2ZM6L

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
total genus 10
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2zm6L00
2NVQH 2ZJPA 3CCMA 1NMFA 2WB1G 4GLXA 4OX9Q 3PUVA 3I56A 1XNQL 2IX1A 1I50H 2OTJA 4QGUA 1WCMG 2R7FA 3ER0A 4LUVA 3HOYG 1EFWA 2Z0SA 3S14H 1GVPA 2ZM6L 3I4MH 1ASZA 1HZCA 4DV6Q 4JI7L 1EYGA 1I3QH 4R4TA 1J5EL 1B8AA 1UE6A 2HIVA 4YCWA 2RCNA 2VQFQ 3PO2G 4A3LH 1PV4A 4DR5L 1XMOL 1S40A 1PYSB 1JJGA 1FJGL 1L1OC 2KENA 4XIGS 1JJ2A 4LFBQ 1N32L 1YNXA 1Z47A 2I5MX 1FJGQ 3EN2A 3KJPA 3KF8B 4HIKA 1I5FA 1T9HA 4H02A 4A3FH 3CC2A 4IFDJ 1V1QA 1WYDA 1NJIC 4DK3C 1WFQA 3PUXA 4A3KH 4L5SA 1Q86C 3RLOA 4JI2L 1AE3A 2JA9A 1BBWA 4B3TL 3U4ZA 3UE0A 3EIVA 1PFSA 3E9IA 2E5LL 3HOZG 5C4JH 4R4QA 4ALPA 3U58A 5LMNL 2B63H 2XTIA 4X62L 1N36L 3M7NA 5GAHC 4BXXH 5LMUQ 1Q1BA 2WB1E 4DV2L 4DR7Q 1N33Q 1N36Q 4LWCA 2ZTDA 3S2HH 4DV7Q 2JA5H 3PO3H 5C4XH 1Y1VH 2R7ZG 1EIFA 2K5VA 2V1CC 3K81C 1M90C 4A4IA 2PNHA 4WJ4A 3GTMH 5M5XH 4OO1G 3JC66 4GOPB 1PH2A 4B3MQ 2AMCB 2MNAA 3CC7A 3F1ZA 3T1HQ 1W2BA 1PH8A 2UUBQ 1VQFA 1OXXK 2RF4A 2UUAQ 2KCTA 4DV0L 2BH8A 3HOYH 1QZGA 4X6AH 1B70B 1Z9FA 2PQAA 1YJ9A 3BZCA 1YEZA 1IBKL 4Y7NH 2BH2A 2CFMA 4A3IH 3KF6B 2JEAI 4IOCA 4IJHA 3T1YL 4A3GG 1SR3A 2BA1A 3J80c 1IBKQ 2LXKA 2I5HA 5BR8Q 3CMEA 3F2BA 5ELNA 5IYDG 1L0WA 1CSQA 4LF8Q 1A62A 2JK8A 5EAYA 4GLVB 1YJNA 1XMQQ 2IX0A 3CCVA 4AQYL 1S3OA 4X66Q 1VQOA 4GOPA 3K8AA 3TS0A 2N49A 4GN4B 3J7A5 3J7ZC 1E22A 1YZ6A 3STBD 4JV5Q 4YWLA 4O2DA 2K5HA 2Z6KA 1MJEA 5HGQA 1Q81C 1N9WA 1M1KC 4C3IH 4OO1I 3F2CA 2WAQG 4JI1L 1VQDA 1VQNA 1MKHA 3NELA 5GQOA 3KF6A 1PH7A 2Q2UA 4L5RC 4C2MH 1XNRQ 1ASYA 3PIOA 2QGQA 1KAWA 1E1OA 4ME3A 1Q46A 4IPGA 4YCUA 4DV5Q 4L5TA 4JI6Q 4LF5Q 2GN5A 1IZ6A 1W3SA 3K0XA 3AQQA 4AH6A 3HOUG 2VQEL 4LF7L 2UU9L 1KL9A 3U4VA 2R7ZH 1JE5A 3RLNA 2K5NA 3W5OA 1CSPA 2UU9Q 2NN6G 4BBSG 1KHIA 3S16H 3RR5A 4HJ5A 1K8GA 4JI4L 3S1QH 1VQHA 5IYCG 1YVCA 2UXDL 3W1GA 2K4KA 3JAMi 5IY0A 4DR3Q 2UXCL 2YTXA 3MEFA 1VQ9A 4JI4Q 2R92G 4X65L 4JI3L 4NXMQ 5M3FG 1XTDA 3KLWA 1NE3A 4KI0A 4A3EG 1HR0W 2QEXA 1D7QA 1SN8A 4AYBG 1CKNB 4A3GH 3BZKA 5GROA 4FDBA 4LFAL 2JA8G 3ULLA 2OTLA 1TWCH 3CCLA 4LF9Q 2NVXH 5IYDH 3UDGA 2DUDA 1VQ8A 2ID0A 3I4NG 3HOXG 1C0AA 1JT8A 1QVFA 2EQSA 5AJ3L 2ASBA 2F4VQ 2IHEA 4DUZQ 1HJPA 4A3DG 2C35B 1GO3E 5AJ3Q 4HIMA 4DV3Q 3PUZA 1K8AC 2JA7G 4QQBX 2NN6I 3BU2A 4BY1G 3NEMA 2YTYA 3CMAA 3GTPH 4LF4Q 3IRBA 1CKNA 3CP0A 1PYBA 3MXNB 1E1TA 1G291 1V43A 1X3FA 2CWAA 5FLMG 4DV6L 1Q8KA 4YWMA 4IPDA 4P71A 4HJ8A 4DPGA 2HIXA 3KJOA 3J81i 2VQFL 4K0KQ 1RIPA 1HNWQ 2K14A 2R93G 1UE1A 3HOUH 4PZ8A 3CCEA 4A93G 4RG1A 3A74A 3E0EA 3S1RH 3H3VH 2N3SA 1XJVA 4LFBL 1BKBA 2OQ0A 1DGSA 2YTVA 3OW2A 1VQIA 4AYBE 1E7ZA 3AFQA 1X9NA 1L1OA 4TVAB 1G51A 2E2JH 3S1NH 4GNXB 5IYCH 1EIYB 1Q12A 3TREA 1B7YB 3S2DH 4LFCQ 4R4OA 3CPFA 2MQHA 5HY6A 4DKAC 5LMNW 5FLXc 5C3EG 1VQ4A 1A63A 3CQZH 4PG3A 1X56A 2ZTCA 4DR6Q 5M3FH 1SE8A 3HFZB 4A3EH 1VQ5A 1LUZA 1YJWA 2NVTH 1IBML 4JOIC 4PMWA 1K3RA 2OWOA 4JCVE 2JA8H 1CKMA 1Q1EA 1IBMQ 1LTLA 2PI2A 2EIFA 5LMUL 1KD1C 3HOXH 4DR7L 1HNZQ 1N33L 2N8NA 3VDYA 2UXBQ 3ICEA 4DV7L 4DR2Q 1G6PA 4NB3A 4OWXB 1VQMA 4POFA 4A3DH 2KBNA 2IY5B 1EWIA 4GNXC 4DR1L 2F52A 4EQ5A 1C9OA 1LYLA 1P16A 3U50C 1QVGA 4B3ML 2JA7H 4WJ3M 4JI8Q 1AH9A 3T1HL 4DR1Q 4UP8A 2UUBL 2F3IA 2UUAL 1MIUA 5GAEC 5JJIA 2RHQB 3EBEA 5FLMH 1WCMH 3KDFB 2JA6G 4B3RQ 1PHJA 4QY7A 4UP7A 5ELOA 4A3JG 1PH5A 2GVBA 3CCUA 1PA6A 1VQ6A 3GTGH 4MNOA 4UP9A 2RHSB 5BR8L 4LF6Q 3A5ZB 4P72A 3PO2H 3A0JA 4DUYL 4LF8L 1PH9A 4IO9A 4JI0L 2VUMG 2AHOB 2OQKA 1LM0A 1XMQL 1U0LA 4OONA 4X66L 4DUYQ 4LW1A 2BA0A 4L5QA 4JI0Q 5JJLA 3TQYA 3GTOH 5JJKA 4R1JA 4YY3Q 4A3BG 1KC8C 5C3EH 1YIJA 4JV5L 1AE2A 4B3SQ 1UE5A 2ATWA 3S1MH 1J6QA 5IP9G 3K7UC 1K73C 3KOJA 2VZAA 2D0PA 1EQQA 1FGUA 1P8LA 1XNRL 2VL6A 3HOWG 2XGTA 2CWPA 5FJ8G 3HOZH 4JI6L 1QUQB 4JYAL 1HZ9A 4DV5L 4LF5L 1I94Q 2D62A 2KHJA 2ZJRA 1U5KA 2HHHQ 4A3CG 5IWAL 1YHBA 1PH1A 2WFWA 1E3PA 1QVCA 2JQOA 2MO0A 3H0GG 4DK6C 1N34Q 4P73A 2MFIA 3AYHB 2VY3A 5IWAQ 5IYBG 4P74A 3CC4A 4AIMA 4BA1I 1SRUA 3L2PA 4DR3L 4NPSA 3M4QA 1K83H 1KIXA 2VS1A 3GTJH 4NXML 4KHZA 2JA6H 4KHPQ 2VW9A 4A3JH 4JBWA 3D0FA 2YYZA 4NXNQ 1Q7YC 4DR4Q 3ERSX 1YI2A 4LF9L 1K9MC 1SLJA 1JJCB 1BBUA 5IP7G 3ZJYC 1YHQA 5GAGC 3PF4A 1GKHA 5E7NA 4O0AA 2F4VL 3LGJA 4DUZL 5IT9c 4DV4Q 4A75A 4IFDI 2WAQE 3OYYA 4A3BH 1SROA 3G4SA 2ALYB 2ES2A 1HZBA 4IJLA 4DV3L 2I0QA 3NENA 1CKOA 3CCSA 3B6YA 4GKKL 2E2HH 1VQAA 1X3GA 3F2DA 3PCOB 4DV1Q 1JB7A 3E9HA 4LF4L 4GKKQ 1WJJA 2NZOA 3PUYA 5GADC 2IHFA 3HOWH 1VQKA 5FJ8H 3JAMc 3W1BA 2NZHA 4JBJA 3HOVG 1TWFH 4IOAA 4EX5A 4GKJQ 4J15A 1IBLQ 1SFOH 4UY8C 4K0KL 1HNWL 2VNUD 3UDFA 4JG2A 4JBKA 3RN5A 4QL5A 3M4OH 4A3CH 1HNXQ 2MO1A 5J3BA 4YWKA 2A1AA 3RLFA 3H0GH 1Y1WG 1OXUA 1YITA 2GVAA 2QA4A 2B3GA 5IYBH 3HKZG 4MZ9A 1PVOA 4LFCL 4JBMA 4BBRG 3I4OA 4BBSH 2Y0SG 1HR0Q 2K50A 1OXVA 3CCJA 2IT1A 4JI5Q 1Q82C 3CPWA 1HZAA 3CAMA 3M3YH 4DR6L 1VQGA 3TS2A 1A8VA 2HQLA 1GM5A 1EOVA 1NBWA 2R92H 3S24A 2PI2E 2JJQA 3GTKH 1A0IA 1VCIA 5C44G 4JOIA 4RMFA 3TEHB 3CCQA 5IP7H 1VQPA 1XNQQ 2I5LX 4GS3A 4YHHL 1L2FA 2Q2IA 1HNZL 1VQCA 2L15A 2ZM6Q 3PV0A 4XTCS 4IPHA 4X64L 4A3IG 3I4NH 2UXBL 4DR2L 4JI7Q 4TQUS 4YHHQ 2LSSA 1QZHA 2E8GA 3J81c 1J5EQ 2AKWB 3G71A 1KXLA 4X64Q 2CQOA 5C0XG 4DR5Q 4GNXA 1XMOQ 4JI8L 1O7IA 3L0OA 3M85A 2CKZB 3I7FA 4A3MG 3GD7A 5JEAG 1C7YA 1N32Q 2E2IH 1MJCA 2N78A 1D8LA 3RNUA 4BY1H 4OWTB 2WP8J 3GO5A 3STBC 1UE7A 5M5WH 1N8RC 1X3EA 3HOVH 4B3RL 3HKZE 3CF5A 5C4XG 2Y0SE 3J80i 3WWVA 4DAMA 3D31A 4HJAA 4LF6L 2PQAB 2B29A 4JI2Q 3PSIA 1V9PA 1Y1WH 2R7DA 2R93H 4B3TQ 1H95A 1PH3A 4HIDA 1JMCA 1VQLA 2E5LQ 1FVIA 1KQSA 3AFPA 4A93H 2D0OA 1NMGA 4IPCA 5LMNQ 3PGZA 4X62Q 4PZ7A 1TWAH 4DAYB 2R6GA 4C3HH 1EQRA 3FP9A 1YBYA 4BBRH 4YY3L 4HJ9A 3CCRA 1XPOA 4DV2Q 1EUJA 3RZOH 4B3SL 4YCVA 2DGYA 2AWOA 4PZ6A 5IE8A 1XPUA 4BY7G 5C0XI 3OTOL 1I6HH 2KHIA 3NBHB 1NY4A 3M4PA 2CCZA 5M5YH 4UPAA 1IXRA 1VQ7A 5C44H 3UDIA 3KDFA 3OTOQ 2UUCL 3F8TA 4OWWB 4Y52H 3BJUA 5M3MG 4GN5A 1VQBA 4DV0Q 4HJ7A 2UUCQ 4GN3B 1I94L 1TXYA 2HHHL 1IYJB 4IFDG 3FKIG 1E24A 3PF5A 3T1YQ 4QJFA 1N34L 4R4CA 2FXQA 3G48A 3GDEA 4C3JH 3RN2A 2HT1A 4JYAQ 4R4IA 4BA2I 2NVYH 3UE1A 4A3MH 3M9BA 1OTCA 2H5XA 4DNIA 1WI5A 2ZTEA 4GOPC 2YU9H 3RZDH 4AQYQ 5H1SE 4KHPL 1YHAA 4KLKA 3G6EA 4NXNL 1SMXA 4DR4L 3PIPA 1Y14B 2Z6KC 2JE6I 1X54A 3ULJA 2Q2TA 1XPRA 3ULPA 1VS0A 1CUKA 1QUQA 4JI1Q 4QIWE 4OXPA 2JEBI 3I55A 3I4MG 2VUMH 1WOCA 1NTGA 4DV4L 4JC0A 3AEVA 5K36G 4GLAC 1UWVA 1R9TH 4A3LG 4HIOA 3KYHC 2VQEQ 4LF7Q 3A5UA 1HH2P 3KFUA 4BY7H 1OXTA 2EXDA 4DV1L 1UEBA 3H15A 2PMZE 1X65A 1TWHH 1GD7A 1OXSC 1X6OA 4MTNA 5IP9H 1PH6A 4P75A 4POGA 3S15H 3HKSA 1KRTA 1BVSA 2A8VA 2K75A 5M3MH 4GKJL 2UXDQ 3L7ZC 3CXCA 4A3FG 1IBLL 3S17H 4A76A 2UXCQ 3Q8DA 5C0XJ 4LUZA 2ZJQA 2A19A 4X65Q 4A3KG 1S72A 2LXJA 1KRSA 3I2ZA 1VQEA 4JI3Q 1HNXL 3J81j 1PH4A 3FHWA 1VQJA 3FKIH 2YV5A 5DLQE 5JEAJ 4LFAQ 2KCMA 3DM3A 2B63G 3CW2C 4BXXG 1X55A 1RL2A 3PUWA 1K0RA 1HR0L 3CD6A 4LNQA 3GTLH 3SGIA 3DLLA 1FL0A 4JI5L 3TRZA 1L1OB 2JA5G 3K7AH 3H3VI 1TWGH 3PO3G 4LUOA 1Y1VG 3UDXA 4APVA 2K52A 3K80C 1IL2A 2AWNA 4OX9L 3GTQH 2Q2HA 2OCEA
chains in the Genus database with same CATH superfamily
3NK9A 3BYTB 3CCMA 1MSHA 1NMFA 2WB1G 3WOEA 4OX9Q 1EIHA 1WCMG 3S14H 5BN4A 1EFWA 2PQEA 3FVQA 5IT9E 3I4NB 1EYGA 3HS0C 1B8AA 2HIVA 4YCWA 2VQFQ 1B2TA 2NWGA 1HFGA 1S40A 4DFAA 2PZWA 2XWJB 5IOCA 1JJ2A 1IKMA 5EKIA 4BY1B 1O7ZA 4H02A 1BBXC 3CC2A 1ET6A 1HTPA 1I4HA 1YNJC 1DXMA 1WYDA 1BR9A 3A7LA 4L5SA 4ZQ3A 1AE3A 2R93B 3U4ZA 3D4WA 3EIVA 3HOZG 4A93B 2B63H 3U58A 3MXPA 3M7NA 1N36L 2QF7A 2CW0C 1EY0A 2Y0SB 4DV2L 4DR7Q 1N36Q 4LWCA 2ZXPA 2ZTDA 1PTOB 1G6ZA 4QMGA 5D65A 1EIFA 2V4DA 1I6HB 2K5VA 2V1CC 4WJ4A 1GHKA 3OMGA 4QUFA 1W2BA 1PH8A 2KCTA 4CKCA 2Z9HA 1QZGA 4I7AA 1BQQT 1LTSD 2X6GA 2CFMA 2IX3A 4A3IH 4IOCA 4A3GG 1SR3A 2A6HC 3J80c 1F9PA 4E6IA 4C3JB 5C0XH 1D6EC 1CSQA 1S4ZA 4LF8Q 1A62A 1JOKA 4ZUIA 4A3MB 4GLVB 4JPBW 1EIGA 2IX0A 3RZDB 4X66Q 2XVSA 4GOPA 3K8AA 3PIO3 4GN4B 3J7ZC 3MC0B 3KLSA 3R8BA 5IGEA 1K8MA 4RCOA 1V8QA 2F1MA 1Q81C 1M1KC 4C3IH 1MSGA 3F2CA 2WAQG 4K6DA 4O1NA 4JI1L 4FXGC 3NELA 5FLXL 5GQOA 4C2MH 3I90A 1UUPA 1NUCA 4JVZA 2K28A 1Q46A 2LY7A 1W3SA 4XYQA 3HOUG 2N88A 1RJTA 3U4VA 1Q3LA 3RLNA 1BUVT 2QEJC 3W5OA 1SXTA 2NN6G 1L0YB 5M9OA 5EKKA 2UXDL 5IY0A 2E75C 1DOKA 1EZ6A 3MEFA 3J80E 4X65L 4NXMQ 4A3EG 1JOOA 1V1PA 4LFAL 1VMPA 3ULLA 4R9WA 4LF9Q 4DXFA 3NUCA 3U9SA 1LO5D 3HOXG 1PTOD 1C0AA 2EQSA 5AJ3L 2ASBA 2F4VQ 2IHEA 4DUZQ 2M9VA 3A55A 3GTQB 1QCBD 4K6LA 5AJ3Q 1CFMA 1YNND 2IJ0A 4K2KA 4IN3A 1ESRA 1XXGA 1I50B 4C1NI 4LF4Q 3H91A 1PYBA 3MXNB 4RWSC 2F0MA 3VA7A 5FLMG 4CDEC 1I3QB 1UE1A 1CZWA 3H09A 4RG1A 3E0EA 1TY2A 4PMCA 4LFBL 2OQ0A 1AZQA 2YTVA 4AYBE 3AFQA 1X9NA 1EWHA 1L1OA 2AUKA 1R4PB 1Q12A 3FEWX 3S2DH 4R4OA 1ZEQX 5LMNW 5FLXc 1VQ4A 1PTOF 3T16A 4MN3A 1M8AA 3HOVB 4HN7A 2NVTH 3J7AF 1HA5A 2D5DA 5C4JB 2EIFA 3TSSA 1HNZQ 1N33L 2N8NA 1D5MC 5EPLA 1VQMA 4XT3B 1Y1VB 1KDCA 1TKWB 1GUSA 1KABA 4TSSA 5M5XB 1QVGA 1LYLA 3CRLC 4L8JA 2WB1B 2UUBL 2BE5D 3MAQA 5KNBA 2JA6G 1U4LA 5ELOA 4A3JG 1BDOA 1ET9A 4ILWA 4LF6Q 4DUYL 1PZJD 1XMQL 1S5DD 4DUYQ 3TP6A 4LW1A 3UI2A 4L5QA 1Q90A 5KRUA 5C3EH 2FJ2A 1CK1A 4FP5D 3S1MH 1EY9A 1EY8A 3K7UC 3KOJA 1P8LA 1SYGA 1C48A 2CWPA 1HZ9A 2NTSA 2D62A 4A3CG 3VR4A 5CBAE 1JE4A 2X6LA 1CQFA 1N34Q 3D6CA 3AYHB 3DHQA 2LFNA 3VYRA 4P74A 2AQ3B 4DR3L 1KLGD 3M4QA 1K83H 3MZ5A 4KHPQ 3D0FA 4A3GB 3SR1A 3ERSX 1LT3D 1LTGD 2Q8RE 1SLJA 2J4XA 5IP7G 2B2UA 4DV4Q 