1SYEA

Engineering alternative beta-turn types in staphylococcal nuclease
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKTNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Engineering alternative beta-turn types in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 39
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1syeA00
1STAA 4G57A 2F0WA 4KD4A 4K2LA 3ITPA 4KJOA 2RKSA 1A3UA 3NHHA 4K5VA 1SNQA 4WRDA 3SK6A 5KRUA 2RBMA 3SK5A 3D6CA 5IIFA 4QB4A 2F0EA 1EY0A 2PW5A 4PNYA 5JOBA 3SR1A 4QMGA 2OF1A 3SK8A 5C3WA 3NXWA 5DEHA 1KDCA 1STBA 2PZTA 3MXPA 1TR5A 5NUCA 5KGUA 1ENCA 1SYBA 2F0SA 2F0DA 4OL7A 2SNMA 2F0TA 3D4WA 3P1HA 4K5WA 3QOLA 5C5LA 1A2TA 2F0LA 3T13A 5C6AA 5IOCA 5ISRA 5F2DA 1A3TA 1EY8A 1SNCA 3MVVA 2PZWA 3OMCA 2F0MA 1NUCA 5EKKA 4IALA 3SHLA 5IGGA 3EVQA 3H6MA 4B9XA 2NUCA 1STGA 1SYDA 1U9RA 2EYPA 5CV6A 5E3FA 5EGTA 5J39A 3QB3A 3C1EA 4F8MA 3EJIA 1SYEA 1AEXA 4ZUIA 3BDCA 5CV4A 2M00A 2F0HA 1II3A 4KY7A 2KHSA 4IUNA 2WACA 3D4DA 1JOKA 2PYKA 4J1MA 3HEJA 1SYCA 4QF4A 5CV8A 4ID6A 1EYCA 5IGBA 1SNMA 2F0PA 5M9OA 5I9OA 4KV6A 2RDFA 3OMGA 4NP5A 2F0FA 1EY4A 5EKLA 1KABA 3NK9A 2HQEA 4K14A 4RKBA 2EY2A 3E5SA 2EYOA 5I6WA 4I65A 4KY5A 2ENBA 1EY6A 4LAAA 1EY9A 2F0GA 5IGFA 1EZ6A 1EY5A 2LKVA 5E1FA 2EYJA 3MEHA 3P75A 4IZ8A 4NMZA 2EYFA 5IGEA 3ERQA 1KAAA 2F0VA 4K8IA 5CV9A 4DU9A 2EY5A 3NQTA 3TMEA 4EQNA 5I6YA 1F2YA 4R8NA 5CV7A 1JOOA 1SNPA 4ODGA 4DF7A 4K6DA 1RKNA 4DGZA 1EYDA 3DMUA 3LX0A 4WORA 4KHVA 2EY6A 2F0IA 3SK4A 5KIXA 5I9PA 2KQ3A 5HGTA 2F3WA 3TP7A 3R3OA 4EQOA 1EZ8A 3NP8A 5HURA 3MHBA 4F7XA 5DAUA 4HMJA 4ZQ3A 3RUZA 3TP5A 5C4HA 4TRDA 3SXHA 5KYLA 4E6IA 4HTHA 2F0UA 5CV5A 2PZUA 4PMBA 1STYA 1TQOA 2F0OA 4J6HA 5KYIA 4K2KA 2QDBA 5JAVA 1F2MA 1F2ZA 2F3VA 3OWFA 5KEEA 4N9TA 2EY1A 4EVOA 2F0QA 1EY7A 5J1ZA 4PMCA 1SYGA 3TP8A 1JORA 5C3XA 1SNOA 1SYFA 4HMIA 4S3SA 4K5XA 4B9WA 4KJNA 1STHA 3C1FA 4N9PA 1TT2A 3U9OA 5CC4A 3OSOA 2EYHA 1STNA 3HZXA 4ME5A 4NDXA 3EROA 3V2TA 5CGKA 5IGDA 4K8JA 2OXPA 1NSNS 2F0KA 3PMFA 4KTAA 3S9WA 3QOJA 2EYMA 4YIJA 4DFAA 1ENAA 3T16A 4RKLA 1IHZA 2F0NA 2O4XA 2EYLA 3BDLA 4KD3A 4H7BA 4MIUA 1A2UA 5J22A 3DHQA 4ZUJA 2OEOA 3TP6A 1A3VA 2F0JA 3NUCA 5C4ZA 1KDAA 2EXZA 2PW7A 2PQEA 4KY6A 5C5MA 1EYAA 2SNSA 1KDBA 1EQVA 4EQPA 1JOQA 3D8GA 5CR3A 3VA5A 3MZ5A 5IGCA 5K5PA 1SNDA 4NKLA 5IODA 2SOBA
chains in the Genus database with same CATH superfamily
2ATWA 4PZ7A 1JB3A 1MSHA 2KVMA 2PMZB 3SK5A 4WFN3 3T56B 3EIVA 1R4QB 2PO4A 1SFOB 5C3WA 2A6HC 3NWSA 2EJGC 2C35B 1S3OA 1NTGA 2MFIA 2F0TA 1U4RA 3KDFA 1J9OA 3QOLA 4A3CH 1LUZA 1SNCA 4A3KB 4DPGA 4LF7L 1L0XB 3MVVA 3M3YB 4EQ5A 1Z7TA 3STBC 2B2YA 4CJ0B 1U5KA 1STGA 1SYDA 2RSNA 2JXMB 5BN4A 4FF2A 1G2TA 1GJXA 2B2UA 3EJIA 3I4LA 3I2ZA 1IBKL 3KDFB 4FP5D 4DUYQ 5FLXL 4KY7A 1PXUA 5C4XG 2WACA 4JBMA 3A8KE 3NK9A 4R9WA 4ZCKA 2Q2TA 1YEZA 3R2IA 2WKDA 4DR2L 1QE6A 1C9OA 1S4ZA 2AUKA 2I5LX 3K5NA 2CHBD 4X3TA 3H3VH 5M5XB 1JE4A 1GUGA 2L5TA 1WJJA 1E2ZA 5BN3A 1T5XD 1YNJD 1FR3A 3I73A 4DF7A 3K5OA 2IHEA 4NXNL 2OTLA 3GD7A 3S2HB 1EYDA 4OELB 4DR3L 1GUSA 4GOPC 5HGTA 4UDUC 3HOVG 1F9SA 4F7XA 2X6LA 3U4ZA 4BY1G 3C2PA 2NVTB 1CZGA 4IUQA 3AB9A 4DV4Q 2LS01 3A7AB 4DR6L 2XIWA 4KKTA 2A68D 3HKSA 3VDYA 5K36G 1EU3A 5EPJA 4ULLA 3BZCA 2A69D 1I3QH 5IYBH 5GADC 1D2BA 5EJWA 4J8QA 3U58A 1STNA 5EPLA 3EROA 1BBXC 2NTSA 1ESFA 3KLRA 3QG1A 5FLMH 5M3MB 1QUQA 2NZOA 4IUTA 2UUCL 1KDAA 2YU9H 2VL6A 2IJ0A 2BH2A 1FNVA 4RAUC 1N36L 3OW7A 2K03A 3BZKA 3IKJA 4LFBL 4A3GB 2JA8H 2OQ0A 1QUQB 3DWQA 2Z6KA 3ITPA 1K3RA 4K5VA 1SNQA 4FXDA 5I4DA 5FO8B 2H1EA 2L12A 4UP8A 2F0EA 3PO3B 3ER0A 1TXYA 4A93G 1LTAD 5KNDA 1BCPF 3AYHB 1IBMQ 2F0DA 3I3CA 5C5LA 4HR7B 3A74A 3D4RA 5IGGA 5FKAC 4JYAL 4RFBA 3F1ZA 5JVH3 4X65L 1J8IA 5DNFA 1R9TB 3AEVA 1SYEA 2NN6G 2K04A 4O1NA 3DXJC 2LY7A 4C3HG 3PUVA 4YHHL 1JOKA 2MP1A 1SYCA 2G9DA 3G7LA 5IWAL 1EYCA 4DR5Q 1D7QA 4JW0A 3J81E 1S72A 3CP0A 3P20A 1D1IA 2A74C 3LWEA 1DD2A 4DK0A 2UXCL 5M5WB 1PLFA 2ENBA 3H0GH 2K5QA 1RDPD 4XYQA 2EYJA 4IZ8A 3HOYH 3HKZE 1N34Q 1BBUA 1LTSD 1H9KA 2KEEA 2JA5G 2QDLA 1QNKA 3HOXG 2BE5D 4K6DA 1L2FA 2EPBA 1GHJA 4RCNA 5M5YH 2K32A 5DLQE 2QCPX 3MFYA 5E7NA 2A19A 3S14B 1B9NA 4NPSA 4HTHA 4B3RL 1PTOH 1SRUA 3BZDB 1EQQA 3G48A 3I91A 1UE7A 3KJOA 3DM1A 4CGYB 2E76C 4TKOB 4LW1A 1SLJA 3BJUA 2VXWA 3TN2A 1C7YA 1NR4A 1JMCA 4B3MQ 4JI3Q 3AFQA 2JN4A 4LUZA 2ZTDA 5C4XH 4ZLTF 2QA4A 3EN2A 1X3FA 3K6OA 3TP6A 1X65A 1VQFA 4KY6A 3PO2G 1Y1VG 4JI0L 1G6PA 2FMMA 3BVZA 4HIKA 1VQ9A 4ZKCB 3I4MB 3A7LA 5IGCA 4NKLA 5IODA 4BBRH 2HQLA 1L0WA 4CDFC 2RKSA 1YNNC 3SK6A 2QKIC 3HOZG 2HIVA 3FEWX 2OF1A 4UP9A 3ULLA 4DKAC 4XDXA 5JJLA 5C0XG 3HOVH 1WTQA 4YCUA 2K33A 2NN6I 1C4QA 1E22A 2SNMA 4BY1H 4Y7NB 2F0LA 1B1ZA 4LF7Q 1DZ1A 3CCQA 1HXYD 2RCNA 1NUCA 3M4OB 4R1JA 3PSIA 2CVRA 1EWHA 2RDHA 1X3EA 4DV0L 3I4NB 2IY5B 4IUVA 3RD4A 2KECA 1NJIC 3C1EA 1GUTA 1IBKQ 5I2YA 4DR7L 5IP7G 2CW0D 4EX5A 4UP7A 4XQJA 1K0RA 4QF4A 1B44D 4GS3A 2I5HA 4B08A 4FDBA 1TU2B 1VQHA 4FNFA 1S5ED 2HQEA 1PVOA 3A56A 1PTOF 3IAYA 2FMCA 4LMQD 4DR2Q 4V0BA 2QF7A 2GA4B 2YTVA 2YV5A 3QWNA 4FVMA 1GOZA 2FXQA 3E0EA 1PRTD 3OWEB 4DN4M 2JA6G 4FYDA 4DV2Q 1H9JA 3PGZA 2EY5A 2M2LA 4R4TA 4JV5L 2WAQB 5JJIA 2E5LL 1IYJB 5IP9G 3ND8A 1DOLA 2A6HD 2V4DA 3CC7A 2YYZA 4A93H 1SE2A 4E6IA 2OT2A 1Y1WG 1NMGA 4DR6Q 1SSOA 2CQOA 2N78A 1IBLQ 3ULPA 1QVGA 3STBD 3R2TA 1DONA 5D3DA 3OYYA 1X3QA 3TP8A 2VY3A 3PUZA 1WTHA 4C3JB 4AH6A 1XNQQ 1TWAH 3PV0A 3D6WA 4BA2I 4CKBA 1K9MC 4KD3A 2OQKA 3PIPA 3BG3A 2DGYA 1Q82C 1I94L 3G6EA 1YJWA 1XMQQ 3DWPA 2UUCQ 4JI7Q 2MUYA 1QB5D 4YWMA 1KDBA 3MA2B 2ZJQA 2D2CC 1KL9A 4KKSA 2F1MA 1K8OA 3S16H 2P5ZX 1PMRA 4WRDA 5EBCA 2ID0A 4QCLA 1JT8A 3VYRA 2JA5H 1QOHA 1WYDA 2RBMA 4WJWA 3HOXH 1Q7YC 1HZBA 4LUOA 4A3BB 2WKCA 2JEBI 1VS0A 2I46A 4B3SQ 1Q8IA 3T13A 5C44G 1FGBD 3J81c 1HRJA 4QIWB 3C3LA 2J7ZA 4FF4A 2NUCA 5E3FA 1NE3A 3RLOA 2ZJRA 2BA1A 4ABNA 1AEXA 5FOBB 3CCJA 4YHHQ 1UE6A 3D4DA 1LTTD 1BUVT 5IT9L 4DAPA 4NP5A 4FF1A 3FPPA 4ZYSA 3CMEA 1UNSA 2UXCQ 4XQQA 2AQ3B 1VQDA 1WCMB 2DJFC 2L4NA 3PO2H 1VQOA 3ERQA 4L63B 1A8VA 1D5ZC 1Y1VH 1C0AA 2NZ1D 5CMDA 3J81j 2B29A 3KUPA 1RKNA 3N52A 1YVCA 1D8LA 2Y0SB 4KI0A 4HIOA 3HOZH 2KENA 1T5EA 1D5MC 4HAEA 2Q8RE 2AWNA 4JVZA 4DR1L 5C0XH 1E3PA 3SEBA 1QWYA 4B3RQ 3NBHA 1SROA 2F0OA 1E24A 1Z9FA 2ALYB 1F2ZA 2EY1A 1B3AA 1EY7A 1STEA 4PMCA 2F4VQ 3UDFA 1S5BD 4P74A 3NBHB 4S3SA 3L9AX 1C48A 2JA9A 4DA2A 1EIYB 2CWPA 5IP7H 1XJVA 2RHSB 1WFQA 3T1HL 1EU4A 3S9WA 3PCOB 1Q46A 3BDLA 4IQZA 4AIMA 3Q8DA 1SAPA 3RMHA 4A3CG 4DV4L 1A3VA 3NUCA 2PW7A 4O2DA 5FJ8G 4EQPA 5C3EG 3J7ZC 2E2HB 4JI0Q 4PG3A 1HQRD 2NVYH 2JA6H 4BBSG 3BU2A 1E2WA 3G6JB 5FLXE 2CFMA 3GTKB 1QILA 3PF5A 1B70B 1X55A 1EQTA 4UY8C 4PQXA 1D5XC 2X6GA 4QMGA 3A5UA 3G71A 2JYOA 4GZYC 3NENA 1JJCB 1V1QA 2E2IB 1KLUD 5DM63 1S5CD 1Y1WH 1JQYD 1A3TA 1X32A 2KCCA 3W3AA 5CBAE 3SHLA 4X3SA 5EKKA 3RZDH 3GTLB 4NB3A 2KUMA 4IN3A 1ML0D 5EGTA 4C2MH 2IHFA 2XGTA 4B3TQ 3GDEA 3M85A 2UUBQ 3DWAA 4DK3C 1D6EC 1TIID 5LMNQ 3KLSA 2RCFA 2A6EC 4RGMA 4Q0FA 1X3PA 5EPKA 3GTGB 2PPBC 5CV8A 4RH6A 4GKKQ 3OMGA 1K8AC 2IW3A 1IYUA 1CI3M 1YITA 1KABA 3OTOQ 1JB7A 1E1OA 5M3FG 2ZT9C 4JBJA 2DNEA 3MEHA 2IX1A 1YJNA 1OXVA 3DUZA 5D14A 1TWGH 1X54A 2KCMA 1JJ2A 3NQTA 3TMEA 1OXTA 1RHPA 1OTCA 4OWTB 1PDQA 2RVLA 1SJHD 1VF5C 2JA7G 3T4AC 1V1PA 3Q6SA 4HJ5A 3NP8A 2HD3A 2AMCB 4JK1C 1E2VA 1CQFA 3A54A 1O7YA 1O7ZA 2R7DA 3M9BA 3JAML 1KXLA 1V1PB 3OWFA 1N34L 2FINB 2K5VA 3HFZB 5C44B 1SYGA 2MO0A 1G91A 1F9RA 3MEFA 2VQFQ 1CZWA 1RJTA 5CGKA 3H09A 1S5DD 4K8JA 5LL6X 5ELFA 1JWMD 2ZXOA 3OIPA 3J7AF 4KMUC 1IHZA 1TWFH 3HKZB 1HUNA 2F0JA 1MHWC 2VUMB 1TS5A 3GV3A 5C5MA 3D8GA 5CR3A 3VA5A 1NAPA 1XTCD 1RCVD 1F9QA 1PH8A 2Z6KC 3H91A 4DNRB 4KD4A 3F2CA 4JI3L 3X3NA 4APVA 5C0XJ 2R92G 3H3VI 1I6VC 2PW5A 2DUDA 4OIJA 2EJMA 2KHIA 1WTXA 2Z8LA 3RLNA 4DV6Q 1SBBB 3GTJB 2HCCA 1ENCA 3ND9A 3P1HA 2ZXRA 3H0GG 5G3LD 4LF8L 4ZRZA 2K6AA 3HS0C 2AUJD 3HOYG 1HHVA 1ICFB 3TRZA 2PI2E 1XPOA 3SVMA 3S1MH 1A15A 1VMCA 2VS1A 1CKNA 3U4VA 1N32Q 1XWEA 2B8FA 4J1MA 3HEJA 1LT6D 1K8GA 3CQZB 2B63H 2XRQD 1KRTA 3FPUB 2BCOA 1CKNB 1U4PA 4P71A 3KLWA 1LLRD 3H15A 3W1GA 1EEID 3EFXD 3URYA 4BY7G 2IT1A 5FJ8H 5C3EH 4JCVE 1HUMA 1YHQA 2QILA 3NTIA 4C1NK 3VYSA 3GTMH 5T1IA 4BBSH 1EQRA 1EFWA 4PZ6A 2Z4IA 1Y8OB 3MWYW 2EY6A 1HNXQ 2R7ZB 4X62L 2C9OA 3R3OA 3KJPA 2EVBA 1D1KA 1ENFA 4FXGC 3F2DA 4DR1Q 1HTLD 1QG7A 4CJ2C 3TS0A 1Y8PB 2F0UA 1ZKOA 5IE8A 2GVAA 4YY3L 5IYDG 2JP1A 2F03A 5CBEE 2UXDQ 2BA0A 2O2LD 1BCPB 1UWVA 4TSSA 5GAGC 1EWCA 5GQOA 1IYVA 5A2QL 2WB1E 1YIJA 1Y8NB 4DV2L 3S1QH 4BBRG 4HMIA 4GN5A 4JI6Q 3I70A 4A3IG 1MI2A 2EYHA 1JICA 2NVQH 5LMUQ 3T1HQ 4F88A 3QOJA 2ICEC 2B8GA 4RKLA 2I5MX 5FLXc 1JCKB 3L0OA 2K5WA 4H7BA 4GN3B 