2ZM6L

Crystal structure of the thermus thermophilus 30s ribosomal subunit
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the Thermus thermophilus 30S ribosomal subunit
rcsb
molecule tags Ribosome
molecule keywords 16S ribosomal RNA
total genus 10
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2008-04-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2zm6L00
2JEBI 2UXBL 2E2JH 2GN5A 1L0WA 4A3EG 4HJ5A 4X62Q 1IBKL 2UU9L 4X66L 1YHAA 2VQFL 5IP7G 1HZBA 1W2BA 3PUYA 2NZHA 4JYAQ 5GAEC 1U5KA 3HFZB 4NXNL 4JC0A 3A5ZB 3S1MH 3UE1A 4B3TL 4Y52H 2UXCQ 2KCTA 4DV1Q 1XMOL 3GTOH 4DAYB 2B63H 4DV1L 3OTOQ 1Q12A 2HQLA 4OONA 4LFAQ 3J80c 3CMEA 1K8GA 1VQ7A 4LF4Q 4LF9Q 2JA7H 1GKHA 2R7DA 2XGTA 4K0KQ 2NVQH 1Q46A 2Q2HA 1OXTA 3GO5A 2VUMG 4GKKQ 4R4QA 3CMAA 2CFMA 4LFCL 1J5EQ 2UUBQ 3S1QH 2JA9A 5C44H 2PI2E 3WWVA 3KF8B 1IXRA 2A1AA 3A0JA 3W1BA 3ULJA 2F4VL 4BBRH 3DLLA 1IBLL 1UE6A 3JAMi 2VW9A 4YWMA 4DK3C 3RN5A 4A76A 1E24A 2CCZA 3CC4A 1VQHA 2Z6KC 3K81C 2NN6I 5IT9c 1XTDA 2N8NA 4OX9Q 2UUCQ 5C0XI 1Y1WG 4FDBA 1C0AA 2LXJA 4JI1Q 3HOXH 5LMNQ 2R6GA 4GS3A 1PH6A 4IFDG 4L5SA 3ZJYC 2N49A 2OTLA 1XNQL 3RN2A 2KENA 5GAHC 5M3FG 3S24A 4POGA 1X3EA 5FLMG 4BY7H 4EX5A 2Y0SG 5IP9H 4JI3Q 2H5XA 2PQAA 4HJ7A 4UY8C 4YY3L 2DUDA 4DR6Q 2R93G 2ZTCA 4JI8L 4DPGA 1A0IA 2HIVA 4B3SL 3I4MH 5C3EG 3PIOA 4JI7L 3M4PA 2Q2UA 2ZJPA 1NTGA 5GROA 1VQ6A 1Q7YC 1N34Q 1EWIA 1P16A 1SR3A 4UPAA 4DR7L 1E7ZA 2MO0A 5JEAG 4BXXH 2K52A 4DK6C 3NENA 2MFIA 2MQHA 2IT1A 4X65L 4DV5Q 4DV7L 3HOZH 4GNXC 4LF7L 1XNRL 1NMFA 2ASBA 4BY1G 2IY5B 4LF8L 4DV2Q 3OW2A 2OTJA 1L1OC 2KHIA 4GLVB 4GN5A 4JI5Q 1V9PA 4JBWA 1BBWA 2OCEA 4A3DG 1YNXA 3K7UC 3J81j 5M3MH 2VY3A 4YHHL 2OQ0A 4NB3A 4OXPA 1EYGA 4DR4Q 5BR8L 2K75A 2A19A 3CCVA 1MJEA 2N78A 1VQLA 2UUAQ 3H0GG 4HJ8A 4O2DA 4A75A 1PH9A 1XPRA 3I4MG 3HKZG 2WAQE 1EIFA 3LGJA 3J7ZC 1VQOA 3M4OH 4JV5L 4JG2A 4POFA 1K73C 3TRZA 4LF6Q 2Q2TA 2AKWB 2EIFA 2PMZE 3S14H 2VZAA 1OXXK 4BBSG 4WJ3M 1KL9A 2BA0A 2XTIA 1LUZA 1O7IA 2JJQA 3PUWA 3U4VA 2HHHL 1YITA 1FL0A 1X65A 3E0EA 1NJIC 3I55A 5GAGC 1NMGA 3CF5A 3L0OA 2NVXH 3CQZH 4PZ8A 1IYJB 1HNZQ 4YCVA 3RR5A 2I5MX 2D0PA 2ZJRA 1SRUA 5DLQE 5FLXc 4DV2L 1OXSC 4QIWE 3D31A 3S15H 3CPWA 3CCEA 3PUXA 4DR3L 4A3FH 1B8AA 1I94L 3CP0A 2VNUD 4LUOA 4DR3Q 4AQYQ 1I94Q 4P73A 1YHQA 1M1KC 1OTCA 3Q8DA 4DR7Q 4DUZQ 2JA7G 1HNXQ 5ELOA 1PH2A 2Q2IA 2HHHQ 1S3OA 1NBWA 2YTXA 3CAMA 4OWXB 5AJ3Q 4IOCA 3PO3H 4AQYL 2K5HA 4GLAC 1PH3A 1K8AC 1AH9A 2KBNA 1Q1EA 4X65Q 4YCUA 4LF6L 1PVOA 3W1GA 4IPDA 1YJNA 1A62A 3TQYA 4NXML 2JQOA 3MXNB 2JA6H 4LFBQ 4MZ9A 2VQEQ 3RZOH 1KIXA 3GDEA 2LXKA 5FJ8H 1SMXA 2E5LQ 4JI7Q 4P71A 3OTOL 1QUQA 4DR1L 4GOPA 3H3VI 3AFPA 4HIMA 4A3KG 1N36L 2FXQA 4JI8Q 1PH5A 3HOVH 3CCSA 1HNXL 1X6OA 3KDFA 1E22A 5HY6A 4IOAA 1PA6A 4BA2I 1VQEA 1UE1A 4DV6L 3UE0A 2MNAA 2AMCB 2DGYA 2WFWA 5J3BA 4DV5L 4DV7Q 1VQPA 1KC8C 2BA1A 4YHHQ 3EN2A 4A3BG 2OQKA 2LSSA 5LMUL 1YHBA 4PMWA 5IWAL 3STBD 4DKAC 2YYZA 3B6YA 3A5UA 1UEBA 3S1RH 2KHJA 2R7FA 2JA5G 1QVCA 3H0GH 3KF6B 2B29A 1A8VA 2KCMA 4ALPA 3ULPA 1KQSA 4NPSA 1G6PA 2NVYH 4L5TA 4A3IG 3HKSA 2F4VQ 4H02A 2JA8H 1T9HA 1LTLA 1MKHA 4RMFA 1CKNB 5FJ8G 2YTYA 4DV0Q 2QEXA 1VQBA 2VQEL 2ID0A 1XJVA 2E2HH 1HH2P 4JI3L 2UUBL 2MO1A 2BH8A 3PUZA 1UE5A 4YWKA 3U4ZA 4A4IA 4BBRG 1Q81C 5C3EH 1EQQA 4R4IA 4LWCA 1Y1VG 3GTKH 5C4XG 4DR4L 1YJWA 2UXBQ 3M4QA 2ZM6Q 1KAWA 3S17H 3H15A 2Z0SA 1E3PA 4GNXB 4BXXG 2ZTDA 1EFWA 4A3MH 4GN3B 4B3RL 4DNIA 2B3GA 2WP8J 4A3BH 2NZOA 4JYAL 4GOPC 3DM3A 4A3CH 4ME3A 3ERSX 1FGUA 1W3SA 2IX0A 1L1OA 1X54A 4P74A 5IYCH 1ASYA 4R1JA 5IP9G 1B70B 3KJPA 1B7YB 1RL2A 2RHSB 3M3YH 1K83H 3E9HA 4A3GG 3M85A 3HOUG 1D8LA 1QVGA 3PO2H 1YVCA 5M3FH 1QZGA 1WI5A 2JEAI 3M7NA 1TWGH 4A3KH 3HOVG 3S16H 4OWWB 3CCLA 1OXUA 3G6EA 3F2DA 3GTJH 2EQSA 4UP7A 3AQQA 2GVBA 1VQMA 3HOWH 2E5LL 4GN4B 1UE7A 1PH1A 1VCIA 3JAMc 4YY3Q 3L7ZC 2GVAA 3RLOA 2K5VA 1RIPA 4AIMA 4GLXA 5H1SE 4WJ4A 4RG1A 5EAYA 1PV4A 1HNZL 4JI0L 1VQAA 1VQNA 4B3RQ 4QGUA 1M90C 1N33L 4K0KL 2HIXA 1OXVA 4DV0L 1PH8A 4A3MG 4KHPQ 1HZCA 1X3FA 3J80i 5IYBG 4X62L 4L5QA 5BR8Q 3UDXA 2K4KA 4DR1Q 1I50H 1BKBA 2YV5A 4A3CG 4LUZA 2CQOA 3VDYA 4DUZL 3RNUA 1QVFA 1S40A 2ZTEA 1JJGA 4R4CA 3L2PA 4LF8Q 4BA1I 1PFSA 1DGSA 3W5OA 3F1ZA 4DV4Q 1JMCA 4IPHA 4DV6Q 3CC2A 4A3DH 4GOPB 2A8VA 4Y7NH 1X55A 5IYDH 4PZ6A 1Y1WH 2CKZB 1HZ9A 3KDFB 3BZKA 3GTLH 3CCUA 5IWAQ 3U58A 1K3RA 3CXCA 1IBLQ 4JCVE 2WAQG 4A3LG 3M9BA 2R92G 3A74A 3FP9A 3CCJA 2F52A 3TEHB 4BBSH 1N33Q 3D0FA 3NBHB 3GTGH 1PYSB 3GD7A 1TWHH 2D0OA 1Q82C 2RCNA 4APVA 1UWVA 1VQDA 1N9WA 2PQAB 2K50A 3CCRA 4HIDA 3KF6A 2UUAL 4IFDJ 4OO1I 5JJIA 4QL5A 4LF9L 2JE6I 1JB7A 5M5YH 1KXLA 3G71A 1VQIA 4B3SQ 4JI4L 3EBEA 4TVAB 3CCQA 1QZHA 2HT1A 2ALYB 4C3HH 3TS0A 2K14A 1NY4A 3G48A 4C3JH 4JOIA 4XIGS 1Z47A 4JBJA 3TREA 4AH6A 4BY1H 3ICEA 1WCMG 1TWCH 3GTPH 1IBKQ 2UU9Q 3TS2A 1MIUA 1LYLA 4LUVA 1XMQQ 3HOYH 2I0QA 3PIPA 1V43A 1U0LA 3NELA 5E7NA 4X6AH 2ATWA 1CKMA 4LF5Q 3PO3G 5M5XH 4UP9A 4JI5L 1HZAA 4X64Q 1IBMQ 5IE8A 2VL6A 4J15A 1YIJA 1FVIA 5JEAJ 4AYBG 3BU2A 2NN6G 4EQ5A 1N36Q 3JC66 5JJLA 1XNRQ 1K0RA 4BY7G 4P75A 1NE3A 4JBMA 2N3SA 3I2ZA 4IO9A 2F3IA 3S2DH 1D7QA 3F2CA 4LFCQ 2CWPA 3CD6A 3IRBA 1P8LA 3KOJA 4A3FG 4OWTB 2OWOA 3FHWA 1FJGQ 3PCOB 1SLJA 1N32L 5IP7H 1HNWQ 5FLMH 4X66Q 3PF5A 1KD1C 1N8RC 1PH4A 2IHFA 4YCWA 4O0AA 1CUKA 1A63A 4B3ML 3HKZE 3PO2G 4B3TQ 3AYHB 1AE3A 1BBUA 4QJFA 1EIYB 5IYCG 3FKIG 4JV5Q 2QGQA 3SGIA 2R7ZH 1VQ4A 4A3GH 4DR2Q 2I5LX 3PV0A 1LM0A 4PG3A 1XPOA 3HOUH 1TWFH 1Z9FA 3K0XA 1N34L 4UP8A 5C44G 1I3QH 1HR0L 4JI1L 2E2IH 1Q1BA 2UXDL 2IHEA 4JOIC 5M3MG 1G291 4GKKL 2R92H 3CW2C 3UDIA 5C4XH 3PSIA 4XTCS 4IJLA 4QY7A 4C3IH 3GTQH 1SROA 1C9OA 5M5WH 4DR5Q 2ZJQA 4HJ9A 4B3MQ 1XMOQ 3PF4A 4GKJQ 1CKOA 2RF4A 3FKIH 4OO1G 1X9NA 1H95A 2QA4A 1Y1VH 4QQBX 1IBML 2WB1E 1N32Q 4YWLA 3KFUA 1SE8A 1MJCA 4NXMQ 4LFBL 4PZ7A 3NEMA 3HOYG 5IY0A 5IYDG 1WYDA 5K36G 4HIKA 3I56A 1TXYA 1VS0A 1VQCA 1VQGA 3I7FA 1HR0Q 3I4NG 3T1HL 3I4OA 3GTMH 1VQ9A 2Y0SE 4GKJL 3F8TA 5AJ3L 3MEFA 1QUQB 1TWAH 1VQJA 2WB1G 2EXDA 3K7AH 5LMNL 3OYYA 2V1CC 2BH2A 3RLNA 1SN8A 4JI2L 1JT8A 4NXNQ 4JBKA 1X3GA 4A3IH 4JI2Q 2AWNA 1SFOH 5LMNW 3BJUA 3J81c 2UXDQ 1KRSA 4KHZA 3PGZA 4DV3L 2JA5H 1Q8KA 2C35B 1G51A 5C0XG 4DV3Q 3T1YL 4C2MH 3U50C 1HNWL 1KHIA 1WFQA 5ELNA 3I4NH 2I5HA 1I6HH 5IYBH 3ER0A 2D62A 4JI6L 1GD7A 1GO3E 2AHOB 4L5RC 1WJJA 1K9MC 1PHJA 4LFAL 2ZM6L 1X56A 3S1NH 1PH7A 4LW1A 1YBYA 2PNHA 1XPUA 2UXCL 2AWOA 1YZ6A 1CKNA 4A93G 2CWAA 1ASZA 3AEVA 4DUYL 1EUJA 5HGQA 4DAMA 4DUYQ 1HR0W 3F2BA 3EIVA 3BZCA 3J81i 2VQFQ 4AYBE 1C7YA 1HJPA 3T1YQ 2JA6G 4LNQA 3KLWA 3KYHC 4IJHA 4LF4L 2YTVA 1YI2A 1VQ8A 2VUMH 4IPCA 3H3VH 3UDFA 4HJAA 4DR5L 2L15A 4HIOA 2UUCL 3ULLA 2R93H 4GNXA 4X64L 4OX9L 2B63G 4JI6Q 2PI2A 1V1QA 3UDGA 2IX1A 4LF5L 3KJOA 4A3LH 4A93H 2ES2A 1E1TA 2K5NA 4R4OA 1JE5A 2E8GA 2VS1A 4LF7Q 1IL2A 3CCMA 1L1OB 1VQFA 3CPFA 4IPGA 4DV4L 1PYBA 4KHPL 4DR2L 5GADC 3HOXG 1J5EL 1GM5A 4R4TA 1FJGL 2NVTH 1JJ2A 4KI0A 4JI0Q 1JJCB 4A3EH 3J7A5 5JJKA 3K8AA 1J6QA 2JA8G 3HOWG 3PUVA 1YJ9A 1VQ5A 4MTNA 3E9IA 5GQOA 4A3JH 1AE2A 1I5FA 5C4JH 1L2FA 1IZ6A 2JK8A 3CC7A 2YU9H 1E1OA 1GVPA 1R9TH 1S72A 1Q86C 3T1HQ 4DR6L 5C0XJ 3STBC 1EOVA 3RLFA 3K80C 4KLKA 4IFDI 1CSQA 4MNOA 1CSPA 2R7ZG 2Z6KA 3RZDH 1BVSA 3S2HH 4P72A 1XMQL 1XNQQ 4TQUS 1WOCA 2RHQB 1YEZA 1Y14B 1VQKA 1WCMH 3G4SA 1KRTA 4A3JG 3HOZG 1EQRA 4JI4Q 3AFQA 5LMUQ
chains in the Genus database with same CATH superfamily
2E2JH 2GN5A 1L0WA 4A3EG 5ELFA 1GUWA 4XQNA 3TN2A 1HZBA 5IP7G 4RFBA 1SAPA 3VR2A 2WV6D 1U5KA 1S5DD 3P75A 4L6TB 1F9QA 4DV1Q 1EY8A 2OEOA 3EVQA 5I9PA 4DAYB 2B63H 3J80c 4OONA 4LFAQ 3CMEA 2R92B 5ELDA 3NTHA 2XGTA 4HCEA 2R93B 3GO5A 1OXTA 1J8IA 3CMAA 2UUBQ 5I9OA 2NYZD 5C44H 3MXGA 1GHKA 3X3NA 3NPPA 1LT6D 3P20A 1PRTC 4HTHA 1SE3A 2Z6KC 2F0KA 5IT9c 1XTDA 1PFBA 2N8NA 4OX9Q 2CW0C 2NVXB 2QDBA 2LXJA 5C4JB 3HOXH 1PH6A 2R6GA 5D3DA 5EPKA 5C3XA 2OTLA 1G91A 5GAHC 5M3FG 3S24A 5LHY1 1SFOB 4POGA 5FLMG 3S14B 4BY7H 4XT3B 5IP9H 2B8FA 3SHLA 4A3MB 2AQ1B 2ZTCA 4G4KA 3VYSA 4DNTB 3N6RA 3T51B 3PIOA 3S1MB 3D4WA 5GROA 5CBEE 5JOBA 1VQ6A 2PCFB 1P16A 1UUPA 3OIQA 1I3QB 3NENA 2MQHA 3NWTA 4MHEA 2E2JB 4X65L 4DV5Q 2FFKB 2XIWA 4LF7L 3PIO3 1XNRL 2ASBA 1GUOA 1HXYD 2RDGA 1V9PA 4IURA 2OCEA 1YNXA 5FO9B 3J81j 3NBIA 4DR4Q 2A6HC 2EYLA 3CCVA 1HPCA 5CC4A 4I7AA 1PH9A 1XPRA 2J0TD 1BO0A 1EIFA 2O5IC 1K73C 4XQQA 3J80E 1SYGA 1C4QA 2F0PA 2AKWB 4E6IA 4DAVA 4LF6Q 4WJ3M 5FO8B 3S17B 1LUZA 3IFDA 2HHHL 3OMGA 1FL0A 1NJIC 4FXGC 3CQZH 1LTTD 1PZID 3FEWX 2ZJRA 1SRUA 5FLXc 3C3LA 3RD4A 4DR3L 3ERQA 4DR3Q 3C2PA 4KKTA 5CV4A 1A3TA 3MXUA 1HNXQ 1DXMA 3I4MB 2HHHQ 2QKIC 1NBWA 3CAMA 4A3FB 4AQYL 5C3EB 2K5HA 4GLAC 2F0TA 4X65Q 1Q1EA 1SYFA 1UEAB 1YNJC 3LWEA 3PMFA 1FNWA 3RZOH 1TS3A 2LS01 1SMXA 3OWEB 3OTOL 3LNNA 4GOPA 1U4LA 4HIMA 2KEEA 5K5PA 2DY7A 4RH6A 5HY6A 3CKIB 1PXUA 4BA2I 5I4DA 1K8OA 2ZJQA 4DV5L 5CV7A 5J3BA 1VQPA 4A3BG 3BDOA 3O13A 4KJOA 1BBXC 3STBD 1PYWD 2B2YC 3B6YA 2KHJA 3KF6B 3DUZA 4O42A 3BS1A 4ALPA 3QJYA 1DOKA 1G6PA 2NVYH 4L5TA 4F87A 3HKSA 4A3IG 4XYOA 1LT3D 2FMMA 3BYYB 1LTLA 1MKHA 1C8CA 1MSHA 2B39A 1C48A 2UUBL 3WOFA 2BH8A 1EY6A 1UE5A 5CGKA 3CQZB 4BBRG 1SBBB 1S5BD 5C3EH 1H9JA 3FKIB 4K5WA 3IFTA 1YJWA 5JPNC 2Z1CA 3CHBD 1TWHB 4XDXA 1EFWA 2B3GA 2E2IB 3I72A 4U68A 1TU2B 3NP8A 2QW7A 3DXJC 5M5YB 4IUTA 1FGUA 1W3SA 1SJHD 1X54A 5IYCH 5IP9G 1GJXA 1HHVA 1K83H 3M85A 3U9SA 1BNZA 1EEID 3DWQA 3S16H 1TWGH 3HOVG 4KN7C 5D65A 2E5LL 4GN4B 2B2TC 3L7ZC 1XTCD 4AIMA 3G7LA 4WJ4A 4B3RQ 4KD4A 1XYIA 