2ZM6L

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
total genus 10
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2zm6L00
1Q8KA 4R1JA 4JBKA 3SGIA 2MQHA 3I4MG 1Q1BA 4DUYQ 4OWXB 4DUZL 2JEAI 3RLNA 1YIJA 4DR7Q 4NXML 4B3TQ 3H3VI 3S1NH 3OTOL 4DR4L 4A3LH 4YWKA 3BU2A 4DK3C 2F4VQ 3PUVA 1YJ9A 3CCQA 4DAYB 1VQJA 4LF7L 1XNQQ 3GO5A 4OO1G 3PF4A 2E2HH 2UXDL 2A8VA 4A3DH 4NXNL 1A0IA 1WCMH 3NENA 2R7DA 2MNAA 4LF5Q 3FKIG 4GS3A 4JI4L 1Q7YC 1TWCH 4JOIA 5BR8Q 4YCUA 1XPUA 1L1OA 3CCVA 4C2MH 1CKNB 1WOCA 1JB7A 4JI6Q 1HZ9A 1A62A 2N49A 1M1KC 3HOVH 1QVCA 2NN6G 1X65A 2AKWB 4APVA 3S2HH 4A3EH 3AQQA 4A4IA 4DKAC 5IE8A 2GVBA 3A74A 1VQ4A 4Y52H 1OXXK 4JI1Q 1XMOL 1VQNA 2K75A 1SLJA 3GTMH 4LF8L 5EAYA 4YY3Q 1IBKQ 3G4SA 1VQ7A 4BBSG 3M4PA 3MXNB 3J81c 3HFZB 1EFWA 1J5EQ 3TREA 3AYHB 4GLAC 3KF8B 1YZ6A 1WI5A 2RF4A 3J81i 4AYBG 3CF5A 3I4OA 1N34L 3PO3H 4X6AH 4LF9L 4LF5L 4IJHA 4HIKA 5IYDG 4QGUA 2JA7H 2VY3A 1DGSA 4A3JG 1HJPA 5IWAQ 4HIOA 4X65L 4IJLA 1UE7A 4DV5L 4GNXB 3CMAA 1C9OA 4OO1I 3CP0A 3I4MH 1PH2A 1PH4A 1W2BA 1PA6A 1TWFH 3EBEA 1N33Q 3S2DH 4P74A 1IBKL 1MKHA 1YHBA 5LMNL 5K36G 1JJGA 2N78A 2WP8J 1XTDA 4LNQA 1NMFA 5IP9G 3T1HQ 3A5ZB 3UDIA 3CCMA 2N3SA 1VQMA 4BBRG 2R93G 3DLLA 4JI7Q 1FVIA 2E2IH 3FKIH 3KFUA 2QGQA 2CQOA 1X3FA 2UU9Q 4BY7G 1CSQA 3CCEA 2JA9A 2L15A 3HKZG 4DR3Q 1X3EA 1CKOA 3K0XA 2E5LL 4L5SA 1Q12A 1VQ5A 2R92G 1KRSA 2JE6I 3AFQA 3KJOA 2WB1E 2D0PA 3F1ZA 1WYDA 4LFBL 2VW9A 4X64Q 2K4KA 1XPOA 3GDEA 5GROA 2JK8A 1VQOA 5JEAG 4R4CA 1VCIA 4BBSH 1XPRA 1E24A 1C0AA 4JBWA 4JI5L 1A8VA 1OXSC 4P71A 4A3KG 1Q86C 1KRTA 2UUAQ 3KDFB 3S1QH 1N32L 4DV3Q 2QA4A 3HOYG 5JEAJ 1AE2A 2H5XA 1BBWA 1I94Q 1X54A 4DK6C 1YI2A 1BBUA 4WJ4A 5IYCG 3H15A 5IYDH 4A3JH 4JYAL 2UU9L 1FGUA 2F3IA 2HIXA 3KF6A 4POFA 3RN2A 2BH8A 1HNWL 1Z47A 1V9PA 1VQCA 4GOPC 4P72A 3S1RH 2VQFQ 1RL2A 4DUZQ 1FJGQ 3HOWG 4IFDI 2K14A 2UXBL 1CKMA 5C44G 2DGYA 4NXMQ 3S14H 1VQ6A 4R4OA 1IBLL 3CXCA 2BH2A 3TS0A 3OTOQ 4JG2A 1NTGA 1HZBA 4DR4Q 1G291 5JJIA 4R4QA 2R6GA 1HZAA 4UPAA 2I5HA 3HOUH 1QUQB 3PCOB 4LF7Q 3AFPA 4DR6Q 4B3SL 3GTJH 4DR2L 1PH8A 3W5OA 2IHEA 1UE5A 2UXDQ 3M4QA 4LWCA 1VQPA 1Q1EA 5M3MG 3STBC 1K8AC 2BA0A 2K50A 2KBNA 3G48A 5IP9H 3I7FA 1S72A 4DNIA 3IRBA 4HJAA 4JI4Q 4KHZA 3FHWA 4BBRH 2R93H 3H3VH 1NE3A 2B29A 2PQAB 1V43A 4GOPB 1OTCA 2RHSB 3CCJA 4DV1L 2Y0SG 3CCSA 3CCLA 1W3SA 1G6PA 5C0XI 2VUMG 1VQDA 2K5VA 3CAMA 4GN3B 4DV4Q 4JOIC 3A0JA 4BY7H 2CWPA 2KHIA 1L1OC 1PH5A 3F2CA 2VQFL 1FJGL 1YHQA 4NPSA 2HHHL 3PUZA 3I55A 1PH6A 1PH3A 4DV6L 4IOCA 1XMOQ 2R92H 1PH9A 3E9HA 4LF8Q 1VQEA 4JBMA 4OX9Q 1N9WA 1P16A 2PMZE 4J15A 4AQYL 3KJPA 4K0KL 3PGZA 4QJFA 3W1BA 2K52A 1Y1VG 2Q2IA 4DR6L 3MEFA 2Z6KA 3F2DA 2E8GA 2IT1A 1N34Q 3CPWA 1BKBA 2CFMA 3G6EA 5LMNW 4A3KH 1YEZA 3NBHB 4LF9Q 4PZ6A 4A3CG 4LUZA 2ZTCA 2YTYA 1YBYA 4AYBE 5FJ8G 3HOYH 2OTJA 5IY0A 2ES2A 1L1OB 4X65Q 4XIGS 5GAEC 4X66Q 1VQFA 3I56A 2Q2TA 2K5NA 5IYCH 4DV5Q 4DV4L 1Y1WG 4UP7A 1ASZA 4IOAA 4KLKA 1IXRA 3J7A5 4AIMA 1VQKA 3HOWH 4QY7A 4GN5A 5C44H 1U0LA 4LFCL 2LXKA 4LFAL 1VQ9A 4OX9L 3ULPA 2YTXA 2QEXA 5LMNQ 3TS2A 4KI0A 2KCMA 3CQZH 1NBWA 1LUZA 2NZHA 2OTLA 4LW1A 4IFDG 1VQBA 2XTIA 1M90C 5JJLA 1SE8A 3ULJA 3WWVA 4JI2Q 5M3MH 4BXXH 3UE0A 1HNXQ 1HNZL 4BA2I 3K80C 1HH2P 1O7IA 3L0OA 3RR5A 4A75A 4IFDJ 4GKKL 2KHJA 1V1QA 1PV4A 4X66L 2UUBL 1VQIA 4OWTB 4JI8L 1H95A 3CCUA 1B8AA 2VUMH 2UXCL 1JE5A 1JJ2A 1B7YB 3GTKH 4JCVE 3RLOA 3HKZE 4A3MG 2E5LQ 3ZJYC 2RHQB 1AH9A 1D7QA 4JI3Q 4R4TA 4LF4L 4GN4B 3STBD 1TXYA 4GLVB 4HJ5A 1I5FA 1JJCB 5ELOA 1YITA 3HOUG 1X56A 1XNRL 4LFBQ 4IO9A 1TWHH 5C0XG 5GAHC 3ICEA 3U50C 4DV7Q 3D31A 2A1AA 4BY1G 4JI5Q 4X62L 1Y1VH 2NZOA 5C4XG 1N32Q 1KIXA 2JA8G 3UDXA 2ZJPA 1BVSA 3JAMc 5IT9c 5C0XJ 1OXTA 4JI2L 4A3CH 1HNXL 4HIDA 3JAMi 4HJ9A 1VQGA 1VS0A 5FJ8H 4GNXA 4JYAQ 3PSIA 3RZDH 1GM5A 1SROA 1X3GA 5AJ3L 4UP8A 1QZHA 4OXPA 1HNWQ 4IPDA 3HOZH 5FLMG 3OYYA 1GVPA 1XJVA 3TQYA 3PUYA 3VDYA 3U58A 2Q2UA 1E3PA 2NVQH 2UXBQ 1Y1WH 4KHPL 1SRUA 1IBLQ 2VZAA 4JI3L 5FLXc 4A93G 3D0FA 4LUOA 2MO1A 4YCWA 4IPCA 1EOVA 3S15H 4NB3A 4EQ5A 1N8RC 3M7NA 4B3SQ 1PYSB 4DR2Q 2K5HA 1MIUA 4DV7L 1A63A 3AEVA 5C4JH 2R7ZG 1S40A 2GVAA 3GTOH 5GAGC 3RZOH 4Y7NH 3ERSX 1QVGA 2AMCB 4IPHA 4YWMA 3T1YL 5ELNA 1VQAA 2KENA 4YHHL 4A3BH 3PIPA 4DV1Q 4B3RL 4A3FG 4TVAB 1XMQL 1KQSA 3KF6B 4O2DA 1KC8C 2WAQE 1GKHA 1HZCA 3F8TA 2Y0SE 1L0WA 5GADC 4BXXG 1X9NA 2PI2A 4MNOA 3L2PA 4L5RC 1EUJA 2HHHQ 3CW2C 3S1MH 1SMXA 4A3MH 4DV6Q 4HJ7A 4GKJL 4DV0L 4JV5L 4C3IH 1Q46A 4JBJA 4YWLA 4AQYQ 3PO2G 1CUKA 4K0KQ 4FDBA 1CSPA 4YCVA 1LYLA 2HQLA 3TEHB 4NXNQ 1QZGA 1EIYB 3BZKA 3L7ZC 4BY1H 1PFSA 5J3BA 1B70B 2YYZA 5C4XH 2JA8H 3M4OH 2ZTEA 2Z6KC 4QIWE 2ZM6Q 1AE3A 3I2ZA 3S17H 2VL6A 1UE6A 1EYGA 2CCZA 2WB1G 2MFIA 2JQOA 2EXDA 5FLMH 1S3OA 2JA5G 2OQ0A 4QQBX 2OQKA 2F52A 1UE1A 1FL0A 1L2FA 4LFCQ 4LFAQ 2OWOA 3B6YA 2KCTA 1X6OA 1GO3E 1VQ8A 2LSSA 4A93H 1OXVA 2I5MX 4A3IG 3EIVA 4LF6L 5GQOA 1I50H 4C3JH 4DAMA 1PYBA 2R7ZH 5M3FG 2YTVA 5HY6A 4BA1I 1HNZQ 2VNUD 1N36L 2B63G 4LUVA 2JJQA 1NMGA 2ZM6L 4DPGA 4HJ8A 1J6QA 3PUXA 4GLXA 2UUBQ 3ER0A 3HOZG 4JI8Q 4GKKQ 2ZTDA 1OXUA 1WJJA 4A3FH 2UUCL 2UXCQ 1K73C 2V1CC 2D0OA 1JT8A 1K3RA 3K7UC 1SN8A 2Q2HA 4JI0L 4DR5L 4LF4Q 4IPGA 1TWGH 1XNRQ 3RNUA 4WJ3M 3I4NG 1HR0Q 5IYBG 5DLQE 2AWOA 3PO2H 4RG1A 2B3GA 3J80c 4X62Q 4A76A 2ZJQA 4L5QA 4OONA 3J80i 3S24A 1EQQA 5LMUL 3E9IA 1IBML 1CKNA 4A3BG 2ATWA 3GD7A 1WFQA 2VQEQ 2IHFA 5AJ3Q 4DR1Q 3RN5A 1VQLA 2Z0SA 1Y14B 3KLWA 3M85A 4DUYL 4DR7L 3U4VA 1YNXA 1IZ6A 3ULLA 1UEBA 4GNXC 1PH7A 1U5KA 4B3TL 4B3MQ 4KHPQ 5JJKA 3J81j 4L5TA 3W1GA 2JA5H 1MJCA 4MZ9A 3UDFA 1C7YA 3S16H 3UDGA 1K83H 3BZCA 4PZ8A 2F4VL 5C3EG 2ASBA 1E1OA 1LM0A 1NJIC 1PHJA 2JA6G 1HR0L 1XNQL 1E22A 4POGA 3RLFA 2FXQA 4ME3A 4HIMA 3PF5A 2RCNA 4A3IH 2LXJA 1JMCA 2BA1A 3E0EA 4RMFA 2YU9H 4P75A 1EIFA 2HIVA 5IP7G 3GTQH 3Q8DA 5BR8L 2IX0A 3NELA 3T1YQ 5M3FH 4YHHQ 4JI6L 2EQSA 2A19A 1LTLA 2AWNA 2DUDA 2GN5A 3LGJA 2B63H 4B3RQ 1I6HH 1XMQQ 2ALYB 2VQEL 4DR1L 1E1TA 2NVYH 1E7ZA 1EWIA 1IYJB 3K81C 4B3ML 1D8LA 4JI1L 2HT1A 4DV2Q 3GTGH 4GKJQ 4DV0Q 3PUWA 4JV5Q 1PVOA 4YY3L 4OWWB 4TQUS 1YVCA 1KHIA 4XTCS 3HOXG 1MJEA 3J7ZC 3H0GG 1Q82C 1J5EL 4A3GG 3I4NH 5IYBH 3K8AA 2VS1A 4H02A 4R4IA 3CCRA 3DM3A 4P73A 2E2JH 2EIFA 2PNHA 1GD7A 5IWAL 1X55A 3M9BA 3GTPH 4O0AA 1G51A 5HGQA 2I5LX 5M5YH 2ZJRA 3KYHC 3TRZA 1KL9A 5M5WH 1KXLA 4A3LG 1RIPA 1ASYA 1YJNA 1YHAA 4ALPA 3CC2A 3PV0A 4AH6A 4DV2L 3CMEA 2NVTH 1N33L 3CC4A 5M5XH 5C3EH 2YV5A 4PMWA 4A3DG 2NN6I 4MTNA 1K9MC 1WCMG 3GTLH 2JA6H 3T1HL 4LF6Q 4EX5A 3F2BA 3KDFA 5H1SE 4UY8C 2ID0A 1KAWA 2AHOB 2CKZB 2JEBI 1SR3A 2C35B 4JI7L 3CC7A 1IL2A 3OW2A 3CD6A 1N36Q 3G71A 3HOVG 2IX1A 5IP7H 2D62A 4UP9A 4C3HH 1PH1A 4DR3L 3BJUA 4A3EG 2XGTA 3HKSA 1Z9FA 2OCEA 1SFOH 1NY4A 1TWAH 4JC0A 2UUCQ 2WFWA 1T9HA 3K7AH 4PZ7A 1QVFA 2CWAA 2PI2E 3EN2A 1KD1C 3KOJA 4JI0Q 4DR5Q 1VQHA 4PG3A 4X64L 1K0RA 2MO0A 3JC66 1R9TH 3M3YH 1EQRA 1QUQA 3PIOA 1YJWA 1P8LA 2NVXH 3FP9A 3NEMA 3HOXH 1K8GA 4QL5A 1I3QH 3H0GH 3A5UA 3PO3G 2UUAL 4A3GH 3U4ZA 1Q81C 2IY5B 2JA7G 4DV3L 2I0QA 1UWVA 2N8NA 5E7NA 1HR0W 2R7FA 2PQAA 2WAQG 3UE1A 5LMUQ 4GOPA 1I94L 1IBMQ 3CPFA
chains in the Genus database with same CATH superfamily
1DXMA 1Q8KA 2XN9C 1SBBB 2EYMA 5JVH3 1RF2D 4DR7Q 3K7AB 3H3VI 3OTOL 5KEEA 1R9TB 4A3LH 4HEDA 4DK3C 3A7LA 3CCQA 4DAYB 2F0PA 2NYZD 2A69D 1CQVA 3PF4A 3ZYYX 2Q8IB 5I2XA 4ILWA 2A8VA 3E5SA 4NXNL 1HFGA 1A0IA 3NENA 3D4RA 3NBHA 2B2UC 1TWCH 5BR8Q 4YCUA 3SK8A 1WVLA 5DM63 1M1KC 3Q22A 3IL8A 2NN6G 3S2HH 2LY7A 1D5XC 1O7YA 5E1FA 1G2SA 3S1NB 1XMOL 3GTMH 1K8MA 2K75A 1SNOA 1EY4A 1TWGB 3G4SA 1VQ7A 3M4PA 2L55A 1H9RA 4RGTA 3KF8B 3QOJA 4JVZA 3SVMA 1CZGA 4KKTA 4AYBG 4LF9L 4LF5L 4HIKA 2EYFA 2JA7H 2VY3A 4A3JG 4C2MB 4HIOA 3HOVB 3KLSA 1WTXA 1W6KA 4A3EB 5FLXE 1QJOA 1RODA 2FJ2A 4KK7A 2DNEA 1PH4A 4CDCC 3EBEA 3NWTA 1N33Q 4P74A 1MKHA 5LMNL 5K36G 2TMPA 1QB5D 4K5WA 1J8IA 5IP9G 3DXJC 3PO3B 2EZVA 3CCMA 2N3SA 3GP7A 3NQIA 2X6LA 1D5MC 2UU9Q 4BY7G 3K5LA 2LFNA 2OT2A 1LTAD 4ZCKA 1CKOA 2E5LL 1A3UA 2OEOA 2PZWA 3L3OC 3SK5A 1VQ5A 1TWFB 3AFQA 4Q0FA 3S2DB 2WB1E 4K14A 3F1ZA 1XPOA 2JK8A 5JEAG 5I6WA 1JQYD 1XPRA 1E24A 3CRLC 2XWBB 4A3KG 3FKIB 4JK1C 5JEAJ 1AE2A 1JICA 4DK6C 5JJZA 4WJ4A 3QIAA 1HFNA 2F3IA 3PIO3 2NBFA 3RN2A 4DNRB 1HNWL 1V9PA 1EZ6A 2VNUD 2VQFQ 3TN2A 2IWHA 4IFDI 2K14A 3VA7A 3S14H 2DGYA 2A73B 2K05A 4R4OA 1NSNS 3FDTA 2PMZB 3TS0A 3OTOQ 5A2QE 1NTGA 3SK4A 5JJIA 5C4HA 1EIHA 1YNJC 3NXWA 2WV6D 2I5HA 3HOUH 1QUQB 4BBSB 4KTAA 4NKLA 3GTJH 4DR2L 3GTLB 3I8ZA 3S1QB 4NXNQ 5M3MG 3STBC 1K8AC 2KBNA 2K50A 1S72A 4HJAA 3IRBA 1ML0D 4BBRH 3H3VH 1V43A 1G6ZA 2RHSB 1G6PA 1EIGA 3T4AC 2VUMG 3CAMA 4GN3B 4FNFA 5IT9L 1SFOB 1BBXC 1H9MA 2CW0D 2WACA 1L1OC 3P75A 3F2CA 4KY6A 4DV6L 1XMOQ 2R92H 1PH9A 3E9HA 1VQEA 3KBGA 2BOSA 3D4WA 4K8JA 4L6TB 2A6HC 1V1OA 4QJFA 1STEA 2Z1CA 2PCFB 2Z8LA 1X3QA 2MJ8A 2NWGA 3VYUA 2CFMA 4ZKCB 3G6EA 2E74C 4LF9Q 3NBHB 2R93B 2YTYA 4AYBE 5FJ8G 1BF4A 2ES2A 4X66Q 1VQFA 3I56A 2O5IC 3MZ5A 5FK9C 3W3AA 3HKZB 1CTMA 3HZXA 4KLKA 3J7A5 1VQKA 3HOWH 5C44H 1EWHA 1JWSD 1CHQD 3TP6A 3ULPA 2HCCA 5LMNQ 4RHRA 5EPLA 1F2MA 2MP1A 3U9OA 1M90C 5JJLA 1SE8A 3UE0A 1HNXQ 2MGSA 3HOYB 1JORA 3DEOA 1O7IA 5I9OA 4A75A 2UUBL 1VQIA 4JI8L 2R61A 1SE3A 4ME5A 1B8AA 2VB2X 3S2HB 2A68C 2UXCL 3CKIB 1WD1A 1LTTD 2ZXRA 4JCVE 2E5LQ 2Q8RE 1D7QA 2NTSA 1EY7A 3GTMB 1EQTA 2EJFC 4FF1A 5C0XG 5GAHC 3U50C 3QG1A 5FOBB 4X62L 3UDXA 1BVSA 3QOLA 5C0XJ 1AZQA 2JA7B 1LT6D 1V1PA 2BE5D 1WTQA 1TVXA 3NTHA 4HIDA 1KLUD 2MUYA 