3QJYA 5M3FH 2PQEA 1EYAA 3KYHC 2Q8IB 1IBLL 3S2HH 1CTMA 1K83H 3E3XA 4EGVA 1KRSA 1PV4A 3U9SA 2VNUD 1GHKA 1HFGA 4JI2Q 2NVTH 3S1NB 3RN2A 2EZVA 2NVXH 1XNQL 2LXKA 1UEAB 2EXDA 4LFAQ 2JA7H 4PZ8A 1PZJD 1QJOA 4JI7L 1XMQL 5FO7B 2F0MA 4B9XA 3K7UC 4A3DG 2YU9B 3NPPA 3SGIA 2K5DA 3CC4A 4R4CA 2UUAL 2VB3X 4AYBG 2BDNA 2JA8B 4CKEA 2RDFA 4B3SL 1BNZA 1VQ8A 1MD2D 3E5SA 4IOCA 4AQYQ 1EIFA 1BO0A 2L9HA 1FJGQ 3J80L 3ONAB 4X6AH 2R93G 1TKWB 1KAAA 4K8IA 1O80A 3PO3H 1BQQT 2JJQA 2KBNA 3CPFA 3BVGA 4CDEC 3JAMi 2L55A 1Z6HA 2UU9L 4WORA 2R92H 3Q0AA 1BR9A 2K52A 1R9TH 3OIQA 1XYIA 4QY7A 1DYQA 3J7YW 1IL8A 1TY2A 1N33Q 4OWXB 1PFSA 1MJCA 3CKIB 1WTPA 1ET6A 1IL2A 1A62A 1TWCH 2B2TC 1JORA 1VQKA 4HJ7A 2A6ED 4KN4C 5L37A 1WTWA 4NDXA 1AW7A 4IPGA 2GVBA 2A5HA 4RHSA 3CU7A 4HN7A 2O4XA 1SMYD 5M5YB 4H02A 2L15A 5BR8Q 1CA5A 1IXRA 4DV1L 1H9SA 4OONA 3VR5A 4Y52H 2SNSA 2N49A 4MNOA 4JOIA 4OWWB 1PTOB 4BY7H 5H1SE 4X3UA 4O42A 2F4VL 5ELNA 1XXGA 2QGQA 2J4XA 3MXGA 5GROA 1H9SB 1VQNA 3S14H 4FO2A 4JI8Q 1EYGA 3K7AB 1M1KC 5IT9E 3HOUG 3RN5A 1OXUA 1Q12A 3EQLC 2JSOA 3X3MA 4HIDA 4OO1H 5IYCH 5C4XB 2N8NA 3TSSA 1OXXK 4DAMA 1MBYA 2AQ1B 4LF8Q 1F2LA 1WI5A 1EY8A 5F2DA 4ZAIA 5IYDH 1TS2A 3E9IA 1ESRA 4ME3A 4H13C 2XRSD 1IKMA 4CDDC 1LTBD 2EYPA 2SEBD 3FRPB 4F8MA 4DR4Q 4QUCA 4IJLA 1CKMA 4ZUIA 3UI2A 3CCRA 4HJ9A 4LF4Q 3A8IE 1GXDC 3RNUA 3GTPH 2QEJC 4A3IH 1ET9A 2E8GA 2PMZE 3DEPA 5COYA 2PNRC 4RKBA 3I4MH 3HOVB 2RA4A 2EYFA 4BY1B 4R4QA 1EFID 4GNXA 2AQ2B 3P7JA 4DU9A 3KF8A 2G5DA 1P16A 1GUNA 4A3EG 3M7GA 3TBIB 4IPHA 4B3TL 2CCZA 2UUBL 4DV5Q 2C5CA 2YTYA 4YCWA 2F4IA 1PRTF 1PH1A 5LMNL 2Z6BA 3LX0A 4Y7NH 1YBYA 2F0IA 4LF5L 4X62Q 1CHQD 4L5TA 4GNXB 4GKKL 3KF8B 2DN8A 2WB1G 1B9MA 3HP3A 3SXHA 2L0CA 3OTOL 3K57A 2RDGA 3K0YA 5CV5A 4YY3Q 5HY6A 1XTDA 4WJ4A 3FKIG 4P75A 1FGUA 4RGOS 1G6ZA 1SR3A 1M4VA 1PH9A 5J1ZA 1GUOA 2Q2HA 4A3DH 1W6KA 2XNAC 5JPNC 2ZTEA 4JI4Q 4NW2A 2F52A 3WWVA 4OEMB 3M7NA 1JWUD 4RWSC 1FVIA 3HOWG 2EYLA 2AKWB 3HRZC 1U4LA 1JR0D 4JI1Q 1I6HH 4A93B 1JOQA 3B6YA 2AWOA 1Q1BA 3MZ5A 4MTKA 2R93H 4IFDG 4X66Q 4G57A 2F0WA 3VA7A 2B2TA 3NE5B 1RODA 2VQFL 4IURA 1O7IA 2A1AA 2JQOA 4IO9A 3GP7A 4HJAA 3QIAA 4DNTB 1VQGA 5DEHA 1Q86C 2PZTA 1AZPA 2XWJB 1E0BA 1PFBA 3QR8A 5KGUA 4C3HB 2ICIA 1TWAB 4OL7A 3D4WA 5IOCA 5LMNW 5TSSA 1DXMA 4ZKBB 2M9VA 3S1RB 1HJPA 5IY0A 5C0XI 5J39A 4L5QA 3LWUA 2B2WA 2UUAQ 4A3FG 3J80i 1Q3LA 4XIGS 3S2DH 1O7LA 3S16B 3VYUA 2JA5B 3OOCA 1G8ZD 3HOXB 5EKLA 4K14A 1DM0B 4DV6L 2E75C 1VQ4A 1PFNA 3CC2A 2EE1A 2TMPA 3S15H 1IZ6A 1WTRA 4YCVA 3IFDA 4O0AA 3JAME 3I56A 1CSPA 5IGEA 2B2VC 4J15A 4A3MG 1G2SA 4UPAA 4LF6Q 4ALPA 4R8NA 3GTOB 1LYLA 1TWHH 1N32L 2UU9Q 2PI2A 3MXNA 2QW7A 3PIOA 1XNRL 3SK4A 4MZ9A 1OXSC 2KQ3A 5ELCA 1LACA 4EQOA 1EZ8A 2NWGA 3HOUH 4TRDA 1VQMA 4RA8A 1KAWA 4LF9Q 3M4YA 2D0OA 5J3BA 1AZQA 3PIO3 4XT1B 4DNIA 2B3GA 3MXNB 4L8JA 1ASYA 5KEEA 4JBWA 5A35A 3RZOH 4G7ZC 3TZDA 4B9WA 3PO2B 5CC4A 2KJXA 4A3JG 1S5FD 1Y1VB 3NTHA 3L3OC 3A5ZB 3V2TA 1F77A 2VW9A 2ZM6L 2OXPA 1E1TA 4L5SA 2LFNA 4KTAA 2R7FA 1HNXL 4POFA 1RF2D 4NXMQ 2IWHA 4ZK9B 5ELOA 2JE6I 3HOZB 1BVSA 4ZUJA 1SXTA 4DV1Q 1BF4A 5IT9c 2UXDL 1B4OA 1Z47A 3UDGA 1X6OA 4KN7C 1GUWA 2A69C 2I07B 3TQYA 4DXFA 1G291 3UE1A 4QGUA 4A3EH 3S17B 2ZTCA 3Q23A 4JI6L 1M8AA 1FD7D 1EY0A 5LMUL 2B63G 2EIFA 1KDCA 1STBA 2E74C 1BXTA 2MGSA 1TR5A 2AHOB 2BOSA 4K5WA 4C3IG 1ONLA 1A2TA 5C6AA 1UE5A 1JWSD 5LHY1 3FKIH 4U673 4QUFA 3F2UA 1NNXA 1A6XA 1HR0Q 3AMUA 3PUWA 1DGSA 1GD7A 2M00A 5JEAG 2OTJA 4LFCQ 1PZKD 2KHSA 2NVYB 1QZHA 4JI2L 2JA6B 4KHPQ 2XSCA 5EBDA 4RCOA 1EUJA 4A3KG 4KV6A 1EOVA 4LFAL 2N88A 2E2HH 2V1CC 2Q2UA 2EY2A 4X64Q 3HOWH 2D62A 1EEFD 3I4OA 1L1OA 1A0IA 4HCSA 1O78A 5IGFA 2LKVA 2VQEL 3GTKH 4RG1A 5AFWA 1Y1WB 3T1YQ 2MNAA 5CV9A 5A2QE 2MJ8A 4IFDH 1L1OB 1K3BC 4UAIA 4C2MB 1WVLA 4IPCA 4LJZC 2Q8TA 1BCPC 1LTLA 1CK1A 4LF5Q 3GTLH 4DAVA 4HMJA 1JE5A 1AH9A 4AQYL 3H3VC 2KOLA 3CRLC 4C1NI 1QVCA 3F2BA 1BBWA 4AYBE 4BWGB 1FJGL 2DNCA 4XQNA 3NELA 2G9HD 2DJGC 4M1UB 5ELBA 2B2VA 5C3XA 1SYFA 5C4JB 4X3KA 1YNND 3U9OA 1TWGB 4A3FH 4P2CB 4ME5A 5IGDA 2WAQE 4PV1C 1BOSA 1YI2A 2NZHA 4RGNA 2EYMA 1ZXTA 1PH2A 3FMCA 2Z0SA 3GTQH 4FXKC 3TEHB 3WOEA 1K73C 3L2PA 2CWAA 1N33L 1EQVA 2Q2IA 3O13A 1KD1C 4MN3A 3KOJA 4DV3Q 4A3MH 1STAA 4KJOA 1I50H 2NYZD 3M4QA 5M3MG 4R8IA 3SR1A 1NY4A 1K0SA 3MTSA 5HGQA 1VQIA 3IRBA 2FFKB 3MXPA 3ERSX 1RIPA 2K7VA 2L1BA 4A3GG 2E2JB 5BR8L 5ISRA 3J80E 1UE1A 2A73B 5G3LF 3PO3G 4M8AA 1ILPA 3D0FA 2IX0A 1F9PA 1YHBA 3JAMc 3VR3A 4A3JH 2PYKA 1XPRA 1HNZQ 1W3SA 2K5NA 5IGBA 4JI8L 2XN9C 1J6QA 4DAYA 3AQQA 1CT1D 5I9OA 4MTNA 3JC66 1SE4A 2KHJA 1EY6A 3NWTA 3A55A 1BDOA 1EY5A 3VYTA 4DAYB 2HUGA 1Q1EA 4R4OA 1DCZA 5I2XA 4QIWE 1HZAA 5CV7A 4DR4L 2DY7A 4LF4L 3UDIA 3GTJH 2LMCB 4V190 3OPOA 3S1MB 1XNRQ 1PYWD 5KIXA 3NEMA 2TSSA 1RD9D 3J7A5 3M4PA 2F3WA 3TP7A 1U4MA 3NSWA 5ELEA 1FNUA 2CH4A 3RLFA 4GN4B 4LK1C 4C3IH 1PZID 4JI5Q 4J6HA 5KYIA 2F3IA 2QDBA 4DV7L 1ASZA 1IW7C 1PRTC 2K50A 2UXBQ 1TS3A 3BVMA 1Q8KA 3CQZH 1SFOH 3C1FA 4DV5L 5C3EB 3K58A 5CYUA 1WTVA 3RR5A 5JEAH 2ZM6Q 1L0YB 2I0QA 3GTMB 3SDZA 2NB0A 4BBSB 1PTOC 1ENAA 4K6LA 2Y0SE 3PQIA 4A3KH 2FHTA 3M3YH 3K80C 5IYCG 1XMOQ 3UDXA 1J5EQ 4KKUA 1RTOA 3DHQA 1PH7A 1EL0A 1CHPD 2K14A 4IFDJ 2EOTA 2R61A 3QO2A 4JOIC 5JJZA 2VB2X 2CQAA 4OX9Q 1HA5A 2R7ZH 4HEDA 1HNWQ 1A3UA 3NHHA 3D6CA 1B2TA 4JI4L 4Q5VA 4CJ1B 5JOBA 4PMWA 3S1QB 3SK8A 3K81C 4XYOA 4QL5A 1PA6A 2NVQB 3D3RA 3I4MG 5KRUA 5M5XH 1B53A 3EBEA 4HSPA 2IX3A 3G4SA 2PZWA 4JI1L 1LT5D 5GAHC 3GO5A 2K1BA 5M3FB 1P8LA 4I7ZC 4A75A 5CV4A 4X66L 3CMAA 1OO9B 1K83B 4HJ8A 4IUNA 1I3QB 1V9PA 3CRKC 5E4WC 2DY8A 1FL0A 1KNEA 1NMFA 2VZAA 3I4NG 2EYOA 3TS2A 2NVXB 1R4PB 4GKJQ 2JA7B 4HCEA 1B8AA 3K0XA 2VQEQ 4NMZA 1LV9A 3PF4A 4GNXC 1H95A 3S1NH 3E0JA 1SNPA 4A4IA 3CXCA 1AE3A 4DGZA 4BA1I 2NTTA 1XPUA 3F8TA 1KIXA 5M3MH 3TREA 1PHJA 2HHHQ 1GKHA 4JBKA 2EDGA 3DLLA 2L11A 2PZUA 2RHQB 2WAQG 4A3GH 2K01A 4KK7A 3MXUA 4BXXG 1V1OA 4OO1I 2F0QA 3NQIA 4LF6L 1TS4A 5T1GA 1I4QA 1M90C 3BS1A 1W2BA 3I72A 1LTGD 2ASBA 1H9RA 3CCSA 3KBXA 4DFAA 3E6ZX 2D5DA 4K0KL 2R92B 2WV6D 2JEAI 3KK7A 4P73A 4LF9L 1PYSB 2RF4A 4P72A 1V8QA 1MSGA 2J0TD 3CCUA 4C3JG 3OW2A 1FYCA 2Z1CA 2IPKD 3H0GB 1SMXA 3HOYB 3BYYB 3AU7A 3J80c 1SJED 4OIKA 1NCVA 1BCPD 1TWCB 3DM3A 2BDOA 4PNYA 3ZJYC 2X69A 4DK6C 2BH8A 3ZYYX 5M5WH 2ZXPA 4YWLA 3PUYA 1SDFA 1PRTB 5D3IB 2FJ2A 3BYTB 4NXML 3VR2A 3CHBD 1U0LA 1RTNA 1CFMA 1B7YB 3NBIA 1VQ5A 2CKZB 2O5IC 4LUVA 4POGA 1KNAA 1U9RA 5JEAJ 4A3BG 1LO5D 1MGSA 2B2WC 1UAPA 2MHVA 4GLAC 3R93A 3UE0A 3D31A 3CCEA 4BY7B 2HIXA 2JK8A 2PCFB 2KCNA 2QEXA 1K28A 2XVSA 1LT3D 1EY4A 5GAEC 1JC7A 5I6WA 4KY5A 2K28A 1KTKA 4LAAA 3FP9A 4IUUA 3V96A 4H0LC 1HR0L 3K7AH 1F2YA 3MC0B 1W6JA 3DMUA 4LFCL 5E4XA 4KHPL 1VQJA 1WOCA 4BBRB 1WCMG 5KNBA 4GOPA 3TP5A 3GTPB 4ZQ3A 1X56A 4A3IB 1GO3E 4X64L 2B39A 3IFTA 1N9WA 4K2KA 4DV7Q 1ZYRC 2F3VA 3AFPA 3W1BA 4GOPB 4N9TA 2Y0SG 3T1YL 1VQEA 1VQLA 1RL2A 1SNOA 1Y69U 4KJNA 4N9PA 1TT2A 3I90A 1QCBD 3W2DA 5JVG3 1SEBD 2GN5A 4XT3B 3T16A 3V05A 2F0NA 3M4OH 3I4NH 3MAQA 5J22A 1H9MA 2OEOA 2NBFA 5C4ZA 1QNUA 2EXZA 1MIUA 5EQ0A 2WFWA 1AE2A 5K36H 5D65A 2K75A 4XXEA 4IOAA 5DM73 3T53B 1SN8A 4A3LG 1VMPA 5IIFA 1PH4A 3PUXA 1PH6A 4A3DB 1I4HA 1VCIA 2EJFC 1HR0W 4HSVA 2F0SA 4AYBB 1SE3A 2SDFA 1AN8A 3I8ZA 3CW2C 1YNXA 3HGBA 3OMCA 1IW7D 1I5FA 4OGQC 3H6MA 2H5XA 4TVAB 5CV6A 2ES2A 4BXXH 1I6HB 4DV3L 3I7FA 4OXPA 3BDCA 3FDTA 4NXNQ 1HCZA 2F0HA 2Z9HA 2R93B 2YTXA 3H94A 4DXGA 4DR3Q 1SE8A 3ULJA 1MKHA 1I4GA 1HPCA 1PTOD 4ID6A 5M9OA 2Z4HA 1HQMC 1Y14B 4G7OC 1L1OC 3K8AA 3K5MA 3KFUA 5FO9B 2RSOA 1WD0A 1EZ6A 1N8RC 2D0PA 4C3JH 1KQSA 2PQAA 4EQNA 3DEOA 5AJ3L 2LSSA 3CCLA 1CSQA 4ODGA 2NN6H 1Q90A 4C3HH 5JPMC 1HZCA 1PH3A 4LWCA 1VQAA 1HNZL 5I9PA 3J81L 2PQAB 3S2DB 3S1RH 1GVPA 3RUZA 5C4HA 5BN5A 3LNNA 2ZJPA 1I4RA 2E2DC 1B50A 1HH2P 1TQOA 5LL6S 1N36Q 2LXJA 5JAVA 1F2MA 1S40A 2HCIA 3PIP3 4LFBQ 1G51A 3S15B 1VQPA 1VQCA 4A3BH 4CKCA 4K5XA 1STHA 1LTID 4ILWA 1ILQA 2HT1A 1PFMA 1YJ9A 1TWHB 2K4KA 1VF7A 5FK9C 3TZUA 4DK1A 4K0KQ 3I55A 1HA6A 3MFGA 1TVXA 3BDOA 3HOUB 4JYAQ 3GTOH 4JI5L 3ICEA 4X65Q 4F87A 5JJKA 1XX8A 4L5RC 2K5HA 1BKBA 4DUZL 1SNDA 4IJHA 2UXBL 1UUPA 4K2LA 4BS9A 1Q81C 1YNJC 1WD1A 1JJGA 2K05A 4QB4A 1CUKA 3HKZG 5IWAQ 3RZOB 1KLGD 2WP8J 2VUMG 2EQSA 3NXWA 3S24A 4IFDI 1WCMH 5NUCA 5HURA 1J5EL 3GQBA 1XMOL 3A0JA 4QJFA 1E7ZA 1VQ6A 2A68C 4IALA 3EVQA 1X3GA 3K5LA 2HDLA 4MHEA 2WINB 1UEBA 3QB3A 4OX9L 4GLXA 3Q22A 4DUYL 2N3SA 1HNWL 3VR6A 1I4PA 4KLKA 1WTOA 3T51B 5EAYA 1K8MA 1SNMA 2F0PA 4A3EB 3FVQA 2D9UA 4R4IA 2H4OA 4I65A 3L7ZC 1YHAA 2F0GA 3S17H 2WB1B 1V43A 3KBGA 2KEDA 1EOTA 3VR4A 3FKIB 1KC8C 4A3LH 1DOMA 4RMFA 1EIHA 2WIIB 1C8CA 4QQBX 1ZEQX 3TDQA 1LTRD 3MHBA 5DAUA 4PMBA 1STYA 4GKJL 4Z9CB 4RGTA 4LNQA 4G4KA 3HOWB 4OO1G 4EVOA 4H44C 2R7ZG 3NTKA 3RZDB 1AP0A 1NBWA 1LT4D 3WDNA 3WOFA 5IP9H 2E2IH 1NSNS 4CDCC 1CQVA 1LABA 4I7AA 3FHWA 4U68A 1T9HA 2HHHL 1IKLA 1A2UA 4N8X1 1GM5A 2B2YC 2CH4W 4DV0Q 5CORA 2B2UC 1PH5A 1TY0A 3W5OA 1ICWA 3GTGH 2MO1A 4DR7Q 2SOBA 3A8JE 2MPMA 1VDZA 4G7HC 2BE5C 1CA6A 4CBVA 3EA6A 1B3QA 3KLSX 4HIMA 4A3FB 4UHVA 1IBML 1SMYC 1SYBA 1A63A 2OCEA 2R3ZA 4GLVB 5C4JH 2KCTA 1ZYRD 3GTQB 4FF3A 1CM9A 1CKOA 1KHIA 3N6RA 3CF5A 5IYBG 3CCMA 4JV5Q 4IUPA 1VQ7A 4JG2A 4XTCS 1QVFA 4A76A 2E5LQ 1AFPA 2XTIA 1II3A 4A3MB 1NR2A 4DR5L 1I50B 5FLMG 1HFNA 3HG9A 2F0FA 3SE0A 4JPBW 4L6TB 2PNHA 1QZGA 5C44H 1EY9A 3J81i 5E1FA 5ELDA 2XWBB 3P75A 4OHJA 1TWFB 1VQBA 5KNCA 4IPDA 2F0VA 1EIGA 2JA8G 5I6YA 5AJ3Q 3CAMA 1JOOA 3CPWA 4KHZA 1DOKA 3U50C 2O5JC 4KHVA 3R8BA 2E2JH 2HDMA 2VUMH 1LM0A 5KYLA 4A3JB 3CD6A 3KF6A 3E9HA 4CHTB 1I94Q 3IL8A 3C46A 4C56C 1HZ9A 3J7AV 2MQHA 3KF6B 2RQXA 1MJEA 4RHRA 3Q24A 3OHXC 3CCVA 1X9NA 1I4XA 4B3ML 2N55A 3OSOA 2CW0C 3HZXA 1PYBA 2F0KA 3PMFA 3GV6A 2R6GA 4YIJA 1YZ6A 1FNWA 1DJRD 4MIUA 4JC0A 2KA7A 2OWOA 1HTPA 4WJ3M 2B63B 4N8FA 1EWIA 2IL8A 4YWKA 4TQUS 2A8VA 4C3IB 5K5PA 4DUZQ 3K59A 3LGJA 5EKIA