4QGUA 1M90C 4K0KL 4DV0L 3CRKC 4X62L 2L1BA 3J7AF 3UDXA 1BKBA 1ILQA 4LUZA 2CQOA 3Q23A 3RNUA 1QVFA 1EZ6A 2DY8A 2IL8A 4BA1I 2F1MA 1PFSA 1DGSA 5CV8A 4DV4Q 3T53B 1MBYA 4GOPB 1BCPC 1SDFA 4G7OC 4CBVA 1B9MA 2I07B 3VR3A 1WD0A 3EA6A 1EL0A 5IWAQ 3WDNA 3BZDB 1IBLQ 4KKSA 4A3LG 3FP9A 3RZDB 3GQBA 1K28A 1VQDA 1N9WA 3CCRA 2K50A 4IFDJ 1DM0B 3KF6A 1V1PB 3KF8A 2UUAL 4OO1I 4QL5A 4RAUC 1SE4A 4FP5D 1VQIA 2A6HD 3QOJA 3Q0AA 4JI4L 2HT1A 4A3GB 3HS0C 1VMPA 5A2QL 2H1EA 3AU7A 1SSOA 4C3JH 2HCIA 4XIGS 3ICEA 2B8GA 1B9NA 3S15B 1EQVA 2I0QA 2WB1B 1KNAA 3NELA 1RF2D 3N52A 2A73B 2ATWA 4LF5Q 1A2TA 1F9PA 4X64Q 1HA5A 2VL6A 5C0XH 1YIJA 3A56A 4OELB 1FVIA 4AYBG 3BU2A 1Y1VB 2EJMA 2EY2A 2KEDA 4BY7G 3A55A 4P75A 2F0EA 2EYPA 2N3SA 3GTQB 3S2DH 4I65A 3A8JE 3KOJA 4B08A 4A3FG 1FJGQ 5IP7H 1PH4A 2IHFA 2G9HD 1LLRD 3HEJA 4C3JG 5IIFA 1TWFB 1PMRA 2HQEA 1YNNC 4B3TQ 2AQ3B 2EY1A 3AYHB 1EIYB 3FKIG 3KLRA 3HOVB 1STAA 3V2TA 4R8IA 3K5MA 1BXTA 2R7ZH 1VQ4A 3EFXD 4PG3A 4WFN3 2FJ2A 3HOUH 1TWFH 1Z9FA 1EY5A 3E3XA 1HR0L 4JI1L 4JOIC 5M3MG 3AB9A 2K04A 5C4XH 3MFYA 3PSIA 4QY7A 4C3IH 5M5WH 4K5XA 4HJ9A 3Q24A 3NQTA 3GTKB 1EWHA 5M5XB 1JOQA 5JAVA 5KNDA 2WB1E 5EKLA 1G2SA 3MXNA 5IYDG 1SYEA 1WYDA 2K5QA 3I90A 1VQCA 1VQGA 3I4NG 3T1HL 1RTOA 3MEFA 1QUQB 2EXDA 5E1FA 3OYYA 2BH2A 1JT8A 4JBKA 1TWGB 4X3SA 3A54A 3BJUA 3DWPA 2UXDQ 1G6ZA 3VYTA 1CHQD 5FOBB 1Q8KA 4KTAA 2C35B 4S3SA 1G51A 4HMJA 2SEBD 5FLXE 1DZ1A 4L8JA 2R7ZB 3HGBA 4JI6L 3I70A 2AHOB 1PTOF 1K9MC 1PHJA 4LFAL 2ZM6L 1B3AA 3M3YB 3S1NH 5EBDA 4A3KB 2LY7A 1XPUA 2UXCL 4XT1B 4TRDA 2AWOA 3GTLB 4A93G 2CWAA 1BCPD 3AEVA 2F0HA 5HGQA 4N8X1 2A74C 4LMQD 1KABA 2M2LA 2Y0SB 3BZCA 5IODA 1C7YA 1PTOH 3T1YQ 5CORA 5E3FA 2JA7B 4ULLA 2VUMH 4A3DB 4HJAA 4KY6A 2FHTA 2UUCL 3ULLA 5LL6S 3QO2A 4JI6Q 2PI2A 1AFPA 1TWAB 2E74C 2ES2A 2K5NA 4LK1C 2E8GA 2VS1A 4LF7Q 2A6EC 3CCMA 1O78A 4IPGA 2XSCA 4DR2L 1ML0D 2NVTH 1GUGA 1JJCB 3MC0B 5JJKA 1SEBD 1D5MC 4ZKBB 1WTQA 2PMZB 3PUVA 4IUPA 1D5ZC 3E9IA 1I5FA 1L2FA 3C1EA 3CC7A 1GVPA 5C0XJ 4HSPA 1EOVA 3K80C 5FK9C 4EGVA 3T4AC 1LTRD 1WOCA 2EXZA 3I73A 1Y14B 1LACA 2ZT9C 4WORA 4NW2A 1KRTA 4A3JG 3D8GA 3AFQA 4R4CA 4Y52H 2JEBI 2D9UA 2VB3X 4LAAA 1IBKL 1I4XA 3HOZB 4JPBW 3PUYA 1Y69U 3HFZB 4JC0A 4B3TL 4OEMB 3L9AX 3GTOH 1GUTA 1Q12A 2HQLA 4JK1C 2JA7H 1SNCA 4C1NK 1GKHA 2BOSA 4K0KQ 2NVQH 4GKKQ 3BG3A 2CFMA 2JA9A 2PI2E 1K0SA 3WWVA 3HOUB 3VA7A 4DXFA 5F2DA 2F4VL 2IWHA 3JAMi 2VW9A 3RN5A 4QMGA 3PO2B 4A76A 3K81C 4ZK9B 2ZXPA 1PTOC 2UUCQ 5C0XI 1C0AA 4CKCA 2MPMA 4IFDG 3ZJYC 3BDCA 3RN2A 2KENA 3OWFA 4FVMA 3CRLC 3OMCA 2ENBA 4UY8C 2LKVA 4DR6Q 4V0BA 4JI8L 1A0IA 1EY0A 4QUCA 3M4PA 2ZJPA 4G7HC 1Q7YC 1EWIA 2MO0A 2NB0A 2K52A 2MFIA 2F03A 1FGBD 5HGTA 3K57A 4DV7L 4HSVA 3HOZH 5AFWA 2BDNA 3PO3B 1A3UA 2KHIA 1CK1A 4GLVB 4GN5A 1II3A 1RJTA 4QIWB 4A3DG 4O1NA 5M3MH 1A2UA 2VY3A 2OQ0A 4OXPA 2EZVA 4KV6A 2K75A 1E2VA 1CFMA 2F3VA 2HD3A 5IOCA 3VA5A 1VQLA 1I4RA 2UUAQ 3I4MG 3HKZG 4JV5L 3EROA 1QJOA 5CR3A 2VXWA 5JVG3 5ELBA 1WTWA 2Q2TA 3C1FA 3D4DA 1SE2A 1OXXK 1TVXA 4BBSG 2BA0A 1O7IA 2JJQA 1YITA 1X65A 1WTXA 1IYUA 3KBXA 5EQ0A 1Y1WB 1O7ZA 4PZ8A 1IYJB 3J7AV 3S15H 1OXSC 3D31A 3CPWA 1B8AA 4N9TA 4A93B 4LUOA 3TDQA 5I2YA 4P73A 4QB4A 1M1KC 1OTCA 3Q8DA 4F88A 2EJGC 1H9SB 2F0DA 2NTSA 1ET9A 3LWUA 3ONAB 2JA7G 4YIJA 5ELOA 2XWJB 4IUNA 4IUVA 5AJ3Q 4IOCA 1MGSA 2Q8TA 2B2UC 2B2WA 2RQXA 4I7ZC 3M4YA 2A69C 4TSSA 1WTVA 1A62A 4NXML 2K03A 2G9DA 1STBA 3J7YW 4JI7Q 2E2HB 4M8AA 2B2VA 3S1NB 3AFPA 3HOVH 2FXQA 4JI8Q 3TP5A 5G3LF 3NTIA 4RGTA 1JB3A 3ND8A 1PA6A 2A68D 2A68C 3SK5A 1QCBD 4DV6L 4DV7Q 2AMCB 2DGYA 3EJIA 4X3UA 2RDHA 2OQKA 1EFID 4PMWA 5ELCA 5IWAL 1J9OA 2YYZA 3E0JA 3SDZA 4DKAC 4DNRB 3A5UA 1X32A 1QB5D 4C1NI 1KQSA 1W6JA 2F4IA 3KK7A 4NPSA 5A35A 4N8FA 1XWEA 2JA8H 1TR5A 1T9HA 2F0QA 3GTOB 5FJ8G 3VR6A 1Q3LA 2ID0A 3NTKA 4NKLA 2PYKA 2WINB 2QILA 4DN4M 2E76C 2Z9HA 1NUCA 4A4IA 2PZWA 2SNMA 4R4IA 1LTGD 4LWCA 2XNAC 4TKOB 4DR4L 3QOLA 4K14A 5ISRA 3S17H 5HURA 2Z0SA 1ESRA 2NTTA 4DNIA 1H9RA 2WP8J 4B3RL 1S4ZA 4A3BH 2NZOA 4GOPC 1BCPB 1NAPA 1L1OA 4R1JA 1X3PA 3KJPA 1B70B 1BQQT 3M3YH 3E9HA 3HOUG 5M3FH 1WI5A 2JEAI 1OXUA 3F2DA 1B53A 3AQQA 2GVBA 2R61A 3JAMc 4HR7B 2GVAA 4GLXA 5H1SE 4RG1A 5EAYA 1HNZL 2DJGC 1AZPA 4EQOA 2HIXA 5BN4A 5DEHA 4L5QA 5BR8Q 2K4KA 4DAYA 1A3VA 2YV5A 4A3CG 5C5MA 1LV9A 4IFDH 2NN6H 4DK1A 4RWSC 1CI3M 4LF8Q 1Q8IA 4R8NA 3BDLA 1F2MA 2M9VA 4IPHA 4DV6Q 5IT9E 3CC2A 4A3DH 2A8VA 3S16B 1CTMA 1X55A 2XRSD 4F7XA 5IYDH 1Y1WH 1HQMC 5NUCA 1SMYC 1EEFD 1HZ9A 2PQEA 1STEA 3V05A 4PMCA 5EKKA 4JCVE 1JCKB 2R92G 1U9RA 4BBSH 2RSOA 4AYBB 3D0FA 3NBHB 2Z4HA 1N34L 1Q82C 2RCNA 3H6MA 2PQAB 4PV1C 2HUGA 2YU9B 2JE6I 1JB7A 2KJXA 1V1OA 2K33A 2KHSA 3WOEA 4TVAB 4DGZA 1JWMD 3CCQA 1YNND 2ALYB 1NR2A 2KA7A 3TS0A 2K14A 2K5DA 1IBKQ 3D4RA 4LUVA 4H44C 3TP8A 3R2IA 4J15A 1BUVT 3MWYW 1TY2A 5JEAJ 2K32A 4QF4A 3V96A 2RDFA 2EOTA 4RHRA 2DJFC 4JBMA 3QIAA 3I2ZA 4IO9A 1D7QA 4LFCQ 2CWPA 1PTOB 3IRBA 1JORA 3R93A 4OWTB 2OWOA 5I2XA 3M7GA 1SLJA 1N32L 4RGOS 1ENFA 1HNWQ 1HUNA 1N8RC 3PQIA 1LTSD 4FF2A 4K6DA 3PO2G 3UI2A 2JP1A 4KN4C 2TMPA 1LTAD 2QGQA 2L0CA 1I6HB 4A3GH 4DR2Q 1LM0A 4KHVA 1TS4A 5C44G 1I3QH 2LMCB 1CM9A 1D1KA 1LTID 1CA5A 4KJNA 3CW2C 2P5ZX 3GTQH 4DR5Q 3GTMB 3W3AA 4B3MQ 2KOLA 2ZXRA 1CKOA 5EKIA 1X9NA 1S5CD 1ENCA 1Y1VH 4QQBX 1IBML 1MSGA 4YWLA 4HAEA 4NXMQ 3H3VC 4PZ7A 5IY0A 5K36G 3I56A 3HOWB 4FYDA 1EOTA 4ODGA 3GTMH 2Y0SE 1BOSA 5G3LD 4GKJL 1I6VC 1VQJA 3R3OA 2HDLA 4J6HA 2V1CC 4JI2L 4NXNQ 1X3GA 2XWBB 4JI2Q 2AWNA 1L0YB 4A3IH 3J81c 3JAML 1ZYRD 1KRSA 4KHZA 4OGQC 4QUFA 1CHPD 4DV3Q 4ME5A 3T1YL 3U50C 3X3MA 5ELNA 3I4NH 2I5HA 1H9MA 4CDFC 1GO3E 1SNDA 3MEHA 4L5RC 1WJJA 1I4PA 1X56A 5IGFA 3IL8A 2RSNA 1JOKA 3NSWA 1GUSA 3DMUA 1EUJA 1Q90A 1MI2A 5KNCA 1HR0W 3J81i 2VQFQ 4AYBE 2EPBA 1STGA 5A2QE 4LNQA 3KLWA 3MHBA 5E4WC 4IPCA 2L15A 3A8IE 3Q6SA 1RTNA 3L3OC 5L37A 2JXMB 1JE4A 1V1QA 1ENAA 3H0GB 3KJOA 2RKSA 3D3RA 1SYCA 1E1TA 1PTOD 4R4OA 3J81E 1IL2A 4HMIA 4HCSA 1SNMA 3CPFA 5GADC 1D2BA 1J5EL 1JQYD 1EU3A 1STYA 1AEXA 4JI0Q 1D5XC 2MP1A 3K8AA 1J6QA 3K5LA 5BN5A 1YJ9A 4MTNA 2LFNA 3TZUA 5IGDA 1AE2A 4A3JH 5C4JH 3HOXB 2JK8A 2YU9H 1A15A 1R9TH 5M5WB 2MGSA 3BYTB 4KLKA 4IFDI 1M8AA 3TBIB 2WIIB 4MNOA 2L5TA 3RZDH 1BR9A 1WVLA 2L11A 4IZ8A 1LT4D 3S2HH 2QEJC 4P72A 1XNQQ 4A3JB 2EY6A 4C2MB 3H09A 3NUCA 1JWUD 3HOZG 2PW7A 1EQRA 2O4XA 2D5DA 5LMUQ 2UXBL 2NVTB 4X62Q 1HUMA 1M4VA 2UU9L 2WKCA 1S5ED 4X66L 1YHAA 2NZHA 2KQ3A 3UE1A 4CHTB 2UXCQ 2KCTA 1STHA 1OO9B 1K8GA 1YNJD 1U4RA 2FINB 4LF4Q 4LF9Q 3IKJA 4EVOA 2VUMG 4R4QA 1J5EQ 4LFCL 4H13C 1FR3A 3SVMA 3KF8B 1IXRA 3A0JA 1RD9D 1U4MA 1TT2A 3ULJA 1IBLL 1UE6A 4YWMA 1KDAA 1E24A 2R7ZG 3CC4A 2HCCA 2EYMA 4FDBA 4JI1Q 4GS3A 4CGYB 1EYAA 2N49A 1D6EC 1X3EA 4EX5A 2Y0SG 2H5XA 2PQAA 4HJ7A 3FVQA 2DUDA 2Z8LA 4YY3L 2F3WA 4NMZA 3I4LA 2HIVA 4X3KA 3QR8A 3I4MH 2C5CA 5C3EG 1KNEA 2D2CC 2DNEA 1NTGA 1DONA 4XQJA 2WACA 1SR3A 1N34Q 1E7ZA 1SXTA 4DK6C 1PZJD 1EY9A 1F77A 3VR5A 4KKUA 1IYVA 4GNXC 3QG1A 1NMFA 4ZKCB 4BY1G 5KGUA 5JPMC 2IY5B 2DNCA 4DV2Q 3K59A 4JI5Q 4LJZC 4BWGB 3K7UC 3T16A 2A6ED 5D14A 4YHHL 2NBFA 1EYGA 3MA2B 2A19A 2QF7A 4K6LA 2NUCA 1UAPA 1O80A 3TZDA 4A75A 1B3QA 1SNQA 3AMUA 3M4OH 2WAQE 4RCOA 3J7ZC 4POFA 3TRZA 2DN8A 2M00A 3F2UA 2PMZE 2VZAA 4RKLA 2H4OA 1EU4A 1KL9A 1TQOA 3NK9A 3FMCA 3PUWA 2CVRA 3E0EA 1EY4A 3I55A 5GAGC 1NMGA 3CF5A 2NVXH 3OW7A 1SYDA 1HNZQ 1IKMA 3RR5A 2I5MX 3HOYB 5DLQE 4QIWE 1Y8OB 4FXDA 3PUXA 4A3FH 3CP0A 1HCZA 2SNSA 5M3MB 4DR7Q 4IN3A 2PW5A 5J39A 2L4NA 2KUMA 3QB3A 2Q2IA 3ND9A 1S3OA 2YTXA 3PO3H 4R9WA 1PH3A 1AH9A 2KBNA 2R3ZA 4YCUA 4LF6L 4IPDA 2OXPA 5J22A 3TP7A 2JA6H 4LFBQ 2JQOA 2VQEQ 2EYJA 1AP0A 4ZUIA 4DR1L 3H3VI 3Q22A 4A3KG 1PH5A 2A69D 3OPOA 3RMHA 1E22A 4G57A 3DHQA 2GA4B 1Z7TA 1UE1A 3OIPA 1KC8C 1CT1D 5J1ZA 2MHVA 2EYOA 1JOOA 3EN2A 1O7YA 2LSSA 1HRJA 1EWCA 2JA5G 3H0GH 1A8VA 3ULPA 1WTPA 2E2DC 3DEOA 1AZQA 4DV0Q 3VR4A 2E2HH 5FLXL 2QEXA 2VQEL 1GUNA 4YWKA 4MN3A 3U4ZA 1EQQA 1F2LA 1JWSD 2XN9C 2NVYB 2F0WA 3GTKH 4C3IB 5C4XG 3M4QA 5JEAH 5C6AA 3H15A 4GNXB 1E3PA 2ZTDA 1B44D 4K8IA 4A3MH 4KD3A 4A3CH 1X3QA 4ME3A 4CDCC 4P74A 3P7JA 5M9OA 2L12A 1CZWA 4IUQA 1B7YB 5DNFA 1MD2D 1QVGA 5DAUA 3PO2H 3M7NA 4FO2A 4OWWB 1HTLD 2BE5C 3MAQA 3CCLA 1DCZA 4UP7A 1VQMA 1UE7A 1RIPA 1K83B 1VQAA 2IW3A 1N33L 5KRUA 1OXVA 1X3FA 1IL8A 3TMEA 4CDEC 3OOCA 4WJWA 5T1IA 3HKZB 4DR1Q 2OT2A 4A3BB 1PFMA 3I91A 3J81L 1PDQA 2IX3A 3K58A 2PPBC 2SDFA 4DUZL 4ZRZA 4KK7A 1S40A 2EY5A 2ZTEA 1DD2A 1F9RA 4CDDC 3F1ZA 2F0JA 2K1BA 1JMCA 4CJ1B 2F0NA 4UAIA 4PZ6A 1R4QB 4CKEA 2CKZB 3GTLH 3CCUA 1K3BC 1VF7A 3U58A 1K3RA 4C3HG 3CXCA 3DM1A 4DK0A 1PRTD 2F0IA 1Y8NB 2EYFA 4RCNA 3CCJA 1ICWA 4DXGA 4G7ZC 5DM73 1N33Q 3MTSA 1PYSB 1TWHH 2D0OA 3GD7A 5C5LA 4ZQ3A 1UWVA 4HIDA 1TIID 5JJIA 1KXLA 4LF9L 1KLUD 3VYUA 5M5YH 3MFGA 4B3SQ 4ZUJA 2EDGA 1PZKD 5KIXA 4C3HH 1EIGA 1NY4A 4Y7NB 1AN8A 1F2ZA 1Z47A 4JBJA 3TREA 4AH6A 1WCMG 1TWCH 2C9OA 1EYDA 2UU9Q 3K7AB 3TS2A 1LYLA 2B2YA 1Y8PB 1XMQQ 4IQZA 3PIPA 5E7NA 5C4HA 4X6AH 1CKMA 1WCMB 5M5XH 4UP9A 4JI5L 1HZAA 4B9XA 3GV3A 2PZTA 5IE8A 4EQ5A 1RKNA 1N36Q 4L63B 5JJLA 1XNRQ 1B50A 3FDTA 1NE3A 3F2CA 3M4OB 4GZYC 4FF4A 5FLMH 4X66Q 3PF5A 1KD1C 3G6JB 1EQTA 4YCWA 4B3ML 2F0OA 3SR1A 1ZXTA 3ITPA 5IYCG 5C4XB 4JV5Q 5C4ZA 2X69A 3SGIA 1ESFA 2I5LX 3PV0A 2IJ0A 3KLSX 1XPOA 1LO5D 3K0XA 4UP8A 2E2IH 1Q1BA 2UXDL 4FXKC 5IGBA 1H9SA 2NZ1D 2SOBA 4GKKL 2F0VA 4XTCS 4IJLA 3NE5B 2B2TA 3PF4A 1XMOQ 1IW7D 4OO1G 2RF4A 3FKIH 1N32Q 3KFUA 1G2TA 1SE8A 1MJCA 4LFBL 2EJFC 3NEMA 1RDPD 1VS0A 3I7FA 