1GUNA 1HNWQ 4UP8A 4OXPA 1Z6HA 3HOZH 5FLMG 3OYYA 1XJVA 3TQYA 3D8GA 1Y1WH 3BVMA 2OXPA 2H4OA 2BDNA 2VZAA 1IKMA 2A74C 3D0FA 5I9PA 2MO1A 4IPCA 4NB3A 5EPJA 3M7NA 1IW7C 1PYSB 2M00A 4DR2Q 2R7ZG 5C4JH 3RZOH 1QVGA 1WTRA 1HXYD 4IFDH 3ND9A 5ELNA 3PIPA 3W2DA 4DGZA 1SYCA 1XMQL 4FF3A 3P20A 4B9WA 2NVQB 1L0WA 2C5CA 2PI2A 1STGA 2J7ZA 1B3AA 1YNNC 4DV6Q 1LTRD 4GKJL 1SJED 4QB4A 1PDQA 3S15B 4JBJA 4FDBA 2IPKD 1EFID 1Q3LA 3BZKA 1EIYB 4RWSC 4BY1H 1PFSA 1B70B 1IHZA 2G5DA 2YYZA 5C4XH 2JA8H 3VR4A 2ZTEA 5D65A 1PRTC 3A8JE 3S17H 1HRJA 2VL6A 5EKLA 1UE6A 2ZT9C 2CCZA 2F0LA 1E2ZA 1STBA 4XT3B 2MFIA 4K2LA 1VF7A 4S3SA 4A3MB 3OPOA 4C3IB 1UE1A 5CGKA 2RDFA 1RHPA 2OF1A 1GO3E 3J80E 3HOUB 4A93H 3V96A 3X3NA 3J7AF 1I50H 2CQAA 5CORA 1PYBA 2F0SA 3I3CA 3K5MA 1N36L 3VR5A 2HDMA 3VYSA 2ZM6L 4HJ8A 2UUBQ 4JI8Q 1OXUA 4XQJA 1GOZA 1BDOA 5JOBA 2UUCL 1NR4A 1K73C 2UXCQ 3I91A 2R92B 4JI0L 1C4QA 4N8FA 3EQLC 4RKLA 1HR0Q 4G7OC 3OIQA 2PO4A 5DLQE 5HURA 3Q6SA 4X62Q 4A76A 2LKVA 1L0XB 4L5QA 2MHVA 4MN3A 1CKNA 1GUTA 2PZUA 3PQIA 4DR1Q 4A3FB 1ZXTA 1VQLA 2Z0SA 3M85A 1IZ6A 2F0UA 1UEBA 3BZDB 4GNXC 1PH7A 3HOWB 3J81j 2JA5H 4HAEA 3SK6A 4NDXA 5C3EG 1E1OA 1LM0A 1E2VA 1XNQL 2B2UA 4POGA 2FXQA 3EFXD 2V4DA 4A3IH 2PQEA 1ZYRC 4P75A 5IP7G 1F9PA 5K5PA 3Q8DA 1V1PB 5M3FH 2DUDA 2B63H 2GN5A 1XMQQ 1TY2A 2ALYB 2AQ2B 3N52A 1G91A 2AUJD 3K81C 2F0TA 1BCPB 4JI1L 4DV2Q 4GKJQ 2L12A 4YY3L 1MJEA 3PIP3 4KV6A 2VS1A 3NSWA 5EJWA 3CCRA 1H9KA 1SE4A 4P73A 4CDFC 1EOTA 2Z6BA 3KBXA 3T53B 2B2VC 4G7ZC 4JPBW 3GTPH 3K5NA 4H44C 5M5YH 2DY8A 1I4XA 3HOZB 4CBVA 3KYHC 5CV4A 5DAUA 1KL9A 4A3LG 1RIPA 2O4XA 1YJNA 1IKLA 5CV8A 4R8IA 3MAQA 3IFTA 3CC2A 1UEAB 3P1HA 2ICIA 2HUGA 5LL6S 2WINB 4PMWA 4MTNA 4QCLA 1ZKOA 4R9WA 4BWGB 2JEBI 3OW2A 1N36Q 1PTOC 2D62A 2OCEA 5AFWA 1NY4A 1TWAH 4JC0A 2UUCQ 5M5WB 1HPCA 3K7AH 2SOBA 4CJ0B 1M4VA 3K59A 1KNEA 2NVTB 2CH4W 4JI0Q 1VQHA 4PG3A 5M5XB 2MO0A 4KJOA 1R9TH 2IX3A 1EQRA 4U673 2JA6B 3NEMA 2JA7G 4DV3L 1SJHD 3NPPA 1NNXA 2N8NA 5C4XB 3CPFA 4KD4A 3T13A 1DZ1A 1Q8IA 1SMYD 2F4IA 1BXTA 4DUZL 3V05A 1YIJA 2SNMA 1A3TA 4NXML 3S1NH 1EY6A 4DR4L 1CHPD 3OW7A 4I7ZC 4FYDA 4LF7L 1XNQQ 2PYKA 1I50B 2KCCA 2ICEC 2EYJA 1L1OA 4C2MH 1CKNB 2B39A 3HOVH 5C4ZA 1O7ZA 1QVCA 4PMBA 4A3EH 4TRDA 3AQQA 1A2TA 3A74A 1VQ4A 2PZTA 1SNQA 4JI1Q 4Y52H 1VQNA 1O80A 4LF8L 2RSOA 4YY3Q 1IBKQ 1R4QB 2NUCA 5BN3A 2E2HB 3AYHB 3CU7A 2F0NA 5IT9E 4K8IA 1YZ6A 1WCMB 2RF4A 5ELBA 1N34L 3I4OA 3PO3H 1PFMA 4DF7A 1EYAA 1PFNA 1DGSA 2B2YC 4J1MA 5EKIA 1EYDA 1MI2A 2QW7A 4IJLA 3SE0A 2FMCA 4DV5L 3CMAA 1A2UA 3QO2A 4OO1I 4Z9CB 3I4MH 3TSSA 3L9AX 4HCEA 1PH2A 2A5HA 1W2BA 1I4GA 4KKSA 1PA6A 1TWFH 5I4DA 3S2DH 5NUCA 2G9DA 4U68A 1B1ZA 4ZKBB 1EQVA 4V190 2JSOA 1JJGA 2N78A 2WP8J 1ICWA 1EL0A 1EU3A 1H9SA 4N9PA 4A3IB 1VQMA 4BBRG 2PPBC 4G4KA 1PTOF 3FKIH 5M3FB 1ONLA 2CQOA 3CCEA 1X3EA 3NBIA 3MA2B 1PZKD 2R92G 2F3VA 2VXWA 3C1EA 1S4ZA 2D0PA 1WYDA 2RDHA 5IODA 1VQOA 3ERQA 4R4CA 3CRKC 1VCIA 1O7LA 4BBSH 4JBWA 1KTKA 4JI5L 1OXSC 1KNAA 1VMCA 3S1QH 4DV3Q 1S5BD 4ABNA 3J81L 1RKNA 1PLFA 1BBUA 1YI2A 5IYDH 4XQNA 2RBMA 2UU9L 2CHBD 3KF6A 1CI3M 2ZXOA 1Z47A 2K01A 3S1RH 3HOWG 2EYLA 4DUZQ 5C44G 4NXMQ 2K32A 1VQ6A 1IBLL 2NB0A 3CXCA 4ZK9B 5L37A 4DR4Q 3I70A 1G291 4R4QA 4WJWA 3PCOB 4LF7Q 3AFPA 4DR6Q 2O5JC 5CYUA 1VQPA 3DWQA 2BA0A 3G48A 3C3LA 3I7FA 2A68D 5ELCA 4DNIA 3FHWA 2R93H 1SSOA 1WTVA 1DCZA 3CCLA 3CCJA 4DV1L 3T16A 5IOCA 1K0SA 4DV4Q 3A0JA 4O42A 1TWAB 2CWPA 1PH5A 2VQFL 2H1EA 3PUZA 1PH6A 4GZYC 4IOCA 2QCPX 4LF8Q 4KJNA 1N9WA 1P16A 4J15A 1BCPF 4AQYL 3KJPA 4K0KL 3PGZA 3QWNA 4H7BA 2I46A 5C5LA 3F2DA 2IT1A 1N34Q 3MFYA 4LUZA 1FGBD 2ZTCA 1YBYA 5CBAE 3HOYH 2OTJA 1L1OB 5GAEC 2E76C 5IYCH 4DV5Q 1Y1WG 4UP7A 4AIMA 4QY7A 4QMGA 4GN5A 1U0LA 2LXKA 4LFAL 2QEXA 5CC4A 4HSVA 2XRSD 2NZHA 5BN4A 4LW1A 4IFDG 2KA7A 4OO1H 4JI2Q 3GV3A 1KDBA 4BA2I 4N9TA 1YNND 3L0OA 3OHXC 4IFDJ 4GKKL 1V1QA 2K03A 4X66L 3MWYW 1H95A 1CM9A 4ZUJA 1JE5A 3DWAA 1WTOA 3ZJYC 4Q5VA 1AH9A 4JI3Q 5EKKA 4LF4L 4GN4B 4NP5A 4GLVB 4HJ5A 2F1MA 1JJCB 1YITA 1X56A 4IUNA 3T51B 3OOCA 1I6VC 4DV7Q 4CHTB 4JI5Q 4BY1G 3AU7A 3HGBA 1KIXA 2JA8G 5C4XG 3JAMc 1M8AA 5F2DA 2FHTA 1OXTA 4A3CH 1HNXL 5KNCA 1RJTA 3JAMi 4HJ9A 4GNXA 2Y0SB 3VYTA 1SROA 2JP1A 4IPDA 1DM0B 3U58A 1SEBD 3VDYA 2NVQH 3I4MB 4KHPL 2P5ZX 1IBLQ 1VMPA 5KRUA 4FXGC 2EOTA 2M2LA 2SDFA 4A93G 1TWHB 1EOVA 3S15H 2DJGC 1N8RC 3RUZA 1Y1VB 1MIUA 2GVAA 1F77A 4QIWB 1KDAA 2AUKA 1VQAA 2MPMA 4A3BH 4DV1Q 3RZDB 2A6ED 3SHLA 1QWYA 1WTHA 3KF6B 4O2DA 5CBEE 2WAQE 1KC8C 3F8TA 4E6IA 5C5MA 5T1GA 3L2PA 4FXDA 1SMXA 4A3MH 4HJ7A 4DV0L 1R4PB 4C3IH 1BR9A 1PXUA 4YWLA 1VDZA 4AQYQ 4K0KQ 1CK1A 1LTID 2HQLA 3TEHB 3GTOB 2B2VA 1PTOH 2E75C 5E3FA 1AP0A 3BG3A 3QB3A 4WORA 3I2ZA 5CV7A 5D3DA 3S1RB 4DK1A 2EXDA 4DA2A 1S3OA 2JA5G 4QQBX 1DOKA 3QR8A 1FL0A 1Y8OB 4LFAQ 2OWOA 2KCTA 3AMUA 1X6OA 1VQ8A 3OIPA 2D5DA 4IN3A 2AQ3B 5IGEA 3ND8A 4A3IG 3OWFA 5M3FG 2YTVA 4BA1I 2B63G 2JJQA 1TS3A 1TIID 4GKKQ 4GLXA 1NAPA 1STNA 1WJJA 4A3FH 3K7UC 3BS1A 4DR5L 4LF4Q 1RTNA 5ELFA 1NR2A 3J80c 3OMGA 4C3JB 2FINB 2XIWA 3J80i 3S24A 1JCKB 1O78A 3MC0B 4OGQC 3GD7A 1WFQA 2VQEQ 3RN5A 1FR3A 4XDXA 3U4VA 4RFBA 4WRDA 2J4XA 4B3MQ 4KHPQ 5BN5A 1MJCA 5C3XA 5ISRA 1K83H 4LK1C 4DNTB 4OHJA 4IZ8A 1PHJA 2F0VA 2EJMA 1HR0L 3PO2B 1PTOD 3RLFA 4HIMA 3E0EA 4IUTA 4F8MA 5A35A 2A19A 3LGJA 1I6HH 4DR1L 5CV9A 1E7ZA 1EWIA 1IYJB 1D8LA 2HT1A 3TZDA 3N6RA 3S16B 3GTGH 4DV0Q 2EY5A 3PUWA 4K5XA 1HUNA 4TQUS 4L63B 1YVCA 4XTCS 5C6AA 3EROA 2B2YA 3K8AA 3DUZA 4N8X1 4LJZC 4I65A 5IGFA 4RGMA 2A69C 2EIFA 5JPMC 1S5FD 1G51A 5HGQA 2I5LX 2NVYB 3H09A 5M5WH 1STHA 1KXLA 1ASYA 1TT2A 3PV0A 4DV2L 2NVTH 2EY6A 3CC4A 1JWUD 2R3ZA 2NTTA 5M5XH 3I4NB 2YV5A 2JA6H 3EA6A 4DU9A 4CGYB 1F2LA 4UY8C 2ID0A 2CKZB 2E2JB 1SR3A 4JI7L 3CC7A 5E4WC 3HOVG 4DFAA 3FVQA 4A3BB 2RKSA 5KNDA 4UP9A 4C3HH 4KY5A 4DR3L 4A3EG 2XGTA 3MXPA 1Z9FA 1B9NA 1K28A 3K57A 2B2WC 2JXMB 1BCPD 3EN2A 1NUCA 4DR5Q 2F0JA 1MGSA 4HMJA 1P8LA 5E4XA 4QL5A 1I3QH 1A3VA 3H0GH 3PO3G 2UUAL 1K8OA 1HCZA 2IY5B 1PTOB 2KQ3A 3UE1A 3KUPA 2PNRC 3D4DA 5D3IB 4K6DA 2B2TC 4R1JA 2MQHA 3K0YA 3I4MG 1Q1BA 4OWXB 1AZPA 3FPUB 5J39A 4IUQA 2EE1A 3J81E 3BU2A 3PUVA 3G7LA 3HOXB 3GO5A 2E2HH 4A3GB 4A3DH 4PNYA 1WCMH 1LTBD 2R7DA 3FKIG 3MTSA 1ICFB 1D1KA 1WOCA 5I2YA 1JB7A 2N49A 3AB9A 2B8FA 3O13A 1H9JA 1X65A 1SYEA 4APVA 1TU2B 4A4IA 3R93A 2GVBA 4BS9A 1OXXK 1SLJA 1U4PA 4BBSG 3HG9A 2IL8A 3P7JA 3HFZB 1EFWA 3TBIB 1CA6A 1QG7A 4DXGA 1WI5A 3SEBA 1ET6A 3CF5A 4EQOA 4X6AH 5IGCA 4IJHA 3WOEA 5IYDG 4QGUA 1HJPA 2B8GA 4X65L 1UE7A 1KLGD 1C9OA 3CP0A 2WB1B 4R8NA 4ZUIA 1K83B 1JOOA 2CW0C 1IBKL 5J1ZA 3HEJA 5CV5A 1PYWD 1B2TA 2XWJB 1BO0A 1XTDA 4LNQA 3MFGA 3A5ZB 3UDIA 2R93G 3I72A 5A2QL 1MHWC 4EQNA 1FVIA 3DLLA 4JI7Q 1PRTF 2WAQB 5C3WA 2QGQA 1X3FA 5TSSA 2SNSA 5JVG3 1I6HB 2L15A 3D3RA 3HKZG 4DR3Q 2Z4IA 3K0XA 1D6EC 1Q12A 1KRSA 3VA5A 3GTGB 2QEJC 4LFBL 1SYFA 2K4KA 2Z9HA 3KLRA 5EBDA 1A8VA 2UUAQ 3TP7A 2QA4A 3HOYG 2E2IB 4PQXA 1B3QA 1SXTA 4F87A 5IYCG 1EY5A 2K7VA 1FGUA 2BH8A 3DM1A 4GOPC 4P72A 3NHHA 1FJGQ 4XYOA 1CKMA 2DNCA 2BH2A 1HZBA 2R6GA 1HZAA 1UAPA 4DN4M 4LMQD 1PH8A 3W5OA 2IHEA 1UE5A 4LWCA 4OO1G 1Q1EA 4C1NK 2EY1A 2WKDA 4AYBB 3J7YW 4ID6A 3IAYA 2B29A 2K33A 4A3JB 1OTCA 4OIKA 4RA8A 5FO7B 4C3HB 1D1IA 1EEID 3H3VC 2K5VA 2N55A 4JOIC 2F0DA 3JAML 1EY8A 2RDGA 2BE5C 4RGNA 1TY0A 1YHQA 4NPSA 2HHHL 3I55A 4ZQ3A 2EYHA 3IFDA 5CV6A 1II3A 3A54A 4JBMA 4OX9Q 2PMZE 5ELDA 4PMCA 1RCVD 4DR6L 1XTCD 1I3QB 3H0GB 1JB3A 1TKWB 4IUUA 4I7AA 4B08A 5LMNW 4A3CG 4PZ6A 1XYIA 5FO9B 1E0BA 5IY0A 3RD4A 4X65Q 4XIGS 4J8QA 2Q2TA 2K5NA 4BY7B 2E2DC 2EXZA 2N88A 4DV4L 3E3XA 1ASZA 1LACA 1IXRA 3D6CA 4P2CB 4RH6A 4EGVA 3G6JB 1VQ9A 3TS2A 1ET9A 2KCMA 3A7AB 1LUZA 4OIJA 2OTLA 4A3DB 2XTIA 4A3KB 4ZYSA 1HQRD 4BXXH 3WWVA 1CT1D 1HNZL 3S9WA 1CZWA 3RR5A 4EVOA 4OWTB 2XRQD 1DOMA 3CCUA 1YNJD 4CJ2C 1JJ2A 1B7YB 4A3MG 3HKZE 4HSPA 2RHQB 4C3IG 4R4TA 3STBD 1TXYA 1TS4A 4LFBQ 3HOUG 4DXFA 1XNRL 1TWHH 3KF8A 3ICEA 3X3MA 4WFN3 2A1AA 4RCOA 1Y1VH 2NZOA 5KYIA 1AN8A 3LWUA 1SDFA 2K5WA 4LAAA 5I6YA 4JI2L 1VQGA 3RZDH 5AJ3L 2VUMB 3GV6A 1RDPD 2RA4A 1GVPA 3GTKB 3PUYA 3F2UA 1E3PA 2A6HD 1SRUA 4JI3L 5FLXc 3BDOA 1TS5A 4KN4C 4YIJA 4YCWA 1Q90A 2K5HA 4DV7L 1A63A 1KABA 1C48A 4B9XA 3GTOH 2AMCB 4YWMA 2F0KA 4YHHL 3J80L 2KENA 3C2PA 3T56B 2DN8A 4A3FG 1KQSA 5ELEA 1HZCA 1FD7D 1X9NA 4IUVA 4MNOA 4G7HC 2HHHQ 3CW2C 1SYDA 2F0GA 2XSCA 1ENCA 2K6AA 2KUMA 1KAAA 3URYA 1CUKA 4MIUA 1EWCA 1WTWA 1LYLA 3KLSX 4Y7NB 1ESRA 2O2LD 4OL7A 2Z6KC 4OELB 5M9OA 1EYGA 2WB1G 2JQOA 3WOFA 3S1MB 2OQKA 3NWSA 1UNSA 1WTPA 5KIXA 3DWPA 2LSSA 1OXVA 2I5MX 3C46A 3D6WA 4HMIA 5GQOA 3BDLA 5FO8B 4MHEA 4C3JH 4ZRZA 5EPKA 1HNZQ 3A8KE 4K5VA 4LUVA 2B2WA 1NMGA 5DNFA 3PUXA 2D2CC 3ER0A 3HOZG 1QCBD 2ZTDA 1STAA 1FNVA 3MXGA 2F0FA 2D0OA 1JT8A 1IW7D 1QOHA 2Q2HA 3KK7A 1XNRQ 2WKCA 1LTGD 1HA5A 3M7GA 1HHVA 2AWOA 3PO2H 2B3GA 2KJXA 1SNCA 2R7ZB 4OONA 2B2TA 1EQQA 1J9OA 5LMUL 3E9IA 2KEDA 5AJ3Q 3A8IE 1Y14B 4DUYL 1LABA 3ULLA 4B3TL 1U5KA 1T5XD 5JJKA 3R2IA 2ENBA 4L5TA 3UDFA 5HGTA 1C7YA 3S16H 3H91A 3UDGA 3BZCA 2F4VL 3M4YA 3MXNA 2JA6G 3ONAB 1E22A 4KMUC 1UUPA 1PRTD 4ME3A 3QJYA 3PF5A 2RCNA 3BDCA 1H9SB 3EJIA 2BA1A 4RMFA 2YU9H 1EIFA 2HIVA 2J0TD 2IX0A 3NELA 4C3HG 4YHHQ 4JI6L 3MXUA 2EQSA 1AEXA 4C56C 3I73A 2VQEL 2NVYH 3SDZA 4B3ML 1SMYC 4X3TA 4OWWB 1Y69U 3J7ZC 2AQ1B 3H0GG 1J5EL 3WDNA 3I4NH 5IYBH 4FO2A 4H02A 4R4IA 3TDQA 1FYCA 2F0WA 3DM3A 1WD0A 3GTQB 2F0IA 2E2JH 4CKCA 1GD7A 5IWAL 3M9BA 3A56A 4O0AA 2ZJRA 3VR6A 