2ZM6L

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 10
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2zm6L00
3OTOL 1N36L 3KFUA 1N32Q 2VW9A 2N78A 1X6OA 1UE7A 2ID0A 1A63A 1XPOA 1A0IA 1TWFH 3F2CA 4HJ7A 3NELA 1K83H 1CKNA 3A5UA 2R7DA 1C0AA 1K8AC 2UU9Q 5IWAL 3M9BA 2LXJA 1JJCB 3MXNB 1DGSA 2LXKA 3I4MH 1QUQA 1T9HA 1Y1WG 2F4VL 3K81C 1HNXL 4WJ3M 1V9PA 1N33L 2MO1A 2WAQG 3S2HH 2AKWB 5IP9G 2QEXA 2ASBA 4GS3A 4A3DG 1UWVA 1VQBA 4LFAQ 5M5WH 4AQYQ 3CMEA 1AH9A 4DV0Q 1PV4A 4H02A 4DR7L 4P71A 4YWLA 2IX0A 4A75A 3I4OA 3GD7A 4DR4L 1E3PA 3ULLA 3PSIA 3U4VA 3BZKA 4A3IG 4A3JG 4LF7Q 2JQOA 2VY3A 3CCJA 1FJGL 2MO0A 3M4QA 1IBKL 3U50C 4DAYB 2V1CC 1Y14B 2ZTEA 4DV5Q 3PO3G 1YNXA 3J81c 1S40A 2E5LL 3CCEA 4R4QA 4UY8C 5FJ8H 4UPAA 1MJEA 2K14A 4A76A 1Q1EA 2QA4A 4KLKA 1HNWL 4JI4Q 1OXTA 2UUAL 4UP9A 3TQYA 4DV3Q 4BXXH 4QY7A 3KF6B 4GNXB 2Q2UA 2MNAA 2VQFQ 4X62L 2Q2TA 2HIXA 1CKNB 3HOUH 3PIOA 2NVTH 4OX9L 1Y1VG 3RLFA 1E24A 4YY3Q 3S2DH 3GTKH 1JT8A 2F3IA 3BU2A 2ZTDA 5IYBH 5LMUQ 4DR1Q 4JYAQ 4JI1Q 1QVCA 2ATWA 1BKBA 4A3BH 1SE8A 1XMQL 3KF6A 4EX5A 1I5FA 2VL6A 2XGTA 3FKIG 5IE8A 2JA6H 1VCIA 1PYBA 4DR2L 2JE6I 1JJ2A 2NZOA 3JAMi 3W1GA 3CCRA 4HIOA 1RIPA 3PF5A 1PH8A 4DPGA 2IX1A 3CCQA 1XNRQ 1Q1BA 3FHWA 4LFBQ 2N3SA 1VQCA 1PH2A 4GNXA 3PO2H 3S14H 3UE1A 4R4CA 4A3CH 4DNIA 3RLNA 2WP8J 4DR5Q 1IBLQ 4NXMQ 4LWCA 2UXDL 3GTJH 2QGQA 2OQ0A 4GLXA 2B63H 2R7ZH 4IFDI 2I5MX 5HGQA 1KL9A 2RF4A 3H0GG 1QZGA 1IZ6A 1IBKQ 1HNZL 1VQ7A 5IP7H 3OYYA 4JI2Q 2Z6KA 1N36Q 4BY7G 2E8GA 1I50H 5M3FG 1EQRA 4XIGS 3CCUA 2B29A 4JOIA 5E7NA 1YEZA 3UDIA 4OXPA 1YJWA 2Y0SG 1L2FA 4HJ5A 1N34L 1SROA 3L0OA 3J7ZC 2R7FA 4LUZA 2A19A 4BBRH 1TWHH 1IL2A 3K7AH 4A3GG 1WI5A 1HZAA 4A3FH 3K0XA 1VQEA 2UXCQ 1CKOA 1SRUA 1S72A 2YTVA 1XMQQ 3GTGH 1UE6A 4BBSH 4DKAC 4JI6L 1PA6A 2OQKA 2VQEL 1CUKA 4X66L 4JI7Q 2VUMH 3S1NH 3DLLA 2NN6G 1VS0A 2CFMA 2IHFA 4LUVA 5M3MG 1M90C 1NBWA 1H95A 1JE5A 3T1HQ 2UXCL 1N32L 4AH6A 4LF7L 1SMXA 1C7YA 1FGUA 4JG2A 1EIYB 4JI5L 1NMFA 3H3VH 1IXRA 5M5YH 5IYDG 1TWAH 4DV6Q 1YZ6A 2AMCB 3NENA 4MTNA 4LFBL 4LF5Q 1YJNA 4APVA 1S3OA 5C44H 1VQ6A 3CAMA 3BJUA 1GKHA 2ZJQA 1UE5A 5DLQE 2UUAQ 3HKSA 3GDEA 5GAEC 1YJ9A 1AE2A 2NVYH 4BXXG 2PMZE 4LW1A 3HOXH 1NTGA 1VQDA 1E22A 2YV5A 4IJLA 5C4JH 1YI2A 3PF4A 3I4MG 4WJ4A 1XJVA 1G51A 4YCWA 4QIWE 4X64Q 4C3HH 1KIXA 3CCSA 4DR4Q 3EIVA 1KD1C 1HR0L 4JC0A 5LMNQ 3S16H 1XPUA 2OTJA 4HJ8A 3KF8B 2Q2HA 2D62A 5JEAG 2NVQH 1Q82C 4B3TL 2Y0SE 4XTCS 2CQOA 3VDYA 1XPRA 1X56A 2OWOA 3CF5A 1PH3A 5M5XH 3KDFB 3PV0A 3NBHB 5IWAQ 1XMOL 4BA2I 2XTIA 1G6PA 5IP7G 1PHJA 3K80C 3U4ZA 3W1BA 4QGUA 1BVSA 1R9TH 4A3EG 3FP9A 2HQLA 2UU9L 4HIKA 5IP9H 4GN4B 2VQEQ 5C0XJ 3W5OA 1NJIC 3GTMH 4A3LG 4JV5Q 3PUZA 1HH2P 5LMUL 4DV0L 3CC2A 3EBEA 2WB1E 3M7NA 1MJCA 3S1RH 1EWIA 1FVIA 1NY4A 5BR8L 1OTCA 3OW2A 1V43A 3J80i 2UXBQ 2D0PA 1YIJA 4DV4L 2E2HH 4JI8L 3J80c 1XNRL 3H3VI 1L1OA 3SGIA 5FLMG 2E2JH 4IO9A 4OO1I 3FKIH 1PYSB 1X3EA 2LSSA 1Q8KA 3HFZB 1X55A 5IY0A 1Z9FA 3UDXA 2FXQA 4X64L 4JBKA 3UDGA 1K9MC 1VQHA 5GROA 3HOUG 4DV7L 4KHPQ 3AQQA 5IYDH 4FDBA 4A3FG 3J81j 4LNQA 3HOWH 2AHOB 2PI2A 4OX9Q 1SN8A 1Y1VH 1EQQA 1A62A 4HIMA 3GTOH 2UXDQ 4DUYQ 4JCVE 5IYBG 2VUMG 4Y7NH 1AE3A 4HIDA 2EXDA 1PFSA 2HHHQ 3AFQA 2F52A 1KAWA 1WOCA 4C3JH 3T1YL 2JA7G 1VQAA 4AYBG 4LF6L 5C4XG 2K75A 4JI0Q 4DUYL 2GN5A 1XNQQ 4GN5A 5AJ3L 4DV6L 3PCOB 1WFQA 4TVAB 3KDFA 4GLAC 5EAYA 3CCMA 3K7UC 1PH7A 1JJGA 3AYHB 3E9IA 4OO1G 2UUBQ 4GKKQ 4J15A 2ZM6L 4DUZL 2A1AA 2BH2A 1JMCA 3M3YH 4R4IA 3MEFA 4GLVB 1LUZA 1CSQA 2AWNA 4O2DA 3G6EA 1OXSC 2YTYA 2CWPA 4BBRG 4PZ7A 3RNUA 3I4NG 4ME3A 3CCLA 3E0EA 1XNQL 2KCTA 2R7ZG 2YYZA 4A3MG 1EIFA 2K50A 5HY6A 3TS0A 3L2PA 3G71A 4DK3C 1J5EQ 1C9OA 4DV3L 4OWTB 4P75A 4A3EH 1JB7A 3S15H 2RHSB 2ZJPA 4PG3A 4AYBE 4NXNL 1N33Q 2DUDA 3HKZE 2H5XA 2NZHA 1YITA 3F2DA 4X65Q 1X3FA 4GKJL 2ES2A 1VQOA 4K0KQ 2ZTCA 1PH4A 1VQMA 1HNZQ 3CP0A 2CCZA 3GTQH 1CKMA 4BA1I 4DR2Q 4JI1L 1GM5A 1LM0A 4JYAL 3ULPA 4A3GH 2KENA 2UUCQ 1WCMH 2R92G 4O0AA 4R1JA 3TEHB 1IBMQ 1EOVA 2N8NA 1FJGQ 2WAQE 2RHQB 3I55A 1B8AA 4BBSG 3KJPA 1SR3A 5FLMH 4PZ6A 1U5KA 4DR5L 5IYCG 3EN2A 4DR3Q 2HIVA 1TWGH 3CQZH 1VQPA 4GKJQ 1PVOA 2VQFL 1OXXK 5AJ3Q 1RL2A 1HNXQ 1SLJA 2N49A 3PUWA 3S24A 4DV4Q 4B3MQ 2JEAI 1HNWQ 1VQNA 3UDFA 4IOAA 1G291 1FL0A 3HOVG 1HZBA 1VQ8A 2HT1A 1YBYA 4L5QA 4YCUA 1Q7YC 1B7YB 2EQSA 4IPCA 4OONA 5LMNL 2NVXH 1X65A 1KC8C 1PH9A 1Q46A 2C35B 2YTXA 3A74A 2JA9A 4A93H 4KI0A 3CW2C 2ZM6Q 2JA5G 1VQJA 1KQSA 3BZCA 3PUVA 4DK6C 2WB1G 3J7A5 1W3SA 3TS2A 4P74A 4ALPA 1W2BA 4B3RL 3S17H 4DV7Q 2PQAA 4DR1L 3HOZG 2Q2IA 2JEBI 3OTOQ 1GO3E 5C4XH 1HJPA 1SFOH 2JA7H 5ELOA 2CKZB 1L0WA 4L5SA 2IT1A 3K8AA 1PH6A 4EQ5A 1N34Q 1VQ9A 1YVCA 3H15A 1IBLL 3HOWG 3S1MH 3D31A 4JI4L 4IFDG 1CSPA 1BBUA 3T1YQ 1MKHA 4A3KH 1ASYA 3PUYA 2R93H 3L7ZC 4YHHQ 3HKZG 4L5TA 4A3LH 2BA1A 3STBD 1J6QA 4C3IH 1U0LA 5BR8Q 4C2MH 1E1OA 3I4NH 1QUQB 1TXYA 2OCEA 1LTLA 4X66Q 2UUBL 4GKKL 3NEMA 4JI3L 4QJFA 3ER0A 4DUZQ 4P73A 2JK8A 4GOPB 3RZOH 1OXUA 3F2BA 2A8VA 2K5VA 1X54A 3PIPA 4YY3L 3CXCA 3CC4A 1PH5A 2IHEA 1VQKA 2KCMA 4B3SL 4X6AH 4DR7Q 3ERSX 4GOPC 4AQYL 1Q12A 4NB3A 1XMOQ 4LUOA 2VNUD 4PZ8A 1LYLA 4IFDJ 1D7QA 1IYJB 1B70B 5JEAJ 1UEBA 3RN2A 1KHIA 4B3ML 5K36G 2HHHL 4MNOA 1VQFA 5C3EG 3WWVA 3J81i 2E5LQ 4R4TA 2ZJRA 4JV5L 1L1OC 4QQBX 1WYDA 1PH1A 4B3RQ 1E1TA 1EUJA 1E7ZA 3A5ZB 1EFWA 3T1HL 3CD6A 1KXLA 4BY1H 2JA8H 4A3DH 1UE1A 3CPFA 4JI6Q 1QVGA 2UUCL 3AFPA 1N8RC 3G4SA 1I94Q 3KLWA 4JI7L 3HOYH 1KRTA 4UP8A 2YU9H 4LF4L 4P72A 3CMAA 4A3IH 5C0XG 4R4OA 4LF5L 1P16A 2NN6I 5J3BA 4POFA 4LF8Q 2KBNA 1D8LA 2BH8A 3M4OH 3ZJYC 4LF9Q 4TQUS 4L5RC 4PMWA 1J5EL 3M85A 1L1OB 2B3GA 2VZAA 4NPSA 4LF4Q 4JBJA 4DAMA 1V1QA 5GAHC 3PUXA 5GQOA 5FLXc 1K8GA 4KHZA 3G48A 3I7FA 1GD7A 4DV5L 2BA0A 4HJAA 4A3MH 4UP7A 4RMFA 4YCVA 4DV1Q 2I0QA 2AWOA 3JC66 2K5NA 3TREA 4AIMA 4YWKA 1Q86C 4DV2L 2I5HA 4JBWA 4JI3Q 1MIUA 2PQAB 1ASZA 5IT9c 1VQGA 3DM3A 3GO5A 4MZ9A 1NE3A 4NXML 1NMGA 3CC7A 2GVAA 3STBC 4A4IA 4LF6Q 4K0KL 1TWCH 2IY5B 4JI8Q 1VQLA 4LFCQ 4GNXC 4LFAL 5JJLA 2MFIA 2Z0SA 5C0XI 2B63G 4IOCA 5ELNA 2JA6G 1M1KC 3A0JA 4A3JH 2E2IH 3H0GH 1QZHA 3ICEA 1YHBA 1WCMG 2R92H 3PO3H 3E9HA 3GTLH 3GTPH 1GVPA 1HZCA 4JI2L 1OXVA 2MQHA 4IPGA 1Y1WH 4BY7H 5FJ8G 2I5LX 2D0OA 3RN5A 3AEVA 4KHPL 3RLOA 5IYCH 2R6GA 1YHQA 1I6HH 1I94L 3ULJA 2R93G 2VS1A 4OWWB 1HZ9A 1XTDA 2L15A 2OTLA 4X65L 4HJ9A 2GVBA 1P8LA 3IRBA 1X9NA 4IJHA 3TRZA 4JI0L 4DR6L 1YHAA 2PNHA 1K73C 1O7IA 4OWXB 2JJQA 1HR0W 2PI2E 1VQ5A 3I56A 4Y52H 1WJJA 2RCNA 2K5HA 4B3TQ 4A93G 1EYGA 2ALYB 3Q8DA 2JA5H 2UXBL 5GADC 2K4KA 3M4PA 5M3FH 3JAMc 1K0RA 4A3BG 3KYHC 3B6YA 3F8TA 3RZDH 5M3MH 2F4VQ 3KOJA 3HOZH 1A8VA 4DR3L 4YWMA 1N9WA 2K52A 4DV2Q 4DR6Q 4JBMA 3S1QH 5JJKA 5JJIA 3HOVH 3RR5A 4RG1A 4GOPA 4DV1L 5C3EH 3PGZA 2EIFA 5C44G 3UE0A 1VQIA 2CWAA 5H1SE 1BBWA 4YHHL 2KHIA 5GAGC 3I2ZA 3KJOA 4A3KG 1Q81C 1Z47A 4IPHA 4BY1G 2DGYA 2JA8G 2WFWA 2Z6KC 1KRSA 3LGJA 3D0FA 3CCVA 3HOXG 4LFCL 4X62Q 4LF8L 4NXNQ 3HOYG 1X3GA 4QL5A 4LF9L 3F1ZA 4GN3B 1I3QH 1K3RA 4JOIC 3CPWA 2KHJA 1QVFA 4POGA 1HR0Q 4IPDA 5LMNW 1IBML 4JI5Q 3U58A 4B3SQ 3PO2G 4A3CG 1VQ4A
chains in the Genus database with same CATH superfamily
3KFUA 1N32Q 2ID0A 4G7OC 5BN3A 4QF4A 1VDZA 5CV5A 2PW5A 2UU9Q 2O2LD 5IWAL 3M9BA 1EZ6A 1L0XB 1JJCB 1JOOA 2LXKA 4LAAA 1GUTA 1Y1WG 4RFBA 3ZYYX 2MO1A 2EJFC 2F0JA 2RCFA 3S2HH 5IP9G 3OSOA 2QEXA 2ASBA 1H9RA 4XQJA 5M5WH 3I91A 1AH9A 1PV4A 5DM63 4YWLA 2IX0A 3EJIA 3I4OA 4A75A 2KUMA 4PNYA 4LF7Q 3BZKA 4A3IG 1FJGL 2VY3A 4DAYB 3PO3G 4DAPA 2ZTEA 5C5MA 3J81c 4R4QA 2QA4A 4KLKA 4IUQA 4F87A 1OXTA 1VMCA 4BXXH 4DV3Q 3KF6B 4GNXB 2MNAA 2VQFQ 4X62L 2HIXA 1CKNB 2E75C 3PIOA 4KMUC 2WB1B 1AEXA 1SE4A 2F0GA 4OELB 3S1NB 2VB2X 1RKNA 2ATWA 1QVCA 1XMQL 1I5FA 2VL6A 2L4NA 3A56A 5IE8A 2X6GA 1PYBA 4RCOA 3JAMi 4ILWA 2XRQD 3V96A 1ICFB 1ET9A 3E3XA 4A3CH 4DF7A 4B08A 2B2WA 1SAPA 1F9PA 4XDXA 3RLNA 3OIQA 4NMZA 3T4AC 2B39A 4Y7NB 4GLXA 2B63H 2R7ZH 2Z9HA 4IFDI 1KL9A 1KLUD 1CHQD 3MWYW 2B29A 4IUTA 5FOBB 3D3RA 1CT1D 2A19A 2EY5A 4FO2A 3VR2A 1GUOA 1VQEA 1SRUA 2MPMA 1UE6A 3CKIB 1L0YB 4KY5A 4U673 5A2QE 3S14B 2CFMA 3CU7A 1JE5A 3T1HQ 2JA7B 1N32L 1I4XA 4AH6A 3FDTA 5C4XB 1EIYB 3OMGA 2AMCB 2KEDA 1PZJD 4X3KA 1YJNA 1VQ6A 1IHZA 3HZXA 3X3NA 2ZJQA 3HOUB 3GDEA 4P2CB 1MHWC 3K5MA 1NTGA 4KJNA 3PF4A 2YV5A 5C4JH 1XJVA 1PTOD 1TKWB 5KYIA 4QIWE 3CCSA 2VXWA 4HMJA 3Q23A 1KLGD 2EYFA 2MGSA 1XPUA 3KF8B 3NQIA 2Q2HA 2QW7A 1I4QA 4CDDC 1STEA 2Y0SE 5KEEA 5JVG3 2Z8LA 1S5CD 3S1RB 1XMOL 1PHJA 3U4ZA 1HTLD 1R9TH 1BVSA 4KKTA 2HQLA 1LO5D 1E2WA 1LABA 4HIKA 5IP9H 1SYDA 1GUNA 1HRJA 3J81L 4JV5Q 2KJXA 2A69C 2OT2A 3EBEA 4MIUA 2PW7A 1NY4A 2UXBQ 1YIJA 2PO4A 4XYQA 2DY8A 5J1ZA 5CC4A 2E2HH 1XNRL 2EDGA 2JP1A 1PZID 1PYSB 1Q8KA 1SBBB 2P5ZX 5AFWA 3NWSA 1TIID 5IYDH 5GROA 1ONLA 1II3A 3HS0C 2PI2A 1SN8A 1Y1VH 4HCSA 4HIMA 4WRDA 2EXZA 3A55A 1SYCA 2K01A 3KLSA 2R92B 2NWGA 4DUYL 1MI2A 1QG7A 4GN5A 5AJ3L 4G4KA 5C3WA 2RDFA 3I72A 2NVTB 4WJWA 1VQ4A 3EVQA 1Z7TA 4DUZL 3M3YH 5FO9B 5M5XB 2RDGA 2A74C 4RH6A 2AWNA 4O2DA 3F2UA 4RAUC 3I4NG 3CCLA 4L6TB 2KCTA 2QILA 4A3MG 1EIFA 4N9PA 5HY6A 1STHA 5HGTA 3G71A 3I4NB 2RVLA 4HEDA 3EFXD 5M3FB 4AYBE 1KABA 1SXTA 1YITA 2NZHA 1GXDC 1CA5A 1VQOA 2BDNA 2ZTCA 5BN5A 1PH4A 3CP0A 1HNZQ 3D4RA 2B2YC 1GM5A 2Z1CA 2KENA 2F0QA 1SE3A 3E0JA 2R92G 4O0AA 2RHQB 1B8AA 2O4XA 2SOBA 3J7AF 4G57A 5IYCG 1D5XC 4IN3A 3CQZH 4GKJQ 3NTIA 1RL2A 4ZUJA 3PUWA 4DV4Q 3S17B 1QWYA 4KN7C 2JEAI 3UDFA 4IOAA 1F9QA 1G291 1SFOB 4L5QA 