5ELEA

Cholera toxin el tor b-pentamer in complex with a lewis-y
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
b'TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cholera enterotoxin subunit B
publication title High-Resolution Crystal Structures Elucidate the Molecular Basis of Cholera Blood Group Dependence.
pubmed doi rcsb
source organism Vibrio cholerae o1
molecule tags Toxin
total genus 26
structure length 103
sequence length 103
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5eleA00
2ICIA 3OWEB 1I4QA 3R2TA 1XXGA 1EU4A 1LTSD 1PRTD 3R8BA 1HTLD 1LLRD 1PTOD 1PZKD 1G8ZD 1LT5D 5ELFA 1S5ED 1M4VA 5ELCA 1PRTF 1RF2D 1PTOF 1PTOH 1JWSD 1TY2A 4Z9CB 2AQ2B 1PZID 1CHQD 3DWQA 2R61A 5I4DA 1CK1A 4O1NA 1ESFA 1BCPC 3W2DA 1PZJD 1TY0A 3BVZA 1TS3A 3BVMA 1EU3A 2NTTA 1LTGD 1EEID 1SXTA 1EWCA 2O2LD 4RGTA 1UNSA 4RGOS 3URYA 1FNWA 5ELBA 1EFID 1TS5A 1UUPA 1MD2D 2TSSA 1D6EC 1JCKB 2IPKD 4BWGB 1L0XB 1F77A 1PRTB 1PTOB 1LTBD 1DJRD 1T5XD 1HXYD 1KLUD 4L6TB 3V05A 3BYTB 5ELEA 1LTRD 1RD9D 2XRQD 1JQYD 1FD7D 1LT6D 1I4XA 1LT3D 5D3DA 1V1PA 1SE3A 4RGMA 1D5XC 2CHBD 5TSSA 1FNVA 2J4XA 1KLGD 1EEFD 2SEBD 1RDPD 3EA6A 1B1ZA 1SJED 4L63B 1S5BD 2NTSA 1JR0D 5FKAC 1SEBD 1XTCD 1ENFA 4C56C 1V1OA 1SE2A 4RH6A 1I4HA 4DXGA 3DWAA 1AN8A 4RCOA 3SEBA 1LTTD 1ET9A 1I4GA 4RGNA 2XRSD 3BYYB 1BXTA 1BCPD 1BCPB 1HA5A 1JWMD 2RDGA 1GOZA 5ELDA 1FNUA 4K6LA 1DYQA 2RDHA 1D5ZC 3EFXD 1KTKA 1PRTC 1TS2A 2IJ0A 5D3IB 4UDUC 2XNAC 1BCPF 1JWUD 2AQ1B 1B44D 1I4RA 3KLSX 3GP7A 1LO5D 1STEA 1FGBD 2XN9C 1AW7A 1ET6A 3R2IA 4RHRA 4DXFA 1CHPD 1SBBB 2Z8LA 4RFBA 5FK9C 1D5MC 2G9HD 3MFGA 1L0YB 4RHSA 2QEJC 1S5FD 1LTAD 1QILA 3CHBD 3O13A 3DWPA 1S5DD 1V1PB 3BZDB 1HQRD 2QILA 4ZYSA 1I4PA 1SJHD 1SE4A 3MC0B 1PTOC 1S5CD 1LTID 1LT4D 4OHJA 3TSSA 2AQ3B 1CT1D 1PYWD 1RCVD 3BVGA 2WV6D 4TSSA 1TS4A 1CQVA
chains in the Genus database with same CATH superfamily
1GXDC 2IT1A 4QMGA 5IGEA 1A3UA 4U673 1IKLA 1G8ZD 4ZUIA 4DV2L 1N8RC 4YIJA 4HIOA 4BY7G 2D62A 1KAAA 3MXNA 1B70B 2AQ2B 4R4CA 3BDLA 4OO1H 3VR4A 1KDAA 5K36H 3CMAA 4BY1B 1X56A 4FF3A 1NMFA 1TY0A 4CGYB 3Q8DA 4CKEA 2XVSA 3G6JB 3M7GA 2QKIC 2CW0C 1GUTA 5ELBA 2OTLA 5M5YB 2KA7A 4JI5Q 2DGYA 2MGSA 4C3JH 2KCTA 4P71A 1EY9A 3RN5A 1SMYC 4J6HA 4JI8L 4IUTA 1LTRD 2XWBB 5IODA 1GM5A 1H9SB 3CCMA 1HA6A 1I6HB 1HUNA 2HCCA 3U4ZA 4JI1Q 3CQZB 2X69A 2F3VA 4X64Q 2Z0SA 2I07B 5J22A 3D6CA 3TP7A 4FVMA 2NVQH 1F2LA 1K8MA 5EKLA 3MFYA 1KHIA 1I4HA 3A0JA 1SYEA 1G6PA 4P72A 2EYPA 2KEDA 3IL8A 3VDYA 4DV1Q 1QCBD 2F0UA 1KRSA 3F2UA 2CQOA 2A8VA 4NW2A 1B44D 3HFZB 2MUYA 3K57A 1WD0A 3K6OA 1Q7YC 4LFCQ 4FXDA 1BBUA 2Z9HA 1WVLA 3H3VC 2JA9A 4DK1A 2I5HA 4RCNA 4JYAQ 3K5MA 1I94Q 5IP9G 4AH6A 3K8AA 3U50C 3OTOL 1HFGA 2O5JC 4B9WA 2QEJC 1BOSA 3CW2C 4LUZA 5CV9A 1ZEQX 1LTAD 5GROA 4NXNQ 2UXCQ 1ENCA 2F3IA 2K52A 3DMUA 1RODA 4WFN3 1KXLA 1SE4A 2LS01 1OTCA 1OXTA 1EYCA 1YIJA 4I65A 3FVQA 4GNXA 3S1QH 2VS1A 4OO1I 4TSSA 1TU2B 4O2DA 4DR6L 4LF7L 3WOEA 3STBD 5IY0A 4A3MB 4LFAL 4H02A 3E9IA 4KD4A 4IURA 3C1FA 3NWSA 1KC8C 3RZOB 5M3MB 2RVLA 5AJ3L 1N36Q 4IQZA 2A73B 1VQNA 2WFWA 3QOJA 1KNEA 1KD1C 2JA5B 1CUKA 1PTOH 2K04A 1R9TB 3OIQA 3N6RA 1CHQD 3P7JA 3HOVG 3BJUA 4B9XA 1J5EQ 5CV4A 4AIMA 4AQYQ 5E4WC 1PZJD 2NB0A 3J81E 3I55A 1B3QA 1QZHA 3MZ5A 4YWLA 2PMZB 3RD4A 1E3PA 3VR5A 1EY6A 1CI3M 4F87A 4KMUC 4K6DA 3OOCA 4BY7B 5HGQA 4OO1G 4IZ8A 5K36G 1C0AA 1HNWQ 4HSVA 1IW7C 4J1MA 1EL0A 1B2TA 4L63B 5C4HA 1XTCD 1IZ6A 1EQRA 3KJOA 1SNOA 1EOTA 2RCFA 1EZ8A 2PQEA 1MSGA 3GV6A 4ABNA 1EWIA 5IT9E 1BCPD 4FO2A 1JWMD 3NK9A 5JJKA 2EY6A 3H15A 2VUMH 1DYQA 1E22A 1BQQT 2RSNA 1IHZA 2YTYA 1PFSA 2N49A 1XTDA 4GS3A 5DLQE 3D6WA 2NVXH 1YJNA 4A76A 2CWPA 3MEFA 5A2QL 3A5UA 2PQAA 1PA6A 1IBMQ 2XN9C 5IYDH 1V1QA 4C3IH 2E5LL 2EPBA 3UE1A 1RTOA 2KENA 3HOZH 1CA5A 1IBLL 2B29A 1BF4A 3KLWA 4B08A 3MC0B 4OHJA 5J3BA 2V4DA 2WAQG 4HR7B 3TSSA 4Q0FA 1S4ZA 2OTJA 1H9KA 2M2LA 2WKDA 5M5XB 3ICEA 2FJ2A 3G6EA 1ICFB 4RKBA 1Z9FA 2AHOB 3T16A 3W1BA 1Y8PB 2YU9B 3EROA 5KNBA 5KRUA 2JA7B 3KFUA 3TRZA 2R6GA 2L1BA 4Q5VA 1LM0A 4N8FA 4B3RQ 1EIFA 2OCEA 5E3FA 2NZOA 1HR0W 4JCVE 4XQQA 2YV5A 2A6EC 3PSIA 5CGKA 2UU9Q 2NTTA 1LTGD 4K14A 4K8JA 4FXKC 2K14A 1PXUA 1J6QA 1JCKB 2ZTEA 3W3AA 4DV5L 1PH2A 2HQLA 3KF8A 4B3TL 2JA8H 2NVTB 2NZHA 1JQYD 3K59A 1FD7D 3AFQA 3S2DH 3HOUH 2K50A 4JW0A 2MFIA 2PZTA 2R7DA 5E7NA 5BR8Q 5EQ0A 4DV6L 2B2VA 4JBKA 2F0HA 3ZJYC 3NTHA 5FKAC 2E2JB 4DR5Q 1JC7A 4DR4Q 2ZJPA 1IKMA 1PMRA 2EVBA 3BG3A 3S16B 4GKKL 2E2DC 2EYOA 2QDBA 1MSHA 3GTQH 1GOZA 3QR8A 4LF9Q 3SK6A 4MNOA 1AFPA 1NSNS 3GQBA 3I70A 2NYZD 5EPLA 2FMCA 1Q81C 4LFBQ 3PUWA 1C48A 1DOMA 5BN4A 1DOKA 2IY5B 1SNCA 3QG1A 2G9DA 5C5LA 4DGZA 5A35A 3M4QA 4HCSA 4KKUA 2ZM6L 2JJQA 3K58A 2VUMG 3GTJB 2YYZA 3CCRA 1QILA 2FXQA 5CV7A 3I3CA 2B63G 1GUNA 3G7LA 2JEAI 3MWYW 4DUZL 1LTID 3U9OA 4K5XA 4DUYL 3FPUB 4GN5A 3Q22A 5IYDG 2BA0A 5EPKA 4C3IG 4BY1H 1MGSA 4YY3Q 3T56B 2CWAA 1JORA 3HOZG 3IFDA 4HMIA 5IGBA 1MIUA 4DAMA 2F4IA 4GKJL 3LGJA 2R7FA 1ZYRC 5ELFA 3J80i 5M5YH 1EY0A 5GAGC 4JI2Q 4POFA 1STYA 3NQTA 3A8JE 1PH5A 4M8AA 1H9RA 1C4QA 4LF4L 2NN6H 2X6GA 2C35B 4PV1C 3GO5A 4A3EB 1XMQQ 3NBHA 1I6HH 5JPMC 3JAMi 3W2DA 3I4NG 3CQZH 3X3MA 1XMOQ 1E24A 4OIKA 1HR0Q 4OEMB 2QDLA 3NTIA 5CV6A 3S1RB 1L1OA 4IUUA 5EKIA 3TQYA 2ZJRA 2IX0A 2A6HC 1OXVA 2Z4HA 1QG7A 3PUVA 5LL6S 2N3SA 1MI2A 3TMEA 2CW0D 1V1PA 5JJIA 1A3TA 4HJ5A 1KLGD 1SR3A 3T4AC 1G2TA 1TWGB 1QNUA 2UUBQ 2LMCB 1V1OA 1AP0A 1G51A 2ZJQA 4DK6C 3QJYA 2WIIB 2JA8G 1Y8OB 3PUZA 2G5DA 3WWVA 1JJGA 2I5MX 3KK7A 4DV4L 3HOUG 2SOBA 3R93A 4OONA 5JJLA 2EYJA 2Q2TA 5HY6A 1N34L 2F0WA 3EFXD 3I2ZA 1CKMA 1TWFB 2A69C 2C9OA 4OWWB 1TQOA 1QZGA 3I91A 1NMGA 1G6ZA 4L8JA 1CSQA 2KUMA 1X3QA 3TREA 1ET6A 4LW1A 4KN7C 1UEAB 2YTVA 4DXFA 3VA7A 1IBKL 4RFBA 3A8KE 1U4RA 1UE7A 5FOBB 1PH1A 1NJIC 4RHSA 4RMFA 4A3MH 5EAYA 1KQSA 4JI3Q 3RZOH 2QILA 5M3MH 4LWCA 1FYCA 4R8NA 3E0EA 1KIXA 2VB2X 4IALA 3MXGA 1HZCA 3I4LA 1YJWA 2JA5H 4OX9Q 1WTWA 3LWEA 5ELOA 1R9TH 1SYGA 4DNIA 2NN6I 2MPMA 3HKZB 2L5TA 4BXXG 3PQIA 1PH9A 1XXGA 1EU4A 5T1GA 4IUVA 3RLNA 4JBWA 4DV0Q 4DR2L 2L15A 3AU7A 1WD1A 4G7HC 1VMPA 4PZ6A 2ENBA 3ONAB 1GVPA 1UE6A 1TY2A 4QUFA 2B63B 3DM3A 3P75A 2IX1A 4BY7H 5IIFA 1E7ZA 1UE5A 1QOHA 1CK1A 3NP8A 4CKBA 3OYYA 1LV9A 3K7AB 1SXTA 5JPNC 3BS1A 3BU2A 1EFID 2F0EA 3RR5A 3VYTA 1T5XD 4WJWA 1TWCB 2EZVA 4TKOB 3CC7A 1ESRA 1NTGA 1NCVA 5E1FA 3D31A 3D8GA 3NBHB 3RZDB 2ZTCA 1XNRQ 2Q2UA 1HCZA 1YZ6A 2A19A 2E75C 1EYAA 2QEXA 3A7LA 3I4NB 2UXDQ 5C4XB 1SJED 3LX0A 2RKSA 1SEBD 3I8ZA 4DAPA 5IGGA 4PNYA 2CVRA 1EOVA 3J81i 4DXGA 1WFQA 1KL9A 1KNAA 3A8IE 4RCOA 3OPOA 2HD3A 5F2DA 3PV0A 