1FNUA 4IURA 3U9SA 4KN7C 1B50A 4AH6A 3CMEA 4CKEA 2RSNA 4A3DG 1TR5A 2NN6I 1WCMG 2KECA 3T1HL 1DYQA 1EY9A 4EX5A 1PZID 3KDFA 1IL8A 5H1SE 1KAWA 2AHOB 1U4LA 2C35B 2JN4A 1IL2A 3K6OA 4CDEC 1CQFA 2IX1A 4RAUC 1PH1A 3BJUA 4X3KA 3HKSA 1QNKA 4HTHA 2WFWA 4M1UB 1CA5A 1GUGA 4PZ7A 1GUOA 1ILPA 1QVFA 2PI2E 3KOJA 2DJFC 1ZYRD 4X64L 1K0RA 3Q23A 3M3YH 5C3EB 3FP9A 4G57A 3HOXH 1A6XA 3A5UA 4A3GH 1Y8NB 4K2KA 3R2TA 5J22A 3NQTA 2I0QA 1UWVA 1I4PA 1PRTB 5E7NA 2R7FA 2PQAA 1I94L 4GOPA 5LMUQ 1SAPA 2L9HA 1Y8PB 3FRPB 1F9RA 3HS0C 4JBKA 3SGIA 4DUYQ 4J6HA 2JEAI 3RLNA 4FF4A 4B3TQ 4ODGA 3OSOA 4IUPA 4YWKA 2K28A 4F88A 2F4VQ 1YJ9A 4X3UA 2NVXB 1VQJA 2L11A 2CVRA 2UXDL 1FNWA 2MNAA 2M9VA 4LF5Q 3OMCA 4GS3A 4JI4L 1Q7YC 1S5ED 4JOIA 4ULLA 1XPUA 4NW2A 3H6MA 3CCVA 4JI6Q 1L0YB 1A62A 1HZ9A 2IW3A 3VR3A 2FFKB 2I07B 2AKWB 4KKUA 4DKAC 5IE8A 1JC7A 1STYA 2C9OA 2DY7A 5EAYA 2GA4B 4ZAIA 3MXNB 3J81c 1J5EQ 1EY0A 1SYGA 3TREA 3JAME 4GLAC 2QKIC 3J81i 1E2WA 1PFBA 1TWCB 2D9UA 2F3WA 1V8QA 1F2YA 5IWAQ 2EPBA 3A55A 1I4RA 4GNXB 2L0CA 2EVBA 2F0MA 3NUCA 3ITPA 3DMUA 4F7XA 1B4OA 1YHBA 4KHVA 1NMFA 1W6JA 3T1HQ 4CKBA 2Q8TA 1ZEQX 2YU9B 2QDBA 2E2IH 3KFUA 1I4HA 1LT3D 4UHVA 2F03A 1CSQA 1JE4A 1LTSD 1QILA 2JA9A 2LMCB 5DM73 2NN6H 2JE6I 2K1BA 3KJOA 2VW9A 4X64Q 1S5DD 4O1NA 3GDEA 5GROA 3MEHA 1C8CA 1C0AA 3FEWX 2ZXPA 4P71A 1Q86C 1KRTA 3KDFB 1N32L 1B9MA 1EYCA 1SNPA 2H5XA 1BBWA 1I94Q 1X54A 1GJXA 4IALA 3H15A 4A3JH 4JYAL 2HIXA 4POFA 1PZJD 1VQCA 3Q24A 1RL2A 2UXBL 2F0QA 2KEEA 5JAVA 1ILQA 1JR0D 4JG2A 3R3OA 4UPAA 1MSGA 3Q0AA 1KDCA 3TZUA 4B3SL 1GUSA 1TS2A 5K36H 3I4LA 2UXDQ 3M4QA 4BXXG 1ENFA 4L5SA 5IP9H 3BYTB 3RMHA 4JI4Q 1U9RA 4KHZA 1SYBA 2HQEA 1NE3A 2PQAB 4GOPB 2Y0SG 3CCSA 3GQBA 1W3SA 1XXGA 3R8BA 5C0XI 1BOSA 1VQDA 1LO5D 4BY7H 1LLRD 2BDOA 2KHIA 1F9SA 3S14B 1FJGL 2RVLA 1PH3A 3K58A 2X6GA 1U4RA 3M3YB 4XYQA 3W1BA 2HCIA 2K52A 1Y1VG 1DJRD 2Q2IA 3GTJB 5FLXL 5JEAH 3MEFA 1AFPA 2Z6KA 1T5EA 2E8GA 3CPWA 1BKBA 4A3KH 1YEZA 4BBRB 1OO9B 1DD2A 3CHBD 5G3LF 4IOAA 3UI2A 1JOQA 2A6EC 1QE6A 4LFCL 3NE5B 4OX9L 3DEPA 2YTXA 3SXHA 1JOKA 4FXKC 4KI0A 3CQZH 1NBWA 3I90A 3LWEA 3FPPA 1VQBA 4UAIA 3SR1A 1EU4A 3ULJA 5M3MH 3J7AV 2X69A 4EQPA 3K80C 1GUWA 1HH2P 3MVVA 2KHJA 1PV4A 1MSHA 1NCVA 1BUVT 5EGTA 2VUMH 4PV1C 3GTKH 3E0JA 3RLOA 2WIIB 5C44B 2QILA 2K5QA 1EZ8A 5EQ0A 5T1IA 1I5FA 5ELOA 4XQQA 4IO9A 3LNNA 3HRZC 3D31A 1RD9D 5LHY1 5DEHA 5JPNC 2XNAC 5CR3A 1N32Q 4X3SA 2ZJPA 5IT9c 1K3BC 5LL6X 1TQOA 1VS0A 5FJ8H 4JYAQ 3PSIA 1GM5A 1X3GA 1QZHA 4FF2A 2UXBQ 1GHJA 2Q2UA 1X3PA 4KD3A 3FMCA 1BNZA 3EVQA 4LUOA 4EQ5A 4QUCA 4DAVA 4B3SQ 4C3JG 2EY2A 3AEVA 1BQQT 1S40A 1A15A 3HP3A 3DHQA 5GAGC 4Y7NH 3ERSX 4IPHA 3T1YL 4H0LC 1ESFA 2JYOA 4HR7B 4B3RL 4TVAB 1GKHA 2Y0SE 5GADC 5FKAC 4TKOB 1Y1WB 4L5RC 1EUJA 3S1MH 4TSSA 4JV5L 1Q46A 3V2TA 1MD2D 2SEBD 3PO2G 2QDLA 1CSPA 4YCVA 2KOLA 5C4JB 4FP5D 5C0XH 1QZGA 4NMZA 3RZOB 3L7ZC 4K6LA 5J3BA 2K5DA 2TSSA 3TP8A 3M4OH 4H13C 3NTIA 4QIWE 2ZM6Q 1AE3A 1X32A 2FMMA 2EYOA 1HA6A 2RQXA 4IQZA 1D2BA 1U4MA 2BCOA 5FLMH 4KY7A 3IKJA 2OQ0A 4UDUC 2F52A 1IYVA 1L2FA 4LFCQ 2RCFA 3B6YA 1F2ZA 1SE2A 1DOLA 1LV9A 5IGDA 3EIVA 4LF6L 1QNUA 4BY1B 4DAMA 4CDDC 2R7ZH 2JA8B 5HY6A 1PMRA 3S17B 4RCNA 4DPGA 1J6QA 2HD3A 3BYYB 1ENAA 2KHSA 4RHSA 3NK9A 1XX8A 2V1CC 1GHKA 3VYRA 1K3RA 2IJ0A 1SN8A 5EBCA 2QF7A 2EDGA 4IPGA 1TWGH 5CMDA 4A93B 3RNUA 4DAYA 4WJ3M 4QF4A 3NTKA 5IYBG 3I4NG 1D5ZC 1LT5D 5KNBA 3VR2A 4RG1A 2KCNA 2ZJQA 2EJGC 4DK0A 1CFMA 4RKBA 5IIFA 5KGUA 2K04A 1IBML 4A3BG 1JWMD 1G2TA 2ATWA 4HN7A 2L4NA 5D14A 2IHFA 1DONA 3KLWA 4DR7L 4CJ1B 4RGOS 1YNXA 2F0EA 1Z7TA 3W1GA 5IGBA 4MZ9A 4DAPA 3K5OA 4PZ8A 2ASBA 1BCPC 1S5CD 3CQZB 1NJIC 4HCSA 2G9HD 3LX0A 2LXJA 1F9QA 1JMCA 5M3MB 2KVMA 2PW7A 3GTQH 5BR8L 3T1YQ 2Z4HA 1LTLA 2AWNA 4B3RQ 1E1TA 1G8ZD 2LS01 2JA5B 2CH4A 4JV5Q 1PVOA 1KHIA 1B53A 3HOXG 3BVZA 1Q82C 4A3GG 3OWEB 3MHBA 4FVMA 1AW7A 3NP8A 1VF5C 1I4QA 2PNHA 2XVSA 2B63B 1X55A 3PMFA 4M8AA 1XWEA 2VB3X 3E6ZX 2L1BA 4V0BA 1RTOA 4L8JA 3TRZA 5COYA 1YHAA 4ALPA 2EYPA 1N33L 2F0OA 5IGGA 4XXEA 2NZ1D 3H94A 5C3EH 1K9MC 3GTLH 4LF6Q 4ZLTF 3F2BA 3BVGA 3CD6A 3G71A 5IP7H 2HDLA 3GTPB 1HTLD 5M5YB 1SFOH 1MBYA 1GXDC 1LT4D 4C1NI 1EEFD 4QUFA 1HQMC 3TMEA 5KYLA 1T9HA 1B44D 2CWAA 4MTKA 2F0HA 1KD1C 1HUMA 2PW5A 3JC66 4OEMB 3PIOA 1QUQA 1YJWA 2NVXH 1HTPA 1K8GA 1IYUA 3U4ZA 4JW0A 1SNDA 1Q81C 3C1FA 3TP5A 1SNMA 5G3LD 4XT1B 1HR0W 2WAQG 3M4OB 1IBMQ 2L5TA
chains in the Genus database with same CATH topology
1Q8KA 4R1JA 4JBKA 3SGIA 2MQHA 3I4MG 1Q1BA 4DUYQ 4OWXB 4DUZL 2JEAI 3RLNA 1YIJA 4DR7Q 4NXML 4B3TQ 3H3VI 3S1NH 3OTOL 4DR4L 4A3LH 4YWKA 3BU2A 4DK3C 2F4VQ 3PUVA 1YJ9A 3CCQA 4DAYB 1VQJA 4LF7L 1XNQQ 3GO5A 4OO1G 3PF4A 2E2HH 2UXDL 2A8VA 4A3DH 4NXNL 1A0IA 1WCMH 3NENA 2R7DA 2MNAA 4LF5Q 3FKIG 4GS3A 4JI4L 1Q7YC 1TWCH 4JOIA 5BR8Q 4YCUA 1XPUA 1L1OA 3CCVA 4C2MH 1CKNB 1WOCA 1JB7A 4JI6Q 1HZ9A 1A62A 2N49A 1M1KC 3HOVH 1QVCA 2NN6G 1X65A 2AKWB 4APVA 3S2HH 4A3EH 3AQQA 4A4IA 4DKAC 5IE8A 2GVBA 3A74A 1VQ4A 4Y52H 1OXXK 4JI1Q 1XMOL 1VQNA 2K75A 1SLJA 3GTMH 4LF8L 5EAYA 4YY3Q 1IBKQ 3G4SA 1VQ7A 4BBSG 3M4PA 3MXNB 3J81c 3HFZB 1EFWA 1J5EQ 3TREA 3AYHB 4GLAC 3KF8B 1YZ6A 1WI5A 2RF4A 3J81i 4AYBG 3CF5A 3I4OA 1N34L 3PO3H 4X6AH 4LF9L 4LF5L 4IJHA 4HIKA 5IYDG 4QGUA 2JA7H 2VY3A 1DGSA 4A3JG 1HJPA 5IWAQ 4HIOA 4X65L 4IJLA 1UE7A 4DV5L 4GNXB 3CMAA 1C9OA 4OO1I 3CP0A 3I4MH 1PH2A 1PH4A 1W2BA 1PA6A 1TWFH 3EBEA 1N33Q 3S2DH 4P74A 1IBKL 1MKHA 1YHBA 5LMNL 5K36G 1JJGA 2N78A 2WP8J 1XTDA 4LNQA 1NMFA 5IP9G 3T1HQ 3A5ZB 3UDIA 3CCMA 2N3SA 1VQMA 4BBRG 2R93G 3DLLA 4JI7Q 1FVIA 2E2IH 3FKIH 3KFUA 2QGQA 2CQOA 1X3FA 2UU9Q 4BY7G 1CSQA 3CCEA 2JA9A 2L15A 3HKZG 4DR3Q 1X3EA 1CKOA 3K0XA 2E5LL 4L5SA 1Q12A 1VQ5A 2R92G 1KRSA 2JE6I 3AFQA 3KJOA 2WB1E 2D0PA 3F1ZA 1WYDA 4LFBL 2VW9A 4X64Q 2K4KA 1XPOA 3GDEA 5GROA 2JK8A 1VQOA 5JEAG 4R4CA 1VCIA 4BBSH 1XPRA 1E24A 1C0AA 4JBWA 4JI5L 1A8VA 1OXSC 4P71A 4A3KG 1Q86C 1KRTA 2UUAQ 3KDFB 3S1QH 1N32L 4DV3Q 2QA4A 3HOYG 5JEAJ 1AE2A 2H5XA 1BBWA 1I94Q 1X54A 4DK6C 1YI2A 1BBUA 4WJ4A 5IYCG 3H15A 5IYDH 4A3JH 4JYAL 2UU9L 1FGUA 2F3IA 2HIXA 3KF6A 4POFA 3RN2A 2BH8A 1HNWL 1Z47A 1V9PA 1VQCA 4GOPC 4P72A 3S1RH 2VQFQ 1RL2A 4DUZQ 1FJGQ 3HOWG 4IFDI 2K14A 2UXBL 1CKMA 5C44G 2DGYA 4NXMQ 3S14H 1VQ6A 4R4OA 1IBLL 3CXCA 2BH2A 3TS0A 3OTOQ 4JG2A 1NTGA 1HZBA 4DR4Q 1G291 5JJIA 4R4QA 2R6GA 1HZAA 4UPAA 2I5HA 3HOUH 1QUQB 3PCOB 4LF7Q 3AFPA 4DR6Q 4B3SL 3GTJH 4DR2L 1PH8A 3W5OA 2IHEA 1UE5A 2UXDQ 3M4QA 4LWCA 1VQPA 1Q1EA 5M3MG 3STBC 1K8AC 2BA0A 2K50A 2KBNA 3G48A 5IP9H 3I7FA 1S72A 4DNIA 3IRBA 4HJAA 4JI4Q 4KHZA 3FHWA 4BBRH 2R93H 3H3VH 1NE3A 2B29A 2PQAB 1V43A 4GOPB 1OTCA 2RHSB 3CCJA 4DV1L 2Y0SG 3CCSA 3CCLA 1W3SA 1G6PA 5C0XI 2VUMG 1VQDA 2K5VA 3CAMA 4GN3B 4DV4Q 4JOIC 3A0JA 4BY7H 2CWPA 2KHIA 1L1OC 1PH5A 3F2CA 2VQFL 1FJGL 1YHQA 4NPSA 2HHHL 3PUZA 3I55A 1PH6A 1PH3A 4DV6L 4IOCA 1XMOQ 2R92H 1PH9A 3E9HA 4LF8Q 1VQEA 4JBMA 4OX9Q 1N9WA 1P16A 2PMZE 4J15A 4AQYL 3KJPA 4K0KL 3PGZA 4QJFA 3W1BA 2K52A 1Y1VG 2Q2IA 4DR6L 3MEFA 2Z6KA 3F2DA 2E8GA 2IT1A 1N34Q 3CPWA 1BKBA 2CFMA 3G6EA 5LMNW 4A3KH 1YEZA 3NBHB 4LF9Q 4PZ6A 4A3CG 4LUZA 2ZTCA 2YTYA 1YBYA 4AYBE 5FJ8G 3HOYH 2OTJA 5IY0A 2ES2A 1L1OB 4X65Q 4XIGS 5GAEC 4X66Q 1VQFA 3I56A 2Q2TA 2K5NA 5IYCH 4DV5Q 4DV4L 1Y1WG 4UP7A 1ASZA 4IOAA 4KLKA 1IXRA 3J7A5 4AIMA 1VQKA 3HOWH 4QY7A 4GN5A 5C44H 1U0LA 4LFCL 2LXKA 4LFAL 1VQ9A 4OX9L 3ULPA 2YTXA 2QEXA 5LMNQ 3TS2A 4KI0A 2KCMA 3CQZH 1NBWA 1LUZA 2NZHA 2OTLA 4LW1A 4IFDG 1VQBA 2XTIA 1M90C 5JJLA 1SE8A 3ULJA 3WWVA 4JI2Q 5M3MH 4BXXH 3UE0A 1HNXQ 1HNZL 4BA2I 3K80C 1HH2P 1O7IA 3L0OA 3RR5A 4A75A 4IFDJ 4GKKL 2KHJA 1V1QA 1PV4A 4X66L 2UUBL 1VQIA 4OWTB 4JI8L 1H95A 3CCUA 1B8AA 2VUMH 2UXCL 1JE5A 1JJ2A 1B7YB 3GTKH 4JCVE 3RLOA 3HKZE 4A3MG 2E5LQ 3ZJYC 2RHQB 1AH9A 1D7QA 4JI3Q 4R4TA 4LF4L 4GN4B 3STBD 1TXYA 4GLVB 4HJ5A 1I5FA 1JJCB 5ELOA 1YITA 3HOUG 1X56A 1XNRL 4LFBQ 4IO9A 1TWHH 5C0XG 5GAHC 3ICEA 3U50C 4DV7Q 3D31A 2A1AA 4BY1G 4JI5Q 4X62L 1Y1VH 2NZOA 5C4XG 1N32Q 1KIXA 2JA8G 3UDXA 2ZJPA 1BVSA 3JAMc 5IT9c 5C0XJ 1OXTA 4JI2L 4A3CH 1HNXL 4HIDA 3JAMi 4HJ9A 1VQGA 1VS0A 5FJ8H 4GNXA 4JYAQ 3PSIA 3RZDH 1GM5A 1SROA 1X3GA 5AJ3L 4UP8A 1QZHA 4OXPA 1HNWQ 4IPDA 3HOZH 5FLMG 3OYYA 1GVPA 1XJVA 3TQYA 3PUYA 3VDYA 3U58A 2Q2UA 1E3PA 2NVQH 2UXBQ 1Y1WH 4KHPL 1SRUA 1IBLQ 2VZAA 4JI3L 5FLXc 4A93G 3D0FA 4LUOA 2MO1A 4YCWA 4IPCA 1EOVA 3S15H 4NB3A 4EQ5A 1N8RC 3M7NA 4B3SQ 1PYSB 4DR2Q 2K5HA 1MIUA 4DV7L 1A63A 3AEVA 5C4JH 2R7ZG 1S40A 2GVAA 3GTOH 5GAGC 3RZOH 4Y7NH 3ERSX 1QVGA 2AMCB 4IPHA 4YWMA 3T1YL 5ELNA 1VQAA 2KENA 4YHHL 4A3BH 3PIPA 4DV1Q 4B3RL 4A3FG 4TVAB 1XMQL 1KQSA 3KF6B 4O2DA 1KC8C 2WAQE 1GKHA 1HZCA 3F8TA 2Y0SE 1L0WA 5GADC 4BXXG 1X9NA 2PI2A 4MNOA 3L2PA 4L5RC 1EUJA 2HHHQ 3CW2C 3S1MH 1SMXA 4A3MH 4DV6Q 4HJ7A 4GKJL 4DV0L 4JV5L 4C3IH 1Q46A 4JBJA 4YWLA 4AQYQ 3PO2G 1CUKA 4K0KQ 4FDBA 1CSPA 4YCVA 1LYLA 2HQLA 3TEHB 4NXNQ 1QZGA 1EIYB 3BZKA 3L7ZC 4BY1H 1PFSA 5J3BA 1B70B 2YYZA 5C4XH 2JA8H 3M4OH 2ZTEA 2Z6KC 4QIWE 2ZM6Q 1AE3A 3I2ZA 3S17H 2VL6A 1UE6A 1EYGA 2CCZA 2WB1G 2MFIA 2JQOA 2EXDA 5FLMH 1S3OA 2JA5G 2OQ0A 4QQBX 2OQKA 2F52A 1UE1A 1FL0A 1L2FA 4LFCQ 4LFAQ 2OWOA 3B6YA 2KCTA 1X6OA 1GO3E 1VQ8A 2LSSA 4A93H 1OXVA 2I5MX 4A3IG 3EIVA 4LF6L 5GQOA 1I50H 4C3JH 4DAMA 1PYBA 2R7ZH 5M3FG 2YTVA 5HY6A 4BA1I 1HNZQ 2VNUD 1N36L 2B63G 4LUVA 2JJQA 1NMGA 2ZM6L 4DPGA 4HJ8A 1J6QA 3PUXA 4GLXA 2UUBQ 3ER0A 3HOZG 4JI8Q 4GKKQ 2ZTDA 1OXUA 1WJJA 4A3FH 2UUCL 2UXCQ 1K73C 2V1CC 2D0OA 1JT8A 1K3RA 