chains in the Genus database with same CATH topology
1JB3A 1MSHA 2KVMA 2PMZB 3SK5A 4WFN3 3T56B 1R4QB 2PO4A 1SFOB 5C3WA 2A6HC 3NWSA 2EJGC 2F0TA 1U4RA 3QOLA 1J9OA 1SNCA 4A3KB 3M3YB 1L0XB 3MVVA 1Z7TA 2B2YA 4CJ0B 1STGA 1SYDA 2RSNA 2JXMB 5BN4A 4FF2A 1G2TA 1GJXA 2B2UA 3EJIA 3I4LA 4FP5D 5FLXL 4KY7A 1PXUA 2WACA 3A8KE 3NK9A 4R9WA 3R2IA 2WKDA 1QE6A 1S4ZA 2AUKA 3K5NA 2CHBD 4X3TA 5M5XB 1JE4A 1GUGA 2L5TA 1E2ZA 5BN3A 1T5XD 1YNJD 1FR3A 3I73A 4DF7A 3K5OA 3S2HB 3GD7A 1EYDA 1GUSA 5HGTA 4UDUC 1F9SA 4F7XA 2X6LA 3C2PA 2NVTB 1CZGA 4IUQA 3AB9A 2LS01 3A7AB 2XIWA 4KKTA 2A68D 5K36G 1EU3A 5EPJA 4ULLA 2A69D 1D2BA 5EJWA 4J8QA 1STNA 5EPLA 3EROA 1BBXC 2NTSA 1ESFA 3KLRA 3QG1A 5M3MB 4IUTA 1KDAA 2IJ0A 1FNVA 4RAUC 3OW7A 2K03A 3IKJA 4A3GB 3DWQA 3ITPA 4K5VA 1SNQA 4FXDA 5I4DA 5FO8B 2H1EA 2L12A 2F0EA 3PO3B 1LTAD 5KNDA 1BCPF 2F0DA 3I3CA 5C5LA 4HR7B 3D4RA 5IGGA 5FKAC 4RFBA 5JVH3 1J8IA 5DNFA 1R9TB 1SYEA 2NN6G 2K04A 4O1NA 3DXJC 2LY7A 4C3HG 3PUVA 1JOKA 2MP1A 1SYCA 2G9DA 3G7LA 1EYCA 3J81E 3P20A 1D1IA 2A74C 3LWEA 1DD2A 4DK0A 5M5WB 1PLFA 2ENBA 2K5QA 1RDPD 4XYQA 2EYJA 4IZ8A 1LTSD 1H9KA 2KEEA 1QNKA 2BE5D 4K6DA 2EPBA 1GHJA 4RCNA 2K32A 2QCPX 3MFYA 3S14B 1B9NA 4HTHA 1PTOH 3BZDB 3I91A 3DM1A 4CGYB 2E76C 4TKOB 3TN2A 2VXWA 1NR4A 4ZLTF 3K6OA 3TP6A 4KY6A 2FMMA 3BVZA 3I4MB 4ZKCB 3A7LA 5IGCA 4NKLA 5IODA 2RKSA 1YNNC 3SK6A 2QKIC 3FEWX 2OF1A 4XDXA 5C0XG 1WTQA 2K33A 2NN6I 1C4QA 2SNMA 4Y7NB 2F0LA 1B1ZA 1DZ1A 1HXYD 1NUCA 3M4OB 2CVRA 1EWHA 2RDHA 3I4NB 4IUVA 3RD4A 2KECA 3C1EA 1GUTA 5I2YA 2CW0D 4XQJA 4QF4A 1B44D 4B08A 1TU2B 4FNFA 1S5ED 2HQEA 3A56A 1PTOF 3IAYA 2FMCA 4LMQD 4V0BA 2QF7A 2GA4B 3QWNA 4FVMA 1GOZA 3OWEB 1PRTD 4DN4M 4FYDA 1H9JA 2EY5A 2M2LA 2WAQB 3ND8A 1DOLA 2A6HD 2V4DA 2YYZA 1SE2A 4E6IA 2OT2A 1SSOA 3R2TA 1DONA 5D3DA 1X3QA 3TP8A 3PUZA 4C3JB 3PV0A 3D6WA 4BA2I 4CKBA 4KD3A 3BG3A 3DWPA 2MUYA 1QB5D 1KDBA 3MA2B 2D2CC 4KKSA 2F1MA 1K8OA 4QCLA 1PMRA 4WRDA 5EBCA 2ID0A 3VYRA 1QOHA 2RBMA 4WJWA 4A3BB 2WKCA 2JEBI 2I46A 1Q8IA 3T13A 1FGBD 1HRJA 4QIWB 3C3LA 2J7ZA 4FF4A 2NUCA 5E3FA 2BA1A 4ABNA 1AEXA 5FOBB 3D4DA 1LTTD 1BUVT 5IT9L 4DAPA 4NP5A 4FF1A 3FPPA 4ZYSA 1UNSA 4XQQA 2AQ3B 1WCMB 2L4NA 3ERQA 4L63B 1D5ZC 2NZ1D 5CMDA 3KUPA 1RKNA 3N52A 2Y0SB 4KI0A 1T5EA 1D5MC 4HAEA 2Q8RE 2AWNA 5C0XH 3SEBA 1QWYA 3NBHA 2F0OA 1F2ZA 2EY1A 1B3AA 1EY7A 1STEA 4PMCA 1S5BD 4S3SA 3L9AX 1C48A 4DA2A 1EU4A 3S9WA 3BDLA 4IQZA 1SAPA 3RMHA 1A3VA 3NUCA 2PW7A 4EQPA 2E2HB 1HQRD 1E2WA 3G6JB 5FLXE 3GTKB 1QILA 1EQTA 4PQXA 1D5XC 2X6GA 4QMGA 2JYOA 4GZYC 2E2IB 1KLUD 5DM63 1S5CD 1JQYD 1A3TA 1X32A 2KCCA 3W3AA 5CBAE 3SHLA 4X3SA 5EKKA 3GTLB 2KUMA 4IN3A 1ML0D 5EGTA 3M85A 3DWAA 1D6EC 1TIID 3KLSA 2A6EC 4RGMA 4Q0FA 1X3PA 5EPKA 3GTGB 2PPBC 5CV8A 4RH6A 3OMGA 2IW3A 1IYUA 1CI3M 1KABA 2ZT9C 2DNEA 3MEHA 2IX1A 1OXVA 3DUZA 5D14A 3NQTA 3TMEA 1OXTA 1RHPA 1PDQA 2RVLA 1SJHD 1VF5C 3T4AC 1V1PA 3Q6SA 3NP8A 4JK1C 1E2VA 1CQFA 3A54A 1O7YA 1O7ZA 3JAML 1V1PB 3OWFA 2FINB 5C44B 1SYGA 1G91A 1F9RA 1CZWA 1RJTA 5CGKA 3H09A 1S5DD 4K8JA 5LL6X 5ELFA 1JWMD 2ZXOA 3OIPA 3J7AF 4KMUC 1IHZA 3HKZB 1HUNA 2F0JA 2VUMB 1TS5A 3GV3A 5C5MA 3D8GA 5CR3A 3VA5A 1NAPA 1XTCD 1RCVD 1F9QA 3H91A 4DNRB 4KD4A 3X3NA 5C0XJ 1I6VC 2PW5A 4OIJA 2EJMA 1WTXA 2Z8LA 1SBBB 3GTJB 2HCCA 1ENCA 3ND9A 3P1HA 2ZXRA 5G3LD 4ZRZA 2K6AA 3HS0C 2AUJD 1HHVA 3SVMA 1A15A 1VMCA 1XWEA 2B8FA 4J1MA 3HEJA 1LT6D 3CQZB 2XRQD 3FPUB 2BCOA 1U4PA 1LLRD 1EEID 3EFXD 3URYA 2IT1A 1HUMA 2QILA 3NTIA 4C1NK 3VYSA 5T1IA 2Z4IA 1Y8OB 3MWYW 2EY6A 2R7ZB 2C9OA 3R3OA 2EVBA 1D1KA 1ENFA 4FXGC 4OO1G 1HTLD 1QG7A 4CJ2C 1Y8PB 2F0UA 1ZKOA 2JP1A 2F03A 5CBEE 2BA0A 2O2LD 1BCPB 4TSSA 1EWCA 1IYVA 5A2QL 1Y8NB 4HMIA 3I70A 1MI2A 2EYHA 1JICA 4F88A 3QOJA 2ICEC 2B8GA 4RKLA 1JCKB 2K5WA 4H7BA 3QJYA 2PQEA 1EYAA 2Q8IB 1CTMA 4EGVA 3U9SA 2VNUD 1GHKA 1HFGA 3S1NB 2EZVA 1UEAB 1PZJD 1QJOA 5FO7B 2F0MA 4B9XA 2YU9B 3NPPA 2K5DA 2VB3X 2BDNA 2JA8B 4CKEA 2RDFA 1BNZA 1MD2D 3E5SA 1BO0A 2L9HA 3J80L 3ONAB 1TKWB 1KAAA 4K8IA 1O80A 1BQQT 3BVGA 2L55A 1Z6HA 4WORA 3Q0AA 1BR9A 3OIQA 1XYIA 1DYQA 3J7YW 1IL8A 1TY2A 3CKIB 1WTPA 1ET6A 2B2TC 1JORA 2A6ED 4KN4C 1WTWA 4NDXA 1AW7A 2A5HA 4RHSA 3CU7A 4HN7A 2O4XA 1SMYD 5M5YB 1CA5A 1H9SA 3VR5A 2SNSA 1PTOB 4X3UA 4O42A 1XXGA 2J4XA 3MXGA 1H9SB 4FO2A 3K7AB 5IT9E 1OXUA 1Q12A 3EQLC 2JSOA 3X3MA 4OO1H 5C4XB 3TSSA 1OXXK 1MBYA 2AQ1B 1F2LA 5F2DA 1EY8A 4ZAIA 1TS2A 1ESRA 4H13C 2XRSD 1IKMA 1LTBD 2EYPA 2SEBD 3FRPB 4F8MA 4QUCA 4ZUIA 3UI2A 3A8IE 1GXDC 2QEJC 1ET9A 5COYA 3DEPA 2PNRC 4RKBA 3HOVB 2RA4A 2EYFA 4BY1B 1EFID 2AQ2B 3P7JA 4DU9A 3KF8A 1GUNA 3M7GA 3TBIB 2C5CA 2F4IA 1PRTF 3LX0A 2F0IA 1CHQD 2DN8A 1B9MA 3HP3A 3SXHA 2L0CA 3K57A 2RDGA 3K0YA 5CV5A 4RGOS 1G6ZA 1M4VA 5J1ZA 1GUOA 1W6KA 2XNAC 5JPNC 4NW2A 3M7NA 1JWUD 4RWSC 2EYLA 3HRZC 1U4LA 1JR0D 4A93B 1JOQA 2AWOA 1Q1BA 3MZ5A 4IFDG 4G57A 2F0WA 3VA7A 2B2TA 3NE5B 1RODA 4IURA 3GP7A 3QIAA 4DNTB 5DEHA 2PZTA 1AZPA 2XWJB 1E0BA 1PFBA 5KGUA 4C3HB 2ICIA 1TWAB 4OL7A 3D4WA 5IOCA 5TSSA 1DXMA 4ZKBB 2M9VA 3S1RB 5C0XI 5J39A 3LWUA 2B2WA 1Q3LA 4XIGS 1O7LA 3S16B 3VYUA 2JA5B 3OOCA 1G8ZD 3HOXB 5EKLA 4K14A 1DM0B 2E75C 1PFNA 2EE1A 2TMPA 1WTRA 3IFDA 3JAME 5IGEA 2B2VC 1G2SA 4R8NA 3GTOB 3MXNA 3SK4A 1OXSC 2KQ3A 5ELCA 4EQOA 1LACA 1EZ8A 2NWGA 4TRDA 4RA8A 3M4YA 1AZQA 3PIO3 4XT1B 4L8JA 5KEEA 4JBWA 5A35A 4G7ZC 3TZDA 4B9WA 3PO2B 5CC4A 2KJXA 1S5FD 1Y1VB 3NTHA 3L3OC 3V2TA 1F77A 2OXPA 2LFNA 4KTAA 1RF2D 2IWHA 4ZK9B 2JE6I 3HOZB 4ZUJA 1SXTA 1BF4A 1B4OA 1Z47A 4KN7C 1GUWA 2A69C 2I07B 4DXFA 1G291 3S17B 3Q23A 1M8AA 1FD7D 1EY0A 1KDCA 1STBA 2E74C 1BXTA 2MGSA 1TR5A 2BOSA 4K5WA 4C3IG 1ONLA 1A2TA 5C6AA 1JWSD 5LHY1 4U673 4QUFA 3F2UA 1A6XA 3AMUA 3PUWA 2M00A 5JEAG 1PZKD 2KHSA 2NVYB 2JA6B 2XSCA 5EBDA 4RCOA 4KV6A 2N88A 2EY2A 2D62A 1EEFD 4HCSA 5IGFA 1O78A 2LKVA 5AFWA 1Y1WB 5CV9A 5A2QE 2MJ8A 4IFDH 4UAIA 4C2MB 1WVLA 4LJZC 2Q8TA 1BCPC 1CK1A 4DAVA 4HMJA 3H3VC 2KOLA 3CRLC 4C1NI 4BWGB 2DNCA 4XQNA 2G9HD 4M1UB 5ELBA 2B2VA 5C3XA 1SYFA 5C4JB 4X3KA 1YNND 3U9OA 1TWGB 4P2CB 4ME5A 5IGDA 4PV1C 1BOSA 4RGNA 2EYMA 1ZXTA 3FMCA 4FXKC 3WOEA 1EQVA 3O13A 4MN3A 1STAA 4KJOA 2NYZD 4R8IA 3SR1A 3MTSA 2FFKB 3MXPA 2K7VA 2L1BA 2E2JB 5ISRA 3J80E 2A73B 5G3LF 4M8AA 1ILPA 2IX0A 1F9PA 3VR3A 2PYKA 5IGBA 2XN9C 4DAYA 1CT1D 5I9OA 1SE4A 1EY6A 3NWTA 3A55A 1BDOA 1EY5A 3VYTA 2HUGA 1Q1EA 1DCZA 5I2XA 5CV7A 2DY7A 2LMCB 4V190 3OPOA 3S1MB 1PYWD 5KIXA 2TSSA 1RD9D 2F3WA 3TP7A 1U4MA 3NSWA 5ELEA 1FNUA 3RLFA 4LK1C 1PZID 4J6HA 5KYIA 2QDBA 1IW7C 1PRTC 1TS3A 3BVMA 3C1FA 5C3EB 3K58A 5CYUA 1WTVA 5JEAH 1L0YB 3GTMB 3SDZA 2NB0A 4BBSB 1PTOC 1ENAA 4K6LA 2FHTA 4KKUA 1RTOA 3DHQA 1EL0A 1CHPD 4IFDJ 2EOTA 2R61A 3QO2A 5JJZA 2VB2X 2CQAA 1HA5A 4HEDA 1A3UA 3NHHA 3D6CA 1B2TA 4Q5VA 4CJ1B 5JOBA 4PMWA 3S1QB 3SK8A 4XYOA 2NVQB 3D3RA 5KRUA 1B53A 4HSPA 2IX3A 2PZWA 1LT5D 3GO5A 2K1BA 5M3FB 4I7ZC 5CV4A 1OO9B 1K83B 4IUNA 1I3QB 3CRKC 5E4WC 2DY8A 1KNEA 2EYOA 2NVXB 1R4PB 2JA7B 4HCEA 4NMZA 1LV9A 3E0JA 1SNPA 4DGZA 4BA1I 2NTTA 2EDGA 2L11A 2PZUA 2K01A 4KK7A 3MXUA 1V1OA 4OO1I 2F0QA 3NQIA 1TS4A 5T1GA 1I4QA 3BS1A 3I72A 1LTGD 1H9RA 3KBXA 4DFAA 3E6ZX 2D5DA 2R92B 2WV6D 2JEAI 3KK7A 1V8QA 1MSGA 2J0TD 4C3JG 1FYCA 2Z1CA 2IPKD 3H0GB 3HOYB 3BYYB 3AU7A 1SJED 4OIKA 1NCVA 1BCPD 1TWCB 4PNYA 2BDOA 2X69A 3ZYYX 2ZXPA 3PUYA 1SDFA 1PRTB 5D3IB 2FJ2A 3BYTB 3VR2A 3CHBD 1RTNA 1CFMA 3NBIA 2O5IC 1KNAA 1U9RA 5JEAJ 1LO5D 1MGSA 2B2WC 1UAPA 2MHVA 3R93A 3D31A 4BY7B 2PCFB 2KCNA 2XVSA 1LT3D 