5M5YH

Rna polymerase i elongation complex 2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Molecular Structures of Transcribing RNA Polymerase I.
pubmed doi rcsb
molecule tags Transcription
total genus 17
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m5yH00
2N49A 5GAGC 4PZ6A 4QIWE 1K0RA 4DV7L 5AJ3L 4LF6Q 2QEXA 1KL9A 1YHQA 2KBNA 5C0XG 2E2JH 3H15A 4BY7G 1A63A 1NY4A 4Y7NH 5LMNW 4IJHA 1HH2P 2R93H 4HJ8A 2K4KA 4GN4B 1T9HA 1JT8A 5K36G 1NMFA 1L0WA 4HIMA 3CCEA 3OW2A 4X62L 1XMQQ 2E5LL 1SMXA 2ID0A 3GTQH 1I5FA 3S15H 5IP7G 3STBC 1VQFA 3W5OA 5IP9H 5AJ3Q 1PH7A 3GTLH 1VQKA 2ATWA 1G6PA 2NVTH 4NPSA 4JCVE 2I0QA 4HJ5A 4P72A 3M9BA 2OQ0A 1VQ9A 2ZJPA 1EWIA 2WFWA 3I4NH 3RZDH 1V9PA 2JA5G 4L5RC 3HOVH 2OCEA 2PQAA 2OWOA 4A3IG 2E5LQ 1L2FA 2JA7G 1PVOA 1YIJA 2JJQA 2NN6I 3A5UA 4A4IA 4JG2A 4IPCA 1UWVA 3U4ZA 2I5LX 2IT1A 4A3EG 4A3KH 1K9MC 1AE2A 2AWOA 3EIVA 3TEHB 1IBKL 1CSPA 2CFMA 4P74A 1N34Q 2LXKA 2JA6G 1Q12A 3I2ZA 1JJCB 3ULPA 5DLQE 3H0GH 1Q86C 1KC8C 1TWFH 3PUVA 3T1YQ 1CKOA 2UUAL 4YY3L 2JEAI 5LMUL 3J81i 2PMZE 4YCVA 2R7DA 1Z9FA 2VL6A 3CCJA 1VQ7A 1PH9A 1WI5A 1Y1VG 3G6EA 3E9IA 1LM0A 1CKNB 1NMGA 1YNXA 5C3EH 2K5HA 1IXRA 3KF6B 1R9TH 1S40A 4JBMA 4LF8Q 4OX9L 1E22A 2KHIA 3K81C 1VCIA 3KFUA 2VQEL 3T1HL 1N36L 3GTJH 4DV4L 1Z47A 5FJ8G 3HOXG 1S72A 4JBWA 4JBKA 5LMUQ 5JEAG 1EFWA 1XTDA 1HZAA 4R4TA 4C2MH 1OTCA 5C44G 4UY8C 2F4VL 3S16H 4L5QA 1HNWL 5M5WH 4JYAQ 4LF7L 2JA8G 3AFPA 1VQ5A 2I5MX 1J6QA 4OX9Q 3J81c 1D8LA 3PGZA 4X64L 4LUOA 2ZTEA 2IX0A 3T1HQ 4DK6C 1VQJA 4DV0Q 1N36Q 1FJGL 4BY7H 4OO1G 4DPGA 3CAMA 5M3FH 1K8AC 1K3RA 3EN2A 3PIOA 3F2BA 3M7NA 4A3LG 4JI5L 2NZHA 3OYYA 4TVAB 2F4VQ 1HNWQ 1HR0L 4R4CA 4DR1L 2Q2HA 5IWAL 4BXXG 1EUJA 4QY7A 2UUBQ 1Q1EA 5HY6A 2UXCL 4A3GG 1N33L 3D0FA 1GKHA 3HKSA 5LMNL 4HJAA 4A3FG 1NE3A 3L2PA 3GDEA 4B3SQ 2CWAA 4GKKL 4EX5A 3S1NH 3HOUG 5GAHC 1CKMA 4KHPQ 1FJGQ 5GADC 3GO5A 4DV1L 4UP8A 2YTVA 1VQ4A 1PV4A 3GD7A 3KYHC 4DR7Q 2HQLA 1BBUA 1QUQB 4DUZL 4LFBQ 2JA5H 2RHSB 2NVYH 4BY1G 2R6GA 2CQOA 4X66L 4KHZA 4NXMQ 2UXCQ 1GVPA 1N33Q 4A3IH 4A75A 4GKKQ 1AE3A 4J15A 1IBML 4TQUS 4POGA 1HNXL 1J5EQ 4A3EH 3ZJYC 2XTIA 2EQSA 5EAYA 1IBLL 2E8GA 4LFAQ 2A19A 3DLLA 1QVGA 2Q2TA 2UXDL 4DV1Q 1WFQA 3BU2A 3CCQA 2JA6H 4OXPA 2Q2IA 4UPAA 1L1OC 1Q46A 3F2CA 3CCRA 3I56A 2ZM6L 3CP0A 2N8NA 3PCOB 2JE6I 1X3FA 1VQIA 2NVXH 2R7FA 3AFQA 1IBMQ 1HNXQ 2Y0SE 3GTGH 1Y1VH 4RMFA 1JJ2A 2D62A 1TWHH 4JI3L 1E24A 2PI2A 3CQZH 4LF4Q 5IYCH 1LTLA 1TXYA 1E1TA 1PYBA 1PH3A 2NN6G 3PUYA 3HOYG 4YWMA 1GO3E 5FLMG 2LSSA 1PH8A 2A1AA 1L1OA 2WAQE 5FJ8H 3HOXH 1O7IA 4NXNL 5M5YH 2GVBA 4A3BG 5C44H 1HR0W 3H3VH 4HJ7A 1WYDA 5IYDG 2UU9L 3PO3G 2JA8H 1RIPA 3JC66 4R1JA 3FKIG 4JOIC 2IX1A 2VUMG 2HIXA 3PO2G 2KHJA 4OONA 5ELOA 4DR3L 1JMCA 1PH4A 2AWNA 2RF4A 1VQ8A 2QA4A 4MTNA 5J3BA 4GOPB 4NXNQ 3WWVA 2Z0SA 4YHHL 4DV5L 4A3JG 1XJVA 4DV7Q 2NVQH 4A3LH 1QVCA 1PFSA 2VS1A 4DAYB 3J7A5 5M3MG 2FXQA 2VQFL 1BVSA 1NJIC 1XNQL 4K0KL 3HKZE 1C7YA 2LXJA 1VQLA 2B3GA 4A3FH 1YZ6A 4B3ML 4A3GH 3J80i 1RL2A 3HOUH 4YWLA 3I55A 4BBRG 1YJ9A 1Q81C 4GNXC 4JOIA 4X6AH 1VQDA 4B3TL 1SN8A 1YBYA 4GLAC 3U4VA 4X62Q 4HIKA 3BZCA 4BBSG 5HGQA 1QZHA 2R7ZG 4HJ9A 1JJGA 2WP8J 4R4QA 4L5TA 4A3DG 1M1KC 4BY1H 3M4QA 1UE1A 1HNZL 4GN3B 4B3MQ 1V43A 1Q8KA 4DR2L 2ES2A 3MXNB 4B3RL 1VQPA 1I94L 4XIGS 2VW9A 4DK3C 4B3TQ 2PQAB 2RCNA 4EQ5A 3UDXA 2ASBA 1DGSA 1XNRL 1WOCA 4GNXA 3UE0A 4PZ8A 1BKBA 3J80c 3TS0A 1E1OA 1D7QA 1Y14B 3F2DA 1IBKQ 3DM3A 4HIDA 1XPRA 2XGTA 1EOVA 4IJLA 4DR2Q 1Q82C 2ZJRA 2JA9A 1I94Q 1H95A 4A3MG 2MNAA 2VY3A 4R4OA 3RNUA 2UUAQ 3J81j 2JEBI 4YY3Q 3AQQA 1QZGA 4AYBG 1XNRQ 4Y52H 4ME3A 2YYZA 4PMWA 3S24A 3S17H 2C35B 1UE7A 4IOCA 3HOYH 3I7FA 3PSIA 5FLMH 3RN2A 3TREA 1BBWA 3M85A 2OTLA 1E7ZA 4XTCS 2KCMA 1JB7A 4JI7L 5M5XH 2HT1A 3CXCA 3M3YH 4A3BH 3U50C 5GQOA 1PH2A 3ULLA 4AQYL 2RHQB 2VQEQ 2Z6KC 1UE5A 2CCZA 5IYDH 4DV4Q 1K73C 3PO3H 1Q7YC 1LUZA 1PHJA 4IFDJ 1WJJA 3FKIH 4DV3L 2PI2E 2WAQG 3PO2H 3PV0A 4KI0A 1K83H 5BR8L 3OTOL 1Q1BA 3I4MG 4LF7Q 3RLOA 3A5ZB 4HIOA 4JI2L 4L5SA 4QGUA 4A3JH 5IP7H 3D31A 4IFDI 1ASYA 1X56A 2ZJQA 2MO1A 4X64Q 5M3MH 4DR6L 4GKJL 5ELNA 3IRBA 1UEBA 4JI0L 1PH6A 3HFZB 1QVFA 2Z6KA 3S1QH 2V1CC 4JI5Q 1A8VA 2R92G 1EYGA 4DR4L 4BBRH 1HR0Q 4DR1Q 1N8RC 5IWAQ 4JV5L 3FP9A 5BR8Q 3CF5A 3CCVA 5C4JH 3Q8DA 3KJPA 5LMNQ 1PH1A 4AH6A 3GTOH 4BBSH 2R7ZH 4QL5A 2JA7H 2IY5B 4O0AA 1QUQA 1VQBA 4DR6Q 1MKHA 4YCWA 3KJOA 1X3EA 4YWKA 3TQYA 2CWPA 4RG1A 1MJEA 4JI4L 2E2IH 4A3DH 4OWXB 3LGJA 3ULJA 2AHOB 1CSQA 3I4OA 1W3SA 4A3CG 5JEAJ 1XPOA 1HZCA 2WB1E 4P73A 4DUZQ 2F3IA 1UE6A 4X66Q 1OXUA 2IHEA 2MO0A 3W1BA 3CC2A 1VQAA 1G291 3KOJA 4O2DA 1KAWA 3K8AA 4JI8L 3G71A 1IBLQ 1MIUA 3KF8B 3RLFA 1EQQA 4JI4Q 2UXDQ 1IZ6A 3PF5A 1VQ6A 3H3VI 3VDYA 2E2HH 4GLVB 4GLXA 2N78A 2ZM6Q 4P75A 4A3MH 4IO9A 1TWGH 1ASZA 1LYLA 3F1ZA 4A93G 3HOZG 1E3PA 3G48A 4X65L 2K5NA 3RN5A 2HIVA 2JQOA 2CKZB 3MEFA 4LUZA 3HOWG 3UDFA 4WJ4A 2D0OA 1A0IA 3K0XA 4JI3Q 4JYAL 1OXTA 2K52A 4LF6L 3KDFB 2UUCL 1X6OA 1B7YB 3CCSA 3CMAA 1L1OB 1S3OA 2ZTDA 2JK8A 3PUWA 4OWTB 4IOAA 4DUYL 1VQMA 1SLJA 1MJCA 1XMQL 1YHBA 4DV2L 3NBHB 3I4MH 4BXXH 2UU9Q 2YU9H 4GOPA 4JI6L 3ICEA 2N3SA 3S2HH 1KIXA 4YCUA 2BA0A 3RR5A 1P16A 5C4XG 2K75A 1I6HH 4IPDA 4DR3Q 2B63G 1VQCA 1WCMG 2UUCQ 1YEZA 3CCMA 1Y1WG 3G4SA 5M3FG 1NBWA 2VZAA 2A8VA 1G51A 3BZKA 1VQNA 3NELA 4YHHQ 4DV5Q 2D0PA 1U5KA 2R92H 1JE5A 1FGUA 4DUYQ 1W2BA 2K5VA 3PUXA 1VQHA 3NENA 2VQFQ 4DV2Q 4BA2I 1PH5A 1XNQQ 4K0KQ 4H02A 4JI6Q 1B70B 3RZOH 3TRZA 3TS2A 2BH8A 2PNHA 5IYBG 2KENA 1YVCA 3A74A 5FLXc 1N34L 3GTKH 1PYSB 2OTJA 2QGQA 3KLWA 4JC0A 5JJIA 1M90C 1SR3A 1I50H 1VQEA 1SROA 1KRTA 1YI2A 3STBD 3T1YL 4IFDG 4A3CH 3K80C 1YJNA 3AEVA 5C0XJ 4APVA 1V1QA 2YV5A 1HNZQ 2VNUD 4WJ3M 4B3RQ 2F52A 2KCTA 4P71A 3L0OA 1CKNA 3E9HA 3KF6A 1X55A 2L15A 2WB1G 4LF8L 1A62A 4LUVA 1EIFA 4PG3A 4GNXB 1X3GA 1SFOH 4NB3A 5C0XI 3PF4A 3CW2C 3B6YA 5JJKA 3UDIA 2NZOA 1YHAA 2Y0SG 1VQOA 2K50A 4R4IA 4UP7A 1YITA 4A93H 3HOZH 3K7AH 1EIYB 4GS3A 2DUDA 1VQGA 1GM5A 3HOWH 5JJLA 5H1SE 3CD6A 4QJFA 1SE8A 3GTMH 2GN5A 5E7NA 4IPGA 1FVIA 2DGYA 5IYCG 3S2DH 3ER0A 4OWWB 2VUMH 4DR5L 3E0EA 2IHFA 4ALPA 4DV0L 3CPWA 1AH9A 3JAMi 4C3HH 5IY0A 4LWCA 1OXSC 3CC7A 1C0AA 1HZ9A 4JI7Q 4GN5A 3FHWA 4AQYQ 4KLKA 2UUBL 4LF9L 2GVAA 4C3JH 5GAEC 3W1GA 5IE8A 4B3SL 3J7ZC 3RLNA 1KHIA 5C4XH 2R93G 3PIPA 4DV3Q 4DR5Q 2Q2UA 4KHPL 2MFIA 1WCMH 4PZ7A 2B63H 1YJWA 3OTOQ 1CUKA 1Y1WH 3S1RH 1P8LA 2I5HA 4JI2Q 4LF5L 3UDGA 5IP9G 2YTYA 4DR7L 2K14A 3HKZG 4LFBL 3EBEA 3A0JA 4JBJA 3S14H 4BA1I 4GKJQ 4LF9Q 4NXML 3U58A 1XPUA 4LNQA 1TWAH 3JAMc 1EQRA 1KRSA 3AYHB 4MNOA 4JI0Q 3I4NG 3NEMA 1J5EL 3CPFA 4LFAL 5IYBH 4POFA 1X9NA 1PA6A 3HOVG 3L7ZC 1OXVA 1VS0A 4DR4Q 4JV5Q 1I3QH 1TWCH 4LF5Q 3GTPH 2UXBL 2AKWB 1HJPA 4MZ9A 4A3KG 3UE1A 5GROA 3M4PA 2BH2A 1SRUA 2H5XA 4DV6L 1U0LA 4A76A 4LFCL 1HZBA 2YTXA 1K8GA 3M4OH 2HHHL 3H0GG 1XMOL 4DAMA 2BA1A 2ZTCA 4QQBX 1N9WA 1KD1C 4FDBA 3CCUA 4LF4L 4IPHA 4C3IH 4DNIA 2UXBQ 1B8AA 3ERSX 3F8TA 4GOPC 3CCLA 1FL0A 4JI8Q 4JI1L 4OO1I 4AYBE 1GD7A 5C3EG 2ALYB 2EXDA 2MQHA 3CMEA 2EIFA 1N32L 4DV6Q 1X54A 1X65A 4LFCQ 2HHHQ 1XMOQ 4AIMA 1C9OA 2B29A 3BJUA 1KXLA 5IT9c 1IYJB 1KQSA 4UP9A 1NTGA 2OQKA 3K7UC 3PUZA 4X65Q 3CC4A 3KDFA 3S1MH 4DKAC 4LW1A 1OXXK 4JI1Q 1IL2A 3SGIA 2AMCB 1N32Q
chains in the Genus database with same CATH superfamily
2N49A 2A69C 1K0RA 1EEID 4LF6Q 5CYUA 5C0XG 4BBRB 1NY4A 2I46A 1CT1D 4IJHA 1HH2P 4DAPA 4A3IB 2JA7B 4GN4B 3NBIA 2EZVA 1T9HA 4A3EB 5ELFA 4F7XA 4X62L 1SMXA 1F9PA 5CBEE 3GTQH 2E2IB 2JA6B 4KD3A 3S15H 1VQFA 3W5OA 5IP9H 4QUFA 3FEWX 2I0QA 1D2BA 2OQ0A 5CV6A 2ZJPA 2WFWA 1LV9A 2OCEA 4HMJA 3VR4A 1L2FA 2NN6I 4A4IA 4JG2A 4A3KH 2I5LX 2IT1A 1AZPA 2AWOA 3EIVA 3NXWA 1DM0B 3H0GH 5C44B 1TWFH 1NR2A 2RSNA 4YY3L 2JEAI 1STYA 5LMUL 5JVG3 1VQ7A 1MSHA 1Z9FA 2VL6A 2XIWA 1MI2A 1Y1VG 3G6EA 2Q8IB 3E9IA 1LM0A 2EYJA 1YNXA 4UAIA 2AUKA 5FOBB 3MC0B 1TY0A 1PTOH 2B8FA 2NVQB 1VCIA 4ZUJA 2VQEL 1NR4A 1EY7A 1Z47A 3HOXG 3S2HB 5CR3A 5LMUQ 4NP5A 4A3FB 3DMUA 4C2MH 2P5ZX 2F4VL 2DJGC 4LF7L 1ET6A 3TZUA 1VQ5A 4XQJA 1PFBA 2XWJB 4RA8A 4FNFA 1FJGL 4DK6C 4BY7H 4DV0Q 4DXGA 1K3RA 2IPKD 3EN2A 2NBFA 4CDEC 4A3LG 4TVAB 2F4VQ 1EU3A 1SNCA 4QB4A 1HR0L 4A3GG 2CWAA 2F0KA 4EX5A 3HOUG 2NTSA 3MXUA 2H1EA 1FJGQ 1B50A 4UP8A 1PV4A 4MN3A 1K0SA 4DR7Q 2HQLA 1BBUA 1EYAA 2BE5C 1UAPA 1H9JA 2NVYH 2RHSB 3I4LA 1F9SA 4KHZA 4BY1G 3R3OA 1GVPA 4U673 2RQXA 4L6TB 1AE3A 4J15A 1IBML 4POGA 1XWEA 1SYCA 3ZJYC 2BCOA 1IBLL 4LFAQ 2UXDL 2PCFB 1WFQA 3BU2A 3CCQA 4OXPA 2Q2IA 1BQQT 3F2CA 3CP0A 2N8NA 3OSOA 2JE6I 3HGBA 1LLRD 2R7FA 1IBMQ 3FKIB 3GTGH 4RMFA 3QOLA 2D62A 1TWHH 5EPKA 3EQLC 1E24A 2PI2A 4FXKC 1LTLA 2K05A 1R4QB 1TXYA 1E1TA 1PYBA 3I8ZA 2NN6G 3PUYA 1BCPF 4YWMA 1RODA 1GO3E 1EEFD 5M3MB 2QKIC 1O7IA 1BBXC 5M5YH 2CHBD 5COYA 2B2UC 2EYFA 4HJ7A 1TQOA 5AFWA 3X3NA 2JA8H 2EJMA 4JOIC 2VUMG 3PIP3 5LHY1 2KHJA 4MTKA 1JMCA 1PH4A 2CQAA 2QA4A 1CTMA 4OO1H 2E74C 5FO9B 3PIO3 2NB0A 4DV5L 2X6GA 4DAYB 4K0KL 1STEA 3HKZE 1U4PA 4HCEA 1C7YA 2B3GA 1YZ6A 4FF1A 2F0QA 4IUVA 3KK7A 2CW0C 2R3ZA 1A3VA 1K28A 4BBRG 1YJ9A 4X6AH 4M1UB 5JVH3 1Y69U 2E2HB 3KUPA 4L5TA 4A3DG 3M4QA 4A3MB 5D3DA 1QCBD 5IIFA 3S9WA 1BNZA 4AYBB 3MXNB 5ELEA 4B3RL 4RGTA 1I94L 3C1EA 1PRTF 1L0XB 4DK3C 5C3WA 2A6HD 1YNND 2ASBA 2Z8LA 4GNXA 3UE0A 2F0TA 3J80c 1E1OA 1Y14B 3BVMA 1XPRA 5EJWA 2XGTA 4IJLA 1SE4A 4V0BA 1VDZA 2ZJRA 1TT2A 1I94Q 5D14A 3FVQA 2EY2A 1EY5A 3J81j 2JEBI 3I4MB 2KVMA 4ME3A 4PMWA 1UE7A 1MBYA 3HOYH 3I7FA 3PSIA 5FLMH 4ZYSA 1ZYRD 4JI7L 