5M5YH

Rna polymerase i elongation complex 2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Molecular Structures of Transcribing RNA Polymerase I.
pubmed doi rcsb
molecule tags Transcription
total genus 17
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m5yH00
1HZAA 1LTLA 2UU9Q 3UE1A 3STBC 1XNRL 4IPGA 4A3LG 4GNXC 1UWVA 3NEMA 4JI8Q 3J81c 1K83H 2ZM6Q 3G4SA 3CF5A 4OWXB 3UE0A 1HJPA 1RIPA 3OTOL 5C4XH 1HZBA 5C0XI 1TWAH 2OCEA 3CMEA 4B3SQ 2VUMG 4A93G 2AWNA 1U5KA 2R93H 4BBRG 1IBLQ 1G6PA 3I4OA 4JBMA 4KHZA 3M3YH 3S16H 4L5QA 1MJCA 2F52A 3GO5A 3Q8DA 4UPAA 2HHHL 2V1CC 2DUDA 2MQHA 3PIPA 4BBSG 2ZTCA 3CCEA 2KHJA 3J81i 4OX9Q 3CAMA 1EWIA 3I7FA 3HOYG 1TWHH 1YVCA 2KHIA 1HNXL 1VQ6A 2R7FA 1QZHA 4JI6Q 4A3IH 1Q46A 3M4OH 3ULLA 4DV5Q 1I50H 1I5FA 2LSSA 2Z0SA 2OQKA 3HOVH 3FHWA 4A3MH 3CCMA 1HR0L 4DR4L 3S24A 2CQOA 5GADC 3JAMc 1I3QH 1NTGA 3L2PA 4A3JG 4UY8C 1TXYA 1H95A 5JJIA 1J6QA 2ZTDA 1YHAA 4IOAA 3PSIA 3UDXA 1MIUA 3KF6B 4JI5L 4A3FG 1UE6A 1OXXK 4JI7L 1XNRQ 1PFSA 1K9MC 1KIXA 3I4MH 4JYAL 2VW9A 2E2IH 4A3BG 2KCMA 1JB7A 2VQEL 1TWGH 1EIYB 3OTOQ 2HT1A 2EIFA 2RF4A 2K50A 1DGSA 1FL0A 1PYBA 2C35B 3CQZH 4JG2A 5M5WH 1NY4A 4DR1Q 4POGA 3S2DH 1A8VA 4QY7A 3T1HQ 2OTLA 5H1SE 4B3RQ 3RZDH 5IWAL 3PF5A 2Q2TA 1KRTA 2BA0A 5J3BA 2E2HH 4FDBA 1Q1EA 5IE8A 2HHHQ 3HFZB 2A1AA 1LYLA 1B70B 1X55A 5JEAG 4DR5L 2MO1A 5IYCG 4DUYL 3HOUG 4P72A 4A3CG 2Q2HA 3K8AA 4WJ3M 2N8NA 3ZJYC 1Z9FA 1BBWA 4GNXB 2JA8G 2BA1A 3J80c 1QVGA 3CCJA 1SR3A 4JI2L 1YHBA 2UUAL 1YJ9A 3RLNA 4KHPQ 1VQ7A 3HKSA 2I0QA 4LF5L 1HR0Q 3GTMH 1N32Q 2IX0A 3E9IA 4X66Q 4DV0L 1PH3A 1X3GA 4GLVB 2K75A 1PH4A 2VUMH 1E1OA 1YZ6A 2YTVA 3WWVA 4LF7L 1IL2A 4A93H 2LXKA 4IPHA 4B3TQ 4JI7Q 4YCUA 4IFDI 1OTCA 2ZJQA 1I6HH 5C4XG 3PUYA 3B6YA 2Q2IA 1UE5A 1B8AA 2ALYB 1E7ZA 2IHEA 3HKZG 4TQUS 3J80i 4JI4Q 2JA9A 1VQ9A 1BBUA 4NXMQ 3IRBA 4JI3L 2AWOA 3MXNB 3G71A 4DV4L 1XNQL 2NVQH 3GTPH 3ICEA 3PO2H 3S1MH 4QQBX 4WJ4A 3JC66 4HJ9A 3TS2A 4JI1L 4LFAL 4BY7H 2PNHA 2F3IA 4DV6Q 2OQ0A 4XIGS 2K14A 2A8VA 1QVFA 3S1NH 4YHHQ 4DR5Q 4LF8Q 4BA2I 1GO3E 5JEAJ 1NBWA 1N36Q 2BH8A 4ALPA 3CCUA 3GTJH 4JI8L 4A3MG 3KF6A 3SGIA 4BY1H 3CMAA 4A3DH 4JI2Q 2Y0SE 2UUAQ 3KLWA 1LUZA 2WB1E 1WI5A 3CPWA 4DV3Q 4A3BH 2CCZA 1CKOA 1IBLL 1E3PA 4DV0Q 1OXVA 3J7ZC 3G6EA 1KD1C 3PIOA 4C2MH 3STBD 3CCSA 3KYHC 4DPGA 1KRSA 2YYZA 4OX9L 2I5MX 2VS1A 3UDIA 3A5UA 1X3EA 3I56A 4IPCA 3F1ZA 3CC4A 2NN6G 1S3OA 4LUOA 2OTJA 4JI6L 4OXPA 4DK6C 2E5LQ 4DV5L 3HOUH 3PF4A 1XNQQ 2N49A 2EXDA 5M3MG 3M7NA 3S14H 1FVIA 4JI1Q 2VL6A 4A3GG 3L7ZC 3S15H 2VNUD 1M90C 4X62Q 2D0OA 5C0XG 2AHOB 1A62A 1IBML 4PG3A 3F2BA 1WJJA 2VQFL 1I94Q 1KHIA 3BZKA 4KLKA 5JJLA 3E9HA 4R4IA 1PH7A 3PUVA 2HQLA 4LFBL 3S1RH 1R9TH 4X64L 4JCVE 3TRZA 4GLAC 2WAQE 1WCMG 1VQOA 1CSPA 5LMNW 4DR1L 4TVAB 3PCOB 4XTCS 1P16A 3T1HL 1V1QA 1FGUA 4B3RL 3M4PA 1PH5A 1VS0A 5JJKA 4IOCA 1VQJA 4DV1Q 4DNIA 2UXCL 1Q7YC 4R4OA 2B29A 5FLMH 1D8LA 4GOPA 2D62A 4LNQA 2F4VQ 2JEAI 2UUCQ 3VDYA 3PO2G 4C3HH 1JJ2A 1QUQB 4QL5A 1AE2A 1XPOA 3CCRA 4BY7G 2E8GA 4AYBE 1Q12A 2BH2A 1S72A 4KHPL 2IY5B 2XTIA 3G48A 5HY6A 2QA4A 1KQSA 1N32L 2ATWA 4MTNA 1Q8KA 4X66L 1CSQA 1MKHA 1IZ6A 4GOPC 1YEZA 4OWWB 1IBMQ 2MFIA 4LF6L 1SMXA 2RHQB 3NELA 3MEFA 4R1JA 4OONA 5C0XJ 2VQFQ 1SFOH 4IPDA 2PQAB 4BY1G 3W1BA 3H15A 4B3TL 3EN2A 1X56A 4DV7L 1VQEA 1PH2A 4LFBQ 4JI4L 2MNAA 1PVOA 2R7DA 4X64Q 3UDFA 4HJ8A 3L0OA 4J15A 3ULJA 1Q1BA 5IYBH 2K4KA 3PGZA 2Q2UA 1N8RC 4JBKA 3UDGA 2YTXA 4NXML 2ASBA 1SN8A 4GKKQ 2YV5A 5ELNA 4HIOA 1MJEA 2JEBI 4NB3A 2NVXH 2UXDQ 4Y52H 1JT8A 4BA1I 5IY0A 4DR3Q 4DV6L 1B7YB 2JK8A 5AJ3L 5M5XH 2UXCQ 3KF8B 5IT9c 4LUVA 5M3MH 4YHHL 4LF8L 3GTOH 4LFCQ 1VQIA 4IJHA 1K8GA 1PH1A 3CPFA 4YCVA 1N36L 4A3GH 3PUWA 1Z47A 2VZAA 3M85A 3BJUA 1TWCH 1UE7A 4C3JH 4HIMA 1VQ8A 1EQRA 2GVAA 3CCVA 1N9WA 1K8AC 5ELOA 1HNWL 1RL2A 3A5ZB 4QJFA 1Q81C 4X6AH 4DV3L 1OXUA 2HIVA 1PH9A 2JA7H 4JBWA 4NPSA 3D0FA 2AMCB 2B63G 2R7ZG 1Y14B 1X3FA 1WCMH 4DKAC 1L0WA 4P75A 1PHJA 4YY3Q 4X65Q 3K0XA 1IBKL 4LF6Q 4AQYQ 3OW2A 1VQFA 2ZJRA 4DV7Q 2GVBA 5GQOA 4PZ8A 4DR2L 2ZTEA 1ASZA 1K3RA 2E5LL 3AEVA 3GTKH 1PH6A 1QUQA 2K5VA 2LXJA 3KDFA 4PMWA 3W5OA 4EX5A 5IP9G 3RR5A 3H3VI 5FLMG 2QEXA 3TREA 3PO3G 1N34L 4MNOA 5AJ3Q 4DAYB 1HZCA 5LMNQ 4X62L 4UP7A 1W3SA 4NXNL 3M9BA 4Y7NH 4JBJA 4GOPB 1SROA 3AYHB 4BXXH 1I94L 3NENA 1EYGA 1U0LA 4IJLA 5C4JH 1SRUA 1HZ9A 3LGJA 2PQAA 3RLOA 4DR6Q 2NZOA 2WP8J 3PUZA 2ZJPA 2FXQA 3T1YL 4DUZQ 1HNWQ 3RN2A 1PA6A 1UE1A 2R92H 3BZCA 4GN5A 4ME3A 4OWTB 4P71A 3RLFA 1W2BA 3KJOA 1WFQA 4O0AA 1KL9A 1AE3A 1YI2A 4LF4Q 2UXBL 4HIDA 2IHFA 4LW1A 4DV1L 3CCQA 1Q86C 1IBKQ 1BVSA 2DGYA 2CFMA 2JA6G 2UUBL 4RMFA 5IYBG 5GAEC 3HOZG 3W1GA 1E1TA 2F4VL 1HNZL 2UUCL 2K5NA 2N78A 3GD7A 4DR2Q 4DK3C 4O2DA 5IYDH 4R4TA 1GM5A 4AIMA 1Y1VH 1JE5A 3CC7A 1C0AA 3BU2A 5GAGC 2WFWA 2PMZE 1N34Q 2KCTA 2NVTH 5K36G 2EQSA 4L5RC 4NXNQ 1M1KC 4DR7L 1XMOQ 1IXRA 1CUKA 2B63H 5GAHC 3CP0A 2L15A 1K0RA 3HKZE 4A75A 1Q82C 2N3SA 3CCLA 1A0IA 4YWMA 4LF9Q 1G291 4A3EH 1YITA 1K73C 2JA7G 3T1YQ 4L5TA 1JJCB 3AFQA 2VY3A 3HOXH 4PZ6A 4GKKL 5C3EH 1VQLA 2UXBQ 2UXDL 1UEBA 3FKIH 4K0KQ 1VQHA 1OXTA 4DR3L 3F8TA 3J7A5 1Y1WH 1XPRA 1XJVA 4A76A 5IP9H 3PV0A 1C9OA 2UUBQ 1KXLA 4LFCL 4HJ7A 1EOVA 3AQQA 3PO3H 1FJGQ 1GD7A 2RHSB 5FJ8H 1HNZQ 1VQCA 2R7ZH 4APVA 1ASYA 1KAWA 3TEHB 1D7QA 1X54A 5LMUQ 1V9PA 3KDFB 4A3DG 3H0GG 3NBHB 2KBNA 2MO0A 1SLJA 1VQAA 1X9NA 4BXXG 1VQPA 4UP8A 2B3GA 4L5SA 1QZGA 1EIFA 2RCNA 1E22A 1L1OA 4YY3L 4X65L 4A3KH 3F2CA 1WOCA 4DR7Q 4HIKA 4AH6A 4AQYL 1YJNA 1N33Q 3D31A 3GTLH 2PI2A 4A4IA 3GDEA 1XPUA 2PI2E 1EQQA 5HGQA 2R92G 1PH8A 4GS3A 2JA6H 5BR8L 1GKHA 2QGQA 3AFPA 3TQYA 1EFWA 3HOZH 3GTQH 2HIXA 1AH9A 1L1OC 5C44H 2D0PA 2JJQA 1XMQQ 1O7IA 1YIJA 3K7UC 5LMNL 1PV4A 5M3FG 1A63A 2YTYA 4HJAA 5IP7G 4B3ML 5EAYA 3DM3A 4P73A 4YWLA 4R4CA 5IYDG 3HOWH 3U50C 2K5HA 3RZOH 1Y1VG 4DR6L 3S17H 2YU9H 4C3IH 4IFDG 4P74A 4DUZL 1XTDA 3DLLA 4JI0L 1YBYA 2JE6I 4RG1A 2ID0A 1YHQA 1VQGA 1PYSB 2Y0SG 3KJPA 1IYJB 2E2JH 4LF4L 3I4NG 1SE8A 2WB1G 1VQKA 4JV5L 4OO1I 3K81C 1NMFA 1EUJA 3M4QA 5FLXc 3JAMi 4GKJL 1CKMA 2R6GA 4MZ9A 2NZHA 4A3EG 1VQ4A 4KI0A 3U4ZA 3HOXG 3KOJA 2JA5G 1VCIA 1X6OA 2CKZB 5M5YH 5C3EG 1HNXQ 3CW2C 5BR8Q 3FKIG 1GVPA 3U58A 1Y1WG 2CWPA 3CC2A 4JC0A 1JJGA 4A3LH 1CKNB 4JOIA 1G51A 1P8LA 4YWKA 3RN5A 3I55A 3E0EA 2CWAA 1TWFH 1YJWA 5FJ8G 3H0GH 2OWOA 4DR4Q 3ULPA 3CXCA 1XMOL 4B3MQ 1J5EL 1HH2P 4BBRH 1S40A 4JI5Q 2KENA 2JQOA 4BBSH 4JOIC 4YCWA 4LF9L 4JYAQ 1OXSC 3OYYA 1VQDA 3I2ZA 2VQEQ 2R93G 1NJIC 4JI0Q 4IFDJ 3S1QH 2WAQG 4QIWE 4A3KG 1KC8C 3A0JA 3EBEA 3EIVA 3HOYH 3ERSX 4H02A 4JV5Q 1L1OB 2K52A 1BKBA 5DLQE 4K0KL 3RNUA 5IWAQ 1WYDA 1LM0A 4GKJQ 1VQMA 4GN3B 4DV2L 3KFUA 3F2DA 4DAMA 4A3IG 1C7YA 4DUYQ 1FJGL 2UU9L 3CD6A 3PUXA 5M3FH 2NVYH 3HOVG 4GN4B 1X65A 5IP7H 5C44G 2ZM6L 5LMUL 4A3JH 4QGUA 2AKWB 2Z6KA 3S2HH 4A3FH 3U4VA 4AYBG 5GROA 2A19A 3TS0A 1YNXA 4B3SL 4LF5Q 3HOWG 4IO9A 4UP9A 3I4MG 1VQBA 3ER0A 2ES2A 1V43A 3J81j 1VQNA 2IX1A 1J5EQ 1QVCA 4LUZA 5E7NA 3GTGH 3I4NH 1N33L 1NMGA 2I5LX 3A74A 4HJ5A 4POFA 4LF7Q 3K7AH 2Z6KC 2IT1A 4R4QA 3H3VH 3K80C 1HR0W 1JMCA 2GN5A 2H5XA 1L2FA 5IYCH 2JA5H 4A3CH 1T9HA 2I5HA 2XGTA 4GNXA 4JI3Q 4GLXA 4PZ7A 4LWCA 4DV4Q 2JA8H 1XMQL 1CKNA 4OO1G 4LFAQ 1VQ5A 1E24A 1NE3A 4DV2Q 3FP9A 2NN6I 4EQ5A
chains in the Genus database with same CATH superfamily
3STBC 4Y7NB 4IPGA 4QUFA 4GNXC 3CF5A 3J81c 2EYHA 4OWXB 4CKCA 3UE0A 1U4MA 5I6YA 5CV9A 4BY1B 4HN7A 1GUSA 1S5DD 2VUMG 1G6PA 1ZYRD 4KHZA 2HHHL 1TKWB 3PIP3 3PIPA 2ZTCA 3CCEA 2MPMA 3CAMA 4IUPA 1K3BC 1TWHH 1HNXL 1IYUA 2IW3A 4CKBA 1Q46A 4DA2A 2B2YA 2OQKA 4HCSA 1WTWA 3NBIA 5I9PA 5EJWA 4DR4L 4OELB 1Y1VB 3L3OC 4A3JG 2XRQD 5DAUA 2Q8IB 5JJIA 1B9NA 5C3WA 1AW7A 2ZTDA 4IOAA 3UDXA 1MIUA 4K14A 4QMGA 1JOQA 1UE6A 4KTAA 1K9MC 4JYAL 2E2IH 4A3BG 4RCOA 4PNYA 5CORA 3K6OA 5G3LD 3CQZH 4DR1Q 4POGA 1A8VA 4RH6A 1WTOA 3T1HQ 2SDFA 3PF5A 3RZDH 1KDBA 1KRTA 1GHJA 1Q1EA 5IE8A 2HHHQ 2A1AA 1LYLA 1SYDA 1X55A 2NB0A 5JEAG 2H4OA 2K05A 2N8NA 2BA1A 1STEA 3TP8A 3CCJA 4JI2L 4KN7C 5CV8A 2UUAL 2F0IA 3RLNA 3R93A 3GTMH 4LF5L 1ZEQX 4KK7A 1HCZA 1STGA 2K75A 2LXKA 4B3TQ 1CHQD 1SNQA 4OGQC 2F0JA 1B8AA 5JJZA 2F0HA 2L1BA 1STYA 1EY5A 1VQ9A 4F7XA 3IRBA 2JA6B 3H09A 3MXNB 4QQBX 2EYMA 4WJ4A 1C8CA 4TRDA 2PNHA 1TU2B 2F0GA 3JAME 3EVQA 5C44B 4YHHQ 4BA2I 4LF8Q 5C6AA 2BH8A 2Q8TA 1A15A 4BY1H 4A3DH 2IPKD 4JI2Q 2RSOA 3HS0C 2UUAQ 4C3IB 2WB1E 3CPWA 1KLUD 4RHRA 3J7ZC 3NWTA 3PIO3 3PIOA 4C2MH 3STBD 4OX9L 1SDFA 1STAA 2I5MX 1SE2A 4JI6L 3HOUH 3PF4A 2L4NA 1TS2A 2PZWA 2XSCA 2PW7A 3MAQA 1B2TA 5M3MG 2KQ3A 1Q8IA 2VXWA 3GV6A 1CT1D 1LV9A 1M90C 4X62Q 4TKOB 2AHOB 1A62A 1IBML 1DOMA 4C3JG 1WTRA 2ICIA 3VA5A 1I94Q 5JJLA 3C1FA 3PUVA 1O7YA 2QDLA 3ITPA 4GLAC 2F0KA 1QB5D 1VQOA 3QOJA 1P16A 1V1QA 1FGUA 2F0VA 3SK4A 4B3RL 3M4PA 1PH5A 2ZXPA 3HOYB 1VS0A 5JJKA 1VQJA 3T16A 4FF2A 1RJTA 5FLMH 5LHY1 1R4QB 2D62A 3NTHA 1VF7A 4C3HH 1JJ2A 1QUQB 3FRPB 2E8GA 4AYBE 1Q12A 1UAPA 2NVYB 2IY5B 1I6VC 5L37A 4KHPL 1CQFA 3G48A 2G5DA 2V4DA 1KQSA 1N32L 1Q8KA 3NUCA 4X66L 1SNDA 1SMYD 1LT3D 2SEBD 1IBMQ 4LF6L 5C0XJ 4R1JA 1SFOH 4OEMB 4IPDA 4BY1G 1SE3A 1PVOA 2R7DA 1KAAA 3K5OA 4J15A 1DYQA 1Q1BA 5IYBH 4FYDA 1HTPA 1N8RC 2YTXA 5ELNA 2NVXH 4XYQA 4NB3A 2JA5B 4BA1I 5IY0A 3VYSA 4M8AA 3KF8B 4LFCQ 3NE5B 1K8GA 3VR5A 1VMPA 3BJUA 3C2PA 1UE7A 3OMGA 1EQRA 2GVAA 2PMZB 3MA2B 1K83B 1DOLA 2AMCB 1Y14B 1WCMH 4DKAC 4DNTB 4YY3Q 4X65Q 4LF6Q 4DK0A 3HGBA 2LY7A 1I4QA 2EZVA 1ASZA 3AEVA 1DOKA 2C9OA 2DN8A 2K5VA 4EX5A 4A3IB 3RR5A 1TQOA 