1EY4A 1JC7A 5I6WA 4KY5A 2K28A 1KTKA 4LAAA 4IUUA 3V96A 4H0LC 1F2YA 3MC0B 1W6JA 3DMUA 5E4XA 4BBRB 5KNBA 3TP5A 3GTPB 4ZQ3A 4A3IB 2B39A 3IFTA 4K2KA 1ZYRC 2F3VA 4N9TA 1SNOA 1Y69U 4KJNA 4N9PA 1TT2A 3I90A 1QCBD 3W2DA 5JVG3 1SEBD 4XT3B 3T16A 3V05A 2F0NA 3MAQA 5J22A 1H9MA 2OEOA 2NBFA 5C4ZA 1QNUA 2EXZA 5EQ0A 5K36H 5D65A 4XXEA 5DM73 3T53B 1VMPA 5IIFA 3PUXA 4A3DB 1I4HA 1VCIA 2EJFC 4HSVA 4AYBB 2F0SA 1SE3A 2SDFA 1AN8A 3I8ZA 3HGBA 3OMCA 1IW7D 4OGQC 3H6MA 5CV6A 1I6HB 3BDCA 3FDTA 1HCZA 2F0HA 2R93B 3H94A 4DXGA 1I4GA 1HPCA 1PTOD 4ID6A 5M9OA 2Z4HA 1HQMC 4G7OC 3K5MA 5FO9B 2RSOA 1WD0A 1EZ6A 4EQNA 3DEOA 4ODGA 2NN6H 1Q90A 5JPMC 5I9PA 3J81L 3S2DB 3RUZA 5C4HA 5BN5A 3LNNA 1I4RA 2E2DC 1B50A 5LL6S 1TQOA 5JAVA 1F2MA 2HCIA 3PIP3 3S15B 4CKCA 4K5XA 1STHA 1LTID 4ILWA 1ILQA 1PFMA 1TWHB 1VF7A 5FK9C 3TZUA 4DK1A 1HA6A 3MFGA 1TVXA 3BDOA 3HOUB 4F87A 1XX8A 1SNDA 1UUPA 4K2LA 4BS9A 1YNJC 1WD1A 2K05A 4QB4A 3RZOB 1KLGD 2WP8J 3NXWA 4IFDI 5NUCA 5HURA 3GQBA 2A68C 4IALA 3EVQA 3K5LA 2HDLA 4MHEA 2WINB 3QB3A 3Q22A 3VR6A 1I4PA 1WTOA 3T51B 1K8MA 1SNMA 2F0PA 4A3EB 3FVQA 2D9UA 2H4OA 4I65A 3L7ZC 2F0GA 2WB1B 1V43A 3KBGA 2KEDA 1EOTA 3VR4A 3FKIB 1DOMA 1EIHA 2WIIB 1C8CA 1ZEQX 3TDQA 1LTRD 3MHBA 5DAUA 4PMBA 1STYA 4Z9CB 4RGTA 4G4KA 3HOWB 4EVOA 4H44C 3NTKA 3RZDB 1AP0A 1LT4D 3WDNA 3WOFA 1NSNS 1CQVA 1LABA 4U68A 1IKLA 1A2UA 2B2YC 5CORA 2B2UC 1TY0A 1ICWA 2SOBA 3A8JE 2MPMA 1VDZA 4G7HC 2BE5C 1CA6A 4CBVA 3EA6A 3KLSX 4A3FB 1SMYC 1SYBA 2R3ZA 1ZYRD 3GTQB 4FF3A 1CM9A 3N6RA 4IUPA 4XTCS 1AFPA 1II3A 4A3MB 1NR2A 1I50B 1HFNA 3HG9A 2F0FA 3SE0A 4L6TB 1EY9A 5E1FA 5ELDA 2XWBB 3P75A 4OHJA 1TWFB 5KNCA 2F0VA 1EIGA 5I6YA 1JOOA 4KHZA 1DOKA 2O5JC 4KHVA 3R8BA 2HDMA 5KYLA 4A3JB 4CHTB 3IL8A 3C46A 4C56C 3J7AV 2RQXA 4RHRA 3Q24A 3OHXC 1I4XA 2N55A 3OSOA 2CW0C 3HZXA 2F0KA 3PMFA 3GV6A 2R6GA 4YIJA 1FNWA 1DJRD 4MIUA 2KA7A 1HTPA 2B63B 2IL8A 4TQUS 4C3IB 5K5PA 3K59A 5EKIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STA A;  4G57 A;  2F0W A;  4KD4 A;  4K2L A;  3ITP A;  4KJO A;  2RKS A;  1A3U A;  3NHH A;  4K5V A;  1SNQ A;  4WRD A;  3SK6 A;  5KRU A;  2RBM A;  3SK5 A;  3D6C A;  5IIF A;  4QB4 A;  2F0E A;  1EY0 A;  2PW5 A;  4PNY A;  5JOB A;  3SR1 A;  4QMG A;  2OF1 A;  3SK8 A;  5C3W A;  3NXW A;  5DEH A;  1KDC A;  1STB A;  2PZT A;  3MXP A;  1TR5 A;  5NUC A;  5KGU A;  1ENC A;  1SYB A;  2F0S A;  2F0D A;  4OL7 A;  2SNM A;  2F0T A;  3D4W A;  3P1H A;  4K5W A;  3QOL A;  5C5L A;  1A2T A;  2F0L A;  3T13 A;  5C6A A;  5IOC A;  5ISR A;  5F2D A;  1A3T A;  1EY8 A;  1SNC A;  3MVV A;  2PZW A;  3OMC A;  2F0M A;  1NUC A;  5EKK A;  4IAL A;  3SHL A;  5IGG A;  3EVQ A;  3H6M A;  4B9X A;  2NUC A;  1STG A;  1SYD A;  1U9R A;  2EYP A;  5CV6 A;  5E3F A;  5EGT A;  5J39 A;  3QB3 A;  3C1E A;  4F8M A;  3EJI A;  1SYE A;  1AEX A;  4ZUI A;  3BDC A;  5CV4 A;  2M00 A;  2F0H A;  1II3 A;  4KY7 A;  2KHS A;  4IUN A;  2WAC A;  3D4D A;  1JOK A;  2PYK A;  4J1M A;  3HEJ A;  1SYC A;  4QF4 A;  5CV8 A;  4ID6 A;  1EYC A;  5IGB A;  1SNM A;  2F0P A;  5M9O A;  5I9O A;  4KV6 A;  2RDF A;  3OMG A;  4NP5 A;  2F0F A;  1EY4 A;  5EKL A;  1KAB A;  3NK9 A;  2HQE A;  4K14 A;  4RKB A;  2EY2 A;  3E5S A;  2EYO A;  5I6W A;  4I65 A;  4KY5 A;  2ENB A;  1EY6 A;  4LAA A;  1EY9 A;  2F0G A;  5IGF A;  1EZ6 A;  1EY5 A;  2LKV A;  5E1F A;  2EYJ A;  3MEH A;  3P75 A;  4IZ8 A;  4NMZ A;  2EYF A;  5IGE A;  3ERQ A;  1KAA A;  2F0V A;  4K8I A;  5CV9 A;  4DU9 A;  2EY5 A;  3NQT A;  3TME A;  4EQN A;  5I6Y A;  1F2Y A;  4R8N A;  5CV7 A;  1JOO A;  1SNP A;  4ODG A;  4DF7 A;  4K6D A;  1RKN A;  4DGZ A;  1EYD A;  3DMU A;  3LX0 A;  4WOR A;  4KHV A;  2EY6 A;  2F0I A;  3SK4 A;  5KIX A;  5I9P A;  2KQ3 A;  5HGT A;  2F3W A;  3TP7 A;  3R3O A;  4EQO A;  1EZ8 A;  3NP8 A;  5HUR A;  3MHB A;  4F7X A;  5DAU A;  4HMJ A;  4ZQ3 A;  3RUZ A;  3TP5 A;  5C4H A;  4TRD A;  3SXH A;  5KYL A;  4E6I A;  4HTH A;  2F0U A;  5CV5 A;  2PZU A;  4PMB A;  1STY A;  1TQO A;  2F0O A;  4J6H A;  5KYI A;  4K2K A;  2QDB A;  5JAV A;  1F2M A;  1F2Z A;  2F3V A;  3OWF A;  5KEE A;  4N9T A;  2EY1 A;  4EVO A;  2F0Q A;  1EY7 A;  5J1Z A;  4PMC A;  1SYG A;  3TP8 A;  1JOR A;  5C3X A;  1SNO A;  1SYF A;  4HMI A;  4S3S A;  4K5X A;  4B9W A;  4KJN A;  1STH A;  3C1F A;  4N9P A;  1TT2 A;  3U9O A;  5CC4 A;  3OSO A;  2EYH A;  1STN A;  3HZX A;  4ME5 A;  4NDX A;  3ERO A;  3V2T A;  5CGK A;  5IGD A;  4K8J A;  2OXP A;  1NSN S;  2F0K A;  3PMF A;  4KTA A;  3S9W A;  3QOJ A;  2EYM A;  4YIJ A;  4DFA A;  1ENA A;  3T16 A;  4RKL A;  1IHZ A;  2F0N A;  2O4X A;  2EYL A;  3BDL A;  4KD3 A;  4H7B A;  4MIU A;  1A2U A;  5J22 A;  3DHQ A;  4ZUJ A;  2OEO A;  3TP6 A;  1A3V A;  2F0J A;  3NUC A;  5C4Z A;  1KDA A;  2EXZ A;  2PW7 A;  2PQE A;  4KY6 A;  5C5M A;  1EYA A;  2SNS A;  1KDB A;  1EQV A;  4EQP A;  1JOQ A;  3D8G A;  5CR3 A;  3VA5 A;  3MZ5 A;  5IGC A;  5K5P A;  1SND A;  4NKL A;  5IOD A;  2SOB A; 
#chains in the Genus database with same CATH topology
 2ATW A;  4PZ7 A;  1JB3 A;  1MSH A;  2KVM A;  2PMZ B;  3SK5 A;  4WFN 3;  3T56 B;  3EIV A;  1R4Q B;  2PO4 A;  1SFO B;  5C3W A;  2A6H C;  3NWS A;  2EJG C;  2C35 B;  1S3O A;  1NTG A;  2MFI A;  2F0T A;  1U4R A;  3KDF A;  1J9O A;  3QOL A;  4A3C H;  1LUZ A;  1SNC A;  4A3K B;  4DPG A;  4LF7 L;  1L0X B;  3MVV A;  3M3Y B;  4EQ5 A;  1Z7T A;  3STB C;  2B2Y A;  4CJ0 B;  1U5K A;  1STG A;  1SYD A;  2RSN A;  2JXM B;  5BN4 A;  4FF2 A;  1G2T A;  1GJX A;  2B2U A;  3EJI A;  3I4L A;  3I2Z A;  1IBK L;  3KDF B;  4FP5 D;  4DUY Q;  5FLX L;  4KY7 A;  1PXU A;  5C4X G;  2WAC A;  4JBM A;  3A8K E;  3NK9 A;  4R9W A;  4ZCK A;  2Q2T A;  1YEZ A;  3R2I A;  2WKD A;  4DR2 L;  1QE6 A;  1C9O A;  1S4Z A;  2AUK A;  2I5L X;  3K5N A;  2CHB D;  4X3T A;  3H3V H;  5M5X B;  1JE4 A;  1GUG A;  2L5T A;  1WJJ A;  1E2Z A;  5BN3 A;  1T5X D;  1YNJ D;  1FR3 A;  3I73 A;  4DF7 A;  3K5O A;  2IHE A;  4NXN L;  2OTL A;  3GD7 A;  3S2H B;  1EYD A;  4OEL B;  4DR3 L;  1GUS A;  4GOP C;  5HGT A;  4UDU C;  3HOV G;  1F9S A;  4F7X A;  2X6L A;  3U4Z A;  4BY1 G;  3C2P A;  2NVT B;  1CZG A;  4IUQ A;  3AB9 A;  4DV4 Q;  2LS0 1;  3A7A B;  4DR6 L;  2XIW A;  4KKT A;  2A68 D;  3HKS A;  3VDY A;  5K36 G;  1EU3 A;  5EPJ A;  4ULL A;  3BZC A;  2A69 D;  1I3Q H;  5IYB H;  5GAD C;  1D2B A;  5EJW A;  4J8Q A;  3U58 A;  1STN A;  5EPL A;  3ERO A;  1BBX C;  2NTS A;  1ESF A;  3KLR A;  3QG1 A;  5FLM H;  5M3M B;  1QUQ A;  2NZO A;  4IUT A;  2UUC L;  1KDA A;  2YU9 H;  2VL6 A;  2IJ0 A;  2BH2 A;  1FNV A;  4RAU C;  1N36 L;  3OW7 A;  2K03 A;  3BZK A;  3IKJ A;  4LFB L;  4A3G B;  2JA8 H;  2OQ0 A;  1QUQ B;  3DWQ A;  2Z6K A;  3ITP A;  1K3R A;  4K5V A;  1SNQ A;  4FXD A;  5I4D A;  5FO8 B;  2H1E A;  2L12 A;  4UP8 A;  2F0E A;  3PO3 B;  3ER0 A;  1TXY A;  4A93 G;  1LTA D;  5KND A;  1BCP F;  3AYH B;  1IBM Q;  2F0D A;  3I3C A;  5C5L A;  4HR7 B;  3A74 A;  3D4R A;  5IGG A;  5FKA C;  4JYA L;  4RFB A;  3F1Z A;  5JVH 3;  4X65 L;  1J8I A;  5DNF A;  1R9T B;  3AEV A;  1SYE A;  2NN6 G;  2K04 A;  4O1N A;  3DXJ C;  2LY7 A;  4C3H G;  3PUV A;  4YHH L;  1JOK A;  2MP1 A;  1SYC A;  2G9D A;  3G7L A;  5IWA L;  1EYC A;  4DR5 Q;  1D7Q A;  4JW0 A;  3J81 E;  1S72 A;  3CP0 A;  3P20 A;  1D1I A;  2A74 C;  3LWE A;  1DD2 A;  4DK0 A;  2UXC L;  5M5W B;  1PLF A;  2ENB A;  3H0G H;  2K5Q A;  1RDP D;  4XYQ A;  2EYJ A;  4IZ8 A;  3HOY H;  3HKZ E;  1N34 Q;  1BBU A;  1LTS D;  1H9K A;  2KEE A;  2JA5 G;  2QDL A;  1QNK A;  3HOX G;  2BE5 D;  4K6D A;  1L2F A;  2EPB A;  1GHJ A;  4RCN A;  5M5Y H;  2K32 A;  5DLQ E;  2QCP X;  3MFY A;  5E7N A;  2A19 A;  3S14 B;  1B9N A;  4NPS A;  4HTH A;  4B3R L;  1PTO H;  1SRU A;  3BZD B;  1EQQ A;  3G48 A;  3I91 A;  1UE7 A;  3KJO A;  3DM1 A;  4CGY B;  2E76 C;  4TKO B;  4LW1 A;  1SLJ A;  3BJU A;  2VXW A;  3TN2 A;  1C7Y A;  1NR4 A;  1JMC A;  4B3M Q;  4JI3 Q;  3AFQ A;  2JN4 A;  4LUZ A;  2ZTD A;  5C4X H;  4ZLT F;  2QA4 A;  3EN2 A;  1X3F A;  3K6O A;  3TP6 A;  1X65 A;  1VQF A;  4KY6 A;  3PO2 G;  1Y1V G;  4JI0 L;  1G6P A;  2FMM A;  3BVZ A;  4HIK A;  1VQ9 A;  4ZKC B;  3I4M B;  3A7L A;  5IGC A;  4NKL A;  5IOD A;  4BBR H;  2HQL A;  1L0W A;  4CDF C;  2RKS A;  1YNN C;  3SK6 A;  2QKI C;  3HOZ G;  2HIV A;  3FEW X;  2OF1 A;  4UP9 A;  3ULL A;  4DKA C;  4XDX A;  5JJL A;  5C0X G;  3HOV H;  1WTQ A;  4YCU A;  2K33 A;  2NN6 I;  1C4Q A;  1E22 A;  2SNM A;  4BY1 H;  4Y7N B;  2F0L A;  1B1Z A;  4LF7 Q;  1DZ1 A;  3CCQ A;  1HXY D;  2RCN A;  1NUC A;  3M4O B;  4R1J A;  3PSI A;  2CVR A;  1EWH A;  2RDH A;  1X3E A;  4DV0 L;  3I4N B;  2IY5 B;  4IUV A;  3RD4 A;  2KEC A;  1NJI C;  3C1E A;  1GUT