3STBD

A complex of two editosome proteins and two nanobodies
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
113
structure length
108
Chain Sequence
KSVNSVTLVGVVHDIQSGFVYEDAVTQFTLTTTSIDTTVVVEKDHHTIRCFGELFSAEVKQKVKEGNVVCVNGRLRLSPQLEPSCNKHFYFPYIQVQPPHGQVAVIHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/immune system
molecule keywords single domain antibody VHH
publication title Crystal structure of a heterodimer of editosome interaction proteins in complex with two copies of a cross-reacting nanobody.
pubmed doi rcsb
source organism Lama glama
total genus 18
structure length 108
sequence length 113
ec nomenclature
pdb deposition date 2011-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3stbD00
3HFZB 3FKIH 4NXML 3I4OA 3PIPA 3ULPA 2ASBA 5IYBH 1HNWL 4IJHA 3NELA 1VQHA 1N9WA 1X9NA 2LXJA 2YTYA 4B3SQ 5IY0A 4IFDJ 4DUYQ 3T1YL 2PI2E 2IX1A 2DGYA 1XNRQ 2R6GA 2JA8G 4LWCA 3VDYA 1I5FA 2Q2HA 5C44H 2WAQG 2KCMA 3L0OA 3KF6B 2NVTH 4KHPQ 1OXUA 4HJ7A 1KC8C 5GQOA 1SMXA 4GLXA 4MNOA 4OWTB 5M5XH 1S72A 4DV4L 4A3JH 4B3SL 4QGUA 4DK3C 5K36G 1Z9FA 1KAWA 4DUYL 5LMNL 1HH2P 3AYHB 1BBUA 2JA5G 4JI0Q 1E1TA 4DV5Q 5IYCG 1XNRL 1MJCA 4JI6Q 2K50A 1VQNA 4DR7Q 1FGUA 4PZ6A 4LF4L 2IHFA 4KHPL 4APVA 4DV6L 3F1ZA 4BBRG 1V43A 2NVQH 4LF7Q 1BVSA 1Y1WH 2Q2IA 4QL5A 4JI0L 4DV5L 2WAQE 4DR7L 4JI6L 3OTOQ 1VQ9A 3H3VI 4BA1I 1V1QA 1RL2A 4IPHA 4QY7A 3ULLA 1SR3A 4DUZQ 3G6EA 2Q2UA 5AJ3Q 3S2HH 4K0KQ 4A76A 1VCIA 2HIXA 5IP9H 1KD1C 4DR4L 1KHIA 3BU2A 2JJQA 2IHEA 3G48A 5J3BA 4LFCQ 1TWAH 3CMEA 4JI8Q 2GVAA 1U0LA 5GROA 2I5HA 1N8RC 4GOPC 3OTOL 3A74A 4TVAB 1ASYA 2R7ZG 3I2ZA 1K83H 4JBJA 1JJCB 1EQQA 1OTCA 3D31A 4GKJL 4K0KL 1WYDA 1EIYB 1A8VA 1X3FA 4GN3B 1E1OA 1VQIA 3NENA 3A0JA 4RMFA 5FJ8G 1MIUA 3CCQA 3PO2G 2MO1A 2UXDQ 4LFBQ 4JI8L 1QUQA 3IRBA 1I3QH 1NMGA 5M5WH 4A3LG 4A3EG 1J5EL 4BY7G 1HZ9A 3OYYA 4NPSA 5HGQA 1EOVA 3JC66 1XPUA 2PNHA 4L5TA 4A75A 2KCTA 4DK6C 1RIPA 1N33Q 1YHBA 2ALYB 1UE6A 3U50C 3ZJYC 4DR5L 5C0XJ 4TQUS 4JI4L 3GTMH 4YWLA 1IXRA 1CSQA 5E7NA 3ULJA 3I4MH 4BBSH 1LM0A 3PF5A 1KL9A 1W2BA 2JE6I 1K8GA 3CW2C 1SROA 4P75A 4R4OA 4IOCA 3S24A 2MNAA 2F4VQ 3AQQA 2YU9H 3KF6A 2BA0A 1CKNB 2HHHQ 3HOYH 3PGZA 1HR0W 4IPDA 4LFAQ 2R92H 3ICEA 1X65A 3D0FA 3GD7A 3PUXA 3TQYA 3UDFA 3S1RH 4BY1H 2A8VA 3BZKA 1JT8A 2VQEQ 2JA6H 4OWWB 1PH4A 3CPWA 2NVYH 4X65Q 4A3MG 1XNQQ 5C4XG 3HKSA 2CFMA 2HHHL 2UXBQ 3GTOH 4YCUA 1VQ8A 3L2PA 2JEAI 4A93H 4LUOA 1N34L 5LMUQ 3GTKH 3PV0A 3CC4A 5BR8L 2ES2A 4HIDA 2NVXH 4DR6Q 5GAHC 4LF5Q 4GLAC 1R9TH 2L15A 4X65L 2ZJQA 1E7ZA 1Y14B 2JA7H 1VQJA 4GOPB 2UXBL 3AFPA 4KI0A 1C7YA 1EUJA 4LW1A 1VQAA 1HR0Q 4POGA 1D8LA 4P71A 1C9OA 2Z6KC 4RG1A 2VUMH 1YJNA 5IT9c 1VQFA 2UXCQ 2C35B 4A3BH 1VQ4A 3ER0A 3UE0A 1Y1VG 2UUCQ 5ELNA 1VQBA 1PYBA 1WI5A 2IT1A 3W1BA 1VQMA 2JA8H 1BBWA 3HOXG 1K9MC 3MXNB 2MQHA 4DR1Q 1AE2A 3K81C 5IWAQ 2VW9A 1SFOH 4EX5A 3EIVA 1K0RA 2UUCL 4A3FH 2RCNA 5IE8A 1PFSA 1S3OA 4DV1L 2A1AA 4BXXH 1YITA 4B3RQ 2JA5H 1QVCA 4AYBG 4Y7NH 1YZ6A 1UWVA 3RZDH 3BZCA 5EAYA 4JV5L 3RN2A 4UP9A 4B3TQ 2OQ0A 2KHJA 5M5YH 4DR2Q 3GTQH 3S1QH 2K4KA 1TXYA 2CWPA 1X55A 2E5LQ 2B63H 1A0IA 2AWOA 2CWAA 1CKNA 3RN5A 1K3RA 2BA1A 1KRTA 4OX9Q 2HIVA 3HOVG 1KQSA 3CC2A 1JE5A 2N78A 1XJVA 2E2HH 4UP8A 1B7YB 1UE1A 5JEAG 4JI5Q 4IFDI 5M3FG 4B3TL 2VQFQ 4DR2L 4AQYQ 2NN6G 1C0AA 2Y0SG 4O0AA 4DV7Q 4PZ7A 1XMQQ 1YEZA 3FHWA 3KJOA 5IP7G 3LGJA 5FLMG 5FLXc 2D0OA 4A3IG 1VQ5A 1TWFH 4A3CG 4AYBE 4DKAC 2EXDA 1YJ9A 4DV2Q 1HNZQ 2R7ZH 3TREA 3STBD 4JI5L 1L0WA 4HIMA 1Q82C 2K5NA 3FKIG 2NN6I 1E3PA 1NBWA 3J81j 3K8AA 1Q86C 4DV7L 1PH1A 2AKWB 2VZAA 4DV3Q 4GOPA 4KLKA 3SGIA 2AHOB 3KLWA 4A3GH 2UUBQ 4LF7L 1LTLA 4PZ8A 4DV2L 1HNZL 4LF8Q 1ASZA 1YJWA 1CKMA 1E22A 2JQOA 1KRSA 3S15H 2WP8J 4DUZL 2JK8A 4FDBA 2R7DA 2V1CC 3E9HA 4DR3Q 5AJ3L 4QQBX 3CAMA 2IY5B 5JJKA 1WFQA 1PH5A 2R7FA 1XPRA 1YNXA 2AMCB 3PUWA 3A5ZB 4QIWE 4LFCL 4AH6A 4YY3Q 1QVGA 3HKZG 4LF8L 1FJGQ 2HT1A 3HOWH 4JI3Q 1CUKA 1G291 4KHZA 1JJ2A 5GAEC 3GTGH 1OXSC 1FL0A 1NTGA 1K8AC 1V9PA 3B6YA 3HOUH 1YBYA 2ZJPA 1IL2A 3GTPH 4HJAA 1XMOQ 2ZJRA 2E8GA 2EQSA 1GD7A 3E0EA 2OQKA 3CPFA 3U4VA 4X64Q 2UXDL 4LFBL 4YY3L 1Y1WG 3BJUA 3KJPA 1XTDA 2UUAQ 4JI3L 3U58A 4R4TA 4UY8C 4P73A 3PO3G 3I4NH 4PG3A 4X6AH 3T1HQ 4A3MH 5C0XG 1N32Q 1WCMH 1WJJA 1X56A 2R93H 1L1OC 4JI2Q 1HZAA 5IP9G 1FVIA 2FXQA 4NXNQ 3CC7A 2EIFA 2ZTDA 4X64L 3H15A 4HJ9A 4A4IA 3CF5A 1K73C 1M1KC 4B3MQ 3M3YH 1N33L 1PV4A 2BH8A 2QA4A 1UE7A 1SRUA 3Q8DA 3T1HL 4L5QA 1U5KA 5C0XI 1N32L 2ZTCA 2K5VA 4PMWA 2F4VL 3KF8B 5JJIA 2CQOA 2NZHA 2QGQA 3M9BA 4R1JA 4B3ML 1AE3A 4A3KH 4LFAL 2YTXA 3TEHB 5HY6A 4A3DG 3TRZA 1NMFA 3H0GH 4JBMA 1I50H 2VQEL 1YIJA 3S1MH 2WFWA 3GO5A 1CSPA 2ZM6Q 1HZBA 1XNQL 1HZCA 4GKKQ 5C3EH 2Z6KA 4MZ9A 3K80C 3NEMA 3CCJA 1VS0A 3OW2A 5LMUL 4C2MH 1TWHH 1EFWA 1YHAA 3EBEA 3UDXA 3HOXH 2I0QA 4BBSG 3I4MG 4DR6L 4EQ5A 2IX0A 2JA9A 4LF5L 2ZM6L 2NZOA 4JBKA 4X62Q 1Q81C 2MO0A 1AH9A 1VQ7A 2I5MX 1M90C 1G6PA 3TS0A 3PUYA 3M4QA 4POFA 1GM5A 1B70B 4JI1Q 1DGSA 4R4IA 1HR0L 1H95A 1TWCH 2JA6G 4DV0Q 1X6OA 2UXCL 2N8NA 1KXLA 4XTCS 1A62A 2N49A 1IBMQ 4L5RC 5JJLA 4X62L 2PQAB 1VQLA 4GNXC 1T9HA 2BH2A 4A93G 3A5UA 4YWMA 1X54A 4JI1L 3RLOA 5LMNW 1L1OB 1OXXK 1UE5A 1N36Q 4WJ4A 1HNXQ 1VQOA 1EYGA 2UU9Q 1Z47A 2YTVA 4O2DA 1QVFA 4IPCA 4MTNA 5IYCH 3CCSA 4OWXB 2K5HA 3J80c 5M3FH 1JJGA 2VS1A 4DR1L 4NXMQ 3CCRA 4IFDG 4HJ8A 1JMCA 2JA7G 5IWAL 1HNWQ 5GADC 2D0PA 4OXPA 2OTLA 4BBRH 1YVCA 4A3IH 4A3CH 3CCLA 1N36L 1VQKA 3T1YQ 3F2CA 4B3RL 1J6QA 1PH3A 1SLJA 3M7NA 4A3BG 3CQZH 3CMAA 3RNUA 4LUZA 1IBLQ 3STBC 3HOZH 5M3MG 1D7QA 2B3GA 3TS2A 3K7UC 3MEFA 3J7ZC 1PA6A 3S1NH 3J81c 4OO1G 2N3SA 4JI7Q 4JOIC 3I7FA 3GTJH 2E5LL 4DV4Q 2VL6A 3CCVA 2D62A 2Z0SA 5LMNQ 3CCEA 4OX9L 3L7ZC 3CP0A 4UPAA 5DLQE 4X66Q 2QEXA 1VQGA 4LF9Q 3K7AH 4LF4Q 4DAYB 1PH8A 4H02A 3PCOB 1IBLL 2RHSB 4QJFA 4L5SA 3J80i 3I55A 3G71A 2VNUD 5C4JH 4DV6Q 3KDFB 2VQFL 2CCZA 4AQYL 5ELOA 5FJ8H 4A3FG 4JI7L 3PO2H 5JEAJ 4HIKA 3U4ZA 1XMQL 2K75A 5IYBG 3G4SA 4DNIA 4BXXG 3FP9A 2I5LX 3KOJA 1VQDA 3PSIA 3PIOA 2PMZE 3PF4A 4X66L 4LF9L 4A3LH 1Q8KA 4A3EH 1VQEA 1OXVA 4GN4B 1XPOA 4BY7H 4OO1I 1E24A 5C44G 4DR4Q 2Y0SE 4LUVA 3KFUA 4YHHQ 1Q7YC 1Q12A 2B63G 4DV3L 3CD6A 3J81i 2KENA 1YHQA 3J7A5 1NE3A 2GVBA 3S2DH 4A3JG 2KHIA 1VQCA 4GNXB 2UUBL 3PO3H 3S14H 4C3HH 3HOZG 4JBWA 2OWOA 1YI2A 4GKJQ 4P72A 2XTIA 4JG2A 3RLNA 4DAMA 1UEBA 4YWKA 2MFIA 1PHJA 4YHHL 2Q2TA 2YYZA 4DR3L 1IYJB 2PQAA 2VY3A 3KYHC 1GO3E 1IBKQ 4UP7A 3S16H 3NBHB 3M4OH 1CKOA 3E9IA 4Y52H 1L1OA 4R4CA 1FJGL 3PUZA 1QZGA 1P16A 1W3SA 1J5EQ 3K0XA 2K52A 2H5XA 1S40A 1LYLA 4JYAQ 5C4XH 1EWIA 1MKHA 1IBKL 4LF6Q 1XMOL 4JI4Q 2A19A 4DR5Q 4BA2I 4A3GG 3HKZE 4A3DH 2F52A 4HJ5A 1NY4A 4P74A 2UUAL 3I56A 2GN5A 5GAGC 3F2DA 2HQLA 1PYSB 3AFQA 4DPGA 2WB1G 3UDGA 3DM3A 4JYAL 1GVPA 1WOCA 4AIMA 4JI2L 2LXKA 5IYDG 4LF6L 4NXNL 3M4PA 4GLVB 2F3IA 3AEVA 3RZOH 2LSSA 3HOWG 3CCMA 3DLLA 5H1SE 4C3JH 4GS3A 1PVOA 2CKZB 3UE1A 1KIXA 2JEBI 1SE8A 3HOUG 3RLFA 1Y1VH 1PH9A 1TWGH 4YCWA 1O7IA 3CCUA 3KDFA 1N34Q 3GDEA 1HJPA 4YCVA 5BR8Q 3CXCA 4LNQA 2OTJA 2YV5A 3PUVA 2ID0A 2WB1E 3I4NG 1PH2A 4NB3A 1WCMG 1X3EA 1PH7A 2R93G 1X3GA 5IYDH 3M85A 1B8AA 4ALPA 3EN2A 4R4QA 3WWVA 3JAMc 4GKKL 3HOYG 1JB7A 1G51A 4IOAA 1IZ6A 2E2JH 1SN8A 2RHQB 1Q46A 2R92G 1I6HH 3W1GA 4BY1G 4XIGS 4GNXA 1GKHA 3S17H 1MJEA 2OCEA 4J15A 3W5OA 1L2FA 1VQPA 1VQ6A 1NJIC 1LUZA 3UDIA 4IPGA 4C3IH 1P8LA 2K14A 3ERSX 4OONA 4IJLA 2RF4A 1I94Q 1OXTA 4ME3A 4A3KG 2E2IH 2XGTA 4GN5A 3HOVH 3H0GG 1Q1BA 3GTLH 1EIFA 2ZTEA 4JCVE 4DV0L 1QZHA 5M3MH 2ATWA 3H3VH 2AWNA 3RR5A 1IBML 5C3EG 4DV1Q 2DUDA 1A63A 5IP7H 5FLMH 1I94L 3JAMi 1Q1EA 1BKBA 1QUQB 3F8TA 4JC0A 4HIOA 2PI2A 4WJ3M 2KBNA 1EQRA 2B29A 1HNXL 4IO9A 2UU9L 1PH6A 2VUMG 4JOIA 4JV5Q 3F2BA
chains in the Genus database with same CATH superfamily
3HFZB 1ZYRC 3I4OA 3PIPA 4IUPA 3ULPA 1HNWL 1X9NA 5C4HA 1STGA 2YTYA 3S15B 1YNJD 4K6DA 2PI2E 2IX1A 1XNRQ 2R6GA 2PO4A 2JA8G 1LV9A 1I4PA 3KF6B 1DM0B 3HOWB 2IWHA 2ZXRA 1SMXA 1MD2D 1S72A 4DV4L 4A3JH 1Z9FA 1HH2P 3AYHB 2JA5G 1E1TA 4DV5Q 2K50A 3JAML 1Y8OB 4KHPL 5JOBA 1V43A 1A15A 2NVQH 1BVSA 1Y1WH 1WCMB 4QL5A 4JI0L 2WAQE 1R4PB 3E6ZX 4UDUC 4BA1I 4DUZQ 1ENCA 1RL2A 3ULLA 5C0XH 2KHSA 3G6EA 1TS3A 1LLRD 4A76A 1VCIA 4CDDC 3G48A 4JI8Q 2J4XA 3KLSX 5GROA 1ASYA 3OTOL 3I2ZA 2EOTA 1OTCA 4GKJL 2N88A 4K0KL 1G91A 4A3KB 3BVMA 1A8VA 5IYDH 1SDFA 3PO2G 2PZUA 4IOAA 2L1BA 1NR2A 2OEOA 5M5WH 4BY7G 1EWCA 4K5XA 4NW2A 4C2MB 4A75A 2KCTA 1AW7A 3CHBD 4DK6C 2BDOA 3ZJYC 5C0XJ 4TQUS 4J8QA 4RKLA 3ULJA 1B53A 4ZK9B 3OPOA 1NUCA 2DNEA 4O1NA 4JPBW 3KF6A 3ZYYX 1CKNB 3Q22A 4LFAQ 3ICEA 3GD7A 1VDZA 5ELDA 2WAQB 4BY1H 1PH4A 1O80A 3CPWA 3K5NA 2PNRC 3SHLA 2FMMA 1U4LA 5T1GA 4U673 2CHBD 3URYA 3QJYA 3G7LA 3QOLA 3BDOA 4HIDA 2NVXH 4DR6Q 1WVLA 4KKUA 3I70A 4BBRB 1EY8A 3HEJA 4GLAC 2RKSA 1QNUA 2UXBL 2EYPA 3TDQA 2QDBA 2MHVA 4G4KA 1PLFA 2VUMH 2C35B 4A3BH 1VQ4A 3L9AX 5CC4A 1PDQA 1NNXA 5ELNA 4RHSA 1IL8A 4CDEC 3W1BA 2K01A 3QB3A 5CMDA 2KEEA 5C4JB 4ZUIA 5CORA 1YNJC 3HOXG 1F2LA 3MXNB 3QIAA 4QUFA 2MQHA 1C8CA 1LTGD 3K81C 5IGBA 2J0TD 4EX5A 1K0RA 2UUCL 5IE8A 3HGBA 4BXXH 4AYBG 4Y7NH 2CVRA 3P20A 4KY6A 4JV5L 2OQ0A 2KHJA 5JAVA 4DR2Q 3J7AF 3S1QH 1C48A 3S2DB 3FPUB 4KD4A 5KYIA 2E5LQ 2B63H 1A0IA 4K8IA 1CZWA 1CKNA 1K3RA 3R8BA 3HOVG 2C5CA 1KQSA 1XJVA 1QE6A 4UP8A 1B7YB 5JEAG 4JI5Q 2XNAC 5G3LF 4B3TL 1GUTA 4XDXA 1KABA 4O0AA 1F9RA 1YEZA 3KJOA 2L5TA 3NUCA 4JVZA 3LWEA 2K32A 1TWFH 3VR2A 4FXGC 3R2TA 1DXMA 3STBD 3TP7A 1EZ8A 1L0WA 3JAME 4X3UA 4HIMA 3J81j 4A3DB 1DD2A 2AKWB 3FRPB 2F0KA 