3C1EA 1B7YB 5LMNL 1XWEA 1MSHA 2YTXA 4A93H 2JA5G 4XYOA 3BZCA 3DXJC 1SNCA 4A3KB 3M4OB 2CQAA 2PQAA 4DR1L 3HOZG 2Q2IA 3BS1A 5C4XH 2JA7H 1HJPA 2EOTA 2CKZB 1NCVA 4XT3B 5TSSA 1PH6A 1D1KA 2EY6A 1IBLL 1BBUA 4QUCA 1HHVA 3PUYA 1UAPA 1PYWD 3L7ZC 4A3LH 3HKZG 2R93H 1MBYA 4NDXA 3E5SA 4A93B 1M8AA 5BR8Q 3I4NH 1QUQB 3H94A 1AFPA 1BCPF 4M8AA 1EWHA 4X3SA 5CBAE 4JI3L 3PQIA 4DUZQ 1J9OA 1BO0A 3H0GB 3PIPA 1X54A 4X6AH 1GHJA 1U4PA 3NP8A 1PMRA 4NB3A 3BYYB 1D7QA 1B1ZA 1S5FD 1K0SA 4C1NK 3RN2A 1KHIA 5I2XA 1VMPA 1RF2D 1VQFA 2E5LQ 2RKSA 5D65A 4QQBX 4C1NI 3BVZA 4IUPA 1E7ZA 4KJOA 1EFWA 3HP3A 3CD6A 1KXLA 3H91A 1UE1A 2Q8IB 2KHSA 3DMUA 3G4SA 1I94Q 3QG1A 2A68D 3I8ZA 4P72A 5C0XG 1P16A 4LF8Q 3M4OH 1LTSD 4LF9Q 4C56C 1LT5D 1J5EL 3M85A 1ENAA 2B2YA 1L1OB 1U4RA 1DONA 3RZOB 1DOLA 1V1QA 3RUZA 3CHBD 5GAHC 3VYRA 4H7BA 2BA0A 3AU7A 4YCVA 2I0QA 2K5NA 2N88A 4DV2L 2I5HA 1MIUA 2PQAB 4KV6A 3PO3B 4IFDH 2YU9B 3PMFA 1NE3A 1H9SA 1NMGA 2B2TC 4K0KL 3I4LA 2KVMA 1TWCH 5JJLA 1KDAA 2G9HD 3VA7A 4LFAL 5IOCA 1FNUA 5ELNA 4J6HA 5I6YA 3H0GH 4DU9A 1S5BD 1GVPA 1HZCA 1OXVA 4BY7H 5FJ8G 2D0OA 3RLOA 1PZKD 1ESFA 3OW7A 1YHQA 1I94L 3OOCA 3ULJA 4ODGA 2L15A 4RGNA 2HUGA 2RQXA 4HJ9A 4O1NA 4M1UB 1ET6A 2BOSA 4DR6L 5K36H 2B2TA 1TY0A 4OWXB 1HR0W 4WFN3 2K5HA 4A93G 1CZWA 2Y0SB 2ALYB 3Q8DA 1SEBD 3M4PA 4FF2A 3MA2B 2ZXPA 3B6YA 3KYHC 3RZDH 2C5CA 3FEWX 3R2IA 2KEEA 1XYIA 4BY7B 2K52A 4JBMA 1PTOB 5JJKA 5JJIA 3HOVH 2AQ3B 4RG1A 1D6EC 4CKEA 5C6AA 5M9OA 3LWEA 3UE0A 1SSOA 4YHHL 1BBWA 1Z6HA 2XWBB 4RHRA 4OIJA 4IPHA 4C2MB 2DGYA 4H13C 4HCEA 1KRSA 2NUCA 4X3TA 5I9PA 3CCVA 4GN3B 1I3QH 3KUPA 4C3HG 1QVFA 4POGA 1HR0Q 3SK5A 3GV3A 3OTOL 3OWEB 1MD2D 1X6OA 3GQBA 1UE7A 1A63A 1XPOA 1TWFH 3F2CA 1DD2A 1C0AA 1K8AC 4FYDA 2LXJA 2SNMA 1DGSA 1QUQA 1CZGA 1T9HA 4G7ZC 2WAQG 2AKWB 1JORA 2NN6H 4A3DG 5IT9L 5EBCA 3OMCA 3UI2A 4H02A 1KNEA 3GD7A 1E3PA 2SNSA 3PSIA 3U4VA 4A3JG 3M4QA 1IBKL 2ENBA 1A6XA 1YNXA 4EQOA 2E5LL 1PFMA 5FJ8H 1QILA 3TDQA 1NUCA 4K2KA 1MJEA 4ZRZA 1Q1EA 4TSSA 1HNWL 1E0BA 1V8QA 1HQRD 3TQYA 1DJRD 3NWTA 5KRUA 4G7HC 1E2ZA 4HSVA 2KCCA 2X69A 3AB9A 3GP7A 4IURA 2K03A 2G5DA 1Y1VG 2I46A 1E24A 2A69D 3GTKH 2VUMB 2F3IA 3MFYA 4JYAQ 4JI1Q 1EQVA 1BKBA 4EX5A 3Q0AA 3P1HA 2JA6H 2B8GA 3AMUA 3FKIB 3CCRA 5M5YB 1RIPA 2IX1A 2JYOA 3K0YA 4LFBQ 4PV1C 2MP1A 1PH2A 4GNXA 3PO2H 3S14H 3UE1A 4R4CA 1F2ZA 1X3QA 4DR5Q 1EY5A 5CV8A 2R3ZA 4CKBA 2RF4A 4CHTB 1QZGA 1IZ6A 1PTOC 2JA6B 1BQQT 5IP7H 2Z6KA 1T5EA 1N36Q 4BY7G 5JVH3 1FD7D 2FMCA 1EQRA 4XIGS 4ZCKA 3CCUA 4JOIA 1YJWA 2Y0SG 2WINB 1SROA 3L0OA 1TWHH 2QDBA 3K7AH 4A3GG 5DAUA 5EPLA 2TMPA 2OF1A 2OQKA 3L9AX 1CUKA 4X66L 1RDPD 1PFNA 4JI7Q 3S1NH 3DLLA 2NN6G 1VS0A 2IHFA 4LUVA 2PQEA 1M90C 1H95A 2EYPA 2PZUA 3R93A 1ZEQX 3KLSX 2NVYB 4H0LC 3WDNA 2K28A 2DNEA 1SMXA 5A35A 4JG2A 4EGVA 4JI5L 1NMFA 1NR2A 3T51B 3S9WA 1WTXA 4DV6Q 3NENA 4MTNA 2AUJD 2HQEA 2F0KA 3CAMA 3BJUA 5DLQE 4V190 5GAEC 1YJ9A 3D8GA 1GUGA 3H6MA 1E22A 2E2HB 4FF1A 3K59A 4UDUC 1KD1C 1HR0L 5LMNQ 1BCPB 5D3DA 3MTSA 4OHJA 2Z4IA 1Q82C 1RTNA 1TS4A 4XTCS 2K5DA 3GTMB 2IPKD 2OWOA 4DNTB 4HMIA 3CF5A 5M5XH 1I3QB 3KDFB 1NAPA 1G6PA 5IP7G 1NSNS 3DM1A 3W1BA 4A3EG 1S5DD 2KQ3A 1LACA 3K5LA 1EYCA 3VR5A 3W5OA 1NJIC 2LMCB 3QO2A 3CC2A 5KYLA 2WB1E 3D4WA 3M7NA 4C3IB 3D4DA 1EWIA 1FVIA 5ELEA 5BR8L 1H9SB 1LT4D 4FP5D 1B2TA 5JOBA 2F03A 3H3VI 2FINB 4N8X1 1LTTD 1SYEA 5I6WA 3HFZB 5IY0A 1Z9FA 2FXQA 4JBKA 3UDGA 1SNQA 4RHSA 1K9MC 3Q22A 4DV7L 3AQQA 4FDBA 3JAML 2AHOB 2LKVA 5ELCA 1DOMA 3L3OC 3MEHA 2XNAC 3GTOH 2UXDQ 1IYVA 4DUYQ 2B8FA 5IYBG 1U9RA 2VUMG 4Y7NH 3C46A 2EXDA 2HHHQ 1FYCA 3AFQA 2F52A 3SVMA 1KAWA 2JA8B 3T1YL 3V2TA 4ZUIA 2K75A 4JI0Q 1LT6D 3NBIA 1XNQQ 4DV6L 1PH7A 5I4DA 3BYTB 3E9IA 4MHEA 4DA2A 5IT9E 2UUBQ 4J15A 2OXPA 1JMCA 4R4IA 1LUZA 1CSQA 3NTHA 2CWPA 4PZ7A 2CVRA 2CW0C 2R7ZG 3TS0A 3HRZC 4A3MB 4A3EH 1JB7A 3S15H 2RHSB 3HKZE 2H5XA 3F2DA 1B50A 2EYOA 1T5XD 1X3FA 2ES2A 4K0KQ 1UNSA 2CCZA 1LM0A 5K5PA 5LL6S 4JYAL 3ULPA 4AYBB 4K5VA 4R1JA 5ELDA 3TEHB 1EOVA 2N8NA 2WAQE 2XN9C 1VQPA 3EN2A 3I3CA 1JC7A 1IW7C 3TP8A 1F2MA 1OXXK 3BDLA 5AJ3Q 3K58A 1HNXQ 3S24A 3NPPA 3NXWA 4K8IA 3S1MB 1HNWQ 3U9OA 1VQNA 4C3HB 1FNVA 1HZBA 1TWHB 4IQZA 4YCUA 1Q7YC 1KTKA 2EQSA 1B4OA 1BCPC 1W6KA 5JPMC 4L63B 4IZ8A 2C9OA 2C35B 3QB3A 4KI0A 3CW2C 2ZM6Q 1KQSA 3PUVA 2NVQB 2NYZD 3TS2A 4ALPA 4B3RL 4QCLA 3W2DA 4DV7Q 4FXKC 5M3MB 2ICEC 3OTOQ 5L37A 5ELOA 1UUPA 1AZQA 5T1IA 1CA6A 2IJ0A 2IT1A 1E2VA 4EQ5A 3H15A 3D31A 4JVZA 2BE5C 3T1YQ 1MKHA 1ASYA 4DN4M 4YHHQ 3STBD 1J6QA 2SDFA 2IWHA 1E1OA 3DWAA 5NUCA 2J4XA 4X66Q 2QCPX 2O5JC 3NEMA 2HDLA 2H4OA 4FXDA 2L11A 1G2TA 2NBFA 2JK8A 4P73A 4GOPB 1OXUA 3RZOH 4A3DB 2A8VA 3CXCA 4YY3L 1PH5A 1BR9A 4YIJA 2KCMA 4AQYL 4N9TA 1WTQA 5EBDA 1XMOQ 4LUOA 4PZ8A 1LYLA 5E1FA 2CH4W 1G8ZD 1C8CA 3NBHA 4FXGC 1A3UA 2QEJC 1WYDA 1HPCA 3KK7A 4B3RQ 4ZKCB 3A5ZB 3I70A 3T1HL 5I2YA 1JWMD 1QVGA 4JI7L 4Q5VA 3U9SA 5CBEE 3CMAA 4LF5L 1TWGB 2F3WA 5J3BA 2XWJB 1QJOA 2E74C 2VZAA 4NPSA 2XIWA 4DAMA 3PUXA 3H09A 4KKUA 1GD7A 1SMYD 1F9SA 4RMFA 4DV1Q 1YNJD 3JC66 3MXPA 4F7XA 3FPUB 5EKKA 1ASZA 1B3QA 2F0OA 5G3LF 3GO5A 1O7YA 4NXML 2K32A 4A4IA 2XVSA 4ZQ3A 2IY5B 1VQLA 2NB0A 2MFIA 1TS2A 3X3MA 3PIP3 3A0JA 3ICEA 2R92H 1ILQA 1EOTA 3GTGB 4JI2L 1Y1WH 4IPGA 1RD9D 3KBGA 2H1EA 3P20A 3AEVA 1ENCA 3BDCA 3TP5A 1A15A 1HZ9A 4LJZC 4C3IG 2OTLA 4X65L 1Y69U 4ULLA 4NKLA 2GVBA 2V4DA 3ITPA 1X9NA 4IJHA 1LTID 5DNFA 3TRZA 3K6OA 1YHAA 3CRKC 1VQ5A 2F0LA 2JJQA 4OIKA 2O5IC 1EYGA 1EY4A 3HGBA 4QB4A 4A3EB 1RTOA 1X32A 2PMZB 5M3FH 3I90A 2AQ1B 3HOZH 5DM73 4DR3L 5D14A 1AN8A 2K7VA 1NNXA 3TBIB 3RR5A 4DV1L 3PGZA 2EIFA 1HUMA 1K28A 4KD4A 1VQIA 2CWAA 5H1SE 4A3KG 2KHIA 5D3IB 1D2BA 1Q81C 3ND9A 2WFWA 3D0FA 4NXNQ 4LFCL 4X62Q 3S1QB 1X3GA 1HQMC 2DN8A 2L1BA 2KHJA 2E2IB 5LMNW 3PO2G 1G6ZA 2NTSA 5EPKA 1YNJC 2VW9A 1A0IA 1SMYC 1X3PA 4HJ7A 3A8KE 3IKJA 3A5UA 2R7DA 3GTPB 2B2UC 1Y1WB 3T16A 3MXNB 5C4HA 1JOQA 3DHQA 1DM0B 5FO7B 2PNRC 5EKIA 3P75A 2F4VL 3K81C 2EJMA 1HNXL 3SK6A 1N33L 3FVQA 1DYQA 1IL8A 2D9UA 4I7ZC 3OHXC 4GS3A 5E3FA 1UWVA 1VQBA 3WOEA 3QIAA 3CMEA 4ZK9B 2PCFB 4DV0Q 4AQYQ 4DR4L 4FVMA 1WVLA 3ULLA 4ME5A 3NK9A 3CCJA 5EKLA 2LFNA 3U50C 1PRTC 2V1CC 1Y14B 4DV5Q 1F9RA 1H9KA 3LNNA 3MHBA 2K14A 4OEMB 5T1GA 1AZPA 1HA6A 3JAME 4JI4Q 2WAQB 1SYGA 4R8IA 2NZ1D 2A6EC 1TS3A 3HOUH 3RLFA 1O7ZA 3S2DH 1RJTA 3D6WA 3BU2A 5LMUQ 1JICA 5IYBH 4DR1Q 1TVXA 1DCZA 4MN3A 3KF6A 2XGTA 4A3JB 3FKIG 2RDHA 1EY6A 5EJWA 2JE6I 2NZOA 3TP7A 1CHPD 2F0TA 4HIOA 1PH8A 4DPGA 1XNRQ 1Q1BA 3FHWA 2BE5D 4XT1B 2F0WA 1Y1VB 4NXMQ 2UXDL 3GTJH 1JWSD 2QGQA 5C4JB 2OQ0A 5JAVA 2I5MX 1WCMB 4H44C 2F0SA 1M4VA 1WTOA 4JI2Q 2E8GA 1I50H 5M3FG 1LV9A 3N6RA 3SK4A 1QNKA 2NTTA 4F88A 1JB3A 3PIO3 5E7NA 3N52A 3UDIA 4OXPA 3K5OA 1L2FA 4HJ5A 1N34L 3M3YB 2F0NA 3J7ZC 2R7FA 3DEOA 4LUZA 1SJED 4BBRH 1LTRD 1IL2A 3KBXA 1WI5A 2AQ2B 2ZT9C 1CKOA 1S72A 4BBSH 1PA6A 2VUMH 3GTKB 4IUVA 5M3MG 4KK7A 4K5WA 2UXCL 4LF7L 1B9MA 1FGUA 2MHVA 1EFID 2IL8A 5IYDG 1YZ6A 4A3BB 4RGTA 4LF5Q 1XTCD 4FNFA 4APVA 3MZ5A 1TWFB 1PDQA 4CDEC 4DK0A 3BVGA 1S4ZA 3HKSA 1AE2A 4BXXG 2PMZE 4LW1A 4FF3A 3HOXH 4IJLA 4WJ4A 1LTAD 3I4MG 1G51A 4X64Q 4X3UA 4EVOA 4DR4Q 2RSOA 1BDOA 3P7JA 4JC0A 2B2UA 3S16H 1RHPA 2OTJA 4HJ8A 3BZDB 2SEBD 1VF7A 3SHLA 3TZUA 4DXFA 5IGBA 2WKCA 2ICIA 2CQOA 1XPRA 1X56A 4I7AA 2EY1A 3H3VC 1CQFA 4HR7B 1HTPA 4UAIA 5F2DA 4GN4B 2EYLA 2B2WC 4QIWB 2E76C 1V1PB 4BWGB 3S15B 3PUZA 1ZKOA 3E6ZX 1HH2P 5LMUL 4DV0L 5KNCA 1Q3LA 5ELBA 3SXHA 3OW2A 1V43A 3J80i 1DXMA 2EYJA 4DV4L 1LTBD 3J80c 1R4QB 2F0PA 1WD1A 2E2JH 5FLMG 1ZYRD 1ICWA 2HCCA 3S16B 1X3EA 3UDXA 4X64L 5IIFA 1V1PA 4RGMA 3TSSA 5IGEA 3HOUG 1GUWA 2AUKA 1KDBA 4JPBW 1A62A 3G7LA 2Q8TA 3MXNA 2F4IA 4BY1B 4F8MA 2F1MA 5EQ0A 3M4YA 4C3JH 1EL0A 5C44B 2GN5A 1TS5A 5C0XH 4TVAB 5EAYA 3CCMA 1QCBD 3K7UC 1JJGA 4B9WA 4OO1G 1STAA 3IAYA 4PMCA 4GKKQ 3RMHA 4DK1A 3MEFA 4GLVB 3G6EA 5FK9C 2FHTA 2YTYA 3RNUA 1IKLA 3E0EA 1XNQL 2YYZA 2K50A 1J5EQ 3HKZB 1I4GA 1C9OA 4DV3L 4OWTB 4P75A 2L0CA 2ZJPA 4PG3A 1STYA 5FKAC 4NXNL 1N33Q 2DUDA 1HFGA 3HOWB 4X65Q 2GA4B 1YNNC 3RD4A 1VQMA 3GTJB 1EIHA 1CKMA 1JWUD 4DR2Q 4JI1L 4OL7A 2WIIB 3TZDA 1WCMH 2UUCQ 1ML0D 2CHBD 2L5TA 2Z6BA 4DAYA 1FJGQ 4TRDA 3KJPA 5FLMH 4DR5L 4DR3Q 1TWGH 3GTQB 3QR8A 1SE2A 1SLJA 4B3MQ 5KIXA 4CJ0B 1FL0A 3K7AB 4RGOS 4IPCA 3HOYB 4WORA 4OONA 1X65A 1Q46A 3A74A 1K8OA 3VYUA 1VQJA 4HN7A 5LL6X 3J7A5 1SNDA 1W3SA 4P74A 5CYUA 4U68A 1CTMA 2N55A 3S17H 4I65A 1GO3E 3MXGA 5IGGA 1SFOH 2NVXB 1L0WA 2FJ2A 4E6IA 3HG9A 1N34Q 1YVCA 2J7ZA 3S1MH 4JI4L 1CSPA 3NSWA 1NR4A 4A3KH 4RA8A 4L5TA 1BBXC 1KDCA 1U0LA 4C2MH 3BG3A 3NUCA 3DWQA 2OCEA 4HSPA 4NP5A 4ABNA 4GKKL 1O80A 2M2LA 4QJFA 3ER0A 2KOLA 2EE1A 2K5VA 5LHY1 4ZYSA 2R93B 2IHEA 2K5WA 4B3SL 2F0DA 4GOPC 1Q12A 1VF5C 2VNUD 4PQXA 4IFDJ 1IYJB 1ZXTA 5JEAJ 3T53B 1UEBA 4B3ML 3M7GA 1GHKA 3OPOA 1XXGA 3C2PA 5C3EG 3J81i 2L55A 2ZJRA 1L1OC 1PH1A 3VYSA 2A6HD 2K1BA 1EUJA 4K6DA 2JA8H 4KY6A 4A3DH 3CPFA 1XX8A 2UUCL 2R61A 3AFPA 1N8RC 3SR1A 1WTWA 3KLWA 2BDOA 1ENFA 3HOYH 2A6HC 2EVBA 1KRTA 4UP8A 1CM9A 3IFTA 1SNPA 1V1OA 1HUNA 1TT2A 5CV6A 2NN6I 5KGUA 3J81E 2K5QA 2BH8A 1TU2B 3ZJYC 4PMWA 1HA5A 2B3GA 5JPNC 4LF4Q 2E2JB 1EZ8A 3VA5A 2QKIC 1IKMA 2L9HA 1A2TA 4KHZA 3I7FA 1TWCB 4S3SA 4A3MH 1PTOH 4UP7A 1STGA 2AWOA 1Q86C 1PRTB 3TREA 4AIMA 1JQYD 1B44D 1TR5A 4JI3Q 3D6CA 5JJZA 1Y8OB 2K05A 4OGQC 2K04A 3CC7A 2GVAA 4LF6Q 1BUVT 1HXYD 4JI8Q 2B63G 3Q24A 4IOCA 5IGFA 3EQLC 1M1KC 2IW3A 2KCNA 4KTAA 3PO3H 3E9HA 3GTLH 4NW2A 3GTPH 2MQHA 3MC0B 