1WTQA

Hyperthermophile chromosomal protein sac7d single mutant m29f in complex with dna gtaattac
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
64
structure length
64
Chain Sequence
VKVKFKYKGEEKEVDTSKIKKVWRVGKFVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*GP*TP*AP*AP*TP*TP*AP*C)-3'
publication title Probing the DNA kink structure induced by the hyperthermophilic chromosomal protein Sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna binding protein/dna
total genus 14
structure length 64
sequence length 64
ec nomenclature
pdb deposition date 2004-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1wtqA00
2L4NA 2KVMA 3LWEA 1G2SA 5CORA 1PFMA 3SVMA 1RODA 1U4LA 1A15A 5D14A 3GV6A 4NW2A 4RAUC 4X3UA 2MP1A 4XT1B 1BNZA 2MPMA 1ZXTA 3G7LA 1G91A 4RA8A 3GV3A 1O7YA 4HSVA 1O80A 1B4OA 1DONA 2CVRA 2EPBA 1BBXC 2L9HA 1EOTA 2KOLA 1X3QA 4HCSA 4CJ2C 1U4RA 1XYIA 1WD0A 4QUFA 2FFKB 4RWSC 5E4XA 3TN2A 1AZQA 2B2TA 3QO2A 1EIGA 1PFNA 4UAIA 1EIHA 3FDTA 3D6WA 5AFWA 1S4ZA 1WTPA 2N55A 1IKLA 4XT3B 3HP3A 1HA6A 2FINB 1IKMA 1AP0A 1WTVA 2H1EA 2M2LA 1DOMA 4R9WA 1WVLA 1CA6A 1HUNA 1PDQA 1HFGA 1NR2A 1XX8A 2NYZD 1J8IA 1WTWA 4HEDA 4IUVA 2HUGA 1B2TA 1B3AA 1BO0A 1X3PA 3TZDA 1SAPA 5CBEE 1LV9A 1U4PA 1E0BA 2IL8A 2HCIA 3I8ZA 1WTQA 2HCCA 5E4WC 2B2TC 2K03A 4O42A 4U68A 2BDNA 3IL8A 3ONAB 1ILQA 2RSNA 5EKIA 1HRJA 2B2WA 1TVXA 1U4MA 3MTSA 1JE4A 1F9SA 1GUWA 1DOLA 1PFBA 2KEDA 2KUMA 1EQTA 2B2VC 2Q8RE 2B2UC 5COYA 1VMPA 4IUQA 2DY7A 1JICA 1MI2A 2JP1A 1CM9A 1RHPA 1NCVA 2B2VA 1AZPA 2B2UA 2KECA 4IUTA 1Q3LA 3DEPA 2K01A 2RVLA 4DN4M 1NAPA 1SDFA 2MJ8A 2NZ1D 2FMMA 2NWGA 3DM1A 3KUPA 2HDLA 4IUPA 4MHEA 1DZ1A 4CJ1B 1VMCA 3MWYW 3H91A 2L11A 2RSOA 1G6ZA 2DY8A 1KNEA 4ZAIA 1HFNA 2B2YC 1B53A 2B2WC 4ZKBB 1WTRA 1DOKA 2K05A 1WD1A 1G2TA 3UI2A 1F9RA 1HHVA 2D9UA 1CA5A 2B2YA 2L12A 5EQ0A 5CBAE 1IL8A 2SDFA 4X3SA 1HUMA 1F9QA 1O7ZA 1QNKA 2K04A 2X69A 2N88A 1PLFA 3KBXA 5T1IA 3R93A 2EE1A 3IFDA 1MSHA 4OIJA 3F2UA 5CMDA 2FHTA 4IUUA 2EOTA 1ILPA 1MGSA 2K28A 3Q6SA 1ICWA 2KEEA 1WTXA 2L1BA 4QUCA 1SSOA 5T1GA 1M8AA 3N52A 5EPLA 3FPUB 1RTNA 3I91A 4ZLTF 1WTOA 1MSGA 3I3CA 4X3KA 5D65A 2VXWA 1X32A 4ZK9B 1RTOA 2R3ZA 2X6LA 2Q8TA 2HDMA 2X6GA 4OIKA 3I90A 1C8CA 1F9PA 4X3TA 4ZKCB 2MGSA 3P7JA 4XDXA 1QE6A 1J9OA 5DNFA 4MN3A 1RJTA 2J7ZA 1F2LA 2JYOA 1B50A 1ML0D 5EPJA 2K1BA 5EPKA 1EL0A 4HAEA 1KNAA 1NR4A 2FJ2A 3DEOA 2RA4A 1BF4A 1QG7A 4LMQD 5EJWA 1ESRA 5JJZA 4IURA 2XIWA 4R8IA 4CJ0B
chains in the Genus database with same CATH superfamily
4BBSG 5LMUQ 5I6WA 1E1OA 5KYLA 1MJEA 4C3IH 4XYOA 5D14A 2JEAI 3DWPA 3UE0A 1EWCA 3J7ZC 1NBWA 5BR8Q 1UUPA 1PRTC 3E6ZX 4RGMA 5I6YA 1DONA 3P1HA 1VQ7A 1LTSD 4GKKL 4RWSC 3IRBA 2CQOA 2O2LD 3OTOQ 1PMRA 2QDBA 3LGJA 4I7AA 5AFWA 3GTKB 2KENA 3J7A5 1Y1VG 2J0TD 1N8RC 4ILWA 5C0XJ 1WCMB 4MZ9A 4C1NI 4DK3C 5JJKA 2E75C 3H0GH 4RFBA 2N8NA 4DXGA 2DGYA 1X3PA 3GO5A 3GTQB 4JG2A 5JEAH 5D3IB 4A3JB 2EDGA 4JPBW 2HHHQ 1D1IA 4A3BH 4M8AA 1VS0A 4CKBA 4RCOA 1PFBA 1WJJA 4DR4Q 2RQXA 1A63A 4IUQA 2ID0A 3M85A 4JI4Q 1MI2A 3AFPA 3L0OA 4QQBX 4DR6L 1LLRD 1A2TA 1HNXL 4JI0Q 1NAPA 2NZ1D 4DV6L 3J7AV 2KCTA 3TEHB 5I4DA 2ZXRA 4LF5L 1LTGD 2HD3A 3L7ZC 1IBLL 2CW0D 1Q1BA 2XTIA 2DNCA 4K2KA 2RCNA 1HH2P 2D0PA 4DAPA 3RNUA 3BDLA 2UU9L 1BCPC 5CV4A 3A8KE 4X65Q 3BDOA 3M4PA 2MQHA 2EY1A 2LSSA 5ISRA 3JAML 3CKIB 4OL7A 4EQ5A 2V1CC 1PXUA 3K5MA 1YZ6A 3S1NB 5K36H 4R4CA 3CHBD 2I5HA 2JE6I 1A2UA 4P73A 4A3KH 4GZYC 1TWGH 2NVXB 1SSOA 3ULJA 1XPOA 4ZLTF 4NDXA 4PNYA 1K83H 3T56B 1CUKA 3ULPA 1FL0A 5CV5A 3STBC 4NPSA 1FNVA 4UP7A 5M3FG 3CMEA 5HGTA 4DV3L 3F2BA 1W3SA 4DPGA 3S9WA 4JI6L 1KNAA 2SNMA 1I94Q 4OO1G 1EY5A 3PUYA 5FLXL 5TSSA 3JAME 3SVMA 4DR7L 2RHQB 1QCBD 4YHHQ 1SNDA 5KNDA 4Y52H 5FOBB 4GN3B 2UUBQ 4LNQA 4M1UB 3TN2A 1JB3A 3PO3G 3KLSA 1PFNA 4A3IB 1MKHA 4WORA 5IY0A 4MNOA 3VYSA 2RDFA 2M2LA 2F4VL 2A68C 1GJXA 3LX0A 1CKNB 5ELDA 1WTWA 4ALPA 4EGVA 1HPCA 1BO0A 1E0BA 1HTLD 1WTQA 1KLGD 2M00A 4JYAQ 1C0AA 3MTSA 5C3WA 4ZQ3A 1HNZQ 4LF6L 5COYA 5F2DA 4KN4C 4UDUC 4NKLA 2OTJA 3DEPA 1I4RA 2K5WA 5KGUA 4CKCA 4DN4M 5ELEA 3KUPA 4DR1Q 2A6EC 1TIID 2L11A 2RSOA 1GUOA 2B2YC 3SE0A 3S2HB 4F7XA 5KNBA 4FXGC 1F9QA 2K04A 2EYLA 5H1SE 1K73C 5EGTA 4AH6A 5C3XA 1JOKA 1S5DD 4JI2Q 1XMQQ 4QY7A 1YHQA 1KIXA 2JSOA 4HJ5A 1D5MC 4HTHA 1WOCA 2AQ1B 3RN2A 2AUKA 1OXUA 2N3SA 3BDCA 3EBEA 1JQYD 4BBSH 2R7ZG 2KBNA 2EYJA 5EPJA 1QG7A 4LMQD 1VQMA 4HJ9A 1OTCA 1ENFA 3MXPA 3GV6A 3D3RA 1CFMA 2ZJPA 4EVOA 4DV4L 2K50A 2EQSA 4A3DH 1GVPA 4QUFA 4C3JH 3PV0A 3QO2A 4L5RC 4UY8C 2KCCA 2EVBA 1YI2A 3HP3A 1TWAH 1CKNA 3NUCA 5C3EG 3I70A 4BBRG 1J8IA 1I4HA 1X9NA 4GOPC 1VF5C 2IHEA 4LAAA 1KDAA 3VYUA 4MTKA 2WKDA 5IT9L 3B6YA 5EKIA 1EY7A 2A19A 2F0KA 1B9NA 1DOLA 4HIDA 4BXXG 2F0EA 4RHRA 3JC66 4P2CB 1HNWL 1M4VA 2KECA 5LMNL 2PZWA 1CZGA 4XTCS 2K5NA 1L0XB 3BZDB 1TXYA 2K5DA 5EKLA 2PZUA 3E0EA 4IUPA 1STEA 2CQAA 2HDLA 5IE8A 3OSOA 3MA2B 3BYYB 3VDYA 3TBIB 5LMUL 2XRQD 1PRTF 4R8NA 2YU9H 3I55A 3J81i 2LKVA 1TU2B 2B2YA 2B39A 2E5LQ 5BR8L 2E2HH 1FR3A 3SK5A 1XXGA 1HR0Q 2ZTEA 1R9TB 3RLNA 1IBKL 3T53B 2NB0A 5CMDA 5ELCA 5BN3A 3Q24A 3OTOL 4X6AH 4QUCA 5M3FH 2KQ3A 3Q8DA 3FKIG 3KBGA 2KHIA 5M3MG 2NVYB 3OYYA 3I3CA 4Y7NB 4X3KA 3M7NA 3LNNA 1UNSA 4OO1H 4L5QA 1LACA 1JE5A 2IW3A 1N33Q 1EY6A 1TWFH 1QILA 2NVQB 2JA6B 1XPUA 1XNQQ 1Y1WB 3S1RB 3PO2B 1EIFA 5M5WB 2B63B 1VQBA 5CR3A 1KDBA 3C46A 2VUMG 2HHHL 4LJZC 3PUZA 2KVMA 3I4MG 1WTHA 2EJGC 4A4IA 4CHTB 4KD4A 5I9PA 2NTSA 3MZ5A 1RCVD 2VQFQ 1STBA 4K14A 4DNIA 4DR4L 2R7DA 1M90C 3PO3H 4ID6A 2OT2A 4JI4L 3CRLC 3V2TA 3HOUB 1SMXA 3HOWB 2G9HD 2QA4A 3QJYA 1VQOA 1N9WA 2CKZB 5FO9B 3N6RA 3G71A 1BCPF 2OXPA 3HS0C 4BA2I 4IOAA 1LTBD 1QZGA 4PMWA 1EWHA 1DOMA 2IX0A 1XPRA 4GLVB 1C48A 4LF4Q 1CK1A 4LFBQ 1SROA 1WYDA 2LS01 2FMCA 2HCIA 2UXDQ 1QJOA 1TY0A 1U4MA 1F9SA 1TT2A 4DNRB 3RUZA 2F0MA 4LFAQ 3KLSX 5AJ3Q 4IOCA 4EQOA 2DY7A 4RGOS 1GXDC 2NVTH 1HJPA 1VF7A 3CF5A 1E3PA 2RVLA 2MJ8A 3URYA 1I94L 2L5TA 1JWSD 1E2VA 3I2ZA 2H4OA 3DHQA 3BVGA 2E2IH 4V190 1KNEA 1K0RA 4A3FB 3MEFA 1SMYC 1KL9A 2F0TA 1X6OA 2F0SA 4YHHL 2JA8B 3S2DB 1F2ZA 4GNXB 4ZRZA 2BE5D 4JK1C 5GQOA 2Q8IB 4C3HB 3W5OA 2UUBL 1AN8A 1A3UA 3NTKA 2F0WA 5EPLA 4PMCA 2R7ZH 1I6VC 3A8JE 3NQTA 1YNJD 3T1YQ 1VQ8A 4ZKCB 1VQEA 1O78A 1RJTA 1B50A 3S1MH 2FJ2A 1CI3M 1PH5A 1Z9FA 2KHJA 2PQEA 3SK6A 1V9PA 3GTPH 5HY6A 4CJ0B 4JYAL 1PH6A 3TP6A 3PMFA 3K5OA 4KHVA 2MP1A 1HZBA 4LFCQ 3OW7A 3U9SA 2BA0A 3OWEB 4G7ZC 5E3FA 4CDDC 2PZTA 3MXUA 4HSPA 4F8MA 4BY7G 3L2PA 1J6QA 3IAYA 1WD0A 1AZQA 3RZOB 3MVVA 2Q2UA 3HEJA 4JBKA 4AIMA 2EZVA 1L0YB 1MIUA 1P16A 5C3EH 4BBRH 1JR0D 2PNHA 2EY6A 3K7UC 3HKZG 5GROA 4A3MH 2AQ2B 4JOIC 1NR2A 3CCJA 2GN5A 2JJQA 4DR2Q 2Z4HA 4GLAC 4DNTB 3J81L 2E2JH 1K8OA 4HMIA 5J39A 4C2MB 4BXXH 2ZJQA 2L55A 3GTMH 2K03A 4O42A 3T1HL 1XMQL 2K4KA 4DR3L 1PH1A 2Y0SG 3K57A 1GUWA 3ZJYC 3BS1A 1G51A 1CSPA 4GN4B 4DKAC 4UPAA 4YWKA 4Q5VA 2F03A 1TWCH 1AZPA 1H9KA 5IGFA 3FRPB 2R92B 1I50B 3CQZH 5I9OA 4QIWB 4FNFA 1VMCA 3J7AF 3TRZA 4P75A 1EQRA 1ZEQX 1QZHA 4LUVA 4O1NA 5IGDA 3UI2A 5M5XH 1PTOB 1W2BA 4JI8Q 2QILA 5IIFA 4IALA 1SN8A 3CC4A 2IT1A 3U9OA 4GNXA 3BG3A 1EYCA 4QIWE 3TZUA 1SNCA 3HOVH 2EE1A 2VL6A 3FKIH 3NTHA 1S5BD 5M3MH 4H7BA 3UDXA 5J1ZA 4UP8A 3P20A 4B9WA 3N52A 2XNAC 1YIJA 4A3GB 1OXTA 3I7FA 1KRTA 4LUOA 2AKWB 4JW0A 4RGNA 3CCVA 1VQ9A 3J80c 1JJ2A 2VUMH 3I4MH 3K6OA 1I3QH 3GTJB 5FKAC 2WP8J 4IPGA 1NR4A 3GQBA 4GS3A 3M4QA 1LO5D 3H09A 5C4JH 3VR5A 1VQHA 3S15H 5FO7B 4WJ3M 3CP0A 5E7NA 4RAUC 2B29A 4WFN3 4XT1B 1NJIC 3QB3A 1VQLA 1PTOD 2ICIA 2CVRA 4BA1I 1XYIA 3GTLH 2CH4W 3D6WA 3HKSA 3BU2A 3KJPA 3HOXB 1Q12A 1WTPA 3CXCA 4XT3B 1MBYA 5IWAQ 5C4XG 1HA5A 3VR6A 3MXNB 1STYA 2F0QA 2ZM6Q 4AQYQ 1KHIA 3HOZG 1KD1C 3H3VI 1XX8A 2E5LL 3MHBA 2EYMA 4JOIA 2HUGA 1TS2A 4IFDJ 5A2QL 3Q23A 5CYUA 1SAPA 5CBEE 5E4WC 2CW0C 1I4GA 1JJGA 4OONA 3L9AX 4IUNA 2OQKA 2XSCA 4AYBB 1HRJA 2B2WA 1TVXA 4OWXB 5A35A 4PMBA 3RN5A 2UUAQ 4QB4A 1I4PA 2B2VC 2Q8RE 3EN2A 2A73B 4IN3A 2BCOA 1E24A 1CM9A 1Y8OB 1NCVA 4A3DB 2Q2IA 5FJ8G 1D5XC 1RDPD 3NWTA 4OHJA 1N33L 5DM63 4AYBE 3NEMA 1EQQA 3QOJA 1XNRQ 1GUNA 5A2QE 1LT5D 1NMFA 2BH2A 1G6ZA 1EOVA 1PA6A 4UP9A 1IW7C 1BKBA 1E1TA 2C9OA 2E74C 2K05A 1VQ5A 4J6HA 2WFWA 5IP7G 2IHFA 1NUCA 1EY0A 3U50C 2SDFA 1OO9B 2R61A 2H5XA 1SNPA 1WCMG 2X69A 4L5TA 5G3LF 1MSHA 3E0JA 1HQRD 3HGBA 2BA1A 5EBDA 3NP8A 3DXJC 4IPDA 4LF9Q 1QWYA 2DJGC 4APVA 3K5NA 4A3JG 5D65A 1FVIA 3NENA 2R3ZA 1LUZA 2X6GA 2I46A 3QIAA 3E9HA 1XMOQ 3GTOH 4LFBL 4A3EB 5J3BA 1JWUD 1YEZA 2UXDL 1NY4A 3TSSA 5JOBA 3M4OH 1ESRA 2ASBA 4XQQA 5C5MA 4BY7H 4LWCA 4X3UA 1BNZA 4Q0FA 4LFAL 1BBUA 4B9XA 2O4XA 1PRTD 5AJ3L 1G91A 1O7YA 4DUYQ 2PPBC 4N9TA 5FLXc 2SNSA 