3STBD

A complex of two editosome proteins and two nanobodies
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
113
structure length
108
Chain Sequence
KSVNSVTLVGVVHDIQSGFVYEDAVTQFTLTTTSIDTTVVVEKDHHTIRCFGELFSAEVKQKVKEGNVVCVNGRLRLSPQLEPSCNKHFYFPYIQVQPPHGQVAVIHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords single domain antibody VHH
publication title Crystal structure of a heterodimer of editosome interaction proteins in complex with two copies of a cross-reacting nanobody.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
total genus 18
structure length 108
sequence length 113
ec nomenclature
pdb deposition date 2011-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3stbD00
1SRUA 2WP8J 1I50H 4Y7NH 5C4XG 1VQAA 5M3FH 5IYBH 1QVFA 3F8TA 1IZ6A 1Q86C 3E0EA 2HIXA 1N34Q 5M3MG 4HJ8A 1PV4A 1SLJA 1VQFA 2DUDA 2NVXH 3TRZA 4LFCQ 1P8LA 1LM0A 1VQMA 1KXLA 4DK3C 1T9HA 4OXPA 3TREA 1SE8A 1B7YB 3CPFA 3SGIA 3CCQA 1CSQA 2OQKA 1FJGQ 1XNRQ 2VL6A 1E3PA 1FJGL 4K0KL 4IFDJ 4A3EG 1OXSC 1HR0L 2A8VA 1G6PA 1J6QA 4PZ7A 2FXQA 1A8VA 2JA5H 3OTOQ 4MZ9A 4LF9Q 1N8RC 4LF9L 3UDFA 4OX9Q 3G48A 2R7ZH 5IP9G 4OX9L 1NMFA 1GKHA 4KLKA 4YCWA 3FP9A 3WWVA 5HY6A 4X62L 1EQQA 4IJLA 1J5EQ 2JA8H 4B3ML 3CXCA 1W3SA 4A3GH 2Z0SA 3K81C 3A5ZB 1LYLA 3F2CA 1XJVA 2N3SA 4BBSG 1SFOH 2CCZA 1JJ2A 3T1HQ 2WAQG 3KDFA 4NXNQ 1XPOA 1I3QH 4BXXH 1YI2A 1EIFA 5LMUL 3A5UA 2CQOA 4BA1I 1KC8C 4JCVE 3ULLA 3HOWH 4LFAL 1PH1A 3HOUG 2NVQH 3GD7A 3AFPA 1VQDA 3PF5A 1VQKA 2YTXA 1X54A 1QZGA 4OO1I 3G71A 4L5TA 4YY3Q 3F2BA 1ASZA 2UU9L 1Y1WH 2AKWB 2KHIA 1AE2A 2XGTA 3MXNB 2VUMH 4KI0A 3S15H 3K8AA 1YHQA 1C9OA 4GOPB 1VQBA 1VQJA 2NN6G 4QL5A 5FLMH 3RZOH 4HIKA 4P74A 4DR7L 4MNOA 1XMQQ 5IP7G 4HIDA 3I4MG 4NPSA 3U4ZA 4DV5Q 1XMQL 1JMCA 4DV5L 1S3OA 2PI2E 4B3SL 2JA7H 2BA1A 4BY1G 1L2FA 4KHZA 1PH3A 2CWPA 4A3DH 2RCNA 4DKAC 2R6GA 2F3IA 4A3KG 2E2HH 3S2DH 1YBYA 3JAMc 4Y52H 2YTVA 4X64L 1IBLQ 1N32Q 4GNXA 1WI5A 4X66Q 4X66L 5AJ3Q 4LF7L 2JJQA 4A3MH 3RZDH 2PMZE 2I0QA 1HZAA 4GOPC 4JBJA 4A3LG 1K8GA 2VQEL 4UP7A 3GDEA 1IBMQ 2YTYA 2LSSA 4LUOA 2R93H 1U0LA 5IYDH 1IBML 2ZJRA 4IFDG 2R7FA 4X65Q 1X3FA 2XTIA 4O0AA 2NN6I 4YCVA 4X65L 3CCJA 2E2IH 2NVTH 4IOAA 3S17H 3GTQH 4R4QA 4APVA 1XNQQ 2Z6KA 4DUYL 4L5SA 3UE1A 3ZJYC 1V1QA 3HOYH 3AYHB 4DV7Q 2OWOA 3BU2A 3W1GA 1M1KC 4XTCS 4P72A 3H0GG 1QUQB 3FHWA 2VQFL 2RF4A 3AQQA 1VCIA 3VDYA 3PF4A 2DGYA 3B6YA 1BBWA 3G4SA 4JI1Q 1VQPA 1VQ8A 4LW1A 1TWHH 3EBEA 1I5FA 1K73C 1G51A 1Q82C 4DV6L 3E9IA 3M9BA 4GN3B 4ALPA 2BH2A 3H15A 3PO3H 2MFIA 4TQUS 4GKKQ 4JV5Q 1R9TH 2ES2A 4JBKA 4GKKL 4JV5L 4LFBL 4LUZA 4DR5Q 1BKBA 4DR5L 4B3RQ 4H02A 3RR5A 3ULJA 3M85A 4IFDI 5IT9c 2ZJPA 4YHHQ 1XMOQ 3J80i 3S1MH 4LNQA 3AEVA 1VQ9A 1OXVA 1KL9A 4AQYQ 4DV4L 4DV1Q 4AQYL 1EYGA 5C3EG 4LF8L 4DV1L 1WYDA 1S40A 3F2DA 1Y14B 4DAYB 1YZ6A 2KENA 1TWGH 2LXJA 2YYZA 3PUWA 3S1QH 2K4KA 5M5YH 1PVOA 4GN5A 4GS3A 2ZM6Q 1QZHA 2PQAA 2ZM6L 1N33L 5M3FG 2WAQE 5IYBG 1ASYA 3J81c 4A3BH 4DR4L 4DR4Q 3CC7A 3HOXH 2OTLA 3HKSA 3NBHB 1EIYB 3UDIA 4HJ5A 4P75A 2Q2HA 3PIOA 1HNWQ 4JG2A 1HNWL 5GQOA 2WFWA 3S14H 1JJCB 1D7QA 3I4NH 3HOVG 4QJFA 2MNAA 3S1RH 2CKZB 3PIPA 4K0KQ 2D0OA 3DLLA 4R4IA 1HR0Q 4JI3L 4GOPA 3CPWA 5GAEC 2ALYB 2VY3A 3PV0A 2Q2IA 4BBRH 2UUAL 4A3JH 2NZHA 1OXTA 2N8NA 4UPAA 2JE6I 4GLVB 4L5RC 1E24A 4C3JH 1LTLA 2B3GA 4YCUA 3TQYA 2QA4A 3A0JA 2ID0A 1L1OB 4MTNA 2JA5G 3CAMA 4A3LH 2UXCL 3KOJA 1X65A 1HNXQ 1QVCA 2K75A 2K50A 2E8GA 5C0XJ 3W1BA 4X62Q 1HNXL 1JB7A 2R7ZG 2KHJA 1IL2A 1K3RA 3PGZA 1TWCH 3PUXA 4LF6L 1VQHA 2R92H 3PCOB 5HGQA 4B3MQ 2F52A 4C2MH 4IJHA 4DR2L 3H3VI 2JA8G 2R7DA 3L0OA 3EIVA 5FJ8H 3GTGH 1C0AA 4DV0L 3PO2H 1E1OA 1NMGA 1HR0W 3L2PA 2JEAI 4QQBX 1KQSA 4A93H 4KHPQ 5K36G 4A3GG 4IPHA 4KHPL 1PYBA 3J81j 5LMUQ 4A75A 3CCLA 4X6AH 4JBWA 3CF5A 1MJCA 1A62A 4LFAQ 4LF4L 4BXXG 5BR8L 2VZAA 2CFMA 4NXML 1K8AC 4DR1L 2BH8A 5ELNA 3T1YL 1L1OC 1NE3A 2ATWA 4P71A 3HOWG 2UXDL 3BJUA 2UU9Q 1MIUA 4JI2L 1B8AA 2HHHL 1VQGA 1YHBA 5J3BA 1UE6A 5IYCG 4LUVA 2I5MX 4LF5L 3GTJH 2IT1A 5IWAL 1QUQA 1Q7YC 3STBC 2VUMG 1D8LA 2PI2A 3CCMA 4HJAA 1VQ5A 2UUBL 2IX0A 4DR7Q 3LGJA 2QEXA 5FLMG 4JOIC 3S24A 4POGA 1HNZL 1I6HH 2IHEA 5M5WH 1KIXA 4B3SQ 1K0RA 1PH5A 4DNIA 4JI4L 4JI0Q 2EIFA 1NBWA 2IHFA 2AHOB 4JI0L 3HOZH 1X56A 4TVAB 1WCMH 2N78A 4IPGA 5JEAJ 1VQ7A 3F1ZA 1A0IA 1YITA 1MJEA 2JA7G 3GTKH 4JYAL 4X64Q 1N36L 3ICEA 2MQHA 4A3DG 4A3CH 1TWFH 1BBUA 1OXUA 4DV2Q 1S72A 3Q8DA 4DV2L 4LF7Q 1GO3E 3ULPA 4QIWE 3M4OH 4B3TL 2PNHA 3K7AH 4FDBA 1WJJA 2VQEQ 1YJWA 1XPUA 4P73A 1AE3A 3S2HH 2D62A 3HFZB 3K7UC 4R4TA 1NJIC 4A3MG 1I94Q 3JC66 3TS2A 4JI6Q 3PUYA 4R4OA 4JI6L 1YHAA 1KRTA 3CCRA 4A3IG 5IYDG 2R93G 3KF6B 4DUYQ 3RNUA 3CW2C 1EUJA 4PMWA 1BVSA 1CKNB 3A74A 2E5LL 1CSPA 2CWAA 5C0XG 2Q2TA 5DLQE 1YVCA 2H5XA 3FKIH 2VQFQ 3HOYG 5IY0A 4DR3Q 3CD6A 2BA0A 5IE8A 4JI5L 4BA2I 2UUCL 4DR3L 3PUZA 4GKJL 2GN5A 5LMNL 5C44H 4DV6Q 3J7ZC 4JI7L 4HJ9A 1N32L 1MKHA 3KF8B 4LFBQ 2WB1G 4BY7H 3RN2A 4DR6L 3PO3G 4J15A 2NZOA 4WJ4A 3I7FA 2JA6H 1IBKL 2HT1A 1L1OA 1FGUA 3CMAA 3RN5A 1WOCA 1W2BA 1HH2P 3NELA 1PH2A 4YWKA 2YU9H 1VQIA 1FVIA 4NB3A 1UEBA 4AH6A 2B63G 4DV4Q 2B29A 1P16A 2IY5B 5FLXc 3CCSA 4LF8Q 1WFQA 1E7ZA 3L7ZC 4UP9A 5C0XI 2JEBI 2K5VA 3GO5A 3STBD 2K14A 3UDXA 1CUKA 3KJPA 4DV3Q 4GLXA 3S16H 2OQ0A 4JOIA 4DV3L 3J81i 1N33Q 1GVPA 4RMFA 1HZCA 4EQ5A 1U5KA 1EFWA 4A3BG 1Y1VH 2A1AA 3I2ZA 1Q12A 1UWVA 3CMEA 3HOXG 1YJ9A 4DPGA 4GNXB 1O7IA 3GTLH 5JEAG 3NENA 4A3FH 1UE7A 2D0PA 1XTDA 3OW2A 3GTPH 5C3EH 3J80c 1IXRA 3UE0A 1KRSA 1JJGA 4HIOA 2KBNA 2K5HA 4JI3Q 5C4XH 2I5LX 2VW9A 2UUAQ 3I4NG 4AYBG 1AH9A 1YNXA 2ZJQA 2JK8A 4PZ8A 1VQEA 3M4PA 1X9NA 5M3MH 3H3VH 4BBRG 2UXCQ 1HJPA 4A3JG 2LXKA 2VNUD 5JJIA 4C3IH 1VQ6A 1N34L 1UE5A 3CCEA 4DK6C 1Q81C 4GLAC 4LF6Q 1X6OA 4DR2Q 1C7YA 2JA9A 4LFCL 4GNXC 2IX1A 3HOVH 4DUZQ 4OONA 1Q1BA 4DAMA 2R92G 4YWMA 4DUZL 4DV0Q 1Z9FA 4A3EH 4QGUA 3PUVA 5GROA 2Q2UA 3S1NH 5FJ8G 3I55A 1XNRL 3UDGA 3PO2G 5GAHC 4A93G 4PZ6A 4OO1G 3PSIA 4LF4Q 4OWTB 1GD7A 5BR8Q 4RG1A 5IP9H 3OYYA 1X3EA 3OTOL 4DR1Q 3ER0A 3T1YQ 4NXMQ 2UXDQ 2KCTA 1CKMA 2AWOA 2Z6KC 4AIMA 3KF6A 4QY7A 4JI2Q 2HHHQ 2Y0SG 3E9HA 1E22A 1M90C 3BZKA 1YEZA 2NVYH 4O2DA 3U50C 5M5XH 1XPRA 4JBMA 4YWLA 2ASBA 1CKNA 3RLNA 3RLOA 3KJOA 1J5EL 4LF5Q 1RIPA 1G291 4A4IA 1HZBA 5IWAQ 3CC2A 4BBSH 1Y1WG 2OTJA 3EN2A 3I4OA 3K80C 2A19A 4L5QA 1PH9A 3CQZH 2UUBQ 4EX5A 1OXXK 5JJKA 4IOCA 1SR3A 3T1HL 4IPDA 1SROA 4NXNL 1PH7A 1HNZQ 1RL2A 5GADC 2GVAA 3CCUA 2PQAB 2VS1A 2AWNA 3HOUH 4HIMA 4JI4Q 2MO0A 3D31A 1H95A 1V43A 2K52A 1YIJA 3JAMi 4IO9A 4JYAQ 3BZCA 3TEHB 1X55A 3DM3A 2WB1E 5IYCH 1VQ4A 1N36Q 4UY8C 3HOZG 4YY3L 1WCMG 2L15A 4R4CA 2ZTCA 4OWWB 5GAGC 3D0FA 1PYSB 4A76A 1YJNA 3GTOH 4A3CG 4B3TQ 1GM5A 1Q8KA 2HIVA 5IP7H 1PH4A 3I4MH 3M4QA 1VQNA 3CCVA 2KCMA 1VQOA 4WJ3M 3IRBA 1UE1A 1L0WA 1EWIA 4HJ7A 1X3GA 1PH8A 4BY1H 1IYJB 3MEFA 3W5OA 4A3KH 4XIGS 2AMCB 1QVGA 2E5LQ 2F4VQ 1HZ9A 2F4VL 1PH6A 1CKOA 1JE5A 4JI5Q 2HQLA 1IBLL 2UUCQ 1OTCA 1KHIA 1NY4A 3J7A5 3M3YH 1E1TA 2I5HA 4LWCA 3FKIG 4GKJQ 1TWAH 3HKZE 5LMNQ 1SMXA 1N9WA 2EXDA 2QGQA 3KDFB 4PG3A 5AJ3L 1I94L 2V1CC 5C4JH 3G6EA 3U58A 1LUZA 1PA6A 1V9PA 4JI7Q 4C3HH 3I56A 4A3IH 5C44G 2C35B 5ELOA 3AFQA 3ERSX 4UP8A 1Q46A 4DR6Q 2YV5A 2RHQB 4IPCA 3KFUA 1A63A 4AYBE 1IBKQ 1Z47A 3CP0A 1NTGA 1K83H 4BY7G 1VQCA 4R1JA 1XNQL 1DGSA 3H0GH 2JA6G 2MO1A 2E2JH 4ME3A 4GN4B 4DV7L 1K9MC 1KAWA 2GVBA 2JQOA 5EAYA 5LMNW 2EQSA 2K5NA 1EOVA 3TS0A 1SN8A 4JI1L 2OCEA 1EQRA 3RLFA 3NEMA 4POFA 3CC4A 3U4VA 2RHSB 3GTMH 1Q1EA 3KYHC 4JC0A 2ZTDA 3M7NA 1FL0A 5E7NA 1VS0A 2N49A 1KD1C 1JT8A 5H1SE 2ZTEA 4B3RL 1VQLA 3HKZG 1B70B 3KLWA 3K0XA 2B63H 1PHJA 2UXBQ 1Y1VG 4YHHL 1XMOL 1PFSA 2UXBL 5JJLA 4JI8Q 4A3FG 2Y0SE 1TXYA 4JI8L 4OWXB
chains in the Genus database with same CATH superfamily
5KYIA 2K1BA 3BZDB 3SK8A 4Y7NH 4KKUA 1VQAA 1Q86C 3BDOA 1N34Q 4KY7A 4C3IB 2F0WA 5M3MG 4XQNA 1DJRD 1U9RA 1WTHA 1M4VA 1PV4A 2NVXH 2R92B 3IAYA 3Q22A 1SYDA 1JOKA 4DK3C 1SBBB 1CSQA 2F0GA 4B08A 4K0KL 1ENFA 2DY7A 4PZ7A 1U4MA 4F87A 2K04A 2B2VC 1N8RC 4LF9L 5FLXL 3SEBA 2R7ZH 1NMFA 3NQTA 1ML0D 3FP9A 4X62L 5HY6A 1LT5D 3CXCA 1W3SA 4G7OC 1XX8A 1MI2A 1XJVA 4BBSG 1SFOH 2RDGA 2CCZA 3MXPA 1I3QH 2EJGC 4DA2A 4BXXH 1EIFA 5KNBA 2CQOA 1KC8C 3HOWH 4DK1A 2PYKA 2DNCA 3GD7A 1AZPA 3AFPA 1IW7C 1X54A 2Z1CA 1QZGA 4RWSC 2UU9L 4UAIA 3MXNB 2A69D 3S15H 4HAEA 2XVSA 4RCOA 1KDAA 3VA5A 1HQMC 5IP7G 4NPSA 1HA6A 3U4ZA 1JMCA 2KCNA 1S3OA 4BY1B 4I7AA 2BA1A 3TBIB 4KHZA 3S2DH 1SSOA 4A3KG 2E2HH 1O7ZA 1YBYA 1EFID 1N32Q 1IBLQ 3QOJA 2PNRC 1I4HA 4X66Q 3MXUA 5DM73 2KECA 3CHBD 1JORA 5BN5A 4KMUC 1K8GA 2VQEL 4G7HC 4A3LG 5ELCA 5IYDH 4DAPA 2SDFA 3CCJA 4X65L 2NVTH 1K83B 1KNAA 2A6HD 4L5SA 1QNUA 2IWHA 3I70A 3K6OA 1G91A 2O2LD 3BU2A 2HDMA 4FF4A 1QUQB 3FHWA 2RF4A 3AQQA 3U9OA 1SDFA 1VQPA 2CH4A 3KK7A 1VQ8A 1I5FA 4EQPA 1G51A 1LT3D 3P1HA 2EY2A 4BS9A 3H15A 2MFIA 4GKKQ 1TY2A 3DEOA 1R9TH 3TN2A 2ES2A 4JV5L 2AUKA 2NYZD 4LFBL 3RMHA 4QIWB 1Y69U 2G9DA 2TMPA 3BVMA 3M85A 1VF7A 3I72A 5IT9c 3V96A 5IGEA 4PNYA 3R3OA 4KY6A 2MJ8A 4O42A 2EJMA 1LABA 4DV1L 1WYDA 3F2DA 1YZ6A 1BOSA 1TWGH 2KENA 2LXJA 1H9RA 2K4KA 4KD4A 5M5YH 1B50A 4GN5A 4PV1C 1PFNA 4GS3A 1GUGA 1N33L 2ZM6L 1WTRA 3MA2B 4DR4L 1BCPB 3CC7A 1EIYB 5C3WA 4P75A 3X3MA 3K59A 3PIOA 1JWMD 1HNWQ 4J6HA 1CA5A 5GQOA 1D7QA 3I4NH 3HOVG 4A3EB 3PIPA 2D0OA 2M9VA 3DWQA 4R4IA 2EDGA 4GOPA 1HR0Q 1DCZA 4DN4M 4L5RC 1E24A 5CV4A 5CBAE 4YCUA 2BOSA 2EYOA 1EY7A 1L1OB 4MTNA 1X65A 5EKLA 5C0XJ 2NVYB 5M5XB 1K3RA 5HGQA 4IJHA 5C6AA 3H3VI 2R7DA 5FJ8H 4A3GB 3PO2H 1E1OA 