1IYUA 2UUBQ 3A8KE 1ASZA 4EGVA 1JWUD 2WP8J 4DUZL 1Q90A 3N52A 4FDBA 2R7DA 3CAMA 1O7LA 2B2UC 2R7FA 4YY3Q 4AH6A 2CW0D 4WJWA 5LL6S 2B2TA 5FO9B 1CUKA 4KHZA 1TWGB 2A68D 3GTGH 1FL0A 3X3MA 3MXNA 1V9PA 3B6YA 2ZJPA 1IL2A 3GTPH 2A69D 1XMOQ 2AUKA 2HDMA 2EQSA 2OQKA 3CPFA 1R4QB 3NE5B 4MIUA 4WORA 4KY5A 2UUAQ 2KEDA 3U58A 4R4TA 2B2WC 2K33A 3PO3G 4X6AH 4C3HG 3D4RA 1X56A 2R93H 2E2JB 1HZAA 3TZUA 3H15A 4HJ9A 4A4IA 1M1KC 3M3YH 1EZ6A 2JA7B 4RFBA 2BH8A 4K5WA 3Q8DA 3J81L 1LACA 1U5KA 5IODA 3BZDB 3T4AC 5I6YA 3K5LA 1SNPA 1B4OA 1ICFB 1AE3A 4LFAL 1V1OA 3TEHB 5M3MB 1AP0A 3H0GH 1WTOA 3I8ZA 3OWEB 5FLXE 2XRQD 5C3EH 2OF1A 5DEHA 2SNSA 3NEMA 1EFWA 4LK1C 3NQTA 3OW2A 2I0QA 3EBEA 3FKIB 4DR6L 3S9WA 2JA9A 2F03A 1E2WA 2ZM6L 3C1FA 1X3PA 3PQIA 4X62Q 1K28A 1GUOA 1XYIA 1NR4A 2J7ZA 2OT2A 4JI1Q 5D3IB 2B2VC 4HR7B 1TWCH 2NVTB 1BR9A 1U4MA 3P75A 2PQAB 1DYQA 2E74C 1EEFD 4GNXC 4HAEA 1X54A 5HURA 1UE5A 3EQLC 3HZXA 4WJ4A 1LT3D 1HPCA 4F88A 1Z47A 1FGBD 2YTVA 4O2DA 3ND8A 4OWXB 5M3FH 5GADC 2D0PA 4OXPA 2OTLA 4A3IH 4R9WA 4A3CH 1N36L 2F0GA 1PH3A 3MHBA 3QWNA 2WKCA 3STBC 4JI7Q 2E5LL 2JP1A 1H9KA 2Z0SA 1LTBD 2MPMA 3CP0A 2EJMA 1HTPA 5HGTA 5C3WA 1BF4A 1WD1A 4DV6Q 2CCZA 3KDFB 3T56B 5ELOA 3PO2H 2RSNA 3PSIA 1VQDA 2WACA 3PIOA 4KJOA 2CW0C 4BY7H 2A68C 1TIID 4BBSB 3U9OA 2A69C 3DMUA 4A3JG 4GNXB 2UUBL 3OIPA 2YU9B 3HOYB 4DAMA 2XTIA 4JG2A 3RLNA 1LTTD 2PQAA 3S1RB 2B2WA 1SYFA 3S16H 3I72A 1RKNA 2K04A 3NP8A 1CKOA 1UUPA 4Y52H 2NBFA 5KIXA 5CV6A 3PUZA 1EY6A 1P16A 2FJ2A 1ILPA 1J5EQ 3UI2A 4A93B 3D6WA 1IKLA 1LYLA 3ND9A 3GV6A 4ABNA 1BO0A 1MKHA 1IBKL 1XMOL 1RJTA 3C1EA 3J80E 4P74A 2UUAL 2B8GA 3Q6SA 5GAGC 1PTOH 1QG7A 2EYLA 2HQLA 3NWTA 3F2DA 3CKIB 3UDGA 4JYAL 3TSSA 3VR3A 3F2UA 4FF3A 5IYDG 5EJWA 4N8FA 1CHQD 1PTOF 5EPLA 2KECA 2WIIB 4HMIA 3HOWG 3CCMA 4C3JH 2L0CA 3SVMA 3J81E 1XWEA 3NTIA 3RLFA 5I9OA 1PH9A 5JPNC 3DWPA 3KDFA 1WTPA 4KJNA 1N34Q 3RUZA 4YCVA 5BR8Q 4H0LC 3I4NG 3PIP3 4G7ZC 1PH2A 4NB3A 1WCMG 1X3GA 4DXGA 1HFNA 1B8AA 2B2VA 3EN2A 1H9MA 1PRTD 1FNUA 1Q46A 1TT2A 4C1NI 3W1GA 4BY1G 1EYDA 1SNOA 4GNXA 2RBMA 1MJEA 4J15A 1GJXA 1CTMA 5KEEA 2K14A 5COYA 4OONA 3TP5A 3NSWA 4A3KG 2E2IH 1DOMA 1I4QA 2WV6D 1EQVA 3HOVH 1Q1BA 3GTLH 1EIFA 1BCPF 5JEAH 1EU3A 1QZHA 3H3VH 2IL8A 1BNZA 3RR5A 3I3CA 3A7LA 4KY7A 3SK4A 1HXYD 2R7ZB 1A63A 4O42A 1Q1EA 3MXGA 1EQRA 2B29A 3DUZA 5BN5A 4IO9A 1PH6A 2VUMG 1A2UA 3F2BA 1LTAD 4DF7A 4CDFC 3MFGA 1SEBD 1LTID 1N9WA 2LXJA 5IY0A 1QILA 1VMCA 3M4YA 1F9SA 1NCVA 2DGYA 1I5FA 1C4QA 2KCMA 2WAQG 1EQTA 3L0OA 4KHPQ 2EY2A 1KC8C 1FD7D 5LL6X 5GQOA 4GLXA 4OWTB 4S3SA 5K36G 3HOUB 1BBUA 4JI0Q 3FVQA 5IYCG 2MUYA 2RDGA 2IHFA 4DV6L 4BBRG 2F0SA 4C56C 2F1MA 4A3MB 2DY7A 1GOZA 3OTOQ 4JI6L 3C46A 1DONA 2LY7A 4K0KQ 1KD1C 1HUMA 5KNBA 3BU2A 2JJQA 5J3BA 2NTTA 3FPPA 3OIQA 3TP8A 1ML0D 1N8RC 4TVAB 4ZUJA 1RD9D 1K83H 4JBJA 4DK0A 1EIYB 2F0HA 4GN3B 4QUCA 1E1OA 3NENA 5FJ8G 2UXDQ 4RMFA 3CCQA 4LFBQ 4K6LA 3T13A 3I91A 3IRBA 1LO5D 1I3QH 1AZQA 1H9SB 1J5EL 4FXDA 4KTAA 1TWHB 1EL0A 4L5TA 1N33Q 3GTMH 3U50C 4DA2A 1V1PA 4RCNA 2FFKB 1JOQA 4OELB 4V190 1K8GA 4IOCA 5E4XA 3S24A 2F4VQ 4L8JA 4WRDA 2BA0A 3PGZA 4XT1B 1HR0W 3D4WA 5IGDA 3KBXA 3PUXA 2F0PA 3UDFA 1JT8A 3IFDA 4ULLA 4OWWB 1PRTC 2NVYH 1M4VA 2UXBQ 5KGUA 4YCUA 1VQ8A 3BDLA 1G2SA 1N34L 3OMGA 3GTKH 3OSOA 3PV0A 1B9NA 5BR8L 3CC4A 3Q0AA 4RAUC 1R9TH 2ZJQA 1D5XC 2BDNA 4XYOA 3H6MA 1VQJA 1CT1D 4QIWB 1C7YA 4IUNA 2LKVA 1HR0Q 3HOZB 4POGA 1D8LA 5I4DA 5IGCA 1C9OA 4RG1A 1S5BD 3BYTB 3VYUA 5IT9c 1VQFA 1K0SA 1EY7A 3GTJB 1HA6A 3UE0A 1MSGA 1Y8NB 4MN3A 5C5MA 2HDLA 2NYZD 1SSOA 2UUCQ 5CV5A 3Q24A 1AEXA 1VQBA 3AMUA 1A3VA 2K05A 1TU2B 1E0BA 1LABA 1CFMA 3ITPA 1M8AA 2NB0A 2VW9A 1SFOH 1SJED 1H9RA 3EIVA 1CA5A 2A1AA 4QB4A 4CJ1B 3BYYB 3J7AV 5JVG3 5L37A 1Q8IA 2DNCA 5EKKA 3BZCA 5JVH3 4B3TQ 1PRTB 3OHXC 2E2DC 3GTQH 2K4KA 1TXYA 1G8ZD 3OOCA 4C1NK 3RN5A 4QMGA 1KRTA 5ELCA 4OX9Q 3DHQA 4CBVA 2HD3A 2E2HH 1UE1A 1PZKD 4IFDI 1SE4A 5M3FG 2EXZA 1EY9A 4I7AA 2VQFQ 3M4OB 2NN6G 5A35A 4PZ7A 3FHWA 5IP7G 5FLMG 4TSSA 1VQ5A 4A3IG 4A3CG 1F9PA 2IPKD 3TMEA 3D8GA 2C9OA 2RSOA 5C4XB 1B50A 3FKIG 2NN6I 3K8AA 4DV7L 2VZAA 4KLKA 3KLWA 4NMZA 2HQEA 1B3AA 3S15H 3QR8A 3RZOB 4V0BA 2AQ3B 4DR3Q 2IY5B 4QQBX 5JJKA 1WFQA 1W6KA 2B2YC 3PUWA 4LF8L 1TR5A 3HOWH 1TQOA 2H1EA 1D1KA 1JR0D 4TRDA 5GAEC 1OXSC 4NKLA 3R3OA 1NTGA 1K8AC 1D2BA 1ZXTA 1YBYA 2B2TC 4EQPA 1GD7A 2UXDL 3U4VA 1STEA 4LFBL 3BJUA 1ONLA 3KJPA 1EY5A 4JI3L 4UY8C 4P73A 3I4NH 1WCMH 1I6HB 2EIFA 2ZTDA 4PMBA 4X64L 2FHTA 4U68A 1N33L 3EFXD 1VMPA 4C3IB 2CH4W 5J1ZA 4L5QA 5FLXL 3K0YA 1BUVT 2F4VL 4IURA 2CQOA 2NZHA 2QGQA 4DFAA 4R1JA 4B3ML 1DJRD 4A3KH 1MSHA 2IJ0A 3IFTA 1KNAA 1CK1A 4JBMA 3VYRA 4CKBA 2ZM6Q 2JN4A 1HZCA 2K6AA 4Z9CB 2D5DA 1MHWC 3NWSA 1SAPA 3K80C 3MTSA 4FVMA 4Q5VA 4XQQA 4C2MH 2O4XA 3UDXA 4BBSG 4C3JG 4OGQC 3VA5A 2NZOA 4JBKA 2MO0A 1AH9A 2I5MX 4MTKA 3PUYA 1GM5A 5C44B 3A55A 4R4IA 1HR0L 3DXJC 5BN4A 5JJLA 5M5XB 4L5RC 5IGEA 5EBDA 4CKCA 2MJ8A 4A93G 1F2ZA 5LMNW 1ILQA 1N36Q 5K36H 1O7ZA 1HNXQ 1EYGA 1DOLA 4OEMB 1QVFA 3V05A 5IYCH 3CCSA 2VS1A 3NXWA 4M1UB 4NXMQ 4DGZA 1TKWB 5CV4A 2HUGA 1XX8A 2SOBA 3EJIA 1ET9A 3MWYW 4BBRH 3CCLA 2X69A 3S2HB 2SDFA 2QW7A 1D7QA 2P5ZX 1TWAB 3TS2A 2OXPA 3MEFA 1PA6A 4JOIC 3I7FA 5ELFA 2DY8A 2D62A 3CCVA 5LMNQ 1QNKA 2PW7A 4OX9L 5DLQE 1CZGA 4K5VA 1STNA 2QEXA 1VQGA 4YIJA 4X3SA 4DAYB 4QJFA 2EY5A 3I55A 3G71A 2VNUD 5C4JH 2F0IA 1KDBA 2VQFL 5FJ8H 5I2XA 3U4ZA 2A73B 3PF4A 2K03A 3SE0A 1QWYA 4LF9L 1OXVA 1VQEA 4GN4B 2B2YA 4DR4Q 4LUVA 3KFUA 2EYMA 1Q12A 5A2QL 4GZYC 1MBYA 1MI2A 1PZJD 4R8NA 3I4MB 5DNFA 1YHQA 3S2DH 4JBWA 5JPMC 2F4IA 4YWKA 2XSCA 2R92B 4DR3L 1LT6D 2VY3A 1IBKQ 4UP7A 2JA6B 3O13A 1S5ED 3E9IA 3J80L 1G6ZA 2PCFB 5ISRA 1W3SA 3GTOB 3K0XA 4RCOA 2I46A 4OIJA 1S40A 3E5SA 2XWBB 4JYAQ 3FDTA 1SNDA 4DR5Q 3MEHA 4A3DH 4HJ5A 4IUTA 4CJ2C 1EIHA 1CHPD 1LTRD 1GVPA 1WOCA 4LF6L 2EYHA 2F3IA 1DZ1A 5H1SE 2N55A 3HP3A 2CKZB 3X3NA 3UE1A 1KIXA 1ESRA 3HOUG 1SE8A 1IHZA 1PFNA 4DAYA 1JOKA 1TWGH 4FO2A 4YCWA 1IKMA 3CCUA 2JA8B 1EY4A 5EKLA 4IN3A 4LNQA 2OTJA 2ID0A 2WB1E 3TBIB 4A3FB 2JXMB 3ERQA 3KBGA 4WFN3 1PH7A 4JK1C 1STHA 1S4ZA 2BOSA 1MGSA 3WWVA 3JAMc 2JA5B 2RQXA 1JB7A 1IZ6A 2E2JH 2RHQB 3RZDB 1GKHA 1L2FA 1DCZA 4IFDH 3N6RA 1B2TA 1P8LA 1OXTA 2XGTA 1VF5C 2XWJB 4GN5A 1WD0A 5M3MH 2NN6H 3K58A 4DV1Q 5IP7H 5FLMH 1PFMA 4LAAA 3JAMi 4HIOA 1CM9A 1HNXL 4JOIA 3H09A 3FKIH 2B39A 3P7JA 2CQAA 4NXML 4A3GB 4K2LA 5IYBH 1JB3A 1U4PA 1EYCA 1EFID 4IFDJ 1K8MA 2WB1B 5IOCA 3NTKA 1IW7D 2PZTA 1RHPA 4LWCA 1QB5D 2Q2HA 4UAIA 2ICEC 2EYOA 2IW3A 1EOTA 1OXUA 2K7VA 2NVTH 3MAQA 4ZQ3A 4G57A 3SDZA 2EY1A 4B3SL 1HHVA 4QGUA 4DUYL 5LMNL 2XVSA 4JI6Q 2F0DA 2X6GA 1FGUA 4PZ6A 1QCBD 4IUVA 3MA2B 3A8JE 1Q3LA 4LF7Q 2Q2IA 2HCIA 2Z1CA 4DR7L 2A6HD 4F7XA 3CRLC 1VQ9A 4QY7A 2Q2UA 4DR4L 2PZWA 5A2QE 5IT9L 1KHIA 3AB9A 4HMJA 4LFCQ 5M9OA 1U0LA 4IZ8A 4GOPC 3QO2A 1L0XB 3A74A 1EQQA 3D31A 4X3TA 1WYDA 4CDCC 5LHY1 2VXWA 1VQIA 2KVMA 1RCVD 4ILWA 1B44D 2MO1A 1I50B 3S1MB 2L9HA 1NSNS 2E76C 2F3WA 2RVLA 2O5IC 3AU7A 1BBXC 1HZ9A 1Z6HA 2FMCA 2QF7A 3OYYA 5HGQA 1XPUA 2PNHA 3HOXB 1JORA 1RIPA 1YHBA 2ALYB 1UE6A 4DR5L 3T51B 4B08A 1CSQA 4BBSH 3BG3A 2I07B 3PF5A 1KL9A 1W2BA 2JE6I 3AQQA 2YU9H 3HOYH 4K2KA 5DM73 1I4HA 1X65A 3D0FA 3K6OA 2A8VA 3S1RH 2VB2X 3BZKA 4KMUC 4PNYA 4R8IA 4CGYB 4H13C 5C4XG 2A6ED 2MP1A 3HOVB 2HHHL 2JEAI 4A93H 3C3LA 2D2CC 3GP7A 5E3FA 5LMUQ 3OW7A 3LNNA 4LF5Q 3VYSA 1JE4A 4X65L 4GOPB 3AFPA 5FOBB 2EYFA 3CQZB 2ENBA 4P71A 2Z6KC 3SK6A 1YJNA 4DN4M 3S1NB 2UXCQ 1LT5D 5J39A 4K8JA 3ER0A 1HCZA 2B8FA 2QDLA 1K8OA 4OHJA 4ZAIA 3K7AB 1S5FD 2IT1A 4KN7C 1UEAB 3K5OA 1VQMA 1UAPA 3WOEA 1K9MC 2KQ3A 1CI3M 1KDAA 1IW7C 4LJZC 4HEDA 1SXTA 4I65A 4DV1L 2RA4A 4A3EB 1YITA 1V1PB 4B3RQ 5C4ZA 2R61A 1YZ6A 1UWVA 1TS4A 5M5YH 3PO3B 2CWPA 3S14B 4C3HB 2CWAA 2AWOA 4HN7A 2K5WA 1D6EC 2HIVA 1LT4D 4RH6A 1JE5A 3NHHA 2M2LA 1GUGA 2A6HC 4I7ZC 2F0OA 1KDCA 1C0AA 3NQIA 4DV7Q 1XMQQ 5KYLA 2D0OA 4IUQA 4RGTA 4P2CB 2EXDA 2AQ2B 2R7ZH 3TREA 1Q82C 2EE1A 2K5NA 4DNTB 1E3PA 1NBWA 1WTRA 4OO1I 4DV3Q 4OIKA 4GOPA 2EPBA 3IKJA 3NTHA 1JWSD 5KRUA 4LF7L 1LTLA 4DV2L 1HNZL 4LF8Q 4XQNA 1CKMA 1KRSA 2JK8A 3E9HA 1KAAA 5TSSA 1PH5A 4KKTA 4HTHA 5IT9E 3EA6A 1XPRA 1YNXA 2AMCB 4LFCL 2F0JA 3A5ZB 4QIWE 4EQNA 1O7YA 2HT1A 4JI3Q 1Y1VB 3HOUH 1V8QA 1WTWA 4HJAA 2ZJRA 4X64Q 3E0EA 1L0YB 1BDOA 2L11A 1XTDA 3VR5A 3VR4A 3CU7A 4A3MH 2G9DA 1BOSA 2L4NA 4IQZA 4ID6A 4JI2Q 5C6AA 5IP9G 2FXQA 2A6EC 1K73C 3S17B 3CF5A 4B9WA 4B3MQ 5G3LD 1SNQA 2QKIC 1I4XA 2QA4A 1W6JA 1SRUA 3T1HL 1N32L 4PMWA 3KF8B 4KD3A 4PV1C 4HSPA 2YTXA 3BVGA 4A3DG 1NMFA 5K5PA 1YIJA 2Y0SB 2WFWA 3GO5A 3V96A 1CQFA 1TY0A 3MFYA 4F87A 2Z6KA 4MZ9A 3CCJA 5KNDA 5LMUL 1TWHH 1YHAA 3I4MG 4BS9A 4EQ5A 1JWMD 5I2YA 4LF5L 4DAPA 1M90C 5DAUA 3M4QA 4POFA 2KUMA 1B70B 2D9UA 1GUNA 2TMPA 3NPPA 1H95A 2JA6G 1JCKB 5FKAC 1X6OA 2KOLA 1ZEQX 2N8NA 3RD4A 2UXCL 1HUNA 1KXLA 1RF2D 2Z9HA 4A3JB 3BVZA 1VQLA 3KLSA 2SNMA 3HKZB 4YWMA 3RLOA 1OXXK 4G7HC 1VQOA 2DJGC 4IPCA 3BDCA 2K5HA 1STBA 1FNWA 4BWGB 4ZYSA 4IFDG 2EJFC 4HJ8A 2JA7G 2NVQB 2E75C 1Y1WB 1YVCA 1EYAA 1VQKA 3T1YQ 4B3RL 1J6QA 1E2VA 1SLJA 2F0QA 4LUZA 3HOZH 5M3MG 1H9JA 2B3GA 2N3SA 4X3KA 3GTJH 2EY6A 2VL6A 3KF8A 2F0EA 5JJZA 3R93A 3L7ZC 1JICA 4UPAA 4LF9Q 5NUCA 4LF4Q 1IBLL 3A56A 4H02A 1HA5A 2RHSB 4A3FG 4HIKA 1XMQL 3OWFA 5IYBG 2QILA 5M5WB 4DNIA 3DEOA 4X66L 4B9XA 1XPOA 1E24A 4JW0A 2Z4HA 3HS0C 1S5CD 4ZKCB 3K59A 4DU9A 3I4NB 4DV3L 3CD6A 2KENA 2KHIA 1VQCA 3SK5A 2OWOA 1XTCD 4P72A 2MFIA 2XN9C 1PHJA 1PRTF 4YHHL 5ELEA 2Q2TA 2YYZA 5BN3A 4L63B 3KYHC 4N9PA 4BY1B 3NBHB 