4LJZC 3N6RA 1PDQA 5M5XH 3M3YH 2KUMA 3A7AB 5GQOA 1PH2A 4AQYL 1FNWA 1EQVA 3DHQA 2Z1CA 3PO3H 1CI3M 2A6EC 3RZOB 2XVSA 3PV0A 1FR3A 1FNVA 1GUTA 3A5ZB 1HQRD 1SYEA 3RLOA 5FLXL 3TDQA 1X3PA 1EZ8A 3D31A 2Q8TA 1ENAA 1KTKA 2MUYA 2EE1A 1EY6A 2Z6KA 3S1QH 1U4RA 4J1MA 3OMCA 5C4JH 1I4HA 3Q8DA 3KJPA 1CA5A 1Z7TA 2R7ZH 2F0OA 4O0AA 1QUQA 1CHPD 5IGCA 1MKHA 2ICIA 3MTSA 3K7AB 4KHVA 4MIUA 3HOWB 3D4WA 3E5SA 2F3IA 1UE6A 5C4HA 1OXUA 2IHEA 1VQAA 3S2DB 3I90A 4O2DA 3TP5A 2SOBA 4Z9CB 3G71A 3KF8B 1BDOA 2F4IA 3RLFA 1PYWD 1EQQA 1GUWA 4C3HB 2NZ1D 3PF5A 1F9QA 2QF7A 2WACA 3ERQA 2A73B 4IO9A 1LYLA 4A93G 2KCNA 2K5NA 3MEFA 2JQOA 2K5WA 2ENBA 2FFKB 2FJ2A 2A74C 1WCMB 2EY6A 3K0XA 5I9PA 2LY7A 4TSSA 2F0DA 4IUQA 1K3BC 4FP5D 1X6OA 3MA2B 1B7YB 5IODA 1YNJC 3CMAA 2ZTDA 4I65A 2JK8A 4OWTB 4I7AA 2K5QA 4CDFC 2F03A 3AU7A 4DUYL 4CJ1B 1VQMA 4DV2L 2UU9Q 1P16A 1TWCB 2K7VA 4XXEA 1PZID 3CRLC 1YEZA 3BDCA 3IFTA 3CCMA 3G4SA 2J4XA 5M3FG 2VZAA 2PZUA 1STAA 3BZKA 1VQNA 3NELA 1B3QA 2R92H 4DUYQ 2E76C 5ELDA 5FLXE 4ZLTF 4DV2Q 3T13A 1KABA 1SAPA 4HAEA 5IYBG 3GTKH 1N34L 4OIJA 3U9SA 2OTJA 5JJIA 1VQEA 1KRTA 1YI2A 3HRZC 3A8JE 2K32A 3STBD 3GTGB 1YJNA 4HSPA 3AEVA 3DWPA 1V1QA 2VNUD 2K1BA 3OHXC 2L15A 2WB1G 3W3AA 4C3IG 1SE3A 4L8JA 3PF4A 3CW2C 2NN6H 2Y0SG 2X6LA 2R93B 2DUDA 2DY7A 2FHTA 3VYSA 2VB2X 3H91A 4QJFA 3GTMH 1LT5D 1SSOA 3IL8A 2VUMH 3NPPA 4ALPA 5KNDA 3CPWA 3TSSA 2NVTB 3JAMi 2JN4A 4LWCA 5IY0A 2RA4A 5HURA 2F0PA 2N55A 3Q6SA 1JOKA 3I4NB 2EXZA 4C3JH 5GAEC 1VMPA 3RLNA 4DV3Q 1PMRA 2B63H 1EIGA 1V1OA 1ENCA 2I5HA 2EYLA 3MFYA 1IL8A 1GJXA 1WTPA 5IP9G 2YTYA 1I6VC 3S14H 4GKJQ 3U58A 1XPUA 5C6AA 3AYHB 1W6JA 2IX3A 3L7ZC 5C3EB 1R9TB 2FINB 2SEBD 3DUZA 4C56C 3GTPH 2L55A 3BYYB 2AKWB 4A3KG 2WV6D 2EY1A 3R93A 4FF3A 5GROA 1D6EC 3M4PA 3W2DA 4DV6L 4ZKCB 4A76A 1HZBA 2YTXA 2HHHL 3H0GG 1XMOL 1ENFA 4DAMA 3NHHA 2BA1A 3OWFA 3GV3A 1FL0A 4OO1I 4JI1L 4AYBE 1F2ZA 1BOSA 1RD9D 1KDBA 2ALYB 4DV6Q 1X54A 1KAAA 2HHHQ 1XMOQ 1S5FD 3DEOA 1A15A 5G3LF 1XYIA 3T16A 2OQKA 3A8KE 5I4DA 3CC4A 3KDFA 1BCPC 3C2PA 1TKWB 4JI1Q 1IL2A 1A2TA 3UI2A 4PZ6A 5KYIA 1IW7C 5AJ3L 4DAYA 2KBNA 2E2JH 2G5DA 4BY7G 1TY2A 1C4QA 1A63A 5LMNW 1EWCA 1DOKA 4C1NI 1PFMA 4HJ8A 5FKAC 1JT8A 4RH6A 1NMFA 3OW2A 2E5LL 1I5FA 1E0BA 5AJ3Q 3WDNA 1PH7A 1LTRD 2B8GA 1VQKA 2ATWA 1G6PA 3RUZA 4JCVE 4HJ5A 2Z4IA 3D4RA 3MXNA 3TMEA 2Q8RE 3ITPA 4IN3A 1Y1VB 2GA4B 1O7LA 2E5LQ 1B3AA 1PVOA 2JJQA 4XYOA 1UWVA 3U4ZA 2J7ZA 2PYKA 3TEHB 2L12A 4P74A 2IW3A 3HOXB 2MP1A 1PRTC 5C5MA 1WTXA 1KC8C 1LTBD 2O5JC 3OPOA 1CKOA 2UUAL 1V1PA 4HTHA 5J39A 5EKIA 2PZTA 3O13A 2RSOA 1NMGA 3I70A 5DNFA 1S40A 2K5HA 2JSOA 4LF8Q 2KHIA 3K81C 3KFUA 1TIID 3GTJH 4BS9A 1ESFA 1S72A 4JBWA 4JBKA 1DYQA 4A3GB 3A56A 4R4TA 3KBXA 1OTCA 4RHRA 3HOUB 5M5WH 2VB3X 2JA8G 3OW7A 1R4PB 2I5MX 4RCNA 4LUOA 1VQJA 4OO1G 1Y8OB 1B2TA 2O5IC 4BY1B 2B2TA 2HCIA 3CAMA 5M3FH 2A68D 2KEDA 2K01A 4JI5L 3QJYA 4R4CA 4DR1L 2Q2HA 5IWAL 3TP6A 1SYDA 4BXXG 4QY7A 5K36H 4J8QA 1Q1EA 1QILA 1N33L 3HKSA 5LMNL 4B3SQ 3L2PA 4KHPQ 3GO5A 2YTVA 1VQ4A 1PTOD 1EYCA 3GD7A 2WKCA 3VA7A 2KOLA 1QUQB 3L3OC 2JA5H 5F2DA 1KDCA 3BDLA 4NXMQ 1B44D 1F2LA 2F0SA 1N33Q 2MJ8A 3V05A 4A75A 1HNXL 4CDDC 5EAYA 1DD2A 1HRJA 2A19A 3H6MA 1Q46A 3CCRA 2EY5A 3J81L 3OIQA 2ZM6L 3PCOB 1UNSA 3K0YA 1VQIA 3AFQA 4R9WA 2VUMB 4KJNA 1HNXQ 1JJ2A 1S5DD 4JI3L 1LTGD 1K83B 3CQZH 1BF4A 2KCCA 2EYHA 3HOYG 1M8AA 5FLMG 2LSSA 1PH8A 2C9OA 2KECA 2WAQE 4NXNL 2DJFC 1A3UA 1AZQA 4CKEA 1HR0W 4NKLA 3VYTA 4FVMA 5DM73 1TVXA 3PO3G 1GUGA 1STHA 5I2XA 4R1JA 4DR3L 1RF2D 5TSSA 5CGKA 4A3DB 5J3BA 3MXPA 4NXNQ 2Z0SA 1XJVA 1LTID 1QVCA 1PFSA 2KEEA 1GHJA 2VS1A 1BVSA 1XNQL 3NQIA 3J7AF 1Q8IA 2LXJA 3J80i 3I55A 1IYVA 4GNXC 1YBYA 4GLAC 4RAUC 4X62Q 4HIKA 4K6LA 3BZCA 3D4DA 5HGQA 3H3VC 2R7ZG 1DOMA 5JPNC 4HJ9A 2PNRC 5EKLA 3I3CA 4EQNA 4HMIA 2PPBC 4WORA 1M1KC 5EPLA 1HNZL 4GN3B 2ES2A 1VQPA 1TS4A 3OIPA 1Y8NB 5CORA 2VW9A 4KKTA 3FRPB 5J22A 2AQ1B 2SNMA 3TS0A 2JYOA 4X66L 3DM3A 3T4AC 4LMQD 3C46A 1H95A 4QIWB 1STGA 4C1NK 4R4OA 4RKLA 4YY3Q 2YU9B 3BS1A 4B9XA 1G2SA 1H9SA 3S17H 4IOCA 1I6HB 3J81E 5D65A 1SXTA 1UUPA 3AB9A 1FD7D 3KBGA 3TREA 3M85A 1E7ZA 4A3BH 3CXCA 4ID6A 4FXDA 2VQEQ 2Z6KC 1Q7YC 1LUZA 2RCFA 3A54A 1WJJA 3H94A 4IFDJ 1D5XC 2PI2E 3PO2H 4KMUC 4P2CB 3OTOL 1Q1BA 4LF7Q 4JI2L 4A3JH 1I50B 4IFDI 1X56A 4N9PA 4JK1C 4F88A 3IRBA 1UEBA 5C4ZA 1PH6A 1U4MA 1QVFA 2BDOA 1ZKOA 2R92G 4N8X1 1HR0Q 2RBMA 3FP9A 3CF5A 4JV5L 3CCVA 1NSNS 4BBSH 4AH6A 3GTOH 2IY5B 1F9RA 2B2WA 4YCWA 3KJOA 2PMZB 4ABNA 4RG1A 4OWXB 4A93B 3VR6A 1PZJD 3TP8A 1MGSA 4ME5A 1HZCA 5JEAJ 4X66Q 2OXPA 5IGFA 1G291 4V190 5C5LA 2EOTA 1KAWA 1SJED 4JI8L 2K03A 1IBLQ 1JR0D 1MIUA 4ZQ3A 2UXDQ 1WTHA 3VDYA 1QJOA 4GLVB 4GLXA 1S5CD 3MHBA 2NWGA 2N78A 5M5WB 4G4KA 5IGGA 1TWGH 3F1ZA 1E3PA 4X65L 2ZXPA 3TP7A 2C5CA 2CVRA 4RGNA 1STBA 1W6KA 1A0IA 5M3FB 3S1RB 2K52A 1BO0A 3KDFB 2UUCL 4OGQC 4KN7C 2F3WA 1L1OB 1S3OA 2F1MA 3K5LA 1TWAB 5KIXA 3T51B 4ULLA 3JAML 1SLJA 1XMQL 3NBHB 1FGBD 4C3JG 3K58A 4BXXH 4GOPA 3ICEA 1KIXA 4OL7A 2F0WA 2B63G 1VQCA 2UUCQ 5CC4A 1I4QA 2A8VA 2CH4W 2ZXOA 3BDOA 4DV5Q 2A69D 2D0PA 3M4OB 2K04A 3DWAA 2JP1A 2LFNA 2G9HD 1PH5A 4K0KQ 4RCOA 2WB1B 3L9AX 4C3IB 3TS2A 2BH8A 4CDCC 1D1KA 3A74A 3QIAA 5EPJA 1PYSB 4U68A 4R8IA 3KLWA 4JC0A 2Y0SB 1WVLA 1M90C 1Q90A 2L11A 1D5ZC 3T1YL 4IFDG 1G91A 2FMCA 4XDXA 1H9KA 3BVZA 3HG9A 3S1MB 1VF7A 4B3RQ 2IWHA 3E9HA 1V8QA 4CJ2C 2K28A 1M4VA 1V1PB 1A62A 1EIFA 5ELCA 1SFOH 1IYUA 3GQBA 3B6YA 1O7YA 1LO5D 2PO4A 3UDIA 2NZOA 1VQOA 4UP7A 3HOZH 4JPBW 5H1SE 1WTVA 1GOZA 1SE8A 5E7NA 2NUCA 2DGYA 3MAQA 2HDLA 3GTQB 3ER0A 3S15B 1CK1A 2IHFA 1DCZA 1AH9A 4MHEA 1C0AA 4JI7Q 4GN5A 5T1GA 4AQYQ 2UUBL 4LF9L 1SNPA 2GVAA 5ISRA 4HN7A 2L9HA 2ZXRA 5IE8A 2RVLA 1KHIA 3EROA 5CV8A 5C4XH 4G7OC 3PIPA 2Q2UA 2QILA 4A3KB 2MFIA 4ILWA 5T1IA 4X3TA 1Y1WH 4TRDA 3RMHA 4PMCA 3JAME 2B39A 4LFBL 3H0GB 4JBJA 4BA1I 1TWFB 4LF9Q 4LNQA 1CQVA 1QE6A 1EQRA 2ZT9C 4QF4A 3NEMA 1J5EL 1AEXA 1X9NA 1PA6A 3VA5A 1I3QH 2F0FA 1HJPA 1PTOB 4MZ9A 2H5XA 3EJIA 4M8AA 1U0LA 2TSSA 3HZXA 5I9OA 3SXHA 4C2MB 1SNDA 4RKBA 1N9WA 4K2KA 3CCUA 4LF4L 4I7ZC 3ERSX 3D3RA 2B2VA 1GD7A 3V2TA 4BY7B 2KQ3A 1C8CA 1N32L 2EIFA 3SVMA 2IL8A 1U4LA 5IOCA 1WTQA 1FNUA 3BJUA 2PW7A 3LX0A 3J7YW 5IT9c 1KQSA 4UP9A 1FYCA 1EOTA 2TMPA 3K7UC 4LW1A 4G57A 1HCZA 4DK1A 1N32Q 3TBIB 1HTLD 4QIWE 3P75A 4DV7L 4KY7A 2QEXA 4OHJA 1KL9A 2X69A 3H15A 1ESRA 1JQYD 4Y7NH 4RGMA 1RDPD 2NVYB 1JWUD 4WFN3 3I91A 1VF5C 2K4KA 1HPCA 1H9MA 5K36G 1S5ED 1EYDA 3CCEA 2ID0A 5E4WC 1ZEQX 2MHVA 1LTSD 5IP7G 4KY6A 1HUNA 3GTLH 2L1BA 4NPSA 4P72A 1VQ9A 2RKSA 2AQ2B 2E2DC 3VR2A 1O78A 3RZDH 4DA2A 3Q0AA 1CA6A 2JA5G 3HOVH 4DXFA 4EGVA 3Q22A 1TWHB 1I4GA 2HD3A 4HCSA 2F0NA 5IGBA 2CW0D 3MXGA 1IBKL 1N34Q 2LXKA 3C1FA 2EYPA 5DM63 3SEBA 1Q12A 3I2ZA 5M5YB 3QG1A 1PFNA 5DLQE 1Q86C 2G9DA 2JA8B 2PMZE 3CCJA 5HGTA 4G7ZC 1PH9A 1WI5A 1CKNB 4F8MA 3KF6B 1IXRA 1EY8A 2F0VA 1SMYD 1H9SB 1DOLA 2B2TC 3NK9A 2JXMB 3T1HL 1HFGA 3CU7A 4DV4L 1HTPA 3HS0C 4KK7A 2DN8A 1EFWA 1HZAA 3S16H 3VR5A 4K8IA 1SNQA 5M9OA 1J6QA 2EYMA 3J81c 1D8LA 1I4XA 4ZK9B 4X64L 2ZTEA 2I07B 2IX0A 3T1HQ 4QCLA 4CHTB 1K8AC 3F2BA 4CGYB 5CMDA 2NZHA 4KD4A 5FO7B 2CH4A 3MWYW 5HY6A 2UXCL 1HA6A 1RJTA 4GKKL 3GDEA 3S1NH 1B9NA 2A6ED 5GAHC 5GADC 4DV1L 4DNTB 3KYHC 4DUZL 4IFDH 2R6GA 2CQOA 2XRSD 2UXCQ 1JB3A 4UDUC 4A3IH 4GKKQ 4PMBA 3BZDB 4TQUS 4A3EH 2XTIA 1B9MA 1QVGA 3HOYB 2Q2TA 4DV1Q 2JA6H 4HR7B 1BUVT 5M5XB 3M3YB 4XT3B 4N8FA 3TZDA 1E2WA 1X3FA 2NVXH 3PO3B 5KNCA 4Q5VA 2SDFA 2Y0SE 4K8JA 1CZGA 3I73A 1WTOA 1PH3A 4PQXA 4DN4M 4KV6A 3FMCA 4KJOA 1GUSA 1L1OA 5FJ8H 5JEAH 2GVBA 4A3BG 2KJXA 3S1QB 5C44H 4N9TA 3SK6A 3NBHA 4H7BA 1RIPA 3JC66 1F2YA 5C4JB 4XT1B 1LTTD 2HIXA 3PO2G 4OONA 2R7ZB 2K5DA 2RF4A 3DEPA 1VQ8A 4GOPB 4IALA 4YHHL 4A3JG 2NVQH 1Q3LA 1H9RA 2VQFL 1NJIC 4GZYC 1VQLA 4A3FH 1YNJD 4ZRZA 1QG7A 1Q81C 4CBVA 1VQDA 4B3TL 3U4VA 5I2YA 4BBSG 3NQTA 1QZHA 1PXUA 2WP8J 2V4DA 2L4NA 1HFNA 4XQQA 1GUOA 4ODGA 3F2UA 1Q8KA 4NDXA 4DR2L 4XIGS 3FPUB 4B3TQ 2D9UA 2PQAB 2RCNA 4EQ5A 5CV9A 1XNRL 1BR9A 1BKBA 2OT2A 4PZ8A 1D7QA 2EDGA 2Z6BA 5EQ0A 3R8BA 4HIDA 2MPMA 2F0JA 1JE4A 1EOVA 4DR2Q 1CZWA 1Q82C 1L0YB 2JA9A 2MNAA 3RNUA 2UUAQ 3Q24A 3AQQA 3URYA 1XNRQ 1HXYD 2YYZA 4QMGA 2WINB 2IJ0A 1A3TA 3NTKA 5BN3A 1G6ZA 2HUGA 3RN2A 2HT1A 4YIJA 1B1ZA 1HQMC 2OTLA 4L63B 3K57A 4WJWA 5DEHA 3U50C 3ULLA 1F77A 2K6AA 2R92B 1ILPA 5IYDH 1K73C 1PHJA 3FKIH 2WAQG 3KLSX 3GTKB 4HIOA 3SR1A 4L5SA 3M7GA 1IKLA 2B2WC 5IP7H 4EVOA 3E3XA 1ASYA 2MO1A 5M3MH 4JI0L 2V1CC 1LT4D 1A8VA 4JI5Q 1EYGA 4DR4L 3A8IE 3MVVA 4DR1Q 3V96A 5IWAQ 1EL0A 3E0JA 3PMFA 5LMNQ 1MSGA 1PH1A 4QL5A 1II3A 1VQBA 2LKVA 1D1IA 1X3EA 1MJEA 2CWPA 3LGJA 5LL6X 1CSQA 3I4OA 1W3SA 1J8IA 1JCKB 1JOOA 1B4OA 4P73A 5CV7A 2MO0A 3GTMB 3DM1A 3K8AA 2L5TA 5EGTA 4CJ0B 5D3IB 2F0MA 1RCVD 1IZ6A 1VQ6A 1G2TA 5DAUA 3H3VI 3IKJA 1TS2A 2E2HH 3S16B 5CV5A 2ZM6Q 4A3MH 4C3JB 3HOZG 3G48A 1TS5A 3RN5A 2HIVA 2EPBA 1SYBA 2RDFA 1STNA 2B63B 4WJ4A 1EFID 2D0OA 5IGDA 4JI3Q 1OXTA 4ZUIA 3OWEB 4LF6L 2L0CA 4B9WA 2O4XA 3S14B 3CCSA 1SYFA 3X3MA 3K5NA 4IOAA 3G7LA 3IAYA 1IHZA 3SHLA 3I4MH 3NP8A 4JI6L 2N3SA 1SYGA 2BA0A 4YCUA 3RR5A 5C4XG 2K75A 3GTPB 4IUUA 4IPDA 4DR3Q 1D5MC 3WOEA 1BCPD 1Y1WG 1NBWA 1U5KA 1IW7D 1FGUA 3HP3A 1W2BA 4H0LC 2A6HC 1YNNC 1T5XD 2K5VA 3NENA 3PUXA 2EJFC 1XNQQ 4H02A 4JI6Q 3RZOH 3NSWA 2PNHA 2KENA 1YVCA 5FLXc 2QGQA 2NVXB 4K14A 1SROA 5KGUA 4BWGB 4O42A 1ONLA 4A3CH 3DXJC 3K80C 2YV5A 1HNZQ 2XRQD 1J9OA 1MD2D 2KCTA 4P71A 1CKNA 1ZYRC 3KF6A 3D8GA 4LUVA 1SJHD 