5I9PA 1G91A 2ATWA 1HJPA 1FJGQ 1ASYA 4DAYA 2HIXA 1FGUA 2A68C 4XT1B 2HIVA 2UXBQ 1PRTC 3F8TA 1SYBA 2MQHA 3T1YQ 2KVMA 4A3GB 3QIAA 1UE1A 4B3SL 3K5LA 4DA2A 2H1EA 4ID6A 3NEMA 1DONA 3R2IA 1BUVT 4NPSA 4EQPA 1YNNC 5M5XH 1ENAA 4FF1A 2Y0SE 3E9HA 2K5DA 2YU9H 3F2DA 1I4PA 1JJCB 2JA7H 1CKOA 1Q12A 3DM1A 5IYCG 2UUAQ 3KOJA 4A3JG 1WYDA 1MJCA 4R4QA 3WDNA 4YWKA 2Q8IB 3J7AF 1WTHA 3OWEB 2B2UC 3KBGA 4OIJA 3KF6A 4A3MG 3NUCA 3RLFA 2CH4A 3M3YB 1VQCA 1LT5D 4YHHL 2Q8RE 5M3MG 1VQEA 1XPOA 1JOOA 3L3OC 1F9SA 1K9MC 2JA5G 4F88A 1EYDA 1C9OA 2F0KA 2NVTH 2F03A 3ULLA 2K28A 4DAVA 1STGA 4QL5A 3E0JA 3RMHA 3RN2A 1ML0D 4I7AA 1QJOA 4EGVA 1SRUA 1TS5A 3K5OA 2IPKD 2E2JH 4UPAA 2XIWA 1DJRD 2A6ED 5C44B 4L6TB 1PFBA 5ELEA 3S16H 1E0BA 4DV7L 4UAIA 4X3TA 5LMNW 1ZXTA 4OWTB 5C4JB 1JE5A 1G291 3CMEA 2VNUD 2E2HB 3CC4A 3K0YA 2B39A 1EY8A 5C3EB 1EEFD 4JI0L 1S5BD 2VB3X 3Q23A 1JR0D 2CKZB 2R93B 1EY5A 2ZTDA 4A3IB 2HUGA 4YCVA 2E8GA 1I4GA 2XTIA 2RDGA 3ITPA 5ELDA 3CP0A 1Y69U 1SDFA 4DR1Q 4EQNA 2LY7A 3GTJH 3OHXC 3OW7A 1D8LA 1XNQL 4UDUC 1DZ1A 3C3LA 1L2FA 5IOCA 3PIO3 2KQ3A 2K4KA 1HPCA 3UI2A 3T13A 1WI5A 4OELB 2F52A 2TMPA 1OXXK 3BDCA 2CH4W 3OWFA 4JI4L 5FJ8H 3K80C 4C2MB 1PH6A 3NENA 1YHAA 4HSPA 2MNAA 3CHBD 3O13A 1D1KA 4R8IA 1HNXQ 4IUQA 3F2BA 1C7YA 3T1HQ 4KHPQ 4BA1I 3CKIB 3D3RA 2Z6BA 3TBIB 5M9OA 4A3EH 2XSCA 4G4KA 3D4RA 2UUCQ 2BE5C 1I4QA 3K5NA 4C1NK 3L2PA 3D0FA 2HT1A 1FL0A 5EBDA 4LF6Q 4DNTB 1CTMA 3S1RH 2HHHL 2JA7G 3T53B 3K7UC 2DNCA 3QB3A 3G71A 3DXJC 1YVCA 5ISRA 1A63A 3S1NB 1C8CA 2OT2A 3UDFA 1K0SA 4A3JB 4K2KA 3MEHA 1YI2A 1ZYRD 2B2UA 3CF5A 2BDNA 3OSOA 3PIP3 3DHQA 2DNEA 3KF6B 2EYLA 1VQGA 2N78A 4RGOS 1TWGH 4YCUA 3CRLC 1VCIA 4RAUC 1VQLA 1LYLA 3NELA 2F0GA 3NTKA 4IOAA 2PNRC 2K32A 1VS0A 1LT6D 3M4OB 1I3QB 2X6LA 2DY7A 1OXUA 3FEWX 3BZCA 2AWNA 2B8GA 5LMNQ 2R92G 3FKIB 2A6HD 3WOFA 1TWFH 4UP8A 3J7A5 4A3CH 3OMGA 3M9BA 4K5VA 1XJVA 4LF5L 4LF8Q 3I4MG 4R4TA 3CD6A 1SE2A 2VQEQ 3FMCA 4LMQD 2B2VC 3ND9A 3V96A 2JN4A 3KLSA 4HTHA 4PMWA 1HA5A 3MXNB 1U5KA 2RDHA 2HCIA 4JI7L 5COYA 1TS2A 2IJ0A 4HJ9A 3SHLA 2AQ1B 1KABA 1JB7A 3DEPA 4NKLA 3MXUA 2VL6A 1JICA 3KYHC 1STNA 3U58A 5DM73 4DR3Q 1SLJA 4AYBE 1GUSA 2Z1CA 2DUDA 3NPPA 4UP7A 5CORA 1YHQA 3VR2A 3EBEA 4B3MQ 3L0OA 1A8VA 1NE3A 5JVH3 2B63H 1SFOB 1WJJA 4DN4M 4NDXA 3A55A 3BZKA 2AQ3B 3HRZC 3SXHA 1K3RA 3SR1A 5KIXA 5FJ8G 1CQVA 3K7AH 3RLOA 5AFWA 3S24A 1EQVA 1B9MA 4X66L 3UDXA 1SNQA 3J7AV 1PRTF 1DGSA 4KN4C 1GUOA 1SAPA 1TWCH 3MHBA 5LMUL 2ALYB 4XDXA 5I9OA 3NE5B 4A3EG 1I6VC 3BVMA 3IRBA 3PIPA 1IYVA 5I2YA 2A1AA 2JYOA 1ZKOA 1Y1VB 3I4NH 1HHVA 5C4XH 2N8NA 4PQXA 1EUJA 2L0CA 1LTBD 5FLXL 4CKCA 3A5ZB 3BYTB 2AUKA 1L1OC 1O78A 1PFMA 5FLXc 4K2LA 1VQ8A 4GNXB 2R7ZG 5I6YA 1N33Q 1B8AA 2J4XA 3UDGA 3EA6A 1O7YA 4A3GH 4JV5L 1TIID 4LNQA 4IPHA 4DR7Q 3IAYA 3MA2B 4DV3Q 3I4OA 4KY7A 2VQFL 1MHWC 4UY8C 2IWHA 3VYRA 2JE6I 2K5HA 2PYKA 4WORA 5EGTA 1FNUA 4P75A 4K0KQ 4X62L 4POGA 2BH2A 1BKBA 3L7ZC 5KYLA 4A3CG 2FMMA 1MJEA 4ZKBB 2R92B 1NUCA 1STEA 1HNZL 3PO3G 1N32L 1CA6A 4DV2Q 1STBA 3I4MB 2F0NA 3EN2A 3HOWB 4KJNA 4M1UB 4MIUA 1CHPD 1PVOA 1O7ZA 1TWHB 3MFGA 4L5TA 1LACA 2F0MA 3M3YH 2F0SA 4P74A 4LAAA 4BBSB 2F0TA 3GTPB 2KHSA 4ZRZA 1PH4A 1JMCA 1NBWA 2QW7A 2RBMA 4JI6L 2EXZA 3HKZG 3K0XA 1TS4A 2OEOA 4NXML 3R2TA 4KKSA 4JI8Q 1X32A 3R8BA 3IKJA 3UDIA 2I0QA 3HP3A 3HZXA 4QQBX 1IL2A 4BXXH 1E2WA 3S17B 3S14B 1ILPA 1DM0B 3B6YA 5JJZA 5ELCA 3MAQA 5IWAL 5C44H 3AFPA 5C3XA 1PZID 3ULPA 1VQBA 1A2TA 2K5VA 1K8AC 1VQJA 1U4MA 4X65L 4O1NA 5C4JH 3G48A 4LUVA 3TS0A 3NSWA 4N9TA 2BOSA 2E2HH 2PQAB 3PF5A 1PFNA 1GHJA 5C3EH 5FLMH 2PCFB 1TWAB 5CV8A 1M1KC 2F0LA 2QCPX 5CBAE 1D6EC 1OXSC 2R93H 3GTMB 1DCZA 2SNSA 1VQ6A 4A3IH 2XRQD 2E2IB 1WCMG 4A3BG 4C3HB 4RGMA 5TSSA 1FNVA 1PYSB 2GVAA 1RDPD 1QVGA 2PW7A 1HTPA 3OTOQ 5C4XG 3KLRA 1TT2A 2F0VA 4FNFA 3EJIA 2K33A 1P16A 3D4DA 2RQXA 2B2TC 3A74A 4EQOA 1LTTD 1NNXA 2RA4A 2BDOA 5CC4A 1NY4A 2Z6KC 1S3OA 2AKWB 4K6LA 1F2YA 4C2MH 4JI5L 3STBC 2JP1A 1VQFA 5C3WA 3FRPB 4KKTA 3IFTA 1K83B 4DR6Q 4LF7Q 4A3GG 2R7ZB 4LFAQ 3I72A 1X3EA 4KD3A 1RTNA 2IHFA 1SMYD 2LXKA 5M5WB 2AMCB 4JI1L 5AJ3Q 4LK1C 1GKHA 4IUNA 2JK8A 4KV6A 4RHRA 4X64L 1EY7A 1HRJA 1B53A 2Z8LA 1YNXA 3KF8B 1X3GA 4PG3A 2V1CC 3W1GA 2JQOA 5C5MA 5CR3A 1PH3A 4OL7A 3H0GB 1YJ9A 4A3LG 1PDQA 3NXWA 5D65A 4ZK9B 1S40A 4DV1L 1PH8A 2HDMA 3S1NH 2PI2E 2RSOA 5IYCH 3PO3B 4A3JH 4IJLA 4LFCL 3M7NA 2Y0SB 4QF4A 1LTSD 4F8MA 2P5ZX 4JVZA 1VF5C 3G4SA 1AH9A 2Z4IA 4XQNA 2PO4A 2VZAA 4JYAL 1I94L 1PTOF 1B50A 2BE5D 3OMCA 4NXNL 1DOLA 1Z7TA 1HH2P 4QIWE 4CDCC 3M4OH 1I3QH 1BCPC 4G57A 1O7LA 3GTOB 3FKIH 1UNSA 4RGTA 1PHJA 1XPRA 5G3LF 4V0BA 1UUPA 1H95A 4ILWA 4RA8A 3L9AX 5C44G 2A74C 1RD9D 4OXPA 4A3KG 1KDCA 4GZYC 1YEZA 4DK3C 1N36L 1JJ2A 4XYOA 2D0OA 2LKVA 5C3EG 5FLMG 1BBWA 2E5LQ 1VF7A 1EZ6A 1DXMA 2EIFA 1I5FA 4TQUS 4QJFA 5M3FB 1J5EL 4LUOA 4P73A 4AQYL 1IBLQ 2R93G 2KHIA 2F4VL 2QGQA 3SEBA 1IL8A 4O42A 3PUXA 1X3PA 3CCUA 4A3IG 3GTGB 2ID0A 1PV4A 2SDFA 2WB1E 4JK1C 2L4NA 4A4IA 1WCMB 3UE0A 4A3BB 3FP9A 3P1HA 4JPBW 1SNMA 1JWUD 1BR9A 4RG1A 4CDEC 3NHHA 1HNWL 3ER0A 2B2TA 2WAQE 1SFOH 2Q2HA 4JG2A 1VQAA 1AZPA 1T5EA 1L1OB 5CYUA 2Z6KA 2F3WA 5FK9C 2GVBA 1GO3E 5IGDA 4KI0A 1IW7D 5JEAG 3H6MA 3HOXG 3PF4A 1SNDA 2OQKA 3J7YW 3DWPA 1V1PB 1X6OA 1HQRD 4ZYSA 3TZUA 4YWMA 4A3DB 3MXPA 4ME5A 1UAPA 1EWHA 4MZ9A 4ULLA 3FDTA 1PYWD 1W3SA 3CCJA 4DV5Q 3U4VA 1QWYA 4B3TQ 4NP5A 5C0XH 1DD2A 2J7ZA 1B4OA 1EYGA 2JA6G 1Y1VH 4KJOA 4DK0A 1JT8A 1IBML 1Q90A 1CZWA 4QCLA 1U4PA 2JXMB 4IPDA 1JWSD 4Z9CB 5C0XJ 4DF7A 4DV6Q 3PUYA 3NWTA 3TZDA 1F9RA 2PZWA 5DNFA 1SYFA 2YTXA 1H9JA 3I73A 5FLXE 1YITA 4GKKQ 4J15A 1A6XA 2O2LD 4HN7A 2FINB 5J39A 2N88A 2A5HA 4BWGB 2EJFC 2VY3A 4A93B 1CKNA 3D4WA 2GN5A 3GV3A 3LWUA 1KLUD 4GLAC 3AB9A 4QGUA 3T51B 1V9PA 2Q2IA 1LT3D 2DJGC 1EQTA 5D3DA 1A2UA 3CU7A 2E74C 1Q8IA 1KRTA 1CFMA 2K05A 1WTQA 1I50B 3FKIG 4EQ5A 1RL2A 5BN5A 3GTKB 4B3RL 3SK8A 2ZM6Q 1UWVA 1V8QA 2ZT9C 2VW9A 2NTSA 1ENFA 1TR5A 4R4IA 2R92H 3P20A 3AYHB 5D14A 2UU9L 2XGTA 3I4MH 3CXCA 3HOWH 4DUZQ 1HZAA 1J8IA 3BYYB 1TWHH 4NMZA 2EY2A 4DUYQ 4A3KB 1CZGA 5JOBA 1HZBA 1W2BA 3J81j 2WINB 3KLSX 4ZKCB 4BBSH 1LO5D 2I5LX 1S72A 4GKJQ 4OWXB 3GTPH 5HURA 1FGBD 2EDGA 3Q0AA 4ZUJA 2F0QA 3SE0A 5BR8L 1D5MC 1VQPA 1AEXA 4LF4Q 4FF2A 1L0YB 2DN8A 3H09A 5EBCA 5J1ZA 2IHEA 4DR5L 4DR4L 5C0XI 1S5DD 1VQ7A 3S17H 3S14H 1YHBA 2RF4A 1LTLA 5EPJA 4ZLTF 1G2SA 5L37A 2EXDA 4OGQC 1KDBA 4LF9L 4AYBB 1RCVD 3C2PA 2WV6D 4CJ0B 2EJGC 5H1SE 5EKKA 3N52A 4LFBL 3GTLB 4ZAIA 1LLRD 3ERSX 2B2WC 3ULJA 1TWAH 3ND8A 2F0IA 4TRDA 3HOXB 5FO8B 5GQOA 4DAYB 1ONLA 1EIHA 1RF2D 4FXGC 3HKSA 4MTNA 1WOCA 2ZXPA 3GTMH 3KJPA 4KLKA 