5FLMG 2QEXA 1A3UA 1N34L 5FO8B 1G2TA 1BF4A 1SROA 2WINB 1EYGA 4IJLA 3IFTA 5C4JH 1I3QB 3LGJA 2PQAA 3HOWB 5EBDA 1A3VA 3I4MB 5ELCA 1PA6A 2MGSA 3BZCA 4LF4Q 5CGKA 3U9SA 1IW7C 4LW1A 1BVSA 5IT9E 5E3FA 2JA6G 1LTGD 4H13C 5IYBG 2E2HB 5IIFA 3WOEA 1IYVA 1O7ZA 5C3XA 1F9RA 2EJFC 1I4XA 2RBMA 4IQZA 1B1ZA 3EFXD 1B53A 4ILWA 1N34Q 2KCTA 3GP7A 1AEXA 1XMOQ 4C3IG 1IXRA 5IODA 3NXWA 2B63H 2K28A 4CDDC 4K5XA 1ML0D 4HTHA 1S5CD 4PV1C 1A0IA 4YWMA 4A93B 1G291 1YITA 1NNXA 4H0LC 2VY3A 2FHTA 4QUCA 4GKKL 4IUQA 5T1IA 1VQHA 4G7OC 3F8TA 3J7A5 2NVQB 1HQMC 1XPRA 3PO2B 1XJVA 1M8AA 4RAUC 3S1MB 2L12A 4DAYA 4HMJA 5FJ8H 4Q5VA 1VQCA 1CK1A 1KAWA 1EL0A 1D7QA 1X54A 3KDFB 3GTJB 2G9HD 3NBHB 2EPBA 1G2SA 4JK1C 3A54A 1QZGA 5EBCA 1MSGA 3KLSA 4B9WA 4A3KH 2EYLA 2QKIC 3D31A 2PI2A 1RKNA 1B3QA 2LKVA 2RKSA 1PTOF 1EQQA 5HGQA 1EWCA 1PH8A 1WTXA 1L0YB 1CTMA 1FNUA 1F9SA 2HIXA 4K2LA 1L1OC 1LT5D 2D0PA 1XMQQ 2NBFA 1BOSA 2KUMA 5LMNL 4RKLA 4R8NA 1A63A 2YTYA 1RCVD 2EJGC 4R4CA 5K36H 1PDQA 3HOWH 5IGBA 3U50C 2K5HA 4O42A 1D5ZC 1D6EC 2ZT9C 2K01A 4XDXA 4P74A 4DUZL 1R9TB 1YBYA 4RG1A 1YHQA 2E2JH 1HFGA 1IYJB 4JV5L 1SE8A 5LL6X 3M4QA 1PFBA 2K03A 2B2VA 3TP5A 4DK1A 3BDCA 2EXZA 1CQVA 2AQ3B 3V96A 3J7AF 1GXDC 1LTTD 2JA5G 1I4PA 3R3OA 1RD9D 2EJMA 1PFNA 4A3LH 3A56A 3EJIA 2CWAA 4L6TB 5FJ8G 4R8IA 2JSOA 1LT6D 3KBXA 2IWHA 4CDEC 5TSSA 4BBRH 1S40A 4JI5Q 2KENA 5JAVA 4BBSH 3ERQA 4KD4A 3PQIA 4IUTA 1ET6A 1LABA 3OYYA 2VQEQ 2F0WA 4NDXA 1RTNA 3T51B 4A3KG 2DNEA 1KC8C 3ERSX 4JV5Q 1EQTA 2IL8A 2Z4HA 1WYDA 1VQMA 1K8MA 3F2DA 3CRKC 1GUNA 1LTAD 2JXMB 4A3IG 3G7LA 3PUXA 3GTOB 4XQJA 5IP7H 2XRSD 5LMUL 5ELEA 2RQXA 4DN4M 4KKSA 4CBVA 4HSPA 3U4VA 5HGTA 1F77A 5GROA 1G91A 4K6LA 3HOWG 4IO9A 4UP9A 5FLXE 3I4MG 1QVCA 4LUZA 3GTGH 1G6ZA 4HJ5A 5FO7B 2E76C 4R4QA 2PPBC 1L2FA 3D6WA 4KJOA 4CHTB 4GNXA 2XGTA 1ESRA 2XN9C 4ZK9B 3MEHA 1SJED 2B39A 3FP9A 1HZAA 2F0LA 4A3LG 1UWVA 2PNRC 3NEMA 1EZ8A 4RWSC 3PMFA 2NTTA 5CC4A 1HJPA 3TMEA 1VMCA 1JC7A 1PZKD 1TWAH 1V1PA 4A93G 2AWNA 1U5KA 4K6DA 4BBRG 2R93H 4JBMA 3S16H 1MJCA 4BBSG 1NSNS 1H9JA 3A55A 1EWIA 1SNOA 1QZHA 3D4DA 3M4OH 2VB3X 1I50H 3HOVH 3CKIB 1ICWA 4LK1C 1HR0L 4B08A 2KCNA 5J22A 5GADC 3JAMc 1NTGA 2BE5C 3D8GA 4OIKA 4UY8C 1TXYA 1GHKA 1OXXK 1PFSA 3ND9A 2VW9A 2E2DC 3FDTA 1TWGH 3SXHA 3S1RB 1FGBD 5EPKA 2KHSA 4CGYB 2WIIB 3HOXB 5J3BA 4DR5L 1JWMD 4N8FA 4FF1A 5A2QL 3K8AA 4OL7A 5CMDA 2FINB 1Y69U 1Z9FA 3SDZA 1II3A 2R7ZB 1SR3A 2J0TD 1HR0Q 1HUMA 3J7AV 4KHVA 4X3UA 2Z6BA 4GLVB 3IKJA 2VUMH 2YTVA 1U4PA 3K57A 3C1EA 1I6HH 3AU7A 4IURA 4WORA 2ALYB 1E7ZA 3I72A 3GTLB 2CQAA 3K59A 2QF7A 4NXMQ 3P7JA 4JI3L 3G71A 3ICEA 4DV4L 3HOZB 3JC66 4HJ9A 3TS2A 4JI1L 5C4ZA 2F3IA 1BBXC 4DV6Q 4XIGS 2BCOA 2A8VA 4DR5Q 3IAYA 1RDPD 2CVRA 4C1NI 2PQEA 1N36Q 4ALPA 2X6GA 3CCUA 1D1KA 4DFAA 1WTQA 2A68C 3CMAA 3RZOB 4HMIA 3S17B 1A6XA 1LUZA 5KGUA 1WI5A 4A3BH 2CCZA 2EYOA 3A8JE 1CKOA 1T5EA 1ILPA 4J1MA 1R4PB 4LMQD 4IN3A 1EEID 1AZQA 3WDNA 1EWHA 1U9RA 2SNMA 1EY7A 2VS1A 3AB9A 3A5UA 1HUNA 3I56A 2NN6G 1S3OA 4LUOA 4J8QA 2E5LQ 4KKUA 4G57A 3M7NA 3S14H 1A2UA 4UHVA 4JI1Q 1PYWD 2VL6A 3L7ZC 3S15H 1A2TA 5CBAE 5C0XG 3MHBA 3F2BA 3H0GB 2PCFB 4DU9A 4KLKA 4RGMA 5E1FA 2HQLA 4NW2A 3S1RH 1HPCA 2G9DA 4KV6A 4ZUJA 1CSPA 4DR1L 4XTCS 3EQLC 3T1HL 1EIHA 3SE0A 2BE5D 4FO2A 4DNIA 1Q7YC 3NHHA 4R4OA 2UUCQ 1HRJA 3VDYA 4OIJA 2L0CA 1AE2A 1HA5A 4K5WA 2L9HA 1RF2D 3CCRA 5M3FB 5HY6A 5E4WC 2QA4A 4MTNA 2CW0D 1YEZA 1BNZA 3E3XA 4OONA 2PQAB 3H15A 4B3TL 3EN2A 1X56A 4DV7L 1AP0A 3I4NB 3UDFA 3TSSA 3ULJA 4JW0A 3K7AB 1D5MC 1SAPA 2Q2UA 4JBKA 4A3EB 2CH4W 1MJEA 1JT8A 3V05A 2D5DA 1NAPA 3JAML 5IGDA 4YIJA 5AJ3L 1SMYC 2A6EC 4LJZC 2JA8B 5IT9c 4YHHL 5M3MH 4LF8L 3CPFA 4YCVA 2N55A 1WTHA 1Z47A 3M85A 1MHWC 1C4QA 4C3JH 4F87A 3TP7A 3Q23A 2SOBA 1BCPB 4QJFA 4ZUIA 1Q81C 4X6AH 1OXUA 2FFKB 2HIVA 4NPSA 5C4HA 3D0FA 1S4ZA 5KNBA 1X3FA 5C4XB 1L0WA 3I70A 3OW2A 4HEDA 2ZJRA 3M3YB 4DV7Q 2GVBA 2A68D 5M9OA 1SYGA 1O78A 3W2DA 2ZTEA 4DR2L 1NR4A 1K3RA 1BUVT 2F0PA 2P5ZX 1DD2A 3TREA 4MNOA 5AJ3Q 1KNAA 4DAYB 1VQ5A 4X62L 4Y7NH 4NXNL 4GOPB 2R7ZG 3AYHB 4BXXH 1I94L 2O4XA 3KK7A 1LACA 2ZJPA 2X6LA 3T1YL 2YU9B 3RN2A 4OWTB 3RLFA 1W2BA 1YI2A 4O0AA 1KL9A 1AE3A 2UXBL 3I3CA 1PTOB 5KYIA 3SR1A 3S2DB 1F2LA 2O5IC 2UUBL 3HOZG 3TN2A 3RD4A 3GD7A 4DR2Q 2JYOA 4ZRZA 4O2DA 1JR0D 2ICEC 1GM5A 4AIMA 1Y1VH 1JE5A 1C0AA 4DNRB 3MFYA 2EQSA 1H9SB 4L5RC 3VR4A 4NXNQ 4KY7A 4ZKBB 1B50A 4XXEA 2PO4A 1HFNA 2L15A 1AN8A 1Q82C 2N3SA 2PZUA 3CCLA 3CRLC 4ZYSA 3K58A 4A3EH 1FD7D 3HP3A 3T1YQ 2F0MA 1EYAA 3MTSA 4PZ6A 1KTKA 2UXBQ 1UEBA 2A74C 2K7VA 3GTPB 2UUBQ 2L5TA 4LFCL 3J81L 1RTOA 2RHSB 3S1NB 1TS3A 1W6KA 3TEHB 4RHSA 5ELBA 4BWGB 3H0GG 1CM9A 1Y8OB 1SLJA 4BXXG 1VQPA 4A3FB 4UP8A 2A6ED 4Q0FA 5NUCA 1E22A 4YY3L 1L1OA 4X65L 4AH6A 1N33Q 1YNJD 1FR3A 4FNFA 4DAVA 4A4IA 1EY6A 1MI2A 3J7YW 4GS3A 1Y8PB 4QIWB 2JA6H 3RUZA 3AFPA 1PFMA 3TQYA 1EFWA 2XVSA 2WKCA 3MFGA 5J39A 1AH9A 2PW5A 5C44H 4K5VA 1O7IA 3K7UC 2NWGA 1IKMA 1SYBA 5M3FG 2K04A 4G4KA 3DEPA 1Y1VG 1K28A 2XWJB 2OT2A 2YU9H 4C3IH 1XTDA 4JI0L 4JPBW 1PTOH 2B8GA 2JE6I 2ID0A 3NK9A 3RMHA 4LF4L 1KLGD 3I4NG 1BQQT 3K81C 1NMFA 1EUJA 5FLXc 1CKMA 2R6GA 4A3EG 2KEDA 4KI0A 1X6OA 2CKZB 3QG1A 3CW2C 1BR9A 1GVPA 2CWPA 3NSWA 3CC2A 3QIAA 3D4RA 4U68A 4YWKA 3QJYA 3CXCA 1XMOL 1SSOA 2BDOA 2JQOA 4UDUC 4YCWA 1PRTB 1SYFA 1NJIC 1V1PB 1EY4A 3VR6A 4JI0Q 4IFDJ 4PQXA 3HOYH 3U9OA 1SNMA 4H02A 1JB3A 2K52A 1BKBA 2RVLA 3RNUA 5IWAQ 4GN3B 3TDQA 4DV2L 3KFUA 2VB2X 4DAMA 3CD6A 3SEBA 4DUYQ 5M5XB 3OMCA 2NVYH 4GN4B 5C44G 3LX0A 2ZM6L 4HSVA 4A3GB 1CZGA 3BG3A 2HQEA 1Q3LA 4KY5A 4A3FH 1TWCB 1T5XD 1GOZA 2A19A 3TS0A 1YNXA 3SHLA 2QDBA 4WRDA 1MD2D 2K5DA 5IGEA 4DXGA 1Z7TA 2ES2A 5ELFA 1V43A 1BCPF 5E4XA 4BS9A 3QWNA 1NMGA 3A74A 4LF7Q 3QOLA 2Z6KC 3D6CA 2NTSA 3H3VH 2H5XA 3KLRA 5IYCH 4X3SA 2JA5H 4LWCA 3DMUA 1XMQL 4LFAQ 1NE3A 4DV2Q 2RDHA 2I46A 3FPPA 4BY7B 1LTLA 3UE1A 1XNRL 4QCLA 4JI8Q 5EQ0A 1K83H 2ZM6Q 3G4SA 4F8MA 1RIPA 4XQQA 2OCEA 1KNEA 1IBLQ 1JOOA 3I4OA 2R92B 3EROA 4L5QA 2F52A 3Q8DA 4IUNA 2D9UA 2KHJA 3P20A 1XWEA 3HOYG 2NYZD 1AZPA 1VQ6A 1SJHD 4A3IH 3ULLA 4DV5Q 1I5FA 1XYIA 4NKLA 3SVMA 3ZYYX 3CCMA 3S24A 2B2TC 2CQOA 1I3QH 2NVTB 3BVZA 4EQNA 3PSIA 1XNRQ 1IL8A 5AFWA 4JI5L 1LTSD 4A3FG 4JI7L 3I4MH 4G7HC 2IJ0A 1LTRD 2KCMA 1JB7A 2WB1B 2VQEL 1EIYB 2RF4A 2B2WC 1JOKA 2K50A 1BXTA 1FL0A 1PYBA 2C35B 4JG2A 1CFMA 2Q2TA 2BA0A 2E2HH 5C3EB 4X3TA 3HFZB 4I7ZC 3FKIB 3BVMA 5ELDA 4L8JA 5IYCG 1Y1WB 4P72A 4WJ3M 2Q2HA 3T56B 3PO3B 1QVGA 1SBBB 1H9MA 1E2ZA 3NPPA 3HKSA 5FLXL 4V0BA 5DM73 2I0QA 3I91A 1HQRD 1K0SA 2IX0A 4DV0L 1X3GA 1LLRD 1PH4A 4A93H 1YZ6A 3WWVA 4ODGA 4IPHA 4JI7Q 3C46A 4YCUA 1OTCA 1YNNC 3PUYA 3B6YA 2Q2IA 4XT3B 4JI4Q 3J80i 4OHJA 2JA9A 3VR2A 2TSSA 1LO5D 1TS4A 5FKAC 1XNQL 2NVQH 3PO2H 3S1MH 4IUUA 3GTQB 4BY7H 4G7ZC 2OQ0A 5KRUA 1GO3E 1UUPA 3GTJH 3KF6A 4WFN3 3SGIA 4OO1H 2OXPA 4FXKC 3OW7A 1CA6A 4KKTA 3KLWA 4DV3Q 1RODA 4DV0Q 1OXVA 2EDGA 2JA7B 3CCSA 1KRSA 2O2LD 3KF8A 5IGFA 1X3EA 4MHEA 4IPCA 3F1ZA 4K2KA 4RFBA 4OXPA 3J80E 2EYJA 4DK6C 2DY8A 4H44C 1XNQQ 2N49A 1IKLA 3A7AB 3GTKB 5C5LA 4A3GG 1SYEA 2D0OA 2DJFC 1TWFB 2Q8RE 1WJJA 2VQFL 2CH4A 3BZKA 3E9HA 4R4IA 1R9TH 1NCVA 4X64L 4JCVE 1TT2A 4EQPA 3TRZA 4KY6A 3V2TA 5LMNW 1FYCA 4TVAB 1PRTF 1JCKB 5CV7A 1KDCA 1QNUA 3S1QB 1NR2A 4IOCA 4DV1Q 2UXCL 5T1GA 5CV4A 2KCCA 4FF4A 2F4VQ 2E74C 2RDFA 3PO2G 4K8IA 3ND8A 4TSSA 3Q22A 2AQ2B 4BY7G 1EZ6A 1ICFB 5EKIA 4A3JB 2BH2A 2XTIA 2BDNA 3OPOA 1MKHA 4DXFA 4GOPC 5ISRA 1DXMA 3OSOA 2XWBB 2MFIA 2AUJD 2RHQB 3NELA 4OO1G 2VQFQ 5I9OA 1VQEA 1PH2A 4WJWA 1PZJD 2Y0SB 4X64Q 2F0NA 3PGZA 4NXML 4KN4C 3UDGA 1SN8A 2NN6H 2JEBI 2RDGA 1PTOC 2UXDQ 4Y52H 1U4RA 4ZQ3A 4DR3Q 2CW0C 1O7LA 2FMMA 4DV6L 2UXCQ 3OWEB 4LUVA 3GTOH 1QNKA 1VQIA 1YNND 2WV6D 1N36L 2XIWA 3PUWA 5C0XH 2KEEA 4HIMA 1VQ8A 1HNWL 2K6AA 1FNWA 4P2CB 1PH9A 2JA7H 2SNSA 4JBWA 3E6ZX 1DZ1A 1SXTA 4AQYQ 1V1OA 1HHVA 2WAQB 4J6HA 2F03A 1ONLA 2E5LL 3GTKH 1TWHB 3Q6SA 1PH6A 4ULLA 1EU4A 4PMWA 3KDFA 5IP9G 3H3VI 3PO3G 3K5LA 4NMZA 2QCPX 1V8QA 4UP7A 3NQTA 3M9BA 4FF3A 4CDFC 1U0LA 1HZ9A 3RLOA 4DR6Q 2NZOA 3SK8A 1Y8NB 2WP8J 2C5CA 1HNWQ 3LWEA 1UE1A 4QB4A 4GN5A 4ME3A 3KJOA 2IHFA 3O13A 4F88A 3CQZB 4ABNA 1G8ZD 1Q86C 2QEJC 2DGYA 2I07B 3SK5A 3RZDB 3OOCA 5KIXA 1E1TA 2HDMA 1HNZL 2UUCL 3KBGA 4FXDA 4DK3C 1BCPD 5A2QE 3H3VC 5IYDH 2E75C 2F0QA 3BU2A 4EQOA 5GAGC 2PMZE 3NTIA 4IFDH 1M1KC 4I65A 2NUCA 4DR7L 3GTMB 4CKEA 4XT1B 1CUKA 4RGNA 3H6MA 5I2XA 2B2UC 2HCIA 2F0FA 4LF9Q 2JA7G 2LFNA 1JJCB 5CYUA 2R3ZA 3HOXH 1JWUD 1VQLA 2HUGA 1E2VA 4K0KQ 1B9MA 1DCZA 2K33A 4L63B 3DWQA 1STBA 5C5MA 5A35A 3PV0A 2J7ZA 1KXLA 4C56C 4HJ7A 1EOVA 1L0XB 4NP5A 4IALA 1HNZQ 1FJGQ 1MGSA 1J8IA 2R7ZH 4APVA 5EPLA 1MBYA 4XYOA 3R8BA 4HR7B 2KBNA 1PTOD 1VQAA 2EE1A 3S2HB 4A3DB 4N9TA 4RCNA 2B3GA 4L5SA 5IGCA 1EIFA 4DR7Q 2OF1A 1WVLA 1UNSA 1WOCA 4HIKA 5COYA 1YJNA 3K0YA 3GTLH 3GDEA 4C2MB 1PRTC 1XPUA 1H9RA 4MN3A 2H1EA 5KNDA 3HOZH 2GA4B 3HOUB 2JJQA 1YIJA 4KMUC 4I7AA 3L9AX 4PMCA 2CHBD 1PV4A 4HJAA 1W6JA 5EAYA 3DM3A 2Z8LA 2A6HC 3VYTA 5IYDG 2F0UA 1YNJC 3RZOH 3ONAB 3VA7A 3S17H 2D2CC 1D5XC 4V190 3FPUB 5I2YA 4IFDG 2FMCA 3DLLA 2RCFA 1GUGA 4LAAA 5F2DA 4PMBA 1PYSB 2Y0SG 3KJPA 4OO1I 1DM0B 3M4YA 4RGTA 3JAMi 4MTKA 3HKZB 2NZHA 1VQ4A 3U4ZA 3HOXG 3KOJA 1UEAB 1Z6HA 3LWUA 1HNXQ 1X3PA 5EPJA 3U58A 4C3HB 1P8LA 3E0EA 5IOCA 2M00A 3H0GH 3D3RA 4DR4Q 2FJ2A 1X32A 4QF4A 4A3MB 1Q90A 1J5EL 2PZTA 1HH2P 3FEWX 4CJ0B 4ZLTF 3EA6A 4JOIC 1SFOB 3OWFA 4JYAQ 2QW7A 2WAQG 4ME5A 3OIPA 2Z4IA 1ESFA 5M5WB 4C1NK 4MIUA 