1WTQA

Hyperthermophile chromosomal protein sac7d single mutant m29f in complex with dna gtaattac
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
b'VKVKFKYKGEEKEVDTSKIKKVWRVGKFVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*AP*AP*TP*TP*AP*C)-3'
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna binding protein/dna
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wtqA00
1ML0D 2H1EA 1F9PA 1AP0A 1HFNA 1B50A 4MN3A 4ZAIA 1DONA 1DOLA 1CA5A 1WTOA 4MHEA 5CORA 2B2WC 2HCCA 2MJ8A 2X6LA 4IUQA 1PFMA 2B2UA 5EQ0A 1G2SA 2XIWA 1WTRA 2N88A 1WTVA 1J9OA 1IL8A 5D14A 1O7ZA 2B2VA 2DY8A 4HAEA 1LV9A 2K05A 1VMCA 4ZKCB 4HCSA 1X3QA 4ZKBB 3N52A 2NZ1D 4OIKA 2MPMA 2M2LA 1HUNA 4X3SA 1HHVA 1IKLA 2K01A 3P7JA 2RSOA 5CMDA 2NWGA 2FFKB 4ZLTF 3H91A 5EPJA 1WTXA 1F2LA 1U4LA 2L12A 1WTPA 5CBAE 3IFDA 1E0BA 2B2TA 3GV6A 4RAUC 2K28A 1HUMA 3KBXA 1SSOA 2X69A 3IL8A 1SDFA 2X6GA 1NR2A 1TVXA 1HFGA 1O80A 1RHPA 2Q8RE 2L9HA 2RSNA 4XDXA 2EE1A 1BNZA 3TN2A 3DM1A 4UAIA 2CVRA 4HSVA 1KNAA 2MP1A 1PFBA 2VXWA 3Q6SA 2N55A 1U4MA 1VMPA 5T1IA 1O7YA 4XT3B 1NCVA 3R93A 1RTNA 3I8ZA 1DOKA 3F2UA 5D65A 4R9WA 1MI2A 2SDFA 2RA4A 1ILPA 3I90A 1SAPA 1G2TA 5E4XA 2KVMA 1CM9A 1B4OA 1PDQA 1WD1A 1JE4A 1S4ZA 2B2YA 3KUPA 4CJ2C 1WTWA 1EOTA 1ILQA 1BF4A 1X32A 5T1GA 4CJ0B 4X3TA 1U4RA 1NR4A 3SVMA 4O42A 1Q3LA 3LWEA 3FPUB 1KNEA 2B2WA 2KECA 1A15A 2FINB 1F9RA 2KEEA 1X3PA 2JP1A 4U68A 4R8IA 2B2UC 1WD0A 1B3AA 1JICA 2R3ZA 4HEDA 2K1BA 1BBXC 1G6ZA 5JJZA 1DOMA 2B2VC 1EL0A 1ICWA 1PLFA 2EPBA 1DZ1A 1U4PA 1ZXTA 4QUCA 4DN4M 2K04A 2KOLA 2FMMA 5COYA 4ZK9B 1ESRA 1RJTA 1XX8A 2D9UA 1QE6A 3GV3A 3MTSA 2L4NA 4RWSC 1EQTA 2FJ2A 2EOTA 3G7LA 1B53A 2IL8A 2HDMA 2B2TC 1WTQA 2NYZD 3QO2A 4IUTA 4IURA 3UI2A 1J8IA 1M8AA 1HA6A 1WVLA 1G91A 1XYIA 1MSGA 3D6WA 1MGSA 2HUGA 1F9SA 2Q8TA 1HRJA 5DNFA 1RTOA 4QUFA 3DEPA 4IUPA 2RVLA 1IKMA 1F9QA 1PFNA 1RODA 5CBEE 1GUWA 2HCIA 3FDTA 3TZDA 1B2TA 5EKIA 3I91A 4LMQD 4CJ1B 3I3CA 2FHTA 2L1BA 1BO0A 2HDLA 3HP3A 3ONAB 1MSHA 4NW2A 1QNKA 2L11A 1EIHA 2MGSA 4X3UA 3DEOA 5AFWA 2K03A 1EIGA 2DY7A 2J7ZA 2JYOA 2KEDA 4IUUA 4X3KA 5E4WC 4OIJA 5EJWA 5EPKA 4XT1B 1QG7A 4IUVA 3MWYW 4RA8A 2BDNA 1AZPA 1NAPA 1AZQA 5EPLA 2KUMA 1C8CA 1CA6A 2B2YC
chains in the Genus database with same CATH superfamily
2I5MX 2Q2TA 5GQOA 2UUCL 5JEAG 1PVOA 3I4NH 1CZGA 2B2WC 1HTPA 1FNVA 3HRZC 2XIWA 4DNRB 3A0JA 4RCOA 5IYCG 1VMCA 3H09A 4OIKA 4A3BH 4Y52H 4DR5L 3SK5A 1GUGA 1ZKOA 2NTTA 4L5TA 3GV6A 2WINB 1N32Q 1PV4A 1WYDA 1H9RA 1HNXL 1E2VA 1VQCA 3SK6A 5FOBB 4POGA 2RHSB 3LX0A 5JEAJ 2H4OA 1F2MA 5M5XB 2ZJPA 4LF9Q 3HOZH 1BDOA 3VR5A 3T56B 1B7YB 5KNDA 3NBHB 4HIOA 1PRTD 2MUYA 3DHQA 5FK9C 2IWHA 2PNRC 3VA7A 4APVA 1N8RC 2VL6A 5EAYA 2JA8H 4JI1L 1HR0W 2OWOA 1LTBD 2EZVA 1QJOA 4PMBA 2JJQA 1Y14B 5C3WA 1HZ9A 1TKWB 4FF4A 2K33A 3HOVG 5JPMC 4LFBQ 4DR7L 4A3JB 1STBA 1EQTA 3FKIB 4B3RQ 1CQFA 1J8IA 4JCVE 4DV1Q 3CPFA 3NELA 3VR2A 4PG3A 4EQ5A 2ATWA 4DKAC 3UE0A 2HIXA 3U4ZA 1DXMA 1M4VA 2F3IA 3I91A 4R4CA 5HGTA 3M3YB 1PYBA 2L1BA 3TZUA 4H02A 5IWAQ 1EIHA 5LMNW 2Q2UA 1VCIA 3LNNA 2O4XA 1EIGA 1EWCA 4DV3L 1S72A 5GAEC 4O0AA 1CHQD 3MFYA 1W6KA 4RA8A 4DAPA 1ICFB 2DGYA 4LJZC 4DR4L 1Z47A 1EQRA 1TR5A 4C1NI 5EBCA 1K3RA 1AN8A 1DOLA 2IHEA 3NEMA 3PUZA 4LUOA 3CC7A 4FF2A 5ISRA 5C4HA 2B2UA 4IN3A 3CU7A 5C4XH 1J9OA 5J39A 1EIFA 3NQTA 1MBYA 1SYDA 3ZJYC 3LGJA 1XTDA 4X3SA 3ULJA 1D1IA 3VA5A 1PTOH 2NWGA 1XNQL 2F0OA 2B2TA 1KQSA 4C3JH 3MEFA 1QUQB 4V0BA 1LTRD 2X6GA 5DLQE 1VQ5A 1I4HA 2GVAA 1BNZA 3TN2A 4LF6L 4EQPA 2K7VA 5IGGA 1JT8A 4LF4Q 1JJGA 2KBNA 2VXWA 1L2FA 5BN5A 3S2DB 2F4VL 1QVGA 3HOVB 2BA1A 1E3PA 3R93A 3GTKH 3I8ZA 4DV6Q 1GHKA 2IPKD 1PDQA 1RCVD 2K14A 2ALYB 2VZAA 1ILQA 1MJEA 5T1GA 2E5LL 1EY7A 3CCLA 5H1SE 5C4ZA 4BY7G 2BOSA 3J7AV 4DU9A 4JI2L 2FINB 2EY5A 1TT2A 2IT1A 4QMGA 1C0AA 3CMEA 4QL5A 5IYDH 1VQNA 2F0EA 2E2HH 4K5WA 1YVCA 1ZXTA 2M9VA 1ZEQX 5EBDA 2A68C 5I2XA 5IT9E 4P72A 2ID0A 3ND8A 4DR2L 3FMCA 2ES2A 5I6YA 1F77A 3G7LA 3H3VI 1YHBA 3R2TA 4FNFA 1WVLA 2WB1E 3A5UA 1QZHA 1F9SA 3S17H 2BDOA 2UUBL 1HNWL 1K83B 3FVQA 1F9QA 1TWFB 4OELB 4LFCQ 5J22A 5LMUL 2QKIC 1ASZA 1JOOA 2E75C 1PA6A 1I4QA 3DM3A 3AU7A 4GOPA 4NW2A 1A2TA 1QOHA 2F4IA 1QNKA 1IZ6A 1SJED 2EYPA 4DV7L 1YEZA 4K5XA 2JA5B 1MD2D 3TDQA 3GP7A 4QF4A 1YI2A 1AZPA 1S5FD 2KUMA 2C35B 2PI2E 4XTCS 2UXBL 4NXNL 2ICIA 4G4KA 5JVH3 1AP0A 4C56C 1KAAA 1NNXA 1WTOA 3GDEA 1GD7A 3KJOA 3CCMA 4IPGA 4CDEC 2WAQE 3VDYA 4A3FH 3A8IE 1A3VA 5IGEA 3ULPA 1R9TB 2F3VA 1Q1BA 1TWAB 1ENFA 1VQBA 3IFDA 2K75A 4TVAB 3SK8A 4BY7B 2PQEA 1L1OC 2R93G 1RHPA 3QG1A 4XDXA 1M1KC 3S16H 1LTAD 4YCWA 4LUVA 2K4KA 3NBHA 3S2HB 1I4XA 3OW2A 1N33L 4JI0Q 4DR6Q 1BKBA 3D0FA 3T13A 5CV7A 2PW7A 2YU9H 3BVGA 4NXML 3NTKA 4L6TB 2FMCA 2JK8A 2A68D 4PMWA 4RGOS 1UE7A 3V96A 2BCOA 2AUJD 4L5SA 1IHZA 1X32A 1BBUA 1AEXA 4B9XA 1KNEA 3G6EA 1KDAA 4KLKA 3MXUA 1GUSA 1X3PA 3S1MH 1L0WA 3J81i 1PH5A 5JOBA 1ICWA 4MTNA 3K8AA 1FJGQ 2OEOA 2K04A 2KOLA 4C3IG 2RKSA 4RWSC 1LT4D 2F0MA 3Q8DA 4R4TA 3BYYB 2HDMA 2WKCA 3MHBA 4IURA 1EYGA 4OWXB 3RMHA 4DUZQ 4BWGB 2HUGA 2CFMA 3BDOA 1S3OA 2ZM6L 4EVOA 5A2QL 1GUWA 3U50C 5FLMH 3UDXA 4A93G 4Z9CB 4A3MH 5IGFA 5FKAC 1EY5A 1SMXA 2QA4A 1UE6A 3TQYA 3T1YQ 2EVBA 1SE2A 3DEOA 1SYEA 2J4XA 3T51B 3ERSX 4GKJQ 1EU4A 2WACA 4YY3L 3BG3A 2Z0SA 1YNXA 4ZCKA 3PIOA 2R93B 4RMFA 4ZAIA 4DXFA 5C0XI 4RGTA 2UU9L 3K5MA 2HCCA 4IUQA 1XNRQ 2EY1A 4OX9L 3SEBA 1FGUA 2K05A 3KLWA 1W6JA 5HGQA 4JK1C 3KDFB 3P7JA 1JMCA 5ELBA 3OW7A 4UP8A 1WTPA 2YYZA 5HY6A 3M85A 3NHHA 2KQ3A 3S1QB 1OXTA 2XRQD 2VQEL 1HFGA 3HOWG 1BR9A 4RGNA 1PYWD 4R4OA 2A6HC 3TEHB 1E22A 4G57A 1JCKB 2A69C 3RLOA 1OTCA 5C0XG 5JAVA 1U4MA 2WB1G 1LT3D 5BN4A 2MNAA 1HR0L 2JEAI 3RLNA 4R9WA 1SAPA 3RN2A 5IGCA 2YTXA 2VUMH 1JE4A 4BBSG 1HTLD 1NMFA 3PSIA 4J15A 2VNUD 1NY4A 4QJFA 3L9AX 3FPUB 1I6VC 1I94Q 1LTLA 4B3SL 1YJWA 4U68A 3M7NA 4A93B 1B3AA 2ZXOA 4AQYL 1BBXC 4EGVA 5AJ3L 4LFAL 1X3EA 3KFUA 3RR5A 1K3BC 3W1GA 3K5OA 1JQYD 4G7HC 4K8JA 1IYJB 1EOVA 1RF2D 5C4JB 3KJPA 1E1OA 4GN4B 2VQFQ 2PO4A 2WAQG 5LMNL 1MSGA 2SNSA 3MEHA 5IYBG 2WV6D 3GTGB 4V190 2LXJA 3E3XA 3OTOL 4LWCA 3AQQA 1CQVA 1TY0A 2F0UA 1HQRD 4KMUC 1P8LA 2ZTEA 2EY6A 4G7ZC 4A3EH 1BO0A 4LAAA 5C3EH 4FYDA 4X6AH 1JWMD 3HOXG 1B1ZA 2D5DA 1YHAA 2LKVA 4LUZA 3HOYG 1BBWA 3MWYW 3PO3H 4IPHA 2OXPA 2B2YC 4FXGC 4UDUC 1F2ZA 3NENA 3HOWB 3G48A 3BS1A 1D1KA 3OSOA 1CA5A 4U673 3EBEA 1PZKD 2N88A 1WTVA 3RN5A 1O7IA 1TWHB 1O7ZA 1KAWA 4HTHA 1MHWC 4HCSA 5TSSA 2WB1B 4ZKBB 5LL6X 1H9MA 1BCPC 5CV6A 2A6HD 4OO1H 2A69D 2EYOA 1X3GA 3GD7A 4BBSB 2L12A 4DV2L 1E0BA 1Y1VH 3RD4A 4DXGA 4KN7C 2F0WA 4X66L 1GJXA 3TP5A 2X69A 5IP7G 3DXJC 4GKKQ 1TVXA 2K52A 2K5NA 2SOBA 2RSNA 3OMGA 3MXNB 5M5XH 1YNJC 4O1NA 4OXPA 2ZJQA 1GUNA 3EA6A 5IP9G 3KLRA 4KK7A 1SMYD 2IX0A 3K81C 1ILPA 1GM5A 1E1TA 2WAQB 2JXMB 3MFGA 5M3MG 2QEXA 1G8ZD 2QDBA 4FXDA 1I50H 4N9TA 2WFWA 3Q22A 2BH2A 3GTJH 2TMPA 1TU2B 1STEA 1WTHA 2NVYH 3VYUA 3M7GA 1SE4A 3PO2G 1JC7A 3U9SA 1Y1WG 1VF7A 1CUKA 3GTMB 4IJLA 4A3JH 1IW7C 3MA2B 3HOYB 3FKIH 1TWGB 3QB3A 1XMQQ 3B6YA 1LTTD 2EOTA 1ENCA 2NYZD 5JEAH 3CCQA 2B63G 3BZCA 2EXZA 5HURA 1W2BA 1TS2A 3ZYYX 2XWJB 1XMOL 4A3GH 5IYCH 3TZDA 4NP5A 1VQMA 2RCFA 1X55A 2R61A 3M9BA 2EJGC 4GNXC 1O7LA 1EEFD 5AFWA 2KEDA 4FP5D 1KXLA 1W3SA 1VF5C 4YCVA 1BCPD 2UXDL 1KIXA 3HKSA 4KKTA 3D4WA 4C3HG 3PF5A 4KY5A 1C7YA 4KHPQ 2XWBB 4X64L 1HFNA 1DJRD 2X6LA 1PFMA 4FXKC 3EVQA 1SYBA 2EY2A 1PHJA 2B2VA 4HAEA 5D3IB 1QCBD 1D5XC 3CHBD 5FLXL 1HXYD 2EQSA 1HZCA 3KDFA 3M4OB 1YNJD 4JC0A 1LLRD 1PZID 1WTXA 3X3MA 4LF8L 5M3MB 2KA7A 3GTLH 2E8GA 2SNMA 2V1CC 3H94A 1SDFA 2GVBA 5M5WB 4CDFC 2UUCQ 3I4MG 4CKCA 5IE8A 3I70A 1G6PA 4CDCC 4YWMA 4TQUS 3I55A 2VW9A 3S2DH 3PO2B 3HOVH 4IUNA 1Y1WB 1VMPA 1PYSB 1B9NA 2MQHA 1IYVA 4DR5Q 4NDXA 1Q12A 3E0JA 5E7NA 1VQLA 2B63B 4WJ4A 1EOTA 3I4OA 2XRSD 4B3TL 2JA7G 4IQZA 1TIID 3RUZA 2D2CC 4CKEA 1HNXQ 5C3XA 5KRUA 3S1RH 1GO3E 1F9RA 3DWAA 2JP1A 4R8IA 5E1FA 2F0JA 1M90C 1STAA 2ENBA 5JJZA 1IBKL 3DWQA 1BUVT 1X65A 1PH6A 4BA1I 3Q24A 4LF5L 4I7AA 4ID6A 1TQOA 2EJFC 2J0TD 1A63A 2JN4A 1FNUA 3M4YA 4JI7L 2EYMA 2R92G 2FJ2A 1RKNA 4C3HB 5GAHC 3TP6A 1JJCB 1PMRA 3J81c 3D6WA 1GXDC 1MGSA 1VQ7A 2HD3A 1YIJA 1TWFH 2R7ZG 2E74C 1IKMA 4JI1Q 1CFMA 3S1NB 1V43A 3RZDH 3K5LA 5CBEE 2HCIA 5DEHA 5JJIA 4JBMA 4AYBE 5ELCA 2E2IB 2Y0SE 2JE6I 4DR7Q 1HCZA 1Y8OB 1YZ6A 5KIXA 5C44G 2BDNA 1ENAA 1NAPA 2OT2A 1N36L 2H1EA 2BH8A 1VQ9A 3V2TA 1CKOA 3I4MB 4B08A 4KKSA 1PFSA 2L55A 5EQ0A 2F0KA 3I4NG 2K5WA 1KRSA 3HS0C 3HFZB 3T53B 1B70B 4XYQA 1YJ9A 2CW0C 3GTQB 1TWAH 2ZT9C 3A56A 1S5CD 5CV4A 2R7DA 2A8VA 2FFKB 4DV3Q 3CCSA 2PCFB 1QB5D 2EIFA 1BXTA 1SR3A 2JA7B 4BY7H 1A3UA 3ERQA 