2ZM6L

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
total genus 10
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2zm6L00
4X65L 3ERSX 1Z9FA 1YHAA 5ELNA 4JI7L 5GAHC 1PH1A 5FJ8H 4PZ6A 2QEXA 4JBWA 3F2DA 1HNWL 2UUCQ 1I3QH 2IHEA 4FDBA 4AQYL 4LF7L 5JJLA 4IPHA 2Y0SE 3J80i 5JEAG 1K73C 1NTGA 4DR4Q 2PNHA 1AH9A 1VQOA 1V1QA 1VQAA 3CC2A 1EQRA 5GQOA 5M5XH 1VQ5A 1YITA 2V1CC 4IPCA 3S16H 3S2DH 1K0RA 5M3FH 4XTCS 2UXDL 1E22A 4JI1L 3S15H 4DV1Q 1QUQB 3DM3A 3J7ZC 2R93G 2ZJPA 3PO3G 3HOXH 3FHWA 4IFDI 4A3FG 3PO2G 3MEFA 4JI2Q 3M7NA 2ZM6Q 1WYDA 2A1AA 1D7QA 5C0XJ 3PIOA 4QGUA 4OO1I 1MKHA 1MJCA 1X56A 1OXXK 1HZBA 1IZ6A 3ULPA 1Q46A 4YY3Q 4OWTB 4POFA 5FLMG 4LFAQ 1HNZQ 1HR0L 1ASZA 4JI8L 4GKKQ 1PYBA 3HOWH 4HIOA 1KD1C 2NZOA 1HNXQ 2MO0A 1N36L 2VQEL 1EOVA 1OXTA 3S24A 1YEZA 3J80c 1Z47A 4LW1A 3GTMH 3HKZG 5C44H 2VQFL 4IPGA 3K80C 3STBC 4B3RQ 1VQFA 4P75A 4JI3L 2ZTCA 3Q8DA 4GNXB 4JV5L 2PQAA 2YTYA 5IP7H 3M3YH 3KJPA 3K0XA 1KRTA 2UU9L 1NBWA 4X6AH 4P74A 3OW2A 2AHOB 3HFZB 3NELA 4AIMA 1UE1A 4LNQA 4JI5Q 1PH6A 4A3DG 2ZM6L 4ALPA 2IY5B 2QA4A 3I2ZA 2HHHL 4R4TA 4BBSH 2Q2IA 4JOIC 4DR6Q 5LMNL 2I5LX 3NBHB 4DK6C 1IBML 4YCUA 4B3MQ 2OQKA 4DV7Q 1N9WA 1VCIA 1XTDA 4DR5L 1MJEA 3K7AH 1HZ9A 4OWWB 1OXVA 1Q8KA 5IYBG 3S1MH 1EIFA 2PMZE 3CCMA 4JI4Q 3M4QA 3U4ZA 2KENA 1YI2A 3L7ZC 4MTNA 4NXNL 2JQOA 4YWMA 2Z6KA 3S1QH 3SGIA 1BVSA 1O7IA 2K52A 4L5TA 2KCMA 3NEMA 3A74A 3S14H 4A3CG 2R93H 1EWIA 3PO3H 3PO2H 3OTOL 2YU9H 1NE3A 4K0KL 3RLNA 1K8AC 1Q86C 1VQIA 3M4PA 4UP7A 4DUZL 2ZJQA 1WOCA 3TS2A 1JT8A 4QIWE 3MXNB 3RR5A 2ATWA 1HJPA 4X62Q 2B3GA 5FLMH 4A3EH 1AE3A 2D62A 1J6QA 2C35B 4LWCA 3UE0A 1JB7A 2LSSA 4DV0Q 1VQEA 1Q82C 2CCZA 1XNQL 2NVQH 1PH9A 2HIXA 4IOAA 2MO1A 4DV5Q 5IE8A 3CC7A 4GNXC 1FGUA 1I94Q 1EFWA 1A62A 2BA1A 1YIJA 5IYDG 3UDGA 2E5LL 2KBNA 3PUZA 4LF4Q 1QZGA 4MZ9A 3H3VI 2CFMA 1SLJA 1SROA 1JJGA 1P16A 3G71A 1OTCA 2NN6I 4JBKA 4YCWA 3UDIA 5JJKA 4DUYQ 1SFOH 4LF8Q 3HOVH 2MFIA 4NB3A 2R6GA 3B6YA 1VQDA 1SN8A 5AJ3L 3TRZA 4OX9L 2VW9A 4HJ7A 4QJFA 2Q2HA 2UXCL 3HOYG 1PH7A 2B63G 1S3OA 3E9HA 4X66Q 1X3FA 1YVCA 4GS3A 5M5WH 2UUAQ 4B3TL 4L5RC 3ZJYC 5IYBH 1PFSA 1VQMA 5LMUL 4A3MG 4A3GG 3AYHB 3PSIA 4YCVA 4DAMA 1Y1WG 1XMQQ 4MNOA 4JYAL 1N32Q 1H95A 1LUZA 1TWHH 3H0GG 1HR0W 1MIUA 4B3SL 4DR3L 1RIPA 4JI6L 4LF5L 2NVYH 4LF4L 4A3CH 1C9OA 2Y0SG 5GADC 2B29A 2UXBL 1UE5A 3G6EA 2ZJRA 4HIDA 1NJIC 1X55A 2UUBQ 3JC66 3F8TA 4P73A 4YHHL 2K75A 4WJ4A 4DR1Q 1G291 4KHPL 1YHQA 5HGQA 3L0OA 4GOPA 4IFDG 3KF8B 4Y7NH 1WJJA 2ASBA 2R7DA 1CKNA 1W2BA 1VQHA 4DV3Q 1JJCB 2K4KA 1J5EL 4R4IA 2I5HA 4LFCQ 4BY7G 4GN4B 2YTXA 4OO1G 4ME3A 3A0JA 3VDYA 3CF5A 5JEAJ 1WI5A 3KF6B 4X66L 4A3LG 3EBEA 5ELOA 2E2IH 2NVXH 2K5HA 1TWFH 4EX5A 1YZ6A 2ALYB 2NZHA 3PV0A 4JBJA 4TVAB 5LMNW 1PH4A 1Q1EA 2E2HH 2F4VQ 1VQ9A 1KL9A 4BXXG 4KHZA 2ZTEA 4QL5A 2I5MX 4A4IA 1N8RC 4JC0A 1XPRA 1RL2A 4LFBQ 4DV4Q 5BR8Q 2AWNA 2RCNA 2FXQA 3I55A 3KLWA 2UUCL 2IT1A 4R1JA 4UY8C 1N33Q 2RF4A 1VQCA 1V43A 1VQ7A 4DR4L 3GTLH 4C3IH 2VNUD 2N49A 3BZKA 2WB1E 1Q7YC 4BY1G 4A93G 3HOYH 2JA6H 3I4NG 2B63H 1L1OA 3RZDH 3UDXA 4DK3C 1YJWA 4C2MH 4JCVE 2F3IA 1U0LA 1A8VA 4DPGA 1SE8A 1VQNA 5M3MG 2PI2A 2JJQA 5GROA 4DV1L 1YHBA 4OONA 2BA0A 5C4XG 4L5SA 4BBRG 3T1YQ 1B8AA 3H0GH 3GO5A 3T1HQ 1QZHA 3A5ZB 4JI2L 1IL2A 1BBWA 1HZCA 3KDFA 2VUMG 5IWAQ 3PUXA 4A3IG 2E2JH 2RHQB 3BU2A 1NY4A 1CUKA 1IBKQ 4R4OA 1FJGQ 2EQSA 2VY3A 3WWVA 1CKMA 4YY3L 4TQUS 1HNZL 3G4SA 4LFAL 3RN2A 4BA2I 3M9BA 2D0OA 4GKKL 1WFQA 1GO3E 1HNXL 4HJAA 4HIMA 3CD6A 1FL0A 1C7YA 1JMCA 3PIPA 4BY7H 4LF6Q 1UE6A 1EIYB 2PQAB 1IBLQ 2JK8A 2JE6I 1PYSB 1LYLA 1QVGA 2K50A 4B3RL 4X64Q 2I0QA 4A3FH 4A3LH 4GKJQ 1KAWA 4A3BG 4P72A 3CCRA 3L2PA 2HQLA 2R92G 1HH2P 5M5YH 4HJ9A 3UDFA 2ZTDA 4RMFA 4BXXH 1LM0A 3NENA 4JI5L 4DNIA 1X9NA 3TS0A 1PH2A 1Q81C 2KCTA 4NXMQ 4IJLA 4PG3A 3S2HH 2YYZA 3KOJA 2RHSB 2XGTA 2HIVA 2Z0SA 3D0FA 2OQ0A 2E8GA 4GN5A 4IJHA 3ER0A 4DR2Q 1VQPA 1JE5A 1X3GA 3CP0A 4GN3B 5GAGC 5E7NA 5IYCG 2R7FA 4DV7L 4B3ML 4J15A 3RZOH 4YWLA 3W5OA 3AQQA 2NN6G 2Q2UA 4JI4L 1PH5A 4A93H 2VS1A 4BY1H 4HJ5A 4DV6Q 3HOZG 3I4NH 1XMOQ 3I4OA 1UE7A 4A75A 3GDEA 4A3KG 1PA6A 4JI0Q 1K3RA 3GD7A 3CQZH 1B7YB 2JA8G 4AYBE 1XNRQ 4O0AA 3F2CA 2QGQA 3GTOH 3KJOA 1Y1VG 3W1GA 1TWAH 1TWCH 4BBRH 4DV2Q 3CW2C 4A3DH 1UEBA 1VQKA 2OTJA 5K36G 2VUMH 1IYJB 2K5VA 3FKIG 4A3IH 1N34Q 5H1SE 2AKWB 3HKSA 2KHIA 4JG2A 1M1KC 3S1NH 3AFQA 2R7ZG 4DR6L 4X62L 3IRBA 5EAYA 4X65Q 4XIGS 1TXYA 2PI2E 2GVBA 4DV0L 4QQBX 1HNWQ 1K83H 4Y52H 4DR2L 4AQYQ 4LF7Q 3TREA 5IP9G 1FVIA 4C3JH 4DV5L 1CSQA 2JEAI 1I94L 3EN2A 4PMWA 3M4OH 1CKOA 1I5FA 1VQGA 4DV6L 3W1BA 3CPWA 3F2BA 1PV4A 4JOIA 4JBMA 1GVPA 2XTIA 4JI1Q 3TQYA 3HOUG 4A3BH 1A0IA 1Q12A 3I56A 1X3EA 5IT9c 1M90C 3AEVA 2WP8J 3ULLA 2R92H 1P8LA 1VQJA 2WAQE 5C4JH 2Q2TA 4DUYL 4LF8L 2IX0A 3G48A 1QUQA 3CC4A 2JA7G 1V9PA 2BH8A 1B70B 2YV5A 2Z6KC 1UWVA 3I7FA 1ASYA 4LUOA 1A63A 4OWXB 2WFWA 1YJ9A 4LUVA 2AWOA 3H3VH 3BZCA 1YJNA 5IYCH 2LXKA 3BJUA 1HR0Q 1U5KA 3U58A 2UUAL 4JI8Q 4KI0A 4KLKA 3GTGH 4IFDJ 2NVTH 1KXLA 1GKHA 5IYDH 3HOZH 3E0EA 1N36Q 1OXUA 2VQEQ 1XMQL 2IHFA 1N32L 2DGYA 4IOCA 1X65A 4A3KH 2JA8H 2VQFQ 1EYGA 5C0XG 2MNAA 3RN5A 1EQQA 4JI3Q 4JV5Q 4GLAC 1Y1VH 3PF5A 2UUBL 2JA9A 3RLOA 4GOPB 3CCJA 4IPDA 3TEHB 2WB1G 2ID0A 1CKNB 3LGJA 4IO9A 2UU9Q 1NMGA 3FKIH 4DR1L 4O2DA 4GNXA 1E1OA 2OWOA 1C0AA 5C0XI 1PHJA 1VQBA 2CKZB 2VZAA 1NMFA 5HY6A 3E9IA 4APVA 5DLQE 2R7ZH 3ICEA 2HHHQ 4DV3L 1XPUA 4LFCL 5C3EG 2HT1A 5LMNQ 2D0PA 4A3MH 4A3GH 1BBUA 1L0WA 3JAMi 1Y1WH 3KYHC 5IP9H 1IBMQ 4POGA 4DR5Q 3K7UC 1GM5A 4OXPA 4A3EG 4GLXA 2JA5G 3PF4A 3CCUA 1K9MC 2LXJA 4NXNQ 1VQLA 3K8AA 3J81i 2F4VL 3S1RH 4UPAA 3AFPA 3K81C 3I4MG 1E3PA 1Q1BA 4A3JG 3HOUH 1LTLA 4UP9A 4H02A 4LFBL 4DV4L 1Y14B 2YTVA 2F52A 5BR8L 3CCEA 1X54A 2A19A 3HKZE 3OTOQ 1GD7A 1VQ8A 4K0KQ 2ES2A 1L1OB 2JA7H 1N33L 3J81j 4R4QA 4UP8A 3RLFA 4DUZQ 3S17H 3HOVG 1WCMG 4LUZA 1I50H 2OTLA 3DLLA 4DKAC 1W3SA 3PGZA 4HIKA 4PZ8A 1XNQQ 1OXSC 3KDFB 1G51A 3UE1A 3FP9A 1KRSA 3JAMc 3D31A 3CCSA 2DUDA 3M85A 4HJ8A 3T1YL 1CSPA 4GOPC 1HZAA 3T1HL 1S40A 4DAYB 2E5LQ 3CCLA 2BH2A 3F1ZA 5IWAL 1VQ6A 2H5XA 2L15A 1S72A 4LF9Q 1QVFA 1IBKL 2GN5A 5IY0A 3J81c 2JEBI 1YNXA 2AMCB 1FJGL 3CCQA 3STBD 3OYYA 1XPOA 2A8VA 5FJ8G 3CXCA 1SMXA 1KC8C 5AJ3Q 1JJ2A 3PUWA 4OX9Q 5J3BA 4AYBG 2IX1A 5C3EH 4PZ7A 1E24A 3CMEA 1PH8A 1IBLL 4LF6L 4DR7Q 5M3MH 2UXCQ 3PCOB 4BA1I 4QY7A 1TWGH 4B3TQ 1QVCA 4X64L 5C4XH 5M3FG 4WJ3M 3GTQH 2JA5H 3CPFA 2N8NA 4GLVB 4NPSA 4C3HH 5LMUQ 3PUYA 4GKJL 4JYAQ 2N78A 4A76A 4P71A 2GVAA 3HOXG 1I6HH 3I4MH 1E7ZA 4A3JH 1KIXA 4B3SQ 1SRUA 1L1OC 4DR3Q 4JI6Q 4LF5Q 1YBYA 4NXML 4JI7Q 1L2FA 1PH3A 2KHJA 1K8GA 4LF9L 2UXBQ 4AH6A 1T9HA 2CWPA 1IXRA 1KQSA 2EIFA 2MQHA 4YHHQ 5JJIA 3RNUA 1EUJA 1VS0A 5GAEC 1R9TH 3CCVA 3HOWG 3EIVA 4KHPQ 1BKBA 3J7A5 1WCMH 3H15A 1XJVA 1XMOL 2CWAA 3ULJA 3CAMA 2EXDA 4RG1A 1J5EQ 1D8LA 1PVOA 2UXDQ 4JI0L 1DGSA 4DR7L 2WAQG 4EQ5A 1SR3A 4YWKA 3GTJH 2OCEA 5C44G 1XNRL 2JA6G 3KFUA 1G6PA 2VL6A 1VQ4A 4R4CA 3U50C 5IP7G 1X6OA 1E1TA 4L5QA 3A5UA 3CMAA 4DV2L 3GTKH 5FLXc 3KF6A 2N3SA 3PUVA 2K5NA 1N34L 2CQOA 1KHIA 1AE2A 2K14A 3GTPH 4BBSG 3U4VA
chains in the Genus database with same CATH superfamily
1YHAA 2AQ3B 1I3QH 2IHEA 4FDBA 2UUCQ 4I7AA 3J80i 1K73C 3C2PA 1VQOA 3NWTA 1VQ5A 2V1CC 4ZUJA 1K0RA 2EY2A 3M7GA 1AW7A 4DV1Q 1QUQB 3DM3A 4IUPA 4EVOA 1EQVA 2R93G 4HMJA 3D8GA 3FHWA 1ZXTA 1HZBA 1RKNA 4ZUIA 3VR4A 4OWTB 5FLMG 3NTHA 4XT1B 1PYBA 1LABA 4RGNA 1OXTA 1YEZA 1HHVA 1Z47A 1Y8PB 4JI3L 3Q8DA 2YTYA 3OW2A 2NVXB 5DNFA 5COYA 1A3TA 4ALPA 2QA4A 1LT6D 2VB3X 4JOIC 2XN9C 4DR6Q 2I5LX 4UHVA 4DK6C 2QEJC 2F03A 4B3MQ 4OWWB 2Q8TA 1N9WA 3TP8A 3K7AH 5D14A 3O13A 5KGUA 3S1MH 1EIFA 5JJZA 4IURA 3M4QA 2KENA 4MTNA 2EOTA 2JQOA 5EKLA 1D1KA 1EFID 2K01A 5KEEA 1SE4A 3RZDB 1BO0A 3NEMA 3A74A 4A3CG 1EWIA 4UDUC 4HAEA 1EYCA 2WACA 4DFAA 3OPOA 2D9UA 3M4PA 1JT8A 3RR5A 1HJPA 1JB7A 1XTCD 3H6MA 5DAUA 5I4DA 3J80E 1XYIA 3S1MB 2MO1A 1EEID 3WDNA 5IE8A 4I7ZC 3CC7A 1I94Q 1EFWA 3UDGA 1EWCA 5E4WC 1SROA 1P16A 2NN6I 4A3FB 1PFBA 5T1IA 2DY8A 4WRDA 4LF8Q 3HOVH 2XSCA 1VQDA 5M5YB 5AJ3L 2FJ2A 2EJFC 1S3OA 2ZXOA 5ELDA 3MHBA 3KUPA 3ZJYC 5LMUL 3I90A 4LJZC 4JYAL 1Y1WG 4XQNA 4BWGB 1TWHH 2G9HD 4A93B 1UAPA 1U4RA 3HKZB 2RSOA 4XT3B 3KLSX 1TS3A 4JI6L 4LF5L 1C9OA 3BG3A 2SDFA 5BN5A 3T16A 1EY8A 2K75A 4DR1Q 1YNJC 1G291 4WFN3 4A3DB 3L0OA 4Y7NH 1HQMC 4GN4B 4ME3A 3VDYA 2O5IC 2NTSA 5JEAJ 1WI5A 3KF6B 2E2IH 5IT9L 2AQ1B 2ALYB 4JBJA 1PH4A 2F4VQ 3D4WA 4PMCA 2I5MX 1AZQA 1N8RC 2PQEA 2RCNA 2IT1A 4R1JA 4R8IA 2MPMA 1NR4A 4A93G 3MA2B 4ZAIA 2PPBC 4RA8A 1GOZA 4DPGA 1SE8A 2Z6BA 1Y69U 4C1NK 4OGQC 5C4XG 1E0BA 4JI2L 1B8AA 3H0GH 1QZHA 2G5DA 2ZXRA 5FO9B 3SR1A 1T5XD 2EYMA 1KABA 2H1EA 1FJGQ 3VA7A 2EQSA 3RN2A 3R3OA 4H44C 1D5XC 4IFDH 1JMCA 4LF6Q 1UE6A 1IBLQ 2JE6I 2RVLA 1PYSB 4CDCC 1QVGA 4P2CB 4B3RL 2I0QA 3CRLC 3WOEA 3DHQA 3DMUA 5CORA 1B44D 4A3GB 1ESRA 5DM63 3L2PA 3BDCA 3DEOA 3H0GB 3KBXA 3NENA 1CT1D 2KCTA 3OWFA 4NXMQ 2RHSB 2XGTA 1VQPA 2OQ0A 2E8GA 4DR2Q 4GN3B 5GAGC 1RF2D 5IYCG 2R61A 2J0TD 4YWLA 2NN6G 2VS1A 3I4NH 3I4OA 4N9PA 3S17B 1QCBD 3GDEA 4JK1C 1PA6A 1STHA 1KDBA 3CQZH 1B7YB 1XNRQ 4KJOA 3FPUB 3GTOH 4F87A 2QGQA 3KJOA 2IWHA 2CW0C 3U9OA 1TWCH 4BBRH 4NMZA 1SMYC 1DYQA 1LTID 4Z9CB 1EIGA 3FPPA 3IL8A 3S1NH 3IRBA 5EAYA 4X65Q 4XIGS 3SDZA 5JOBA 3E5SA 1V1PB 4QQBX 1K83H 2J4XA 4DR2L 4AQYQ 2RBMA 2FINB 5I6WA 5IP9G 4LF7Q 4Y52H 4DV5L 3VR3A 4ZLTF 5CV5A 4RHSA 3V2TA 1CKOA 1VQGA 1PV4A 4JOIA 3A8JE 1GVPA 3CQZB 2XRSD 