3K7UC 1SN8A 2Q2HA 4JI0L 4DR5L 4LF4Q 4IPGA 1TWGH 1XNRQ 3RNUA 4WJ3M 3I4NG 1HR0Q 5IYBG 5DLQE 2AWOA 3PO2H 4RG1A 2B3GA 3J80c 4X62Q 4A76A 2ZJQA 4L5QA 4OONA 3J80i 3S24A 1EQQA 5LMUL 3E9IA 1IBML 1CKNA 4A3BG 2ATWA 3GD7A 1WFQA 2VQEQ 2IHFA 5AJ3Q 4DR1Q 3RN5A 1VQLA 2Z0SA 1Y14B 3KLWA 3M85A 4DUYL 4DR7L 3U4VA 1YNXA 1IZ6A 3ULLA 1UEBA 4GNXC 1PH7A 1U5KA 4B3TL 4B3MQ 4KHPQ 5JJKA 3J81j 4L5TA 3W1GA 2JA5H 1MJCA 4MZ9A 3UDFA 1C7YA 3S16H 3UDGA 1K83H 3BZCA 4PZ8A 2F4VL 5C3EG 2ASBA 1E1OA 1LM0A 1NJIC 1PHJA 2JA6G 1HR0L 1XNQL 1E22A 4POGA 3RLFA 2FXQA 4ME3A 4HIMA 3PF5A 2RCNA 4A3IH 2LXJA 1JMCA 2BA1A 3E0EA 4RMFA 2YU9H 4P75A 1EIFA 2HIVA 5IP7G 3GTQH 3Q8DA 5BR8L 2IX0A 3NELA 3T1YQ 5M3FH 4YHHQ 4JI6L 2EQSA 2A19A 1LTLA 2AWNA 2DUDA 2GN5A 3LGJA 2B63H 4B3RQ 1I6HH 1XMQQ 2ALYB 2VQEL 4DR1L 1E1TA 2NVYH 1E7ZA 1EWIA 1IYJB 3K81C 4B3ML 1D8LA 4JI1L 2HT1A 4DV2Q 3GTGH 4GKJQ 4DV0Q 3PUWA 4JV5Q 1PVOA 4YY3L 4OWWB 4TQUS 1YVCA 1KHIA 4XTCS 3HOXG 1MJEA 3J7ZC 3H0GG 1Q82C 1J5EL 4A3GG 3I4NH 5IYBH 3K8AA 2VS1A 4H02A 4R4IA 3CCRA 3DM3A 4P73A 2E2JH 2EIFA 2PNHA 1GD7A 5IWAL 1X55A 3M9BA 3GTPH 4O0AA 1G51A 5HGQA 2I5LX 5M5YH 2ZJRA 3KYHC 3TRZA 1KL9A 5M5WH 1KXLA 4A3LG 1RIPA 1ASYA 1YJNA 1YHAA 4ALPA 3CC2A 3PV0A 4AH6A 4DV2L 3CMEA 2NVTH 1N33L 3CC4A 5M5XH 5C3EH 2YV5A 4PMWA 4A3DG 2NN6I 4MTNA 1K9MC 1WCMG 3GTLH 2JA6H 3T1HL 4LF6Q 4EX5A 3F2BA 3KDFA 5H1SE 4UY8C 2ID0A 1KAWA 2AHOB 2CKZB 2JEBI 1SR3A 2C35B 4JI7L 3CC7A 1IL2A 3OW2A 3CD6A 1N36Q 3G71A 3HOVG 2IX1A 5IP7H 2D62A 4UP9A 4C3HH 1PH1A 4DR3L 3BJUA 4A3EG 2XGTA 3HKSA 1Z9FA 2OCEA 1SFOH 1NY4A 1TWAH 4JC0A 2UUCQ 2WFWA 1T9HA 3K7AH 4PZ7A 1QVFA 2CWAA 2PI2E 3EN2A 1KD1C 3KOJA 4JI0Q 4DR5Q 1VQHA 4PG3A 4X64L 1K0RA 2MO0A 3JC66 1R9TH 3M3YH 1EQRA 1QUQA 3PIOA 1YJWA 1P8LA 2NVXH 3FP9A 3NEMA 3HOXH 1K8GA 4QL5A 1I3QH 3H0GH 3A5UA 3PO3G 2UUAL 4A3GH 3U4ZA 1Q81C 2IY5B 2JA7G 4DV3L 2I0QA 1UWVA 2N8NA 5E7NA 1HR0W 2R7FA 2PQAA 2WAQG 3UE1A 5LMUQ 4GOPA 1I94L 1IBMQ 3CPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q8K A;  4R1J A;  4JBK A;  3SGI A;  2MQH A;  3I4M G;  1Q1B A;  4DUY Q;  4OWX B;  4DUZ L;  2JEA I;  3RLN A;  1YIJ A;  4DR7 Q;  4NXM L;  4B3T Q;  3H3V I;  3S1N H;  3OTO L;  4DR4 L;  4A3L H;  4YWK A;  3BU2 A;  4DK3 C;  2F4V Q;  3PUV A;  1YJ9 A;  3CCQ A;  4DAY B;  1VQJ A;  4LF7 L;  1XNQ Q;  3GO5 A;  4OO1 G;  3PF4 A;  2E2H H;  2UXD L;  2A8V A;  4A3D H;  4NXN L;  1A0I A;  1WCM H;  3NEN A;  2R7D A;  2MNA A;  4LF5 Q;  3FKI G;  4GS3 A;  4JI4 L;  1Q7Y C;  1TWC H;  4JOI A;  5BR8 Q;  4YCU A;  1XPU A;  1L1O A;  3CCV A;  4C2M H;  1CKN B;  1WOC A;  1JB7 A;  4JI6 Q;  1HZ9 A;  1A62 A;  2N49 A;  1M1K C;  3HOV H;  1QVC A;  2NN6 G;  1X65 A;  2AKW B;  4APV A;  3S2H H;  4A3E H;  3AQQ A;  4A4I A;  4DKA C;  5IE8 A;  2GVB A;  3A74 A;  1VQ4 A;  4Y52 H;  1OXX K;  4JI1 Q;  1XMO L;  1VQN A;  2K75 A;  1SLJ A;  3GTM H;  4LF8 L;  5EAY A;  4YY3 Q;  1IBK Q;  3G4S A;  1VQ7 A;  4BBS G;  3M4P A;  3MXN B;  3J81 c;  3HFZ B;  1EFW A;  1J5E Q;  3TRE A;  3AYH B;  4GLA C;  3KF8 B;  1YZ6 A;  1WI5 A;  2RF4 A;  3J81 i;  4AYB G;  3CF5 A;  3I4O A;  1N34 L;  3PO3 H;  4X6A H;  4LF9 L;  4LF5 L;  4IJH A;  4HIK A;  5IYD G;  4QGU A;  2JA7 H;  2VY3 A;  1DGS A;  4A3J G;  1HJP A;  5IWA Q;  4HIO A;  4X65 L;  4IJL A;  1UE7 A;  4DV5 L;  4GNX B;  3CMA A;  1C9O A;  4OO1 I;  3CP0 A;  3I4M H;  1PH2 A;  1PH4 A;  1W2B A;  1PA6 A;  1TWF H;  3EBE A;  1N33 Q;  3S2D H;  4P74 A;  1IBK L;  1MKH A;  1YHB A;  5LMN L;  5K36 G;  1JJG A;  2N78 A;  2WP8 J;  1XTD A;  4LNQ A;  1NMF A;  5IP9 G;  3T1H Q;  3A5Z B;  3UDI A;  3CCM A;  2N3S A;  1VQM A;  4BBR G;  2R93 G;  3DLL A;  4JI7 Q;  1FVI A;  2E2I H;  3FKI H;  3KFU A;  2QGQ A;  2CQO A;  1X3F A;  2UU9 Q;  4BY7 G;  1CSQ A;  3CCE A;  2JA9 A;  2L15 A;  3HKZ G;  4DR3 Q;  1X3E A;  1CKO A;  3K0X A;  2E5L L;  4L5S A;  1Q12 A;  1VQ5 A;  2R92 G;  1KRS A;  2JE6 I;  3AFQ A;  3KJO A;  2WB1 E;  2D0P A;  3F1Z A;  1WYD A;  4LFB L;  2VW9 A;  4X64 Q;  2K4K A;  1XPO A;  3GDE A;  5GRO A;  2JK8 A;  1VQO A;  5JEA G;  4R4C A;  1VCI A;  4BBS H;  1XPR A;  1E24 A;  1C0A A;  4JBW A;  4JI5 L;  1A8V A;  1OXS C;  4P71 A;  4A3K G;  1Q86 C;  1KRT A;  2UUA Q;  3KDF B;  3S1Q H;  1N32 L;  4DV3 Q;  2QA4 A;  3HOY G;  5JEA J;  1AE2 A;  2H5X A;  1BBW A;  1I94 Q;  1X54 A;  4DK6 C;  1YI2 A;  1BBU A;  4WJ4 A;  5IYC G;  3H15 A;  5IYD H;  4A3J H;  4JYA L;  2UU9 L;  1FGU A;  2F3I A;  2HIX A;  3KF6 A;  4POF A;  3RN2 A;  2BH8 A;  1HNW L;  1Z47 A;  1V9P A;  1VQC A;  4GOP C;  4P72 A;  3S1R H;  2VQF Q;  1RL2 A;  4DUZ Q;  1FJG Q;  3HOW G;  4IFD I;  2K14 A;  2UXB L;  1CKM A;  5C44 G;  2DGY A;  4NXM Q;  3S14 H;  1VQ6 A;  4R4O A;  1IBL L;  3CXC A;  2BH2 A;  3TS0 A;  3OTO Q;  4JG2 A;  1NTG A;  1HZB A;  4DR4 Q;  1G29 1;  5JJI A;  4R4Q A;  2R6G A;  1HZA A;  4UPA A;  2I5H A;  3HOU H;  1QUQ B;  3PCO B;  4LF7 Q;  3AFP A;  4DR6 Q;  4B3S L;  3GTJ H;  4DR2 L;  1PH8 A;  3W5O A;  2IHE A;  1UE5 A;  2UXD Q;  3M4Q A;  4LWC A;  1VQP A;  1Q1E A;  5M3M G;  3STB C;  1K8A C;  2BA0 A;  2K50 A;  2KBN A;  3G48 A;  5IP9 H;  3I7F A;  1S72 A;  4DNI A;  3IRB A;  4HJA A;  4JI4 Q;  4KHZ A;  3FHW A;  4BBR H;  2R93 H;  3H3V H;  1NE3 A;  2B29 A;  2PQA B;  1V43 A;  4GOP B;  1OTC A;  2RHS B;  3CCJ A;  4DV1 L;  2Y0S G;  3CCS A;  3CCL A;  1W3S A;  1G6P A;  5C0X I;  2VUM G;  1VQD A;  2K5V A;  3CAM A;  4GN3 B;  4DV4 Q;  4JOI C;  3A0J A;  4BY7 H;  2CWP A;  2KHI A;  1L1O C;  1PH5 A;  3F2C A;  2VQF L;  1FJG L;  1YHQ A;  4NPS A;  2HHH L;  3PUZ A;  3I55 A;  1PH6 A;  1PH3 A;  4DV6 L;  4IOC A;  1XMO Q;  2R92 H;  1PH9 A;  3E9H A;  4LF8 Q;  1VQE A;  4JBM A;  4OX9 Q;  1N9W A;  1P16 A;  2PMZ E;  4J15 A;  4AQY L;  3KJP A;  4K0K L;  3PGZ A;  4QJF A;  3W1B A;  2K52 A;  1Y1V G;  2Q2I A;  4DR6 L;  3MEF A;  2Z6K A;  3F2D A;  2E8G A;  2IT1 A;  1N34 Q;  3CPW A;  1BKB A;  2CFM A;  3G6E A;  5LMN W;  4A3K H;  1YEZ A;  3NBH B;  4LF9 Q;  4PZ6 A;  4A3C G;  4LUZ A;  2ZTC A;  2YTY A;  1YBY A;  4AYB E;  5FJ8 G;  3HOY H;  2OTJ A;  5IY0 A;  2ES2 A;  1L1O B;  4X65 Q;  4XIG S;  5GAE C;  4X66 Q;  1VQF A;  3I56 A;  2Q2T A;  2K5N A;  5IYC H;  4DV5 Q;  4DV4 L;  1Y1W G;  4UP7 A;  1ASZ A;  4IOA A;  4KLK A;  1IXR A;  3J7A 5;  4AIM A;  1VQK A;  3HOW H;  4QY7 A;  4GN5 A;  5C44 H;  1U0L A;  4LFC L;  2LXK A;  4LFA L;  1VQ9 A;  4OX9 L;  3ULP A;  2YTX A;  2QEX A;  5LMN Q;  3TS2 A;  4KI0 A;  2KCM A;  3CQZ H;  1NBW A;  1LUZ A;  2NZH A;  2OTL A;  4LW1 A;  4IFD G;  1VQB A;  2XTI A;  1M90 C;  5JJL A;  1SE8 A;  3ULJ A;  3WWV A;  4JI2 Q;  5M3M H;  4BXX H;  3UE0 A;  1HNX Q;  1HNZ L;  4BA2 I;  3K80 C;  1HH2 P;  1O7I A;  3L0O A;  3RR5 A;  4A75 A;  4IFD J;  4GKK L;  2KHJ A;  1V1Q A;  1PV4 A;  4X66 L;  2UUB L;  1VQI A;  4OWT B;  4JI8 L;  1H95 A;  3CCU A;  1B8A A;  2VUM H;  2UXC L;  1JE5 A;  1JJ2 A;  1B7Y B;  3GTK H;  4JCV E;  3RLO A;  3HKZ E;  4A3M G;  2E5L Q;  3ZJY C;  2RHQ B;  1AH9 A;  1D7Q A;  4JI3 Q;  4R4T A;  4LF4 L;  4GN4 B;  3STB D;  1TXY A;  4GLV B;  4HJ5 A;  1I5F A;  1JJC B;  5ELO A;  1YIT A;  3HOU G;  1X56 A;  1XNR L;  4LFB Q;  4IO9 A;  1TWH H;  5C0X G;  5GAH C;  3ICE A;  3U50 C;  4DV7 Q;  3D31 A;  2A1A A;  4BY1 G;  4JI5 Q;  4X62 L;  1Y1V H;  2NZO A;  5C4X G;  1N32 Q;  1KIX A;  2JA8 G;  3UDX A;  2ZJP A;  1BVS A;  3JAM c;  5IT9 c;  5C0X J;  1OXT A;  4JI2 L;  4A3C H;  1HNX L;  4HID A;  3JAM i;  4HJ9 A;  1VQG A;  1VS0 A;  5FJ8 H;  4GNX A;  4JYA Q;  3PSI A;  3RZD H;  1GM5 A;  1SRO A;  1X3G A;  5AJ3 L;  4UP8 A;  1QZH A;  4OXP A;  1HNW Q;  4IPD A;  3HOZ H;  5FLM G;  3OYY A;  1GVP A;  1XJV A;  3TQY A;  3PUY A;  3VDY A;  3U58 A;  2Q2U A;  1E3P A;  2NVQ H;  2UXB Q;  1Y1W H;  4KHP L;  1SRU A;  1IBL Q;  2VZA A;  4JI3 L;  5FLX c;  4A93 G;  3D0F A;  4LUO A;  2MO1 A;  4YCW A;  4IPC A;  1EOV A;  3S15 H;  4NB3 A;  4EQ5 A;  1N8R C;  3M7N A;  4B3S Q;  1PYS B;  4DR2 Q;  2K5H A;  1MIU A;  4DV7 L;  1A63 A;  3AEV A;  5C4J H;  2R7Z G;  1S40 A;  2GVA A;  3GTO H;  5GAG C;  3RZO H;  4Y7N H;  3ERS X;  1QVG A;  2AMC B;  4IPH A;  4YWM A;  3T1Y L;  5ELN A;  1VQA A;  2KEN A;  4YHH L;  4A3B H;  3PIP A;  4DV1 Q;  4B3R L;  4A3F G;  4TVA B;  1XMQ L;  1KQS A;  3KF6 B;  4O2D A;  1KC8 C;  2WAQ E;  1GKH A;  1HZC A;  3F8T A;  2Y0S E;  1L0W A;  5GAD C;  4BXX G;  1X9N A;  2PI2 A;  4MNO A;  3L2P A;  4L5R C;  1EUJ A;  2HHH Q;  3CW2 C;  3S1M H;  1SMX A;  4A3M H;  4DV6 Q;  4HJ7 A;  4GKJ L;  4DV0 L;  4JV5 L;  4C3I H;  1Q46 A;  4JBJ A;  4YWL A;  4AQY Q;  3PO2 G;  1CUK A;  4K0K Q;  4FDB A;  1CSP A;  4YCV A;  1LYL A;  2HQL A;  3TEH B;  4NXN Q;  1QZG A;  1EIY B;  3BZK A;  3L7Z C;  4BY1 H;  1PFS A;  5J3B A;  1B70 B;  2YYZ A;  5C4X H;  2JA8 H;  3M4O H;  2ZTE A;  2Z6K C;  4QIW E;  2ZM6 Q;  1AE3 A;  3I2Z A;  3S17 H;  2VL6 A;  1UE6 A;  1EYG A;  2CCZ A;  2WB1 G;  2MFI A;  2JQO A;  2EXD A;  5FLM H;  1S3O A;  2JA5 G;  2OQ0 A;  4QQB X;  2OQK A;  2F52 A;  1UE1 A;  1FL0 A;  1L2F A;  4LFC Q;  4LFA Q;  2OWO A;  3B6Y A;  2KCT A;  1X6O A;  1GO3 E;  1VQ8 A;  2LSS A;  4A93 H;  1OXV A;  2I5M X;  4A3I G;  3EIV A;  4LF6 L;  5GQO A;  1I50 H;  4C3J H;  4DAM A;  1PYB A;  2R7Z H;  5M3F G;  2YTV A;  5HY6 A;  4BA1 I;  1HNZ Q;  2VNU D;  1N36 L;  2B63 G;  4LUV A;  2JJQ A;  1NMG A;  2ZM6 L;  4DPG A;  4HJ8 A;  1J6Q A;  3PUX A;  4GLX A;  2UUB Q;  3ER0 A;  3HOZ G;  4JI8 Q;  4GKK Q;  2ZTD A;  1OXU A;  1WJJ A;  4A3F H;  2UUC L;  2UXC