5M5YH

Rna polymerase i elongation complex 2
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
144
structure length
134
Chain Sequence
NTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNATRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase I subunit RPA190
publication title Molecular Structures of Transcribing RNA Polymerase I.
pubmed doi rcsb
total genus 17
structure length 134
sequence length 144
ec nomenclature
pdb deposition date 2016-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 5m5yH00
5M5XH 2R7DA 1TWHH 4GNXA 2KHIA 4LF9Q 5IYCG 4HIMA 4DAYB 3J80c 1I94L 2E2HH 4A93H 2N49A 1P16A 3OTOL 1WFQA 5AJ3Q 3HOUG 3KYHC 4PMWA 2RCNA 1KL9A 4L5TA 1N36L 4JI1Q 3HOXH 1X65A 2JK8A 2IHFA 3U4ZA 4GKKL 1LM0A 1A0IA 5C4XH 3G4SA 5M3FH 1N32L 1Y1VG 4LFBQ 4JBKA 4LF4Q 3S15H 4BBRG 2RHSB 4QJFA 1K8AC 4UY8C 1UE7A 4P73A 3ER0A 1SN8A 1HJPA 3H0GH 4GOPC 2AHOB 2UU9Q 4B3RQ 5FLMH 1JJGA 1XPRA 3K80C 3GTPH 2UUAQ 1A8VA 3HOYG 3UDGA 3VDYA 1PYBA 2IT1A 4JBWA 1J5EQ 2UXCQ 1H95A 1VQCA 1KD1C 4LFAL 3K7UC 1CKOA 2UXCL 1P8LA 2ZJQA 1NY4A 1HNWL 4NXMQ 4JOIA 2VQEL 3I4NG 3MXNB 2E5LL 3IRBA 4HIDA 1FVIA 4OWXB 3CCVA 3HOVG 3S2DH 2OCEA 4QGUA 2JEAI 2K5HA 4NPSA 1Q82C 4GOPB 2CFMA 3BZCA 2AMCB 4EQ5A 4P75A 5FJ8G 3Q8DA 3HKZG 3U4VA 4IPGA 2R92G 5JEAJ 3CMAA 5C0XG 2AWOA 4JI5L 3RLFA 1C7YA 3HKZE 1HNXQ 2K5VA 3A74A 3NEMA 2VUMH 2V1CC 1GO3E 1M90C 3GO5A 1NE3A 1XPOA 5IP7G 4A3KG 3PSIA 1WCMG 1WOCA 1Y1WH 2BA1A 1OXUA 1HZAA 4JCVE 2Q2UA 1WJJA 2VZAA 4X65L 4GLXA 5C3EG 4DV0Q 5M5WH 2JQOA 4IPCA 1LTLA 2AKWB 1MKHA 2Q2IA 3F2BA 4R4CA 2ID0A 3DLLA 5IY0A 4UPAA 3I4OA 4IPDA 1CKMA 2NZOA 4MTNA 4QY7A 5M5YH 1QZHA 3D0FA 4B3SL 2UXDQ 2NN6G 1AE3A 1X56A 3AEVA 1XNRQ 2XGTA 1W2BA 3W5OA 4GN4B 1YITA 5LMNL 4JI0Q 1MIUA 4PZ6A 1IXRA 2QEXA 1OXXK 1Q1BA 4GLAC 5IP9H 5C44G 1JB7A 3CD6A 4C2MH 4DKAC 3CPWA 4L5RC 3A5ZB 4FDBA 4DR3Q 2HHHL 3FHWA 4IJLA 2C35B 3G71A 2UUCL 1NBWA 4DV4L 1ASZA 1HZ9A 2JA6H 1QVGA 2OTLA 1Z47A 4DV5Q 1VQIA 1I3QH 1E1OA 2CQOA 2K75A 3S1RH 4MZ9A 1VQNA 1IBMQ 4UP8A 4X62Q 2Z6KC 2D0OA 4KI0A 1S40A 3CC4A 3T1HL 1PH3A 4AIMA 1NJIC 2PI2E 3KF6B 4LFCQ 1X3EA 3KJPA 5HY6A 4JI7L 4A76A 4EX5A 4LF6Q 2R93H 3PUYA 1PH5A 1CKNB 4LNQA 1SFOH 4GN5A 2JA5G 4JBMA 5HGQA 3PUZA 1RIPA 1YHAA 4HIOA 1G51A 5IWAQ 3J7ZC 2QA4A 4DV3Q 1EIYB 3HOZH 4YHHL 1IZ6A 2F4VQ 1YNXA 4JYAL 4A93G 3PCOB 4DV1Q 1IBLL 5ELOA 5C4JH 2E2JH 4DR2L 1KC8C 1JJ2A 4AQYL 3BZKA 1NMFA 4DAMA 4GNXC 4C3IH 4BY1H 3M4QA 5GROA 5GADC 3ULPA 3HOXG 5E7NA 1L0WA 1A62A 4YY3L 4A3IG 1UE5A 1FGUA 1XPUA 2KENA 3F2DA 5H1SE 3M85A 4IOCA 5C4XG 2MQHA 4B3ML 3CF5A 1WYDA 3PO3H 5BR8Q 5IYDH 4LF5L 1VQHA 4UP9A 4DV7Q 4HJ9A 5FLMG 1HZBA 1TWAH 3FP9A 3CCRA 1GM5A 1EYGA 3ULLA 4GNXB 4HJ7A 2NVQH 3S1QH 3TS0A 1N34L 2GVBA 1D8LA 5LMUQ 1K0RA 1YVCA 1VQAA 4LUOA 3S14H 4O2DA 4GKJL 1CSPA 2I5MX 1JJCB 2HT1A 3PF4A 2VY3A 1OTCA 1QUQB 4DR5L 4A3FH 3F1ZA 1RL2A 1VCIA 4OWTB 4JI6Q 4JOIC 3PF5A 2K50A 1PHJA 2VQFL 3CPFA 1LYLA 5GAGC 3U58A 4K0KQ 2YYZA 4LF9L 1EUJA 4A3DH 2VUMG 2VNUD 1HH2P 3S1NH 1N9WA 3UE0A 1UE6A 3J81i 1QUQA 3GD7A 1VQ7A 3PUXA 1EOVA 5ELNA 1TWGH 3AYHB 1VQBA 2CWPA 4JI1L 2UUBQ 4IJHA 3PO2H 4BXXH 3S2HH 2A1AA 3FKIH 2KCMA 4A3JH 3GTMH 1OXSC 4LFBL 4LF4L 1WI5A 2KBNA 2R6GA 1YHBA 3NBHB 1I94Q 4B3RL 4X66L 1CSQA 4POFA 4DR6Q 1G6PA 4DR7Q 1Q46A 1YJ9A 1FJGQ 1S3OA 1UWVA 3H3VH 4L5QA 1OXVA 2BA0A 1UEBA 1S72A 1Q81C 1PH2A 1N36Q 1J5EL 1K9MC 3I4MH 1GD7A 3G48A 1BVSA 4NXML 2LXKA 3BJUA 1N32Q 1VQ9A 4A3CH 1A63A 1JE5A 1YI2A 3RLNA 2ATWA 2GVAA 4HJAA 2Y0SG 4JI4Q 3G6EA 4ME3A 3RZDH 3EBEA 3CCLA 2JA8G 1VQFA 2BH8A 2WB1G 2XTIA 2Y0SE 3K8AA 1PH1A 4IFDJ 4A3LH 1E7ZA 2H5XA 2WB1E 4A3MH 4LF8Q 1HNXL 1MJEA 1E1TA 2YTYA 2MFIA 1U0LA 4A3EH 4POGA 4C3HH 5K36G 1YJWA 3UDIA 1VQPA 2R93G 2HIXA 2F3IA 3K81C 5M3MG 1HR0Q 4JI3L 1I5FA 4DV0L 3S17H 4BY7H 4BBSG 4JC0A 4YCWA 2HQLA 4AYBG 2ZTCA 4X64Q 1VQDA 3KOJA 1JT8A 3CMEA 1Q86C 4JI2Q 4HIKA 2JA9A 4OO1I 3CCMA 3HKSA 3HOUH 1XNRL 1SRUA 3CW2C 4JBJA 1L1OC 2EQSA 4PG3A 4KHPQ 3KFUA 4JI0L 1PA6A 4Y7NH 4BY1G 2DUDA 2NVTH 1VQMA 2R7ZG 2JA7G 1DGSA 2YTXA 3TQYA 1Y1VH 3J81j 1TWCH 4DR3L 2IY5B 1B7YB 1Y14B 2EIFA 4HJ5A 3J7A5 1TWFH 3CC2A 4L5SA 4IPHA 5IYDG 3I55A 2WFWA 3PO3G 1PVOA 3L7ZC 4B3TQ 4DR4L 3HFZB 4DV5L 3KF8B 4R4IA 4XIGS 1L1OB 2MO1A 4P72A 5JEAG 2OQ0A 3BU2A 4KHZA 5LMNQ 2UXBQ 3M4OH 2IHEA 1O7IA 4X62L 1XNQQ 4NXNL 2LSSA 3W1BA 3HOWH 4WJ4A 1PYSB 2CKZB 4LFCL 1K8GA 1HR0W 3HOVH 4LF6L 1KAWA 3OW2A 1L1OA 3GTKH 2E2IH 2K52A 3U50C 4YCVA 2F52A 3SGIA 3PV0A 5IE8A 2ZM6Q 4A75A 3RZOH 1XMOQ 3S16H 4DV3L 3T1HQ 4GN3B 2B63H 4A3BH 2QGQA 4A3DG 4BA1I 2F4VL 2NVYH 5FLXc 3GDEA 3KJOA 2I5LX 4RG1A 4DV1L 1R9TH 1WCMH 4BA2I 4P71A 1L2FA 1VQ5A 4JV5L 1M1KC 1SR3A 5M3FG 1QZGA 1E24A 2D62A 3B6YA 4DV6Q 3PO2G 4BXXG 1KRTA 3STBC 2PMZE 3FKIG 3CC7A 2N8NA 3H0GG 1EQRA 4DUZQ 1IBKQ 1K73C 1N8RC 2NZHA 3E0EA 5BR8L 1PFSA 2I0QA 3PUVA 1K83H 4IO9A 4DV7L 4JI8L 3I2ZA 4QL5A 3J81c 1V43A 1XMQQ 1HNZQ 5GAEC 2DGYA 3ZJYC 4OX9L 3ERSX 1NTGA 3I4MG 1VQOA 5LMUL 3UE1A 4UP7A 3CCEA 2FXQA 3F8TA 1X9NA 2YV5A 1UE1A 2ES2A 1GKHA 2OQKA 3PIPA 1EQQA 4DV2L 1PH4A 4TQUS 2B3GA 1OXTA 3NENA 4JG2A 3K0XA 4A3LG 2E8GA 4GLVB 1KRSA 4LF7Q 3NELA 1YEZA 4DR1Q 3S1MH 1EWIA 4H02A 3L2PA 4IFDI 4ALPA 2JE6I 4K0KL 3EIVA 4OO1G 3TEHB 3KLWA 5AJ3L 4DUYQ 4A3EG 4GKJQ 3I7FA 1Y1WG 3T1YQ 3E9IA 2IX0A 1N33Q 1Q8KA 4DR5Q 4NB3A 5C0XJ 1KXLA 3CCJA 3GTOH 4C3JH 1VQLA 2JA5H 2UUBL 4DPGA 4BY7G 4APVA 2ZTEA 3AQQA 1IYJB 3GTGH 3M9BA 2UU9L 1W3SA 3OTOQ 1Q7YC 2UUAL 2A8VA 3UDFA 5IYBH 1BKBA 2N78A 4A3GH 4DR6L 4DR7L 4KLKA 1VQKA 1KHIA 1SMXA 2N3SA 5GQOA 1FJGL 5IP9G 4GKKQ 4WJ3M 4LW1A 1J6QA 2MNAA 1QVFA 4A3IH 3GTJH 1NMGA 2JA6G 4P74A 4QIWE 4YWLA 1I50H 3RNUA 2ASBA 2IX1A 4JI4L 4X66Q 3PIOA 3W1GA 4LFAQ 1ASYA 2Q2TA 3H3VI 2K14A 2VQFQ 1HNWQ 2YTVA 2VQEQ 3J80i 4TVAB 1KIXA 2E5LQ 3WWVA 4LF8L 2RF4A 1KQSA 4LUZA 3LGJA 1VQ6A 4OXPA 4O0AA 3CP0A 3HOWG 3M7NA 1BBWA 1B70B 1EIFA 4IOAA 2ALYB 4JI5Q 3STBD 1YHQA 1HR0L 4R4OA 1X3FA 3GTLH 5IYCH 1V1QA 1E22A 1YBYA 3HOZG 3RLOA 1AH9A 4AYBE 4X64L 2UXDL 3PGZA 3AFQA 2B63G 3M3YH 4A3BG 1U5KA 2ZJPA 4JI2L 5JJLA 3CXCA 1YZ6A 4X65Q 4GOPA 1T9HA 3L0OA 2JJQA 3RN2A 3CCQA 4KHPL 4YWKA 4OONA 4JI3Q 3JAMc 1QVCA 4BBRH 1VQ4A 5JJKA 4B3SQ 2R7FA 3PUWA 2WAQG 4YWMA 4AH6A 3TS2A 2EXDA 3A5UA 1VS0A 2L15A 3K7AH 1XTDA 4R1JA 2RHQB 3HOYH 2WAQE 3AFPA 1VQGA 1PH7A 5GAHC 1K3RA 4B3TL 1Q12A 1YIJA 1VQEA 1IBML 1EFWA 3ULJA 1VQ8A 4IFDG 2JEBI 1Q1EA 3EN2A 3KDFB 1HZCA 3I4NH 2UXBL 4QQBX 2HHHQ 1XNQL 2VL6A 2NVXH 2UUCQ 4DV4Q 4MNOA 3RN5A 1FL0A 2D0PA 5FJ8H 3TRZA 3CAMA 1SE8A 1Z9FA 3M4PA 2PQAB 3S24A 4A3FG 2R92H 1SLJA 2VS1A 1TXYA 3JAMi 1PV4A 1JMCA 4LUVA 2JA8H 4DR4Q 4J15A 5IWAL 2A19A 2PNHA 3KDFA 1G291 5DLQE 3F2CA 1IL2A 1X6OA 4LWCA 3RR5A 2ZJRA 1GVPA 1PH8A 2CWAA 2ZM6L 4NXNQ 1XMOL 4OWWB 4PZ7A 5IP7H 4A3KH 4JI7Q 5JJIA 2BH2A 4R4TA 2PQAA 4YCUA 3JC66 1PH6A 4DK3C 1LUZA 5C3EH 2K5NA 5J3BA 1BBUA 1E3PA 2OTJA 3I56A 2Z0SA 5M3MH 4A3JG 2OWOA 5C0XI 4A4IA 4BBSH 4YHHQ 1D7QA 4GS3A 5LMNW 2KHJA 4DV6L 4HJ8A 4JYAQ 4PZ8A 1IBLQ 1IBKL 3KF6A 4DUZL 4DR2Q 4AQYQ 1B8AA 3A0JA 5IYBG 2VW9A 3H15A 1AE2A 3D31A 4DK6C 4A3GG 1CUKA 4Y52H 1XMQL 1HNZL 4YY3Q 5C44H 4JV5Q 1C0AA 1CKNA 4RMFA 1I6HH 4X6AH 2MO0A 2R7ZH 2JA7H 4A3CG 4B3MQ 3DM3A 1MJCA 2AWNA 2I5HA 2Q2HA 2Z6KA 3CQZH 4R4QA 5IT9c 3CCUA 4LF5Q 4JI6L 2GN5A 2NN6I 3MEFA 1XJVA 1V9PA 1X3GA 1X55A 4JI8Q 3CCSA 2K4KA 2KCTA 4A3MG 1YJNA 1N34Q 1PH9A 1SROA 4OX9Q 2PI2A 5EAYA 1X54A 4LF7L 4DR1L 4DNIA 3UDXA 2CCZA 3GTQH 3OYYA 4XTCS 3TREA 2ZTDA 4DUYL 1VQJA 2HIVA 2YU9H 3T1YL 3ICEA 4DV2Q 3E9HA 2B29A 1N33L 1C9OA 2LXJA 2WP8J
chains in the Genus database with same CATH superfamily
1VMCA 2R7DA 3OHXC 5IIFA 1I94L 4F87A 3RZDB 3OTOL 2A5HA 3ITPA 1PTOC 3D6CA 1JC7A 2FFKB 4BS9A 2XRQD 5ELBA 2IHFA 5I9OA 2RSOA 1LM0A 1A0IA 4K2KA 4GKKL 2ZXPA 4LF4Q 4QJFA 1UE7A 4B3RQ 1CTMA 1GUTA 1HJPA 4L6TB 2PW7A 5C6AA 5FLMH 1XPRA 2UUAQ 2Z4HA 3HOYG 4DK1A 2IT1A 1U4RA 1KD1C 1B50A 3S9WA 1CKOA 1P8LA 2ZJQA 1F77A 1HNWL 5KIXA 4HCSA 1I4QA 3K6OA 1FVIA 2OCEA 4QGUA 2JEAI 2K5HA 1Q82C 4GOPB 3NBHA 3MWYW 1LTTD 4IPGA 2R92G 4Y7NB 4C1NK 1G8ZD 1CA5A 4HMIA 2Z8LA 3QO2A 1TWCB 3NEMA 2K7VA 1GO3E 2V1CC 4OHJA 1I4GA 2IWHA 2VUMH 1HUNA 1NE3A 1A3UA 1F2MA 1XPOA 2KOLA 2DY7A 1Y1WH 2BA1A 1WJJA 2VZAA 5I2YA 4GLXA 4ILWA 3I4OA 4IPDA 3ND9A 5A35A 5CV4A 4B3SL 1SBBB 1TU2B 1X56A 3BDLA 2XGTA 3W5OA 5EPJA 5LMNL 3T16A 2E2IB 1MIUA 1GUWA 1IXRA 4GLAC 4M1UB 4KN4C 1DZ1A 3CD6A 3A8KE 4F8MA 1U9RA 2OF1A 2K5DA 4L5RC 3KUPA 5I2XA 4IJLA 3LWUA 3J80L 1NBWA 2UUCL 1HZ9A 1I3QH 1E1OA 2HQEA 4ZLTF 1IBMQ 3OW7A 1S40A 3T1HL 1PH3A 3Q22A 2PI2E 4LFCQ 4EX5A 1S5DD 2KEDA 4KKSA 5FOBB 2SNSA 4GZYC 4GN5A 3KF8A 5HGQA 4HIOA 4HAEA 3A8IE 4ID6A 4HSVA 1A6XA 2E2JH 1SYFA 2PZTA 1JJ2A 4XDXA 3BZKA 1PRTB 4GNXC 4BY1H 3M4QA 3C1FA 3ULPA 3S1MB 4F7XA 1RODA 1L0WA 4A3IG 2KENA 3F2DA 1EFID 5D65A 2MQHA 4B3ML 3PO3H 2ICEC 1HZBA 5FO7B 1M8AA 1IW7C 4C3JB 3CCRA 4HJ7A 2KCNA 2XNAC 1N34L 3MXPA 2EYFA 3V2TA 1CSPA 4GKJL 2I5MX 2QDBA 4I65A 2A6EC 3NWTA 1V1PA 1RL2A 4OWTB 3KBGA 4JK1C 1I4XA 3EQLC 3CPFA 3I70A 1LYLA 1NUCA 4LF9L 3K5OA 2VNUD 1PXUA 3S1NH 4RFBA 1PZID 5I6YA 4RKBA 1H9MA 5EQ0A 3GQBA 1KNAA 1VQ7A 1EOVA 5ELNA 1TWGH 2E75C 1VQBA 1L0YB 4C56C 3FKIH 2EYPA 3GTMH 1OXSC 4LFBL 3DWQA 1WI5A 2A68C 3NBHB 2JSOA 2F0NA 4IUTA 1S3OA 1QWYA 1S72A 3GTLB 3SK5A 2UXCL 4K8IA 4DN4M 2EVBA 2L11A 3TP5A 1N32Q 1PRTD 4JI4Q 3G6EA 4ME3A 3OSOA 1CT1D 3K8AA 4MN3A 1E7ZA 3BVZA 2WB1E 4A3MH 1HNXL 2B8GA 4NDXA 1JORA 4OO1H 1E2VA 3T4AC 3HOYB 1H9SA 5K36G 1BF4A 2R93G 2HIXA 2DN8A 1AP0A 3W3AA 2P5ZX 5M3MG 4YCWA 2NVXB 4JI2Q 2VXWA 2R92B 