2ZM6L

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 10
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2zm6L00
4BY1G 4DAMA 4BBSG 3JC66 4HJ8A 2JK8A 4YHHL 2YTYA 4A3JH 1QVGA 3E9IA 2ZJPA 2B63H 5JEAG 3W1BA 3D0FA 4GN5A 1SFOH 1VQ5A 2I5LX 3G48A 4JI3L 4LF9L 4A3LH 1E22A 2R93G 1FL0A 1G6PA 4DR2Q 4A3IG 3KLWA 2OWOA 2Q2HA 1Q12A 3CD6A 3M4PA 4JI7L 1Y1VH 3BJUA 5K36G 3M4OH 4ALPA 5GAGC 4XIGS 4B3SQ 2Y0SE 5IYCH 2ZM6Q 2EIFA 4LNQA 3VDYA 2N3SA 4YCVA 3CC7A 4DR7Q 4B3RL 3STBC 1N32Q 1LUZA 5IT9c 1JT8A 2YV5A 4APVA 1I94L 5C0XJ 3HOWG 4YY3L 3RR5A 2UXCQ 5E7NA 3EN2A 1VQDA 1A62A 1D8LA 4PZ8A 4LF7Q 1H95A 4TQUS 4YCWA 3PSIA 5AJ3L 3H0GG 4DR2L 4IPGA 3ULLA 1CKNB 1ASYA 1MJEA 1C7YA 4DV4Q 3CMEA 5IWAQ 2A1AA 4KHPQ 2CFMA 1IZ6A 1SMXA 4IOAA 1LM0A 2Z6KA 2UXBQ 2KENA 1XPUA 4OWWB 4DV2Q 1CSQA 1YJWA 3NBHB 1HR0L 4X65Q 3L2PA 4HJ5A 1VQCA 3RZDH 3S1MH 3NELA 1EQQA 1JJ2A 2K14A 3RZOH 3M7NA 3PO2G 1VQLA 3GTGH 2NN6I 4GNXA 4PG3A 3GTQH 1E1TA 1S3OA 2IHFA 5C44G 1TWCH 1HNXL 3T1YL 4NXNQ 1VQJA 4EX5A 4A3MG 4K0KQ 3AFQA 2K5NA 4X66L 4DV4L 3A5ZB 2K52A 1TWFH 3Q8DA 3CC2A 3UDFA 3PCOB 3TRZA 3GTLH 1IBMQ 3KF6A 2Y0SG 1PH1A 2IY5B 5C4XH 3I4MG 1W3SA 3HKSA 4A93G 1UWVA 2ASBA 2MFIA 2JA5G 1N36L 3ER0A 2UU9L 4R4CA 3RNUA 4GKJQ 1VQ7A 1VQGA 1EFWA 2RHSB 4GKKL 3M85A 3UE0A 2E8GA 2R7FA 2HHHQ 4JI5Q 5EAYA 4QIWE 4JI3Q 4A3GH 1E1OA 1HNZQ 2B3GA 5GAEC 1KXLA 2JA5H 2F4VL 4GN3B 4R4IA 4DR5L 2VW9A 1CSPA 2IX0A 1VQ9A 4IFDI 4YWMA 5C0XI 1XPOA 4X62Q 3UDXA 4GOPC 2D0PA 1IYJB 5J3BA 1IBML 3CF5A 5IP9H 4HIOA 4KI0A 1SROA 2AHOB 3S16H 1Q1BA 4OONA 4R4OA 4DAYB 1EOVA 3S1NH 4L5TA 4IPDA 1PHJA 1FJGL 1Q81C 3PO3H 2MNAA 1HZCA 1JB7A 4AYBG 4GKKQ 2YTVA 1YJNA 1KRTA 1Q7YC 3E9HA 4LF5L 4C3IH 3W5OA 3D31A 4IJLA 3CC4A 4JV5L 4XTCS 3CAMA 1K0RA 4GS3A 3J81j 1XMOL 3S2HH 1UE7A 1L0WA 4DR1L 2LXKA 3U50C 3CPFA 4JI0Q 3TEHB 1FVIA 4BBRG 2NVQH 4DUYQ 4IJHA 5HGQA 1J5EL 2NVTH 4R4QA 5GAHC 4JI2L 5C3EG 2UXCL 4KHPL 4JI6L 1PH4A 2ID0A 1N9WA 3CCMA 4GNXC 2ATWA 4NXML 3GTOH 2UXBL 1NY4A 1K3RA 1OXXK 1Q8KA 1X3GA 2RF4A 2UUCL 2UUBL 2LSSA 4DR3L 1QZGA 1PH9A 4JI4L 4LUVA 2JA6G 4L5SA 3H15A 3G71A 4HJ7A 1E3PA 2KCTA 2BA0A 1AE3A 4QGUA 2ZTCA 2VY3A 2Q2UA 2I5MX 1WJJA 3OW2A 4UPAA 2GVBA 2ZJRA 1NMFA 1A8VA 4DK6C 1KD1C 1YHQA 1GD7A 5IYCG 2A8VA 2AWOA 4K0KL 2AWNA 2N49A 4YWKA 4DV6L 4JI2Q 5JJKA 1Y1VG 4DNIA 2KBNA 4AQYQ 1UEBA 4YHHQ 1HNWQ 4JC0A 4J15A 4DKAC 4HIMA 4X64L 4A3IH 2K75A 2NZOA 1R9TH 4A3CG 4NXNL 3S1RH 2JQOA 3GD7A 2WB1G 4JI8L 1YZ6A 1UE6A 2DGYA 2OQKA 4MTNA 5LMUQ 2WAQE 4KLKA 4JI5L 1RIPA 1HZBA 4RMFA 3G4SA 2JA7G 4P75A 2L15A 2NN6G 4DR4L 5DLQE 3RN5A 1P8LA 3H3VH 5ELNA 4GLAC 3RLNA 2A19A 2VQFQ 1CUKA 1PYSB 1PA6A 4AQYL 4YY3Q 4B3RQ 1WCMG 3B6YA 3F8TA 5FJ8G 4OO1I 3WWVA 4A3CH 4X64Q 1L1OC 2NZHA 2WAQG 3EBEA 4DV1Q 5M3FH 1XNQQ 5IP9G 1L1OA 2CKZB 2F4VQ 3KF8B 1KQSA 4LF4Q 4HIKA 3PV0A 1IL2A 1EYGA 1IBKQ 2D62A 3J7A5 4HJ9A 4X62L 5IY0A 1KL9A 3ZJYC 1O7IA 1Q82C 1TWGH 4DR1Q 4A3GG 1V43A 1Y1WG 1YHBA 1VQAA 4GLVB 4MZ9A 2JEAI 1VQHA 1X55A 4HJAA 3M4QA 4JBWA 2LXJA 3CCEA 2YTXA 4IFDJ 1GM5A 1NJIC 1G291 3I4NH 2N8NA 3A5UA 2ZJQA 1SR3A 1W2BA 3H3VI 2JA6H 3OYYA 3GTPH 3M3YH 4A93H 2Z6KC 3J7ZC 5IYDH 2EXDA 4A3KG 1X65A 3STBD 1YVCA 1ASZA 4HIDA 3F2CA 4JOIC 1JMCA 4JI6Q 2K5HA 3T1YQ 1Q86C 2CCZA 1SN8A 3BZKA 4PMWA 5M3MH 1BKBA 2UU9Q 5C3EH 2R6GA 1NBWA 1GKHA 2VZAA 5IYBG 4O0AA 4OXPA 4LF6Q 3FKIH 1T9HA 5LMNL 1YHAA 4YWLA 5GADC 3ERSX 4YCUA 4DR6L 3PUZA 1JJGA 3K7UC 1E7ZA 4OWTB 4A3EH 1TWHH 1TWAH 3RLOA 4AIMA 3KDFB 1KAWA 3BU2A 2WP8J 3T1HQ 2QA4A 3DLLA 4LUOA 4DR3Q 1MIUA 2YYZA 3KFUA 4UP8A 2DUDA 2Q2TA 5H1SE 1PH8A 2ZTDA 1MKHA 3PO3G 1YNXA 1FGUA 2KCMA 2XTIA 2BA1A 3FKIG 4AYBE 1QUQA 2V1CC 3UDIA 5LMNQ 4BA2I 1XNRQ 3HOVG 2R92H 2PNHA 3GO5A 1SRUA 1M1KC 3S1QH 5GROA 2Q2IA 3PIOA 4QY7A 4IO9A 4IPCA 3S24A 3I2ZA 3CW2C 2MO0A 3A0JA 3KF6B 3S14H 1XMOQ 3HKZE 4QL5A 2PI2E 2WFWA 4P73A 4R4TA 2VQFL 1XMQQ 1IBLQ 1J6QA 4DR4Q 4IOCA 4JBKA 3PGZA 3K0XA 3CCUA 4DV5Q 4LFBQ 2RCNA 1Y1WH 2KHIA 1XNQL 4H02A 4B3TQ 2BH8A 2PMZE 1N8RC 5LMNW 3TQYA 4LWCA 3KJPA 1YI2A 1K8AC 5C4XG 2JEBI 2K4KA 2ZTEA 4LFAQ 1OXVA 1G51A 2F52A 4DUYL 1XTDA 1OXSC 1PYBA 4GOPA 4GLXA 1CKMA 5C0XG 5M3FG 3ULJA 3E0EA 3PF4A 3I56A 1I50H 3TS0A 4B3SL 1M90C 5FJ8H 1J5EQ 3U4ZA 1OTCA 1I6HH 3SGIA 2FXQA 1IBLL 3A74A 4NXMQ 4QQBX 2VNUD 1L2FA 1NMGA 4BY1H 4BBSH 1VQIA 1JJCB 3PUWA 1RL2A 2H5XA 4A3FG 4DK3C 4LFBL 3PO2H 1EQRA 1I94Q 1N36Q 2PQAA 1U5KA 4B3MQ 4OO1G 2K5VA 3AFPA 3F2DA 1PH5A 3CCLA 4BA1I 2UUBQ 4R1JA 1KHIA 5FLMH 1A0IA 3CP0A 4PZ7A 1K9MC 2UXDQ 1XJVA 1X54A 2OTLA 3JAMi 3CCQA 1VQ4A 3OTOQ 3AYHB 1YIJA 1VQMA 3HFZB 4C2MH 1EIYB 3S2DH 4LF6L 2IT1A 2VL6A 1VQEA 1Q1EA 4DV3L 2OCEA 4BY7H 1VQNA 4IFDG 1V9PA 1S40A 1UE1A 3H0GH 1X3EA 3NEMA 3F2BA 2YU9H 4LF8Q 1X6OA 4DV0L 2JA8G 1Z47A 3PIPA 3PF5A 4JI8Q 1PH2A 1WYDA 1XPRA 2UUAL 3UDGA 3MXNB 3HOWH 1N33L 4A75A 3S15H 3DM3A 3M9BA 1PV4A 4DV7L 3BZCA 1B8AA 4BXXH 4P74A 1OXTA 1I5FA 3HOVH 1PVOA 2E2JH 2JA8H 3L7ZC 4LF4L 2IHEA 2Z0SA 1CKNA 5GQOA 1GO3E 1VQ6A 2C35B 1VQOA 2E2IH 2E5LQ 4BY7G 1AE2A 5FLXc 4LW1A 2OQ0A 3NENA 3W1GA 2KHJA 1QVCA 2AKWB 3KDFA 4DV1L 4P72A 4A3LG 4JYAQ 4ME3A 3HOUG 2R93H 4KHZA 1HZAA 2RHQB 1EWIA 1TXYA 2MQHA 4FDBA 4BBRH 4GKJL 1NTGA 3EIVA 3RLFA 1LYLA 5IYBH 1VQ8A 2HHHL 1YITA 1XNRL 4RG1A 1X9NA 4WJ4A 1IBKL 3GTJH 2N78A 4GNXB 3J80i 3RN2A 4LFAL 2QGQA 1QUQB 3TREA 4A3DG 3CPWA 5BR8L 4A76A 2K50A 1AH9A 4DR7L 2R7ZG 1PH3A 4JI1Q 5M5YH 1SE8A 1VQFA 4DV5L 1UE5A 1PH6A 2CWAA 3J80c 3CCSA 2E5LL 1YBYA 3IRBA 4TVAB 3S17H 2HIXA 3KYHC 4OWXB 3CCJA 3K7AH 4DR6Q 2I0QA 3FHWA 4LF7L 3TS2A 1JE5A 1VQKA 1L1OB 3J81c 1HR0Q 4X65L 5AJ3Q 5JEAJ 1Q46A 4WJ3M 1A63A 1EUJA 4DV2L 4P71A 4QJFA 2AMCB 4LF5Q 1V1QA 4Y7NH 3ULPA 1N34Q 1Y14B 3FP9A 3G6EA 4OX9L 3AEVA 5LMUL 1VQPA 3HOZG 4A3BG 2HQLA 1C9OA 3K81C 3K8AA 1HZ9A 3HOYG 2E2HH 4JG2A 4Y52H 3HOZH 1PH7A 4DUZL 3OTOL 4NB3A 4DV3Q 1K83H 2IX1A 5IP7G 3PUXA 1VS0A 3I4MH 1I3QH 2ALYB 3T1HL 4L5QA 2HT1A 1KIXA 3HKZG 1QZHA 1WI5A 2R92G 2QEXA 1P16A 1BBUA 1MJCA 1C0AA 3MEFA 4LF8L 3GTMH 5HY6A 3KJOA 2PQAB 4A3MH 3ICEA 4JI4Q 2VS1A 1WOCA 4X66Q 1VQBA 4JCVE 2WB1E 1SLJA 5C44H 4OX9Q 1KRSA 1HJPA 4DV7Q 4NPSA 1IXRA 1X56A 3PUYA 3GTKH 2VUMG 1E24A 4GN4B 1HR0W 4JI7Q 2GVAA 3I55A 2XGTA 2BH2A 2VUMH 2ES2A 5C4JH 1N32L 2R7DA 4A3EG 3L0OA 2UUAQ 4B3TL 2HIVA 4LUZA 2B29A 1Z9FA 3HOUH 1DGSA 2JA9A 1GVPA 3I7FA 3CQZH 4MNOA 2NVXH 1D7QA 2I5HA 2JE6I 5M3MG 3AQQA 3JAMc 1HNZL 1VCIA 1YEZA 4JYAL 4C3JH 4AH6A 5M5WH 4DR5Q 2PI2A 2CWPA 5ELOA 4LFCL 4A3KH 3UE1A 4C3HH 1S72A 3K80C 1LTLA 5IYDG 2UXDL 4UP7A 5IP7H 4UY8C 4IPHA 5JJIA 3I4NG 3KOJA 5BR8Q 4BXXG 3U4VA 2VQEL 4EQ5A 5IWAL 4JI0L 4X6AH 4JI1L 3HOYH 3CMAA 1FJGQ 3LGJA 3F1ZA 1K73C 2OTJA 5JJLA 4POFA 4JBMA 2EQSA 4B3ML 1YJ9A 4A3BH 1B7YB 2MO1A 3PUVA 1EIFA 2GN5A 2F3IA 3CCVA 1X3FA 3CCRA 4JOIA 4JV5Q 4O2DA 3J81i 1PFSA 4PZ6A 1HNXQ 1OXUA 3I4OA 2UUCQ 2JJQA 1QVFA 1BBWA 1HH2P 3GDEA 4LF9Q 5M5XH 4LFCQ 1NE3A 1CKOA 4DPGA 1KC8C 1K8GA 4POGA 4GOPB 1BVSA 2B63G 1N34L 1WCMH 4A3JG 2VQEQ 2R7ZH 1U0LA 4DV0Q 2NVYH 4JBJA 5IE8A 5FLMG 3HOXH 3U58A 4A3DH 2ZM6L 2CQOA 4DV6Q 1B70B 4UP9A 4DUZQ 1XMQL 4L5RC 1WFQA 3CXCA 2JA7H 1N33Q 1HNWL 3HOXG 2D0OA 4A4IA 4A3FH
chains in the Genus database with same CATH superfamily
3GTJB 1K8OA 3JC66 4HJ8A 2YTYA 2ZJPA 4LF9L 2I5LX 4A3LH 4G7OC 1G6PA 4CJ1B 2K03A 4DR2Q 3UI2A 1G2SA 2OWOA 2Q2HA 1Q12A 5I2YA 3M4OH 1CZGA 4HMJA 3A54A 4LNQA 2EIFA 1QILA 3STBC 1JT8A 1Q3LA 4YY3L 1U4PA 2A5HA 1VQDA 5KIXA 1F2MA 4C3JB 3PSIA 2XRSD 1X32A 1EY6A 1ASYA 3GTQB 3Q22A 5KNDA 4DV4Q 5IWAQ 4WORA 2RQXA 2CH4A 1LM0A 3I70A 3K5LA 4HJ5A 3RZDH 1VQCA 3NELA 3M7NA 3C1EA 2ICEC 2NN6I 1S3OA 5FO9B 1HNXL 1TWCH 2EYLA 1SYCA 1VQJA 4EX5A 1STEA 3AFQA 4X66L 2RCFA 2O2LD 5I9OA 2PPBC 3KF6A 1PH1A 5I6YA 1KDBA 3HKSA 4A93G 2JA5G 1JQYD 1N36L 2H4OA 2WAQB 5JPNC 5M5YB 1FYCA 3HOVB 2E8GA 4QIWE 1KAAA 3C1FA 4JPBW 1E1OA 2B3GA 4ID6A 1DCZA 2F4VL 4GN3B 5A35A 2VW9A 2Q8IB 2MHVA 2D0PA 5D14A 1J8IA 3OPOA 1IBML 3BVZA 5IP9H 4BBRB 3D4RA 3H3VC 1SROA 3S16H 4OONA 1TU2B 3CU7A 3PO3H 1FJGL 2NVTB 4V190 1S5BD 2MNAA 2EY1A 1PTOF 4AYBG 2K04A 1IW7D 1QE6A 3OIQA 3CC4A 5KGUA 2RDFA 3SXHA 5C6AA 4X3KA 3J81j 4GS3A 3MFYA 4DR1L 2LXKA 5EBDA 4IJHA 1GUTA 4R4QA 5GAHC 5JPMC 3K5MA 5EPKA 4F87A 2UXCL 1K28A 1JE4A 1TS4A 1N9WA 2ATWA 2LSSA 5C5MA 4OL7A 3H15A 5JVH3 3J80L 1AE3A 4IALA 4QGUA 1WJJA 3OW2A 1RCVD 2EYMA 1HPCA 2ZJRA 1A8VA 3QB3A 2KQ3A 2D9UA 2OT2A 1GD7A 5IYCG 2A8VA 1WTRA 2N49A 3FRPB 2F0WA 1Y1VG 2KBNA 1UEBA 4YHHQ 4A3KB 1D2BA 1JR0D 4DKAC 1SAPA 4A3IH 5CV9A 1B2TA 1EZ8A 4JK1C 2NZOA 1R9TH 4UDUC 3S1RH 1UE6A 4MTNA 2RA4A 5LMUQ 2QW7A 4KLKA 3KK7A 2L15A 2X6GA 5DLQE 1AFPA 3H3VH 3NSWA 4U68A 3P75A 3RLNA 2VQFQ 4B3RQ 3BVMA 3B6YA 3E0JA 5FJ8G 4OO1I 4A3CH 4X64Q 5JOBA 1STBA 2WAQG 3X3NA 3TP7A 4EQPA 2QDLA 2JN4A 4LF4Q 5I2XA 1IBKQ 2D62A 4CDDC 1O7IA 3VYSA 4DR1Q 4X3UA 4G7ZC 1STAA 1VQAA 4HJAA 2WV6D 2NTTA 3CCEA 4IFDJ 1NUCA 3SDZA 3OMGA 1W2BA 3MXNA 3OYYA 2Z6KC 4A3KG 2FMCA 1Y1VB 4XDXA 5FOBB 1YVCA 1JMCA 1PRTB 4Z9CB 3J80E 1Q86C 1SN8A 3DM1A 4DA2A 2VZAA 3FKIH 4YWLA 3ERSX 3KLSX 3PUZA 4LK1C 1E7ZA 1UNSA 3M7GA 1JCKB 3KDFB 3V96A 3T1HQ 4WRDA 5C4ZA 1B9MA 1EWHA 4LUOA 2DUDA 5CMDA 1WTPA 4AYBE 1QUQA 1O7ZA 2F0TA 5LMNQ 1MD2D 4Y7NB 3PIOA 3D3RA 1SMYD 4QY7A 3A0JA 1XMOQ 3EQLC 3DEOA 1HQRD 3M4YA 4F88A 1XMQQ 2SNMA 3K0XA 3IFDA 3OIPA 4DV5Q 4BWGB 4G7HC 4H02A 3K7AB 5FLXL 2PMZE 1A15A 4LWCA 4XYOA 5C4XG 5KNCA 2JEBI 4YIJA 1G51A 2F52A 4DUYL 1XTDA 3NE5B 4L6TB 5C0XG 3HGBA 5M3FG 1G91A 3PF4A 3G7LA 1I50H 5FJ8H 5FO8B 1I6HH 2OF1A 1IBLL 1L2FA 2H5XA 4LFBL 