1X3GA 1EY4A 4NB3A 1NCVA 3GP7A 3M4YA 2E2JB 5JJKA 1TR5A 1YHAA 1YITA 2K50A 4R4IA 4DU9A 3K7AH 1GM5A 3HOWH 4LAAA 5JJLA 3CD6A 1PRTD 2GN5A 1FVIA 5IYCG 3S2DH 4OWWB 3E0EA 2WIIB 2QDBA 4FXGC 4DV0L 3QO2A 4LK1C 4C3HH 1OXSC 1PTOF 3CRKC 1SNMA 5I6YA 3MEHA 1A2UA 3W1GA 5A35A 2LMCB 4Q0FA 1WCMH 4PZ7A 3OTOQ 1CUKA 4JI2Q 3UDGA 4DR7L 3HKZG 3EBEA 4X3UA 1KRSA 5BN5A 4IUNA 3CPFA 4LFAL 4POFA 3HOVG 4JW0A 4JV5Q 2XWBB 3J7AV 3K59A 2DY8A 1TWCH 2B2VC 1X3QA 1KLUD 1CHQD 1AP0A 3MFGA 1XXGA 3UE1A 2F0HA 4E6IA 2HQEA 3GTJB 2BH2A 1SRUA 5IGEA 5C3XA 4H13C 1G8ZD 4QQBX 1LACA 1GUNA 2AQ3B 1KDAA 4DNIA 1K8OA 4JI8Q 3KLRA 3ND8A 3CMEA 2KHSA 1X65A 1B53A 2B2YA 4AIMA 4H44C 2B29A 4DAVA 5K5PA 3NUCA 3T53B 1IYJB 2E75C 1NTGA 2EVBA 1QNUA 3PUZA 4X65Q 1EWHA 1I4RA 5GAGC 1TS3A 2LS01 1ML0D 2BDNA 1YHQA 2PZWA 2JA5B 4K2LA 5LL6S 2R93H 1PLFA 5E3FA 3GV6A 2M2LA 4ZAIA 1L0WA 4HIMA 1XMQQ 1IKMA 3STBC 1QNKA 1S4ZA 1KNAA 1RHPA 2NVTH 1EQTA 3M9BA 4NMZA 3I4NH 1EWIA 1V9PA 4XYQA 4L5RC 2XNAC 3TN2A 2M9VA 2PQAA 2OWOA 3CQZB 3U9OA 4A3IG 2JA7G 1YIJA 3A5UA 4A3EG 1K9MC 1ZXTA 4IPCA 5BN4A 1AE2A 2PW5A 1CSPA 2CFMA 2VXWA 3BVGA 2JA6G 1JJCB 4KKUA 1EZ6A 3ULPA 2XSCA 3PUVA 5JOBA 1PZKD 3OOCA 2WKDA 3T1YQ 1SMYC 1C48A 3J81i 4YCVA 2R7DA 4RGOS 3LWEA 3QOJA 4DF7A 2N88A 5C3EH 1R9TH 4JBMA 4OX9L 3VR3A 1E22A 3SDZA 1N36L 3IFDA 5FJ8G 1AN8A 5JEAG 1XTDA 4UY8C 5C44G 4L5QA 4TKOB 1HNWL 1O7ZA 3AFPA 3NWSA 4OX9Q 3SK4A 4UHVA 3PGZA 5C0XH 1N36Q 4DPGA 2F0EA 3PIOA 3M7NA 3OYYA 3I72A 3PQIA 1HNWQ 2FMMA 2OEOA 1CQFA 2J0TD 4KY5A 1DONA 1EUJA 2UUBQ 3D0FA 1GKHA 4A3FG 4HJAA 1JICA 1NE3A 1CKMA 3K5OA 4X3KA 1MHWC 4LFBQ 3RD4A 4X3SA 1CM9A 1J5EQ 3S17B 2EQSA 2OF1A 2E8GA 2F0LA 3DLLA 2BE5D 3NTIA 4UPAA 1L1OC 4A3BB 1BXTA 4KKSA 2F0UA 3I56A 1LTAD 2M00A 3A55A 3T56B 3EFXD 1JWMD 3PO2B 1Y1VH 4JVZA 3VYRA 2D5DA 4LF4Q 5IYCH 2K33A 3EVQA 4A3JB 1GHKA 3AMUA 3SK8A 2A1AA 3HOXH 3H3VH 1WYDA 5IYDG 2UU9L 3FKIG 2IX1A 5FO8B 4BBSB 1JOQA 3GTOB 5ELOA 2AWNA 2F0IA 1TU2B 4MTNA 1EY0A 4NW2A 3WWVA 4A3LH 4CKBA 4DV7Q 1XX8A 3J7A5 4F87A 5M3MG 2FXQA 2QEJC 2QDLA 5G3LD 2B2UA 4A3GH 4B3ML 2RDGA 1RL2A 3HOUH 4YWLA 3R2IA 3OMGA 3QWNA 4JOIA 1AFPA 1SN8A 1BCPB 1JJGA 1RTOA 4R4QA 4G7HC 4BY1H 1UE1A 4OIKA 1TWGB 4IURA 5JPMC 1V43A 4B3MQ 1EIHA 1HUMA 4O1NA 3FPPA 1WTWA 5A2QL 2D2CC 4S3SA 4FF4A 3UDXA 1DGSA 1WOCA 1HA5A 1UEAB 3F2DA 1IBKQ 4KTAA 1LABA 2WAQB 3QR8A 4A3MG 1EY9A 2VY3A 1LT6D 1QZGA 4AYBG 4Y52H 3S24A 2C35B 5KRUA 2A68C 1BBWA 4XTCS 2HDMA 2KCMA 1JB7A 3D6CA 4K5WA 4DK0A 2Z4HA 3Q23A 2RHQB 1UE5A 2CCZA 4DV4Q 1PRTB 4EQOA 3K5MA 2EJGC 4DV3L 1NAPA 3LNNA 3N52A 4KI0A 1K83H 4XQNA 5BR8L 1PTOC 3I4MG 2RDHA 4QGUA 1KNEA 4DR6L 2ZJQA 4X64Q 4GKJL 3HEJA 3J80L 5ELNA 3K6OA 3HFZB 4FO2A 3FDTA 2QCPX 3BYTB 3P20A 4BBRH 1E2ZA 1N8RC 1VMCA 5BR8Q 4WRDA 2MGSA 1Y8PB 3VYUA 2JA7H 1SFOB 4OELB 4DR6Q 4YWKA 5EBDA 3TQYA 4JI4L 4A3DH 2E2IH 3ULJA 3HOZB 1QB5D 3D6WA 1OO9B 2AHOB 5E4XA 4A3CG 1XPOA 2WB1E 4DUZQ 5J1ZA 3W1BA 3CC2A 4FF2A 3KOJA 3NE5B 2PQEA 3LWUA 4HEDA 4QUCA 3R2TA 4JI4Q 1LT3D 1WTRA 1RKNA 2Z9HA 5A2QE 4P75A 1ASZA 2CKZB 4LUZA 3HOWG 1E2VA 5C4XB 3UDFA 4IZ8A 3NTHA 4JYAL 1DZ1A 1Y1WB 3A7LA 1SDFA 4EQPA 3ONAB 4PV1C 2ICEC 2R61A 1Z6HA 5E1FA 4C3HG 3WOFA 1QOHA 4PNYA 3CKIB 3PUWA 2QW7A 1JC7A 4DNRB 1MJCA 1T5EA 1YHBA 2NYZD 5KNBA 2YU9H 4JYAQ 3S2HH 1I3QB 4IUTA 1I6HH 1GXDC 1WCMG 3C3LA 2SNSA 1G51A 4YHHQ 4B08A 4FYDA 1ET9A 1JE5A 1I4PA 5ELBA 1VQHA 2VQFQ 4BA2I 3EA6A 1B70B 3TRZA 3E6ZX 1KLGD 1DXMA 1RTNA 3SK5A 3J80E 4ZCKA 2BOSA 1SBBB 1A6XA 1DJRD 5JJZA 1SR3A 1I50H 1SE2A 2F3VA 2DNEA 2HCCA 3BG3A 3G6JB 3H09A 1O80A 5C0XJ 4APVA 4J6HA 5IT9L 4WJ3M 1SNOA 4RHSA 1XTCD 2F52A 4ZKBB 1F2MA 3L0OA 4KN4C 1X55A 5CBAE 4LF8L 4PG3A 4GNXB 5C0XI 1WD1A 3P1HA 4Y7NB 2KA7A 4A93H 1EIYB 4GS3A 1VQGA 2F0GA 2A5HA 4K6DA 3QB3A 2O2LD 4IPGA 4K5XA 1AW7A 3ND9A 1S5BD 5JAVA 4DR5L 1NNXA 3GTLB 3HKZB 4IUPA 1EU4A 3CC7A 1HZ9A 1X32A 1SEBD 3FHWA 3RZDB 3KLSA 4KLKA 4IQZA 3HOVB 4B3SL 3J7ZC 2R93G 1HHVA 5KEEA 4DR5Q 1ILQA 1JWSD 4KHPL 1YJWA 2XN9C 4RWSC 1WD0A 3S1RH 1P8LA 4LF5L 4RFBA 2K14A 3A0JA 4NXML 1ICWA 1K8MA 3DWQA 1TWAH 3JAMc 5KYLA 5I6WA 4MNOA 4JI0Q 1U9RA 3I4NG 5EKKA 3ZYYX 5NUCA 5IYBH 4DR4Q 4DFAA 1OXVA 1VS0A 4K5VA 1CFMA 2AUJD 5L37A 4LF5Q 2DNCA 2UXBL 2EYOA 1ICFB 2B2YC 3SE0A 1JORA 5EBCA 1K8GA 4LFCL 3M4OH 3MZ5A 3P7JA 5CV4A 2ZTCA 3KF8A 3NWTA 1KD1C 4FDBA 4IPHA 4OEMB 4C3IH 2UXBQ 1B8AA 3F8TA 4GOPC 3CCLA 5C3EG 4R8NA 3CHBD 2H4OA 1QWYA 2EXDA 2MQHA 4HSVA 5IT9E 4LFCQ 2NTTA 5FK9C 1C9OA 1KXLA 4DGZA 3S1MH 1NUCA 4CKCA 3S1NB 4DKAC 1OXXK 3SGIA 2AMCB
chains in the Genus database with same CATH topology
2N49A 5GAGC 4PZ6A 4QIWE 1K0RA 4DV7L 5AJ3L 4LF6Q 2QEXA 1KL9A 1YHQA 2KBNA 5C0XG 2E2JH 3H15A 4BY7G 1A63A 1NY4A 4Y7NH 5LMNW 4IJHA 1HH2P 2R93H 4HJ8A 2K4KA 4GN4B 1T9HA 1JT8A 5K36G 1NMFA 1L0WA 4HIMA 3CCEA 3OW2A 4X62L 1XMQQ 2E5LL 1SMXA 2ID0A 3GTQH 1I5FA 3S15H 5IP7G 3STBC 1VQFA 3W5OA 5IP9H 5AJ3Q 1PH7A 3GTLH 1VQKA 2ATWA 1G6PA 2NVTH 4NPSA 4JCVE 2I0QA 4HJ5A 4P72A 3M9BA 2OQ0A 1VQ9A 2ZJPA 1EWIA 2WFWA 3I4NH 3RZDH 1V9PA 2JA5G 4L5RC 3HOVH 2OCEA 2PQAA 2OWOA 4A3IG 2E5LQ 1L2FA 2JA7G 1PVOA 1YIJA 2JJQA 2NN6I 3A5UA 4A4IA 4JG2A 4IPCA 1UWVA 3U4ZA 2I5LX 2IT1A 4A3EG 4A3KH 1K9MC 1AE2A 2AWOA 3EIVA 3TEHB 1IBKL 1CSPA 2CFMA 4P74A 1N34Q 2LXKA 2JA6G 1Q12A 3I2ZA 1JJCB 3ULPA 5DLQE 3H0GH 1Q86C 1KC8C 1TWFH 3PUVA 3T1YQ 1CKOA 2UUAL 4YY3L 2JEAI 5LMUL 3J81i 2PMZE 4YCVA 2R7DA 1Z9FA 2VL6A 3CCJA 1VQ7A 1PH9A 1WI5A 1Y1VG 3G6EA 3E9IA 1LM0A 1CKNB 1NMGA 1YNXA 5C3EH 2K5HA 1IXRA 3KF6B 1R9TH 1S40A 4JBMA 4LF8Q 4OX9L 1E22A 2KHIA 3K81C 1VCIA 3KFUA 2VQEL 3T1HL 1N36L 3GTJH 4DV4L 1Z47A 5FJ8G 3HOXG 1S72A 4JBWA 4JBKA 5LMUQ 5JEAG 1EFWA 1XTDA 1HZAA 4R4TA 4C2MH 1OTCA 5C44G 4UY8C 2F4VL 3S16H 4L5QA 1HNWL 5M5WH 4JYAQ 4LF7L 2JA8G 3AFPA 1VQ5A 2I5MX 1J6QA 4OX9Q 3J81c 1D8LA 3PGZA 4X64L 4LUOA 2ZTEA 2IX0A 3T1HQ 4DK6C 1VQJA 4DV0Q 1N36Q 1FJGL 4BY7H 4OO1G 4DPGA 3CAMA 5M3FH 1K8AC 1K3RA 3EN2A 3PIOA 3F2BA 3M7NA 4A3LG 4JI5L 2NZHA 3OYYA 4TVAB 2F4VQ 1HNWQ 1HR0L 4R4CA 4DR1L 2Q2HA 5IWAL 4BXXG 1EUJA 4QY7A 2UUBQ 1Q1EA 5HY6A 2UXCL 4A3GG 1N33L 3D0FA 1GKHA 3HKSA 5LMNL 4HJAA 4A3FG 1NE3A 3L2PA 3GDEA 4B3SQ 2CWAA 4GKKL 4EX5A 3S1NH 3HOUG 5GAHC 1CKMA 4KHPQ 1FJGQ 5GADC 3GO5A 4DV1L 4UP8A 2YTVA 1VQ4A 1PV4A 3GD7A 3KYHC 4DR7Q 2HQLA 1BBUA 1QUQB 4DUZL 4LFBQ 2JA5H 2RHSB 2NVYH 4BY1G 2R6GA 2CQOA 4X66L 4KHZA 4NXMQ 2UXCQ 1GVPA 1N33Q 4A3IH 4A75A 4GKKQ 1AE3A 4J15A 1IBML 4TQUS 4POGA 1HNXL 1J5EQ 4A3EH 3ZJYC 2XTIA 2EQSA 5EAYA 1IBLL 2E8GA 4LFAQ 2A19A 3DLLA 1QVGA 2Q2TA 2UXDL 4DV1Q 1WFQA 3BU2A 3CCQA 2JA6H 4OXPA 2Q2IA 4UPAA 1L1OC 1Q46A 3F2CA 3CCRA 3I56A 2ZM6L 3CP0A 2N8NA 3PCOB 2JE6I 1X3FA 1VQIA 2NVXH 2R7FA 3AFQA 1IBMQ 1HNXQ 2Y0SE 3GTGH 1Y1VH 4RMFA 1JJ2A 2D62A 1TWHH 4JI3L 1E24A 2PI2A 3CQZH 4LF4Q 5IYCH 1LTLA 1TXYA 1E1TA 1PYBA 1PH3A 2NN6G 3PUYA 3HOYG 4YWMA 1GO3E 5FLMG 2LSSA 1PH8A 2A1AA 1L1OA 2WAQE 5FJ8H 3HOXH 1O7IA 4NXNL 5M5YH 2GVBA 4A3BG 5C44H 1HR0W 3H3VH 4HJ7A 1WYDA 5IYDG 2UU9L 3PO3G 2JA8H 1RIPA 3JC66 4R1JA 3FKIG 4JOIC 2IX1A 2VUMG 2HIXA 3PO2G 2KHJA 4OONA 5ELOA 4DR3L 1JMCA 1PH4A 2AWNA 2RF4A 1VQ8A 2QA4A 4MTNA 5J3BA 4GOPB 4NXNQ 3WWVA 2Z0SA 4YHHL 4DV5L 4A3JG 1XJVA 4DV7Q 2NVQH 4A3LH 1QVCA 1PFSA 2VS1A 4DAYB 3J7A5 5M3MG 2FXQA 2VQFL 1BVSA 1NJIC 1XNQL 4K0KL 3HKZE 1C7YA 2LXJA 1VQLA 2B3GA 4A3FH 1YZ6A 4B3ML 4A3GH 3J80i 1RL2A 3HOUH 4YWLA 3I55A 4BBRG 1YJ9A 1Q81C 4GNXC 4JOIA 4X6AH 1VQDA 4B3TL 1SN8A 1YBYA 4GLAC 3U4VA 4X62Q 4HIKA 3BZCA 4BBSG 5HGQA 1QZHA 2R7ZG 4HJ9A 1JJGA 2WP8J 4R4QA 4L5TA 4A3DG 1M1KC 4BY1H 3M4QA 1UE1A 1HNZL 4GN3B 4B3MQ 1V43A 1Q8KA 4DR2L 2ES2A 3MXNB 4B3RL 1VQPA 1I94L 4XIGS 2VW9A 4DK3C 4B3TQ 2PQAB 2RCNA 4EQ5A 3UDXA 2ASBA 1DGSA 1XNRL 1WOCA 4GNXA 3UE0A 4PZ8A 1BKBA 3J80c 3TS0A 1E1OA 1D7QA 1Y14B 3F2DA 1IBKQ 3DM3A 4HIDA 1XPRA 2XGTA 1EOVA 4IJLA 4DR2Q 1Q82C 2ZJRA 2JA9A 1I94Q 1H95A 4A3MG 2MNAA 2VY3A 4R4OA 3RNUA 2UUAQ 3J81j 2JEBI 4YY3Q 3AQQA 1QZGA 4AYBG 1XNRQ 4Y52H 4ME3A 2YYZA 4PMWA 3S24A 3S17H 2C35B 1UE7A 4IOCA 3HOYH 3I7FA 3PSIA 5FLMH 3RN2A 3TREA 1BBWA 3M85A 2OTLA 1E7ZA 4XTCS 2KCMA 1JB7A 4JI7L 5M5XH 2HT1A 3CXCA 3M3YH 4A3BH 3U50C 5GQOA 1PH2A 3ULLA 4AQYL 2RHQB 2VQEQ 2Z6KC 1UE5A 2CCZA 5IYDH 4DV4Q 1K73C 3PO3H 1Q7YC 1LUZA 1PHJA 4IFDJ 1WJJA 3FKIH 4DV3L 2PI2E 2WAQG 3PO2H 3PV0A 4KI0A 1K83H 5BR8L 3OTOL 1Q1BA 3I4MG 4LF7Q 3RLOA 3A5ZB 4HIOA 4JI2L 4L5SA 4QGUA 4A3JH 5IP7H 3D31A 4IFDI 1ASYA 1X56A 2ZJQA 2MO1A 4X64Q 5M3MH 4DR6L 4GKJL 5ELNA 3IRBA 1UEBA 4JI0L 1PH6A 3HFZB 1QVFA 2Z6KA 3S1QH 2V1CC 4JI5Q 1A8VA 2R92G 1EYGA 4DR4L 4BBRH 1HR0Q 4DR1Q 1N8RC 5IWAQ 4JV5L 3FP9A 5BR8Q 3CF5A 3CCVA 5C4JH 3Q8DA 3KJPA 5LMNQ 1PH1A 4AH6A 3GTOH 4BBSH 2R7ZH 4QL5A 2JA7H 2IY5B 4O0AA 1QUQA 1VQBA 4DR6Q 1MKHA 4YCWA 3KJOA 1X3EA 4YWKA 3TQYA 2CWPA 4RG1A 1MJEA 4JI4L 2E2IH 4A3DH 4OWXB 3LGJA 3ULJA 2AHOB 1CSQA 3I4OA 1W3SA 4A3CG 5JEAJ 1XPOA 1HZCA 2WB1E 4P73A 4DUZQ 2F3IA 1UE6A 4X66Q 1OXUA 2IHEA 2MO0A 3W1BA 3CC2A 1VQAA 1G291 3KOJA 4O2DA 1KAWA 3K8AA 4JI8L 3G71A 1IBLQ 1MIUA 3KF8B 3RLFA 1EQQA 4JI4Q 2UXDQ 1IZ6A 3PF5A 1VQ6A 3H3VI 3VDYA 2E2HH 4GLVB 4GLXA 2N78A 2ZM6Q 4P75A 4A3MH 4IO9A 1TWGH 1ASZA 1LYLA 3F1ZA 4A93G 3HOZG 1E3PA 3G48A 4X65L 2K5NA 3RN5A 2HIVA 2JQOA 2CKZB 3MEFA 4LUZA 3HOWG 3UDFA 4WJ4A 2D0OA 1A0IA 3K0XA 4JI3Q 4JYAL 1OXTA 2K52A 4LF6L 3KDFB 2UUCL 1X6OA 1B7YB 3CCSA 3CMAA 1L1OB 1S3OA 2ZTDA 2JK8A 3PUWA 4OWTB 4IOAA 4DUYL 1VQMA 1SLJA 1MJCA 1XMQL 1YHBA 4DV2L 3NBHB 3I4MH 4BXXH 2UU9Q 2YU9H 4GOPA 4JI6L 3ICEA 2N3SA 3S2HH 1KIXA 4YCUA 2BA0A 3RR5A 1P16A 5C4XG 2K75A 1I6HH 