5M5YH

Rna polymerase i elongation complex 2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
144
structure length
134
Chain Sequence
b'NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Molecular Structures of Transcribing RNA Polymerase I.
pubmed doi rcsb
molecule tags Transcription
total genus 17
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m5yH00
4DK3C 4B3MQ 4IO9A 2BA0A 2OCEA 3MEFA 2NVXH 2YTYA 1Z47A 1YZ6A 3H3VH 1Y14B 3STBC 4A3EG 4EQ5A 5LMNQ 2JA7G 5GROA 3STBD 2CWPA 4HIOA 2I5LX 4ME3A 3PUVA 1XPUA 1K0RA 4DR4L 4LFCL 4PMWA 1C0AA 4YY3L 3A5ZB 2K5NA 3J81c 1PH7A 2I0QA 4A3JH 4NXNQ 5IYDH 4X66Q 2UUAL 4BBSH 1E3PA 4IPHA 2IY5B 3HOVH 1E22A 1BVSA 3RLFA 3CAMA 4TVAB 3LGJA 4C3IH 4A3DG 4GKJQ 3PIOA 4A93H 1VQHA 4LFAQ 3PIPA 4L5TA 1LM0A 2VQEL 5C4XG 1A62A 1GKHA 3UE1A 1SLJA 1VQLA 4NXML 1A63A 2K75A 3ULJA 4JOIC 4NB3A 1LUZA 3U50C 5IWAQ 3G48A 1YHBA 4LF7Q 4DR5Q 3L7ZC 4YHHL 4QIWE 4A3EH 2JA7H 1X6OA 4C2MH 1XJVA 1QVGA 1IBLL 4DV1Q 1XNRQ 2RHSB 3PF5A 3PUWA 3UE0A 4QGUA 4JI1L 3CMEA 1TWAH 4XIGS 3G6EA 1VQPA 2UXCQ 4A3GG 1W3SA 3U4VA 5ELOA 2VY3A 3A74A 1E24A 3UDGA 1JE5A 1AE3A 3B6YA 4X64Q 2ZM6Q 1EQQA 2HIXA 1HZ9A 1IXRA 4BBRG 4DR2L 3VDYA 3I4NH 4A3DH 1I6HH 1NMFA 4A3CG 3T1YL 3CCQA 1SN8A 3E0EA 5ELNA 4POFA 1J6QA 3GTOH 3I4MG 4JYAL 1TXYA 5C4XH 4PZ6A 3GDEA 1OXSC 4KHZA 1OXTA 2F52A 3J81j 1N8RC 3I55A 3J7A5 3E9HA 4X62L 1I3QH 1HJPA 1Q1EA 1YJ9A 2DGYA 4GS3A 4DR3Q 1HZBA 1VQMA 4BY1G 3ICEA 1K83H 1U5KA 1AE2A 4LF9Q 2CKZB 2QGQA 4AQYQ 4DV2L 3M3YH 3AYHB 3G4SA 2E8GA 5M5WH 1EIFA 1VQ8A 3M7NA 4HJ7A 4IFDJ 5GAHC 2D0OA 2IHEA 1JT8A 1SR3A 3D0FA 4MTNA 2AWNA 4A3GH 2KHJA 4DV0Q 3CP0A 4GKJL 5C4JH 2JA6H 2ID0A 2XTIA 3GTPH 5GAEC 4JC0A 3M4OH 2ZTDA 3KDFA 2N78A 4LFBQ 3EN2A 4DR4Q 4BBRH 1XMOL 2KENA 1Y1WG 4A3CH 2FXQA 4DUYQ 4A75A 4K0KQ 3PUYA 1L0WA 1NJIC 3I4MH 4HJ5A 2L15A 4JBMA 1X3FA 5IWAL 4R1JA 1FGUA 1KAWA 1VQEA 1K8AC 4LF7L 2JA8G 4DR5L 3F8TA 4Y7NH 1IL2A 1PFSA 1KHIA 2VQEQ 4DV1L 2K52A 2VL6A 4HIKA 3J80i 4NXMQ 1Q7YC 3FKIG 4L5RC 2ZTCA 1K73C 2UXCL 4LW1A 4A4IA 1Q86C 1X3GA 1PH6A 4LF4L 2YYZA 2EXDA 4X64L 4A3MH 2K14A 2JQOA 1YI2A 3I4OA 2JA8H 1X65A 1KRTA 3U58A 4YHHQ 1EYGA 1WI5A 1XPOA 2UXDQ 4A3JG 3KF8B 1Q81C 2KCTA 3TREA 3M4PA 4JI1Q 4LNQA 5JJIA 4DV7L 4A3FG 1KL9A 1C9OA 1Y1WH 3WWVA 1IBMQ 3NEMA 1EUJA 3F2DA 3TQYA 3F2BA 1K8GA 1I94L 2OTJA 4X65Q 2NVQH 4JBJA 3OTOQ 2WP8J 4WJ4A 3PSIA 5K36G 2Z6KC 3M4QA 3ULLA 2UUBL 5AJ3Q 1VQ4A 2ASBA 3NELA 4JOIA 3NENA 1K9MC 4LF9L 1D8LA 2UUCQ 3AFPA 4AQYL 4OWWB 4YCWA 4JI8Q 4DAYB 3A0JA 4JYAQ 2IHFA 2OQKA 3S24A 3D31A 4IPCA 1HNZQ 4X6AH 1KXLA 1VQDA 5IYBH 3AQQA 2NZHA 3OYYA 5M5XH 4R4OA 3Q8DA 3CPFA 3FKIH 3CQZH 3KDFB 1HNXQ 4OX9L 4X62Q 1VQBA 1VQJA 1IBKQ 2HHHQ 2KBNA 4YCVA 4DV0L 1I50H 4DV6Q 1HR0Q 3AEVA 1XTDA 1PH5A 4IPGA 4GN5A 2V1CC 5IYCH 1XPRA 2K5VA 5IE8A 1HZAA 4LFBL 2YTVA 4JCVE 1V43A 2B63H 3CXCA 3K8AA 4DV2Q 1X9NA 3ULPA 3GTMH 4O0AA 3L2PA 2Y0SG 4DUYL 4K0KL 4O2DA 5IY0A 4BXXH 5DLQE 3M9BA 1PYSB 2AHOB 2C35B 1QZHA 1GM5A 1N32Q 4A3FH 1VQIA 4IOAA 4TQUS 4JI2Q 3I4NG 3JAMi 3CPWA 1SRUA 1P16A 1TWHH 3SGIA 4OWTB 5GADC 5JEAJ 1JMCA 1PH9A 2R6GA 4APVA 1PH3A 4JV5L 2NN6I 1XMOQ 5GQOA 1XNQQ 4MNOA 1S40A 2QA4A 3CCMA 2KHIA 4UPAA 3MXNB 2IX1A 1V9PA 4DUZQ 3CCJA 1IZ6A 4A76A 3HOXG 4LUVA 2GVAA 1Z9FA 4IPDA 1CKOA 3KJOA 3HOWG 5M3FH 1HR0W 2OTLA 4YWKA 1EOVA 4IJLA 3KOJA 4B3TL 4ALPA 2UXDL 2I5MX 2LXKA 1CUKA 1E7ZA 3RR5A 4B3SQ 5FLMG 4P72A 1Q82C 4POGA 1WCMG 2MO0A 3U4ZA 3PO2G 4GKKL 3W5OA 3S2DH 2JA6G 1IBML 4DPGA 5C44G 2JK8A 2LSSA 4X65L 1M1KC 3RN2A 3OTOL 3H15A 1NBWA 4H02A 5AJ3L 4DNIA 5C3EG 1TWGH 1VQOA 1MIUA 5C0XI 4DV3Q 2UUCL 2ZJQA 4JI8L 4DV5L 2F4VQ 4J15A 1HNZL 2NZOA 4UP7A 1U0LA 4DV7Q 1T9HA 2ATWA 3S15H 1HNXL 2WAQG 2R93H 3GO5A 2N3SA 1WOCA 1YJNA 1IBKL 1UE1A 1I94Q 1HR0L 2HHHL 4DV6L 1D7QA 4A3IG 3F2CA 4LF4Q 1L2FA 3HOXH 4LUOA 2JEBI 2UUBQ 3HOWH 3H0GH 1BBWA 2UU9Q 2GVBA 2CCZA 2BH2A 3TEHB 2E5LQ 3A5UA 3K0XA 3J80c 5H1SE 4A3MG 5FLMH 3KYHC 2PQAA 3I56A 1N32L 1WCMH 4P75A 4OX9Q 3PO2H 1HNWQ 5IP9G 4BA2I 1N9WA 4JI2L 1WYDA 1CSPA 3NBHB 3PO3H 1HZCA 1IYJB 3FHWA 4B3RQ 4LF8L 5C44H 1B8AA 4QY7A 4GLVB 1UE5A 1UWVA 4QJFA 5C3EH 2VQFQ 1XNQL 4OXPA 4L5QA 1CKMA 1OXXK 4KHPL 2Z6KA 3F1ZA 3UDIA 1J5EQ 4JI7Q 1YHAA 2IT1A 4DUZL 4A3BH 4P73A 2AWOA 4BY7H 3HOZG 5E7NA 4GN3B 4DAMA 2Y0SE 4PG3A 4A3IH 1SE8A 2K5HA 2PI2A 2XGTA 3E9IA 5IYBG 3PCOB 4JBWA 1WFQA 3CCRA 1ASYA 1VQKA 4B3SL 4UY8C 4JV5Q 2MNAA 2HIVA 3RN5A 4OONA 1NE3A 1YBYA 2Q2UA 4JI5Q 1X55A 4DK6C 1O7IA 5IYCG 4DR6Q 3GD7A 3K81C 2JA9A 4GOPA 1NY4A 5IP9H 2B63G 4JI3Q 3CCSA 4B3TQ 1MJEA 1YEZA 1EWIA 1KRSA 4DV3L 1BBUA 5J3BA 2F4VL 4BXXG 1E1OA 1MJCA 1VQ9A 2YTXA 1VS0A 3GTGH 4UP9A 4GKKQ 4HJAA 1R9TH 3PF4A 4BA1I 4LWCA 4OWXB 5HY6A 3RLOA 3KJPA 1SROA 1X54A 4R4QA 2B3GA 1E1TA 3JAMc 3PUXA 4YCUA 3PUZA 4AH6A 1PHJA 2PQAB 1TWCH 1VQ5A 4JI4Q 2Q2IA 2E2IH 3HOUG 3HOZH 4R4IA 4DV5Q 2UU9L 2JE6I 1A8VA 2E5LL 3K7AH 3S1MH 2MO1A 2JEAI 3H3VI 2K4KA 1YJWA 2ZTEA 3GTJH 1Q8KA 5M3FG 1QVFA 5EAYA 1FL0A 4RMFA 4DR7L 1HNWL 3CC2A 4B3RL 2MFIA 3CD6A 1VCIA 1QVCA 1XMQL 1L1OA 3BZCA 3K7UC 1Q12A 2CWAA 2B29A 3KF6A 4R4CA 1YITA 1X56A 4IFDI 2WAQE 3UDXA 2VQFL 4HIDA 4GOPC 1K3RA 3T1HQ 2OQ0A 2AMCB 1QUQA 1WJJA 2CQOA 3CMAA 1VQAA 2EIFA 4GN4B 3S17H 3BJUA 1PH1A 1J5EL 4JI7L 1RIPA 2NN6G 2D62A 1PH8A 3TS0A 1N33L 2UXBL 4WJ3M 4LF8Q 2VNUD 2AKWB 4OO1I 4GNXA 4RG1A 2H5XA 4JI0Q 2VZAA 5IP7G 3HOUH 2OWOA 2R93G 4P71A 2Q2TA 3HKZG 4GOPB 1Q1BA 4KHPQ 4AYBG 4QL5A 1PH4A 5M5YH 2IX0A 2MQHA 1PA6A 4JI5L 1LYLA 3DLLA 1MKHA 4LF5L 2E2HH 3CCEA 4DR6L 3H0GG 1YNXA 3M85A 4A3KG 4JI3L 1PYBA 1KC8C 2VUMG 1NTGA 2WB1G 1CKNA 1FVIA 1SFOH 4DR1L 4HIMA 1BKBA 1L1OC 5C0XG 2JA5H 2R92G 1S3OA 3PO3G 2R7FA 2ALYB 4IOCA 2HT1A 2R7ZG 2VW9A 1VQ6A 1RL2A 3EIVA 1LTLA 5IT9c 3ER0A 3CCUA 2RCNA 5LMUQ 3W1GA 4JI4L 4FDBA 1OXVA 1EFWA 3HOYG 3CCLA 1QZGA 3FP9A 5M3MG 5HGQA 5LMNW 1KD1C 1JB7A 1ASZA 1X3EA 2K50A 3I2ZA 1N36Q 5IP7H 4GNXC 4A3BG 3AFQA 1L1OB 3CCVA 3KF6B 1M90C 4BY7G 3RLNA 3RNUA 3J81i 1PH2A 1JJGA 4PZ7A 3HFZB 3ERSX 4DV4L 1P8LA 4LF6Q 4JI6Q 2N8NA 2I5HA 1QUQB 1B70B 4P74A 2R7DA 3BU2A 4A3KH 1VQGA 3I7FA 3S1RH 3T1HL 5FJ8G 4DKAC 2JJQA 1YHQA 2VUMH 3CC7A 5BR8Q 2QEXA 1N34L 2YV5A 1SMXA 4GNXB 4HJ9A 4C3JH 2RHQB 4DR7Q 1GO3E 4GLAC 3DM3A 1FJGQ 1Y1VG 2R92H 2ZJPA 4C3HH 4JG2A 2R7ZH 4PZ8A 2Q2HA 1YIJA 1XMQQ 2EQSA 3G71A 4B3ML 3ZJYC 4GLXA 1VQ7A 5JEAG 1DGSA 4JI0L 3TRZA 5LMNL 5JJKA 2WFWA 3HOYH 1VQCA 4YWMA 4EX5A 2RF4A 3PGZA 5M3MH 2DUDA 3CF5A 4HJ8A 1OTCA 1A0IA 3K80C 2N49A 1N33Q 4YWLA 1CKNB 2UXBQ 3OW2A 1PV4A 4NXNL 4X66L 1B7YB 3J7ZC 4LUZA 2PI2E 4KI0A 2A19A 1YVCA 3CW2C 1JJ2A 1JJCB 3S2HH 4LFAL 1AH9A 5FJ8H 2A8VA 4Y52H 4LFCQ 4QQBX 3PV0A 4YY3Q 4LF5Q 2NVTH 2CFMA 3GTQH 5FLXc 2F3IA 4A3LG 5LMUL 2UUAQ 1Y1VH 3KFUA 3HKZE 2ES2A 4AYBE 3S1NH 1V1QA 1TWFH 2VS1A 2NVYH 1EQRA 2HQLA 3EBEA 4MZ9A 5GAGC 2LXJA 4DR1Q 1N36L 1GVPA 1XNRL 1OXUA 3S16H 1HH2P 4BY1H 1W2BA 4XTCS 3CC4A 1EIYB 2D0PA 4LF6L 1G51A 4JI6L 2WB1E 4JBKA 1G291 2E2JH 3RZDH 1Q46A 3GTKH 2ZM6L 4NPSA 3RZOH 3S1QH 2PNHA 1I5FA 1C7YA 5BR8L 1G6PA 3UDFA 2GN5A 4R4TA 5IYDG 1VQNA 1IBLQ 2A1AA 3JC66 4IFDG 4BBSG 1FJGL 3TS2A 4KLKA 3W1BA 4DV4Q 4L5SA 3HOVG 5C0XJ 3S14H 2BH8A 5JJLA 3IRBA 4UP8A 2PMZE 4A3LH 4AIMA 1KIXA 3KLWA 1VQFA 3L0OA 1S72A 4A93G 2BA1A 2JA5G 3GTLH 4DR3L 2KCMA 4DR2Q 3HKSA 1UE6A 4OO1G 1N34Q 1KQSA 1PVOA 1CSQA 1UEBA 3BZKA 1GD7A 3T1YQ 2Z0SA 1H95A 1UE7A 2YU9H 1NMGA 4IJHA 2ZJRA
chains in the Genus database with same CATH superfamily
1ZKOA 5BN5A 1STNA 3KUPA 3HEJA 2XIWA 1Y14B 3EROA 4HIOA 4C2MB 1GOZA 4DU9A 3J81c 2Z4HA 4BBSH 3RLFA 4C3IH 4GKJQ 3I4NB 4A3DB 1I6HB 1ILPA 1RDPD 3H94A 4RA8A 5C4XG 5K36H 2IJ0A 2KJXA 3UE1A 1L0YB 1SLJA 4X3KA 1DOLA 2K75A 5I2YA 1LUZA 1TKWB 3P75A 5IWAQ 1E2WA 3J80L 1YHBA 2QDLA 3L7ZC 4QIWE 1CQFA 5M5WB 4Q0FA 3PF5A 3PUWA 3UE0A 3VYUA 1OO9B 4JI1L 1TWAH 4QGUA 4ZKBB 3CMEA 4N8FA 4A3GB 1MD2D 4OIJA 2HIXA 3VDYA 4A3CG 4RHRA 4KY5A 5ELNA 4JYAL 3I4MG 5C4XH 1PFNA 3GDEA 3J81j 1N8RC 3I55A 2WAQB 4X62L 1I3QH 1D2BA 1J8IA 1YJ9A 3OSOA 4KY6A 1VQMA 4BY1G 1U5KA 5C3WA 2CKZB 2QGQA 4DV2L 3M3YH 3AYHB 1A3TA 2EXZA 4JW0A 4K5XA 4LJZC 3M7NA 4A3MB 1BCPC 1TVXA 2D0OA 2ICEC 1KTKA 2A74C 3D3RA 1D1KA 3D0FA 2Z1CA 4MTNA 2KHJA 2FJ2A 5C4ZA 4DV0Q 4ZQ3A 2ID0A 2XTIA 2DJFC 2KEEA 4KN4C 3KDFA 2A6EC 4A3CH 1D5XC 4K0KQ 1NJIC 3I4MH 4KKSA 5EKIA 1BCPB 2JA8G 4LF7L 4PMBA 4DR5L 3QIAA 3F8TA 4DV1L 2LS01 4HIKA 3T56B 1Q7YC 4L5RC 2ZTCA 1FNUA 1ENCA 4YIJA 1Z7TA 2F0KA 2A68C 1VF5C 1YI2A 3I4OA 1F2YA 3U58A 3X3NA 1WI5A 1UUPA 1STEA 3TREA 4JI1Q 2MHVA 4V0BA 1QILA 4A3FG 1KL9A 1SDFA 3WWVA 1EUJA 4C1NI 3TQYA 3F2DA 1K8GA 4DAVA 2KCNA 2Q8RE 4JBJA 4QUFA 2WP8J 4KKTA 4K8JA 2Z6KC 1VQ4A 2JA8H 1D8LA 2FMMA 3AFPA 4AQYL 2UUCQ 4IUQA 4YCWA 4JYAQ 1FR3A 4IPCA 4IURA 4DGZA 2NZHA 2GA4B 4OX9L 4K6LA 4X62Q 1VQJA 3ERQA 4YCVA 1HR0Q 1I50H 5EPLA 1BUVT 1SNCA 1EY8A 1SE3A 2F0NA 2K5VA 2NUCA 4LFBL 1V43A 3VR6A 4DV2Q 1D5ZC 3DWAA 1X9NA 1LLRD 1RJTA 2CHBD 4DUYL 3M7GA 4DAPA 4O2DA 1Y8PB 2RA4A 3GV6A 3K5NA 4BXXH 1N32Q 1PYSB 2AHOB 2C35B 1GM5A 3A54A 4A3FH 1VQIA 4IOAA 5EQ0A 4CKEA 4J6HA 3CPWA 3I4NG 1SRUA 2K7VA 2RDGA 1B3QA 3SGIA 4XQQA 5EPKA 5JEAJ 1PH9A 3OMGA 4APVA 1PH3A 4JV5L 2NN6I 1HCZA 2I46A 4MNOA 4G7ZC 2H1EA 3CCMA 2R93B 3HKZB 3MXNB 1EYCA 4CJ0B 1IZ6A 1PTOD 1PMRA 1JT8A 1HR0W 3CKIB 3W2DA 4C1NK 3H0GB 1EOVA 4ALPA 4MTKA 1CHPD 2CW0D 3U4ZA 1WCMB 4RAUC 3Q23A 3VR3A 3OPOA 5C44G 2DNCA 3PO3B 1M1KC 2CH4W 2SEBD 5C3EG 1A3UA 1MIUA 1O7LA 1HNZL 2HQEA 1WTPA 1AN8A 3MA2B 2WAQG 4CHTB 1YJNA 4BY7B 1UE1A 1EZ6A 2B2YC 3F2CA 1L2FA 4G7HC 4A3IB 2B2UA 3DEOA 