 3IFTA 2AUKA 1I3QB 2PYKA 1O7YA 1EFID 1F77A 4C3IG 4ZQ3A 1WCMB 5M3MB 4FO2A 1DD2A 1MSHA 2HQEA 4BS9A 1JOOA 1XTCD 5D14A 5J39A 2SNSA 1STHA 2DY7A 4HTHA 5C3EB 1TY0A 1SNQA 5DAUA 1CA6A 4KHZA 1F2YA 5DM63 2DY8A 4R8IA 2QEJC 4KY6A 1JWMD 4RGOS 4NP5A 5FK9C 2GA4B 1IYVA 1RKNA 2RSNA 2Z8LA 4KKSA 1Q3LA 2NUCA 1FNVA 4PMWA 1U4RA 4Q0FA 2Z4HA 2RKSA 1MGSA 3QOLA 5DEHA 2B8FA 1QOHA 2WINB 1LT6D 5CBEE 4KK7A 1SEBD 3BVGA 4NDXA 4C1NI 5K36H 2B2YA 1Z47A 4A3IB 1I4RA 1ESFA 1WTRA 2NN6G 4KN4C 2EY6A 2VB3X 5C0XJ 1A2TA 3N6RA 4OGQC 2WKDA 3ND8A 2L55A 5I2XA 3R8BA 1SYFA 2JE6I 5EBCA 4RHSA 2TMPA 4QIWB 3NP8A 1EY9A 2PO4A 3PIP3 4DFAA 1TS4A 2MP1A 3BVMA 4K5VA 2LMCB 1CQVA 1I50B 3X3MA 2L12A 3D3RA 3SR1A 4OIJA 1F9QA 4R8NA 1UEAB 5IGCA 2B63B 3DUZA 3C1FA 5KRUA 3BZDB 3LNNA 1NSNS 2A6ED 1Q1EA 1IHZA 3QO2A 3GTGB 3RUZA 3D6WA 2R7ZB 3C2PA 1CM9A 4DGZA 3WDNA 2VNUD 3J7YW 3CRKC 1BO0A 4OHJA 3NE5B 4TSSA 4FVMA 5EPLA 1G91A 3R3OA 3S2HB 1F2MA 2BE5C 4BY7B 4I65A 4J1MA 2B2UA 5FKAC 1C4QA 2HDLA 3LWUA 1LABA 2JA6B 4A3MB 1AZPA 3W2DA 2K03A 2ENBA 2ICEC 4K6DA 3OWFA 3PUXA 3TDQA 1PZID 4K8IA 3Q22A 2RDFA 4FXGC 4IURA 4EQPA 1EZ8A 2EYLA 2PZTA 2EDGA 3MZ5A 4KD3A 5IIFA 1HQRD 2B2UC 3PMFA 1EWHA 1H9RA 3NHHA 4A3EB 4XDXA 4UDUC 2F0UA 1Y8OB 4ZYSA 1CA5A 1LV9A 2BA1A 2ZXOA 1Z7TA 4KV6A 2K04A 4CJ2C 3I8ZA 3MXUA 5K5PA 4XT1B 1A3TA 3P1HA 1TWGB 3HOYB 5JVH3 3K5OA 2KEDA 5M3FB 4B9WA 1ML0D 1BBXC 1GUWA 2ZT9C 3S9WA 3A8KE 5FO9B 2R61A 4OO1G 3WOFA 1AZQA 5D3DA 5IGBA 5CV4A 2IX1A 5FLXL 1GUNA 4FF2A 5CV6A 3J81L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CQF A;  1CZG A;  1R4Q B;  3MXG A;  1D1K A;  1QOH A;  4ULL A;  1CZW A;  1DM0 B;  4M1U B;  2BOS A;  1C48 A;  1QNU A;  2C5C A;  1BOS A;  1D1I A;  2GA4 B;  1R4P B;  4P2C B;  2XSC A;  1C4Q A; 
#chains in the Genus database with same CATH topology
 3D4D A;  1VQI A;  1I50 H;  3SEB A;  4C2M B;  4HID A;  1XYI A;  2R92 B;  1CZG A;  4LJZ C;  5C5M A;  3T1Y L;  3Q0A A;  1X6O A;  4GN3 B;  4X3T A;  4DK0 A;  2R92 G;  1YJW A;  2D5D A;  2B63 H;  5ELB A;  4ZUI A;  1U4L A;  2K32 A;  1K83 H;  3GTJ H;  1G51 A;  2BE5 D;  2Y0S B;  3E9I A;  4LAA A;  1K8O A;  4KTA A;  4X64 Q;  1GKH A;  3J80 c;  1WTQ A;  2WAQ G;  1BXT A;  5FLX c;  1QNK A;  2RCF A;  4L8J A;  1HH2 P;  1YEZ A;  1W6J A;  2Z0S A;  4G7Z C;  5A35 A;  1X65 A;  1SFO H;  3S15 H;  4DV3 L;  2P5Z X;  3DLL A;  2K4K A;  3G4S A;  2FMM A;  1TWH H;  4YWL A;  1HUM A;  3VR3 A;  4JI4 L;  1VQA A;  1V1Q A;  4OXP A;  1CKM A;  4X3K A;  4OX9 Q;  2F3I A;  4UY8 C;  5C4J H;  4X65 Q;  1IW7 D;  4XXE A;  4F88 A;  5JJK A;  1PTO B;  3S14 H;  1JE5 A;  2N88 A;  4JK1 C;  4DPG A;  1KL9 A;  2X6G A;  1XMO Q;  3EBE A;  2MQH A;  4JI5 Q;  2IX0 A;  1E1O A;  1EIF A;  1D1K A;  4P75 A;  1O7Z A;  3M4Q A;  1TU2 B;  4HIO A;  1DOL A;  4KHP Q;  4PZ6 A;  2F1M A;  1FVI A;  2N78 A;  5JVG 3;  3NK9 A;  1WVL A;  2WB1 E;  2R7D A;  4K5X A;  3TS2 A;  4JI3 L;  3Q8D A;  2B8G A;  1Q7Y C;  2A74 C;  3PUY A;  4AIM A;  1Q12 A;  1Q8K A;  1QE6 A;  4A3K B;  3C1E A;  3HEJ A;  3AU7 A;  1QVG A;  1H9J A;  4M1U B;  1ET9 A;  2JA7 G;  1Q1B A;  1CSP A;  2JEB I;  1A3U A;  2C9O A;  1NMG A;  2PW5 A;  1L0X B;  1PRT B;  2L4N A;  4EQO A;  2F0H A;  4DK1 A;  1M90 C;  3W5O A;  3K80 C;  2UUB L;  4RG1 A;  4ME3 A;  2J7Z A;  2LKV A;  4ILW A;  4IFD G;  1B9N A;  2JA8 B;  5DLQ E;  2YTY A;  4A76 A;  3KUP A;  3CQZ B;  2KCN A;  4RCO A;  4V0B A;  3CMA A;  3CAM A;  2JEA I;  1HUN A;  4GLA C;  3GTP H;  1FL0 A;  3BDL A;  4DF7 A;  3KBX A;  4JBK A;  3SE0 A;  1A15 A;  3J81 E;  4BY1 H;  5LHY 1;  4JW0 A;  1WTX A;  4IUU A;  4DUY Q;  3HKZ E;  4JI0 Q;  2B63 G;  1M4V A;  1TWG H;  1R9T H;  5EGT A;  3I4N G;  3VYR A;  4HJ5 A;  2CVR A;  1RD9 D;  5JEA G;  4LF5 Q;  4I7Z C;  1RTO A;  1IW7 C;  1U5K A;  1SBB B;  2RDH A;  1MIU A;  5L37 A;  2CQA A;  5EKI A;  4DNR B;  2M00 A;  4B9X A;  1FGU A;  2F0J A;  3LX0 A;  1XMQ Q;  2Z6K C;  4LF8 L;  1DCZ A;  1HPC A;  1CTM A;  3CXC A;  3T13 A;  3G7L A;  2R7Z G;  1J8I A;  1G8Z D;  1JB3 A;  1I4H A;  3NXW A;  1PA6 A;  4OEM B;  1IZ6 A;  4JI1 L;  5IGE A;  4XQJ A;  1Q8I A;  2LXJ A;  4CDC C;  3A5U A;  3PIO 3;  2J4X A;  1M1K C;  4OO1 H;  1PZJ D;  3NPP A;  2G5D A;  1AEX A;  2D62 A;  3AYH B;  2JA8 H;  1IKM A;  2VL6 A;  2FMC A;  3NSW A;  1CHP D;  4L5S A;  3S2D B;  2F0N A;  4LK1 C;  5ELO A;  1TWA H;  3RLN A;  4GS3 A;  4LUO A;  4WJW A;  4LMQ D;  4GOP C;  1SMY D;  3J7A V;  3FPP A;  4LWC A;  2AQ3 B;  3FDT A;  5GAH C;  1F9P A;  3CCS A;  2K50 A;  5IP7 H;  4A3M G;  1IYU A;  1F2L A;  1R4Q B;  4DR3 Q;  2SOB A;  5JJL A;  1EOV A;  3STB C;  2B2V C;  2NZO A;  3M7N A;  1Q90 A;  5I2Y A;  1SJH D;  3GTJ B;  2XRS D;  1ZYR D;  1PTO H;  3D31 A;  3S14 B;  1Q46 A;  5CV5 A;  1K28 A;  2RHS B;  4DR2 L;  3WWV A;  1LT5 D;  2IW3 A;  2CW0 D;  5C4H A;  3OTO L;  3S1R H;  1XNQ L;  3JAM L;  1SNC A;  4GZY C;  2EYM A;  2NVT H;  4GOP B;  1X56 A;  2EY1 A;  4GN5 A;  2WFW A;  2PNR C;  3UE0 A;  1DOM A;  4P74 A;  5CGK A;  4LF9 L;  5IYD H;  2JP1 