4K2LA 1N36Q 4A93B 2PQAA 1U5KA 3I4MB 2A74C 3CCLA 4R1JA 2UXDQ 1K9MC 3C2PA 2D2CC 3JAMi 2ZXOA 1VQ4A 1VQMA 2WACA 4C2MH 3SK4A 1LTGD 4TKOB 4DN4M 4OIKA 1V8QA 1SEBD 1STHA 2IJ0A 3T16A 1S40A 1PLFA 4QCLA 5AFWA 4LF8Q 2MGSA 2JA8G 1TY2A 3PIPA 2J7ZA 1WYDA 3HOWH 4A75A 1CHPD 1IHZA 3S15H 2EYPA 2F1MA 4ME5A 5IT9E 4DV7L 3BZCA 1SMYC 4A3EB 1I5FA 2J4XA 4WFN3 2JA8H 1SYEA 2Z0SA 5IGDA 1EYDA 1B53A 5FLXc 4LW1A 1AN8A 2SDFA 3BZDB 3W1GA 4DV1L 1QVCA 4A3LG 3HOUG 2LMCB 1QCBD 2HHHL 1YITA 2D5DA 3DHQA 1EEFD 4KJNA 1IBKL 1LTAD 2MP1A 3BYTB 3J80i 4LFAL 4NKLA 1QUQB 3TREA 3PO2B 4A3DG 3CPWA 1EFID 4DV5L 1PH6A 5T1IA 3J80c 3CCSA 3IRBA 3S17H 4DR6Q 1WVLA 5EKLA 1CA5A 5HURA 4X65L 5AJ3Q 3VA7A 2O5IC 4DV2L 3OW7A 3VA5A 1Y14B 4A3BG 4K5XA 5LMUL 1SNOA 2HQLA 5F2DA 1HZ9A 5L37A 4JG2A 3QO2A 3OTOL 4NB3A 1K83H 1A3UA 1R4QB 1VS0A 4C3HG 1I3QH 2ALYB 3T1HL 2EYOA 1WI5A 1F2ZA 1P16A 1BBUA 3MEFA 5HY6A 3KJOA 1TR5A 3SR1A 4FF2A 2PQAB 4A3MH 1EY5A 2F0QA 1KTKA 1WOCA 4X66Q 2WB1E 4DNTB 4DV7Q 2RSOA 4JVZA 2CH4W 1Z7TA 3PUYA 1JORA 1E24A 4GN4B 1HR0W 4JI7Q 4BY1B 2XGTA 3K59A 5C4JH 2SOBA 1PZKD 2VB3X 2EE1A 4DXGA 1F2LA 1Z9FA 1TVXA 2KHSA 4M1UB 2IL8A 5CBEE 3JAMc 4A3JB 1VCIA 5C4XB 2EJFC 4C3JH 2ENBA 5ELOA 2Z4HA 1II3A 5IYDG 4KK7A 2G5DA 4UY8C 4IPHA 5JJIA 1U9RA 5BR8Q 1EY9A 1U4LA 1FJGQ 3LGJA 4KN7C 5JJLA 4RKLA 3W3AA 1Y8OB 4B3ML 1GUGA 1EIFA 2GN5A 4DK1A 2R92B 3CCVA 1X3FA 1SSOA 1PFSA 5J22A 1BBWA 1EY7A 4FXKC 3GDEA 2FFKB 4DAPA 4LFCQ 2Z1CA 4ABNA 5T1GA 3W2DA 1ENCA 1BVSA 2FHTA 5CC4A 1WCMH 1N34L 2K01A 1SYGA 4KKSA 1U0LA 4DV0Q 2NVYH 5FLMG 4A3DH 1BF4A 2VB2X 1EU3A 1B70B 1XMQL 2EDGA 2QILA 2JA7H 3ERQA 5M9OA 4ZLTF 4BBSG 1F9QA 4GZYC 2JK8A 3CRLC 4A3JH 1S5CD 3RZOB 1I50B 4DXFA 5JEAG 1HTPA 3D0FA 1ICFB 2R93G 1GOZA 1E22A 1FL0A 5IGEA 4E6IA 1AZQA 4J1MA 2HDLA 4JI7L 4MIUA 5FO7B 5M5WB 3HKZB 4LAAA 2KECA 1N32Q 1LUZA 2YV5A 2WIIB 1Y8PB 3RR5A 3NBIA 5E7NA 1TWAB 3EN2A 1A62A 2KA7A 1EOTA 1LT4D 4PZ8A 4TQUS 4CJ0B 2A73B 3H0GG 3R8BA 4DR2L 4NMZA 3ULLA 4IFDH 2K5WA 1MJEA 5I6WA 3CMEA 2BDOA 1ENFA 2AQ1B 4KN4C 1IZ6A 1XPUA 5KEEA 4X65Q 3S1MH 1JWSD 4C3IG 1EQQA 2EXZA 1VQLA 3GTGH 4GNXA 1I4QA 3NUCA 3T1YL 1C8CA 4NXNQ 2BCOA 5CGKA 1IL8A 2K5NA 4A3GB 3I3CA 3A5ZB 1D5MC 3Q8DA 3NHHA 1JOQA 4R8IA 1IBMQ 2Y0SG 2IY5B 1ZXTA 4PNYA 3Q0AA 3ER0A 3GTGB 4A3FB 3RNUA 2AQ3B 3QJYA 1VQ7A 1LTID 2RHSB 3OMCA 2G9HD 2R7FA 2R61A 2V4DA 4JI3Q 3SK6A 3D4DA 1HNZQ 4R4IA 2IX0A 4IFDI 1FNVA 3NTIA 1G8ZD 1W6JA 1EOVA 3S1NH 4DNRB 4IPDA 1PHJA 5CV8A 1Q81C 4HAEA 1HZCA 1X3QA 1QB5D 1V1PB 4GKKQ 1Q7YC 4XQQA 4PMCA 3ZYYX 4LF5L 1PFNA 1IYUA 2NN6H 1XMOL 3S2HH 1UE7A 2JSOA 3S17B 3U50C 3CPFA 1HHVA 1G2TA 4H7BA 4BBRG 4DUYQ 1NNXA 2K05A 5HGQA 1W6KA 3EJIA 5DAUA 1GUNA 5C3EG 2PO4A 4JI6L 3BDOA 2ID0A 2KUMA 4EQNA 4GNXC 3CCMA 3GTOH 4NXML 1EYCA 5KNBA 2UXBL 1NY4A 1UEAB 3D8GA 3S9WA 4J6HA 1PH9A 1SNDA 4JI4L 2DNCA 5CV4A 2AUKA 2E75C 2ZTCA 1H9JA 2P5ZX 4I65A 2I5MX 2VY3A 3DXJC 1YNNC 3E6ZX 4DK6C 3OOCA 1ICWA 4DV6L 4JI2Q 5JJZA 4AQYQ 4J15A 1WTVA 2L5TA 2DY7A 1GUSA 2K75A 4NXNL 2JQOA 3GD7A 2WB1G 1PTOC 1YZ6A 2OQKA 4IUQA 5IGFA 3R3OA 1RIPA 3JAML 4FYDA 3RN5A 1FD7D 5ELNA 3H6MA 4U673 1UAPA 1EQTA 1PA6A 5ELEA 3SVMA 3S16B 3ONAB 4DV1Q 2B2TC 5IP9G 3KF8B 1KQSA 2ICIA 3WOEA 4HIKA 1IL2A 3G6JB 4HJ9A 5IOCA 3MXPA 2LY7A 2B2YC 3IFTA 1RD9D 3WOFA 4IUPA 3J7AV 4GLVB 5K5PA 3C3LA 1VQHA 4JBWA 2LXJA 1NJIC 1G291 2N8NA 3AU7A 2ZJQA 3H3VI 1KLUD 1NR2A 5IYDH 1RF2D 1F9PA 4DAYA 1S5FD 2SNSA 1F2YA 5G3LF 1X65A 4HMIA 1ASZA 2R93B 2CCZA 4IN3A 4L8JA 2RDHA 2R6GA 4O0AA 4OXPA 1JJGA 1E2WA 2B2UC 4Q5VA 4OWTB 4A3EH 4AIMA 3RLOA 3SE0A 3BU2A 2WP8J 1A3VA 2QA4A 1PTOD 1QJOA 3DLLA 4DR3Q 1HA6A 4FO2A 2EYHA 4UP8A 2A6HC 3P7JA 5J39A 3R93A 2MUYA 1H9SB 1BCPB 2XTIA 2BA1A 4RGOS 5JVG3 1MBYA 3N6RA 2XWBB 1YNND 1SRUA 1M1KC 2Q2IA 4IO9A 1PXUA 3QIAA 2MO0A 3RUZA 1SNCA 3KF6B 3S14H 3HKZE 4FF3A 1V1OA 2KCNA 2WFWA 4P73A 4QL5A 4R4TA 4DR4Q 4JBKA 3PGZA 1I4RA 3S1RB 3CCUA 4LFBQ 1A3TA 4B3TQ 5FKAC 3HOXB 2LFNA 1YI2A 2K4KA 2ZTEA 3NK9A 3GQBA 3Q24A 1R4PB 4BS9A 5ELCA 3ULJA 1HRJA 5JEAH 5E1FA 1JWMD 4QQBX 2VNUD 4BBSH 4KD3A 1WD0A 3A8JE 3M3YB 1MSGA 1EQRA 2PNRC 1DOKA 3F2DA 2OXPA 4HEDA 1H9MA 1KHIA 4PZ7A 3CCQA 3OTOQ 1BCPF 2PW7A 3MA2B 1YIJA 3HFZB 4A3MB 4F7XA 1EIYB 3S2DH 3I4NB 2IT1A 1BR9A 2MJ8A 1VMCA 2IW3A 4BY7H 4IFDG 1V9PA 2ZXRA 1UE1A 3H0GH 3F2BA 2YU9H 1X6OA 5J1ZA 1GUOA 4DV0L 4CDEC 1PH2A 4OGQC 2UUAL 1PTOB 3MXNB 4OELB 1N33L 2E76C 2LKVA 3DM3A 1PV4A 1D1KA 4P74A 1OXTA 2EY2A 3HOVH 1EWCA 1PVOA 2X6LA 4LF4L 1Q90A 5K36H 5GQOA 3HRZC 1GO3E 2A68D 2NZ1D 2C35B 1AEXA 4OIJA 4BY7G 5I9PA 4G57A 2F4IA 2KHJA 3GV3A 2R93H 4JYAQ 4P72A 3K5OA 3V05A 4FF4A 1TXYA 2MQHA 4FDBA 1PFMA 3RLFA 5IYBH 4RG1A 1CHQD 3NTHA 1GHKA 1DYQA 4GNXB 3T51B 3SK8A 3FEWX 4RHSA 1EU4A 2K50A 2R3ZA 5M5XB 2R7ZG 1VQFA 2E5LL 1CM9A 3QR8A 1YBYA 4TVAB 2EPBA 1O78A 3SK5A 1CA6A 2I0QA 1JE5A 1VQKA 1JB3A 1SE2A 1JOOA 1Q46A 4WJ3M 1S5ED 3PQIA 1V1QA 1N34Q 3FP9A 3G6EA 4JW0A 1VQPA 1XX8A 2L0CA 3IL8A 3HOYG 4Y52H 3HOWB 1EL0A 4DV3Q 1SYFA 5IP7G 4K5WA 4FVMA 3I4MH 5CV6A 4DAVA 3HKZG 1QNKA 4KY6A 5DEHA 1MJCA 1TWGB 4LF8L 2PW5A 3ICEA 2NVYB 4KY5A 2VS1A 2L12A 4X6AH 4WJWA 1SLJA 1KRSA 2K1BA 2GVAA 4BBSB 4I7AA 5EPLA 5G3LD 2VUMH 1N32L 4MTKA 5JAVA 1DZ1A 3DWQA 3OHXC 3HZXA 2UUAQ 2HIVA 3MZ5A 2B29A 1HQMC 3HOUH 2JA9A 3CQZH 4MNOA 1D7QA 1IW7C 1ML0D 2ZT9C 2IX3A 1HNZL 4CHTB 4NP5A 4CBVA 2F3WA 4AH6A 4DR5Q 1BQQT 2AQ2B 1AP0A 2QDBA 1HUNA 4A3KH 2Q8RE 3UE1A 4C3HH 2VUMB 2XVSA 1LTLA 2UXDL 1MSHA 4UP7A 1MGSA 3U4VA 2B2YA 2VQEL 5IWAL 4XQNA 4UHVA 1K73C 3DMUA 5CV7A 4JBMA 2EQSA 4A3BH 1HA5A 1B7YB 1LABA 1CFMA 2RDGA 1A2UA 4CGYB 1EEID 4O2DA 4PZ6A 1IKMA 1OXUA 2UUCQ 1ZYRC 1QVFA 2XWJB 1NE3A 2EYFA 3T13A 4Q0FA 1KC8C 4POGA 1LLRD 2F0DA 4KD4A 4CJ2C 2B63G 4A3JG 2PQEA 4JBJA 4K14A 1EY0A 1RTOA 2CQOA 2ZXPA 4XQJA 1V1PA 4A4IA 4A3FH 1PH7A 2F0OA 4BY1G 3VR3A 4O42A 4DAMA 4ILWA 3E9IA 1BXTA 1FGBD 3W1BA 1CT1D 2LS01 1LO5D 1WTOA 5C0XH 3MXGA 3KBXA 3KLWA 1Y1VH 5K36G 1I4XA 3KLSA 2Y0SE 5IYCH 2A68C 3L3OC 2ZM6Q 1SYDA 1Y1WB 4YCVA 4B3RL 3FKIB 5ISRA 2NUCA 2O4XA 4FF1A 1BBXC 4APVA 4RA8A 1I94L 1ESFA 2F0FA 3HOWG 2UXCQ 4KHVA 1D8LA 4BY7B 2DJGC 5EKIA 2O5JC 4J8QA 4CKEA 5AJ3L 1LTRD 2L55A 2YU9B 4IPGA 1CKNB 1STYA 3N52A 1XXGA 4N8X1 1O80A 4G4KA 1SMXA 2Z6KA 2UXBQ 2KENA 4DV2Q 1HR0L 1KNEA 4NDXA 2E2DC 2PZTA 3I72A 3PO2G 2WKCA 4ZCKA 4PG3A 5HGTA 3GTQH 3ND9A 2IHFA 5C44G 1HTLD 2HQEA 4QIWB 1ZEQX 2B2VC 1TWFH 3QOJA 2NVQB 3R2TA 3PCOB 4QMGA 3TRZA 3T4AC 3A7AB 1TY0A 4B9XA 1W3SA 1DOLA 3TP6A 5BN4A 2NTSA 2MFIA 2ASBA 2UU9L 4R4CA 4IQZA 1BDOA 1L0XB 3NWTA 1EFWA 4GKKL 2KEEA 3GP7A 3UE0A 3M85A 2JA6B 3GTPB 2A69C 2K6AA 5GAEC 2F3VA 1CSPA 1VQ9A 4RHRA 4YWMA 1XPOA 1U4RA 4X62Q 1SNMA 4GOPC 3FPUB 1TQOA 5EJWA 5J3BA 4HIOA 2AHOB 2F0HA 3TP8A 4L5TA 2K33A 3SEBA 2N88A 1KLGD 3FPPA 1KRTA 2QEJC 3A8KE 3W5OA 3D31A 4IJLA 4AYBB 4JV5L 2E74C 3CAMA 4XTCS 2FINB 1L0WA 3U9SA 3TEHB 1TWFB 2NVQH 2I07B 4HCSA 2NVTH 3PO3B 4JI2L 4KHPL 2TMPA 1TT2A 1LTBD 1PH4A 4XT3B 4EGVA 3CHBD 2F0KA 5CORA 2RF4A 1K3RA 1Q8KA 1X3GA 2UUCL 4K2KA 1QZGA 3HOVG 4LUVA 3G71A 1E3PA 1TIID 2KCTA 2BA0A 3TP5A 2N55A 3ITPA 4HSVA 1D1IA 1ESRA 2GVBA 1F9SA 2B39A 1YHQA 3FDTA 1PRTC 2AWOA 3CRKC 1DXMA 4K0KL 2AWNA 4YWKA 2EY6A 2K28A 2J0TD 3LWEA 1HNWQ 2HD3A 2CW0C 3VYTA 4ZRZA 4A3CG 4JI8L 1PRTF 2DGYA 4HN7A 2HCCA 1BCPC 1HFGA 1E2ZA 4JI5L 1HZBA 3G4SA 4P75A 1RTNA 2NN6G 3AB9A 4DR4L 1P8LA 3GTKB 4GLAC 1CUKA 1PYSB 4AQYL 3MXUA 1EQVA 3BYYB 2NYZD 3D6CA 3F8TA 1J9OA 3WWVA 1L1OC 5ELBA 1XNQQ 2EOTA 5M3FH 3MAQA 2CKZB 2F4VQ 3X3MA 2G9DA 1EYGA 3J7A5 1WTWA 4X62L 5IY0A 3ZJYC 1ZYRD 1RKNA 3MWYW 1Q82C 2F0VA 3MHBA 1V43A 2RBMA 4MZ9A 4RGMA 5C44B 1B4OA 2YTXA 1GM5A 3I4NH 3M3YH 3A5UA 2JA6H 3GTPH 4KY7A 4A3IB 2EXDA 3STBD 4QUFA 5C4JB 4JI6Q 2K5HA 4TSSA 3V2TA 3T1YQ 1TS5A 3BZKA 4PMWA 1BKBA 5C3EH 1NBWA 3OWFA 1UUPA 1T9HA 1YHAA 1WTQA 4H13C 2B2UA 5GADC 5DNFA 2XN9C 1C48A 4CKCA 1PYWD 3GV6A 1TWHH 4N8FA 4PQXA 4OEMB 4K6DA 1K0SA 4N9PA 1NAPA 2BE5C 1VF7A 1YNJD 3J7YW 3KFUA 4HR7B 5C3EB 1KDAA 2TSSA 1D5ZC 3DUZA 1MKHA 1PZID 3PO3G 3FKIG 3K0YA 3UDIA 3M4OB 4HTHA 1XNRQ 2R92H 3Q23A 1TWHB 2QCPX 3GO5A 4C2MB 2K5DA 5GROA 4IPCA 3I2ZA 3CW2C 3FMCA 4DF7A 3T53B 2PI2E 2NB0A 2VQFL 1C4QA 2F0MA 2KHIA 1XNQL 4XYQA 5LMNW 3TQYA 3P20A 1K8AC 3SHLA 3C46A 2CVRA 4LFAQ 1B3QA 1FNUA 1PRTD 1WTHA 1OXSC 2DY8A 3E0EA 4KV6A 4RGNA 4C1NI 3I56A 3TS0A 4B3SL 2B63B 1Q8IA 3U4ZA 1HCZA 3SGIA 2FXQA 4NXMQ 1NMGA 4BY1H 1QOHA 3PUWA 1WD1A 1RL2A 2B2WC 4TRDA 1SDFA 1O7LA 2XNAC 2PYKA 1K8MA 2F0GA 2FJ2A 2EVBA 1XJVA 3S1MB 2OTLA 3TBIB 3KF8A 1S5DD 2B2WA 5DM63 4LF6L 1VQEA 3LNNA 2OCEA 3A7LA 3FVQA 1L0YB 1Z47A 3PF5A 4ZAIA 4R9WA 1XPRA 1AW7A 3HOZB 5IODA 3E5SA 2Z8LA 1B8AA 5EKKA 5C3WA 2XSCA 3BG3A 2C9OA 5KYLA 2B2TA 1VQ6A 2JA5B 1VQOA 2E5LQ 2WINB 2OQ0A 2Y0SB 3NENA 3MFGA 1A63A 3Q6SA 1SXTA 1YNJC 4S3SA 4ME3A 3S15B 4KHZA 1EWIA 4GKJL 1OO9B 3NBHA 2PCFB 3EIVA 3JAME 1XNRL 1VQ8A 4H44C 4RKBA 3S14B 3NWSA 3VYUA 5BR8L 4A76A 1AH9A 1QWYA 3DWPA 4JI1Q 1ONLA 2CWAA 1I4GA 3CCJA 3KYHC 4OWXB 1A2TA 3VYRA 3FHWA 3TS2A 3I4LA 3H91A 4IUUA 2I46A 4ZKBB 3J81c 3TDQA 1LV9A 3RD4A 2AMCB 4LF5Q 4Y7NH 5KRUA 3ULPA 3AEVA 4KTAA 5NUCA 3NP8A 1G6ZA 1SYBA 1JWUD 3K8AA 2E2HH 2R7ZB 2IX1A 3PUXA 2M00A 1EYAA 1QZHA 1R9TB 2R92G 1HUMA 1C0AA 4KKTA 3GTMH 4DFAA 4RGTA 2L11A 4JI4Q 2L4NA 1CTMA 4OX9Q 1DONA 5C44H 1HJPA 1EY8A 3PMFA 1K83B 1IXRA 1X56A 2A6HD 3GTKH 2VUMG 1QG7A 4RH6A 1BCPD 3I55A 2BH2A 1K3BC 2R7DA 2A6ED 2Z9HA 5FK9C 3L0OA 2B8GA 2CW0D 4B3TL 4RFBA 1LTTD 1GVPA 2JYOA 2NVXH 2I5HA 2JE6I 3AQQA 3I91A 4JYAL 1YEZA 2BDNA 