3STBD

A complex of two editosome proteins and two nanobodies
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
113
structure length
108
Chain Sequence
KSVNSVTLVGVVHDIQSGFVYEDAVTQFTLTTTSIDTTVVVEKDHHTIRCFGELFSAEVKQKVKEGNVVCVNGRLRLSPQLEPSCNKHFYFPYIQVQPPHGQVAVIHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords single domain antibody VHH
publication title Crystal structure of a heterodimer of editosome interaction proteins in complex with two copies of a cross-reacting nanobody.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
total genus 18
structure length 108
sequence length 113
ec nomenclature
pdb deposition date 2011-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3stbD00
3J81j 3CPWA 3PSIA 4PG3A 3U4VA 1K9MC 1X54A 4DV2L 4X62Q 2Q2IA 4DAMA 2ZM6Q 1XNRL 1GO3E 2K52A 4DPGA 3PF5A 4DV7Q 1Q82C 1K8GA 4LF4Q 3EIVA 1QVFA 2Q2UA 4X65L 2E8GA 4JI5L 3ERSX 4YWLA 2R7ZH 2YTVA 4IO9A 1I50H 1NE3A 2EXDA 4BA1I 3UE0A 2I5HA 2A19A 2CKZB 3NENA 1WI5A 4DAYB 2GN5A 2JA6H 4OWTB 1IBMQ 3K80C 5LMUQ 4A3IG 2K5VA 1YZ6A 3PO3G 2IT1A 1VQBA 1B7YB 1UEBA 4GLVB 3UDFA 1G51A 1KRSA 3CAMA 1Q1EA 4EQ5A 4DR7Q 1NMGA 2VZAA 4GS3A 1I94L 4IOAA 3RN5A 1Y1WG 4OXPA 5JEAJ 4ME3A 5M3FG 4HIKA 1FL0A 3VDYA 4JI7Q 2JA8G 4DR4Q 1PHJA 4A3DG 3I4OA 1SRUA 4IFDG 2R7FA 3LGJA 2YU9H 2VQFL 4NXNQ 1Y1VH 3HKZE 1HZCA 4DV3Q 1UE6A 4LW1A 4R1JA 4DKAC 1KAWA 2PQAB 2GVBA 1UWVA 2JA9A 1VQJA 2JA7G 1KXLA 1CUKA 1Q8KA 3RNUA 2BH2A 2R93G 3RLFA 3CMAA 4JV5L 3NBHB 3A5UA 1OXXK 1NJIC 1OXSC 2WB1E 4A3FH 4YCVA 3UDXA 1QVGA 4X66Q 1XTDA 5M5WH 5FJ8G 4H02A 3PUXA 4POGA 2VQEL 1NY4A 4GNXC 3GDEA 3S16H 4DR5Q 3PO2G 4P71A 4PMWA 4AIMA 4YHHQ 3CCMA 2PI2E 4UPAA 4DV0L 4A3KG 1IBLQ 2R6GA 3UDIA 2MFIA 4LUOA 3S1NH 1X3EA 4DUZL 2JA5G 1N33Q 1LUZA 3K0XA 1HZBA 3KF8B 3WWVA 4X64Q 5FLXc 5IWAQ 2RF4A 1BVSA 2ZTCA 4GNXA 2BH8A 1SN8A 1PH4A 4JI6Q 4LNQA 3CQZH 3EN2A 1EIFA 4P75A 4JI4Q 4A3IH 3HOWH 3PO3H 4R4IA 1PVOA 1VQMA 4LF5Q 1X3FA 4JI2L 4GKJL 3CCJA 1K3RA 4PZ8A 2JEAI 4R4OA 1Y1WH 2UUCQ 5JJIA 5M3FH 4A3DH 2JA8H 2YTYA 2Y0SG 4DV1Q 4JI0L 2F4VL 2LSSA 2MQHA 2UXCL 3CCQA 5BR8L 1HH2P 4AQYQ 1MJEA 3S17H 1UE1A 4C3JH 4YCUA 4NXMQ 4DR2Q 3J80c 4P73A 5IP7G 1E1OA 4BY1G 3JAMc 2AHOB 2JA7H 2Q2HA 1EOVA 4GOPB 1YI2A 4GN4B 4DV6L 4BXXG 4L5TA 2R93H 4B3RL 1YITA 1QZHA 4QQBX 3CCSA 1YHQA 4R4TA 3HOXG 1SR3A 4IJLA 4R4CA 5J3BA 1WOCA 1X6OA 5LMNW 4A3MG 4OWWB 4DV5Q 3I4NG 1EFWA 4JBJA 3AYHB 2HHHQ 4A3LH 3S2DH 1Q81C 1Q46A 2CWAA 3B6YA 5AJ3Q 3L2PA 3HOVG 5IT9c 2NN6I 4A3KH 2ZJPA 1VQOA 2B29A 5K36G 1Q12A 1HJPA 4DV4L 1SMXA 2YYZA 4K0KQ 2OQ0A 2JA5H 4OX9Q 4JYAQ 4B3SQ 4X62L 4JBKA 4DV7L 2GVAA 4LF4L 4DK6C 3H0GH 4AYBG 2BA0A 4LFBL 4AH6A 1PH6A 2KHIA 5C3EG 3D31A 3KJOA 2VUMG 4BBRG 1BBUA 3I55A 2EIFA 1ASYA 2WAQG 5C0XI 3M4QA 1GM5A 5E7NA 2UUBQ 4GLAC 5LMUL 4HJ8A 1DGSA 3KOJA 3F2CA 4GKKQ 2OTLA 1P8LA 2N49A 3KYHC 4C3HH 4DR7L 1SE8A 2ZTEA 2PI2A 2R7DA 3RLNA 3FHWA 3BU2A 3NELA 4JBWA 4UP8A 4JI7L 2JQOA 4DR4L 1E7ZA 1E3PA 3FKIG 3HFZB 5IYBG 4TQUS 3CXCA 1RIPA 4NXNL 3T1YQ 4BY1H 2LXKA 3ULLA 2N8NA 3E0EA 1AH9A 4BXXH 5IYDG 3H3VH 1ASZA 1L1OB 5HGQA 5LMNQ 3S1RH 2HQLA 2NZHA 3PUWA 3J7ZC 4LF7Q 2Q2TA 1I3QH 4B3ML 1Y14B 3H15A 2I5LX 1YVCA 3M7NA 1YJWA 4YWKA 2PQAA 4X66L 1A62A 1V43A 4HJAA 2A8VA 1S3OA 3CC4A 3HOVH 2OCEA 1X3GA 1XMQQ 4HJ5A 1JB7A 1X56A 5ELNA 4DR5L 1YHAA 2QEXA 3NEMA 2XGTA 1JJCB 1TWCH 3PUZA 1IBLL 4WJ4A 2MO1A 2D62A 4C2MH 1VQLA 1VS0A 1FGUA 3CC2A 4A3GG 1PH9A 2ALYB 1N33L 3HOZH 1YHBA 2PNHA 3RN2A 5C3EH 1FJGQ 5M3MG 4X64L 1M90C 5IWAL 4BBRH 2VUMH 2D0OA 1U5KA 4JI3L 1E24A 1PYBA 4A4IA 2WFWA 4JI6L 2K5NA 5GQOA 1KC8C 2V1CC 4LF6L 4FDBA 4JI4L 4MNOA 2E2HH 3E9HA 4A3JG 1VQ6A 3J80i 3OTOL 3AFQA 4LF5L 1S40A 3JAMi 4LFCL 1S72A 2UUCL 1XNQQ 3F8TA 1K0RA 2NN6G 3FKIH 5IYBH 4DV1L 2DUDA 2K50A 1N36Q 4ALPA 4AQYL 4LF8Q 1IXRA 3G48A 4GOPC 5IYDH 3TS0A 3A74A 4IFDJ 3UDGA 1WJJA 1YJNA 4KLKA 4JI1L 4NB3A 3M4OH 4LFAQ 4YY3L 3PGZA 1WCMG 5H1SE 1A0IA 2A1AA 2C35B 2UXBL 2UU9Q 4BA2I 4DNIA 1U0LA 1MKHA 2ID0A 3K7UC 5C44G 4LUVA 5C0XG 4DV5L 4L5SA 1O7IA 5C4XG 4GLXA 4EX5A 4DR1L 4GOPA 1XMOQ 1J5EQ 3HOYG 3AQQA 1PH7A 2NVYH 3W5OA 5AJ3L 1X9NA 5C4JH 3PCOB 1YEZA 3IRBA 3U4ZA 1Z47A 4KI0A 5M5YH 2XTIA 3G6EA 1JE5A 3CCEA 2CFMA 1PH3A 4DUYQ 1PA6A 3GO5A 1TWHH 3PF4A 4K0KL 4OX9L 4O2DA 2VW9A 4B3SL 4JYAL 4BBSG 2ZJQA 3ZJYC 5M3MH 2CQOA 3STBC 1IZ6A 1IL2A 1X55A 3CCVA 4DR6Q 2AWNA 2RCNA 3KDFA 1HNXQ 1BBWA 2VY3A 1OXTA 1NBWA 4A3JH 4B3TQ 5IY0A 2UUAQ 1N8RC 2UUBL 2RHQB 1N32L 1KHIA 4A93G 5FJ8H 4LF9Q 1Z9FA 3KJPA 3L0OA 4APVA 3OYYA 5IYCG 3KF6A 3W1GA 3I4MG 3S15H 3PO2H 4Y7NH 1KQSA 1BKBA 2H5XA 2JJQA 3CD6A 4IPCA 4DV0Q 1VQ8A 3TQYA 4BY7G 1LTLA 5IP9G 1L1OC 1V9PA 3T1YL 1GD7A 1AE3A 2ZM6L 4JI8Q 3RZOH 1QUQA 3TS2A 1TWFH 3HKSA 2AMCB 4P74A 5EAYA 3M4PA 1TWGH 1VQFA 1HR0W 3DLLA 5GROA 3A5ZB 1XPOA 4UP7A 5C4XH 1PH2A 3MEFA 2LXJA 4JOIC 3HOYH 1B8AA 1EQQA 3F1ZA 1E1TA 2OQKA 2Z6KC 1L1OA 1IBML 4O0AA 1NTGA 3A0JA 4DR3Q 2E2JH 1VQIA 2KCTA 1XMQL 1MIUA 1HNZQ 2BA1A 3M9BA 3GTGH 1YJ9A 1KL9A 1MJCA 1KD1C 2B63G 2F52A 3HKZG 1Q7YC 1CKNB 2L15A 5HY6A 1QZGA 1K83H 1D8LA 5BR8Q 4A3CG 1SLJA 5JJLA 4JOIA 3GTJH 4KHZA 3I7FA 3ULJA 2DGYA 4XTCS 5IP7H 5FLMG 3CCUA 2OWOA 1EQRA 2Y0SE 3S1QH 4DV3L 1I6HH 2Z0SA 3CC7A 3G71A 1A8VA 2JE6I 2NZOA 3KFUA 3D0FA 2WB1G 1PFSA 4QY7A 2OTJA 2WP8J 2QGQA 4UY8C 5GAGC 3HOXH 1UE5A 3RZDH 4A3MH 4JBMA 3PIPA 2E5LQ 3GD7A 2MO0A 3I4NH 4A93H 4LWCA 4QJFA 4OO1I 1EUJA 3I4MH 1LM0A 2N3SA 3GTMH 1XNQL 3J81c 4IPDA 1EYGA 1HNWQ 2AKWB 3KLWA 5JEAG 4A3BG 1N36L 4BY7H 4R4QA 4YHHL 5IP9H 4DV4Q 2K75A 1JT8A 1N9WA 2MNAA 2VL6A 3CW2C 2ATWA 4IPGA 1HR0Q 2K4KA 2UXDQ 1VQ9A 2B3GA 3MXNB 1JMCA 1PH1A 1N34Q 1VQNA 4LFBQ 3H3VI 4LFAL 2KENA 3EBEA 3PV0A 2UU9L 1TXYA 2ZTDA 1XJVA 2CCZA 4A3EG 3CCLA 1IBKQ 4AYBE 1XPUA 1W2BA 2N78A 1W3SA 1XMOL 1J5EL 5ELOA 4C3IH 3TEHB 4GN3B 3S24A 3T1HQ 3HOWG 1C7YA 5M5XH 1VQAA 1OXUA 2HIXA 2WAQE 4L5RC 1TWAH 2B63H 3BJUA 2AWOA 3J7A5 4DUYL 3RR5A 4A3CH 4KHPQ 2JEBI 1KRTA 3ICEA 5FLMH 1B70B 3PIOA 4IOCA 3JC66 1VQCA 1YBYA 2IY5B 3PUYA 4NXML 3E9IA 4DV2Q 4DR2L 1IYJB 1XNRQ 4DR6L 3K7AH 3GTPH 4HJ7A 1G291 1HNXL 1T9HA 2IHFA 1C0AA 1PV4A 3CF5A 1VQ7A 4X65Q 2YV5A 4JI5Q 2NVXH 1L2FA 2EQSA 2IHEA 2R92G 4B3TL 3M3YH 4PZ7A 4B3MQ 2I5MX 2UUAL 3CCRA 4A76A 4OONA 1AE2A 2HIVA 2PMZE 1PH5A 2HHHL 4UP9A 4LF9L 1HZ9A 4A3LG 4A3BH 4A75A 2KBNA 2K5HA 3AFPA 3Q8DA 3F2BA 3GTOH 1WYDA 1VQEA 3F2DA 2K14A 1HZAA 2QA4A 1I94Q 4PZ6A 1SROA 4YCWA 2VNUD 4A3GH 1FVIA 1WFQA 3K81C 1KIXA 4IJHA 4P72A 1C9OA 1CKMA 1OTCA 5GAHC 4JI8L 1P16A 2E2IH 4JC0A 1YIJA 2VQFQ 4HJ9A 1VQDA 3H0GG 4OWXB 4A3EH 1Q86C 2D0PA 1K73C 4JI3Q 3DM3A 1H95A 1CSPA 4QL5A 3CMEA 4LF6Q 1VQ5A 3S1MH 3HOUG 2ASBA 1J6QA 4HIMA 4JV5Q 4OO1G 4NPSA 3OTOQ 4DR3L 5C0XJ 1VQGA 1CSQA 4LFCQ 1QVCA 1HNZL 4GKKL 1VCIA 3ER0A 5IE8A 2VQEQ 3GTKH 3U50C 2HT1A 4JCVE 4IFDI 4GNXB 3W1BA 4L5QA 3U58A 3I56A 4Y52H 1NMFA 3FP9A 3L7ZC 2IX0A 1VQKA 4DUZQ 3J81i 1CKOA 2VS1A 3AEVA 4JI1Q 2F3IA 1CKNA 5LMNL 2R92H 1WCMH 1L0WA 3CP0A 5JJKA 4YY3Q 1VQHA 1VQPA 1PH8A 1GKHA 2E5LL 5C44H 4LF7L 2UXBQ 4TVAB 2R7ZG 4X6AH 1X65A 2ES2A 1G6PA 2NVTH 2KCMA 4DR1Q 1SFOH 2JK8A 3OW2A 2KHJA 3BZKA 3CPFA 2JA6G 1PYSB 1Q1BA 2FXQA 3TRZA 1HNWL 4JI2Q 1I5FA 2RHSB 4RMFA 1VQ4A 4GKJQ 2CWPA 4WJ3M 1V1QA 2I0QA 1OXVA 3KDFB 4HIOA 3M85A 1RL2A 1LYLA 4JI0Q 4BBSH 1EIYB 2F4VQ 2UXCQ 1HR0L 1UE7A 4J15A 1R9TH 4XIGS 4DK3C 4HIDA 3RLOA 3S14H 2UXDL 5GADC 5GAEC 1N34L 3HOZG 2Z6KA 4RG1A 4MZ9A 3UE1A 1FJGL 2IX1A 5DLQE 1A63A 1JJGA 1Y1VG 3STBD 1M1KC 1GVPA 3ULPA 3BZCA 4DV6Q 3K8AA 3KF6B 2NVQH 2YTXA 1IBKL 3GTLH 3HOUH 4B3RQ 4GN5A 4MTNA 2ZJRA 3S2HH 1K8AC 3TREA 1N32Q 3T1HL 4YWMA 4JG2A 4IPHA 1EWIA 4QIWE 4LUZA 1XPRA 5IYCH 4POFA 3I2ZA 4A3FG 1YNXA 1QUQB 3GTQH 1E22A 1JJ2A 4KHPL 3G4SA 1D7QA 3SGIA 4QGUA 4LF8L 3PUVA
chains in the Genus database with same CATH superfamily
3J81j 1QB5D 3F2UA 3KLRA 1X54A 4UAIA 4DAMA 4K8JA 1Q82C 2E8GA 1JWMD 2YTVA 2EYJA 4Z9CB 4BA1I 1JORA 4HCEA 4CKCA 2CKZB 2AUKA 4A3FB 3ITPA 2SOBA 2A6HD 3PO3G 1VQBA 3UDFA 1G51A 1KRSA 4EQ5A 1Q1EA 4DR7Q 1I94L 1NCVA 1Y1WG 4HIKA 3IFDA 3VDYA 2O5IC 3S1NB 1PHJA 3I4OA 3KK7A 1EOTA 5EPKA 1X3PA 4IFDG 3HZXA 3BZDB 3LGJA 1SNMA 3E6ZX 3EA6A 3QJYA 4LW1A 2J4XA 1UWVA 4XXEA 1VQJA 3CQZB 1S5CD 1FYCA 4A3IB 2BE5C 4XYQA 2F0SA 3A5UA 1SJHD 1GOZA 4A3FH 3TP6A 5M5YB 1XTDA 1V1OA 4MIUA 1MI2A 2DY8A 2VQEL 1ENAA 4POGA 2JA8B 4A3DB 4DR5Q 3CCMA 4AIMA 4DV0L 2L55A 4LMQD 3U9OA 3S17B 1R4PB 1B53A 2R6GA 3LWEA 3S1NH 1XWEA 3U9SA 1I4RA 4B9XA 1KABA 1F77A 4DUZL 1N33Q 2JA7B 2QDBA 4JW0A 3P7JA 3QOJA 4CKEA 2R93B 3IL8A 4DK1A 1BVSA 4GNXA 3TP7A 1ILQA 3CQZH 1MBYA 4A3IH 3K57A 1PVOA 3K5MA 3S15B 4FVMA 3CCJA 4A3KB 4PZ8A 5JJIA 4G57A 4A3DH 2JA8H 3BDOA 2UXCL 1F9RA 4G7HC 3S17H 1DOKA 3A7LA 4C3JH 4PMCA 1JB3A 4NXMQ 3J80c 1SAPA 2Z4IA 4P73A 4BY1G 1ET9A 2EYHA 2JA7H 1EOVA 1PLFA 4L5TA 2R93H 2RDGA 1YITA 1CA6A 4DAPA 3OHXC 1YHQA 4QQBX 2DJGC 4R4TA 3IAYA 4R4CA 2MP1A 3Q22A 1LT3D 3I4NG 4KJNA 3FEWX 4I7AA 3D4WA 1Q46A 1B3AA 1SYDA 2KECA 3D6CA 3L2PA 3HOVG 5IT9c 4A3KH 3WOFA 4WJWA 2ZJPA 2B29A 1DXMA 2YYZA 4K0KQ 3DMUA 3BS1A 4JBKA 4MTKA 1GXDC 4TKOB 4DV7L 4QIWB 3C1FA 3P1HA 4ZQ3A 4AYBG 4AH6A 1PH6A 3W3AA 4KD4A 5C3EG 3RZDB 3HOXB 4S3SA 2QKIC 4JPBW 4BBRG 3A8JE 3QOLA 2JN4A 3NPPA 5HGTA 2UUBQ 2P5ZX 4HJ8A 1DGSA 4J1MA 2Z4HA 3F2CA 2OTLA 2F0MA 1P8LA 3CRLC 2ZTEA 4L63B 3BU2A 4UP8A 4LK1C 3K58A 4JI7L 4V190 2WKCA 1E7ZA 2RDHA 2F0EA 4TQUS 1RIPA 3T1YQ 2K7VA 2N8NA 3E0EA 1AH9A 1IKLA 5HGQA 5LMNQ 4CJ2C 4F87A 2F0LA 1STYA 2HQLA 3PUWA 2F0IA 3GP7A 2Q2TA 3MXGA 4LF7Q 1TT2A 2I5LX 1YVCA 4HSVA 2PQAA 1MHWC 3CC4A 2OCEA 5CR3A 1XMQQ 1JB7A 