4A3LG 5JEAJ 4POGA 3KF6B 2ES2A 1Q8IA 4DA2A 1S4ZA 1VQIA 2JA5B 2GVAA 1IKLA 2LMCB 3E3XA 5JVH3 1J5EQ 4OEMB 2FINB 3I4NB 1WTVA 2WIIB 1EU4A 5DEHA 2XGTA 1SNQA 4IUVA 3MEHA 1Y8NB 1X54A 4DXFA 2IL8A 4JCVE 1K8AC 3OMGA 1HCZA 2K32A 3H15A 3ERSX 2XRSD 3AFQA 1HZAA 2WAQB 3I4LA 1STNA 3FP9A 3OPOA 4KHPL 3J81j 2B2VA 4ZYSA 4CBVA 3T51B 2IJ0A 1OXVA 4X62Q 3U58A 3ND9A 1KLUD 2WAQE 3VR3A 3S16B 4OWWB 5ELNA 4FF1A 2NN6I 4GKJQ 2QF7A 1FJGQ 3E9IA 2NTTA 5LHY1 4A3IG 4LFCL 3H3VC 3K0XA 5CBAE 2BDOA 2F0OA 4XXEA 1HUMA 1BDOA 1SNMA 1PLFA 4IFDI 4L6TB 2F0LA 1OXXK 1K3BC 3I56A 3MC0B 1HA6A 4K5WA 3ND8A 1KTKA 4ZK9B 4NP5A 2WB1B 4ME3A 2A8VA 3KK7A 3WWVA 5C0XI 1MJCA 4MIUA 1X56A 3D8GA 5IYBG 1K28A 3GTGH 2MFIA 2JA9A 4R8IA 5GAGC 4TKOB 1G2SA 2WB1E 5CORA 3ITPA 5C4HA 2DNEA 1KC8C 2KJXA 4PZ8A 3G7LA 1ZXTA 2XWJB 3R2TA 1BBXC 2K5QA 1SYBA 2J4XA 1U4RA 3KF6A 1RKNA 5C4XH 1PHJA 3IFTA 4OELB 4R1JA 1VQPA 3S17B 4UAIA 3HOZH 2OWOA 1A8VA 2YTVA 1ASZA 1KDCA 3K8AA 4K6DA 2H1EA 1WVLA 4JI8L 1PDQA 2PCFB 4BY1B 4B3SQ 1H9SB 4G4KA 3IKJA 4NB3A 4JI5Q 3CMAA 3KLRA 5ELOA 4QCLA 1AE2A 1M1KC 1HZCA 3D6CA 4KHZA 1Y1VH 5FJ8H 4H13C 4DR5Q 4FF4A 2R93B 1SFOB 3AMUA 2K7VA 1SEBD 2AWOA 3ZYYX 2N78A 2F3IA 1RHPA 1B9MA 2EJMA 1QVCA 5IT9c 1PFSA 4FXKC 1PYWD 4JI7Q 4K5VA 2FMMA 2WV6D 4K0KQ 5IP7H 5CV8A 1BXTA 3GTKH 4F88A 2F0HA 1SE3A 1S72A 4XQJA 3QOLA 5E1FA 2CWAA 1KRSA 4A3MB 1WCMH 1H9MA 1YVCA 1WD1A 1H9RA 4B3MQ 3HFZB 2D9UA 3A0JA 1X3GA 2OQ0A 4KV6A 4PZ6A 3NTIA 2RBMA 5T1IA 4FP5D 4FF3A 3GTQH 4A3JH 4B3RQ 2TSSA 3QR8A 5ELBA 5BN5A 2F3WA 3S1QB 2HQEA 3NE5B 4B3TQ 2L1BA 4R4IA 1IHZA 2AHOB 5IWAL 4IJLA 4A93B 1G291 1HZ9A 4AQYL 2X6LA 4DV1Q 2JYOA 4OGQC 3ULLA 3I72A 2WINB 2RCFA 2ATWA 2BH8A 3OIPA 5EAYA 5JJZA 2XWBB 2K5VA 3LWEA 3PF5A 1I6HB 1GKHA 2EYOA 2UUAL 5C4ZA 1Y14B 4H02A 4A3LH 1AH9A 3SK4A 1G6PA 3RZDB 4JBWA 3DUZA 4DV7Q 2K33A 3HOVB 2O5IC 4CJ2C 2ENBA 3S1NH 4LF8Q 2DN8A 5M5YB 5E4XA 2NVXH 3H6MA 1BOSA 3A7LA 1EIHA 1V8QA 1XNRL 2LXKA 4KY5A 1EEID 2NN6G 3K80C 3W1BA 2JA7B 3EFXD 1X3EA 1AP0A 1HUNA 2C5CA 5KRUA 3KF8B 4GKKQ 1H9SA 2F0GA 1K9MC 1SJED 2JEBI 4IPCA 1PH7A 3HOYB 3S14B 2ICEC 4IFDG 4GN5A 1KXLA 2PW7A 2JA6G 1LABA 4B08A 2OTLA 4JI0L 1Y1WG 1JE4A 4LF9L 5ELFA 1B7YB 2QEXA 1TWHB 2JK8A 2B63G 3PO2G 1KAAA 1CKOA 1SE4A 2B2UC 2TMPA 4KY6A 3M9BA 4DV5Q 3U4VA 2O5JC 5BN4A 1AE3A 2JP1A 3M3YB 1FNUA 4DAYB 2F1MA 2BE5C 4IQZA 3OOCA 3K7AB 3MFGA 1UE7A 1SDFA 3KLWA 4X65L 5C44B 3HOUG 1DZ1A 1JJCB 1L1OB 3HOWG 5C0XG 3RR5A 2LY7A 1PZKD 3NWSA 1SR3A 1YNJC 4I7ZC 4DR6Q 2NVTB 4P74A 4C3IB 2CCZA 1EEFD 4DUYL 3G48A 2QEJC 3R93A 2PQAB 4I65A 4HR7B 4UHVA 4TVAB 1JC7A 3O13A 4XIGS 5CV9A 5LL6X 2VB2X 5T1GA 1WTXA 1CA6A 1WTOA 1K8GA 3TREA 5L37A 1ICFB 1J5EL 4DF7A 3H3VH 1RF2D 1MHWC 1F77A 4KN7C 1C8CA 2Q8TA 5IYBH 4X3TA 3P7JA 4GNXC 2CWPA 1Y8PB 3H0GB 2R7FA 4ZCKA 5IYDG 1YNND 2Z8LA 2Z6BA 2VQEQ 1II3A 3S2HH 2SEBD 1RODA 1PVOA 4NW2A 4A3BB 3FHWA 1HTPA 4RKBA 2KCNA 4A3FG 4JI6Q 4E6IA 3NPPA 3AYHB 2KOLA 3MFYA 2JA8G 1A62A 4X62L 2B2TA 4DR7Q 1UE6A 4C3HG 3F2CA 1BVSA 4GKJL 5DLQE 3U4ZA 2Z0SA 1FJGL 1RL2A 2VS1A 3H94A 3KF8A 3EVQA 3L3OC 4TQUS 1IKMA 3FEWX 4DGZA 4HIOA 1NNXA 1HNZL 4DV2Q 1B3AA 2EY2A 1LV9A 1V43A 5CC4A 5IGBA 1ILQA 3CU7A 2RSNA 2B8GA 4LK1C 3RLFA 4A3KB 4DR1L 3TQYA 1TWGB 3FPPA 3R2IA 1KQSA 1WI5A 3ICEA 4DAYA 2UXBQ 1ET9A 1K83B 2B2UA 3Q22A 3NELA 1L1OA 1IYUA 1C9OA 3QG1A 1Q86C 2DY8A 4ZAIA 5CGKA 2B2WC 2HIVA 3OHXC 1WTRA 4JI2L 2PNRC 2IWHA 4QMGA 3UDIA 2YTYA 3WDNA 4X3SA 1STAA 3KBXA 1Q7YC 4OIJA 1LT3D 1TS4A 4IUUA 4TRDA 2EOTA 5C5LA 3A54A 4DAMA 2A6HD 1O7IA 1S3OA 3P75A 1A3VA 1EZ8A 1GHJA 1RTNA 2VW9A 2JN4A 5GAHC 1VQ6A 1PYSB 3PQIA 1UEBA 1PTOC 1SYEA 2PI2E 4HJAA 4LF7Q 2GVBA 2PO4A 1X32A 4O2DA 1Q1EA 1CTMA 1RTOA 2OF1A 4J8QA 5CV7A 5IODA 1K3RA 4XDXA 4B3SL 4JBMA 3PIPA 5EPKA 2K1BA 4BS9A 4H0LC 1X55A 1G8ZD 3KDFB 2R92G 1GM5A 5EJWA 3CCRA 3R8BA 2L4NA 1JMCA 2LXJA 1FGUA 4DR5L 3CCQA 3BZKA 1YJWA 2SOBA 1R9TH 3CAMA 1S5ED 2MUYA 1IZ6A 2A69D 3PSIA 4ULLA 1E7ZA 1JB7A 1A6XA 4ABNA 2NN6H 1EIGA 3NHHA 2UXCQ 1CQVA 1IYJB 4Z9CB 3CCUA 4K0KL 2NVYH 4Y7NH 3RMHA 5LMNW 1S40A 4YWMA 1JOQA 1CHQD 2UUCQ 4B3ML 1EUJA 1IBMQ 4A3GG 2NVQH 4CDFC 1W6KA 1AFPA 2JA6H 1ZYRD 1SE8A 3CPWA 2RHSB 3S1RH 3W1GA 1Y1WH 1SNOA 5M5WH 2B63H 3PO2H 4B3RL 3CPFA 2K6AA 3CCEA 1EWIA 3ONAB 4J15A 3SHLA 4B3TL 1VDZA 1UEAB 1DCZA 1LTTD 3I73A 5IGCA 1B1ZA 3V96A 1JORA 3HOUH 3HOWH 3CW2C 4X66Q 5C0XH 4DUZQ 4A3CG 3J80L 4DV1L 2GA4B 3ERQA 3J7YW 2K01A 1SYGA 1STHA 1XTCD 4BBSB 4MHEA 4CJ1B 1HR0L 1CHPD 3MWYW 2DUDA 3Q0AA 1HNWQ 1XJVA 4ZKBB 3HOXG 2ZTDA 1Q82C 1I5FA 4OX9Q 2PI2A 2VNUD 1V1OA 1IL8A 4DV7L 2F0PA 2YV5A 3GDEA 4MTNA 3RD4A 2RDHA 3SEBA 2F0VA 1CSQA 1X3FA 4YCUA 1EZ6A 4N9PA 4CKEA 3J80E 1Y1VB 3DWQA 1T9HA 2K28A 2PYKA 4C3JB 4DK1A 1ICWA 3BZCA 4P71A 1LTRD 5JPMC 1U0LA 2Z4IA 1XNQL 4KLKA 4N8X1 4AYBG 1IBKQ 1IL2A 1DYQA 5IYDH 3K59A 1TQOA 1TWAB 1PRTB 3C3LA 2MGSA 5DNFA 2VQFL 1EL0A 3KDFA 1PZID 4A3DG 4KI0A 2IX3A 1QNUA 3R3OA 4C3JG 1B70B 1QOHA 4A3FH 4WJWA 3FPUB 2IPKD 2F3VA 2QCPX 1A15A 2JA8H 4JV5Q 2F52A 1E2ZA 2HQLA 3S2DH 4FDBA 4DV5L 4HSVA 1O80A 4IPHA 2K75A 4C3HH 3OWFA 1X3QA 1OXSC 5DM73 5CV6A 3VR2A 2I5LX 3JAMc 1H9JA 3A5UA 5M9OA 1TKWB 3FDTA 4LF4L 4EX5A 4IZ8A 2D2CC 3OW2A 1ET6A 2Z6KA 5IGGA 2YU9B 4ZUJA 1D5ZC 4EQNA 2VZAA 1PH8A 1B2TA 3DWAA 2E2HB 1IYVA 2ZJRA 1U9RA 5FK9C 1V1PB 4A75A 1E22A 3M7GA 4A3EG 2F0IA 3K5LA 2F0NA 1VQDA 5M3FB 1BCPB 2QDLA 3MXNA 4DV0Q 4FF2A 1GD7A 3RZOH 4DFAA 1NE3A 2B3GA 1V1QA 2NWGA 1TWFB 5IYCG 3FMCA 3GD7A 2VQEL 1IW7D 2VB3X 2MO0A 4ODGA 3D0FA 3SGIA 4P72A 1R4QB 2Z1CA 1N32Q 3TMEA 4WRDA 3KOJA 1YITA 1X65A 1DOKA 4PZ7A 1VQJA 1F9RA 1FNWA 2JA5G 4J1MA 4K8IA 5I2YA 5GAEC 5EQ0A 5NUCA 3I4NG 4C2MH 1F2MA 1QNKA 4HMJA 3PO3B 3F2UA 2QW7A 1FYCA 3TDQA 3KFUA 2ZT9C 3T1YL 1YHAA 5D3DA 1LYLA 1VQAA 1MGSA 3OIQA 1AW7A 5C6AA 4V0BA 3I91A 4YIJA 1DM0B 4LW1A 2WAQG 5LL6S 1PV4A 2R92H 1VQFA 1TS5A 1I50H 5K5PA 4OIKA 1BCPD 3I90A 1F9PA 1EY4A 4DAVA 3CCMA 2E76C 4DV2L 3LWUA 3BVMA 2D62A 4JI3Q 1RIPA 4KKTA 3F8TA 1SRUA 5FLXE 2KA7A 2KEEA 4IURA 3T16A 4JI1Q 1EFWA 1B44D 3TS0A 1PTOH 1VQGA 1PH3A 3T4AC 1BUVT 4NXNQ 1SYCA 4YCWA 2NZHA 1DXMA 1FD7D 4OWTB 1KABA 2UXBL 3V05A 4HIKA 3KYHC 3PIO3 1U5KA 4HCSA 3STBD 1HQMC 3VR4A 4DU9A 5JAVA 1QVGA 4DR2L 4A3GH 4GLXA 3BJUA 1YBYA 1NTGA 1EY8A 1N34Q 3WOFA 2E2IB 3PF4A 4HIMA 2I5MX 2QGQA 2A74C 2NYZD 3GTJH 1QUQB 4LUZA 2WB1G 1D6EC 4FVMA 1V1PA 2Z9HA 5KEEA 2HCCA 1S5CD 2PMZB 2XN9C 4U68A 1PTOF 2R6GA 2A1AA 4A3CH 2VY3A 4K2LA 3NSWA 2QKIC 2KEDA 3G6EA 3VYRA 4LF7L 1CT1D 2B8FA 3SK8A 4KTAA 2R7ZB 3MXGA 2A68D 3T1HQ 2PMZE 4DR3Q 3CCLA 1A3TA 3HOXH 3CD6A 4NXMQ 4YCVA 5HURA 2G9DA 3S1MB 1Z47A 4YY3Q 5IP9G 3H91A 5IOCA 3T13A 2EYPA 3GTPB 1UE5A 1CA5A 1N36Q 3RLOA 5FO8B 1O7ZA 4X64Q 2N88A 4KJNA 4BY1G 3NBHB 5FLMG 1Z7TA 2UXCL 3AB9A 3K0YA 4KD3A 3HG9A 3Q6SA 1I4XA 1XTDA 2CFMA 5EKKA 1M8AA 2A6ED 2N49A 5C3EB 4BBRB 2Q2TA 1D1KA 2UUCL 1R4PB 4R4QA 1VQKA 2R93G 4HJ7A 3GP7A 1IBML 3EIVA 2HDMA 1PH2A 1LT6D 2EJFC 1J9OA 4OXPA 1PYBA 2E2JB 3DEOA 2OCEA 1JWMD 2C35B 4O0AA 2XIWA 1A0IA 3EJIA 3GTMB 2EYFA 1PFMA 1HR0W 3X3NA 3S24A 4RH6A 4A3MG 4G57A 3PUXA 1VQ4A 2F0UA 3A7AB 2EPBA 4X66L 4DUZL 2D0OA 2ZM6L 1LM0A 1TWCB 3TP8A 2K5HA 4GOPB 4L5SA 1ONLA 2V4DA 3BVZA 3CQZB 2L0CA 1TR5A 2PW5A 2N55A 3DMUA 2IY5B 1FGBD 4R9WA 3PUVA 4C56C 1HFGA 4OX9L 1QUQA 5M5XB 4A93G 4HEDA 4A3EH 1C7YA 1ZKOA 1EIYB 3TZDA 1L0WA 3HZXA 3NK9A 3AQQA 3E5SA 2M9VA 4WJ4A 2B2TC 3FKIB 1Q46A 5IT9E 3VA7A 1IXRA 5M3MB 2BDNA 1Z6HA 1W6JA 1PZJD 1K8MA 2KUMA 1EQTA 2XVSA 3UE1A 2F0DA 1K0SA 3X3MA 1E2WA 1JICA 5IYCH 3PIP3 2NUCA 1O7LA 4IUTA 4TSSA 2I07B 1D2BA 3NQIA 3HOVG 1D8LA 2VUMB 2JQOA 1ENCA 1NMGA 3I4MB 1I3QB 2JA5H 1I4QA 3D31A 3NBIA 2D5DA 3PCOB 3I4NH 5J22A 1STGA 1B53A 5C4JB 2EYHA 2MO1A 1HHVA 3S15B 4JV5L 4RMFA 1GUSA 3G6JB 4JC0A 4HN7A 2L12A 1UAPA 1CKMA 2JA7G 1D7QA 2KHSA 3NBHA 1YNNC 1Q90A 1L1OC 1NSNS 2OEOA 3HOYG 3GTLB 1XMOL 1DD2A 4FYDA 4A3IH 3PIOA 4HCEA 4POFA 3WOEA 2VXWA 2WKCA 2MHVA 3NXWA 4K6LA 1QB5D 4KMUC 1CZWA 3ER0A 3TP7A 1HNXQ 1EQVA 1Q81C 3S16H 1H95A 4DV6Q 4HAEA 1GUTA 1YJ9A 1EFID 1VCIA 4LF5Q 1SYDA 1IBLQ 5C44G 3HRZC 4EQPA 1KAWA 3AEVA 1U4LA 3SDZA 5KNCA 1GO3E 4IJHA 4R4TA 2UU9Q 4C1NK 3D4WA 2MPMA 1LTID 1LTLA 4K8JA 4QL5A 3CC2A 1YJNA 1GOZA 4FXDA 4ME5A 1SYFA 1VQCA 4DV0L 1GHKA 2L9HA 1EOTA 1EU3A 3J80i 4GOPA 4C3IG 5IGEA 2FFKB 1ASYA 1UWVA 2RF4A 4DK6C 5JJIA 2ALYB 2LFNA 3A5ZB 3VYTA 2L15A 5JPNC 1N32L 4CGYB 2ZTCA 5I2XA 4YWLA 3D4RA 3AU7A 4DV3Q 4RHSA 2ZXPA 1PH9A 1MD2D 5GADC 1U4PA 1ESFA 4G7HC 2EIFA 3A56A 2NBFA 3H0GG 3IL8A 3K81C 1T5XD 5G3LD 4HJ8A 4QJFA 3F1ZA 2YTXA 1VMPA 5HGQA 1VQNA 5JEAG 3EA6A 2K52A 4A3BG 3UDFA 1P8LA 1Q3LA 5IP9H 3F2DA 2WACA 4U673 2A6HC 2CH4A 3S17H 1Q8KA 4ZUIA 4PV1C 3D4DA 3DM1A 4JI3L 3GTOB 2EXDA 1SE2A 