1HR0W 3L2PA 2L11A 4IPHA 3KLSA 3J81j 4IURA 4RA8A 5LMUQ 3A55A 3CF5A 1MJCA 1A62A 4DR1L 5ELNA 3T1YL 1J9OA 2NUCA 1WTXA 3NXWA 4P71A 1NR4A 1MIUA 4XDXA 3OWEB 4LUVA 1R4QB 5IWAL 1HUNA 2I07B 3DEPA 3RZOB 3MFYA 4L63B 1ET6A 4HJAA 2UUBL 2EJFC 5FLMG 3OIQA 3NTIA 3S24A 1HNZL 4XQJA 2IHEA 4B3SQ 2SEBD 1K0RA 4JI0Q 2EIFA 1JQYD 4A3DB 2N78A 1TS5A 1KLGD 3F1ZA 3MEHA 3ICEA 2QEJC 4XYQA 1BBUA 4ZQ3A 1S72A 4LF7Q 3EA6A 3M4OH 4H44C 3K7AH 1XPUA 1YNNC 1AE3A 1EL0A 4A3IB 1LT4D 3HP3A 2L55A 3RNUA 1LTID 4ILWA 4ZK9B 3HOYB 1BCPD 2E2JB 2Q2TA 1DM0B 3FKIH 1O7YA 2G5DA 2C9OA 3N52A 5IY0A 1EQTA 4DR3L 4UHVA 1PRTB 1ONLA 3TP6A 5LMNL 4GKJL 2WB1B 1UNSA 4X3SA 1MKHA 3P75A 3QR8A 3PO3B 1F2ZA 4U673 2OF1A 1AN8A 4R9WA 2NZOA 3I7FA 5I2XA 1LTSD 3I90A 2EYMA 4LAAA 2B63B 2K33A 3KLRA 1TT2A 1EWCA 3P20A 4RKBA 1IHZA 5FLXc 3CCSA 4LF8Q 1K28A 2JEBI 3GO5A 2K14A 3S1QB 3KJPA 2OQ0A 2RDFA 4RMFA 1S4ZA 5J39A 2CW0C 2L12A 2A1AA 3H6MA 1Q12A 1YJ9A 2NVXB 1AP0A 3P7JA 4CHTB 1FR3A 3UE0A 5FO7B 3QG1A 4JI3Q 2I5LX 4J8QA 2L4NA 1AH9A 2ENBA 3ITPA 4BBRB 1VQEA 3M4PA 3VYSA 1BXTA 2H4OA 3H3VH 5A2QL 5J1ZA 4C3IH 3QWNA 2NZ1D 1N34L 2ICEC 2XRSD 5EQ0A 3CCEA 1SYGA 1LTGD 4GLAC 4LF6Q 3OHXC 3HOVH 4DUZQ 1SYCA 4DF7A 4K5WA 4YWMA 1Z9FA 4RH6A 1JCKB 4QGUA 5GROA 1D5ZC 1SFOB 2K28A 3I55A 1I3QB 5I4DA 2B8FA 3G6JB 4A93G 5BR8Q 5IP9H 3HOWB 3OSOA 3OYYA 2AWOA 2WIIB 1STHA 3K5OA 1QWYA 1EWHA 3E9HA 5DM63 1A3UA 1M90C 4O2DA 1XPRA 4CDDC 1RIPA 1G291 4TKOB 1G2SA 5CGKA 1OXXK 4C1NI 3W3AA 1B9NA 1PRTD 4IPDA 4XT1B 1PH7A 1RL2A 1I6HB 2M00A 3OOCA 4HIMA 1HUMA 3LWEA 2O5JC 2K52A 1YIJA 3TEHB 3S2DB 1RKNA 1HFNA 2E2HB 2A5HA 3HOZG 3F2UA 5E1FA 1WCMG 2L15A 4R4CA 4QMGA 2DJGC 4B3TQ 1EYDA 2QW7A 3CCVA 5EKKA 4WJ3M 4Z9CB 2OT2A 1X3GA 1PH8A 1SNCA 4BY1H 1SNOA 4CDCC 1V1PA 1RDPD 3W5OA 2LFNA 5JAVA 5KRUA 1B4OA 3FPPA 2F4VQ 1HZ9A 1XTCD 4J1MA 3NBHA 4CJ1B 1BBXC 1CKOA 2F03A 4JI5Q 2HQLA 3TP8A 1IBLL 1OTCA 1N32L 1NY4A 4G4KA 3N6RA 1SMXA 4XQQA 3G6EA 1LLRD 4JI7Q 3A8IE 3KBGA 2B2YC 1F2MA 1R9TB 3HEJA 2RHQB 1TS2A 4AYBE 1K83H 3T16A 1FNWA 5EPLA 2PW7A 1EQVA 2JA6G 2F1MA 2Z9HA 2F0JA 2EQSA 4L6TB 2K32A 1EQRA 4ZKBB 1SNMA 5M5YB 3K58A 3CC4A 4RGTA 1C48A 1G6ZA 2RSNA 1SAPA 2E74C 2KA7A 1Y8NB 2B2TC 1FNUA 3K5MA 1Y1VB 1BUVT 3HKZG 1B70B 3GTPB 5I6WA 1DOLA 2UXBL 5JJLA 3LNNA 2D5DA 2IL8A 4G7ZC 2FFKB 1S5DD 1CHPD 5D3DA 1YNND 3TP7A 1EIGA 5IYBH 5M3FH 5M3MB 2KEEA 2GA4B 4NKLA 1TS3A 1O78A 4K2KA 4F88A 1D5XC 1VQFA 4FF2A 4KD3A 1FYCA 4QUFA 1K3BC 1T9HA 3TREA 3R93A 1A2UA 1SE8A 1U4PA 4X3KA 3PO2B 2RDHA 1FJGQ 1XNRQ 1HR0L 1I6VC 3NSWA 1EZ6A 3DXJC 3OTOQ 3BYYB 1RODA 1HPCA 4OX9Q 1WVLA 1WTQA 2LY7A 2Q8TA 2F3WA 3FMCA 4YCWA 1EQQA 1J5EQ 1MBYA 4IJLA 1TIID 3SK4A 4TRDA 1CQFA 1F77A 3OMGA 5BN3A 4A3GH 3T1HQ 4NXNQ 1RTOA 5LMUL 2N55A 4JCVE 2L5TA 2CH4W 3J80L 1I4PA 4RGNA 2O4XA 5CR3A 5ELEA 1EY6A 2AUJD 2YTXA 2K01A 4DNRB 1VQKA 5IIFA 3X3NA 4L5TA 4YY3Q 3F2BA 1ICFB 2Z4IA 1MGSA 4KI0A 2J4XA 1C9OA 3K7AB 3RZOH 1JR0D 1VQJA 2KUMA 3G7LA 1UUPA 1ZEQX 3I4MG 2B2UC 2QKIC 4PQXA 4CKEA 1XMQL 3KUPA 4IUVA 5I9OA 4DV5L 2A6EC 3V05A 5NUCA 2PI2E 4B3SL 4A3KB 4FXGC 4A3DH 4K8IA 2CWPA 3VYTA 1M8AA 3I4LA 1E2ZA 4R8NA 2YTVA 4GNXA 3GV6A 5AJ3Q 4LF7L 4A3MH 2PMZE 4OGQC 5C4JB 4JBJA 4CGYB 4JW0A 1CTMA 4S3SA 1IBMQ 5IGFA 2YTYA 2LSSA 1X3FA 2B2VA 2XTIA 4O0AA 4IOAA 3D8GA 2E2IH 1VDZA 3GTQH 4R4QA 2RVLA 3UE1A 1W6KA 1D6EC 3TMEA 3ZJYC 4HCSA 3HOYH 4DV7Q 2OWOA 1M1KC 3H0GG 5LL6S 1VCIA 3B6YA 4U68A 5IT9E 3EBEA 4IALA 1DYQA 4ALPA 3PO3H 2AQ3B 4TQUS 4ZKCB 1WD0A 3URYA 4LUZA 1AZQA 1BKBA 2FINB 4DR5L 4KY5A 2PMZB 4B3RQ 1PXUA 1B53A 1AFPA 1XWEA 4YHHQ 1XMOQ 3J80i 1VQ9A 1OXVA 4LJZC 4AQYL 1EYGA 5C3EG 4LF8L 3S1QH 5CV7A 1RHPA 1QZHA 1JC7A 2PQAA 2WAQE 2L0CA 2XIWA 3NBHB 3UDIA 2Q8RE 5CV6A 2A74C 1I4RA 3BDCA 3HOVB 3UI2A 4QJFA 4NDXA 1VMPA 4JI3L 2BE5D 4JPBW 2RCFA 4BBRH 1PTOF 2NZHA 1OXTA 4UPAA 4DAVA 2JE6I 1EY9A 1QCBD 2B3GA 1MSHA 2F0IA 2K5QA 4FF1A 3T56B 5C3XA 2ID0A 5FO9B 2JA5G 3RD4A 3S9WA 3KBXA 1BCPC 5HURA 3W1BA 1HNXL 3DM1A 1JB7A 2KHJA 3PGZA 4LF6L 5DNFA 1VQHA 3PCOB 4C2MH 2JA8G 3EVQA 3EIVA 3ND9A 2WAQB 5K36G 1I4QA 1OO9B 4JK1C 1KQSA 4KHPQ 1STEA 2K5WA 2X6GA 2KHSA 1KLUD 1EZ8A 3CRLC 2DNEA 4LFAQ 2F0LA 5BR8L 2VZAA 4CBVA 1K8AC 2NVQB 1L1OC 1WTWA 3BJUA 3Q23A 5IODA 5C4ZA 1F9RA 5IYCG 3DWAA 2I5MX 5AFWA 1ZYRD 4ZUIA 4E6IA 2VUMG 1D8LA 4EQNA 4DR7Q 3LGJA 2QEXA 4WORA 3T53B 4POGA 1I6HH 2PZTA 4DNIA 4IUNA 3EFXD 1B44D 1GUNA 1V1OA 1WD1A 1VQ7A 2JA7G 1A0IA 4X64Q 2SNMA 4A3CH 2F0UA 1H9SA 4DV2Q 2O5IC 2B39A 4QIWE 4B3TL 2PNHA 2ICIA 3RZDB 2D62A 3HFZB 1S5BD 1NAPA 4JI6Q 3PUYA 1YHAA 1KRTA 3CCRA 3A54A 2R93G 3KF6B 3S17B 3CW2C 4V190 2FJ2A 1LT6D 4FF3A 1BVSA 1KAAA 3A74A 3E3XA 5IGDA 2CWAA 2HD3A 5DLQE 1YVCA 2H5XA 1BF4A 3T4AC 4JI5L 4BA2I 3QB3A 1TWHB 1S5FD 3MXGA 3D4WA 1STYA 4DV6Q 5T1GA 4JI7L 5FLXE 3KF8B 1NNXA 4DK0A 3RN2A 2TSSA 4J15A 4WJ4A 2HT1A 3D4DA 2Z4HA 3RN5A 1W2BA 1HH2P 4FXDA 2QDBA 1VQIA 1FVIA 4NB3A 4OEMB 1P16A 1PRTC 1TR5A 2PQEA 3JAML 3STBD 3UDXA 1CUKA 1TQOA 3S16H 5M3FB 4DV3L 3WOEA 1SYEA 3J81i 3BS1A 1HZCA 2EXZA 2A6ED 3K5NA 1SYFA 4A3BG 1LTBD 1Y1VH 1UWVA 4C1NK 3A56A 3HOXG 4K8JA 4DPGA 4GNXB 5JEAG 3T13A 4A3FH 1UE7A 4ZRZA 2D0PA 1XTDA 3GTPH 1NCVA 3S14B 5C3EH 3J80c 1IXRA 4RGMA 3S1RB 1KRSA 3FDTA 3HRZC 1JJGA 2K5HA 2HUGA 2VW9A 3O13A 2JK8A 1Q3LA 4QUCA 2EE1A 5M3MH 2FHTA 4A3JG 2LXKA 2VNUD 4C3JG 1UAPA 4KHVA 1UE5A 5IGCA 5KGUA 1TWCB 4DR2Q 1HFGA 2JA9A 4OONA 1Q1BA 2R92G 4OELB 4DV0Q 3GTGB 1JOQA 2Z6BA 1J8IA 4KKSA 3PUVA 4A93B 4IZ8A 1U4RA 2N88A 1XNRL 2AQ2B 5CV9A 3IFDA 4OO1G 3PSIA 4OWTB 3OTOL 3ER0A 3HZXA 2UXDQ 2KCTA 5CC4A 4AIMA 4QY7A 4JI2Q 4FVMA 2Y0SG 1Z7TA 3U50C 1CKNA 2HCCA 1J5EL 1F2YA 4XYOA 3CC2A 4BBSH 3GTJB 1PDQA 3I4OA 1PH9A 3CQZH 4HEDA 5JJKA 4RAUC 4DU9A 3T1HL 4NXNL 2P5ZX 2GVAA 3CCUA 2PQAB 5IGBA 3HG9A 4JI4Q 3GQBA 3NBIA 3JAMi 3HOZB 4CKCA 4JYAQ 2XNAC 2WB1E 5IYCH 1VQ4A 1N36Q 4UY8C 4YY3L 5D65A 2ZTCA 5GAGC 1PYSB 2QF7A 4A76A 2WACA 1WTPA 1GM5A 4A3MB 1Q8KA 5IP7H 1PH4A 1DOMA 3M4QA 4XT3B 2KCMA 2EYFA 3IRBA 3M4YA 1STAA 4HJ7A 1ILPA 3J7YW 1X3PA 1IYJB 2E2IB 4A3KH 3GTQB 4XIGS 2AMCB 1QVGA 4RGOS 1PFMA 1PH6A 4X3TA 3M3YH 4LWCA 4A3LH 2MHVA 3HKZE 1I94Q 1N9WA 2EXDA 5AJ3L 5C4JH 3EROA 1CI3M 1LUZA 1PA6A 1V9PA 5C44G 1U4LA 2KJXA 3ERSX 4K2LA 2E76C 4UP8A 4WFN3 4DR6Q 1IYVA 3R2TA 2JA6B 4BY7G 1VQCA 1DGSA 3AU7A 3ZYYX 1GUWA 2F0HA 3NTKA 4DV7L 2ZXPA 1KAWA 4Q5VA 5FKAC 1F9SA 2K5NA 1SN8A 4KJOA 4G57A 3NEMA 4KV6A 4R8IA 3U4VA 3CU7A 3KYHC 4JC0A 2ZTDA 3HKZB 5E7NA 1Z6HA 1KD1C 4KTAA 2MGSA 4I65A 2EZVA 4B3RL 4TSSA 1PHJA 4YHHL 4ZCKA 1XMOL 1DD2A 4JI8Q 1A3VA 3DUZA 2EVBA 1T5XD 4LNQA 2WP8J 1I50H 4XXEA 5C4XG 2CHBD 4MTKA 1JOOA 4HJ8A 5ISRA 1PFBA 1SLJA 3VYRA 2J7ZA 4LFCQ 4QB4A 1P8LA 1STBA 4NMZA 4C2MB 1KXLA 5CMDA 1EY4A 4OXPA 3AB9A 5A35A 1B7YB 3CPFA 4CKBA 4A3EG 2A8VA 1G6PA 2FXQA 1A8VA 1F2LA 4LF9Q 1GKHA 1D1IA 1G2TA 2H1EA 1LACA 1KTKA 2KCCA 2V4DA 2PZWA 1A3TA 2Z0SA 3A5ZB 1LYLA 3F2CA 2N3SA 4H7BA 5LHY1 1JJ2A 3KDFA 4RKLA 1XPOA 3D6WA 1YI2A 1LV9A 2F0PA 4BA1I 3A5UA 2K05A 3ULLA 1B3AA 2NTSA 4LFAL 1PH1A 3HOUG 2NVQH 3IKJA 1SNDA 3PF5A 2B2TA 2F0DA 3FVQA 1ASZA 5M9OA 4HMJA 2KHIA 1VMCA 5E4XA 1YHQA 4GOPB 3I4MB 1SNQA 2NN6G 2JN4A 5FLMH 1X32A 4DR7L 1PTOB 4HSPA 2F0FA 4CDFC 3CRKC 1PH3A 2RCNA 3NTHA 4DKAC 4Y52H 1MSGA 3JAMc 3SXHA 3NE5B 5FOBB 2RQXA 4X64L 2F0SA 5DEHA 3V2TA 2Q8IB 4X66L 4ODGA 1TWAB 2BE5C 3RZDH 1HZAA 2EY6A 3K0YA 1IL8A 1X3QA 5A2QE 1U0LA 1QE6A 4IFDG 1GJXA 4HSVA 4C3HG 4X65Q 2NN6I 2F3VA 3S17H 1XNQQ 2Z6KA 1UEAB 3Q24A 4FO2A 1ICWA 3H0GB 1V1QA 3W1GA 1L0XB 1S5ED 5KNDA 4P72A 3VDYA 3MVVA 3PF4A 2HQEA 3QIAA 2DGYA 4O1NA 3G4SA 2ZXOA 1TWHH 3H91A 2CQAA 1K73C 1EU3A 4NW2A 4DV6L 4GN3B 3M9BA 2BH2A 3S16B 4JV5Q 4GKKL 4GZYC 5CV8A 3RR5A 3VA7A 4IFDI 4A3FB 4DXFA 2ZJPA 1ZYRC 5C3EB 1PZKD 1KL9A 4MN3A 4DV1Q 4EGVA 4EVOA 4F7XA 1S40A 2I46A 1Y14B 3NK9A 3PUWA 2B2UA 5T1IA 2ZM6Q 4DR4Q 2ZXRA 1GHKA 1ASYA 1ENCA 4LMQD 2R3ZA 1SYBA 5C4HA 1ILQA 4HJ5A 1PYWD 1SJED 1IKLA 3DWPA 3TP5A 1C4QA 1HNWL 2WFWA 3U9SA 3S14H 3MXNA 1EY5A 3S1RH 2CKZB 2EPBA 3EJIA 3PIO3 5GAEC 2ALYB 2VY3A 4IUTA 4HTHA 2JA5B 1LTLA 2NBFA 3TQYA 4IUPA 3K57A 2QA4A 3H3VC 3PIP3 1PZID 2K75A 2K50A 2E8GA 2R7ZG 1V8QA 5DAUA 3PUXA 1IL2A 1TWCH 2JA8B 4B3MQ 2F52A 4DR2L 1VF5C 1BO0A 4BBSB 1TS4A 3GTGH 3L0OA 4HN7A 4DV0L 1NMGA 3CQZB 4QQBX 4A93H 2BDOA 2C5CA 4A75A 3CCLA 2FMMA 4X6AH 4JBWA 4K6DA 3VR6A 3MHBA 4BXXG 2CFMA 4ULLA 2BH8A 2ATWA 2UXDL 3ONAB 5JOBA 3HOWG 3T51B 4JI2L 1B8AA 1VQGA 1YHBA 4RFBA 1E2WA 1UE6A 4Q0FA 5J3BA 3GTJH 1QUQA 3K5LA 3STBC 2IX0A 1I4GA 1JICA 1EY0A 3IL8A 4JOIC 1KIXA 3NUCA 4JI4L 2JA7B 1D2BA 4K14A 2AHOB 4JI0L 3HOZH 1X56A 4TVAB 1WCMH 5JEAJ 2B2WC 4JYAL 1MJEA 1YITA 1B2TA 3R2IA 1N36L 2MQHA 5CORA 2B8GA 1G8ZD 1TWFH 2X6LA 1OXUA 3M3YB 3Q8DA 1GO3E 3ULPA 3OWFA 4FDBA 1WJJA 3S2HH 4R4TA 3JC66 3L9AX 3TS2A 3WOFA 4R4OA 5EPJA 1GUSA 4PMCA 5IYDG 4DUYQ 1SXTA 1DONA 1LTAD 1CSPA 2VQFQ 3TZDA 1PLFA 4DR3Q 2BA0A 5IE8A 3PUZA 1JE4A 3A8JE 2EY5A 4HJ9A 4K5XA 3PMFA 2MPMA 1T5EA 1SMYC 4DR6L 2JSOA 1CA6A 2JA6H 1L1OA 3M7GA 3EQLC 2JP1A 3NELA 1PH2A 3S1MB 2YU9H 4AH6A 2A68D 3C1FA 4DV4Q 1RF2D 1WFQA 2G9HD 1E7ZA 1I50B 3L7ZC 4UP9A 3SE0A 2K5VA 2RKSA 1ZXTA 3J80E 4OIJA 1V1PB 2M2LA 2Z8LA 1FGBD 1GVPA 4A3BB 1EEID 1U5KA 4L8JA 3CMEA 3Q0AA 1O7IA 4RHRA 1Y8OB 3OW2A 5HGTA 4HIOA 2PCFB 2UUAQ 3A8KE 3I4NG 4AYBG 1CQVA 3BDLA 2FMCA 1K0SA 4F8MA 4PZ8A 4A3JB 1X9NA 4C3JB 1EY8A 2UXCQ 1HJPA 1YNJC 1VQ6A 1X6OA 1SE3A 1AEXA 1SE4A 5EJWA 1C7YA 4LFCL 4GNXC 2IX1A 2VXWA 5JVH3 4JVZA 4DAMA 3BYTB 1HRJA 4QCLA 1SE2A 5I9PA 4DUZL 4DXGA 4UDUC 1O80A 5FO8B 5FJ8G 1A15A 3UDGA 3PO2G 1RD9D 4LF4Q 4B9XA 4NXMQ 1X3EA 2Y0SB 1CKMA 4OL7A 