3D4RA 3G4SA 2ALYB 1QG7A 2P5ZX 2E2HH 1SNOA 3PCOB 4IUQA 5GADC 2K01A 2QDLA 5FJ8H 3W1BA 3S14B 4IOAA 1TWFH 1BO0A 2VNUD 1HNWL 3HOUB 4JG2A 1CHQD 1HNXQ 5J3BA 2A1AA 1Y1WG 3K0YA 1OXUA 4B9WA 3N52A 1IKLA 1SNCA 3T13A 1WVLA 2KA7A 5I2XA 1OXVA 4TRDA 2IT1A 4BWGB 3CCJA 1Q82C 4DR6L 2D9UA 4X3SA 3TS2A 4UAIA 1PYWD 4M1UB 2R92H 3S24A 3IL8A 3GTKH 5C44G 1O80A 4DF7A 1PDQA 3HOXB 3HRZC 2Q2IA 4FVMA 4DK0A 4IPHA 3I4NH 4DR2L 4JI7Q 2B8FA 3MEHA 2AKWB 3G71A 2EYLA 5D3DA 4GNXA 1XMOQ 1A15A 4CDFC 4Q5VA 1AEXA 1TR5A 3TZUA 4ULLA 3QJYA 5JEAG 1RDPD 4U673 1C7YA 2N78A 2B2WA 4DA2A 4BY1H 2WP8J 4EQPA 3HKZE 3CF5A 1QNUA 3WWVA 3J80i 2BOSA 1STAA 2PQAB 4NMZA 2R93H 4Z9CB 1JMCA 1VQLA 1S5FD 1U4RA 2R3ZA 2D0OA 4A93H 5LMNQ 1WTPA 4PZ7A 2R6GA 1EQRA 4HJ9A 4RGOS 2IW3A 2AWOA 4ZUJA 3VR6A 1XPUA 4BY7G 1HCZA 3NE5B 1I6HH 3M4PA 1I4QA 2F4IA 5CV7A 3KDFA 4OWWB 1B3QA 3BJUA 1CHPD 4KV6A 4GN5A 1VQBA 2O5IC 4HJ7A 4K5XA 5CC4A 2HHHL 3I73A 1TQOA 2QDBA 4S3SA 2WKDA 1J9OA 1DOMA 3PIP3 3OWFA 2RSOA 2MHVA 2EY6A 4C3JH 2K5QA 3IFTA 4R4IA 2HT1A 1QJOA 4A3MH 3M9BA 1OTCA 2H5XA 4KMUC 2ZTEA 1WI5A 4DNIA 5IGCA 3RZDH 1H9SB 1SMXA 4DR4L 1X54A 3ULJA 2Q2TA 1CUKA 1EWCA 1D1KA 4YIJA 3NHHA 3SK6A 3I55A 1GUNA 3I4MG 4JC0A 1W6KA 3AEVA 5K36G 4GLAC 3E5SA 2EXZA 2SEBD 3D4DA 4MTNA 5IP9H 5IGDA 4OGQC 1HHVA 3HKSA 1KRTA 4RHRA 4A3FG 1EQTA 2C9OA 2EY1A 2ZJQA 3CKIB 4H13C 3RD4A 2LXJA 2H1EA 3J81j 1PH4A 3K58A 3FKIH 2BCOA 1FNUA 4HAEA 5JEAJ 1FGBD 3DM3A 2J0TD 5AFWA 1RL2A 5T1GA 1SMYC 1H9KA 4BBSB 4LNQA 4K8IA 3O13A 3TRZA 3NPPA 4KK7A 1V1OA 2O4XA 4UDUC 2JA5G 3GTQH 1IL2A 3UDXA 4JCVE 1Y8PB 5CV6A 1XNQL 3PUVA 3EA6A 1QWYA 3I56A 1I50H 2OTJA 1K0SA 3ER0A 4ZRZA 2KCNA 2ZM6L 1EY4A 1ASZA 1I3QH 5ELBA 3PO2G 4DR5L 4FF2A 1EYCA 4HMJA 3TMEA 1F77A 1FJGL 2KENA 4XIGS 1F2ZA 2I5MX 2VB3X 1FJGQ 3EN2A 5M5WB 3KF8B 5DM63 5JPNC 1V1QA 4DK3C 1WFQA 3PUXA 1WTOA 1BBWA 2E2DC 1Y1WB 3HG9A 5EPJA 4ZLTF 5C4JH 2XTIA 2RKSA 2L11A 1TWAB 4OHJA 5GAHC 1JICA 4K5WA 1RKNA 1KLUD 3E0JA 1Y1VH 2R7ZG 4B08A 1A6XA 2PNHA 5M5YB 5M5XH 4OO1G 3QIAA 5C44B 2ICIA 4B3MQ 1PRTD 2AMCB 2PZTA 4IUTA 3F1ZA 2MNAA 4WFN3 3T1HQ 2OT2A 1ILQA 1VDZA 1OXXK 1VQFA 2RF4A 4CGYB 4DV0L 2UUAQ 2BH8A 2L5TA 4X6AH 2NB0A 3BZCA 5C5MA 4G7HC 4FO2A 2L9HA 1A2UA 3KF6B 5BR8Q 3MWYW 4DAYA 3LNNA 2IL8A 4WORA 1L0WA 1SYDA 2JK8A 4RGTA 3A7AB 4AQYL 1M4VA 1VQOA 3NBHA 4KHVA 1SE4A 4K14A 4DGZA 2K5HA 1VQNA 1VQDA 3KUPA 2F0TA 5I2YA 2OEOA 3S9WA 3PIOA 1PRTF 2QGQA 2QCPX 1E1OA 4ME3A 4CJ0B 4JI6Q 4JYAQ 4DV5Q 4LF5Q 3K0XA 1R9TB 4AH6A 4LF7L 4BY7B 4QIWB 1JE5A 1CSPA 2K33A 3S15B 5FO7B 3RR5A 4LK1C 1XYIA 1YVCA 1BXTA 2YTXA 1VQ9A 1F9RA 1FNVA 1TWFB 1XTDA 5M3FG 2QEXA 2PMZB 1SN8A 2FMCA 2XNAC 4A3GH 3CCLA 1RHPA 2NVXH 3QO2A 3P75A 2RBMA 3TN2A 1JT8A 4N9PA 1PZID 1EFID 1XWEA 1R4QB 1TWGB 4RKLA 1HJPA 4A3DG 3G7LA 1SE2A 3TP8A 4DV3Q 2KEDA 3PUZA 1QB5D 3M7GA 2JA7G 4DNRB 3A8KE 2NN6I 3GTKB 3CMAA 1UAPA 3M4YA 3IRBA 1TS3A 1E1TA 1LTBD 1V43A 4YWMA 2EYHA 4HJ8A 2HIXA 3KJOA 2VQFL 1IW7C 4K0KQ 3MFYA 2K14A 3HOUH 1XTCD 4PZ8A 3CCEA 3A74A 1H9RA 2L55A 1IHZA 1ENAA 1BKBA 1VQIA 1G51A 1EIYB 1I4RA 4LFCQ 5HY6A 4A3FB 3DEPA 1Y8NB 1X56A 2ZTCA 3HFZB 5IIFA 5JPMC 4A3EH 3MXNA 4HMIA 4PMWA 2OWOA 3OSOA 1NSNS 2SOBA 1LTLA 3FDTA 3GP7A 2Z6BA 1NR4A 3HOXH 4DR7L 2DY7A 5CORA 5CV4A 2UXBQ 3SEBA 3S2HB 2J7ZA 1G6PA 4NB3A 1CZGA 4POFA 1LTID 2IY5B 2CH4W 2F52A 2AQ2B 2Z4IA 1LACA 1P16A 4WJ3M 2CH4A 3NQTA 2F3IA 1LT6D 3I8ZA 4K2LA 5FLMH 1ZXTA 4B3RQ 2F0QA 3K57A 3CCUA 2F0JA 1HXYD 5D14A 1PA6A 3GTGH 2RHSB 1BNZA 4P72A 3JAML 1UNSA 4LF8L 1PH9A 4IO9A 2VUMG 2KCCA 5E3FA 1U0LA 1IYVA 4X66L 2JSOA 5JJLA 1TS5A 2ZXOA 4A3BG 1PXUA 1KC8C 3VR3A 1FNWA 1AE2A 4KD3A 4B3SQ 1EY5A 2B2VA 5HGTA 1YNJD 2D0PA 1FGUA 4KN4C 3MHBA 2CW0D 1U5KA 2G9DA 2M00A 3GV3A 2R7ZB 1QVCA 3H0GG 4DK6C 1TT2A 4ZKBB 5IYBG 1K28A 3S1QB 4BA1I 1G2SA 1SRUA 3L2PA 3A8JE 1KIXA 3I3CA 4NXML 4KHZA 1EYDA 5A35A 2JA6H 4PQXA 4A3JH 4JBWA 1G91A 1CA5A 1YI2A 1TWCB 4LF9L 3FKIB 1JJCB 2F0KA 3Q24A 1UEAB 3ZJYC 2A6HD 1AFPA 3PF4A 3T51B 5F2DA 5E7NA 2I07B 2F4VL 3LGJA 4DUZL 4KKSA 4A75A 3AB9A 1VF5C 3NENA 3CCSA 3B6YA 4EQNA 1GHJA 3GTPB 2FMMA 1BF4A 4LF4L 1JC7A 3K5NA 4GKKQ 4M8AA 3PUYA 3OIPA 3QOLA 1VQKA 3NWTA 3K5MA 3JAMc 4JBJA 4EX5A 1FD7D 5C3XA 5IGBA 1JWUD 1EOTA 2HD3A 4JBKA 4A3CH 1E2WA 4FYDA 3S1RB 4YWKA 1AZPA 4QUCA 1YITA 1AW7A 1HFNA 3MFGA 1BOSA 4ABNA 3S1NB 2EE1A 4MZ9A 3HP3A 4BBRG 4BBSH 3OHXC 1WTHA 2K50A 2A6EC 3CQZB 2EYOA 3BDOA 2EJFC 5M3FB 2D2CC 1EOVA 5G3LF 1GUTA 1A0IA 2EJGC 3BVGA 4JOIA 3D6WA 5IP7H 2K04A 1HNZL 4XTCS 4A3IG 2Z1CA 1QZHA 1J5EQ 3J81c 4A3DB 4IUVA 5C0XG 2KVMA 2L4NA 2JA7B 4F7XA 3ND9A 1O7IA 3L0OA 3M85A 1STBA 2F03A 1N32Q 1D8LA 2B2TA 3STBC 5M5WH 1WCMB 3GO5A 1UE7A 3H6MA 2PPBC 4KY6A 3DXJC 1CI3M 2Y0SE 4LF6L 2EOTA 3EROA 4JI2Q 1Y1WH 4B3TQ 1PH3A 1EU4A 2E5LQ 1KQSA 1QNKA 2KOLA 2NTTA 5KYIA 4X62Q 1TWAH 5FLXE 3GTOB 3CCRA 1RODA 2H4OA 1XPOA 1EEID 5EBCA 4HSVA 5IGFA 4RGMA 2HDMA 4OELB 3IFDA 3OTOL 2KHIA 1B3AA 1A3UA 5M5YH 1IXRA 2NYZD 1VQ7A 5C44H 5KNCA 3OTOQ 1S5CD 2ZXRA 1I4PA 3F8TA 4ZAIA 3HOZB 2JXMB 5M3MG 2F3WA 2A73B 1I4GA 2EPBA 3MA2B 3NBIA 4FXDA 3PF5A 2JN4A 3T1YQ 4LJZC 1N34L 3D3RA 3GDEA 4BA2I 3UE1A 1EY7A 5JEAH 1SNPA 4GOPC 1T5EA 1QE6A 3GTJB 2MGSA 2Z4HA 2NUCA 5H1SE 4KHPL 3G6EA 1HRJA 1A2TA 3PIPA 1Y14B 4HTHA 4N9TA 4P2CB 1GUOA 5LHY1 3FRPB 4F88A 1QUQA 2NVXB 3BZDB 1V1PB 1WTQA 4KD4A 1WTRA 1WOCA 1W6JA 2BDOA 4DV4L 1MGSA 4A3BB 1R9TH 4A3LG 4HIOA 3V96A 2VQEQ 4BY7H 1HH2P 4OIKA 2EYFA 1OXTA 1GJXA 1UEBA 5JAVA 3D8GA 3H15A 4C56C 1X65A 1OXSC 1X6OA 3U9OA 3S15H 2RDFA 4HCSA 2WAQB 1BVSA 2K75A 1D7QA 4HSPA 3L7ZC 3CXCA 2UXCQ 4PNYA 1SFOB 5C0XJ 4DN4M 2PW5A 4A3KG 4JI3Q 3M4OB 3F2UA 1HNXL 2A69C 3FHWA 1VQJA 4K8JA 4NP5A 3H0GB 5DLQE 5KGUA 1NNXA 4CBVA 2XN9C 1I4XA 1SNQA 4BXXG 1K0RA 3SGIA 4J1MA 2A5HA 4ZCKA 1FL0A 1L1OB 3K7AH 3H3VI 1TWGH 3PO3G 4APVA 5C4XG 1LT4D 4A3EB 4GLXA 2IX1A 4R8IA 4QGUA 1EY6A 2R7FA 4LUVA 1JORA 3HOYG 5IGGA 4MTKA 3NWSA 3I4MH 1HQRD 4JI7L 2K03A 4DV6Q 3C1EA 1UE6A 4WJWA 3C1FA 4X3TA 5K36H 2RCNA 2HCIA 3TP7A 4OEMB 1XMOL 1STGA 1PYSB 2E76C 1L1OC 1Z47A 5C4ZA 4RAUC 3KJPA 1I5FA 4A3FH 1O78A 3BYYB 3W2DA 2KEEA 3WDNA 2K5DA 3RLOA 3GTGB 3UE0A 2A68C 1KNAA 3E9IA 5FO8B 5J39A 2JP1A 4MIUA 4R4QA 5LMNL 4ALPA 4BBRB 4XDXA 2KJXA 5LMUQ 1Q1BA 2WB1E 5C5LA 4XXEA 3RZOB 1SEBD 3S2HH 4DV7Q 4FF3A 5HURA 2JA5H 3PQIA 5I4DA 4N8FA 2F0LA 1M90C 2PW7A 3JC66 1PH2A 3CC7A 1TU2B 1B70B 4KJOA 1Z9FA 1IBKL 4Y7NH 2BH2A 2JEAI 1HPCA 2BA1A 1MBYA 1IBKQ 2LXKA 3F2BA 3CMEA 1GXDC 1BCPC 5IYDG 1ONLA 3LWEA 5EAYA 3QR8A 1KTKA 1S3OA 2X69A 2SDFA 1DONA 2N49A 1L0XB 1CM9A 1E22A 1YZ6A 3DUZA 2JA6B 4JV5Q 4OIJA 4A3JB 3DM1A 2Z6KA 1MJEA 4CKEA 4OO1I 3J7YW 1NR2A 3KF6A 1XNRQ 4KTAA 1ASYA 2HQEA 4IPGA 2GN5A 1PMRA 3Q23A 2FINB 2UU9L 1KL9A 2R7ZH 4CJ2C 2K5NA 2UU9Q 4OO1H 1KHIA 3S1QH 1K8GA 4JI4L 1MD2D 5IYCG 1VF7A 3N6RA 2K4KA 3W1GA 5M3MB 3JAMi 3R93A 3S17B 1RCVD 4TKOB 4JI4Q 2R92G 1HR0W 1NE3A 4KI0A 2MJ8A 1CKNB 3GV6A 4AYBG 2DNCA 4ZKCB 3BZKA 4FDBA 2JA8G 2HDLA 5I6WA 1TWCH 4R8NA 3FPPA 2CVRA 1VQ8A 3I4NG 3C2PA 1T5XD 2FHTA 2PO4A 1QVFA 2B2UC 4ODGA 1ZYRC 2F0OA 1U4MA 1GO3E 4HIMA 2B2YA 1K8AC 2NVQB 1KAAA 4I7ZC 3BU2A 1K3BC 5CYUA 4BY1G 3NEMA 2YTYA 3GTPH 4HEDA 3CP0A 3RUZA 4ME5A 1LTRD 1Q8KA 4IPDA 4P71A 4DPGA 2L0CA 3J81i 1RIPA 5J1ZA 2R93G 4DNTB 4G4KA 4A93G 3S1RH 3ITPA 3K5LA 5FK9C 5KYLA 1XJVA 1DGSA 3OW2A 5KEEA 2E2JH 3S1NH 4GNXB 2EVBA 1B7YB 3VA5A 2XRSD 4DKAC 2MQHA 1A63A 1H95A 3CQZH 4PG3A 5CV8A 2L1BA 5M3FH 1ML0D 4A3KB 1SE8A 5D3IB 2F0IA 1YJWA 5CMDA 4KJNA 3BVMA 1Q1EA 1KD1C 1MHWC 4CKBA 3VDYA 1SMYD 3PO3B 4A3DH 2KBNA 4GNXC 4DR1L 4C3JG 1CA6A 3GTMB 4EQ5A 2JA7H 4B3ML 3U50C 4JI8Q 3T1HL 4DR1Q 2B2WC 4KY5A 2HCCA 2UUAL 2EZVA 1E0BA 3K5OA 2RHQB 2N55A 1WCMH 3KDFB 1PHJA 4UP7A 1AP0A 1VQ6A 4MNOA 3H94A 4UP9A 2NBFA 1D5ZC 5BR8L 5E4XA 3QB3A 3A0JA 1U9RA 4JI0L 2AHOB 2OQKA 3SDZA 1LT5D 4NW2A 1D2BA 1SDFA 3NXWA 1X3PA 1ICWA 4JI0Q 3TQYA 3GTOH 4H0LC 4R1JA 4YY3Q 2F0SA 1YIJA 3NTKA 2ATWA 1J6QA 5IP9G 3MTSA 1K73C 2VZAA 1EQQA 3ND8A 4I65A 3J7AV 1H9JA 3HOWG 2XGTA 3HOZH 1O7YA 2F0WA 4JI6L 4JYAL 4DV5L 4LF5L 1I94Q 5IWAL 1PH1A 1E3PA 2WFWA 2JQOA 3FMCA 2MO0A 4CJ1B 4KKTA 3NQIA 2VY3A 5IWAQ 3S16B 3KK7A 4PMBA 3EQLC 4AIMA 4NPSA 1WTXA 2K7VA 3GTJH 3I91A 4B9XA 3HEJA 2YYZA 4NXNQ 1Q7YC 1HUMA 4LAAA 1K9MC 3VYUA 1BBUA 3L3OC 4GZYC 4IUUA 1YHQA 5GAGC 4HR7B 5ELCA 3A54A 5IT9c 4IFDI 4A3BH 3KLSX 1SROA 2EJMA 2ES2A 2I0QA 1HZBA 4DV3L 1ENCA 3K7AB 1GOZA 5CV5A 1JB7A 4DV1Q 2NZ1D 3MVVA 1SBBB 1JQYD 1WJJA 2NZOA 2NZHA 3URYA 3HOVG 4GKJQ 2WKCA 1IBLQ 2G9HD 1SFOH 4K0KL 3I4MB 3UDFA 3M4OH 4QL5A 3DWPA 2MO1A 4IURA 3VR5A 3X3MA 3H0GH 1TVXA 4QF4A 1KDBA 2GVAA 2TMPA 3OPOA 2QA4A 5IYBH 1SYEA 3HKZG 2K1BA 1PVOA 5I9PA 3HGBA 2NN6H 4LFCL 4C3HG 3VYTA 1HR0Q 2B2YC 4JI5Q 3CPWA 1HZAA 1VQGA 1A8VA 2OF1A 1GM5A 4AYBB 2PI2E 2JA8B 5I9OA 2WIIB 2LMCB 4GS3A 4RFBA 4FXKC 4YHHL 3H3VC 1VQCA 2K5WA 2L15A 3PV0A 3T53B 4X64L 2UXBL 3EJIA 4J6HA 4TQUS 4YHHQ 2LSSA 1KXLA 1DD2A 4X64Q 2CQOA 2B8GA 1FR3A 2JA5B 1TS2A 2ENBA 2CKZB 1A3VA 3SK8A 1MJCA 2IWHA 3RNUA 4JK1C 2BDNA 4OWTB 4DAVA 4B3RL 1H9MA 1HQMC 3I70A 3V05A 5EQ0A 4XYOA 3VR2A 4DAMA 4Y7NB 2B29A 3PO2B 3PSIA 1IW7D 4HIDA 5DEHA 1FVIA 2CQAA 4IPCA 4EGVA 4DAYB 2SNMA 4BBRH 2XRQD 4DV2Q 1EUJA 3RZOH 1S5ED 4B3SL 4PZ6A 5C0XI 3NBHB 5IODA 1LLRD 1NY4A 5TSSA 1KDAA 2WACA 3NTIA 3G6JB 3UDIA 2UUCL 4Y52H 1RD9D 1SYFA 1SNMA 4C1NK 1TS4A 4GN3B 5KNDA 2M2LA 2UUCQ 1J8IA 4IFDG 1E24A 3VYSA 4R4CA 1PTOC 3G48A 1G2TA 1VMCA 2DJFC 2NVYH 3MXUA 5JVG3 2EYPA 2MPMA 1DZ1A 1SJED 2F0DA 2YU9H 4DU9A 3J81L 3SK5A 