5K36H 1ESRA 1IBLL 4WJ4A 1IW7D 3NWTA 3VA5A 4A3GG 3MFGA 4CKBA 4H7BA 2PMZB 2PNHA 3RN2A 1WTQA 2I46A 3M4OB 4X64L 3BYYB 5IWAL 2D0OA 1YNND 2L0CA 2OXPA 2K5NA 2V1CC 4HCSA 4KN7C 4KN4C 2NBFA 2R61A 4R8IA 2F4IA 4IUNA 4UHVA 3F8TA 2K50A 1N36Q 2FMCA 2XWBB 4AQYL 1ICFB 4LF8Q 2D5DA 2RQXA 1B9MA 3A74A 3M4OH 2BDNA 5FO9B 4LFAQ 1WCMG 4A3JB 4DNIA 4L5SA 1PMRA 1O7IA 4DR1L 4GOPA 1XX8A 1J5EQ 3HOYG 1X9NA 4ZLTF 3IRBA 4Y7NB 1Z47A 4KI0A 3G6EA 3T16A 1WTOA 4KKTA 2CFMA 1SNCA 1HUNA 1TWHH 3H3VC 4BBSG 2ZJQA 4KKUA 3VYRA 3STBC 1IZ6A 1X55A 3LX0A 1XXGA 2RCNA 1NBWA 4RGTA 4A3JH 4B3TQ 2NVTB 5IY0A 2UUAQ 2KVMA 1STGA 2QW7A 3DWQA 1WVLA 4LAAA 5IODA 3R2IA 4KD3A 3PO2H 4Y7NH 1KQSA 1S4ZA 4DV0Q 4BY7G 1RTOA 4XYOA 5IP9G 1GD7A 1CHPD 1QUQA 2F3WA 3L9AX 1TWFH 3HKSA 3M4PA 1PZID 5IGCA 1DJRD 3PIO3 4RH6A 3H6MA 4WRDA 3MEFA 2LXJA 1SE4A 3QG1A 1EQQA 3P75A 2Z6KC 1CA5A 3V96A 2FJ2A 1IBML 3A0JA 2N88A 3M9BA 3CU7A 5ELDA 4ME5A 1KL9A 1MJCA 1RHPA 5CGKA 1Q7YC 4DAYA 1VF5C 1EU3A 3VR6A 3MA2B 2EY2A 3ULJA 2DGYA 4XTCS 5IP7H 2OWOA 1BF4A 1CK1A 1I6HH 2PZTA 3G71A 3KLSX 3D0FA 1H9RA 2OTJA 2WP8J 2QGQA 3VR2A 4NP5A 1EUJA 4PNYA 4HAEA 5EJWA 4KTAA 2B2TA 3A56A 2K32A 2XNAC 2B63B 2NTSA 1LTRD 4IPDA 1HNWQ 1H9MA 4A3BG 2OT2A 5EGTA 4YHHL 4HEDA 5LHY1 1JT8A 2VL6A 2ATWA 1G91A 1PRTC 2K4KA 5HURA 1RODA 2OEOA 1FR3A 4XDXA 1TXYA 2UU9L 3NQTA 2PW7A 4AYBE 1XPUA 1XMOL 3KF8A 4IUQA 4GN3B 3T1HQ 2B2WC 1FNVA 1C7YA 4EVOA 4G7ZC 3GTOB 2B63H 4XQNA 3J7A5 1EY4A 3MVVA 2K05A 3OIQA 5EPLA 3ICEA 5I9PA 5FLMH 2E2IB 1GUTA 1CFMA 4DR2L 1XNRQ 3MXUA 1LTID 1G291 1T9HA 2RVLA 4A3EB 4X3SA 3TDQA 1SYFA 4JI5Q 1L2FA 1SDFA 5CBAE 1JOOA 3RMHA 2AQ1B 5C5LA 5CYUA 2HHHL 4LF9L 1WTVA 3V2TA 2K5HA 3AFPA 1PZJD 3GTOH 3F2DA 1VQEA 2K14A 1HZAA 4B9WA 2QA4A 2F0OA 1SROA 2VNUD 2RKSA 3K81C 1CKMA 5GAHC 4JI8L 1HFGA 1P16A 2E2IH 5BN4A 3H0GG 4OGQC 4A3EH 3M4YA 3DM3A 1H95A 2D9UA 3VR4A 4N8FA 1QOHA 2EDGA 3NHHA 4HIMA 4JV5Q 1C4QA 1U4RA 1CSQA 2KJXA 1HNZL 1B9NA 5FO8B 2NN6H 2JYOA 3GTKH 1TY2A 2IL8A 1B1ZA 3A8KE 3BVMA 2HT1A 4JCVE 3S14B 4IFDI 2XN9C 2F0TA 4Y52H 3L7ZC 2IX0A 3J81i 1CKNA 3HOUB 2KEEA 2E5LL 5C44H 4X6AH 4TVAB 1G6PA 1SSOA 1YNJC 2KCMA 2KEDA 4DR1Q 2JK8A 4C3HB 3CPFA 3BZKA 1PYSB 4RMFA 5JPMC 2A69D 1ZYRD 3EFXD 4GKJQ 2CWPA 1QCBD 5IT9L 2RBMA 4HTHA 4PQXA 1EIYB 2F4VQ 5IGFA 4J15A 4DK3C 4HIDA 3S14H 2UXDL 3HOZG 4MZ9A 1FJGL 2F0KA 1Y1VG 1M1KC 3GTLH 3VYUA 3HOUH 4MTNA 3L3OC 1EWIA 1K8OA 4QIWE 4LUZA 1TKWB 1QUQB 1EY7A 3SK6A 3QWNA 3TN2A 1D7QA 3SGIA 1NAPA 2B2UC 1GUNA 3U4VA 2IPKD 4X62Q 4DV2L 1GO3E 2K52A 2PO4A 2HCIA 4DPGA 3PF5A 5FLXE 3EIVA 4CJ0B 5CC4A 1B50A 1K0SA 2EXDA 2F0FA 1H9KA 1PTOC 2AQ2B 2CW0D 1EEID 4DAYB 2GN5A 4OWTB 1IBMQ 3K80C 2BCOA 5LMUQ 2K5VA 1EY8A 4RGOS 3GQBA 1IYUA 2DNCA 3RUZA 3BDLA 4OXPA 1RTNA 4ME3A 1QILA 2Q8RE 3JAME 2VQFL 1G2TA 1HZCA 1UE6A 1IKMA 4R1JA 3FVQA 2G5DA 1CUKA 2BH2A 1WTHA 1B44D 3CMAA 3PO3B 3J7YW 2A5HA 2IW3A 4IURA 2ICIA 4YCVA 2A74C 4X66Q 5M5WH 2FMMA 5D65A 4H02A 1Y1WB 1ENCA 2K1BA 2FHTA 1K28A 4P71A 4PMWA 4YHHQ 1ILPA 2IX3A 2Q8IB 4RWSC 1MGSA 4ZKCB 2JA5G 2L11A 1LUZA 3KF8B 3V05A 4WORA 2HCCA 1AEXA 1SN8A 4JI6Q 4LNQA 3EN2A 1II3A 4JI4Q 3HOWH 3PO3H 2G9DA 1VQMA 4LF5Q 1Q90A 1X3FA 2FFKB 2JEAI 1Y1WH 2UUCQ 4RFBA 3DM1A 2Y0SG 4DV1Q 4JI0L 2ICEC 3NTHA 4IFDH 3CCQA 5BR8L 1MJEA 2NZ1D 4YCUA 3KUPA 2DN8A 4DR2Q 2AHOB 3NWSA 4GN4B 4DV6L 4B3RL 1QZHA 1LT6D 4FYDA 2GA4B 2PPBC 5J3BA 4A3MG 1X6OA 1E2VA 2K03A 2BE5D 2HHHQ 1Q81C 1VMCA 5AJ3Q 3B6YA 1NUCA 1CT1D 3GTJB 2NYZD 4JYAQ 3KLSA 4BY1B 4B3SQ 5DAUA 3S1QB 1HA5A 4PV1C 2JSOA 4LF4L 2KQ3A 2BA0A 4LFBL 3S1RB 3I4NB 2EIFA 4DNRB 2WAQG 3R2TA 4R9WA 2EY5A 5E7NA 5JAVA 3HOVB 1LTTD 3OPOA 2G9HD 2A68C 1TWCB 2R7DA 3RLNA 1Y69U 1CI3M 1ICWA 3BVGA 4JBWA 4FF1A 4DR4L 3FKIG 1E3PA 5IYBG 4AYBB 1LV9A 3MEHA 4BY1H 4NXNL 5C3EB 1B4OA 1QNUA 3OIPA 4BBRB 5IYDG 1L1OB 2XIWA 3S1RH 5D3DA 1DD2A 4KK7A 4EQOA 3H15A 4F7XA 1F2ZA 1A62A 1V43A 2RSOA 3HOVH 1S3OA 5ELNA 1YHAA 4CDFC 1TWCH 2MO1A 5FOBB 3CC2A 3HP3A 1PH9A 1YHBA 1U4LA 5C3EH 1FJGQ 5M3MG 4BBRH 4RA8A 1U5KA 1E24A 4A4IA 2VB2X 4RCNA 5GQOA 2F3VA 2K5DA 3R8BA 4H0LC 1I4HA 2B2VC 1V1PA 1W6JA 3JAMi 5EPJA 1S72A 3NBIA 1CZGA 4Q0FA 1XNQQ 4A3GB 2DUDA 1AFPA 3OWEB 4ALPA 1BUVT 1EIGA 1IXRA 1LABA 2E76C 1CHQD 2VXWA 3K5OA 1GUGA 1JWSD 2AQ3B 2UXBL 4BA2I 1U0LA 4DV5L 2E75C 1KDBA 5C4XG 4GLXA 4EX5A 3PCOB 3PIP3 4RAUC 5M5YH 2I07B 1CQFA 2L4NA 5C3WA 1PA6A 4ZCKA 3DUZA 4OX9L 3KBXA 3RZOB 4K5WA 4O42A 5IOCA 4DR6Q 1WCMB 5E4WC 2AWNA 3KDFA 3TZUA 4F8MA 4DXFA 1BO0A 5BN3A 2Z9HA 1EY6A 3HOYB 3T51B 2RHQB 3NTIA 4A93G 3ND8A 5FJ8H 5ISRA 2K33A 3L0OA 2ZXPA 4APVA 3KF6A 3W1GA 3S15H 4BBSB 1TS2A 1K83B 4LJZC 2LMCB 3TQYA 3IKJA 4K2LA 2IWHA 4TRDA 2ZM6L 3RZOH 4P74A 2AMCB 2B39A 2MGSA 1VQFA 1HR0W 4F88A 5C5MA 1C8CA 3A5ZB 3RD4A 4UP7A 1SYEA 2B8GA 1PH2A 3HOYH 2A6HC 1L0YB 1E2WA 2EYOA 1NTGA 4DR3Q 2RCFA 1GJXA 5FK9C 2WACA 2KCTA 4BY7B 1KD1C 1K83H 1D8LA 5BR8Q 1SLJA 2IJ0A 5JJLA 1H9SA 2ZXRA 2LKVA 3I7FA 4K5VA 3MTSA 2Y0SE 4DV3L 2EOTA 1A8VA 2JE6I 2NZOA 3KFUA 2WB1G 1PFSA 4UY8C 3HOXH 3RZDH 4YIJA 4JBMA 3EQLC 1Y8OB 1BOSA 1LM0A 1LTSD 2BDOA 3KLWA 3FPPA 5ELEA 4BY7H 5JVH3 5IP9H 3NBHA 2K75A 4HMJA 2MNAA 1EU4A 3CW2C 4IPGA 2F03A 3Q23A 4K6LA 3GTPB 1VQNA 1EZ8A 4LFBQ 3MAQA 5K5PA 3H3VI 4CDEC 1TU2B 1I4PA 2KENA 5I2YA 1EYDA 3I90A 1SMYC 2QCPX 4FP5D 1F2MA 2ZTDA 2CCZA 3CCLA 1IBKQ 3QB3A 2LS01 2N78A 1F9PA 4XQQA 1W3SA 5ELOA 3S24A 4A3BB 1STEA 4RKLA 2WAQE 2QEJC 2AWOA 4DUYL 4KHPQ 1KRTA 4IOCA 1YBYA 3PUYA 4C3JG 5DM73 1A6XA 3G7LA 4K14A 3GTPH 1HNXL 3K5LA 1O7LA 1PV4A 3HG9A 1DOLA 2EQSA 2EZVA 2I5MX 3S9WA 4A76A 2X6LA 1AE2A 4OONA 5D3IB 3W2DA 4UP9A 3FPUB 1HZ9A 2CH4W 4A3BH 4A75A 5CBEE 3F2BA 2NB0A 1RKNA 1WYDA 1I94Q 4OELB 1FVIA 2XRSD 2D2CC 4IJHA 5DM63 1C9OA 5KIXA 1S5DD 1YIJA 1V1PB 1PRTD 3QIAA 2D0PA 1ML0D 4QL5A 3A54A 1HCZA 3A55A 1SFOB 1J6QA 3S2DB 4OO1G 3T13A 5C0XJ 5DNFA 1GUWA 1QVCA 1E0BA 4GKKL 2VQEQ 4ZK9B 4QCLA 3MXPA 4GNXB 3H0GB 3CKIB 1NMFA 4DUZQ 1MSGA 1F9QA 1L0WA 3CP0A 1VQHA 2UXBQ 1DCZA 2R7ZG 1F2YA 3S2HB 2ES2A 3TP5A 3NE5B 2NVTH 1SFOH 2AUJD 2JA6G 2EYFA 1K3BC 4KHVA 3TRZA 4ILWA 1IW7C 1D2BA 1V1QA 3KDFB 4HIOA 3LNNA 1I6VC 3M85A 1ONLA 4RKBA 2UXCQ 2O2LD 1HR0L 5LL6S 1YNNC 5GADC 5GAEC 3I73A 1N34L 4RG1A 1JJGA 5I6WA 1I3QB 1JQYD 2ZT9C 3KF6B 3S2HH 1K8AC 2FINB 2F0PA 1AW7A 5IYCH 4G7OC 3I2ZA 4IUUA 1E22A 4ZAIA 2HQEA 2F0JA 4DU9A 5KNCA 3C3LA 3NUCA 4QGUA 3HOZB 2WV6D 2PYKA 3CPWA 3PSIA 4X3UA 1K9MC 3PQIA 2YU9B 1Y1VB 2Q2IA 2ZM6Q 4J6HA 4DV7Q 1K8GA 4NMZA 4QMGA 1QVFA 2Q2UA 4X65L 3BYTB 1BDOA 1V8QA 4IO9A 1NE3A 3UE0A 2I5HA 1WI5A 1PRTF 2B2UA 1BCPC 1STAA 1H9SB 1D5MC 3S16B 3CAMA 4ZRZA 2VZAA 1U4PA 1IYVA 3RN5A 3H91A 5JEAJ 5M3FG 4JI7Q 3KBGA 1QNKA 1I4GA 5E4XA 3J80E 2YU9H 1Y1VH 4DV3Q 4WFN3 2PQAB 2DNEA 2GVBA 1LTGD 5KNDA 1G2SA 1HPCA 2L12A 3NBHB 1NJIC 1OXSC 2WB1E 4HSPA 3T56B 3NSWA 5IT9E 3PUXA 1MD2D 3S16H 3PO2G 2J0TD 3MC0B 1BNZA 2PI2E 4UPAA 1IBLQ 1EL0A 2TMPA 5CMDA 4IUTA 5KGUA 2LY7A 3ZYYX 3E3XA 1X3EA 2A6EC 3K0XA 3T4AC 5CV5A 3WWVA 4DF7A 4X64Q 5IWAQ 2RF4A 2ZTCA 5BN5A 2BH8A 4H44C 1PH4A 1LLRD 1HFNA 3K59A 4P75A 1JOKA 1O80A 1PTOD 1NSNS 4R4IA 4JI2L 1K3RA 4RHRA 2YTYA 2LSSA 2MQHA 3BVZA 2JA5B 4AQYQ 1UE1A 2CH4A 3H09A 1JC7A 1LO5D 5IP7G 5KYIA 2Q2HA 4GOPB 3J80L 4BXXG 3CCSA 4C1NK 1SR3A 4IJLA 4X3TA 5LMNW 1WOCA 3AB9A 4C56C 1A3VA 4JBJA 4A3LH 1LACA 1JE4A 4NDXA 1QE6A 2Y0SB 2CWAA 3SEBA 2PZUA 1VQOA 1BBXC 4TSSA 2C9OA 1Q12A 4DV4L 1FNWA 4XT1B 1SMXA 1O7YA 4BWGB 1CTMA 2XSCA 1X3QA 2JA5H 3R3OA 4QUFA 1XYIA 1Q8IA 3Q0AA 3UI2A 4DK6C 2O4XA 3SK8A 2KHIA 3D31A 4A3MB 4ABNA 3KJOA 2VUMG 1BBUA 3I55A 1ASYA 3MZ5A 1GM5A 5A2QE 3MXNA 4GLAC 2K01A 3D6WA 5IGEA 4GKKQ 5EQ0A 4C3HH 4DR7L 2PI2A 3FHWA 4N9TA 3HFZB 1KLUD 3CXCA 3EJIA 4DAVA 1RCVD 2EXZA 2LXKA 1EWCA 1O78A 4MN3A 2WAQB 4I65A 2NZHA 1LTAD 3J7ZC 3OSOA 4B3ML 1Y14B 3K0YA 2F1MA 2L5TA 2B2YC 3M7NA 3NTKA 1YJWA 1X3GA 4HJ5A 1X56A 3FKIB 4DR5L 4K2KA 1PTOF 2XGTA 3NEMA 1JJCB 2JP1A 3PUZA 3PMFA 1L0XB 2D62A 5CV8A 1A3UA 1H9JA 5NUCA 1K8MA 1TQOA 1N33L 1DYQA 1LTBD 1PFMA 4JI3L 1PYBA 3Q24A 4FF4A 2NTTA 2WFWA 1RF2D 1WTRA 4LF6L 4MNOA 3E9HA 1VQ6A 1C48A 2NVYB 3J80i 3AFQA 2A73B 5C4JB 1SNPA 4C1NI 5A2QL 1K0RA 3DEOA 2NN6G 3FKIH 5IYBH 4K5XA 2A68D 5M3MB 3C46A 3GV3A 4NKLA 5IYDH 1Z6HA 4DN4M 1WJJA 4JVZA 4KLKA 4JI1L 4NB3A 1T5XD 1FD7D 5H1SE 2Z1CA 1A0IA 2C35B 2J7ZA 2UU9Q 1GUOA 1MKHA 2ID0A 5C44G 4FXGC 4LUVA 5C0XG 1WTWA 2EY1A 1PTOB 5KEEA 1S5ED 1XMOQ 1PH7A 2NVYH 5C4JH 3U4ZA 4JK1C 1A2UA 3CCEA 2XTIA 4K0KL 4QB4A 2VW9A 2K5QA 3ZJYC 5M3MH 5AFWA 1A15A 5CV9A 1IL2A 1AN8A 1TWGB 3CCVA 1HXYD 4QF4A 1BBWA 1R4QB 5J1ZA 1EYCA 1OXTA 5C4XB 3VR3A 2UUBL 1D5XC 2E2JB 1KHIA 1NR4A 4LF9Q 1Z9FA 4I7ZC 3I4MG 1XTCD 2H5XA 4IPCA 1VQ8A 1R9TB 1LT5D 5G3LF 1L1OC 3T1YL 4XQJA 1AE3A 2E2DC 1J9OA 4JI8Q 1B3QA 1UEAB 5EAYA 2CW0C 1TWGH 2Q8TA 2B8FA 3DLLA 5GROA 4RCOA 4DGZA 2EPBA 4A93B 5EKKA 2EYMA 5C4XH 3WDNA 4JOIC 1B8AA 3F1ZA 1E1TA 3FMCA 4O0AA 3GTMB 1Y8NB 2E2JH 4RHSA 4C3IG 3DWPA 1XMQL 1HNZQ 1KDCA 1LT4D 1JCKB 3HKZG 1CKNB 2L15A 5HY6A 1QZGA 4A3CG 3GTJH 4KHZA 1U4MA 3CCUA 3S1QH 1SXTA 3CC7A 1NNXA 2VB3X 1UE5A 3TP8A 3O13A 3GD7A 2E5LQ 2MO0A 3I4NH 4A93H 4OO1I 2HD3A 2CQAA 4CGYB 5CV6A 1A2TA 5FKAC 3GTMH 1TWAB 3J81c 4OIJA 2AKWB 5JEAG 1N36L 4R4QA 4IALA 4DV4Q 1PYWD 1N9WA 3SXHA 1AP0A 1EY9A 2WB1B 2UXDQ 1VQ9A 1I4XA 2B3GA 3MXNB 5C4ZA 1GUSA 1JMCA 4X3KA 2NVXB 4LFAL 3M7GA 2CVRA 3I72A 4XT3B 3M3YB 3PV0A 1XJVA 1W2BA 1J5EL 4CJ1B 3HOWG 1WTPA 3ERQA 1EY0A 1VQAA 5E1FA 2CHBD 1OXUA 2O5JC 4L5RC 1TWAH 3BJUA 1AZQA 3RR5A 3J7AF 2JEBI 3A8IE 1B70B 3PIOA 3JC66 1IHZA 2BOSA 4DXGA 3E9IA 4DV2Q 1IYJB 4FNFA 1C0AA 5EKIA 4GZYC 2YV5A 2NVXH 2IHEA 