4RA8A 2NVXB 4Z9CB 3DUZA 1C7YA 2UU9L 1S5ED 2ZXOA 5M3FH 1EYDA 4R9WA 3W3AA 2F0TA 2AKWB 2Z6KA 3S2HH 3GQBA 3TZDA 1MSHA 4KD3A 4B3SL 4LF5Q 1RHPA 3MC0B 3ER0A 5D65A 3T4AC 1VQNA 1J5EQ 3NP8A 5E7NA 3HG9A 4RGOS 3I4NH 1N33L 2I5LX 1WCMB 3X3MA 4POFA 3K7AH 1LT4D 5D14A 1E2WA 2HDLA 2WACA 1JMCA 2XNAC 1PXUA 4GZYC 3Q24A 4A3CH 2I5HA 4GLXA 1H9KA 1ENCA 1QOHA 3F2UA 2JA8H 1CKNA 4ZCKA 1HTLD 1B44D 2NN6I 5JVH3 1CHPD 3VYUA 5K5PA 2UU9Q 1PRTD 1EYCA 1TY2A 4DAPA 3I73A 5C4JB 1BO0A 5BN5A 3OTOL 4U673 5D3IB 5C4XH 1HZBA 2F3WA 5C0XI 1C48A 4N9PA 4B3SQ 3CMEA 3VR3A 1SNCA 2ENBA 3M3YH 3FMCA 3GO5A 1STHA 4UPAA 2V1CC 2A6HD 2DUDA 2MQHA 3MVVA 4ZAIA 3J81i 4OX9Q 2B2TA 3I7FA 1YVCA 2KHIA 1VF5C 2R7FA 1O80A 4JI6Q 1QG7A 5LL6S 2K5WA 2LSSA 2Z0SA 3LNNA 5BN3A 3FHWA 2JN4A 2EYFA 4A3MH 4FP5D 2B2WA 1S5BD 1H95A 5KYLA 3L2PA 3OIQA 1J6QA 1YHAA 4S3SA 3C3LA 4A3DG 3KF6B 2B2YC 1KIXA 2OEOA 3QO2A 2B63B 2EY6A 3OTOQ 1EY9A 1QJOA 2HT1A 2EIFA 1DGSA 5M5WH 1FNVA 1NY4A 3S2DH 4QY7A 4HAEA 4B9XA 5JVG3 2OTLA 5IT9L 5H1SE 4B3RQ 5IWAL 1KABA 4FDBA 1B70B 1GJXA 3BYTB 2MO1A 5EKLA 4DUYL 3HOUG 4K8JA 4A3CG 3E0JA 3ZJYC 3MZ5A 4ID6A 1BBWA 3I90A 3J81E 3T53B 4GNXB 2JA8G 3J80c 3QR8A 5JPMC 1KDAA 1CZWA 1S5FD 1YHBA 1YJ9A 4KHPQ 3BYYB 1VQ7A 1N32Q 1QE6A 3E9IA 4X66Q 2F0SA 1PH3A 1GUWA 1ENFA 1E1OA 3TZUA 1WD0A 2F0EA 3NQIA 4LF7L 1HXYD 2AQ1B 1IL2A 1X3QA 4IFDI 2ZJQA 5C4XG 4A3KB 1UE5A 2IHEA 3HKZG 4TQUS 3HRZC 5KEEA 1VDZA 1BBUA 3E5SA 2AWOA 3D4WA 3GTPH 2F1MA 4LFAL 2K14A 4C3HG 1QVFA 3S1NH 1QILA 2EY5A 5JEAJ 1NBWA 1F9QA 1EEFD 4JI8L 4A3MG 1SNPA 2MP1A 3NTKA 5I6WA 5CBEE 2Y0SE 1IBLL 1E3PA 4CDCC 3G6EA 2KA7A 2EYPA 1KD1C 2LS01 2E2JB 5DM63 2EY2A 3KYHC 4DPGA 5FOBB 2YYZA 5EGTA 3UDIA 2EOTA 4EGVA 3CC4A 2OTJA 3KLSX 1JE4A 1TR5A 5DNFA 4DV5L 1AFPA 2EXDA 1FVIA 3P1HA 2VNUD 1QWYA 3FVQA 4PG3A 2O5JC 3WOFA 1KHIA 2DJGC 1PH7A 1I4HA 4LFBL 3H94A 3I8ZA 1EY0A 2N88A 1ENAA 4BBRB 2WAQE 1WCMG 4BBSB 2RSNA 1EIGA 3PCOB 2M9VA 3MXNA 2EY1A 1U4LA 3K5NA 3DWPA 2B29A 3IFDA 1D8LA 4GOPA 2JEAI 4LNQA 2R61A 3A8KE 4QL5A 1XPOA 2JP1A 4DF7A 1STNA 1S72A 3BDOA 1SEBD 4JVZA 2ATWA 1IHZA 3Q0AA 1JWSD 1F9PA 1CSQA 1TY0A 1IZ6A 4ZKCB 1D1IA 4OWWB 1SMXA 3MEFA 3W1BA 1TIID 2A69C 4LFBQ 4JI4L 2MNAA 3GTGB 5FO9B 4HJ8A 3L0OA 5CR3A 2K4KA 2ASBA 4GKKQ 2YV5A 4HIOA 1B7YB 2JK8A 4DGZA 5M5XH 1NUCA 1I4GA 1H9SA 3MXPA 4IJHA 5G3LF 1PH1A 4A3GH 2WKDA 3H91A 2DY7A 2VZAA 1QCBD 1TWCH 3BZDB 3CCVA 1N9WA 1K8AC 5ELOA 1RL2A 3A5ZB 3CHBD 4DV3L 2B63G 1EOTA 1TWAB 4P75A 4CJ1B 1ZKOA 1PHJA 1F2YA 1BDOA 3K0XA 1IBKL 2R93B 1VQFA 1EY8A 3S16B 3J80L 4UAIA 5GQOA 4PZ8A 1F2ZA 1QUQA 2LXJA 3W5OA 1WTVA 4H7BA 3M4OB 1IW7D 1I50B 3HOVB 1SE4A 5HURA 1HZCA 5LMNQ 1WTPA 1W3SA 4JBJA 5IGGA 4M1UB 3NENA 4AYBB 3K5MA 1SRUA 3R2IA 1JQYD 4O1NA 3PUZA 2FXQA 4DUZQ 4XQNA 2R92H 4P71A 1TWGB 3BVGA 1WFQA 1J9OA 2HD3A 4HIDA 1ILQA 3MXUA 3HEJA 3CCQA 3R2TA 4DV1L 1IBKQ 3I4LA 2CFMA 2F3VA 2MHVA 4RMFA 5GAEC 1E0BA 3W1GA 1ET9A 2F4VL 2F0OA 2K5NA 2N78A 1B3AA 2KECA 5M5YB 3AMUA 3S9WA 2B2UA 4R4TA 3A8IE 3CC7A 2WFWA 4HCEA 1DONA 5CV6A 2NVTH 5K36G 3DEOA 2ZXRA 4KJNA 1PZID 3MXGA 2F0DA 1JICA 5GAHC 3CP0A 5FK9C 3T13A 1K0RA 3HKZE 4A75A 1ZXTA 3DHQA 2VUMB 5BN4A 2MJ8A 1K73C 1I6HB 1BCPC 4L5TA 3AFQA 1I4RA 2F4IA 3P75A 5C3EH 1F2MA 2KJXA 2UXDL 1EQVA 3FKIH 1OXTA 3N52A 4DR3L 1Y1WH 2PYKA 4A76A 5IP9H 2J4XA 1C9OA 2A69D 3DXJC 5D3DA 3AQQA 3PO3H 1GD7A 4IZ8A 2X69A 4RKBA 1ASYA 4X3KA 5LMUQ 1V9PA 1JORA 2MO0A 3UI2A 2K32A 3HZXA 1X9NA 1LTID 2K1BA 4A3BB 2RCNA 3F2CA 4AQYL 1XXGA 2AUKA 4E6IA 5CV5A 2R92G 5JOBA 2PI2E 5EKKA 5BR8L 1CA5A 1GKHA 2QGQA 3GTQH 1DJRD 3IL8A 1K8OA 3URYA 1ZYRC 2M2LA 3S14B 5IP7G 4B3ML 4P73A 4YWLA 2L55A 1M4VA 2HCCA 3S15B 3DM1A 1A3TA 4FVMA 4DR6L 1PLFA 4FXGC 3GV3A 5I4DA 3CU7A 2A5HA 1VQGA 5DEHA 1PMRA 2WB1G 1VQKA 3MWYW 4GKJL 1TS5A 4MZ9A 1WD1A 3X3NA 3M7GA 1VCIA 5M5YH 5C3EG 2L11A 3VYRA 1LTBD 3FKIG 3NWSA 5BR8Q 2NZ1D 1Y1WG 1OO9B 2B2VC 4JC0A 1JJGA 1CKNB 4JOIA 1G51A 3BS1A 1XX8A 2KOLA 3NBHA 4CJ2C 1GUTA 3I55A 3RN5A 1TWFH 4EVOA 1YJWA 2OWOA 5JPNC 3ULPA 4B3MQ 3KUPA 2KVMA 2B8FA 4N8X1 3N6RA 3QB3A 4LF9L 1OXSC 2A73B 3A7LA 1VQDA 3I2ZA 2R93G 2E2IB 3S1QH 4QIWE 3A0JA 3EBEA 3EIVA 1L1OB 5DLQE 1XTCD 4K0KL 4GKJQ 1LM0A 3DWAA 2RA4A 4IUVA 1HA6A 1FJGL 2BOSA 1GUOA 5M3MB 3HOVG 4A3JH 1X65A 3OHXC 4QGUA 1TVXA 3BDLA 3TBIB 2K5QA 2QILA 4AYBG 4C3JB 1EU3A 2MUYA 1SYCA 2Z9HA 1VQBA 2IX3A 3J81j 1D2BA 2IX1A 2Z1CA 2TMPA 3SK6A 2LMCB 3G6JB 2IT1A 3TP6A 3K80C 1HR0W 5JEAH 2GN5A 1T9HA 2EVBA 5J1ZA 5KNCA 4JI3Q 4PZ7A 4DV4Q 1EFID 1CI3M 1E24A 1B4OA 2DNCA 4EQ5A
chains in the Genus database with same CATH topology
1HZAA 1LTLA 2UU9Q 3UE1A 3STBC 1XNRL 4IPGA 4A3LG 4GNXC 1UWVA 3NEMA 4JI8Q 3J81c 1K83H 2ZM6Q 3G4SA 3CF5A 4OWXB 3UE0A 1HJPA 1RIPA 3OTOL 5C4XH 1HZBA 5C0XI 1TWAH 2OCEA 3CMEA 4B3SQ 2VUMG 4A93G 2AWNA 1U5KA 2R93H 4BBRG 1IBLQ 1G6PA 3I4OA 4JBMA 4KHZA 3M3YH 3S16H 4L5QA 1MJCA 2F52A 3GO5A 3Q8DA 4UPAA 2HHHL 2V1CC 2DUDA 2MQHA 3PIPA 4BBSG 2ZTCA 3CCEA 2KHJA 3J81i 4OX9Q 3CAMA 1EWIA 3I7FA 3HOYG 1TWHH 1YVCA 2KHIA 1HNXL 1VQ6A 2R7FA 1QZHA 4JI6Q 4A3IH 1Q46A 3M4OH 3ULLA 4DV5Q 1I50H 1I5FA 2LSSA 2Z0SA 2OQKA 3HOVH 3FHWA 4A3MH 3CCMA 1HR0L 4DR4L 3S24A 2CQOA 5GADC 3JAMc 1I3QH 1NTGA 3L2PA 4A3JG 4UY8C 1TXYA 1H95A 5JJIA 1J6QA 2ZTDA 1YHAA 4IOAA 3PSIA 3UDXA 1MIUA 3KF6B 4JI5L 4A3FG 1UE6A 1OXXK 4JI7L 1XNRQ 1PFSA 1K9MC 1KIXA 3I4MH 4JYAL 2VW9A 2E2IH 4A3BG 2KCMA 1JB7A 2VQEL 1TWGH 1EIYB 3OTOQ 2HT1A 2EIFA 2RF4A 2K50A 1DGSA 1FL0A 1PYBA 2C35B 3CQZH 4JG2A 5M5WH 1NY4A 4DR1Q 4POGA 3S2DH 1A8VA 4QY7A 3T1HQ 2OTLA 5H1SE 4B3RQ 3RZDH 5IWAL 3PF5A 2Q2TA 1KRTA 2BA0A 5J3BA 2E2HH 4FDBA 1Q1EA 5IE8A 2HHHQ 3HFZB 2A1AA 1LYLA 1B70B 1X55A 5JEAG 4DR5L 2MO1A 5IYCG 4DUYL 3HOUG 4P72A 4A3CG 2Q2HA 3K8AA 4WJ3M 2N8NA 3ZJYC 1Z9FA 1BBWA 4GNXB 2JA8G 2BA1A 3J80c 1QVGA 3CCJA 1SR3A 4JI2L 1YHBA 2UUAL 1YJ9A 3RLNA 4KHPQ 1VQ7A 3HKSA 2I0QA 4LF5L 1HR0Q 3GTMH 1N32Q 2IX0A 3E9IA 4X66Q 4DV0L 1PH3A 1X3GA 4GLVB 2K75A 1PH4A 2VUMH 1E1OA 1YZ6A 2YTVA 3WWVA 4LF7L 1IL2A 4A93H 2LXKA 4IPHA 4B3TQ 4JI7Q 4YCUA 4IFDI 1OTCA 2ZJQA 1I6HH 5C4XG 3PUYA 3B6YA 2Q2IA 1UE5A 1B8AA 2ALYB 1E7ZA 2IHEA 3HKZG 4TQUS 3J80i 4JI4Q 2JA9A 1VQ9A 1BBUA 4NXMQ 3IRBA 4JI3L 2AWOA 3MXNB 3G71A 4DV4L 1XNQL 2NVQH 3GTPH 3ICEA 3PO2H 3S1MH 4QQBX 4WJ4A 3JC66 4HJ9A 3TS2A 4JI1L 4LFAL 4BY7H 2PNHA 2F3IA 4DV6Q 2OQ0A 4XIGS 2K14A 2A8VA 1QVFA 3S1NH 4YHHQ 4DR5Q 4LF8Q 4BA2I 1GO3E 5JEAJ 1NBWA 1N36Q 2BH8A 4ALPA 3CCUA 3GTJH 4JI8L 4A3MG 3KF6A 3SGIA 4BY1H 3CMAA 4A3DH 4JI2Q 2Y0SE 2UUAQ 3KLWA 1LUZA 2WB1E 1WI5A 3CPWA 4DV3Q 4A3BH 2CCZA 1CKOA 1IBLL 1E3PA 4DV0Q 1OXVA 3J7ZC 3G6EA 1KD1C 3PIOA 4C2MH 3STBD 3CCSA 3KYHC 4DPGA 1KRSA 2YYZA 4OX9L 2I5MX 2VS1A 3UDIA 3A5UA 1X3EA 3I56A 4IPCA 3F1ZA 3CC4A 2NN6G 1S3OA 4LUOA 2OTJA 4JI6L 4OXPA 4DK6C 2E5LQ 4DV5L 3HOUH 3PF4A 1XNQQ 2N49A 2EXDA 5M3MG 3M7NA 3S14H 1FVIA 4JI1Q 2VL6A 4A3GG 3L7ZC 3S15H 2VNUD 1M90C 4X62Q 2D0OA 5C0XG 2AHOB 1A62A 1IBML 4PG3A 3F2BA 1WJJA 2VQFL 1I94Q 1KHIA 3BZKA 4KLKA 5JJLA 3E9HA 4R4IA 1PH7A 3PUVA 2HQLA 4LFBL 3S1RH 1R9TH 4X64L 4JCVE 3TRZA 4GLAC 2WAQE 1WCMG 1VQOA 1CSPA 5LMNW 4DR1L 4TVAB 3PCOB 4XTCS 1P16A 3T1HL 1V1QA 1FGUA 4B3RL 3M4PA 1PH5A 1VS0A 5JJKA 4IOCA 1VQJA 4DV1Q 4DNIA 2UXCL 1Q7YC 4R4OA 2B29A 5FLMH 1D8LA 4GOPA 2D62A 4LNQA 2F4VQ 2JEAI 2UUCQ 3VDYA 3PO2G 4C3HH 1JJ2A 1QUQB 4QL5A 1AE2A 1XPOA 3CCRA 4BY7G 2E8GA 4AYBE 1Q12A 2BH2A 1S72A 4KHPL 2IY5B 2XTIA 3G48A 5HY6A 2QA4A 1KQSA 1N32L 2ATWA 4MTNA 1Q8KA 4X66L 1CSQA 1MKHA 1IZ6A 4GOPC 1YEZA 4OWWB 1IBMQ 2MFIA 4LF6L 1SMXA 2RHQB 3NELA 3MEFA 4R1JA 4OONA 5C0XJ 2VQFQ 1SFOH 4IPDA 2PQAB 4BY1G 3W1BA 3H15A 4B3TL 3EN2A 1X56A 4DV7L 1VQEA 1PH2A 4LFBQ 4JI4L 2MNAA 1PVOA 2R7DA 4X64Q 3UDFA 4HJ8A 3L0OA 4J15A 3ULJA 1Q1BA 5IYBH 2K4KA 3PGZA 2Q2UA 1N8RC 4JBKA 3UDGA 2YTXA 4NXML 2ASBA 1SN8A 4GKKQ 2YV5A 5ELNA 4HIOA 1MJEA 2JEBI 4NB3A 2NVXH 2UXDQ 4Y52H 1JT8A 4BA1I 5IY0A 4DR3Q 4DV6L 1B7YB 2JK8A 5AJ3L 5M5XH 2UXCQ 3KF8B 5IT9c 4LUVA 5M3MH 4YHHL 4LF8L 3GTOH 4LFCQ 1VQIA 4IJHA 1K8GA 1PH1A 3CPFA 4YCVA 1N36L 4A3GH 3PUWA 1Z47A 2VZAA 3M85A 3BJUA 1TWCH 1UE7A 4C3JH 4HIMA 1VQ8A 1EQRA 2GVAA 3CCVA 1N9WA 1K8AC 5ELOA 1HNWL 1RL2A 3A5ZB 4QJFA 1Q81C 4X6AH 4DV3L 1OXUA 2HIVA 1PH9A 2JA7H 4JBWA 4NPSA 3D0FA 2AMCB 2B63G 2R7ZG 1Y14B 1X3FA 1WCMH 4DKAC 1L0WA 4P75A 1PHJA 4YY3Q 4X65Q 3K0XA 1IBKL 4LF6Q 4AQYQ 3OW2A 1VQFA 2ZJRA 4DV7Q 2GVBA 5GQOA 4PZ8A 4DR2L 2ZTEA 1ASZA 1K3RA 2E5LL 3AEVA 3GTKH 1PH6A 1QUQA 2K5VA 2LXJA 3KDFA 4PMWA 3W5OA 4EX5A 5IP9G 3RR5A 3H3VI 5FLMG 2QEXA 3TREA 3PO3G 1N34L 4MNOA 5AJ3Q 4DAYB 1HZCA 5LMNQ 4X62L 4UP7A 1W3SA 4NXNL 3M9BA 4Y7NH 4JBJA 4GOPB 1SROA 3AYHB 4BXXH 1I94L 3NENA 1EYGA 1U0LA 4IJLA 5C4JH 1SRUA 1HZ9A 3LGJA 2PQAA 3RLOA 4DR6Q 2NZOA 2WP8J 3PUZA 2ZJPA 2FXQA 3T1YL 4DUZQ 1HNWQ 3RN2A 1PA6A 1UE1A 2R92H 3BZCA 4GN5A 4ME3A 4OWTB 4P71A 3RLFA 1W2BA 3KJOA 1WFQA 4O0AA 1KL9A 1AE3A 1YI2A 4LF4Q 2UXBL 4HIDA 2IHFA 4LW1A 4DV1L 3CCQA 1Q86C 1IBKQ 1BVSA 2DGYA 2CFMA 2JA6G 2UUBL 4RMFA 5IYBG 5GAEC 3HOZG 3W1GA 1E1TA 2F4VL 1HNZL 2UUCL 2K5NA 2N78A 3GD7A 4DR2Q 4DK3C 4O2DA 5IYDH 4R4TA 1GM5A 4AIMA 1Y1VH 1JE5A 3CC7A 1C0AA 3BU2A 5GAGC 2WFWA 2PMZE 1N34Q 2KCTA 2NVTH 5K36G 2EQSA 4L5RC 4NXNQ 1M1KC 4DR7L 1XMOQ 1IXRA 1CUKA 2B63H 5GAHC 3CP0A 2L15A 1K0RA 3HKZE 4A75A 1Q82C 2N3SA 3CCLA 1A0IA 4YWMA 4LF9Q 1G291 4A3EH 1YITA 1K73C 2JA7G 3T1YQ 4L5TA 1JJCB 3AFQA 2VY3A 3HOXH 4PZ6A 4GKKL 5C3EH 1VQLA 2UXBQ 2UXDL 1UEBA 3FKIH 4K0KQ 1VQHA 1OXTA 4DR3L 3F8TA 3J7A5 1Y1WH 1XPRA 1XJVA 4A76A 5IP9H 3PV0A 1C9OA 2UUBQ 1KXLA 4LFCL 4HJ7A 