3J7YW 1HTLD 3M4OH 4R4CA 1I4RA 2K52A 2H5XA 1SE3A 1Z7TA 5C4XH 1SYCA 4LF6Q 4FYDA 2NVXB 3EROA 4JI4Q 4A3GG 2F52A 1G2TA 1A2TA 3I56A 1D5MC 2GN5A 1RTOA 3AFQA 2WB1G 4DAVA 4NDXA 4AIMA 4JI2L 2VUMB 3M4PA 3AEVA 3RZOH 4ME5A 4A3BB 1RTNA 1EU4A 5EQ0A 1TVXA 5FO7B 4GS3A 2RDHA 3D6CA 5CV7A 3GDEA 1HJPA 2DJFC 2L12A 3E0JA 5C3XA 3PUVA 3IAYA 4RHRA 1F2YA 4KN4C 3M85A 4ALPA 4R4QA 3HOYG 4Y7NB 2BE5D 4TKOB 1RODA 4OL7A 2PQEA 5E1FA 3W2DA 1I6HH 2WKDA 3W3AA 3S1QB 3QOJA 3W5OA 1VQPA 5IGGA 3DWAA 2B63B 1LTSD 4C3IH 4IPGA 3ERSX 3C2PA 2RF4A 3PIO3 1SYEA 5I9PA 5ELBA 3NBHA 5I6WA 2ZTEA 1U4RA 4UHVA 2ATWA 1TWFB 4OO1H 1SNMA 3HG9A 5CV9A 1QOHA 1I94L 1BKBA 1QUQB 3F8TA 4WJ3M 2PI2A 4H44C 4J1MA 3T53B 2RDFA 1D1IA 1PTOD 1ET6A 2FINB 2ASBA 4FXKC 4IJHA 4KHVA 3NELA 1VQHA 3BS1A 2SEBD 4B3SQ 2F0WA 4DUYQ 3T1YL 1SJHD 2XRSD 3VDYA 5C44H 1B9MA 4FF1A 2ZT9C 2K28A 4IALA 4HJ7A 2JSOA 4N9TA 3KLRA 3SR1A 1U9RA 4MNOA 5M5XH 3GTGB 4DK3C 1KAWA 5T1IA 3GTPB 1XNRL 4DR7Q 1MJCA 4NP5A 1VQNA 4LF4L 3TP6A 4APVA 4KKSA 2LMCB 3F1ZA 5EPJA 5CR3A 3Q23A 1AZPA 3DEPA 2R93B 4RA8A 4DV5L 3H3VI 1V1QA 4IPHA 3S2HH 1SR3A 3M3YB 5D65A 5AJ3Q 2HIXA 5IP9H 3FMCA 1BCPD 1STYA 2IHEA 3DWQA 1TWAH 3CMEA 5CGKA 2GVAA 3SEBA 1DOKA 2I5HA 2R7ZG 4FF4A 4JV5Q 1JJCB 1JC7A 2F0FA 3QG1A 1X3FA 2JYOA 3A0JA 1MIUA 3H0GB 2LFNA 1PZID 4JI8L 1Y8PB 4PMCA 1QUQA 1KLUD 3ONAB 3GV3A 1NMGA 5C3EB 4A3LG 4A3EG 4KV6A 4XT3B 5EGTA 1EEID 4NPSA 1EOVA 1WTVA 3JC66 5CBEE 2EVBA 5EBCA 3G6JB 2Q8IB 4JI4L 4YWLA 1IXRA 5E7NA 3I4MH 1LM0A 2DN8A 3I4LA 3CW2C 1SROA 4P75A 4R4OA 2MNAA 3L3OC 1KNEA 2HHHQ 3R2IA 1S5DD 1TWCB 3VA7A 4IPDA 2R92H 2BE5C 3TQYA 2F0MA 2VB3X 2VQEQ 2JA6H 4X65Q 4A3MG 1XNQQ 2L55A 3HKSA 1EIGA 2CFMA 3GTOH 4RGOS 3L2PA 4LUOA 5M3FB 2HCCA 2ES2A 4DXFA 2KA7A 2MGSA 3D4DA 5GAHC 4F8MA 1AFPA 4A3IB 2L15A 1E7ZA 1Y14B 2JA7H 1GHKA 4KI0A 2R3ZA 1ICWA 1EUJA 1UNSA 2X6LA 4LW1A 1D5ZC 1VQAA 3MXPA 3WOFA 5CBAE 3RMHA 1ZKOA 1PTOC 2G5DA 1Y1VG 2O5JC 1PYBA 1WI5A 3K57A 2V4DA 4QCLA 2JA8H 1BBWA 2ICIA 4ZKBB 3PO2B 4DR1Q 4DNRB 1AE2A 3LX0A 5IWAQ 4A3FH 2RCNA 1PFSA 1S3OA 3DM1A 3T16A 1T5EA 4BY7B 2JA5H 1QVCA 2NZ1D 4DK1A 4CJ0B 2H4OA 4G7OC 3RZDH 5EAYA 3RN2A 4UP9A 1SMYD 1HQRD 1X55A 2F3VA 2KJXA 2BA1A 4Q0FA 3CC2A 2N78A 2RCFA 2KCNA 3S16B 2Q8TA 2F0UA 4K14A 4DR2L 1F2MA 4AQYQ 2Y0SG 4XQJA 1ENAA 3LGJA 1QJOA 5FLXc 1BCPC 4AYBE 4E6IA 4DKAC 1NAPA 1YJ9A 4DV2Q 1HNZQ 4JI5L 2NWGA 1GHJA 1TY2A 1Q86C 1PH1A 3HOZG 3H3VC 3SGIA 2AHOB 1PTOB 2PW5A 4A3GH 2F0NA 3I73A 4PZ8A 2B2UA 2K1BA 1YJWA 2EDGA 1E22A 2JQOA 2PYKA 2V1CC 3VYTA 4QF4A 5AJ3L 1O78A 3A54A 4C3JB 1WTQA 1X3QA 1QVGA 1FJGQ 2A74C 3H94A 3HKZG 5IGFA 2QCPX 4PQXA 1G291 1JJ2A 1SBBB 1PYWD 5EPKA 2Z6BA 3PMFA 3U9SA 2E8GA 3KK7A 3MVVA 4YY3L 1Y1WG 2F0LA 3P1HA 4KK7A 1SE2A 4PG3A 1AN8A 3T1HQ 3VR6A 1EWHA 5C0XG 1N32Q 1WJJA 1L1OC 4RWSC 1CA6A 1JOOA 3MXUA 1VF7A 1FVIA 4NXNQ 1SYGA 2F0TA 3CC7A 1A6XA 4AYBB 2WINB 1PV4A 3WDNA 1UE7A 3TN2A 3NBIA 1BCPB 1JQYD 2ZXPA 5C0XI 2F0VA 5E4WC 2ZTCA 5KNCA 2K5VA 2E2IB 4RKBA 5JJIA 3M9BA 3GTLB 2Q8RE 5HY6A 3HRZC 3TRZA 3A7AB 1TS5A 1I50H 3K5MA 2VQEL 3S1MH 1SYBA 5FO8B 1CSPA 1HZBA 1XNQL 3GQBA 4GKKQ 3KUPA 1F77A 2QEJC 1GUSA 1OO9B 3SXHA 2EJGC 1VS0A 1K3BC 3HOXH 1B1ZA 3NK9A 5D3DA 2IX0A 4H7BA 1Q81C 1VQ7A 4HCSA 1G6PA 3TS0A 1DGSA 5M5YB 1YNND 4DV0Q 5C5LA 4XTCS 1A62A 2N49A 2G9HD 4L6TB 2IX3A 4X62L 1IBMQ 1F9QA 2BH2A 1T9HA 3A5UA 4JI1L 1L1OB 1SMYC 3EVQA 2UU9Q 4RGNA 1GXDC 4MTNA 1STAA 1JJGA 3J80c 3MC0B 3H91A 4DR1L 3CCRA 1JMCA 3TZDA 5IWAL 4C3IG 1HNWQ 4XXEA 4FNFA 1A3UA 3F2CA 1CQVA 3M7NA 4M8AA 4A3BG 2NUCA 3CQZH 1II3A 3CMAA 2AUJD 3RNUA 1IBLQ 3K7UC 1SYDA 3J7ZC 3S1NH 3J81c 4OO1G 3E3XA 4EQOA 4DV4Q 1K83B 4ZRZA 3CCEA 4X66Q 2A5HA 1ZYRD 3K7AH 1PH8A 3PCOB 4L5SA 4FF2A 3J80i 2TSSA 2EYJA 4AQYL 4JI7L 5JEAJ 1BQQT 2K75A 3G4SA 1I3QB 4ODGA 5IIFA 4BXXG 3FP9A 2I5LX 2KCCA 3KOJA 2Z8LA 4ZLTF 3FEWX 2PMZE 1PMRA 2AQ1B 1SNCA 4A3LH 1Q8KA 4A3EH 1T5XD 4CKEA 1X32A 5C44G 2Y0SE 3GTMB 4YHHQ 4HSVA 1Q7YC 1GUWA 2B63G 3J81i 4J6HA 3J7A5 1NE3A 2GVBA 3PO3H 3S14H 4C3HH 1WTHA 1YI2A 4GKJQ 2ZXOA 1UEBA 4FP5D 3LWUA 1IYJB 1GO3E 1I4GA 5EKIA 2NVYB 1L1OA 1FJGL 1QZGA 1HFGA 4XYQA 3GTKB 1EWIA 3SK8A 3I90A 1E2ZA 1FR3A 1Y69U 2A19A 4BA2I 5CYUA 3HKZE 2BCOA 1R9TB 3A8IE 1NY4A 5F2DA 4MHEA 1PYSB 5DM63 4DPGA 2NTSA 3DM3A 3MZ5A 1HRJA 2O2LD 2LXKA 4NXNL 4GLVB 1J9OA 2LSSA 2EZVA 2PMZB 5AFWA 3DLLA 1PVOA 4RGMA 1A3TA 1PFBA 2JEBI 1Y1VH 3OMCA 4EVOA 5J22A 1O7IA 1HQMC 5FK9C 1KLGD 3CXCA 2GA4B 2YV5A 1TS2A 3IL8A 1SFOB 4LMQD 2PPBC 1YNNC 1X3EA 2R93G 1ENFA 4ZCKA 4GKKL 1G51A 2K5DA 2Z4IA 3V2TA 1SN8A 5D14A 1RDPD 2R92G 4N8X1 4XIGS 3S17H 3GTQB 3CRKC 1B3QA 2OCEA 1ESFA 2K5QA 2CH4A 1VQ6A 1NJIC 2M9VA 1WTXA 1LUZA 3UDIA 4HCEA 4CHTB 3M7GA 1J8IA 1XXGA 4IJLA 2XIWA 2E2HB 1I94Q 5CV8A 4ME3A 1PXUA 1KTKA 1FNVA 3H0GG 4JCVE 3D3RA 1FYCA 4DV0L 2LS01 2AWNA 1IBML 1IYVA 4IUUA 5C3EG 2DUDA 1BXTA 1EY0A 2M00A 1I6VC 4JC0A 2KBNA 2UU9L 1H9SA
chains in the Genus database with same CATH topology
3HFZB 3FKIH 4NXML 3I4OA 3PIPA 3ULPA 2ASBA 5IYBH 1HNWL 4IJHA 3NELA 1VQHA 1N9WA 1X9NA 2LXJA 2YTYA 4B3SQ 5IY0A 4IFDJ 4DUYQ 3T1YL 2PI2E 2IX1A 2DGYA 1XNRQ 2R6GA 2JA8G 4LWCA 3VDYA 1I5FA 2Q2HA 5C44H 2WAQG 2KCMA 3L0OA 3KF6B 2NVTH 4KHPQ 1OXUA 4HJ7A 1KC8C 5GQOA 1SMXA 4GLXA 4MNOA 4OWTB 5M5XH 1S72A 4DV4L 4A3JH 4B3SL 4QGUA 4DK3C 5K36G 1Z9FA 1KAWA 4DUYL 5LMNL 1HH2P 3AYHB 1BBUA 2JA5G 4JI0Q 1E1TA 4DV5Q 5IYCG 1XNRL 1MJCA 4JI6Q 2K50A 1VQNA 4DR7Q 1FGUA 4PZ6A 4LF4L 2IHFA 4KHPL 4APVA 4DV6L 3F1ZA 4BBRG 1V43A 2NVQH 4LF7Q 1BVSA 1Y1WH 2Q2IA 4QL5A 4JI0L 4DV5L 2WAQE 4DR7L 4JI6L 3OTOQ 1VQ9A 3H3VI 4BA1I 1V1QA 1RL2A 4IPHA 4QY7A 3ULLA 1SR3A 4DUZQ 3G6EA 2Q2UA 5AJ3Q 3S2HH 4K0KQ 4A76A 1VCIA 2HIXA 5IP9H 1KD1C 4DR4L 1KHIA 3BU2A 2JJQA 2IHEA 3G48A 5J3BA 4LFCQ 1TWAH 3CMEA 4JI8Q 2GVAA 1U0LA 5GROA 2I5HA 1N8RC 4GOPC 3OTOL 3A74A 4TVAB 1ASYA 2R7ZG 3I2ZA 1K83H 4JBJA 1JJCB 1EQQA 1OTCA 3D31A 4GKJL 4K0KL 1WYDA 1EIYB 1A8VA 1X3FA 4GN3B 1E1OA 1VQIA 3NENA 3A0JA 4RMFA 5FJ8G 1MIUA 3CCQA 3PO2G 2MO1A 2UXDQ 4LFBQ 4JI8L 1QUQA 3IRBA 1I3QH 1NMGA 5M5WH 4A3LG 4A3EG 1J5EL 4BY7G 1HZ9A 3OYYA 4NPSA 5HGQA 1EOVA 3JC66 1XPUA 2PNHA 4L5TA 4A75A 2KCTA 4DK6C 1RIPA 1N33Q 1YHBA 2ALYB 1UE6A 3U50C 3ZJYC 4DR5L 5C0XJ 4TQUS 4JI4L 3GTMH 4YWLA 1IXRA 1CSQA 5E7NA 3ULJA 3I4MH 4BBSH 1LM0A 3PF5A 1KL9A 1W2BA 2JE6I 1K8GA 3CW2C 1SROA 4P75A 4R4OA 4IOCA 3S24A 2MNAA 2F4VQ 3AQQA 2YU9H 3KF6A 2BA0A 1CKNB 2HHHQ 3HOYH 3PGZA 1HR0W 4IPDA 4LFAQ 2R92H 3ICEA 1X65A 3D0FA 3GD7A 3PUXA 3TQYA 3UDFA 3S1RH 4BY1H 2A8VA 3BZKA 1JT8A 2VQEQ 2JA6H 4OWWB 1PH4A 3CPWA 2NVYH 4X65Q 4A3MG 1XNQQ 5C4XG 3HKSA 2CFMA 2HHHL 2UXBQ 3GTOH 4YCUA 1VQ8A 3L2PA 2JEAI 4A93H 4LUOA 1N34L 5LMUQ 3GTKH 3PV0A 3CC4A 5BR8L 2ES2A 4HIDA 2NVXH 4DR6Q 5GAHC 4LF5Q 4GLAC 1R9TH 2L15A 4X65L 2ZJQA 1E7ZA 1Y14B 2JA7H 1VQJA 4GOPB 2UXBL 3AFPA 4KI0A 1C7YA 1EUJA 4LW1A 1VQAA 1HR0Q 4POGA 1D8LA 4P71A 1C9OA 2Z6KC 4RG1A 2VUMH 1YJNA 5IT9c 1VQFA 2UXCQ 2C35B 4A3BH 1VQ4A 3ER0A 3UE0A 1Y1VG 2UUCQ 5ELNA 1VQBA 1PYBA 1WI5A 2IT1A 3W1BA 1VQMA 2JA8H 1BBWA 3HOXG 1K9MC 3MXNB 2MQHA 4DR1Q 1AE2A 3K81C 5IWAQ 2VW9A 1SFOH 4EX5A 3EIVA 1K0RA 2UUCL 4A3FH 2RCNA 5IE8A 1PFSA 1S3OA 4DV1L 2A1AA 4BXXH 1YITA 4B3RQ 2JA5H 1QVCA 4AYBG 4Y7NH 1YZ6A 1UWVA 3RZDH 3BZCA 5EAYA 4JV5L 3RN2A 4UP9A 4B3TQ 2OQ0A 2KHJA 5M5YH 4DR2Q 3GTQH 3S1QH 2K4KA 1TXYA 2CWPA 1X55A 2E5LQ 2B63H 1A0IA 2AWOA 2CWAA 1CKNA 3RN5A 1K3RA 2BA1A 1KRTA 4OX9Q 2HIVA 3HOVG 1KQSA 3CC2A 1JE5A 2N78A 1XJVA 2E2HH 4UP8A 1B7YB 1UE1A 5JEAG 4JI5Q 4IFDI 5M3FG 4B3TL 2VQFQ 4DR2L 4AQYQ 2NN6G 1C0AA 2Y0SG 4O0AA 4DV7Q 4PZ7A 1XMQQ 1YEZA 3FHWA 3KJOA 5IP7G 3LGJA 5FLMG 5FLXc 2D0OA 4A3IG 1VQ5A 1TWFH 4A3CG 4AYBE 4DKAC 2EXDA 1YJ9A 4DV2Q 1HNZQ 2R7ZH 3TREA 3STBD 4JI5L 1L0WA 4HIMA 1Q82C 2K5NA 3FKIG 2NN6I 1E3PA 1NBWA 3J81j 3K8AA 1Q86C 4DV7L 1PH1A 2AKWB 2VZAA 4DV3Q 4GOPA 4KLKA 3SGIA 2AHOB 3KLWA 4A3GH 2UUBQ 4LF7L 1LTLA 4PZ8A 4DV2L 1HNZL 4LF8Q 1ASZA 1YJWA 1CKMA 1E22A 2JQOA 1KRSA 3S15H 2WP8J 4DUZL 2JK8A 4FDBA 2R7DA 2V1CC 3E9HA 4DR3Q 5AJ3L 4QQBX 3CAMA 2IY5B 5JJKA 1WFQA 1PH5A 2R7FA 1XPRA 1YNXA 2AMCB 3PUWA 3A5ZB 4QIWE 4LFCL 4AH6A 4YY3Q 1QVGA 3HKZG 4LF8L 1FJGQ 2HT1A 3HOWH 4JI3Q 1CUKA 1G291 4KHZA 1JJ2A 5GAEC 3GTGH 1OXSC 1FL0A 1NTGA 1K8AC 1V9PA 3B6YA 3HOUH 1YBYA 2ZJPA 1IL2A 3GTPH 4HJAA 1XMOQ 2ZJRA 2E8GA 2EQSA 1GD7A 3E0EA 2OQKA 3CPFA 3U4VA 4X64Q 2UXDL 4LFBL 4YY3L 1Y1WG 3BJUA 3KJPA 1XTDA 2UUAQ 4JI3L 3U58A 4R4TA 4UY8C 4P73A 3PO3G 3I4NH 4PG3A 4X6AH 3T1HQ 4A3MH 5C0XG 1N32Q 1WCMH 1WJJA 1X56A 2R93H 1L1OC 4JI2Q 1HZAA 5IP9G 1FVIA 2FXQA 4NXNQ 3CC7A 2EIFA 2ZTDA 4X64L 3H15A 4HJ9A 4A4IA 3CF5A 1K73C 1M1KC 4B3MQ 3M3YH 1N33L 1PV4A 2BH8A 2QA4A 1UE7A 1SRUA 3Q8DA 3T1HL 4L5QA 1U5KA 5C0XI 1N32L 2ZTCA 2K5VA 4PMWA 2F4VL 3KF8B 5JJIA 2CQOA 2NZHA 2QGQA 3M9BA 4R1JA 4B3ML 1AE3A 4A3KH 4LFAL 2YTXA 3TEHB 5HY6A 4A3DG 3TRZA 1NMFA 3H0GH 4JBMA 1I50H 2VQEL 1YIJA 3S1MH 2WFWA 3GO5A 1CSPA 2ZM6Q 1HZBA 1XNQL 1HZCA 4GKKQ 5C3EH 2Z6KA 4MZ9A 3K80C 3NEMA 3CCJA 1VS0A 3OW2A 5LMUL 4C2MH 1TWHH 1EFWA 1YHAA 3EBEA 3UDXA 3HOXH 2I0QA 4BBSG 3I4MG 4DR6L 4EQ5A 2IX0A 2JA9A 4LF5L 2ZM6L 2NZOA 4JBKA 4X62Q 1Q81C 2MO0A 1AH9A 1VQ7A 2I5MX 1M90C 1G6PA 3TS0A 3PUYA 3M4QA 4POFA 1GM5A 1B70B 4JI1Q 1DGSA 4R4IA 1HR0L 1H95A 1TWCH 2JA6G 4DV0Q 1X6OA 2UXCL 2N8NA 1KXLA 4XTCS 1A62A 2N49A 1IBMQ 4L5RC 5JJLA 4X62L 2PQAB 1VQLA 4GNXC 1T9HA 2BH2A 4A93G 3A5UA 4YWMA 1X54A 4JI1L 3RLOA 5LMNW 1L1OB 1OXXK 1UE5A 1N36Q 4WJ4A 1HNXQ 1VQOA 1EYGA 2UU9Q 1Z47A 2YTVA 4O2DA 1QVFA 4IPCA 4MTNA 5IYCH 3CCSA 4OWXB 2K5HA 3J80c 5M3FH 1JJGA 2VS1A 4DR1L 4NXMQ 3CCRA 4IFDG 4HJ8A 1JMCA 2JA7G 5IWAL 1HNWQ 5GADC 2D0PA 4OXPA 2OTLA 4BBRH 1YVCA 4A3IH 4A3CH 3CCLA 1N36L 1VQKA 3T1YQ 3F2CA 4B3RL 1J6QA 1PH3A 1SLJA 3M7NA 4A3BG 3CQZH 3CMAA 3RNUA 4LUZA 1IBLQ 3STBC 3HOZH 5M3MG 1D7QA 2B3GA 3TS2A 3K7UC 3MEFA 3J7ZC 1PA6A 3S1NH 3J81c 4OO1G 2N3SA 4JI7Q 4JOIC 3I7FA 3GTJH 2E5LL 4DV4Q 2VL6A 3CCVA 2D62A 2Z0SA 5LMNQ 3CCEA 4OX9L 3L7ZC 3CP0A 4UPAA 5DLQE 4X66Q 2QEXA 1VQGA 4LF9Q 3K7AH 4LF4Q 4DAYB 1PH8A 4H02A 3PCOB 1IBLL 2RHSB 4QJFA 4L5SA 3J80i 3I55A 3G71A 2VNUD 5C4JH 4DV6Q 3KDFB 2VQFL 2CCZA 4AQYL 5ELOA 5FJ8H 4A3FG 4JI7L 3PO2H 5JEAJ 4HIKA 3U4ZA 1XMQL 2K75A 5IYBG 3G4SA 4DNIA 4BXXG 3FP9A 2I5LX 3KOJA 1VQDA 3PSIA 3PIOA 2PMZE 3PF4A 4X66L 4LF9L 4A3LH 1Q8KA 4A3EH 1VQEA 1OXVA 4GN4B 1XPOA 4BY7H 4OO1I 1E24A 5C44G 4DR4Q 2Y0SE 4LUVA 3KFUA 4YHHQ 1Q7YC 1Q12A 2B63G 4DV3L 3CD6A 3J81i 2KENA 1YHQA 3J7A5 1NE3A 2GVBA 3S2DH 4A3JG 2KHIA 1VQCA 4GNXB 2UUBL 3PO3H 3S14H 4C3HH 3HOZG 4JBWA 2OWOA 1YI2A 4GKJQ 4P72A 2XTIA 4JG2A 3RLNA 4DAMA 1UEBA 4YWKA 2MFIA 1PHJA 4YHHL 2Q2TA 2YYZA 4DR3L 1IYJB 2PQAA 2VY3A 3KYHC 1GO3E 1IBKQ 4UP7A 3S16H 3NBHB 3M4OH 1CKOA 3E9IA 4Y52H 1L1OA 4R4CA 1FJGL 3PUZA 1QZGA 1P16A 1W3SA 1J5EQ 3K0XA 2K52A 2H5XA 1S40A 1LYLA 4JYAQ 5C4XH 1EWIA 1MKHA 1IBKL 4LF6Q 1XMOL 4JI4Q 2A19A 4DR5Q 4BA2I 4A3GG 3HKZE 4A3DH 2F52A 4HJ5A 1NY4A 4P74A 2UUAL 3I56A 2GN5A 5GAGC 3F2DA 2HQLA 1PYSB 3AFQA 4DPGA 2WB1G 3UDGA 3DM3A 4JYAL 1GVPA 1WOCA 4AIMA 4JI2L 2LXKA 5IYDG 4LF6L 4NXNL 3M4PA 4GLVB 2F3IA 3AEVA 3RZOH 2LSSA 3HOWG 3CCMA 3DLLA 5H1SE 4C3JH 4GS3A 1PVOA 2CKZB 3UE1A 1KIXA 2JEBI 1SE8A 3HOUG 3RLFA 1Y1VH 1PH9A 1TWGH 4YCWA 1O7IA 3CCUA 3KDFA 1N34Q 3GDEA 1HJPA 4YCVA 5BR8Q 3CXCA 4LNQA 2OTJA 2YV5A 3PUVA 2ID0A 2WB1E 3I4NG 1PH2A 4NB3A 1WCMG 1X3EA 1PH7A 2R93G 1X3GA 5IYDH 3M85A 1B8AA 4ALPA 3EN2A 4R4QA 3WWVA 3JAMc 4GKKL 3HOYG 1JB7A 1G51A 4IOAA 1IZ6A 2E2JH 1SN8A 2RHQB 1Q46A 2R92G 1I6HH 3W1GA 4BY1G 4XIGS 4GNXA 1GKHA 3S17H 1MJEA 2OCEA 4J15A 3W5OA 1L2FA 1VQPA 1VQ6A 1NJIC 1LUZA 3UDIA 4IPGA 4C3IH 1P8LA 2K14A 3ERSX 4OONA 4IJLA 2RF4A 1I94Q 1OXTA 4ME3A 4A3KG 2E2IH 2XGTA 4GN5A 3HOVH 3H0GG 1Q1BA 3GTLH 1EIFA 2ZTEA 4JCVE 4DV0L 1QZHA 5M3MH 2ATWA 3H3VH 2AWNA 3RR5A 1IBML 5C3EG 4DV1Q 2DUDA 1A63A 5IP7H 5FLMH 1I94L 3JAMi 1Q1EA 1BKBA 1QUQB 3F8TA 4JC0A 4HIOA 2PI2A 4WJ3M 2KBNA 1EQRA 2B29A 1HNXL 4IO9A 2UU9L 1PH6A 2VUMG 4JOIA 4JV5Q 3F2BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HFZ B;  3FKI H;  4NXM L;  3I4O A;  3PIP A;  3ULP A;  2ASB A;  5IYB H;  1HNW L;  4IJH A;  3NEL A;  1VQH A;  1N9W A;  1X9N A;  2LXJ A;  2YTY A;  4B3S Q;  5IY0 A;  4IFD J;  4DUY Q;  3T1Y L;  2PI2 E;  2IX1 A;  2DGY A;  1XNR Q;  2R6G A;  2JA8 G;  4LWC A;  3VDY A;  1I5F A;  2Q2H A;  5C44 H;  2WAQ G;  2KCM A;  3L0O A;  3KF6 B;  2NVT H;  4KHP Q;  1OXU A;  4HJ7 A;  1KC8 C;  5GQO A;  1SMX A;  4GLX A;  4MNO A;  4OWT B;  5M5X H;  1S72 A;  4DV4 L;  4A3J H;  4B3S L;  4QGU A;  4DK3 C;  5K36 G;  1Z9F A;  1KAW A;  4DUY L;  5LMN L;  1HH2 P;  3AYH B;  1BBU A;  2JA5 G;  4JI0 Q;  1E1T A;  4DV5 Q;  5IYC G;  1XNR L;  1MJC A;  4JI6 Q;  2K50 A;  1VQN A;  4DR7 Q;  1FGU A;  4PZ6 A;  4LF4 L;  2IHF A;  4KHP L;  4APV A;  4DV6 L;  3F1Z A;  4BBR G;  1V43 A;  2NVQ H;  4LF7 Q;  1BVS A;  1Y1W H;  2Q2I A;  4QL5 A;  4JI0 L;  4DV5 L;  2WAQ E;  4DR7 L;  4JI6 L;  3OTO Q;  1VQ9 A;  3H3V I;  4BA1 I;  1V1Q A;  1RL2 A;  4IPH A;  4QY7 A;  3ULL A;  1SR3 A;  4DUZ Q;  3G6E A;  2Q2U A;  5AJ3 Q;  3S2H H;  4K0K Q;  4A76 A;  1VCI A;  2HIX A;  5IP9 H;  1KD1 C;  4DR4 L;  1KHI A;  3BU2 A;  2JJQ A;  2IHE A;  3G48 A;  5J3B A;  4LFC Q;  1TWA H;  3CME A;  4JI8 Q;  2GVA A;  1U0L A;  5GRO A;  2I5H A;  1N8R C;  4GOP C;  3OTO L;  3A74 A;  4TVA B;  1ASY A;  2R7Z G;  3I2Z A;  1K83 H;  4JBJ A;  1JJC B;  1EQQ A;  1OTC A;  3D31 A;  4GKJ L;  4K0K L;  1WYD A;  1EIY B;  1A8V A;  1X3F A;  4GN3 B;  1E1O A;  1VQI A;  3NEN A;  3A0J A;  4RMF A;  5FJ8 G;  1MIU A;  3CCQ A;  3PO2 G;  2MO1 A;  2UXD Q;  4LFB Q;  4JI8 L;  1QUQ A;  3IRB A;  1I3Q H;  1NMG A;  5M5W H;  4A3L G;  4A3E G;  1J5E L;  4BY7 G;  1HZ9 A;  3OYY A;  4NPS A;  5HGQ A;  1EOV A;  3JC6 6;  1XPU A;  2PNH A;  4L5T A;  4A75 A;  2KCT A;  4DK6 C;  1RIP A;  1N33 Q;  1YHB A;  2ALY B;  1UE6 A;  3U50 C;  3ZJY C;  4DR5 L;  5C0X J;  4TQU S;  4JI4 L;  3GTM H;  4YWL A;  1IXR A;  1CSQ A;  5E7N A;  3ULJ A;  3I4M H;  4BBS H;  1LM0 A;  3PF5 A;  1KL9 A;  1W2B A;  2JE6 I;  1K8G A;  3CW2 C;  1SRO A;  4P75 A;  4R4O A;  4IOC A;  3S24 A;  2MNA A;  2F4V Q;  3AQQ A;  2YU9 H;  3KF6 A;  2BA0 A;  1CKN B;  2HHH Q;  3HOY H;  3PGZ A;  1HR0 W;  4IPD A;  4LFA Q;  2R92 H;  3ICE A;  1X65 A;  3D0F A;  3GD7 A;  3PUX A;  3TQY A;  3UDF A;  3S1R H;  4BY1 H;  2A8V A;  3BZK A;  1JT8 A;  2VQE Q;  2JA6 H;  4OWW B;  1PH4 A;  3CPW A;  2NVY H;  4X65 Q;  4A3M G;  1XNQ Q;  5C4X G;  3HKS A;  2CFM A;  2HHH L;  2UXB Q;  3GTO H;  4YCU A;  1VQ8 A;  3L2P A;  2JEA I;  4A93 H;  4LUO A;  1N34 L;  5LMU Q;  3GTK H;  3PV0 A;  3CC4 A;  5BR8 L;  2ES2 A;  4HID A;  2NVX H;  4DR6 Q;  5GAH C;  4LF5 Q;  4GLA C;  1R9T H;  2L15 A;  4X65 L;  2ZJQ A;  1E7Z A;  1Y14 B;  2JA7 H;  1VQJ A;  4GOP B;  2UXB L;  3AFP A;  4KI0 A;  1C7Y A;  1EUJ A;  4LW1 A;  1VQA A;  1HR0 Q;  4POG A;  1D8L A;  4P71 A;  1C9O A;  2Z6K C;  4RG1 A;  2VUM H;  1YJN A;  5IT9 c;  1VQF A;  2UXC Q;  2C35 B;  4A3B H;  1VQ4 A;  3ER0 A;  3UE0 A;  1Y1V G;  2UUC Q;  5ELN A;  1VQB A;  1PYB A;  1WI5 A;  2IT1 A;  3W1B A;  1VQM A;  2JA8 H;  1BBW A;  3HOX G;  1K9M C;  3MXN B;  2MQH A;  4DR1 Q;  1AE2 A;  3K81 C;  5IWA Q;  2VW9 A;  1SFO H;  4EX5 A;  3EIV A;  1K0R A;  2UUC L;  4A3F H;  2RCN A;  5IE8 A;  1PFS A;  1S3O A;  4DV1 L;  2A1A A;  4BXX H;  1YIT A;  4B3R Q;  2JA5 H;  1QVC A;  4AYB G;  4Y7N H;  1YZ6 A;  1UWV A;  3RZD H;  3BZC A;  5EAY A;  4JV5 L;  3RN2 A;  4UP9 A;  4B3T Q;  2OQ0 A;  2KHJ A;  5M5Y H;  4DR2 Q;  3GTQ H;  3S1Q H;  2K4K A;  1TXY A;  2CWP A;  1X55 A;  2E5L Q;  2B63 H;  1A0I A;  2AWO A;  2CWA A;  1CKN A;  3RN5 A;  1K3R A;  2BA1 A;  1KRT A;  4OX9 Q;  2HIV A;  3HOV G;  1KQS A;  3CC2 A;  1JE5 A;  2N78 A;  1XJV A;  2E2H H;  4UP8 A;  1B7Y B;  1UE1 A;  5JEA G;  4JI5 Q;  4IFD I;  5M3F G;  4B3T L;  2VQF Q;  4DR2 L;  4AQY Q;  2NN6 G;  1C0A A;  2Y0S G;  4O0A A;  4DV7 Q;  4PZ7 A;  1XMQ Q;  1YEZ A;  3FHW A;  3KJO A;  5IP7 G;  3LGJ A;  5FLM G;  5FLX c;  2D0O A;  4A3I G;  1VQ5 A;  1TWF H;  4A3C G;  4AYB E;  4DKA C;  2EXD A;  1YJ9 A;  4DV2 Q;  1HNZ Q;  2R7Z H;  3TRE A;  3STB D;  4JI5 L;  1L0W A;  4HIM A;  1Q82 C;  2K5N A;  3FKI G;  2NN6 I;  1E3P A;  1NBW A;  3J81 j;  3K8A A;  1Q86 C;  4DV7 L;  1PH1 A;  2AKW B;  2VZA A;  4DV3 Q;  4GOP A;  4KLK A;  3SGI A;  2AHO B;  3KLW A;  4A3G H;  2UUB Q;  4LF7 L;  1LTL A;  4PZ8 A;  4DV2 L;  1HNZ L;  4LF8 Q;  1ASZ A;  1YJW A;  1CKM A;  1E22 A;  2JQO A;  1KRS A;  3S15 H;  2WP8 J;  4DUZ L;  2JK8 A;  4FDB A;  2R7D A;  2V1C C;  3E9H A;  4DR3 Q;  5AJ3 L;  4QQB X;  3CAM A;  2IY5 B;  5JJK A;  1WFQ A;  1PH5 A;  2R7F A;  1XPR A;  1YNX A;  2AMC B;  3PUW A;  3A5Z B;  4QIW E;  4LFC L;  4AH6 A;  4YY3 Q;  1QVG A;  3HKZ G;  4LF8 L;  1FJG Q;  2HT1 A;  3HOW H;  4JI3 Q;  1CUK A;  1G29 1;  4KHZ A;  1JJ2 A;  5GAE C;  3GTG H;  1OXS C;  1FL0 A;  1NTG A;  1K8A C;  1V9P A;  3B6Y A;  3HOU H;  1YBY A;  2ZJP A;  1IL2 A;  3GTP H;  4HJA A;  1XMO Q;  2ZJR A;  2E8G A;  2EQS A;  1GD7 A;  3E0E A;  2OQK A;  3CPF A;  3U4V A;  4X64 Q;  2UXD L;  4LFB L;  4YY3 L;  1Y1W G;  3BJU A;  3KJP A;  1XTD A;  2UUA Q;  4JI3 L;  3U58 A;  4R4T A;  4UY8 C;  4P73 A;  3PO3 G;  3I4N H;  4PG3 A;  4X6A H;  3T1H Q;  4A3M H;  5C0X G;  1N32 Q;  1WCM H;  1WJJ A;  1X56 A;  2R93 H;  1L1O C;  4JI2 Q;  1HZA A;  5IP9 G;  1FVI A;  2FXQ A;  4NXN Q;  3CC7 A;  2EIF A;  2ZTD A;  4X64 L;  3H15 A;  4HJ9 A;  4A4I A;  3CF5 A;  1K73 C;  1M1K C;  4B3M Q;  3M3Y H;  1N33 L;  1PV4 A;  2BH8 A;  2QA4 A;  1UE7 A;  1SRU A;  3Q8D A;  3T1H L;  4L5Q A;  1U5K A;  5C0X I;  1N32 L;  2ZTC A;  2K5V A;  4PMW A;  2F4V L;  3KF8 B;  5JJI A;  2CQO A;  2NZH A;  2QGQ A;  3M9B A;  4R1J A;  4B3M L;  1AE3 A;  4A3K H;  4LFA L;  2YTX A;  3TEH B;  5HY6 A;  4A3D G;  3TRZ A;  1NMF A;  3H0G H;  4JBM A;  1I50 H;  2VQE L;  1YIJ A;  3S1M H;  2WFW A;  3GO5 A;  1CSP A;  2ZM6 Q;  1HZB A;  1XNQ L;  1HZC A;  4GKK Q;  5C3E H;  2Z6K A;  4MZ9 A;  3K80 C;  3NEM A;  3CCJ A;  1VS0 A;  3OW2 A;  5LMU L;  4C2M H;  1TWH H;  1EFW A;  1YHA A;  3EBE A;  3UDX A;  3HOX H;  2I0Q A;  4BBS G;  3I4M G;  4DR6 L;  4EQ5 A;  2IX0 A;  2JA9 A;  4LF5 L;  2ZM6 L;  2NZO A;  4JBK A;  4X62 Q;  1Q81 C;  2MO0 A;  1AH9 A;  1VQ7 A;  2I5M X;  1M90 C;  1G6P A;  3TS0 A;  3PUY A;  3M4Q A;  4POF A;  1GM5 A;  1B70 B;  4JI1 Q;  1DGS A;  4R4I A;  1HR0 L;  1H95 A;  1TWC H;  2JA6 G;  4DV0 Q;  1X6O A;  2UXC L;  2N8N A;  1KXL A;  4XTC S;  1A62 A;  2N49 A;  1IBM Q;  4L5R C;  5JJL A;  4X62 L;  2PQA B;  1VQL A;  4GNX C;  1T9H A;  2BH2 A;  4A93 G;  3A5U A;  4YWM A;  1X54 A;  4JI1 L;  3RLO A;  5LMN W;  1L1O B;  1OXX K;  1UE5 A;  1N36 Q;  4WJ4 A;  1HNX Q;  1VQO A;  1EYG A;  2UU9 Q;  1Z47 A;  2YTV A;  4O2D A;  1QVF A;  4IPC A;  4MTN A;  5IYC H;  3CCS A;  4OWX B;  2K5H A;  3J80 c;  5M3F H;  1JJG A;  2VS1 A;  4DR1 L;  4NXM Q;  3CCR A;  4IFD G;  4HJ8 A;  1JMC A;  2JA7 G;  5IWA L;  1HNW Q;  5GAD C;  2D0P A;  4OXP A;  2OTL A;  4BBR H;  1YVC A;  4A3I H;  4A3C H;  3CCL A;  1N36 L;  1VQK A;  3T1Y Q;  3F2C A;  4B3R L;  1J6Q A;  1PH3 A;  1SLJ A;  3M7N A;  4A3B G;  3CQZ H;  