1K0SA 1SNMA 3A5ZB 1CK1A 3MXNA 4DR4Q 1DM0B 4JI4L 2L9HA 2PI2A 1DGSA 3NUCA 5ELDA 1JR0D 2CVRA 3URYA 1KNAA 3WDNA 4FVMA 3S2HH 3AFPA 2OQ0A 3Q6SA 2KCMA 3FRPB 3BVMA 4Q0FA 2BE5C 3HOZG 4XQQA 4LF7L 2RA4A 2R92B 3D31A 4TSSA 5KNCA 4MZ9A 1XPOA 1XNQQ 4X62L 1EYDA 3I73A 2JA5G 3S15B 2R7ZB 1Z6HA 2B3GA 3DLLA 5LL6S 1S5DD 2JQOA 5DM63 4LF6Q 2KHSA 4RHRA 1O78A 4Y7NB 4JI8L 5M5YB 2GN5A 1PLFA 2F4VQ 3ITPA 5DM73 1H95A 1U4PA 1C9OA 3OOCA 4ODGA 3HOUB 4JYAL 5C44B 3A54A 3QR8A 4JI6L 2NN6I 1HNZL 2KCCA 5M3FG 3H3VH 2QDLA 4X65L 4AH6A 2E5LQ 5DNFA 2YTYA 2RVLA 3I4NB 1WFQA 4JI2Q 4JOIC 4QCLA 4L63B 2NBFA 3HP3A 4TKOB 4N8FA 1MSHA 4KJNA 2ICEC 4B9WA 1YBYA 4X3UA 1NBWA 3FHWA 3Q0AA 1UAPA 2Z6KC 2TSSA 2CW0D 2ZTCA 4DR2Q 4K0KL 3NK9A 2CQAA 1C8CA 1IL2A 3R8BA 5K36G 1G291 1JJ2A 4A3LG 1WOCA 2UUBQ 2NN6G 1HNWQ 5J1ZA 1IL8A 2Z8LA 3ND9A 5LMUQ 2KENA 1GUOA 1HUNA 2D0OA 3HOZB 1SXTA 2YV5A 4EQOA 5G3LF 2DNEA 4A3CG 1SROA 4DV7Q 2B39A 3D6CA 4DV5L 3GTPH 2KHIA 2DN8A 2BE5D 4GLXA 3A55A 3ICEA 4HMIA 2AKWB 3HG9A 3HKZE 3CCVA 4AIMA 2UXBQ 1PH4A 1Q1EA 4NXNQ 3E6ZX 1HJPA 3UDIA 2OCEA 1EZ8A 3CCJA 1EFID 2EXDA 4I65A 4H13C 3K6OA 1LUZA 4L8JA 1PFBA 2N55A 1KHIA 4C3IH 1AW7A 5CV5A 1RTNA 1K28A 4K8IA 4RH6A 4DUYL 1D6EC 1KDCA 4A75A 3NE5B 2LFNA 3J80L 2L15A 5M3FB 1PZJD 2VB2X 3EROA 2V4DA 2IX3A 4CJ0B 3JAML 1QVCA 4AYBG 1Q3LA 4HN7A 4ME3A 2B2WA 2Y0SG 4A93H 4GLVB 3W5OA 4A4IA 1JOQA 1AFPA 2IHFA 3IFTA 2R3ZA 5ELOA 1CKMA 1CSPA 1A0IA 1UNSA 5IYDG 1PTOC 5IGBA 1N33Q 1TS5A 1JWUD 3K57A 1AH9A 3WOEA 2F0HA 4NXMQ 2PW5A 1LYLA 2HT1A 3EFXD 2Q2IA 1QNUA 4JV5L 4I7ZC 4QUFA 4O2DA 4GS3A 3MXPA 1KL9A 2E2DC 4NMZA 2D62A 3PIP3 3U58A 2AUKA 2XGTA 4LW1A 1IBML 2R7FA 1Y8PB 2K03A 2B8FA 3E9HA 1XWEA 5EJWA 4XT1B 2QCPX 1SEBD 1I4PA 1FL0A 1C48A 2I5LX 4G7OC 1ZYRC 5EPLA 1K0RA 4BY1H 1VQIA 3HOWH 1TWCH 4R4QA 4JI5L 1B50A 2LS01 2K5VA 1ET9A 3M4PA 2ZM6Q 1TWHH 5C0XH 3GQBA 5D14A 1FR3A 1LV9A 2JEBI 2IY5B 2MPMA 4LNQA 1LTGD 1EY6A 3KLSA 2NVQH 1ONLA 1IXRA 5EPJA 1XPRA 4YY3Q 2B29A 5ELNA 4IJHA 4AYBB 2XTIA 3IL8A 1VQDA 3L7ZC 3BDCA 2Y0SB 2Q8RE 3P1HA 5E3FA 3QWNA 1A2UA 1K8AC 3D3RA 2UU9Q 4IFDI 4OX9Q 2PZUA 4K6LA 1EY0A 2MP1A 4RG1A 1EQQA 1O7YA 3S14H 2E2HB 4OWWB 1DOKA 4YHHL 3F2UA 5D65A 2SDFA 1CTMA 1IBLQ 1SJHD 1G2TA 1Q46A 1VQJA 3CF5A 1B4OA 1PTOD 2UXCL 5IYBH 2HQEA 3KUPA 4LK1C 2F0FA 4OL7A 1STNA 4QQBX 1J6QA 3C2PA 3K7AB 1RDPD 2VQEQ 5CYUA 2F0PA 2CCZA 3F2CA 3G4SA 2LMCB 1DOMA 4HCEA 4BBRG 1Y69U 3HOXH 3GTMH 2MO0A 4IFDG 2F1MA 3J81E 4QUCA 1HR0Q 3RNUA 2CH4W 1J5EL 1TWGH 1ESRA 2L4NA 3OWFA 3QOJA 5BR8L 1EU3A 1VQFA 1VQEA 1MJCA 1PTOF 3VR4A 3TREA 2JA6G 4RKLA 4DK1A 4P73A 4C2MH 3VYTA 1SE3A 4JI3L 4B3SQ 4H0LC 1B8AA 1B2TA 2A6EC 4AQYQ 2NVXH 2F0QA 4LFAQ 2AQ1B 5AJ3Q 2UUAQ 3HKZG 1SNCA 2HDLA 4ZQ3A 2LXKA 1IYUA 1EY9A 2K5HA 4KKUA 4IFDJ 1STHA 4JBJA 4ULLA 2C5CA 3U4VA 3SXHA 1F9PA 5LMNQ 3NBIA 4PZ6A 3AMUA 3T16A 1SFOH 1VQ6A 3C1EA 3OTOQ 1WTRA 3OMCA 4XYOA 5IP9H 3H0GG 3CP0A 5L37A 3M4OH 2NZ1D 1SBBB 4KJOA 1S5ED 4HJ9A 1R4PB 3CCEA 3J80c 1OXXK 3CW2C 4WFN3 2YU9B 1SYFA 3K59A 3JAMc 5C5LA 3J7AF 1VQ4A 5M5WH 1FD7D 5FO9B 3CMAA 3TS0A 1N34L 3PO2H 3S1MB 4BBRB 1Y1WH 4RGMA 3J81j 1NCVA 4ZUJA 2K50A 2RHQB 3PV0A 1CM9A 1KLGD 1JOKA 4F88A 1GKHA 4NPSA 1OXSC 4DV2Q 4MIUA 1SLJA 4X66Q 1X56A 2JA6B 1Q90A 2HQLA 1LTSD 1NR4A 1K73C 4O42A 1Q7YC 1JB7A 3GTOB 1UUPA 4WJWA 2B2UC 1X3FA 3HKZB 1HPCA 2OTLA 3RZOB 4A3KG 2OTJA 1DZ1A 1LACA 4A3DG 1EIYB 4DR3L 2A19A 1BCPB 4JG2A 4ZK9B 3BDLA 4C3HH 1H9JA 2HHHL 2CH4A 3T1HL 2IL8A 5FJ8G 1FNWA 1WTQA 2B2TC 1M8AA 2F0DA 3CRLC 1G91A 2Q8TA 1S40A 4F87A 1L1OA 1RTOA 2I5HA 3S1NH 4DV0L 4IUPA 2NVTB 1SN8A 4IZ8A 4PV1C 3H0GB 3E0EA 4BXXH 4K14A 3CC2A 1V1PB 4FO2A 2E2IH 4OONA 3W1BA 1I6HB 1PH3A 1BOSA 5IODA 3I56A 1PH7A 2DY7A 4K2LA 2OQKA 1JE5A 5E4WC 1RL2A 4CKBA 1BCPF 4K5VA 2Z4HA 4DV4L 3AFQA 5ELEA 3L2PA 4NKLA 3I4MH 2EYJA 2B8GA 4OEMB 1U5KA 2JA9A 4XXEA 3MC0B 1WCMG 4IOCA 5JJKA 1EZ6A 1HA5A 2AWOA 4A3IG 2F0GA 1XMOQ 4B3ML 4EQNA 3M3YH 1Z9FA 3CAMA 2GA4B 1HHVA 4JW0A 1I4GA 5CMDA 3X3NA 2N8NA 1KTKA 1ASYA 2JA7H 2UXDQ 2MO1A 1Y1VG 4BS9A 2O5JC 3HEJA 1STYA 3IKJA 1NMGA 1JORA 4KY6A 4X64Q 1I3QB 1X54A 4DK6C 1A6XA 3STBC 2F0SA 5CGKA 4A3KB 1PRTC 3CQZB 4GOPC 3C1FA 1B44D 4A3DB 2R92H 1CSQA 2ZXRA 4GNXB 3SGIA 1LT5D 3FEWX 1I5FA 2KVMA 3EIVA 4LF8Q 1NE3A 1H9KA 2WKDA 3PUXA 1VQGA 4DK3C 3D4DA 3L3OC 2F0TA 4UY8C 4JBWA 3KLSX 1JICA 5I9OA 3K5NA 2RBMA 3L0OA 4HJ5A 1B3QA 4DN4M 4JVZA 4DR1L 2D9UA 2DJFC 2RF4A 2PQAB 1K9MC 2PYKA 5I4DA 3PO3B 1B9MA 1E2WA 2A5HA 4PMCA 1HA6A 1IW7D 4B3TQ 4UPAA 1WCMB 3TMEA 1D5MC 3VR3A 4A3IB 1QVFA 3J7A5 4KI0A 3HZXA 4ILWA 4A3GG 3MZ5A 4KD3A 1JB3A 4CJ1B 1IBKQ 4RHSA 3EQLC 4R8NA 4LF5Q 4C1NK 3F8TA 4KV6A 4DK0A 3KOJA 4KN4C 4JI7Q 1E7ZA 1V1QA 4J6HA 2PNHA 1AZQA 1Y1VB 3H15A 3J7ZC 3DWPA 1N32L 4YWKA 3OYYA 2CWAA 3A8KE 4HJ8A 1DONA 1K83H 3TBIB 3I72A 5EGTA 2A74C 3SDZA 2E2JB 3HGBA 2WIIB 4LF9L 2Z4IA 3A8JE 1JWSD 1QWYA 2M2LA 1T5XD 5BN3A 4ZRZA 2N3SA 3STBD 5M9OA 4P2CB 3M4QA 1A8VA 2Z1CA 4WORA 3OHXC 4RCNA 3BZKA 2JA5H 1F2LA 3HOUG 5JVG3 4BA2I 3O13A 1N36Q 2LY7A 3F2BA 2RDGA 1I50B 3J80i 5GADC 2G9DA 3QJYA 2EE1A 1KDBA 3DM1A 2QW7A 1YHQA 3GTJB 1FYCA 1CT1D 2NVYB 3JAMi 4QGUA 2A1AA 4PNYA 5I9PA 2AWNA 2F52A 1R9TH 2ZJRA 4LFBL 1MI2A 4UP7A 4A3BG 3QOLA 3F2DA 3AB9A 4HJAA 5M3FH 2NZHA 2VB3X 5D3DA 1PRTF 4B3RL 1LABA 2BA0A 2B2YA 4R1JA 4CJ2C 4DV1L 3BYTB 2FXQA 4IPCA 2D0PA 1TXYA 1AE3A 4F7XA 4JI4Q 2KEEA 4A3GB 3PUYA 1EWIA 5ELFA 4L5RC 1G51A 2OF1A 1EL0A 5IWAL 2EPBA 2PMZE 1VQPA 5KEEA 3WWVA 4ME5A 3NPPA 2I0QA 4GZYC 5DAUA 4LF7Q 5K36H 2ZTDA 1B53A 1EUJA 3BJUA 3S24A 4X62Q 4A76A 1YITA 3QO2A 4A3LH 3ER0A 1K8OA 2NN6H 1XYIA 4KHZA 3AYHB 3P20A 1PFNA 2JA8G 4P71A 1V1PA 1WI5A 4QB4A 4CDDC 2FHTA 3FP9A 1LO5D 4JI8Q 4A3CH 2MGSA 3R3OA 1EYCA 4OWTB 3F1ZA 4JYAQ 1QG7A 2Q2HA 1SNOA 1YJNA 3KF6B 3S9WA 1K8GA 4JI6Q 1DYQA 4GN3B 3OIQA 1HNZQ 3GTLB 4KD4A 4MN3A 4X65Q 1CZWA 3KK7A 2RQXA 3LWUA 1WJJA 2R6GA 4CGYB 4LF4L 3PGZA 3J80E 3MXGA 1D5ZC 3E5SA 5FLXc 2G5DA 2KHJA 5G3LD 1II3A 4DV6L 4JBKA 3JAME 4A3BB 1HZAA 1YNNC 1XPUA 1U4LA 4K0KQ 1EY4A 3A7LA 5GROA 2VY3A 5IIFA 2R93H 4M1UB 5JJLA 4POFA 4CBVA 4DA2A 1VDZA 3S1RB 3TS2A 1CHPD 3PCOB 4IO9A 5C4XG 3D4RA 1NUCA 4GNXA 4XT3B 5K5PA 3K0XA 2NZOA 1EEID 4IALA 1OXUA 4XIGS 5KYLA 4DV5Q 2QF7A 3K7AH 3S1QH 4J8QA 1CKNB 4C3JG 4E6IA 4LFCL 2JA8B 4WJ3M 3T4AC 3RZDB 2F03A 4RFBA 2K1BA 1UEAB 2HIVA 2EJMA 3CC4A 1D8LA 2PQAA 2WP8J 1SNQA 4RKBA 3PIPA 3K0YA 1S5BD 4DUYQ 4KTAA 1RJTA 2A73B 5A2QE 2IJ0A 3MTSA 1ESFA 1V8QA 4OHJA 1PH9A 4HR7B 3WOFA 4Q5VA 3SR1A 1L0YB 1P16A 3CPWA 1U9RA 1RODA 5CR3A 5EKIA 3H6MA 2Z9HA 3I3CA 4DAYB 1STGA 1PH1A 1MKHA 2EDGA 1GVPA 4DFAA 3KYHC 2H5XA 5IY0A 4OIJA 5C4JH 2DUDA 4IUVA 1GOZA 1ML0D 1YNND 3KF8B 4IOAA 1T9HA 2SEBD 3GTGH 5IT9L 2DJGC 1DD2A 4PZ7A 4JV5Q 2PZWA 4MHEA 2MJ8A 4WRDA 1EQVA 1T5EA 1L1OB 5LHY1 4HIKA 5C4XB 2C9OA 4PQXA 1X3QA 3OWEB 3N52A 4JI0L 4DR6L 1AE2A 4NB3A 1IBMQ 3N6RA 4F8MA 1PTOB 2YTVA 4TRDA 1LM0A 2RDFA 5CBAE 3K58A 1DCZA 4GLAC 4P74A 3H3VC 3VR6A 1U0LA 1Q81C 1EYAA 3GO5A 3NQIA 1NR2A 2XSCA 3NWSA 4QIWE 4C3JB 1O80A 2N78A 4JI5Q 3AEVA 4BBRH 2QILA 2AHOB 4DPGA 4UAIA 1L0XB 2IW3A 1UE5A 4S3SA 4IFDH 3U9OA 1KABA 2DNCA 2EYHA 2P5ZX 5T1IA 1FJGL 3NSWA 2L5TA 1PH8A 3GTKB 5CV9A 2I46A 4A3FG 2VS1A 3G6JB 3I90A 4XQNA 4BBSH 2AQ3B 1TS3A 1D7QA 3UE1A 2JA6H 2XVSA 4DUZL 5NUCA 1UEBA 1V9PA 1I4RA 4KHVA 2MFIA 3GTOH 1RD9D 5EKKA 1A15A 1H9SB 4R4IA 2RDHA 1HH2P 3RZOH 2B2VC 3NXWA 3FPPA 3BVZA 4KY7A 3C46A 3T1YL 1FVIA 1VQKA 2KCTA 4DNTB 4YHHQ 4GKJL 1UWVA 4HIMA 5IOCA 4FF1A 4ZYSA 1KLUD 2UXCQ 4YIJA 1V1OA 3UI2A 4FDBA 1KD1C 4MTKA 2NVTH 3NTIA 3DEPA 3S17B 3H0GH 2Q8IB 1XNRL 3DUZA 4CHTB 3C3LA 1MIUA 3A74A 1I6HH 4HIDA 1IBLL 3HOYH 5FO7B 1VQHA 3KF6A 4K6DA 1J5EQ 1GHJA 3DMUA 1QUQA 2QGQA 1NSNS 3GTPB 5BR8Q 1CA6A 2PMZB 1KRTA 4M8AA 2CWPA 4BY1G 3PMFA 1NTGA 1BVSA 1HZBA 1VS0A 2XN9C 1ZYRD 1RIPA 4DGZA 4JI3Q 4YWLA 3A7AB 4DNIA 3CXCA 3MVVA 5FLMG 4C3IB 4A3MG 4A3FB 3PUVA 1IKLA 2K01A 2EYFA 1BQQT 1VQAA 4N9PA 1OO9B 3W2DA 5GAGC 4ZLTF 2F3WA 2EYLA 3PIO3 4RAUC 3SHLA 4FF3A 2K28A 1HUMA 5IP7H 3KBXA 1N9WA 3V05A 1SSOA 3IAYA 1I3QH 1K8MA 3K80C 2ASBA 1I94L 5KNBA 2K5DA 2K32A 1SMYC 1PXUA 4A3KH 4JOIA 2UUAL 4J1MA 3IRBA 3S16B 1XXGA 3CQZH 3J7YW 3G71A 4A3DH 1XTCD 5C0XJ 4GN5A 3KBGA 4OGQC 2M00A 2Z6KA 5J3BA 4ABNA 5FJ8H 3EN2A 1TS4A 4H44C 1FGBD 2CQOA 5M3MH 1WD1A 2VQFL 1S4ZA 3OPOA 1WTWA 1BF4A 1CKNA 3I7FA 5CC4A 2KECA 3NTHA 1A62A 3TP8A 4PZ8A 2NUCA 4HEDA 1N34Q 1G6ZA 1SYCA 1F2YA 3PQIA 3CRKC 2N49A 1SYGA 3R2IA 3EJIA 1GUTA 2F0LA 2L0CA 2JSOA 2B63H 4IUTA 4BY1B 2VUMG 2KJXA 1WCMH 2NB0A 5IT9c 1X6OA 3J81L 4P75A 1TWCB 4A3IH 1Q86C 4UHVA 1E24A 1HRJA 3PF4A 3E9IA 3SE0A 4HMJA 1R4QB 3P75A 4DAYA 3FDTA 2F0VA 1Q8KA 3BZDB 5C5MA 1LT6D 3QIAA 4UP9A 1EY8A 4A3MB 3ONAB 3VYSA 3VYRA 3CCUA 4DAVA 2A6ED 2JYOA 2NVQB 4IUUA 5EPKA 4DR3Q 2PPBC 1X9NA 3KF8A 4JPBW 4EX5A 1VQOA 2HHHQ 3T1HQ 3I2ZA 3BU2A 2RCNA 3ULLA 2K6AA 5FLXE 4GKKL 5CORA 1Q82C 4DV0Q 2E2JH 4L5QA 3TP7A 1G2SA 3MAQA 1PH2A 3SK4A 2DY8A 4ZKCB 4OO1I 2XNAC 2QEJC 3S14B 4A3EG 3I4LA 5C3EG 2RSOA 3NP8A 1SNPA 3H91A 5KGUA 2NTSA 4DV4Q 2LSSA 3PO3G 5A35A 3OIPA 1HQMC 3TSSA 2IX1A 1E2ZA 2AQ2B 4XQJA 1XJVA 2MHVA 4HSVA 4B3MQ 1UE1A 5CV8A 1C4QA 2O5IC 2E76C 3HOXB 3GTQH 2F0IA 1KC8C 2O2LD 3UDFA 4IPDA 1ET6A 3CCRA 1XMQL 4OO1G 1D2BA 5E4XA 2VUMB 1Z7TA 2F0NA 1H9SA 4X3TA 1U4RA 3SVMA 3LWEA 1SRUA 1CI3M 4C2MB 4ALPA 1WD0A 2K5QA 5KYIA 2AMCB 3TRZA 2NVXB 3W3AA 4QIWB 5FO8B 2CKZB 2ZXPA 1QZGA 2FMMA 5C6AA 5COYA 1XX8A 4HJ7A 1QE6A 3GV3A 1TY2A 3S15H 1SNDA 4KHPL 5F2DA 2R7ZH 1Q8IA 2I07B 1EWHA 1LTID 5IGDA 3RLFA 3Q23A 1SFOB 3NWTA 1Y8NB 4DAMA 3PUWA 4H7BA 4HSPA 2CHBD 1SE8A 4Y7NH 3UDGA 4QY7A 4LMQD 5JPNC 5M5YH 4BXXG 4A3EB 5EKLA 2PZTA 1PRTB 2L11A 4K2KA 3K7UC 4YCUA 1A3TA 5I6WA 5C3EB 1NJIC 2G9HD 4DF7A 4GOPB 3HOUH 2J7ZA 3JC66 4X3KA 2KCNA 5C44H 1VQ8A 1EFWA 2Z6BA 4DR1Q 4N8X1 3D8GA 1OXVA 4A3JG 4MNOA 3CD6A 3FKIG 5I2YA 4ZUIA 1QILA 3CKIB