1EOVA 3AQQA 3PO3H 1FJGQ 1GD7A 2RHSB 5FJ8H 1HNZQ 1VQCA 2R7ZH 4APVA 1ASYA 1KAWA 3TEHB 1D7QA 1X54A 5LMUQ 1V9PA 3KDFB 4A3DG 3H0GG 3NBHB 2KBNA 2MO0A 1SLJA 1VQAA 1X9NA 4BXXG 1VQPA 4UP8A 2B3GA 4L5SA 1QZGA 1EIFA 2RCNA 1E22A 1L1OA 4YY3L 4X65L 4A3KH 3F2CA 1WOCA 4DR7Q 4HIKA 4AH6A 4AQYL 1YJNA 1N33Q 3D31A 3GTLH 2PI2A 4A4IA 3GDEA 1XPUA 2PI2E 1EQQA 5HGQA 2R92G 1PH8A 4GS3A 2JA6H 5BR8L 1GKHA 2QGQA 3AFPA 3TQYA 1EFWA 3HOZH 3GTQH 2HIXA 1AH9A 1L1OC 5C44H 2D0PA 2JJQA 1XMQQ 1O7IA 1YIJA 3K7UC 5LMNL 1PV4A 5M3FG 1A63A 2YTYA 4HJAA 5IP7G 4B3ML 5EAYA 3DM3A 4P73A 4YWLA 4R4CA 5IYDG 3HOWH 3U50C 2K5HA 3RZOH 1Y1VG 4DR6L 3S17H 2YU9H 4C3IH 4IFDG 4P74A 4DUZL 1XTDA 3DLLA 4JI0L 1YBYA 2JE6I 4RG1A 2ID0A 1YHQA 1VQGA 1PYSB 2Y0SG 3KJPA 1IYJB 2E2JH 4LF4L 3I4NG 1SE8A 2WB1G 1VQKA 4JV5L 4OO1I 3K81C 1NMFA 1EUJA 3M4QA 5FLXc 3JAMi 4GKJL 1CKMA 2R6GA 4MZ9A 2NZHA 4A3EG 1VQ4A 4KI0A 3U4ZA 3HOXG 3KOJA 2JA5G 1VCIA 1X6OA 2CKZB 5M5YH 5C3EG 1HNXQ 3CW2C 5BR8Q 3FKIG 1GVPA 3U58A 1Y1WG 2CWPA 3CC2A 4JC0A 1JJGA 4A3LH 1CKNB 4JOIA 1G51A 1P8LA 4YWKA 3RN5A 3I55A 3E0EA 2CWAA 1TWFH 1YJWA 5FJ8G 3H0GH 2OWOA 4DR4Q 3ULPA 3CXCA 1XMOL 4B3MQ 1J5EL 1HH2P 4BBRH 1S40A 4JI5Q 2KENA 2JQOA 4BBSH 4JOIC 4YCWA 4LF9L 4JYAQ 1OXSC 3OYYA 1VQDA 3I2ZA 2VQEQ 2R93G 1NJIC 4JI0Q 4IFDJ 3S1QH 2WAQG 4QIWE 4A3KG 1KC8C 3A0JA 3EBEA 3EIVA 3HOYH 3ERSX 4H02A 4JV5Q 1L1OB 2K52A 1BKBA 5DLQE 4K0KL 3RNUA 5IWAQ 1WYDA 1LM0A 4GKJQ 1VQMA 4GN3B 4DV2L 3KFUA 3F2DA 4DAMA 4A3IG 1C7YA 4DUYQ 1FJGL 2UU9L 3CD6A 3PUXA 5M3FH 2NVYH 3HOVG 4GN4B 1X65A 5IP7H 5C44G 2ZM6L 5LMUL 4A3JH 4QGUA 2AKWB 2Z6KA 3S2HH 4A3FH 3U4VA 4AYBG 5GROA 2A19A 3TS0A 1YNXA 4B3SL 4LF5Q 3HOWG 4IO9A 4UP9A 3I4MG 1VQBA 3ER0A 2ES2A 1V43A 3J81j 1VQNA 2IX1A 1J5EQ 1QVCA 4LUZA 5E7NA 3GTGH 3I4NH 1N33L 1NMGA 2I5LX 3A74A 4HJ5A 4POFA 4LF7Q 3K7AH 2Z6KC 2IT1A 4R4QA 3H3VH 3K80C 1HR0W 1JMCA 2GN5A 2H5XA 1L2FA 5IYCH 2JA5H 4A3CH 1T9HA 2I5HA 2XGTA 4GNXA 4JI3Q 4GLXA 4PZ7A 4LWCA 4DV4Q 2JA8H 1XMQL 1CKNA 4OO1G 4LFAQ 1VQ5A 1E24A 1NE3A 4DV2Q 3FP9A 2NN6I 4EQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HZA A;  1LTL A;  2UU9 Q;  3UE1 A;  3STB C;  1XNR L;  4IPG A;  4A3L G;  4GNX C;  1UWV A;  3NEM A;  4JI8 Q;  3J81 c;  1K83 H;  2ZM6 Q;  3G4S A;  3CF5 A;  4OWX B;  3UE0 A;  1HJP A;  1RIP A;  3OTO L;  5C4X H;  1HZB A;  5C0X I;  1TWA H;  2OCE A;  3CME A;  4B3S Q;  2VUM G;  4A93 G;  2AWN A;  1U5K A;  2R93 H;  4BBR G;  1IBL Q;  1G6P A;  3I4O A;  4JBM A;  4KHZ A;  3M3Y H;  3S16 H;  4L5Q A;  1MJC A;  2F52 A;  3GO5 A;  3Q8D A;  4UPA A;  2HHH L;  2V1C C;  2DUD A;  2MQH A;  3PIP A;  4BBS G;  2ZTC A;  3CCE A;  2KHJ A;  3J81 i;  4OX9 Q;  3CAM A;  1EWI A;  3I7F A;  3HOY G;  1TWH H;  1YVC A;  2KHI A;  1HNX L;  1VQ6 A;  2R7F A;  1QZH A;  4JI6 Q;  4A3I H;  1Q46 A;  3M4O H;  3ULL A;  4DV5 Q;  1I50 H;  1I5F A;  2LSS A;  2Z0S A;  2OQK A;  3HOV H;  3FHW A;  4A3M H;  3CCM A;  1HR0 L;  4DR4 L;  3S24 A;  2CQO A;  5GAD C;  3JAM c;  1I3Q H;  1NTG A;  3L2P A;  4A3J G;  4UY8 C;  1TXY A;  1H95 A;  5JJI A;  1J6Q A;  2ZTD A;  1YHA A;  4IOA A;  3PSI A;  3UDX A;  1MIU A;  3KF6 B;  4JI5 L;  4A3F G;  1UE6 A;  1OXX K;  4JI7 L;  1XNR Q;  1PFS A;  1K9M C;  1KIX A;  3I4M H;  4JYA L;  2VW9 A;  2E2I H;  4A3B G;  2KCM A;  1JB7 A;  2VQE L;  1TWG H;  1EIY B;  3OTO Q;  2HT1 A;  2EIF A;  2RF4 A;  2K50 A;  1DGS A;  1FL0 A;  1PYB A;  2C35 B;  3CQZ H;  4JG2 A;  5M5W H;  1NY4 A;  4DR1 Q;  4POG A;  3S2D H;  1A8V A;  4QY7 A;  3T1H Q;  2OTL A;  5H1S E;  4B3R Q;  3RZD H;  5IWA L;  3PF5 A;  2Q2T A;  1KRT A;  2BA0 A;  5J3B A;  2E2H H;  4FDB A;  1Q1E A;  5IE8 A;  2HHH Q;  3HFZ B;  2A1A A;  1LYL A;  1B70 B;  1X55 A;  5JEA G;  4DR5 L;  2MO1 A;  5IYC G;  4DUY L;  3HOU G;  4P72 A;  4A3C G;  2Q2H A;  3K8A A;  4WJ3 M;  2N8N A;  3ZJY C;  1Z9F A;  1BBW A;  4GNX B;  2JA8 G;  2BA1 A;  3J80 c;  1QVG A;  3CCJ A;  1SR3 A;  4JI2 L;  1YHB A;  2UUA L;  1YJ9 A;  3RLN A;  4KHP Q;  1VQ7 A;  3HKS A;  2I0Q A;  4LF5 L;  1HR0 Q;  3GTM H;  1N32 Q;  2IX0 A;  3E9I A;  4X66 Q;  4DV0 L;  1PH3 A;  1X3G A;  4GLV B;  2K75 A;  1PH4 A;  2VUM H;  1E1O A;  1YZ6 A;  2YTV A;  3WWV A;  4LF7 L;  1IL2 A;  4A93 H;  2LXK A;  4IPH A;  4B3T Q;  4JI7 Q;  4YCU A;  4IFD I;  1OTC A;  2ZJQ A;  1I6H H;  5C4X G;  3PUY A;  3B6Y A;  2Q2I A;  1UE5 A;  1B8A A;  2ALY B;  1E7Z A;  2IHE A;  3HKZ G;  4TQU S;  3J80 i;  4JI4 Q;  2JA9 A;  1VQ9 A;  1BBU A;  4NXM Q;  3IRB A;  4JI3 L;  2AWO A;  3MXN B;  3G71 A;  4DV4 L;  1XNQ L;  2NVQ H;  3GTP H;  3ICE A;  3PO2 H;  3S1M H;  4QQB X;  4WJ4 A;  3JC6 6;  4HJ9 A;  3TS2 A;  4JI1 L;  4LFA L;  4BY7 H;  2PNH A;  2F3I A;  4DV6 Q;  2OQ0 A;  4XIG S;  2K14 A;  2A8V A;  1QVF A;  3S1N H;  4YHH Q;  4DR5 Q;  4LF8 Q;  4BA2 I;  1GO3 E;  5JEA J;  1NBW A;  1N36 Q;  2BH8 A;  4ALP A;  3CCU A;  3GTJ H;  4JI8 L;  4A3M G;  3KF6 A;  3SGI A;  4BY1 H;  3CMA A;  4A3D H;  4JI2 Q;  2Y0S E;  2UUA Q;  3KLW A;  1LUZ A;  2WB1 E;  1WI5 A;  3CPW A;  4DV3 Q;  4A3B H;  2CCZ A;  1CKO A;  1IBL L;  1E3P A;  4DV0 Q;  1OXV A;  3J7Z C;  3G6E A;  1KD1 C;  3PIO A;  4C2M H;  3STB D;  3CCS A;  3KYH C;  4DPG A;  1KRS A;  2YYZ A;  4OX9 L;  2I5M X;  2VS1 A;  3UDI A;  3A5U A;  1X3E A;  3I56 A;  4IPC A;  3F1Z A;  3CC4 A;  2NN6 G;  1S3O A;  4LUO A;  2OTJ A;  4JI6 L;  4OXP A;  4DK6 C;  2E5L Q;  4DV5 L;  3HOU H;  3PF4 A;  1XNQ Q;  2N49 A;  2EXD A;  5M3M G;  3M7N A;  3S14 H;  1FVI A;  4JI1 Q;  2VL6 A;  4A3G G;  3L7Z C;  3S15 H;  2VNU D;  1M90 C;  4X62 Q;  2D0O A;  5C0X G;  2AHO B;  1A62 A;  1IBM L;  4PG3 A;  3F2B A;  1WJJ A;  2VQF L;  1I94 Q;  1KHI A;  3BZK A;  4KLK A;  5JJL A;  3E9H A;  4R4I A;  1PH7 A;  3PUV A;  2HQL A;  4LFB L;  3S1R H;  1R9T H;  4X64 L;  4JCV E;  3TRZ A;  4GLA C;  2WAQ E;  1WCM G;  1VQO A;  1CSP A;  5LMN W;  4DR1 L;  4TVA B;  3PCO B;  4XTC S;  1P16 A;  3T1H L;  1V1Q A;  1FGU A;  4B3R L;  3M4P A;  1PH5 A;  1VS0 A;  5JJK A;  4IOC A;  1VQJ A;  4DV1 Q;  4DNI A;  2UXC L;  1Q7Y C;  4R4O A;  2B29 A;  5FLM H;  1D8L A;  4GOP A;  2D62 A;  4LNQ A;  2F4V Q;  2JEA I;  2UUC Q;  3VDY A;  3PO2 G;  4C3H H;  1JJ2 A;  1QUQ B;  4QL5 A;  1AE2 A;  1XPO A;  3CCR A;  4BY7 G;  2E8G A;  4AYB E;  1Q12 A;  2BH2 A;  1S72 A;  4KHP L;  2IY5 B;  2XTI A;  3G48 A;  5HY6 A;  2QA4 A;  1KQS A;  1N32 L;  2ATW A;  4MTN A;  1Q8K A;  4X66 L;  1CSQ A;  1MKH A;  1IZ6 A;  4GOP C;  1YEZ A;  4OWW B;  1IBM Q;  2MFI A;  4LF6 L;  1SMX A;  2RHQ B;  3NEL A;  3MEF A;  4R1J A;  4OON A;  5C0X J;  2VQF Q;  1SFO H;  4IPD A;  2PQA B;  4BY1 G;  3W1B A;  3H15 A;  4B3T L;  3EN2 A;  1X56 A;  4DV7 L;  1VQE A;  1PH2 A;  4LFB Q;  4JI4 L;  2MNA A;  1PVO A;  2R7D A;  4X64 Q;  3UDF A;  4HJ8 A;  3L0O A;  4J15 A;  3ULJ A;  1Q1B A;  5IYB H;  2K4K A;  3PGZ A;  2Q2U A;  1N8R C;  4JBK A;  3UDG A;  2YTX A;  4NXM L;  2ASB A;  1SN8 A;  4GKK Q;  2YV5 A;  5ELN A;  4HIO A;  1MJE A;  2JEB I;  4NB3 A;  2NVX H;  2UXD Q;  4Y52 H;  1JT8 A;  4BA1 I;  5IY0 A;  4DR3 Q;  4DV6 L;  1B7Y B;  2JK8 A;  5AJ3 L;  5M5X H;  2UXC Q;  3KF8 B;  5IT9 c;  4LUV A;  5M3M H;  4YHH L;  4LF8 L;  3GTO H;  4LFC Q;  1VQI A;  4IJH A;  1K8G A;  1PH1 A;  3CPF A;  4YCV A;  1N36 L;  4A3G H;  3PUW A;  1Z47 A;  2VZA A;  3M85 A;  3BJU A;  1TWC H;  1UE7 A;  4C3J H;  4HIM A;  1VQ8 A;  1EQR A;  2GVA A;  3CCV A;  1N9W A;  1K8A C;  5ELO A;  1HNW L;  1RL2 A;  3A5Z B;  4QJF A;  1Q81 C;  4X6A H;  4DV3 L;  1OXU A;  2HIV A;  1PH9 A;  2JA7 H;  4JBW A;  4NPS A;  3D0F A;  2AMC B;  2B63 G;  2R7Z G;  1Y14 B;  1X3F A;  1WCM H;  4DKA C;  1L0W A;  4P75 A;  1PHJ A;  4YY3 Q;  4X65 Q;  3K0X A;  1IBK L;  4LF6 Q;  4AQY Q;  3OW2 A;  1VQF A;  2ZJR A;  4DV7 Q;  2GVB A;  5GQO A;  4PZ8 A;  4DR2 L;  2ZTE A;  1ASZ A;  1K3R A;  2E5L L;  3AEV A;  3GTK H;  1PH6 A;  1QUQ A;  2K5V A;  2LXJ A;  3KDF A;  4PMW A;  3W5O A;  4EX5 A;  5IP9 G;  3RR5 A;  3H3V I;  5FLM G;  2QEX A;  3TRE A;  3PO3 G;  1N34 L;  4MNO A;  5AJ3 Q;  4DAY B;  1HZC A;  5LMN Q;  4X62 L;  4UP7 A;  1W3S A;  4NXN L;  3M9B A;  4Y7N H;  4JBJ A;  4GOP B;  1SRO A;  3AYH B;  4BXX H;  1I94 L;  3NEN A;  1EYG A;  1U0L A;  4IJL A;  5C4J H;  1SRU A;  1HZ9 A;  3LGJ A;  2PQA A;  3RLO A;  4DR6 Q;  2NZO A;  2WP8 J;  3PUZ A;  2ZJP A;  2FXQ A;  3T1Y L;  4DUZ Q;  1HNW Q;  3RN2 A;  1PA6 A;  1UE1 A;  2R92 H;  3BZC A;  4GN5 A;  4ME3 A;  4OWT B;  4P71 A;  3RLF A;  1W2B A;  3KJO A;  1WFQ A;  4O0A A;  1KL9 A;  1AE3 A;  1YI2 A;  4LF4 Q;  2UXB L;  4HID A;  2IHF A;  4LW1 A;  4DV1 L;  3CCQ A;  1Q86 C;  1IBK Q;  1BVS A;  2DGY A;  2CFM A;  2JA6 G;  2UUB L;  4RMF A;  5IYB G;  5GAE C;  3HOZ G;  3W1G A;  1E1T A;  2F4V L;  1HNZ L;  2UUC L;  2K5N A;  2N78 A;  3GD7 A;  4DR2 Q;  4DK3 C;  4O2D A;  5IYD H;  4R4T A;  1GM5 A;  4AIM A;  1Y1V H;  1JE5 A;  3CC7 A;  1C0A A;  3BU2 A;  5GAG C;  2WFW A;  2PMZ E;  1N34 Q;  2KCT A;  2NVT H;  5K36 G;  2EQS A;  4L5R C;  4NXN Q;  1M1K C;  4DR7 L;  1XMO Q;  1IXR A;  1CUK A;  2B63 H;  5GAH C;  3CP0 A;  2L15 A;  1K0R A;  3HKZ E;  4A75 A;  1Q82 C;  2N3S A;  3CCL A;  1A0I A;  4YWM A;  4LF9 Q;  1G29 1;  4A3E H;  1YIT A;  1K73 C;  2JA7 G;  3T1Y Q;  4L5T A;  1JJC B;  3AFQ A;  2VY3 A;  3HOX H;  4PZ6 A;  4GKK L;  5C3E H;  1VQL A;  2UXB Q;  2UXD L;  1UEB A;  3FKI H;  4K0K Q;  1VQH A;  1OXT A;  4DR3 L;  3F8T A;  3J7A 5;  1Y1W H;  1XPR A;  1XJV A;  4A76 A;  5IP9 H;  3PV0 A;  1C9O A;  2UUB Q;  1KXL A;  4LFC L;  4HJ7 A;  1EOV A;  3AQQ A;  3PO3 H;  1FJG Q;  1GD7 A;  2RHS B;  5FJ8 H;  1HNZ Q;  1VQC A;  2R7Z H;  4APV A;  1ASY A;  1KAW A;  3TEH B;  1D7Q A;  1X54 A;  5LMU Q;  1V9P A;  3KDF B;  4A3D G;  3H0G G;  3NBH B;  2KBN A;  2MO0 A;  1SLJ A;  1VQA A;  1X9N A;  4BXX G;  1VQP A;  4UP8 A;  2B3G A;  4L5S A;  1QZG A;  1EIF A;  2RCN A;  1E22 A;  1L1O A;  4YY3 L;  4X65 L;  4A3K H;  3F2C A;  1WOC A;  4DR7 Q;  4HIK A;  4AH6 A;  4AQY L;  1YJN A;  1N33 Q;  3D31 A;  3GTL H;  2PI2 A;  4A4I A;  3GDE A;  1XPU A;  2PI2 E;  1EQQ A;  5HGQ A;  2R92 G;  1PH8 A;  4GS3 A;  2JA6 H;  5BR8 L;  1GKH A;  2QGQ A;  3AFP A;  3TQY A;  1EFW A;  3HOZ H;  3GTQ H;  2HIX A;  1AH9 A;  1L1O C;  5C44 H;  2D0P A;  2JJQ A;  1XMQ Q;  1O7I A;  1YIJ A;  3K7U C;  5LMN L;  1PV4 A;  5M3F G;  1A63 A;  2YTY A;  4HJA A;  5IP7 G;  4B3M L;  5EAY A;  3DM3 A;  4P73 A;  4YWL A;  4R4C A;  5IYD G;  3HOW H;  3U50 C;  2K5H A;  3RZO H;  1Y1V G;  4DR6 L;  3S17 H;  2YU9 H;  4C3I H;  4IFD G;  4P74 A;  4DUZ L;  1XTD A;  3DLL A;  4JI0 L;  1YBY A;  2JE6 I;  4RG1 A;  2ID0 A;  1YHQ A;  1VQG A;  1PYS B;  2Y0S G;  3KJP A;  1IYJ B;  2E2J H;  4LF4 L;  3I4N G;  1SE8 A;  2WB1 G;  1VQK A;  4JV5 L;  4OO1 I;  3K81 C;  1NMF A;  1EUJ A;  3M4Q A;  5FLX c;  3JAM i;  4GKJ L;  1CKM A;  2R6G A;  4MZ9 A;  2NZH A;  4A3E G;  1VQ4 A;  4KI0 A;  3U4Z A;  3HOX G;  3KOJ A;  2JA5 G;  1VCI A;  1X6O A;  2CKZ B;  5M5Y H;  5C3E G;  1HNX Q;  3CW2 C;  5BR8 Q;  3FKI G;  1GVP A;  3U58 A;  1Y1W G;  2CWP A;  3CC2 A;  4JC0 A;  1JJG A;  4A3L H;  1CKN B;  4JOI A;  1G51 A;  1P8L A;  4YWK A;  3RN5 A;  3I55 A;  3E0E A;  2CWA A;  1TWF H;  1YJW A;  5FJ8 G;  3H0G H;  2OWO A;  4DR4 Q;  3ULP A;  3CXC A;  1XMO L;  4B3M Q;  1J5E L;  1HH2 P;  4BBR H;  1S40 A;  4JI5 Q;  2KEN A;  2JQO A;  4BBS H;  4JOI C;  4YCW A;  4LF9 L;  4JYA Q;  1OXS C;  3OYY A;  1VQD A;  3I2Z A;  2VQE Q;  2R93 G;  1NJI C;  4JI0 Q;  4IFD J;  3S1Q H;  2WAQ G;  4QIW E;  4A3K G;  1KC8 C;  3A0J A;  3EBE A;  3EIV A;  3HOY H;  3ERS X;  4H02 A;  4JV5 Q;  1L1O B;  2K52 A;  1BKB A;  5DLQ E;  4K0K L;  3RNU A;  5IWA Q;  1WYD A;  1LM0 A;  4GKJ Q;  1VQM A;  4GN3 B;  4DV2 L;  3KFU A;  3F2D A;  4DAM A;  4A3I G;  1C7Y A;  4DUY Q;  1FJG L;  2UU9 L;  3CD6 A;  3PUX A;  5M3F H;  2NVY H;  3HOV G;  4GN4 B;  1X65 A;  5IP7 H;  5C44 G;  2ZM6 L;  5LMU L;  4A3J H;  4QGU A;  2AKW B;  2Z6K A;  3S2H H;  4A3F H;  3U4V A;  4AYB G;  5GRO A;  2A19 A;  3TS0 A;  1YNX A;  4B3S L;  4LF5 Q;  3HOW G;  4IO9 A;  4UP9 A;  3I4M G;  1VQB A;  3ER0 A;  2ES2 A;  1V43 A;  3J81 j;  1VQN A;  2IX1 A;  1J5E Q;  1QVC A;  4LUZ A;  5E7N A;  3GTG H;  3I4N H;  1N33 L;  1NMG A;  2I5L X;  3A74 A;  4HJ5 A;  4POF A;  4LF7 Q;  3K7A H;  2Z6K C;  2IT1 A;  4R4Q A;  3H3V H;  3K80 C;  1HR0 W;  1JMC A;  2GN5 A;  2H5X A;  1L2F A;  5IYC H;  2JA5 H;  4A3C H;  1T9H A;  2I5H A;  2XGT A;  4GNX A;  4JI3 Q;  4GLX A;  4PZ7 A;  4LWC A;  4DV4 Q;  2JA8 H;  1XMQ L;  1CKN A;  4OO1 G;  4LFA Q;  1VQ5 A;  1E24 A;  1NE3 A;  4DV2 Q;  3FP9 A;  2NN6 I;  4EQ5 A; 
#chains in the Genus database with same CATH topology
 3STB C;  4Y7N B;  4IPG A;  4QUF A;  4GNX C;  3CF5 A;  3J81 c;  2EYH A;  4OWX B;  4CKC A;  3UE0 A;  1U4M A;  5I6Y A;  5CV9 A;  4BY1 B;  4HN7 A;  1GUS A;  1S5D D;  2VUM G;  1G6P A;  1ZYR D;  4KHZ A;  2HHH L;  1TKW B;  3PIP 3;  3PIP A;  2ZTC A;  3CCE A;  2MPM A;  3CAM A;  4IUP A;  1K3B C;  1TWH H;  1HNX L;  1IYU A;  2IW3 A;  4CKB A;  1Q46 A;  4DA2 A;  2B2Y A;  2OQK A;  4HCS A;  1WTW A;  3NBI A;  5I9P A;  5EJW A;  4DR4 L;  4OEL B;  1Y1V B;  3L3O C;  4A3J G;  2XRQ D;  5DAU A;  2Q8I B;  5JJI A;  1B9N A;  5C3W A;  1AW7 A;  2ZTD A;  4IOA A;  3UDX A;  1MIU A;  4K14 A;  4QMG A;  1JOQ A;  1UE6 A;  4KTA A;  1K9M C;  4JYA L;  2E2I H;  4A3B G;  4RCO A;  4PNY A;  5COR A;  3K6O A;  5G3L D;  3CQZ H;  4DR1 Q;  4POG A;  1A8V A;  4RH6 A;  1WTO A;  3T1H Q;  2SDF A;  3PF5 A;  3RZD H;  1KDB A;  1KRT A;  1GHJ A;  1Q1E A;  5IE8 A;  2HHH Q;  2A1A A;  1LYL A;  1SYD A;  1X55 A;  2NB0 A;  5JEA G;  2H4O A;  2K05 A;  2N8N A;  2BA1 A;  1STE A;  3TP8 A;  3CCJ A;  4JI2 L;  4KN7 C;  5CV8 A;  2UUA L;  2F0I A;  3RLN A;  3R93 A;  3GTM H;  4LF5 L;  1ZEQ X;  4KK7 A;  1HCZ A;  1STG A;  2K75 A;  2LXK A;  4B3T Q;  1CHQ D;  1SNQ A;  4OGQ C;  2F0J A;  1B8A A;  5JJZ A;  2F0H A;  2L1B A;  1STY A;  1EY5 A;  1VQ9 A;  4F7X A;  3IRB A;  2JA6 B;  3H09 A;  3MXN B;  4QQB X;  2EYM A;  4WJ4 A;  1C8C A;  4TRD A;  2PNH A;  1TU2 B;  2F0G A;  3JAM E;  3EVQ A;  5C44 B;  4YHH Q;  4BA2 I;  4LF8 Q;  5C6A A;  2BH8 A;  2Q8T A;  1A15 A;  4BY1 H;  4A3D H;  2IPK D;  4JI2 Q;  2RSO A;  3HS0 C;  2UUA Q;  4C3I B;  2WB1 E;  3CPW A;  1KLU D;  4RHR A;  3J7Z C;  3NWT A;  3PIO 3;  3PIO A;  4C2M H;  3STB D;  4OX9 L;  1SDF A;  1STA A;  2I5M X;  1SE2 A;  4JI6 L;  3HOU H;  3PF4 A;  2L4N A;  1TS2 A;  2PZW A;  2XSC A;  2PW7 A;  3MAQ A;  1B2T A;  5M3M G;  2KQ3 A;  1Q8I A;  2VXW A;  3GV6 A;  1CT1 D;  1LV9 A;  1M90 C;  4X62 Q;  4TKO B;  2AHO B;  1A62 A;  1IBM L;  1DOM A;  4C3J G;  1WTR A;  2ICI A;  3VA5 A;  1I94 Q;  5JJL A;  3C1F A;  3PUV A;  1O7Y A;  2QDL A;  3ITP A;  4GLA C;  2F0K A;  1QB5 D;  1VQO A;  3QOJ A;  1P16 A;  1V1Q A;  1FGU A;  2F0V A;  3SK4 A;  4B3R L;  3M4P A;  1PH5 A;  2ZXP A;  3HOY B;  1VS0 A;  5JJK A;  1VQJ A;  3T16 A;  4FF2 A;  1RJT A;  5FLM H;  5LHY 1;  1R4Q B;  2D62 A;  3NTH A;  1VF7 A;  4C3H H;  1JJ2 A;  1QUQ B;  3FRP B;  2E8G A;  4AYB E;  1Q12 A;  1UAP A;  2NVY B;  2IY5 B;  1I6V C;  5L37 A;  4KHP L;  1CQF A;  3G48 A;  2G5D A;  2V4D A;  1KQS A;  1N32 L;  1Q8K A;  3NUC A;  4X66 L;  1SND A;  1SMY D;  1LT3 D;  2SEB D;  1IBM Q;  4LF6 L;  5C0X J;  4R1J A;  1SFO H;  4OEM B;  4IPD A;  4BY1 G;  1SE3 A;  1PVO A;  2R7D A;  1KAA A;  3K5O A;  4J15 A;  1DYQ A;  1Q1B A;  5IYB H;  4FYD A;  1HTP A;  1N8R C;  2YTX A;  5ELN A;  2NVX H;  4XYQ A;  4NB3 A;  2JA5 B;  4BA1 I;  5IY0 A;  3VYS A;  4M8A A;  3KF8 B;  4LFC Q;  3NE5 B;  1K8G A;  3VR5 A;  1VMP A;  3BJU A;  3C2P A;  1UE7 A;  3OMG A;  1EQR A;  2GVA A;  2PMZ B;  3MA2 B;  1K83 B;  1DOL A;  2AMC B;  1Y14 B;  1WCM H;  4DKA C;  4DNT B;  4YY3 Q;  4X65 Q;  4LF6 Q;  4DK0 A;  3HGB A;  2LY7 A;  1I4Q A;  2EZV A;  1ASZ A;  3AEV A;  1DOK A;  2C9O A;  2DN8 A;  2K5V A;  4EX5 A;  4A3I B;  3RR5 A;  1TQO A;  5FLM G;  2QEX A;  1A3U A;  1N34 L;  5FO8 B;  1G2T A;  1BF4 A;  1SRO A;  2WIN B;  1EYG A;  4IJL A;  3IFT A;  5C4J H;  1I3Q B;  3LGJ A;  2PQA A;  3HOW B;  5EBD A;  1A3V A;  3I4M B;  5ELC A;  1PA6 A;  2MGS A;  3BZC A;  4LF4 Q;  5CGK A;  3U9S A;  1IW7 C;  4LW1 A;  1BVS A;  5IT9 E;  5E3F A;  2JA6 G;  1LTG D;  4H13 C;  5IYB G;  2E2H B;  5IIF A;  3WOE A;  1IYV A;  1O7Z A;  5C3X A;  1F9R A;  2EJF C;  1I4X A;  2RBM A;  4IQZ A;  1B1Z A;  3EFX D;  1B53 A;  4ILW A;  1N34 Q;  2KCT A;  3GP7 A;  1AEX A;  1XMO Q;  4C3I G;  1IXR A;  5IOD A;  3NXW A;  2B63 H;  2K28 A;  4CDD C;  4K5X A;  1ML0 D;  4HTH A;  1S5C D;  4PV1 C;  1A0I A;  4YWM A;  4A93 B;  1G29 1;  1YIT A;  1NNX A;  4H0L C;  2VY3 A;  2FHT A;  4QUC A;  4GKK L;  4IUQ A;  5T1I A;  1VQH A;  4G7O C;  3F8T A;  3J7A 5;  2NVQ B;  1HQM C;  1XPR A;  3PO2 B;  1XJV A;  1M8A A;  4RAU C;  3S1M B;  2L12 A;  4DAY A;  4HMJ A;  5FJ8 H;  4Q5V A;  1VQC A;  1CK1 A;  1KAW A;  1EL0 A;  1D7Q A;  1X54 A;  3KDF B;  3GTJ B;  2G9H D;  3NBH B;  2EPB A;  1G2S A;  4JK1 C;  3A54 A;  1QZG A;  5EBC A;  1MSG A;  3KLS A;  4B9W A;  4A3K H;  2EYL A;  2QKI C;  3D31 A;  2PI2 A;  1RKN A;  1B3Q A;  2LKV A;  2RKS A;  1PTO F;  1EQQ A;  5HGQ A;  1EWC A;  1PH8 A;  1WTX A;  1L0Y B;  1CTM A;  1FNU A;  1F9S A;  2HIX A;  4K2L A;  1L1O C;  1LT5 D;  2D0P A;  1XMQ Q;  2NBF A;  1BOS A;  2KUM A;  5LMN L;  4RKL A;  4R8N A;  1A63 A;  2YTY A;  1RCV D;  2EJG C;  4R4C A;  5K36 H;  1PDQ A;  3HOW H;  5IGB A;  3U50 C;  2K5H A;  4O42 A;  1D5Z C;  1D6E C;  2ZT9 C;  2K01 A;  4XDX A;  4P74 A;  4DUZ L;  1R9T B;  1YBY A;  4RG1 A;  1YHQ A;  2E2J H;  1HFG A;  1IYJ B;  4JV5 L;  1SE8 A;  5LL6 X;  3M4Q A;  1PFB A;  2K03 A;  2B2V A;  3TP5 A;  4DK1 A;  3BDC A;  2EXZ A;  1CQV A;  2AQ3 B;  3V96 A;  3J7A F;  1GXD C;  1LTT D;  2JA5 G;  1I4P A;  3R3O A;  1RD9 D;  2EJM A;  1PFN A;  4A3L H;  3A56 A;  3EJI A;  2CWA A;  4L6T B;  5FJ8 G;  4R8I A;  2JSO A;  1LT6 D;  3KBX A;  2IWH A;  4CDE C;  5TSS A;  4BBR H;  1S40 A;  4JI5 Q;  2KEN A;  5JAV A;  4BBS H;  3ERQ A;  4KD4 A;  3PQI A;  4IUT A;  1ET6 A;  1LAB A;  3OYY A;  2VQE Q;  2F0W A;  4NDX A;  1RTN A;  3T51 B;  4A3K G;  2DNE A;  1KC8 C;  3ERS X;  4JV5 Q;  1EQT A;  2IL8 A;  2Z4H A;  1WYD A;  1VQM A;  1K8M A;  3F2D A;  3CRK C;  1GUN A;  1LTA D;  2JXM B;  4A3I G;  3G7L A;  3PUX A;  3GTO B;  4XQJ A;  5IP7 H;  2XRS D;  5LMU L;  5ELE A;  2RQX A;  4DN4 M;  4KKS A;  4CBV A;  4HSP A;  3U4V A;  5HGT A;  1F77 A;  5GRO A;  1G91 A;  4K6L A;  3HOW G;  4IO9 A;  4UP9 A;  5FLX E;  3I4M G;  1QVC A;  4LUZ A;  3GTG H;  1G6Z A;  4HJ5 A;  5FO7 B;  2E76 C;  4R4Q A;  2PPB C;  1L2F A;  3D6W A;  4KJO A;  4CHT B;  4GNX A;  2XGT A;  1ESR A;  2XN9 C;  4ZK9 B;  3MEH A;  1SJE D;  2B39 A;  3FP9 A;  1HZA A;  2F0L A;  4A3L G;  1UWV A;  2PNR C;  3NEM A;  1EZ8 A;  4RWS C;  3PMF A;  2NTT A;  5CC4 A;  1HJP A;  3TME A;  1VMC A;  1JC7 A;  1PZK D;  1TWA H;  1V1P A;  4A93 G;  2AWN A;  1U5K A;  4K6D A;  4BBR G;  2R93 H;  4JBM A;  3S16 H;  1MJC A;  4BBS G;  1NSN S;  1H9J