5I4DA 4HJAA 2E2IH 1VQDA 3H3VH 5KNDA 2K5WA 4C3HH 4DU9A 1EFWA 1ILQA 4R4OA 5C0XG 3MVVA 1QNKA 1EWCA 3KDFA 4IFDH 4WJ4A 4GN3B 1CQFA 1Y1VG 4DV4Q 1FNWA 1GUWA 3TP6A 5IP7H 1AE3A 1MD2D 4A3FG 1N34Q 4QUCA 4UP9A 2F0FA 1NAPA 2JA6B 5LL6X 1Y1WG 4YY3L 3NQIA 4K8IA 2M00A 4IFDJ 1Q86C 3HOYB 2L12A 4BBRG 3TN2A 3TS2A 4JI2L 4N8X1 3S2HB 3H91A 1GD7A 1E2ZA 4FYDA 1IBKQ 4G7ZC 4I7ZC 1WTXA 4X6AH 1K83H 3S1MB 2R7ZH 1EIYB 1XMQL 1CKNB 3DWAA 2KHJA 5M5WH 1IXRA 4X3SA 1XMOL 1HR0L 4H7BA 4PZ7A 3A7AB 5E4XA 4CHTB 1BCPB 3TEHB 5IE8A 3S15B 2MHVA 1BCPF 3HEJA 3SK5A 3VA5A 4BS9A 1Z6HA 3H0GH 2ZXRA 2MO0A 2ZXOA 3AMUA 1E1OA 4DR2Q 2K01A 3GDEA 4BA2I 1Q1EA 4JOIC 4QB4A 3FPPA 3HOWG 1U0LA 1UEBA 3PO3H 5KEEA 1JB3A 2G9HD 4GN4B 2UUBL 3PO2G 2EYHA 2KJXA 2AUJD 3BZDB 2F0PA 4DPGA 4FF4A 4BBSG 1L0WA 3LNNA 3SDZA 1PTOC 5NUCA 3MTSA 1QUQA 4L5SA 2F4VQ 2K1BA 2PI2A 1W6KA 4X3KA 3PIOA 1MBYA 4XIGS 3CRKC 3H3VI 3QO2A 1A0IA 3KBXA 3GTOH 3QWNA 2A69D 1PZKD 4L5QA 1S5ED 4IFDI 5JAVA 4E6IA 4IN3A 2HQEA 1A62A 3DWQA 4KK7A 1D1IA 5DEHA 1VQKA 2EYMA 4JI3L 3DEOA 1LUZA 1PYBA 4HAEA 2K7VA 2R3ZA 2QA4A 4C3JG 4OX9L 2B2WA 5KYIA 2O5IC 2PZUA 1PRTB 1F77A 2IX3A 5M3FH 4ZCKA 5ELNA 1WTVA 3QOLA 3DUZA 4XXEA 1SNPA 3GTGH 1XWEA 1WTPA 4DV0L 1X65A 4B3SQ 4HIKA 4HMJA 2LFNA 1YNJC 1SYCA 4JC0A 4C3HG 1SE3A 5HGTA 3TP5A 1X9NA 2ES2A 2CHBD 4UHVA 4IOCA 2IW3A 1WCMH 4ME3A 4A3BH 1PH7A 4IFDG 2ICEC 3KDFB 5EJWA 3RZDH 1SN8A 5IP7G 1K28A 4GLXA 1BVSA 2WB1G 3V2TA 5I2XA 4A3FB 5CMDA 4H0LC 1PLFA 3CAMA 3X3NA 1Y1WB 1BXTA 3VR6A 1X54A 2DJFC 2OQ0A 2RHQB 1KTKA 4BBRB 3VR3A 4IUPA 1Z47A 4FDBA 1K8GA 1F9PA 4A3DH 3W5OA 1K73C 2LSSA 1OO9B 5C4ZA 3Q6SA 3F2CA 4YHHQ 1XNRL 1T9HA 2FFKB 2EJMA 1E1TA 2UXDL 4KTAA 2K5QA 4FP5D 5KGUA 5BN3A 2NUCA 1S5FD 1VQIA 2F1MA 1MKHA 1BO0A 2RDFA 1RJTA 4GLVB 3J80L 1YBYA 4L5RC 3NBIA 1SJHD 3H0GG 2IL8A 1F2ZA 4PZ8A 1LT4D 4GOPC 4R1JA 1FJGL 3J80c 2NWGA 4JOIA 3A56A 4LJZC 2UXBL 4A3LH 4Y7NB 4ODGA 4X3UA 3JAML 3T1YL 2ICIA 4WJ3M 3EVQA 2A68D 1K8OA 4G7OC 2Y0SG 4HEDA 1PRTD 1HTLD 1JE4A 3C1EA 1TKWB 3OIPA 2M9VA 5LHY1 4H44C 2PMZE 4DV7Q 4WRDA 4YCWA 4F7XA 3JAMc 3PO2B 4HJ8A 2EYFA 1LABA 1M4VA 1CM9A 4PMCA 4A93H 5CV5A 1QUQB 2KCCA 2MJ8A 4JI0Q 3HOVB 2OF1A 5GADC 2SNMA 4IO9A 1NR4A 1YNND 2NVYB 4H13C 3RUZA 4J8QA 1ESFA 2Q8TA 1TS3A 2EOTA 1EU3A 3PMFA 1D7QA 2UUAL 4DKAC 4A75A 3URYA 1I50H 4KY6A 3GTKH 5KNCA 4ZQ3A 1VQ9A 1XNQQ 1BDOA 4XT3B 2KOLA 2JEBI 2RCNA 2QF7A 4QIWB 2PNHA 1QVFA 1X55A 2EY1A 3TP8A 4A3KH 3HGBA 4JI4Q 2OWOA 1JOKA 3CCLA 1R4PB 1U9RA 4C3JB 4JBJA 4RH6A 5M3FG 2CFMA 3KUPA 5IGCA 1VMCA 1J9OA 4PMBA 1ET9A 2XWJB 4RGNA 1Y14B 1NR2A 2K75A 1D5ZC 3SK4A 5IYBH 5D3IB 2BA1A 2NVQB 3BDOA 1I4RA 2L55A 4XYQA 1Y8NB 1W6JA 3K81C 3E6ZX 2D5DA 1KAWA 2HHHQ 5I6WA 2KEEA 1HUMA 2WB1B 2L9HA 3AQQA 4MHEA 4KY5A 1VQOA 3EIVA 2EQSA 3GTLH 4CDFC 4ALPA 1R4QB 4TVAB 5JEAH 4CJ1B 1CSPA 3HOXH 1GJXA 4A3DG 2I46A 2F0OA 1XPUA 2WAQB 4DR1L 4CDDC 3Q24A 4RKLA 3BVGA 5JEAJ 1M8AA 1JOQA 4XTCS 1A3VA 2OXPA 2MP1A 5GAEC 2NBFA 2JSOA 1QE6A 2O4XA 4GOPA 3SVMA 2JA6H 2F0DA 5K5PA 3S1QB 4LF5Q 2B3GA 2R61A 3HS0C 3CPWA 3HOYH 1FVIA 1WTOA 1HNXL 2B2YC 3PGZA 5DM63 2BCOA 3VYUA 3T1HL 1ASZA 3VYSA 3S2HH 1B9NA 1B3AA 2LXJA 4HJ7A 4KHPL 3FHWA 3TDQA 2ASBA 1N9WA 3S1MH 2TSSA 1A15A 4HIDA 4IPGA 4JI7Q 3GD7A 1PTOB 5IGFA 3J81L 4A93G 1HXYD 3HG9A 2UUCL 4Y52H 4EX5A 2WACA 4IPCA 3J81c 1I4XA 4LF6L 1EIGA 3J7ZC 1U4LA 3S15H 3C46A 2UXCL 2K6AA 1SMXA 1E2VA 2NZ1D 1B1ZA 4V190 1II3A 1IYJB 1SYDA 4C56C 1EQQA 3E5SA 3M4PA 1RIPA 1Q46A 5JVG3 1SSOA 3H94A 2WKCA 2XRSD 1GUGA 2F0JA 5IT9L 3DLLA 3GP7A 4U68A 1M90C 3ERQA 1SROA 2EY5A 2GA4B 4IJHA 3CC2A 1HFNA 2J0TD 4X66Q 1VQMA 5IT9c 1QB5D 1BNZA 5LMNL 1V43A 1WTRA 1VQ4A 3CCEA 4JBMA 2VUMB 4APVA 4LF8L 5LMUQ 2HDLA 5IYBG 3SGIA 2VQEL 2BH8A 3I56A 3CCQA 4S3SA 4MN3A 2NVXB 1S5CD 1Q82C 4BY1G 2VXWA 4AYBG 1O7IA 2KBNA 1CT1D 4C3IB 2PPBC 4EVOA 1ICWA 2CCZA 3HOZB 3RNUA 1STAA 1PTOD 1TXYA 2H5XA 2NN6G 4HIMA 2EE1A 1RHPA 4DR3L 2RHSB 3M85A 2KECA 3CCSA 4JV5Q 1VQ5A 1H9SA 1TVXA 3PCOB 1VQHA 4B3ML 2VQFQ 5C6AA 5G3LD 1Q3LA 3BVZA 1K3BC 1EEID 2D2CC 2E76C 1O80A 1RKNA 2MO1A 4NB3A 5DAUA 4CBVA 1L0XB 4O0AA 4X62Q 3A54A 3I90A 4GOPB 2KCNA 1FR3A 2K03A 2WP8J 3V05A 4A3FH 4DNRB 5A2QE 3R3OA 3U9SA 4P2CB 3HOYG 1HNZQ 1Y1WH 4K5WA 2AWOA 2B2YA 1N32Q 2C5CA 4KHVA 1D5XC 4CJ2C 2K5NA 1IYUA 1QVCA 5FO7B 1STHA 1EY4A 2SEBD 2DY8A 4BBRH 1GHKA 1SE8A 3ZYYX 3JC66 3EQLC 4QY7A 4DFAA 1X3FA 3E3XA 3F1ZA 2B8FA 4C1NI 1HQMC 1YNJD 1AN8A 2JA8B 1XYIA 1AZQA 2D0PA 3I7FA 2H4OA 4KHZA 2N55A 5IP9H 3AEVA 3S2DB 3HOUB 3S9WA 1HZ9A 5CBEE 4JI6Q 2XNAC 2PW5A 3CPFA 1Q1BA 4NXMQ 2CQAA 3CCVA 1D2BA 3OW2A 1AE2A 1F9QA 1K0RA 4R9WA 1AW7A 1P8LA 4GNXC 1N33L 3J80E 3M4YA 3HKZE 1SBBB 4XQJA 4Y7NH 4HCEA 3GTQB 5IWAQ 4DR7L 4DV3L 4X65Q 2KCMA 1B7YB 2D9UA 3PO2H 4N9PA 3JAME 1XX8A 1F2MA 5T1IA 1BBXC 2L11A 1VDZA 2FHTA 1Q8KA 3HOVH 2NVYH 4K0KL 5FO9B 1H9MA 4RWSC 5GAHC 4MTKA
chains in the Genus database with same CATH topology
1GXDC 2IT1A 4QMGA 5IGEA 1A3UA 4U673 1IKLA 1G8ZD 4ZUIA 4YIJA 2D62A 1KAAA 3MXNA 2AQ2B 3BDLA 4OO1H 3VR4A 1KDAA 5K36H 4BY1B 4FF3A 1TY0A 4CGYB 4CKEA 2XVSA 3G6JB 3M7GA 2QKIC 2CW0C 1GUTA 5ELBA 5M5YB 2KA7A 2MGSA 1EY9A 1SMYC 4J6HA 4IUTA 1LTRD 2XWBB 5IODA 1H9SB 1HA6A 1I6HB 1HUNA 2HCCA 3CQZB 2X69A 2F3VA 2I07B 5J22A 3D6CA 3TP7A 4FVMA 1F2LA 1K8MA 5EKLA 3MFYA 1I4HA 1SYEA 2EYPA 2KEDA 3IL8A 1QCBD 2F0UA 3F2UA 4NW2A 1B44D 3K57A 2MUYA 1WD0A 4FXDA 3K6OA 1WVLA 3H3VC 4DK1A 4RCNA 3K5MA 1HFGA 2O5JC 4B9WA 2QEJC 1BOSA 5CV9A 1ZEQX 1LTAD 1ENCA 3DMUA 1RODA 4WFN3 1SE4A 2LS01 1OXTA 1EYCA 4I65A 3FVQA 4OO1I 4TSSA 1TU2B 3WOEA 4A3MB 4KD4A 4IURA 3C1FA 3NWSA 3RZOB 5M3MB 2RVLA 4IQZA 2A73B 3QOJA 1KNEA 2JA5B 1PTOH 2K04A 1R9TB 3OIQA 3N6RA 1CHQD 3P7JA 4B9XA 5CV4A 5E4WC 1PZJD 2NB0A 3J81E 3MZ5A 2PMZB 3RD4A 3VR5A 1EY6A 1CI3M 4F87A 4KMUC 4K6DA 3OOCA 4BY7B 4OO1G 4IZ8A 5K36G 4HSVA 1IW7C 4J1MA 1EL0A 1B2TA 4L63B 5C4HA 1XTCD 1SNOA 1EOTA 1EZ8A 2PQEA 4ABNA 1MSGA 3GV6A 5IT9E 1BCPD 4FO2A 1JWMD 3NK9A 2EY6A 1DYQA 1BQQT 2RSNA 1IHZA 3D6WA 5A2QL 2XN9C 2EPBA 1RTOA 1CA5A 1BF4A 4B08A 3MC0B 4OHJA 2V4DA 4HR7B 3TSSA 4Q0FA 1S4ZA 1H9KA 2M2LA 2WKDA 5M5XB 2FJ2A 4RKBA 3T16A 1Y8PB 2YU9B 3EROA 5KNBA 5KRUA 2JA7B 2R6GA 2L1BA 4Q5VA 5E3FA 4XQQA 2A6EC 5CGKA 2NTTA 1LTGD 4K14A 4K8JA 4FXKC 1PXUA 1JCKB 3W3AA 3KF8A 2NVTB 1JQYD 3K59A 1FD7D 2PZTA 5EQ0A 2B2VA 2F0HA 3NTHA 5FKAC 2E2JB 1JC7A 1IKMA 1PMRA 2EVBA 3BG3A 3S16B 2E2DC 2EYOA 2QDBA 1MSHA 1GOZA 1AFPA 3SK6A 1NSNS 3GQBA 3I70A 2NYZD 5EPLA 2FMCA 3PUWA 1C48A 1DOMA 5BN4A 1DOKA 1SNCA 3QG1A 2G9DA 5C5LA 4DGZA 5A35A 4HCSA 4KKUA 3K58A 3GTJB 2YYZA 1QILA 5CV7A 3I3CA 1GUNA 3G7LA 2JEAI 3MWYW 1LTID 3U9OA 4K5XA 3FPUB 