4HMJA 3HOUH 2JA8B 1XNRL 3VYUA 4KHPQ 1F9QA 4PG3A 3E5SA 1PA6A 3OOCA 3LX0A 2YTXA 3P20A 2EYOA 4J1MA 3J81j 1FYCA 1B7YB 1Y14B 4HJ5A 4QMGA 3I55A 2F03A 1HA5A 2EY6A 3L7ZC 5J39A 4QUCA 3KF8B 2WV6D 5JEAG 2B8FA 1ZEQX 4ABNA 2UXBQ 2OQ0A 3BU2A 1S5CD 3CU7A 1JICA 4X62L 2FMMA 4EQOA 3HOWH 3I4LA 4G57A 1K8GA 1VDZA 3OW2A 1XXGA 3GTKH 3FRPB 2JA7B 5IE8A 3KK7A 2KECA 2B63H 3HEJA 4BA1I 2F4VL 2DNEA 5DM63 2NVYH 5FLXc 1MGSA 3KJOA 1WCMH 3U9SA 1VQ5A 1TS2A 2PO4A 3KLSA 3I90A 1WVLA 4XQJA 3CC7A 1LV9A 1K73C 1JE4A 1I4RA 3MAQA 4DV7L 3J81c 1EYCA 1QNUA 4IFDH 5M5XB 2BE5D 1WTXA 3I4MG 1V8QA 2FXQA 2NB0A 1X9NA 3OPOA 4DV2L 1HFGA 4TQUS 2B3GA 5M3FB 3K0XA 4IN3A 4GLVB 3S15B 1KRSA 4PNYA 4K0KL 3GTMB 3H0GB 5EJWA 3EIVA 5AJ3L 4A3EG 1DONA 3GTPB 4QCLA 4FF2A 5DEHA 2IX0A 1N33Q 4DR5Q 1O80A 2MHVA 5BN5A 1JOKA 3CCJA 3GTOH 2WKDA 1YNND 2JA5H 4JPBW 3UDFA 1VF5C 5GQOA 4WJ3M 3MVVA 2E2DC 4P74A 2J0TD 1TQOA 1KAAA 3PIOA 4LFAQ 3R3OA 2IL8A 2RA4A 1KIXA 4V190 4KY7A 3WWVA 4LUZA 3LGJA 5IGFA 2K04A 1IKLA 3M7NA 1PDQA 1BBWA 4IUPA 2ALYB 3STBD 1YHQA 4QIWB 4R4OA 2F0WA 1ENFA 4AYBE 4X64L 2UXDL 2H1EA 3MXNA 3PGZA 4KKUA 4A3BG 3CXCA 1SMYC 3TZDA 1DOMA 3DEPA 3W2DA 3JAMc 4BBRH 1VQ4A 4CBVA 3TS2A 2NZ1D 1BCPB 4OIJA 3MTSA 3A5UA 2R93B 1VS0A 3K7AH 4R1JA 1VQGA 4F88A 1K3RA 4B3TL 3CRLC 1EFWA 3VA5A 1BR9A 1Q1EA 3BVMA 3HOZB 2K01A 4QQBX 2HHHQ 1MSGA 1PRTF 2D5DA 1LLRD 5C4JB 2D0PA 5FJ8H 3CAMA 4J6HA 4DR4Q 5C0XH 1PV4A 4LUVA 3KDFA 4KY5A 1X6OA 3NXWA 2WAQB 3X3MA 4PZ7A 4JI7Q 5IGCA 1L0XB 1J8IA 4YCUA 1PH6A 1CZWA 4DK3C 5C3EH 3S1QB 3I91A 2K5NA 3OIQA 4BWGB 1E3PA 2OTJA 2Z0SA 3GV3A 2OWOA 4BBSH 4DV6L 4K6LA 4H7BA 4PZ8A 1IBKL 1UNSA 3A0JA 1CHPD 1AE2A 4A3GG 1HNZL 5C44H 4ZRZA 2H4OA 2R7ZH 2FMCA 2RQXA 1RKNA 5FO8B 3WOFA 4R4QA 5IT9c 2PZWA 4JI6L 2NN6I 3I8ZA 1V9PA 1BCPD 4DAPA 1YJNA 3S2HB 1X3PA 1PH9A 2PI2A 4DR1L 3H94A 3GTQH 1NSNS 2YU9H 2F0SA 1RJTA 2B29A 3I4MB 1B1ZA 2F0HA 1TWHH 2J7ZA 1H9RA 4CKBA 1WTHA 3J80c 2E2HH 1LTAD 3KYHC 4KHVA 1EZ8A 4L5TA 1N36L 4JI1Q 3HOXH 4L8JA 5C4XH 1O7YA 4A3EB 2EYLA 4FF1A 1HCZA 1SN8A 4GOPC 2AHOB 3A7AB 5FLXL 1A8VA 2F0EA 1H95A 5HURA 3S17B 4B08A 2V4DA 4NXMQ 3I4NG 1ENAA 3MXNB 2E5LL 4OWXB 3CCVA 3S2DH 2IW3A 2CFMA 3BZCA 4P75A 3I3CA 3Q8DA 2IPKD 2BDOA 3QWNA 1WTPA 1EU4A 5JEAJ 2NVTB 3HKZE 4PV1C 1Y1VB 5COYA 2K5VA 5EGTA 1M90C 3FPPA 3FEWX 1TWFB 1E2ZA 2EJGC 1IYUA 5IP7G 4A3KG 2LY7A 1WOCA 3PIO3 1HZAA 4JCVE 3EJIA 4X65L 4DV0Q 2JQOA 2LMCB 2Q2IA 3DLLA 2L5TA 1CKMA 1QZHA 3HOVB 3SK8A 2NN6G 1SSOA 5TSSA 4H0LC 1GHKA 3TSSA 5CV9A 5IP9H 3RZOB 1QB5D 1SXTA 4DKAC 4A3BB 4DR3Q 2JXMB 1TR5A 2C35B 3G71A 2JA6H 2GA4B 3J81E 3N52A 4DV5Q 2MGSA 4MZ9A 2D0OA 1CQFA 3D4DA 1GUGA 4G7HC 3PQIA 2Q8IB 1CI3M 2D2CC 5HY6A 5A2QE 4A76A 1EY6A 3KLSX 1PRTC 1IL8A 1PH5A 4DNTB 1QILA 2F0OA 1Z7TA 1LT6D 2EY5A 3PUZA 1RIPA 3FDTA 1EIYB 1G51A 3J7ZC 2QA4A 4DV3Q 4K2LA 1QJOA 1YNXA 3D4WA 2XSCA 4DV1Q 1IBLL 5ELOA 5JJZA 4AQYL 4RKLA 2A6HC 3N6RA 4C3IH 5GROA 1B3AA 5I6WA 1A62A 1GHJA 2B2YA 1XPUA 2EJMA 3OWEB 3D3RA 4LF5L 5FLMG 1TWAH 3ULLA 2NVQH 4XYQA 3JAML 1YVCA 1SDFA 2XIWA 4FYDA 1JJCB 2HT1A 1AEXA 4A3GB 3X3NA 1QUQB 4A3FH 1SNDA 3Q0AA 1PHJA 1A3VA 1D1KA 2VQFL 5C4XB 2F0JA 2PW5A 4LMQD 1JB3A 2YYZA 4A3DH 2VUMG 3CHBD 1N9WA 3UE0A 1UE6A 3J81i 5KNCA 2CWPA 4BXXH 1DXMA 2JYOA 4A3JH 4K14A 4LF4L 2KBNA 1I94Q 4B3RL 4X66L 4POFA 4DR6Q 1G6PA 3QJYA 1W6JA 1UWVA 1JCKB 1PH2A 3ONAB 1K9MC 1LABA 2G9DA 1GD7A 1A63A 5IGDA 1JE5A 1ICWA 3RLNA 2ATWA 3TMEA 4DAVA 4HJAA 2N88A 1SYEA 4MIUA 2JA8G 2BH8A 2K28A 2Y0SE 1BCPF 3NQIA 4A3LH 1B44D 1G91A 2M2LA 4LF8Q 2F0VA 2BE5C 5IT9L 4C3HH 4NMZA 1PTOH 3I4NB 1HR0Q 4BY7H 1VMPA 4JC0A 1S4ZA 4AYBG 5AFWA 1JWMD 1DD2A 3KOJA 4RGOS 3CMEA 1Q86C 1HQMC 2O4XA 4OO1I 1A3TA 2WB1B 1SRUA 3CW2C 1DOKA 4ZUIA 3KFUA 1T5XD 2CH4A 4BY1G 2JA7G 1DGSA 2M9VA 4A3KB 3MZ5A 2MPMA 1PFBA 1YNNC 4OIKA 2A69D 3PO3G 3CC2A 2OEOA 1PVOA 5D3IB 4K5XA 1LTRD 1D2BA 1LO5D 4R4IA 3LWEA 1LT4D 5LMNQ 3E0JA 3M4OH 2IHEA 2JP1A 1XNQQ 4NXNL 4JW0A 1EY8A 4HN7A 1PYSB 4P2CB 4LFCL 4ULLA 1KAWA 1HTPA 1DCZA 3FMCA 5JPNC 1I6HB 1B53A 4G7OC 3H09A 3SGIA 4FO2A 1WTRA 4A75A 3S16H 1AW7A 4GN3B 3T1HQ 5F2DA 4CJ0B 1R9TH 4BA2I 2QKIC 1M1KC 3OMCA 5M3FG 1QZGA 5LL6X 3J80E 3B6YA 3STBC 3FKIG 3VYSA 2N8NA 3H0GG 4K5VA 1EWHA 1N8RC 3VYRA 1PFSA 2E76C 5D3DA 1K83H 1QE6A 4JI8L 4QL5A 1V43A 2RBMA 5CGKA 5GAEC 1EYAA 3ZJYC 4OX9L 2B39A 1NTGA 3ERSX 1D5ZC 4H13C 1Z6HA 1I4HA 1TT2A 3VR2A 3D8GA 1BBXC 4V0BA 3CCEA 1RF2D 1FNUA 2RDFA 1UE1A 4RGTA 3PIPA 1STHA 3MA2B 1YNJD 4JG2A 2E8GA 2LS01 4IFDI 4C1NI 1BQQT 1EWIA 3QR8A 1RTNA 4OO1G 3KLWA 4TSSA 4GKJQ 4OGQC 3E9IA 4FF4A 5CV6A 1BDOA 1VQLA 3AQQA 1IYJB 3GTGH 3M9BA 3SHLA 2UU9L 1Q7YC 5LL6S 2A8VA 2FHTA 5IYBH 1OO9B 1BKBA 2N78A 2MP1A 5EBCA 1SAPA 1VQKA 1SMXA 2B2TA 2AQ2B 3DWAA 2VUMB 2MNAA 1QVFA 4A3IH 3GTJH 4RCNA 4HR7B 3HG9A 3HRZC 1AZPA 4YWLA 1RTOA 1I50H 2PCFB 1Y1WB 4JI4L 1WTWA 1EY5A 2EE1A 2Q2TA 2L1BA 3H3VI 2VQFQ 4S3SA 2VQEQ 3J80i 1A2UA 2XVSA 4OXPA 3HOWG 4FF3A 1X32A 5M9OA 2HCIA 1IHZA 4JI5Q 5KYLA 1WD0A 1TS3A 3NK9A 4RWSC 1X3FA 5IYCH 1E22A 1YBYA 3HOZG 3QIAA 1BCPC 1BO0A 1U4LA 1SNCA 3AFQA 2B63G 3M3YH 5EBDA 4JI2L 1I3QB 3MXGA 3L0OA 3J7YW 2JJQA 4XYOA 4KHPL 4YWKA 2A74C 1NR4A 1QVCA 5JJKA 1EYDA 3PUWA 2WAQG 4YWMA 4AH6A 1C8CA 2EXDA 1XTDA 2PPBC 1PH7A 1SNQA 1UEAB 5C4HA 2I46A 4AYBB 1VQ8A 4IFDG 5IGEA 4Q5VA 2UXBL 1A2TA 2VL6A 4Q0FA 2Z9HA 4N9PA 4DV4Q 2E2JB 1C48A 4IQZA 2K5QA 3S24A 2PQAB 4BY1B 5L37A 1SLJA 1JMCA 4J15A 1TY2A 5IWAL 2A19A 4LWCA 1O7LA 1PH8A 2ZJRA 4OWWB 3PO3B 3DXJC 3TP8A 1GOZA 2BH2A 1F9RA 3TP6A 4G4KA 2Q8TA 4EGVA 2D9UA 5J3BA 1BBUA 5M3MH 1EWCA 5C0XI 2IX3A 4YHHQ 4GS3A 1ZKOA 4HJ8A 4JYAQ 5E4WC 4DR2Q 5D14A 1JOOA 2VW9A 3H15A 1ICFB 2MJ8A 1FNVA 1CUKA 1F9SA 3K5NA 2ZXRA 4YY3Q 1CKNA 4L63B 4X6AH 3S1NB 4A3CG 3MXUA 5EPLA 2Z6KA 2AWNA 3CQZH 1K0SA 3CCUA 3H3VC 2RDHA 1TWGB 4IURA 1DOLA 1LTSD 4NKLA 3FKIB 1SROA 3VR4A 1TS5A 1LTBD 5EAYA 1X54A 2EJFC 3UDXA 1VQJA 2HIVA 4DV2Q 2BDNA 3E9HA 4ZCKA 5DAUA 1HRJA 2G5DA 1N33L 1KDBA 2XRSD 2KHIA 4ZKBB 4HIMA 3NPPA 4DAYB 4CHTB 3PIP3 4A93H 1Q90A 1P16A 5CORA 1WFQA 2CQAA 5AJ3Q 2B2WA 4PMWA 5JPMC 2RCNA 3SVMA 1HHVA 1FGBD 4A3MB 2JK8A 3U4ZA 3G4SA 5CR3A 1ZYRD 1Y1VG 4BBRG 3ER0A 3L9AX 1JJGA 2MUYA 3NBIA 3K80C 4FXDA 3D6WA 3NWSA 1CQVA 3VDYA 1HXYD 4JBWA 1J5EQ 4LFAL 4WRDA 4RA8A 2DJGC 2N55A 1NY4A 4JOIA 3K59A 1EIGA 4HIDA 3HOVG 3HOUB 1PZJD 4KN7C 1G6ZA 2HD3A 4EQ5A 5FJ8G 5C5LA 3U4VA 5C0XG 2AWOA 3V05A 2SDFA 1KLUD 2M00A 3GO5A 2Z1CA 4ODGA 4CDFC 1RHPA 1OXUA 2K6AA 5C3EG 5E3FA 5M5WH 1B9NA 1QG7A 1LTLA 2AKWB 1MKHA 1EL0A 3F2BA 4R4CA 5CBAE 5IY0A 4MTNA 5M5YH 3HOWB 1LACA 2QILA 2PQEA 3D0FA 2UXDQ 1AE3A 3AEVA 3DUZA 1W2BA 1NNXA 2QW7A 3HKZB 3OWFA 3MHBA 1YITA 5LHY1 4ZUJA 4CDDC 4JI0Q 3GTKB 2QEXA 1OXXK 4RGMA 5C44G 4TKOB 4C2MH 2B63B 3A5ZB 2HHHL 2R61A 2NVYB 4MTKA 4H44C 1WCMB 1ASZA 5CV7A 1VQIA 2WIIB 1MHWC 2CQOA 2K75A 2ZT9C 1NAPA 3S1RH 4UP8A 4R8NA 2DNCA 4KD3A 3CC4A 4AIMA 4I7ZC 3E6ZX 4JI7L 2X69A 2K32A 5DNFA 4LF6Q 2AUKA 3PUYA 1B9MA 1DM0B 1CKNB 4LNQA 1GXDC 1SFOH 1ESFA 1Y8OB 4U68A 1YHAA 1FNWA 1G2TA 1VF7A 2KEEA 3IFDA 2HUGA 1ILPA 3BDCA 3SEBA 2SOBA 3T56B 1NMFA 2G9HD 5GADC 3HOXG 5E7NA 1WTQA 1EQTA 1UE5A 3MFYA 5C4XG 1HQRD 2AQ3B 2EXZA 3M85A 1WTOA 5BR8Q 5IYDH 5ELDA 4FXGC 4HJ9A 4UP9A 3GTOB 4RHRA 2DY8A 2JA5B 1U4MA 1IYVA 5EPKA 1K8MA 3AU7A 3SXHA 1UAPA 5LMUQ 4LUOA 3TP7A 3S14H 4O2DA 1GJXA 1Y69U 5IODA 3PMFA 5C4ZA 4MHEA 4JI6Q 3F1ZA 1VCIA 3TZUA 3RUZA 2A69C 3PF5A 2K50A 2EY1A 4KKTA 4EQNA 5GAGC 1STNA 3KLRA 2FJ2A 3P75A 4X3SA 1JWSD 4OL7A 2F3VA 1QUQA 1QCBD 4ZKCB 4JI1L 2UUBQ 4IJHA 3PO2H 2A1AA 1STGA 1TIID 1KDCA 3K57A 2R6GA 2SNMA 4NW2A 1SYCA 4DR7Q 1E0BA 1Q46A 1FJGQ 1PMRA 4UDUC 4L5QA 2BA0A 1N36Q 5CV5A 1Q81C 3K58A 3G48A 3BDOA 3FVQA 5NUCA 2LXKA 3BJUA 2L55A 2K33A 4NXML 2BCOA 1LTID 3A7LA 3RZDH 3BYYB 4CKEA 3NTKA 2XN9C 2WB1G 5C5MA 4CJ1B 1PH1A 4IFDJ 1RCVD 4BBRB 1F2YA 5FK9C 1FR3A 1MJEA 4RGNA 1U0LA 4K5WA 4POGA 4KY6A 3K7AB 4DF7A 1HUMA 3MEHA 1RDPD 2NUCA 3BG3A 3G7LA 1B2TA 2WINB 2F3IA 3K81C 4JI3L 1I5FA 4DV0L 3MFGA 5FLXE 2HQLA 3NTIA 2ZTCA 1YNJC 1JT8A 2Y0SB 4HIKA 2JA9A 3HKSA 1EIHA 1AFPA 1PFNA 1U4PA 3GP7A 1SE4A 4Y7NH 2DUDA 3NP8A 1S5FD 2Z6BA 1EY4A 4FNFA 2F0IA 1STEA 3EROA 4QB4A 1TWCH 3F2UA 4DR3L 2IY5B 4KJNA 2EIFA 2QF7A 3TBIB 4L5SA 4IPHA 5C3EB 4KJOA 4DV5L 5KEEA 2B2YC 4XIGS 1L1OB 2MO1A 4P72A 1KTKA 3BVGA 5C3WA 4BBSB 4RCOA 2C9OA 4JVZA 3HP3A 3C46A 2CKZB 1TVXA 1HR0W 5CMDA 3VR6A 1D5XC 1XYIA 5C44B 3VR5A 2E2IH 2AQ1B 2C5CA 1PLFA 3U50C 2R7ZB 3PV0A 2ZM6Q 1XMOQ 4XQQA 2QDLA 4DV3L 1AZQA 4I7AA 4A3DG 2QGQA 3FPUB 1BOSA 2I5LX 2KCCA 4DV1L 1HFNA 4WJWA 1L2FA 4JV5L 2RVLA 3QB3A 1SR3A 2OT2A 4J8QA 3T53B 2PYKA 4BXXG 4DXFA 3GTQB 4QF4A 3DWPA 1STYA 4CDCC 2R3ZA 4DUZQ 3UI2A 2YU9B 2NZHA 4G7ZC 2I0QA 4ZK9B 3I2ZA 2VB2X 1XMQQ 1TWHB 4B9WA 2WACA 2DGYA 4N8FA 1VQOA 2E2HB 1H9KA 3P7JA 4UP7A 3DEOA 2L0CA 3F8TA 2ES2A 4O42A 1IKMA 1S5BD 3URYA 2CW0D 3HOXB 1MSHA 1OXTA 3O13A 4A3LG 1TY0A 4K6DA 4LF7Q 3NELA 1YEZA 3S1MH 3R93A 3L2PA 2X6LA 4X3KA 2B2VC 3TEHB 4DUYQ 3I7FA 5ELCA 1Y1WG 3T1YQ 2F0LA 5C0XJ 1KXLA 3Q24A 3CKIB 2EZVA 4XXEA 3I73A 4C3JH 3IL8A 4BY7G 2VB3X 4APVA 5C3XA 1B3QA 2B2UA 3S2DB 1W3SA 3OTOQ 2F0DA 4PMBA 2UUAL 3AB9A 3DM1A 1O78A 4DR6L 3JAME 3ND8A 2ENBA 4KLKA 1I6VC 2N3SA 4GKKQ 3V96A 3WOEA 1J6QA 4ME5A 1NMGA 2JN4A 3RD4A 3J7AF 3Q6SA 4X3UA 2B2VA 2ASBA 1Y8PB 4X66Q 1SE3A 1ASYA 2K14A 1HNWQ 2LFNA 4TVAB 4LF8L 1AN8A 1VQ6A 1STAA 1KABA 4O0AA 3CP0A 2AUJD 3GV6A 4PMCA 3BYTB 1B70B 3C3LA 4E6IA 5KGUA 1D6EC 1HR0L 4HTHA 3GTLH 1AH9A 5ISRA 2JA6B 1MBYA 1U5KA 2ZJPA 5JJLA 1YZ6A 2KJXA 2RKSA 1GUSA 1CM9A 2EYMA 4OONA 2HDMA 