A;  1IBK Q;  5I2Y A;  4DR7 L;  5IP7 G;  2CW0 D;  4EX5 A;  4UP7 A;  4XQJ A;  1K0R A;  4QF4 A;  1B44 D;  4GS3 A;  2I5H A;  4B08 A;  4FDB A;  1TU2 B;  1VQH A;  4FNF A;  1S5E D;  2HQE A;  1PVO A;  3A56 A;  1PTO F;  3IAY A;  2FMC A;  4LMQ D;  4DR2 Q;  4V0B A;  2QF7 A;  2GA4 B;  2YTV A;  2YV5 A;  3QWN A;  4FVM A;  1GOZ A;  2FXQ A;  3E0E A;  1PRT D;  3OWE B;  4DN4 M;  2JA6 G;  4FYD A;  4DV2 Q;  1H9J A;  3PGZ A;  2EY5 A;  2M2L A;  4R4T A;  4JV5 L;  2WAQ B;  5JJI A;  2E5L L;  1IYJ B;  5IP9 G;  3ND8 A;  1DOL A;  2A6H D;  2V4D A;  3CC7 A;  2YYZ A;  4A93 H;  1SE2 A;  4E6I A;  2OT2 A;  1Y1W G;  1NMG A;  4DR6 Q;  1SSO A;  2CQO A;  2N78 A;  1IBL Q;  3ULP A;  1QVG A;  3STB D;  3R2T A;  1DON A;  5D3D A;  3OYY A;  1X3Q A;  3TP8 A;  2VY3 A;  3PUZ A;  1WTH A;  4C3J B;  4AH6 A;  1XNQ Q;  1TWA H;  3PV0 A;  3D6W A;  4BA2 I;  4CKB A;  1K9M C;  4KD3 A;  2OQK A;  3PIP A;  3BG3 A;  2DGY A;  1Q82 C;  1I94 L;  3G6E A;  1YJW A;  1XMQ Q;  3DWP A;  2UUC Q;  4JI7 Q;  2MUY A;  1QB5 D;  4YWM A;  1KDB A;  3MA2 B;  2ZJQ A;  2D2C C;  1KL9 A;  4KKS A;  2F1M A;  1K8O A;  3S16 H;  2P5Z X;  1PMR A;  4WRD A;  5EBC A;  2ID0 A;  4QCL A;  1JT8 A;  3VYR A;  2JA5 H;  1QOH A;  1WYD A;  2RBM A;  4WJW A;  3HOX H;  1Q7Y C;  1HZB A;  4LUO A;  4A3B B;  2WKC A;  2JEB I;  1VS0 A;  2I46 A;  4B3S Q;  1Q8I A;  3T13 A;  5C44 G;  1FGB D;  3J81 c;  1HRJ A;  4QIW B;  3C3L A;  2J7Z A;  4FF4 A;  2NUC A;  5E3F A;  1NE3 A;  3RLO A;  2ZJR A;  2BA1 A;  4ABN A;  1AEX A;  5FOB B;  3CCJ A;  4YHH Q;  1UE6 A;  3D4D A;  1LTT D;  1BUV T;  5IT9 L;  4DAP A;  4NP5 A;  4FF1 A;  3FPP A;  4ZYS A;  3CME A;  1UNS A;  2UXC Q;  4XQQ A;  2AQ3 B;  1VQD A;  1WCM B;  2DJF C;  2L4N A;  3PO2 H;  1VQO A;  3ERQ A;  4L63 B;  1A8V A;  1D5Z C;  1Y1V H;  1C0A A;  2NZ1 D;  5CMD A;  3J81 j;  2B29 A;  3KUP A;  1RKN A;  3N52 A;  1YVC A;  1D8L A;  2Y0S B;  4KI0 A;  4HIO A;  3HOZ H;  2KEN A;  1T5E A;  1D5M C;  4HAE A;  2Q8R E;  2AWN A;  4JVZ A;  4DR1 L;  5C0X H;  1E3P A;  3SEB A;  1QWY A;  4B3R Q;  3NBH A;  1SRO A;  2F0O A;  1E24 A;  1Z9F A;  2ALY B;  1F2Z A;  2EY1 A;  1B3A A;  1EY7 A;  1STE A;  4PMC A;  2F4V Q;  3UDF A;  1S5B D;  4P74 A;  3NBH B;  4S3S A;  3L9A X;  1C48 A;  2JA9 A;  4DA2 A;  1EIY B;  2CWP A;  5IP7 H;  1XJV A;  2RHS B;  1WFQ A;  3T1H L;  1EU4 A;  3S9W A;  3PCO B;  1Q46 A;  3BDL A;  4IQZ A;  4AIM A;  3Q8D A;  1SAP A;  3RMH A;  4A3C G;  4DV4 L;  1A3V A;  3NUC A;  2PW7 A;  4O2D A;  5FJ8 G;  4EQP A;  5C3E G;  3J7Z C;  2E2H B;  4JI0 Q;  4PG3 A;  1HQR D;  2NVY H;  2JA6 H;  4BBS G;  3BU2 A;  1E2W A;  3G6J B;  5FLX E;  2CFM A;  3GTK B;  1QIL A;  3PF5 A;  1B70 B;  1X55 A;  1EQT A;  4UY8 C;  4PQX A;  1D5X C;  2X6G A;  4QMG A;  3A5U A;  3G71 A;  2JYO A;  4GZY C;  3NEN A;  1JJC B;  1V1Q A;  2E2I B;  1KLU D;  5DM6 3;  1S5C D;  1Y1W H;  1JQY D;  1A3T A;  1X32 A;  2KCC A;  3W3A A;  5CBA E;  3SHL A;  4X3S A;  5EKK A;  3RZD H;  3GTL B;  4NB3 A;  2KUM A;  4IN3 A;  1ML0 D;  5EGT A;  4C2M H;  2IHF A;  2XGT A;  4B3T Q;  3GDE A;  3M85 A;  2UUB Q;  3DWA A;  4DK3 C;  1D6E C;  1TII D;  5LMN Q;  3KLS A;  2RCF A;  2A6E C;  4RGM A;  4Q0F A;  1X3P A;  5EPK A;  3GTG B;  2PPB C;  5CV8 A;  4RH6 A;  4GKK Q;  3OMG A;  1K8A C;  2IW3 A;  1IYU A;  1CI3 M;  1YIT A;  1KAB A;  3OTO Q;  1JB7 A;  1E1O A;  5M3F G;  2ZT9 C;  4JBJ A;  2DNE A;  3MEH A;  2IX1 A;  1YJN A;  1OXV A;  3DUZ A;  5D14 A;  1TWG H;  1X54 A;  2KCM A;  1JJ2 A;  3NQT A;  3TME A;  1OXT A;  1RHP A;  1OTC A;  4OWT B;  1PDQ A;  2RVL A;  1SJH D;  1VF5 C;  2JA7 G;  3T4A C;  1V1P A;  3Q6S A;  4HJ5 A;  3NP8 A;  2HD3 A;  2AMC B;  4JK1 C;  1E2V A;  1CQF A;  3A54 A;  1O7Y A;  1O7Z A;  2R7D A;  3M9B A;  3JAM L;  1KXL A;  1V1P B;  3OWF A;  1N34 L;  2FIN B;  2K5V A;  3HFZ B;  5C44 B;  1SYG A;  2MO0 A;  1G91 A;  1F9R A;  3MEF A;  2VQF Q;  1CZW A;  1RJT A;  5CGK A;  3H09 A;  1S5D D;  4K8J A;  5LL6 X;  5ELF A;  1JWM D;  2ZXO A;  3OIP A;  3J7A F;  4KMU C;  1IHZ A;  1TWF H;  3HKZ B;  1HUN A;  2F0J A;  1MHW C;  2VUM B;  1TS5 A;  3GV3 A;  5C5M A;  3D8G A;  5CR3 A;  3VA5 A;  1NAP A;  1XTC D;  1RCV D;  1F9Q A;  1PH8 A;  2Z6K C;  3H91 A;  4DNR B;  4KD4 A;  3F2C A;  4JI3 L;  3X3N A;  4APV A;  5C0X J;  2R92 G;  3H3V I;  1I6V C;  2PW5 A;  2DUD A;  4OIJ A;  2EJM A;  2KHI A;  1WTX A;  2Z8L A;  3RLN A;  4DV6 Q;  1SBB B;  3GTJ B;  2HCC A;  1ENC A;  3ND9 A;  3P1H A;  2ZXR A;  3H0G G;  5G3L D;  4LF8 L;  4ZRZ A;  2K6A A;  3HS0 C;  2AUJ D;  3HOY G;  1HHV A;  1ICF B;  3TRZ A;  2PI2 E;  1XPO A;  3SVM A;  3S1M H;  1A15 A;  1VMC A;  2VS1 A;  1CKN A;  3U4V A;  1N32 Q;  1XWE A;  2B8F A;  4J1M A;  3HEJ A;  1LT6 D;  1K8G A;  3CQZ B;  2B63 H;  2XRQ D;  1KRT A;  3FPU B;  2BCO A;  1CKN B;  1U4P A;  4P71 A;  3KLW A;  1LLR D;  3H15 A;  3W1G A;  1EEI D;  3EFX D;  3URY A;  4BY7 G;  2IT1 A;  5FJ8 H;  5C3E H;  4JCV E;  1HUM A;  1YHQ A;  2QIL A;  3NTI A;  4C1N K;  3VYS A;  3GTM H;  5T1I A;  4BBS H;  1EQR A;  1EFW A;  4PZ6 A;  2Z4I A;  1Y8O B;  3MWY W;  2EY6 A;  1HNX Q;  2R7Z B;  4X62 L;  2C9O A;  3R3O A;  3KJP A;  2EVB A;  1D1K A;  1ENF A;  4FXG C;  3F2D A;  4DR1 Q;  1HTL D;  1QG7 A;  4CJ2 C;  3TS0 A;  1Y8P B;  2F0U A;  1ZKO A;  5IE8 A;  2GVA A;  4YY3 L;  5IYD G;  2JP1 A;  2F03 A;  5CBE E;  2UXD Q;  2BA0 A;  2O2L D;  1BCP B;  1UWV A;  4TSS A;  5GAG C;  1EWC A;  5GQO A;  1IYV A;  5A2Q L;  2WB1 E;  1YIJ A;  1Y8N B;  4DV2 L;  3S1Q H;  4BBR G;  4HMI A;  4GN5 A;  4JI6 Q;  3I70 A;  4A3I G;  1MI2 A;  2EYH A;  1JIC A;  2NVQ H;  5LMU Q;  3T1H Q;  4F88 A;  3QOJ A;  2ICE C;  2B8G A;  4RKL A;  2I5M X;  5FLX c;  1JCK B;  3L0O A;  2K5W A;  4H7B A;  4GN3 B;  3QJY A;  5M3F H;  2PQE A;  1EYA A;  3KYH C;  2Q8I B;  1IBL L;  3S2H H;  1CTM A;  1K83 H;  3E3X A;  4EGV A;  1KRS A;  1PV4 A;  3U9S A;  2VNU D;  1GHK A;  1HFG A;  4JI2 Q;  2NVT H;  3S1N B;  3RN2 A;  2EZV A;  2NVX H;  1XNQ L;  2LXK A;  1UEA B;  2EXD A;  4LFA Q;  2JA7 H;  4PZ8 A;  1PZJ D;  1QJO A;  4JI7 L;  1XMQ L;  5FO7 B;  2F0M A;  4B9X A;  3K7U C;  4A3D G;  2YU9 B;  3NPP A;  3SGI A;  2K5D A;  3CC4 A;  4R4C A;  2UUA L;  2VB3 X;  4AYB G;  2BDN A;  2JA8 B;  4CKE A;  2RDF A;  4B3S L;  1BNZ A;  1VQ8 A;  1MD2 D;  3E5S A;  4IOC A;  4AQY Q;  1EIF A;  1BO0 A;  2L9H A;  1FJG Q;  3J80 L;  3ONA B;  4X6A H;  2R93 G;  1TKW B;  1KAA A;  4K8I A;  1O80 A;  3PO3 H;  1BQQ T;  2JJQ A;  2KBN A;  3CPF A;  3BVG A;  4CDE C;  3JAM i;  2L55 A;  1Z6H A;  2UU9 L;  4WOR A;  2R92 H;  3Q0A A;  1BR9 A;  2K52 A;  1R9T H;  3OIQ A;  1XYI A;  4QY7 A;  1DYQ A;  3J7Y W;  1IL8 A;  1TY2 A;  1N33 Q;  4OWX B;  1PFS A;  1MJC A;  3CKI B;  1WTP A;  1ET6 A;  1IL2 A;  1A62 A;  1TWC H;  2B2T C;  1JOR A;  1VQK A;  4HJ7 A;  2A6E D;  4KN4 C;  5L37 A;  1WTW A;  4NDX A;  1AW7 A;  4IPG A;  2GVB A;  2A5H A;  4RHS A;  3CU7 A;  4HN7 A;  2O4X A;  1SMY D;  5M5Y B;  4H02 A;  2L15 A;  5BR8 Q;  1CA5 A;  1IXR A;  4DV1 L;  1H9S A;  4OON A;  3VR5 A;  4Y52 H;  2SNS A;  2N49 A;  4MNO A;  4JOI A;  4OWW B;  1PTO B;  4BY7 H;  5H1S E;  4X3U A;  4O42 A;  2F4V L;  5ELN A;  1XXG A;  2QGQ A;  2J4X A;  3MXG A;  5GRO A;  1H9S B;  1VQN A;  3S14 H;  4FO2 A;  4JI8 Q;  1EYG A;  3K7A B;  1M1K C;  5IT9 E;  3HOU G;  3RN5 A;  1OXU A;  1Q12 A;  3EQL C;  2JSO A;  3X3M A;  4HID A;  4OO1 H;  5IYC H;  5C4X B;  2N8N A;  3TSS A;  1OXX K;  4DAM A;  1MBY A;  2AQ1 B;  4LF8 Q;  1F2L A;  1WI5 A;  1EY8 A;  5F2D A;  4ZAI A;  5IYD H;  1TS2 A;  3E9I A;  1ESR A;  4ME3 A;  4H13 C;  2XRS D;  1IKM A;  4CDD C;  1LTB D;  2EYP A;  2SEB D;  3FRP B;  4F8M A;  4DR4 Q;  4QUC A;  4IJL A;  1CKM A;  4ZUI A;  3UI2 A;  3CCR A;  4HJ9 A;  4LF4 Q;  3A8I E;  1GXD C;  3RNU A;  3GTP H;  2QEJ C;  4A3I H;  1ET9 A;  2E8G A;  2PMZ E;  3DEP A;  5COY A;  2PNR C;  4RKB A;  3I4M H;  3HOV B;  2RA4 A;  2EYF A;  4BY1 B;  4R4Q A;  1EFI D;  4GNX A;  2AQ2 B;  3P7J A;  4DU9 A;  3KF8 A;  2G5D A;  1P16 A;  1GUN A;  4A3E G;  3M7G A;  3TBI B;  4IPH A;  4B3T L;  2CCZ A;  2UUB L;  4DV5 Q;  2C5C A;  2YTY A;  4YCW A;  2F4I A;  1PRT F;  1PH1 A;  5LMN L;  2Z6B A;  3LX0 A;  4Y7N H;  1YBY A;  2F0I A;  4LF5 L;  4X62 Q;  1CHQ D;  4L5T A;  4GNX B;  4GKK L;  3KF8 B;  2DN8 A;  2WB1 G;  1B9M A;  3HP3 A;  3SXH A;  2L0C A;  3OTO L;  3K57 A;  2RDG A;  3K0Y A;  5CV5 A;  4YY3 Q;  5HY6 A;  1XTD A;  4WJ4 A;  3FKI G;  4P75 A;  1FGU A;  4RGO S;  1G6Z A;  1SR3 A;  1M4V A;  1PH9 A;  5J1Z A;  1GUO A;  2Q2H A;  4A3D H;  1W6K A;  2XNA C;  5JPN C;  2ZTE A;  4JI4 Q;  4NW2 A;  2F52 A;  3WWV A;  4OEM B;  3M7N A;  1JWU D;  4RWS C;  1FVI A;  3HOW G;  