A;  1B3A A;  3CP0 A;  4RKL A;  1OXU A;  5C4J B;  3NWT A;  3BVZ A;  3IAY A;  3M7G A;  1SAP A;  5E4X A;  3NWS A;  3T53 B;  4MTK A;  4BBR G;  3GTM H;  4B08 A;  4NW2 A;  5IYC H;  1G29 1;  4IUP A;  2VB2 X;  3NBI A;  3M3Y B;  1YJ9 A;  3MHB A;  2MO0 A;  2HHH L;  2F0D A;  3KLS X;  1BF4 A;  1N33 L;  3M3Y H;  2BOS A;  3M4O H;  2KEE A;  2QDB A;  2QKI C;  1GVP A;  3G71 A;  3H09 A;  4IO9 A;  4GKJ Q;  4IPC A;  4DR3 L;  2F0K A;  1I4X A;  1EEF D;  3HOZ H;  4BY7 H;  2X69 A;  5K36 G;  2HT1 A;  4H7B A;  4AQY L;  1VF5 C;  3P7J A;  2NVQ B;  1PH6 A;  5AJ3 L;  2E2D C;  4A3C G;  2KEN A;  3QG1 A;  1MI2 A;  1S4Z A;  2N49 A;  5JEA H;  3CCQ A;  1QZG A;  4DA2 A;  3OMG A;  1YNN D;  4LF7 L;  4HCE A;  2PI2 A;  4V19 0;  1IKL A;  4KI0 A;  5C0X I;  3QJY A;  4APV A;  3G48 A;  4LFB L;  4QMG A;  1SYG A;  2I0Q A;  3ERQ A;  1SMX A;  1YVC A;  1R9T B;  2Q2T A;  4G7O C;  3FKI H;  1OTC A;  1EY6 A;  4P73 A;  4B3S L;  1J9O A;  3ONA B;  1QZH A;  3F2U A;  4RWS C;  1PFN A;  3I4L A;  2B3G A;  4JBM A;  1O78 A;  5T1I A;  2EXD A;  1JT8 A;  1JIC A;  3BZC A;  1ASZ A;  4DV1 Q;  1B53 A;  1KNE A;  1EOT A;  2K33 A;  4TVA B;  3JAM i;  1RF2 D;  3PO2 H;  1DOK A;  1VQN A;  3M4O B;  1QCB D;  3J81 c;  1VQM A;  2F0V A;  3I56 A;  2UU9 Q;  1HCZ A;  1S5E D;  5IYD G;  3VYT A;  2B2V A;  3CPF A;  1JCK B;  3KJP A;  3KLW A;  1WD0 A;  5M5W H;  3QB3 A;  4C3J H;  3NQI A;  3S2D H;  1E22 A;  1NAP A;  1JC7 A;  1P8L A;  5C5L A;  3RLF A;  1B4O A;  2HIX A;  4GKK Q;  3H91 A;  3RN2 A;  3NUC A;  2YTX A;  2ZM6 L;  1SE2 A;  2XWJ B;  3FMC A;  3K8A A;  2B2T C;  1SR3 A;  1VQL A;  1S5D D;  2EIF A;  3S1R B;  4F87 A;  1PVO A;  1G2S A;  3OIQ A;  1U4M A;  1RDP D;  5JAV A;  3SHL A;  1V9P A;  2OF1 A;  1FYC A;  3AB9 A;  4IAL A;  4ME5 A;  1DON A;  3IL8 A;  4Y7N B;  1NBW A;  1SYE A;  3HGB A;  2PPB C;  4XT3 B;  4HIM A;  1C0A A;  2Z4I A;  2F4V L;  2I07 B;  4K0K L;  3FRP B;  5CC4 A;  1KLG D;  1C8C A;  4HR7 B;  5AJ3 Q;  4DR5 Q;  1RJT A;  2YU9 B;  5IYB H;  1HTP A;  3I3C A;  4DV1 L;  3I70 A;  1EWI A;  2SNM A;  3K7A H;  2JA8 G;  5FOB B;  2GN5 A;  3J80 L;  1EZ6 A;  2RDG A;  3GTL B;  4YIJ A;  1C7Y A;  3GTL H;  1VMC A;  4HMI A;  5EPJ A;  4NXN Q;  4EGV A;  4J8Q A;  3VA7 A;  3M85 A;  5IGG A;  1UAP A;  1X3F A;  4QCL A;  1UE1 A;  4NB3 A;  1TQO A;  4PG3 A;  1IL8 A;  4ALP A;  5LMN W;  1P16 A;  3MXN B;  3G6J B;  5IOD A;  2DJF C;  3RZO B;  1A6X A;  1TT2 A;  5M5Y H;  4A93 H;  4ODG A;  2ZXP A;  4IUN A;  2QA4 A;  4X64 L;  2NTT A;  1CKO A;  3BZK A;  1S5C D;  2F52 A;  3H0G B;  1EQV A;  4ULL A;  5LMN L;  4UP8 A;  4R4O A;  2QIL A;  3I91 A;  2E76 C;  3PO3 B;  2JSO A;  2Z6K A;  1KAA A;  2M9V A;  3LGJ A;  2K7V A;  1KDA A;  5CV7 A;  5FLX E;  1ZXT A;  4QB4 A;  2F0G A;  4FXK C;  1EIY B;  1PTO C;  3CCE A;  5LMU Q;  3OSO A;  3J80 E;  5FJ8 H;  2NTS A;  3G6E A;  2KHJ A;  1PZK D;  3KYH C;  2B2W A;  3GV3 A;  2JA5 G;  2UXD L;  2O5J C;  1ESR A;  4DR2 Q;  3OPO A;  3SVM A;  3E3X A;  4DR5 L;  4BY7 G;  2F4I A;  3UDF A;  2B39 A;  3J7A 5;  4B3R Q;  4DAV A;  1LTR D;  1EWC A;  2ASB A;  2ZTE A;  1PYW D;  2DUD A;  5IGD A;  3PO2 G;  2Q2I A;  3HP3 A;  4LF9 Q;  3RMH A;  4LF4 Q;  4HSP A;  1F2Z A;  4DR7 Q;  3MXG A;  2H4O A;  2MHV A;  1BCP F;  5C44 H;  2NZH A;  3A8I E;  4JVZ A;  2KHS A;  3FHW A;  2NBF A;  1ILQ A;  4JI3 Q;  1HQM C;  4OIK A;  1PH7 A;  3F2D A;  4JI8 L;  5EBD A;  1EY0 A;  3SK4 A;  2MPM A;  4A3G B;  1A63 A;  2VQE L;  2RQX A;  5C3E G;  1LTI D;  3OW2 A;  4AYB G;  1FR3 A;  4XQQ A;  1MKH A;  3SXH A;  1LAC A;  3V96 A;  1E24 A;  1RL2 A;  1MHW C;  1VQP A;  5M9O A;  1H95 A;  1LTG D;  1M8A A;  4XTC S;  2PMZ B;  4MIU A;  4BA1 I;  1X3P A;  2DNE A;  2EVB A;  3T4A C;  5KYL A;  2Q2U A;  1TXY A;  1MSG A;  1L1O B;  3KF8 A;  4A3I G;  4L5R C;  4Y7N H;  1ET6 A;  1VQF A;  2LFN A;  3MEF A;  1NR4 A;  2WP8 J;  2F0O A;  3C46 A;  3RNU A;  1RIP A;  4IUQ A;  3QIA A;  1MBY A;  2PQE A;  2G9D A;  3ZJY C;  5I6Y A;  1STB A;  3CKI B;  3HRZ C;  2CHB D;  3DMU A;  1ROD A;  2L0C A;  2ZJR A;  4A3B B;  3H6M A;  1VQ5 A;  1HNZ L;  1J5E L;  5I4D A;  5ELE A;  3EFX D;  4O0A A;  5HY6 A;  4X3S A;  5A2Q E;  1PDQ A;  2KCT A;  1HXY D;  2JK8 A;  2QCP X;  1I94 L;  2LY7 A;  1ENF A;  3FVQ A;  4B3S Q;  1LT3 D;  1DJR D;  4JI6 Q;  1JWS D;  1D5M C;  1HFN A;  3BS1 A;  1KIX A;  3L9A X;  4CKC A;  4HJ8 A;  1XMQ L;  2CW0 C;  1W3S A;  5ELD A;  4NKL A;  5KND A;  1Z6H A;  2B2T A;  2E5L Q;  4RAU C;  4KJO A;  2IWH A;  5CR3 A;  3NQT A;  2XWB B;  5BR8 L;  2K5Q A;  1EL0 A;  2A69 D;  3DWA A;  1TVX A;  2EJG C;  1PTO F;  4FF1 A;  2E74 C;  4BWG B;  1UE5 A;  1HNX Q;  3K57 A;  4KN7 C;  3ND9 A;  4YY3 Q;  1I6H B;  1RHP A;  4LFC L;  4C3I B;  2K5D A;  1VQH A;  4IUV A;  1CQF A;  3I4N B;  1Q82 C;  1TS5 A;  1S5B D;  5EJW A;  4IJH A;  2VQE Q;  1YIT A;  2F0Q A;  4Z9C B;  1B8A A;  4IFD I;  1SE3 A;  2FXQ A;  2K75 A;  3S1N B;  1YNJ D;  4HN7 A;  3DM3 A;  3I4M B;  1DGS A;  1F9S A;  4FF3 A;  5G3L F;  4DNI A;  