2HHHQ 1E22A 1A6XA 1YEZA 2XWBB 2ASBA 4YWLA 1GUTA 1QB5D 3DHQA 3RLNA 2EYJA 4LF5Q 2LS01 2OTJA 1HZBA 5JPMC 1Y1WG 1XYIA 3SHLA 3J81L 1DXMA 4M8AA 4EX5A 2F0EA 4IOCA 5GADC 1MD2D 2EYHA 1Y8PB 2AWNA 2VS1A 5M5WB 1HHVA 3D31A 1H95A 3BVZA 4QF4A 4IO9A 2IX3A 3DM3A 3GTKB 3Q6SA 3KLSX 4X3UA 3I73A 1YJNA 1F9PA 3RUZA 3E5SA 5LL6X 3I4MH 1VQNA 1VQOA 1PTOH 2K6AA 3WDNA 2D2CC 4DAYA 1L0WA 1B3QA 2K7VA 1ENAA 3MEFA 5TSSA 1STNA 4DNTB 5G3LF 1SNPA 2E5LQ 2XRQD 2F4VL 3J7A5 2UUCQ 1KHIA 1E1TA 2I5HA 3FKIG 4ZYSA 1TWAH 2QGQA 2D9UA 4KN7C 2V1CC 5C44B 2F4IA 3U58A 4N9PA 3I56A 1FD7D 1PZJD 3AFQA 4CJ2C 4BY7B 2RSOA 2YV5A 3KFUA 3VR3A 4ID6A 1IBKQ 1Z47A 1SJHD 3SK6A 1XNQL 3H0GH 3C2PA 1AW7A 4ME3A 4GN4B 3I8ZA 1KNEA 1K9MC 3NQIA 2GVBA 1EOVA 3TS0A 2OCEA 3TZUA 3RLFA 1JB3A 1GOZA 2RHSB 3C1EA 1Q1EA 1R4PB 1VS0A 2N49A 3HGBA 3NWTA 2F0VA 1B9MA 2LKVA 1JT8A 1VQLA 3GTLB 3K0XA 3J81E 2UXBQ 3OMCA 1IKMA 3SDZA 1PVOA 4ME5A 1SRUA 1PMRA 5C4XB 4KN4C 5ELBA 1QVFA 3F8TA 1IZ6A 1HQRD 1ESRA 3E0EA 2HIXA 5EBCA 1S5CD 1RTNA 3OIPA 3FPUB 1I4XA 1CZGA 2QILA 4C3IG 2DUDA 3TRZA 1MHWC 1LM0A 1TY0A 1VQMA 2PW5A 3QJYA 3SGIA 3CCQA 2OQKA 3S1NB 2VL6A 1E3PA 1FJGL 4IFDJ 1H9KA 1OXSC 1J6QA 2JA5H 1QILA 3QO2A 4MZ9A 2XSCA 3UDFA 3G48A 2WKDA 4ZAIA 1SMYD 3MC0B 5IP9G 4OX9L 5CBEE 3LX0A 4KLKA 3WWVA 2JA8H 2OXPA 5D3IB 1C8CA 4B3ML 5K36H 1BQQT 3K81C 4WRDA 2JXMB 2WAQG 1H9JA 3OPOA 3HOUB 1NUCA 4ABNA 2WV6D 4KKTA 1VQDA 1WCMB 4OO1I 3G71A 1Y1WH 2AKWB 2QCPX 1AE2A 2XGTA 5EPKA 1TWFB 5FK9C 3SVMA 2VUMH 3GTOB 1XXGA 3K8AA 3JAME 3MAQA 1VQBA 4QL5A 4HIKA 3S2HB 4P74A 2PZUA 4MNOA 1XMQQ 4HIDA 4DV5Q 3MWYW 3MZ5A 1CZWA 3I3CA 2JA7H 3GP7A 4BY1G 1L2FA 3ND8A 1BDOA 1DOKA 1YNJD 2F3IA 2R6GA 1CK1A 4K6LA 2MP1A 1WI5A 2JJQA 2I0QA 1E0BA 4GOPC 3TSSA 4UP7A 4C3HB 3GDEA 5ELFA 4LUOA 3A7AB 2R93H 1PTOC 1IBML 2JYOA 2ZJRA 2R7FA 2SNSA 1HXYD 4YCVA 1O7LA 2E2DC 4APVA 4DUYL 3AYHB 3D4RA 4XTCS 2YU9B 2VQFL 4IUQA 2NWGA 1FNVA 2RA4A 1BBWA 4JI1Q 4LW1A 4OHJA 1CHQD 4H13C 4N8FA 4WJWA 1Q82C 2BCOA 2L1BA 2SOBA 3E9IA 1LO5D 5KNCA 1KDBA 4JBKA 3GTMB 4FXKC 2KEDA 4DR5Q 2J0TD 2K03A 2QDLA 1EYAA 1F9QA 4H02A 2F0TA 4P2CB 3ULJA 1IW7D 1H9SB 3VR2A 3S1MH 4V0BA 3NP8A 4I7ZC 3AEVA 4AQYQ 3D6CA 2HDLA 4DV4L 2AQ1B 4Y7NB 1D5MC 4DAYB 2YYZA 1CT1D 2EOTA 3AMUA 5M3FG 5IYBG 2EYPA 2F0QA 3J81c 4A3BH 3HOXH 2OTLA 3HKSA 2PPBC 1NR2A 5JEAH 4K5VA 2LMCB 1NSNS 2Q2HA 4JG2A 5C5LA 5L37A 1JJCB 5JPNC 5KEEA 2MNAA 1TVXA 3PQIA 1GUOA 2F0NA 3BVGA 3DLLA 4K0KQ 3CPWA 2UUAL 3PV0A 2Q2IA 4IQZA 4A3JH 2N8NA 4GLVB 1JWUD 4C3JH 2B2YA 3A0JA 2UXCL 2R7ZB 3CAMA 3KOJA 4NP5A 1HNXQ 1QVCA 4M1UB 4X62Q 2R92H 3D3RA 2L9HA 3H94A 1C0AA 2XWJB 2JEAI 4OO1H 4A3GG 5E4WC 4KHPL 1PYBA 5EKIA 4HR7B 4KK7A 4LF4L 4NXML 1NE3A 5F2DA 2UU9Q 2WINB 2HHHL 2A68C 1HTLD 1BR9A 4LF5L 3S15B 1JWSD 2IT1A 1Q7YC 2PI2A 5KIXA 3CCMA 4N8X1 2BDNA 1A2TA 5KYLA 5M5WH 5COYA 1PH5A 4FNFA 1NBWA 2IHFA 1QJOA 4IPGA 3IFTA 3GTKH 1ZKOA 4A3DG 3GV3A 4DV2L 1QOHA 1RCVD 1CM9A 1EU4A 2VB3X 3MFGA 2VQEQ 1YJWA 4FP5D 4P73A 1W6JA 3K7UC 1NJIC 4A3MG 1RJTA 1SEBD 4JI6L 4CDEC 4A3IG 3BG3A 4B9WA 2NVTB 1BCPF 3NPPA 1EUJA 4PMWA 1CKNB 2E5LL 3E6ZX 2NTTA 5C0XG 2K5DA 5CV5A 3HOYG 3CD6A 1HTPA 2UUCL 4KJNA 5JJZA 1IYUA 1TKWB 2GN5A 4H0LC 2EYLA 2WKCA 2RBMA 5C44H 2DN8A 3J7ZC 3VYUA 5J22A 1KDCA 3HS0C 4LFBQ 2WB1G 4BY7H 4DFAA 3PO3G 1IBKL 3CMAA 1FGUA 4CJ0B 4IN3A 1WOCA 4YWKA 3NHHA 1UEBA 2B63G 3A7LA 2B29A 4N9TA 3SR1A 2IY5B 1GXDC 5C0XI 1TWGB 3MTSA 4DV3Q 4GLXA 4JOIA 1WTOA 3LWUA 1N33Q 4EQ5A 1EYCA 1EFWA 3VR5A 3NWSA 3I2ZA 2B2WA 2A69C 3GTLH 5BN4A 2PO4A 3NENA 1K8MA 4DGZA 5JVG3 4HCEA 4ZUJA 3C46A 3I4NB 1K8OA 4AYBB 1DZ1A 2KBNA 4HMIA 5C4XH 1CFMA 1YNXA 2ZJQA 4LK1C 3E0JA 4BBRG 1EIHA 1PTOD 1E2VA 4C56C 5JJIA 3CKIB 2F0OA 1KABA 3L3OC 4DK6C 1Q81C 2OEOA 2DJFC 2KQ3A 2EY1A 1QG7A 3DMUA 1GHJA 1Q8IA 2NB0A 4A3EH 1D1KA 2Q2UA 3S1NH 4FYDA 4RCNA 5GAHC 5IT9L 4PZ6A 4ZLTF 1GD7A 2A6HC 4RG1A 4DR1Q 1A63A 3T1YQ 2Z6KC 3OW7A 3KF6A 2DY8A 3C3LA 3BZKA 2NVYH 5M5XH 4JBMA 1LTRD 5D14A 1Y1WB 3RLOA 3KJOA 3J7AF 4A4IA 5IWAQ 2VUMB 5E3FA 4EQOA 3EN2A 5K5PA 3K80C 2A19A 1PRTF 4L5QA 2UUBQ 1WTVA 2F0MA 1SR3A 3FEWX 1SROA 1HNZQ 3R8BA 3H09A 4IUUA 1HA5A 3HOUH 3KF8A 4MIUA 2MO0A 4BWGB 3SK5A 1V43A 2KOLA 3BZCA 1X55A 2HCIA 1H9MA 2IW3A 4YIJA 1EEFD 5ELDA 5I6YA 2CW0D 4OWWB 3D0FA 2IPKD 4MHEA 2NN6H 3FRPB 3GTOH 4A3CG 3VR4A 3M4OB 2HIVA 2VB2X 2ZT9C 1ESFA 2R93B 2MUYA 1UE1A 1EWIA 1HCZA 4OIKA 2CVRA 5IGGA 2R61A 2X69A 5EBDA 2F0KA 5G3LD 3FKIB 5CYUA 1JE5A 1EOTA 3QOLA 1TU2B 4GKJQ 5LMNQ 1VQ5A 4PG3A 3KDFB 1I94L 5I2YA 4IFDH 4C3HH 3I91A 4A3IH 2C35B 1Q90A 5EGTA 5ELOA 1Q46A 4IPCA 1LTTD 3CP0A 1NTGA 1B1ZA 2KVMA 4R1JA 5C0XH 3ERQA 1II3A 2XN9C 2MO1A 4PMBA 2E2JH 1ET9A 5C5MA 1STGA 1L0YB 2JQOA 5EAYA 5LMNW 2E75C 5IOCA 4JI1L 3J7AV 1QNKA 4POFA 4RHSA 1BNZA 3GTMH 2IJ0A 3M7NA 1FL0A 3HOXB 5H1SE 2ZTEA 2A73B 3KLWA 2B63H 3TDQA 3W2DA 1Y1VG 1PFSA 4A3FG 2Y0SE 1TXYA 4JI8L 4OWXB
chains in the Genus database with same CATH topology
1SRUA 2WP8J 1I50H 4Y7NH 5C4XG 1VQAA 5M3FH 5IYBH 1QVFA 3F8TA 1IZ6A 1Q86C 3E0EA 2HIXA 1N34Q 5M3MG 4HJ8A 1PV4A 1SLJA 1VQFA 2DUDA 2NVXH 3TRZA 4LFCQ 1P8LA 1LM0A 1VQMA 1KXLA 4DK3C 1T9HA 4OXPA 3TREA 1SE8A 1B7YB 3CPFA 3SGIA 3CCQA 1CSQA 2OQKA 1FJGQ 1XNRQ 2VL6A 1E3PA 1FJGL 4K0KL 4IFDJ 4A3EG 1OXSC 1HR0L 2A8VA 1G6PA 1J6QA 4PZ7A 2FXQA 1A8VA 2JA5H 3OTOQ 4MZ9A 4LF9Q 1N8RC 4LF9L 3UDFA 4OX9Q 3G48A 2R7ZH 5IP9G 4OX9L 1NMFA 1GKHA 4KLKA 4YCWA 3FP9A 3WWVA 5HY6A 4X62L 1EQQA 4IJLA 1J5EQ 2JA8H 4B3ML 3CXCA 1W3SA 4A3GH 2Z0SA 3K81C 3A5ZB 1LYLA 3F2CA 1XJVA 2N3SA 4BBSG 1SFOH 2CCZA 1JJ2A 3T1HQ 2WAQG 3KDFA 4NXNQ 1XPOA 1I3QH 4BXXH 1YI2A 1EIFA 5LMUL 3A5UA 2CQOA 4BA1I 1KC8C 4JCVE 3ULLA 3HOWH 4LFAL 1PH1A 3HOUG 2NVQH 3GD7A 3AFPA 1VQDA 3PF5A 1VQKA 2YTXA 1X54A 1QZGA 4OO1I 3G71A 4L5TA 4YY3Q 3F2BA 1ASZA 2UU9L 1Y1WH 2AKWB 2KHIA 1AE2A 2XGTA 3MXNB 2VUMH 4KI0A 3S15H 3K8AA 1YHQA 1C9OA 4GOPB 1VQBA 1VQJA 2NN6G 4QL5A 5FLMH 3RZOH 4HIKA 4P74A 4DR7L 4MNOA 1XMQQ 5IP7G 4HIDA 3I4MG 4NPSA 3U4ZA 4DV5Q 1XMQL 1JMCA 4DV5L 1S3OA 2PI2E 4B3SL 2JA7H 2BA1A 4BY1G 1L2FA 4KHZA 1PH3A 2CWPA 4A3DH 2RCNA 4DKAC 2R6GA 2F3IA 4A3KG 2E2HH 3S2DH 1YBYA 3JAMc 4Y52H 2YTVA 4X64L 1IBLQ 1N32Q 4GNXA 1WI5A 4X66Q 4X66L 5AJ3Q 4LF7L 2JJQA 4A3MH 3RZDH 2PMZE 2I0QA 1HZAA 4GOPC 4JBJA 4A3LG 1K8GA 2VQEL 4UP7A 3GDEA 1IBMQ 2YTYA 2LSSA 4LUOA 2R93H 1U0LA 5IYDH 1IBML 2ZJRA 4IFDG 2R7FA 4X65Q 1X3FA 2XTIA 4O0AA 2NN6I 4YCVA 4X65L 3CCJA 2E2IH 2NVTH 4IOAA 3S17H 3GTQH 4R4QA 4APVA 1XNQQ 2Z6KA 4DUYL 4L5SA 3UE1A 3ZJYC 1V1QA 3HOYH 3AYHB 4DV7Q 2OWOA 3BU2A 3W1GA 1M1KC 4XTCS 4P72A 3H0GG 1QUQB 3FHWA 2VQFL 2RF4A 3AQQA 1VCIA 3VDYA 3PF4A 2DGYA 3B6YA 1BBWA 3G4SA 4JI1Q 1VQPA 1VQ8A 4LW1A 1TWHH 3EBEA 1I5FA 1K73C 1G51A 1Q82C 4DV6L 3E9IA 3M9BA 4GN3B 4ALPA 2BH2A 3H15A 3PO3H 2MFIA 4TQUS 4GKKQ 4JV5Q 1R9TH 2ES2A 4JBKA 4GKKL 4JV5L 4LFBL 4LUZA 4DR5Q 1BKBA 4DR5L 4B3RQ 4H02A 3RR5A 3ULJA 3M85A 4IFDI 5IT9c 2ZJPA 4YHHQ 1XMOQ 3J80i 3S1MH 4LNQA 3AEVA 1VQ9A 1OXVA 1KL9A 4AQYQ 4DV4L 4DV1Q 4AQYL 1EYGA 5C3EG 4LF8L 4DV1L 1WYDA 1S40A 3F2DA 1Y14B 4DAYB 1YZ6A 2KENA 1TWGH 2LXJA 2YYZA 3PUWA 3S1QH 2K4KA 5M5YH 1PVOA 4GN5A 4GS3A 2ZM6Q 1QZHA 2PQAA 2ZM6L 1N33L 5M3FG 2WAQE 5IYBG 1ASYA 3J81c 4A3BH 4DR4L 4DR4Q 3CC7A 3HOXH 2OTLA 3HKSA 3NBHB 1EIYB 3UDIA 4HJ5A 4P75A 2Q2HA 3PIOA 1HNWQ 4JG2A 1HNWL 5GQOA 2WFWA 3S14H 1JJCB 1D7QA 3I4NH 3HOVG 4QJFA 2MNAA 3S1RH 2CKZB 3PIPA 4K0KQ 2D0OA 3DLLA 4R4IA 1HR0Q 4JI3L 4GOPA 3CPWA 5GAEC 2ALYB 2VY3A 3PV0A 2Q2IA 4BBRH 2UUAL 4A3JH 2NZHA 1OXTA 2N8NA 4UPAA 2JE6I 4GLVB 4L5RC 1E24A 4C3JH 1LTLA 2B3GA 4YCUA 3TQYA 2QA4A 3A0JA 2ID0A 1L1OB 4MTNA 2JA5G 3CAMA 4A3LH 2UXCL 3KOJA 1X65A 1HNXQ 1QVCA 2K75A 2K50A 2E8GA 5C0XJ 3W1BA 4X62Q 1HNXL 1JB7A 2R7ZG 2KHJA 1IL2A 1K3RA 3PGZA 1TWCH 3PUXA 4LF6L 1VQHA 2R92H 3PCOB 5HGQA 4B3MQ 2F52A 4C2MH 4IJHA 4DR2L 3H3VI 2JA8G 2R7DA 3L0OA 3EIVA 5FJ8H 3GTGH 1C0AA 4DV0L 3PO2H 1E1OA 1NMGA 1HR0W 3L2PA 2JEAI 4QQBX 1KQSA 4A93H 4KHPQ 5K36G 4A3GG 4IPHA 4KHPL 1PYBA 3J81j 5LMUQ 4A75A 3CCLA 4X6AH 4JBWA 3CF5A 1MJCA 1A62A 4LFAQ 4LF4L 4BXXG 5BR8L 2VZAA 2CFMA 4NXML 1K8AC 4DR1L 2BH8A 5ELNA 3T1YL 1L1OC 1NE3A 2ATWA 4P71A 3HOWG 2UXDL 3BJUA 2UU9Q 1MIUA 4JI2L 1B8AA 2HHHL 1VQGA 1YHBA 5J3BA 1UE6A 5IYCG 4LUVA 2I5MX 4LF5L 3GTJH 2IT1A 5IWAL 1QUQA 1Q7YC 3STBC 2VUMG 1D8LA 2PI2A 3CCMA 4HJAA 1VQ5A 2UUBL 2IX0A 4DR7Q 3LGJA 2QEXA 5FLMG 4JOIC 3S24A 4POGA 1HNZL 1I6HH 2IHEA 5M5WH 1KIXA 4B3SQ 1K0RA 1PH5A 4DNIA 4JI4L 4JI0Q 2EIFA 1NBWA 2IHFA 2AHOB 4JI0L 3HOZH 1X56A 4TVAB 1WCMH 2N78A 4IPGA 5JEAJ 1VQ7A 3F1ZA 1A0IA 1YITA 1MJEA 2JA7G 3GTKH 4JYAL 4X64Q 1N36L 3ICEA 2MQHA 4A3DG 4A3CH 1TWFH 1BBUA 1OXUA 4DV2Q 1S72A 3Q8DA 4DV2L 4LF7Q 1GO3E 3ULPA 4QIWE 3M4OH 4B3TL 2PNHA 3K7AH 4FDBA 1WJJA 2VQEQ 1YJWA 1XPUA 4P73A 1AE3A 3S2HH 2D62A 3HFZB 3K7UC 4R4TA 1NJIC 4A3MG 1I94Q 3JC66 3TS2A 4JI6Q 3PUYA 4R4OA 4JI6L 1YHAA 1KRTA 3CCRA 4A3IG 5IYDG 2R93G 3KF6B 4DUYQ 3RNUA 3CW2C 1EUJA 4PMWA 1BVSA 1CKNB 3A74A 2E5LL 1CSPA 2CWAA 5C0XG 2Q2TA 5DLQE 1YVCA 2H5XA 3FKIH 2VQFQ 3HOYG 5IY0A 4DR3Q 3CD6A 2BA0A 5IE8A 4JI5L 4BA2I 2UUCL 4DR3L 3PUZA 4GKJL 2GN5A 5LMNL 5C44H 4DV6Q 3J7ZC 4JI7L 4HJ9A 1N32L 1MKHA 3KF8B 4LFBQ 2WB1G 4BY7H 3RN2A 4DR6L 3PO3G 4J15A 2NZOA 4WJ4A 3I7FA 2JA6H 1IBKL 2HT1A 1L1OA 1FGUA 3CMAA 3RN5A 1WOCA 1W2BA 1HH2P 3NELA 1PH2A 4YWKA 2YU9H 1VQIA 1FVIA 4NB3A 1UEBA 4AH6A 2B63G 4DV4Q 2B29A 1P16A 2IY5B 5FLXc 3CCSA 4LF8Q 1WFQA 1E7ZA 3L7ZC 4UP9A 5C0XI 2JEBI 2K5VA 3GO5A 3STBD 2K14A 3UDXA 1CUKA 3KJPA 4DV3Q 4GLXA 3S16H 2OQ0A 4JOIA 4DV3L 3J81i 1N33Q 1GVPA 4RMFA 1HZCA 4EQ5A 1U5KA 1EFWA 4A3BG 1Y1VH 2A1AA 3I2ZA 