2EYL A;  2AKW B;  3HRZ C;  1U4L A;  1JR0 D;  4JI1 Q;  1I6H H;  4A93 B;  1JOQ A;  3B6Y A;  2AWO A;  1Q1B A;  3MZ5 A;  4MTK A;  2R93 H;  4IFD G;  4X66 Q;  4G57 A;  2F0W A;  3VA7 A;  2B2T A;  3NE5 B;  1ROD A;  2VQF L;  4IUR A;  1O7I A;  2A1A A;  2JQO A;  4IO9 A;  3GP7 A;  4HJA A;  3QIA A;  4DNT B;  1VQG A;  5DEH A;  1Q86 C;  2PZT A;  1AZP A;  2XWJ B;  1E0B A;  1PFB A;  3QR8 A;  5KGU A;  4C3H B;  2ICI A;  1TWA B;  4OL7 A;  3D4W A;  5IOC A;  5LMN W;  5TSS A;  1DXM A;  4ZKB B;  2M9V A;  3S1R B;  1HJP A;  5IY0 A;  5C0X I;  5J39 A;  4L5Q A;  3LWU A;  2B2W A;  2UUA Q;  4A3F G;  3J80 i;  1Q3L A;  4XIG S;  3S2D H;  1O7L A;  3S16 B;  3VYU A;  2JA5 B;  3OOC A;  1G8Z D;  3HOX B;  5EKL A;  4K14 A;  1DM0 B;  4DV6 L;  2E75 C;  1VQ4 A;  1PFN A;  3CC2 A;  2EE1 A;  2TMP A;  3S15 H;  1IZ6 A;  1WTR A;  4YCV A;  3IFD A;  4O0A A;  3JAM E;  3I56 A;  1CSP A;  5IGE A;  2B2V C;  4J15 A;  4A3M G;  1G2S A;  4UPA A;  4LF6 Q;  4ALP A;  4R8N A;  3GTO B;  1LYL A;  1TWH H;  1N32 L;  2UU9 Q;  2PI2 A;  3MXN A;  2QW7 A;  3PIO A;  1XNR L;  3SK4 A;  4MZ9 A;  1OXS C;  2KQ3 A;  5ELC A;  1LAC A;  4EQO A;  1EZ8 A;  2NWG A;  3HOU H;  4TRD A;  1VQM A;  4RA8 A;  1KAW A;  4LF9 Q;  3M4Y A;  2D0O A;  5J3B A;  1AZQ A;  3PIO 3;  4XT1 B;  4DNI A;  2B3G A;  3MXN B;  4L8J A;  1ASY A;  5KEE A;  4JBW A;  5A35 A;  3RZO H;  4G7Z C;  3TZD A;  4B9W A;  3PO2 B;  5CC4 A;  2KJX A;  4A3J G;  1S5F D;  1Y1V B;  3NTH A;  3L3O C;  3A5Z B;  3V2T A;  1F77 A;  2VW9 A;  2ZM6 L;  2OXP A;  1E1T A;  4L5S A;  2LFN A;  4KTA A;  2R7F A;  1HNX L;  4POF A;  1RF2 D;  4NXM Q;  2IWH A;  4ZK9 B;  5ELO A;  2JE6 I;  3HOZ B;  1BVS A;  4ZUJ A;  1SXT A;  4DV1 Q;  1BF4 A;  5IT9 c;  2UXD L;  1B4O A;  1Z47 A;  3UDG A;  1X6O A;  4KN7 C;  1GUW A;  2A69 C;  2I07 B;  3TQY A;  4DXF A;  1G29 1;  3UE1 A;  4QGU A;  4A3E H;  3S17 B;  2ZTC A;  3Q23 A;  4JI6 L;  1M8A A;  1FD7 D;  1EY0 A;  5LMU L;  2B63 G;  2EIF A;  1KDC A;  1STB A;  2E74 C;  1BXT A;  2MGS A;  1TR5 A;  2AHO B;  2BOS A;  4K5W A;  4C3I G;  1ONL A;  1A2T A;  5C6A A;  1UE5 A;  1JWS D;  5LHY 1;  3FKI H;  4U67 3;  4QUF A;  3F2U A;  1NNX A;  1A6X A;  1HR0 Q;  3AMU A;  3PUW A;  1DGS A;  1GD7 A;  2M00 A;  5JEA G;  2OTJ A;  4LFC Q;  1PZK D;  2KHS A;  2NVY B;  1QZH A;  4JI2 L;  2JA6 B;  4KHP Q;  2XSC A;  5EBD A;  4RCO A;  1EUJ A;  4A3K G;  4KV6 A;  1EOV A;  4LFA L;  2N88 A;  2E2H H;  2V1C C;  2Q2U A;  2EY2 A;  4X64 Q;  3HOW H;  2D62 A;  1EEF D;  3I4O A;  1L1O A;  1A0I A;  4HCS A;  1O78 A;  5IGF A;  2LKV A;  2VQE L;  3GTK H;  4RG1 A;  5AFW A;  1Y1W B;  3T1Y Q;  2MNA A;  5CV9 A;  5A2Q E;  2MJ8 A;  4IFD H;  1L1O B;  1K3B C;  4UAI A;  4C2M B;  1WVL A;  4IPC A;  4LJZ C;  2Q8T A;  1BCP C;  1LTL A;  1CK1 A;  4LF5 Q;  3GTL H;  4DAV A;  4HMJ A;  1JE5 A;  1AH9 A;  4AQY L;  3H3V C;  2KOL A;  3CRL C;  4C1N I;  1QVC A;  3F2B A;  1BBW A;  4AYB E;  4BWG B;  1FJG L;  2DNC A;  4XQN A;  3NEL A;  2G9H D;  2DJG C;  4M1U B;  5ELB A;  2B2V A;  5C3X A;  1SYF A;  5C4J B;  4X3K A;  1YNN D;  3U9O A;  1TWG B;  4A3F H;  4P2C B;  4ME5 A;  5IGD A;  2WAQ E;  4PV1 C;  1BOS A;  1YI2 A;  2NZH A;  4RGN A;  2EYM A;  1ZXT A;  1PH2 A;  3FMC A;  2Z0S A;  3GTQ H;  4FXK C;  3TEH B;  3WOE A;  1K73 C;  3L2P A;  2CWA A;  1N33 L;  1EQV A;  2Q2I A;  3O13 A;  1KD1 C;  4MN3 A;  3KOJ A;  4DV3 Q;  4A3M H;  1STA A;  4KJO A;  1I50 H;  2NYZ D;  3M4Q A;  5M3M G;  4R8I A;  3SR1 A;  1NY4 A;  1K0S A;  3MTS A;  5HGQ A;  1VQI A;  3IRB A;  2FFK B;  3MXP A;  3ERS X;  1RIP A;  2K7V A;  2L1B A;  4A3G G;  2E2J B;  5BR8 L;  5ISR A;  3J80 E;  1UE1 A;  2A73 B;  5G3L F;  3PO3 G;  4M8A A;  1ILP A;  3D0F A;  2IX0 A;  1F9P A;  1YHB A;  3JAM c;  3VR3 A;  4A3J H;  2PYK A;  1XPR A;  1HNZ Q;  1W3S A;  2K5N A;  5IGB A;  4JI8 L;  2XN9 C;  1J6Q A;  4DAY A;  3AQQ A;  1CT1 D;  5I9O A;  4MTN A;  3JC6 6;  1SE4 A;  2KHJ A;  1EY6 A;  3NWT A;  3A55 A;  1BDO A;  1EY5 A;  3VYT A;  4DAY B;  2HUG A;  1Q1E A;  4R4O A;  1DCZ A;  5I2X A;  4QIW E;  1HZA A;  5CV7 A;  4DR4 L;  2DY7 A;  4LF4 L;  3UDI A;  3GTJ H;  2LMC B;  4V19 0;  3OPO A;  3S1M B;  1XNR Q;  1PYW D;  5KIX A;  3NEM A;  2TSS A;  1RD9 D;  3J7A 5;  3M4P A;  2F3W A;  3TP7 A;  1U4M A;  3NSW A;  5ELE A;  1FNU A;  2CH4 A;  3RLF A;  4GN4 B;  4LK1 C;  4C3I H;  1PZI D;  4JI5 Q;  4J6H A;  5KYI A;  2F3I A;  2QDB A;  4DV7 L;  1ASZ A;  1IW7 C;  1PRT C;  2K50 A;  2UXB Q;  1TS3 A;  3BVM A;  1Q8K A;  3CQZ H;  1SFO H;  3C1F A;  4DV5 L;  5C3E B;  3K58 A;  5CYU A;  1WTV A;  3RR5 A;  5JEA H;  2ZM6 Q;  1L0Y B;  2I0Q A;  3GTM B;  3SDZ A;  2NB0 A;  4BBS B;  1PTO C;  1ENA A;  4K6L A;  2Y0S E;  3PQI A;  4A3K H;  2FHT A;  3M3Y H;  3K80 C;  5IYC G;  1XMO Q;  3UDX A;  1J5E Q;  4KKU A;  1RTO A;  3DHQ A;  1PH7 A;  1EL0 A;  1CHP D;  2K14 A;  4IFD J;  2EOT A;  2R61 A;  3QO2 A;  4JOI C;  5JJZ A;  2VB2 X;  2CQA A;  4OX9 Q;  1HA5 A;  2R7Z H;  4HED A;  1HNW Q;  1A3U A;  3NHH A;  3D6C A;  1B2T A;  4JI4 L;  4Q5V A;  4CJ1 B;  5JOB A;  4PMW A;  3S1Q B;  3SK8 A;  3K81 C;  4XYO A;  4QL5 A;  1PA6 A;  2NVQ B;  3D3R A;  3I4M G;  5KRU A;  5M5X H;  1B53 A;  3EBE A;  4HSP A;  2IX3 A;  3G4S A;  2PZW A;  4JI1 L;  1LT5 D;  5GAH C;  3GO5 A;  2K1B A;  5M3F B;  1P8L A;  4I7Z C;  4A75 A;  5CV4 A;  4X66 L;  3CMA A;  1OO9 B;  1K83 B;  4HJ8 A;  4IUN A;  1I3Q B;  1V9P A;  3CRK C;  5E4W C;  2DY8 A;  1FL0 A;  1KNE A;  1NMF A;  2VZA A;  3I4N G;  2EYO A;  3TS2 A;  2NVX B;  1R4P B;  4GKJ Q;  2JA7 B;  4HCE A;  1B8A A;  3K0X A;  2VQE Q;  4NMZ A;  1LV9 A;  3PF4 A;  4GNX C;  1H95 A;  3S1N H;  3E0J A;  1SNP A;  4A4I A;  3CXC A;  1AE3 A;  4DGZ A;  4BA1 I;  2NTT A;  1XPU A;  3F8T A;  1KIX A;  5M3M H;  3TRE A;  1PHJ A;  2HHH Q;  1GKH A;  4JBK A;  2EDG A;  3DLL A;  2L11 A;  2PZU A;  2RHQ B;  2WAQ G;  4A3G H;  2K01 A;  4KK7 A;  3MXU A;  4BXX G;  1V1O A;  4OO1 I;  2F0Q A;  3NQI A;  4LF6 L;  1TS4 A;  5T1G A;  1I4Q A;  1M90 C;  3BS1 A;  1W2B A;  3I72 A;  1LTG D;  2ASB A;  1H9R A;  3CCS A;  3KBX A;  4DFA A;  3E6Z X;  2D5D A;  4K0K L;  2R92 B;  2WV6 D;  2JEA I;  3KK7 A;  4P73 A;  4LF9 L;  1PYS B;  2RF4 A;  4P72 A;  1V8Q A;  1MSG A;  2J0T D;  3CCU A;  4C3J G;  3OW2 A;  1FYC A;  2Z1C A;  2IPK D;  3H0G B;  1SMX A;  3HOY B;  3BYY B;  3AU7 A;  3J80 c;  1SJE D;  4OIK A;  1NCV A;  1BCP D;  1TWC B;  3DM3 A;  2BDO A;  4PNY A;  3ZJY C;  2X69 A;  4DK6 C;  2BH8 A;  3ZYY X;  5M5W H;  2ZXP A;  4YWL A;  3PUY A;  1SDF A;  1PRT B;  5D3I B;  2FJ2 A;  3BYT B;  4NXM L;  3VR2 A;  3CHB D;  1U0L A;  1RTN A;  1CFM A;  1B7Y B;  3NBI A;  1VQ5 A;  2CKZ B;  2O5I C;  4LUV A;  4POG A;  1KNA A;  1U9R A;  5JEA J;  4A3B G;  1LO5 D;  1MGS A;  2B2W C;  1UAP A;  2MHV A;  4GLA C;  3R93 A;  3UE0 A;  3D31 A;  3CCE A;  4BY7 B;  2HIX A;  2JK8 A;  2PCF B;  2KCN A;  2QEX A;  1K28 A;  2XVS A;  1LT3 D;  1EY4 A;  5GAE C;  1JC7 A;  5I6W A;  4KY5 A;  2K28 A;  1KTK A;  4LAA A;  3FP9 A;  4IUU A;  3V96 A;  4H0L C;  1HR0 L;  3K7A H;  1F2Y A;  3MC0 B;  1W6J A;  3DMU A;  4LFC L;  5E4X A;  4KHP L;  1VQJ A;  1WOC A;  4BBR B;  1WCM G;  5KNB A;  4GOP A;  3TP5 A;  3GTP B;  4ZQ3 A;  1X56 A;  4A3I B;  1GO3 E;  4X64 L;  2B39 A;  3IFT A;  1N9W A;  4K2K A;  4DV7 Q;  1ZYR C;  2F3V A;  3AFP A;  3W1B A;  4GOP B;  4N9T A;  2Y0S G;  3T1Y L;  1VQE A;  1VQL A;  1RL2 A;  1SNO A;  1Y69 U;  4KJN A;  4N9P A;  1TT2 A;  3I90 A;  1QCB D;  3W2D A;  5JVG 3;  1SEB D;  2GN5 A;  4XT3 B;  3T16 A;  3V05 A;  2F0N A;  3M4O H;  3I4N H;  3MAQ A;  5J22 A;  1H9M A;  2OEO A;  2NBF A;  5C4Z A;  1QNU A;  2EXZ A;  1MIU A;  5EQ0 A;  2WFW A;  1AE2 A;  5K36 H;  5D65 A;  2K75 A;  4XXE A;  4IOA A;  5DM7 3;  3T53 B;  1SN8 A;  4A3L G;  1VMP A;  5IIF A;  1PH4 A;  3PUX A;  1PH6 A;  4A3D B;  1I4H A;  1VCI A;  2EJF C;  1HR0 W;  4HSV A;  2F0S A;  4AYB B;  1SE3 A;  2SDF A;  1AN8 A;  3I8Z A;  3CW2 C;  1YNX A;  3HGB A;  3OMC A;  1IW7 D;  1I5F A;  4OGQ C;  3H6M A;  2H5X A;  4TVA B;  5CV6 A;  2ES2 A;  4BXX H;  1I6H B;  4DV3 L;  3I7F A;  4OXP A;  3BDC A;  3FDT A;  4NXN Q;  1HCZ A;  2F0H A;  2Z9H A;  2R93 B;  2YTX A;  3H94 A;  4DXG A;  4DR3 Q;  1SE8 A;  3ULJ A;  1MKH A;  1I4G A;  1HPC A;  1PTO D;  4ID6 A;  5M9O A;  2Z4H A;  1HQM C;  1Y14 B;  4G7O C;  1L1O C;  3K8A A;  3K5M A;  3KFU A;  5FO9 B;  2RSO A;  1WD0 A;  1EZ6 A;  1N8R C;  2D0P A;  4C3J H;  1KQS A;  2PQA A;  4EQN A;  3DEO A;  5AJ3 L;  2LSS A;  3CCL A;  1CSQ A;  4ODG A;  2NN6 H;  1Q90 A;  4C3H H;  5JPM C;  1HZC A;  1PH3 A;  4LWC A;  1VQA A;  1HNZ L;  5I9P A;  3J81 L;  2PQA B;  3S2D B;  3S1R H;  1GVP A;  3RUZ A;  