2VB3X 1PFBA 1R4PB 3NQTA 3RN5A 4KHPL 3TN2A 3TP6A 2R93G 1J8IA 5C3XA 2LS01 3A7AB 4JI0L 1G91A 5ISRA 4IUUA 1I4PA 2PNHA 1O7IA 2PI2E 3I56A 1WJJA 2RCNA 4B3TQ 3S2HB 4RKBA 1FNWA 2UXBL 3MFGA 2K4KA 1Q90A 5M5WB 1K0RA 3F8TA 2F4VQ 3Q6SA 3KOJA 1U4LA 1N9WA 1JR0D 4RCNA 1B53A 3G6JB 1JCKB 3MXUA 4GOPA 2QDLA 5C3EH 4GZYC 3MVVA 5C44G 3EA6A 3J80L 3NTKA 5GAGC 1FGBD 1YNND 3KJOA 1Z47A 5C4ZA 4BY1G 2CH4A 2ZXRA 4LF8L 1EYDA 3HOYG 4LF9L 2HCIA 3F1ZA 1SDFA 3CPWA 3V05A 4IPDA 1IBML 2XRSD 4A3CG 2FFKB 4ZLTF 2WKDA 1N36L 3GV6A 1MSGA 2N78A 3HEJA 1I6VC 1IYUA 3NELA 1K83H 1CKNA 1EY9A 4BS9A 4QUFA 3I4MH 3QOLA 3IFDA 4WJ3M 1V9PA 1JOKA 3A8IE 4R9WA 4HAEA 4LFAQ 2A68C 5CV4A 3FRPB 4KY7A 4DR7L 1K8MA 4P71A 4RKLA 4DXGA 1SYFA 2JQOA 2MO0A 1I6HB 1O7LA 4BBRB 4KKSA 1S40A 1STBA 1A3TA 3CCEA 4UY8C 2JSOA 4UPAA 1DOKA 3IL8A 3FPPA 4A76A 1H9MA 2UUAL 1ZYRC 4UP9A 4HTHA 4QY7A 1CI3M 2Q2UA 1MGSA 2Q2TA 2DY7A 4KN4C 2NVTH 4OX9L 4EQPA 4J1MA 3C3LA 4YY3Q 3I4MB 1JT8A 2ZTDA 3ND8A 3EROA 1EEFD 4A3BH 4Z9CB 5EGTA 3TMEA 1SE8A 3HOVB 3A54A 4C3JG 1VCIA 1AW7A 1CQVA 4DR2L 1JJ2A 3W1GA 3PF5A 3CCQA 2M9VA 5KNBA 1EQTA 2N3SA 3HOXB 1VQCA 3OIPA 4DNIA 3J7YW 3T56B 3W3AA 5J22A 4XQQA 4CGYB 2WP8J 1IBLQ 3J7AV 4LWCA 1SNOA 2ZXOA 1BF4A 1SNMA 2EY2A 1BNZA 5HGQA 2J0TD 1WTVA 4KHVA 3H0GG 1IBKQ 1QE6A 1HNZL 1VQ7A 3OYYA 4O42A 4JK1C 2DNCA 5EPJA 1YEZA 1G2SA 4CKCA 2LY7A 5G3LD 1HZAA 4A3FH 5IODA 1R9TB 3K0XA 2UXCQ 2MUYA 3GTGH 2YTVA 1XMQQ 4DKAC 4JI6L 3R2TA 2VQEL 1OO9B 4XQNA 5FO8B 5FLXL 4JW0A 1NBWA 4KD3A 2HDMA 1QB5D 3DEPA 1ESRA 4QMGA 1C7YA 3NE5B 3H3VH 1IXRA 5M5YH 1FR3A 1TWAH 2B63B 4OO1H 5IGDA 4LFBL 1C48A 3SK8A 3MAQA 4L8JA 5C44H 1S3OA 4A3FB 1GKHA 1UE5A 2UUAQ 2EPBA 2NVYH 4LK1C 1VQDA 1YI2A 1LTGD 4YCWA 1CK1A 4C3HH 5KNDA 1KIXA 3EIVA 1Y8NB 3I73A 3C1FA 1EU4A 1I50B 5J39A 2D62A 5CV9A 5JEAG 2RA4A 2NVQH 1STNA 2PPBC 4B3TL 1JE4A 3VDYA 2IX3A 1A2UA 1PH3A 2E2DC 3PV0A 3NBHB 5IWAQ 4UHVA 4BA2I 2XTIA 3ERQA 1GJXA 4FF4A 2BCOA 3K80C 4QGUA 3DWPA 3FP9A 2UU9L 4RWSC 2R7ZB 1HFNA 2VQEQ 5C0XJ 1U4MA 3GTMH 4A3LG 1MJCA 3S1RH 3BVMA 5CMDA 2F0MA 4Q0FA 1OTCA 1K3BC 1KAAA 5BN4A 2D0PA 2A6ED 3DUZA 3SEBA 1WD0A 4JI8L 1SJHD 1L1OA 2D5DA 3SGIA 2WACA 4IO9A 3GTOB 4OO1I 1I4HA 4K2LA 3FKIH 4CDFC 2LSSA 1TWAB 1X55A 2K6AA 1GOZA 1TY2A 1VQHA 3PO2B 1PRTD 4KHPQ 4B9XA 3HOWH 3K5NA 3J81j 4A3FG 4LNQA 4OX9Q 1EQQA 4DFAA 4JCVE 2F0IA 1AE3A 4IUNA 4HIDA 1PFSA 1WOCA 2JA7G 1VQAA 4AYBG 4LF6L 5C4XG 1D5MC 2F0HA 2JXMB 3PCOB 3VR4A 1WFQA 2EYHA 3KDFA 1BOSA 4GLAC 1F77A 3AYHB 5COYA 2PYKA 5HURA 2TSSA 1B3AA 4MTKA 2ZM6L 2A1AA 2BH2A 4CJ2C 3QJYA 1KNAA 5I9OA 1OXSC 5CV7A 4BBRG 2KECA 2XSCA 4ME3A 2Q8RE 3L2PA 4DK3C 4CJ1B 1W6JA 3SDZA 2EYMA 2B2VC 4J8QA 4N8FA 1LLRD 4DGZA 1B9NA 4GKJL 5CGKA 2DJGC 3GTQH 1WTRA 4BA1I 1PLFA 3FMCA 4A3GH 1DZ1A 2EJGC 3R3OA 1IBMQ 3I55A 4ID6A 4BBSG 1SR3A 4PZ6A 1PTOF 1U5KA 4TKOB 1PVOA 2HIVA 2JN4A 2VQFL 5E4WC 2N49A 3VR6A 3J80E 4C3JB 2PZWA 3A8JE 3HOVG 2I07B 2HT1A 1VQ8A 1YBYA 1Y8PB 2NVXH 1KC8C 3T13A 1C4QA 1PH9A 2JA9A 4K14A 4BBSB 4DK6C 2WB1G 3CRLC 1W2BA 2L12A 1CFMA 5DEHA 2JEBI 4L5SA 1Q8IA 3K8AA 3VYTA 3HOWG 1VQ9A 4IFDG 3LX0A 4A3GB 5CORA 2PZTA 2Z4HA 5E4XA 5JEAH 2BA1A 4C3IH 2DJFC 1TXYA 1LTLA 2UUBL 2KA7A 3F2BA 3CC4A 1VQKA 1EIGA 1EYAA 3GTLB 4DR7Q 3ERSX 2F0FA 1B70B 1EWCA 1EY7A 5K36G 1QOHA 1LT3D 3A7LA 2HHHL 4MNOA 2WV6D 3KF8A 3WWVA 4R4TA 4JV5L 1E1TA 1EY0A 2RBMA 4BY1H 1D5ZC 4JI6Q 3SE0A 2MJ8A 3BDOA 1A3VA 4DNRB 3KLRA 2YU9H 5CR3A 3QOJA 4LF4L 2B2VA 4A3IH 4R4OA 3CQZB 4POFA 2KBNA 1D8LA 4TQUS 4L5RC 4V0BA 1ILPA 1F2LA 2D2CC 3VR3A 4JBJA 3HOZB 3ONAB 1PRTF 5GQOA 5FLXc 1K8GA 3G48A 4DV5L 1WTHA 4HJAA 1HCZA 2JA5B 3URYA 4YWKA 4JBWA 5IT9c 1BXTA 1VQGA 3DM3A 4XXEA 4MZ9A 4EQNA 4A3IB 1I4RA 3STBC 2OEOA 4LFCQ 4GNXC 2Z0SA 1GUSA 2F0UA 2FMMA 5C0XI 3K57A 4CDCC 2JA6G 5C3EB 4A3JH 4IALA 1EY8A 2E2IH 1QZHA 1YHBA 1WCMG 2F0EA 2QF7A 1QNUA 3NHHA 1EU3A 2I5LX 2F3VA 5IYCH 2R6GA 4R8NA 1UEAB 1I6HH 5ELFA 1D1IA 2VS1A 4OWWB 1XTDA 1AP0A 2K33A 1P8LA 3LWUA 3IRBA 1BCPD 5FLXE 1WTPA 1K73C 2X6LA 4CBVA 4Y52H 2JA5H 1K83B 1SYBA 1TQOA 2G9DA 5GADC 1RCVD 3JAMc 4A3BG 1S5ED 1IW7D 5M3MH 2RSNA 1A8VA 4YWMA 4DV2Q 4DR6Q 1H9JA 3QWNA 3R8BA 4ZAIA 2EZVA 4DAVA 3S1QH 3OWFA 2M00A 4K6LA 1RODA 3WOFA 1F2YA 3RZDB 3I2ZA 4K8JA 4ZKBB 2A5HA 1EEID 2JA8G 2Z6KC 4K5XA 3LGJA 3HOXG 4LMQD 2HD3A 4QL5A 1O78A 5IGCA 1K3RA 4JOIC 3O13A 2F0VA 5A2QL 4JI5Q 1PXUA 2CW0D 3U58A 4B3SQ 2A73B 3S2DB 4PMBA 5C5LA
chains in the Genus database with same CATH topology
3OTOL 1N36L 3KFUA 1N32Q 2VW9A 2N78A 1X6OA 1UE7A 2ID0A 1A63A 1XPOA 1A0IA 1TWFH 3F2CA 4HJ7A 3NELA 1K83H 1CKNA 3A5UA 2R7DA 1C0AA 1K8AC 2UU9Q 5IWAL 3M9BA 2LXJA 1JJCB 3MXNB 1DGSA 2LXKA 3I4MH 1QUQA 1T9HA 1Y1WG 2F4VL 3K81C 1HNXL 4WJ3M 1V9PA 1N33L 2MO1A 2WAQG 3S2HH 2AKWB 5IP9G 2QEXA 2ASBA 4GS3A 4A3DG 1UWVA 1VQBA 4LFAQ 5M5WH 4AQYQ 3CMEA 1AH9A 4DV0Q 1PV4A 4H02A 4DR7L 4P71A 4YWLA 2IX0A 4A75A 3I4OA 3GD7A 4DR4L 1E3PA 3ULLA 3PSIA 3U4VA 3BZKA 4A3IG 4A3JG 4LF7Q 2JQOA 2VY3A 3CCJA 1FJGL 2MO0A 3M4QA 1IBKL 3U50C 4DAYB 2V1CC 1Y14B 2ZTEA 4DV5Q 3PO3G 1YNXA 3J81c 1S40A 2E5LL 3CCEA 4R4QA 4UY8C 5FJ8H 4UPAA 1MJEA 2K14A 4A76A 1Q1EA 2QA4A 4KLKA 1HNWL 4JI4Q 1OXTA 2UUAL 4UP9A 3TQYA 4DV3Q 4BXXH 4QY7A 3KF6B 4GNXB 2Q2UA 2MNAA 2VQFQ 4X62L 2Q2TA 2HIXA 1CKNB 3HOUH 3PIOA 2NVTH 4OX9L 1Y1VG 3RLFA 1E24A 4YY3Q 3S2DH 3GTKH 1JT8A 2F3IA 3BU2A 2ZTDA 5IYBH 5LMUQ 4DR1Q 4JYAQ 4JI1Q 1QVCA 2ATWA 1BKBA 4A3BH 1SE8A 1XMQL 3KF6A 4EX5A 1I5FA 2VL6A 2XGTA 3FKIG 5IE8A 2JA6H 1VCIA 1PYBA 4DR2L 2JE6I 1JJ2A 2NZOA 3JAMi 3W1GA 3CCRA 4HIOA 1RIPA 3PF5A 1PH8A 4DPGA 2IX1A 3CCQA 1XNRQ 1Q1BA 3FHWA 4LFBQ 2N3SA 1VQCA 1PH2A 4GNXA 3PO2H 3S14H 3UE1A 4R4CA 4A3CH 4DNIA 3RLNA 2WP8J 4DR5Q 1IBLQ 4NXMQ 4LWCA 2UXDL 3GTJH 2QGQA 2OQ0A 4GLXA 2B63H 2R7ZH 4IFDI 2I5MX 5HGQA 1KL9A 2RF4A 3H0GG 1QZGA 1IZ6A 1IBKQ 1HNZL 1VQ7A 5IP7H 3OYYA 4JI2Q 2Z6KA 1N36Q 4BY7G 2E8GA 1I50H 5M3FG 1EQRA 4XIGS 3CCUA 2B29A 4JOIA 5E7NA 1YEZA 3UDIA 4OXPA 1YJWA 2Y0SG 1L2FA 4HJ5A 1N34L 1SROA 3L0OA 3J7ZC 2R7FA 4LUZA 2A19A 4BBRH 1TWHH 1IL2A 3K7AH 4A3GG 1WI5A 1HZAA 4A3FH 3K0XA 1VQEA 2UXCQ 1CKOA 1SRUA 1S72A 2YTVA 1XMQQ 3GTGH 1UE6A 4BBSH 4DKAC 4JI6L 1PA6A 2OQKA 2VQEL 1CUKA 4X66L 4JI7Q 2VUMH 3S1NH 3DLLA 2NN6G 1VS0A 2CFMA 2IHFA 4LUVA 5M3MG 1M90C 1NBWA 1H95A 1JE5A 3T1HQ 2UXCL 1N32L 4AH6A 4LF7L 1SMXA 1C7YA 1FGUA 4JG2A 1EIYB 4JI5L 1NMFA 3H3VH 1IXRA 5M5YH 5IYDG 1TWAH 4DV6Q 1YZ6A 2AMCB 3NENA 4MTNA 4LFBL 4LF5Q 1YJNA 4APVA 1S3OA 5C44H 1VQ6A 3CAMA 3BJUA 1GKHA 2ZJQA 1UE5A 5DLQE 2UUAQ 3HKSA 3GDEA 5GAEC 1YJ9A 1AE2A 2NVYH 4BXXG 2PMZE 4LW1A 3HOXH 1NTGA 1VQDA 1E22A 2YV5A 4IJLA 5C4JH 1YI2A 3PF4A 3I4MG 4WJ4A 1XJVA 1G51A 4YCWA 4QIWE 4X64Q 4C3HH 1KIXA 3CCSA 4DR4Q 3EIVA 1KD1C 1HR0L 4JC0A 5LMNQ 3S16H 1XPUA 2OTJA 4HJ8A 3KF8B 2Q2HA 2D62A 5JEAG 2NVQH 1Q82C 4B3TL 2Y0SE 4XTCS 2CQOA 3VDYA 1XPRA 1X56A 2OWOA 3CF5A 1PH3A 5M5XH 3KDFB 3PV0A 3NBHB 5IWAQ 1XMOL 4BA2I 2XTIA 1G6PA 5IP7G 1PHJA 3K80C 3U4ZA 3W1BA 4QGUA 1BVSA 1R9TH 4A3EG 3FP9A 2HQLA 2UU9L 4HIKA 5IP9H 4GN4B 2VQEQ 5C0XJ 3W5OA 1NJIC 3GTMH 4A3LG 4JV5Q 3PUZA 1HH2P 5LMUL 4DV0L 3CC2A 3EBEA 2WB1E 3M7NA 1MJCA 3S1RH 1EWIA 1FVIA 1NY4A 5BR8L 1OTCA 3OW2A 1V43A 3J80i 2UXBQ 2D0PA 1YIJA 4DV4L 2E2HH 4JI8L 3J80c 1XNRL 3H3VI 1L1OA 3SGIA 5FLMG 2E2JH 4IO9A 4OO1I 3FKIH 1PYSB 1X3EA 2LSSA 1Q8KA 3HFZB 1X55A 5IY0A 1Z9FA 3UDXA 2FXQA 4X64L 4JBKA 3UDGA 1K9MC 1VQHA 5GROA 3HOUG 4DV7L 4KHPQ 3AQQA 5IYDH 4FDBA 4A3FG 3J81j 4LNQA 3HOWH 2AHOB 2PI2A 4OX9Q 1SN8A 1Y1VH 1EQQA 1A62A 4HIMA 3GTOH 2UXDQ 4DUYQ 4JCVE 5IYBG 2VUMG 4Y7NH 1AE3A 4HIDA 2EXDA 1PFSA 2HHHQ 3AFQA 2F52A 1KAWA 1WOCA 4C3JH 3T1YL 2JA7G 1VQAA 4AYBG 4LF6L 5C4XG 2K75A 4JI0Q 4DUYL 2GN5A 1XNQQ 4GN5A 5AJ3L 4DV6L 3PCOB 1WFQA 4TVAB 3KDFA 4GLAC 5EAYA 3CCMA 3K7UC 1PH7A 1JJGA 3AYHB 3E9IA 4OO1G 2UUBQ 4GKKQ 4J15A 2ZM6L 4DUZL 2A1AA 2BH2A 1JMCA 3M3YH 4R4IA 3MEFA 4GLVB 1LUZA 1CSQA 2AWNA 4O2DA 3G6EA 1OXSC 2YTYA 2CWPA 4BBRG 4PZ7A 3RNUA 3I4NG 4ME3A 3CCLA 3E0EA 1XNQL 2KCTA 2R7ZG 2YYZA 4A3MG 1EIFA 2K50A 5HY6A 3TS0A 3L2PA 3G71A 4DK3C 1J5EQ 1C9OA 4DV3L 4OWTB 4P75A 4A3EH 1JB7A 3S15H 2RHSB 2ZJPA 4PG3A 4AYBE 4NXNL 1N33Q 2DUDA 3HKZE 2H5XA 2NZHA 1YITA 3F2DA 4X65Q 1X3FA 4GKJL 2ES2A 1VQOA 4K0KQ 2ZTCA 1PH4A 1VQMA 1HNZQ 3CP0A 2CCZA 3GTQH 1CKMA 4BA1I 4DR2Q 4JI1L 1GM5A 1LM0A 4JYAL 3ULPA 4A3GH 2KENA 2UUCQ 1WCMH 2R92G 4O0AA 4R1JA 3TEHB 1IBMQ 1EOVA 2N8NA 1FJGQ 2WAQE 2RHQB 3I55A 1B8AA 4BBSG 3KJPA 1SR3A 5FLMH 4PZ6A 1U5KA 4DR5L 5IYCG 3EN2A 4DR3Q 2HIVA 1TWGH 3CQZH 1VQPA 4GKJQ 1PVOA 2VQFL 1OXXK 5AJ3Q 1RL2A 1HNXQ 1SLJA 2N49A 3PUWA 3S24A 4DV4Q 4B3MQ 2JEAI 1HNWQ 1VQNA 3UDFA 4IOAA 1G291 1FL0A 3HOVG 1HZBA 1VQ8A 2HT1A 1YBYA 4L5QA 4YCUA 1Q7YC 1B7YB 2EQSA 4IPCA 4OONA 5LMNL 2NVXH 1X65A 1KC8C 1PH9A 1Q46A 2C35B 2YTXA 3A74A 2JA9A 4A93H 4KI0A 3CW2C 2ZM6Q 2JA5G 1VQJA 1KQSA 3BZCA 3PUVA 4DK6C 2WB1G 3J7A5 1W3SA 3TS2A 4P74A 4ALPA 1W2BA 4B3RL 3S17H 4DV7Q 2PQAA 4DR1L 3HOZG 2Q2IA 2JEBI 3OTOQ 1GO3E 5C4XH 1HJPA 1SFOH 2JA7H 5ELOA 2CKZB 1L0WA 4L5SA 2IT1A 3K8AA 1PH6A 4EQ5A 1N34Q 1VQ9A 1YVCA 3H15A 1IBLL 3HOWG 3S1MH 3D31A 4JI4L 4IFDG 1CSPA 1BBUA 3T1YQ 1MKHA 4A3KH 1ASYA 3PUYA 2R93H 3L7ZC 4YHHQ 3HKZG 4L5TA 4A3LH 2BA1A 3STBD 1J6QA 4C3IH 1U0LA 5BR8Q 4C2MH 1E1OA 3I4NH 1QUQB 1TXYA 2OCEA 1LTLA 4X66Q 2UUBL 4GKKL 3NEMA 4JI3L 4QJFA 3ER0A 4DUZQ 4P73A 2JK8A 4GOPB 3RZOH 1OXUA 3F2BA 2A8VA 2K5VA 1X54A 3PIPA 4YY3L 3CXCA 3CC4A 1PH5A 2IHEA 1VQKA 2KCMA 4B3SL 4X6AH 4DR7Q 3ERSX 4GOPC 4AQYL 1Q12A 4NB3A 1XMOQ 4LUOA 2VNUD 4PZ8A 1LYLA 