1Q12A 1UWVA 3CMEA 3HOXG 1YJ9A 4DPGA 4GNXB 1O7IA 3GTLH 5JEAG 3NENA 4A3FH 1UE7A 2D0PA 1XTDA 3OW2A 3GTPH 5C3EH 3J80c 1IXRA 3UE0A 1KRSA 1JJGA 4HIOA 2KBNA 2K5HA 4JI3Q 5C4XH 2I5LX 2VW9A 2UUAQ 3I4NG 4AYBG 1AH9A 1YNXA 2ZJQA 2JK8A 4PZ8A 1VQEA 3M4PA 1X9NA 5M3MH 3H3VH 4BBRG 2UXCQ 1HJPA 4A3JG 2LXKA 2VNUD 5JJIA 4C3IH 1VQ6A 1N34L 1UE5A 3CCEA 4DK6C 1Q81C 4GLAC 4LF6Q 1X6OA 4DR2Q 1C7YA 2JA9A 4LFCL 4GNXC 2IX1A 3HOVH 4DUZQ 4OONA 1Q1BA 4DAMA 2R92G 4YWMA 4DUZL 4DV0Q 1Z9FA 4A3EH 4QGUA 3PUVA 5GROA 2Q2UA 3S1NH 5FJ8G 3I55A 1XNRL 3UDGA 3PO2G 5GAHC 4A93G 4PZ6A 4OO1G 3PSIA 4LF4Q 4OWTB 1GD7A 5BR8Q 4RG1A 5IP9H 3OYYA 1X3EA 3OTOL 4DR1Q 3ER0A 3T1YQ 4NXMQ 2UXDQ 2KCTA 1CKMA 2AWOA 2Z6KC 4AIMA 3KF6A 4QY7A 4JI2Q 2HHHQ 2Y0SG 3E9HA 1E22A 1M90C 3BZKA 1YEZA 2NVYH 4O2DA 3U50C 5M5XH 1XPRA 4JBMA 4YWLA 2ASBA 1CKNA 3RLNA 3RLOA 3KJOA 1J5EL 4LF5Q 1RIPA 1G291 4A4IA 1HZBA 5IWAQ 3CC2A 4BBSH 1Y1WG 2OTJA 3EN2A 3I4OA 3K80C 2A19A 4L5QA 1PH9A 3CQZH 2UUBQ 4EX5A 1OXXK 5JJKA 4IOCA 1SR3A 3T1HL 4IPDA 1SROA 4NXNL 1PH7A 1HNZQ 1RL2A 5GADC 2GVAA 3CCUA 2PQAB 2VS1A 2AWNA 3HOUH 4HIMA 4JI4Q 2MO0A 3D31A 1H95A 1V43A 2K52A 1YIJA 3JAMi 4IO9A 4JYAQ 3BZCA 3TEHB 1X55A 3DM3A 2WB1E 5IYCH 1VQ4A 1N36Q 4UY8C 3HOZG 4YY3L 1WCMG 2L15A 4R4CA 2ZTCA 4OWWB 5GAGC 3D0FA 1PYSB 4A76A 1YJNA 3GTOH 4A3CG 4B3TQ 1GM5A 1Q8KA 2HIVA 5IP7H 1PH4A 3I4MH 3M4QA 1VQNA 3CCVA 2KCMA 1VQOA 4WJ3M 3IRBA 1UE1A 1L0WA 1EWIA 4HJ7A 1X3GA 1PH8A 4BY1H 1IYJB 3MEFA 3W5OA 4A3KH 4XIGS 2AMCB 1QVGA 2E5LQ 2F4VQ 1HZ9A 2F4VL 1PH6A 1CKOA 1JE5A 4JI5Q 2HQLA 1IBLL 2UUCQ 1OTCA 1KHIA 1NY4A 3J7A5 3M3YH 1E1TA 2I5HA 4LWCA 3FKIG 4GKJQ 1TWAH 3HKZE 5LMNQ 1SMXA 1N9WA 2EXDA 2QGQA 3KDFB 4PG3A 5AJ3L 1I94L 2V1CC 5C4JH 3G6EA 3U58A 1LUZA 1PA6A 1V9PA 4JI7Q 4C3HH 3I56A 4A3IH 5C44G 2C35B 5ELOA 3AFQA 3ERSX 4UP8A 1Q46A 4DR6Q 2YV5A 2RHQB 4IPCA 3KFUA 1A63A 4AYBE 1IBKQ 1Z47A 3CP0A 1NTGA 1K83H 4BY7G 1VQCA 4R1JA 1XNQL 1DGSA 3H0GH 2JA6G 2MO1A 2E2JH 4ME3A 4GN4B 4DV7L 1K9MC 1KAWA 2GVBA 2JQOA 5EAYA 5LMNW 2EQSA 2K5NA 1EOVA 3TS0A 1SN8A 4JI1L 2OCEA 1EQRA 3RLFA 3NEMA 4POFA 3CC4A 3U4VA 2RHSB 3GTMH 1Q1EA 3KYHC 4JC0A 2ZTDA 3M7NA 1FL0A 5E7NA 1VS0A 2N49A 1KD1C 1JT8A 5H1SE 2ZTEA 4B3RL 1VQLA 3HKZG 1B70B 3KLWA 3K0XA 2B63H 1PHJA 2UXBQ 1Y1VG 4YHHL 1XMOL 1PFSA 2UXBL 5JJLA 4JI8Q 4A3FG 2Y0SE 1TXYA 4JI8L 4OWXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SRU A;  2WP8 J;  1I50 H;  4Y7N H;  5C4X G;  1VQA A;  5M3F H;  5IYB H;  1QVF A;  3F8T A;  1IZ6 A;  1Q86 C;  3E0E A;  2HIX A;  1N34 Q;  5M3M G;  4HJ8 A;  1PV4 A;  1SLJ A;  1VQF A;  2DUD A;  2NVX H;  3TRZ A;  4LFC Q;  1P8L A;  1LM0 A;  1VQM A;  1KXL A;  4DK3 C;  1T9H A;  4OXP A;  3TRE A;  1SE8 A;  1B7Y B;  3CPF A;  3SGI A;  3CCQ A;  1CSQ A;  2OQK A;  1FJG Q;  1XNR Q;  2VL6 A;  1E3P A;  1FJG L;  4K0K L;  4IFD J;  4A3E G;  1OXS C;  1HR0 L;  2A8V A;  1G6P A;  1J6Q A;  4PZ7 A;  2FXQ A;  1A8V A;  2JA5 H;  3OTO Q;  4MZ9 A;  4LF9 Q;  1N8R C;  4LF9 L;  3UDF A;  4OX9 Q;  3G48 A;  2R7Z H;  5IP9 G;  4OX9 L;  1NMF A;  1GKH A;  4KLK A;  4YCW A;  3FP9 A;  3WWV A;  5HY6 A;  4X62 L;  1EQQ A;  4IJL A;  1J5E Q;  2JA8 H;  4B3M L;  3CXC A;  1W3S A;  4A3G H;  2Z0S A;  3K81 C;  3A5Z B;  1LYL A;  3F2C A;  1XJV A;  2N3S A;  4BBS G;  1SFO H;  2CCZ A;  1JJ2 A;  3T1H Q;  2WAQ G;  3KDF A;  4NXN Q;  1XPO A;  1I3Q H;  4BXX H;  1YI2 A;  1EIF A;  5LMU L;  3A5U A;  2CQO A;  4BA1 I;  1KC8 C;  4JCV E;  3ULL A;  3HOW H;  4LFA L;  1PH1 A;  3HOU G;  2NVQ H;  3GD7 A;  3AFP A;  1VQD A;  3PF5 A;  1VQK A;  2YTX A;  1X54 A;  1QZG A;  4OO1 I;  3G71 A;  4L5T A;  4YY3 Q;  3F2B A;  1ASZ A;  2UU9 L;  1Y1W H;  2AKW B;  2KHI A;  1AE2 A;  2XGT A;  3MXN B;  2VUM H;  4KI0 A;  3S15 H;  3K8A A;  1YHQ A;  1C9O A;  4GOP B;  1VQB A;  1VQJ A;  2NN6 G;  4QL5 A;  5FLM H;  3RZO H;  4HIK A;  4P74 A;  4DR7 L;  4MNO A;  1XMQ Q;  5IP7 G;  4HID A;  3I4M G;  4NPS A;  3U4Z A;  4DV5 Q;  1XMQ L;  1JMC A;  4DV5 L;  1S3O A;  2PI2 E;  4B3S L;  2JA7 H;  2BA1 A;  4BY1 G;  1L2F A;  4KHZ A;  1PH3 A;  2CWP A;  4A3D H;  2RCN A;  4DKA C;  2R6G A;  2F3I A;  4A3K G;  2E2H H;  3S2D H;  1YBY A;  3JAM c;  4Y52 H;  2YTV A;  4X64 L;  1IBL Q;  1N32 Q;  4GNX A;  1WI5 A;  4X66 Q;  4X66 L;  5AJ3 Q;  4LF7 L;  2JJQ A;  4A3M H;  3RZD H;  2PMZ E;  2I0Q A;  1HZA A;  4GOP C;  4JBJ A;  4A3L G;  1K8G A;  2VQE L;  4UP7 A;  3GDE A;  1IBM Q;  2YTY A;  2LSS A;  4LUO A;  2R93 H;  1U0L A;  5IYD H;  1IBM L;  2ZJR A;  4IFD G;  2R7F A;  4X65 Q;  1X3F A;  2XTI A;  4O0A A;  2NN6 I;  4YCV A;  4X65 L;  3CCJ A;  2E2I H;  2NVT H;  4IOA A;  3S17 H;  3GTQ H;  4R4Q A;  4APV A;  1XNQ Q;  2Z6K A;  4DUY L;  4L5S A;  3UE1 A;  3ZJY C;  1V1Q A;  3HOY H;  3AYH B;  4DV7 Q;  2OWO A;  3BU2 A;  3W1G A;  1M1K C;  4XTC S;  4P72 A;  3H0G G;  1QUQ B;  3FHW A;  2VQF L;  2RF4 A;  3AQQ A;  1VCI A;  3VDY A;  3PF4 A;  2DGY A;  3B6Y A;  1BBW A;  3G4S A;  4JI1 Q;  1VQP A;  1VQ8 A;  4LW1 A;  1TWH H;  3EBE A;  1I5F A;  1K73 C;  1G51 A;  1Q82 C;  4DV6 L;  3E9I A;  3M9B A;  4GN3 B;  4ALP A;  2BH2 A;  3H15 A;  3PO3 H;  2MFI A;  4TQU S;  4GKK Q;  4JV5 Q;  1R9T H;  2ES2 A;  4JBK A;  4GKK L;  4JV5 L;  4LFB L;  4LUZ A;  4DR5 Q;  1BKB A;  4DR5 L;  4B3R Q;  4H02 A;  3RR5 A;  3ULJ A;  3M85 A;  4IFD I;  5IT9 c;  2ZJP A;  4YHH Q;  1XMO Q;  3J80 i;  3S1M H;  4LNQ A;  3AEV A;  1VQ9 A;  1OXV A;  1KL9 A;  4AQY Q;  4DV4 L;  4DV1 Q;  4AQY L;  1EYG A;  5C3E G;  4LF8 L;  4DV1 L;  1WYD A;  1S40 A;  3F2D A;  1Y14 B;  4DAY B;  1YZ6 A;  2KEN A;  1TWG H;  2LXJ A;  2YYZ A;  3PUW A;  3S1Q H;  2K4K A;  5M5Y H;  1PVO A;  4GN5 A;  4GS3 A;  2ZM6 Q;  1QZH A;  2PQA A;  2ZM6 L;  1N33 L;  5M3F G;  2WAQ E;  5IYB G;  1ASY A;  3J81 c;  4A3B H;  4DR4 L;  4DR4 Q;  3CC7 A;  3HOX H;  2OTL A;  3HKS A;  3NBH B;  1EIY B;  3UDI A;  4HJ5 A;  4P75 A;  2Q2H A;  3PIO A;  1HNW Q;  4JG2 A;  1HNW L;  5GQO A;  2WFW A;  3S14 H;  1JJC B;  1D7Q A;  3I4N H;  3HOV G;  4QJF A;  2MNA A;  3S1R H;  2CKZ B;  3PIP A;  4K0K Q;  2D0O A;  3DLL A;  4R4I A;  1HR0 Q;  4JI3 L;  4GOP A;  3CPW A;  5GAE C;  2ALY B;  2VY3 A;  3PV0 A;  2Q2I A;  4BBR H;  2UUA L;  4A3J H;  2NZH A;  1OXT A;  2N8N A;  4UPA A;  2JE6 I;  4GLV B;  4L5R C;  1E24 A;  4C3J H;  1LTL A;  2B3G A;  4YCU A;  3TQY A;  2QA4 A;  3A0J A;  2ID0 A;  1L1O B;  4MTN A;  2JA5 G;  3CAM A;  4A3L H;  2UXC L;  3KOJ A;  1X65 A;  1HNX Q;  1QVC A;  2K75 A;  2K50 A;  2E8G A;  5C0X J;  3W1B A;  4X62 Q;  1HNX L;  1JB7 A;  2R7Z G;  2KHJ A;  1IL2 A;  1K3R A;  3PGZ A;  1TWC H;  3PUX A;  4LF6 L;  1VQH A;  2R92 H;  3PCO B;  5HGQ A;  4B3M Q;  2F52 A;  4C2M H;  4IJH A;  4DR2 L;  3H3V I;  2JA8 G;  2R7D A;  3L0O A;  3EIV A;  5FJ8 H;  3GTG H;  1C0A A;  4DV0 L;  3PO2 H;  1E1O A;  1NMG A;  1HR0 W;  3L2P A;  2JEA I;  4QQB X;  1KQS A;  4A93 H;  4KHP Q;  5K36 G;  4A3G G;  4IPH A;  4KHP L;  1PYB A;  3J81 j;  5LMU Q;  4A75 A;  3CCL A;  4X6A H;  4JBW A;  3CF5 A;  1MJC A;  1A62 A;  4LFA Q;  4LF4 L;  4BXX G;  5BR8 L;  2VZA A;  2CFM A;  4NXM L;  1K8A C;  4DR1 L;  2BH8 A;  5ELN A;  3T1Y L;  1L1O C;  1NE3 A;  2ATW A;  4P71 A;  3HOW G;  2UXD L;  3BJU A;  2UU9 Q;  1MIU A;  4JI2 L;  1B8A A;  2HHH L;  1VQG A;  1YHB A;  5J3B A;  1UE6 A;  5IYC G;  4LUV A;  2I5M X;  4LF5 L;  3GTJ H;  2IT1 A;  5IWA L;  1QUQ A;  1Q7Y C;  3STB C;  2VUM G;  1D8L A;  2PI2 A;  3CCM A;  4HJA A;  1VQ5 A;  2UUB L;  2IX0 A;  4DR7 Q;  3LGJ A;  2QEX A;  5FLM G;  4JOI C;  3S24 A;  4POG A;  1HNZ L;  1I6H H;  2IHE A;  5M5W H;  1KIX A;  4B3S Q;  1K0R A;  1PH5 A;  4DNI A;  4JI4 L;  4JI0 Q;  2EIF A;  1NBW A;  2IHF A;  2AHO B;  4JI0 L;  3HOZ H;  1X56 A;  4TVA B;  1WCM H;  2N78 A;  4IPG A;  5JEA J;  1VQ7 A;  3F1Z A;  1A0I A;  1YIT A;  1MJE A;  2JA7 G;  3GTK H;  4JYA L;  4X64 Q;  1N36 L;  3ICE A;  2MQH A;  4A3D G;  4A3C H;  1TWF H;  1BBU A;  1OXU A;  4DV2 Q;  1S72 A;  3Q8D A;  4DV2 L;  4LF7 Q;  1GO3 E;  3ULP A;  4QIW E;  3M4O H;  4B3T L;  2PNH A;  3K7A H;  4FDB A;  1WJJ A;  2VQE Q;  1YJW A;  1XPU A;  4P73 A;  1AE3 A;  3S2H H;  2D62 A;  3HFZ B;  3K7U C;  4R4T A;  1NJI C;  4A3M G;  1I94 Q;  3JC6 6;  3TS2 A;  4JI6 Q;  3PUY A;  4R4O A;  4JI6 L;  1YHA A;  1KRT A;  3CCR A;  4A3I G;  5IYD G;  2R93 G;  3KF6 B;  4DUY Q;  3RNU A;  3CW2 C;  1EUJ A;  4PMW A;  1BVS A;  1CKN B;  3A74 A;  2E5L L;  1CSP A;  2CWA A;  5C0X G;  2Q2T A;  5DLQ E;  1YVC A;  2H5X A;  3FKI H;  2VQF Q;  3HOY G;  5IY0 A;  4DR3 Q;  3CD6 A;  2BA0 A;  5IE8 A;  4JI5 L;  4BA2 I;  2UUC L;  4DR3 L;  3PUZ A;  4GKJ L;  2GN5 A;  5LMN L;  5C44 H;  4DV6 Q;  3J7Z C;  4JI7 L;  4HJ9 A;  1N32 L;  1MKH A;  3KF8 B;  4LFB Q;  2WB1 G;  4BY7 H;  3RN2 A;  4DR6 L;  3PO3 G;  4J15 A;  2NZO A;  4WJ4 A;  3I7F A;  2JA6 H;  1IBK L;  2HT1 A;  1L1O A;  1FGU A;  3CMA A;  3RN5 A;  1WOC A;  1W2B A;  1HH2 P;  3NEL A;  1PH2 A;  4YWK A;  2YU9 H;  1VQI A;  1FVI A;  4NB3 A;  1UEB A;  4AH6 A;  2B63 G;  4DV4 Q;  2B29 A;  1P16 A;  2IY5 B;  5FLX c;  3CCS A;  4LF8 Q;  1WFQ A;  1E7Z A;  3L7Z C;  4UP9 A;  5C0X I;  2JEB I;  2K5V A;  3GO5 A;  3STB D;  2K14 A;  3UDX A;  1CUK A;  3KJP A;  4DV3 Q;  4GLX A;  3S16 H;  2OQ0 A;  4JOI A;  4DV3 L;  3J81 i;  1N33 Q;  1GVP A;  4RMF A;  1HZC A;  4EQ5 A;  1U5K A;  1EFW A;  4A3B G;  1Y1V H;  2A1A A;  3I2Z A;  1Q12 A;  1UWV A;  3CME A;  3HOX G;  1YJ9 A;  4DPG A;  4GNX B;  1O7I A;  3GTL H;  5JEA G;  3NEN A;  4A3F H;  1UE7 A;  2D0P A;  1XTD A;  3OW2 A;  3GTP H;  5C3E H;  3J80 c;  1IXR A;  3UE0 A;  