5C4H A;  5BN5 A;  3LNN A;  2ZJP A;  1I4R A;  2E2D C;  1B50 A;  1HH2 P;  1TQO A;  5LL6 S;  1N36 Q;  2LXJ A;  5JAV A;  1F2M A;  1S40 A;  2HCI A;  3PIP 3;  4LFB Q;  1G51 A;  3S15 B;  1VQP A;  1VQC A;  4A3B H;  4CKC A;  4K5X A;  1STH A;  1LTI D;  4ILW A;  1ILQ A;  2HT1 A;  1PFM A;  1YJ9 A;  1TWH B;  2K4K A;  1VF7 A;  5FK9 C;  3TZU A;  4DK1 A;  4K0K Q;  3I55 A;  1HA6 A;  3MFG A;  1TVX A;  3BDO A;  3HOU B;  4JYA Q;  3GTO H;  4JI5 L;  3ICE A;  4X65 Q;  4F87 A;  5JJK A;  1XX8 A;  4L5R C;  2K5H A;  1BKB A;  4DUZ L;  1SND A;  4IJH A;  2UXB L;  1UUP A;  4K2L A;  4BS9 A;  1Q81 C;  1YNJ C;  1WD1 A;  1JJG A;  2K05 A;  4QB4 A;  1CUK A;  3HKZ G;  5IWA Q;  3RZO B;  1KLG D;  2WP8 J;  2VUM G;  2EQS A;  3NXW A;  3S24 A;  4IFD I;  1WCM H;  5NUC A;  5HUR A;  1J5E L;  3GQB A;  1XMO L;  3A0J A;  4QJF A;  1E7Z A;  1VQ6 A;  2A68 C;  4IAL A;  3EVQ A;  1X3G A;  3K5L A;  2HDL A;  4MHE A;  2WIN B;  1UEB A;  3QB3 A;  4OX9 L;  4GLX A;  3Q22 A;  4DUY L;  2N3S A;  1HNW L;  3VR6 A;  1I4P A;  4KLK A;  1WTO A;  3T51 B;  5EAY A;  1K8M A;  1SNM A;  2F0P A;  4A3E B;  3FVQ A;  2D9U A;  4R4I A;  2H4O A;  4I65 A;  3L7Z C;  1YHA A;  2F0G A;  3S17 H;  2WB1 B;  1V43 A;  3KBG A;  2KED A;  1EOT A;  3VR4 A;  3FKI B;  1KC8 C;  4A3L H;  1DOM A;  4RMF A;  1EIH A;  2WII B;  1C8C A;  4QQB X;  1ZEQ X;  3TDQ A;  1LTR D;  3MHB A;  5DAU A;  4PMB A;  1STY A;  4GKJ L;  4Z9C B;  4RGT A;  4LNQ A;  4G4K A;  3HOW B;  4OO1 G;  4EVO A;  4H44 C;  2R7Z G;  3NTK A;  3RZD B;  1AP0 A;  1NBW A;  1LT4 D;  3WDN A;  3WOF A;  5IP9 H;  2E2I H;  1NSN S;  4CDC C;  1CQV A;  1LAB A;  4I7A A;  3FHW A;  4U68 A;  1T9H A;  2HHH L;  1IKL A;  1A2U A;  4N8X 1;  1GM5 A;  2B2Y C;  2CH4 W;  4DV0 Q;  5COR A;  2B2U C;  1PH5 A;  1TY0 A;  3W5O A;  1ICW A;  3GTG H;  2MO1 A;  4DR7 Q;  2SOB A;  3A8J E;  2MPM A;  1VDZ A;  4G7H C;  2BE5 C;  1CA6 A;  4CBV A;  3EA6 A;  1B3Q A;  3KLS X;  4HIM A;  4A3F B;  4UHV A;  1IBM L;  1SMY C;  1SYB A;  1A63 A;  2OCE A;  2R3Z A;  4GLV B;  5C4J H;  2KCT A;  1ZYR D;  3GTQ B;  4FF3 A;  1CM9 A;  1CKO A;  1KHI A;  3N6R A;  3CF5 A;  5IYB G;  3CCM A;  4JV5 Q;  4IUP A;  1VQ7 A;  4JG2 A;  4XTC S;  1QVF A;  4A76 A;  2E5L Q;  1AFP A;  2XTI A;  1II3 A;  4A3M B;  1NR2 A;  4DR5 L;  1I50 B;  5FLM G;  1HFN A;  3HG9 A;  2F0F A;  3SE0 A;  4JPB W;  4L6T B;  2PNH A;  1QZG A;  5C44 H;  1EY9 A;  3J81 i;  5E1F A;  5ELD A;  2XWB B;  3P75 A;  4OHJ A;  1TWF B;  1VQB A;  5KNC A;  4IPD A;  2F0V A;  1EIG A;  2JA8 G;  5I6Y A;  5AJ3 Q;  3CAM A;  1JOO A;  3CPW A;  4KHZ A;  1DOK A;  3U50 C;  2O5J C;  4KHV A;  3R8B A;  2E2J H;  2HDM A;  2VUM H;  1LM0 A;  5KYL A;  4A3J B;  3CD6 A;  3KF6 A;  3E9H A;  4CHT B;  1I94 Q;  3IL8 A;  3C46 A;  4C56 C;  1HZ9 A;  3J7A V;  2MQH A;  3KF6 B;  2RQX A;  1MJE A;  4RHR A;  3Q24 A;  3OHX C;  3CCV A;  1X9N A;  1I4X A;  4B3M L;  2N55 A;  3OSO A;  2CW0 C;  3HZX A;  1PYB A;  2F0K A;  3PMF A;  3GV6 A;  2R6G A;  4YIJ A;  1YZ6 A;  1FNW A;  1DJR D;  4MIU A;  4JC0 A;  2KA7 A;  2OWO A;  1HTP A;  4WJ3 M;  2B63 B;  4N8F A;  1EWI A;  2IL8 A;  4YWK A;  4TQU S;  2A8V A;  4C3I B;  5K5P A;  4DUZ Q;  3K59 A;  3LGJ A;  5EKI A; 
#chains in the Genus database with same CATH homology
 1JB3 A;  1MSH A;  2KVM A;  2PMZ B;  3SK5 A;  4WFN 3;  3T56 B;  1R4Q B;  2PO4 A;  1SFO B;  5C3W A;  2A6H C;  3NWS A;  2EJG C;  2F0T A;  1U4R A;  3QOL A;  1J9O A;  1SNC A;  4A3K B;  3M3Y B;  1L0X B;  3MVV A;  1Z7T A;  2B2Y A;  4CJ0 B;  1STG A;  1SYD A;  2RSN A;  2JXM B;  5BN4 A;  4FF2 A;  1G2T A;  1GJX A;  2B2U A;  3EJI A;  3I4L A;  4FP5 D;  5FLX L;  4KY7 A;  1PXU A;  2WAC A;  3A8K E;  3NK9 A;  4R9W A;  3R2I A;  2WKD A;  1QE6 A;  1S4Z A;  2AUK A;  3K5N A;  2CHB D;  4X3T A;  5M5X B;  1JE4 A;  1GUG A;  2L5T A;  1E2Z A;  5BN3 A;  1T5X D;  1YNJ D;  1FR3 A;  3I73 A;  4DF7 A;  3K5O A;  3S2H B;  3GD7 A;  1EYD A;  1GUS A;  5HGT A;  4UDU C;  1F9S A;  4F7X A;  2X6L A;  3C2P A;  2NVT B;  1CZG A;  4IUQ A;  3AB9 A;  2LS0 1;  3A7A B;  2XIW A;  4KKT A;  2A68 D;  5K36 G;  1EU3 A;  5EPJ A;  4ULL A;  2A69 D;  1D2B A;  5EJW A;  4J8Q A;  1STN A;  5EPL A;  3ERO A;  1BBX C;  2NTS A;  1ESF A;  3KLR A;  3QG1 A;  5M3M B;  4IUT A;  1KDA A;  2IJ0 A;  1FNV A;  4RAU C;  3OW7 A;  2K03 A;  3IKJ A;  4A3G B;  3DWQ A;  3ITP A;  4K5V A;  1SNQ A;  4FXD A;  5I4D A;  5FO8 B;  2H1E A;  2L12 A;  2F0E A;  3PO3 B;  1LTA D;  5KND A;  1BCP F;  2F0D A;  3I3C A;  5C5L A;  4HR7 B;  3D4R A;  5IGG A;  5FKA C;  4RFB A;  5JVH 3;  1J8I A;  5DNF A;  1R9T B;  1SYE A;  2NN6 G;  2K04 A;  4O1N A;  3DXJ C;  2LY7 A;  4C3H G;  3PUV A;  1JOK A;  2MP1 A;  1SYC A;  2G9D A;  3G7L A;  1EYC A;  3J81 E;  3P20 A;  1D1I A;  2A74 C;  3LWE A;  1DD2 A;  4DK0 A;  5M5W B;  1PLF A;  2ENB A;  2K5Q A;  1RDP D;  4XYQ A;  2EYJ A;  4IZ8 A;  1LTS D;  1H9K A;  2KEE A;  1QNK A;  2BE5 D;  4K6D A;  2EPB A;  1GHJ A;  4RCN A;  2K32 A;  2QCP X;  3MFY A;  3S14 B;  1B9N A;  4HTH A;  1PTO H;  3BZD B;  3I91 A;  3DM1 A;  4CGY B;  2E76 C;  4TKO B;  3TN2 A;  2VXW A;  1NR4 A;  4ZLT F;  3K6O A;  3TP6 A;  4KY6 A;  2FMM A;  3BVZ A;  3I4M B;  4ZKC B;  3A7L A;  5IGC A;  4NKL A;  5IOD A;  2RKS A;  1YNN C;  3SK6 A;  2QKI C;  3FEW X;  2OF1 A;  4XDX A;  5C0X G;  1WTQ A;  2K33 A;  2NN6 I;  1C4Q A;  2SNM A;  4Y7N B;  2F0L A;  1B1Z A;  1DZ1 A;  1HXY D;  1NUC A;  3M4O B;  2CVR A;  1EWH A;  2RDH A;  3I4N B;  4IUV A;  3RD4 A;  2KEC A;  3C1E A;  1GUT A;  5I2Y A;  2CW0 D;  4XQJ A;  4QF4 A;  1B44 D;  4B08 A;  1TU2 B;  4FNF A;  1S5E D;  2HQE A;  3A56 A;  1PTO F;  3IAY A;  2FMC A;  4LMQ D;  4V0B A;  2QF7 A;  2GA4 B;  3QWN A;  4FVM A;  1GOZ A;  3OWE B;  1PRT D;  4DN4 M;  4FYD A;  1H9J A;  2EY5 A;  2M2L A;  2WAQ B;  3ND8 A;  1DOL A;  2A6H D;  2V4D A;  2YYZ A;  1SE2 A;  4E6I A;  2OT2 A;  1SSO A;  3R2T A;  1DON A;  5D3D A;  1X3Q A;  3TP8 A;  3PUZ A;  4C3J B;  3PV0 A;  3D6W A;  4BA2 I;  4CKB A;  4KD3 A;  3BG3 A;  3DWP A;  2MUY A;  1QB5 D;  1KDB A;  3MA2 B;  2D2C C;  4KKS A;  2F1M A;  1K8O A;  4QCL A;  1PMR A;  4WRD A;  5EBC A;  2ID0 A;  3VYR A;  1QOH A;  2RBM A;  4WJW A;  4A3B B;  2WKC A;  2JEB I;  2I46 A;  1Q8I A;  3T13 A;  1FGB D;  1HRJ A;  4QIW B;  3C3L A;  2J7Z A;  4FF4 A;  2NUC A;  5E3F A;  2BA1 A;  4ABN A;  1AEX A;  5FOB B;  3D4D A;  1LTT D;  1BUV T;  5IT9 L;  4DAP A;  4NP5 A;  4FF1 A;  3FPP A;  4ZYS A;  1UNS A;  4XQQ A;  2AQ3 B;  1WCM B;  2L4N A;  3ERQ A;  4L63 B;  1D5Z C;  2NZ1 D;  5CMD A;  3KUP A;  1RKN A;  3N52 A;  2Y0S B;  4KI0 A;  1T5E A;  1D5M C;  4HAE A;  2Q8R E;  2AWN A;  5C0X H;  3SEB A;  1QWY A;  3NBH A;  2F0O A;  1F2Z A;  2EY1 A;  1B3A A;  1EY7 A;  1STE A;  4PMC A;  1S5B D;  4S3S A;  3L9A X;  1C48 A;  4DA2 A;  1EU4 A;  3S9W A;  3BDL A;  4IQZ A;  1SAP A;  3RMH A;  1A3V A;  3NUC A;  2PW7 A;  4EQP A;  2E2H B;  1HQR D;  1E2W A;  3G6J B;  5FLX E;  3GTK B;  1QIL A;  1EQT A;  4PQX A;  1D5X C;  2X6G A;  4QMG A;  2JYO A;  4GZY C;  2E2I B;  1KLU D;  5DM6 3;  1S5C D;  1JQY D;  1A3T A;  1X32 A;  2KCC A;  3W3A A;  5CBA E;  3SHL A;  4X3S A;  5EKK A;  3GTL B;  2KUM A;  4IN3 A;  1ML0 D;  5EGT A;  3M85 A;  3DWA A;  1D6E C;  1TII D;  3KLS A;  2A6E C;  4RGM A;  4Q0F A;  1X3P A;  5EPK A;  3GTG B;  2PPB C;  5CV8 A;  4RH6 A;  3OMG A;  2IW3 A;  1IYU A;  1CI3 M;  1KAB A;  2ZT9 C;  2DNE A;  3MEH A;  2IX1 A;  1OXV A;  3DUZ A;  5D14 A;  3NQT A;  3TME A;  1OXT A;  1RHP A;  1PDQ A;  2RVL A;  1SJH D;  1VF5 C;  3T4A C;  1V1P A;  3Q6S A;  3NP8 A;  4JK1 C;  1E2V A;  1CQF A;  3A54 A;  1O7Y A;  1O7Z A;  3JAM L;  1V1P B;  3OWF A;  2FIN B;  5C44 B;  1SYG A;  1G91 A;  1F9R A;  1CZW A;  1RJT A;  5CGK A;  3H09 A;  1S5D D;  4K8J A;  5LL6 X;  5ELF A;  1JWM D;  2ZXO A;  3OIP A;  3J7A F;  4KMU C;  1IHZ A;  3HKZ B;  1HUN A;  2F0J A;  2VUM B;  1TS5 A;  3GV3 A;  5C5M A;  3D8G A;  5CR3 A;  3VA5 A;  1NAP A;  1XTC D;  1RCV D;  1F9Q A;  3H91 A;  4DNR B;  4KD4 A;  3X3N A;  5C0X J;  1I6V C;  2PW5 A;  4OIJ A;  2EJM A;  1WTX A;  2Z8L A;  1SBB B;  3GTJ B;  2HCC A;  1ENC A;  3ND9 A;  3P1H A;  2ZXR A;  5G3L D;  4ZRZ A;  2K6A A;  3HS0 C;  2AUJ D;  1HHV A;  3SVM A;  1A15 A;  1VMC A;  1XWE A;  2B8F A;  4J1M A;  3HEJ A;  1LT6 D;  3CQZ B;  2XRQ D;  3FPU B;  2BCO A;  1U4P A;  1LLR D;  1EEI D;  3EFX D;  3URY A;  2IT1 A;  1HUM A;  2QIL A;  3NTI A;  4C1N K;  3VYS A;  5T1I A;  2Z4I A;  1Y8O B;  3MWY W;  2EY6 A;  2R7Z B;  2C9O A;  3R3O A;  2EVB A;  1D1K A;  1ENF A;  4FXG C;  4OO1 G;  1HTL D;  1QG7 A;  4CJ2 C;  1Y8P B;  2F0U A;  1ZKO A;  2JP1 A;  2F03 A;  5CBE E;  2BA0 A;  2O2L D;  1BCP