3Q22A 2BA0A 5EPKA 4C3IG 1MGSA 3T56B 1JORA 3IFDA 4HMIA 5IGBA 2F4IA 5ELFA 1ZYRC 1EY0A 1STYA 3NQTA 3A8JE 4M8AA 1H9RA 1C4QA 2NN6H 2X6GA 4PV1C 3GO5A 4A3EB 3NBHA 5JPMC 3W2DA 3X3MA 4OIKA 3NTIA 5CV6A 3S1RB 4IUUA 5EKIA 2IX0A 2A6HC 1OXVA 2Z4HA 1QG7A 3PUVA 5LL6S 1MI2A 3TMEA 2CW0D 1V1PA 1A3TA 1KLGD 3T4AC 1G2TA 1TWGB 1QNUA 2LMCB 1V1OA 1AP0A 3QJYA 2WIIB 1Y8OB 3PUZA 3KK7A 2SOBA 3R93A 2EYJA 2F0WA 3EFXD 1TWFB 2A69C 2C9OA 1TQOA 3I91A 1G6ZA 4L8JA 2KUMA 1X3QA 1ET6A 4KN7C 1UEAB 4DXFA 3VA7A 4RFBA 3A8KE 1U4RA 5FOBB 4RHSA 2QILA 4R8NA 1FYCA 2VB2X 4IALA 3MXGA 3I4LA 1WTWA 3LWEA 1SYGA 2NN6I 2MPMA 3HKZB 2L5TA 1XXGA 1EU4A 5T1GA 4IUVA 4JBWA 3AU7A 1WD1A 4G7HC 1VMPA 2ENBA 3ONAB 1TY2A 4QUFA 2B63B 3P75A 2IX1A 5IIFA 1QOHA 1CK1A 3NP8A 4CKBA 1LV9A 3K7AB 1SXTA 5JPNC 3BS1A 1EFID 2F0EA 3VYTA 1T5XD 4WJWA 1TWCB 2EZVA 4TKOB 1ESRA 1NCVA 5E1FA 3D31A 3D8GA 3RZDB 1HCZA 2E75C 1EYAA 3I4NB 3A7LA 5C4XB 1SJED 3LX0A 2RKSA 1SEBD 3I8ZA 4DAPA 5IGGA 4PNYA 2CVRA 4DXGA 1KNAA 3A8IE 4RCOA 3OPOA 5I9PA 5F2DA 3PV0A 1G91A 4DAYA 2A68C 4XT1B 1PRTC 1SYBA 2KVMA 4A3GB 3QIAA 3K5LA 4DA2A 2H1EA 4ID6A 1DONA 3R2IA 1BUVT 4EQPA 1YNNC 1ENAA 4FF1A 2K5DA 1I4PA 1Q12A 3DM1A 3WDNA 2Q8IB 3J7AF 3OWEB 2B2UC 3KBGA 4OIJA 3NUCA 3RLFA 3M3YB 1LT5D 2Q8RE 1JOOA 3L3OC 1F9SA 4F88A 1EYDA 2F0KA 2F03A 2K28A 4DAVA 1STGA 3E0JA 3RMHA 1ML0D 1QJOA 4EGVA 1TS5A 3K5OA 2IPKD 2XIWA 1DJRD 2A6ED 5C44B 4L6TB 1PFBA 5ELEA 1E0BA 4UAIA 4X3TA 1ZXTA 5C4JB 1G291 2VNUD 2E2HB 3K0YA 2B39A 1EY8A 5C3EB 1EEFD 1S5BD 2VB3X 3Q23A 1JR0D 2R93B 1EY5A 4A3IB 2HUGA 1I4GA 2RDGA 3ITPA 5ELDA 1Y69U 1SDFA 4EQNA 2LY7A 3OHXC 3OW7A 4UDUC 1DZ1A 3C3LA 5IOCA 3PIO3 2KQ3A 1HPCA 3UI2A 3T13A 2TMPA 1OXXK 3BDCA 3OWFA 4C2MB 4HSPA 3CHBD 3O13A 1D1KA 4R8IA 4IUQA 4BA1I 3CKIB 3D3RA 3TBIB 5M9OA 2XSCA 4G4KA 3D4RA 2BE5C 1I4QA 3K5NA 4C1NK 5EBDA 4DNTB 1CTMA 3T53B 2DNCA 3QB3A 3DXJC 5ISRA 3S1NB 1C8CA 2OT2A 4A3JB 4K2KA 3MEHA 1ZYRD 2B2UA 2BDNA 3OSOA 3PIP3 3DHQA 2DNEA 2EYLA 4RGOS 3CRLC 1VCIA 4RAUC 2F0GA 3NTKA 2PNRC 2K32A 1LT6D 3M4OB 1I3QB 2X6LA 2DY7A 1OXUA 3FEWX 2AWNA 2B8GA 2A6HD 3FKIB 3WOFA 3OMGA 4K5VA 1SE2A 3FMCA 4LMQD 2B2VC 3ND9A 3V96A 3KLSA 4HTHA 4PMWA 1HA5A 2RDHA 2HCIA 5COYA 1TS2A 2IJ0A 3SHLA 2AQ1B 1KABA 3DEPA 4NKLA 3MXUA 1JICA 1STNA 5DM73 1GUSA 2Z1CA 3NPPA 5CORA 3VR2A 5JVH3 1SFOB 4DN4M 4NDXA 3A55A 2AQ3B 3HRZC 3SXHA 3SR1A 5KIXA 1CQVA 5AFWA 1EQVA 1B9MA 1SNQA 3J7AV 1PRTF 4KN4C 1GUOA 1SAPA 3MHBA 4XDXA 5I9OA 3NE5B 1I6VC 3BVMA 1IYVA 5I2YA 2JYOA 1ZKOA 1Y1VB 1HHVA 4PQXA 2L0CA 1LTBD 5FLXL 4CKCA 3BYTB 2AUKA 1O78A 1PFMA 4K2LA 5I6YA 2J4XA 3EA6A 1O7YA 1TIID 3IAYA 3MA2B 4KY7A 2IWHA 3VYRA 2JE6I 2PYKA 4WORA 5EGTA 1FNUA 3L7ZC 5KYLA 2FMMA 4ZKBB 2R92B 1NUCA 1STEA 1CA6A 1STBA 3I4MB 2F0NA 3HOWB 4KJNA 4M1UB 4MIUA 1CHPD 1O7ZA 1TWHB 3MFGA 1LACA 2F0MA 2F0SA 4BBSB 4LAAA 2F0TA 3GTPB 2KHSA 4ZRZA 2RBMA 2EXZA 1TS4A 2OEOA 3R2TA 4KKSA 1X32A 3R8BA 3IKJA 3HP3A 3HZXA 3S17B 1E2WA 3S14B 1ILPA 1DM0B 5JJZA 5ELCA 3MAQA 5C3XA 1PZID 1A2TA 1U4MA 4O1NA 3NSWA 4N9TA 2BOSA 1PFNA 1GHJA 2PCFB 1TWAB 5CV8A 2F0LA 2QCPX 5CBAE 1D6EC 1OXSC 3GTMB 1DCZA 2SNSA 2XRQD 2E2IB 4C3HB 4RGMA 5TSSA 1FNVA 1RDPD 2PW7A 1HTPA 3KLRA 1TT2A 2F0VA 4FNFA 3EJIA 2K33A 3D4DA 2RQXA 2B2TC 4EQOA 1LTTD 2RA4A 2BDOA 5CC4A 4K6LA 1F2YA 2JP1A 5C3WA 3FRPB 4KKTA 3IFTA 1K83B 2R7ZB 3I72A 4KD3A 1RTNA 1SMYD 5M5WB 4LK1C 4IUNA 4KV6A 4RHRA 1EY7A 1HRJA 1B53A 2Z8LA 5C5MA 5CR3A 4OL7A 3H0GB 1PDQA 3NXWA 5D65A 4ZK9B 2HDMA 2RSOA 3PO3B 3M7NA 2Y0SB 4QF4A 1LTSD 4F8MA 1VF5C 2Z4IA 4XQNA 2PO4A 1PTOF 1B50A 2BE5D 3OMCA 1DOLA 1Z7TA 1BCPC 4G57A 1O7LA 3GTOB 4RGTA 1UNSA 5G3LF 4V0BA 1UUPA 4ILWA 4RA8A 3L9AX 2A74C 1RD9D 1KDCA 4GZYC 4XYOA 2LKVA 1VF7A 1EZ6A 1DXMA 4TQUS 5M3FB 3SEBA 1IL8A 4O42A 1X3PA 3PUXA 3GTGB 2ID0A 2SDFA 4JK1C 2L4NA 1WCMB 4A3BB 3P1HA 1SNMA 1JWUD 1BR9A 3NHHA 2B2TA 1AZPA 1T5EA 5CYUA 2F3WA 5FK9C 5IGDA 4KI0A 1IW7D 5JEAG 3H6MA 1SNDA 3J7YW 3DWPA 1V1PB 1HQRD 4ZYSA 3TZUA 4A3DB 3MXPA 4ME5A 1UAPA 1EWHA 4ULLA 3FDTA 1PYWD 1QWYA 4NP5A 5C0XH 1DD2A 2J7ZA 1B4OA 4KJOA 4DK0A 1Q90A 1CZWA 4QCLA 1U4PA 2JXMB 1JWSD 4Z9CB 5C0XJ 4DF7A 3PUYA 3NWTA 3TZDA 1F9RA 2PZWA 5DNFA 1SYFA 1H9JA 3I73A 5FLXE 1A6XA 2O2LD 4HN7A 2FINB 5J39A 2N88A 2A5HA 4BWGB 2EJFC 4A93B 3D4WA 3GV3A 3LWUA 1KLUD 3AB9A 3T51B 1LT3D 5D3DA 1EQTA 1A2UA 3CU7A 2E74C 1Q8IA 1CFMA 2K05A 1WTQA 1I50B 3GTKB 5BN5A 3SK8A 2ZT9C 1V8QA 2NTSA 1ENFA 1TR5A 3P20A 5D14A 1J8IA 3BYYB 4NMZA 2EY2A 4A3KB 1CZGA 5JOBA 2WINB 3KLSX 4ZKCB 1LO5D 5HURA 1FGBD 2EDGA 3Q0AA 4ZUJA 2F0QA 3SE0A 1D5MC 4FF2A 1AEXA 1L0YB 2DN8A 3H09A 5EBCA 5J1ZA 5C0XI 1S5DD 5EPJA 4ZLTF 1G2SA 4OGQC 1KDBA 4AYBB 1RCVD 3C2PA 2WV6D 4CJ0B 2EJGC 5EKKA 3N52A 3GTLB 4ZAIA 1LLRD 2B2WC 3ND8A 2F0IA 4TRDA 3HOXB 5FO8B 1ONLA 1EIHA 1RF2D 4FXGC 2ZXPA 5I4DA 5KNDA 2K5WA 4DU9A 1ILQA 5C0XG 1QNKA 3MVVA 1EWCA 4IFDH 1CQFA 1FNWA 1GUWA 3TP6A 1MD2D 4QUCA 2F0FA 1NAPA 2JA6B 5LL6X 3NQIA 4K8IA 2M00A 4IFDJ 3HOYB 2L12A 3TN2A 3S2HB 3H91A 1E2ZA 4FYDA 4G7ZC 4I7ZC 1WTXA 3S1MB 3DWAA 4X3SA 4H7BA 3A7AB 5E4XA 4CHTB 1BCPB 3S15B 2MHVA 1BCPF 3HEJA 3SK5A 3VA5A 4BS9A 1Z6HA 2ZXRA 2ZXOA 3AMUA 2K01A 4BA2I 1Q1EA 4QB4A 3FPPA 5KEEA 1JB3A 2G9HD 2EYHA 2KJXA 2AUJD 3BZDB 2F0PA 4FF4A 3SDZA 3LNNA 1PTOC 5NUCA 3MTSA 2K1BA 1W6KA 4X3KA 1MBYA 4XIGS 3CRKC 3QO2A 3KBXA 3QWNA 2A69D 1PZKD 1S5ED 4IFDI 5JAVA 4E6IA 4IN3A 2HQEA 3DWQA 4KK7A 1D1IA 5DEHA 2EYMA 3DEOA 4HAEA 2K7VA 2R3ZA 4C3JG 2B2WA 5KYIA 2O5IC 2PZUA 1PRTB 1F77A 2IX3A 1WTVA 3QOLA 3DUZA 4XXEA 1SNPA 1XWEA 1WTPA 4HMJA 2LFNA 1YNJC 1SYCA 4C3HG 5HGTA 1SE3A 3TP5A 2CHBD 2IW3A 4IFDG 2ICEC 5EJWA 3V2TA 5I2XA 4A3FB 5CMDA 4H0LC 1PLFA 3X3NA 1Y1WB 1BXTA 3VR6A 1KTKA 4BBRB 3VR3A 4IUPA 1Z47A 1F9PA 1OO9B 5C4ZA 3Q6SA 2FFKB 2EJMA 4KTAA 2K5QA 4FP5D 5KGUA 5BN3A 2NUCA 1S5FD 2F1MA 1BO0A 2RDFA 1RJTA 3J80L 3NBIA 1SJHD 2IL8A 1F2ZA 1LT4D 2NWGA 3A56A 4LJZC 4Y7NB 4ODGA 4X3UA 3JAML 2ICIA 3EVQA 2A68D 1K8OA 4G7OC 4HEDA 1PRTD 1HTLD 1JE4A 3C1EA 1TKWB 3OIPA 2M9VA 5LHY1 4H44C 4WRDA 4F7XA 3PO2B 2EYFA 1LABA 1M4VA 1CM9A 4PMCA 5CV5A 2KCCA 2MJ8A 3HOVB 2OF1A 2SNMA 1NR4A 1YNND 2NVYB 4H13C 3RUZA 4J8QA 1ESFA 2Q8TA 1TS3A 2EOTA 1EU3A 3PMFA 3URYA 4KY6A 5KNCA 4ZQ3A 1BDOA 4XT3B 2KOLA 2JEBI 2QF7A 4QIWB 2EY1A 3TP8A 3HGBA 1JOKA 1R4PB 1U9RA 4C3JB 4RH6A 3KUPA 5IGCA 1VMCA 1J9OA 4PMBA 1ET9A 2XWJB 4RGNA 1NR2A 1D5ZC 3SK4A 5D3IB 2BA1A 2NVQB 3BDOA 1I4RA 2L55A 4XYQA 1Y8NB 1W6JA 2D5DA 3E6ZX 5I6WA 2KEEA 1HUMA 2WB1B 2L9HA 4MHEA 4KY5A 1R4QB 5JEAH 4CJ1B 1GJXA 2I46A 2F0OA 2WAQB 3Q24A 4RKLA 3BVGA 5JEAJ 1M8AA 1JOQA 4XTCS 1A3VA 2OXPA 2MP1A 2NBFA 2JSOA 1QE6A 2O4XA 3SVMA 2F0DA 5K5PA 3S1QB 3HS0C 2R61A 