A;  3A55 A;  1EWI A;  1SNO A;  1QZH A;  3D4D A;  3M4O H;  2VB3 X;  1I50 H;  3HOV H;  3CKI B;  1ICW A;  4LK1 C;  1HR0 L;  4B08 A;  2KCN A;  5J22 A;  5GAD C;  3JAM c;  1NTG A;  2BE5 C;  3D8G A;  4OIK A;  4UY8 C;  1TXY A;  1GHK A;  1OXX K;  1PFS A;  3ND9 A;  2VW9 A;  2E2D C;  3FDT A;  1TWG H;  3SXH A;  3S1R B;  1FGB D;  5EPK A;  2KHS A;  4CGY B;  2WII B;  3HOX B;  5J3B A;  4DR5 L;  1JWM D;  4N8F A;  4FF1 A;  5A2Q L;  3K8A A;  4OL7 A;  5CMD A;  2FIN B;  1Y69 U;  1Z9F A;  3SDZ A;  1II3 A;  2R7Z B;  1SR3 A;  2J0T D;  1HR0 Q;  1HUM A;  3J7A V;  4KHV A;  4X3U A;  2Z6B A;  4GLV B;  3IKJ A;  2VUM H;  2YTV A;  1U4P A;  3K57 A;  3C1E A;  1I6H H;  3AU7 A;  4IUR A;  4WOR A;  2ALY B;  1E7Z A;  3I72 A;  3GTL B;  2CQA A;  3K59 A;  2QF7 A;  4NXM Q;  3P7J A;  4JI3 L;  3G71 A;  3ICE A;  4DV4 L;  3HOZ B;  3JC6 6;  4HJ9 A;  3TS2 A;  4JI1 L;  5C4Z A;  2F3I A;  1BBX C;  4DV6 Q;  4XIG S;  2BCO A;  2A8V A;  4DR5 Q;  3IAY A;  1RDP D;  2CVR A;  4C1N I;  2PQE A;  1N36 Q;  4ALP A;  2X6G A;  3CCU A;  1D1K A;  4DFA A;  1WTQ A;  2A68 C;  3CMA A;  3RZO B;  4HMI A;  3S17 B;  1A6X A;  1LUZ A;  5KGU A;  1WI5 A;  4A3B H;  2CCZ A;  2EYO A;  3A8J E;  1CKO A;  1T5E A;  1ILP A;  4J1M A;  1R4P B;  4LMQ D;  4IN3 A;  1EEI D;  1AZQ A;  3WDN A;  1EWH A;  1U9R A;  2SNM A;  1EY7 A;  2VS1 A;  3AB9 A;  3A5U A;  1HUN A;  3I56 A;  2NN6 G;  1S3O A;  4LUO A;  4J8Q A;  2E5L Q;  4KKU A;  4G57 A;  3M7N A;  3S14 H;  1A2U A;  4UHV A;  4JI1 Q;  1PYW D;  2VL6 A;  3L7Z C;  3S15 H;  1A2T A;  5CBA E;  5C0X G;  3MHB A;  3F2B A;  3H0G B;  2PCF B;  4DU9 A;  4KLK A;  4RGM A;  5E1F A;  2HQL A;  4NW2 A;  3S1R H;  1HPC A;  2G9D A;  4KV6 A;  4ZUJ A;  1CSP A;  4DR1 L;  4XTC S;  3EQL C;  3T1H L;  1EIH A;  3SE0 A;  2BE5 D;  4FO2 A;  4DNI A;  1Q7Y C;  3NHH A;  4R4O A;  2UUC Q;  1HRJ A;  3VDY A;  4OIJ A;  2L0C A;  1AE2 A;  1HA5 A;  4K5W A;  2L9H A;  1RF2 D;  3CCR A;  5M3F B;  5HY6 A;  5E4W C;  2QA4 A;  4MTN A;  2CW0 D;  1YEZ A;  1BNZ A;  3E3X A;  4OON A;  2PQA B;  3H15 A;  4B3T L;  3EN2 A;  1X56 A;  4DV7 L;  1AP0 A;  3I4N B;  3UDF A;  3TSS A;  3ULJ A;  4JW0 A;  3K7A B;  1D5M C;  1SAP A;  2Q2U A;  4JBK A;  4A3E B;  2CH4 W;  1MJE A;  1JT8 A;  3V05 A;  2D5D A;  1NAP A;  3JAM L;  5IGD A;  4YIJ A;  5AJ3 L;  1SMY C;  2A6E C;  4LJZ C;  2JA8 B;  5IT9 c;  4YHH L;  5M3M H;  4LF8 L;  3CPF A;  4YCV A;  2N55 A;  1WTH A;  1Z47 A;  3M85 A;  1MHW C;  1C4Q A;  4C3J H;  4F87 A;  3TP7 A;  3Q23 A;  2SOB A;  1BCP B;  4QJF A;  4ZUI A;  1Q81 C;  4X6A H;  1OXU A;  2FFK B;  2HIV A;  4NPS A;  5C4H A;  3D0F A;  1S4Z A;  5KNB A;  1X3F A;  5C4X B;  1L0W A;  3I70 A;  3OW2 A;  4HED A;  2ZJR A;  3M3Y B;  4DV7 Q;  2GVB A;  2A68 D;  5M9O A;  1SYG A;  1O78 A;  3W2D A;  2ZTE A;  4DR2 L;  1NR4 A;  1K3R A;  1BUV T;  2F0P A;  2P5Z X;  1DD2 A;  3TRE A;  4MNO A;  5AJ3 Q;  1KNA A;  4DAY B;  1VQ5 A;  4X62 L;  4Y7N H;  4NXN L;  4GOP B;  2R7Z G;  3AYH B;  4BXX H;  1I94 L;  2O4X A;  3KK7 A;  1LAC A;  2ZJP A;  2X6L A;  3T1Y L;  2YU9 B;  3RN2 A;  4OWT B;  3RLF A;  1W2B A;  1YI2 A;  4O0A A;  1KL9 A;  1AE3 A;  2UXB L;  3I3C A;  1PTO B;  5KYI A;  3SR1 A;  3S2D B;  1F2L A;  2O5I C;  2UUB L;  3HOZ G;  3TN2 A;  3RD4 A;  3GD7 A;  4DR2 Q;  2JYO A;  4ZRZ A;  4O2D A;  1JR0 D;  2ICE C;  1GM5 A;  4AIM A;  1Y1V H;  1JE5 A;  1C0A A;  4DNR B;  3MFY A;  2EQS A;  1H9S B;  4L5R C;  3VR4 A;  4NXN Q;  4KY7 A;  4ZKB B;  1B50 A;  4XXE A;  2PO4 A;  1HFN A;  2L15 A;  1AN8 A;  1Q82 C;  2N3S A;  2PZU A;  3CCL A;  3CRL C;  4ZYS A;  3K58 A;  4A3E H;  1FD7 D;  3HP3 A;  3T1Y Q;  2F0M A;  1EYA A;  3MTS A;  4PZ6 A;  1KTK A;  2UXB Q;  1UEB A;  2A74 C;  2K7V A;  3GTP B;  2UUB Q;  2L5T A;  4LFC L;  3J81 L;  1RTO A;  2RHS B;  3S1N B;  1TS3 A;  1W6K A;  3TEH B;  4RHS A;  5ELB A;  4BWG B;  3H0G G;  1CM9 A;  1Y8O B;  1SLJ A;  4BXX G;  1VQP A;  4A3F B;  4UP8 A;  2A6E D;  4Q0F A;  5NUC A;  1E22 A;  4YY3 L;  1L1O A;  4X65 L;  4AH6 A;  1N33 Q;  1YNJ D;  1FR3 A;  4FNF A;  4DAV A;  4A4I A;  1EY6 A;  1MI2 A;  3J7Y W;  4GS3 A;  1Y8P B;  4QIW B;  2JA6 H;  3RUZ A;  3AFP A;  1PFM A;  3TQY A;  1EFW A;  2XVS A;  2WKC A;  3MFG A;  5J39 A;  1AH9 A;  2PW5 A;  5C44 H;  4K5V A;  1O7I A;  3K7U C;  2NWG A;  1IKM A;  1SYB A;  5M3F G;  2K04 A;  4G4K A;  3DEP A;  1Y1V G;  1K28 A;  2XWJ B;  2OT2 A;  2YU9 H;  4C3I H;  1XTD A;  4JI0 L;  4JPB W;  1PTO H;  2B8G A;  2JE6 I;  2ID0 A;  3NK9 A;  3RMH A;  4LF4 L;  1KLG D;  3I4N G;  1BQQ T;  3K81 C;  1NMF A;  1EUJ A;  5FLX c;  1CKM A;  2R6G A;  4A3E G;  2KED A;  4KI0 A;  1X6O A;  2CKZ B;  3QG1 A;  3CW2 C;  1BR9 A;  1GVP A;  2CWP A;  3NSW A;  3CC2 A;  3QIA A;  3D4R A;  4U68 A;  4YWK A;  3QJY A;  3CXC A;  1XMO L;  1SSO A;  2BDO A;  2JQO A;  4UDU C;  4YCW A;  1PRT B;  1SYF A;  1NJI C;  1V1P B;  1EY4 A;  3VR6 A;  4JI0 Q;  4IFD J;  4PQX A;  3HOY H;  3U9O A;  1SNM A;  4H02 A;  1JB3 A;  2K52 A;  1BKB A;  2RVL A;  3RNU A;  5IWA Q;  4GN3 B;  3TDQ A;  4DV2 L;  3KFU A;  2VB2 X;  4DAM A;  3CD6 A;  3SEB A;  4DUY Q;  5M5X B;  3OMC A;  2NVY H;  4GN4 B;  5C44 G;  3LX0 A;  2ZM6 L;  4HSV A;  4A3G B;  1CZG A;  3BG3 A;  2HQE A;  1Q3L A;  4KY5 A;  4A3F H;  1TWC B;  1T5X D;  1GOZ A;  2A19 A;  3TS0 A;  1YNX A;  3SHL A;  2QDB A;  4WRD A;  1MD2 D;  2K5D A;  5IGE A;  4DXG A;  1Z7T A;  2ES2 A;  5ELF A;  1V43 A;  1BCP F;  5E4X A;  4BS9 A;  3QWN A;  1NMG A;  3A74 A;  4LF7 Q;  3QOL A;  2Z6K C;  3D6C A;  2NTS A;  3H3V H;  2H5X A;  3KLR A;  5IYC H;  4X3S A;  2JA5 H;  4LWC A;  3DMU A;  1XMQ L;  4LFA Q;  1NE3 A;  4DV2 Q;  2RDH A;  2I46 A;  3FPP A;  4BY7 B;  1LTL A;  3UE1 A;  1XNR L;  4QCL A;  4JI8 Q;  5EQ0 A;  1K83 H;  2ZM6 Q;  3G4S A;  4F8M A;  1RIP A;  4XQQ A;  2OCE A;  1KNE A;  1IBL Q;  1JOO A;  3I4O A;  2R92 B;  3ERO A;  4L5Q A;  2F52 A;  3Q8D A;  4IUN A;  2D9U A;  2KHJ A;  3P20 A;  1XWE A;  3HOY G;  2NYZ D;  1AZP A;  1VQ6 A;  1SJH D;  4A3I H;  3ULL A;  4DV5 Q;  1I5F A;  1XYI A;  4NKL A;  3SVM A;  3ZYY X;  3CCM A;  3S24 A;  2B2T C;  2CQO A;  1I3Q H;  2NVT B;  3BVZ A;  4EQN A;  3PSI A;  1XNR Q;  1IL8 A;  5AFW A;  4JI5 L;  1LTS D;  4A3F G;  4JI7 L;  3I4M H;  4G7H C;  2IJ0 A;  1LTR D;  2KCM A;  1JB7 A;  2WB1 B;  2VQE L;  1EIY B;  2RF4 A;  2B2W C;  1JOK A;  2K50 A;  1BXT A;  1FL0 A;  1PYB A;  2C35 B;  4JG2 A;  1CFM A;  2Q2T A;  2BA0 A;  2E2H H;  5C3E B;  4X3T A;  3HFZ B;  4I7Z C;  3FKI B;  3BVM A;  5ELD A;  4L8J A;  5IYC G;  1Y1W B;  4P72 A;  4WJ3 M;  2Q2H A;  3T56 B;  3PO3 B;  1QVG A;  1SBB B;  1H9M A;  1E2Z A;  3NPP A;  3HKS A;  5FLX L;  4V0B A;  5DM7 3;  2I0Q A;  3I91 A;  1HQR D;  1K0S A;  2IX0 A;  4DV0 L;  1X3G A;  1LLR D;  1PH4 A;  4A93 H;  1YZ6 A;  3WWV A;  4ODG A;  4IPH A;  4JI7 Q;  3C46 A;  4YCU A;  1OTC A;  1YNN C;  3PUY A;  3B6Y A;  2Q2I A;  4XT3 B;  4JI4 Q;  3J80 i;  4OHJ A;  2JA9 A;  3VR2 A;  2TSS A;  1LO5 D;  1TS4 A;  5FKA C;  1XNQ L;  2NVQ H;  3PO2 H;  3S1M H;  4IUU A;  3GTQ B;  4BY7 H;  4G7Z C;  2OQ0 A;  5KRU A;  1GO3 E;  1UUP A;  3GTJ H;  3KF6 A;  4WFN 3;  3SGI A;  4OO1 H;  2OXP A;  4FXK C;  3OW7 A;  1CA6 A;  4KKT A;  3KLW A;  4DV3 Q;  1ROD A;  4DV0 Q;  1OXV A;  2EDG A;  2JA7 B;  3CCS A;  1KRS A;  2O2L D;  3KF8 A;  5IGF A;  1X3E A;  4MHE A;  4IPC A;  3F1Z A;  4K2K A;  4RFB A;  4OXP A;  3J80 E;  2EYJ A;  4DK6 C;  2DY8 A;  4H44 C;  1XNQ Q;  2N49 A;  1IKL A;  3A7A B;  3GTK B;  5C5L A;  4A3G G;  1SYE A;  2D0O A;  2DJF C;  1TWF B;  2Q8R E;  1WJJ A;  2VQF L;  2CH4 A;  3BZK A;  3E9H A;  4R4I A;  1R9T H;  1NCV A;  4X64 L;  4JCV E;  1TT2 A;  4EQP A;  3TRZ A;  4KY6 A;  3V2T A;  5LMN W;  1FYC A;  4TVA B;  1PRT F;  1JCK B;  5CV7 A;  1KDC A;  1QNU A;  3S1Q B;  1NR2 A;  4IOC A;  4DV1 Q;  2UXC L;  5T1G A;  5CV4 A;  2KCC A;  4FF4 A;  2F4V Q;  2E74 C;  2RDF A;  3PO2 G;  4K8I A;  3ND8 A;  4TSS A;  3Q22 A;  2AQ2 B;  4BY7 G;  1EZ6 A;  1ICF B;  5EKI A;  4A3J B;  2BH2 A;  2XTI A;  2BDN A;  3OPO A;  1MKH A;  4DXF A;  4GOP C;  5ISR A;  1DXM A;  3OSO A;  2XWB B;  2MFI A;  2AUJ D;  2RHQ B;  3NEL A;  4OO1 G;  2VQF Q;  5I9O A;  1VQE A;  1PH2 A;  4WJW A;  1PZJ D;  2Y0S B;  4X64 Q;  2F0N A;  3PGZ A;  4NXM L;  4KN4 C;  3UDG A;  1SN8 A;  2NN6 H;  2JEB I;  2RDG A;  1PTO C;  2UXD Q;  4Y52 H;  1U4R A;  4ZQ3 A;  4DR3 Q;  2CW0 C;  1O7L A;  2FMM A;  4DV6 L;  2UXC Q;  3OWE B;  4LUV A;  3GTO H;  1QNK A;  1VQI A;  1YNN D;  2WV6 D;  1N36 L;  2XIW A;  3PUW A;  5C0X H;  2KEE A;  4HIM A;  1VQ8 A;  1HNW L;  2K6A A;  1FNW A;  4P2C B;  1PH9 A;  2JA7 H;  2SNS A;  4JBW A;  3E6Z X;  1DZ1 A;  1SXT A;  4AQY Q;  1V1O A;  1HHV A;  2WAQ B;  4J6H A;  2F03 A;  1ONL A;  2E5L L;  3GTK H;  1TWH B;  3Q6S A;  1PH6 A;  4ULL A;  1EU4 A;  4PMW A;  3KDF A;  5IP9 G;  3H3V I;  3PO3 G;  3K5L A;  4NMZ A;  2QCP X;  1V8Q A;  4UP7 A;  3NQT A;  3M9B A;  4FF3 A;  4CDF C;  1U0L A;  1HZ9 A;  3RLO A;  4DR6 Q;  2NZO A;  3SK8 A;  1Y8N B;  2WP8 J;  2C5C A;  1HNW Q;  3LWE A;  1UE1 A;  4QB4 A;  4GN5 A;  4ME3 A;  3KJO A;  2IHF A;  3O13 A;  4F88 A;  3CQZ B;  4ABN A;  1G8Z D;  1Q86 C;  2QEJ C;  2DGY A;  2I07 B;  3SK5 A;  3RZD B;  3OOC A;  5KIX A;  1E1T A;  2HDM A;  1HNZ L;  2UUC L;  3KBG A;  4FXD A;  4DK3 C;  1BCP D;  5A2Q E;  3H3V C;  5IYD H;  2E75 C;  2F0Q A;  3BU2 A;  4EQO A;  5GAG C;  2PMZ E;  3NTI A;  4IFD H;  1M1K C;  4I65 A;  2NUC A;  4DR7 L;  3GTM B;  4CKE A;  4XT1 B;  1CUK A;  