1KRS A;  1JJG A;  4HIO A;  2KBN A;  2K5H A;  4JI3 Q;  5C4X H;  2I5L X;  2VW9 A;  2UUA Q;  3I4N G;  4AYB G;  1AH9 A;  1YNX A;  2ZJQ A;  2JK8 A;  4PZ8 A;  1VQE A;  3M4P A;  1X9N A;  5M3M H;  3H3V H;  4BBR G;  2UXC Q;  1HJP A;  4A3J G;  2LXK A;  2VNU D;  5JJI A;  4C3I H;  1VQ6 A;  1N34 L;  1UE5 A;  3CCE A;  4DK6 C;  1Q81 C;  4GLA C;  4LF6 Q;  1X6O A;  4DR2 Q;  1C7Y A;  2JA9 A;  4LFC L;  4GNX C;  2IX1 A;  3HOV H;  4DUZ Q;  4OON A;  1Q1B A;  4DAM A;  2R92 G;  4YWM A;  4DUZ L;  4DV0 Q;  1Z9F A;  4A3E H;  4QGU A;  3PUV A;  5GRO A;  2Q2U A;  3S1N H;  5FJ8 G;  3I55 A;  1XNR L;  3UDG A;  3PO2 G;  5GAH C;  4A93 G;  4PZ6 A;  4OO1 G;  3PSI A;  4LF4 Q;  4OWT B;  1GD7 A;  5BR8 Q;  4RG1 A;  5IP9 H;  3OYY A;  1X3E A;  3OTO L;  4DR1 Q;  3ER0 A;  3T1Y Q;  4NXM Q;  2UXD Q;  2KCT A;  1CKM A;  2AWO A;  2Z6K C;  4AIM A;  3KF6 A;  4QY7 A;  4JI2 Q;  2HHH Q;  2Y0S G;  3E9H A;  1E22 A;  1M90 C;  3BZK A;  1YEZ A;  2NVY H;  4O2D A;  3U50 C;  5M5X H;  1XPR A;  4JBM A;  4YWL A;  2ASB A;  1CKN A;  3RLN A;  3RLO A;  3KJO A;  1J5E L;  4LF5 Q;  1RIP A;  1G29 1;  4A4I A;  1HZB A;  5IWA Q;  3CC2 A;  4BBS H;  1Y1W G;  2OTJ A;  3EN2 A;  3I4O A;  3K80 C;  2A19 A;  4L5Q A;  1PH9 A;  3CQZ H;  2UUB Q;  4EX5 A;  1OXX K;  5JJK A;  4IOC A;  1SR3 A;  3T1H L;  4IPD A;  1SRO A;  4NXN L;  1PH7 A;  1HNZ Q;  1RL2 A;  5GAD C;  2GVA A;  3CCU A;  2PQA B;  2VS1 A;  2AWN A;  3HOU H;  4HIM A;  4JI4 Q;  2MO0 A;  3D31 A;  1H95 A;  1V43 A;  2K52 A;  1YIJ A;  3JAM i;  4IO9 A;  4JYA Q;  3BZC A;  3TEH B;  1X55 A;  3DM3 A;  2WB1 E;  5IYC H;  1VQ4 A;  1N36 Q;  4UY8 C;  3HOZ G;  4YY3 L;  1WCM G;  2L15 A;  4R4C A;  2ZTC A;  4OWW B;  5GAG C;  3D0F A;  1PYS B;  4A76 A;  1YJN A;  3GTO H;  4A3C G;  4B3T Q;  1GM5 A;  1Q8K A;  2HIV A;  5IP7 H;  1PH4 A;  3I4M H;  3M4Q A;  1VQN A;  3CCV A;  2KCM A;  1VQO A;  4WJ3 M;  3IRB A;  1UE1 A;  1L0W A;  1EWI A;  4HJ7 A;  1X3G A;  1PH8 A;  4BY1 H;  1IYJ B;  3MEF A;  3W5O A;  4A3K H;  4XIG S;  2AMC B;  1QVG A;  2E5L Q;  2F4V Q;  1HZ9 A;  2F4V L;  1PH6 A;  1CKO A;  1JE5 A;  4JI5 Q;  2HQL A;  1IBL L;  2UUC Q;  1OTC A;  1KHI A;  1NY4 A;  3J7A 5;  3M3Y H;  1E1T A;  2I5H A;  4LWC A;  3FKI G;  4GKJ Q;  1TWA H;  3HKZ E;  5LMN Q;  1SMX A;  1N9W A;  2EXD A;  2QGQ A;  3KDF B;  4PG3 A;  5AJ3 L;  1I94 L;  2V1C C;  5C4J H;  3G6E A;  3U58 A;  1LUZ A;  1PA6 A;  1V9P A;  4JI7 Q;  4C3H H;  3I56 A;  4A3I H;  5C44 G;  2C35 B;  5ELO A;  3AFQ A;  3ERS X;  4UP8 A;  1Q46 A;  4DR6 Q;  2YV5 A;  2RHQ B;  4IPC A;  3KFU A;  1A63 A;  4AYB E;  1IBK Q;  1Z47 A;  3CP0 A;  1NTG A;  1K83 H;  4BY7 G;  1VQC A;  4R1J A;  1XNQ L;  1DGS A;  3H0G H;  2JA6 G;  2MO1 A;  2E2J H;  4ME3 A;  4GN4 B;  4DV7 L;  1K9M C;  1KAW A;  2GVB A;  2JQO A;  5EAY A;  5LMN W;  2EQS A;  2K5N A;  1EOV A;  3TS0 A;  1SN8 A;  4JI1 L;  2OCE A;  1EQR A;  3RLF A;  3NEM A;  4POF A;  3CC4 A;  3U4V A;  2RHS B;  3GTM H;  1Q1E A;  3KYH C;  4JC0 A;  2ZTD A;  3M7N A;  1FL0 A;  5E7N A;  1VS0 A;  2N49 A;  1KD1 C;  1JT8 A;  5H1S E;  2ZTE A;  4B3R L;  1VQL A;  3HKZ G;  1B70 B;  3KLW A;  3K0X A;  2B63 H;  1PHJ A;  2UXB Q;  1Y1V G;  4YHH L;  1XMO L;  1PFS A;  2UXB L;  5JJL A;  4JI8 Q;  4A3F G;  2Y0S E;  1TXY A;  4JI8 L;  4OWX B; 
#chains in the Genus database with same CATH topology
 5KYI A;  2K1B A;  3BZD B;  3SK8 A;  4Y7N H;  4KKU A;  1VQA A;  1Q86 C;  3BDO A;  1N34 Q;  4KY7 A;  4C3I B;  2F0W A;  5M3M G;  4XQN A;  1DJR D;  1U9R A;  1WTH A;  1M4V A;  1PV4 A;  2NVX H;  2R92 B;  3IAY A;  3Q22 A;  1SYD A;  1JOK A;  4DK3 C;  1SBB B;  1CSQ A;  2F0G A;  4B08 A;  4K0K L;  1ENF A;  2DY7 A;  4PZ7 A;  1U4M A;  4F87 A;  2K04 A;  2B2V C;  1N8R C;  4LF9 L;  5FLX L;  3SEB A;  2R7Z H;  1NMF A;  3NQT A;  1ML0 D;  3FP9 A;  4X62 L;  5HY6 A;  1LT5 D;  3CXC A;  1W3S A;  4G7O C;  1XX8 A;  1MI2 A;  1XJV A;  4BBS G;  1SFO H;  2RDG A;  2CCZ A;  3MXP A;  1I3Q H;  2EJG C;  4DA2 A;  4BXX H;  1EIF A;  5KNB A;  2CQO A;  1KC8 C;  3HOW H;  4DK1 A;  2PYK A;  2DNC A;  3GD7 A;  1AZP A;  3AFP A;  1IW7 C;  1X54 A;  2Z1C A;  1QZG A;  4RWS C;  2UU9 L;  4UAI A;  3MXN B;  2A69 D;  3S15 H;  4HAE A;  2XVS A;  4RCO A;  1KDA A;  3VA5 A;  1HQM C;  5IP7 G;  4NPS A;  1HA6 A;  3U4Z A;  1JMC A;  2KCN A;  1S3O A;  4BY1 B;  4I7A A;  2BA1 A;  3TBI B;  4KHZ A;  3S2D H;  1SSO A;  4A3K G;  2E2H H;  1O7Z A;  1YBY A;  1EFI D;  1N32 Q;  1IBL Q;  3QOJ A;  2PNR C;  1I4H A;  4X66 Q;  3MXU A;  5DM7 3;  2KEC A;  3CHB D;  1JOR A;  5BN5 A;  4KMU C;  1K8G A;  2VQE L;  4G7H C;  4A3L G;  5ELC A;  5IYD H;  4DAP A;  2SDF A;  3CCJ A;  4X65 L;  2NVT H;  1K83 B;  1KNA A;  2A6H D;  4L5S A;  1QNU A;  2IWH A;  3I70 A;  3K6O A;  1G91 A;  2O2L D;  3BU2 A;  2HDM A;  4FF4 A;  1QUQ B;  3FHW A;  2RF4 A;  3AQQ A;  3U9O A;  1SDF A;  1VQP A;  2CH4 A;  3KK7 A;  1VQ8 A;  1I5F A;  4EQP A;  1G51 A;  1LT3 D;  3P1H A;  2EY2 A;  4BS9 A;  3H15 A;  2MFI A;  4GKK Q;  1TY2 A;  3DEO A;  1R9T H;  3TN2 A;  2ES2 A;  4JV5 L;  2AUK A;  2NYZ D;  4LFB L;  3RMH A;  4QIW B;  1Y69 U;  2G9D A;  2TMP A;  3BVM A;  3M85 A;  1VF7 A;  3I72 A;  5IT9 c;  3V96 A;  5IGE A;  4PNY A;  3R3O A;  4KY6 A;  2MJ8 A;  4O42 A;  2EJM A;  1LAB A;  4DV1 L;  1WYD A;  3F2D A;  1YZ6 A;  1BOS A;  1TWG H;  2KEN A;  2LXJ A;  1H9R A;  2K4K A;  4KD4 A;  5M5Y H;  1B50 A;  4GN5 A;  4PV1 C;  1PFN A;  4GS3 A;  1GUG A;  1N33 L;  2ZM6 L;  1WTR A;  3MA2 B;  4DR4 L;  1BCP B;  3CC7 A;  1EIY B;  5C3W A;  4P75 A;  3X3M A;  3K59 A;  3PIO A;  1JWM D;  1HNW Q;  4J6H A;  1CA5 A;  5GQO A;  1D7Q A;  3I4N H;  3HOV G;  4A3E B;  3PIP A;  2D0O A;  2M9V A;  3DWQ A;  4R4I A;  2EDG A;  4GOP A;  1HR0 Q;  1DCZ A;  4DN4 M;  4L5R C;  1E24 A;  5CV4 A;  5CBA E;  4YCU A;  2BOS A;  2EYO A;  1EY7 A;  1L1O B;  4MTN A;  1X65 A;  5EKL A;  5C0X J;  2NVY B;  5M5X B;  1K3R A;  5HGQ A;  4IJH A;  5C6A A;  3H3V I;  2R7D A;  5FJ8 H;  4A3G B;  3PO2 H;  1E1O A;  1HR0 W;  3L2P A;  2L11 A;  4IPH A;  3KLS A;  3J81 j;  4IUR A;  4RA8 A;  5LMU Q;  3A55 A;  3CF5 A;  1MJC A;  1A62 A;  4DR1 L;  5ELN A;  3T1Y L;  1J9O A;  2NUC A;  1WTX A;  3NXW A;  4P71 A;  1NR4 A;  1MIU A;  4XDX A;  3OWE B;  4LUV A;  1R4Q B;  5IWA L;  1HUN A;  2I07 B;  3DEP A;  3RZO B;  3MFY A;  4L63 B;  1ET6 A;  4HJA A;  2UUB L;  2EJF C;  5FLM G;  3OIQ A;  3NTI A;  3S24 A;  1HNZ L;  4XQJ A;  2IHE A;  4B3S Q;  2SEB D;  1K0R A;  4JI0 Q;  2EIF A;  1JQY D;  4A3D B;  2N78 A;  1TS5 A;  1KLG D;  3F1Z A;  3MEH A;  3ICE A;  2QEJ C;  4XYQ A;  1BBU A;  4ZQ3 A;  1S72 A;  4LF7 Q;  3EA6 A;  3M4O H;  4H44 C;  3K7A H;  1XPU A;  1YNN C;  1AE3 A;  1EL0 A;  4A3I B;  1LT4 D;  3HP3 A;  2L55 A;  3RNU A;  1LTI D;  4ILW A;  4ZK9 B;  3HOY B;  1BCP D;  2E2J B;  2Q2T A;  1DM0 B;  3FKI H;  1O7Y A;  2G5D A;  2C9O A;  3N52 A;  5IY0 A;  1EQT A;  4DR3 L;  4UHV A;  1PRT B;  1ONL A;  3TP6 A;  5LMN L;  4GKJ L;  2WB1 B;  1UNS A;  4X3S A;  1MKH A;  3P75 A;  3QR8 A;  3PO3 B;  1F2Z A;  4U67 3;  2OF1 A;  1AN8 A;  4R9W A;  2NZO A;  3I7F A;  5I2X A;  1LTS D;  3I90 A;  2EYM A;  4LAA A;  2B63 B;  2K33 A;  3KLR A;  1TT2 A;  1EWC A;  3P20 A;  4RKB A;  1IHZ A;  5FLX c;  3CCS A;  4LF8 Q;  1K28 A;  2JEB I;  3GO5 A;  2K14 A;  3S1Q B;  3KJP A;  2OQ0 A;  2RDF A;  4RMF A;  1S4Z A;  5J39 A;  2CW0 C;  2L12 A;  2A1A A;  3H6M A;  1Q12 A;  1YJ9 A;  2NVX B;  1AP0 A;  3P7J A;  4CHT B;  1FR3 A;  3UE0 A;  5FO7 B;  3QG1 A;  4JI3 Q;  2I5L X;  4J8Q A;  2L4N A;  1AH9 A;  2ENB A;  3ITP A;  4BBR B;  1VQE A;  3M4P A;  3VYS A;  1BXT A;  2H4O A;  3H3V H;  5A2Q L;  5J1Z A;  4C3I H;  3QWN A;  2NZ1 D;  1N34 L;  2ICE C;  2XRS D;  5EQ0 A;  3CCE A;  1SYG A;  1LTG D;  4GLA C;  4LF6 Q;  3OHX C;  3HOV H;  4DUZ Q;  1SYC A;  4DF7 A;  4K5W A;  4YWM A;  1Z9F A;  4RH6 A;  1JCK B;  4QGU A;  5GRO A;  1D5Z C;  1SFO B;  2K28 A;  3I55 A;  1I3Q B;  5I4D A;  2B8F A;  3G6J B;  4A93 G;  5BR8 Q;  5IP9 H;  3HOW B;  3OSO A;  3OYY A;  2AWO A;  2WII B;  1STH A;  3K5O A;  1QWY A;  1EWH A;  3E9H A;  5DM6 3;  1A3U A;  1M90 C;  4O2D A;  1XPR A;  4CDD C;  1RIP A;  1G29 1;  4TKO B;  1G2S A;  5CGK A;  1OXX K;  4C1N I;  3W3A A;  1B9N A;  1PRT D;  4IPD A;  4XT1 B;  1PH7 A;  1RL2 A;  1I6H B;  2M00 A;  3OOC A;  4HIM A;  1HUM A;  3LWE A;  2O5J C;  2K52 A;  1YIJ A;  3TEH B;  3S2D B;  1RKN A;  1HFN A;  2E2H B;  2A5H A;  3HOZ G;  3F2U A;  5E1F A;  1WCM G;  2L15 A;  4R4C A;  4QMG A;  2DJG C;  4B3T Q;  1EYD A;  2QW7 A;  3CCV A;  5EKK A;  4WJ3 M;  4Z9C B;  2OT2 A;  1X3G A;  1PH8 A;  1SNC A;  4BY1 H;  1SNO A;  4CDC C;  1V1P A;  1RDP D;  3W5O A;  2LFN A;  5JAV A;  5KRU A;  1B4O A;  3FPP A;  2F4V Q;  1HZ9 A;  1XTC D;  4J1M A;  3NBH A;  4CJ1 B;  1BBX C;  1CKO A;  2F03 A;  4JI5 Q;  2HQL A;  3TP8 A;  1IBL L;  1OTC A;  1N32 L;  1NY4 A;  4G4K A;  3N6R A;  1SMX A;  4XQQ A;  3G6E A;  1LLR D;  4JI7 Q;  3A8I E;  3KBG A;  2B2Y C;  1F2M A;  1R9T B;  3HEJ A;  2RHQ B;  1TS2 A;  4AYB E;  1K83 H;  3T16 A;  1FNW A;  5EPL A;  2PW7 A;  1EQV A;  2JA6 G;  2F1M A;  2Z9H A;  2F0J A;  2EQS A;  4L6T B;  2K32 A;  1EQR A;  4ZKB B;  1SNM A;  5M5Y B;  3K58 A;  3CC4 A;  4RGT A;  1C48 A;  1G6Z A;  2RSN A;  1SAP A;  2E74 C;  2KA7 A;  1Y8N B;  2B2T C;  1FNU A;  3K5M A;  1Y1V B;  1BUV T;  3HKZ G;  1B70 B;  3GTP B;  5I6W A;  1DOL A;  2UXB L;  5JJL A;  3LNN A;  2D5D A;  2IL8 A;  4G7Z C;  2FFK B;  1S5D D;  1CHP D;  5D3D A;  1YNN D;  3TP7 A;  1EIG A;  5IYB H;  5M3F H;  5M3M B;  2KEE