4ZYSA 4B3SQ 3SK6A 4IZ8A 1SNOA 2L15A 3KBXA 3HOYH 2RDGA 1EY0A 5GAHC 1Q12A 3SR1A 1YIJA 1IBML 3ULJA 3EN2A 5IT9E 1HZCA 1ILQA 1XNQL 2NVXH 1K28A 2UUCQ 2OXPA 3RN5A 1X3QA 1ZYRC 1FL0A 2EOTA 5JVG3 4C3IB 2R92H 1F2ZA 1DJRD 2F0UA 1TXYA 4LJZC 3JAMi 2JA8H 1BNZA 2PNHA 2QEJC 1CZGA 1G291 1IL2A 1GVPA 2CWAA 4NXNQ 2NTTA 2F0KA 4LK1C 1TWAB 1SJED 2PQAA 1LUZA 4HCEA 2NVQB 5ELFA 2XWJB 4A4IA 2SEBD 1D7QA 4HSPA 1SYDA 2O5IC 1R4QB 4WORA 3KF6A 4A3FB 2EPBA 5IYBG 2E74C 4Y52H 1BXTA 3DHQA 4RMFA 4CDEC 4OEMB 4A3DB 1WTVA 2MO0A 5KNBA 2JA7H 1XWEA 4B3MQ 1MJCA 1D5MC 2B2TC 2GN5A 3MEFA 1X3GA 4JI8Q 3CCSA 2K4KA 2KCTA 1LT3D 4A3MG 1N34Q 5T1IA 4A3JB 4OX9Q 1RD9D 2F0MA 3NSWA 4DNIA 4O1NA 2L9HA 2ZTDA 1HA6A 2KHSA 3T13A 1JOQA 2F0GA 3NE5B 3ICEA 5JAVA 1C4QA 1C9OA 1HTLD 2LXJA 3P1HA 3AMUA 5M5XH 4GNXA 2O2LD 4LF9Q 3L3OC 5IYCG 2N49A 1DYQA 3HOUG 2KUMA 4KTAA 3SK4A 3T51B 5K5PA 1SJHD 3EA6A 1KL9A 1SNMA 2L12A 4IUVA 4X3TA 1X65A 1JWUD 5M3FH 3C2PA 1N32L 2J4XA 4JBKA 3S15H 4LFBQ 2RHSB 4DAYA 4C3HB 1K8AC 4UY8C 4P73A 2UU9Q 3H0GH 4R8IA 3SDZA 3GTPH 1Q3LA 3A54A 1PTOB 3UDGA 1PYBA 2UXCQ 2CHBD 2CH4W 4BY7B 1D1IA 1VQCA 5IGBA 3K7UC 3QOJA 5J22A 2VQEL 3IRBA 4NPSA 2F0PA 2AMCB 3HKZG 1ET9A 4IUNA 3CMAA 1EU3A 1C7YA 4JI5L 3RLFA 1HNXQ 3A74A 5CYUA 5EKLA 1J9OA 4FXKC 3PSIA 1WCMG 2A6HD 2Q2UA 3M4OB 4IPCA 2ID0A 4ZAIA 4UPAA 2NZOA 4QY7A 5JVH3 1UUPA 2F4IA 5G3LD 1XNRQ 1PZKD 4GN4B 3K5LA 1NR2A 4PZ6A 4DA2A 5EKKA 1Q1BA 5CV8A 1JB7A 2HCCA 3S16B 3CPWA 4FDBA 3FHWA 3A56A 5E4XA 1R9TB 4DV4L 1E2WA 3RMHA 3NHHA 1QVGA 2OTLA 1Z47A 3NUCA 2K5WA 2ZXOA 5KNDA 1VQNA 4X62Q 2Z6KC 4KI0A 2K1BA 1NJIC 1PTOD 3KF6B 1X3EA 5K36H 3KJPA 1K83B 1PYWD 2R93H 2JA5G 4JBMA 2HDLA 3HGBA 4B9XA 5IWAQ 1I4PA 4KD4A 3HOZH 4YHHL 1IZ6A 2F4VQ 4JYAL 4A93G 3PCOB 1EQVA 5C4JH 4DR2L 1KC8C 4DAMA 4FVMA 3DMUA 3ERQA 3QG1A 2Q8RE 4YY3L 1FGUA 4IOCA 5H1SE 2B2WC 1ONLA 5CC4A 3CF5A 1WYDA 1MI2A 1SYBA 3U9OA 4LAAA 1VQHA 4DV7Q 3FP9A 1V1PB 5JEAH 1EYGA 1GM5A 4GNXB 3S1QH 2ICIA 3TS0A 2GVBA 1D8LA 2IJ0A 3GTGB 2EYHA 1K0RA 1Q8IA 1VQAA 3WDNA 3K0YA 1R4PB 2F0TA 2NTSA 2I07B 3PF4A 3R8BA 1ET6A 2VY3A 1OTCA 2K03A 4RAUC 1H9JA 4DNRB 4DR5L 4JOIC 1EZ6A 3A55A 4A3IB 3GTJB 2QCPX 4K0KQ 2PMZB 3M4YA 3U58A 1KLGD 1EUJA 1XX8A 5I4DA 3NQTA 1HH2P 1I50B 4XT3B 2F3WA 3K5MA 1ML0D 3GD7A 1EY9A 3PUXA 4N8X1 3AYHB 1HPCA 1NCVA 4NP5A 3S2HH 3SE0A 2KCMA 1FD7D 1TKWB 1YHBA 3LNNA 1LT5D 1ZXTA 1CSQA 3HZXA 1YJ9A 1SYGA 3H3VH 3R2TA 1OXVA 1UEBA 3H91A 1J5EL 3I4MH 1BVSA 1SE2A 3M3YB 1VQ9A 4A3CH 1YI2A 2GVAA 1QNKA 2Y0SG 1H9SB 1EOTA 3EBEA 3CCLA 1VQFA 2XTIA 3VR3A 3BZDB 2H5XA 5CBEE 4U673 2PZUA 1E1TA 2YTYA 2MFIA 3TDQA 1O7ZA 4A3EH 1YJWA 3UDIA 1VQPA 1V1OA 2CW0C 1XTCD 3S17H 3EFXD 4BBSG 3OMGA 4X64Q 5I9PA 1VQDA 5IOCA 2EYJA 2NYZD 1IW7D 3CCMA 2NBFA 1M4VA 1CA6A 4JBJA 1L1OC 2EQSA 4JI0L 4HEDA 2NVTH 1VQMA 2R7ZG 1LTGD 3TQYA 1GUNA 1Y1VH 2A6ED 4RHSA 3J7A5 1TWFH 5IYDG 2WFWA 4DR4L 4B3TQ 3HFZB 1JQYD 5M3MB 5ELEA 1EY7A 4KHZA 1O7IA 1QOHA 3A8JE 2LSSA 1SNPA 3W1BA 4WJ4A 4XT1B 1CK1A 3HOVH 2F0FA 5HGTA 4LF6L 1KDAA 5T1GA 1L1OA 3HS0C 3BS1A 2K52A 4YCVA 2F52A 2A68D 3RZOH 3D4RA 3CQZB 1G2SA 4A3BH 3EVQA 4WFN3 4FP5D 3GDEA 4RG1A 4P71A 3ZYYX 2NWGA 5IGGA 2XWBB 1E24A 2D62A 4DV6Q 3PO2G 4CGYB 1KRTA 2PMZE 3H6MA 5G3LF 1EQRA 1IBKQ 1K8OA 1GUOA 3E0EA 5BR8L 3PUVA 1B4OA 4IO9A 1HNZQ 4XQNA 4IUUA 2KQ3A 4KK7A 5LMUL 4A93B 3UE1A 2YV5A 1GKHA 1A15A 2OQKA 1EQQA 2Z4IA 5BN3A 1PH4A 1KNEA 3NENA 2WKCA 2O5JC 4KMUC 1F9PA 1PTOF 4DR1Q 4H02A 4ALPA 2JE6I 2KVMA 3VYTA 2FINB 3IKJA 4CKCA 4DFAA 1Q8KA 4NB3A 4OELB 2UUBL 3M7GA 4DPGA 5J1ZA 2ZTEA 2EY2A 4CJ2C 3VA7A 4EQPA 2RSNA 4R9WA 4A3GH 4DR7L 1KHIA 4UAIA 1FJGL 2K05A 4IALA 5IP9G 4LW1A 2F1MA 2JA6G 4QIWE 3RNUA 2IX1A 1EEID 5E1FA 4ZQ3A 1S5ED 5M5WB 3W1GA 1PFMA 5M5YB 2YTVA 3OIPA 4N9TA 2E5LQ 1Y8NB 3J7AV 2RF4A 1KQSA 4IUQA 3QOLA 3NTHA 3IAYA 1WD1A 1EIFA 4IOAA 2TSSA 1CHQD 2TMPA 3IFTA 3J81L 4C2MB 1V1QA 3G6JB 1SEBD 5DM73 3RLOA 1ENCA 2X6GA 1II3A 4C3IG 4DK0A 4X65Q 1ESRA 1T9HA 3TN2A 4GOPA 3S1RB 3RN2A 5A2QL 3CCQA 4Z9CB 2CVRA 2A73B 4JI3Q 4KV6A 3Q23A 1T5EA 2LKVA 2R7FA 1CFMA 2RHQB 5KRUA 2WAQE 3AFPA 2EDGA 4QUFA 1SFOB 1VQEA 1F2LA 2JEBI 3CRKC 4UHVA 3KDFB 3I4NH 4EVOA 4DXGA 4MNOA 2PNRC 3R2IA 3TRZA 4A3FG 1SE8A 1Z9FA 3M4PA 1BUVT 2VS1A 3C1EA 4PQXA 3F2CA 5DLQE 3RR5A 2L4NA 2ZM6L 5JOBA 1W6KA 1XMOL 5IP7H 4A3KH 4TRDA 5JJIA 4R4TA 3JC66 3I72A 5KYIA 3E3XA 3I56A 4C3JG 4A3JG 3S14B 1MD2D 2KA7A 4M8AA 5LMNW 2KHJA 4DGZA 2NN6H 2DJFC 2RCFA 1IBLQ 4DUZL 4DU9A 4AQYQ 1B8AA 5FO9B 3D31A 4DK6C 1XMQL 1C0AA 4JV5Q 2B2UC 5EKIA 1I6HH 1K3BC 1JR0D 2Q2HA 3DM3A 2I5HA 4LF5Q 4RH6A 5BN4A 1XJVA 4YIJA 1X55A 3PO2B 4K8JA 2BOSA 4LF7L 1STBA 1SMYD 4C3HG 2F0QA 2CCZA 3OYYA 4XTCS 3TREA 4DUYL 3MC0B 3T1YL 1TS4A 1EEFD 2WP8J 5FKAC
chains in the Genus database with same CATH topology
5M5XH 2R7DA 1TWHH 4GNXA 2KHIA 4LF9Q 5IYCG 4HIMA 4DAYB 3J80c 1I94L 2E2HH 4A93H 2N49A 1P16A 3OTOL 1WFQA 5AJ3Q 3HOUG 3KYHC 4PMWA 2RCNA 1KL9A 4L5TA 1N36L 4JI1Q 3HOXH 1X65A 2JK8A 2IHFA 3U4ZA 4GKKL 1LM0A 1A0IA 5C4XH 3G4SA 5M3FH 1N32L 1Y1VG 4LFBQ 4JBKA 4LF4Q 3S15H 4BBRG 2RHSB 4QJFA 1K8AC 4UY8C 1UE7A 4P73A 3ER0A 1SN8A 1HJPA 3H0GH 4GOPC 2AHOB 2UU9Q 4B3RQ 5FLMH 1JJGA 1XPRA 3K80C 3GTPH 2UUAQ 1A8VA 3HOYG 3UDGA 3VDYA 1PYBA 2IT1A 4JBWA 1J5EQ 2UXCQ 1H95A 1VQCA 1KD1C 4LFAL 3K7UC 1CKOA 2UXCL 1P8LA 2ZJQA 1NY4A 1HNWL 4NXMQ 4JOIA 2VQEL 3I4NG 3MXNB 2E5LL 3IRBA 4HIDA 1FVIA 4OWXB 3CCVA 3HOVG 3S2DH 2OCEA 4QGUA 2JEAI 2K5HA 4NPSA 1Q82C 4GOPB 2CFMA 3BZCA 2AMCB 4EQ5A 4P75A 5FJ8G 3Q8DA 3HKZG 3U4VA 4IPGA 2R92G 5JEAJ 3CMAA 5C0XG 2AWOA 4JI5L 3RLFA 1C7YA 3HKZE 1HNXQ 2K5VA 3A74A 3NEMA 2VUMH 2V1CC 1GO3E 1M90C 3GO5A 1NE3A 1XPOA 5IP7G 4A3KG 3PSIA 1WCMG 1WOCA 1Y1WH 2BA1A 1OXUA 1HZAA 4JCVE 2Q2UA 1WJJA 2VZAA 4X65L 4GLXA 5C3EG 4DV0Q 5M5WH 2JQOA 4IPCA 1LTLA 2AKWB 1MKHA 2Q2IA 3F2BA 4R4CA 2ID0A 3DLLA 5IY0A 4UPAA 3I4OA 4IPDA 1CKMA 2NZOA 4MTNA 4QY7A 5M5YH 1QZHA 3D0FA 4B3SL 2UXDQ 2NN6G 1AE3A 1X56A 3AEVA 1XNRQ 2XGTA 1W2BA 3W5OA 4GN4B 1YITA 5LMNL 4JI0Q 1MIUA 4PZ6A 1IXRA 2QEXA 1OXXK 1Q1BA 4GLAC 5IP9H 5C44G 1JB7A 3CD6A 4C2MH 4DKAC 3CPWA 4L5RC 3A5ZB 4FDBA 4DR3Q 2HHHL 3FHWA 4IJLA 2C35B 3G71A 2UUCL 1NBWA 4DV4L 1ASZA 1HZ9A 2JA6H 1QVGA 2OTLA 1Z47A 4DV5Q 1VQIA 1I3QH 1E1OA 2CQOA 2K75A 3S1RH 4MZ9A 1VQNA 1IBMQ 4UP8A 4X62Q 2Z6KC 2D0OA 4KI0A 1S40A 3CC4A 3T1HL 1PH3A 4AIMA 1NJIC 2PI2E 3KF6B 4LFCQ 1X3EA 3KJPA 5HY6A 4JI7L 4A76A 4EX5A 4LF6Q 2R93H 3PUYA 1PH5A 1CKNB 4LNQA 1SFOH 4GN5A 2JA5G 4JBMA 5HGQA 3PUZA 1RIPA 1YHAA 4HIOA 1G51A 5IWAQ 3J7ZC 2QA4A 4DV3Q 1EIYB 3HOZH 4YHHL 1IZ6A 2F4VQ 1YNXA 4JYAL 4A93G 3PCOB 4DV1Q 1IBLL 5ELOA 5C4JH 2E2JH 4DR2L 1KC8C 1JJ2A 4AQYL 3BZKA 1NMFA 4DAMA 4GNXC 4C3IH 4BY1H 3M4QA 5GROA 5GADC 3ULPA 3HOXG 5E7NA 1L0WA 1A62A 4YY3L 4A3IG 1UE5A 1FGUA 1XPUA 2KENA 3F2DA 5H1SE 3M85A 4IOCA 5C4XG 2MQHA 4B3ML 3CF5A 1WYDA 3PO3H 5BR8Q 5IYDH 4LF5L 1VQHA 4UP9A 4DV7Q 4HJ9A 5FLMG 1HZBA 1TWAH 3FP9A 3CCRA 1GM5A 1EYGA 3ULLA 4GNXB 4HJ7A 2NVQH 3S1QH 3TS0A 1N34L 2GVBA 1D8LA 5LMUQ 1K0RA 1YVCA 1VQAA 4LUOA 3S14H 4O2DA 4GKJL 1CSPA 2I5MX 1JJCB 2HT1A 3PF4A 2VY3A 1OTCA 1QUQB 4DR5L 4A3FH 3F1ZA 1RL2A 1VCIA 4OWTB 4JI6Q 4JOIC 3PF5A 2K50A 1PHJA 2VQFL 3CPFA 1LYLA 5GAGC 3U58A 4K0KQ 2YYZA 4LF9L 1EUJA 4A3DH 2VUMG 2VNUD 1HH2P 3S1NH 1N9WA 3UE0A 1UE6A 3J81i 1QUQA 3GD7A 1VQ7A 3PUXA 1EOVA 5ELNA 1TWGH 3AYHB 1VQBA 2CWPA 4JI1L 2UUBQ 4IJHA 3PO2H 4BXXH 3S2HH 2A1AA 3FKIH 2KCMA 4A3JH 3GTMH 1OXSC 4LFBL 4LF4L 1WI5A 2KBNA 2R6GA 1YHBA 3NBHB 1I94Q 4B3RL 4X66L 1CSQA 4POFA 4DR6Q 1G6PA 4DR7Q 1Q46A 1YJ9A 1FJGQ 1S3OA 1UWVA 3H3VH 4L5QA 1OXVA 2BA0A 1UEBA 1S72A 1Q81C 1PH2A 1N36Q 1J5EL 1K9MC 3I4MH 1GD7A 3G48A 1BVSA 4NXML 2LXKA 3BJUA 1N32Q 1VQ9A 4A3CH 1A63A 1JE5A 1YI2A 3RLNA 2ATWA 2GVAA 4HJAA 2Y0SG 4JI4Q 3G6EA 4ME3A 3RZDH 3EBEA 3CCLA 2JA8G 1VQFA 2BH8A 2WB1G 2XTIA 2Y0SE 3K8AA 1PH1A 4IFDJ 4A3LH 1E7ZA 2H5XA 2WB1E 4A3MH 4LF8Q 1HNXL 1MJEA 1E1TA 2YTYA 2MFIA 1U0LA 4A3EH 4POGA 4C3HH 5K36G 1YJWA 3UDIA 1VQPA 2R93G 2HIXA 2F3IA 3K81C 5M3MG 1HR0Q 4JI3L 1I5FA 4DV0L 3S17H 4BY7H 4BBSG 4JC0A 4YCWA 2HQLA 4AYBG 2ZTCA 4X64Q 1VQDA 3KOJA 1JT8A 3CMEA 1Q86C 4JI2Q 4HIKA 2JA9A 4OO1I 3CCMA 3HKSA 3HOUH 1XNRL 1SRUA 3CW2C 4JBJA 1L1OC 2EQSA 4PG3A 4KHPQ 3KFUA 4JI0L 1PA6A 4Y7NH 4BY1G 2DUDA 2NVTH 1VQMA 2R7ZG 2JA7G 1DGSA 2YTXA 3TQYA 1Y1VH 3J81j 1TWCH 4DR3L 2IY5B 1B7YB 1Y14B 2EIFA 4HJ5A 3J7A5 1TWFH 3CC2A 4L5SA 4IPHA 5IYDG 3I55A 2WFWA 3PO3G 1PVOA 3L7ZC 4B3TQ 4DR4L 3HFZB 4DV5L 3KF8B 4R4IA 4XIGS 1L1OB 2MO1A 4P72A 5JEAG 2OQ0A 3BU2A 4KHZA 5LMNQ 2UXBQ 3M4OH 2IHEA 1O7IA 4X62L 1XNQQ 4NXNL 2LSSA 3W1BA 3HOWH 4WJ4A 1PYSB 2CKZB 4LFCL 1K8GA 1HR0W 3HOVH 4LF6L 1KAWA 3OW2A 1L1OA 3GTKH 2E2IH 2K52A 3U50C 4YCVA 2F52A 3SGIA 3PV0A 5IE8A 2ZM6Q 4A75A 3RZOH 1XMOQ 3S16H 4DV3L 3T1HQ 4GN3B 2B63H 4A3BH 2QGQA 4A3DG 4BA1I 2F4VL 2NVYH 5FLXc 3GDEA 3KJOA 2I5LX 4RG1A 4DV1L 1R9TH 1WCMH 4BA2I 4P71A 1L2FA 1VQ5A 4JV5L 1M1KC 1SR3A 5M3FG 1QZGA 1E24A 2D62A 3B6YA 4DV6Q 3PO2G 4BXXG 1KRTA 3STBC 2PMZE 3FKIG 3CC7A 2N8NA 3H0GG 1EQRA 4DUZQ 1IBKQ 1K73C 1N8RC 2NZHA 3E0EA 5BR8L 1PFSA 2I0QA 3PUVA 1K83H 4IO9A 4DV7L 4JI8L 3I2ZA 4QL5A 3J81c 1V43A 1XMQQ 1HNZQ 5GAEC 2DGYA 3ZJYC 4OX9L 3ERSX 1NTGA 3I4MG 1VQOA 5LMUL 3UE1A 4UP7A 3CCEA 2FXQA 3F8TA 1X9NA 2YV5A 1UE1A 2ES2A 1GKHA 2OQKA 3PIPA 1EQQA 4DV2L 1PH4A 4TQUS 2B3GA 1OXTA 3NENA 4JG2A 3K0XA 4A3LG 2E8GA 4GLVB 1KRSA 4LF7Q 3NELA 1YEZA 4DR1Q 3S1MH 1EWIA 4H02A 3L2PA 4IFDI 4ALPA 2JE6I 4K0KL 3EIVA 4OO1G 3TEHB 3KLWA 5AJ3L 4DUYQ 4A3EG 4GKJQ 3I7FA 1Y1WG 3T1YQ 3E9IA 2IX0A 1N33Q 1Q8KA 4DR5Q 4NB3A 