4JI1L 4KHPQ 2AUJD 3M4OB 3CRKC 4NXNL 1BR9A 1G2TA 2F4VQ 4BY1H 4BY7B 3K58A 5FLMH 1SXTA 1JT8A 1PH4A 3UDGA 3J81c 2FHTA 2P5ZX 3SR1A 1ILPA 4PG3A 1JOOA 2R93H 3HKZB 1SFOH 2DJFC 2YYZA 4QF4A 4KKUA 1C4QA 4CDCC 4LF6Q 3BYTB 1LTAD 1MSGA 4KY7A 1N34L 5K36G 1EYGA 1SMYD 2A69C 4A3KG 4KJOA 2J7ZA 1F2LA 1T5EA 3HKZE 1ML0D 3TP5A 2ZXOA 2Y0SB 2PQAA 2Q2HA 3DM3A 1XWEA 4CDEC 1DJRD 3A74A 1F2YA 2E8GA 2CHBD 4G7OC 3M4YA 1JCKB 5JJLA 1BQQT 3C1FA 4QGUA 2EY5A 4RA8A 3GV3A 3JAMi 1L2FA 1ZYRC 1B4OA 3PGZA 2Y0SE 3C1EA 3W2DA 4RCNA 1SLJA 3S1QH 3I4OA 1S5FD 2IX1A 4NXML 2FXQA 1B3QA 4JI5L 4YY3L 3A8IE 4A93H 4JBJA 5KIXA 3C2PA 4L8JA 1SBBB 2I0QA 4R4OA 1N36L 2K14A 1QVFA 4OO1I 1TY2A 3QWNA 4NMZA 4X64L 3J81E 1BBWA 5EBCA 2RKSA 3I8ZA 4IO9A 1I6HH 1LT4D 4KK7A 1B8AA 4JI7L 4BWGB 3RZDH 1EYDA 2HIXA 2EXZA 2F0JA 2G5DA 1TS3A 3FVQA 4N8FA 4DK0A 3KJOA 2A5HA 2Z6KC 5DAUA 1GUGA 3MAQA 5M5YH 4DV4Q 2E2DC 2JXMB 3VA5A 2KCMA 4JVZA 4FO2A 3CC7A 1DGSA 4IFDH 1UE1A 3EROA 2F0FA 4A76A 2AWNA 2JA7H 1Y69U 1RD9D 2AMCB 1HFNA 3GTGB 2BOSA 3CCSA 2MNAA 2HT1A 3A55A 4RGTA 5KYIA 3HOYH 4XQNA 3S14H 1HXYD 4S3SA 3IFDA 4F87A 1WFQA 1ENAA 2RDGA 1YHBA 4L63B 5C4XB 1EY9A 1TWHH 4PQXA 3G4SA 4RG1A 4XYQA 3W3AA 3HOZB 3M3YH 3OMCA 3K7AH 2F4IA 5LMNQ 3EQLC 2NZOA 5C44H 1QE6A 2AQ3B 3DLLA 4MN3A 4K5XA 5JVG3 1YNXA 4RKLA 2RA4A 1AEXA 4H44C 1BF4A 1EYAA 1CQFA 1SJHD 3SXHA 3TS2A 3PUWA 4LF8L 4KKSA
chains in the Genus database with same CATH topology
5I6WA 5KYLA 4XYOA 5D14A 2JEAI 3DWPA 1EWCA 1UUPA 1PRTC 3E6ZX 4RGMA 5I6YA 1DONA 3P1HA 1LTSD 4RWSC 2O2LD 1PMRA 2QDBA 5AFWA 3GTKB 2J0TD 4ILWA 5C0XJ 1WCMB 4C1NI 2E75C 4RFBA 4DXGA 1X3PA 3GO5A 3GTQB 5JEAH 5D3IB 4A3JB 2EDGA 1D1IA 4M8AA 4CKBA 4RCOA 1PFBA 2RQXA 4IUQA 2ID0A 3M85A 1MI2A 1LLRD 1A2TA 1NAPA 2NZ1D 3J7AV 5I4DA 2ZXRA 1LTGD 3L7ZC 2CW0D 1Q1BA 2DNCA 4K2KA 4DAPA 3BDLA 1BCPC 5CV4A 3A8KE 3BDOA 2EY1A 5ISRA 3JAML 3CKIB 4OL7A 1PXUA 3K5MA 3S1NB 5K36H 3CHBD 4GZYC 2JE6I 1A2UA 2NVXB 1SSOA 4ZLTF 4NDXA 4PNYA 3T56B 5CV5A 1FNVA 5HGTA 3S9WA 1KNAA 2SNMA 4OO1G 1EY5A 3PUYA 5FLXL 5TSSA 3JAME 3SVMA 1QCBD 1SNDA 5KNDA 5FOBB 4M1UB 3TN2A 1JB3A 3KLSA 1PFNA 4A3IB 4WORA 3VYSA 2RDFA 2M2LA 2A68C 1GJXA 3LX0A 5ELDA 1WTWA 4EGVA 1HPCA 1BO0A 1E0BA 1HTLD 1WTQA 1KLGD 2M00A 3MTSA 5C3WA 4ZQ3A 5COYA 5F2DA 4KN4C 4UDUC 4NKLA 3DEPA 1I4RA 2K5WA 5KGUA 4CKCA 4DN4M 5ELEA 3KUPA 2A6EC 1TIID 2L11A 2RSOA 1GUOA 2B2YC 3SE0A 3S2HB 4F7XA 5KNBA 4FXGC 1F9QA 2K04A 2EYLA 5EGTA 5C3XA 1JOKA 1S5DD 2JSOA 1D5MC 4HTHA 2AQ1B 2AUKA 1OXUA 3BDCA 1JQYD 2EYJA 5EPJA 1QG7A 4LMQD 1ENFA 3MXPA 3GV6A 3D3RA 1CFMA 4EVOA 4QUFA 3PV0A 3QO2A 2KCCA 2EVBA 3HP3A 3NUCA 3I70A 1J8IA 1I4HA 1VF5C 4LAAA 1KDAA 3VYUA 2WKDA 5IT9L 5EKIA 1EY7A 2F0KA 1B9NA 1DOLA 2F0EA 4RHRA 4P2CB 1M4VA 2KECA 2PZWA 1CZGA 4XTCS 1L0XB 3BZDB 2K5DA 5EKLA 2PZUA 4IUPA 1STEA 2CQAA 2HDLA 3OSOA 3MA2B 3BYYB 3TBIB 2XRQD 1PRTF 4R8NA 2LKVA 1TU2B 2B2YA 2B39A 1FR3A 3SK5A 1XXGA 1R9TB 3T53B 2NB0A 5CMDA 5ELCA 5BN3A 3Q24A 4QUCA 2KQ3A 3KBGA 2NVYB 4Y7NB 3I3CA 4X3KA 3M7NA 3LNNA 1UNSA 4OO1H 1LACA 2IW3A 1EY6A 1QILA 2NVQB 2JA6B 1Y1WB 3S1RB 3PO2B 5M5WB 2B63B 5CR3A 3C46A 1KDBA 4LJZC 3PUZA 2KVMA 2EJGC 4CHTB 5I9PA 4KD4A 2NTSA 3MZ5A 1RCVD 1STBA 4K14A 4ID6A 2OT2A 3CRLC 3V2TA 3HOUB 3HOWB 2G9HD 3QJYA 5FO9B 3N6RA 1BCPF 2OXPA 3HS0C 4BA2I 1LTBD 4PMWA 1EWHA 1DOMA 2IX0A 1C48A 1CK1A 2LS01 2FMCA 2HCIA 1QJOA 1TY0A 1U4MA 1F9SA 1TT2A 4DNRB 3RUZA 2F0MA 3KLSX 4EQOA 2DY7A 4RGOS 1GXDC 1VF7A 2RVLA 2MJ8A 3URYA 2L5TA 1JWSD 1E2VA 2H4OA 3DHQA 3BVGA 4V190 1KNEA 4A3FB 1SMYC 2F0TA 2F0SA 2JA8B 3S2DB 1F2ZA 4ZRZA 2BE5D 4JK1C 4C3HB 2Q8IB 1AN8A 1A3UA 3NTKA 2F0WA 5EPLA 4PMCA 1I6VC 3A8JE 3NQTA 1YNJD 4ZKCB 1O78A 1RJTA 1B50A 2FJ2A 1CI3M 2PQEA 3SK6A 4CJ0B 3TP6A 3PMFA 3K5OA 4KHVA 2MP1A 3OW7A 3U9SA 2BA0A 3OWEB 4G7ZC 5E3FA 2PZTA 3MXUA 4HSPA 4F8MA 3IAYA 1WD0A 1AZQA 3RZOB 3MVVA 3HEJA 2EZVA 1L0YB 1JR0D 2EY6A 2AQ2B 1NR2A 2Z4HA 4DNTB 3J81L 1K8OA 4HMIA 5J39A 4C2MB 2L55A 2K03A 4O42A 3K57A 1GUWA 3BS1A 4Q5VA 2F03A 1AZPA 1H9KA 5IGFA 3FRPB 2R92B 1I50B 5I9OA 4QIWB 4FNFA 1VMCA 3J7AF 1ZEQX 4O1NA 5IGDA 3UI2A 1PTOB 2QILA 5IIFA 4IALA 2IT1A 3U9OA 3BG3A 1EYCA 3TZUA 1SNCA 2EE1A 3NTHA 1S5BD 4H7BA 5J1ZA 3P20A 4B9WA 3N52A 2XNAC 4A3GB 1OXTA 4RGNA 3K6OA 3GTJB 5FKAC 2WP8J 1NR4A 3GQBA 1LO5D 3H09A 3VR5A 5FO7B 4RAUC 4WFN3 4XT1B 3QB3A 1PTOD 2ICIA 2CVRA 4BA1I 1XYIA 3D6WA 3HOXB 1Q12A 1WTPA 4XT3B 1MBYA 1HA5A 3VR6A 1STYA 2F0QA 1XX8A 3MHBA 2EYMA 2HUGA 1TS2A 4IFDJ 5A2QL 3Q23A 5CYUA 1SAPA 5CBEE 5E4WC 2CW0C 1I4GA 3L9AX 4IUNA 2XSCA 4AYBB 1HRJA 2B2WA 1TVXA 5A35A 4PMBA 4QB4A 1I4PA 2B2VC 2Q8RE 2A73B 4IN3A 2BCOA 1CM9A 1Y8OB 1NCVA 4A3DB 1D5XC 1RDPD 3NWTA 4OHJA 5DM63 3QOJA 1GUNA 5A2QE 1LT5D 1G6ZA 1IW7C 2E74C 2C9OA 2K05A 4J6HA 1NUCA 1EY0A 2SDFA 1OO9B 2R61A 1SNPA 2X69A 5G3LF 1MSHA 3E0JA 1HQRD 3HGBA 2BA1A 5EBDA 3NP8A 3DXJC 1QWYA 3K5NA 5D65A 2R3ZA 2X6GA 2I46A 3QIAA 4A3EB 1JWUD 3TSSA 5JOBA 1ESRA 4XQQA 5C5MA 4X3UA 1BNZA 4Q0FA 4B9XA 2O4XA 1PRTD 1G91A 1O7YA 2PPBC 4N9TA 2SNSA 5JEAJ 1Q8IA 4DA2A 1S4ZA 2JA5B 5JVH3 1IKLA 2LMCB 2FINB 3I4NB 1WTVA 2WIIB 1EU4A 5DEHA 1SNQA 4IUVA 3MEHA 1Y8NB 4DXFA 2IL8A 3OMGA 1HCZA 2K32A 2XRSD 2WAQB 3I4LA 1STNA 3OPOA 2B2VA 4ZYSA 4CBVA 3T51B 2IJ0A 1OXVA 3ND9A 1KLUD 3VR3A 3S16B 4FF1A 2NN6I 2QF7A 5LHY1 2NTTA 3H3VC 5CBAE 2BDOA 2F0OA 4XXEA 1SNMA 1HUMA 1BDOA 1PLFA 4IFDI 4L6TB 2F0LA 1OXXK 3MC0B 1HA6A 4K5WA 3ND8A 1KTKA 4ZK9B 4NP5A 2WB1B 3KK7A 5C0XI 4MIUA 3D8GA 4R8IA 4TKOB 1G2SA 5CORA 5C4HA 3ITPA 2DNEA 2KJXA 3G7LA 1ZXTA 2XWJB 3R2TA 1BBXC 2K5QA 1SYBA 2J4XA 1U4RA 1RKNA 3IFTA 3S17B 4UAIA 1KDCA 4K6DA 2H1EA 1WVLA 1PDQA 2PCFB 4BY1B 1H9SB 4G4KA 3IKJA 3KLRA 4QCLA 3D6CA 4KHZA 4H13C 4FF4A 2R93B 1SFOB 3AMUA 2K7VA 1SEBD 2AWOA 3ZYYX 1RHPA 1B9MA 2EJMA 4FXKC 1PYWD 4K5VA 2FMMA 2WV6D 5CV8A 1BXTA 4F88A 2F0HA 1SE3A 4XQJA 3QOLA 5E1FA 4A3MB 1H9MA 1WD1A 1H9RA 2D9UA 4KV6A 3NTIA 2RBMA 5T1IA 4FP5D 4FF3A 2TSSA 5BN5A 5ELBA 2F3WA 3S1QB 2HQEA 3NE5B 2L1BA 1IHZA 4A93B 1G291 2X6LA 2JYOA 4OGQC 3I72A 2WINB 3OIPA 5JJZA 2XWBB 3LWEA 1I6HB 2EYOA 5C4ZA 3SK4A 3RZDB 4JBWA 3DUZA 2K33A 3HOVB 2O5IC 4CJ2C 2ENBA 2DN8A 5M5YB 5E4XA 3H6MA 1BOSA 3A7LA 1EIHA 1V8QA 4KY5A 1EEID 2NN6G 2JA7B 3EFXD 1AP0A 1HUNA 2C5CA 5KRUA 1H9SA 2F0GA 1SJED 2JEBI 3HOYB 3S14B 2ICEC 4IFDG 2PW7A 1LABA 4B08A 1JE4A 5ELFA 1TWHB 1KAAA 1SE4A 4KY6A 2B2UC 2TMPA 2O5JC 5BN4A 3M3YB 2JP1A 1FNUA 2F1MA 2BE5C 4IQZA 3OOCA 3K7AB 3MFGA 1SDFA 5C44B 1DZ1A 5C0XG 2LY7A 1PZKD 3NWSA 1YNJC 4I7ZC 2NVTB 4C3IB 1EEFD 2QEJC 3R93A 4I65A 4HR7B 1JC7A 3O13A 4XIGS 5CV9A 5LL6X 2VB2X 5T1GA 1WTXA 1CA6A 1WTOA 4DF7A 1RF2D 1F77A 4KN7C 1C8CA 2Q8TA 4X3TA 3P7JA 1Y8PB 3H0GB 1YNND 2Z8LA 1II3A 2SEBD 1RODA 4NW2A 4A3BB 1HTPA 4RKBA 2KCNA 4E6IA 3NPPA 2KOLA 3MFYA 2B2TA 4C3HG 3H94A 3KF8A 3EVQA 3L3OC 4TQUS 1IKMA 3FEWX 4DGZA 1B3AA 2EY2A 1LV9A 1V43A 5CC4A 5IGBA 1ILQA 3CU7A 2RSNA 2B8GA 4LK1C 3RLFA 4A3KB 1TWGB 3FPPA 3R2IA 4DAYA 1ET9A 1K83B 2B2UA 3Q22A 1IYUA 3QG1A 2DY8A 4ZAIA 5CGKA 2B2WC 1WTRA 3OHXC 2PNRC 2IWHA 4QMGA 3WDNA 4X3SA 1STAA 3KBXA 4OIJA 1LT3D 1TS4A 4IUUA 4TRDA 2EOTA 5C5LA 3A54A 2A6HD 3P75A 1A3VA 1EZ8A 1GHJA 1RTNA 1PTOC 1SYEA 2PO4A 1X32A 1Q1EA 1CTMA 1RTOA 2OF1A 4J8QA 5CV7A 5IODA 4XDXA 5EPKA 2K1BA 4BS9A 4H0LC 1G8ZD 5EJWA 3R8BA 2L4NA 2SOBA 1S5ED 2MUYA 2A69D 4ULLA 1A6XA 4ABNA 2NN6H 1EIGA 3NHHA 1CQVA 4Z9CB 3RMHA 1JOQA 1CHQD 1W6KA 1AFPA 1ZYRD 1SNOA 2K6AA 3ONAB 3SHLA 1VDZA 1UEAB 1DCZA 1LTTD 3I73A 5IGCA 1B1ZA 3V96A 1JORA 5C0XH 3J80L 2GA4B 3ERQA 3J7YW 2K01A 1SYGA 1STHA 1XTCD 4BBSB 4MHEA 4CJ1B 1CHPD 3MWYW 3Q0AA 4ZKBB 2VNUD 1V1OA 1IL8A 2F0PA 3RD4A 2RDHA 3SEBA 2F0VA 1EZ6A 4N9PA 4CKEA 3J80E 1Y1VB 3DWQA 2K28A 2PYKA 4C3JB 4DK1A 1ICWA 1LTRD 5JPMC 2Z4IA 1DYQA 3K59A 1TQOA 1TWAB 1PRTB 3C3LA 2MGSA 5DNFA 1EL0A 1PZID 4KI0A 2IX3A 1QNUA 3R3OA 4C3JG 1QOHA 4WJWA 3FPUB 2IPKD 2F3VA 2QCPX 1A15A 1E2ZA 4HSVA 1O80A 3OWFA 1X3QA 1OXSC 5DM73 5CV6A 3VR2A 1H9JA 5M9OA 1TKWB 3FDTA 4IZ8A 2D2CC 1ET6A 5IGGA 2YU9B 4ZUJA 1D5ZC 4EQNA 1B2TA 3DWAA 2E2HB 1IYVA 1U9RA 5FK9C 1V1PB 3M7GA 2F0IA 3K5LA 2F0NA 5M3FB 1BCPB 3MXNA 4FF2A 4DFAA 2NWGA 1TWFB 3FMCA 3GD7A 1IW7D 2VB3X 4ODGA 1R4QB 2Z1CA 3TMEA 4WRDA 1DOKA 1F9RA 1FNWA 4J1MA 4K8IA 5I2YA 5EQ0A 5NUCA 1F2MA 1QNKA 4HMJA 3PO3B 3F2UA 1FYCA 3TDQA 2ZT9C 5D3DA 1MGSA 3OIQA 1AW7A 5C6AA 4V0BA 3I91A 4YIJA 1DM0B 5LL6S 1TS5A 5K5PA 4OIKA 1BCPD 3I90A 1F9PA 1EY4A 4DAVA 2E76C 3LWUA 3BVMA 2D62A 4KKTA 5FLXE 2KA7A 2KEEA 3T16A 4IURA 1B44D 1PTOH 3T4AC 1BUVT 1SYCA 1DXMA 1FD7D 1KABA 3V05A 3PIO3 4HCSA 1HQMC 3VR4A 4DU9A 5JAVA 1EY8A 3WOFA 2E2IB 2A74C 2NYZD 1D6EC 4FVMA 1V1PA 5KEEA 2HCCA 1S5CD 2PMZB 2XN9C 4U68A 1PTOF 2R6GA 4K2LA 3NSWA 2QKIC 2KEDA 3VYRA 