Q;  1K73 C;  2V1C C;  2D0O A;  1JT8 A;  1K3R A;  3K7U C;  1SN8 A;  2Q2H A;  4JI0 L;  4DR5 L;  4LF4 Q;  4IPG A;  1TWG H;  1XNR Q;  3RNU A;  4WJ3 M;  3I4N G;  1HR0 Q;  5IYB G;  5DLQ E;  2AWO A;  3PO2 H;  4RG1 A;  2B3G A;  3J80 c;  4X62 Q;  4A76 A;  2ZJQ A;  4L5Q A;  4OON A;  3J80 i;  3S24 A;  1EQQ A;  5LMU L;  3E9I A;  1IBM L;  1CKN A;  4A3B G;  2ATW A;  3GD7 A;  1WFQ A;  2VQE Q;  2IHF A;  5AJ3 Q;  4DR1 Q;  3RN5 A;  1VQL A;  2Z0S A;  1Y14 B;  3KLW A;  3M85 A;  4DUY L;  4DR7 L;  3U4V A;  1YNX A;  1IZ6 A;  3ULL A;  1UEB A;  4GNX C;  1PH7 A;  1U5K A;  4B3T L;  4B3M Q;  4KHP Q;  5JJK A;  3J81 j;  4L5T A;  3W1G A;  2JA5 H;  1MJC A;  4MZ9 A;  3UDF A;  1C7Y A;  3S16 H;  3UDG A;  1K83 H;  3BZC A;  4PZ8 A;  2F4V L;  5C3E G;  2ASB A;  1E1O A;  1LM0 A;  1NJI C;  1PHJ A;  2JA6 G;  1HR0 L;  1XNQ L;  1E22 A;  4POG A;  3RLF A;  2FXQ A;  4ME3 A;  4HIM A;  3PF5 A;  2RCN A;  4A3I H;  2LXJ A;  1JMC A;  2BA1 A;  3E0E A;  4RMF A;  2YU9 H;  4P75 A;  1EIF A;  2HIV A;  5IP7 G;  3GTQ H;  3Q8D A;  5BR8 L;  2IX0 A;  3NEL A;  3T1Y Q;  5M3F H;  4YHH Q;  4JI6 L;  2EQS A;  2A19 A;  1LTL A;  2AWN A;  2DUD A;  2GN5 A;  3LGJ A;  2B63 H;  4B3R Q;  1I6H H;  1XMQ Q;  2ALY B;  2VQE L;  4DR1 L;  1E1T A;  2NVY H;  1E7Z A;  1EWI A;  1IYJ B;  3K81 C;  4B3M L;  1D8L A;  4JI1 L;  2HT1 A;  4DV2 Q;  3GTG H;  4GKJ Q;  4DV0 Q;  3PUW A;  4JV5 Q;  1PVO A;  4YY3 L;  4OWW B;  4TQU S;  1YVC A;  1KHI A;  4XTC S;  3HOX G;  1MJE A;  3J7Z C;  3H0G G;  1Q82 C;  1J5E L;  4A3G G;  3I4N H;  5IYB H;  3K8A A;  2VS1 A;  4H02 A;  4R4I A;  3CCR A;  3DM3 A;  4P73 A;  2E2J H;  2EIF A;  2PNH A;  1GD7 A;  5IWA L;  1X55 A;  3M9B A;  3GTP H;  4O0A A;  1G51 A;  5HGQ A;  2I5L X;  5M5Y H;  2ZJR A;  3KYH C;  3TRZ A;  1KL9 A;  5M5W H;  1KXL A;  4A3L G;  1RIP A;  1ASY A;  1YJN A;  1YHA A;  4ALP A;  3CC2 A;  3PV0 A;  4AH6 A;  4DV2 L;  3CME A;  2NVT H;  1N33 L;  3CC4 A;  5M5X H;  5C3E H;  2YV5 A;  4PMW A;  4A3D G;  2NN6 I;  4MTN A;  1K9M C;  1WCM G;  3GTL H;  2JA6 H;  3T1H L;  4LF6 Q;  4EX5 A;  3F2B A;  3KDF A;  5H1S E;  4UY8 C;  2ID0 A;  1KAW A;  2AHO B;  2CKZ B;  2JEB I;  1SR3 A;  2C35 B;  4JI7 L;  3CC7 A;  1IL2 A;  3OW2 A;  3CD6 A;  1N36 Q;  3G71 A;  3HOV G;  2IX1 A;  5IP7 H;  2D62 A;  4UP9 A;  4C3H H;  1PH1 A;  4DR3 L;  3BJU A;  4A3E G;  2XGT A;  3HKS A;  1Z9F A;  2OCE A;  1SFO H;  1NY4 A;  1TWA H;  4JC0 A;  2UUC Q;  2WFW A;  1T9H A;  3K7A H;  4PZ7 A;  1QVF A;  2CWA A;  2PI2 E;  3EN2 A;  1KD1 C;  3KOJ A;  4JI0 Q;  4DR5 Q;  1VQH A;  4PG3 A;  4X64 L;  1K0R A;  2MO0 A;  3JC6 6;  1R9T H;  3M3Y H;  1EQR A;  1QUQ A;  3PIO A;  1YJW A;  1P8L A;  2NVX H;  3FP9 A;  3NEM A;  3HOX H;  1K8G A;  4QL5 A;  1I3Q H;  3H0G H;  3A5U A;  3PO3 G;  2UUA L;  4A3G H;  3U4Z A;  1Q81 C;  2IY5 B;  2JA7 G;  4DV3 L;  2I0Q A;  1UWV A;  2N8N A;  5E7N A;  1HR0 W;  2R7F A;  2PQA A;  2WAQ G;  3UE1 A;  5LMU Q;  4GOP A;  1I94 L;  1IBM Q;  3CPF A; 
#chains in the Genus database with same CATH topology
 1DXM A;  1Q8K A;  2XN9 C;  1SBB B;  2EYM A;  5JVH 3;  1RF2 D;  4DR7 Q;  3K7A B;  3H3V I;  3OTO L;  5KEE A;  1R9T B;  4A3L H;  4HED A;  4DK3 C;  3A7L A;  3CCQ A;  4DAY B;  2F0P A;  2NYZ D;  2A69 D;  1CQV A;  3PF4 A;  3ZYY X;  2Q8I B;  5I2X A;  4ILW A;  2A8V A;  3E5S A;  4NXN L;  1HFG A;  1A0I A;  3NEN A;  3D4R A;  3NBH A;  2B2U C;  1TWC H;  5BR8 Q;  4YCU A;  3SK8 A;  1WVL A;  5DM6 3;  1M1K C;  3Q22 A;  3IL8 A;  2NN6 G;  3S2H H;  2LY7 A;  1D5X C;  1O7Y A;  5E1F A;  1G2S A;  3S1N B;  1XMO L;  3GTM H;  1K8M A;  2K75 A;  1SNO A;  1EY4 A;  1TWG B;  3G4S A;  1VQ7 A;  3M4P A;  2L55 A;  1H9R A;  4RGT A;  3KF8 B;  3QOJ A;  4JVZ A;  3SVM A;  1CZG A;  4KKT A;  4AYB G;  4LF9 L;  4LF5 L;  4HIK A;  2EYF A;  2JA7 H;  2VY3 A;  4A3J G;  4C2M B;  4HIO A;  3HOV B;  3KLS A;  1WTX A;  1W6K A;  4A3E B;  5FLX E;  1QJO A;  1ROD A;  2FJ2 A;  4KK7 A;  2DNE A;  1PH4 A;  4CDC C;  3EBE A;  3NWT A;  1N33 Q;  4P74 A;  1MKH A;  5LMN L;  5K36 G;  2TMP A;  1QB5 D;  4K5W A;  1J8I A;  5IP9 G;  3DXJ C;  3PO3 B;  2EZV A;  3CCM A;  2N3S A;  3GP7 A;  3NQI A;  2X6L A;  1D5M C;  2UU9 Q;  4BY7 G;  3K5L A;  2LFN A;  2OT2 A;  1LTA D;  4ZCK A;  1CKO A;  2E5L L;  1A3U A;  2OEO A;  2PZW A;  3L3O C;  3SK5 A;  1VQ5 A;  1TWF B;  3AFQ A;  4Q0F A;  3S2D B;  2WB1 E;  4K14 A;  3F1Z A;  1XPO A;  2JK8 A;  5JEA G;  5I6W A;  1JQY D;  1XPR A;  1E24 A;  3CRL C;  2XWB B;  4A3K G;  3FKI B;  4JK1 C;  5JEA J;  1AE2 A;  1JIC A;  4DK6 C;  5JJZ A;  4WJ4 A;  3QIA A;  1HFN A;  2F3I A;  3PIO 3;  2NBF A;  3RN2 A;  4DNR B;  1HNW L;  1V9P A;  1EZ6 A;  2VNU D;  2VQF Q;  3TN2 A;  2IWH A;  4IFD I;  2K14 A;  3VA7 A;  3S14 H;  2DGY A;  2A73 B;  2K05 A;  4R4O A;  1NSN S;  3FDT A;  2PMZ B;  3TS0 A;  3OTO Q;  5A2Q E;  1NTG A;  3SK4 A;  5JJI A;  5C4H A;  1EIH A;  1YNJ C;  3NXW A;  2WV6 D;  2I5H A;  3HOU H;  1QUQ B;  4BBS B;  4KTA A;  4NKL A;  3GTJ H;  4DR2 L;  3GTL B;  3I8Z A;  3S1Q B;  4NXN Q;  5M3M G;  3STB C;  1K8A C;  2KBN A;  2K50 A;  1S72 A;  4HJA A;  3IRB A;  1ML0 D;  4BBR H;  3H3V H;  1V43 A;  1G6Z A;  2RHS B;  1G6P A;  1EIG A;  3T4A C;  2VUM G;  3CAM A;  4GN3 B;  4FNF A;  5IT9 L;  1SFO B;  1BBX C;  1H9M A;  2CW0 D;  2WAC A;  1L1O C;  3P75 A;  3F2C A;  4KY6 A;  4DV6 L;  1XMO Q;  2R92 H;  1PH9 A;  3E9H A;  1VQE A;  3KBG A;  2BOS A;  3D4W A;  4K8J A;  4L6T B;  2A6H C;  1V1O A;  4QJF A;  1STE A;  2Z1C A;  2PCF B;  2Z8L A;  1X3Q A;  2MJ8 A;  2NWG A;  3VYU A;  2CFM A;  4ZKC B;  3G6E A;  2E74 C;  4LF9 Q;  3NBH B;  2R93 B;  2YTY A;  4AYB E;  5FJ8 G;  1BF4 A;  2ES2 A;  4X66 Q;  1VQF A;  3I56 A;  2O5I C;  3MZ5 A;  5FK9 C;  3W3A A;  3HKZ B;  1CTM A;  3HZX A;  4KLK A;  3J7A 5;  1VQK A;  3HOW H;  5C44 H;  1EWH A;  1JWS D;  1CHQ D;  3TP6 A;  3ULP A;  2HCC A;  5LMN Q;  4RHR A;  5EPL A;  1F2M A;  2MP1 A;  3U9O A;  1M90 C;  5JJL A;  1SE8 A;  3UE0 A;  1HNX Q;  2MGS A;  3HOY B;  1JOR A;  3DEO A;  1O7I A;  5I9O A;  4A75 A;  2UUB L;  1VQI A;  4JI8 L;  2R61 A;  1SE3 A;  4ME5 A;  1B8A A;  2VB2 X;  3S2H B;  2A68 C;  2UXC L;  3CKI B;  1WD1 A;  1LTT D;  2ZXR A;  4JCV E;  2E5L Q;  2Q8R E;  1D7Q A;  2NTS A;  1EY7 A;  3GTM B;  1EQT A;  2EJF C;  4FF1 A;  5C0X G;  5GAH C;  3U50 C;  3QG1 A;  5FOB B;  4X62 L;  3UDX A;  1BVS A;  3QOL A;  5C0X J;  1AZQ A;  2JA7 B;  1LT6 D;  1V1P A;  2BE5 D;  1WTQ A;  1TVX A;  3NTH A;  4HID A;  1KLU D;  2MUY A;  1GUN A;  1HNW Q;  4UP8 A;  4OXP A;  1Z6H A;  3HOZ H;  5FLM G;  3OYY A;  1XJV A;  3TQY A;  3D8G A;  1Y1W H;  3BVM A;  2OXP A;  2H4O A;  2BDN A;  2VZA A;  1IKM A;  2A74 C;  3D0F A;  5I9P A;  2MO1 A;  4IPC A;  4NB3 A;  5EPJ A;  3M7N A;  1IW7 C;  1PYS B;  2M00 A;  4DR2 Q;  2R7Z G;  5C4J H;  3RZO H;  1QVG A;  1WTR A;  1HXY D;  4IFD H;  3ND9 A;  5ELN A;  3PIP A;  3W2D A;  4DGZ A;  1SYC A;  1XMQ L;  4FF3 A;  3P20 A;  4B9W A;  2NVQ B;  1L0W A;  2C5C A;  2PI2 A;  1STG A;  2J7Z A;  1B3A A;  1YNN C;  4DV6 Q;  1LTR D;  4GKJ L;  1SJE D;  4QB4 A;  1PDQ A;  3S15 B;  4JBJ A;  4FDB A;  2IPK D;  1EFI D;  1Q3L A;  3BZK A;  1EIY B;  4RWS C;  4BY1 H;  1PFS A;  1B70 B;  1IHZ A;  2G5D A;  2YYZ A;  5C4X H;  2JA8 H;  3VR4 A;  2ZTE A;  5D65 A;  1PRT C;  3A8J E;  3S17 H;  1HRJ A;  2VL6 A;  5EKL A;  1UE6 A;  2ZT9 C;  2CCZ A;  2F0L A;  1E2Z A;  1STB A;  4XT3 B;  2MFI A;  4K2L A;  1VF7 A;  4S3S A;  4A3M B;  3OPO A;  4C3I B;  1UE1 A;  5CGK A;  2RDF A;  1RHP A;  2OF1 A;  1GO3 E;  3J80 E;  3HOU B;  4A93 H;  3V96 A;  3X3N A;  3J7A F;  1I50 H;  2CQA A;  5COR A;  1PYB A;  2F0S A;  3I3C A;  3K5M A;  1N36 L;  3VR5 A;  2HDM A;  3VYS A;  2ZM6 L;  4HJ8 A;  2UUB Q;  4JI8 Q;  1OXU A;  4XQJ A;  1GOZ A;  1BDO A;  5JOB A;  2UUC L;  1NR4 A;  1K73 C;  2UXC Q;  3I91 A;  2R92 B;  4JI0 L;  1C4Q A;  4N8F A;  3EQL C;  4RKL A;  1HR0 Q;  4G7O C;  3OIQ A;  2PO4 A;  5DLQ E;  5HUR A;  3Q6S A;  4X62 Q;  4A76 A;  2LKV A;  1L0X B;  4L5Q A;  2MHV A;  4MN3 A;  1CKN A;  1GUT A;  2PZU A;  3PQI A;  4DR1 Q;  4A3F B;  1ZXT A;  1VQL A;  2Z0S A;  3M85 A;  1IZ6 A;  2F0U A;  1UEB A;  3BZD B;  4GNX C;  1PH7 A;  3HOW B;  3J81 j;  2JA5 H;  4HAE A;  3SK6 A;  4NDX A;  5C3E G;  1E1O A;  1LM0 A;  1E2V A;  1XNQ L;  2B2U A;  4POG A;  2FXQ A;  3EFX D;  2V4D A;  4A3I H;  2PQE A;  1ZYR C;  4P75 A;  5IP7 G;  1F9P A;  5K5P A;  3Q8D A;  1V1P B;  5M3F H;  2DUD A;  2B63 H;  2GN5 A;  1XMQ Q;  1TY2 A;  2ALY B;  2AQ2 B;  3N52 A;  1G91 A;  2AUJ D;  3K81 C;  2F0T A;  1BCP B;  4JI1 L;  4DV2 Q;  4GKJ Q;  2L12 A;  4YY3 L;  1MJE A;  3PIP 3;  4KV6 A;  2VS1 A;  3NSW A;  5EJW A;  3CCR A;  1H9K A;  1SE4 A;  4P73 A;  4CDF C;  1EOT A;  2Z6B A;  3KBX A;  3T53 B;  2B2V C;  4G7Z C;  4JPB W;  3GTP H;  3K5N A;  4H44 C;  5M5Y H;  2DY8 A;  1I4X A;  3HOZ B;  4CBV A;  3KYH C;  5CV4 A;  5DAU A;  1KL9 A;  4A3L G;  1RIP A;  2O4X A;  1YJN A;  1IKL A;  5CV8 A;  4R8I A;  3MAQ A;  3IFT A;  3CC2 A;  1UEA B;  3P1H A;  2ICI A;  2HUG A;  5LL6 S;  2WIN B;  4PMW A;  4MTN A;  4QCL A;  1ZKO A;  4R9W A;  4BWG B;  2JEB I;  3OW2 A;  1N36 Q;  1PTO C;  2D62 A;  2OCE A;  5AFW A;  1NY4 A;  1TWA H;  4JC0 A;  2UUC Q;  5M5W B;  1HPC A;  3K7A H;  2SOB A;  4CJ0 B;  1M4V A;  3K59 A;  1KNE A;  2NVT B;  2CH4 W;  4JI0 Q;  1VQH A;  4PG3 A;  5M5X B;  2MO0 A;  4KJO A;  1R9T H;  2IX3 A;  1EQR A;  4U67 3;  2JA6 B;  3NEM A;  2JA7 G;  4DV3 L;  1SJH D;  