2XRSD 2CCZA 3E6ZX 1PTOF 4BWGB 3S2HB 2K32A 4IZ8A 4A3MG 3KYHC 3I56A 2A69D 1DONA 4OX9Q 3EQLC 1EFID 1JOKA 1SNOA 2DN8A 2X69A 3V05A 4BA2I 1WYDA 1HZCA 1IYJB 4B3RQ 1Y8OB 5C44H 3Q6SA 3VR4A 2NYZD 4QJFA 5C3EH 3LWUA 2E74C 2ENBA 1WTVA 4OXPA 1XNQL 3GTGB 3VYTA 4L5QA 1CKMA 3MVVA 3F1ZA 2EYMA 1J5EQ 1R4PB 1WVLA 5EJWA 4DNTB 4A3BH 5E7NA 2EPBA 3BS1A 1V1PA 4F88A 2K5HA 2XGTA 5HGTA 3A7LA 4JV5Q 1ASYA 3D6CA 3MXPA 2HIVA 4I7ZC 4UDUC 5I2XA 3RN5A 3MTSA 3OMCA 3F2UA 3NTHA 1PZKD 3T51B 4JI5Q 1JR0D 4DK6C 5IYCG 4DR6Q 3S14B 4GOPA 3J81E 3CRLC 1UAPA 4DV3L 2F4VL 4EVOA 5C6AA 2IX3A 1E1OA 4HJAA 3KJPA 4OWXB 1BF4A 3MXUA 1TS2A 5D3DA 2Q2IA 2E2IH 3HOUB 2UU9L 3KLSA 1A8VA 1IW7C 3H3VI 2ZTEA 1QE6A 1HNWL 4XT3B 2MFIA 3KBXA 1VCIA 1K8MA 1L1OA 3K7UC 1Q12A 4KTAA 4R4CA 3UDXA 4A93B 3T1HQ 1QUQA 3S17H 5JPNC 4JPBW 1K3BC 2LY7A 2L11A 1HQMC 3OWEB 4OO1I 2R61A 5IIFA 3P7JA 3WDNA 2OWOA 2R93G 3MXGA 4P71A 2OXPA 3HKZG 4A3EB 2Q2TA 1PZID 4QL5A 2IX0A 3SEBA 1MKHA 4LF5L 4JVZA 4OGQC 3H0GG 1JE4A 1F77A 5FO8B 4NW2A 2G9DA 2WB1B 4IUNA 4HIMA 1BKBA 4KV6A 5C0XG 2JA5H 2CVRA 3PO3G 4J1MA 2R7FA 2ALYB 4CBVA 3AMUA 1VQ6A 3OW7A 4C3HB 1LTLA 4F7XA 1SEBD 5LMUQ 3OIPA 1SYEA 5M3MB 1X3EA 2K50A 4DNRB 4GNXC 4DN4M 1VMCA 3IL8A 1M90C 4BY7G 4JI6Q 2WINB 1EIGA 3N52A 5EPJA 1QOHA 1O7ZA 3BU2A 5C4JB 1HHVA 1G2SA 3I7FA 3S1RH 2WKCA 1LT6D 3C1FA 1SYCA 4DKAC 3TBIB 2OT2A 4BBRB 4R8IA 4Q5VA 4GNXB 1Q90A 1STBA 3DM3A 5C0XH 1Y1VG 4P2CB 1A2TA 2CH4A 4JG2A 1HFGA 2Q2HA 2EQSA 3G71A 4IUPA 3ZJYC 1VQ7A 5JEAG 1DGSA 2SOBA 2WFWA 4HCEA 1VQCA 4EX5A 1A0IA 4RGTA 3K80C 2N49A 2J4XA 2PZWA 1CKNB 2AQ2B 2FHTA 3SK4A 1TR5A 4LUZA 1ZYRD 3NHHA 3CW2C 5TSSA 1JJCB 3S2HH 1O78A 1PYWD 2A8VA 4Y52H 4QQBX 2QEJC 4YY3Q 4LF5Q 3I90A 4NDXA 2KHSA 1NR2A 2UUAQ 1LO5D 1Y1VH 1FGBD 2ES2A 3UI2A 1SE2A 4AYBE 3S1NH 1F9PA 4ULLA 1CT1D 1TWFH 2VS1A 2NVYH 4N8X1 2QKIC 5JEAH 2LXJA 4ME5A 2VB2X 5EBDA 3TN2A 3DWPA 2WB1E 1LTAD 3FKIB 1EY4A 4RGOS 3NWSA 3GTKH 4NPSA 3RZOH 3BYTB 1G6PA 5BR8L 4R9WA 3UDFA 1JQYD 3T53B 4IFDG 1ILQA 2RDFA 4BBSB 1GUWA 4KLKA 3VA7A 3S14H 3K5LA 4C3IB 3H09A 3KLWA 3BDLA 4CKCA 4A93G 1B2TA 1SNMA 1B4OA 4S3SA 1HTLD 1NMGA 1U4PA 5DM73 2F4IA 4DK3C 5A2QE 2OCEA 1DOMA 2E2DC 1YZ6A 2QILA 3STBC 4A3EG 5GROA 1I4HA 1MHWC 2CWPA 3EFXD 1XPUA 4NKLA 4DR4L 4LFCL 1TWAB 2K5NA 1JOOA 4XXEA 4A3JH 4IFDH 4ABNA 2Y0SB 4IPHA 5I6WA 4TVAB 3LGJA 1ZXTA 1SNDA 3PIOA 1WTOA 4A93H 1PDQA 3PIPA 1LM0A 1GJXA 5C4XB 1VQLA 4NXML 1B44D 3S15B 4V190 1I3QB 1F9SA 4CKBA 2JN4A 1IYUA 3G48A 1AZPA 2BDOA 4MN3A 4A3EH 1XJVA 3GP7A 1IBLL 2CW0C 4DK1A 3BVGA 1W3SA 3U4VA 2VY3A 3URYA 4X64Q 4X3UA 4HMJA 1RF2D 1HZ9A 4BBRG 4O1NA 4DF7A 2AQ3B 1LT4D 3T1YL 4CDFC 2G9HD 1EZ8A 1TXYA 1CZWA 2JP1A 4KHZA 1OXTA 2F52A 3KF8A 5BN3A 3IFDA 4JK1C 1K83H 3ITPA 1K8OA 3MHBA 3TP6A 2K5WA 5E1FA 2F0UA 5ELEA 1I6VC 2E8GA 2A69C 4DAYA 2FINB 4GKJL 2D2CC 3CP0A 5C4JH 2JA6H 2WKDA 4JC0A 5I6YA 3EN2A 4DR4Q 4BBRH 4HTHA 4A75A 1L0WA 2MP1A 5I9PA 4HJ5A 2L15A 1DM0B 2EYPA 5IWAL 1FGUA 1KAWA 1VQEA 3W3AA 4K2LA 1SYBA 1PFSA 4NXMQ 3FKIG 3HG9A 3AU7A 1PFBA 3R3OA 5FO9B 1YNND 2F0EA 4LW1A 4A4IA 1K73C 1ONLA 1X3GA 3V96A 1JCKB 1PH6A 3HZXA 2EXDA 3QR8A 3TZDA 2HDMA 1KRTA 1EYGA 4OEMB 4FXKC 1JC7A 5JJIA 3WOEA 4C3IG 2XN9C 1VMPA 1IBMQ 3NEMA 3F2BA 1I94L 2OTJA 4X65Q 1RTNA 3OTOQ 1I4QA 4WJ4A 5K36G 4KN7C 2UUBL 5AJ3Q 3NELA 4JOIA 4OWWB 4JI8Q 2IHFA 3D31A 1H9RA 3NPPA 5IYBH 3OYYA 1HNXQ 5M5XH 4R4OA 4UAIA 3FKIH 3CQZH 3K59A 3DMUA 1VQBA 1IBKQ 1X32A 3PIO3 2KBNA 4DV0L 5T1IA 4GN5A 1TS4A 2V1CC 1XPRA 5IE8A 1HZAA 2NTSA 1QNUA 5J39A 5IT9L 1C4QA 2Y0SG 4K0KL 1LV9A 1EU3A 1QZHA 2X6LA 5JJZA 4TQUS 1AW7A 1C48A 3RUZA 2EY5A 4KJOA 1LACA 1UEAB 2M2LA 2KOLA 3NBHA 2HCIA 1S40A 2QA4A 2K01A 4UPAA 4HSPA 1IYVA 4A76A 4LUVA 4H7BA 4RFBA 5M3FH 3SVMA 2CQAA 1M8AA 4N9PA 2I5MX 1E7ZA 2K04A 4B3SQ 5D65A 2MO0A 3ND9A 2EZVA 1EYDA 3W5OA 2J0TD 4KK7A 4DPGA 2TMPA 2LSSA 5C44B 3RN2A 3H15A 1ICFB 1NBWA 1A6XA 5C3EB 2UUCL 2LMCB 2F0VA 4UP7A 1T9HA 3S15H 2PMZB 2M00A 3GO5A 4A3BB 1WOCA 1I94Q 3MEHA 1HR0L 2F0SA 4LF4Q 2JEBI 4EGVA 2UUBQ 2N88A 3BYYB 2L5TA 2GVBA 3VA5A 2E5LQ 5FLXL 5KNDA 3NXWA 1N32L 4P75A 2B2TC 1DCZA 1PTOH 4G4KA 1ENFA 2A5HA 1CHQD 4GLVB 1UE5A 2PCFB 2Z9HA 2KEDA 2AUKA 3SE0A 2Z4IA 3JAML 1GHKA 5CV5A 4KHPL 2K5QA 2EJMA 3UDIA 3TZUA 4JI7Q 1RCVD 3QOLA 2E2IB 5LHY1 3CD6A 3QG1A 1SE8A 1ZYRC 2PI2A 3O13A 5KNBA 3SK8A 4JBWA 4UY8C 1NUCA 1PRTD 1MSGA 1TY2A 3D4RA 4RCNA 3DHQA 1O7IA 1UNSA 1DD2A 3GD7A 1NY4A 3ONAB 1YEZA 1EWIA 1KRSA 1EEID 2WIIB 3K0YA 4BXXG 3S17B 3CHBD 1VQ9A 3OOCA 4KKUA 2P5ZX 2YU9B 1XX8A 1YNJD 5HY6A 1SROA 4R4QA 3PUXA 2H4OA 2PQAB 1FNWA 5COYA 4K8IA 4R4IA 3Q24A 1LTBD 3S1MH 2XVSA 2MO1A 1KAAA 1SMYC 2K4KA 3NQTA 1FL0A 3G7LA 4RMFA 2MPMA 1HRJA 1V1OA 4B3RL 1JWMD 2F03A 1QVCA 1XMQL 1PRTF 3A8KE 1F2MA 3KF6A 2B2VA 2CWAA 1C8CA 1TY0A 1ET9A 1TU2B 2WAQE 3NUCA 2O4XA 3HP3A 4HIDA 1K3RA 2OQ0A 1WJJA 2JA5B 1U9RA 1VQAA 1W6JA 2EIFA 1J5EL 2NN6G 2D62A 3TS0A 1G6ZA 2MJ8A 2AKWB 3EA6A 3A7AB 1EYAA 4JI0Q 2N55A 4TKOB 2JA7B 3DM1A 2XWJB 4KHPQ 5M5YH 5AFWA 5LL6S 4JI5L 1LYLA 3CCEA 1NNXA 4DR6L 4A3KG 2D9UA 2NTTA 1Y69U 3J80E 3S1RB 2L55A 4FXGC 1F2LA 2KCCA 1FVIA 4DR1L 2R92G 1S3OA 2QDBA 2KVMA 5G3LD 5CBEE 2HT1A 3LNNA 3EIVA 2NN6H 5FK9C 2RCNA 2L1BA 5FO7B 3HOYG 4IUUA 1D6EC 1KDBA 1SYDA 5LMNW 1KD1C 1HUMA 1N36Q 4A3BG 3AFQA 1D5MC 4RKBA 4FP5D 1PH2A 1E2VA 3HFZB 3I91A 1LTTD 2I5HA 1G91A 1B70B 2JXMB 4A3KH 1VQGA 3QOJA 1W6KA 3T1HL 1J9OA 1EY0A 4G57A 2QEXA 1SMXA 4GZYC 4FNFA 2RHQB 2C5CA 4HR7B 2R92H 3K58A 3RMHA 2ZJPA 1Y1VB 1XMQQ 1YIJA 4B3ML 3S1NB 3HRZC 1S4ZA 1I4PA 1TWFB 3PQIA 2NVYB 5G3LF 3TRZA 1LTID 3HOYH 2RF4A 1B9MA 4H44C 1SNQA 3MAQA 3FMCA 2B2WA 1PV4A 4NXNL 5EKLA 4X66L 1ET6A 3GTKB 2NWGA 2XNAC 3RZOB 3QO2A 2A19A 1LT3D 1S5ED 1AH9A 1F9RA 2A6HC 2BCOA 2RSOA 2CFMA 2NVTH 5IGGA 4N9TA 4KY7A 2F3IA 4A3LG 5LMUL 4TSSA 4PNYA 3HKZE 2NVQB 2X6GA 1V1QA 4NP5A 3J7AV 4DR1Q 2BE5C 5M9OA 2F0DA 3DXJC 1W2BA 4XTCS 3CC4A 2D0PA 5I9OA 4JI6L 2B39A 3IKJA 1U4MA 3NQIA 2ZM6L 5KYIA 2C9OA 4ZCKA 1GUNA 5IGCA 1MSHA 2F0PA 2LKVA 1VQNA 3JC66 4A3JB 3TS2A 3HOVG 4I7AA 1JWUD 3I70A 5JJLA 4A3LH 1U4LA 1TWHB 2RSNA 2JA5G 4QB4A 4DR2Q 3HKSA 4OO1G 5CR3A 1UEBA 1GD7A 2Z0SA 1B53A 1RODA 1UE7A 2EVBA 3VYSA 3QWNA 1BNZA 2YU9H 2ZJRA 1STHA 4B3MQ 3FPUB 2BA0A 2YTYA 1Z47A 4LMQD 3H3VH 5T1GA 2JA7G 2I5LX 4ME3A 3PUVA 3D4WA 4YY3L 2DY7A 3A5ZB 2F0HA 1JICA 4NXNQ 3IFTA 3ND8A 4X66Q 2UUAL 5IOCA 1E3PA 4Z9CB 5DEHA 3HOVH 3CAMA 1A15A 3NP8A 4BS9A 4K5VA 1EU4A 4L5TA 1Q3LA 1A62A 2K05A 4OO1H 2DY8A 3ULJA 4MHEA 4JOIC 4NB3A 2M9VA 3ZYYX 3HOXB 1K83B 1LTGD 4YHHL 1E0BA 2JA7H 1GUGA 1X6OA 1QVGA 4FF3A 2RHSB 5F2DA 1EY9A 3VYRA 3I3CA 4K5WA 3G6EA 2UXCQ 1XYIA 5ELOA 3A74A 2B8GA 3B6YA 1AE3A 3UDGA 2ZM6Q 2JA6B 1EQQA 4PMCA 1IXRA 1I4RA 1NMFA 3E0EA 1WTQA 1J6QA 3GTOH 4RCOA 2G5DA 4PZ6A 1NCVA 2EYJA 5JVG3 1OXSC 3A8IE 5D3IB 3E9HA 1HJPA 5C4HA 1Q1EA 4GS3A 2XWBB 5DAUA 2HD3A 3NTKA 4LF9Q 3G4SA 1EIFA 4FVMA 4FF1A 2EJGC 5GAHC 2I07B 2J7ZA 1SR3A 2VXWA 3GTPH 1S5CD 3I8ZA 1Z6HA 2N78A 3RD4A 1XMOL 5CV9A 1Y1WG 2FXQA 2A6ED 3PUYA 5ELCA 4J8QA 1X3FA 4M1UB 5C5MA 4R1JA 1TWCB 4QF4A 4Y7NH 3TSSA 3NK9A 2EYHA 4OIKA 2VL6A 1PRTC 3J80i 5M5XB 3CQZB 2Z6BA 1JOQA 2YYZA 2XRQD 4X64L 2K14A 4XYQA 5C3XA 2JQOA 4ILWA 4HEDA 1X65A 4DXFA 1ESFA 1DOKA 4YHHQ 3MXNA 4HSVA 2UXDQ 4A3JG 1Q81C 3M4PA 1PRTB 1Q8IA 4DV7L 4E6IA 1Y1WH 4RHSA 2NVQH 1BQQT 3M4QA 3ULLA 1H9MA 2ASBA 1K9MC 3A0JA 5CMDA 2OQKA 3S24A 1KXLA 1VQDA 1A3VA 3Q8DA 3CPFA 3KDFB 5KNCA 3MFYA 2QF7A 5M3FB 2HHHQ 2PZTA 4QCLA 3AEVA 4DV6Q 1STYA 2XSCA 1AFPA 2B63H 4JCVE 2EYOA 3GTMH 3L2PA 5DLQE 3M9BA 2RVLA 4JI2Q 3JAMi 2VB3X 1TWHH 1E2ZA 4OWTB 1X3PA 1H9JA 2HUGA 2OF1A 1SJED 1XMOQ 3S9WA 5GQOA 2B2YA 2KQ3A 1QB5D 5FOBB 1PTOC 2F3VA 1V9PA 4DUZQ 3HOXG 4IPDA 3KJOA 4XYOA 2OTLA 4IJLA 1QG7A 3KOJA 4B3TL 1ICWA 2K03A 3RR5A 2L12A 5J22A 5FLMG 1Q82C 4POGA 3PO2G 1BXTA 4RKLA 3TMEA 3S2DH 2B2VC 2JA6G 1PTOB 1IBML 1H9SA 1BDOA 4X65L 2R7ZB 3OTOL 4ID6A 2RQXA 4H02A 5AJ3L 4EQPA 1VQOA 4HMIA 4JI8L 3KBGA 2L9HA 4DV7Q 2ATWA 1HNXL 1DZ1A 3KLRA 2N3SA 1IBKL 3X3MA 1HA6A 1EL0A 3HOXH 4K6DA 1STAA 2JSOA 2BH2A 3A5UA 3K0XA 2KUMA 3J80c 5H1SE 5FLMH 3PO2H 2ZXPA 5IP9G 1N9WA 1GUTA 3EJIA 1M4VA 3FHWA 1JORA 5LL6X 1B8AA 4QY7A 2L0CA 5KIXA 2VQFQ 5D14A 4DK0A 1IL8A 1OXXK 4KJNA 2F0QA 1A2UA 5KRUA 1YHAA 1QCBD 1KNAA 4P73A 4HN7A 2AWOA 1SSOA 3HOZG 5ELFA 1CFMA 4GN3B 2Y0SE 4FO2A 3CCRA 5IYBG 3PCOB 4B3SL 2SDFA 3S1MB 3SK5A 1QJOA 2B2UC 4B9XA 2LFNA 3GV3A 1X55A 2IL8A 2JA9A 4QIWB 5IP9H 4JI3Q 4B3TQ 1MJEA 5J3BA 2F0LA 3BVZA 1MJCA 2YTXA 1VS0A 1SBBB 2NBFA 1R9TH 3KK7A 3PF4A 1SE4A 1I4GA 4C56C 4LF4L 3CU7A 1NR4A 3JAMc 2B3GA 3PUZA 4JI4Q 1TWCH 3HOZH 2JE6I 2E5LL 2HDLA 5M5YB 3LWEA 3A8JE 2JEAI 3D6WA 1YJWA 1Q8KA 5M3FG 3DUZA 2Q8TA 3CC2A 3PIP3 1PLFA 3U9OA 1DJRD 1LT5D 3BZCA 2B29A 1X56A 4GOPC 1JB7A 5KEEA 1C0AA 2CQOA 2DJGC 3CMAA 1PXUA 1V1PB 1MGSA 4JI7L 2K1BA 2PZUA 1N33L 2UXBL 4WJ3M 3K6OA 2VNUD 4HAEA 4GNXA 4G7OC 2H5XA 3M4YA 3K5MA 3SK6A 2E75C 2VZAA 5IP7G 1WTRA 4GOPB 1Q1BA 1L0XB 2ZT9C 1PA6A 3DLLA 2E2HH 3D8GA 1YNXA 2EYFA 4A3KB 3R2IA 1CKNA 2WACA 4PQXA 1SFOH 1L1OC 5CV7A 1R4QB 4IOCA 2R7ZG 2R92B 2VW9A 4XDXA 2O2LD 3CCUA 3W1GA 4DA2A 1K0SA 1K28A 1OXVA 1SNPA 2L4NA 5JVH3 1QZGA 3FP9A 3HOYB 2EE1A 1ASZA 3NE5B 4I65A 5IP7H 1L1OB 3CCVA 3CRKC 3RLNA 4PZ7A 1EQTA 4LF6Q 3ERSX 2RDHA 1P8LA 3Q0AA 2N8NA 1CK1A 1QUQB 1TS3A 4CDEC 3M4OB 5FJ8G 1FNVA 4RGNA 3CC7A 1S5BD 1N34L 1XTCD 2YV5A 2NVTB 1GO3E 4IALA 1FJGQ 1T5EA 1TT2A 2R7ZH 3TDQA 1WD0A 2AQ1B 4JI0L 1XXGA 4U68A 5LMNL 4K2KA 3PGZA 3CF5A 4HJ8A 1N33Q 4YWLA 2UXBQ 1EIHA 3J7ZC 2KA7A 1B50A 1IHZA 