2XRQD 1RODA 4NDXA 4K2LA 1A6XA 1Z6HA 2WB1G 1BCPF 3K7AH 2RVLA 3A8KE 2X6LA 3RLNA 1CZGA 4XXEA 5M3FB 1FYCA 1O7LA 3PGZA 1V1PA 2ICEC 4DV3L 5TSSA 5C0XG 2RA4A 1HNWL 4V190 1WFQA 4RGNA 1SMYD 3ER0A 3T13A 1HFNA 1GD7A 1L0XB 3I3CA 1PH7A 2E75C 2PNHA 2ICIA 1E2WA 1CKNA 1ASZA 4DUYL 4WRDA 1GXDC 4DAMA 4DUYQ 3F2BA 3EIVA 1HJPA 2JA6G 3KYHC 4IJHA 4DR5L 3MZ5A 2PO4A 2NVQB 4X64L 2B63G 3KUPA 4H7BA 5JVH3 1W6KA 3UDGA 4LF5L 2IX1A 4A3LH 4A93H 3IAYA 1L1OB 4RHSA 1PYBA 3PIP3 1ONLA 5K36H 3HOXG 1GM5A 1FJGL 4KI0A 2BDOA 5EPLA 4A3EH 3J7A5 1NR4A 1CQVA 2JSOA 5ELEA 1VQ5A 3BVGA 5KYLA 1E1OA 5KEEA 1T5XD 1S72A 4KMUC 3T1HQ 2WAQB 1FNUA 5I6WA 3RLFA 3H94A 1CA6A 2Z6KA 1BVSA 1HQRD 3GTGB 1XMQL 2J7ZA 4UHVA 4Z9CB 1BDOA 5CV9A 4F8MA 1VQKA 2QDLA 3GV6A 1IHZA 4JI4Q 4HJ5A 1D1IA 4M1UB 2VQFL 5E4XA 1W2BA 4C3IG 3NXWA 4JYAQ 5GAEC 3W2DA 4NXNL 3A5ZB 3S1MH 1EIHA 3A7AB 4OO1H 1DJRD 3DWAA 2VUMB 1FD7D 1XMOL 1I50B 1SNPA 3OTOQ 4DV1L 1VQ7A 5EBCA 2B2VC 2R7DA 4DFAA 5EGTA 4FNFA 1Q46A 2Q2HA 4ZAIA 3S1QH 2Z4IA 3OHXC 2A1AA 1FNVA 4N9PA 4H0LC 3W1BA 4BBRH 3DLLA 1MHWC 4DK3C 4A3EB 2CCZA 1WTRA 1VQHA 1NCVA 2NN6I 3OSOA 1Y1WG 5LMNQ 4L5SA 2IPKD 4BBRB 1XNQL 4EQNA 4UDUC 4OL7A 4ZLTF 1V8QA 4JI3Q 1XX8A 5FKAC 2R93G 4DPGA 2F0FA 4B3SL 5I6YA 4JI7L 2Q2UA 2NWGA 5KYIA 1XXGA 1PLFA 4UPAA 5EPJA 5D3IB 4DR7L 5JEAG 4BXXH 1CQFA 4P2CB 2IT1A 4JW0A 4EQPA 1RHPA 2EVBA 1IW7C 4LF8L 3OW2A 1L1OC 1LABA 2HDMA 2CW0D 4JBWA 1BBWA 1PRTB 2G5DA 5IGEA 3URYA 4BY7B 1I4HA 4NB3A 4RKBA 5BR8L 1B1ZA 1MJEA 2N78A 1HFGA 3H0GG 4HJ8A 4O2DA 5CMDA 3LGJA 1VQOA 1I4QA 4JG2A 4PQXA 1S5FD 4B9WA 2EIFA 3S14H 3SK6A 1E2ZA 1EYCA 2XTIA 5JJZA 3D6CA 3U4VA 5LL6X 2N88A 3RZOB 2F0UA 1KLGD 3L0OA 1ILPA 1B2TA 3KLSA 4YCVA 4DV2L 2D0PA 2V4DA 2F0LA 3CCEA 1I94L 3E6ZX 2VNUD 2K6AA 5C44B 1I94Q 4AQYQ 1YHQA 1SYBA 4X3TA 4DUZQ 2Z6BA 1PH2A 3K5OA 4OWXB 2X6GA 1KDCA 1K8AC 1TY0A 3GP7A 1ZEQX 1PVOA 3W1GA 4DAPA 1YJNA 3TQYA 3MXNB 4MZ9A 3VYRA 1KIXA 3GDEA 2LXKA 5FJ8H 2E5LQ 4P71A 1QOHA 1QUQA 2MJ8A 4BY1B 1N36L 1QWYA 1AW7A 3KBGA 3CCSA 1HNXL 1X6OA 5T1GA 3KDFA 2JN4A 3J80L 4OIKA 4IOAA 4CKBA 2TSSA 1LTBD 2AQ2B 5BN3A 1VQEA 2JA5B 3UE0A 2MNAA 2WFWA 2N55A 2BA1A 1F9SA 4YHHQ 4BS9A 5LMUL 1YHBA 3NBHA 4ID6A 2J4XA 1UEBA 3S1RH 2R7FA 1QVCA 2B29A 2KCMA 2F4VQ 4H02A 1R4PB 2A5HA 4RMFA 1CKNB 1G8ZD 2WKDA 1I4GA 2YTYA 1VQBA 1XJVA 4BXXG 1HH2P 4JI3L 1U4PA 2MO1A 3PUZA 4XYQA 2CHBD 3FPUB 4CJ0B 1Q81C 2K28A 4RA8A 1TS5A 1Y1VG 3NWSA 1IKLA 2UXBQ 4K8JA 2O2LD 1KAWA 2ZM6Q 2K05A 4GN3B 1DOLA 2CQAA 2KVMA 4JYAL 1EZ8A 3DM3A 3FRPB 2IX0A 3ERSX 3GTJB 5COYA 4DA2A 1ASYA 4A3IB 1RL2A 2RHSB 3BVMA 3K5NA 4A3GG 1D8LA 1F2YA 1JC7A 4DU9A 1YVCA 3S9WA 1QZGA 1GHJA 4A3KH 1B4OA 3G6EA 1KAAA 3GTJH 3P1HA 2EQSA 1R9TB 3HOWH 1PH1A 4RGMA 1VCIA 3S1QB 4YY3Q 3RLOA 2K5VA 2L9HA 1PV4A 4JI0L 1VQNA 4ZYSA 5CBAE 2BCOA 4JVZA 2JA6B 1RCVD 1PH8A 2FMCA 4A3MG 4KHPQ 1HZCA 2AUKA 3J80i 5IYBG 3NHHA 1I50H 3VDYA 4ILWA 4OIJA 2PNRC 2QCPX 1VDZA 4J1MA 2XVSA 1JJGA 3L2PA 4OHJA 1WTHA 1QG7A 3W5OA 5CV5A 2BE5D 2PZUA 4C3JB 3MVVA 4Y7NH 1TWCB 2K01A 3KDFB 3BZKA 1LT5D 2B2UA 2B2WC 4ABNA 1STNA 1K8MA 1DOMA 2WAQG 3M9BA 3A74A 4IUUA 2F52A 4K2KA 3TEHB 2OF1A 2CH4A 4NP5A 3GTGH 3HG9A 2OTJA 4APVA 3K0YA 2EE1A 3S2DB 3G71A 3EBEA 1QZHA 1VF5C 3TSSA 3SK4A 2CH4W 3G48A 4JOIA 4MTKA 5CYUA 3RUZA 3SK8A 4BY1H 1GOZA 3GTPH 1UNSA 3CU7A 1MIUA 4KY7A 3HOYH 5IGGA 1V43A 1U0LA 3T56B 1PRTF 3HRZC 4HN7A 3PO3G 1PFNA 1IBMQ 1NSNS 5C3WA 3DEPA 2NN6G 3HZXA 3JC66 2JYOA 2Q8RE 1K0RA 2AUJD 3S2HB 1T5EA 2L55A 2ZXOA 3S1RB 3HP3A 5IGCA 2F3IA 1KTKA 1HTPA 3CD6A 1KDBA 1P8LA 1WTOA 2RBMA 2RCFA 3FHWA 3PCOB 4PNYA 2VB2X 2JA8B 1NNXA 3EQLC 4O0AA 1CUKA 1QILA 4BBSB 1A63A 3HKZE 3TP6A 1AE3A 1BBUA 4QJFA 5CV6A 4C56C 4FF3A 2F0GA 4ZCKA 4HEDA 2IHEA 1DYQA 1G291 2R92H 3UDIA 3A7LA 2K5WA 1SROA 4CJ2C 5IT9L 1ZKOA 4DF7A 1C9OA 1JICA 3ZYYX 5KNBA 4GKJQ 1H95A 2QA4A 3BVZA 3HOYG 1SNOA 1QE6A 4HIKA 1TXYA 1HR0Q 1HA6A 3I4OA 3GTPB 1VQ9A 3F8TA 5AJ3L 3R8BA 1TWAH 5LMNL 4J8QA 1SN8A 3I4NB 1SFOH 5LMNW 4Q5VA 4C3HB 4Q0FA 1E0BA 5DM63 2JA5H 2MUYA 5FO7B 4C2MH 4U673 1KHIA 1I6HH 5IYBH 2D62A 4PMBA 1QNUA 3I8ZA 1WD1A 4LW1A 1YBYA 5EJWA 3K6OA 2F0SA 2KECA 1YZ6A 2Q8IB 4KY5A 4MIUA 1BF4A 3E5SA 3R2TA 1TS2A 2B63B 3LX0A 4LF4L 1QNKA 2YTVA 1YI2A 1VQ8A 3H3VH 3UDFA 3NQIA 4HIOA 3U9OA 2R93H 4GNXA 4OX9L 1ET6A 1TKWB 4FF1A 1ZYRC 3H91A 3C46A 1JE5A 1ICFB 1VQFA 1EY7A 4KHPL 4DV4L 2K7VA 1VMCA 4R4TA 1JJ2A 3D6WA 3JAME 2JA8G 3HOWG 4QCLA 2KCCA 5GQOA 3FPPA 1IZ6A 2I46A 3SXHA 1Q86C 4DR6L 3STBC 2O5JC 3SE0A 1CSQA 2F0MA 1CSPA 3MXPA 4TQUS 2RHQB 4IALA 3SEBA 1YEZA 4K5VA 1WCMH 3QWNA 3G4SA 2KCNA 1SJED 1H9KA 2EYHA 1JR0D
chains in the Genus database with same CATH topology
2JEBI 2UXBL 2E2JH 2GN5A 1L0WA 4A3EG 4HJ5A 4X62Q 1IBKL 2UU9L 4X66L 1YHAA 2VQFL 5IP7G 1HZBA 1W2BA 3PUYA 2NZHA 4JYAQ 5GAEC 1U5KA 3HFZB 4NXNL 4JC0A 3A5ZB 3S1MH 3UE1A 4B3TL 4Y52H 2UXCQ 2KCTA 4DV1Q 1XMOL 3GTOH 4DAYB 2B63H 4DV1L 3OTOQ 1Q12A 2HQLA 4OONA 4LFAQ 3J80c 3CMEA 1K8GA 1VQ7A 4LF4Q 4LF9Q 2JA7H 1GKHA 2R7DA 2XGTA 4K0KQ 2NVQH 1Q46A 2Q2HA 1OXTA 3GO5A 2VUMG 4GKKQ 4R4QA 3CMAA 2CFMA 4LFCL 1J5EQ 2UUBQ 3S1QH 2JA9A 5C44H 2PI2E 3WWVA 3KF8B 1IXRA 2A1AA 3A0JA 3W1BA 3ULJA 2F4VL 4BBRH 3DLLA 1IBLL 1UE6A 3JAMi 2VW9A 4YWMA 4DK3C 3RN5A 4A76A 1E24A 2CCZA 3CC4A 1VQHA 2Z6KC 3K81C 2NN6I 5IT9c 1XTDA 2N8NA 4OX9Q 2UUCQ 5C0XI 1Y1WG 4FDBA 1C0AA 2LXJA 4JI1Q 3HOXH 5LMNQ 2R6GA 4GS3A 1PH6A 4IFDG 4L5SA 3ZJYC 2N49A 2OTLA 1XNQL 3RN2A 2KENA 5GAHC 5M3FG 3S24A 4POGA 1X3EA 5FLMG 4BY7H 4EX5A 2Y0SG 5IP9H 4JI3Q 2H5XA 2PQAA 4HJ7A 4UY8C 4YY3L 2DUDA 4DR6Q 2R93G 2ZTCA 4JI8L 4DPGA 1A0IA 2HIVA 4B3SL 3I4MH 5C3EG 3PIOA 4JI7L 3M4PA 2Q2UA 2ZJPA 1NTGA 5GROA 1VQ6A 1Q7YC 1N34Q 1EWIA 1P16A 1SR3A 4UPAA 4DR7L 1E7ZA 2MO0A 5JEAG 4BXXH 2K52A 4DK6C 3NENA 2MFIA 2MQHA 2IT1A 4X65L 4DV5Q 4DV7L 3HOZH 4GNXC 4LF7L 1XNRL 1NMFA 2ASBA 4BY1G 2IY5B 4LF8L 4DV2Q 3OW2A 2OTJA 1L1OC 2KHIA 4GLVB 4GN5A 4JI5Q 1V9PA 4JBWA 1BBWA 2OCEA 4A3DG 1YNXA 3K7UC 3J81j 5M3MH 2VY3A 4YHHL 2OQ0A 4NB3A 4OXPA 1EYGA 4DR4Q 5BR8L 2K75A 2A19A 3CCVA 1MJEA 2N78A 1VQLA 2UUAQ 3H0GG 4HJ8A 4O2DA 4A75A 1PH9A 1XPRA 3I4MG 3HKZG 2WAQE 1EIFA 3LGJA 3J7ZC 1VQOA 3M4OH 4JV5L 4JG2A 4POFA 1K73C 3TRZA 4LF6Q 2Q2TA 2AKWB 2EIFA 2PMZE 3S14H 2VZAA 1OXXK 4BBSG 4WJ3M 1KL9A 2BA0A 2XTIA 1LUZA 1O7IA 2JJQA 3PUWA 3U4VA 2HHHL 1YITA 1FL0A 1X65A 3E0EA 1NJIC 3I55A 5GAGC 1NMGA 3CF5A 3L0OA 2NVXH 3CQZH 4PZ8A 1IYJB 1HNZQ 4YCVA 3RR5A 2I5MX 2D0PA 2ZJRA 1SRUA 5DLQE 5FLXc 4DV2L 1OXSC 4QIWE 3D31A 3S15H 3CPWA 3CCEA 3PUXA 4DR3L 4A3FH 1B8AA 1I94L 3CP0A 2VNUD 4LUOA 4DR3Q 4AQYQ 1I94Q 4P73A 1YHQA 1M1KC 1OTCA 3Q8DA 4DR7Q 4DUZQ 2JA7G 1HNXQ 5ELOA 1PH2A 2Q2IA 2HHHQ 1S3OA 1NBWA 2YTXA 3CAMA 4OWXB 5AJ3Q 4IOCA 3PO3H 4AQYL 2K5HA 4GLAC 1PH3A 1K8AC 1AH9A 2KBNA 1Q1EA 4X65Q 4YCUA 4LF6L 1PVOA 3W1GA 4IPDA 1YJNA 1A62A 3TQYA 4NXML 2JQOA 3MXNB 2JA6H 4LFBQ 4MZ9A 2VQEQ 3RZOH 1KIXA 3GDEA 2LXKA 5FJ8H 1SMXA 2E5LQ 4JI7Q 4P71A 3OTOL 1QUQA 4DR1L 4GOPA 3H3VI 3AFPA 4HIMA 4A3KG 1N36L 2FXQA 4JI8Q 1PH5A 3HOVH 3CCSA 1HNXL 1X6OA 3KDFA 1E22A 5HY6A 4IOAA 1PA6A 4BA2I 1VQEA 1UE1A 4DV6L 3UE0A 2MNAA 2AMCB 2DGYA 2WFWA 5J3BA 4DV5L 4DV7Q 1VQPA 1KC8C 2BA1A 4YHHQ 3EN2A 4A3BG 2OQKA 2LSSA 5LMUL 1YHBA 4PMWA 5IWAL 3STBD 4DKAC 2YYZA 3B6YA 3A5UA 1UEBA 3S1RH 2KHJA 2R7FA 2JA5G 1QVCA 3H0GH 3KF6B 2B29A 1A8VA 2KCMA 4ALPA 3ULPA 1KQSA 4NPSA 1G6PA 2NVYH 4L5TA 4A3IG 3HKSA 2F4VQ 4H02A 2JA8H 1T9HA 1LTLA 1MKHA 4RMFA 1CKNB 5FJ8G 2YTYA 4DV0Q 2QEXA 1VQBA 2VQEL 2ID0A 1XJVA 2E2HH 1HH2P 4JI3L 2UUBL 2MO1A 2BH8A 3PUZA 1UE5A 4YWKA 3U4ZA 4A4IA 4BBRG 1Q81C 5C3EH 1EQQA 4R4IA 4LWCA 1Y1VG 3GTKH 5C4XG 4DR4L 1YJWA 2UXBQ 3M4QA 2ZM6Q 1KAWA 3S17H 3H15A 2Z0SA 1E3PA 4GNXB 4BXXG 2ZTDA 1EFWA 4A3MH 4GN3B 4B3RL 4DNIA 2B3GA 2WP8J 4A3BH 2NZOA 4JYAL 4GOPC 3DM3A 4A3CH 4ME3A 3ERSX 1FGUA 1W3SA 2IX0A 1L1OA 1X54A 4P74A 5IYCH 1ASYA 4R1JA 5IP9G 1B70B 3KJPA 1B7YB 1RL2A 2RHSB 3M3YH 1K83H 3E9HA 4A3GG 3M85A 3HOUG 1D8LA 1QVGA 3PO2H 1YVCA 5M3FH 1QZGA 1WI5A 2JEAI 3M7NA 1TWGH 4A3KH 3HOVG 3S16H 4OWWB 3CCLA 1OXUA 3G6EA 3F2DA 3GTJH 2EQSA 4UP7A 3AQQA 2GVBA 1VQMA 3HOWH 2E5LL 4GN4B 1UE7A 1PH1A 1VCIA 3JAMc 4YY3Q 3L7ZC 2GVAA 3RLOA 2K5VA 1RIPA 4AIMA 4GLXA 5H1SE 4WJ4A 4RG1A 5EAYA 1PV4A 1HNZL 4JI0L 1VQAA 1VQNA 4B3RQ 4QGUA 1M90C 1N33L 4K0KL 2HIXA 1OXVA 4DV0L 1PH8A 4A3MG 4KHPQ 1HZCA 1X3FA 3J80i 5IYBG 4X62L 4L5QA 5BR8Q 3UDXA 2K4KA 4DR1Q 1I50H 1BKBA 2YV5A 4A3CG 4LUZA 2CQOA 3VDYA 4DUZL 3RNUA 1QVFA 1S40A 2ZTEA 1JJGA 4R4CA 3L2PA 4LF8Q 4BA1I 1PFSA 1DGSA 3W5OA 3F1ZA 4DV4Q 1JMCA 4IPHA 4DV6Q 3CC2A 4A3DH 4GOPB 2A8VA 4Y7NH 1X55A 5IYDH 4PZ6A 1Y1WH 2CKZB 1HZ9A 3KDFB 3BZKA 3GTLH 3CCUA 5IWAQ 3U58A 1K3RA 3CXCA 1IBLQ 4JCVE 2WAQG 4A3LG 3M9BA 2R92G 3A74A 3FP9A 3CCJA 2F52A 3TEHB 4BBSH 1N33Q 3D0FA 3NBHB 3GTGH 1PYSB 3GD7A 1TWHH 2D0OA 1Q82C 2RCNA 4APVA 1UWVA 1VQDA 1N9WA 2PQAB 2K50A 3CCRA 4HIDA 3KF6A 2UUAL 4IFDJ 4OO1I 5JJIA 4QL5A 4LF9L 2JE6I 1JB7A 5M5YH 1KXLA 3G71A 1VQIA 4B3SQ 4JI4L 3EBEA 4TVAB 3CCQA 1QZHA 2HT1A 2ALYB 4C3HH 3TS0A 2K14A 1NY4A 3G48A 4C3JH 4JOIA 4XIGS 1Z47A 4JBJA 3TREA 4AH6A 4BY1H 3ICEA 1WCMG 1TWCH 3GTPH 1IBKQ 2UU9Q 3TS2A 1MIUA 1LYLA 4LUVA 1XMQQ 3HOYH 2I0QA 3PIPA 1V43A 1U0LA 3NELA 5E7NA 4X6AH 2ATWA 1CKMA 4LF5Q 3PO3G 5M5XH 4UP9A 4JI5L 1HZAA 4X64Q 1IBMQ 5IE8A 2VL6A 4J15A 1YIJA 1FVIA 5JEAJ 4AYBG 3BU2A 2NN6G 4EQ5A 1N36Q 3JC66 5JJLA 1XNRQ 1K0RA 4BY7G 4P75A 1NE3A 4JBMA 2N3SA 3I2ZA 4IO9A 2F3IA 3S2DH 1D7QA 3F2CA 4LFCQ 2CWPA 3CD6A 3IRBA 1P8LA 3KOJA 4A3FG 4OWTB 2OWOA 3FHWA 1FJGQ 3PCOB 1SLJA 1N32L 5IP7H 