1WTQA

Hyperthermophile chromosomal protein sac7d single mutant m29f in complex with dna gtaattac
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
VKVKFKYKGEEKEVDTSKIKKVWRVGKFVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords 5'-D(*GP*TP*AP*AP*TP*TP*AP*C)-3'
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wtqA00
2Q8RE 3QO2A 3R93A 1QE6A 4IUTA 1DOKA 3IFDA 2HDLA 1U4MA 2BDNA 3I3CA 1PLFA 1SDFA 5EPKA 2HDMA 5T1IA 3DEOA 1DOMA 2DY7A 2KECA 1PFNA 1RTNA 1XYIA 2NZ1D 1EQTA 1AZPA 5D65A 2FMMA 2EOTA 4UAIA 4OIKA 2B2YA 1HHVA 1MGSA 5DNFA 1C8CA 3ONAB 2K1BA 2NYZD 1F2LA 4CJ0B 2NWGA 2RVLA 4IUUA 3TZDA 4IUVA 4X3SA 4NW2A 1RHPA 4QUFA 1EOTA 2KUMA 3Q6SA 1O7YA 2MGSA 2N55A 5CMDA 5EQ0A 1F9QA 1IL8A 1B3AA 1E0BA 2M2LA 1G91A 5T1GA 4ZLTF 4R8IA 4CJ2C 1ILPA 3GV6A 1X3QA 2B2TC 2L1BA 2L12A 3P7JA 1HRJA 2L11A 2B2TA 2K28A 1KNAA 1U4LA 1WTRA 1BBXC 1MSGA 2K05A 4CJ1B 1SAPA 4IURA 4MN3A 1B50A 1J9OA 5D14A 3D6WA 4HAEA 1TVXA 1X3PA 2B2WC 1NAPA 4RA8A 1F9PA 1WTQA 1CA5A 2MP1A 2B2UC 5CBAE 5JJZA 1B4OA 1RJTA 4DN4M 3N52A 1MSHA 2K01A 5EPLA 1QG7A 4IUQA 4XT1B 4LMQD 4RWSC 5EJWA 1RTOA 1ILQA 5E4WC 4MHEA 4X3TA 1WD0A 5E4XA 1ML0D 1NR4A 3GV3A 2SDFA 2CVRA 4XT3B 5COYA 5CORA 1O80A 1BO0A 1ICWA 4O42A 4ZKCB 1WTXA 1NCVA 1VMCA 1LV9A 2B2VC 4X3KA 1XX8A 2Q8TA 1A15A 2FFKB 4XDXA 1M8AA 1WD1A 1G2SA 1BF4A 2X6GA 1X32A 1EIHA 1PFMA 1MI2A 2MPMA 1ZXTA 1KNEA 1PFBA 2X6LA 4OIJA 1NR2A 1O7ZA 3KBXA 2XIWA 3FDTA 1F9RA 1JE4A 2X69A 1U4RA 2B2WA 3DM1A 4IUPA 1DZ1A 1S4ZA 3I90A 2IL8A 2B2UA 2VXWA 4R9WA 1RODA 1WTOA 1B53A 1DONA 3MTSA 1VMPA 1HUNA 1WTWA 2HUGA 2DY8A 2KVMA 2KEDA 1WVLA 2JP1A 2KEEA 2RA4A 3I8ZA 2JYOA 1AZQA 1PDQA 2KOLA 4HCSA 5CBEE 1AP0A 2HCIA 4RAUC 1DOLA 2RSNA 1U4PA 4ZAIA 1EIGA 1ESRA 2K04A 3FPUB 3DEPA 2B2VA 3MWYW 5EKIA 1EL0A 2HCCA 1G2TA 1QNKA 2EE1A 2L9HA 2R3ZA 2D9UA 2J7ZA 1JICA 4ZKBB 2L4NA 3F2UA 1BNZA 1SSOA 1IKLA 3G7LA 4QUCA 1HFNA 2FINB 2N88A 1HFGA 1HUMA 2B2YC 4HSVA 5EPJA 3TN2A 3SVMA 3I91A 3UI2A 1CM9A 2EPBA 1B2TA 3LWEA 1J8IA 3HP3A 1HA6A 1WTPA 1CA6A 1GUWA 4X3UA 4U68A 2RSOA 3H91A 4HEDA 1IKMA 3IL8A 2MJ8A 2H1EA 3KUPA 1F9SA 1Q3LA 2K03A 4ZK9B 1WTVA 5AFWA 1G6ZA 2FJ2A 2FHTA
chains in the Genus database with same CATH superfamily
3S14H 3L3OC 4H02A 4HJ7A 2KECA 1OXVA 3J81c 3CCSA 2K7VA 5I2YA 3GTGH 3AEVA 3LNNA 4FDBA 3S1MB 4CJ0B 2PYKA 4DK0A 3NBHA 5CV9A 3JAME 2EIFA 2PW5A 3QG1A 4X3SA 2NVQB 2KUMA 5CMDA 1SE8A 3VYUA 3AMUA 3GTLH 1B3AA 4JI0Q 2A19A 3T51B 5FOBB 2UUAQ 1EWIA 1PTOC 1HTPA 3PO2G 3MHBA 3ICEA 3EROA 4QIWE 1LYLA 5LMNW 2A68D 2WINB 1E2WA 1CKMA 4GKKL 2B2UC 4G7ZC 1QG7A 1PZID 2F03A 1W2BA 1N32Q 4LF5L 1RKNA 5LMNL 2K5HA 4DAMA 3KDFA 3QR8A 4YWMA 4GZYC 5CORA 3T1YL 3SDZA 5G3LF 2DN8A 4POGA 4KK7A 1NCVA 2VY3A 2ZXPA 3K80C 2WIIB 1F2YA 3D0FA 3I2ZA 1TS3A 3U4VA 1G2SA 3SXHA 3WDNA 1ZXTA 1OTCA 2YU9H 3PUVA 1SNPA 2AUJD 3A8JE 3JAML 4PMCA 4R8NA 1LTID 1VQLA 3HOWH 4A3BB 3VA5A 4IJHA 2B3GA 2O2LD 2B8GA 1IBLL 2L5TA 2SNMA 2WB1G 3CRKC 4R4CA 4NB3A 5IP9G 3E0JA 1EWCA 2ZXOA 2K5VA 3BZKA 3I4NB 4GS3A 3DLLA 2HD3A 4WRDA 1WI5A 2LSSA 4IPCA 5JJKA 4UDUC 1Z47A 3HOYB 2L15A 4DR5L 5JOBA 2AWOA 3H0GH 3OW2A 3GTQH 1E1OA 1Y8NB 2F0IA 1LTRD 5IY0A 4X3UA 4FF4A 3H91A 3A74A 1IKMA 2CQAA 3BZDB 1F9SA 1SROA 1NMFA 2FHTA 1Q1EA 1QZGA 1SDFA 4QCLA 1Y1VG 4J6HA 2ZTEA 4JBWA 3EQLC 3WOEA 5KNBA 4RKLA 2RCFA 1R4QB 3UDIA 4HCEA 4A3KG 1Y14B 4CGYB 2NYZD 1Q46A 2BE5D 2L55A 3SEBA 3D8GA 3VR3A 1EYDA 1BQQT 2VS1A 2IX0A 4ODGA 4TQUS 4KHPQ 3STBC 4QY7A 1BDOA 4TSSA 1PH9A 1BBXC 4G4KA 2QA4A 3ZYYX 1AN8A 3S15B 1JQYD 2R93H 1KHIA 2KHIA 4IFDI 3K8AA 3NTIA 3VR6A 2JA8B 1Y1WG 4O0AA 3NXWA 5IYCG 3CCLA 1X3FA 5CYUA 4GOPA 5COYA 5JVH3 2K5DA 1R9TB 3VR5A 4JI5Q 3FKIH 3LWUA 4IPGA 1A15A 3UDFA 5FJ8H 1GM5A 1HR0W 5C3EG 2AHOB 3A54A 4KN4C 4DV2Q 4ILWA 3J81j 3HKSA 2VUMH 2JA7G 1ZEQX 1I94Q 3E6ZX 5D3IB 2LMCB 3CF5A 4L5QA 1HR0L 3K5LA 3M4QA 2IPKD 1VQ5A 2EYLA 1HUNA 1JOQA 1LTTD 4JI2L 3SK4A 1XMOQ 3V96A 1HZCA 1V1PA 1U0LA 2F0VA 2PMZE 4X6AH 1UE7A 3Q8DA 4B3MQ 4NXMQ 2D9UA 4QIWB 5LL6S 3F2CA 3SK6A 1HFNA 3TN2A 5EPJA 3I91A 4A3DB 2UUBL 2O5IC 2F3VA 2F0PA 2RSOA 3MXNA 1HZ9A 4LF7Q 1OO9B 2A1AA 2WKCA 2Q2IA 4K2LA 4ZK9B 2KENA 2MUYA 3K57A 4A93H 1LLRD 3MC0B 3GTGB 2CKZB 1ENFA 3OIQA 3HOZH 2Z6BA 1PH4A 4DR4L 2F0FA 1CQVA 1C48A 2RDHA 3GTOH 1LUZA 2E74C 2F4VL 2OQ0A 2JA6G 1STNA 3GTLB 4DK3C 4LF8L 1NY4A 1CT1D 1SR3A 2B2YA 5DNFA 4MTKA 4IUUA 1M1KC 2A6ED 3DXJC 1VQKA 2PCFB 4CDCC 3A5UA 3P20A 3DWAA 4DPGA 5LL6X 2L11A 1SLJA 4LFAL 3NQTA 4GN3B 4DV6L 1WTHA 4IO9A 1KQSA 5IP7H 1CSPA 3OSOA 5GADC 4LJZC 3IRBA 2VQFQ 2BCOA 1E2VA 2JEBI 4OXPA 4PQXA 5C6AA 4K0KL 2BA0A 4I7ZC 2ZM6L 3URYA 4A75A 4C3IH 2RHSB 3U9SA 2YU9B 1BO0A 5TSSA 4NPSA 4ZKCB 3J81i 2A74C 3HOWB 1YZ6A 4XDXA 1RDPD 2JK8A 3NK9A 3A0JA 2UXDL 2OXPA 1AH9A 4XQQA 4L5TA 2B2UA 4QJFA 4YCWA 2Y0SE 1J5EQ 2WAQG 3H0GB 5JAVA 2HCIA 3GTQB 1KXLA 3RD4A 1U4PA 2WFWA 3M85A 2NVTH 4KY7A 2R3ZA 4ZKBB 4LFBL 1VQHA 3NELA 4KJOA 4DUYQ 1SFOH 4JI1Q 1A3VA 1HFGA 1U9RA 3CMEA 4Y52H 3TREA 3ULLA 3M7NA 3A8KE 4XQNA 1S5ED 4X62L 1PH8A 1MJCA 3X3MA 1Q1BA 1BBUA 3TMEA 3G71A 4LUZA 2G5DA 4NP5A 4DNIA 4DR6Q 4KV6A 3NENA 4RCNA 1TU2B 2Q8RE 4C3JH 1EIFA 3TP8A 4PMWA 1K3BC 4DAPA 3R2TA 4YWLA 5JEAH 3FEWX 4MIUA 1EY5A 4KKTA 5F2DA 1XTCD 2KCTA 4UAIA 3P1HA 1MGSA 1D5MC 2NWGA 3AFPA 5BN3A 2R93B 1EYAA 1N36Q 5I2XA 2BOSA 4L8JA 4GKJQ 2RDGA 3GV6A 4FXDA 4M1UB 2L1BA 2PMZB 3S1RH 3VR4A 5BR8Q 2GVAA 1IYJB 2HQEA 4OHJA 1QWYA 2B63H 1E2ZA 2EQSA 4UP9A 4K6LA 5FO8B 1TVXA 2PQEA 1V43A 4ID6A 1RJTA 1YBYA 2JN4A 3I4MG 1UEAB 3FKIB 1AE3A 4A76A 3BVGA 3HG9A 1N33Q 1SNMA 3AU7A 2F0LA 2SDFA 4MTNA 2E2IH 2F1MA 4WFN3 5IYBH 2VUMB 4TRDA 1RCVD 1K3RA 4IQZA 4O42A 3PSIA 5EBCA 3AB9A 4PMBA 3AQQA 3K7AH 5K36G 1D5XC 1IW7D 3ULPA 2PPBC 3D6CA 1LTLA 1SMXA 3ND8A 5NUCA 1F2MA 2NVQH 3RMHA 1N34Q 1Z7TA 3IAYA 4XTCS 1WCMG 4JI3L 1HQMC 4DA2A 3C1FA 5IWAQ 5C4HA 4RHSA 1VMPA 2KVMA 4XYQA 4IPHA 4U673 1BCPD 3FVQA 1SYGA 5CR3A 4BY1G 4AQYQ 1X9NA 4A3JG 2RSNA 1VQ7A 2VQEQ 3S16H 5EKIA 3S1QH 1C7YA 4R4TA 4JI6L 4X64Q 1KAAA 1SSOA 3G7LA 1ZYRD 4A93B 2PZWA 1A8VA 4DAVA 3VYRA 4B3TQ 2VZAA 2AUKA 3TP6A 1WTPA 4YY3L 4NXNQ 1EOVA 1LM0A 1KRTA 3L9AX 3GTOB 1NTGA 1O7LA 1K8GA 2JQOA 3X3NA 4OX9Q 3HEJA 1BVSA 1SMYD 2I5LX 4HN7A 2PO4A 3A5ZB 4EGVA 5IIFA 4QQBX 4PNYA 1GUOA 5IGFA 1XJVA 4JBKA 1VQMA 2HIVA 1IL2A 1CI3M 4LF9L 1STYA 5HGQA 4GLAC 2EOTA 4F87A 2PZUA 4O2DA 2UUCL 3OMGA 4HMIA 4RGTA 2JE6I 1GXDC 1H9KA 1RHPA 2QKIC 3RN2A 2Y0SB 3IKJA 1GHKA 4R8IA 4BBSH 4J8QA 1K0RA 2OT2A 3LGJA 2K28A 4A3GG 1SYEA 2F0UA 4CJ1B 1I3QB 4MNOA 5D14A 3EA6A 4YWKA 1NAPA 2LFNA 2MP1A 4N8FA 1KABA 3V2TA 1VQ9A 4B3SL 2Z4HA 2R92H 5FO9B 2KQ3A 5I6WA 1GKHA 3BDOA 4DR7Q 1BCPB 1SJHD 4DFAA 1B8AA 5DM63 2BH8A 4B3RQ 1KLUD 4ME5A 1CZWA 4L63B 3PF5A 3HOXH 1L0XB 4X3KA 1H95A 1GO3E 1SNCA 2IWHA 1WD1A 1SYFA 3HFZB 5A2QL 3OOCA 2X6LA 1KNEA 3HGBA 2MNAA 4UY8C 2DUDA 2JJQA 5HY6A 1JJ2A 4IFDJ 3FPPA 1GHJA 1Q81C 2Z9HA 3OMCA 3CHBD 1DM0B 2NVTB 5J3BA 4QF4A 4ZYSA 4DK6C 4JVZA 5AJ3L 4A3BG 3S15H 4K5XA 1SFOB 3TRZA 4BBRG 1XMQL 4HCSA 1PRTD 3EBEA 1EIGA 2JA8H 3MWYW 4ZUJA 4DV5L 1UUPA 1G2TA 3I4NG 2L9HA 4DV0Q 2MQHA 1JICA 5ELOA 3ND9A 1P8LA 1II3A 1G6PA 2KJXA 4C3JB 3MXGA 4YHHL 3HOYG 3SHLA 3T56B 2K75A 1S5BD 1HNXL 1HXYD 1VCIA 2K52A 3F2BA 4GN5A 1SYDA 1BR9A 3QWNA 2NN6I 3KOJA 1I4GA 4JI8Q 1M4VA 1D6EC 1U4MA 1X55A 4FXGC 3J7AV 3I3CA 2AWNA 4P73A 4HJ8A 4GN4B 1DOMA 1N8RC 3NBIA 1S3OA 3NQIA 1EY6A 5GAHC 3PO2H 5C4XB 5CV8A 1XXGA 4IUNA 1EQTA 3TZUA 1KRSA 2FMMA 5C5LA 3H3VI 1VQGA 3S1RB 1UE6A 4QUFA 1P16A 4GNXC 2B63B 1IL8A 1LT6D 3PGZA 1BKBA 1PH6A 1FL0A 3NBHB 2IHEA 3VDYA 1EEID 1B44D 4YCUA 2IX3A 2E2IB 1PV4A 3KF8A 1D2BA 1R4PB 2PI2A 2AQ1B 4HJAA 1EQQA 4B9XA 2EYFA 3K7AB 1ILQA 1JWSD 3T53B 3J7YW 2N3SA 4RMFA 4X65L 1HNZQ 2NB0A 2XNAC 4A3MH 4DV1Q 1PRTB 1ZKOA 4IPDA 3NPPA 2K5WA 3D3RA 4EQPA 1CK1A 1OXUA 1VMCA 1LV9A 2N8NA 2E8GA 1D1IA 3BG3A 1I50H 5ELDA 1E3PA 3KDFB 2AQ2B 1PH2A 4KY5A 4A3FG 1STEA 2ATWA 1KAWA 2EJFC 5HURA 1NBWA 3J80c 3FHWA 3DM1A 1DZ1A 3S16B 1B53A 4A3CH 3S1QB 2A69C 4IJLA 1D1KA 2HUGA 2VNUD 2KEDA 1FYCA 2QEXA 3OPOA 2RA4A 4HSPA 5IGEA 2KOLA 4QGUA 4HJ9A 1AP0A 1PTOH 1L1OC 3S9WA 1KTKA 1ASZA 2KCMA 1QNKA 2EE1A 1IYVA 2E2HB 4KD4A 4LF6Q 3IFTA 3TS0A 5IOCA 4ALPA 1YHAA 1J5EL 2F0NA 5FLXc 4A3DG 4EQNA 3M4YA 3QIAA 2MJ8A 2IHFA 1Q3LA 3CXCA 5AFWA 1F2ZA 1EWHA 2Z8LA 3HKZE 3QO2A 5IE8A 3J81E 3IFDA 2IY5B 2O5JC 4JK1C 4JI1L 3UE1A 1L2FA 2E75C 1SE4A 3A55A 3G6JB 4A4IA 1KIXA 2UXCL 4JC0A 4DNTB 4JW0A 4BBSB 1O78A 3CCUA 3W5OA 1EQRA 3GTJH 2RKSA 4LAAA 3CCEA 1Y1WH 4P71A 2YTXA 1KDCA 3K7UC 5T1GA 1STAA 1XNRQ 3S17H 1X65A 2A6EC 3NEMA 3Q24A 2ICEC 2R92B 2PQAA 5LHY1 1B3QA 2WP8J 1EZ8A 3ULJA 1F9PA 3DWQA 1YEZA 2EY1A 