5C0XJ 1KXLA 3CCJA 3GTOH 4C3JH 1VQLA 2JA5H 2UUBL 4DPGA 4BY7G 4APVA 2ZTEA 3AQQA 1IYJB 3GTGH 3M9BA 2UU9L 1W3SA 3OTOQ 1Q7YC 2UUAL 2A8VA 3UDFA 5IYBH 1BKBA 2N78A 4A3GH 4DR6L 4DR7L 4KLKA 1VQKA 1KHIA 1SMXA 2N3SA 5GQOA 1FJGL 5IP9G 4GKKQ 4WJ3M 4LW1A 1J6QA 2MNAA 1QVFA 4A3IH 3GTJH 1NMGA 2JA6G 4P74A 4QIWE 4YWLA 1I50H 3RNUA 2ASBA 2IX1A 4JI4L 4X66Q 3PIOA 3W1GA 4LFAQ 1ASYA 2Q2TA 3H3VI 2K14A 2VQFQ 1HNWQ 2YTVA 2VQEQ 3J80i 4TVAB 1KIXA 2E5LQ 3WWVA 4LF8L 2RF4A 1KQSA 4LUZA 3LGJA 1VQ6A 4OXPA 4O0AA 3CP0A 3HOWG 3M7NA 1BBWA 1B70B 1EIFA 4IOAA 2ALYB 4JI5Q 3STBD 1YHQA 1HR0L 4R4OA 1X3FA 3GTLH 5IYCH 1V1QA 1E22A 1YBYA 3HOZG 3RLOA 1AH9A 4AYBE 4X64L 2UXDL 3PGZA 3AFQA 2B63G 3M3YH 4A3BG 1U5KA 2ZJPA 4JI2L 5JJLA 3CXCA 1YZ6A 4X65Q 4GOPA 1T9HA 3L0OA 2JJQA 3RN2A 3CCQA 4KHPL 4YWKA 4OONA 4JI3Q 3JAMc 1QVCA 4BBRH 1VQ4A 5JJKA 4B3SQ 2R7FA 3PUWA 2WAQG 4YWMA 4AH6A 3TS2A 2EXDA 3A5UA 1VS0A 2L15A 3K7AH 1XTDA 4R1JA 2RHQB 3HOYH 2WAQE 3AFPA 1VQGA 1PH7A 5GAHC 1K3RA 4B3TL 1Q12A 1YIJA 1VQEA 1IBML 1EFWA 3ULJA 1VQ8A 4IFDG 2JEBI 1Q1EA 3EN2A 3KDFB 1HZCA 3I4NH 2UXBL 4QQBX 2HHHQ 1XNQL 2VL6A 2NVXH 2UUCQ 4DV4Q 4MNOA 3RN5A 1FL0A 2D0PA 5FJ8H 3TRZA 3CAMA 1SE8A 1Z9FA 3M4PA 2PQAB 3S24A 4A3FG 2R92H 1SLJA 2VS1A 1TXYA 3JAMi 1PV4A 1JMCA 4LUVA 2JA8H 4DR4Q 4J15A 5IWAL 2A19A 2PNHA 3KDFA 1G291 5DLQE 3F2CA 1IL2A 1X6OA 4LWCA 3RR5A 2ZJRA 1GVPA 1PH8A 2CWAA 2ZM6L 4NXNQ 1XMOL 4OWWB 4PZ7A 5IP7H 4A3KH 4JI7Q 5JJIA 2BH2A 4R4TA 2PQAA 4YCUA 3JC66 1PH6A 4DK3C 1LUZA 5C3EH 2K5NA 5J3BA 1BBUA 1E3PA 2OTJA 3I56A 2Z0SA 5M3MH 4A3JG 2OWOA 5C0XI 4A4IA 4BBSH 4YHHQ 1D7QA 4GS3A 5LMNW 2KHJA 4DV6L 4HJ8A 4JYAQ 4PZ8A 1IBLQ 1IBKL 3KF6A 4DUZL 4DR2Q 4AQYQ 1B8AA 3A0JA 5IYBG 2VW9A 3H15A 1AE2A 3D31A 4DK6C 4A3GG 1CUKA 4Y52H 1XMQL 1HNZL 4YY3Q 5C44H 4JV5Q 1C0AA 1CKNA 4RMFA 1I6HH 4X6AH 2MO0A 2R7ZH 2JA7H 4A3CG 4B3MQ 3DM3A 1MJCA 2AWNA 2I5HA 2Q2HA 2Z6KA 3CQZH 4R4QA 5IT9c 3CCUA 4LF5Q 4JI6L 2GN5A 2NN6I 3MEFA 1XJVA 1V9PA 1X3GA 1X55A 4JI8Q 3CCSA 2K4KA 2KCTA 4A3MG 1YJNA 1N34Q 1PH9A 1SROA 4OX9Q 2PI2A 5EAYA 1X54A 4LF7L 4DR1L 4DNIA 3UDXA 2CCZA 3GTQH 3OYYA 4XTCS 3TREA 2ZTDA 4DUYL 1VQJA 2HIVA 2YU9H 3T1YL 3ICEA 4DV2Q 3E9HA 2B29A 1N33L 1C9OA 2LXJA 2WP8J
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5X H;  2R7D A;  1TWH H;  4GNX A;  2KHI A;  4LF9 Q;  5IYC G;  4HIM A;  4DAY B;  3J80 c;  1I94 L;  2E2H H;  4A93 H;  2N49 A;  1P16 A;  3OTO L;  1WFQ A;  5AJ3 Q;  3HOU G;  3KYH C;  4PMW A;  2RCN A;  1KL9 A;  4L5T A;  1N36 L;  4JI1 Q;  3HOX H;  1X65 A;  2JK8 A;  2IHF A;  3U4Z A;  4GKK L;  1LM0 A;  1A0I A;  5C4X H;  3G4S A;  5M3F H;  1N32 L;  1Y1V G;  4LFB Q;  4JBK A;  4LF4 Q;  3S15 H;  4BBR G;  2RHS B;  4QJF A;  1K8A C;  4UY8 C;  1UE7 A;  4P73 A;  3ER0 A;  1SN8 A;  1HJP A;  3H0G H;  4GOP C;  2AHO B;  2UU9 Q;  4B3R Q;  5FLM H;  1JJG A;  1XPR A;  3K80 C;  3GTP H;  2UUA Q;  1A8V A;  3HOY G;  3UDG A;  3VDY A;  1PYB A;  2IT1 A;  4JBW A;  1J5E Q;  2UXC Q;  1H95 A;  1VQC A;  1KD1 C;  4LFA L;  3K7U C;  1CKO A;  2UXC L;  1P8L A;  2ZJQ A;  1NY4 A;  1HNW L;  4NXM Q;  4JOI A;  2VQE L;  3I4N G;  3MXN B;  2E5L L;  3IRB A;  4HID A;  1FVI A;  4OWX B;  3CCV A;  3HOV G;  3S2D H;  2OCE A;  4QGU A;  2JEA I;  2K5H A;  4NPS A;  1Q82 C;  4GOP B;  2CFM A;  3BZC A;  2AMC B;  4EQ5 A;  4P75 A;  5FJ8 G;  3Q8D A;  3HKZ G;  3U4V A;  4IPG A;  2R92 G;  5JEA J;  3CMA A;  5C0X G;  2AWO A;  4JI5 L;  3RLF A;  1C7Y A;  3HKZ E;  1HNX Q;  2K5V A;  3A74 A;  3NEM A;  2VUM H;  2V1C C;  1GO3 E;  1M90 C;  3GO5 A;  1NE3 A;  1XPO A;  5IP7 G;  4A3K G;  3PSI A;  1WCM G;  1WOC A;  1Y1W H;  2BA1 A;  1OXU A;  1HZA A;  4JCV E;  2Q2U A;  1WJJ A;  2VZA A;  4X65 L;  4GLX A;  5C3E G;  4DV0 Q;  5M5W H;  2JQO A;  4IPC A;  1LTL A;  2AKW B;  1MKH A;  2Q2I A;  3F2B A;  4R4C A;  2ID0 A;  3DLL A;  5IY0 A;  4UPA A;  3I4O A;  4IPD A;  1CKM A;  2NZO A;  4MTN A;  4QY7 A;  5M5Y H;  1QZH A;  3D0F A;  4B3S L;  2UXD Q;  2NN6 G;  1AE3 A;  1X56 A;  3AEV A;  1XNR Q;  2XGT A;  1W2B A;  3W5O A;  4GN4 B;  1YIT A;  5LMN L;  4JI0 Q;  1MIU A;  4PZ6 A;  1IXR A;  2QEX A;  1OXX K;  1Q1B A;  4GLA C;  5IP9 H;  5C44 G;  1JB7 A;  3CD6 A;  4C2M H;  4DKA C;  3CPW A;  4L5R C;  3A5Z B;  4FDB A;  4DR3 Q;  2HHH L;  3FHW A;  4IJL A;  2C35 B;  3G71 A;  2UUC L;  1NBW A;  4DV4 L;  1ASZ A;  1HZ9 A;  2JA6 H;  1QVG A;  2OTL A;  1Z47 A;  4DV5 Q;  1VQI A;  1I3Q H;  1E1O A;  2CQO A;  2K75 A;  3S1R H;  4MZ9 A;  1VQN A;  1IBM Q;  4UP8 A;  4X62 Q;  2Z6K C;  2D0O A;  4KI0 A;  1S40 A;  3CC4 A;  3T1H L;  1PH3 A;  4AIM A;  1NJI C;  2PI2 E;  3KF6 B;  4LFC Q;  1X3E A;  3KJP A;  5HY6 A;  4JI7 L;  4A76 A;  4EX5 A;  4LF6 Q;  2R93 H;  3PUY A;  1PH5 A;  1CKN B;  4LNQ A;  1SFO H;  4GN5 A;  2JA5 G;  4JBM A;  5HGQ A;  3PUZ A;  1RIP A;  1YHA A;  4HIO A;  1G51 A;  5IWA Q;  3J7Z C;  2QA4 A;  4DV3 Q;  1EIY B;  3HOZ H;  4YHH L;  1IZ6 A;  2F4V Q;  1YNX A;  4JYA L;  4A93 G;  3PCO B;  4DV1 Q;  1IBL L;  5ELO A;  5C4J H;  2E2J H;  4DR2 L;  1KC8 C;  1JJ2 A;  4AQY L;  3BZK A;  1NMF A;  4DAM A;  4GNX C;  4C3I H;  4BY1 H;  3M4Q A;  5GRO A;  5GAD C;  3ULP A;  3HOX G;  5E7N A;  1L0W A;  1A62 A;  4YY3 L;  4A3I G;  1UE5 A;  1FGU A;  1XPU A;  2KEN A;  3F2D A;  5H1S E;  3M85 A;  4IOC A;  5C4X G;  2MQH A;  4B3M L;  3CF5 A;  1WYD A;  3PO3 H;  5BR8 Q;  5IYD H;  4LF5 L;  1VQH A;  4UP9 A;  4DV7 Q;  4HJ9 A;  5FLM G;  1HZB A;  1TWA H;  3FP9 A;  3CCR A;  1GM5 A;  1EYG A;  3ULL A;  4GNX B;  4HJ7 A;  2NVQ H;  3S1Q H;  3TS0 A;  1N34 L;  2GVB A;  1D8L A;  5LMU Q;  1K0R A;  1YVC A;  1VQA A;  4LUO A;  3S14 H;  4O2D A;  4GKJ L;  1CSP A;  2I5M X;  1JJC B;  2HT1 A;  3PF4 A;  2VY3 A;  1OTC A;  1QUQ B;  4DR5 L;  4A3F H;  3F1Z A;  1RL2 A;  1VCI A;  4OWT B;  4JI6 Q;  4JOI C;  3PF5 A;  2K50 A;  1PHJ A;  2VQF L;  3CPF A;  1LYL A;  5GAG C;  3U58 A;  4K0K Q;  2YYZ A;  4LF9 L;  1EUJ A;  4A3D H;  2VUM G;  2VNU D;  1HH2 P;  3S1N H;  1N9W A;  3UE0 A;  1UE6 A;  3J81 i;  1QUQ A;  3GD7 A;  1VQ7 A;  3PUX A;  1EOV A;  5ELN A;  1TWG H;  3AYH B;  1VQB A;  2CWP A;  4JI1 L;  2UUB Q;  4IJH A;  3PO2 H;  4BXX H;  3S2H H;  2A1A A;  3FKI H;  2KCM A;  4A3J H;  3GTM H;  1OXS C;  4LFB L;  4LF4 L;  1WI5 A;  2KBN A;  2R6G A;  1YHB A;  3NBH B;  1I94 Q;  4B3R L;  4X66 L;  1CSQ A;  4POF A;  4DR6 Q;  1G6P A;  4DR7 Q;  1Q46 A;  1YJ9 A;  1FJG Q;  1S3O A;  1UWV A;  3H3V H;  4L5Q A;  1OXV A;  2BA0 A;  1UEB A;  1S72 A;  1Q81 C;  1PH2 A;  1N36 Q;  1J5E L;  1K9M C;  3I4M H;  1GD7 A;  3G48 A;  1BVS A;  4NXM L;  2LXK A;  3BJU A;  1N32 Q;  1VQ9 A;  4A3C H;  1A63 A;  1JE5 A;  1YI2 A;  3RLN A;  2ATW A;  2GVA A;  4HJA A;  2Y0S G;  4JI4 Q;  3G6E A;  4ME3 A;  3RZD H;  3EBE A;  3CCL A;  2JA8 G;  1VQF A;  2BH8 A;  2WB1 G;  2XTI A;  2Y0S E;  3K8A A;  1PH1 A;  4IFD J;  4A3L H;  1E7Z A;  2H5X A;  2WB1 E;  4A3M H;  4LF8 Q;  1HNX L;  1MJE A;  1E1T A;  2YTY A;  2MFI A;  1U0L A;  4A3E H;  4POG A;  4C3H H;  5K36 G;  1YJW A;  3UDI A;  1VQP A;  2R93 G;  2HIX A;  2F3I A;  3K81 C;  5M3M G;  1HR0 Q;  4JI3 L;  1I5F A;  4DV0 L;  3S17 H;  4BY7 H;  4BBS G;  4JC0 A;  4YCW A;  2HQL A;  4AYB G;  2ZTC A;  4X64 Q;  1VQD A;  3KOJ A;  1JT8 A;  3CME A;  1Q86 C;  4JI2 Q;  4HIK A;  2JA9 A;  4OO1 I;  3CCM A;  3HKS A;  3HOU H;  1XNR L;  1SRU A;  3CW2 C;  4JBJ A;  1L1O C;  2EQS A;  4PG3 A;  4KHP Q;  3KFU A;  4JI0 L;  1PA6 A;  4Y7N H;  4BY1 G;  2DUD A;  2NVT H;  1VQM A;  2R7Z G;  2JA7 G;  1DGS A;  2YTX A;  3TQY A;  1Y1V H;  3J81 j;  1TWC H;  4DR3 L;  2IY5 B;  1B7Y B;  1Y14 B;  2EIF A;  4HJ5 A;  3J7A 5;  1TWF H;  3CC2 A;  4L5S A;  4IPH A;  5IYD G;  3I55 A;  2WFW A;  3PO3 G;  1PVO A;  3L7Z C;  4B3T Q;  4DR4 L;  3HFZ B;  4DV5 L;  3KF8 B;  4R4I A;  4XIG S;  1L1O B;  2MO1 A;  4P72 A;  5JEA G;  2OQ0 A;  3BU2 A;  4KHZ A;  5LMN Q;  2UXB Q;  3M4O H;  2IHE A;  1O7I A;  4X62 L;  1XNQ Q;  4NXN L;  2LSS A;  3W1B A;  3HOW H;  4WJ4 A;  1PYS B;  2CKZ B;  4LFC L;  1K8G A;  1HR0 W;  3HOV H;  4LF6 L;  1KAW A;  3OW2 A;  1L1O A;  3GTK H;  2E2I H;  2K52 A;  3U50 C;  4YCV A;  2F52 A;  3SGI A;  3PV0 A;  5IE8 A;  2ZM6 Q;  4A75 A;  3RZO H;  1XMO Q;  3S16 H;  4DV3 L;  3T1H Q;  4GN3 B;  2B63 H;  4A3B H;  2QGQ A;  4A3D G;  4BA1 I;  2F4V L;  2NVY H;  5FLX c;  3GDE A;  3KJO A;  2I5L X;  4RG1 A;  4DV1 L;  1R9T H;  1WCM H;  4BA2 I;  4P71 A;  1L2F A;  1VQ5 A;  4JV5 L;  1M1K C;  1SR3 A;  5M3F G;  1QZG A;  1E24 A;  2D62 A;  3B6Y A;  4DV6 Q;  3PO2 G;  4BXX G;  1KRT A;  3STB C;  2PMZ E;  3FKI G;  3CC7 A;  2N8N A;  3H0G G;  1EQR A;  4DUZ Q;  1IBK Q;  1K73 C;  1N8R C;  2NZH A;  3E0E A;  5BR8 L;  1PFS A;  2I0Q A;  3PUV A;  1K83 H;  4IO9 A;  4DV7 L;  4JI8 L;  3I2Z A;  4QL5 A;  3J81 c;  1V43 A;  1XMQ Q;  1HNZ Q;  5GAE C;  2DGY A;  3ZJY C;  4OX9 L;  3ERS X;  1NTG A;  3I4M G;  1VQO A;  5LMU L;  3UE1 A;  4UP7 A;  3CCE A;  2FXQ A;  3F8T A;  1X9N A;  2YV5 A;  1UE1 A;  2ES2 A;  1GKH A;  2OQK A;  3PIP A;  1EQQ A;  4DV2 L;  1PH4 A;  4TQU S;  2B3G A;  1OXT A;  3NEN A;  4JG2 A;  3K0X A;  4A3L G;  2E8G A;  4GLV B;  1KRS A;  4LF7 Q;  3NEL A;  1YEZ A;  4DR1 Q;  3S1M H;  1EWI A;  4H02 A;  3L2P A;  4IFD I;  4ALP A;  2JE6 I;  4K0K L;  3EIV A;  4OO1 G;  3TEH B;  3KLW A;  5AJ3 L;  4DUY Q;  4A3E G;  4GKJ Q;  3I7F A;  1Y1W G;  3T1Y Q;  3E9I A;  2IX0 A;  1N33 Q;  1Q8K A;  4DR5 Q;  4NB3 A;  5C0X J;  1KXL A;  3CCJ A;  3GTO H;  4C3J H;  1VQL A;  2JA5 H;  2UUB L;  4DPG A;  4BY7 G;  4APV A;  2ZTE A;  3AQQ A;  1IYJ B;  3GTG H;  3M9B A;  2UU9 L;  1W3S A;  3OTO Q;  1Q7Y C;  2UUA L;  2A8V A;  3UDF A;  5IYB H;  1BKB A;  2N78 A;  4A3G H;  4DR6 L;  4DR7 L;  4KLK A;  1VQK A;  1KHI A;  1SMX A;  2N3S A;  5GQO A;  1FJG L;  5IP9 G;  4GKK Q;  4WJ3 M;  4LW1 A;  1J6Q A;  2MNA A;  1QVF A;  4A3I H;  3GTJ H;  1NMG A;  2JA6 G;  4P74 A;  4QIW E;  4YWL A;  1I50 H;  3RNU A;  2ASB A;  2IX1 A;  4JI4 L;  4X66 Q;  3PIO A;  3W1G A;  4LFA Q;  1ASY A;  2Q2T A;  3H3V I;  2K14 A;  2VQF Q;  1HNW Q;  2YTV A;  2VQE Q;  3J80 i;  4TVA B;  1KIX A;  2E5L Q;  3WWV A;  4LF8 L;  2RF4 A;  1KQS A;  4LUZ A;  3LGJ A;  1VQ6 A;  4OXP A;  4O0A A;  3CP0 A;  3HOW G;  3M7N A;  1BBW A;  1B70 B;  1EIF A;  4IOA A;  2ALY B;  4JI5 Q;  3STB D;  1YHQ A;  1HR0 L;  4R4O A;  1X3F A;  3GTL H;  5IYC H;  1V1Q A;  1E22 A;  1YBY A;  3HOZ G;  3RLO A;  1AH9 A;  4AYB E;  4X64 L;  2UXD L;  3PGZ A;  3AFQ A;  2B63 G;  3M3Y H;  4A3B G;  1U5K A;  2ZJP A;  4JI2 L;  5JJL A;  3CXC A;  1YZ6 A;  4X65 Q;  4GOP A;  1T9H A;  3L0O A;  2JJQ A;  3RN2 A;  3CCQ A;  4KHP L;  4YWK A;  4OON A;  4JI3 Q;  3JAM c;  1QVC A;  4BBR H;  1VQ4 A;  5JJK A;  4B3S Q;  2R7F A;  3PUW A;  2WAQ G;  4YWM A;  4AH6 A;  3TS2 A;  2EXD A;  3A5U A;  1VS0 A;  2L15 A;  3K7A H;  1XTD A;  4R1J A;  2RHQ B;  3HOY H;  2WAQ E;  3AFP A;  1VQG A;  1PH7 A;  5GAH C;  1K3R A;  4B3T L;  1Q12 A;  1YIJ A;  1VQE A;  1IBM L;  1EFW A;  3ULJ A;  1VQ8 A;  4IFD G;  2JEB I;  1Q1E A;  3EN2 A;  3KDF B;  1HZC A;  3I4N H;  2UXB L;  4QQB X;  2HHH Q;  1XNQ L;  2VL6 A;  2NVX H;  2UUC Q;  4DV4 Q;  4MNO A;  3RN5 A;  1FL0 A;  2D0P A;  5FJ8 H;  3TRZ A;  3CAM A;  1SE8 A;  1Z9F A;  3M4P A;  2PQA B;  3S24 A;  4A3F G;  2R92 H;  1SLJ A;  2VS1 A;  1TXY A;  3JAM i;  1PV4 A;  1JMC A;  4LUV A;  2JA8 H;  4DR4 Q;  4J15 A;  5IWA L;  2A19 A;  2PNH A;  3KDF A;  1G29 1;  5DLQ E;  3F2C A;  1IL2 A;  1X6O A;  4LWC A;  3RR5 A;  2ZJR A;  1GVP A;  1PH8 A;  2CWA A;  2ZM6 L;  4NXN Q;  1XMO L;  4OWW B;  4PZ7 A;  5IP7 H;  4A3K H;  4JI7 Q;  5JJI A;  2BH2 A;  4R4T A;  2PQA A;  4YCU A;  3JC6 6;  1PH6 A;  4DK3 C;  1LUZ A;  5C3E H;  2K5N A;  5J3B A;  1BBU A;  1E3P A;  2OTJ A;  3I56 A;  2Z0S A;  5M3M H;  4A3J G;  2OWO A;  5C0X I;  4A4I A;  4BBS H;  4YHH Q;  1D7Q A;  4GS3 A;  5LMN W;  2KHJ A;  4DV6 L;  4HJ8 A;  4JYA Q;  4PZ8 A;  1IBL Q;  1IBK L;  3KF6 A;  4DUZ L;  4DR2 Q;  4AQY Q;  1B8A A;  3A0J A;  5IYB G;  2VW9 A;  3H15 A;  1AE2 A;  3D31 A;  4DK6 C;  4A3G G;  1CUK A;  4Y52 H;  1XMQ L;  1HNZ L;  4YY3 Q;  5C44 H;  4JV5 Q;  1C0A A;  1CKN A;  4RMF A;  1I6H H;  4X6A H;  2MO0 A;  2R7Z H;  2JA7 H;  4A3C G;  4B3M Q;  3DM3 A;  1MJC A;  2AWN A;  2I5H A;  2Q2H A;  2Z6K A;  3CQZ H;  4R4Q A;  5IT9 c;  3CCU A;  4LF5 Q;  4JI6 L;  2GN5 A;  2NN6 I;  3MEF A;  1XJV A;  1V9P A;  1X3G A;  1X55 A;  4JI8 Q;  3CCS A;  2K4K A;  2KCT A;  4A3M G;  1YJN A;  1N34 Q;  1PH9 A;  1SRO A;  4OX9 Q;  2PI2 A;  5EAY A;  1X54 A;  4LF7 L;  4DR1 L;  4DNI A;  3UDX A;  2CCZ A;  3GTQ H;  3OYY A;  4XTC S;  3TRE A;  2ZTD A;  4DUY L;  1VQJ A;  2HIV A;  2YU9 H;  3T1Y L;  3ICE A;  4DV2 Q;  3E9H A;  2B29 A;  1N33 L;  1C9O A;  2LXJ A;  2WP8 J; 
#chains in the Genus database with same CATH topology
 1VMC A;  2R7D A;  3OHX C;  5IIF A;  1I94 L;  4F87 A;  3RZD B;  3OTO L;  2A5H A;  3ITP A;  1PTO C;  3D6C A;  1JC7 A;  2FFK B;  4BS9 A;  2XRQ D;  5ELB A;  2IHF A;  5I9O A;  2RSO A;  1LM0 A;  1A0I A;  4K2K A;  4GKK L;  2ZXP A;  4LF4 Q;  4QJF A;  1UE7 A;  4B3R Q;  1CTM A;  1GUT A;  1HJP A;  4L6T B;  2PW7 A;  5C6A A;  5FLM H;  1XPR A;  2UUA Q;  2Z4H A;  3HOY G;  4DK1 A;  2IT1 A;  1U4R A;  1KD1 C;  1B50 A;  3S9W A;  1CKO A;  1P8L A;  2ZJQ A;  1F77 A;  1HNW L;  5KIX A;  4HCS A;  1I4Q A;  3K6O A;  1FVI A;  2OCE A;  4QGU A;  2JEA I;  2K5H A;  1Q82 C;  4GOP B;  3NBH A;  3MWY W;  1LTT D;  4IPG A;  2R92 G;  4Y7N B;  4C1N K;  1G8Z D;  1CA5 A;  4HMI A;  2Z8L A;  3QO2 A;  1TWC B;  3NEM A;  2K7V A;  1GO3 E;  2V1C C;  4OHJ A;  1I4G A;  2IWH A;  2VUM H;  1HUN A;  1NE3 A;  1A3U A;  1F2M A;  1XPO A;  2KOL A;  2DY7 A;  1Y1W H;  2BA1 A;  1WJJ A;  2VZA A;  5I2Y A;  4GLX A;  4ILW A;  3I4O A;  4IPD A;  3ND9 A;  5A35 A;  5CV4 A;  4B3S L;  1SBB B;  1TU2 B;  1X56 A;  3BDL A;  2XGT A;  3W5O A;  5EPJ A;  5LMN L;  3T16 A;  2E2I B;  1MIU A;  1GUW A;  1IXR A;  4GLA C;  4M1U B;  4KN4 C;  1DZ1 A;  3CD6 A;  3A8K E;  4F8M A;  1U9R A;  2OF1 A;  2K5D A;  4L5R C;  3KUP A;  5I2X A;  4IJL A;  3LWU A;  3J80 L;  1NBW A;  2UUC L;  1HZ9 A;  1I3Q H;  1E1O A;  2HQE A;  4ZLT F;  1IBM Q;  3OW7 A;  1S40 A;  3T1H L;  1PH3 A;  3Q22 A;  2PI2 E;  4LFC Q;  4EX5 A;  1S5D D;  2KED A;  4KKS A;  5FOB B;  2SNS A;  4GZY C;  4GN5 A;  3KF8 A;  5HGQ A;  4HIO A;  4HAE A;  3A8I E;  4ID6 A;  4HSV A;  1A6X A;  2E2J H;  1SYF A;  2PZT A;  1JJ2 A;  4XDX A;  3BZK A;  1PRT B;  4GNX C;  4BY1 H;  3M4Q A;  3C1F A;  3ULP A;  3S1M B;  4F7X A;  1ROD A;  1L0W A;  4A3I G;  2KEN A;  3F2D A;  1EFI D;  5D65 A;  2MQH A;  4B3M L;  3PO3 H;  2ICE C;  1HZB A;  5FO7 B;  1M8A A;  1IW7 C;  4C3J B;  3CCR A;  4HJ7 A;  2KCN A;  2XNA C;  1N34 L;  3MXP A;  2EYF A;  3V2T A;  1CSP A;  4GKJ L;  2I5M X;  2QDB A;  4I65 A;  2A6E C;  3NWT A;  1V1P A;  1RL2 A;  4OWT B;  3KBG A;  4JK1 C;  1I4X A;  3EQL C;  3CPF A;  3I70 A;  1LYL A;  1NUC A;  4LF9 L;  3K5O A;  2VNU D;  1PXU A;  3S1N H;  4RFB A;  1PZI D;  5I6Y A;  4RKB A;  1H9M A;  5EQ0 A;  3GQB A;  1KNA A;  1VQ7 A;  1EOV A;  5ELN A;  1TWG H;  2E75 C;  1VQB A;  1L0Y B;  4C56 C;  3FKI H;  2EYP A;  3GTM H;  1OXS C;  4LFB L;  3DWQ A;  1WI5 A;  2A68 C;  3NBH B;  2JSO A;  2F0N A;  4IUT A;  1S3O A;  1QWY A;  1S72 A;  3GTL B;  3SK5 A;  2UXC L;  4K8I A;  4DN4 M;  2EVB A;  2L11 A;  3TP5 A;  1N32 Q;  1PRT D;  4JI4 Q;  3G6E A;  4ME3 A;  3OSO A;  1CT1 D;  3K8A A;  4MN3 A;  1E7Z A;  3BVZ A;  2WB1 E;  4A3M H;  1HNX L;  2B8G A;  4NDX A;  1JOR A;  4OO1 H;  1E2V A;  3T4A C;  3HOY B;  1H9S A;  5K36 G;  1BF4 A;  2R93 G;  2HIX A;  2DN8 A;  1AP0 A;  3W3A A;  2P5Z X;  5M3M G;  4YCW A;  2NVX B;  4JI2 Q;  2VXW A;  2R92 B;  4HMJ A;  3HOU H;  2JA8 B;  1XNR L;  3VYU A;  4KHP Q;  1F9Q A;  4PG3 A;  3E5S A;  1PA6 A;  3OOC A;  3LX0 A;  2YTX A;  3P20 A;  2EYO A;  4J1M A;  3J81 j;  1FYC A;  1B7Y B;  1Y14 B;  4HJ5 A;  4QMG A;  3I55 A;  2F03 A;  1HA5 A;  2EY6 A;  3L7Z C;  5J39 A;  4QUC A;  3KF8 B;  2WV6 D;  5JEA G;  2B8F A;  1ZEQ X;  4ABN A;  2UXB Q;  2OQ0 A;  3BU2 A;  1S5C D;  3CU7 A;  1JIC A;  4X62 L;  2FMM A;  4EQO A;  3HOW H;  3I4L A;  4G57 A;  1K8G A;  1VDZ A;  3OW2 A;  1XXG A;  3GTK H;  3FRP B;  2JA7 B;  5IE8 A;  3KK7 A;  2KEC A;  2B63 H;  3HEJ A;  4BA1 I;  2F4V L;  2DNE A;  5DM6 3;  2NVY H;  5FLX c;  1MGS A;  3KJO A;  1WCM H;  3U9S A;  1VQ5 A;  1TS2 A;  2PO4 A;  3KLS A;  3I90 A;  1WVL A;  4XQJ A;  3CC7 A;  1LV9 A;  1K73 C;  1JE4 A;  1I4R A;  3MAQ A;  4DV7 L;  3J81 c;  1EYC A;  1QNU A;  4IFD H;  5M5X B;  2BE5 D;  1WTX A;  3I4M G;  1V8Q A;  2FXQ A;  2NB0 A;  1X9N A;  3OPO A;  4DV2 L;  1HFG A;  4TQU S;  2B3G A;  5M3F B;  3K0X A;  4IN3 A;  4GLV B;  3S15 B;  1KRS A;  4PNY A;  4K0K L;  3GTM B;  3H0G B;  5EJW A;  3EIV A;  5AJ3 L;  4A3E G;  1DON A;  3GTP B;  4QCL A;  4FF2 A;  5DEH A;  2IX0 A;  1N33 Q;  4DR5 Q;  1O80 A;  2MHV A;  5BN5 A;  1JOK A;  3CCJ A;  3GTO H;  2WKD A;  1YNN D;  2JA5 H;  4JPB W;  3UDF A;  1VF5 C;  5GQO A;  4WJ3 M;  3MVV A;  2E2D C;  4P74 A;  2J0T D;  1TQO A;  1KAA A;  3PIO A;  4LFA Q;  3R3O A;  2IL8 A;  2RA4 A;  1KIX A;  4V19 0;  4KY7 A;  3WWV A;  4LUZ A;  3LGJ A;  5IGF A;  2K04 A;  1IKL A;  3M7N A;  1PDQ A;  1BBW A;  4IUP A;  2ALY B;  3STB D;  1YHQ A;  4QIW B;  4R4O A;  2F0W A;  1ENF A;  4AYB E;  4X64 L;  2UXD L;  2H1E A;  3MXN A;  3PGZ A;  4KKU A;  4A3B G;  3CXC A;  1SMY C;  3TZD A;  1DOM A;  3DEP A;  3W2D A;  3JAM c;  4BBR H;  1VQ4 A;  4CBV A;  3TS2 A;  2NZ1 D;  1BCP B;  4OIJ A;  3MTS A;  3A5U A;  2R93 B;  1VS0 A;  3K7A H;  4R1J A;  1VQG A;  4F88 A;  1K3R A;  4B3T L;  3CRL C;  1EFW A;  3VA5 A;  1BR9 A;  1Q1E A;  3BVM A;  3HOZ B;  2K01 A;  4QQB X;  2HHH Q;  1MSG A;  1PRT F;  2D5D A;  1LLR D;  5C4J B;  2D0P A;  5FJ8 H;  3CAM A;  4J6H A;  4DR4 Q;  5C0X H;  1PV4 A;  4LUV A;  3KDF A;  4KY5 A;  1X6O A;  3NXW A;  2WAQ B;  3X3M A;  4PZ7 A;  4JI7 Q;  5IGC A;  1L0X B;  1J8I A;  4YCU A;  1PH6 A;  1CZW A;  4DK3 C;  5C3E H;  3S1Q B;  3I91 A;  2K5N A;  3OIQ A;  4BWG B;  1E3P A;  2OTJ A;  2Z0S A;  3GV3 A;  2OWO A;  4BBS H;  4DV6 L;  4K6L A;  4H7B A;  4PZ8 A;  1IBK L;  1UNS A;  3A0J A;  1CHP D;  1AE2 A;  4A3G G;  1HNZ L;  5C44 H;  4ZRZ A;  2H4O A;  2R7Z H;  2FMC A;  2RQX A;  1RKN A;  5FO8 B;  3WOF A;  4R4Q A;  5IT9 c;  2PZW A;  4JI6 L;  2NN6 I;  3I8Z A;  1V9P A;  1BCP D;  4DAP A;  1YJN A;  3S2H B;  1X3P A;  1PH9 A;  2PI2 A;  4DR1 L;  3H94 A;  3GTQ H;  1NSN S;  2YU9 H;  2F0S A;  1RJT A;  2B29 A;  3I4M B;  1B1Z A;  2F0H A;  1TWH H;  2J7Z A;  1H9R A;  4CKB A;  1WTH A;  3J80 c;  2E2H H;  1LTA D;  3KYH C;  4KHV A;  1EZ8 A;  4L5T A;  1N36 L;  4JI1 Q;  3HOX H;  4L8J A;  5C4X H;  1O7Y A;  4A3E B;  2EYL A;  4FF1 A;  1HCZ A;  1SN8 A;  4GOP C;  2AHO B;  3A7A B;  5FLX L;  1A8V A;  2F0E A;  1H95 A;  5HUR A;  3S17 B;  4B08 A;  2V4D A;  4NXM Q;  3I4N G;  1ENA A;  3MXN B;  2E5L L;  4OWX B;  3CCV A;  3S2D H;  2IW3 A;  2CFM A;  3BZC A;  4P75 A;  3I3C A;  3Q8D A;  2IPK D;  2BDO A;  3QWN A;  1WTP A;  