2F0FA 4KI0A 3MFGA 1YVCA 1V8QA 4LFAL 4KHVA 5FJ8H 3R93A 4L8JA 3GTQH 1F9QA 4ZYSA 3H3VC 3KFUA 5IGDA 5JPMC 3MC0B 4QMGA 2K6AA 2HQLA 4MZ9A 5GAGC 1N36L 1B9NA 1XNRL 1OXUA 4OL7A 3S16H 3PMFA 4BY1H 1S5FD 1G51A 4JBKA 1PFMA 1G291 2E2JH 3I72A 3RZDH 2R3ZA 5E4WC 3J81L 3S1QH 1RKNA 5CYUA 3SHLA 1EEFD 1I5FA 1HXYD 4R4TA 5IYDG 3Q22A 2A1AA 2F0OA 2IWHA 2PYKA 5C0XJ 3HOVB 1SJHD 1CM9A 2PMZE 4UP8A 1KIXA 3FDTA 1VQFA 3L0OA 2BA1A 5NUCA 2SNMA 4DR3L 5E4XA 1UE6A 3OHXC 1N34Q 2QW7A 5IT9E 1KQSA 1PVOA 5CV6A 4FF4A 1H95A 2PW7A 1FD7D 1HPCA 4ZLTF 5L37A 4IJHA 4IO9A 1HQRD 3MEFA 2NVXH 1IKMA 3T13A 4EQ5A 5LMNQ 3STBD 1K0RA 1X3QA 4PMWA 5FKAC 2NZ1D 5IODA 1PH7A 2I0QA 5IYDH 5BN4A 4XQJA 2IY5B 1E22A 1BVSA 1KNEA 4A3DG 1PZJD 3DEPA 3HGBA 2EY1A 1TWGB 3D4DA 4FF2A 3HS0C 1VQHA 4LFAQ 2VQEL 3GTOB 1GKHA 1MI2A 4ZK9B 1A63A 3U50C 3FVQA 3E0JA 3BDCA 3J7YW 1GXDC 1AEXA 4LF7Q 3HOWB 4DR5Q 3FEWX 1XNRQ 4C2MH 4DV1Q 4XIGS 1HFNA 1VQPA 4A3GG 3C1EA 4WORA 1E24A 1JE5A 4F8MA 2SNSA 3GTPB 4LAAA 3MZ5A 1CZGA 5CC4A 3T4AC 2F0MA 4DR2L 3I4NH 4A3DH 1I6HH 1B1ZA 5FLXE 3T16A 3CCQA 1BO0A 1SN8A 4POFA 1EY5A 5ELBA 2EOTA 3J7A5 3EVQA 3J7AF 1O7YA 2DGYA 4Y7NB 4DR3Q 1HZBA 3ICEA 1CQVA 4RWSC 1AE2A 3JAME 4AQYQ 1BBXC 2EJFC 1TS5A 5M5WH 1VQ8A 4HJ7A 4IFDJ 2IHEA 2DNEA 2AWNA 4A3GH 1FYCA 1G8ZD 3GQBA 5GAEC 2K33A 3SXHA 3M4OH 2ZTDA 3N6RA 4H0LC 4LFBQ 2PNRC 4RGMA 4X3TA 3E5SA 2KENA 5ELDA 1TQOA 3TP8A 4DUYQ 1Y1WB 3R8BA 4JBMA 3NSWA 1WD1A 1K8AC 4XT1B 1U4RA 1STGA 4RH6A 1IL2A 1KHIA 2VQEQ 1H9SB 3K7AB 4B9WA 2K52A 3FPPA 1YNNC 3BZDB 4CDCC 3GTJB 2UXCL 1Q86C 1LTSD 2V4DA 3P1HA 4A3MH 3C3LA 2MUYA 1XPOA 2B63B 3KF8B 2KCTA 2PQEA 1AZQA 3GTMB 4HCSA 4LNQA 4L63B 5JAVA 1C9OA 1RD9D 2Q8IB 4EQOA 5ISRA 3PSIA 2EDGA 1QWYA 4LF9L 1O80A 3NENA 1XWEA 4DAYB 5K5PA 1HNZQ 2IW3A 4X6AH 5DM63 3AQQA 1ESRA 1WTHA 2F1MA 1HA5A 3FRPB 1XTDA 1EWCA 1PH5A 4IPGA 5IYCH 2YTVA 3CXCA 3K8AA 2F0IA 1VDZA 3NTIA 3ULPA 1T5XD 4O0AA 3S2DB 5IY0A 4QUCA 5A2QL 1P16A 5GADC 1JMCA 2R6GA 1GUSA 5EBCA 1XNQQ 2FMCA 4DXGA 2KHIA 3AB9A 3R2TA 4AYBB 2IX1A 3CCJA 2GVAA 1Z9FA 2OEOA 1CKOA 3HOWG 4FXDA 5EGTA 4ZRZA 4YWKA 3OIQA 4KD3A 2UXDL 4CJ2C 2LXKA 1CUKA 4P72A 2B2TA 2VUMB 1F2ZA 1WCMG 1SXTA 4GKKL 4C3JB 3PO2B 5C5LA 4OHJA 2JK8A 3L9AX 4O42A 4ZUJA 2F0WA 1SAPA 2QCPX 4DNIA 1TWGH 4LK1C 4X3SA 5C0XI 4DV3Q 1SYGA 2ZJQA 4U673 4DV5L 2F4VQ 1KDAA 4J15A 2NZOA 1U0LA 4KD4A 3IAYA 2R93H 2HHHL 1D7QA 4DV6L 4A3IG 4LUOA 1CA6A 3HOWH 3H0GH 1BBWA 1EOTA 2UU9Q 3TEHB 3U9SA 1II3A 2K28A 2PQAA 1EWHA 4B08A 5IGBA 1LTRD 1WCMH 1HNWQ 1BCPD 2F0GA 4JI2L 1CSPA 3NBHB 3PO3H 2D5DA 4LF8L 4XQNA 2KECA 1UWVA 1DXMA 1RHPA 5CORA 2FFKB 3SR1A 1ENAA 4ZKCB 2F0JA 1D1IA 3KLSX 3NWTA 1R9TB 4UHVA 2O5JC 2F0TA 4OELB 1GUOA 2EYLA 2MGSA 2Z6KA 2IT1A 4DUZL 3QB3A 3E3XA 4CGYB 4WJWA 1KABA 1CI3M 1SYFA 4IUVA 4BY7H 3HOZB 4DAMA 4A3IH 4PG3A 5CV8A 3E9IA 1VQKA 1WFQA 1LABA 2MNAA 2BOSA 1Y8NB 3BDOA 4OONA 1NE3A 1YBYA 2Q2UA 4IQZA 1DYQA 2A68D 3K81C 2ZXOA 2B63G 1KLUD 2JYOA 3CCSA 3I4LA 5CGKA 5KGUA 1BBUA 5CBAE 3GTLB 1NAPA 4MIUA 1BCPF 2BDNA 3P20A 3GTGH 4UP9A 4GKKQ 2K5DA 3K57A 1IKLA 3SDZA 3L3OC 1YNJC 3LX0A 4BA1I 2O5IC 4LWCA 3RLOA 1X54A 1E1TA 1CTMA 4YCUA 4AH6A 1PHJA 4FYDA 3HOUG 2HCCA 1VQ5A 1ZEQX 4DV5Q 5CV4A 4IN3A 3K7AH 4TRDA 1JWSD 3TP7A 1G2TA 3C46A 5HURA 4ODGA 1NSNS 3QJYA 3GTJH 1QVFA 1SMYD 5EAYA 2E2HB 4DR7L 2PO4A 3DWQA 2Z8LA 1YITA 4IFDI 5KYLA 2VQFL 1SFOB 2AMCB 2EY2A 4GN4B 3BJUA 4WRDA 1PH1A 1RIPA 1PH8A 5EKKA 2EY6A 4LF8Q 4IUTA 4RG1A 5DNFA 3HOUH 2RCFA 2ZXRA 3H91A 4AYBG 4ZAIA 3VR2A 1PH4A 1VF7A 1KDCA 2MQHA 3VR5A 2F3WA 3M85A 1KC8C 1TIID 1PYBA 4JI3L 5IGFA 1I4XA 1WTXA 1NTGA 2WB1G 2VUMG 4C3JG 3BG3A 2E76C 4C3HG 1RL2A 4NMZA 5E3FA 1H9KA 5IT9c 3ER0A 4R8NA 2B8FA 4JI4L 4FDBA 3V2TA 4CJ1B 1EFWA 3CCLA 5M3MG 5HGQA 3OWFA 3I2ZA 4M8AA 4PV1C 3M3YB 3KF6B 2NB0A 3H6MA 3RNUA 3J81i 1JJGA 3I73A 4DV4L 1GHJA 2TSSA 1BR9A 3A55A 4P74A 2R7DA 1HTPA 1QNKA 3WOFA 4CDDC 4WFN3 2JJQA 1YHQA 2VUMH 4KMUC 5BR8Q 4HJ9A 4C3JH 3GTQB 4DR7Q 4GLAC 3C2PA 4H13C 3I4MB 2A73B 4C3HH 4PZ8A 4GLXA 1JB3A 5JJKA 4YWMA 3S16B 4BY1B 5M3MH 2DUDA 1OTCA 5A35A 3OW2A 2ICIA 2E2JB 1WTWA 1B7YB 3RZDB 1AP0A 2PPBC 2RKSA 3S1QB 4DFAA 2PI2E 1S5DD 2AUJD 1JJ2A 2IPKD 1HUNA 3NBIA 4LFCQ 1ML0D 3PV0A 5IGEA 2A6HD 5FLXc 3BVMA 3K5OA 1EQRA 3EBEA 2JA8B 1GVPA 2BE5D 1B3AA 1HH2P 3A56A 2RBMA 1EIYB 4LF6L 2NVXB 1RTOA 1EY7A 1I50B 1Q46A 2B2WC 2WV6D 1BOSA 2PNHA 1C7YA 4ZUIA 2GN5A 4K14A 1IW7D 1IBLQ 4BBSG 1FJGL 2PW5A 3W1BA 4DV4Q 4L5SA 2BH8A 4A3FB 5JOBA 3IRBA 5J1ZA 4AIMA 1MBYA 1S72A 3GTLH 4F87A 2KCMA 1CA5A 3G6JB 3MWYW 3TP5A 1CSQA 3T1YQ 3BZKA 4L6TB 5I4DA 1EQVA 1KLGD 1EY6A 4EQNA
chains in the Genus database with same CATH topology
4DK3C 4B3MQ 4IO9A 2BA0A 2OCEA 3MEFA 2NVXH 2YTYA 1Z47A 1YZ6A 3H3VH 1Y14B 3STBC 4A3EG 4EQ5A 5LMNQ 2JA7G 5GROA 3STBD 2CWPA 4HIOA 2I5LX 4ME3A 3PUVA 1XPUA 1K0RA 4DR4L 4LFCL 4PMWA 1C0AA 4YY3L 3A5ZB 2K5NA 3J81c 1PH7A 2I0QA 4A3JH 4NXNQ 5IYDH 4X66Q 2UUAL 4BBSH 1E3PA 4IPHA 2IY5B 3HOVH 1E22A 1BVSA 3RLFA 3CAMA 4TVAB 3LGJA 4C3IH 4A3DG 4GKJQ 3PIOA 4A93H 1VQHA 4LFAQ 3PIPA 4L5TA 1LM0A 2VQEL 5C4XG 1A62A 1GKHA 3UE1A 1SLJA 1VQLA 4NXML 1A63A 2K75A 3ULJA 4JOIC 4NB3A 1LUZA 3U50C 5IWAQ 3G48A 1YHBA 4LF7Q 4DR5Q 3L7ZC 4YHHL 4QIWE 4A3EH 2JA7H 1X6OA 4C2MH 1XJVA 1QVGA 1IBLL 4DV1Q 1XNRQ 2RHSB 3PF5A 3PUWA 3UE0A 4QGUA 4JI1L 3CMEA 1TWAH 4XIGS 3G6EA 1VQPA 2UXCQ 4A3GG 1W3SA 3U4VA 5ELOA 2VY3A 3A74A 1E24A 3UDGA 1JE5A 1AE3A 3B6YA 4X64Q 2ZM6Q 1EQQA 2HIXA 1HZ9A 1IXRA 4BBRG 4DR2L 3VDYA 3I4NH 4A3DH 1I6HH 1NMFA 4A3CG 3T1YL 3CCQA 1SN8A 3E0EA 5ELNA 4POFA 1J6QA 3GTOH 3I4MG 4JYAL 1TXYA 5C4XH 4PZ6A 3GDEA 1OXSC 4KHZA 1OXTA 2F52A 3J81j 1N8RC 3I55A 3J7A5 3E9HA 4X62L 1I3QH 1HJPA 1Q1EA 1YJ9A 2DGYA 4GS3A 4DR3Q 1HZBA 1VQMA 4BY1G 3ICEA 1K83H 1U5KA 1AE2A 4LF9Q 2CKZB 2QGQA 4AQYQ 4DV2L 3M3YH 3AYHB 3G4SA 2E8GA 5M5WH 1EIFA 1VQ8A 3M7NA 4HJ7A 4IFDJ 5GAHC 2D0OA 2IHEA 1JT8A 1SR3A 3D0FA 4MTNA 2AWNA 4A3GH 2KHJA 4DV0Q 3CP0A 4GKJL 5C4JH 2JA6H 2ID0A 2XTIA 3GTPH 5GAEC 4JC0A 3M4OH 2ZTDA 3KDFA 2N78A 4LFBQ 3EN2A 4DR4Q 4BBRH 1XMOL 2KENA 1Y1WG 4A3CH 2FXQA 4DUYQ 4A75A 4K0KQ 3PUYA 1L0WA 1NJIC 3I4MH 4HJ5A 2L15A 4JBMA 1X3FA 5IWAL 4R1JA 1FGUA 1KAWA 1VQEA 1K8AC 4LF7L 2JA8G 4DR5L 3F8TA 4Y7NH 1IL2A 1PFSA 1KHIA 2VQEQ 4DV1L 2K52A 2VL6A 4HIKA 3J80i 4NXMQ 1Q7YC 3FKIG 4L5RC 2ZTCA 1K73C 2UXCL 4LW1A 4A4IA 1Q86C 1X3GA 1PH6A 4LF4L 2YYZA 2EXDA 4X64L 4A3MH 2K14A 2JQOA 1YI2A 3I4OA 2JA8H 1X65A 1KRTA 3U58A 4YHHQ 1EYGA 1WI5A 1XPOA 2UXDQ 4A3JG 3KF8B 1Q81C 2KCTA 3TREA 3M4PA 4JI1Q 4LNQA 5JJIA 4DV7L 4A3FG 1KL9A 1C9OA 1Y1WH 3WWVA 1IBMQ 3NEMA 1EUJA 3F2DA 3TQYA 3F2BA 1K8GA 1I94L 2OTJA 4X65Q 2NVQH 4JBJA 3OTOQ 2WP8J 4WJ4A 3PSIA 5K36G 2Z6KC 3M4QA 3ULLA 2UUBL 5AJ3Q 1VQ4A 2ASBA 3NELA 4JOIA 3NENA 1K9MC 4LF9L 1D8LA 2UUCQ 3AFPA 4AQYL 4OWWB 4YCWA 4JI8Q 4DAYB 3A0JA 4JYAQ 2IHFA 2OQKA 3S24A 3D31A 4IPCA 1HNZQ 4X6AH 1KXLA 1VQDA 5IYBH 3AQQA 2NZHA 3OYYA 5M5XH 4R4OA 3Q8DA 3CPFA 3FKIH 3CQZH 3KDFB 1HNXQ 4OX9L 4X62Q 1VQBA 1VQJA 1IBKQ 2HHHQ 2KBNA 4YCVA 4DV0L 1I50H 4DV6Q 1HR0Q 3AEVA 1XTDA 1PH5A 4IPGA 4GN5A 2V1CC 5IYCH 1XPRA 2K5VA 5IE8A 1HZAA 4LFBL 2YTVA 4JCVE 1V43A 2B63H 3CXCA 3K8AA 4DV2Q 1X9NA 3ULPA 3GTMH 4O0AA 3L2PA 2Y0SG 4DUYL 4K0KL 4O2DA 5IY0A 4BXXH 5DLQE 3M9BA 1PYSB 2AHOB 2C35B 1QZHA 1GM5A 1N32Q 4A3FH 1VQIA 4IOAA 4TQUS 4JI2Q 3I4NG 3JAMi 3CPWA 1SRUA 1P16A 1TWHH 3SGIA 4OWTB 5GADC 5JEAJ 1JMCA 1PH9A 2R6GA 4APVA 1PH3A 4JV5L 2NN6I 1XMOQ 5GQOA 1XNQQ 4MNOA 1S40A 2QA4A 3CCMA 2KHIA 4UPAA 3MXNB 2IX1A 1V9PA 4DUZQ 3CCJA 1IZ6A 4A76A 3HOXG 4LUVA 2GVAA 1Z9FA 4IPDA 1CKOA 3KJOA 3HOWG 5M3FH 1HR0W 2OTLA 4YWKA 1EOVA 4IJLA 3KOJA 4B3TL 4ALPA 2UXDL 2I5MX 2LXKA 1CUKA 1E7ZA 3RR5A 4B3SQ 5FLMG 4P72A 1Q82C 4POGA 1WCMG 2MO0A 3U4ZA 3PO2G 4GKKL 3W5OA 3S2DH 2JA6G 1IBML 4DPGA 5C44G 2JK8A 2LSSA 4X65L 1M1KC 3RN2A 3OTOL 3H15A 1NBWA 4H02A 5AJ3L 4DNIA 5C3EG 1TWGH 1VQOA 1MIUA 5C0XI 4DV3Q 2UUCL 2ZJQA 4JI8L 4DV5L 2F4VQ 4J15A 1HNZL 2NZOA 4UP7A 1U0LA 4DV7Q 1T9HA 2ATWA 3S15H 1HNXL 2WAQG 2R93H 3GO5A 2N3SA 1WOCA 1YJNA 1IBKL 1UE1A 1I94Q 1HR0L 2HHHL 4DV6L 1D7QA 4A3IG 3F2CA 4LF4Q 1L2FA 3HOXH 4LUOA 2JEBI 2UUBQ 3HOWH 3H0GH 1BBWA 2UU9Q 2GVBA 2CCZA 2BH2A 3TEHB 2E5LQ 3A5UA 3K0XA 3J80c 5H1SE 4A3MG 5FLMH 3KYHC 2PQAA 3I56A 1N32L 1WCMH 4P75A 4OX9Q 3PO2H 1HNWQ 5IP9G 4BA2I 1N9WA 4JI2L 1WYDA 1CSPA 3NBHB 3PO3H 1HZCA 1IYJB 3FHWA 4B3RQ 4LF8L 5C44H 1B8AA 4QY7A 4GLVB 1UE5A 1UWVA 4QJFA 5C3EH 2VQFQ 1XNQL 4OXPA 4L5QA 1CKMA 1OXXK 4KHPL 2Z6KA 3F1ZA 3UDIA 1J5EQ 4JI7Q 1YHAA 2IT1A 4DUZL 4A3BH 4P73A 2AWOA 4BY7H 3HOZG 5E7NA 4GN3B 4DAMA 2Y0SE 4PG3A 4A3IH 1SE8A 2K5HA 2PI2A 2XGTA 3E9IA 5IYBG 3PCOB 4JBWA 1WFQA 3CCRA 1ASYA 1VQKA 4B3SL 4UY8C 4JV5Q 2MNAA 2HIVA 3RN5A 4OONA 1NE3A 1YBYA 2Q2UA 4JI5Q 1X55A 4DK6C 1O7IA 5IYCG 4DR6Q 3GD7A 3K81C 2JA9A 4GOPA 1NY4A 5IP9H 2B63G 4JI3Q 3CCSA 4B3TQ 1MJEA 1YEZA 1EWIA 1KRSA 4DV3L 1BBUA 5J3BA 2F4VL 4BXXG 1E1OA 1MJCA 1VQ9A 2YTXA 1VS0A 3GTGH 4UP9A 4GKKQ 4HJAA 1R9TH 3PF4A 4BA1I 4LWCA 4OWXB 5HY6A 3RLOA 3KJPA 1SROA 1X54A 4R4QA 2B3GA 1E1TA 3JAMc 3PUXA 4YCUA 3PUZA 4AH6A 1PHJA 2PQAB 1TWCH 1VQ5A 4JI4Q 2Q2IA 2E2IH 3HOUG 3HOZH 4R4IA 4DV5Q 2UU9L 2JE6I 1A8VA 2E5LL 3K7AH 3S1MH 2MO1A 2JEAI 3H3VI 2K4KA 1YJWA 2ZTEA 3GTJH 1Q8KA 5M3FG 1QVFA 5EAYA 1FL0A 4RMFA 4DR7L 1HNWL 3CC2A 4B3RL 2MFIA 3CD6A 1VCIA 1QVCA 1XMQL 1L1OA 3BZCA 3K7UC 1Q12A 2CWAA 2B29A 3KF6A 4R4CA 1YITA 1X56A 4IFDI 2WAQE 3UDXA 2VQFL 4HIDA 4GOPC 1K3RA 3T1HQ 2OQ0A 2AMCB 1QUQA 1WJJA 2CQOA 3CMAA 1VQAA 2EIFA 4GN4B 3S17H 3BJUA 1PH1A 1J5EL 4JI7L 1RIPA 