2R92G 3S1MB 4K8IA 4B3TL 3OW7A 3M3YH 2E74C 4B3MQ 2UUAL 2F0HA 5JVG3 1PH5A 4KY5A 3VYTA 2EJGC 2F0GA 3Q8DA 4OEMB 4PZ6A 4C3JB 4OHJA 3IFTA 5IGBA 4A3GH 1KIXA 3NP8A 2MUYA 3ND9A 1EY5A 1KLGD 2SNSA 2EJFC 2VQFQ 2EY6A 4HJ9A 4M1UB 1VQDA 2M9VA 1STBA 4IZ8A 4KY6A 4OWXB 4JI3Q 5T1IA 1Q86C 1STNA 1SEBD 1TS3A 1CSPA 3DXJC 3ONAB 3CMEA 1VQ5A 3SK5A 4LF6Q 1SMYD 3S1MH 3NQIA 2ASBA 4NPSA 3OMGA 1VQGA 1J8IA 2HDMA 3DEPA 5FO7B 3ER0A 4BS9A 1D1IA 3K5NA 1SE2A 5EKLA 3I3CA 2DJFC 3E5SA 2F0QA 3I56A 5C6AA 3FP9A 1VQKA 1EQVA 2QF7A 4JI1Q 2EVBA 1WCMH 5JJKA 1VQPA 1PH8A 4CDDC 1GKHA 4O1NA 1X65A 3X3NA 3OOCA 1B2TA 1TR5A 3OW2A 1UAPA 2KHJA 2FXQA 3GTQB 1HNWL 1VQ4A 1I5FA 2RHSB 2X69A 4CHTB 2I0QA 3TBIB 1OXVA 4E6IA 3OWFA 1LYLA 4JI0Q 4BBSH 4DK0A 4XIGS 1EYAA 2RSNA 1GHJA 2Z6KA 3UE1A 5DLQE 2R7ZB 5COYA 3STBD 2MHVA 3K6OA 1I50B 1HA6A 1GVPA 3BZCA 4DV6Q 4B3RQ 4OO1H 2ZJRA 2JA6B 4IN3A 4R8NA 3T1HL 3C2PA 3LWUA 4JG2A 2X6GA 4A3FG 1YNXA 4PMBA 3GTQH 3R93A 1TY0A 4EGVA 1EFID 3Q6SA 1RD9D 4PG3A 4HMIA 1XNRL 4LF4Q 4UDUC 3SHLA 4JI5L 3ERSX 4YWLA 2N55A 2R7ZH 3HEJA 1I50H 4N9PA 4P2CB 2H4OA 2JXMB 2A19A 3NENA 2RDFA 2JA6H 4A3IG 3D4DA 1YZ6A 2IT1A 1B7YB 4ZUJA 1UEBA 4GLVB 5I9OA 1NMGA 2LFNA 4GS3A 4IOAA 1FNUA 4DR4Q 1FL0A 2PNRC 2JA8G 4A3DG 3NXWA 1SRUA 2HDLA 2PQEA 4KY7A 2R7FA 4NXNQ 1CZWA 3HKZE 4CDCC 2B2WA 2RA4A 5ELCA 2KUMA 4DKAC 1KAWA 3SDZA 3VR5A 1HUMA 2JA9A 2JA7G 1KXLA 1Q8KA 3RNUA 2R93G 3RLFA 4JV5L 1OXXK 4FF3A 1QVGA 3UDXA 5J39A 5FJ8G 2V4DA 4KV6A 5ELFA 5M3FB 1EZ6A 1NY4A 1TWHB 4GNXC 3GDEA 1MSHA 3TZDA 4A3KG 1VMPA 1UNSA 1ESFA 3UDIA 2MFIA 4LUOA 4L6TB 3X3MA 1HZBA 2R3ZA 5FLXc 1HHVA 2M00A 1EIFA 3NK9A 3PO2B 1BCPD 4GKJL 1JOQA 4R4OA 2XWJB 5M3FH 1GHKA 1EIHA 2EYPA 3H94A 5JJZA 2F4VL 1HH2P 1TWFB 5KNBA 1E1OA 3JAMc 2K28A 1YI2A 4RGMA 1TIID 4EQNA 2ENBA 1D1KA 3TMEA 3HOXG 4OWWB 4DV5Q 1EFWA 3AYHB 1G6ZA 3J81E 3S2DH 1DONA 1BQQT 2NN6I 4ZKBB 1HQMC 5K36G 1HJPA 3MFYA 3E0JA 4KJOA 2OQ0A 4OX9Q 4X62L 4FF2A 2KA7A 1I6HB 2NUCA 2GVAA 1D6EC 1JR0D 3H0GH 2A6ED 5KRUA 1U9RA 5C0XI 3M4QA 4M8AA 4U673 5LMUL 3HGBA 1QJOA 4J8QA 4H13C 3KOJA 2N49A 3KYHC 1SE8A 1Z7TA 5D14A 2XRQD 4C2MB 3NELA 2JQOA 4QUCA 1SYCA 1RJTA 2K04A 2EE1A 3ULLA 1KNEA 2VUMB 4BXXH 3H3VH 1ASZA 5M9OA 1I3QH 2E2HB 1QG7A 3EROA 2ZXOA 1PFNA 4YWKA 4HJAA 4X66L 1YNJD 2A8VA 4EQPA 3AMUA 2KHSA 1AZPA 3TSSA 2QEXA 1SBBB 3J81L 4IQZA 2NWGA 4C2MH 1VQLA 1VS0A 1FGUA 3I8ZA 2EYLA 3G6JB 1BCPF 2ALYB 3DWAA 3HOZH 2B2YA 3SR1A 5J22A 1DM0B 1S5FD 4OIKA 1M90C 2VUMH 5A35A 2OF1A 1HTLD 4JI6L 2Z8LA 4NW2A 2F0WA 4N8X1 1KC8C 1JWUD 4FDBA 1I4QA 4JI4L 2E2HH 1WD1A 1OO9B 3A7AB 4A3JG 3OTOL 4LF5L 1S40A 1KTKA 3VYSA 4LFCL 3SVMA 4CBVA 2WINB 2UUCL 2QILA 4IUVA 4DV1L 5T1GA 1KAAA 5F2DA 5C4HA 4MHEA 5CORA 3G48A 1SNQA 4GOPC 3SK4A 3TS0A 4IFDJ 3UDGA 1YJNA 3FRPB 1PRTB 4YY3L 3PGZA 1WTXA 2A1AA 3N6RA 1EEFD 1S5BD 2KCCA 1HTPA 3K7UC 3I91A 3AQQA 1SJED 3W5OA 5AJ3L 3GTKB 1E2ZA 1YEZA 1BCPB 3C1EA 1JE5A 1PH3A 4DUYQ 3GO5A 3PF4A 4JYAL 4O2DA 4B3SL 4HR7B 3MHBA 2F0UA 2CQOA 1SE3A 1HNXQ 5C44B 2VY3A 5DEHA 2QDLA 1N8RC 4FO2A 1N32L 3GTGB 3KJPA 3OYYA 4B08A 5IYCG 1BKBA 2JJQA 3CD6A 4KMUC 2F0NA 1LTLA 2K5WA 1HRJA 5E3FA 1V9PA 1BR9A 3TS2A 3GTLB 1M8AA 2SNMA 1XPOA 5C0XH 2C5CA 1FGBD 1VF7A 4DNTB 2OQKA 1L1OA 3I4MB 3BG3A 3AU7A 1VQIA 1MIUA 5CV4A 2BA1A 3GTGH 1YJ9A 1ENFA 4L8JA 2B63G 2F52A 1Q3LA 4JOIA 1NR2A 2B2TC 1JICA 1PDQA 4FXKC 4OL7A 5FLMG 1EQRA 5TSSA 5L37A 2Z0SA 4QY7A 4KKSA 5GAGC 2Z6BA 4A3MH 3PIPA 4LWCA 4QJFA 4C3IB 5M5XB 3I4MH 2N3SA 1RDPD 1ZXTA 5G3LD 3HKZB 1XNQL 1SYGA 1EYGA 1STHA 1WD0A 1F2LA 5I2XA 2M2LA 1HR0Q 3K7AB 5IGGA 3EVQA 5C3XA 1PH1A 1N34Q 4ZUIA 3CRKC 3EBEA 1BXTA 2F0DA 2L1BA 1UUPA 4A3EG 5KYLA 4FXDA 1ZKOA 2SDFA 2DY7A 5M5WB 4C3IH 3HRZC 3TEHB 5JOBA 5M5XH 2MJ8A 2HIXA 4U68A 4G4KA 3BDCA 3URYA 1KNAA 4A3CH 1DOMA 5EBDA 3P20A 1VQCA 3GV6A 2IY5B 2B2VA 4NXML 4DR6L 3K7AH 4K6DA 4HJ7A 2F0VA 1SNDA 2IHFA 3CF5A 4Q5VA 4X65Q 1VQ7A 4ID6A 4DFAA 4PZ7A 3HOWB 3CCRA 1TS5A 2HIVA 1D5ZC 2PMZE 3MWYW 2A69C 1ZYRC 1X32A 2HUGA 5JEAH 4A3LG 1IL8A 1M4VA 2KBNA 5I6YA 1TVXA 2K6AA 1EWHA 3D3RA 4HN7A 1ZEQX 1PFBA 1F9SA 4YCWA 1WFQA 4P72A 1ET6A 5I4DA 5IIFA 1OTCA 2EJMA 4JC0A 2R92B 2TSSA 1K73C 5FLXL 5IGDA 2KCNA 3HOUG 3QO2A 4ULLA 3OTOQ 1CM9A 3N52A 4DR3L 1T5EA 1TS4A 1PTOH 2WKDA 4LFCQ 1VCIA 4IUPA 5JPNC 5IE8A 4C3HG 1A3TA 3D4RA 1SYBA 3U50C 3CHBD 3DHQA 3VA7A 3W1BA 4L5QA 3U58A 3QR8A 2H1EA 2PZWA 1CKOA 2VS1A 4ZYSA 3AEVA 1QWYA 3I70A 2F3IA 4RGNA 1SNOA 5LMNL 2R92H 3JAML 2NVQB 4YY3Q 5LL6X 2L9HA 4LF7L 2PCFB 2SEBD 5CV7A 1KDAA 2MPMA 1DZ1A 1PZKD 1Q1BA 4JI2Q 3I4LA 4WJ3M 4V0BA 3D8GA 4DA2A 1HQRD 3T53B 3HS0C 1RL2A 1EQTA 1PXUA 1UE7A 1R9TH 3FDTA 3RLOA 2IX1A 1G8ZD 5ELBA 1A63A 2WIIB 2PW5A 3ULPA 2XVSA 3K8AA 3WOEA 2NVQH 1W6KA 2YTXA 1VDZA 1IBKL 4GN5A 1Y8PB 1O7ZA 5EBCA 3TREA 1N32Q 4YWMA 1CQVA 3J7AV 4IPHA 3OMCA 1XPRA 4POFA 2KOLA 4ODGA 3SE0A 1JJ2A 4KHPL 3G4SA 4LF8L 3PUVA
chains in the Genus database with same CATH topology
3J81j 3CPWA 3PSIA 4PG3A 3U4VA 1K9MC 1X54A 4DV2L 4X62Q 2Q2IA 4DAMA 2ZM6Q 1XNRL 1GO3E 2K52A 4DPGA 3PF5A 4DV7Q 1Q82C 1K8GA 4LF4Q 3EIVA 1QVFA 2Q2UA 4X65L 2E8GA 4JI5L 3ERSX 4YWLA 2R7ZH 2YTVA 4IO9A 1I50H 1NE3A 2EXDA 4BA1I 3UE0A 2I5HA 2A19A 2CKZB 3NENA 1WI5A 4DAYB 2GN5A 2JA6H 4OWTB 1IBMQ 3K80C 5LMUQ 4A3IG 2K5VA 1YZ6A 3PO3G 2IT1A 1VQBA 1B7YB 1UEBA 4GLVB 3UDFA 1G51A 1KRSA 3CAMA 1Q1EA 4EQ5A 4DR7Q 1NMGA 2VZAA 4GS3A 1I94L 4IOAA 3RN5A 1Y1WG 4OXPA 5JEAJ 4ME3A 5M3FG 4HIKA 1FL0A 3VDYA 4JI7Q 2JA8G 4DR4Q 1PHJA 4A3DG 3I4OA 1SRUA 4IFDG 2R7FA 3LGJA 2YU9H 2VQFL 4NXNQ 1Y1VH 3HKZE 1HZCA 4DV3Q 1UE6A 4LW1A 4R1JA 4DKAC 1KAWA 2PQAB 2GVBA 1UWVA 2JA9A 1VQJA 2JA7G 1KXLA 1CUKA 1Q8KA 3RNUA 2BH2A 2R93G 3RLFA 3CMAA 4JV5L 3NBHB 3A5UA 1OXXK 1NJIC 1OXSC 2WB1E 4A3FH 4YCVA 3UDXA 1QVGA 4X66Q 1XTDA 5M5WH 5FJ8G 4H02A 3PUXA 4POGA 2VQEL 1NY4A 4GNXC 3GDEA 3S16H 4DR5Q 3PO2G 4P71A 4PMWA 4AIMA 4YHHQ 3CCMA 2PI2E 4UPAA 4DV0L 4A3KG 1IBLQ 2R6GA 3UDIA 2MFIA 4LUOA 3S1NH 1X3EA 4DUZL 2JA5G 1N33Q 1LUZA 3K0XA 1HZBA 3KF8B 3WWVA 4X64Q 5FLXc 5IWAQ 2RF4A 1BVSA 2ZTCA 4GNXA 2BH8A 1SN8A 1PH4A 4JI6Q 4LNQA 3CQZH 3EN2A 1EIFA 4P75A 4JI4Q 4A3IH 3HOWH 3PO3H 4R4IA 1PVOA 1VQMA 4LF5Q 1X3FA 4JI2L 4GKJL 3CCJA 1K3RA 4PZ8A 2JEAI 4R4OA 1Y1WH 2UUCQ 5JJIA 5M3FH 4A3DH 2JA8H 2YTYA 2Y0SG 4DV1Q 4JI0L 2F4VL 2LSSA 2MQHA 2UXCL 3CCQA 5BR8L 1HH2P 4AQYQ 1MJEA 3S17H 1UE1A 4C3JH 4YCUA 4NXMQ 4DR2Q 3J80c 4P73A 5IP7G 1E1OA 4BY1G 3JAMc 2AHOB 2JA7H 2Q2HA 1EOVA 4GOPB 1YI2A 4GN4B 4DV6L 4BXXG 4L5TA 2R93H 4B3RL 1YITA 1QZHA 4QQBX 3CCSA 1YHQA 4R4TA 3HOXG 1SR3A 4IJLA 4R4CA 5J3BA 1WOCA 1X6OA 5LMNW 4A3MG 4OWWB 4DV5Q 3I4NG 1EFWA 4JBJA 3AYHB 2HHHQ 4A3LH 3S2DH 1Q81C 1Q46A 2CWAA 3B6YA 5AJ3Q 3L2PA 3HOVG 5IT9c 2NN6I 4A3KH 2ZJPA 1VQOA 2B29A 5K36G 1Q12A 1HJPA 4DV4L 1SMXA 2YYZA 4K0KQ 2OQ0A 2JA5H 4OX9Q 4JYAQ 4B3SQ 4X62L 4JBKA 4DV7L 2GVAA 4LF4L 4DK6C 3H0GH 4AYBG 2BA0A 4LFBL 4AH6A 1PH6A 2KHIA 5C3EG 3D31A 3KJOA 2VUMG 4BBRG 1BBUA 3I55A 2EIFA 1ASYA 2WAQG 5C0XI 3M4QA 1GM5A 5E7NA 2UUBQ 4GLAC 5LMUL 4HJ8A 1DGSA 3KOJA 3F2CA 4GKKQ 2OTLA 1P8LA 2N49A 3KYHC 4C3HH 4DR7L 1SE8A 2ZTEA 2PI2A 2R7DA 3RLNA 3FHWA 3BU2A 3NELA 4JBWA 4UP8A 4JI7L 2JQOA 4DR4L 1E7ZA 1E3PA 3FKIG 3HFZB 5IYBG 4TQUS 3CXCA 1RIPA 4NXNL 3T1YQ 4BY1H 2LXKA 3ULLA 2N8NA 3E0EA 1AH9A 4BXXH 5IYDG 3H3VH 1ASZA 1L1OB 5HGQA 5LMNQ 3S1RH 2HQLA 2NZHA 3PUWA 3J7ZC 4LF7Q 2Q2TA 1I3QH 4B3ML 1Y14B 3H15A 2I5LX 1YVCA 3M7NA 1YJWA 4YWKA 2PQAA 4X66L 1A62A 1V43A 4HJAA 2A8VA 1S3OA 3CC4A 3HOVH 2OCEA 1X3GA 1XMQQ 4HJ5A 1JB7A 1X56A 5ELNA 4DR5L 1YHAA 2QEXA 3NEMA 2XGTA 1JJCB 1TWCH 3PUZA 1IBLL 4WJ4A 2MO1A 2D62A 4C2MH 1VQLA 1VS0A 1FGUA 3CC2A 4A3GG 1PH9A 2ALYB 1N33L 3HOZH 1YHBA 2PNHA 3RN2A 5C3EH 1FJGQ 5M3MG 4X64L 1M90C 5IWAL 4BBRH 2VUMH 2D0OA 1U5KA 4JI3L 1E24A 1PYBA 4A4IA 2WFWA 4JI6L 2K5NA 5GQOA 1KC8C 2V1CC 4LF6L 4FDBA 4JI4L 4MNOA 2E2HH 3E9HA 4A3JG 1VQ6A 3J80i 3OTOL 3AFQA 4LF5L 1S40A 3JAMi 4LFCL 1S72A 2UUCL 1XNQQ 3F8TA 1K0RA 2NN6G 3FKIH 5IYBH 4DV1L 2DUDA 2K50A 1N36Q 4ALPA 4AQYL 4LF8Q 1IXRA 3G48A 4GOPC 5IYDH 3TS0A 3A74A 4IFDJ 3UDGA 1WJJA 1YJNA 4KLKA 4JI1L 4NB3A 3M4OH 4LFAQ 4YY3L 3PGZA 1WCMG 5H1SE 1A0IA 2A1AA 2C35B 2UXBL 2UU9Q 4BA2I 4DNIA 1U0LA 1MKHA 2ID0A 3K7UC 5C44G 4LUVA 5C0XG 4DV5L 4L5SA 1O7IA 5C4XG 4GLXA 4EX5A 4DR1L 4GOPA 1XMOQ 1J5EQ 3HOYG 3AQQA 1PH7A 2NVYH 3W5OA 5AJ3L 1X9NA 5C4JH 3PCOB 1YEZA 3IRBA 3U4ZA 1Z47A 4KI0A 5M5YH 2XTIA 3G6EA 1JE5A 3CCEA 2CFMA 1PH3A 4DUYQ 1PA6A 3GO5A 1TWHH 3PF4A 4K0KL 4OX9L 4O2DA 2VW9A 4B3SL 4JYAL 4BBSG 2ZJQA 3ZJYC 5M3MH 2CQOA 3STBC 1IZ6A 1IL2A 1X55A 3CCVA 4DR6Q 2AWNA 2RCNA 3KDFA 1HNXQ 1BBWA 2VY3A 1OXTA 1NBWA 4A3JH 4B3TQ 5IY0A 2UUAQ 1N8RC 2UUBL 2RHQB 1N32L 1KHIA 4A93G 5FJ8H 4LF9Q 1Z9FA 3KJPA 3L0OA 4APVA 3OYYA 5IYCG 3KF6A 3W1GA 3I4MG 3S15H 3PO2H 4Y7NH 1KQSA 1BKBA 2H5XA 2JJQA 3CD6A 4IPCA 4DV0Q 1VQ8A 3TQYA 4BY7G 1LTLA 5IP9G 1L1OC 1V9PA 3T1YL 1GD7A 1AE3A 2ZM6L 4JI8Q 3RZOH 1QUQA 3TS2A 1TWFH 3HKSA 2AMCB 4P74A 5EAYA 3M4PA 1TWGH 1VQFA 1HR0W 3DLLA 5GROA 3A5ZB 1XPOA 4UP7A 5C4XH 1PH2A 3MEFA 2LXJA 4JOIC 3HOYH 1B8AA 1EQQA 3F1ZA 1E1TA 2OQKA 2Z6KC 1L1OA 1IBML 4O0AA 1NTGA 3A0JA 4DR3Q 2E2JH 1VQIA 2KCTA 1XMQL 1MIUA 1HNZQ 2BA1A 3M9BA 3GTGH 1YJ9A 1KL9A 1MJCA 1KD1C 2B63G 2F52A 3HKZG 1Q7YC 1CKNB 2L15A 5HY6A 1QZGA 1K83H 1D8LA 5BR8Q 4A3CG 1SLJA 5JJLA 4JOIA 3GTJH 4KHZA 3I7FA 3ULJA 2DGYA 4XTCS 5IP7H 5FLMG 3CCUA 2OWOA 1EQRA 2Y0SE 3S1QH 4DV3L 1I6HH 2Z0SA 3CC7A 3G71A 1A8VA 2JE6I 2NZOA 3KFUA 3D0FA 2WB1G 1PFSA 4QY7A 2OTJA 2WP8J 2QGQA 4UY8C 5GAGC 3HOXH 1UE5A 3RZDH 4A3MH 4JBMA 3PIPA 2E5LQ 3GD7A 2MO0A 3I4NH 4A93H 4LWCA 4QJFA 