chains in the Genus database with same CATH topology
5JEAG 1CZGA 2B2WC 1HTPA 1FNVA 3HRZC 2XIWA 4DNRB 4RCOA 1VMCA 3H09A 4OIKA 3SK5A 1GUGA 1ZKOA 2NTTA 3GV6A 2WINB 1H9RA 1E2VA 5FOBB 3SK6A 3LX0A 5JEAJ 2H4OA 1F2MA 5M5XB 1BDOA 3VR5A 3T56B 5KNDA 1PRTD 2MUYA 3DHQA 5FK9C 2IWHA 2PNRC 3VA7A 1LTBD 2EZVA 1QJOA 4PMBA 5C3WA 1TKWB 4FF4A 2K33A 5JPMC 4A3JB 1STBA 1EQTA 3FKIB 1CQFA 1J8IA 3VR2A 1DXMA 1M4VA 5HGTA 3I91A 3M3YB 2L1BA 3TZUA 1EIHA 1VCIA 3LNNA 2O4XA 1EIGA 1EWCA 1CHQD 3MFYA 1W6KA 4RA8A 4DAPA 4LJZC 1Z47A 1TR5A 4C1NI 5EBCA 1AN8A 1DOLA 3PUZA 4FF2A 5ISRA 5C4HA 2B2UA 4IN3A 3CU7A 1J9OA 5J39A 3NQTA 1MBYA 1SYDA 4X3SA 1D1IA 3VA5A 1PTOH 2NWGA 2F0OA 2B2TA 4V0BA 1LTRD 2X6GA 1I4HA 1BNZA 3TN2A 4EQPA 2K7VA 5IGGA 2VXWA 5BN5A 3S2DB 3HOVB 2BA1A 3R93A 3I8ZA 1GHKA 2IPKD 1RCVD 1PDQA 1ILQA 5T1GA 1EY7A 5C4ZA 2BOSA 3J7AV 4DU9A 2FINB 2EY5A 1TT2A 2IT1A 4QMGA 2F0EA 4K5WA 1ZXTA 2M9VA 5IT9E 1ZEQX 5EBDA 2A68C 5I2XA 2ID0A 3ND8A 3FMCA 5I6YA 1F77A 3G7LA 3R2TA 4FNFA 1WVLA 1F9SA 2BDOA 1K83B 3FVQA 1F9QA 1TWFB 5J22A 2QKIC 1JOOA 2E75C 1I4QA 3AU7A 4NW2A 1A2TA 1QOHA 2F4IA 1QNKA 1SJED 2EYPA 4K5XA 2JA5B 3TDQA 1MD2D 3GP7A 4QF4A 1AZPA 1S5FD 2KUMA 4XTCS 2ICIA 4G4KA 5JVH3 1AP0A 4C56C 1KAAA 1WTOA 3A8IE 1A3VA 5IGEA 1R9TB 2F3VA 1Q1BA 1TWAB 1ENFA 3IFDA 3SK8A 4BY7B 2PQEA 1RHPA 3QG1A 4XDXA 1LTAD 3NBHA 3S2HB 1I4XA 3T13A 5CV7A 2PW7A 3BVGA 3NTKA 4L6TB 2FMCA 4PMWA 2A68D 3V96A 4RGOS 2BCOA 2AUJD 1IHZA 1X32A 1AEXA 4B9XA 1KNEA 1KDAA 3MXUA 1GUSA 1X3PA 5JOBA 1ICWA 2OEOA 2K04A 2KOLA 4C3IG 2RKSA 4RWSC 1LT4D 2F0MA 3BYYB 2HDMA 2WKCA 3MHBA 4IURA 3RMHA 4BWGB 2HUGA 3BDOA 4EVOA 5A2QL 1GUWA 4Z9CB 5IGFA 5FKAC 1EY5A 2EVBA 1SE2A 3DEOA 1SYEA 2J4XA 3T51B 1EU4A 2WACA 3BG3A 2R93B 4ZAIA 4DXFA 5C0XI 4RGTA 3K5MA 2HCCA 4IUQA 2EY1A 3SEBA 2K05A 1W6JA 4JK1C 3P7JA 5ELBA 3OW7A 1WTPA 2YYZA 3M85A 3NHHA 2KQ3A 3S1QB 1OXTA 2XRQD 1HFGA 1BR9A 4RGNA 1PYWD 2A6HC 4G57A 1JCKB 2A69C 5C0XG 5JAVA 1U4MA 1LT3D 5BN4A 2JEAI 4R9WA 1SAPA 5IGCA 1JE4A 1HTLD 2VNUD 3L9AX 3FPUB 1I6VC 4U68A 3M7NA 4A93B 1B3AA 2ZXOA 1BBXC 4EGVA 3K5OA 1JQYD 4G7HC 4K8JA 1RF2D 5C4JB 2PO4A 1MSGA 2SNSA 3MEHA 2WV6D 3GTGB 4V190 1CQVA 1TY0A 2F0UA 1HQRD 4KMUC 2EY6A 4G7ZC 1BO0A 4LAAA 4FYDA 1JWMD 1B1ZA 2D5DA 2LKVA 3MWYW 2OXPA 4FXGC 2B2YC 4UDUC 1F2ZA 3HOWB 3BS1A 1D1KA 3OSOA 1CA5A 4U673 1PZKD 2N88A 1WTVA 1TWHB 1O7ZA 4HTHA 5TSSA 4HCSA 2WB1B 4ZKBB 5LL6X 1H9MA 1BCPC 5CV6A 2A6HD 4OO1H 2A69D 2EYOA 3GD7A 4BBSB 2L12A 1E0BA 3RD4A 4DXGA 4KN7C 2F0WA 1GJXA 3TP5A 2X69A 3DXJC 1TVXA 2SOBA 2RSNA 3OMGA 1YNJC 4O1NA 1GUNA 3EA6A 3KLRA 4KK7A 1SMYD 2IX0A 1ILPA 2WAQB 2JXMB 3MFGA 1G8ZD 2QDBA 4FXDA 4N9TA 3Q22A 2TMPA 1TU2B 1STEA 3VYUA 3M7GA 1SE4A 1JC7A 3U9SA 1VF7A 3GTMB 1IW7C 3MA2B 3HOYB 1TWGB 3QB3A 1LTTD 2EOTA 1ENCA 2NYZD 5JEAH 2EXZA 5HURA 1TS2A 3ZYYX 2XWJB 3TZDA 4NP5A 2R61A 2EJGC 1O7LA 1EEFD 5AFWA 2KEDA 4FP5D 1VF5C 1BCPD 4KKTA 3D4WA 4C3HG 4KY5A 2XWBB 1HFNA 1DJRD 2X6LA 1PFMA 4FXKC 3EVQA 1SYBA 2EY2A 2B2VA 4HAEA 5D3IB 1QCBD 1D5XC 3CHBD 5FLXL 1HXYD 3M4OB 1YNJD 1LLRD 1PZID 1WTXA 3X3MA 5M3MB 2KA7A 2SNMA 3H94A 1SDFA 5M5WB 4CKCA 3I70A 4TQUS 3PO2B 4IUNA 1Y1WB 1VMPA 1B9NA 1IYVA 4NDXA 1Q12A 3E0JA 2B63B 1EOTA 2XRSD 4IQZA 1TIID 3RUZA 2D2CC 4CKEA 5C3XA 5KRUA 1F9RA 3DWAA 2JP1A 4R8IA 5E1FA 2F0JA 1STAA 2ENBA 5JJZA 3DWQA 1BUVT 4BA1I 3Q24A 4ID6A 1TQOA 2EJFC 2J0TD 1FNUA 3M4YA 2EYMA 2FJ2A 1RKNA 4C3HB 3TP6A 1PMRA 3D6WA 1GXDC 1MGSA 2E74C 1IKMA 1CFMA 3S1NB 1V43A 3K5LA 5CBEE 2HCIA 5DEHA 5ELCA 2E2IB 2JE6I 1HCZA 1Y8OB 5KIXA 2BDNA 1ENAA 1NAPA 2OT2A 2H1EA 3V2TA 3I4MB 4B08A 4KKSA 2L55A 5EQ0A 2F0KA 2K5WA 3HS0C 3T53B 4XYQA 2CW0C 3GTQB 2ZT9C 3A56A 1S5CD 5CV4A 2FFKB 2PCFB 1QB5D 1BXTA 2JA7B 1A3UA 3ERQA 1SNMA 1CK1A 3MXNA 1DM0B 2L9HA 3NUCA 5ELDA 1JR0D 2CVRA 3URYA 1KNAA 3WDNA 4FVMA 3Q6SA 3FRPB 3BVMA 4Q0FA 2BE5C 4XQQA 2RA4A 2R92B 3D31A 4TSSA 5KNCA 1EYDA 3I73A 3S15B 2R7ZB 1Z6HA 5LL6S 1S5DD 5DM63 2KHSA 4RHRA 1O78A 4Y7NB 5M5YB 1PLFA 3ITPA 5DM73 1U4PA 3OOCA 4ODGA 3HOUB 5C44B 3A54A 2NN6I 2KCCA 5DNFA 2RVLA 3I4NB 4QCLA 4L63B 2NBFA 3HP3A 4TKOB 1MSHA 4KJNA 2ICEC 4B9WA 4X3UA 3Q0AA 1UAPA 2TSSA 2CW0D 3NK9A 2CQAA 1C8CA 3R8BA 5K36G 1G291 2NN6G 5J1ZA 1IL8A 2Z8LA 3ND9A 1GUOA 1HUNA 3HOZB 1SXTA 4EQOA 5G3LF 2DNEA 2B39A 3D6CA 2DN8A 2BE5D 3A55A 4HMIA 3HG9A 1Q1EA 3E6ZX 1EZ8A 1EFID 4I65A 4H13C 3K6OA 4L8JA 1PFBA 2N55A 1AW7A 5CV5A 1RTNA 4K8IA 4RH6A 1D6EC 1KDCA 3NE5B 2LFNA 3J80L 5M3FB 1PZJD 2VB2X 3EROA 2V4DA 2IX3A 4CJ0B 3JAML 1Q3LA 4HN7A 2B2WA 1JOQA 1AFPA 3IFTA 2R3ZA 1UNSA 1PTOC 5IGBA 1TS5A 1JWUD 3K57A 3WOEA 2F0HA 2PW5A 3EFXD 1QNUA 4I7ZC 4QUFA 3MXPA 2E2DC 4NMZA 2D62A 3PIP3 2AUKA 1Y8PB 2K03A 2B8FA 1XWEA 5EJWA 4XT1B 2QCPX 1SEBD 1I4PA 1C48A 4G7OC 1ZYRC 5EPLA 1B50A 2LS01 1ET9A 5C0XH 3GQBA 5D14A 1FR3A 1LV9A 2JEBI 2MPMA 1LTGD 1EY6A 3KLSA 1ONLA 5EPJA 4AYBB 3IL8A 3L7ZC 3BDCA 2Y0SB 2Q8RE 3P1HA 5E3FA 3QWNA 1A2UA 3D3RA 4IFDI 2PZUA 4K6LA 1EY0A 2MP1A 1O7YA 2E2HB 1DOKA 3F2UA 5D65A 2SDFA 1CTMA 1SJHD 1G2TA 1B4OA 1PTOD 2HQEA 3KUPA 4LK1C 2F0FA 4OL7A 1STNA 3C2PA 3K7AB 1RDPD 5CYUA 2F0PA 2LMCB 1DOMA 4HCEA 1Y69U 4IFDG 2F1MA 3J81E 4QUCA 1ESRA 2L4NA 3OWFA 3QOJA 1EU3A 1PTOF 3VR4A 4RKLA 4DK1A 3VYTA 1SE3A 4H0LC 1B2TA 2A6EC 2F0QA 2AQ1B 1SNCA 2HDLA 4ZQ3A 1IYUA 1EY9A 4KKUA 4IFDJ 1STHA 4ULLA 2C5CA 3SXHA 1F9PA 3AMUA 3NBIA 3T16A 3C1EA 1WTRA 3OMCA 4XYOA 2NZ1D 1SBBB 4KJOA 1S5ED 1R4PB 1OXXK 4WFN3 2YU9B 1SYFA 3K59A 3J7AF 5C5LA 1FD7D 5FO9B 3S1MB 4BBRB 4RGMA 1NCVA 4ZUJA 3PV0A 1CM9A 1KLGD 1JOKA 4F88A 1OXSC 4MIUA 2JA6B 1Q90A 1LTSD 1NR4A 4O42A 3GTOB 1UUPA 4WJWA 2B2UC 3HKZB 1HPCA 3RZOB 1DZ1A 1LACA 1BCPB 4ZK9B 3BDLA 1H9JA 2IL8A 1FNWA 1WTQA 2B2TC 1M8AA 2F0DA 3CRLC 1G91A 2Q8TA 4F87A 1RTOA 2NVTB 4IUPA 4IZ8A 4PV1C 3H0GB 4K14A 1V1PB 4FO2A 1I6HB 1BOSA 5IODA 2DY7A 4K2LA 5E4WC 4CKBA 4K5VA 2Z4HA 5ELEA 4NKLA 2EYJA 2B8GA 4XXEA 3MC0B 1EZ6A 1HA5A 2AWOA 2F0GA 4EQNA 2GA4B 1HHVA 1I4GA 5CMDA 3X3NA 1KTKA 4BS9A 2O5JC 3HEJA 1STYA 3IKJA 1JORA 4KY6A 1I3QB 1A6XA 2F0SA 5CGKA 4A3KB 1PRTC 3CQZB 3C1FA 1B44D 4A3DB 2ZXRA 1LT5D 3FEWX 2KVMA 1H9KA 2WKDA 3PUXA 3D4DA 3L3OC 2F0TA 4JBWA 3KLSX 1JICA 5I9OA 3K5NA 2RBMA 4DN4M 2D9UA 2PYKA 5I4DA 3PO3B 1B9MA 1E2WA 2A5HA 4PMCA 1HA6A 1IW7D 1WCMB 3TMEA 1D5MC 3VR3A 4A3IB 4KI0A 3HZXA 4ILWA 3MZ5A 4KD3A 1JB3A 4CJ1B 4RHSA 3EQLC 4R8NA 4C1NK 4KV6A 4DK0A 4KN4C 4J6HA 1AZQA 1Y1VB 3DWPA 3A8KE 1DONA 3TBIB 3I72A 5EGTA 2A74C 3SDZA 2E2JB 3HGBA 2WIIB 2Z4IA 3A8JE 1JWSD 1QWYA 2M2LA 1T5XD 5BN3A 4ZRZA 5M9OA 4P2CB 2Z1CA 4WORA 3OHXC 4RCNA 1F2LA 5JVG3 4BA2I 3O13A 2LY7A 2RDGA 1I50B 2G9DA 3QJYA 2EE1A 1KDBA 3DM1A 3GTJB 1FYCA 1CT1D 2NVYB 5I9PA 4PNYA 2AWNA 1MI2A 3QOLA 3AB9A 2VB3X 5D3DA 1PRTF 1LABA 2BA0A 2B2YA 4CJ2C 3BYTB 4F7XA 2KEEA 4A3GB 3PUYA 5ELFA 1EL0A 2OF1A 2EPBA 5KEEA 4ME5A 3NPPA 4GZYC 5DAUA 5K36H 1B53A 3QO2A 1K8OA 2NN6H 1XYIA 4KHZA 3P20A 1PFNA 1V1PA 4QB4A 2FHTA 1LO5D 2MGSA 3R3OA 1EYCA 1QG7A 1SNOA 3S9WA 1DYQA 3OIQA 3GTLB 4KD4A 4MN3A 1CZWA 3KK7A 2RQXA 3LWUA 2R6GA 4CGYB 3J80E 3MXGA 1D5ZC 3E5SA 5G3LD 1II3A 3JAME 4A3BB 1YNNC 1U4LA 1EY4A 3A7LA 5IIFA 4M1UB 4CBVA 4DA2A 1VDZA 3S1RB 1CHPD 3D4RA 1NUCA 4XT3B 5K5PA 1EEID 4IALA 1OXUA 4XIGS 5KYLA 2QF7A 4J8QA 4C3JG 4E6IA 2JA8B 3T4AC 3RZDB 2F03A 4RFBA 2K1BA 1UEAB 2EJMA 2WP8J 1SNQA 4RKBA 3K0YA 1S5BD 4KTAA 1RJTA 2A73B 5A2QE 2IJ0A 3MTSA 1ESFA 1V8QA 4OHJA 4HR7B 3WOFA 4Q5VA 3SR1A 1L0YB 1U9RA 1RODA 5CR3A 5EKIA 3H6MA 3I3CA 1STGA 2EDGA 4DFAA 4OIJA 4IUVA 