2NN6G 2D62A 1PH8A 3TS0A 1N33L 2UXBL 4WJ3M 4LF8Q 2VNUD 2AKWB 4OO1I 4GNXA 4RG1A 2H5XA 4JI0Q 2VZAA 5IP7G 3HOUH 2OWOA 2R93G 4P71A 2Q2TA 3HKZG 4GOPB 1Q1BA 4KHPQ 4AYBG 4QL5A 1PH4A 5M5YH 2IX0A 2MQHA 1PA6A 4JI5L 1LYLA 3DLLA 1MKHA 4LF5L 2E2HH 3CCEA 4DR6L 3H0GG 1YNXA 3M85A 4A3KG 4JI3L 1PYBA 1KC8C 2VUMG 1NTGA 2WB1G 1CKNA 1FVIA 1SFOH 4DR1L 4HIMA 1BKBA 1L1OC 5C0XG 2JA5H 2R92G 1S3OA 3PO3G 2R7FA 2ALYB 4IOCA 2HT1A 2R7ZG 2VW9A 1VQ6A 1RL2A 3EIVA 1LTLA 5IT9c 3ER0A 3CCUA 2RCNA 5LMUQ 3W1GA 4JI4L 4FDBA 1OXVA 1EFWA 3HOYG 3CCLA 1QZGA 3FP9A 5M3MG 5HGQA 5LMNW 1KD1C 1JB7A 1ASZA 1X3EA 2K50A 3I2ZA 1N36Q 5IP7H 4GNXC 4A3BG 3AFQA 1L1OB 3CCVA 3KF6B 1M90C 4BY7G 3RLNA 3RNUA 3J81i 1PH2A 1JJGA 4PZ7A 3HFZB 3ERSX 4DV4L 1P8LA 4LF6Q 4JI6Q 2N8NA 2I5HA 1QUQB 1B70B 4P74A 2R7DA 3BU2A 4A3KH 1VQGA 3I7FA 3S1RH 3T1HL 5FJ8G 4DKAC 2JJQA 1YHQA 2VUMH 3CC7A 5BR8Q 2QEXA 1N34L 2YV5A 1SMXA 4GNXB 4HJ9A 4C3JH 2RHQB 4DR7Q 1GO3E 4GLAC 3DM3A 1FJGQ 1Y1VG 2R92H 2ZJPA 4C3HH 4JG2A 2R7ZH 4PZ8A 2Q2HA 1YIJA 1XMQQ 2EQSA 3G71A 4B3ML 3ZJYC 4GLXA 1VQ7A 5JEAG 1DGSA 4JI0L 3TRZA 5LMNL 5JJKA 2WFWA 3HOYH 1VQCA 4YWMA 4EX5A 2RF4A 3PGZA 5M3MH 2DUDA 3CF5A 4HJ8A 1OTCA 1A0IA 3K80C 2N49A 1N33Q 4YWLA 1CKNB 2UXBQ 3OW2A 1PV4A 4NXNL 4X66L 1B7YB 3J7ZC 4LUZA 2PI2E 4KI0A 2A19A 1YVCA 3CW2C 1JJ2A 1JJCB 3S2HH 4LFAL 1AH9A 5FJ8H 2A8VA 4Y52H 4LFCQ 4QQBX 3PV0A 4YY3Q 4LF5Q 2NVTH 2CFMA 3GTQH 5FLXc 2F3IA 4A3LG 5LMUL 2UUAQ 1Y1VH 3KFUA 3HKZE 2ES2A 4AYBE 3S1NH 1V1QA 1TWFH 2VS1A 2NVYH 1EQRA 2HQLA 3EBEA 4MZ9A 5GAGC 2LXJA 4DR1Q 1N36L 1GVPA 1XNRL 1OXUA 3S16H 1HH2P 4BY1H 1W2BA 4XTCS 3CC4A 1EIYB 2D0PA 4LF6L 1G51A 4JI6L 2WB1E 4JBKA 1G291 2E2JH 3RZDH 1Q46A 3GTKH 2ZM6L 4NPSA 3RZOH 3S1QH 2PNHA 1I5FA 1C7YA 5BR8L 1G6PA 3UDFA 2GN5A 4R4TA 5IYDG 1VQNA 1IBLQ 2A1AA 3JC66 4IFDG 4BBSG 1FJGL 3TS2A 4KLKA 3W1BA 4DV4Q 4L5SA 3HOVG 5C0XJ 3S14H 2BH8A 5JJLA 3IRBA 4UP8A 2PMZE 4A3LH 4AIMA 1KIXA 3KLWA 1VQFA 3L0OA 1S72A 4A93G 2BA1A 2JA5G 3GTLH 4DR3L 2KCMA 4DR2Q 3HKSA 1UE6A 4OO1G 1N34Q 1KQSA 1PVOA 1CSQA 1UEBA 3BZKA 1GD7A 3T1YQ 2Z0SA 1H95A 1UE7A 2YU9H 1NMGA 4IJHA 2ZJRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DK3 C;  4B3M Q;  4IO9 A;  2BA0 A;  2OCE A;  3MEF A;  2NVX H;  2YTY A;  1Z47 A;  1YZ6 A;  3H3V H;  1Y14 B;  3STB C;  4A3E G;  4EQ5 A;  5LMN Q;  2JA7 G;  5GRO A;  3STB D;  2CWP A;  4HIO A;  2I5L X;  4ME3 A;  3PUV A;  1XPU A;  1K0R A;  4DR4 L;  4LFC L;  4PMW A;  1C0A A;  4YY3 L;  3A5Z B;  2K5N A;  3J81 c;  1PH7 A;  2I0Q A;  4A3J H;  4NXN Q;  5IYD H;  4X66 Q;  2UUA L;  4BBS H;  1E3P A;  4IPH A;  2IY5 B;  3HOV H;  1E22 A;  1BVS A;  3RLF A;  3CAM A;  4TVA B;  3LGJ A;  4C3I H;  4A3D G;  4GKJ Q;  3PIO A;  4A93 H;  1VQH A;  4LFA Q;  3PIP A;  4L5T A;  1LM0 A;  2VQE L;  5C4X G;  1A62 A;  1GKH A;  3UE1 A;  1SLJ A;  1VQL A;  4NXM L;  1A63 A;  2K75 A;  3ULJ A;  4JOI C;  4NB3 A;  1LUZ A;  3U50 C;  5IWA Q;  3G48 A;  1YHB A;  4LF7 Q;  4DR5 Q;  3L7Z C;  4YHH L;  4QIW E;  4A3E H;  2JA7 H;  1X6O A;  4C2M H;  1XJV A;  1QVG A;  1IBL L;  4DV1 Q;  1XNR Q;  2RHS B;  3PF5 A;  3PUW A;  3UE0 A;  4QGU A;  4JI1 L;  3CME A;  1TWA H;  4XIG S;  3G6E A;  1VQP A;  2UXC Q;  4A3G G;  1W3S A;  3U4V A;  5ELO A;  2VY3 A;  3A74 A;  1E24 A;  3UDG A;  1JE5 A;  1AE3 A;  3B6Y A;  4X64 Q;  2ZM6 Q;  1EQQ A;  2HIX A;  1HZ9 A;  1IXR A;  4BBR G;  4DR2 L;  3VDY A;  3I4N H;  4A3D H;  1I6H H;  1NMF A;  4A3C G;  3T1Y L;  3CCQ A;  1SN8 A;  3E0E A;  5ELN A;  4POF A;  1J6Q A;  3GTO H;  3I4M G;  4JYA L;  1TXY A;  5C4X H;  4PZ6 A;  3GDE A;  1OXS C;  4KHZ A;  1OXT A;  2F52 A;  3J81 j;  1N8R C;  3I55 A;  3J7A 5;  3E9H A;  4X62 L;  1I3Q H;  1HJP A;  1Q1E A;  1YJ9 A;  2DGY A;  4GS3 A;  4DR3 Q;  1HZB A;  1VQM A;  4BY1 G;  3ICE A;  1K83 H;  1U5K A;  1AE2 A;  4LF9 Q;  2CKZ B;  2QGQ A;  4AQY Q;  4DV2 L;  3M3Y H;  3AYH B;  3G4S A;  2E8G A;  5M5W H;  1EIF A;  1VQ8 A;  3M7N A;  4HJ7 A;  4IFD J;  5GAH C;  2D0O A;  2IHE A;  1JT8 A;  1SR3 A;  3D0F A;  4MTN A;  2AWN A;  4A3G H;  2KHJ A;  4DV0 Q;  3CP0 A;  4GKJ L;  5C4J H;  2JA6 H;  2ID0 A;  2XTI A;  3GTP H;  5GAE C;  4JC0 A;  3M4O H;  2ZTD A;  3KDF A;  2N78 A;  4LFB Q;  3EN2 A;  4DR4 Q;  4BBR H;  1XMO L;  2KEN A;  1Y1W G;  4A3C H;  2FXQ A;  4DUY Q;  4A75 A;  4K0K Q;  3PUY A;  1L0W A;  1NJI C;  3I4M H;  4HJ5 A;  2L15 A;  4JBM A;  1X3F A;  5IWA L;  4R1J A;  1FGU A;  1KAW A;  1VQE A;  1K8A C;  4LF7 L;  2JA8 G;  4DR5 L;  3F8T A;  4Y7N H;  1IL2 A;  1PFS A;  1KHI A;  2VQE Q;  4DV1 L;  2K52 A;  2VL6 A;  4HIK A;  3J80 i;  4NXM Q;  1Q7Y C;  3FKI G;  4L5R C;  2ZTC A;  1K73 C;  2UXC L;  4LW1 A;  4A4I A;  1Q86 C;  1X3G A;  1PH6 A;  4LF4 L;  2YYZ A;  2EXD A;  4X64 L;  4A3M H;  2K14 A;  2JQO A;  1YI2 A;  3I4O A;  2JA8 H;  1X65 A;  1KRT A;  3U58 A;  4YHH Q;  1EYG A;  1WI5 A;  1XPO A;  2UXD Q;  4A3J G;  3KF8 B;  1Q81 C;  2KCT A;  3TRE A;  3M4P A;  4JI1 Q;  4LNQ A;  5JJI A;  4DV7 L;  4A3F G;  1KL9 A;  1C9O A;  1Y1W H;  3WWV A;  1IBM Q;  3NEM A;  1EUJ A;  3F2D A;  3TQY A;  3F2B A;  1K8G A;  1I94 L;  2OTJ A;  4X65 Q;  2NVQ H;  4JBJ A;  3OTO Q;  2WP8 J;  4WJ4 A;  3PSI A;  5K36 G;  2Z6K C;  3M4Q A;  3ULL A;  2UUB L;  5AJ3 Q;  1VQ4 A;  2ASB A;  3NEL A;  4JOI A;  3NEN A;  1K9M C;  4LF9 L;  1D8L A;  2UUC Q;  3AFP A;  4AQY L;  4OWW B;  4YCW A;  4JI8 Q;  4DAY B;  3A0J A;  4JYA Q;  2IHF A;  2OQK A;  3S24 A;  3D31 A;  4IPC A;  1HNZ Q;  4X6A H;  1KXL A;  1VQD A;  5IYB H;  3AQQ A;  2NZH A;  3OYY A;  5M5X H;  4R4O A;  3Q8D A;  3CPF A;  3FKI H;  3CQZ H;  3KDF B;  1HNX Q;  4OX9 L;  4X62 Q;  1VQB A;  1VQJ A;  1IBK Q;  2HHH Q;  2KBN A;  4YCV A;  4DV0 L;  1I50 H;  4DV6 Q;  1HR0 Q;  3AEV A;  1XTD A;  1PH5 A;  4IPG A;  4GN5 A;  2V1C C;  5IYC H;  1XPR A;  2K5V A;  5IE8 A;  1HZA A;  4LFB L;  2YTV A;  4JCV E;  1V43 A;  2B63 H;  3CXC A;  3K8A A;  4DV2 Q;  1X9N A;  3ULP A;  3GTM H;  4O0A A;  3L2P A;  2Y0S G;  4DUY L;  4K0K L;  4O2D A;  5IY0 A;  4BXX H;  5DLQ E;  3M9B A;  1PYS B;  2AHO B;  2C35 B;  1QZH A;  1GM5 A;  1N32 Q;  4A3F H;  1VQI A;  4IOA A;  4TQU S;  4JI2 Q;  3I4N G;  3JAM i;  3CPW A;  1SRU A;  1P16 A;  1TWH H;  3SGI A;  4OWT B;  5GAD C;  5JEA J;  1JMC A;  1PH9 A;  2R6G A;  4APV A;  1PH3 A;  4JV5 L;  2NN6 I;  1XMO Q;  5GQO A;  1XNQ Q;  4MNO A;  1S40 A;  2QA4 A;  3CCM A;  2KHI A;  4UPA A;  3MXN B;  2IX1 A;  1V9P A;  4DUZ Q;  3CCJ A;  1IZ6 A;  4A76 A;  3HOX G;  4LUV A;  2GVA A;  1Z9F A;  4IPD A;  1CKO A;  3KJO A;  3HOW G;  5M3F H;  1HR0 W;  2OTL A;  4YWK A;  1EOV A;  4IJL A;  3KOJ A;  4B3T L;  4ALP A;  2UXD L;  2I5M X;  2LXK A;  1CUK A;  1E7Z A;  3RR5 A;  4B3S Q;  5FLM G;  4P72 A;  1Q82 C;  4POG A;  1WCM G;  2MO0 A;  3U4Z A;  3PO2 G;  4GKK L;  3W5O A;  3S2D H;  2JA6 G;  1IBM L;  4DPG A;  5C44 G;  2JK8 A;  2LSS A;  4X65 L;  1M1K C;  3RN2 A;  3OTO L;  3H15 A;  1NBW A;  4H02 A;  5AJ3 L;  4DNI A;  5C3E G;  1TWG H;  1VQO A;  1MIU A;  5C0X I;  4DV3 Q;  2UUC L;  2ZJQ A;  4JI8 L;  4DV5 L;  2F4V Q;  4J15 A;  1HNZ L;  2NZO A;  4UP7 A;  1U0L A;  4DV7 Q;  1T9H A;  2ATW A;  3S15 H;  1HNX L;  2WAQ G;  2R93 H;  3GO5 A;  2N3S A;  1WOC A;  1YJN A;  1IBK L;  1UE1 A;  1I94 Q;  1HR0 L;  2HHH L;  4DV6 L;  1D7Q A;  4A3I G;  3F2C A;  4LF4 Q;  1L2F A;  3HOX H;  4LUO A;  2JEB I;  2UUB Q;  3HOW H;  3H0G H;  1BBW A;  2UU9 Q;  2GVB A;  2CCZ A;  2BH2 A;  3TEH B;  2E5L Q;  3A5U A;  3K0X A;  3J80 c;  5H1S E;  4A3M G;  5FLM H;  3KYH C;  2PQA A;  3I56 A;  1N32 L;  1WCM H;  4P75 A;  4OX9 Q;  3PO2 H;  1HNW Q;  5IP9 G;  4BA2 I;  1N9W A;  4JI2 L;  1WYD A;  1CSP A;  3NBH B;  3PO3 H;  1HZC A;  1IYJ B;  3FHW A;  4B3R Q;  4LF8 L;  5C44 H;  1B8A A;  4QY7 A;  4GLV B;  1UE5 A;  1UWV A;  4QJF A;  5C3E H;  2VQF Q;  1XNQ L;  4OXP A;  4L5Q A;  1CKM A;  1OXX K;  4KHP L;  2Z6K A;  3F1Z A;  3UDI A;  1J5E Q;  4JI7 Q;  1YHA A;  2IT1 A;  4DUZ L;  4A3B H;  4P73 A;  2AWO A;  4BY7 H;  3HOZ G;  5E7N A;  4GN3 B;  4DAM A;  2Y0S E;  4PG3 A;  4A3I H;  1SE8 A;  2K5H A;  2PI2 A;  2XGT A;  3E9I A;  5IYB G;  3PCO B;  4JBW A;  1WFQ A;  3CCR A;  1ASY A;  1VQK A;  4B3S L;  4UY8 C;  4JV5 Q;  2MNA A;  2HIV A;  3RN5 A;  4OON A;  1NE3 A;  1YBY A;  2Q2U A;  4JI5 Q;  1X55 A;  4DK6 C;  1O7I A;  5IYC G;  4DR6 Q;  3GD7 A;  3K81 C;  2JA9 A;  4GOP A;  1NY4 A;  5IP9 H;  2B63 G;  4JI3 Q;  3CCS A;  4B3T Q;  1MJE A;  1YEZ A;  1EWI A;  1KRS A;  4DV3 L;  1BBU A;  5J3B A;  2F4V L;  4BXX G;  1E1O A;  1MJC A;  1VQ9 A;  2YTX A;  1VS0 A;  3GTG H;  4UP9 A;  4GKK Q;  4HJA A;  1R9T H;  3PF4 A;  4BA1 I;  4LWC A;  4OWX B;  5HY6 A;  3RLO A;  3KJP A;  1SRO A;  1X54 A;  4R4Q A;  2B3G A;  1E1T A;  3JAM c;  3PUX A;  4YCU A;  3PUZ A;  4AH6 A;  1PHJ A;  2PQA B;  1TWC H;  1VQ5 A;  4JI4 Q;  2Q2I A;  2E2I H;  3HOU G;  3HOZ H;  4R4I A;  4DV5 Q;  2UU9 L;  2JE6 I;  1A8V A;  2E5L L;  3K7A H;  3S1M H;  2MO1 A;  2JEA I;  3H3V I;  2K4K A;  1YJW A;  2ZTE A;  3GTJ H;  1Q8K A;  5M3F G;  1QVF A;  5EAY A;  1FL0 A;  4RMF A;  4DR7 L;  1HNW L;  3CC2 A;  4B3R L;  2MFI A;  3CD6 A;  1VCI A;  1QVC A;  1XMQ L;  1L1O A;  3BZC A;  3K7U C;  1Q12 A;  2CWA A;  2B29 A;  3KF6 A;  4R4C A;  1YIT A;  1X56 A;  4IFD I;  2WAQ E;  3UDX A;  2VQF L;  4HID A;  4GOP C;  1K3R A;  3T1H Q;  2OQ0 A;  2AMC B;  1QUQ A;  1WJJ A;  2CQO A;  3CMA A;  1VQA A;  2EIF A;  4GN4 B;  3S17 H;  3BJU A;  1PH1 A;  1J5E L;  4JI7 L;  1RIP A;  2NN6 G;  2D62 A;  1PH8 A;  3TS0 A;  1N33 L;  2UXB L;  