4XIG S;  4F7X A;  2HIV A;  2ZTD A;  2KEC A;  3KF6 B;  1I94 Q;  3DXJ C;  2AWO A;  1U4P A;  4PMB A;  2MUY A;  1VDZ A;  1B1Z A;  4JV5 L;  3MFY A;  4KKU A;  1I3Q H;  4HAE A;  5KNB A;  2CWP A;  5FLM G;  3HOV G;  2XRQ D;  2OEO A;  1NY4 A;  4DV4 L;  4KY7 A;  5KGU A;  1DXM A;  3CCM A;  1NCV A;  5JPN C;  1ZYR C;  1BNZ A;  1PRT F;  3NBH A;  1SRO A;  3I55 A;  5F2D A;  5IWA Q;  5IOC A;  4JC0 A;  1K73 C;  3CC2 A;  4JI6 L;  1KD1 C;  4WFN 3;  1BCP B;  3DHQ A;  4A3E G;  4A3F G;  1HNX L;  5JPM C;  3BDC A;  4JI2 L;  4BBR H;  1CK1 A;  1C48 A;  4XYQ A;  1BOS A;  2KCC A;  1EU4 A;  2N55 A;  2RVL A;  1AN8 A;  1FJG L;  2QDL A;  4WRD A;  4NMZ A;  2L5T A;  1KTK A;  4OL7 A;  4C2M H;  2MNA A;  2R92 H;  1S3O A;  2RHQ B;  1U0L A;  1FNU A;  5HUR A;  3FEW X;  3EA6 A;  4C1N K;  1IBL L;  3M4P A;  3KF6 A;  3VR5 A;  2VZA A;  1UE6 A;  1WTP A;  2FIN B;  5LMU L;  4YY3 L;  1A8V A;  1B3Q A;  3W3A A;  1JOQ A;  1LTS D;  1Y14 B;  2ALY B;  3VYS A;  3KJO A;  2E2H H;  3NTH A;  3S16 B;  5GRO A;  4QF4 A;  2D0P A;  1E0B A;  3L0O A;  4A4I A;  4DR6 L;  3S1Q B;  4HCS A;  1QWY A;  4CDF C;  4LF6 L;  2K05 A;  1V1P A;  4B3R L;  4EQ5 A;  2AQ2 B;  4JOI A;  1TKW B;  4RA8 A;  1Z9F A;  4DUZ Q;  3S17 B;  1GOZ A;  3D8G A;  1BQQ T;  2Q8R E;  3PIO A;  1SYC A;  4LUV A;  5C4X G;  1BVS A;  3R2I A;  1K83 B;  3ULP A;  3OHX C;  4RGN A;  2UXB L;  1LTA D;  2JJQ A;  3W1G A;  3L2P A;  1KDB A;  2JA6 G;  1X3Q A;  5H1S E;  3K0X A;  4YCW A;  1HR0 W;  4DR7 L;  4OWW B;  1Y1V H;  2LSS A;  2IT1 A;  4DAP A;  3NEN A;  1W2B A;  3DWQ A;  1VQ7 A;  1Y1V B;  4H13 C;  2BA0 A;  3VR2 A;  1WTO A;  1TWF H;  2ICI A;  2PZW A;  4S3S A;  4IOA A;  3J81 j;  2UU9 L;  2Y0S G;  5IE8 A;  1GUO A;  3E6Z X;  4DR4 L;  1V1O A;  3D6C A;  2NVY H;  2Q8I B;  4JBJ A;  4ZK9 B;  1XNR L;  1E1T A;  1D7Q A;  4DV3 Q;  1GXD C;  1AW7 A;  1WTV A;  3TBI B;  1BR9 A;  4C3I H;  5FO7 B;  3OYY A;  1CI3 M;  2QW7 A;  3KBG A;  1E7Z A;  1NUC A;  4GLV B;  3Q23 A;  4A3F B;  4X66 Q;  2Q2H A;  3K6O A;  1KXL A;  5ELF A;  3TEH B;  1QJO A;  1KRT A;  1Y8N B;  2EOT A;  1L1O C;  2N3S A;  2RA4 A;  1CZW A;  1BUV T;  4JYA Q;  3QWN A;  1BBW A;  1DM0 B;  3A54 A;  2EYH A;  1KRS A;  4A3G G;  1Q81 C;  3H3V C;  2PZU A;  5I6W A;  4A93 G;  2VQF L;  1TS3 A;  4DUZ L;  2OWO A;  1GD7 A;  4R4Q A;  3SK5 A;  2FFK B;  4K2L A;  5EKK A;  4A3F H;  5DNF A;  1EQQ A;  3C3L A;  3T51 B;  1B44 D;  5E7N A;  3RLO A;  5C3X A;  2VUM G;  3U50 C;  1YZ6 A;  5KEE A;  1JOK A;  1SNM A;  1PFM A;  4O2D A;  3PUV A;  3VYU A;  2F0T A;  1ICF B;  2XTI A;  3TP8 A;  1PRT D;  3FP9 A;  4CGY B;  2E75 C;  4CBV A;  3PO3 H;  2NVY B;  2VS1 A;  4C3H G;  2C5C A;  3BDO A;  4IN3 A;  4QUC A;  4HED A;  1WFQ A;  2OXP A;  4EX5 A;  3HOY G;  3I7F A;  4GLX A;  2A8V A;  3HKZ G;  5C3E H;  4WOR A;  3PV0 A;  3E5S A;  5IT9 L;  4FF4 A;  4N8X 1;  1LTL A;  2I5M X;  3UDI A;  1PMR A;  1LT4 D;  3SK8 A;  5D3I B;  3E9H A;  1EY8 A;  3KDF A;  1YHB A;  1SND A;  1WCM G;  2MJ8 A;  2A6H D;  4DR4 Q;  5LMN Q;  1WD1 A;  2R93 B;  3PUW A;  4KLK A;  1T5X D;  2I5H A;  3GTG H;  1X3E A;  2AWN A;  3HZX A;  2WAQ B;  2YYZ A;  3VR4 A;  1VQJ A;  1LTB D;  1PXU A;  3CRL C;  2UUC L;  1HTL D;  1SNO A;  3BG3 A;  1SN8 A;  2CH4 A;  2ES2 A;  1IXR A;  2EE1 A;  4L63 B;  1VQ9 A;  2OTJ A;  1SJE D;  1STY A;  3S2H H;  4DU9 A;  5CMD A;  1VQ4 A;  2UXC L;  1J6Q A;  1W6K A;  3OMC A;  5DM7 3;  2VUM H;  4LF8 Q;  3A5Z B;  1SXT A;  3P20 A;  4U67 3;  4A3J B;  4OON A;  3D4R A;  4A3D B;  1O80 A;  5C4Z A;  4MN3 A;  3FKI G;  3T1Y Q;  3CCV A;  4ZKC B;  1PH1 A;  2E2H B;  4DK3 C;  2PQA A;  1SYB A;  1X32 A;  4ABN A;  5C4X H;  4RGT A;  5TSS A;  4KMU C;  4UAI A;  5KIX A;  1K8M A;  4JI2 Q;  1XX8 A;  1SSO A;  1AFP A;  1HZA A;  2WV6 D;  1K0S A;  3NEM A;  2HUG A;  3L7Z C;  4IOC A;  4R1J A;  3TME A;  1WTH A;  4G4K A;  4LUZ A;  5EQ0 A;  1HZB A;  2ZJP A;  5M3F H;  3HOU G;  1A3V A;  1FJG Q;  3IFD A;  4MNO A;  3AFQ A;  3URY A;  2KUM A;  4ZKB B;  3T56 B;  4POF A;  4MHE A;  3K5M A;  4ZUJ A;  4B3M Q;  3PGZ A;  1UNS A;  1BKB A;  2A69 C;  3QOJ A;  2F3V A;  4FP5 D;  3B6Y A;  4KJN A;  4DR1 L;  1SYD A;  3S16 H;  4HJ7 A;  2XNA C;  3K7A B;  3F2B A;  3GDE A;  3MVV A;  5J1Z A;  4KY5 A;  1JB7 A;  3VA5 A;  3WOE A;  4HJA A;  1ZKO A;  2AQ1 B;  1DZ1 A;  2E2J B;  2R7F A;  2PNH A;  4YCV A;  4FNF A;  1I4P A;  1HZ9 A;  5CBA E;  3A74 A;  4LW1 A;  1AE3 A;  3GTO B;  2QEX A;  2F0E A;  1RCV D;  2ZJQ A;  1IBM L;  3HOZ B;  4DN4 M;  4JI4 Q;  4YHH Q;  4U68 A;  4KHP L;  1TII D;  4L5Q A;  5HGQ A;  5I9O A;  2WAC A;  1D5Z C;  3UI2 A;  2UXC Q;  4JCV E;  5D65 A;  3JC6 6;  1S40 A;  2KJX A;  2JN4 A;  2AHO B;  3NBH B;  4BBS G;  4GNX A;  2N8N A;  4ZRZ A;  2SEB D;  2E5L L;  2V1C C;  4CHT B;  3E0J A;  4Y52 H;  4K8J A;  1ZEQ X;  4ZLT F;  1L0Y B;  5IP9 G;  2BCO A;  1HA6 A;  3RD4 A;  1N8R C;  3QR8 A;  4YWM A;  4QGU A;  2IL8 A;  2UUA L;  1GJX A;  3GP7 A;  3HKZ B;  3U9S A;  3R93 A;  2K6A A;  4POG A;  2SDF