3EVQA 1M90C 1TWCB 2WP8J 2HUGA 5C4JH 4DUYL 1FNVA 3G48A 3I72A 1QUQA 3CC4A 1V9PA 1HFGA 2YV5A 1WVLA 1UWVA 4LUOA 1A63A 3IKJA 5CMDA 2B8FA 3S1NB 3H3VH 3BZCA 3FEWX 1VDZA 1SNDA 1Q8IA 1DOLA 4JI8Q 3MXPA 1EWHA 4KLKA 3GTGH 4K2LA 3TZUA 2NVTH 5IYDH 2QF7A 4NKLA 1NNXA 3QB3A 4IOCA 4A3KH 4OEMB 1UUPA 1CZWA 2JA8H 1IW7D 1Y1VH 4GOPB 1MGSA 1CKNB 2X69A 3LGJA 1SXTA 1PZJD 1NMGA 3FKIH 1E2VA 2VXWA 4MN3A 4RHRA 3OIPA 2VZAA 1NMFA 5HY6A 2R7ZH 1XPUA 5AFWA 1STAA 2HT1A 5LMNQ 2D0PA 1BBUA 1L0WA 2L12A 1IBMQ 4DR5Q 2F0MA 3NPPA 1MBYA 2LXJA 1W6KA 4AYBB 2IL8A 4A3KB 1Q1BA 4A3JG 2JA8B 2BCOA 1NSNS 1Y1VB 5M3FB 1Y14B 2YTVA 2F52A 2LMCB 3VYTA 5BR8L 4X3TA 4ULLA 4K0KQ 1L1OB 2QILA 3FKIB 2KCCA 3TN2A 1STEA 4NDXA 2K5QA 2PNRC 1LTAD 3I4LA 1I50H 2EYFA 3W2DA 2HCIA 2EVBA 2BE5D 1XNQQ 3NK9A 3OIQA 2HQEA 4S3SA 1LTRD 3A8IE 2L0CA 3CCSA 4HJ8A 3M85A 2B2WC 3T1YL 3OWEB 4GOPC 1ESFA 5LL6S 2E5LQ 2PZTA 3F1ZA 3N6RA 2L15A 1S72A 1CHQD 1IBKL 1A3VA 3J81c 1YNXA 2AMCB 2RA4A 4HSVA 1BBXC 3H3VC 4KK7A 3M3YB 1YNNC 3LNNA 4ME5A 1V1OA 1A3UA 1JJ2A 4PNYA 1JORA 4AYBG 2IX1A 1KXLA 3CRKC 5M3MH 3J81L 1QVCA 5M3FG 3GTQH 2JA5H 3CPFA 2N8NA 4C3HH 3PUYA 1HPCA 2KJXA 4A76A 2GVAA 5CR3A 1SRUA 1L1OC 4DR3Q 5FOBB 2F0FA 4G4KA 4PV1C 4HEDA 2KHJA 3S9WA 1PH3A 1KQSA 1TVXA 3T51B 1LO5D 2MQHA 4HN7A 4YHHQ 3RNUA 3I91A 5GAEC 3PO3B 4QUFA 3PO2B 2ICEC 1DCZA 3EIVA 4YIJA 1BKBA 3TP7A 1XMOL 3ULJA 4CBVA 1D8LA 2JA6G 4YWKA 1SYGA 3KFUA 3GTQB 4A3EB 4C3HB 3EFXD 1STNA 3RMHA 1O7ZA 2B2TC 4R4CA 4RKBA 1E1TA 1MHWC 3GTKH 4KN4C 1A15A 3KF6A 3HEJA 3VYSA 1KHIA 3MC0B 2OT2A 1LTSD 4QMGA 4PMBA 3DXJC 3QO2A 1Z9FA 5ELNA 4PZ6A 3K5MA 3F2DA 5JEAG 5TSSA 3X3MA 4DR4Q 2PNHA 3AB9A 2EJMA 1MD2D 5M5XH 5GQOA 1JOKA 4IPCA 1QE6A 4XTCS 5I6YA 3S15H 2NZ1D 2D5DA 3URYA 2ZJPA 3PO3G 2E76C 3NQTA 5E1FA 3PO2G 3GTKB 3MEFA 2K7VA 4G7OC 1L0XB 2QDLA 1WYDA 2X6GA 4IUNA 2F0WA 4FF3A 4K8IA 1MSGA 4OO1I 1MKHA 2C9OA 1MJCA 1X56A 3ERQA 4ODGA 1H9MA 1LV9A 1STGA 4FVMA 1A2TA 2GA4B 3FDTA 3IFDA 4YY3Q 4POFA 1HNZQ 4LFAQ 1HR0L 2CVRA 4GKKQ 1PYWD 4HIOA 2NZOA 1IL8A 1H9KA 2MO0A 4RWSC 1EZ6A 3C46A 2MJ8A 3S24A 5J39A 5M5XB 4LW1A 4L63B 4IPGA 2DNEA 4JV5L 1U4MA 2ZTCA 1UNSA 3TBIB 1KRTA 3HFZB 4AIMA 1UE1A 4LNQA 1PH6A 2E2HB 2HHHL 4BBSH 1NR2A 4NP5A 3NBHB 2OQKA 1VCIA 1XTDA 5E3FA 4H7BA 1OXVA 1Q8KA 3DEPA 4RAUC 2SNSA 2SNMA 3U4ZA 3UI2A 1YI2A 3OMCA 2I46A 4NXNL 2F4IA 4YWMA 5C0XH 1VMPA 3S1QH 4C3IB 3SGIA 1BVSA 4GZYC 2XWBB 2K52A 4L5TA 2DJFC 2R93H 3Q22A 1KLUD 4KHVA 2YU9H 1NE3A 1B53A 1TT2A 1I4HA 2M00A 3LWEA 3RLNA 1Q86C 2F1MA 1VQIA 4UP7A 4DUZL 5KIXA 3TS2A 3QWNA 2K5DA 2Z1CA 4X62Q 2B3GA 5FLMH 1J6QA 2IPKD 2K6AA 1VQEA 3G6JB 1FGUA 3L3OC 1V1PA 2FFKB 2BA1A 1S5FD 3S1QB 4BY7B 2CFMA 3SE0A 1SLJA 1JJGA 1OTCA 3RD4A 4JBKA 4KKSA 5JJKA 2BDNA 4NB3A 2J7ZA 1XXGA 3B6YA 1SN8A 2OEOA 4OX9L 1JQYD 4K5XA 4C3IG 1QNKA 2UXCL 3I3CA 1PTOF 3QOJA 2B63G 3S2HB 4DGZA 2NUCA 3E9HA 4X66Q 3D3RA 4B3TL 4E6IA 1EYAA 4L5RC 4OIKA 2DNCA 2D2CC 5CBEE 4A3MG 3PSIA 3R2IA 1N32Q 1H95A 1EU3A 1LUZA 3SVMA 1HR0W 2F0DA 4B3SL 1RIPA 2EJGC 4A3CH 2L5TA 3A54A 5GADC 2UXBL 1PTOD 2UUBQ 4HIDA 2O5JC 1TWAB 4CDDC 2SOBA 5HGQA 2B2WA 4EQPA 1D6EC 4HMIA 4K8JA 3KF8B 4X3SA 3WOFA 1WJJA 4GOPA 2ASBA 2VUMB 1CKNA 4DV3Q 1J5EL 4LFCQ 4BY7G 4OO1G 1JOOA 1JR0D 1T5EA 3A0JA 4X66L 4A3LG 2NVXH 2K5HA 3OHXC 2Q8IB 4EX5A 2NZHA 3T53B 2HD3A 3H91A 1CQFA 2ZTEA 4QL5A 4A4IA 4JC0A 5KNDA 1WTHA 5EKKA 4QB4A 4JPBW 1S5DD 3RUZA 3KLWA 2UUCL 4KY7A 4UY8C 4QIWB 5E4XA 2RF4A 1VQCA 1V43A 1VQ7A 2QDBA 2A73B 2N49A 4RGOS 4BY1G 2RSNA 1FNWA 1L1OA 3F2UA 3RZDH 2M2LA 2F3IA 3CKIB 1XWEA 2KVMA 1KDAA 5GROA 2JJQA 4DV1L 4OONA 2BA0A 5I2YA 2VB2X 2DJGC 1ENAA 4KD4A 4FF2A 1GUWA 3T1HQ 1IL2A 3A5ZB 4B9WA 2VUMG 3T13A 1QNUA 2EYPA 3NP8A 1AN8A 3TSSA 1CKMA 4TQUS 1RTOA 4I65A 3M9BA 4BA2I 2B2TA 1I6VC 1JWMD 1CA5A 1NUCA 1WFQA 1GO3E 4HJAA 4HIMA 1HFNA 3GV6A 2PQAB 1PRTF 4X64Q 1PXUA 4A3FH 2JXMB 1EIHA 1Y1WB 3MXNA 1SNPA 5M9OA 2B2VA 4HJ9A 4IZ8A 5M5YH 3UDFA 1DOKA 3TS0A 3VR2A 1PH2A 4IJLA 4PG3A 3S1RB 2YYZA 3KOJA 4DR6L 1PRTD 3SK8A 3A56A 4CKEA 2DY7A 3CP0A 4B3ML 1EOTA 3AQQA 3NTIA 2Q2UA 4A93H 3Q0AA 4HJ5A 3SXHA 1BCPF 2RQXA 1UE7A 4K2KA 3K5LA 1K3RA 1TQOA 4AYBE 1WTRA 1S4ZA 1ICWA 4O0AA 4ZKCB 3F2CA 1FGBD 3W1GA 3DUZA 4A3DH 4DV2Q 1UEBA 1VQKA 2OTJA 2K33A 1ILQA 2AKWB 2EYHA 2KHIA 1BCPD 3AFQA 5D3DA 3NBIA 1TR5A 2GVBA 3MEHA 1HNWQ 1MSHA 3IFTA 5C4HA 4MHEA 1I94L 3NSWA 2DN8A 2LFNA 3W1BA 2MHVA 1DJRD 1IW7C 3F2BA 3BS1A 4JI1Q 2A74C 1GUTA 3HOUG 4ZQ3A 1Q12A 3I56A 1AP0A 5IT9c 5C4XB 3ULLA 4DN4M 2Q2TA 2EXZA 4LF8L 2AQ2B 2JA7G 3KLRA 1B70B 3I7FA 4X3KA 3I4MB 4OWXB 1S5CD 1F9QA 3K0YA 4LUVA 4LAAA 1HQRD 1YJNA 5IYCH 3BJUA 3U58A 2NN6H 1N36Q 4KD3A 2VQEQ 5ELCA 2KQ3A 1JC7A 5IGEA 1VF7A 2DGYA 4L6TB 3QIAA 2VQFQ 4CJ2C 2MNAA 3RN5A 3PF5A 4B08A 4IPDA 2WB1G 4X3UA 4IO9A 2UU9Q 1HUMA 4DR1L 2AUJD 4O2DA 5D3IB 2OWOA 2EYJA 5CV7A 2CKZB 1RDPD 5DLQE 3ICEA 4RGTA 1LACA 4A3GH 2BE5C 1EU4A 2QCPX 3ND9A 5IP9H 4POGA 1KTKA 1GUOA 3P7JA 1G2SA 5KNCA 4GLXA 3NBHA 3J81i 2F4VL 3AFPA 3I4MG 2F0HA 4OHJA 3S16B 2JN4A 3S2DB 1DD2A 1Y8NB 1C48A 4UP9A 4QUCA 2CH4W 1B1ZA 1X54A 3OTOQ 1VQ8A 2IW3A 5I9OA 2ES2A 2V4DA 3C3LA 2KUMA 4R4QA 3DWQA 4UP8A 1JWUD 1ZYRD 4NW2A 3S17H 4DA2A 3HOVG 5G3LF 4DK0A 1ENFA 5NUCA 1CK1A 3DLLA 4DKAC 1W3SA 3H09A 1BXTA 1EY0A 3D6CA 2N88A 4FXGC 2F0IA 3JAMc 2DUDA 4MTKA 1QWYA 4DAYB 1VQ6A 5G3LD 3GTMB 1FJGL 2B2YC 3CCQA 3OYYA 1M8AA 1O80A 5FJ8G 3CXCA 1SMXA 3JAML 4J8QA 3DWAA 2NWGA 4DXFA 1KC8C 3PUWA 2NYZD 1OO9B 1DM0B 2K05A 4LF6L 3CMEA 4DR7Q 1IBLL 3NXWA 2C5CA 1TWGH 4WJ3M 2K03A 4V0BA 1D5ZC 2CQAA 5HURA 1DONA 3K6OA 3HOXG 1I6HH 2KHSA 1E7ZA 1K3BC 4A3JH 3MVVA 1KIXA 4OELB 4NXML 4JI7Q 4F8MA 3G7LA 2EDGA 1PFMA 2CWPA 3S14B 3PQIA 5JJIA 3HOWG 4KHPQ 1FR3A 3A55A 1XJVA 5IOCA 3CAMA 1FD7D 1PVOA 3OOCA 1DGSA 1TWGB 4FXDA 4DR7L 3KF8A 3I73A 2OCEA 5C44G 1XNRL 4F88A 2F0VA 3U50C 5IP7G 3A5UA 4L5QA 3AMUA 3J81E 4G57A 5FLXc 1I6HB 2N3SA 1QJOA 4A3JB 5ISRA 4QF4A 2F0QA 3U4VA 4X65L 4JI7L 2QEXA 4JBWA 1LLRD 4AQYL 4LF7L 1B4OA 3M4YA 5FLXL 1SFOB 1AH9A 1VQAA 4LK1C 3A7LA 1MI2A 1EQRA 3HS0C 1QG7A 3Q23A 5M3FH 3EQLC 2RKSA 3J7ZC 4ZRZA 2BDOA 3D6WA 2ZM6Q 2A1AA 1D7QA 5C0XJ 5ELFA 4H0LC 3CU7A 5KYIA 1Q46A 1CZGA 1QOHA 2WKCA 4JI8L 2A68D 1KD1C 5CV8A 1HNXQ 3J7AV 3V96A 1EOVA 3D4RA 1TU2B 2KCNA 2A6HD 1X3PA 3K80C 1ENCA 3STBC 1VQFA 4P75A 1IYVA 2L4NA 2PQAA 3M3YH 1JICA 1O7YA 3K0XA 3KJPA 4DXGA 4P74A 1LTTD 1II3A 1C8CA 2AHOB 2I07B 3NELA 4JI5Q 1EY5A 3BVZA 2ZM6L 1JE4A 1RD9D 1L0YB 3I2ZA 2Q2IA 3V05A 5D65A 5LMNL 5EJWA 4HCEA 1IBML 4YCUA 1R4PB 4DV7Q 5JEAH 4DR5L 5A2QL 5JPNC 5IYBG 2PMZE 3CCMA 4JI4Q 1SYFA 1PDQA 5IIFA 4KN7C 3GTLB 3VR6A 3W3AA 2JP1A 2JA6B 3HOYB 1G8ZD 4PQXA 4TSSA 4C2MB 1B9NA 3PO3H 3TDQA 2E75C 3PO2H 4K0KL 1H9SB 1HCZA 3TP6A 2OXPA 1WOCA 4K5WA 4QIWE 3MXNB 2ATWA 2E2JB 1LTGD 2Y0SB 4A3EH 2D62A 4LWCA 2ENBA 3UE0A 2LSSA 4DV0Q 1Q82C 2CCZA 1XNQL 2NVQH 4IOAA 4LMQD 4DU9A 3MAQA 1WTXA 4F7XA 1A62A 1YIJA 1JB3A 5IYDG 2E5LL 1QZGA 2TMPA 3G71A 2ZXPA 1RJTA 3UDIA 2ZT9C 1SNQA 3T4AC 3TRZA 4HJ7A 4QJFA 2Q2HA 4EGVA 1GUSA 3HOYG 5CBAE 1U9RA 5CC4A 1X3FA 1YVCA 1PZID 1LTBD 1QILA 3C1EA 2UUAQ 3R93A 1PFSA 2NVQB 3EA6A 1KLGD 2L9HA 1XMQQ 3RZOB 4MNOA 2HDMA 3LX0A 1MIUA 1VMCA 2F0JA 4HSPA 4KTAA 4DR3L 3TMEA 3HG9A 1SAPA 2Y0SG 2F3VA 4B9XA 2B29A 5BN4A 1UE5A 1X55A 3JC66 4BS9A 2F0PA 4CGYB 3F8TA 4YHHL 2RDFA 1YHQA 2F0LA 1EQTA 1PRTB 1K8MA 1VQHA 4A3IB 1JJCB 2K4KA 2KA7A 4R4IA 1U4PA 3CF5A 2B2YA 5ELOA 1TWFH 1D5MC 4OL7A 1M4VA 5LMNW 2E2HH 4N8X1 1VQ9A 1KL9A 1HUNA 4BXXG 4KHZA 3M4OB 2XVSA 3K5NA 1XPRA 1RL2A 2N55A 3IAYA 4LFBQ 1Z7TA 3GQBA 4DV4Q 2AWNA 2FXQA 3I55A 5EQ0A 2WINB 4RKLA 1N33Q 1BCPB 2R92B 2FMMA 4DR4L 4C56C 4C3IH 1ZEQX 2L11A 2VNUD 1NAPA 1IYUA 2B2UC 2WB1E 4CKBA 4DAPA 2B63H 1F2MA 2Z9HA 1SYEA 1A8VA 2HDLA 1SNCA 5M3MG 4KY6A 3A8KE 1TWFB 1UEAB 1HTPA 4L5SA 3GO5A 3HOZB 2PO4A 1HZCA 5IWAQ 1BOSA 3R2TA 2F0OA 3PUXA 4A3IG 2RHQB 1NY4A 5FKAC 1SEBD 2L1BA 1PRTC 1ML0D 4DAYA 2VY3A 2Z4HA 3WWVA 4YY3L 1GHJA 1HNZL 3G4SA 4LFAL 1HA5A 2D0OA 5KNBA 4GKKL 3CD6A 4C3JG 1C7YA 3PIPA 2F0TA 4BY7H 3P1HA 2B63B 1E2WA 2JK8A 4OO1H 4ID6A 3BVGA 4A3LH 4GKJQ 1KAWA 4A3MB 4A3BG 3CCRA 1TIID 2HQLA 3ZYYX 1HH2P 2R92G 2ZTDA 3PMFA 4RMFA 1LM0A 3S2HH 1BCPC 1EZ8A 2HIVA 3D0FA 4IJHA 1ZKOA 3ER0A 1X3GA 4J15A 3W5OA 1PH5A 5IODA 4BY1H 3HOZG 5IGCA 2PW5A 4ZK9B 3NUCA 4A75A 1IKMA 4JI0Q 3J7AF 3GV3A 4K5VA 3H94A 1WTWA 2A6ED 1TWAH 3CW2C 1SSOA 5K36G 2VUMH 2K5VA 2NB0A 1N34Q 2KECA 3HKSA 1I4QA 4JG2A 2E74C 5EPLA 1M1KC 4X62L 1F2ZA 5CV9A 2FHTA 2O2LD 4J6HA 4FYDA 4KMUC 1FVIA 4BY1B 5JPMC 2JEAI 3AU7A 3EN2A 4PMWA 1I5FA 1SE3A 3NTKA 4JBMA 2XTIA 3TQYA 1WTPA 3P20A 1RTNA 1X3EA 1D1IA 2RDHA 4KY5A 3AEVA 1F9RA 1VQJA 2IX0A 3SK6A 4O1NA 4RFBA 2Z6KC 1KNAA 1ASYA 2XRQD 2A5HA 4J1MA 2AWOA 2PMZB 5ELBA 5C3XA 5EBCA 4ABNA 3NE5B 1A6XA 1U5KA 5CV4A 2NTTA 4IFDJ 1EY4A 3E0EA 1OXUA 1N32L 3VA5A 1WCMB 1C4QA 1CM9A 2LS01 4MIUA 5KYLA 4Q0FA 1EYGA 5C0XG 4K6LA 4JI3Q 3U9SA 3Q24A 2UUBL 3GTJB 1F2LA 3D4DA 2OF1A 3P75A 2PW7A 4DF7A 1ILPA 3VYUA 1PHJA 1ZYRC 3VR5A 1HA6A 4ZKBB 4DV3L 5I2XA 4LFCL 5C3EG 1K8OA 1RHPA 1SBBB 3FRPB 3GTPB 2F0SA 3JAMi 1Y1WH 1EL0A 4R9WA 3K7UC 1GM5A 3PF4A 1I3QB 1SYCA 1K9MC 4U673 1CQVA 3LWUA 5IT9E 1BDOA 3K8AA 1VQLA 3S1RH 3K81C 1E3PA 2TSSA 5C6AA 4DNRB 3HOUH 1O78A 2JSOA 1LTLA 4H02A 2A19A 1GD7A 2JA7H 3QJYA 1TS5A 4U68A 3J81j 1GHKA 5CYUA 3RLFA 2F0KA 1TKWB 1WCMG 1FNUA 1H9SA 4LUZA 2OTLA 3HP3A 2Z4IA 3SHLA 3PGZA 2IJ0A 4PZ8A 1OXSC 1SNOA 3BYTB 3KDFB 1G51A 2EE1A 2EY5A 4CJ1B 3FP9A 4CDEC 3D31A 1S40A 1CSPA 3T1HL 1HZAA 2BH2A 