1YNNC 4XQNA 1YHAA 3LX0A 5DAUA 2I46A 4ID6A 1VS0A 2EYJA 4XT1B 4JI1Q 1ILPA 4QIWE 5C6AA 4OXPA 2HUGA 3L9AX 1LTTD 2F0VA 2QW7A 1UWVA 4G57A 3KYHC 1SE3A 3SVMA 3A5UA 5G3LD 1O7LA 3KFUA 4UHVA 2F0NA 2EXDA 2PMZE 3NP8A 4CDCC 4GKKL 1GD7A 4POGA 2WV6D 4P75A 3HOWB 1LABA 4F8MA 2A8VA 5M3MH 2UXDQ 3S17H 4A76A 3Q8DA 4LUZA 1I6VC 4X65Q 3I2ZA 3NSWA 4LFAQ 2KCMA 4N8X1 2B63G 1F2MA 1AN8A 1S5BD 1X55A 5C4HA 2E2JB 3ONAB 3CD6A 3DLLA 3SXHA 3M3YB 4LUOA 1WD1A 3NTHA 2Q2HA 2A19A 2OCEA 1DOLA 2ZJPA 3QOJA 5FO9B 1C8CA 2NVQH 2BE5C 1TY0A 3QWNA 2CHBD 2F0PA 2Z0SA 1GVPA 1SJHD 3ERQA 1HZCA 3TDQA 4R4TA 1J5EL 1EL0A 4A3LH 5LL6X 1PV4A 1B1ZA 1JJGA 5DM73 4LFBQ 1N32L 1YNXA 2E2IB 3P1HA 3JAME 2MUYA 1WD0A 4HIKA 2R61A 1T9HA 1OO9B 4QB4A 4IFDJ 1NJIC 2XIWA 4A3KH 5JOBA 1Q86C 1JOQA 2KHSA 4JI2L 2JA9A 4C3IG 4B3TL 4H44C 1PFSA 2E5LL 1SYCA 1EU3A 4FNFA 1A3TA 5LL6S 3HKZB 4X62L 2EYMA 4G7ZC 4BXXH 1HA6A 4C3HB 2PNRC 2KUMA 1Q8IA 1N33Q 1GUGA 3SE0A 5BN3A 1D5XC 4X3KA 3PO3H 2FFKB 5C4XH 5E1FA 1EEFD 2A6ED 2GA4B 4OL7A 2DNEA 3K81C 4A4IA 3GTMH 3TP5A 3BVZA 4GOPB 2ZT9C 2MP1A 4XQQA 2UUBQ 4G7OC 3HOYH 1X32A 2PQAA 2E74C 3PMFA 3J81E 1YJ9A 1YEZA 1E2VA 2F0EA 3T1YL 4IJHA 5I6YA 2I5HA 2Z8LA 1LV9A 5ELNA 1EQVA 3W3AA 4EQOA 4JW0A 3FPUB 3DWAA 1YJNA 3OIQA 1XMQQ 3CCVA 3TS0A 3J7A5 2B2VC 1SSOA 3STBD 2F0UA 4YWLA 4O2DA 4IALA 5HGQA 1N9WA 2KQ3A 1MKHA 1STYA 1JWMD 1PH7A 2Q2UA 4L5RC 2K05A 2VUMB 1KAWA 1STEA 4YCUA 3DMUA 1C4QA 4L5TA 1IZ6A 3AQQA 4X3UA 3K6OA 2VQEL 3R3OA 5ELDA 1ZKOA 2IPKD 2ICEC 3BDLA 1TWHB 4BBSG 3S16H 4HJ5A 1H9SA 1QILA 1VQHA 1LTAD 4DR3Q 2UXCL 4JI3L 3WOFA 3KLWA 1PFNA 5ELFA 1Y69U 4EVOA 5GROA 4V190 2OTLA 1NAPA 5IYDH 1CTMA 3UDGA 1HTLD 2DUDA 2ID0A 2RVLA 3GTLB 4HCEA 3Q0AA 2K6AA 3TBIB 2C35B 4QQBX 1X3QA 2VXWA 1CKNA 1Z7TA 1G291 2CWAA 1X3FA 4DV6L 2RDGA 3CU7A 3TZDA 1HNWQ 5EBDA 3CHBD 3E6ZX 3H3VH 1K8OA 2N3SA 3A8IE 4O42A 5E4WC 1NCVA 1Y8OB 1E7ZA 4TVAB 5K5PA 5COYA 3BDCA 5IYCH 3TREA 3BG3A 3X3NA 4DXGA 3CPFA 3P7JA 5C3EG 4KN7C 1SAPA 4DR6Q 1VQ5A 1LUZA 1IBML 4JOIC 1K3RA 3T56B 2JA8H 1CKMA 5CGKA 2B63B 2A69D 1IYUA 1ENFA 1IBMQ 2PI2A 5LMUL 2RQXA 4RHSA 1SYBA 3ICEA 4DV7L 2SNSA 2F0GA 4DR2Q 4OWXB 3OOCA 1BCPB 1EWIA 1C9OA 1ESFA 1DYQA 3KBGA 3KF8A 1AH9A 1B50A 5T1IA 4UP8A 2B2TC 4L63B 2RA4A 3HZXA 5CBEE 1MIUA 2RSNA 1JR0D 5GAEC 4QCLA 5JJIA 3EBEA 2OXPA 4QY7A 1D1IA 1PH5A 2GVBA 3Q6SA 4A3IB 2Q8TA 1JB3A 3K59A 3DWQA 3A5ZB 4L6TB 3PO2H 5EGTA 1LM0A 2NVYB 4OONA 2BA0A 1EYAA 5JJKA 4RA8A 1PTOH 1F2YA 3R2IA 2YU9B 3P20A 1F9SA 4JV5L 1UE5A 1WTWA 3Q22A 2JYOA 1PFBA 3GQBA 4C3IB 1XNRL 1RF2D 4C2MB 3I72A 2PCFB 2VL6A 2A68D 5FJ8G 1GUWA 1QUQB 1QOHA 3C46A 4LMQD 1KNEA 2KHJA 1II3A 2ZJRA 2HHHQ 4NDXA 2Q8IB 4WRDA 1YHBA 4RGNA 4P73A 2MFIA 3I4LA 2EY2A 3C3LA 3KLRA 3EVQA 5C3WA 2F0FA 2RCFA 5J22A 4V0BA 4FF4A 2VS1A 2VW9A 2C5CA 4DR4Q 5EKLA 5FOBB 2QKIC 2K32A 1BCPD 1GKHA 1PZKD 2PYKA 4O0AA 1WTVA 1B4OA 1F9QA 2WAQE 3OYYA 3AMUA 4IJLA 1CKOA 2XWBB 1VQAA 1X3GA 3F2DA 2EY5A 1G8ZD 3E9HA 4KKUA 3SHLA 1PRTB 5L37A 2IHFA 3HOWH 3ZYYX 4J15A 2DN8A 4UY8C 1FYCA 1DJRD 5DNFA 5NUCA 3RN5A 1DCZA 3RLFA 3MXGA 3T4AC 3CRKC 1RTOA 2B3GA 3BS1A 1RTNA 5A2QL 2DJGC 4JBMA 3S2DB 3I4OA 2WINB 2Y0SG 1B9NA 2F0HA 2VB2X 1BCPF 2XSCA 3CAMA 3M3YH 3IKJA 2HQLA 1PRTC 1NBWA 2NVTB 1JWSD 2JJQA 4Q0FA 1VCIA 1E2ZA 4RMFA 3TEHB 3CCQA 1VQPA 1XNQQ 2I5LX 4CHTB 4U68A 5KIXA 1HUNA 1L2FA 1SNDA 2ZM6Q 2G5DA 4KY7A 4ZYSA 4XQJA 2E8GA 5JVH3 1ZYRD 2LKVA 2EDGA 1STHA 5C4XB 3DEOA 4DR5Q 4JI8L 4IUNA 4H7BA 3I7FA 4A3MG 3GD7A 1IL8A 2AUJD 2F3VA 2E2IH 5IT9L 1N8RC 1JCKB 3HOYB 1X3EA 3HOVH 4MHEA 1B53A 1PLFA 1DM0B 3D31A 4HJAA 1V9PA 2R7DA 4RKBA 4RH6A 3AFPA 1NMGA 1PFMA 2O5JC 3PGZA 4IQZA 1TIID 4C3HH 3CC4A 2LS01 3FP9A 1YBYA 4YY3L 5C3EB 1CT1D 3A56A 4YCVA 3S1MB 2DGYA 4J8QA 5IE8A 4FF1A 5JJZA 3SK4A 4DAPA 2CCZA 4UPAA 5CR3A 3RMHA 3IAYA 4DV0Q 5EJWA 1I94L 1TXYA 1IYJB 4PV1C 3FKIG 3EFXD 3LWUA 4QJFA 2RDHA 2FXQA 4NKLA 3V2TA 1CQVA 3RN2A 2AQ1B 3OWEB 4F87A 4RCNA 1K83B 3R2TA 2B39A 2O2LD 4AQYQ 1ICFB 4KLKA 1XX8A 1F2LA 3OW7A 4NXNL 1B44D 2JE6I 2Z6KC 1XPRA 3ULPA 1U4PA 2JEBI 4DK1A 2A74C 2VUMH 1NTGA 4IUPA 1EZ8A 5ELEA 5BN5A 4LF7Q 4BS9A 2KECA 2E2HB 2QILA 4DV1L 4CDDC 1TWHH 3OMCA 3E3XA 1PH6A 4IZ8A 1MI2A 5A2QE 4GKJL 1IBLL 4K5VA 5FKAC 1S72A 5CV9A 1KRSA 1VQEA 2L12A 4IFDH 2YV5A 1STNA 2DY8A 3QG1A 5EPKA 5ISRA 3CW2C 3PUWA 1HR0L 1B9MA 2PZUA 4ZK9B 3GTLH 3J80L 3AU7A 1Z6HA 4JI5L 2TSSA 1Y1VG 2K52A 3K80C 2R92B 2AWNA 4OX9L 3KBXA
chains in the Genus database with same CATH topology
2NVQH 2ZJPA 3CCMA 1NMFA 2WB1G 4GLXA 4OX9Q 3PUVA 3I56A 1XNQL 2IX1A 1I50H 2OTJA 4QGUA 1WCMG 2R7FA 3ER0A 4LUVA 3HOYG 1EFWA 2Z0SA 3S14H 1GVPA 2ZM6L 3I4MH 1ASZA 1HZCA 4DV6Q 4JI7L 1EYGA 1I3QH 4R4TA 1J5EL 1B8AA 1UE6A 2HIVA 4YCWA 2RCNA 2VQFQ 3PO2G 4A3LH 1PV4A 4DR5L 1XMOL 1S40A 1PYSB 1JJGA 1FJGL 1L1OC 2KENA 4XIGS 1JJ2A 4LFBQ 1N32L 1YNXA 1Z47A 2I5MX 1FJGQ 3EN2A 3KJPA 3KF8B 4HIKA 1I5FA 1T9HA 4H02A 4A3FH 3CC2A 4IFDJ 1V1QA 1WYDA 1NJIC 4DK3C 1WFQA 3PUXA 4A3KH 4L5SA 1Q86C 3RLOA 4JI2L 1AE3A 2JA9A 1BBWA 4B3TL 3U4ZA 3UE0A 3EIVA 1PFSA 3E9IA 2E5LL 3HOZG 5C4JH 4R4QA 4ALPA 3U58A 5LMNL 2B63H 2XTIA 4X62L 1N36L 3M7NA 5GAHC 4BXXH 5LMUQ 1Q1BA 2WB1E 4DV2L 4DR7Q 1N33Q 1N36Q 4LWCA 2ZTDA 3S2HH 4DV7Q 2JA5H 3PO3H 5C4XH 1Y1VH 2R7ZG 1EIFA 2K5VA 2V1CC 3K81C 1M90C 4A4IA 2PNHA 4WJ4A 3GTMH 5M5XH 4OO1G 3JC66 4GOPB 1PH2A 4B3MQ 2AMCB 2MNAA 3CC7A 3F1ZA 3T1HQ 1W2BA 1PH8A 2UUBQ 1VQFA 1OXXK 2RF4A 2UUAQ 2KCTA 4DV0L 2BH8A 3HOYH 1QZGA 4X6AH 1B70B 1Z9FA 2PQAA 1YJ9A 3BZCA 1YEZA 1IBKL 4Y7NH 2BH2A 2CFMA 4A3IH 3KF6B 2JEAI 4IOCA 4IJHA 3T1YL 4A3GG 1SR3A 2BA1A 3J80c 1IBKQ 2LXKA 2I5HA 5BR8Q 3CMEA 3F2BA 5ELNA 5IYDG 1L0WA 1CSQA 4LF8Q 1A62A 2JK8A 5EAYA 4GLVB 1YJNA 1XMQQ 2IX0A 3CCVA 4AQYL 1S3OA 4X66Q 1VQOA 4GOPA 3K8AA 3TS0A 2N49A 4GN4B 3J7A5 3J7ZC 1E22A 1YZ6A 3STBD 4JV5Q 4YWLA 4O2DA 2K5HA 2Z6KA 1MJEA 5HGQA 1Q81C 1N9WA 1M1KC 4C3IH 4OO1I 3F2CA 2WAQG 4JI1L 1VQDA 1VQNA 1MKHA 3NELA 5GQOA 3KF6A 1PH7A 2Q2UA 4L5RC 4C2MH 1XNRQ 1ASYA 3PIOA 2QGQA 1KAWA 1E1OA 4ME3A 1Q46A 4IPGA 4YCUA 4DV5Q 4L5TA 4JI6Q 4LF5Q 2GN5A 1IZ6A 1W3SA 3K0XA 3AQQA 4AH6A 3HOUG 2VQEL 4LF7L 2UU9L 1KL9A 3U4VA 2R7ZH 1JE5A 3RLNA 2K5NA 3W5OA 1CSPA 2UU9Q 2NN6G 4BBSG 1KHIA 3S16H 3RR5A 4HJ5A 1K8GA 4JI4L 3S1QH 1VQHA 5IYCG 1YVCA 2UXDL 3W1GA 2K4KA 3JAMi 5IY0A 4DR3Q 2UXCL 2YTXA 3MEFA 1VQ9A 4JI4Q 2R92G 4X65L 4JI3L 4NXMQ 5M3FG 1XTDA 3KLWA 1NE3A 4KI0A 4A3EG 1HR0W 2QEXA 1D7QA 1SN8A 4AYBG 1CKNB 4A3GH 3BZKA 5GROA 4FDBA 4LFAL 2JA8G 3ULLA 2OTLA 1TWCH 3CCLA 4LF9Q 2NVXH 5IYDH 3UDGA 2DUDA 1VQ8A 2ID0A 3I4NG 3HOXG 1C0AA 1JT8A 1QVFA 2EQSA 5AJ3L 2ASBA 2F4VQ 2IHEA 4DUZQ 1HJPA 4A3DG 2C35B 1GO3E 5AJ3Q 4HIMA 4DV3Q 3PUZA 1K8AC 2JA7G 4QQBX 2NN6I 3BU2A 4BY1G 3NEMA 2YTYA 3CMAA 3GTPH 4LF4Q 3IRBA 1CKNA 3CP0A 1PYBA 3MXNB 1E1TA 1G291 1V43A 1X3FA 2CWAA 5FLMG 4DV6L 1Q8KA 4YWMA 4IPDA 4P71A 4HJ8A 4DPGA 2HIXA 3KJOA 3J81i 2VQFL 4K0KQ 1RIPA 1HNWQ 2K14A 2R93G 1UE1A 3HOUH 4PZ8A 3CCEA 4A93G 4RG1A 3A74A 3E0EA 3S1RH 3H3VH 2N3SA 1XJVA 4LFBL 1BKBA 2OQ0A 1DGSA 2YTVA 3OW2A 1VQIA 4AYBE 1E7ZA 3AFQA 1X9NA 1L1OA 4TVAB 1G51A 2E2JH 3S1NH 4GNXB 5IYCH 1EIYB 1Q12A 3TREA 1B7YB 3S2DH 4LFCQ 4R4OA 3CPFA 2MQHA 5HY6A 4DKAC 5LMNW 5FLXc 5C3EG 1VQ4A 1A63A 3CQZH 4PG3A 1X56A 2ZTCA 4DR6Q 5M3FH 1SE8A 3HFZB 4A3EH 1VQ5A 1LUZA 1YJWA 2NVTH 1IBML 4JOIC 4PMWA 1K3RA 2OWOA 4JCVE 2JA8H 1CKMA 1Q1EA 1IBMQ 1LTLA 2PI2A 2EIFA 5LMUL 1KD1C 3HOXH 4DR7L 1HNZQ 1N33L 2N8NA 3VDYA 2UXBQ 3ICEA 4DV7L 4DR2Q 1G6PA 4NB3A 4OWXB 1VQMA 4POFA 4A3DH 2KBNA 2IY5B 1EWIA 4GNXC 4DR1L 2F52A 4EQ5A 1C9OA 1LYLA 1P16A 3U50C 1QVGA 4B3ML 2JA7H 4WJ3M 4JI8Q 1AH9A 3T1HL 4DR1Q 4UP8A 2UUBL 2F3IA 2UUAL 1MIUA 5GAEC 5JJIA 2RHQB 3EBEA 5FLMH 1WCMH 3KDFB 2JA6G 4B3RQ 1PHJA 4QY7A 4UP7A 5ELOA 4A3JG 1PH5A 2GVBA 3CCUA 1PA6A 1VQ6A 3GTGH 4MNOA 4UP9A 2RHSB 5BR8L 4LF6Q 3A5ZB 4P72A 3PO2H 3A0JA 4DUYL 4LF8L 1PH9A 4IO9A 4JI0L 2VUMG 2AHOB 2OQKA 1LM0A 1XMQL 1U0LA 4OONA 4X66L 4DUYQ 4LW1A 2BA0A 4L5QA 4JI0Q 5JJLA 3TQYA 3GTOH 5JJKA 4R1JA 4YY3Q 4A3BG 1KC8C 5C3EH 1YIJA 4JV5L 1AE2A 4B3SQ 1UE5A 2ATWA 3S1MH 1J6QA 5IP9G 3K7UC 1K73C 3KOJA 2VZAA 2D0PA 1EQQA 1FGUA 1P8LA 1XNRL 2VL6A 3HOWG 2XGTA 2CWPA 5FJ8G 3HOZH 4JI6L 1QUQB 4JYAL 1HZ9A 4DV5L 4LF5L 1I94Q 2D62A 2KHJA 2ZJRA 1U5KA 2HHHQ 4A3CG 5IWAL 1YHBA 1PH1A 2WFWA 1E3PA 1QVCA 2JQOA 2MO0A 3H0GG 4DK6C 1N34Q 4P73A 2MFIA 3AYHB 2VY3A 5IWAQ 5IYBG 4P74A 3CC4A 4AIMA 4BA1I 1SRUA 3L2PA 4DR3L 4NPSA 3M4QA 1K83H 1KIXA 2VS1A 3GTJH 4NXML 4KHZA 2JA6H 4KHPQ 2VW9A 4A3JH 4JBWA 3D0FA 2YYZA 4NXNQ 1Q7YC 4DR4Q 3ERSX 1YI2A 4LF9L 1K9MC 1SLJA 1JJCB 1BBUA 5IP7G 3ZJYC 1YHQA 5GAGC 3PF4A 1GKHA 5E7NA 4O0AA 2F4VL 3LGJA 4DUZL 5IT9c 4DV4Q 4A75A 4IFDI 2WAQE 3OYYA 4A3BH 1SROA 3G4SA 2ALYB 2ES2A 1HZBA 4IJLA 4DV3L 2I0QA 3NENA 1CKOA 3CCSA 3B6YA 4GKKL 2E2HH 1VQAA 1X3GA 3F2DA 3PCOB 4DV1Q 1JB7A 3E9HA 4LF4L 4GKKQ 1WJJA 2NZOA 3PUYA 5GADC 2IHFA 3HOWH 1VQKA 5FJ8H 3JAMc 3W1BA 2NZHA 4JBJA 3HOVG 1TWFH 4IOAA 4EX5A 4GKJQ 4J15A 1IBLQ 1SFOH 4UY8C 4K0KL 1HNWL 2VNUD 3UDFA 4JG2A 4JBKA 3RN5A 4QL5A 3M4OH 4A3CH 1HNXQ 2MO1A 5J3BA 4YWKA 2A1AA 3RLFA 3H0GH 1Y1WG 1OXUA 1YITA 2GVAA 2QA4A 2B3GA 5IYBH 3HKZG 4MZ9A 1PVOA 4LFCL 4JBMA 4BBRG 3I4OA 4BBSH 2Y0SG 1HR0Q 2K50A 1OXVA 3CCJA 2IT1A 4JI5Q 1Q82C 3CPWA 1HZAA 3CAMA 3M3YH 4DR6L 1VQGA 3TS2A 1A8VA 2HQLA 1GM5A 1EOVA 1NBWA 2R92H 3S24A 2PI2E 2JJQA 3GTKH 1A0IA 1VCIA 5C44G 4JOIA 4RMFA 3TEHB 3CCQA 5IP7H 1VQPA 1XNQQ 2I5LX 4GS3A 4YHHL 1L2FA 2Q2IA 1HNZL 1VQCA 2L15A 2ZM6Q 3PV0A 4XTCS 4IPHA 4X64L 4A3IG 