4IPDA 4DR3Q 2B63G 1VQCA 1WCMG 2UUCQ 1YEZA 3CCMA 1Y1WG 3G4SA 5M3FG 1NBWA 2VZAA 2A8VA 1G51A 3BZKA 1VQNA 3NELA 4YHHQ 4DV5Q 2D0PA 1U5KA 2R92H 1JE5A 1FGUA 4DUYQ 1W2BA 2K5VA 3PUXA 1VQHA 3NENA 2VQFQ 4DV2Q 4BA2I 1PH5A 1XNQQ 4K0KQ 4H02A 4JI6Q 1B70B 3RZOH 3TRZA 3TS2A 2BH8A 2PNHA 5IYBG 2KENA 1YVCA 3A74A 5FLXc 1N34L 3GTKH 1PYSB 2OTJA 2QGQA 3KLWA 4JC0A 5JJIA 1M90C 1SR3A 1I50H 1VQEA 1SROA 1KRTA 1YI2A 3STBD 3T1YL 4IFDG 4A3CH 3K80C 1YJNA 3AEVA 5C0XJ 4APVA 1V1QA 2YV5A 1HNZQ 2VNUD 4WJ3M 4B3RQ 2F52A 2KCTA 4P71A 3L0OA 1CKNA 3E9HA 3KF6A 1X55A 2L15A 2WB1G 4LF8L 1A62A 4LUVA 1EIFA 4PG3A 4GNXB 1X3GA 1SFOH 4NB3A 5C0XI 3PF4A 3CW2C 3B6YA 5JJKA 3UDIA 2NZOA 1YHAA 2Y0SG 1VQOA 2K50A 4R4IA 4UP7A 1YITA 4A93H 3HOZH 3K7AH 1EIYB 4GS3A 2DUDA 1VQGA 1GM5A 3HOWH 5JJLA 5H1SE 3CD6A 4QJFA 1SE8A 3GTMH 2GN5A 5E7NA 4IPGA 1FVIA 2DGYA 5IYCG 3S2DH 3ER0A 4OWWB 2VUMH 4DR5L 3E0EA 2IHFA 4ALPA 4DV0L 3CPWA 1AH9A 3JAMi 4C3HH 5IY0A 4LWCA 1OXSC 3CC7A 1C0AA 1HZ9A 4JI7Q 4GN5A 3FHWA 4AQYQ 4KLKA 2UUBL 4LF9L 2GVAA 4C3JH 5GAEC 3W1GA 5IE8A 4B3SL 3J7ZC 3RLNA 1KHIA 5C4XH 2R93G 3PIPA 4DV3Q 4DR5Q 2Q2UA 4KHPL 2MFIA 1WCMH 4PZ7A 2B63H 1YJWA 3OTOQ 1CUKA 1Y1WH 3S1RH 1P8LA 2I5HA 4JI2Q 4LF5L 3UDGA 5IP9G 2YTYA 4DR7L 2K14A 3HKZG 4LFBL 3EBEA 3A0JA 4JBJA 3S14H 4BA1I 4GKJQ 4LF9Q 4NXML 3U58A 1XPUA 4LNQA 1TWAH 3JAMc 1EQRA 1KRSA 3AYHB 4MNOA 4JI0Q 3I4NG 3NEMA 1J5EL 3CPFA 4LFAL 5IYBH 4POFA 1X9NA 1PA6A 3HOVG 3L7ZC 1OXVA 1VS0A 4DR4Q 4JV5Q 1I3QH 1TWCH 4LF5Q 3GTPH 2UXBL 2AKWB 1HJPA 4MZ9A 4A3KG 3UE1A 5GROA 3M4PA 2BH2A 1SRUA 2H5XA 4DV6L 1U0LA 4A76A 4LFCL 1HZBA 2YTXA 1K8GA 3M4OH 2HHHL 3H0GG 1XMOL 4DAMA 2BA1A 2ZTCA 4QQBX 1N9WA 1KD1C 4FDBA 3CCUA 4LF4L 4IPHA 4C3IH 4DNIA 2UXBQ 1B8AA 3ERSX 3F8TA 4GOPC 3CCLA 1FL0A 4JI8Q 4JI1L 4OO1I 4AYBE 1GD7A 5C3EG 2ALYB 2EXDA 2MQHA 3CMEA 2EIFA 1N32L 4DV6Q 1X54A 1X65A 4LFCQ 2HHHQ 1XMOQ 4AIMA 1C9OA 2B29A 3BJUA 1KXLA 5IT9c 1IYJB 1KQSA 4UP9A 1NTGA 2OQKA 3K7UC 3PUZA 4X65Q 3CC4A 3KDFA 3S1MH 4DKAC 4LW1A 1OXXK 4JI1Q 1IL2A 3SGIA 2AMCB 1N32Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N49 A;  5GAG C;  4PZ6 A;  4QIW E;  1K0R A;  4DV7 L;  5AJ3 L;  4LF6 Q;  2QEX A;  1KL9 A;  1YHQ A;  2KBN A;  5C0X G;  2E2J H;  3H15 A;  4BY7 G;  1A63 A;  1NY4 A;  4Y7N H;  5LMN W;  4IJH A;  1HH2 P;  2R93 H;  4HJ8 A;  2K4K A;  4GN4 B;  1T9H A;  1JT8 A;  5K36 G;  1NMF A;  1L0W A;  4HIM A;  3CCE A;  3OW2 A;  4X62 L;  1XMQ Q;  2E5L L;  1SMX A;  2ID0 A;  3GTQ H;  1I5F A;  3S15 H;  5IP7 G;  3STB C;  1VQF A;  3W5O A;  5IP9 H;  5AJ3 Q;  1PH7 A;  3GTL H;  1VQK A;  2ATW A;  1G6P A;  2NVT H;  4NPS A;  4JCV E;  2I0Q A;  4HJ5 A;  4P72 A;  3M9B A;  2OQ0 A;  1VQ9 A;  2ZJP A;  1EWI A;  2WFW A;  3I4N H;  3RZD H;  1V9P A;  2JA5 G;  4L5R C;  3HOV H;  2OCE A;  2PQA A;  2OWO A;  4A3I G;  2E5L Q;  1L2F A;  2JA7 G;  1PVO A;  1YIJ A;  2JJQ A;  2NN6 I;  3A5U A;  4A4I A;  4JG2 A;  4IPC A;  1UWV A;  3U4Z A;  2I5L X;  2IT1 A;  4A3E G;  4A3K H;  1K9M C;  1AE2 A;  2AWO A;  3EIV A;  3TEH B;  1IBK L;  1CSP A;  2CFM A;  4P74 A;  1N34 Q;  2LXK A;  2JA6 G;  1Q12 A;  3I2Z A;  1JJC B;  3ULP A;  5DLQ E;  3H0G H;  1Q86 C;  1KC8 C;  1TWF H;  3PUV A;  3T1Y Q;  1CKO A;  2UUA L;  4YY3 L;  2JEA I;  5LMU L;  3J81 i;  2PMZ E;  4YCV A;  2R7D A;  1Z9F A;  2VL6 A;  3CCJ A;  1VQ7 A;  1PH9 A;  1WI5 A;  1Y1V G;  3G6E A;  3E9I A;  1LM0 A;  1CKN B;  1NMG A;  1YNX A;  5C3E H;  2K5H A;  1IXR A;  3KF6 B;  1R9T H;  1S40 A;  4JBM A;  4LF8 Q;  4OX9 L;  1E22 A;  2KHI A;  3K81 C;  1VCI A;  3KFU A;  2VQE L;  3T1H L;  1N36 L;  3GTJ H;  4DV4 L;  1Z47 A;  5FJ8 G;  3HOX G;  1S72 A;  4JBW A;  4JBK A;  5LMU Q;  5JEA G;  1EFW A;  1XTD A;  1HZA A;  4R4T A;  4C2M H;  1OTC A;  5C44 G;  4UY8 C;  2F4V L;  3S16 H;  4L5Q A;  1HNW L;  5M5W H;  4JYA Q;  4LF7 L;  2JA8 G;  3AFP A;  1VQ5 A;  2I5M X;  1J6Q A;  4OX9 Q;  3J81 c;  1D8L A;  3PGZ A;  4X64 L;  4LUO A;  2ZTE A;  2IX0 A;  3T1H Q;  4DK6 C;  1VQJ A;  4DV0 Q;  1N36 Q;  1FJG L;  4BY7 H;  4OO1 G;  4DPG A;  3CAM A;  5M3F H;  1K8A C;  1K3R A;  3EN2 A;  3PIO A;  3F2B A;  3M7N A;  4A3L G;  4JI5 L;  2NZH A;  3OYY A;  4TVA B;  2F4V Q;  1HNW Q;  1HR0 L;  4R4C A;  4DR1 L;  2Q2H A;  5IWA L;  4BXX G;  1EUJ A;  4QY7 A;  2UUB Q;  1Q1E A;  5HY6 A;  2UXC L;  4A3G G;  1N33 L;  3D0F A;  1GKH A;  3HKS A;  5LMN L;  4HJA A;  4A3F G;  1NE3 A;  3L2P A;  3GDE A;  4B3S Q;  2CWA A;  4GKK L;  4EX5 A;  3S1N H;  3HOU G;  5GAH C;  1CKM A;  4KHP Q;  1FJG Q;  5GAD C;  3GO5 A;  4DV1 L;  4UP8 A;  2YTV A;  1VQ4 A;  1PV4 A;  3GD7 A;  3KYH C;  4DR7 Q;  2HQL A;  1BBU A;  1QUQ B;  4DUZ L;  4LFB Q;  2JA5 H;  2RHS B;  2NVY H;  4BY1 G;  2R6G A;  2CQO A;  4X66 L;  4KHZ A;  4NXM Q;  2UXC Q;  1GVP A;  1N33 Q;  4A3I H;  4A75 A;  4GKK Q;  1AE3 A;  4J15 A;  1IBM L;  4TQU S;  4POG A;  1HNX L;  1J5E Q;  4A3E H;  3ZJY C;  2XTI A;  2EQS A;  5EAY A;  1IBL L;  2E8G A;  4LFA Q;  2A19 A;  3DLL A;  1QVG A;  2Q2T A;  2UXD L;  4DV1 Q;  1WFQ A;  3BU2 A;  3CCQ A;  2JA6 H;  4OXP A;  2Q2I A;  4UPA A;  1L1O C;  1Q46 A;  3F2C A;  3CCR A;  3I56 A;  2ZM6 L;  3CP0 A;  2N8N A;  3PCO B;  2JE6 I;  1X3F A;  1VQI A;  2NVX H;  2R7F A;  3AFQ A;  1IBM Q;  1HNX Q;  2Y0S E;  3GTG H;  1Y1V H;  4RMF A;  1JJ2 A;  2D62 A;  1TWH H;  4JI3 L;  1E24 A;  2PI2 A;  3CQZ H;  4LF4 Q;  5IYC H;  1LTL A;  1TXY A;  1E1T A;  1PYB A;  1PH3 A;  2NN6 G;  3PUY A;  3HOY G;  4YWM A;  1GO3 E;  5FLM G;  2LSS A;  1PH8 A;  2A1A A;  1L1O A;  2WAQ E;  5FJ8 H;  3HOX H;  1O7I A;  4NXN L;  5M5Y H;  2GVB A;  4A3B G;  5C44 H;  1HR0 W;  3H3V H;  4HJ7 A;  1WYD A;  5IYD G;  2UU9 L;  3PO3 G;  2JA8 H;  1RIP A;  3JC6 6;  4R1J A;  3FKI G;  4JOI C;  2IX1 A;  2VUM G;  2HIX A;  3PO2 G;  2KHJ A;  4OON A;  5ELO A;  4DR3 L;  1JMC A;  1PH4 A;  2AWN A;  2RF4 A;  1VQ8 A;  2QA4 A;  4MTN A;  5J3B A;  4GOP B;  4NXN Q;  3WWV A;  2Z0S A;  4YHH L;  4DV5 L;  4A3J G;  1XJV A;  4DV7 Q;  2NVQ H;  4A3L H;  1QVC A;  1PFS A;  2VS1 A;  4DAY B;  3J7A 5;  5M3M G;  2FXQ A;  2VQF L;  1BVS A;  1NJI C;  1XNQ L;  4K0K L;  3HKZ E;  1C7Y A;  2LXJ A;  1VQL A;  2B3G A;  4A3F H;  1YZ6 A;  4B3M L;  4A3G H;  3J80 i;  1RL2 A;  3HOU H;  4YWL A;  3I55 A;  4BBR G;  1YJ9 A;  1Q81 C;  4GNX C;  4JOI A;  4X6A H;  1VQD A;  4B3T L;  1SN8 A;  1YBY A;  4GLA C;  3U4V A;  4X62 Q;  4HIK A;  3BZC A;  4BBS G;  5HGQ A;  1QZH A;  2R7Z G;  4HJ9 A;  1JJG A;  2WP8 J;  4R4Q A;  4L5T A;  4A3D G;  1M1K C;  4BY1 H;  3M4Q A;  1UE1 A;  1HNZ L;  4GN3 B;  4B3M Q;  1V43 A;  1Q8K A;  4DR2 L;  2ES2 A;  3MXN B;  4B3R L;  1VQP A;  1I94 L;  4XIG S;  2VW9 A;  4DK3 C;  4B3T Q;  2PQA B;  2RCN A;  4EQ5 A;  3UDX A;  2ASB A;  1DGS A;  1XNR L;  1WOC A;  4GNX A;  3UE0 A;  4PZ8 A;  1BKB A;  3J80 c;  3TS0 A;  1E1O A;  1D7Q A;  1Y14 B;  3F2D A;  1IBK Q;  3DM3 A;  4HID A;  1XPR A;  2XGT A;  1EOV A;  4IJL A;  4DR2 Q;  1Q82 C;  2ZJR A;  2JA9 A;  1I94 Q;  1H95 A;  4A3M G;  2MNA A;  2VY3 A;  4R4O A;  3RNU A;  2UUA Q;  3J81 j;  2JEB I;  4YY3 Q;  3AQQ A;  1QZG A;  4AYB G;  1XNR Q;  4Y52 H;  4ME3 A;  2YYZ A;  4PMW A;  3S24 A;  3S17 H;  2C35 B;  1UE7 A;  4IOC A;  3HOY H;  3I7F A;  3PSI A;  5FLM H;  3RN2 A;  3TRE A;  1BBW A;  3M85 A;  2OTL A;  1E7Z A;  4XTC S;  2KCM A;  1JB7 A;  4JI7 L;  5M5X H;  2HT1 A;  3CXC A;  3M3Y H;  4A3B H;  3U50 C;  5GQO A;  1PH2 A;  3ULL A;  4AQY L;  2RHQ B;  2VQE Q;  2Z6K C;  1UE5 A;  2CCZ A;  5IYD H;  4DV4 Q;  1K73 C;  3PO3 H;  1Q7Y C;  1LUZ A;  1PHJ A;  4IFD J;  1WJJ A;  3FKI H;  4DV3 L;  2PI2 E;  2WAQ G;  3PO2 H;  3PV0 A;  4KI0 A;  1K83 H;  5BR8 L;  3OTO L;  1Q1B A;  3I4M G;  4LF7 Q;  3RLO A;  3A5Z B;  4HIO A;  4JI2 L;  4L5S A;  4QGU A;  4A3J H;  5IP7 H;  3D31 A;  4IFD I;  1ASY A;  1X56 A;  2ZJQ A;  2MO1 A;  4X64 Q;  5M3M H;  4DR6 L;  4GKJ L;  5ELN A;  3IRB A;  1UEB A;  4JI0 L;  1PH6 A;  3HFZ B;  1QVF A;  2Z6K A;  3S1Q H;  2V1C C;  4JI5 Q;  1A8V A;  2R92 G;  1EYG A;  4DR4 L;  4BBR H;  1HR0 Q;  4DR1 Q;  1N8R C;  5IWA Q;  4JV5 L;  3FP9 A;  5BR8 Q;  3CF5 A;  3CCV A;  5C4J H;  3Q8D A;  3KJP A;  5LMN Q;  1PH1 A;  4AH6 A;  3GTO H;  4BBS H;  2R7Z H;  4QL5 A;  2JA7 H;  2IY5 B;  4O0A A;  1QUQ A;  1VQB A;  4DR6 Q;  1MKH A;  4YCW A;  3KJO A;  1X3E A;  4YWK A;  3TQY A;  2CWP A;  4RG1 A;  1MJE A;  4JI4 L;  2E2I H;  4A3D H;  4OWX B;  3LGJ A;  3ULJ A;  2AHO B;  1CSQ A;  3I4O A;  1W3S A;  4A3C G;  5JEA J;  1XPO A;  1HZC A;  2WB1 E;  4P73 A;  4DUZ Q;  2F3I A;  1UE6 A;  4X66 Q;  1OXU A;  2IHE A;  2MO0 A;  3W1B A;  3CC2 A;  1VQA A;  1G29 1;  3KOJ A;  4O2D A;  1KAW A;  3K8A A;  4JI8 L;  3G71 A;  1IBL Q;  1MIU A;  3KF8 B;  3RLF A;  1EQQ A;  4JI4 Q;  2UXD Q;  1IZ6 A;  3PF5 A;  1VQ6 A;  3H3V I;  3VDY A;  2E2H H;  4GLV B;  4GLX A;  2N78 A;  2ZM6 Q;  4P75 A;  4A3M H;  4IO9 A;  1TWG H;  1ASZ A;  1LYL A;  3F1Z A;  4A93 G;  3HOZ G;  1E3P A;  3G48 A;  4X65 L;  2K5N A;  3RN5 A;  2HIV A;  2JQO A;  2CKZ B;  3MEF A;  4LUZ A;  3HOW G;  3UDF A;  4WJ4 A;  2D0O A;  1A0I A;  3K0X A;  4JI3 Q;  4JYA L;  1OXT A;  2K52 A;  4LF6 L;  3KDF B;  2UUC L;  1X6O A;  1B7Y B;  3CCS A;  3CMA A;  1L1O B;  1S3O A;  2ZTD A;  2JK8 A;  3PUW A;  4OWT B;  4IOA A;  4DUY L;  1VQM A;  1SLJ A;  1MJC A;  1XMQ L;  1YHB A;  4DV2 L;  3NBH B;  3I4M H;  4BXX H;  2UU9 Q;  2YU9 H;  4GOP A;  4JI6 L;  3ICE A;  2N3S A;  3S2H H;  1KIX A;  4YCU A;  2BA0 A;  3RR5 A;  1P16 A;  5C4X G;  2K75 A;  1I6H H;  