3NPP A;  1NNX A;  2N8N A;  5C4X B;  3CPF A;  4KD4 A;  3T13 A;  1DZ1 A;  1Q8I A;  1SMY D;  2F4I A;  1BXT A;  4DUZ L;  3V05 A;  1YIJ A;  2SNM A;  1A3T A;  4NXM L;  3S1N H;  1EY6 A;  4DR4 L;  1CHP D;  3OW7 A;  4I7Z C;  4FYD A;  4LF7 L;  1XNQ Q;  2PYK A;  1I50 B;  2KCC A;  2ICE C;  2EYJ A;  1L1O A;  4C2M H;  1CKN B;  2B39 A;  3HOV H;  5C4Z A;  1O7Z A;  1QVC A;  4PMB A;  4A3E H;  4TRD A;  3AQQ A;  1A2T A;  3A74 A;  1VQ4 A;  2PZT A;  1SNQ A;  4JI1 Q;  4Y52 H;  1VQN A;  1O80 A;  4LF8 L;  2RSO A;  4YY3 Q;  1IBK Q;  1R4Q B;  2NUC A;  5BN3 A;  2E2H B;  3AYH B;  3CU7 A;  2F0N A;  5IT9 E;  4K8I A;  1YZ6 A;  1WCM B;  2RF4 A;  5ELB A;  1N34 L;  3I4O A;  3PO3 H;  1PFM A;  4DF7 A;  1EYA A;  1PFN A;  1DGS A;  2B2Y C;  4J1M A;  5EKI A;  1EYD A;  1MI2 A;  2QW7 A;  4IJL A;  3SE0 A;  2FMC A;  4DV5 L;  3CMA A;  1A2U A;  3QO2 A;  4OO1 I;  4Z9C B;  3I4M H;  3TSS A;  3L9A X;  4HCE A;  1PH2 A;  2A5H A;  1W2B A;  1I4G A;  4KKS A;  1PA6 A;  1TWF H;  5I4D A;  3S2D H;  5NUC A;  2G9D A;  4U68 A;  1B1Z A;  4ZKB B;  1EQV A;  4V19 0;  2JSO A;  1JJG A;  2N78 A;  2WP8 J;  1ICW A;  1EL0 A;  1EU3 A;  1H9S A;  4N9P A;  4A3I B;  1VQM A;  4BBR G;  2PPB C;  4G4K A;  1PTO F;  3FKI H;  5M3F B;  1ONL A;  2CQO A;  3CCE A;  1X3E A;  3NBI A;  3MA2 B;  1PZK D;  2R92 G;  2F3V A;  2VXW A;  3C1E A;  1S4Z A;  2D0P A;  1WYD A;  2RDH A;  5IOD A;  1VQO A;  3ERQ A;  4R4C A;  3CRK C;  1VCI A;  1O7L A;  4BBS H;  4JBW A;  1KTK A;  4JI5 L;  1OXS C;  1KNA A;  1VMC A;  3S1Q H;  4DV3 Q;  1S5B D;  4ABN A;  3J81 L;  1RKN A;  1PLF A;  1BBU A;  1YI2 A;  5IYD H;  4XQN A;  2RBM A;  2UU9 L;  2CHB D;  3KF6 A;  1CI3 M;  2ZXO A;  1Z47 A;  2K01 A;  3S1R H;  3HOW G;  2EYL A;  4DUZ Q;  5C44 G;  4NXM Q;  2K32 A;  1VQ6 A;  1IBL L;  2NB0 A;  3CXC A;  4ZK9 B;  5L37 A;  4DR4 Q;  3I70 A;  1G29 1;  4R4Q A;  4WJW A;  3PCO B;  4LF7 Q;  3AFP A;  4DR6 Q;  2O5J C;  5CYU A;  1VQP A;  3DWQ A;  2BA0 A;  3G48 A;  3C3L A;  3I7F A;  2A68 D;  5ELC A;  4DNI A;  3FHW A;  2R93 H;  1SSO A;  1WTV A;  1DCZ A;  3CCL A;  3CCJ A;  4DV1 L;  3T16 A;  5IOC A;  1K0S A;  4DV4 Q;  3A0J A;  4O42 A;  1TWA B;  2CWP A;  1PH5 A;  2VQF L;  2H1E A;  3PUZ A;  1PH6 A;  4GZY C;  4IOC A;  2QCP X;  4LF8 Q;  4KJN A;  1N9W A;  1P16 A;  4J15 A;  1BCP F;  4AQY L;  3KJP A;  4K0K L;  3PGZ A;  3QWN A;  4H7B A;  2I46 A;  5C5L A;  3F2D A;  2IT1 A;  1N34 Q;  3MFY A;  4LUZ A;  1FGB D;  2ZTC A;  1YBY A;  5CBA E;  3HOY H;  2OTJ A;  1L1O B;  5GAE C;  2E76 C;  5IYC H;  4DV5 Q;  1Y1W G;  4UP7 A;  4AIM A;  4QY7 A;  4QMG A;  4GN5 A;  1U0L A;  2LXK A;  4LFA L;  2QEX A;  5CC4 A;  4HSV A;  2XRS D;  2NZH A;  5BN4 A;  4LW1 A;  4IFD G;  2KA7 A;  4OO1 H;  4JI2 Q;  3GV3 A;  1KDB A;  4BA2 I;  4N9T A;  1YNN D;  3L0O A;  3OHX C;  4IFD J;  4GKK L;  1V1Q A;  2K03 A;  4X66 L;  3MWY W;  1H95 A;  1CM9 A;  4ZUJ A;  1JE5 A;  3DWA A;  1WTO A;  3ZJY C;  4Q5V A;  1AH9 A;  4JI3 Q;  5EKK A;  4LF4 L;  4GN4 B;  4NP5 A;  4GLV B;  4HJ5 A;  2F1M A;  1JJC B;  1YIT A;  1X56 A;  4IUN A;  3T51 B;  3OOC A;  1I6V C;  4DV7 Q;  4CHT B;  4JI5 Q;  4BY1 G;  3AU7 A;  3HGB A;  1KIX A;  2JA8 G;  5C4X G;  3JAM c;  1M8A A;  5F2D A;  2FHT A;  1OXT A;  4A3C H;  1HNX L;  5KNC A;  1RJT A;  3JAM i;  4HJ9 A;  4GNX A;  2Y0S B;  3VYT A;  1SRO A;  2JP1 A;  4IPD A;  1DM0 B;  3U58 A;  1SEB D;  3VDY A;  2NVQ H;  3I4M B;  4KHP L;  2P5Z X;  1IBL Q;  1VMP A;  5KRU A;  4FXG C;  2EOT A;  2M2L A;  2SDF A;  4A93 G;  1TWH B;  1EOV A;  3S15 H;  2DJG C;  1N8R C;  3RUZ A;  1Y1V B;  1MIU A;  2GVA A;  1F77 A;  4QIW B;  1KDA A;  2AUK A;  1VQA A;  2MPM A;  4A3B H;  4DV1 Q;  3RZD B;  2A6E D;  3SHL A;  1QWY A;  1WTH A;  3KF6 B;  4O2D A;  5CBE E;  2WAQ E;  1KC8 C;  3F8T A;  4E6I A;  5C5M A;  5T1G A;  3L2P A;  4FXD A;  1SMX A;  4A3M H;  4HJ7 A;  4DV0 L;  1R4P B;  4C3I H;  1BR9 A;  1PXU A;  4YWL A;  1VDZ A;  4AQY Q;  4K0K Q;  1CK1 A;  1LTI D;  2HQL A;  3TEH B;  3GTO B;  2B2V A;  1PTO H;  2E75 C;  5E3F A;  1AP0 A;  3BG3 A;  3QB3 A;  4WOR A;  3I2Z A;  5CV7 A;  5D3D A;  3S1R B;  4DK1 A;  2EXD A;  4DA2 A;  1S3O A;  2JA5 G;  4QQB X;  1DOK A;  3QR8 A;  1FL0 A;  1Y8O B;  4LFA Q;  2OWO A;  2KCT A;  3AMU A;  1X6O A;  1VQ8 A;  3OIP A;  2D5D A;  4IN3 A;  2AQ3 B;  5IGE A;  3ND8 A;  4A3I G;  3OWF A;  5M3F G;  2YTV A;  4BA1 I;  2B63 G;  2JJQ A;  1TS3 A;  1TII D;  4GKK Q;  4GLX A;  1NAP A;  1STN A;  1WJJ A;  4A3F H;  3K7U C;  3BS1 A;  4DR5 L;  4LF4 Q;  1RTN A;  5ELF A;  1NR2 A;  3J80 c;  3OMG A;  4C3J B;  2FIN B;  2XIW A;  3J80 i;  3S24 A;  1JCK B;  1O78 A;  3MC0 B;  4OGQ C;  3GD7 A;  1WFQ A;  2VQE Q;  3RN5 A;  1FR3 A;  4XDX A;  3U4V A;  4RFB A;  4WRD A;  2J4X A;  4B3M Q;  4KHP Q;  5BN5 A;  1MJC A;  5C3X A;  5ISR A;  1K83 H;  4LK1 C;  4DNT B;  4OHJ A;  4IZ8 A;  1PHJ A;  2F0V A;  2EJM A;  1HR0 L;  3PO2 B;  1PTO D;  3RLF A;  4HIM A;  3E0E A;  4IUT A;  4F8M A;  5A35 A;  2A19 A;  3LGJ A;  1I6H H;  4DR1 L;  5CV9 A;  1E7Z A;  1EWI A;  1IYJ B;  1D8L A;  2HT1 A;  3TZD A;  3N6R A;  3S16 B;  3GTG H;  4DV0 Q;  2EY5 A;  3PUW A;  4K5X A;  1HUN A;  4TQU S;  4L63 B;  1YVC A;  4XTC S;  5C6A A;  3ERO A;  2B2Y A;  3K8A A;  3DUZ A;  4N8X 1;  4LJZ C;  4I65 A;  5IGF A;  4RGM A;  2A69 C;  2EIF A;  5JPM C;  1S5F D;  1G51 A;  5HGQ A;  2I5L X;  2NVY B;  3H09 A;  5M5W H;  1STH A;  1KXL A;  1ASY A;  1TT2 A;  3PV0 A;  4DV2 L;  2NVT H;  2EY6 A;  3CC4 A;  1JWU D;  2R3Z A;  2NTT A;  5M5X H;  3I4N B;  2YV5 A;  2JA6 H;  3EA6 A;  4DU9 A;  4CGY B;  1F2L A;  4UY8 C;  2ID0 A;  2CKZ B;  2E2J B;  1SR3 A;  4JI7 L;  3CC7 A;  5E4W C;  3HOV G;  4DFA A;  3FVQ A;  4A3B B;  2RKS A;  5KND A;  4UP9 A;  4C3H H;  4KY5 A;  4DR3 L;  4A3E G;  2XGT A;  3MXP A;  1Z9F A;  1B9N A;  1K28 A;  3K57 A;  2B2W C;  2JXM B;  1BCP D;  3EN2 A;  1NUC A;  4DR5 Q;  2F0J A;  1MGS A;  4HMJ A;  1P8L A;  5E4X A;  4QL5 A;  1I3Q H;  1A3V A;  3H0G H;  3PO3 G;  2UUA L;  1K8O A;  1HCZ A;  2IY5 B;  1PTO B;  2KQ3 A;  3UE1 A;  3KUP A;  2PNR C;  3D4D A;  5D3I B;  4K6D A;  2B2T C;  4R1J A;  2MQH A;  3K0Y A;  3I4M G;  1Q1B A;  4OWX B;  1AZP A;  3FPU B;  5J39 A;  4IUQ A;  2EE1 A;  3J81 E;  3BU2 A;  3PUV A;  3G7L A;  3HOX B;  3GO5 A;  2E2H H;  4A3G B;  4A3D H;  4PNY A;  1WCM H;  1LTB D;  2R7D A;  3FKI G;  3MTS A;  1ICF B;  1D1K A;  1WOC A;  5I2Y A;  1JB7 A;  2N49 A;  3AB9 A;  2B8F A;  3O13 A;  1H9J A;  1X65 A;  1SYE A;  4APV A;  1TU2 B;  4A4I A;  3R93 A;  2GVB A;  4BS9 A;  1OXX K;  1SLJ A;  1U4P A;  4BBS G;  3HG9 A;  2IL8 A;  3P7J A;  3HFZ B;  1EFW A;  3TBI B;  1CA6 A;  1QG7 A;  4DXG A;  1WI5 A;  3SEB A;  1ET6 A;  3CF5 A;  4EQO A;  4X6A H;  5IGC A;  4IJH A;  3WOE A;  5IYD G;  4QGU A;  1HJP A;  2B8G A;  4X65 L;  1UE7 A;  1KLG D;  1C9O A;  3CP0 A;  2WB1 B;  4R8N A;  4ZUI A;  1K83 B;  1JOO A;  2CW0 C;  1IBK L;  5J1Z A;  3HEJ A;  5CV5 A;  1PYW D;  1B2T A;  2XWJ B;  1BO0 A;  1XTD A;  4LNQ A;  3MFG A;  3A5Z B;  3UDI A;  2R93 G;  3I72 A;  5A2Q L;  1MHW C;  4EQN A;  1FVI A;  3DLL A;  4JI7 Q;  1PRT F;  2WAQ B;  5C3W A;  2QGQ A;  1X3F A;  5TSS A;  2SNS A;  5JVG 3;  1I6H B;  2L15 A;  3D3R A;  3HKZ G;  4DR3 Q;  2Z4I A;  3K0X A;  1D6E C;  1Q12 A;  1KRS A;  3VA5 A;  3GTG B;  2QEJ C;  4LFB L;  1SYF A;  2K4K A;  2Z9H A;  3KLR A;  5EBD A;  1A8V A;  2UUA Q;  3TP7 A;  2QA4 A;  3HOY G;  2E2I B;  4PQX A;  1B3Q A;  1SXT A;  4F87 A;  5IYC G;  1EY5 A;  2K7V A;  1FGU A;  2BH8 A;  3DM1 A;  4GOP C;  4P72 A;  3NHH A;  1FJG Q;  4XYO A;  1CKM A;  2DNC A;  2BH2 A;  1HZB A;  2R6G A;  1HZA A;  1UAP A;  4DN4 M;  4LMQ D;  1PH8 A;  3W5O A;  2IHE A;  1UE5 A;  4LWC A;  4OO1 G;  1Q1E A;  4C1N K;  2EY1 A;  2WKD A;  4AYB B;  3J7Y W;  4ID6 A;  3IAY A;  2B29 A;  2K33 A;  4A3J B;  1OTC A;  4OIK A;  4RA8 A;  5FO7 B;  4C3H B;  1D1I A;  1EEI D;  3H3V C;  2K5V A;  2N55 A;  4JOI C;  2F0D A;  3JAM L;  1EY8 A;  2RDG A;  2BE5 C;  4RGN A;  1TY0 A;  1YHQ A;  4NPS A;  2HHH L;  3I55 A;  4ZQ3 A;  2EYH A;  3IFD A;  5CV6 A;  1II3 A;  3A54 A;  4JBM A;  4OX9 Q;  2PMZ E;  5ELD A;  4PMC A;  1RCV D;  4DR6 L;  1XTC D;  1I3Q B;  3H0G B;  1JB3 A;  1TKW B;  4IUU A;  4I7A A;  4B08 A;  5LMN W;  4A3C G;  4PZ6 A;  1XYI A;  5FO9 B;  1E0B A;  5IY0 A;  3RD4 A;  4X65 Q;  4XIG S;  4J8Q A;  2Q2T A;  2K5N A;  4BY7 B;  2E2D C;  2EXZ A;  2N88 A;  4DV4 L;  3E3X A;  1ASZ A;  1LAC A;  1IXR A;  3D6C A;  4P2C B;  4RH6 A;  4EGV A;  3G6J B;  1VQ9 A;  3TS2 A;  1ET9 A;  2KCM A;  3A7A B;  1LUZ A;  4OIJ A;  2OTL A;  4A3D B;  2XTI A;  4A3K B;  4ZYS A;  1HQR D;  4BXX H;  3WWV A;  1CT1 D;  1HNZ L;  3S9W A;  1CZW A;  3RR5 A;  4EVO A;  4OWT B;  2XRQ D;  1DOM A;  3CCU A;  1YNJ D;  4CJ2 C;  1JJ2 A;  1B7Y B;  4A3M G;  3HKZ E;  4HSP A;  2RHQ B;  4C3I G;  4R4T A;  3STB D;  1TXY A;  1TS4 A;  4LFB Q;  3HOU G;  4DXF A;  1XNR L;  1TWH H;  3KF8 A;  3ICE A;  3X3M A;  4WFN 3;  2A1A A;  4RCO A;  1Y1V H;  2NZO A;  5KYI A;  1AN8 A;  3LWU A;  1SDF A;  2K5W A;  4LAA A;  5I6Y A;  4JI2 L;  1VQG A;  3RZD H;  5AJ3 L;  2VUM B;  3GV6 A;  1RDP D;  2RA4 A;  1GVP A;  3GTK B;  3PUY A;  3F2U A;  1E3P A;  2A6H D;  1SRU A;  4JI3 L;  5FLX c;  3BDO A;  1TS5 A;  4KN4 C;  4YIJ A;  4YCW A;  1Q90 A;  2K5H A;  4DV7 L;  1A63 A;  1KAB A;  1C48 A;  4B9X A;  3GTO H;  2AMC B;  4YWM A;  2F0K A;  4YHH L;  3J80 L;  2KEN A;  3C2P A;  3T56 B;  2DN8 A;  4A3F G;  1KQS A;  5ELE