A;  1I4Q A;  1TS2 A;  4O42 A;  4OWT B;  1EQT A;  3TZD A;  3PO2 B;  2NVX B;  2E2I B;  2F0W A;  4DV7 L;  4DAY B;  1EYG A;  4K6L A;  1B70 B;  5JJZ A;  2KOL A;  1EIG A;  2ID0 A;  3EJI A;  1A2U A;  1A62 A;  2EYJ A;  2B2Y C;  1HR0 Q;  3A7L A;  2GVB A;  2IHF A;  2JXM B;  1CUK A;  3M4Y A;  1PV4 A;  1VF7 A;  1Y1W G;  1JQY D;  3V2T A;  1Y1W B;  4C56 C;  1PFS A;  3A8J E;  1ASY A;  4LF7 Q;  1Y1W H;  2NYZ D;  3TP6 A;  4I7A A;  2VQF Q;  2F0L A;  5C44 B;  4R9W A;  1U9R A;  1E2Z A;  1G2T A;  3TN2 A;  5C6A A;  4H44 C;  2A1A A;  3NTK A;  2K01 A;  4DUY L;  1CHQ D;  1LO5 D;  4CKB A;  4A3D H;  3TP7 A;  1OO9 B;  4IPH A;  3S1M B;  1GHK A;  4OEL B;  3UDG A;  2JA9 A;  2EJF C;  5T1G A;  3S1M H;  4P2C B;  2R93 H;  3BJU A;  4DV6 Q;  4N8F A;  2H1E A;  2HD3 A;  1CT1 D;  1EY4 A;  2KCM A;  4L5T A;  1YHA A;  1BBU A;  3CC7 A;  4PQX A;  1HNW L;  4A3K H;  4X62 L;  4X6A H;  5IGF A;  2KQ3 A;  4DV5 L;  3OW7 A;  5E4W C;  4K14 A;  5COY A;  3KDF B;  2A19 A;  3K59 A;  1E2W A;  4FDB A;  1EYC A;  1T5E A;  4K5W A;  1H9S A;  3MC0 B;  4QL5 A;  2DJG C;  2O4X A;  3D0F A;  2L11 A;  5JEA J;  4QY7 A;  1KHI A;  2AUJ D;  1S5F D;  2JYO A;  1Y69 U;  1FD7 D;  2QF7 A;  2MO1 A;  4H02 A;  4JBW A;  4B3T L;  4QIW E;  1KNA A;  2KA7 A;  3TS0 A;  3CCJ A;  3U58 A;  1EY5 A;  5EPK A;  3GO5 A;  2OQ0 A;  1LM0 A;  1PLF A;  2IPK D;  2MFI A;  3J7Z C;  4MZ9 A;  1GUG A;  3K0Y A;  5HGT A;  1K3B C;  4R4I A;  4BXX H;  4R4T A;  1XPU A;  1D5X C;  1KAB A;  1SFO B;  3S15 B;  5C0X G;  3MTS A;  2F4V Q;  1K9M C;  3HOX G;  1K8G A;  3ER0 A;  2IHE A;  2R6G A;  2IX3 A;  3GTO H;  3GTQ B;  1YIJ A;  3K7U C;  2CQO A;  3J7A F;  3BU2 A;  2A73 B;  4K2K A;  1ENA A;  2A6H C;  1D2B A;  1OXS C;  1J5E Q;  3KFU A;  2PCF B;  4X62 Q;  3AFP A;  2YV5 A;  4XQN A;  3I4N H;  3HG9 A;  1EYD A;  3I2Z A;  2Z6B A;  3I72 A;  2KBN A;  4K0K Q;  1NNX A;  4QUF A;  4BY1 G;  1SLJ A;  3I73 A;  1PH3 A;  1Q86 C;  3STB D;  3CW2 C;  2WKC A;  2F0P A;  5CV9 A;  4CJ1 B;  3K58 A;  1QVF A;  2D0O A;  5E1F A;  1JMC A;  5I9P A;  5ELN A;  4NXM Q;  3K5N A;  3ITP A;  4A3C H;  1NMF A;  2EY2 A;  1PH9 A;  1XTD A;  2EPB A;  4F8M A;  3PF5 A;  2K1B A;  2GVA A;  4DV5 Q;  2NVT B;  3H94 A;  4B3M L;  2R7Z H;  5LL6 S;  2DNC A;  4DV0 Q;  2NB0 A;  4ZCK A;  1GUT A;  3CCR A;  4LFC Q;  1TWC B;  3D4W A;  1YNN C;  2D9U A;  4UP7 A;  1ILP A;  1BCP C;  2F3W A;  4G57 A;  4FYD A;  1H9M A;  2DN8 A;  5J22 A;  3PCO B;  3AQQ A;  2HHH Q;  5M5Y B;  2D2C C;  2K5V A;  4P71 A;  1JJC B;  1SE8 A;  5AFW A;  4A3L G;  1NJI C;  3GV6 A;  2XIW A;  1IBM Q;  3TRZ A;  2I5L X;  2FJ2 A;  3BYT B;  4JG2 A;  1GUS A;  1PH4 A;  5E3F A;  2ZXR A;  4YHH L;  1D6E C;  1STA A;  2UUB Q;  2EYP A;  3U9O A;  4IPG A;  4JI0 L;  2RBM A;  1NTG A;  2WB1 B;  1VQ6 A;  4JV5 Q;  1JOR A;  2WB1 G;  1QB5 D;  3AEV A;  2CWA A;  3N52 A;  1PTO D;  4R4C A;  1EQR A;  1S72 A;  4JI7 L;  4A3B H;  2CCZ A;  3NEL A;  2G9H D;  1KC8 C;  1JE4 A;  4PV1 C;  2XVS A;  2F0F A;  1YBY A;  1CFM A;  3CQZ H;  1XWE A;  5FO8 B;  1PRT C;  3OOC A;  2UUA Q;  5FLM H;  1TWA B;  4DV0 L;  2A68 C;  2VXW A;  5KNC A;  2JA7 H;  3GTP B;  1SMY C;  4DXG A;  4LF5 L;  3MAQ A;  2PI2 E;  5COR A;  5IYC G;  1SNP A;  2R3Z A;  1G6Z A;  2X6L A;  4M8A A;  1FGB D;  1STG A;  3T16 A;  1EUJ A;  1A0I A;  2VUM B;  2O5I C;  2M2L A;  1T9H A;  3KOJ A;  3T1H L;  1WJJ A;  3GD7 A;  2MGS A;  1AE2 A;  2WAQ E;  2EXZ A;  1STN A;  1JJ2 A;  3GTQ H;  4C3H B;  1UUP A;  5EKL A;  4JPB W;  4G7H C;  3A56 A;  1YI2 A;  4DAY A;  4HJ9 A;  3PQI A;  1BDO A;  3LWE A;  3DM1 A;  3PO3 G;  4NPS A;  2RSO A;  3NTI A;  5C4X B;  1QG7 A;  3HS0 C;  4OX9 L;  1WTW A;  1G6P A;  5NUC A;  2HCI A;  3E0E A;  4HMJ A;  3CU7 A;  1Y8P B;  4N9T A;  3M9B A;  3EQL C;  3DWP A;  2JA5 H;  4PZ7 A;  2BDO A;  4UPA A;  2JA5 B;  1DYQ A;  3A0J A;  4PZ8 A;  2XN9 C;  1I6H H;  1HNW Q;  1VQG A;  3F1Z A;  5GAD C;  1CSQ A;  3PIP A;  3X3N A;  4A75 A;  1N36 L;  4UP9 A;  3MWY W;  3TP5 A;  3GTM B;  4IJL A;  2V4D A;  1PFB A;  1RTN A;  3VR6 A;  5CYU A;  2O2L D;  3TSS A;  5IT9 E;  1K8A C;  3EIV A;  5C3W A;  1VQB A;  2JQO A;  3I4M H;  5CV8 A;  2IJ0 A;  1TWC H;  1OXV A;  1HZC A;  2VW9 A;  3H15 A;  4H0L C;  2K52 A;  2XGT A;  4BA2 I;  2K5N A;  3T1H Q;  2F0I A;  1KDC A;  5JOB A;  2Z1C A;  4KD4 A;  2EYO A;  1N33 Q;  3R2T A;  2OCE A;  3V05 A;  4JOI C;  4A93 B;  4IPD A;  1SDF A;  2NVQ H;  2L1B A;  2YTV A;  1XJV A;  1WI5 A;  4A3D G;  3KK7 A;  1JR0 D;  1H9S B;  1L0W A;  2KHI A;  3IKJ A;  4EVO A;  3MFG A;  3Q6S A;  3SDZ A;  2J0T D;  4AQY Q;  4A3B G;  1XXG A;  1HA5 A;  1V8Q A;  1D1I A;  4PMC A;  3VDY A;  3CD6 A;  3I90 A;  4WJ4 A;  1N32 L;  3J81 i;  3A7A B;  3PUZ A;  2JA6 H;  2B2W C;  3CCU A;  3HOW H;  1NR2 A;  1B9M A;  2EYF A;  5LL6 X;  3ULJ A;  1IYJ B;  5BN3 A;  2EY5 A;  2NVX H;  1B2T A;  2KVM A;  3BYY B;  4L6T B;  3PSI A;  4IUT A;  4CDD C;  1VQ8 A;  4J6H A;  3ERO A;  3OWE B;  1AP0 A;  4IFD H;  1N9W A;  2JA7 B;  4RCN A;  