A;  2GA4 B;  4NKL A;  1TS3 A;  1O78 A;  4K2K A;  4F88 A;  1D5X C;  1VQF A;  4FF2 A;  4KD3 A;  1FYC A;  4QUF A;  1K3B C;  1T9H A;  3TRE A;  3R93 A;  1A2U A;  1SE8 A;  1U4P A;  4X3K A;  3PO2 B;  2RDH A;  1FJG Q;  1XNR Q;  1HR0 L;  1I6V C;  3NSW A;  1EZ6 A;  3DXJ C;  3OTO Q;  3BYY B;  1ROD A;  1HPC A;  4OX9 Q;  1WVL A;  1WTQ A;  2LY7 A;  2Q8T A;  2F3W A;  3FMC A;  4YCW A;  1EQQ A;  1J5E Q;  1MBY A;  4IJL A;  1TII D;  3SK4 A;  4TRD A;  1CQF A;  1F77 A;  3OMG A;  5BN3 A;  4A3G H;  3T1H Q;  4NXN Q;  1RTO A;  5LMU L;  2N55 A;  4JCV E;  2L5T A;  2CH4 W;  3J80 L;  1I4P A;  4RGN A;  2O4X A;  5CR3 A;  5ELE A;  1EY6 A;  2AUJ D;  2YTX A;  2K01 A;  4DNR B;  1VQK A;  5IIF A;  3X3N A;  4L5T A;  4YY3 Q;  3F2B A;  1ICF B;  2Z4I A;  1MGS A;  4KI0 A;  2J4X A;  1C9O A;  3K7A B;  3RZO H;  1JR0 D;  1VQJ A;  2KUM A;  3G7L A;  1UUP A;  1ZEQ X;  3I4M G;  2B2U C;  2QKI C;  4PQX A;  4CKE A;  1XMQ L;  3KUP A;  4IUV A;  5I9O A;  4DV5 L;  2A6E C;  3V05 A;  5NUC A;  2PI2 E;  4B3S L;  4A3K B;  4FXG C;  4A3D H;  4K8I A;  2CWP A;  3VYT A;  1M8A A;  3I4L A;  1E2Z A;  4R8N A;  2YTV A;  4GNX A;  3GV6 A;  5AJ3 Q;  4LF7 L;  4A3M H;  2PMZ E;  4OGQ C;  5C4J B;  4JBJ A;  4CGY B;  4JW0 A;  1CTM A;  4S3S A;  1IBM Q;  5IGF A;  2YTY A;  2LSS A;  1X3F A;  2B2V A;  2XTI A;  4O0A A;  4IOA A;  3D8G A;  2E2I H;  1VDZ A;  3GTQ H;  4R4Q A;  2RVL A;  3UE1 A;  1W6K A;  1D6E C;  3TME A;  3ZJY C;  4HCS A;  3HOY H;  4DV7 Q;  2OWO A;  1M1K C;  3H0G G;  5LL6 S;  1VCI A;  3B6Y A;  4U68 A;  5IT9 E;  3EBE A;  4IAL A;  1DYQ A;  4ALP A;  3PO3 H;  2AQ3 B;  4TQU S;  4ZKC B;  1WD0 A;  3URY A;  4LUZ A;  1AZQ A;  1BKB A;  2FIN B;  4DR5 L;  4KY5 A;  2PMZ B;  4B3R Q;  1PXU A;  1B53 A;  1AFP A;  1XWE A;  4YHH Q;  1XMO Q;  3J80 i;  1VQ9 A;  1OXV A;  4LJZ C;  4AQY L;  1EYG A;  5C3E G;  4LF8 L;  3S1Q H;  5CV7 A;  1RHP A;  1QZH A;  1JC7 A;  2PQA A;  2WAQ E;  2L0C A;  2XIW A;  3NBH B;  3UDI A;  2Q8R E;  5CV6 A;  2A74 C;  1I4R A;  3BDC A;  3HOV B;  3UI2 A;  4QJF A;  4NDX A;  1VMP A;  4JI3 L;  2BE5 D;  4JPB W;  2RCF A;  4BBR H;  1PTO F;  2NZH A;  1OXT A;  4UPA A;  4DAV A;  2JE6 I;  1EY9 A;  1QCB D;  2B3G A;  1MSH A;  2F0I A;  2K5Q A;  4FF1 A;  3T56 B;  5C3X A;  2ID0 A;  5FO9 B;  2JA5 G;  3RD4 A;  3S9W A;  3KBX A;  1BCP C;  5HUR A;  3W1B A;  1HNX L;  3DM1 A;  1JB7 A;  2KHJ A;  3PGZ A;  4LF6 L;  5DNF A;  1VQH A;  3PCO B;  4C2M H;  2JA8 G;  3EVQ A;  3EIV A;  3ND9 A;  2WAQ B;  5K36 G;  1I4Q A;  1OO9 B;  4JK1 C;  1KQS A;  4KHP Q;  1STE A;  2K5W A;  2X6G A;  2KHS A;  1KLU D;  1EZ8 A;  3CRL C;  2DNE A;  4LFA Q;  2F0L A;  5BR8 L;  2VZA A;  4CBV A;  1K8A C;  2NVQ B;  1L1O C;  1WTW A;  3BJU A;  3Q23 A;  5IOD A;  5C4Z A;  1F9R A;  5IYC G;  3DWA A;  2I5M X;  5AFW A;  1ZYR D;  4ZUI A;  4E6I A;  2VUM G;  1D8L A;  4EQN A;  4DR7 Q;  3LGJ A;  2QEX A;  4WOR A;  3T53 B;  4POG A;  1I6H H;  2PZT A;  4DNI A;  4IUN A;  3EFX D;  1B44 D;  1GUN A;  1V1O A;  1WD1 A;  1VQ7 A;  2JA7 G;  1A0I A;  4X64 Q;  2SNM A;  4A3C H;  2F0U A;  1H9S A;  4DV2 Q;  2O5I C;  2B39 A;  4QIW E;  4B3T L;  2PNH A;  2ICI A;  3RZD B;  2D62 A;  3HFZ B;  1S5B D;  1NAP A;  4JI6 Q;  3PUY A;  1YHA A;  1KRT A;  3CCR A;  3A54 A;  2R93 G;  3KF6 B;  3S17 B;  3CW2 C;  4V19 0;  2FJ2 A;  1LT6 D;  4FF3 A;  1BVS A;  1KAA A;  3A74 A;  3E3X A;  5IGD A;  2CWA A;  2HD3 A;  5DLQ E;  1YVC A;  2H5X A;  1BF4 A;  3T4A C;  4JI5 L;  4BA2 I;  3QB3 A;  1TWH B;  1S5F D;  3MXG A;  3D4W A;  1STY A;  4DV6 Q;  5T1G A;  4JI7 L;  5FLX E;  3KF8 B;  1NNX A;  4DK0 A;  3RN2 A;  2TSS A;  4J15 A;  4WJ4 A;  2HT1 A;  3D4D A;  2Z4H A;  3RN5 A;  1W2B A;  1HH2 P;  4FXD A;  2QDB A;  1VQI A;  1FVI A;  4NB3 A;  4OEM B;  1P16 A;  1PRT C;  1TR5 A;  2PQE A;  3JAM L;  3STB D;  3UDX A;  1CUK A;  1TQO A;  3S16 H;  5M3F B;  4DV3 L;  3WOE A;  1SYE A;  3J81 i;  3BS1 A;  1HZC A;  2EXZ A;  2A6E D;  3K5N A;  1SYF A;  4A3B G;  1LTB D;  1Y1V H;  1UWV A;  4C1N K;  3A56 A;  3HOX G;  4K8J A;  4DPG A;  4GNX B;  5JEA G;  3T13 A;  4A3F H;  1UE7 A;  4ZRZ A;  2D0P A;  1XTD A;  3GTP H;  1NCV A;  3S14 B;  5C3E H;  3J80 c;  1IXR A;  4RGM A;  3S1R B;  1KRS A;  3FDT A;  3HRZ C;  1JJG A;  2K5H A;  2HUG A;  2VW9 A;  3O13 A;  2JK8 A;  1Q3L A;  4QUC A;  2EE1 A;  5M3M H;  2FHT A;  4A3J G;  2LXK A;  2VNU D;  4C3J G;  1UAP A;  4KHV A;  1UE5 A;  5IGC A;  5KGU A;  1TWC B;  4DR2 Q;  1HFG A;  2JA9 A;  4OON A;  1Q1B A;  2R92 G;  4OEL B;  4DV0 Q;  3GTG B;  1JOQ A;  2Z6B A;  1J8I A;  4KKS A;  3PUV A;  4A93 B;  4IZ8 A;  1U4R A;  2N88 A;  1XNR L;  2AQ2 B;  5CV9 A;  3IFD A;  4OO1 G;  3PSI A;  4OWT B;  3OTO L;  3ER0 A;  3HZX A;  2UXD Q;  2KCT A;  5CC4 A;  4AIM A;  4QY7 A;  4JI2 Q;  4FVM A;  2Y0S G;  1Z7T A;  3U50 C;  1CKN A;  2HCC A;  1J5E L;  1F2Y A;  4XYO A;  3CC2 A;  4BBS H;  3GTJ B;  1PDQ A;  3I4O A;  1PH9 A;  3CQZ H;  4HED A;  5JJK A;  4RAU C;  4DU9 A;  3T1H L;  4NXN L;  2P5Z X;  2GVA A;  3CCU A;  2PQA B;  5IGB A;  3HG9 A;  4JI4 Q;  3GQB A;  3NBI A;  3JAM i;  3HOZ B;  4CKC A;  4JYA Q;  2XNA C;  2WB1 E;  5IYC H;  1VQ4 A;  1N36 Q;  4UY8 C;  4YY3 L;  5D65 A;  2ZTC A;  5GAG C;  1PYS B;  2QF7 A;  4A76 A;  2WAC A;  1WTP A;  1GM5 A;  4A3M B;  1Q8K A;  5IP7 H;  1PH4 A;  1DOM A;  3M4Q A;  4XT3 B;  2KCM A;  2EYF A;  3IRB A;  3M4Y A;  1STA A;  4HJ7 A;  1ILP A;  3J7Y W;  1X3P A;  1IYJ B;  2E2I B;  4A3K H;  3GTQ B;  4XIG S;  2AMC B;  1QVG A;  4RGO S;  1PFM A;  1PH6 A;  4X3T A;  3M3Y H;  4LWC A;  4A3L H;  2MHV A;  3HKZ E;  1I94 Q;  1N9W A;  2EXD A;  5AJ3 L;  5C4J H;  3ERO A;  1CI3 M;  1LUZ A;  1PA6 A;  1V9P A;  5C44 G;  1U4L A;  2KJX A;  3ERS X;  4K2L A;  2E76 C;  4UP8 A;  4WFN 3;  4DR6 Q;  1IYV A;  3R2T A;  2JA6 B;  4BY7 G;  1VQC A;  1DGS A;  3AU7 A;  3ZYY X;  1GUW A;  2F0H A;  3NTK A;  4DV7 L;  2ZXP A;  1KAW A;  4Q5V A;  5FKA C;  1F9S A;  2K5N A;  1SN8 A;  4KJO A;  4G57 A;  3NEM A;  4KV6 A;  4R8I A;  3U4V A;  3CU7 A;  3KYH C;  4JC0 A;  2ZTD A;  3HKZ B;  5E7N A;  1Z6H A;  1KD1 C;  4KTA A;  2MGS A;  4I65 A;  2EZV A;  4B3R L;  4TSS A;  1PHJ A;  4YHH L;  4ZCK A;  1XMO L;  1DD2 A;  4JI8 Q;  1A3V A;  3DUZ A;  2EVB A;  1T5X D;  4LNQ A;  2WP8 J;  1I50 H;  4XXE A;  5C4X G;  2CHB D;  4MTK A;  1JOO A;  4HJ8 A;  5ISR A;  1PFB A;  1SLJ A;  3VYR A;  2J7Z A;  4LFC Q;  4QB4 A;  1P8L A;  1STB A;  4NMZ A;  4C2M B;  1KXL A;  5CMD A;  1EY4 A;  4OXP A;  3AB9 A;  5A35 A;  1B7Y B;  3CPF A;  4CKB A;  4A3E G;  2A8V A;  1G6P A;  2FXQ A;  1A8V A;  1F2L A;  4LF9 Q;  1GKH A;  1D1I A;  1G2T A;  2H1E A;  1LAC A;  1KTK A;  2KCC A;  2V4D A;  2PZW A;  1A3T A;  2Z0S A;  3A5Z B;  1LYL A;  3F2C A;  2N3S A;  4H7B A;  5LHY 1;  1JJ2 A;  3KDF A;  4RKL A;  1XPO A;  3D6W A;  1YI2 A;  1LV9 A;  2F0P A;  4BA1 I;  3A5U A;  2K05 A;  3ULL A;  1B3A A;  2NTS A;  4LFA L;  1PH1 A;  3HOU G;  2NVQ H;  3IKJ A;  1SND A;  3PF5 A;  2B2T A;  2F0D A;  3FVQ A;  1ASZ A;  5M9O A;  4HMJ A;  2KHI A;  1VMC A;  5E4X A;  1YHQ A;  4GOP B;  3I4M B;  1SNQ A;  2NN6 G;  2JN4 A;  5FLM H;  1X32 A;  4DR7 L;  1PTO B;  4HSP A;  2F0F A;  4CDF C;  3CRK C;  1PH3 A;  2RCN A;  3NTH A;  4DKA C;  4Y52 H;  1MSG A;  3JAM c;  3SXH A;  3NE5 B;  5FOB B;  2RQX A;  4X64 L;  2F0S A;  5DEH A;  3V2T A;  2Q8I B;  4X66 L;  4ODG A;  1TWA B;  2BE5 C;  3RZD H;  1HZA A;  2EY6 A;  3K0Y A;  1IL8 A;  1X3Q A;  5A2Q E;  1U0L A;  1QE6 A;  4IFD G;  1GJX A;  4HSV A;  4C3H G;  4X65 Q;  2NN6 I;  2F3V A;  3S17 H;  1XNQ Q;  2Z6K A;  1UEA B;  3Q24 A;  4FO2 A;  1ICW A;  3H0G B;  1V1Q A;  3W1G A;  1L0X B;  1S5E D;  5KND A;  4P72 A;  3VDY A;  3MVV A;  3PF4 A;  2HQE A;  3QIA A;  2DGY A;  4O1N A;  3G4S A;  2ZXO A;  1TWH H;  3H91 A;  2CQA A;  1K73 C;  1EU3 A;  4NW2 A;  4DV6 L;  4GN3 B;  3M9B A;  2BH2 A;  3S16 B;  4JV5 Q;  4GKK L;  4GZY C;  5CV8 A;  3RR5 A;  3VA7 A;  4IFD I;  4A3F B;  4DXF A;  2ZJP A;  1ZYR C;  5C3E B;  1PZK D;  1KL9 A;  4MN3 A;  4DV1 Q;  4EGV A;  4EVO A;  4F7X A;  1S40 A;  2I46 A;  1Y14 B;  3NK9 A;  3PUW A;  2B2U A;  5T1I A;  2ZM6 Q;  4DR4 Q;  2ZXR A;  1GHK A;  1ASY A;  1ENC A;  4LMQ D;  2R3Z A;  1SYB A;  5C4H A;  1ILQ A;  4HJ5 A;  1PYW D;  1SJE D;  1IKL A;  3DWP A;  3TP5 A;  1C4Q A;  1HNW L;  2WFW A;  3U9S A;  3S14 H;  3MXN A;  1EY5 A;  3S1R H;  2CKZ B;  2EPB A;  3EJI A;  3PIO 3;  5GAE C;  2ALY B;  2VY3 A;  4IUT A;  4HTH A;  2JA5 B;  1LTL A;  2NBF A;  3TQY A;  4IUP A;  3K57 A;  2QA4 A;  3H3V C;  3PIP 3;  1PZI D;  2K75 A;  2K50 A;  2E8G A;  2R7Z G;  1V8Q A;  5DAU A;  3PUX A;  1IL2 A;  1TWC H;  2JA8 B;  4B3M Q;  2F52 A;  4DR2 L;  1VF5 C;  1BO0 A;  4BBS B;  1TS4 A;  3GTG H;  3L0O A;  4HN7 A;  4DV0 L;  1NMG A;  3CQZ B;  4QQB X;  4A93 H;  2BDO A;  2C5C A;  4A75 A;  3CCL A;  2FMM A;  4X6A H;  4JBW A;  4K6D A;  3VR6 A;  3MHB A;  4BXX G;  2CFM A;  4ULL A;  2BH8 A;  2ATW A;  2UXD L;  3ONA B;  5JOB A;  3HOW G;  3T51 B;  4JI2 L;  1B8A A;  1VQG A;  1YHB A;  4RFB A;  1E2W A;  1UE6 A;  4Q0F A;  5J3B A;  3GTJ H;  1QUQ A;  3K5L A;  3STB C;  2IX0 A;  1I4G A;  1JIC A;  1EY0 A;  3IL8 A;  4JOI C;  1KIX A;  3NUC A;  4JI4 L;  2JA7 B;  1D2B A;  4K14 A;  2AHO B;  4JI0 L;  3HOZ H;  1X56 A;  4TVA B;  1WCM H;  5JEA J;  2B2W C;  4JYA L;  1MJE A;  1YIT A;  1B2T A;  3R2I A;  1N36 L;  2MQH A;  5COR A;  2B8G A;  1G8Z D;  1TWF H;  2X6L A;  1OXU A;  3M3Y B;  3Q8D A;  1GO3 E;  3ULP A;  3OWF A;  4FDB A;  1WJJ A;  3S2H H;  4R4T A;  3JC6 6;  3L9A X;  3TS2 A;  