1NMGA 4O1NA 1HNWL 4KHVA 4XT1B 3HOXB 4JI7L 1PH1A 2JA7H 1WD0A 3CC7A 1NR4A 4GKJL 1VQEA 4LW1A 1KL9A 3J81L 1O80A 4N9TA 5IT9c 3C3LA 5LMUQ 4DUZL 1YNXA 2Q8TA 5KNDA 3I70A 4DV3L 4GOPB 1JE5A 3M3YH 1HH2P 5IGBA 5K5PA 1ENCA 3D4RA 4C3HG 4OELB 1SBBB 3PMFA 3T1HL 1AW7A 1VQCA 2CH4A 4K5WA 2IL8A 2VXWA 3Q23A 5I4DA 2SNSA 2KBNA 2JP1A 2RDFA 2E5LQ 2KEEA 4CHTB 1WJJA 1PDQA 2Q2UA 1G51A 1CFMA 1YJ9A 2NVYB 4JI4Q 2OTLA 4KD3A 3MA2B 1KLGD 2HCCA 3H0GG 1OXTA 3MXUA 3MXPA 5BN5A 3BYTB 3A7LA 1KC8C 2L4NA 4QUCA 1PVOA 5KEEA 1V1PB 2N88A 2JA9A 4N9PA 1VQOA 4L5RC 2R7ZH 4DR3Q 2UXBQ 1J8IA 2JA5G 4BY7H 1PTOD 2LKVA 3S2DH 3VYSA 3OTOL 4X66L 2H1EA 3PO2B 2F0HA 3F8TA 4K8IA 4DV7Q 4HJ5A 4A3IH 1XNQQ 1QE6A 4LNQA 4DV4L 2DJGC 1DOKA 3MXNB 1NJIC 2F4IA 1QJOA 1HTLD 5T1IA 3DEOA 2UU9L 4CDDC 4KI0A 4DF7A 1SJED 2YTVA 1PFNA 5EKLA 5EGTA 1FVIA 1IZ6A 4OEMB 1QZHA 2AQ3B 5IYDH 3TEHB 1F2LA 2RVLA 3B6YA 4IUVA 3CMAA 4F8MA 1YJNA 1O7YA 1S5DD 3C2PA 1G91A 3I7FA 4UP8A 2IT1A 3OW7A 5KNCA 1GOZA 5M9OA 3VYTA 4JOIC 4JV5Q 1B70B 4IURA 2A73B 4HAEA 4DR2Q 4A3MB 4CKCA 2O4XA 3N52A 4IFDG 1I50B 4LF4Q 2ZJQA 3UDGA 1J6QA 3L2PA 1K83H 4RGNA 5M3FH 1PH5A 1I4RA 1FR3A 4GNXA 3DM3A 4CKBA 4KN7C 3HKZB 5FJ8G 3PO3G 1WTXA 2K6AA 3E9IA 4H13C 2HHHQ 2VUMG 2EXZA 1DXMA 4JBMA 1QVCA 1TWFB 3TBIB 1STGA 2IJ0A 2DNCA 1X6OA 1YJWA 3CCVA 1PTOB 4JYAL 4FF3A 3C46A 3N6RA 3DWPA 1I3QH 4KTAA 4OO1I 1EY0A 1YHBA 2N49A 3QJYA 4XQJA 1X3EA 3WOFA 2H4OA 2HT1A 4RG1A 2TMPA 4DAYA 4OO1H 2WV6D 1Y8PB 1VQNA 2C9OA 2J7ZA 3M4OH 4RKBA 1BNZA 1EY8A 4XXEA 4HSVA 4DR1L 2RF4A 2RCNA 3STBD 2NVXB 2WAQE 4U68A 5FO7B 4GKKQ 4C1NI 4HEDA 3GQBA 4H7BA 2G9DA 2XTIA 5KYLA 3HOZG 1BCPF 1U5KA 4LF5Q 1HZAA 5LMNQ 2JSOA 3U4ZA 4K5VA 3J80i 1IBKL 5CGKA 3T1YQ 4XYOA 1PLFA 5C44G 3GTJB 1L1OA 1Y1WB 1RTNA 1A2TA 1FGBD 1JMCA 2XWBB 3S17B 4RGOS 3RZDH 4OIKA 1TWAB 5IGDA 2K32A 1QB5D 4R1JA 1JT8A 2D62A 3JC66 1JC7A 1TS4A 1I6HB 1IBML 1E0BA 2M2LA 3P75A 2SEBD 1IBLQ 3RR5A 4LFCL 3J7ZC 3CD6A 3CU7A 1AE2A 1TY0A 2L12A 1GUTA 2Y0SG 1FJGQ 2JXMB 4JCVE 2JA7B 2ICIA 5IP7G 3OWEB 2PW7A 1Q12A 1K8OA 2MO1A 1ASYA 1WTQA 3MAQA 4C3IG 4DR5Q 3HOUG 1RTOA 3MVVA 3S1NH 1ML0D 3M3YB 1UNSA 1YNNC 2EYMA 3W3AA 1H9MA 5C4XH 2XGTA 3M9BA 1STHA 3J7AF 1ICWA 1VQ8A 3I56A 3MEFA 4AYBE 4B9WA 4R4QA 2PZTA 1FNVA 2A6HD 5KYIA 4QL5A 3K59A 2PNRC 1GUGA 2EYPA 1VQDA 1SYCA 1QOHA 3I90A 1HNZL 2M9VA 1EYCA 4R9WA 4DV1L 2F3IA 4JI0L 1QUQA 4C2MB 2NBFA 2UUAL 2IW3A 4BXXH 3KK7A 2R7ZB 2R61A 4ZAIA 4BY7B 3T16A 3S2DB 1EL0A 1T9HA 5FLMH 3R3OA 3PIOA 5EKKA 2E76C 2R7DA 1N32L 4A3IB 5L37A 1LTGD 1CKNA 2QILA 1SE2A 4C3JG 1WTVA 2PI2E 1PH7A 1G6ZA 4A3LH 5JEAG 1A0IA 1PRTF 1WOCA 1JJCB 1TS2A 1SN8A 3A7AB 2CW0C 3PQIA 3EVQA 4A3GH 4DGZA 1MD2D 2BDOA 1UE5A 4LWCA 2K5NA 2EZVA 3T4AC 4A3EG 1HR0Q 1EY9A 4KKUA 1HPCA 2E2HH 1BBWA 3GO5A 3HS0C 3KJOA 3PUYA 1DJRD 1PH3A 2K33A 4KHZA 3I72A 4CJ2C 2B63G 1X3QA 3S2HH 1Q86C 2L0CA 2B2TA 4JI2Q 2F0OA 4HMJA 1K83B 1QVFA 1E7ZA 3KBGA 5M3FB 1PZKD 2Z4IA 1CA5A 1B9MA 2ZTDA 3CCMA 1WFQA 4DN4M 4OWTB 2K01A 4DNRB 2WAQB 4RWSC 5KGUA 1O7IA 5E4WC 2UUBQ 3HOVH 1L0YB 4B08A 1EQVA 4NDXA 1EY7A 1EY4A 2B2VC 5CV7A 1XX8A 3M7GA 4RFBA 2VL6A 4GLVB 3LX0A 5C0XI 1EIHA 4JOIA 1MI2A 4DR4Q 1S40A 4FNFA 1CHPD 1UE1A 3MFYA 2F4VQ 4J1MA 5C0XH 3RUZA 1G8ZD 1EU3A 3Q22A 4LF8Q 2XRSD 1WTWA 5CV5A 3QOJA 4KHPL 4YIJA 1BUVT 2A68C 1A3TA 3M4OB 4G7HC 3HRZC 1PHJA 4IALA 3I4OA 3ZJYC 4R4OA 3K5OA 4EQOA 2K04A 1Q82C 4NMZA 5M5YB 1GVPA 2C35B 3GP7A 1WYDA 5I6YA 4FP5D 5D3DA 4LFAQ 1CUKA 2HIXA 4DV6Q 3K0XA 1S5FD 1HA6A 1Y8OB 1VQFA 5M5XH 5M5WH 2EJGC 5H1SE 4JI4L 3TP7A 4JI5L 5J1ZA 5M3MH 4JPBW 4PG3A 2OEOA 3KF6A 4OL7A 3K5MA 4K0KQ 2ZM6Q 4AYBB 1H9JA 4OONA 3RZDB 1S5CD 1UAPA 1K8AC 4DV2L 1UEBA 1BXTA 1Q7YC 4TKOB 3KLSX 1I94L 1CQFA 5JPNC 1W6KA 2YTYA 2Z1CA 1TXYA 3PF4A 4FO2A 4ME3A 1AZPA 5GAEC 5D65A 2NVYH 1E24A 4H44C 5ELFA 1LTAD 4KLKA 5IODA 1JORA 2UXDQ 1MKHA 4BBSG 4AH6A 1Q8IA 2EYHA 1VDZA 2WACA 1XMOL 4UPAA 1LT5D 1H9SA 5JVG3 1AFPA 3JAMc 4CDFC 4B3ML 3KLSA 4NXML 2B8FA 1DGSA 1V9PA 4E6IA 4JBJA 3S1NB 1B50A 4KJNA 4N8X1 1PMRA 1DD2A 1X3GA 3FRPB 2ENBA 5ELEA 4LFBQ 4LF7L 2RBMA 3TDQA 3G6EA 3GTMH 1QNUA 4X3TA 4DXGA 1QVGA 5DAUA 4C1NK 3U58A 3KF8B 3SK5A 1XPUA 3HOXG 3H3VC 4X62Q 2F0QA 4L6TB 4ZRZA 1Q8KA 2BE5C 2P5ZX 5E3FA 2NZHA 1S72A 1I4PA 1VQBA 4WJWA 4AIMA 3K5NA 2R7FA 3VA7A 3G48A 2Q2TA 3W2DA 2CH4W 1U4RA 2B39A 2FXQA 2DJFC 4JG2A 4RCOA 3SGIA 3MTSA 4QMGA 2LS01 2Z0SA 4KMUC 4OWXB 2JA8G 2RHQB 3KLRA 2EYJA 5BN4A 3E3XA 5CBEE 1IXRA 1ESRA 1YNJD 3M4PA 5IP9H 3OIPA 3NSWA 2I0QA 3AFQA 1VF7A 1L0WA 4ULLA 1XPRA 1RIPA 4FXKC 2K4KA 5KRUA 2VQFL 2V4DA 3NE5B 3SVMA 4I65A 2EPBA 4PV1C 3HP3A 3I4LA 1D5ZC 2CWPA 1CTMA 5IGCA 2C5CA 3KUPA 2K03A 4A3GB 1I5FA 1TIID 1TWFH 3NTHA 2NN6G 3DMUA 1YIJA 2HDLA 5J22A 3ERQA 2F0GA 3L7ZC 1I4QA 2DY7A 1XYIA 1AEXA 2F0TA 1K8MA 1Y1VH 1CKOA 4V190 1I4XA 2SOBA 3KJPA 1C8CA 3ONAB 2WB1E 2E2DC 3EIVA 4UHVA 3S2HB 4JI3Q 3O13A 3TZDA 1PTOF 3E9HA 2B29A 4BS9A 4A3KH 3BVMA 2MGSA 3ITPA 3E0EA 2ZXRA 1GUSA 1MIUA 1ILPA 5I9PA 2NVXH 1PYWD 3P7JA 1HRJA 4DUYL 5ELCA 4BWGB 3HOVB 2EY6A 2QF7A 5C4ZA 2B2WC 4RA8A 3U50C 4JI6Q 3KLWA 2PQAB 2QCPX 4C3HH 2Z6KA 3OWFA 4A3MG 2OF1A 4LMQD 4BBRB 1TKWB 3RNUA 4P72A 4DR6L 2J4XA 3H6MA 5CV6A 3TP5A 1FJGL 4YY3Q 2R6GA 5DM73 3CAMA 4Q5VA 3QB3A 3EJIA 5EAYA 5IYCH 4M8AA 2BA1A 5J39A 1HZBA 5JEAJ 3J80E 1E22A 1TWAH 5GAGC 1EZ6A 2ZJRA 2NTTA 3HKZG 2CQOA 2CFMA 1LO5D 1PFBA 3NTKA 1O7ZA 4FF2A 1I6HH 2XIWA 1D8LA 4A3CG 3U9OA 5C3EH 2EJMA 1TWHB 1S4ZA 3D4WA 2VB3X 4LF9Q 1RODA 1DONA 1N36L 2JA5H 1EFWA 1LABA 2EYOA 2ZJPA 4OGQC 4DK1A 2XVSA 2UUCQ 5BR8L 2Q8IB 4Y7NB 3OHXC 4S3SA 2I5MX 2NTSA 3G4SA 3PIO3 3DHQA 2B2VA 2KHJA 4K6DA 5M5XB 5M5WB 4RHRA 2TSSA 4POFA 1B7YB 3HOWG 5M3MB 5FLXE 1K28A 1LTBD 3UI2A 1N33L 1V1QA 1VQIA 4B3SQ 3IL8A 4ZUIA 4FYDA 4PZ6A 3J80L 4IOAA 3PIPA 2OQKA 3AYHB 3R93A 1FNWA 4IUTA 2XRQD 1N34L 3TS2A 3K58A 1TQOA 4IN3A 4C2MH 3QOLA 2NZ1D 1ICFB 4GLXA 5IWAL 2MFIA 3PUWA 1HJPA 2HQLA 2JA6H 1SNQA 2K1BA 1TWCH 1NUCA 4IFDH 1EOTA 3Q6SA 5C4JH 4AQYL 3RZOH 5G3LD 3WWVA 2VQEL 4DKAC 4A3FB 5AJ3Q 1NSNS 2B2TC 4X64L 5C3XA 3GTMB 3PO3H 1XMQQ 1U4LA 2I46A 2K05A 1K73C 5FLXL 1ENAA 1V1OA 1X56A 1PFSA 1I4HA 2A69D 3CRLC 3D6WA 5E1FA 2VW9A 2LXJA 3D4DA 1X3PA 2F52A 3BJUA 4K14A 4DV5Q 4B3TL 2ASBA 4NXNL 5JJZA 4R4IA 1VQ6A 5EPLA 4BA2I 4OX9L 5IT9E 1OXXK 4YHHQ 1HA5A 1IYUA 2CVRA 4H0LC 4C56C 1A3UA 1HNXQ 4ZCKA 3MFGA 2OTJA 2R93G 1BF4A 4GNXB 1PFMA 2LXKA 4HIDA 2X69A 4IUPA 3NWTA 3CC2A 1D7QA 3DUZA 3JAMi 2WB1B 2A6HC 4PZ7A 3S14B 4RH6A 1RF2D 1FGUA 3I55A 3BYYB 3FKIG 1KDAA 2K14A 4KY6A 2CWAA 1ONLA 3K6OA 1STBA 2ZTCA 3EFXD 1B9NA 1NE3A 2KA7A 3A56A 3FPUB 1JWMD 3GTKH 2R7ZG 2VB2X 4OWWB 4P2CB 5C0XJ 5C44H 4BY7G 1IKLA 2F0EA 5DLQE 4FVMA 1HUMA 4P74A 5IT9L 4DR7L 5I9OA 4DAYB 1B2TA 2J0TD 2G9HD 1IW7C 1Z9FA 5FK9C 4B3RL 3SE0A 4A3IG 3T13A 3BZCA 5C3WA 1JB3A 1Y1VB 4X65Q 4HIOA 3V05A 3R2IA 4G7OC 3VR2A 1BCPC 2MO0A 1PYBA 5IYDG 4A3KB 1SNOA 4IZ8A 3PV0A 1C9OA 1NNXA 5CV4A 2F0MA 1L1OB 1PYSB 3SR1A 3TSSA 2D0OA 3Q0AA 1V8QA 5M5YH 1W3SA 4WORA 4NW2A 4F7XA 4A93G 3GDEA 3HOUH 3NHHA 1ZYRC 5EQ0A 3R8BA 3H15A 3TQYA 4DV0L 1TR5A 1DYQA 4G57A 4C3HB 1KNAA 3RN5A 1MSGA 1LTSD 2E2JH 4MN3A 3RLOA 3MZ5A 1EUJA 2KHSA 1SMYC 2NUCA 4LUOA 3BU2A 5M3FG 3ER0A 2DGYA 2EDGA 2K5QA 3I4MH 1F77A 3GV3A 4JI8L 2EY2A 3SK8A 4HIKA 1W6JA 2AMCB 1C0AA 1VQJA 1A2UA 5C3EB 3FP9A 2K50A 1QCBD 2CCZA 4ZQ3A 2JA5B 3CPFA 4OIJA 5K36H 2A8VA 1JE4A 2RQXA 2B2WA 4APVA 4K2KA 1T5XD 5E7NA 3CKIB 2UXCQ 1WTOA 3PCOB 1WCMH 4J15A 1AZQA 4OO1G 3CQZH 4UP7A 2F0KA 3GTPH 1QUQB 5ELNA 1XWEA 3MEHA 4V0BA 4BY1H 4A3JH 1TWGH 1SXTA 4LK1C 2F0JA 1ESFA 1TY2A 1VS0A 1YVCA 1EU4A 2EY5A 3LWEA 1CSQA 1GUWA 1H9RA 1HNWQ 1EFID 4JI7Q 1A62A 1M90C 4A3EH 1CKNB 3RLFA 2JA6B 3K0YA 5EBDA 5ISRA 1YHQA 1CZGA 1PXUA 1TWCB 1CHQD 4AYBG 4FF1A 4DUZQ 5ELBA 5C5MA 5C4JB 3RZOB 3UDXA 4DV3Q 1PRTC 4EQ5A 2D0PA 3BVZA 3A8IE 1ET6A 3T1HQ 2F0SA 3PO3B 4TVAB 5JJIA 1LACA 1VQ4A 2CHBD 3H09A 4HIMA 3CCQA 1JB7A 2D2CC 1JWUD 2QDLA 4LUVA 1UWVA 1TS5A 1GJXA 3S1MH 4NKLA 1MJEA 4LF6L 4Z9CB 2I5HA 5FKAC 2WKDA 1DCZA 1ET9A 2DNEA 4KKSA 4HTHA 5CBAE 1B4OA 3S24A 5HGTA 2Z6KC 3F1ZA 4XIGS 2QEJC 1KDBA 5EJWA 5C4XG 2M00A 1RL2A 4MHEA 2YV5A 1Y69U 1SNDA 4XT3B 2LY7A 5GROA 4DU9A 4F88A 4CKEA 3OTOQ 1JJGA 4X66Q 1MBYA 3W1GA 2H5XA 3F2DA 2FFKB 2X6GA 1X32A 4DV4Q 1MHWC 3EN2A 3KBXA 3FDTA 2UU9Q 1A63A 1F9RA 3HOZB 2V1CC 3L0OA 3CPWA 4BXXG 1E1TA 1XNRL 5IYBG 3GTKB 4K8JA 1WVLA 1IHZA 1LT3D 1VQAA 4YCVA 1EIYB 5C44B 1Q90A 2QGQA 2GN5A 4RAUC 5FLMG 4A3BH 2A5HA 4CBVA 3PUXA 4BBRH 1VQPA 1C4QA 3NUCA 2FINB 5A2QE 1JOOA 2ID0A 5A35A 3I4NH 1YNJC 4Q0FA 4L5SA 2EXDA 1CA6A 4I7AA 1X54A 2I07B 4A3LG 2XN9C 3PIP3 1TT2A 3HOYH 5LMUL 3D31A 2AKWB 2ALYB 1B1ZA 5GQOA 1TWHH 1SRUA 1LT4D 2BDNA 1YI2A 2NZOA 2BH2A 5EPKA 2HDMA 4IOCA 1FNUA 1QILA 1Z6HA 1GD7A 4C3IB 3KF6B 3HOUB 1YNND 2JEAI 4QB4A 4ABNA 3NWSA 4DXFA 4Y7NH 1HHVA 4RGMA 2E5LL 4WJ3M 4GOPC 5IGGA 1JCKB 2E2JB 2KCNA 2F0DA 2GVBA 2N55A 1F9QA 4JYAQ 1FD7D 3CCJA 3C1EA 3UE0A 4ZLTF 3W1BA 2YYZA 1I6VC 2IX1A 1PZJD 3H94A 1WTRA 1H9SB 1SAPA 1HQRD 1JR0D 2XSCA 1J9OA 4P75A 4DR3L 3I4MB 2UXBL 3GD7A 3BS1A 1A6XA 2MHVA 3HOVG 1MSHA 3ERSX 4BA1I 4IUQA 1RD9D 3HZXA 4MZ9A 3NP8A 4DV7L 2N78A 5E4XA 4DR1Q 1XNQL 3CP0A 4HR7B 1XPOA 1SEBD 4EX5A 2QW7A 2EVBA 3K81C 1GUNA 1N9WA 2Q2HA 1XTDA 1M8AA 1WCMB 5KIXA 1IBKQ 4CDEC 2ES2A 2MPMA 5C0XG 1NR2A 3I73A 3KYHC 1K0SA 2R92G 3CQZB 1R9TH 3BDLA 1SE3A 4A3FH 5JJLA 3J7A5 3GTPB 2QDBA 1EYGA 2KCCA 2DY8A 3CW2C 3CC4A 3OYYA 4BY1B 4A3JB 1TWGB 1G291 2XWJB 3PUZA 2CW0D 3I8ZA 2JYOA 1VF5C 1OXSC 3E5SA 4JV5L 2D5DA 1JOKA 1DOLA 5DEHA 4WJ4A 1IBMQ 3KFUA 4DR2L 3RLNA 3DEPA 2ZT9C 2OCEA 4LFCQ 1PA6A 2NN6H 1K9MC 2FMCA 3F2UA 1KD1C 1SYBA 2F3WA 2PNHA 3CCRA 2B2YC 4LF4L 4A3EB 1T5EA 1CM9A 1YITA 4PZ8A 2F0WA 5M3MG 2OWOA 1BOSA 3FMCA 1EEFD 1HCZA 5JPMC 2GA4B 3H3VH 3BDCA 4EVOA 5CC4A 2HHHL 2FJ2A 4A3DH