4IFDJ 1D7QA 1IYJB 1B70B 5JEAJ 1UEBA 3RN2A 1KHIA 4B3ML 5K36G 2HHHL 4MNOA 1VQFA 5C3EG 3WWVA 3J81i 2E5LQ 4R4TA 2ZJRA 4JV5L 1L1OC 4QQBX 1WYDA 1PH1A 4B3RQ 1E1TA 1EUJA 1E7ZA 3A5ZB 1EFWA 3T1HL 3CD6A 1KXLA 4BY1H 2JA8H 4A3DH 1UE1A 3CPFA 4JI6Q 1QVGA 2UUCL 3AFPA 1N8RC 3G4SA 1I94Q 3KLWA 4JI7L 3HOYH 1KRTA 4UP8A 2YU9H 4LF4L 4P72A 3CMAA 4A3IH 5C0XG 4R4OA 4LF5L 1P16A 2NN6I 5J3BA 4POFA 4LF8Q 2KBNA 1D8LA 2BH8A 3M4OH 3ZJYC 4LF9Q 4TQUS 4L5RC 4PMWA 1J5EL 3M85A 1L1OB 2B3GA 2VZAA 4NPSA 4LF4Q 4JBJA 4DAMA 1V1QA 5GAHC 3PUXA 5GQOA 5FLXc 1K8GA 4KHZA 3G48A 3I7FA 1GD7A 4DV5L 2BA0A 4HJAA 4A3MH 4UP7A 4RMFA 4YCVA 4DV1Q 2I0QA 2AWOA 3JC66 2K5NA 3TREA 4AIMA 4YWKA 1Q86C 4DV2L 2I5HA 4JBWA 4JI3Q 1MIUA 2PQAB 1ASZA 5IT9c 1VQGA 3DM3A 3GO5A 4MZ9A 1NE3A 4NXML 1NMGA 3CC7A 2GVAA 3STBC 4A4IA 4LF6Q 4K0KL 1TWCH 2IY5B 4JI8Q 1VQLA 4LFCQ 4GNXC 4LFAL 5JJLA 2MFIA 2Z0SA 5C0XI 2B63G 4IOCA 5ELNA 2JA6G 1M1KC 3A0JA 4A3JH 2E2IH 3H0GH 1QZHA 3ICEA 1YHBA 1WCMG 2R92H 3PO3H 3E9HA 3GTLH 3GTPH 1GVPA 1HZCA 4JI2L 1OXVA 2MQHA 4IPGA 1Y1WH 4BY7H 5FJ8G 2I5LX 2D0OA 3RN5A 3AEVA 4KHPL 3RLOA 5IYCH 2R6GA 1YHQA 1I6HH 1I94L 3ULJA 2R93G 2VS1A 4OWWB 1HZ9A 1XTDA 2L15A 2OTLA 4X65L 4HJ9A 2GVBA 1P8LA 3IRBA 1X9NA 4IJHA 3TRZA 4JI0L 4DR6L 1YHAA 2PNHA 1K73C 1O7IA 4OWXB 2JJQA 1HR0W 2PI2E 1VQ5A 3I56A 4Y52H 1WJJA 2RCNA 2K5HA 4B3TQ 4A93G 1EYGA 2ALYB 3Q8DA 2JA5H 2UXBL 5GADC 2K4KA 3M4PA 5M3FH 3JAMc 1K0RA 4A3BG 3KYHC 3B6YA 3F8TA 3RZDH 5M3MH 2F4VQ 3KOJA 3HOZH 1A8VA 4DR3L 4YWMA 1N9WA 2K52A 4DV2Q 4DR6Q 4JBMA 3S1QH 5JJKA 5JJIA 3HOVH 3RR5A 4RG1A 4GOPA 4DV1L 5C3EH 3PGZA 2EIFA 5C44G 3UE0A 1VQIA 2CWAA 5H1SE 1BBWA 4YHHL 2KHIA 5GAGC 3I2ZA 3KJOA 4A3KG 1Q81C 1Z47A 4IPHA 4BY1G 2DGYA 2JA8G 2WFWA 2Z6KC 1KRSA 3LGJA 3D0FA 3CCVA 3HOXG 4LFCL 4X62Q 4LF8L 4NXNQ 3HOYG 1X3GA 4QL5A 4LF9L 3F1ZA 4GN3B 1I3QH 1K3RA 4JOIC 3CPWA 2KHJA 1QVFA 4POGA 1HR0Q 4IPDA 5LMNW 1IBML 4JI5Q 3U58A 4B3SQ 3PO2G 4A3CG 1VQ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OTO L;  1N36 L;  3KFU A;  1N32 Q;  2VW9 A;  2N78 A;  1X6O A;  1UE7 A;  2ID0 A;  1A63 A;  1XPO A;  1A0I A;  1TWF H;  3F2C A;  4HJ7 A;  3NEL A;  1K83 H;  1CKN A;  3A5U A;  2R7D A;  1C0A A;  1K8A C;  2UU9 Q;  5IWA L;  3M9B A;  2LXJ A;  1JJC B;  3MXN B;  1DGS A;  2LXK A;  3I4M H;  1QUQ A;  1T9H A;  1Y1W G;  2F4V L;  3K81 C;  1HNX L;  4WJ3 M;  1V9P A;  1N33 L;  2MO1 A;  2WAQ G;  3S2H H;  2AKW B;  5IP9 G;  2QEX A;  2ASB A;  4GS3 A;  4A3D G;  1UWV A;  1VQB A;  4LFA Q;  5M5W H;  4AQY Q;  3CME A;  1AH9 A;  4DV0 Q;  1PV4 A;  4H02 A;  4DR7 L;  4P71 A;  4YWL A;  2IX0 A;  4A75 A;  3I4O A;  3GD7 A;  4DR4 L;  1E3P A;  3ULL A;  3PSI A;  3U4V A;  3BZK A;  4A3I G;  4A3J G;  4LF7 Q;  2JQO A;  2VY3 A;  3CCJ A;  1FJG L;  2MO0 A;  3M4Q A;  1IBK L;  3U50 C;  4DAY B;  2V1C C;  1Y14 B;  2ZTE A;  4DV5 Q;  3PO3 G;  1YNX A;  3J81 c;  1S40 A;  2E5L L;  3CCE A;  4R4Q A;  4UY8 C;  5FJ8 H;  4UPA A;  1MJE A;  2K14 A;  4A76 A;  1Q1E A;  2QA4 A;  4KLK A;  1HNW L;  4JI4 Q;  1OXT A;  2UUA L;  4UP9 A;  3TQY A;  4DV3 Q;  4BXX H;  4QY7 A;  3KF6 B;  4GNX B;  2Q2U A;  2MNA A;  2VQF Q;  4X62 L;  2Q2T A;  2HIX A;  1CKN B;  3HOU H;  3PIO A;  2NVT H;  4OX9 L;  1Y1V G;  3RLF A;  1E24 A;  4YY3 Q;  3S2D H;  3GTK H;  1JT8 A;  2F3I A;  3BU2 A;  2ZTD A;  5IYB H;  5LMU Q;  4DR1 Q;  4JYA Q;  4JI1 Q;  1QVC A;  2ATW A;  1BKB A;  4A3B H;  1SE8 A;  1XMQ L;  3KF6 A;  4EX5 A;  1I5F A;  2VL6 A;  2XGT A;  3FKI G;  5IE8 A;  2JA6 H;  1VCI A;  1PYB A;  4DR2 L;  2JE6 I;  1JJ2 A;  2NZO A;  3JAM i;  3W1G A;  3CCR A;  4HIO A;  1RIP A;  3PF5 A;  1PH8 A;  4DPG A;  2IX1 A;  3CCQ A;  1XNR Q;  1Q1B A;  3FHW A;  4LFB Q;  2N3S A;  1VQC A;  1PH2 A;  4GNX A;  3PO2 H;  3S14 H;  3UE1 A;  4R4C A;  4A3C H;  4DNI A;  3RLN A;  2WP8 J;  4DR5 Q;  1IBL Q;  4NXM Q;  4LWC A;  2UXD L;  3GTJ H;  2QGQ A;  2OQ0 A;  4GLX A;  2B63 H;  2R7Z H;  4IFD I;  2I5M X;  5HGQ A;  1KL9 A;  2RF4 A;  3H0G G;  1QZG A;  1IZ6 A;  1IBK Q;  1HNZ L;  1VQ7 A;  5IP7 H;  3OYY A;  4JI2 Q;  2Z6K A;  1N36 Q;  4BY7 G;  2E8G A;  1I50 H;  5M3F G;  1EQR A;  4XIG S;  3CCU A;  2B29 A;  4JOI A;  5E7N A;  1YEZ A;  3UDI A;  4OXP A;  1YJW A;  2Y0S G;  1L2F A;  4HJ5 A;  1N34 L;  1SRO A;  3L0O A;  3J7Z C;  2R7F A;  4LUZ A;  2A19 A;  4BBR H;  1TWH H;  1IL2 A;  3K7A H;  4A3G G;  1WI5 A;  1HZA A;  4A3F H;  3K0X A;  1VQE A;  2UXC Q;  1CKO A;  1SRU A;  1S72 A;  2YTV A;  1XMQ Q;  3GTG H;  1UE6 A;  4BBS H;  4DKA C;  4JI6 L;  1PA6 A;  2OQK A;  2VQE L;  1CUK A;  4X66 L;  4JI7 Q;  2VUM H;  3S1N H;  3DLL A;  2NN6 G;  1VS0 A;  2CFM A;  2IHF A;  4LUV A;  5M3M G;  1M90 C;  1NBW A;  1H95 A;  1JE5 A;  3T1H Q;  2UXC L;  1N32 L;  4AH6 A;  4LF7 L;  1SMX A;  1C7Y A;  1FGU A;  4JG2 A;  1EIY B;  4JI5 L;  1NMF A;  3H3V H;  1IXR A;  5M5Y H;  5IYD G;  1TWA H;  4DV6 Q;  1YZ6 A;  2AMC B;  3NEN A;  4MTN A;  4LFB L;  4LF5 Q;  1YJN A;  4APV A;  1S3O A;  5C44 H;  1VQ6 A;  3CAM A;  3BJU A;  1GKH A;  2ZJQ A;  1UE5 A;  5DLQ E;  2UUA Q;  3HKS A;  3GDE A;  5GAE C;  1YJ9 A;  1AE2 A;  2NVY H;  4BXX G;  2PMZ E;  4LW1 A;  3HOX H;  1NTG A;  1VQD A;  1E22 A;  2YV5 A;  4IJL A;  5C4J H;  1YI2 A;  3PF4 A;  3I4M G;  4WJ4 A;  1XJV A;  1G51 A;  4YCW A;  4QIW E;  4X64 Q;  4C3H H;  1KIX A;  3CCS A;  4DR4 Q;  3EIV A;  1KD1 C;  1HR0 L;  4JC0 A;  5LMN Q;  3S16 H;  1XPU A;  2OTJ A;  4HJ8 A;  3KF8 B;  2Q2H A;  2D62 A;  5JEA G;  2NVQ H;  1Q82 C;  4B3T L;  2Y0S E;  4XTC S;  2CQO A;  3VDY A;  1XPR A;  1X56 A;  2OWO A;  3CF5 A;  1PH3 A;  5M5X H;  3KDF B;  3PV0 A;  3NBH B;  5IWA Q;  1XMO L;  4BA2 I;  2XTI A;  1G6P A;  5IP7 G;  1PHJ A;  3K80 C;  3U4Z A;  3W1B A;  4QGU A;  1BVS A;  1R9T H;  4A3E G;  3FP9 A;  2HQL A;  2UU9 L;  4HIK A;  5IP9 H;  4GN4 B;  2VQE Q;  5C0X J;  3W5O A;  1NJI C;  3GTM H;  4A3L G;  4JV5 Q;  3PUZ A;  1HH2 P;  5LMU L;  4DV0 L;  3CC2 A;  3EBE A;  2WB1 E;  3M7N A;  1MJC A;  3S1R H;  1EWI A;  1FVI A;  1NY4 A;  5BR8 L;  1OTC A;  3OW2 A;  1V43 A;  3J80 i;  2UXB Q;  2D0P A;  1YIJ A;  4DV4 L;  2E2H H;  4JI8 L;  3J80 c;  1XNR L;  3H3V I;  1L1O A;  3SGI A;  5FLM G;  2E2J H;  4IO9 A;  4OO1 I;  3FKI H;  1PYS B;  1X3E A;  2LSS A;  1Q8K A;  3HFZ B;  1X55 A;  5IY0 A;  1Z9F A;  3UDX A;  2FXQ A;  4X64 L;  4JBK A;  3UDG A;  1K9M C;  1VQH A;  5GRO A;  3HOU G;  4DV7 L;  4KHP Q;  3AQQ A;  5IYD H;  4FDB A;  4A3F G;  3J81 j;  4LNQ A;  3HOW H;  2AHO B;  2PI2 A;  4OX9 Q;  1SN8 A;  1Y1V H;  1EQQ A;  1A62 A;  4HIM A;  3GTO H;  2UXD Q;  4DUY Q;  4JCV E;  5IYB G;  2VUM G;  4Y7N H;  1AE3 A;  4HID A;  2EXD A;  1PFS A;  2HHH Q;  3AFQ A;  2F52 A;  1KAW A;  1WOC A;  4C3J H;  3T1Y L;  2JA7 G;  1VQA A;  4AYB G;  4LF6 L;  5C4X G;  2K75 A;  4JI0 Q;  4DUY L;  2GN5 A;  1XNQ Q;  4GN5 A;  5AJ3 L;  4DV6 L;  3PCO B;  1WFQ A;  4TVA B;  3KDF A;  4GLA C;  5EAY A;  3CCM A;  3K7U C;  1PH7 A;  1JJG A;  3AYH B;  3E9I A;  4OO1 G;  2UUB Q;  4GKK Q;  4J15 A;  2ZM6 L;  4DUZ L;  2A1A A;  2BH2 A;  1JMC A;  3M3Y H;  4R4I A;  3MEF A;  4GLV B;  1LUZ A;  1CSQ A;  2AWN A;  4O2D A;  3G6E A;  1OXS C;  2YTY A;  2CWP A;  4BBR G;  4PZ7 A;  3RNU A;  3I4N G;  4ME3 A;  3CCL A;  3E0E A;  1XNQ L;  2KCT A;  2R7Z G;  2YYZ A;  4A3M G;  1EIF A;  2K50 A;  5HY6 A;  3TS0 A;  3L2P A;  3G71 A;  4DK3 C;  1J5E Q;  1C9O A;  4DV3 L;  4OWT B;  4P75 A;  4A3E H;  1JB7 A;  3S15 H;  2RHS B;  2ZJP A;  4PG3 A;  4AYB E;  4NXN L;  1N33 Q;  2DUD A;  3HKZ E;  2H5X A;  2NZH A;  1YIT A;  3F2D A;  4X65 Q;  1X3F A;  4GKJ L;  2ES2 A;  1VQO A;  4K0K Q;  2ZTC A;  1PH4 A;  1VQM A;  1HNZ Q;  3CP0 A;  2CCZ A;  3GTQ H;  1CKM A;  4BA1 I;  4DR2 Q;  4JI1 L;  1GM5 A;  1LM0 A;  4JYA L;  3ULP A;  4A3G H;  2KEN A;  2UUC Q;  1WCM H;  2R92 G;  4O0A A;  4R1J A;  3TEH B;  1IBM Q;  1EOV A;  2N8N A;  1FJG Q;  2WAQ E;  2RHQ B;  3I55 A;  1B8A A;  4BBS G;  3KJP A;  1SR3 A;  5FLM H;  4PZ6 A;  1U5K A;  4DR5 L;  5IYC G;  3EN2 A;  4DR3 Q;  2HIV A;  1TWG H;  3CQZ H;  1VQP A;  4GKJ Q;  1PVO A;  2VQF L;  1OXX K;  5AJ3 Q;  1RL2 A;  1HNX Q;  1SLJ A;  2N49 A;  3PUW A;  3S24 A;  4DV4 Q;  4B3M Q;  2JEA I;  1HNW Q;  1VQN A;  3UDF A;  4IOA A;  1G29 1;  1FL0 A;  3HOV G;  1HZB A;  1VQ8 A;  2HT1 A;  1YBY A;  4L5Q A;  4YCU A;  1Q7Y C;  1B7Y B;  2EQS A;  4IPC A;  4OON A;  5LMN L;  2NVX H;  1X65 A;  1KC8 C;  1PH9 A;  1Q46 A;  2C35 B;  2YTX A;  3A74 A;  2JA9 A;  4A93 H;  4KI0 A;  3CW2 C;  2ZM6 Q;  2JA5 G;  1VQJ A;  1KQS A;  3BZC A;  3PUV A;  4DK6 C;  2WB1 G;  3J7A 5;  1W3S A;  3TS2 A;  4P74 A;  4ALP A;  1W2B A;  4B3R L;  3S17 H;  4DV7 Q;  2PQA A;  4DR1 L;  3HOZ G;  2Q2I A;  2JEB I;  3OTO Q;  1GO3 E;  5C4X H;  1HJP A;  1SFO H;  2JA7 H;  5ELO A;  2CKZ B;  1L0W A;  4L5S A;  2IT1 A;  3K8A A;  1PH6 A;  4EQ5 A;  1N34 Q;  1VQ9 A;  1YVC A;  3H15 A;  1IBL L;  3HOW G;  3S1M H;  3D31 A;  4JI4 L;  4IFD G;  1CSP A;  1BBU A;  3T1Y Q;  1MKH A;  4A3K H;  1ASY A;  3PUY A;  2R93 H;  3L7Z C;  4YHH Q;  3HKZ G;  4L5T A;  4A3L H;  2BA1 A;  3STB D;  1J6Q A;  4C3I H;  1U0L A;  5BR8 Q;  4C2M H;  1E1O A;  3I4N H;  1QUQ B;  1TXY A;  2OCE A;  1LTL A;  4X66 Q;  2UUB L;  4GKK L;  3NEM A;  4JI3 L;  4QJF A;  3ER0 A;  4DUZ Q;  4P73 A;  2JK8 A;  4GOP B;  3RZO H;  1OXU A;  3F2B A;  2A8V A;  2K5V A;  1X54 A;  3PIP A;  4YY3 L;  3CXC A;  3CC4 A;  1PH5 A;  2IHE A;  1VQK A;  2KCM A;  4B3S L;  4X6A H;  4DR7 Q;  3ERS X;  4GOP C;  4AQY L;  1Q12 