3DWPA 3QR8A 4LF9Q 3MXUA 3HOUB 4C1NI 4KV6A 2WAQB 5IY0A 2A8VA 1XPOA 4CDFC 4DNTB 2JA7B 1TS4A 2WV6D 2F0EA 1X32A 5AJ3Q 5J3BA 1J9OA 4PZ7A 1E24A 2PCFB 1PH8A 3PCOB 4BA1I 3L9AX 1D2BA 5J1ZA 4X64L 5C4XH 3NHHA 2F0NA 5LMUQ 1B50A 4JYAQ 2EYOA 3K7AB 4P71A 4N9TA 3I4MH 2B2UA 1EY7A 4JI6Q 4LF5Q 1TS2A 1K8GA 4LF9L 4AH6A 2WB1B 1IXRA 1EUJA 5C4ZA 1R9TH 2LY7A 3CCVA 4N8FA 3J7A5 3H15A 1LT4D 1CA6A 2MP1A 1K0SA 2EXDA 2MUYA 2UXDQ 3JAME 1LT5D 4QCLA 1R4QB 2BOSA 2WAQG 1GUNA 1SR3A 1G6PA 1F77A 1VQ4A 4DV2L 4TKOB 1IKLA 2PZUA 3QG1A 2K5NA 2A69D 1PFNA 1AE2A 2QW7A 2K14A 1Q3LA 3ERSX 1EY6A 1BNZA 4IUTA 5GAHC 1PH1A 5FJ8H 1HNWL 2A68C 1R9TB 5JJLA 4IPHA 2Y0SE 1DOMA 1NTGA 3HOVB 1V1QA 3CC2A 2A6HC 3S16H 1YITA 3S2DH 2PYKA 1J8IA 3K58A 4RCOA 1NCVA 2UXDL 2L55A 1E22A 4JI1L 1KAAA 1G91A 4XYOA 1KDCA 2K28A 3HGBA 2CHBD 3HOXH 4A3FG 2ICIA 4IFDI 4JI2Q 5JVG3 3M7NA 3PIOA 4QGUA 1TWHB 1OXXK 1EY9A 2XIWA 1IZ6A 3ULPA 1WD1A 1ASZA 3HOWH 1H9JA 2QKIC 1N36L 2VQEL 3HZXA 1WTOA 1W6JA 3J80c 4Y7NB 3GTMH 3BVMA 2AUKA 2MGSA 5FLXE 3HKZG 5C44H 1STBA 2VQFL 4B3RQ 1DXMA 4GNXB 4RH6A 1AZPA 4FF4A 3I8ZA 5IGFA 1RCVD 5IP7H 2UU9L 1NBWA 3HOXB 4X6AH 1JWSD 2E2IB 1ET9A 4A3DG 3J80L 2EY6A 2IY5B 3QOLA 4R4TA 1DZ1A 2LKVA 1MJEA 3HOWB 1HZ9A 2P5ZX 2HCCA 3L7ZC 2Z6KA 1XX8A 3K59A 4CJ0B 1G6ZA 1O7IA 3EROA 5C44B 2KCMA 4G7HC 4HCSA 3S14H 2H4OA 1B2TA 3MWYW 3OTOL 1SE2A 2EYLA 1ICFB 1JCKB 1SDFA 1K8AC 1ET6A 2ZJQA 1HRJA 1AE3A 2C35B 4KJNA 3CHBD 1PH9A 2HIXA 3SEBA 4DV5Q 1TY0A 4WJWA 4GNXC 1FYCA 1BQQT 2KBNA 3PUZA 4LF4Q 5A2QE 3FVQA 4MZ9A 3H3VI 5JVH3 5J22A 2F0UA 3VYRA 1S5BD 4YCWA 2EPBA 5EKIA 1I4RA 4DUYQ 1SFOH 3A7AB 2MFIA 2R6GA 3GP7A 4IQZA 1SYDA 3R8BA 2VW9A 4KKUA 4ZYSA 3KBGA 1PH7A 4GS3A 4XYQA 5M5WH 2JYOA 5IYBH 1VQMA 4CHTB 1GXDC 4A3GG 3AYHB 4DAMA 4YCVA 3DM1A 1TY2A 4IUUA 4EQNA 5FK9C 4FNFA 3H0GG 2IX3A 4K6DA 3I4NB 4FP5D 3I70A 4K14A 2NVYH 4LF4L 4H13C 4FO2A 3T56B 3PIP3 3G6EA 3ITPA 1B3QA 2ZJRA 1NJIC 3GTOB 4P73A 3OW7A 2FMCA 4WJ4A 2K5WA 4BBRB 4KHPL 5KRUA 4IFDG 2XWJB 2R7DA 2WIIB 1W2BA 2I5HA 4O42A 5IGBA 2YTXA 2Z8LA 5M5WB 1BR9A 1B9MA 3ND8A 2B39A 3EBEA 4M8AA 1K83B 1YZ6A 3PV0A 4TVAB 1PTOH 1Q1EA 1CFMA 4EQOA 1WTQA 1Z6HA 5EPKA 5C5LA 2NVYB 3OMGA 1GUGA 1JOQA 2SEBD 5BR8Q 5EBDA 1I4XA 1YNJD 5C4JB 3GTLH 1Q7YC 3BZKA 3HOYH 2JA6H 2KEDA 3I4NG 1V8QA 3UDXA 4WORA 4DK3C 1YJWA 4C2MH 4JCVE 4ZCKA 1CTMA 1U0LA 1VQNA 2PI2A 1YHBA 2KOLA 3GTGB 4BBRG 2NVTB 3T1YQ 4IUQA 1PTOB 1F2YA 1BBWA 3KDFA 3OSOA 2KEEA 5CV6A 2E2DC 2E2JH 3BU2A 1CUKA 3NWSA 1IBKQ 1K28A 4R4OA 1U4LA 4L8JA 5HGTA 3NQIA 1HNXL 4G7ZC 1FL0A 2XNAC 5EPJA 1EIYB 1I4GA 2R7ZB 1LYLA 3TZDA 2K50A 2A6EC 1IHZA 2NBFA 1BF4A 4P72A 4IN3A 1SYBA 1PLFA 4BXXH 4JI5L 4DNIA 1X9NA 1Q81C 5L37A 2F0GA 2Z0SA 4GN5A 3MFGA 1JE5A 1A2UA 5E7NA 3J7YW 2R7FA 3MZ5A 4DV7L 3RZOH 5LHY1 4OIJA 4JI4L 4DV6Q 1AFPA 1STYA 1XMOQ 3MTSA 4A3KG 1PTOC 3GD7A 1I50B 2JA8G 1HTLD 1Y1VG 4IALA 3ONAB 1IYJB 3FKIG 3E6ZX 4A3IH 5H1SE 4M1UB 5CGKA 5DEHA 5C3WA 2R7ZG 1TXYA 4XQQA 2PI2E 1WTVA 3E3XA 4DV0L 3TREA 4C3JH 3MFYA 1CSQA 2RDGA 3BYYB 3M4OH 4DV6L 1F9PA 3CPWA 3FMCA 5M3MB 1CHPD 4A3BH 4Q5VA 1A0IA 1CI3M 2CW0D 2R92H 2JA5B 1P8LA 2WAQE 3EJIA 2X6LA 1SMYD 3MXGA 2BH8A 1E2ZA 4KKTA 2WFWA 1YJ9A 2G9DA 2LXKA 1HR0Q 2UUAL 4KI0A 1Y8OB 1GKHA 3HOZH 4C3JB 1XMQL 5F2DA 2IHFA 3Q6SA 4XDXA 2B2VC 3K5OA 1PMRA 3SK4A 1X65A 1EQQA 4JV5Q 4GLAC 4FF1A 4A3BB 4IUVA 2JA9A 3RLOA 3CCJA 2WKDA 3TEHB 2ID0A 5K36H 5FO8B 4GNXA 1E1OA 1C0AA 5C0XI 1VQBA 4FXKC 3TP5A 2F3WA 3E9IA 4APVA 2HHHQ 3BDOA 4V190 4A3MH 3KYHC 1BUVT 2EY1A 1VF5C 4OXPA 4A3EG 4C3HG 2JA5G 1EYDA 3CCUA 4NXNQ 2B8GA 4UPAA 3KLSA 1LT3D 4RCNA 5T1GA 2CH4A 2RCFA 4LFBL 4DV4L 1HXYD 3CCEA 1Q90A 3S15B 3SK5A 3HKZE 4ILWA 4TRDA 4DAVA 2K1BA 1SNMA 1ONLA 1N33L 2M9VA 4DUZQ 2K32A 5LL6X 1SJED 1B3AA 2R3ZA 3E0JA 4JVZA 1I4PA 4HIKA 5ELEA 2Q8RE 3X3NA 5IGDA 3UE1A 1KRSA 2EZVA 3CCLA 5IWAL 2PZWA 2H5XA 3N52A 5A35A 1QVFA 2GN5A 2JEBI 3STBD 3C1FA 4XXEA 4CKCA 1O7LA 4OX9Q 5C3EH 5EGTA 5IGGA 3K57A 2UXCQ 4RGMA 1X3QA 4QY7A 4XQJA 1F9SA 4BBSB 4B3TQ 5FO7B 3PIO3 4GKJL 4GLVB 4NPSA 3HRZC 2N78A 4UAIA 5JAVA 1G2TA 2A69C 4B3SQ 1SJHD 1PZKD 2O4XA 3BDLA 1KNEA 1YBYA 5I9PA 4HTHA 1L2FA 3BZDB 2UXBQ 4DK1A 1T9HA 1EEFD 2EIFA 2R93B 4JW0A 1VS0A 1YNND 1H9RA 2YU9B 5C5MA 1WCMH 1WD0A 2CWAA 5C3EB 5BN3A 4RG1A 3KK7A 1J5EQ 4JI0L 4EQ5A 3GTJH 4R8NA 5DM73 2VL6A 1QB5D 1AEXA 1X6OA 1S5ED 3CMAA 1GJXA 2K04A 3PUVA 1N34L 4HR7B 2CQOA 3GTPH 1RODA 5K5PA 4BBSG
chains in the Genus database with same CATH topology
4X65L 3ERSX 1Z9FA 1YHAA 5ELNA 4JI7L 5GAHC 1PH1A 5FJ8H 4PZ6A 2QEXA 4JBWA 3F2DA 1HNWL 2UUCQ 1I3QH 2IHEA 4FDBA 4AQYL 4LF7L 5JJLA 4IPHA 2Y0SE 3J80i 5JEAG 1K73C 1NTGA 4DR4Q 2PNHA 1AH9A 1VQOA 1V1QA 1VQAA 3CC2A 1EQRA 5GQOA 5M5XH 1VQ5A 1YITA 2V1CC 4IPCA 3S16H 3S2DH 1K0RA 5M3FH 4XTCS 2UXDL 1E22A 4JI1L 3S15H 4DV1Q 1QUQB 3DM3A 3J7ZC 2R93G 2ZJPA 3PO3G 3HOXH 3FHWA 4IFDI 4A3FG 3PO2G 3MEFA 4JI2Q 3M7NA 2ZM6Q 1WYDA 2A1AA 1D7QA 5C0XJ 3PIOA 4QGUA 4OO1I 1MKHA 1MJCA 1X56A 1OXXK 1HZBA 1IZ6A 3ULPA 1Q46A 4YY3Q 4OWTB 4POFA 5FLMG 4LFAQ 1HNZQ 1HR0L 1ASZA 4JI8L 4GKKQ 1PYBA 3HOWH 4HIOA 1KD1C 2NZOA 1HNXQ 2MO0A 1N36L 2VQEL 1EOVA 1OXTA 3S24A 1YEZA 3J80c 1Z47A 4LW1A 3GTMH 3HKZG 5C44H 2VQFL 4IPGA 3K80C 3STBC 4B3RQ 1VQFA 4P75A 4JI3L 2ZTCA 3Q8DA 4GNXB 4JV5L 2PQAA 2YTYA 5IP7H 3M3YH 3KJPA 3K0XA 1KRTA 2UU9L 1NBWA 4X6AH 4P74A 3OW2A 2AHOB 3HFZB 3NELA 4AIMA 1UE1A 4LNQA 4JI5Q 1PH6A 4A3DG 2ZM6L 4ALPA 2IY5B 2QA4A 3I2ZA 2HHHL 4R4TA 4BBSH 2Q2IA 4JOIC 4DR6Q 5LMNL 2I5LX 3NBHB 4DK6C 1IBML 4YCUA 4B3MQ 2OQKA 4DV7Q 1N9WA 1VCIA 1XTDA 4DR5L 1MJEA 3K7AH 1HZ9A 4OWWB 1OXVA 1Q8KA 5IYBG 3S1MH 1EIFA 2PMZE 3CCMA 4JI4Q 3M4QA 3U4ZA 2KENA 1YI2A 3L7ZC 4MTNA 4NXNL 2JQOA 4YWMA 2Z6KA 3S1QH 3SGIA 1BVSA 1O7IA 2K52A 4L5TA 2KCMA 3NEMA 3A74A 3S14H 4A3CG 2R93H 1EWIA 3PO3H 3PO2H 3OTOL 2YU9H 1NE3A 4K0KL 3RLNA 1K8AC 1Q86C 1VQIA 3M4PA 4UP7A 4DUZL 2ZJQA 1WOCA 3TS2A 1JT8A 4QIWE 3MXNB 3RR5A 2ATWA 1HJPA 4X62Q 2B3GA 5FLMH 4A3EH 1AE3A 2D62A 1J6QA 2C35B 4LWCA 3UE0A 1JB7A 2LSSA 4DV0Q 1VQEA 1Q82C 2CCZA 1XNQL 2NVQH 1PH9A 2HIXA 4IOAA 2MO1A 4DV5Q 5IE8A 3CC7A 4GNXC 1FGUA 1I94Q 1EFWA 1A62A 2BA1A 1YIJA 5IYDG 3UDGA 2E5LL 2KBNA 3PUZA 4LF4Q 1QZGA 4MZ9A 3H3VI 2CFMA 1SLJA 1SROA 1JJGA 1P16A 3G71A 1OTCA 2NN6I 4JBKA 4YCWA 3UDIA 5JJKA 4DUYQ 1SFOH 4LF8Q 3HOVH 2MFIA 4NB3A 2R6GA 3B6YA 1VQDA 1SN8A 5AJ3L 3TRZA 4OX9L 2VW9A 4HJ7A 4QJFA 2Q2HA 2UXCL 3HOYG 1PH7A 2B63G 1S3OA 3E9HA 4X66Q 1X3FA 1YVCA 4GS3A 5M5WH 2UUAQ 4B3TL 4L5RC 3ZJYC 5IYBH 1PFSA 1VQMA 5LMUL 4A3MG 4A3GG 3AYHB 3PSIA 4YCVA 4DAMA 1Y1WG 1XMQQ 4MNOA 4JYAL 1N32Q 1H95A 1LUZA 1TWHH 3H0GG 1HR0W 1MIUA 4B3SL 4DR3L 1RIPA 4JI6L 4LF5L 2NVYH 4LF4L 4A3CH 1C9OA 2Y0SG 5GADC 2B29A 2UXBL 1UE5A 3G6EA 2ZJRA 4HIDA 1NJIC 1X55A 2UUBQ 3JC66 3F8TA 4P73A 4YHHL 2K75A 4WJ4A 4DR1Q 1G291 4KHPL 1YHQA 5HGQA 3L0OA 4GOPA 4IFDG 3KF8B 4Y7NH 1WJJA 2ASBA 2R7DA 1CKNA 1W2BA 1VQHA 4DV3Q 1JJCB 2K4KA 1J5EL 4R4IA 2I5HA 4LFCQ 4BY7G 4GN4B 2YTXA 4OO1G 4ME3A 3A0JA 3VDYA 3CF5A 5JEAJ 1WI5A 3KF6B 4X66L 4A3LG 3EBEA 5ELOA 2E2IH 2NVXH 2K5HA 1TWFH 4EX5A 1YZ6A 2ALYB 2NZHA 3PV0A 4JBJA 4TVAB 5LMNW 1PH4A 1Q1EA 2E2HH 2F4VQ 1VQ9A 1KL9A 4BXXG 4KHZA 2ZTEA 4QL5A 2I5MX 4A4IA 1N8RC 4JC0A 1XPRA 1RL2A 4LFBQ 4DV4Q 5BR8Q 2AWNA 2RCNA 2FXQA 3I55A 3KLWA 2UUCL 2IT1A 4R1JA 4UY8C 1N33Q 2RF4A 1VQCA 1V43A 1VQ7A 4DR4L 3GTLH 4C3IH 2VNUD 2N49A 3BZKA 2WB1E 1Q7YC 4BY1G 4A93G 3HOYH 2JA6H 3I4NG 2B63H 1L1OA 3RZDH 3UDXA 4DK3C 1YJWA 4C2MH 4JCVE 2F3IA 1U0LA 1A8VA 4DPGA 1SE8A 1VQNA 5M3MG 2PI2A 2JJQA 5GROA 4DV1L 1YHBA 4OONA 2BA0A 5C4XG 4L5SA 4BBRG 3T1YQ 1B8AA 3H0GH 3GO5A 3T1HQ 1QZHA 3A5ZB 4JI2L 1IL2A 1BBWA 1HZCA 3KDFA 2VUMG 5IWAQ 3PUXA 4A3IG 2E2JH 2RHQB 3BU2A 1NY4A 1CUKA 1IBKQ 4R4OA 1FJGQ 2EQSA 2VY3A 3WWVA 1CKMA 4YY3L 4TQUS 1HNZL 3G4SA 4LFAL 3RN2A 4BA2I 3M9BA 2D0OA 4GKKL 1WFQA 1GO3E 1HNXL 4HJAA 4HIMA 3CD6A 1FL0A 1C7YA 1JMCA 3PIPA 4BY7H 4LF6Q 1UE6A 1EIYB 2PQAB 1IBLQ 2JK8A 2JE6I 1PYSB 1LYLA 1QVGA 2K50A 4B3RL 4X64Q 2I0QA 4A3FH 4A3LH 4GKJQ 1KAWA 4A3BG 4P72A 3CCRA 3L2PA 2HQLA 2R92G 1HH2P 5M5YH 4HJ9A 3UDFA 2ZTDA 4RMFA 4BXXH 1LM0A 3NENA 4JI5L 4DNIA 1X9NA 3TS0A 1PH2A 1Q81C 2KCTA 4NXMQ 4IJLA 4PG3A 3S2HH 2YYZA 3KOJA 2RHSB 2XGTA 2HIVA 2Z0SA 3D0FA 2OQ0A 2E8GA 4GN5A 4IJHA 3ER0A 4DR2Q 1VQPA 1JE5A 1X3GA 3CP0A 4GN3B 5GAGC 5E7NA 5IYCG 2R7FA 4DV7L 4B3ML 4J15A 3RZOH 4YWLA 3W5OA 3AQQA 2NN6G 2Q2UA 4JI4L 1PH5A 4A93H 2VS1A 4BY1H 4HJ5A 4DV6Q 3HOZG 3I4NH 1XMOQ 3I4OA 1UE7A 4A75A 3GDEA 4A3KG 1PA6A 4JI0Q 1K3RA 3GD7A 3CQZH 1B7YB 2JA8G 4AYBE 1XNRQ 4O0AA 3F2CA 2QGQA 3GTOH 3KJOA 1Y1VG 3W1GA 1TWAH 1TWCH 4BBRH 4DV2Q 3CW2C 4A3DH 1UEBA 1VQKA 2OTJA 5K36G 2VUMH 1IYJB 2K5VA 3FKIG 4A3IH 1N34Q 5H1SE 2AKWB 3HKSA 2KHIA 4JG2A 1M1KC 3S1NH 3AFQA 2R7ZG 4DR6L 4X62L 3IRBA 5EAYA 4X65Q 4XIGS 1TXYA 2PI2E 2GVBA 4DV0L 4QQBX 1HNWQ 1K83H 4Y52H 4DR2L 4AQYQ 4LF7Q 3TREA 5IP9G 1FVIA 4C3JH 4DV5L 1CSQA 2JEAI 1I94L 3EN2A 4PMWA 3M4OH 1CKOA 1I5FA 1VQGA 4DV6L 3W1BA 3CPWA 3F2BA 1PV4A 4JOIA 4JBMA 1GVPA 2XTIA 4JI1Q 3TQYA 3HOUG 4A3BH 1A0IA 1Q12A 3I56A 1X3EA 5IT9c 1M90C 3AEVA 2WP8J 3ULLA 2R92H 1P8LA 1VQJA 2WAQE 5C4JH 2Q2TA 4DUYL 4LF8L 2IX0A 3G48A 1QUQA 3CC4A 2JA7G 1V9PA 2BH8A 1B70B 2YV5A 2Z6KC 1UWVA 3I7FA 1ASYA 4LUOA 1A63A 4OWXB 2WFWA 1YJ9A 4LUVA 2AWOA 3H3VH 3BZCA 1YJNA 5IYCH 2LXKA 3BJUA 1HR0Q 1U5KA 3U58A 2UUAL 4JI8Q 4KI0A 4KLKA 3GTGH 4IFDJ 2NVTH 1KXLA 1GKHA 5IYDH 3HOZH 3E0EA 1N36Q 1OXUA 2VQEQ 1XMQL 2IHFA 1N32L 2DGYA 4IOCA 1X65A 4A3KH 2JA8H 2VQFQ 1EYGA 5C0XG 2MNAA 