1GOZA 1ML0D 1YNND 2SEBD 5IT9L 1DD2A 2PZWA 4MHEA 2MJ8A 4WRDA 1EQVA 1T5EA 5LHY1 5C4XB 2C9OA 4PQXA 1X3QA 3OWEB 3N52A 3N6RA 4F8MA 1PTOB 4TRDA 2RDFA 5CBAE 3K58A 1DCZA 3H3VC 3VR6A 1EYAA 3GO5A 3NQIA 1NR2A 2XSCA 3NWSA 4C3JB 1O80A 2QILA 4UAIA 1L0XB 2IW3A 4S3SA 4IFDH 3U9OA 1KABA 2DNCA 2EYHA 5T1IA 3NSWA 2L5TA 3GTKB 5CV9A 2I46A 3G6JB 3I90A 4XQNA 2AQ3B 1TS3A 2XVSA 5NUCA 1I4RA 4KHVA 1RD9D 5EKKA 1A15A 1H9SB 2RDHA 2B2VC 3NXWA 3FPPA 3BVZA 4KY7A 3C46A 4DNTB 5IOCA 4FF1A 4ZYSA 1KLUD 4YIJA 1V1OA 3UI2A 3NTIA 3DEPA 3S17B 2Q8IB 3DUZA 4CHTB 3C3LA 5FO7B 4K6DA 1GHJA 3DMUA 1NSNS 3GTPB 1CA6A 2PMZB 4M8AA 3PMFA 2XN9C 1ZYRD 4DGZA 3A7AB 3MVVA 4C3IB 4A3FB 3PUVA 1IKLA 2K01A 2EYFA 3W2DA 1BQQT 4N9PA 1OO9B 4ZLTF 2F3WA 2EYLA 3PIO3 4RAUC 3SHLA 4FF3A 2K28A 1HUMA 3KBXA 3V05A 1SSOA 3IAYA 1K8MA 5KNBA 2K5DA 2K32A 1SMYC 1PXUA 4J1MA 3S16B 1XXGA 3J7YW 1XTCD 5C0XJ 4ABNA 3KBGA 4OGQC 2M00A 1TS4A 1QILA 4H44C 1FGBD 1WD1A 1S4ZA 3OPOA 1WTWA 1BF4A 5CC4A 2KECA 3NTHA 3TP8A 2NUCA 4HEDA 1G6ZA 1SYCA 1F2YA 3CRKC 1SYGA 3R2IA 3EJIA 1GUTA 2F0LA 2L0CA 2JSOA 4IUTA 4BY1B 2KJXA 2NB0A 3J81L 1TWCB 1HRJA 3SE0A 4HMJA 1R4QB 3P75A 4DAYA 3FDTA 2F0VA 3BZDB 5C5MA 1LT6D 3QIAA 1EY8A 4A3MB 3ONAB 3VYSA 3VYRA 4DAVA 2A6ED 2JYOA 2NVQB 4IUUA 5EPKA 2PPBC 3KF8A 2K6AA 5FLXE 5CORA 3TP7A 1G2SA 3MAQA 3SK4A 2DY8A 4ZKCB 4OO1I 2XNAC 2QEJC 3S14B 3I4LA 2RSOA 3NP8A 1SNPA 3H91A 5KGUA 2NTSA 5A35A 3OIPA 1HQMC 3TSSA 2IX1A 1E2ZA 2AQ2B 4XQJA 2MHVA 4HSVA 5CV8A 1C4QA 2O5IC 2E76C 3HOXB 2F0IA 2O2LD 1ET6A 4OO1G 1D2BA 5E4XA 2VUMB 1Z7TA 2F0NA 1H9SA 4X3TA 1U4RA 3SVMA 3LWEA 1CI3M 4C2MB 1WD0A 2K5QA 5KYIA 2NVXB 3W3AA 4QIWB 5FO8B 2ZXPA 2FMMA 5C6AA 5COYA 1XX8A 1QE6A 3GV3A 1TY2A 1SNDA 5F2DA 1Q8IA 2I07B 1EWHA 1LTID 5IGDA 3RLFA 3Q23A 1SFOB 3NWTA 1Y8NB 3PUWA 4H7BA 4HSPA 2CHBD 4LMQD 5JPNC 4A3EB 5EKLA 2PZTA 1PRTB 2L11A 4K2KA 1A3TA 5I6WA 5C3EB 2G9HD 4DF7A 2J7ZA 4X3KA 2KCNA 3D8GA 1OXVA 5I2YA 4ZUIA 1BCPF 3CKIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ML0 D;  2H1E A;  1F9P A;  1AP0 A;  1HFN A;  1B50 A;  4MN3 A;  4ZAI A;  1DON A;  1DOL A;  1CA5 A;  1WTO A;  4MHE A;  5COR A;  2B2W C;  2HCC A;  2MJ8 A;  2X6L A;  4IUQ A;  1PFM A;  2B2U A;  5EQ0 A;  1G2S A;  2XIW A;  1WTR A;  2N88 A;  1WTV A;  1J9O A;  1IL8 A;  5D14 A;  1O7Z A;  2B2V A;  2DY8 A;  4HAE A;  1LV9 A;  2K05 A;  1VMC A;  4ZKC B;  4HCS A;  1X3Q A;  4ZKB B;  3N52 A;  2NZ1 D;  4OIK A;  2MPM A;  2M2L A;  1HUN A;  4X3S A;  1HHV A;  1IKL A;  2K01 A;  3P7J A;  2RSO A;  5CMD A;  2NWG A;  2FFK B;  4ZLT F;  3H91 A;  5EPJ A;  1WTX A;  1F2L A;  1U4L A;  2L12 A;  1WTP A;  5CBA E;  3IFD A;  1E0B A;  2B2T A;  3GV6 A;  4RAU C;  2K28 A;  1HUM A;  3KBX A;  1SSO A;  2X69 A;  3IL8 A;  1SDF A;  2X6G A;  1NR2 A;  1TVX A;  1HFG A;  1O80 A;  1RHP A;  2Q8R E;  2L9H A;  2RSN A;  4XDX A;  2EE1 A;  1BNZ A;  3TN2 A;  3DM1 A;  4UAI A;  2CVR A;  4HSV A;  1KNA A;  2MP1 A;  1PFB A;  2VXW A;  3Q6S A;  2N55 A;  1U4M A;  1VMP A;  5T1I A;  1O7Y A;  4XT3 B;  1NCV A;  3R93 A;  1RTN A;  3I8Z A;  1DOK A;  3F2U A;  5D65 A;  4R9W A;  1MI2 A;  2SDF A;  2RA4 A;  1ILP A;  3I90 A;  1SAP A;  1G2T A;  5E4X A;  2KVM A;  1CM9 A;  1B4O A;  1PDQ A;  1WD1 A;  1JE4 A;  1S4Z A;  2B2Y A;  3KUP A;  4CJ2 C;  1WTW A;  1EOT A;  1ILQ A;  1BF4 A;  1X32 A;  5T1G A;  4CJ0 B;  4X3T A;  1U4R A;  1NR4 A;  3SVM A;  4O42 A;  1Q3L A;  3LWE A;  3FPU B;  1KNE A;  2B2W A;  2KEC A;  1A15 A;  2FIN B;  1F9R A;  2KEE A;  1X3P A;  2JP1 A;  4U68 A;  4R8I A;  2B2U C;  1WD0 A;  1B3A A;  1JIC A;  2R3Z A;  4HED A;  2K1B A;  1BBX C;  1G6Z A;  5JJZ A;  1DOM A;  2B2V C;  1EL0 A;  1ICW A;  1PLF A;  2EPB A;  1DZ1 A;  1U4P A;  1ZXT A;  4QUC A;  4DN4 M;  2K04 A;  2KOL A;  2FMM A;  5COY A;  4ZK9 B;  1ESR A;  1RJT A;  1XX8 A;  2D9U A;  1QE6 A;  3GV3 A;  3MTS A;  2L4N A;  4RWS C;  1EQT A;  2FJ2 A;  2EOT A;  3G7L A;  1B53 A;  2IL8 A;  2HDM A;  2B2T C;  1WTQ A;  2NYZ D;  3QO2 A;  4IUT A;  4IUR A;  3UI2 A;  1J8I A;  1M8A A;  1HA6 A;  1WVL A;  1G91 A;  1XYI A;  1MSG A;  3D6W A;  1MGS A;  2HUG A;  1F9S A;  2Q8T A;  1HRJ A;  5DNF A;  1RTO A;  4QUF A;  3DEP A;  4IUP A;  2RVL A;  1IKM A;  1F9Q A;  1PFN A;  1ROD A;  5CBE E;  1GUW A;  2HCI A;  3FDT A;  3TZD A;  1B2T A;  5EKI A;  3I91 A;  4LMQ D;  4CJ1 B;  3I3C A;  2FHT A;  2L1B A;  1BO0 A;  2HDL A;  3HP3 A;  3ONA B;  1MSH A;  4NW2 A;  1QNK A;  2L11 A;  1EIH A;  2MGS A;  4X3U A;  3DEO A;  5AFW A;  2K03 A;  1EIG A;  2DY7 A;  2J7Z A;  2JYO A;  2KED A;  4IUU A;  4X3K A;  5E4W C;  4OIJ A;  5EJW A;  5EPK A;  4XT1 B;  1QG7 A;  4IUV A;  3MWY W;  4RA8 A;  2BDN A;  1AZP A;  1NAP A;  1AZQ A;  5EPL A;  2KUM A;  1C8C A;  1CA6 A;  2B2Y C; 
#chains in the Genus database with same CATH topology
 2I5M X;  2Q2T A;  5GQO A;  2UUC L;  5JEA G;  1PVO A;  3I4N H;  1CZG A;  2B2W C;  1HTP A;  1FNV A;  3HRZ C;  2XIW A;  4DNR B;  3A0J A;  4RCO A;  5IYC G;  1VMC A;  3H09 A;  4OIK A;  4A3B H;  4Y52 H;  4DR5 L;  3SK5 A;  1GUG A;  1ZKO A;  2NTT A;  4L5T A;  3GV6 A;  2WIN B;  1N32 Q;  1PV4 A;  1WYD A;  1H9R A;  1HNX L;  1E2V A;  1VQC A;  3SK6 A;  5FOB B;  4POG A;  2RHS B;  3LX0 A;  5JEA J;  2H4O A;  1F2M A;  5M5X B;  2ZJP A;  4LF9 Q;  3HOZ H;  1BDO A;  3VR5 A;  3T56 B;  1B7Y B;  5KND A;  3NBH B;  4HIO A;  1PRT D;  2MUY A;  3DHQ A;  5FK9 C;  2IWH A;  2PNR C;  3VA7 A;  4APV A;  1N8R C;  2VL6 A;  5EAY A;  2JA8 H;  4JI1 L;  1HR0 W;  2OWO A;  1LTB D;  2EZV A;  1QJO A;  4PMB A;  2JJQ A;  1Y14 B;  5C3W A;  1HZ9 A;  1TKW B;  4FF4 A;  2K33 A;  3HOV G;  5JPM C;  4LFB Q;  4DR7 L;  4A3J B;  1STB A;  1EQT A;  3FKI B;  4B3R Q;  1CQF A;  1J8I A;  4JCV E;  4DV1 Q;  3CPF A;  3NEL A;  3VR2 A;  4PG3 A;  4EQ5 A;  2ATW A;  4DKA C;  3UE0 A;  2HIX A;  3U4Z A;  1DXM A;  1M4V A;  2F3I A;  3I91 A;  4R4C A;  5HGT A;  3M3Y B;  1PYB A;  2L1B A;  3TZU A;  4H02 A;  5IWA Q;  1EIH A;  5LMN W;  2Q2U A;  1VCI A;  3LNN A;  2O4X A;  1EIG A;  1EWC A;  4DV3 L;  1S72 A;  5GAE C;  4O0A A;  1CHQ D;  3MFY A;  1W6K A;  4RA8 A;  4DAP A;  1ICF B;  2DGY A;  4LJZ C;  4DR4 L;  1Z47 A;  1EQR A;  1TR5 A;  4C1N I;  5EBC A;  1K3R A;  1AN8 A;  1DOL A;  2IHE A;  3NEM A;  3PUZ A;  4LUO A;  3CC7 A;  4FF2 A;  5ISR A;  5C4H A;  2B2U A;  4IN3 A;  3CU7 A;  5C4X H;  1J9O A;  5J39 A;  1EIF A;  3NQT A;  1MBY A;  1SYD A;  3ZJY C;  3LGJ A;  1XTD A;  4X3S A;  3ULJ A;  1D1I A;  3VA5 A;  1PTO H;  2NWG A;  1XNQ L;  2F0O A;  2B2T A;  1KQS A;  4C3J H;  3MEF A;  1QUQ B;  4V0B A;  1LTR D;  2X6G A;  5DLQ E;  1VQ5 A;  1I4H A;  2GVA A;  1BNZ A;  3TN2 A;  4LF6 L;  4EQP A;  2K7V A;  5IGG A;  1JT8 A;  4LF4 Q;  1JJG A;  2KBN A;  2VXW A;  1L2F A;  5BN5 A;  3S2D B;  2F4V L;  1QVG A;  3HOV B;  2BA1 A;  1E3P A;  3R93 A;  3GTK H;  3I8Z A;  4DV6 Q;  1GHK A;  2IPK D;  1PDQ A;  1RCV D;  2K14 A;  2ALY B;  2VZA A;  1ILQ A;  1MJE A;  5T1G A;  2E5L L;  1EY7 A;  3CCL A;  5H1S E;  5C4Z A;  4BY7 G;  2BOS A;  3J7A V;  4DU9 A;  4JI2 L;  2FIN B;  2EY5 A;  1TT2 A;  2IT1 A;  4QMG A;  1C0A A;  3CME A;  4QL5 A;  5IYD H;  1VQN A;  2F0E A;  2E2H H;  4K5W A;  1YVC A;  1ZXT A;  2M9V A;  1ZEQ X;  5EBD A;  2A68 C;  5I2X A;  5IT9 E;  4P72 A;  2ID0 A;  3ND8 A;  4DR2 L;  3FMC A;  2ES2 A;  5I6Y A;  1F77 A;  3G7L A;  3H3V I;  1YHB A;  3R2T A;  4FNF A;  1WVL A;  2WB1 E;  3A5U A;  1QZH A;  1F9S A;  3S17 H;  2BDO A;  2UUB L;  1HNW L;  1K83 B;  3FVQ A;  1F9Q A;  1TWF B;  4OEL B;  4LFC Q;  5J22 A;  5LMU L;  2QKI C;  1ASZ A;  1JOO A;  2E75 C;  1PA6 A;  1I4Q A;  3DM3 A;  3AU7 A;  4GOP A;  4NW2 A;  1A2T A;  1QOH A;  2F4I A;  1QNK A;  1IZ6 A;  1SJE D;  2EYP A;  4DV7 L;  1YEZ A;  4K5X A;  2JA5 B;  1MD2 D;  3TDQ A;  3GP7 A;  4QF4 A;  1YI2 A;  1AZP A;  1S5F D;  2KUM A;  2C35 B;  2PI2 E;  4XTC S;  2UXB L;  4NXN L;  2ICI A;  4G4K A;  5JVH 3;  1AP0 A;  4C56 C;  1KAA A;  1NNX A;  1WTO A;  3GDE A;  1GD7 A;  3KJO A;  3CCM A;  4IPG A;  4CDE C;  2WAQ E;  3VDY A;  4A3F H;  3A8I E;  1A3V A;  5IGE A;  3ULP A;  1R9T B;  2F3V A;  1Q1B A;  1TWA B;  1ENF A;  1VQB A;  3IFD A;  2K75 A;  4TVA B;  3SK8 A;  4BY7 B;  2PQE A;  1L1O C;  2R93 G;  1RHP A;  3QG1 A;  4XDX A;  1M1K C;  3S16 H;  1LTA D;  4YCW A;  4LUV A;  2K4K A;  3NBH A;  3S2H B;  1I4X A;  3OW2 A;  1N33 L;  4JI0 Q;  4DR6 Q;  1BKB A;  3D0F A;  3T13 A;  5CV7 A;  2PW7 A;  2YU9 H;  3BVG A;  4NXM L;  3NTK A;  4L6T B;  2FMC A;  2JK8 A;  2A68 D;  4PMW A;  4RGO S;  1UE7 A;  3V96 A;  2BCO A;  2AUJ D;  4L5S A;  1IHZ A;  1X32 A;  1BBU A;  1AEX A;  4B9X A;  1KNE A;  3G6E A;  1KDA A;  4KLK A;  3MXU