chains in the Genus database with same CATH topology
3L3OC 2KECA 1OXVA 2K7VA 5I2YA 3LNNA 3S1MB 4CJ0B 2PYKA 4DK0A 3NBHA 5CV9A 3JAME 3QG1A 2PW5A 4X3SA 2NVQB 2KUMA 5CMDA 3VYUA 3AMUA 1B3AA 3T51B 5FOBB 1PTOC 1HTPA 3MHBA 3EROA 2A68D 2WINB 1E2WA 2B2UC 4G7ZC 1QG7A 1PZID 2F03A 1RKNA 4GZYC 5CORA 3SDZA 5G3LF 2DN8A 4KK7A 1NCVA 2ZXPA 2WIIB 1F2YA 1TS3A 1G2SA 3SXHA 3WDNA 1ZXTA 3PUVA 1SNPA 2AUJD 3A8JE 3JAML 4PMCA 4R8NA 1LTID 4A3BB 3VA5A 2O2LD 2B8GA 2L5TA 2SNMA 3CRKC 3E0JA 1EWCA 2ZXOA 3I4NB 4WRDA 4UDUC 1Z47A 3HOYB 5JOBA 2AWOA 2F0IA 1Y8NB 1LTRD 4X3UA 4FF4A 3H91A 1IKMA 2CQAA 3BZDB 1F9SA 2FHTA 1Q1EA 1SDFA 4QCLA 4J6HA 4JBWA 3EQLC 3WOEA 5KNBA 4RKLA 1R4QB 4HCEA 4CGYB 2NYZD 2BE5D 2L55A 3SEBA 3D8GA 3VR3A 1EYDA 1BQQT 2IX0A 4ODGA 4TQUS 1BDOA 4TSSA 1BBXC 4G4KA 3ZYYX 1AN8A 3S15B 1JQYD 4IFDI 3NTIA 3VR6A 2JA8B 3NXWA 5CYUA 5COYA 5JVH3 2K5DA 1R9TB 3VR5A 3LWUA 1A15A 3A54A 4KN4C 4ILWA 1ZEQX 3E6ZX 5D3IB 2LMCB 3K5LA 2IPKD 2EYLA 1HUNA 1JOQA 1LTTD 3SK4A 3V96A 1V1PA 2F0VA 2D9UA 4QIWB 5LL6S 3SK6A 1HFNA 3TN2A 5EPJA 3I91A 4A3DB 2O5IC 2F3VA 2F0PA 2RSOA 3MXNA 1OO9B 2WKCA 4K2LA 4ZK9B 2MUYA 3K57A 1LLRD 3MC0B 3GTGB 1ENFA 3OIQA 2F0FA 1CQVA 1C48A 2RDHA 2E74C 1STNA 3GTLB 1CT1D 2B2YA 5DNFA 4IUUA 2A6ED 3DXJC 2PCFB 3P20A 3DWAA 5LL6X 2L11A 3NQTA 3OSOA 4LJZC 2BCOA 1E2VA 2JEBI 4PQXA 5C6AA 2BA0A 4I7ZC 3URYA 3U9SA 2YU9B 1BO0A 5TSSA 4ZKCB 2A74C 3HOWB 4XDXA 1RDPD 3NK9A 2OXPA 4XQQA 2B2UA 3H0GB 5JAVA 2HCIA 3GTQB 3RD4A 1U4PA 3M85A 4KY7A 2R3ZA 4ZKBB 4KJOA 1A3VA 1HFGA 1U9RA 3M7NA 3A8KE 4XQNA 1S5ED 3X3MA 1Q1BA 3TMEA 4NP5A 4KV6A 4RCNA 1TU2B 2Q8RE 3TP8A 4PMWA 4DAPA 3R2TA 5JEAH 3FEWX 4MIUA 1EY5A 4KKTA 5F2DA 1XTCD 4UAIA 3P1HA 1MGSA 1D5MC 2NWGA 5BN3A 2R93B 1EYAA 5I2XA 2BOSA 4L8JA 2RDGA 3GV6A 4FXDA 4M1UB 2L1BA 2PMZB 3VR4A 2HQEA 4OHJA 1QWYA 1E2ZA 5FO8B 4K6LA 1TVXA 2PQEA 1V43A 4ID6A 1RJTA 1UEAB 3FKIB 3BVGA 3HG9A 1SNMA 3AU7A 2F0LA 2SDFA 2F1MA 4WFN3 2VUMB 4TRDA 1RCVD 4IQZA 4O42A 5EBCA 3AB9A 4PMBA 5K36G 1D5XC 1IW7D 2PPBC 3D6CA 3ND8A 5NUCA 1F2MA 3RMHA 1Z7TA 3IAYA 4XTCS 1HQMC 4DA2A 3C1FA 5C4HA 4RHSA 1VMPA 2KVMA 4XYQA 4U673 1BCPD 3FVQA 1SYGA 5CR3A 2RSNA 5EKIA 1KAAA 1SSOA 3G7LA 1ZYRD 4A93B 2PZWA 4DAVA 3VYRA 3TP6A 2AUKA 1WTPA 3L9AX 3GTOB 1O7LA 3X3NA 3HEJA 1SMYD 4HN7A 2PO4A 4EGVA 5IIFA 4PNYA 1GUOA 5IGFA 1CI3M 1STYA 2EOTA 4F87A 2PZUA 3OMGA 4HMIA 4RGTA 2JE6I 1GXDC 1H9KA 1RHPA 2QKIC 2Y0SB 3IKJA 1GHKA 4R8IA 4J8QA 2OT2A 2K28A 1SYEA 2F0UA 4CJ1B 1I3QB 5D14A 3EA6A 1NAPA 2LFNA 2MP1A 3V2TA 1KABA 2Z4HA 5FO9B 2KQ3A 5I6WA 3BDOA 1BCPB 1SJHD 4DFAA 5DM63 1KLUD 4ME5A 1CZWA 4L63B 1L0XB 4X3KA 1SNCA 2IWHA 1WD1A 1SYFA 5A2QL 3OOCA 2X6LA 1KNEA 3HGBA 4IFDJ 3FPPA 1GHJA 3OMCA 3CHBD 1DM0B 2NVTB 4QF4A 4ZYSA 4K5XA 1SFOB 4HCSA 1PRTD 1EIGA 3MWYW 4ZUJA 1UUPA 1G2TA 2L9HA 1JICA 3ND9A 1II3A 2KJXA 4C3JB 3MXGA 3SHLA 3T56B 1S5BD 1HXYD 1VCIA 1SYDA 1BR9A 3QWNA 2NN6I 1I4GA 1M4VA 1D6EC 1U4MA 4FXGC 3J7AV 3I3CA 2AWNA 1DOMA 3NBIA 3NQIA 1EY6A 5C4XB 5CV8A 1XXGA 4IUNA 1EQTA 3TZUA 2FMMA 5C5LA 3S1RB 4QUFA 2B63B 1IL8A 1LT6D 1EEID 1B44D 2IX3A 2E2IB 3KF8A 1D2BA 1R4PB 2AQ1B 4B9XA 2EYFA 3K7AB 1ILQA 1JWSD 3T53B 3J7YW 2NB0A 2XNAC 1PRTB 1ZKOA 2K5WA 3D3RA 3NPPA 4EQPA 1CK1A 1OXUA 1VMCA 1LV9A 1D1IA 3BG3A 5ELDA 2AQ2B 4KY5A 1STEA 2EJFC 5HURA 3DM1A 1DZ1A 3S16B 1B53A 3S1QB 2A69C 1D1KA 2HUGA 2VNUD 2KEDA 1FYCA 3OPOA 2RA4A 4HSPA 5IGEA 2KOLA 1AP0A 1PTOH 3S9WA 1KTKA 1QNKA 2EE1A 1IYVA 2E2HB 4KD4A 3IFTA 5IOCA 2F0NA 4EQNA 3M4YA 3QIAA 2MJ8A 1Q3LA 5AFWA 1F2ZA 1EWHA 2Z8LA 3QO2A 3J81E 3IFDA 2O5JC 4JK1C 2E75C 1SE4A 3A55A 3G6JB 4DNTB 4BBSB 1O78A 2RKSA 4LAAA 1KDCA 5T1GA 1STAA 2A6EC 3Q24A 2ICEC 2R92B 5LHY1 2WP8J 1EZ8A 1F9PA 3DWQA 2EY1A 4O1NA 4KHVA 4XT1B 3HOXB 1WD0A 1NR4A 3J81L 1O80A 4N9TA 3C3LA 2Q8TA 5KNDA 3I70A 5IGBA 5K5PA 1ENCA 3D4RA 4C3HG 1SBBB 3PMFA 1AW7A 4K5WA 2IL8A 2VXWA 3Q23A 5I4DA 2SNSA 2JP1A 2RDFA 2KEEA 4CHTB 1PDQA 1CFMA 2NVYB 4KD3A 3MA2B 1KLGD 2HCCA 1OXTA 3MXUA 3MXPA 5BN5A 3BYTB 3A7LA 2L4NA 4QUCA 5KEEA 1V1PB 2N88A 4N9PA 1J8IA 1PTOD 2LKVA 3VYSA 2H1EA 3PO2B 2F0HA 4K8IA 1QE6A 1DOKA 2F4IA 1QJOA 1HTLD 5T1IA 3DEOA 4DF7A 4KI0A 1SJED 1PFNA 5EKLA 5EGTA 2AQ3B 1F2LA 2RVLA 4IUVA 4F8MA 1O7YA 1S5DD 3C2PA 1G91A 2IT1A 3OW7A 5KNCA 1GOZA 5M9OA 3VYTA 4IURA 2A73B 4HAEA 4A3MB 4CKCA 2O4XA 3N52A 4IFDG 1I50B 4RGNA 1I4RA 1FR3A 4CKBA 4KN7C 3HKZB 1WTXA 2K6AA 4H13C 2EXZA 1DXMA 1TWFB 3TBIB 1STGA 2IJ0A 2DNCA 1PTOB 4FF3A 3C46A 3N6RA 3DWPA 4KTAA 4OO1I 1EY0A 3QJYA 4XQJA 3WOFA 2H4OA 2TMPA 4DAYA 4OO1H 2WV6D 1Y8PB 2C9OA 2J7ZA 4RKBA 1BNZA 1EY8A 4XXEA 4HSVA 2NVXB 4U68A 5FO7B 4C1NI 4HEDA 3GQBA 4H7BA 2G9DA 5KYLA 1BCPF 2JSOA 4K5VA 5CGKA 4XYOA 1PLFA 3GTJB 1Y1WB 1RTNA 1A2TA 1FGBD 2XWBB 3S17B 4RGOS 4OIKA 1TWAB 5IGDA 2K32A 1QB5D 2D62A 1JC7A 1TS4A 1I6HB 1E0BA 2M2LA 3P75A 2SEBD 3CU7A 1TY0A 2L12A 1GUTA 2JXMB 2JA7B 2ICIA 3OWEB 2PW7A 1Q12A 1K8OA 1WTQA 3MAQA 4C3IG 1RTOA 3MVVA 1ML0D 3M3YB 1UNSA 1YNNC 2EYMA 3W3AA 1H9MA 3J7AF 1STHA 1ICWA 4B9WA 2PZTA 1FNVA 2A6HD 5KYIA 3K59A 2PNRC 1GUGA 2EYPA 1SYCA 1QOHA 3I90A 2M9VA 1EYCA 4R9WA 4C2MB 2NBFA 2IW3A 3KK7A 2R7ZB 2R61A 4ZAIA 4BY7B 3T16A 3S2DB 1EL0A 3R3OA 5EKKA 2E76C 4A3IB 1LTGD 2QILA 1SE2A 4C3JG 1WTVA 1G6ZA 5JEAG 1PRTF 1TS2A 3A7AB 2CW0C 3EVQA 4DGZA 1MD2D 2BDOA 2EZVA 3T4AC 1EY9A 4KKUA 1HPCA 3GO5A 3HS0C 3PUYA 1DJRD 2K33A 4KHZA 3I72A 4CJ2C 1X3QA 2L0CA 2B2TA 2F0OA 4HMJA 1K83B 3KBGA 5M3FB 1PZKD 2Z4IA 1CA5A 1B9MA 4DN4M 2K01A 4DNRB 2WAQB 4RWSC 5KGUA 5E4WC 1L0YB 4B08A 1EQVA 4NDXA 1EY7A 1EY4A 2B2VC 5CV7A 1XX8A 3M7GA 4RFBA 3LX0A 5C0XI 1EIHA 1MI2A 4FNFA 1CHPD 3MFYA 4J1MA 5C0XH 3RUZA 1G8ZD 1EU3A 3Q22A 2XRSD 1WTWA 5CV5A 3QOJA 4YIJA 1BUVT 2A68C 1A3TA 3M4OB 4G7HC 3HRZC 4IALA 3K5OA 4EQOA 2K04A 4NMZA 5M5YB 3GP7A 5I6YA 4FP5D 5D3DA 1S5FD 1HA6A 1Y8OB 2EJGC 3TP7A 5J1ZA 2OEOA 4OL7A 3K5MA 4AYBB 1H9JA 3RZDB 1S5CD 1UAPA 1BXTA 4TKOB 3KLSX 1CQFA 5JPNC 1W6KA 2Z1CA 4FO2A 1AZPA 5D65A 4H44C 5ELFA 1LTAD 5IODA 1JORA 1Q8IA 2EYHA 1VDZA 2WACA 1LT5D 1H9SA 5JVG3 1AFPA 3KLSA 2B8FA 4E6IA 3S1NB 1B50A 4KJNA 1PMRA 1DD2A 3FRPB 2ENBA 5ELEA 2RBMA 3TDQA 1QNUA 4X3TA 4DXGA 5DAUA 4C1NK 3SK5A 3H3VC 2F0QA 4L6TB 4ZRZA 2BE5C 5E3FA 1I4PA 4WJWA 3K5NA 3VA7A 3W2DA 1U4RA 2B39A 4RCOA 3MTSA 4QMGA 2LS01 4KMUC 3KLRA 2EYJA 5BN4A 5CBEE 1ESRA 1YNJD 3OIPA 3NSWA 1VF7A 4ULLA 4FXKC 5KRUA 3NE5B 2V4DA 3SVMA 4I65A 2EPBA 4PV1C 3HP3A 3I4LA 1D5ZC 1CTMA 5IGCA 2C5CA 3KUPA 2K03A 4A3GB 1TIID 3NTHA 2NN6G 3DMUA 2HDLA 5J22A 3ERQA 2F0GA 3L7ZC 1I4QA 2DY7A 1XYIA 1AEXA 2F0TA 1K8MA 4V190 1I4XA 2SOBA 1C8CA 3ONAB 2E2DC 3S2HB 3O13A 3TZDA 1PTOF 4BS9A 3BVMA 2MGSA 3ITPA 2ZXRA 1GUSA 1ILPA 5I9PA 1PYWD 3P7JA 1HRJA 5ELCA 4BWGB 3HOVB 2EY6A 2QF7A 5C4ZA 2B2WC 4RA8A 2QCPX 3OWFA 2OF1A 4LMQD 4BBRB 1TKWB 2J4XA 3H6MA 5CV6A 3TP5A 2R6GA 5DM73 4Q5VA 3QB3A 3EJIA 4M8AA 2BA1A 5J39A 5JEAJ 3J80E 1EZ6A 2NTTA 1LO5D 1PFBA 3NTKA 1O7ZA 4FF2A 2XIWA 3U9OA 2EJMA 1TWHB 1S4ZA 3D4WA 2VB3X 1RODA 1DONA 1LABA 2EYOA 4OGQC 4DK1A 2XVSA 2Q8IB 4Y7NB 3OHXC 4S3SA 2NTSA 3PIO3 3DHQA 2B2VA 4K6DA 5M5XB 5M5WB 4RHRA 2TSSA 5M3MB 5FLXE 1LTBD 3UI2A 3IL8A 4ZUIA 4FYDA 3J80L 3R93A 1FNWA 4IUTA 2XRQD 3K58A 1TQOA 4IN3A 3QOLA 2NZ1D 3PUWA 1SNQA 2K1BA 1NUCA 4IFDH 1EOTA 3Q6SA 5G3LD 4A3FB 1NSNS 2B2TC 5C3XA 3GTMB 1U4LA 2I46A 2K05A 5FLXL 1ENAA 1V1OA 2A69D 1I4HA 3CRLC 3D6WA 5E1FA 4K14A 3D4DA 1X3PA 5JJZA 5EPLA 4BA2I 5IT9E 1OXXK 1HA5A 1IYUA 2CVRA 4H0LC 4C56C 1A3UA 3MFGA 1BF4A 1PFMA 2X69A 4IUPA 3NWTA 3DUZA 2WB1B 2A6HC 3S14B 4RH6A 1RF2D 