3RN5A 1EQQA 4JI3Q 4JV5Q 4GLAC 1Y1VH 3PF5A 2UUBL 2JA9A 3RLOA 4GOPB 3CCJA 4IPDA 3TEHB 2WB1G 2ID0A 1CKNB 3LGJA 4IO9A 2UU9Q 1NMGA 3FKIH 4DR1L 4O2DA 4GNXA 1E1OA 2OWOA 1C0AA 5C0XI 1PHJA 1VQBA 2CKZB 2VZAA 1NMFA 5HY6A 3E9IA 4APVA 5DLQE 2R7ZH 3ICEA 2HHHQ 4DV3L 1XPUA 4LFCL 5C3EG 2HT1A 5LMNQ 2D0PA 4A3MH 4A3GH 1BBUA 1L0WA 3JAMi 1Y1WH 3KYHC 5IP9H 1IBMQ 4POGA 4DR5Q 3K7UC 1GM5A 4OXPA 4A3EG 4GLXA 2JA5G 3PF4A 3CCUA 1K9MC 2LXJA 4NXNQ 1VQLA 3K8AA 3J81i 2F4VL 3S1RH 4UPAA 3AFPA 3K81C 3I4MG 1E3PA 1Q1BA 4A3JG 3HOUH 1LTLA 4UP9A 4H02A 4LFBL 4DV4L 1Y14B 2YTVA 2F52A 5BR8L 3CCEA 1X54A 2A19A 3HKZE 3OTOQ 1GD7A 1VQ8A 4K0KQ 2ES2A 1L1OB 2JA7H 1N33L 3J81j 4R4QA 4UP8A 3RLFA 4DUZQ 3S17H 3HOVG 1WCMG 4LUZA 1I50H 2OTLA 3DLLA 4DKAC 1W3SA 3PGZA 4HIKA 4PZ8A 1XNQQ 1OXSC 3KDFB 1G51A 3UE1A 3FP9A 1KRSA 3JAMc 3D31A 3CCSA 2DUDA 3M85A 4HJ8A 3T1YL 1CSPA 4GOPC 1HZAA 3T1HL 1S40A 4DAYB 2E5LQ 3CCLA 2BH2A 3F1ZA 5IWAL 1VQ6A 2H5XA 2L15A 1S72A 4LF9Q 1QVFA 1IBKL 2GN5A 5IY0A 3J81c 2JEBI 1YNXA 2AMCB 1FJGL 3CCQA 3STBD 3OYYA 1XPOA 2A8VA 5FJ8G 3CXCA 1SMXA 1KC8C 5AJ3Q 1JJ2A 3PUWA 4OX9Q 5J3BA 4AYBG 2IX1A 5C3EH 4PZ7A 1E24A 3CMEA 1PH8A 1IBLL 4LF6L 4DR7Q 5M3MH 2UXCQ 3PCOB 4BA1I 4QY7A 1TWGH 4B3TQ 1QVCA 4X64L 5C4XH 5M3FG 4WJ3M 3GTQH 2JA5H 3CPFA 2N8NA 4GLVB 4NPSA 4C3HH 5LMUQ 3PUYA 4GKJL 4JYAQ 2N78A 4A76A 4P71A 2GVAA 3HOXG 1I6HH 3I4MH 1E7ZA 4A3JH 1KIXA 4B3SQ 1SRUA 1L1OC 4DR3Q 4JI6Q 4LF5Q 1YBYA 4NXML 4JI7Q 1L2FA 1PH3A 2KHJA 1K8GA 4LF9L 2UXBQ 4AH6A 1T9HA 2CWPA 1IXRA 1KQSA 2EIFA 2MQHA 4YHHQ 5JJIA 3RNUA 1EUJA 1VS0A 5GAEC 1R9TH 3CCVA 3HOWG 3EIVA 4KHPQ 1BKBA 3J7A5 1WCMH 3H15A 1XJVA 1XMOL 2CWAA 3ULJA 3CAMA 2EXDA 4RG1A 1J5EQ 1D8LA 1PVOA 2UXDQ 4JI0L 1DGSA 4DR7L 2WAQG 4EQ5A 1SR3A 4YWKA 3GTJH 2OCEA 5C44G 1XNRL 2JA6G 3KFUA 1G6PA 2VL6A 1VQ4A 4R4CA 3U50C 5IP7G 1X6OA 1E1TA 4L5QA 3A5UA 3CMAA 4DV2L 3GTKH 5FLXc 3KF6A 2N3SA 3PUVA 2K5NA 1N34L 2CQOA 1KHIA 1AE2A 2K14A 3GTPH 4BBSG 3U4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 L;  3ERS X;  1Z9F A;  1YHA A;  5ELN A;  4JI7 L;  5GAH C;  1PH1 A;  5FJ8 H;  4PZ6 A;  2QEX A;  4JBW A;  3F2D A;  1HNW L;  2UUC Q;  1I3Q H;  2IHE A;  4FDB A;  4AQY L;  4LF7 L;  5JJL A;  4IPH A;  2Y0S E;  3J80 i;  5JEA G;  1K73 C;  1NTG A;  4DR4 Q;  2PNH A;  1AH9 A;  1VQO A;  1V1Q A;  1VQA A;  3CC2 A;  1EQR A;  5GQO A;  5M5X H;  1VQ5 A;  1YIT A;  2V1C C;  4IPC A;  3S16 H;  3S2D H;  1K0R A;  5M3F H;  4XTC S;  2UXD L;  1E22 A;  4JI1 L;  3S15 H;  4DV1 Q;  1QUQ B;  3DM3 A;  3J7Z C;  2R93 G;  2ZJP A;  3PO3 G;  3HOX H;  3FHW A;  4IFD I;  4A3F G;  3PO2 G;  3MEF A;  4JI2 Q;  3M7N A;  2ZM6 Q;  1WYD A;  2A1A A;  1D7Q A;  5C0X J;  3PIO A;  4QGU A;  4OO1 I;  1MKH A;  1MJC A;  1X56 A;  1OXX K;  1HZB A;  1IZ6 A;  3ULP A;  1Q46 A;  4YY3 Q;  4OWT B;  4POF A;  5FLM G;  4LFA Q;  1HNZ Q;  1HR0 L;  1ASZ A;  4JI8 L;  4GKK Q;  1PYB A;  3HOW H;  4HIO A;  1KD1 C;  2NZO A;  1HNX Q;  2MO0 A;  1N36 L;  2VQE L;  1EOV A;  1OXT A;  3S24 A;  1YEZ A;  3J80 c;  1Z47 A;  4LW1 A;  3GTM H;  3HKZ G;  5C44 H;  2VQF L;  4IPG A;  3K80 C;  3STB C;  4B3R Q;  1VQF A;  4P75 A;  4JI3 L;  2ZTC A;  3Q8D A;  4GNX B;  4JV5 L;  2PQA A;  2YTY A;  5IP7 H;  3M3Y H;  3KJP A;  3K0X A;  1KRT A;  2UU9 L;  1NBW A;  4X6A H;  4P74 A;  3OW2 A;  2AHO B;  3HFZ B;  3NEL A;  4AIM A;  1UE1 A;  4LNQ A;  4JI5 Q;  1PH6 A;  4A3D G;  2ZM6 L;  4ALP A;  2IY5 B;  2QA4 A;  3I2Z A;  2HHH L;  4R4T A;  4BBS H;  2Q2I A;  4JOI C;  4DR6 Q;  5LMN L;  2I5L X;  3NBH B;  4DK6 C;  1IBM L;  4YCU A;  4B3M Q;  2OQK A;  4DV7 Q;  1N9W A;  1VCI A;  1XTD A;  4DR5 L;  1MJE A;  3K7A H;  1HZ9 A;  4OWW B;  1OXV A;  1Q8K A;  5IYB G;  3S1M H;  1EIF A;  2PMZ E;  3CCM A;  4JI4 Q;  3M4Q A;  3U4Z A;  2KEN A;  1YI2 A;  3L7Z C;  4MTN A;  4NXN L;  2JQO A;  4YWM A;  2Z6K A;  3S1Q H;  3SGI A;  1BVS A;  1O7I A;  2K52 A;  4L5T A;  2KCM A;  3NEM A;  3A74 A;  3S14 H;  4A3C G;  2R93 H;  1EWI A;  3PO3 H;  3PO2 H;  3OTO L;  2YU9 H;  1NE3 A;  4K0K L;  3RLN A;  1K8A C;  1Q86 C;  1VQI A;  3M4P A;  4UP7 A;  4DUZ L;  2ZJQ A;  1WOC A;  3TS2 A;  1JT8 A;  4QIW E;  3MXN B;  3RR5 A;  2ATW A;  1HJP A;  4X62 Q;  2B3G A;  5FLM H;  4A3E H;  1AE3 A;  2D62 A;  1J6Q A;  2C35 B;  4LWC A;  3UE0 A;  1JB7 A;  2LSS A;  4DV0 Q;  1VQE A;  1Q82 C;  2CCZ A;  1XNQ L;  2NVQ H;  1PH9 A;  2HIX A;  4IOA A;  2MO1 A;  4DV5 Q;  5IE8 A;  3CC7 A;  4GNX C;  1FGU A;  1I94 Q;  1EFW A;  1A62 A;  2BA1 A;  1YIJ A;  5IYD G;  3UDG A;  2E5L L;  2KBN A;  3PUZ A;  4LF4 Q;  1QZG A;  4MZ9 A;  3H3V I;  2CFM A;  1SLJ A;  1SRO A;  1JJG A;  1P16 A;  3G71 A;  1OTC A;  2NN6 I;  4JBK A;  4YCW A;  3UDI A;  5JJK A;  4DUY Q;  1SFO H;  4LF8 Q;  3HOV H;  2MFI A;  4NB3 A;  2R6G A;  3B6Y A;  1VQD A;  1SN8 A;  5AJ3 L;  3TRZ A;  4OX9 L;  2VW9 A;  4HJ7 A;  4QJF A;  2Q2H A;  2UXC L;  3HOY G;  1PH7 A;  2B63 G;  1S3O A;  3E9H A;  4X66 Q;  1X3F A;  1YVC A;  4GS3 A;  5M5W H;  2UUA Q;  4B3T L;  4L5R C;  3ZJY C;  5IYB H;  1PFS A;  1VQM A;  5LMU L;  4A3M G;  4A3G G;  3AYH B;  3PSI A;  4YCV A;  4DAM A;  1Y1W G;  1XMQ Q;  4MNO A;  4JYA L;  1N32 Q;  1H95 A;  1LUZ A;  1TWH H;  3H0G G;  1HR0 W;  1MIU A;  4B3S L;  4DR3 L;  1RIP A;  4JI6 L;  4LF5 L;  2NVY H;  4LF4 L;  4A3C H;  1C9O A;  2Y0S G;  5GAD C;  2B29 A;  2UXB L;  1UE5 A;  3G6E A;  2ZJR A;  4HID A;  1NJI C;  1X55 A;  2UUB Q;  3JC6 6;  3F8T A;  4P73 A;  4YHH L;  2K75 A;  4WJ4 A;  4DR1 Q;  1G29 1;  4KHP L;  1YHQ A;  5HGQ A;  3L0O A;  4GOP A;  4IFD G;  3KF8 B;  4Y7N H;  1WJJ A;  2ASB A;  2R7D A;  1CKN A;  1W2B A;  1VQH A;  4DV3 Q;  1JJC B;  2K4K A;  1J5E L;  4R4I A;  2I5H A;  4LFC Q;  4BY7 G;  4GN4 B;  2YTX A;  4OO1 G;  4ME3 A;  3A0J A;  3VDY A;  3CF5 A;  5JEA J;  1WI5 A;  3KF6 B;  4X66 L;  4A3L G;  3EBE A;  5ELO A;  2E2I H;  2NVX H;  2K5H A;  1TWF H;  4EX5 A;  1YZ6 A;  2ALY B;  2NZH A;  3PV0 A;  4JBJ A;  4TVA B;  5LMN W;  1PH4 A;  1Q1E A;  2E2H H;  2F4V Q;  1VQ9 A;  1KL9 A;  4BXX G;  4KHZ A;  2ZTE A;  4QL5 A;  2I5M X;  4A4I A;  1N8R C;  4JC0 A;  1XPR A;  1RL2 A;  4LFB Q;  4DV4 Q;  5BR8 Q;  2AWN A;  2RCN A;  2FXQ A;  3I55 A;  3KLW A;  2UUC L;  2IT1 A;  4R1J A;  4UY8 C;  1N33 Q;  2RF4 A;  1VQC A;  1V43 A;  1VQ7 A;  4DR4 L;  3GTL H;  4C3I H;  2VNU D;  2N49 A;  3BZK A;  2WB1 E;  1Q7Y C;  4BY1 G;  4A93 G;  3HOY H;  2JA6 H;  3I4N G;  2B63 H;  1L1O A;  3RZD H;  3UDX A;  4DK3 C;  1YJW A;  4C2M H;  4JCV E;  2F3I A;  1U0L A;  1A8V A;  4DPG A;  1SE8 A;  1VQN A;  5M3M G;  2PI2 A;  2JJQ A;  5GRO A;  4DV1 L;  1YHB A;  4OON A;  2BA0 A;  5C4X G;  4L5S A;  4BBR G;  3T1Y Q;  1B8A A;  3H0G H;  3GO5 A;  3T1H Q;  1QZH A;  3A5Z B;  4JI2 L;  1IL2 A;  1BBW A;  1HZC A;  3KDF A;  2VUM G;  5IWA Q;  3PUX A;  4A3I G;  2E2J H;  2RHQ B;  3BU2 A;  1NY4 A;  1CUK A;  1IBK Q;  4R4O A;  1FJG Q;  2EQS A;  2VY3 A;  3WWV A;  1CKM A;  4YY3 L;  4TQU S;  1HNZ L;  3G4S A;  4LFA L;  3RN2 A;  4BA2 I;  3M9B A;  2D0O A;  4GKK L;  1WFQ A;  1GO3 E;  1HNX L;  4HJA A;  4HIM A;  3CD6 A;  1FL0 A;  1C7Y A;  1JMC A;  3PIP A;  4BY7 H;  4LF6 Q;  1UE6 A;  1EIY B;  2PQA B;  1IBL Q;  2JK8 A;  2JE6 I;  1PYS B;  1LYL A;  1QVG A;  2K50 A;  4B3R L;  4X64 Q;  2I0Q A;  4A3F H;  4A3L H;  4GKJ Q;  1KAW A;  4A3B G;  4P72 A;  3CCR A;  3L2P A;  2HQL A;  2R92 G;  1HH2 P;  5M5Y H;  4HJ9 A;  3UDF A;  2ZTD A;  4RMF A;  4BXX H;  1LM0 A;  3NEN A;  4JI5 L;  4DNI A;  1X9N A;  3TS0 A;  1PH2 A;  1Q81 C;  2KCT A;  4NXM Q;  4IJL A;  4PG3 A;  3S2H H;  2YYZ A;  3KOJ A;  2RHS B;  2XGT A;  2HIV A;  2Z0S A;  3D0F A;  2OQ0 A;  2E8G A;  4GN5 A;  4IJH A;  3ER0 A;  4DR2 Q;  1VQP A;  1JE5 A;  1X3G A;  3CP0 A;  4GN3 B;  5GAG C;  5E7N A;  5IYC G;  2R7F A;  4DV7 L;  4B3M L;  4J15 A;  3RZO H;  4YWL A;  3W5O A;  3AQQ A;  2NN6 G;  2Q2U A;  4JI4 L;  1PH5 A;  4A93 H;  2VS1 A;  4BY1 H;  4HJ5 A;  4DV6 Q;  3HOZ G;  3I4N H;  1XMO Q;  3I4O A;  1UE7 A;  4A75 A;  3GDE A;  4A3K G;  1PA6 A;  4JI0 Q;  1K3R A;  3GD7 A;  3CQZ H;  1B7Y B;  2JA8 G;  4AYB E;  1XNR Q;  4O0A A;  3F2C A;  2QGQ A;  3GTO H;  3KJO A;  1Y1V G;  3W1G A;  1TWA H;  1TWC H;  4BBR H;  4DV2 Q;  3CW2 C;  4A3D H;  1UEB A;  1VQK A;  2OTJ A;  5K36 G;  2VUM H;  1IYJ B;  2K5V A;  3FKI G;  4A3I H;  1N34 Q;  5H1S E;  2AKW B;  3HKS A;  2KHI A;  4JG2 A;  1M1K C;  3S1N H;  3AFQ A;  2R7Z G;  4DR6 L;  4X62 L;  3IRB A;  5EAY A;  4X65 Q;  4XIG S;  1TXY A;  2PI2 E;  2GVB A;  4DV0 L;  4QQB X;  1HNW Q;  1K83 H;  4Y52 H;  4DR2 L;  4AQY Q;  4LF7 Q;  3TRE A;  5IP9 G;  1FVI A;  4C3J H;  4DV5 L;  1CSQ A;  2JEA I;  1I94 L;  3EN2 A;  4PMW A;  3M4O H;  1CKO A;  1I5F A;  1VQG A;  4DV6 L;  3W1B A;  3CPW A;  3F2B A;  1PV4 A;  4JOI A;  4JBM A;  1GVP A;  2XTI A;  4JI1 Q;  3TQY A;  3HOU G;  4A3B H;  1A0I A;  1Q12 A;  3I56 A;  1X3E A;  5IT9 c;  1M90 C;  3AEV A;  2WP8 J;  3ULL A;  2R92 H;  1P8L A;  1VQJ A;  2WAQ E;  5C4J H;  2Q2T A;  4DUY L;  4LF8 L;  2IX0 A;  3G48 A;  1QUQ A;  3CC4 A;  2JA7 G;  1V9P A;  2BH8 A;  1B70 B;  2YV5 A;  2Z6K C;  1UWV A;  3I7F A;  1ASY A;  4LUO A;  1A63 A;  4OWX B;  2WFW A;  1YJ9 A;  4LUV A;  2AWO A;  3H3V H;  3BZC A;  1YJN A;  5IYC H;  2LXK A;  3BJU A;  1HR0 Q;  1U5K A;  3U58 A;  2UUA L;  4JI8 Q;  4KI0 A;  4KLK A;  3GTG H;  4IFD J;  2NVT H;  1KXL A;  1GKH A;  5IYD H;  3HOZ H;  3E0E A;  1N36 Q;  1OXU A;  2VQE Q;  1XMQ L;  2IHF A;  1N32 L;  2DGY A;  4IOC A;  1X65 A;  4A3K H;  