4OO1I 1EUJA 3I4MH 1LM0A 2N3SA 3GTMH 1XNQL 3J81c 4IPDA 1EYGA 1HNWQ 2AKWB 3KLWA 5JEAG 4A3BG 1N36L 4BY7H 4R4QA 4YHHL 5IP9H 4DV4Q 2K75A 1JT8A 1N9WA 2MNAA 2VL6A 3CW2C 2ATWA 4IPGA 1HR0Q 2K4KA 2UXDQ 1VQ9A 2B3GA 3MXNB 1JMCA 1PH1A 1N34Q 1VQNA 4LFBQ 3H3VI 4LFAL 2KENA 3EBEA 3PV0A 2UU9L 1TXYA 2ZTDA 1XJVA 2CCZA 4A3EG 3CCLA 1IBKQ 4AYBE 1XPUA 1W2BA 2N78A 1W3SA 1XMOL 1J5EL 5ELOA 4C3IH 3TEHB 4GN3B 3S24A 3T1HQ 3HOWG 1C7YA 5M5XH 1VQAA 1OXUA 2HIXA 2WAQE 4L5RC 1TWAH 2B63H 3BJUA 2AWOA 3J7A5 4DUYL 3RR5A 4A3CH 4KHPQ 2JEBI 1KRTA 3ICEA 5FLMH 1B70B 3PIOA 4IOCA 3JC66 1VQCA 1YBYA 2IY5B 3PUYA 4NXML 3E9IA 4DV2Q 4DR2L 1IYJB 1XNRQ 4DR6L 3K7AH 3GTPH 4HJ7A 1G291 1HNXL 1T9HA 2IHFA 1C0AA 1PV4A 3CF5A 1VQ7A 4X65Q 2YV5A 4JI5Q 2NVXH 1L2FA 2EQSA 2IHEA 2R92G 4B3TL 3M3YH 4PZ7A 4B3MQ 2I5MX 2UUAL 3CCRA 4A76A 4OONA 1AE2A 2HIVA 2PMZE 1PH5A 2HHHL 4UP9A 4LF9L 1HZ9A 4A3LG 4A3BH 4A75A 2KBNA 2K5HA 3AFPA 3Q8DA 3F2BA 3GTOH 1WYDA 1VQEA 3F2DA 2K14A 1HZAA 2QA4A 1I94Q 4PZ6A 1SROA 4YCWA 2VNUD 4A3GH 1FVIA 1WFQA 3K81C 1KIXA 4IJHA 4P72A 1C9OA 1CKMA 1OTCA 5GAHC 4JI8L 1P16A 2E2IH 4JC0A 1YIJA 2VQFQ 4HJ9A 1VQDA 3H0GG 4OWXB 4A3EH 1Q86C 2D0PA 1K73C 4JI3Q 3DM3A 1H95A 1CSPA 4QL5A 3CMEA 4LF6Q 1VQ5A 3S1MH 3HOUG 2ASBA 1J6QA 4HIMA 4JV5Q 4OO1G 4NPSA 3OTOQ 4DR3L 5C0XJ 1VQGA 1CSQA 4LFCQ 1QVCA 1HNZL 4GKKL 1VCIA 3ER0A 5IE8A 2VQEQ 3GTKH 3U50C 2HT1A 4JCVE 4IFDI 4GNXB 3W1BA 4L5QA 3U58A 3I56A 4Y52H 1NMFA 3FP9A 3L7ZC 2IX0A 1VQKA 4DUZQ 3J81i 1CKOA 2VS1A 3AEVA 4JI1Q 2F3IA 1CKNA 5LMNL 2R92H 1WCMH 1L0WA 3CP0A 5JJKA 4YY3Q 1VQHA 1VQPA 1PH8A 1GKHA 2E5LL 5C44H 4LF7L 2UXBQ 4TVAB 2R7ZG 4X6AH 1X65A 2ES2A 1G6PA 2NVTH 2KCMA 4DR1Q 1SFOH 2JK8A 3OW2A 2KHJA 3BZKA 3CPFA 2JA6G 1PYSB 1Q1BA 2FXQA 3TRZA 1HNWL 4JI2Q 1I5FA 2RHSB 4RMFA 1VQ4A 4GKJQ 2CWPA 4WJ3M 1V1QA 2I0QA 1OXVA 3KDFB 4HIOA 3M85A 1RL2A 1LYLA 4JI0Q 4BBSH 1EIYB 2F4VQ 2UXCQ 1HR0L 1UE7A 4J15A 1R9TH 4XIGS 4DK3C 4HIDA 3RLOA 3S14H 2UXDL 5GADC 5GAEC 1N34L 3HOZG 2Z6KA 4RG1A 4MZ9A 3UE1A 1FJGL 2IX1A 5DLQE 1A63A 1JJGA 1Y1VG 3STBD 1M1KC 1GVPA 3ULPA 3BZCA 4DV6Q 3K8AA 3KF6B 2NVQH 2YTXA 1IBKL 3GTLH 3HOUH 4B3RQ 4GN5A 4MTNA 2ZJRA 3S2HH 1K8AC 3TREA 1N32Q 3T1HL 4YWMA 4JG2A 4IPHA 1EWIA 4QIWE 4LUZA 1XPRA 5IYCH 4POFA 3I2ZA 4A3FG 1YNXA 1QUQB 3GTQH 1E22A 1JJ2A 4KHPL 3G4SA 1D7QA 3SGIA 4QGUA 4LF8L 3PUVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3J81 j;  3CPW A;  3PSI A;  4PG3 A;  3U4V A;  1K9M C;  1X54 A;  4DV2 L;  4X62 Q;  2Q2I A;  4DAM A;  2ZM6 Q;  1XNR L;  1GO3 E;  2K52 A;  4DPG A;  3PF5 A;  4DV7 Q;  1Q82 C;  1K8G A;  4LF4 Q;  3EIV A;  1QVF A;  2Q2U A;  4X65 L;  2E8G A;  4JI5 L;  3ERS X;  4YWL A;  2R7Z H;  2YTV A;  4IO9 A;  1I50 H;  1NE3 A;  2EXD A;  4BA1 I;  3UE0 A;  2I5H A;  2A19 A;  2CKZ B;  3NEN A;  1WI5 A;  4DAY B;  2GN5 A;  2JA6 H;  4OWT B;  1IBM Q;  3K80 C;  5LMU Q;  4A3I G;  2K5V A;  1YZ6 A;  3PO3 G;  2IT1 A;  1VQB A;  1B7Y B;  1UEB A;  4GLV B;  3UDF A;  1G51 A;  1KRS A;  3CAM A;  1Q1E A;  4EQ5 A;  4DR7 Q;  1NMG A;  2VZA A;  4GS3 A;  1I94 L;  4IOA A;  3RN5 A;  1Y1W G;  4OXP A;  5JEA J;  4ME3 A;  5M3F G;  4HIK A;  1FL0 A;  3VDY A;  4JI7 Q;  2JA8 G;  4DR4 Q;  1PHJ A;  4A3D G;  3I4O A;  1SRU A;  4IFD G;  2R7F A;  3LGJ A;  2YU9 H;  2VQF L;  4NXN Q;  1Y1V H;  3HKZ E;  1HZC A;  4DV3 Q;  1UE6 A;  4LW1 A;  4R1J A;  4DKA C;  1KAW A;  2PQA B;  2GVB A;  1UWV A;  2JA9 A;  1VQJ A;  2JA7 G;  1KXL A;  1CUK A;  1Q8K A;  3RNU A;  2BH2 A;  2R93 G;  3RLF A;  3CMA A;  4JV5 L;  3NBH B;  3A5U A;  1OXX K;  1NJI C;  1OXS C;  2WB1 E;  4A3F H;  4YCV A;  3UDX A;  1QVG A;  4X66 Q;  1XTD A;  5M5W H;  5FJ8 G;  4H02 A;  3PUX A;  4POG A;  2VQE L;  1NY4 A;  4GNX C;  3GDE A;  3S16 H;  4DR5 Q;  3PO2 G;  4P71 A;  4PMW A;  4AIM A;  4YHH Q;  3CCM A;  2PI2 E;  4UPA A;  4DV0 L;  4A3K G;  1IBL Q;  2R6G A;  3UDI A;  2MFI A;  4LUO A;  3S1N H;  1X3E A;  4DUZ L;  2JA5 G;  1N33 Q;  1LUZ A;  3K0X A;  1HZB A;  3KF8 B;  3WWV A;  4X64 Q;  5FLX c;  5IWA Q;  2RF4 A;  1BVS A;  2ZTC A;  4GNX A;  2BH8 A;  1SN8 A;  1PH4 A;  4JI6 Q;  4LNQ A;  3CQZ H;  3EN2 A;  1EIF A;  4P75 A;  4JI4 Q;  4A3I H;  3HOW H;  3PO3 H;  4R4I A;  1PVO A;  1VQM A;  4LF5 Q;  1X3F A;  4JI2 L;  4GKJ L;  3CCJ A;  1K3R A;  4PZ8 A;  2JEA I;  4R4O A;  1Y1W H;  2UUC Q;  5JJI A;  5M3F H;  4A3D H;  2JA8 H;  2YTY A;  2Y0S G;  4DV1 Q;  4JI0 L;  2F4V L;  2LSS A;  2MQH A;  2UXC L;  3CCQ A;  5BR8 L;  1HH2 P;  4AQY Q;  1MJE A;  3S17 H;  1UE1 A;  4C3J H;  4YCU A;  4NXM Q;  4DR2 Q;  3J80 c;  4P73 A;  5IP7 G;  1E1O A;  4BY1 G;  3JAM c;  2AHO B;  2JA7 H;  2Q2H A;  1EOV A;  4GOP B;  1YI2 A;  4GN4 B;  4DV6 L;  4BXX G;  4L5T A;  2R93 H;  4B3R L;  1YIT A;  1QZH A;  4QQB X;  3CCS A;  1YHQ A;  4R4T A;  3HOX G;  1SR3 A;  4IJL A;  4R4C A;  5J3B A;  1WOC A;  1X6O A;  5LMN W;  4A3M G;  4OWW B;  4DV5 Q;  3I4N G;  1EFW A;  4JBJ A;  3AYH B;  2HHH Q;  4A3L H;  3S2D H;  1Q81 C;  1Q46 A;  2CWA A;  3B6Y A;  5AJ3 Q;  3L2P A;  3HOV G;  5IT9 c;  2NN6 I;  4A3K H;  2ZJP A;  1VQO A;  2B29 A;  5K36 G;  1Q12 A;  1HJP A;  4DV4 L;  1SMX A;  2YYZ A;  4K0K Q;  2OQ0 A;  2JA5 H;  4OX9 Q;  4JYA Q;  4B3S Q;  4X62 L;  4JBK A;  4DV7 L;  2GVA A;  4LF4 L;  4DK6 C;  3H0G H;  4AYB G;  2BA0 A;  4LFB L;  4AH6 A;  1PH6 A;  2KHI A;  5C3E G;  3D31 A;  3KJO A;  2VUM G;  4BBR G;  1BBU A;  3I55 A;  2EIF A;  1ASY A;  2WAQ G;  5C0X I;  3M4Q A;  1GM5 A;  5E7N A;  2UUB Q;  4GLA C;  5LMU L;  4HJ8 A;  1DGS A;  3KOJ A;  3F2C A;  4GKK Q;  2OTL A;  1P8L A;  2N49 A;  3KYH C;  4C3H H;  4DR7 L;  1SE8 A;  2ZTE A;  2PI2 A;  2R7D A;  3RLN A;  3FHW A;  3BU2 A;  3NEL A;  4JBW A;  4UP8 A;  4JI7 L;  2JQO A;  4DR4 L;  1E7Z A;  1E3P A;  3FKI G;  3HFZ B;  5IYB G;  4TQU S;  3CXC A;  1RIP A;  4NXN L;  3T1Y Q;  4BY1 H;  2LXK A;  3ULL A;  2N8N A;  3E0E A;  1AH9 A;  4BXX H;  5IYD G;  3H3V H;  1ASZ A;  1L1O B;  5HGQ A;  5LMN Q;  3S1R H;  2HQL A;  2NZH A;  3PUW A;  3J7Z C;  4LF7 Q;  2Q2T A;  1I3Q H;  4B3M L;  1Y14 B;  3H15 A;  2I5L X;  1YVC A;  3M7N A;  1YJW A;  4YWK A;  2PQA A;  4X66 L;  1A62 A;  1V43 A;  4HJA A;  2A8V A;  1S3O A;  3CC4 A;  3HOV H;  2OCE A;  1X3G A;  1XMQ Q;  4HJ5 A;  1JB7 A;  1X56 A;  5ELN A;  4DR5 L;  1YHA A;  2QEX A;  3NEM A;  2XGT A;  1JJC B;  1TWC H;  3PUZ A;  1IBL L;  4WJ4 A;  2MO1 A;  2D62 A;  4C2M H;  1VQL A;  1VS0 A;  1FGU A;  3CC2 A;  4A3G G;  1PH9 A;  2ALY B;  1N33 L;  3HOZ H;  1YHB A;  2PNH A;  3RN2 A;  5C3E H;  1FJG Q;  5M3M G;  4X64 L;  1M90 C;  5IWA L;  4BBR H;  2VUM H;  2D0O A;  1U5K A;  4JI3 L;  1E24 A;  1PYB A;  4A4I A;  2WFW A;  4JI6 L;  2K5N A;  5GQO A;  1KC8 C;  2V1C C;  4LF6 L;  4FDB A;  4JI4 L;  4MNO A;  2E2H H;  3E9H A;  4A3J G;  1VQ6 A;  3J80 i;  3OTO L;  3AFQ A;  4LF5 L;  1S40 A;  3JAM i;  4LFC L;  1S72 A;  2UUC L;  1XNQ Q;  3F8T A;  1K0R A;  2NN6 G;  3FKI H;  5IYB H;  4DV1 L;  2DUD A;  2K50 A;  1N36 Q;  4ALP A;  4AQY L;  4LF8 Q;  1IXR A;  3G48 A;  4GOP C;  5IYD H;  3TS0 A;  3A74 A;  4IFD J;  3UDG A;  1WJJ A;  1YJN A;  4KLK A;  4JI1 L;  4NB3 A;  3M4O H;  4LFA Q;  4YY3 L;  3PGZ A;  1WCM G;  5H1S E;  1A0I A;  2A1A A;  2C35 B;  2UXB L;  2UU9 Q;  4BA2 I;  4DNI A;  1U0L A;  1MKH A;  2ID0 A;  3K7U C;  5C44 G;  4LUV A;  5C0X G;  4DV5 L;  4L5S A;  1O7I A;  5C4X G;  4GLX A;  4EX5 A;  4DR1 L;  4GOP A;  1XMO Q;  1J5E Q;  3HOY G;  3AQQ A;  1PH7 A;  2NVY H;  3W5O A;  5AJ3 L;  1X9N A;  5C4J H;  3PCO B;  1YEZ A;  3IRB A;  3U4Z A;  1Z47 A;  4KI0 A;  5M5Y H;  2XTI A;  3G6E A;  1JE5 A;  3CCE A;  2CFM A;  1PH3 A;  4DUY Q;  1PA6 A;  3GO5 A;  1TWH H;  3PF4 A;  4K0K L;  4OX9 L;  4O2D A;  2VW9 A;  4B3S L;  4JYA L;  4BBS G;  2ZJQ A;  3ZJY C;  5M3M H;  2CQO A;  3STB C;  1IZ6 A;  1IL2 A;  1X55 A;  3CCV A;  4DR6 Q;  2AWN A;  2RCN A;  3KDF A;  1HNX Q;  1BBW A;  2VY3 A;  1OXT A;  1NBW A;  4A3J H;  4B3T Q;  5IY0 A;  2UUA Q;  1N8R C;  2UUB L;  2RHQ B;  1N32 L;  1KHI A;  4A93 G;  5FJ8 H;  4LF9 Q;  1Z9F A;  3KJP A;  3L0O A;  4APV A;  3OYY A;  5IYC G;  3KF6 A;  3W1G A;  3I4M G;  3S15 H;  3PO2 H;  4Y7N H;  1KQS A;  1BKB A;  2H5X A;  2JJQ A;  3CD6 A;  4IPC A;  4DV0 Q;  1VQ8 A;  3TQY A;  4BY7 G;  1LTL A;  5IP9 G;  1L1O C;  1V9P A;  3T1Y L;  1GD7 A;  1AE3 A;  2ZM6 L;  4JI8 Q;  3RZO H;  1QUQ A;  3TS2 A;  1TWF H;  3HKS A;  2AMC B;  4P74 A;  5EAY A;  3M4P A;  1TWG H;  1VQF A;  1HR0 W;  3DLL A;  5GRO A;  3A5Z B;  1XPO A;  4UP7 A;  5C4X H;  1PH2 A;  3MEF A;  2LXJ A;  4JOI C;  3HOY H;  1B8A A;  1EQQ A;  3F1Z A;  1E1T A;  2OQK A;  2Z6K C;  1L1O A;  1IBM L;  4O0A A;  1NTG A;  3A0J A;  4DR3 Q;  2E2J H;  1VQI A;  2KCT A;  1XMQ L;  1MIU A;  1HNZ Q;  2BA1 A;  3M9B A;  3GTG H;  1YJ9 A;  1KL9 A;  1MJC A;  1KD1 C;  2B63 G;  2F52 A;  3HKZ G;  1Q7Y C;  1CKN B;  2L15 A;  5HY6 A;  1QZG A;  1K83 H;  1D8L A;  5BR8 Q;  4A3C G;  1SLJ A;  5JJL A;  4JOI A;  3GTJ H;  4KHZ A;  3I7F A;  3ULJ A;  2DGY A;  4XTC S;  5IP7 H;  5FLM G;  3CCU A;  2OWO A;  1EQR A;  2Y0S E;  3S1Q H;  4DV3 L;  1I6H H;  2Z0S A;  3CC7 A;  3G71 A;  1A8V A;  2JE6 I;  2NZO A;  3KFU A;  3D0F A;  2WB1 G;  1PFS A;  4QY7 A;  2OTJ A;  2WP8 J;  2QGQ A;  4UY8 C;  5GAG C;  3HOX H;  1UE5 A;  3RZD H;  4A3M H;  4JBM A;  3PIP A;  2E5L Q;  3GD7 A;  2MO0 A;  3I4N H;  4A93 H;  4LWC A;  4QJF A;  4OO1 I;  1EUJ A;  3I4M H;  1LM0 A;  2N3S A;  3GTM H;  1XNQ L;  3J81 c;  4IPD A;  1EYG A;  1HNW Q;  2AKW B;  3KLW A;  5JEA G;  4A3B G;  1N36 L;  4BY7 H;  4R4Q A;  4YHH L;  5IP9 H;  4DV4 Q;  