3IKJA 1M4VA 5IT9L 2CWPA 3VR2A 1S72A 2SEBD 3K80C 4ZQ3A 1DOMA 1E0BA 3I4NG 3KOJA 5E3FA 5C4HA 4JI0L 4JI1L 3HOYH 4IUTA 3CMAA 3F1ZA 1F9RA 3KBGA 4POFA 1I3QB 1CQFA 3TSSA 5ELFA 2B8FA 1IYVA 2MO1A 2F0LA 5EBCA 2F3IA 4JOIA 4JV5Q 1RODA 1MHWC 1HNXQ 2JJQA 1TS3A 2K32A 5C5LA 5C3XA 5M5XH 4LF9Q 1TWCB 1CKOA 4DPGA 3HOYB 5M3MB 2VQEQ 2F0SA 3TZDA 5KYIA 3U58A 1HXYD 2ZM6L 4DV6Q 4UP9A 1PZJD 4DUZQ 1JC7A 2M2LA 4L5RC 1WFQA 1N33Q 1AZPA 2CQAA 4KI0A 5IYBG 1D6EC 3NQTA 2NVXB 2HCIA 4L63B 3K58A 2Q8TA 4YHHL 1QVGA 2B63H 1SFOH 4GN5A 1VQ5A 3G48A 4JI3L 4A3IG 1MI2A 4A3DB 3LWUA 3CD6A 3M4PA 3BJUA 5EQ0A 2KJXA 1U4MA 4ALPA 5GAGC 4XIGS 4B3SQ 1VDZA 1FNWA 3VDYA 2N3SA 3R2IA 3CC7A 4DR7Q 4DK0A 3WDNA 5IT9c 3HOUB 5C0XJ 3K6OA 1H95A 4LF7Q 4YCWA 3MC0B 4A3BB 1ENAA 5LL6X 2RSNA 1C7YA 1WCMB 1B50A 2A69D 2A1AA 3BDLA 2CFMA 4KHPQ 2BE5D 2F0EA 4IOAA 1CI3M 3VR4A 1O7YA 3GTMB 2F0UA 4ZK9B 3S1NB 4OWWB 2JA7B 1CSQA 1YJWA 2BOSA 3NBHB 2EZVA 2EYJA 3L2PA 3HEJA 4OO1H 1PFBA 1JJ2A 2K14A 3RZOH 2GA4B 5A2QL 2X69A 1F77A 3NTKA 1E1TA 3PIP3 2F0IA 3DWAA 1BO0A 4A3MG 2PZWA 4K0KQ 4DV4L 1WTXA 2K52A 3CC2A 4K6LA 3UDFA 1Y69U 1B1ZA 3GTLH 3IAYA 3MTSA 5C4XH 2K7VA 3MVVA 3I4MG 2XRQD 1UWVA 2OEOA 2FMMA 4GKJQ 1VQGA 5IGCA 2HHHQ 4JI5Q 5EAYA 1TKWB 5A2QE 3EROA 4K8IA 4A3GH 5M3FB 1KXLA 2JA5H 3F2UA 2RKSA 4DR5L 5C0XI 3UDXA 5DM73 1IYJB 2F0NA 1X3PA 3CF5A 1VMPA 1Q1BA 4R4OA 4DAYB 2WB1B 1BNZA 4PV1C 4RWSC 1JB7A 2YTVA 1YJNA 3E9HA 4C3IH 1ILQA 1LACA 1I4PA 1BOSA 1K0RA 4H0LC 4ZKCB 2IWHA 4RAUC 2EJGC 2EJMA 4JI0Q 3HG9A 1FVIA 1J5EL 3QOLA 1ET6A 5BN5A 5CYUA 1CK1A 1SFOB 1CQVA 3DEPA 4PMBA 2CHBD 1OXXK 3A8IE 2UUBL 2JA6G 4DR3L 1ZKOA 4L5SA 4HJ7A 4CDFC 1NSNS 2C5CA 2Q2UA 2PMZB 4UPAA 3OWEB 1KNAA 1TS2A 1NMFA 1KD1C 3QWNA 3D4WA 5CR3A 5JJKA 3VR5A 4DNIA 4I7ZC 4P2CB 2KVMA 3KLRA 4JC0A 4QF4A 4V0BA 4HIMA 4X64L 2JXMB 5D3DA 1DM0B 1D5XC 3E3XA 4EVOA 1Y8NB 3QG1A 2EY5A 1E2VA 1B44D 4NW2A 2WAQE 1H9RA 1RJTA 1SNPA 4RMFA 2JA7G 4B9WA 1I6VC 2A19A 4YY3Q 1WCMG 3GTOB 2NZHA 3EBEA 2MPMA 4N9TA 1L1OA 3H09A 2WKDA 3PV0A 2PZUA 4MHEA 1T5XD 1PTOH 1KL9A 1M8AA 3NPPA 1TWGH 1SBBB 4A3GG 1Y1WG 1YHBA 2JEAI 2E2JB 1X55A 1ET9A 3M4QA 1SR3A 4A93H 4LJZC 3J7ZC 3MEHA 4ZUIA 1SJED 4HIDA 3F2CA 4JOIC 1I6HB 5EGTA 1CZWA 1EIGA 5M3MH 2UU9Q 4KKUA 1GKHA 4LF6Q 4KMUC 4QB4A 5FLXE 5LMNL 4DR6L 4YCUA 4K5VA 1I4HA 2KOLA 3H94A 3K7UC 4FXGC 1TWAH 5EPJA 1KAWA 2HUGA 2NBFA 4CKBA 2M9VA 1MIUA 2YYZA 2DJFC 4C56C 2Q2TA 5H1SE 1PH8A 2ZTDA 2QF7A 1YNXA 1FGUA 2KCMA 4ZUJA 2V1CC 2RVLA 5IGBA 4BA2I 3TZUA 1PMRA 2PNHA 2JP1A 3S1QH 2AUJD 4X3TA 4OHJA 3S24A 3TN2A 2KCCA 3J81L 1IBLQ 1J6QA 4MN3A 4QUCA 4IOCA 3U9OA 4K8JA 4F8MA 5ELDA 2RCNA 1Y1WH 2BH8A 1STNA 1N8RC 1B3AA 4FP5D 3A55A 1SNQA 4DGZA 3KJPA 3BVGA 3S1QB 1HFNA 1IKLA 1OXVA 5IIFA 4GLXA 1PYBA 4GOPA 1CKMA 3CKIB 5E4XA 3HS0C 3J7AF 3TMEA 3HP3A 1M90C 1J5EQ 1OTCA 1FR3A 3A74A 3NXWA 3K57A 1VQIA 1JJCB 3BDCA 4A3FG 4DK3C 3PO2H 5CBAE 1I94Q 3NQIA 4B3MQ 4OO1G 2K5VA 3AFPA 1PH5A 4BA1I 2UUBQ 5FLMH 1A0IA 3CP0A 1X54A 3RZDB 3AYHB 1LT5D 1EY4A 3PIO3 1EIHA 4X3SA 5E4WC 4DV3L 1KDCA 2VL6A 1Q1EA 3J81E 2KEDA 3EVQA 1VQNA 1A6XA 4HSPA 1X3EA 3NEMA 4C3IB 2DNEA 3RMHA 2E2IB 2L9HA 4JI8Q 2VXWA 4UAIA 3UDGA 3M9BA 2IPKD 3URYA 1Z6HA 3OSOA 4BXXH 2E2JH 5BN3A 1S4ZA 3L7ZC 2IHEA 1CKNA 3H0GB 4HCEA 4R8NA 4C3JG 2E2IH 4EQOA 1AE2A 1JICA 2AKWB 3KDFA 4ULLA 3VR6A 2NWGA 1HZAA 2RHQB 4BBRH 3L9AX 1NTGA 1RDPD 1LYLA 1SE4A 3S2HB 1X9NA 4WJ4A 3GTJH 2N78A 1H9SA 1B9NA 3RN2A 2QGQA 5I4DA 4DU9A 4ZYSA 2K5QA 4B08A 4DR7L 4FNFA 1H9KA 1SJHD 1PH3A 5M5YH 1SE8A 1UE5A 2DN8A 1LTSD 2HIXA 2Z4IA 1GJXA 3K7AH 3LX0A 1JOKA 4LF7L 1GHJA 3CQZB 1L1OB 1NR4A 1HR0Q 5JEAJ 1EUJA 4P71A 4QJFA 1NCVA 4IURA 1LT3D 2B2VA 4OX9L 3HOZG 1C9OA 1DD2A 3K81C 4FXDA 1ILPA 4KJOA 2XIWA 3HOZH 4DUZL 4IUNA 3EFXD 1XWEA 4RCOA 4L5QA 4LMQD 2HT1A 1KIXA 2QEXA 3A56A 1XTCD 3I73A 4XT1B 5TSSA 3EA6A 3T56B 3I90A 2QKIC 1VQBA 4JCVE 4NPSA 5LHY1 2L1BA 1GXDC 1DJRD 1KABA 2ES2A 5D65A 4M8AA 5CV5A 2H1EA 4A3EG 1LT6D 4O1NA 4RCNA 4LUZA 2Z6BA 1XYIA 5D3IB 1DGSA 2F0JA 3I7FA 1VF5C 5M3MG 1STGA 2JA8B 5M5WH 3S2DB 2PI2A 1GUWA 4LFCL 4IZ8A 5IP7H 4BXXG 5COYA 3D6WA 1T5EA 4EQ5A 3BS1A 5LL6S 5IGGA 2OTJA 1YJ9A 4C1NK 1QNUA 4ODGA 1SE3A 3PUVA 3P1HA 2F0PA 3CCRA 3GTLB 3J81i 3I4OA 1HH2P 4XXEA 4C3HB 4IUVA 2A6EC 1K8GA 3KUPA 4GOPB 3O13A 2HDMA 2R7ZH 1PDQA 1RHPA 2E2HB 3K5NA 5IE8A 3HOXH 3ND8A 1BUVT 3I8ZA 2F03A 4CDCC 3AMUA 3CXCA 1HNWL 1EZ6A 3HOXG 2D0OA
chains in the Genus database with same CATH topology
4BY1G 4DAMA 4BBSG 3JC66 4HJ8A 2JK8A 4YHHL 2YTYA 4A3JH 1QVGA 3E9IA 2ZJPA 2B63H 5JEAG 3W1BA 3D0FA 4GN5A 1SFOH 1VQ5A 2I5LX 3G48A 4JI3L 4LF9L 4A3LH 1E22A 2R93G 1FL0A 1G6PA 4DR2Q 4A3IG 3KLWA 2OWOA 2Q2HA 1Q12A 3CD6A 3M4PA 4JI7L 1Y1VH 3BJUA 5K36G 3M4OH 4ALPA 5GAGC 4XIGS 4B3SQ 2Y0SE 5IYCH 2ZM6Q 2EIFA 4LNQA 3VDYA 2N3SA 4YCVA 3CC7A 4DR7Q 4B3RL 3STBC 1N32Q 1LUZA 5IT9c 1JT8A 2YV5A 4APVA 1I94L 5C0XJ 3HOWG 4YY3L 3RR5A 2UXCQ 5E7NA 3EN2A 1VQDA 1A62A 1D8LA 4PZ8A 4LF7Q 1H95A 4TQUS 4YCWA 3PSIA 5AJ3L 3H0GG 4DR2L 4IPGA 3ULLA 1CKNB 1ASYA 1MJEA 1C7YA 4DV4Q 3CMEA 5IWAQ 2A1AA 4KHPQ 2CFMA 1IZ6A 1SMXA 4IOAA 1LM0A 2Z6KA 2UXBQ 2KENA 1XPUA 4OWWB 4DV2Q 1CSQA 1YJWA 3NBHB 1HR0L 4X65Q 3L2PA 4HJ5A 1VQCA 3RZDH 3S1MH 3NELA 1EQQA 1JJ2A 2K14A 3RZOH 3M7NA 3PO2G 1VQLA 3GTGH 2NN6I 4GNXA 4PG3A 3GTQH 1E1TA 1S3OA 2IHFA 5C44G 1TWCH 1HNXL 3T1YL 4NXNQ 1VQJA 4EX5A 4A3MG 4K0KQ 3AFQA 2K5NA 4X66L 4DV4L 3A5ZB 2K52A 1TWFH 3Q8DA 3CC2A 3UDFA 3PCOB 3TRZA 3GTLH 1IBMQ 3KF6A 2Y0SG 1PH1A 2IY5B 5C4XH 3I4MG 1W3SA 3HKSA 4A93G 1UWVA 2ASBA 2MFIA 2JA5G 1N36L 3ER0A 2UU9L 4R4CA 3RNUA 4GKJQ 1VQ7A 1VQGA 1EFWA 2RHSB 4GKKL 3M85A 3UE0A 2E8GA 2R7FA 2HHHQ 4JI5Q 5EAYA 4QIWE 4JI3Q 4A3GH 1E1OA 1HNZQ 2B3GA 5GAEC 1KXLA 2JA5H 2F4VL 4GN3B 4R4IA 4DR5L 2VW9A 1CSPA 2IX0A 1VQ9A 4IFDI 4YWMA 5C0XI 1XPOA 4X62Q 3UDXA 4GOPC 2D0PA 1IYJB 5J3BA 1IBML 3CF5A 5IP9H 4HIOA 4KI0A 1SROA 2AHOB 3S16H 1Q1BA 4OONA 4R4OA 4DAYB 1EOVA 3S1NH 4L5TA 4IPDA 1PHJA 1FJGL 1Q81C 3PO3H 2MNAA 1HZCA 1JB7A 4AYBG 4GKKQ 2YTVA 1YJNA 1KRTA 1Q7YC 3E9HA 4LF5L 4C3IH 3W5OA 3D31A 4IJLA 3CC4A 4JV5L 4XTCS 3CAMA 1K0RA 4GS3A 3J81j 1XMOL 3S2HH 1UE7A 1L0WA 4DR1L 2LXKA 3U50C 3CPFA 4JI0Q 3TEHB 1FVIA 4BBRG 2NVQH 4DUYQ 4IJHA 5HGQA 1J5EL 2NVTH 4R4QA 5GAHC 4JI2L 5C3EG 2UXCL 4KHPL 4JI6L 1PH4A 2ID0A 1N9WA 3CCMA 4GNXC 2ATWA 4NXML 3GTOH 2UXBL 1NY4A 1K3RA 1OXXK 1Q8KA 1X3GA 2RF4A 2UUCL 2UUBL 2LSSA 4DR3L 1QZGA 1PH9A 4JI4L 4LUVA 2JA6G 4L5SA 3H15A 3G71A 4HJ7A 1E3PA 2KCTA 2BA0A 1AE3A 4QGUA 2ZTCA 2VY3A 2Q2UA 2I5MX 1WJJA 3OW2A 4UPAA 2GVBA 2ZJRA 1NMFA 1A8VA 4DK6C 1KD1C 1YHQA 1GD7A 5IYCG 2A8VA 2AWOA 4K0KL 2AWNA 2N49A 4YWKA 4DV6L 4JI2Q 5JJKA 1Y1VG 4DNIA 2KBNA 4AQYQ 1UEBA 4YHHQ 1HNWQ 4JC0A 4J15A 4DKAC 4HIMA 4X64L 4A3IH 2K75A 2NZOA 1R9TH 4A3CG 4NXNL 3S1RH 2JQOA 3GD7A 2WB1G 4JI8L 1YZ6A 1UE6A 2DGYA 2OQKA 4MTNA 5LMUQ 2WAQE 4KLKA 4JI5L 1RIPA 1HZBA 4RMFA 3G4SA 2JA7G 4P75A 2L15A 2NN6G 4DR4L 5DLQE 3RN5A 1P8LA 3H3VH 5ELNA 4GLAC 3RLNA 2A19A 2VQFQ 1CUKA 1PYSB 1PA6A 4AQYL 4YY3Q 4B3RQ 1WCMG 3B6YA 3F8TA 5FJ8G 4OO1I 3WWVA 4A3CH 4X64Q 1L1OC 2NZHA 2WAQG 3EBEA 4DV1Q 5M3FH 1XNQQ 5IP9G 1L1OA 2CKZB 2F4VQ 3KF8B 1KQSA 4LF4Q 4HIKA 3PV0A 1IL2A 1EYGA 1IBKQ 2D62A 3J7A5 4HJ9A 4X62L 5IY0A 1KL9A 3ZJYC 1O7IA 1Q82C 1TWGH 4DR1Q 4A3GG 1V43A 1Y1WG 1YHBA 1VQAA 4GLVB 4MZ9A 2JEAI 1VQHA 1X55A 4HJAA 3M4QA 4JBWA 2LXJA 3CCEA 2YTXA 4IFDJ 1GM5A 1NJIC 1G291 3I4NH 2N8NA 3A5UA 2ZJQA 1SR3A 1W2BA 3H3VI 2JA6H 3OYYA 3GTPH 3M3YH 4A93H 2Z6KC 3J7ZC 5IYDH 2EXDA 4A3KG 1X65A 3STBD 1YVCA 1ASZA 4HIDA 3F2CA 4JOIC 1JMCA 4JI6Q 2K5HA 3T1YQ 1Q86C 2CCZA 1SN8A 3BZKA 4PMWA 5M3MH 1BKBA 2UU9Q 5C3EH 2R6GA 1NBWA 1GKHA 2VZAA 5IYBG 4O0AA 4OXPA 4LF6Q 3FKIH 1T9HA 5LMNL 1YHAA 4YWLA 5GADC 3ERSX 4YCUA 4DR6L 3PUZA 1JJGA 3K7UC 1E7ZA 4OWTB 4A3EH 1TWHH 1TWAH 3RLOA 4AIMA 3KDFB 1KAWA 3BU2A 2WP8J 3T1HQ 2QA4A 3DLLA 4LUOA 4DR3Q 1MIUA 2YYZA 3KFUA 4UP8A 2DUDA 2Q2TA 5H1SE 1PH8A 2ZTDA 1MKHA 3PO3G 1YNXA 1FGUA 2KCMA 2XTIA 2BA1A 3FKIG 4AYBE 1QUQA 2V1CC 3UDIA 5LMNQ 4BA2I 1XNRQ 3HOVG 2R92H 2PNHA 3GO5A 1SRUA 1M1KC 3S1QH 5GROA 2Q2IA 3PIOA 4QY7A 4IO9A 4IPCA 3S24A 3I2ZA 3CW2C 2MO0A 3A0JA 3KF6B 3S14H 1XMOQ 3HKZE 4QL5A 2PI2E 2WFWA 4P73A 4R4TA 2VQFL 1XMQQ 1IBLQ 1J6QA 4DR4Q 4IOCA 4JBKA 3PGZA 3K0XA 3CCUA 4DV5Q 4LFBQ 2RCNA 1Y1WH 2KHIA 1XNQL 4H02A 4B3TQ 2BH8A 2PMZE 1N8RC 5LMNW 3TQYA 4LWCA 3KJPA 1YI2A 1K8AC 5C4XG 2JEBI 2K4KA 2ZTEA 4LFAQ 1OXVA 1G51A 2F52A 4DUYL 1XTDA 1OXSC 1PYBA 4GOPA 4GLXA 1CKMA 5C0XG 5M3FG 3ULJA 3E0EA 3PF4A 3I56A 1I50H 3TS0A 4B3SL 1M90C 5FJ8H 1J5EQ 3U4ZA 1OTCA 1I6HH 3SGIA 2FXQA 1IBLL 3A74A 4NXMQ 4QQBX 2VNUD 1L2FA 1NMGA 4BY1H 4BBSH 1VQIA 1JJCB 3PUWA 1RL2A 2H5XA 4A3FG 4DK3C 4LFBL 3PO2H 1EQRA 1I94Q 1N36Q 2PQAA 1U5KA 4B3MQ 4OO1G 2K5VA 3AFPA 3F2DA 1PH5A 3CCLA 4BA1I 2UUBQ 4R1JA 1KHIA 5FLMH 1A0IA 3CP0A 4PZ7A 1K9MC 2UXDQ 1XJVA 1X54A 2OTLA 3JAMi 3CCQA 1VQ4A 3OTOQ 3AYHB 1YIJA 1VQMA 3HFZB 4C2MH 1EIYB 3S2DH 4LF6L 2IT1A 2VL6A 1VQEA 1Q1EA 4DV3L 2OCEA 4BY7H 1VQNA 4IFDG 1V9PA 1S40A 1UE1A 3H0GH 1X3EA 3NEMA 3F2BA 2YU9H 4LF8Q 1X6OA 4DV0L 2JA8G 1Z47A 3PIPA 3PF5A 4JI8Q 1PH2A 1WYDA 1XPRA 2UUAL 3UDGA 3MXNB 3HOWH 1N33L 4A75A 3S15H 3DM3A 3M9BA 1PV4A 4DV7L 3BZCA 1B8AA 4BXXH 4P74A 1OXTA 1I5FA 3HOVH 1PVOA 2E2JH 2JA8H 3L7ZC 4LF4L 2IHEA 2Z0SA 1CKNA 5GQOA 1GO3E 1VQ6A 2C35B 1VQOA 2E2IH 2E5LQ 4BY7G 1AE2A 5FLXc 4LW1A 2OQ0A 3NENA 3W1GA 2KHJA 1QVCA 2AKWB 3KDFA 4DV1L 4P72A 4A3LG 4JYAQ 4ME3A 3HOUG 2R93H 4KHZA 1HZAA 2RHQB 1EWIA 1TXYA 2MQHA 4FDBA 4BBRH 