3BYYB 1KDAA 4KY6A 1ONLA 3K6OA 1STBA 3EFXD 1B9NA 2KA7A 3A56A 3FPUB 1JWMD 2VB2X 4P2CB 5C0XJ 1IKLA 2F0EA 4FVMA 1HUMA 5IT9L 5I9OA 1B2TA 2J0TD 2G9HD 1IW7C 5FK9C 3SE0A 3T13A 5C3WA 1JB3A 1Y1VB 3V05A 3R2IA 4G7OC 3VR2A 1BCPC 4A3KB 1SNOA 4IZ8A 3PV0A 5CV4A 2F0MA 3SR1A 3TSSA 3Q0AA 1V8QA 4WORA 4NW2A 4F7XA 3NHHA 1ZYRC 5EQ0A 3R8BA 1TR5A 1DYQA 4G57A 4C3HB 1KNAA 1MSGA 1LTSD 4MN3A 3MZ5A 2KHSA 1SMYC 2NUCA 2EDGA 2K5QA 1F77A 3GV3A 3SK8A 2EY2A 1W6JA 1A2UA 5C3EB 1QCBD 4ZQ3A 2JA5B 4OIJA 5K36H 1JE4A 2RQXA 2B2WA 4K2KA 1T5XD 3CKIB 1WTOA 1AZQA 4OO1G 2F0KA 1XWEA 3MEHA 4V0BA 1SXTA 4LK1C 2F0JA 1ESFA 1TY2A 1EU4A 2EY5A 3LWEA 1GUWA 1H9RA 1EFID 3RLFA 2JA6B 3K0YA 5EBDA 5ISRA 1CZGA 1PXUA 1TWCB 1CHQD 4FF1A 5ELBA 5C5MA 5C4JB 3RZOB 1PRTC 3BVZA 3A8IE 1ET6A 2F0SA 3PO3B 1LACA 2CHBD 3H09A 2D2CC 1JWUD 1TS5A 1GJXA 4NKLA 4Z9CB 5FKAC 2WKDA 1DCZA 1ET9A 2DNEA 4KKSA 4HTHA 5CBAE 1B4OA 5HGTA 4XIGS 2QEJC 1KDBA 5EJWA 2M00A 4MHEA 1Y69U 1SNDA 4XT3B 2LY7A 4DU9A 4F88A 4CKEA 1MBYA 2FFKB 2X6GA 1X32A 3KBXA 3FDTA 1F9RA 3HOZB 3GTKB 4K8JA 1WVLA 1IHZA 1LT3D 5C44B 1Q90A 4RAUC 2A5HA 4CBVA 3PUXA 1C4QA 3NUCA 2FINB 5A2QE 1JOOA 2ID0A 5A35A 1YNJC 4Q0FA 1CA6A 2I07B 2XN9C 3PIP3 1TT2A 3D31A 1B1ZA 1LT4D 2BDNA 5EPKA 2HDMA 1FNUA 1QILA 1Z6HA 4C3IB 3HOUB 1YNND 2JEAI 4QB4A 4ABNA 3NWSA 4DXFA 1HHVA 4RGMA 5IGGA 1JCKB 2E2JB 2KCNA 2F0DA 2N55A 1F9QA 1FD7D 3C1EA 4ZLTF 2YYZA 1I6VC 2IX1A 1PZJD 3H94A 1WTRA 1H9SB 1SAPA 1HQRD 1JR0D 2XSCA 1J9OA 3I4MB 3GD7A 3BS1A 1A6XA 2MHVA 1MSHA 4BA1I 4IUQA 1RD9D 3HZXA 3NP8A 5E4XA 4HR7B 1SEBD 2EVBA 1GUNA 1M8AA 1WCMB 5KIXA 2MPMA 5C0XG 1NR2A 3I73A 3CQZB 3BDLA 1SE3A 3GTPB 2QDBA 2KCCA 2DY8A 4BY1B 4A3JB 1TWGB 1G291 2XWJB 3PUZA 2CW0D 3I8ZA 2JYOA 1VF5C 1OXSC 3E5SA 2D5DA 1JOKA 1DOLA 5DEHA 3DEPA 2ZT9C 2NN6H 2FMCA 3F2UA 1SYBA 2F3WA 2B2YC 4A3EB 1T5EA 1CM9A 2F0WA 1BOSA 3FMCA 1EEFD 1HCZA 5JPMC 2GA4B 3BDCA 4EVOA 5CC4A 2FJ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q8R E;  3QO2 A;  3R93 A;  1QE6 A;  4IUT A;  1DOK A;  3IFD A;  2HDL A;  1U4M A;  2BDN A;  3I3C A;  1PLF A;  1SDF A;  5EPK A;  2HDM A;  5T1I A;  3DEO A;  1DOM A;  2DY7 A;  2KEC A;  1PFN A;  1RTN A;  1XYI A;  2NZ1 D;  1EQT A;  1AZP A;  5D65 A;  2FMM A;  2EOT A;  4UAI A;  4OIK A;  2B2Y A;  1HHV A;  1MGS A;  5DNF A;  1C8C A;  3ONA B;  2K1B A;  2NYZ D;  1F2L A;  4CJ0 B;  2NWG A;  2RVL A;  4IUU A;  3TZD A;  4IUV A;  4X3S A;  4NW2 A;  1RHP A;  4QUF A;  1EOT A;  2KUM A;  3Q6S A;  1O7Y A;  2MGS A;  2N55 A;  5CMD A;  5EQ0 A;  1F9Q A;  1IL8 A;  1B3A A;  1E0B A;  2M2L A;  1G91 A;  5T1G A;  4ZLT F;  4R8I A;  4CJ2 C;  1ILP A;  3GV6 A;  1X3Q A;  2B2T C;  2L1B A;  2L12 A;  3P7J A;  1HRJ A;  2L11 A;  2B2T A;  2K28 A;  1KNA A;  1U4L A;  1WTR A;  1BBX C;  1MSG A;  2K05 A;  4CJ1 B;  1SAP A;  4IUR A;  4MN3 A;  1B50 A;  1J9O A;  5D14 A;  3D6W A;  4HAE A;  1TVX A;  1X3P A;  2B2W C;  1NAP A;  4RA8 A;  1F9P A;  1WTQ A;  1CA5 A;  2MP1 A;  2B2U C;  5CBA E;  5JJZ A;  1B4O A;  1RJT A;  4DN4 M;  3N52 A;  1MSH A;  2K01 A;  5EPL A;  1QG7 A;  4IUQ A;  4XT1 B;  4LMQ D;  4RWS C;  5EJW A;  1RTO A;  1ILQ A;  5E4W C;  4MHE A;  4X3T A;  1WD0 A;  5E4X A;  1ML0 D;  1NR4 A;  3GV3 A;  2SDF A;  2CVR A;  4XT3 B;  5COY A;  5COR A;  1O80 A;  1BO0 A;  1ICW A;  4O42 A;  4ZKC B;  1WTX A;  1NCV A;  1VMC A;  1LV9 A;  2B2V C;  4X3K A;  1XX8 A;  2Q8T A;  1A15 A;  2FFK B;  4XDX A;  1M8A A;  1WD1 A;  1G2S A;  1BF4 A;  2X6G A;  1X32 A;  1EIH A;  1PFM A;  1MI2 A;  2MPM A;  1ZXT A;  1KNE A;  1PFB A;  2X6L A;  4OIJ A;  1NR2 A;  1O7Z A;  3KBX A;  2XIW A;  3FDT A;  1F9R A;  1JE4 A;  2X69 A;  1U4R A;  2B2W A;  3DM1 A;  4IUP A;  1DZ1 A;  1S4Z A;  3I90 A;  2IL8 A;  2B2U A;  2VXW A;  4R9W A;  1ROD A;  1WTO A;  1B53 A;  1DON A;  3MTS A;  1VMP A;  1HUN A;  1WTW A;  2HUG A;  2DY8 A;  2KVM A;  2KED A;  1WVL A;  2JP1 A;  2KEE A;  2RA4 A;  3I8Z A;  2JYO A;  1AZQ A;  1PDQ A;  2KOL A;  4HCS A;  5CBE E;  1AP0 A;  2HCI A;  4RAU C;  1DOL A;  2RSN A;  1U4P A;  4ZAI A;  1EIG A;  1ESR A;  2K04 A;  3FPU B;  3DEP A;  2B2V A;  3MWY W;  5EKI A;  1EL0 A;  2HCC A;  1G2T A;  1QNK A;  2EE1 A;  2L9H A;  2R3Z A;  2D9U A;  2J7Z A;  1JIC A;  4ZKB B;  2L4N A;  3F2U A;  1BNZ A;  1SSO A;  1IKL A;  3G7L A;  4QUC A;  1HFN A;  2FIN B;  2N88 A;  1HFG A;  1HUM A;  2B2Y C;  4HSV A;  5EPJ A;  3TN2 A;  3SVM A;  3I91 A;  3UI2 A;  1CM9 A;  2EPB A;  1B2T A;  3LWE A;  1J8I A;  3HP3 A;  1HA6 A;  1WTP A;  1CA6 A;  1GUW A;  4X3U A;  4U68 A;  2RSO A;  3H91 A;  4HED A;  1IKM A;  3IL8 A;  2MJ8 A;  2H1E A;  3KUP A;  1F9S A;  1Q3L A;  2K03 A;  4ZK9 B;  1WTV A;  5AFW A;  1G6Z A;  2FJ2 A;  2FHT A; 
#chains in the Genus database with same CATH topology
 3S14 H;  3L3O C;  4H02 A;  4HJ7 A;  2KEC A;  1OXV A;  3J81 c;  3CCS A;  2K7V A;  5I2Y A;  3GTG H;  3AEV A;  3LNN A;  4FDB A;  3S1M B;  4CJ0 B;  2PYK A;  4DK0 A;  3NBH A;  5CV9 A;  3JAM E;  2EIF A;  2PW5 A;  3QG1 A;  4X3S A;  2NVQ B;  2KUM A;  5CMD A;  1SE8 A;  3VYU A;  3AMU A;  3GTL H;  1B3A A;  4JI0 Q;  2A19 A;  3T51 B;  5FOB B;  2UUA Q;  1EWI A;  1PTO C;  1HTP A;  3PO2 G;  3MHB A;  3ICE A;  3ERO A;  4QIW E;  1LYL A;  5LMN W;  2A68 D;  2WIN B;  1E2W A;  1CKM A;  4GKK L;  2B2U C;  4G7Z C;  1QG7 A;  1PZI D;  2F03 A;  1W2B A;  1N32 Q;  4LF5 L;  1RKN A;  5LMN L;  2K5H A;  4DAM A;  3KDF A;  3QR8 A;  4YWM A;  4GZY C;  5COR A;  3T1Y L;  3SDZ A;  5G3L F;  2DN8 A;  4POG A;  4KK7 A;  1NCV A;  2VY3 A;  2ZXP A;  3K80 C;  2WII B;  1F2Y A;  3D0F A;  3I2Z A;  1TS3 A;  3U4V A;  1G2S A;  3SXH A;  3WDN A;  1ZXT A;  1OTC A;  2YU9 H;  3PUV A;  1SNP A;  2AUJ D;  3A8J E;  3JAM L;  4PMC A;  4R8N A;  1LTI D;  1VQL A;  3HOW H;  4A3B B;  3VA5 A;  4IJH A;  2B3G A;  2O2L D;  2B8G A;  1IBL L;  2L5T A;  2SNM A;  2WB1 G;  3CRK C;  4R4C A;  4NB3 A;  5IP9 G;  3E0J A;  1EWC A;  2ZXO A;  2K5V A;  3BZK A;  3I4N B;  4GS3 A;  3DLL A;  2HD3 A;  4WRD A;  1WI5 A;  2LSS A;  4IPC A;  5JJK A;  4UDU C;  1Z47 A;  3HOY B;  2L15 A;  4DR5 L;  5JOB A;  2AWO A;  3H0G H;  3OW2 A;  3GTQ H;  1E1O A;  1Y8N B;  2F0I A;  1LTR D;  5IY0 A;  4X3U A;  4FF4 A;  3H91 A;  3A74 A;  1IKM A;  2CQA A;  3BZD B;  1F9S A;  1SRO A;  1NMF A;  2FHT A;  1Q1E A;  1QZG A;  1SDF A;  4QCL A;  1Y1V G;  4J6H A;  2ZTE A;  4JBW A;  3EQL C;  3WOE A;  5KNB A;  4RKL A;  2RCF A;  1R4Q B;  3UDI A;  4HCE A;  4A3K G;  1Y14 B;  4CGY B;  2NYZ D;  1Q46 A;  2BE5 D;  2L55 A;  3SEB A;  3D8G A;  3VR3 A;  1EYD A;  1BQQ T;  2VS1 A;  2IX0 A;  4ODG A;  4TQU S;  4KHP Q;  3STB C;  4QY7 A;  1BDO A;  4TSS A;  1PH9 A;  1BBX C;  4G4K A;  2QA4 A;  3ZYY X;  1AN8 A;  3S15 B;  1JQY D;  2R93 H;  1KHI A;  2KHI A;  4IFD I;  3K8A A;  3NTI A;  3VR6 A;  2JA8 B;  1Y1W G;  4O0A A;  3NXW A;  5IYC G;  3CCL A;  1X3F A;  5CYU A;  4GOP A;  5COY A;  5JVH 3;  2K5D A;  1R9T B;  3VR5 A;  4JI5 Q;  3FKI H;  3LWU A;  4IPG A;  1A15 A;  3UDF A;  5FJ8 H;  1GM5 A;  1HR0 W;  5C3E G;  2AHO B;  3A54 A;  4KN4 C;  4DV2 Q;  4ILW A;  3J81 j;  3HKS A;  2VUM H;  2JA7 G;  1ZEQ X;  1I94 Q;  3E6Z X;  5D3I B;  2LMC B;  3CF5 A;  4L5Q A;  1HR0 L;  3K5L A;  3M4Q A;  2IPK D;  1VQ5 A;  2EYL A;  1HUN A;  1JOQ A;  1LTT D;  4JI2 L;  3SK4 A;  1XMO Q;  3V96 A;  1HZC A;  1V1P A;  1U0L A;  2F0V A;  2PMZ E;  4X6A H;  1UE7 A;  3Q8D A;  4B3M Q;  4NXM Q;  2D9U A;  4QIW B;  5LL6 S;  3F2C A;  3SK6 A;  1HFN A;  3TN2 A;  5EPJ A;  3I91 A;  4A3D B;  2UUB L;  2O5I C;  2F3V A;  2F0P A;  2RSO A;  3MXN A;  1HZ9 A;  4LF7 Q;  1OO9 B;  2A1A A;  2WKC A;  2Q2I A;  4K2L A;  4ZK9 B;  2KEN A;  2MUY A;  3K57 A;  4A93 H;  1LLR D;  3MC0 B;  3GTG B;  2CKZ B;  1ENF A;  3OIQ A;  3HOZ H;  2Z6B A;  1PH4 A;  4DR4 L;  2F0F A;  1CQV A;  1C48 A;  2RDH A;  3GTO H;  1LUZ A;  2E74 C;  2F4V L;  2OQ0 A;  2JA6 G;  1STN A;  3GTL B;  4DK3 C;  4LF8 L;  1NY4 A;  1CT1 D;  1SR3 A;  2B2Y A;  5DNF A;  4MTK A;  4IUU A;  1M1K C;  2A6E D;  3DXJ C;  1VQK A;  2PCF B;  4CDC C;  3A5U A;  3P20 A;  3DWA A;  4DPG A;  5LL6 X;  2L11 A;  1SLJ A;  4LFA L;  3NQT A;  4GN3 B;  4DV6 L;  1WTH A;  4IO9 A;  1KQS A;  5IP7 H;  1CSP A;  3OSO A;  5GAD C;  4LJZ C;  3IRB A;  2VQF Q;  2BCO A;  1E2V A;  2JEB I;  4OXP A;  4PQX A;  5C6A A;  4K0K L;  2BA0 A;  4I7Z C;  2ZM6 L;  3URY A;  4A75 A;  4C3I H;  2RHS B;  3U9S A;  2YU9 B;  1BO0 A;  5TSS A;  4NPS A;  4ZKC B;  3J81 i;  2A74 C;  3HOW B;  1YZ6 A;  4XDX A;  1RDP D;  2JK8 A;  3NK9 A;  3A0J A;  2UXD L;  2OXP A;  1AH9 A;  4XQQ A;  4L5T A;  2B2U A;  4QJF A;  4YCW A;  2Y0S E;  1J5E Q;  2WAQ G;  3H0G B;  5JAV A;  