4IPD A;  4DR3 Q;  2B63 G;  1VQC A;  1WCM G;  2UUC Q;  1YEZ A;  3CCM A;  1Y1W G;  3G4S A;  5M3F G;  1NBW A;  2VZA A;  2A8V A;  1G51 A;  3BZK A;  1VQN A;  3NEL A;  4YHH Q;  4DV5 Q;  2D0P A;  1U5K A;  2R92 H;  1JE5 A;  1FGU A;  4DUY Q;  1W2B A;  2K5V A;  3PUX A;  1VQH A;  3NEN A;  2VQF Q;  4DV2 Q;  4BA2 I;  1PH5 A;  1XNQ Q;  4K0K Q;  4H02 A;  4JI6 Q;  1B70 B;  3RZO H;  3TRZ A;  3TS2 A;  2BH8 A;  2PNH A;  5IYB G;  2KEN A;  1YVC A;  3A74 A;  5FLX c;  1N34 L;  3GTK H;  1PYS B;  2OTJ A;  2QGQ A;  3KLW A;  4JC0 A;  5JJI A;  1M90 C;  1SR3 A;  1I50 H;  1VQE A;  1SRO A;  1KRT A;  1YI2 A;  3STB D;  3T1Y L;  4IFD G;  4A3C H;  3K80 C;  1YJN A;  3AEV A;  5C0X J;  4APV A;  1V1Q A;  2YV5 A;  1HNZ Q;  2VNU D;  4WJ3 M;  4B3R Q;  2F52 A;  2KCT A;  4P71 A;  3L0O A;  1CKN A;  3E9H A;  3KF6 A;  1X55 A;  2L15 A;  2WB1 G;  4LF8 L;  1A62 A;  4LUV A;  1EIF A;  4PG3 A;  4GNX B;  1X3G A;  1SFO H;  4NB3 A;  5C0X I;  3PF4 A;  3CW2 C;  3B6Y A;  5JJK A;  3UDI A;  2NZO A;  1YHA A;  2Y0S G;  1VQO A;  2K50 A;  4R4I A;  4UP7 A;  1YIT A;  4A93 H;  3HOZ H;  3K7A H;  1EIY B;  4GS3 A;  2DUD A;  1VQG A;  1GM5 A;  3HOW H;  5JJL A;  5H1S E;  3CD6 A;  4QJF A;  1SE8 A;  3GTM H;  2GN5 A;  5E7N A;  4IPG A;  1FVI A;  2DGY A;  5IYC G;  3S2D H;  3ER0 A;  4OWW B;  2VUM H;  4DR5 L;  3E0E A;  2IHF A;  4ALP A;  4DV0 L;  3CPW A;  1AH9 A;  3JAM i;  4C3H H;  5IY0 A;  4LWC A;  1OXS C;  3CC7 A;  1C0A A;  1HZ9 A;  4JI7 Q;  4GN5 A;  3FHW A;  4AQY Q;  4KLK A;  2UUB L;  4LF9 L;  2GVA A;  4C3J H;  5GAE C;  3W1G A;  5IE8 A;  4B3S L;  3J7Z C;  3RLN A;  1KHI A;  5C4X H;  2R93 G;  3PIP A;  4DV3 Q;  4DR5 Q;  2Q2U A;  4KHP L;  2MFI A;  1WCM H;  4PZ7 A;  2B63 H;  1YJW A;  3OTO Q;  1CUK A;  1Y1W H;  3S1R H;  1P8L A;  2I5H A;  4JI2 Q;  4LF5 L;  3UDG A;  5IP9 G;  2YTY A;  4DR7 L;  2K14 A;  3HKZ G;  4LFB L;  3EBE A;  3A0J A;  4JBJ A;  3S14 H;  4BA1 I;  4GKJ Q;  4LF9 Q;  4NXM L;  3U58 A;  1XPU A;  4LNQ A;  1TWA H;  3JAM c;  1EQR A;  1KRS A;  3AYH B;  4MNO A;  4JI0 Q;  3I4N G;  3NEM A;  1J5E L;  3CPF A;  4LFA L;  5IYB H;  4POF A;  1X9N A;  1PA6 A;  3HOV G;  3L7Z C;  1OXV A;  1VS0 A;  4DR4 Q;  4JV5 Q;  1I3Q H;  1TWC H;  4LF5 Q;  3GTP H;  2UXB L;  2AKW B;  1HJP A;  4MZ9 A;  4A3K G;  3UE1 A;  5GRO A;  3M4P A;  2BH2 A;  1SRU A;  2H5X A;  4DV6 L;  1U0L A;  4A76 A;  4LFC L;  1HZB A;  2YTX A;  1K8G A;  3M4O H;  2HHH L;  3H0G G;  1XMO L;  4DAM A;  2BA1 A;  2ZTC A;  4QQB X;  1N9W A;  1KD1 C;  4FDB A;  3CCU A;  4LF4 L;  4IPH A;  4C3I H;  4DNI A;  2UXB Q;  1B8A A;  3ERS X;  3F8T A;  4GOP C;  3CCL A;  1FL0 A;  4JI8 Q;  4JI1 L;  4OO1 I;  4AYB E;  1GD7 A;  5C3E G;  2ALY B;  2EXD A;  2MQH A;  3CME A;  2EIF A;  1N32 L;  4DV6 Q;  1X54 A;  1X65 A;  4LFC Q;  2HHH Q;  1XMO Q;  4AIM A;  1C9O A;  2B29 A;  3BJU A;  1KXL A;  5IT9 c;  1IYJ B;  1KQS A;  4UP9 A;  1NTG A;  2OQK A;  3K7U C;  3PUZ A;  4X65 Q;  3CC4 A;  3KDF A;  3S1M H;  4DKA C;  4LW1 A;  1OXX K;  4JI1 Q;  1IL2 A;  3SGI A;  2AMC B;  1N32 Q; 
#chains in the Genus database with same CATH topology
 2N49 A;  2A69 C;  1K0R A;  1EEI D;  4LF6 Q;  5CYU A;  5C0X G;  4BBR B;  1NY4 A;  2I46 A;  1CT1 D;  4IJH A;  1HH2 P;  4DAP A;  4A3I B;  2JA7 B;  4GN4 B;  3NBI A;  2EZV A;  1T9H A;  4A3E B;  5ELF A;  4F7X A;  4X62 L;  1SMX A;  1F9P A;  5CBE E;  3GTQ H;  2E2I B;  2JA6 B;  4KD3 A;  3S15 H;  1VQF A;  3W5O A;  5IP9 H;  4QUF A;  3FEW X;  2I0Q A;  1D2B A;  2OQ0 A;  5CV6 A;  2ZJP A;  2WFW A;  1LV9 A;  2OCE A;  4HMJ A;  3VR4 A;  1L2F A;  2NN6 I;  4A4I A;  4JG2 A;  4A3K H;  2I5L X;  2IT1 A;  1AZP A;  2AWO A;  3EIV A;  3NXW A;  1DM0 B;  3H0G H;  5C44 B;  1TWF H;  1NR2 A;  2RSN A;  4YY3 L;  2JEA I;  1STY A;  5LMU L;  5JVG 3;  1VQ7 A;  1MSH A;  1Z9F A;  2VL6 A;  2XIW A;  1MI2 A;  1Y1V G;  3G6E A;  2Q8I B;  3E9I A;  1LM0 A;  2EYJ A;  1YNX A;  4UAI A;  2AUK A;  5FOB B;  3MC0 B;  1TY0 A;  1PTO H;  2B8F A;  2NVQ B;  1VCI A;  4ZUJ A;  2VQE L;  1NR4 A;  1EY7 A;  1Z47 A;  3HOX G;  3S2H B;  5CR3 A;  5LMU Q;  4NP5 A;  4A3F B;  3DMU A;  4C2M H;  2P5Z X;  2F4V L;  2DJG C;  4LF7 L;  1ET6 A;  3TZU A;  1VQ5 A;  4XQJ A;  1PFB A;  2XWJ B;  4RA8 A;  4FNF A;  1FJG L;  4DK6 C;  4BY7 H;  4DV0 Q;  4DXG A;  1K3R A;  2IPK D;  3EN2 A;  2NBF A;  4CDE C;  4A3L G;  4TVA B;  2F4V Q;  1EU3 A;  1SNC A;  4QB4 A;  1HR0 L;  4A3G G;  2CWA A;  2F0K A;  4EX5 A;  3HOU G;  2NTS A;  3MXU A;  2H1E A;  1FJG Q;  1B50 A;  4UP8 A;  1PV4 A;  4MN3 A;  1K0S A;  4DR7 Q;  2HQL A;  1BBU A;  1EYA A;  2BE5 C;  1UAP A;  1H9J A;  2NVY H;  2RHS B;  3I4L A;  1F9S A;  4KHZ A;  4BY1 G;  3R3O A;  1GVP A;  4U67 3;  2RQX A;  4L6T B;  1AE3 A;  4J15 A;  1IBM L;  4POG A;  1XWE A;  1SYC A;  3ZJY C;  2BCO A;  1IBL L;  4LFA Q;  2UXD L;  2PCF B;  1WFQ A;  3BU2 A;  3CCQ A;  4OXP A;  2Q2I A;  1BQQ T;  3F2C A;  3CP0 A;  2N8N A;  3OSO A;  2JE6 I;  3HGB A;  1LLR D;  2R7F A;  1IBM Q;  3FKI B;  3GTG H;  4RMF A;  3QOL A;  2D62 A;  1TWH H;  5EPK A;  3EQL C;  1E24 A;  2PI2 A;  4FXK C;  1LTL A;  2K05 A;  1R4Q B;  1TXY A;  1E1T A;  1PYB A;  3I8Z A;  2NN6 G;  3PUY A;  1BCP F;  4YWM A;  1ROD A;  1GO3 E;  1EEF D;  5M3M B;  2QKI C;  1O7I A;  1BBX C;  5M5Y H;  2CHB D;  5COY A;  2B2U C;  2EYF A;  4HJ7 A;  1TQO A;  5AFW A;  3X3N A;  2JA8 H;  2EJM A;  4JOI C;  2VUM G;  3PIP 3;  5LHY 1;  2KHJ A;  4MTK A;  1JMC A;  1PH4 A;  2CQA A;  2QA4 A;  1CTM A;  4OO1 H;  2E74 C;  5FO9 B;  3PIO 3;  2NB0 A;  4DV5 L;  2X6G A;  4DAY B;  4K0K L;  1STE A;  3HKZ E;  1U4P A;  4HCE A;  1C7Y A;  2B3G A;  1YZ6 A;  4FF1 A;  2F0Q A;  4IUV A;  3KK7 A;  2CW0 C;  2R3Z A;  1A3V A;  1K28 A;  4BBR G;  1YJ9 A;  4X6A H;  4M1U B;  5JVH 3;  1Y69 U;  2E2H B;  3KUP A;  4L5T A;  4A3D G;  3M4Q A;  4A3M B;  5D3D A;  1QCB D;  5IIF A;  3S9W A;  1BNZ A;  4AYB B;  3MXN B;  5ELE A;  4B3R L;  4RGT A;  1I94 L;  3C1E A;  1PRT F;  1L0X B;  4DK3 C;  5C3W A;  2A6H D;  1YNN D;  2ASB A;  2Z8L A;  4GNX A;  3UE0 A;  2F0T A;  3J80 c;  1E1O A;  1Y14 B;  3BVM A;  1XPR A;  5EJW A;  2XGT A;  4IJL A;  1SE4 A;  4V0B A;  1VDZ A;  2ZJR A;  1TT2 A;  1I94 Q;  5D14 A;  3FVQ A;  2EY2 A;  1EY5 A;  3J81 j;  2JEB I;  3I4M B;  2KVM A;  4ME3 A;  4PMW A;  1UE7 A;  1MBY A;  3HOY H;  3I7F A;  3PSI A;  5FLM H;  4ZYS A;  1ZYR D;  4JI7 L;  4LJZ C;  3N6R A;  1PDQ A;  5M5X H;  3M3Y H;  2KUM A;  3A7A B;  5GQO A;  1PH2 A;  4AQY L;  1FNW A;  1EQV A;  3DHQ A;  2Z1C A;  3PO3 H;  1CI3 M;  2A6E C;  3RZO B;  2XVS A;  3PV0 A;  1FR3 A;  1FNV A;  1GUT A;  3A5Z B;  1HQR D;  1SYE A;  3RLO A;  5FLX L;  3TDQ A;  1X3P A;  1EZ8 A;  3D31 A;  2Q8T A;  1ENA A;  1KTK A;  2MUY A;  2EE1 A;  1EY6 A;  2Z6K A;  3S1Q H;  1U4R A;  4J1M A;  3OMC A;  5C4J H;  1I4H A;  3Q8D A;  3KJP A;  1CA5 A;  1Z7T A;  2R7Z H;  2F0O A;  4O0A A;  1QUQ A;  1CHP D;  5IGC A;  1MKH A;  2ICI A;  3MTS A;  3K7A B;  4KHV A;  4MIU A;  3HOW B;  3D4W A;  3E5S A;  2F3I A;  1UE6 A;  5C4H A;  1OXU A;  2IHE A;  1VQA A;  3S2D B;  3I90 A;  4O2D A;  3TP5 A;  2SOB A;  4Z9C B;  3G71 A;  3KF8 B;  1BDO A;  2F4I A;  3RLF A;  1PYW D;  1EQQ A;  1GUW A;  4C3H B;  2NZ1 D;  3PF5 A;  1F9Q A;  2QF7 A;  2WAC A;  3ERQ A;  2A73 B;  4IO9 A;  1LYL A;  4A93 G;  2KCN A;  2K5N A;  3MEF A;  2JQO A;  2K5W A;  2ENB A;  2FFK B;  2FJ2 A;  2A74 C;  1WCM B;  2EY6 A;  3K0X A;  5I9P A;  2LY7 A;  4TSS A;  2F0D A;  4IUQ A;  1K3B C;  4FP5 D;  1X6O A;  3MA2 B;  1B7Y B;  5IOD A;  1YNJ C;  3CMA A;  2ZTD A;  4I65 A;  2JK8 A;  4OWT B;  4I7A A;  2K5Q A;  4CDF C;  2F03 A;  3AU7 A;  4DUY L;  4CJ1 B;  1VQM A;  4DV2 L;  2UU9 Q;  1P16 A;  1TWC B;  2K7V A;  4XXE A;  1PZI D;  3CRL C;  1YEZ A;  3BDC A;  3IFT A;  3CCM A;  3G4S A;  2J4X A;  5M3F G;  2VZA A;  2PZU A;  1STA A;  3BZK A;  1VQN A;  3NEL A;  1B3Q A;  2R92 H;  4DUY Q;  2E76 C;  5ELD A;  5FLX E;  4ZLT F;  4DV2 Q;  3T13 A;  1KAB A;  1SAP A;  4HAE A;  5IYB G;  3GTK H;  1N34 L;  4OIJ A;  3U9S A;  2OTJ A;  5JJI A;  1VQE A;  1KRT A;  1YI2 A;  3HRZ C;  3A8J E;  2K32 A;  3STB D;  3GTG B;  1YJN A;  4HSP A;  3AEV A;  3DWP A;  1V1Q A;  2VNU D;  2K1B A;  3OHX C;  2L15 A;  2WB1 G;  3W3A A;  4C3I G;  1SE3 A;  4L8J A;  3PF4 A;  3CW2 C;  2NN6 H;  2Y0S G;  2X6L A;  2R93 B;  2DUD A;  2DY7 A;  2FHT A;  3VYS A;  2VB2 X;  3H91 A;  4QJF A;  3GTM H;  1LT5 D;  1SSO A;  3IL8 A;  2VUM H;  3NPP A;  4ALP A;  5KND A;  3CPW A;  3TSS A;  2NVT B;  3JAM i;  2JN4 A;  4LWC A;  5IY0 A;  2RA4 A;  5HUR A;  2F0P A;  2N55 A;  3Q6S A;  1JOK A;  3I4N B;  2EXZ A;  4C3J H;  5GAE C;  1VMP A;  3RLN A;  4DV3 Q;  1PMR A;  2B63 H;  1EIG A;  1V1O A;  1ENC A;  2I5H A;  2EYL A;  3MFY A;  1IL8 A;  1GJX A;  1WTP A;  5IP9 G;  2YTY A;  1I6V C;  3S14 H;  4GKJ Q;  3U58 A;  1XPU A;  5C6A A;  3AYH B;  1W6J A;  2IX3 A;  3L7Z C;  5C3E B;  1R9T B;  2FIN B;  2SEB D;  3DUZ A;  4C56 C;  3GTP H;  2L55 A;  3BYY B;  2AKW B;  4A3K G;  2WV6 D;  2EY1 A;  3R93 A;  4FF3 A;  5GRO A;  1D6E C;  3M4P A;  3W2D A;  4DV6 L;  4ZKC B;  4A76 A;  1HZB A;  2YTX A;  2HHH L;  3H0G G;  1XMO L;  1ENF A;  4DAM A;  3NHH A;  2BA1 A;  3OWF A;  3GV3 A;  1FL0 A;  4OO1 I;  4JI1 L;  4AYB E;  1F2Z A;  1BOS A;  1RD9 D;  1KDB A;  2ALY B;  4DV6 Q;  1X54 A;  1KAA A;  2HHH Q;  1XMO Q;  1S5F D;  3DEO A;  1A15 A;  5G3L F;  1XYI A;  3T16 A;  2OQK A;  3A8K E;  5I4D A;  3CC4 A;  3KDF A;  1BCP C;  3C2P A;  1TKW B;  4JI1 Q;  1IL2 