3WOF A;  4R4O A;  5EPJ A;  1GUS A;  4PMC A;  5IYD G;  4DUY Q;  1SXT A;  1DON A;  1LTA D;  1CSP A;  2VQF Q;  3TZD A;  1PLF A;  4DR3 Q;  2BA0 A;  5IE8 A;  3PUZ A;  1JE4 A;  3A8J E;  2EY5 A;  4HJ9 A;  4K5X A;  3PMF A;  2MPM A;  1T5E A;  1SMY C;  4DR6 L;  2JSO A;  1CA6 A;  2JA6 H;  1L1O A;  3M7G A;  3EQL C;  2JP1 A;  3NEL A;  1PH2 A;  3S1M B;  2YU9 H;  4AH6 A;  2A68 D;  3C1F A;  4DV4 Q;  1RF2 D;  1WFQ A;  2G9H D;  1E7Z A;  1I50 B;  3L7Z C;  4UP9 A;  3SE0 A;  2K5V A;  2RKS A;  1ZXT A;  3J80 E;  4OIJ A;  1V1P B;  2M2L A;  2Z8L A;  1FGB D;  1GVP A;  4A3B B;  1EEI D;  1U5K A;  4L8J A;  3CME A;  3Q0A A;  1O7I A;  4RHR A;  1Y8O B;  3OW2 A;  5HGT A;  4HIO A;  2PCF B;  2UUA Q;  3A8K E;  3I4N G;  4AYB G;  1CQV A;  3BDL A;  2FMC A;  1K0S A;  4F8M A;  4PZ8 A;  4A3J B;  1X9N A;  4C3J B;  1EY8 A;  2UXC Q;  1HJP A;  1YNJ C;  1VQ6 A;  1X6O A;  1SE3 A;  1AEX A;  1SE4 A;  5EJW A;  1C7Y A;  4LFC L;  4GNX C;  2IX1 A;  2VXW A;  5JVH 3;  4JVZ A;  4DAM A;  3BYT B;  1HRJ A;  4QCL A;  1SE2 A;  5I9P A;  4DUZ L;  4DXG A;  4UDU C;  1O80 A;  5FO8 B;  5FJ8 G;  1A15 A;  3UDG A;  3PO2 G;  1RD9 D;  4LF4 Q;  4B9X A;  4NXM Q;  1X3E A;  2Y0S B;  1CKM A;  4OL7 A;  2HHH Q;  1E22 A;  1A6X A;  1YEZ A;  2XWB B;  2ASB A;  4YWL A;  1GUT A;  1QB5 D;  3DHQ A;  3RLN A;  2EYJ A;  4LF5 Q;  2LS0 1;  2OTJ A;  1HZB A;  5JPM C;  1Y1W G;  1XYI A;  3SHL A;  3J81 L;  1DXM A;  4M8A A;  4EX5 A;  2F0E A;  4IOC A;  5GAD C;  1MD2 D;  2EYH A;  1Y8P B;  2AWN A;  2VS1 A;  5M5W B;  1HHV A;  3D31 A;  1H95 A;  3BVZ A;  4QF4 A;  4IO9 A;  2IX3 A;  3DM3 A;  3GTK B;  3Q6S A;  3KLS X;  4X3U A;  3I73 A;  1YJN A;  1F9P A;  3RUZ A;  3E5S A;  5LL6 X;  3I4M H;  1VQN A;  1VQO A;  1PTO H;  2K6A A;  3WDN A;  2D2C C;  4DAY A;  1L0W A;  1B3Q A;  2K7V A;  1ENA A;  3MEF A;  5TSS A;  1STN A;  4DNT B;  5G3L F;  1SNP A;  2E5L Q;  2XRQ D;  2F4V L;  3J7A 5;  2UUC Q;  1KHI A;  1E1T A;  2I5H A;  3FKI G;  4ZYS A;  1TWA H;  2QGQ A;  2D9U A;  4KN7 C;  2V1C C;  5C44 B;  2F4I A;  3U58 A;  4N9P A;  3I56 A;  1FD7 D;  1PZJ D;  3AFQ A;  4CJ2 C;  4BY7 B;  2RSO A;  2YV5 A;  3KFU A;  3VR3 A;  4ID6 A;  1IBK Q;  1Z47 A;  1SJH D;  3SK6 A;  1XNQ L;  3H0G H;  3C2P A;  1AW7 A;  4ME3 A;  4GN4 B;  3I8Z A;  1KNE A;  1K9M C;  3NQI A;  2GVB A;  1EOV A;  3TS0 A;  2OCE A;  3TZU A;  3RLF A;  1JB3 A;  1GOZ A;  2RHS B;  3C1E A;  1Q1E A;  1R4P B;  1VS0 A;  2N49 A;  3HGB A;  3NWT A;  2F0V A;  1B9M A;  2LKV A;  1JT8 A;  1VQL A;  3GTL B;  3K0X A;  3J81 E;  2UXB Q;  3OMC A;  1IKM A;  3SDZ A;  1PVO A;  4ME5 A;  1SRU A;  1PMR A;  5C4X B;  4KN4 C;  5ELB A;  1QVF A;  3F8T A;  1IZ6 A;  1HQR D;  1ESR A;  3E0E A;  2HIX A;  5EBC A;  1S5C D;  1RTN A;  3OIP A;  3FPU B;  1I4X A;  1CZG A;  2QIL A;  4C3I G;  2DUD A;  3TRZ A;  1MHW C;  1LM0 A;  1TY0 A;  1VQM A;  2PW5 A;  3QJY A;  3SGI A;  3CCQ A;  2OQK A;  3S1N B;  2VL6 A;  1E3P A;  1FJG L;  4IFD J;  1H9K A;  1OXS C;  1J6Q A;  2JA5 H;  1QIL A;  3QO2 A;  4MZ9 A;  2XSC A;  3UDF A;  3G48 A;  2WKD A;  4ZAI A;  1SMY D;  3MC0 B;  5IP9 G;  4OX9 L;  5CBE E;  3LX0 A;  4KLK A;  3WWV A;  2JA8 H;  2OXP A;  5D3I B;  1C8C A;  4B3M L;  5K36 H;  1BQQ T;  3K81 C;  4WRD A;  2JXM B;  2WAQ G;  1H9J A;  3OPO A;  3HOU B;  1NUC A;  4ABN A;  2WV6 D;  4KKT A;  1VQD A;  1WCM B;  4OO1 I;  3G71 A;  1Y1W H;  2AKW B;  2QCP X;  1AE2 A;  2XGT A;  5EPK A;  1TWF B;  5FK9 C;  3SVM A;  2VUM H;  3GTO B;  1XXG A;  3K8A A;  3JAM E;  3MAQ A;  1VQB A;  4QL5 A;  4HIK A;  3S2H B;  4P74 A;  2PZU A;  4MNO A;  1XMQ Q;  4HID A;  4DV5 Q;  3MWY W;  3MZ5 A;  1CZW A;  3I3C A;  2JA7 H;  3GP7 A;  4BY1 G;  1L2F A;  3ND8 A;  1BDO A;  1DOK A;  1YNJ D;  2F3I A;  2R6G A;  1CK1 A;  4K6L A;  2MP1 A;  1WI5 A;  2JJQ A;  2I0Q A;  1E0B A;  4GOP C;  3TSS A;  4UP7 A;  4C3H B;  3GDE A;  5ELF A;  4LUO A;  3A7A B;  2R93 H;  1PTO C;  1IBM L;  2JYO A;  2ZJR A;  2R7F A;  2SNS A;  1HXY D;  4YCV A;  1O7L A;  2E2D C;  4APV A;  4DUY L;  3AYH B;  3D4R A;  4XTC S;  2YU9 B;  2VQF L;  4IUQ A;  2NWG A;  1FNV A;  2RA4 A;  1BBW A;  4JI1 Q;  4LW1 A;  4OHJ A;  1CHQ D;  4H13 C;  4N8F A;  4WJW A;  1Q82 C;  2BCO A;  2L1B A;  2SOB A;  3E9I A;  1LO5 D;  5KNC A;  1KDB A;  4JBK A;  3GTM B;  4FXK C;  2KED A;  4DR5 Q;  2J0T D;  2K03 A;  2QDL A;  1EYA A;  1F9Q A;  4H02 A;  2F0T A;  4P2C B;  3ULJ A;  1IW7 D;  1H9S B;  3VR2 A;  3S1M H;  4V0B A;  3NP8 A;  4I7Z C;  3AEV A;  4AQY Q;  3D6C A;  2HDL A;  4DV4 L;  2AQ1 B;  4Y7N B;  1D5M C;  4DAY B;  2YYZ A;  1CT1 D;  2EOT A;  3AMU A;  5M3F G;  5IYB G;  2EYP A;  2F0Q A;  3J81 c;  4A3B H;  3HOX H;  2OTL A;  3HKS A;  2PPB C;  1NR2 A;  5JEA H;  4K5V A;  2LMC B;  1NSN S;  2Q2H A;  4JG2 A;  5C5L A;  5L37 A;  1JJC B;  5JPN C;  5KEE A;  2MNA A;  1TVX A;  3PQI A;  1GUO A;  2F0N A;  3BVG A;  3DLL A;  4K0K Q;  3CPW A;  2UUA L;  3PV0 A;  2Q2I A;  4IQZ A;  4A3J H;  2N8N A;  4GLV B;  1JWU D;  4C3J H;  2B2Y A;  3A0J A;  2UXC L;  2R7Z B;  3CAM A;  3KOJ A;  4NP5 A;  1HNX Q;  1QVC A;  4M1U B;  4X62 Q;  2R92 H;  3D3R A;  2L9H A;  3H94 A;  1C0A A;  2XWJ B;  2JEA I;  4OO1 H;  4A3G G;  5E4W C;  4KHP L;  1PYB A;  5EKI A;  4HR7 B;  4KK7 A;  4LF4 L;  4NXM L;  1NE3 A;  5F2D A;  2UU9 Q;  2WIN B;  2HHH L;  2A68 C;  1HTL D;  1BR9 A;  4LF5 L;  3S15 B;  1JWS D;  2IT1 A;  1Q7Y C;  2PI2 A;  5KIX A;  3CCM A;  4N8X 1;  2BDN A;  1A2T A;  5KYL A;  5M5W H;  5COY A;  1PH5 A;  4FNF A;  1NBW A;  2IHF A;  1QJO A;  4IPG A;  3IFT A;  3GTK H;  1ZKO A;  4A3D G;  3GV3 A;  4DV2 L;  1QOH A;  1RCV D;  1CM9 A;  1EU4 A;  2VB3 X;  3MFG A;  2VQE Q;  1YJW A;  4FP5 D;  4P73 A;  1W6J A;  3K7U C;  1NJI C;  4A3M G;  1RJT A;  1SEB D;  4JI6 L;  4CDE C;  4A3I G;  3BG3 A;  4B9W A;  2NVT B;  1BCP F;  3NPP A;  1EUJ A;  4PMW A;  1CKN B;  2E5L L;  3E6Z X;  2NTT A;  5C0X G;  2K5D A;  5CV5 A;  3HOY G;  3CD6 A;  1HTP A;  2UUC L;  4KJN A;  5JJZ A;  1IYU A;  1TKW B;  2GN5 A;  4H0L C;  2EYL A;  2WKC A;  2RBM A;  5C44 H;  2DN8 A;  3J7Z C;  3VYU A;  5J22 A;  1KDC A;  3HS0 C;  4LFB Q;  2WB1 G;  4BY7 H;  4DFA A;  3PO3 G;  1IBK L;  3CMA A;  1FGU A;  4CJ0 B;  4IN3 A;  1WOC A;  4YWK A;  3NHH A;  1UEB A;  2B63 G;  3A7L A;  2B29 A;  4N9T A;  3SR1 A;  2IY5 B;  1GXD C;  5C0X I;  1TWG B;  3MTS A;  4DV3 Q;  4GLX A;  4JOI A;  1WTO A;  3LWU A;  1N33 Q;  4EQ5 A;  1EYC A;  1EFW A;  3VR5 A;  3NWS A;  3I2Z A;  2B2W A;  2A69 C;  3GTL H;  5BN4 A;  2PO4 A;  3NEN A;  1K8M A;  4DGZ A;  5JVG 3;  4HCE A;  4ZUJ A;  3C46 A;  3I4N B;  1K8O A;  4AYB B;  1DZ1 A;  2KBN A;  4HMI A;  5C4X H;  1CFM A;  1YNX A;  2ZJQ A;  4LK1 C;  3E0J A;  4BBR G;  1EIH A;  1PTO D;  1E2V A;  4C56 C;  5JJI A;  3CKI B;  2F0O A;  1KAB A;  3L3O C;  4DK6 C;  1Q81 C;  2OEO A;  2DJF C;  2KQ3 A;  2EY1 A;  1QG7 A;  3DMU A;  1GHJ A;  1Q8I A;  2NB0 A;  4A3E H;  1D1K A;  2Q2U A;  3S1N H;  4FYD A;  4RCN A;  5GAH C;  5IT9 L;  4PZ6 A;  4ZLT F;  1GD7 A;  2A6H C;  4RG1 A;  4DR1 Q;  1A63 A;  3T1Y Q;  2Z6K C;  3OW7 A;  3KF6 A;  2DY8 A;  3C3L A;  3BZK A;  2NVY H;  5M5X H;  4JBM A;  1LTR D;  5D14 A;  1Y1W B;  3RLO A;  3KJO A;  3J7A F;  4A4I A;  5IWA Q;  2VUM B;  5E3F A;  4EQO A;  3EN2 A;  5K5P A;  3K80 C;  2A19 A;  1PRT F;  4L5Q A;  2UUB Q;  1WTV A;  2F0M A;  1SR3 A;  3FEW X;  1SRO A;  1HNZ Q;  3R8B A;  3H09 A;  4IUU A;  1HA5 A;  3HOU H;  3KF8 A;  4MIU A;  2MO0 A;  4BWG B;  3SK5 A;  1V43 A;  2KOL A;  3BZC A;  1X55 A;  2HCI A;  1H9M A;  2IW3 A;  4YIJ A;  1EEF D;  5ELD A;  5I6Y A;  2CW0 D;  4OWW B;  3D0F A;  2IPK D;  4MHE A;  2NN6 H;  3FRP B;  3GTO H;  4A3C G;  3VR4 A;  3M4O B;  2HIV A;  2VB2 X;  2ZT9 C;  1ESF A;  2R93 B;  2MUY A;  1UE1 A;  1EWI A;  1HCZ A;  4OIK A;  2CVR A;  5IGG A;  2R61 A;  2X69 A;  5EBD A;  2F0K A;  5G3L D;  3FKI B;  5CYU A;  1JE5 A;  1EOT A;  3QOL A;  1TU2 B;  4GKJ Q;  5LMN Q;  1VQ5 A;  4PG3 A;  3KDF B;  1I94 L;  5I2Y A;  4IFD H;  4C3H H;  3I91 A;  4A3I H;  2C35 B;  1Q90 A;  5EGT A;  5ELO A;  1Q46 A;  4IPC A;  1LTT D;  3CP0 A;  1NTG A;  1B1Z A;  2KVM A;  4R1J A;  5C0X H;  3ERQ A;  1II3 A;  2XN9 C;  2MO1 A;  4PMB A;  2E2J H;  1ET9 A;  5C5M A;  1STG A;  1L0Y B;  2JQO A;  5EAY A;  5LMN W;  2E75 C;  5IOC A;  4JI1 L;  3J7A V;  1QNK A;  4POF A;  4RHS A;  1BNZ A;  3GTM H;  2IJ0 A;  3M7N A;  1FL0 A;  3HOX B;  5H1S E;  2ZTE A;  2A73 B;  3KLW A;  2B63 H;  3TDQ A;  3W2D A;  1Y1V G;  1PFS A;  4A3F G;  2Y0S E;  1TXY A;  4JI8 L;  4OWX B; 
#chains in the Genus database with same CATH homology
