3STBD

A complex of two editosome proteins and two nanobodies
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
113
structure length
108
Chain Sequence
KSVNSVTLVGVVHDIQSGFVYEDAVTQFTLTTTSIDTTVVVEKDHHTIRCFGELFSAEVKQKVKEGNVVCVNGRLRLSPQLEPSCNKHFYFPYIQVQPPHGQVAVIHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a heterodimer of editosome interaction proteins in complex with two copies of a cross-reacting nanobody.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
molecule keywords single domain antibody VHH
total genus 18
structure length 108
sequence length 113
ec nomenclature
pdb deposition date 2011-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3stbD00
3RN5A 3ICEA 1TWFH 3CW2C 1R9TH 4X66L 2K5VA 1U0LA 1EQQA 4OO1G 1VQHA 4GKKQ 3PIOA 1Y1VH 2JA6H 3VDYA 1CKNB 4A3JG 1JT8A 1CSQA 1TWAH 4YHHQ 4ME3A 1IBML 5C3EG 3PSIA 4AYBE 1EWIA 1TWHH 4BBRH 2UUCL 2R7FA 4KHPL 1VQ6A 2BH8A 1XNQQ 3J81c 3GDEA 2Q2IA 3RZDH 3HOWH 4JV5L 2JQOA 2LXKA 2VQEL 2VQFL 4IPCA 1D8LA 2NVTH 1X56A 5E7NA 3CPWA 1L1OC 5IYCG 4DK3C 4JI3Q 4LF8L 2C35B 3CCEA 2CQOA 1YJ9A 2N8NA 5M3MG 2HHHQ 1K73C 3F2CA 3T1YL 4YWMA 1FGUA 4P75A 4PMWA 4JC0A 1VQNA 1VQKA 1PV4A 4GNXC 2JA8G 3CCSA 1H95A 1JE5A 2R7ZG 3CPFA 4DR5L 3UDIA 1NJIC 5LMNW 3S1NH 1EUJA 1L2FA 2WFWA 3EN2A 1GD7A 3JC66 3RN2A 3Q8DA 2Q2TA 4LF5L 2JA7G 2CWPA 2VY3A 3ULJA 4IPDA 4EX5A 4DR1L 1UE7A 1WOCA 2ZM6L 5C0XJ 4BBSG 3A5ZB 4LFBQ 1SN8A 4B3RQ 2EIFA 1G51A 3GTGH 4GKKL 2ASBA 4XTCS 5EAYA 4QQBX 1HNWL 4R4OA 2IHFA 3FHWA 4GNXA 1MJEA 4YHHL 2VUMH 4JI3L 4H02A 4A3JH 4L5RC 1QZGA 4HJ5A 4YCUA 3LGJA 1WJJA 4KLKA 5BR8Q 3CXCA 3CMEA 4A75A 1Q7YC 1HZ9A 2PQAA 3CC7A 4DNIA 1HR0Q 4DR4L 5JJKA 1IZ6A 1MJCA 1WFQA 4JI8Q 1VQ5A 2Q2UA 5AJ3L 4B3SL 3BZKA 3CCQA 1M1KC 4A93G 4LF7L 1E24A 3HOXH 1BVSA 5ELOA 3K7AH 2EXDA 4YWKA 5IP9H 1Q8KA 1QVCA 3J80c 1VQLA 1T9HA 2OWOA 1N33Q 1YEZA 2MQHA 2UU9L 2WP8J 4KHPQ 3L7ZC 3PO2H 4A3EG 2YV5A 3KJPA 1KAWA 4JOIC 2HT1A 1XPRA 4BA2I 2A1AA 3A0JA 4DAMA 3RNUA 2JJQA 2N49A 5IP7G 2NN6G 3L0OA 2ID0A 2WAQE 4LFBL 2XGTA 5BR8L 3S1MH 2Y0SG 1BBUA 2K75A 1HNWQ 3E0EA 3KLWA 1A62A 1QUQA 2K5HA 4GNXB 4GOPB 3KFUA 1PH7A 1YZ6A 2JA7H 4AIMA 3S17H 4IJLA 1Q46A 3U50C 1VCIA 1JJGA 2PI2A 5GQOA 3S24A 1TXYA 4GOPC 2A19A 3FKIH 2HIXA 4DV6Q 2FXQA 1J6QA 4NXNL 5HGQA 1PH2A 4PZ7A 1HZAA 2KCTA 4JI8L 3HOVH 1I94L 4DUZQ 5C44G 3HOZH 1DGSA 4JOIA 2B63G 3S2HH 4FDBA 3TEHB 4DV5Q 1IBLL 1JMCA 3D0FA 3HFZB 3I4NH 2IT1A 4YCWA 3J81i 1HZCA 2QA4A 4JI7L 1VQAA 1N32Q 5FJ8G 3K0XA 4B3TQ 3L2PA 4POGA 4BXXG 4GN4B 4LF4L 4K0KQ 3I4MH 1AH9A 1PH4A 4DAYB 3RLOA 1A0IA 1HR0L 3GTQH 4DR4Q 4JI2Q 5FLMH 3M4OH 4L5QA 1OXXK 1X9NA 1GO3E 1YBYA 4GKJL 4X64L 1YHBA 1HZBA 2K14A 3E9IA 5J3BA 4AYBG 4DV0Q 4GLXA 4LF6Q 1XMOL 3H3VH 4BY7H 3G6EA 2ZJRA 1Y1VG 1C9OA 3H0GG 2YU9H 4RG1A 4J15A 2R93H 5IYDH 2RHQB 2D0PA 2DUDA 3PGZA 2K4KA 4R4CA 4GN3B 3U4VA 2CCZA 1IL2A 2Z6KA 5C0XG 1GKHA 3EIVA 3PUVA 2VS1A 3HKZE 4JI5L 4JYAQ 1UE5A 3T1YQ 4A3BH 4A76A 1B8AA 3OTOL 4C3HH 3RLFA 1VQJA 3G71A 3ULPA 1XNQL 5JJIA 5FJ8H 3GTKH 3AYHB 4A3MG 1C7YA 3KF8B 5C0XI 5LMNQ 1AE3A 1PVOA 4ALPA 1K9MC 1Q1EA 4OX9Q 3M7NA 4OWXB 4IOAA 4O0AA 4DPGA 1K83H 2VW9A 2UUAQ 3FP9A 1K3RA 1WCMG 1KRTA 4X64Q 4DK6C 1X55A 4IOCA 4JCVE 4R4IA 1PA6A 4A3EH 1CKOA 2UUCQ 4DUYQ 1O7IA 1E1OA 4GOPA 2LSSA 4LW1A 2JA5G 3M4PA 1K8GA 4P72A 4LF4Q 2OQKA 1Q12A 3F8TA 4K0KL 1WI5A 1N9WA 4JI1L 4LUVA 3PIPA 3CCRA 4A3MH 4GKJQ 4UPAA 2EQSA 1G291 3AEVA 2ES2A 4A3GH 1X3EA 2VNUD 1J5EL 4A3BG 2ATWA 3D31A 2VL6A 4DV5L 1IBLQ 1I6HH 2ZJQA 4A3LH 5IY0A 3BU2A 1YI2A 5AJ3Q 3CC4A 4JI7Q 1N32L 4DR3L 2PMZE 4OX9L 5HY6A 3PV0A 3PCOB 4B3TL 1OXTA 4DR6Q 3TREA 2AHOB 1X6OA 3KDFA 4QGUA 4MTNA 4X62Q 1N33L 3S14H 3PO2G 3NEMA 5C4JH 1XTDA 3U58A 2UXDL 3PF4A 1SRUA 4WJ3M 2IY5B 4LUZA 4DR7L 3T1HL 3GO5A 2F52A 5FLMG 5GADC 4B3ML 1K8AC 3PUZA 1NMFA 3DLLA 1VQ4A 2KHIA 3J81j 3M85A 2CWAA 3CCJA 1XNRQ 1P8LA 2KBNA 1BKBA 4LWCA 1I5FA 1WYDA 5GAGC 2UXCL 1N36Q 2H5XA 1SFOH 1Y1WH 4R4QA 3TRZA 2IX0A 1X54A 4APVA 5IP9G 4A3CH 3HKSA 1D7QA 2JA8H 4A3FG 4IPHA 2KCMA 3F2BA 1VQ7A 2F4VL 4GLAC 2BA0A 4JI1Q 1UE1A 1PH3A 2IHEA 1PH8A 3GTOH 5JEAJ 1SMXA 4DV3L 2UXBL 1YVCA 3ULLA 1NBWA 4X66Q 5M5YH 3GTJH 3KJOA 2K52A 2MO0A 2K50A 3I7FA 1E7ZA 3J80i 4TQUS 1E1TA 2L15A 4UP9A 4DV6L 5GAEC 4HJ7A 4NXMQ 2AWNA 1FL0A 4B3MQ 1X65A 4IPGA 1LTLA 1W3SA 2WB1G 3CCVA 1CKNA 3PUYA 1YITA 3OW2A 1Q81C 4BBSH 4MZ9A 1Q82C 1XNRL 2E2HH 1NE3A 4QY7A 1PHJA 5FLXc 5GROA 2Y0SE 2I5LX 1VQPA 4X6AH 4JBKA 1PYBA 1YHQA 4L5SA 4DR7Q 2UXDQ 4LUOA 4QL5A 2BH2A 2RCNA 2D62A 3CD6A 4C3IH 5M5WH 1P16A 2OQ0A 1CSPA 4NXNQ 3PO3G 4IFDI 1K0RA 1VS0A 4EQ5A 1YIJA 1VQ8A 4DV2Q 4JI2L 3S1QH 3JAMc 4DR3Q 4DV0L 4LF6L 1B7YB 1YJNA 1FVIA 4NB3A 3CMAA 3GTLH 5M3MH 1NY4A 2NVQH 2N78A 2ZTDA 5IYBH 3ERSX 3M4QA 4GS3A 4JI6L 4DR5Q 2PI2E 4HJ8A 5IYCH 1A8VA 2UUBQ 4A3DH 4JBWA 2AWOA 2R6GA 1E22A 4GN5A 1KD1C 4JYAL 3W1GA 3ER0A 3KOJA 2A8VA 3I4OA 1L0WA 2VUMG 1OTCA 3HOYH 4A3DG 2RHSB 5JJLA 4PG3A 1PH6A 1XMQL 4JI4L 4B3RL 3UE0A 3I2ZA 1EIFA 4JBMA 4A3IH 3CP0A 3STBC 3AFPA 3I4MG 4DV7L 4LFAQ 1IYJB 2ZTCA 4A3KG 4LFCQ 1S3OA 3A74A 4A3LG 3K80C 1QVFA 4RMFA 3ZJYC 4AQYQ 1RIPA 4IFDJ 4OO1I 3S2DH 2RF4A 3KDFB 1QUQB 3F2DA 5LMUQ 2ZTEA 3NBHB 4A93H 3OTOQ 3J7ZC 3HOVG 1LM0A 2XTIA 1XMOQ 4UY8C 5IE8A 2BA1A 3RR5A 1GVPA 5LMNL 4C3JH 1UEBA 4HIKA 2JK8A 4YY3Q 3HKZG 1SROA 3KF6A 1E3PA 1VQGA 4DV2L 3UDFA 3BJUA 1YJWA 2E2IH 3PO3H 1Y1WG 4A3IG 2YTVA 4NXML 4TVAB 1FJGQ 2DGYA 3KYHC 1KIXA 1WCMH 4UP7A 1N8RC 3MEFA 2JA9A 5JEAG 3K7UC 3GTPH 1C0AA 2MFIA 1Z47A 1SE8A 2UUBL 1G6PA 1HNZQ 3J7A5 4HIMA 3I55A 4Y7NH 1CKMA 1HNXL 1BBWA 5C4XG 4X62L 1N34Q 1L1OA 1XMQQ 4JI4Q 3SGIA 4Y52H 1KXLA 1UWVA 3M9BA 1J5EQ 3GD7A 4LF7Q 2R92G 3HOUG 2HIVA 5IYBG 1CUKA 3BZCA 3GTMH 2R7ZH 1L1OB 2QEXA 2UXCQ 2JA6G 5M3FH 5IT9c 1NTGA 5DLQE 4BY1G 1V43A 1UE6A 2OCEA 1KHIA 3B6YA 2V1CC 3W1BA 1B70B 2YYZA 4OXPA 5LMUL 3HOXG 2GN5A 3F1ZA 4DV1L 4DKAC 1X3GA 3S15H 1S72A 2JEBI 3T1HQ 2D0OA 4YY3L 4DV4Q 2JA5H 2UXBQ 3IRBA 4IO9A 4JBJA 4HIDA 1I94Q 4LNQA 3NELA 2JE6I 2GVBA 3HOWG 3TQYA 4P71A 1FJGL 5IWAL 4OWTB 1MKHA 4LF8Q 2IX1A 1LYLA 3RZOH 4NPSA 4JI0Q 1YNXA 1TWCH 2CFMA 4QJFA 4L5TA 2K5NA 1ASZA 2OTLA 4KHZA 2F3IA 4GLVB 2F4VQ 2WAQG 3PUXA 2VQFQ 4PZ8A 1PH9A 2CKZB 1VQBA 4JG2A 1EFWA 3M3YH 3H0GH 1XPUA 1OXUA 1N34L 4A3CG 4AH6A 4DUZL 1W2BA 1N36L 4R1JA 1EIYB 5K36G 2NVYH 2Z0SA 2ZM6Q 4XIGS 2NN6I 4O2DA 1QVGA 1QZHA 4BY7G 3I56A 4UP8A 1JJ2A 2VQEQ 1MIUA 2E8GA 3A5UA 4YCVA 2B3GA 1X3FA 4QIWE 5GAHC 2AMCB 4JI6Q 3H3VI 1IXRA 4MNOA 2N3SA 2NZHA 3MXNB 1VQFA 1I50H 2AKWB 5C44H 2R7DA 4DR2L 1PH5A 4LF9Q 4KI0A 3OYYA 3WWVA 2UUAL 3UE1A 1SLJA 3PF5A 5H1SE 3KF6B 1Q86C 1AE2A 1VQMA 4WJ4A 3S16H 2B29A 2KHJA 1VQCA 2MO1A 2PNHA 2YTXA 3FKIG 3RLNA 4X65L 1EYGA 1VQDA 4PZ6A 2E2JH 3CAMA 2I0QA 3K81C 4JI5Q 1NMGA 2QGQA 1KL9A 2YTYA 1RL2A 4LFCL 1M90C 1PH1A 2UU9Q 4A3KH 5IYDG 1Z9FA 1VQ9A 1U5KA 4A3FH 2OTJA 2R92H 3HOUH 1IBKQ 4YWLA 4C2MH 3HOYG 4P73A 1I3QH 5C4XH 3CC2A 1TWGH 4JI0L 2HQLA 2ZJPA 3AFQA 4A4IA 4DV7Q 2ALYB 3TS2A 4DUYL 4DR6L 3S1RH 3AQQA 4DR2Q 4LF9L 4OWWB 2VZAA 1OXSC 2Z6KC 3EBEA 4AQYL 4BXXH 1OXVA 2PQAB 3CQZH 3HOZG 4IFDG 3STBD 3UDXA 4B3SQ 5M3FG 1YHAA 2E5LQ 4POFA 1VQOA 1GM5A 1Y14B 1HNZL 1XJVA 4IJHA 1KC8C 2NVXH 2WB1E 3CCMA 4LFAL 1HH2P 2LXJA 1HJPA 3G48A 3K8AA 5M5XH 1IBKL 1SR3A 4P74A 1JJCB 3JAMi 3TS0A 2R93G 4HIOA 4A3GG 1EQRA 3H15A 1EOVA 1IBMQ 3CCLA 2GVAA 1HR0W 4HJAA 2I5MX 1S40A 1A63A 3W5OA 3UDGA 4R4TA 3CCUA 2MNAA 4JV5Q 5IP7H 1HNXQ 1V1QA 2NZOA 4LF5Q 1PFSA 4DV1Q 1KQSA 4BBRG 4BA1I 1Q1BA 3CF5A 3I4NG 5C3EH 4DR1Q 2E5LL 3PUWA 1V9PA 4OONA 4DV4L 2HHHL 1LUZA 1VQIA 1VQEA 4X65Q 3U4ZA 3E9HA 2KENA 3G4SA 4HJ9A 1XPOA 5IWAQ 1PYSB 1ASYA 2JEAI 1JB7A 2Q2HA 3DM3A 2B63H 2I5HA 5ELNA 3NENA 1KRSA 4BY1H 4DV3Q
chains in the Genus database with same CATH superfamily
3CW2C 2DN8A 1EQQA 5JPMC 2EYMA 3PIOA 3H09A 1W6JA 1Y1VH 2F0PA 3DWAA 1EYCA 3BYTB 4YHHQ 4AYBE 1EWIA 1TWHH 1EEFD 2BH8A 5I2YA 2VQFL 4Q0FA 2XSCA 3I4LA 1GUWA 1KDBA 1L1OC 4DK3C 4JI3Q 2C35B 4DNTB 5EPJA 1WTHA 1QCBD 2QEJC 4ZKCB 4JC0A 1PV4A 4GNXC 2JA8G 1JE5A 3CPFA 1LV9A 4C3JG 3ERQA 4FO2A 4QMGA 1SFOB 1IKMA 4A3GB 3EN2A 3RN2A 1O80A 3JC66 1VDZA 4XDXA 2JA7G 5IT9L 4IPDA 2ICEC 4BBSG 1UE7A 1DXMA 1WOCA 2CVRA 4DAYA 5C0XJ 5CYUA 3TP7A 2EDGA 2Z6BA 5EAYA 4RHSA 5FK9C 3RD4A 2IHFA 5C4ZA 4U68A 4JI3L 1SJED 2J7ZA 2B63B 1WCMB 5CORA 4BBSB 1WJJA 3CMEA 1Q7YC 2KCCA 4DNIA 4RGOS 1SYDA 4JI8Q 1VQ5A 2Q2UA 1HFNA 3BZKA 1STEA 4LF7L 4YWKA 3MWYW 5IP9H 5E4WC 1Q8KA 2OWOA 1T9HA 2MQHA 4JW0A 4KHPQ 1TS4A 3VYSA 4Y7NB 3QB3A 2K05A 3L7ZC 3MTSA 1F9RA 2KOLA 4BA2I 1CZWA 1XPRA 1AZQA 2F1MA 1EWCA 2A1AA 1LTGD 2V4DA 3OIPA 2N49A 2ID0A 2XNAC 5BR8L 3Q24A 2JA5B 3IFDA 1NSNS 1TWGB 2QDLA 2K5HA 4G7ZC 1KNAA 4GNXB 3EA6A 2F0MA 5FO8B 1PH7A 3S17H 3KLSA 4IJLA 4F8MA 3A55A 1RJTA 2Y0SB 1EWHA 4GOPC 2A19A 1PH2A 5KNDA 5D3IB 3R2IA 2KCTA 1V1PA 4JI8L 1F2ZA 2WACA 3S2HH 1IBLL 5M5XB 1VF5C 3I4NH 1JWUD 1HZCA 2K04A 2QA4A 1GUSA 1VQAA 3K0XA 4IFDH 4BXXG 4K0KQ 1PH4A 1TT2A 4ZQ3A 4DR4Q 5IGDA 1EIHA 3BZDB 4RA8A 1GO3E 1R9TB 5J3BA 1S5BD 2I07B 4AYBG 1XMOL 3P20A 3M4OB 2E2IB 5IGEA 2M00A 5KYIA 1Y1VG 5JVG3 2YU9H 4RG1A 5C4HA 3PGZA 2CCZA 3SK6A 2Z6KA 1GKHA 3VR4A 5I9PA 3HKZE 4JYAQ 4BBRB 3OTOL 4PMBA 3G71A 1XNQL 3VR2A 5JJIA 5FJ8H 3GTKH 1AP0A 5LMNQ 1AE3A 3FDTA 4FP5D 4X3UA 4O0AA 4DPGA 4DK1A 2VW9A 1WCMG 5FLXL 5E3FA 3VA7A 4A3EH 4RH6A 4DUYQ 1PRTD 4XQNA 1QB5D 4R8IA 1BCPF 1BUVT 4L63B 5CGKA 2OQKA 1N9WA 5KNBA 4UPAA 3A56A 5D65A 4C2MB 2IX3A 1HCZA 2ZXRA 2ZJQA 4KKUA 4A3LH 3BU2A 5EKLA 5T1IA 3CC4A 4JI7Q 1YNNC 2C9OA 1OXTA 4B3TL 3TREA 4KHVA 1TWCB 5LL6S 2MUYA 