1HNWQ 5FLMH 4X66Q 3PF5A 1KD1C 1N8RC 1PH4A 2IHFA 4YCWA 4O0AA 1CUKA 1A63A 4B3ML 3HKZE 3PO2G 4B3TQ 3AYHB 1AE3A 1BBUA 4QJFA 1EIYB 5IYCG 3FKIG 4JV5Q 2QGQA 3SGIA 2R7ZH 1VQ4A 4A3GH 4DR2Q 2I5LX 3PV0A 1LM0A 4PG3A 1XPOA 3HOUH 1TWFH 1Z9FA 3K0XA 1N34L 4UP8A 5C44G 1I3QH 1HR0L 4JI1L 2E2IH 1Q1BA 2UXDL 2IHEA 4JOIC 5M3MG 1G291 4GKKL 2R92H 3CW2C 3UDIA 5C4XH 3PSIA 4XTCS 4IJLA 4QY7A 4C3IH 3GTQH 1SROA 1C9OA 5M5WH 4DR5Q 2ZJQA 4HJ9A 4B3MQ 1XMOQ 3PF4A 4GKJQ 1CKOA 2RF4A 3FKIH 4OO1G 1X9NA 1H95A 2QA4A 1Y1VH 4QQBX 1IBML 2WB1E 1N32Q 4YWLA 3KFUA 1SE8A 1MJCA 4NXMQ 4LFBL 4PZ7A 3NEMA 3HOYG 5IY0A 5IYDG 1WYDA 5K36G 4HIKA 3I56A 1TXYA 1VS0A 1VQCA 1VQGA 3I7FA 1HR0Q 3I4NG 3T1HL 3I4OA 3GTMH 1VQ9A 2Y0SE 4GKJL 3F8TA 5AJ3L 3MEFA 1QUQB 1TWAH 1VQJA 2WB1G 2EXDA 3K7AH 5LMNL 3OYYA 2V1CC 2BH2A 3RLNA 1SN8A 4JI2L 1JT8A 4NXNQ 4JBKA 1X3GA 4A3IH 4JI2Q 2AWNA 1SFOH 5LMNW 3BJUA 3J81c 2UXDQ 1KRSA 4KHZA 3PGZA 4DV3L 2JA5H 1Q8KA 2C35B 1G51A 5C0XG 4DV3Q 3T1YL 4C2MH 3U50C 1HNWL 1KHIA 1WFQA 5ELNA 3I4NH 2I5HA 1I6HH 5IYBH 3ER0A 2D62A 4JI6L 1GD7A 1GO3E 2AHOB 4L5RC 1WJJA 1K9MC 1PHJA 4LFAL 2ZM6L 1X56A 3S1NH 1PH7A 4LW1A 1YBYA 2PNHA 1XPUA 2UXCL 2AWOA 1YZ6A 1CKNA 4A93G 2CWAA 1ASZA 3AEVA 4DUYL 1EUJA 5HGQA 4DAMA 4DUYQ 1HR0W 3F2BA 3EIVA 3BZCA 3J81i 2VQFQ 4AYBE 1C7YA 1HJPA 3T1YQ 2JA6G 4LNQA 3KLWA 3KYHC 4IJHA 4LF4L 2YTVA 1YI2A 1VQ8A 2VUMH 4IPCA 3H3VH 3UDFA 4HJAA 4DR5L 2L15A 4HIOA 2UUCL 3ULLA 2R93H 4GNXA 4X64L 4OX9L 2B63G 4JI6Q 2PI2A 1V1QA 3UDGA 2IX1A 4LF5L 3KJOA 4A3LH 4A93H 2ES2A 1E1TA 2K5NA 4R4OA 1JE5A 2E8GA 2VS1A 4LF7Q 1IL2A 3CCMA 1L1OB 1VQFA 3CPFA 4IPGA 4DV4L 1PYBA 4KHPL 4DR2L 5GADC 3HOXG 1J5EL 1GM5A 4R4TA 1FJGL 2NVTH 1JJ2A 4KI0A 4JI0Q 1JJCB 4A3EH 3J7A5 5JJKA 3K8AA 1J6QA 2JA8G 3HOWG 3PUVA 1YJ9A 1VQ5A 4MTNA 3E9IA 5GQOA 4A3JH 1AE2A 1I5FA 5C4JH 1L2FA 1IZ6A 2JK8A 3CC7A 2YU9H 1E1OA 1GVPA 1R9TH 1S72A 1Q86C 3T1HQ 4DR6L 5C0XJ 3STBC 1EOVA 3RLFA 3K80C 4KLKA 4IFDI 1CSQA 4MNOA 1CSPA 2R7ZG 2Z6KA 3RZDH 1BVSA 3S2HH 4P72A 1XMQL 1XNQQ 4TQUS 1WOCA 2RHQB 1YEZA 1Y14B 1VQKA 1WCMH 3G4SA 1KRTA 4A3JG 3HOZG 1EQRA 4JI4Q 3AFQA 5LMUQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JEB I;  2UXB L;  2E2J H;  2GN5 A;  1L0W A;  4A3E G;  4HJ5 A;  4X62 Q;  1IBK L;  2UU9 L;  4X66 L;  1YHA A;  2VQF L;  5IP7 G;  1HZB A;  1W2B A;  3PUY A;  2NZH A;  4JYA Q;  5GAE C;  1U5K A;  3HFZ B;  4NXN L;  4JC0 A;  3A5Z B;  3S1M H;  3UE1 A;  4B3T L;  4Y52 H;  2UXC Q;  2KCT A;  4DV1 Q;  1XMO L;  3GTO H;  4DAY B;  2B63 H;  4DV1 L;  3OTO Q;  1Q12 A;  2HQL A;  4OON A;  4LFA Q;  3J80 c;  3CME A;  1K8G A;  1VQ7 A;  4LF4 Q;  4LF9 Q;  2JA7 H;  1GKH A;  2R7D A;  2XGT A;  4K0K Q;  2NVQ H;  1Q46 A;  2Q2H A;  1OXT A;  3GO5 A;  2VUM G;  4GKK Q;  4R4Q A;  3CMA A;  2CFM A;  4LFC L;  1J5E Q;  2UUB Q;  3S1Q H;  2JA9 A;  5C44 H;  2PI2 E;  3WWV A;  3KF8 B;  1IXR A;  2A1A A;  3A0J A;  3W1B A;  3ULJ A;  2F4V L;  4BBR H;  3DLL A;  1IBL L;  1UE6 A;  3JAM i;  2VW9 A;  4YWM A;  4DK3 C;  3RN5 A;  4A76 A;  1E24 A;  2CCZ A;  3CC4 A;  1VQH A;  2Z6K C;  3K81 C;  2NN6 I;  5IT9 c;  1XTD A;  2N8N A;  4OX9 Q;  2UUC Q;  5C0X I;  1Y1W G;  4FDB A;  1C0A A;  2LXJ A;  4JI1 Q;  3HOX H;  5LMN Q;  2R6G A;  4GS3 A;  1PH6 A;  4IFD G;  4L5S A;  3ZJY C;  2N49 A;  2OTL A;  1XNQ L;  3RN2 A;  2KEN A;  5GAH C;  5M3F G;  3S24 A;  4POG A;  1X3E A;  5FLM G;  4BY7 H;  4EX5 A;  2Y0S G;  5IP9 H;  4JI3 Q;  2H5X A;  2PQA A;  4HJ7 A;  4UY8 C;  4YY3 L;  2DUD A;  4DR6 Q;  2R93 G;  2ZTC A;  4JI8 L;  4DPG A;  1A0I A;  2HIV A;  4B3S L;  3I4M H;  5C3E G;  3PIO A;  4JI7 L;  3M4P A;  2Q2U A;  2ZJP A;  1NTG A;  5GRO A;  1VQ6 A;  1Q7Y C;  1N34 Q;  1EWI A;  1P16 A;  1SR3 A;  4UPA A;  4DR7 L;  1E7Z A;  2MO0 A;  5JEA G;  4BXX H;  2K52 A;  4DK6 C;  3NEN A;  2MFI A;  2MQH A;  2IT1 A;  4X65 L;  4DV5 Q;  4DV7 L;  3HOZ H;  4GNX C;  4LF7 L;  1XNR L;  1NMF A;  2ASB A;  4BY1 G;  2IY5 B;  4LF8 L;  4DV2 Q;  3OW2 A;  2OTJ A;  1L1O C;  2KHI A;  4GLV B;  4GN5 A;  4JI5 Q;  1V9P A;  4JBW A;  1BBW A;  2OCE A;  4A3D G;  1YNX A;  3K7U C;  3J81 j;  5M3M H;  2VY3 A;  4YHH L;  2OQ0 A;  4NB3 A;  4OXP A;  1EYG A;  4DR4 Q;  5BR8 L;  2K75 A;  2A19 A;  3CCV A;  1MJE A;  2N78 A;  1VQL A;  2UUA Q;  3H0G G;  4HJ8 A;  4O2D A;  4A75 A;  1PH9 A;  1XPR A;  3I4M G;  3HKZ G;  2WAQ E;  1EIF A;  3LGJ A;  3J7Z C;  1VQO A;  3M4O H;  4JV5 L;  4JG2 A;  4POF A;  1K73 C;  3TRZ A;  4LF6 Q;  2Q2T A;  2AKW B;  2EIF A;  2PMZ E;  3S14 H;  2VZA A;  1OXX K;  4BBS G;  4WJ3 M;  1KL9 A;  2BA0 A;  2XTI A;  1LUZ A;  1O7I A;  2JJQ A;  3PUW A;  3U4V A;  2HHH L;  1YIT A;  1FL0 A;  1X65 A;  3E0E A;  1NJI C;  3I55 A;  5GAG C;  1NMG A;  3CF5 A;  3L0O A;  2NVX H;  3CQZ H;  4PZ8 A;  1IYJ B;  1HNZ Q;  4YCV A;  3RR5 A;  2I5M X;  2D0P A;  2ZJR A;  1SRU A;  5DLQ E;  5FLX c;  4DV2 L;  1OXS C;  4QIW E;  3D31 A;  3S15 H;  3CPW A;  3CCE A;  3PUX A;  4DR3 L;  4A3F H;  1B8A A;  1I94 L;  3CP0 A;  2VNU D;  4LUO A;  4DR3 Q;  4AQY Q;  1I94 Q;  4P73 A;  1YHQ A;  1M1K C;  1OTC A;  3Q8D A;  4DR7 Q;  4DUZ Q;  2JA7 G;  1HNX Q;  5ELO A;  1PH2 A;  2Q2I A;  2HHH Q;  1S3O A;  1NBW A;  2YTX A;  3CAM A;  4OWX B;  5AJ3 Q;  4IOC A;  3PO3 H;  4AQY L;  2K5H A;  4GLA C;  1PH3 A;  1K8A C;  1AH9 A;  2KBN A;  1Q1E A;  4X65 Q;  4YCU A;  4LF6 L;  1PVO A;  3W1G A;  4IPD A;  1YJN A;  1A62 A;  3TQY A;  4NXM L;  2JQO A;  3MXN B;  2JA6 H;  4LFB Q;  4MZ9 A;  2VQE Q;  3RZO H;  1KIX A;  3GDE A;  2LXK A;  5FJ8 H;  1SMX A;  2E5L Q;  4JI7 Q;  4P71 A;  3OTO L;  1QUQ A;  4DR1 L;  4GOP A;  3H3V I;  3AFP A;  4HIM A;  4A3K G;  1N36 L;  2FXQ A;  4JI8 Q;  1PH5 A;  3HOV H;  3CCS A;  1HNX L;  1X6O A;  3KDF A;  1E22 A;  5HY6 A;  4IOA A;  1PA6 A;  4BA2 I;  1VQE A;  1UE1 A;  4DV6 L;  3UE0 A;  2MNA A;  2AMC B;  2DGY A;  2WFW A;  5J3B A;  4DV5 L;  4DV7 Q;  1VQP A;  1KC8 C;  2BA1 A;  4YHH Q;  3EN2 A;  4A3B G;  2OQK A;  2LSS A;  5LMU L;  1YHB A;  4PMW A;  5IWA L;  3STB D;  4DKA C;  2YYZ A;  3B6Y A;  3A5U A;  1UEB A;  3S1R H;  2KHJ A;  2R7F A;  2JA5 G;  1QVC A;  3H0G H;  3KF6 B;  2B29 A;  1A8V A;  2KCM A;  4ALP A;  3ULP A;  1KQS A;  4NPS A;  1G6P A;  2NVY H;  4L5T A;  4A3I G;  3HKS A;  2F4V Q;  4H02 A;  2JA8 H;  1T9H A;  1LTL A;  1MKH A;  4RMF A;  1CKN B;  5FJ8 G;  2YTY A;  4DV0 Q;  2QEX A;  1VQB A;  2VQE L;  2ID0 A;  1XJV A;  2E2H H;  1HH2 P;  4JI3 L;  2UUB L;  2MO1 A;  2BH8 A;  3PUZ A;  1UE5 A;  4YWK A;  3U4Z A;  4A4I A;  4BBR G;  1Q81 C;  5C3E H;  1EQQ A;  4R4I A;  4LWC A;  1Y1V G;  3GTK H;  5C4X G;  4DR4 L;  1YJW A;  2UXB Q;  3M4Q A;  2ZM6 Q;  1KAW A;  3S17 H;  3H15 A;  2Z0S A;  1E3P A;  4GNX B;  4BXX G;  2ZTD A;  1EFW A;  4A3M H;  4GN3 B;  4B3R L;  4DNI A;  2B3G A;  2WP8 J;  4A3B H;  2NZO A;  4JYA L;  4GOP C;  3DM3 A;  4A3C H;  4ME3 A;  3ERS X;  1FGU A;  1W3S A;  2IX0 A;  1L1O A;  1X54 A;  4P74 A;  5IYC H;  1ASY A;  4R1J A;  5IP9 G;  1B70 B;  3KJP A;  1B7Y B;  1RL2 A;  2RHS B;  3M3Y H;  1K83 H;  3E9H A;  4A3G G;  3M85 A;  3HOU G;  1D8L A;  1QVG A;  3PO2 H;  1YVC A;  5M3F H;  1QZG A;  1WI5 A;  2JEA I;  3M7N A;  1TWG H;  4A3K H;  3HOV G;  3S16 H;  4OWW B;  3CCL A;  1OXU A;  3G6E A;  3F2D A;  3GTJ H;  2EQS A;  4UP7 A;  3AQQ A;  2GVB A;  1VQM A;  3HOW H;  2E5L L;  4GN4 B;  1UE7 A;  1PH1 A;  1VCI A;  3JAM c;  4YY3 Q;  3L7Z C;  2GVA A;  3RLO A;  2K5V A;  1RIP A;  4AIM A;  4GLX A;  5H1S E;  4WJ4 A;  4RG1 A;  5EAY A;  1PV4 A;  1HNZ L;  4JI0 L;  1VQA A;  1VQN A;  4B3R Q;  4QGU A;  1M90 C;  1N33 L;  4K0K L;  2HIX A;  1OXV A;  4DV0 L;  1PH8 A;  4A3M G;  4KHP Q;  1HZC A;  1X3F A;  3J80 i;  5IYB G;  4X62 L;  4L5Q A;  5BR8 Q;  3UDX A;  2K4K A;  4DR1 Q;  1I50 H;  1BKB A;  2YV5 A;  4A3C G;  4LUZ A;  2CQO A;  3VDY A;  4DUZ L;  3RNU A;  1QVF A;  1S40 A;  2ZTE A;  1JJG A;  4R4C A;  3L2P A;  4LF8 Q;  4BA1 I;  1PFS A;  1DGS A;  3W5O A;  3F1Z A;  4DV4 Q;  1JMC A;  4IPH A;  4DV6 Q;  3CC2 A;  4A3D H;  4GOP B;  2A8V A;  4Y7N H;  1X55 A;  5IYD H;  4PZ6 A;  1Y1W H;  2CKZ B;  1HZ9 A;  3KDF B;  3BZK A;  3GTL H;  3CCU A;  5IWA Q;  3U58 A;  1K3R A;  3CXC A;  1IBL Q;  4JCV E;  2WAQ G;  4A3L G;  3M9B A;  2R92 G;  3A74 A;  3FP9 A;  3CCJ A;  2F52 A;  3TEH B;  4BBS H;  1N33 Q;  3D0F A;  3NBH B;  3GTG H;  1PYS B;  3GD7 A;  1TWH H;  2D0O A;  1Q82 C;  2RCN A;  4APV A;  1UWV A;  1VQD A;  1N9W A;  2PQA B;  2K50 A;  3CCR A;  4HID A;  3KF6 A;  2UUA L;  4IFD J;  4OO1 I;  5JJI A;  4QL5 A;  4LF9 L;  2JE6 I;  1JB7 A;  5M5Y H;  1KXL A;  3G71 A;  1VQI A;  4B3S Q;  4JI4 L;  3EBE A;  4TVA B;  3CCQ A;  1QZH A;  2HT1 A;  2ALY B;  4C3H H;  3TS0 A;  2K14 A;  1NY4 A;  3G48 A;  4C3J H;  4JOI A;  4XIG S;  1Z47 A;  4JBJ A;  3TRE A;  4AH6 A;  4BY1 H;  3ICE A;  1WCM G;  1TWC H;  3GTP H;  1IBK Q;  2UU9 Q;  3TS2 A;  1MIU A;  1LYL A;  4LUV A;  1XMQ Q;  3HOY H;  2I0Q A;  3PIP A;  1V43 A;  1U0L A;  3NEL A;  5E7N A;  4X6A H;  2ATW A;  1CKM A;  4LF5 Q;  3PO3 G;  5M5X H;  4UP9 A;  4JI5 L;  1HZA A;  4X64 Q;  1IBM Q;  5IE8 A;  2VL6 A;  4J15 A;  1YIJ A;  1FVI A;  5JEA J;  4AYB G;  3BU2 A;  2NN6 G;  4EQ5 A;  1N36 Q;  3JC6 6;  5JJL A;  1XNR Q;  1K0R A;  4BY7 G;  4P75 A;  1NE3 A;  4JBM A;  2N3S A;  3I2Z A;  4IO9 A;  2F3I A;  3S2D H;  1D7Q A;  3F2C A;  4LFC Q;  2CWP A;  3CD6 A;  3IRB A;  1P8L A;  3KOJ A;  4A3F G;  4OWT B;  2OWO A;  3FHW A;  1FJG Q;  3PCO B;  1SLJ A;  1N32 L;  5IP7 H;  1HNW Q;  5FLM H;  4X66 Q;  3PF5 A;  1KD1 C;  1N8R