3CMA A;  3RNU A;  4LUZ A;  1IBL Q;  3STB C;  3HOZ H;  5M3M G;  1D7Q A;  2B3G A;  3TS2 A;  3K7U C;  3MEF A;  3J7Z C;  1PA6 A;  3S1N H;  3J81 c;  4OO1 G;  2N3S A;  4JI7 Q;  4JOI C;  3I7F A;  3GTJ H;  2E5L L;  4DV4 Q;  2VL6 A;  3CCV A;  2D62 A;  2Z0S A;  5LMN Q;  3CCE A;  4OX9 L;  3L7Z C;  3CP0 A;  4UPA A;  5DLQ E;  4X66 Q;  2QEX A;  1VQG A;  4LF9 Q;  3K7A H;  4LF4 Q;  4DAY B;  1PH8 A;  4H02 A;  3PCO B;  1IBL L;  2RHS B;  4QJF A;  4L5S A;  3J80 i;  3I55 A;  3G71 A;  2VNU D;  5C4J H;  4DV6 Q;  3KDF B;  2VQF L;  2CCZ A;  4AQY L;  5ELO A;  5FJ8 H;  4A3F G;  4JI7 L;  3PO2 H;  5JEA J;  4HIK A;  3U4Z A;  1XMQ L;  2K75 A;  5IYB G;  3G4S A;  4DNI A;  4BXX G;  3FP9 A;  2I5L X;  3KOJ A;  1VQD A;  3PSI A;  3PIO A;  2PMZ E;  3PF4 A;  4X66 L;  4LF9 L;  4A3L H;  1Q8K A;  4A3E H;  1VQE A;  1OXV A;  4GN4 B;  1XPO A;  4BY7 H;  4OO1 I;  1E24 A;  5C44 G;  4DR4 Q;  2Y0S E;  4LUV A;  3KFU A;  4YHH Q;  1Q7Y C;  1Q12 A;  2B63 G;  4DV3 L;  3CD6 A;  3J81 i;  2KEN A;  1YHQ A;  3J7A 5;  1NE3 A;  2GVB A;  3S2D H;  4A3J G;  2KHI A;  1VQC A;  4GNX B;  2UUB L;  3PO3 H;  3S14 H;  4C3H H;  3HOZ G;  4JBW A;  2OWO A;  1YI2 A;  4GKJ Q;  4P72 A;  2XTI A;  4JG2 A;  3RLN A;  4DAM A;  1UEB A;  4YWK A;  2MFI A;  1PHJ A;  4YHH L;  2Q2T A;  2YYZ A;  4DR3 L;  1IYJ B;  2PQA A;  2VY3 A;  3KYH C;  1GO3 E;  1IBK Q;  4UP7 A;  3S16 H;  3NBH B;  3M4O H;  1CKO A;  3E9I A;  4Y52 H;  1L1O A;  4R4C A;  1FJG L;  3PUZ A;  1QZG A;  1P16 A;  1W3S A;  1J5E Q;  3K0X A;  2K52 A;  2H5X A;  1S40 A;  1LYL A;  4JYA Q;  5C4X H;  1EWI A;  1MKH A;  1IBK L;  4LF6 Q;  1XMO L;  4JI4 Q;  2A19 A;  4DR5 Q;  4BA2 I;  4A3G G;  3HKZ E;  4A3D H;  2F52 A;  4HJ5 A;  1NY4 A;  4P74 A;  2UUA L;  3I56 A;  2GN5 A;  5GAG C;  3F2D A;  2HQL A;  1PYS B;  3AFQ A;  4DPG A;  2WB1 G;  3UDG A;  3DM3 A;  4JYA L;  1GVP A;  1WOC A;  4AIM A;  4JI2 L;  2LXK A;  5IYD G;  4LF6 L;  4NXN L;  3M4P A;  4GLV B;  2F3I A;  3AEV A;  3RZO H;  2LSS A;  3HOW G;  3CCM A;  3DLL A;  5H1S E;  4C3J H;  4GS3 A;  1PVO A;  2CKZ B;  3UE1 A;  1KIX A;  2JEB I;  1SE8 A;  3HOU G;  3RLF A;  1Y1V H;  1PH9 A;  1TWG H;  4YCW A;  1O7I A;  3CCU A;  3KDF A;  1N34 Q;  3GDE A;  1HJP A;  4YCV A;  5BR8 Q;  3CXC A;  4LNQ A;  2OTJ A;  2YV5 A;  3PUV A;  2ID0 A;  2WB1 E;  3I4N G;  1PH2 A;  4NB3 A;  1WCM G;  1X3E A;  1PH7 A;  2R93 G;  1X3G A;  5IYD H;  3M85 A;  1B8A A;  4ALP A;  3EN2 A;  4R4Q A;  3WWV A;  3JAM c;  4GKK L;  3HOY G;  1JB7 A;  1G51 A;  4IOA A;  1IZ6 A;  2E2J H;  1SN8 A;  2RHQ B;  1Q46 A;  2R92 G;  1I6H H;  3W1G A;  4BY1 G;  4XIG S;  4GNX A;  1GKH A;  3S17 H;  1MJE A;  2OCE A;  4J15 A;  3W5O A;  1L2F A;  1VQP A;  1VQ6 A;  1NJI C;  1LUZ A;  3UDI A;  4IPG A;  4C3I H;  1P8L A;  2K14 A;  3ERS X;  4OON A;  4IJL A;  2RF4 A;  1I94 Q;  1OXT A;  4ME3 A;  4A3K G;  2E2I H;  2XGT A;  4GN5 A;  3HOV H;  3H0G G;  1Q1B A;  3GTL H;  1EIF A;  2ZTE A;  4JCV E;  4DV0 L;  1QZH A;  5M3M H;  2ATW A;  3H3V H;  2AWN A;  3RR5 A;  1IBM L;  5C3E G;  4DV1 Q;  2DUD A;  1A63 A;  5IP7 H;  5FLM H;  1I94 L;  3JAM i;  1Q1E A;  1BKB A;  1QUQ B;  3F8T A;  4JC0 A;  4HIO A;  2PI2 A;  4WJ3 M;  2KBN A;  1EQR A;  2B29 A;  1HNX L;  4IO9 A;  2UU9 L;  1PH6 A;  2VUM G;  4JOI A;  4JV5 Q;  3F2B A; 
#chains in the Genus database with same CATH topology
 3HFZ B;  1ZYR C;  3I4O A;  3PIP A;  4IUP A;  3ULP A;  1HNW L;  1X9N A;  5C4H A;  1STG A;  2YTY A;  3S15 B;  1YNJ D;  4K6D A;  2PI2 E;  2IX1 A;  1XNR Q;  2R6G A;  2PO4 A;  2JA8 G;  1LV9 A;  1I4P A;  3KF6 B;  1DM0 B;  3HOW B;  2IWH A;  2ZXR A;  1SMX A;  1MD2 D;  1S72 A;  4DV4 L;  4A3J H;  1Z9F A;  1HH2 P;  3AYH B;  2JA5 G;  1E1T A;  4DV5 Q;  2K50 A;  3JAM L;  1Y8O B;  4KHP L;  5JOB A;  1V43 A;  1A15 A;  2NVQ H;  1BVS A;  1Y1W H;  1WCM B;  4QL5 A;  4JI0 L;  2WAQ E;  1R4P B;  3E6Z X;  4UDU C;  4BA1 I;  4DUZ Q;  1ENC A;  1RL2 A;  3ULL A;  5C0X H;  2KHS A;  3G6E A;  1TS3 A;  1LLR D;  4A76 A;  1VCI A;  4CDD C;  3G48 A;  4JI8 Q;  2J4X A;  3KLS X;  5GRO A;  1ASY A;  3OTO L;  3I2Z A;  2EOT A;  1OTC A;  4GKJ L;  2N88 A;  4K0K L;  1G91 A;  4A3K B;  3BVM A;  1A8V A;  5IYD H;  1SDF A;  3PO2 G;  2PZU A;  4IOA A;  2L1B A;  1NR2 A;  2OEO A;  5M5W H;  4BY7 G;  1EWC A;  4K5X A;  4NW2 A;  4C2M B;  4A75 A;  2KCT A;  1AW7 A;  3CHB D;  4DK6 C;  2BDO A;  3ZJY C;  5C0X J;  4TQU S;  4J8Q A;  4RKL A;  3ULJ A;  1B53 A;  4ZK9 B;  3OPO A;  1NUC A;  2DNE A;  4O1N A;  4JPB W;  3KF6 A;  3ZYY X;  1CKN B;  3Q22 A;  4LFA Q;  3ICE A;  3GD7 A;  1VDZ A;  5ELD A;  2WAQ B;  4BY1 H;  1PH4 A;  1O80 A;  3CPW A;  3K5N A;  2PNR C;  3SHL A;  2FMM A;  1U4L A;  5T1G A;  4U67 3;  2CHB D;  3URY A;  3QJY A;  3G7L A;  3QOL A;  3BDO A;  4HID A;  2NVX H;  4DR6 Q;  1WVL A;  4KKU A;  3I70 A;  4BBR B;  1EY8 A;  3HEJ A;  4GLA C;  2RKS A;  1QNU A;  2UXB L;  2EYP A;  3TDQ A;  2QDB A;  2MHV A;  4G4K A;  1PLF A;  2VUM H;  2C35 B;  4A3B H;  1VQ4 A;  3L9A X;  5CC4 A;  1PDQ A;  1NNX A;  5ELN A;  4RHS A;  1IL8 A;  4CDE C;  3W1B A;  2K01 A;  3QB3 A;  5CMD A;  2KEE A;  5C4J B;  4ZUI A;  5COR A;  1YNJ C;  3HOX G;  1F2L A;  3MXN B;  3QIA A;  4QUF A;  2MQH A;  1C8C A;  1LTG D;  3K81 C;  5IGB A;  2J0T D;  4EX5 A;  1K0R A;  2UUC L;  5IE8 A;  3HGB A;  4BXX H;  4AYB G;  4Y7N H;  2CVR A;  3P20 A;  4KY6 A;  4JV5 L;  2OQ0 A;  2KHJ A;  5JAV A;  4DR2 Q;  3J7A F;  3S1Q H;  1C48 A;  3S2D B;  3FPU B;  4KD4 A;  5KYI A;  2E5L Q;  2B63 H;  1A0I A;  4K8I A;  1CZW A;  1CKN A;  1K3R A;  3R8B A;  3HOV G;  2C5C A;  1KQS A;  1XJV A;  1QE6 A;  4UP8 A;  1B7Y B;  5JEA G;  4JI5 Q;  2XNA C;  5G3L F;  4B3T L;  1GUT A;  4XDX A;  1KAB A;  4O0A A;  1F9R A;  1YEZ A;  3KJO A;  2L5T A;  3NUC A;  4JVZ A;  3LWE A;  2K32 A;  1TWF H;  3VR2 A;  4FXG C;  3R2T A;  1DXM A;  3STB D;  3TP7 A;  1EZ8 A;  1L0W A;  3JAM E;  4X3U A;  4HIM A;  3J81 j;  4A3D B;  1DD2 A;  2AKW B;  3FRP B;  2F0K A;  1IYU A;  2UUB Q;  3A8K E;  1ASZ A;  4EGV A;  1JWU D;  2WP8 J;  4DUZ L;  1Q90 A;  3N52 A;  4FDB A;  2R7D A;  3CAM A;  1O7L A;  2B2U C;  2R7F A;  4YY3 Q;  4AH6 A;  2CW0 D;  4WJW A;  5LL6 S;  2B2T A;  5FO9 B;  1CUK A;  4KHZ A;  1TWG B;  2A68 D;  3GTG H;  1FL0 A;  3X3M A;  3MXN A;  1V9P A;  3B6Y A;  2ZJP A;  1IL2 A;  3GTP H;  2A69 D;  1XMO Q;  2AUK A;  2HDM A;  2EQS A;  2OQK A;  3CPF A;  1R4Q B;  3NE5 B;  4MIU A;  4WOR A;  4KY5 A;  2UUA Q;  2KED A;  3U58 A;  4R4T A;  2B2W C;  2K33 A;  3PO3 G;  4X6A H;  4C3H G;  3D4R A;  1X56 A;  2R93 H;  2E2J B;  1HZA A;  3TZU A;  3H15 A;  4HJ9 A;  4A4I A;  1M1K C;  3M3Y H;  1EZ6 A;  2JA7 B;  4RFB A;  2BH8 A;  4K5W A;  3Q8D A;  3J81 L;  1LAC A;  1U5K A;  5IOD A;  3BZD B;  3T4A C;  5I6Y A;  3K5L A;  1SNP A;  1B4O A;  1ICF B;  1AE3 A;  4LFA L;  1V1O A;  3TEH B;  5M3M B;  1AP0 A;  3H0G H;  1WTO A;  3I8Z A;  3OWE B;  5FLX E;  2XRQ D;  5C3E H;  2OF1 A;  5DEH A;  2SNS A;  3NEM A;  1EFW A;  4LK1 C;  3NQT A;  3OW2 A;  2I0Q A;  3EBE A;  3FKI B;  4DR6 L;  3S9W A;  2JA9 A;  2F03 A;  1E2W A;  2ZM6 L;  3C1F A;  1X3P A;  3PQI A;  4X62 Q;  1K28 A;  1GUO A;  1XYI A;  1NR4 A;  2J7Z A;  2OT2 A;  4JI1 Q;  5D3I B;  2B2V C;  4HR7 B;  1TWC H;  2NVT B;  1BR9 A;  1U4M A;  3P75 A;  2PQA B;  1DYQ A;  2E74 C;  1EEF D;  4GNX C;  4HAE A;  1X54 A;  5HUR A;  1UE5 A;  3EQL C;  3HZX A;  4WJ4 A;  1LT3 D;  1HPC A;  4F88 A;  1Z47 A;  1FGB D;  2YTV A;  4O2D A;  3ND8 A;  4OWX B;  5M3F H;  5GAD C;  2D0P A;  4OXP A;  2OTL A;  4A3I H;  4R9W A;  4A3C H;  1N36 L;  2F0G A;  1PH3 A;  3MHB A;  3QWN A;  2WKC A;  3STB C;  4JI7 Q;  2E5L L;  2JP1 A;  1H9K A;  2Z0S A;  1LTB D;  2MPM A;  3CP0 A;  2EJM A;  1HTP A;  5HGT A;  5C3W A;  1BF4 A;  1WD1 A;  4DV6 Q;  2CCZ A;  3KDF B;  3T56 B;  5ELO A;  3PO2 H;  2RSN A;  3PSI A;  1VQD A;  2WAC A;  3PIO A;  4KJO A;  2CW0 C;  4BY7 H;  2A68 C;  1TII D;  4BBS B;  3U9O A;  2A69 C;  3DMU A;  4A3J G;  4GNX B;  2UUB L;  3OIP A;  2YU9 B;  3HOY B;  4DAM A;  2XTI A;  4JG2 A;  3RLN A;  1LTT D;  2PQA A;  3S1R B;  2B2W A;  1SYF A;  3S16 H;  3I72 A;  1RKN A;  2K04 A;  3NP8 A;  1CKO A;  1UUP A;  4Y52 H;  2NBF A;  5KIX A;  5CV6 A;  3PUZ A;  1EY6 A;  1P16 A;  2FJ2 A;  1ILP A;  1J5E Q;  3UI2 A;  4A93 B;  3D6W A;  1IKL A;  1LYL A;  3ND9 A;  3GV6 A;  4ABN A;  1BO0 A;  1MKH A;  1IBK L;  1XMO L;  1RJT A;  3C1E A;  3J80 E;  4P74 A;  2UUA L;  2B8G A;  3Q6S A;  5GAG C;  1PTO H;  1QG7 A;  2EYL A;  2HQL A;  3NWT A;  3F2D A;  3CKI B;  3UDG A;  4JYA L;  3TSS A;  3VR3 A;  3F2U A;  4FF3 A;  5IYD G;  5EJW A;  4N8F A;  1CHQ D;  1PTO F;  5EPL A;  2KEC A;  2WII B;  4HMI A;  3HOW G;  3CCM A;  4C3J H;  2L0C A;  3SVM A;  3J81 E;  1XWE A;  3NTI A;  3RLF A;  5I9O A;  1PH9 A;  5JPN C;  3DWP A;  3KDF A;  1WTP A;  4KJN A;  1N34 Q;  3RUZ A;  4YCV A;  5BR8 Q;  4H0L C;  3I4N G;  3PIP 3;  4G7Z C;  1PH2 A;  4NB3 A;  1WCM G;  1X3G A;  4DXG A;  1HFN A;  1B8A A;  2B2V A;  3EN2 A;  1H9M A;  1PRT D;  1FNU A;  1Q46 A;  1TT2 A;  4C1N I;  3W1G A;  4BY1 G;  1EYD A;  1SNO A;  4GNX A;  2RBM A;  1MJE A;  4J15 A;  1GJX A;  1CTM A;  5KEE A;  2K14 A;  5COY A;  4OON A;  3TP5 A;  3NSW A;  4A3K G;  2E2I H;  1DOM A;  1I4Q A;  2WV6 D;  1EQV A;  3HOV H;  1Q1B A;  3GTL H;  1EIF A;  1BCP F;  5JEA H;  1EU3 A;  1QZH A;  3H3V H;  2IL8 A;  1BNZ A;  3RR5 A;  3I3C A;  3A7L A;  4KY7 A;  3SK4 A;  1HXY D;  2R7Z B;  1A63 A;  4O42 A;  1Q1E A;  3MXG A;  1EQR A;  2B29 A;  3DUZ A;  5BN5 A;  4IO9 A;  1PH6 A;  2VUM