4QGUA 1EQVA 1EFID 4X62Q 1N33L 3S14H 3PO2G 4WJ3M 3U58A 1SRUA 4DR7L 4CDEC 4XXEA 3H0GB 3TSSA 1NMFA 1K8AC 1W6KA 2CWAA 3CCJA 1P8LA 4U673 4G7HC 2EOTA 1AH9A 1WYDA 5G3LD 1Y1WH 2I46A 4APVA 3HOVB 5IP9G 1U4LA 1PXUA 2PO4A 2WINB 3NTHA 4A3FG 2KCMA 3F2BA 2BA0A 4C3HB 3H6MA 2L9HA 1A6XA 1YVCA 3A8JE 4IUNA 2RSNA 3KBXA 3I7FA 2HDMA 4TQUS 3ITPA 5GAEC 2LKVA 3HEJA 2A68D 3NUCA 2CHBD 3H94A 1J8IA 3LWUA 1QG7A 1X65A 1YITA 2KHSA 2WB1G 5K5PA 1I6HH 2SDFA 3GTKB 2H1EA 2F4IA 1NE3A 2EYJA 2PQEA 4QY7A 1B44D 1PHJA 2Y0SE 2XWBB 4JBKA 3D4WA 1YHQA 4LUOA 1IW7D 2EY1A 1Y8PB 1Y1VB 1CSPA 1S5CD 1K0RA 4EQ5A 3J80E 1M4VA 1RD9D 1HXYD 2A73B 3S16B 4DV0L 4XQQA 5IGGA 1YJNA 1FVIA 3CMAA 1X3PA 2NVQH 2N78A 1K83B 3M4QA 2SNSA 4DR5Q 3VYRA 4HJ8A 4JBWA 1PZJD 3ER0A 3W1GA 3MAQA 1L0WA 5IODA 3HOYH 4LJZC 3CP0A 1VMCA 4OL7A 1IYJB 4A3KG 1SSOA 2RQXA 4LFCQ 4A3LG 3HRZC 4HSVA 4IFDJ 2ZTEA 3NBHB 1LM0A 2XTIA 4RWSC 1XMOQ 2ENBA 5LMNL 4HIKA 4YY3Q 1WTXA 4KD3A 3UDFA 3BJUA 1YNJC 2YTVA 1FJGQ 3KYHC 1WCMH 5DM73 1SE2A 3K57A 3CRKC 1C0AA 2IL8A 5EKKA 5D3DA 3J7A5 3CHBD 1HNXL 5C4XG 4FVMA 1O7ZA 3TZUA 1TWHB 2A74C 1L1OA 4JI4Q 1LO5D 1UWVA 2C5CA 3GD7A 2R92G 2HIVA 3GTMH 3CQZB 4OO1H 4XYOA 2MJ8A 5NUCA 1NTGA 5DLQE 4BY1G 1V43A 2OCEA 3W1BA 1KHIA 3K5NA 1IKLA 4OXPA 3HOXG 3F1ZA 3TN2A 1L0XB 1X3GA 2K1BA 1BXTA 2Z8LA 2JA5H 1PFMA 3J81L 4IO9A 4HIDA 1STYA 3M7GA 3NELA 1J9OA 1BF4A 1QWYA 3QOLA 5FKAC 3K5MA 4LF8Q 4K8IA 1II3A 2IX1A 4A3MB 1EEID 2QW7A 4HCSA 1UNSA 2CFMA 4KY5A 5J1ZA 4L5TA 1ASZA 2F3IA 4O42A 4CDFC 1IYVA 3NBIA 5C0XH 4AH6A 1W2BA 4R1JA 5F2DA 3I4NB 2MGSA 1BNZA 2Z0SA 3J7AF 4QUFA 1QVGA 4MN3A 1CA6A 4BY7G 4UP8A 1DOKA 2VQEQ 5M9OA 1B1ZA 1TKWB 4QIWE 1QOHA 3OSOA 3DWQA 4JI6Q 1YNJD 1IXRA 1CI3M 2B8FA 1ILQA 3HS0C 3GTOB 3WWVA 1S5DD 4N9TA 3PF5A 4K2KA 1VQMA 3BVMA 5EBCA 2XN9C 1VQDA 2UU9Q 2B2YC 5IYDG 1Z9FA 1VQ9A 1U5KA 3NQTA 4DF7A 1IBKQ 2CH4W 2J0TD 2P5ZX 3HOYG 3MFYA 1JOKA 4P73A 5KNCA 4Q5VA 3NPPA 2HQLA 2ZJPA 4JI0L 5EJWA 3R8BA 1A3TA 2D9UA 1C8CA 1Q8IA 3AQQA 4OWWB 2B2TA 2QDBA 2D5DA 4BXXH 1OXVA 3CQZH 4LMQD 4WJWA 4B3SQ 1QE6A 1YHAA 4X3TA 4POFA 3H91A 1FGBD 2NVXH 3CCMA 4LFAL 2XWJB 1HJPA 4UDUC 3E0JA 4B08A 2EYPA 3KUPA 1Y69U 3MZ5A 4A3GG 3CCLA 4QF4A 1PRTC 1SNQA 2I5MX 3J80L 1S40A 3W5OA 1JWMD 2MNAA 4RCOA 4JV5Q 2NZOA 3A7LA 3PUWA 2IJ0A 4OONA 4FXDA 2KENA 5JAVA 3G4SA 2JEAI 1JB7A 3DM3A 2I5HA 2VNUD 5C6AA 4BY1H 3K7AB 4DV3Q 3QIAA 4FF3A 1TWFH 3ICEA 4FNFA 1WD1A 2K5VA 1U0LA 1H9SA 2K5DA 3DEOA 1VQHA 3NE5B 3C46A 3VDYA 4UAIA 5I2XA 1SBBB 4A3JG 1F9SA 2K01A 2L5TA 4BBRH 1SMYD 2OXPA 1GXDC 1RTNA 3J81c 3GDEA 2Q2IA 3RZDH 3HOWH 2JQOA 1D8LA 1M8AA 4F88A 2NVTH 1E2WA 5IYCG 2KCNA 3CCEA 2E2DC 2CQOA 1YJ9A 5M3MG 3IKJA 4KJNA 1FGUA 1PTOB 2B2VA 1VQNA 1I3QB 4ULLA 1ESFA 5LMNW 3T51B 2R3ZA 2WFWA 3MHBA 1GD7A 2EPBA 3Q8DA 1AZPA 2HCCA 3A5ZB 5HGTA 2EIFA 1G51A 4GKKL 1GOZA 5E4XA 4QQBX 1HNWL 1ZKOA 4TRDA 4YHHL 5I4DA 4F87A 4A93B 1VMPA 1CHPD 3LGJA 4KLKA 2BE5D 5BR8Q 3CXCA 2AUJD 2R93B 4ZKBB 1EY5A 4A3KB 1IZ6A 4B3SL 1M1KC 5KRUA 1STNA 3K7AH 5I6WA 3J80c 1VQLA 2IWHA 2E74C 2WP8J 1HA6A 3PO2H 3KJPA 1KAWA 1SNOA 1EY0A 3A0JA 1LT6D 3GTMB 3S1MH 2K75A 1HNWQ 4X3KA 4ZYSA 3BS1A 4PNYA 3KLWA 3RZDB 4ZLTF 5C4JB 1XYIA 4GOPB 5JEAH 1YZ6A 4KV6A 4CKEA 1VCIA 2L11A 2PI2A 3NWTA 5GQOA 1CHQD 4ID6A 1CZGA 3V96A 2L1BA 4DUZQ 5C44G 1WTRA 2G5DA 3TEHB 2B39A 1JMCA 4YCWA 3J81i 1D6EC 1O7LA 4JI7L 5FJ8G 4EQOA 4B3TQ 4IUUA 2XRQD 4OELB 3GTQH 3D4RA 3M4OH 1OXXK 4BWGB 4X64L 1YHBA 4IURA 2K14A 3NWSA 1BR9A 1V8QA 2ZJRA 1MSHA 2F0DA 3NK9A 2N55A 5IYDH 2RHQB 1QNKA 2K4KA 3CU7A 4GN3B 4QUCA 3PUVA 1ZEQX 3I3CA 3RUZA 3T1YQ 3VR6A 4BY1B 5CV7A 3TP8A 3ULPA 1SYFA 1C7YA 5C0XI 2PMZB 5M3FB 2M9VA 1K9MC 4OX9Q 5EKIA 4A3EB 1C4QA 1Z6HA 3I73A 3T4AC 2UUCQ 4N8FA 4GOPA 2LSSA 3M4PA 1HQMC 4O1NA 4LF4Q 3F8TA 1U4PA 1WI5A 1UUPA 4LUVA 4A3MH 4V190 3S15B 1EL0A 2CW0D 3T13A 4TKOB 4CKBA 2ES2A 3X3MA 5ELDA 4WORA 4A3BG 2XIWA 2ATWA 4DV5L 1CQFA 2HUGA 1B9NA 1HTPA 1EU4A 1YI2A 1WTWA 3MEHA 4A3DB 1E2ZA 5HY6A 1AN8A 3S1MB 2B2VC 5A35A 1HRJA 1SDFA 2F0HA 3NEMA 3PF4A 3T1HL 4PQXA 5GADC 1Y1WB 4E6IA 2KHIA 3J7YW 3M85A 4KY6A 1H9MA 3L3OC 4FF4A 4G4KA 2UXCL 5GAGC 2PZTA 1N36Q 1SFOH 2A68C 1KLUD 2IX0A 4R4QA 4A3CH 3QOJA 1D7QA 2F4VL 1VQ7A 4GLAC 1PH8A 3A54A 1UE1A 1PH3A 2OEOA 1GUTA 3GTOH 5JEAJ 4DV3L 2UXBL 1EY8A 5M5YH 3KJOA 3N52A 1FNVA 2Q8TA 3J80i 1PMRA 2L15A 4UP9A 4OEMB 1R4QB 1D5MC 3W2DA 2E2HB 3OHXC 3PUYA 1CKNA 1MGSA 1SXTA 5T1GA 4MZ9A 1Q82C 4KMUC 4L5SA 4QB4A 4DR7Q 5CBEE 2K5WA 1RTOA 4J1MA 4CKCA 2BH2A 2RCNA 3NHHA 5CV5A 5M5WH 2IW3A 1KTKA 3PO3G 4HEDA 4I65A 4JI2L 5A2QE 5BN4A 2H4OA 1NCVA 4NB3A 1IHZA 5M3MH 2NZ1D 2ZTDA 3ERSX 4GS3A 5KGUA 4PMCA 2PI2E 1I6VC 1SYEA 3K0YA 1KD1C 4JYAL 1H9RA 2RHSB 1WTOA 3HOZB 4PG3A 1PH6A 1XMQL 4JBMA 1EIFA 3MFGA 3STBC 3VYTA 3I4MG 1EY7A 3NSWA 4LFAQ 3NTIA 1S3OA 3K80C 2FMMA 3DEPA 3IAYA 1D1IA 1SYCA 4OO1I 4NDXA 2RF4A 3PMFA 4L8JA 3OTOQ 2RDFA 1I4RA 3FVQA 3K59A 1VF7A 3O13A 2BA1A 5EGTA 1BCPC 3KF6A 2JXMB 1VQGA 4DV2L 2A6EC 3W3AA 3TP6A 4ABNA 3ND8A 4UP7A 1KNEA 1N8RC 2JA9A 1R4PB 4H44C 2MFIA 2TSSA 3C1EA 1Z47A 2Z1CA 1AEXA 3ND9A 4HIMA 5KEEA 2JP1A 2VB3X 4NMZA 1Z7TA 4X62L 4RFBA 1N34Q 1XMQQ 4Y52H 2KEEA 2F03A 5E1FA 2SEBD 1CUKA 2F0NA 1U9RA 1MHWC 2QKIC 1DOMA 5EPKA 2J4XA 3R93A 2E2JB 1UE6A 3B6YA 2V1CC 1B70B 2YYZA 2AQ2B 1SNMA 2GN5A 4DV1L 3S15H 1S72A 2JEBI 4LNQA 1I94Q 2JE6I 4OWTB 2JA7B 4UHVA 1D1KA 1LYLA 1H9JA 4HAEA 4JI0Q 3WOFA 4RGTA 1Q3LA 1YNXA 3C3LA 1AFPA 2EY2A 2EJGC 2K5NA 2F4VQ 2OTLA 4KHZA 3HOWB 2WAQG 5ELBA 5ELCA 2NVTB 1EFWA 1VQBA 1OXUA 1N34L 3GTJB 1N36L 1GHJA 3KBGA 3BG3A 4O2DA 1JOOA 1QZHA 3I4MB 1ET9A 3I56A 1JJ2A 1JCKB 1MIUA 4A3IB 1CTMA 4YCVA 1S5FD 2B3GA 3GP7A 1V1OA 3G6JB 1LLRD 3CKIB 3D3RA 4KN7C 2NZHA 2A6HC 2AKWB 3VA5A 2EXZA 4KI0A 2UUAL 1TIID 1SEBD 4XT3B 2F0GA 3S16H 2CQAA 1VQCA 4K6DA 4X65L 1EYGA 5K36H 1UEAB 4PZ6A 3CAMA 4JI5Q 2R92B 4YIJA 1KL9A 1RL2A 1LTTD 3GTPB 3HOUH 2NUCA 2F0EA 3HOXB 2EVBA 4C2MH 3HOYB 5C4XH 4R9WA 1TWGH 4IUPA 3MA2B 1SE4A 4A4IA 2LFNA 3TS2A 4DUYL 2NTTA 3SK8A 4DR6L 3S1RH 4DR2Q 4KKSA 3G7LA 4AQYL 3HOZG 3STBD 2HD3A 4HN7A 1B53A 2E5LQ 2VXWA 1VQOA 1Y14B 1XWEA 5CV4A 3TBIB 4DNRB 1HNZL 5EPLA 3D8GA 4IJHA 1KC8C 1DJRD 3T53B 2F0VA 5M5XH 2KVMA 1SNDA 1EOVA 1IBMQ 2GVAA 3GQBA 4HJAA 1PTOC 3U9SA 1CK1A 3NXWA 3CCUA 4RGNA 1HNXQ 1V1QA 1KQSA 1SMYC 4BA1I 1I4HA 3I4NG 4XYQA 5A2QL 1LUZA 1VQEA 5JJZA 3E9HA 4CJ1B 4HJ9A 4FF2A 5IWAQ 1PYSB 2Z9HA 2PZUA 2B63H 5ELNA 3SK5A 4WFN3 4A3BB 4C56C 4KJOA 1JR0D 4HCEA 1SYGA 3OWFA 5IGBA 3I8ZA 3K5LA 3I90A 3LWEA 4CHTB 2JA6H 2F0KA 1CKNB 1ZYRC 4EVOA 1JT8A 1CSQA 1TWAH 4KD4A 5C3EG 2B8GA 5ELFA 3SE0A 2R7FA 2FJ2A 2MPMA 1F2LA 1DM0B 3UI2A 4C3IB 4JV5L 1NUCA 2LXKA 5CC4A 2VQEL 5BN3A 1X56A 4S3SA 3CPWA 1EIGA 2RA4A 1HQRD 1TR5A 2N8NA 4OGQC 2B2UC 3F2CA 4YWMA 4P75A 1VQKA 2R7ZG 1NJIC 3UDIA 1RODA 3KF8A 2RDHA 3Q6SA 1EUJA 3EROA 2Q2TA 2L55A 1MD2D 2VY3A 2YU9B 3ULJA 1EZ6A 1HUMA 3HGBA 4LFBQ 1SN8A 3FPPA 3GTGH 2ASBA 4R4OA 2VUMH 3MVVA 1HFGA 1G8ZD 2FFKB 1QZGA 4HJ5A 3WDNA 3T16A 4YCUA 2PQAA 3CC7A 4DR4L 1WFQA 5AJ3L 3HP3A 2EYFA 4A93G 1G2TA 3M4YA 1BVSA 2ZXOA 5IOCA 2EXDA 3JAML 3P1HA 2BCOA 2SNMA 1YEZA 2EJFC 5IGCA 2JSOA 4A3EG 4JOIC 3VR5A 4FF1A 3RNUA 5IP7G 2NN6G 1RDPD 2WAQE 1S5ED 1XXGA 1TQOA 5I9OA 2RBMA 3HG9A 5HURA 1A62A 1QUQA 3R3OA 3U9OA 3OPOA 4B9WA 1Q46A 1HA5A 3U50C 3FEWX 1JJGA 3S24A 2A6ED 1EYDA 1FNUA 4AYBB 3FKIH 2HIXA 3TZDA 4DV6Q 3EQLC 5C5MA 2FXQA 1J6QA 4NXNL 3QR8A 3HOVH 2HQEA 1I94L 3GTGB 3S2DB 4JOIA 2B63G 2B2WC 4FDBA 4DV5Q 5C3EB 4G57A 3MXPA 3L2PA 3K5OA 2F0OA 4GN4B 4LF4L 2L0CA 1A0IA 3S14B 5FLMH 4L5QA 1X9NA 1YBYA 3Q23A 3D6CA 1KDAA 4DV0Q 3X3NA 4GLXA 1EYAA 3G6EA 1K28A 1C9OA 3H0GG 4J15A 3U4VA 1IL2A 4R4CA 3EVQA 5C0XG 3K58A 2VS1A 4JI5L 3NQIA 3SEBA 4A3BH 4C1NK 2DY7A 4EQPA 4C3HH 3RLFA 1VQJA 2XVSA 4DAPA 1A2UA 4I7ZC 3KF8B 5LHY1 5JPNC 1Q1EA 3M7NA 1T5EA 4IOAA 2SOBA 1K83H 1SNPA 2UUAQ 4RCNA 1NR4A 4X64Q 4IOCA 4JCVE 4R4IA 1CKOA 1O7IA 1E1OA 4DA2A 4GZYC 4LW1A 1K8GA 1E0BA 1G6ZA 1STBA 2O4XA 4RHRA 4GKJQ 2IPKD 2EQSA 4CJ2C 3AEVA 3S17B 3D31A 1LT5D 3LX0A 2FHTA 3S1RB 3FKIB 5AJ3Q 1N32L 4K6LA 4OX9L 4DXFA 1EU3A 2AHOB 3KDFA 3QJYA 4MTNA 3S9WA 2WIIB 4MHEA 2UXDL 2IY5B 2F52A 5FLMG 4B3ML 3DLLA 3J81j 1XNRQ 3K6OA 2ZXPA 2KBNA 3RZOB 2JA8B 5J39A 4LWCA 2H5XA 2VUMB 1X54A 3BDLA 1F77A 1JB3A 2E76C 4ZK9B 2IHEA 1TVXA 1I4XA 5CV6A 1NBWA 4BS9A 3GTJH 2K52A 2CW0C 1E1TA 1JQYD 2CH4A 2AWNA 4B3MQ 1FD7D 4IPGA 3PQIA 1LTLA 1W3SA 2G9DA 2EE1A 3KLRA 3CCVA 3BVZA 1LABA 1L0YB 2E2HH 2ICIA 4X6AH 2I5LX 1VQPA 4KKTA 2NN6H 2NWGA 3QWNA 2EZVA 3S1QB 3T56B 2EYOA 2D62A 4DXGA 1DZ1A 2OQ0A 4NXNQ 1Y8NB 1VS0A 2DJFC 5C3XA 4DV2Q 1VQ8A 3JAMc 4DR3Q 1TWAB 1F2MA 3D6WA 1B7YB 2PNRC 2EJMA 4K8JA 3GTLH 1NY4A 5FLXE 4JI6L 2LMCB 1A8VA 1KABA 1E22A 2A8VA 2VUMG 1OTCA 4JI4L 3UE0A 4BY7B 3AFPA 4JPBW 3A74A 1LACA 4RMFA 4AQYQ 1RIPA 1I4GA 1TY0A 4DFAA 4KK7A 3KDFB 3F2DA 2NBFA 5LMUQ 4A93H 3J7ZC 1DCZA 4UY8C 1TS2A 5IE8A 3RR5A 3QG1A 4QCLA 1UEBA 4N9PA 1E3PA 1TY2A 2E2IH 1SJHD 1YJWA 1I6HB 3ZYYX 4A3IG 4NXML 1WTQA 4IUTA 5JEAG 2MP1A 3AB9A 2EYLA 1SE8A 1G6PA 1JC7A 3I55A 2KQ3A 4K5WA 1CKMA 1BBWA 3MXGA 1EZ8A 4FXKC 5G3LF 3M9BA 2KECA 1I50B 1WD0A 4LF7Q 4DGZA 4CGYB 2R7ZH 1B4OA 1L1OB 2QEXA 5M3FH 5IT9c 4NXMQ 5AFWA 1Q81C 4DU9A 5EQ0A 2MHVA 3I70A 5IGFA 3IRBA 3FMCA 2PW5A 3HOWG 2GVBA 2EY5A 1FJGL 5ELEA 4JK1C 1JWSD 4NPSA 1TWCH 2A69C 4QJFA 1K8MA 2RCFA 2B2UA 3ONAB 3TP5A 3PUXA 5COYA 2VQFQ 4PZ8A 1PH9A 2CKZB 2NVQB 3H0GH 3EJIA 1ONLA 1XPUA 3S2HB 4DUZL 1EIYB 5K36G 1SYBA 2AUKA 2Q8IB 2NVYH 4XIGS 4IN3A 1I4PA 2KJXA 2K5QA 3A7AB 3MC0B 2E8GA 3DM1A 4ZUIA 2WV6D 1RKNA 5GAHC 2AMCB 4ZRZA 