C;  1PH4 A;  2IHF A;  4YCW A;  4O0A A;  1CUK A;  1A63 A;  4B3M L;  3HKZ E;  3PO2 G;  4B3T Q;  3AYH B;  1AE3 A;  1BBU A;  4QJF A;  1EIY B;  5IYC G;  3FKI G;  4JV5 Q;  2QGQ A;  3SGI A;  2R7Z H;  1VQ4 A;  4A3G H;  4DR2 Q;  2I5L X;  3PV0 A;  1LM0 A;  4PG3 A;  1XPO A;  3HOU H;  1TWF H;  1Z9F A;  3K0X A;  1N34 L;  4UP8 A;  5C44 G;  1I3Q H;  1HR0 L;  4JI1 L;  2E2I H;  1Q1B A;  2UXD L;  2IHE A;  4JOI C;  5M3M G;  1G29 1;  4GKK L;  2R92 H;  3CW2 C;  3UDI A;  5C4X H;  3PSI A;  4XTC S;  4IJL A;  4QY7 A;  4C3I H;  3GTQ H;  1SRO A;  1C9O A;  5M5W H;  4DR5 Q;  2ZJQ A;  4HJ9 A;  4B3M Q;  1XMO Q;  3PF4 A;  4GKJ Q;  1CKO A;  2RF4 A;  3FKI H;  4OO1 G;  1X9N A;  1H95 A;  2QA4 A;  1Y1V H;  4QQB X;  1IBM L;  2WB1 E;  1N32 Q;  4YWL A;  3KFU A;  1SE8 A;  1MJC A;  4NXM Q;  4LFB L;  4PZ7 A;  3NEM A;  3HOY G;  5IY0 A;  5IYD G;  1WYD A;  5K36 G;  4HIK A;  3I56 A;  1TXY A;  1VS0 A;  1VQC A;  1VQG A;  3I7F A;  1HR0 Q;  3I4N G;  3T1H L;  3I4O A;  3GTM H;  1VQ9 A;  2Y0S E;  4GKJ L;  3F8T A;  5AJ3 L;  3MEF A;  1QUQ B;  1TWA H;  1VQJ A;  2WB1 G;  2EXD A;  3K7A H;  5LMN L;  3OYY A;  2V1C C;  2BH2 A;  3RLN A;  1SN8 A;  4JI2 L;  1JT8 A;  4NXN Q;  4JBK A;  1X3G A;  4A3I H;  4JI2 Q;  2AWN A;  1SFO H;  5LMN W;  3BJU A;  3J81 c;  2UXD Q;  1KRS A;  4KHZ A;  3PGZ A;  4DV3 L;  2JA5 H;  1Q8K A;  2C35 B;  1G51 A;  5C0X G;  4DV3 Q;  3T1Y L;  4C2M H;  3U50 C;  1HNW L;  1KHI A;  1WFQ A;  5ELN A;  3I4N H;  2I5H A;  1I6H H;  5IYB H;  3ER0 A;  2D62 A;  4JI6 L;  1GD7 A;  1GO3 E;  2AHO B;  4L5R C;  1WJJ A;  1K9M C;  1PHJ A;  4LFA L;  2ZM6 L;  1X56 A;  3S1N H;  1PH7 A;  4LW1 A;  1YBY A;  2PNH A;  1XPU A;  2UXC L;  2AWO A;  1YZ6 A;  1CKN A;  4A93 G;  2CWA A;  1ASZ A;  3AEV A;  4DUY L;  1EUJ A;  5HGQ A;  4DAM A;  4DUY Q;  1HR0 W;  3F2B A;  3EIV A;  3BZC A;  3J81 i;  2VQF Q;  4AYB E;  1C7Y A;  1HJP A;  3T1Y Q;  2JA6 G;  4LNQ A;  3KLW A;  3KYH C;  4IJH A;  4LF4 L;  2YTV A;  1YI2 A;  1VQ8 A;  2VUM H;  4IPC A;  3H3V H;  3UDF A;  4HJA A;  4DR5 L;  2L15 A;  4HIO A;  2UUC L;  3ULL A;  2R93 H;  4GNX A;  4X64 L;  4OX9 L;  2B63 G;  4JI6 Q;  2PI2 A;  1V1Q A;  3UDG A;  2IX1 A;  4LF5 L;  3KJO A;  4A3L H;  4A93 H;  2ES2 A;  1E1T A;  2K5N A;  4R4O A;  1JE5 A;  2E8G A;  2VS1 A;  4LF7 Q;  1IL2 A;  3CCM A;  1L1O B;  1VQF A;  3CPF A;  4IPG A;  4DV4 L;  1PYB A;  4KHP L;  4DR2 L;  5GAD C;  3HOX G;  1J5E L;  1GM5 A;  4R4T A;  1FJG L;  2NVT H;  1JJ2 A;  4KI0 A;  4JI0 Q;  1JJC B;  4A3E H;  3J7A 5;  5JJK A;  3K8A A;  1J6Q A;  2JA8 G;  3HOW G;  3PUV A;  1YJ9 A;  1VQ5 A;  4MTN A;  3E9I A;  5GQO A;  4A3J H;  1AE2 A;  1I5F A;  5C4J H;  1L2F A;  1IZ6 A;  2JK8 A;  3CC7 A;  2YU9 H;  1E1O A;  1GVP A;  1R9T H;  1S72 A;  1Q86 C;  3T1H Q;  4DR6 L;  5C0X J;  3STB C;  1EOV A;  3RLF A;  3K80 C;  4KLK A;  4IFD I;  1CSQ A;  4MNO A;  1CSP A;  2R7Z G;  2Z6K A;  3RZD H;  1BVS A;  3S2H H;  4P72 A;  1XMQ L;  1XNQ Q;  4TQU S;  1WOC A;  2RHQ B;  1YEZ A;  1Y14 B;  1VQK A;  1WCM H;  3G4S A;  1KRT A;  4A3J G;  3HOZ G;  1EQR A;  4JI4 Q;  3AFQ A;  5LMU Q; 
#chains in the Genus database with same CATH topology
 2E2J H;  2GN5 A;  1L0W A;  4A3E G;  5ELF A;  1GUW A;  4XQN A;  3TN2 A;  1HZB A;  5IP7 G;  4RFB A;  1SAP A;  3VR2 A;  2WV6 D;  1U5K A;  1S5D D;  3P75 A;  4L6T B;  1F9Q A;  4DV1 Q;  1EY8 A;  2OEO A;  3EVQ A;  5I9P A;  4DAY B;  2B63 H;  3J80 c;  4OON A;  4LFA Q;  3CME A;  2R92 B;  5ELD A;  3NTH A;  2XGT A;  4HCE A;  2R93 B;  3GO5 A;  1OXT A;  1J8I A;  3CMA A;  2UUB Q;  5I9O A;  2NYZ D;  5C44 H;  3MXG A;  1GHK A;  3X3N A;  3NPP A;  1LT6 D;  3P20 A;  1PRT C;  4HTH A;  1SE3 A;  2Z6K C;  2F0K A;  5IT9 c;  1XTD A;  1PFB A;  2N8N A;  4OX9 Q;  2CW0 C;  2NVX B;  2QDB A;  2LXJ A;  5C4J B;  3HOX H;  1PH6 A;  2R6G A;  5D3D A;  5EPK A;  5C3X A;  2OTL A;  1G91 A;  5GAH C;  5M3F G;  3S24 A;  5LHY 1;  1SFO B;  4POG A;  5FLM G;  3S14 B;  4BY7 H;  4XT3 B;  5IP9 H;  2B8F A;  3SHL A;  4A3M B;  2AQ1 B;  2ZTC A;  4G4K A;  3VYS A;  4DNT B;  3N6R A;  3T51 B;  3PIO A;  3S1M B;  3D4W A;  5GRO A;  5CBE E;  5JOB A;  1VQ6 A;  2PCF B;  1P16 A;  1UUP A;  3OIQ A;  1I3Q B;  3NEN A;  2MQH A;  3NWT A;  4MHE A;  2E2J B;  4X65 L;  4DV5 Q;  2FFK B;  2XIW A;  4LF7 L;  3PIO 3;  1XNR L;  2ASB A;  1GUO A;  1HXY D;  2RDG A;  1V9P A;  4IUR A;  2OCE A;  1YNX A;  5FO9 B;  3J81 j;  3NBI A;  4DR4 Q;  2A6H C;  2EYL A;  3CCV A;  1HPC A;  5CC4 A;  4I7A A;  1PH9 A;  1XPR A;  2J0T D;  1BO0 A;  1EIF A;  2O5I C;  1K73 C;  4XQQ A;  3J80 E;  1SYG A;  1C4Q A;  2F0P A;  2AKW B;  4E6I A;  4DAV A;  4LF6 Q;  4WJ3 M;  5FO8 B;  3S17 B;  1LUZ A;  3IFD A;  2HHH L;  3OMG A;  1FL0 A;  1NJI C;  4FXG C;  3CQZ H;  1LTT D;  1PZI D;  3FEW X;  2ZJR A;  1SRU A;  5FLX c;  3C3L A;  3RD4 A;  4DR3 L;  3ERQ A;  4DR3 Q;  3C2P A;  4KKT A;  5CV4 A;  1A3T A;  3MXU A;  1HNX Q;  1DXM A;  3I4M B;  2HHH Q;  2QKI C;  1NBW A;  3CAM A;  4A3F B;  4AQY L;  5C3E B;  2K5H A;  4GLA C;  2F0T A;  4X65 Q;  1Q1E A;  1SYF A;  1UEA B;  1YNJ C;  3LWE A;  3PMF A;  1FNW A;  3RZO H;  1TS3 A;  2LS0 1;  1SMX A;  3OWE B;  3OTO L;  3LNN A;  4GOP A;  1U4L A;  4HIM A;  2KEE A;  5K5P A;  2DY7 A;  4RH6 A;  5HY6 A;  3CKI B;  1PXU A;  4BA2 I;  5I4D A;  1K8O A;  2ZJQ A;  4DV5 L;  5CV7 A;  5J3B A;  1VQP A;  4A3B G;  3BDO A;  3O13 A;  4KJO A;  1BBX C;  3STB D;  1PYW D;  2B2Y C;  3B6Y A;  2KHJ A;  3KF6 B;  3DUZ A;  4O42 A;  3BS1 A;  4ALP A;  3QJY A;  1DOK A;  1G6P A;  2NVY H;  4L5T A;  4F87 A;  3HKS A;  4A3I G;  4XYO A;  1LT3 D;  2FMM A;  3BYY B;  1LTL A;  1MKH A;  1C8C A;  1MSH A;  2B39 A;  1C48 A;  2UUB L;  3WOF A;  2BH8 A;  1EY6 A;  1UE5 A;  5CGK A;  3CQZ B;  4BBR G;  1SBB B;  1S5B D;  5C3E H;  1H9J A;  3FKI B;  4K5W A;  3IFT A;  1YJW A;  5JPN C;  2Z1C A;  3CHB D;  1TWH B;  4XDX A;  1EFW A;  2B3G A;  2E2I B;  3I72 A;  4U68 A;  1TU2 B;  3NP8 A;  2QW7 A;  3DXJ C;  5M5Y B;  4IUT A;  1FGU A;  1W3S A;  1SJH D;  1X54 A;  5IYC H;  5IP9 G;  1GJX A;  1HHV A;  1K83 H;  3M85 A;  3U9S A;  1BNZ A;  1EEI D;  3DWQ A;  3S16 H;  1TWG H;  3HOV G;  4KN7 C;  5D65 A;  2E5L L;  4GN4 B;  2B2T C;  3L7Z C;  1XTC D;  4AIM A;  3G7L A;  4WJ4 A;  4B3R Q;  4KD4 A;  1XYI A;  4QGU A;  1M90 C;  4K0K L;  4DV0 L;  3CRK C;  4X62 L;  2L1B A;  3J7A F;  3UDX A;  1BKB A;  1ILQ A;  4LUZ A;  2CQO A;  3Q23 A;  3RNU A;  1QVF A;  1EZ6 A;  2DY8 A;  2IL8 A;  4BA1 I;  2F1M A;  1PFS A;  1DGS A;  5CV8 A;  4DV4 Q;  3T53 B;  1MBY A;  4GOP B;  1BCP C;  1SDF A;  4G7O C;  4CBV A;  1B9M A;  2I07 B;  3VR3 A;  1WD0 A;  3EA6 A;  1EL0 A;  5IWA Q;  3WDN A;  3BZD B;  1IBL Q;  4KKS A;  4A3L G;  3FP9 A;  3RZD B;  3GQB A;  1K28 A;  1VQD A;  1N9W A;  3CCR A;  2K50 A;  4IFD J;  1DM0 B;  3KF6 A;  1V1P B;  3KF8 A;  2UUA L;  4OO1 I;  4QL5 A;  4RAU C;  1SE4 A;  4FP5 D;  1VQI A;  2A6H D;  3QOJ A;  3Q0A A;  4JI4 L;  2HT1 A;  4A3G B;  3HS0 C;  1VMP A;  5A2Q L;  2H1E A;  3AU7 A;  1SSO A;  4C3J H;  2HCI A;  4XIG S;  3ICE A;  2B8G A;  1B9N A;  3S15 B;  1EQV A;  2I0Q A;  2WB1 B;  1KNA A;  3NEL A;  1RF2 D;  3N52 A;  2A73 B;  2ATW A;  4LF5 Q;  1A2T A;  1F9P A;  4X64 Q;  1HA5 A;  2VL6 A;  5C0X H;  1YIJ A;  3A56 A;  4OEL B;  1FVI A;  4AYB G;  3BU2 A;  1Y1V B;  2EJM A;  2EY2 A;  2KED A;  4BY7 G;  3A55 A;  4P75 A;  2F0E A;  2EYP A;  2N3S A;  3GTQ B;  3S2D H;  4I65 A;  3A8J E;  3KOJ A;  4B08 A;  4A3F G;  1FJG Q;  5IP7 H;  1PH4 A;  2IHF A;  2G9H D;  1LLR D;  3HEJ A;  4C3J G;  5IIF A;  1TWF B;  1PMR A;  2HQE A;  1YNN C;  4B3T Q;  2AQ3 B;  2EY1 A;  3AYH B;  1EIY B;  3FKI G;  3KLR A;  3HOV B;  1STA A;  3V2T A;  4R8I A;  3K5M A;  1BXT A;  2R7Z H;  1VQ4 A;  3EFX D;  4PG3 A;  4WFN 3;  2FJ2 A;  3HOU H;  1TWF H;  1Z9F A;  1EY5 A;  3E3X A;  1HR0 L;  4JI1 L;  4JOI C;  5M3M G;  3AB9 A;  2K04 A;  5C4X H;  3MFY A;  3PSI A;  4QY7 A;  4C3I H;  5M5W H;  4K5X A;  4HJ9 A;  3Q24 A;  3NQT A;  3GTK B;  1EWH A;  5M5X B;  1JOQ A;  5JAV A;  5KND A;  2WB1 E;  5EKL A;  1G2S A;  3MXN A;  5IYD G;  1SYE A;  1WYD A;  2K5Q A;  3I90 A;  1VQC A;  1VQG A;  3I4N G;  3T1H L;  1RTO A;  3MEF A;  1QUQ B;  2EXD A;  5E1F A;  3OYY A;  2BH2 A;  1JT8 A;  4JBK A;  1TWG B;  4X3S A;  3A54 A;  3BJU A;  3DWP A;  2UXD Q;  1G6Z A;  3VYT A;  1CHQ D;  5FOB B;  1Q8K A;  4KTA A;  2C35 B;  4S3S A;  1G51 A;  4HMJ A;  2SEB D;  5FLX E;  1DZ1 A;  4L8J A;  2R7Z B;  3HGB A;  4JI6 L;  3I70 A;  2AHO B;  1PTO F;  1K9M C;  1PHJ A;  4LFA L;  2ZM6 L;  1B3A A;  3M3Y B;  3S1N H;  5EBD A;  4A3K B;  2LY7 A;  1XPU A;  2UXC L;  4XT1 B;  4TRD A;  2AWO A;  3GTL B;  4A93 G;  2CWA A;  1BCP D;  3AEV A;  2F0H A;  5HGQ A;  4N8X 1;  2A74 C;  4LMQ D;  1KAB A;  2M2L A;  2Y0S B;  3BZC A;  5IOD A;  1C7Y A;  1PTO H;  3T1Y Q;  5COR A;  5E3F A;  2JA7 B;  4ULL A;  2VUM H;  4A3D B;  4HJA A;  4KY6 A;  2FHT A;  2UUC L;  3ULL A;  5LL6 S;  3QO2 A;  4JI6 Q;  2PI2 A;  1AFP A;  1TWA B;  2E74 C;  2ES2 A;  2K5N A;  4LK1 C;  2E8G A;  2VS1 A;  4LF7 Q;  2A6E C;  3CCM A;  1O78 A;  4IPG A;  2XSC A;  4DR2 L;  1ML0 D;  2NVT H;  1GUG A;  1JJC B;  3MC0 B;  5JJK A;  1SEB D;  1D5M C;  4ZKB B;  1WTQ A;  2PMZ B;  3PUV A;  4IUP A;  1D5Z C;  3E9I A;  1I5F A;  1L2F A;  3C1E A;  3CC7 A;  1GVP A;  5C0X J;  4HSP A;  1EOV A;  3K80 C;  5FK9 C;  4EGV A;  3T4A C;  1LTR D;  1WOC A;  2EXZ A;  3I73 A;  1Y14 B;  1LAC A;  2ZT9 C;  4WOR A;  4NW2 A;  1KRT A;  4A3J G;  3D8G A;  