G;  1A2U A;  3F2B A;  1LTA D;  4DF7 A;  4CDF C;  3MFG A;  1SEB D;  1LTI D;  1N9W A;  2LXJ A;  5IY0 A;  1QIL A;  1VMC A;  3M4Y A;  1F9S A;  1NCV A;  2DGY A;  1I5F A;  1C4Q A;  2KCM A;  2WAQ G;  1EQT A;  3L0O A;  4KHP Q;  2EY2 A;  1KC8 C;  1FD7 D;  5LL6 X;  5GQO A;  4GLX A;  4OWT B;  4S3S A;  5K36 G;  3HOU B;  1BBU A;  4JI0 Q;  3FVQ A;  5IYC G;  2MUY A;  2RDG A;  2IHF A;  4DV6 L;  4BBR G;  2F0S A;  4C56 C;  2F1M A;  4A3M B;  2DY7 A;  1GOZ A;  3OTO Q;  4JI6 L;  3C46 A;  1DON A;  2LY7 A;  4K0K Q;  1KD1 C;  1HUM A;  5KNB A;  3BU2 A;  2JJQ A;  5J3B A;  2NTT A;  3FPP A;  3OIQ A;  3TP8 A;  1ML0 D;  1N8R C;  4TVA B;  4ZUJ A;  1RD9 D;  1K83 H;  4JBJ A;  4DK0 A;  1EIY B;  2F0H A;  4GN3 B;  4QUC A;  1E1O A;  3NEN A;  5FJ8 G;  2UXD Q;  4RMF A;  3CCQ A;  4LFB Q;  4K6L A;  3T13 A;  3I91 A;  3IRB A;  1LO5 D;  1I3Q H;  1AZQ A;  1H9S B;  1J5E L;  4FXD A;  4KTA A;  1TWH B;  1EL0 A;  4L5T A;  1N33 Q;  3GTM H;  3U50 C;  4DA2 A;  1V1P A;  4RCN A;  2FFK B;  1JOQ A;  4OEL B;  4V19 0;  1K8G A;  4IOC A;  5E4X A;  3S24 A;  2F4V Q;  4L8J A;  4WRD A;  2BA0 A;  3PGZ A;  4XT1 B;  1HR0 W;  3D4W A;  5IGD A;  3KBX A;  3PUX A;  2F0P A;  3UDF A;  1JT8 A;  3IFD A;  4ULL A;  4OWW B;  1PRT C;  2NVY H;  1M4V A;  2UXB Q;  5KGU A;  4YCU A;  1VQ8 A;  3BDL A;  1G2S A;  1N34 L;  3OMG A;  3GTK H;  3OSO A;  3PV0 A;  1B9N A;  5BR8 L;  3CC4 A;  3Q0A A;  4RAU C;  1R9T H;  2ZJQ A;  1D5X C;  2BDN A;  4XYO A;  3H6M A;  1VQJ A;  1CT1 D;  4QIW B;  1C7Y A;  4IUN A;  2LKV A;  1HR0 Q;  3HOZ B;  4POG A;  1D8L A;  5I4D A;  5IGC A;  1C9O A;  4RG1 A;  1S5B D;  3BYT B;  3VYU A;  5IT9 c;  1VQF A;  1K0S A;  1EY7 A;  3GTJ B;  1HA6 A;  3UE0 A;  1MSG A;  1Y8N B;  4MN3 A;  5C5M A;  2HDL A;  2NYZ D;  1SSO A;  2UUC Q;  5CV5 A;  3Q24 A;  1AEX A;  1VQB A;  3AMU A;  1A3V A;  2K05 A;  1TU2 B;  1E0B A;  1LAB A;  1CFM A;  3ITP A;  1M8A A;  2NB0 A;  2VW9 A;  1SFO H;  1SJE D;  1H9R A;  3EIV A;  1CA5 A;  2A1A A;  4QB4 A;  4CJ1 B;  3BYY B;  3J7A V;  5JVG 3;  5L37 A;  1Q8I A;  2DNC A;  5EKK A;  3BZC A;  5JVH 3;  4B3T Q;  1PRT B;  3OHX C;  2E2D C;  3GTQ H;  2K4K A;  1TXY A;  1G8Z D;  3OOC A;  4C1N K;  3RN5 A;  4QMG A;  1KRT A;  5ELC A;  4OX9 Q;  3DHQ A;  4CBV A;  2HD3 A;  2E2H H;  1UE1 A;  1PZK D;  4IFD I;  1SE4 A;  5M3F G;  2EXZ A;  1EY9 A;  4I7A A;  2VQF Q;  3M4O B;  2NN6 G;  5A35 A;  4PZ7 A;  3FHW A;  5IP7 G;  5FLM G;  4TSS A;  1VQ5 A;  4A3I G;  4A3C G;  1F9P A;  2IPK D;  3TME A;  3D8G A;  2C9O A;  2RSO A;  5C4X B;  1B50 A;  3FKI G;  2NN6 I;  3K8A A;  4DV7 L;  2VZA A;  4KLK A;  3KLW A;  4NMZ A;  2HQE A;  1B3A A;  3S15 H;  3QR8 A;  3RZO B;  4V0B A;  2AQ3 B;  4DR3 Q;  2IY5 B;  4QQB X;  5JJK A;  1WFQ A;  1W6K A;  2B2Y C;  3PUW A;  4LF8 L;  1TR5 A;  3HOW H;  1TQO A;  2H1E A;  1D1K A;  1JR0 D;  4TRD A;  5GAE C;  1OXS C;  4NKL A;  3R3O A;  1NTG A;  1K8A C;  1D2B A;  1ZXT A;  1YBY A;  2B2T C;  4EQP A;  1GD7 A;  2UXD L;  3U4V A;  1STE A;  4LFB L;  3BJU A;  1ONL A;  3KJP A;  1EY5 A;  4JI3 L;  4UY8 C;  4P73 A;  3I4N H;  1WCM H;  1I6H B;  2EIF A;  2ZTD A;  4PMB A;  4X64 L;  2FHT A;  4U68 A;  1N33 L;  3EFX D;  1VMP A;  4C3I B;  2CH4 W;  5J1Z A;  4L5Q A;  5FLX L;  3K0Y A;  1BUV T;  2F4V L;  4IUR A;  2CQO A;  2NZH A;  2QGQ A;  4DFA A;  4R1J A;  4B3M L;  1DJR D;  4A3K H;  1MSH A;  2IJ0 A;  3IFT A;  1KNA A;  1CK1 A;  4JBM A;  3VYR A;  4CKB A;  2ZM6 Q;  2JN4 A;  1HZC A;  2K6A A;  4Z9C B;  2D5D A;  1MHW C;  3NWS A;  1SAP A;  3K80 C;  3MTS A;  4FVM A;  4Q5V A;  4XQQ A;  4C2M H;  2O4X A;  3UDX A;  4BBS G;  4C3J G;  4OGQ C;  3VA5 A;  2NZO A;  4JBK A;  2MO0 A;  1AH9 A;  2I5M X;  4MTK A;  3PUY A;  1GM5 A;  5C44 B;  3A55 A;  4R4I A;  1HR0 L;  3DXJ C;  5BN4 A;  5JJL A;  5M5X B;  4L5R C;  5IGE A;  5EBD A;  4CKC A;  2MJ8 A;  4A93 G;  1F2Z A;  5LMN W;  1ILQ A;  1N36 Q;  5K36 H;  1O7Z A;  1HNX Q;  1EYG A;  1DOL A;  4OEM B;  1QVF A;  3V05 A;  5IYC H;  3CCS A;  2VS1 A;  3NXW A;  4M1U B;  4NXM Q;  4DGZ A;  1TKW B;  5CV4 A;  2HUG A;  1XX8 A;  2SOB A;  3EJI A;  1ET9 A;  3MWY W;  4BBR H;  3CCL A;  2X69 A;  3S2H B;  2SDF A;  2QW7 A;  1D7Q A;  2P5Z X;  1TWA B;  3TS2 A;  2OXP A;  3MEF A;  1PA6 A;  4JOI C;  3I7F A;  5ELF A;  2DY8 A;  2D62 A;  3CCV A;  5LMN Q;  1QNK A;  2PW7 A;  4OX9 L;  5DLQ E;  1CZG A;  4K5V A;  1STN A;  2QEX A;  1VQG A;  4YIJ A;  4X3S A;  4DAY B;  4QJF A;  2EY5 A;  3I55 A;  3G71 A;  2VNU D;  5C4J H;  2F0I A;  1KDB A;  2VQF L;  5FJ8 H;  5I2X A;  3U4Z A;  2A73 B;  3PF4 A;  2K03 A;  3SE0 A;  1QWY A;  4LF9 L;  1OXV A;  1VQE A;  4GN4 B;  2B2Y A;  4DR4 Q;  4LUV A;  3KFU A;  2EYM A;  1Q12 A;  5A2Q L;  4GZY C;  1MBY A;  1MI2 A;  1PZJ D;  4R8N A;  3I4M B;  5DNF A;  1YHQ A;  3S2D H;  4JBW A;  5JPM C;  2F4I A;  4YWK A;  2XSC A;  2R92 B;  4DR3 L;  1LT6 D;  2VY3 A;  1IBK Q;  4UP7 A;  2JA6 B;  3O13 A;  1S5E D;  3E9I A;  3J80 L;  1G6Z A;  2PCF B;  5ISR A;  1W3S A;  3GTO B;  3K0X A;  4RCO A;  2I46 A;  4OIJ A;  1S40 A;  3E5S A;  2XWB B;  4JYA Q;  3FDT A;  1SND A;  4DR5 Q;  3MEH A;  4A3D H;  4HJ5 A;  4IUT A;  4CJ2 C;  1EIH A;  1CHP D;  1LTR D;  1GVP A;  1WOC A;  4LF6 L;  2EYH A;  2F3I A;  1DZ1 A;  5H1S E;  2N55 A;  3HP3 A;  2CKZ B;  3X3N A;  3UE1 A;  1KIX A;  1ESR A;  3HOU G;  1SE8 A;  1IHZ A;  1PFN A;  4DAY A;  1JOK A;  1TWG H;  4FO2 A;  4YCW A;  1IKM A;  3CCU A;  2JA8 B;  1EY4 A;  5EKL A;  4IN3 A;  4LNQ A;  2OTJ A;  2ID0 A;  2WB1 E;  3TBI B;  4A3F B;  2JXM B;  3ERQ A;  3KBG A;  4WFN 3;  1PH7 A;  4JK1 C;  1STH A;  1S4Z A;  2BOS A;  1MGS A;  3WWV A;  3JAM c;  2JA5 B;  2RQX A;  1JB7 A;  1IZ6 A;  2E2J H;  2RHQ B;  3RZD B;  1GKH A;  1L2F A;  1DCZ A;  4IFD H;  3N6R A;  1B2T A;  1P8L A;  1OXT A;  2XGT A;  1VF5 C;  2XWJ B;  4GN5 A;  1WD0 A;  5M3M H;  2NN6 H;  3K58 A;  4DV1 Q;  5IP7 H;  5FLM H;  1PFM A;  4LAA A;  3JAM i;  4HIO A;  1CM9 A;  1HNX L;  4JOI A;  3H09 A;  3FKI H;  2B39 A;  3P7J A;  2CQA A;  4NXM L;  4A3G B;  4K2L A;  5IYB H;  1JB3 A;  1U4P A;  1EYC A;  1EFI D;  4IFD J;  1K8M A;  2WB1 B;  5IOC A;  3NTK A;  1IW7 D;  2PZT A;  1RHP A;  4LWC A;  1QB5 D;  2Q2H A;  4UAI A;  2ICE C;  2EYO A;  2IW3 A;  1EOT A;  1OXU A;  2K7V A;  2NVT H;  3MAQ A;  4ZQ3 A;  4G57 A;  3SDZ A;  2EY1 A;  4B3S L;  1HHV A;  4QGU A;  4DUY L;  5LMN L;  2XVS A;  4JI6 Q;  2F0D A;  2X6G A;  1FGU A;  4PZ6 A;  1QCB D;  4IUV A;  3MA2 B;  3A8J E;  1Q3L A;  4LF7 Q;  2Q2I A;  2HCI A;  2Z1C A;  4DR7 L;  2A6H D;  4F7X A;  3CRL C;  1VQ9 A;  4QY7 A;  2Q2U A;  4DR4 L;  2PZW A;  5A2Q E;  5IT9 L;  1KHI A;  3AB9 A;  4HMJ A;  4LFC Q;  5M9O A;  1U0L A;  4IZ8 A;  4GOP C;  3QO2 A;  1L0X B;  3A74 A;  1EQQ A;  3D31 A;  4X3T A;  1WYD A;  4CDC C;  5LHY 1;  2VXW A;  1VQI A;  2KVM A;  1RCV D;  4ILW A;  1B44 D;  2MO1 A;  1I50 B;  3S1M B;  2L9H A;  1NSN S;  2E76 C;  2F3W A;  2RVL A;  2O5I C;  3AU7 A;  1BBX C;  1HZ9 A;  1Z6H A;  2FMC A;  2QF7 A;  3OYY A;  5HGQ A;  1XPU A;  2PNH A;  3HOX B;  1JOR A;  1RIP A;  1YHB A;  2ALY B;  1UE6 A;  4DR5 L;  3T51 B;  4B08 A;  1CSQ A;  4BBS H;  3BG3 A;  2I07 B;  3PF5 A;  1KL9 A;  1W2B A;  2JE6 I;  3AQQ A;  2YU9 H;  3HOY H;  4K2K A;  5DM7 3;  1I4H A;  1X65 A;  3D0F A;  3K6O A;  2A8V A;  3S1R H;  2VB2 X;  3BZK A;  4KMU C;  4PNY A;  4R8I A;  4CGY B;  4H13 C;  5C4X G;  2A6E D;  2MP1 A;  3HOV B;  2HHH L;  2JEA I;  4A93 H;  3C3L A;  2D2C C;  3GP7 A;  5E3F A;  5LMU Q;  3OW7 A;  3LNN A;  4LF5 Q;  3VYS A;  1JE4 A;  4X65 L;  4GOP B;  3AFP A;  5FOB B;  2EYF A;  3CQZ B;  2ENB A;  4P71 A;  2Z6K C;  3SK6 A;  1YJN A;  4DN4 M;  3S1N B;  2UXC Q;  1LT5 D;  5J39 A;  4K8J A;  3ER0 A;  1HCZ A;  2B8F A;  2QDL A;  1K8O A;  4OHJ A;  4ZAI A;  3K7A B;  1S5F D;  2IT1 A;  4KN7 C;  1UEA B;  3K5O A;  1VQM A;  1UAP A;  3WOE A;  1K9M C;  2KQ3 A;  1CI3 M;  1KDA A;  1IW7 C;  4LJZ C;  4HED A;  1SXT A;  4I65 A;  4DV1 L;  2RA4 A;  4A3E B;  1YIT A;  1V1P B;  4B3R Q;  5C4Z A;  2R61 A;  1YZ6 A;  1UWV A;  1TS4 A;  5M5Y H;  3PO3 B;  2CWP A;  3S14 B;  4C3H B;  2CWA A;  2AWO A;  4HN7 A;  2K5W A;  1D6E C;  2HIV A;  1LT4 D;  4RH6 A;  1JE5 A;  3NHH A;  2M2L A;  1GUG A;  2A6H C;  4I7Z C;  2F0O A;  1KDC A;  1C0A A;  3NQI A;  4DV7 Q;  1XMQ Q;  5KYL A;  2D0O A;  4IUQ A;  4RGT A;  4P2C B;  2EXD A;  2AQ2 B;  2R7Z H;  3TRE A;  1Q82 C;  2EE1 A;  2K5N A;  4DNT B;  1E3P A;  1NBW A;  1WTR A;  4OO1 I;  4DV3 Q;  4OIK A;  4GOP A;  2EPB A;  3IKJ A;  3NTH A;  1JWS D;  5KRU A;  4LF7 L;  1LTL A;  4DV2 L;  1HNZ L;  4LF8 Q;  4XQN A;  1CKM A;  1KRS A;  2JK8 A;  3E9H A;  1KAA A;  5TSS A;  1PH5 A;  4KKT A;  4HTH A;  5IT9 E;  3EA6 A;  1XPR A;  1YNX A;  2AMC B;  4LFC L;  2F0J A;  3A5Z B;  4QIW E;  4EQN A;  1O7Y A;  2HT1 A;  4JI3 Q;  1Y1V B;  3HOU H;  1V8Q A;  1WTW A;  4HJA A;  2ZJR A;  4X64 Q;  3E0E A;  1L0Y B;  1BDO A;  2L11 A;  1XTD A;  3VR5 A;  3VR4 A;  3CU7 A;  4A3M H;  2G9D A;  1BOS A;  2L4N A;  4IQZ A;  4ID6 A;  4JI2 Q;  5C6A A;  5IP9 G;  2FXQ A;  2A6E C;  1K73 C;  3S17 B;  3CF5 A;  4B9W A;  4B3M Q;  5G3L D;  1SNQ A;  2QKI C;  1I4X A;  2QA4 A;  1W6J A;  1SRU A;  3T1H L;  1N32 L;  4PMW A;  3KF8 B;  4KD3 A;  4PV1 C;  4HSP A;  2YTX A;  3BVG A;  4A3D G;  1NMF A;  5K5P A;  1YIJ A;  2Y0S B;  2WFW A;  3GO5 A;  3V96 A;  1CQF A;  1TY0 A;  3MFY A;  4F87 A;  2Z6K A;  4MZ9 A;  3CCJ A;  5KND A;  5LMU L;  1TWH H;  1YHA A;  3I4M G;  4BS9 A;  4EQ5 A;  1JWM D;  5I2Y A;  4LF5 L;  4DAP A;  1M90 C;  5DAU A;  3M4Q A;  4POF