2JA8 H;  2VQF Q;  1EYG A;  5C0X G;  2MNA A;  3RN5 A;  1EQQ A;  4JI3 Q;  4JV5 Q;  4GLA C;  1Y1V H;  3PF5 A;  2UUB L;  2JA9 A;  3RLO A;  4GOP B;  3CCJ A;  4IPD A;  3TEH B;  2WB1 G;  2ID0 A;  1CKN B;  3LGJ A;  4IO9 A;  2UU9 Q;  1NMG A;  3FKI H;  4DR1 L;  4O2D A;  4GNX A;  1E1O A;  2OWO A;  1C0A A;  5C0X I;  1PHJ A;  1VQB A;  2CKZ B;  2VZA A;  1NMF A;  5HY6 A;  3E9I A;  4APV A;  5DLQ E;  2R7Z H;  3ICE A;  2HHH Q;  4DV3 L;  1XPU A;  4LFC L;  5C3E G;  2HT1 A;  5LMN Q;  2D0P A;  4A3M H;  4A3G H;  1BBU A;  1L0W A;  3JAM i;  1Y1W H;  3KYH C;  5IP9 H;  1IBM Q;  4POG A;  4DR5 Q;  3K7U C;  1GM5 A;  4OXP A;  4A3E G;  4GLX A;  2JA5 G;  3PF4 A;  3CCU A;  1K9M C;  2LXJ A;  4NXN Q;  1VQL A;  3K8A A;  3J81 i;  2F4V L;  3S1R H;  4UPA A;  3AFP A;  3K81 C;  3I4M G;  1E3P A;  1Q1B A;  4A3J G;  3HOU H;  1LTL A;  4UP9 A;  4H02 A;  4LFB L;  4DV4 L;  1Y14 B;  2YTV A;  2F52 A;  5BR8 L;  3CCE A;  1X54 A;  2A19 A;  3HKZ E;  3OTO Q;  1GD7 A;  1VQ8 A;  4K0K Q;  2ES2 A;  1L1O B;  2JA7 H;  1N33 L;  3J81 j;  4R4Q A;  4UP8 A;  3RLF A;  4DUZ Q;  3S17 H;  3HOV G;  1WCM G;  4LUZ A;  1I50 H;  2OTL A;  3DLL A;  4DKA C;  1W3S A;  3PGZ A;  4HIK A;  4PZ8 A;  1XNQ Q;  1OXS C;  3KDF B;  1G51 A;  3UE1 A;  3FP9 A;  1KRS A;  3JAM c;  3D31 A;  3CCS A;  2DUD A;  3M85 A;  4HJ8 A;  3T1Y L;  1CSP A;  4GOP C;  1HZA A;  3T1H L;  1S40 A;  4DAY B;  2E5L Q;  3CCL A;  2BH2 A;  3F1Z A;  5IWA L;  1VQ6 A;  2H5X A;  2L15 A;  1S72 A;  4LF9 Q;  1QVF A;  1IBK L;  2GN5 A;  5IY0 A;  3J81 c;  2JEB I;  1YNX A;  2AMC B;  1FJG L;  3CCQ A;  3STB D;  3OYY A;  1XPO A;  2A8V A;  5FJ8 G;  3CXC A;  1SMX A;  1KC8 C;  5AJ3 Q;  1JJ2 A;  3PUW A;  4OX9 Q;  5J3B A;  4AYB G;  2IX1 A;  5C3E H;  4PZ7 A;  1E24 A;  3CME A;  1PH8 A;  1IBL L;  4LF6 L;  4DR7 Q;  5M3M H;  2UXC Q;  3PCO B;  4BA1 I;  4QY7 A;  1TWG H;  4B3T Q;  1QVC A;  4X64 L;  5C4X H;  5M3F G;  4WJ3 M;  3GTQ H;  2JA5 H;  3CPF A;  2N8N A;  4GLV B;  4NPS A;  4C3H H;  5LMU Q;  3PUY A;  4GKJ L;  4JYA Q;  2N78 A;  4A76 A;  4P71 A;  2GVA A;  3HOX G;  1I6H H;  3I4M H;  1E7Z A;  4A3J H;  1KIX A;  4B3S Q;  1SRU A;  1L1O C;  4DR3 Q;  4JI6 Q;  4LF5 Q;  1YBY A;  4NXM L;  4JI7 Q;  1L2F A;  1PH3 A;  2KHJ A;  1K8G A;  4LF9 L;  2UXB Q;  4AH6 A;  1T9H A;  2CWP A;  1IXR A;  1KQS A;  2EIF A;  2MQH A;  4YHH Q;  5JJI A;  3RNU A;  1EUJ A;  1VS0 A;  5GAE C;  1R9T H;  3CCV A;  3HOW G;  3EIV A;  4KHP Q;  1BKB A;  3J7A 5;  1WCM H;  3H15 A;  1XJV A;  1XMO L;  2CWA A;  3ULJ A;  3CAM A;  2EXD A;  4RG1 A;  1J5E Q;  1D8L A;  1PVO A;  2UXD Q;  4JI0 L;  1DGS A;  4DR7 L;  2WAQ G;  4EQ5 A;  1SR3 A;  4YWK A;  3GTJ H;  2OCE A;  5C44 G;  1XNR L;  2JA6 G;  3KFU A;  1G6P A;  2VL6 A;  1VQ4 A;  4R4C A;  3U50 C;  5IP7 G;  1X6O A;  1E1T A;  4L5Q A;  3A5U A;  3CMA A;  4DV2 L;  3GTK H;  5FLX c;  3KF6 A;  2N3S A;  3PUV A;  2K5N A;  1N34 L;  2CQO A;  1KHI A;  1AE2 A;  2K14 A;  3GTP H;  4BBS G;  3U4V A; 
#chains in the Genus database with same CATH topology
 1YHA A;  2AQ3 B;  1I3Q H;  2IHE A;  4FDB A;  2UUC Q;  4I7A A;  3J80 i;  1K73 C;  3C2P A;  1VQO A;  3NWT A;  1VQ5 A;  2V1C C;  4ZUJ A;  1K0R A;  2EY2 A;  3M7G A;  1AW7 A;  4DV1 Q;  1QUQ B;  3DM3 A;  4IUP A;  4EVO A;  1EQV A;  2R93 G;  4HMJ A;  3D8G A;  3FHW A;  1ZXT A;  1HZB A;  1RKN A;  4ZUI A;  3VR4 A;  4OWT B;  5FLM G;  3NTH A;  4XT1 B;  1PYB A;  1LAB A;  4RGN A;  1OXT A;  1YEZ A;  1HHV A;  1Z47 A;  1Y8P B;  4JI3 L;  3Q8D A;  2YTY A;  3OW2 A;  2NVX B;  5DNF A;  5COY A;  1A3T A;  4ALP A;  2QA4 A;  1LT6 D;  2VB3 X;  4JOI C;  2XN9 C;  4DR6 Q;  2I5L X;  4UHV A;  4DK6 C;  2QEJ C;  2F03 A;  4B3M Q;  4OWW B;  2Q8T A;  1N9W A;  3TP8 A;  3K7A H;  5D14 A;  3O13 A;  5KGU A;  3S1M H;  1EIF A;  5JJZ A;  4IUR A;  3M4Q A;  2KEN A;  4MTN A;  2EOT A;  2JQO A;  5EKL A;  1D1K A;  1EFI D;  2K01 A;  5KEE A;  1SE4 A;  3RZD B;  1BO0 A;  3NEM A;  3A74 A;  4A3C G;  1EWI A;  4UDU C;  4HAE A;  1EYC A;  2WAC A;  4DFA A;  3OPO A;  2D9U A;  3M4P A;  1JT8 A;  3RR5 A;  1HJP A;  1JB7 A;  1XTC D;  3H6M A;  5DAU A;  5I4D A;  3J80 E;  1XYI A;  3S1M B;  2MO1 A;  1EEI D;  3WDN A;  5IE8 A;  4I7Z C;  3CC7 A;  1I94 Q;  1EFW A;  3UDG A;  1EWC A;  5E4W C;  1SRO A;  1P16 A;  2NN6 I;  4A3F B;  1PFB A;  5T1I A;  2DY8 A;  4WRD A;  4LF8 Q;  3HOV H;  2XSC A;  1VQD A;  5M5Y B;  5AJ3 L;  2FJ2 A;  2EJF C;  1S3O A;  2ZXO A;  5ELD A;  3MHB A;  3KUP A;  3ZJY C;  5LMU L;  3I90 A;  4LJZ C;  4JYA L;  1Y1W G;  4XQN A;  4BWG B;  1TWH H;  2G9H D;  4A93 B;  1UAP A;  1U4R A;  3HKZ B;  2RSO A;  4XT3 B;  3KLS X;  1TS3 A;  4JI6 L;  4LF5 L;  1C9O A;  3BG3 A;  2SDF A;  5BN5 A;  3T16 A;  1EY8 A;  2K75 A;  4DR1 Q;  1YNJ C;  1G29 1;  4WFN 3;  4A3D B;  3L0O A;  4Y7N H;  1HQM C;  4GN4 B;  4ME3 A;  3VDY A;  2O5I C;  2NTS A;  5JEA J;  1WI5 A;  3KF6 B;  2E2I H;  5IT9 L;  2AQ1 B;  2ALY B;  4JBJ A;  1PH4 A;  2F4V Q;  3D4W A;  4PMC A;  2I5M X;  1AZQ A;  1N8R C;  2PQE A;  2RCN A;  2IT1 A;  4R1J A;  4R8I A;  2MPM A;  1NR4 A;  4A93 G;  3MA2 B;  4ZAI A;  2PPB C;  4RA8 A;  1GOZ A;  4DPG A;  1SE8 A;  2Z6B A;  1Y69 U;  4C1N K;  4OGQ C;  5C4X G;  1E0B A;  4JI2 L;  1B8A A;  3H0G H;  1QZH A;  2G5D A;  2ZXR A;  5FO9 B;  3SR1 A;  1T5X D;  2EYM A;  1KAB A;  2H1E A;  1FJG Q;  3VA7 A;  2EQS A;  3RN2 A;  3R3O A;  4H44 C;  1D5X C;  4IFD H;  1JMC A;  4LF6 Q;  1UE6 A;  1IBL Q;  2JE6 I;  2RVL A;  1PYS B;  4CDC C;  1QVG A;  4P2C B;  4B3R L;  2I0Q A;  3CRL C;  3WOE A;  3DHQ A;  3DMU A;  5COR A;  1B44 D;  4A3G B;  1ESR A;  5DM6 3;  3L2P A;  3BDC A;  3DEO A;  3H0G B;  3KBX A;  3NEN A;  1CT1 D;  2KCT A;  3OWF A;  4NXM Q;  2RHS B;  2XGT A;  1VQP A;  2OQ0 A;  2E8G A;  4DR2 Q;  4GN3 B;  5GAG C;  1RF2 D;  5IYC G;  2R61 A;  2J0T D;  4YWL A;  2NN6 G;  2VS1 A;  3I4N H;  3I4O A;  4N9P A;  3S17 B;  1QCB D;  3GDE A;  4JK1 C;  1PA6 A;  1STH A;  1KDB A;  3CQZ H;  1B7Y B;  1XNR Q;  4KJO A;  3FPU B;  3GTO H;  4F87 A;  2QGQ A;  3KJO A;  2IWH A;  2CW0 C;  3U9O A;  1TWC H;  4BBR H;  4NMZ A;  1SMY C;  1DYQ A;  1LTI D;  4Z9C B;  1EIG A;  3FPP A;  3IL8 A;  3S1N H;  3IRB A;  5EAY A;  4X65 Q;  4XIG S;  3SDZ A;  5JOB A;  3E5S A;  1V1P B;  4QQB X;  1K83 H;  2J4X A;  4DR2 L;  4AQY Q;  2RBM A;  2FIN B;  5I6W A;  5IP9 G;  4LF7 Q;  4Y52 H;  4DV5 L;  3VR3 A;  4ZLT F;  5CV5 A;  4RHS A;  3V2T A;  1CKO A;  1VQG A;  1PV4 A;  4JOI A;  3A8J E;  1GVP A;  3CQZ B;  2XRS D;  3EVQ A;  1M90 C;  1TWC B;  2WP8 J;  2HUG A;  5C4J H;  4DUY L;  1FNV A;  3G48 A;  3I72 A;  1QUQ A;  3CC4 A;  1V9P A;  1HFG A;  2YV5 A;  1WVL A;  1UWV A;  4LUO A;  1A63 A;  3IKJ A;  5CMD A;  2B8F A;  3S1N B;  3H3V H;  3BZC A;  3FEW X;  1VDZ A;  1SND A;  1Q8I A;  1DOL A;  4JI8 Q;  3MXP A;  1EWH A;  4KLK A;  3GTG H;  4K2L A;  3TZU A;  2NVT H;  5IYD H;  2QF7 A;  4NKL A;  1NNX A;  3QB3 A;  4IOC A;  4A3K H;  4OEM B;  1UUP A;  1CZW A;  2JA8 H;  1IW7 D;  1Y1V H;  4GOP B;  1MGS A;  1CKN B;  2X69 A;  3LGJ A;  1SXT A;  1PZJ D;  1NMG A;  3FKI H;  1E2V A;  2VXW A;  4MN3 A;  4RHR A;  3OIP A;  2VZA A;  1NMF A;  5HY6 A;  2R7Z H;  1XPU A;  5AFW A;  1STA A;  2HT1 A;  5LMN Q;  2D0P A;  1BBU A;  1L0W A;  2L12 A;  1IBM Q;  4DR5 Q;  2F0M A;  3NPP A;  1MBY A;  2LXJ A;  1W6K A;  4AYB B;  2IL8 A;  4A3K B;  1Q1B A;  4A3J G;  2JA8 B;  2BCO A;  1NSN S;  1Y1V B;  5M3F B;  1Y14 B;  2YTV A;  2F52 A;  2LMC B;  3VYT A;  5BR8 L;  4X3T A;  4ULL A;  4K0K Q;  1L1O B;  2QIL A;  3FKI B;  2KCC A;  3TN2 A;  1STE A;  4NDX A;  2K5Q A;  2PNR C;  1LTA D;  3I4L A;  1I50 H;  2EYF A;  3W2D A;  2HCI A;  2EVB A;  2BE5 D;  1XNQ Q;  3NK9 A;  3OIQ A;  2HQE A;  4S3S A;  1LTR D;  3A8I E;  2L0C A;  3CCS A;  4HJ8 A;  3M85 A;  2B2W C;  3T1Y L;  3OWE B;  4GOP C;  1ESF A;  5LL6 S;  2E5L Q;  2PZT A;  3F1Z A;  3N6R A;  2L15 A;  1S72 A;  1CHQ D;  1IBK L;  1A3V A;  3J81 c;  1YNX A;  2AMC B;  2RA4 A;  4HSV A;  1BBX C;  3H3V C;  4KK7 A;  3M3Y B;  1YNN C;  3LNN A;  4ME5 A;  1V1O A;  1A3U A;  1JJ2 A;  4PNY A;  1JOR A;  4AYB G;  2IX1 A;  1KXL A;  3CRK C;  5M3M H;  3J81 L;  1QVC A;  5M3F G;  3GTQ H;  2JA5 H;  3CPF A;  2N8N A;  4C3H H;  3PUY A;  1HPC A;  2KJX A;  4A76 A;  2GVA A;  5CR3 A;  1SRU A;  1L1O C;  4DR3 Q;  5FOB B;  2F0F A;  4G4K A;  4PV1 C;  4HED A;  2KHJ A;  3S9W A;  1PH3 A;  1KQS A;  1TVX A;  3T51 B;  1LO5 D;  2MQH A;  4HN7 A;  4YHH Q;  3RNU A;  3I91 A;  5GAE C;  3PO3 B;  4QUF A;  3PO2 B;  2ICE C;  1DCZ A;  3EIV A;  4YIJ A;  1BKB A;  3TP7 A;  1XMO L;  3ULJ A;  4CBV A;  1D8L A;  2JA6 G;  4YWK A;  1SYG A;  3KFU A;  3GTQ B;  4A3E B;  4C3H B;  3EFX D;  1STN A;  3RMH A;  1O7Z A;  2B2T C;  4R4C A;  4RKB A;  1E1T A;  1MHW C;  3GTK H;  4KN4 C;  1A15 A;  3KF6 A;  3HEJ A;  3VYS A;  1KHI A;  3MC0 B;  2OT2 A;  1LTS D;  4QMG A;  4PMB A;  3DXJ C;  3QO2 A;  1Z9F A;  5ELN A;  4PZ6 A;  3K5M A;  3F2D A;  5JEA G;  5TSS A;  3X3M A;  4DR4 Q;  2PNH A;  3AB9 A;  2EJM A;  1MD2 D;  5M5X H;  5GQO A;  1JOK A;  4IPC A;  1QE6 A;  4XTC S;  5I6Y A;  3S15 H;  2NZ1 D;  2D5D A;  3URY A;  2ZJP A;  3PO3 G;  2E76 C;  3NQT A;  5E1F A;  3PO2 G;  3GTK B;  3MEF A;  2K7V A;  4G7O C;  1L0X B;  2QDL A;  1WYD A;  2X6G A;  4IUN A;  2F0W A;  4FF3 A;  4K8I A;  1MSG A;  4OO1 I;  1MKH A;  2C9O A;  1MJC A;  1X56 A;  3ERQ A;  4ODG A;  1H9M A;  1LV9 A;  1STG A;  4FVM A;  1A2T A;  2GA4 B;  3FDT A;  3IFD A;  4YY3 Q;  