3I4NH 2UXBL 4DR2L 4JI7Q 4TQUS 4YHHQ 2LSSA 1QZHA 2E8GA 3J81c 1J5EQ 2AKWB 3G71A 1KXLA 4X64Q 2CQOA 5C0XG 4DR5Q 4GNXA 1XMOQ 4JI8L 1O7IA 3L0OA 3M85A 2CKZB 3I7FA 4A3MG 3GD7A 5JEAG 1C7YA 1N32Q 2E2IH 1MJCA 2N78A 1D8LA 3RNUA 4BY1H 4OWTB 2WP8J 3GO5A 3STBC 1UE7A 5M5WH 1N8RC 1X3EA 3HOVH 4B3RL 3HKZE 3CF5A 5C4XG 2Y0SE 3J80i 3WWVA 4DAMA 3D31A 4HJAA 4LF6L 2PQAB 2B29A 4JI2Q 3PSIA 1V9PA 1Y1WH 2R7DA 2R93H 4B3TQ 1H95A 1PH3A 4HIDA 1JMCA 1VQLA 2E5LQ 1FVIA 1KQSA 3AFPA 4A93H 2D0OA 1NMGA 4IPCA 5LMNQ 3PGZA 4X62Q 4PZ7A 1TWAH 4DAYB 2R6GA 4C3HH 1EQRA 3FP9A 1YBYA 4BBRH 4YY3L 4HJ9A 3CCRA 1XPOA 4DV2Q 1EUJA 3RZOH 4B3SL 4YCVA 2DGYA 2AWOA 4PZ6A 5IE8A 1XPUA 4BY7G 5C0XI 3OTOL 1I6HH 2KHIA 3NBHB 1NY4A 3M4PA 2CCZA 5M5YH 4UPAA 1IXRA 1VQ7A 5C44H 3UDIA 3KDFA 3OTOQ 2UUCL 3F8TA 4OWWB 4Y52H 3BJUA 5M3MG 4GN5A 1VQBA 4DV0Q 4HJ7A 2UUCQ 4GN3B 1I94L 1TXYA 2HHHL 1IYJB 4IFDG 3FKIG 1E24A 3PF5A 3T1YQ 4QJFA 1N34L 4R4CA 2FXQA 3G48A 3GDEA 4C3JH 3RN2A 2HT1A 4JYAQ 4R4IA 4BA2I 2NVYH 3UE1A 4A3MH 3M9BA 1OTCA 2H5XA 4DNIA 1WI5A 2ZTEA 4GOPC 2YU9H 3RZDH 4AQYQ 5H1SE 4KHPL 1YHAA 4KLKA 3G6EA 4NXNL 1SMXA 4DR4L 3PIPA 1Y14B 2Z6KC 2JE6I 1X54A 3ULJA 2Q2TA 1XPRA 3ULPA 1VS0A 1CUKA 1QUQA 4JI1Q 4QIWE 4OXPA 2JEBI 3I55A 3I4MG 2VUMH 1WOCA 1NTGA 4DV4L 4JC0A 3AEVA 5K36G 4GLAC 1UWVA 1R9TH 4A3LG 4HIOA 3KYHC 2VQEQ 4LF7Q 3A5UA 1HH2P 3KFUA 4BY7H 1OXTA 2EXDA 4DV1L 1UEBA 3H15A 2PMZE 1X65A 1TWHH 1GD7A 1OXSC 1X6OA 4MTNA 5IP9H 1PH6A 4P75A 4POGA 3S15H 3HKSA 1KRTA 1BVSA 2A8VA 2K75A 5M3MH 4GKJL 2UXDQ 3L7ZC 3CXCA 4A3FG 1IBLL 3S17H 4A76A 2UXCQ 3Q8DA 5C0XJ 4LUZA 2ZJQA 2A19A 4X65Q 4A3KG 1S72A 2LXJA 1KRSA 3I2ZA 1VQEA 4JI3Q 1HNXL 3J81j 1PH4A 3FHWA 1VQJA 3FKIH 2YV5A 5DLQE 5JEAJ 4LFAQ 2KCMA 3DM3A 2B63G 3CW2C 4BXXG 1X55A 1RL2A 3PUWA 1K0RA 1HR0L 3CD6A 4LNQA 3GTLH 3SGIA 3DLLA 1FL0A 4JI5L 3TRZA 1L1OB 2JA5G 3K7AH 3H3VI 1TWGH 3PO3G 4LUOA 1Y1VG 3UDXA 4APVA 2K52A 3K80C 1IL2A 2AWNA 4OX9L 3GTQH 2Q2HA 2OCEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NVQ H;  2ZJP A;  3CCM A;  1NMF A;  2WB1 G;  4GLX A;  4OX9 Q;  3PUV A;  3I56 A;  1XNQ L;  2IX1 A;  1I50 H;  2OTJ A;  4QGU A;  1WCM G;  2R7F A;  3ER0 A;  4LUV A;  3HOY G;  1EFW A;  2Z0S A;  3S14 H;  1GVP A;  2ZM6 L;  3I4M H;  1ASZ A;  1HZC A;  4DV6 Q;  4JI7 L;  1EYG A;  1I3Q H;  4R4T A;  1J5E L;  1B8A A;  1UE6 A;  2HIV A;  4YCW A;  2RCN A;  2VQF Q;  3PO2 G;  4A3L H;  1PV4 A;  4DR5 L;  1XMO L;  1S40 A;  1PYS B;  1JJG A;  1FJG L;  1L1O C;  2KEN A;  4XIG S;  1JJ2 A;  4LFB Q;  1N32 L;  1YNX A;  1Z47 A;  2I5M X;  1FJG Q;  3EN2 A;  3KJP A;  3KF8 B;  4HIK A;  1I5F A;  1T9H A;  4H02 A;  4A3F H;  3CC2 A;  4IFD J;  1V1Q A;  1WYD A;  1NJI C;  4DK3 C;  1WFQ A;  3PUX A;  4A3K H;  4L5S A;  1Q86 C;  3RLO A;  4JI2 L;  1AE3 A;  2JA9 A;  1BBW A;  4B3T L;  3U4Z A;  3UE0 A;  3EIV A;  1PFS A;  3E9I A;  2E5L L;  3HOZ G;  5C4J H;  4R4Q A;  4ALP A;  3U58 A;  5LMN L;  2B63 H;  2XTI A;  4X62 L;  1N36 L;  3M7N A;  5GAH C;  4BXX H;  5LMU Q;  1Q1B A;  2WB1 E;  4DV2 L;  4DR7 Q;  1N33 Q;  1N36 Q;  4LWC A;  2ZTD A;  3S2H H;  4DV7 Q;  2JA5 H;  3PO3 H;  5C4X H;  1Y1V H;  2R7Z G;  1EIF A;  2K5V A;  2V1C C;  3K81 C;  1M90 C;  4A4I A;  2PNH A;  4WJ4 A;  3GTM H;  5M5X H;  4OO1 G;  3JC6 6;  4GOP B;  1PH2 A;  4B3M Q;  2AMC B;  2MNA A;  3CC7 A;  3F1Z A;  3T1H Q;  1W2B A;  1PH8 A;  2UUB Q;  1VQF A;  1OXX K;  2RF4 A;  2UUA Q;  2KCT A;  4DV0 L;  2BH8 A;  3HOY H;  1QZG A;  4X6A H;  1B70 B;  1Z9F A;  2PQA A;  1YJ9 A;  3BZC A;  1YEZ A;  1IBK L;  4Y7N H;  2BH2 A;  2CFM A;  4A3I H;  3KF6 B;  2JEA I;  4IOC A;  4IJH A;  3T1Y L;  4A3G G;  1SR3 A;  2BA1 A;  3J80 c;  1IBK Q;  2LXK A;  2I5H A;  5BR8 Q;  3CME A;  3F2B A;  5ELN A;  5IYD G;  1L0W A;  1CSQ A;  4LF8 Q;  1A62 A;  2JK8 A;  5EAY A;  4GLV B;  1YJN A;  1XMQ Q;  2IX0 A;  3CCV A;  4AQY L;  1S3O A;  4X66 Q;  1VQO A;  4GOP A;  3K8A A;  3TS0 A;  2N49 A;  4GN4 B;  3J7A 5;  3J7Z C;  1E22 A;  1YZ6 A;  3STB D;  4JV5 Q;  4YWL A;  4O2D A;  2K5H A;  2Z6K A;  1MJE A;  5HGQ A;  1Q81 C;  1N9W A;  1M1K C;  4C3I H;  4OO1 I;  3F2C A;  2WAQ G;  4JI1 L;  1VQD A;  1VQN A;  1MKH A;  3NEL A;  5GQO A;  3KF6 A;  1PH7 A;  2Q2U A;  4L5R C;  4C2M H;  1XNR Q;  1ASY A;  3PIO A;  2QGQ A;  1KAW A;  1E1O A;  4ME3 A;  1Q46 A;  4IPG A;  4YCU A;  4DV5 Q;  4L5T A;  4JI6 Q;  4LF5 Q;  2GN5 A;  1IZ6 A;  1W3S A;  3K0X A;  3AQQ A;  4AH6 A;  3HOU G;  2VQE L;  4LF7 L;  2UU9 L;  1KL9 A;  3U4V A;  2R7Z H;  1JE5 A;  3RLN A;  2K5N A;  3W5O A;  1CSP A;  2UU9 Q;  2NN6 G;  4BBS G;  1KHI A;  3S16 H;  3RR5 A;  4HJ5 A;  1K8G A;  4JI4 L;  3S1Q H;  1VQH A;  5IYC G;  1YVC A;  2UXD L;  3W1G A;  2K4K A;  3JAM i;  5IY0 A;  4DR3 Q;  2UXC L;  2YTX A;  3MEF A;  1VQ9 A;  4JI4 Q;  2R92 G;  4X65 L;  4JI3 L;  4NXM Q;  5M3F G;  1XTD A;  3KLW A;  1NE3 A;  4KI0 A;  4A3E G;  1HR0 W;  2QEX A;  1D7Q A;  1SN8 A;  4AYB G;  1CKN B;  4A3G H;  3BZK A;  5GRO A;  4FDB A;  4LFA L;  2JA8 G;  3ULL A;  2OTL A;  1TWC H;  3CCL A;  4LF9 Q;  2NVX H;  5IYD H;  3UDG A;  2DUD A;  1VQ8 A;  2ID0 A;  3I4N G;  3HOX G;  1C0A A;  1JT8 A;  1QVF A;  2EQS A;  5AJ3 L;  2ASB A;  2F4V Q;  2IHE A;  4DUZ Q;  1HJP A;  4A3D G;  2C35 B;  1GO3 E;  5AJ3 Q;  4HIM A;  4DV3 Q;  3PUZ A;  1K8A C;  2JA7 G;  4QQB X;  2NN6 I;  3BU2 A;  4BY1 G;  3NEM A;  2YTY A;  3CMA A;  3GTP H;  4LF4 Q;  3IRB A;  1CKN A;  3CP0 A;  1PYB A;  3MXN B;  1E1T A;  1G29 1;  1V43 A;  1X3F A;  2CWA A;  5FLM G;  4DV6 L;  1Q8K A;  4YWM A;  4IPD A;  4P71 A;  4HJ8 A;  4DPG A;  2HIX A;  3KJO A;  3J81 i;  2VQF L;  4K0K Q;  1RIP A;  1HNW Q;  2K14 A;  2R93 G;  1UE1 A;  3HOU H;  4PZ8 A;  3CCE A;  4A93 G;  4RG1 A;  3A74 A;  3E0E A;  3S1R H;  3H3V H;  2N3S A;  1XJV A;  4LFB L;  1BKB A;  2OQ0 A;  1DGS A;  2YTV A;  3OW2 A;  1VQI A;  4AYB E;  1E7Z A;  3AFQ A;  1X9N A;  1L1O A;  4TVA B;  1G51 A;  2E2J H;  3S1N H;  4GNX B;  5IYC H;  1EIY B;  1Q12 A;  3TRE A;  1B7Y B;  3S2D H;  4LFC Q;  4R4O A;  3CPF A;  2MQH A;  5HY6 A;  4DKA C;  5LMN W;  5FLX c;  5C3E G;  1VQ4 A;  1A63 A;  3CQZ H;  4PG3 A;  1X56 A;  2ZTC A;  4DR6 Q;  5M3F H;  1SE8 A;  3HFZ B;  4A3E H;  1VQ5 A;  1LUZ A;  1YJW A;  2NVT H;  1IBM L;  4JOI C;  4PMW A;  1K3R A;  2OWO A;  4JCV E;  2JA8 H;  1CKM A;  1Q1E A;  1IBM Q;  1LTL A;  2PI2 A;  2EIF A;  5LMU L;  1KD1 C;  3HOX H;  4DR7 L;  1HNZ Q;  1N33 L;  2N8N A;  3VDY A;  2UXB Q;  3ICE A;  4DV7 L;  4DR2 Q;  1G6P A;  4NB3 A;  4OWX B;  1VQM A;  4POF A;  4A3D H;  2KBN A;  2IY5 B;  1EWI A;  4GNX C;  4DR1 L;  2F52 A;  4EQ5 A;  1C9O A;  1LYL A;  1P16 A;  3U50 C;  1QVG A;  4B3M L;  2JA7 H;  4WJ3 M;  4JI8 Q;  1AH9 A;  3T1H L;  4DR1 Q;  4UP8 A;  2UUB L;  2F3I A;  2UUA L;  1MIU A;  5GAE C;  5JJI A;  2RHQ B;  3EBE A;  5FLM H;  1WCM H;  3KDF B;  2JA6 G;  4B3R Q;  1PHJ A;  4QY7 A;  4UP7 A;  5ELO A;  4A3J G;  1PH5 A;  2GVB A;  3CCU A;  1PA6 A;  1VQ6 A;  3GTG H;  4MNO A;  4UP9 A;  2RHS B;  5BR8 L;  4LF6 Q;  3A5Z B;  4P72 A;  3PO2 H;  3A0J A;  4DUY L;  4LF8 L;  1PH9 A;  4IO9 A;  4JI0 L;  2VUM G;  2AHO B;  2OQK A;  1LM0 A;  1XMQ L;  1U0L A;  4OON A;  4X66 L;  4DUY Q;  4LW1 A;  2BA0 A;  4L5Q A;  4JI0 Q;  5JJL A;  3TQY A;  3GTO H;  5JJK A;  4R1J A;  4YY3 Q;  4A3B G;  1KC8 C;  5C3E H;  1YIJ A;  4JV5 L;  1AE2 A;  4B3S Q;  1UE5 A;  2ATW A;  3S1M H;  1J6Q A;  5IP9 G;  3K7U C;  1K73 C;  3KOJ A;  2VZA A;  2D0P A;  1EQQ A;  1FGU A;  1P8L A;  1XNR L;  2VL6 A;  3HOW G;  2XGT A;  2CWP A;  5FJ8 G;  3HOZ H;  4JI6 L;  1QUQ B;  4JYA L;  1HZ9 A;  4DV5 L;  4LF5 L;  1I94 Q;  2D62 A;  2KHJ A;  2ZJR A;  1U5K A;  2HHH Q;  4A3C G;  5IWA L;  1YHB A;  1PH1 A;  2WFW A;  1E3P A;  1QVC A;  2JQO A;  2MO0 A;  3H0G G;  4DK6 C;  1N34 Q;  4P73 A;  2MFI A;  3AYH B;  2VY3 A;  5IWA Q;  5IYB G;  4P74 A;  3CC4 A;  4AIM A;  4BA1 I;  1SRU A;  3L2P A;  4DR3 L;  4NPS A;  3M4Q A;  1K83 H;  1KIX A;  2VS1 A;  3GTJ H;  4NXM L;  4KHZ A;  2JA6 H;  4KHP Q;  2VW9 A;  4A3J H;  4JBW A;  3D0F A;  2YYZ A;  4NXN Q;  1Q7Y C;  4DR4 Q;  3ERS X;  1YI2 A;  4LF9 L;  1K9M C;  1SLJ A;  1JJC B;  1BBU A;  5IP7 G;  3ZJY C;  1YHQ A;  5GAG C;  3PF4 A;  1GKH A;  5E7N A;  4O0A A;  2F4V L;  3LGJ A;  4DUZ L;  5IT9 c;  4DV4 Q;  4A75 A;  4IFD I;  2WAQ E;  3OYY A;  4A3B H;  1SRO A;  3G4S A;  2ALY B;  2ES2 A;  1HZB A;  4IJL A;  4DV3 L;  2I0Q A;  3NEN A;  1CKO A;  3CCS A;  3B6Y A;  4GKK L;  2E2H H;  1VQA A;  1X3G A;  3F2D A;  3PCO B;  4DV1 Q;  1JB7 A;  3E9H A;  4LF4 L;  4GKK Q;  1WJJ A;  2NZO A;  3PUY A;  5GAD C;  2IHF A;  3HOW H;  1VQK A;  5FJ8 H;  3JAM c;  3W1B A;  2NZH A;  4JBJ A;  3HOV G;  1TWF H;  4IOA A;  4EX5 A;  4GKJ Q;  4J15 A;  1IBL Q;  1SFO H;  4UY8 C;  4K0K L;  1HNW L;  2VNU D;  3UDF A;  4JG2 A;  4JBK A;  3RN5 A;  4QL5 A;  3M4O H;  4A3C H;  1HNX Q;  2MO1 A;  5J3B A;  4YWK A;  2A1A A;  3RLF A;  3H0G H;  1Y1W G;  1OXU A;  1YIT A;  2GVA A;  2QA4 A;  2B3G A;  5IYB H;  3HKZ G;  4MZ9 A;  1PVO A;  4LFC L;  4JBM A;  4BBR G;  3I4O A;  4BBS H;  2Y0S G;  1HR0 Q;  2K50 A;  1OXV A;  3CCJ A;  2IT1 A;  4JI5 Q;  1Q82 C;  3CPW A;  1HZA A;  3CAM A;  3M3Y H;  4DR6 L;  1VQG A;  3TS2 A;  1A8V A;  2HQL A;  1GM5 A;  1EOV A;  1NBW A;  2R92 H;  3S24 A;  2PI2 E;  2JJQ A;  3GTK H;  1A0I A;  1VCI A;  5C44 G;  4JOI A;  4RMF A;  3TEH B;  3CCQ A;  5IP7 H;  1VQP A;  1XNQ Q;  2I5L X;  4GS3 A;  4YHH L;  1L2F A;  2Q2I A;  1HNZ L;  1VQC A;  2L15 A;  2ZM6 Q;  3PV0 A;  4XTC S;  4IPH A;  4X64 L;  4A3I G;  3I4N H;  2UXB L;  4DR2 L;  4JI7 Q;  4TQU S;  4YHH Q;  2LSS A;  1QZH A;  2E8G A;  3J81 c;  1J5E Q;  2AKW B;  3G71 A;  1KXL A;  4X64 Q;  2CQO A;  5C0X G;  4DR5 Q;  4GNX A;  1XMO Q;  4JI8 L;  1O7I A;  3L0O A;  3M85 A;  2CKZ B;  3I7F A;  4A3M G;  3GD7 A;  5JEA G;  1C7Y A;  1N32 Q;  2E2I H;  1MJC A;  2N78 A;  1D8L A;  3RNU A;  4BY1 H;  4OWT B;  2WP8 J;  3GO5 A;  3STB C;  1UE7 A;  5M5W H;  1N8R C;  1X3E A;  3HOV H;  4B3R L;  3HKZ E;  3CF5 A;  5C4X G;  2Y0S E;  3J80 i;  3WWV A;  4DAM A;  3D31 A;  4HJA A;  4LF6 L;  2PQA B;  2B29 A;  4JI2 Q;  3PSI A;  1V9P A;  1Y1W H;  2R7D A;  2R93 H;  4B3T Q;  1H95 A;  1PH3 A;  4HID A;  1JMC A;  1VQL A;  2E5L Q;  1FVI A;  1KQS A;  3AFP A;  4A93 H;  2D0O A;  1NMG A;  4IPC A;  5LMN Q;  3PGZ A;  4X62 Q;  4PZ7 A;  1TWA H;  4DAY B;  2R6G A;  4C3H H;  1EQR A;  3FP9 A;  1YBY A;  4BBR H;  4YY3 L;  4HJ9 A;  3CCR A;  1XPO A;  4DV2 Q;  1EUJ A;  3RZO H;  4B3S L;  4YCV A;  2DGY A;  2AWO A;  4PZ6 A;  5IE8 A;  1XPU A;  4BY7 G;  5C0X I;  3OTO L;  1I6H H;  2KHI A;  3NBH B;  1NY4 A;  3M4P A;  2CCZ A;  5M5Y H;  4UPA A;  1IXR A;  1VQ7 A;  5C44 H;  3UDI A;  3KDF A;  3OTO Q;  2UUC L;  3F8T A;  4OWW B;  4Y52 H;  3BJU A;  5M3M G;  4GN5 A;  1VQB A;  4DV0 Q;  4HJ7 A;  2UUC Q;  4GN3 B;  1I94 L;  1TXY A;  2HHH L;  1IYJ B;  4IFD G;  3FKI G;  1E24 A;  3PF5 A;  3T1Y Q;  4QJF A;  1N34 L;  4R4C A;  2FXQ A;  3G48 A;  3GDE A;  4C3J H;  3RN2 A;  2HT1 A;  4JYA Q;  4R4I A;  4BA2 I;  2NVY H;  3UE1 A;  4A3M H;  3M9B A;  1OTC A;  2H5X A;  4DNI A;  1WI5 A;  2ZTE A;  4GOP C;  2YU9 H;  3RZD H;  4AQY Q;  5H1S E;  4KHP L;  1YHA A;  4KLK A;  3G6E A;  4NXN L;  1SMX A;  4DR4 L;  3PIP A;  1Y14 B;  2Z6K C;  2JE6 I;  1X54 A;  3ULJ A;  2Q2T A;  1XPR A;  3ULP A;  1VS0 A;  1CUK A;  1QUQ A;  4JI1 Q;  4QIW E;  4OXP A;  2JEB I;  3I55 A;  3I4M G;  2VUM H;  1WOC A;  1NTG A;  4DV4 L;  4JC0 A;  3AEV A;  5K36 G;  4GLA C;  1UWV A;  1R9T H;  4A3L G;  4HIO A;  3KYH C;  2VQE Q;  4LF7 Q;  3A5U A;  1HH2 P;  3KFU A;  4BY7 H;  1OXT A;  2EXD A;  4DV1 L;  1UEB A;  3H15 A;  2PMZ E;  1X65 A;  1TWH H;  1GD7 A;  1OXS C;  1X6O A;  4MTN A;  5IP9 H;  1PH6 A;  4P75 A;  4POG A;  3S15 H;  3HKS A;  1KRT A;  1BVS A;  2A8V A;  2K75 A;  5M3M H;  4GKJ L;  2UXD Q;  3L7Z C;  3CXC A;  4A3F G;  1IBL L;  3S17 H;  4A76 A;  2UXC Q;  3Q8D A;  5C0X J;  4LUZ A;  2ZJQ A;  2A19 A;  4X65 Q;  4A3K G;  1S72 A;  2LXJ A;  1KRS A;  3I2Z A;  1VQE A;  4JI3 Q;  1HNX L;  3J81 j;  1PH4 A;  3FHW A;  1VQJ A;  3FKI H;  2YV5 A;  5DLQ E;  5JEA J;  4LFA Q;  2KCM A;  3DM3 A;  2B63 G;  3CW2 C;  4BXX G;  1X55 A;  1RL2 A;  3PUW A;  1K0R A;  1HR0 L;  3CD6 A;  4LNQ A;  3GTL H;  3SGI A;  3DLL A;  1FL0 A;  4JI5 L;  3TRZ A;  1L1O B;  2JA5 G;  3K7A H;  3H3V I;  1TWG H;  3PO3 G;  4LUO A;  1Y1V G;  3UDX A;  4APV A;  2K52 A;  3K80 C;  1IL2 A;  2AWN A;  4OX9 L;  3GTQ H;  2Q2H A;  2OCE A; 
#chains in the Genus database with same CATH topology
 3NK9 A;  3BYT B;  3CCM A;  1MSH A;  1NMF A;  2WB1 G;  3WOE A;  4OX9 Q;  1EIH A;  1WCM G;  3S14 H;  5BN4 A;  1EFW A;  2PQE A;  3FVQ A;  5IT9 E;  3I4N B;  1EYG A;  3HS0 C;  1B8A A;  2HIV A;  4YCW A;  2VQF Q;  1B2T A;  2NWG A;  1HFG A;  1S40 A;  4DFA A;  2PZW A;  2XWJ B;  5IOC A;  1JJ2 A;  1IKM A;  5EKI A;  4BY1 B;  1O7Z A;  4H02 A;  1BBX C;  3CC2 A;  1ET6 A;  1HTP A;  1I4H A;  1YNJ C;  1DXM A;  1WYD A;  1BR9 A;  3A7L A;  4L5S A;  4ZQ3 A;  1AE3 A;  2R93 B;  3U4Z A;  3D4W A;  3EIV A;  3HOZ G;  4A93 B;  2B63 H;  3U58 A;  3MXP A;  3M7N A;  1N36 L;  2QF7 A;  2CW0 C;  1EY0 A;  2Y0S B;  4DV2 L;  4DR7 Q;  1N36 Q;  4LWC A;  2ZXP A;  2ZTD A;  1PTO B;  1G6Z A;  4QMG A;  5D65 A;  1EIF A;  2V4D A;  1I6H B;  2K5V A;  2V1C C;  4WJ4 A;  1GHK A;  3OMG A;  4QUF A;  1W2B A;  1PH8 A;  2KCT A;  4CKC A;  2Z9H A;  1QZG A;  4I7A A;  1BQQ T;  1LTS D;  2X6G A;  2CFM A;  2IX3 A;  4A3I H;  4IOC A;  4A3G G;  1SR3 A;  2A6H C;  3J80 c;  1F9P A;  4E6I A;  4C3J B;  5C0X H;  1D6E C;  1CSQ A;  1S4Z A;  4LF8 Q;  1A62 A;  1JOK A;  4ZUI A;  4A3M B;  4GLV B;  4JPB W;  1EIG A;  2IX0 A;  3RZD B;  4X66 Q;  2XVS A;  4GOP A;  3K8A A;  3PIO 3;  4GN4 B;  3J7Z C;  3MC0 B;  3KLS A;  3R8B A;  5IGE A;  1K8M A;  4RCO A;  1V8Q A;  2F1M A;  1Q81 C;  1M1K C;  4C3I H;  1MSG A;  3F2C A;  2WAQ G;  4K6D A;  4O1N A;  4JI1 L;  4FXG C;  3NEL A;  5FLX L;  5GQO A;  4C2M H;  3I90 A;  1UUP A;  1NUC A;  4JVZ A;  2K28 A;  1Q46 A;  2LY7 A;  1W3S A;  4XYQ A;  3HOU G;  2N88 A;  1RJT A;  3U4V A;  1Q3L A;  3RLN A;  1BUV T;  2QEJ C;  3W5O A;  1SXT A;  2NN6 G;  1L0Y B;  5M9O A;  5EKK A;  2UXD L;  5IY0 A;  2E75 C;  1DOK A;  1EZ6 A;  3MEF A;  3J80 E;  4X65 L;  4NXM Q;  4A3E G;  1JOO A;  1V1P A;  4LFA L;  1VMP A;  3ULL A;  4R9W A;  4LF9 Q;  4DXF A;  3NUC A;  3U9S A;  1LO5 D;  3HOX G;  1PTO D;  1C0A A;  2EQS A;  5AJ3 L;  2ASB A;  2F4V Q;  2IHE A;  4DUZ Q;  2M9V A;  3A55 A;  3GTQ B;  1QCB D;  4K6L A;  5AJ3 Q;  1CFM A;  1YNN D;  2IJ0 A;  4K2K A;  4IN3 A;  1ESR A;  1XXG A;  1I50 B;  4C1N I;  4LF4 Q;  3H91 A;  1PYB A;  3MXN B;  4RWS C;  2F0M A;  3VA7 A;  5FLM G;  4CDE C;  1I3Q B;  1UE1 A;  1CZW A;  3H09 A;  4RG1 A;  3E0E A;  1TY2 A;  4PMC A;  4LFB L;  2OQ0 A;  1AZQ A;  2YTV A;  4AYB E;  3AFQ A;  1X9N A;  1EWH A;  1L1O A;  2AUK A;  1R4P B;  1Q12 A;  3FEW X;  3S2D H;  4R4O A;  1ZEQ X;  5LMN W;  5FLX c;  1VQ4 A;  1PTO F;  3T16 A;  4MN3 A;  1M8A A;  3HOV B;  4HN7 A;  2NVT H;  3J7A F;  1HA5 A;  2D5D A;  5C4J B;  2EIF A;  3TSS A;  1HNZ Q;  1N33 L;  2N8N A;  1D5M C;  5EPL A;  1VQM A;  4XT3 B;  1Y1V B;  1KDC A;  1TKW B;  1GUS A;  1KAB A;  4TSS A;  5M5X B;  1QVG A;  1LYL A;  3CRL C;  4L8J A;  2WB1 B;  2UUB L;  2BE5 D;  3MAQ A;  5KNB A;  2JA6 G;  1U4L A;  5ELO A;  4A3J G;  1BDO A;  1ET9 A;  4ILW A;  4LF6 Q;  4DUY L;  1PZJ D;  1XMQ L;  1S5D D;  4DUY Q;  3TP6 A;  4LW1 A;  3UI2 A;  4L5Q A;  1Q90 A;  5KRU A;  5C3E H;  2FJ2 A;  1CK1 A;  4FP5 D;  3S1M H;  1EY9 A;  1EY8 A;  3K7U C;  3KOJ A;  1P8L A;  1SYG A;  1C48 A;  2CWP A;  1HZ9 A;  2NTS A;  2D62 A;  4A3C G;  3VR4 A;  5CBA E;  1JE4 A;  2X6L A;  1CQF A;  1N34 Q;  3D6C A;  3AYH B;  3DHQ A;  2LFN A;  3VYR A;  4P74 A;  2AQ3 B;  4DR3 L;  1KLG D;  3M4Q A;  1K83 H;  3MZ5 A;  4KHP Q;  3D0F A;  4A3G B;  3SR1 A;  3ERS X;  1LT3 D;  1LTG D;  2Q8R E;  1SLJ A;  2J4X A;  5IP7 G;  2B2U A;  4DV4 Q;  3D4R A;  3G4S A;  2ALY B;  1QG7 A;  2P5Z X;  2E2H H;  1SNO A;  3PCO B;  4IUQ A;  5GAD C;  2K01 A;  2QDL A;  5FJ8 H;  3W1B A;  3S14 B;  4IOA A;  1TWF H;  1BO0 A;  2VNU D;  1HNW L;  3HOU B;  4JG2 A;  1CHQ D;  1HNX Q;  5J3B A;  2A1A A;  1Y1W G;  3K0Y A;  1OXU A;  4B9W A;  3N52 A;  1IKL A;  1SNC A;  3T13 A;  1WVL A;  2KA7 A;  5I2X A;  1OXV A;  4TRD A;  2IT1 A;  4BWG B;  3CCJ A;  1Q82 C;  4DR6 L;  2D9U A;  4X3S A;  3TS2 A;  4UAI A;  1PYW D;  4M1U B;  2R92 H;  3S24 A;  3IL8 A;  3GTK H;  5C44 G;  1O80 A;  4DF7 A;  1PDQ A;  3HOX B;  3HRZ C;  2Q2I A;  4FVM A;  4DK0 A;  4IPH A;  3I4N H;  4DR2 L;  4JI7 Q;  2B8F A;  3MEH A;  2AKW B;  3G71 A;  2EYL A;  5D3D A;  4GNX A;  1XMO Q;  1A15 A;  4CDF C;  4Q5V A;  1AEX A;  1TR5 A;  3TZU A;  4ULL A;  3QJY A;  5JEA G;  1RDP D;  4U67 3;  1C7Y A;  2N78 A;  2B2W A;  4DA2 A;  4BY1 H;  2WP8 J;  4EQP A;  3HKZ E;  3CF5 A;  1QNU A;  3WWV A;  3J80 i;  2BOS A;  1STA A;  2PQA B;  4NMZ A;  2R93 H;  4Z9C B;  1JMC A;  1VQL A;  1S5F D;  1U4R A;  2R3Z A;  2D0O A;  4A93 H;  5LMN Q;  1WTP A;  4PZ7 A;  2R6G A;  1EQR A;  4HJ9 A;  4RGO S;  2IW3 A;  2AWO A;  4ZUJ A;  3VR6 A;  1XPU A;  4BY7 G;  1HCZ A;  3NE5 B;  1I6H H;  3M4P A;  1I4Q A;  2F4I A;  5CV7 A;  3KDF A;  4OWW B;  1B3Q A;  3BJU A;  1CHP D;  4KV6 A;  4GN5 A;  1VQB A;  2O5I C;  4HJ7 A;  4K5X A;  5CC4 A;  2HHH L;  3I73 A;  1TQO A;  2QDB A;  4S3S A;  2WKD A;  1J9O A;  1DOM A;  3PIP 3;  3OWF A;  2RSO A;  2MHV A;  2EY6 A;  4C3J H;  2K5Q A;  3IFT A;  4R4I A;  2HT1 A;  1QJO A;  4A3M H;  3M9B A;  1OTC A;  2H5X A;  4KMU C;  2ZTE A;  1WI5 A;  4DNI A;  5IGC A;  3RZD H;  1H9S B;  1SMX A;  4DR4 L;  1X54 A;  3ULJ A;  2Q2T A;  1CUK A;  1EWC A;  1D1K A;  4YIJ A;  3NHH A;  3SK6 A;  3I55 A;  1GUN A;  3I4M G;  4JC0 A;  1W6K A;  3AEV A;  5K36 G;  4GLA C;  3E5S A;  2EXZ A;  2SEB D;  3D4D A;  4MTN A;  5IP9 H;  5IGD A;  4OGQ C;  1HHV A;  3HKS A;  1KRT A;  4RHR A;  4A3F G;  1EQT A;  2C9O A;  2EY1 A;  2ZJQ A;  3CKI B;  4H13 C;  3RD4 A;  2LXJ A;  2H1E A;  3J81 j;  1PH4 A;  3K58 A;  3FKI H;  2BCO A;  1FNU A;  4HAE A;  5JEA J;  1FGB D;  3DM3 A;  2J0T D;  5AFW A;  1RL2 A;  5T1G A;  1SMY C;  1H9K A;  4BBS B;  4LNQ A;  4K8I A;  3O13 A;  3TRZ A;  3NPP A;  4KK7 A;  1V1O A;  2O4X A;  4UDU C;  2JA5 G;  3GTQ H;  1IL2 A;  3UDX A;  4JCV E;  1Y8P B;  5CV6 A;  1XNQ L;  3PUV A;  3EA6 A;  1QWY A;  3I56 A;  1I50 H;  2OTJ A;  1K0S A;  3ER0 A;  4ZRZ A;  2KCN A;  2ZM6 L;  1EY4 A;  1ASZ A;  1I3Q H;  5ELB A;  3PO2 G;  4DR5 L;  4FF2 A;  1EYC A;  4HMJ A;  3TME A;  1F77 A;  1FJG L;  2KEN A;  4XIG S;  1F2Z A;  2I5M X;  2VB3 X;  1FJG Q;  3EN2 A;  5M5W B;  3KF8 B;  5DM6 3;  5JPN C;  1V1Q A;  4DK3 C;  1WFQ A;  3PUX A;  1WTO A;  1BBW A;  2E2D C;  1Y1W B;  3HG9 A;  5EPJ A;  4ZLT F;  5C4J H;  2XTI A;  2RKS A;  2L11 A;  1TWA B;  4OHJ A;  5GAH C;  1JIC A;  4K5W A;  1RKN A;  1KLU D;  3E0J A;  1Y1V H;  