4GKJL 1NTGA 3EIVA 3RLFA 1LYLA 5IYBH 1VQ8A 2HHHL 1YITA 1XNRL 4RG1A 1X9NA 4WJ4A 1IBKL 3GTJH 2N78A 4GNXB 3J80i 3RN2A 4LFAL 2QGQA 1QUQB 3TREA 4A3DG 3CPWA 5BR8L 4A76A 2K50A 1AH9A 4DR7L 2R7ZG 1PH3A 4JI1Q 5M5YH 1SE8A 1VQFA 4DV5L 1UE5A 1PH6A 2CWAA 3J80c 3CCSA 2E5LL 1YBYA 3IRBA 4TVAB 3S17H 2HIXA 3KYHC 4OWXB 3CCJA 3K7AH 4DR6Q 2I0QA 3FHWA 4LF7L 3TS2A 1JE5A 1VQKA 1L1OB 3J81c 1HR0Q 4X65L 5AJ3Q 5JEAJ 1Q46A 4WJ3M 1A63A 1EUJA 4DV2L 4P71A 4QJFA 2AMCB 4LF5Q 1V1QA 4Y7NH 3ULPA 1N34Q 1Y14B 3FP9A 3G6EA 4OX9L 3AEVA 5LMUL 1VQPA 3HOZG 4A3BG 2HQLA 1C9OA 3K81C 3K8AA 1HZ9A 3HOYG 2E2HH 4JG2A 4Y52H 3HOZH 1PH7A 4DUZL 3OTOL 4NB3A 4DV3Q 1K83H 2IX1A 5IP7G 3PUXA 1VS0A 3I4MH 1I3QH 2ALYB 3T1HL 4L5QA 2HT1A 1KIXA 3HKZG 1QZHA 1WI5A 2R92G 2QEXA 1P16A 1BBUA 1MJCA 1C0AA 3MEFA 4LF8L 3GTMH 5HY6A 3KJOA 2PQAB 4A3MH 3ICEA 4JI4Q 2VS1A 1WOCA 4X66Q 1VQBA 4JCVE 2WB1E 1SLJA 5C44H 4OX9Q 1KRSA 1HJPA 4DV7Q 4NPSA 1IXRA 1X56A 3PUYA 3GTKH 2VUMG 1E24A 4GN4B 1HR0W 4JI7Q 2GVAA 3I55A 2XGTA 2BH2A 2VUMH 2ES2A 5C4JH 1N32L 2R7DA 4A3EG 3L0OA 2UUAQ 4B3TL 2HIVA 4LUZA 2B29A 1Z9FA 3HOUH 1DGSA 2JA9A 1GVPA 3I7FA 3CQZH 4MNOA 2NVXH 1D7QA 2I5HA 2JE6I 5M3MG 3AQQA 3JAMc 1HNZL 1VCIA 1YEZA 4JYAL 4C3JH 4AH6A 5M5WH 4DR5Q 2PI2A 2CWPA 5ELOA 4LFCL 4A3KH 3UE1A 4C3HH 1S72A 3K80C 1LTLA 5IYDG 2UXDL 4UP7A 5IP7H 4UY8C 4IPHA 5JJIA 3I4NG 3KOJA 5BR8Q 4BXXG 3U4VA 2VQEL 4EQ5A 5IWAL 4JI0L 4X6AH 4JI1L 3HOYH 3CMAA 1FJGQ 3LGJA 3F1ZA 1K73C 2OTJA 5JJLA 4POFA 4JBMA 2EQSA 4B3ML 1YJ9A 4A3BH 1B7YB 2MO1A 3PUVA 1EIFA 2GN5A 2F3IA 3CCVA 1X3FA 3CCRA 4JOIA 4JV5Q 4O2DA 3J81i 1PFSA 4PZ6A 1HNXQ 1OXUA 3I4OA 2UUCQ 2JJQA 1QVFA 1BBWA 1HH2P 3GDEA 4LF9Q 5M5XH 4LFCQ 1NE3A 1CKOA 4DPGA 1KC8C 1K8GA 4POGA 4GOPB 1BVSA 2B63G 1N34L 1WCMH 4A3JG 2VQEQ 2R7ZH 1U0LA 4DV0Q 2NVYH 4JBJA 5IE8A 5FLMG 3HOXH 3U58A 4A3DH 2ZM6L 2CQOA 4DV6Q 1B70B 4UP9A 4DUZQ 1XMQL 4L5RC 1WFQA 3CXCA 2JA7H 1N33Q 1HNWL 3HOXG 2D0OA 4A4IA 4A3FH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BY1 G;  4DAM A;  4BBS G;  3JC6 6;  4HJ8 A;  2JK8 A;  4YHH L;  2YTY A;  4A3J H;  1QVG A;  3E9I A;  2ZJP A;  2B63 H;  5JEA G;  3W1B A;  3D0F A;  4GN5 A;  1SFO H;  1VQ5 A;  2I5L X;  3G48 A;  4JI3 L;  4LF9 L;  4A3L H;  1E22 A;  2R93 G;  1FL0 A;  1G6P A;  4DR2 Q;  4A3I G;  3KLW A;  2OWO A;  2Q2H A;  1Q12 A;  3CD6 A;  3M4P A;  4JI7 L;  1Y1V H;  3BJU A;  5K36 G;  3M4O H;  4ALP A;  5GAG C;  4XIG S;  4B3S Q;  2Y0S E;  5IYC H;  2ZM6 Q;  2EIF A;  4LNQ A;  3VDY A;  2N3S A;  4YCV A;  3CC7 A;  4DR7 Q;  4B3R L;  3STB C;  1N32 Q;  1LUZ A;  5IT9 c;  1JT8 A;  2YV5 A;  4APV A;  1I94 L;  5C0X J;  3HOW G;  4YY3 L;  3RR5 A;  2UXC Q;  5E7N A;  3EN2 A;  1VQD A;  1A62 A;  1D8L A;  4PZ8 A;  4LF7 Q;  1H95 A;  4TQU S;  4YCW A;  3PSI A;  5AJ3 L;  3H0G G;  4DR2 L;  4IPG A;  3ULL A;  1CKN B;  1ASY A;  1MJE A;  1C7Y A;  4DV4 Q;  3CME A;  5IWA Q;  2A1A A;  4KHP Q;  2CFM A;  1IZ6 A;  1SMX A;  4IOA A;  1LM0 A;  2Z6K A;  2UXB Q;  2KEN A;  1XPU A;  4OWW B;  4DV2 Q;  1CSQ A;  1YJW A;  3NBH B;  1HR0 L;  4X65 Q;  3L2P A;  4HJ5 A;  1VQC A;  3RZD H;  3S1M H;  3NEL A;  1EQQ A;  1JJ2 A;  2K14 A;  3RZO H;  3M7N A;  3PO2 G;  1VQL A;  3GTG H;  2NN6 I;  4GNX A;  4PG3 A;  3GTQ H;  1E1T A;  1S3O A;  2IHF A;  5C44 G;  1TWC H;  1HNX L;  3T1Y L;  4NXN Q;  1VQJ A;  4EX5 A;  4A3M G;  4K0K Q;  3AFQ A;  2K5N A;  4X66 L;  4DV4 L;  3A5Z B;  2K52 A;  1TWF H;  3Q8D A;  3CC2 A;  3UDF A;  3PCO B;  3TRZ A;  3GTL H;  1IBM Q;  3KF6 A;  2Y0S G;  1PH1 A;  2IY5 B;  5C4X H;  3I4M G;  1W3S A;  3HKS A;  4A93 G;  1UWV A;  2ASB A;  2MFI A;  2JA5 G;  1N36 L;  3ER0 A;  2UU9 L;  4R4C A;  3RNU A;  4GKJ Q;  1VQ7 A;  1VQG A;  1EFW A;  2RHS B;  4GKK L;  3M85 A;  3UE0 A;  2E8G A;  2R7F A;  2HHH Q;  4JI5 Q;  5EAY A;  4QIW E;  4JI3 Q;  4A3G H;  1E1O A;  1HNZ Q;  2B3G A;  5GAE C;  1KXL A;  2JA5 H;  2F4V L;  4GN3 B;  4R4I A;  4DR5 L;  2VW9 A;  1CSP A;  2IX0 A;  1VQ9 A;  4IFD I;  4YWM A;  5C0X I;  1XPO A;  4X62 Q;  3UDX A;  4GOP C;  2D0P A;  1IYJ B;  5J3B A;  1IBM L;  3CF5 A;  5IP9 H;  4HIO A;  4KI0 A;  1SRO A;  2AHO B;  3S16 H;  1Q1B A;  4OON A;  4R4O A;  4DAY B;  1EOV A;  3S1N H;  4L5T A;  4IPD A;  1PHJ A;  1FJG L;  1Q81 C;  3PO3 H;  2MNA A;  1HZC A;  1JB7 A;  4AYB G;  4GKK Q;  2YTV A;  1YJN A;  1KRT A;  1Q7Y C;  3E9H A;  4LF5 L;  4C3I H;  3W5O A;  3D31 A;  4IJL A;  3CC4 A;  4JV5 L;  4XTC S;  3CAM A;  1K0R A;  4GS3 A;  3J81 j;  1XMO L;  3S2H H;  1UE7 A;  1L0W A;  4DR1 L;  2LXK A;  3U50 C;  3CPF A;  4JI0 Q;  3TEH B;  1FVI A;  4BBR G;  2NVQ H;  4DUY Q;  4IJH A;  5HGQ A;  1J5E L;  2NVT H;  4R4Q A;  5GAH C;  4JI2 L;  5C3E G;  2UXC L;  4KHP L;  4JI6 L;  1PH4 A;  2ID0 A;  1N9W A;  3CCM A;  4GNX C;  2ATW A;  4NXM L;  3GTO H;  2UXB L;  1NY4 A;  1K3R A;  1OXX K;  1Q8K A;  1X3G A;  2RF4 A;  2UUC L;  2UUB L;  2LSS A;  4DR3 L;  1QZG A;  1PH9 A;  4JI4 L;  4LUV A;  2JA6 G;  4L5S A;  3H15 A;  3G71 A;  4HJ7 A;  1E3P A;  2KCT A;  2BA0 A;  1AE3 A;  4QGU A;  2ZTC A;  2VY3 A;  2Q2U A;  2I5M X;  1WJJ A;  3OW2 A;  4UPA A;  2GVB A;  2ZJR A;  1NMF A;  1A8V A;  4DK6 C;  1KD1 C;  1YHQ A;  1GD7 A;  5IYC G;  2A8V A;  2AWO A;  4K0K L;  2AWN A;  2N49 A;  4YWK A;  4DV6 L;  4JI2 Q;  5JJK A;  1Y1V G;  4DNI A;  2KBN A;  4AQY Q;  1UEB A;  4YHH Q;  1HNW Q;  4JC0 A;  4J15 A;  4DKA C;  4HIM A;  4X64 L;  4A3I H;  2K75 A;  2NZO A;  1R9T H;  4A3C G;  4NXN L;  3S1R H;  2JQO A;  3GD7 A;  2WB1 G;  4JI8 L;  1YZ6 A;  1UE6 A;  2DGY A;  2OQK A;  4MTN A;  5LMU Q;  2WAQ E;  4KLK A;  4JI5 L;  1RIP A;  1HZB A;  4RMF A;  3G4S A;  2JA7 G;  4P75 A;  2L15 A;  2NN6 G;  4DR4 L;  5DLQ E;  3RN5 A;  1P8L A;  3H3V H;  5ELN A;  4GLA C;  3RLN A;  2A19 A;  2VQF Q;  1CUK A;  1PYS B;  1PA6 A;  4AQY L;  4YY3 Q;  4B3R Q;  1WCM G;  3B6Y A;  3F8T A;  5FJ8 G;  4OO1 I;  3WWV A;  4A3C H;  4X64 Q;  1L1O C;  2NZH A;  2WAQ G;  3EBE A;  4DV1 Q;  5M3F H;  1XNQ Q;  5IP9 G;  1L1O A;  2CKZ B;  2F4V Q;  3KF8 B;  1KQS A;  4LF4 Q;  4HIK A;  3PV0 A;  1IL2 A;  1EYG A;  1IBK Q;  2D62 A;  3J7A 5;  4HJ9 A;  4X62 L;  5IY0 A;  1KL9 A;  3ZJY C;  1O7I A;  1Q82 C;  1TWG H;  4DR1 Q;  4A3G G;  1V43 A;  1Y1W G;  1YHB A;  1VQA A;  4GLV B;  4MZ9 A;  2JEA I;  1VQH A;  1X55 A;  4HJA A;  3M4Q A;  4JBW A;  2LXJ A;  3CCE A;  2YTX A;  4IFD J;  1GM5 A;  1NJI C;  1G29 1;  3I4N H;  2N8N A;  3A5U A;  2ZJQ A;  1SR3 A;  1W2B A;  3H3V I;  2JA6 H;  3OYY A;  3GTP H;  3M3Y H;  4A93 H;  2Z6K C;  3J7Z C;  5IYD H;  2EXD A;  4A3K G;  1X65 A;  3STB D;  1YVC A;  1ASZ A;  4HID A;  3F2C A;  4JOI C;  1JMC A;  4JI6 Q;  2K5H A;  3T1Y Q;  1Q86 C;  2CCZ A;  1SN8 A;  3BZK A;  4PMW A;  5M3M H;  1BKB A;  2UU9 Q;  5C3E H;  2R6G A;  1NBW A;  1GKH A;  2VZA A;  5IYB G;  4O0A A;  4OXP A;  4LF6 Q;  3FKI H;  1T9H A;  5LMN L;  1YHA A;  4YWL A;  5GAD C;  3ERS X;  4YCU A;  4DR6 L;  3PUZ A;  1JJG A;  3K7U C;  1E7Z A;  4OWT B;  4A3E H;  1TWH H;  1TWA H;  3RLO A;  4AIM A;  3KDF B;  1KAW A;  3BU2 A;  2WP8 J;  3T1H Q;  2QA4 A;  3DLL A;  4LUO A;  4DR3 Q;  1MIU A;  2YYZ A;  3KFU A;  4UP8 A;  2DUD A;  2Q2T A;  5H1S E;  1PH8 A;  2ZTD A;  1MKH A;  3PO3 G;  1YNX A;  1FGU A;  2KCM A;  2XTI A;  2BA1 A;  3FKI G;  4AYB E;  1QUQ A;  2V1C C;  3UDI A;  5LMN Q;  4BA2 I;  1XNR Q;  3HOV G;  2R92 H;  2PNH A;  3GO5 A;  1SRU A;  1M1K C;  3S1Q H;  5GRO A;  2Q2I A;  3PIO A;  4QY7 A;  4IO9 A;  4IPC A;  3S24 A;  3I2Z A;  3CW2 C;  2MO0 A;  3A0J A;  3KF6 B;  3S14 H;  1XMO Q;  3HKZ E;  4QL5 A;  2PI2 E;  2WFW A;  4P73 A;  4R4T A;  2VQF L;  1XMQ Q;  1IBL Q;  1J6Q A;  4DR4 Q;  4IOC A;  4JBK A;  3PGZ A;  3K0X A;  3CCU A;  4DV5 Q;  4LFB Q;  2RCN A;  1Y1W H;  2KHI A;  1XNQ L;  4H02 A;  4B3T Q;  2BH8 A;  2PMZ E;  1N8R C;  5LMN W;  3TQY A;  4LWC A;  3KJP A;  1YI2 A;  1K8A C;  5C4X G;  2JEB I;  2K4K A;  2ZTE A;  4LFA Q;  1OXV A;  1G51 A;  2F52 A;  4DUY L;  1XTD A;  1OXS C;  1PYB A;  4GOP A;  4GLX A;  1CKM A;  5C0X G;  5M3F G;  3ULJ A;  3E0E A;  3PF4 A;  3I56 A;  1I50 H;  3TS0 A;  4B3S L;  1M90 C;  5FJ8 H;  1J5E Q;  3U4Z A;  1OTC A;  1I6H H;  3SGI A;  2FXQ A;  1IBL L;  3A74 A;  4NXM Q;  4QQB X;  2VNU D;  1L2F A;  1NMG A;  4BY1 H;  4BBS H;  1VQI A;  1JJC B;  3PUW A;  1RL2 A;  2H5X A;  4A3F G;  4DK3 C;  4LFB L;  3PO2 H;  1EQR A;  1I94 Q;  1N36 Q;  2PQA A;  1U5K A;  4B3M Q;  4OO1 G;  2K5V A;  3AFP A;  3F2D A;  1PH5 A;  3CCL A;  4BA1 I;  2UUB Q;  4R1J A;  1KHI A;  5FLM H;  1A0I A;  3CP0 A;  4PZ7 A;  1K9M C;  2UXD Q;  1XJV A;  1X54 A;  2OTL A;  3JAM i;  3CCQ A;  1VQ4 A;  3OTO Q;  3AYH B;  1YIJ A;  1VQM A;  3HFZ B;  4C2M H;  1EIY B;  3S2D H;  4LF6 L;  2IT1 A;  2VL6 A;  1VQE A;  1Q1E A;  4DV3 L;  2OCE A;  4BY7 H;  1VQN A;  4IFD G;  1V9P A;  1S40 A;  1UE1 A;  3H0G H;  1X3E A;  3NEM A;  3F2B A;  2YU9 H;  4LF8 Q;  1X6O A;  4DV0 L;  2JA8 G;  1Z47 A;  3PIP A;  3PF5 A;  4JI8 Q;  1PH2 A;  1WYD A;  1XPR A;  2UUA L;  3UDG A;  3MXN B;  3HOW H;  1N33 L;  4A75 A;  3S15 H;  3DM3 A;  3M9B A;  1PV4 A;  4DV7 L;  3BZC A;  1B8A A;  4BXX H;  4P74 A;  1OXT A;  1I5F A;  3HOV H;  1PVO A;  2E2J H;  2JA8 H;  3L7Z C;  4LF4 L;  2IHE A;  2Z0S A;  1CKN A;  5GQO A;  1GO3 E;  1VQ6 A;  2C35 B;  1VQO A;  2E2I H;  2E5L Q;  4BY7 G;  1AE2 A;  5FLX c;  4LW1 A;  2OQ0 A;  3NEN A;  3W1G A;  2KHJ A;  1QVC A;  2AKW B;  3KDF A;  4DV1 L;  4P72 A;  4A3L G;  4JYA Q;  4ME3 A;  3HOU G;  2R93 H;  4KHZ A;  1HZA