4POF A;  1HNZ Q;  4LFA Q;  1HR0 L;  2CVR A;  4GKK Q;  1PYW D;  4HIO A;  2NZO A;  1IL8 A;  1H9K A;  2MO0 A;  4RWS C;  1EZ6 A;  3C46 A;  2MJ8 A;  3S24 A;  5J39 A;  5M5X B;  4LW1 A;  4L63 B;  4IPG A;  2DNE A;  4JV5 L;  1U4M A;  2ZTC A;  1UNS A;  3TBI B;  1KRT A;  3HFZ B;  4AIM A;  1UE1 A;  4LNQ A;  1PH6 A;  2E2H B;  2HHH L;  4BBS H;  1NR2 A;  4NP5 A;  3NBH B;  2OQK A;  1VCI A;  1XTD A;  5E3F A;  4H7B A;  1OXV A;  1Q8K A;  3DEP A;  4RAU C;  2SNS A;  2SNM A;  3U4Z A;  3UI2 A;  1YI2 A;  3OMC A;  2I46 A;  4NXN L;  2F4I A;  4YWM A;  5C0X H;  1VMP A;  3S1Q H;  4C3I B;  3SGI A;  1BVS A;  4GZY C;  2XWB B;  2K52 A;  4L5T A;  2DJF C;  2R93 H;  3Q22 A;  1KLU D;  4KHV A;  2YU9 H;  1NE3 A;  1B53 A;  1TT2 A;  1I4H A;  2M00 A;  3LWE A;  3RLN A;  1Q86 C;  2F1M A;  1VQI A;  4UP7 A;  4DUZ L;  5KIX A;  3TS2 A;  3QWN A;  2K5D A;  2Z1C A;  4X62 Q;  2B3G A;  5FLM H;  1J6Q A;  2IPK D;  2K6A A;  1VQE A;  3G6J B;  1FGU A;  3L3O C;  1V1P A;  2FFK B;  2BA1 A;  1S5F D;  3S1Q B;  4BY7 B;  2CFM A;  3SE0 A;  1SLJ A;  1JJG A;  1OTC A;  3RD4 A;  4JBK A;  4KKS A;  5JJK A;  2BDN A;  4NB3 A;  2J7Z A;  1XXG A;  3B6Y A;  1SN8 A;  2OEO A;  4OX9 L;  1JQY D;  4K5X A;  4C3I G;  1QNK A;  2UXC L;  3I3C A;  1PTO F;  3QOJ A;  2B63 G;  3S2H B;  4DGZ A;  2NUC A;  3E9H A;  4X66 Q;  3D3R A;  4B3T L;  4E6I A;  1EYA A;  4L5R C;  4OIK A;  2DNC A;  2D2C C;  5CBE E;  4A3M G;  3PSI A;  3R2I A;  1N32 Q;  1H95 A;  1EU3 A;  1LUZ A;  3SVM A;  1HR0 W;  2F0D A;  4B3S L;  1RIP A;  2EJG C;  4A3C H;  2L5T A;  3A54 A;  5GAD C;  2UXB L;  1PTO D;  2UUB Q;  4HID A;  2O5J C;  1TWA B;  4CDD C;  2SOB A;  5HGQ A;  2B2W A;  4EQP A;  1D6E C;  4HMI A;  4K8J A;  3KF8 B;  4X3S A;  3WOF A;  1WJJ A;  4GOP A;  2ASB A;  2VUM B;  1CKN A;  4DV3 Q;  1J5E L;  4LFC Q;  4BY7 G;  4OO1 G;  1JOO A;  1JR0 D;  1T5E A;  3A0J A;  4X66 L;  4A3L G;  2NVX H;  2K5H A;  3OHX C;  2Q8I B;  4EX5 A;  2NZH A;  3T53 B;  2HD3 A;  3H91 A;  1CQF A;  2ZTE A;  4QL5 A;  4A4I A;  4JC0 A;  5KND A;  1WTH A;  5EKK A;  4QB4 A;  4JPB W;  1S5D D;  3RUZ A;  3KLW A;  2UUC L;  4KY7 A;  4UY8 C;  4QIW B;  5E4X A;  2RF4 A;  1VQC A;  1V43 A;  1VQ7 A;  2QDB A;  2A73 B;  2N49 A;  4RGO S;  4BY1 G;  2RSN A;  1FNW A;  1L1O A;  3F2U A;  3RZD H;  2M2L A;  2F3I A;  3CKI B;  1XWE A;  2KVM A;  1KDA A;  5GRO A;  2JJQ A;  4DV1 L;  4OON A;  2BA0 A;  5I2Y A;  2VB2 X;  2DJG C;  1ENA A;  4KD4 A;  4FF2 A;  1GUW A;  3T1H Q;  1IL2 A;  3A5Z B;  4B9W A;  2VUM G;  3T13 A;  1QNU A;  2EYP A;  3NP8 A;  1AN8 A;  3TSS A;  1CKM A;  4TQU S;  1RTO A;  4I65 A;  3M9B A;  4BA2 I;  2B2T A;  1I6V C;  1JWM D;  1CA5 A;  1NUC A;  1WFQ A;  1GO3 E;  4HJA A;  4HIM A;  1HFN A;  3GV6 A;  2PQA B;  1PRT F;  4X64 Q;  1PXU A;  4A3F H;  2JXM B;  1EIH A;  1Y1W B;  3MXN A;  1SNP A;  5M9O A;  2B2V A;  4HJ9 A;  4IZ8 A;  5M5Y H;  3UDF A;  1DOK A;  3TS0 A;  3VR2 A;  1PH2 A;  4IJL A;  4PG3 A;  3S1R B;  2YYZ A;  3KOJ A;  4DR6 L;  1PRT D;  3SK8 A;  3A56 A;  4CKE A;  2DY7 A;  3CP0 A;  4B3M L;  1EOT A;  3AQQ A;  3NTI A;  2Q2U A;  4A93 H;  3Q0A A;  4HJ5 A;  3SXH A;  1BCP F;  2RQX A;  1UE7 A;  4K2K A;  3K5L A;  1K3R A;  1TQO A;  4AYB E;  1WTR A;  1S4Z A;  1ICW A;  4O0A A;  4ZKC B;  3F2C A;  1FGB D;  3W1G A;  3DUZ A;  4A3D H;  4DV2 Q;  1UEB A;  1VQK A;  2OTJ A;  2K33 A;  1ILQ A;  2AKW B;  2EYH A;  2KHI A;  1BCP D;  3AFQ A;  5D3D A;  3NBI A;  1TR5 A;  2GVB A;  3MEH A;  1HNW Q;  1MSH A;  3IFT A;  5C4H A;  4MHE A;  1I94 L;  3NSW A;  2DN8 A;  2LFN A;  3W1B A;  2MHV A;  1DJR D;  1IW7 C;  3F2B A;  3BS1 A;  4JI1 Q;  2A74 C;  1GUT A;  3HOU G;  4ZQ3 A;  1Q12 A;  3I56 A;  1AP0 A;  5IT9 c;  5C4X B;  3ULL A;  4DN4 M;  2Q2T A;  2EXZ A;  4LF8 L;  2AQ2 B;  2JA7 G;  3KLR A;  1B70 B;  3I7F A;  4X3K A;  3I4M B;  4OWX B;  1S5C D;  1F9Q A;  3K0Y A;  4LUV A;  4LAA A;  1HQR D;  1YJN A;  5IYC H;  3BJU A;  3U58 A;  2NN6 H;  1N36 Q;  4KD3 A;  2VQE Q;  5ELC A;  2KQ3 A;  1JC7 A;  5IGE A;  1VF7 A;  2DGY A;  4L6T B;  3QIA A;  2VQF Q;  4CJ2 C;  2MNA A;  3RN5 A;  3PF5 A;  4B08 A;  4IPD A;  2WB1 G;  4X3U A;  4IO9 A;  2UU9 Q;  1HUM A;  4DR1 L;  2AUJ D;  4O2D A;  5D3I B;  2OWO A;  2EYJ A;  5CV7 A;  2CKZ B;  1RDP D;  5DLQ E;  3ICE A;  4RGT A;  1LAC A;  4A3G H;  2BE5 C;  1EU4 A;  2QCP X;  3ND9 A;  5IP9 H;  4POG A;  1KTK A;  1GUO A;  3P7J A;  1G2S A;  5KNC A;  4GLX A;  3NBH A;  3J81 i;  2F4V L;  3AFP A;  3I4M G;  2F0H A;  4OHJ A;  3S16 B;  2JN4 A;  3S2D B;  1DD2 A;  1Y8N B;  1C48 A;  4UP9 A;  4QUC A;  2CH4 W;  1B1Z A;  1X54 A;  3OTO Q;  1VQ8 A;  2IW3 A;  5I9O A;  2ES2 A;  2V4D A;  3C3L A;  2KUM A;  4R4Q A;  3DWQ A;  4UP8 A;  1JWU D;  1ZYR D;  4NW2 A;  3S17 H;  4DA2 A;  3HOV G;  5G3L F;  4DK0 A;  1ENF A;  5NUC A;  1CK1 A;  3DLL A;  4DKA C;  1W3S A;  3H09 A;  1BXT A;  1EY0 A;  3D6C A;  2N88 A;  4FXG C;  2F0I A;  3JAM c;  2DUD A;  4MTK A;  1QWY A;  4DAY B;  1VQ6 A;  5G3L D;  3GTM B;  1FJG L;  2B2Y C;  3CCQ A;  3OYY A;  1M8A A;  1O80 A;  5FJ8 G;  3CXC A;  1SMX A;  3JAM L;  4J8Q A;  3DWA A;  2NWG A;  4DXF A;  1KC8 C;  3PUW A;  2NYZ D;  1OO9 B;  1DM0 B;  2K05 A;  4LF6 L;  3CME A;  4DR7 Q;  1IBL L;  3NXW A;  2C5C A;  1TWG H;  4WJ3 M;  2K03 A;  4V0B A;  1D5Z C;  2CQA A;  5HUR A;  1DON A;  3K6O A;  3HOX G;  1I6H H;  2KHS A;  1E7Z A;  1K3B C;  4A3J H;  3MVV A;  1KIX A;  4OEL B;  4NXM L;  4JI7 Q;  4F8M A;  3G7L A;  2EDG A;  1PFM A;  2CWP A;  3S14 B;  3PQI A;  5JJI A;  3HOW G;  4KHP Q;  1FR3 A;  3A55 A;  1XJV A;  5IOC A;  3CAM A;  1FD7 D;  1PVO A;  3OOC A;  1DGS A;  1TWG B;  4FXD A;  4DR7 L;  3KF8 A;  3I73 A;  2OCE A;  5C44 G;  1XNR L;  4F88 A;  2F0V A;  3U50 C;  5IP7 G;  3A5U A;  4L5Q A;  3AMU A;  3J81 E;  4G57 A;  5FLX c;  1I6H B;  2N3S A;  1QJO A;  4A3J B;  5ISR A;  4QF4 A;  2F0Q A;  3U4V A;  4X65 L;  4JI7 L;  2QEX A;  4JBW A;  1LLR D;  4AQY L;  4LF7 L;  1B4O A;  3M4Y A;  5FLX L;  1SFO B;  1AH9 A;  1VQA A;  4LK1 C;  3A7L A;  1MI2 A;  1EQR A;  3HS0 C;  1QG7 A;  3Q23 A;  5M3F H;  3EQL C;  2RKS A;  3J7Z C;  4ZRZ A;  2BDO A;  3D6W A;  2ZM6 Q;  2A1A A;  1D7Q A;  5C0X J;  5ELF A;  4H0L C;  3CU7 A;  5KYI A;  1Q46 A;  1CZG A;  1QOH A;  2WKC A;  4JI8 L;  2A68 D;  1KD1 C;  5CV8 A;  1HNX Q;  3J7A V;  3V96 A;  1EOV A;  3D4R A;  1TU2 B;  2KCN A;  2A6H D;  1X3P A;  3K80 C;  1ENC A;  3STB C;  1VQF A;  4P75 A;  1IYV A;  2L4N A;  2PQA A;  3M3Y H;  1JIC A;  1O7Y A;  3K0X A;  3KJP A;  4DXG A;  4P74 A;  1LTT D;  1II3 A;  1C8C A;  2AHO B;  2I07 B;  3NEL A;  4JI5 Q;  1EY5 A;  3BVZ A;  2ZM6 L;  1JE4 A;  1RD9 D;  1L0Y B;  3I2Z A;  2Q2I A;  3V05 A;  5D65 A;  5LMN L;  5EJW A;  4HCE A;  1IBM L;  4YCU A;  1R4P B;  4DV7 Q;  5JEA H;  4DR5 L;  5A2Q L;  5JPN C;  5IYB G;  2PMZ E;  3CCM A;  4JI4 Q;  1SYF A;  1PDQ A;  5IIF A;  4KN7 C;  3GTL B;  3VR6 A;  3W3A A;  2JP1 A;  2JA6 B;  3HOY B;  1G8Z D;  4PQX A;  4TSS A;  4C2M B;  1B9N A;  3PO3 H;  3TDQ A;  2E75 C;  3PO2 H;  4K0K L;  1H9S B;  1HCZ A;  3TP6 A;  2OXP A;  1WOC A;  4K5W A;  4QIW E;  3MXN B;  2ATW A;  2E2J B;  1LTG D;  2Y0S B;  4A3E H;  2D62 A;  4LWC A;  2ENB A;  3UE0 A;  2LSS A;  4DV0 Q;  1Q82 C;  2CCZ A;  1XNQ L;  2NVQ H;  4IOA A;  4LMQ D;  4DU9 A;  3MAQ A;  1WTX A;  4F7X A;  1A62 A;  1YIJ A;  1JB3 A;  5IYD G;  2E5L L;  1QZG A;  2TMP A;  3G71 A;  2ZXP A;  1RJT A;  3UDI A;  2ZT9 C;  1SNQ A;  3T4A C;  3TRZ A;  4HJ7 A;  4QJF A;  2Q2H A;  4EGV A;  1GUS A;  3HOY G;  5CBA E;  1U9R A;  5CC4 A;  1X3F A;  1YVC A;  1PZI D;  1LTB D;  1QIL A;  3C1E A;  2UUA Q;  3R93 A;  1PFS A;  2NVQ B;  3EA6 A;  1KLG D;  2L9H A;  1XMQ Q;  3RZO B;  4MNO A;  2HDM A;  3LX0 A;  1MIU A;  1VMC A;  2F0J A;  4HSP A;  4KTA A;  4DR3 L;  3TME A;  3HG9 A;  1SAP A;  2Y0S G;  2F3V A;  4B9X A;  2B29 A;  5BN4 A;  1UE5 A;  1X55 A;  3JC6 6;  4BS9 A;  2F0P A;  4CGY B;  3F8T A;  4YHH L;  2RDF A;  1YHQ A;  2F0L A;  1EQT A;  1PRT B;  1K8M A;  1VQH A;  4A3I B;  1JJC B;  2K4K A;  2KA7 A;  4R4I A;  1U4P A;  3CF5 A;  2B2Y A;  5ELO A;  1TWF H;  1D5M C;  4OL7 A;  1M4V A;  5LMN W;  2E2H H;  4N8X 1;  1VQ9 A;  1KL9 A;  1HUN A;  4BXX G;  4KHZ A;  3M4O B;  2XVS A;  3K5N A;  1XPR A;  1RL2 A;  2N55 A;  3IAY A;  4LFB Q;  1Z7T A;  3GQB A;  4DV4 Q;  2AWN A;  2FXQ A;  3I55 A;  5EQ0 A;  2WIN B;  4RKL A;  1N33 Q;  1BCP B;  2R92 B;  2FMM A;  4DR4 L;  4C56 C;  4C3I H;  1ZEQ X;  2L11 A;  2VNU D;  1NAP A;  1IYU A;  2B2U C;  2WB1 E;  4CKB A;  4DAP A;  2B63 H;  1F2M A;  2Z9H A;  1SYE A;  1A8V A;  2HDL A;  1SNC A;  5M3M G;  4KY6 A;  3A8K E;  1TWF B;  1UEA B;  1HTP A;  4L5S A;  3GO5 A;  3HOZ B;  2PO4 A;  1HZC A;  5IWA Q;  1BOS A;  3R2T A;  2F0O A;  3PUX A;  4A3I G;  2RHQ B;  1NY4 A;  5FKA C;  1SEB D;  2L1B A;  1PRT C;  1ML0 D;  4DAY A;  2VY3 A;  2Z4H A;  3WWV A;  4YY3 L;  1GHJ A;  1HNZ L;  3G4S A;  4LFA L;  1HA5 A;  2D0O A;  5KNB A;  4GKK L;  3CD6 A;  4C3J G;  1C7Y A;  3PIP A;  2F0T A;  4BY7 H;  3P1H A;  2B63 B;  1E2W A;  2JK8 A;  4OO1 H;  4ID6 A;  3BVG A;  4A3L H;  4GKJ Q;  1KAW A;  4A3M B;  4A3B G;  3CCR A;  1TII D;  2HQL A;  3ZYY X;  1HH2 P;  2R92 G;  2ZTD A;  3PMF A;  4RMF A;  1LM0 A;  3S2H H;  1BCP C;  1EZ8 A;  2HIV A;  3D0F A;  4IJH A;  1ZKO A;  3ER0 A;  1X3G A;  4J15 A;  3W5O A;  1PH5 A;  5IOD A;  4BY1 H;  3HOZ G;  5IGC A;  2PW5 A;  4ZK9 B;  3NUC A;  4A75 A;  1IKM A;  4JI0 Q;  3J7A F;  3GV3 A;  4K5V