A;  2KUM A;  1B70 B;  2D9U A;  1GUN A;  2TMP A;  3NPP A;  1H95 A;  2JA6 G;  1JCK B;  5FKA C;  1X6O A;  2KOL A;  1ZEQ X;  2N8N A;  3RD4 A;  2UXC L;  1HUN A;  1KXL A;  1RF2 D;  2Z9H A;  4A3J B;  3BVZ A;  1VQL A;  3KLS A;  2SNM A;  3HKZ B;  4YWM A;  3RLO A;  1OXX K;  4G7H C;  1VQO A;  2DJG C;  4IPC A;  3BDC A;  2K5H A;  1STB A;  1FNW A;  4BWG B;  4ZYS A;  4IFD G;  2EJF C;  4HJ8 A;  2JA7 G;  2NVQ B;  2E75 C;  1Y1W B;  1YVC A;  1EYA A;  1VQK A;  3T1Y Q;  4B3R L;  1J6Q A;  1E2V A;  1SLJ A;  2F0Q A;  4LUZ A;  3HOZ H;  5M3M G;  1H9J A;  2B3G A;  2N3S A;  4X3K A;  3GTJ H;  2EY6 A;  2VL6 A;  3KF8 A;  2F0E A;  5JJZ A;  3R93 A;  3L7Z C;  1JIC A;  4UPA A;  4LF9 Q;  5NUC A;  4LF4 Q;  1IBL L;  3A56 A;  4H02 A;  1HA5 A;  2RHS B;  4A3F G;  4HIK A;  1XMQ L;  3OWF A;  5IYB G;  2QIL A;  5M5W B;  4DNI A;  3DEO A;  4X66 L;  4B9X A;  1XPO A;  1E24 A;  4JW0 A;  2Z4H A;  3HS0 C;  1S5C D;  4ZKC B;  3K59 A;  4DU9 A;  3I4N B;  4DV3 L;  3CD6 A;  2KEN A;  2KHI A;  1VQC A;  3SK5 A;  2OWO A;  1XTC D;  4P72 A;  2MFI A;  2XN9 C;  1PHJ A;  1PRT F;  4YHH L;  5ELE A;  2Q2T A;  2YYZ A;  5BN3 A;  4L63 B;  3KYH C;  4N9P A;  4BY1 B;  3NBH B;  3J7Y W;  1HTL D;  3M4O H;  4R4C A;  1I4R A;  2K52 A;  2H5X A;  1SE3 A;  1Z7T A;  5C4X H;  1SYC A;  4LF6 Q;  4FYD A;  2NVX B;  3ERO A;  4JI4 Q;  4A3G G;  2F52 A;  1G2T A;  1A2T A;  3I56 A;  1D5M C;  2GN5 A;  1RTO A;  3AFQ A;  2WB1 G;  4DAV A;  4NDX A;  4AIM A;  4JI2 L;  2VUM B;  3M4P A;  3AEV A;  3RZO H;  4ME5 A;  4A3B B;  1RTN A;  1EU4 A;  5EQ0 A;  1TVX A;  5FO7 B;  4GS3 A;  2RDH A;  3D6C A;  5CV7 A;  3GDE A;  1HJP A;  2DJF C;  2L12 A;  3E0J A;  5C3X A;  3PUV A;  3IAY A;  4RHR A;  1F2Y A;  4KN4 C;  3M85 A;  4ALP A;  4R4Q A;  3HOY G;  4Y7N B;  2BE5 D;  4TKO B;  1ROD A;  4OL7 A;  2PQE A;  5E1F A;  3W2D A;  1I6H H;  2WKD A;  3W3A A;  3S1Q B;  3QOJ A;  3W5O A;  1VQP A;  5IGG A;  3DWA A;  2B63 B;  1LTS D;  4C3I H;  4IPG A;  3ERS X;  3C2P A;  2RF4 A;  3PIO 3;  1SYE A;  5I9P A;  5ELB A;  3NBH A;  5I6W A;  2ZTE A;  1U4R A;  4UHV A;  2ATW A;  1TWF B;  4OO1 H;  1SNM A;  3HG9 A;  5CV9 A;  1QOH A;  1I94 L;  1BKB A;  1QUQ B;  3F8T A;  4WJ3 M;  2PI2 A;  4H44 C;  4J1M A;  3T53 B;  2RDF A;  1D1I A;  1PTO D;  1ET6 A;  2FIN B;  2ASB A;  4FXK C;  4IJH A;  4KHV A;  3NEL A;  1VQH A;  3BS1 A;  2SEB D;  4B3S Q;  2F0W A;  4DUY Q;  3T1Y L;  1SJH D;  2XRS D;  3VDY A;  5C44 H;  1B9M A;  4FF1 A;  2ZT9 C;  2K28 A;  4IAL A;  4HJ7 A;  2JSO A;  4N9T A;  3KLR A;  3SR1 A;  1U9R A;  4MNO A;  5M5X H;  3GTG B;  4DK3 C;  1KAW A;  5T1I A;  3GTP B;  1XNR L;  4DR7 Q;  1MJC A;  4NP5 A;  1VQN A;  4LF4 L;  3TP6 A;  4APV A;  4KKS A;  2LMC B;  3F1Z A;  5EPJ A;  5CR3 A;  3Q23 A;  1AZP A;  3DEP A;  2R93 B;  4RA8 A;  4DV5 L;  3H3V I;  1V1Q A;  4IPH A;  3S2H H;  1SR3 A;  3M3Y B;  5D65 A;  5AJ3 Q;  2HIX A;  5IP9 H;  3FMC A;  1BCP D;  1STY A;  2IHE A;  3DWQ A;  1TWA H;  3CME A;  5CGK A;  2GVA A;  3SEB A;  1DOK A;  2I5H A;  2R7Z G;  4FF4 A;  4JV5 Q;  1JJC B;  1JC7 A;  2F0F A;  3QG1 A;  1X3F A;  2JYO A;  3A0J A;  1MIU A;  3H0G B;  2LFN A;  1PZI D;  4JI8 L;  1Y8P B;  4PMC A;  1QUQ A;  1KLU D;  3ONA B;  3GV3 A;  1NMG A;  5C3E B;  4A3L G;  4A3E G;  4KV6 A;  4XT3 B;  5EGT A;  1EEI D;  4NPS A;  1EOV A;  1WTV A;  3JC6 6;  5CBE E;  2EVB A;  5EBC A;  3G6J B;  2Q8I B;  4JI4 L;  4YWL A;  1IXR A;  5E7N A;  3I4M H;  1LM0 A;  2DN8 A;  3I4L A;  3CW2 C;  1SRO A;  4P75 A;  4R4O A;  2MNA A;  3L3O C;  1KNE A;  2HHH Q;  3R2I A;  1S5D D;  1TWC B;  3VA7 A;  4IPD A;  2R92 H;  2BE5 C;  3TQY A;  2F0M A;  2VB3 X;  2VQE Q;  2JA6 H;  4X65 Q;  4A3M G;  1XNQ Q;  2L55 A;  3HKS A;  1EIG A;  2CFM A;  3GTO H;  4RGO S;  3L2P A;  4LUO A;  5M3F B;  2HCC A;  2ES2 A;  4DXF A;  2KA7 A;  2MGS A;  3D4D A;  5GAH C;  4F8M A;  1AFP A;  4A3I B;  2L15 A;  1E7Z A;  1Y14 B;  2JA7 H;  1GHK A;  4KI0 A;  2R3Z A;  1ICW A;  1EUJ A;  1UNS A;  2X6L A;  4LW1 A;  1D5Z C;  1VQA A;  3MXP A;  3WOF A;  5CBA E;  3RMH A;  1ZKO A;  1PTO C;  2G5D A;  1Y1V G;  2O5J C;  1PYB A;  1WI5 A;  3K57 A;  2V4D A;  4QCL A;  2JA8 H;  1BBW A;  2ICI A;  4ZKB B;  3PO2 B;  4DR1 Q;  4DNR B;  1AE2 A;  3LX0 A;  5IWA Q;  4A3F H;  2RCN A;  1PFS A;  1S3O A;  3DM1 A;  3T16 A;  1T5E A;  4BY7 B;  2JA5 H;  1QVC A;  2NZ1 D;  4DK1 A;  4CJ0 B;  2H4O A;  4G7O C;  3RZD H;  5EAY A;  3RN2 A;  4UP9 A;  1SMY D;  1HQR D;  1X55 A;  2F3V A;  2KJX A;  2BA1 A;  4Q0F A;  3CC2 A;  2N78 A;  2RCF A;  2KCN A;  3S16 B;  2Q8T A;  2F0U A;  4K14 A;  4DR2 L;  1F2M A;  4AQY Q;  2Y0S G;  4XQJ A;  1ENA A;  3LGJ A;  1QJO A;  5FLX c;  1BCP C;  4AYB E;  4E6I A;  4DKA C;  1NAP A;  1YJ9 A;  4DV2 Q;  1HNZ Q;  4JI5 L;  2NWG A;  1GHJ A;  1TY2 A;  1Q86 C;  1PH1 A;  3HOZ G;  3H3V C;  3SGI A;  2AHO B;  1PTO B;  2PW5 A;  4A3G H;  2F0N A;  3I73 A;  4PZ8 A;  2B2U A;  2K1B A;  1YJW A;  2EDG A;  1E22 A;  2JQO A;  2PYK A;  2V1C C;  3VYT A;  4QF4 A;  5AJ3 L;  1O78 A;  3A54 A;  4C3J B;  1WTQ A;  1X3Q A;  1QVG A;  1FJG Q;  2A74 C;  3H94 A;  3HKZ G;  5IGF A;  2QCP X;  4PQX A;  1G29 1;  1JJ2 A;  1SBB B;  1PYW D;  5EPK A;  2Z6B A;  3PMF A;  3U9S A;  2E8G A;  3KK7 A;  3MVV A;  4YY3 L;  1Y1W G;  2F0L A;  3P1H A;  4KK7 A;  1SE2 A;  4PG3 A;  1AN8 A;  3T1H Q;  3VR6 A;  1EWH A;  5C0X G;  1N32 Q;  1WJJ A;  1L1O C;  4RWS C;  1CA6 A;  1JOO A;  3MXU A;  1VF7 A;  1FVI A;  4NXN Q;  1SYG A;  2F0T A;  3CC7 A;  1A6X A;  4AYB B;  2WIN B;  1PV4 A;  3WDN A;  1UE7 A;  3TN2 A;  3NBI A;  1BCP B;  1JQY D;  2ZXP A;  5C0X I;  2F0V A;  5E4W C;  2ZTC A;  5KNC A;  2K5V A;  2E2I B;  4RKB A;  5JJI A;  3M9B A;  3GTL B;  2Q8R E;  5HY6 A;  3HRZ C;  3TRZ A;  3A7A B;  1TS5 A;  1I50 H;  3K5M A;  2VQE L;  3S1M H;  1SYB A;  5FO8 B;  1CSP A;  1HZB A;  1XNQ L;  3GQB A;  4GKK Q;  3KUP A;  1F77 A;  2QEJ C;  1GUS A;  1OO9 B;  3SXH A;  2EJG C;  1VS0 A;  1K3B C;  3HOX H;  1B1Z A;  3NK9 A;  5D3D A;  2IX0 A;  4H7B A;  1Q81 C;  1VQ7 A;  4HCS A;  1G6P A;  3TS0 A;  1DGS A;  5M5Y B;  1YNN D;  4DV0 Q;  5C5L A;  4XTC S;  1A62 A;  2N49 A;  2G9H D;  4L6T B;  2IX3 A;  4X62 L;  1IBM Q;  1F9Q A;  2BH2 A;  1T9H A;  3A5U A;  4JI1 L;  1L1O B;  1SMY C;  3EVQ A;  2UU9 Q;  4RGN A;  1GXD C;  4MTN A;  1STA A;  1JJG A;  3J80 c;  3MC0 B;  3H91 A;  4DR1 L;  3CCR A;  1JMC A;  3TZD A;  5IWA L;  4C3I G;  1HNW Q;  4XXE A;  4FNF A;  1A3U A;  3F2C A;  1CQV A;  3M7N A;  4M8A A;  4A3B G;  2NUC A;  3CQZ H;  1II3 A;  3CMA A;  2AUJ D;  3RNU A;  1IBL Q;  3K7U C;  1SYD A;  3J7Z C;  3S1N H;  3J81 c;  4OO1 G;  3E3X A;  4EQO A;  4DV4 Q;  1K83 B;  4ZRZ A;  3CCE A;  4X66 Q;  2A5H A;  1ZYR D;  3K7A H;  1PH8 A;  3PCO B;  4L5S A;  4FF2 A;  3J80 i;  2TSS A;  2EYJ A;  4AQY L;  4JI7 L;  5JEA J;  1BQQ T;  2K75 A;  3G4S A;  1I3Q B;  4ODG A;  5IIF A;  4BXX G;  3FP9 A;  2I5L X;  2KCC A;  3KOJ A;  2Z8L A;  4ZLT F;  3FEW X;  2PMZ E;  1PMR A;  2AQ1 B;  1SNC A;  4A3L H;  1Q8K A;  4A3E H;  1T5X D;  4CKE A;  1X32 A;  5C44 G;  2Y0S E;  3GTM B;  4YHH Q;  4HSV A;  1Q7Y C;  1GUW A;  2B63 G;  3J81 i;  4J6H A;  3J7A 5;  1NE3 A;  2GVB A;  3PO3 H;  3S14 H;  4C3H H;  1WTH A;  1YI2 A;  4GKJ Q;  2ZXO A;  1UEB A;  4FP5 D;  3LWU A;  1IYJ B;  1GO3 E;  1I4G A;  5EKI A;  2NVY B;  1L1O A;  1FJG L;  1QZG A;  1HFG A;  4XYQ A;  3GTK B;  1EWI A;  3SK8 A;  3I90 A;  1E2Z A;  1FR3 A;  1Y69 U;  2A19 A;  4BA2 I;  5CYU A;  3HKZ E;  2BCO A;  1R9T B;  3A8I E;  1NY4 A;  5F2D A;  4MHE A;  1PYS B;  5DM6 3;  4DPG A;  2NTS A;  3DM3 A;  3MZ5 A;  1HRJ A;  2O2L D;  2LXK A;  4NXN L;  4GLV B;  1J9O A;  2LSS A;  2EZV A;  2PMZ B;  5AFW A;  3DLL A;  1PVO A;  4RGM A;  1A3T A;  1PFB A;  2JEB I;  1Y1V H;  3OMC A;  4EVO A;  5J22 A;  1O7I A;  1HQM C;  5FK9 C;  1KLG D;  3CXC A;  2GA4 B;  2YV5 A;  1TS2 A;  3IL8 A;  1SFO B;  4LMQ D;  2PPB C;  1YNN C;  1X3E A;  2R93 G;  1ENF A;  4ZCK A;  4GKK L;  1G51 A;  2K5D A;  2Z4I A;  3V2T A;  1SN8 A;  5D14 A;  1RDP D;  2R92 G;  4N8X 1;  4XIG S;  3S17 H;  3GTQ B;  3CRK C;  1B3Q A;  2OCE A;  1ESF A;  2K5Q A;  2CH4 A;  1VQ6 A;  1NJI C;  2M9V A;  1WTX A;  1LUZ A;  3UDI A;  4HCE A;  4CHT B;  3M7G A;  1J8I A;  1XXG A;  4IJL A;  2XIW A;  2E2H B;  1I94 Q;  5CV8 A;  4ME3 A;  1PXU A;  1KTK A;  1FNV A;  3H0G G;  4JCV E;  3D3R A;  1FYC A;  4DV0 L;  2LS0 1;  2AWN A;  1IBM L;  1IYV A;  4IUU A;  5C3E G;  2DUD A;  1BXT A;  1EY0 A;  2M00 A;  1I6V C;  4JC0 A;  2KBN A;  2UU9 L;  1H9S A; 
#chains in the Genus database with same CATH homology