A;  1GUS A;  1X3P A;  3S1M H;  1L0W A;  3J81 i;  1PH5 A;  5JOB A;  1ICW A;  4MTN A;  3K8A A;  1FJG Q;  2OEO A;  2K04 A;  2KOL A;  4C3I G;  2RKS A;  4RWS C;  1LT4 D;  2F0M A;  3Q8D A;  4R4T A;  3BYY B;  2HDM A;  2WKC A;  3MHB A;  4IUR A;  1EYG A;  4OWX B;  3RMH A;  4DUZ Q;  4BWG B;  2HUG A;  2CFM A;  3BDO A;  1S3O A;  2ZM6 L;  4EVO A;  5A2Q L;  1GUW A;  3U50 C;  5FLM H;  3UDX A;  4A93 G;  4Z9C B;  4A3M H;  5IGF A;  5FKA C;  1EY5 A;  1SMX A;  2QA4 A;  1UE6 A;  3TQY A;  3T1Y Q;  2EVB A;  1SE2 A;  3DEO A;  1SYE A;  2J4X A;  3T51 B;  3ERS X;  4GKJ Q;  1EU4 A;  2WAC A;  4YY3 L;  3BG3 A;  2Z0S A;  1YNX A;  4ZCK A;  3PIO A;  2R93 B;  4RMF A;  4ZAI A;  4DXF A;  5C0X I;  4RGT A;  2UU9 L;  3K5M A;  2HCC A;  4IUQ A;  1XNR Q;  2EY1 A;  4OX9 L;  3SEB A;  1FGU A;  2K05 A;  3KLW A;  1W6J A;  5HGQ A;  4JK1 C;  3KDF B;  3P7J A;  1JMC A;  5ELB A;  3OW7 A;  4UP8 A;  1WTP A;  2YYZ A;  5HY6 A;  3M85 A;  3NHH A;  2KQ3 A;  3S1Q B;  1OXT A;  2XRQ D;  2VQE L;  1HFG A;  3HOW G;  1BR9 A;  4RGN A;  1PYW D;  4R4O A;  2A6H C;  3TEH B;  1E22 A;  4G57 A;  1JCK B;  2A69 C;  3RLO A;  1OTC A;  5C0X G;  5JAV A;  1U4M A;  2WB1 G;  1LT3 D;  5BN4 A;  2MNA A;  1HR0 L;  2JEA I;  3RLN A;  4R9W A;  1SAP A;  3RN2 A;  5IGC A;  2YTX A;  2VUM H;  1JE4 A;  4BBS G;  1HTL D;  1NMF A;  3PSI A;  4J15 A;  2VNU D;  1NY4 A;  4QJF A;  3L9A X;  3FPU B;  1I6V C;  1I94 Q;  1LTL A;  4B3S L;  1YJW A;  4U68 A;  3M7N A;  4A93 B;  1B3A A;  2ZXO A;  4AQY L;  1BBX C;  4EGV A;  5AJ3 L;  4LFA L;  1X3E A;  3KFU A;  3RR5 A;  1K3B C;  3W1G A;  3K5O A;  1JQY D;  4G7H C;  4K8J A;  1IYJ B;  1EOV A;  1RF2 D;  5C4J B;  3KJP A;  1E1O A;  4GN4 B;  2VQF Q;  2PO4 A;  2WAQ G;  5LMN L;  1MSG A;  2SNS A;  3MEH A;  5IYB G;  2WV6 D;  3GTG B;  4V19 0;  2LXJ A;  3E3X A;  3OTO L;  4LWC A;  3AQQ A;  1CQV A;  1TY0 A;  2F0U A;  1HQR D;  4KMU C;  1P8L A;  2ZTE A;  2EY6 A;  4G7Z C;  4A3E H;  1BO0 A;  4LAA A;  5C3E H;  4FYD A;  4X6A H;  1JWM D;  3HOX G;  1B1Z A;  2D5D A;  1YHA A;  2LKV A;  4LUZ A;  3HOY G;  1BBW A;  3MWY W;  3PO3 H;  4IPH A;  2OXP A;  2B2Y C;  4FXG C;  4UDU C;  1F2Z A;  3NEN A;  3HOW B;  3G48 A;  3BS1 A;  1D1K A;  3OSO A;  1CA5 A;  4U67 3;  3EBE A;  1PZK D;  2N88 A;  1WTV A;  3RN5 A;  1O7I A;  1TWH B;  1O7Z A;  1KAW A;  4HTH A;  1MHW C;  4HCS A;  5TSS A;  2WB1 B;  4ZKB B;  5LL6 X;  1H9M A;  1BCP C;  5CV6 A;  2A6H D;  4OO1 H;  2A69 D;  2EYO A;  1X3G A;  3GD7 A;  4BBS B;  2L12 A;  4DV2 L;  1E0B A;  1Y1V H;  3RD4 A;  4DXG A;  4KN7 C;  2F0W A;  4X66 L;  1GJX A;  3TP5 A;  2X69 A;  5IP7 G;  3DXJ C;  4GKK Q;  1TVX A;  2K52 A;  2K5N A;  2SOB A;  2RSN A;  3OMG A;  3MXN B;  5M5X H;  1YNJ C;  4O1N A;  4OXP A;  2ZJQ A;  1GUN A;  3EA6 A;  5IP9 G;  3KLR A;  4KK7 A;  1SMY D;  2IX0 A;  3K81 C;  1ILP A;  1GM5 A;  1E1T A;  2WAQ B;  2JXM B;  3MFG A;  5M3M G;  2QEX A;  1G8Z D;  2QDB A;  4FXD A;  1I50 H;  4N9T A;  2WFW A;  3Q22 A;  2BH2 A;  3GTJ H;  2TMP A;  1TU2 B;  1STE A;  1WTH A;  2NVY H;  3VYU A;  3M7G A;  1SE4 A;  3PO2 G;  1JC7 A;  3U9S A;  1Y1W G;  1VF7 A;  1CUK A;  3GTM B;  4IJL A;  4A3J H;  1IW7 C;  3MA2 B;  3HOY B;  3FKI H;  1TWG B;  3QB3 A;  1XMQ Q;  3B6Y A;  1LTT D;  2EOT A;  1ENC A;  2NYZ D;  5JEA H;  3CCQ A;  2B63 G;  3BZC A;  2EXZ A;  5HUR A;  1W2B A;  1TS2 A;  3ZYY X;  2XWJ B;  1XMO L;  4A3G H;  5IYC H;  3TZD A;  4NP5 A;  1VQM A;  2RCF A;  1X55 A;  2R61 A;  3M9B A;  2EJG C;  4GNX C;  1O7L A;  1EEF D;  5AFW A;  2KED A;  4FP5 D;  1KXL A;  1W3S A;  1VF5 C;  4YCV A;  1BCP D;  2UXD L;  1KIX A;  3HKS A;  4KKT A;  3D4W A;  4C3H G;  3PF5 A;  4KY5 A;  1C7Y A;  4KHP Q;  2XWB B;  4X64 L;  1HFN A;  1DJR D;  2X6L A;  1PFM A;  4FXK C;  3EVQ A;  1SYB A;  2EY2 A;  1PHJ A;  2B2V A;  4HAE A;  5D3I B;  1QCB D;  1D5X C;  3CHB D;  5FLX L;  1HXY D;  2EQS A;  1HZC A;  3KDF A;  3M4O B;  1YNJ D;  4JC0 A;  1LLR D;  1PZI D;  1WTX A;  3X3M A;  4LF8 L;  5M3M B;  2KA7 A;  3GTL H;  2E8G A;  2SNM A;  2V1C C;  3H94 A;  1SDF A;  2GVB A;  5M5W B;  4CDF C;  2UUC Q;  3I4M G;  4CKC A;  5IE8 A;  3I70 A;  1G6P A;  4CDC C;  4YWM A;  4TQU S;  3I55 A;  2VW9 A;  3S2D H;  3PO2 B;  3HOV H;  4IUN A;  1Y1W B;  1VMP A;  1PYS B;  1B9N A;  2MQH A;  1IYV A;  4DR5 Q;  4NDX A;  1Q12 A;  3E0J A;  5E7N A;  1VQL A;  2B63 B;  4WJ4 A;  1EOT A;  3I4O A;  2XRS D;  4B3T L;  2JA7 G;  4IQZ A;  1TII D;  3RUZ A;  2D2C C;  4CKE A;  1HNX Q;  5C3X A;  5KRU A;  3S1R H;  1GO3 E;  1F9R A;  3DWA A;  2JP1 A;  4R8I A;  5E1F A;  2F0J A;  1M90 C;  1STA A;  2ENB A;  5JJZ A;  1IBK L;  3DWQ A;  1BUV T;  1X65 A;  1PH6 A;  4BA1 I;  3Q24 A;  4LF5 L;  4I7A A;  4ID6 A;  1TQO A;  2EJF C;  2J0T D;  1A63 A;  2JN4 A;  1FNU A;  3M4Y A;  4JI7 L;  2EYM A;  2R92 G;  2FJ2 A;  1RKN A;  4C3H B;  5GAH C;  3TP6 A;  1JJC B;  1PMR A;  3J81 c;  3D6W A;  1GXD C;  1MGS A;  1VQ7 A;  2HD3 A;  1YIJ A;  1TWF H;  2R7Z G;  2E74 C;  1IKM A;  4JI1 Q;  1CFM A;  3S1N B;  1V43 A;  3RZD H;  3K5L A;  5CBE E;  2HCI A;  5DEH A;  5JJI A;  4JBM A;  4AYB E;  5ELC A;  2E2I B;  2Y0S E;  2JE6 I;  4DR7 Q;  1HCZ A;  1Y8O B;  1YZ6 A;  5KIX A;  5C44 G;  2BDN A;  1ENA A;  1NAP A;  2OT2 A;  1N36 L;  2H1E A;  2BH8 A;  1VQ9 A;  3V2T A;  1CKO A;  3I4M B;  4B08 A;  4KKS A;  1PFS A;  2L55 A;  5EQ0 A;  2F0K A;  3I4N G;  2K5W A;  1KRS A;  3HS0 C;  3HFZ B;  3T53 B;  1B70 B;  4XYQ A;  1YJ9 A;  2CW0 C;  3GTQ B;  1TWA H;  2ZT9 C;  3A56 A;  1S5C D;  5CV4 A;  2R7D A;  2A8V A;  2FFK B;  4DV3 Q;  3CCS A;  2PCF B;  1QB5 D;  2EIF A;  1BXT A;  1SR3 A;  2JA7 B;  4BY7 H;  1A3U A;  3ERQ A;  1K0S A;  1SNM A;  3A5Z B;  1CK1 A;  3MXN A;  4DR4 Q;  1DM0 B;  4JI4 L;  2L9H A;  2PI2 A;  1DGS A;  3NUC A;  5ELD A;  1JR0 D;  2CVR A;  3URY A;  1KNA A;  3WDN A;  4FVM A;  3S2H H;  3AFP A;  2OQ0 A;  3Q6S A;  2KCM A;  3FRP B;  3BVM A;  4Q0F A;  2BE5 C;  3HOZ G;  4XQQ A;  4LF7 L;  2RA4 A;  2R92 B;  3D31 A;  4TSS A;  5KNC A;  4MZ9 A;  1XPO A;  1XNQ Q;  4X62 L;  1EYD A;  3I73 A;  2JA5 G;  3S15 B;  2R7Z B;  1Z6H A;  2B3G A;  3DLL A;  5LL6 S;  1S5D D;  2JQO A;  5DM6 3;  4LF6 Q;  2KHS A;  4RHR A;  1O78 A;  4Y7N B;  4JI8 L;  5M5Y B;  2GN5 A;  1PLF A;  2F4V Q;  3ITP A;  5DM7 3;  1H95 A;  1U4P A;  1C9O A;  3OOC A;  4ODG A;  3HOU B;  4JYA L;  5C44 B;  3A54 A;  3QR8 A;  4JI6 L;  2NN6 I;  1HNZ L;  2KCC A;  5M3F G;  3H3V H;  2QDL A;  4X65 L;  4AH6 A;  2E5L Q;  5DNF A;  2YTY A;  2RVL A;  3I4N B;  1WFQ A;  4JI2 Q;  4JOI C;  4QCL A;  4L63 B;  2NBF A;  3HP3 A;  4TKO B;  4N8F A;  1MSH A;  4KJN A;  2ICE C;  4B9W A;  1YBY A;  4X3U A;  1NBW A;  3FHW A;  3Q0A A;  1UAP A;  2Z6K C;  2TSS A;  2CW0 D;  2ZTC A;  4DR2 Q;  4K0K L;  3NK9 A;  2CQA A;  1C8C A;  1IL2 A;  3R8B A;  5K36 G;  1G29 1;  1JJ2 A;  4A3L G;  1WOC A;  2UUB Q;  2NN6 G;  1HNW Q;  5J1Z A;  1IL8 A;  2Z8L A;  3ND9 A;  5LMU Q;  2KEN A;  1GUO A;  1HUN A;  2D0O A;  3HOZ B;  1SXT A;  2YV5 A;  4EQO A;  5G3L F;  2DNE A;  4A3C G;  1SRO A;  4DV7 Q;  2B39 A;  3D6C A;  4DV5 L;  3GTP H;  2KHI A;  2DN8 A;  2BE5 D;  4GLX A;  3A55 A;  3ICE A;  4HMI A;  2AKW B;  3HG9 A;  3HKZ E;  3CCV A;  4AIM A;  2UXB Q;  1PH4 A;  1Q1E A;  4NXN Q;  3E6Z X;  1HJP A;  3UDI A;  2OCE A;  1EZ8 A;  3CCJ A;  1EFI D;  2EXD A;  4I65 A;  4H13 C;  3K6O A;  1LUZ A;  4L8J A;  1PFB A;  2N55 A;  1KHI A;  4C3I H;  1AW7 A;  5CV5 A;  1RTN A;  1K28 A;  4K8I A;  4RH6 A;  4DUY L;  1D6E C;  1KDC A;  4A75 A;  3NE5 B;  2LFN A;  3J80 L;  2L15 A;  5M3F B;  1PZJ D;  2VB2 X;  3ERO A;  2V4D A;  2IX3 A;  4CJ0 B;  3JAM L;  1QVC A;  4AYB G;  1Q3L A;  4HN7 A;  4ME3 A;  2B2W A;  2Y0S G;  4A93 H;  4GLV B;  3W5O A;  4A4I A;  1JOQ A;  1AFP A;  2IHF A;  3IFT A;  2R3Z A;  5ELO A;  1CKM A;  1CSP A;  1A0I A;  1UNS A;  5IYD G;  1PTO C;  5IGB A;  1N33 Q;  1TS5 A;  1JWU D;  3K57 A;  1AH9 A;  3WOE A;  2F0H A;  4NXM Q;  2PW5 A;  1LYL A;  2HT1 A;  3EFX D;  2Q2I A;  1QNU A;  4JV5 L;  4I7Z C;  4QUF A;  4O2D A;  4GS3 A;  3MXP A;  1KL9 A;  2E2D C;  4NMZ A;  2D62 A;  3PIP 3;  3U58 A;  2AUK A;  2XGT A;  4LW1 A;  1IBM L;  2R7F A;  1Y8P B;  2K03 A;  2B8F A;  3E9H A;  1XWE A;  5EJW A;  4XT1 B;  2QCP X;  1SEB D;  1I4P A;  1FL0 A;  1C48 A;  2I5L X;  4G7O C;  1ZYR C;  5EPL A;  1K0R A;  4BY1 H;  1VQI A;  3HOW H;  1TWC H;  4R4Q A;  4JI5 L;  1B50 A;  2LS0 1;  2K5V A;  1ET9 A;  3M4P A;  2ZM6 Q;  1TWH H;  5C0X H;  3GQB A;  5D14 A;  1FR3 A;  1LV9 A;  2JEB I;  2IY5 B;  2MPM A;  4LNQ A;  1LTG D;  1EY6 A;  3KLS A;  2NVQ H;  1ONL A;  1IXR A;  5EPJ A;  1XPR A;  4YY3 Q;  2B29 