A;  2RHQ B;  1EWI A;  1TXY A;  2MQH A;  4FDB A;  4BBR H;  4GKJ L;  1NTG A;  3EIV A;  3RLF A;  1LYL A;  5IYB H;  1VQ8 A;  2HHH L;  1YIT A;  1XNR L;  4RG1 A;  1X9N A;  4WJ4 A;  1IBK L;  3GTJ H;  2N78 A;  4GNX B;  3J80 i;  3RN2 A;  4LFA L;  2QGQ A;  1QUQ B;  3TRE A;  4A3D G;  3CPW A;  5BR8 L;  4A76 A;  2K50 A;  1AH9 A;  4DR7 L;  2R7Z G;  1PH3 A;  4JI1 Q;  5M5Y H;  1SE8 A;  1VQF A;  4DV5 L;  1UE5 A;  1PH6 A;  2CWA A;  3J80 c;  3CCS A;  2E5L L;  1YBY A;  3IRB A;  4TVA B;  3S17 H;  2HIX A;  3KYH C;  4OWX B;  3CCJ A;  3K7A H;  4DR6 Q;  2I0Q A;  3FHW A;  4LF7 L;  3TS2 A;  1JE5 A;  1VQK A;  1L1O B;  3J81 c;  1HR0 Q;  4X65 L;  5AJ3 Q;  5JEA J;  1Q46 A;  4WJ3 M;  1A63 A;  1EUJ A;  4DV2 L;  4P71 A;  4QJF A;  2AMC B;  4LF5 Q;  1V1Q A;  4Y7N H;  3ULP A;  1N34 Q;  1Y14 B;  3FP9 A;  3G6E A;  4OX9 L;  3AEV A;  5LMU L;  1VQP A;  3HOZ G;  4A3B G;  2HQL A;  1C9O A;  3K81 C;  3K8A A;  1HZ9 A;  3HOY G;  2E2H H;  4JG2 A;  4Y52 H;  3HOZ H;  1PH7 A;  4DUZ L;  3OTO L;  4NB3 A;  4DV3 Q;  1K83 H;  2IX1 A;  5IP7 G;  3PUX A;  1VS0 A;  3I4M H;  1I3Q H;  2ALY B;  3T1H L;  4L5Q A;  2HT1 A;  1KIX A;  3HKZ G;  1QZH A;  1WI5 A;  2R92 G;  2QEX A;  1P16 A;  1BBU A;  1MJC A;  1C0A A;  3MEF A;  4LF8 L;  3GTM H;  5HY6 A;  3KJO A;  2PQA B;  4A3M H;  3ICE A;  4JI4 Q;  2VS1 A;  1WOC A;  4X66 Q;  1VQB A;  4JCV E;  2WB1 E;  1SLJ A;  5C44 H;  4OX9 Q;  1KRS A;  1HJP A;  4DV7 Q;  4NPS A;  1IXR A;  1X56 A;  3PUY A;  3GTK H;  2VUM G;  1E24 A;  4GN4 B;  1HR0 W;  4JI7 Q;  2GVA A;  3I55 A;  2XGT A;  2BH2 A;  2VUM H;  2ES2 A;  5C4J H;  1N32 L;  2R7D A;  4A3E G;  3L0O A;  2UUA Q;  4B3T L;  2HIV A;  4LUZ A;  2B29 A;  1Z9F A;  3HOU H;  1DGS A;  2JA9 A;  1GVP A;  3I7F A;  3CQZ H;  4MNO A;  2NVX H;  1D7Q A;  2I5H A;  2JE6 I;  5M3M G;  3AQQ A;  3JAM c;  1HNZ L;  1VCI A;  1YEZ A;  4JYA L;  4C3J H;  4AH6 A;  5M5W H;  4DR5 Q;  2PI2 A;  2CWP A;  5ELO A;  4LFC L;  4A3K H;  3UE1 A;  4C3H H;  1S72 A;  3K80 C;  1LTL A;  5IYD G;  2UXD L;  4UP7 A;  5IP7 H;  4UY8 C;  4IPH A;  5JJI A;  3I4N G;  3KOJ A;  5BR8 Q;  4BXX G;  3U4V A;  2VQE L;  4EQ5 A;  5IWA L;  4JI0 L;  4X6A H;  4JI1 L;  3HOY H;  3CMA A;  1FJG Q;  3LGJ A;  3F1Z A;  1K73 C;  2OTJ A;  5JJL A;  4POF A;  4JBM A;  2EQS A;  4B3M L;  1YJ9 A;  4A3B H;  1B7Y B;  2MO1 A;  3PUV A;  1EIF A;  2GN5 A;  2F3I A;  3CCV A;  1X3F A;  3CCR A;  4JOI A;  4JV5 Q;  4O2D A;  3J81 i;  1PFS A;  4PZ6 A;  1HNX Q;  1OXU A;  3I4O A;  2UUC Q;  2JJQ A;  1QVF A;  1BBW A;  1HH2 P;  3GDE A;  4LF9 Q;  5M5X H;  4LFC Q;  1NE3 A;  1CKO A;  4DPG A;  1KC8 C;  1K8G A;  4POG A;  4GOP B;  1BVS A;  2B63 G;  1N34 L;  1WCM H;  4A3J G;  2VQE Q;  2R7Z H;  1U0L A;  4DV0 Q;  2NVY H;  4JBJ A;  5IE8 A;  5FLM G;  3HOX H;  3U58 A;  4A3D H;  2ZM6 L;  2CQO A;  4DV6 Q;  1B70 B;  4UP9 A;  4DUZ Q;  1XMQ L;  4L5R C;  1WFQ A;  3CXC A;  2JA7 H;  1N33 Q;  1HNW L;  3HOX G;  2D0O A;  4A4I A;  4A3F H; 
#chains in the Genus database with same CATH topology
 3GTJ B;  1K8O A;  3JC6 6;  4HJ8 A;  2YTY A;  2ZJP A;  4LF9 L;  2I5L X;  4A3L H;  4G7O C;  1G6P A;  4CJ1 B;  2K03 A;  4DR2 Q;  3UI2 A;  1G2S A;  2OWO A;  2Q2H A;  1Q12 A;  5I2Y A;  3M4O H;  1CZG A;  4HMJ A;  3A54 A;  4LNQ A;  2EIF A;  1QIL A;  3STB C;  1JT8 A;  1Q3L A;  4YY3 L;  1U4P A;  2A5H A;  1VQD A;  5KIX A;  1F2M A;  4C3J B;  3PSI A;  2XRS D;  1X32 A;  1EY6 A;  1ASY A;  3GTQ B;  3Q22 A;  5KND A;  4DV4 Q;  5IWA Q;  4WOR A;  2RQX A;  2CH4 A;  1LM0 A;  3I70 A;  3K5L A;  4HJ5 A;  3RZD H;  1VQC A;  3NEL A;  3M7N A;  3C1E A;  2ICE C;  2NN6 I;  1S3O A;  5FO9 B;  1HNX L;  1TWC H;  2EYL A;  1SYC A;  1VQJ A;  4EX5 A;  1STE A;  3AFQ A;  4X66 L;  2RCF A;  2O2L D;  5I9O A;  2PPB C;  3KF6 A;  1PH1 A;  5I6Y A;  1KDB A;  3HKS A;  4A93 G;  2JA5 G;  1JQY D;  1N36 L;  2H4O A;  2WAQ B;  5JPN C;  5M5Y B;  1FYC A;  3HOV B;  2E8G A;  4QIW E;  1KAA A;  3C1F A;  4JPB W;  1E1O A;  2B3G A;  4ID6 A;  1DCZ A;  2F4V L;  4GN3 B;  5A35 A;  2VW9 A;  2Q8I B;  2MHV A;  2D0P A;  5D14 A;  1J8I A;  3OPO A;  1IBM L;  3BVZ A;  5IP9 H;  4BBR B;  3D4R A;  3H3V C;  1SRO A;  3S16 H;  4OON A;  1TU2 B;  3CU7 A;  3PO3 H;  1FJG L;  2NVT B;  4V19 0;  1S5B D;  2MNA A;  2EY1 A;  1PTO F;  4AYB G;  2K04 A;  1IW7 D;  1QE6 A;  3OIQ A;  3CC4 A;  5KGU A;  2RDF A;  3SXH A;  5C6A A;  4X3K A;  3J81 j;  4GS3 A;  3MFY A;  4DR1 L;  2LXK A;  5EBD A;  4IJH A;  1GUT A;  4R4Q A;  5GAH C;  5JPM C;  3K5M A;  5EPK A;  4F87 A;  2UXC L;  1K28 A;  1JE4 A;  1TS4 A;  1N9W A;  2ATW A;  2LSS A;  5C5M A;  4OL7 A;  3H15 A;  5JVH 3;  3J80 L;  1AE3 A;  4IAL A;  4QGU A;  1WJJ A;  3OW2 A;  1RCV D;  2EYM A;  1HPC A;  2ZJR A;  1A8V A;  3QB3 A;  2KQ3 A;  2D9U A;  2OT2 A;  1GD7 A;  5IYC G;  2A8V A;  1WTR A;  2N49 A;  3FRP B;  2F0W A;  1Y1V G;  2KBN A;  1UEB A;  4YHH Q;  4A3K B;  1D2B A;  1JR0 D;  4DKA C;  1SAP A;  4A3I H;  5CV9 A;  1B2T A;  1EZ8 A;  4JK1 C;  2NZO A;  1R9T H;  4UDU C;  3S1R H;  1UE6 A;  4MTN A;  2RA4 A;  5LMU Q;  2QW7 A;  4KLK A;  3KK7 A;  2L15 A;  2X6G A;  5DLQ E;  1AFP A;  3H3V H;  3NSW A;  4U68 A;  3P75 A;  3RLN A;  2VQF Q;  4B3R Q;  3BVM A;  3B6Y A;  3E0J A;  5FJ8 G;  4OO1 I;  4A3C H;  4X64 Q;  5JOB A;  1STB A;  2WAQ G;  3X3N A;  3TP7 A;  4EQP A;  2QDL A;  2JN4 A;  4LF4 Q;  5I2X A;  1IBK Q;  2D62 A;  4CDD C;  1O7I A;  3VYS A;  4DR1 Q;  4X3U A;  4G7Z C;  1STA A;  1VQA A;  4HJA A;  2WV6 D;  2NTT A;  3CCE A;  4IFD J;  1NUC A;  3SDZ A;  3OMG A;  1W2B A;  3MXN A;  3OYY A;  2Z6K C;  4A3K G;  2FMC A;  1Y1V B;  4XDX A;  5FOB B;  1YVC A;  1JMC A;  1PRT B;  4Z9C B;  3J80 E;  1Q86 C;  1SN8 A;  3DM1 A;  4DA2 A;  2VZA A;  3FKI H;  4YWL A;  3ERS X;  3KLS X;  3PUZ A;  4LK1 C;  1E7Z A;  1UNS A;  3M7G A;  1JCK B;  3KDF B;  3V96 A;  3T1H Q;  4WRD A;  5C4Z A;  1B9M A;  1EWH A;  4LUO A;  2DUD A;  5CMD A;  1WTP A;  4AYB E;  1QUQ A;  1O7Z A;  2F0T A;  5LMN Q;  1MD2 D;  4Y7N B;  3PIO A;  3D3R A;  1SMY D;  4QY7 A;  3A0J A;  1XMO Q;  3EQL C;  3DEO A;  1HQR D;  3M4Y A;  4F88 A;  1XMQ Q;  2SNM A;  3K0X A;  3IFD A;  3OIP A;  4DV5 Q;  4BWG B;  4G7H C;  4H02 A;  3K7A B;  5FLX L;  2PMZ E;  1A15 A;  4LWC A;  4XYO A;  5C4X G;  5KNC A;  2JEB I;  4YIJ A;  1G51 A;  2F52 A;  4DUY L;  1XTD A;  3NE5 B;  4L6T B;  5C0X G;  3HGB A;  5M3F G;  1G91 A;  3PF4 A;  3G7L A;  1I50 H;  5FJ8 H;  5FO8 B;  1I6H H;  2OF1 A;  1IBL L;  1L2F A;  2H5X A;  4LFB L;  4K2L A;  1N36 Q;  4A93 B;  2PQA A;  1U5K A;  3I4M B;  2A74 C;  3CCL A;  4R1J A;  2UXD Q;  1K9M C;  3C2P A;  2D2C C;  3JAM i;  2ZXO A;  1VQ4 A;  1VQM A;  2WAC A;  4C2M H;  3SK4 A;  1LTG D;  4TKO B;  4DN4 M;  4OIK A;  1V8Q A;  1SEB D;  1STH A;  2IJ0 A;  3T16 A;  1S40 A;  1PLF A;  4QCL A;  5AFW A;  4LF8 Q;  2MGS A;  2JA8 G;  1TY2 A;  3PIP A;  2J7Z A;  1WYD A;  3HOW H;  4A75 A;  1CHP D;  1IHZ A;  3S15 H;  2EYP A;  2F1M A;  4ME5 A;  5IT9 E;  4DV7 L;  3BZC A;  1SMY C;  4A3E B;  1I5F A;  2J4X A;  4WFN 3;  2JA8 H;  1SYE A;  2Z0S A;  5IGD A;  1EYD A;  1B53 A;  5FLX c;  4LW1 A;  1AN8 A;  2SDF A;  3BZD B;  3W1G A;  4DV1 L;  1QVC A;  4A3L G;  3HOU G;  2LMC B;  1QCB D;  2HHH L;  1YIT A;  2D5D A;  3DHQ A;  1EEF D;  4KJN A;  1IBK L;  1LTA D;  2MP1 A;  3BYT B;  3J80 i;  4LFA L;  4NKL A;  1QUQ B;  3TRE A;  3PO2 B;  4A3D G;  3CPW A;  1EFI D;  4DV5 L;  1PH6 A;  5T1I A;  3J80 c;  3CCS A;  3IRB A;  3S17 H;  4DR6 Q;  1WVL A;  5EKL A;  1CA5 A;  5HUR A;  4X65 L;  5AJ3 Q;  3VA7 A;  2O5I C;  4DV2 L;  3OW7 A;  3VA5 A;  1Y14 B;  4A3B G;  4K5X A;  5LMU L;  1SNO A;  2HQL A;  5F2D A;  1HZ9 A;  5L37 A;  4JG2 A;  3QO2 A;  3OTO L;  4NB3 A;  1K83 H;  1A3U A;  1R4Q B;  1VS0 A;  4C3H G;  1I3Q H;  2ALY B;  3T1H L;  2EYO A;  1WI5 A;  1F2Z A;  1P16 A;  1BBU A;  3MEF A;  5HY6 A;  3KJO A;  1TR5 A;  3SR1 A;  4FF2 A;  2PQA B;  4A3M H;  1EY5 A;  2F0Q A;  1KTK A;  1WOC A;  4X66 Q;  2WB1 E;  4DNT B;  4DV7 Q;  2RSO A;  4JVZ A;  2CH4 W;  1Z7T A;  3PUY A;  1JOR A;  1E24 A;  4GN4 B;  1HR0 W;  4JI7 Q;  4BY1 B;  2XGT A;  3K59 A;  5C4J H;  2SOB A;  1PZK D;  2VB3 X;  2EE1 A;  4DXG A;  1F2L A;  1Z9F A;  1TVX A;  2KHS A;  4M1U B;  2IL8 A;  5CBE E;  3JAM c;  4A3J B;  1VCI A;  5C4X B;  2EJF C;  4C3J H;  2ENB A;  5ELO A;  2Z4H A;  1II3 A;  5IYD G;  4KK7 A;  2G5D A;  4UY8 C;  4IPH A;  5JJI A;  1U9R A;  5BR8 Q;  1EY9 A;  1U4L A;  1FJG Q;  3LGJ A;  4KN7 C;  5JJL A;  4RKL A;  3W3A A;  1Y8O B;  4B3M L;  1GUG A;  1EIF A;  2GN5 A;  4DK1 A;  2R92 B;  3CCV A;  1X3F A;  1SSO A;  1PFS A;  5J22 A;  1BBW A;  1EY7 A;  4FXK C;  3GDE A;  2FFK B;  4DAP A;  4LFC Q;  2Z1C A;  4ABN A;  5T1G A;  3W2D A;  1ENC A;  1BVS A;  2FHT A;  5CC4 A;  1WCM H;  1N34 L;  2K01 A;  1SYG A;  4KKS A;  1U0L A;  4DV0 Q;  2NVY H;  5FLM G;  4A3D H;  1BF4 A;  2VB2 X;  1EU3 A;  1B70 B;  1XMQ L;  2EDG A;  2QIL A;  2JA7 H;  3ERQ A;  5M9O A;  4ZLT F;  4BBS G;  1F9Q A;  4GZY C;  2JK8 A;  3CRL C;  4A3J H;  1S5C D;  3RZO B;  1I50 B;  4DXF A;  5JEA G;  1HTP A;  3D0F A;  1ICF B;  2R93 G;  1GOZ A;  1E22 A;  1FL0 A;  5IGE A;  4E6I A;  1AZQ A;  4J1M A;  2HDL A;  4JI7 L;  4MIU A;  5FO7 B;  5M5W B;  3HKZ B;  4LAA A;  2KEC A;  1N32 Q;  1LUZ A;  2YV5 A;  2WII B;  1Y8P B;  3RR5 A;  3NBI A;  5E7N A;  1TWA B;  3EN2 A;  1A62 A;  2KA7 A;  1EOT A;  1LT4 D;  4PZ8 A;  4TQU S;  4CJ0 B;  2A73 B;  3H0G G;  3R8B A;  4DR2 L;  4NMZ A;  3ULL A;  4IFD H;  2K5W A;  1MJE A;  5I6W A;  3CME A;  2BDO A;  1ENF A;  2AQ1 B;  4KN4 C;  1IZ6 A;  1XPU A;  5KEE A;  4X65 Q;  3S1M H;  1JWS D;  4C3I G;  1EQQ A;  2EXZ A;  1VQL A;  3GTG H;  4GNX A;  1I4Q A;  3NUC A;  3T1Y L;  1C8C A;  4NXN Q;  2BCO A;  5CGK A;  1IL8 A;  2K5N A;  4A3G B;  3I3C A;  3A5Z B;  1D5M C;  3Q8D A;  3NHH A;  1JOQ A;  4R8I A;  1IBM Q;  2Y0S G;  2IY5 B;  1ZXT A;  4PNY A;  3Q0A A;  3ER0 A;  3GTG B;  4A3F B;  3RNU A;  2AQ3 B;  3QJY A;  1VQ7 A;  1LTI D;  2RHS B;  3OMC A;  2G9H D;  2R7F A;  2R61 A;  2V4D A;  4JI3 Q;  3SK6 A;  3D4D A;  1HNZ Q;  4R4I A;  2IX0 A;  4IFD I;  1FNV A;  3NTI A;  1G8Z D;  1W6J A;  1EOV A;  3S1N H;  4DNR B;  4IPD A;  1PHJ A;  5CV8 A;  1Q81 C;  4HAE A;  1HZC A;  1X3Q A;  1QB5 D;  1V1P B;  4GKK Q;  1Q7Y C;  4XQQ A;  4PMC A;  3ZYY X;  4LF5 L;  1PFN A;  1IYU A;  2NN6 H;  1XMO L;  3S2H H;  1UE7 A;  2JSO A;  3S17 B;  3U50 C;  3CPF A;  1HHV A;  1G2T A;  4H7B A;  4BBR G;  4DUY Q;  1NNX A;  2K05 A;  5HGQ A;  1W6K A;  3EJI A;  5DAU A;  1GUN A;  5C3E G;  2PO4 A;  4JI6 L;  3BDO A;  2ID0 A;  2KUM A;  4EQN A;  4GNX C;  3CCM A;  3GTO H;  4NXM L;  1EYC A;  5KNB A;  2UXB L;  1NY4 A;  1UEA B;  3D8G A;  3S9W A;  4J6H A;  1PH9 A;  1SND A;  4JI4 L;  2DNC A;  5CV4 A;  2AUK A;  2E75 C;  2ZTC A;  1H9J A;  2P5Z X;  4I65 A;  2I5M X;  2VY3 A;  3DXJ C;  1YNN C;  3E6Z X;  4DK6 C;  3OOC A;  1ICW A;  4DV6 L;  4JI2 Q;  5JJZ A;  4AQY Q;  4J15 A;  1WTV A;  2L5T A;  2DY7 A;  1GUS A;  2K75 A;  4NXN L;  2JQO A;  3GD7 A;  2WB1 G;  1PTO C;  1YZ6 A;  2OQK A;  4IUQ A;  5IGF A;  3R3O A;  1RIP A;  3JAM L;  4FYD A;  3RN5 A;  1FD7 D;  5ELN A;  3H6M A;  4U67 3;  1UAP A;  1EQT A;  1PA6 A;  5ELE A;  3SVM A;  3S16 B;  3ONA B;  4DV1 Q;  2B2T C;  5IP9 G;  3KF8 B;  1KQS A;  2ICI A;  3WOE A;  4HIK A;  1IL2 A;  3G6J B;  4HJ9 A;  5IOC A;  3MXP A;  2LY7 A;  2B2Y C;  3IFT A;  1RD9 D;  3WOF A;  4IUP A;  3J7A V;  4GLV B;  5K5P A;  3C3L A;  1VQH A;  4JBW A;  2LXJ A;  1NJI C;  1G29 1;  2N8N A;  3AU7 A;  2ZJQ A;  3H3V I;  1KLU D;  1NR2 A;  5IYD H;  1RF2 D;  1F9P A;  4DAY A;  1S5F D;  2SNS A;  1F2Y A;  5G3L F;  1X65 A;  4HMI A;  1ASZ A;  2R93 B;  2CCZ A;  4IN3 A;  4L8J A;  2RDH A;  2R6G A;  4O0A A;  4OXP A;  1JJG A;  1E2W A;  2B2U C;  4Q5V A;  4OWT B;  4A3E H;  4AIM A;  3RLO A;  3SE0 A;  3BU2 A;  2WP8 J;  1A3V A;  2QA4 A;  1PTO D;  1QJO A;  3DLL A;  4DR3 Q;  1HA6 A;  4FO2 A;  2EYH A;  4UP8 A;  2A6H C;  3P7J A;  5J39 A;  3R93 A;  2MUY A;  1H9S B;  1BCP B;  2XTI A;  2BA1 A;  4RGO S;  5JVG 3;  1MBY A;  3N6R A;  2XWB B;  1YNN D;  1SRU A;  1M1K C;  2Q2I A;  4IO9 A;  1PXU A;  3QIA A;  2MO0 A;  3RUZ A;  1SNC A;  3KF6 B;  3S14 H;  3HKZ E;  4FF3 A;  1V1O A;  2KCN A;  2WFW A;  4P73 A;  4QL5 A;  4R4T A;  4DR4 Q;  4JBK A;  3PGZ A;  1I4R A;  3S1R B;  3CCU A;  4LFB Q;  1A3T A;  4B3T Q;  5FKA C;  3HOX B;  2LFN A;  1YI2 A;  2K4K A;  2ZTE A;  3NK9 A;  3GQB A;  3Q24 A;  1R4P B;  4BS9 A;  5ELC A;  3ULJ A;  1HRJ A;  5JEA H;  5E1F A;  1JWM D;  4QQB X;  2VNU D;  4BBS H;  4KD3 A;  1WD0 A;  3A8J E;  3M3Y B;  1MSG A;  1EQR A;  2PNR C;  1DOK A;  3F2D A;  2OXP A;  4HED A;  1H9M A;  1KHI A;  4PZ7 A;  3CCQ A;  3OTO Q;  1BCP F;  2PW7 A;  3MA2 B;  1YIJ A;  3HFZ B;  4A3M B;  4F7X A;  1EIY B;  3S2D H;  3I4N B;  2IT1 A;  1BR9 A;  2MJ8 A;  1VMC A;  2IW3 A;  4BY7 H;  4IFD G;  1V9P A;  2ZXR A;  1UE1 A;  3H0G H;  3F2B A;  2YU9 H;  1X6O A;  5J1Z A;  1GUO A;  4DV0 L;  4CDE C;  1PH2 A;  4OGQ C;  2UUA L;  1PTO B;  3MXN B;  4OEL B;  1N33 L;  2E76 C;  2LKV A;  3DM3 A;  1PV4 A;  1D1K A;  4P74 A;  1OXT A;  2EY2 A;  3HOV H;  1EWC A;  1PVO A;  2X6L A;  4LF4 L;  1Q90 A;  5K36 H;  5GQO A;  3HRZ C;  1GO3 E;  2A68 D;  2NZ1 D;  2C35 B;  1AEX A;  4OIJ A;  4BY7 G;  5I9P A;  4G57 A;  2F4I A;  2KHJ A;  3GV3 A;  2R93 H;  4JYA Q;  4P72 A;  3K5O A;  3V05 A;  4FF4 A;  1TXY A;  2MQH A;  4FDB A;  1PFM A;  3RLF A;  5IYB H;  4RG1 A;  1CHQ D;  3NTH A;  1GHK A;  1DYQ A;  4GNX B;  3T51 B;  3SK8 A;  3FEW X;  4RHS A;  1EU4 A;  2K50 A;  2R3Z A;  5M5X B;  2R7Z G;  1VQF A;  2E5L L;  1CM9 A;  3QR8 A;  1YBY A;  4TVA B;  2EPB A;  1O78 A;  3SK5 A;  1CA6 A;  2I0Q A;  1JE5 A;  1VQK A;  1JB3 A;  1SE2 A;  1JOO A;  1Q46 A;  4WJ3 M;  1S5E D;  3PQI A;  1V1Q A;  1N34 Q;  3FP9 A;  3G6E A;  4JW0 A;  1VQP A;  1XX8 A;  2L0C A;  3IL8 A;  3HOY G;  4Y52 H;  3HOW B;  1EL0 A;  4DV3 Q;  1SYF A;  5IP7 G;  4K5W A;  4FVM A;  3I4M H;  5CV6 A;  4DAV A;  3HKZ G;  1QNK A;  4KY6 A;  5DEH A;  1MJC A;  1TWG B;  4LF8 L;  2PW5 A;  3ICE A;  2NVY B;  4KY5 A;  2VS1 A;  2L12 A;  4X6A H;  4WJW A;  1SLJ A;  1KRS A;  2K1B A;  2GVA A;  4BBS B;  4I7A A;  5EPL A;  5G3L D;  2VUM H;  1N32 L;  4MTK A;  5JAV A;  1DZ1 A;  3DWQ A;  3OHX C;  3HZX A;  2UUA Q;  2HIV A;  3MZ5 A;  2B29 A;  1HQM C;  3HOU H;  2JA9 A;  3CQZ H;  4MNO A;  1D7Q A;  1IW7 C;  1ML0 D;  2ZT9 C;  2IX3 A;  1HNZ L;  4CHT B;  4NP5 A;  4CBV A;  2F3W A;  4AH6 A;  4DR5 Q;  1BQQ T;  2AQ2 B;  1AP0 A;  2QDB A;  1HUN A;  4A3K H;  2Q8R E;  3UE1 A;  4C3H H;  2VUM B;  2XVS A;  1LTL A;  2UXD L;  1MSH A;  4UP7 A;  1MGS A;  3U4V A;  2B2Y A;  2VQE L;  5IWA L;  4XQN A;  4UHV A;  1K73 C;  3DMU A;  5CV7 A;  4JBM A;  2EQS A;  4A3B H;  1HA5 A;  1B7Y B;  1LAB A;  1CFM A;  2RDG A;  1A2U A;  4CGY B;  1EEI D;  4O2D A;  4PZ6 A;  1IKM A;  1OXU A;  2UUC Q;  1ZYR C;  1QVF A;  2XWJ B;  1NE3 A;  2EYF A;  3T13 A;  4Q0F A;  1KC8 C;  4POG A;  1LLR D;  2F0D A;  4KD4 A;  4CJ2 C;  2B63 G;  4A3J G;  2PQE A;  4JBJ A;  4K14 A;  1EY0 A;  1RTO A;  2CQO A;  2ZXP A;  4XQJ A;  1V1P A;  4A4I A;  4A3F H;  1PH7 A;  2F0O A;  4BY1 G;  3VR3 A;  4O42 A;  4DAM A;  4ILW A;  3E9I A;  1BXT A;  1FGB D;  3W1B A;  1CT1 D;  2LS0 1;  1LO5 D;  1WTO A;  5C0X H;  3MXG A;  3KBX A;  3KLW A;  1Y1V H;  5K36 G;  1I4X A;  3KLS A;  2Y0S E;  5IYC H;  2A68 C;  3L3O C;  2ZM6 Q;  1SYD A;  1Y1W B;  4YCV A;  4B3R L;  3FKI B;  5ISR A;  2NUC A;  2O4X A;  4FF1 A;  1BBX C;  4APV A;  4RA8 A;  1I94 L;  1ESF A;  2F0F A;  3HOW G;  2UXC Q;  4KHV A;  1D8L A;  4BY7 B;  2DJG C;  5EKI A;  2O5J C;  4J8Q A;  4CKE A;  5AJ3 L;  1LTR D;  2L55 A;  2YU9 B;  4IPG A;  1CKN B;  1STY A;  3N52 A;  1XXG A;  4N8X 1;  1O80 A;  4G4K A;  1SMX A;  2Z6K A;  2UXB Q;  2KEN A;  4DV2 Q;  1HR0 L;  1KNE A;  4NDX A;  2E2D C;  2PZT A;  3I72 A;  3PO2 G;  2WKC A;  4ZCK A;  4PG3 A;  5HGT A;  3GTQ H;  3ND9 A;  2IHF A;  5C44 G;  1HTL D;  2HQE A;  4QIW B;  1ZEQ X;  2B2V C;  1TWF H;  3QOJ A;  2NVQ B;  3R2T A;  3PCO B;  4QMG A;  3TRZ A;  3T4A C;  3A7A B;  1TY0 A;  4B9X A;  1W3S A;  1DOL A;  3TP6 A;  5BN4 A;  2NTS A;  2MFI A;  2ASB A;  2UU9 L;  4R4C A;  4IQZ A;  1BDO A;  1L0X B;  3NWT A;  1EFW A;  4GKK L;  2KEE A;  3GP7 A;  3UE0 A;  3M85 A;  2JA6 B;  3GTP B;  2A69 C;  2K6A A;  5GAE C;  2F3V A;  1CSP A;  1VQ9 A;  4RHR A;  4YWM A;  1XPO A;  1U4R A;  4X62 Q;  1SNM A;  4GOP C;  3FPU B;  1TQO A;  5EJW A;  5J3B A;  4HIO A;  2AHO B;  2F0H A;  3TP8 A;  4L5T A;  2K33 A;  3SEB A;  2N88 A;  1KLG D;  3FPP A;  1KRT A;  2QEJ C;  3A8K E;  3W5O A;  3D31 A;  4IJL A;  4AYB B;  4JV5 L;  2E74 C;  3CAM A;  4XTC S;  2FIN B;  1L0W A;  3U9S A;  3TEH B;  1TWF B;  2NVQ H;  2I07 B;  4HCS A;  2NVT H;  3PO3 B;  4JI2 L;  4KHP L;  2TMP A;  1TT2 A;  1LTB D;  1PH4 A;  4XT3 B;  4EGV A;  3CHB D;  2F0K A;  5COR A;  2RF4 A;  1K3R A;  1Q8K A;  1X3G A;  2UUC L;  4K2K A;  1QZG A;  3HOV G;  4LUV A;  3G71 A;  1E3P A;  1TII D;  2KCT A;  2BA0 A;  3TP5 A;  2N55 A;  3ITP A;  4HSV A;  1D1I A;  1ESR A;  2GVB A;  1F9S A;  2B39 A;  1YHQ A;  3FDT A;  1PRT C;  2AWO A;  3CRK C;  1DXM A;  4K0K L;  2AWN A;  4YWK A;  2EY6 A;  2K28 A;  2J0T D;  3LWE A;  1HNW Q;  2HD3 A;  2CW0 C;  3VYT A;  4ZRZ A;  4A3C G;  4JI8 L;  1PRT F;  2DGY A;  4HN7 A;  2HCC A;  1BCP C;  1HFG A;  1E2Z A;  4JI5 L;  1HZB A;  3G4S A;  4P75 A;  1RTN A;  2NN6 G;  3AB9 A;  4DR4 L;  1P8L A;  3GTK B;  4GLA C;  1CUK A;  1PYS B;  4AQY L;  3MXU A;  1EQV A;  3BYY B;  2NYZ D;  3D6C A;  3F8T A;  1J9O A;  3WWV A;  1L1O C;  5ELB A;  1XNQ Q;  2EOT A;  5M3F H;  3MAQ A;  2CKZ B;  2F4V Q;  3X3M A;  2G9D A;  1EYG A;  3J7A 5;  1WTW A;  4X62 L;  5IY0 A;  3ZJY C;  1ZYR D;  1RKN A;  3MWY W;  1Q82 C;  2F0V A;  3MHB A;  1V43 A;  2RBM A;  4MZ9 A;  4RGM A;  5C44 B;  1B4O A;  2YTX A;  1GM5 A;  3I4N H;  3M3Y H;  3A5U A;  2JA6 H;  3GTP H;  4KY7 A;  4A3I B;  2EXD A;  3STB D;  4QUF A;  5C4J B;  4JI6 Q;  2K5H A;  4TSS A;  3V2T A;  3T1Y Q;  1TS5 A;  3BZK A;  4PMW A;  1BKB A;  5C3E H;  1NBW A;  3OWF A;  1UUP A;  1T9H A;  1YHA A;  1WTQ A;  4H13 C;  2B2U A;  5GAD C;  5DNF A;  2XN9 C;  1C48 A;  4CKC A;  1PYW D;  3GV6 A;  1TWH H;  4N8F A;  4PQX A;  4OEM B;  4K6D A;  1K0S A;  4N9P A;  1NAP A;  2BE5 C;  1VF7 A;  1YNJ D;  3J7Y W;  3KFU A;  4HR7 B;  5C3E B;  1KDA A;  2TSS A;  1D5Z C;  3DUZ A;  1MKH A;  1PZI D;  3PO3 G;  3FKI G;  3K0Y A;  3UDI A;  3M4O B;  4HTH A;  1XNR Q;  2R92 H;  3Q23 A;  1TWH B;  2QCP X;  3GO5 A;  4C2M B;  2K5D A;  5GRO A;  4IPC A;  3I2Z A;  3CW2 C;  3FMC A;  4DF7 A;  3T53 B;  2PI2 E;  2NB0 A;  2VQF L;  1C4Q A;  2F0M A;  2KHI A;  1XNQ L;  4XYQ A;  5LMN W;  3TQY A;  3P20 A;  1K8A C;  3SHL A;  3C46 A;  2CVR A;  4LFA Q;  1B3Q A;  1FNU A;  1PRT D;  1WTH A;  1OXS C;  2DY8 A;  3E0E A;  4KV6 A;  4RGN A;  4C1N I;  3I56 A;  3TS0 A;  