2R7Z G;  4B08 A;  1A6X A;  2PNH A;  5M5Y B;  5M5X H;  4OO1 G;  3QIA A;  5C44 B;  2ICI A;  4B3M Q;  1PRT D;  2AMC B;  2PZT A;  4IUT A;  3F1Z A;  2MNA A;  4WFN 3;  3T1H Q;  2OT2 A;  1ILQ A;  1VDZ A;  1OXX K;  1VQF A;  2RF4 A;  4CGY B;  4DV0 L;  2UUA Q;  2BH8 A;  2L5T A;  4X6A H;  2NB0 A;  3BZC A;  5C5M A;  4G7H C;  4FO2 A;  2L9H A;  1A2U A;  3KF6 B;  5BR8 Q;  3MWY W;  4DAY A;  3LNN A;  2IL8 A;  4WOR A;  1L0W A;  1SYD A;  2JK8 A;  4RGT A;  3A7A B;  4AQY L;  1M4V A;  1VQO A;  3NBH A;  4KHV A;  1SE4 A;  4K14 A;  4DGZ A;  2K5H A;  1VQN A;  1VQD A;  3KUP A;  2F0T A;  5I2Y A;  2OEO A;  3S9W A;  3PIO A;  1PRT F;  2QGQ A;  2QCP X;  1E1O A;  4ME3 A;  4CJ0 B;  4JI6 Q;  4JYA Q;  4DV5 Q;  4LF5 Q;  3K0X A;  1R9T B;  4AH6 A;  4LF7 L;  4BY7 B;  4QIW B;  1JE5 A;  1CSP A;  2K33 A;  3S15 B;  5FO7 B;  3RR5 A;  4LK1 C;  1XYI A;  1YVC A;  1BXT A;  2YTX A;  1VQ9 A;  1F9R A;  1FNV A;  1TWF B;  1XTD A;  5M3F G;  2QEX A;  2PMZ B;  1SN8 A;  2FMC A;  2XNA C;  4A3G H;  3CCL A;  1RHP A;  2NVX H;  3QO2 A;  3P75 A;  2RBM A;  3TN2 A;  1JT8 A;  4N9P A;  1PZI D;  1EFI D;  1XWE A;  1R4Q B;  1TWG B;  4RKL A;  1HJP A;  4A3D G;  3G7L A;  1SE2 A;  3TP8 A;  4DV3 Q;  2KED A;  3PUZ A;  1QB5 D;  3M7G A;  2JA7 G;  4DNR B;  3A8K E;  2NN6 I;  3GTK B;  3CMA A;  1UAP A;  3M4Y A;  3IRB A;  1TS3 A;  1E1T A;  1LTB D;  1V43 A;  4YWM A;  2EYH A;  4HJ8 A;  2HIX A;  3KJO A;  2VQF L;  1IW7 C;  4K0K Q;  3MFY A;  2K14 A;  3HOU H;  1XTC D;  4PZ8 A;  3CCE A;  3A74 A;  1H9R A;  2L55 A;  1IHZ A;  1ENA A;  1BKB A;  1VQI A;  1G51 A;  1EIY B;  1I4R A;  4LFC Q;  5HY6 A;  4A3F B;  3DEP A;  1Y8N B;  1X56 A;  2ZTC A;  3HFZ B;  5IIF A;  5JPM C;  4A3E H;  3MXN A;  4HMI A;  4PMW A;  2OWO A;  3OSO A;  1NSN S;  2SOB A;  1LTL A;  3FDT A;  3GP7 A;  2Z6B A;  1NR4 A;  3HOX H;  4DR7 L;  2DY7 A;  5COR A;  5CV4 A;  2UXB Q;  3SEB A;  3S2H B;  2J7Z A;  1G6P A;  4NB3 A;  1CZG A;  4POF A;  1LTI D;  2IY5 B;  2CH4 W;  2F52 A;  2AQ2 B;  2Z4I A;  1LAC A;  1P16 A;  4WJ3 M;  2CH4 A;  3NQT A;  2F3I A;  1LT6 D;  3I8Z A;  4K2L A;  5FLM H;  1ZXT A;  4B3R Q;  2F0Q A;  3K57 A;  3CCU A;  2F0J A;  1HXY D;  5D14 A;  1PA6 A;  3GTG H;  2RHS B;  1BNZ A;  4P72 A;  3JAM L;  1UNS A;  4LF8 L;  1PH9 A;  4IO9 A;  2VUM G;  2KCC A;  5E3F A;  1U0L A;  1IYV A;  4X66 L;  2JSO A;  5JJL A;  1TS5 A;  2ZXO A;  4A3B G;  1PXU A;  1KC8 C;  3VR3 A;  1FNW A;  1AE2 A;  4KD3 A;  4B3S Q;  1EY5 A;  2B2V A;  5HGT A;  1YNJ D;  2D0P A;  1FGU A;  4KN4 C;  3MHB A;  2CW0 D;  1U5K A;  2G9D A;  2M00 A;  3GV3 A;  2R7Z B;  1QVC A;  3H0G G;  4DK6 C;  1TT2 A;  4ZKB B;  5IYB G;  1K28 A;  3S1Q B;  4BA1 I;  1G2S A;  1SRU A;  3L2P A;  3A8J E;  1KIX A;  3I3C A;  4NXM L;  4KHZ A;  1EYD A;  5A35 A;  2JA6 H;  4PQX A;  4A3J H;  4JBW A;  1G91 A;  1CA5 A;  1YI2 A;  1TWC B;  4LF9 L;  3FKI B;  1JJC B;  2F0K A;  3Q24 A;  1UEA B;  3ZJY C;  2A6H D;  1AFP A;  3PF4 A;  3T51 B;  5F2D A;  5E7N A;  2I07 B;  2F4V L;  3LGJ A;  4DUZ L;  4KKS A;  4A75 A;  3AB9 A;  1VF5 C;  3NEN A;  3CCS A;  3B6Y A;  4EQN A;  1GHJ A;  3GTP B;  2FMM A;  1BF4 A;  4LF4 L;  1JC7 A;  3K5N A;  4GKK Q;  4M8A A;  3PUY A;  3OIP A;  3QOL A;  1VQK A;  3NWT A;  3K5M A;  3JAM c;  4JBJ A;  4EX5 A;  1FD7 D;  5C3X A;  5IGB A;  1JWU D;  1EOT A;  2HD3 A;  4JBK A;  4A3C H;  1E2W A;  4FYD A;  3S1R B;  4YWK A;  1AZP A;  4QUC A;  1YIT A;  1AW7 A;  1HFN A;  3MFG A;  1BOS A;  4ABN A;  3S1N B;  2EE1 A;  4MZ9 A;  3HP3 A;  4BBR G;  4BBS H;  3OHX C;  1WTH A;  2K50 A;  2A6E C;  3CQZ B;  2EYO A;  3BDO A;  2EJF C;  5M3F B;  2D2C C;  1EOV A;  5G3L F;  1GUT A;  1A0I A;  2EJG C;  3BVG A;  4JOI A;  3D6W A;  5IP7 H;  2K04 A;  1HNZ L;  4XTC S;  4A3I G;  2Z1C A;  1QZH A;  1J5E Q;  3J81 c;  4A3D B;  4IUV A;  5C0X G;  2KVM A;  2L4N A;  2JA7 B;  4F7X A;  3ND9 A;  1O7I A;  3L0O A;  3M85 A;  1STB A;  2F03 A;  1N32 Q;  1D8L A;  2B2T A;  3STB C;  5M5W H;  1WCM B;  3GO5 A;  1UE7 A;  3H6M A;  2PPB C;  4KY6 A;  3DXJ C;  1CI3 M;  2Y0S E;  4LF6 L;  2EOT A;  3ERO A;  4JI2 Q;  1Y1W H;  4B3T Q;  1PH3 A;  1EU4 A;  2E5L Q;  1KQS A;  1QNK A;  2KOL A;  2NTT A;  5KYI A;  4X62 Q;  1TWA H;  5FLX E;  3GTO B;  3CCR A;  1ROD A;  2H4O A;  1XPO A;  1EEI D;  5EBC A;  4HSV A;  5IGF A;  4RGM A;  2HDM A;  4OEL B;  3IFD A;  3OTO L;  2KHI A;  1B3A A;  1A3U A;  5M5Y H;  1IXR A;  2NYZ D;  1VQ7 A;  5C44 H;  5KNC A;  3OTO Q;  1S5C D;  2ZXR A;  1I4P A;  3F8T A;  4ZAI A;  3HOZ B;  2JXM B;  5M3M G;  2F3W A;  2A73 B;  1I4G A;  2EPB A;  3MA2 B;  3NBI A;  4FXD A;  3PF5 A;  2JN4 A;  3T1Y Q;  4LJZ C;  1N34 L;  3D3R A;  3GDE A;  4BA2 I;  3UE1 A;  1EY7 A;  5JEA H;  1SNP A;  4GOP C;  1T5E A;  1QE6 A;  3GTJ B;  2MGS A;  2Z4H A;  2NUC A;  5H1S E;  4KHP L;  3G6E A;  1HRJ A;  1A2T A;  3PIP A;  1Y14 B;  4HTH A;  4N9T A;  4P2C B;  1GUO A;  5LHY 1;  3FRP B;  4F88 A;  1QUQ A;  2NVX B;  3BZD B;  1V1P B;  1WTQ A;  4KD4 A;  1WTR A;  1WOC A;  1W6J A;  2BDO A;  4DV4 L;  1MGS A;  4A3B B;  1R9T H;  4A3L G;  4HIO A;  3V96 A;  2VQE Q;  4BY7 H;  1HH2 P;  4OIK A;  2EYF A;  1OXT A;  1GJX A;  1UEB A;  5JAV A;  3D8G A;  3H15 A;  4C56 C;  1X65 A;  1OXS C;  1X6O A;  3U9O A;  3S15 H;  2RDF A;  4HCS A;  2WAQ B;  1BVS A;  2K75 A;  1D7Q A;  4HSP A;  3L7Z C;  3CXC A;  2UXC Q;  4PNY A;  1SFO B;  5C0X J;  4DN4 M;  2PW5 A;  4A3K G;  4JI3 Q;  3M4O B;  3F2U A;  1HNX L;  2A69 C;  3FHW A;  1VQJ A;  4K8J A;  4NP5 A;  3H0G B;  5DLQ E;  5KGU A;  1NNX A;  4CBV A;  2XN9 C;  1I4X A;  1SNQ A;  4BXX G;  1K0R A;  3SGI A;  4J1M A;  2A5H A;  4ZCK A;  1FL0 A;  1L1O B;  3K7A H;  3H3V I;  1TWG H;  3PO3 G;  4APV A;  5C4X G;  1LT4 D;  4A3E B;  4GLX A;  2IX1 A;  4R8I A;  4QGU A;  1EY6 A;  2R7F A;  4LUV A;  1JOR A;  3HOY G;  5IGG A;  4MTK A;  3NWS A;  3I4M H;  1HQR D;  4JI7 L;  2K03 A;  4DV6 Q;  3C1E A;  1UE6 A;  4WJW A;  3C1F A;  4X3T A;  5K36 H;  2RCN A;  2HCI A;  3TP7 A;  4OEM B;  1XMO L;  1STG A;  1PYS B;  2E76 C;  1L1O C;  1Z47 A;  5C4Z A;  4RAU C;  3KJP A;  1I5F A;  4A3F H;  1O78 A;  3BYY B;  3W2D A;  2KEE A;  3WDN A;  2K5D A;  3RLO A;  3GTG B;  3UE0 A;  2A68 C;  1KNA A;  3E9I A;  5FO8 B;  5J39 A;  2JP1 A;  4MIU A;  4R4Q A;  5LMN L;  4ALP A;  4BBR B;  4XDX A;  2KJX A;  5LMU Q;  1Q1B A;  2WB1 E;  5C5L A;  4XXE A;  3RZO B;  1SEB D;  3S2H H;  4DV7 Q;  4FF3 A;  5HUR A;  2JA5 H;  3PQI A;  5I4D A;  4N8F A;  2F0L A;  1M90 C;  2PW7 A;  3JC6 6;  1PH2 A;  3CC7 A;  1TU2 B;  1B70 B;  4KJO A;  1Z9F A;  1IBK L;  4Y7N H;  2BH2 A;  2JEA I;  1HPC A;  2BA1 A;  1MBY A;  1IBK Q;  2LXK A;  3F2B A;  3CME A;  1GXD C;  1BCP C;  5IYD G;  1ONL A;  3LWE A;  5EAY A;  3QR8 A;  1KTK A;  1S3O A;  2X69 A;  2SDF A;  1DON A;  2N49 A;  1L0X B;  1CM9 A;  1E22 A;  1YZ6 A;  3DUZ A;  2JA6 B;  4JV5 Q;  4OIJ A;  4A3J B;  3DM1 A;  2Z6K A;  1MJE A;  4CKE A;  4OO1 I;  3J7Y W;  1NR2 A;  3KF6 A;  1XNR Q;  4KTA A;  1ASY A;  2HQE A;  4IPG A;  2GN5 A;  1PMR A;  3Q23 A;  2FIN B;  2UU9 L;  1KL9 A;  2R7Z H;  4CJ2 C;  2K5N A;  2UU9 Q;  4OO1 H;  1KHI A;  3S1Q H;  1K8G A;  4JI4 L;  1MD2 D;  5IYC G;  1VF7 A;  3N6R A;  2K4K A;  3W1G A;  5M3M B;  3JAM i;  3R93 A;  3S17 B;  1RCV D;  4TKO B;  4JI4 Q;  2R92 G;  1HR0 W;  1NE3 A;  4KI0 A;  2MJ8 A;  1CKN B;  3GV6 A;  4AYB G;  2DNC A;  4ZKC B;  3BZK A;  4FDB A;  2JA8 G;  2HDL A;  5I6W A;  1TWC H;  4R8N A;  3FPP A;  2CVR A;  1VQ8 A;  3I4N G;  3C2P A;  1T5X D;  2FHT A;  2PO4 A;  1QVF A;  2B2U C;  4ODG A;  1ZYR C;  2F0O A;  1U4M A;  1GO3 E;  4HIM A;  2B2Y A;  1K8A C;  2NVQ B;  1KAA A;  4I7Z C;  3BU2 A;  1K3B C;  5CYU A;  4BY1 G;  3NEM A;  2YTY A;  3GTP H;  4HED A;  3CP0 A;  3RUZ A;  4ME5 A;  1LTR D;  1Q8K A;  4IPD A;  4P71 A;  4DPG A;  2L0C A;  3J81 i;  1RIP A;  5J1Z A;  2R93 G;  4DNT B;  4G4K A;  4A93 G;  3S1R H;  3ITP A;  3K5L A;  5FK9 C;  5KYL A;  1XJV A;  1DGS A;  3OW2 A;  5KEE A;  2E2J H;  3S1N H;  4GNX B;  2EVB A;  1B7Y B;  3VA5 A;  2XRS D;  4DKA C;  2MQH A;  1A63 A;  1H95 A;  3CQZ H;  4PG3 A;  5CV8 A;  2L1B A;  5M3F H;  1ML0 D;  4A3K B;  1SE8 A;  5D3I B;  2F0I A;  1YJW A;  5CMD A;  4KJN A;  3BVM A;  1Q1E A;  1KD1 C;  1MHW C;  4CKB A;  3VDY A;  1SMY D;  3PO3 B;  4A3D H;  2KBN A;  4GNX C;  4DR1 L;  4C3J G;  1CA6 A;  3GTM B;  4EQ5 A;  2JA7 H;  4B3M L;  3U50 C;  4JI8 Q;  3T1H L;  4DR1 Q;  2B2W C;  4KY5 A;  2HCC A;  2UUA L;  2EZV A;  1E0B A;  3K5O A;  2RHQ B;  2N55 A;  1WCM H;  3KDF B;  1PHJ A;  4UP7 A;  1AP0 A;  1VQ6 A;  4MNO A;  3H94 A;  4UP9 A;  2NBF A;  1D5Z C;  5BR8 L;  5E4X A;  3QB3 A;  3A0J A;  1U9R A;  4JI0 L;  2AHO B;  2OQK A;  3SDZ A;  1LT5 D;  4NW2 A;  1D2B A;  1SDF A;  3NXW A;  1X3P A;  1ICW A;  4JI0 Q;  3TQY A;  3GTO H;  4H0L C;  4R1J A;  4YY3 Q;  2F0S A;  1YIJ A;  3NTK A;  2ATW A;  1J6Q A;  5IP9 G;  3MTS A;  1K73 C;  2VZA A;  1EQQ A;  3ND8 A;  4I65 A;  3J7A V;  1H9J A;  3HOW G;  2XGT A;  3HOZ H;  1O7Y A;  2F0W A;  4JI6 L;  4JYA L;  4DV5 L;  4LF5 L;  1I94 Q;  5IWA L;  1PH1 A;  1E3P A;  2WFW A;  2JQO A;  3FMC A;  2MO0 A;  4CJ1 B;  4KKT A;  3NQI A;  2VY3 A;  5IWA Q;  3S16 B;  3KK7 A;  4PMB A;  3EQL C;  4AIM A;  4NPS A;  1WTX A;  2K7V A;  3GTJ H;  3I91 A;  4B9X A;  3HEJ A;  2YYZ A;  4NXN Q;  1Q7Y C;  1HUM A;  4LAA A;  1K9M C;  3VYU A;  1BBU A;  3L3O C;  4GZY C;  4IUU A;  1YHQ A;  5GAG C;  4HR7 B;  5ELC A;  3A54 A;  5IT9 c;  4IFD I;  4A3B