4WJ3 M;  4LF8 Q;  2VNU D;  2AKW B;  4OO1 I;  4GNX A;  4RG1 A;  2H5X A;  4JI0 Q;  2VZA A;  5IP7 G;  3HOU H;  2OWO A;  2R93 G;  4P71 A;  2Q2T A;  3HKZ G;  4GOP B;  1Q1B A;  4KHP Q;  4AYB G;  4QL5 A;  1PH4 A;  5M5Y H;  2IX0 A;  2MQH A;  1PA6 A;  4JI5 L;  1LYL A;  3DLL A;  1MKH A;  4LF5 L;  2E2H H;  3CCE A;  4DR6 L;  3H0G G;  1YNX A;  3M85 A;  4A3K G;  4JI3 L;  1PYB A;  1KC8 C;  2VUM G;  1NTG A;  2WB1 G;  1CKN A;  1FVI A;  1SFO H;  4DR1 L;  4HIM A;  1BKB A;  1L1O C;  5C0X G;  2JA5 H;  2R92 G;  1S3O A;  3PO3 G;  2R7F A;  2ALY B;  4IOC A;  2HT1 A;  2R7Z G;  2VW9 A;  1VQ6 A;  1RL2 A;  3EIV A;  1LTL A;  5IT9 c;  3ER0 A;  3CCU A;  2RCN A;  5LMU Q;  3W1G A;  4JI4 L;  4FDB A;  1OXV A;  1EFW A;  3HOY G;  3CCL A;  1QZG A;  3FP9 A;  5M3M G;  5HGQ A;  5LMN W;  1KD1 C;  1JB7 A;  1ASZ A;  1X3E A;  2K50 A;  3I2Z A;  1N36 Q;  5IP7 H;  4GNX C;  4A3B G;  3AFQ A;  1L1O B;  3CCV A;  3KF6 B;  1M90 C;  4BY7 G;  3RLN A;  3RNU A;  3J81 i;  1PH2 A;  1JJG A;  4PZ7 A;  3HFZ B;  3ERS X;  4DV4 L;  1P8L A;  4LF6 Q;  4JI6 Q;  2N8N A;  2I5H A;  1QUQ B;  1B70 B;  4P74 A;  2R7D A;  3BU2 A;  4A3K H;  1VQG A;  3I7F A;  3S1R H;  3T1H L;  5FJ8 G;  4DKA C;  2JJQ A;  1YHQ A;  2VUM H;  3CC7 A;  5BR8 Q;  2QEX A;  1N34 L;  2YV5 A;  1SMX A;  4GNX B;  4HJ9 A;  4C3J H;  2RHQ B;  4DR7 Q;  1GO3 E;  4GLA C;  3DM3 A;  1FJG Q;  1Y1V G;  2R92 H;  2ZJP A;  4C3H H;  4JG2 A;  2R7Z H;  4PZ8 A;  2Q2H A;  1YIJ A;  1XMQ Q;  2EQS A;  3G71 A;  4B3M L;  3ZJY C;  4GLX A;  1VQ7 A;  5JEA G;  1DGS A;  4JI0 L;  3TRZ A;  5LMN L;  5JJK A;  2WFW A;  3HOY H;  1VQC A;  4YWM A;  4EX5 A;  2RF4 A;  3PGZ A;  5M3M H;  2DUD A;  3CF5 A;  4HJ8 A;  1OTC A;  1A0I A;  3K80 C;  2N49 A;  1N33 Q;  4YWL A;  1CKN B;  2UXB Q;  3OW2 A;  1PV4 A;  4NXN L;  4X66 L;  1B7Y B;  3J7Z C;  4LUZ A;  2PI2 E;  4KI0 A;  2A19 A;  1YVC A;  3CW2 C;  1JJ2 A;  1JJC B;  3S2H H;  4LFA L;  1AH9 A;  5FJ8 H;  2A8V A;  4Y52 H;  4LFC Q;  4QQB X;  3PV0 A;  4YY3 Q;  4LF5 Q;  2NVT H;  2CFM A;  3GTQ H;  5FLX c;  2F3I A;  4A3L G;  5LMU L;  2UUA Q;  1Y1V H;  3KFU A;  3HKZ E;  2ES2 A;  4AYB E;  3S1N H;  1V1Q A;  1TWF H;  2VS1 A;  2NVY H;  1EQR A;  2HQL A;  3EBE A;  4MZ9 A;  5GAG C;  2LXJ A;  4DR1 Q;  1N36 L;  1GVP A;  1XNR L;  1OXU A;  3S16 H;  1HH2 P;  4BY1 H;  1W2B A;  4XTC S;  3CC4 A;  1EIY B;  2D0P A;  4LF6 L;  1G51 A;  4JI6 L;  2WB1 E;  4JBK A;  1G29 1;  2E2J H;  3RZD H;  1Q46 A;  3GTK H;  2ZM6 L;  4NPS A;  3RZO H;  3S1Q H;  2PNH A;  1I5F A;  1C7Y A;  5BR8 L;  1G6P A;  3UDF A;  2GN5 A;  4R4T A;  5IYD G;  1VQN A;  1IBL Q;  2A1A A;  3JC6 6;  4IFD G;  4BBS G;  1FJG L;  3TS2 A;  4KLK A;  3W1B A;  4DV4 Q;  4L5S A;  3HOV G;  5C0X J;  3S14 H;  2BH8 A;  5JJL A;  3IRB A;  4UP8 A;  2PMZ E;  4A3L H;  4AIM A;  1KIX A;  3KLW A;  1VQF A;  3L0O A;  1S72 A;  4A93 G;  2BA1 A;  2JA5 G;  3GTL H;  4DR3 L;  2KCM A;  4DR2 Q;  3HKS A;  1UE6 A;  4OO1 G;  1N34 Q;  1KQS A;  1PVO A;  1CSQ A;  1UEB A;  3BZK A;  1GD7 A;  3T1Y Q;  2Z0S A;  1H95 A;  1UE7 A;  2YU9 H;  1NMG A;  4IJH A;  2ZJR A; 
#chains in the Genus database with same CATH topology
 1ZKO A;  5BN5 A;  1STN A;  3KUP A;  3HEJ A;  2XIW A;  1Y14 B;  3ERO A;  4HIO A;  4C2M B;  1GOZ A;  4DU9 A;  3J81 c;  2Z4H A;  4BBS H;  3RLF A;  4C3I H;  4GKJ Q;  3I4N B;  4A3D B;  1I6H B;  1ILP A;  1RDP D;  3H94 A;  4RA8 A;  5C4X G;  5K36 H;  2IJ0 A;  2KJX A;  3UE1 A;  1L0Y B;  1SLJ A;  4X3K A;  1DOL A;  2K75 A;  5I2Y A;  1LUZ A;  1TKW B;  3P75 A;  5IWA Q;  1E2W A;  3J80 L;  1YHB A;  2QDL A;  3L7Z C;  4QIW E;  1CQF A;  5M5W B;  4Q0F A;  3PF5 A;  3PUW A;  3UE0 A;  3VYU A;  1OO9 B;  4JI1 L;  1TWA H;  4QGU A;  4ZKB B;  3CME A;  4N8F A;  4A3G B;  1MD2 D;  4OIJ A;  2HIX A;  3VDY A;  4A3C G;  4RHR A;  4KY5 A;  5ELN A;  4JYA L;  3I4M G;  5C4X H;  1PFN A;  3GDE A;  3J81 j;  1N8R C;  3I55 A;  2WAQ B;  4X62 L;  1I3Q H;  1D2B A;  1J8I A;  1YJ9 A;  3OSO A;  4KY6 A;  1VQM A;  4BY1 G;  1U5K A;  5C3W A;  2CKZ B;  2QGQ A;  4DV2 L;  3M3Y H;  3AYH B;  1A3T A;  2EXZ A;  4JW0 A;  4K5X A;  4LJZ C;  3M7N A;  4A3M B;  1BCP C;  1TVX A;  2D0O A;  2ICE C;  1KTK A;  2A74 C;  3D3R A;  1D1K A;  3D0F A;  2Z1C A;  4MTN A;  2KHJ A;  2FJ2 A;  5C4Z A;  4DV0 Q;  4ZQ3 A;  2ID0 A;  2XTI A;  2DJF C;  2KEE A;  4KN4 C;  3KDF A;  2A6E C;  4A3C H;  1D5X C;  4K0K Q;  1NJI C;  3I4M H;  4KKS A;  5EKI A;  1BCP B;  2JA8 G;  4LF7 L;  4PMB A;  4DR5 L;  3QIA A;  3F8T A;  4DV1 L;  2LS0 1;  4HIK A;  3T56 B;  1Q7Y C;  4L5R C;  2ZTC A;  1FNU A;  1ENC A;  4YIJ A;  1Z7T A;  2F0K A;  2A68 C;  1VF5 C;  1YI2 A;  3I4O A;  1F2Y A;  3U58 A;  3X3N A;  1WI5 A;  1UUP A;  1STE A;  3TRE A;  4JI1 Q;  2MHV A;  4V0B A;  1QIL A;  4A3F G;  1KL9 A;  1SDF A;  3WWV A;  1EUJ A;  4C1N I;  3TQY A;  3F2D A;  1K8G A;  4DAV A;  2KCN A;  2Q8R E;  4JBJ A;  4QUF A;  2WP8 J;  4KKT A;  4K8J A;  2Z6K C;  1VQ4 A;  2JA8 H;  1D8L A;  2FMM A;  3AFP A;  4AQY L;  2UUC Q;  4IUQ A;  4YCW A;  4JYA Q;  1FR3 A;  4IPC A;  4IUR A;  4DGZ A;  2NZH A;  2GA4 B;  4OX9 L;  4K6L A;  4X62 Q;  1VQJ A;  3ERQ A;  4YCV A;  1HR0 Q;  1I50 H;  5EPL A;  1BUV T;  1SNC A;  1EY8 A;  1SE3 A;  2F0N A;  2K5V A;  2NUC A;  4LFB L;  1V43 A;  3VR6 A;  4DV2 Q;  1D5Z C;  3DWA A;  1X9N A;  1LLR D;  1RJT A;  2CHB D;  4DUY L;  3M7G A;  4DAP A;  4O2D A;  1Y8P B;  2RA4 A;  3GV6 A;  3K5N A;  4BXX H;  1N32 Q;  1PYS B;  2AHO B;  2C35 B;  1GM5 A;  3A54 A;  4A3F H;  1VQI A;  4IOA A;  5EQ0 A;  4CKE A;  4J6H A;  3CPW A;  3I4N G;  1SRU A;  2K7V A;  2RDG A;  1B3Q A;  3SGI A;  4XQQ A;  5EPK A;  5JEA J;  1PH9 A;  3OMG A;  4APV A;  1PH3 A;  4JV5 L;  2NN6 I;  1HCZ A;  2I46 A;  4MNO A;  4G7Z C;  2H1E A;  3CCM A;  2R93 B;  3HKZ B;  3MXN B;  1EYC A;  4CJ0 B;  1IZ6 A;  1PTO D;  1PMR A;  1JT8 A;  1HR0 W;  3CKI B;  3W2D A;  4C1N K;  3H0G B;  1EOV A;  4ALP A;  4MTK A;  1CHP D;  2CW0 D;  3U4Z A;  1WCM B;  4RAU C;  3Q23 A;  3VR3 A;  3OPO A;  5C44 G;  2DNC A;  3PO3 B;  1M1K C;  2CH4 W;  2SEB D;  5C3E G;  1A3U A;  1MIU A;  1O7L A;  1HNZ L;  2HQE A;  1WTP A;  1AN8 A;  3MA2 B;  2WAQ G;  4CHT B;  1YJN A;  4BY7 B;  1UE1 A;  1EZ6 A;  2B2Y C;  3F2C A;  1L2F A;  4G7H C;  4A3I B;  2B2U A;  3DEO A;  2XRS D;  2CCZ A;  3E6Z X;  1PTO F;  4BWG B;  3S2H B;  2K32 A;  4IZ8 A;  4A3M G;  3KYH C;  3I56 A;  2A69 D;  1DON A;  4OX9 Q;  3EQL C;  1EFI D;  1JOK A;  1SNO A;  2DN8 A;  2X69 A;  3V05 A;  4BA2 I;  1WYD A;  1HZC A;  1IYJ B;  4B3R Q;  1Y8O B;  5C44 H;  3Q6S A;  3VR4 A;  2NYZ D;  4QJF A;  5C3E H;  3LWU A;  2E74 C;  2ENB A;  1WTV A;  4OXP A;  1XNQ L;  3GTG B;  3VYT A;  4L5Q A;  1CKM A;  3MVV A;  3F1Z A;  2EYM A;  1J5E Q;  1R4P B;  1WVL A;  5EJW A;  4DNT B;  4A3B H;  5E7N A;  2EPB A;  3BS1 A;  1V1P A;  4F88 A;  2K5H A;  2XGT A;  5HGT A;  3A7L A;  4JV5 Q;  1ASY A;  3D6C A;  3MXP A;  2HIV A;  4I7Z C;  4UDU C;  5I2X A;  3RN5 A;  3MTS A;  3OMC A;  3F2U A;  3NTH A;  1PZK D;  3T51 B;  4JI5 Q;  1JR0 D;  4DK6 C;  5IYC G;  4DR6 Q;  3S14 B;  4GOP A;  3J81 E;  3CRL C;  1UAP A;  4DV3 L;  2F4V L;  4EVO A;  5C6A A;  2IX3 A;  1E1O A;  4HJA A;  3KJP A;  4OWX B;  1BF4 A;  3MXU A;  1TS2 A;  5D3D A;  2Q2I A;  2E2I H;  3HOU B;  2UU9 L;  3KLS A;  1A8V A;  1IW7 C;  3H3V I;  2ZTE A;  1QE6 A;  1HNW L;  4XT3 B;  2MFI A;  3KBX A;  1VCI A;  1K8M A;  1L1O A;  3K7U C;  1Q12 A;  4KTA A;  4R4C A;  3UDX A;  4A93 B;  3T1H Q;  1QUQ A;  3S17 H;  5JPN C;  4JPB W;  1K3B C;  2LY7 A;  2L11 A;  1HQM C;  3OWE B;  4OO1 I;  2R61 A;  5IIF A;  3P7J A;  3WDN A;  2OWO A;  2R93 G;  3MXG A;  4P71 A;  2OXP A;  3HKZ G;  4A3E B;  2Q2T A;  1PZI D;  4QL5 A;  2IX0 A;  3SEB A;  1MKH A;  4LF5 L;  4JVZ A;  4OGQ C;  3H0G G;  1JE4 A;  1F77 A;  5FO8 B;  4NW2 A;  2G9D A;  2WB1 B;  4IUN A;  4HIM A;  1BKB A;  4KV6 A;  5C0X G;  2JA5 H;  2CVR A;  3PO3 G;  4J1M A;  2R7F A;  2ALY B;  4CBV A;  3AMU A;  1VQ6 A;  3OW7 A;  4C3H B;  1LTL A;  4F7X A;  1SEB D;  5LMU Q;  3OIP A;  1SYE A;  5M3M B;  1X3E A;  2K50 A;  4DNR B;  4GNX C;  4DN4 M;  1VMC A;  3IL8 A;  1M90 C;  4BY7 G;  4JI6 Q;  2WIN B;  1EIG A;  3N52 A;  5EPJ A;  1QOH A;  1O7Z A;  3BU2 A;  5C4J B;  1HHV A;  1G2S A;  3I7F A;  3S1R H;  2WKC A;  1LT6 D;  3C1F A;  1SYC A;  4DKA C;  3TBI B;  2OT2 A;  4BBR B;  4R8I A;  4Q5V A;  4GNX B;  1Q90 A;  1STB A;  3DM3 A;  5C0X H;  1Y1V G;  4P2C B;  1A2T A;  2CH4 A;  4JG2 A;  1HFG A;  2Q2H A;  2EQS A;  3G71 A;  4IUP A;  3ZJY C;  1VQ7 A;  5JEA G;  1DGS A;  2SOB A;  2WFW A;  4HCE A;  1VQC A;  4EX5 A;  1A0I A;  4RGT A;  3K80 C;  2N49 A;  2J4X A;  2PZW A;  1CKN B;  2AQ2 B;  2FHT A;  3SK4 A;  1TR5 A;  4LUZ A;  1ZYR D;  3NHH A;  3CW2 C;  5TSS A;  1JJC B;  3S2H H;  1O78 A;  1PYW D;  2A8V A;  4Y52 H;  4QQB X;  2QEJ C;  4YY3 Q;  4LF5 Q;  3I90 A;  4NDX A;  2KHS A;  1NR2 A;  2UUA Q;  1LO5 D;  1Y1V H;  1FGB D;  2ES2 A;  3UI2 A;  1SE2 A;  4AYB E;  3S1N H;  1F9P A;  4ULL A;  1CT1 D;  1TWF H;  2VS1 A;  2NVY H;  4N8X 1;  2QKI C;  5JEA H;  2LXJ A;  4ME5 A;  2VB2 X;  5EBD A;  3TN2 A;  3DWP A;  2WB1 E;  1LTA D;  3FKI B;  1EY4 A;  4RGO S;  3NWS A;  3GTK H;  4NPS A;  3RZO H;  3BYT B;  1G6P A;  5BR8 L;  4R9W A;  3UDF A;  1JQY D;  3T53 B;  4IFD G;  1ILQ A;  2RDF A;  4BBS B;  1GUW A;  4KLK A;  3VA7 A;  3S14 H;  3K5L A;  4C3I B;  3H09 A;  3KLW A;  3BDL A;  4CKC A;  4A93 G;  1B2T A;  1SNM A;  1B4O A;  4S3S A;  1HTL D;  1NMG A;  1U4P