2HCI A;  3GTQ B;  1KXL A;  3RD4 A;  1U4P A;  2WFW A;  3M85 A;  2NVT H;  4KY7 A;  2R3Z A;  4ZKB B;  4LFB L;  1VQH A;  3NEL A;  4KJO A;  4DUY Q;  1SFO H;  4JI1 Q;  1A3V A;  1HFG A;  1U9R A;  3CME A;  4Y52 H;  3TRE A;  3ULL A;  3M7N A;  3A8K E;  4XQN A;  1S5E D;  4X62 L;  1PH8 A;  1MJC A;  3X3M A;  1Q1B A;  1BBU A;  3TME A;  3G71 A;  4LUZ A;  2G5D A;  4NP5 A;  4DNI A;  4DR6 Q;  4KV6 A;  3NEN A;  4RCN A;  1TU2 B;  2Q8R E;  4C3J H;  1EIF A;  3TP8 A;  4PMW A;  1K3B C;  4DAP A;  3R2T A;  4YWL A;  5JEA H;  3FEW X;  4MIU A;  1EY5 A;  4KKT A;  5F2D A;  1XTC D;  2KCT A;  4UAI A;  3P1H A;  1MGS A;  1D5M C;  2NWG A;  3AFP A;  5BN3 A;  2R93 B;  1EYA A;  1N36 Q;  5I2X A;  2BOS A;  4L8J A;  4GKJ Q;  2RDG A;  3GV6 A;  4FXD A;  4M1U B;  2L1B A;  2PMZ B;  3S1R H;  3VR4 A;  5BR8 Q;  2GVA A;  1IYJ B;  2HQE A;  4OHJ A;  1QWY A;  2B63 H;  1E2Z A;  2EQS A;  4UP9 A;  4K6L A;  5FO8 B;  1TVX A;  2PQE A;  1V43 A;  4ID6 A;  1RJT A;  1YBY A;  2JN4 A;  3I4M G;  1UEA B;  3FKI B;  1AE3 A;  4A76 A;  3BVG A;  3HG9 A;  1N33 Q;  1SNM A;  3AU7 A;  2F0L A;  2SDF A;  4MTN A;  2E2I H;  2F1M A;  4WFN 3;  5IYB H;  2VUM B;  4TRD A;  1RCV D;  1K3R A;  4IQZ A;  4O42 A;  3PSI A;  5EBC A;  3AB9 A;  4PMB A;  3AQQ A;  3K7A H;  5K36 G;  1D5X C;  1IW7 D;  3ULP A;  2PPB C;  3D6C A;  1LTL A;  1SMX A;  3ND8 A;  5NUC A;  1F2M A;  2NVQ H;  3RMH A;  1N34 Q;  1Z7T A;  3IAY A;  4XTC S;  1WCM G;  4JI3 L;  1HQM C;  4DA2 A;  3C1F A;  5IWA Q;  5C4H A;  4RHS A;  1VMP A;  2KVM A;  4XYQ A;  4IPH A;  4U67 3;  1BCP D;  3FVQ A;  1SYG A;  5CR3 A;  4BY1 G;  4AQY Q;  1X9N A;  4A3J G;  2RSN A;  1VQ7 A;  2VQE Q;  3S16 H;  5EKI A;  3S1Q H;  1C7Y A;  4R4T A;  4JI6 L;  4X64 Q;  1KAA A;  1SSO A;  3G7L A;  1ZYR D;  4A93 B;  2PZW A;  1A8V A;  4DAV A;  3VYR A;  4B3T Q;  2VZA A;  2AUK A;  3TP6 A;  1WTP A;  4YY3 L;  4NXN Q;  1EOV A;  1LM0 A;  1KRT A;  3L9A X;  3GTO B;  1NTG A;  1O7L A;  1K8G A;  2JQO A;  3X3N A;  4OX9 Q;  3HEJ A;  1BVS A;  1SMY D;  2I5L X;  4HN7 A;  2PO4 A;  3A5Z B;  4EGV A;  5IIF A;  4QQB X;  4PNY A;  1GUO A;  5IGF A;  1XJV A;  4JBK A;  1VQM A;  2HIV A;  1IL2 A;  1CI3 M;  4LF9 L;  1STY A;  5HGQ A;  4GLA C;  2EOT A;  4F87 A;  2PZU A;  4O2D A;  2UUC L;  3OMG A;  4HMI A;  4RGT A;  2JE6 I;  1GXD C;  1H9K A;  1RHP A;  2QKI C;  3RN2 A;  2Y0S B;  3IKJ A;  1GHK A;  4R8I A;  4BBS H;  4J8Q A;  1K0R A;  2OT2 A;  3LGJ A;  2K28 A;  4A3G G;  1SYE A;  2F0U A;  4CJ1 B;  1I3Q B;  4MNO A;  5D14 A;  3EA6 A;  4YWK A;  1NAP A;  2LFN A;  2MP1 A;  4N8F A;  1KAB A;  3V2T A;  1VQ9 A;  4B3S L;  2Z4H A;  2R92 H;  5FO9 B;  2KQ3 A;  5I6W A;  1GKH A;  3BDO A;  4DR7 Q;  1BCP B;  1SJH D;  4DFA A;  1B8A A;  5DM6 3;  2BH8 A;  4B3R Q;  1KLU D;  4ME5 A;  1CZW A;  4L63 B;  3PF5 A;  3HOX H;  1L0X B;  4X3K A;  1H95 A;  1GO3 E;  1SNC A;  2IWH A;  1WD1 A;  1SYF A;  3HFZ B;  5A2Q L;  3OOC A;  2X6L A;  1KNE A;  3HGB A;  2MNA A;  4UY8 C;  2DUD A;  2JJQ A;  5HY6 A;  1JJ2 A;  4IFD J;  3FPP A;  1GHJ A;  1Q81 C;  2Z9H A;  3OMC A;  3CHB D;  1DM0 B;  2NVT B;  5J3B A;  4QF4 A;  4ZYS A;  4DK6 C;  4JVZ A;  5AJ3 L;  4A3B G;  3S15 H;  4K5X A;  1SFO B;  3TRZ A;  4BBR G;  1XMQ L;  4HCS A;  1PRT D;  3EBE A;  1EIG A;  2JA8 H;  3MWY W;  4ZUJ A;  4DV5 L;  1UUP A;  1G2T A;  3I4N G;  2L9H A;  4DV0 Q;  2MQH A;  1JIC A;  5ELO A;  3ND9 A;  1P8L A;  1II3 A;  1G6P A;  2KJX A;  4C3J B;  3MXG A;  4YHH L;  3HOY G;  3SHL A;  3T56 B;  2K75 A;  1S5B D;  1HNX L;  1HXY D;  1VCI A;  2K52 A;  3F2B A;  4GN5 A;  1SYD A;  1BR9 A;  3QWN A;  2NN6 I;  3KOJ A;  1I4G A;  4JI8 Q;  1M4V A;  1D6E C;  1U4M A;  1X55 A;  4FXG C;  3J7A V;  3I3C A;  2AWN A;  4P73 A;  4HJ8 A;  4GN4 B;  1DOM A;  1N8R C;  3NBI A;  1S3O A;  3NQI A;  1EY6 A;  5GAH C;  3PO2 H;  5C4X B;  5CV8 A;  1XXG A;  4IUN A;  1EQT A;  3TZU A;  1KRS A;  2FMM A;  5C5L A;  3H3V I;  1VQG A;  3S1R B;  1UE6 A;  4QUF A;  1P16 A;  4GNX C;  2B63 B;  1IL8 A;  1LT6 D;  3PGZ A;  1BKB A;  1PH6 A;  1FL0 A;  3NBH B;  2IHE A;  3VDY A;  1EEI D;  1B44 D;  4YCU A;  2IX3 A;  2E2I B;  1PV4 A;  3KF8 A;  1D2B A;  1R4P B;  2PI2 A;  2AQ1 B;  4HJA A;  1EQQ A;  4B9X A;  2EYF A;  3K7A B;  1ILQ A;  1JWS D;  3T53 B;  3J7Y W;  2N3S A;  4RMF A;  4X65 L;  1HNZ Q;  2NB0 A;  2XNA C;  4A3M H;  4DV1 Q;  1PRT B;  1ZKO A;  4IPD A;  3NPP A;  2K5W A;  3D3R A;  4EQP A;  1CK1 A;  1OXU A;  1VMC A;  1LV9 A;  2N8N A;  2E8G A;  1D1I A;  3BG3 A;  1I50 H;  5ELD A;  1E3P A;  3KDF B;  2AQ2 B;  1PH2 A;  4KY5 A;  4A3F G;  1STE A;  2ATW A;  1KAW A;  2EJF C;  5HUR A;  1NBW A;  3J80 c;  3FHW A;  3DM1 A;  1DZ1 A;  3S16 B;  1B53 A;  4A3C H;  3S1Q B;  2A69 C;  4IJL A;  1D1K A;  2HUG A;  2VNU D;  2KED A;  1FYC A;  2QEX A;  3OPO A;  2RA4 A;  4HSP A;  5IGE A;  2KOL A;  4QGU A;  4HJ9 A;  1AP0 A;  1PTO H;  1L1O C;  3S9W A;  1KTK A;  1ASZ A;  2KCM A;  1QNK A;  2EE1 A;  1IYV A;  2E2H B;  4KD4 A;  4LF6 Q;  3IFT A;  3TS0 A;  5IOC A;  4ALP A;  1YHA A;  1J5E L;  2F0N A;  5FLX c;  4A3D G;  4EQN A;  3M4Y A;  3QIA A;  2MJ8 A;  2IHF A;  1Q3L A;  3CXC A;  5AFW A;  1F2Z A;  1EWH A;  2Z8L A;  3HKZ E;  3QO2 A;  5IE8 A;  3J81 E;  3IFD A;  2IY5 B;  2O5J C;  4JK1 C;  4JI1 L;  3UE1 A;  1L2F A;  2E75 C;  1SE4 A;  3A55 A;  3G6J B;  4A4I A;  1KIX A;  2UXC L;  4JC0 A;  4DNT B;  4JW0 A;  4BBS B;  1O78 A;  3CCU A;  3W5O A;  1EQR A;  3GTJ H;  2RKS A;  4LAA A;  3CCE A;  1Y1W H;  4P71 A;  2YTX A;  1KDC A;  3K7U C;  5T1G A;  1STA A;  1XNR Q;  3S17 H;  1X65 A;  2A6E C;  3NEM A;  3Q24 A;  2ICE C;  2R92 B;  2PQA A;  5LHY 1;  1B3Q A;  2WP8 J;  1EZ8 A;  3ULJ A;  1F9P A;  3DWQ A;  1YEZ A;  2EY1 A;  1NMG A;  4O1N A;  1HNW L;  4KHV A;  4XT1 B;  3HOX B;  4JI7 L;  1PH1 A;  2JA7 H;  1WD0 A;  3CC7 A;  1NR4 A;  4GKJ L;  1VQE A;  4LW1 A;  1KL9 A;  3J81 L;  1O80 A;  4N9T A;  5IT9 c;  3C3L A;  5LMU Q;  4DUZ L;  1YNX A;  2Q8T A;  5KND A;  3I70 A;  4DV3 L;  4GOP B;  1JE5 A;  3M3Y H;  1HH2 P;  5IGB A;  5K5P A;  1ENC A;  3D4R A;  4C3H G;  4OEL B;  1SBB B;  3PMF A;  3T1H L;  1AW7 A;  1VQC A;  2CH4 A;  4K5W A;  2IL8 A;  2VXW A;  3Q23 A;  5I4D A;  2SNS A;  2KBN A;  2JP1 A;  2RDF A;  2E5L Q;  2KEE A;  4CHT B;  1WJJ A;  1PDQ A;  2Q2U A;  1G51 A;  1CFM A;  1YJ9 A;  2NVY B;  4JI4 Q;  2OTL A;  4KD3 A;  3MA2 B;  1KLG D;  2HCC A;  3H0G G;  1OXT A;  3MXU A;  3MXP A;  5BN5 A;  3BYT B;  3A7L A;  1KC8 C;  2L4N A;  4QUC A;  1PVO A;  5KEE A;  1V1P B;  2N88 A;  2JA9 A;  4N9P A;  1VQO A;  4L5R C;  2R7Z H;  4DR3 Q;  2UXB Q;  1J8I A;  2JA5 G;  4BY7 H;  1PTO D;  2LKV A;  3S2D H;  3VYS A;  3OTO L;  4X66 L;  2H1E A;  3PO2 B;  2F0H A;  3F8T A;  4K8I A;  4DV7 Q;  4HJ5 A;  4A3I H;  1XNQ Q;  1QE6 A;  4LNQ A;  4DV4 L;  2DJG C;  1DOK A;  3MXN B;  1NJI C;  2F4I A;  1QJO A;  1HTL D;  5T1I A;  3DEO A;  2UU9 L;  4CDD C;  4KI0 A;  4DF7 A;  1SJE D;  2YTV A;  1PFN A;  5EKL A;  5EGT A;  1FVI A;  1IZ6 A;  4OEM B;  1QZH A;  2AQ3 B;  5IYD H;  3TEH B;  1F2L A;  2RVL A;  3B6Y A;  4IUV A;  3CMA A;  4F8M A;  1YJN A;  1O7Y A;  1S5D D;  3C2P A;  1G91 A;  3I7F A;  4UP8 A;  2IT1 A;  3OW7 A;  5KNC A;  1GOZ A;  5M9O A;  3VYT A;  4JOI C;  4JV5 Q;  1B70 B;  4IUR A;  2A73 B;  4HAE A;  4DR2 Q;  4A3M B;  4CKC A;  2O4X A;  3N52 A;  4IFD G;  1I50 B;  4LF4 Q;  2ZJQ A;  3UDG A;  1J6Q A;  3L2P A;  1K83 H;  4RGN A;  5M3F H;  1PH5 A;  1I4R A;  1FR3 A;  4GNX A;  3DM3 A;  4CKB A;  4KN7 C;  3HKZ B;  5FJ8 G;  3PO3 G;  1WTX A;  2K6A A;  3E9I A;  4H13 C;  2HHH Q;  2VUM G;  2EXZ A;  1DXM A;  4JBM A;  1QVC A;  1TWF B;  3TBI B;  1STG A;  2IJ0 A;  2DNC A;  1X6O A;  1YJW A;  3CCV A;  1PTO B;  4JYA L;  4FF3 A;  3C46 A;  3N6R A;  3DWP A;  1I3Q H;  4KTA A;  4OO1 I;  1EY0 A;  1YHB A;  2N49 A;  3QJY A;  4XQJ A;  1X3E A;  3WOF A;  2H4O A;  2HT1 A;  4RG1 A;  2TMP A;  4DAY A;  4OO1 H;  2WV6 D;  1Y8P B;  1VQN A;  2C9O A;  2J7Z A;  3M4O H;  4RKB A;  1BNZ A;  1EY8 A;  4XXE A;  4HSV A;  4DR1 L;  2RF4 A;  2RCN A;  3STB D;  2NVX B;  2WAQ E;  4U68 A;  5FO7 B;  4GKK Q;  4C1N I;  4HED A;  3GQB A;  4H7B A;  2G9D A;  2XTI A;  5KYL A;  3HOZ G;  1BCP F;  1U5K A;  4LF5 Q;  1HZA A;  5LMN Q;  2JSO A;  3U4Z A;  4K5V A;  3J80 i;  1IBK L;  5CGK A;  3T1Y Q;  4XYO A;  1PLF A;  5C44 G;  3GTJ B;  1L1O A;  1Y1W B;  1RTN A;  1A2T A;  1FGB D;  1JMC A;  2XWB B;  3S17 B;  4RGO S;  3RZD H;  4OIK A;  1TWA B;  5IGD A;  2K32 A;  1QB5 D;  4R1J A;  1JT8 A;  2D62 A;  3JC6 6;  1JC7 A;  1TS4 A;  1I6H B;  1IBM L;  1E0B A;  2M2L A;  3P75 A;  2SEB D;  1IBL Q;  3RR5 A;  4LFC L;  