 1SRU A;  2WP8 J;  1I50 H;  4Y7N H;  5C4X G;  1VQA A;  5M3F H;  5IYB H;  1QVF A;  3F8T A;  1IZ6 A;  1Q86 C;  3E0E A;  2HIX A;  1N34 Q;  5M3M G;  4HJ8 A;  1PV4 A;  1SLJ A;  1VQF A;  2DUD A;  2NVX H;  3TRZ A;  4LFC Q;  1P8L A;  1LM0 A;  1VQM A;  1KXL A;  4DK3 C;  1T9H A;  4OXP A;  3TRE A;  1SE8 A;  1B7Y B;  3CPF A;  3SGI A;  3CCQ A;  1CSQ A;  2OQK A;  1FJG Q;  1XNR Q;  2VL6 A;  1E3P A;  1FJG L;  4K0K L;  4IFD J;  4A3E G;  1OXS C;  1HR0 L;  2A8V A;  1G6P A;  1J6Q A;  4PZ7 A;  2FXQ A;  1A8V A;  2JA5 H;  3OTO Q;  4MZ9 A;  4LF9 Q;  1N8R C;  4LF9 L;  3UDF A;  4OX9 Q;  3G48 A;  2R7Z H;  5IP9 G;  4OX9 L;  1NMF A;  1GKH A;  4KLK A;  4YCW A;  3FP9 A;  3WWV A;  5HY6 A;  4X62 L;  1EQQ A;  4IJL A;  1J5E Q;  2JA8 H;  4B3M L;  3CXC A;  1W3S A;  4A3G H;  2Z0S A;  3K81 C;  3A5Z B;  1LYL A;  3F2C A;  1XJV A;  2N3S A;  4BBS G;  1SFO H;  2CCZ A;  1JJ2 A;  3T1H Q;  2WAQ G;  3KDF A;  4NXN Q;  1XPO A;  1I3Q H;  4BXX H;  1YI2 A;  1EIF A;  5LMU L;  3A5U A;  2CQO A;  4BA1 I;  1KC8 C;  4JCV E;  3ULL A;  3HOW H;  4LFA L;  1PH1 A;  3HOU G;  2NVQ H;  3GD7 A;  3AFP A;  1VQD A;  3PF5 A;  1VQK A;  2YTX A;  1X54 A;  1QZG A;  4OO1 I;  3G71 A;  4L5T A;  4YY3 Q;  3F2B A;  1ASZ A;  2UU9 L;  1Y1W H;  2AKW B;  2KHI A;  1AE2 A;  2XGT A;  3MXN B;  2VUM H;  4KI0 A;  3S15 H;  3K8A A;  1YHQ A;  1C9O A;  4GOP B;  1VQB A;  1VQJ A;  2NN6 G;  4QL5 A;  5FLM H;  3RZO H;  4HIK A;  4P74 A;  4DR7 L;  4MNO A;  1XMQ Q;  5IP7 G;  4HID A;  3I4M G;  4NPS A;  3U4Z A;  4DV5 Q;  1XMQ L;  1JMC A;  4DV5 L;  1S3O A;  2PI2 E;  4B3S L;  2JA7 H;  2BA1 A;  4BY1 G;  1L2F A;  4KHZ A;  1PH3 A;  2CWP A;  4A3D H;  2RCN A;  4DKA C;  2R6G A;  2F3I A;  4A3K G;  2E2H H;  3S2D H;  1YBY A;  3JAM c;  4Y52 H;  2YTV A;  4X64 L;  1IBL Q;  1N32 Q;  4GNX A;  1WI5 A;  4X66 Q;  4X66 L;  5AJ3 Q;  4LF7 L;  2JJQ A;  4A3M H;  3RZD H;  2PMZ E;  2I0Q A;  1HZA A;  4GOP C;  4JBJ A;  4A3L G;  1K8G A;  2VQE L;  4UP7 A;  3GDE A;  1IBM Q;  2YTY A;  2LSS A;  4LUO A;  2R93 H;  1U0L A;  5IYD H;  1IBM L;  2ZJR A;  4IFD G;  2R7F A;  4X65 Q;  1X3F A;  2XTI A;  4O0A A;  2NN6 I;  4YCV A;  4X65 L;  3CCJ A;  2E2I H;  2NVT H;  4IOA A;  3S17 H;  3GTQ H;  4R4Q A;  4APV A;  1XNQ Q;  2Z6K A;  4DUY L;  4L5S A;  3UE1 A;  3ZJY C;  1V1Q A;  3HOY H;  3AYH B;  4DV7 Q;  2OWO A;  3BU2 A;  3W1G A;  1M1K C;  4XTC S;  4P72 A;  3H0G G;  1QUQ B;  3FHW A;  2VQF L;  2RF4 A;  3AQQ A;  1VCI A;  3VDY A;  3PF4 A;  2DGY A;  3B6Y A;  1BBW A;  3G4S A;  4JI1 Q;  1VQP A;  1VQ8 A;  4LW1 A;  1TWH H;  3EBE A;  1I5F A;  1K73 C;  1G51 A;  1Q82 C;  4DV6 L;  3E9I A;  3M9B A;  4GN3 B;  4ALP A;  2BH2 A;  3H15 A;  3PO3 H;  2MFI A;  4TQU S;  4GKK Q;  4JV5 Q;  1R9T H;  2ES2 A;  4JBK A;  4GKK L;  4JV5 L;  4LFB L;  4LUZ A;  4DR5 Q;  1BKB A;  4DR5 L;  4B3R Q;  4H02 A;  3RR5 A;  3ULJ A;  3M85 A;  4IFD I;  5IT9 c;  2ZJP A;  4YHH Q;  1XMO Q;  3J80 i;  3S1M H;  4LNQ A;  3AEV A;  1VQ9 A;  1OXV A;  1KL9 A;  4AQY Q;  4DV4 L;  4DV1 Q;  4AQY L;  1EYG A;  5C3E G;  4LF8 L;  4DV1 L;  1WYD A;  1S40 A;  3F2D A;  1Y14 B;  4DAY B;  1YZ6 A;  2KEN A;  1TWG H;  2LXJ A;  2YYZ A;  3PUW A;  3S1Q H;  2K4K A;  5M5Y H;  1PVO A;  4GN5 A;  4GS3 A;  2ZM6 Q;  1QZH A;  2PQA A;  2ZM6 L;  1N33 L;  5M3F G;  2WAQ E;  5IYB G;  1ASY A;  3J81 c;  4A3B H;  4DR4 L;  4DR4 Q;  3CC7 A;  3HOX H;  2OTL A;  3HKS A;  3NBH B;  1EIY B;  3UDI A;  4HJ5 A;  4P75 A;  2Q2H A;  3PIO A;  1HNW Q;  4JG2 A;  1HNW L;  5GQO A;  2WFW A;  3S14 H;  1JJC B;  1D7Q A;  3I4N H;  3HOV G;  4QJF A;  2MNA A;  3S1R H;  2CKZ B;  3PIP A;  4K0K Q;  2D0O A;  3DLL A;  4R4I A;  1HR0 Q;  4JI3 L;  4GOP A;  3CPW A;  5GAE C;  2ALY B;  2VY3 A;  3PV0 A;  2Q2I A;  4BBR H;  2UUA L;  4A3J H;  2NZH A;  1OXT A;  2N8N A;  4UPA A;  2JE6 I;  4GLV B;  4L5R C;  1E24 A;  4C3J H;  1LTL A;  2B3G A;  4YCU A;  3TQY A;  2QA4 A;  3A0J A;  2ID0 A;  1L1O B;  4MTN A;  2JA5 G;  3CAM A;  4A3L H;  2UXC L;  3KOJ A;  1X65 A;  1HNX Q;  1QVC A;  2K75 A;  2K50 A;  2E8G A;  5C0X J;  3W1B A;  4X62 Q;  1HNX L;  1JB7 A;  2R7Z G;  2KHJ A;  1IL2 A;  1K3R A;  3PGZ A;  1TWC H;  3PUX A;  4LF6 L;  1VQH A;  2R92 H;  3PCO B;  5HGQ A;  4B3M Q;  2F52 A;  4C2M H;  4IJH A;  4DR2 L;  3H3V I;  2JA8 G;  2R7D A;  3L0O A;  3EIV A;  5FJ8 H;  3GTG H;  1C0A A;  4DV0 L;  3PO2 H;  1E1O A;  1NMG A;  1HR0 W;  3L2P A;  2JEA I;  4QQB X;  1KQS A;  4A93 H;  4KHP Q;  5K36 G;  4A3G G;  4IPH A;  4KHP L;  1PYB A;  3J81 j;  5LMU Q;  4A75 A;  3CCL A;  4X6A H;  4JBW A;  3CF5 A;  1MJC A;  1A62 A;  4LFA Q;  4LF4 L;  4BXX G;  5BR8 L;  2VZA A;  2CFM A;  4NXM L;  1K8A C;  4DR1 L;  2BH8 A;  5ELN A;  3T1Y L;  1L1O C;  1NE3 A;  2ATW A;  4P71 A;  3HOW G;  2UXD L;  3BJU A;  2UU9 Q;  1MIU A;  4JI2 L;  1B8A A;  2HHH L;  1VQG A;  1YHB A;  5J3B A;  1UE6 A;  5IYC G;  4LUV A;  2I5M X;  4LF5 L;  3GTJ H;  2IT1 A;  5IWA L;  1QUQ A;  1Q7Y C;  3STB C;  2VUM G;  1D8L A;  2PI2 A;  3CCM A;  4HJA A;  1VQ5 A;  2UUB L;  2IX0 A;  4DR7 Q;  3LGJ A;  2QEX A;  5FLM G;  4JOI C;  3S24 A;  4POG A;  1HNZ L;  1I6H H;  2IHE A;  5M5W H;  1KIX A;  4B3S Q;  1K0R A;  1PH5 A;  4DNI A;  4JI4 L;  4JI0 Q;  2EIF A;  1NBW A;  2IHF A;  2AHO B;  4JI0 L;  3HOZ H;  1X56 A;  4TVA B;  1WCM H;  2N78 A;  4IPG A;  5JEA J;  1VQ7 A;  3F1Z A;  1A0I A;  1YIT A;  1MJE A;  2JA7 G;  3GTK H;  4JYA L;  4X64 Q;  1N36 L;  3ICE A;  2MQH A;  4A3D G;  4A3C H;  1TWF H;  1BBU A;  1OXU A;  4DV2 Q;  1S72 A;  3Q8D A;  4DV2 L;  4LF7 Q;  1GO3 E;  3ULP A;  4QIW E;  3M4O H;  4B3T L;  2PNH A;  3K7A H;  4FDB A;  1WJJ A;  2VQE Q;  1YJW A;  1XPU A;  4P73 A;  1AE3 A;  3S2H H;  2D62 A;  3HFZ B;  3K7U C;  4R4T A;  1NJI C;  4A3M G;  1I94 Q;  3JC6 6;  3TS2 A;  4JI6 Q;  3PUY A;  4R4O A;  4JI6 L;  1YHA A;  1KRT A;  3CCR A;  4A3I G;  5IYD G;  2R93 G;  3KF6 B;  4DUY Q;  3RNU A;  3CW2 C;  1EUJ A;  4PMW A;  1BVS A;  1CKN B;  3A74 A;  2E5L L;  1CSP A;  2CWA A;  5C0X G;  2Q2T A;  5DLQ E;  1YVC A;  2H5X A;  3FKI H;  2VQF Q;  3HOY G;  5IY0 A;  4DR3 Q;  3CD6 A;  2BA0 A;  5IE8 A;  4JI5 L;  4BA2 I;  2UUC L;  4DR3 L;  3PUZ A;  4GKJ L;  2GN5 A;  5LMN L;  5C44 H;  4DV6 Q;  3J7Z C;  4JI7 L;  4HJ9 A;  1N32 L;  1MKH A;  3KF8 B;  4LFB Q;  2WB1 G;  4BY7 H;  3RN2 A;  4DR6 L;  3PO3 G;  4J15 A;  2NZO A;  4WJ4 A;  3I7F A;  2JA6 H;  1IBK L;  2HT1 A;  1L1O A;  1FGU A;  3CMA A;  3RN5 A;  1WOC A;  1W2B A;  1HH2 P;  3NEL A;  1PH2 A;  4YWK A;  2YU9 H;  1VQI A;  1FVI A;  4NB3 A;  1UEB A;  4AH6 A;  2B63 G;  4DV4 Q;  2B29 A;  1P16 A;  2IY5 B;  5FLX c;  3CCS A;  4LF8 Q;  1WFQ A;  1E7Z A;  3L7Z C;  4UP9 A;  5C0X I;  2JEB I;  2K5V A;  3GO5 A;  3STB D;  2K14 A;  3UDX A;  1CUK A;  3KJP A;  4DV3 Q;  4GLX A;  3S16 H;  2OQ0 A;  4JOI A;  4DV3 L;  3J81 i;  1N33 Q;  1GVP A;  4RMF A;  1HZC A;  4EQ5 A;  1U5K A;  1EFW A;  4A3B G;  1Y1V H;  2A1A A;  3I2Z A;  1Q12 A;  1UWV A;  3CME A;  3HOX G;  1YJ9 A;  4DPG A;  4GNX B;  1O7I A;  3GTL H;  5JEA G;  3NEN A;  4A3F H;  1UE7 A;  2D0P A;  1XTD A;  3OW2 A;  3GTP H;  5C3E H;  3J80 c;  1IXR A;  3UE0 A;  1KRS A;  1JJG A;  4HIO A;  2KBN A;  2K5H A;  4JI3 Q;  5C4X H;  2I5L X;  2VW9 A;  2UUA Q;  3I4N G;  4AYB G;  1AH9 A;  1YNX A;  2ZJQ A;  2JK8 A;  4PZ8 A;  1VQE A;  3M4P A;  1X9N A;  5M3M H;  3H3V H;  4BBR G;  2UXC Q;  1HJP A;  4A3J G;  2LXK A;  2VNU D;  5JJI A;  4C3I H;  1VQ6 A;  1N34 L;  1UE5 A;  3CCE A;  4DK6 C;  1Q81 C;  4GLA C;  4LF6 Q;  1X6O A;  4DR2 Q;  1C7Y A;  2JA9 A;  4LFC L;  4GNX C;  2IX1 A;  3HOV H;  4DUZ Q;  4OON A;  1Q1B A;  4DAM A;  2R92 G;  4YWM A;  4DUZ L;  4DV0 Q;  1Z9F A;  4A3E H;  4QGU A;  3PUV A;  5GRO A;  2Q2U A;  3S1N H;  5FJ8 G;  3I55 A;  1XNR L;  3UDG A;  3PO2 G;  5GAH C;  4A93 G;  4PZ6 A;  4OO1 G;  3PSI A;  4LF4 Q;  4OWT B;  1GD7 A;  5BR8 Q;  4RG1 A;  5IP9 H;  3OYY A;  1X3E A;  3OTO L;  4DR1 Q;  3ER0 A;  3T1Y Q;  4NXM Q;  2UXD Q;  2KCT A;  1CKM A;  2AWO A;  2Z6K C;  4AIM A;  3KF6 A;  4QY7 A;  4JI2 Q;  2HHH Q;  2Y0S G;  3E9H A;  1E22 A;  1M90 C;  3BZK A;  1YEZ A;  2NVY H;  4O2D A;  3U50 C;  5M5X H;  1XPR A;  4JBM A;  4YWL A;  2ASB A;  1CKN A;  3RLN A;  3RLO A;  3KJO A;  1J5E L;  4LF5 Q;  1RIP A;  1G29 1;  4A4I A;  1HZB A;  5IWA Q;  3CC2 A;  4BBS H;  1Y1W G;  2OTJ A;  3EN2 A;  3I4O A;  3K80 C;  2A19 A;  4L5Q A;  1PH9 A;  3CQZ H;  2UUB Q;  4EX5 A;  1OXX K;  5JJK A;  4IOC A;  1SR3 A;  3T1H L;  4IPD A;  1SRO A;  4NXN L;  1PH7 A;  1HNZ Q;  1RL2 A;  5GAD C;  2GVA A;  3CCU A;  2PQA B;  2VS1 A;  2AWN A;  3HOU H;  4HIM A;  4JI4 Q;  2MO0 A;  3D31 A;  1H95 A;  1V43 A;  2K52 A;  1YIJ A;  3JAM i;  4IO9 A;  4JYA Q;  3BZC A;  3TEH B;  1X55 A;  3DM3 A;  2WB1 E;  5IYC H;  1VQ4 A;  1N36 Q;  4UY8 C;  3HOZ G;  4YY3 L;  1WCM G;  2L15 A;  4R4C A;  2ZTC A;  4OWW B;  5GAG C;  3D0F A;  1PYS B;  4A76 A;  1YJN A;  3GTO H;  4A3C G;  4B3T Q;  1GM5 A;  1Q8K A;  2HIV A;  5IP7 H;  1PH4 A;  3I4M H;  3M4Q A;  1VQN A;  3CCV A;  2KCM A;  1VQO A;  4WJ3 M;  3IRB A;  1UE1 A;  1L0W A;  1EWI A;  4HJ7 A;  1X3G A;  1PH8 A;  4BY1 H;  1IYJ B;  3MEF A;  3W5O A;  4A3K H;  4XIG S;  2AMC B;  1QVG A;  2E5L Q;  2F4V Q;  1HZ9 A;  2F4V L;  1PH6 A;  1CKO A;  1JE5 A;  4JI5 Q;  2HQL A;  1IBL L;  2UUC Q;  1OTC A;  1KHI A;  1NY4 A;  3J7A 5;  3M3Y H;  1E1T A;  2I5H A;  4LWC A;  3FKI G;  4GKJ Q;  1TWA H;  3HKZ E;  5LMN Q;  1SMX A;  1N9W A;  2EXD A;  2QGQ A;  3KDF B;  4PG3 A;  5AJ3 L;  1I94 L;  2V1C C;  5C4J H;  3G6E A;  3U58 A;  1LUZ A;  1PA6 A;  1V9P A;  4JI7 Q;  4C3H H;  3I56 A;  4A3I H;  5C44 G;  2C35 B;  5ELO A;  3AFQ A;  3ERS X;  4UP8 A;  1Q46 A;  4DR6 Q;  2YV5 A;  2RHQ B;  4IPC A;  3KFU A;  1A63 A;  4AYB E;  1IBK Q;  1Z47 A;  3CP0 A;  1NTG A;  1K83 H;  4BY7 G;  1VQC A;  4R1J A;  1XNQ L;  1DGS A;  3H0G H;  2JA6 G;  2MO1 A;  2E2J H;  4ME3 A;  4GN4 B;  4DV7 L;  1K9M C;  1KAW A;  2GVB A;  2JQO A;  5EAY A;  5LMN W;  2EQS A;  2K5N A;  1EOV A;  3TS0 A;  1SN8 A;  4JI1 L;  2OCE A;  1EQR A;  3RLF A;  3NEM A;  4POF A;  3CC4 A;  3U4V A;  2RHS B;  3GTM H;  1Q1E A;  3KYH C;  4JC0 A;  2ZTD A;  3M7N A;  1FL0 A;  5E7N A;  1VS0 A;  2N49 A;  1KD1 C;  1JT8 A;  5H1S E;  2ZTE A;  4B3R L;  1VQL A;  3HKZ G;  1B70 B;  3KLW A;  3K0X A;  2B63 H;  1PHJ A;  2UXB Q;  1Y1V G;  4YHH L;  1XMO L;  1PFS A;  2UXB L;  5JJL A;  4JI8 Q;  4A3F G;  2Y0S E;  1TXY A;  4JI8 L;  4OWX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...