4B3S L;  2B63 B;  1Q8I A;  3U4Z A;  1HCZ A;  3SGI A;  2FXQ A;  4NXM Q;  1NMG A;  4BY1 H;  1QOH A;  3PUW A;  1WD1 A;  1RL2 A;  2B2W C;  4TRD A;  1SDF A;  1O7L A;  2XNA C;  2PYK A;  1K8M A;  2F0G A;  2FJ2 A;  2EVB A;  1XJV A;  3S1M B;  2OTL A;  3TBI B;  3KF8 A;  1S5D D;  2B2W A;  5DM6 3;  4LF6 L;  1VQE A;  3LNN A;  2OCE A;  3A7L A;  3FVQ A;  1L0Y B;  1Z47 A;  3PF5 A;  4ZAI A;  4R9W A;  1XPR A;  1AW7 A;  3HOZ B;  5IOD A;  3E5S A;  2Z8L A;  1B8A A;  5EKK A;  5C3W A;  2XSC A;  3BG3 A;  2C9O A;  5KYL A;  2B2T A;  1VQ6 A;  2JA5 B;  1VQO A;  2E5L Q;  2WIN B;  2OQ0 A;  2Y0S B;  3NEN A;  3MFG A;  1A63 A;  3Q6S A;  1SXT A;  1YNJ C;  4S3S A;  4ME3 A;  3S15 B;  4KHZ A;  1EWI A;  4GKJ L;  1OO9 B;  3NBH A;  2PCF B;  3EIV A;  3JAM E;  1XNR L;  1VQ8 A;  4H44 C;  4RKB A;  3S14 B;  3NWS A;  3VYU A;  5BR8 L;  4A76 A;  1AH9 A;  1QWY A;  3DWP A;  4JI1 Q;  1ONL A;  2CWA A;  1I4G A;  3CCJ A;  3KYH C;  4OWX B;  1A2T A;  3VYR A;  3FHW A;  3TS2 A;  3I4L A;  3H91 A;  4IUU A;  2I46 A;  4ZKB B;  3J81 c;  3TDQ A;  1LV9 A;  3RD4 A;  2AMC B;  4LF5 Q;  4Y7N H;  5KRU A;  3ULP A;  3AEV A;  4KTA A;  5NUC A;  3NP8 A;  1G6Z A;  1SYB A;  1JWU D;  3K8A A;  2E2H H;  2R7Z B;  2IX1 A;  3PUX A;  2M00 A;  1EYA A;  1QZH A;  1R9T B;  2R92 G;  1HUM A;  1C0A A;  4KKT A;  3GTM H;  4DFA A;  4RGT A;  2L11 A;  4JI4 Q;  2L4N A;  1CTM A;  4OX9 Q;  1DON A;  5C44 H;  1HJP A;  1EY8 A;  3PMF A;  1K83 B;  1IXR A;  1X56 A;  2A6H D;  3GTK H;  2VUM G;  1QG7 A;  4RH6 A;  1BCP D;  3I55 A;  2BH2 A;  1K3B C;  2R7D A;  2A6E D;  2Z9H A;  5FK9 C;  3L0O A;  2B8G A;  2CW0 D;  4B3T L;  4RFB A;  1LTT D;  1GVP A;  2JYO A;  2NVX H;  2I5H A;  2JE6 I;  3AQQ A;  3I91 A;  4JYA L;  1YEZ A;  2BDN A;  3IKJ A;  1M4V A;  5IT9 L;  2CWP A;  3VR2 A;  1S72 A;  2SEB D;  3K80 C;  4ZQ3 A;  1DOM A;  1E0B A;  3I4N G;  3KOJ A;  5E3F A;  5C4H A;  4JI0 L;  4JI1 L;  3HOY H;  4IUT A;  3CMA A;  3F1Z A;  1F9R A;  3KBG A;  4POF A;  1I3Q B;  1CQF A;  3TSS A;  5ELF A;  2B8F A;  1IYV A;  2MO1 A;  2F0L A;  5EBC A;  2F3I A;  4JOI A;  4JV5 Q;  1ROD A;  1MHW C;  1HNX Q;  2JJQ A;  1TS3 A;  2K32 A;  5C5L A;  5C3X A;  5M5X H;  4LF9 Q;  1TWC B;  1CKO A;  4DPG A;  3HOY B;  5M3M B;  2VQE Q;  2F0S A;  3TZD A;  5KYI A;  3U58 A;  1HXY D;  2ZM6 L;  4DV6 Q;  4UP9 A;  1PZJ D;  4DUZ Q;  1JC7 A;  2M2L A;  4L5R C;  1WFQ A;  1N33 Q;  1AZP A;  2CQA A;  4KI0 A;  5IYB G;  1D6E C;  3NQT A;  2NVX B;  2HCI A;  4L63 B;  3K58 A;  2Q8T A;  4YHH L;  1QVG A;  2B63 H;  1SFO H;  4GN5 A;  1VQ5 A;  3G48 A;  4JI3 L;  4A3I G;  1MI2 A;  4A3D B;  3LWU A;  3CD6 A;  3M4P A;  3BJU A;  5EQ0 A;  2KJX A;  1U4M A;  4ALP A;  5GAG C;  4XIG S;  4B3S Q;  1VDZ A;  1FNW A;  3VDY A;  2N3S A;  3R2I A;  3CC7 A;  4DR7 Q;  4DK0 A;  3WDN A;  5IT9 c;  3HOU B;  5C0X J;  3K6O A;  1H95 A;  4LF7 Q;  4YCW A;  3MC0 B;  4A3B B;  1ENA A;  5LL6 X;  2RSN A;  1C7Y A;  1WCM B;  1B50 A;  2A69 D;  2A1A A;  3BDL A;  2CFM A;  4KHP Q;  2BE5 D;  2F0E A;  4IOA A;  1CI3 M;  3VR4 A;  1O7Y A;  3GTM B;  2F0U A;  4ZK9 B;  3S1N B;  4OWW B;  2JA7 B;  1CSQ A;  1YJW A;  2BOS A;  3NBH B;  2EZV A;  2EYJ A;  3L2P A;  3HEJ A;  4OO1 H;  1PFB A;  1JJ2 A;  2K14 A;  3RZO H;  2GA4 B;  5A2Q L;  2X69 A;  1F77 A;  3NTK A;  1E1T A;  3PIP 3;  2F0I A;  3DWA A;  1BO0 A;  4A3M G;  2PZW A;  4K0K Q;  4DV4 L;  1WTX A;  2K52 A;  3CC2 A;  4K6L A;  3UDF A;  1Y69 U;  1B1Z A;  3GTL H;  3IAY A;  3MTS A;  5C4X H;  2K7V A;  3MVV A;  3I4M G;  2XRQ D;  1UWV A;  2OEO A;  2FMM A;  4GKJ Q;  1VQG A;  5IGC A;  2HHH Q;  4JI5 Q;  5EAY A;  1TKW B;  5A2Q E;  3ERO A;  4K8I A;  4A3G H;  5M3F B;  1KXL A;  2JA5 H;  3F2U A;  2RKS A;  4DR5 L;  5C0X I;  3UDX A;  5DM7 3;  1IYJ B;  2F0N A;  1X3P A;  3CF5 A;  1VMP A;  1Q1B A;  4R4O A;  4DAY B;  2WB1 B;  1BNZ A;  4PV1 C;  4RWS C;  1JB7 A;  2YTV A;  1YJN A;  3E9H A;  4C3I H;  1ILQ A;  1LAC A;  1I4P A;  1BOS A;  1K0R A;  4H0L C;  4ZKC B;  2IWH A;  4RAU C;  2EJG C;  2EJM A;  4JI0 Q;  3HG9 A;  1FVI A;  1J5E L;  3QOL A;  1ET6 A;  5BN5 A;  5CYU A;  1CK1 A;  1SFO B;  1CQV A;  3DEP A;  4PMB A;  2CHB D;  1OXX K;  3A8I E;  2UUB L;  2JA6 G;  4DR3 L;  1ZKO A;  4L5S A;  4HJ7 A;  4CDF C;  1NSN S;  2C5C A;  2Q2U A;  2PMZ B;  4UPA A;  3OWE B;  1KNA A;  1TS2 A;  1NMF A;  1KD1 C;  3QWN A;  3D4W A;  5CR3 A;  5JJK A;  3VR5 A;  4DNI A;  4I7Z C;  4P2C B;  2KVM A;  3KLR A;  4JC0 A;  4QF4 A;  4V0B A;  4HIM A;  4X64 L;  2JXM B;  5D3D A;  1DM0 B;  1D5X C;  3E3X A;  4EVO A;  1Y8N B;  3QG1 A;  2EY5 A;  1E2V A;  1B44 D;  4NW2 A;  2WAQ E;  1H9R A;  1RJT A;  1SNP A;  4RMF A;  2JA7 G;  4B9W A;  1I6V C;  2A19 A;  4YY3 Q;  1WCM G;  3GTO B;  2NZH A;  3EBE A;  2MPM A;  4N9T A;  1L1O A;  3H09 A;  2WKD A;  3PV0 A;  2PZU A;  4MHE A;  1T5X D;  1PTO H;  1KL9 A;  1M8A A;  3NPP A;  1TWG H;  1SBB B;  4A3G G;  1Y1W G;  1YHB A;  2JEA I;  2E2J B;  1X55 A;  1ET9 A;  3M4Q A;  1SR3 A;  4A93 H;  4LJZ C;  3J7Z C;  3MEH A;  4ZUI A;  1SJE D;  4HID A;  3F2C A;  4JOI C;  1I6H B;  5EGT A;  1CZW A;  1EIG A;  5M3M H;  2UU9 Q;  4KKU A;  1GKH A;  4LF6 Q;  4KMU C;  4QB4 A;  5FLX E;  5LMN L;  4DR6 L;  4YCU A;  4K5V A;  1I4H A;  2KOL A;  3H94 A;  3K7U C;  4FXG C;  1TWA H;  5EPJ A;  1KAW A;  2HUG A;  2NBF A;  4CKB A;  2M9V A;  1MIU A;  2YYZ A;  2DJF C;  4C56 C;  2Q2T A;  5H1S E;  1PH8 A;  2ZTD A;  2QF7 A;  1YNX A;  1FGU A;  2KCM A;  4ZUJ A;  2V1C C;  2RVL A;  5IGB A;  4BA2 I;  3TZU A;  1PMR A;  2PNH A;  2JP1 A;  3S1Q H;  2AUJ D;  4X3T A;  4OHJ A;  3S24 A;  3TN2 A;  2KCC A;  3J81 L;  1IBL Q;  1J6Q A;  4MN3 A;  4QUC A;  4IOC A;  3U9O A;  4K8J A;  4F8M A;  5ELD A;  2RCN A;  1Y1W H;  2BH8 A;  1STN A;  1N8R C;  1B3A A;  4FP5 D;  3A55 A;  1SNQ A;  4DGZ A;  3KJP A;  3BVG A;  3S1Q B;  1HFN A;  1IKL A;  1OXV A;  5IIF A;  4GLX A;  1PYB A;  4GOP A;  1CKM A;  3CKI B;  5E4X A;  3HS0 C;  3J7A F;  3TME A;  3HP3 A;  1M90 C;  1J5E Q;  1OTC A;  1FR3 A;  3A74 A;  3NXW A;  3K57 A;  1VQI A;  1JJC B;  3BDC A;  4A3F G;  4DK3 C;  3PO2 H;  5CBA E;  1I94 Q;  3NQI A;  4B3M Q;  4OO1 G;  2K5V A;  3AFP A;  1PH5 A;  4BA1 I;  2UUB Q;  5FLM H;  1A0I A;  3CP0 A;  1X54 A;  3RZD B;  3AYH B;  1LT5 D;  1EY4 A;  3PIO 3;  1EIH A;  4X3S A;  5E4W C;  4DV3 L;  1KDC A;  2VL6 A;  1Q1E A;  3J81 E;  2KED A;  3EVQ A;  1VQN A;  1A6X A;  4HSP A;  1X3E A;  3NEM A;  4C3I B;  2DNE A;  3RMH A;  2E2I B;  2L9H A;  4JI8 Q;  2VXW A;  4UAI A;  3UDG A;  3M9B A;  2IPK D;  3URY A;  1Z6H A;  3OSO A;  4BXX H;  2E2J H;  5BN3 A;  1S4Z A;  3L7Z C;  2IHE A;  1CKN A;  3H0G B;  4HCE A;  4R8N A;  4C3J G;  2E2I H;  4EQO A;  1AE2 A;  1JIC A;  2AKW B;  3KDF A;  4ULL A;  3VR6 A;  2NWG A;  1HZA A;  2RHQ B;  4BBR H;  3L9A X;  1NTG A;  1RDP D;  1LYL A;  1SE4 A;  3S2H B;  1X9N A;  4WJ4 A;  3GTJ H;  2N78 A;  1H9S A;  1B9N A;  3RN2 A;  2QGQ A;  5I4D A;  4DU9 A;  4ZYS A;  2K5Q A;  4B08 A;  4DR7 L;  4FNF A;  1H9K A;  1SJH D;  1PH3 A;  5M5Y H;  1SE8 A;  1UE5 A;  2DN8 A;  1LTS D;  2HIX A;  2Z4I A;  1GJX A;  3K7A H;  3LX0 A;  1JOK A;  4LF7 L;  1GHJ A;  3CQZ B;  1L1O B;  1NR4 A;  1HR0 Q;  5JEA J;  1EUJ A;  4P71 A;  4QJF A;  1NCV A;  4IUR A;  1LT3 D;  2B2V A;  4OX9 L;  3HOZ G;  1C9O A;  1DD2 A;  3K81 C;  4FXD A;  1ILP A;  4KJO A;  2XIW A;  3HOZ H;  4DUZ L;  4IUN A;  3EFX D;  1XWE A;  4RCO A;  4L5Q A;  4LMQ D;  2HT1 A;  1KIX A;  2QEX A;  3A56 A;  1XTC D;  3I73 A;  4XT1 B;  5TSS A;  3EA6 A;  3T56 B;  3I90 A;  2QKI C;  1VQB A;  4JCV E;  4NPS A;  5LHY 1;  2L1B A;  1GXD C;  1DJR D;  1KAB A;  2ES2 A;  5D65 A;  4M8A A;  5CV5 A;  2H1E A;  4A3E G;  1LT6 D;  4O1N A;  4RCN A;  4LUZ A;  2Z6B A;  1XYI A;  5D3I B;  1DGS A;  2F0J A;  3I7F A;  1VF5 C;  5M3M G;  1STG A;  2JA8 B;  5M5W H;  3S2D B;  2PI2 A;  1GUW A;  4LFC L;  4IZ8 A;  5IP7 H;  4BXX G;  5COY A;  3D6W A;  1T5E A;  4EQ5 A;  3BS1 A;  5LL6 S;  5IGG A;  2OTJ A;  1YJ9 A;  4C1N K;  1QNU A;  4ODG A;  1SE3 A;  3PUV A;  3P1H A;  2F0P A;  3CCR A;  3GTL B;  3J81 i;  3I4O A;  1HH2 P;  4XXE A;  4C3H B;  4IUV A;  2A6E C;  1K8G A;  3KUP A;  4GOP B;  3O13 A;  2HDM A;  2R7Z H;  1PDQ A;  1RHP A;  2E2H B;  3K5N A;  5IE8 A;  3HOX H;  3ND8 A;  1BUV T;  3I8Z A;  2F03 A;  4CDC C;  3AMU A;  3CXC A;  1HNW L;  1EZ6 A;  3HOX G;  2D0O A; 
#chains in the Genus database with same CATH homology