3J7Z C;  3CD6 A;  3CU7 A;  1AE2 A;  1TY0 A;  2L12 A;  1GUT A;  2Y0S G;  1FJG Q;  2JXM B;  4JCV E;  2JA7 B;  2ICI A;  5IP7 G;  3OWE B;  2PW7 A;  1Q12 A;  1K8O A;  2MO1 A;  1ASY A;  1WTQ A;  3MAQ A;  4C3I G;  4DR5 Q;  3HOU G;  1RTO A;  3MVV A;  3S1N H;  1ML0 D;  3M3Y B;  1UNS A;  1YNN C;  2EYM A;  3W3A A;  1H9M A;  5C4X H;  2XGT A;  3M9B A;  1STH A;  3J7A F;  1ICW A;  1VQ8 A;  3I56 A;  3MEF A;  4AYB E;  4B9W A;  4R4Q A;  2PZT A;  1FNV A;  2A6H D;  5KYI A;  4QL5 A;  3K59 A;  2PNR C;  1GUG A;  2EYP A;  1VQD A;  1SYC A;  1QOH A;  3I90 A;  1HNZ L;  2M9V A;  1EYC A;  4R9W A;  4DV1 L;  2F3I A;  4JI0 L;  1QUQ A;  4C2M B;  2NBF A;  2UUA L;  2IW3 A;  4BXX H;  3KK7 A;  2R7Z B;  2R61 A;  4ZAI A;  4BY7 B;  3T16 A;  3S2D B;  1EL0 A;  1T9H A;  5FLM H;  3R3O A;  3PIO A;  5EKK A;  2E76 C;  2R7D A;  1N32 L;  4A3I B;  5L37 A;  1LTG D;  1CKN A;  2QIL A;  1SE2 A;  4C3J G;  1WTV A;  2PI2 E;  1PH7 A;  1G6Z A;  4A3L H;  5JEA G;  1A0I A;  1PRT F;  1WOC A;  1JJC B;  1TS2 A;  1SN8 A;  3A7A B;  2CW0 C;  3PQI A;  3EVQ A;  4A3G H;  4DGZ A;  1MD2 D;  2BDO A;  1UE5 A;  4LWC A;  2K5N A;  2EZV A;  3T4A C;  4A3E G;  1HR0 Q;  1EY9 A;  4KKU A;  1HPC A;  2E2H H;  1BBW A;  3GO5 A;  3HS0 C;  3KJO A;  3PUY A;  1DJR D;  1PH3 A;  2K33 A;  4KHZ A;  3I72 A;  4CJ2 C;  2B63 G;  1X3Q A;  3S2H H;  1Q86 C;  2L0C A;  2B2T A;  4JI2 Q;  2F0O A;  4HMJ A;  1K83 B;  1QVF A;  1E7Z A;  3KBG A;  5M3F B;  1PZK D;  2Z4I A;  1CA5 A;  1B9M A;  2ZTD A;  3CCM A;  1WFQ A;  4DN4 M;  4OWT B;  2K01 A;  4DNR B;  2WAQ B;  4RWS C;  5KGU A;  1O7I A;  5E4W C;  2UUB Q;  3HOV H;  1L0Y B;  4B08 A;  1EQV A;  4NDX A;  1EY7 A;  1EY4 A;  2B2V C;  5CV7 A;  1XX8 A;  3M7G A;  4RFB A;  2VL6 A;  4GLV B;  3LX0 A;  5C0X I;  1EIH A;  4JOI A;  1MI2 A;  4DR4 Q;  1S40 A;  4FNF A;  1CHP D;  1UE1 A;  3MFY A;  2F4V Q;  4J1M A;  5C0X H;  3RUZ A;  1G8Z D;  1EU3 A;  3Q22 A;  4LF8 Q;  2XRS D;  1WTW A;  5CV5 A;  3QOJ A;  4KHP L;  4YIJ A;  1BUV T;  2A68 C;  1A3T A;  3M4O B;  4G7H C;  3HRZ C;  1PHJ A;  4IAL A;  3I4O A;  3ZJY C;  4R4O A;  3K5O A;  4EQO A;  2K04 A;  1Q82 C;  4NMZ A;  5M5Y B;  1GVP A;  2C35 B;  3GP7 A;  1WYD A;  5I6Y A;  4FP5 D;  5D3D A;  4LFA Q;  1CUK A;  2HIX A;  4DV6 Q;  3K0X A;  1S5F D;  1HA6 A;  1Y8O B;  1VQF A;  5M5X H;  5M5W H;  2EJG C;  5H1S E;  4JI4 L;  3TP7 A;  4JI5 L;  5J1Z A;  5M3M H;  4JPB W;  4PG3 A;  2OEO A;  3KF6 A;  4OL7 A;  3K5M A;  4K0K Q;  2ZM6 Q;  4AYB B;  1H9J A;  4OON A;  3RZD B;  1S5C D;  1UAP A;  1K8A C;  4DV2 L;  1UEB A;  1BXT A;  1Q7Y C;  4TKO B;  3KLS X;  1I94 L;  1CQF A;  5JPN C;  1W6K A;  2YTY A;  2Z1C A;  1TXY A;  3PF4 A;  4FO2 A;  4ME3 A;  1AZP A;  5GAE C;  5D65 A;  2NVY H;  1E24 A;  4H44 C;  5ELF A;  1LTA D;  4KLK A;  5IOD A;  1JOR A;  2UXD Q;  1MKH A;  4BBS G;  4AH6 A;  1Q8I A;  2EYH A;  1VDZ A;  2WAC A;  1XMO L;  4UPA A;  1LT5 D;  1H9S A;  5JVG 3;  1AFP A;  3JAM c;  4CDF C;  4B3M L;  3KLS A;  4NXM L;  2B8F A;  1DGS A;  1V9P A;  4E6I A;  4JBJ A;  3S1N B;  1B50 A;  4KJN A;  4N8X 1;  1PMR A;  1DD2 A;  1X3G A;  3FRP B;  2ENB A;  5ELE A;  4LFB Q;  4LF7 L;  2RBM A;  3TDQ A;  3G6E A;  3GTM H;  1QNU A;  4X3T A;  4DXG A;  1QVG A;  5DAU A;  4C1N K;  3U58 A;  3KF8 B;  3SK5 A;  1XPU A;  3HOX G;  3H3V C;  4X62 Q;  2F0Q A;  4L6T B;  4ZRZ A;  1Q8K A;  2BE5 C;  2P5Z X;  5E3F A;  2NZH A;  1S72 A;  1I4P A;  1VQB A;  4WJW A;  4AIM A;  3K5N A;  2R7F A;  3VA7 A;  3G48 A;  2Q2T A;  3W2D A;  2CH4 W;  1U4R A;  2B39 A;  2FXQ A;  2DJF C;  4JG2 A;  4RCO A;  3SGI A;  3MTS A;  4QMG A;  2LS0 1;  2Z0S A;  4KMU C;  4OWX B;  2JA8 G;  2RHQ B;  3KLR A;  2EYJ A;  5BN4 A;  3E3X A;  5CBE E;  1IXR A;  1ESR A;  1YNJ D;  3M4P A;  5IP9 H;  3OIP A;  3NSW A;  2I0Q A;  3AFQ A;  1VF7 A;  1L0W A;  4ULL A;  1XPR A;  1RIP A;  4FXK C;  2K4K A;  5KRU A;  2VQF L;  2V4D A;  3NE5 B;  3SVM A;  4I65 A;  2EPB A;  4PV1 C;  3HP3 A;  3I4L A;  1D5Z C;  2CWP A;  1CTM A;  5IGC A;  2C5C A;  3KUP A;  2K03 A;  4A3G B;  1I5F A;  1TII D;  1TWF H;  3NTH A;  2NN6 G;  3DMU A;  1YIJ A;  2HDL A;  5J22 A;  3ERQ A;  2F0G A;  3L7Z C;  1I4Q A;  2DY7 A;  1XYI A;  1AEX A;  2F0T A;  1K8M A;  1Y1V H;  1CKO A;  4V19 0;  1I4X A;  2SOB A;  3KJP A;  1C8C A;  3ONA B;  2WB1 E;  2E2D C;  3EIV A;  4UHV A;  3S2H B;  4JI3 Q;  3O13 A;  3TZD A;  1PTO F;  3E9H A;  2B29 A;  4BS9 A;  4A3K H;  3BVM A;  2MGS A;  3ITP A;  3E0E A;  2ZXR A;  1GUS A;  1MIU A;  1ILP A;  5I9P A;  2NVX H;  1PYW D;  3P7J A;  1HRJ A;  4DUY L;  5ELC A;  4BWG B;  3HOV B;  2EY6 A;  2QF7 A;  5C4Z A;  2B2W C;  4RA8 A;  3U50 C;  4JI6 Q;  3KLW A;  2PQA B;  2QCP X;  4C3H H;  2Z6K A;  3OWF A;  4A3M G;  2OF1 A;  4LMQ D;  4BBR B;  1TKW B;  3RNU A;  4P72 A;  4DR6 L;  2J4X A;  3H6M A;  5CV6 A;  3TP5 A;  1FJG L;  4YY3 Q;  2R6G A;  5DM7 3;  3CAM A;  4Q5V A;  3QB3 A;  3EJI A;  5EAY A;  5IYC H;  4M8A A;  2BA1 A;  5J39 A;  1HZB A;  5JEA J;  3J80 E;  1E22 A;  1TWA H;  5GAG C;  1EZ6 A;  2ZJR A;  2NTT A;  3HKZ G;  2CQO A;  2CFM A;  1LO5 D;  1PFB A;  3NTK A;  1O7Z A;  4FF2 A;  1I6H H;  2XIW A;  1D8L A;  4A3C G;  3U9O A;  5C3E H;  2EJM A;  1TWH B;  1S4Z A;  3D4W A;  2VB3 X;  4LF9 Q;  1ROD A;  1DON A;  1N36 L;  2JA5 H;  1EFW A;  1LAB A;  2EYO A;  2ZJP A;  4OGQ C;  4DK1 A;  2XVS A;  2UUC Q;  5BR8 L;  2Q8I B;  4Y7N B;  3OHX C;  4S3S A;  2I5M X;  2NTS A;  3G4S A;  3PIO 3;  3DHQ A;  2B2V A;  2KHJ A;  4K6D A;  5M5X B;  5M5W B;  4RHR A;  2TSS A;  4POF A;  1B7Y B;  3HOW G;  5M3M B;  5FLX E;  1K28 A;  1LTB D;  3UI2 A;  1N33 L;  1V1Q A;  1VQI A;  4B3S Q;  3IL8 A;  4ZUI A;  4FYD A;  4PZ6 A;  3J80 L;  4IOA A;  3PIP A;  2OQK A;  3AYH B;  3R93 A;  1FNW A;  4IUT A;  2XRQ D;  1N34 L;  3TS2 A;  3K58 A;  1TQO A;  4IN3 A;  4C2M H;  3QOL A;  2NZ1 D;  1ICF B;  4GLX A;  5IWA L;  2MFI A;  3PUW A;  1HJP A;  2HQL A;  2JA6 H;  1SNQ A;  2K1B A;  1TWC H;  1NUC A;  4IFD H;  1EOT A;  3Q6S A;  5C4J H;  4AQY L;  3RZO H;  5G3L D;  3WWV A;  2VQE L;  4DKA C;  4A3F B;  5AJ3 Q;  1NSN S;  2B2T C;  4X64 L;  5C3X A;  3GTM B;  3PO3 H;  1XMQ Q;  1U4L A;  2I46 A;  2K05 A;  1K73 C;  5FLX L;  1ENA A;  1V1O A;  1X56 A;  1PFS A;  1I4H A;  2A69 D;  3CRL C;  3D6W A;  5E1F A;  2VW9 A;  2LXJ A;  3D4D A;  1X3P A;  2F52 A;  3BJU A;  4K14 A;  4DV5 Q;  4B3T L;  2ASB A;  4NXN L;  5JJZ A;  4R4I A;  1VQ6 A;  5EPL A;  4BA2 I;  4OX9 L;  5IT9 E;  1OXX K;  4YHH Q;  1HA5 A;  1IYU A;  2CVR A;  4H0L C;  4C56 C;  1A3U A;  1HNX Q;  4ZCK A;  3MFG A;  2OTJ A;  2R93 G;  1BF4 A;  4GNX B;  1PFM A;  2LXK A;  4HID A;  2X69 A;  4IUP A;  3NWT A;  3CC2 A;  1D7Q A;  3DUZ A;  3JAM i;  2WB1 B;  2A6H C;  4PZ7 A;  3S14 B;  4RH6 A;  1RF2 D;  1FGU A;  3I55 A;  3BYY B;  3FKI G;  1KDA A;  2K14 A;  4KY6 A;  2CWA A;  1ONL A;  3K6O A;  1STB A;  2ZTC A;  3EFX D;  1B9N A;  1NE3 A;  2KA7 A;  3A56 A;  3FPU B;  1JWM D;  3GTK H;  2R7Z G;  2VB2 X;  4OWW B;  4P2C B;  5C0X J;  5C44 H;  4BY7 G;  1IKL A;  2F0E A;  5DLQ E;  4FVM A;  1HUM A;  4P74 A;  5IT9 L;  4DR7 L;  5I9O A;  4DAY B;  1B2T A;  2J0T D;  2G9H D;  1IW7 C;  1Z9F A;  5FK9 C;  4B3R L;  3SE0 A;  4A3I G;  3T13 A;  3BZC A;  5C3W A;  1JB3 A;  1Y1V B;  4X65 Q;  4HIO A;  3V05 A;  3R2I A;  4G7O C;  3VR2 A;  1BCP C;  2MO0 A;  1PYB A;  5IYD G;  4A3K B;  1SNO A;  4IZ8 A;  3PV0 A;  1C9O A;  1NNX A;  5CV4 A;  2F0M A;  1L1O B;  1PYS B;  3SR1 A;  3TSS A;  2D0O A;  3Q0A A;  1V8Q A;  5M5Y H;  1W3S A;  4WOR A;  4NW2 A;  4F7X A;  4A93 G;  3GDE A;  3HOU H;  3NHH A;  1ZYR C;  5EQ0 A;  3R8B A;  3H15 A;  3TQY A;  4DV0 L;  1TR5 A;  1DYQ A;  4G57 A;  4C3H B;  1KNA A;  3RN5 A;  1MSG A;  1LTS D;  2E2J H;  4MN3 A;  3RLO A;  3MZ5 A;  1EUJ A;  2KHS A;  1SMY C;  2NUC A;  4LUO A;  3BU2 A;  5M3F G;  3ER0 A;  2DGY A;  2EDG A;  2K5Q A;  3I4M H;  1F77 A;  3GV3 A;  4JI8 L;  2EY2 A;  3SK8 A;  4HIK A;  1W6J A;  2AMC B;  1C0A A;  1VQJ A;  1A2U A;  5C3E B;  3FP9 A;  2K50 A;  1QCB D;  2CCZ A;  4ZQ3 A;  2JA5 B;  3CPF A;  4OIJ A;  5K36 H;  2A8V A;  1JE4 A;  2RQX A;  2B2W A;  4APV A;  4K2K A;  1T5X D;  5E7N A;  3CKI B;  2UXC Q;  1WTO A;  3PCO B;  1WCM H;  4J15 A;  1AZQ A;  4OO1 G;  3CQZ H;  4UP7 A;  2F0K A;  3GTP H;  1QUQ B;  5ELN A;  1XWE A;  3MEH A;  4V0B A;  4BY1 H;  4A3J H;  1TWG H;  1SXT A;  4LK1 C;  2F0J A;  1ESF A;  1TY2 A;  1VS0 A;  1YVC A;  1EU4 A;  2EY5 A;  3LWE A;  1CSQ A;  1GUW A;  1H9R A;  1HNW Q;  1EFI D;  4JI7 Q;  1A62 A;  1M90 C;  4A3E H;  1CKN B;  3RLF A;  2JA6 B;  3K0Y A;  5EBD A;  5ISR A;  1YHQ A;  1CZG A;  1PXU A;  