1HUNA 3H3VI 2KEDA 1S4ZA 4MNOA 3MXNB 1I50H 3I91A 4B9XA 4LF9Q 1PH5A 4ZCKA 3OYYA 1DONA 1G91A 4IUQA 3Q0AA 5H1SE 3KF6B 1Q86C 1DOLA 1NAPA 4RKLA 2KHJA 3FKIG 5M5YB 1ICFB 3GV6A 5D14A 3VR3A 2I0QA 3K81C 3HOUB 1NMGA 4LFCL 3SDZA 1PH1A 1LTBD 2F0IA 1GUGA 2R92H 1GUOA 1RCVD 4FXGC 4RGMA 4A3FB 2BE5C 1I3QH 3CC2A 1EY6A 1F9QA 2B2YA 5ISRA 4XT1B 3AFQA 1TS3A 4DV7Q 2ALYB 2WB1B 2BDNA 4LF9L 1OXSC 1SE3A 3EBEA 2PQAB 3E5SA 1G2SA 4IFDG 2R7ZB 5M3FG 4OHJA 1XJVA 2WB1E 1HH2P 2LXJA 2TMPA 4DAVA 3G48A 3K8AA 2O2LD 1IBKL 2RKSA 1SR3A 4KTAA 1BO0A 1XTCD 3TS0A 2R61A 1EQRA 4R8NA 3H15A 2ZT9C 3SR1A 1A63A 3UDGA 2GA4B 4R4TA 1V1PB 5IP7H 3H3VC 4NW2A 1BDOA 4LF5Q 4XQJA 4CBVA 5C3EH 1IW7C 1V9PA 4DV4L 4Z9CB 2HHHL 4X65Q 1H9SB 1XPOA 1ASYA 5CR3A 1KRSA 1JE4A 4K5XA 3RN5A 1R9TH 4X66L 3TDQA 3WOEA 2DNEA 4OO1G 3A8KE 3Q22A 4GKKQ 3KLSX 1PFNA 5M5WB 5FO9B 3CRLC 1JORA 4QIWB 1AW7A 1IYUA 4CJ0B 1IBML 1U4RA 4ME3A 3PSIA 2UUCL 4KHPL 1VQ6A 1XNQQ 1A3VA 2O5JC 4IPCA 2F0SA 1DD2A 5E7NA 1ENFA 3SVMA 1B2TA 4LF8L 4HR7B 3RMHA 3BDOA 4M1UB 3L9AX 2HHHQ 2BDOA 1K73C 2NTSA 3T1YL 4PMWA 2A69D 2NVXB 3CCSA 1H95A 4DR5L 1O7YA 3QO2A 1LTID 3NTKA 1BBXC 1L2FA 4LF5L 1B3QA 2CWPA 1K8OA 5DM63 4DR1L 4EX5A 2PYKA 2ZM6L 3OMGA 4B3RQ 2K03A 4G7OC 4XTCS 2EYHA 2WKCA 5CV9A 1TU2B 2F0LA 3FHWA 2PZWA 4I7AA 4P2CB 4GNXA 1MJEA 3BDCA 4H02A 1EY9A 4K2LA 4A3JH 4L5RC 4KN4C 3OIQA 1PLFA 1TWFB 3F2UA 4NKLA 4A75A 1HZ9A 3BYYB 1HR0Q 5JJKA 1MJCA 3J7AV 3CCQA 2O5IC 1QJOA 1E24A 3HOXH 3J81E 5ELOA 3NP8A 5DAUA 3N6RA 1QVCA 1N33Q 1H9KA 3TMEA 5DEHA 2DNCA 2OF1A 2UU9L 1STHA 2YV5A 4JVZA 1F2YA 2HT1A 1X32A 4DAMA 2JJQA 1ZXTA 4TSSA 3L0OA 4LFBL 2XGTA 3VYUA 2QCPX 2Y0SG 1BBUA 1BOSA 2K28A 3E0EA 1PZID 1KLGD 5C3WA 3P75A 1EOTA 4K14A 4EGVA 4FYDA 3KFUA 5M3MB 2JA7H 4AIMA 4MIUA 2F3WA 2G9HD 1TXYA 3PIP3 2KA7A 3C1FA 2BOSA 3IFTA 4ILWA 5HGQA 3DXJC 5L37A 4PZ7A 1HZAA 1X3QA 3HZXA 3HOZH 1DGSA 2L4NA 3D0FA 3HFZB 2IT1A 1N32Q 3LNNA 1HPCA 1CQVA 4POGA 3I4MH 2K6AA 1LT4D 4H13C 1I4QA 4DAYB 3C2PA 1T5XD 3RLOA 1HR0L 3URYA 1PTOH 4JI2Q 1MBYA 4GKJL 4ME5A 4K5VA 5JOBA 1HZBA 3E9IA 3S1NH 4LF6Q 3H3VH 1A3UA 4X3SA 4BY7H 1B3AA 2OT2A 4LK1C 2Z4IA 3PIO3 2R93H 4H7BA 4N8X1 2D0PA 2DUDA 3NBHA 1C48A 2WAQB 3EIVA 4V0BA 2B2TC 1UE5A 2F0JA 2K7VA 1B8AA 4A76A 3AYHB 3R2TA 4A3MG 1PVOA 4ALPA 2F0QA 4J6HA 4OWXB 1YNND 3FP9A 1K3RA 1KRTA 4DK6C 1SNCA 1X55A 1PA6A 1IL8A 1WVLA 2JA5G 4P72A 1B9MA 2PCFB 1PFBA 4K0KL 1Q12A 3AU7A 4JI1L 3PIPA 1RHPA 3SK4A 1KDCA 3CCRA 1G291 3IL8A 2K33A 1X3EA 4A3GH 1J5EL 2VL6A 1IBLQ 1XX8A 1LTAD 5IY0A 2XRSD 4DR3L 2PMZE 3PV0A 3PCOB 4DR6Q 1X6OA 3KK7A 4NP5A 1LTRD 2HDLA 2NVYB 3E6ZX 5C4JH 1XTDA 1ZYRD 4LUZA 3GO5A 4OIKA 3PUZA 1VQ4A 2HCIA 3OOCA 1BKBA 3OMCA 1I5FA 1PYWD 3TRZA 4IZ8A 3HKSA 4A3JB 2JA8H 1O78A 5LL6X 4IPHA 4JI1Q 1SMXA 2F0WA 3ULLA 2B2WA 4X66Q 2MO0A 5TSSA 2K50A 1E7ZA 1PDQA 4DV6L 4PV1C 4C3JB 5J22A 4HJ7A 3GTQB 1FL0A 4H0LC 4HMIA 3PO3B 4BBSH 1FR3A 3OW2A 5IT9E 1XNRL 1PTOF 5FLXc 5GROA 1ICWA 1PYBA 2UXDQ 4QL5A 4ZAIA 3CD6A 4C3IH 1F9PA 1P16A 2JN4A 1BQQT 4IFDI 1YIJA 1CM9A 3S1QH 4RAUC 1CT1D 1D5XC 1D2BA 4LF6L 4RKBA 3M3YB 4HSPA 5IYBH 4C1NI 1RF2D 2RVLA 5KIXA 5IYCH 3GTLB 2Z4HA 2UUBQ 4KY7A 3DHQA 4A3DH 2AWOA 2R6GA 4GN5A 1MI2A 3OW7A 5BN5A 3KOJA 1BCPB 4WRDA 3I4OA 2X6LA 2RSOA 1PRTB 4HTHA 5JVH3 4A3DG 5JJLA 3P7JA 3FPUB 1DYQA 4B3RL 3I2ZA 4A3IH 4DV7L 2ZTCA 1QVFA 3ZJYC 2WKDA 2Q8RE 1A15A 2X6GA 3S2DH 1CA5A 1QUQB 2F0TA 1PTOD 4OIJA 3HOVG 4LAAA 2NYZD 1QILA 1GVPA 4C3JH 2A6HD 2F0UA 2JK8A 3HKZG 3D4DA 1LTSD 1SROA 1ENCA 3PO3H 1Y1WG 1ENAA 4TVAB 3SXHA 2DGYA 1KIXA 3MXNA 3MEFA 3GTPH 3K7UC 5EBDA 2E75C 2UUBL 2PPBC 3A8IE 4ODGA 1HNZQ 4Y7NH 5C4XB 1LT3D 4HMJA 2LS01 3SGIA 1KXLA 1CFMA 4F7XA 1J5EQ 2QF7A 3HOUG 3MXUA 5IYBG 1ESRA 3DUZA 4EQNA 3BZCA 2D2CC 4IUVA 2FINB 5CV8A 1WTVA 2PW7A 2UXCQ 2JA6G 2JYOA 5LMUL 2N88A 4DKAC 1Q90A 4L6TB 4DN4M 3T1HQ 2D0OA 4YY3L 5CMDA 4DV4Q 2UXBQ 4JBJA 3BVGA 1A2TA 1GJXA 4CDCC 3TQYA 4P71A 5IWAL 3DMUA 1MKHA 3RZOH 1U4MA 1UAPA 1OO9B 4GLVB 3M3YH 5KYLA 4JG2A 3V2TA 4A3CG 1HHVA 1ML0D 1EY4A 3DWPA 3OWEB 2ZM6Q 2LY7A 2K32A 2NN6I 2RDGA 5C5LA 4C3IG 2M2LA 3GV3A 3A5UA 1ILPA 1X3FA 1EQTA 1Y8OB 2AQ1B 3V05A 1ET6A 4CDDC 1JOQA 2N3SA 2NB0A 4ZUJA 3PO2B 4C3HG 1VQFA 1BCPD 2DY8A 5C44H 1QNUA 2R7DA 1GHKA 1FNWA 1PRTF 4DR2L 3UE1A 1SLJA 4MTKA 4WJ4A 1K0SA 1E2VA 1AE2A 1MSGA 1D5ZC 2B29A 2MO1A 2PNHA 2YTXA 5CBAE 1WTPA 3RLNA 2E2JH 2QGQA 2YTYA 1M90C 4A3KH 2DJGC 3E3XA 4A3FH 2OTJA 3EFXD 4YWLA 2QILA 2VB2X 1FYCA 5I6YA 3SHLA 1NNXA 1PZKD 2JA6B 1SAPA 3I72A 2AQ3B 2A5HA 2VZAA 1STAA 2Z6KC 1JICA 4IALA 1B50A 5DNFA 3UDXA 2KUMA 1GM5A 5FO7B 1KAAA 4J8QA 3FRPB 1HTLD 1K3BC 4P74A 1JJCB 3JAMi 2R93G 3S1NB 4HIOA 2F3VA 2EY6A 1HR0W 3HKZB 3AMUA 1STGA 1NR2A 1PFSA 2FMCA 5FOBB 3JAME 4DV1Q 4BBRG 4M8AA 3CF5A 1Q1BA 4DR1Q 2E5LL 4IQZA 1GUNA 2L12A 2X69A 1VQIA 1TS5A 4DK0A 5IIFA 3U4ZA 2F0FA 2Q2HA 5C44B 3NENA
chains in the Genus database with same CATH topology
3RN5A 3ICEA 1TWFH 3CW2C 1R9TH 4X66L 2K5VA 1U0LA 1EQQA 4OO1G 1VQHA 4GKKQ 3PIOA 1Y1VH 2JA6H 3VDYA 1CKNB 4A3JG 1JT8A 1CSQA 1TWAH 4YHHQ 4ME3A 1IBML 5C3EG 3PSIA 4AYBE 1EWIA 1TWHH 4BBRH 2UUCL 2R7FA 4KHPL 1VQ6A 2BH8A 1XNQQ 3J81c 3GDEA 2Q2IA 3RZDH 3HOWH 4JV5L 2JQOA 2LXKA 2VQEL 2VQFL 4IPCA 1D8LA 2NVTH 1X56A 5E7NA 3CPWA 1L1OC 5IYCG 4DK3C 4JI3Q 4LF8L 2C35B 3CCEA 2CQOA 1YJ9A 2N8NA 5M3MG 2HHHQ 1K73C 3F2CA 3T1YL 4YWMA 1FGUA 4P75A 4PMWA 4JC0A 1VQNA 1VQKA 1PV4A 4GNXC 2JA8G 3CCSA 1H95A 1JE5A 2R7ZG 3CPFA 4DR5L 3UDIA 1NJIC 5LMNW 3S1NH 1EUJA 1L2FA 2WFWA 3EN2A 1GD7A 3JC66 3RN2A 3Q8DA 2Q2TA 4LF5L 2JA7G 2CWPA 2VY3A 3ULJA 4IPDA 4EX5A 4DR1L 1UE7A 1WOCA 2ZM6L 5C0XJ 4BBSG 3A5ZB 4LFBQ 1SN8A 4B3RQ 2EIFA 1G51A 3GTGH 4GKKL 2ASBA 4XTCS 5EAYA 4QQBX 1HNWL 4R4OA 2IHFA 3FHWA 4GNXA 1MJEA 4YHHL 2VUMH 4JI3L 4H02A 4A3JH 4L5RC 1QZGA 4HJ5A 4YCUA 3LGJA 1WJJA 4KLKA 5BR8Q 3CXCA 3CMEA 4A75A 1Q7YC 1HZ9A 2PQAA 3CC7A 4DNIA 1HR0Q 4DR4L 5JJKA 1IZ6A 1MJCA 1WFQA 4JI8Q 1VQ5A 2Q2UA 5AJ3L 4B3SL 3BZKA 3CCQA 1M1KC 4A93G 4LF7L 1E24A 3HOXH 1BVSA 5ELOA 3K7AH 2EXDA 4YWKA 5IP9H 1Q8KA 1QVCA 3J80c 1VQLA 1T9HA 2OWOA 1N33Q 1YEZA 2MQHA 2UU9L 2WP8J 4KHPQ 3L7ZC 3PO2H 4A3EG 2YV5A 3KJPA 1KAWA 4JOIC 2HT1A 1XPRA 4BA2I 2A1AA 3A0JA 4DAMA 3RNUA 2JJQA 2N49A 5IP7G 2NN6G 3L0OA 2ID0A 2WAQE 4LFBL 2XGTA 5BR8L 3S1MH 2Y0SG 1BBUA 2K75A 1HNWQ 3E0EA 3KLWA 1A62A 1QUQA 2K5HA 4GNXB 4GOPB 3KFUA 1PH7A 1YZ6A 2JA7H 4AIMA 3S17H 4IJLA 1Q46A 3U50C 1VCIA 1JJGA 2PI2A 5GQOA 3S24A 1TXYA 4GOPC 2A19A 3FKIH 2HIXA 4DV6Q 2FXQA 1J6QA 4NXNL 5HGQA 1PH2A 4PZ7A 1HZAA 2KCTA 4JI8L 3HOVH 1I94L 4DUZQ 5C44G 3HOZH 1DGSA 4JOIA 2B63G 3S2HH 4FDBA 3TEHB 4DV5Q 1IBLL 1JMCA 3D0FA 3HFZB 3I4NH 2IT1A 4YCWA 3J81i 1HZCA 2QA4A 4JI7L 1VQAA 1N32Q 5FJ8G 3K0XA 4B3TQ 3L2PA 4POGA 4BXXG 4GN4B 4LF4L 4K0KQ 3I4MH 1AH9A 1PH4A 4DAYB 3RLOA 1A0IA 1HR0L 3GTQH 4DR4Q 4JI2Q 5FLMH 3M4OH 4L5QA 1OXXK 1X9NA 1GO3E 1YBYA 4GKJL 4X64L 1YHBA 1HZBA 2K14A 3E9IA 5J3BA 4AYBG 4DV0Q 4GLXA 4LF6Q 1XMOL 3H3VH 4BY7H 3G6EA 2ZJRA 1Y1VG 1C9OA 3H0GG 2YU9H 4RG1A 4J15A 2R93H 5IYDH 2RHQB 2D0PA 2DUDA 3PGZA 2K4KA 4R4CA 4GN3B 3U4VA 2CCZA 1IL2A 2Z6KA 5C0XG 1GKHA 3EIVA 3PUVA 2VS1A 3HKZE 4JI5L 4JYAQ 1UE5A 3T1YQ 4A3BH 4A76A 1B8AA 3OTOL 4C3HH 3RLFA 1VQJA 3G71A 3ULPA 1XNQL 5JJIA 5FJ8H 3GTKH 3AYHB 4A3MG 1C7YA 3KF8B 5C0XI 5LMNQ 1AE3A 1PVOA 4ALPA 1K9MC 1Q1EA 4OX9Q 3M7NA 4OWXB 4IOAA 4O0AA 4DPGA 1K83H 2VW9A 2UUAQ 3FP9A 1K3RA 1WCMG 1KRTA 4X64Q 4DK6C 1X55A 4IOCA 4JCVE 4R4IA 1PA6A 4A3EH 1CKOA 2UUCQ 4DUYQ 1O7IA 1E1OA 4GOPA 2LSSA 4LW1A 2JA5G 3M4PA 1K8GA 4P72A 4LF4Q 2OQKA 1Q12A 3F8TA 4K0KL 1WI5A 1N9WA 4JI1L 4LUVA 3PIPA 3CCRA 4A3MH 4GKJQ 4UPAA 2EQSA 1G291 3AEVA 2ES2A 4A3GH 1X3EA 2VNUD 1J5EL 4A3BG 2ATWA 3D31A 2VL6A 4DV5L 1IBLQ 1I6HH 2ZJQA 4A3LH 5IY0A 3BU2A 1YI2A 5AJ3Q 3CC4A 4JI7Q 1N32L 4DR3L 2PMZE 4OX9L 5HY6A 3PV0A 3PCOB 4B3TL 1OXTA 4DR6Q 3TREA 2AHOB 1X6OA 3KDFA 4QGUA 4MTNA 4X62Q 1N33L 3S14H 3PO2G 3NEMA 5C4JH 1XTDA 3U58A 2UXDL 3PF4A 1SRUA 4WJ3M 2IY5B 4LUZA 4DR7L 3T1HL 3GO5A 2F52A 5FLMG 5GADC 4B3ML 1K8AC 3PUZA 1NMFA 3DLLA 1VQ4A 2KHIA 3J81j 3M85A 2CWAA 3CCJA 1XNRQ 1P8LA 2KBNA 1BKBA 4LWCA 1I5FA 1WYDA 5GAGC 2UXCL 1N36Q 2H5XA 1SFOH 1Y1WH 4R4QA 3TRZA 2IX0A 1X54A 4APVA 5IP9G 4A3CH 3HKSA 1D7QA 2JA8H 4A3FG 4IPHA 2KCMA 3F2BA 1VQ7A 2F4VL 4GLAC 2BA0A 4JI1Q 1UE1A 1PH3A 2IHEA 1PH8A 3GTOH 5JEAJ 1SMXA 4DV3L 2UXBL 1YVCA 3ULLA 1NBWA 4X66Q 5M5YH 3GTJH 3KJOA 2K52A 2MO0A 2K50A 3I7FA 1E7ZA 3J80i 4TQUS 1E1TA 2L15A 4UP9A 4DV6L 5GAEC 4HJ7A 4NXMQ 2AWNA 1FL0A 4B3MQ 1X65A 4IPGA 1LTLA 1W3SA 2WB1G 3CCVA 1CKNA 3PUYA 1YITA 3OW2A 1Q81C 4BBSH 4MZ9A 1Q82C 1XNRL 2E2HH 1NE3A 4QY7A 1PHJA 5FLXc 5GROA 2Y0SE 2I5LX 1VQPA 4X6AH 4JBKA 1PYBA 1YHQA 4L5SA 4DR7Q 2UXDQ 4LUOA 4QL5A 2BH2A 2RCNA 2D62A 3CD6A 4C3IH 5M5WH 1P16A 2OQ0A 1CSPA 4NXNQ 3PO3G 4IFDI 1K0RA 1VS0A 4EQ5A 1YIJA 1VQ8A 4DV2Q 4JI2L 3S1QH 3JAMc 4DR3Q 4DV0L 4LF6L 1B7YB 1YJNA 1FVIA 4NB3A 3CMAA 3GTLH 5M3MH 1NY4A 2NVQH 2N78A 2ZTDA 5IYBH 3ERSX 3M4QA 4GS3A 4JI6L 4DR5Q 2PI2E 4HJ8A 5IYCH 1A8VA 2UUBQ 4A3DH 4JBWA 2AWOA 2R6GA 1E22A 4GN5A 1KD1C 4JYAL 3W1GA 3ER0A 3KOJA 2A8VA 3I4OA 1L0WA 2VUMG 1OTCA 3HOYH 4A3DG 2RHSB 5JJLA 4PG3A 1PH6A 1XMQL 4JI4L 4B3RL 3UE0A 3I2ZA 1EIFA 4JBMA 4A3IH 3CP0A 3STBC 3AFPA 3I4MG 4DV7L 4LFAQ 1IYJB 2ZTCA 4A3KG 4LFCQ 1S3OA 3A74A 4A3LG 3K80C 1QVFA 4RMFA 3ZJYC 4AQYQ 1RIPA 4IFDJ 4OO1I 3S2DH 2RF4A 3KDFB 1QUQB 3F2DA 5LMUQ 2ZTEA 3NBHB 4A93H 3OTOQ 3J7ZC 3HOVG 1LM0A 2XTIA 1XMOQ 4UY8C 5IE8A 2BA1A 3RR5A 1GVPA 5LMNL 4C3JH 1UEBA 4HIKA 2JK8A 4YY3Q 3HKZG 1SROA 3KF6A 1E3PA 1VQGA 4DV2L 3UDFA 3BJUA 1YJWA 2E2IH 3PO3H 