4IZ8 A;  5BN5 A;  3S17 H;  4TRD A;  3HOW B;  4X3U A;  1HFG A;  5KYI A;  3HOX B;  1I4G A;  2Y0S E;  1OXT A;  1VMP A;  1TR5 A;  2FHT A;  1I5F A;  4RGM A;  1PH2 A;  3GTK B;  2NN6 I;  1LUZ A;  4J15 A;  2R93 G;  1L2F A;  3CPW A;  4CJ0 B;  4OWX B;  1QUQ A;  2HCC A;  3OIP A;  3L3O C;  2K28 A;  2DGY A;  3P75 A;  5M3F G;  2A6E C;  3HOU H;  1TWF B;  2K14 A;  4BY1 B;  2K5W A;  4GKK L;  2Q8T A;  4C3J B;  1YNX A;  4DV7 Q;  1EU3 A;  1UWV A;  2ZTC A;  2BH2 A;  1JWU D;  2EJM A;  3RZD H;  1TY2 A;  1VQK A;  1WCM H;  3EVQ A;  3DEP A;  2BDN A;  3SK6 A;  4PNY A;  2F0M A;  4ID6 A;  4RHR A;  1EIH A;  4GNX C;  1O7L A;  1HNZ Q;  2EQS A;  2C35 B;  3HOV B;  1LTT D;  4LFA L;  4O1N A;  2XSC A;  4UHV A;  3HOV H;  4CKE A;  3FKI B;  1V1P B;  2F03 A;  1B7Y B;  4IQZ A;  3MEH A;  4IFD J;  1BCP D;  4FXD A;  4P72 A;  1E3P A;  5A2Q L;  3GQB A;  1XMO L;  2H5X A;  2IY5 B;  1H9K A;  4YWK A;  5C0X H;  5G3L D;  1LLR D;  1WYD A;  4AH6 A;  3Q24 A;  3MA2 B;  1B50 A;  1KQS A;  3KLS A;  2LS0 1;  4RKB A;  1ENC A;  2WII B;  3ZYY X;  3HOU B;  1VCI A;  2OQK A;  4RH6 A;  3DEO A;  5C44 G;  2PW7 A;  4GN4 B;  1TWH B;  4XYO A;  2K5H A;  1HHV A;  5M5W B;  2QGQ A;  2OT2 A;  4AYB B;  5ELC A;  2I46 A;  4DV2 Q;  3RZD B;  1YNJ C;  5M5X B;  4DNT B;  3AMU A;  1HJP A;  2L9H A;  4N9P A;  4X66 L;  1D8L A;  4KHV A;  3KLR A;  1ONL A;  2CH4 W;  2EZV A;  1VQC A;  2NWG A;  3UDX A;  3HOW G;  2NN6 H;  2ATW A;  3CHB D;  3MXP A;  1E2V A;  4LNQ A;  2TSS A;  1X55 A;  3H0G H;  3JAM E;  3F2C A;  4HSV A;  4ZAI A;  4EQN A;  4BBS B;  4GOP A;  4BBR B;  1II3 A;  2B29 A;  4BBS H;  2A5H A;  4LFA Q;  2E8G A;  2F0S A;  1FNW A;  1HRJ A;  2A68 D;  3FPU B;  1SE4 A;  5ISR A;  1GM5 A;  1EEI D;  1QNU A;  3I4O A;  1QUQ B;  3K5L A;  4C3J G;  1JJG A;  4RMF A;  1STE A;  4KKT A;  4TKO B;  3A55 A;  1CKN B;  1AH9 A;  3RZO H;  1UEB A;  4DKA C;  1KLU D;  3ERS X;  3ICE A;  1V43 A;  4TQU S;  1QIL A;  1ICW A;  1MJC A;  1MD2 D;  2Z9H A;  3HFZ B;  2CKZ B;  4LFB Q;  4Q5V A;  1LYL A;  1Y1V G;  4E6I A;  4RFB A;  3MXN A;  1N36 Q;  4DXF A;  2HDM A;  1OXX K;  5M5X H;  1VQD A;  1I6V C;  4A3L H;  2NZ1 D;  4AYB E;  2UXD Q;  1EY7 A;  5IY0 A;  1F9R A;  4YCU A;  1R4P B;  1MJE A;  3HOX H;  5BN4 A;  3O13 A;  3TZU A;  5IT9 c;  1EYA A;  1GHJ A;  1N34 L;  4MTN A;  4OO1 I;  1IBK Q;  3IFT A;  2AUK A;  3W1B A;  1I3Q B;  2PYK A;  4NXM L;  1O7Y A;  1EFI D;  1F77 A;  4C3I G;  3H3V I;  4ZQ3 A;  1WCM B;  5M3M B;  4LF4 L;  4FO2 A;  2VY3 A;  1DD2 A;  1X9N A;  1MSH A;  3CME A;  2HQE A;  3S24 A;  5FJ8 G;  1IBL Q;  4BS9 A;  1JOO A;  1XTC D;  5D14 A;  5J39 A;  1C9O A;  2SNS A;  4DV2 L;  1STH A;  2DY7 A;  3TQY A;  3J80 i;  4A3J G;  4HTH A;  5C3E B;  1TY0 A;  3SGI A;  1SNQ A;  1GO3 E;  1HR0 L;  5DAU A;  1CA6 A;  4KHZ A;  4DR6 Q;  1CKN A;  1YHQ A;  1F2Y A;  5DM6 3;  2DY8 A;  3RN5 A;  4R8I A;  1KAW A;  2QEJ C;  1EFW A;  4KY6 A;  1JWM D;  4RGO S;  1SRU A;  2OTL A;  1VS0 A;  4NP5 A;  2L15 A;  2GA4 B;  5FK9 C;  1RKN A;  2RSN A;  1IYV A;  5GAE C;  2Z8L A;  4A3G H;  4KKS A;  1Q3L A;  2NUC A;  1FNV A;  4PMW A;  1IL2 A;  1U4R A;  2CFM A;  4Q0F A;  2Z4H A;  2RKS A;  1MGS A;  4X65 L;  3QOL A;  5DEH A;  2AKW B;  2B8F A;  1QOH A;  2WIN B;  1LT6 D;  5CBE E;  4KK7 A;  1O7I A;  1SEB D;  3BVG A;  4DV6 L;  4JI7 Q;  4NDX A;  3HOY H;  3GTK H;  1N34 Q;  4BXX G;  1IBK L;  5M3M H;  4C1N I;  5K36 H;  3CF5 A;  2B2Y A;  1Z47 A;  1PHJ A;  4A3I B;  1L1O A;  1I4R A;  4NXN L;  1ESF A;  1WTR A;  1XNR Q;  2NN6 G;  4KN4 C;  2EY6 A;  2VB3 X;  5C0X J;  1A2T A;  3N6R A;  1UE7 A;  4OGQ C;  2WKD A;  3ND8 A;  2L55 A;  5I2X A;  3R8B A;  1SYF A;  2JE6 I;  5EBC A;  4RHS A;  1QVC A;  2AMC B;  2TMP A;  4QIW B;  3U4V A;  1VQE A;  1EY9 A;  2PO4 A;  3NP8 A;  3K81 C;  3PIP 3;  4DFA A;  4B3T Q;  1TS4 A;  2MP1 A;  3H3V H;  3BVM A;  4K5V A;  2LMC B;  2YU9 H;  4HIK A;  1CQV A;  1I50 B;  3F8T A;  3X3M A;  2L12 A;  1PYB A;  3D3R A;  3SR1 A;  4OIJ A;  4GKJ L;  4DR1 Q;  5M3M G;  1F9Q A;  1K0R A;  4R8N A;  3S1N H;  1UEA B;  5IGC A;  4QQB X;  2B63 B;  3DUZ A;  3C1F A;  3HOZ G;  5KRU A;  3BZD B;  3H0G G;  3LNN A;  4GNX B;  1NE3 A;  1NSN S;  2A6E D;  1Q1E A;  1IHZ A;  1XPR A;  3QO2 A;  3RUZ A;  3GTG B;  4JYA L;  3D6W A;  3TRE A;  2R7Z B;  3C2P A;  1CM9 A;  4DGZ A;  2E2J H;  5IP7 G;  3WDN A;  3JAM c;  4A3M H;  2VNU D;  5JJI A;  3J7Y W;  3CRK C;  1BO0 A;  4CDE C;  4A3E H;  1WOC A;  3NE5 B;  4OHJ A;  4TSS A;  4FVM A;  1VQO A;  2PQA B;  1PYS B;  4WJ3 M;  5EPL A;  5IWA L;  3R3O A;  1G91 A;  1PH5 A;  3S2H B;  1F2M A;  2BE5 C;  2LXK A;  4BY7 B;  4I65 A;  4J1M A;  2B2U A;  3KF8 B;  4DV4 Q;  5FKA C;  1C4Q A;  2HDL A;  3LWU A;  1LAB A;  2RCN A;  4JI8 Q;  3U4Z A;  4A3K G;  4QJF A;  2JA6 B;  4A3J H;  4DK6 C;  4A3M B;  1AZP A;  3W2D A;  2K03 A;  3ULL A;  2ENB A;  2ICE C;  5J3B A;  3RR5 A;  4JI1 Q;  4K6D A;  3OWF A;  2PMZ E;  4DAM A;  2BH8 A;  3PUX A;  3TDQ A;  1PZI D;  4K8I A;  3Q22 A;  2E2I