1WTOA 2B2YC 5DM63 2BCOA 3VYUA 3VYSA 1B9NA 1B3AA 3TDQA 2TSSA 1A15A 3GD7A 1PTOB 5IGFA 3J81L 1HXYD 3HG9A 2WACA 1I4XA 1EIGA 1U4LA 3C46A 2K6AA 1E2VA 2NZ1D 1B1ZA 4V190 1II3A 1SYDA 4C56C 3E5SA 5JVG3 1SSOA 3H94A 2WKCA 2XRSD 1GUGA 2F0JA 5IT9L 3GP7A 4U68A 3ERQA 2EY5A 2GA4B 1HFNA 2J0TD 1QB5D 1BNZA 1WTRA 1V43A 2VUMB 2HDLA 4S3SA 4MN3A 2NVXB 1S5CD 2VXWA 1CT1D 4C3IB 2PPBC 4EVOA 1ICWA 3HOZB 1STAA 1PTOD 2NN6G 2EE1A 1RHPA 3M85A 2KECA 1H9SA 1TVXA 5C6AA 5G3LD 1Q3LA 3BVZA 1EEID 2D2CC 2E76C 1O80A 1RKNA 5DAUA 4CBVA 1L0XB 3A54A 3I90A 2KCNA 1FR3A 2K03A 2WP8J 3V05A 4DNRB 5A2QE 3R3OA 3U9SA 4P2CB 4K5WA 2AWOA 2B2YA 2C5CA 4KHVA 1D5XC 4CJ2C 1IYUA 5FO7B 1STHA 1EY4A 2SEBD 2DY8A 1GHKA 3ZYYX 3EQLC 4DFAA 2B8FA 4C1NI 1HQMC 1YNJD 1AN8A 2JA8B 1XYIA 1AZQA 2H4OA 4KHZA 2N55A 3S2DB 3HOUB 3S9WA 5CBEE 2XNAC 2PW5A 1Q1BA 2CQAA 1D2BA 1F9QA 4R9WA 1AW7A 3J80E 3M4YA 1SBBB 4XQJA 4HCEA 3GTQB 2D9UA 4N9PA 3JAME 1XX8A 1F2MA 5T1IA 1BBXC 2L11A 1VDZA 2FHTA 5FO9B 1H9MA 4RWSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ICI A;  3OWE B;  1I4Q A;  3R2T A;  1XXG A;  1EU4 A;  1LTS D;  1PRT D;  3R8B A;  1HTL D;  1LLR D;  1PTO D;  1PZK D;  1G8Z D;  1LT5 D;  5ELF A;  1S5E D;  1M4V A;  5ELC A;  1PRT F;  1RF2 D;  1PTO F;  1PTO H;  1JWS D;  1TY2 A;  4Z9C B;  2AQ2 B;  1PZI D;  1CHQ D;  3DWQ A;  2R61 A;  5I4D A;  1CK1 A;  4O1N A;  1ESF A;  1BCP C;  3W2D A;  1PZJ D;  1TY0 A;  3BVZ A;  1TS3 A;  3BVM A;  1EU3 A;  2NTT A;  1LTG D;  1EEI D;  1SXT A;  1EWC A;  2O2L D;  4RGT A;  1UNS A;  4RGO S;  3URY A;  1FNW A;  5ELB A;  1EFI D;  1TS5 A;  1UUP A;  1MD2 D;  2TSS A;  1D6E C;  1JCK B;  2IPK D;  4BWG B;  1L0X B;  1F77 A;  1PRT B;  1PTO B;  1LTB D;  1DJR D;  1T5X D;  1HXY D;  1KLU D;  4L6T B;  3V05 A;  3BYT B;  5ELE A;  1LTR D;  1RD9 D;  2XRQ D;  1JQY D;  1FD7 D;  1LT6 D;  1I4X A;  1LT3 D;  5D3D A;  1V1P A;  1SE3 A;  4RGM A;  1D5X C;  2CHB D;  5TSS A;  1FNV A;  2J4X A;  1KLG D;  1EEF D;  2SEB D;  1RDP D;  3EA6 A;  1B1Z A;  1SJE D;  4L63 B;  1S5B D;  2NTS A;  1JR0 D;  5FKA C;  1SEB D;  1XTC D;  1ENF A;  4C56 C;  1V1O A;  1SE2 A;  4RH6 A;  1I4H A;  4DXG A;  3DWA A;  1AN8 A;  4RCO A;  3SEB A;  1LTT D;  1ET9 A;  1I4G A;  4RGN A;  2XRS D;  3BYY B;  1BXT A;  1BCP D;  1BCP B;  1HA5 A;  1JWM D;  2RDG A;  1GOZ A;  5ELD A;  1FNU A;  4K6L A;  1DYQ A;  2RDH A;  1D5Z C;  3EFX D;  1KTK A;  1PRT C;  1TS2 A;  2IJ0 A;  5D3I B;  4UDU C;  2XNA C;  1BCP F;  1JWU D;  2AQ1 B;  1B44 D;  1I4R A;  3KLS X;  3GP7 A;  1LO5 D;  1STE A;  1FGB D;  2XN9 C;  1AW7 A;  1ET6 A;  3R2I A;  4RHR A;  4DXF A;  1CHP D;  1SBB B;  2Z8L A;  4RFB A;  5FK9 C;  1D5M C;  2G9H D;  3MFG A;  1L0Y B;  4RHS A;  2QEJ C;  1S5F D;  1LTA D;  1QIL A;  3CHB D;  3O13 A;  3DWP A;  1S5D D;  1V1P B;  3BZD B;  1HQR D;  2QIL A;  4ZYS A;  1I4P A;  1SJH D;  1SE4 A;  3MC0 B;  1PTO C;  1S5C D;  1LTI D;  1LT4 D;  4OHJ A;  3TSS A;  2AQ3 B;  1CT1 D;  1PYW D;  1RCV D;  3BVG A;  2WV6 D;  4TSS A;  1TS4 A;  1CQV A; 
#chains in the Genus database with same CATH topology
 1GXD C;  2IT1 A;  4QMG A;  5IGE A;  1A3U A;  4U67 3;  1IKL A;  1G8Z D;  4ZUI A;  4DV2 L;  1N8R C;  4YIJ A;  4HIO A;  4BY7 G;  2D62 A;  1KAA A;  3MXN A;  1B70 B;  2AQ2 B;  4R4C A;  3BDL A;  4OO1 H;  3VR4 A;  1KDA A;  5K36 H;  3CMA A;  4BY1 B;  1X56 A;  4FF3 A;  1NMF A;  1TY0 A;  4CGY B;  3Q8D A;  4CKE A;  2XVS A;  3G6J B;  3M7G A;  2QKI C;  2CW0 C;  1GUT A;  5ELB A;  2OTL A;  5M5Y B;  2KA7 A;  4JI5 Q;  2DGY A;  2MGS A;  4C3J H;  2KCT A;  4P71 A;  1EY9 A;  3RN5 A;  1SMY C;  4J6H A;  4JI8 L;  4IUT A;  1LTR D;  2XWB B;  5IOD A;  1GM5 A;  1H9S B;  3CCM A;  1HA6 A;  1I6H B;  1HUN A;  2HCC A;  3U4Z A;  4JI1 Q;  3CQZ B;  2X69 A;  2F3V A;  4X64 Q;  2Z0S A;  2I07 B;  5J22 A;  3D6C A;  3TP7 A;  4FVM A;  2NVQ H;  1F2L A;  1K8M A;  5EKL A;  3MFY A;  1KHI A;  1I4H A;  3A0J A;  1SYE A;  1G6P A;  4P72 A;  2EYP A;  2KED A;  3IL8 A;  3VDY A;  4DV1 Q;  1QCB D;  2F0U A;  1KRS A;  3F2U A;  2CQO A;  2A8V A;  4NW2 A;  1B44 D;  3HFZ B;  2MUY A;  3K57 A;  1WD0 A;  3K6O A;  1Q7Y C;  4LFC Q;  4FXD A;  1BBU A;  2Z9H A;  1WVL A;  3H3V C;  2JA9 A;  4DK1 A;  2I5H A;  4RCN A;  4JYA Q;  3K5M A;  1I94 Q;  5IP9 G;  4AH6 A;  3K8A A;  3U50 C;  3OTO L;  1HFG A;  2O5J C;  4B9W A;  2QEJ C;  1BOS A;  3CW2 C;  4LUZ A;  5CV9 A;  1ZEQ X;  1LTA D;  5GRO A;  4NXN Q;  2UXC Q;  1ENC A;  2F3I A;  2K52 A;  3DMU A;  1ROD A;  4WFN 3;  1KXL A;  1SE4 A;  2LS0 1;  1OTC A;  1OXT A;  1EYC A;  1YIJ A;  4I65 A;  3FVQ A;  4GNX A;  3S1Q H;  2VS1 A;  4OO1 I;  4TSS A;  1TU2 B;  4O2D A;  4DR6 L;  4LF7 L;  3WOE A;  3STB D;  5IY0 A;  4A3M B;  4LFA L;  4H02 A;  3E9I A;  4KD4 A;  4IUR A;  3C1F A;  3NWS A;  1KC8 C;  3RZO B;  5M3M B;  2RVL A;  5AJ3 L;  1N36 Q;  4IQZ A;  2A73 B;  1VQN A;  2WFW A;  3QOJ A;  1KNE A;  1KD1 C;  2JA5 B;  1CUK A;  1PTO H;  2K04 A;  1R9T B;  3OIQ A;  3N6R A;  1CHQ D;  3P7J A;  3HOV G;  3BJU A;  4B9X A;  1J5E Q;  5CV4 A;  4AIM A;  4AQY Q;  5E4W C;  1PZJ D;  2NB0 A;  3J81 E;  3I55 A;  1B3Q A;  1QZH A;  3MZ5 A;  4YWL A;  2PMZ B;  3RD4 A;  1E3P A;  3VR5 A;  1EY6 A;  1CI3 M;  4F87 A;  4KMU C;  4K6D A;  3OOC A;  4BY7 B;  5HGQ A;  4OO1 G;  4IZ8 A;  5K36 G;  1C0A A;  1HNW Q;  4HSV A;  1IW7 C;  4J1M A;  1EL0 A;  1B2T A;  4L63 B;  5C4H A;  1XTC D;  1IZ6 A;  1EQR A;  3KJO A;  1SNO A;  1EOT A;  2RCF A;  1EZ8 A;  2PQE A;  1MSG A;  3GV6 A;  4ABN A;  1EWI A;  5IT9 E;  1BCP D;  4FO2 A;  1JWM D;  3NK9 A;  5JJK A;  2EY6 A;  3H15 A;  2VUM H;  1DYQ A;  1E22 A;  1BQQ T;  2RSN A;  1IHZ A;  2YTY A;  1PFS A;  2N49 A;  1XTD A;  4GS3 A;  5DLQ E;  3D6W A;  2NVX H;  1YJN A;  4A76 A;  2CWP A;  3MEF A;  5A2Q L;  3A5U A;  2PQA A;  1PA6 A;  1IBM Q;  2XN9 C;  5IYD H;  1V1Q A;  4C3I H;  2E5L L;  2EPB A;  3UE1 A;  1RTO A;  2KEN A;  3HOZ H;  1CA5 A;  1IBL L;  2B29 A;  1BF4 A;  3KLW A;  4B08 A;  3MC0 B;  4OHJ A;  5J3B A;  2V4D A;  2WAQ G;  4HR7 B;  3TSS A;  4Q0F A;  1S4Z A;  2OTJ A;  1H9K A;  2M2L A;  2WKD A;  5M5X B;  3ICE A;  2FJ2 A;  3G6E A;  1ICF B;  4RKB A;  1Z9F A;  2AHO B;  3T16 A;  3W1B A;  1Y8P B;  2YU9 B;  3ERO A;  5KNB A;  5KRU A;  2JA7 B;  3KFU A;  3TRZ A;  2R6G A;  2L1B A;  4Q5V A;  1LM0 A;  4N8F A;  4B3R Q;  1EIF A;  2OCE A;  5E3F A;  2NZO A;  1HR0 W;  4JCV E;  4XQQ A;  2YV5 A;  2A6E C;  3PSI A;  5CGK A;  2UU9 Q;  2NTT A;  1LTG D;  4K14 A;  4K8J A;  4FXK C;  2K14 A;  1PXU A;  1J6Q A;  1JCK B;  2ZTE A;  3W3A A;  4DV5 L;  1PH2 A;  2HQL A;  3KF8 A;  4B3T L;  2JA8 H;  2NVT B;  2NZH A;  