1EU4 A;  5JEA J;  2NVT B;  3HKZ E;  4PV1 C;  1Y1V B;  5COY A;  2K5V A;  5EGT A;  1M90 C;  3FPP A;  3FEW X;  1TWF B;  1E2Z A;  2EJG C;  1IYU A;  5IP7 G;  4A3K G;  2LY7 A;  1WOC A;  3PIO 3;  1HZA A;  4JCV E;  3EJI A;  4X65 L;  4DV0 Q;  2JQO A;  2LMC B;  2Q2I A;  3DLL A;  2L5T A;  1CKM A;  1QZH A;  3HOV B;  3SK8 A;  2NN6 G;  1SSO A;  5TSS A;  4H0L C;  1GHK A;  3TSS A;  5CV9 A;  5IP9 H;  3RZO B;  1QB5 D;  1SXT A;  4DKA C;  4A3B B;  4DR3 Q;  2JXM B;  1TR5 A;  2C35 B;  3G71 A;  2JA6 H;  2GA4 B;  3J81 E;  3N52 A;  4DV5 Q;  2MGS A;  4MZ9 A;  2D0O A;  1CQF A;  3D4D A;  1GUG A;  4G7H C;  3PQI A;  2Q8I B;  1CI3 M;  2D2C C;  5HY6 A;  5A2Q E;  4A76 A;  1EY6 A;  3KLS X;  1PRT C;  1IL8 A;  1PH5 A;  4DNT B;  1QIL A;  2F0O A;  1Z7T A;  1LT6 D;  2EY5 A;  3PUZ A;  1RIP A;  3FDT A;  1EIY B;  1G51 A;  3J7Z C;  2QA4 A;  4DV3 Q;  4K2L A;  1QJO A;  1YNX A;  3D4W A;  2XSC A;  4DV1 Q;  1IBL L;  5ELO A;  5JJZ A;  4AQY L;  4RKL A;  2A6H C;  3N6R A;  4C3I H;  5GRO A;  1B3A A;  5I6W A;  1A62 A;  1GHJ A;  2B2Y A;  1XPU A;  2EJM A;  3OWE B;  3D3R A;  4LF5 L;  5FLM G;  1TWA H;  3ULL A;  2NVQ H;  4XYQ A;  3JAM L;  1YVC A;  1SDF A;  2XIW A;  4FYD A;  1JJC B;  2HT1 A;  1AEX A;  4A3G B;  3X3N A;  1QUQ B;  4A3F H;  1SND A;  3Q0A A;  1PHJ A;  1A3V A;  1D1K A;  2VQF L;  5C4X B;  2F0J A;  2PW5 A;  4LMQ D;  1JB3 A;  2YYZ A;  4A3D H;  2VUM G;  3CHB D;  1N9W A;  3UE0 A;  1UE6 A;  3J81 i;  5KNC A;  2CWP A;  4BXX H;  1DXM A;  2JYO A;  4A3J H;  4K14 A;  4LF4 L;  2KBN A;  1I94 Q;  4B3R L;  4X66 L;  4POF A;  4DR6 Q;  1G6P A;  3QJY A;  1W6J A;  1UWV A;  1JCK B;  1PH2 A;  3ONA B;  1K9M C;  1LAB A;  2G9D A;  1GD7 A;  1A63 A;  5IGD A;  1JE5 A;  1ICW A;  3RLN A;  2ATW A;  3TME A;  4DAV A;  4HJA A;  2N88 A;  1SYE A;  4MIU A;  2JA8 G;  2BH8 A;  2K28 A;  2Y0S E;  1BCP F;  3NQI A;  4A3L H;  1B44 D;  1G91 A;  2M2L A;  4LF8 Q;  2F0V A;  2BE5 C;  5IT9 L;  4C3H H;  4NMZ A;  1PTO H;  3I4N B;  1HR0 Q;  4BY7 H;  1VMP A;  4JC0 A;  1S4Z A;  4AYB G;  5AFW A;  1JWM D;  1DD2 A;  3KOJ A;  4RGO S;  3CME A;  1Q86 C;  1HQM C;  2O4X A;  4OO1 I;  1A3T A;  2WB1 B;  1SRU A;  3CW2 C;  1DOK A;  4ZUI A;  3KFU A;  1T5X D;  2CH4 A;  4BY1 G;  2JA7 G;  1DGS A;  2M9V A;  4A3K B;  3MZ5 A;  2MPM A;  1PFB A;  1YNN C;  4OIK A;  2A69 D;  3PO3 G;  3CC2 A;  2OEO A;  1PVO A;  5D3I B;  4K5X A;  1LTR D;  1D2B A;  1LO5 D;  4R4I A;  3LWE A;  1LT4 D;  5LMN Q;  3E0J A;  3M4O H;  2IHE A;  2JP1 A;  1XNQ Q;  4NXN L;  4JW0 A;  1EY8 A;  4HN7 A;  1PYS B;  4P2C B;  4LFC L;  4ULL A;  1KAW A;  1HTP A;  1DCZ A;  3FMC A;  5JPN C;  1I6H B;  1B53 A;  4G7O C;  3H09 A;  3SGI A;  4FO2 A;  1WTR A;  4A75 A;  3S16 H;  1AW7 A;  4GN3 B;  3T1H Q;  5F2D A;  4CJ0 B;  1R9T H;  4BA2 I;  2QKI C;  1M1K C;  3OMC A;  5M3F G;  1QZG A;  5LL6 X;  3J80 E;  3B6Y A;  3STB C;  3FKI G;  3VYS A;  2N8N A;  3H0G G;  4K5V A;  1EWH A;  1N8R C;  3VYR A;  1PFS A;  2E76 C;  5D3D A;  1K83 H;  1QE6 A;  4JI8 L;  4QL5 A;  1V43 A;  2RBM A;  5CGK A;  5GAE C;  1EYA A;  3ZJY C;  4OX9 L;  2B39 A;  1NTG A;  3ERS X;  1D5Z C;  4H13 C;  1Z6H A;  1I4H A;  1TT2 A;  3VR2 A;  3D8G A;  1BBX C;  4V0B A;  3CCE A;  1RF2 D;  1FNU A;  2RDF A;  1UE1 A;  4RGT A;  3PIP A;  1STH A;  3MA2 B;  1YNJ D;  4JG2 A;  2E8G A;  2LS0 1;  4IFD I;  4C1N I;  1BQQ T;  1EWI A;  3QR8 A;  1RTN A;  4OO1 G;  3KLW A;  4TSS A;  4GKJ Q;  4OGQ C;  3E9I A;  4FF4 A;  5CV6 A;  1BDO A;  1VQL A;  3AQQ A;  1IYJ B;  3GTG H;  3M9B A;  3SHL A;  2UU9 L;  1Q7Y C;  5LL6 S;  2A8V A;  2FHT A;  5IYB H;  1OO9 B;  1BKB A;  2N78 A;  2MP1 A;  5EBC A;  1SAP A;  1VQK A;  1SMX A;  2B2T A;  2AQ2 B;  3DWA A;  2VUM B;  2MNA A;  1QVF A;  4A3I H;  3GTJ H;  4RCN A;  4HR7 B;  3HG9 A;  3HRZ C;  1AZP A;  4YWL A;  1RTO A;  1I50 H;  2PCF B;  1Y1W B;  4JI4 L;  1WTW A;  1EY5 A;  2EE1 A;  2Q2T A;  2L1B A;  3H3V I;  2VQF Q;  4S3S A;  2VQE Q;  3J80 i;  1A2U A;  2XVS A;  4OXP A;  3HOW G;  4FF3 A;  1X32 A;  5M9O A;  2HCI A;  1IHZ A;  4JI5 Q;  5KYL A;  1WD0 A;  1TS3 A;  3NK9 A;  4RWS C;  1X3F A;  5IYC H;  1E22 A;  1YBY A;  3HOZ G;  3QIA A;  1BCP C;  1BO0 A;  1U4L A;  1SNC A;  3AFQ A;  2B63 G;  3M3Y H;  5EBD A;  4JI2 L;  1I3Q B;  3MXG A;  3L0O A;  3J7Y W;  2JJQ A;  4XYO A;  4KHP L;  4YWK A;  2A74 C;  1NR4 A;  1QVC A;  5JJK A;  1EYD A;  3PUW A;  2WAQ G;  4YWM A;  4AH6 A;  1C8C A;  2EXD A;  1XTD A;  2PPB C;  1PH7 A;  1SNQ A;  1UEA B;  5C4H A;  2I46 A;  4AYB B;  1VQ8 A;  4IFD G;  5IGE A;  4Q5V A;  2UXB L;  1A2T A;  2VL6 A;  4Q0F A;  2Z9H A;  4N9P A;  4DV4 Q;  2E2J B;  1C48 A;  4IQZ A;  2K5Q A;  3S24 A;  2PQA B;  4BY1 B;  5L37 A;  1SLJ A;  1JMC A;  4J15 A;  1TY2 A;  5IWA L;  2A19 A;  4LWC A;  1O7L A;  1PH8 A;  2ZJR A;  4OWW B;  3PO3 B;  3DXJ C;  3TP8 A;  1GOZ A;  2BH2 A;  1F9R A;  3TP6 A;  4G4K A;  2Q8T A;  4EGV A;  2D9U A;  5J3B A;  1BBU A;  5M3M H;  1EWC A;  5C0X I;  2IX3 A;  4YHH Q;  4GS3 A;  1ZKO A;  4HJ8 A;  4JYA Q;  5E4W C;  4DR2 Q;  5D14 A;  1JOO A;  2VW9 A;  3H15 A;  1ICF B;  2MJ8 A;  1FNV A;  1CUK A;  1F9S A;  3K5N A;  2ZXR A;  4YY3 Q;  1CKN A;  4L63 B;  4X6A H;  3S1N B;  4A3C G;  3MXU A;  5EPL A;  2Z6K A;  2AWN A;  3CQZ H;  1K0S A;  3CCU A;  3H3V C;  2RDH A;  1TWG B;  4IUR A;  1DOL A;  1LTS D;  4NKL A;  3FKI B;  1SRO A;  3VR4 A;  1TS5 A;  1LTB D;  5EAY A;  1X54 A;  2EJF C;  3UDX A;  1VQJ A;  2HIV A;  4DV2 Q;  2BDN A;  3E9H A;  4ZCK A;  5DAU A;  1HRJ A;  2G5D A;  1N33 L;  1KDB A;  2XRS D;  2KHI A;  4ZKB B;  4HIM A;  3NPP A;  4DAY B;  4CHT B;  3PIP 3;  4A93 H;  1Q90 A;  1P16 A;  5COR A;  1WFQ A;  2CQA A;  5AJ3 Q;  2B2W A;  4PMW A;  5JPM C;  2RCN A;  3SVM A;  1HHV A;  1FGB D;  4A3M B;  2JK8 A;  3U4Z A;  3G4S A;  5CR3 A;  1ZYR D;  1Y1V G;  4BBR G;  3ER0 A;  3L9A X;  1JJG A;  2MUY A;  3NBI A;  3K80 C;  4FXD A;  3D6W A;  3NWS A;  1CQV A;  3VDY A;  1HXY D;  4JBW A;  1J5E Q;  4LFA L;  4WRD A;  4RA8 A;  2DJG C;  2N55 A;  1NY4 A;  4JOI A;  3K59 A;  1EIG A;  4HID A;  3HOV G;  3HOU B;  1PZJ D;  4KN7 C;  1G6Z A;  2HD3 A;  4EQ5 A;  5FJ8 G;  5C5L A;  3U4V A;  5C0X G;  2AWO A;  3V05 A;  2SDF A;  1KLU D;  2M00 A;  3GO5 A;  2Z1C A;  4ODG A;  4CDF C;  1RHP A;  1OXU A;  2K6A A;  5C3E G;  5E3F A;  5M5W H;  1B9N A;  1QG7 A;  1LTL A;  2AKW B;  1MKH A;  1EL0 A;  3F2B A;  4R4C A;  5CBA E;  5IY0 A;  4MTN A;  5M5Y H;  3HOW B;  1LAC A;  2QIL A;  2PQE A;  3D0F A;  2UXD Q;  1AE3 A;  3AEV A;  3DUZ A;  1W2B A;  1NNX A;  2QW7 A;  3HKZ B;  3OWF A;  3MHB A;  1YIT A;  5LHY 1;  4ZUJ A;  4CDD C;  4JI0 Q;  3GTK B;  2QEX A;  1OXX K;  4RGM A;  5C44 G;  4TKO B;  4C2M H;  2B63 B;  3A5Z B;  2HHH L;  2R61 A;  2NVY B;  4MTK A;  4H44 C;  1WCM B;  1ASZ A;  5CV7 A;  1VQI A;  2WII B;  1MHW C;  2CQO A;  2K75 A;  2ZT9 C;  1NAP A;  3S1R H;  4UP8 A;  4R8N A;  2DNC A;  4KD3 A;  3CC4 A;  4AIM A;  4I7Z C;  3E6Z X;  4JI7 L;  2X69 A;  2K32 A;  5DNF A;  4LF6 Q;  2AUK A;  3PUY A;  1B9M A;  1DM0 B;  1CKN B;  4LNQ A;  1GXD C;  1SFO H;  1ESF A;  1Y8O B;  4U68 A;  1YHA A;  1FNW A;  1G2T A;  1VF7 A;  2KEE A;  3IFD A;  2HUG A;  1ILP A;  3BDC A;  3SEB A;  2SOB A;  3T56 B;  1NMF A;  2G9H D;  5GAD C;  3HOX G;  5E7N A;  1WTQ A;  1EQT A;  1UE5 A;  3MFY A;  5C4X G;  1HQR D;  2AQ3 B;  2EXZ A;  3M85 A;  1WTO A;  5BR8 Q;  5IYD H;  5ELD A;  4FXG C;  4HJ9 A;  4UP9 A;  3GTO B;  4RHR A;  2DY8 A;  2JA5 B;  1U4M A;  1IYV A;  5EPK A;  1K8M A;  3AU7 A;  3SXH A;  1UAP A;  5LMU Q;  4LUO A;  3TP7 A;  3S14 H;  4O2D A;  1GJX A;  1Y69 U;  5IOD A;  3PMF A;  5C4Z A;  4MHE A;  4JI6 Q;  3F1Z A;  1VCI A;  3TZU A;  3RUZ A;  2A69 C;  3PF5 A;  2K50 A;  2EY1 A;  4KKT A;  4EQN A;  5GAG C;  1STN A;  3KLR A;  2FJ2 A;  3P75 A;  4X3S A;  1JWS D;  4OL7 A;  2F3V A;  1QUQ A;  1QCB D;  4ZKC B;  4JI1 L;  2UUB Q;  4IJH A;  3PO2 H;  2A1A A;  1STG A;  1TII D;  1KDC A;  3K57 A;  2R6G A;  2SNM A;  4NW2 A;  1SYC A;  4DR7 Q;  1E0B A;  1Q46 A;  1FJG Q;  1PMR A;  4UDU C;  4L5Q A;  2BA0 A;  1N36 Q;  5CV5 A;  1Q81 C;  3K58 A;  3G48 A;  3BDO A;  3FVQ A;  5NUC A;  2LXK A;  3BJU A;  2L55 A;  2K33 A;  4NXM L;  2BCO A;  1LTI D;  3A7L A;  3RZD H;  3BYY B;  4CKE A;  3NTK A;  2XN9 C;  2WB1 G;  5C5M A;  4CJ1 B;  1PH1 A;  4IFD J;  1RCV D;  4BBR B;  1F2Y A;  5FK9 C;  1FR3 A;  1MJE A;  4RGN A;  1U0L A;  4K5W A;  4POG A;  4KY6 A;  3K7A B;  4DF7 A;  1HUM A;  3MEH A;  1RDP D;  2NUC A;  3BG3 A;  3G7L A;  1B2T A;  2WIN B;  2F3I A;  3K81 C;  4JI3 L;  1I5F A;  4DV0 L;  3MFG A;  5FLX E;  2HQL A;  3NTI A;  2ZTC A;  1YNJ C;  1JT8 A;  2Y0S B;  4HIK A;  2JA9 A;  3HKS A;  1EIH A;  1AFP A;  1PFN A;  1U4P A;  3GP7 A;  1SE4 A;  4Y7N H;  2DUD A;  3NP8 A;  1S5F D;  2Z6B A;  1EY4 A;  4FNF A;  2F0I A;  1STE A;  3ERO A;  4QB4 A;  1TWC H;  3F2U A;  4DR3 L;  2IY5 B;  4KJN A;  2EIF A;  2QF7 A;  3TBI B;  4L5S A;  4IPH A;  5C3E B;  4KJO A;  4DV5 L;  5KEE A;  2B2Y C;  4XIG S;  1L1O B;  2MO1 A;  4P72 A;  1KTK A;  3BVG A;  5C3W A;  4BBS B;  4RCO A;  2C9O A;  4JVZ A;  3HP3 A;  3C46 A;  2CKZ B;  1TVX A;  1HR0 W;  5CMD A;  3VR6 A;  1D5X C;  1XYI A;  5C44 B;  3VR5 A;  2E2I H;  2AQ1 B;  2C5C A;  1PLF A;  3U50 C;  2R7Z B;  3PV0 A;  2ZM6 Q;  1XMO Q;  4XQQ A;  2QDL A;  4DV3 L;  1AZQ A;  4I7A A;  4A3D G;  2QGQ A;  3FPU B;  1BOS A;  2I5L X;  2KCC A;  4DV1 L;  1HFN A;  4WJW A;  1L2F A;  4JV5 L;  2RVL A;  3QB3 A;  1SR3 A;  2OT2 A;  4J8Q A;  3T53 B;  2PYK A;  4BXX G;  