A;  1A2T A;  3UI2 A;  4PZ6 A;  5KYI A;  1IW7 C;  5AJ3 L;  4DAY A;  2KBN A;  2E2J H;  2G5D A;  4BY7 G;  1TY2 A;  1C4Q A;  1A63 A;  5LMN W;  1EWC A;  1DOK A;  4C1N I;  1PFM A;  4HJ8 A;  5FKA C;  1JT8 A;  4RH6 A;  1NMF A;  3OW2 A;  2E5L L;  1I5F A;  1E0B A;  5AJ3 Q;  3WDN A;  1PH7 A;  1LTR D;  2B8G A;  1VQK A;  2ATW A;  1G6P A;  3RUZ A;  4JCV E;  4HJ5 A;  2Z4I A;  3D4R A;  3MXN A;  3TME A;  2Q8R E;  3ITP A;  4IN3 A;  1Y1V B;  2GA4 B;  1O7L A;  2E5L Q;  1B3A A;  1PVO A;  2JJQ A;  4XYO A;  1UWV A;  3U4Z A;  2J7Z A;  2PYK A;  3TEH B;  2L12 A;  4P74 A;  2IW3 A;  3HOX B;  2MP1 A;  1PRT C;  5C5M A;  1WTX A;  1KC8 C;  1LTB D;  2O5J C;  3OPO A;  1CKO A;  2UUA L;  1V1P A;  4HTH A;  5J39 A;  5EKI A;  2PZT A;  3O13 A;  2RSO A;  1NMG A;  3I70 A;  5DNF A;  1S40 A;  2K5H A;  2JSO A;  4LF8 Q;  2KHI A;  3K81 C;  3KFU A;  1TII D;  3GTJ H;  4BS9 A;  1ESF A;  1S72 A;  4JBW A;  4JBK A;  1DYQ A;  4A3G B;  3A56 A;  4R4T A;  3KBX A;  1OTC A;  4RHR A;  3HOU B;  5M5W H;  2VB3 X;  2JA8 G;  3OW7 A;  1R4P B;  2I5M X;  4RCN A;  4LUO A;  1VQJ A;  4OO1 G;  1Y8O B;  1B2T A;  2O5I C;  4BY1 B;  2B2T A;  2HCI A;  3CAM A;  5M3F H;  2A68 D;  2KED A;  2K01 A;  4JI5 L;  3QJY A;  4R4C A;  4DR1 L;  2Q2H A;  5IWA L;  3TP6 A;  1SYD A;  4BXX G;  4QY7 A;  5K36 H;  4J8Q A;  1Q1E A;  1QIL A;  1N33 L;  3HKS A;  5LMN L;  4B3S Q;  3L2P A;  4KHP Q;  3GO5 A;  2YTV A;  1VQ4 A;  1PTO D;  1EYC A;  3GD7 A;  2WKC A;  3VA7 A;  2KOL A;  1QUQ B;  3L3O C;  2JA5 H;  5F2D A;  1KDC A;  3BDL A;  4NXM Q;  1B44 D;  1F2L A;  2F0S A;  1N33 Q;  2MJ8 A;  3V05 A;  4A75 A;  1HNX L;  4CDD C;  5EAY A;  1DD2 A;  1HRJ A;  2A19 A;  3H6M A;  1Q46 A;  3CCR A;  2EY5 A;  3J81 L;  3OIQ A;  2ZM6 L;  3PCO B;  1UNS A;  3K0Y A;  1VQI A;  3AFQ A;  4R9W A;  2VUM B;  4KJN A;  1HNX Q;  1JJ2 A;  1S5D D;  4JI3 L;  1LTG D;  1K83 B;  3CQZ H;  1BF4 A;  2KCC A;  2EYH A;  3HOY G;  1M8A A;  5FLM G;  2LSS A;  1PH8 A;  2C9O A;  2KEC A;  2WAQ E;  4NXN L;  2DJF C;  1A3U A;  1AZQ A;  4CKE A;  1HR0 W;  4NKL A;  3VYT A;  4FVM A;  5DM7 3;  1TVX A;  3PO3 G;  1GUG A;  1STH A;  5I2X A;  4R1J A;  4DR3 L;  1RF2 D;  5TSS A;  5CGK A;  4A3D B;  5J3B A;  3MXP A;  4NXN Q;  2Z0S A;  1XJV A;  1LTI D;  1QVC A;  1PFS A;  2KEE A;  1GHJ A;  2VS1 A;  1BVS A;  1XNQ L;  3NQI A;  3J7A F;  1Q8I A;  2LXJ A;  3J80 i;  3I55 A;  1IYV A;  4GNX C;  1YBY A;  4GLA C;  4RAU C;  4X62 Q;  4HIK A;  4K6L A;  3BZC A;  3D4D A;  5HGQ A;  3H3V C;  2R7Z G;  1DOM A;  5JPN C;  4HJ9 A;  2PNR C;  5EKL A;  3I3C A;  4EQN A;  4HMI A;  2PPB C;  4WOR A;  1M1K C;  5EPL A;  1HNZ L;  4GN3 B;  2ES2 A;  1VQP A;  1TS4 A;  3OIP A;  1Y8N B;  5COR A;  2VW9 A;  4KKT A;  3FRP B;  5J22 A;  2AQ1 B;  2SNM A;  3TS0 A;  2JYO A;  4X66 L;  3DM3 A;  3T4A C;  4LMQ D;  3C46 A;  1H95 A;  4QIW B;  1STG A;  4C1N K;  4R4O A;  4RKL A;  4YY3 Q;  2YU9 B;  3BS1 A;  4B9X A;  1G2S A;  1H9S A;  3S17 H;  4IOC A;  1I6H B;  3J81 E;  5D65 A;  1SXT A;  1UUP A;  3AB9 A;  1FD7 D;  3KBG A;  3TRE A;  3M85 A;  1E7Z A;  4A3B H;  3CXC A;  4ID6 A;  4FXD A;  2VQE Q;  2Z6K C;  1Q7Y C;  1LUZ A;  2RCF A;  3A54 A;  1WJJ A;  3H94 A;  4IFD J;  1D5X C;  2PI2 E;  3PO2 H;  4KMU C;  4P2C B;  3OTO L;  1Q1B A;  4LF7 Q;  4JI2 L;  4A3J H;  1I50 B;  4IFD I;  1X56 A;  4N9P A;  4JK1 C;  4F88 A;  3IRB A;  1UEB A;  5C4Z A;  1PH6 A;  1U4M A;  1QVF A;  2BDO A;  1ZKO A;  2R92 G;  4N8X 1;  1HR0 Q;  2RBM A;  3FP9 A;  3CF5 A;  4JV5 L;  3CCV A;  1NSN S;  4BBS H;  4AH6 A;  3GTO H;  2IY5 B;  1F9R A;  2B2W A;  4YCW A;  3KJO A;  2PMZ B;  4ABN A;  4RG1 A;  4OWX B;  4A93 B;  3VR6 A;  1PZJ D;  3TP8 A;  1MGS A;  4ME5 A;  1HZC A;  5JEA J;  4X66 Q;  2OXP A;  5IGF A;  1G29 1;  4V19 0;  5C5L A;  2EOT A;  1KAW A;  1SJE D;  4JI8 L;  2K03 A;  1IBL Q;  1JR0 D;  1MIU A;  4ZQ3 A;  2UXD Q;  1WTH A;  3VDY A;  1QJO A;  4GLV B;  4GLX A;  1S5C D;  3MHB A;  2NWG A;  2N78 A;  5M5W B;  4G4K A;  5IGG A;  1TWG H;  3F1Z A;  1E3P A;  4X65 L;  2ZXP A;  3TP7 A;  2C5C A;  2CVR A;  4RGN A;  1STB A;  1W6K A;  1A0I A;  5M3F B;  3S1R B;  2K52 A;  1BO0 A;  3KDF B;  2UUC L;  4OGQ C;  4KN7 C;  2F3W A;  1L1O B;  1S3O A;  2F1M A;  3K5L A;  1TWA B;  5KIX A;  3T51 B;  4ULL A;  3JAM L;  1SLJ A;  1XMQ L;  3NBH B;  1FGB D;  4C3J G;  3K58 A;  4BXX H;  4GOP A;  3ICE A;  1KIX A;  4OL7 A;  2F0W A;  2B63 G;  1VQC A;  2UUC Q;  5CC4 A;  1I4Q A;  2A8V A;  2CH4 W;  2ZXO A;  3BDO A;  4DV5 Q;  2A69 D;  2D0P A;  3M4O B;  2K04 A;  3DWA A;  2JP1 A;  2LFN A;  2G9H D;  1PH5 A;  4K0K Q;  4RCO A;  2WB1 B;  3L9A X;  4C3I B;  3TS2 A;  2BH8 A;  4CDC C;  1D1K A;  3A74 A;  3QIA A;  5EPJ A;  1PYS B;  4U68 A;  4R8I A;  3KLW A;  4JC0 A;  2Y0S B;  1WVL A;  1M90 C;  1Q90 A;  2L11 A;  1D5Z C;  3T1Y L;  4IFD G;  1G91 A;  2FMC A;  4XDX A;  1H9K A;  3BVZ A;  3HG9 A;  3S1M B;  1VF7 A;  4B3R Q;  2IWH A;  3E9H A;  1V8Q A;  4CJ2 C;  2K28 A;  1M4V A;  1V1P B;  1A62 A;  1EIF A;  5ELC A;  1SFO H;  1IYU A;  3GQB A;  3B6Y A;  1O7Y A;  1LO5 D;  2PO4 A;  3UDI A;  2NZO A;  1VQO A;  4UP7 A;  3HOZ H;  4JPB W;  5H1S E;  1WTV A;  1GOZ A;  1SE8 A;  5E7N A;  2NUC A;  2DGY A;  3MAQ A;  2HDL A;  3GTQ B;  3ER0 A;  3S15 B;  1CK1 A;  2IHF A;  1DCZ A;  1AH9 A;  4MHE A;  1C0A A;  4JI7 Q;  4GN5 A;  5T1G A;  4AQY Q;  2UUB L;  4LF9 L;  1SNP A;  2GVA A;  5ISR A;  4HN7 A;  2L9H A;  2ZXR A;  5IE8 A;  2RVL A;  1KHI A;  3ERO A;  5CV8 A;  5C4X H;  4G7O C;  3PIP A;  2Q2U A;  2QIL A;  4A3K B;  2MFI A;  4ILW A;  5T1I A;  4X3T A;  1Y1W H;  4TRD A;  3RMH A;  4PMC A;  3JAM E;  2B39 A;  4LFB L;  3H0G B;  4JBJ A;  4BA1 I;  1TWF B;  4LF9 Q;  4LNQ A;  1CQV A;  1QE6 A;  1EQR A;  2ZT9 C;  4QF4 A;  3NEM A;  1J5E L;  1AEX A;  1X9N A;  1PA6 A;  3VA5 A;  1I3Q H;  2F0F A;  1HJP A;  1PTO B;  4MZ9 A;  2H5X A;  3EJI A;  4M8A A;  1U0L A;  2TSS A;  3HZX A;  5I9O A;  3SXH A;  4C2M B;  1SND A;  4RKB A;  1N9W A;  4K2K A;  3CCU A;  4LF4 L;  4I7Z C;  3ERS X;  3D3R A;  2B2V A;  1GD7 A;  3V2T A;  4BY7 B;  2KQ3 A;  1C8C A;  1N32 L;  2EIF A;  3SVM A;  2IL8 A;  1U4L A;  5IOC A;  1WTQ A;  1FNU A;  3BJU A;  2PW7 A;  3LX0 A;  3J7Y W;  5IT9 c;  1KQS A;  4UP9 A;  1FYC A;  1EOT A;  2TMP A;  3K7U C;  4LW1 A;  4G57 A;  1HCZ A;  4DK1 A;  1N32 Q;  3TBI B;  1HTL D;  4QIW E;  3P75 A;  4DV7 L;  4KY7 A;  2QEX A;  4OHJ A;  1KL9 A;  2X69 A;  3H15 A;  1ESR A;  1JQY D;  4Y7N H;  4RGM A;  1RDP D;  2NVY B;  1JWU D;  4WFN 3;  3I91 A;  1VF5 C;  2K4K A;  1HPC A;  1H9M A;  5K36 G;  1S5E D;  1EYD A;  3CCE A;  2ID0 A;  5E4W C;  1ZEQ X;  2MHV A;  1LTS D;  5IP7 G;  4KY6 A;  1HUN A;  3GTL H;  2L1B A;  4NPS A;  4P72 A;  1VQ9 A;  2RKS A;  2AQ2 B;  2E2D C;  3VR2 A;  1O78 A;  3RZD H;  4DA2 A;  3Q0A A;  1CA6 A;  2JA5 G;  3HOV H;  4DXF A;  4EGV A;  3Q22 A;  1TWH B;  1I4G A;  2HD3 A;  4HCS A;  2F0N A;  5IGB A;  2CW0 D;  3MXG A;  1IBK L;  1N34 Q;  2LXK A;  3C1F A;  2EYP A;  5DM6 3;  3SEB A;  1Q12 A;  3I2Z A;  5M5Y B;  3QG1 A;  1PFN A;  5DLQ E;  1Q86 C;  2G9D A;  2JA8 B;  2PMZ E;  3CCJ A;  5HGT A;  4G7Z C;  1PH9 A;  1WI5 A;  1CKN B;  4F8M A;  3KF6 B;  1IXR A;  1EY8 A;  2F0V A;  1SMY D;  1H9S B;  1DOL A;  2B2T C;  3NK9 A;  2JXM B;  3T1H L;  1HFG A;  3CU7 A;  4DV4 L;  1HTP A;  3HS0 C;  4KK7 A;  2DN8 A;  1EFW A;  1HZA A;  3S16 H;  3VR5 A;  4K8I A;  1SNQ A;  5M9O A;  1J6Q A;  2EYM A;  3J81 c;  1D8L A;  1I4X A;  4ZK9 B;  4X64 L;  2ZTE A;  2I07 B;  2IX0 A;  3T1H Q;  4QCL A;  4CHT B;  1K8A C;  3F2B A;  4CGY B;  5CMD A;  2NZH A;  4KD4 A;  5FO7 B;  2CH4 A;  3MWY W;  5HY6 A;  2UXC L;  1HA6 A;  1RJT A;  4GKK L;  3GDE A;  3S1N H;  1B9N A;  2A6E D;  5GAH C;  5GAD C;  4DV1 L;  4DNT B;  3KYH C;  4DUZ L;  4IFD H;  2R6G A;  2CQO A;  2XRS D;  2UXC Q;  1JB3 A;  4UDU C;  4A3I H;  4GKK Q;  4PMB A;  3BZD B;  4TQU S;  4A3E H;  2XTI A;  1B9M A;  1QVG A;  3HOY B;  2Q2T A;  4DV1 Q;  2JA6 H;  4HR7 B;  1BUV T;  5M5X B;  3M3Y B;  4XT3 B;  4N8F A;  3TZD A;  1E2W A;  1X3F A;  2NVX H;  3PO3 B;  5KNC A;  4Q5V A;  2SDF A;  2Y0S E;  4K8J A;  1CZG A;  3I73 A;  1WTO A;  1PH3 A;  4PQX A;  4DN4 M;  4KV6 A;  3FMC A;  4KJO A;  1GUS A;  1L1O A;  5FJ8 H;  5JEA H;  2GVB A;  4A3B G;  2KJX A;  3S1Q B;  5C44 H;  4N9T A;  3SK6 A;  3NBH A;  4H7B A;  1RIP A;  3JC6 6;  1F2Y A;  5C4J B;  4XT1 B;  1LTT D;  2HIX A;  3PO2 G;  4OON A;  2R7Z B;  2K5D A;  2RF4 A;  3DEP A;  1VQ8 A;  4GOP B;  4IAL A;  4YHH L;  4A3J G;  2NVQ H;  1Q3L A;  1H9R A;  2VQF L;  1NJI C;  4GZY C;  1VQL A;  4A3F H;  1YNJ D;  4ZRZ A;  1QG7 A;  1Q81 C;  4CBV A;  1VQD A;  4B3T L;  3U4V A;  5I2Y A;  4BBS G;  3NQT A;  1QZH A;  1PXU A;  2WP8 J;  2V4D A;  2L4N A;  1HFN A;  4XQQ A;  1GUO A;  4ODG A;  3F2U A;  1Q8K A;  4NDX A;  4DR2 L;  4XIG S;  3FPU B;  4B3T Q;  2D9U A;  2PQA B;  2RCN A;  4EQ5 A;  5CV9 A;  1XNR L;  1BR9 A;  1BKB A;  2OT2 A;  4PZ8 A;  1D7Q A;  2EDG A;  2Z6B A;  5EQ0 A;  3R8B A;  4HID A;  2MPM A;  2F0J A;  1JE4 A;  1EOV A;  4DR2 Q;  1CZW A;  1Q82 C;  1L0Y B;  2JA9 A;  2MNA A;  3RNU A;  2UUA Q;  3Q24 A;  3AQQ A;  3URY A;  1XNR Q;  1HXY D;  2YYZ A;  4QMG A;  2WIN B;  2IJ0 A;  1A3T A;  3NTK A;  5BN3 A;  1G6Z A;  2HUG A;  3RN2 A;  2HT1 A;  4YIJ A;  1B1Z A;  1HQM C;  2OTL A;  4L63 B;  3K57 A;  4WJW A;  5DEH A;  3U50 C;  3ULL A;  1F77 A;  2K6A A;  2R92 B;  1ILP A;  5IYD H;  1K73 C;  1PHJ A;  3FKI H;  2WAQ G;  3KLS X;  3GTK B;  