A;  1HZC A;  1FD7 D;  1X9N A;  4IUV A;  4MNO A;  4G7H C;  2HHH Q;  3CW2 C;  1SYD A;  2F0G A;  2XSC A;  1ENC A;  2K6A A;  2KUM A;  1KAA A;  3URY A;  1CUK A;  4MIU A;  1EWC A;  1WTW A;  1LYL A;  3KLS X;  4Y7N B;  1ESR A;  2O2L D;  4OL7 A;  2Z6K C;  4OEL B;  5M9O A;  1EYG A;  2WB1 G;  2JQO A;  3WOF A;  3S1M B;  2OQK A;  3NWS A;  1UNS A;  1WTP A;  5KIX A;  3DWP A;  2LSS A;  1OXV A;  2I5M X;  3C46 A;  3D6W A;  4HMI A;  5GQO A;  3BDL A;  5FO8 B;  4MHE A;  4C3J H;  4ZRZ A;  5EPK A;  1HNZ Q;  3A8K E;  4K5V A;  4LUV A;  2B2W A;  1NMG A;  5DNF A;  3PUX A;  2D2C C;  3ER0 A;  3HOZ G;  1QCB D;  2ZTD A;  1STA A;  1FNV A;  3MXG A;  2F0F A;  2D0O A;  1JT8 A;  1IW7 D;  1QOH A;  2Q2H A;  3KK7 A;  1XNR Q;  2WKC A;  1LTG D;  1HA5 A;  3M7G A;  1HHV A;  2AWO A;  3PO2 H;  2B3G A;  2KJX A;  1SNC A;  2R7Z B;  4OON A;  2B2T A;  1EQQ A;  1J9O A;  5LMU L;  3E9I A;  2KED A;  5AJ3 Q;  3A8I E;  1Y14 B;  4DUY L;  1LAB A;  3ULL A;  4B3T L;  1U5K A;  1T5X D;  5JJK A;  3R2I A;  2ENB A;  4L5T A;  3UDF A;  5HGT A;  1C7Y A;  3S16 H;  3H91 A;  3UDG A;  3BZC A;  2F4V L;  3M4Y A;  3MXN A;  2JA6 G;  3ONA B;  1E22 A;  4KMU C;  1UUP A;  1PRT D;  4ME3 A;  3QJY A;  3PF5 A;  2RCN A;  3BDC A;  1H9S B;  3EJI A;  2BA1 A;  4RMF A;  2YU9 H;  1EIF A;  2HIV A;  2J0T D;  2IX0 A;  3NEL A;  4C3H G;  4YHH Q;  4JI6 L;  3MXU A;  2EQS A;  1AEX A;  4C56 C;  3I73 A;  2VQE L;  2NVY H;  3SDZ A;  4B3M L;  1SMY C;  4X3T A;  4OWW B;  1Y69 U;  3J7Z C;  2AQ1 B;  3H0G G;  1J5E L;  3WDN A;  3I4N H;  5IYB H;  4FO2 A;  4H02 A;  4R4I A;  3TDQ A;  1FYC A;  2F0W A;  3DM3 A;  1WD0 A;  3GTQ B;  2F0I A;  2E2J H;  4CKC A;  1GD7 A;  5IWA L;  3M9B A;  3A56 A;  4O0A A;  2ZJR A;  3VR6 A;  1FNU A;  4IUR A;  3U9S A;  4KN7 C;  1B50 A;  4AH6 A;  3CME A;  4CKE A;  2RSN A;  4A3D G;  1TR5 A;  2NN6 I;  1WCM G;  2KEC A;  3T1H L;  1DYQ A;  1EY9 A;  4EX5 A;  1PZI D;  3KDF A;  1IL8 A;  5H1S E;  1KAW A;  2AHO B;  1U4L A;  2C35 B;  2JN4 A;  1IL2 A;  3K6O A;  4CDE C;  1CQF A;  2IX1 A;  4RAU C;  1PH1 A;  3BJU A;  4X3K A;  3HKS A;  1QNK A;  4HTH A;  2WFW A;  4M1U B;  1CA5 A;  1GUG A;  4PZ7 A;  1GUO A;  1ILP A;  1QVF A;  2PI2 E;  3KOJ A;  2DJF C;  1ZYR D;  4X64 L;  1K0R A;  3Q23 A;  3M3Y H;  5C3E B;  3FP9 A;  4G57 A;  3HOX H;  1A6X A;  3A5U A;  4A3G H;  1Y8N B;  4K2K A;  3R2T A;  5J22 A;  3NQT A;  2I0Q A;  1UWV A;  1I4P A;  1PRT B;  5E7N A;  2R7F A;  2PQA A;  1I94 L;  4GOP A;  5LMU Q;  1SAP A;  2L9H A;  1Y8P B;  3FRP B;  1F9R A;  3HS0 C;  4JBK A;  3SGI A;  4DUY Q;  4J6H A;  2JEA I;  3RLN A;  4FF4 A;  4B3T Q;  4ODG A;  3OSO A;  4IUP A;  4YWK A;  2K28 A;  4F88 A;  2F4V Q;  1YJ9 A;  4X3U A;  2NVX B;  1VQJ A;  2L11 A;  2CVR A;  2UXD L;  1FNW A;  2MNA A;  2M9V A;  4LF5 Q;  3OMC A;  4GS3 A;  4JI4 L;  1Q7Y C;  1S5E D;  4JOI A;  4ULL A;  1XPU A;  4NW2 A;  3H6M A;  3CCV A;  4JI6 Q;  1L0Y B;  1A62 A;  1HZ9 A;  2IW3 A;  3VR3 A;  2FFK B;  2I07 B;  2AKW B;  4KKU A;  4DKA C;  5IE8 A;  1JC7 A;  1STY A;  2C9O A;  2DY7 A;  5EAY A;  2GA4 B;  4ZAI A;  3MXN B;  3J81 c;  1J5E Q;  1EY0 A;  1SYG A;  3TRE A;  3JAM E;  4GLA C;  2QKI C;  3J81 i;  1E2W A;  1PFB A;  1TWC B;  2D9U A;  2F3W A;  1V8Q A;  1F2Y A;  5IWA Q;  2EPB A;  3A55 A;  1I4R A;  4GNX B;  2L0C A;  2EVB A;  2F0M A;  3NUC A;  3ITP A;  3DMU A;  4F7X A;  1B4O A;  1YHB A;  4KHV A;  1NMF A;  1W6J A;  3T1H Q;  4CKB A;  2Q8T A;  1ZEQ X;  2YU9 B;  2QDB A;  2E2I H;  3KFU A;  1I4H A;  1LT3 D;  4UHV A;  2F03 A;  1CSQ A;  1JE4 A;  1LTS D;  1QIL A;  2JA9 A;  2LMC B;  5DM7 3;  2NN6 H;  2JE6 I;  2K1B A;  3KJO A;  2VW9 A;  4X64 Q;  1S5D D;  4O1N A;  3GDE A;  5GRO A;  3MEH A;  1C8C A;  1C0A A;  3FEW X;  2ZXP A;  4P71 A;  1Q86 C;  1KRT A;  3KDF B;  1N32 L;  1B9M A;  1EYC A;  1SNP A;  2H5X A;  1BBW A;  1I94 Q;  1X54 A;  1GJX A;  4IAL A;  3H15 A;  4A3J H;  4JYA L;  2HIX A;  4POF A;  1PZJ D;  1VQC A;  3Q24 A;  1RL2 A;  2UXB L;  2F0Q A;  2KEE A;  5JAV A;  1ILQ A;  1JR0 D;  4JG2 A;  3R3O A;  4UPA A;  1MSG A;  3Q0A A;  1KDC A;  3TZU A;  4B3S L;  1GUS A;  1TS2 A;  5K36 H;  3I4L A;  2UXD Q;  3M4Q A;  4BXX G;  1ENF A;  4L5S A;  5IP9 H;  3BYT B;  3RMH A;  4JI4 Q;  1U9R A;  4KHZ A;  1SYB A;  2HQE A;  1NE3 A;  2PQA B;  4GOP B;  2Y0S G;  3CCS A;  3GQB A;  1W3S A;  1XXG A;  3R8B A;  5C0X I;  1BOS A;  1VQD A;  1LO5 D;  4BY7 H;  1LLR D;  2BDO A;  2KHI A;  1F9S A;  3S14 B;  1FJG L;  2RVL A;  1PH3 A;  3K58 A;  2X6G A;  1U4R A;  3M3Y B;  4XYQ A;  3W1B A;  2HCI A;  2K52 A;  1Y1V G;  1DJR D;  2Q2I A;  3GTJ B;  5FLX L;  5JEA H;  3MEF A;  1AFP A;  2Z6K A;  1T5E A;  2E8G A;  3CPW A;  1BKB A;  4A3K H;  1YEZ A;  4BBR B;  1OO9 B;  1DD2 A;  3CHB D;  5G3L F;  4IOA A;  3UI2 A;  1JOQ A;  2A6E C;  1QE6 A;  4LFC L;  3NE5 B;  4OX9 L;  3DEP A;  2YTX A;  3SXH A;  1JOK A;  4FXK C;  4KI0 A;  3CQZ H;  1NBW A;  3I90 A;  3LWE A;  3FPP A;  1VQB A;  4UAI A;  3SR1 A;  1EU4 A;  3ULJ A;  5M3M H;  3J7A V;  2X69 A;  4EQP A;  3K80 C;  1GUW A;  1HH2 P;  3MVV A;  2KHJ A;  1PV4 A;  1MSH A;  1NCV A;  1BUV T;  5EGT A;  2VUM H;  4PV1 C;  3GTK H;  3E0J A;  3RLO A;  2WII B;  5C44 B;  2QIL A;  2K5Q A;  1EZ8 A;  5EQ0 A;  5T1I A;  1I5F A;  5ELO A;  4XQQ A;  4IO9 A;  3LNN A;  3HRZ C;  3D31 A;  1RD9 D;  5LHY 1;  5DEH A;  5JPN C;  2XNA C;  5CR3 A;  1N32 Q;  4X3S A;  2ZJP A;  5IT9 c;  1K3B C;  5LL6 X;  1TQO A;  1VS0 A;  5FJ8 H;  4JYA Q;  3PSI A;  1GM5 A;  1X3G A;  1QZH A;  4FF2 A;  2UXB Q;  1GHJ A;  2Q2U A;  1X3P A;  4KD3 A;  3FMC A;  1BNZ A;  3EVQ A;  4LUO A;  4EQ5 A;  4QUC A;  4DAV A;  4B3S Q;  4C3J G;  2EY2 A;  3AEV A;  1BQQ T;  1S40 A;  1A15 A;  3HP3 A;  3DHQ A;  5GAG C;  4Y7N H;  3ERS X;  4IPH A;  3T1Y L;  4H0L C;  1ESF A;  2JYO A;  4HR7 B;  4B3R L;  4TVA B;  1GKH A;  2Y0S E;  5GAD C;  5FKA C;  4TKO B;  1Y1W B;  4L5R C;  1EUJ A;  3S1M H;  4TSS A;  4JV5 L;  1Q46 A;  3V2T A;  1MD2 D;  2SEB D;  3PO2 G;  2QDL A;  1CSP A;  4YCV A;  2KOL A;  5C4J B;  4FP5 D;  5C0X H;  1QZG A;  4NMZ A;  3RZO B;  3L7Z C;  4K6L A;  5J3B A;  2K5D A;  2TSS A;  3TP8 A;  3M4O H;  4H13 C;  3NTI A;  4QIW E;  2ZM6 Q;  1AE3 A;  1X32 A;  2FMM A;  2EYO A;  1HA6 A;  2RQX A;  4IQZ A;  1D2B A;  1U4M A;  2BCO A;  5FLM H;  4KY7 A;  3IKJ A;  2OQ0 A;  4UDU C;  2F52 A;  1IYV A;  1L2F A;  4LFC Q;  2RCF A;  3B6Y A;  1F2Z A;  1SE2 A;  1DOL A;  1LV9 A;  5IGD A;  3EIV A;  4LF6 L;  1QNU A;  4BY1 B;  4DAM A;  4CDD C;  2R7Z H;  2JA8 B;  5HY6 A;  1PMR A;  3S17 B;  4RCN A;  4DPG A;  1J6Q A;  2HD3 A;  3BYY B;  1ENA A;  2KHS A;  4RHS A;  3NK9 A;  1XX8 A;  2V1C C;  1GHK A;  3VYR A;  1K3R A;  2IJ0 A;  1SN8 A;  5EBC A;  2QF7 A;  2EDG A;  4IPG A;  1TWG H;  5CMD A;  4A93 B;  3RNU A;  4DAY A;  4WJ3 M;  4QF4 A;  3NTK A;  5IYB G;  3I4N G;  1D5Z C;  1LT5 D;  5KNB A;  3VR2 A;  4RG1 A;  2KCN A;  2ZJQ A;  2EJG C;  4DK0 A;  1CFM A;  4RKB A;  5IIF A;  5KGU A;  2K04 A;  1IBM L;  4A3B G;  1JWM D;  1G2T A;  2ATW A;  4HN7 A;  2L4N A;  5D14 A;  2IHF A;  1DON A;  3KLW A;  4DR7 L;  4CJ1 B;  4RGO S;  1YNX A;  2F0E A;  1Z7T A;  3W1G A;  5IGB A;  4MZ9 A;  4DAP A;  3K5O A;  4PZ8 A;  2ASB A;  1BCP C;  1S5C D;  3CQZ B;  1NJI C;  4HCS A;  2G9H D;  3LX0 A;  2LXJ A;  1F9Q A;  1JMC A;  5M3M B;  2KVM A;  2PW7 A;  3GTQ H;  5BR8 L;  3T1Y Q;  2Z4H A;  1LTL A;  2AWN A;  4B3R Q;  1E1T A;  1G8Z D;  2LS0 1;  2JA5 B;  2CH4 A;  4JV5 Q;  1PVO A;  1KHI A;  1B53 A;  3HOX G;  3BVZ A;  1Q82 C;  4A3G G;  3OWE B;  3MHB A;  4FVM A;  1AW7 A;  3NP8 A;  1VF5 C;  1I4Q A;  2PNH A;  2XVS A;  2B63 B;  1X55 A;  3PMF A;  4M8A A;  1XWE A;  2VB3 X;  3E6Z X;  2L1B A;  4V0B A;  1RTO A;  4L8J A;  3TRZ A;  5COY A;  1YHA A;  4ALP A;  2EYP A;  1N33 L;  2F0O A;  5IGG A;  4XXE A;  2NZ1 D;  3H94 A;  5C3E H;  1K9M C;  3GTL H;  4LF6 Q;  4ZLT F;  3F2B A;  3BVG A;  3CD6 A;  3G71 A;  5IP7 H;  2HDL A;  3GTP B;  1HTL D;  5M5Y B;  1SFO H;  1MBY A;  1GXD C;  1LT4 D;  4C1N I;  1EEF D;  4QUF A;  1HQM C;  3TME A;  5KYL A;  1T9H A;  1B44 D;  2CWA A;  4MTK A;  2F0H A;  1KD1 C;  1HUM A;  2PW5 A;  3JC6 6;  4OEM B;  3PIO A;  1QUQ A;  1YJW A;  2NVX H;  1HTP A;  1K8G A;  1IYU A;  3U4Z A;  4JW0 A;  1SND A;  1Q81 C;  3C1F A;  3TP5 A;  1SNM A;  5G3L D;  4XT1 B;  1HR0 W;  2WAQ G;  3M4O B;  1IBM Q;  2L5T A; 
#chains in the Genus database with same CATH homology