A;  5ELN A;  4IJH A;  4AYB B;  2XTI A;  3IL8 A;  1VQD A;  3L7Z C;  3BDC A;  2Y0S B;  2Q8R E;  3P1H A;  5E3F A;  3QWN A;  1A2U A;  1K8A C;  3D3R A;  2UU9 Q;  4IFD I;  4OX9 Q;  2PZU A;  4K6L A;  1EY0 A;  2MP1 A;  4RG1 A;  1EQQ A;  1O7Y A;  3S14 H;  2E2H B;  4OWW B;  1DOK A;  4YHH L;  3F2U A;  5D65 A;  2SDF A;  1CTM A;  1IBL Q;  1SJH D;  1G2T A;  1Q46 A;  1VQJ A;  3CF5 A;  1B4O A;  1PTO D;  2UXC L;  5IYB H;  2HQE A;  3KUP A;  4LK1 C;  2F0F A;  4OL7 A;  1STN A;  4QQB X;  1J6Q A;  3C2P A;  3K7A B;  1RDP D;  2VQE Q;  5CYU A;  2F0P A;  2CCZ A;  3F2C A;  3G4S A;  2LMC B;  1DOM A;  4HCE A;  4BBR G;  1Y69 U;  3HOX H;  3GTM H;  2MO0 A;  4IFD G;  2F1M A;  3J81 E;  4QUC A;  1HR0 Q;  3RNU A;  2CH4 W;  1J5E L;  1TWG H;  1ESR A;  2L4N A;  3OWF A;  3QOJ A;  5BR8 L;  1EU3 A;  1VQF A;  1VQE A;  1MJC A;  1PTO F;  3VR4 A;  3TRE A;  2JA6 G;  4RKL A;  4DK1 A;  4P73 A;  4C2M H;  3VYT A;  1SE3 A;  4JI3 L;  4B3S Q;  4H0L C;  1B8A A;  1B2T A;  2A6E C;  4AQY Q;  2NVX H;  2F0Q A;  4LFA Q;  2AQ1 B;  5AJ3 Q;  2UUA Q;  3HKZ G;  1SNC A;  2HDL A;  4ZQ3 A;  2LXK A;  1IYU A;  1EY9 A;  2K5H A;  4KKU A;  4IFD J;  1STH A;  4JBJ A;  4ULL A;  2C5C A;  3U4V A;  3SXH A;  1F9P A;  5LMN Q;  3NBI A;  4PZ6 A;  3AMU A;  3T16 A;  1SFO H;  1VQ6 A;  3C1E A;  3OTO Q;  1WTR A;  3OMC A;  4XYO A;  5IP9 H;  3H0G G;  3CP0 A;  5L37 A;  3M4O H;  2NZ1 D;  1SBB B;  4KJO A;  1S5E D;  4HJ9 A;  1R4P B;  3CCE A;  3J80 c;  1OXX K;  3CW2 C;  4WFN 3;  2YU9 B;  1SYF A;  3K59 A;  3JAM c;  5C5L A;  3J7A F;  1VQ4 A;  5M5W H;  1FD7 D;  5FO9 B;  3CMA A;  3TS0 A;  1N34 L;  3PO2 H;  3S1M B;  4BBR B;  1Y1W H;  4RGM A;  3J81 j;  1NCV A;  4ZUJ A;  2K50 A;  2RHQ B;  3PV0 A;  1CM9 A;  1KLG D;  1JOK A;  4F88 A;  1GKH A;  4NPS A;  1OXS C;  4DV2 Q;  4MIU A;  1SLJ A;  4X66 Q;  1X56 A;  2JA6 B;  1Q90 A;  2HQL A;  1LTS D;  1NR4 A;  1K73 C;  4O42 A;  1Q7Y C;  1JB7 A;  3GTO B;  1UUP A;  4WJW A;  2B2U C;  1X3F A;  3HKZ B;  1HPC A;  2OTL A;  3RZO B;  4A3K G;  2OTJ A;  1DZ1 A;  1LAC A;  4A3D G;  1EIY B;  4DR3 L;  2A19 A;  1BCP B;  4JG2 A;  4ZK9 B;  3BDL A;  4C3H H;  1H9J A;  2HHH L;  2CH4 A;  3T1H L;  2IL8 A;  5FJ8 G;  1FNW A;  1WTQ A;  2B2T C;  1M8A A;  2F0D A;  3CRL C;  1G91 A;  2Q8T A;  1S40 A;  4F87 A;  1L1O A;  1RTO A;  2I5H A;  3S1N H;  4DV0 L;  4IUP A;  2NVT B;  1SN8 A;  4IZ8 A;  4PV1 C;  3H0G B;  3E0E A;  4BXX H;  4K14 A;  3CC2 A;  1V1P B;  4FO2 A;  2E2I H;  4OON A;  3W1B A;  1I6H B;  1PH3 A;  1BOS A;  5IOD A;  3I56 A;  1PH7 A;  2DY7 A;  4K2L A;  2OQK A;  1JE5 A;  5E4W C;  1RL2 A;  4CKB A;  1BCP F;  4K5V A;  2Z4H A;  4DV4 L;  3AFQ A;  5ELE A;  3L2P A;  4NKL A;  3I4M H;  2EYJ A;  2B8G A;  4OEM B;  1U5K A;  2JA9 A;  4XXE A;  3MC0 B;  1WCM G;  4IOC A;  5JJK A;  1EZ6 A;  1HA5 A;  2AWO A;  4A3I G;  2F0G A;  1XMO Q;  4B3M L;  4EQN A;  3M3Y H;  1Z9F A;  3CAM A;  2GA4 B;  1HHV A;  4JW0 A;  1I4G A;  5CMD A;  3X3N A;  2N8N A;  1KTK A;  1ASY A;  2JA7 H;  2UXD Q;  2MO1 A;  1Y1V G;  4BS9 A;  2O5J C;  3HEJ A;  1STY A;  3IKJ A;  1NMG A;  1JOR A;  4KY6 A;  4X64 Q;  1I3Q B;  1X54 A;  4DK6 C;  1A6X A;  3STB C;  2F0S A;  5CGK A;  4A3K B;  1PRT C;  3CQZ B;  4GOP C;  3C1F A;  1B44 D;  4A3D B;  2R92 H;  1CSQ A;  2ZXR A;  4GNX B;  3SGI A;  1LT5 D;  3FEW X;  1I5F A;  2KVM A;  3EIV A;  4LF8 Q;  1NE3 A;  1H9K A;  2WKD A;  3PUX A;  1VQG A;  4DK3 C;  3D4D A;  3L3O C;  2F0T A;  4UY8 C;  4JBW A;  3KLS X;  1JIC A;  5I9O A;  3K5N A;  2RBM A;  3L0O A;  4HJ5 A;  1B3Q A;  4DN4 M;  4JVZ A;  4DR1 L;  2D9U A;  2DJF C;  2RF4 A;  2PQA B;  1K9M C;  2PYK A;  5I4D A;  3PO3 B;  1B9M A;  1E2W A;  2A5H A;  4PMC A;  1HA6 A;  1IW7 D;  4B3T Q;  4UPA A;  1WCM B;  3TME A;  1D5M C;  3VR3 A;  4A3I B;  1QVF A;  3J7A 5;  4KI0 A;  3HZX A;  4ILW A;  4A3G G;  3MZ5 A;  4KD3 A;  1JB3 A;  4CJ1 B;  1IBK Q;  4RHS A;  3EQL C;  4R8N A;  4LF5 Q;  4C1N K;  3F8T A;  4KV6 A;  4DK0 A;  3KOJ A;  4KN4 C;  4JI7 Q;  1E7Z A;  1V1Q A;  4J6H A;  2PNH A;  1AZQ A;  1Y1V B;  3H15 A;  3J7Z C;  3DWP A;  1N32 L;  4YWK A;  3OYY A;  2CWA A;  3A8K E;  4HJ8 A;  1DON A;  1K83 H;  3TBI B;  3I72 A;  5EGT A;  2A74 C;  3SDZ A;  2E2J B;  3HGB A;  2WII B;  4LF9 L;  2Z4I A;  3A8J E;  1JWS D;  1QWY A;  2M2L A;  1T5X D;  5BN3 A;  4ZRZ A;  2N3S A;  3STB D;  5M9O A;  4P2C B;  3M4Q A;  1A8V A;  2Z1C A;  4WOR A;  3OHX C;  4RCN A;  3BZK A;  2JA5 H;  1F2L A;  3HOU G;  5JVG 3;  4BA2 I;  3O13 A;  1N36 Q;  2LY7 A;  3F2B A;  2RDG A;  1I50 B;  3J80 i;  5GAD C;  2G9D A;  3QJY A;  2EE1 A;  1KDB A;  3DM1 A;  2QW7 A;  1YHQ A;  3GTJ B;  1FYC A;  1CT1 D;  2NVY B;  3JAM i;  4QGU A;  2A1A A;  4PNY A;  5I9P A;  2AWN A;  2F52 A;  1R9T H;  2ZJR A;  4LFB L;  1MI2 A;  4UP7 A;  4A3B G;  3QOL A;  3F2D A;  3AB9 A;  4HJA A;  5M3F H;  2NZH A;  2VB3 X;  5D3D A;  1PRT F;  4B3R L;  1LAB A;  2BA0 A;  2B2Y A;  4R1J A;  4CJ2 C;  4DV1 L;  3BYT B;  2FXQ A;  4IPC A;  2D0P A;  1TXY A;  1AE3 A;  4F7X A;  4JI4 Q;  2KEE A;  4A3G B;  3PUY A;  1EWI A;  5ELF A;  4L5R C;  1G51 A;  2OF1 A;  1EL0 A;  5IWA L;  2EPB A;  2PMZ E;  1VQP A;  5KEE A;  3WWV A;  4ME5 A;  3NPP A;  2I0Q A;  4GZY C;  5DAU A;  4LF7 Q;  5K36 H;  2ZTD A;  1B53 A;  1EUJ A;  3BJU A;  3S24 A;  4X62 Q;  4A76 A;  1YIT A;  3QO2 A;  4A3L H;  3ER0 A;  1K8O A;  2NN6 H;  1XYI A;  4KHZ A;  3AYH B;  3P20 A;  1PFN A;  2JA8 G;  4P71 A;  1V1P A;  1WI5 A;  4QB4 A;  4CDD C;  2FHT A;  3FP9 A;  1LO5 D;  4JI8 Q;  4A3C H;  2MGS A;  3R3O A;  1EYC A;  4OWT B;  3F1Z A;  4JYA Q;  1QG7 A;  2Q2H A;  1SNO A;  1YJN A;  3KF6 B;  3S9W A;  1K8G A;  4JI6 Q;  1DYQ A;  4GN3 B;  3OIQ A;  1HNZ Q;  3GTL B;  4KD4 A;  4MN3 A;  4X65 Q;  1CZW A;  3KK7 A;  2RQX A;  3LWU A;  1WJJ A;  2R6G A;  4CGY B;  4LF4 L;  3PGZ A;  3J80 E;  3MXG A;  1D5Z C;  3E5S A;  5FLX c;  2G5D A;  2KHJ A;  5G3L D;  1II3 A;  4DV6 L;  4JBK A;  3JAM E;  4A3B B;  1HZA A;  1YNN C;  1XPU A;  1U4L A;  4K0K Q;  1EY4 A;  3A7L A;  5GRO A;  2VY3 A;  5IIF A;  2R93 H;  4M1U B;  5JJL A;  4POF A;  4CBV A;  4DA2 A;  1VDZ A;  3S1R B;  3TS2 A;  1CHP D;  3PCO B;  4IO9 A;  5C4X G;  3D4R A;  1NUC A;  4GNX A;  4XT3 B;  5K5P A;  3K0X A;  2NZO A;  1EEI D;  4IAL A;  1OXU A;  4XIG S;  5KYL A;  4DV5 Q;  2QF7 A;  3K7A H;  3S1Q H;  4J8Q A;  1CKN B;  4C3J G;  4E6I A;  4LFC L;  2JA8 B;  4WJ3 M;  3T4A C;  3RZD B;  2F03 A;  4RFB A;  2K1B A;  1UEA B;  2HIV A;  2EJM A;  3CC4 A;  1D8L A;  2PQA A;  2WP8 J;  1SNQ A;  4RKB A;  3PIP A;  3K0Y A;  1S5B D;  4DUY Q;  4KTA A;  1RJT A;  2A73 B;  5A2Q E;  2IJ0 A;  3MTS A;  1ESF A;  1V8Q A;  4OHJ A;  1PH9 A;  4HR7 B;  3WOF A;  4Q5V A;  3SR1 A;  1L0Y B;  1P16 A;  3CPW A;  1U9R A;  1ROD A;  5CR3 A;  5EKI A;  3H6M A;  2Z9H A;  3I3C A;  4DAY B;  1STG A;  1PH1 A;  1MKH A;  2EDG A;  1GVP A;  4DFA A;  3KYH C;  2H5X A;  5IY0 A;  4OIJ A;  5C4J H;  2DUD A;  4IUV A;  1GOZ A;  1ML0 D;  1YNN D;  3KF8 B;  4IOA A;  1T9H A;  2SEB D;  3GTG H;  5IT9 L;  2DJG C;  1DD2 A;  4PZ7 A;  4JV5 Q;  2PZW A;  4MHE A;  2MJ8 A;  4WRD A;  1EQV A;  1T5E A;  1L1O B;  5LHY 1;  4HIK A;  5C4X B;  2C9O A;  4PQX A;  1X3Q A;  3OWE B;  3N52 A;  4JI0 L;  4DR6 L;  1AE2 A;  4NB3 A;  1IBM Q;  3N6R A;  4F8M A;  1PTO B;  2YTV A;  4TRD A;  1LM0 A;  2RDF A;  5CBA E;  3K58 A;  1DCZ A;  4GLA C;  4P74 A;  3H3V C;  3VR6 A;  1U0L A;  1Q81 C;  1EYA A;  3GO5 A;  3NQI A;  1NR2 A;  2XSC A;  3NWS A;  4QIW E;  4C3J B;  1O80 A;  2N78 A;  4JI5 Q;  3AEV A;  4BBR H;  2QIL A;  2AHO B;  4DPG A;  4UAI A;  1L0X B;  2IW3 A;  1UE5 A;  4S3S A;  4IFD H;  3U9O A;  1KAB A;  2DNC A;  2EYH A;  2P5Z X;  5T1I A;  1FJG L;  3NSW A;  2L5T A;  1PH8 A;  3GTK B;  5CV9 A;  2I46 A;  4A3F G;  2VS1 A;  3G6J B;  3I90 A;  4XQN A;  4BBS H;  2AQ3 B;  1TS3 A;  1D7Q A;  3UE1 A;  2JA6 H;  2XVS A;  4DUZ L;  5NUC A;  1UEB A;  1V9P A;  1I4R A;  4KHV A;  2MFI A;  3GTO H;  1RD9 D;  5EKK A;  1A15 A;  1H9S B;  4R4I A;  2RDH A;  1HH2 P;  3RZO H;  2B2V C;  3NXW A;  3FPP A;  3BVZ A;  4KY7 A;  3C46 A;  3T1Y L;  1FVI A;  1VQK A;  2KCT A;  4DNT B;  4YHH Q;  4GKJ L;  1UWV A;  4HIM A;  5IOC A;  4FF1 A;  4ZYS A;  1KLU D;  2UXC Q;  4YIJ A;  1V1O A;  3UI2 A;  4FDB A;  1KD1 C;  4MTK A;  2NVT H;  3NTI A;  3DEP A;  3S17 B;  3H0G H;  2Q8I B;  1XNR L;  3DUZ A;  4CHT B;  3C3L A;  1MIU A;  3A74 A;  1I6H H;  4HID A;  1IBL L;  3HOY H;  5FO7 B;  1VQH A;  3KF6 A;  4K6D A;  1J5E Q;  1GHJ A;  3DMU A;  1QUQ A;  2QGQ A;  1NSN S;  3GTP B;  5BR8 Q;  1CA6 A;  2PMZ B;  1KRT A;  4M8A A;  2CWP A;  4BY1 G;  3PMF A;  