2K75 A;  1JT8 A;  1N9W A;  2MNA A;  2VL6 A;  3CW2 C;  2ATW A;  4IPG A;  1HR0 Q;  2K4K A;  2UXD Q;  1VQ9 A;  2B3G A;  3MXN B;  1JMC A;  1PH1 A;  1N34 Q;  1VQN A;  4LFB Q;  3H3V I;  4LFA L;  2KEN A;  3EBE A;  3PV0 A;  2UU9 L;  1TXY A;  2ZTD A;  1XJV A;  2CCZ A;  4A3E G;  3CCL A;  1IBK Q;  4AYB E;  1XPU A;  1W2B A;  2N78 A;  1W3S A;  1XMO L;  1J5E L;  5ELO A;  4C3I H;  3TEH B;  4GN3 B;  3S24 A;  3T1H Q;  3HOW G;  1C7Y A;  5M5X H;  1VQA A;  1OXU A;  2HIX A;  2WAQ E;  4L5R C;  1TWA H;  2B63 H;  3BJU A;  2AWO A;  3J7A 5;  4DUY L;  3RR5 A;  4A3C H;  4KHP Q;  2JEB I;  1KRT A;  3ICE A;  5FLM H;  1B70 B;  3PIO A;  4IOC A;  3JC6 6;  1VQC A;  1YBY A;  2IY5 B;  3PUY A;  4NXM L;  3E9I A;  4DV2 Q;  4DR2 L;  1IYJ B;  1XNR Q;  4DR6 L;  3K7A H;  3GTP H;  4HJ7 A;  1G29 1;  1HNX L;  1T9H A;  2IHF A;  1C0A A;  1PV4 A;  3CF5 A;  1VQ7 A;  4X65 Q;  2YV5 A;  4JI5 Q;  2NVX H;  1L2F A;  2EQS A;  2IHE A;  2R92 G;  4B3T L;  3M3Y H;  4PZ7 A;  4B3M Q;  2I5M X;  2UUA L;  3CCR A;  4A76 A;  4OON A;  1AE2 A;  2HIV A;  2PMZ E;  1PH5 A;  2HHH L;  4UP9 A;  4LF9 L;  1HZ9 A;  4A3L G;  4A3B H;  4A75 A;  2KBN A;  2K5H A;  3AFP A;  3Q8D A;  3F2B A;  3GTO H;  1WYD A;  1VQE A;  3F2D A;  2K14 A;  1HZA A;  2QA4 A;  1I94 Q;  4PZ6 A;  1SRO A;  4YCW A;  2VNU D;  4A3G H;  1FVI A;  1WFQ A;  3K81 C;  1KIX A;  4IJH A;  4P72 A;  1C9O A;  1CKM A;  1OTC A;  5GAH C;  4JI8 L;  1P16 A;  2E2I H;  4JC0 A;  1YIJ A;  2VQF Q;  4HJ9 A;  1VQD A;  3H0G G;  4OWX B;  4A3E H;  1Q86 C;  2D0P A;  1K73 C;  4JI3 Q;  3DM3 A;  1H95 A;  1CSP A;  4QL5 A;  3CME A;  4LF6 Q;  1VQ5 A;  3S1M H;  3HOU G;  2ASB A;  1J6Q A;  4HIM A;  4JV5 Q;  4OO1 G;  4NPS A;  3OTO Q;  4DR3 L;  5C0X J;  1VQG A;  1CSQ A;  4LFC Q;  1QVC A;  1HNZ L;  4GKK L;  1VCI A;  3ER0 A;  5IE8 A;  2VQE Q;  3GTK H;  3U50 C;  2HT1 A;  4JCV E;  4IFD I;  4GNX B;  3W1B A;  4L5Q A;  3U58 A;  3I56 A;  4Y52 H;  1NMF A;  3FP9 A;  3L7Z C;  2IX0 A;  1VQK A;  4DUZ Q;  3J81 i;  1CKO A;  2VS1 A;  3AEV A;  4JI1 Q;  2F3I A;  1CKN A;  5LMN L;  2R92 H;  1WCM H;  1L0W A;  3CP0 A;  5JJK A;  4YY3 Q;  1VQH A;  1VQP A;  1PH8 A;  1GKH A;  2E5L L;  5C44 H;  4LF7 L;  2UXB Q;  4TVA B;  2R7Z G;  4X6A H;  1X65 A;  2ES2 A;  1G6P A;  2NVT H;  2KCM A;  4DR1 Q;  1SFO H;  2JK8 A;  3OW2 A;  2KHJ A;  3BZK A;  3CPF A;  2JA6 G;  1PYS B;  1Q1B A;  2FXQ A;  3TRZ A;  1HNW L;  4JI2 Q;  1I5F A;  2RHS B;  4RMF A;  1VQ4 A;  4GKJ Q;  2CWP A;  4WJ3 M;  1V1Q A;  2I0Q A;  1OXV A;  3KDF B;  4HIO A;  3M85 A;  1RL2 A;  1LYL A;  4JI0 Q;  4BBS H;  1EIY B;  2F4V Q;  2UXC Q;  1HR0 L;  1UE7 A;  4J15 A;  1R9T H;  4XIG S;  4DK3 C;  4HID A;  3RLO A;  3S14 H;  2UXD L;  5GAD C;  5GAE C;  1N34 L;  3HOZ G;  2Z6K A;  4RG1 A;  4MZ9 A;  3UE1 A;  1FJG L;  2IX1 A;  5DLQ E;  1A63 A;  1JJG A;  1Y1V G;  3STB D;  1M1K C;  1GVP A;  3ULP A;  3BZC A;  4DV6 Q;  3K8A A;  3KF6 B;  2NVQ H;  2YTX A;  1IBK L;  3GTL H;  3HOU H;  4B3R Q;  4GN5 A;  4MTN A;  2ZJR A;  3S2H H;  1K8A C;  3TRE A;  1N32 Q;  3T1H L;  4YWM A;  4JG2 A;  4IPH A;  1EWI A;  4QIW E;  4LUZ A;  1XPR A;  5IYC H;  4POF A;  3I2Z A;  4A3F G;  1YNX A;  1QUQ B;  3GTQ H;  1E22 A;  1JJ2 A;  4KHP L;  3G4S A;  1D7Q A;  3SGI A;  4QGU A;  4LF8 L;  3PUV A; 
#chains in the Genus database with same CATH topology
 3J81 j;  1QB5 D;  3F2U A;  3KLR A;  1X54 A;  4UAI A;  4DAM A;  4K8J A;  1Q82 C;  2E8G A;  1JWM D;  2YTV A;  2EYJ A;  4Z9C B;  4BA1 I;  1JOR A;  4HCE A;  4CKC A;  2CKZ B;  2AUK A;  4A3F B;  3ITP A;  2SOB A;  2A6H D;  3PO3 G;  1VQB A;  3UDF A;  1G51 A;  1KRS A;  4EQ5 A;  1Q1E A;  4DR7 Q;  1I94 L;  1NCV A;  1Y1W G;  4HIK A;  3IFD A;  3VDY A;  2O5I C;  3S1N B;  1PHJ A;  3I4O A;  3KK7 A;  1EOT A;  5EPK A;  1X3P A;  4IFD G;  3HZX A;  3BZD B;  3LGJ A;  1SNM A;  3E6Z X;  3EA6 A;  3QJY A;  4LW1 A;  2J4X A;  1UWV A;  4XXE A;  1VQJ A;  3CQZ B;  1S5C D;  1FYC A;  4A3I B;  2BE5 C;  4XYQ A;  2F0S A;  3A5U A;  1SJH D;  1GOZ A;  4A3F H;  3TP6 A;  5M5Y B;  1XTD A;  1V1O A;  4MIU A;  1MI2 A;  2DY8 A;  2VQE L;  1ENA A;  4POG A;  2JA8 B;  4A3D B;  4DR5 Q;  3CCM A;  4AIM A;  4DV0 L;  2L55 A;  4LMQ D;  3U9O A;  3S17 B;  1R4P B;  1B53 A;  2R6G A;  3LWE A;  3S1N H;  1XWE A;  3U9S A;  1I4R A;  4B9X A;  1KAB A;  1F77 A;  4DUZ L;  1N33 Q;  2JA7 B;  2QDB A;  4JW0 A;  3P7J A;  3QOJ A;  4CKE A;  2R93 B;  3IL8 A;  4DK1 A;  1BVS A;  4GNX A;  3TP7 A;  1ILQ A;  3CQZ H;  1MBY A;  4A3I H;  3K57 A;  1PVO A;  3K5M A;  3S15 B;  4FVM A;  3CCJ A;  4A3K B;  4PZ8 A;  5JJI A;  4G57 A;  4A3D H;  2JA8 H;  3BDO A;  2UXC L;  1F9R A;  4G7H C;  3S17 H;  1DOK A;  3A7L A;  4C3J H;  4PMC A;  1JB3 A;  4NXM Q;  3J80 c;  1SAP A;  2Z4I A;  4P73 A;  4BY1 G;  1ET9 A;  2EYH A;  2JA7 H;  1EOV A;  1PLF A;  4L5T A;  2R93 H;  2RDG A;  1YIT A;  1CA6 A;  4DAP A;  3OHX C;  1YHQ A;  4QQB X;  2DJG C;  4R4T A;  3IAY A;  4R4C A;  2MP1 A;  3Q22 A;  1LT3 D;  3I4N G;  4KJN A;  3FEW X;  4I7A A;  3D4W A;  1Q46 A;  1B3A A;  1SYD A;  2KEC A;  3D6C A;  3L2P A;  3HOV G;  5IT9 c;  4A3K H;  3WOF A;  4WJW A;  2ZJP A;  2B29 A;  1DXM A;  2YYZ A;  4K0K Q;  3DMU A;  3BS1 A;  4JBK A;  4MTK A;  1GXD C;  4TKO B;  4DV7 L;  4QIW B;  3C1F A;  3P1H A;  4ZQ3 A;  4AYB G;  4AH6 A;  1PH6 A;  3W3A A;  4KD4 A;  5C3E G;  3RZD B;  3HOX B;  4S3S A;  2QKI C;  4JPB W;  4BBR G;  3A8J E;  3QOL A;  2JN4 A;  3NPP A;  5HGT A;  2UUB Q;  2P5Z X;  4HJ8 A;  1DGS A;  4J1M A;  2Z4H A;  3F2C A;  2OTL A;  2F0M A;  1P8L A;  3CRL C;  2ZTE A;  4L63 B;  3BU2 A;  4UP8 A;  4LK1 C;  3K58 A;  4JI7 L;  4V19 0;  2WKC A;  1E7Z A;  2RDH A;  2F0E A;  4TQU S;  1RIP A;  3T1Y Q;  2K7V A;  2N8N A;  3E0E A;  1AH9 A;  1IKL A;  5HGQ A;  5LMN Q;  4CJ2 C;  4F87 A;  2F0L A;  1STY A;  2HQL A;  3PUW A;  2F0I A;  3GP7 A;  2Q2T A;  3MXG A;  4LF7 Q;  1TT2 A;  2I5L X;  1YVC A;  4HSV A;  2PQA A;  1MHW C;  3CC4 A;  2OCE A;  5CR3 A;  1XMQ Q;  1JB7 A;  5K36 H;  1ESR A;  1IBL L;  4WJ4 A;  1IW7 D;  3NWT A;  3VA5 A;  4A3G G;  3MFG A;  4CKB A;  4H7B A;  2PMZ B;  2PNH A;  3RN2 A;  1WTQ A;  2I46 A;  3M4O B;  4X64 L;  3BYY B;  5IWA L;  2D0O A;  1YNN D;  2L0C A;  2OXP A;  2K5N A;  2V1C C;  4HCS A;  4KN7 C;  4KN4 C;  2NBF A;  2R61 A;  4R8I A;  2F4I A;  4IUN A;  4UHV A;  3F8T A;  2K50 A;  1N36 Q;  2FMC A;  2XWB B;  4AQY L;  1ICF B;  4LF8 Q;  2D5D A;  2RQX A;  1B9M A;  3A74 A;  3M4O H;  2BDN A;  5FO9 B;  4LFA Q;  1WCM G;  4A3J B;  4DNI A;  4L5S A;  1PMR A;  1O7I A;  4DR1 L;  4GOP A;  1XX8 A;  1J5E Q;  3HOY G;  1X9N A;  4ZLT F;  3IRB A;  4Y7N B;  1Z47 A;  4KI0 A;  3G6E A;  3T16 A;  1WTO A;  4KKT A;  2CFM A;  1SNC A;  1HUN A;  1TWH H;  3H3V C;  4BBS G;  2ZJQ A;  4KKU A;  3VYR A;  3STB C;  1IZ6 A;  1X55 A;  3LX0 A;  1XXG A;  2RCN A;  1NBW A;  4RGT A;  4A3J H;  4B3T Q;  2NVT B;  5IY0 A;  2UUA Q;  2KVM A;  1STG A;  2QW7 A;  3DWQ A;  1WVL A;  4LAA A;  5IOD A;  3R2I A;  4KD3 A;  3PO2 H;  4Y7N H;  1KQS A;  1S4Z A;  4DV0 Q;  4BY7 G;  1RTO A;  4XYO A;  5IP9 G;  1GD7 A;  1CHP D;  1QUQ A;  2F3W A;  3L9A X;  1TWF H;  3HKS A;  3M4P A;  1PZI D;  5IGC A;  1DJR D;  3PIO 3;  4RH6 A;  3H6M A;  4WRD A;  3MEF A;  2LXJ A;  1SE4 A;  3QG1 A;  1EQQ A;  3P75 A;  2Z6K C;  1CA5 A;  3V96 A;  2FJ2 A;  1IBM L;  3A0J A;  2N88 A;  3M9B A;  3CU7 A;  5ELD A;  4ME5 A;  1KL9 A;  1MJC A;  1RHP A;  5CGK A;  1Q7Y C;  4DAY A;  1VF5 C;  1EU3 A;  3VR6 A;  3MA2 B;  2EY2 A;  3ULJ A;  2DGY A;  4XTC S;  5IP7 H;  2OWO A;  1BF4 A;  1CK1 A;  1I6H H;  2PZT A;  3G71 A;  3KLS X;  3D0F A;  1H9R A;  2OTJ A;  2WP8 J;  2QGQ A;  3VR2 A;  4NP5 A;  1EUJ A;  4PNY A;  4HAE A;  5EJW A;  4KTA A;  2B2T A;  3A56 A;  2K32 A;  2XNA C;  2B63 B;  2NTS A;  1LTR D;  4IPD A;  1HNW Q;  1H9M A;  4A3B G;  2OT2 A;  5EGT A;  4YHH L;  4HED A;  5LHY 1;  1JT8 A;  2VL6 A;  2ATW A;  1G91 A;  1PRT C;  2K4K A;  5HUR A;  1ROD A;  2OEO A;  1FR3 A;  4XDX A;  1TXY A;  2UU9 L;  3NQT A;  2PW7 A;  4AYB E;  1XPU A;  1XMO L;  3KF8 A;  4IUQ A;  4GN3 B;  3T1H Q;  2B2W C;  1FNV A;  1C7Y A;  4EVO A;  4G7Z C;  3GTO B;  2B63 H;  4XQN A;  3J7A 5;  1EY4 A;  3MVV A;  2K05 A;  3OIQ A;  5EPL A;  3ICE A;  5I9P A;  5FLM H;  2E2I B;  1GUT A;  1CFM A;  4DR2 L;  1XNR Q;  3MXU A;  1LTI D;  1G29 1;  1T9H A;  2RVL A;  4A3E B;  4X3S A;  3TDQ A;  1SYF A;  4JI5 Q;  1L2F A;  1SDF A;  5CBA E;  1JOO A;  3RMH A;  2AQ1 B;  5C5L A;  5CYU A;  2HHH L;  4LF9 L;  1WTV A;  3V2T A;  2K5H A;  3AFP A;  1PZJ D;  3GTO H;  3F2D A;  1VQE A;  2K14 A;  1HZA A;  4B9W A;  2QA4 A;  2F0O A;  1SRO A;  2VNU D;  2RKS A;  3K81 C;  1CKM A;  5GAH C;  4JI8 L;  1HFG A;  1P16 A;  2E2I H;  5BN4 A;  3H0G G;  4OGQ C;  4A3E H;  3M4Y A;  3DM3 A;  1H95 A;  2D9U A;  3VR4 A;  4N8F A;  1QOH A;  2EDG A;  3NHH A;  4HIM A;  4JV5 Q;  1C4Q A;  1U4R A;  1CSQ A;  2KJX A;  1HNZ L;  1B9N A;  5FO8 B;  2NN6 H;  2JYO A;  3GTK H;  1TY2 A;  2IL8 A;  1B1Z A;  3A8K E;  3BVM A;  2HT1 A;  4JCV E;  3S14 B;  4IFD I;  2XN9 C;  2F0T A;  4Y52 H;  3L7Z C;  2IX0 A;  3J81 i;  1CKN A;  3HOU B;  2KEE A;  2E5L L;  5C44 H;  4X6A H;  4TVA B;  1G6P A;  1SSO A;  1YNJ C;  2KCM A;  2KED A;  4DR1 Q;  2JK8 A;  4C3H B;  3CPF A;  3BZK A;  1PYS B;  4RMF A;  5JPM C;  2A69 D;  1ZYR D;  3EFX D;  4GKJ Q;  2CWP A;  1QCB D;  5IT9 L;  2RBM A;  4HTH A;  4PQX A;  1EIY B;  2F4V Q;  5IGF A;  4J15 A;  4DK3 C;  4HID A;  3S14 H;  2UXD L;  3HOZ G;  4MZ9 A;  1FJG L;  2F0K A;  1Y1V G;  1M1K C;  3GTL