4DXF A;  3GTQ B;  4QF4 A;  3DWP A;  1STY A;  4CDC C;  2R3Z A;  4DUZ Q;  3UI2 A;  2YU9 B;  2NZH A;  4G7Z C;  2I0Q A;  4ZK9 B;  3I2Z A;  2VB2 X;  1XMQ Q;  1TWH B;  4B9W A;  2WAC A;  2DGY A;  4N8F A;  1VQO A;  2E2H B;  1H9K A;  3P7J A;  4UP7 A;  3DEO A;  2L0C A;  3F8T A;  2ES2 A;  4O42 A;  1IKM A;  1S5B D;  3URY A;  2CW0 D;  3HOX B;  1MSH A;  1OXT A;  3O13 A;  4A3L G;  1TY0 A;  4K6D A;  4LF7 Q;  3NEL A;  1YEZ A;  3S1M H;  3R93 A;  3L2P A;  2X6L A;  4X3K A;  2B2V C;  3TEH B;  4DUY Q;  3I7F A;  5ELC A;  1Y1W G;  3T1Y Q;  2F0L A;  5C0X J;  1KXL A;  3Q24 A;  3CKI B;  2EZV A;  4XXE A;  3I73 A;  4C3J H;  3IL8 A;  4BY7 G;  2VB3 X;  4APV A;  5C3X A;  1B3Q A;  2B2U A;  3S2D B;  1W3S A;  3OTO Q;  2F0D A;  4PMB A;  2UUA L;  3AB9 A;  3DM1 A;  1O78 A;  4DR6 L;  3JAM E;  3ND8 A;  2ENB A;  4KLK A;  1I6V C;  2N3S A;  4GKK Q;  3V96 A;  3WOE A;  1J6Q A;  4ME5 A;  1NMG A;  2JN4 A;  3RD4 A;  3J7A F;  3Q6S A;  4X3U A;  2B2V A;  2ASB A;  1Y8P B;  4X66 Q;  1SE3 A;  1ASY A;  2K14 A;  1HNW Q;  2LFN A;  4TVA B;  4LF8 L;  1AN8 A;  1VQ6 A;  1STA A;  1KAB A;  4O0A A;  3CP0 A;  2AUJ D;  3GV6 A;  4PMC A;  3BYT B;  1B70 B;  3C3L A;  4E6I A;  5KGU A;  1D6E C;  1HR0 L;  4HTH A;  3GTL H;  1AH9 A;  5ISR A;  2JA6 B;  1MBY A;  1U5K A;  2ZJP A;  5JJL A;  1YZ6 A;  2KJX A;  2RKS A;  1GUS A;  1CM9 A;  2EYM A;  4OON A;  2HDM A;  4ZYS A;  4B3S Q;  3SK6 A;  4IZ8 A;  1SNO A;  2L15 A;  3KBX A;  3HOY H;  2RDG A;  1EY0 A;  5GAH C;  1Q12 A;  3SR1 A;  1YIJ A;  1IBM L;  3ULJ A;  3EN2 A;  5IT9 E;  1HZC A;  1ILQ A;  1XNQ L;  2NVX H;  1K28 A;  2UUC Q;  2OXP A;  3RN5 A;  1X3Q A;  1ZYR C;  1FL0 A;  2EOT A;  5JVG 3;  4C3I B;  2R92 H;  1F2Z A;  1DJR D;  2F0U A;  1TXY A;  4LJZ C;  3JAM i;  2JA8 H;  1BNZ A;  2PNH A;  2QEJ C;  1CZG A;  1G29 1;  1IL2 A;  1GVP A;  2CWA A;  4NXN Q;  2NTT A;  2F0K A;  4LK1 C;  1TWA B;  1SJE D;  2PQA A;  1LUZ A;  4HCE A;  2NVQ B;  5ELF A;  2XWJ B;  4A4I A;  2SEB D;  1D7Q A;  4HSP A;  1SYD A;  2O5I C;  1R4Q B;  4WOR A;  3KF6 A;  4A3F B;  2EPB A;  5IYB G;  2E74 C;  4Y52 H;  1BXT A;  3DHQ A;  4RMF A;  4CDE C;  4OEM B;  4A3D B;  1WTV A;  2MO0 A;  5KNB A;  2JA7 H;  1XWE A;  4B3M Q;  1MJC A;  1D5M C;  2B2T C;  2GN5 A;  3MEF A;  1X3G A;  4JI8 Q;  3CCS A;  2K4K A;  2KCT A;  1LT3 D;  4A3M G;  1N34 Q;  5T1I A;  4A3J B;  4OX9 Q;  1RD9 D;  2F0M A;  3NSW A;  4DNI A;  4O1N A;  2L9H A;  2ZTD A;  1HA6 A;  2KHS A;  3T13 A;  1JOQ A;  2F0G A;  3NE5 B;  3ICE A;  5JAV A;  1C4Q A;  1C9O A;  1HTL D;  2LXJ A;  3P1H A;  3AMU A;  5M5X H;  4GNX A;  2O2L D;  4LF9 Q;  3L3O C;  5IYC G;  2N49 A;  1DYQ A;  3HOU G;  2KUM A;  4KTA A;  3SK4 A;  3T51 B;  5K5P A;  1SJH D;  3EA6 A;  1KL9 A;  1SNM A;  2L12 A;  4IUV A;  4X3T A;  1X65 A;  1JWU D;  5M3F H;  3C2P A;  1N32 L;  2J4X A;  4JBK A;  3S15 H;  4LFB Q;  2RHS B;  4DAY A;  4C3H B;  1K8A C;  4UY8 C;  4P73 A;  2UU9 Q;  3H0G H;  4R8I A;  3SDZ A;  3GTP H;  1Q3L A;  3A54 A;  1PTO B;  3UDG A;  1PYB A;  2UXC Q;  2CHB D;  2CH4 W;  4BY7 B;  1D1I A;  1VQC A;  5IGB A;  3K7U C;  3QOJ A;  5J22 A;  2VQE L;  3IRB A;  4NPS A;  2F0P A;  2AMC B;  3HKZ G;  1ET9 A;  4IUN A;  3CMA A;  1EU3 A;  1C7Y A;  4JI5 L;  3RLF A;  1HNX Q;  3A74 A;  5CYU A;  5EKL A;  1J9O A;  4FXK C;  3PSI A;  1WCM G;  2A6H D;  2Q2U A;  3M4O B;  4IPC A;  2ID0 A;  4ZAI A;  4UPA A;  2NZO A;  4QY7 A;  5JVH 3;  1UUP A;  2F4I A;  5G3L D;  1XNR Q;  1PZK D;  4GN4 B;  3K5L A;  1NR2 A;  4PZ6 A;  4DA2 A;  5EKK A;  1Q1B A;  5CV8 A;  1JB7 A;  2HCC A;  3S16 B;  3CPW A;  4FDB A;  3FHW A;  3A56 A;  5E4X A;  1R9T B;  4DV4 L;  1E2W A;  3RMH A;  3NHH A;  1QVG A;  2OTL A;  1Z47 A;  3NUC A;  2K5W A;  2ZXO A;  5KND A;  1VQN A;  4X62 Q;  2Z6K C;  4KI0 A;  2K1B A;  1NJI C;  1PTO D;  3KF6 B;  1X3E A;  5K36 H;  3KJP A;  1K83 B;  1PYW D;  2R93 H;  2JA5 G;  4JBM A;  2HDL A;  3HGB A;  4B9X A;  5IWA Q;  1I4P A;  4KD4 A;  3HOZ H;  4YHH L;  1IZ6 A;  2F4V Q;  4JYA L;  4A93 G;  3PCO B;  1EQV A;  5C4J H;  4DR2 L;  1KC8 C;  4DAM A;  4FVM A;  3DMU A;  3ERQ A;  3QG1 A;  2Q8R E;  4YY3 L;  1FGU A;  4IOC A;  5H1S E;  2B2W C;  1ONL A;  5CC4 A;  3CF5 A;  1WYD A;  1MI2 A;  1SYB A;  3U9O A;  4LAA A;  1VQH A;  4DV7 Q;  3FP9 A;  1V1P B;  5JEA H;  1EYG A;  1GM5 A;  4GNX B;  3S1Q H;  2ICI A;  3TS0 A;  2GVB A;  1D8L A;  2IJ0 A;  3GTG B;  2EYH A;  1K0R A;  1Q8I A;  1VQA A;  3WDN A;  3K0Y A;  1R4P B;  2F0T A;  2NTS A;  2I07 B;  3PF4 A;  3R8B A;  1ET6 A;  2VY3 A;  1OTC A;  2K03 A;  4RAU C;  1H9J A;  4DNR B;  4DR5 L;  4JOI C;  1EZ6 A;  3A55 A;  4A3I B;  3GTJ B;  2QCP X;  4K0K Q;  2PMZ B;  3M4Y A;  3U58 A;  1KLG D;  1EUJ A;  1XX8 A;  5I4D A;  3NQT A;  1HH2 P;  1I50 B;  4XT3 B;  2F3W A;  3K5M A;  1ML0 D;  3GD7 A;  1EY9 A;  3PUX A;  4N8X 1;  3AYH B;  1HPC A;  1NCV A;  4NP5 A;  3S2H H;  3SE0 A;  2KCM A;  1FD7 D;  1TKW B;  1YHB A;  3LNN A;  1LT5 D;  1ZXT A;  1CSQ A;  3HZX A;  1YJ9 A;  1SYG A;  3H3V H;  3R2T A;  1OXV A;  1UEB A;  3H91 A;  1J5E L;  3I4M H;  1BVS A;  1SE2 A;  3M3Y B;  1VQ9 A;  4A3C H;  1YI2 A;  2GVA A;  1QNK A;  2Y0S G;  1H9S B;  1EOT A;  3EBE A;  3CCL A;  1VQF A;  2XTI A;  3VR3 A;  3BZD B;  2H5X A;  5CBE E;  4U67 3;  2PZU A;  1E1T A;  2YTY A;  2MFI A;  3TDQ A;  1O7Z A;  4A3E H;  1YJW A;  3UDI A;  1VQP A;  1V1O A;  2CW0 C;  1XTC D;  3S17 H;  3EFX D;  4BBS G;  3OMG A;  4X64 Q;  5I9P A;  1VQD A;  5IOC A;  2EYJ A;  2NYZ D;  1IW7 D;  3CCM A;  2NBF A;  1M4V A;  1CA6 A;  4JBJ A;  1L1O C;  2EQS A;  4JI0 L;  4HED A;  2NVT H;  1VQM A;  2R7Z G;  1LTG D;  3TQY A;  1GUN A;  1Y1V H;  2A6E D;  4RHS A;  3J7A 5;  1TWF H;  5IYD G;  2WFW A;  4DR4 L;  4B3T Q;  3HFZ B;  1JQY D;  5M3M B;  5ELE A;  1EY7 A;  4KHZ A;  1O7I A;  1QOH A;  3A8J E;  2LSS A;  1SNP A;  3W1B A;  4WJ4 A;  4XT1 B;  1CK1 A;  3HOV H;  2F0F A;  5HGT A;  4LF6 L;  1KDA A;  5T1G A;  1L1O A;  3HS0 C;  3BS1 A;  2K52 A;  4YCV A;  2F52 A;  2A68 D;  3RZO H;  3D4R A;  3CQZ B;  1G2S A;  4A3B H;  3EVQ A;  4WFN 3;  4FP5 D;  3GDE A;  4RG1 A;  4P71 A;  3ZYY X;  2NWG A;  5IGG A;  2XWB B;  1E24 A;  2D62 A;  4DV6 Q;  3PO2 G;  4CGY B;  1KRT A;  2PMZ E;  3H6M A;  5G3L F;  1EQR A;  1IBK Q;  1K8O A;  1GUO A;  3E0E A;  5BR8 L;  3PUV A;  1B4O A;  4IO9 A;  1HNZ Q;  4XQN A;  4IUU A;  2KQ3 A;  4KK7 A;  5LMU L;  4A93 B;  3UE1 A;  2YV5 A;  1GKH A;  1A15 A;  2OQK A;  1EQQ A;  2Z4I A;  5BN3 A;  1PH4 A;  1KNE A;  3NEN A;  2WKC A;  2O5J C;  4KMU C;  1F9P A;  1PTO F;  4DR1 Q;  4H02 A;  4ALP A;  2JE6 I;  2KVM A;  3VYT A;  2FIN B;  3IKJ A;  4CKC A;  4DFA A;  1Q8K A;  4NB3 A;  4OEL B;  2UUB L;  3M7G A;  4DPG A;  5J1Z A;  2ZTE A;  2EY2 A;  4CJ2 C;  3VA7 A;  4EQP A;  2RSN A;  4R9W A;  4A3G H;  4DR7 L;  1KHI A;  4UAI A;  1FJG L;  2K05 A;  4IAL A;  5IP9 G;  4LW1 A;  2F1M A;  2JA6 G;  4QIW E;  3RNU A;  2IX1 A;  1EEI D;  5E1F A;  4ZQ3 A;  1S5E D;  5M5W B;  3W1G A;  1PFM A;  5M5Y B;  2YTV A;  3OIP A;  4N9T A;  2E5L Q;  1Y8N B;  3J7A V;  2RF4 A;  1KQS A;  4IUQ A;  3QOL A;  3NTH A;  3IAY A;  1WD1 A;  1EIF A;  4IOA A;  2TSS A;  1CHQ D;  2TMP A;  3IFT A;  3J81 L;  4C2M B;  1V1Q A;  3G6J B;  1SEB D;  5DM7 3;  3RLO A;  1ENC A;  2X6G A;  1II3 A;  4C3I G;  4DK0 A;  4X65 Q;  1ESR A;  1T9H A;  3TN2 A;  4GOP A;  3S1R B;  3RN2 A;  5A2Q L;  3CCQ A;  4Z9C B;  2CVR A;  2A73 B;  4JI3 Q;  4KV6 A;  3Q23 A;  1T5E A;  2LKV A;  2R7F A;  1CFM A;  2RHQ B;  5KRU A;  2WAQ E;  3AFP A;  2EDG A;  4QUF A;  1SFO B;  1VQE A;  1F2L A;  2JEB I;  3CRK C;  4UHV A;  3KDF B;  3I4N H;  4EVO A;  4DXG A;  4MNO A;  2PNR C;  3R2I A;  3TRZ A;  4A3F G;  1SE8 A;  1Z9F A;  3M4P A;  1BUV T;  2VS1 A;  3C1E A;  4PQX A;  3F2C A;  5DLQ E;  3RR5 A;  2L4N A;  2ZM6 L;  5JOB A;  1W6K A;  1XMO L;  5IP7 H;  4A3K H;  4TRD A;  5JJI A;  4R4T A;  3JC6 6;  3I72 A;  5KYI A;  3E3X A;  3I56 A;  4C3J G;  4A3J G;  3S14 B;  1MD2 D;  2KA7 A;  4M8A A;  5LMN W;  2KHJ A;  4DGZ A;  2NN6 H;  2DJF C;  2RCF A;  1IBL Q;  4DUZ L;  4DU9 A;  4AQY Q;  1B8A A;  5FO9 B;  3D31 A;  4DK6 C;  1XMQ L;  1C0A A;  4JV5 Q;  2B2U C;  5EKI A;  1I6H H;  1K3B C;  1JR0 D;  2Q2H A;  3DM3 A;  2I5H A;  4LF5 Q;  4RH6 A;  5BN4 A;  1XJV A;  4YIJ A;  1X55 A;  3PO2 B;  4K8J A;  2BOS A;  4LF7 L;  1STB A;  1SMY D;  4C3H G;  2F0Q A;  2CCZ A;  3OYY A;  4XTC S;  3TRE A;  4DUY L;  3MC0 B;  3T1Y L;  1TS4 A;  1EEF D;  2WP8 J;  5FKA C; 
#chains in the Genus database with same CATH homology