1CT1D 2B8FA 3SK8A 4KTAA 2R7ZB 3MXGA 2A68D 1A3TA 5HURA 2G9DA 3S1MB 1Z47A 3H91A 5IOCA 3T13A 2EYPA 3GTPB 1CA5A 5FO8B 1O7ZA 2N88A 4KJNA 1Z7TA 3AB9A 3K0YA 4KD3A 3HG9A 3Q6SA 1I4XA 5EKKA 1M8AA 2A6ED 5C3EB 4BBRB 1D1KA 1R4PB 3GP7A 2HDMA 1LT6D 2EJFC 1J9OA 2E2JB 3DEOA 1JWMD 2XIWA 3EJIA 3GTMB 2EYFA 1PFMA 3X3NA 4RH6A 4G57A 3PUXA 2F0UA 3A7AB 2EPBA 1TWCB 3TP8A 1ONLA 2V4DA 3BVZA 3CQZB 2L0CA 1TR5A 2PW5A 2N55A 3DMUA 1FGBD 4R9WA 3PUVA 4C56C 1HFGA 5M5XB 4HEDA 1ZKOA 3TZDA 3HZXA 3NK9A 3E5SA 2M9VA 2B2TC 3FKIB 5IT9E 3VA7A 5M3MB 2BDNA 1Z6HA 1W6JA 1PZJD 1K8MA 2KUMA 1EQTA 2XVSA 2F0DA 3X3MA 1E2WA 1JICA 3PIP3 2NUCA 1O7LA 4IUTA 4TSSA 2I07B 1D2BA 3NQIA 2VUMB 1ENCA 3I4MB 1I3QB 1I4QA 3D31A 3NBIA 2D5DA 5J22A 1STGA 1B53A 5C4JB 2EYHA 1HHVA 3S15B 1GUSA 3G6JB 4HN7A 2L12A 1UAPA 2KHSA 3NBHA 1YNNC 1Q90A 1NSNS 2OEOA 3GTLB 1DD2A 4FYDA 4HCEA 3WOEA 2VXWA 2WKCA 2MHVA 3NXWA 4K6LA 1QB5D 4KMUC 1CZWA 3TP7A 1EQVA 4HAEA 1GUTA 1EFID 1VCIA 1SYDA 3HRZC 4EQPA 1U4LA 3SDZA 5KNCA 4C1NK 3D4WA 2MPMA 1LTID 4K8JA 1GOZA 4FXDA 4ME5A 1SYFA 1GHKA 2L9HA 1EOTA 1EU3A 4C3IG 5IGEA 2FFKB 2LFNA 3VYTA 5JPNC 4CGYB 5I2XA 3D4RA 3AU7A 4RHSA 2ZXPA 1MD2D 1U4PA 1ESFA 4G7HC 3A56A 2NBFA 3IL8A 1T5XD 5G3LD 1VMPA 5JEAG 3EA6A 1Q3LA 2WACA 4U673 2A6HC 4ZUIA 4PV1C 3D4DA 3DM1A 3GTOB 1SE2A 2AUJD 3M4OB 3CRKC 1BR9A 1G2TA 4BY7B 3K58A 1SXTA 2FHTA 3SR1A 1ILPA 1JOOA 3HKZB 2YYZA 4QF4A 4KKUA 1C4QA 3BYTB 1LTAD 1MSGA 4KY7A 5K36G 1SMYD 2A69C 4KJOA 2J7ZA 1F2LA 1T5EA 1ML0D 3TP5A 2ZXOA 2Y0SB 1XWEA 1DJRD 1F2YA 2CHBD 4G7OC 3M4YA 1JCKB 1BQQT 3C1FA 2EY5A 4RA8A 3GV3A 1ZYRC 1B4OA 3C1EA 3W2DA 4RCNA 1S5FD 2IX1A 3A8IE 3C2PA 5KIXA 4L8JA 1SBBB 4OO1I 1TY2A 3QWNA 4NMZA 3J81E 5EBCA 2RKSA 3I8ZA 1LT4D 4KK7A 4BWGB 1EYDA 2EXZA 2F0JA 1TS3A 3FVQA 4DK0A 2A5HA 5DAUA 1GUGA 3MAQA 2E2DC 2JXMB 3VA5A 4FO2A 4IFDH 3EROA 2F0FA 2AWNA 1Y69U 1RD9D 1HFNA 3GTGB 2BOSA 3A55A 4RGTA 5KYIA 4XQNA 1HXYD 4S3SA 3IFDA 4F87A 1ENAA 2RDGA 4L63B 5C4XB 1EY9A 4PQXA 4XYQA 3W3AA 3HOZB 3OMCA 2F4IA 3EQLC 1QE6A 2AQ3B 4MN3A 4K5XA 5JVG3 4RKLA 2RA4A 1AEXA 4H44C 1BF4A 1EYAA 1CQFA 1SJHD 3SXHA 3PUWA 4KKSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4N A;  2KVM A;  3LWE A;  1G2S A;  5COR A;  1PFM A;  3SVM A;  1ROD A;  1U4L A;  1A15 A;  5D14 A;  3GV6 A;  4NW2 A;  4RAU C;  4X3U A;  2MP1 A;  4XT1 B;  1BNZ A;  2MPM A;  1ZXT A;  3G7L A;  1G91 A;  4RA8 A;  3GV3 A;  1O7Y A;  4HSV A;  1O80 A;  1B4O A;  1DON A;  2CVR A;  2EPB A;  1BBX C;  2L9H A;  1EOT A;  2KOL A;  1X3Q A;  4HCS A;  4CJ2 C;  1U4R A;  1XYI A;  1WD0 A;  4QUF A;  2FFK B;  4RWS C;  5E4X A;  3TN2 A;  1AZQ A;  2B2T A;  3QO2 A;  1EIG A;  1PFN A;  4UAI A;  1EIH A;  3FDT A;  3D6W A;  5AFW A;  1S4Z A;  1WTP A;  2N55 A;  1IKL A;  4XT3 B;  3HP3 A;  1HA6 A;  2FIN B;  1IKM A;  1AP0 A;  1WTV A;  2H1E A;  2M2L A;  1DOM A;  4R9W A;  1WVL A;  1CA6 A;  1HUN A;  1PDQ A;  1HFG A;  1NR2 A;  1XX8 A;  2NYZ D;  1J8I A;  1WTW A;  4HED A;  4IUV A;  2HUG A;  1B2T A;  1B3A A;  1BO0 A;  1X3P A;  3TZD A;  1SAP A;  5CBE E;  1LV9 A;  1U4P A;  1E0B A;  2IL8 A;  2HCI A;  3I8Z A;  1WTQ A;  2HCC A;  5E4W C;  2B2T C;  2K03 A;  4O42 A;  4U68 A;  2BDN A;  3IL8 A;  3ONA B;  1ILQ A;  2RSN A;  5EKI A;  1HRJ A;  2B2W A;  1TVX A;  1U4M A;  3MTS A;  1JE4 A;  1F9S A;  1GUW A;  1DOL A;  1PFB A;  2KED A;  2KUM A;  1EQT A;  2B2V C;  2Q8R E;  2B2U C;  5COY A;  1VMP A;  4IUQ A;  2DY7 A;  1JIC A;  1MI2 A;  2JP1 A;  1CM9 A;  1RHP A;  1NCV A;  2B2V A;  1AZP A;  2B2U A;  2KEC A;  4IUT A;  1Q3L A;  3DEP A;  2K01 A;  2RVL A;  4DN4 M;  1NAP A;  1SDF A;  2MJ8 A;  2NZ1 D;  2FMM A;  2NWG A;  3DM1 A;  3KUP A;  2HDL A;  4IUP A;  4MHE A;  1DZ1 A;  4CJ1 B;  1VMC A;  3MWY W;  3H91 A;  2L11 A;  2RSO A;  1G6Z A;  2DY8 A;  1KNE A;  4ZAI A;  1HFN A;  2B2Y C;  1B53 A;  2B2W C;  4ZKB B;  1WTR A;  1DOK A;  2K05 A;  1WD1 A;  1G2T A;  3UI2 A;  1F9R A;  1HHV A;  2D9U A;  1CA5 A;  2B2Y A;  2L12 A;  5EQ0 A;  5CBA E;  1IL8 A;  2SDF A;  4X3S A;  1HUM A;  1F9Q A;  1O7Z A;  1QNK A;  2K04 A;  2X69 A;  2N88 A;  1PLF A;  3KBX A;  5T1I A;  3R93 A;  2EE1 A;  3IFD A;  1MSH A;  4OIJ A;  3F2U A;  5CMD A;  2FHT A;  4IUU A;  2EOT A;  1ILP A;  1MGS A;  2K28 A;  3Q6S A;  1ICW A;  2KEE A;  1WTX A;  2L1B A;  4QUC A;  1SSO A;  5T1G A;  1M8A A;  3N52 A;  5EPL A;  3FPU B;  1RTN A;  3I91 A;  4ZLT F;  1WTO A;  1MSG A;  3I3C A;  4X3K A;  5D65 A;  2VXW A;  1X32 A;  4ZK9 B;  1RTO A;  2R3Z A;  2X6L A;  2Q8T A;  2HDM A;  2X6G A;  4OIK A;  3I90 A;  1C8C A;  1F9P A;  4X3T A;  4ZKC B;  2MGS A;  3P7J A;  4XDX A;  1QE6 A;  1J9O A;  5DNF A;  4MN3 A;  1RJT A;  2J7Z A;  1F2L A;  2JYO A;  1B50 A;  1ML0 D;  5EPJ A;  2K1B A;  5EPK A;  1EL0 A;  4HAE A;  1KNA A;  1NR4 A;  2FJ2 A;  3DEO A;  2RA4 A;  1BF4 A;  1QG7 A;  4LMQ D;  5EJW A;  1ESR A;  5JJZ A;  4IUR A;  2XIW A;  4R8I A;  4CJ0 B; 
#chains in the Genus database with same CATH topology
 4BBS G;  5LMU Q;  5I6W A;  1E1O A;  5KYL A;  1MJE A;  4C3I H;  4XYO A;  5D14 A;  2JEA I;  3DWP A;  3UE0 A;  1EWC A;  3J7Z C;  1NBW A;  5BR8 Q;  1UUP A;  1PRT C;  3E6Z X;  4RGM A;  5I6Y A;  1DON A;  3P1H A;  1VQ7 A;  1LTS D;  4GKK L;  4RWS C;  3IRB A;  2CQO A;  2O2L D;  3OTO Q;  1PMR A;  2QDB A;  3LGJ A;  4I7A A;  5AFW A;  3GTK B;  2KEN A;  3J7A 5;  1Y1V G;  2J0T D;  1N8R C;  4ILW A;  5C0X J;  1WCM B;  4MZ9 A;  4C1N I;  4DK3 C;  5JJK A;  2E75 C;  3H0G H;  4RFB A;  2N8N A;  4DXG A;  2DGY A;  1X3P A;  3GO5 A;  3GTQ B;  4JG2 A;  5JEA H;  5D3I B;  4A3J B;  2EDG A;  4JPB W;  2HHH Q;  1D1I A;  4A3B H;  4M8A A;  1VS0 A;  4CKB A;  4RCO A;  1PFB A;  1WJJ A;  4DR4 Q;  2RQX A;  1A63 A;  4IUQ A;  2ID0 A;  3M85 A;  4JI4 Q;  1MI2 A;  3AFP A;  3L0O A;  4QQB X;  4DR6 L;  1LLR D;  1A2T A;  1HNX L;  4JI0 Q;  1NAP A;  2NZ1 D;  4DV6 L;  3J7A V;  2KCT A;  3TEH B;  5I4D A;  2ZXR A;  4LF5 L;  1LTG D;  2HD3 A;  3L7Z C;  1IBL L;  2CW0 D;  1Q1B A;  2XTI A;  2DNC A;  4K2K A;  2RCN A;  1HH2 P;  2D0P A;  4DAP A;  3RNU A;  3BDL A;  2UU9 L;  1BCP C;  5CV4 A;  3A8K E;  4X65 Q;  3BDO A;  3M4P A;  2MQH A;  2EY1 A;  2LSS A;  5ISR A;  3JAM L;  3CKI B;  4OL7 A;  4EQ5 A;  2V1C C;  1PXU A;  3K5M A;  1YZ6 A;  3S1N B;  5K36 H;  4R4C A;  3CHB D;  2I5H A;  2JE6 I;  1A2U A;  4P73 A;  4A3K H;  4GZY C;  1TWG H;  2NVX B;  1SSO A;  3ULJ A;  1XPO A;  4ZLT F;  4NDX A;  4PNY A;  1K83 H;  3T56 B;  1CUK A;  3ULP A;  1FL0 A;  5CV5 A;  3STB C;  4NPS A;  1FNV A;  4UP7 A;  5M3F G;  3CME A;  5HGT A;  4DV3 L;  3F2B A;  1W3S A;  4DPG A;  3S9W A;  4JI6 L;  1KNA A;  2SNM A;  1I94 Q;  4OO1 G;  1EY5 A;  3PUY A;  5FLX L;  5TSS A;  3JAM E;  3SVM A;  4DR7 L;  2RHQ B;  1QCB D;  4YHH Q;  1SND A;  5KND A;  4Y52 H;  5FOB B;  4GN3 B;  2UUB Q;  4LNQ A;  4M1U B;  3TN2 A;  1JB3 A;  3PO3 G;  3KLS A;  1PFN A;  4A3I B;  1MKH A;  4WOR A;  5IY0 A;  4MNO A;  3VYS A;  2RDF A;  2M2L A;  2F4V L;  2A68 C;  1GJX A;  3LX0 A;  1CKN B;  5ELD A;  1WTW A;  4ALP A;  4EGV A;  1HPC A;  1BO0 A;  1E0B A;  1HTL D;  1WTQ A;  1KLG D;  2M00 A;  4JYA Q;  1C0A A;  3MTS A;  5C3W A;  4ZQ3 A;  1HNZ Q;  4LF6 L;  5COY A;  5F2D A;  4KN4 C;  4UDU C;  4NKL A;  2OTJ A;  3DEP A;  1I4R A;  2K5W A;  5KGU A;  4CKC A;  4DN4 M;  5ELE A;  3KUP A;  4DR1 Q;  2A6E C;  1TII D;  2L11 A;  2RSO A;  1GUO A;  2B2Y C;  3SE0 A;  3S2H B;  4F7X A;  5KNB A;  4FXG C;  1F9Q A;  2K04 A;  2EYL A;  5H1S E;  1K73 C;  5EGT A;  4AH6 A;  5C3X A;  1JOK A;  1S5D D;  4JI2 Q;  1XMQ Q;  4QY7 A;  1YHQ A;  1KIX A;  2JSO A;  4HJ5 A;  1D5M C;  4HTH A;  1WOC A;  2AQ1 B;  3RN2 A;  2AUK A;  1OXU A;  2N3S A;  3BDC A;  3EBE A;  1JQY D;  4BBS H;  2R7Z G;  2KBN A;  2EYJ A;  5EPJ A;  1QG7 A;  4LMQ D;  1VQM A;  4HJ9 A;  1OTC A;  1ENF A;  3MXP A;  3GV6 A;  3D3R A;  1CFM A;  2ZJP A;  4EVO A;  4DV4 L;  2K50 A;  2EQS A;  4A3D H;  1GVP A;  4QUF A;  4C3J H;  3PV0 A;  3QO2 A;  4L5R C;  4UY8 C;  2KCC A;  2EVB A;  1YI2 A;  3HP3 A;  1TWA H;  1CKN A;  3NUC A;  5C3E G;  3I70 A;  4BBR G;  1J8I A;  1I4H A;  1X9N A;  4GOP C;  1VF5 C;  2IHE A;  4LAA A;  1KDA A;  3VYU A;  4MTK A;  2WKD A;  5IT9 L;  3B6Y A;  5EKI A;  1EY7 A;  2A19 A;  2F0K A;  1B9N A;  1DOL A;  4HID A;  4BXX G;  2F0E A;  4RHR A;  3JC6 6;  4P2C B;  1HNW L;  1M4V A;  2KEC A;  5LMN L;  2PZW A;  1CZG A;  4XTC S;  2K5N A;  1L0X B;  3BZD B;  1TXY A;  2K5D A;  5EKL A;  2PZU A;  3E0E A;  4IUP A;  1STE A;  2CQA A;  2HDL A;  5IE8 A;  3OSO A;  3MA2 B;  3BYY B;  3VDY A;  3TBI B;  5LMU L;  2XRQ D;  1PRT F;  4R8N A;  2YU9 H;  3I55 A;  3J81 i;  2LKV A;  1TU2 B;  2B2Y A;  2B39 A;  2E5L Q;  5BR8 L;  2E2H