4HIO A;  3SR1 A;  4L5S A;  3M7G A;  1IKL A;  2B2W C;  5IP7 H;  4EVO A;  3E3X A;  1ASY A;  2MO1 A;  5M3M H;  4JI0 L;  2V1C C;  1LT4 D;  1A8V A;  4JI5 Q;  1EYG A;  4DR4 L;  3A8I E;  3MVV A;  4DR1 Q;  3V96 A;  5IWA Q;  1EL0 A;  3E0J A;  3PMF A;  5LMN Q;  1MSG A;  1PH1 A;  4QL5 A;  1II3 A;  1VQB A;  2LKV A;  1D1I A;  1X3E A;  1MJE A;  2CWP A;  3LGJ A;  5LL6 X;  1CSQ A;  3I4O A;  1W3S A;  1J8I A;  1JCK B;  1JOO A;  1B4O A;  4P73 A;  5CV7 A;  2MO0 A;  3GTM B;  3DM1 A;  3K8A A;  2L5T A;  5EGT A;  4CJ0 B;  5D3I B;  2F0M A;  1RCV D;  1IZ6 A;  1VQ6 A;  1G2T A;  5DAU A;  3H3V I;  3IKJ A;  1TS2 A;  2E2H H;  3S16 B;  5CV5 A;  2ZM6 Q;  4A3M H;  4C3J B;  3HOZ G;  3G48 A;  1TS5 A;  3RN5 A;  2HIV A;  2EPB A;  1SYB A;  2RDF A;  1STN A;  2B63 B;  4WJ4 A;  1EFI D;  2D0O A;  5IGD A;  4JI3 Q;  1OXT A;  4ZUI A;  3OWE B;  4LF6 L;  2L0C A;  4B9W A;  2O4X A;  3S14 B;  3CCS A;  1SYF A;  3X3M A;  3K5N A;  4IOA A;  3G7L A;  3IAY A;  1IHZ A;  3SHL A;  3I4M H;  3NP8 A;  4JI6 L;  2N3S A;  1SYG A;  2BA0 A;  4YCU A;  3RR5 A;  5C4X G;  2K75 A;  3GTP B;  4IUU A;  4IPD A;  4DR3 Q;  1D5M C;  3WOE A;  1BCP D;  1Y1W G;  1NBW A;  1U5K A;  1IW7 D;  1FGU A;  3HP3 A;  1W2B A;  4H0L C;  2A6H C;  1YNN C;  1T5X D;  2K5V A;  3NEN A;  3PUX A;  2EJF C;  1XNQ Q;  4H02 A;  4JI6 Q;  3RZO H;  3NSW A;  2PNH A;  2KEN A;  1YVC A;  5FLX c;  2QGQ A;  2NVX B;  4K14 A;  1SRO A;  5KGU A;  4BWG B;  4O42 A;  1ONL A;  4A3C H;  3DXJ C;  3K80 C;  2YV5 A;  1HNZ Q;  2XRQ D;  1J9O A;  1MD2 D;  2KCT A;  4P71 A;  1CKN A;  1ZYR C;  3KF6 A;  3D8G A;  4LUV A;  1SJH D;  1X3G A;  1EY4 A;  4NB3 A;  1NCV A;  3GP7 A;  3M4Y A;  2E2J B;  5JJK A;  1TR5 A;  1YHA A;  1YIT A;  2K50 A;  4R4I A;  4DU9 A;  3K7A H;  1GM5 A;  3HOW H;  4LAA A;  5JJL A;  3CD6 A;  1PRT D;  2GN5 A;  1FVI A;  5IYC G;  3S2D H;  4OWW B;  3E0E A;  2WII B;  2QDB A;  4FXG C;  4DV0 L;  3QO2 A;  4LK1 C;  4C3H H;  1OXS C;  1PTO F;  3CRK C;  1SNM A;  5I6Y A;  3MEH A;  1A2U A;  3W1G A;  5A35 A;  2LMC B;  4Q0F A;  1WCM H;  4PZ7 A;  3OTO Q;  1CUK A;  4JI2 Q;  3UDG A;  4DR7 L;  3HKZ G;  3EBE A;  4X3U A;  1KRS A;  5BN5 A;  4IUN A;  3CPF A;  4LFA L;  4POF A;  3HOV G;  4JW0 A;  4JV5 Q;  2XWB B;  3J7A V;  3K59 A;  2DY8 A;  1TWC H;  2B2V C;  1X3Q A;  1KLU D;  1CHQ D;  1AP0 A;  3MFG A;  1XXG A;  3UE1 A;  2F0H A;  4E6I A;  2HQE A;  3GTJ B;  2BH2 A;  1SRU A;  5IGE A;  5C3X A;  4H13 C;  1G8Z D;  4QQB X;  1LAC A;  1GUN A;  2AQ3 B;  1KDA A;  4DNI A;  1K8O A;  4JI8 Q;  3KLR A;  3ND8 A;  3CME A;  2KHS A;  1X65 A;  1B53 A;  2B2Y A;  4AIM A;  4H44 C;  2B29 A;  4DAV A;  5K5P A;  3NUC A;  3T53 B;  1IYJ B;  2E75 C;  1NTG A;  2EVB A;  1QNU A;  3PUZ A;  4X65 Q;  1EWH A;  1I4R A;  5GAG C;  1TS3 A;  2LS0 1;  1ML0 D;  2BDN A;  1YHQ A;  2PZW A;  2JA5 B;  4K2L A;  5LL6 S;  2R93 H;  1PLF A;  5E3F A;  3GV6 A;  2M2L A;  4ZAI A;  1L0W A;  4HIM A;  1XMQ Q;  1IKM A;  3STB C;  1QNK A;  1S4Z A;  1KNA A;  1RHP A;  2NVT H;  1EQT A;  3M9B A;  4NMZ A;  3I4N H;  1EWI A;  1V9P A;  4XYQ A;  4L5R C;  2XNA C;  3TN2 A;  2M9V A;  2PQA A;  2OWO A;  3CQZ B;  3U9O A;  4A3I G;  2JA7 G;  1YIJ A;  3A5U A;  4A3E G;  1K9M C;  1ZXT A;  4IPC A;  5BN4 A;  1AE2 A;  2PW5 A;  1CSP A;  2CFM A;  2VXW A;  3BVG A;  2JA6 G;  1JJC B;  4KKU A;  1EZ6 A;  3ULP A;  2XSC A;  3PUV A;  5JOB A;  1PZK D;  3OOC A;  2WKD A;  3T1Y Q;  1SMY C;  1C48 A;  3J81 i;  4YCV A;  2R7D A;  4RGO S;  3LWE A;  3QOJ A;  4DF7 A;  2N88 A;  5C3E H;  1R9T H;  4JBM A;  4OX9 L;  3VR3 A;  1E22 A;  3SDZ A;  1N36 L;  3IFD A;  5FJ8 G;  1AN8 A;  5JEA G;  1XTD A;  4UY8 C;  5C44 G;  4L5Q A;  4TKO B;  1HNW L;  1O7Z A;  3AFP A;  3NWS A;  4OX9 Q;  3SK4 A;  4UHV A;  3PGZ A;  5C0X H;  1N36 Q;  4DPG A;  2F0E A;  3PIO A;  3M7N A;  3OYY A;  3I72 A;  3PQI A;  1HNW Q;  2FMM A;  2OEO A;  1CQF A;  2J0T D;  4KY5 A;  1DON A;  1EUJ A;  2UUB Q;  3D0F A;  1GKH A;  4A3F G;  4HJA A;  1JIC A;  1NE3 A;  1CKM A;  3K5O A;  4X3K A;  1MHW C;  4LFB Q;  3RD4 A;  4X3S A;  1CM9 A;  1J5E Q;  3S17 B;  2EQS A;  2OF1 A;  2E8G A;  2F0L A;  3DLL A;  2BE5 D;  3NTI A;  4UPA A;  1L1O C;  4A3B B;  1BXT A;  4KKS A;  2F0U A;  3I56 A;  1LTA D;  2M00 A;  3A55 A;  3T56 B;  3EFX D;  1JWM D;  3PO2 B;  1Y1V H;  4JVZ A;  3VYR A;  2D5D A;  4LF4 Q;  5IYC H;  2K33 A;  3EVQ A;  4A3J B;  1GHK A;  3AMU A;  3SK8 A;  2A1A A;  3HOX H;  3H3V H;  1WYD A;  5IYD G;  2UU9 L;  3FKI G;  2IX1 A;  5FO8 B;  4BBS B;  1JOQ A;  3GTO B;  5ELO A;  2AWN A;  2F0I A;  1TU2 B;  4MTN A;  1EY0 A;  4NW2 A;  3WWV A;  4A3L H;  4CKB A;  4DV7 Q;  1XX8 A;  3J7A 5;  4F87 A;  5M3M G;  2FXQ A;  2QEJ C;  2QDL A;  5G3L D;  2B2U A;  4A3G H;  4B3M L;  2RDG A;  1RL2 A;  3HOU H;  4YWL A;  3R2I A;  3OMG A;  3QWN A;  4JOI A;  1AFP A;  1SN8 A;  1BCP B;  1JJG A;  1RTO A;  4R4Q A;  4G7H C;  4BY1 H;  1UE1 A;  4OIK A;  1TWG B;  4IUR A;  5JPM C;  1V43 A;  4B3M Q;  1EIH A;  1HUM A;  4O1N A;  3FPP A;  1WTW A;  5A2Q L;  2D2C C;  4S3S A;  4FF4 A;  3UDX A;  1DGS A;  1WOC A;  1HA5 A;  1UEA B;  3F2D A;  1IBK Q;  4KTA A;  1LAB A;  2WAQ B;  3QR8 A;  4A3M G;  1EY9 A;  2VY3 A;  1LT6 D;  1QZG A;  4AYB G;  4Y52 H;  3S24 A;  2C35 B;  5KRU A;  2A68 C;  1BBW A;  4XTC S;  2HDM A;  2KCM A;  1JB7 A;  3D6C A;  4K5W A;  4DK0 A;  2Z4H A;  3Q23 A;  2RHQ B;  1UE5 A;  2CCZ A;  4DV4 Q;  1PRT B;  4EQO A;  3K5M A;  2EJG C;  4DV3 L;  1NAP A;  3LNN A;  3N52 A;  4KI0 A;  1K83 H;  4XQN A;  5BR8 L;  1PTO C;  3I4M G;  2RDH A;  4QGU A;  1KNE A;  4DR6 L;  2ZJQ A;  4X64 Q;  4GKJ L;  3HEJ A;  3J80 L;  5ELN A;  3K6O A;  3HFZ B;  4FO2 A;  3FDT A;  2QCP X;  3BYT B;  3P20 A;  4BBR H;  1E2Z A;  1N8R C;  1VMC A;  5BR8 Q;  4WRD A;  2MGS A;  1Y8P B;  3VYU A;  2JA7 H;  1SFO B;  4OEL B;  4DR6 Q;  4YWK A;  5EBD A;  3TQY A;  4JI4 L;  4A3D H;  2E2I H;  3ULJ A;  3HOZ B;  1QB5 D;  3D6W A;  1OO9 B;  2AHO B;  5E4X A;  4A3C G;  1XPO A;  2WB1 E;  4DUZ Q;  5J1Z A;  3W1B A;  3CC2 A;  4FF2 A;  3KOJ A;  3NE5 B;  2PQE A;  3LWU A;  4HED A;  4QUC A;  3R2T A;  4JI4 Q;  1LT3 D;  1WTR A;  1RKN A;  2Z9H A;  5A2Q E;  4P75 A;  1ASZ A;  2CKZ B;  4LUZ A;  3HOW G;  1E2V A;  5C4X B;  3UDF A;  4IZ8 A;  3NTH A;  4JYA L;  1DZ1 A;  1Y1W B;  3A7L A;  1SDF A;  4EQP A;  3ONA B;  4PV1 C;  2ICE C;  2R61 A;  1Z6H A;  5E1F A;  4C3H G;  3WOF A;  1QOH A;  4PNY A;  3CKI B;  3PUW A;  2QW7 A;  1JC7 A;  4DNR B;  1MJC A;  1T5E A;  1YHB A;  2NYZ D;  5KNB A;  2YU9 H;  4JYA Q;  3S2H H;  1I3Q B;  4IUT A;  1I6H H;  1GXD C;  1WCM G;  3C3L A;  2SNS A;  1G51 A;  4YHH Q;  4B08 A;  4FYD A;  1ET9 A;  1JE5 A;  1I4P A;  5ELB A;  1VQH A;  2VQF Q;  4BA2 I;  3EA6 A;  1B70 B;  3TRZ A;  3E6Z X;  1KLG D;  1DXM A;  1RTN A;  3SK5 A;  3J80 E;  4ZCK A;  2BOS A;  1SBB B;  1A6X A;  1DJR D;  5JJZ A;  1SR3 A;  1I50 H;  1SE2 A;  2F3V A;  2DNE A;  2HCC A;  3BG3 A;  3G6J B;  3H09 A;  1O80 A;  5C0X J;  4APV A;  4J6H A;  5IT9 L;  4WJ3 M;  1SNO A;  4RHS A;  1XTC D;  2F52 A;  4ZKB B;  1F2M A;  3L0O A;  4KN4 C;  1X55 A;  5CBA E;  4LF8 L;  4PG3 A;  4GNX B;  5C0X I;  1WD1 A;  3P1H A;  4Y7N B;  2KA7 A;  4A93 H;  1EIY B;  4GS3 A;  1VQG A;  2F0G A;  2A5H A;  4K6D A;  3QB3 A;  2O2L D;  4IPG A;  4K5X A;  1AW7 A;  3ND9 A;  1S5B D;  5JAV A;  4DR5 L;  1NNX A;  3GTL B;  3HKZ B;  4IUP A;  1EU4 A;  3CC7 A;  1HZ9 A;  1X32 A;  1SEB D;  3FHW A;  3RZD B;  3KLS A;  4KLK A;  4IQZ A;  3HOV B;  4B3S L;  3J7Z C;  2R93 G;  1HHV A;  5KEE A;  4DR5 Q;  1ILQ A;  1JWS D;  4KHP L;  1YJW A;  2XN9 C;  4RWS C;  1WD0 A;  3S1R H;  1P8L A;  4LF5 L;  4RFB A;  2K14 A;  3A0J A;  4NXM L;  1ICW A;  1K8M A;  3DWQ A;  1TWA H;  3JAM c;  5KYL A;  5I6W A;  4MNO A;  4JI0 Q;  1U9R A;  3I4N G;  5EKK A;  3ZYY X;  5NUC A;  5IYB H;  4DR4 Q;  4DFA A;  1OXV A;  1VS0 A;  4K5V A;  1CFM A;  2AUJ D;  5L37 A;  4LF5 Q;  2DNC A;  2UXB L;  2EYO A;  1ICF B;  2B2Y C;  3SE0 A;  1JOR A;  5EBC A;  1K8G A;  4LFC L;  3M4O H;  3MZ5 A;  3P7J A;  5CV4 A;  2ZTC A;  3KF8 A;  3NWT A;  1KD1 C;  4FDB A;  4IPH A;  4OEM B;  4C3I H;  2UXB Q;  1B8A A;  3F8T A;  4GOP C;  3CCL A;  5C3E G;  4R8N A;  3CHB D;  2H4O A;  1QWY A;  2EXD A;  2MQH A;  4HSV A;  5IT9 E;  4LFC Q;  2NTT A;  5FK9 C;  1C9O A;  1KXL A;  4DGZ A;  3S1M H;  1NUC A;  4CKC A;  3S1N B;  4DKA C;  1OXX K;  3SGI A;  2AMC B; 
#chains in the Genus database with same CATH homology