1TWC B;  1CHQ D;  4AYB G;  4FF1 A;  4DUZ Q;  5ELB A;  5C5M A;  5C4J B;  3RZO B;  3UDX A;  4DV3 Q;  1PRT C;  4EQ5 A;  2D0P A;  3BVZ A;  3A8I E;  1ET6 A;  3T1H Q;  2F0S A;  3PO3 B;  4TVA B;  5JJI A;  1LAC A;  1VQ4 A;  2CHB D;  3H09 A;  4HIM A;  3CCQ A;  1JB7 A;  2D2C C;  1JWU D;  2QDL A;  4LUV A;  1UWV A;  1TS5 A;  1GJX A;  3S1M H;  4NKL A;  1MJE A;  4LF6 L;  4Z9C B;  2I5H A;  5FKA C;  2WKD A;  1DCZ A;  1ET9 A;  2DNE A;  4KKS A;  4HTH A;  5CBA E;  1B4O A;  3S24 A;  5HGT A;  2Z6K C;  3F1Z A;  4XIG S;  2QEJ C;  1KDB A;  5EJW A;  5C4X G;  2M00 A;  1RL2 A;  4MHE A;  2YV5 A;  1Y69 U;  1SND A;  4XT3 B;  2LY7 A;  5GRO A;  4DU9 A;  4F88 A;  4CKE A;  3OTO Q;  1JJG A;  4X66 Q;  1MBY A;  3W1G A;  2H5X A;  3F2D A;  2FFK B;  2X6G A;  1X32 A;  4DV4 Q;  1MHW C;  3EN2 A;  3KBX A;  3FDT A;  2UU9 Q;  1A63 A;  1F9R A;  3HOZ B;  2V1C C;  3L0O A;  3CPW A;  4BXX G;  1E1T A;  1XNR L;  5IYB G;  3GTK B;  4K8J A;  1WVL A;  1IHZ A;  1LT3 D;  1VQA A;  4YCV A;  1EIY B;  5C44 B;  1Q90 A;  2QGQ A;  2GN5 A;  4RAU C;  5FLM G;  4A3B H;  2A5H A;  4CBV A;  3PUX A;  4BBR H;  1VQP A;  1C4Q A;  3NUC A;  2FIN B;  5A2Q E;  1JOO A;  2ID0 A;  5A35 A;  3I4N H;  1YNJ C;  4Q0F A;  4L5S A;  2EXD A;  1CA6 A;  4I7A A;  1X54 A;  2I07 B;  4A3L G;  2XN9 C;  3PIP 3;  1TT2 A;  3HOY H;  5LMU L;  3D31 A;  2AKW B;  2ALY B;  1B1Z A;  5GQO A;  1TWH H;  1SRU A;  1LT4 D;  2BDN A;  1YI2 A;  2NZO A;  2BH2 A;  5EPK A;  2HDM A;  4IOC A;  1FNU A;  1QIL A;  1Z6H A;  1GD7 A;  4C3I B;  3KF6 B;  3HOU B;  1YNN D;  2JEA I;  4QB4 A;  4ABN A;  3NWS A;  4DXF A;  4Y7N H;  1HHV A;  4RGM A;  2E5L L;  4WJ3 M;  4GOP C;  5IGG A;  1JCK B;  2E2J B;  2KCN A;  2F0D A;  2GVB A;  2N55 A;  1F9Q A;  4JYA Q;  1FD7 D;  3CCJ A;  3C1E A;  3UE0 A;  4ZLT F;  3W1B A;  2YYZ A;  1I6V C;  2IX1 A;  1PZJ D;  3H94 A;  1WTR A;  1H9S B;  1SAP A;  1HQR D;  1JR0 D;  2XSC A;  1J9O A;  4P75 A;  4DR3 L;  3I4M B;  2UXB L;  3GD7 A;  3BS1 A;  1A6X A;  2MHV A;  3HOV G;  1MSH A;  3ERS X;  4BA1 I;  4IUQ A;  1RD9 D;  3HZX A;  4MZ9 A;  3NP8 A;  4DV7 L;  2N78 A;  5E4X A;  4DR1 Q;  1XNQ L;  3CP0 A;  4HR7 B;  1XPO A;  1SEB D;  4EX5 A;  2QW7 A;  2EVB A;  3K81 C;  1GUN A;  1N9W A;  2Q2H A;  1XTD A;  1M8A A;  1WCM B;  5KIX A;  1IBK Q;  4CDE C;  2ES2 A;  2MPM A;  5C0X G;  1NR2 A;  3I73 A;  3KYH C;  1K0S A;  2R92 G;  3CQZ B;  1R9T H;  3BDL A;  1SE3 A;  4A3F H;  5JJL A;  3J7A 5;  3GTP B;  2QDB A;  1EYG A;  2KCC A;  2DY8 A;  3CW2 C;  3CC4 A;  3OYY A;  4BY1 B;  4A3J B;  1TWG B;  1G29 1;  2XWJ B;  3PUZ A;  2CW0 D;  3I8Z A;  2JYO A;  1VF5 C;  1OXS C;  3E5S A;  4JV5 L;  2D5D A;  1JOK A;  1DOL A;  5DEH A;  4WJ4 A;  1IBM Q;  3KFU A;  4DR2 L;  3RLN A;  3DEP A;  2ZT9 C;  2OCE A;  4LFC Q;  1PA6 A;  2NN6 H;  1K9M C;  2FMC A;  3F2U A;  1KD1 C;  1SYB A;  2F3W A;  2PNH A;  3CCR A;  2B2Y C;  4LF4 L;  4A3E B;  1T5E A;  1CM9 A;  1YIT A;  4PZ8 A;  2F0W A;  5M3M G;  2OWO A;  1BOS A;  3FMC A;  1EEF D;  1HCZ A;  5JPM C;  2GA4 B;  3H3V H;  3BDC A;  4EVO A;  5CC4 A;  2HHH L;  2FJ2 A;  4A3D H; 
#chains in the Genus database with same CATH homology
 3L3O C;  2KEC A;  1OXV A;  2K7V A;  5I2Y A;  3LNN A;  3S1M B;  4CJ0 B;  2PYK A;  4DK0 A;  3NBH A;  5CV9 A;  3JAM E;  3QG1 A;  2PW5 A;  4X3S A;  2NVQ B;  2KUM A;  5CMD A;  3VYU A;  3AMU A;  1B3A A;  3T51 B;  5FOB B;  1PTO C;  1HTP A;  3MHB A;  3ERO A;  2A68 D;  2WIN B;  1E2W A;  2B2U C;  4G7Z C;  1QG7 A;  1PZI D;  2F03 A;  1RKN A;  4GZY C;  5COR A;  3SDZ A;  5G3L F;  2DN8 A;  4KK7 A;  1NCV A;  2ZXP A;  2WII B;  1F2Y A;  1TS3 A;  1G2S A;  3SXH A;  3WDN A;  1ZXT A;  3PUV A;  1SNP A;  2AUJ D;  3A8J E;  3JAM L;  4PMC A;  4R8N A;  1LTI D;  4A3B B;  3VA5 A;  2O2L D;  2B8G A;  2L5T A;  2SNM A;  3CRK C;  3E0J A;  1EWC A;  2ZXO A;  3I4N B;  4WRD A;  4UDU C;  1Z47 A;  3HOY B;  5JOB A;  2AWO A;  2F0I A;  1Y8N B;  1LTR D;  4X3U A;  4FF4 A;  3H91 A;  1IKM A;  2CQA A;  3BZD B;  1F9S A;  2FHT A;  1Q1E A;  1SDF A;  4QCL A;  4J6H A;  4JBW A;  3EQL C;  3WOE A;  5KNB A;  4RKL A;  1R4Q B;  4HCE A;  4CGY B;  2NYZ D;  2BE5 D;  2L55 A;  3SEB A;  3D8G A;  3VR3 A;  1EYD A;  1BQQ T;  2IX0 A;  4ODG A;  4TQU S;  1BDO A;  4TSS A;  1BBX C;  4G4K A;  3ZYY X;  1AN8 A;  3S15 B;  1JQY D;  4IFD I;  3NTI A;  3VR6 A;  2JA8 B;  3NXW A;  5CYU A;  5COY A;  5JVH 3;  2K5D A;  1R9T B;  3VR5 A;  3LWU A;  1A15 A;  3A54 A;  4KN4 C;  4ILW A;  1ZEQ X;  3E6Z X;  5D3I B;  2LMC B;  3K5L A;  2IPK D;  2EYL A;  1HUN A;  1JOQ A;  1LTT D;  3SK4 A;  3V96 A;  1V1P A;  2F0V A;  2D9U A;  4QIW B;  5LL6 S;  3SK6 A;  1HFN A;  3TN2 A;  5EPJ A;  3I91 A;  4A3D B;  2O5I C;  2F3V A;  2F0P A;  2RSO A;  3MXN A;  1OO9 B;  2WKC A;  4K2L A;  4ZK9 B;  2MUY A;  3K57 A;  1LLR D;  3MC0 B;  3GTG B;  1ENF A;  3OIQ A;  2F0F A;  1CQV A;  1C48 A;  2RDH A;  2E74 C;  1STN A;  3GTL B;  1CT1 D;  2B2Y A;  5DNF A;  4IUU A;  2A6E D;  3DXJ C;  2PCF B;  3P20 A;  3DWA A;  5LL6 X;  2L11 A;  3NQT A;  3OSO A;  4LJZ C;  2BCO A;  1E2V A;  2JEB I;  4PQX A;  5C6A A;  2BA0 A;  4I7Z C;  3URY A;  3U9S A;  2YU9 B;  1BO0 A;  5TSS A;  4ZKC B;  2A74 C;  3HOW B;  4XDX A;  1RDP D;  3NK9 A;  2OXP A;  4XQQ A;  2B2U A;  3H0G B;  5JAV A;  2HCI A;  3GTQ B;  3RD4 A;  1U4P A;  3M85 A;  4KY7 A;  2R3Z A;  4ZKB B;  4KJO A;  1A3V A;  1HFG A;  1U9R A;  3M7N A;  3A8K E;  4XQN A;  1S5E D;  3X3M A;  1Q1B A;  3TME A;  4NP5 A;  4KV6 A;  4RCN A;  1TU2 B;  2Q8R E;  3TP8 A;  4PMW A;  4DAP A;  3R2T A;  5JEA H;  3FEW X;  4MIU A;  1EY5 A;  4KKT A;  5F2D A;  1XTC D;  4UAI A;  3P1H A;  1MGS A;  1D5M C;  2NWG A;  5BN3 A;  2R93 B;  1EYA A;  5I2X A;  2BOS A;  4L8J A;  2RDG A;  3GV6 A;  4FXD A;  4M1U B;  2L1B A;  2PMZ B;  3VR4 A;  2HQE A;  4OHJ A;  1QWY A;  1E2Z A;  5FO8 B;  4K6L A;  1TVX A;  2PQE A;  1V43 A;  4ID6 A;  1RJT A;  1UEA B;  3FKI B;  3BVG A;  3HG9 A;  1SNM A;  3AU7 A;  2F0L A;  2SDF A;  2F1M A;  4WFN 3;  2VUM B;  4TRD A;  1RCV D;  4IQZ A;  4O42 A;  5EBC A;  3AB9 A;  4PMB A;  5K36 G;  1D5X C;  1IW7 D;  2PPB C;  3D6C A;  3ND8 A;  5NUC A;  1F2M A;  3RMH A;  1Z7T A;  3IAY A;  4XTC S;  1HQM C;  4DA2 A;  3C1F A;  5C4H A;  4RHS A;  1VMP A;  2KVM A;  4XYQ A;  4U67 3;  1BCP D;  3FVQ A;  1SYG A;  5CR3 A;  2RSN A;  5EKI A;  1KAA A;  1SSO A;  3G7L A;  1ZYR D;  4A93 B;  2PZW A;  4DAV A;  3VYR A;  3TP6 A;  2AUK A;  1WTP A;  3L9A X;  3GTO B;  1O7L A;  3X3N A;  3HEJ A;  1SMY D;  4HN7 A;  2PO4 A;  4EGV A;  5IIF A;  4PNY A;  1GUO A;  5IGF A;  1CI3 M;  1STY A;  2EOT A;  4F87 A;  2PZU A;  3OMG A;  4HMI A;  4RGT A;  2JE6 I;  1GXD C;  1H9K A;  1RHP A;  2QKI C;  2Y0S B;  3IKJ A;  1GHK A;  4R8I A;  4J8Q A;  2OT2 A;  2K28 A;  1SYE A;  2F0U A;  4CJ1 B;  1I3Q B;  5D14 A;  3EA6 A;  1NAP A;  2LFN A;  2MP1 A;  3V2T A;  1KAB A;  2Z4H A;  5FO9 B;  2KQ3 A;  5I6W A;  3BDO A;  1BCP B;  1SJH D;  4DFA A;  5DM6 3;  1KLU D;  4ME5 A;  1CZW A;  4L63 B;  1L0X B;  4X3K A;  1SNC A;  2IWH A;  1WD1 A;  1SYF A;  5A2Q L;  3OOC A;  2X6L A;  1KNE A;  3HGB A;  4IFD J;  3FPP A;  1GHJ A;  3OMC A;  3CHB D;  1DM0 B;  2NVT B;  4QF4 A;  4ZYS A;  4K5X A;  1SFO B;  4HCS A;  1PRT D;  1EIG A;  3MWY W;  4ZUJ A;  1UUP A;  1G2T A;  2L9H A;  1JIC A;  3ND9 A;  1II3 A;  2KJX A;  4C3J B;  3MXG A;  3SHL A;  3T56 B;  1S5B D;  1HXY D;  1VCI A;  1SYD A;  1BR9 A;  3QWN A;  2NN6 I;  1I4G A;  1M4V A;  1D6E C;  1U4M A;  4FXG C;  3J7A V;  3I3C A;  2AWN A;  1DOM A;  3NBI A;  3NQI A;  1EY6 A;  5C4X B;  5CV8 A;  1XXG A;  4IUN A;  1EQT A;  3TZU A;  2FMM A;  5C5L A;  3S1R B;  4QUF A;  2B63 B;  1IL8 A;  1LT6 D;  1EEI D;  1B44 D;  2IX3 A;  2E2I B;  3KF8 A;  1D2B A;  1R4P B;  2AQ1 B;  4B9X A;  2EYF A;  3K7A B;  1ILQ A;  1JWS D;  3T53 B;  3J7Y W;  2NB0 A;  2XNA C;  1PRT B;  1ZKO A;  2K5W A;  3D3R A;  3NPP A;  4EQP A;  1CK1 A;  1OXU A;  1VMC A;  1LV9 A;  1D1I A;  3BG3 A;  5ELD A;  2AQ2 B;  4KY5 A;  1STE A;  2EJF C;  5HUR A;  3DM1 A;  1DZ1 A;  3S16 B;  1B53 A;  3S1Q B;  2A69 C;  1D1K A;  2HUG A;  2VNU D;  2KED A;  1FYC A;  3OPO A;  2RA4 A;  4HSP A;  5IGE A;  2KOL A;  1AP0 A;  1PTO H;  3S9W A;  1KTK A;  1QNK A;  2EE1 A;  1IYV A;  2E2H B;  4KD4 A;  3IFT A;  5IOC A;  2F0N A;  4EQN A;  3M4Y A;  3QIA A;  2MJ8 A;  1Q3L A;  5AFW A;  1F2Z A;  1EWH A;  2Z8L A;  3QO2 A;  3J81 E;  3IFD A;  2O5J C;  4JK1 C;  2E75 C;  1SE4 A;  3A55 A;  3G6J B;  4DNT B;  4BBS B;  1O78 A;  2RKS A;  4LAA A;  1KDC A;  5T1G A;  1STA A;  2A6E C;  3Q24 A;  2ICE C;  2R92 B;  5LHY 1;  2WP8 J;  1EZ8 A;  1F9P