3AFQ A;  4R4C A;  4Y52 H;  2JEB I;  2D9U A;  2VB3 X;  4LAA A;  1IBK L;  1I4X A;  3HOZ B;  4JPB W;  3PUY A;  1Y69 U;  3HFZ B;  4JC0 A;  4B3T L;  4OEM B;  3L9A X;  3GTO H;  1GUT A;  1Q12 A;  2HQL A;  4JK1 C;  2JA7 H;  1SNC A;  4C1N K;  1GKH A;  2BOS A;  4K0K Q;  2NVQ H;  4GKK Q;  3BG3 A;  2CFM A;  2JA9 A;  2PI2 E;  1K0S A;  3WWV A;  3HOU B;  3VA7 A;  4DXF A;  5F2D A;  2F4V L;  2IWH A;  3JAM i;  2VW9 A;  3RN5 A;  4QMG A;  3PO2 B;  4A76 A;  3K81 C;  4ZK9 B;  2ZXP A;  1PTO C;  2UUC Q;  5C0X I;  1C0A A;  4CKC A;  2MPM A;  4IFD G;  3ZJY C;  3BDC A;  3RN2 A;  2KEN A;  3OWF A;  4FVM A;  3CRL C;  3OMC A;  2ENB A;  4UY8 C;  2LKV A;  4DR6 Q;  4V0B A;  4JI8 L;  1A0I A;  1EY0 A;  4QUC A;  3M4P A;  2ZJP A;  4G7H C;  1Q7Y C;  1EWI A;  2MO0 A;  2NB0 A;  2K52 A;  2MFI A;  2F03 A;  1FGB D;  5HGT A;  3K57 A;  4DV7 L;  4HSV A;  3HOZ H;  5AFW A;  2BDN A;  3PO3 B;  1A3U A;  2KHI A;  1CK1 A;  4GLV B;  4GN5 A;  1II3 A;  1RJT A;  4QIW B;  4A3D G;  4O1N A;  5M3M H;  1A2U A;  2VY3 A;  2OQ0 A;  4OXP A;  2EZV A;  4KV6 A;  2K75 A;  1E2V A;  1CFM A;  2F3V A;  2HD3 A;  5IOC A;  3VA5 A;  1VQL A;  1I4R A;  2UUA Q;  3I4M G;  3HKZ G;  4JV5 L;  3ERO A;  1QJO A;  5CR3 A;  2VXW A;  5JVG 3;  5ELB A;  1WTW A;  2Q2T A;  3C1F A;  3D4D A;  1SE2 A;  1OXX K;  1TVX A;  4BBS G;  2BA0 A;  1O7I A;  2JJQ A;  1YIT A;  1X65 A;  1WTX A;  1IYU A;  3KBX A;  5EQ0 A;  1Y1W B;  1O7Z A;  4PZ8 A;  1IYJ B;  3J7A V;  3S15 H;  1OXS C;  3D31 A;  3CPW A;  1B8A A;  4N9T A;  4A93 B;  4LUO A;  3TDQ A;  5I2Y A;  4P73 A;  4QB4 A;  1M1K C;  1OTC A;  3Q8D A;  4F88 A;  2EJG C;  1H9S B;  2F0D A;  2NTS A;  1ET9 A;  3LWU A;  3ONA B;  2JA7 G;  4YIJ A;  5ELO A;  2XWJ B;  4IUN A;  4IUV A;  5AJ3 Q;  4IOC A;  1MGS A;  2Q8T A;  2B2U C;  2B2W A;  2RQX A;  4I7Z C;  3M4Y A;  2A69 C;  4TSS A;  1WTV A;  1A62 A;  4NXM L;  2K03 A;  2G9D A;  1STB A;  3J7Y W;  4JI7 Q;  2E2H B;  4M8A A;  2B2V A;  3S1N B;  3AFP A;  3HOV H;  2FXQ A;  4JI8 Q;  3TP5 A;  5G3L F;  3NTI A;  4RGT A;  1JB3 A;  3ND8 A;  1PA6 A;  2A68 D;  2A68 C;  3SK5 A;  1QCB D;  4DV6 L;  4DV7 Q;  2AMC B;  2DGY A;  3EJI A;  4X3U A;  2RDH A;  2OQK A;  1EFI D;  4PMW A;  5ELC A;  5IWA L;  1J9O A;  2YYZ A;  3E0J A;  3SDZ A;  4DKA C;  4DNR B;  3A5U A;  1X32 A;  1QB5 D;  4C1N I;  1KQS A;  1W6J A;  2F4I A;  3KK7 A;  4NPS A;  5A35 A;  4N8F A;  1XWE A;  2JA8 H;  1TR5 A;  1T9H A;  2F0Q A;  3GTO B;  5FJ8 G;  3VR6 A;  1Q3L A;  2ID0 A;  3NTK A;  4NKL A;  2PYK A;  2WIN B;  2QIL A;  4DN4 M;  2E76 C;  2Z9H A;  1NUC A;  4A4I A;  2PZW A;  2SNM A;  4R4I A;  1LTG D;  4LWC A;  2XNA C;  4TKO B;  4DR4 L;  3QOL A;  4K14 A;  5ISR A;  3S17 H;  5HUR A;  2Z0S A;  1ESR A;  2NTT A;  4DNI A;  1H9R A;  2WP8 J;  4B3R L;  1S4Z A;  4A3B H;  2NZO A;  4GOP C;  1BCP B;  1NAP A;  1L1O A;  4R1J A;  1X3P A;  3KJP A;  1B70 B;  1BQQ T;  3M3Y H;  3E9H A;  3HOU G;  5M3F H;  1WI5 A;  2JEA I;  1OXU A;  3F2D A;  1B53 A;  3AQQ A;  2GVB A;  2R61 A;  3JAM c;  4HR7 B;  2GVA A;  4GLX A;  5H1S E;  4RG1 A;  5EAY A;  1HNZ L;  2DJG C;  1AZP A;  4EQO A;  2HIX A;  5BN4 A;  5DEH A;  4L5Q A;  5BR8 Q;  2K4K A;  4DAY A;  1A3V A;  2YV5 A;  4A3C G;  5C5M A;  1LV9 A;  4IFD H;  2NN6 H;  4DK1 A;  4RWS C;  1CI3 M;  4LF8 Q;  1Q8I A;  4R8N A;  3BDL A;  1F2M A;  2M9V A;  4IPH A;  4DV6 Q;  5IT9 E;  3CC2 A;  4A3D H;  2A8V A;  3S16 B;  1CTM A;  1X55 A;  2XRS D;  4F7X A;  5IYD H;  1Y1W H;  1HQM C;  5NUC A;  1SMY C;  1EEF D;  1HZ9 A;  2PQE A;  1STE A;  3V05 A;  4PMC A;  5EKK A;  4JCV E;  1JCK B;  2R92 G;  1U9R A;  4BBS H;  2RSO A;  4AYB B;  3D0F A;  3NBH B;  2Z4H A;  1N34 L;  1Q82 C;  2RCN A;  3H6M A;  2PQA B;  4PV1 C;  2HUG A;  2YU9 B;  2JE6 I;  1JB7 A;  2KJX A;  1V1O A;  2K33 A;  2KHS A;  3WOE A;  4TVA B;  4DGZ A;  1JWM D;  3CCQ A;  1YNN D;  2ALY B;  1NR2 A;  2KA7 A;  3TS0 A;  2K14 A;  2K5D A;  1IBK Q;  3D4R A;  4LUV A;  4H44 C;  3TP8 A;  3R2I A;  4J15 A;  1BUV T;  3MWY W;  1TY2 A;  5JEA J;  2K32 A;  4QF4 A;  3V96 A;  2RDF A;  2EOT A;  4RHR A;  2DJF C;  4JBM A;  3QIA A;  3I2Z A;  4IO9 A;  1D7Q A;  4LFC Q;  2CWP A;  1PTO B;  3IRB A;  1JOR A;  3R93 A;  4OWT B;  2OWO A;  5I2X A;  3M7G A;  1SLJ A;  1N32 L;  4RGO S;  1ENF A;  1HNW Q;  1HUN A;  1N8R C;  3PQI A;  1LTS D;  4FF2 A;  4K6D A;  3PO2 G;  3UI2 A;  2JP1 A;  4KN4 C;  2TMP A;  1LTA D;  2QGQ A;  2L0C A;  1I6H B;  4A3G H;  4DR2 Q;  1LM0 A;  4KHV A;  1TS4 A;  5C44 G;  1I3Q H;  2LMC B;  1CM9 A;  1D1K A;  1LTI D;  1CA5 A;  4KJN A;  3CW2 C;  2P5Z X;  3GTQ H;  4DR5 Q;  3GTM B;  3W3A A;  4B3M Q;  2KOL A;  2ZXR A;  1CKO A;  5EKI A;  1X9N A;  1S5C D;  1ENC A;  1Y1V H;  4QQB X;  1IBM L;  1MSG A;  4YWL A;  4HAE A;  4NXM Q;  3H3V C;  4PZ7 A;  5IY0 A;  5K36 G;  3I56 A;  3HOW B;  4FYD A;  1EOT A;  4ODG A;  3GTM H;  2Y0S E;  1BOS A;  5G3L D;  4GKJ L;  1I6V C;  1VQJ A;  3R3O A;  2HDL A;  4J6H A;  2V1C C;  4JI2 L;  4NXN Q;  1X3G A;  2XWB B;  4JI2 Q;  2AWN A;  1L0Y B;  4A3I H;  3J81 c;  3JAM L;  1ZYR D;  1KRS A;  4KHZ A;  4OGQ C;  4QUF A;  1CHP D;  4DV3 Q;  4ME5 A;  3T1Y L;  3U50 C;  3X3M A;  5ELN A;  3I4N H;  2I5H A;  1H9M A;  4CDF C;  1GO3 E;  1SND A;  3MEH A;  4L5R C;  1WJJ A;  1I4P A;  1X56 A;  5IGF A;  3IL8 A;  2RSN A;  1JOK A;  3NSW A;  1GUS A;  3DMU A;  1EUJ A;  1Q90 A;  1MI2 A;  5KNC A;  1HR0 W;  3J81 i;  2VQF Q;  4AYB E;  2EPB A;  1STG A;  5A2Q E;  4LNQ A;  3KLW A;  3MHB A;  5E4W C;  4IPC A;  2L15 A;  3A8I E;  3Q6S A;  1RTN A;  3L3O C;  5L37 A;  2JXM B;  1JE4 A;  1V1Q A;  1ENA A;  3H0G B;  3KJO A;  2RKS A;  3D3R A;  1SYC A;  1E1T A;  1PTO D;  4R4O A;  3J81 E;  1IL2 A;  4HMI A;  4HCS A;  1SNM A;  3CPF A;  5GAD C;  1D2B A;  1J5E L;  1JQY D;  1EU3 A;  1STY A;  1AEX A;  4JI0 Q;  1D5X C;  2MP1 A;  3K8A A;  1J6Q A;  3K5L A;  5BN5 A;  1YJ9 A;  4MTN A;  2LFN A;  3TZU A;  5IGD A;  1AE2 A;  4A3J H;  5C4J H;  3HOX B;  2JK8 A;  2YU9 H;  1A15 A;  1R9T H;  5M5W B;  2MGS A;  3BYT B;  4KLK A;  4IFD I;  1M8A A;  3TBI B;  2WII B;  4MNO A;  2L5T A;  3RZD H;  1BR9 A;  1WVL A;  2L11 A;  4IZ8 A;  1LT4 D;  3S2H H;  2QEJ C;  4P72 A;  1XNQ Q;  4A3J B;  2EY6 A;  4C2M B;  3H09 A;  3NUC A;  1JWU D;  3HOZ G;  2PW7 A;  1EQR A;  2O4X A;  2D5D A;  5LMU Q;  2UXB L;  2NVT B;  4X62 Q;  1HUM A;  1M4V A;  2UU9 L;  2WKC A;  1S5E D;  4X66 L;  1YHA A;  2NZH A;  2KQ3 A;  3UE1 A;  4CHT B;  2UXC Q;  2KCT A;  1STH A;  1OO9 B;  1K8G A;  1YNJ D;  1U4R A;  2FIN B;  4LF4 Q;  4LF9 Q;  3IKJ A;  4EVO A;  2VUM G;  4R4Q A;  1J5E Q;  4LFC L;  4H13 C;  1FR3 A;  3SVM A;  3KF8 B;  1IXR A;  3A0J A;  1RD9 D;  1U4M A;  1TT2 A;  3ULJ A;  1IBL L;  1UE6 A;  4YWM A;  1KDA A;  1E24 A;  2R7Z G;  3CC4 A;  2HCC A;  2EYM A;  4FDB A;  4JI1 Q;  4GS3 A;  4CGY B;  1EYA A;  2N49 A;  1D6E C;  1X3E A;  4EX5 A;  2Y0S G;  2H5X A;  2PQA A;  4HJ7 A;  3FVQ A;  2DUD A;  2Z8L A;  4YY3 L;  2F3W A;  4NMZ A;  3I4L A;  2HIV A;  4X3K A;  3QR8 A;  3I4M H;  2C5C A;  5C3E G;  1KNE A;  2D2C C;  2DNE A;  1NTG A;  1DON A;  4XQJ A;  2WAC A;  1SR3 A;  1N34 Q;  1E7Z A;  1SXT A;  4DK6 C;  1PZJ D;  1EY9 A;  1F77 A;  3VR5 A;  4KKU A;  1IYV A;  4GNX C;  3QG1 A;  1NMF A;  4ZKC B;  4BY1 G;  5KGU A;  5JPM C;  2IY5 B;  2DNC A;  4DV2 Q;  3K59 A;  4JI5 Q;  4LJZ C;  4BWG B;  3K7U C;  3T16 A;  2A6E D;  5D14 A;  4YHH L;  2NBF A;  1EYG A;  3MA2 B;  2A19 A;  2QF7 A;  4K6L A;  2NUC A;  1UAP A;  1O80 A;  3TZD A;  4A75 A;  1B3Q A;  1SNQ A;  3AMU A;  3M4O H;  2WAQ E;  4RCO A;  3J7Z C;  4POF A;  3TRZ A;  2DN8 A;  2M00 A;  3F2U A;  2PMZ E;  2VZA A;  4RKL A;  2H4O A;  1EU4 A;  1KL9 A;  1TQO A;  3NK9 A;  3FMC A;  3PUW A;  2CVR A;  3E0E A;  1EY4 A;  3I55 A;  5GAG C;  1NMG A;  3CF5 A;  2NVX H;  3OW7 A;  1SYD A;  1HNZ Q;  1IKM A;  3RR5 A;  2I5M X;  3HOY B;  5DLQ E;  4QIW E;  1Y8O B;  4FXD A;  3PUX A;  4A3F H;  3CP0 A;  1HCZ A;  2SNS A;  5M3M B;  4DR7 Q;  4IN3 A;  2PW5 A;  5J39 A;  2L4N A;  2KUM A;  3QB3 A;  2Q2I A;  3ND9 A;  1S3O A;  2YTX A;  3PO3 H;  4R9W A;  1PH3 A;  1AH9 A;  2KBN A;  2R3Z A;  4YCU A;  4LF6 L;  4IPD A;  2OXP A;  5J22 A;  3TP7 A;  2JA6 H;  4LFB Q;  2JQO A;  2VQE Q;  2EYJ A;  1AP0 A;  4ZUI A;  4DR1 L;  3H3V I;  3Q22 A;  4A3K G;  1PH5 A;  2A69 D;  3OPO A;  3RMH A;  1E22 A;  4G57 A;  3DHQ A;  2GA4 B;  1Z7T A;  1UE1 A;  3OIP A;  1KC8 C;  1CT1 D;  5J1Z A;  2MHV A;  2EYO A;  1JOO A;  3EN2 A;  1O7Y A;  2LSS A;  1HRJ A;  1EWC A;  2JA5 G;  3H0G H;  1A8V A;  3ULP A;  1WTP A;  2E2D C;  3DEO A;  1AZQ A;  4DV0 Q;  3VR4 A;  2E2H H;  5FLX L;  2QEX A;  2VQE L;  1GUN A;  4YWK A;  4MN3 A;  3U4Z A;  1EQQ A;  1F2L A;  1JWS D;  2XN9 C;  2NVY B;  2F0W A;  3GTK H;  4C3I B;  5C4X G;  3M4Q A;  5JEA H;  5C6A A;  3H15 A;  4GNX B;  1E3P A;  2ZTD A;  1B44 D;  4K8I A;  4A3M H;  4KD3 A;  4A3C H;  1X3Q A;  4ME3 A;  4CDC C;  4P74 A;  3P7J A;  5M9O A;  2L12 A;  1CZW A;  4IUQ A;  1B7Y B;  5DNF A;  1MD2 D;  1QVG A;  5DAU A;  3PO2 H;  3M7N A;  4FO2 A;  4OWW B;  1HTL D;  2BE5 C;  3MAQ A;  3CCL A;  1DCZ A;  4UP7 A;  1VQM A;  1UE7 A;  1RIP A;  1K83 B;  1VQA A;  2IW3 A;  1N33 L;  5KRU A;  1OXV A;  1X3F A;  1IL8 A;  3TME A;  4CDE C;  3OOC A;  4WJW A;  5T1I A;  3HKZ B;  4DR1 Q;  2OT2 A;  4A3B B;  1PFM A;  3I91 A;  3J81 L;  1PDQ A;  2IX3 A;  3K58 A;  2PPB C;  2SDF A;  4DUZ L;  4ZRZ A;  4KK7 A;  1S40 A;  2EY5 A;  2ZTE A;  1DD2 A;  1F9R A;  4CDD C;  3F1Z A;  2F0J A;  