1NTG A;  1BVS A;  1HZB A;  1VS0 A;  2XN9 C;  1ZYR D;  1RIP A;  4DGZ A;  4JI3 Q;  4YWL A;  3A7A B;  4DNI A;  3CXC A;  3MVV A;  5FLM G;  4C3I B;  4A3M G;  4A3F B;  3PUV A;  1IKL A;  2K01 A;  2EYF A;  1BQQ T;  1VQA A;  4N9P A;  1OO9 B;  3W2D A;  5GAG C;  4ZLT F;  2F3W A;  2EYL A;  3PIO 3;  4RAU C;  3SHL A;  4FF3 A;  2K28 A;  1HUM A;  5IP7 H;  3KBX A;  1N9W A;  3V05 A;  1SSO A;  3IAY A;  1I3Q H;  1K8M A;  3K80 C;  2ASB A;  1I94 L;  5KNB A;  2K5D A;  2K32 A;  1SMY C;  1PXU A;  4A3K H;  4JOI A;  2UUA L;  4J1M A;  3IRB A;  3S16 B;  1XXG A;  3CQZ H;  3J7Y W;  3G71 A;  4A3D H;  1XTC D;  5C0X J;  4GN5 A;  3KBG A;  4OGQ C;  2M00 A;  2Z6K A;  5J3B A;  4ABN A;  5FJ8 H;  3EN2 A;  1TS4 A;  4H44 C;  1FGB D;  2CQO A;  5M3M H;  1WD1 A;  2VQF L;  1S4Z A;  3OPO A;  1WTW A;  1BF4 A;  1CKN A;  3I7F A;  5CC4 A;  2KEC A;  3NTH A;  1A62 A;  3TP8 A;  4PZ8 A;  2NUC A;  4HED A;  1N34 Q;  1G6Z A;  1SYC A;  1F2Y A;  3PQI A;  3CRK C;  2N49 A;  1SYG A;  3R2I A;  3EJI A;  1GUT A;  2F0L A;  2L0C A;  2JSO A;  2B63 H;  4IUT A;  4BY1 B;  2VUM G;  2KJX A;  1WCM H;  2NB0 A;  5IT9 c;  1X6O A;  3J81 L;  4P75 A;  1TWC B;  4A3I H;  1Q86 C;  4UHV A;  1E24 A;  1HRJ A;  3PF4 A;  3E9I A;  3SE0 A;  4HMJ A;  1R4Q B;  3P75 A;  4DAY A;  3FDT A;  2F0V A;  1Q8K A;  3BZD B;  5C5M A;  1LT6 D;  3QIA A;  4UP9 A;  1EY8 A;  4A3M B;  3ONA B;  3VYS A;  3VYR A;  3CCU A;  4DAV A;  2A6E D;  2JYO A;  2NVQ B;  4IUU A;  5EPK A;  4DR3 Q;  2PPB C;  1X9N A;  3KF8 A;  4JPB W;  4EX5 A;  1VQO A;  2HHH Q;  3T1H Q;  3I2Z A;  3BU2 A;  2RCN A;  3ULL A;  2K6A A;  5FLX E;  4GKK L;  5COR A;  1Q82 C;  4DV0 Q;  2E2J H;  4L5Q A;  3TP7 A;  1G2S A;  3MAQ A;  1PH2 A;  3SK4 A;  2DY8 A;  4ZKC B;  4OO1 I;  2XNA C;  2QEJ C;  3S14 B;  4A3E G;  3I4L A;  5C3E G;  2RSO A;  3NP8 A;  1SNP A;  3H91 A;  5KGU A;  2NTS A;  4DV4 Q;  2LSS A;  3PO3 G;  5A35 A;  3OIP A;  1HQM C;  3TSS A;  2IX1 A;  1E2Z A;  2AQ2 B;  4XQJ A;  1XJV A;  2MHV A;  4HSV A;  4B3M Q;  1UE1 A;  5CV8 A;  1C4Q A;  2O5I C;  2E76 C;  3HOX B;  3GTQ H;  2F0I A;  1KC8 C;  2O2L D;  3UDF A;  4IPD A;  1ET6 A;  3CCR A;  1XMQ L;  4OO1 G;  1D2B A;  5E4X A;  2VUM B;  1Z7T A;  2F0N A;  1H9S A;  4X3T A;  1U4R A;  3SVM A;  3LWE A;  1SRU A;  1CI3 M;  4C2M B;  4ALP A;  1WD0 A;  2K5Q A;  5KYI A;  2AMC B;  3TRZ A;  2NVX B;  3W3A A;  4QIW B;  5FO8 B;  2CKZ B;  2ZXP A;  1QZG A;  2FMM A;  5C6A A;  5COY A;  1XX8 A;  4HJ7 A;  1QE6 A;  3GV3 A;  1TY2 A;  3S15 H;  1SND A;  4KHP L;  5F2D A;  2R7Z H;  1Q8I A;  2I07 B;  1EWH A;  1LTI D;  5IGD A;  3RLF A;  3Q23 A;  1SFO B;  3NWT A;  1Y8N B;  4DAM A;  3PUW A;  4H7B A;  4HSP A;  2CHB D;  1SE8 A;  4Y7N H;  3UDG A;  4QY7 A;  4LMQ D;  5JPN C;  5M5Y H;  4BXX G;  4A3E B;  5EKL A;  2PZT A;  1PRT B;  2L11 A;  4K2K A;  3K7U C;  4YCU A;  1A3T A;  5I6W A;  5C3E B;  1NJI C;  2G9H D;  4DF7 A;  4GOP B;  3HOU H;  2J7Z A;  3JC6 6;  4X3K A;  2KCN A;  5C44 H;  1VQ8 A;  1EFW A;  2Z6B A;  4DR1 Q;  4N8X 1;  3D8G A;  1OXV A;  4A3J G;  4MNO A;  3CD6 A;  3FKI G;  5I2Y A;  4ZUI A;  1QIL A;  3CKI B; 
#chains in the Genus database with same CATH homology
 5JEA G;  1CZG A;  2B2W C;  1HTP A;  1FNV A;  3HRZ C;  2XIW A;  4DNR B;  4RCO A;  1VMC A;  3H09 A;  4OIK A;  3SK5 A;  1GUG A;  1ZKO A;  2NTT A;  3GV6 A;  2WIN B;  1H9R A;  1E2V A;  5FOB B;  3SK6 A;  3LX0 A;  5JEA J;  2H4O A;  1F2M A;  5M5X B;  1BDO A;  3VR5 A;  3T56 B;  5KND A;  1PRT D;  2MUY A;  3DHQ A;  5FK9 C;  2IWH A;  2PNR C;  3VA7 A;  1LTB D;  2EZV A;  1QJO A;  4PMB A;  5C3W A;  1TKW B;  4FF4 A;  2K33 A;  5JPM C;  4A3J B;  1STB A;  1EQT A;  3FKI B;  1CQF A;  1J8I A;  3VR2 A;  1DXM A;  1M4V A;  5HGT A;  3I91 A;  3M3Y B;  2L1B A;  3TZU A;  1EIH A;  1VCI A;  3LNN A;  2O4X A;  1EIG A;  1EWC A;  1CHQ D;  3MFY A;  1W6K A;  4RA8 A;  4DAP A;  4LJZ C;  1Z47 A;  1TR5 A;  4C1N I;  5EBC A;  1AN8 A;  1DOL A;  3PUZ A;  4FF2 A;  5ISR A;  5C4H A;  2B2U A;  4IN3 A;  3CU7 A;  1J9O A;  5J39 A;  3NQT A;  1MBY A;  1SYD A;  4X3S A;  1D1I A;  3VA5 A;  1PTO H;  2NWG A;  2F0O A;  2B2T A;  4V0B A;  1LTR D;  2X6G A;  1I4H A;  1BNZ A;  3TN2 A;  4EQP A;  2K7V A;  5IGG A;  2VXW A;  5BN5 A;  3S2D B;  3HOV B;  2BA1 A;  3R93 A;  3I8Z A;  1GHK A;  2IPK D;  1RCV D;  1PDQ A;  1ILQ A;  5T1G A;  1EY7 A;  5C4Z A;  2BOS A;  3J7A V;  4DU9 A;  2FIN B;  2EY5 A;  1TT2 A;  2IT1 A;  4QMG A;  2F0E A;  4K5W A;  1ZXT A;  2M9V A;  5IT9 E;  1ZEQ X;  5EBD A;  2A68 C;  5I2X A;  2ID0 A;  3ND8 A;  3FMC A;  5I6Y A;  1F77 A;  3G7L A;  3R2T A;  4FNF A;  1WVL A;  1F9S A;  2BDO A;  1K83 B;  3FVQ A;  1F9Q A;  1TWF B;  5J22 A;  2QKI C;  1JOO A;  2E75 C;  1I4Q A;  3AU7 A;  4NW2 A;  1A2T A;  1QOH A;  2F4I A;  1QNK A;  1SJE D;  2EYP A;  4K5X A;  2JA5 B;  3TDQ A;  1MD2 D;  3GP7 A;  4QF4 A;  1AZP A;  1S5F D;  2KUM A;  4XTC S;  2ICI A;  4G4K A;  5JVH 3;  1AP0 A;  4C56 C;  1KAA A;  1WTO A;  3A8I E;  1A3V A;  5IGE A;  1R9T B;  2F3V A;  1Q1B A;  1TWA B;  1ENF A;  3IFD A;  3SK8 A;  4BY7 B;  2PQE A;  1RHP A;  3QG1 A;  4XDX A;  1LTA D;  3NBH A;  3S2H B;  1I4X A;  3T13 A;  5CV7 A;  2PW7 A;  3BVG A;  3NTK A;  4L6T B;  2FMC A;  4PMW A;  2A68 D;  3V96 A;  4RGO S;  2BCO A;  2AUJ D;  1IHZ A;  1X32 A;  1AEX A;  4B9X A;  1KNE A;  1KDA A;  3MXU A;  1GUS A;  1X3P A;  5JOB A;  1ICW A;  2OEO A;  2K04 A;  2KOL A;  4C3I G;  2RKS A;  4RWS C;  1LT4 D;  2F0M A;  3BYY B;  2HDM A;  2WKC A;  3MHB A;  4IUR A;  3RMH A;  4BWG B;  2HUG A;  3BDO A;  4EVO A;  5A2Q L;  1GUW A;  4Z9C B;  5IGF A;  5FKA C;  1EY5 A;  2EVB A;  1SE2 A;  3DEO A;  1SYE A;  2J4X A;  3T51 B;  1EU4 A;  2WAC A;  3BG3 A;  2R93 B;  4ZAI A;  4DXF A;  5C0X I;  4RGT A;  3K5M A;  2HCC A;  4IUQ A;  2EY1 A;  3SEB A;  2K05 A;  1W6J A;  4JK1 C;  3P7J A;  5ELB A;  3OW7 A;  1WTP A;  2YYZ A;  3M85 A;  3NHH A;  2KQ3 A;  3S1Q B;  1OXT A;  2XRQ D;  1HFG A;  1BR9 A;  4RGN A;  1PYW D;  2A6H C;  4G57 A;  1JCK B;  2A69 C;  5C0X G;  5JAV A;  1U4M A;  1LT3 D;  5BN4 A;  2JEA I;  4R9W A;  1SAP A;  5IGC A;  1JE4 A;  1HTL D;  2VNU D;  3L9A X;  3FPU B;  1I6V C;  4U68 A;  3M7N A;  4A93 B;  1B3A A;  2ZXO A;  1BBX C;  4EGV A;  3K5O A;  1JQY D;  4G7H C;  4K8J A;  1RF2 D;  5C4J B;  2PO4 A;  1MSG A;  2SNS A;  3MEH A;  2WV6 D;  3GTG B;  4V19 0;  1CQV A;  1TY0 A;  2F0U A;  1HQR D;  4KMU C;  2EY6 A;  4G7Z C;  1BO0 A;  4LAA A;  4FYD A;  1JWM D;  1B1Z A;  2D5D A;  2LKV A;  3MWY W;  2OXP A;  4FXG C;  2B2Y C;  4UDU C;  1F2Z A;  3HOW B;  3BS1 A;  1D1K A;  3OSO A;  1CA5 A;  4U67 3;  1PZK D;  2N88 A;  1WTV A;  1TWH B;  1O7Z A;  4HTH A;  5TSS A;  4HCS A;  2WB1 B;  4ZKB B;  5LL6 X;  1H9M A;  1BCP C;  5CV6 A;  2A6H D;  4OO1 H;  2A69 D;  2EYO A;  3GD7 A;  4BBS B;  2L12 A;  1E0B A;  3RD4 A;  4DXG A;  4KN7 C;  2F0W A;  1GJX A;  3TP5 A;  2X69 A;  3DXJ C;  1TVX A;  2SOB A;  2RSN A;  3OMG A;  1YNJ C;  4O1N A;  1GUN A;  3EA6 A;  3KLR A;  4KK7 A;  1SMY D;  2IX0 A;  1ILP A;  2WAQ B;  2JXM B;  3MFG A;  1G8Z D;  2QDB A;  4FXD A;  4N9T A;  3Q22 A;  2TMP A;  1TU2 B;  1STE A;  3VYU A;  3M7G A;  1SE4 A;  1JC7 A;  3U9S A;  1VF7 A;  3GTM B;  1IW7 C;  3MA2 B;  3HOY B;  1TWG B;  3QB3 A;  1LTT D;  2EOT A;  1ENC A;  2NYZ D;  5JEA H;  2EXZ A;  5HUR A;  1TS2 A;  3ZYY X;  2XWJ B;  3TZD A;  4NP5 A;  2R61 A;  2EJG C;  1O7L A;  1EEF D;  5AFW A;  2KED A;  4FP5 D;  1VF5 C;  1BCP D;  4KKT A;  3D4W A;  4C3H G;  4KY5 A;  2XWB B;  1HFN A;  1DJR D;  2X6L A;  1PFM A;  4FXK C;  3EVQ A;  1SYB A;  2EY2 A;  2B2V A;  4HAE A;  5D3I B;  1QCB D;  1D5X C;  3CHB D;  5FLX L;  1HXY D;  3M4O B;  1YNJ D;  1LLR D;  1PZI D;  1WTX A;  3X3M A;  5M3M B;  2KA7 A;  2SNM A;  3H94 A;  1SDF A;  5M5W B;  4CKC A;  3I70 A;  4TQU S;  3PO2 B;  4IUN A;  1Y1W B;  1VMP A;  1B9N A;  1IYV A;  4NDX A;  1Q12 A;  3E0J A;  2B63 B;  1EOT A;  2XRS D;  4IQZ A;  1TII D;  3RUZ A;  2D2C C;  4CKE A;  5C3X A;  5KRU A;  1F9R A;  3DWA A;  2JP1 A;  4R8I A;  5E1F A;  2F0J A;  1STA A;  2ENB A;  5JJZ A;  3DWQ A;  1BUV T;  4BA1 I;  3Q24 A;  4ID6 A;  1TQO A;  2EJF C;  2J0T D;  1FNU A;  3M4Y A;  2EYM A;  2FJ2 A;  1RKN A;  4C3H B;  3TP6 A;  1PMR A;  3D6W A;  1GXD C;  1MGS A;  2E74 C;  1IKM A;  1CFM A;  3S1N B;  1V43 A;  3K5L A;  5CBE E;  2HCI A;  5DEH A;  5ELC A;  2E2I B;  2JE6 I;  1HCZ A;  1Y8O B;  5KIX A;  2BDN A;  1ENA A;  1NAP A;  2OT2 A;  2H1E A;  3V2T A;  3I4M B;  4B08 A;  4KKS A;  2L55 A;  5EQ0 A;  2F0K A;  2K5W A;  3HS0 C;  3T53 B;  4XYQ A;  2CW0 C;  3GTQ B;  2ZT9 C;  3A56 A;  1S5C D;  5CV4 A;  2FFK B;  