1Y1WG 4A3IG 2YTVA 4NXML 4TVAB 1FJGQ 2DGYA 3KYHC 1KIXA 1WCMH 4UP7A 1N8RC 3MEFA 2JA9A 5JEAG 3K7UC 3GTPH 1C0AA 2MFIA 1Z47A 1SE8A 2UUBL 1G6PA 1HNZQ 3J7A5 4HIMA 3I55A 4Y7NH 1CKMA 1HNXL 1BBWA 5C4XG 4X62L 1N34Q 1L1OA 1XMQQ 4JI4Q 3SGIA 4Y52H 1KXLA 1UWVA 3M9BA 1J5EQ 3GD7A 4LF7Q 2R92G 3HOUG 2HIVA 5IYBG 1CUKA 3BZCA 3GTMH 2R7ZH 1L1OB 2QEXA 2UXCQ 2JA6G 5M3FH 5IT9c 1NTGA 5DLQE 4BY1G 1V43A 1UE6A 2OCEA 1KHIA 3B6YA 2V1CC 3W1BA 1B70B 2YYZA 4OXPA 5LMUL 3HOXG 2GN5A 3F1ZA 4DV1L 4DKAC 1X3GA 3S15H 1S72A 2JEBI 3T1HQ 2D0OA 4YY3L 4DV4Q 2JA5H 2UXBQ 3IRBA 4IO9A 4JBJA 4HIDA 1I94Q 4LNQA 3NELA 2JE6I 2GVBA 3HOWG 3TQYA 4P71A 1FJGL 5IWAL 4OWTB 1MKHA 4LF8Q 2IX1A 1LYLA 3RZOH 4NPSA 4JI0Q 1YNXA 1TWCH 2CFMA 4QJFA 4L5TA 2K5NA 1ASZA 2OTLA 4KHZA 2F3IA 4GLVB 2F4VQ 2WAQG 3PUXA 2VQFQ 4PZ8A 1PH9A 2CKZB 1VQBA 4JG2A 1EFWA 3M3YH 3H0GH 1XPUA 1OXUA 1N34L 4A3CG 4AH6A 4DUZL 1W2BA 1N36L 4R1JA 1EIYB 5K36G 2NVYH 2Z0SA 2ZM6Q 4XIGS 2NN6I 4O2DA 1QVGA 1QZHA 4BY7G 3I56A 4UP8A 1JJ2A 2VQEQ 1MIUA 2E8GA 3A5UA 4YCVA 2B3GA 1X3FA 4QIWE 5GAHC 2AMCB 4JI6Q 3H3VI 1IXRA 4MNOA 2N3SA 2NZHA 3MXNB 1VQFA 1I50H 2AKWB 5C44H 2R7DA 4DR2L 1PH5A 4LF9Q 4KI0A 3OYYA 3WWVA 2UUAL 3UE1A 1SLJA 3PF5A 5H1SE 3KF6B 1Q86C 1AE2A 1VQMA 4WJ4A 3S16H 2B29A 2KHJA 1VQCA 2MO1A 2PNHA 2YTXA 3FKIG 3RLNA 4X65L 1EYGA 1VQDA 4PZ6A 2E2JH 3CAMA 2I0QA 3K81C 4JI5Q 1NMGA 2QGQA 1KL9A 2YTYA 1RL2A 4LFCL 1M90C 1PH1A 2UU9Q 4A3KH 5IYDG 1Z9FA 1VQ9A 1U5KA 4A3FH 2OTJA 2R92H 3HOUH 1IBKQ 4YWLA 4C2MH 3HOYG 4P73A 1I3QH 5C4XH 3CC2A 1TWGH 4JI0L 2HQLA 2ZJPA 3AFQA 4A4IA 4DV7Q 2ALYB 3TS2A 4DUYL 4DR6L 3S1RH 3AQQA 4DR2Q 4LF9L 4OWWB 2VZAA 1OXSC 2Z6KC 3EBEA 4AQYL 4BXXH 1OXVA 2PQAB 3CQZH 3HOZG 4IFDG 3STBD 3UDXA 4B3SQ 5M3FG 1YHAA 2E5LQ 4POFA 1VQOA 1GM5A 1Y14B 1HNZL 1XJVA 4IJHA 1KC8C 2NVXH 2WB1E 3CCMA 4LFAL 1HH2P 2LXJA 1HJPA 3G48A 3K8AA 5M5XH 1IBKL 1SR3A 4P74A 1JJCB 3JAMi 3TS0A 2R93G 4HIOA 4A3GG 1EQRA 3H15A 1EOVA 1IBMQ 3CCLA 2GVAA 1HR0W 4HJAA 2I5MX 1S40A 1A63A 3W5OA 3UDGA 4R4TA 3CCUA 2MNAA 4JV5Q 5IP7H 1HNXQ 1V1QA 2NZOA 4LF5Q 1PFSA 4DV1Q 1KQSA 4BBRG 4BA1I 1Q1BA 3CF5A 3I4NG 5C3EH 4DR1Q 2E5LL 3PUWA 1V9PA 4OONA 4DV4L 2HHHL 1LUZA 1VQIA 1VQEA 4X65Q 3U4ZA 3E9HA 2KENA 3G4SA 4HJ9A 1XPOA 5IWAQ 1PYSB 1ASYA 2JEAI 1JB7A 2Q2HA 3DM3A 2B63H 2I5HA 5ELNA 3NENA 1KRSA 4BY1H 4DV3Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RN5 A;  3ICE A;  1TWF H;  3CW2 C;  1R9T H;  4X66 L;  2K5V A;  1U0L A;  1EQQ A;  4OO1 G;  1VQH A;  4GKK Q;  3PIO A;  1Y1V H;  2JA6 H;  3VDY A;  1CKN B;  4A3J G;  1JT8 A;  1CSQ A;  1TWA H;  4YHH Q;  4ME3 A;  1IBM L;  5C3E G;  3PSI A;  4AYB E;  1EWI A;  1TWH H;  4BBR H;  2UUC L;  2R7F A;  4KHP L;  1VQ6 A;  2BH8 A;  1XNQ Q;  3J81 c;  3GDE A;  2Q2I A;  3RZD H;  3HOW H;  4JV5 L;  2JQO A;  2LXK A;  2VQE L;  2VQF L;  4IPC A;  1D8L A;  2NVT H;  1X56 A;  5E7N A;  3CPW A;  1L1O C;  5IYC G;  4DK3 C;  4JI3 Q;  4LF8 L;  2C35 B;  3CCE A;  2CQO A;  1YJ9 A;  2N8N A;  5M3M G;  2HHH Q;  1K73 C;  3F2C A;  3T1Y L;  4YWM A;  1FGU A;  4P75 A;  4PMW A;  4JC0 A;  1VQN A;  1VQK A;  1PV4 A;  4GNX C;  2JA8 G;  3CCS A;  1H95 A;  1JE5 A;  2R7Z G;  3CPF A;  4DR5 L;  3UDI A;  1NJI C;  5LMN W;  3S1N H;  1EUJ A;  1L2F A;  2WFW A;  3EN2 A;  1GD7 A;  3JC6 6;  3RN2 A;  3Q8D A;  2Q2T A;  4LF5 L;  2JA7 G;  2CWP A;  2VY3 A;  3ULJ A;  4IPD A;  4EX5 A;  4DR1 L;  1UE7 A;  1WOC A;  2ZM6 L;  5C0X J;  4BBS G;  3A5Z B;  4LFB Q;  1SN8 A;  4B3R Q;  2EIF A;  1G51 A;  3GTG H;  4GKK L;  2ASB A;  4XTC S;  5EAY A;  4QQB X;  1HNW L;  4R4O A;  2IHF A;  3FHW A;  4GNX A;  1MJE A;  4YHH L;  2VUM H;  4JI3 L;  4H02 A;  4A3J H;  4L5R C;  1QZG A;  4HJ5 A;  4YCU A;  3LGJ A;  1WJJ A;  4KLK A;  5BR8 Q;  3CXC A;  3CME A;  4A75 A;  1Q7Y C;  1HZ9 A;  2PQA A;  3CC7 A;  4DNI A;  1HR0 Q;  4DR4 L;  5JJK A;  1IZ6 A;  1MJC A;  1WFQ A;  4JI8 Q;  1VQ5 A;  2Q2U A;  5AJ3 L;  4B3S L;  3BZK A;  3CCQ A;  1M1K C;  4A93 G;  4LF7 L;  1E24 A;  3HOX H;  1BVS A;  5ELO A;  3K7A H;  2EXD A;  4YWK A;  5IP9 H;  1Q8K A;  1QVC A;  3J80 c;  1VQL A;  1T9H A;  2OWO A;  1N33 Q;  1YEZ A;  2MQH A;  2UU9 L;  2WP8 J;  4KHP Q;  3L7Z C;  3PO2 H;  4A3E G;  2YV5 A;  3KJP A;  1KAW A;  4JOI C;  2HT1 A;  1XPR A;  4BA2 I;  2A1A A;  3A0J A;  4DAM A;  3RNU A;  2JJQ A;  2N49 A;  5IP7 G;  2NN6 G;  3L0O A;  2ID0 A;  2WAQ E;  4LFB L;  2XGT A;  5BR8 L;  3S1M H;  2Y0S G;  1BBU A;  2K75 A;  1HNW Q;  3E0E A;  3KLW A;  1A62 A;  1QUQ A;  2K5H A;  4GNX B;  4GOP B;  3KFU A;  1PH7 A;  1YZ6 A;  2JA7 H;  4AIM A;  3S17 H;  4IJL A;  1Q46 A;  3U50 C;  1VCI A;  1JJG A;  2PI2 A;  5GQO A;  3S24 A;  1TXY A;  4GOP C;  2A19 A;  3FKI H;  2HIX A;  4DV6 Q;  2FXQ A;  1J6Q A;  4NXN L;  5HGQ A;  1PH2 A;  4PZ7 A;  1HZA A;  2KCT A;  4JI8 L;  3HOV H;  1I94 L;  4DUZ Q;  5C44 G;  3HOZ H;  1DGS A;  4JOI A;  2B63 G;  3S2H H;  4FDB A;  3TEH B;  4DV5 Q;  1IBL L;  1JMC A;  3D0F A;  3HFZ B;  3I4N H;  2IT1 A;  4YCW A;  3J81 i;  1HZC A;  2QA4 A;  4JI7 L;  1VQA A;  1N32 Q;  5FJ8 G;  3K0X A;  4B3T Q;  3L2P A;  4POG A;  4BXX G;  4GN4 B;  4LF4 L;  4K0K Q;  3I4M H;  1AH9 A;  1PH4 A;  4DAY B;  3RLO A;  1A0I A;  1HR0 L;  3GTQ H;  4DR4 Q;  4JI2 Q;  5FLM H;  3M4O H;  4L5Q A;  1OXX K;  1X9N A;  1GO3 E;  1YBY A;  4GKJ L;  4X64 L;  1YHB A;  1HZB A;  2K14 A;  3E9I A;  5J3B A;  4AYB G;  4DV0 Q;  4GLX A;  4LF6 Q;  1XMO L;  3H3V H;  4BY7 H;  3G6E A;  2ZJR A;  1Y1V G;  1C9O A;  3H0G G;  2YU9 H;  4RG1 A;  4J15 A;  2R93 H;  5IYD H;  2RHQ B;  2D0P A;  2DUD A;  3PGZ A;  2K4K A;  4R4C A;  4GN3 B;  3U4V A;  2CCZ A;  1IL2 A;  2Z6K A;  5C0X G;  1GKH A;  3EIV A;  3PUV A;  2VS1 A;  3HKZ E;  4JI5 L;  4JYA Q;  1UE5 A;  3T1Y Q;  4A3B H;  4A76 A;  1B8A A;  3OTO L;  4C3H H;  3RLF A;  1VQJ A;  3G71 A;  3ULP A;  1XNQ L;  5JJI A;  5FJ8 H;  3GTK H;  3AYH B;  4A3M G;  1C7Y A;  3KF8 B;  5C0X I;  5LMN Q;  1AE3 A;  1PVO A;  4ALP A;  1K9M C;  1Q1E A;  4OX9 Q;  3M7N A;  4OWX B;  4IOA A;  4O0A A;  4DPG A;  1K83 H;  2VW9 A;  2UUA Q;  3FP9 A;  1K3R A;  1WCM G;  1KRT A;  4X64 Q;  4DK6 C;  1X55 A;  4IOC A;  4JCV E;  4R4I A;  1PA6 A;  4A3E H;  1CKO A;  2UUC Q;  4DUY Q;  1O7I A;  1E1O A;  4GOP A;  2LSS A;  4LW1 A;  2JA5 G;  3M4P A;  1K8G A;  4P72 A;  4LF4 Q;  2OQK A;  1Q12 A;  3F8T A;  4K0K L;  1WI5 A;  1N9W A;  4JI1 L;  4LUV A;  3PIP A;  3CCR A;  4A3M H;  4GKJ Q;  4UPA A;  2EQS A;  1G29 1;  3AEV A;  2ES2 A;  4A3G H;  1X3E A;  2VNU D;  1J5E L;  4A3B G;  2ATW A;  3D31 A;  2VL6 A;  4DV5 L;  1IBL Q;  1I6H H;  2ZJQ A;  4A3L H;  5IY0 A;  3BU2 A;  1YI2 A;  5AJ3 Q;  3CC4 A;  4JI7 Q;  1N32 L;  4DR3 L;  2PMZ E;  4OX9 L;  5HY6 A;  3PV0 A;  3PCO B;  4B3T L;  1OXT A;  4DR6 Q;  3TRE A;  2AHO B;  1X6O A;  3KDF A;  4QGU A;  4MTN A;  4X62 Q;  1N33 L;  3S14 H;  3PO2 G;  3NEM A;  5C4J H;  1XTD A;  3U58 A;  2UXD L;  3PF4 A;  1SRU A;  4WJ3 M;  2IY5 B;  4LUZ A;  4DR7 L;  3T1H L;  3GO5 A;  2F52 A;  5FLM G;  5GAD C;  4B3M L;  1K8A C;  3PUZ A;  1NMF A;  3DLL A;  1VQ4 A;  2KHI A;  3J81 j;  3M85 A;  2CWA A;  3CCJ A;  1XNR Q;  1P8L A;  2KBN A;  1BKB A;  4LWC A;  1I5F A;  1WYD A;  5GAG C;  2UXC L;  1N36 Q;  2H5X A;  1SFO H;  1Y1W H;  4R4Q A;  3TRZ A;  2IX0 A;  1X54 A;  4APV A;  5IP9 G;  4A3C H;  3HKS A;  1D7Q A;  2JA8 H;  4A3F G;  4IPH A;  2KCM A;  3F2B A;  1VQ7 A;  2F4V L;  4GLA C;  2BA0 A;  4JI1 Q;  1UE1 A;  1PH3 A;  2IHE A;  1PH8 A;  3GTO H;  5JEA J;  1SMX A;  4DV3 L;  2UXB L;  1YVC A;  3ULL A;  1NBW A;  4X66 Q;  5M5Y H;  3GTJ H;  3KJO A;  2K52 A;  2MO0 A;  2K50 A;  3I7F A;  1E7Z A;  3J80 i;  4TQU S;  1E1T A;  2L15 A;  4UP9 A;  4DV6 L;  5GAE C;  4HJ7 A;  4NXM Q;  2AWN A;  1FL0 A;  4B3M Q;  1X65 A;  4IPG A;  1LTL A;  1W3S A;  2WB1 G;  3CCV A;  1CKN A;  3PUY A;  1YIT A;  3OW2 A;  1Q81 C;  4BBS H;  4MZ9 A;  1Q82 C;  1XNR L;  2E2H H;  1NE3 A;  4QY7 A;  1PHJ A;  5FLX c;  5GRO A;  2Y0S E;  2I5L X;  1VQP A;  4X6A H;  4JBK A;  1PYB A;  1YHQ A;  4L5S A;  4DR7 Q;  2UXD Q;  4LUO A;  4QL5 A;  2BH2 A;  2RCN A;  2D62 A;  3CD6 A;  4C3I H;  5M5W H;  1P16 A;  2OQ0 A;  1CSP A;  4NXN Q;  3PO3 G;  4IFD I;  1K0R A;  1VS0 A;  4EQ5 A;  1YIJ A;  1VQ8 A;  4DV2 Q;  4JI2 L;  3S1Q H;  3JAM c;  4DR3 Q;  4DV0 L;  4LF6 L;  1B7Y B;  1YJN A;  1FVI A;  4NB3 A;  3CMA A;  3GTL H;  5M3M H;  1NY4 A;  2NVQ H;  2N78 A;  2ZTD A;  5IYB H;  3ERS X;  3M4Q A;  4GS3 A;  4JI6 L;  4DR5 Q;  2PI2 E;  4HJ8 A;  5IYC H;  1A8V A;  2UUB Q;  4A3D H;  4JBW A;  2AWO A;  2R6G A;  1E22 A;  4GN5 A;  1KD1 C;  4JYA L;  3W1G A;  3ER0 A;  3KOJ A;  2A8V A;  3I4O A;  1L0W A;  2VUM G;  1OTC A;  3HOY H;  4A3D G;  2RHS B;  5JJL A;  4PG3 A;  1PH6 A;  1XMQ L;  4JI4 L;  4B3R L;  3UE0 A;  3I2Z A;  1EIF A;  4JBM A;  4A3I H;  3CP0 A;  3STB C;  3AFP A;  3I4M G;  4DV7 L;  4LFA Q;  1IYJ B;  2ZTC A;  4A3K G;  4LFC Q;  1S3O A;  3A74 A;  4A3L G;  3K80 C;  1QVF A;  4RMF A;  3ZJY C;  4AQY Q;  1RIP A;  4IFD J;  4OO1 I;  3S2D H;  2RF4 A;  3KDF B;  1QUQ B;  3F2D A;  5LMU Q;  2ZTE A;  3NBH B;  4A93 H;  3OTO Q;  3J7Z C;  3HOV G;  1LM0 A;  2XTI A;  1XMO Q;  4UY8 C;  5IE8 A;  2BA1 A;  3RR5 A;  1GVP A;  5LMN L;  4C3J H;  1UEB A;  4HIK A;  2JK8 A;  4YY3 Q;  3HKZ G;  1SRO A;  3KF6 A;  1E3P A;  1VQG A;  4DV2 L;  3UDF A;  3BJU A;  1YJW A;  2E2I H;  3PO3 H;  1Y1W G;  4A3I G;  2YTV A;  4NXM L;  4TVA B;  1FJG Q;  2DGY A;  3KYH C;  1KIX A;  1WCM H;  4UP7 A;  1N8R C;  3MEF A;  2JA9 A;  5JEA G;  3K7U C;  3GTP H;  1C0A A;  2MFI A;  1Z47 A;  1SE8 