H;  3KLS X;  1SRO A;  2EJM A;  2ES2 A;  2I0Q A;  1HZB A;  4DV3 L;  1ENC A;  3K7A B;  1GOZ A;  5CV5 A;  1JB7 A;  4DV1 Q;  2NZ1 D;  3MVV A;  1SBB B;  1JQY D;  1WJJ A;  2NZO A;  2NZH A;  3URY A;  3HOV G;  4GKJ Q;  2WKC A;  1IBL Q;  2G9H D;  1SFO H;  4K0K L;  3I4M B;  3UDF A;  3M4O H;  4QL5 A;  3DWP A;  2MO1 A;  4IUR A;  3VR5 A;  3X3M A;  3H0G H;  1TVX A;  4QF4 A;  1KDB A;  2GVA A;  2TMP A;  3OPO A;  2QA4 A;  5IYB H;  1SYE A;  3HKZ G;  2K1B A;  1PVO A;  5I9P A;  3HGB A;  2NN6 H;  4LFC L;  4C3H G;  3VYT A;  1HR0 Q;  2B2Y C;  4JI5 Q;  3CPW A;  1HZA A;  1VQG A;  1A8V A;  2OF1 A;  1GM5 A;  4AYB B;  2PI2 E;  2JA8 B;  5I9O A;  2WII B;  2LMC B;  4GS3 A;  4RFB A;  4FXK C;  4YHH L;  3H3V C;  1VQC A;  2K5W A;  2L15 A;  3PV0 A;  3T53 B;  4X64 L;  2UXB L;  3EJI A;  4J6H A;  4TQU S;  4YHH Q;  2LSS A;  1KXL A;  1DD2 A;  4X64 Q;  2CQO A;  2B8G A;  1FR3 A;  2JA5 B;  1TS2 A;  2ENB A;  2CKZ B;  1A3V A;  3SK8 A;  1MJC A;  2IWH A;  3RNU A;  4JK1 C;  2BDN A;  4OWT B;  4DAV A;  4B3R L;  1H9M A;  1HQM C;  3I70 A;  3V05 A;  5EQ0 A;  4XYO A;  3VR2 A;  4DAM A;  4Y7N B;  2B29 A;  3PO2 B;  3PSI A;  1IW7 D;  4HID A;  5DEH A;  1FVI A;  2CQA A;  4IPC A;  4EGV A;  4DAY B;  2SNM A;  4BBR H;  2XRQ D;  4DV2 Q;  1EUJ A;  3RZO H;  1S5E D;  4B3S L;  4PZ6 A;  5C0X I;  3NBH B;  5IOD A;  1LLR D;  1NY4 A;  5TSS A;  1KDA A;  2WAC A;  3NTI A;  3G6J B;  3UDI A;  2UUC L;  4Y52 H;  1RD9 D;  1SYF A;  1SNM A;  4C1N K;  1TS4 A;  4GN3 B;  5KND A;  2M2L A;  2UUC Q;  1J8I A;  4IFD G;  1E24 A;  3VYS A;  4R4C A;  1PTO C;  3G48 A;  1G2T A;  1VMC A;  2DJF C;  2NVY H;  3MXU A;  5JVG 3;  2EYP A;  2MPM A;  1DZ1 A;  1SJE D;  2F0D A;  2YU9 H;  4DU9 A;  3J81 L;  3SK5 A;  1YNN C;  4XQN A;  1YHA A;  3LX0 A;  5DAU A;  2I46 A;  4ID6 A;  1VS0 A;  2EYJ A;  4XT1 B;  4JI1 Q;  1ILP A;  4QIW E;  5C6A A;  4OXP A;  2HUG A;  3L9A X;  1LTT D;  2F0V A;  2QW7 A;  1UWV A;  4G57 A;  3KYH C;  1SE3 A;  3SVM A;  3A5U A;  5G3L D;  1O7L A;  3KFU A;  4UHV A;  2F0N A;  2EXD A;  2PMZ E;  3NP8 A;  4CDC C;  4GKK L;  1GD7 A;  4POG A;  2WV6 D;  4P75 A;  3HOW B;  1LAB A;  4F8M A;  2A8V A;  5M3M H;  2UXD Q;  3S17 H;  4A76 A;  3Q8D A;  4LUZ A;  1I6V C;  4X65 Q;  3I2Z A;  3NSW A;  4LFA Q;  2KCM A;  4N8X 1;  2B63 G;  1F2M A;  1AN8 A;  1S5B D;  1X55 A;  5C4H A;  2E2J B;  3ONA B;  3CD6 A;  3DLL A;  3SXH A;  3M3Y B;  4LUO A;  1WD1 A;  3NTH A;  2Q2H A;  2A19 A;  2OCE A;  1DOL A;  2ZJP A;  3QOJ A;  5FO9 B;  1C8C A;  2NVQ H;  2BE5 C;  1TY0 A;  3QWN A;  2CHB D;  2F0P A;  2Z0S A;  1GVP A;  1SJH D;  3ERQ A;  1HZC A;  3TDQ A;  4R4T A;  1J5E L;  1EL0 A;  4A3L H;  5LL6 X;  1PV4 A;  1B1Z A;  1JJG A;  5DM7 3;  4LFB Q;  1N32 L;  1YNX A;  2E2I B;  3P1H A;  3JAM E;  2MUY A;  1WD0 A;  4HIK A;  2R61 A;  1T9H A;  1OO9 B;  4QB4 A;  4IFD J;  1NJI C;  2XIW A;  4A3K H;  5JOB A;  1Q86 C;  1JOQ A;  2KHS A;  4JI2 L;  2JA9 A;  4C3I G;  4B3T L;  4H44 C;  1PFS A;  2E5L L;  1SYC A;  1EU3 A;  4FNF A;  1A3T A;  5LL6 S;  3HKZ B;  4X62 L;  2EYM A;  4G7Z C;  4BXX H;  1HA6 A;  4C3H B;  2PNR C;  2KUM A;  1Q8I A;  1N33 Q;  1GUG A;  3SE0 A;  5BN3 A;  1D5X C;  4X3K A;  3PO3 H;  2FFK B;  5C4X H;  5E1F A;  1EEF D;  2A6E D;  2GA4 B;  4OL7 A;  2DNE A;  3K81 C;  4A4I A;  3GTM H;  3TP5 A;  3BVZ A;  4GOP B;  2ZT9 C;  2MP1 A;  4XQQ A;  2UUB Q;  4G7O C;  3HOY H;  1X32 A;  2PQA A;  2E74 C;  3PMF A;  3J81 E;  1YJ9 A;  1YEZ A;  1E2V A;  2F0E A;  3T1Y L;  4IJH A;  5I6Y A;  2I5H A;  2Z8L A;  1LV9 A;  5ELN A;  1EQV A;  3W3A A;  4EQO A;  4JW0 A;  3FPU B;  3DWA A;  1YJN A;  3OIQ A;  1XMQ Q;  3CCV A;  3TS0 A;  3J7A 5;  2B2V C;  1SSO A;  3STB D;  2F0U A;  4YWL A;  4O2D A;  4IAL A;  5HGQ A;  1N9W A;  2KQ3 A;  1MKH A;  1STY A;  1JWM D;  1PH7 A;  2Q2U A;  4L5R C;  2K05 A;  2VUM B;  1KAW A;  1STE A;  4YCU A;  3DMU A;  1C4Q A;  4L5T A;  1IZ6 A;  3AQQ A;  4X3U A;  3K6O A;  2VQE L;  3R3O A;  5ELD A;  1ZKO A;  2IPK D;  2ICE C;  3BDL A;  1TWH B;  4BBS G;  3S16 H;  4HJ5 A;  1H9S A;  1QIL A;  1VQH A;  1LTA D;  4DR3 Q;  2UXC L;  4JI3 L;  3WOF A;  3KLW A;  1PFN A;  5ELF A;  1Y69 U;  4EVO A;  5GRO A;  4V19 0;  2OTL A;  1NAP A;  5IYD H;  1CTM A;  3UDG A;  1HTL D;  2DUD A;  2ID0 A;  2RVL A;  3GTL B;  4HCE A;  3Q0A A;  2K6A A;  3TBI B;  2C35 B;  4QQB X;  1X3Q A;  2VXW A;  1CKN A;  1Z7T A;  1G29 1;  2CWA A;  1X3F A;  4DV6 L;  2RDG A;  3CU7 A;  3TZD A;  1HNW Q;  5EBD A;  3CHB D;  3E6Z X;  3H3V H;  1K8O A;  2N3S A;  3A8I E;  4O42 A;  5E4W C;  1NCV A;  1Y8O B;  1E7Z A;  4TVA B;  5K5P A;  5COY A;  3BDC A;  5IYC H;  3TRE A;  3BG3 A;  3X3N A;  4DXG A;  3CPF A;  3P7J A;  5C3E G;  4KN7 C;  1SAP A;  4DR6 Q;  1VQ5 A;  1LUZ A;  1IBM L;  4JOI C;  1K3R A;  3T56 B;  2JA8 H;  1CKM A;  5CGK A;  2B63 B;  2A69 D;  1IYU A;  1ENF A;  1IBM Q;  2PI2 A;  5LMU L;  2RQX A;  4RHS A;  1SYB A;  3ICE A;  4DV7 L;  2SNS A;  2F0G A;  4DR2 Q;  4OWX B;  3OOC A;  1BCP B;  1EWI A;  1C9O A;  1ESF A;  1DYQ A;  3KBG A;  3KF8 A;  1AH9 A;  1B50 A;  5T1I A;  4UP8 A;  2B2T C;  4L63 B;  2RA4 A;  3HZX A;  5CBE E;  1MIU A;  2RSN A;  1JR0 D;  5GAE C;  4QCL A;  5JJI A;  3EBE A;  2OXP A;  4QY7 A;  1D1I A;  1PH5 A;  2GVB A;  3Q6S A;  4A3I B;  2Q8T A;  1JB3 A;  3K59 A;  3DWQ A;  3A5Z B;  4L6T B;  3PO2 H;  5EGT A;  1LM0 A;  2NVY B;  4OON A;  2BA0 A;  1EYA A;  5JJK A;  4RA8 A;  1PTO H;  1F2Y A;  3R2I A;  2YU9 B;  3P20 A;  1F9S A;  4JV5 L;  1UE5 A;  1WTW A;  3Q22 A;  2JYO A;  1PFB A;  3GQB A;  4C3I B;  1XNR L;  1RF2 D;  4C2M B;  3I72 A;  2PCF B;  2VL6 A;  2A68 D;  5FJ8 G;  1GUW A;  1QUQ B;  1QOH A;  3C46 A;  4LMQ D;  1KNE A;  2KHJ A;  1II3 A;  2ZJR A;  2HHH Q;  4NDX A;  2Q8I B;  4WRD A;  1YHB A;  4RGN A;  4P73 A;  2MFI A;  3I4L A;  2EY2 A;  3C3L A;  3KLR A;  3EVQ A;  5C3W A;  2F0F A;  2RCF A;  5J22 A;  4V0B A;  4FF4 A;  2VS1 A;  2VW9 A;  2C5C A;  4DR4 Q;  5EKL A;  5FOB B;  2QKI C;  2K32 A;  1BCP D;  1GKH A;  1PZK D;  2PYK A;  4O0A A;  1WTV A;  1B4O A;  1F9Q A;  2WAQ E;  3OYY A;  3AMU A;  4IJL A;  1CKO A;  2XWB B;  1VQA A;  1X3G A;  3F2D A;  2EY5 A;  1G8Z D;  3E9H A;  4KKU A;  3SHL A;  1PRT B;  5L37 A;  2IHF A;  3HOW H;  3ZYY X;  4J15 A;  2DN8 A;  4UY8 C;  1FYC A;  1DJR D;  5DNF A;  5NUC A;  3RN5 A;  1DCZ A;  3RLF A;  3MXG A;  3T4A C;  3CRK C;  1RTO A;  2B3G A;  3BS1 A;  1RTN A;  5A2Q L;  2DJG C;  4JBM A;  3S2D B;  3I4O A;  2WIN B;  2Y0S G;  1B9N A;  2F0H A;  2VB2 X;  1BCP F;  2XSC A;  3CAM A;  3M3Y H;  3IKJ A;  2HQL A;  1PRT C;  1NBW A;  2NVT B;  1JWS D;  2JJQ A;  4Q0F A;  1VCI A;  1E2Z A;  4RMF A;  3TEH B;  3CCQ A;  1VQP A;  1XNQ Q;  2I5L X;  4CHT B;  4U68 A;  5KIX A;  1HUN A;  1L2F A;  1SND A;  2ZM6 Q;  2G5D A;  4KY7 A;  4ZYS A;  4XQJ A;  2E8G A;  5JVH 3;  1ZYR D;  2LKV A;  2EDG A;  1STH A;  5C4X B;  3DEO A;  4DR5 Q;  4JI8 L;  4IUN A;  4H7B A;  3I7F A;  4A3M G;  3GD7 A;  1IL8 A;  2AUJ D;  2F3V A;  2E2I H;  5IT9 L;  1N8R C;  1JCK B;  3HOY B;  1X3E A;  3HOV H;  4MHE A;  1B53 A;  1PLF A;  1DM0 B;  3D31 A;  4HJA A;  1V9P A;  2R7D A;  4RKB A;  4RH6 A;  3AFP A;  1NMG A;  1PFM A;  2O5J C;  3PGZ A;  4IQZ A;  1TII D;  4C3H H;  3CC4 A;  2LS0 1;  3FP9 A;  1YBY A;  4YY3 L;  5C3E B;  1CT1 D;  3A56 A;  4YCV A;  3S1M B;  2DGY A;  4J8Q A;  5IE8 A;  4FF1 A;  5JJZ A;  3SK4 A;  4DAP A;  2CCZ A;  4UPA A;  5CR3 A;  3RMH A;  3IAY A;  4DV0 Q;  5EJW A;  1I94 L;  1TXY A;  1IYJ B;  4PV1 C;  3FKI G;  3EFX D;  3LWU A;  4QJF A;  2RDH A;  2FXQ A;  4NKL A;  3V2T A;  1CQV A;  3RN2 A;  2AQ1 B;  3OWE B;  4F87 A;  4RCN A;  1K83 B;  3R2T A;  2B39 A;  2O2L D;  4AQY Q;  1ICF B;  4KLK A;  1XX8 A;  1F2L A;  3OW7 A;  4NXN L;  1B44 D;  2JE6 I;  2Z6K C;  1XPR A;  3ULP A;  1U4P A;  2JEB I;  4DK1 A;  2A74 C;  2VUM H;  1NTG A;  4IUP A;  1EZ8 A;  5ELE A;  5BN5 A;  4LF7 Q;  4BS9 A;  2KEC A;  2E2H B;  2QIL A;  4DV1 L;  4CDD C;  1TWH H;  3OMC A;  3E3X A;  1PH6 A;  4IZ8 A;  1MI2 A;  5A2Q E;  4GKJ L;  1IBL L;  4K5V A;  5FKA C;  1S72 A;  5CV9 A;  1KRS A;  1VQE A;  2L12 A;  4IFD H;  2YV5 A;  1STN A;  2DY8 A;  3QG1 A;  5EPK A;  5ISR A;  3CW2 C;  3PUW A;  1HR0 L;  1B9M A;  2PZU A;  4ZK9 B;  3GTL H;  3J80 L;  3AU7 A;  1Z6H A;  4JI5 L;  2TSS A;  1Y1V G;  2K52 A;  3K80 C;  2R92 B;  2AWN A;  4OX9 L;  3KBX A; 
#chains in the Genus database with same CATH homology