 3HFZ B;  3FKI H;  4NXM L;  3I4O A;  3PIP A;  3ULP A;  2ASB A;  5IYB H;  1HNW L;  4IJH A;  3NEL A;  1VQH A;  1N9W A;  1X9N A;  2LXJ A;  2YTY A;  4B3S Q;  5IY0 A;  4IFD J;  4DUY Q;  3T1Y L;  2PI2 E;  2IX1 A;  2DGY A;  1XNR Q;  2R6G A;  2JA8 G;  4LWC A;  3VDY A;  1I5F A;  2Q2H A;  5C44 H;  2WAQ G;  2KCM A;  3L0O A;  3KF6 B;  2NVT H;  4KHP Q;  1OXU A;  4HJ7 A;  1KC8 C;  5GQO A;  1SMX A;  4GLX A;  4MNO A;  4OWT B;  5M5X H;  1S72 A;  4DV4 L;  4A3J H;  4B3S L;  4QGU A;  4DK3 C;  5K36 G;  1Z9F A;  1KAW A;  4DUY L;  5LMN L;  1HH2 P;  3AYH B;  1BBU A;  2JA5 G;  4JI0 Q;  1E1T A;  4DV5 Q;  5IYC G;  1XNR L;  1MJC A;  4JI6 Q;  2K50 A;  1VQN A;  4DR7 Q;  1FGU A;  4PZ6 A;  4LF4 L;  2IHF A;  4KHP L;  4APV A;  4DV6 L;  3F1Z A;  4BBR G;  1V43 A;  2NVQ H;  4LF7 Q;  1BVS A;  1Y1W H;  2Q2I A;  4QL5 A;  4JI0 L;  4DV5 L;  2WAQ E;  4DR7 L;  4JI6 L;  3OTO Q;  1VQ9 A;  3H3V I;  4BA1 I;  1V1Q A;  1RL2 A;  4IPH A;  4QY7 A;  3ULL A;  1SR3 A;  4DUZ Q;  3G6E A;  2Q2U A;  5AJ3 Q;  3S2H H;  4K0K Q;  4A76 A;  1VCI A;  2HIX A;  5IP9 H;  1KD1 C;  4DR4 L;  1KHI A;  3BU2 A;  2JJQ A;  2IHE A;  3G48 A;  5J3B A;  4LFC Q;  1TWA H;  3CME A;  4JI8 Q;  2GVA A;  1U0L A;  5GRO A;  2I5H A;  1N8R C;  4GOP C;  3OTO L;  3A74 A;  4TVA B;  1ASY A;  2R7Z G;  3I2Z A;  1K83 H;  4JBJ A;  1JJC B;  1EQQ A;  1OTC A;  3D31 A;  4GKJ L;  4K0K L;  1WYD A;  1EIY B;  1A8V A;  1X3F A;  4GN3 B;  1E1O A;  1VQI A;  3NEN A;  3A0J A;  4RMF A;  5FJ8 G;  1MIU A;  3CCQ A;  3PO2 G;  2MO1 A;  2UXD Q;  4LFB Q;  4JI8 L;  1QUQ A;  3IRB A;  1I3Q H;  1NMG A;  5M5W H;  4A3L G;  4A3E G;  1J5E L;  4BY7 G;  1HZ9 A;  3OYY A;  4NPS A;  5HGQ A;  1EOV A;  3JC6 6;  1XPU A;  2PNH A;  4L5T A;  4A75 A;  2KCT A;  4DK6 C;  1RIP A;  1N33 Q;  1YHB A;  2ALY B;  1UE6 A;  3U50 C;  3ZJY C;  4DR5 L;  5C0X J;  4TQU S;  4JI4 L;  3GTM H;  4YWL A;  1IXR A;  1CSQ A;  5E7N A;  3ULJ A;  3I4M H;  4BBS H;  1LM0 A;  3PF5 A;  1KL9 A;  1W2B A;  2JE6 I;  1K8G A;  3CW2 C;  1SRO A;  4P75 A;  4R4O A;  4IOC A;  3S24 A;  2MNA A;  2F4V Q;  3AQQ A;  2YU9 H;  3KF6 A;  2BA0 A;  1CKN B;  2HHH Q;  3HOY H;  3PGZ A;  1HR0 W;  4IPD A;  4LFA Q;  2R92 H;  3ICE A;  1X65 A;  3D0F A;  3GD7 A;  3PUX A;  3TQY A;  3UDF A;  3S1R H;  4BY1 H;  2A8V A;  3BZK A;  1JT8 A;  2VQE Q;  2JA6 H;  4OWW B;  1PH4 A;  3CPW A;  2NVY H;  4X65 Q;  4A3M G;  1XNQ Q;  5C4X G;  3HKS A;  2CFM A;  2HHH L;  2UXB Q;  3GTO H;  4YCU A;  1VQ8 A;  3L2P A;  2JEA I;  4A93 H;  4LUO A;  1N34 L;  5LMU Q;  3GTK H;  3PV0 A;  3CC4 A;  5BR8 L;  2ES2 A;  4HID A;  2NVX H;  4DR6 Q;  5GAH C;  4LF5 Q;  4GLA C;  1R9T H;  2L15 A;  4X65 L;  2ZJQ A;  1E7Z A;  1Y14 B;  2JA7 H;  1VQJ A;  4GOP B;  2UXB L;  3AFP A;  4KI0 A;  1C7Y A;  1EUJ A;  4LW1 A;  1VQA A;  1HR0 Q;  4POG A;  1D8L A;  4P71 A;  1C9O A;  2Z6K C;  4RG1 A;  2VUM H;  1YJN A;  5IT9 c;  1VQF A;  2UXC Q;  2C35 B;  4A3B H;  1VQ4 A;  3ER0 A;  3UE0 A;  1Y1V G;  2UUC Q;  5ELN A;  1VQB A;  1PYB A;  1WI5 A;  2IT1 A;  3W1B A;  1VQM A;  2JA8 H;  1BBW A;  3HOX G;  1K9M C;  3MXN B;  2MQH A;  4DR1 Q;  1AE2 A;  3K81 C;  5IWA Q;  2VW9 A;  1SFO H;  4EX5 A;  3EIV A;  1K0R A;  2UUC L;  4A3F H;  2RCN A;  5IE8 A;  1PFS A;  1S3O A;  4DV1 L;  2A1A A;  4BXX H;  1YIT A;  4B3R Q;  2JA5 H;  1QVC A;  4AYB G;  4Y7N H;  1YZ6 A;  1UWV A;  3RZD H;  3BZC A;  5EAY A;  4JV5 L;  3RN2 A;  4UP9 A;  4B3T Q;  2OQ0 A;  2KHJ A;  5M5Y H;  4DR2 Q;  3GTQ H;  3S1Q H;  2K4K A;  1TXY A;  2CWP A;  1X55 A;  2E5L Q;  2B63 H;  1A0I A;  2AWO A;  2CWA A;  1CKN A;  3RN5 A;  1K3R A;  2BA1 A;  1KRT A;  4OX9 Q;  2HIV A;  3HOV G;  1KQS A;  3CC2 A;  1JE5 A;  2N78 A;  1XJV A;  2E2H H;  4UP8 A;  1B7Y B;  1UE1 A;  5JEA G;  4JI5 Q;  4IFD I;  5M3F G;  4B3T L;  2VQF Q;  4DR2 L;  4AQY Q;  2NN6 G;  1C0A A;  2Y0S G;  4O0A A;  4DV7 Q;  4PZ7 A;  1XMQ Q;  1YEZ A;  3FHW A;  3KJO A;  5IP7 G;  3LGJ A;  5FLM G;  5FLX c;  2D0O A;  4A3I G;  1VQ5 A;  1TWF H;  4A3C G;  4AYB E;  4DKA C;  2EXD A;  1YJ9 A;  4DV2 Q;  1HNZ Q;  2R7Z H;  3TRE A;  3STB D;  4JI5 L;  1L0W A;  4HIM A;  1Q82 C;  2K5N A;  3FKI G;  2NN6 I;  1E3P A;  1NBW A;  3J81 j;  3K8A A;  1Q86 C;  4DV7 L;  1PH1 A;  2AKW B;  2VZA A;  4DV3 Q;  4GOP A;  4KLK A;  3SGI A;  2AHO B;  3KLW A;  4A3G H;  2UUB Q;  4LF7 L;  1LTL A;  4PZ8 A;  4DV2 L;  1HNZ L;  4LF8 Q;  1ASZ A;  1YJW A;  1CKM A;  1E22 A;  2JQO A;  1KRS A;  3S15 H;  2WP8 J;  4DUZ L;  2JK8 A;  4FDB A;  2R7D A;  2V1C C;  3E9H A;  4DR3 Q;  5AJ3 L;  4QQB X;  3CAM A;  2IY5 B;  5JJK A;  1WFQ A;  1PH5 A;  2R7F A;  1XPR A;  1YNX A;  2AMC B;  3PUW A;  3A5Z B;  4QIW E;  4LFC L;  4AH6 A;  4YY3 Q;  1QVG A;  3HKZ G;  4LF8 L;  1FJG Q;  2HT1 A;  3HOW H;  4JI3 Q;  1CUK A;  1G29 1;  4KHZ A;  1JJ2 A;  5GAE C;  3GTG H;  1OXS C;  1FL0 A;  1NTG A;  1K8A C;  1V9P A;  3B6Y A;  3HOU H;  1YBY A;  2ZJP A;  1IL2 A;  3GTP H;  4HJA A;  1XMO Q;  2ZJR A;  2E8G A;  2EQS A;  1GD7 A;  3E0E A;  2OQK A;  3CPF A;  3U4V A;  4X64 Q;  2UXD L;  4LFB L;  4YY3 L;  1Y1W G;  3BJU A;  3KJP A;  1XTD A;  2UUA Q;  4JI3 L;  3U58 A;  4R4T A;  4UY8 C;  4P73 A;  3PO3 G;  3I4N H;  4PG3 A;  4X6A H;  3T1H Q;  4A3M H;  5C0X G;  1N32 Q;  1WCM H;  1WJJ A;  1X56 A;  2R93 H;  1L1O C;  4JI2 Q;  1HZA A;  5IP9 G;  1FVI A;  2FXQ A;  4NXN Q;  3CC7 A;  2EIF A;  2ZTD A;  4X64 L;  3H15 A;  4HJ9 A;  4A4I A;  3CF5 A;  1K73 C;  1M1K C;  4B3M Q;  3M3Y H;  1N33 L;  1PV4 A;  2BH8 A;  2QA4 A;  1UE7 A;  1SRU A;  3Q8D A;  3T1H L;  4L5Q A;  1U5K A;  5C0X I;  1N32 L;  2ZTC A;  2K5V A;  4PMW A;  2F4V L;  3KF8 B;  5JJI A;  2CQO A;  2NZH A;  2QGQ A;  3M9B A;  4R1J A;  4B3M L;  1AE3 A;  4A3K H;  4LFA L;  2YTX A;  3TEH B;  5HY6 A;  4A3D G;  3TRZ A;  1NMF A;  3H0G H;  4JBM A;  1I50 H;  2VQE L;  1YIJ A;  3S1M H;  2WFW A;  3GO5 A;  1CSP A;  2ZM6 Q;  1HZB A;  1XNQ L;  1HZC A;  4GKK Q;  5C3E H;  2Z6K A;  4MZ9 A;  3K80 C;  3NEM A;  3CCJ A;  1VS0 A;  3OW2 A;  5LMU L;  4C2M H;  1TWH H;  1EFW A;  1YHA A;  3EBE A;  3UDX A;  3HOX H;  2I0Q A;  4BBS G;  3I4M G;  4DR6 L;  4EQ5 A;  2IX0 A;  2JA9 A;  4LF5 L;  2ZM6 L;  2NZO A;  4JBK A;  4X62 Q;  1Q81 C;  2MO0 A;  1AH9 A;  1VQ7 A;  2I5M X;  1M90 C;  1G6P A;  3TS0 A;  3PUY A;  3M4Q A;  4POF A;  1GM5 A;  1B70 B;  4JI1 Q;  1DGS A;  4R4I A;  1HR0 L;  1H95 A;  1TWC H;  2JA6 G;  4DV0 Q;  1X6O A;  2UXC L;  2N8N A;  1KXL A;  4XTC S;  1A62 A;  2N49 A;  1IBM Q;  4L5R C;  5JJL A;  4X62 L;  2PQA B;  1VQL A;  4GNX C;  1T9H A;  2BH2 A;  4A93 G;  3A5U A;  4YWM A;  1X54 A;  4JI1 L;  3RLO A;  5LMN W;  1L1O B;  1OXX K;  1UE5 A;  1N36 Q;  4WJ4 A;  1HNX Q;  1VQO A;  1EYG A;  2UU9 Q;  1Z47 A;  2YTV A;  4O2D A;  1QVF A;  4IPC A;  4MTN A;  5IYC H;  3CCS A;  4OWX B;  2K5H A;  3J80 c;  5M3F H;  1JJG A;  2VS1 A;  4DR1 L;  4NXM Q;  3CCR A;  4IFD G;  4HJ8 A;  1JMC A;  2JA7 G;  5IWA L;  1HNW Q;  5GAD C;  2D0P A;  4OXP A;  2OTL A;  4BBR H;  1YVC A;  4A3I H;  4A3C H;  3CCL A;  1N36 L;  1VQK A;  3T1Y Q;  3F2C A;  4B3R L;  1J6Q A;  1PH3 A;  1SLJ A;  3M7N A;  4A3B G;  3CQZ H;  3CMA A;  3RNU A;  4LUZ A;  1IBL Q;  3STB C;  3HOZ H;  5M3M G;  1D7Q A;  2B3G A;  3TS2 A;  3K7U C;  3MEF A;  3J7Z C;  1PA6 A;  3S1N H;  3J81 c;  4OO1 G;  2N3S A;  4JI7 Q;  4JOI C;  3I7F A;  3GTJ H;  2E5L L;  4DV4 Q;  2VL6 A;  3CCV A;  2D62 A;  2Z0S A;  5LMN Q;  3CCE A;  4OX9 L;  3L7Z C;  3CP0 A;  4UPA A;  5DLQ E;  4X66 Q;  2QEX A;  1VQG A;  4LF9 Q;  3K7A H;  4LF4 Q;  4DAY B;  1PH8 A;  4H02 A;  3PCO B;  1IBL L;  2RHS B;  4QJF A;  4L5S A;  3J80 i;  3I55 A;  3G71 A;  2VNU D;  5C4J H;  4DV6 Q;  3KDF B;  2VQF L;  2CCZ A;  4AQY L;  5ELO A;  5FJ8 H;  4A3F G;  4JI7 L;  3PO2 H;  5JEA J;  4HIK A;  3U4Z A;  1XMQ L;  2K75 A;  5IYB G;  3G4S A;  4DNI A;  4BXX G;  3FP9 A;  2I5L X;  3KOJ A;  1VQD A;  3PSI A;  3PIO A;  2PMZ E;  3PF4 A;  4X66 L;  4LF9 L;  4A3L H;  1Q8K A;  4A3E H;  1VQE A;  1OXV A;  4GN4 B;  1XPO A;  4BY7 H;  4OO1 I;  1E24 A;  5C44 G;  4DR4 Q;  2Y0S E;  4LUV A;  3KFU A;  4YHH Q;  1Q7Y C;  1Q12 A;  2B63 G;  4DV3 L;  3CD6 A;  3J81 i;  2KEN A;  1YHQ A;  3J7A 5;  1NE3 A;  2GVB A;  3S2D H;  4A3J G;  2KHI A;  1VQC A;  4GNX B;  2UUB L;  3PO3 H;  3S14 H;  4C3H H;  3HOZ G;  4JBW A;  2OWO A;  1YI2 A;  4GKJ Q;  4P72 A;  2XTI A;  4JG2 A;  3RLN A;  4DAM A;  1UEB A;  4YWK A;  2MFI A;  1PHJ A;  4YHH L;  2Q2T A;  2YYZ A;  4DR3 L;  1IYJ B;  2PQA A;  2VY3 A;  3KYH C;  1GO3 E;  1IBK Q;  4UP7 A;  3S16 H;  3NBH B;  3M4O H;  1CKO A;  3E9I A;  4Y52 H;  1L1O A;  4R4C A;  1FJG L;  3PUZ A;  1QZG A;  1P16 A;  1W3S A;  1J5E Q;  3K0X A;  2K52 A;  2H5X A;  1S40 A;  1LYL A;  4JYA Q;  5C4X H;  1EWI A;  1MKH A;  1IBK L;  4LF6 Q;  1XMO L;  4JI4 Q;  2A19 A;  4DR5 Q;  4BA2 I;  4A3G G;  3HKZ E;  4A3D H;  2F52 A;  4HJ5 A;  1NY4 A;  4P74 A;  2UUA L;  3I56 A;  2GN5 A;  5GAG C;  3F2D A;  2HQL A;  1PYS B;  3AFQ A;  4DPG A;  2WB1 G;  3UDG A;  3DM3 A;  4JYA L;  1GVP A;  1WOC A;  4AIM A;  4JI2 L;  2LXK A;  5IYD G;  4LF6 L;  4NXN L;  3M4P A;  4GLV B;  2F3I A;  3AEV A;  3RZO H;  2LSS A;  3HOW G;  3CCM A;  3DLL A;  5H1S E;  4C3J H;  4GS3 A;  1PVO A;  2CKZ B;  3UE1 A;  1KIX A;  2JEB I;  1SE8 A;  3HOU G;  3RLF A;  1Y1V H;  1PH9 A;  1TWG H;  4YCW A;  1O7I A;  3CCU A;  3KDF A;  1N34 Q;  3GDE A;  1HJP A;  4YCV A;  5BR8 Q;  3CXC A;  4LNQ A;  2OTJ A;  2YV5 A;  3PUV A;  2ID0 A;  2WB1 E;  3I4N G;  1PH2 A;  4NB3 A;  1WCM G;  1X3E A;  1PH7 A;  2R93 G;  1X3G A;  5IYD H;  3M85 A;  1B8A A;  4ALP A;  3EN2 A;  4R4Q A;  3WWV A;  3JAM c;  4GKK L;  3HOY G;  1JB7 A;  1G51 A;  4IOA A;  1IZ6 A;  2E2J H;  1SN8 A;  2RHQ B;  1Q46 A;  2R92 G;  1I6H H;  3W1G A;  4BY1 G;  4XIG S;  4GNX A;  1GKH A;  3S17 H;  1MJE A;  2OCE A;  4J15 A;  3W5O A;  1L2F A;  1VQP A;  1VQ6 A;  1NJI C;  1LUZ A;  3UDI A;  4IPG A;  4C3I H;  1P8L A;  2K14 A;  3ERS X;  4OON A;  4IJL A;  2RF4 A;  1I94 Q;  1OXT A;  4ME3 A;  4A3K G;  2E2I H;  2XGT A;  4GN5 A;  3HOV H;  3H0G G;  1Q1B A;  3GTL H;  1EIF A;  2ZTE A;  4JCV E;  4DV0 L;  1QZH A;  5M3M H;  2ATW A;  3H3V H;  2AWN A;  3RR5 A;  1IBM L;  5C3E G;  4DV1 Q;  2DUD A;  1A63 A;  5IP7 H;  5FLM H;  1I94 L;  3JAM i;  1Q1E A;  1BKB A;  1QUQ B;  3F8T A;  4JC0 A;  4HIO A;  2PI2 A;  4WJ3 M;  2KBN A;  1EQR A;  2B29 A;  1HNX L;  4IO9 A;  2UU9 L;  1PH6 A;  2VUM G;  4JOI A;  4JV5 Q;  3F2B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...