A;  5DM7 3;  2F4I A;  4DK3 C;  5A2Q E;  2OCE A;  1DOM A;  2E2D C;  1YZ6 A;  2QIL A;  3STB C;  4A3E G;  5GRO A;  1I4H A;  1MHW C;  2CWP A;  3EFX D;  1XPU A;  4NKL A;  4DR4 L;  4LFC L;  1TWA B;  2K5N A;  1JOO A;  4XXE A;  4A3J H;  4IFD H;  4ABN A;  2Y0S B;  4IPH A;  5I6W A;  4TVA B;  3LGJ A;  1ZXT A;  1SND A;  3PIO A;  1WTO A;  4A93 H;  1PDQ A;  3PIP A;  1LM0 A;  1GJX A;  5C4X B;  1VQL A;  4NXM L;  1B44 D;  3S15 B;  4V19 0;  1I3Q B;  1F9S A;  4CKB A;  2JN4 A;  1IYU A;  3G48 A;  1AZP A;  2BDO A;  4MN3 A;  4A3E H;  1XJV A;  3GP7 A;  1IBL L;  2CW0 C;  4DK1 A;  3BVG A;  1W3S A;  3U4V A;  2VY3 A;  3URY A;  4X64 Q;  4X3U A;  4HMJ A;  1RF2 D;  1HZ9 A;  4BBR G;  4O1N A;  4DF7 A;  2AQ3 B;  1LT4 D;  3T1Y L;  4CDF C;  2G9H D;  1EZ8 A;  1TXY A;  1CZW A;  2JP1 A;  4KHZ A;  1OXT A;  2F52 A;  3KF8 A;  5BN3 A;  3IFD A;  4JK1 C;  1K83 H;  3ITP A;  1K8O A;  3MHB A;  3TP6 A;  2K5W A;  5E1F A;  2F0U A;  5ELE A;  1I6V C;  2E8G A;  2A69 C;  4DAY A;  2FIN B;  4GKJ L;  2D2C C;  3CP0 A;  5C4J H;  2JA6 H;  2WKD A;  4JC0 A;  5I6Y A;  3EN2 A;  4DR4 Q;  4BBR H;  4HTH A;  4A75 A;  1L0W A;  2MP1 A;  5I9P A;  4HJ5 A;  2L15 A;  1DM0 B;  2EYP A;  5IWA L;  1FGU A;  1KAW A;  1VQE A;  3W3A A;  4K2L A;  1SYB A;  1PFS A;  4NXM Q;  3FKI G;  3HG9 A;  3AU7 A;  1PFB A;  3R3O A;  5FO9 B;  1YNN D;  2F0E A;  4LW1 A;  4A4I A;  1K73 C;  1ONL A;  1X3G A;  3V96 A;  1JCK B;  1PH6 A;  3HZX A;  2EXD A;  3QR8 A;  3TZD A;  2HDM A;  1KRT A;  1EYG A;  4OEM B;  4FXK C;  1JC7 A;  5JJI A;  3WOE A;  4C3I G;  2XN9 C;  1VMP A;  1IBM Q;  3NEM A;  3F2B A;  1I94 L;  2OTJ A;  4X65 Q;  1RTN A;  3OTO Q;  1I4Q A;  4WJ4 A;  5K36 G;  4KN7 C;  2UUB L;  5AJ3 Q;  3NEL A;  4JOI A;  4OWW B;  4JI8 Q;  2IHF A;  3D31 A;  1H9R A;  3NPP A;  5IYB H;  3OYY A;  1HNX Q;  5M5X H;  4R4O A;  4UAI A;  3FKI H;  3CQZ H;  3K59 A;  3DMU A;  1VQB A;  1IBK Q;  1X32 A;  3PIO 3;  2KBN A;  4DV0 L;  5T1I A;  4GN5 A;  1TS4 A;  2V1C C;  1XPR A;  5IE8 A;  1HZA A;  2NTS A;  1QNU A;  5J39 A;  5IT9 L;  1C4Q A;  2Y0S G;  4K0K L;  1LV9 A;  1EU3 A;  1QZH A;  2X6L A;  5JJZ A;  4TQU S;  1AW7 A;  1C48 A;  3RUZ A;  2EY5 A;  4KJO A;  1LAC A;  1UEA B;  2M2L A;  2KOL A;  3NBH A;  2HCI A;  1S40 A;  2QA4 A;  2K01 A;  4UPA A;  4HSP A;  1IYV A;  4A76 A;  4LUV A;  4H7B A;  4RFB A;  5M3F H;  3SVM A;  2CQA A;  1M8A A;  4N9P A;  2I5M X;  1E7Z A;  2K04 A;  4B3S Q;  5D65 A;  2MO0 A;  3ND9 A;  2EZV A;  1EYD A;  3W5O A;  2J0T D;  4KK7 A;  4DPG A;  2TMP A;  2LSS A;  5C44 B;  3RN2 A;  3H15 A;  1ICF B;  1NBW A;  1A6X A;  5C3E B;  2UUC L;  2LMC B;  2F0V A;  4UP7 A;  1T9H A;  3S15 H;  2PMZ B;  2M00 A;  3GO5 A;  4A3B B;  1WOC A;  1I94 Q;  3MEH A;  1HR0 L;  2F0S A;  4LF4 Q;  2JEB I;  4EGV A;  2UUB Q;  2N88 A;  3BYY B;  2L5T A;  2GVB A;  3VA5 A;  2E5L Q;  5FLX L;  5KND A;  3NXW A;  1N32 L;  4P75 A;  2B2T C;  1DCZ A;  1PTO H;  4G4K A;  1ENF A;  2A5H A;  1CHQ D;  4GLV B;  1UE5 A;  2PCF B;  2Z9H A;  2KED A;  2AUK A;  3SE0 A;  2Z4I A;  3JAM L;  1GHK A;  5CV5 A;  4KHP L;  2K5Q A;  2EJM A;  3UDI A;  3TZU A;  4JI7 Q;  1RCV D;  3QOL A;  2E2I B;  5LHY 1;  3CD6 A;  3QG1 A;  1SE8 A;  1ZYR C;  2PI2 A;  3O13 A;  5KNB A;  3SK8 A;  4JBW A;  4UY8 C;  1NUC A;  1PRT D;  1MSG A;  1TY2 A;  3D4R A;  4RCN A;  3DHQ A;  1O7I A;  1UNS A;  1DD2 A;  3GD7 A;  1NY4 A;  3ONA B;  1YEZ A;  1EWI A;  1KRS A;  1EEI D;  2WII B;  3K0Y A;  4BXX G;  3S17 B;  3CHB D;  1VQ9 A;  3OOC A;  4KKU A;  2P5Z X;  2YU9 B;  1XX8 A;  1YNJ D;  5HY6 A;  1SRO A;  4R4Q A;  3PUX A;  2H4O A;  2PQA B;  1FNW A;  5COY A;  4K8I A;  4R4I A;  3Q24 A;  1LTB D;  3S1M H;  2XVS A;  2MO1 A;  1KAA A;  1SMY C;  2K4K A;  3NQT A;  1FL0 A;  3G7L A;  4RMF A;  2MPM A;  1HRJ A;  1V1O A;  4B3R L;  1JWM D;  2F03 A;  1QVC A;  1XMQ L;  1PRT F;  3A8K E;  1F2M A;  3KF6 A;  2B2V A;  2CWA A;  1C8C A;  1TY0 A;  1ET9 A;  1TU2 B;  2WAQ E;  3NUC A;  2O4X A;  3HP3 A;  4HID A;  1K3R A;  2OQ0 A;  1WJJ A;  2JA5 B;  1U9R A;  1VQA A;  1W6J A;  2EIF A;  1J5E L;  2NN6 G;  2D62 A;  3TS0 A;  1G6Z A;  2MJ8 A;  2AKW B;  3EA6 A;  3A7A B;  1EYA A;  4JI0 Q;  2N55 A;  4TKO B;  2JA7 B;  3DM1 A;  2XWJ B;  4KHP Q;  5M5Y H;  5AFW A;  5LL6 S;  4JI5 L;  1LYL A;  3CCE A;  1NNX A;  4DR6 L;  4A3K G;  2D9U A;  2NTT A;  1Y69 U;  3J80 E;  3S1R B;  2L55 A;  4FXG C;  1F2L A;  2KCC A;  1FVI A;  4DR1 L;  2R92 G;  1S3O A;  2QDB A;  2KVM A;  5G3L D;  5CBE E;  2HT1 A;  3LNN A;  3EIV A;  2NN6 H;  5FK9 C;  2RCN A;  2L1B A;  5FO7 B;  3HOY G;  4IUU A;  1D6E C;  1KDB A;  1SYD A;  5LMN W;  1KD1 C;  1HUM A;  1N36 Q;  4A3B G;  3AFQ A;  1D5M C;  4RKB A;  4FP5 D;  1PH2 A;  1E2V A;  3HFZ B;  3I91 A;  1LTT D;  2I5H A;  1G91 A;  1B70 B;  2JXM B;  4A3K H;  1VQG A;  3QOJ A;  1W6K A;  3T1H L;  1J9O A;  1EY0 A;  4G57 A;  2QEX A;  1SMX A;  4GZY C;  4FNF A;  2RHQ B;  2C5C A;  4HR7 B;  2R92 H;  3K58 A;  3RMH A;  2ZJP A;  1Y1V B;  1XMQ Q;  1YIJ A;  4B3M L;  3S1N B;  3HRZ C;  1S4Z A;  1I4P A;  1TWF B;  3PQI A;  2NVY B;  5G3L F;  3TRZ A;  1LTI D;  3HOY H;  2RF4 A;  1B9M A;  4H44 C;  1SNQ A;  3MAQ A;  3FMC A;  2B2W A;  1PV4 A;  4NXN L;  5EKL A;  4X66 L;  1ET6 A;  3GTK B;  2NWG A;  2XNA C;  3RZO B;  3QO2 A;  2A19 A;  1LT3 D;  1S5E D;  1AH9 A;  1F9R A;  2A6H C;  2BCO A;  2RSO A;  2CFM A;  2NVT H;  5IGG A;  4N9T A;  4KY7 A;  2F3I A;  4A3L G;  5LMU L;  4TSS A;  4PNY A;  3HKZ E;  2NVQ B;  2X6G A;  1V1Q A;  4NP5 A;  3J7A V;  4DR1 Q;  2BE5 C;  5M9O A;  2F0D A;  3DXJ C;  1W2B A;  4XTC S;  3CC4 A;  2D0P A;  5I9O A;  4JI6 L;  2B39 A;  3IKJ A;  1U4M A;  3NQI A;  2ZM6 L;  5KYI A;  2C9O A;  4ZCK A;  1GUN A;  5IGC A;  1MSH A;  2F0P A;  2LKV A;  1VQN A;  3JC6 6;  4A3J B;  3TS2 A;  3HOV G;  4I7A A;  1JWU D;  3I70 A;  5JJL A;  4A3L H;  1U4L A;  1TWH B;  2RSN A;  2JA5 G;  4QB4 A;  4DR2 Q;  3HKS A;  4OO1 G;  5CR3 A;  1UEB A;  1GD7 A;  2Z0S A;  1B53 A;  1ROD A;  1UE7 A;  2EVB A;  3VYS A;  3QWN A;  1BNZ A;  2YU9 H;  2ZJR A;  1STH A;  4B3M Q;  3FPU B;  2BA0 A;  2YTY A;  1Z47 A;  4LMQ D;  3H3V H;  5T1G A;  2JA7 G;  2I5L X;  4ME3 A;  3PUV A;  3D4W A;  4YY3 L;  2DY7 A;  3A5Z B;  2F0H A;  1JIC A;  4NXN Q;  3IFT A;  3ND8 A;  4X66 Q;  2UUA L;  5IOC A;  1E3P A;  4Z9C B;  5DEH A;  3HOV H;  3CAM A;  1A15 A;  3NP8 A;  4BS9 A;  4K5V A;  1EU4 A;  4L5T A;  1Q3L A;  1A62 A;  2K05 A;  4OO1 H;  2DY8 A;  3ULJ A;  4MHE A;  4JOI C;  4NB3 A;  2M9V A;  3ZYY X;  3HOX B;  1K83 B;  1LTG D;  4YHH L;  1E0B A;  2JA7 H;  1GUG A;  1X6O A;  1QVG A;  4FF3 A;  2RHS B;  5F2D A;  1EY9 A;  3VYR A;  3I3C A;  4K5W A;  3G6E A;  2UXC Q;  1XYI A;  5ELO A;  3A74 A;  2B8G A;  3B6Y A;  1AE3 A;  3UDG A;  2ZM6 Q;  2JA6 B;  1EQQ A;  4PMC A;  1IXR A;  1I4R A;  1NMF A;  3E0E A;  1WTQ A;  1J6Q A;  3GTO H;  4RCO A;  2G5D A;  4PZ6 A;  1NCV A;  2EYJ A;  5JVG 3;  1OXS C;  3A8I E;  5D3I B;  3E9H A;  1HJP A;  5C4H A;  1Q1E A;  4GS3 A;  2XWB B;  5DAU A;  2HD3 A;  3NTK A;  4LF9 Q;  3G4S A;  1EIF A;  4FVM A;  4FF1 A;  2EJG C;  5GAH C;  2I07 B;  2J7Z A;  1SR3 A;  2VXW A;  3GTP H;  1S5C D;  3I8Z A;  1Z6H A;  2N78 A;  3RD4 A;  1XMO L;  5CV9 A;  1Y1W G;  2FXQ A;  2A6E D;  3PUY A;  5ELC A;  4J8Q A;  1X3F A;  4M1U B;  5C5M A;  4R1J A;  1TWC B;  4QF4 A;  4Y7N H;  3TSS A;  3NK9 A;  2EYH A;  4OIK A;  2VL6 A;  1PRT C;  3J80 i;  5M5X B;  3CQZ B;  2Z6B A;  1JOQ A;  2YYZ A;  2XRQ D;  4X64 L;  2K14 A;  4XYQ A;  5C3X A;  2JQO A;  4ILW A;  4HED A;  1X65 A;  4DXF A;  1ESF A;  1DOK A;  4YHH Q;  3MXN A;  4HSV A;  2UXD Q;  4A3J G;  1Q81 C;  3M4P A;  1PRT B;  1Q8I A;  4DV7 L;  4E6I A;  1Y1W H;  4RHS A;  2NVQ H;  1BQQ T;  3M4Q A;  3ULL A;  1H9M A;  2ASB A;  1K9M C;  3A0J A;  5CMD A;  2OQK A;  3S24 A;  1KXL A;  1VQD A;  1A3V A;  3Q8D A;  3CPF A;  3KDF B;  5KNC A;  3MFY A;  2QF7 A;  5M3F B;  2HHH Q;  2PZT A;  4QCL A;  3AEV A;  4DV6 Q;  1STY A;  2XSC A;  1AFP A;  2B63 H;  4JCV E;  2EYO A;  3GTM H;  3L2P A;  5DLQ E;  3M9B A;  2RVL A;  4JI2 Q;  3JAM i;  2VB3 X;  1TWH H;  1E2Z A;  4OWT B;  1X3P A;  1H9J A;  2HUG A;  2OF1 A;  1SJE D;  1XMO Q;  3S9W A;  5GQO A;  2B2Y A;  2KQ3 A;  1QB5 D;  5FOB B;  1PTO C;  2F3V A;  1V9P A;  4DUZ Q;  3HOX G;  4IPD A;  3KJO A;  4XYO A;  2OTL A;  4IJL A;  1QG7 A;  3KOJ A;  4B3T L;  1ICW A;  2K03 A;  3RR5 A;  2L12 A;  5J22 A;  5FLM G;  1Q82 C;  4POG A;  3PO2 G;  1BXT A;  4RKL A;  3TME A;  3S2D H;  2B2V C;  2JA6 G;  1PTO B;  1IBM L;  1H9S A;  1BDO A;  4X65 L;  2R7Z B;  3OTO L;  4ID6 A;  2RQX A;  4H02 A;  5AJ3 L;  4EQP A;  1VQO A;  4HMI A;  4JI8 L;  3KBG A;  2L9H A;  4DV7 Q;  2ATW A;  1HNX L;  1DZ1 A;  3KLR A;  2N3S A;  1IBK L;  3X3M A;  1HA6 A;  1EL0 A;  3HOX H;  4K6D A;  1STA A;  2JSO A;  2BH2 A;  3A5U A;  3K0X A;  2KUM A;  3J80 c;  5H1S E;  5FLM H;  3PO2 H;  2ZXP A;  5IP9 G;  1N9W A;  1GUT A;  3EJI A;  1M4V A;  3FHW A;  1JOR A;  5LL6 X;  1B8A A;  4QY7 A;  2L0C A;  5KIX A;  2VQF Q;  5D14 A;  4DK0 A;  1IL8 A;  1OXX K;  4KJN A;  2F0Q A;  1A2U A;  5KRU A;  1YHA A;  1QCB D;  1KNA A;  4P73 A;  4HN7 A;  2AWO A;  1SSO A;  3HOZ G;  5ELF A;  1CFM A;  4GN3 B;  2Y0S E;  4FO2 A;  3CCR A;  5IYB G;  3PCO B;  4B3S L;  2SDF A;  3S1M B;  3SK5 A;  1QJO A;  2B2U C;  4B9X A;  2LFN A;  3GV3 A;  1X55 A;  2IL8 A;  2JA9 A;  4QIW B;  5IP9 H;  4JI3 Q;  4B3T Q;  1MJE A;  5J3B A;  2F0L A;  3BVZ A;  1MJC A;  2YTX A;  1VS0 A;  1SBB B;  