 5M5X H;  2R7D A;  1TWH H;  4GNX A;  2KHI A;  4LF9 Q;  5IYC G;  4HIM A;  4DAY B;  3J80 c;  1I94 L;  2E2H H;  4A93 H;  2N49 A;  1P16 A;  3OTO L;  1WFQ A;  5AJ3 Q;  3HOU G;  3KYH C;  4PMW A;  2RCN A;  1KL9 A;  4L5T A;  1N36 L;  4JI1 Q;  3HOX H;  1X65 A;  2JK8 A;  2IHF A;  3U4Z A;  4GKK L;  1LM0 A;  1A0I A;  5C4X H;  3G4S A;  5M3F H;  1N32 L;  1Y1V G;  4LFB Q;  4JBK A;  4LF4 Q;  3S15 H;  4BBR G;  2RHS B;  4QJF A;  1K8A C;  4UY8 C;  1UE7 A;  4P73 A;  3ER0 A;  1SN8 A;  1HJP A;  3H0G H;  4GOP C;  2AHO B;  2UU9 Q;  4B3R Q;  5FLM H;  1JJG A;  1XPR A;  3K80 C;  3GTP H;  2UUA Q;  1A8V A;  3HOY G;  3UDG A;  3VDY A;  1PYB A;  2IT1 A;  4JBW A;  1J5E Q;  2UXC Q;  1H95 A;  1VQC A;  1KD1 C;  4LFA L;  3K7U C;  1CKO A;  2UXC L;  1P8L A;  2ZJQ A;  1NY4 A;  1HNW L;  4NXM Q;  4JOI A;  2VQE L;  3I4N G;  3MXN B;  2E5L L;  3IRB A;  4HID A;  1FVI A;  4OWX B;  3CCV A;  3HOV G;  3S2D H;  2OCE A;  4QGU A;  2JEA I;  2K5H A;  4NPS A;  1Q82 C;  4GOP B;  2CFM A;  3BZC A;  2AMC B;  4EQ5 A;  4P75 A;  5FJ8 G;  3Q8D A;  3HKZ G;  3U4V A;  4IPG A;  2R92 G;  5JEA J;  3CMA A;  5C0X G;  2AWO A;  4JI5 L;  3RLF A;  1C7Y A;  3HKZ E;  1HNX Q;  2K5V A;  3A74 A;  3NEM A;  2VUM H;  2V1C C;  1GO3 E;  1M90 C;  3GO5 A;  1NE3 A;  1XPO A;  5IP7 G;  4A3K G;  3PSI A;  1WCM G;  1WOC A;  1Y1W H;  2BA1 A;  1OXU A;  1HZA A;  4JCV E;  2Q2U A;  1WJJ A;  2VZA A;  4X65 L;  4GLX A;  5C3E G;  4DV0 Q;  5M5W H;  2JQO A;  4IPC A;  1LTL A;  2AKW B;  1MKH A;  2Q2I A;  3F2B A;  4R4C A;  2ID0 A;  3DLL A;  5IY0 A;  4UPA A;  3I4O A;  4IPD A;  1CKM A;  2NZO A;  4MTN A;  4QY7 A;  5M5Y H;  1QZH A;  3D0F A;  4B3S L;  2UXD Q;  2NN6 G;  1AE3 A;  1X56 A;  3AEV A;  1XNR Q;  2XGT A;  1W2B A;  3W5O A;  4GN4 B;  1YIT A;  5LMN L;  4JI0 Q;  1MIU A;  4PZ6 A;  1IXR A;  2QEX A;  1OXX K;  1Q1B A;  4GLA C;  5IP9 H;  5C44 G;  1JB7 A;  3CD6 A;  4C2M H;  4DKA C;  3CPW A;  4L5R C;  3A5Z B;  4FDB A;  4DR3 Q;  2HHH L;  3FHW A;  4IJL A;  2C35 B;  3G71 A;  2UUC L;  1NBW A;  4DV4 L;  1ASZ A;  1HZ9 A;  2JA6 H;  1QVG A;  2OTL A;  1Z47 A;  4DV5 Q;  1VQI A;  1I3Q H;  1E1O A;  2CQO A;  2K75 A;  3S1R H;  4MZ9 A;  1VQN A;  1IBM Q;  4UP8 A;  4X62 Q;  2Z6K C;  2D0O A;  4KI0 A;  1S40 A;  3CC4 A;  3T1H L;  1PH3 A;  4AIM A;  1NJI C;  2PI2 E;  3KF6 B;  4LFC Q;  1X3E A;  3KJP A;  5HY6 A;  4JI7 L;  4A76 A;  4EX5 A;  4LF6 Q;  2R93 H;  3PUY A;  1PH5 A;  1CKN B;  4LNQ A;  1SFO H;  4GN5 A;  2JA5 G;  4JBM A;  5HGQ A;  3PUZ A;  1RIP A;  1YHA A;  4HIO A;  1G51 A;  5IWA Q;  3J7Z C;  2QA4 A;  4DV3 Q;  1EIY B;  3HOZ H;  4YHH L;  1IZ6 A;  2F4V Q;  1YNX A;  4JYA L;  4A93 G;  3PCO B;  4DV1 Q;  1IBL L;  5ELO A;  5C4J H;  2E2J H;  4DR2 L;  1KC8 C;  1JJ2 A;  4AQY L;  3BZK A;  1NMF A;  4DAM A;  4GNX C;  4C3I H;  4BY1 H;  3M4Q A;  5GRO A;  5GAD C;  3ULP A;  3HOX G;  5E7N A;  1L0W A;  1A62 A;  4YY3 L;  4A3I G;  1UE5 A;  1FGU A;  1XPU A;  2KEN A;  3F2D A;  5H1S E;  3M85 A;  4IOC A;  5C4X G;  2MQH A;  4B3M L;  3CF5 A;  1WYD A;  3PO3 H;  5BR8 Q;  5IYD H;  4LF5 L;  1VQH A;  4UP9 A;  4DV7 Q;  4HJ9 A;  5FLM G;  1HZB A;  1TWA H;  3FP9 A;  3CCR A;  1GM5 A;  1EYG A;  3ULL A;  4GNX B;  4HJ7 A;  2NVQ H;  3S1Q H;  3TS0 A;  1N34 L;  2GVB A;  1D8L A;  5LMU Q;  1K0R A;  1YVC A;  1VQA A;  4LUO A;  3S14 H;  4O2D A;  4GKJ L;  1CSP A;  2I5M X;  1JJC B;  2HT1 A;  3PF4 A;  2VY3 A;  1OTC A;  1QUQ B;  4DR5 L;  4A3F H;  3F1Z A;  1RL2 A;  1VCI A;  4OWT B;  4JI6 Q;  4JOI C;  3PF5 A;  2K50 A;  1PHJ A;  2VQF L;  3CPF A;  1LYL A;  5GAG C;  3U58 A;  4K0K Q;  2YYZ A;  4LF9 L;  1EUJ A;  4A3D H;  2VUM G;  2VNU D;  1HH2 P;  3S1N H;  1N9W A;  3UE0 A;  1UE6 A;  3J81 i;  1QUQ A;  3GD7 A;  1VQ7 A;  3PUX A;  1EOV A;  5ELN A;  1TWG H;  3AYH B;  1VQB A;  2CWP A;  4JI1 L;  2UUB Q;  4IJH A;  3PO2 H;  4BXX H;  3S2H H;  2A1A A;  3FKI H;  2KCM A;  4A3J H;  3GTM H;  1OXS C;  4LFB L;  4LF4 L;  1WI5 A;  2KBN A;  2R6G A;  1YHB A;  3NBH B;  1I94 Q;  4B3R L;  4X66 L;  1CSQ A;  4POF A;  4DR6 Q;  1G6P A;  4DR7 Q;  1Q46 A;  1YJ9 A;  1FJG Q;  1S3O A;  1UWV A;  3H3V H;  4L5Q A;  1OXV A;  2BA0 A;  1UEB A;  1S72 A;  1Q81 C;  1PH2 A;  1N36 Q;  1J5E L;  1K9M C;  3I4M H;  1GD7 A;  3G48 A;  1BVS A;  4NXM L;  2LXK A;  3BJU A;  1N32 Q;  1VQ9 A;  4A3C H;  1A63 A;  1JE5 A;  1YI2 A;  3RLN A;  2ATW A;  2GVA A;  4HJA A;  2Y0S G;  4JI4 Q;  3G6E A;  4ME3 A;  3RZD H;  3EBE A;  3CCL A;  2JA8 G;  1VQF A;  2BH8 A;  2WB1 G;  2XTI A;  2Y0S E;  3K8A A;  1PH1 A;  4IFD J;  4A3L H;  1E7Z A;  2H5X A;  2WB1 E;  4A3M H;  4LF8 Q;  1HNX L;  1MJE A;  1E1T A;  2YTY A;  2MFI A;  1U0L A;  4A3E H;  4POG A;  4C3H H;  5K36 G;  1YJW A;  3UDI A;  1VQP A;  2R93 G;  2HIX A;  2F3I A;  3K81 C;  5M3M G;  1HR0 Q;  4JI3 L;  1I5F A;  4DV0 L;  3S17 H;  4BY7 H;  4BBS G;  4JC0 A;  4YCW A;  2HQL A;  4AYB G;  2ZTC A;  4X64 Q;  1VQD A;  3KOJ A;  1JT8 A;  3CME A;  1Q86 C;  4JI2 Q;  4HIK A;  2JA9 A;  4OO1 I;  3CCM A;  3HKS A;  3HOU H;  1XNR L;  1SRU A;  3CW2 C;  4JBJ A;  1L1O C;  2EQS A;  4PG3 A;  4KHP Q;  3KFU A;  4JI0 L;  1PA6 A;  4Y7N H;  4BY1 G;  2DUD A;  2NVT H;  1VQM A;  2R7Z G;  2JA7 G;  1DGS A;  2YTX A;  3TQY A;  1Y1V H;  3J81 j;  1TWC H;  4DR3 L;  2IY5 B;  1B7Y B;  1Y14 B;  2EIF A;  4HJ5 A;  3J7A 5;  1TWF H;  3CC2 A;  4L5S A;  4IPH A;  5IYD G;  3I55 A;  2WFW A;  3PO3 G;  1PVO A;  3L7Z C;  4B3T Q;  4DR4 L;  3HFZ B;  4DV5 L;  3KF8 B;  4R4I A;  4XIG S;  1L1O B;  2MO1 A;  4P72 A;  5JEA G;  2OQ0 A;  3BU2 A;  4KHZ A;  5LMN Q;  2UXB Q;  3M4O H;  2IHE A;  1O7I A;  4X62 L;  1XNQ Q;  4NXN L;  2LSS A;  3W1B A;  3HOW H;  4WJ4 A;  1PYS B;  2CKZ B;  4LFC L;  1K8G A;  1HR0 W;  3HOV H;  4LF6 L;  1KAW A;  3OW2 A;  1L1O A;  3GTK H;  2E2I H;  2K52 A;  3U50 C;  4YCV A;  2F52 A;  3SGI A;  3PV0 A;  5IE8 A;  2ZM6 Q;  4A75 A;  3RZO H;  1XMO Q;  3S16 H;  4DV3 L;  3T1H Q;  4GN3 B;  2B63 H;  4A3B H;  2QGQ A;  4A3D G;  4BA1 I;  2F4V L;  2NVY H;  5FLX c;  3GDE A;  3KJO A;  2I5L X;  4RG1 A;  4DV1 L;  1R9T H;  1WCM H;  4BA2 I;  4P71 A;  1L2F A;  1VQ5 A;  4JV5 L;  1M1K C;  1SR3 A;  5M3F G;  1QZG A;  1E24 A;  2D62 A;  3B6Y A;  4DV6 Q;  3PO2 G;  4BXX G;  1KRT A;  3STB C;  2PMZ E;  3FKI G;  3CC7 A;  2N8N A;  3H0G G;  1EQR A;  4DUZ Q;  1IBK Q;  1K73 C;  1N8R C;  2NZH A;  3E0E A;  5BR8 L;  1PFS A;  2I0Q A;  3PUV A;  1K83 H;  4IO9 A;  4DV7 L;  4JI8 L;  3I2Z A;  4QL5 A;  3J81 c;  1V43 A;  1XMQ Q;  1HNZ Q;  5GAE C;  2DGY A;  3ZJY C;  4OX9 L;  3ERS X;  1NTG A;  3I4M G;  1VQO A;  5LMU L;  3UE1 A;  4UP7 A;  3CCE A;  2FXQ A;  3F8T A;  1X9N A;  2YV5 A;  1UE1 A;  2ES2 A;  1GKH A;  2OQK A;  3PIP A;  1EQQ A;  4DV2 L;  1PH4 A;  4TQU S;  2B3G A;  1OXT A;  3NEN A;  4JG2 A;  3K0X A;  4A3L G;  2E8G A;  4GLV B;  1KRS A;  4LF7 Q;  3NEL A;  1YEZ A;  4DR1 Q;  3S1M H;  1EWI A;  4H02 A;  3L2P A;  4IFD I;  4ALP A;  2JE6 I;  4K0K L;  3EIV A;  4OO1 G;  3TEH B;  3KLW A;  5AJ3 L;  4DUY Q;  4A3E G;  4GKJ Q;  3I7F A;  1Y1W G;  3T1Y Q;  3E9I A;  2IX0 A;  1N33 Q;  1Q8K A;  4DR5 Q;  4NB3 A;  5C0X J;  1KXL A;  3CCJ A;  3GTO H;  4C3J H;  1VQL A;  2JA5 H;  2UUB L;  4DPG A;  4BY7 G;  4APV A;  2ZTE A;  3AQQ A;  1IYJ B;  3GTG H;  3M9B A;  2UU9 L;  1W3S A;  3OTO Q;  1Q7Y C;  2UUA L;  2A8V A;  3UDF A;  5IYB H;  1BKB A;  2N78 A;  4A3G H;  4DR6 L;  4DR7 L;  4KLK A;  1VQK A;  1KHI A;  1SMX A;  2N3S A;  5GQO A;  1FJG L;  5IP9 G;  4GKK Q;  4WJ3 M;  4LW1 A;  1J6Q A;  2MNA A;  1QVF A;  4A3I H;  3GTJ H;  1NMG A;  2JA6 G;  4P74 A;  4QIW E;  4YWL A;  1I50 H;  3RNU A;  2ASB A;  2IX1 A;  4JI4 L;  4X66 Q;  3PIO A;  3W1G A;  4LFA Q;  1ASY A;  2Q2T A;  3H3V I;  2K14 A;  2VQF Q;  1HNW Q;  2YTV A;  2VQE Q;  3J80 i;  4TVA B;  1KIX A;  2E5L Q;  3WWV A;  4LF8 L;  2RF4 A;  1KQS A;  4LUZ A;  3LGJ A;  1VQ6 A;  4OXP A;  4O0A A;  3CP0 A;  3HOW G;  3M7N A;  1BBW A;  1B70 B;  1EIF A;  4IOA A;  2ALY B;  4JI5 Q;  3STB D;  1YHQ A;  1HR0 L;  4R4O A;  1X3F A;  3GTL H;  5IYC H;  1V1Q A;  1E22 A;  1YBY A;  3HOZ G;  3RLO A;  1AH9 A;  4AYB E;  4X64 L;  2UXD L;  3PGZ A;  3AFQ A;  2B63 G;  3M3Y H;  4A3B G;  1U5K A;  2ZJP A;  4JI2 L;  5JJL A;  3CXC A;  1YZ6 A;  4X65 Q;  4GOP A;  1T9H A;  3L0O A;  2JJQ A;  3RN2 A;  3CCQ A;  4KHP L;  4YWK A;  4OON A;  4JI3 Q;  3JAM c;  1QVC A;  4BBR H;  1VQ4 A;  5JJK A;  4B3S Q;  2R7F A;  3PUW A;  2WAQ G;  4YWM A;  4AH6 A;  3TS2 A;  2EXD A;  3A5U A;  1VS0 A;  2L15 A;  3K7A H;  1XTD A;  4R1J A;  2RHQ B;  3HOY H;  2WAQ E;  3AFP A;  1VQG A;  1PH7 A;  5GAH C;  1K3R A;  4B3T L;  1Q12 A;  1YIJ A;  1VQE A;  1IBM L;  1EFW A;  3ULJ A;  1VQ8 A;  4IFD G;  2JEB I;  1Q1E A;  3EN2 A;  3KDF B;  1HZC A;  3I4N H;  2UXB L;  4QQB X;  2HHH Q;  1XNQ L;  2VL6 A;  2NVX H;  2UUC Q;  4DV4 Q;  4MNO A;  3RN5 A;  1FL0 A;  2D0P A;  5FJ8 H;  3TRZ A;  3CAM A;  1SE8 A;  1Z9F A;  3M4P A;  2PQA B;  3S24 A;  4A3F G;  2R92 H;  1SLJ A;  2VS1 A;  1TXY A;  3JAM i;  1PV4 A;  1JMC A;  4LUV A;  2JA8 H;  4DR4 Q;  4J15 A;  5IWA L;  2A19 A;  2PNH A;  3KDF A;  1G29 1;  5DLQ E;  3F2C A;  1IL2 A;  1X6O A;  4LWC A;  3RR5 A;  2ZJR A;  1GVP A;  1PH8 A;  2CWA A;  2ZM6 L;  4NXN Q;  1XMO L;  4OWW B;  4PZ7 A;  5IP7 H;  4A3K H;  4JI7 Q;  5JJI A;  2BH2 A;  4R4T A;  2PQA A;  4YCU A;  3JC6 6;  1PH6 A;  4DK3 C;  1LUZ A;  5C3E H;  2K5N A;  5J3B A;  1BBU A;  1E3P A;  2OTJ A;  3I56 A;  2Z0S A;  5M3M H;  4A3J G;  2OWO A;  5C0X I;  4A4I A;  4BBS H;  4YHH Q;  1D7Q A;  4GS3 A;  5LMN W;  2KHJ A;  4DV6 L;  4HJ8 A;  4JYA Q;  4PZ8 A;  1IBL Q;  1IBK L;  3KF6 A;  4DUZ L;  4DR2 Q;  4AQY Q;  1B8A A;  3A0J A;  5IYB G;  2VW9 A;  3H15 A;  1AE2 A;  3D31 A;  4DK6 C;  4A3G G;  1CUK A;  4Y52 H;  1XMQ L;  1HNZ L;  4YY3 Q;  5C44 H;  4JV5 Q;  1C0A A;  1CKN A;  4RMF A;  1I6H H;  4X6A H;  2MO0 A;  2R7Z H;  2JA7 H;  4A3C G;  4B3M Q;  3DM3 A;  1MJC A;  2AWN A;  2I5H A;  2Q2H A;  2Z6K A;  3CQZ H;  4R4Q A;  5IT9 c;  3CCU A;  4LF5 Q;  4JI6 L;  2GN5 A;  2NN6 I;  3MEF A;  1XJV A;  1V9P A;  1X3G A;  1X55 A;  4JI8 Q;  3CCS A;  2K4K A;  2KCT A;  4A3M G;  1YJN A;  1N34 Q;  1PH9 A;  1SRO A;  4OX9 Q;  2PI2 A;  5EAY A;  1X54 A;  4LF7 L;  4DR1 L;  4DNI A;  3UDX A;  2CCZ A;  3GTQ H;  3OYY A;  4XTC S;  3TRE A;  2ZTD A;  4DUY L;  1VQJ A;  2HIV A;  2YU9 H;  3T1Y L;  3ICE A;  4DV2 Q;  3E9H A;  2B29 A;  1N33 L;  1C9O A;  2LXJ A;  2WP8 J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...