 4BY1 G;  4DAM A;  4BBS G;  3JC6 6;  4HJ8 A;  2JK8 A;  4YHH L;  2YTY A;  4A3J H;  1QVG A;  3E9I A;  2ZJP A;  2B63 H;  5JEA G;  3W1B A;  3D0F A;  4GN5 A;  1SFO H;  1VQ5 A;  2I5L X;  3G48 A;  4JI3 L;  4LF9 L;  4A3L H;  1E22 A;  2R93 G;  1FL0 A;  1G6P A;  4DR2 Q;  4A3I G;  3KLW A;  2OWO A;  2Q2H A;  1Q12 A;  3CD6 A;  3M4P A;  4JI7 L;  1Y1V H;  3BJU A;  5K36 G;  3M4O H;  4ALP A;  5GAG C;  4XIG S;  4B3S Q;  2Y0S E;  5IYC H;  2ZM6 Q;  2EIF A;  4LNQ A;  3VDY A;  2N3S A;  4YCV A;  3CC7 A;  4DR7 Q;  4B3R L;  3STB C;  1N32 Q;  1LUZ A;  5IT9 c;  1JT8 A;  2YV5 A;  4APV A;  1I94 L;  5C0X J;  3HOW G;  4YY3 L;  3RR5 A;  2UXC Q;  5E7N A;  3EN2 A;  1VQD A;  1A62 A;  1D8L A;  4PZ8 A;  4LF7 Q;  1H95 A;  4TQU S;  4YCW A;  3PSI A;  5AJ3 L;  3H0G G;  4DR2 L;  4IPG A;  3ULL A;  1CKN B;  1ASY A;  1MJE A;  1C7Y A;  4DV4 Q;  3CME A;  5IWA Q;  2A1A A;  4KHP Q;  2CFM A;  1IZ6 A;  1SMX A;  4IOA A;  1LM0 A;  2Z6K A;  2UXB Q;  2KEN A;  1XPU A;  4OWW B;  4DV2 Q;  1CSQ A;  1YJW A;  3NBH B;  1HR0 L;  4X65 Q;  3L2P A;  4HJ5 A;  1VQC A;  3RZD H;  3S1M H;  3NEL A;  1EQQ A;  1JJ2 A;  2K14 A;  3RZO H;  3M7N A;  3PO2 G;  1VQL A;  3GTG H;  2NN6 I;  4GNX A;  4PG3 A;  3GTQ H;  1E1T A;  1S3O A;  2IHF A;  5C44 G;  1TWC H;  1HNX L;  3T1Y L;  4NXN Q;  1VQJ A;  4EX5 A;  4A3M G;  4K0K Q;  3AFQ A;  2K5N A;  4X66 L;  4DV4 L;  3A5Z B;  2K52 A;  1TWF H;  3Q8D A;  3CC2 A;  3UDF A;  3PCO B;  3TRZ A;  3GTL H;  1IBM Q;  3KF6 A;  2Y0S G;  1PH1 A;  2IY5 B;  5C4X H;  3I4M G;  1W3S A;  3HKS A;  4A93 G;  1UWV A;  2ASB A;  2MFI A;  2JA5 G;  1N36 L;  3ER0 A;  2UU9 L;  4R4C A;  3RNU A;  4GKJ Q;  1VQ7 A;  1VQG A;  1EFW A;  2RHS B;  4GKK L;  3M85 A;  3UE0 A;  2E8G A;  2R7F A;  2HHH Q;  4JI5 Q;  5EAY A;  4QIW E;  4JI3 Q;  4A3G H;  1E1O A;  1HNZ Q;  2B3G A;  5GAE C;  1KXL A;  2JA5 H;  2F4V L;  4GN3 B;  4R4I A;  4DR5 L;  2VW9 A;  1CSP A;  2IX0 A;  1VQ9 A;  4IFD I;  4YWM A;  5C0X I;  1XPO A;  4X62 Q;  3UDX A;  4GOP C;  2D0P A;  1IYJ B;  5J3B A;  1IBM L;  3CF5 A;  5IP9 H;  4HIO A;  4KI0 A;  1SRO A;  2AHO B;  3S16 H;  1Q1B A;  4OON A;  4R4O A;  4DAY B;  1EOV A;  3S1N H;  4L5T A;  4IPD A;  1PHJ A;  1FJG L;  1Q81 C;  3PO3 H;  2MNA A;  1HZC A;  1JB7 A;  4AYB G;  4GKK Q;  2YTV A;  1YJN A;  1KRT A;  1Q7Y C;  3E9H A;  4LF5 L;  4C3I H;  3W5O A;  3D31 A;  4IJL A;  3CC4 A;  4JV5 L;  4XTC S;  3CAM A;  1K0R A;  4GS3 A;  3J81 j;  1XMO L;  3S2H H;  1UE7 A;  1L0W A;  4DR1 L;  2LXK A;  3U50 C;  3CPF A;  4JI0 Q;  3TEH B;  1FVI A;  4BBR G;  2NVQ H;  4DUY Q;  4IJH A;  5HGQ A;  1J5E L;  2NVT H;  4R4Q A;  5GAH C;  4JI2 L;  5C3E G;  2UXC L;  4KHP L;  4JI6 L;  1PH4 A;  2ID0 A;  1N9W A;  3CCM A;  4GNX C;  2ATW A;  4NXM L;  3GTO H;  2UXB L;  1NY4 A;  1K3R A;  1OXX K;  1Q8K A;  1X3G A;  2RF4 A;  2UUC L;  2UUB L;  2LSS A;  4DR3 L;  1QZG A;  1PH9 A;  4JI4 L;  4LUV A;  2JA6 G;  4L5S A;  3H15 A;  3G71 A;  4HJ7 A;  1E3P A;  2KCT A;  2BA0 A;  1AE3 A;  4QGU A;  2ZTC A;  2VY3 A;  2Q2U A;  2I5M X;  1WJJ A;  3OW2 A;  4UPA A;  2GVB A;  2ZJR A;  1NMF A;  1A8V A;  4DK6 C;  1KD1 C;  1YHQ A;  1GD7 A;  5IYC G;  2A8V A;  2AWO A;  4K0K L;  2AWN A;  2N49 A;  4YWK A;  4DV6 L;  4JI2 Q;  5JJK A;  1Y1V G;  4DNI A;  2KBN A;  4AQY Q;  1UEB A;  4YHH Q;  1HNW Q;  4JC0 A;  4J15 A;  4DKA C;  4HIM A;  4X64 L;  4A3I H;  2K75 A;  2NZO A;  1R9T H;  4A3C G;  4NXN L;  3S1R H;  2JQO A;  3GD7 A;  2WB1 G;  4JI8 L;  1YZ6 A;  1UE6 A;  2DGY A;  2OQK A;  4MTN A;  5LMU Q;  2WAQ E;  4KLK A;  4JI5 L;  1RIP A;  1HZB A;  4RMF A;  3G4S A;  2JA7 G;  4P75 A;  2L15 A;  2NN6 G;  4DR4 L;  5DLQ E;  3RN5 A;  1P8L A;  3H3V H;  5ELN A;  4GLA C;  3RLN A;  2A19 A;  2VQF Q;  1CUK A;  1PYS B;  1PA6 A;  4AQY L;  4YY3 Q;  4B3R Q;  1WCM G;  3B6Y A;  3F8T A;  5FJ8 G;  4OO1 I;  3WWV A;  4A3C H;  4X64 Q;  1L1O C;  2NZH A;  2WAQ G;  3EBE A;  4DV1 Q;  5M3F H;  1XNQ Q;  5IP9 G;  1L1O A;  2CKZ B;  2F4V Q;  3KF8 B;  1KQS A;  4LF4 Q;  4HIK A;  3PV0 A;  1IL2 A;  1EYG A;  1IBK Q;  2D62 A;  3J7A 5;  4HJ9 A;  4X62 L;  5IY0 A;  1KL9 A;  3ZJY C;  1O7I A;  1Q82 C;  1TWG H;  4DR1 Q;  4A3G G;  1V43 A;  1Y1W G;  1YHB A;  1VQA A;  4GLV B;  4MZ9 A;  2JEA I;  1VQH A;  1X55 A;  4HJA A;  3M4Q A;  4JBW A;  2LXJ A;  3CCE A;  2YTX A;  4IFD J;  1GM5 A;  1NJI C;  1G29 1;  3I4N H;  2N8N A;  3A5U A;  2ZJQ A;  1SR3 A;  1W2B A;  3H3V I;  2JA6 H;  3OYY A;  3GTP H;  3M3Y H;  4A93 H;  2Z6K C;  3J7Z C;  5IYD H;  2EXD A;  4A3K G;  1X65 A;  3STB D;  1YVC A;  1ASZ A;  4HID A;  3F2C A;  4JOI C;  1JMC A;  4JI6 Q;  2K5H A;  3T1Y Q;  1Q86 C;  2CCZ A;  1SN8 A;  3BZK A;  4PMW A;  5M3M H;  1BKB A;  2UU9 Q;  5C3E H;  2R6G A;  1NBW A;  1GKH A;  2VZA A;  5IYB G;  4O0A A;  4OXP A;  4LF6 Q;  3FKI H;  1T9H A;  5LMN L;  1YHA A;  4YWL A;  5GAD C;  3ERS X;  4YCU A;  4DR6 L;  3PUZ A;  1JJG A;  3K7U C;  1E7Z A;  4OWT B;  4A3E H;  1TWH H;  1TWA H;  3RLO A;  4AIM A;  3KDF B;  1KAW A;  3BU2 A;  2WP8 J;  3T1H Q;  2QA4 A;  3DLL A;  4LUO A;  4DR3 Q;  1MIU A;  2YYZ A;  3KFU A;  4UP8 A;  2DUD A;  2Q2T A;  5H1S E;  1PH8 A;  2ZTD A;  1MKH A;  3PO3 G;  1YNX A;  1FGU A;  2KCM A;  2XTI A;  2BA1 A;  3FKI G;  4AYB E;  1QUQ A;  2V1C C;  3UDI A;  5LMN Q;  4BA2 I;  1XNR Q;  3HOV G;  2R92 H;  2PNH A;  3GO5 A;  1SRU A;  1M1K C;  3S1Q H;  5GRO A;  2Q2I A;  3PIO A;  4QY7 A;  4IO9 A;  4IPC A;  3S24 A;  3I2Z A;  3CW2 C;  2MO0 A;  3A0J A;  3KF6 B;  3S14 H;  1XMO Q;  3HKZ E;  4QL5 A;  2PI2 E;  2WFW A;  4P73 A;  4R4T A;  2VQF L;  1XMQ Q;  1IBL Q;  1J6Q A;  4DR4 Q;  4IOC A;  4JBK A;  3PGZ A;  3K0X A;  3CCU A;  4DV5 Q;  4LFB Q;  2RCN A;  1Y1W H;  2KHI A;  1XNQ L;  4H02 A;  4B3T Q;  2BH8 A;  2PMZ E;  1N8R C;  5LMN W;  3TQY A;  4LWC A;  3KJP A;  1YI2 A;  1K8A C;  5C4X G;  2JEB I;  2K4K A;  2ZTE A;  4LFA Q;  1OXV A;  1G51 A;  2F52 A;  4DUY L;  1XTD A;  1OXS C;  1PYB A;  4GOP A;  4GLX A;  1CKM A;  5C0X G;  5M3F G;  3ULJ A;  3E0E A;  3PF4 A;  3I56 A;  1I50 H;  3TS0 A;  4B3S L;  1M90 C;  5FJ8 H;  1J5E Q;  3U4Z A;  1OTC A;  1I6H H;  3SGI A;  2FXQ A;  1IBL L;  3A74 A;  4NXM Q;  4QQB X;  2VNU D;  1L2F A;  1NMG A;  4BY1 H;  4BBS H;  1VQI A;  1JJC B;  3PUW A;  1RL2 A;  2H5X A;  4A3F G;  4DK3 C;  4LFB L;  3PO2 H;  1EQR A;  1I94 Q;  1N36 Q;  2PQA A;  1U5K A;  4B3M Q;  4OO1 G;  2K5V A;  3AFP A;  3F2D A;  1PH5 A;  3CCL A;  4BA1 I;  2UUB Q;  4R1J A;  1KHI A;  5FLM H;  1A0I A;  3CP0 A;  4PZ7 A;  1K9M C;  2UXD Q;  1XJV A;  1X54 A;  2OTL A;  3JAM i;  3CCQ A;  1VQ4 A;  3OTO Q;  3AYH B;  1YIJ A;  1VQM A;  3HFZ B;  4C2M H;  1EIY B;  3S2D H;  4LF6 L;  2IT1 A;  2VL6 A;  1VQE A;  1Q1E A;  4DV3 L;  2OCE A;  4BY7 H;  1VQN A;  4IFD G;  1V9P A;  1S40 A;  1UE1 A;  3H0G H;  1X3E A;  3NEM A;  3F2B A;  2YU9 H;  4LF8 Q;  1X6O A;  4DV0 L;  2JA8 G;  1Z47 A;  3PIP A;  3PF5 A;  4JI8 Q;  1PH2 A;  1WYD A;  1XPR A;  2UUA L;  3UDG A;  3MXN B;  3HOW H;  1N33 L;  4A75 A;  3S15 H;  3DM3 A;  3M9B A;  1PV4 A;  4DV7 L;  3BZC A;  1B8A A;  4BXX H;  4P74 A;  1OXT A;  1I5F A;  3HOV H;  1PVO A;  2E2J H;  2JA8 H;  3L7Z C;  4LF4 L;  2IHE A;  2Z0S A;  1CKN A;  5GQO A;  1GO3 E;  1VQ6 A;  2C35 B;  1VQO A;  2E2I H;  2E5L Q;  4BY7 G;  1AE2 A;  5FLX c;  4LW1 A;  2OQ0 A;  3NEN A;  3W1G A;  2KHJ A;  1QVC A;  2AKW B;  3KDF A;  4DV1 L;  4P72 A;  4A3L G;  4JYA Q;  4ME3 A;  3HOU G;  2R93 H;  4KHZ A;  1HZA A;  2RHQ B;  1EWI A;  1TXY A;  2MQH A;  4FDB A;  4BBR H;  4GKJ L;  1NTG A;  3EIV A;  3RLF A;  1LYL A;  5IYB H;  1VQ8 A;  2HHH L;  1YIT A;  1XNR L;  4RG1 A;  1X9N A;  4WJ4 A;  1IBK L;  3GTJ H;  2N78 A;  4GNX B;  3J80 i;  3RN2 A;  4LFA L;  2QGQ A;  1QUQ B;  3TRE A;  4A3D G;  3CPW A;  5BR8 L;  4A76 A;  2K50 A;  1AH9 A;  4DR7 L;  2R7Z G;  1PH3 A;  4JI1 Q;  5M5Y H;  1SE8 A;  1VQF A;  4DV5 L;  1UE5 A;  1PH6 A;  2CWA A;  3J80 c;  3CCS A;  2E5L L;  1YBY A;  3IRB A;  4TVA B;  3S17 H;  2HIX A;  3KYH C;  4OWX B;  3CCJ A;  3K7A H;  4DR6 Q;  2I0Q A;  3FHW A;  4LF7 L;  3TS2 A;  1JE5 A;  1VQK A;  1L1O B;  3J81 c;  1HR0 Q;  4X65 L;  5AJ3 Q;  5JEA J;  1Q46 A;  4WJ3 M;  1A63 A;  1EUJ A;  4DV2 L;  4P71 A;  4QJF A;  2AMC B;  4LF5 Q;  1V1Q A;  4Y7N H;  3ULP A;  1N34 Q;  1Y14 B;  3FP9 A;  3G6E A;  4OX9 L;  3AEV A;  5LMU L;  1VQP A;  3HOZ G;  4A3B G;  2HQL A;  1C9O A;  3K81 C;  3K8A A;  1HZ9 A;  3HOY G;  2E2H H;  4JG2 A;  4Y52 H;  3HOZ H;  1PH7 A;  4DUZ L;  3OTO L;  4NB3 A;  4DV3 Q;  1K83 H;  2IX1 A;  5IP7 G;  3PUX A;  1VS0 A;  3I4M H;  1I3Q H;  2ALY B;  3T1H L;  4L5Q A;  2HT1 A;  1KIX A;  3HKZ G;  1QZH A;  1WI5 A;  2R92 G;  2QEX A;  1P16 A;  1BBU A;  1MJC A;  1C0A A;  3MEF A;  4LF8 L;  3GTM H;  5HY6 A;  3KJO A;  2PQA B;  4A3M H;  3ICE A;  4JI4 Q;  2VS1 A;  1WOC A;  4X66 Q;  1VQB A;  4JCV E;  2WB1 E;  1SLJ A;  5C44 H;  4OX9 Q;  1KRS A;  1HJP A;  4DV7 Q;  4NPS A;  1IXR A;  1X56 A;  3PUY A;  3GTK H;  2VUM G;  1E24 A;  4GN4 B;  1HR0 W;  4JI7 Q;  2GVA A;  3I55 A;  2XGT A;  2BH2 A;  2VUM H;  2ES2 A;  5C4J H;  1N32 L;  2R7D A;  4A3E G;  3L0O A;  2UUA Q;  4B3T L;  2HIV A;  4LUZ A;  2B29 A;  1Z9F A;  3HOU H;  1DGS A;  2JA9 A;  1GVP A;  3I7F A;  3CQZ H;  4MNO A;  2NVX H;  1D7Q A;  2I5H A;  2JE6 I;  5M3M G;  3AQQ A;  3JAM c;  1HNZ L;  1VCI A;  1YEZ A;  4JYA L;  4C3J H;  4AH6 A;  5M5W H;  4DR5 Q;  2PI2 A;  2CWP A;  5ELO A;  4LFC L;  4A3K H;  3UE1 A;  4C3H H;  1S72 A;  3K80 C;  1LTL A;  5IYD G;  2UXD L;  4UP7 A;  5IP7 H;  4UY8 C;  4IPH A;  5JJI A;  3I4N G;  3KOJ A;  5BR8 Q;  4BXX G;  3U4V A;  2VQE L;  4EQ5 A;  5IWA L;  4JI0 L;  4X6A H;  4JI1 L;  3HOY H;  3CMA A;  1FJG Q;  3LGJ A;  3F1Z A;  1K73 C;  2OTJ A;  5JJL A;  4POF A;  4JBM A;  2EQS A;  4B3M L;  1YJ9 A;  4A3B H;  1B7Y B;  2MO1 A;  3PUV A;  1EIF A;  2GN5 A;  2F3I A;  3CCV A;  1X3F A;  3CCR A;  4JOI A;  4JV5 Q;  4O2D A;  3J81 i;  1PFS A;  4PZ6 A;  1HNX Q;  1OXU A;  3I4O A;  2UUC Q;  2JJQ A;  1QVF A;  1BBW A;  1HH2 P;  3GDE A;  4LF9 Q;  5M5X H;  4LFC Q;  1NE3 A;  1CKO A;  4DPG A;  1KC8 C;  1K8G A;  4POG A;  4GOP B;  1BVS A;  2B63 G;  1N34 L;  1WCM H;  4A3J G;  2VQE Q;  2R7Z H;  1U0L A;  4DV0 Q;  2NVY H;  4JBJ A;  5IE8 A;  5FLM G;  3HOX H;  3U58 A;  4A3D H;  2ZM6 L;  2CQO A;  4DV6 Q;  1B70 B;  4UP9 A;  4DUZ Q;  1XMQ L;  4L5R C;  1WFQ A;  3CXC A;  2JA7 H;  1N33 Q;  1HNW L;  3HOX G;  2D0O A;  4A4I A;  4A3F H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...