H;  3VYU A;  3HOU H;  4MTN A;  3L3O C;  1EWI A;  1K8O A;  4QIW E;  4LUZ A;  1TKW B;  1QUQ B;  1EY7 A;  3SK6 A;  3QWN A;  3TN2 A;  1D7Q A;  3SGI A;  1NAP A;  2B2U C;  1GUN A;  3U4V A;  2IPK D;  4X62 Q;  4DV2 L;  1GO3 E;  2K52 A;  2PO4 A;  2HCI A;  4DPG A;  3PF5 A;  5FLX E;  3EIV A;  4CJ0 B;  5CC4 A;  1B50 A;  1K0S A;  2EXD A;  2F0F A;  1H9K A;  1PTO C;  2AQ2 B;  2CW0 D;  1EEI D;  4DAY B;  2GN5 A;  4OWT B;  1IBM Q;  3K80 C;  2BCO A;  5LMU Q;  2K5V A;  1EY8 A;  4RGO S;  3GQB A;  1IYU A;  2DNC A;  3RUZ A;  3BDL A;  4OXP A;  1RTN A;  4ME3 A;  1QIL A;  2Q8R E;  3JAM E;  2VQF L;  1G2T A;  1HZC A;  1UE6 A;  1IKM A;  4R1J A;  3FVQ A;  2G5D A;  1CUK A;  2BH2 A;  1WTH A;  1B44 D;  3CMA A;  3PO3 B;  3J7Y W;  2A5H A;  2IW3 A;  4IUR A;  2ICI A;  4YCV A;  2A74 C;  4X66 Q;  5M5W H;  2FMM A;  5D65 A;  4H02 A;  1Y1W B;  1ENC A;  2K1B A;  2FHT A;  1K28 A;  4P71 A;  4PMW A;  4YHH Q;  1ILP A;  2IX3 A;  2Q8I B;  4RWS C;  1MGS A;  4ZKC B;  2JA5 G;  2L11 A;  1LUZ A;  3KF8 B;  3V05 A;  4WOR A;  2HCC A;  1AEX A;  1SN8 A;  4JI6 Q;  4LNQ A;  3EN2 A;  1II3 A;  4JI4 Q;  3HOW H;  3PO3 H;  2G9D A;  1VQM A;  4LF5 Q;  1Q90 A;  1X3F A;  2FFK B;  2JEA I;  1Y1W H;  2UUC Q;  4RFB A;  3DM1 A;  2Y0S G;  4DV1 Q;  4JI0 L;  2ICE C;  3NTH A;  4IFD H;  3CCQ A;  5BR8 L;  1MJE A;  2NZ1 D;  4YCU A;  3KUP A;  2DN8 A;  4DR2 Q;  2AHO B;  3NWS A;  4GN4 B;  4DV6 L;  4B3R L;  1QZH A;  1LT6 D;  4FYD A;  2GA4 B;  2PPB C;  5J3B A;  4A3M G;  1X6O A;  1E2V A;  2K03 A;  2BE5 D;  2HHH Q;  1Q81 C;  1VMC A;  5AJ3 Q;  3B6Y A;  1NUC A;  1CT1 D;  3GTJ B;  2NYZ D;  4JYA Q;  3KLS A;  4BY1 B;  4B3S Q;  5DAU A;  3S1Q B;  1HA5 A;  4PV1 C;  2JSO A;  4LF4 L;  2KQ3 A;  2BA0 A;  4LFB L;  3S1R B;  3I4N B;  2EIF A;  4DNR B;  2WAQ G;  3R2T A;  4R9W A;  2EY5 A;  5E7N A;  5JAV A;  3HOV B;  1LTT D;  3OPO A;  2G9H D;  2A68 C;  1TWC B;  2R7D A;  3RLN A;  1Y69 U;  1CI3 M;  1ICW A;  3BVG A;  4JBW A;  4FF1 A;  4DR4 L;  3FKI G;  1E3P A;  5IYB G;  4AYB B;  1LV9 A;  3MEH A;  4BY1 H;  4NXN L;  5C3E B;  1B4O A;  1QNU A;  3OIP A;  4BBR B;  5IYD G;  1L1O B;  2XIW A;  3S1R H;  5D3D A;  1DD2 A;  4KK7 A;  4EQO A;  3H15 A;  4F7X A;  1F2Z A;  1A62 A;  1V43 A;  2RSO A;  3HOV H;  1S3O A;  5ELN A;  1YHA A;  4CDF C;  1TWC H;  2MO1 A;  5FOB B;  3CC2 A;  3HP3 A;  1PH9 A;  1YHB A;  1U4L A;  5C3E H;  1FJG Q;  5M3M G;  4BBR H;  4RA8 A;  1U5K A;  1E24 A;  4A4I A;  2VB2 X;  4RCN A;  5GQO A;  2F3V A;  2K5D A;  3R8B A;  4H0L C;  1I4H A;  2B2V C;  1V1P A;  1W6J A;  3JAM i;  5EPJ A;  1S72 A;  3NBI A;  1CZG A;  4Q0F A;  1XNQ Q;  4A3G B;  2DUD A;  1AFP A;  3OWE B;  4ALP A;  1BUV T;  1EIG A;  1IXR A;  1LAB A;  2E76 C;  1CHQ D;  2VXW A;  3K5O A;  1GUG A;  1JWS D;  2AQ3 B;  2UXB L;  4BA2 I;  1U0L A;  4DV5 L;  2E75 C;  1KDB A;  5C4X G;  4GLX A;  4EX5 A;  3PCO B;  3PIP 3;  4RAU C;  5M5Y H;  2I07 B;  1CQF A;  2L4N A;  5C3W A;  1PA6 A;  4ZCK A;  3DUZ A;  4OX9 L;  3KBX A;  3RZO B;  4K5W A;  4O42 A;  5IOC A;  4DR6 Q;  1WCM B;  5E4W C;  2AWN A;  3KDF A;  3TZU A;  4F8M A;  4DXF A;  1BO0 A;  5BN3 A;  2Z9H A;  1EY6 A;  3HOY B;  3T51 B;  2RHQ B;  3NTI A;  4A93 G;  3ND8 A;  5FJ8 H;  5ISR A;  2K33 A;  3L0O A;  2ZXP A;  4APV A;  3KF6 A;  3W1G A;  3S15 H;  4BBS B;  1TS2 A;  1K83 B;  4LJZ C;  2LMC B;  3TQY A;  3IKJ A;  4K2L A;  2IWH A;  4TRD A;  2ZM6 L;  3RZO H;  4P74 A;  2AMC B;  2B39 A;  2MGS A;  1VQF A;  1HR0 W;  4F88 A;  5C5M A;  1C8C A;  3A5Z B;  3RD4 A;  4UP7 A;  1SYE A;  2B8G A;  1PH2 A;  3HOY H;  2A6H C;  1L0Y B;  1E2W A;  2EYO A;  1NTG A;  4DR3 Q;  2RCF A;  1GJX A;  5FK9 C;  2WAC A;  2KCT A;  4BY7 B;  1KD1 C;  1K83 H;  1D8L A;  5BR8 Q;  1SLJ A;  2IJ0 A;  5JJL A;  1H9S A;  2ZXR A;  2LKV A;  3I7F A;  4K5V A;  3MTS A;  2Y0S E;  4DV3 L;  2EOT A;  1A8V A;  2JE6 I;  2NZO A;  3KFU A;  2WB1 G;  1PFS A;  4UY8 C;  3HOX H;  3RZD H;  4YIJ A;  4JBM A;  3EQL C;  1Y8O B;  1BOS A;  1LM0 A;  1LTS D;  2BDO A;  3KLW A;  3FPP A;  5ELE A;  4BY7 H;  5JVH 3;  5IP9 H;  3NBH A;  2K75 A;  4HMJ A;  2MNA A;  1EU4 A;  3CW2 C;  4IPG A;  2F03 A;  3Q23 A;  4K6L A;  3GTP B;  1VQN A;  1EZ8 A;  4LFB Q;  3MAQ A;  5K5P A;  3H3V I;  4CDE C;  1TU2 B;  1I4P A;  2KEN A;  5I2Y A;  1EYD A;  3I90 A;  1SMY C;  2QCP X;  4FP5 D;  1F2M A;  2ZTD A;  2CCZ A;  3CCL A;  1IBK Q;  3QB3 A;  2LS0 1;  2N78 A;  1F9P A;  4XQQ A;  1W3S A;  5ELO A;  3S24 A;  4A3B B;  1STE A;  4RKL A;  2WAQ E;  2QEJ C;  2AWO A;  4DUY L;  4KHP Q;  1KRT A;  4IOC A;  1YBY A;  3PUY A;  4C3J G;  5DM7 3;  1A6X A;  3G7L A;  4K14 A;  3GTP H;  1HNX L;  3K5L A;  1O7L A;  1PV4 A;  3HG9 A;  1DOL A;  2EQS A;  2EZV A;  2I5M X;  3S9W A;  4A76 A;  2X6L A;  1AE2 A;  4OON A;  5D3I B;  3W2D A;  4UP9 A;  3FPU B;  1HZ9 A;  2CH4 W;  4A3B H;  4A75 A;  5CBE E;  3F2B A;  2NB0 A;  1RKN A;  1WYD A;  1I94 Q;  4OEL B;  1FVI A;  2XRS D;  2D2C C;  4IJH A;  5DM6 3;  1C9O A;  5KIX A;  1S5D D;  1YIJ A;  1V1P B;  1PRT D;  3QIA A;  2D0P A;  1ML0 D;  4QL5 A;  3A54 A;  1HCZ A;  3A55 A;  1SFO B;  1J6Q A;  3S2D B;  4OO1 G;  3T13 A;  5C0X J;  5DNF A;  1GUW A;  1QVC A;  1E0B A;  4GKK L;  2VQE Q;  4ZK9 B;  4QCL A;  3MXP A;  4GNX B;  3H0G B;  3CKI B;  1NMF A;  4DUZ Q;  1MSG A;  1F9Q A;  1L0W A;  3CP0 A;  1VQH A;  2UXB Q;  1DCZ A;  2R7Z G;  1F2Y A;  3S2H B;  2ES2 A;  3TP5 A;  3NE5 B;  2NVT H;  1SFO H;  2AUJ D;  2JA6 G;  2EYF A;  1K3B C;  4KHV A;  3TRZ A;  4ILW A;  1IW7 C;  1D2B A;  1V1Q A;  3KDF B;  4HIO A;  3LNN A;  1I6V C;  3M85 A;  1ONL A;  4RKB A;  2UXC Q;  2O2L D;  1HR0 L;  5LL6 S;  1YNN C;  5GAD C;  5GAE C;  3I73 A;  1N34 L;  4RG1 A;  1JJG A;  5I6W A;  1I3Q B;  1JQY D;  2ZT9 C;  3KF6 B;  3S2H H;  1K8A C;  2FIN B;  2F0P A;  1AW7 A;  5IYC H;  4G7O C;  3I2Z A;  4IUU A;  1E22 A;  4ZAI A;  2HQE A;  2F0J A;  4DU9 A;  5KNC A;  3C3L A;  3NUC A;  4QGU A;  3HOZ B;  2WV6 D;  2PYK A;  3CPW A;  3PSI A;  4X3U A;  1K9M C;  3PQI A;  2YU9 B;  1Y1V B;  2Q2I A;  2ZM6 Q;  4J6H A;  4DV7 Q;  1K8G A;  4NMZ A;  4QMG A;  1QVF A;  2Q2U A;  4X65 L;  3BYT B;  1BDO A;  1V8Q A;  4IO9 A;  1NE3 A;  3UE0 A;  2I5H A;  1WI5 A;  1PRT F;  2B2U A;  1BCP C;  1STA A;  1H9S B;  1D5M C;  3S16 B;  3CAM A;  4ZRZ A;  2VZA A;  1U4P A;  1IYV A;  3RN5 A;  3H91 A;  5JEA J;  5M3F G;  4JI7 Q;  3KBG A;  1QNK A;  1I4G A;  5E4X A;  3J80 E;  2YU9 H;  1Y1V H;  4DV3 Q;  4WFN 3;  2PQA B;  2DNE A;  2GVB A;  1LTG D;  5KND A;  1G2S A;  1HPC A;  2L12 A;  3NBH B;  1NJI C;  1OXS C;  2WB1 E;  4HSP A;  3T56 B;  3NSW A;  5IT9 E;  3PUX A;  1MD2 D;  3S16 H;  3PO2 G;  2J0T D;  3MC0 B;  1BNZ A;  2PI2 E;  4UPA A;  1IBL Q;  1EL0 A;  2TMP A;  5CMD A;  4IUT A;  5KGU A;  2LY7 A;  3ZYY X;  3E3X A;  1X3E A;  2A6E C;  3K0X A;  3T4A C;  5CV5 A;  3WWV A;  4DF7 A;  4X64 Q;  5IWA Q;  2RF4 A;  2ZTC A;  5BN5 A;  2BH8 A;  4H44 C;  1PH4 A;  1LLR D;  1HFN A;  3K59 A;  4P75 A;  1JOK A;  1O80 A;  1PTO D;  1NSN S;  4R4I A;  4JI2 L;  1K3R A;  4RHR A;  2YTY A;  2LSS A;  2MQH A;  3BVZ A;  2JA5 B;  4AQY Q;  1UE1 A;  2CH4 A;  3H09 A;  1JC7 A;  1LO5 D;  5IP7 G;  5KYI A;  2Q2H A;  4GOP B;  3J80 L;  4BXX G;  3CCS A;  4C1N K;  1SR3 A;  4IJL A;  4X3T A;  5LMN W;  1WOC A;  3AB9 A;  4C56 C;  1A3V A;  4JBJ A;  4A3L H;  1LAC A;  1JE4 A;  4NDX A;  1QE6 A;  2Y0S B;  2CWA A;  3SEB A;  2PZU A;  1VQO A;  1BBX C;  4TSS A;  2C9O A;  1Q12 A;  4DV4 L;  1FNW A;  4XT1 B;  1SMX A;  1O7Y A;  4BWG B;  1CTM A;  2XSC A;  1X3Q A;  2JA5 H;  3R3O A;  4QUF A;  1XYI A;  1Q8I A;  3Q0A A;  3UI2 A;  4DK6 C;  2O4X A;  3SK8 A;  2KHI A;  3D31 A;  4A3M B;  4ABN A;  3KJO A;  2VUM G;  1BBU A;  3I55 A;  1ASY A;  3MZ5 A;  1GM5 A;  5A2Q E;  3MXN A;  4GLA C;  2K01 A;  3D6W A;  5IGE A;  4GKK Q;  5EQ0 A;  4C3H H;  4DR7 L;  2PI2 A;  3FHW A;  4N9T A;  3HFZ B;  1KLU D;  3CXC A;  3EJI A;  4DAV A;  1RCV D;  2EXZ A;  2LXK A;  1EWC A;  1O78 A;  4MN3 A;  2WAQ B;  4I65 A;  2NZH A;  1LTA D;  3J7Z C;  3OSO A;  4B3M L;  1Y14 B;  3K0Y A;  2F1M A;  2L5T A;  2B2Y C;  3M7N A;  3NTK A;  1YJW A;  1X3G A;  4HJ5 A;  1X56 A;  3FKI B;  4DR5 L;  4K2K A;  1PTO F;  2XGT A;  3NEM A;  1JJC B;  2JP1 A;  3PUZ A;  3PMF A;  1L0X B;  2D62 A;  5CV8 A;  1A3U A;  1H9J A;  5NUC A;  1K8M A;  1TQO A;  1N33 L;  1DYQ A;  1LTB D;  1PFM A;  4JI3 L;  1PYB A;  3Q24 A;  4FF4 A;  2NTT A;  2WFW A;  1RF2 D;  1WTR A;  4LF6 L;  4MNO A;  3E9H A;  1VQ6 A;  1C48 A;  2NVY B;  3J80 i;  3AFQ A;  2A73 B;  5C4J B;  1SNP A;  4C1N I;  5A2Q L;  1K0R A;  3DEO A;  2NN6 G;  3FKI H;  5IYB H;  4K5X A;  2A68 D;  5M3M B;  3C46 A;  3GV3 A;  4NKL A;  5IYD H;  1Z6H A;  4DN4 M;  1WJJ A;  4JVZ A;  4KLK A;  4JI1 L;  4NB3 A;  1T5X D;  1FD7 D;  5H1S E;  2Z1C A;  1A0I A;  2C35 B;  2J7Z A;  2UU9 Q;  1GUO A;  1MKH A;  2ID0 A;  5C44 G;  4FXG C;  4LUV A;  5C0X G;  1WTW A;  2EY1 A;  1PTO B;  5KEE A;  1S5E D;  1XMO Q;  1PH7 A;  2NVY H;  5C4J H;  3U4Z A;  4JK1 C;  1A2U A;  3CCE A;  2XTI A;  4K0K L;  4QB4 A;  2VW9 A;  2K5Q A;  3ZJY C;  5M3M H;  5AFW A;  1A15 A;  5CV9 A;  1IL2 A;  1AN8 A;  1TWG B;  3CCV A;  1HXY D;  4QF4 A;  1BBW A;  1R4Q B;  5J1Z A;  1EYC A;  1OXT A;  5C4X B;  3VR3 A;  2UUB L;  1D5X C;  2E2J B;  1KHI A;  1NR4 A;  4LF9 Q;  1Z9F A;  4I7Z C;  3I4M G;  1XTC D;  2H5X A;  4IPC A;  1VQ8 A;  1R9T B;  1LT5 D;  5G3L F;  1L1O C;  3T1Y L;  4XQJ A;  1AE3 A;  2E2D C;  1J9O A;  4JI8 Q;  1B3Q A;  1UEA B;  5EAY A;  2CW0 C;  1TWG H;  2Q8T A;  2B8F A;  