H;  2RDF A;  5IP9 H;  2UUC Q;  3HKS A;  4FXG C;  2HQL A;  4IUR A;  4EQP A;  1EZ8 A;  1YJN A;  5GQO A;  2EYL A;  2ZM6 Q;  2PZT A;  2EDG A;  3MZ5 A;  5IYB G;  4KD3 A;  3I4M G;  5IIF A;  1HQR D;  2B2U C;  4LF6 Q;  1X54 A;  1N32 Q;  3PMF A;  1EWH A;  1H9R A;  1XPO A;  3NHH A;  4A3E B;  4XDX A;  4UDU C;  3S1Q H;  2F0U A;  4JI5 L;  1Y8O B;  4ZYS A;  1CA5 A;  1LV9 A;  3UE1 A;  2BA1 A;  2ZXO A;  1Z7T A;  4KV6 A;  2K04 A;  2UXB Q;  3CCL A;  4CJ2 C;  3I8Z A;  3MXU A;  1K3R A;  5K5P A;  4XT1 B;  1A3T A;  3P1H A;  1TWG B;  3IRB A;  3HOY B;  5JVH 3;  3K5O A;  2KED A;  5M3F B;  3OTO Q;  1XNQ Q;  4B9W A;  1ML0 D;  3EN2 A;  4C3H H;  1BBX C;  1GUW A;  2RF4 A;  2ZT9 C;  3S9W A;  4A3I H;  3A8K E;  2R61 A;  5FO9 B;  4OO1 G;  3WOF A;  5D3D A;  1AZQ A;  1X3G A;  5IGB A;  3CC4 A;  5CV4 A;  2IX1 A;  5FLX L;  1GUN A;  4FF2 A;  1PH8 A;  5CV6 A;  5EAY A;  5BR8 Q;  3J81 L;  3PF4 A;  5GAG C; 
#chains in the Genus database with same CATH homology
 3D4D A;  3SEB A;  4C2M B;  1XYI A;  2R92 B;  1CZG A;  4LJZ C;  5C5M A;  3Q0A A;  4X3T A;  4DK0 A;  2D5D A;  5ELB A;  4ZUI A;  1U4L A;  2K32 A;  2BE5 D;  2Y0S B;  4LAA A;  1K8O A;  4KTA A;  1WTQ A;  1BXT A;  1QNK A;  4L8J A;  1W6J A;  4G7Z C;  5A35 A;  2FMM A;  1HUM A;  3VR3 A;  4X3K A;  1IW7 D;  4XXE A;  4F88 A;  1PTO B;  2N88 A;  4JK1 C;  2X6G A;  2IX0 A;  1D1K A;  1O7Z A;  1TU2 B;  1DOL A;  2F1M A;  5JVG 3;  3NK9 A;  1WVL A;  4K5X A;  2B8G A;  2A74 C;  3PUY A;  1Q12 A;  1QE6 A;  4A3K B;  3C1E A;  3HEJ A;  3AU7 A;  1H9J A;  4M1U B;  1ET9 A;  1Q1B A;  2JEB I;  1A3U A;  2C9O A;  2PW5 A;  1L0X B;  1PRT B;  2L4N A;  4EQO A;  2F0H A;  4DK1 A;  2J7Z A;  2LKV A;  4ILW A;  4IFD G;  1B9N A;  2JA8 B;  3KUP A;  3CQZ B;  2KCN A;  4RCO A;  4V0B A;  2JEA I;  1HUN A;  3BDL A;  4DF7 A;  3KBX A;  3SE0 A;  1A15 A;  3J81 E;  5LHY 1;  1WTX A;  4IUU A;  1M4V A;  5EGT A;  3VYR A;  2CVR A;  1RD9 D;  5JEA G;  4I7Z C;  1RTO A;  1IW7 C;  1SBB B;  2RDH A;  2CQA A;  5EKI A;  4DNR B;  2M00 A;  4B9X A;  2F0J A;  3LX0 A;  1DCZ A;  1HPC A;  1CTM A;  3T13 A;  3G7L A;  1J8I A;  1G8Z D;  1JB3 A;  1I4H A;  3NXW A;  5IGE A;  4XQJ A;  1Q8I A;  3PIO 3;  2J4X A;  4OO1 H;  1PZJ D;  3NPP A;  1AEX A;  2D62 A;  1IKM A;  2FMC A;  3NSW A;  1CHP D;  3S2D B;  2F0N A;  4LK1 C;  4WJW A;  4LMQ D;  1SMY D;  3J7A V;  3FPP A;  2AQ3 B;  3FDT A;  1F9P A;  1IYU A;  1F2L A;  1R4Q B;  2SOB A;  2B2V C;  3M7N A;  1Q90 A;  5I2Y A;  1SJH D;  3GTJ B;  2XRS D;  1ZYR D;  1PTO H;  3D31 A;  3S14 B;  5CV5 A;  1LT5 D;  2IW3 A;  2CW0 D;  5C4H A;  3JAM L;  1SNC A;  4GZY C;  2EYM A;  2EY1 A;  2PNR C;  1DOM A;  5CGK A;  2JP1 A;  1B3A A;  4RKL A;  1OXU A;  5C4J B;  3NWT A;  3BVZ A;  3IAY A;  3M7G A;  1SAP A;  5E4X A;  3NWS A;  3T53 B;  4B08 A;  4NW2 A;  1G29 1;  4IUP A;  2VB2 X;  3NBI A;  3M3Y B;  3MHB A;  2F0D A;  3KLS X;  1BF4 A;  2BOS A;  2KEE A;  2QDB A;  2QKI C;  3H09 A;  2F0K A;  1I4X A;  1EEF D;  2X69 A;  5K36 G;  4H7B A;  1VF5 C;  3P7J A;  2NVQ B;  2E2D C;  3QG1 A;  1MI2 A;  5JEA H;  1S4Z A;  4DA2 A;  3OMG A;  1YNN D;  4HCE A;  4V19 0;  1IKL A;  4KI0 A;  5C0X I;  3QJY A;  4QMG A;  1SYG A;  3ERQ A;  1R9T B;  4G7O C;  1EY6 A;  1J9O A;  3ONA B;  3F2U A;  4RWS C;  1PFN A;  3I4L A;  1O78 A;  5T1I A;  1JIC A;  1B53 A;  1KNE A;  1EOT A;  2K33 A;  1RF2 D;  1DOK A;  3M4O B;  1QCB D;  2F0V A;  1HCZ A;  1S5E D;  3VYT A;  2B2V A;  1JCK B;  1WD0 A;  3QB3 A;  3NQI A;  1NAP A;  1JC7 A;  5C5L A;  3RLF A;  1B4O A;  3H91 A;  3NUC A;  1SE2 A;  2XWJ B;  3FMC A;  2B2T C;  1S5D D;  3S1R B;  4F87 A;  1G2S A;  3OIQ A;  1U4M A;  1RDP D;  5JAV A;  3SHL A;  2OF1 A;  1FYC A;  3AB9 A;  4IAL A;  4ME5 A;  1DON A;  3IL8 A;  4Y7N B;  1SYE A;  3HGB A;  2PPB C;  4XT3 B;  2Z4I A;  2I07 B;  3FRP B;  5CC4 A;  1KLG D;  1C8C A;  4HR7 B;  1RJT A;  2YU9 B;  1HTP A;  3I3C A;  3I70 A;  2SNM A;  5FOB B;  3J80 L;  1EZ6 A;  2RDG A;  3GTL B;  4YIJ A;  1VMC A;  4HMI A;  5EPJ A;  4EGV A;  4J8Q A;  3VA7 A;  3M85 A;  5IGG A;  1UAP A;  4QCL A;  1TQO A;  1IL8 A;  5IOD A;  3G6J B;  3RZO B;  1A6X A;  1TT2 A;  4ODG A;  2ZXP A;  4IUN A;  2NTT A;  1S5C D;  3H0G B;  1EQV A;  4ULL A;  2QIL A;  3I91 A;  2E76 C;  3PO3 B;  2JSO A;  1KAA A;  2M9V A;  2K7V A;  1KDA A;  5CV7 A;  5FLX E;  1ZXT A;  4QB4 A;  2F0G A;  4FXK C;  1PTO C;  3OSO A;  3J80 E;  2NTS A;  1PZK D;  2B2W A;  3GV3 A;  2O5J C;  1ESR A;  3OPO A;  3SVM A;  2F4I A;  2B39 A;  4DAV A;  1LTR D;  1EWC A;  1PYW D;  5IGD A;  3HP3 A;  3RMH A;  4HSP A;  1F2Z A;  3MXG A;  2H4O A;  2MHV A;  1BCP F;  3A8I E;  2KHS A;  2NBF A;  1ILQ A;  1HQM C;  4OIK A;  5EBD A;  1EY0 A;  3SK4 A;  2MPM A;  4A3G B;  2RQX A;  1LTI D;  1FR3 A;  4XQQ A;  3SXH A;  1LAC A;  3V96 A;  5M9O A;  1LTG D;  1M8A A;  4XTC S;  2PMZ B;  4MIU A;  4BA1 I;  1X3P A;  2DNE A;  2EVB A;  3T4A C;  5KYL A;  1MSG A;  3KF8 A;  1ET6 A;  2LFN A;  1NR4 A;  2WP8 J;  2F0O A;  3C46 A;  4IUQ A;  