2K1B A;  1JMC A;  4CJ1 B;  2F0N A;  4UAI A;  4PZ6 A;  1R4Q B;  4CKE A;  2CKZ B;  3GTL H;  3CCU A;  1K3B C;  1VF7 A;  3U58 A;  1K3R A;  4C3H G;  3CXC A;  3DM1 A;  4DK0 A;  1PRT D;  2F0I A;  1Y8N B;  2EYF A;  4RCN A;  3CCJ A;  1ICW A;  4DXG A;  4G7Z C;  5DM7 3;  1N33 Q;  3MTS A;  1PYS B;  1TWH H;  2D0O A;  3GD7 A;  5C5L A;  4ZQ3 A;  1UWV A;  4HID A;  1TII D;  5JJI A;  1KXL A;  4LF9 L;  1KLU D;  3VYU A;  5M5Y H;  3MFG A;  4B3S Q;  4ZUJ A;  2EDG A;  1PZK D;  5KIX A;  4C3H H;  1EIG A;  1NY4 A;  4Y7N B;  1AN8 A;  1F2Z A;  1Z47 A;  4JBJ A;  3TRE A;  4AH6 A;  1WCM G;  1TWC H;  2C9O A;  1EYD A;  2UU9 Q;  3K7A B;  3TS2 A;  1LYL A;  2B2Y A;  1Y8P B;  1XMQ Q;  4IQZ A;  3PIP A;  5E7N A;  5C4H A;  4X6A H;  1CKM A;  1WCM B;  5M5X H;  4UP9 A;  4JI5 L;  1HZA A;  4B9X A;  3GV3 A;  2PZT A;  5IE8 A;  4EQ5 A;  1RKN A;  1N36 Q;  4L63 B;  5JJL A;  1XNR Q;  1B50 A;  3FDT A;  1NE3 A;  3F2C A;  3M4O B;  4GZY C;  4FF4 A;  5FLM H;  4X66 Q;  3PF5 A;  1KD1 C;  3G6J B;  1EQT A;  4YCW A;  4B3M L;  2F0O A;  3SR1 A;  1ZXT A;  3ITP A;  5IYC G;  5C4X B;  4JV5 Q;  5C4Z A;  2X69 A;  3SGI A;  1ESF A;  2I5L X;  3PV0 A;  2IJ0 A;  3KLS X;  1XPO A;  1LO5 D;  3K0X A;  4UP8 A;  2E2I H;  1Q1B A;  2UXD L;  4FXK C;  5IGB A;  1H9S A;  2NZ1 D;  2SOB A;  4GKK L;  2F0V A;  4XTC S;  4IJL A;  3NE5 B;  2B2T A;  3PF4 A;  1XMO Q;  1IW7 D;  4OO1 G;  2RF4 A;  3FKI H;  1N32 Q;  3KFU A;  1G2T A;  1SE8 A;  1MJC A;  4LFB L;  2EJF C;  3NEM A;  1RDP D;  1VS0 A;  3I7F A;  2XRQ D;  1ROD A;  4NDX A;  4K2L A;  1A6X A;  1Z6H A;  2WB1 G;  1BCP F;  3K7A H;  2RVL A;  3A8K E;  2X6L A;  3RLN A;  1CZG A;  4XXE A;  5M3F B;  1FYC A;  1O7L A;  3PGZ A;  1V1P A;  2ICE C;  4DV3 L;  5TSS A;  5C0X G;  2RA4 A;  1HNW L;  4V19 0;  1WFQ A;  4RGN A;  1SMY D;  3ER0 A;  3T13 A;  1HFN A;  1GD7 A;  1L0X B;  3I3C A;  1PH7 A;  2E75 C;  2PNH A;  2ICI A;  1E2W A;  1CKN A;  1ASZ A;  4DUY L;  4WRD A;  1GXD C;  4DAM A;  4DUY Q;  3F2B A;  3EIV A;  1HJP A;  2JA6 G;  3KYH C;  4IJH A;  4DR5 L;  3MZ5 A;  2PO4 A;  2NVQ B;  4X64 L;  2B63 G;  3KUP A;  4H7B A;  5JVH 3;  1W6K A;  3UDG A;  4LF5 L;  2IX1 A;  4A3L H;  4A93 H;  3IAY A;  1L1O B;  4RHS A;  1PYB A;  3PIP 3;  1ONL A;  5K36 H;  3HOX G;  1GM5 A;  1FJG L;  4KI0 A;  2BDO A;  5EPL A;  4A3E H;  3J7A 5;  1NR4 A;  1CQV A;  2JSO A;  5ELE A;  1VQ5 A;  3BVG A;  5KYL A;  1E1O A;  5KEE A;  1T5X D;  1S72 A;  4KMU C;  3T1H Q;  2WAQ B;  1FNU A;  5I6W A;  3RLF A;  3H94 A;  1CA6 A;  2Z6K A;  1BVS A;  1HQR D;  3GTG B;  1XMQ L;  2J7Z A;  4UHV A;  4Z9C B;  1BDO A;  5CV9 A;  4F8M A;  1VQK A;  2QDL A;  3GV6 A;  1IHZ A;  4JI4 Q;  4HJ5 A;  1D1I A;  4M1U B;  2VQF L;  5E4X A;  1W2B A;  4C3I G;  3NXW A;  4JYA Q;  5GAE C;  3W2D A;  4NXN L;  3A5Z B;  3S1M H;  1EIH A;  3A7A B;  4OO1 H;  1DJR D;  3DWA A;  2VUM B;  1FD7 D;  1XMO L;  1I50 B;  1SNP A;  3OTO Q;  4DV1 L;  1VQ7 A;  5EBC A;  2B2V C;  2R7D A;  4DFA A;  5EGT A;  4FNF A;  1Q46 A;  2Q2H A;  4ZAI A;  3S1Q H;  2Z4I A;  3OHX C;  2A1A A;  1FNV A;  4N9P A;  4H0L C;  3W1B A;  4BBR H;  3DLL A;  1MHW C;  4DK3 C;  4A3E B;  2CCZ A;  1WTR A;  1VQH A;  1NCV A;  2NN6 I;  3OSO A;  1Y1W G;  5LMN Q;  4L5S A;  2IPK D;  4BBR B;  1XNQ L;  4EQN A;  4UDU C;  4OL7 A;  4ZLT F;  1V8Q A;  4JI3 Q;  1XX8 A;  5FKA C;  2R93 G;  4DPG A;  2F0F A;  4B3S L;  5I6Y A;  4JI7 L;  2Q2U A;  2NWG A;  5KYI A;  1XXG A;  1PLF A;  4UPA A;  5EPJ A;  5D3I B;  4DR7 L;  5JEA G;  4BXX H;  1CQF A;  4P2C B;  2IT1 A;  4JW0 A;  4EQP A;  1RHP A;  2EVB A;  1IW7 C;  4LF8 L;  3OW2 A;  1L1O C;  1LAB A;  2HDM A;  2CW0 D;  4JBW A;  1BBW A;  1PRT B;  2G5D A;  5IGE A;  3URY A;  4BY7 B;  1I4H A;  4NB3 A;  4RKB A;  5BR8 L;  1B1Z A;  1MJE A;  2N78 A;  1HFG A;  3H0G G;  4HJ8 A;  4O2D A;  5CMD A;  3LGJ A;  1VQO A;  1I4Q A;  4JG2 A;  4PQX A;  1S5F D;  4B9W A;  2EIF A;  3S14 H;  3SK6 A;  1E2Z A;  1EYC A;  2XTI A;  5JJZ A;  3D6C A;  3U4V A;  5LL6 X;  2N88 A;  3RZO B;  2F0U A;  1KLG D;  3L0O A;  1ILP A;  1B2T A;  3KLS A;  4YCV A;  4DV2 L;  2D0P A;  2V4D A;  2F0L A;  3CCE A;  1I94 L;  3E6Z X;  2VNU D;  2K6A A;  5C44 B;  1I94 Q;  4AQY Q;  1YHQ A;  1SYB A;  4X3T A;  4DUZ Q;  2Z6B A;  1PH2 A;  3K5O A;  4OWX B;  2X6G A;  1KDC A;  1K8A C;  1TY0 A;  3GP7 A;  1ZEQ X;  1PVO A;  3W1G A;  4DAP A;  1YJN A;  3TQY A;  3MXN B;  4MZ9 A;  3VYR A;  1KIX A;  3GDE A;  2LXK A;  5FJ8 H;  2E5L Q;  4P71 A;  1QOH A;  1QUQ A;  2MJ8 A;  4BY1 B;  1N36 L;  1QWY A;  1AW7 A;  3KBG A;  3CCS A;  1HNX L;  1X6O A;  5T1G A;  3KDF A;  2JN4 A;  3J80 L;  4OIK A;  4IOA A;  4CKB A;  2TSS A;  1LTB D;  2AQ2 B;  5BN3 A;  1VQE A;  2JA5 B;  3UE0 A;  2MNA A;  2WFW A;  2N55 A;  2BA1 A;  1F9S A;  4YHH Q;  4BS9 A;  5LMU L;  1YHB A;  3NBH A;  4ID6 A;  2J4X A;  1UEB A;  3S1R H;  2R7F A;  1QVC A;  2B29 A;  2KCM A;  2F4V Q;  4H02 A;  1R4P B;  2A5H A;  4RMF A;  1CKN B;  1G8Z D;  2WKD A;  1I4G A;  2YTY A;  1VQB A;  1XJV A;  4BXX G;  1HH2 P;  4JI3 L;  1U4P A;  2MO1 A;  3PUZ A;  4XYQ A;  2CHB D;  3FPU B;  4CJ0 B;  1Q81 C;  2K28 A;  4RA8 A;  1TS5 A;  1Y1V G;  3NWS A;  1IKL A;  2UXB Q;  4K8J A;  2O2L D;  1KAW A;  2ZM6 Q;  2K05 A;  4GN3 B;  1DOL A;  2CQA A;  2KVM A;  4JYA L;  1EZ8 A;  3DM3 A;  3FRP B;  2IX0 A;  3ERS X;  3GTJ B;  5COY A;  4DA2 A;  1ASY A;  4A3I B;  1RL2 A;  2RHS B;  3BVM A;  3K5N A;  4A3G G;  1D8L A;  1F2Y A;  1JC7 A;  4DU9 A;  1YVC A;  3S9W A;  1QZG A;  1GHJ A;  4A3K H;  1B4O A;  3G6E A;  1KAA A;  3GTJ H;  3P1H A;  2EQS A;  1R9T B;  3HOW H;  1PH1 A;  4RGM A;  1VCI A;  3S1Q B;  4YY3 Q;  3RLO A;  2K5V A;  2L9H A;  1PV4 A;  4JI0 L;  1VQN A;  4ZYS A;  5CBA E;  2BCO A;  4JVZ A;  2JA6 B;  1RCV D;  1PH8 A;  2FMC A;  4A3M G;  4KHP Q;  1HZC A;  2AUK A;  3J80 i;  5IYB G;  3NHH A;  1I50 H;  3VDY A;  4ILW A;  4OIJ A;  2PNR C;  2QCP X;  1VDZ A;  4J1M A;  2XVS A;  1JJG A;  3L2P A;  4OHJ A;  1WTH A;  1QG7 A;  3W5O A;  5CV5 A;  2BE5 D;  2PZU A;  4C3J B;  3MVV A;  4Y7N H;  1TWC B;  2K01 A;  3KDF B;  3BZK A;  1LT5 D;  2B2U A;  2B2W C;  4ABN A;  1STN A;  1K8M A;  1DOM A;  2WAQ G;  3M9B A;  3A74 A;  4IUU A;  2F52 A;  4K2K A;  3TEH B;  2OF1 A;  2CH4 A;  4NP5 A;  3GTG H;  3HG9 A;  2OTJ A;  4APV A;  3K0Y A;  2EE1 A;  3S2D B;  3G71 A;  3EBE A;  1QZH A;  1VF5 C;  3TSS A;  3SK4 A;  2CH4 W;  3G48 A;  4JOI A;  4MTK A;  5CYU A;  3RUZ A;  3SK8 A;  4BY1 H;  1GOZ A;  3GTP H;  1UNS A;  3CU7 A;  1MIU A;  4KY7 A;  3HOY H;  5IGG A;  1V43 A;  1U0L A;  3T56 B;  1PRT F;  3HRZ C;  4HN7 A;  3PO3 G;  1PFN A;  1IBM Q;  1NSN S;  5C3W A;  3DEP A;  2NN6 G;  3HZX A;  3JC6 6;  2JYO A;  2Q8R E;  1K0R A;  2AUJ D;  3S2H B;  1T5E A;  2L55 A;  2ZXO A;  3S1R B;  3HP3 A;  5IGC A;  2F3I A;  1KTK A;  1HTP A;  3CD6 A;  1KDB A;  1P8L A;  1WTO A;  2RBM A;  2RCF A;  3FHW A;  3PCO B;  4PNY A;  2VB2 X;  2JA8 B;  1NNX A;  3EQL C;  4O0A A;  1CUK A;  1QIL A;  4BBS B;  1A63 A;  3HKZ E;  3TP6 A;  1AE3 A;  1BBU A;  4QJF A;  5CV6 A;  4C56 C;  4FF3 A;  2F0G A;  4ZCK A;  4HED A;  2IHE A;  1DYQ A;  1G29 1;  2R92 H;  3UDI A;  3A7L A;  2K5W A;  1SRO A;  4CJ2 C;  5IT9 L;  1ZKO A;  4DF7 A;  1C9O A;  1JIC A;  3ZYY X;  5KNB A;  4GKJ Q;  1H95 A;  2QA4 A;  3BVZ A;  3HOY G;  1SNO A;  1QE6 A;  4HIK A;  1TXY A;  1HR0 Q;  1HA6 A;  3I4O A;  3GTP B;  1VQ9 A;  3F8T A;  5AJ3 L;  3R8B A;  1TWA H;  5LMN L;  4J8Q A;  1SN8 A;  3I4N B;  1SFO H;  5LMN W;  4Q5V A;  4C3H B;  4Q0F A;  1E0B A;  5DM6 3;  2JA5 H;  2MUY A;  5FO7 B;  4C2M H;  4U67 3;  1KHI A;  1I6H H;  5IYB H;  2D62 A;  4PMB A;  1QNU A;  3I8Z A;  1WD1 A;  4LW1 A;  1YBY A;  5EJW A;  3K6O A;  2F0S A;  2KEC A;  1YZ6 A;  2Q8I B;  4KY5 A;  4MIU A;  1BF4 A;  3E5S A;  3R2T A;  1TS2 A;  2B63 B;  3LX0 A;  4LF4 L;  1QNK A;  2YTV A;  1YI2 A;  1VQ8 A;  3H3V H;  3UDF A;  3NQI A;  4HIO A;  3U9O A;  2R93 H;  4GNX A;  4OX9 L;  1ET6 A;  1TKW B;  4FF1 A;  1ZYR C;  3H91 A;  3C46 A;  1JE5 A;  1ICF B;  1VQF A;  1EY7 A;  4KHP L;  4DV4 L;  2K7V A;  1VMC A;  4R4T A;  1JJ2 A;  3D6W A;  3JAM E;  2JA8 G;  3HOW G;  4QCL A;  2KCC A;  5GQO A;  3FPP A;  1IZ6 A;  2I46 A;  3SXH A;  1Q86 C;  4DR6 L;  3STB C;  2O5J C;  3SE0 A;  1CSQ A;  2F0M A;  1CSP A;  3MXP A;  4TQU S;  2RHQ B;  4IAL A;  3SEB A;  1YEZ A;  4K5V A;  1WCM H;  3QWN A;  3G4S A;  2KCN A;  1SJE D;  1H9K A;  2EYH A;  1JR0 D; 
#chains in the Genus database with same CATH homology