 2NVQ H;  2ZJP A;  3CCM A;  1NMF A;  2WB1 G;  4GLX A;  4OX9 Q;  3PUV A;  3I56 A;  1XNQ L;  2IX1 A;  1I50 H;  2OTJ A;  4QGU A;  1WCM G;  2R7F A;  3ER0 A;  4LUV A;  3HOY G;  1EFW A;  2Z0S A;  3S14 H;  1GVP A;  2ZM6 L;  3I4M H;  1ASZ A;  1HZC A;  4DV6 Q;  4JI7 L;  1EYG A;  1I3Q H;  4R4T A;  1J5E L;  1B8A A;  1UE6 A;  2HIV A;  4YCW A;  2RCN A;  2VQF Q;  3PO2 G;  4A3L H;  1PV4 A;  4DR5 L;  1XMO L;  1S40 A;  1PYS B;  1JJG A;  1FJG L;  1L1O C;  2KEN A;  4XIG S;  1JJ2 A;  4LFB Q;  1N32 L;  1YNX A;  1Z47 A;  2I5M X;  1FJG Q;  3EN2 A;  3KJP A;  3KF8 B;  4HIK A;  1I5F A;  1T9H A;  4H02 A;  4A3F H;  3CC2 A;  4IFD J;  1V1Q A;  1WYD A;  1NJI C;  4DK3 C;  1WFQ A;  3PUX A;  4A3K H;  4L5S A;  1Q86 C;  3RLO A;  4JI2 L;  1AE3 A;  2JA9 A;  1BBW A;  4B3T L;  3U4Z A;  3UE0 A;  3EIV A;  1PFS A;  3E9I A;  2E5L L;  3HOZ G;  5C4J H;  4R4Q A;  4ALP A;  3U58 A;  5LMN L;  2B63 H;  2XTI A;  4X62 L;  1N36 L;  3M7N A;  5GAH C;  4BXX H;  5LMU Q;  1Q1B A;  2WB1 E;  4DV2 L;  4DR7 Q;  1N33 Q;  1N36 Q;  4LWC A;  2ZTD A;  3S2H H;  4DV7 Q;  2JA5 H;  3PO3 H;  5C4X H;  1Y1V H;  2R7Z G;  1EIF A;  2K5V A;  2V1C C;  3K81 C;  1M90 C;  4A4I A;  2PNH A;  4WJ4 A;  3GTM H;  5M5X H;  4OO1 G;  3JC6 6;  4GOP B;  1PH2 A;  4B3M Q;  2AMC B;  2MNA A;  3CC7 A;  3F1Z A;  3T1H Q;  1W2B A;  1PH8 A;  2UUB Q;  1VQF A;  1OXX K;  2RF4 A;  2UUA Q;  2KCT A;  4DV0 L;  2BH8 A;  3HOY H;  1QZG A;  4X6A H;  1B70 B;  1Z9F A;  2PQA A;  1YJ9 A;  3BZC A;  1YEZ A;  1IBK L;  4Y7N H;  2BH2 A;  2CFM A;  4A3I H;  3KF6 B;  2JEA I;  4IOC A;  4IJH A;  3T1Y L;  4A3G G;  1SR3 A;  2BA1 A;  3J80 c;  1IBK Q;  2LXK A;  2I5H A;  5BR8 Q;  3CME A;  3F2B A;  5ELN A;  5IYD G;  1L0W A;  1CSQ A;  4LF8 Q;  1A62 A;  2JK8 A;  5EAY A;  4GLV B;  1YJN A;  1XMQ Q;  2IX0 A;  3CCV A;  4AQY L;  1S3O A;  4X66 Q;  1VQO A;  4GOP A;  3K8A A;  3TS0 A;  2N49 A;  4GN4 B;  3J7A 5;  3J7Z C;  1E22 A;  1YZ6 A;  3STB D;  4JV5 Q;  4YWL A;  4O2D A;  2K5H A;  2Z6K A;  1MJE A;  5HGQ A;  1Q81 C;  1N9W A;  1M1K C;  4C3I H;  4OO1 I;  3F2C A;  2WAQ G;  4JI1 L;  1VQD A;  1VQN A;  1MKH A;  3NEL A;  5GQO A;  3KF6 A;  1PH7 A;  2Q2U A;  4L5R C;  4C2M H;  1XNR Q;  1ASY A;  3PIO A;  2QGQ A;  1KAW A;  1E1O A;  4ME3 A;  1Q46 A;  4IPG A;  4YCU A;  4DV5 Q;  4L5T A;  4JI6 Q;  4LF5 Q;  2GN5 A;  1IZ6 A;  1W3S A;  3K0X A;  3AQQ A;  4AH6 A;  3HOU G;  2VQE L;  4LF7 L;  2UU9 L;  1KL9 A;  3U4V A;  2R7Z H;  1JE5 A;  3RLN A;  2K5N A;  3W5O A;  1CSP A;  2UU9 Q;  2NN6 G;  4BBS G;  1KHI A;  3S16 H;  3RR5 A;  4HJ5 A;  1K8G A;  4JI4 L;  3S1Q H;  1VQH A;  5IYC G;  1YVC A;  2UXD L;  3W1G A;  2K4K A;  3JAM i;  5IY0 A;  4DR3 Q;  2UXC L;  2YTX A;  3MEF A;  1VQ9 A;  4JI4 Q;  2R92 G;  4X65 L;  4JI3 L;  4NXM Q;  5M3F G;  1XTD A;  3KLW A;  1NE3 A;  4KI0 A;  4A3E G;  1HR0 W;  2QEX A;  1D7Q A;  1SN8 A;  4AYB G;  1CKN B;  4A3G H;  3BZK A;  5GRO A;  4FDB A;  4LFA L;  2JA8 G;  3ULL A;  2OTL A;  1TWC H;  3CCL A;  4LF9 Q;  2NVX H;  5IYD H;  3UDG A;  2DUD A;  1VQ8 A;  2ID0 A;  3I4N G;  3HOX G;  1C0A A;  1JT8 A;  1QVF A;  2EQS A;  5AJ3 L;  2ASB A;  2F4V Q;  2IHE A;  4DUZ Q;  1HJP A;  4A3D G;  2C35 B;  1GO3 E;  5AJ3 Q;  4HIM A;  4DV3 Q;  3PUZ A;  1K8A C;  2JA7 G;  4QQB X;  2NN6 I;  3BU2 A;  4BY1 G;  3NEM A;  2YTY A;  3CMA A;  3GTP H;  4LF4 Q;  3IRB A;  1CKN A;  3CP0 A;  1PYB A;  3MXN B;  1E1T A;  1G29 1;  1V43 A;  1X3F A;  2CWA A;  5FLM G;  4DV6 L;  1Q8K A;  4YWM A;  4IPD A;  4P71 A;  4HJ8 A;  4DPG A;  2HIX A;  3KJO A;  3J81 i;  2VQF L;  4K0K Q;  1RIP A;  1HNW Q;  2K14 A;  2R93 G;  1UE1 A;  3HOU H;  4PZ8 A;  3CCE A;  4A93 G;  4RG1 A;  3A74 A;  3E0E A;  3S1R H;  3H3V H;  2N3S A;  1XJV A;  4LFB L;  1BKB A;  2OQ0 A;  1DGS A;  2YTV A;  3OW2 A;  1VQI A;  4AYB E;  1E7Z A;  3AFQ A;  1X9N A;  1L1O A;  4TVA B;  1G51 A;  2E2J H;  3S1N H;  4GNX B;  5IYC H;  1EIY B;  1Q12 A;  3TRE A;  1B7Y B;  3S2D H;  4LFC Q;  4R4O A;  3CPF A;  2MQH A;  5HY6 A;  4DKA C;  5LMN W;  5FLX c;  5C3E G;  1VQ4 A;  1A63 A;  3CQZ H;  4PG3 A;  1X56 A;  2ZTC A;  4DR6 Q;  5M3F H;  1SE8 A;  3HFZ B;  4A3E H;  1VQ5 A;  1LUZ A;  1YJW A;  2NVT H;  1IBM L;  4JOI C;  4PMW A;  1K3R A;  2OWO A;  4JCV E;  2JA8 H;  1CKM A;  1Q1E A;  1IBM Q;  1LTL A;  2PI2 A;  2EIF A;  5LMU L;  1KD1 C;  3HOX H;  4DR7 L;  1HNZ Q;  1N33 L;  2N8N A;  3VDY A;  2UXB Q;  3ICE A;  4DV7 L;  4DR2 Q;  1G6P A;  4NB3 A;  4OWX B;  1VQM A;  4POF A;  4A3D H;  2KBN A;  2IY5 B;  1EWI A;  4GNX C;  4DR1 L;  2F52 A;  4EQ5 A;  1C9O A;  1LYL A;  1P16 A;  3U50 C;  1QVG A;  4B3M L;  2JA7 H;  4WJ3 M;  4JI8 Q;  1AH9 A;  3T1H L;  4DR1 Q;  4UP8 A;  2UUB L;  2F3I A;  2UUA L;  1MIU A;  5GAE C;  5JJI A;  2RHQ B;  3EBE A;  5FLM H;  1WCM H;  3KDF B;  2JA6 G;  4B3R Q;  1PHJ A;  4QY7 A;  4UP7 A;  5ELO A;  4A3J G;  1PH5 A;  2GVB A;  3CCU A;  1PA6 A;  1VQ6 A;  3GTG H;  4MNO A;  4UP9 A;  2RHS B;  5BR8 L;  4LF6 Q;  3A5Z B;  4P72 A;  3PO2 H;  3A0J A;  4DUY L;  4LF8 L;  1PH9 A;  4IO9 A;  4JI0 L;  2VUM G;  2AHO B;  2OQK A;  1LM0 A;  1XMQ L;  1U0L A;  4OON A;  4X66 L;  4DUY Q;  4LW1 A;  2BA0 A;  4L5Q A;  4JI0 Q;  5JJL A;  3TQY A;  3GTO H;  5JJK A;  4R1J A;  4YY3 Q;  4A3B G;  1KC8 C;  5C3E H;  1YIJ A;  4JV5 L;  1AE2 A;  4B3S Q;  1UE5 A;  2ATW A;  3S1M H;  1J6Q A;  5IP9 G;  3K7U C;  1K73 C;  3KOJ A;  2VZA A;  2D0P A;  1EQQ A;  1FGU A;  1P8L A;  1XNR L;  2VL6 A;  3HOW G;  2XGT A;  2CWP A;  5FJ8 G;  3HOZ H;  4JI6 L;  1QUQ B;  4JYA L;  1HZ9 A;  4DV5 L;  4LF5 L;  1I94 Q;  2D62 A;  2KHJ A;  2ZJR A;  1U5K A;  2HHH Q;  4A3C G;  5IWA L;  1YHB A;  1PH1 A;  2WFW A;  1E3P A;  1QVC A;  2JQO A;  2MO0 A;  3H0G G;  4DK6 C;  1N34 Q;  4P73 A;  2MFI A;  3AYH B;  2VY3 A;  5IWA Q;  5IYB G;  4P74 A;  3CC4 A;  4AIM A;  4BA1 I;  1SRU A;  3L2P A;  4DR3 L;  4NPS A;  3M4Q A;  1K83 H;  1KIX A;  2VS1 A;  3GTJ H;  4NXM L;  4KHZ A;  2JA6 H;  4KHP Q;  2VW9 A;  4A3J H;  4JBW A;  3D0F A;  2YYZ A;  4NXN Q;  1Q7Y C;  4DR4 Q;  3ERS X;  1YI2 A;  4LF9 L;  1K9M C;  1SLJ A;  1JJC B;  1BBU A;  5IP7 G;  3ZJY C;  1YHQ A;  5GAG C;  3PF4 A;  1GKH A;  5E7N A;  4O0A A;  2F4V L;  3LGJ A;  4DUZ L;  5IT9 c;  4DV4 Q;  4A75 A;  4IFD I;  2WAQ E;  3OYY A;  4A3B H;  1SRO A;  3G4S A;  2ALY B;  2ES2 A;  1HZB A;  4IJL A;  4DV3 L;  2I0Q A;  3NEN A;  1CKO A;  3CCS A;  3B6Y A;  4GKK L;  2E2H H;  1VQA A;  1X3G A;  3F2D A;  3PCO B;  4DV1 Q;  1JB7 A;  3E9H A;  4LF4 L;  4GKK Q;  1WJJ A;  2NZO A;  3PUY A;  5GAD C;  2IHF A;  3HOW H;  1VQK A;  5FJ8 H;  3JAM c;  3W1B A;  2NZH A;  4JBJ A;  3HOV G;  1TWF H;  4IOA A;  4EX5 A;  4GKJ Q;  4J15 A;  1IBL Q;  1SFO H;  4UY8 C;  4K0K L;  1HNW L;  2VNU D;  3UDF A;  4JG2 A;  4JBK A;  3RN5 A;  4QL5 A;  3M4O H;  4A3C H;  1HNX Q;  2MO1 A;  5J3B A;  4YWK A;  2A1A A;  3RLF A;  3H0G H;  1Y1W G;  1OXU A;  1YIT A;  2GVA A;  2QA4 A;  2B3G A;  5IYB H;  3HKZ G;  4MZ9 A;  1PVO A;  4LFC L;  4JBM A;  4BBR G;  3I4O A;  4BBS H;  2Y0S G;  1HR0 Q;  2K50 A;  1OXV A;  3CCJ A;  2IT1 A;  4JI5 Q;  1Q82 C;  3CPW A;  1HZA A;  3CAM A;  3M3Y H;  4DR6 L;  1VQG A;  3TS2 A;  1A8V A;  2HQL A;  1GM5 A;  1EOV A;  1NBW A;  2R92 H;  3S24 A;  2PI2 E;  2JJQ A;  3GTK H;  1A0I A;  1VCI A;  5C44 G;  4JOI A;  4RMF A;  3TEH B;  3CCQ A;  5IP7 H;  1VQP A;  1XNQ Q;  2I5L X;  4GS3 A;  4YHH L;  1L2F A;  2Q2I A;  1HNZ L;  1VQC A;  2L15 A;  2ZM6 Q;  3PV0 A;  4XTC S;  4IPH A;  4X64 L;  4A3I G;  3I4N H;  2UXB L;  4DR2 L;  4JI7 Q;  4TQU S;  4YHH Q;  2LSS A;  1QZH A;  2E8G A;  3J81 c;  1J5E Q;  2AKW B;  3G71 A;  1KXL A;  4X64 Q;  2CQO A;  5C0X G;  4DR5 Q;  4GNX A;  1XMO Q;  4JI8 L;  1O7I A;  3L0O A;  3M85 A;  2CKZ B;  3I7F A;  4A3M G;  3GD7 A;  5JEA G;  1C7Y A;  1N32 Q;  2E2I H;  1MJC A;  2N78 A;  1D8L A;  3RNU A;  4BY1 H;  4OWT B;  2WP8 J;  3GO5 A;  3STB C;  1UE7 A;  5M5W H;  1N8R C;  1X3E A;  3HOV H;  4B3R L;  3HKZ E;  3CF5 A;  5C4X G;  2Y0S E;  3J80 i;  3WWV A;  4DAM A;  3D31 A;  4HJA A;  4LF6 L;  2PQA B;  2B29 A;  4JI2 Q;  3PSI A;  1V9P A;  1Y1W H;  2R7D A;  2R93 H;  4B3T Q;  1H95 A;  1PH3 A;  4HID A;  1JMC A;  1VQL A;  2E5L Q;  1FVI A;  1KQS A;  3AFP A;  4A93 H;  2D0O A;  1NMG A;  4IPC A;  5LMN Q;  3PGZ A;  4X62 Q;  4PZ7 A;  1TWA H;  4DAY B;  2R6G A;  4C3H H;  1EQR A;  3FP9 A;  1YBY A;  4BBR H;  4YY3 L;  4HJ9 A;  3CCR A;  1XPO A;  4DV2 Q;  1EUJ A;  3RZO H;  4B3S L;  4YCV A;  2DGY A;  2AWO A;  4PZ6 A;  5IE8 A;  1XPU A;  4BY7 G;  5C0X I;  3OTO L;  1I6H H;  2KHI A;  3NBH B;  1NY4 A;  3M4P A;  2CCZ A;  5M5Y H;  4UPA A;  1IXR A;  1VQ7 A;  5C44 H;  3UDI A;  3KDF A;  3OTO Q;  2UUC L;  3F8T A;  4OWW B;  4Y52 H;  3BJU A;  5M3M G;  4GN5 A;  1VQB A;  4DV0 Q;  4HJ7 A;  2UUC Q;  4GN3 B;  1I94 L;  1TXY A;  2HHH L;  1IYJ B;  4IFD G;  3FKI G;  1E24 A;  3PF5 A;  3T1Y Q;  4QJF A;  1N34 L;  4R4C A;  2FXQ A;  3G48 A;  3GDE A;  4C3J H;  3RN2 A;  2HT1 A;  4JYA Q;  4R4I A;  4BA2 I;  2NVY H;  3UE1 A;  4A3M H;  3M9B A;  1OTC A;  2H5X A;  4DNI A;  1WI5 A;  2ZTE A;  4GOP C;  2YU9 H;  3RZD H;  4AQY Q;  5H1S E;  4KHP L;  1YHA A;  4KLK A;  3G6E A;  4NXN L;  1SMX A;  4DR4 L;  3PIP A;  1Y14 B;  2Z6K C;  2JE6 I;  1X54 A;  3ULJ A;  2Q2T A;  1XPR A;  3ULP A;  1VS0 A;  1CUK A;  1QUQ A;  4JI1 Q;  4QIW E;  4OXP A;  2JEB I;  3I55 A;  3I4M G;  2VUM H;  1WOC A;  1NTG A;  4DV4 L;  4JC0 A;  3AEV A;  5K36 G;  4GLA C;  1UWV A;  1R9T H;  4A3L G;  4HIO A;  3KYH C;  2VQE Q;  4LF7 Q;  3A5U A;  1HH2 P;  3KFU A;  4BY7 H;  1OXT A;  2EXD A;  4DV1 L;  1UEB A;  3H15 A;  2PMZ E;  1X65 A;  1TWH H;  1GD7 A;  1OXS C;  1X6O A;  4MTN A;  5IP9 H;  1PH6 A;  4P75 A;  4POG A;  3S15 H;  3HKS A;  1KRT A;  1BVS A;  2A8V A;  2K75 A;  5M3M H;  4GKJ L;  2UXD Q;  3L7Z C;  3CXC A;  4A3F G;  1IBL L;  3S17 H;  4A76 A;  2UXC Q;  3Q8D A;  5C0X J;  4LUZ A;  2ZJQ A;  2A19 A;  4X65 Q;  4A3K G;  1S72 A;  2LXJ A;  1KRS A;  3I2Z A;  1VQE A;  4JI3 Q;  1HNX L;  3J81 j;  1PH4 A;  3FHW A;  1VQJ A;  3FKI H;  2YV5 A;  5DLQ E;  5JEA J;  4LFA Q;  2KCM A;  3DM3 A;  2B63 G;  3CW2 C;  4BXX G;  1X55 A;  1RL2 A;  3PUW A;  1K0R A;  1HR0 L;  3CD6 A;  4LNQ A;  3GTL H;  3SGI A;  3DLL A;  1FL0 A;  4JI5 L;  3TRZ A;  1L1O B;  2JA5 G;  3K7A H;  3H3V I;  1TWG H;  3PO3 G;  4LUO A;  1Y1V G;  3UDX A;  4APV A;  2K52 A;  3K80 C;  1IL2 A;  2AWN A;  4OX9 L;  3GTQ H;  2Q2H A;  2OCE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...