A;  3DWQ A;  2EY1 A;  4O1N A;  4KHV A;  4XT1 B;  3HOX B;  1WD0 A;  1NR4 A;  3J81 L;  1O80 A;  4N9T A;  3C3L A;  2Q8T A;  5KND A;  3I70 A;  5IGB A;  5K5P A;  1ENC A;  3D4R A;  4C3H G;  1SBB B;  3PMF A;  1AW7 A;  4K5W A;  2IL8 A;  2VXW A;  3Q23 A;  5I4D A;  2SNS A;  2JP1 A;  2RDF A;  2KEE A;  4CHT B;  1PDQ A;  1CFM A;  2NVY B;  4KD3 A;  3MA2 B;  1KLG D;  2HCC A;  1OXT A;  3MXU A;  3MXP A;  5BN5 A;  3BYT B;  3A7L A;  2L4N A;  4QUC A;  5KEE A;  1V1P B;  2N88 A;  4N9P A;  1J8I A;  1PTO D;  2LKV A;  3VYS A;  2H1E A;  3PO2 B;  2F0H A;  4K8I A;  1QE6 A;  1DOK A;  2F4I A;  1QJO A;  1HTL D;  5T1I A;  3DEO A;  4DF7 A;  4KI0 A;  1SJE D;  1PFN A;  5EKL A;  5EGT A;  2AQ3 B;  1F2L A;  2RVL A;  4IUV A;  4F8M A;  1O7Y A;  1S5D D;  3C2P A;  1G91 A;  2IT1 A;  3OW7 A;  5KNC A;  1GOZ A;  5M9O A;  3VYT A;  4IUR A;  2A73 B;  4HAE A;  4A3M B;  4CKC A;  2O4X A;  3N52 A;  4IFD G;  1I50 B;  4RGN A;  1I4R A;  1FR3 A;  4CKB A;  4KN7 C;  3HKZ B;  1WTX A;  2K6A A;  4H13 C;  2EXZ A;  1DXM A;  1TWF B;  3TBI B;  1STG A;  2IJ0 A;  2DNC A;  1PTO B;  4FF3 A;  3C46 A;  3N6R A;  3DWP A;  4KTA A;  4OO1 I;  1EY0 A;  3QJY A;  4XQJ A;  3WOF A;  2H4O A;  2TMP A;  4DAY A;  4OO1 H;  2WV6 D;  1Y8P B;  2C9O A;  2J7Z A;  4RKB A;  1BNZ A;  1EY8 A;  4XXE A;  4HSV A;  2NVX B;  4U68 A;  5FO7 B;  4C1N I;  4HED A;  3GQB A;  4H7B A;  2G9D A;  5KYL A;  1BCP F;  2JSO A;  4K5V A;  5CGK A;  4XYO A;  1PLF A;  3GTJ B;  1Y1W B;  1RTN A;  1A2T A;  1FGB D;  2XWB B;  3S17 B;  4RGO S;  4OIK A;  1TWA B;  5IGD A;  2K32 A;  1QB5 D;  2D62 A;  1JC7 A;  1TS4 A;  1I6H B;  1E0B A;  2M2L A;  3P75 A;  2SEB D;  3CU7 A;  1TY0 A;  2L12 A;  1GUT A;  2JXM B;  2JA7 B;  2ICI A;  3OWE B;  2PW7 A;  1Q12 A;  1K8O A;  1WTQ A;  3MAQ A;  4C3I G;  1RTO A;  3MVV A;  1ML0 D;  3M3Y B;  1UNS A;  1YNN C;  2EYM A;  3W3A A;  1H9M A;  3J7A F;  1STH A;  1ICW A;  4B9W A;  2PZT A;  1FNV A;  2A6H D;  5KYI A;  3K59 A;  2PNR C;  1GUG A;  2EYP A;  1SYC A;  1QOH A;  3I90 A;  2M9V A;  1EYC A;  4R9W A;  4C2M B;  2NBF A;  2IW3 A;  3KK7 A;  2R7Z B;  2R61 A;  4ZAI A;  4BY7 B;  3T16 A;  3S2D B;  1EL0 A;  3R3O A;  5EKK A;  2E76 C;  4A3I B;  1LTG D;  2QIL A;  1SE2 A;  4C3J G;  1WTV A;  1G6Z A;  5JEA G;  1PRT F;  1TS2 A;  3A7A B;  2CW0 C;  3EVQ A;  4DGZ A;  1MD2 D;  2BDO A;  2EZV A;  3T4A C;  1EY9 A;  4KKU A;  1HPC A;  3GO5 A;  3HS0 C;  3PUY A;  1DJR D;  2K33 A;  4KHZ A;  3I72 A;  4CJ2 C;  1X3Q A;  2L0C A;  2B2T A;  2F0O A;  4HMJ A;  1K83 B;  3KBG A;  5M3F B;  1PZK D;  2Z4I A;  1CA5 A;  1B9M A;  4DN4 M;  2K01 A;  4DNR B;  2WAQ B;  4RWS C;  5KGU A;  5E4W C;  1L0Y B;  4B08 A;  1EQV A;  4NDX A;  1EY7 A;  1EY4 A;  2B2V C;  5CV7 A;  1XX8 A;  3M7G A;  4RFB A;  3LX0 A;  5C0X I;  1EIH A;  1MI2 A;  4FNF A;  1CHP D;  3MFY A;  4J1M A;  5C0X H;  3RUZ A;  1G8Z D;  1EU3 A;  3Q22 A;  2XRS D;  1WTW A;  5CV5 A;  3QOJ A;  4YIJ A;  1BUV T;  2A68 C;  1A3T A;  3M4O B;  4G7H C;  3HRZ C;  4IAL A;  3K5O A;  4EQO A;  2K04 A;  4NMZ A;  5M5Y B;  3GP7 A;  5I6Y A;  4FP5 D;  5D3D A;  1S5F D;  1HA6 A;  1Y8O B;  2EJG C;  3TP7 A;  5J1Z A;  2OEO A;  4OL7 A;  3K5M A;  4AYB B;  1H9J A;  3RZD B;  1S5C D;  1UAP A;  1BXT A;  4TKO B;  3KLS X;  1CQF A;  5JPN C;  1W6K A;  2Z1C A;  4FO2 A;  1AZP A;  5D65 A;  4H44 C;  5ELF A;  1LTA D;  5IOD A;  1JOR A;  1Q8I A;  2EYH A;  1VDZ A;  2WAC A;  1LT5 D;  1H9S A;  5JVG 3;  1AFP A;  3KLS A;  2B8F A;  4E6I A;  3S1N B;  1B50 A;  4KJN A;  1PMR A;  1DD2 A;  3FRP B;  2ENB A;  5ELE A;  2RBM A;  3TDQ A;  1QNU A;  4X3T A;  4DXG A;  5DAU A;  4C1N K;  3SK5 A;  3H3V C;  2F0Q A;  4L6T B;  4ZRZ A;  2BE5 C;  5E3F A;  1I4P A;  4WJW A;  3K5N A;  3VA7 A;  3W2D A;  1U4R A;  2B39 A;  4RCO A;  3MTS A;  4QMG A;  2LS0 1;  4KMU C;  3KLR A;  2EYJ A;  5BN4 A;  5CBE E;  1ESR A;  1YNJ D;  3OIP A;  3NSW A;  1VF7 A;  4ULL A;  4FXK C;  5KRU A;  3NE5 B;  2V4D A;  3SVM A;  4I65 A;  2EPB A;  4PV1 C;  3HP3 A;  3I4L A;  1D5Z C;  1CTM A;  5IGC A;  2C5C A;  3KUP A;  2K03 A;  4A3G B;  1TII D;  3NTH A;  2NN6 G;  3DMU A;  2HDL A;  5J22 A;  3ERQ A;  2F0G A;  3L7Z C;  1I4Q A;  2DY7 A;  1XYI A;  1AEX A;  2F0T A;  1K8M A;  4V19 0;  1I4X A;  2SOB A;  1C8C A;  3ONA B;  2E2D C;  3S2H B;  3O13 A;  3TZD A;  1PTO F;  4BS9 A;  3BVM A;  2MGS A;  3ITP A;  2ZXR A;  1GUS A;  1ILP A;  5I9P A;  1PYW D;  3P7J A;  1HRJ A;  5ELC A;  4BWG B;  3HOV B;  2EY6 A;  2QF7 A;  5C4Z A;  2B2W C;  4RA8 A;  2QCP X;  3OWF A;  2OF1 A;  4LMQ D;  4BBR B;  1TKW B;  2J4X A;  3H6M A;  5CV6 A;  3TP5 A;  2R6G A;  5DM7 3;  4Q5V A;  3QB3 A;  3EJI A;  4M8A A;  2BA1 A;  5J39 A;  5JEA J;  3J80 E;  1EZ6 A;  2NTT A;  1LO5 D;  1PFB A;  3NTK A;  1O7Z A;  4FF2 A;  2XIW A;  3U9O A;  2EJM A;  1TWH B;  1S4Z A;  3D4W A;  2VB3 X;  1ROD A;  1DON A;  1LAB A;  2EYO A;  4OGQ C;  4DK1 A;  2XVS A;  2Q8I B;  4Y7N B;  3OHX C;  4S3S A;  2NTS A;  3PIO 3;  3DHQ A;  2B2V A;  4K6D A;  5M5X B;  5M5W B;  4RHR A;  2TSS A;  5M3M B;  5FLX E;  1LTB D;  3UI2 A;  3IL8 A;  4ZUI A;  4FYD A;  3J80 L;  3R93 A;  1FNW A;  4IUT A;  2XRQ D;  3K58 A;  1TQO A;  4IN3 A;  3QOL A;  2NZ1 D;  3PUW A;  1SNQ A;  2K1B A;  1NUC A;  4IFD H;  1EOT A;  3Q6S A;  5G3L D;  4A3F B;  1NSN S;  2B2T C;  5C3X A;  3GTM B;  1U4L A;  2I46 A;  2K05 A;  5FLX L;  1ENA A;  1V1O A;  2A69 D;  1I4H A;  3CRL C;  3D6W A;  5E1F A;  4K14 A;  3D4D A;  1X3P A;  5JJZ A;  5EPL A;  4BA2 I;  5IT9 E;  1OXX K;  1HA5 A;  1IYU A;  2CVR A;  4H0L C;  4C56 C;  1A3U A;  3MFG A;  1BF4 A;  1PFM A;  2X69 A;  4IUP A;  3NWT A;  3DUZ A;  2WB1 B;  2A6H C;  3S14 B;  4RH6 A;  1RF2 D;  3BYY B;  1KDA A;  4KY6 A;  1ONL A;  3K6O A;  1STB A;  3EFX D;  1B9N A;  2KA7 A;  3A56 A;  3FPU B;  1JWM D;  2VB2 X;  4P2C B;  5C0X J;  1IKL A;  2F0E A;  4FVM A;  1HUM A;  5IT9 L;  5I9O A;  1B2T A;  2J0T D;  2G9H D;  1IW7 C;  5FK9 C;  3SE0 A;  3T13 A;  5C3W A;  1JB3 A;  1Y1V B;  3V05 A;  3R2I A;  4G7O C;  3VR2 A;  1BCP C;  4A3K B;  1SNO A;  4IZ8 A;  3PV0 A;  5CV4 A;  2F0M A;  3SR1 A;  3TSS A;  3Q0A A;  1V8Q A;  4WOR A;  4NW2 A;  4F7X A;  3NHH A;  1ZYR C;  5EQ0 A;  3R8B A;  1TR5 A;  1DYQ A;  4G57 A;  4C3H B;  1KNA A;  1MSG A;  1LTS D;  4MN3 A;  3MZ5 A;  2KHS A;  1SMY C;  2NUC A;  2EDG A;  2K5Q A;  1F77 A;  3GV3 A;  3SK8 A;  2EY2 A;  1W6J A;  1A2U A;  5C3E B;  1QCB D;  4ZQ3 A;  2JA5 B;  4OIJ A;  5K36 H;  1JE4 A;  2RQX A;  2B2W A;  4K2K A;  1T5X D;  3CKI B;  1WTO A;  1AZQ A;  4OO1 G;  2F0K A;  1XWE A;  3MEH A;  4V0B A;  1SXT A;  4LK1 C;  2F0J A;  1ESF A;  1TY2 A;  1EU4 A;  2EY5 A;  3LWE A;  1GUW A;  1H9R A;  1EFI D;  3RLF A;  2JA6 B;  3K0Y A;  5EBD A;  5ISR A;  1CZG A;  1PXU A;  1TWC B;  1CHQ D;  4FF1 A;  5ELB A;  5C5M A;  5C4J B;  3RZO B;  1PRT C;  3BVZ A;  3A8I E;  1ET6 A;  2F0S A;  3PO3 B;  1LAC A;  2CHB D;  3H09 A;  2D2C C;  1JWU D;  1TS5 A;  1GJX A;  4NKL A;  4Z9C B;  5FKA C;  2WKD A;  1DCZ A;  1ET9 A;  2DNE A;  4KKS A;  4HTH A;  5CBA E;  1B4O A;  5HGT A;  4XIG S;  2QEJ C;  1KDB A;  5EJW A;  2M00 A;  4MHE A;  1Y69 U;  1SND A;  4XT3 B;  2LY7 A;  4DU9 A;  4F88 A;  4CKE A;  1MBY A;  2FFK B;  2X6G A;  1X32 A;  3KBX A;  3FDT A;  1F9R A;  3HOZ B;  3GTK B;  4K8J A;  1WVL A;  1IHZ A;  1LT3 D;  5C44 B;  1Q90 A;  4RAU C;  2A5H A;  4CBV A;  3PUX A;  1C4Q A;  3NUC A;  2FIN B;  5A2Q E;  1JOO A;  2ID0 A;  5A35 A;  1YNJ C;  4Q0F A;  1CA6 A;  2I07 B;  2XN9 C;  3PIP 3;  1TT2 A;  3D31 A;  1B1Z A;  1LT4 D;  2BDN A;  5EPK A;  2HDM A;  1FNU A;  1QIL A;  1Z6H A;  4C3I B;  3HOU B;  1YNN D;  2JEA I;  4QB4 A;  4ABN A;  3NWS A;  4DXF A;  1HHV A;  4RGM A;  5IGG A;  1JCK B;  2E2J B;  2KCN A;  2F0D A;  2N55 A;  1F9Q A;  1FD7 D;  3C1E A;  4ZLT F;  2YYZ A;  1I6V C;  2IX1 A;  1PZJ D;  3H94 A;  1WTR A;  1H9S B;  1SAP A;  1HQR D;  1JR0 D;  2XSC A;  1J9O A;  3I4M B;  3GD7 A;  3BS1 A;  1A6X A;  2MHV A;  1MSH A;  4BA1 I;  4IUQ A;  1RD9 D;  3HZX A;  3NP8 A;  5E4X A;  4HR7 B;  1SEB D;  2EVB A;  1GUN A;  1M8A A;  1WCM B;  5KIX A;  2MPM A;  5C0X G;  1NR2 A;  3I73 A;  3CQZ B;  3BDL A;  1SE3 A;  3GTP B;  2QDB A;  2KCC A;  2DY8 A;  4BY1 B;  4A3J B;  1TWG B;  1G29 1;  2XWJ B;  3PUZ A;  2CW0 D;  3I8Z A;  2JYO A;  1VF5 C;  1OXS C;  3E5S A;  2D5D A;  1JOK A;  1DOL A;  5DEH A;  3DEP A;  2ZT9 C;  2NN6 H;  2FMC A;  3F2U A;  1SYB A;  2F3W A;  2B2Y C;  4A3E B;  1T5E A;  1CM9 A;  2F0W A;  1BOS A;  3FMC A;  1EEF D;  1HCZ A;  5JPM C;  2GA4 B;  3BDC A;  4EVO A;  5CC4 A;  2FJ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...