1JQY D;  3K59 A;  1FD7 D;  3AFQ A;  3S2D H;  3HOU H;  2K50 A;  4JW0 A;  2MFI A;  2PZT A;  2R7D A;  5E7N A;  5BR8 Q;  5EQ0 A;  4DV6 L;  2B2V A;  4JBK A;  2F0H A;  3ZJY C;  3NTH A;  5FKA C;  2E2J B;  4DR5 Q;  1JC7 A;  4DR4 Q;  2ZJP A;  1IKM A;  1PMR A;  2EVB A;  3BG3 A;  3S16 B;  4GKK L;  2E2D C;  2EYO A;  2QDB A;  1MSH A;  3GTQ H;  1GOZ A;  3QR8 A;  4LF9 Q;  3SK6 A;  4MNO A;  1AFP A;  1NSN S;  3GQB A;  3I70 A;  2NYZ D;  5EPL A;  2FMC A;  1Q81 C;  4LFB Q;  3PUW A;  1C48 A;  1DOM A;  5BN4 A;  1DOK A;  2IY5 B;  1SNC A;  3QG1 A;  2G9D A;  5C5L A;  4DGZ A;  5A35 A;  3M4Q A;  4HCS A;  4KKU A;  2ZM6 L;  2JJQ A;  3K58 A;  2VUM G;  3GTJ B;  2YYZ A;  3CCR A;  1QIL A;  2FXQ A;  5CV7 A;  3I3C A;  2B63 G;  1GUN A;  3G7L A;  2JEA I;  3MWY W;  4DUZ L;  1LTI D;  3U9O A;  4K5X A;  4DUY L;  3FPU B;  4GN5 A;  3Q22 A;  5IYD G;  2BA0 A;  5EPK A;  4C3I G;  4BY1 H;  1MGS A;  4YY3 Q;  3T56 B;  2CWA A;  1JOR A;  3HOZ G;  3IFD A;  4HMI A;  5IGB A;  1MIU A;  4DAM A;  2F4I A;  4GKJ L;  3LGJ A;  2R7F A;  1ZYR C;  5ELF A;  3J80 i;  5M5Y H;  1EY0 A;  5GAG C;  4JI2 Q;  4POF A;  1STY A;  3NQT A;  3A8J E;  1PH5 A;  4M8A A;  1H9R A;  1C4Q A;  4LF4 L;  2NN6 H;  2X6G A;  2C35 B;  4PV1 C;  3GO5 A;  4A3E B;  1XMQ Q;  3NBH A;  1I6H H;  5JPM C;  3JAM i;  3W2D A;  3I4N G;  3CQZ H;  3X3M A;  1XMO Q;  1E24 A;  4OIK A;  1HR0 Q;  4OEM B;  2QDL A;  3NTI A;  5CV6 A;  3S1R B;  1L1O A;  4IUU A;  5EKI A;  3TQY A;  2ZJR A;  2IX0 A;  2A6H C;  1OXV A;  2Z4H A;  1QG7 A;  3PUV A;  5LL6 S;  2N3S A;  1MI2 A;  3TME A;  2CW0 D;  1V1P A;  5JJI A;  1A3T A;  4HJ5 A;  1KLG D;  1SR3 A;  3T4A C;  1G2T A;  1TWG B;  1QNU A;  2UUB Q;  2LMC B;  1V1O A;  1AP0 A;  1G51 A;  2ZJQ A;  4DK6 C;  3QJY A;  2WII B;  2JA8 G;  1Y8O B;  3PUZ A;  2G5D A;  3WWV A;  1JJG A;  2I5M X;  3KK7 A;  4DV4 L;  3HOU G;  2SOB A;  3R93 A;  4OON A;  5JJL A;  2EYJ A;  2Q2T A;  5HY6 A;  1N34 L;  2F0W A;  3EFX D;  3I2Z A;  1CKM A;  1TWF B;  2A69 C;  2C9O A;  4OWW B;  1TQO A;  1QZG A;  3I91 A;  1NMG A;  1G6Z A;  4L8J A;  1CSQ A;  2KUM A;  1X3Q A;  3TRE A;  1ET6 A;  4LW1 A;  4KN7 C;  1UEA B;  2YTV A;  4DXF A;  3VA7 A;  1IBK L;  4RFB A;  3A8K E;  1U4R A;  1UE7 A;  5FOB B;  1PH1 A;  1NJI C;  4RHS A;  4RMF A;  4A3M H;  5EAY A;  1KQS A;  4JI3 Q;  3RZO H;  2QIL A;  5M3M H;  4LWC A;  1FYC A;  4R8N A;  3E0E A;  1KIX A;  2VB2 X;  4IAL A;  3MXG A;  1HZC A;  3I4L A;  1YJW A;  2JA5 H;  4OX9 Q;  1WTW A;  3LWE A;  5ELO A;  1R9T H;  1SYG A;  4DNI A;  2NN6 I;  2MPM A;  3HKZ B;  2L5T A;  4BXX G;  3PQI A;  1PH9 A;  1XXG A;  1EU4 A;  5T1G A;  4IUV A;  3RLN A;  4JBW A;  4DV0 Q;  4DR2 L;  2L15 A;  3AU7 A;  1WD1 A;  4G7H C;  1VMP A;  4PZ6 A;  2ENB A;  3ONA B;  1GVP A;  1UE6 A;  1TY2 A;  4QUF A;  2B63 B;  3DM3 A;  3P75 A;  2IX1 A;  4BY7 H;  5IIF A;  1E7Z A;  1UE5 A;  1QOH A;  1CK1 A;  3NP8 A;  4CKB A;  3OYY A;  1LV9 A;  3K7A B;  1SXT A;  5JPN C;  3BS1 A;  3BU2 A;  1EFI D;  2F0E A;  3RR5 A;  3VYT A;  1T5X D;  4WJW A;  1TWC B;  2EZV A;  4TKO B;  3CC7 A;  1ESR A;  1NTG A;  1NCV A;  5E1F A;  3D31 A;  3D8G A;  3NBH B;  3RZD B;  2ZTC A;  1XNR Q;  2Q2U A;  1HCZ A;  1YZ6 A;  2A19 A;  2E75 C;  1EYA A;  2QEX A;  3A7L A;  3I4N B;  2UXD Q;  5C4X B;  1SJE D;  3LX0 A;  2RKS A;  1SEB D;  3I8Z A;  4DAP A;  5IGG A;  4PNY A;  2CVR A;  1EOV A;  3J81 i;  4DXG A;  1WFQ A;  1KL9 A;  1KNA A;  3A8I E;  4RCO A;  3OPO A;  2HD3 A;  5F2D A;  3PV0 A;  5I9P A;  1G91 A;  2ATW A;  1HJP A;  1FJG Q;  1ASY A;  4DAY A;  2HIX A;  1FGU A;  2A68 C;  4XT1 B;  2HIV A;  2UXB Q;  1PRT C;  3F8T A;  1SYB A;  2MQH A;  3T1Y Q;  2KVM A;  4A3G B;  3QIA A;  1UE1 A;  4B3S L;  3K5L A;  4DA2 A;  2H1E A;  4ID6 A;  3NEM A;  1DON A;  3R2I A;  1BUV T;  4NPS A;  4EQP A;  1YNN C;  5M5X H;  1ENA A;  4FF1 A;  2Y0S E;  3E9H A;  2K5D A;  2YU9 H;  3F2D A;  1I4P A;  1JJC B;  2JA7 H;  1CKO A;  1Q12 A;  3DM1 A;  5IYC G;  2UUA Q;  3KOJ A;  4A3J G;  1WYD A;  1MJC A;  4R4Q A;  3WDN A;  4YWK A;  2Q8I B;  3J7A F;  1WTH A;  3OWE B;  2B2U C;  3KBG A;  4OIJ A;  3KF6 A;  4A3M G;  3NUC A;  3RLF A;  2CH4 A;  3M3Y B;  1VQC A;  1LT5 D;  4YHH L;  2Q8R E;  5M3M G;  1VQE A;  1XPO A;  1JOO A;  3L3O C;  1F9S A;  1K9M C;  2JA5 G;  4F88 A;  1EYD A;  1C9O A;  2F0K A;  2NVT H;  2F03 A;  3ULL A;  2K28 A;  4DAV A;  1STG A;  4QL5 A;  3E0J A;  3RMH A;  3RN2 A;  1ML0 D;  4I7A A;  1QJO A;  4EGV A;  1SRU A;  1TS5 A;  3K5O A;  2IPK D;  2E2J H;  4UPA A;  2XIW A;  1DJR D;  2A6E D;  5C44 B;  4L6T B;  1PFB A;  5ELE A;  3S16 H;  1E0B A;  4DV7 L;  4UAI A;  4X3T A;  5LMN W;  1ZXT A;  4OWT B;  5C4J B;  1JE5 A;  1G29 1;  3CME A;  2VNU D;  2E2H B;  3CC4 A;  3K0Y A;  2B39 A;  1EY8 A;  5C3E B;  1EEF D;  4JI0 L;  1S5B D;  2VB3 X;  3Q23 A;  1JR0 D;  2CKZ B;  2R93 B;  1EY5 A;  2ZTD A;  4A3I B;  2HUG A;  4YCV A;  2E8G A;  1I4G A;  2XTI A;  2RDG A;  3ITP A;  5ELD A;  3CP0 A;  1Y69 U;  1SDF A;  4DR1 Q;  4EQN A;  2LY7 A;  3GTJ H;  3OHX C;  3OW7 A;  1D8L A;  1XNQ L;  4UDU C;  1DZ1 A;  3C3L A;  1L2F A;  5IOC A;  3PIO 3;  2KQ3 A;  2K4K A;  1HPC A;  3UI2 A;  3T13 A;  1WI5 A;  4OEL B;  2F52 A;  2TMP A;  1OXX K;  3BDC A;  2CH4 W;  3OWF A;  4JI4 L;  5FJ8 H;  3K80 C;  4C2M B;  1PH6 A;  3NEN A;  1YHA A;  4HSP A;  2MNA A;  3CHB D;  3O13 A;  1D1K A;  4R8I A;  1HNX Q;  4IUQ A;  3F2B A;  1C7Y A;  3T1H Q;  4KHP Q;  4BA1 I;  3CKI B;  3D3R A;  2Z6B A;  3TBI B;  5M9O A;  4A3E H;  2XSC A;  4G4K A;  3D4R A;  2UUC Q;  2BE5 C;  1I4Q A;  3K5N A;  4C1N K;  3L2P A;  3D0F A;  2HT1 A;  1FL0 A;  5EBD A;  4LF6 Q;  4DNT B;  1CTM A;  3S1R H;  2HHH L;  2JA7 G;  3T53 B;  3K7U C;  2DNC A;  3QB3 A;  3G71 A;  3DXJ C;  1YVC A;  5ISR A;  1A63 A;  3S1N B;  1C8C A;  2OT2 A;  3UDF A;  1K0S A;  4A3J B;  4K2K A;  3MEH A;  1YI2 A;  1ZYR D;  2B2U A;  3CF5 A;  2BDN A;  3OSO A;  3PIP 3;  3DHQ A;  2DNE A;  3KF6 B;  2EYL A;  1VQG A;  2N78 A;  4RGO S;  1TWG H;  4YCU A;  3CRL C;  1VCI A;  4RAU C;  1VQL A;  1LYL A;  3NEL A;  2F0G A;  3NTK A;  4IOA A;  2PNR C;  2K32 A;  1VS0 A;  1LT6 D;  3M4O B;  1I3Q B;  2X6L A;  2DY7 A;  1OXU A;  3FEW X;  3BZC A;  2AWN A;  2B8G A;  5LMN Q;  2R92 G;  3FKI B;  2A6H D;  3WOF A;  1TWF H;  4UP8 A;  3J7A 5;  4A3C H;  3OMG A;  3M9B A;  4K5V A;  1XJV A;  4LF5 L;  4LF8 Q;  3I4M G;  4R4T A;  3CD6 A;  1SE2 A;  2VQE Q;  3FMC A;  4LMQ D;  2B2V C;  3ND9 A;  3V96 A;  2JN4 A;  3KLS A;  4HTH A;  4PMW A;  1HA5 A;  3MXN B;  1U5K A;  2RDH A;  2HCI A;  4JI7 L;  5COY A;  1TS2 A;  2IJ0 A;  4HJ9 A;  3SHL A;  