H;  1FR3 A;  3SK5 A;  1XXG A;  1HR0 Q;  2ZTE A;  1R9T B;  3RLN A;  1IBK L;  3T53 B;  2NB0 A;  5CMD A;  5ELC A;  5BN3 A;  3Q24 A;  3OTO L;  4X6A H;  4QUC A;  5M3F H;  2KQ3 A;  3Q8D A;  3FKI G;  3KBG A;  2KHI A;  5M3M G;  2NVY B;  3OYY A;  3I3C A;  4Y7N B;  4X3K A;  3M7N A;  3LNN A;  1UNS A;  4OO1 H;  4L5Q A;  1LAC A;  1JE5 A;  2IW3 A;  1N33 Q;  1EY6 A;  1TWF H;  1QIL A;  2NVQ B;  2JA6 B;  1XPU A;  1XNQ Q;  1Y1W B;  3S1R B;  3PO2 B;  1EIF A;  5M5W B;  2B63 B;  1VQB A;  5CR3 A;  1KDB A;  3C46 A;  2VUM G;  2HHH L;  4LJZ C;  3PUZ A;  2KVM A;  3I4M G;  1WTH A;  2EJG C;  4A4I A;  4CHT B;  4KD4 A;  5I9P A;  2NTS A;  3MZ5 A;  1RCV D;  2VQF Q;  1STB A;  4K14 A;  4DNI A;  4DR4 L;  2R7D A;  1M90 C;  3PO3 H;  4ID6 A;  2OT2 A;  4JI4 L;  3CRL C;  3V2T A;  3HOU B;  1SMX A;  3HOW B;  2G9H D;  2QA4 A;  3QJY A;  1VQO A;  1N9W A;  2CKZ B;  5FO9 B;  3N6R A;  3G71 A;  1BCP F;  2OXP A;  3HS0 C;  4BA2 I;  4IOA A;  1LTB D;  1QZG A;  4PMW A;  1EWH A;  1DOM A;  2IX0 A;  1XPR A;  4GLV B;  1C48 A;  4LF4 Q;  1CK1 A;  4LFB Q;  1SRO A;  1WYD A;  2LS0 1;  2FMC A;  2HCI A;  2UXD Q;  1QJO A;  1TY0 A;  1U4M A;  1F9S A;  1TT2 A;  4DNR B;  3RUZ A;  2F0M A;  4LFA Q;  3KLS X;  5AJ3 Q;  4IOC A;  4EQO A;  2DY7 A;  4RGO S;  1GXD C;  2NVT H;  1HJP A;  1VF7 A;  3CF5 A;  1E3P A;  2RVL A;  2MJ8 A;  3URY A;  1I94 L;  2L5T A;  1JWS D;  1E2V A;  3I2Z A;  2H4O A;  3DHQ A;  3BVG A;  2E2I H;  4V19 0;  1KNE A;  1K0R A;  4A3F B;  3MEF A;  1SMY C;  1KL9 A;  2F0T A;  1X6O A;  2F0S A;  4YHH L;  2JA8 B;  3S2D B;  1F2Z A;  4GNX B;  4ZRZ A;  2BE5 D;  4JK1 C;  5GQO A;  2Q8I B;  4C3H B;  3W5O A;  2UUB L;  1AN8 A;  1A3U A;  3NTK A;  2F0W A;  5EPL A;  4PMC A;  2R7Z H;  1I6V C;  3A8J E;  3NQT A;  1YNJ D;  3T1Y Q;  1VQ8 A;  4ZKC B;  1VQE A;  1O78 A;  1RJT A;  1B50 A;  3S1M H;  2FJ2 A;  1CI3 M;  1PH5 A;  1Z9F A;  2KHJ A;  2PQE A;  3SK6 A;  1V9P A;  3GTP H;  5HY6 A;  4CJ0 B;  4JYA L;  1PH6 A;  3TP6 A;  3PMF A;  3K5O A;  4KHV A;  2MP1 A;  1HZB A;  4LFC Q;  3OW7 A;  3U9S A;  2BA0 A;  3OWE B;  4G7Z C;  5E3F A;  4CDD C;  2PZT A;  3MXU A;  4HSP A;  4F8M A;  4BY7 G;  3L2P A;  1J6Q A;  3IAY A;  1WD0 A;  1AZQ A;  3RZO B;  3MVV A;  2Q2U A;  3HEJ A;  4JBK A;  4AIM A;  2EZV A;  1L0Y B;  1MIU A;  1P16 A;  5C3E H;  4BBR H;  1JR0 D;  2PNH A;  2EY6 A;  3K7U C;  3HKZ G;  5GRO A;  4A3M H;  2AQ2 B;  4JOI C;  1NR2 A;  3CCJ A;  2GN5 A;  2JJQ A;  4DR2 Q;  2Z4H A;  4GLA C;  4DNT B;  3J81 L;  2E2J H;  1K8O A;  4HMI A;  5J39 A;  4C2M B;  4BXX H;  2ZJQ A;  2L55 A;  3GTM H;  2K03 A;  4O42 A;  3T1H L;  1XMQ L;  2K4K A;  4DR3 L;  1PH1 A;  2Y0S G;  3K57 A;  1GUW A;  3ZJY C;  3BS1 A;  1G51 A;  1CSP A;  4GN4 B;  4DKA C;  4UPA A;  4YWK A;  4Q5V A;  2F03 A;  1TWC H;  1AZP A;  1H9K A;  5IGF A;  3FRP B;  2R92 B;  1I50 B;  3CQZ H;  5I9O A;  4QIW B;  4FNF A;  1VMC A;  3J7A F;  3TRZ A;  4P75 A;  1EQR A;  1ZEQ X;  1QZH A;  4LUV A;  4O1N A;  5IGD A;  3UI2 A;  5M5X H;  1PTO B;  1W2B A;  4JI8 Q;  2QIL A;  5IIF A;  4IAL A;  1SN8 A;  3CC4 A;  2IT1 A;  3U9O A;  4GNX A;  3BG3 A;  1EYC A;  4QIW E;  3TZU A;  1SNC A;  3HOV H;  2EE1 A;  2VL6 A;  3FKI H;  3NTH A;  1S5B D;  5M3M H;  4H7B A;  3UDX A;  5J1Z A;  4UP8 A;  3P20 A;  4B9W A;  3N52 A;  2XNA C;  1YIJ A;  4A3G B;  1OXT A;  3I7F A;  1KRT A;  4LUO A;  2AKW B;  4JW0 A;  4RGN A;  3CCV A;  1VQ9 A;  3J80 c;  1JJ2 A;  2VUM H;  3I4M H;  3K6O A;  1I3Q H;  3GTJ B;  5FKA C;  2WP8 J;  4IPG A;  1NR4 A;  3GQB A;  4GS3 A;  3M4Q A;  1LO5 D;  3H09 A;  5C4J H;  3VR5 A;  1VQH A;  3S15 H;  5FO7 B;  4WJ3 M;  3CP0 A;  5E7N A;  4RAU C;  2B29 A;  4WFN 3;  4XT1 B;  1NJI C;  3QB3 A;  1VQL A;  1PTO D;  2ICI A;  2CVR A;  4BA1 I;  1XYI A;  3GTL H;  2CH4 W;  3D6W A;  3HKS A;  3BU2 A;  3KJP A;  3HOX B;  1Q12 A;  1WTP A;  3CXC A;  4XT3 B;  1MBY A;  5IWA Q;  5C4X G;  1HA5 A;  3VR6 A;  3MXN B;  1STY A;  2F0Q A;  2ZM6 Q;  4AQY Q;  1KHI A;  3HOZ G;  1KD1 C;  3H3V I;  1XX8 A;  2E5L L;  3MHB A;  2EYM A;  4JOI A;  2HUG A;  1TS2 A;  4IFD J;  5A2Q L;  3Q23 A;  5CYU A;  1SAP A;  5CBE E;  5E4W C;  2CW0 C;  1I4G A;  1JJG A;  4OON A;  3L9A X;  4IUN A;  2OQK A;  2XSC A;  4AYB B;  1HRJ A;  2B2W A;  1TVX A;  4OWX B;  5A35 A;  4PMB A;  3RN5 A;  2UUA Q;  4QB4 A;  1I4P A;  2B2V C;  2Q8R E;  3EN2 A;  2A73 B;  4IN3 A;  2BCO A;  1E24 A;  1CM9 A;  1Y8O B;  1NCV A;  4A3D B;  2Q2I A;  5FJ8 G;  1D5X C;  1RDP D;  3NWT A;  4OHJ A;  1N33 L;  5DM6 3;  4AYB E;  3NEM A;  1EQQ A;  3QOJ A;  1XNR Q;  1GUN A;  5A2Q E;  1LT5 D;  1NMF A;  2BH2 A;  1G6Z A;  1EOV A;  1PA6 A;  4UP9 A;  1IW7 C;  1BKB A;  1E1T A;  2C9O A;  2E74 C;  2K05 A;  1VQ5 A;  4J6H A;  2WFW A;  5IP7 G;  2IHF A;  1NUC A;  1EY0 A;  3U50 C;  2SDF A;  1OO9 B;  2R61 A;  2H5X A;  1SNP A;  1WCM G;  2X69 A;  4L5T A;  5G3L F;  1MSH A;  3E0J A;  1HQR D;  3HGB A;  2BA1 A;  5EBD A;  3NP8 A;  3DXJ C;  4IPD A;  4LF9 Q;  1QWY A;  2DJG C;  4APV A;  3K5N A;  4A3J G;  5D65 A;  1FVI A;  3NEN A;  2R3Z A;  1LUZ A;  2X6G A;  2I46 A;  3QIA A;  3E9H A;  1XMO Q;  3GTO H;  4LFB L;  4A3E B;  5J3B A;  1JWU D;  1YEZ A;  2UXD L;  1NY4 A;  3TSS A;  5JOB A;  3M4O H;  1ESR A;  2ASB A;  4XQQ A;  5C5M A;  4BY7 H;  4LWC A;  4X3U A;  1BNZ A;  4Q0F A;  4LFA L;  1BBU A;  4B9X A;  2O4X A;  1PRT D;  5AJ3 L;  1G91 A;  1O7Y A;  4DUY Q;  2PPB C;  4N9T A;  5FLX c;  2SNS A;  4A3L G;  5JEA J;  4POG A;  3KF6 B;  2ES2 A;  1Q8I A;  4DA2 A;  1S4Z A;  1VQI A;  2JA5 B;  2GVA A;  1IKL A;  2LMC B;  3E3X A;  5JVH 3;  1J5E Q;  4OEM B;  2FIN B;  3I4N B;  1WTV A;  2WII B;  1EU4 A;  5DEH A;  2XGT A;  1SNQ A;  4IUV A;  3MEH A;  1Y8N B;  1X54 A;  4DXF A;  2IL8 A;  4JCV E;  1K8A C;  3OMG A;  1HCZ A;  2K32 A;  3H15 A;  3ERS X;  2XRS D;  3AFQ A;  1HZA A;  2WAQ B;  3I4L A;  1STN A;  3FP9 A;  3OPO A;  4KHP L;  3J81 j;  2B2V A;  4ZYS A;  4CBV A;  3T51 B;  2IJ0 A;  1OXV A;  4X62 Q;  3U58 A;  3ND9 A;  1KLU D;  2WAQ E;  3VR3 A;  3S16 B;  4OWW B;  5ELN A;  4FF1 A;  2NN6 I;  4GKJ Q;  2QF7 A;  1FJG Q;  3E9I A;  2NTT A;  5LHY 1;  4A3I G;  4LFC L;  3H3V C;  3K0X A;  5CBA E;  2BDO A;  2F0O A;  4XXE A;  1HUM A;  1BDO A;  1SNM A;  1PLF A;  4IFD I;  4L6T B;  2F0L A;  1OXX K;  1K3B C;  3I56 A;  3MC0 B;  1HA6 A;  4K5W A;  3ND8 A;  1KTK A;  4ZK9 B;  4NP5 A;  2WB1 B;  4ME3 A;  2A8V A;  3KK7 A;  3WWV A;  5C0X I;  1MJC A;  4MIU A;  1X56 A;  3D8G A;  5IYB G;  1K28 A;  3GTG H;  2MFI A;  2JA9 A;  4R8I A;  5GAG C;  4TKO B;  1G2S A;  2WB1 E;  5COR A;  3ITP A;  5C4H A;  2DNE A;  1KC8 C;  2KJX A;  4PZ8 A;  3G7L A;  1ZXT A;  2XWJ B;  3R2T A;  1BBX C;  2K5Q A;  1SYB A;  2J4X A;  1U4R A;  3KF6 A;  1RKN A;  5C4X H;  1PHJ A;  3IFT A;  4OEL B;  4R1J A;  1VQP A;  3S17 B;  4UAI A;  3HOZ H;  2OWO A;  1A8V A;  2YTV A;  1ASZ A;  1KDC A;  3K8A A;  4K6D A;  2H1E A;  1WVL A;  4JI8 L;  1PDQ A;  2PCF B;  4BY1 B;  4B3S Q;  1H9S B;  4G4K A;  3IKJ A;  4NB3 A;  4JI5 Q;  3CMA A;  3KLR A;  5ELO A;  4QCL A;  1AE2 A;  1M1K C;  1HZC A;  3D6C A;  4KHZ A;  1Y1V H;  5FJ8 H;  4H13 C;  4DR5 Q;  4FF4 A;  2R93 B;  1SFO B;  3AMU A;  2K7V A;  1SEB D;  2AWO A;  3ZYY X;  2N78 A;  2F3I A;  1RHP A;  1B9M A;  2EJM A;  1QVC A;  5IT9 c;  1PFS A;  4FXK C;  1PYW D;  4JI7 Q;  4K5V A;  2FMM A;  2WV6 D;  4K0K Q;  5IP7 H;  5CV8 A;  1BXT A;  3GTK H;  4F88 A;  2F0H A;  1SE3 A;  1S72 A;  4XQJ A;  3QOL A;  5E1F A;  2CWA A;  1KRS A;  4A3M B;  1WCM H;  1H9M A;  1YVC A;  1WD1 A;  1H9R A;  4B3M Q;  3HFZ B;  2D9U A;  3A0J A;  1X3G A;  2OQ0 A;  4KV6 A;  4PZ6 A;  3NTI A;  2RBM A;  5T1I A;  4FP5 D;  4FF3 A;  3GTQ H;  4A3J H;  4B3R Q;  2TSS A;  3QR8 A;  5ELB A;  5BN5 A;  2F3W A;  3S1Q B;  2HQE A;  3NE5 B;  4B3T Q;  2L1B A;  4R4I A;  1IHZ A;  2AHO B;  5IWA L;  4IJL A;  4A93 B;  1G29 1;  1HZ9 A;  4AQY L;  2X6L A;  4DV1 Q;  2JYO A;  4OGQ C;  3ULL A;  3I72 A;  2WIN B;  2RCF A;  2ATW A;  2BH8 A;  3OIP A;  5EAY A;  5JJZ A;  2XWB B;  2K5V A;  3LWE A;  3PF5 A;  1I6H B;  1GKH A;  2EYO A;  2UUA L;  5C4Z A;  1Y14 B;  4H02 A;  4A3L H;  1AH9 A;  3SK4 A;  1G6P A;  3RZD B;  4JBW A;  3DUZ A;  4DV7 Q;  2K33 A;  3HOV B;  2O5I C;  4CJ2 C;  2ENB A;  3S1N H;  4LF8 Q;  2DN8 A;  5M5Y B;  5E4X A;  2NVX H;  3H6M A;  1BOS A;  3A7L A;  1EIH A;  1V8Q A;  1XNR L;  2LXK A;  4KY5 A;  1EEI D;  2NN6 G;  3K80 C;  3W1B A;  2JA7 B;  3EFX D;  1X3E A;  1AP0 A;  1HUN A;  2C5C A;  5KRU A;  3KF8 B;  4GKK Q;  1H9S A;  2F0G A;  1K9M C;  1SJE D;  2JEB I;  4IPC A;  1PH7 A;  3HOY B;  3S14 B;  2ICE C;  4IFD G;  4GN5 A;  1KXL A;  2PW7 A;  2JA6 G;  1LAB