A;  2UUB L;  1G6P A;  1HNZ Q;  3J7A 5;  4HIM A;  3I55 A;  4Y7N H;  1CKM A;  1HNX L;  1BBW A;  5C4X G;  4X62 L;  1N34 Q;  1L1O A;  1XMQ Q;  4JI4 Q;  3SGI A;  4Y52 H;  1KXL A;  1UWV A;  3M9B A;  1J5E Q;  3GD7 A;  4LF7 Q;  2R92 G;  3HOU G;  2HIV A;  5IYB G;  1CUK A;  3BZC A;  3GTM H;  2R7Z H;  1L1O B;  2QEX A;  2UXC Q;  2JA6 G;  5M3F H;  5IT9 c;  1NTG A;  5DLQ E;  4BY1 G;  1V43 A;  1UE6 A;  2OCE A;  1KHI A;  3B6Y A;  2V1C C;  3W1B A;  1B70 B;  2YYZ A;  4OXP A;  5LMU L;  3HOX G;  2GN5 A;  3F1Z A;  4DV1 L;  4DKA C;  1X3G A;  3S15 H;  1S72 A;  2JEB I;  3T1H Q;  2D0O A;  4YY3 L;  4DV4 Q;  2JA5 H;  2UXB Q;  3IRB A;  4IO9 A;  4JBJ A;  4HID A;  1I94 Q;  4LNQ A;  3NEL A;  2JE6 I;  2GVB A;  3HOW G;  3TQY A;  4P71 A;  1FJG L;  5IWA L;  4OWT B;  1MKH A;  4LF8 Q;  2IX1 A;  1LYL A;  3RZO H;  4NPS A;  4JI0 Q;  1YNX A;  1TWC H;  2CFM A;  4QJF A;  4L5T A;  2K5N A;  1ASZ A;  2OTL A;  4KHZ A;  2F3I A;  4GLV B;  2F4V Q;  2WAQ G;  3PUX A;  2VQF Q;  4PZ8 A;  1PH9 A;  2CKZ B;  1VQB A;  4JG2 A;  1EFW A;  3M3Y H;  3H0G H;  1XPU A;  1OXU A;  1N34 L;  4A3C G;  4AH6 A;  4DUZ L;  1W2B A;  1N36 L;  4R1J A;  1EIY B;  5K36 G;  2NVY H;  2Z0S A;  2ZM6 Q;  4XIG S;  2NN6 I;  4O2D A;  1QVG A;  1QZH A;  4BY7 G;  3I56 A;  4UP8 A;  1JJ2 A;  2VQE Q;  1MIU A;  2E8G A;  3A5U A;  4YCV A;  2B3G A;  1X3F A;  4QIW E;  5GAH C;  2AMC B;  4JI6 Q;  3H3V I;  1IXR A;  4MNO A;  2N3S A;  2NZH A;  3MXN B;  1VQF A;  1I50 H;  2AKW B;  5C44 H;  2R7D A;  4DR2 L;  1PH5 A;  4LF9 Q;  4KI0 A;  3OYY A;  3WWV A;  2UUA L;  3UE1 A;  1SLJ A;  3PF5 A;  5H1S E;  3KF6 B;  1Q86 C;  1AE2 A;  1VQM A;  4WJ4 A;  3S16 H;  2B29 A;  2KHJ A;  1VQC A;  2MO1 A;  2PNH A;  2YTX A;  3FKI G;  3RLN A;  4X65 L;  1EYG A;  1VQD A;  4PZ6 A;  2E2J H;  3CAM A;  2I0Q A;  3K81 C;  4JI5 Q;  1NMG A;  2QGQ A;  1KL9 A;  2YTY A;  1RL2 A;  4LFC L;  1M90 C;  1PH1 A;  2UU9 Q;  4A3K H;  5IYD G;  1Z9F A;  1VQ9 A;  1U5K A;  4A3F H;  2OTJ A;  2R92 H;  3HOU H;  1IBK Q;  4YWL A;  4C2M H;  3HOY G;  4P73 A;  1I3Q H;  5C4X H;  3CC2 A;  1TWG H;  4JI0 L;  2HQL A;  2ZJP A;  3AFQ A;  4A4I A;  4DV7 Q;  2ALY B;  3TS2 A;  4DUY L;  4DR6 L;  3S1R H;  3AQQ A;  4DR2 Q;  4LF9 L;  4OWW B;  2VZA A;  1OXS C;  2Z6K C;  3EBE A;  4AQY L;  4BXX H;  1OXV A;  2PQA B;  3CQZ H;  3HOZ G;  4IFD G;  3STB D;  3UDX A;  4B3S Q;  5M3F G;  1YHA A;  2E5L Q;  4POF A;  1VQO A;  1GM5 A;  1Y14 B;  1HNZ L;  1XJV A;  4IJH A;  1KC8 C;  2NVX H;  2WB1 E;  3CCM A;  4LFA L;  1HH2 P;  2LXJ A;  1HJP A;  3G48 A;  3K8A A;  5M5X H;  1IBK L;  1SR3 A;  4P74 A;  1JJC B;  3JAM i;  3TS0 A;  2R93 G;  4HIO A;  4A3G G;  1EQR A;  3H15 A;  1EOV A;  1IBM Q;  3CCL A;  2GVA A;  1HR0 W;  4HJA A;  2I5M X;  1S40 A;  1A63 A;  3W5O A;  3UDG A;  4R4T A;  3CCU A;  2MNA A;  4JV5 Q;  5IP7 H;  1HNX Q;  1V1Q A;  2NZO A;  4LF5 Q;  1PFS A;  4DV1 Q;  1KQS A;  4BBR G;  4BA1 I;  1Q1B A;  3CF5 A;  3I4N G;  5C3E H;  4DR1 Q;  2E5L L;  3PUW A;  1V9P A;  4OON A;  4DV4 L;  2HHH L;  1LUZ A;  1VQI A;  1VQE A;  4X65 Q;  3U4Z A;  3E9H A;  2KEN A;  3G4S A;  4HJ9 A;  1XPO A;  5IWA Q;  1PYS B;  1ASY A;  2JEA I;  1JB7 A;  2Q2H A;  3DM3 A;  2B63 H;  2I5H A;  5ELN A;  3NEN A;  1KRS A;  4BY1 H;  4DV3 Q; 
#chains in the Genus database with same CATH topology
 3CW2 C;  2DN8 A;  1EQQ A;  5JPM C;  2EYM A;  3PIO A;  3H09 A;  1W6J A;  1Y1V H;  2F0P A;  3DWA A;  1EYC A;  3BYT B;  4YHH Q;  4AYB E;  1EWI A;  1TWH H;  1EEF D;  2BH8 A;  5I2Y A;  2VQF L;  4Q0F A;  2XSC A;  3I4L A;  1GUW A;  1KDB A;  1L1O C;  4DK3 C;  4JI3 Q;  2C35 B;  4DNT B;  5EPJ A;  1WTH A;  1QCB D;  2QEJ C;  4ZKC B;  4JC0 A;  1PV4 A;  4GNX C;  2JA8 G;  1JE5 A;  3CPF A;  1LV9 A;  4C3J G;  3ERQ A;  4FO2 A;  4QMG A;  1SFO B;  1IKM A;  4A3G B;  3EN2 A;  3RN2 A;  1O80 A;  3JC6 6;  1VDZ A;  4XDX A;  2JA7 G;  5IT9 L;  4IPD A;  2ICE C;  4BBS G;  1UE7 A;  1DXM A;  1WOC A;  2CVR A;  4DAY A;  5C0X J;  5CYU A;  3TP7 A;  2EDG A;  2Z6B A;  5EAY A;  4RHS A;  5FK9 C;  3RD4 A;  2IHF A;  5C4Z A;  4U68 A;  4JI3 L;  1SJE D;  2J7Z A;  2B63 B;  1WCM B;  5COR A;  4BBS B;  1WJJ A;  3CME A;  1Q7Y C;  2KCC A;  4DNI A;  4RGO S;  1SYD A;  4JI8 Q;  1VQ5 A;  2Q2U A;  1HFN A;  3BZK A;  1STE A;  4LF7 L;  4YWK A;  3MWY W;  5IP9 H;  5E4W C;  1Q8K A;  2OWO A;  1T9H A;  2MQH A;  4JW0 A;  4KHP Q;  1TS4 A;  3VYS A;  4Y7N B;  3QB3 A;  2K05 A;  3L7Z C;  3MTS A;  1F9R A;  2KOL A;  4BA2 I;  1CZW A;  1XPR A;  1AZQ A;  2F1M A;  1EWC A;  2A1A A;  1LTG D;  2V4D A;  3OIP A;  2N49 A;  2ID0 A;  2XNA C;  5BR8 L;  3Q24 A;  2JA5 B;  3IFD A;  1NSN S;  1TWG B;  2QDL A;  2K5H A;  4G7Z C;  1KNA A;  4GNX B;  3EA6 A;  2F0M A;  5FO8 B;  1PH7 A;  3S17 H;  3KLS A;  4IJL A;  4F8M A;  3A55 A;  1RJT A;  2Y0S B;  1EWH A;  4GOP C;  2A19 A;  1PH2 A;  5KND A;  5D3I B;  3R2I A;  2KCT A;  1V1P A;  4JI8 L;  1F2Z A;  2WAC A;  3S2H H;  1IBL L;  5M5X B;  1VF5 C;  3I4N H;  1JWU D;  1HZC A;  2K04 A;  2QA4 A;  1GUS A;  1VQA A;  3K0X A;  4IFD H;  4BXX G;  4K0K Q;  1PH4 A;  1TT2 A;  4ZQ3 A;  4DR4 Q;  5IGD A;  1EIH A;  3BZD B;  4RA8 A;  1GO3 E;  1R9T B;  5J3B A;  1S5B D;  2I07 B;  4AYB G;  1XMO L;  3P20 A;  3M4O B;  2E2I B;  5IGE A;  2M00 A;  5KYI A;  1Y1V G;  5JVG 3;  2YU9 H;  4RG1 A;  5C4H A;  3PGZ A;  2CCZ A;  3SK6 A;  2Z6K A;  1GKH A;  3VR4 A;  5I9P A;  3HKZ E;  4JYA Q;  4BBR B;  3OTO L;  4PMB A;  3G71 A;  1XNQ L;  3VR2 A;  5JJI A;  5FJ8 H;  3GTK H;  1AP0 A;  5LMN Q;  1AE3 A;  3FDT A;  4FP5 D;  4X3U A;  4O0A A;  4DPG A;  4DK1 A;  2VW9 A;  1WCM G;  5FLX L;  5E3F A;  3VA7 A;  4A3E H;  4RH6 A;  4DUY Q;  1PRT D;  4XQN A;  1QB5 D;  4R8I A;  1BCP F;  1BUV T;  4L63 B;  5CGK A;  2OQK A;  1N9W A;  5KNB A;  4UPA A;  3A56 A;  5D65 A;  4C2M B;  2IX3 A;  1HCZ A;  2ZXR A;  2ZJQ A;  4KKU A;  4A3L H;  3BU2 A;  5EKL A;  5T1I A;  3CC4 A;  4JI7 Q;  1YNN C;  2C9O A;  1OXT A;  4B3T L;  3TRE A;  4KHV A;  1TWC B;  5LL6 S;  2MUY A;  4QGU A;  1EQV A;  1EFI D;  4X62 Q;  1N33 L;  3S14 H;  3PO2 G;  4WJ3 M;  3U58 A;  1SRU A;  4DR7 L;  4CDE C;  4XXE A;  3H0G B;  3TSS A;  1NMF A;  1K8A C;  1W6K A;  2CWA A;  3CCJ A;  1P8L A;  4U67 3;  4G7H C;  2EOT A;  1AH9 A;  1WYD A;  5G3L D;  1Y1W H;  2I46 A;  4APV A;  3HOV B;  5IP9 G;  1U4L A;  1PXU A;  2PO4 A;  2WIN B;  3NTH A;  4A3F G;  2KCM A;  3F2B A;  2BA0 A;  4C3H B;  3H6M A;  2L9H A;  1A6X A;  1YVC A;  3A8J E;  4IUN A;  2RSN A;  3KBX A;  3I7F A;  2HDM A;  4TQU S;  3ITP A;  5GAE C;  2LKV A;  3HEJ A;  2A68 D;  3NUC A;  2CHB D;  3H94 A;  1J8I A;  3LWU A;  1QG7 A;  1X65 A;  1YIT A;  2KHS A;  2WB1 G;  5K5P A;  1I6H H;  2SDF A;  3GTK B;  2H1E A;  2F4I A;  1NE3 A;  2EYJ A;  2PQE A;  4QY7 A;  1B44 D;  1PHJ A;  2Y0S E;  2XWB B;  4JBK A;  3D4W A;  1YHQ A;  4LUO A;  1IW7 D;  2EY1 A;  1Y8P B;  1Y1V B;  1CSP A;  1S5C D;  1K0R A;  4EQ5 A;  3J80 E;  1M4V A;  1RD9 D;  1HXY D;  2A73 B;  3S16 B;  4DV0 L;  4XQQ A;  5IGG A;  1YJN A;  1FVI A;  3CMA A;  1X3P A;  2NVQ H;  2N78 A;  1K83 B;  3M4Q A;  2SNS A;  4DR5 Q;  3VYR A;  4HJ8 A;  4JBW A;  1PZJ D;  3ER0 A;  3W1G A;  3MAQ A;  1L0W A;  5IOD A;  3HOY H;  4LJZ C;  3CP0 A;  1VMC A;  4OL7 A;  1IYJ B;  4A3K G;  1SSO A;  2RQX A;  4LFC Q;  4A3L G;  3HRZ C;  4HSV A;  4IFD J;  2ZTE A;  3NBH B;  1LM0 A;  2XTI A;  4RWS C;  1XMO Q;  2ENB A;  5LMN L;  4HIK A;  4YY3 Q;  1WTX A;  4KD3 A;  3UDF A;  3BJU A;  1YNJ C;  2YTV A;  1FJG Q;  3KYH C;  1WCM H;  5DM7 3;  1SE2 A;  3K57 A;  3CRK C;  1C0A A;  2IL8 A;  5EKK A;  5D3D A;  3J7A 5;  3CHB D;  1HNX L;  5C4X G;  4FVM A;  1O7Z A;  3TZU A;  1TWH B;  2A74 C;  1L1O A;  4JI4 Q;  1LO5 D;  1UWV A;  2C5C A;  3GD7 A;  2R92 G;  2HIV A;  3GTM H;  3CQZ B;  4OO1 H;  4XYO A;  2MJ8 A;  5NUC A;  1NTG A;  5DLQ E;  4BY1 G;  1V43 A;  2OCE A;  3W1B A;  1KHI A;  3K5N A;  1IKL A;  4OXP A;  3HOX G;  3F1Z A;  3TN2 A;  1L0X B;  1X3G A;  2K1B A;  1BXT A;  2Z8L A;  2JA5 H;  1PFM A;  3J81 L;  4IO9 A;  4HID A;  1STY A;  3M7G A;  3NEL A;  1J9O A;  1BF4 A;  1QWY A;  3QOL A;  5FKA C;  3K5M A;  4LF8 Q;  4K8I A;  1II3 A;  2IX1 A;  4A3M B;  1EEI D;  2QW7 A;  4HCS A;  1UNS A;  2CFM A;  4KY5 A;  5J1Z A;  4L5T A;  1ASZ A;  2F3I A;  4O42 A;  4CDF C;  1IYV A;  3NBI A;  5C0X H;  4AH6 A;  1W2B A;  4R1J A;  5F2D A;  3I4N B;  2MGS A;  1BNZ A;  2Z0S A;  3J7A F;  4QUF A;  1QVG A;  4MN3 A;  1CA6 A;  4BY7 G;  4UP8 A;  1DOK A;  2VQE Q;  5M9O A;  1B1Z A;  1TKW B;  4QIW E;  1QOH A;  3OSO A;  3DWQ A;  4JI6 Q;  1YNJ D;  1IXR A;  1CI3 M;  2B8F A;  1ILQ A;  3HS0 C;  3GTO B;  3WWV A;  1S5D D;  4N9T A;  3PF5 A;  4K2K A;  1VQM A;  3BVM A;  5EBC A;  2XN9 C;  1VQD A;  2UU9 Q;  2B2Y C;  5IYD G;  1Z9F A;  1VQ9 A;  1U5K A;  3NQT A;  4DF7 A;  1IBK Q;  2CH4 W;  2J0T D;  2P5Z X;  3HOY G;  3MFY A;  1JOK A;  4P73 A;  5KNC A;  4Q5V A;  3NPP A;  2HQL A;  2ZJP A;  4JI0 L;  5EJW A;  3R8B A;  1A3T A;  2D9U A;  1C8C A;  1Q8I A;  3AQQ A;  4OWW B;  2B2T A;  2QDB A;  2D5D A;  4BXX H;  1OXV A;  3CQZ H;  4LMQ D;  4WJW A;  4B3S Q;  1QE6 A;  1YHA A;  4X3T A;  4POF A;  3H91 A;  1FGB D;  2NVX H;  3CCM A;  4LFA L;  2XWJ B;  1HJP A;  4UDU C;  3E0J A;  4B08 A;  2EYP A;  3KUP A;  1Y69 U;  3MZ5 A;  4A3G G;  3CCL A;  4QF4 A;  1PRT C;  1SNQ A;  2I5M X;  3J80 L;  1S40 A;  3W5O A;  1JWM D;  2MNA A;  4RCO A;  4JV5 Q;  2NZO A;  3A7L A;  3PUW A;  2IJ0 A;  4OON A;  4FXD A;  2KEN A;  5JAV A;  3G4S A;  2JEA I;  1JB7 A;  3DM3 A;  2I5H