2AQ1 B;  1KAB A;  1JB7 A;  3DEP A;  4NKL A;  3MXU A;  2VL6 A;  1JIC A;  3KYH C;  1STN A;  3U58 A;  5DM7 3;  4DR3 Q;  1SLJ A;  4AYB E;  1GUS A;  2Z1C A;  2DUD A;  3NPP A;  4UP7 A;  5COR A;  1YHQ A;  3VR2 A;  3EBE A;  4B3M Q;  3L0O A;  1A8V A;  1NE3 A;  5JVH 3;  2B63 H;  1SFO B;  1WJJ A;  4DN4 M;  4NDX A;  3A55 A;  3BZK A;  2AQ3 B;  3HRZ C;  3SXH A;  1K3R A;  3SR1 A;  5KIX A;  5FJ8 G;  1CQV A;  3K7A H;  3RLO A;  5AFW A;  3S24 A;  1EQV A;  1B9M A;  4X66 L;  3UDX A;  1SNQ A;  3J7A V;  1PRT F;  1DGS A;  4KN4 C;  1GUO A;  1SAP A;  1TWC H;  3MHB A;  5LMU L;  2ALY B;  4XDX A;  5I9O A;  3NE5 B;  4A3E G;  1I6V C;  3BVM A;  3IRB A;  3PIP A;  1IYV A;  5I2Y A;  2A1A A;  2JYO A;  1ZKO A;  1Y1V B;  3I4N H;  1HHV A;  5C4X H;  2N8N A;  4PQX A;  1EUJ A;  2L0C A;  1LTB D;  5FLX L;  4CKC A;  3A5Z B;  3BYT B;  2AUK A;  1L1O C;  1O78 A;  1PFM A;  5FLX c;  4K2L A;  1VQ8 A;  4GNX B;  2R7Z G;  5I6Y A;  1N33 Q;  1B8A A;  2J4X A;  3UDG A;  3EA6 A;  1O7Y A;  4A3G H;  4JV5 L;  1TII D;  4LNQ A;  4IPH A;  4DR7 Q;  3IAY A;  3MA2 B;  4DV3 Q;  3I4O A;  4KY7 A;  2VQF L;  1MHW C;  4UY8 C;  2IWH A;  3VYR A;  2JE6 I;  2K5H A;  2PYK A;  4WOR A;  5EGT A;  1FNU A;  4P75 A;  4K0K Q;  4X62 L;  4POG A;  2BH2 A;  1BKB A;  3L7Z C;  5KYL A;  4A3C G;  2FMM A;  1MJE A;  4ZKB B;  2R92 B;  1NUC A;  1STE A;  1HNZ L;  3PO3 G;  1N32 L;  1CA6 A;  4DV2 Q;  1STB A;  3I4M B;  2F0N A;  3EN2 A;  3HOW B;  4KJN A;  4M1U B;  4MIU A;  1CHP D;  1PVO A;  1O7Z A;  1TWH B;  3MFG A;  4L5T A;  1LAC A;  2F0M A;  3M3Y H;  2F0S A;  4P74 A;  4LAA A;  4BBS B;  2F0T A;  3GTP B;  2KHS A;  4ZRZ A;  1PH4 A;  1JMC A;  1NBW A;  2QW7 A;  2RBM A;  4JI6 L;  2EXZ A;  3HKZ G;  3K0X A;  1TS4 A;  2OEO A;  4NXM L;  3R2T A;  4KKS A;  4JI8 Q;  1X32 A;  3R8B A;  3IKJ A;  3UDI A;  2I0Q A;  3HP3 A;  3HZX A;  4QQB X;  1IL2 A;  4BXX H;  1E2W A;  3S17 B;  3S14 B;  1ILP A;  1DM0 B;  3B6Y A;  5JJZ A;  5ELC A;  3MAQ A;  5IWA L;  5C44 H;  3AFP A;  5C3X A;  1PZI D;  3ULP A;  1VQB A;  1A2T A;  2K5V A;  1K8A C;  1VQJ A;  1U4M A;  4X65 L;  4O1N A;  5C4J H;  3G48 A;  4LUV A;  3TS0 A;  3NSW A;  4N9T A;  2BOS A;  2E2H H;  2PQA B;  3PF5 A;  1PFN A;  1GHJ A;  5C3E H;  5FLM H;  2PCF B;  1TWA B;  5CV8 A;  1M1K C;  2F0L A;  2QCP X;  5CBA E;  1D6E C;  1OXS C;  2R93 H;  3GTM B;  1DCZ A;  2SNS A;  1VQ6 A;  4A3I H;  2XRQ D;  2E2I B;  1WCM G;  4A3B G;  4C3H B;  4RGM A;  5TSS A;  1FNV A;  1PYS B;  2GVA A;  1RDP D;  1QVG A;  2PW7 A;  1HTP A;  3OTO Q;  5C4X G;  3KLR A;  1TT2 A;  2F0V A;  4FNF A;  3EJI A;  2K33 A;  1P16 A;  3D4D A;  2RQX A;  2B2T C;  3A74 A;  4EQO A;  1LTT D;  1NNX A;  2RA4 A;  2BDO A;  5CC4 A;  1NY4 A;  2Z6K C;  1S3O A;  2AKW B;  4K6L A;  1F2Y A;  4C2M H;  4JI5 L;  3STB C;  2JP1 A;  1VQF A;  5C3W A;  3FRP B;  4KKT A;  3IFT A;  1K83 B;  4DR6 Q;  4LF7 Q;  4A3G G;  2R7Z B;  4LFA Q;  3I72 A;  1X3E A;  4KD3 A;  1RTN A;  2IHF A;  1SMY D;  2LXK A;  5M5W B;  2AMC B;  4JI1 L;  5AJ3 Q;  4LK1 C;  1GKH A;  4IUN A;  2JK8 A;  4KV6 A;  4RHR A;  4X64 L;  1EY7 A;  1HRJ A;  1B53 A;  2Z8L A;  1YNX A;  3KF8 B;  1X3G A;  4PG3 A;  2V1C C;  3W1G A;  2JQO A;  5C5M A;  5CR3 A;  1PH3 A;  4OL7 A;  3H0G B;  1YJ9 A;  4A3L G;  1PDQ A;  3NXW A;  5D65 A;  4ZK9 B;  1S40 A;  4DV1 L;  1PH8 A;  2HDM A;  3S1N H;  2PI2 E;  2RSO A;  5IYC H;  3PO3 B;  4A3J H;  4IJL A;  4LFC L;  3M7N A;  2Y0S B;  4QF4 A;  1LTS D;  4F8M A;  2P5Z X;  4JVZ A;  1VF5 C;  3G4S A;  1AH9 A;  2Z4I A;  4XQN A;  2PO4 A;  2VZA A;  4JYA L;  1I94 L;  1PTO F;  1B50 A;  2BE5 D;  3OMC A;  4NXN L;  1DOL A;  1Z7T A;  1HH2 P;  4QIW E;  4CDC C;  3M4O H;  1I3Q H;  1BCP C;  4G57 A;  1O7L A;  3GTO B;  3FKI H;  1UNS A;  4RGT A;  1PHJ A;  1XPR A;  5G3L F;  4V0B A;  1UUP A;  1H95 A;  4ILW A;  4RA8 A;  3L9A X;  5C44 G;  2A74 C;  1RD9 D;  4OXP A;  4A3K G;  1KDC A;  4GZY C;  1YEZ A;  4DK3 C;  1N36 L;  1JJ2 A;  4XYO A;  2D0O A;  2LKV A;  5C3E G;  5FLM G;  1BBW A;  2E5L Q;  1VF7 A;  1EZ6 A;  1DXM A;  2EIF A;  1I5F A;  4TQU S;  4QJF A;  5M3F B;  1J5E L;  4LUO A;  4P73 A;  4AQY L;  1IBL Q;  2R93 G;  2KHI A;  2F4V L;  2QGQ A;  3SEB A;  1IL8 A;  4O42 A;  3PUX A;  1X3P A;  3CCU A;  4A3I G;  3GTG B;  2ID0 A;  1PV4 A;  2SDF A;  2WB1 E;  4JK1 C;  2L4N A;  4A4I A;  1WCM B;  3UE0 A;  4A3B B;  3FP9 A;  3P1H A;  4JPB W;  1SNM A;  1JWU D;  1BR9 A;  4RG1 A;  4CDE C;  3NHH A;  1HNW L;  3ER0 A;  2B2T A;  2WAQ E;  1SFO H;  2Q2H A;  4JG2 A;  1VQA A;  1AZP A;  1T5E A;  1L1O B;  5CYU A;  2Z6K A;  2F3W A;  5FK9 C;  2GVB A;  1GO3 E;  5IGD A;  4KI0 A;  1IW7 D;  5JEA G;  3H6M A;  3HOX G;  3PF4 A;  1SND A;  2OQK A;  3J7Y W;  3DWP A;  1V1P B;  1X6O A;  1HQR D;  4ZYS A;  3TZU A;  4YWM A;  4A3D B;  3MXP A;  4ME5 A;  1UAP A;  1EWH A;  4MZ9 A;  4ULL A;  3FDT A;  1PYW D;  1W3S A;  3CCJ A;  4DV5 Q;  3U4V A;  1QWY A;  4B3T Q;  4NP5 A;  5C0X H;  1DD2 A;  2J7Z A;  1B4O A;  1EYG A;  2JA6 G;  1Y1V H;  4KJO A;  4DK0 A;  1JT8 A;  1IBM L;  1Q90 A;  1CZW A;  4QCL A;  1U4P A;  2JXM B;  4IPD A;  1JWS D;  4Z9C B;  5C0X J;  4DF7 A;  4DV6 Q;  3PUY A;  3NWT A;  3TZD A;  1F9R A;  2PZW A;  5DNF A;  1SYF A;  2YTX A;  1H9J A;  3I73 A;  5FLX E;  1YIT A;  4GKK Q;  4J15 A;  1A6X A;  2O2L D;  4HN7 A;  2FIN B;  5J39 A;  2N88 A;  2A5H A;  4BWG B;  2EJF C;  2VY3 A;  4A93 B;  1CKN A;  3D4W A;  2GN5 A;  3GV3 A;  3LWU A;  1KLU D;  4GLA C;  3AB9 A;  4QGU A;  3T51 B;  1V9P A;  2Q2I A;  1LT3 D;  2DJG C;  1EQT A;  5D3D A;  1A2U A;  3CU7 A;  2E74 C;  1Q8I A;  1KRT A;  1CFM A;  2K05 A;  1WTQ A;  1I50 B;  3FKI G;  4EQ5 A;  1RL2 A;  5BN5 A;  3GTK B;  4B3R L;  3SK8 A;  2ZM6 Q;  1UWV A;  1V8Q A;  2ZT9 C;  2VW9 A;  2NTS A;  1ENF A;  1TR5 A;  4R4I A;  2R92 H;  3P20 A;  3AYH B;  5D14 A;  2UU9 L;  2XGT A;  3I4M H;  3CXC A;  3HOW H;  4DUZ Q;  1HZA A;  1J8I A;  3BYY B;  1TWH H;  4NMZ A;  2EY2 A;  4DUY Q;  4A3K B;  1CZG A;  5JOB A;  1HZB A;  1W2B A;  3J81 j;  2WIN B;  3KLS X;  4ZKC B;  4BBS H;  1LO5 D;  2I5L X;  1S72 A;  4GKJ Q;  4OWX B;  3GTP H;  5HUR A;  1FGB D;  2EDG A;  3Q0A A;  4ZUJ A;  2F0Q A;  3SE0 A;  5BR8 L;  1D5M C;  1VQP A;  1AEX A;  4LF4 Q;  4FF2 A;  1L0Y B;  2DN8 A;  3H09 A;  5EBC A;  5J1Z A;  2IHE A;  4DR5 L;  4DR4 L;  5C0X I;  1S5D D;  1VQ7 A;  3S17 H;  3S14 H;  1YHB A;  2RF4 A;  1LTL A;  5EPJ A;  4ZLT F;  1G2S A;  5L37 A;  2EXD A;  4OGQ C;  1KDB A;  4LF9 L;  4AYB B;  1RCV D;  3C2P A;  2WV6 D;  4CJ0 B;  2EJG C;  5H1S E;  5EKK A;  3N52 A;  4LFB L;  3GTL B;  4ZAI A;  1LLR D;  3ERS X;  2B2W