3DLL A;  5GRO A;  4RCO A;  4DGZ A;  2EPB A;  4A93 B;  5EKK A;  2EYM A;  5C4X H;  3WDN A;  4JOI C;  1B8A A;  3F1Z A;  1E1T A;  3FMC A;  4O0A A;  3GTM B;  1Y8N B;  2E2J H;  4RHS A;  4C3I G;  3DWP A;  1XMQ L;  1HNZ Q;  1KDC A;  1LT4 D;  1JCK B;  3HKZ G;  1CKN B;  2L15 A;  5HY6 A;  1QZG A;  4A3C G;  3GTJ H;  4KHZ A;  1U4M A;  3CCU A;  3S1Q H;  1SXT A;  3CC7 A;  1NNX A;  2VB3 X;  1UE5 A;  3TP8 A;  3O13 A;  3GD7 A;  2E5L Q;  2MO0 A;  3I4N H;  4A93 H;  4OO1 I;  2HD3 A;  2CQA A;  4CGY B;  5CV6 A;  1A2T A;  5FKA C;  3GTM H;  1TWA B;  3J81 c;  4OIJ A;  2AKW B;  5JEA G;  1N36 L;  4R4Q A;  4IAL A;  4DV4 Q;  1PYW D;  1N9W A;  3SXH A;  1AP0 A;  1EY9 A;  2WB1 B;  2UXD Q;  1VQ9 A;  1I4X A;  2B3G A;  3MXN B;  5C4Z A;  1GUS A;  1JMC A;  4X3K A;  2NVX B;  4LFA L;  3M7G A;  2CVR A;  3I72 A;  4XT3 B;  3M3Y B;  3PV0 A;  1XJV A;  1W2B A;  1J5E L;  4CJ1 B;  3HOW G;  1WTP A;  3ERQ A;  1EY0 A;  1VQA A;  5E1F A;  2CHB D;  1OXU A;  2O5J C;  4L5R C;  1TWA H;  3BJU A;  1AZQ A;  3RR5 A;  3J7A F;  2JEB I;  3A8I E;  1B70 B;  3PIO A;  3JC6 6;  1IHZ A;  2BOS A;  4DXG A;  3E9I A;  4DV2 Q;  1IYJ B;  4FNF A;  1C0A A;  5EKI A;  4GZY C;  2YV5 A;  2NVX H;  2IHE A;  2R92 G;  3S1M B;  4K8I A;  4B3T L;  3OW7 A;  3M3Y H;  2E74 C;  4B3M Q;  2UUA L;  2F0H A;  5JVG 3;  1PH5 A;  4KY5 A;  3VYT A;  2EJG C;  2F0G A;  3Q8D A;  4OEM B;  4PZ6 A;  4C3J B;  4OHJ A;  3IFT A;  5IGB A;  4A3G H;  1KIX A;  3NP8 A;  2MUY A;  3ND9 A;  1EY5 A;  1KLG D;  2SNS A;  2EJF C;  2VQF Q;  2EY6 A;  4HJ9 A;  4M1U B;  1VQD A;  2M9V A;  1STB A;  4IZ8 A;  4KY6 A;  4OWX B;  4JI3 Q;  5T1I A;  1Q86 C;  1STN A;  1SEB D;  1TS3 A;  1CSP A;  3DXJ C;  3ONA B;  3CME A;  1VQ5 A;  3SK5 A;  4LF6 Q;  1SMY D;  3S1M H;  3NQI A;  2ASB A;  4NPS A;  3OMG A;  1VQG A;  1J8I A;  2HDM A;  3DEP A;  5FO7 B;  3ER0 A;  4BS9 A;  1D1I A;  3K5N A;  1SE2 A;  5EKL A;  3I3C A;  2DJF C;  3E5S A;  2F0Q A;  3I56 A;  5C6A A;  3FP9 A;  1VQK A;  1EQV A;  2QF7 A;  4JI1 Q;  2EVB A;  1WCM H;  5JJK A;  1VQP A;  1PH8 A;  4CDD C;  1GKH A;  4O1N A;  1X65 A;  3X3N A;  3OOC A;  1B2T A;  1TR5 A;  3OW2 A;  1UAP A;  2KHJ A;  2FXQ A;  3GTQ B;  1HNW L;  1VQ4 A;  1I5F A;  2RHS B;  2X69 A;  4CHT B;  2I0Q A;  3TBI B;  1OXV A;  4E6I A;  3OWF A;  1LYL A;  4JI0 Q;  4BBS H;  4DK0 A;  4XIG S;  1EYA A;  2RSN A;  1GHJ A;  2Z6K A;  3UE1 A;  5DLQ E;  2R7Z B;  5COY A;  3STB D;  2MHV A;  3K6O A;  1I50 B;  1HA6 A;  1GVP A;  3BZC A;  4DV6 Q;  4B3R Q;  4OO1 H;  2ZJR A;  2JA6 B;  4IN3 A;  4R8N A;  3T1H L;  3C2P A;  3LWU A;  4JG2 A;  2X6G A;  4A3F G;  1YNX A;  4PMB A;  3GTQ H;  3R93 A;  1TY0 A;  4EGV A;  1EFI D;  3Q6S A;  1RD9 D;  4PG3 A;  4HMI A;  1XNR L;  4LF4 Q;  4UDU C;  3SHL A;  4JI5 L;  3ERS X;  4YWL A;  2N55 A;  2R7Z H;  3HEJ A;  1I50 H;  4N9P A;  4P2C B;  2H4O A;  2JXM B;  2A19 A;  3NEN A;  2RDF A;  2JA6 H;  4A3I G;  3D4D A;  1YZ6 A;  2IT1 A;  1B7Y B;  4ZUJ A;  1UEB A;  4GLV B;  5I9O A;  1NMG A;  2LFN A;  4GS3 A;  4IOA A;  1FNU A;  4DR4 Q;  1FL0 A;  2PNR C;  2JA8 G;  4A3D G;  3NXW A;  1SRU A;  2HDL A;  2PQE A;  4KY7 A;  2R7F A;  4NXN Q;  1CZW A;  3HKZ E;  4CDC C;  2B2W A;  2RA4 A;  5ELC A;  2KUM A;  4DKA C;  1KAW A;  3SDZ A;  3VR5 A;  1HUM A;  2JA9 A;  2JA7 G;  1KXL A;  1Q8K A;  3RNU A;  2R93 G;  3RLF A;  4JV5 L;  1OXX K;  4FF3 A;  1QVG A;  3UDX A;  5J39 A;  5FJ8 G;  2V4D A;  4KV6 A;  5ELF A;  5M3F B;  1EZ6 A;  1NY4 A;  1TWH B;  4GNX C;  3GDE A;  1MSH A;  3TZD A;  4A3K G;  1VMP A;  1UNS A;  1ESF A;  3UDI A;  2MFI A;  4LUO A;  4L6T B;  3X3M A;  1HZB A;  2R3Z A;  5FLX c;  1HHV A;  2M00 A;  1EIF A;  3NK9 A;  3PO2 B;  1BCP D;  4GKJ L;  1JOQ A;  4R4O A;  2XWJ B;  5M3F H;  1GHK A;  1EIH A;  2EYP A;  3H94 A;  5JJZ A;  2F4V L;  1HH2 P;  1TWF B;  5KNB A;  1E1O A;  3JAM c;  2K28 A;  1YI2 A;  4RGM A;  1TII D;  4EQN A;  2ENB A;  1D1K A;  3TME A;  3HOX G;  4OWW B;  4DV5 Q;  1EFW A;  3AYH B;  1G6Z A;  3J81 E;  3S2D H;  1DON A;  1BQQ T;  2NN6 I;  4ZKB B;  1HQM C;  5K36 G;  1HJP A;  3MFY A;  3E0J A;  4KJO A;  2OQ0 A;  4OX9 Q;  4X62 L;  4FF2 A;  2KA7 A;  1I6H B;  2NUC A;  2GVA A;  1D6E C;  1JR0 D;  3H0G H;  2A6E D;  5KRU A;  1U9R A;  5C0X I;  3M4Q A;  4M8A A;  4U67 3;  5LMU L;  3HGB A;  1QJO A;  4J8Q A;  4H13 C;  3KOJ A;  2N49 A;  3KYH C;  1SE8 A;  1Z7T A;  5D14 A;  2XRQ D;  4C2M B;  3NEL A;  2JQO A;  4QUC A;  1SYC A;  1RJT A;  2K04 A;  2EE1 A;  3ULL A;  1KNE A;  2VUM B;  4BXX H;  3H3V H;  1ASZ A;  5M9O A;  1I3Q H;  2E2H B;  1QG7 A;  3ERO A;  2ZXO A;  1PFN A;  4YWK A;  4HJA A;  4X66 L;  1YNJ D;  2A8V A;  4EQP A;  3AMU A;  2KHS A;  1AZP A;  3TSS A;  2QEX A;  1SBB B;  3J81 L;  4IQZ A;  2NWG A;  4C2M H;  1VQL A;  1VS0 A;  1FGU A;  3I8Z A;  2EYL A;  3G6J B;  1BCP F;  2ALY B;  3DWA A;  3HOZ H;  2B2Y A;  3SR1 A;  5J22 A;  1DM0 B;  1S5F D;  4OIK A;  1M90 C;  2VUM H;  5A35 A;  2OF1 A;  1HTL D;  4JI6 L;  2Z8L A;  4NW2 A;  2F0W A;  4N8X 1;  1KC8 C;  1JWU D;  4FDB A;  1I4Q A;  4JI4 L;  2E2H H;  1WD1 A;  1OO9 B;  3A7A B;  4A3J G;  3OTO L;  4LF5 L;  1S40 A;  1KTK A;  3VYS A;  4LFC L;  3SVM A;  4CBV A;  2WIN B;  2UUC L;  2QIL A;  4IUV A;  4DV1 L;  5T1G A;  1KAA A;  5F2D A;  5C4H A;  4MHE A;  5COR A;  3G48 A;  1SNQ A;  4GOP C;  3SK4 A;  3TS0 A;  4IFD J;  3UDG A;  1YJN A;  3FRP B;  1PRT B;  4YY3 L;  3PGZ A;  1WTX A;  2A1A A;  3N6R A;  1EEF D;  1S5B D;  2KCC A;  1HTP A;  3K7U C;  3I91 A;  3AQQ A;  1SJE D;  3W5O A;  5AJ3 L;  3GTK B;  1E2Z A;  1YEZ A;  1BCP B;  3C1E A;  1JE5 A;  1PH3 A;  4DUY Q;  3GO5 A;  3PF4 A;  4JYA L;  4O2D A;  4B3S L;  4HR7 B;  3MHB A;  2F0U A;  2CQO A;  1SE3 A;  1HNX Q;  5C44 B;  2VY3 A;  5DEH A;  2QDL A;  1N8R C;  4FO2 A;  1N32 L;  3GTG B;  3KJP A;  3OYY A;  4B08 A;  5IYC G;  1BKB A;  2JJQ A;  3CD6 A;  4KMU C;  2F0N A;  1LTL A;  2K5W A;  1HRJ A;  5E3F A;  1V9P A;  1BR9 A;  3TS2 A;  3GTL B;  1M8A A;  2SNM A;  1XPO A;  5C0X H;  2C5C A;  1FGB D;  1VF7 A;  4DNT B;  2OQK A;  1L1O A;  3I4M B;  3BG3 A;  3AU7 A;  1VQI A;  1MIU A;  5CV4 A;  2BA1 A;  3GTG H;  1YJ9 A;  1ENF A;  4L8J A;  2B63 G;  2F52 A;  1Q3L A;  4JOI A;  1NR2 A;  2B2T C;  1JIC A;  1PDQ A;  4FXK C;  4OL7 A;  5FLM G;  1EQR A;  5TSS A;  5L37 A;  2Z0S A;  4QY7 A;  4KKS A;  5GAG C;  2Z6B A;  4A3M H;  3PIP A;  4LWC A;  4QJF A;  4C3I B;  5M5X B;  3I4M H;  2N3S A;  1RDP D;  1ZXT A;  5G3L D;  3HKZ B;  1XNQ L;  1SYG A;  1EYG A;  1STH A;  1WD0 A;  1F2L A;  5I2X A;  2M2L A;  1HR0 Q;  3K7A B;  5IGG A;  3EVQ A;  5C3X A;  1PH1 A;  1N34 Q;  4ZUI A;  3CRK C;  3EBE A;  1BXT A;  2F0D A;  2L1B A;  1UUP A;  4A3E G;  5KYL A;  4FXD A;  1ZKO A;  2SDF A;  2DY7 A;  5M5W B;  4C3I H;  3HRZ C;  3TEH B;  5JOB A;  5M5X H;  2MJ8 A;  2HIX A;  4U68 A;  4G4K A;  3BDC A;  3URY A;  1KNA A;  4A3C H;  1DOM A;  5EBD A;  3P20 A;  1VQC A;  3GV6 A;  2IY5 B;  2B2V A;  4NXM L;  4DR6 L;  3K7A H;  4K6D A;  4HJ7 A;  2F0V A;  1SND A;  2IHF A;  3CF5 A;  4Q5V A;  4X65 Q;  1VQ7 A;  4ID6 A;  4DFA A;  4PZ7 A;  3HOW B;  3CCR A;  1TS5 A;  2HIV A;  1D5Z C;  2PMZ E;  3MWY W;  2A69 C;  1ZYR C;  1X32 A;  2HUG A;  5JEA H;  4A3L G;  1IL8 A;  1M4V A;  2KBN A;  5I6Y A;  1TVX A;  2K6A A;  1EWH A;  3D3R A;  4HN7 A;  1ZEQ X;  1PFB A;  1F9S A;  4YCW A;  1WFQ A;  4P72 A;  1ET6 A;  5I4D A;  5IIF A;  1OTC A;  2EJM A;  4JC0 A;  2R92 B;  2TSS A;  1K73 C;  5FLX L;  5IGD A;  2KCN A;  3HOU G;  3QO2 A;  4ULL A;  3OTO Q;  1CM9 A;  3N52 A;  4DR3 L;  1T5E A;  1TS4 A;  1PTO H;  2WKD A;  4LFC Q;  1VCI A;  4IUP A;  5JPN C;  5IE8 A;  4C3H G;  1A3T A;  3D4R A;  1SYB A;  3U50 C;  3CHB D;  3DHQ A;  3VA7 A;  3W1B A;  4L5Q A;  3U58 A;  3QR8 A;  2H1E A;  2PZW A;  1CKO A;  2VS1 A;  4ZYS A;  3AEV A;  1QWY A;  3I70 A;  2F3I A;  4RGN A;  1SNO A;  5LMN L;  2R92 H;  3JAM L;  2NVQ B;  4YY3 Q;  5LL6 X;  2L9H A;  4LF7 L;  2PCF B;  2SEB D;  5CV7 A;  1KDA A;  2MPM A;  1DZ1 A;  1PZK D;  1Q1B A;  4JI2 Q;  3I4L A;  4WJ3 M;  4V0B A;  3D8G A;  4DA2 A;  1HQR D;  3T53 B;  3HS0 C;  1RL2 A;  1EQT A;  1PXU A;  1UE7 A;  1R9T H;  3FDT A;  3RLO A;  2IX1 A;  1G8Z D;  5ELB A;  1A63 A;  2WII B;  2PW5 A;  3ULP A;  2XVS A;  3K8A A;  3WOE A;  2NVQ H;  1W6K A;  2YTX A;  1VDZ A;  1IBK L;  4GN5 A;  1Y8P B;  1O7Z A;  5EBC A;  3TRE A;  1N32 Q;  4YWM A;  1CQV A;  3J7A V;  4IPH A;  3OMC A;  1XPR A;  4POF A;  2KOL A;  4ODG A;  3SE0 A;  1JJ2 A;  4KHP L;  3G4S A;  4LF8 L;  3PUV A; 
#chains in the Genus database with same CATH homology