3QIA A;  1MBY A;  2PQE A;  2G9D A;  5I6Y A;  1STB A;  3CKI B;  3HRZ C;  2CHB D;  3DMU A;  1ROD A;  2L0C A;  4A3B B;  3H6M A;  5I4D A;  5ELE A;  3EFX D;  4X3S A;  5A2Q E;  1PDQ A;  1HXY D;  2QCP X;  2LY7 A;  1ENF A;  3FVQ A;  1LT3 D;  1DJR D;  1JWS D;  1D5M C;  1HFN A;  3BS1 A;  3L9A X;  4CKC A;  2CW0 C;  5ELD A;  4NKL A;  5KND A;  1Z6H A;  2B2T A;  4RAU C;  4KJO A;  2IWH A;  5CR3 A;  3NQT A;  2XWB B;  2K5Q A;  1EL0 A;  2A69 D;  3DWA A;  1TVX A;  2EJG C;  1PTO F;  4FF1 A;  2E74 C;  4BWG B;  3K57 A;  4KN7 C;  3ND9 A;  1I6H B;  1RHP A;  4C3I B;  2K5D A;  4IUV A;  1CQF A;  3I4N B;  1TS5 A;  1S5B D;  5EJW A;  2F0Q A;  4Z9C B;  4IFD I;  1SE3 A;  3S1N B;  1YNJ D;  4HN7 A;  3I4M B;  1F9S A;  4FF3 A;  5G3L F;  4XIG S;  4F7X A;  2KEC A;  3DXJ C;  2AWO A;  1U4P A;  4PMB A;  2MUY A;  1VDZ A;  1B1Z A;  3MFY A;  4KKU A;  4HAE A;  5KNB A;  2XRQ D;  2OEO A;  4KY7 A;  5KGU A;  1DXM A;  1NCV A;  5JPN C;  1ZYR C;  1BNZ A;  1PRT F;  3NBH A;  5F2D A;  5IOC A;  4WFN 3;  1BCP B;  3DHQ A;  5JPM C;  3BDC A;  1CK1 A;  1C48 A;  4XYQ A;  1BOS A;  2KCC A;  1EU4 A;  2N55 A;  2RVL A;  1AN8 A;  4WRD A;  4NMZ A;  2L5T A;  1KTK A;  4OL7 A;  1FNU A;  5HUR A;  3FEW X;  3EA6 A;  4C1N K;  3VR5 A;  1WTP A;  2FIN B;  3W3A A;  1JOQ A;  1LTS D;  3VYS A;  3NTH A;  3S16 B;  4QF4 A;  1E0B A;  3S1Q B;  4HCS A;  1QWY A;  2K05 A;  1V1P A;  2AQ2 B;  1TKW B;  4RA8 A;  3S17 B;  1GOZ A;  3D8G A;  1BQQ T;  2Q8R E;  1SYC A;  3R2I A;  1K83 B;  3OHX C;  4RGN A;  1LTA D;  1KDB A;  1X3Q A;  2IT1 A;  4DAP A;  3DWQ A;  1Y1V B;  4H13 C;  2BA0 A;  3VR2 A;  1WTO A;  2ICI A;  2PZW A;  4S3S A;  1GUO A;  3E6Z X;  1V1O A;  3D6C A;  2Q8I B;  4ZK9 B;  1GXD C;  1AW7 A;  1WTV A;  3TBI B;  1BR9 A;  5FO7 B;  1CI3 M;  3KBG A;  3Q23 A;  1NUC A;  4A3F B;  3K6O A;  5ELF A;  1QJO A;  1Y8N B;  2EOT A;  2RA4 A;  1CZW A;  1BUV T;  3QWN A;  1DM0 B;  3A54 A;  2EYH A;  3H3V C;  2PZU A;  5I6W A;  1TS3 A;  3SK5 A;  2FFK B;  4K2L A;  5EKK A;  5DNF A;  3C3L A;  3T51 B;  1B44 D;  5C3X A;  5KEE A;  1JOK A;  1SNM A;  1PFM A;  3PUV A;  3VYU A;  2F0T A;  3TP8 A;  1PRT D;  4CGY B;  2E75 C;  4CBV A;  2NVY B;  4C3H G;  2C5C A;  3BDO A;  4IN3 A;  4QUC A;  4HED A;  2OXP A;  4WOR A;  3PV0 A;  3E5S A;  4FF4 A;  5IT9 L;  1PMR A;  1LT4 D;  3SK8 A;  5D3I B;  1EY8 A;  1SND A;  2MJ8 A;  2A6H D;  2R93 B;  1WD1 A;  3PUW A;  1T5X D;  2AWN A;  3HZX A;  2WAQ B;  2YYZ A;  3VR4 A;  1LTB D;  1PXU A;  3CRL C;  1HTL D;  1SNO A;  3BG3 A;  2EE1 A;  4L63 B;  1SJE D;  1STY A;  4DU9 A;  5CMD A;  1W6K A;  3OMC A;  5DM7 3;  1SXT A;  3P20 A;  4U67 3;  4A3J B;  3D4R A;  4A3D B;  1O80 A;  5C4Z A;  4MN3 A;  4ZKC B;  2E2H B;  1SYB A;  1X32 A;  4ABN A;  4RGT A;  5TSS A;  4KMU C;  4UAI A;  5KIX A;  1K8M A;  1XX8 A;  1SSO A;  1AFP A;  2WV6 D;  2HUG A;  3L7Z C;  3TME A;  4G4K A;  5EQ0 A;  1A3V A;  3IFD A;  3URY A;  2KUM A;  4ZKB B;  3T56 B;  4MHE A;  3K5M A;  4ZUJ A;  1UNS A;  2A69 C;  3QOJ A;  2F3V A;  4FP5 D;  4KJN A;  1SYD A;  2XNA C;  3K7A B;  3MVV A;  5J1Z A;  4KY5 A;  3VA5 A;  3WOE A;  1ZKO A;  2AQ1 B;  1DZ1 A;  2E2J B;  4FNF A;  1I4P A;  5CBA E;  3GTO B;  2F0E A;  1RCV D;  3HOZ B;  4DN4 M;  4U68 A;  1TII D;  5I9O A;  2WAC A;  1D5Z C;  3UI2 A;  5D65 A;  2KJX A;  4ZRZ A;  2SEB D;  4CHT B;  3E0J A;  4K8J A;  1ZEQ X;  4ZLT F;  1L0Y B;  2BCO A;  1HA6 A;  3RD4 A;  2IL8 A;  1GJX A;  3GP7 A;  3HKZ B;  3U9S A;  3R93 A;  2K6A A;  2SDF A;  1I4Q A;  1TS2 A;  4O42 A;  1EQT A;  3TZD A;  3PO2 B;  2NVX B;  2E2I B;  2F0W A;  4K6L A;  5JJZ A;  2KOL A;  1EIG A;  2ID0 A;  3EJI A;  1A2U A;  2EYJ A;  2B2Y C;  3A7L A;  2JXM B;  3M4Y A;  1VF7 A;  1JQY D;  3V2T A;  1Y1W B;  4C56 C;  3A8J E;  2NYZ D;  3TP6 A;  2F0L A;  5C44 B;  4R9W A;  1U9R A;  1E2Z A;  1G2T A;  3TN2 A;  5C6A A;  4H44 C;  3NTK A;  2K01 A;  1CHQ D;  1LO5 D;  4CKB A;  3TP7 A;  1OO9 B;  3S1M B;  1GHK A;  2EJF C;  5T1G A;  4P2C B;  2H1E A;  1CT1 D;  1EY4 A;  4PQX A;  5IGF A;  2KQ3 A;  3OW7 A;  5E4W C;  4K14 A;  5COY A;  3K59 A;  1E2W A;  1EYC A;  1T5E A;  4K5W A;  1H9S A;  3MC0 B;  2O4X A;  2L11 A;  5JEA J;  2AUJ D;  1S5F D;  2JYO A;  1Y69 U;  1FD7 D;  2QF7 A;  4JBW A;  1KNA A;  2KA7 A;  1EY5 A;  5EPK A;  3GO5 A;  1PLF A;  2IPK D;  1GUG A;  3K0Y A;  5HGT A;  1D5X C;  1KAB A;  1SFO B;  3S15 B;  5C0X G;  3MTS A;  2R6G A;  2IX3 A;  3GTQ B;  3J7A F;  4K2K A;  2A73 B;  1ENA A;  2A6H C;  1D2B A;  1OXS C;  2PCF B;  4XQN A;  3HG9 A;  1EYD A;  3I72 A;  4QUF A;  3I73 A;  2WKC A;  2F0P A;  5CV9 A;  4CJ1 B;  3K58 A;  5E1F A;  5I9P A;  3K5N A;  3ITP A;  2EY2 A;  2EPB A;  4F8M A;  2K1B A;  2NVT B;  3H94 A;  5LL6 S;  2DNC A;  2NB0 A;  1GUT A;  1TWC B;  3D4W A;  1YNN C;  2D9U A;  1ILP A;  1BCP C;  2F3W A;  4G57 A;  4FYD A;  1H9M A;  2DN8 A;  5J22 A;  5M5Y B;  2D2C C;  5AFW A;  3GV6 A;  2XIW A;  3BYT B;  2FJ2 A;  1GUS A;  5E3F A;  2ZXR A;  1D6E C;  1STA A;  2EYP A;  3U9O A;  2RBM