A;  4B08 A;  2OTL A;  4JI0 L;  1Y1W G;  1JE4 A;  4LF9 L;  5ELF A;  1B7Y B;  2QEX A;  1TWH B;  2JK8 A;  2B63 G;  3PO2 G;  1KAA A;  1CKO A;  1SE4 A;  2B2U C;  2TMP A;  4KY6 A;  3M9B A;  4DV5 Q;  3U4V A;  2O5J C;  5BN4 A;  1AE3 A;  2JP1 A;  3M3Y B;  1FNU A;  4DAY B;  2F1M A;  2BE5 C;  4IQZ A;  3OOC A;  3K7A B;  3MFG A;  1UE7 A;  1SDF A;  3KLW A;  4X65 L;  5C44 B;  3HOU G;  1DZ1 A;  1JJC B;  1L1O B;  3HOW G;  5C0X G;  3RR5 A;  2LY7 A;  1PZK D;  3NWS A;  1SR3 A;  1YNJ C;  4I7Z C;  4DR6 Q;  2NVT B;  4P74 A;  4C3I B;  2CCZ A;  1EEF D;  4DUY L;  3G48 A;  2QEJ C;  3R93 A;  2PQA B;  4I65 A;  4HR7 B;  4UHV A;  4TVA B;  1JC7 A;  3O13 A;  4XIG S;  5CV9 A;  5LL6 X;  2VB2 X;  5T1G A;  1WTX A;  1CA6 A;  1WTO A;  1K8G A;  3TRE A;  5L37 A;  1ICF B;  1J5E L;  4DF7 A;  3H3V H;  1RF2 D;  1MHW C;  1F77 A;  4KN7 C;  1C8C A;  2Q8T A;  5IYB H;  4X3T A;  3P7J A;  4GNX C;  2CWP A;  1Y8P B;  3H0G B;  2R7F A;  4ZCK A;  5IYD G;  1YNN D;  2Z8L A;  2Z6B A;  2VQE Q;  1II3 A;  3S2H H;  2SEB D;  1ROD A;  1PVO A;  4NW2 A;  4A3B B;  3FHW A;  1HTP A;  4RKB A;  2KCN A;  4A3F G;  4JI6 Q;  4E6I A;  3NPP A;  3AYH B;  2KOL A;  3MFY A;  2JA8 G;  1A62 A;  4X62 L;  2B2T A;  4DR7 Q;  1UE6 A;  4C3H G;  3F2C A;  1BVS A;  4GKJ L;  5DLQ E;  3U4Z A;  2Z0S A;  1FJG L;  1RL2 A;  2VS1 A;  3H94 A;  3KF8 A;  3EVQ A;  3L3O C;  4TQU S;  1IKM A;  3FEW X;  4DGZ A;  4HIO A;  1NNX A;  1HNZ L;  4DV2 Q;  1B3A A;  2EY2 A;  1LV9 A;  1V43 A;  5CC4 A;  5IGB A;  1ILQ A;  3CU7 A;  2RSN A;  2B8G A;  4LK1 C;  3RLF A;  4A3K B;  4DR1 L;  3TQY A;  1TWG B;  3FPP A;  3R2I A;  1KQS A;  1WI5 A;  3ICE A;  4DAY A;  2UXB Q;  1ET9 A;  1K83 B;  2B2U A;  3Q22 A;  3NEL A;  1L1O A;  1IYU A;  1C9O A;  3QG1 A;  1Q86 C;  2DY8 A;  4ZAI A;  5CGK A;  2B2W C;  2HIV A;  3OHX C;  1WTR A;  4JI2 L;  2PNR C;  2IWH A;  4QMG A;  3UDI A;  2YTY A;  3WDN A;  4X3S A;  1STA A;  3KBX A;  1Q7Y C;  4OIJ A;  1LT3 D;  1TS4 A;  4IUU A;  4TRD A;  2EOT A;  5C5L A;  3A54 A;  4DAM A;  2A6H D;  1O7I A;  1S3O A;  3P75 A;  1A3V A;  1EZ8 A;  1GHJ A;  1RTN A;  2VW9 A;  2JN4 A;  5GAH C;  1VQ6 A;  1PYS B;  3PQI A;  1UEB A;  1PTO C;  1SYE A;  2PI2 E;  4HJA A;  4LF7 Q;  2GVB A;  2PO4 A;  1X32 A;  4O2D A;  1Q1E A;  1CTM A;  1RTO A;  2OF1 A;  4J8Q A;  5CV7 A;  5IOD A;  1K3R A;  4XDX A;  4B3S L;  4JBM A;  3PIP A;  5EPK A;  2K1B A;  4BS9 A;  4H0L C;  1X55 A;  1G8Z D;  3KDF B;  2R92 G;  1GM5 A;  5EJW A;  3CCR A;  3R8B A;  2L4N A;  1JMC A;  2LXJ A;  1FGU A;  4DR5 L;  3CCQ A;  3BZK A;  1YJW A;  2SOB A;  1R9T H;  3CAM A;  1S5E D;  2MUY A;  1IZ6 A;  2A69 D;  3PSI A;  4ULL A;  1E7Z A;  1JB7 A;  1A6X A;  4ABN A;  2NN6 H;  1EIG A;  3NHH A;  2UXC Q;  1CQV A;  1IYJ B;  4Z9C B;  3CCU A;  4K0K L;  2NVY H;  4Y7N H;  3RMH A;  5LMN W;  1S40 A;  4YWM A;  1JOQ A;  1CHQ D;  2UUC Q;  4B3M L;  1EUJ A;  1IBM Q;  4A3G G;  2NVQ H;  4CDF C;  1W6K A;  1AFP A;  2JA6 H;  1ZYR D;  1SE8 A;  3CPW A;  2RHS B;  3S1R H;  3W1G A;  1Y1W H;  1SNO A;  5M5W H;  2B63 H;  3PO2 H;  4B3R L;  3CPF A;  2K6A A;  3CCE A;  1EWI A;  3ONA B;  4J15 A;  3SHL A;  4B3T L;  1VDZ A;  1UEA B;  1DCZ A;  1LTT D;  3I73 A;  5IGC A;  1B1Z A;  3V96 A;  1JOR A;  3HOU H;  3HOW H;  3CW2 C;  4X66 Q;  5C0X H;  4DUZ Q;  4A3C G;  3J80 L;  4DV1 L;  2GA4 B;  3ERQ A;  3J7Y W;  2K01 A;  1SYG A;  1STH A;  1XTC D;  4BBS B;  4MHE A;  4CJ1 B;  1HR0 L;  1CHP D;  3MWY W;  2DUD A;  3Q0A A;  1HNW Q;  1XJV A;  4ZKB B;  3HOX G;  2ZTD A;  1Q82 C;  1I5F A;  4OX9 Q;  2PI2 A;  2VNU D;  1V1O A;  1IL8 A;  4DV7 L;  2F0P A;  2YV5 A;  3GDE A;  4MTN A;  3RD4 A;  2RDH A;  3SEB A;  2F0V A;  1CSQ A;  1X3F A;  4YCU A;  1EZ6 A;  4N9P A;  4CKE A;  3J80 E;  1Y1V B;  3DWQ A;  1T9H A;  2K28 A;  2PYK A;  4C3J B;  4DK1 A;  1ICW A;  3BZC A;  4P71 A;  1LTR D;  5JPM C;  1U0L A;  2Z4I A;  1XNQ L;  4KLK A;  4N8X 1;  4AYB G;  1IBK Q;  1IL2 A;  1DYQ A;  5IYD H;  3K59 A;  1TQO A;  1TWA B;  1PRT B;  3C3L A;  2MGS A;  5DNF A;  2VQF L;  1EL0 A;  3KDF A;  1PZI D;  4A3D G;  4KI0 A;  2IX3 A;  1QNU A;  3R3O A;  4C3J G;  1B70 B;  1QOH A;  4A3F H;  4WJW A;  3FPU B;  2IPK D;  2F3V A;  2QCP X;  1A15 A;  2JA8 H;  4JV5 Q;  2F52 A;  1E2Z A;  2HQL A;  3S2D H;  4FDB A;  4DV5 L;  4HSV A;  1O80 A;  4IPH A;  2K75 A;  4C3H H;  3OWF A;  1X3Q A;  1OXS C;  5DM7 3;  5CV6 A;  3VR2 A;  2I5L X;  3JAM c;  1H9J A;  3A5U A;  5M9O A;  1TKW B;  3FDT A;  4LF4 L;  4EX5 A;  4IZ8 A;  2D2C C;  3OW2 A;  1ET6 A;  2Z6K A;  5IGG A;  2YU9 B;  4ZUJ A;  1D5Z C;  4EQN A;  2VZA A;  1PH8 A;  1B2T A;  3DWA A;  2E2H B;  1IYV A;  2ZJR A;  1U9R A;  5FK9 C;  1V1P B;  4A75 A;  1E22 A;  3M7G A;  4A3E G;  2F0I A;  3K5L A;  2F0N A;  1VQD A;  5M3F B;  1BCP B;  2QDL A;  3MXN A;  4DV0 Q;  4FF2 A;  1GD7 A;  3RZO H;  4DFA A;  1NE3 A;  2B3G A;  1V1Q A;  2NWG A;  1TWF B;  5IYC G;  3FMC A;  3GD7 A;  2VQE L;  1IW7 D;  2VB3 X;  2MO0 A;  4ODG A;  3D0F A;  3SGI A;  4P72 A;  1R4Q B;  2Z1C A;  1N32 Q;  3TME A;  4WRD A;  3KOJ A;  1YIT A;  1X65 A;  1DOK A;  4PZ7 A;  1VQJ A;  1F9R A;  1FNW A;  2JA5 G;  4J1M A;  4K8I A;  5I2Y A;  5GAE C;  5EQ0 A;  5NUC A;  3I4N G;  4C2M H;  1F2M A;  1QNK A;  4HMJ A;  3PO3 B;  3F2U A;  2QW7 A;  1FYC A;  3TDQ A;  3KFU A;  2ZT9 C;  3T1Y L;  1YHA A;  5D3D A;  1LYL A;  1VQA A;  1MGS A;  3OIQ A;  1AW7 A;  5C6A A;  4V0B A;  3I91 A;  4YIJ A;  1DM0 B;  4LW1 A;  2WAQ G;  5LL6 S;  1PV4 A;  2R92 H;  1VQF A;  1TS5 A;  1I50 H;  5K5P A;  4OIK A;  1BCP D;  3I90 A;  1F9P A;  1EY4 A;  4DAV A;  3CCM A;  2E76 C;  4DV2 L;  3LWU A;  3BVM A;  2D62 A;  4JI3 Q;  1RIP A;  4KKT A;  3F8T A;  1SRU A;  5FLX E;  2KA7 A;  2KEE A;  4IUR A;  3T16 A;  4JI1 Q;  1EFW A;  1B44 D;  3TS0 A;  1PTO H;  1VQG A;  1PH3 A;  3T4A C;  1BUV T;  4NXN Q;  1SYC A;  4YCW A;  2NZH A;  1DXM A;  1FD7 D;  4OWT B;  1KAB A;  2UXB L;  3V05 A;  4HIK A;  3KYH C;  3PIO 3;  1U5K A;  4HCS A;  3STB D;  1HQM C;  3VR4 A;  4DU9 A;  5JAV A;  1QVG A;  4DR2 L;  4A3G H;  4GLX A;  3BJU A;  1YBY A;  1NTG A;  1EY8 A;  1N34 Q;  3WOF A;  2E2I B;  3PF4 A;  4HIM A;  2I5M X;  2QGQ A;  2A74 C;  2NYZ D;  3GTJ H;  1QUQ B;  4LUZ A;  2WB1 G;  1D6E C;  4FVM A;  1V1P A;  2Z9H A;  5KEE A;  2HCC A;  1S5C D;  2PMZ B;  2XN9 C;  4U68 A;  1PTO F;  2R6G A;  2A1A A;  4A3C H;  2VY3 A;  4K2L A;  3NSW A;  2QKI C;  2KED A;  3G6E A;  3VYR A;  4LF7 L;  1CT1 D;  2B8F A;  3SK8 A;  4KTA A;  2R7Z B;  3MXG A;  2A68 D;  3T1H Q;  2PMZ E;  4DR3 Q;  3CCL A;  1A3T A;  3HOX H;  3CD6 A;  4NXM Q;  4YCV A;  5HUR A;  2G9D A;  3S1M B;  1Z47 A;  4YY3 Q;  5IP9 G;  3H91 A;  5IOC A;  3T13 A;  2EYP A;  3GTP B;  1UE5 A;  1CA5 A;  1N36 Q;  3RLO A;  5FO8 B;  1O7Z A;  4X64 Q;  2N88 A;  4KJN A;  4BY1 G;  3NBH B;  5FLM G;  1Z7T A;  2UXC L;  3AB9 A;  3K0Y A;  4KD3 A;  3HG9 A;  3Q6S A;  1I4X A;  1XTD A;  2CFM A;  5EKK A;  1M8A A;  2A6E D;  2N49 A;  5C3E B;  4BBR B;  2Q2T A;  1D1K A;  2UUC L;  1R4P B;  4R4Q A;  1VQK A;  2R93 G;  4HJ7 A;  3GP7 A;  1IBM L;  3EIV A;  2HDM A;  1PH2 A;  1LT6 D;  2EJF C;  1J9O A;  4OXP A;  1PYB A;  2E2J B;  3DEO A;  2OCE A;  1JWM D;  2C35 B;  4O0A A;  2XIW A;  1A0I A;  3EJI A;  3GTM B;  2EYF A;  1PFM A;  1HR0 W;  3X3N A;  3S24 A;  4RH6 A;  4A3M G;  4G57 A;  3PUX A;  1VQ4 A;  2F0U A;  3A7A B;  2EPB A;  4X66 L;  4DUZ L;  2D0O A;  2ZM6 L;  1LM0 A;  1TWC B;  3TP8 A;  2K5H A;  4GOP B;  4L5S A;  1ONL A;  2V4D A;  3BVZ A;  3CQZ B;  2L0C A;  1TR5 A;  2PW5 A;  2N55 A;  3DMU A;  2IY5 B;  1FGB D;  4R9W A;  3PUV A;  4C56 C;  1HFG A;  4OX9 L;  1QUQ A;  5M5X B;  4A93 G;  4HED A;  4A3E H;  1C7Y A;  1ZKO A;  1EIY B;  3TZD A;  1L0W A;  3HZX A;  3NK9 A;  3AQQ A;  3E5S A;  2M9V A;  4WJ4 A;  2B2T C;  3FKI B;  1Q46 A;  5IT9 E;  3VA7 A;  1IXR A;  5M3M B;  2BDN A;  1Z6H A;  1W6J A;  1PZJ D;  1K8M A;  2KUM A;  1EQT A;  2XVS A;  3UE1 A;  2F0D A;  1K0S A;  3X3M A;  1E2W A;  1JIC A;  5IYC H;  3PIP 3;  2NUC A;  1O7L A;  4IUT A;  4TSS A;  2I07 B;  1D2B A;  3NQI A;  3HOV G;  1D8L A;  2VUM B;  2JQO A;  1ENC A;  1NMG A;  3I4M B;  1I3Q B;  2JA5 H;  1I4Q A;  3D31 A;  3NBI A;  2D5D A;  3PCO B;  3I4N H;  5J22 A;  1STG A;  1B53 A;  5C4J B;  2EYH A;  2MO1 A;  1HHV A;  3S15 B;  4JV5 L;  4RMF A;  1GUS A;  3G6J B;  4JC0 A;  4HN7 A;  2L12 A;  1UAP A;  1CKM A;  2JA7 G;  1D7Q A;  2KHS A;  3NBH A;  1YNN C;  1Q90 A;  1L1O C;  1NSN S;  2OEO A;  3HOY G;  3GTL B;  1XMO L;  1DD2 A;  4FYD A;  4A3I H;  3PIO A;  4HCE A;  4POF A;  3WOE A;  2VXW A;  2WKC A;  2MHV A;  3NXW A;  4K6L A;  1QB5 D;  4KMU C;  1CZW A;  3ER0 A;  3TP7 