2PCF B;  1QB5 D;  1BXT A;  2JA7 B;  1A3U A;  3ERQ A;  1SNM A;  1CK1 A;  3MXN A;  1DM0 B;  2L9H A;  3NUC A;  5ELD A;  1JR0 D;  2CVR A;  3URY A;  1KNA A;  3WDN A;  4FVM A;  3Q6S A;  3FRP B;  3BVM A;  4Q0F A;  2BE5 C;  4XQQ A;  2RA4 A;  2R92 B;  3D31 A;  4TSS A;  5KNC A;  1EYD A;  3I73 A;  3S15 B;  2R7Z B;  1Z6H A;  5LL6 S;  1S5D D;  5DM6 3;  2KHS A;  4RHR A;  1O78 A;  4Y7N B;  5M5Y B;  1PLF A;  3ITP A;  5DM7 3;  1U4P A;  3OOC A;  4ODG A;  3HOU B;  5C44 B;  3A54 A;  2NN6 I;  2KCC A;  5DNF A;  2RVL A;  3I4N B;  4QCL A;  4L63 B;  2NBF A;  3HP3 A;  4TKO B;  1MSH A;  4KJN A;  2ICE C;  4B9W A;  4X3U A;  3Q0A A;  1UAP A;  2TSS A;  2CW0 D;  3NK9 A;  2CQA A;  1C8C A;  3R8B A;  5K36 G;  1G29 1;  2NN6 G;  5J1Z A;  1IL8 A;  2Z8L A;  3ND9 A;  1GUO A;  1HUN A;  3HOZ B;  1SXT A;  4EQO A;  5G3L F;  2DNE A;  2B39 A;  3D6C A;  2DN8 A;  2BE5 D;  3A55 A;  4HMI A;  3HG9 A;  1Q1E A;  3E6Z X;  1EZ8 A;  1EFI D;  4I65 A;  4H13 C;  3K6O A;  4L8J A;  1PFB A;  2N55 A;  1AW7 A;  5CV5 A;  1RTN A;  4K8I A;  4RH6 A;  1D6E C;  1KDC A;  3NE5 B;  2LFN A;  3J80 L;  5M3F B;  1PZJ D;  2VB2 X;  3ERO A;  2V4D A;  2IX3 A;  4CJ0 B;  3JAM L;  1Q3L A;  4HN7 A;  2B2W A;  1JOQ A;  1AFP A;  3IFT A;  2R3Z A;  1UNS A;  1PTO C;  5IGB A;  1TS5 A;  1JWU D;  3K57 A;  3WOE A;  2F0H A;  2PW5 A;  3EFX D;  1QNU A;  4I7Z C;  4QUF A;  3MXP A;  2E2D C;  4NMZ A;  2D62 A;  3PIP 3;  2AUK A;  1Y8P B;  2K03 A;  2B8F A;  1XWE A;  5EJW A;  4XT1 B;  2QCP X;  1SEB D;  1I4P A;  1C48 A;  4G7O C;  1ZYR C;  5EPL A;  1B50 A;  2LS0 1;  1ET9 A;  5C0X H;  3GQB A;  5D14 A;  1FR3 A;  1LV9 A;  2JEB I;  2MPM A;  1LTG D;  1EY6 A;  3KLS A;  1ONL A;  5EPJ A;  4AYB B;  3IL8 A;  3L7Z C;  3BDC A;  2Y0S B;  2Q8R E;  3P1H A;  5E3F A;  3QWN A;  1A2U A;  3D3R A;  4IFD I;  2PZU A;  4K6L A;  1EY0 A;  2MP1 A;  1O7Y A;  2E2H B;  1DOK A;  3F2U A;  5D65 A;  2SDF A;  1CTM A;  1SJH D;  1G2T A;  1B4O A;  1PTO D;  2HQE A;  3KUP A;  4LK1 C;  2F0F A;  4OL7 A;  1STN A;  3C2P A;  3K7A B;  1RDP D;  5CYU A;  2F0P A;  2LMC B;  1DOM A;  4HCE A;  1Y69 U;  4IFD G;  2F1M A;  3J81 E;  4QUC A;  1ESR A;  2L4N A;  3OWF A;  3QOJ A;  1EU3 A;  1PTO F;  3VR4 A;  4RKL A;  4DK1 A;  3VYT A;  1SE3 A;  4H0L C;  1B2T A;  2A6E C;  2F0Q A;  2AQ1 B;  1SNC A;  2HDL A;  4ZQ3 A;  1IYU A;  1EY9 A;  4KKU A;  4IFD J;  1STH A;  4ULL A;  2C5C A;  3SXH A;  1F9P A;  3AMU A;  3NBI A;  3T16 A;  3C1E A;  1WTR A;  3OMC A;  4XYO A;  2NZ1 D;  1SBB B;  4KJO A;  1S5E D;  1R4P B;  1OXX K;  4WFN 3;  2YU9 B;  1SYF A;  3K59 A;  3J7A F;  5C5L A;  1FD7 D;  5FO9 B;  3S1M B;  4BBR B;  4RGM A;  1NCV A;  4ZUJ A;  3PV0 A;  1CM9 A;  1KLG D;  1JOK A;  4F88 A;  1OXS C;  4MIU A;  2JA6 B;  1Q90 A;  1LTS D;  1NR4 A;  4O42 A;  3GTO B;  1UUP A;  4WJW A;  2B2U C;  3HKZ B;  1HPC A;  3RZO B;  1DZ1 A;  1LAC A;  1BCP B;  4ZK9 B;  3BDL A;  1H9J A;  2IL8 A;  1FNW A;  1WTQ A;  2B2T C;  1M8A A;  2F0D A;  3CRL C;  1G91 A;  2Q8T A;  4F87 A;  1RTO A;  2NVT B;  4IUP A;  4IZ8 A;  4PV1 C;  3H0G B;  4K14 A;  1V1P B;  4FO2 A;  1I6H B;  1BOS A;  5IOD A;  2DY7 A;  4K2L A;  5E4W C;  4CKB A;  4K5V A;  2Z4H A;  5ELE A;  4NKL A;  2EYJ A;  2B8G A;  4XXE A;  3MC0 B;  1EZ6 A;  1HA5 A;  2AWO A;  2F0G A;  4EQN A;  2GA4 B;  1HHV A;  1I4G A;  5CMD A;  3X3N A;  1KTK A;  4BS9 A;  2O5J C;  3HEJ A;  1STY A;  3IKJ A;  1JOR A;  4KY6 A;  1I3Q B;  1A6X A;  2F0S A;  5CGK A;  4A3K B;  1PRT C;  3CQZ B;  3C1F A;  1B44 D;  4A3D B;  2ZXR A;  1LT5 D;  3FEW X;  2KVM A;  1H9K A;  2WKD A;  3PUX A;  3D4D A;  3L3O C;  2F0T A;  4JBW A;  3KLS X;  1JIC A;  5I9O A;  3K5N A;  2RBM A;  4DN4 M;  2D9U A;  2PYK A;  5I4D A;  3PO3 B;  1B9M A;  1E2W A;  2A5H A;  4PMC A;  1HA6 A;  1IW7 D;  1WCM B;  3TME A;  1D5M C;  3VR3 A;  4A3I B;  4KI0 A;  3HZX A;  4ILW A;  3MZ5 A;  4KD3 A;  1JB3 A;  4CJ1 B;  4RHS A;  3EQL C;  4R8N A;  4C1N K;  4KV6 A;  4DK0 A;  4KN4 C;  4J6H A;  1AZQ A;  1Y1V B;  3DWP A;  3A8K E;  1DON A;  3TBI B;  3I72 A;  5EGT A;  2A74 C;  3SDZ A;  2E2J B;  3HGB A;  2WII B;  2Z4I A;  3A8J E;  1JWS D;  1QWY A;  2M2L A;  1T5X D;  5BN3 A;  4ZRZ A;  5M9O A;  4P2C B;  2Z1C A;  4WOR A;  3OHX C;  4RCN A;  1F2L A;  5JVG 3;  4BA2 I;  3O13 A;  2LY7 A;  2RDG A;  1I50 B;  2G9D A;  3QJY A;  2EE1 A;  1KDB A;  3DM1 A;  3GTJ B;  1FYC A;  1CT1 D;  2NVY B;  5I9P A;  4PNY A;  2AWN A;  1MI2 A;  3QOL A;  3AB9 A;  2VB3 X;  5D3D A;  1PRT F;  1LAB A;  2BA0 A;  2B2Y A;  4CJ2 C;  3BYT B;  4F7X A;  2KEE A;  4A3G B;  3PUY A;  5ELF A;  1EL0 A;  2OF1 A;  2EPB A;  5KEE A;  4ME5 A;  3NPP A;  4GZY C;  5DAU A;  5K36 H;  1B53 A;  3QO2 A;  1K8O A;  2NN6 H;  1XYI A;  4KHZ A;  3P20 A;  1PFN A;  1V1P A;  4QB4 A;  2FHT A;  1LO5 D;  2MGS A;  3R3O A;  1EYC A;  1QG7 A;  1SNO A;  3S9W A;  1DYQ A;  3OIQ A;  3GTL B;  4KD4 A;  4MN3 A;  1CZW A;  3KK7 A;  2RQX A;  3LWU A;  2R6G A;  4CGY B;  3J80 E;  3MXG A;  1D5Z C;  3E5S A;  5G3L D;  1II3 A;  3JAM E;  4A3B B;  1YNN C;  1U4L A;  1EY4 A;  3A7L A;  5IIF A;  4M1U B;  4CBV A;  4DA2 A;  1VDZ A;  3S1R B;  1CHP D;  3D4R A;  1NUC A;  4XT3 B;  5K5P A;  1EEI D;  4IAL A;  1OXU A;  4XIG S;  5KYL A;  2QF7 A;  4J8Q A;  4C3J G;  4E6I A;  2JA8 B;  3T4A C;  3RZD B;  2F03 A;  4RFB A;  2K1B A;  1UEA B;  2EJM A;  2WP8 J;  1SNQ A;  4RKB A;  3K0Y A;  1S5B D;  4KTA A;  1RJT A;  2A73 B;  5A2Q E;  2IJ0 A;  3MTS A;  1ESF A;  1V8Q A;  4OHJ A;  4HR7 B;  3WOF A;  4Q5V A;  3SR1 A;  1L0Y B;  1U9R A;  1ROD A;  5CR3 A;  5EKI A;  3H6M A;  3I3C A;  1STG A;  2EDG A;  4DFA A;  4OIJ A;  4IUV A;  1GOZ A;  1ML0 D;  1YNN D;  2SEB D;  5IT9 L;  1DD2 A;  2PZW A;  4MHE A;  2MJ8 A;  4WRD A;  1EQV A;  1T5E A;  5LHY 1;  5C4X B;  2C9O A;  4PQX A;  1X3Q A;  3OWE B;  3N52 A;  3N6R A;  4F8M A;  1PTO B;  4TRD A;  2RDF A;  5CBA E;  3K58 A;  1DCZ A;  3H3V C;  3VR6 A;  1EYA A;  3GO5 A;  3NQI A;  1NR2 A;  2XSC A;  3NWS A;  4C3J B;  1O80 A;  2QIL A;  4UAI A;  1L0X B;  2IW3 A;  4S3S A;  4IFD H;  3U9O A;  1KAB A;  2DNC A;  2EYH A;  5T1I A;  3NSW A;  2L5T A;  3GTK B;  5CV9 A;  2I46 A;  3G6J B;  3I90 A;  4XQN A;  2AQ3 B;  1TS3 A;  2XVS A;  5NUC A;  1I4R A;  4KHV A;  1RD9 D;  5EKK A;  1A15 A;  1H9S B;  2RDH A;  2B2V C;  3NXW A;  3FPP A;  3BVZ A;  4KY7 A;  3C46 A;  4DNT B;  5IOC A;  4FF1 A;  4ZYS A;  1KLU D;  4YIJ A;  1V1O A;  3UI2 A;  3NTI A;  3DEP A;  3S17 B;  2Q8I B;  3DUZ A;  4CHT B;  3C3L A;  5FO7 B;  4K6D A;  1GHJ A;  3DMU A;  1NSN S;  3GTP B;  1CA6 A;  2PMZ B;  4M8A A;  3PMF A;  2XN9 C;  1ZYR D;  4DGZ A;  3A7A B;  3MVV A;  4C3I B;  4A3F B;  3PUV A;  1IKL A;  2K01 A;  2EYF A;  3W2D A;  1BQQ T;  4N9P A;  1OO9 B;  4ZLT F;  2F3W A;  2EYL A;  3PIO 3;  4RAU C;  3SHL A;  4FF3 A;  2K28 A;  1HUM A;  3KBX A;  3V05 A;  1SSO A;  3IAY A;  1K8M A;  5KNB A;  2K5D A;  2K32 A;  1SMY C;  1PXU A;  4J1M A;  3S16 B;  1XXG A;  3J7Y W;  1XTC D;  5C0X J;  4ABN A;  3KBG A;  4OGQ C;  2M00 A;  1TS4 A;  1QIL A;  4H44 C;  1FGB D;  1WD1 A;  1S4Z A;  3OPO A;  1WTW A;  1BF4 A;  5CC4 A;  2KEC A;  3NTH A;  3TP8 A;  2NUC A;  4HED A;  1G6Z A;  1SYC A;  1F2Y A;  3CRK C;  1SYG A;  3R2I A;  3EJI A;  1GUT A;  2F0L A;  2L0C A;  2JSO A;  4IUT A;  4BY1 B;  2KJX A;  2NB0 A;  3J81 L;  1TWC B;  1HRJ A;  3SE0 A;  4HMJ A;  1R4Q B;  3P75 A;  4DAY A;  3FDT A;  2F0V A;  3BZD B;  5C5M A;  1LT6 D;  3QIA A;  1EY8 A;  4A3M B;  3ONA B;  3VYS A;  3VYR A;  4DAV A;  2A6E D;  2JYO A;  2NVQ B;  4IUU A;  5EPK A;  2PPB C;  3KF8 A;  2K6A A;  5FLX E;  5COR A;  3TP7 A;  1G2S A;  3MAQ A;  3SK4 A;  2DY8 A;  4ZKC B;  4OO1 I;  2XNA C;  2QEJ C;  3S14 B;  3I4L A;  2RSO A;  3NP8 A;  1SNP A;  3H91 A;  5KGU A;  2NTS A;  5A35 A;  3OIP A;  1HQM C;  3TSS A;  2IX1 A;  1E2Z A;  2AQ2 B;  4XQJ A;  2MHV A;  4HSV A;  5CV8 A;  1C4Q A;  2O5I C;  2E76 C;  3HOX B;  2F0I A;  2O2L D;  1ET6 A;  4OO1 G;  1D2B A;  5E4X A;  2VUM B;  1Z7T A;  2F0N A;  1H9S A;  4X3T A;  1U4R A;  3SVM A;  3LWE A;  1CI3 M;  4C2M B;  1WD0 A;  2K5Q A;  5KYI A;  2NVX B;  3W3A A;  4QIW B;  5FO8 B;  2ZXP A;  2FMM A;  5C6A A;  5COY A;  1XX8 A;  1QE6 A;  3GV3 A;  1TY2 A;  1SND A;  5F2D A;  1Q8I A;  2I07 B;  1EWH A;  1LTI D;  5IGD A;  3RLF A;  3Q23 A;  1SFO B;  3NWT A;  1Y8N B;  3PUW A;  4H7B A;  4HSP A;  2CHB D;  4LMQ D;  5JPN C;  4A3E B;  5EKL A;  2PZT A;  1PRT B;  2L11 A;  4K2K A;  1A3T A;  5I6W A;  5C3E B;  2G9H D;  4DF7 A;  2J7Z A;  4X3K A;  2KCN A;  3D8G A;  1OXV A;  5I2Y A;  4ZUI A;  1BCP F;  3CKI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...