4RGN A;  3H6M A;  5I2X A;  2B2U C;  2HCI A;  2F0F A;  4LF9 Q;  2JA7 G;  2LFN A;  1JJC B;  5CYU A;  2R3Z A;  3HOX H;  1JWU D;  1VQL A;  2HUG A;  1E2V A;  4K0K Q;  1B9M A;  1DCZ A;  2K33 A;  4L63 B;  3DWQ A;  1STB A;  5C5M A;  5A35 A;  3PV0 A;  2J7Z A;  1KXL A;  4C56 C;  4HJ7 A;  1EOV A;  1L0X B;  4NP5 A;  4IAL A;  1HNZ Q;  1FJG Q;  1MGS A;  1J8I A;  2R7Z H;  4APV A;  5EPL A;  1MBY A;  4XYO A;  3R8B A;  4HR7 B;  2KBN A;  1PTO D;  1VQA A;  2EE1 A;  3S2H B;  4A3D B;  4N9T A;  4RCN A;  2B3G A;  4L5S A;  5IGC A;  1EIF A;  4DR7 Q;  2OF1 A;  1WVL A;  1UNS A;  1WOC A;  4HIK A;  5COY A;  1YJN A;  3K0Y A;  3GTL H;  3GDE A;  4C2M B;  1PRT C;  1XPU A;  1H9R A;  4MN3 A;  2H1E A;  5KND A;  3HOZ H;  2GA4 B;  3HOU B;  2JJQ A;  1YIJ A;  4KMU C;  4I7A A;  3L9A X;  4PMC A;  2CHB D;  1PV4 A;  4HJA A;  1W6J A;  5EAY A;  3DM3 A;  2Z8L A;  2A6H C;  3VYT A;  5IYD G;  2F0U A;  1YNJ C;  3RZO H;  3ONA B;  3VA7 A;  3S17 H;  2D2C C;  1D5X C;  4V19 0;  3FPU B;  5I2Y A;  4IFD G;  2FMC A;  3DLL A;  2RCF A;  1GUG A;  4LAA A;  5F2D A;  4PMB A;  1PYS B;  2Y0S G;  3KJP A;  4OO1 I;  1DM0 B;  3M4Y A;  4RGT A;  3JAM i;  4MTK A;  3HKZ B;  2NZH A;  1VQ4 A;  3U4Z A;  3HOX G;  3KOJ A;  1UEA B;  1Z6H A;  3LWU A;  1HNX Q;  1X3P A;  5EPJ A;  3U58 A;  4C3H B;  1P8L A;  3E0E A;  5IOC A;  2M00 A;  3H0G H;  3D3R A;  4DR4 Q;  2FJ2 A;  1X32 A;  4QF4 A;  4A3M B;  1Q90 A;  1J5E L;  2PZT A;  1HH2 P;  3FEW X;  4CJ0 B;  4ZLT F;  3EA6 A;  4JOI C;  1SFO B;  3OWF A;  4JYA Q;  2QW7 A;  2WAQ G;  4ME5 A;  3OIP A;  2Z4I A;  1ESF A;  5M5W B;  4C1N K;  4MIU A;  4RA8 A;  2NVX B;  4Z9C B;  3DUZ A;  1C7Y A;  2UU9 L;  1S5E D;  2ZXO A;  5M3F H;  1EYD A;  4R9W A;  3W3A A;  2F0T A;  2AKW B;  2Z6K A;  3S2H H;  3GQB A;  3TZD A;  1MSH A;  4KD3 A;  4B3S L;  4LF5 Q;  1RHP A;  3MC0 B;  3ER0 A;  5D65 A;  3T4A C;  1VQN A;  1J5E Q;  3NP8 A;  5E7N A;  3HG9 A;  4RGO S;  3I4N H;  1N33 L;  2I5L X;  1WCM B;  3X3M A;  4POF A;  3K7A H;  1LT4 D;  5D14 A;  1E2W A;  2HDL A;  2WAC A;  1JMC A;  2XNA C;  1PXU A;  4GZY C;  3Q24 A;  4A3C H;  2I5H A;  4GLX A;  1H9K A;  1ENC A;  1QOH A;  3F2U A;  2JA8 H;  1CKN A;  4ZCK A;  1HTL D;  1B44 D;  2NN6 I;  5JVH 3;  1CHP D;  3VYU A;  5K5P A;  2UU9 Q;  1PRT D;  1EYC A;  1TY2 A;  4DAP A;  3I73 A;  5C4J B;  1BO0 A;  5BN5 A;  3OTO L;  4U67 3;  5D3I B;  5C4X H;  1HZB A;  2F3W A;  5C0X I;  1C48 A;  4N9P A;  4B3S Q;  3CME A;  3VR3 A;  1SNC A;  2ENB A;  3M3Y H;  3FMC A;  3GO5 A;  1STH A;  4UPA A;  2V1C C;  2A6H D;  2DUD A;  2MQH A;  3MVV A;  4ZAI A;  3J81 i;  4OX9 Q;  2B2T A;  3I7F A;  1YVC A;  2KHI A;  1VF5 C;  2R7F A;  1O80 A;  4JI6 Q;  1QG7 A;  5LL6 S;  2K5W A;  2LSS A;  2Z0S A;  3LNN A;  5BN3 A;  3FHW A;  2JN4 A;  2EYF A;  4A3M H;  4FP5 D;  2B2W A;  1S5B D;  1H95 A;  5KYL A;  3L2P A;  3OIQ A;  1J6Q A;  1YHA A;  4S3S A;  3C3L A;  4A3D G;  3KF6 B;  2B2Y C;  1KIX A;  2OEO A;  3QO2 A;  2B63 B;  2EY6 A;  3OTO Q;  1EY9 A;  1QJO A;  2HT1 A;  2EIF A;  1DGS A;  5M5W H;  1FNV A;  1NY4 A;  3S2D H;  4QY7 A;  4HAE A;  4B9X A;  5JVG 3;  2OTL A;  5IT9 L;  5H1S E;  4B3R Q;  5IWA L;  1KAB A;  4FDB A;  1B70 B;  1GJX A;  3BYT B;  2MO1 A;  5EKL A;  4DUY L;  3HOU G;  4K8J A;  4A3C G;  3E0J A;  3ZJY C;  3MZ5 A;  4ID6 A;  1BBW A;  3I90 A;  3J81 E;  3T53 B;  4GNX B;  2JA8 G;  3J80 c;  3QR8 A;  5JPM C;  1KDA A;  1CZW A;  1S5F D;  1YHB A;  1YJ9 A;  4KHP Q;  3BYY B;  1VQ7 A;  1N32 Q;  1QE6 A;  3E9I A;  4X66 Q;  2F0S A;  1PH3 A;  1GUW A;  1ENF A;  1E1O A;  3TZU A;  1WD0 A;  2F0E A;  3NQI A;  4LF7 L;  1HXY D;  2AQ1 B;  1IL2 A;  1X3Q A;  4IFD I;  2ZJQ A;  5C4X G;  4A3K B;  1UE5 A;  2IHE A;  3HKZ G;  4TQU S;  3HRZ C;  5KEE A;  1VDZ A;  1BBU A;  3E5S A;  2AWO A;  3D4W A;  3GTP H;  2F1M A;  4LFA L;  2K14 A;  4C3H G;  1QVF A;  3S1N H;  1QIL A;  2EY5 A;  5JEA J;  1NBW A;  1F9Q A;  1EEF D;  4JI8 L;  4A3M G;  1SNP A;  2MP1 A;  3NTK A;  5I6W A;  5CBE E;  2Y0S E;  1IBL L;  1E3P A;  4CDC C;  3G6E A;  2KA7 A;  2EYP A;  1KD1 C;  2LS0 1;  2E2J B;  5DM6 3;  2EY2 A;  3KYH C;  4DPG A;  5FOB B;  2YYZ A;  5EGT A;  3UDI A;  2EOT A;  4EGV A;  3CC4 A;  2OTJ A;  3KLS X;  1JE4 A;  1TR5 A;  5DNF A;  4DV5 L;  1AFP A;  2EXD A;  1FVI A;  3P1H A;  2VNU D;  1QWY A;  3FVQ A;  4PG3 A;  2O5J C;  3WOF A;  1KHI A;  2DJG C;  1PH7 A;  1I4H A;  4LFB L;  3H94 A;  3I8Z A;  1EY0 A;  2N88 A;  1ENA A;  4BBR B;  2WAQ E;  1WCM G;  4BBS B;  2RSN A;  1EIG A;  3PCO B;  2M9V A;  3MXN A;  2EY1 A;  1U4L A;  3K5N A;  3DWP A;  2B29 A;  3IFD A;  1D8L A;  4GOP A;  2JEA I;  4LNQ A;  2R61 A;  3A8K E;  4QL5 A;  1XPO A;  2JP1 A;  4DF7 A;  1STN A;  1S72 A;  3BDO A;  1SEB D;  4JVZ A;  2ATW A;  1IHZ A;  3Q0A A;  1JWS D;  1F9P A;  1CSQ A;  1TY0 A;  1IZ6 A;  4ZKC B;  1D1I A;  4OWW B;  1SMX A;  3MEF A;  3W1B A;  1TII D;  2A69 C;  4LFB Q;  4JI4 L;  2MNA A;  3GTG B;  5FO9 B;  4HJ8 A;  3L0O A;  5CR3 A;  2K4K A;  2ASB A;  4GKK Q;  2YV5 A;  4HIO A;  1B7Y B;  2JK8 A;  4DGZ A;  5M5X H;  1NUC A;  1I4G A;  1H9S A;  3MXP A;  4IJH A;  5G3L F;  1PH1 A;  4A3G H;  2WKD A;  3H91 A;  2DY7 A;  2VZA A;  1QCB D;  1TWC H;  3BZD B;  3CCV A;  1N9W A;  1K8A C;  5ELO A;  1RL2 A;  3A5Z B;  3CHB D;  4DV3 L;  2B63 G;  1EOT A;  1TWA B;  4P75 A;  4CJ1 B;  1ZKO A;  1PHJ A;  1F2Y A;  1BDO A;  3K0X A;  1IBK L;  2R93 B;  1VQF A;  1EY8 A;  3S16 B;  3J80 L;  4UAI A;  5GQO A;  4PZ8 A;  1F2Z A;  1QUQ A;  2LXJ A;  3W5O A;  1WTV A;  4H7B A;  3M4O B;  1IW7 D;  1I50 B;  3HOV B;  1SE4 A;  5HUR A;  1HZC A;  5LMN Q;  1WTP A;  1W3S A;  4JBJ A;  5IGG A;  4M1U B;  3NEN A;  4AYB B;  3K5M A;  1SRU A;  3R2I A;  1JQY D;  4O1N A;  3PUZ A;  2FXQ A;  4DUZ Q;  4XQN A;  2R92 H;  4P71 A;  1TWG B;  3BVG A;  1WFQ A;  1J9O A;  2HD3 A;  4HID A;  1ILQ A;  3MXU A;  3HEJ A;  3CCQ A;  3R2T A;  4DV1 L;  1IBK Q;  3I4L A;  2CFM A;  2F3V A;  2MHV A;  4RMF A;  5GAE C;  1E0B A;  3W1G A;  1ET9 A;  2F4V L;  2F0O A;  2K5N A;  2N78 A;  1B3A A;  2KEC A;  5M5Y B;  3AMU A;  3S9W A;  2B2U A;  4R4T A;  3A8I E;  3CC7 A;  2WFW A;  4HCE A;  1DON A;  5CV6 A;  2NVT H;  5K36 G;  3DEO A;  2ZXR A;  4KJN A;  1PZI D;  3MXG A;  2F0D A;  1JIC A;  5GAH C;  3CP0 A;  5FK9 C;  3T13 A;  1K0R A;  3HKZ E;  4A75 A;  1ZXT A;  3DHQ A;  2VUM B;  5BN4 A;  2MJ8 A;  1K73 C;  1I6H B;  1BCP C;  4L5T A;  3AFQ A;  1I4R A;  2F4I A;  3P75 A;  5C3E H;  1F2M A;  2KJX A;  2UXD L;  1EQV A;  3FKI H;  1OXT A;  3N52 A;  4DR3 L;  1Y1W H;  2PYK A;  4A76 A;  5IP9 H;  2J4X A;  1C9O A;  2A69 D;  3DXJ C;  5D3D A;  3AQQ A;  3PO3 H;  1GD7 A;  4IZ8 A;  2X69 A;  4RKB A;  1ASY A;  4X3K A;  5LMU Q;  1V9P A;  1JOR A;  2MO0 A;  3UI2 A;  2K32 A;  3HZX A;  1X9N A;  1LTI D;  2K1B A;  4A3B B;  2RCN A;  3F2C A;  4AQY L;  1XXG A;  2AUK A;  4E6I A;  5CV5 A;  2R92 G;  5JOB A;  2PI2 E;  5EKK A;  5BR8 L;  1CA5 A;  1GKH A;  2QGQ A;  3GTQ H;  1DJR D;  3IL8 A;  1K8O A;  3URY A;  1ZYR C;  2M2L A;  3S14 B;  5IP7 G;  4B3M L;  4P73 A;  4YWL A;  2L55 A;  1M4V A;  2HCC A;  3S15 B;  3DM1 A;  1A3T A;  4FVM A;  4DR6 L;  1PLF A;  4FXG C;  3GV3 A;  5I4D A;  3CU7 A;  2A5H A;  1VQG A;  5DEH A;  1PMR A;  2WB1 G;  1VQK A;  3MWY W;  4GKJ L;  1TS5 A;  4MZ9 A;  1WD1 A;  3X3N A;  3M7G A;  1VCI A;  5M5Y H;  5C3E G;  2L11 A;  3VYR A;  1LTB D;  3FKI G;  3NWS A;  5BR8 Q;  2NZ1 D;  1Y1W G;  1OO9 B;  2B2V C;  4JC0 A;  1JJG A;  1CKN B;  4JOI A;  1G51 A;  3BS1 A;  1XX8 A;  2KOL A;  3NBH A;  4CJ2 C;  1GUT A;  3I55 A;  3RN5 A;  1TWF H;  4EVO A;  1YJW A;  2OWO A;  5JPN C;  3ULP A;  4B3M Q;  3KUP A;  2KVM A;  2B8F A;  4N8X 1;  3N6R A;  3QB3 A;  4LF9 L;  1OXS C;  2A73 B;  3A7L A;  1VQD A;  3I2Z A;  2R93 G;  2E2I B;  3S1Q H;  4QIW E;  3A0J A;  3EBE A;  3EIV A;  1L1O B;  5DLQ E;  1XTC D;  4K0K L;  4GKJ Q;  1LM0 A;  3DWA A;  2RA4 A;  4IUV A;  1HA6 A;  1FJG L;  2BOS A;  1GUO A;  5M3M B;  3HOV G;  4A3J H;  1X65 A;  3OHX C;  4QGU A;  1TVX A;  3BDL A;  3TBI B;  2K5Q A;  2QIL A;  4AYB G;  4C3J B;  1EU3 A;  2MUY A;  1SYC A;  2Z9H A;  1VQB A;  2IX3 A;  3J81 j;  1D2B A;  2IX1 A;  2Z1C A;  2TMP A;  3SK6 A;  2LMC B;  3G6J B;  2IT1 A;  3TP6 A;  3K80 C;  1HR0 W;  5JEA H;  2GN5 A;  1T9H A;  2EVB A;  5J1Z A;  5KNC A;  4JI3 Q;  4PZ7 A;  4DV4 Q;  1EFI D;  1CI3 M;  1E24 A;  1B4O A;  2DNC A;  4EQ5 A; 
#chains in the Genus database with same CATH homology