 2N49 A;  5GAG C;  4PZ6 A;  4QIW E;  1K0R A;  4DV7 L;  5AJ3 L;  4LF6 Q;  2QEX A;  1KL9 A;  1YHQ A;  2KBN A;  5C0X G;  2E2J H;  3H15 A;  4BY7 G;  1A63 A;  1NY4 A;  4Y7N H;  5LMN W;  4IJH A;  1HH2 P;  2R93 H;  4HJ8 A;  2K4K A;  4GN4 B;  1T9H A;  1JT8 A;  5K36 G;  1NMF A;  1L0W A;  4HIM A;  3CCE A;  3OW2 A;  4X62 L;  1XMQ Q;  2E5L L;  1SMX A;  2ID0 A;  3GTQ H;  1I5F A;  3S15 H;  5IP7 G;  3STB C;  1VQF A;  3W5O A;  5IP9 H;  5AJ3 Q;  1PH7 A;  3GTL H;  1VQK A;  2ATW A;  1G6P A;  2NVT H;  4NPS A;  4JCV E;  2I0Q A;  4HJ5 A;  4P72 A;  3M9B A;  2OQ0 A;  1VQ9 A;  2ZJP A;  1EWI A;  2WFW A;  3I4N H;  3RZD H;  1V9P A;  2JA5 G;  4L5R C;  3HOV H;  2OCE A;  2PQA A;  2OWO A;  4A3I G;  2E5L Q;  1L2F A;  2JA7 G;  1PVO A;  1YIJ A;  2JJQ A;  2NN6 I;  3A5U A;  4A4I A;  4JG2 A;  4IPC A;  1UWV A;  3U4Z A;  2I5L X;  2IT1 A;  4A3E G;  4A3K H;  1K9M C;  1AE2 A;  2AWO A;  3EIV A;  3TEH B;  1IBK L;  1CSP A;  2CFM A;  4P74 A;  1N34 Q;  2LXK A;  2JA6 G;  1Q12 A;  3I2Z A;  1JJC B;  3ULP A;  5DLQ E;  3H0G H;  1Q86 C;  1KC8 C;  1TWF H;  3PUV A;  3T1Y Q;  1CKO A;  2UUA L;  4YY3 L;  2JEA I;  5LMU L;  3J81 i;  2PMZ E;  4YCV A;  2R7D A;  1Z9F A;  2VL6 A;  3CCJ A;  1VQ7 A;  1PH9 A;  1WI5 A;  1Y1V G;  3G6E A;  3E9I A;  1LM0 A;  1CKN B;  1NMG A;  1YNX A;  5C3E H;  2K5H A;  1IXR A;  3KF6 B;  1R9T H;  1S40 A;  4JBM A;  4LF8 Q;  4OX9 L;  1E22 A;  2KHI A;  3K81 C;  1VCI A;  3KFU A;  2VQE L;  3T1H L;  1N36 L;  3GTJ H;  4DV4 L;  1Z47 A;  5FJ8 G;  3HOX G;  1S72 A;  4JBW A;  4JBK A;  5LMU Q;  5JEA G;  1EFW A;  1XTD A;  1HZA A;  4R4T A;  4C2M H;  1OTC A;  5C44 G;  4UY8 C;  2F4V L;  3S16 H;  4L5Q A;  1HNW L;  5M5W H;  4JYA Q;  4LF7 L;  2JA8 G;  3AFP A;  1VQ5 A;  2I5M X;  1J6Q A;  4OX9 Q;  3J81 c;  1D8L A;  3PGZ A;  4X64 L;  4LUO A;  2ZTE A;  2IX0 A;  3T1H Q;  4DK6 C;  1VQJ A;  4DV0 Q;  1N36 Q;  1FJG L;  4BY7 H;  4OO1 G;  4DPG A;  3CAM A;  5M3F H;  1K8A C;  1K3R A;  3EN2 A;  3PIO A;  3F2B A;  3M7N A;  4A3L G;  4JI5 L;  2NZH A;  3OYY A;  4TVA B;  2F4V Q;  1HNW Q;  1HR0 L;  4R4C A;  4DR1 L;  2Q2H A;  5IWA L;  4BXX G;  1EUJ A;  4QY7 A;  2UUB Q;  1Q1E A;  5HY6 A;  2UXC L;  4A3G G;  1N33 L;  3D0F A;  1GKH A;  3HKS A;  5LMN L;  4HJA A;  4A3F G;  1NE3 A;  3L2P A;  3GDE A;  4B3S Q;  2CWA A;  4GKK L;  4EX5 A;  3S1N H;  3HOU G;  5GAH C;  1CKM A;  4KHP Q;  1FJG Q;  5GAD C;  3GO5 A;  4DV1 L;  4UP8 A;  2YTV A;  1VQ4 A;  1PV4 A;  3GD7 A;  3KYH C;  4DR7 Q;  2HQL A;  1BBU A;  1QUQ B;  4DUZ L;  4LFB Q;  2JA5 H;  2RHS B;  2NVY H;  4BY1 G;  2R6G A;  2CQO A;  4X66 L;  4KHZ A;  4NXM Q;  2UXC Q;  1GVP A;  1N33 Q;  4A3I H;  4A75 A;  4GKK Q;  1AE3 A;  4J15 A;  1IBM L;  4TQU S;  4POG A;  1HNX L;  1J5E Q;  4A3E H;  3ZJY C;  2XTI A;  2EQS A;  5EAY A;  1IBL L;  2E8G A;  4LFA Q;  2A19 A;  3DLL A;  1QVG A;  2Q2T A;  2UXD L;  4DV1 Q;  1WFQ A;  3BU2 A;  3CCQ A;  2JA6 H;  4OXP A;  2Q2I A;  4UPA A;  1L1O C;  1Q46 A;  3F2C A;  3CCR A;  3I56 A;  2ZM6 L;  3CP0 A;  2N8N A;  3PCO B;  2JE6 I;  1X3F A;  1VQI A;  2NVX H;  2R7F A;  3AFQ A;  1IBM Q;  1HNX Q;  2Y0S E;  3GTG H;  1Y1V H;  4RMF A;  1JJ2 A;  2D62 A;  1TWH H;  4JI3 L;  1E24 A;  2PI2 A;  3CQZ H;  4LF4 Q;  5IYC H;  1LTL A;  1TXY A;  1E1T A;  1PYB A;  1PH3 A;  2NN6 G;  3PUY A;  3HOY G;  4YWM A;  1GO3 E;  5FLM G;  2LSS A;  1PH8 A;  2A1A A;  1L1O A;  2WAQ E;  5FJ8 H;  3HOX H;  1O7I A;  4NXN L;  5M5Y H;  2GVB A;  4A3B G;  5C44 H;  1HR0 W;  3H3V H;  4HJ7 A;  1WYD A;  5IYD G;  2UU9 L;  3PO3 G;  2JA8 H;  1RIP A;  3JC6 6;  4R1J A;  3FKI G;  4JOI C;  2IX1 A;  2VUM G;  2HIX A;  3PO2 G;  2KHJ A;  4OON A;  5ELO A;  4DR3 L;  1JMC A;  1PH4 A;  2AWN A;  2RF4 A;  1VQ8 A;  2QA4 A;  4MTN A;  5J3B A;  4GOP B;  4NXN Q;  3WWV A;  2Z0S A;  4YHH L;  4DV5 L;  4A3J G;  1XJV A;  4DV7 Q;  2NVQ H;  4A3L H;  1QVC A;  1PFS A;  2VS1 A;  4DAY B;  3J7A 5;  5M3M G;  2FXQ A;  2VQF L;  1BVS A;  1NJI C;  1XNQ L;  4K0K L;  3HKZ E;  1C7Y A;  2LXJ A;  1VQL A;  2B3G A;  4A3F H;  1YZ6 A;  4B3M L;  4A3G H;  3J80 i;  1RL2 A;  3HOU H;  4YWL A;  3I55 A;  4BBR G;  1YJ9 A;  1Q81 C;  4GNX C;  4JOI A;  4X6A H;  1VQD A;  4B3T L;  1SN8 A;  1YBY A;  4GLA C;  3U4V A;  4X62 Q;  4HIK A;  3BZC A;  4BBS G;  5HGQ A;  1QZH A;  2R7Z G;  4HJ9 A;  1JJG A;  2WP8 J;  4R4Q A;  4L5T A;  4A3D G;  1M1K C;  4BY1 H;  3M4Q A;  1UE1 A;  1HNZ L;  4GN3 B;  4B3M Q;  1V43 A;  1Q8K A;  4DR2 L;  2ES2 A;  3MXN B;  4B3R L;  1VQP A;  1I94 L;  4XIG S;  2VW9 A;  4DK3 C;  4B3T Q;  2PQA B;  2RCN A;  4EQ5 A;  3UDX A;  2ASB A;  1DGS A;  1XNR L;  1WOC A;  4GNX A;  3UE0 A;  4PZ8 A;  1BKB A;  3J80 c;  3TS0 A;  1E1O A;  1D7Q A;  1Y14 B;  3F2D A;  1IBK Q;  3DM3 A;  4HID A;  1XPR A;  2XGT A;  1EOV A;  4IJL A;  4DR2 Q;  1Q82 C;  2ZJR A;  2JA9 A;  1I94 Q;  1H95 A;  4A3M G;  2MNA A;  2VY3 A;  4R4O A;  3RNU A;  2UUA Q;  3J81 j;  2JEB I;  4YY3 Q;  3AQQ A;  1QZG A;  4AYB G;  1XNR Q;  4Y52 H;  4ME3 A;  2YYZ A;  4PMW A;  3S24 A;  3S17 H;  2C35 B;  1UE7 A;  4IOC A;  3HOY H;  3I7F A;  3PSI A;  5FLM H;  3RN2 A;  3TRE A;  1BBW A;  3M85 A;  2OTL A;  1E7Z A;  4XTC S;  2KCM A;  1JB7 A;  4JI7 L;  5M5X H;  2HT1 A;  3CXC A;  3M3Y H;  4A3B H;  3U50 C;  5GQO A;  1PH2 A;  3ULL A;  4AQY L;  2RHQ B;  2VQE Q;  2Z6K C;  1UE5 A;  2CCZ A;  5IYD H;  4DV4 Q;  1K73 C;  3PO3 H;  1Q7Y C;  1LUZ A;  1PHJ A;  4IFD J;  1WJJ A;  3FKI H;  4DV3 L;  2PI2 E;  2WAQ G;  3PO2 H;  3PV0 A;  4KI0 A;  1K83 H;  5BR8 L;  3OTO L;  1Q1B A;  3I4M G;  4LF7 Q;  3RLO A;  3A5Z B;  4HIO A;  4JI2 L;  4L5S A;  4QGU A;  4A3J H;  5IP7 H;  3D31 A;  4IFD I;  1ASY A;  1X56 A;  2ZJQ A;  2MO1 A;  4X64 Q;  5M3M H;  4DR6 L;  4GKJ L;  5ELN A;  3IRB A;  1UEB A;  4JI0 L;  1PH6 A;  3HFZ B;  1QVF A;  2Z6K A;  3S1Q H;  2V1C C;  4JI5 Q;  1A8V A;  2R92 G;  1EYG A;  4DR4 L;  4BBR H;  1HR0 Q;  4DR1 Q;  1N8R C;  5IWA Q;  4JV5 L;  3FP9 A;  5BR8 Q;  3CF5 A;  3CCV A;  5C4J H;  3Q8D A;  3KJP A;  5LMN Q;  1PH1 A;  4AH6 A;  3GTO H;  4BBS H;  2R7Z H;  4QL5 A;  2JA7 H;  2IY5 B;  4O0A A;  1QUQ A;  1VQB A;  4DR6 Q;  1MKH A;  4YCW A;  3KJO A;  1X3E A;  4YWK A;  3TQY A;  2CWP A;  4RG1 A;  1MJE A;  4JI4 L;  2E2I H;  4A3D H;  4OWX B;  3LGJ A;  3ULJ A;  2AHO B;  1CSQ A;  3I4O A;  1W3S A;  4A3C G;  5JEA J;  1XPO A;  1HZC A;  2WB1 E;  4P73 A;  4DUZ Q;  2F3I A;  1UE6 A;  4X66 Q;  1OXU A;  2IHE A;  2MO0 A;  3W1B A;  3CC2 A;  1VQA A;  1G29 1;  3KOJ A;  4O2D A;  1KAW A;  3K8A A;  4JI8 L;  3G71 A;  1IBL Q;  1MIU A;  3KF8 B;  3RLF A;  1EQQ A;  4JI4 Q;  2UXD Q;  1IZ6 A;  3PF5 A;  1VQ6 A;  3H3V I;  3VDY A;  2E2H H;  4GLV B;  4GLX A;  2N78 A;  2ZM6 Q;  4P75 A;  4A3M H;  4IO9 A;  1TWG H;  1ASZ A;  1LYL A;  3F1Z A;  4A93 G;  3HOZ G;  1E3P A;  3G48 A;  4X65 L;  2K5N A;  3RN5 A;  2HIV A;  2JQO A;  2CKZ B;  3MEF A;  4LUZ A;  3HOW G;  3UDF A;  4WJ4 A;  2D0O A;  1A0I A;  3K0X A;  4JI3 Q;  4JYA L;  1OXT A;  2K52 A;  4LF6 L;  3KDF B;  2UUC L;  1X6O A;  1B7Y B;  3CCS A;  3CMA A;  1L1O B;  1S3O A;  2ZTD A;  2JK8 A;  3PUW A;  4OWT B;  4IOA A;  4DUY L;  1VQM A;  1SLJ A;  1MJC A;  1XMQ L;  1YHB A;  4DV2 L;  3NBH B;  3I4M H;  4BXX H;  2UU9 Q;  2YU9 H;  4GOP A;  4JI6 L;  3ICE A;  2N3S A;  3S2H H;  1KIX A;  4YCU A;  2BA0 A;  3RR5 A;  1P16 A;  5C4X G;  2K75 A;  1I6H H;  4IPD A;  4DR3 Q;  2B63 G;  1VQC A;  1WCM G;  2UUC Q;  1YEZ A;  3CCM A;  1Y1W G;  3G4S A;  5M3F G;  1NBW A;  2VZA A;  2A8V A;  1G51 A;  3BZK A;  1VQN A;  3NEL A;  4YHH Q;  4DV5 Q;  2D0P A;  1U5K A;  2R92 H;  1JE5 A;  1FGU A;  4DUY Q;  1W2B A;  2K5V A;  3PUX A;  1VQH A;  3NEN A;  2VQF Q;  4DV2 Q;  4BA2 I;  1PH5 A;  1XNQ Q;  4K0K Q;  4H02 A;  4JI6 Q;  1B70 B;  3RZO H;  3TRZ A;  3TS2 A;  2BH8 A;  2PNH A;  5IYB G;  2KEN A;  1YVC A;  3A74 A;  5FLX c;  1N34 L;  3GTK H;  1PYS B;  2OTJ A;  2QGQ A;  3KLW A;  4JC0 A;  5JJI A;  1M90 C;  1SR3 A;  1I50 H;  1VQE A;  1SRO A;  1KRT A;  1YI2 A;  3STB D;  3T1Y L;  4IFD G;  4A3C H;  3K80 C;  1YJN A;  3AEV A;  5C0X J;  4APV A;  1V1Q A;  2YV5 A;  1HNZ Q;  2VNU D;  4WJ3 M;  4B3R Q;  2F52 A;  2KCT A;  4P71 A;  3L0O A;  1CKN A;  3E9H A;  3KF6 A;  1X55 A;  2L15 A;  2WB1 G;  4LF8 L;  1A62 A;  4LUV A;  1EIF A;  4PG3 A;  4GNX B;  1X3G A;  1SFO H;  4NB3 A;  5C0X I;  3PF4 A;  3CW2 C;  3B6Y A;  5JJK A;  3UDI A;  2NZO A;  1YHA A;  2Y0S G;  1VQO A;  2K50 A;  4R4I A;  4UP7 A;  1YIT A;  4A93 H;  3HOZ H;  3K7A H;  1EIY B;  4GS3 A;  2DUD A;  1VQG A;  1GM5 A;  3HOW H;  5JJL A;  5H1S E;  3CD6 A;  4QJF A;  1SE8 A;  3GTM H;  2GN5 A;  5E7N A;  4IPG A;  1FVI A;  2DGY A;  5IYC G;  3S2D H;  3ER0 A;  4OWW B;  2VUM H;  4DR5 L;  3E0E A;  2IHF A;  4ALP A;  4DV0 L;  3CPW A;  1AH9 A;  3JAM i;  4C3H H;  5IY0 A;  4LWC A;  1OXS C;  3CC7 A;  1C0A A;  1HZ9 A;  4JI7 Q;  4GN5 A;  3FHW A;  4AQY Q;  4KLK A;  2UUB L;  4LF9 L;  2GVA A;  4C3J H;  5GAE C;  3W1G A;  5IE8 A;  4B3S L;  3J7Z C;  3RLN A;  1KHI A;  5C4X H;  2R93 G;  3PIP A;  4DV3 Q;  4DR5 Q;  2Q2U A;  4KHP L;  2MFI A;  1WCM H;  4PZ7 A;  2B63 H;  1YJW A;  3OTO Q;  1CUK A;  1Y1W H;  3S1R H;  1P8L A;  2I5H A;  4JI2 Q;  4LF5 L;  3UDG A;  5IP9 G;  2YTY A;  4DR7 L;  2K14 A;  3HKZ G;  4LFB L;  3EBE A;  3A0J A;  4JBJ A;  3S14 H;  4BA1 I;  4GKJ Q;  4LF9 Q;  4NXM L;  3U58 A;  1XPU A;  4LNQ A;  1TWA H;  3JAM c;  1EQR A;  1KRS A;  3AYH B;  4MNO A;  4JI0 Q;  3I4N G;  3NEM A;  1J5E L;  3CPF A;  4LFA L;  5IYB H;  4POF A;  1X9N A;  1PA6 A;  3HOV G;  3L7Z C;  1OXV A;  1VS0 A;  4DR4 Q;  4JV5 Q;  1I3Q H;  1TWC H;  4LF5 Q;  3GTP H;  2UXB L;  2AKW B;  1HJP A;  4MZ9 A;  4A3K G;  3UE1 A;  5GRO A;  3M4P A;  2BH2 A;  1SRU A;  2H5X A;  4DV6 L;  1U0L A;  4A76 A;  4LFC L;  1HZB A;  2YTX A;  1K8G A;  3M4O H;  2HHH L;  3H0G G;  1XMO L;  4DAM A;  2BA1 A;  2ZTC A;  4QQB X;  1N9W A;  1KD1 C;  4FDB A;  3CCU A;  4LF4 L;  4IPH A;  4C3I H;  4DNI A;  2UXB Q;  1B8A A;  3ERS X;  3F8T A;  4GOP C;  3CCL A;  1FL0 A;  4JI8 Q;  4JI1 L;  4OO1 I;  4AYB E;  1GD7 A;  5C3E G;  2ALY B;  2EXD A;  2MQH A;  3CME A;  2EIF A;  1N32 L;  4DV6 Q;  1X54 A;  1X65 A;  4LFC Q;  2HHH Q;  1XMO Q;  4AIM A;  1C9O A;  2B29 A;  3BJU A;  1KXL A;  5IT9 c;  1IYJ B;  1KQS A;  4UP9 A;  1NTG A;  2OQK A;  3K7U C;  3PUZ A;  4X65 Q;  3CC4 A;  3KDF A;  3S1M H;  4DKA C;  4LW1 A;  1OXX K;  4JI1 Q;  1IL2 A;  3SGI A;  2AMC B;  1N32 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...