 2JEB I;  2UXB L;  2E2J H;  2GN5 A;  1L0W A;  4A3E G;  4HJ5 A;  4X62 Q;  1IBK L;  2UU9 L;  4X66 L;  1YHA A;  2VQF L;  5IP7 G;  1HZB A;  1W2B A;  3PUY A;  2NZH A;  4JYA Q;  5GAE C;  1U5K A;  3HFZ B;  4NXN L;  4JC0 A;  3A5Z B;  3S1M H;  3UE1 A;  4B3T L;  4Y52 H;  2UXC Q;  2KCT A;  4DV1 Q;  1XMO L;  3GTO H;  4DAY B;  2B63 H;  4DV1 L;  3OTO Q;  1Q12 A;  2HQL A;  4OON A;  4LFA Q;  3J80 c;  3CME A;  1K8G A;  1VQ7 A;  4LF4 Q;  4LF9 Q;  2JA7 H;  1GKH A;  2R7D A;  2XGT A;  4K0K Q;  2NVQ H;  1Q46 A;  2Q2H A;  1OXT A;  3GO5 A;  2VUM G;  4GKK Q;  4R4Q A;  3CMA A;  2CFM A;  4LFC L;  1J5E Q;  2UUB Q;  3S1Q H;  2JA9 A;  5C44 H;  2PI2 E;  3WWV A;  3KF8 B;  1IXR A;  2A1A A;  3A0J A;  3W1B A;  3ULJ A;  2F4V L;  4BBR H;  3DLL A;  1IBL L;  1UE6 A;  3JAM i;  2VW9 A;  4YWM A;  4DK3 C;  3RN5 A;  4A76 A;  1E24 A;  2CCZ A;  3CC4 A;  1VQH A;  2Z6K C;  3K81 C;  2NN6 I;  5IT9 c;  1XTD A;  2N8N A;  4OX9 Q;  2UUC Q;  5C0X I;  1Y1W G;  4FDB A;  1C0A A;  2LXJ A;  4JI1 Q;  3HOX H;  5LMN Q;  2R6G A;  4GS3 A;  1PH6 A;  4IFD G;  4L5S A;  3ZJY C;  2N49 A;  2OTL A;  1XNQ L;  3RN2 A;  2KEN A;  5GAH C;  5M3F G;  3S24 A;  4POG A;  1X3E A;  5FLM G;  4BY7 H;  4EX5 A;  2Y0S G;  5IP9 H;  4JI3 Q;  2H5X A;  2PQA A;  4HJ7 A;  4UY8 C;  4YY3 L;  2DUD A;  4DR6 Q;  2R93 G;  2ZTC A;  4JI8 L;  4DPG A;  1A0I A;  2HIV A;  4B3S L;  3I4M H;  5C3E G;  3PIO A;  4JI7 L;  3M4P A;  2Q2U A;  2ZJP A;  1NTG A;  5GRO A;  1VQ6 A;  1Q7Y C;  1N34 Q;  1EWI A;  1P16 A;  1SR3 A;  4UPA A;  4DR7 L;  1E7Z A;  2MO0 A;  5JEA G;  4BXX H;  2K52 A;  4DK6 C;  3NEN A;  2MFI A;  2MQH A;  2IT1 A;  4X65 L;  4DV5 Q;  4DV7 L;  3HOZ H;  4GNX C;  4LF7 L;  1XNR L;  1NMF A;  2ASB A;  4BY1 G;  2IY5 B;  4LF8 L;  4DV2 Q;  3OW2 A;  2OTJ A;  1L1O C;  2KHI A;  4GLV B;  4GN5 A;  4JI5 Q;  1V9P A;  4JBW A;  1BBW A;  2OCE A;  4A3D G;  1YNX A;  3K7U C;  3J81 j;  5M3M H;  2VY3 A;  4YHH L;  2OQ0 A;  4NB3 A;  4OXP A;  1EYG A;  4DR4 Q;  5BR8 L;  2K75 A;  2A19 A;  3CCV A;  1MJE A;  2N78 A;  1VQL A;  2UUA Q;  3H0G G;  4HJ8 A;  4O2D A;  4A75 A;  1PH9 A;  1XPR A;  3I4M G;  3HKZ G;  2WAQ E;  1EIF A;  3LGJ A;  3J7Z C;  1VQO A;  3M4O H;  4JV5 L;  4JG2 A;  4POF A;  1K73 C;  3TRZ A;  4LF6 Q;  2Q2T A;  2AKW B;  2EIF A;  2PMZ E;  3S14 H;  2VZA A;  1OXX K;  4BBS G;  4WJ3 M;  1KL9 A;  2BA0 A;  2XTI A;  1LUZ A;  1O7I A;  2JJQ A;  3PUW A;  3U4V A;  2HHH L;  1YIT A;  1FL0 A;  1X65 A;  3E0E A;  1NJI C;  3I55 A;  5GAG C;  1NMG A;  3CF5 A;  3L0O A;  2NVX H;  3CQZ H;  4PZ8 A;  1IYJ B;  1HNZ Q;  4YCV A;  3RR5 A;  2I5M X;  2D0P A;  2ZJR A;  1SRU A;  5DLQ E;  5FLX c;  4DV2 L;  1OXS C;  4QIW E;  3D31 A;  3S15 H;  3CPW A;  3CCE A;  3PUX A;  4DR3 L;  4A3F H;  1B8A A;  1I94 L;  3CP0 A;  2VNU D;  4LUO A;  4DR3 Q;  4AQY Q;  1I94 Q;  4P73 A;  1YHQ A;  1M1K C;  1OTC A;  3Q8D A;  4DR7 Q;  4DUZ Q;  2JA7 G;  1HNX Q;  5ELO A;  1PH2 A;  2Q2I A;  2HHH Q;  1S3O A;  1NBW A;  2YTX A;  3CAM A;  4OWX B;  5AJ3 Q;  4IOC A;  3PO3 H;  4AQY L;  2K5H A;  4GLA C;  1PH3 A;  1K8A C;  1AH9 A;  2KBN A;  1Q1E A;  4X65 Q;  4YCU A;  4LF6 L;  1PVO A;  3W1G A;  4IPD A;  1YJN A;  1A62 A;  3TQY A;  4NXM L;  2JQO A;  3MXN B;  2JA6 H;  4LFB Q;  4MZ9 A;  2VQE Q;  3RZO H;  1KIX A;  3GDE A;  2LXK A;  5FJ8 H;  1SMX A;  2E5L Q;  4JI7 Q;  4P71 A;  3OTO L;  1QUQ A;  4DR1 L;  4GOP A;  3H3V I;  3AFP A;  4HIM A;  4A3K G;  1N36 L;  2FXQ A;  4JI8 Q;  1PH5 A;  3HOV H;  3CCS A;  1HNX L;  1X6O A;  3KDF A;  1E22 A;  5HY6 A;  4IOA A;  1PA6 A;  4BA2 I;  1VQE A;  1UE1 A;  4DV6 L;  3UE0 A;  2MNA A;  2AMC B;  2DGY A;  2WFW A;  5J3B A;  4DV5 L;  4DV7 Q;  1VQP A;  1KC8 C;  2BA1 A;  4YHH Q;  3EN2 A;  4A3B G;  2OQK A;  2LSS A;  5LMU L;  1YHB A;  4PMW A;  5IWA L;  3STB D;  4DKA C;  2YYZ A;  3B6Y A;  3A5U A;  1UEB A;  3S1R H;  2KHJ A;  2R7F A;  2JA5 G;  1QVC A;  3H0G H;  3KF6 B;  2B29 A;  1A8V A;  2KCM A;  4ALP A;  3ULP A;  1KQS A;  4NPS A;  1G6P A;  2NVY H;  4L5T A;  4A3I G;  3HKS A;  2F4V Q;  4H02 A;  2JA8 H;  1T9H A;  1LTL A;  1MKH A;  4RMF A;  1CKN B;  5FJ8 G;  2YTY A;  4DV0 Q;  2QEX A;  1VQB A;  2VQE L;  2ID0 A;  1XJV A;  2E2H H;  1HH2 P;  4JI3 L;  2UUB L;  2MO1 A;  2BH8 A;  3PUZ A;  1UE5 A;  4YWK A;  3U4Z A;  4A4I A;  4BBR G;  1Q81 C;  5C3E H;  1EQQ A;  4R4I A;  4LWC A;  1Y1V G;  3GTK H;  5C4X G;  4DR4 L;  1YJW A;  2UXB Q;  3M4Q A;  2ZM6 Q;  1KAW A;  3S17 H;  3H15 A;  2Z0S A;  1E3P A;  4GNX B;  4BXX G;  2ZTD A;  1EFW A;  4A3M H;  4GN3 B;  4B3R L;  4DNI A;  2B3G A;  2WP8 J;  4A3B H;  2NZO A;  4JYA L;  4GOP C;  3DM3 A;  4A3C H;  4ME3 A;  3ERS X;  1FGU A;  1W3S A;  2IX0 A;  1L1O A;  1X54 A;  4P74 A;  5IYC H;  1ASY A;  4R1J A;  5IP9 G;  1B70 B;  3KJP A;  1B7Y B;  1RL2 A;  2RHS B;  3M3Y H;  1K83 H;  3E9H A;  4A3G G;  3M85 A;  3HOU G;  1D8L A;  1QVG A;  3PO2 H;  1YVC A;  5M3F H;  1QZG A;  1WI5 A;  2JEA I;  3M7N A;  1TWG H;  4A3K H;  3HOV G;  3S16 H;  4OWW B;  3CCL A;  1OXU A;  3G6E A;  3F2D A;  3GTJ H;  2EQS A;  4UP7 A;  3AQQ A;  2GVB A;  1VQM A;  3HOW H;  2E5L L;  4GN4 B;  1UE7 A;  1PH1 A;  1VCI A;  3JAM c;  4YY3 Q;  3L7Z C;  2GVA A;  3RLO A;  2K5V A;  1RIP A;  4AIM A;  4GLX A;  5H1S E;  4WJ4 A;  4RG1 A;  5EAY A;  1PV4 A;  1HNZ L;  4JI0 L;  1VQA A;  1VQN A;  4B3R Q;  4QGU A;  1M90 C;  1N33 L;  4K0K L;  2HIX A;  1OXV A;  4DV0 L;  1PH8 A;  4A3M G;  4KHP Q;  1HZC A;  1X3F A;  3J80 i;  5IYB G;  4X62 L;  4L5Q A;  5BR8 Q;  3UDX A;  2K4K A;  4DR1 Q;  1I50 H;  1BKB A;  2YV5 A;  4A3C G;  4LUZ A;  2CQO A;  3VDY A;  4DUZ L;  3RNU A;  1QVF A;  1S40 A;  2ZTE A;  1JJG A;  4R4C A;  3L2P A;  4LF8 Q;  4BA1 I;  1PFS A;  1DGS A;  3W5O A;  3F1Z A;  4DV4 Q;  1JMC A;  4IPH A;  4DV6 Q;  3CC2 A;  4A3D H;  4GOP B;  2A8V A;  4Y7N H;  1X55 A;  5IYD H;  4PZ6 A;  1Y1W H;  2CKZ B;  1HZ9 A;  3KDF B;  3BZK A;  3GTL H;  3CCU A;  5IWA Q;  3U58 A;  1K3R A;  3CXC A;  1IBL Q;  4JCV E;  2WAQ G;  4A3L G;  3M9B A;  2R92 G;  3A74 A;  3FP9 A;  3CCJ A;  2F52 A;  3TEH B;  4BBS H;  1N33 Q;  3D0F A;  3NBH B;  3GTG H;  1PYS B;  3GD7 A;  1TWH H;  2D0O A;  1Q82 C;  2RCN A;  4APV A;  1UWV A;  1VQD A;  1N9W A;  2PQA B;  2K50 A;  3CCR A;  4HID A;  3KF6 A;  2UUA L;  4IFD J;  4OO1 I;  5JJI A;  4QL5 A;  4LF9 L;  2JE6 I;  1JB7 A;  5M5Y H;  1KXL A;  3G71 A;  1VQI A;  4B3S Q;  4JI4 L;  3EBE A;  4TVA B;  3CCQ A;  1QZH A;  2HT1 A;  2ALY B;  4C3H H;  3TS0 A;  2K14 A;  1NY4 A;  3G48 A;  4C3J H;  4JOI A;  4XIG S;  1Z47 A;  4JBJ A;  3TRE A;  4AH6 A;  4BY1 H;  3ICE A;  1WCM G;  1TWC H;  3GTP H;  1IBK Q;  2UU9 Q;  3TS2 A;  1MIU A;  1LYL A;  4LUV A;  1XMQ Q;  3HOY H;  2I0Q A;  3PIP A;  1V43 A;  1U0L A;  3NEL A;  5E7N A;  4X6A H;  2ATW A;  1CKM A;  4LF5 Q;  3PO3 G;  5M5X H;  4UP9 A;  4JI5 L;  1HZA A;  4X64 Q;  1IBM Q;  5IE8 A;  2VL6 A;  4J15 A;  1YIJ A;  1FVI A;  5JEA J;  4AYB G;  3BU2 A;  2NN6 G;  4EQ5 A;  1N36 Q;  3JC6 6;  5JJL A;  1XNR Q;  1K0R A;  4BY7 G;  4P75 A;  1NE3 A;  4JBM A;  2N3S A;  3I2Z A;  4IO9 A;  2F3I A;  3S2D H;  1D7Q A;  3F2C A;  4LFC Q;  2CWP A;  3CD6 A;  3IRB A;  1P8L A;  3KOJ A;  4A3F G;  4OWT B;  2OWO A;  3FHW A;  1FJG Q;  3PCO B;  1SLJ A;  1N32 L;  5IP7 H;  1HNW Q;  5FLM H;  4X66 Q;  3PF5 A;  1KD1 C;  1N8R C;  1PH4 A;  2IHF A;  4YCW A;  4O0A A;  1CUK A;  1A63 A;  4B3M L;  3HKZ E;  3PO2 G;  4B3T Q;  3AYH B;  1AE3 A;  1BBU A;  4QJF A;  1EIY B;  5IYC G;  3FKI G;  4JV5 Q;  2QGQ A;  3SGI A;  2R7Z H;  1VQ4 A;  4A3G H;  4DR2 Q;  2I5L X;  3PV0 A;  1LM0 A;  4PG3 A;  1XPO A;  3HOU H;  1TWF H;  1Z9F A;  3K0X A;  1N34 L;  4UP8 A;  5C44 G;  1I3Q H;  1HR0 L;  4JI1 L;  2E2I H;  1Q1B A;  2UXD L;  2IHE A;  4JOI C;  5M3M G;  1G29 1;  4GKK L;  2R92 H;  3CW2 C;  3UDI A;  5C4X H;  3PSI A;  4XTC S;  4IJL A;  4QY7 A;  4C3I H;  3GTQ H;  1SRO A;  1C9O A;  5M5W H;  4DR5 Q;  2ZJQ A;  4HJ9 A;  4B3M Q;  1XMO Q;  3PF4 A;  4GKJ Q;  1CKO A;  2RF4 A;  3FKI H;  4OO1 G;  1X9N A;  1H95 A;  2QA4 A;  1Y1V H;  4QQB X;  1IBM L;  2WB1 E;  1N32 Q;  4YWL A;  3KFU A;  1SE8 A;  1MJC A;  4NXM Q;  4LFB L;  4PZ7 A;  3NEM A;  3HOY G;  5IY0 A;  5IYD G;  1WYD A;  5K36 G;  4HIK A;  3I56 A;  1TXY A;  1VS0 A;  1VQC A;  1VQG A;  3I7F A;  1HR0 Q;  3I4N G;  3T1H L;  3I4O A;  3GTM H;  1VQ9 A;  2Y0S E;  4GKJ L;  3F8T A;  5AJ3 L;  3MEF A;  1QUQ B;  1TWA H;  1VQJ A;  2WB1 G;  2EXD A;  3K7A H;  5LMN L;  3OYY A;  2V1C C;  2BH2 A;  3RLN A;  1SN8 A;  4JI2 L;  1JT8 A;  4NXN Q;  4JBK A;  1X3G A;  4A3I H;  4JI2 Q;  2AWN A;  1SFO H;  5LMN W;  3BJU A;  3J81 c;  2UXD Q;  1KRS A;  4KHZ A;  3PGZ A;  4DV3 L;  2JA5 H;  1Q8K A;  2C35 B;  1G51 A;  5C0X G;  4DV3 Q;  3T1Y L;  4C2M H;  3U50 C;  1HNW L;  1KHI A;  1WFQ A;  5ELN A;  3I4N H;  2I5H A;  1I6H H;  5IYB H;  3ER0 A;  2D62 A;  4JI6 L;  1GD7 A;  1GO3 E;  2AHO B;  4L5R C;  1WJJ A;  1K9M C;  1PHJ A;  4LFA L;  2ZM6 L;  1X56 A;  3S1N H;  1PH7 A;  4LW1 A;  1YBY A;  2PNH A;  1XPU A;  2UXC L;  2AWO A;  1YZ6 A;  1CKN A;  4A93 G;  2CWA A;  1ASZ A;  3AEV A;  4DUY L;  1EUJ A;  5HGQ A;  4DAM A;  4DUY Q;  1HR0 W;  3F2B A;  3EIV A;  3BZC A;  3J81 i;  2VQF Q;  4AYB E;  1C7Y A;  1HJP A;  3T1Y Q;  2JA6 G;  4LNQ A;  3KLW A;  3KYH C;  4IJH A;  4LF4 L;  2YTV A;  1YI2 A;  1VQ8 A;  2VUM H;  4IPC A;  3H3V H;  3UDF A;  4HJA A;  4DR5 L;  2L15 A;  4HIO A;  2UUC L;  3ULL A;  2R93 H;  4GNX A;  4X64 L;  4OX9 L;  2B63 G;  4JI6 Q;  2PI2 A;  1V1Q A;  3UDG A;  2IX1 A;  4LF5 L;  3KJO A;  4A3L H;  4A93 H;  2ES2 A;  1E1T A;  2K5N A;  4R4O A;  1JE5 A;  2E8G A;  2VS1 A;  4LF7 Q;  1IL2 A;  3CCM A;  1L1O B;  1VQF A;  3CPF A;  4IPG A;  4DV4 L;  1PYB A;  4KHP L;  4DR2 L;  5GAD C;  3HOX G;  1J5E L;  1GM5 A;  4R4T A;  1FJG L;  2NVT H;  1JJ2 A;  4KI0 A;  4JI0 Q;  1JJC B;  4A3E H;  3J7A 5;  5JJK A;  3K8A A;  1J6Q A;  2JA8 G;  3HOW G;  3PUV A;  1YJ9 A;  1VQ5 A;  4MTN A;  3E9I A;  5GQO A;  4A3J H;  1AE2 A;  1I5F A;  5C4J H;  1L2F A;  1IZ6 A;  2JK8 A;  3CC7 A;  2YU9 H;  1E1O A;  1GVP A;  1R9T H;  1S72 A;  1Q86 C;  3T1H Q;  4DR6 L;  5C0X J;  3STB C;  1EOV A;  3RLF A;  3K80 C;  4KLK A;  4IFD I;  1CSQ A;  4MNO A;  1CSP A;  2R7Z G;  2Z6K A;  3RZD H;  1BVS A;  3S2H H;  4P72 A;  1XMQ L;  1XNQ Q;  4TQU S;  1WOC A;  2RHQ B;  1YEZ A;  1Y14 B;  1VQK A;  1WCM H;  3G4S A;  1KRT A;  4A3J G;  3HOZ G;  1EQR A;  4JI4 Q;  3AFQ A;  5LMU Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...