A;  1HNX Q;  1EQV A;  1Q81 C;  3S16 H;  1H95 A;  4DV6 Q;  4HAE A;  1GUT A;  1YJ9 A;  1EFI D;  1VCI A;  4LF5 Q;  1SYD A;  1IBL Q;  5C44 G;  3HRZ C;  4EQP A;  1KAW A;  3AEV A;  1U4L A;  3SDZ A;  5KNC A;  1GO3 E;  4IJH A;  4R4T A;  2UU9 Q;  4C1N K;  3D4W A;  2MPM A;  1LTI D;  1LTL A;  4K8J A;  4QL5 A;  3CC2 A;  1YJN A;  1GOZ A;  4FXD A;  4ME5 A;  1SYF A;  1VQC A;  4DV0 L;  1GHK A;  2L9H A;  1EOT A;  1EU3 A;  3J80 i;  4GOP A;  4C3I G;  5IGE A;  2FFK B;  1ASY A;  1UWV A;  2RF4 A;  4DK6 C;  5JJI A;  2ALY B;  2LFN A;  3A5Z B;  3VYT A;  2L15 A;  5JPN C;  1N32 L;  4CGY B;  2ZTC A;  5I2X A;  4YWL A;  3D4R A;  3AU7 A;  4DV3 Q;  4RHS A;  2ZXP A;  1PH9 A;  1MD2 D;  5GAD C;  1U4P A;  1ESF A;  4G7H C;  2EIF A;  3A56 A;  2NBF A;  3H0G G;  3IL8 A;  3K81 C;  1T5X D;  5G3L D;  4HJ8 A;  4QJF A;  3F1Z A;  2YTX A;  1VMP A;  5HGQ A;  1VQN A;  5JEA G;  3EA6 A;  2K52 A;  4A3B G;  3UDF A;  1P8L A;  1Q3L A;  5IP9 H;  3F2D A;  2WAC A;  4U67 3;  2A6H C;  2CH4 A;  3S17 H;  1Q8K A;  4ZUI A;  4PV1 C;  3D4D A;  3DM1 A;  4JI3 L;  3GTO B;  2EXD A;  1SE2 A;  4JI1 L;  4KHP Q;  2AUJ D;  3M4O B;  3CRK C;  4NXN L;  1BR9 A;  1G2T A;  2F4V Q;  4BY1 H;  4BY7 B;  3K58 A;  5FLM H;  1SXT A;  1JT8 A;  1PH4 A;  3UDG A;  3J81 c;  2FHT A;  2P5Z X;  3SR1 A;  1ILP A;  4PG3 A;  1JOO A;  2R93 H;  3HKZ B;  1SFO H;  2DJF C;  2YYZ A;  4QF4 A;  4KKU A;  1C4Q A;  4CDC C;  4LF6 Q;  3BYT B;  1LTA D;  1MSG A;  4KY7 A;  1N34 L;  5K36 G;  1EYG A;  1SMY D;  2A69 C;  4A3K G;  4KJO A;  2J7Z A;  1F2L A;  1T5E A;  3HKZ E;  1ML0 D;  3TP5 A;  2ZXO A;  2Y0S B;  2PQA A;  2Q2H A;  3DM3 A;  1XWE A;  4CDE C;  1DJR D;  3A74 A;  1F2Y A;  2E8G A;  2CHB D;  4G7O C;  3M4Y A;  1JCK B;  5JJL A;  1BQQ T;  3C1F A;  4QGU A;  2EY5 A;  4RA8 A;  3GV3 A;  3JAM i;  1L2F A;  1ZYR C;  1B4O A;  3PGZ A;  2Y0S E;  3C1E A;  3W2D A;  4RCN A;  1SLJ A;  3S1Q H;  3I4O A;  1S5F D;  2IX1 A;  4NXM L;  2FXQ A;  1B3Q A;  4JI5 L;  4YY3 L;  3A8I E;  4A93 H;  4JBJ A;  5KIX A;  3C2P A;  4L8J A;  1SBB B;  2I0Q A;  4R4O A;  1N36 L;  2K14 A;  1QVF A;  4OO1 I;  1TY2 A;  3QWN A;  4NMZ A;  4X64 L;  3J81 E;  1BBW A;  5EBC A;  2RKS A;  3I8Z A;  4IO9 A;  1I6H H;  1LT4 D;  4KK7 A;  1B8A A;  4JI7 L;  4BWG B;  3RZD H;  1EYD A;  2HIX A;  2EXZ A;  2F0J A;  2G5D A;  1TS3 A;  3FVQ A;  4N8F A;  4DK0 A;  3KJO A;  2A5H A;  2Z6K C;  5DAU A;  1GUG A;  3MAQ A;  5M5Y H;  4DV4 Q;  2E2D C;  2JXM B;  3VA5 A;  2KCM A;  4JVZ A;  4FO2 A;  3CC7 A;  1DGS A;  4IFD H;  1UE1 A;  3ERO A;  2F0F A;  4A76 A;  2AWN A;  2JA7 H;  1Y69 U;  1RD9 D;  2AMC B;  1HFN A;  3GTG B;  2BOS A;  3CCS A;  2MNA A;  2HT1 A;  3A55 A;  4RGT A;  5KYI A;  3HOY H;  4XQN A;  3S14 H;  1HXY D;  4S3S A;  3IFD A;  4F87 A;  1WFQ A;  1ENA A;  2RDG A;  1YHB A;  4L63 B;  5C4X B;  1EY9 A;  1TWH H;  4PQX A;  3G4S A;  4RG1 A;  4XYQ A;  3W3A A;  3HOZ B;  3M3Y H;  3OMC A;  3K7A H;  2F4I A;  5LMN Q;  3EQL C;  2NZO A;  5C44 H;  1QE6 A;  2AQ3 B;  3DLL A;  4MN3 A;  4K5X A;  5JVG 3;  1YNX A;  4RKL A;  2RA4 A;  1AEX A;  4H44 C;  1BF4 A;  1EYA A;  1CQF A;  1SJH D;  3SXH A;  3TS2 A;  3PUW A;  4LF8 L;  4KKS A; 
#chains in the Genus database with same CATH homology
 5I6W A;  5KYL A;  4XYO A;  5D14 A;  2JEA I;  3DWP A;  1EWC A;  1UUP A;  1PRT C;  3E6Z X;  4RGM A;  5I6Y A;  1DON A;  3P1H A;  1LTS D;  4RWS C;  2O2L D;  1PMR A;  2QDB A;  5AFW A;  3GTK B;  2J0T D;  4ILW A;  5C0X J;  1WCM B;  4C1N I;  2E75 C;  4RFB A;  4DXG A;  1X3P A;  3GO5 A;  3GTQ B;  5JEA H;  5D3I B;  4A3J B;  2EDG A;  1D1I A;  4M8A A;  4CKB A;  4RCO A;  1PFB A;  2RQX A;  4IUQ A;  2ID0 A;  3M85 A;  1MI2 A;  1LLR D;  1A2T A;  1NAP A;  2NZ1 D;  3J7A V;  5I4D A;  2ZXR A;  1LTG D;  3L7Z C;  2CW0 D;  1Q1B A;  2DNC A;  4K2K A;  4DAP A;  3BDL A;  1BCP C;  5CV4 A;  3A8K E;  3BDO A;  2EY1 A;  5ISR A;  3JAM L;  3CKI B;  4OL7 A;  1PXU A;  3K5M A;  3S1N B;  5K36 H;  3CHB D;  4GZY C;  2JE6 I;  1A2U A;  2NVX B;  1SSO A;  4ZLT F;  4NDX A;  4PNY A;  3T56 B;  5CV5 A;  1FNV A;  5HGT A;  3S9W A;  1KNA A;  2SNM A;  4OO1 G;  1EY5 A;  3PUY A;  5FLX L;  5TSS A;  3JAM E;  3SVM A;  1QCB D;  1SND A;  5KND A;  5FOB B;  4M1U B;  3TN2 A;  1JB3 A;  3KLS A;  1PFN A;  4A3I B;  4WOR A;  3VYS A;  2RDF A;  2M2L A;  2A68 C;  1GJX A;  3LX0 A;  5ELD A;  1WTW A;  4EGV A;  1HPC A;  1BO0 A;  1E0B A;  1HTL D;  1WTQ A;  1KLG D;  2M00 A;  3MTS A;  5C3W A;  4ZQ3 A;  5COY A;  5F2D A;  4KN4 C;  4UDU C;  4NKL A;  3DEP A;  1I4R A;  2K5W A;  5KGU A;  4CKC A;  4DN4 M;  5ELE A;  3KUP A;  2A6E C;  1TII D;  2L11 A;  2RSO A;  1GUO A;  2B2Y C;  3SE0 A;  3S2H B;  4F7X A;  5KNB A;  4FXG C;  1F9Q A;  2K04 A;  2EYL A;  5EGT A;  5C3X A;  1JOK A;  1S5D D;  2JSO A;  1D5M C;  4HTH A;  2AQ1 B;  2AUK A;  1OXU A;  3BDC A;  1JQY D;  2EYJ A;  5EPJ A;  1QG7 A;  4LMQ D;  1ENF A;  3MXP A;  3GV6 A;  3D3R A;  1CFM A;  4EVO A;  4QUF A;  3PV0 A;  3QO2 A;  2KCC A;  2EVB A;  3HP3 A;  3NUC A;  3I70 A;  1J8I A;  1I4H A;  1VF5 C;  4LAA A;  1KDA A;  3VYU A;  2WKD A;  5IT9 L;  5EKI A;  1EY7 A;  2F0K A;  1B9N A;  1DOL A;  2F0E A;  4RHR A;  4P2C B;  1M4V A;  2KEC A;  2PZW A;  1CZG A;  4XTC S;  1L0X B;  3BZD B;  2K5D A;  5EKL A;  2PZU A;  4IUP A;  1STE A;  2CQA A;  2HDL A;  3OSO A;  3MA2 B;  3BYY B;  3TBI B;  2XRQ D;  1PRT F;  4R8N A;  2LKV A;  1TU2 B;  2B2Y A;  2B39 A;  1FR3 A;  3SK5 A;  1XXG A;  1R9T B;  3T53 B;  2NB0 A;  5CMD A;  5ELC A;  5BN3 A;  3Q24 A;  4QUC A;  2KQ3 A;  3KBG A;  2NVY B;  4Y7N B;  3I3C A;  4X3K A;  3M7N A;  3LNN A;  1UNS A;  4OO1 H;  1LAC A;  2IW3 A;  1EY6 A;  1QIL A;  2NVQ B;  2JA6 B;  1Y1W B;  3S1R B;  3PO2 B;  5M5W B;  2B63 B;  5CR3 A;  3C46 A;  1KDB A;  4LJZ C;  3PUZ A;  2KVM A;  2EJG C;  4CHT B;  5I9P A;  4KD4 A;  2NTS A;  3MZ5 A;  1RCV D;  1STB A;  4K14 A;  4ID6 A;  2OT2 A;  3CRL C;  3V2T A;  3HOU B;  3HOW B;  2G9H D;  3QJY A;  5FO9 B;  3N6R A;  1BCP F;  2OXP A;  3HS0 C;  4BA2 I;  1LTB D;  4PMW A;  1EWH A;  1DOM A;  2IX0 A;  1C48 A;  1CK1 A;  2LS0 1;  2FMC A;  2HCI A;  1QJO A;  1TY0 A;  1U4M A;  1F9S A;  1TT2 A;  4DNR B;  3RUZ A;  2F0M A;  3KLS X;  4EQO A;  2DY7 A;  4RGO S;  1GXD C;  1VF7 A;  2RVL A;  2MJ8 A;  3URY A;  2L5T A;  1JWS D;  1E2V A;  2H4O A;  3DHQ A;  3BVG A;  4V19 0;  1KNE A;  4A3F B;  1SMY C;  2F0T A;  2F0S A;  2JA8 B;  3S2D B;  1F2Z A;  4ZRZ A;  2BE5 D;  4JK1 C;  4C3H B;  2Q8I B;  1AN8 A;  1A3U A;  3NTK A;  2F0W A;  5EPL A;  4PMC A;  1I6V C;  3A8J E;  3NQT A;  1YNJ D;  4ZKC B;  1O78 A;  1RJT A;  1B50 A;  2FJ2 A;  1CI3 M;  2PQE A;  3SK6 A;  4CJ0 B;  3TP6 A;  3PMF A;  3K5O A;  4KHV A;  2MP1 A;  3OW7 A;  3U9S A;  2BA0 A;  3OWE B;  4G7Z C;  5E3F A;  2PZT A;  3MXU A;  4HSP A;  4F8M A;  3IAY A;  1WD0 A;  1AZQ A;  3RZO B;  3MVV A;  3HEJ A;  2EZV A;  1L0Y B;  1JR0 D;  2EY6 A;  2AQ2 B;  1NR2 A;  2Z4H A;  4DNT B;  3J81 L;  1K8O A;  4HMI A;  5J39 A;  4C2M B;  2L55 A;  2K03 A;  4O42 A;  3K57 A;  1GUW A;  3BS1 A;  4Q5V A;  2F03 A;  1AZP A;  1H9K A;  5IGF A;  3FRP B;  2R92 B;  1I50 B;  5I9O A;  4QIW B;  4FNF A;  1VMC A;  3J7A F;  1ZEQ X;  4O1N A;  5IGD A;  3UI2 A;  1PTO B;  2QIL A;  5IIF A;  4IAL A;  2IT1 A;  3U9O A;  3BG3 A;  1EYC A;  3TZU A;  1SNC A;  2EE1 A;  3NTH A;  1S5B D;  4H7B A;  5J1Z A;  3P20 A;  4B9W A;  3N52 A;  2XNA C;  4A3G B;  1OXT A;  4RGN A;  3K6O A;  3GTJ B;  5FKA C;  2WP8 J;  1NR4 A;  3GQB A;  1LO5 D;  3H09 A;  3VR5 A;  5FO7 B;  4RAU C;  4WFN 3;  4XT1 B;  3QB3 A;  1PTO D;  2ICI A;  2CVR A;  4BA1 I;  1XYI A;  3D6W A;  3HOX B;  1Q12 A;  1WTP A;  4XT3 B;  1MBY A;  1HA5 A;  3VR6 A;  1STY A;  2F0Q A;  1XX8 A;  3MHB A;  2EYM A;  2HUG A;  1TS2 A;  4IFD J;  5A2Q L;  3Q23 A;  5CYU A;  1SAP A;  5CBE E;  5E4W C;  2CW0 C;  1I4G A;  3L9A X;  4IUN A;  2XSC A;  4AYB B;  1HRJ A;  2B2W A;  1TVX A;  5A35 A;  4PMB A;  4QB4 A;  1I4P A;  2B2V C;  2Q8R E;  2A73 B;  4IN3 A;  2BCO A;  1CM9 A;  1Y8O B;  1NCV A;  4A3D B;  1D5X C;  1RDP D;  3NWT A;  4OHJ A;  5DM6 3;  3QOJ A;  1GUN A;  5A2Q E;  1LT5 D;  1G6Z A;  1IW7 C;  2E74 C;  2C9O A;  2K05 A;  4J6H A;  1NUC A;  1EY0 A;  2SDF A;  1OO9 B;  2R61 A;  1SNP A;  2X69 A;  5G3L F;  1MSH A;  3E0J A;  1HQR D;  3HGB A;  2BA1 A;  5EBD A;  3NP8 A;  3DXJ C;  1QWY A;  3K5N A;  5D65 A;  2R3Z A;  2X6G A;  2I46 A;  3QIA A;  4A3E B;  1JWU D;  3TSS A;  5JOB A;  1ESR A;  4XQQ A;  5C5M A;  4X3U A;  1BNZ A;  4Q0F A;  4B9X A;  2O4X A;  1PRT D;  1G91 A;  1O7Y A;  2PPB C;  4N9T A;  2SNS A;  5JEA J;  1Q8I A;  4DA2 A;  1S4Z A;  2JA5 B;  5JVH 3;  1IKL A;  2LMC