A;  4NB3 A;  1XMO Q;  4LUO A;  2VNU D;  4PZ8 A;  1LYL A;  4IFD J;  1D7Q A;  1IYJ B;  1B70 B;  5JEA J;  1UEB A;  3RN2 A;  1KHI A;  4B3M L;  5K36 G;  2HHH L;  4MNO A;  1VQF A;  5C3E G;  3WWV A;  3J81 i;  2E5L Q;  4R4T A;  2ZJR A;  4JV5 L;  1L1O C;  4QQB X;  1WYD A;  1PH1 A;  4B3R Q;  1E1T A;  1EUJ A;  1E7Z A;  3A5Z B;  1EFW A;  3T1H L;  3CD6 A;  1KXL A;  4BY1 H;  2JA8 H;  4A3D H;  1UE1 A;  3CPF A;  4JI6 Q;  1QVG A;  2UUC L;  3AFP A;  1N8R C;  3G4S A;  1I94 Q;  3KLW A;  4JI7 L;  3HOY H;  1KRT A;  4UP8 A;  2YU9 H;  4LF4 L;  4P72 A;  3CMA A;  4A3I H;  5C0X G;  4R4O A;  4LF5 L;  1P16 A;  2NN6 I;  5J3B A;  4POF A;  4LF8 Q;  2KBN A;  1D8L A;  2BH8 A;  3M4O H;  3ZJY C;  4LF9 Q;  4TQU S;  4L5R C;  4PMW A;  1J5E L;  3M85 A;  1L1O B;  2B3G A;  2VZA A;  4NPS A;  4LF4 Q;  4JBJ A;  4DAM A;  1V1Q A;  5GAH C;  3PUX A;  5GQO A;  5FLX c;  1K8G A;  4KHZ A;  3G48 A;  3I7F A;  1GD7 A;  4DV5 L;  2BA0 A;  4HJA A;  4A3M H;  4UP7 A;  4RMF A;  4YCV A;  4DV1 Q;  2I0Q A;  2AWO A;  3JC6 6;  2K5N A;  3TRE A;  4AIM A;  4YWK A;  1Q86 C;  4DV2 L;  2I5H A;  4JBW A;  4JI3 Q;  1MIU A;  2PQA B;  1ASZ A;  5IT9 c;  1VQG A;  3DM3 A;  3GO5 A;  4MZ9 A;  1NE3 A;  4NXM L;  1NMG A;  3CC7 A;  2GVA A;  3STB C;  4A4I A;  4LF6 Q;  4K0K L;  1TWC H;  2IY5 B;  4JI8 Q;  1VQL A;  4LFC Q;  4GNX C;  4LFA L;  5JJL A;  2MFI A;  2Z0S A;  5C0X I;  2B63 G;  4IOC A;  5ELN A;  2JA6 G;  1M1K C;  3A0J A;  4A3J H;  2E2I H;  3H0G H;  1QZH A;  3ICE A;  1YHB A;  1WCM G;  2R92 H;  3PO3 H;  3E9H A;  3GTL H;  3GTP H;  1GVP A;  1HZC A;  4JI2 L;  1OXV A;  2MQH A;  4IPG A;  1Y1W H;  4BY7 H;  5FJ8 G;  2I5L X;  2D0O A;  3RN5 A;  3AEV A;  4KHP L;  3RLO A;  5IYC H;  2R6G A;  1YHQ A;  1I6H H;  1I94 L;  3ULJ A;  2R93 G;  2VS1 A;  4OWW B;  1HZ9 A;  1XTD A;  2L15 A;  2OTL A;  4X65 L;  4HJ9 A;  2GVB A;  1P8L A;  3IRB A;  1X9N A;  4IJH A;  3TRZ A;  4JI0 L;  4DR6 L;  1YHA A;  2PNH A;  1K73 C;  1O7I A;  4OWX B;  2JJQ A;  1HR0 W;  2PI2 E;  1VQ5 A;  3I56 A;  4Y52 H;  1WJJ A;  2RCN A;  2K5H A;  4B3T Q;  4A93 G;  1EYG A;  2ALY B;  3Q8D A;  2JA5 H;  2UXB L;  5GAD C;  2K4K A;  3M4P A;  5M3F H;  3JAM c;  1K0R A;  4A3B G;  3KYH C;  3B6Y A;  3F8T A;  3RZD H;  5M3M H;  2F4V Q;  3KOJ A;  3HOZ H;  1A8V A;  4DR3 L;  4YWM A;  1N9W A;  2K52 A;  4DV2 Q;  4DR6 Q;  4JBM A;  3S1Q H;  5JJK A;  5JJI A;  3HOV H;  3RR5 A;  4RG1 A;  4GOP A;  4DV1 L;  5C3E H;  3PGZ A;  2EIF A;  5C44 G;  3UE0 A;  1VQI A;  2CWA A;  5H1S E;  1BBW A;  4YHH L;  2KHI A;  5GAG C;  3I2Z A;  3KJO A;  4A3K G;  1Q81 C;  1Z47 A;  4IPH A;  4BY1 G;  2DGY A;  2JA8 G;  2WFW A;  2Z6K C;  1KRS A;  3LGJ A;  3D0F A;  3CCV A;  3HOX G;  4LFC L;  4X62 Q;  4LF8 L;  4NXN Q;  3HOY G;  1X3G A;  4QL5 A;  4LF9 L;  3F1Z A;  4GN3 B;  1I3Q H;  1K3R A;  4JOI C;  3CPW A;  2KHJ A;  1QVF A;  4POG A;  1HR0 Q;  4IPD A;  5LMN W;  1IBM L;  4JI5 Q;  3U58 A;  4B3S Q;  3PO2 G;  4A3C G;  1VQ4 A; 
#chains in the Genus database with same CATH topology
 3KFU A;  1N32 Q;  2ID0 A;  4G7O C;  5BN3 A;  4QF4 A;  1VDZ A;  5CV5 A;  2PW5 A;  2UU9 Q;  2O2L D;  5IWA L;  3M9B A;  1EZ6 A;  1L0X B;  1JJC B;  1JOO A;  2LXK A;  4LAA A;  1GUT A;  1Y1W G;  4RFB A;  3ZYY X;  2MO1 A;  2EJF C;  2F0J A;  2RCF A;  3S2H H;  5IP9 G;  3OSO A;  2QEX A;  2ASB A;  1H9R A;  4XQJ A;  5M5W H;  3I91 A;  1AH9 A;  1PV4 A;  5DM6 3;  4YWL A;  2IX0 A;  3EJI A;  3I4O A;  4A75 A;  2KUM A;  4PNY A;  4LF7 Q;  3BZK A;  4A3I G;  1FJG L;  2VY3 A;  4DAY B;  3PO3 G;  4DAP A;  2ZTE A;  5C5M A;  3J81 c;  4R4Q A;  2QA4 A;  4KLK A;  4IUQ A;  4F87 A;  1OXT A;  1VMC A;  4BXX H;  4DV3 Q;  3KF6 B;  4GNX B;  2MNA A;  2VQF Q;  4X62 L;  2HIX A;  1CKN B;  2E75 C;  3PIO A;  4KMU C;  2WB1 B;  1AEX A;  1SE4 A;  2F0G A;  4OEL B;  3S1N B;  2VB2 X;  1RKN A;  2ATW A;  1QVC A;  1XMQ L;  1I5F A;  2VL6 A;  2L4N A;  3A56 A;  5IE8 A;  2X6G A;  1PYB A;  4RCO A;  3JAM i;  4ILW A;  2XRQ D;  3V96 A;  1ICF B;  1ET9 A;  3E3X A;  4A3C H;  4DF7 A;  4B08 A;  2B2W A;  1SAP A;  1F9P A;  4XDX A;  3RLN A;  3OIQ A;  4NMZ A;  3T4A C;  2B39 A;  4Y7N B;  4GLX A;  2B63 H;  2R7Z H;  2Z9H A;  4IFD I;  1KL9 A;  1KLU D;  1CHQ D;  3MWY W;  2B29 A;  4IUT A;  5FOB B;  3D3R A;  1CT1 D;  2A19 A;  2EY5 A;  4FO2 A;  3VR2 A;  1GUO A;  1VQE A;  1SRU A;  2MPM A;  1UE6 A;  3CKI B;  1L0Y B;  4KY5 A;  4U67 3;  5A2Q E;  3S14 B;  2CFM A;  3CU7 A;  1JE5 A;  3T1H Q;  2JA7 B;  1N32 L;  1I4X A;  4AH6 A;  3FDT A;  5C4X B;  1EIY B;  3OMG A;  2AMC B;  2KED A;  1PZJ D;  4X3K A;  1YJN A;  1VQ6 A;  1IHZ A;  3HZX A;  3X3N A;  2ZJQ A;  3HOU B;  3GDE A;  4P2C B;  1MHW C;  3K5M A;  1NTG A;  4KJN A;  3PF4 A;  2YV5 A;  5C4J H;  1XJV A;  1PTO D;  1TKW B;  5KYI A;  4QIW E;  3CCS A;  2VXW A;  4HMJ A;  3Q23 A;  1KLG D;  2EYF A;  2MGS A;  1XPU A;  3KF8 B;  3NQI A;  2Q2H A;  2QW7 A;  1I4Q A;  4CDD C;  1STE A;  2Y0S E;  5KEE A;  5JVG 3;  2Z8L A;  1S5C D;  3S1R B;  1XMO L;  1PHJ A;  3U4Z A;  1HTL D;  1R9T H;  1BVS A;  4KKT A;  2HQL A;  1LO5 D;  1E2W A;  1LAB A;  4HIK A;  5IP9 H;  1SYD A;  1GUN A;  1HRJ A;  3J81 L;  4JV5 Q;  2KJX A;  2A69 C;  2OT2 A;  3EBE A;  4MIU A;  2PW7 A;  1NY4 A;  2UXB Q;  1YIJ A;  2PO4 A;  4XYQ A;  2DY8 A;  5J1Z A;  5CC4 A;  2E2H H;  1XNR L;  2EDG A;  2JP1 A;  1PZI D;  1PYS B;  1Q8K A;  1SBB B;  2P5Z X;  5AFW A;  3NWS A;  1TII D;  5IYD H;  5GRO A;  1ONL A;  1II3 A;  3HS0 C;  2PI2 A;  1SN8 A;  1Y1V H;  4HCS A;  4HIM A;  4WRD A;  2EXZ A;  3A55 A;  1SYC A;  2K01 A;  3KLS A;  2R92 B;  2NWG A;  4DUY L;  1MI2 A;  1QG7 A;  4GN5 A;  5AJ3 L;  4G4K A;  5C3W A;  2RDF A;  3I72 A;  2NVT B;  4WJW A;  1VQ4 A;  3EVQ A;  1Z7T A;  4DUZ L;  3M3Y H;  5FO9 B;  5M5X B;  2RDG A;  2A74 C;  4RH6 A;  2AWN A;  4O2D A;  3F2U A;  4RAU C;  3I4N G;  3CCL A;  4L6T B;  2KCT A;  2QIL A;  4A3M G;  1EIF A;  4N9P A;  5HY6 A;  1STH A;  5HGT A;  3G71 A;  3I4N B;  2RVL A;  4HED A;  3EFX D;  5M3F B;  4AYB E;  1KAB A;  1SXT A;  1YIT A;  2NZH A;  1GXD C;  1CA5 A;  1VQO A;  2BDN A;  2ZTC A;  5BN5 A;  1PH4 A;  3CP0 A;  1HNZ Q;  3D4R A;  2B2Y C;  1GM5 A;  2Z1C A;  2KEN A;  2F0Q A;  1SE3 A;  3E0J A;  2R92 G;  4O0A A;  2RHQ B;  1B8A A;  2O4X A;  2SOB A;  3J7A F;  4G57 A;  5IYC G;  1D5X C;  4IN3 A;  3CQZ H;  4GKJ Q;  3NTI A;  1RL2 A;  4ZUJ A;  3PUW A;  4DV4 Q;  3S17 B;  1QWY A;  4KN7 C;  2JEA I;  3UDF A;  4IOA A;  1F9Q A;  1G29 1;  1SFO B;  4L5Q A;  3C1E A;  1B7Y B;  5LMN L;  1XWE A;  1MSH A;  2YTX A;  4A93 H;  2JA5 G;  4XYO A;  3BZC A;  3DXJ C;  1SNC A;  4A3K B;  3M4O B;  2CQA A;  2PQA A;  4DR1 L;  3HOZ G;  2Q2I A;  3BS1 A;  5C4X H;  2JA7 H;  1HJP A;  2EOT A;  2CKZ B;  1NCV A;  4XT3 B;  5TSS A;  1PH6 A;  1D1K A;  2EY6 A;  1IBL L;  1BBU A;  4QUC A;  1HHV A;  3PUY A;  1UAP A;  1PYW D;  3L7Z C;  4A3L H;  3HKZ G;  2R93 H;  1MBY A;  4NDX A;  3E5S A;  4A93 B;  1M8A A;  5BR8 Q;  3I4N H;  1QUQ B;  3H94 A;  1AFP A;  1BCP F;  4M8A A;  1EWH A;  4X3S A;  5CBA E;  4JI3 L;  3PQI A;  4DUZ Q;  1J9O A;  1BO0 A;  3H0G B;  3PIP A;  1X54 A;  4X6A H;  1GHJ A;  1U4P A;  3NP8 A;  1PMR A;  4NB3 A;  3BYY B;  1D7Q A;  1B1Z A;  1S5F D;  1K0S A;  4C1N K;  3RN2 A;  1KHI A;  5I2X A;  1VMP A;  1RF2 D;  1VQF A;  2E5L Q;  2RKS A;  5D65 A;  4QQB X;  4C1N I;  3BVZ A;  4IUP A;  1E7Z A;  4KJO A;  1EFW A;  3HP3 A;  3CD6 A;  1KXL A;  3H91 A;  1UE1 A;  2Q8I B;  2KHS A;  3DMU A;  3G4S A;  1I94 Q;  3QG1 A;  2A68 D;  3I8Z A;  4P72 A;  5C0X G;  1P16 A;  4LF8 Q;  3M4O H;  1LTS D;  4LF9 Q;  4C56 C;  1LT5 D;  1J5E L;  3M85 A;  1ENA A;  2B2Y A;  1L1O B;  1U4R A;  1DON A;  3RZO B;  1DOL A;  1V1Q A;  3RUZ A;  3CHB D;  5GAH C;  3VYR A;  4H7B A;  2BA0 A;  3AU7 A;  4YCV A;  2I0Q A;  2K5N A;  2N88 A;  4DV2 L;  2I5H A;  1MIU A;  2PQA B;  4KV6 A;  3PO3 B;  4IFD H;  2YU9 B;  3PMF A;  1NE3 A;  1H9S A;  1NMG A;  2B2T C;  4K0K L;  3I4L A;  2KVM A;  1TWC H;  5JJL A;  1KDA A;  2G9H D;  3VA7 A;  4LFA L;  5IOC A;  1FNU A;  5ELN A;  4J6H A;  5I6Y A;  3H0G H;  4DU9 A;  1S5B D;  1GVP A;  1HZC A;  1OXV A;  4BY7 H;  5FJ8 G;  2D0O A;  3RLO A;  1PZK D;  1ESF A;  3OW7 A;  1YHQ A;  1I94 L;  3OOC A;  3ULJ A;  4ODG A;  2L15 A;  4RGN A;  2HUG A;  2RQX A;  4HJ9 A;  4O1N A;  4M1U B;  1ET6 A;  2BOS A;  4DR6 L;  5K36 H;  2B2T A;  1TY0 A;  4OWX B;  1HR0 W;  4WFN 3;  2K5H A;  4A93 G;  1CZW A;  2Y0S B;  2ALY B;  3Q8D A;  1SEB D;  3M4P A;  4FF2 A;  3MA2 B;  2ZXP A;  3B6Y A;  3KYH C;  3RZD H;  2C5C A;  3FEW X;  3R2I A;  2KEE A;  1XYI A;  4BY7 B;  2K52 A;  4JBM A;  1PTO B;  5JJK A;  5JJI A;  3HOV H;  2AQ3 B;  4RG1 A;  1D6E C;  4CKE A;  5C6A A;  5M9O A;  3LWE A;  3UE0 A;  1SSO A;  4YHH L;  1BBW A;  1Z6H A;  2XWB B;  4RHR A;  4OIJ A;  4IPH A;  4C2M B;  2DGY A;  4H13 C;  4HCE A;  1KRS A;  2NUC A;  4X3T A;  5I9P A;  3CCV A;  4GN3 B;  1I3Q H;  3KUP A;  4C3H G;  1QVF A;  4POG A;  1HR0 Q;  3SK5 A;  3GV3 A;  3OTO L;  3OWE B;  1MD2 D;  1X6O A;  3GQB A;  1UE7 A;  1A63 A;  1XPO A;  1TWF H;  3F2C A;  1DD2 A;  1C0A A;  1K8A C;  4FYD A;  2LXJ A;  2SNM A;  1DGS A;  1QUQ A;  1CZG A;  1T9H A;  4G7Z C;  2WAQ G;  2AKW B;  1JOR A;  2NN6 H;  4A3D G;  5IT9 L;  5EBC A;  3OMC A;  3UI2 A;  4H02 A;  1KNE A;  3GD7 A;  1E3P A;  2SNS A;  3PSI A;  3U4V A;  4A3J G;  3M4Q A;  1IBK L;  2ENB A;  1A6X A;  1YNX A;  4EQO A;  2E5L L;  1PFM A;  5FJ8 H;  1QIL A;  3TDQ A;  1NUC A;  4K2K A;  1MJE A;  4ZRZ A;  1Q1E A;  4TSS A;  1HNW L;  1E0B A;  1V8Q A;  1HQR D;  3TQY A;  1DJR D;  3NWT A;  5KRU A;  4G7H C;  1E2Z A;  4HSV A;  2KCC A;  2X69 A;  3AB9 A;  3GP7 A;  4IUR A;  2K03 A;  2G5D A;  1Y1V G;  2I46 A;  1E24 A;  2A69 D;  3GTK H;  2VUM B;  2F3I A;  3MFY A;  4JYA Q;  4JI1 Q;  1EQV A;  1BKB A;  4EX5 A;  3Q0A A;  3P1H A;  2JA6 H;  2B8G A;  3AMU A;  3FKI B;  3CCR A;  5M5Y B;  1RIP A;  2IX1 A;  2JYO A;  3K0Y A;  4LFB Q;  4PV1 C;  2MP1 A;  1PH2 A;  4GNX A;  3PO2 H;  3S14 H;  3UE1 A;  4R4C A;  1F2Z A;  1X3Q A;  4DR5 Q;  1EY5 A;  5CV8 A;  2R3Z A;  4CKB A;  2RF4 A;  4CHT B;  1QZG A;  1IZ6 A;  1PTO C;  2JA6 B;  1BQQ T;  5IP7 H;  2Z6K A;  1T5E A;  1N36 Q;  4BY7 G;  5JVH 3;  1FD7 D;  2FMC A;  1EQR A;  4XIG S;  4ZCK A;  3CCU A;  4JOI A;  1YJW A;  2Y0S G;  2WIN B;  1SRO A;  3L0O A;  1TWH H;  2QDB A;  3K7A H;  4A3G G;  5DAU A;  5EPL A;  2TMP A;  2OF1 A;  2OQK A;  3L9A X;  1CUK A;  4X66 L;  1RDP D;  1PFN A;  4JI7 Q;  3S1N H;  3DLL A;  2NN6 G;  1VS0 A;  2IHF A;  4LUV A;  2PQE A;  1M90 C;  1H95 A;  2EYP A;  2PZU A;  3R93 A;  1ZEQ X;  3KLS X;  2NVY B;  4H0L C;  3WDN A;  2K28 A;  2DNE A;  1SMX A;  5A35 A;  4JG2 A;  4EGV A;  4JI5 L;  1NMF A;  1NR2 A;  3T51 B;  3S9W A;  1WTX A;  4DV6 Q;  3NEN A;  4MTN A;  2AUJ D;  2HQE A;  2F0K A;  3CAM A;  3BJU A;  5DLQ E;  4V19 0;  5GAE C;  1YJ9 A;  3D8G A;  1GUG A;  3H6M A;  1E22 A;  2E2H B;  4FF1 A;  3K59 A;  4UDU C;  1KD1 C;  1HR0 L;  5LMN Q;  1BCP B;  5D3D A;  3MTS A;  4OHJ A;  2Z4I A;  1Q82 C;  1RTN A;  1TS4 A;  4XTC S;  2K5D A;  3GTM B;  2IPK D;  2OWO A;  4DNT B;  4HMI A;  3CF5 A;  5M5X H;  1I3Q B;  3KDF B;  1NAP A;  1G6P A;  5IP7 G;  1NSN S;  3DM1 A;  3W1B A;  4A3E G;  1S5D D;  2KQ3 A;  1LAC A;  3K5L A;  1EYC A;  3VR5 A;  3W5O A;  1NJI C;  2LMC B;  3QO2 A;  3CC2 A;  5KYL A;  2WB1 E;  3D4W A;  3M7N A;  4C3I B;  3D4D A;  1EWI A;  1FVI A;  5ELE A;  5BR8 L;  1H9S B;  1LT4 D;  4FP5 D;  1B2T A;  5JOB A;  2F03 A;  3H3V I;  2FIN B;  4N8X 1;  1LTT D;  1SYE A;  5I6W A;  3HFZ B;  5IY0 A;  1Z9F A;  2FXQ A;  4JBK A;  3UDG A;  1SNQ A;  4RHS A;  1K9M C;  3Q22 A;  4DV7 L;  3AQQ A;  4FDB A;  3JAM L;  2AHO B;  2LKV A;  5ELC A;  1DOM A;  3L3O C;  3MEH A;  2XNA C;  3GTO H;  2UXD Q;  1IYV A;  4DUY Q;  2B8F A;  5IYB G;  1U9R A;  2VUM G;  4Y7N H;  3C46 A;  2EXD A;  2HHH Q;  1FYC A;  3AFQ A;  2F52 A;  3SVM A;  1KAW A;  2JA8 B;  3T1Y L;  3V2T A;  4ZUI A;  2K75 A;  4JI0 Q;  1LT6 D;  3NBI A;  1XNQ Q;  4DV6 L;  1PH7 A;  5I4D A;  3BYT B;  3E9I A;  4MHE A;  4DA2 A;  5IT9 E;  2UUB Q;  4J15 A;  2OXP A;  1JMC A;  4R4I A;  1LUZ A;  1CSQ A;  3NTH A;  2CWP A;  4PZ7 A;  2CVR A;  2CW0 C;  2R7Z G;  3TS0 A;  3HRZ C;  4A3M B;  4A3E H;  1JB7 A;  3S15 H;  2RHS B;  3HKZ E;  2H5X A;  3F2D A;  1B50 A;  2EYO A;  1T5X D;  1X3F A;  2ES2 A;  4K0K Q;  1UNS A;  2CCZ A;  1LM0 A;  5K5P A;  5LL6 S;  4JYA L;  3ULP A;  4AYB B;  4K5V A;  4R1J A;  5ELD A;  3TEH B;  1EOV A;  2N8N A;  2WAQ E;  2XN9 C;  1VQP A;  3EN2 A;  3I3C A;  1JC7 A;  1IW7 C;  3TP8 A;  1F2M A;  1OXX K;  3BDL A;  5AJ3 Q;  3K58 A;  1HNX Q;  3S24 A;  3NPP A;  3NXW A;  4K8I A;  3S1M B;  1HNW Q;  3U9O A;  1VQN A;  4C3H B;  1FNV A;  1HZB A;  1TWH B;  4IQZ A;  4YCU A;  1Q7Y C;  1KTK A;  2EQS A;  1B4O A;  1BCP C;  1W6K A;  5JPM C;  4L63 B;  4IZ8 A;  2C9O A;  2C35 B;  3QB3 A;  4KI0 A;  3CW2 C;  2ZM6 Q;  1KQS A;  3PUV A;  2NVQ B;  2NYZ D;  3TS2 A;  4ALP A;  4B3R L;  4QCL A;  3W2D A;  4DV7 Q;  4FXK C;  5M3M B;  2ICE C;  3OTO Q;  5L37 A;  5ELO A;  1UUP A;  1AZQ A;  5T1I A;  1CA6 A;  2IJ0 A;  2IT1 A;  1E2V A;  4EQ5 A;  3H15 A;  3D31 A;  4JVZ A;  2BE5 C;  3T1Y Q;  1MKH A;  1ASY A;  4DN4 M;  4YHH Q;  3STB D;  1J6Q A;  2SDF A;  2IWH A;  1E1O A;  3DWA A;  5NUC A;  2J4X A;  4X66 Q;  2QCP X;  2O5J C;  3NEM A;  2HDL A;  2H4O A;  4FXD A;  2L11 A;  1G2T A;  2NBF A;  2JK8 A;  4P73 A;  4GOP B;  1OXU A;  3RZO H;  4A3D B;  2A8V A;  3CXC A;  4YY3 L;  1PH5 A;  1BR9 A;  4YIJ A;  2KCM A;  4AQY L;  4N9T A;  1WTQ A;  5EBD A;  1XMO Q;  4LUO A;  4PZ8 A;  1LYL A;  5E1F A;  2CH4 W;  1G8Z D;  1C8C A;  3NBH A;  4FXG C;  1A3U A;  2QEJ C;  1WYD A;  1HPC A;  3KK7 A;  4B3R Q;  4ZKC B;  3A5Z B;  3I70 A;  3T1H L;  5I2Y A;  1JWM D;  1QVG A;  4JI7 L;  4Q5V A;  3U9S A;  5CBE E;  3CMA A;  4LF5 L;  1TWG B;  2F3W A;  5J3B A;  2XWJ B;  1QJO A;  2E74 C;  2VZA A;  4NPS A;  2XIW A;  4DAM A;  3PUX A;  3H09 A;  4KKU A;  1GD7 A;  1SMY D;  1F9S A;  4RMF A;  4DV1 Q;  1YNJ D;  3JC6 6;  3MXP A;  4F7X A;  3FPU B;  5EKK A;  1ASZ A;  1B3Q A;  2F0O A;  5G3L F;  3GO5 A;  1O7Y A;  4NXM L;  2K32 A;  4A4I A;  2XVS A;  4ZQ3 A;  2IY5 B;  1VQL A;  2NB0 A;  2MFI A;  1TS2 A;  3X3M A;  3PIP 3;  3A0J A;  3ICE A;  2R92 H;  1ILQ A;  1EOT A;  3GTG B;  4JI2 L;  1Y1W H;  4IPG A;  1RD9 D;  3KBG A;  2H1E A;  3P20 A;  3AEV A;  1ENC A;  3BDC A;  3TP5 A;  1A15 A;  1HZ9 A;  4LJZ C;  4C3I G;  2OTL A;  4X65 L;  1Y69 U;  4ULL A;  4NKL A;  2GVB A;  2V4D A;  3ITP A;  1X9N A;  4IJH A;  1LTI D;  5DNF A;  3TRZ A;  3K6O A;  1YHA A;  3CRK C;  1VQ5 A;  2F0L A;  2JJQ A;  4OIK A;  2O5I C;  1EYG A;  1EY4 A;  3HGB A;  4QB4 A;  4A3E B;  1RTO A;  1X32 A;  2PMZ B;  5M3F H;  3I90 A;  2AQ1 B;  3HOZ H;  5DM7 3;  4DR3 L;  5D14 A;  1AN8 A;  2K7V A;  1NNX A;  3TBI B;  3RR5 A;  4DV1 L;  3PGZ A;  2EIF A;  1HUM A;  1K28 A;  4KD4 A;  1VQI A;  2CWA A;  5H1S E;  4A3K G;  2KHI A;  5D3I B;  1D2B A;  1Q81 C;  3ND9 A;  2WFW A;  3D0F A;  4NXN Q;  4LFC L;  4X62 Q;  3S1Q B;  1X3G A;  1HQM C;  2DN8 A;  2L1B A;  2KHJ A;  2E2I B;  5LMN W;  3PO2 G;  1G6Z A;  2NTS A;  5EPK A;  1YNJ C;  2VW9 A;  1A0I A;  1SMY C;  1X3P A;  4HJ7 A;  3A8K E;  3IKJ A;  3A5U A;  2R7D A;  3GTP B;  2B2U C;  1Y1W B;  3T16 A;  3MXN B;  5C4H A;  1JOQ A;  3DHQ A;  1DM0 B;  5FO7 B;  2PNR C;  5EKI A;  3P75 A;  2F4V L;  3K81 C;  2EJM A;  1HNX L;  3SK6 A;  1N33 L;  3FVQ A;  1DYQ A;  1IL8 A;  2D9U A;  4I7Z C;  3OHX C;  4GS3 A;  5E3F A;  1UWV A;  1VQB A;  3WOE A;  3QIA A;  3CME A;  4ZK9 B;  2PCF B;  4DV0 Q;  4AQY Q;  4DR4 L;  4FVM A;  1WVL A;  3ULL A;  4ME5 A;  3NK9 A;  3CCJ A;  5EKL A;  2LFN A;  3U50 C;  1PRT C;  2V1C C;  1Y14 B;  4DV5 Q;  1F9R A;  1H9K A;  3LNN A;  3MHB A;  2K14 A;  4OEM B;  5T1G A;  1AZP A;  1HA6 A;  3JAM E;  4JI4 Q;  2WAQ B;  1SYG A;  4R8I A;  2NZ1 D;  2A6E C;  1TS3 A;  3HOU H;  3RLF A;  1O7Z A;  3S2D H;  1RJT A;  3D6W A;  3BU2 A;  5LMU Q;  1JIC A;  5IYB H;  4DR1 Q;  1TVX A;  1DCZ A;  4MN3 A;  3KF6 A;  2XGT A;  4A3J B;  3FKI G;  2RDH A;  1EY6 A;  5EJW A;  2JE6 I;  2NZO A;  3TP7 A;  1CHP D;  2F0T A;  4HIO A;  1PH8 A;  4DPG A;  1XNR Q;  1Q1B A;  3FHW A;  2BE5 D;  4XT1 B;  2F0W A;  1Y1V B;  4NXM Q;  2UXD L;  3GTJ H;  1JWS D;  2QGQ A;  5C4J B;  2OQ0 A;  5JAV A;  2I5M X;  1WCM B;  4H44 C;  2F0S A;  1M4V A;  1WTO A;  4JI2 Q;  2E8G A;  1I50 H;  5M3F G;  1LV9 A;  3N6R A;  3SK4 A;  1QNK A;  2NTT A;  4F88 A;  1JB3 A;  3PIO 3;  5E7N A;  3N52 A;  3UDI A;  4OXP A;  3K5O A;  1L2F A;  4HJ5 A;  1N34 L;  3M3Y B;  2F0N A;  3J7Z C;  2R7F A;  3DEO A;  4LUZ A;  1SJE D;  4BBR H;  1LTR D;  1IL2 A;  3KBX A;  1WI5 A;  2AQ2 B;  2ZT9 C;  1CKO A;  1S72 A;  4BBS H;  1PA6 A;  2VUM H;  3GTK B;  4IUV A;  5M3M G;  4KK7 A;  4K5W A;  2UXC L;  4LF7 L;  1B9M A;  1FGU A;  2MHV A;  1EFI D;  2IL8 A;  5IYD G;  1YZ6 A;  4A3B B;  4RGT A;  4LF5 Q;  1XTC D;  4FNF A;  4APV A;  3MZ5 A;  1TWF B;  1PDQ A;  4CDE C;  4DK0 A;  3BVG A;  1S4Z A;  3HKS A;  1AE2 A;  4BXX G;  2PMZ E;  4LW1 A;  4FF3 A;  3HOX H;  4IJL A;  4WJ4 A;  1LTA D;  3I4M G;  1G51 A;  4X64 Q;  4X3U A;  4EVO A;  4DR4 Q;  2RSO A;  1BDO A;  3P7J A;  4JC0 A;  2B2U A;  3S16 H;  1RHP A;  2OTJ A;  4HJ8 A;  3BZD B;  2SEB D;  1VF7 A;  3SHL A;  3TZU A;  4DXF A;  5IGB A;  2WKC A;  2ICI A;  2CQO A;  1XPR A;  1X56 A;  4I7A A;  2EY1 A;  3H3V C;  1CQF A;  4HR7 B;  1HTP A;  4UAI A;  5F2D A;  4GN4 B;  2EYL A;  2B2W C;  4QIW B;  2E76 C;  1V1P B;  4BWG B;  3S15 B;  3PUZ A;  1ZKO A;  3E6Z X;  1HH2 P;  5LMU L;  4DV0 L;  5KNC A;  1Q3L A;  5ELB A;  3SXH A;  3OW2 A;  1V43 A;  3J80 i;  1DXM A;  2EYJ A;  4DV4 L;  1LTB D;  3J80 c;  1R4Q B;  2F0P A;  1WD1 A;  2E2J H;  5FLM G;  1ZYR D;  1ICW A;  2HCC A;  3S16 B;  1X3E A;  3UDX A;  4X64 L;  5IIF A;  1V1P A;  4RGM A;  3TSS A;  5IGE A;  3HOU G;  1GUW A;  2AUK A;  1KDB A;  4JPB W;  1A62 A;  3G7L A;  2Q8T A;  3MXN A;  2F4I A;  4BY1 B;  4F8M A;  2F1M A;  5EQ0 A;  3M4Y A;  4C3J H;  1EL0 A;  5C44 B;  2GN5 A;  1TS5 A;  5C0X H;  4TVA B;  5EAY A;  3CCM A;  1QCB D;  3K7U C;  1JJG A;  4B9W A;  4OO1 G;  1STA A;  3IAY A;  4PMC A;  4GKK Q;  3RMH A;  4DK1 A;  3MEF A;  4GLV B;  3G6E A;  5FK9 C;  2FHT A;  2YTY A;  3RNU A;  1IKL A;  3E0E A;  1XNQ L;  2YYZ A;  2K50 A;  1J5E Q;  3HKZ B;  1I4G A;  1C9O A;  4DV3 L;  4OWT B;  4P75 A;  2L0C A;  2ZJP A;  4PG3 A;  1STY A;  5FKA C;  4NXN L;  1N33 Q;  2DUD A;  1HFG A;  3HOW B;  4X65 Q;  2GA4 B;  1YNN C;  3RD4 A;  1VQM A;  3GTJ B;  1EIH A;  1CKM A;  1JWU D;  4DR2 Q;  4JI1 L;  4OL7 A;  2WII B;  3TZD A;  1WCM H;  2UUC Q;  1ML0 D;  2CHB D;  2L5T A;  2Z6B A;  4DAY A;  1FJG Q;  4TRD A;  3KJP A;  5FLM H;  4DR5 L;  4DR3 Q;  1TWG H;  3GTQ B;  3QR8 A;  1SE2 A;  1SLJ A;  4B3M Q;  5KIX A;  4CJ0 B;  1FL0 A;  3K7A B;  4RGO S;  4IPC A;  3HOY B;  4WOR A;  