2NBF A;  1R9T H;  3KK7 A;  3PF4 A;  1SE4 A;  1I4G A;  4C56 C;  4LF4 L;  3CU7 A;  1NR4 A;  3JAM c;  2B3G A;  3PUZ A;  4JI4 Q;  1TWC H;  3HOZ H;  2JE6 I;  2E5L L;  2HDL A;  5M5Y B;  3LWE A;  3A8J E;  2JEA I;  3D6W A;  1YJW A;  1Q8K A;  5M3F G;  3DUZ A;  2Q8T A;  3CC2 A;  3PIP 3;  1PLF A;  3U9O A;  1DJR D;  1LT5 D;  3BZC A;  2B29 A;  1X56 A;  4GOP C;  1JB7 A;  5KEE A;  1C0A A;  2CQO A;  2DJG C;  3CMA A;  1PXU A;  1V1P B;  1MGS A;  4JI7 L;  2K1B A;  2PZU A;  1N33 L;  2UXB L;  4WJ3 M;  3K6O A;  2VNU D;  4HAE A;  4GNX A;  4G7O C;  2H5X A;  3M4Y A;  3K5M A;  3SK6 A;  2E75 C;  2VZA A;  5IP7 G;  1WTR A;  4GOP B;  1Q1B A;  1L0X B;  2ZT9 C;  1PA6 A;  3DLL A;  2E2H H;  3D8G A;  1YNX A;  2EYF A;  4A3K B;  3R2I A;  1CKN A;  2WAC A;  4PQX A;  1SFO H;  1L1O C;  5CV7 A;  1R4Q B;  4IOC A;  2R7Z G;  2R92 B;  2VW9 A;  4XDX A;  2O2L D;  3CCU A;  3W1G A;  4DA2 A;  1K0S A;  1K28 A;  1OXV A;  1SNP A;  2L4N A;  5JVH 3;  1QZG A;  3FP9 A;  3HOY B;  2EE1 A;  1ASZ A;  3NE5 B;  4I65 A;  5IP7 H;  1L1O B;  3CCV A;  3CRK C;  3RLN A;  4PZ7 A;  1EQT A;  4LF6 Q;  3ERS X;  2RDH A;  1P8L A;  3Q0A A;  2N8N A;  1CK1 A;  1QUQ B;  1TS3 A;  4CDE C;  3M4O B;  5FJ8 G;  1FNV A;  4RGN A;  3CC7 A;  1S5B D;  1N34 L;  1XTC D;  2YV5 A;  2NVT B;  1GO3 E;  4IAL A;  1FJG Q;  1T5E A;  1TT2 A;  2R7Z H;  3TDQ A;  1WD0 A;  2AQ1 B;  4JI0 L;  1XXG A;  4U68 A;  5LMN L;  4K2K A;  3PGZ A;  3CF5 A;  4HJ8 A;  1N33 Q;  4YWL A;  2UXB Q;  1EIH A;  3J7Z C;  2KA7 A;  1B50 A;  1IHZ A;  2F0F A;  4KI0 A;  3MFG A;  1YVC A;  1V8Q A;  4LFA L;  4KHV A;  5FJ8 H;  3R93 A;  4L8J A;  3GTQ H;  1F9Q A;  4ZYS A;  3H3V C;  3KFU A;  5IGD A;  5JPM C;  3MC0 B;  4QMG A;  2K6A A;  2HQL A;  4MZ9 A;  5GAG C;  1N36 L;  1B9N A;  1XNR L;  1OXU A;  4OL7 A;  3S16 H;  3PMF A;  4BY1 H;  1S5F D;  1G51 A;  4JBK A;  1PFM A;  1G29 1;  2E2J H;  3I72 A;  3RZD H;  2R3Z A;  5E4W C;  3J81 L;  3S1Q H;  1RKN A;  5CYU A;  3SHL A;  1EEF D;  1I5F A;  1HXY D;  4R4T A;  5IYD G;  3Q22 A;  2A1A A;  2F0O A;  2IWH A;  2PYK A;  5C0X J;  3HOV B;  1SJH D;  1CM9 A;  2PMZ E;  4UP8 A;  1KIX A;  3FDT A;  1VQF A;  3L0O A;  2BA1 A;  5NUC A;  2SNM A;  4DR3 L;  5E4X A;  1UE6 A;  3OHX C;  1N34 Q;  2QW7 A;  5IT9 E;  1KQS A;  1PVO A;  5CV6 A;  4FF4 A;  1H95 A;  2PW7 A;  1FD7 D;  1HPC A;  4ZLT F;  5L37 A;  4IJH A;  4IO9 A;  1HQR D;  3MEF A;  2NVX H;  1IKM A;  3T13 A;  4EQ5 A;  5LMN Q;  3STB D;  1K0R A;  1X3Q A;  4PMW A;  5FKA C;  2NZ1 D;  5IOD A;  1PH7 A;  2I0Q A;  5IYD H;  5BN4 A;  4XQJ A;  2IY5 B;  1E22 A;  1BVS A;  1KNE A;  4A3D G;  1PZJ D;  3DEP A;  3HGB A;  2EY1 A;  1TWG B;  3D4D A;  4FF2 A;  3HS0 C;  1VQH A;  4LFA Q;  2VQE L;  3GTO B;  1GKH A;  1MI2 A;  4ZK9 B;  1A63 A;  3U50 C;  3FVQ A;  3E0J A;  3BDC A;  3J7Y W;  1GXD C;  1AEX A;  4LF7 Q;  3HOW B;  4DR5 Q;  3FEW X;  1XNR Q;  4C2M H;  4DV1 Q;  4XIG S;  1HFN A;  1VQP A;  4A3G G;  3C1E A;  4WOR A;  1E24 A;  1JE5 A;  4F8M A;  2SNS A;  3GTP B;  4LAA A;  3MZ5 A;  1CZG A;  5CC4 A;  3T4A C;  2F0M A;  4DR2 L;  3I4N H;  4A3D H;  1I6H H;  1B1Z A;  5FLX E;  3T16 A;  3CCQ A;  1BO0 A;  1SN8 A;  4POF A;  1EY5 A;  5ELB A;  2EOT A;  3J7A 5;  3EVQ A;  3J7A F;  1O7Y A;  2DGY A;  4Y7N B;  4DR3 Q;  1HZB A;  3ICE A;  1CQV A;  4RWS C;  1AE2 A;  3JAM E;  4AQY Q;  1BBX C;  2EJF C;  1TS5 A;  5M5W H;  1VQ8 A;  4HJ7 A;  4IFD J;  2IHE A;  2DNE A;  2AWN A;  4A3G H;  1FYC A;  1G8Z D;  3GQB A;  5GAE C;  2K33 A;  3SXH A;  3M4O H;  2ZTD A;  3N6R A;  4H0L C;  4LFB Q;  2PNR C;  4RGM A;  4X3T A;  3E5S A;  2KEN A;  5ELD A;  1TQO A;  3TP8 A;  4DUY Q;  1Y1W B;  3R8B A;  4JBM A;  3NSW A;  1WD1 A;  1K8A C;  4XT1 B;  1U4R A;  1STG A;  4RH6 A;  1IL2 A;  1KHI A;  2VQE Q;  1H9S B;  3K7A B;  4B9W A;  2K52 A;  3FPP A;  1YNN C;  3BZD B;  4CDC C;  3GTJ B;  2UXC L;  1Q86 C;  1LTS D;  2V4D A;  3P1H A;  4A3M H;  3C3L A;  2MUY A;  1XPO A;  2B63 B;  3KF8 B;  2KCT A;  2PQE A;  1AZQ A;  3GTM B;  4HCS A;  4LNQ A;  4L63 B;  5JAV A;  1C9O A;  1RD9 D;  2Q8I B;  4EQO A;  5ISR A;  3PSI A;  2EDG A;  1QWY A;  4LF9 L;  1O80 A;  3NEN A;  1XWE A;  4DAY B;  5K5P A;  1HNZ Q;  2IW3 A;  4X6A H;  5DM6 3;  3AQQ A;  1ESR A;  1WTH A;  2F1M A;  1HA5 A;  3FRP B;  1XTD A;  1EWC A;  1PH5 A;  4IPG A;  5IYC H;  2YTV A;  3CXC A;  3K8A A;  2F0I A;  1VDZ A;  3NTI A;  3ULP A;  1T5X D;  4O0A A;  3S2D B;  5IY0 A;  4QUC A;  5A2Q L;  1P16 A;  5GAD C;  1JMC A;  2R6G A;  1GUS A;  5EBC A;  1XNQ Q;  2FMC A;  4DXG A;  2KHI A;  3AB9 A;  3R2T A;  4AYB B;  2IX1 A;  3CCJ A;  2GVA A;  1Z9F A;  2OEO A;  1CKO A;  3HOW G;  4FXD A;  5EGT A;  4ZRZ A;  4YWK A;  3OIQ A;  4KD3 A;  2UXD L;  4CJ2 C;  2LXK A;  1CUK A;  4P72 A;  2B2T A;  2VUM B;  1F2Z A;  1WCM G;  1SXT A;  4GKK L;  4C3J B;  3PO2 B;  5C5L A;  4OHJ A;  2JK8 A;  3L9A X;  4O42 A;  4ZUJ A;  2F0W A;  1SAP A;  2QCP X;  4DNI A;  1TWG H;  4LK1 C;  4X3S A;  5C0X I;  4DV3 Q;  1SYG A;  2ZJQ A;  4U67 3;  4DV5 L;  2F4V Q;  1KDA A;  4J15 A;  2NZO A;  1U0L A;  4KD4 A;  3IAY A;  2R93 H;  2HHH L;  1D7Q A;  4DV6 L;  4A3I G;  4LUO A;  1CA6 A;  3HOW H;  3H0G H;  1BBW A;  1EOT A;  2UU9 Q;  3TEH B;  3U9S A;  1II3 A;  2K28 A;  2PQA A;  1EWH A;  4B08 A;  5IGB A;  1LTR D;  1WCM H;  1HNW Q;  1BCP D;  2F0G A;  4JI2 L;  1CSP A;  3NBH B;  3PO3 H;  2D5D A;  4LF8 L;  4XQN A;  2KEC A;  1UWV A;  1DXM A;  1RHP A;  5COR A;  2FFK B;  3SR1 A;  1ENA A;  4ZKC B;  2F0J A;  1D1I A;  3KLS X;  3NWT A;  1R9T B;  4UHV A;  2O5J C;  2F0T A;  4OEL B;  1GUO A;  2EYL A;  2MGS A;  2Z6K A;  2IT1 A;  4DUZ L;  3QB3 A;  3E3X A;  4CGY B;  4WJW A;  1KAB A;  1CI3 M;  1SYF A;  4IUV A;  4BY7 H;  3HOZ B;  4DAM A;  4A3I H;  4PG3 A;  5CV8 A;  3E9I A;  1VQK A;  1WFQ A;  1LAB A;  2MNA A;  2BOS A;  1Y8N B;  3BDO A;  4OON A;  1NE3 A;  1YBY A;  2Q2U A;  4IQZ A;  1DYQ A;  2A68 D;  3K81 C;  2ZXO A;  2B63 G;  1KLU D;  2JYO A;  3CCS A;  3I4L A;  5CGK A;  5KGU A;  1BBU A;  5CBA E;  3GTL B;  1NAP A;  4MIU A;  1BCP F;  2BDN A;  3P20 A;  3GTG H;  4UP9 A;  4GKK Q;  2K5D A;  3K57 A;  1IKL A;  3SDZ A;  3L3O C;  1YNJ C;  3LX0 A;  4BA1 I;  2O5I C;  4LWC A;  3RLO A;  1X54 A;  1E1T A;  1CTM A;  4YCU A;  4AH6 A;  1PHJ A;  4FYD A;  3HOU G;  2HCC A;  1VQ5 A;  1ZEQ X;  4DV5 Q;  5CV4 A;  4IN3 A;  3K7A H;  4TRD A;  1JWS D;  3TP7 A;  1G2T A;  3C46 A;  5HUR A;  4ODG A;  1NSN S;  3QJY A;  3GTJ H;  1QVF A;  1SMY D;  5EAY A;  2E2H B;  4DR7 L;  2PO4 A;  3DWQ A;  2Z8L A;  1YIT A;  4IFD I;  5KYL A;  2VQF L;  1SFO B;  2AMC B;  2EY2 A;  4GN4 B;  3BJU A;  4WRD A;  1PH1 A;  1RIP A;  1PH8 A;  5EKK A;  2EY6 A;  4LF8 Q;  4IUT A;  4RG1 A;  5DNF A;  3HOU H;  2RCF A;  2ZXR A;  3H91 A;  4AYB G;  4ZAI A;  3VR2 A;  1PH4 A;  1VF7 A;  1KDC A;  2MQH A;  3VR5 A;  2F3W A;  3M85 A;  1KC8 C;  1TII D;  1PYB A;  4JI3 L;  5IGF A;  1I4X A;  1WTX A;  1NTG A;  2WB1 G;  2VUM G;  4C3J G;  3BG3 A;  2E76 C;  4C3H G;  1RL2 A;  4NMZ A;  5E3F A;  1H9K A;  5IT9 c;  3ER0 A;  4R8N A;  2B8F A;  4JI4 L;  4FDB A;  3V2T A;  4CJ1 B;  1EFW A;  3CCL A;  5M3M G;  5HGQ A;  3OWF A;  3I2Z A;  4M8A A;  4PV1 C;  3M3Y B;  3KF6 B;  2NB0 A;  3H6M A;  3RNU A;  3J81 i;  1JJG A;  3I73 A;  4DV4 L;  1GHJ A;  2TSS A;  1BR9 A;  3A55 A;  4P74 A;  2R7D A;  1HTP A;  1QNK A;  3WOF A;  4CDD C;  4WFN 3;  2JJQ A;  1YHQ A;  2VUM H;  4KMU C;  5BR8 Q;  4HJ9 A;  4C3J H;  3GTQ B;  4DR7 Q;  4GLA C;  3C2P A;  4H13 C;  3I4M B;  2A73 B;  4C3H H;  4PZ8 A;  4GLX A;  1JB3 A;  5JJK A;  4YWM A;  3S16 B;  4BY1 B;  5M3M H;  2DUD A;  1OTC A;  5A35 A;  3OW2 A;  2ICI A;  2E2J B;  1WTW A;  1B7Y B;  3RZD B;  1AP0 A;  2PPB C;  2RKS A;  3S1Q B;  4DFA A;  2PI2 E;  1S5D D;  2AUJ D;  1JJ2 A;  2IPK D;  1HUN A;  3NBI A;  4LFC Q;  1ML0 D;  3PV0 A;  5IGE A;  2A6H D;  5FLX c;  3BVM A;  3K5O A;  1EQR A;  3EBE A;  2JA8 B;  1GVP A;  2BE5 D;  1B3A A;  1HH2 P;  3A56 A;  2RBM A;  1EIY B;  4LF6 L;  2NVX B;  1RTO A;  1EY7 A;  1I50 B;  1Q46 A;  2B2W C;  2WV6 D;  1BOS A;  2PNH A;  1C7Y A;  4ZUI A;  2GN5 A;  4K14 A;  1IW7 D;  1IBL Q;  4BBS G;  1FJG L;  2PW5 A;  3W1B A;  4DV4 Q;  4L5S A;  2BH8 A;  4A3F B;  5JOB A;  3IRB A;  5J1Z A;  4AIM A;  1MBY A;  1S72 A;  3GTL H;  4F87 A;  2KCM A;  1CA5 A;  3G6J B;  3MWY W;  3TP5 A;  1CSQ A;  3T1Y Q;  3BZK A;  4L6T B;  5I4D A;  1EQV A;  1KLG D;  1EY6 A;  4EQN A; 
#chains in the Genus database with same CATH homology