 1Q8K A;  4R1J A;  4JBK A;  3SGI A;  2MQH A;  3I4M G;  1Q1B A;  4DUY Q;  4OWX B;  4DUZ L;  2JEA I;  3RLN A;  1YIJ A;  4DR7 Q;  4NXM L;  4B3T Q;  3H3V I;  3S1N H;  3OTO L;  4DR4 L;  4A3L H;  4YWK A;  3BU2 A;  4DK3 C;  2F4V Q;  3PUV A;  1YJ9 A;  3CCQ A;  4DAY B;  1VQJ A;  4LF7 L;  1XNQ Q;  3GO5 A;  4OO1 G;  3PF4 A;  2E2H H;  2UXD L;  2A8V A;  4A3D H;  4NXN L;  1A0I A;  1WCM H;  3NEN A;  2R7D A;  2MNA A;  4LF5 Q;  3FKI G;  4GS3 A;  4JI4 L;  1Q7Y C;  1TWC H;  4JOI A;  5BR8 Q;  4YCU A;  1XPU A;  1L1O A;  3CCV A;  4C2M H;  1CKN B;  1WOC A;  1JB7 A;  4JI6 Q;  1HZ9 A;  1A62 A;  2N49 A;  1M1K C;  3HOV H;  1QVC A;  2NN6 G;  1X65 A;  2AKW B;  4APV A;  3S2H H;  4A3E H;  3AQQ A;  4A4I A;  4DKA C;  5IE8 A;  2GVB A;  3A74 A;  1VQ4 A;  4Y52 H;  1OXX K;  4JI1 Q;  1XMO L;  1VQN A;  2K75 A;  1SLJ A;  3GTM H;  4LF8 L;  5EAY A;  4YY3 Q;  1IBK Q;  3G4S A;  1VQ7 A;  4BBS G;  3M4P A;  3MXN B;  3J81 c;  3HFZ B;  1EFW A;  1J5E Q;  3TRE A;  3AYH B;  4GLA C;  3KF8 B;  1YZ6 A;  1WI5 A;  2RF4 A;  3J81 i;  4AYB G;  3CF5 A;  3I4O A;  1N34 L;  3PO3 H;  4X6A H;  4LF9 L;  4LF5 L;  4IJH A;  4HIK A;  5IYD G;  4QGU A;  2JA7 H;  2VY3 A;  1DGS A;  4A3J G;  1HJP A;  5IWA Q;  4HIO A;  4X65 L;  4IJL A;  1UE7 A;  4DV5 L;  4GNX B;  3CMA A;  1C9O A;  4OO1 I;  3CP0 A;  3I4M H;  1PH2 A;  1PH4 A;  1W2B A;  1PA6 A;  1TWF H;  3EBE A;  1N33 Q;  3S2D H;  4P74 A;  1IBK L;  1MKH A;  1YHB A;  5LMN L;  5K36 G;  1JJG A;  2N78 A;  2WP8 J;  1XTD A;  4LNQ A;  1NMF A;  5IP9 G;  3T1H Q;  3A5Z B;  3UDI A;  3CCM A;  2N3S A;  1VQM A;  4BBR G;  2R93 G;  3DLL A;  4JI7 Q;  1FVI A;  2E2I H;  3FKI H;  3KFU A;  2QGQ A;  2CQO A;  1X3F A;  2UU9 Q;  4BY7 G;  1CSQ A;  3CCE A;  2JA9 A;  2L15 A;  3HKZ G;  4DR3 Q;  1X3E A;  1CKO A;  3K0X A;  2E5L L;  4L5S A;  1Q12 A;  1VQ5 A;  2R92 G;  1KRS A;  2JE6 I;  3AFQ A;  3KJO A;  2WB1 E;  2D0P A;  3F1Z A;  1WYD A;  4LFB L;  2VW9 A;  4X64 Q;  2K4K A;  1XPO A;  3GDE A;  5GRO A;  2JK8 A;  1VQO A;  5JEA G;  4R4C A;  1VCI A;  4BBS H;  1XPR A;  1E24 A;  1C0A A;  4JBW A;  4JI5 L;  1A8V A;  1OXS C;  4P71 A;  4A3K G;  1Q86 C;  1KRT A;  2UUA Q;  3KDF B;  3S1Q H;  1N32 L;  4DV3 Q;  2QA4 A;  3HOY G;  5JEA J;  1AE2 A;  2H5X A;  1BBW A;  1I94 Q;  1X54 A;  4DK6 C;  1YI2 A;  1BBU A;  4WJ4 A;  5IYC G;  3H15 A;  5IYD H;  4A3J H;  4JYA L;  2UU9 L;  1FGU A;  2F3I A;  2HIX A;  3KF6 A;  4POF A;  3RN2 A;  2BH8 A;  1HNW L;  1Z47 A;  1V9P A;  1VQC A;  4GOP C;  4P72 A;  3S1R H;  2VQF Q;  1RL2 A;  4DUZ Q;  1FJG Q;  3HOW G;  4IFD I;  2K14 A;  2UXB L;  1CKM A;  5C44 G;  2DGY A;  4NXM Q;  3S14 H;  1VQ6 A;  4R4O A;  1IBL L;  3CXC A;  2BH2 A;  3TS0 A;  3OTO Q;  4JG2 A;  1NTG A;  1HZB A;  4DR4 Q;  1G29 1;  5JJI A;  4R4Q A;  2R6G A;  1HZA A;  4UPA A;  2I5H A;  3HOU H;  1QUQ B;  3PCO B;  4LF7 Q;  3AFP A;  4DR6 Q;  4B3S L;  3GTJ H;  4DR2 L;  1PH8 A;  3W5O A;  2IHE A;  1UE5 A;  2UXD Q;  3M4Q A;  4LWC A;  1VQP A;  1Q1E A;  5M3M G;  3STB C;  1K8A C;  2BA0 A;  2K50 A;  2KBN A;  3G48 A;  5IP9 H;  3I7F A;  1S72 A;  4DNI A;  3IRB A;  4HJA A;  4JI4 Q;  4KHZ A;  3FHW A;  4BBR H;  2R93 H;  3H3V H;  1NE3 A;  2B29 A;  2PQA B;  1V43 A;  4GOP B;  1OTC A;  2RHS B;  3CCJ A;  4DV1 L;  2Y0S G;  3CCS A;  3CCL A;  1W3S A;  1G6P A;  5C0X I;  2VUM G;  1VQD A;  2K5V A;  3CAM A;  4GN3 B;  4DV4 Q;  4JOI C;  3A0J A;  4BY7 H;  2CWP A;  2KHI A;  1L1O C;  1PH5 A;  3F2C A;  2VQF L;  1FJG L;  1YHQ A;  4NPS A;  2HHH L;  3PUZ A;  3I55 A;  1PH6 A;  1PH3 A;  4DV6 L;  4IOC A;  1XMO Q;  2R92 H;  1PH9 A;  3E9H A;  4LF8 Q;  1VQE A;  4JBM A;  4OX9 Q;  1N9W A;  1P16 A;  2PMZ E;  4J15 A;  4AQY L;  3KJP A;  4K0K L;  3PGZ A;  4QJF A;  3W1B A;  2K52 A;  1Y1V G;  2Q2I A;  4DR6 L;  3MEF A;  2Z6K A;  3F2D A;  2E8G A;  2IT1 A;  1N34 Q;  3CPW A;  1BKB A;  2CFM A;  3G6E A;  5LMN W;  4A3K H;  1YEZ A;  3NBH B;  4LF9 Q;  4PZ6 A;  4A3C G;  4LUZ A;  2ZTC A;  2YTY A;  1YBY A;  4AYB E;  5FJ8 G;  3HOY H;  2OTJ A;  5IY0 A;  2ES2 A;  1L1O B;  4X65 Q;  4XIG S;  5GAE C;  4X66 Q;  1VQF A;  3I56 A;  2Q2T A;  2K5N A;  5IYC H;  4DV5 Q;  4DV4 L;  1Y1W G;  4UP7 A;  1ASZ A;  4IOA A;  4KLK A;  1IXR A;  3J7A 5;  4AIM A;  1VQK A;  3HOW H;  4QY7 A;  4GN5 A;  5C44 H;  1U0L A;  4LFC L;  2LXK A;  4LFA L;  1VQ9 A;  4OX9 L;  3ULP A;  2YTX A;  2QEX A;  5LMN Q;  3TS2 A;  4KI0 A;  2KCM A;  3CQZ H;  1NBW A;  1LUZ A;  2NZH A;  2OTL A;  4LW1 A;  4IFD G;  1VQB A;  2XTI A;  1M90 C;  5JJL A;  1SE8 A;  3ULJ A;  3WWV A;  4JI2 Q;  5M3M H;  4BXX H;  3UE0 A;  1HNX Q;  1HNZ L;  4BA2 I;  3K80 C;  1HH2 P;  1O7I A;  3L0O A;  3RR5 A;  4A75 A;  4IFD J;  4GKK L;  2KHJ A;  1V1Q A;  1PV4 A;  4X66 L;  2UUB L;  1VQI A;  4OWT B;  4JI8 L;  1H95 A;  3CCU A;  1B8A A;  2VUM H;  2UXC L;  1JE5 A;  1JJ2 A;  1B7Y B;  3GTK H;  4JCV E;  3RLO A;  3HKZ E;  4A3M G;  2E5L Q;  3ZJY C;  2RHQ B;  1AH9 A;  1D7Q A;  4JI3 Q;  4R4T A;  4LF4 L;  4GN4 B;  3STB D;  1TXY A;  4GLV B;  4HJ5 A;  1I5F A;  1JJC B;  5ELO A;  1YIT A;  3HOU G;  1X56 A;  1XNR L;  4LFB Q;  4IO9 A;  1TWH H;  5C0X G;  5GAH C;  3ICE A;  3U50 C;  4DV7 Q;  3D31 A;  2A1A A;  4BY1 G;  4JI5 Q;  4X62 L;  1Y1V H;  2NZO A;  5C4X G;  1N32 Q;  1KIX A;  2JA8 G;  3UDX A;  2ZJP A;  1BVS A;  3JAM c;  5IT9 c;  5C0X J;  1OXT A;  4JI2 L;  4A3C H;  1HNX L;  4HID A;  3JAM i;  4HJ9 A;  1VQG A;  1VS0 A;  5FJ8 H;  4GNX A;  4JYA Q;  3PSI A;  3RZD H;  1GM5 A;  1SRO A;  1X3G A;  5AJ3 L;  4UP8 A;  1QZH A;  4OXP A;  1HNW Q;  4IPD A;  3HOZ H;  5FLM G;  3OYY A;  1GVP A;  1XJV A;  3TQY A;  3PUY A;  3VDY A;  3U58 A;  2Q2U A;  1E3P A;  2NVQ H;  2UXB Q;  1Y1W H;  4KHP L;  1SRU A;  1IBL Q;  2VZA A;  4JI3 L;  5FLX c;  4A93 G;  3D0F A;  4LUO A;  2MO1 A;  4YCW A;  4IPC A;  1EOV A;  3S15 H;  4NB3 A;  4EQ5 A;  1N8R C;  3M7N A;  4B3S Q;  1PYS B;  4DR2 Q;  2K5H A;  1MIU A;  4DV7 L;  1A63 A;  3AEV A;  5C4J H;  2R7Z G;  1S40 A;  2GVA A;  3GTO H;  5GAG C;  3RZO H;  4Y7N H;  3ERS X;  1QVG A;  2AMC B;  4IPH A;  4YWM A;  3T1Y L;  5ELN A;  1VQA A;  2KEN A;  4YHH L;  4A3B H;  3PIP A;  4DV1 Q;  4B3R L;  4A3F G;  4TVA B;  1XMQ L;  1KQS A;  3KF6 B;  4O2D A;  1KC8 C;  2WAQ E;  1GKH A;  1HZC A;  3F8T A;  2Y0S E;  1L0W A;  5GAD C;  4BXX G;  1X9N A;  2PI2 A;  4MNO A;  3L2P A;  4L5R C;  1EUJ A;  2HHH Q;  3CW2 C;  3S1M H;  1SMX A;  4A3M H;  4DV6 Q;  4HJ7 A;  4GKJ L;  4DV0 L;  4JV5 L;  4C3I H;  1Q46 A;  4JBJ A;  4YWL A;  4AQY Q;  3PO2 G;  1CUK A;  4K0K Q;  4FDB A;  1CSP A;  4YCV A;  1LYL A;  2HQL A;  3TEH B;  4NXN Q;  1QZG A;  1EIY B;  3BZK A;  3L7Z C;  4BY1 H;  1PFS A;  5J3B A;  1B70 B;  2YYZ A;  5C4X H;  2JA8 H;  3M4O H;  2ZTE A;  2Z6K C;  4QIW E;  2ZM6 Q;  1AE3 A;  3I2Z A;  3S17 H;  2VL6 A;  1UE6 A;  1EYG A;  2CCZ A;  2WB1 G;  2MFI A;  2JQO A;  2EXD A;  5FLM H;  1S3O A;  2JA5 G;  2OQ0 A;  4QQB X;  2OQK A;  2F52 A;  1UE1 A;  1FL0 A;  1L2F A;  4LFC Q;  4LFA Q;  2OWO A;  3B6Y A;  2KCT A;  1X6O A;  1GO3 E;  1VQ8 A;  2LSS A;  4A93 H;  1OXV A;  2I5M X;  4A3I G;  3EIV A;  4LF6 L;  5GQO A;  1I50 H;  4C3J H;  4DAM A;  1PYB A;  2R7Z H;  5M3F G;  2YTV A;  5HY6 A;  4BA1 I;  1HNZ Q;  2VNU D;  1N36 L;  2B63 G;  4LUV A;  2JJQ A;  1NMG A;  2ZM6 L;  4DPG A;  4HJ8 A;  1J6Q A;  3PUX A;  4GLX A;  2UUB Q;  3ER0 A;  3HOZ G;  4JI8 Q;  4GKK Q;  2ZTD A;  1OXU A;  1WJJ A;  4A3F H;  2UUC L;  2UXC Q;  1K73 C;  2V1C C;  2D0O A;  1JT8 A;  1K3R A;  3K7U C;  1SN8 A;  2Q2H A;  4JI0 L;  4DR5 L;  4LF4 Q;  4IPG A;  1TWG H;  1XNR Q;  3RNU A;  4WJ3 M;  3I4N G;  1HR0 Q;  5IYB G;  5DLQ E;  2AWO A;  3PO2 H;  4RG1 A;  2B3G A;  3J80 c;  4X62 Q;  4A76 A;  2ZJQ A;  4L5Q A;  4OON A;  3J80 i;  3S24 A;  1EQQ A;  5LMU L;  3E9I A;  1IBM L;  1CKN A;  4A3B G;  2ATW A;  3GD7 A;  1WFQ A;  2VQE Q;  2IHF A;  5AJ3 Q;  4DR1 Q;  3RN5 A;  1VQL A;  2Z0S A;  1Y14 B;  3KLW A;  3M85 A;  4DUY L;  4DR7 L;  3U4V A;  1YNX A;  1IZ6 A;  3ULL A;  1UEB A;  4GNX C;  1PH7 A;  1U5K A;  4B3T L;  4B3M Q;  4KHP Q;  5JJK A;  3J81 j;  4L5T A;  3W1G A;  2JA5 H;  1MJC A;  4MZ9 A;  3UDF A;  1C7Y A;  3S16 H;  3UDG A;  1K83 H;  3BZC A;  4PZ8 A;  2F4V L;  5C3E G;  2ASB A;  1E1O A;  1LM0 A;  1NJI C;  1PHJ A;  2JA6 G;  1HR0 L;  1XNQ L;  1E22 A;  4POG A;  3RLF A;  2FXQ A;  4ME3 A;  4HIM A;  3PF5 A;  2RCN A;  4A3I H;  2LXJ A;  1JMC A;  2BA1 A;  3E0E A;  4RMF A;  2YU9 H;  4P75 A;  1EIF A;  2HIV A;  5IP7 G;  3GTQ H;  3Q8D A;  5BR8 L;  2IX0 A;  3NEL A;  3T1Y Q;  5M3F H;  4YHH Q;  4JI6 L;  2EQS A;  2A19 A;  1LTL A;  2AWN A;  2DUD A;  2GN5 A;  3LGJ A;  2B63 H;  4B3R Q;  1I6H H;  1XMQ Q;  2ALY B;  2VQE L;  4DR1 L;  1E1T A;  2NVY H;  1E7Z A;  1EWI A;  1IYJ B;  3K81 C;  4B3M L;  1D8L A;  4JI1 L;  2HT1 A;  4DV2 Q;  3GTG H;  4GKJ Q;  4DV0 Q;  3PUW A;  4JV5 Q;  1PVO A;  4YY3 L;  4OWW B;  4TQU S;  1YVC A;  1KHI A;  4XTC S;  3HOX G;  1MJE A;  3J7Z C;  3H0G G;  1Q82 C;  1J5E L;  4A3G G;  3I4N H;  5IYB H;  3K8A A;  2VS1 A;  4H02 A;  4R4I A;  3CCR A;  3DM3 A;  4P73 A;  2E2J H;  2EIF A;  2PNH A;  1GD7 A;  5IWA L;  1X55 A;  3M9B A;  3GTP H;  4O0A A;  1G51 A;  5HGQ A;  2I5L X;  5M5Y H;  2ZJR A;  3KYH C;  3TRZ A;  1KL9 A;  5M5W H;  1KXL A;  4A3L G;  1RIP A;  1ASY A;  1YJN A;  1YHA A;  4ALP A;  3CC2 A;  3PV0 A;  4AH6 A;  4DV2 L;  3CME A;  2NVT H;  1N33 L;  3CC4 A;  5M5X H;  5C3E H;  2YV5 A;  4PMW A;  4A3D G;  2NN6 I;  4MTN A;  1K9M C;  1WCM G;  3GTL H;  2JA6 H;  3T1H L;  4LF6 Q;  4EX5 A;  3F2B A;  3KDF A;  5H1S E;  4UY8 C;  2ID0 A;  1KAW A;  2AHO B;  2CKZ B;  2JEB I;  1SR3 A;  2C35 B;  4JI7 L;  3CC7 A;  1IL2 A;  3OW2 A;  3CD6 A;  1N36 Q;  3G71 A;  3HOV G;  2IX1 A;  5IP7 H;  2D62 A;  4UP9 A;  4C3H H;  1PH1 A;  4DR3 L;  3BJU A;  4A3E G;  2XGT A;  3HKS A;  1Z9F A;  2OCE A;  1SFO H;  1NY4 A;  1TWA H;  4JC0 A;  2UUC Q;  2WFW A;  1T9H A;  3K7A H;  4PZ7 A;  1QVF A;  2CWA A;  2PI2 E;  3EN2 A;  1KD1 C;  3KOJ A;  4JI0 Q;  4DR5 Q;  1VQH A;  4PG3 A;  4X64 L;  1K0R A;  2MO0 A;  3JC6 6;  1R9T H;  3M3Y H;  1EQR A;  1QUQ A;  3PIO A;  1YJW A;  1P8L A;  2NVX H;  3FP9 A;  3NEM A;  3HOX H;  1K8G A;  4QL5 A;  1I3Q H;  3H0G H;  3A5U A;  3PO3 G;  2UUA L;  4A3G H;  3U4Z A;  1Q81 C;  2IY5 B;  2JA7 G;  4DV3 L;  2I0Q A;  1UWV A;  2N8N A;  5E7N A;  1HR0 W;  2R7F A;  2PQA A;  2WAQ G;  3UE1 A;  5LMU Q;  4GOP A;  1I94 L;  1IBM Q;  3CPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...