A;  2WB1 B;  1JOR A;  1QB5 D;  3N52 A;  1PTO D;  2G9H D;  1JE4 A;  4PV1 C;  2XVS A;  2F0F A;  1CFM A;  1XWE A;  5FO8 B;  1PRT C;  3OOC A;  1TWA B;  2A68 C;  2VXW A;  5KNC A;  3GTP B;  1SMY C;  4DXG A;  3MAQ A;  5COR A;  1SNP A;  2R3Z A;  1G6Z A;  2X6L A;  4M8A A;  1FGB D;  1STG A;  3T16 A;  2VUM B;  2O5I C;  2M2L A;  3GD7 A;  2MGS A;  2EXZ A;  1STN A;  4C3H B;  1UUP A;  5EKL A;  4G7H C;  3A56 A;  4DAY A;  1BDO A;  3LWE A;  3DM1 A;  2RSO A;  3NTI A;  5C4X B;  1QG7 A;  3HS0 C;  1WTW A;  5NUC A;  2HCI A;  4HMJ A;  3CU7 A;  1Y8P B;  4N9T A;  3EQL C;  3DWP A;  2BDO A;  2JA5 B;  1DYQ A;  2XN9 C;  3X3N A;  3MWY W;  3GTM B;  3TP5 A;  2V4D A;  1PFB A;  1RTN A;  3VR6 A;  5CYU A;  2O2L D;  3TSS A;  5IT9 E;  5C3W A;  5CV8 A;  2IJ0 A;  1OXV A;  4H0L C;  4BA2 I;  2F0I A;  1KDC A;  5JOB A;  2Z1C A;  4KD4 A;  2EYO A;  3R2T A;  3V05 A;  4A93 B;  1SDF A;  2L1B A;  3KK7 A;  1JR0 D;  1H9S B;  3IKJ A;  4EVO A;  3MFG A;  3Q6S A;  3SDZ A;  2J0T D;  1XXG A;  1HA5 A;  1V8Q A;  1D1I A;  4PMC A;  3I90 A;  3A7A B;  3PUZ A;  2B2W C;  1NR2 A;  1B9M A;  2EYF A;  5LL6 X;  5BN3 A;  2EY5 A;  1B2T A;  2KVM A;  3BYY B;  4L6T B;  4IUT A;  4J6H A;  3ERO A;  3OWE B;  1AP0 A;  4IFD H;  2JA7 B;  4RCN A;  4IZ8 A;  5BN5 A;  4TRD A;  3HOW B;  4X3U A;  1HFG A;  5KYI A;  3HOX B;  1I4G A;  1OXT A;  1VMP A;  1TR5 A;  2FHT A;  4RGM A;  3GTK B;  2NN6 I;  4CJ0 B;  2HCC A;  3OIP A;  3L3O C;  2K28 A;  3P75 A;  2A6E C;  1TWF B;  4BY1 B;  2K5W A;  2Q8T A;  4C3J B;  1EU3 A;  1JWU D;  2EJM A;  1TY2 A;  3EVQ A;  3DEP A;  2BDN A;  3SK6 A;  4PNY A;  2F0M A;  4ID6 A;  4RHR A;  1EIH A;  1O7L A;  3HOV B;  1LTT D;  4O1N A;  2XSC A;  4CKE A;  3FKI B;  1V1P B;  2F03 A;  4IQZ A;  3MEH A;  4IFD J;  1BCP D;  4FXD A;  5A2Q L;  3GQB A;  1H9K A;  5C0X H;  5G3L D;  1LLR D;  3Q24 A;  3MA2 B;  1B50 A;  3KLS A;  2LS0 1;  4RKB A;  1ENC A;  2WII B;  3ZYY X;  3HOU B;  1VCI A;  4RH6 A;  3DEO A;  2PW7 A;  1TWH B;  4XYO A;  1HHV A;  5M5W B;  2OT2 A;  4AYB B;  5ELC A;  2I46 A;  3RZD B;  1YNJ C;  5M5X B;  4DNT B;  3AMU A;  2L9H A;  4N9P A;  4KHV A;  3KLR A;  1ONL A;  2EZV A;  2NWG A;  2NN6 H;  3CHB D;  3MXP A;  1E2V A;  2TSS A;  3JAM E;  4HSV A;  4ZAI A;  4EQN A;  4BBS B;  4BBR B;  1II3 A;  2A5H A;  2F0S A;  1FNW A;  1HRJ A;  2A68 D;  3FPU B;  1SE4 A;  5ISR A;  1EEI D;  1QNU A;  3K5L A;  4C3J G;  1STE A;  4KKT A;  4TKO B;  3A55 A;  1KLU D;  1V43 A;  4TQU S;  1QIL A;  1ICW A;  1MD2 D;  4Q5V A;  4E6I A;  4RFB A;  3MXN A;  4DXF A;  2HDM A;  1OXX K;  1I6V C;  2NZ1 D;  1EY7 A;  1F9R A;  1R4P B;  5BN4 A;  3O13 A;  3TZU A;  1EYA A;  1GHJ A;  4OO1 I;  3IFT A;  2AUK A;  1I3Q B;  2PYK A;  1O7Y A;  1EFI D;  1F77 A;  4C3I G;  4ZQ3 A;  1WCM B;  5M3M B;  4FO2 A;  1DD2 A;  1MSH A;  2HQE A;  4BS9 A;  1JOO A;  1XTC D;  5D14 A;  5J39 A;  2SNS A;  1STH A;  2DY7 A;  4HTH A;  5C3E B;  1TY0 A;  1SNQ A;  5DAU A;  1CA6 A;  4KHZ A;  1F2Y A;  5DM6 3;  2DY8 A;  4R8I A;  2QEJ C;  4KY6 A;  1JWM D;  4RGO S;  4NP5 A;  5FK9 C;  2GA4 B;  1IYV A;  1RKN A;  2RSN A;  2Z8L A;  4KKS A;  1Q3L A;  2NUC A;  1FNV A;  4PMW A;  1U4R A;  4Q0F A;  2Z4H A;  2RKS A;  1MGS A;  3QOL A;  5DEH A;  2B8F A;  1QOH A;  2WIN B;  1LT6 D;  5CBE E;  4KK7 A;  1SEB D;  3BVG A;  4NDX A;  4C1N I;  5K36 H;  2B2Y A;  1Z47 A;  4A3I B;  1I4R A;  1ESF A;  1WTR A;  2NN6 G;  4KN4 C;  2EY6 A;  2VB3 X;  5C0X J;  1A2T A;  3N6R A;  4OGQ C;  2WKD A;  3ND8 A;  2L55 A;  5I2X A;  3R8B A;  1SYF A;  2JE6 I;  5EBC A;  4RHS A;  2TMP A;  4QIW B;  3NP8 A;  1EY9 A;  2PO4 A;  3PIP 3;  4DFA A;  1TS4 A;  2MP1 A;  3BVM A;  4K5V A;  2LMC B;  1CQV A;  1I50 B;  3X3M A;  2L12 A;  3D3R A;  3SR1 A;  4OIJ A;  1F9Q A;  4R8N A;  1UEA B;  5IGC A;  2B63 B;  3DUZ A;  3C1F A;  5KRU A;  3BZD B;  3LNN A;  1NSN S;  2A6E D;  1Q1E A;  1IHZ A;  3QO2 A;  3GTG B;  3RUZ A;  3D6W A;  2R7Z B;  3C2P A;  1CM9 A;  4DGZ A;  3WDN A;  2VNU D;  3J7Y W;  3CRK C;  1BO0 A;  4OHJ A;  3NE5 B;  4TSS A;  4FVM A;  5EPL A;  1G91 A;  3R3O A;  3S2H B;  1F2M A;  2BE5 C;  4BY7 B;  4I65 A;  4J1M A;  2B2U A;  5FKA C;  1C4Q A;  2HDL A;  3LWU A;  1LAB A;  2JA6 B;  4A3M B;  1AZP A;  3W2D A;  2K03 A;  2ENB A;  2ICE C;  4K6D A;  3OWF A;  3PUX A;  3TDQ A;  1PZI D;  4K8I A;  3Q22 A;  2RDF A;  4FXG C;  4IUR A;  4EQP A;  1EZ8 A;  2EYL A;  2PZT A;  2EDG A;  3MZ5 A;  4KD3 A;  5IIF A;  1HQR D;  2B2U C;  3PMF A;  1EWH A;  1H9R A;  3NHH A;  4A3E B;  4XDX A;  4UDU C;  2F0U A;  1Y8O B;  4ZYS A;  1CA5 A;  1LV9 A;  2BA1 A;  2ZXO A;  1Z7T A;  4KV6 A;  2K04 A;  4CJ2 C;  3I8Z A;  3MXU A;  5K5P A;  4XT1 B;  1A3T A;  3P1H A;  1TWG B;  3HOY B;  5JVH 3;  3K5O A;  2KED A;  5M3F B;  4B9W A;  1ML0 D;  1BBX C;  1GUW A;  2ZT9 C;  3S9W A;  3A8K E;  5FO9 B;  2R61 A;  4OO1 G;  3WOF A;  1AZQ A;  5D3D A;  5IGB A;  5CV4 A;  2IX1 A;  5FLX L;  1GUN A;  4FF2 A;  5CV6 A;  3J81 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...