B;  2FIN B;  3I4N B;  1WTV A;  2WII B;  1EU4 A;  5DEH A;  1SNQ A;  4IUV A;  3MEH A;  1Y8N B;  4DXF A;  2IL8 A;  3OMG A;  1HCZ A;  2K32 A;  2XRS D;  2WAQ B;  3I4L A;  1STN A;  3OPO A;  2B2V A;  4ZYS A;  4CBV A;  3T51 B;  2IJ0 A;  1OXV A;  3ND9 A;  1KLU D;  3VR3 A;  3S16 B;  4FF1 A;  2NN6 I;  2QF7 A;  5LHY 1;  2NTT A;  3H3V C;  5CBA E;  2BDO A;  2F0O A;  4XXE A;  1SNM A;  1HUM A;  1BDO A;  1PLF A;  4IFD I;  4L6T B;  2F0L A;  1OXX K;  3MC0 B;  1HA6 A;  4K5W A;  3ND8 A;  1KTK A;  4ZK9 B;  4NP5 A;  2WB1 B;  3KK7 A;  5C0X I;  4MIU A;  3D8G A;  4R8I A;  4TKO B;  1G2S A;  5COR A;  5C4H A;  3ITP A;  2DNE A;  2KJX A;  3G7L A;  1ZXT A;  2XWJ B;  3R2T A;  1BBX C;  2K5Q A;  1SYB A;  2J4X A;  1U4R A;  1RKN A;  3IFT A;  3S17 B;  4UAI A;  1KDC A;  4K6D A;  2H1E A;  1WVL A;  1PDQ A;  2PCF B;  4BY1 B;  1H9S B;  4G4K A;  3IKJ A;  3KLR A;  4QCL A;  3D6C A;  4KHZ A;  4H13 C;  4FF4 A;  2R93 B;  1SFO B;  3AMU A;  2K7V A;  1SEB D;  2AWO A;  3ZYY X;  1RHP A;  1B9M A;  2EJM A;  4FXK C;  1PYW D;  4K5V A;  2FMM A;  2WV6 D;  5CV8 A;  1BXT A;  4F88 A;  2F0H A;  1SE3 A;  4XQJ A;  3QOL A;  5E1F A;  4A3M B;  1H9M A;  1WD1 A;  1H9R A;  2D9U A;  4KV6 A;  3NTI A;  2RBM A;  5T1I A;  4FP5 D;  4FF3 A;  2TSS A;  5BN5 A;  5ELB A;  2F3W A;  3S1Q B;  2HQE A;  3NE5 B;  2L1B A;  1IHZ A;  4A93 B;  1G29 1;  2X6L A;  2JYO A;  4OGQ C;  3I72 A;  2WIN B;  3OIP A;  5JJZ A;  2XWB B;  3LWE A;  1I6H B;  2EYO A;  5C4Z A;  3SK4 A;  3RZD B;  4JBW A;  3DUZ A;  2K33 A;  3HOV B;  2O5I C;  4CJ2 C;  2ENB A;  2DN8 A;  5M5Y B;  5E4X A;  3H6M A;  1BOS A;  3A7L A;  1EIH A;  1V8Q A;  4KY5 A;  1EEI D;  2NN6 G;  2JA7 B;  3EFX D;  1AP0 A;  1HUN A;  2C5C A;  5KRU A;  1H9S A;  2F0G A;  1SJE D;  2JEB I;  3HOY B;  3S14 B;  2ICE C;  4IFD G;  2PW7 A;  1LAB A;  4B08 A;  1JE4 A;  5ELF A;  1TWH B;  1KAA A;  1SE4 A;  4KY6 A;  2B2U C;  2TMP A;  2O5J C;  5BN4 A;  3M3Y B;  2JP1 A;  1FNU A;  2F1M A;  2BE5 C;  4IQZ A;  3OOC A;  3K7A B;  3MFG A;  1SDF A;  5C44 B;  1DZ1 A;  5C0X G;  2LY7 A;  1PZK D;  3NWS A;  1YNJ C;  4I7Z C;  2NVT B;  4C3I B;  1EEF D;  2QEJ C;  3R93 A;  4I65 A;  4HR7 B;  1JC7 A;  3O13 A;  4XIG S;  5CV9 A;  5LL6 X;  2VB2 X;  5T1G A;  1WTX A;  1CA6 A;  1WTO A;  4DF7 A;  1RF2 D;  1F77 A;  4KN7 C;  1C8C A;  2Q8T A;  4X3T A;  3P7J A;  1Y8P B;  3H0G B;  1YNN D;  2Z8L A;  1II3 A;  2SEB D;  1ROD A;  4NW2 A;  4A3B B;  1HTP A;  4RKB A;  2KCN A;  4E6I A;  3NPP A;  2KOL A;  3MFY A;  2B2T A;  4C3H G;  3H94 A;  3KF8 A;  3EVQ A;  3L3O C;  4TQU S;  1IKM A;  3FEW X;  4DGZ A;  1B3A A;  2EY2 A;  1LV9 A;  1V43 A;  5CC4 A;  5IGB A;  1ILQ A;  3CU7 A;  2RSN A;  2B8G A;  4LK1 C;  3RLF A;  4A3K B;  1TWG B;  3FPP A;  3R2I A;  4DAY A;  1ET9 A;  1K83 B;  2B2U A;  3Q22 A;  1IYU A;  3QG1 A;  2DY8 A;  4ZAI A;  5CGK A;  2B2W C;  1WTR A;  3OHX C;  2PNR C;  2IWH A;  4QMG A;  3WDN A;  4X3S A;  1STA A;  3KBX A;  4OIJ A;  1LT3 D;  1TS4 A;  4IUU A;  4TRD A;  2EOT A;  5C5L A;  3A54 A;  2A6H D;  3P75 A;  1A3V A;  1EZ8 A;  1GHJ A;  1RTN A;  1PTO C;  1SYE A;  2PO4 A;  1X32 A;  1Q1E A;  1CTM A;  1RTO A;  2OF1 A;  4J8Q A;  5CV7 A;  5IOD A;  4XDX A;  5EPK A;  2K1B A;  4BS9 A;  4H0L C;  1G8Z D;  5EJW A;  3R8B A;  2L4N A;  2SOB A;  1S5E D;  2MUY A;  2A69 D;  4ULL A;  1A6X A;  4ABN A;  2NN6 H;  1EIG A;  3NHH A;  1CQV A;  4Z9C B;  3RMH A;  1JOQ A;  1CHQ D;  1W6K A;  1AFP A;  1ZYR D;  1SNO A;  2K6A A;  3ONA B;  3SHL A;  1VDZ A;  1UEA B;  1DCZ A;  1LTT D;  3I73 A;  5IGC A;  1B1Z A;  3V96 A;  1JOR A;  5C0X H;  3J80 L;  2GA4 B;  3ERQ A;  3J7Y W;  2K01 A;  1SYG A;  1STH A;  1XTC D;  4BBS B;  4MHE A;  4CJ1 B;  1CHP D;  3MWY W;  3Q0A A;  4ZKB B;  2VNU D;  1V1O A;  1IL8 A;  2F0P A;  3RD4 A;  2RDH A;  3SEB A;  2F0V A;  1EZ6 A;  4N9P A;  4CKE A;  3J80 E;  1Y1V B;  3DWQ A;  2K28 A;  2PYK A;  4C3J B;  4DK1 A;  1ICW A;  1LTR D;  5JPM C;  2Z4I A;  1DYQ A;  3K59 A;  1TQO A;  1TWA B;  1PRT B;  3C3L A;  2MGS A;  5DNF A;  1EL0 A;  1PZI D;  4KI0 A;  2IX3 A;  1QNU A;  3R3O A;  4C3J G;  1QOH A;  4WJW A;  3FPU B;  2IPK D;  2F3V A;  2QCP X;  1A15 A;  1E2Z A;  4HSV A;  1O80 A;  3OWF A;  1X3Q A;  1OXS C;  5DM7 3;  5CV6 A;  3VR2 A;  1H9J A;  5M9O A;  1TKW B;  3FDT A;  4IZ8 A;  2D2C C;  1ET6 A;  5IGG A;  2YU9 B;  4ZUJ A;  1D5Z C;  4EQN A;  1B2T A;  3DWA A;  2E2H B;  1IYV A;  1U9R A;  5FK9 C;  1V1P B;  3M7G A;  2F0I A;  3K5L A;  2F0N A;  5M3F B;  1BCP B;  3MXN A;  4FF2 A;  4DFA A;  2NWG A;  1TWF B;  3FMC A;  3GD7 A;  1IW7 D;  2VB3 X;  4ODG A;  1R4Q B;  2Z1C A;  3TME A;  4WRD A;  1DOK A;  1F9R A;  1FNW A;  4J1M A;  4K8I A;  5I2Y A;  5EQ0 A;  5NUC A;  1F2M A;  1QNK A;  4HMJ A;  3PO3 B;  3F2U A;  1FYC A;  3TDQ A;  2ZT9 C;  5D3D A;  1MGS A;  3OIQ A;  1AW7 A;  5C6A A;  4V0B A;  3I91 A;  4YIJ A;  1DM0 B;  5LL6 S;  1TS5 A;  5K5P A;  4OIK A;  1BCP D;  3I90 A;  1F9P A;  1EY4 A;  4DAV A;  2E76 C;  3LWU A;  3BVM A;  2D62 A;  4KKT A;  5FLX E;  2KA7 A;  2KEE A;  3T16 A;  4IUR A;  1B44 D;  1PTO H;  3T4A C;  1BUV T;  1SYC A;  1DXM A;  1FD7 D;  1KAB A;  3V05 A;  3PIO 3;  4HCS A;  1HQM C;  3VR4 A;  4DU9 A;  5JAV A;  1EY8 A;  3WOF A;  2E2I B;  2A74 C;  2NYZ D;  1D6E C;  4FVM A;  1V1P A;  5KEE A;  2HCC A;  1S5C D;  2PMZ B;  2XN9 C;  4U68 A;  1PTO F;  2R6G A;  4K2L A;  3NSW A;  2QKI C;  2KED A;  3VYR A;  1CT1 D;  2B8F A;  3SK8 A;  4KTA A;  2R7Z B;  3MXG A;  2A68 D;  1A3T A;  5HUR A;  2G9D A;  3S1M B;  1Z47 A;  3H91 A;  5IOC A;  3T13 A;  2EYP A;  3GTP B;  1CA5 A;  5FO8 B;  1O7Z A;  2N88 A;  4KJN A;  1Z7T A;  3AB9 A;  3K0Y A;  4KD3 A;  3HG9 A;  3Q6S A;  1I4X A;  5EKK A;  1M8A A;  2A6E D;  5C3E B;  4BBR B;  1D1K A;  1R4P B;  3GP7 A;  2HDM A;  1LT6 D;  2EJF C;  1J9O A;  2E2J B;  3DEO A;  1JWM D;  2XIW A;  3EJI A;  3GTM B;  2EYF A;  1PFM A;  3X3N A;  4RH6 A;  4G57 A;  3PUX A;  2F0U A;  3A7A B;  2EPB A;  1TWC B;  3TP8 A;  1ONL A;  2V4D A;  3BVZ A;  3CQZ B;  2L0C A;  1TR5 A;  2PW5 A;  2N55 A;  3DMU A;  1FGB D;  4R9W A;  3PUV A;  4C56 C;  1HFG A;  5M5X B;  4HED A;  1ZKO A;  3TZD A;  3HZX A;  3NK9 A;  3E5S A;  2M9V A;  2B2T C;  3FKI B;  5IT9 E;  3VA7 A;  5M3M B;  2BDN A;  1Z6H A;  1W6J A;  1PZJ D;  1K8M A;  2KUM A;  1EQT A;  2XVS A;  2F0D A;  3X3M A;  1E2W A;  1JIC A;  3PIP 3;  2NUC A;  1O7L A;  4IUT A;  4TSS A;  2I07 B;  1D2B A;  3NQI A;  2VUM B;  1ENC A;  3I4M B;  1I3Q B;  1I4Q A;  3D31 A;  3NBI A;  2D5D A;  5J22 A;  1STG A;  1B53 A;  5C4J B;  2EYH A;  1HHV A;  3S15 B;  1GUS A;  3G6J B;  4HN7 A;  2L12 A;  1UAP A;  2KHS A;  3NBH A;  1YNN C;  1Q90 A;  1NSN S;  2OEO A;  3GTL B;  1DD2 A;  4FYD A;  4HCE A;  3WOE A;  2VXW A;  2WKC A;  2MHV A;  3NXW A;  4K6L A;  1QB5 D;  4KMU C;  1CZW A;  3TP7 A;  1EQV A;  4HAE A;  1GUT A;  1EFI D;  1VCI A;  1SYD A;  3HRZ C;  4EQP A;  1U4L A;  3SDZ A;  5KNC A;  4C1N K;  3D4W A;  2MPM A;  1LTI D;  4K8J A;  1GOZ A;  4FXD A;  4ME5 A;  1SYF A;  1GHK A;  2L9H A;  1EOT A;  1EU3 A;  4C3I G;  5IGE A;  2FFK B;  2LFN A;  3VYT A;  5JPN C;  4CGY B;  5I2X A;  3D4R A;  3AU7 A;  4RHS A;  2ZXP A;  1MD2 D;  1U4P A;  1ESF A;  4G7H C;  3A56 A;  2NBF A;  3IL8 A;  1T5X D;  5G3L D;  1VMP A;  5JEA G;  3EA6 A;  1Q3L A;  2WAC A;  4U67 3;  2A6H C;  4ZUI A;  4PV1 C;  3D4D A;  3DM1 A;  3GTO B;  1SE2 A;  2AUJ D;  3M4O B;  3CRK C;  1BR9 A;  1G2T A;  4BY7 B;  3K58 A;  1SXT A;  2FHT A;  3SR1 A;  1ILP A;  1JOO A;  3HKZ B;  2YYZ A;  4QF4 A;  4KKU A;  1C4Q A;  3BYT B;  1LTA D;  1MSG A;  4KY7 A;  5K36 G;  1SMY D;  2A69 C;  4KJO A;  2J7Z A;  1F2L A;  1T5E A;  1ML0 D;  3TP5 A;  2ZXO A;  2Y0S B;  1XWE A;  1DJR D;  1F2Y A;  2CHB D;  4G7O C;  3M4Y A;  1JCK B;  1BQQ T;  3C1F A;  2EY5 A;  4RA8 A;  3GV3 A;  1ZYR C;  1B4O A;  3C1E A;  3W2D A;  4RCN A;  1S5F D;  2IX1 A;  3A8I E;  3C2P A;  5KIX A;  4L8J A;  1SBB B;  4OO1 I;  1TY2 A;  3QWN A;  4NMZ A;  3J81 E;  5EBC A;  2RKS A;  3I8Z A;  1LT4 D;  4KK7 A;  4BWG B;  1EYD A;  2EXZ A;  2F0J A;  1TS3 A;  3FVQ A;  4DK0 A;  2A5H A;  5DAU A;  1GUG A;  3MAQ A;  2E2D C;  2JXM B;  3VA5 A;  4FO2 A;  4IFD H;  3ERO A;  2F0F A;  2AWN A;  1Y69 U;  1RD9 D;  1HFN A;  3GTG B;  2BOS A;  3A55 A;  4RGT A;  5KYI A;  4XQN A;  1HXY D;  4S3S A;  3IFD A;  4F87 A;  1ENA A;  2RDG A;  4L63 B;  5C4X B;  1EY9 A;  4PQX A;  4XYQ A;  3W3A A;  3HOZ B;  3OMC A;  2F4I A;  3EQL C;  1QE6 A;  2AQ3 B;  4MN3 A;  4K5X A;  5JVG 3;  4RKL A;  2RA4 A;  1AEX A;  4H44 C;  1BF4 A;  1EYA A;  1CQF A;  1SJH D;  3SXH A;  3PUW A;  4KKS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...