4OON A;  1X65 A;  1Q46 A;  3A74 A;  1K8O A;  3VYU A;  1VQJ A;  4HN7 A;  5LL6 X;  3J7A 5;  1SND A;  1W3S A;  4P74 A;  5CYU A;  4U68 A;  1CTM A;  2N55 A;  3S17 H;  4I65 A;  1GO3 E;  3MXG A;  5IGG A;  1SFO H;  2NVX B;  1L0W A;  2FJ2 A;  4E6I A;  3HG9 A;  1N34 Q;  1YVC A;  2J7Z A;  3S1M H;  4JI4 L;  1CSP A;  3NSW A;  1NR4 A;  4A3K H;  4RA8 A;  4L5T A;  1BBX C;  1KDC A;  1U0L A;  4C2M H;  3BG3 A;  3NUC A;  3DWQ A;  2OCE A;  4HSP A;  4NP5 A;  4ABN A;  4GKK L;  1O80 A;  2M2L A;  4QJF A;  3ER0 A;  2KOL A;  2EE1 A;  2K5V A;  5LHY 1;  4ZYS A;  2R93 B;  2IHE A;  2K5W A;  4B3S L;  2F0D A;  4GOP C;  1Q12 A;  1VF5 C;  2VNU D;  4PQX A;  4IFD J;  1IYJ B;  1ZXT A;  5JEA J;  3T53 B;  1UEB A;  4B3M L;  3M7G A;  1GHK A;  3OPO A;  1XXG A;  3C2P A;  5C3E G;  3J81 i;  2L55 A;  2ZJR A;  1L1O C;  1PH1 A;  3VYS A;  2A6H D;  2K1B A;  1EUJ A;  4K6D A;  2JA8 H;  4KY6 A;  4A3D H;  3CPF A;  1XX8 A;  2UUC L;  2R61 A;  3AFP A;  1N8R C;  3SR1 A;  1WTW A;  3KLW A;  2BDO A;  1ENF A;  3HOY H;  2A6H C;  2EVB A;  1KRT A;  4UP8 A;  1CM9 A;  3IFT A;  1SNP A;  1V1O A;  1HUN A;  1TT2 A;  5CV6 A;  2NN6 I;  5KGU A;  3J81 E;  2K5Q A;  2BH8 A;  1TU2 B;  3ZJY C;  4PMW A;  1HA5 A;  2B3G A;  5JPN C;  4LF4 Q;  2E2J B;  1EZ8 A;  3VA5 A;  2QKI C;  1IKM A;  2L9H A;  1A2T A;  4KHZ A;  3I7F A;  1TWC B;  4S3S A;  4A3M H;  1PTO H;  4UP7 A;  1STG A;  2AWO A;  1Q86 C;  1PRT B;  3TRE A;  4AIM A;  1JQY D;  1B44 D;  1TR5 A;  4JI3 Q;  3D6C A;  5JJZ A;  1Y8O B;  2K05 A;  4OGQ C;  2K04 A;  3CC7 A;  2GVA A;  4LF6 Q;  1BUV T;  1HXY D;  4JI8 Q;  2B63 G;  3Q24 A;  4IOC A;  5IGF A;  3EQL C;  1M1K C;  2IW3 A;  2KCN A;  4KTA A;  3PO3 H;  3E9H A;  3GTL H;  4NW2 A;  3GTP H;  2MQH A;  3MC0 B;  2VB3 X;  1PFB A;  1R4P B;  3NQT A;  3RN5 A;  4KHP L;  3TN2 A;  3TP6 A;  2R93 G;  1J8I A;  5C3X A;  2LS0 1;  3A7A B;  4JI0 L;  1G91 A;  5ISR A;  4IUU A;  1I4P A;  2PNH A;  1O7I A;  2PI2 E;  3I56 A;  1WJJ A;  2RCN A;  4B3T Q;  3S2H B;  4RKB A;  1FNW A;  2UXB L;  3MFG A;  2K4K A;  1Q90 A;  5M5W B;  1K0R A;  3F8T A;  2F4V Q;  3Q6S A;  3KOJ A;  1U4L A;  1N9W A;  1JR0 D;  4RCN A;  1B53 A;  3G6J B;  1JCK B;  3MXU A;  4GOP A;  2QDL A;  5C3E H;  4GZY C;  3MVV A;  5C44 G;  3EA6 A;  3J80 L;  3NTK A;  5GAG C;  1FGB D;  1YNN D;  3KJO A;  1Z47 A;  5C4Z A;  4BY1 G;  2CH4 A;  2ZXR A;  4LF8 L;  1EYD A;  3HOY G;  4LF9 L;  2HCI A;  3F1Z A;  1SDF A;  3CPW A;  3V05 A;  4IPD A;  1IBM L;  2XRS D;  4A3C G;  2FFK B;  4ZLT F;  2WKD A;  1N36 L;  3GV6 A;  1MSG A;  2N78 A;  3HEJ A;  1I6V C;  1IYU A;  3NEL A;  1K83 H;  1CKN A;  1EY9 A;  4BS9 A;  4QUF A;  3I4M H;  3QOL A;  3IFD A;  4WJ3 M;  1V9P A;  1JOK A;  3A8I E;  4R9W A;  4HAE A;  4LFA Q;  2A68 C;  5CV4 A;  3FRP B;  4KY7 A;  4DR7 L;  1K8M A;  4P71 A;  4RKL A;  4DXG A;  1SYF A;  2JQO A;  2MO0 A;  1I6H B;  1O7L A;  4BBR B;  4KKS A;  1S40 A;  1STB A;  1A3T A;  3CCE A;  4UY8 C;  2JSO A;  4UPA A;  1DOK A;  3IL8 A;  3FPP A;  4A76 A;  1H9M A;  2UUA L;  1ZYR C;  4UP9 A;  4HTH A;  4QY7 A;  1CI3 M;  2Q2U A;  1MGS A;  2Q2T A;  2DY7 A;  4KN4 C;  2NVT H;  4OX9 L;  4EQP A;  4J1M A;  3C3L A;  4YY3 Q;  3I4M B;  1JT8 A;  2ZTD A;  3ND8 A;  3ERO A;  1EEF D;  4A3B H;  4Z9C B;  5EGT A;  3TME A;  1SE8 A;  3HOV B;  3A54 A;  4C3J G;  1VCI A;  1AW7 A;  1CQV A;  4DR2 L;  1JJ2 A;  3W1G A;  3PF5 A;  3CCQ A;  2M9V A;  5KNB A;  1EQT A;  2N3S A;  3HOX B;  1VQC A;  3OIP A;  4DNI A;  3J7Y W;  3T56 B;  3W3A A;  5J22 A;  4XQQ A;  4CGY B;  2WP8 J;  1IBL Q;  3J7A V;  4LWC A;  1SNO A;  2ZXO A;  1BF4 A;  1SNM A;  2EY2 A;  1BNZ A;  5HGQ A;  2J0T D;  1WTV A;  4KHV A;  3H0G G;  1IBK Q;  1QE6 A;  1HNZ L;  1VQ7 A;  3OYY A;  4O42 A;  4JK1 C;  2DNC A;  5EPJ A;  1YEZ A;  1G2S A;  4CKC A;  2LY7 A;  5G3L D;  1HZA A;  4A3F H;  5IOD A;  1R9T B;  3K0X A;  2UXC Q;  2MUY A;  3GTG H;  2YTV A;  1XMQ Q;  4DKA C;  4JI6 L;  3R2T A;  2VQE L;  1OO9 B;  4XQN A;  5FO8 B;  5FLX L;  4JW0 A;  1NBW A;  4KD3 A;  2HDM A;  1QB5 D;  3DEP A;  1ESR A;  4QMG A;  1C7Y A;  3NE5 B;  3H3V H;  1IXR A;  5M5Y H;  1FR3 A;  1TWA H;  2B63 B;  4OO1 H;  5IGD A;  4LFB L;  1C48 A;  3SK8 A;  3MAQ A;  4L8J A;  5C44 H;  1S3O A;  4A3F B;  1GKH A;  1UE5 A;  2UUA Q;  2EPB A;  2NVY H;  4LK1 C;  1VQD A;  1YI2 A;  1LTG D;  4YCW A;  1CK1 A;  4C3H H;  5KND A;  1KIX A;  3EIV A;  1Y8N B;  3I73 A;  3C1F A;  1EU4 A;  1I50 B;  5J39 A;  2D62 A;  5CV9 A;  5JEA G;  2RA4 A;  2NVQ H;  1STN A;  2PPB C;  4B3T L;  1JE4 A;  3VDY A;  2IX3 A;  1A2U A;  1PH3 A;  2E2D C;  3PV0 A;  3NBH B;  5IWA Q;  4UHV A;  4BA2 I;  2XTI A;  3ERQ A;  1GJX A;  4FF4 A;  2BCO A;  3K80 C;  4QGU A;  3DWP A;  3FP9 A;  2UU9 L;  4RWS C;  2R7Z B;  1HFN A;  2VQE Q;  5C0X J;  1U4M A;  3GTM H;  4A3L G;  1MJC A;  3S1R H;  3BVM A;  5CMD A;  2F0M A;  4Q0F A;  1OTC A;  1K3B C;  1KAA A;  5BN4 A;  2D0P A;  2A6E D;  3DUZ A;  3SEB A;  1WD0 A;  4JI8 L;  1SJH D;  1L1O A;  2D5D A;  3SGI A;  2WAC A;  4IO9 A;  3GTO B;  4OO1 I;  1I4H A;  4K2L A;  3FKI H;  4CDF C;  2LSS A;  1TWA B;  1X55 A;  2K6A A;  1GOZ A;  1TY2 A;  1VQH A;  3PO2 B;  1PRT D;  4KHP Q;  4B9X A;  3HOW H;  3K5N A;  3J81 j;  4A3F G;  4LNQ A;  4OX9 Q;  1EQQ A;  4DFA A;  4JCV E;  2F0I A;  1AE3 A;  4IUN A;  4HID A;  1PFS A;  1WOC A;  2JA7 G;  1VQA A;  4AYB G;  4LF6 L;  5C4X G;  1D5M C;  2F0H A;  2JXM B;  3PCO B;  3VR4 A;  1WFQ A;  2EYH A;  3KDF A;  1BOS A;  4GLA C;  1F77 A;  3AYH B;  5COY A;  2PYK A;  5HUR A;  2TSS A;  1B3A A;  4MTK A;  2ZM6 L;  2A1A A;  2BH2 A;  4CJ2 C;  3QJY A;  1KNA A;  5I9O A;  1OXS C;  5CV7 A;  4BBR G;  2KEC A;  2XSC A;  4ME3 A;  2Q8R E;  3L2P A;  4DK3 C;  4CJ1 B;  1W6J A;  3SDZ A;  2EYM A;  2B2V C;  4J8Q A;  4N8F A;  1LLR D;  4DGZ A;  1B9N A;  4GKJ L;  5CGK A;  2DJG C;  3GTQ H;  1WTR A;  4BA1 I;  1PLF A;  3FMC A;  4A3G H;  1DZ1 A;  2EJG C;  3R3O A;  1IBM Q;  3I55 A;  4ID6 A;  4BBS G;  1SR3 A;  4PZ6 A;  1PTO F;  1U5K A;  4TKO B;  1PVO A;  2HIV A;  2JN4 A;  2VQF L;  5E4W C;  2N49 A;  3VR6 A;  3J80 E;  4C3J B;  2PZW A;  3A8J E;  3HOV G;  2I07 B;  2HT1 A;  1VQ8 A;  1YBY A;  1Y8P B;  2NVX H;  1KC8 C;  3T13 A;  1C4Q A;  1PH9 A;  2JA9 A;  4K14 A;  4BBS B;  4DK6 C;  2WB1 G;  3CRL C;  1W2B A;  2L12 A;  1CFM A;  5DEH A;  2JEB I;  4L5S A;  1Q8I A;  3K8A A;  3VYT A;  3HOW G;  1VQ9 A;  4IFD G;  3LX0 A;  4A3G B;  5COR A;  2PZT A;  2Z4H A;  5E4X A;  5JEA H;  2BA1 A;  4C3I H;  2DJF C;  1TXY A;  1LTL A;  2UUB L;  2KA7 A;  3F2B A;  3CC4 A;  1VQK A;  1EIG A;  1EYA A;  3GTL B;  4DR7 Q;  3ERS X;  2F0F A;  1B70 B;  1EWC A;  1EY7 A;  5K36 G;  1QOH A;  1LT3 D;  3A7L A;  2HHH L;  4MNO A;  2WV6 D;  3KF8 A;  3WWV A;  4R4T A;  4JV5 L;  1E1T A;  1EY0 A;  2RBM A;  4BY1 H;  1D5Z C;  4JI6 Q;  3SE0 A;  2MJ8 A;  3BDO A;  1A3V A;  4DNR B;  3KLR A;  2YU9 H;  5CR3 A;  3QOJ A;  4LF4 L;  2B2V A;  4A3I H;  4R4O A;  3CQZ B;  4POF A;  2KBN A;  1D8L A;  4TQU S;  4L5R C;  4V0B A;  1ILP A;  1F2L A;  2D2C C;  3VR3 A;  4JBJ A;  3HOZ B;  3ONA B;  1PRT F;  5GQO A;  5FLX c;  1K8G A;  3G48 A;  4DV5 L;  1WTH A;  4HJA A;  1HCZ A;  2JA5 B;  3URY A;  4YWK A;  4JBW A;  5IT9 c;  1BXT A;  1VQG A;  3DM3 A;  4XXE A;  4MZ9 A;  4EQN A;  4A3I B;  1I4R A;  3STB C;  2OEO A;  4LFC Q;  4GNX C;  2Z0S A;  1GUS A;  2F0U A;  2FMM A;  5C0X I;  3K57 A;  4CDC C;  2JA6 G;  5C3E B;  4A3J H;  4IAL A;  1EY8 A;  2E2I H;  1QZH A;  1YHB A;  1WCM G;  2F0E A;  2QF7 A;  1QNU A;  3NHH A;  1EU3 A;  2I5L X;  2F3V A;  5IYC H;  2R6G A;  4R8N A;  1UEA B;  1I6H H;  5ELF A;  1D1I A;  2VS1 A;  4OWW B;  1XTD A;  1AP0 A;  2K33 A;  1P8L A;  3LWU A;  3IRB A;  1BCP D;  5FLX E;  1WTP A;  1K73 C;  2X6L A;  4CBV A;  4Y52 H;  2JA5 H;  1K83 B;  1SYB A;  1TQO A;  2G9D A;  5GAD C;  1RCV D;  3JAM c;  4A3B G;  1S5E D;  1IW7 D;  5M3M H;  2RSN A;  1A8V A;  4YWM A;  4DV2 Q;  4DR6 Q;  1H9J A;  3QWN A;  3R8B A;  4ZAI A;  2EZV A;  4DAV A;  3S1Q H;  3OWF A;  2M00 A;  4K6L A;  1ROD A;  3WOF A;  1F2Y A;  3RZD B;  3I2Z A;  4K8J A;  4ZKB B;  2A5H A;  1EEI D;  2JA8 G;  2Z6K C;  4K5X A;  3LGJ A;  3HOX G;  4LMQ D;  2HD3 A;  4QL5 A;  1O78 A;  5IGC A;  1K3R A;  4JOI C;  3O13 A;  2F0V A;  5A2Q L;  4JI5 Q;  1PXU A;  2CW0 D;  3U58 A;  4B3S Q;  2A73 B;  3S2D B;  4PMB A;  5C5L A; 
#chains in the Genus database with same CATH homology