A;  2VNU D;  5C6A A;  4BY1 H;  3K7A B;  4DV3 Q;  3QIA A;  4FF3 A;  1TWF H;  3ICE A;  4FNF A;  1WD1 A;  2K5V A;  1U0L A;  1H9S A;  2K5D A;  3DEO A;  1VQH A;  3NE5 B;  3C46 A;  3VDY A;  4UAI A;  5I2X A;  1SBB B;  4A3J G;  1F9S A;  2K01 A;  2L5T A;  4BBR H;  1SMY D;  2OXP A;  1GXD C;  1RTN A;  3J81 c;  3GDE A;  2Q2I A;  3RZD H;  3HOW H;  2JQO A;  1D8L A;  1M8A A;  4F88 A;  2NVT H;  1E2W A;  5IYC G;  2KCN A;  3CCE A;  2E2D C;  2CQO A;  1YJ9 A;  5M3M G;  3IKJ A;  4KJN A;  1FGU A;  1PTO B;  2B2V A;  1VQN A;  1I3Q B;  4ULL A;  1ESF A;  5LMN W;  3T51 B;  2R3Z A;  2WFW A;  3MHB A;  1GD7 A;  2EPB A;  3Q8D A;  1AZP A;  2HCC A;  3A5Z B;  5HGT A;  2EIF A;  1G51 A;  4GKK L;  1GOZ A;  5E4X A;  4QQB X;  1HNW L;  1ZKO A;  4TRD A;  4YHH L;  5I4D A;  4F87 A;  4A93 B;  1VMP A;  1CHP D;  3LGJ A;  4KLK A;  2BE5 D;  5BR8 Q;  3CXC A;  2AUJ D;  2R93 B;  4ZKB B;  1EY5 A;  4A3K B;  1IZ6 A;  4B3S L;  1M1K C;  5KRU A;  1STN A;  3K7A H;  5I6W A;  3J80 c;  1VQL A;  2IWH A;  2E74 C;  2WP8 J;  1HA6 A;  3PO2 H;  3KJP A;  1KAW A;  1SNO A;  1EY0 A;  3A0J A;  1LT6 D;  3GTM B;  3S1M H;  2K75 A;  1HNW Q;  4X3K A;  4ZYS A;  3BS1 A;  4PNY A;  3KLW A;  3RZD B;  4ZLT F;  5C4J B;  1XYI A;  4GOP B;  5JEA H;  1YZ6 A;  4KV6 A;  4CKE A;  1VCI A;  2L11 A;  2PI2 A;  3NWT A;  5GQO A;  1CHQ D;  4ID6 A;  1CZG A;  3V96 A;  2L1B A;  4DUZ Q;  5C44 G;  1WTR A;  2G5D A;  3TEH B;  2B39 A;  1JMC A;  4YCW A;  3J81 i;  1D6E C;  1O7L A;  4JI7 L;  5FJ8 G;  4EQO A;  4B3T Q;  4IUU A;  2XRQ D;  4OEL B;  3GTQ H;  3D4R A;  3M4O H;  1OXX K;  4BWG B;  4X64 L;  1YHB A;  4IUR A;  2K14 A;  3NWS A;  1BR9 A;  1V8Q A;  2ZJR A;  1MSH A;  2F0D A;  3NK9 A;  2N55 A;  5IYD H;  2RHQ B;  1QNK A;  2K4K A;  3CU7 A;  4GN3 B;  4QUC A;  3PUV A;  1ZEQ X;  3I3C A;  3RUZ A;  3T1Y Q;  3VR6 A;  4BY1 B;  5CV7 A;  3TP8 A;  3ULP A;  1SYF A;  1C7Y A;  5C0X I;  2PMZ B;  5M3F B;  2M9V A;  1K9M C;  4OX9 Q;  5EKI A;  4A3E B;  1C4Q A;  1Z6H A;  3I73 A;  3T4A C;  2UUC Q;  4N8F A;  4GOP A;  2LSS A;  3M4P A;  1HQM C;  4O1N A;  4LF4 Q;  3F8T A;  1U4P A;  1WI5 A;  1UUP A;  4LUV A;  4A3M H;  4V19 0;  3S15 B;  1EL0 A;  2CW0 D;  3T13 A;  4TKO B;  4CKB A;  2ES2 A;  3X3M A;  5ELD A;  4WOR A;  4A3B G;  2XIW A;  2ATW A;  4DV5 L;  1CQF A;  2HUG A;  1B9N A;  1HTP A;  1EU4 A;  1YI2 A;  1WTW A;  3MEH A;  4A3D B;  1E2Z A;  5HY6 A;  1AN8 A;  3S1M B;  2B2V C;  5A35 A;  1HRJ A;  1SDF A;  2F0H A;  3NEM A;  3PF4 A;  3T1H L;  4PQX A;  5GAD C;  1Y1W B;  4E6I A;  2KHI A;  3J7Y W;  3M85 A;  4KY6 A;  1H9M A;  3L3O C;  4FF4 A;  4G4K A;  2UXC L;  5GAG C;  2PZT A;  1N36 Q;  1SFO H;  2A68 C;  1KLU D;  2IX0 A;  4R4Q A;  4A3C H;  3QOJ A;  1D7Q A;  2F4V L;  1VQ7 A;  4GLA C;  1PH8 A;  3A54 A;  1UE1 A;  1PH3 A;  2OEO A;  1GUT A;  3GTO H;  5JEA J;  4DV3 L;  2UXB L;  1EY8 A;  5M5Y H;  3KJO A;  3N52 A;  1FNV A;  2Q8T A;  3J80 i;  1PMR A;  2L15 A;  4UP9 A;  4OEM B;  1R4Q B;  1D5M C;  3W2D A;  2E2H B;  3OHX C;  3PUY A;  1CKN A;  1MGS A;  1SXT A;  5T1G A;  4MZ9 A;  1Q82 C;  4KMU C;  4L5S A;  4QB4 A;  4DR7 Q;  5CBE E;  2K5W A;  1RTO A;  4J1M A;  4CKC A;  2BH2 A;  2RCN A;  3NHH A;  5CV5 A;  5M5W H;  2IW3 A;  1KTK A;  3PO3 G;  4HED A;  4I65 A;  4JI2 L;  5A2Q E;  5BN4 A;  2H4O A;  1NCV A;  4NB3 A;  1IHZ A;  5M3M H;  2NZ1 D;  2ZTD A;  3ERS X;  4GS3 A;  5KGU A;  4PMC A;  2PI2 E;  1I6V C;  1SYE A;  3K0Y A;  1KD1 C;  4JYA L;  1H9R A;  2RHS B;  1WTO A;  3HOZ B;  4PG3 A;  1PH6 A;  1XMQ L;  4JBM A;  1EIF A;  3MFG A;  3STB C;  3VYT A;  3I4M G;  1EY7 A;  3NSW A;  4LFA Q;  3NTI A;  1S3O A;  3K80 C;  2FMM A;  3DEP A;  3IAY A;  1D1I A;  1SYC A;  4OO1 I;  4NDX A;  2RF4 A;  3PMF A;  4L8J A;  3OTO Q;  2RDF A;  1I4R A;  3FVQ A;  3K59 A;  1VF7 A;  3O13 A;  2BA1 A;  5EGT A;  1BCP C;  3KF6 A;  2JXM B;  1VQG A;  4DV2 L;  2A6E C;  3W3A A;  3TP6 A;  4ABN A;  3ND8 A;  4UP7 A;  1KNE A;  1N8R C;  2JA9 A;  1R4P B;  4H44 C;  2MFI A;  2TSS A;  3C1E A;  1Z47 A;  2Z1C A;  1AEX A;  3ND9 A;  4HIM A;  5KEE A;  2JP1 A;  2VB3 X;  4NMZ A;  1Z7T A;  4X62 L;  4RFB A;  1N34 Q;  1XMQ Q;  4Y52 H;  2KEE A;  2F03 A;  5E1F A;  2SEB D;  1CUK A;  2F0N A;  1U9R A;  1MHW C;  2QKI C;  1DOM A;  5EPK A;  2J4X A;  3R93 A;  2E2J B;  1UE6 A;  3B6Y A;  2V1C C;  1B70 B;  2YYZ A;  2AQ2 B;  1SNM A;  2GN5 A;  4DV1 L;  3S15 H;  1S72 A;  2JEB I;  4LNQ A;  1I94 Q;  2JE6 I;  4OWT B;  2JA7 B;  4UHV A;  1D1K A;  1LYL A;  1H9J A;  4HAE A;  4JI0 Q;  3WOF A;  4RGT A;  1Q3L A;  1YNX A;  3C3L A;  1AFP A;  2EY2 A;  2EJG C;  2K5N A;  2F4V Q;  2OTL A;  4KHZ A;  3HOW B;  2WAQ G;  5ELB A;  5ELC A;  2NVT B;  1EFW A;  1VQB A;  1OXU A;  1N34 L;  3GTJ B;  1N36 L;  1GHJ A;  3KBG A;  3BG3 A;  4O2D A;  1JOO A;  1QZH A;  3I4M B;  1ET9 A;  3I56 A;  1JJ2 A;  1JCK B;  1MIU A;  4A3I B;  1CTM A;  4YCV A;  1S5F D;  2B3G A;  3GP7 A;  1V1O A;  3G6J B;  1LLR D;  3CKI B;  3D3R A;  4KN7 C;  2NZH A;  2A6H C;  2AKW B;  3VA5 A;  2EXZ A;  4KI0 A;  2UUA L;  1TII D;  1SEB D;  4XT3 B;  2F0G A;  3S16 H;  2CQA A;  1VQC A;  4K6D A;  4X65 L;  1EYG A;  5K36 H;  1UEA B;  4PZ6 A;  3CAM A;  4JI5 Q;  2R92 B;  4YIJ A;  1KL9 A;  1RL2 A;  1LTT D;  3GTP B;  3HOU H;  2NUC A;  2F0E A;  3HOX B;  2EVB A;  4C2M H;  3HOY B;  5C4X H;  4R9W A;  1TWG H;  4IUP A;  3MA2 B;  1SE4 A;  4A4I A;  2LFN A;  3TS2 A;  4DUY L;  2NTT A;  3SK8 A;  4DR6 L;  3S1R H;  4DR2 Q;  4KKS A;  3G7L A;  4AQY L;  3HOZ G;  3STB D;  2HD3 A;  4HN7 A;  1B53 A;  2E5L Q;  2VXW A;  1VQO A;  1Y14 B;  1XWE A;  5CV4 A;  3TBI B;  4DNR B;  1HNZ L;  5EPL A;  3D8G A;  4IJH A;  1KC8 C;  1DJR D;  3T53 B;  2F0V A;  5M5X H;  2KVM A;  1SND A;  1EOV A;  1IBM Q;  2GVA A;  3GQB A;  4HJA A;  1PTO C;  3U9S A;  1CK1 A;  3NXW A;  3CCU A;  4RGN A;  1HNX Q;  1V1Q A;  1KQS A;  1SMY C;  4BA1 I;  1I4H A;  3I4N G;  4XYQ A;  5A2Q L;  1LUZ A;  1VQE A;  5JJZ A;  3E9H A;  4CJ1 B;  4HJ9 A;  4FF2 A;  5IWA Q;  1PYS B;  2Z9H A;  2PZU A;  2B63 H;  5ELN A;  3SK5 A;  4WFN 3;  4A3B B;  4C56 C;  4KJO A;  1JR0 D;  4HCE A;  1SYG A;  3OWF A;  5IGB A;  3I8Z A;  3K5L A;  3I90 A;  3LWE A;  4CHT B;  2JA6 H;  2F0K A;  1CKN B;  1ZYR C;  4EVO A;  1JT8 A;  1CSQ A;  1TWA H;  4KD4 A;  5C3E G;  2B8G A;  5ELF A;  3SE0 A;  2R7F A;  2FJ2 A;  2MPM A;  1F2L A;  1DM0 B;  3UI2 A;  4C3I B;  4JV5 L;  1NUC A;  2LXK A;  5CC4 A;  2VQE L;  5BN3 A;  1X56 A;  4S3S A;  3CPW A;  1EIG A;  2RA4 A;  1HQR D;  1TR5 A;  2N8N A;  4OGQ C;  2B2U C;  3F2C A;  4YWM A;  4P75 A;  1VQK A;  2R7Z G;  1NJI C;  3UDI A;  1ROD A;  3KF8 A;  2RDH A;  3Q6S A;  1EUJ A;  3ERO A;  2Q2T A;  2L55 A;  1MD2 D;  2VY3 A;  2YU9 B;  3ULJ A;  1EZ6 A;  1HUM A;  3HGB A;  4LFB Q;  1SN8 A;  3FPP A;  3GTG H;  2ASB A;  4R4O A;  2VUM H;  3MVV A;  1HFG A;  1G8Z D;  2FFK B;  1QZG A;  4HJ5 A;  3WDN A;  3T16 A;  4YCU A;  2PQA A;  3CC7 A;  4DR4 L;  1WFQ A;  5AJ3 L;  3HP3 A;  2EYF A;  4A93 G;  1G2T A;  3M4Y A;  1BVS A;  2ZXO A;  5IOC A;  2EXD A;  3JAM L;  3P1H A;  2BCO A;  2SNM A;  1YEZ A;  2EJF C;  5IGC A;  2JSO A;  4A3E G;  4JOI C;  3VR5 A;  4FF1 A;  3RNU A;  5IP7 G;  2NN6 G;  1RDP D;  2WAQ E;  1S5E D;  1XXG A;  1TQO A;  5I9O A;  2RBM A;  3HG9 A;  5HUR A;  1A62 A;  1QUQ A;  3R3O A;  3U9O A;  3OPO A;  4B9W A;  1Q46 A;  1HA5 A;  3U50 C;  3FEW X;  1JJG A;  3S24 A;  2A6E D;  1EYD A;  1FNU A;  4AYB B;  3FKI H;  2HIX A;  3TZD A;  4DV6 Q;  3EQL C;  5C5M A;  2FXQ A;  1J6Q A;  4NXN L;  3QR8 A;  3HOV H;  2HQE A;  1I94 L;  3GTG B;  3S2D B;  4JOI A;  2B63 G;  2B2W C;  4FDB A;  4DV5 Q;  5C3E B;  4G57 A;  3MXP A;  3L2P A;  3K5O A;  2F0O A;  4GN4 B;  4LF4 L;  2L0C A;  1A0I A;  3S14 B;  5FLM H;  4L5Q A;  1X9N A;  1YBY A;  3Q23 A;  3D6C A;  1KDA A;  4DV0 Q;  3X3N A;  4GLX A;  1EYA A;  3G6E A;  1K28 A;  1C9O A;  3H0G G;  4J15 A;  3U4V A;  1IL2 A;  4R4C A;  3EVQ A;  5C0X G;  3K58 A;  2VS1 A;  4JI5 L;  3NQI A;  3SEB A;  4A3B H;  4C1N K;  2DY7 A;  4EQP A;  4C3H H;  3RLF A;  1VQJ A;  2XVS A;  4DAP A;  1A2U A;  4I7Z C;  3KF8 B;  5LHY 1;  5JPN C;  1Q1E A;  3M7N A;  1T5E A;  4IOA A;  2SOB A;  1K83 H;  1SNP A;  2UUA Q;  4RCN A;  1NR4 A;  4X64 Q;  4IOC A;  4JCV E;  4R4I A;  1CKO A;  1O7I A;  1E1O A;  4DA2 A;  4GZY C;  4LW1 A;  1K8G A;  1E0B A;  1G6Z A;  1STB A;  2O4X A;  4RHR A;  4GKJ Q;  2IPK D;  2EQS A;  4CJ2 C;  3AEV A;  3S17 B;  3D31 A;  1LT5 D;  3LX0 A;  2FHT A;  3S1R B;  3FKI B;  5AJ3 Q;  1N32 L;  4K6L A;  4OX9 L;  4DXF A;  1EU3 A;  2AHO B;  3KDF A;  3QJY A;  4MTN A;  3S9W A;  2WII B;  4MHE A;  2UXD L;  2IY5 B;  2F52 A;  5FLM G;  4B3M L;  3DLL A;  3J81 j;  1XNR Q;  3K6O A;  2ZXP A;  2KBN A;  3RZO B;  2JA8 B;  5J39 A;  4LWC A;  2H5X A;  2VUM B;  1X54 A;  3BDL A;  1F77 A;  1JB3 A;  2E76 C;  4ZK9 B;  2IHE A;  1TVX A;  1I4X A;  5CV6 A;  1NBW A;  4BS9 A;  3GTJ H;  2K52 A;  2CW0 C;  1E1T A;  1JQY D;  2CH4 A;  2AWN A;  4B3M Q;  1FD7 D;  4IPG A;  3PQI A;  1LTL A;  1W3S A;  2G9D A;  2EE1 A;  3KLR A;  3CCV A;  3BVZ A;  1LAB A;  1L0Y B;  2E2H H;  2ICI A;  4X6A H;  2I5L X;  1VQP A;  4KKT A;  2NN6 H;  2NWG A;  3QWN A;  2EZV A;  3S1Q B;  3T56 B;  2EYO A;  2D62 A;  4DXG A;  1DZ1 A;  2OQ0 A;  4NXN Q;  1Y8N B;  1VS0 A;  2DJF C;  5C3X A;  4DV2 Q;  1VQ8 A;  3JAM c;  4DR3 Q;  1TWA B;  1F2M A;  3D6W A;  1B7Y B;  2PNR C;  2EJM A;  4K8J A;  3GTL H;  1NY4 A;  5FLX E;  4JI6 L;  2LMC B;  1A8V A;  1KAB A;  1E22 A;  2A8V A;  2VUM G;  1OTC A;  4JI4 