A;  3H94 A;  1WTW A;  2A6E D;  1TWA H;  3CW2 C;  1SSO A;  5K36 G;  2VUM H;  2K5V A;  2NB0 A;  1N34 Q;  2KEC A;  3HKS A;  1I4Q A;  4JG2 A;  2E74 C;  5EPL A;  1M1K C;  4X62 L;  1F2Z A;  5CV9 A;  2FHT A;  2O2L D;  4J6H A;  4FYD A;  4KMU C;  1FVI A;  4BY1 B;  5JPM C;  2JEA I;  3AU7 A;  3EN2 A;  4PMW A;  1I5F A;  1SE3 A;  3NTK A;  4JBM A;  2XTI A;  3TQY A;  1WTP A;  3P20 A;  1RTN A;  1X3E A;  1D1I A;  2RDH A;  4KY5 A;  3AEV A;  1F9R A;  1VQJ A;  2IX0 A;  3SK6 A;  4O1N A;  4RFB A;  2Z6K C;  1KNA A;  1ASY A;  2XRQ D;  2A5H A;  4J1M A;  2AWO A;  2PMZ B;  5ELB A;  5C3X A;  5EBC A;  4ABN A;  3NE5 B;  1A6X A;  1U5K A;  5CV4 A;  2NTT A;  4IFD J;  1EY4 A;  3E0E A;  1OXU A;  1N32 L;  3VA5 A;  1WCM B;  1C4Q A;  1CM9 A;  2LS0 1;  4MIU A;  5KYL A;  4Q0F A;  1EYG A;  5C0X G;  4K6L A;  4JI3 Q;  3U9S A;  3Q24 A;  2UUB L;  3GTJ B;  1F2L A;  3D4D A;  2OF1 A;  3P75 A;  2PW7 A;  4DF7 A;  1ILP A;  3VYU A;  1PHJ A;  1ZYR C;  3VR5 A;  1HA6 A;  4ZKB B;  4DV3 L;  5I2X A;  4LFC L;  5C3E G;  1K8O A;  1RHP A;  1SBB B;  3FRP B;  3GTP B;  2F0S A;  3JAM i;  1Y1W H;  1EL0 A;  4R9W A;  3K7U C;  1GM5 A;  3PF4 A;  1I3Q B;  1SYC A;  1K9M C;  4U67 3;  1CQV A;  3LWU A;  5IT9 E;  1BDO A;  3K8A A;  1VQL A;  3S1R H;  3K81 C;  1E3P A;  2TSS A;  5C6A A;  4DNR B;  3HOU H;  1O78 A;  2JSO A;  1LTL A;  4H02 A;  2A19 A;  1GD7 A;  2JA7 H;  3QJY A;  1TS5 A;  4U68 A;  3J81 j;  1GHK A;  5CYU A;  3RLF A;  2F0K A;  1TKW B;  1WCM G;  1FNU A;  1H9S A;  4LUZ A;  2OTL A;  3HP3 A;  2Z4I A;  3SHL A;  3PGZ A;  2IJ0 A;  4PZ8 A;  1OXS C;  1SNO A;  3BYT B;  3KDF B;  1G51 A;  2EE1 A;  2EY5 A;  4CJ1 B;  3FP9 A;  4CDE C;  3D31 A;  1S40 A;  1CSP A;  3T1H L;  1HZA A;  2BH2 A;  3DWP A;  3QR8 A;  4LF9 Q;  3MXU A;  3HOU B;  4C1N I;  4KV6 A;  2WAQ B;  5IY0 A;  2A8V A;  1XPO A;  4CDF C;  4DNT B;  2JA7 B;  1TS4 A;  2WV6 D;  2F0E A;  1X32 A;  5AJ3 Q;  5J3B A;  1J9O A;  4PZ7 A;  1E24 A;  2PCF B;  1PH8 A;  3PCO B;  4BA1 I;  3L9A X;  1D2B A;  5J1Z A;  4X64 L;  5C4X H;  3NHH A;  2F0N A;  5LMU Q;  1B50 A;  4JYA Q;  2EYO A;  3K7A B;  4P71 A;  4N9T A;  3I4M H;  2B2U A;  1EY7 A;  4JI6 Q;  4LF5 Q;  1TS2 A;  1K8G A;  4LF9 L;  4AH6 A;  2WB1 B;  1IXR A;  1EUJ A;  5C4Z A;  1R9T H;  2LY7 A;  3CCV A;  4N8F A;  3J7A 5;  3H15 A;  1LT4 D;  1CA6 A;  2MP1 A;  1K0S A;  2EXD A;  2MUY A;  2UXD Q;  3JAM E;  1LT5 D;  4QCL A;  1R4Q B;  2BOS A;  2WAQ G;  1GUN A;  1SR3 A;  1G6P A;  1F77 A;  1VQ4 A;  4DV2 L;  4TKO B;  1IKL A;  2PZU A;  3QG1 A;  2K5N A;  2A69 D;  1PFN A;  1AE2 A;  2QW7 A;  2K14 A;  1Q3L A;  3ERS X;  1EY6 A;  1BNZ A;  4IUT A;  5GAH C;  1PH1 A;  5FJ8 H;  1HNW L;  2A68 C;  1R9T B;  5JJL A;  4IPH A;  2Y0S E;  1DOM A;  1NTG A;  3HOV B;  1V1Q A;  3CC2 A;  2A6H C;  3S16 H;  1YIT A;  3S2D H;  2PYK A;  1J8I A;  3K58 A;  4RCO A;  1NCV A;  2UXD L;  2L55 A;  1E22 A;  4JI1 L;  1KAA A;  1G91 A;  4XYO A;  1KDC A;  2K28 A;  3HGB A;  2CHB D;  3HOX H;  4A3F G;  2ICI A;  4IFD I;  4JI2 Q;  5JVG 3;  3M7N A;  3PIO A;  4QGU A;  1TWH B;  1OXX K;  1EY9 A;  2XIW A;  1IZ6 A;  3ULP A;  1WD1 A;  1ASZ A;  3HOW H;  1H9J A;  2QKI C;  1N36 L;  2VQE L;  3HZX A;  1WTO A;  1W6J A;  3J80 c;  4Y7N B;  3GTM H;  3BVM A;  2AUK A;  2MGS A;  5FLX E;  3HKZ G;  5C44 H;  1STB A;  2VQF L;  4B3R Q;  1DXM A;  4GNX B;  4RH6 A;  1AZP A;  4FF4 A;  3I8Z A;  5IGF A;  1RCV D;  5IP7 H;  2UU9 L;  1NBW A;  3HOX B;  4X6A H;  1JWS D;  2E2I B;  1ET9 A;  4A3D G;  3J80 L;  2EY6 A;  2IY5 B;  3QOL A;  4R4T A;  1DZ1 A;  2LKV A;  1MJE A;  3HOW B;  1HZ9 A;  2P5Z X;  2HCC A;  3L7Z C;  2Z6K A;  1XX8 A;  3K59 A;  4CJ0 B;  1G6Z A;  1O7I A;  3ERO A;  5C44 B;  2KCM A;  4G7H C;  4HCS A;  3S14 H;  2H4O A;  1B2T A;  3MWY W;  3OTO L;  1SE2 A;  2EYL A;  1ICF B;  1JCK B;  1SDF A;  1K8A C;  1ET6 A;  2ZJQ A;  1HRJ A;  1AE3 A;  2C35 B;  4KJN A;  3CHB D;  1PH9 A;  2HIX A;  3SEB A;  4DV5 Q;  1TY0 A;  4WJW A;  4GNX C;  1FYC A;  1BQQ T;  2KBN A;  3PUZ A;  4LF4 Q;  5A2Q E;  3FVQ A;  4MZ9 A;  3H3V I;  5JVH 3;  5J22 A;  2F0U A;  3VYR A;  1S5B D;  4YCW A;  2EPB A;  5EKI A;  1I4R A;  4DUY Q;  1SFO H;  3A7A B;  2MFI A;  2R6G A;  3GP7 A;  4IQZ A;  1SYD A;  3R8B A;  2VW9 A;  4KKU A;  4ZYS A;  3KBG A;  1PH7 A;  4GS3 A;  4XYQ A;  5M5W H;  2JYO A;  5IYB H;  1VQM A;  4CHT B;  1GXD C;  4A3G G;  3AYH B;  4DAM A;  4YCV A;  3DM1 A;  1TY2 A;  4IUU A;  4EQN A;  5FK9 C;  4FNF A;  3H0G G;  2IX3 A;  4K6D A;  3I4N B;  4FP5 D;  3I70 A;  4K14 A;  2NVY H;  4LF4 L;  4H13 C;  4FO2 A;  3T56 B;  3PIP 3;  3G6E A;  3ITP A;  1B3Q A;  2ZJR A;  1NJI C;  3GTO B;  4P73 A;  3OW7 A;  2FMC A;  4WJ4 A;  2K5W A;  4BBR B;  4KHP L;  5KRU A;  4IFD G;  2XWJ B;  2R7D A;  2WII B;  1W2B A;  2I5H A;  4O42 A;  5IGB A;  2YTX A;  2Z8L A;  5M5W B;  1BR9 A;  1B9M A;  3ND8 A;  2B39 A;  3EBE A;  4M8A A;  1K83 B;  1YZ6 A;  3PV0 A;  4TVA B;  1PTO H;  1Q1E A;  1CFM A;  4EQO A;  1WTQ A;  1Z6H A;  5EPK A;  5C5L A;  2NVY B;  3OMG A;  1GUG A;  1JOQ A;  2SEB D;  5BR8 Q;  5EBD A;  1I4X A;  1YNJ D;  5C4J B;  3GTL H;  1Q7Y C;  3BZK A;  3HOY H;  2JA6 H;  2KED A;  3I4N G;  1V8Q A;  3UDX A;  4WOR A;  4DK3 C;  1YJW A;  4C2M H;  4JCV E;  4ZCK A;  1CTM A;  1U0L A;  1VQN A;  2PI2 A;  1YHB A;  2KOL A;  3GTG B;  4BBR G;  2NVT B;  3T1Y Q;  4IUQ A;  1PTO B;  1F2Y A;  1BBW A;  3KDF A;  3OSO A;  2KEE A;  5CV6 A;  2E2D C;  2E2J H;  3BU2 A;  1CUK A;  3NWS A;  1IBK Q;  1K28 A;  4R4O A;  1U4L A;  4L8J A;  5HGT A;  3NQI A;  1HNX L;  4G7Z C;  1FL0 A;  2XNA C;  5EPJ A;  1EIY B;  1I4G A;  2R7Z B;  1LYL A;  3TZD A;  2K50 A;  2A6E C;  1IHZ A;  2NBF A;  1BF4 A;  4P72 A;  4IN3 A;  1SYB A;  1PLF A;  4BXX H;  4JI5 L;  4DNI A;  1X9N A;  1Q81 C;  5L37 A;  2F0G A;  2Z0S A;  4GN5 A;  3MFG A;  1JE5 A;  1A2U A;  5E7N A;  3J7Y W;  2R7F A;  3MZ5 A;  4DV7 L;  3RZO H;  5LHY 1;  4OIJ A;  4JI4 L;  4DV6 Q;  1AFP A;  1STY A;  1XMO Q;  3MTS A;  4A3K G;  1PTO C;  3GD7 A;  1I50 B;  2JA8 G;  1HTL D;  1Y1V G;  4IAL A;  3ONA B;  1IYJ B;  3FKI G;  3E6Z X;  4A3I H;  5H1S E;  4M1U B;  5CGK A;  5DEH A;  5C3W A;  2R7Z G;  1TXY A;  4XQQ A;  2PI2 E;  1WTV A;  3E3X A;  4DV0 L;  3TRE A;  4C3J H;  3MFY A;  1CSQ A;  2RDG A;  3BYY B;  3M4O H;  4DV6 L;  1F9P A;  3CPW A;  3FMC A;  5M3M B;  1CHP D;  4A3B H;  4Q5V A;  1A0I A;  1CI3 M;  2CW0 D;  2R92 H;  2JA5 B;  1P8L A;  2WAQ E;  3EJI A;  2X6L A;  1SMY D;  3MXG A;  2BH8 A;  1E2Z A;  4KKT A;  2WFW A;  1YJ9 A;  2G9D A;  2LXK A;  1HR0 Q;  2UUA L;  4KI0 A;  1Y8O B;  1GKH A;  3HOZ H;  4C3J B;  1XMQ L;  5F2D A;  2IHF A;  3Q6S A;  4XDX A;  2B2V C;  3K5O A;  1PMR A;  3SK4 A;  1X65 A;  1EQQ A;  4JV5 Q;  4GLA C;  4FF1 A;  4A3B B;  4IUV A;  2JA9 A;  3RLO A;  3CCJ A;  2WKD A;  3TEH B;  2ID0 A;  5K36 H;  5FO8 B;  4GNX A;  1E1O A;  1C0A A;  5C0X I;  1VQB A;  4FXK C;  3TP5 A;  2F3W A;  3E9I A;  4APV A;  2HHH Q;  3BDO A;  4V19 0;  4A3M H;  3KYH C;  1BUV T;  2EY1 A;  1VF5 C;  4OXP A;  4A3E G;  4C3H G;  2JA5 G;  1EYD A;  3CCU A;  4NXN Q;  2B8G A;  4UPA A;  3KLS A;  1LT3 D;  4RCN A;  5T1G A;  2CH4 A;  2RCF A;  4LFB L;  4DV4 L;  1HXY D;  3CCE A;  1Q90 A;  3S15 B;  3SK5 A;  3HKZ E;  4ILW A;  4TRD A;  4DAV A;  2K1B A;  1SNM A;  1ONL A;  1N33 L;  2M9V A;  4DUZ Q;  2K32 A;  5LL6 X;  1SJE D;  1B3A A;  2R3Z A;  3E0J A;  4JVZ A;  1I4P A;  4HIK A;  5ELE A;  2Q8R E;  3X3N A;  5IGD A;  3UE1 A;  1KRS A;  2EZV A;  3CCL A;  5IWA L;  2PZW A;  2H5X A;  3N52 A;  5A35 A;  1QVF A;  2GN5 A;  2JEB I;  3STB D;  3C1F A;  4XXE A;  4CKC A;  1O7L A;  4OX9 Q;  5C3E H;  5EGT A;  5IGG A;  3K57 A;  2UXC Q;  4RGM A;  1X3Q A;  4QY7 A;  4XQJ A;  1F9S A;  4BBS B;  4B3T Q;  5FO7 B;  3PIO 3;  4GKJ L;  4GLV B;  4NPS A;  3HRZ C;  2N78 A;  4UAI A;  5JAV A;  1G2T A;  2A69 C;  4B3S Q;  1SJH D;  1PZK D;  2O4X A;  3BDL A;  1KNE A;  1YBY A;  5I9P A;  4HTH A;  1L2F A;  3BZD B;  2UXB Q;  4DK1 A;  1T9H A;  1EEF D;  2EIF A;  2R93 B;  4JW0 A;  1VS0 A;  1YNN D;  1H9R A;  2YU9 B;  5C5M A;  1WCM H;  1WD0 A;  2CWA A;  5C3E B;  5BN3 A;  4RG1 A;  3KK7 A;  1J5E Q;  4JI0 L;  4EQ5 A;  3GTJ H;  4R8N A;  5DM7 3;  2VL6 A;  1QB5 D;  1AEX A;  1X6O A;  1S5E D;  3CMA A;  1GJX A;  2K04 A;  3PUV A;  1N34 L;  4HR7 B;  2CQO A;  3GTP H;  1ROD A;  5K5P A;  4BBS G; 
#chains in the Genus database with same CATH homology