B;  4TSS A;  1EWC A;  1IYV A;  5A2Q L;  1Y8N B;  4HMI A;  3I70 A;  1MI2 A;  2EYH A;  1JIC A;  4F88 A;  3QOJ A;  2ICE C;  2B8G A;  4RKL A;  1JCK B;  2K5W A;  4H7B A;  3QJY A;  2PQE A;  1EYA A;  2Q8I B;  1CTM A;  4EGV A;  3U9S A;  2VNU D;  1GHK A;  1HFG A;  3S1N B;  2EZV A;  1UEA B;  1PZJ D;  1QJO A;  5FO7 B;  2F0M A;  4B9X A;  2YU9 B;  3NPP A;  2K5D A;  2VB3 X;  2BDN A;  2JA8 B;  4CKE A;  2RDF A;  1BNZ A;  1MD2 D;  3E5S A;  1BO0 A;  2L9H A;  3J80 L;  3ONA B;  1TKW B;  1KAA A;  4K8I A;  1O80 A;  1BQQ T;  3BVG A;  2L55 A;  1Z6H A;  4WOR A;  3Q0A A;  1BR9 A;  3OIQ A;  1XYI A;  1DYQ A;  3J7Y W;  1IL8 A;  1TY2 A;  3CKI B;  1WTP A;  1ET6 A;  2B2T C;  1JOR A;  2A6E D;  4KN4 C;  1WTW A;  4NDX A;  1AW7 A;  2A5H A;  4RHS A;  3CU7 A;  4HN7 A;  2O4X A;  1SMY D;  5M5Y B;  1CA5 A;  1H9S A;  3VR5 A;  2SNS A;  1PTO B;  4X3U A;  4O42 A;  1XXG A;  2J4X A;  3MXG A;  1H9S B;  4FO2 A;  3K7A B;  5IT9 E;  1OXU A;  1Q12 A;  3EQL C;  2JSO A;  3X3M A;  4OO1 H;  5C4X B;  3TSS A;  1OXX K;  1MBY A;  2AQ1 B;  1F2L A;  5F2D A;  1EY8 A;  4ZAI A;  1TS2 A;  1ESR A;  4H13 C;  2XRS D;  1IKM A;  1LTB D;  2EYP A;  2SEB D;  3FRP B;  4F8M A;  4QUC A;  4ZUI A;  3UI2 A;  3A8I E;  1GXD C;  2QEJ C;  1ET9 A;  5COY A;  3DEP A;  2PNR C;  4RKB A;  3HOV B;  2RA4 A;  2EYF A;  4BY1 B;  1EFI D;  2AQ2 B;  3P7J A;  4DU9 A;  3KF8 A;  1GUN A;  3M7G A;  3TBI B;  2C5C A;  2F4I A;  1PRT F;  3LX0 A;  2F0I A;  1CHQ D;  2DN8 A;  1B9M A;  3HP3 A;  3SXH A;  2L0C A;  3K57 A;  2RDG A;  3K0Y A;  5CV5 A;  4RGO S;  1G6Z A;  1M4V A;  5J1Z A;  1GUO A;  1W6K A;  2XNA C;  5JPN C;  4NW2 A;  3M7N A;  1JWU D;  4RWS C;  2EYL A;  3HRZ C;  1U4L A;  1JR0 D;  4A93 B;  1JOQ A;  2AWO A;  1Q1B A;  3MZ5 A;  4IFD G;  4G57 A;  2F0W A;  3VA7 A;  2B2T A;  3NE5 B;  1ROD A;  4IUR A;  3GP7 A;  3QIA A;  4DNT B;  5DEH A;  2PZT A;  1AZP A;  2XWJ B;  1E0B A;  1PFB A;  5KGU A;  4C3H B;  2ICI A;  1TWA B;  4OL7 A;  3D4W A;  5IOC A;  5TSS A;  1DXM A;  4ZKB B;  2M9V A;  3S1R B;  5C0X I;  5J39 A;  3LWU A;  2B2W A;  1Q3L A;  4XIG S;  1O7L A;  3S16 B;  3VYU A;  2JA5 B;  3OOC A;  1G8Z D;  3HOX B;  5EKL A;  4K14 A;  1DM0 B;  2E75 C;  1PFN A;  2EE1 A;  2TMP A;  1WTR A;  3IFD A;  3JAM E;  5IGE A;  2B2V C;  1G2S A;  4R8N A;  3GTO B;  3MXN A;  3SK4 A;  1OXS C;  2KQ3 A;  5ELC A;  4EQO A;  1LAC A;  1EZ8 A;  2NWG A;  4TRD A;  4RA8 A;  3M4Y A;  1AZQ A;  3PIO 3;  4XT1 B;  4L8J A;  5KEE A;  4JBW A;  5A35 A;  4G7Z C;  3TZD A;  4B9W A;  3PO2 B;  5CC4 A;  2KJX A;  1S5F D;  1Y1V B;  3NTH A;  3L3O C;  3V2T A;  1F77 A;  2OXP A;  2LFN A;  4KTA A;  1RF2 D;  2IWH A;  4ZK9 B;  2JE6 I;  3HOZ B;  4ZUJ A;  1SXT A;  1BF4 A;  1B4O A;  1Z47 A;  4KN7 C;  1GUW A;  2A69 C;  2I07 B;  4DXF A;  1G29 1;  3S17 B;  3Q23 A;  1M8A A;  1FD7 D;  1EY0 A;  1KDC A;  1STB A;  2E74 C;  1BXT A;  2MGS A;  1TR5 A;  2BOS A;  4K5W A;  4C3I G;  1ONL A;  1A2T A;  5C6A A;  1JWS D;  5LHY 1;  4U67 3;  4QUF A;  3F2U A;  1A6X A;  3AMU A;  3PUW A;  2M00 A;  5JEA G;  1PZK D;  2KHS A;  2NVY B;  2JA6 B;  2XSC A;  5EBD A;  4RCO A;  4KV6 A;  2N88 A;  2EY2 A;  2D62 A;  1EEF D;  4HCS A;  5IGF A;  1O78 A;  2LKV A;  5AFW A;  1Y1W B;  5CV9 A;  5A2Q E;  2MJ8 A;  4IFD H;  4UAI A;  4C2M B;  1WVL A;  4LJZ C;  2Q8T A;  1BCP C;  1CK1 A;  4DAV A;  4HMJ A;  3H3V C;  2KOL A;  3CRL C;  4C1N I;  4BWG B;  2DNC A;  4XQN A;  2G9H D;  4M1U B;  5ELB A;  2B2V A;  5C3X A;  1SYF A;  5C4J B;  4X3K A;  1YNN D;  3U9O A;  1TWG B;  4P2C B;  4ME5 A;  5IGD A;  4PV1 C;  1BOS A;  4RGN A;  2EYM A;  1ZXT A;  3FMC A;  4FXK C;  3WOE A;  1EQV A;  3O13 A;  4MN3 A;  1STA A;  4KJO A;  2NYZ D;  4R8I A;  3SR1 A;  3MTS A;  2FFK B;  3MXP A;  2K7V A;  2L1B A;  2E2J B;  5ISR A;  3J80 E;  2A73 B;  5G3L F;  4M8A A;  1ILP A;  2IX0 A;  1F9P A;  3VR3 A;  2PYK A;  5IGB A;  2XN9 C;  4DAY A;  1CT1 D;  5I9O A;  1SE4 A;  1EY6 A;  3NWT A;  3A55 A;  1BDO A;  1EY5 A;  3VYT A;  2HUG A;  1Q1E A;  1DCZ A;  5I2X A;  5CV7 A;  2DY7 A;  2LMC B;  4V19 0;  3OPO A;  3S1M B;  1PYW D;  5KIX A;  2TSS A;  1RD9 D;  2F3W A;  3TP7 A;  1U4M A;  3NSW A;  5ELE A;  1FNU A;  3RLF A;  4LK1 C;  1PZI D;  4J6H A;  5KYI A;  2QDB A;  1IW7 C;  1PRT C;  1TS3 A;  3BVM A;  3C1F A;  5C3E B;  3K58 A;  5CYU A;  1WTV A;  5JEA H;  1L0Y B;  3GTM B;  3SDZ A;  2NB0 A;  4BBS B;  1PTO C;  1ENA A;  4K6L A;  2FHT A;  4KKU A;  1RTO A;  3DHQ A;  1EL0 A;  1CHP D;  4IFD J;  2EOT A;  2R61 A;  3QO2 A;  5JJZ A;  2VB2 X;  2CQA A;  1HA5 A;  4HED A;  1A3U A;  3NHH A;  3D6C A;  1B2T A;  4Q5V A;  4CJ1 B;  5JOB A;  4PMW A;  3S1Q B;  3SK8 A;  4XYO A;  2NVQ B;  3D3R A;  5KRU A;  1B53 A;  4HSP A;  2IX3 A;  2PZW A;  1LT5 D;  3GO5 A;  2K1B A;  5M3F B;  4I7Z C;  5CV4 A;  1OO9 B;  1K83 B;  4IUN A;  1I3Q B;  3CRK C;  5E4W C;  2DY8 A;  1KNE A;  2EYO A;  2NVX B;  1R4P B;  2JA7 B;  4HCE A;  4NMZ A;  1LV9 A;  3E0J A;  1SNP A;  4DGZ A;  4BA1 I;  2NTT A;  2EDG A;  2L11 A;  2PZU A;  2K01 A;  4KK7 A;  3MXU A;  1V1O A;  4OO1 I;  2F0Q A;  3NQI A;  1TS4 A;  5T1G A;  1I4Q A;  3BS1 A;  3I72 A;  1LTG D;  1H9R A;  3KBX A;  4DFA A;  3E6Z X;  2D5D A;  2R92 B;  2WV6 D;  2JEA I;  3KK7 A;  1V8Q A;  1MSG A;  2J0T D;  4C3J G;  1FYC A;  2Z1C A;  2IPK D;  3H0G B;  3HOY B;  3BYY B;  3AU7 A;  1SJE D;  4OIK A;  1NCV A;  1BCP D;  1TWC B;  4PNY A;  2BDO A;  2X69 A;  3ZYY X;  2ZXP A;  3PUY A;  1SDF A;  1PRT B;  5D3I B;  2FJ2 A;  3BYT B;  3VR2 A;  3CHB D;  1RTN A;  1CFM A;  3NBI A;  2O5I C;  1KNA A;  1U9R A;  5JEA J;  1LO5 D;  1MGS A;  2B2W C;  1UAP A;  2MHV A;  3R93 A;  3D31 A;  4BY7 B;  2PCF B;  2KCN A;  2XVS A;  1LT3 D;  1EY4 A;  1JC7 A;  5I6W A;  4KY5 A;  2K28 A;  1KTK A;  4LAA A;  4IUU A;  3V96 A;  4H0L C;  1F2Y A;  3MC0 B;  1W6J A;  3DMU A;  5E4X A;  4BBR B;  5KNB A;  3TP5 A;  3GTP B;  4ZQ3 A;  4A3I B;  2B39 A;  3IFT A;  4K2K A;  1ZYR C;  2F3V A;  4N9T A;  1SNO A;  1Y69 U;  4KJN A;  4N9P A;  1TT2 A;  3I90 A;  1QCB D;  3W2D A;  5JVG 3;  1SEB D;  4XT3 B;  3T16 A;  3V05 A;  2F0N A;  3MAQ A;  5J22 A;  1H9M A;  2OEO A;  2NBF A;  5C4Z A;  1QNU A;  2EXZ A;  5EQ0 A;  5K36 H;  5D65 A;  4XXE A;  5DM7 3;  3T53 B;  1VMP A;  5IIF A;  3PUX A;  4A3D B;  1I4H A;  1VCI A;  2EJF C;  4HSV A;  4AYB B;  2F0S A;  1SE3 A;  2SDF A;  1AN8 A;  3I8Z A;  3HGB A;  3OMC A;  1IW7 D;  4OGQ C;  3H6M A;  5CV6 A;  1I6H B;  3BDC A;  3FDT A;  1HCZ A;  2F0H A;  2R93 B;  3H94 A;  4DXG A;  1I4G A;  1HPC A;  1PTO D;  4ID6 A;  5M9O A;  2Z4H A;  1HQM C;  4G7O C;  3K5M A;  5FO9 B;  2RSO A;  1WD0 A;  1EZ6 A;  4EQN A;  3DEO A;  4ODG A;  2NN6 H;  1Q90 A;  5JPM C;  5I9P A;  3J81 L;  3S2D B;  3RUZ A;  5C4H A;  5BN5 A;  3LNN A;  1I4R A;  2E2D C;  1B50 A;  5LL6 S;  1TQO A;  5JAV A;  1F2M A;  2HCI A;  3PIP 3;  3S15 B;  4CKC A;  4K5X A;  1STH A;  1LTI D;  4ILW A;  1ILQ A;  1PFM A;  1TWH B;  1VF7 A;  5FK9 C;  3TZU A;  4DK1 A;  1HA6 A;  3MFG A;  1TVX A;  3BDO A;  3HOU B;  4F87 A;  1XX8 A;  1SND A;  1UUP A;  4K2L A;  4BS9 A;  1YNJ C;  1WD1 A;  2K05 A;  4QB4 A;  3RZO B;  1KLG D;  2WP8 J;  3NXW A;  4IFD I;  5NUC A;  5HUR A;  3GQB A;  2A68 C;  4IAL A;  3EVQ A;  3K5L A;  2HDL A;  4MHE A;  2WIN B;  3QB3 A;  3Q22 A;  3VR6 A;  1I4P A;  1WTO A;  3T51 B;  1K8M A;  1SNM A;  2F0P A;  4A3E B;  3FVQ A;  2D9U A;  2H4O A;  4I65 A;  3L7Z C;  2F0G A;  2WB1 B;  1V43 A;  3KBG A;  2KED A;  1EOT A;  3VR4 A;  3FKI B;  1DOM A;  1EIH A;  2WII B;  1C8C A;  1ZEQ X;  3TDQ A;  1LTR D;  3MHB A;  5DAU A;  4PMB A;  1STY A;  4Z9C B;  4RGT A;  4G4K A;  3HOW B;  4EVO A;  4H44 C;  3NTK A;  3RZD B;  1AP0 A;  1LT4 D;  3WDN A;  3WOF A;  1NSN S;  1CQV A;  1LAB A;  4U68 A;  1IKL A;  1A2U A;  2B2Y C;  5COR A;  2B2U C;  1TY0 A;  1ICW A;  2SOB A;  3A8J E;  2MPM A;  1VDZ A;  4G7H C;  2BE5 C;  1CA6 A;  4CBV A;  3EA6 A;  3KLS X;  4A3F B;  1SMY C;  1SYB A;  2R3Z A;  1ZYR D;  3GTQ B;  4FF3 A;  1CM9 A;  3N6R A;  4IUP A;  4XTC S;  1AFP A;  1II3 A;  4A3M B;  1NR2 A;  1I50 B;  1HFN A;  3HG9 A;  2F0F A;  3SE0 A;  4L6T B;  1EY9 A;  5E1F A;  5ELD A;  2XWB B;  3P75 A;  4OHJ A;  1TWF B;  5KNC A;  2F0V A;  1EIG A;  5I6Y A;  1JOO A;  4KHZ A;  1DOK A;  2O5J C;  4KHV A;  3R8B A;  2HDM A;  5KYL A;  4A3J B;  4CHT B;  3IL8 A;  3C46 A;  4C56 C;  3J7A V;  2RQX A;  4RHR A;  3Q24 A;  3OHX C;  1I4X A;  2N55 A;  3OSO A;  2CW0 C;  3HZX A;  2F0K A;  3PMF A;  3GV6 A;  2R6G A;  4YIJ A;  1FNW A;  1DJR D;  4MIU A;  2KA7 A;  1HTP A;  2B63 B;  2IL8 A;  4TQU S;  4C3I B;  5K5P A;  3K59 A;  5EKI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...