 3OTO L;  1N36 L;  3KFU A;  1N32 Q;  2VW9 A;  2N78 A;  1X6O A;  1UE7 A;  2ID0 A;  1A63 A;  1XPO A;  1A0I A;  1TWF H;  3F2C A;  4HJ7 A;  3NEL A;  1K83 H;  1CKN A;  3A5U A;  2R7D A;  1C0A A;  1K8A C;  2UU9 Q;  5IWA L;  3M9B A;  2LXJ A;  1JJC B;  3MXN B;  1DGS A;  2LXK A;  3I4M H;  1QUQ A;  1T9H A;  1Y1W G;  2F4V L;  3K81 C;  1HNX L;  4WJ3 M;  1V9P A;  1N33 L;  2MO1 A;  2WAQ G;  3S2H H;  2AKW B;  5IP9 G;  2QEX A;  2ASB A;  4GS3 A;  4A3D G;  1UWV A;  1VQB A;  4LFA Q;  5M5W H;  4AQY Q;  3CME A;  1AH9 A;  4DV0 Q;  1PV4 A;  4H02 A;  4DR7 L;  4P71 A;  4YWL A;  2IX0 A;  4A75 A;  3I4O A;  3GD7 A;  4DR4 L;  1E3P A;  3ULL A;  3PSI A;  3U4V A;  3BZK A;  4A3I G;  4A3J G;  4LF7 Q;  2JQO A;  2VY3 A;  3CCJ A;  1FJG L;  2MO0 A;  3M4Q A;  1IBK L;  3U50 C;  4DAY B;  2V1C C;  1Y14 B;  2ZTE A;  4DV5 Q;  3PO3 G;  1YNX A;  3J81 c;  1S40 A;  2E5L L;  3CCE A;  4R4Q A;  4UY8 C;  5FJ8 H;  4UPA A;  1MJE A;  2K14 A;  4A76 A;  1Q1E A;  2QA4 A;  4KLK A;  1HNW L;  4JI4 Q;  1OXT A;  2UUA L;  4UP9 A;  3TQY A;  4DV3 Q;  4BXX H;  4QY7 A;  3KF6 B;  4GNX B;  2Q2U A;  2MNA A;  2VQF Q;  4X62 L;  2Q2T A;  2HIX A;  1CKN B;  3HOU H;  3PIO A;  2NVT H;  4OX9 L;  1Y1V G;  3RLF A;  1E24 A;  4YY3 Q;  3S2D H;  3GTK H;  1JT8 A;  2F3I A;  3BU2 A;  2ZTD A;  5IYB H;  5LMU Q;  4DR1 Q;  4JYA Q;  4JI1 Q;  1QVC A;  2ATW A;  1BKB A;  4A3B H;  1SE8 A;  1XMQ L;  3KF6 A;  4EX5 A;  1I5F A;  2VL6 A;  2XGT A;  3FKI G;  5IE8 A;  2JA6 H;  1VCI A;  1PYB A;  4DR2 L;  2JE6 I;  1JJ2 A;  2NZO A;  3JAM i;  3W1G A;  3CCR A;  4HIO A;  1RIP A;  3PF5 A;  1PH8 A;  4DPG A;  2IX1 A;  3CCQ A;  1XNR Q;  1Q1B A;  3FHW A;  4LFB Q;  2N3S A;  1VQC A;  1PH2 A;  4GNX A;  3PO2 H;  3S14 H;  3UE1 A;  4R4C A;  4A3C H;  4DNI A;  3RLN A;  2WP8 J;  4DR5 Q;  1IBL Q;  4NXM Q;  4LWC A;  2UXD L;  3GTJ H;  2QGQ A;  2OQ0 A;  4GLX A;  2B63 H;  2R7Z H;  4IFD I;  2I5M X;  5HGQ A;  1KL9 A;  2RF4 A;  3H0G G;  1QZG A;  1IZ6 A;  1IBK Q;  1HNZ L;  1VQ7 A;  5IP7 H;  3OYY A;  4JI2 Q;  2Z6K A;  1N36 Q;  4BY7 G;  2E8G A;  1I50 H;  5M3F G;  1EQR A;  4XIG S;  3CCU A;  2B29 A;  4JOI A;  5E7N A;  1YEZ A;  3UDI A;  4OXP A;  1YJW A;  2Y0S G;  1L2F A;  4HJ5 A;  1N34 L;  1SRO A;  3L0O A;  3J7Z C;  2R7F A;  4LUZ A;  2A19 A;  4BBR H;  1TWH H;  1IL2 A;  3K7A H;  4A3G G;  1WI5 A;  1HZA A;  4A3F H;  3K0X A;  1VQE A;  2UXC Q;  1CKO A;  1SRU A;  1S72 A;  2YTV A;  1XMQ Q;  3GTG H;  1UE6 A;  4BBS H;  4DKA C;  4JI6 L;  1PA6 A;  2OQK A;  2VQE L;  1CUK A;  4X66 L;  4JI7 Q;  2VUM H;  3S1N H;  3DLL A;  2NN6 G;  1VS0 A;  2CFM A;  2IHF A;  4LUV A;  5M3M G;  1M90 C;  1NBW A;  1H95 A;  1JE5 A;  3T1H Q;  2UXC L;  1N32 L;  4AH6 A;  4LF7 L;  1SMX A;  1C7Y A;  1FGU A;  4JG2 A;  1EIY B;  4JI5 L;  1NMF A;  3H3V H;  1IXR A;  5M5Y H;  5IYD G;  1TWA H;  4DV6 Q;  1YZ6 A;  2AMC B;  3NEN A;  4MTN A;  4LFB L;  4LF5 Q;  1YJN A;  4APV A;  1S3O A;  5C44 H;  1VQ6 A;  3CAM A;  3BJU A;  1GKH A;  2ZJQ A;  1UE5 A;  5DLQ E;  2UUA Q;  3HKS A;  3GDE A;  5GAE C;  1YJ9 A;  1AE2 A;  2NVY H;  4BXX G;  2PMZ E;  4LW1 A;  3HOX H;  1NTG A;  1VQD A;  1E22 A;  2YV5 A;  4IJL A;  5C4J H;  1YI2 A;  3PF4 A;  3I4M G;  4WJ4 A;  1XJV A;  1G51 A;  4YCW A;  4QIW E;  4X64 Q;  4C3H H;  1KIX A;  3CCS A;  4DR4 Q;  3EIV A;  1KD1 C;  1HR0 L;  4JC0 A;  5LMN Q;  3S16 H;  1XPU A;  2OTJ A;  4HJ8 A;  3KF8 B;  2Q2H A;  2D62 A;  5JEA G;  2NVQ H;  1Q82 C;  4B3T L;  2Y0S E;  4XTC S;  2CQO A;  3VDY A;  1XPR A;  1X56 A;  2OWO A;  3CF5 A;  1PH3 A;  5M5X H;  3KDF B;  3PV0 A;  3NBH B;  5IWA Q;  1XMO L;  4BA2 I;  2XTI A;  1G6P A;  5IP7 G;  1PHJ A;  3K80 C;  3U4Z A;  3W1B A;  4QGU A;  1BVS A;  1R9T H;  4A3E G;  3FP9 A;  2HQL A;  2UU9 L;  4HIK A;  5IP9 H;  4GN4 B;  2VQE Q;  5C0X J;  3W5O A;  1NJI C;  3GTM H;  4A3L G;  4JV5 Q;  3PUZ A;  1HH2 P;  5LMU L;  4DV0 L;  3CC2 A;  3EBE A;  2WB1 E;  3M7N A;  1MJC A;  3S1R H;  1EWI A;  1FVI A;  1NY4 A;  5BR8 L;  1OTC A;  3OW2 A;  1V43 A;  3J80 i;  2UXB Q;  2D0P A;  1YIJ A;  4DV4 L;  2E2H H;  4JI8 L;  3J80 c;  1XNR L;  3H3V I;  1L1O A;  3SGI A;  5FLM G;  2E2J H;  4IO9 A;  4OO1 I;  3FKI H;  1PYS B;  1X3E A;  2LSS A;  1Q8K A;  3HFZ B;  1X55 A;  5IY0 A;  1Z9F A;  3UDX A;  2FXQ A;  4X64 L;  4JBK A;  3UDG A;  1K9M C;  1VQH A;  5GRO A;  3HOU G;  4DV7 L;  4KHP Q;  3AQQ A;  5IYD H;  4FDB A;  4A3F G;  3J81 j;  4LNQ A;  3HOW H;  2AHO B;  2PI2 A;  4OX9 Q;  1SN8 A;  1Y1V H;  1EQQ A;  1A62 A;  4HIM A;  3GTO H;  2UXD Q;  4DUY Q;  4JCV E;  5IYB G;  2VUM G;  4Y7N H;  1AE3 A;  4HID A;  2EXD A;  1PFS A;  2HHH Q;  3AFQ A;  2F52 A;  1KAW A;  1WOC A;  4C3J H;  3T1Y L;  2JA7 G;  1VQA A;  4AYB G;  4LF6 L;  5C4X G;  2K75 A;  4JI0 Q;  4DUY L;  2GN5 A;  1XNQ Q;  4GN5 A;  5AJ3 L;  4DV6 L;  3PCO B;  1WFQ A;  4TVA B;  3KDF A;  4GLA C;  5EAY A;  3CCM A;  3K7U C;  1PH7 A;  1JJG A;  3AYH B;  3E9I A;  4OO1 G;  2UUB Q;  4GKK Q;  4J15 A;  2ZM6 L;  4DUZ L;  2A1A A;  2BH2 A;  1JMC A;  3M3Y H;  4R4I A;  3MEF A;  4GLV B;  1LUZ A;  1CSQ A;  2AWN A;  4O2D A;  3G6E A;  1OXS C;  2YTY A;  2CWP A;  4BBR G;  4PZ7 A;  3RNU A;  3I4N G;  4ME3 A;  3CCL A;  3E0E A;  1XNQ L;  2KCT A;  2R7Z G;  2YYZ A;  4A3M G;  1EIF A;  2K50 A;  5HY6 A;  3TS0 A;  3L2P A;  3G71 A;  4DK3 C;  1J5E Q;  1C9O A;  4DV3 L;  4OWT B;  4P75 A;  4A3E H;  1JB7 A;  3S15 H;  2RHS B;  2ZJP A;  4PG3 A;  4AYB E;  4NXN L;  1N33 Q;  2DUD A;  3HKZ E;  2H5X A;  2NZH A;  1YIT A;  3F2D A;  4X65 Q;  1X3F A;  4GKJ L;  2ES2 A;  1VQO A;  4K0K Q;  2ZTC A;  1PH4 A;  1VQM A;  1HNZ Q;  3CP0 A;  2CCZ A;  3GTQ H;  1CKM A;  4BA1 I;  4DR2 Q;  4JI1 L;  1GM5 A;  1LM0 A;  4JYA L;  3ULP A;  4A3G H;  2KEN A;  2UUC Q;  1WCM H;  2R92 G;  4O0A A;  4R1J A;  3TEH B;  1IBM Q;  1EOV A;  2N8N A;  1FJG Q;  2WAQ E;  2RHQ B;  3I55 A;  1B8A A;  4BBS G;  3KJP A;  1SR3 A;  5FLM H;  4PZ6 A;  1U5K A;  4DR5 L;  5IYC G;  3EN2 A;  4DR3 Q;  2HIV A;  1TWG H;  3CQZ H;  1VQP A;  4GKJ Q;  1PVO A;  2VQF L;  1OXX K;  5AJ3 Q;  1RL2 A;  1HNX Q;  1SLJ A;  2N49 A;  3PUW A;  3S24 A;  4DV4 Q;  4B3M Q;  2JEA I;  1HNW Q;  1VQN A;  3UDF A;  4IOA A;  1G29 1;  1FL0 A;  3HOV G;  1HZB A;  1VQ8 A;  2HT1 A;  1YBY A;  4L5Q A;  4YCU A;  1Q7Y C;  1B7Y B;  2EQS A;  4IPC A;  4OON A;  5LMN L;  2NVX H;  1X65 A;  1KC8 C;  1PH9 A;  1Q46 A;  2C35 B;  2YTX A;  3A74 A;  2JA9 A;  4A93 H;  4KI0 A;  3CW2 C;  2ZM6 Q;  2JA5 G;  1VQJ A;  1KQS A;  3BZC A;  3PUV A;  4DK6 C;  2WB1 G;  3J7A 5;  1W3S A;  3TS2 A;  4P74 A;  4ALP A;  1W2B A;  4B3R L;  3S17 H;  4DV7 Q;  2PQA A;  4DR1 L;  3HOZ G;  2Q2I A;  2JEB I;  3OTO Q;  1GO3 E;  5C4X H;  1HJP A;  1SFO H;  2JA7 H;  5ELO A;  2CKZ B;  1L0W A;  4L5S A;  2IT1 A;  3K8A A;  1PH6 A;  4EQ5 A;  1N34 Q;  1VQ9 A;  1YVC A;  3H15 A;  1IBL L;  3HOW G;  3S1M H;  3D31 A;  4JI4 L;  4IFD G;  1CSP A;  1BBU A;  3T1Y Q;  1MKH A;  4A3K H;  1ASY A;  3PUY A;  2R93 H;  3L7Z C;  4YHH Q;  3HKZ G;  4L5T A;  4A3L H;  2BA1 A;  3STB D;  1J6Q A;  4C3I H;  1U0L A;  5BR8 Q;  4C2M H;  1E1O A;  3I4N H;  1QUQ B;  1TXY A;  2OCE A;  1LTL A;  4X66 Q;  2UUB L;  4GKK L;  3NEM A;  4JI3 L;  4QJF A;  3ER0 A;  4DUZ Q;  4P73 A;  2JK8 A;  4GOP B;  3RZO H;  1OXU A;  3F2B A;  2A8V A;  2K5V A;  1X54 A;  3PIP A;  4YY3 L;  3CXC A;  3CC4 A;  1PH5 A;  2IHE A;  1VQK A;  2KCM A;  4B3S L;  4X6A H;  4DR7 Q;  3ERS X;  4GOP C;  4AQY L;  1Q12 A;  4NB3 A;  1XMO Q;  4LUO A;  2VNU D;  4PZ8 A;  1LYL A;  4IFD J;  1D7Q A;  1IYJ B;  1B70 B;  5JEA J;  1UEB A;  3RN2 A;  1KHI A;  4B3M L;  5K36 G;  2HHH L;  4MNO A;  1VQF A;  5C3E G;  3WWV A;  3J81 i;  2E5L Q;  4R4T A;  2ZJR A;  4JV5 L;  1L1O C;  4QQB X;  1WYD A;  1PH1 A;  4B3R Q;  1E1T A;  1EUJ A;  1E7Z A;  3A5Z B;  1EFW A;  3T1H L;  3CD6 A;  1KXL A;  4BY1 H;  2JA8 H;  4A3D H;  1UE1 A;  3CPF A;  4JI6 Q;  1QVG A;  2UUC L;  3AFP A;  1N8R C;  3G4S A;  1I94 Q;  3KLW A;  4JI7 L;  3HOY H;  1KRT A;  4UP8 A;  2YU9 H;  4LF4 L;  4P72 A;  3CMA A;  4A3I H;  5C0X G;  4R4O A;  4LF5 L;  1P16 A;  2NN6 I;  5J3B A;  4POF A;  4LF8 Q;  2KBN A;  1D8L A;  2BH8 A;  3M4O H;  3ZJY C;  4LF9 Q;  4TQU S;  4L5R C;  4PMW A;  1J5E L;  3M85 A;  1L1O B;  2B3G A;  2VZA A;  4NPS A;  4LF4 Q;  4JBJ A;  4DAM A;  1V1Q A;  5GAH C;  3PUX A;  5GQO A;  5FLX c;  1K8G A;  4KHZ A;  3G48 A;  3I7F A;  1GD7 A;  4DV5 L;  2BA0 A;  4HJA A;  4A3M H;  4UP7 A;  4RMF A;  4YCV A;  4DV1 Q;  2I0Q A;  2AWO A;  3JC6 6;  2K5N A;  3TRE A;  4AIM A;  4YWK A;  1Q86 C;  4DV2 L;  2I5H A;  4JBW A;  4JI3 Q;  1MIU A;  2PQA B;  1ASZ A;  5IT9 c;  1VQG A;  3DM3 A;  3GO5 A;  4MZ9 A;  1NE3 A;  4NXM L;  1NMG A;  3CC7 A;  2GVA A;  3STB C;  4A4I A;  4LF6 Q;  4K0K L;  1TWC H;  2IY5 B;  4JI8 Q;  1VQL A;  4LFC Q;  4GNX C;  4LFA L;  5JJL A;  2MFI A;  2Z0S A;  5C0X I;  2B63 G;  4IOC A;  5ELN A;  2JA6 G;  1M1K C;  3A0J A;  4A3J H;  2E2I H;  3H0G H;  1QZH A;  3ICE A;  1YHB A;  1WCM G;  2R92 H;  3PO3 H;  3E9H A;  3GTL H;  3GTP H;  1GVP A;  1HZC A;  4JI2 L;  1OXV A;  2MQH A;  4IPG A;  1Y1W H;  4BY7 H;  5FJ8 G;  2I5L X;  2D0O A;  3RN5 A;  3AEV A;  4KHP L;  3RLO A;  5IYC H;  2R6G A;  1YHQ A;  1I6H H;  1I94 L;  3ULJ A;  2R93 G;  2VS1 A;  4OWW B;  1HZ9 A;  1XTD A;  2L15 A;  2OTL A;  4X65 L;  4HJ9 A;  2GVB A;  1P8L A;  3IRB A;  1X9N A;  4IJH A;  3TRZ A;  4JI0 L;  4DR6 L;  1YHA A;  2PNH A;  1K73 C;  1O7I A;  4OWX B;  2JJQ A;  1HR0 W;  2PI2 E;  1VQ5 A;  3I56 A;  4Y52 H;  1WJJ A;  2RCN A;  2K5H A;  4B3T Q;  4A93 G;  1EYG A;  2ALY B;  3Q8D A;  2JA5 H;  2UXB L;  5GAD C;  2K4K A;  3M4P A;  5M3F H;  3JAM c;  1K0R A;  4A3B G;  3KYH C;  3B6Y A;  3F8T A;  3RZD H;  5M3M H;  2F4V Q;  3KOJ A;  3HOZ H;  1A8V A;  4DR3 L;  4YWM A;  1N9W A;  2K52 A;  4DV2 Q;  4DR6 Q;  4JBM A;  3S1Q H;  5JJK A;  5JJI A;  3HOV H;  3RR5 A;  4RG1 A;  4GOP A;  4DV1 L;  5C3E H;  3PGZ A;  2EIF A;  5C44 G;  3UE0 A;  1VQI A;  2CWA A;  5H1S E;  1BBW A;  4YHH L;  2KHI A;  5GAG C;  3I2Z A;  3KJO A;  4A3K G;  1Q81 C;  1Z47 A;  4IPH A;  4BY1 G;  2DGY A;  2JA8 G;  2WFW A;  2Z6K C;  1KRS A;  3LGJ A;  3D0F A;  3CCV A;  3HOX G;  4LFC L;  4X62 Q;  4LF8 L;  4NXN Q;  3HOY G;  1X3G A;  4QL5 A;  4LF9 L;  3F1Z A;  4GN3 B;  1I3Q H;  1K3R A;  4JOI C;  3CPW A;  2KHJ A;  1QVF A;  4POG A;  1HR0 Q;  4IPD A;  5LMN W;  1IBM L;  4JI5 Q;  3U58 A;  4B3S Q;  3PO2 G;  4A3C G;  1VQ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...