 4X65 L;  3ERS X;  1Z9F A;  1YHA A;  5ELN A;  4JI7 L;  5GAH C;  1PH1 A;  5FJ8 H;  4PZ6 A;  2QEX A;  4JBW A;  3F2D A;  1HNW L;  2UUC Q;  1I3Q H;  2IHE A;  4FDB A;  4AQY L;  4LF7 L;  5JJL A;  4IPH A;  2Y0S E;  3J80 i;  5JEA G;  1K73 C;  1NTG A;  4DR4 Q;  2PNH A;  1AH9 A;  1VQO A;  1V1Q A;  1VQA A;  3CC2 A;  1EQR A;  5GQO A;  5M5X H;  1VQ5 A;  1YIT A;  2V1C C;  4IPC A;  3S16 H;  3S2D H;  1K0R A;  5M3F H;  4XTC S;  2UXD L;  1E22 A;  4JI1 L;  3S15 H;  4DV1 Q;  1QUQ B;  3DM3 A;  3J7Z C;  2R93 G;  2ZJP A;  3PO3 G;  3HOX H;  3FHW A;  4IFD I;  4A3F G;  3PO2 G;  3MEF A;  4JI2 Q;  3M7N A;  2ZM6 Q;  1WYD A;  2A1A A;  1D7Q A;  5C0X J;  3PIO A;  4QGU A;  4OO1 I;  1MKH A;  1MJC A;  1X56 A;  1OXX K;  1HZB A;  1IZ6 A;  3ULP A;  1Q46 A;  4YY3 Q;  4OWT B;  4POF A;  5FLM G;  4LFA Q;  1HNZ Q;  1HR0 L;  1ASZ A;  4JI8 L;  4GKK Q;  1PYB A;  3HOW H;  4HIO A;  1KD1 C;  2NZO A;  1HNX Q;  2MO0 A;  1N36 L;  2VQE L;  1EOV A;  1OXT A;  3S24 A;  1YEZ A;  3J80 c;  1Z47 A;  4LW1 A;  3GTM H;  3HKZ G;  5C44 H;  2VQF L;  4IPG A;  3K80 C;  3STB C;  4B3R Q;  1VQF A;  4P75 A;  4JI3 L;  2ZTC A;  3Q8D A;  4GNX B;  4JV5 L;  2PQA A;  2YTY A;  5IP7 H;  3M3Y H;  3KJP A;  3K0X A;  1KRT A;  2UU9 L;  1NBW A;  4X6A H;  4P74 A;  3OW2 A;  2AHO B;  3HFZ B;  3NEL A;  4AIM A;  1UE1 A;  4LNQ A;  4JI5 Q;  1PH6 A;  4A3D G;  2ZM6 L;  4ALP A;  2IY5 B;  2QA4 A;  3I2Z A;  2HHH L;  4R4T A;  4BBS H;  2Q2I A;  4JOI C;  4DR6 Q;  5LMN L;  2I5L X;  3NBH B;  4DK6 C;  1IBM L;  4YCU A;  4B3M Q;  2OQK A;  4DV7 Q;  1N9W A;  1VCI A;  1XTD A;  4DR5 L;  1MJE A;  3K7A H;  1HZ9 A;  4OWW B;  1OXV A;  1Q8K A;  5IYB G;  3S1M H;  1EIF A;  2PMZ E;  3CCM A;  4JI4 Q;  3M4Q A;  3U4Z A;  2KEN A;  1YI2 A;  3L7Z C;  4MTN A;  4NXN L;  2JQO A;  4YWM A;  2Z6K A;  3S1Q H;  3SGI A;  1BVS A;  1O7I A;  2K52 A;  4L5T A;  2KCM A;  3NEM A;  3A74 A;  3S14 H;  4A3C G;  2R93 H;  1EWI A;  3PO3 H;  3PO2 H;  3OTO L;  2YU9 H;  1NE3 A;  4K0K L;  3RLN A;  1K8A C;  1Q86 C;  1VQI A;  3M4P A;  4UP7 A;  4DUZ L;  2ZJQ A;  1WOC A;  3TS2 A;  1JT8 A;  4QIW E;  3MXN B;  3RR5 A;  2ATW A;  1HJP A;  4X62 Q;  2B3G A;  5FLM H;  4A3E H;  1AE3 A;  2D62 A;  1J6Q A;  2C35 B;  4LWC A;  3UE0 A;  1JB7 A;  2LSS A;  4DV0 Q;  1VQE A;  1Q82 C;  2CCZ A;  1XNQ L;  2NVQ H;  1PH9 A;  2HIX A;  4IOA A;  2MO1 A;  4DV5 Q;  5IE8 A;  3CC7 A;  4GNX C;  1FGU A;  1I94 Q;  1EFW A;  1A62 A;  2BA1 A;  1YIJ A;  5IYD G;  3UDG A;  2E5L L;  2KBN A;  3PUZ A;  4LF4 Q;  1QZG A;  4MZ9 A;  3H3V I;  2CFM A;  1SLJ A;  1SRO A;  1JJG A;  1P16 A;  3G71 A;  1OTC A;  2NN6 I;  4JBK A;  4YCW A;  3UDI A;  5JJK A;  4DUY Q;  1SFO H;  4LF8 Q;  3HOV H;  2MFI A;  4NB3 A;  2R6G A;  3B6Y A;  1VQD A;  1SN8 A;  5AJ3 L;  3TRZ A;  4OX9 L;  2VW9 A;  4HJ7 A;  4QJF A;  2Q2H A;  2UXC L;  3HOY G;  1PH7 A;  2B63 G;  1S3O A;  3E9H A;  4X66 Q;  1X3F A;  1YVC A;  4GS3 A;  5M5W H;  2UUA Q;  4B3T L;  4L5R C;  3ZJY C;  5IYB H;  1PFS A;  1VQM A;  5LMU L;  4A3M G;  4A3G G;  3AYH B;  3PSI A;  4YCV A;  4DAM A;  1Y1W G;  1XMQ Q;  4MNO A;  4JYA L;  1N32 Q;  1H95 A;  1LUZ A;  1TWH H;  3H0G G;  1HR0 W;  1MIU A;  4B3S L;  4DR3 L;  1RIP A;  4JI6 L;  4LF5 L;  2NVY H;  4LF4 L;  4A3C H;  1C9O A;  2Y0S G;  5GAD C;  2B29 A;  2UXB L;  1UE5 A;  3G6E A;  2ZJR A;  4HID A;  1NJI C;  1X55 A;  2UUB Q;  3JC6 6;  3F8T A;  4P73 A;  4YHH L;  2K75 A;  4WJ4 A;  4DR1 Q;  1G29 1;  4KHP L;  1YHQ A;  5HGQ A;  3L0O A;  4GOP A;  4IFD G;  3KF8 B;  4Y7N H;  1WJJ A;  2ASB A;  2R7D A;  1CKN A;  1W2B A;  1VQH A;  4DV3 Q;  1JJC B;  2K4K A;  1J5E L;  4R4I A;  2I5H A;  4LFC Q;  4BY7 G;  4GN4 B;  2YTX A;  4OO1 G;  4ME3 A;  3A0J A;  3VDY A;  3CF5 A;  5JEA J;  1WI5 A;  3KF6 B;  4X66 L;  4A3L G;  3EBE A;  5ELO A;  2E2I H;  2NVX H;  2K5H A;  1TWF H;  4EX5 A;  1YZ6 A;  2ALY B;  2NZH A;  3PV0 A;  4JBJ A;  4TVA B;  5LMN W;  1PH4 A;  1Q1E A;  2E2H H;  2F4V Q;  1VQ9 A;  1KL9 A;  4BXX G;  4KHZ A;  2ZTE A;  4QL5 A;  2I5M X;  4A4I A;  1N8R C;  4JC0 A;  1XPR A;  1RL2 A;  4LFB Q;  4DV4 Q;  5BR8 Q;  2AWN A;  2RCN A;  2FXQ A;  3I55 A;  3KLW A;  2UUC L;  2IT1 A;  4R1J A;  4UY8 C;  1N33 Q;  2RF4 A;  1VQC A;  1V43 A;  1VQ7 A;  4DR4 L;  3GTL H;  4C3I H;  2VNU D;  2N49 A;  3BZK A;  2WB1 E;  1Q7Y C;  4BY1 G;  4A93 G;  3HOY H;  2JA6 H;  3I4N G;  2B63 H;  1L1O A;  3RZD H;  3UDX A;  4DK3 C;  1YJW A;  4C2M H;  4JCV E;  2F3I A;  1U0L A;  1A8V A;  4DPG A;  1SE8 A;  1VQN A;  5M3M G;  2PI2 A;  2JJQ A;  5GRO A;  4DV1 L;  1YHB A;  4OON A;  2BA0 A;  5C4X G;  4L5S A;  4BBR G;  3T1Y Q;  1B8A A;  3H0G H;  3GO5 A;  3T1H Q;  1QZH A;  3A5Z B;  4JI2 L;  1IL2 A;  1BBW A;  1HZC A;  3KDF A;  2VUM G;  5IWA Q;  3PUX A;  4A3I G;  2E2J H;  2RHQ B;  3BU2 A;  1NY4 A;  1CUK A;  1IBK Q;  4R4O A;  1FJG Q;  2EQS A;  2VY3 A;  3WWV A;  1CKM A;  4YY3 L;  4TQU S;  1HNZ L;  3G4S A;  4LFA L;  3RN2 A;  4BA2 I;  3M9B A;  2D0O A;  4GKK L;  1WFQ A;  1GO3 E;  1HNX L;  4HJA A;  4HIM A;  3CD6 A;  1FL0 A;  1C7Y A;  1JMC A;  3PIP A;  4BY7 H;  4LF6 Q;  1UE6 A;  1EIY B;  2PQA B;  1IBL Q;  2JK8 A;  2JE6 I;  1PYS B;  1LYL A;  1QVG A;  2K50 A;  4B3R L;  4X64 Q;  2I0Q A;  4A3F H;  4A3L H;  4GKJ Q;  1KAW A;  4A3B G;  4P72 A;  3CCR A;  3L2P A;  2HQL A;  2R92 G;  1HH2 P;  5M5Y H;  4HJ9 A;  3UDF A;  2ZTD A;  4RMF A;  4BXX H;  1LM0 A;  3NEN A;  4JI5 L;  4DNI A;  1X9N A;  3TS0 A;  1PH2 A;  1Q81 C;  2KCT A;  4NXM Q;  4IJL A;  4PG3 A;  3S2H H;  2YYZ A;  3KOJ A;  2RHS B;  2XGT A;  2HIV A;  2Z0S A;  3D0F A;  2OQ0 A;  2E8G A;  4GN5 A;  4IJH A;  3ER0 A;  4DR2 Q;  1VQP A;  1JE5 A;  1X3G A;  3CP0 A;  4GN3 B;  5GAG C;  5E7N A;  5IYC G;  2R7F A;  4DV7 L;  4B3M L;  4J15 A;  3RZO H;  4YWL A;  3W5O A;  3AQQ A;  2NN6 G;  2Q2U A;  4JI4 L;  1PH5 A;  4A93 H;  2VS1 A;  4BY1 H;  4HJ5 A;  4DV6 Q;  3HOZ G;  3I4N H;  1XMO Q;  3I4O A;  1UE7 A;  4A75 A;  3GDE A;  4A3K G;  1PA6 A;  4JI0 Q;  1K3R A;  3GD7 A;  3CQZ H;  1B7Y B;  2JA8 G;  4AYB E;  1XNR Q;  4O0A A;  3F2C A;  2QGQ A;  3GTO H;  3KJO A;  1Y1V G;  3W1G A;  1TWA H;  1TWC H;  4BBR H;  4DV2 Q;  3CW2 C;  4A3D H;  1UEB A;  1VQK A;  2OTJ A;  5K36 G;  2VUM H;  1IYJ B;  2K5V A;  3FKI G;  4A3I H;  1N34 Q;  5H1S E;  2AKW B;  3HKS A;  2KHI A;  4JG2 A;  1M1K C;  3S1N H;  3AFQ A;  2R7Z G;  4DR6 L;  4X62 L;  3IRB A;  5EAY A;  4X65 Q;  4XIG S;  1TXY A;  2PI2 E;  2GVB A;  4DV0 L;  4QQB X;  1HNW Q;  1K83 H;  4Y52 H;  4DR2 L;  4AQY Q;  4LF7 Q;  3TRE A;  5IP9 G;  1FVI A;  4C3J H;  4DV5 L;  1CSQ A;  2JEA I;  1I94 L;  3EN2 A;  4PMW A;  3M4O H;  1CKO A;  1I5F A;  1VQG A;  4DV6 L;  3W1B A;  3CPW A;  3F2B A;  1PV4 A;  4JOI A;  4JBM A;  1GVP A;  2XTI A;  4JI1 Q;  3TQY A;  3HOU G;  4A3B H;  1A0I A;  1Q12 A;  3I56 A;  1X3E A;  5IT9 c;  1M90 C;  3AEV A;  2WP8 J;  3ULL A;  2R92 H;  1P8L A;  1VQJ A;  2WAQ E;  5C4J H;  2Q2T A;  4DUY L;  4LF8 L;  2IX0 A;  3G48 A;  1QUQ A;  3CC4 A;  2JA7 G;  1V9P A;  2BH8 A;  1B70 B;  2YV5 A;  2Z6K C;  1UWV A;  3I7F A;  1ASY A;  4LUO A;  1A63 A;  4OWX B;  2WFW A;  1YJ9 A;  4LUV A;  2AWO A;  3H3V H;  3BZC A;  1YJN A;  5IYC H;  2LXK A;  3BJU A;  1HR0 Q;  1U5K A;  3U58 A;  2UUA L;  4JI8 Q;  4KI0 A;  4KLK A;  3GTG H;  4IFD J;  2NVT H;  1KXL A;  1GKH A;  5IYD H;  3HOZ H;  3E0E A;  1N36 Q;  1OXU A;  2VQE Q;  1XMQ L;  2IHF A;  1N32 L;  2DGY A;  4IOC A;  1X65 A;  4A3K H;  2JA8 H;  2VQF Q;  1EYG A;  5C0X G;  2MNA A;  3RN5 A;  1EQQ A;  4JI3 Q;  4JV5 Q;  4GLA C;  1Y1V H;  3PF5 A;  2UUB L;  2JA9 A;  3RLO A;  4GOP B;  3CCJ A;  4IPD A;  3TEH B;  2WB1 G;  2ID0 A;  1CKN B;  3LGJ A;  4IO9 A;  2UU9 Q;  1NMG A;  3FKI H;  4DR1 L;  4O2D A;  4GNX A;  1E1O A;  2OWO A;  1C0A A;  5C0X I;  1PHJ A;  1VQB A;  2CKZ B;  2VZA A;  1NMF A;  5HY6 A;  3E9I A;  4APV A;  5DLQ E;  2R7Z H;  3ICE A;  2HHH Q;  4DV3 L;  1XPU A;  4LFC L;  5C3E G;  2HT1 A;  5LMN Q;  2D0P A;  4A3M H;  4A3G H;  1BBU A;  1L0W A;  3JAM i;  1Y1W H;  3KYH C;  5IP9 H;  1IBM Q;  4POG A;  4DR5 Q;  3K7U C;  1GM5 A;  4OXP A;  4A3E G;  4GLX A;  2JA5 G;  3PF4 A;  3CCU A;  1K9M C;  2LXJ A;  4NXN Q;  1VQL A;  3K8A A;  3J81 i;  2F4V L;  3S1R H;  4UPA A;  3AFP A;  3K81 C;  3I4M G;  1E3P A;  1Q1B A;  4A3J G;  3HOU H;  1LTL A;  4UP9 A;  4H02 A;  4LFB L;  4DV4 L;  1Y14 B;  2YTV A;  2F52 A;  5BR8 L;  3CCE A;  1X54 A;  2A19 A;  3HKZ E;  3OTO Q;  1GD7 A;  1VQ8 A;  4K0K Q;  2ES2 A;  1L1O B;  2JA7 H;  1N33 L;  3J81 j;  4R4Q A;  4UP8 A;  3RLF A;  4DUZ Q;  3S17 H;  3HOV G;  1WCM G;  4LUZ A;  1I50 H;  2OTL A;  3DLL A;  4DKA C;  1W3S A;  3PGZ A;  4HIK A;  4PZ8 A;  1XNQ Q;  1OXS C;  3KDF B;  1G51 A;  3UE1 A;  3FP9 A;  1KRS A;  3JAM c;  3D31 A;  3CCS A;  2DUD A;  3M85 A;  4HJ8 A;  3T1Y L;  1CSP A;  4GOP C;  1HZA A;  3T1H L;  1S40 A;  4DAY B;  2E5L Q;  3CCL A;  2BH2 A;  3F1Z A;  5IWA L;  1VQ6 A;  2H5X A;  2L15 A;  1S72 A;  4LF9 Q;  1QVF A;  1IBK L;  2GN5 A;  5IY0 A;  3J81 c;  2JEB I;  1YNX A;  2AMC B;  1FJG L;  3CCQ A;  3STB D;  3OYY A;  1XPO A;  2A8V A;  5FJ8 G;  3CXC A;  1SMX A;  1KC8 C;  5AJ3 Q;  1JJ2 A;  3PUW A;  4OX9 Q;  5J3B A;  4AYB G;  2IX1 A;  5C3E H;  4PZ7 A;  1E24 A;  3CME A;  1PH8 A;  1IBL L;  4LF6 L;  4DR7 Q;  5M3M H;  2UXC Q;  3PCO B;  4BA1 I;  4QY7 A;  1TWG H;  4B3T Q;  1QVC A;  4X64 L;  5C4X H;  5M3F G;  4WJ3 M;  3GTQ H;  2JA5 H;  3CPF A;  2N8N A;  4GLV B;  4NPS A;  4C3H H;  5LMU Q;  3PUY A;  4GKJ L;  4JYA Q;  2N78 A;  4A76 A;  4P71 A;  2GVA A;  3HOX G;  1I6H H;  3I4M H;  1E7Z A;  4A3J H;  1KIX A;  4B3S Q;  1SRU A;  1L1O C;  4DR3 Q;  4JI6 Q;  4LF5 Q;  1YBY A;  4NXM L;  4JI7 Q;  1L2F A;  1PH3 A;  2KHJ A;  1K8G A;  4LF9 L;  2UXB Q;  4AH6 A;  1T9H A;  2CWP A;  1IXR A;  1KQS A;  2EIF A;  2MQH A;  4YHH Q;  5JJI A;  3RNU A;  1EUJ A;  1VS0 A;  5GAE C;  1R9T H;  3CCV A;  3HOW G;  3EIV A;  4KHP Q;  1BKB A;  3J7A 5;  1WCM H;  3H15 A;  1XJV A;  1XMO L;  2CWA A;  3ULJ A;  3CAM A;  2EXD A;  4RG1 A;  1J5E Q;  1D8L A;  1PVO A;  2UXD Q;  4JI0 L;  1DGS A;  4DR7 L;  2WAQ G;  4EQ5 A;  1SR3 A;  4YWK A;  3GTJ H;  2OCE A;  5C44 G;  1XNR L;  2JA6 G;  3KFU A;  1G6P A;  2VL6 A;  1VQ4 A;  4R4C A;  3U50 C;  5IP7 G;  1X6O A;  1E1T A;  4L5Q A;  3A5U A;  3CMA A;  4DV2 L;  3GTK H;  5FLX c;  3KF6 A;  2N3S A;  3PUV A;  2K5N A;  1N34 L;  2CQO A;  1KHI A;  1AE2 A;  2K14 A;  3GTP H;  4BBS G;  3U4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...