 4DK3 C;  4B3M Q;  4IO9 A;  2BA0 A;  2OCE A;  3MEF A;  2NVX H;  2YTY A;  1Z47 A;  1YZ6 A;  3H3V H;  1Y14 B;  3STB C;  4A3E G;  4EQ5 A;  5LMN Q;  2JA7 G;  5GRO A;  3STB D;  2CWP A;  4HIO A;  2I5L X;  4ME3 A;  3PUV A;  1XPU A;  1K0R A;  4DR4 L;  4LFC L;  4PMW A;  1C0A A;  4YY3 L;  3A5Z B;  2K5N A;  3J81 c;  1PH7 A;  2I0Q A;  4A3J H;  4NXN Q;  5IYD H;  4X66 Q;  2UUA L;  4BBS H;  1E3P A;  4IPH A;  2IY5 B;  3HOV H;  1E22 A;  1BVS A;  3RLF A;  3CAM A;  4TVA B;  3LGJ A;  4C3I H;  4A3D G;  4GKJ Q;  3PIO A;  4A93 H;  1VQH A;  4LFA Q;  3PIP A;  4L5T A;  1LM0 A;  2VQE L;  5C4X G;  1A62 A;  1GKH A;  3UE1 A;  1SLJ A;  1VQL A;  4NXM L;  1A63 A;  2K75 A;  3ULJ A;  4JOI C;  4NB3 A;  1LUZ A;  3U50 C;  5IWA Q;  3G48 A;  1YHB A;  4LF7 Q;  4DR5 Q;  3L7Z C;  4YHH L;  4QIW E;  4A3E H;  2JA7 H;  1X6O A;  4C2M H;  1XJV A;  1QVG A;  1IBL L;  4DV1 Q;  1XNR Q;  2RHS B;  3PF5 A;  3PUW A;  3UE0 A;  4QGU A;  4JI1 L;  3CME A;  1TWA H;  4XIG S;  3G6E A;  1VQP A;  2UXC Q;  4A3G G;  1W3S A;  3U4V A;  5ELO A;  2VY3 A;  3A74 A;  1E24 A;  3UDG A;  1JE5 A;  1AE3 A;  3B6Y A;  4X64 Q;  2ZM6 Q;  1EQQ A;  2HIX A;  1HZ9 A;  1IXR A;  4BBR G;  4DR2 L;  3VDY A;  3I4N H;  4A3D H;  1I6H H;  1NMF A;  4A3C G;  3T1Y L;  3CCQ A;  1SN8 A;  3E0E A;  5ELN A;  4POF A;  1J6Q A;  3GTO H;  3I4M G;  4JYA L;  1TXY A;  5C4X H;  4PZ6 A;  3GDE A;  1OXS C;  4KHZ A;  1OXT A;  2F52 A;  3J81 j;  1N8R C;  3I55 A;  3J7A 5;  3E9H A;  4X62 L;  1I3Q H;  1HJP A;  1Q1E A;  1YJ9 A;  2DGY A;  4GS3 A;  4DR3 Q;  1HZB A;  1VQM A;  4BY1 G;  3ICE A;  1K83 H;  1U5K A;  1AE2 A;  4LF9 Q;  2CKZ B;  2QGQ A;  4AQY Q;  4DV2 L;  3M3Y H;  3AYH B;  3G4S A;  2E8G A;  5M5W H;  1EIF A;  1VQ8 A;  3M7N A;  4HJ7 A;  4IFD J;  5GAH C;  2D0O A;  2IHE A;  1JT8 A;  1SR3 A;  3D0F A;  4MTN A;  2AWN A;  4A3G H;  2KHJ A;  4DV0 Q;  3CP0 A;  4GKJ L;  5C4J H;  2JA6 H;  2ID0 A;  2XTI A;  3GTP H;  5GAE C;  4JC0 A;  3M4O H;  2ZTD A;  3KDF A;  2N78 A;  4LFB Q;  3EN2 A;  4DR4 Q;  4BBR H;  1XMO L;  2KEN A;  1Y1W G;  4A3C H;  2FXQ A;  4DUY Q;  4A75 A;  4K0K Q;  3PUY A;  1L0W A;  1NJI C;  3I4M H;  4HJ5 A;  2L15 A;  4JBM A;  1X3F A;  5IWA L;  4R1J A;  1FGU A;  1KAW A;  1VQE A;  1K8A C;  4LF7 L;  2JA8 G;  4DR5 L;  3F8T A;  4Y7N H;  1IL2 A;  1PFS A;  1KHI A;  2VQE Q;  4DV1 L;  2K52 A;  2VL6 A;  4HIK A;  3J80 i;  4NXM Q;  1Q7Y C;  3FKI G;  4L5R C;  2ZTC A;  1K73 C;  2UXC L;  4LW1 A;  4A4I A;  1Q86 C;  1X3G A;  1PH6 A;  4LF4 L;  2YYZ A;  2EXD A;  4X64 L;  4A3M H;  2K14 A;  2JQO A;  1YI2 A;  3I4O A;  2JA8 H;  1X65 A;  1KRT A;  3U58 A;  4YHH Q;  1EYG A;  1WI5 A;  1XPO A;  2UXD Q;  4A3J G;  3KF8 B;  1Q81 C;  2KCT A;  3TRE A;  3M4P A;  4JI1 Q;  4LNQ A;  5JJI A;  4DV7 L;  4A3F G;  1KL9 A;  1C9O A;  1Y1W H;  3WWV A;  1IBM Q;  3NEM A;  1EUJ A;  3F2D A;  3TQY A;  3F2B A;  1K8G A;  1I94 L;  2OTJ A;  4X65 Q;  2NVQ H;  4JBJ A;  3OTO Q;  2WP8 J;  4WJ4 A;  3PSI A;  5K36 G;  2Z6K C;  3M4Q A;  3ULL A;  2UUB L;  5AJ3 Q;  1VQ4 A;  2ASB A;  3NEL A;  4JOI A;  3NEN A;  1K9M C;  4LF9 L;  1D8L A;  2UUC Q;  3AFP A;  4AQY L;  4OWW B;  4YCW A;  4JI8 Q;  4DAY B;  3A0J A;  4JYA Q;  2IHF A;  2OQK A;  3S24 A;  3D31 A;  4IPC A;  1HNZ Q;  4X6A H;  1KXL A;  1VQD A;  5IYB H;  3AQQ A;  2NZH A;  3OYY A;  5M5X H;  4R4O A;  3Q8D A;  3CPF A;  3FKI H;  3CQZ H;  3KDF B;  1HNX Q;  4OX9 L;  4X62 Q;  1VQB A;  1VQJ A;  1IBK Q;  2HHH Q;  2KBN A;  4YCV A;  4DV0 L;  1I50 H;  4DV6 Q;  1HR0 Q;  3AEV A;  1XTD A;  1PH5 A;  4IPG A;  4GN5 A;  2V1C C;  5IYC H;  1XPR A;  2K5V A;  5IE8 A;  1HZA A;  4LFB L;  2YTV A;  4JCV E;  1V43 A;  2B63 H;  3CXC A;  3K8A A;  4DV2 Q;  1X9N A;  3ULP A;  3GTM H;  4O0A A;  3L2P A;  2Y0S G;  4DUY L;  4K0K L;  4O2D A;  5IY0 A;  4BXX H;  5DLQ E;  3M9B A;  1PYS B;  2AHO B;  2C35 B;  1QZH A;  1GM5 A;  1N32 Q;  4A3F H;  1VQI A;  4IOA A;  4TQU S;  4JI2 Q;  3I4N G;  3JAM i;  3CPW A;  1SRU A;  1P16 A;  1TWH H;  3SGI A;  4OWT B;  5GAD C;  5JEA J;  1JMC A;  1PH9 A;  2R6G A;  4APV A;  1PH3 A;  4JV5 L;  2NN6 I;  1XMO Q;  5GQO A;  1XNQ Q;  4MNO A;  1S40 A;  2QA4 A;  3CCM A;  2KHI A;  4UPA A;  3MXN B;  2IX1 A;  1V9P A;  4DUZ Q;  3CCJ A;  1IZ6 A;  4A76 A;  3HOX G;  4LUV A;  2GVA A;  1Z9F A;  4IPD A;  1CKO A;  3KJO A;  3HOW G;  5M3F H;  1HR0 W;  2OTL A;  4YWK A;  1EOV A;  4IJL A;  3KOJ A;  4B3T L;  4ALP A;  2UXD L;  2I5M X;  2LXK A;  1CUK A;  1E7Z A;  3RR5 A;  4B3S Q;  5FLM G;  4P72 A;  1Q82 C;  4POG A;  1WCM G;  2MO0 A;  3U4Z A;  3PO2 G;  4GKK L;  3W5O A;  3S2D H;  2JA6 G;  1IBM L;  4DPG A;  5C44 G;  2JK8 A;  2LSS A;  4X65 L;  1M1K C;  3RN2 A;  3OTO L;  3H15 A;  1NBW A;  4H02 A;  5AJ3 L;  4DNI A;  5C3E G;  1TWG H;  1VQO A;  1MIU A;  5C0X I;  4DV3 Q;  2UUC L;  2ZJQ A;  4JI8 L;  4DV5 L;  2F4V Q;  4J15 A;  1HNZ L;  2NZO A;  4UP7 A;  1U0L A;  4DV7 Q;  1T9H A;  2ATW A;  3S15 H;  1HNX L;  2WAQ G;  2R93 H;  3GO5 A;  2N3S A;  1WOC A;  1YJN A;  1IBK L;  1UE1 A;  1I94 Q;  1HR0 L;  2HHH L;  4DV6 L;  1D7Q A;  4A3I G;  3F2C A;  4LF4 Q;  1L2F A;  3HOX H;  4LUO A;  2JEB I;  2UUB Q;  3HOW H;  3H0G H;  1BBW A;  2UU9 Q;  2GVB A;  2CCZ A;  2BH2 A;  3TEH B;  2E5L Q;  3A5U A;  3K0X A;  3J80 c;  5H1S E;  4A3M G;  5FLM H;  3KYH C;  2PQA A;  3I56 A;  1N32 L;  1WCM H;  4P75 A;  4OX9 Q;  3PO2 H;  1HNW Q;  5IP9 G;  4BA2 I;  1N9W A;  4JI2 L;  1WYD A;  1CSP A;  3NBH B;  3PO3 H;  1HZC A;  1IYJ B;  3FHW A;  4B3R Q;  4LF8 L;  5C44 H;  1B8A A;  4QY7 A;  4GLV B;  1UE5 A;  1UWV A;  4QJF A;  5C3E H;  2VQF Q;  1XNQ L;  4OXP A;  4L5Q A;  1CKM A;  1OXX K;  4KHP L;  2Z6K A;  3F1Z A;  3UDI A;  1J5E Q;  4JI7 Q;  1YHA A;  2IT1 A;  4DUZ L;  4A3B H;  4P73 A;  2AWO A;  4BY7 H;  3HOZ G;  5E7N A;  4GN3 B;  4DAM A;  2Y0S E;  4PG3 A;  4A3I H;  1SE8 A;  2K5H A;  2PI2 A;  2XGT A;  3E9I A;  5IYB G;  3PCO B;  4JBW A;  1WFQ A;  3CCR A;  1ASY A;  1VQK A;  4B3S L;  4UY8 C;  4JV5 Q;  2MNA A;  2HIV A;  3RN5 A;  4OON A;  1NE3 A;  1YBY A;  2Q2U A;  4JI5 Q;  1X55 A;  4DK6 C;  1O7I A;  5IYC G;  4DR6 Q;  3GD7 A;  3K81 C;  2JA9 A;  4GOP A;  1NY4 A;  5IP9 H;  2B63 G;  4JI3 Q;  3CCS A;  4B3T Q;  1MJE A;  1YEZ A;  1EWI A;  1KRS A;  4DV3 L;  1BBU A;  5J3B A;  2F4V L;  4BXX G;  1E1O A;  1MJC A;  1VQ9 A;  2YTX A;  1VS0 A;  3GTG H;  4UP9 A;  4GKK Q;  4HJA A;  1R9T H;  3PF4 A;  4BA1 I;  4LWC A;  4OWX B;  5HY6 A;  3RLO A;  3KJP A;  1SRO A;  1X54 A;  4R4Q A;  2B3G A;  1E1T A;  3JAM c;  3PUX A;  4YCU A;  3PUZ A;  4AH6 A;  1PHJ A;  2PQA B;  1TWC H;  1VQ5 A;  4JI4 Q;  2Q2I A;  2E2I H;  3HOU G;  3HOZ H;  4R4I A;  4DV5 Q;  2UU9 L;  2JE6 I;  1A8V A;  2E5L L;  3K7A H;  3S1M H;  2MO1 A;  2JEA I;  3H3V I;  2K4K A;  1YJW A;  2ZTE A;  3GTJ H;  1Q8K A;  5M3F G;  1QVF A;  5EAY A;  1FL0 A;  4RMF A;  4DR7 L;  1HNW L;  3CC2 A;  4B3R L;  2MFI A;  3CD6 A;  1VCI A;  1QVC A;  1XMQ L;  1L1O A;  3BZC A;  3K7U C;  1Q12 A;  2CWA A;  2B29 A;  3KF6 A;  4R4C A;  1YIT A;  1X56 A;  4IFD I;  2WAQ E;  3UDX A;  2VQF L;  4HID A;  4GOP C;  1K3R A;  3T1H Q;  2OQ0 A;  2AMC B;  1QUQ A;  1WJJ A;  2CQO A;  3CMA A;  1VQA A;  2EIF A;  4GN4 B;  3S17 H;  3BJU A;  1PH1 A;  1J5E L;  4JI7 L;  1RIP A;  2NN6 G;  2D62 A;  1PH8 A;  3TS0 A;  1N33 L;  2UXB L;  4WJ3 M;  4LF8 Q;  2VNU D;  2AKW B;  4OO1 I;  4GNX A;  4RG1 A;  2H5X A;  4JI0 Q;  2VZA A;  5IP7 G;  3HOU H;  2OWO A;  2R93 G;  4P71 A;  2Q2T A;  3HKZ G;  4GOP B;  1Q1B A;  4KHP Q;  4AYB G;  4QL5 A;  1PH4 A;  5M5Y H;  2IX0 A;  2MQH A;  1PA6 A;  4JI5 L;  1LYL A;  3DLL A;  1MKH A;  4LF5 L;  2E2H H;  3CCE A;  4DR6 L;  3H0G G;  1YNX A;  3M85 A;  4A3K G;  4JI3 L;  1PYB A;  1KC8 C;  2VUM G;  1NTG A;  2WB1 G;  1CKN A;  1FVI A;  1SFO H;  4DR1 L;  4HIM A;  1BKB A;  1L1O C;  5C0X G;  2JA5 H;  2R92 G;  1S3O A;  3PO3 G;  2R7F A;  2ALY B;  4IOC A;  2HT1 A;  2R7Z G;  2VW9 A;  1VQ6 A;  1RL2 A;  3EIV A;  1LTL A;  5IT9 c;  3ER0 A;  3CCU A;  2RCN A;  5LMU Q;  3W1G A;  4JI4 L;  4FDB A;  1OXV A;  1EFW A;  3HOY G;  3CCL A;  1QZG A;  3FP9 A;  5M3M G;  5HGQ A;  5LMN W;  1KD1 C;  1JB7 A;  1ASZ A;  1X3E A;  2K50 A;  3I2Z A;  1N36 Q;  5IP7 H;  4GNX C;  4A3B G;  3AFQ A;  1L1O B;  3CCV A;  3KF6 B;  1M90 C;  4BY7 G;  3RLN A;  3RNU A;  3J81 i;  1PH2 A;  1JJG A;  4PZ7 A;  3HFZ B;  3ERS X;  4DV4 L;  1P8L A;  4LF6 Q;  4JI6 Q;  2N8N A;  2I5H A;  1QUQ B;  1B70 B;  4P74 A;  2R7D A;  3BU2 A;  4A3K H;  1VQG A;  3I7F A;  3S1R H;  3T1H L;  5FJ8 G;  4DKA C;  2JJQ A;  1YHQ A;  2VUM H;  3CC7 A;  5BR8 Q;  2QEX A;  1N34 L;  2YV5 A;  1SMX A;  4GNX B;  4HJ9 A;  4C3J H;  2RHQ B;  4DR7 Q;  1GO3 E;  4GLA C;  3DM3 A;  1FJG Q;  1Y1V G;  2R92 H;  2ZJP A;  4C3H H;  4JG2 A;  2R7Z H;  4PZ8 A;  2Q2H A;  1YIJ A;  1XMQ Q;  2EQS A;  3G71 A;  4B3M L;  3ZJY C;  4GLX A;  1VQ7 A;  5JEA G;  1DGS A;  4JI0 L;  3TRZ A;  5LMN L;  5JJK A;  2WFW A;  3HOY H;  1VQC A;  4YWM A;  4EX5 A;  2RF4 A;  3PGZ A;  5M3M H;  2DUD A;  3CF5 A;  4HJ8 A;  1OTC A;  1A0I A;  3K80 C;  2N49 A;  1N33 Q;  4YWL A;  1CKN B;  2UXB Q;  3OW2 A;  1PV4 A;  4NXN L;  4X66 L;  1B7Y B;  3J7Z C;  4LUZ A;  2PI2 E;  4KI0 A;  2A19 A;  1YVC A;  3CW2 C;  1JJ2 A;  1JJC B;  3S2H H;  4LFA L;  1AH9 A;  5FJ8 H;  2A8V A;  4Y52 H;  4LFC Q;  4QQB X;  3PV0 A;  4YY3 Q;  4LF5 Q;  2NVT H;  2CFM A;  3GTQ H;  5FLX c;  2F3I A;  4A3L G;  5LMU L;  2UUA Q;  1Y1V H;  3KFU A;  3HKZ E;  2ES2 A;  4AYB E;  3S1N H;  1V1Q A;  1TWF H;  2VS1 A;  2NVY H;  1EQR A;  2HQL A;  3EBE A;  4MZ9 A;  5GAG C;  2LXJ A;  4DR1 Q;  1N36 L;  1GVP A;  1XNR L;  1OXU A;  3S16 H;  1HH2 P;  4BY1 H;  1W2B A;  4XTC S;  3CC4 A;  1EIY B;  2D0P A;  4LF6 L;  1G51 A;  4JI6 L;  2WB1 E;  4JBK A;  1G29 1;  2E2J H;  3RZD H;  1Q46 A;  3GTK H;  2ZM6 L;  4NPS A;  3RZO H;  3S1Q H;  2PNH A;  1I5F A;  1C7Y A;  5BR8 L;  1G6P A;  3UDF A;  2GN5 A;  4R4T A;  5IYD G;  1VQN A;  1IBL Q;  2A1A A;  3JC6 6;  4IFD G;  4BBS G;  1FJG L;  3TS2 A;  4KLK A;  3W1B A;  4DV4 Q;  4L5S A;  3HOV G;  5C0X J;  3S14 H;  2BH8 A;  5JJL A;  3IRB A;  4UP8 A;  2PMZ E;  4A3L H;  4AIM A;  1KIX A;  3KLW A;  1VQF A;  3L0O A;  1S72 A;  4A93 G;  2BA1 A;  2JA5 G;  3GTL H;  4DR3 L;  2KCM A;  4DR2 Q;  3HKS A;  1UE6 A;  4OO1 G;  1N34 Q;  1KQS A;  1PVO A;  1CSQ A;  1UEB A;  3BZK A;  1GD7 A;  3T1Y Q;  2Z0S A;  1H95 A;  1UE7 A;  2YU9 H;  1NMG A;  4IJH A;  2ZJR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...