 3J81 j;  3CPW A;  3PSI A;  4PG3 A;  3U4V A;  1K9M C;  1X54 A;  4DV2 L;  4X62 Q;  2Q2I A;  4DAM A;  2ZM6 Q;  1XNR L;  1GO3 E;  2K52 A;  4DPG A;  3PF5 A;  4DV7 Q;  1Q82 C;  1K8G A;  4LF4 Q;  3EIV A;  1QVF A;  2Q2U A;  4X65 L;  2E8G A;  4JI5 L;  3ERS X;  4YWL A;  2R7Z H;  2YTV A;  4IO9 A;  1I50 H;  1NE3 A;  2EXD A;  4BA1 I;  3UE0 A;  2I5H A;  2A19 A;  2CKZ B;  3NEN A;  1WI5 A;  4DAY B;  2GN5 A;  2JA6 H;  4OWT B;  1IBM Q;  3K80 C;  5LMU Q;  4A3I G;  2K5V A;  1YZ6 A;  3PO3 G;  2IT1 A;  1VQB A;  1B7Y B;  1UEB A;  4GLV B;  3UDF A;  1G51 A;  1KRS A;  3CAM A;  1Q1E A;  4EQ5 A;  4DR7 Q;  1NMG A;  2VZA A;  4GS3 A;  1I94 L;  4IOA A;  3RN5 A;  1Y1W G;  4OXP A;  5JEA J;  4ME3 A;  5M3F G;  4HIK A;  1FL0 A;  3VDY A;  4JI7 Q;  2JA8 G;  4DR4 Q;  1PHJ A;  4A3D G;  3I4O A;  1SRU A;  4IFD G;  2R7F A;  3LGJ A;  2YU9 H;  2VQF L;  4NXN Q;  1Y1V H;  3HKZ E;  1HZC A;  4DV3 Q;  1UE6 A;  4LW1 A;  4R1J A;  4DKA C;  1KAW A;  2PQA B;  2GVB A;  1UWV A;  2JA9 A;  1VQJ A;  2JA7 G;  1KXL A;  1CUK A;  1Q8K A;  3RNU A;  2BH2 A;  2R93 G;  3RLF A;  3CMA A;  4JV5 L;  3NBH B;  3A5U A;  1OXX K;  1NJI C;  1OXS C;  2WB1 E;  4A3F H;  4YCV A;  3UDX A;  1QVG A;  4X66 Q;  1XTD A;  5M5W H;  5FJ8 G;  4H02 A;  3PUX A;  4POG A;  2VQE L;  1NY4 A;  4GNX C;  3GDE A;  3S16 H;  4DR5 Q;  3PO2 G;  4P71 A;  4PMW A;  4AIM A;  4YHH Q;  3CCM A;  2PI2 E;  4UPA A;  4DV0 L;  4A3K G;  1IBL Q;  2R6G A;  3UDI A;  2MFI A;  4LUO A;  3S1N H;  1X3E A;  4DUZ L;  2JA5 G;  1N33 Q;  1LUZ A;  3K0X A;  1HZB A;  3KF8 B;  3WWV A;  4X64 Q;  5FLX c;  5IWA Q;  2RF4 A;  1BVS A;  2ZTC A;  4GNX A;  2BH8 A;  1SN8 A;  1PH4 A;  4JI6 Q;  4LNQ A;  3CQZ H;  3EN2 A;  1EIF A;  4P75 A;  4JI4 Q;  4A3I H;  3HOW H;  3PO3 H;  4R4I A;  1PVO A;  1VQM A;  4LF5 Q;  1X3F A;  4JI2 L;  4GKJ L;  3CCJ A;  1K3R A;  4PZ8 A;  2JEA I;  4R4O A;  1Y1W H;  2UUC Q;  5JJI A;  5M3F H;  4A3D H;  2JA8 H;  2YTY A;  2Y0S G;  4DV1 Q;  4JI0 L;  2F4V L;  2LSS A;  2MQH A;  2UXC L;  3CCQ A;  5BR8 L;  1HH2 P;  4AQY Q;  1MJE A;  3S17 H;  1UE1 A;  4C3J H;  4YCU A;  4NXM Q;  4DR2 Q;  3J80 c;  4P73 A;  5IP7 G;  1E1O A;  4BY1 G;  3JAM c;  2AHO B;  2JA7 H;  2Q2H A;  1EOV A;  4GOP B;  1YI2 A;  4GN4 B;  4DV6 L;  4BXX G;  4L5T A;  2R93 H;  4B3R L;  1YIT A;  1QZH A;  4QQB X;  3CCS A;  1YHQ A;  4R4T A;  3HOX G;  1SR3 A;  4IJL A;  4R4C A;  5J3B A;  1WOC A;  1X6O A;  5LMN W;  4A3M G;  4OWW B;  4DV5 Q;  3I4N G;  1EFW A;  4JBJ A;  3AYH B;  2HHH Q;  4A3L H;  3S2D H;  1Q81 C;  1Q46 A;  2CWA A;  3B6Y A;  5AJ3 Q;  3L2P A;  3HOV G;  5IT9 c;  2NN6 I;  4A3K H;  2ZJP A;  1VQO A;  2B29 A;  5K36 G;  1Q12 A;  1HJP A;  4DV4 L;  1SMX A;  2YYZ A;  4K0K Q;  2OQ0 A;  2JA5 H;  4OX9 Q;  4JYA Q;  4B3S Q;  4X62 L;  4JBK A;  4DV7 L;  2GVA A;  4LF4 L;  4DK6 C;  3H0G H;  4AYB G;  2BA0 A;  4LFB L;  4AH6 A;  1PH6 A;  2KHI A;  5C3E G;  3D31 A;  3KJO A;  2VUM G;  4BBR G;  1BBU A;  3I55 A;  2EIF A;  1ASY A;  2WAQ G;  5C0X I;  3M4Q A;  1GM5 A;  5E7N A;  2UUB Q;  4GLA C;  5LMU L;  4HJ8 A;  1DGS A;  3KOJ A;  3F2C A;  4GKK Q;  2OTL A;  1P8L A;  2N49 A;  3KYH C;  4C3H H;  4DR7 L;  1SE8 A;  2ZTE A;  2PI2 A;  2R7D A;  3RLN A;  3FHW A;  3BU2 A;  3NEL A;  4JBW A;  4UP8 A;  4JI7 L;  2JQO A;  4DR4 L;  1E7Z A;  1E3P A;  3FKI G;  3HFZ B;  5IYB G;  4TQU S;  3CXC A;  1RIP A;  4NXN L;  3T1Y Q;  4BY1 H;  2LXK A;  3ULL A;  2N8N A;  3E0E A;  1AH9 A;  4BXX H;  5IYD G;  3H3V H;  1ASZ A;  1L1O B;  5HGQ A;  5LMN Q;  3S1R H;  2HQL A;  2NZH A;  3PUW A;  3J7Z C;  4LF7 Q;  2Q2T A;  1I3Q H;  4B3M L;  1Y14 B;  3H15 A;  2I5L X;  1YVC A;  3M7N A;  1YJW A;  4YWK A;  2PQA A;  4X66 L;  1A62 A;  1V43 A;  4HJA A;  2A8V A;  1S3O A;  3CC4 A;  3HOV H;  2OCE A;  1X3G A;  1XMQ Q;  4HJ5 A;  1JB7 A;  1X56 A;  5ELN A;  4DR5 L;  1YHA A;  2QEX A;  3NEM A;  2XGT A;  1JJC B;  1TWC H;  3PUZ A;  1IBL L;  4WJ4 A;  2MO1 A;  2D62 A;  4C2M H;  1VQL A;  1VS0 A;  1FGU A;  3CC2 A;  4A3G G;  1PH9 A;  2ALY B;  1N33 L;  3HOZ H;  1YHB A;  2PNH A;  3RN2 A;  5C3E H;  1FJG Q;  5M3M G;  4X64 L;  1M90 C;  5IWA L;  4BBR H;  2VUM H;  2D0O A;  1U5K A;  4JI3 L;  1E24 A;  1PYB A;  4A4I A;  2WFW A;  4JI6 L;  2K5N A;  5GQO A;  1KC8 C;  2V1C C;  4LF6 L;  4FDB A;  4JI4 L;  4MNO A;  2E2H H;  3E9H A;  4A3J G;  1VQ6 A;  3J80 i;  3OTO L;  3AFQ A;  4LF5 L;  1S40 A;  3JAM i;  4LFC L;  1S72 A;  2UUC L;  1XNQ Q;  3F8T A;  1K0R A;  2NN6 G;  3FKI H;  5IYB H;  4DV1 L;  2DUD A;  2K50 A;  1N36 Q;  4ALP A;  4AQY L;  4LF8 Q;  1IXR A;  3G48 A;  4GOP C;  5IYD H;  3TS0 A;  3A74 A;  4IFD J;  3UDG A;  1WJJ A;  1YJN A;  4KLK A;  4JI1 L;  4NB3 A;  3M4O H;  4LFA Q;  4YY3 L;  3PGZ A;  1WCM G;  5H1S E;  1A0I A;  2A1A A;  2C35 B;  2UXB L;  2UU9 Q;  4BA2 I;  4DNI A;  1U0L A;  1MKH A;  2ID0 A;  3K7U C;  5C44 G;  4LUV A;  5C0X G;  4DV5 L;  4L5S A;  1O7I A;  5C4X G;  4GLX A;  4EX5 A;  4DR1 L;  4GOP A;  1XMO Q;  1J5E Q;  3HOY G;  3AQQ A;  1PH7 A;  2NVY H;  3W5O A;  5AJ3 L;  1X9N A;  5C4J H;  3PCO B;  1YEZ A;  3IRB A;  3U4Z A;  1Z47 A;  4KI0 A;  5M5Y H;  2XTI A;  3G6E A;  1JE5 A;  3CCE A;  2CFM A;  1PH3 A;  4DUY Q;  1PA6 A;  3GO5 A;  1TWH H;  3PF4 A;  4K0K L;  4OX9 L;  4O2D A;  2VW9 A;  4B3S L;  4JYA L;  4BBS G;  2ZJQ A;  3ZJY C;  5M3M H;  2CQO A;  3STB C;  1IZ6 A;  1IL2 A;  1X55 A;  3CCV A;  4DR6 Q;  2AWN A;  2RCN A;  3KDF A;  1HNX Q;  1BBW A;  2VY3 A;  1OXT A;  1NBW A;  4A3J H;  4B3T Q;  5IY0 A;  2UUA Q;  1N8R C;  2UUB L;  2RHQ B;  1N32 L;  1KHI A;  4A93 G;  5FJ8 H;  4LF9 Q;  1Z9F A;  3KJP A;  3L0O A;  4APV A;  3OYY A;  5IYC G;  3KF6 A;  3W1G A;  3I4M G;  3S15 H;  3PO2 H;  4Y7N H;  1KQS A;  1BKB A;  2H5X A;  2JJQ A;  3CD6 A;  4IPC A;  4DV0 Q;  1VQ8 A;  3TQY A;  4BY7 G;  1LTL A;  5IP9 G;  1L1O C;  1V9P A;  3T1Y L;  1GD7 A;  1AE3 A;  2ZM6 L;  4JI8 Q;  3RZO H;  1QUQ A;  3TS2 A;  1TWF H;  3HKS A;  2AMC B;  4P74 A;  5EAY A;  3M4P A;  1TWG H;  1VQF A;  1HR0 W;  3DLL A;  5GRO A;  3A5Z B;  1XPO A;  4UP7 A;  5C4X H;  1PH2 A;  3MEF A;  2LXJ A;  4JOI C;  3HOY H;  1B8A A;  1EQQ A;  3F1Z A;  1E1T A;  2OQK A;  2Z6K C;  1L1O A;  1IBM L;  4O0A A;  1NTG A;  3A0J A;  4DR3 Q;  2E2J H;  1VQI A;  2KCT A;  1XMQ L;  1MIU A;  1HNZ Q;  2BA1 A;  3M9B A;  3GTG H;  1YJ9 A;  1KL9 A;  1MJC A;  1KD1 C;  2B63 G;  2F52 A;  3HKZ G;  1Q7Y C;  1CKN B;  2L15 A;  5HY6 A;  1QZG A;  1K83 H;  1D8L A;  5BR8 Q;  4A3C G;  1SLJ A;  5JJL A;  4JOI A;  3GTJ H;  4KHZ A;  3I7F A;  3ULJ A;  2DGY A;  4XTC S;  5IP7 H;  5FLM G;  3CCU A;  2OWO A;  1EQR A;  2Y0S E;  3S1Q H;  4DV3 L;  1I6H H;  2Z0S A;  3CC7 A;  3G71 A;  1A8V A;  2JE6 I;  2NZO A;  3KFU A;  3D0F A;  2WB1 G;  1PFS A;  4QY7 A;  2OTJ A;  2WP8 J;  2QGQ A;  4UY8 C;  5GAG C;  3HOX H;  1UE5 A;  3RZD H;  4A3M H;  4JBM A;  3PIP A;  2E5L Q;  3GD7 A;  2MO0 A;  3I4N H;  4A93 H;  4LWC A;  4QJF A;  4OO1 I;  1EUJ A;  3I4M H;  1LM0 A;  2N3S A;  3GTM H;  1XNQ L;  3J81 c;  4IPD A;  1EYG A;  1HNW Q;  2AKW B;  3KLW A;  5JEA G;  4A3B G;  1N36 L;  4BY7 H;  4R4Q A;  4YHH L;  5IP9 H;  4DV4 Q;  2K75 A;  1JT8 A;  1N9W A;  2MNA A;  2VL6 A;  3CW2 C;  2ATW A;  4IPG A;  1HR0 Q;  2K4K A;  2UXD Q;  1VQ9 A;  2B3G A;  3MXN B;  1JMC A;  1PH1 A;  1N34 Q;  1VQN A;  4LFB Q;  3H3V I;  4LFA L;  2KEN A;  3EBE A;  3PV0 A;  2UU9 L;  1TXY A;  2ZTD A;  1XJV A;  2CCZ A;  4A3E G;  3CCL A;  1IBK Q;  4AYB E;  1XPU A;  1W2B A;  2N78 A;  1W3S A;  1XMO L;  1J5E L;  5ELO A;  4C3I H;  3TEH B;  4GN3 B;  3S24 A;  3T1H Q;  3HOW G;  1C7Y A;  5M5X H;  1VQA A;  1OXU A;  2HIX A;  2WAQ E;  4L5R C;  1TWA H;  2B63 H;  3BJU A;  2AWO A;  3J7A 5;  4DUY L;  3RR5 A;  4A3C H;  4KHP Q;  2JEB I;  1KRT A;  3ICE A;  5FLM H;  1B70 B;  3PIO A;  4IOC A;  3JC6 6;  1VQC A;  1YBY A;  2IY5 B;  3PUY A;  4NXM L;  3E9I A;  4DV2 Q;  4DR2 L;  1IYJ B;  1XNR Q;  4DR6 L;  3K7A H;  3GTP H;  4HJ7 A;  1G29 1;  1HNX L;  1T9H A;  2IHF A;  1C0A A;  1PV4 A;  3CF5 A;  1VQ7 A;  4X65 Q;  2YV5 A;  4JI5 Q;  2NVX H;  1L2F A;  2EQS A;  2IHE A;  2R92 G;  4B3T L;  3M3Y H;  4PZ7 A;  4B3M Q;  2I5M X;  2UUA L;  3CCR A;  4A76 A;  4OON A;  1AE2 A;  2HIV A;  2PMZ E;  1PH5 A;  2HHH L;  4UP9 A;  4LF9 L;  1HZ9 A;  4A3L G;  4A3B H;  4A75 A;  2KBN A;  2K5H A;  3AFP A;  3Q8D A;  3F2B A;  3GTO H;  1WYD A;  1VQE A;  3F2D A;  2K14 A;  1HZA A;  2QA4 A;  1I94 Q;  4PZ6 A;  1SRO A;  4YCW A;  2VNU D;  4A3G H;  1FVI A;  1WFQ A;  3K81 C;  1KIX A;  4IJH A;  4P72 A;  1C9O A;  1CKM A;  1OTC A;  5GAH C;  4JI8 L;  1P16 A;  2E2I H;  4JC0 A;  1YIJ A;  2VQF Q;  4HJ9 A;  1VQD A;  3H0G G;  4OWX B;  4A3E H;  1Q86 C;  2D0P A;  1K73 C;  4JI3 Q;  3DM3 A;  1H95 A;  1CSP A;  4QL5 A;  3CME A;  4LF6 Q;  1VQ5 A;  3S1M H;  3HOU G;  2ASB A;  1J6Q A;  4HIM A;  4JV5 Q;  4OO1 G;  4NPS A;  3OTO Q;  4DR3 L;  5C0X J;  1VQG A;  1CSQ A;  4LFC Q;  1QVC A;  1HNZ L;  4GKK L;  1VCI A;  3ER0 A;  5IE8 A;  2VQE Q;  3GTK H;  3U50 C;  2HT1 A;  4JCV E;  4IFD I;  4GNX B;  3W1B A;  4L5Q A;  3U58 A;  3I56 A;  4Y52 H;  1NMF A;  3FP9 A;  3L7Z C;  2IX0 A;  1VQK A;  4DUZ Q;  3J81 i;  1CKO A;  2VS1 A;  3AEV A;  4JI1 Q;  2F3I A;  1CKN A;  5LMN L;  2R92 H;  1WCM H;  1L0W A;  3CP0 A;  5JJK A;  4YY3 Q;  1VQH A;  1VQP A;  1PH8 A;  1GKH A;  2E5L L;  5C44 H;  4LF7 L;  2UXB Q;  4TVA B;  2R7Z G;  4X6A H;  1X65 A;  2ES2 A;  1G6P A;  2NVT H;  2KCM A;  4DR1 Q;  1SFO H;  2JK8 A;  3OW2 A;  2KHJ A;  3BZK A;  3CPF A;  2JA6 G;  1PYS B;  1Q1B A;  2FXQ A;  3TRZ A;  1HNW L;  4JI2 Q;  1I5F A;  2RHS B;  4RMF A;  1VQ4 A;  4GKJ Q;  2CWP A;  4WJ3 M;  1V1Q A;  2I0Q A;  1OXV A;  3KDF B;  4HIO A;  3M85 A;  1RL2 A;  1LYL A;  4JI0 Q;  4BBS H;  1EIY B;  2F4V Q;  2UXC Q;  1HR0 L;  1UE7 A;  4J15 A;  1R9T H;  4XIG S;  4DK3 C;  4HID A;  3RLO A;  3S14 H;  2UXD L;  5GAD C;  5GAE C;  1N34 L;  3HOZ G;  2Z6K A;  4RG1 A;  4MZ9 A;  3UE1 A;  1FJG L;  2IX1 A;  5DLQ E;  1A63 A;  1JJG A;  1Y1V G;  3STB D;  1M1K C;  1GVP A;  3ULP A;  3BZC A;  4DV6 Q;  3K8A A;  3KF6 B;  2NVQ H;  2YTX A;  1IBK L;  3GTL H;  3HOU H;  4B3R Q;  4GN5 A;  4MTN A;  2ZJR A;  3S2H H;  1K8A C;  3TRE A;  1N32 Q;  3T1H L;  4YWM A;  4JG2 A;  4IPH A;  1EWI A;  4QIW E;  4LUZ A;  1XPR A;  5IYC H;  4POF A;  3I2Z A;  4A3F G;  1YNX A;  1QUQ B;  3GTQ H;  1E22 A;  1JJ2 A;  4KHP L;  3G4S A;  1D7Q A;  3SGI A;  4QGU A;  4LF8 L;  3PUV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...