L;  3UE0 A;  4BY7 B;  3AFP A;  4JPB W;  3A74 A;  1LAC A;  4RMF A;  4AQY Q;  1RIP A;  1I4G A;  1TY0 A;  4DFA A;  4KK7 A;  3KDF B;  3F2D A;  2NBF A;  5LMU Q;  4A93 H;  3J7Z C;  1DCZ A;  4UY8 C;  1TS2 A;  5IE8 A;  3RR5 A;  3QG1 A;  4QCL A;  1UEB A;  4N9P A;  1E3P A;  1TY2 A;  2E2I H;  1SJH D;  1YJW A;  1I6H B;  3ZYY X;  4A3I G;  4NXM L;  1WTQ A;  4IUT A;  5JEA G;  2MP1 A;  3AB9 A;  2EYL A;  1SE8 A;  1G6P A;  1JC7 A;  3I55 A;  2KQ3 A;  4K5W A;  1CKM A;  1BBW A;  3MXG A;  1EZ8 A;  4FXK C;  5G3L F;  3M9B A;  2KEC A;  1I50 B;  1WD0 A;  4LF7 Q;  4DGZ A;  4CGY B;  2R7Z H;  1B4O A;  1L1O B;  2QEX A;  5M3F H;  5IT9 c;  4NXM Q;  5AFW A;  1Q81 C;  4DU9 A;  5EQ0 A;  2MHV A;  3I70 A;  5IGF A;  3IRB A;  3FMC A;  2PW5 A;  3HOW G;  2GVB A;  2EY5 A;  1FJG L;  5ELE A;  4JK1 C;  1JWS D;  4NPS A;  1TWC H;  2A69 C;  4QJF A;  1K8M A;  2RCF A;  2B2U A;  3ONA B;  3TP5 A;  3PUX A;  5COY A;  2VQF Q;  4PZ8 A;  1PH9 A;  2CKZ B;  2NVQ B;  3H0G H;  3EJI A;  1ONL A;  1XPU A;  3S2H B;  4DUZ L;  1EIY B;  5K36 G;  1SYB A;  2AUK A;  2Q8I B;  2NVY H;  4XIG S;  4IN3 A;  1I4P A;  2KJX A;  2K5Q A;  3A7A B;  3MC0 B;  2E8G A;  3DM1 A;  4ZUI A;  2WV6 D;  1RKN A;  5GAH C;  2AMC B;  4ZRZ A;  1HUN A;  3H3V I;  2KED A;  1S4Z A;  4MNO A;  3MXN B;  1I50 H;  3I91 A;  4B9X A;  4LF9 Q;  1PH5 A;  4ZCK A;  3OYY A;  1DON A;  1G91 A;  4IUQ A;  3Q0A A;  5H1S E;  3KF6 B;  1Q86 C;  1DOL A;  1NAP A;  4RKL A;  2KHJ A;  3FKI G;  5M5Y B;  1ICF B;  3GV6 A;  5D14 A;  3VR3 A;  2I0Q A;  3K81 C;  3HOU B;  1NMG A;  4LFC L;  3SDZ A;  1PH1 A;  1LTB D;  2F0I A;  1GUG A;  2R92 H;  1GUO A;  1RCV D;  4FXG C;  4RGM A;  4A3F B;  2BE5 C;  1I3Q H;  3CC2 A;  1EY6 A;  1F9Q A;  2B2Y A;  5ISR A;  4XT1 B;  3AFQ A;  1TS3 A;  4DV7 Q;  2ALY B;  2WB1 B;  2BDN A;  4LF9 L;  1OXS C;  1SE3 A;  3EBE A;  2PQA B;  3E5S A;  1G2S A;  4IFD G;  2R7Z B;  5M3F G;  4OHJ A;  1XJV A;  2WB1 E;  1HH2 P;  2LXJ A;  2TMP A;  4DAV A;  3G48 A;  3K8A A;  2O2L D;  1IBK L;  2RKS A;  1SR3 A;  4KTA A;  1BO0 A;  1XTC D;  3TS0 A;  2R61 A;  1EQR A;  4R8N A;  3H15 A;  2ZT9 C;  3SR1 A;  1A63 A;  3UDG A;  2GA4 B;  4R4T A;  1V1P B;  5IP7 H;  3H3V C;  4NW2 A;  1BDO A;  4LF5 Q;  4XQJ A;  4CBV A;  5C3E H;  1IW7 C;  1V9P A;  4DV4 L;  4Z9C B;  2HHH L;  4X65 Q;  1H9S B;  1XPO A;  1ASY A;  5CR3 A;  1KRS A;  1JE4 A;  4K5X A;  3RN5 A;  1R9T H;  4X66 L;  3TDQ A;  3WOE A;  2DNE A;  4OO1 G;  3A8K E;  3Q22 A;  4GKK Q;  3KLS X;  1PFN A;  5M5W B;  5FO9 B;  3CRL C;  1JOR A;  4QIW B;  1AW7 A;  1IYU A;  4CJ0 B;  1IBM L;  1U4R A;  4ME3 A;  3PSI A;  2UUC L;  4KHP L;  1VQ6 A;  1XNQ Q;  1A3V A;  2O5J C;  4IPC A;  2F0S A;  1DD2 A;  5E7N A;  1ENF A;  3SVM A;  1B2T A;  4LF8 L;  4HR7 B;  3RMH A;  3BDO A;  4M1U B;  3L9A X;  2HHH Q;  2BDO A;  1K73 C;  2NTS A;  3T1Y L;  4PMW A;  2A69 D;  2NVX B;  3CCS A;  1H95 A;  4DR5 L;  1O7Y A;  3QO2 A;  1LTI D;  3NTK A;  1BBX C;  1L2F A;  4LF5 L;  1B3Q A;  2CWP A;  1K8O A;  5DM6 3;  4DR1 L;  4EX5 A;  2PYK A;  2ZM6 L;  3OMG A;  4B3R Q;  2K03 A;  4G7O C;  4XTC S;  2EYH A;  2WKC A;  5CV9 A;  1TU2 B;  2F0L A;  3FHW A;  2PZW A;  4I7A A;  4P2C B;  4GNX A;  1MJE A;  3BDC A;  4H02 A;  1EY9 A;  4K2L A;  4A3J H;  4L5R C;  4KN4 C;  3OIQ A;  1PLF A;  1TWF B;  3F2U A;  4NKL A;  4A75 A;  1HZ9 A;  3BYY B;  1HR0 Q;  5JJK A;  1MJC A;  3J7A V;  3CCQ A;  2O5I C;  1QJO A;  1E24 A;  3HOX H;  3J81 E;  5ELO A;  3NP8 A;  5DAU A;  3N6R A;  1QVC A;  1N33 Q;  1H9K A;  3TME A;  5DEH A;  2DNC A;  2OF1 A;  2UU9 L;  1STH A;  2YV5 A;  4JVZ A;  1F2Y A;  2HT1 A;  1X32 A;  4DAM A;  2JJQ A;  1ZXT A;  4TSS A;  3L0O A;  4LFB L;  2XGT A;  3VYU A;  2QCP X;  2Y0S G;  1BBU A;  1BOS A;  2K28 A;  3E0E A;  1PZI D;  1KLG D;  5C3W A;  3P75 A;  1EOT A;  4K14 A;  4EGV A;  4FYD A;  3KFU A;  5M3M B;  2JA7 H;  4AIM A;  4MIU A;  2F3W A;  2G9H D;  1TXY A;  3PIP 3;  2KA7 A;  3C1F A;  2BOS A;  3IFT A;  4ILW A;  5HGQ A;  3DXJ C;  5L37 A;  4PZ7 A;  1HZA A;  1X3Q A;  3HZX A;  3HOZ H;  1DGS A;  2L4N A;  3D0F A;  3HFZ B;  2IT1 A;  1N32 Q;  3LNN A;  1HPC A;  1CQV A;  4POG A;  3I4M H;  2K6A A;  1LT4 D;  4H13 C;  1I4Q A;  4DAY B;  3C2P A;  1T5X D;  3RLO A;  1HR0 L;  3URY A;  1PTO H;  4JI2 Q;  1MBY A;  4GKJ L;  4ME5 A;  4K5V A;  5JOB A;  1HZB A;  3E9I A;  3S1N H;  4LF6 Q;  3H3V H;  1A3U A;  4X3S A;  4BY7 H;  1B3A A;  2OT2 A;  4LK1 C;  2Z4I A;  3PIO 3;  2R93 H;  4H7B A;  4N8X 1;  2D0P A;  2DUD A;  3NBH A;  1C48 A;  2WAQ B;  3EIV A;  4V0B A;  2B2T C;  1UE5 A;  2F0J A;  2K7V A;  1B8A A;  4A76 A;  3AYH B;  3R2T A;  4A3M G;  1PVO A;  4ALP A;  2F0Q A;  4J6H A;  4OWX B;  1YNN D;  3FP9 A;  1K3R A;  1KRT A;  4DK6 C;  1SNC A;  1X55 A;  1PA6 A;  1IL8 A;  1WVL A;  2JA5 G;  4P72 A;  1B9M A;  2PCF B;  1PFB A;  4K0K L;  1Q12 A;  3AU7 A;  4JI1 L;  3PIP A;  1RHP A;  3SK4 A;  1KDC A;  3CCR A;  1G29 1;  3IL8 A;  2K33 A;  1X3E A;  4A3G H;  1J5E L;  2VL6 A;  1IBL Q;  1XX8 A;  1LTA D;  5IY0 A;  2XRS D;  4DR3 L;  2PMZ E;  3PV0 A;  3PCO B;  4DR6 Q;  1X6O A;  3KK7 A;  4NP5 A;  1LTR D;  2HDL A;  2NVY B;  3E6Z X;  5C4J H;  1XTD A;  1ZYR D;  4LUZ A;  3GO5 A;  4OIK A;  3PUZ A;  1VQ4 A;  2HCI A;  3OOC A;  1BKB A;  3OMC A;  1I5F A;  1PYW D;  3TRZ A;  4IZ8 A;  3HKS A;  4A3J B;  2JA8 H;  1O78 A;  5LL6 X;  4IPH A;  4JI1 Q;  1SMX A;  2F0W A;  3ULL A;  2B2W A;  4X66 Q;  2MO0 A;  5TSS A;  2K50 A;  1E7Z A;  1PDQ A;  4DV6 L;  4PV1 C;  4C3J B;  5J22 A;  4HJ7 A;  3GTQ B;  1FL0 A;  4H0L C;  4HMI A;  3PO3 B;  4BBS H;  1FR3 A;  3OW2 A;  5IT9 E;  1XNR L;  1PTO F;  5FLX c;  5GRO A;  1ICW A;  1PYB A;  2UXD Q;  4QL5 A;  4ZAI A;  3CD6 A;  4C3I H;  1F9P A;  1P16 A;  2JN4 A;  1BQQ T;  4IFD I;  1YIJ A;  1CM9 A;  3S1Q H;  4RAU C;  1CT1 D;  1D5X C;  1D2B A;  4LF6 L;  4RKB A;  3M3Y B;  4HSP A;  5IYB H;  4C1N I;  1RF2 D;  2RVL A;  5KIX A;  5IYC H;  3GTL B;  2Z4H A;  2UUB Q;  4KY7 A;  3DHQ A;  4A3D H;  2AWO A;  2R6G A;  4GN5 A;  1MI2 A;  3OW7 A;  5BN5 A;  3KOJ A;  1BCP B;  4WRD A;  3I4O A;  2X6L A;  2RSO A;  1PRT B;  4HTH A;  5JVH 3;  4A3D G;  5JJL A;  3P7J A;  3FPU B;  1DYQ A;  4B3R L;  3I2Z A;  4A3I H;  4DV7 L;  2ZTC A;  1QVF A;  3ZJY C;  2WKD A;  2Q8R E;  1A15 A;  2X6G A;  3S2D H;  1CA5 A;  1QUQ B;  2F0T A;  1PTO D;  4OIJ A;  3HOV G;  4LAA A;  2NYZ D;  1QIL A;  1GVP A;  4C3J H;  2A6H D;  2F0U A;  2JK8 A;  3HKZ G;  3D4D A;  1LTS D;  1SRO A;  1ENC A;  3PO3 H;  1Y1W G;  1ENA A;  4TVA B;  3SXH A;  2DGY A;  1KIX A;  3MXN A;  3MEF A;  3GTP H;  3K7U C;  5EBD A;  2E75 C;  2UUB L;  2PPB C;  3A8I E;  4ODG A;  1HNZ Q;  4Y7N H;  5C4X B;  1LT3 D;  4HMJ A;  2LS0 1;  3SGI A;  1KXL A;  1CFM A;  4F7X A;  1J5E Q;  2QF7 A;  3HOU G;  3MXU A;  5IYB G;  1ESR A;  3DUZ A;  4EQN A;  3BZC A;  2D2C C;  4IUV A;  2FIN B;  5CV8 A;  1WTV A;  2PW7 A;  2UXC Q;  2JA6 G;  2JYO A;  5LMU L;  2N88 A;  4DKA C;  1Q90 A;  4L6T B;  4DN4 M;  3T1H Q;  2D0O A;  4YY3 L;  5CMD A;  4DV4 Q;  2UXB Q;  4JBJ A;  3BVG A;  1A2T A;  1GJX A;  4CDC C;  3TQY A;  4P71 A;  5IWA L;  3DMU A;  1MKH A;  3RZO H;  1U4M A;  1UAP A;  1OO9 B;  4GLV B;  3M3Y H;  5KYL A;  4JG2 A;  3V2T A;  4A3C G;  1HHV A;  1ML0 D;  1EY4 A;  3DWP A;  3OWE B;  2ZM6 Q;  2LY7 A;  2K32 A;  2NN6 I;  2RDG A;  5C5L A;  4C3I G;  2M2L A;  3GV3 A;  3A5U A;  1ILP A;  1X3F A;  1EQT A;  1Y8O B;  2AQ1 B;  3V05 A;  1ET6 A;  4CDD C;  1JOQ A;  2N3S A;  2NB0 A;  4ZUJ A;  3PO2 B;  4C3H G;  1VQF A;  1BCP D;  2DY8 A;  5C44 H;  1QNU A;  2R7D A;  1GHK A;  1FNW A;  1PRT F;  4DR2 L;  3UE1 A;  1SLJ A;  4MTK A;  4WJ4 A;  1K0S A;  1E2V A;  1AE2 A;  1MSG A;  1D5Z C;  2B29 A;  2MO1 A;  2PNH A;  2YTX A;  5CBA E;  1WTP A;  3RLN A;  2E2J H;  2QGQ A;  2YTY A;  1M90 C;  4A3K H;  2DJG C;  3E3X A;  4A3F H;  2OTJ A;  3EFX D;  4YWL A;  2QIL A;  2VB2 X;  1FYC A;  5I6Y A;  3SHL A;  1NNX A;  1PZK D;  2JA6 B;  1SAP A;  3I72 A;  2AQ3 B;  2A5H A;  2VZA A;  1STA A;  2Z6K C;  1JIC A;  4IAL A;  1B50 A;  5DNF A;  3UDX A;  2KUM A;  1GM5 A;  5FO7 B;  1KAA A;  4J8Q A;  3FRP B;  1HTL D;  1K3B C;  4P74 A;  1JJC B;  3JAM i;  2R93 G;  3S1N B;  4HIO A;  2F3V A;  2EY6 A;  1HR0 W;  3HKZ B;  3AMU A;  1STG A;  1NR2 A;  1PFS A;  2FMC A;  5FOB B;  3JAM E;  4DV1 Q;  4BBR G;  4M8A A;  3CF5 A;  1Q1B A;  4DR1 Q;  2E5L L;  4IQZ A;  1GUN A;  2L12 A;  2X69 A;  1VQI A;  1TS5 A;  4DK0 A;  5IIF A;  3U4Z A;  2F0F A;  2Q2H A;  5C44 B;  3NEN A; 
#chains in the Genus database with same CATH homology