 1HZA A;  1LTL A;  2UU9 Q;  3UE1 A;  3STB C;  1XNR L;  4IPG A;  4A3L G;  4GNX C;  1UWV A;  3NEM A;  4JI8 Q;  3J81 c;  1K83 H;  2ZM6 Q;  3G4S A;  3CF5 A;  4OWX B;  3UE0 A;  1HJP A;  1RIP A;  3OTO L;  5C4X H;  1HZB A;  5C0X I;  1TWA H;  2OCE A;  3CME A;  4B3S Q;  2VUM G;  4A93 G;  2AWN A;  1U5K A;  2R93 H;  4BBR G;  1IBL Q;  1G6P A;  3I4O A;  4JBM A;  4KHZ A;  3M3Y H;  3S16 H;  4L5Q A;  1MJC A;  2F52 A;  3GO5 A;  3Q8D A;  4UPA A;  2HHH L;  2V1C C;  2DUD A;  2MQH A;  3PIP A;  4BBS G;  2ZTC A;  3CCE A;  2KHJ A;  3J81 i;  4OX9 Q;  3CAM A;  1EWI A;  3I7F A;  3HOY G;  1TWH H;  1YVC A;  2KHI A;  1HNX L;  1VQ6 A;  2R7F A;  1QZH A;  4JI6 Q;  4A3I H;  1Q46 A;  3M4O H;  3ULL A;  4DV5 Q;  1I50 H;  1I5F A;  2LSS A;  2Z0S A;  2OQK A;  3HOV H;  3FHW A;  4A3M H;  3CCM A;  1HR0 L;  4DR4 L;  3S24 A;  2CQO A;  5GAD C;  3JAM c;  1I3Q H;  1NTG A;  3L2P A;  4A3J G;  4UY8 C;  1TXY A;  1H95 A;  5JJI A;  1J6Q A;  2ZTD A;  1YHA A;  4IOA A;  3PSI A;  3UDX A;  1MIU A;  3KF6 B;  4JI5 L;  4A3F G;  1UE6 A;  1OXX K;  4JI7 L;  1XNR Q;  1PFS A;  1K9M C;  1KIX A;  3I4M H;  4JYA L;  2VW9 A;  2E2I H;  4A3B G;  2KCM A;  1JB7 A;  2VQE L;  1TWG H;  1EIY B;  3OTO Q;  2HT1 A;  2EIF A;  2RF4 A;  2K50 A;  1DGS A;  1FL0 A;  1PYB A;  2C35 B;  3CQZ H;  4JG2 A;  5M5W H;  1NY4 A;  4DR1 Q;  4POG A;  3S2D H;  1A8V A;  4QY7 A;  3T1H Q;  2OTL A;  5H1S E;  4B3R Q;  3RZD H;  5IWA L;  3PF5 A;  2Q2T A;  1KRT A;  2BA0 A;  5J3B A;  2E2H H;  4FDB A;  1Q1E A;  5IE8 A;  2HHH Q;  3HFZ B;  2A1A A;  1LYL A;  1B70 B;  1X55 A;  5JEA G;  4DR5 L;  2MO1 A;  5IYC G;  4DUY L;  3HOU G;  4P72 A;  4A3C G;  2Q2H A;  3K8A A;  4WJ3 M;  2N8N A;  3ZJY C;  1Z9F A;  1BBW A;  4GNX B;  2JA8 G;  2BA1 A;  3J80 c;  1QVG A;  3CCJ A;  1SR3 A;  4JI2 L;  1YHB A;  2UUA L;  1YJ9 A;  3RLN A;  4KHP Q;  1VQ7 A;  3HKS A;  2I0Q A;  4LF5 L;  1HR0 Q;  3GTM H;  1N32 Q;  2IX0 A;  3E9I A;  4X66 Q;  4DV0 L;  1PH3 A;  1X3G A;  4GLV B;  2K75 A;  1PH4 A;  2VUM H;  1E1O A;  1YZ6 A;  2YTV A;  3WWV A;  4LF7 L;  1IL2 A;  4A93 H;  2LXK A;  4IPH A;  4B3T Q;  4JI7 Q;  4YCU A;  4IFD I;  1OTC A;  2ZJQ A;  1I6H H;  5C4X G;  3PUY A;  3B6Y A;  2Q2I A;  1UE5 A;  1B8A A;  2ALY B;  1E7Z A;  2IHE A;  3HKZ G;  4TQU S;  3J80 i;  4JI4 Q;  2JA9 A;  1VQ9 A;  1BBU A;  4NXM Q;  3IRB A;  4JI3 L;  2AWO A;  3MXN B;  3G71 A;  4DV4 L;  1XNQ L;  2NVQ H;  3GTP H;  3ICE A;  3PO2 H;  3S1M H;  4QQB X;  4WJ4 A;  3JC6 6;  4HJ9 A;  3TS2 A;  4JI1 L;  4LFA L;  4BY7 H;  2PNH A;  2F3I A;  4DV6 Q;  2OQ0 A;  4XIG S;  2K14 A;  2A8V A;  1QVF A;  3S1N H;  4YHH Q;  4DR5 Q;  4LF8 Q;  4BA2 I;  1GO3 E;  5JEA J;  1NBW A;  1N36 Q;  2BH8 A;  4ALP A;  3CCU A;  3GTJ H;  4JI8 L;  4A3M G;  3KF6 A;  3SGI A;  4BY1 H;  3CMA A;  4A3D H;  4JI2 Q;  2Y0S E;  2UUA Q;  3KLW A;  1LUZ A;  2WB1 E;  1WI5 A;  3CPW A;  4DV3 Q;  4A3B H;  2CCZ A;  1CKO A;  1IBL L;  1E3P A;  4DV0 Q;  1OXV A;  3J7Z C;  3G6E A;  1KD1 C;  3PIO A;  4C2M H;  3STB D;  3CCS A;  3KYH C;  4DPG A;  1KRS A;  2YYZ A;  4OX9 L;  2I5M X;  2VS1 A;  3UDI A;  3A5U A;  1X3E A;  3I56 A;  4IPC A;  3F1Z A;  3CC4 A;  2NN6 G;  1S3O A;  4LUO A;  2OTJ A;  4JI6 L;  4OXP A;  4DK6 C;  2E5L Q;  4DV5 L;  3HOU H;  3PF4 A;  1XNQ Q;  2N49 A;  2EXD A;  5M3M G;  3M7N A;  3S14 H;  1FVI A;  4JI1 Q;  2VL6 A;  4A3G G;  3L7Z C;  3S15 H;  2VNU D;  1M90 C;  4X62 Q;  2D0O A;  5C0X G;  2AHO B;  1A62 A;  1IBM L;  4PG3 A;  3F2B A;  1WJJ A;  2VQF L;  1I94 Q;  1KHI A;  3BZK A;  4KLK A;  5JJL A;  3E9H A;  4R4I A;  1PH7 A;  3PUV A;  2HQL A;  4LFB L;  3S1R H;  1R9T H;  4X64 L;  4JCV E;  3TRZ A;  4GLA C;  2WAQ E;  1WCM G;  1VQO A;  1CSP A;  5LMN W;  4DR1 L;  4TVA B;  3PCO B;  4XTC S;  1P16 A;  3T1H L;  1V1Q A;  1FGU A;  4B3R L;  3M4P A;  1PH5 A;  1VS0 A;  5JJK A;  4IOC A;  1VQJ A;  4DV1 Q;  4DNI A;  2UXC L;  1Q7Y C;  4R4O A;  2B29 A;  5FLM H;  1D8L A;  4GOP A;  2D62 A;  4LNQ A;  2F4V Q;  2JEA I;  2UUC Q;  3VDY A;  3PO2 G;  4C3H H;  1JJ2 A;  1QUQ B;  4QL5 A;  1AE2 A;  1XPO A;  3CCR A;  4BY7 G;  2E8G A;  4AYB E;  1Q12 A;  2BH2 A;  1S72 A;  4KHP L;  2IY5 B;  2XTI A;  3G48 A;  5HY6 A;  2QA4 A;  1KQS A;  1N32 L;  2ATW A;  4MTN A;  1Q8K A;  4X66 L;  1CSQ A;  1MKH A;  1IZ6 A;  4GOP C;  1YEZ A;  4OWW B;  1IBM Q;  2MFI A;  4LF6 L;  1SMX A;  2RHQ B;  3NEL A;  3MEF A;  4R1J A;  4OON A;  5C0X J;  2VQF Q;  1SFO H;  4IPD A;  2PQA B;  4BY1 G;  3W1B A;  3H15 A;  4B3T L;  3EN2 A;  1X56 A;  4DV7 L;  1VQE A;  1PH2 A;  4LFB Q;  4JI4 L;  2MNA A;  1PVO A;  2R7D A;  4X64 Q;  3UDF A;  4HJ8 A;  3L0O A;  4J15 A;  3ULJ A;  1Q1B A;  5IYB H;  2K4K A;  3PGZ A;  2Q2U A;  1N8R C;  4JBK A;  3UDG A;  2YTX A;  4NXM L;  2ASB A;  1SN8 A;  4GKK Q;  2YV5 A;  5ELN A;  4HIO A;  1MJE A;  2JEB I;  4NB3 A;  2NVX H;  2UXD Q;  4Y52 H;  1JT8 A;  4BA1 I;  5IY0 A;  4DR3 Q;  4DV6 L;  1B7Y B;  2JK8 A;  5AJ3 L;  5M5X H;  2UXC Q;  3KF8 B;  5IT9 c;  4LUV A;  5M3M H;  4YHH L;  4LF8 L;  3GTO H;  4LFC Q;  1VQI A;  4IJH A;  1K8G A;  1PH1 A;  3CPF A;  4YCV A;  1N36 L;  4A3G H;  3PUW A;  1Z47 A;  2VZA A;  3M85 A;  3BJU A;  1TWC H;  1UE7 A;  4C3J H;  4HIM A;  1VQ8 A;  1EQR A;  2GVA A;  3CCV A;  1N9W A;  1K8A C;  5ELO A;  1HNW L;  1RL2 A;  3A5Z B;  4QJF A;  1Q81 C;  4X6A H;  4DV3 L;  1OXU A;  2HIV A;  1PH9 A;  2JA7 H;  4JBW A;  4NPS A;  3D0F A;  2AMC B;  2B63 G;  2R7Z G;  1Y14 B;  1X3F A;  1WCM H;  4DKA C;  1L0W A;  4P75 A;  1PHJ A;  4YY3 Q;  4X65 Q;  3K0X A;  1IBK L;  4LF6 Q;  4AQY Q;  3OW2 A;  1VQF A;  2ZJR A;  4DV7 Q;  2GVB A;  5GQO A;  4PZ8 A;  4DR2 L;  2ZTE A;  1ASZ A;  1K3R A;  2E5L L;  3AEV A;  3GTK H;  1PH6 A;  1QUQ A;  2K5V A;  2LXJ A;  3KDF A;  4PMW A;  3W5O A;  4EX5 A;  5IP9 G;  3RR5 A;  3H3V I;  5FLM G;  2QEX A;  3TRE A;  3PO3 G;  1N34 L;  4MNO A;  5AJ3 Q;  4DAY B;  1HZC A;  5LMN Q;  4X62 L;  4UP7 A;  1W3S A;  4NXN L;  3M9B A;  4Y7N H;  4JBJ A;  4GOP B;  1SRO A;  3AYH B;  4BXX H;  1I94 L;  3NEN A;  1EYG A;  1U0L A;  4IJL A;  5C4J H;  1SRU A;  1HZ9 A;  3LGJ A;  2PQA A;  3RLO A;  4DR6 Q;  2NZO A;  2WP8 J;  3PUZ A;  2ZJP A;  2FXQ A;  3T1Y L;  4DUZ Q;  1HNW Q;  3RN2 A;  1PA6 A;  1UE1 A;  2R92 H;  3BZC A;  4GN5 A;  4ME3 A;  4OWT B;  4P71 A;  3RLF A;  1W2B A;  3KJO A;  1WFQ A;  4O0A A;  1KL9 A;  1AE3 A;  1YI2 A;  4LF4 Q;  2UXB L;  4HID A;  2IHF A;  4LW1 A;  4DV1 L;  3CCQ A;  1Q86 C;  1IBK Q;  1BVS A;  2DGY A;  2CFM A;  2JA6 G;  2UUB L;  4RMF A;  5IYB G;  5GAE C;  3HOZ G;  3W1G A;  1E1T A;  2F4V L;  1HNZ L;  2UUC L;  2K5N A;  2N78 A;  3GD7 A;  4DR2 Q;  4DK3 C;  4O2D A;  5IYD H;  4R4T A;  1GM5 A;  4AIM A;  1Y1V H;  1JE5 A;  3CC7 A;  1C0A A;  3BU2 A;  5GAG C;  2WFW A;  2PMZ E;  1N34 Q;  2KCT A;  2NVT H;  5K36 G;  2EQS A;  4L5R C;  4NXN Q;  1M1K C;  4DR7 L;  1XMO Q;  1IXR A;  1CUK A;  2B63 H;  5GAH C;  3CP0 A;  2L15 A;  1K0R A;  3HKZ E;  4A75 A;  1Q82 C;  2N3S A;  3CCL A;  1A0I A;  4YWM A;  4LF9 Q;  1G29 1;  4A3E H;  1YIT A;  1K73 C;  2JA7 G;  3T1Y Q;  4L5T A;  1JJC B;  3AFQ A;  2VY3 A;  3HOX H;  4PZ6 A;  4GKK L;  5C3E H;  1VQL A;  2UXB Q;  2UXD L;  1UEB A;  3FKI H;  4K0K Q;  1VQH A;  1OXT A;  4DR3 L;  3F8T A;  3J7A 5;  1Y1W H;  1XPR A;  1XJV A;  4A76 A;  5IP9 H;  3PV0 A;  1C9O A;  2UUB Q;  1KXL A;  4LFC L;  4HJ7 A;  1EOV A;  3AQQ A;  3PO3 H;  1FJG Q;  1GD7 A;  2RHS B;  5FJ8 H;  1HNZ Q;  1VQC A;  2R7Z H;  4APV A;  1ASY A;  1KAW A;  3TEH B;  1D7Q A;  1X54 A;  5LMU Q;  1V9P A;  3KDF B;  4A3D G;  3H0G G;  3NBH B;  2KBN A;  2MO0 A;  1SLJ A;  1VQA A;  1X9N A;  4BXX G;  1VQP A;  4UP8 A;  2B3G A;  4L5S A;  1QZG A;  1EIF A;  2RCN A;  1E22 A;  1L1O A;  4YY3 L;  4X65 L;  4A3K H;  3F2C A;  1WOC A;  4DR7 Q;  4HIK A;  4AH6 A;  4AQY L;  1YJN A;  1N33 Q;  3D31 A;  3GTL H;  2PI2 A;  4A4I A;  3GDE A;  1XPU A;  2PI2 E;  1EQQ A;  5HGQ A;  2R92 G;  1PH8 A;  4GS3 A;  2JA6 H;  5BR8 L;  1GKH A;  2QGQ A;  3AFP A;  3TQY A;  1EFW A;  3HOZ H;  3GTQ H;  2HIX A;  1AH9 A;  1L1O C;  5C44 H;  2D0P A;  2JJQ A;  1XMQ Q;  1O7I A;  1YIJ A;  3K7U C;  5LMN L;  1PV4 A;  5M3F G;  1A63 A;  2YTY A;  4HJA A;  5IP7 G;  4B3M L;  5EAY A;  3DM3 A;  4P73 A;  4YWL A;  4R4C A;  5IYD G;  3HOW H;  3U50 C;  2K5H A;  3RZO H;  1Y1V G;  4DR6 L;  3S17 H;  2YU9 H;  4C3I H;  4IFD G;  4P74 A;  4DUZ L;  1XTD A;  3DLL A;  4JI0 L;  1YBY A;  2JE6 I;  4RG1 A;  2ID0 A;  1YHQ A;  1VQG A;  1PYS B;  2Y0S G;  3KJP A;  1IYJ B;  2E2J H;  4LF4 L;  3I4N G;  1SE8 A;  2WB1 G;  1VQK A;  4JV5 L;  4OO1 I;  3K81 C;  1NMF A;  1EUJ A;  3M4Q A;  5FLX c;  3JAM i;  4GKJ L;  1CKM A;  2R6G A;  4MZ9 A;  2NZH A;  4A3E G;  1VQ4 A;  4KI0 A;  3U4Z A;  3HOX G;  3KOJ A;  2JA5 G;  1VCI A;  1X6O A;  2CKZ B;  5M5Y H;  5C3E G;  1HNX Q;  3CW2 C;  5BR8 Q;  3FKI G;  1GVP A;  3U58 A;  1Y1W G;  2CWP A;  3CC2 A;  4JC0 A;  1JJG A;  4A3L H;  1CKN B;  4JOI A;  1G51 A;  1P8L A;  4YWK A;  3RN5 A;  3I55 A;  3E0E A;  2CWA A;  1TWF H;  1YJW A;  5FJ8 G;  3H0G H;  2OWO A;  4DR4 Q;  3ULP A;  3CXC A;  1XMO L;  4B3M Q;  1J5E L;  1HH2 P;  4BBR H;  1S40 A;  4JI5 Q;  2KEN A;  2JQO A;  4BBS H;  4JOI C;  4YCW A;  4LF9 L;  4JYA Q;  1OXS C;  3OYY A;  1VQD A;  3I2Z A;  2VQE Q;  2R93 G;  1NJI C;  4JI0 Q;  4IFD J;  3S1Q H;  2WAQ G;  4QIW E;  4A3K G;  1KC8 C;  3A0J A;  3EBE A;  3EIV A;  3HOY H;  3ERS X;  4H02 A;  4JV5 Q;  1L1O B;  2K52 A;  1BKB A;  5DLQ E;  4K0K L;  3RNU A;  5IWA Q;  1WYD A;  1LM0 A;  4GKJ Q;  1VQM A;  4GN3 B;  4DV2 L;  3KFU A;  3F2D A;  4DAM A;  4A3I G;  1C7Y A;  4DUY Q;  1FJG L;  2UU9 L;  3CD6 A;  3PUX A;  5M3F H;  2NVY H;  3HOV G;  4GN4 B;  1X65 A;  5IP7 H;  5C44 G;  2ZM6 L;  5LMU L;  4A3J H;  4QGU A;  2AKW B;  2Z6K A;  3S2H H;  4A3F H;  3U4V A;  4AYB G;  5GRO A;  2A19 A;  3TS0 A;  1YNX A;  4B3S L;  4LF5 Q;  3HOW G;  4IO9 A;  4UP9 A;  3I4M G;  1VQB A;  3ER0 A;  2ES2 A;  1V43 A;  3J81 j;  1VQN A;  2IX1 A;  1J5E Q;  1QVC A;  4LUZ A;  5E7N A;  3GTG H;  3I4N H;  1N33 L;  1NMG A;  2I5L X;  3A74 A;  4HJ5 A;  4POF A;  4LF7 Q;  3K7A H;  2Z6K C;  2IT1 A;  4R4Q A;  3H3V H;  3K80 C;  1HR0 W;  1JMC A;  2GN5 A;  2H5X A;  1L2F A;  5IYC H;  2JA5 H;  4A3C H;  1T9H A;  2I5H A;  2XGT A;  4GNX A;  4JI3 Q;  4GLX A;  4PZ7 A;  4LWC A;  4DV4 Q;  2JA8 H;  1XMQ L;  1CKN A;  4OO1 G;  4LFA Q;  1VQ5 A;  1E24 A;  1NE3 A;  4DV2 Q;  3FP9 A;  2NN6 I;  4EQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...