 3RN5 A;  3ICE A;  1TWF H;  3CW2 C;  1R9T H;  4X66 L;  2K5V A;  1U0L A;  1EQQ A;  4OO1 G;  1VQH A;  4GKK Q;  3PIO A;  1Y1V H;  2JA6 H;  3VDY A;  1CKN B;  4A3J G;  1JT8 A;  1CSQ A;  1TWA H;  4YHH Q;  4ME3 A;  1IBM L;  5C3E G;  3PSI A;  4AYB E;  1EWI A;  1TWH H;  4BBR H;  2UUC L;  2R7F A;  4KHP L;  1VQ6 A;  2BH8 A;  1XNQ Q;  3J81 c;  3GDE A;  2Q2I A;  3RZD H;  3HOW H;  4JV5 L;  2JQO A;  2LXK A;  2VQE L;  2VQF L;  4IPC A;  1D8L A;  2NVT H;  1X56 A;  5E7N A;  3CPW A;  1L1O C;  5IYC G;  4DK3 C;  4JI3 Q;  4LF8 L;  2C35 B;  3CCE A;  2CQO A;  1YJ9 A;  2N8N A;  5M3M G;  2HHH Q;  1K73 C;  3F2C A;  3T1Y L;  4YWM A;  1FGU A;  4P75 A;  4PMW A;  4JC0 A;  1VQN A;  1VQK A;  1PV4 A;  4GNX C;  2JA8 G;  3CCS A;  1H95 A;  1JE5 A;  2R7Z G;  3CPF A;  4DR5 L;  3UDI A;  1NJI C;  5LMN W;  3S1N H;  1EUJ A;  1L2F A;  2WFW A;  3EN2 A;  1GD7 A;  3JC6 6;  3RN2 A;  3Q8D A;  2Q2T A;  4LF5 L;  2JA7 G;  2CWP A;  2VY3 A;  3ULJ A;  4IPD A;  4EX5 A;  4DR1 L;  1UE7 A;  1WOC A;  2ZM6 L;  5C0X J;  4BBS G;  3A5Z B;  4LFB Q;  1SN8 A;  4B3R Q;  2EIF A;  1G51 A;  3GTG H;  4GKK L;  2ASB A;  4XTC S;  5EAY A;  4QQB X;  1HNW L;  4R4O A;  2IHF A;  3FHW A;  4GNX A;  1MJE A;  4YHH L;  2VUM H;  4JI3 L;  4H02 A;  4A3J H;  4L5R C;  1QZG A;  4HJ5 A;  4YCU A;  3LGJ A;  1WJJ A;  4KLK A;  5BR8 Q;  3CXC A;  3CME A;  4A75 A;  1Q7Y C;  1HZ9 A;  2PQA A;  3CC7 A;  4DNI A;  1HR0 Q;  4DR4 L;  5JJK A;  1IZ6 A;  1MJC A;  1WFQ A;  4JI8 Q;  1VQ5 A;  2Q2U A;  5AJ3 L;  4B3S L;  3BZK A;  3CCQ A;  1M1K C;  4A93 G;  4LF7 L;  1E24 A;  3HOX H;  1BVS A;  5ELO A;  3K7A H;  2EXD A;  4YWK A;  5IP9 H;  1Q8K A;  1QVC A;  3J80 c;  1VQL A;  1T9H A;  2OWO A;  1N33 Q;  1YEZ A;  2MQH A;  2UU9 L;  2WP8 J;  4KHP Q;  3L7Z C;  3PO2 H;  4A3E G;  2YV5 A;  3KJP A;  1KAW A;  4JOI C;  2HT1 A;  1XPR A;  4BA2 I;  2A1A A;  3A0J A;  4DAM A;  3RNU A;  2JJQ A;  2N49 A;  5IP7 G;  2NN6 G;  3L0O A;  2ID0 A;  2WAQ E;  4LFB L;  2XGT A;  5BR8 L;  3S1M H;  2Y0S G;  1BBU A;  2K75 A;  1HNW Q;  3E0E A;  3KLW A;  1A62 A;  1QUQ A;  2K5H A;  4GNX B;  4GOP B;  3KFU A;  1PH7 A;  1YZ6 A;  2JA7 H;  4AIM A;  3S17 H;  4IJL A;  1Q46 A;  3U50 C;  1VCI A;  1JJG A;  2PI2 A;  5GQO A;  3S24 A;  1TXY A;  4GOP C;  2A19 A;  3FKI H;  2HIX A;  4DV6 Q;  2FXQ A;  1J6Q A;  4NXN L;  5HGQ A;  1PH2 A;  4PZ7 A;  1HZA A;  2KCT A;  4JI8 L;  3HOV H;  1I94 L;  4DUZ Q;  5C44 G;  3HOZ H;  1DGS A;  4JOI A;  2B63 G;  3S2H H;  4FDB A;  3TEH B;  4DV5 Q;  1IBL L;  1JMC A;  3D0F A;  3HFZ B;  3I4N H;  2IT1 A;  4YCW A;  3J81 i;  1HZC A;  2QA4 A;  4JI7 L;  1VQA A;  1N32 Q;  5FJ8 G;  3K0X A;  4B3T Q;  3L2P A;  4POG A;  4BXX G;  4GN4 B;  4LF4 L;  4K0K Q;  3I4M H;  1AH9 A;  1PH4 A;  4DAY B;  3RLO A;  1A0I A;  1HR0 L;  3GTQ H;  4DR4 Q;  4JI2 Q;  5FLM H;  3M4O H;  4L5Q A;  1OXX K;  1X9N A;  1GO3 E;  1YBY A;  4GKJ L;  4X64 L;  1YHB A;  1HZB A;  2K14 A;  3E9I A;  5J3B A;  4AYB G;  4DV0 Q;  4GLX A;  4LF6 Q;  1XMO L;  3H3V H;  4BY7 H;  3G6E A;  2ZJR A;  1Y1V G;  1C9O A;  3H0G G;  2YU9 H;  4RG1 A;  4J15 A;  2R93 H;  5IYD H;  2RHQ B;  2D0P A;  2DUD A;  3PGZ A;  2K4K A;  4R4C A;  4GN3 B;  3U4V A;  2CCZ A;  1IL2 A;  2Z6K A;  5C0X G;  1GKH A;  3EIV A;  3PUV A;  2VS1 A;  3HKZ E;  4JI5 L;  4JYA Q;  1UE5 A;  3T1Y Q;  4A3B H;  4A76 A;  1B8A A;  3OTO L;  4C3H H;  3RLF A;  1VQJ A;  3G71 A;  3ULP A;  1XNQ L;  5JJI A;  5FJ8 H;  3GTK H;  3AYH B;  4A3M G;  1C7Y A;  3KF8 B;  5C0X I;  5LMN Q;  1AE3 A;  1PVO A;  4ALP A;  1K9M C;  1Q1E A;  4OX9 Q;  3M7N A;  4OWX B;  4IOA A;  4O0A A;  4DPG A;  1K83 H;  2VW9 A;  2UUA Q;  3FP9 A;  1K3R A;  1WCM G;  1KRT A;  4X64 Q;  4DK6 C;  1X55 A;  4IOC A;  4JCV E;  4R4I A;  1PA6 A;  4A3E H;  1CKO A;  2UUC Q;  4DUY Q;  1O7I A;  1E1O A;  4GOP A;  2LSS A;  4LW1 A;  2JA5 G;  3M4P A;  1K8G A;  4P72 A;  4LF4 Q;  2OQK A;  1Q12 A;  3F8T A;  4K0K L;  1WI5 A;  1N9W A;  4JI1 L;  4LUV A;  3PIP A;  3CCR A;  4A3M H;  4GKJ Q;  4UPA A;  2EQS A;  1G29 1;  3AEV A;  2ES2 A;  4A3G H;  1X3E A;  2VNU D;  1J5E L;  4A3B G;  2ATW A;  3D31 A;  2VL6 A;  4DV5 L;  1IBL Q;  1I6H H;  2ZJQ A;  4A3L H;  5IY0 A;  3BU2 A;  1YI2 A;  5AJ3 Q;  3CC4 A;  4JI7 Q;  1N32 L;  4DR3 L;  2PMZ E;  4OX9 L;  5HY6 A;  3PV0 A;  3PCO B;  4B3T L;  1OXT A;  4DR6 Q;  3TRE A;  2AHO B;  1X6O A;  3KDF A;  4QGU A;  4MTN A;  4X62 Q;  1N33 L;  3S14 H;  3PO2 G;  3NEM A;  5C4J H;  1XTD A;  3U58 A;  2UXD L;  3PF4 A;  1SRU A;  4WJ3 M;  2IY5 B;  4LUZ A;  4DR7 L;  3T1H L;  3GO5 A;  2F52 A;  5FLM G;  5GAD C;  4B3M L;  1K8A C;  3PUZ A;  1NMF A;  3DLL A;  1VQ4 A;  2KHI A;  3J81 j;  3M85 A;  2CWA A;  3CCJ A;  1XNR Q;  1P8L A;  2KBN A;  1BKB A;  4LWC A;  1I5F A;  1WYD A;  5GAG C;  2UXC L;  1N36 Q;  2H5X A;  1SFO H;  1Y1W H;  4R4Q A;  3TRZ A;  2IX0 A;  1X54 A;  4APV A;  5IP9 G;  4A3C H;  3HKS A;  1D7Q A;  2JA8 H;  4A3F G;  4IPH A;  2KCM A;  3F2B A;  1VQ7 A;  2F4V L;  4GLA C;  2BA0 A;  4JI1 Q;  1UE1 A;  1PH3 A;  2IHE A;  1PH8 A;  3GTO H;  5JEA J;  1SMX A;  4DV3 L;  2UXB L;  1YVC A;  3ULL A;  1NBW A;  4X66 Q;  5M5Y H;  3GTJ H;  3KJO A;  2K52 A;  2MO0 A;  2K50 A;  3I7F A;  1E7Z A;  3J80 i;  4TQU S;  1E1T A;  2L15 A;  4UP9 A;  4DV6 L;  5GAE C;  4HJ7 A;  4NXM Q;  2AWN A;  1FL0 A;  4B3M Q;  1X65 A;  4IPG A;  1LTL A;  1W3S A;  2WB1 G;  3CCV A;  1CKN A;  3PUY A;  1YIT A;  3OW2 A;  1Q81 C;  4BBS H;  4MZ9 A;  1Q82 C;  1XNR L;  2E2H H;  1NE3 A;  4QY7 A;  1PHJ A;  5FLX c;  5GRO A;  2Y0S E;  2I5L X;  1VQP A;  4X6A H;  4JBK A;  1PYB A;  1YHQ A;  4L5S A;  4DR7 Q;  2UXD Q;  4LUO A;  4QL5 A;  2BH2 A;  2RCN A;  2D62 A;  3CD6 A;  4C3I H;  5M5W H;  1P16 A;  2OQ0 A;  1CSP A;  4NXN Q;  3PO3 G;  4IFD I;  1K0R A;  1VS0 A;  4EQ5 A;  1YIJ A;  1VQ8 A;  4DV2 Q;  4JI2 L;  3S1Q H;  3JAM c;  4DR3 Q;  4DV0 L;  4LF6 L;  1B7Y B;  1YJN A;  1FVI A;  4NB3 A;  3CMA A;  3GTL H;  5M3M H;  1NY4 A;  2NVQ H;  2N78 A;  2ZTD A;  5IYB H;  3ERS X;  3M4Q A;  4GS3 A;  4JI6 L;  4DR5 Q;  2PI2 E;  4HJ8 A;  5IYC H;  1A8V A;  2UUB Q;  4A3D H;  4JBW A;  2AWO A;  2R6G A;  1E22 A;  4GN5 A;  1KD1 C;  4JYA L;  3W1G A;  3ER0 A;  3KOJ A;  2A8V A;  3I4O A;  1L0W A;  2VUM G;  1OTC A;  3HOY H;  4A3D G;  2RHS B;  5JJL A;  4PG3 A;  1PH6 A;  1XMQ L;  4JI4 L;  4B3R L;  3UE0 A;  3I2Z A;  1EIF A;  4JBM A;  4A3I H;  3CP0 A;  3STB C;  3AFP A;  3I4M G;  4DV7 L;  4LFA Q;  1IYJ B;  2ZTC A;  4A3K G;  4LFC Q;  1S3O A;  3A74 A;  4A3L G;  3K80 C;  1QVF A;  4RMF A;  3ZJY C;  4AQY Q;  1RIP A;  4IFD J;  4OO1 I;  3S2D H;  2RF4 A;  3KDF B;  1QUQ B;  3F2D A;  5LMU Q;  2ZTE A;  3NBH B;  4A93 H;  3OTO Q;  3J7Z C;  3HOV G;  1LM0 A;  2XTI A;  1XMO Q;  4UY8 C;  5IE8 A;  2BA1 A;  3RR5 A;  1GVP A;  5LMN L;  4C3J H;  1UEB A;  4HIK A;  2JK8 A;  4YY3 Q;  3HKZ G;  1SRO A;  3KF6 A;  1E3P A;  1VQG A;  4DV2 L;  3UDF A;  3BJU A;  1YJW A;  2E2I H;  3PO3 H;  1Y1W G;  4A3I G;  2YTV A;  4NXM L;  4TVA B;  1FJG Q;  2DGY A;  3KYH C;  1KIX A;  1WCM H;  4UP7 A;  1N8R C;  3MEF A;  2JA9 A;  5JEA G;  3K7U C;  3GTP H;  1C0A A;  2MFI A;  1Z47 A;  1SE8 A;  2UUB L;  1G6P A;  1HNZ Q;  3J7A 5;  4HIM A;  3I55 A;  4Y7N H;  1CKM A;  1HNX L;  1BBW A;  5C4X G;  4X62 L;  1N34 Q;  1L1O A;  1XMQ Q;  4JI4 Q;  3SGI A;  4Y52 H;  1KXL A;  1UWV A;  3M9B A;  1J5E Q;  3GD7 A;  4LF7 Q;  2R92 G;  3HOU G;  2HIV A;  5IYB G;  1CUK A;  3BZC A;  3GTM H;  2R7Z H;  1L1O B;  2QEX A;  2UXC Q;  2JA6 G;  5M3F H;  5IT9 c;  1NTG A;  5DLQ E;  4BY1 G;  1V43 A;  1UE6 A;  2OCE A;  1KHI A;  3B6Y A;  2V1C C;  3W1B A;  1B70 B;  2YYZ A;  4OXP A;  5LMU L;  3HOX G;  2GN5 A;  3F1Z A;  4DV1 L;  4DKA C;  1X3G A;  3S15 H;  1S72 A;  2JEB I;  3T1H Q;  2D0O A;  4YY3 L;  4DV4 Q;  2JA5 H;  2UXB Q;  3IRB A;  4IO9 A;  4JBJ A;  4HID A;  1I94 Q;  4LNQ A;  3NEL A;  2JE6 I;  2GVB A;  3HOW G;  3TQY A;  4P71 A;  1FJG L;  5IWA L;  4OWT B;  1MKH A;  4LF8 Q;  2IX1 A;  1LYL A;  3RZO H;  4NPS A;  4JI0 Q;  1YNX A;  1TWC H;  2CFM A;  4QJF A;  4L5T A;  2K5N A;  1ASZ A;  2OTL A;  4KHZ A;  2F3I A;  4GLV B;  2F4V Q;  2WAQ G;  3PUX A;  2VQF Q;  4PZ8 A;  1PH9 A;  2CKZ B;  1VQB A;  4JG2 A;  1EFW A;  3M3Y H;  3H0G H;  1XPU A;  1OXU A;  1N34 L;  4A3C G;  4AH6 A;  4DUZ L;  1W2B A;  1N36 L;  4R1J A;  1EIY B;  5K36 G;  2NVY H;  2Z0S A;  2ZM6 Q;  4XIG S;  2NN6 I;  4O2D A;  1QVG A;  1QZH A;  4BY7 G;  3I56 A;  4UP8 A;  1JJ2 A;  2VQE Q;  1MIU A;  2E8G A;  3A5U A;  4YCV A;  2B3G A;  1X3F A;  4QIW E;  5GAH C;  2AMC B;  4JI6 Q;  3H3V I;  1IXR A;  4MNO A;  2N3S A;  2NZH A;  3MXN B;  1VQF A;  1I50 H;  2AKW B;  5C44 H;  2R7D A;  4DR2 L;  1PH5 A;  4LF9 Q;  4KI0 A;  3OYY A;  3WWV A;  2UUA L;  3UE1 A;  1SLJ A;  3PF5 A;  5H1S E;  3KF6 B;  1Q86 C;  1AE2 A;  1VQM A;  4WJ4 A;  3S16 H;  2B29 A;  2KHJ A;  1VQC A;  2MO1 A;  2PNH A;  2YTX A;  3FKI G;  3RLN A;  4X65 L;  1EYG A;  1VQD A;  4PZ6 A;  2E2J H;  3CAM A;  2I0Q A;  3K81 C;  4JI5 Q;  1NMG A;  2QGQ A;  1KL9 A;  2YTY A;  1RL2 A;  4LFC L;  1M90 C;  1PH1 A;  2UU9 Q;  4A3K H;  5IYD G;  1Z9F A;  1VQ9 A;  1U5K A;  4A3F H;  2OTJ A;  2R92 H;  3HOU H;  1IBK Q;  4YWL A;  4C2M H;  3HOY G;  4P73 A;  1I3Q H;  5C4X H;  3CC2 A;  1TWG H;  4JI0 L;  2HQL A;  2ZJP A;  3AFQ A;  4A4I A;  4DV7 Q;  2ALY B;  3TS2 A;  4DUY L;  4DR6 L;  3S1R H;  3AQQ A;  4DR2 Q;  4LF9 L;  4OWW B;  2VZA A;  1OXS C;  2Z6K C;  3EBE A;  4AQY L;  4BXX H;  1OXV A;  2PQA B;  3CQZ H;  3HOZ G;  4IFD G;  3STB D;  3UDX A;  4B3S Q;  5M3F G;  1YHA A;  2E5L Q;  4POF A;  1VQO A;  1GM5 A;  1Y14 B;  1HNZ L;  1XJV A;  4IJH A;  1KC8 C;  2NVX H;  2WB1 E;  3CCM A;  4LFA L;  1HH2 P;  2LXJ A;  1HJP A;  3G48 A;  3K8A A;  5M5X H;  1IBK L;  1SR3 A;  4P74 A;  1JJC B;  3JAM i;  3TS0 A;  2R93 G;  4HIO A;  4A3G G;  1EQR A;  3H15 A;  1EOV A;  1IBM Q;  3CCL A;  2GVA A;  1HR0 W;  4HJA A;  2I5M X;  1S40 A;  1A63 A;  3W5O A;  3UDG A;  4R4T A;  3CCU A;  2MNA A;  4JV5 Q;  5IP7 H;  1HNX Q;  1V1Q A;  2NZO A;  4LF5 Q;  1PFS A;  4DV1 Q;  1KQS A;  4BBR G;  4BA1 I;  1Q1B A;  3CF5 A;  3I4N G;  5C3E H;  4DR1 Q;  2E5L L;  3PUW A;  1V9P A;  4OON A;  4DV4 L;  2HHH L;  1LUZ A;  1VQI A;  1VQE A;  4X65 Q;  3U4Z A;  3E9H A;  2KEN A;  3G4S A;  4HJ9 A;  1XPO A;  5IWA Q;  1PYS B;  1ASY A;  2JEA I;  1JB7 A;  2Q2H A;  3DM3 A;  2B63 H;  2I5H A;  5ELN A;  3NEN A;  1KRS A;  4BY1 H;  4DV3 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...