C;  3ULJ A;  1TWA H;  3ND8 A;  2F0I A;  4TRD A;  3HOX B;  5FO8 B;  5GQO A;  4DAY B;  1ONL A;  1EIH A;  1RF2 D;  4FXG C;  3HKS A;  4MTN A;  1WOC A;  2ZXP A;  3GTM H;  3KJP A;  4KLK A;  5I4D A;  4HJA A;  2E2I H;  1VQD A;  3H3V H;  5KND A;  2K5W A;  4C3H H;  4DU9 A;  1EFW A;  1ILQ A;  4R4O A;  5C0X G;  3MVV A;  1QNK A;  1EWC A;  3KDF A;  4IFD H;  4WJ4 A;  4GN3 B;  1CQF A;  1Y1V G;  4DV4 Q;  1FNW A;  1GUW A;  3TP6 A;  5IP7 H;  1AE3 A;  1MD2 D;  4A3F G;  1N34 Q;  4QUC A;  4UP9 A;  2F0F A;  1NAP A;  2JA6 B;  5LL6 X;  1Y1W G;  4YY3 L;  3NQI A;  4K8I A;  2M00 A;  4IFD J;  1Q86 C;  3HOY B;  2L12 A;  4BBR G;  3TN2 A;  3TS2 A;  4JI2 L;  4N8X 1;  3S2H B;  3H91 A;  1GD7 A;  1E2Z A;  4FYD A;  1IBK Q;  4G7Z C;  4I7Z C;  1WTX A;  4X6A H;  1K83 H;  3S1M B;  2R7Z H;  1EIY B;  1XMQ L;  1CKN B;  3DWA A;  2KHJ A;  5M5W H;  1IXR A;  4X3S A;  1XMO L;  1HR0 L;  4H7B A;  4PZ7 A;  3A7A B;  5E4X A;  4CHT B;  1BCP B;  3TEH B;  5IE8 A;  3S15 B;  2MHV A;  1BCP F;  3HEJ A;  3SK5 A;  3VA5 A;  4BS9 A;  1Z6H A;  3H0G H;  2ZXR A;  2MO0 A;  2ZXO A;  3AMU A;  1E1O A;  4DR2 Q;  2K01 A;  3GDE A;  4BA2 I;  1Q1E A;  4JOI C;  4QB4 A;  3FPP A;  3HOW G;  1U0L A;  1UEB A;  3PO3 H;  5KEE A;  1JB3 A;  2G9H D;  4GN4 B;  2UUB L;  3PO2 G;  2EYH A;  2KJX A;  2AUJ D;  3BZD B;  2F0P A;  4DPG A;  4FF4 A;  4BBS G;  1L0W A;  3LNN A;  3SDZ A;  1PTO C;  5NUC A;  3MTS A;  1QUQ A;  4L5S A;  2F4V Q;  2K1B A;  2PI2 A;  1W6K A;  4X3K A;  3PIO A;  1MBY A;  4XIG S;  3CRK C;  3H3V I;  3QO2 A;  1A0I A;  3KBX A;  3GTO H;  3QWN A;  2A69 D;  1PZK D;  4L5Q A;  1S5E D;  4IFD I;  5JAV A;  4E6I A;  4IN3 A;  2HQE A;  1A62 A;  3DWQ A;  4KK7 A;  1D1I A;  5DEH A;  1VQK A;  2EYM A;  4JI3 L;  3DEO A;  1LUZ A;  1PYB A;  4HAE A;  2K7V A;  2R3Z A;  2QA4 A;  4C3J G;  4OX9 L;  2B2W A;  5KYI A;  2O5I C;  2PZU A;  1PRT B;  1F77 A;  2IX3 A;  5M3F H;  4ZCK A;  5ELN A;  1WTV A;  3QOL A;  3DUZ A;  4XXE A;  1SNP A;  3GTG H;  1XWE A;  1WTP A;  4DV0 L;  1X65 A;  4B3S Q;  4HIK A;  4HMJ A;  2LFN A;  1YNJ C;  1SYC A;  4JC0 A;  4C3H G;  1SE3 A;  5HGT A;  3TP5 A;  1X9N A;  2ES2 A;  2CHB D;  4UHV A;  4IOC A;  2IW3 A;  1WCM H;  4ME3 A;  4A3B H;  1PH7 A;  4IFD G;  2ICE C;  3KDF B;  5EJW A;  3RZD H;  1SN8 A;  5IP7 G;  1K28 A;  4GLX A;  1BVS A;  2WB1 G;  3V2T A;  5I2X A;  4A3F B;  5CMD A;  4H0L C;  1PLF A;  3CAM A;  3X3N A;  1Y1W B;  1BXT A;  3VR6 A;  1X54 A;  2DJF C;  2OQ0 A;  2RHQ B;  1KTK A;  4BBR B;  3VR3 A;  4IUP A;  1Z47 A;  4FDB A;  1K8G A;  1F9P A;  4A3D H;  3W5O A;  1K73 C;  2LSS A;  1OO9 B;  5C4Z A;  3Q6S A;  3F2C A;  4YHH Q;  1XNR L;  1T9H A;  2FFK B;  2EJM A;  1E1T A;  2UXD L;  4KTA A;  2K5Q A;  4FP5 D;  5KGU A;  5BN3 A;  2NUC A;  1S5F D;  1VQI A;  2F1M A;  1MKH A;  1BO0 A;  2RDF A;  1RJT A;  4GLV B;  3J80 L;  1YBY A;  4L5R C;  3NBI A;  1SJH D;  3H0G G;  2IL8 A;  1F2Z A;  4PZ8 A;  1LT4 D;  4GOP C;  4R1J A;  1FJG L;  3J80 c;  2NWG A;  4JOI A;  3A56 A;  4LJZ C;  2UXB L;  4A3L H;  4Y7N B;  4ODG A;  4X3U A;  3JAM L;  3T1Y L;  2ICI A;  4WJ3 M;  3EVQ A;  2A68 D;  1K8O A;  4G7O C;  2Y0S G;  4HED A;  1PRT D;  1HTL D;  1JE4 A;  3C1E A;  1TKW B;  3OIP A;  2M9V A;  5LHY 1;  4H44 C;  2PMZ E;  4DV7 Q;  4WRD A;  4YCW A;  4F7X A;  3JAM c;  3PO2 B;  4HJ8 A;  2EYF A;  1LAB A;  1M4V A;  1CM9 A;  4PMC A;  4A93 H;  5CV5 A;  1QUQ B;  2KCC A;  2MJ8 A;  4JI0 Q;  3HOV B;  2OF1 A;  5GAD C;  2SNM A;  4IO9 A;  1NR4 A;  1YNN D;  2NVY B;  4H13 C;  3RUZ A;  4J8Q A;  1ESF A;  2Q8T A;  1TS3 A;  2EOT A;  1EU3 A;  3PMF A;  1D7Q A;  2UUA L;  4DKA C;  4A75 A;  3URY A;  1I50 H;  4KY6 A;  3GTK H;  5KNC A;  4ZQ3 A;  1VQ9 A;  1XNQ Q;  1BDO A;  4XT3 B;  2KOL A;  2JEB I;  2RCN A;  2QF7 A;  4QIW B;  2PNH A;  1QVF A;  1X55 A;  2EY1 A;  3TP8 A;  4A3K H;  3HGB A;  4JI4 Q;  2OWO A;  1JOK A;  3CCL A;  1R4P B;  1U9R A;  4C3J B;  4JBJ A;  4RH6 A;  5M3F G;  2CFM A;  3KUP A;  5IGC A;  1VMC A;  1J9O A;  4PMB A;  1ET9 A;  2XWJ B;  4RGN A;  1Y14 B;  1NR2 A;  2K75 A;  1D5Z C;  3SK4 A;  5IYB H;  5D3I B;  2BA1 A;  2NVQ B;  3BDO A;  1I4R A;  2L55 A;  4XYQ A;  1Y8N B;  1W6J A;  3K81 C;  3E6Z X;  2D5D A;  1KAW A;  2HHH Q;  5I6W A;  2KEE A;  1HUM A;  2WB1 B;  2L9H A;  3AQQ A;  4MHE A;  4KY5 A;  1VQO A;  3EIV A;  2EQS A;  3GTL H;  4CDF C;  4ALP A;  1R4Q B;  4TVA B;  5JEA H;  4CJ1 B;  1CSP A;  3HOX H;  1GJX A;  4A3D G;  2I46 A;  2F0O A;  1XPU A;  2WAQ B;  4DR1 L;  4CDD C;  3Q24 A;  4RKL A;  3BVG A;  5JEA J;  1M8A A;  1JOQ A;  4XTC S;  1A3V A;  2OXP A;  2MP1 A;  5GAE C;  2NBF A;  2JSO A;  1QE6 A;  2O4X A;  4GOP A;  3SVM A;  2JA6 H;  2F0D A;  5K5P A;  3S1Q B;  4LF5 Q;  2B3G A;  2R61 A;  3HS0 C;  3CPW A;  3HOY H;  1FVI A;  1WTO A;  1HNX L;  2B2Y C;  3PGZ A;  5DM6 3;  2BCO A;  3VYU A;  3T1H L;  1ASZ A;  3VYS A;  3S2H H;  1B9N A;  1B3A A;  2LXJ A;  4HJ7 A;  4KHP L;  3FHW A;  3TDQ A;  2ASB A;  1N9W A;  3S1M H;  2TSS A;  1A15 A;  4HID A;  4IPG A;  4JI7 Q;  3GD7 A;  1PTO B;  5IGF A;  3J81 L;  4A93 G;  1HXY D;  3HG9 A;  2UUC L;  4Y52 H;  4EX5 A;  2WAC A;  4IPC A;  3J81 c;  1I4X A;  4LF6 L;  1EIG A;  3J7Z C;  1U4L A;  3S15 H;  3C46 A;  2UXC L;  2K6A A;  1SMX A;  1E2V A;  2NZ1 D;  1B1Z A;  4V19 0;  1II3 A;  1IYJ B;  1SYD A;  4C56 C;  1EQQ A;  3E5S A;  3M4P A;  1RIP A;  1Q46 A;  5JVG 3;  1SSO A;  3H94 A;  2WKC A;  2XRS D;  1GUG A;  2F0J A;  5IT9 L;  3DLL A;  3GP7 A;  4U68 A;  1M90 C;  3ERQ A;  1SRO A;  2EY5 A;  2GA4 B;  4IJH A;  3CC2 A;  1HFN A;  2J0T D;  4X66 Q;  1VQM A;  5IT9 c;  1QB5 D;  1BNZ A;  5LMN L;  1V43 A;  1WTR A;  1VQ4 A;  3CCE A;  4JBM A;  2VUM B;  4APV A;  4LF8 L;  5LMU Q;  2HDL A;  5IYB G;  3SGI A;  2VQE L;  2BH8 A;  3I56 A;  3CCQ A;  4S3S A;  4MN3 A;  2NVX B;  1S5C D;  1Q82 C;  4BY1 G;  2VXW A;  4AYB G;  1O7I A;  2KBN A;  1CT1 D;  4C3I B;  2PPB C;  4EVO A;  1ICW A;  2CCZ A;  3HOZ B;  3RNU A;  1STA A;  1PTO D;  1TXY A;  2H5X A;  2NN6 G;  4HIM A;  2EE1 A;  1RHP A;  4DR3 L;  2RHS B;  3M85 A;  2KEC A;  3CCS A;  4JV5 Q;  1VQ5 A;  1H9S A;  1TVX A;  3PCO B;  1VQH A;  4B3M L;  2VQF Q;  5C6A A;  5G3L D;  1Q3L A;  3BVZ A;  1K3B C;  1EEI D;  2D2C C;  2E76 C;  1O80 A;  1RKN A;  2MO1 A;  4NB3 A;  5DAU A;  4CBV A;  1L0X B;  4O0A A;  4X62 Q;  3A54 A;  3I90 A;  4GOP B;  2KCN A;  1FR3 A;  2K03 A;  2WP8 J;  3V05 A;  4A3F H;  4DNR B;  5A2Q E;  3R3O A;  3U9S A;  4P2C B;  3HOY G;  1HNZ Q;  1Y1W H;  4K5W A;  2AWO A;  2B2Y A;  1N32 Q;  2C5C A;  4KHV A;  1D5X C;  4CJ2 C;  2K5N A;  1IYU A;  1QVC A;  5FO7 B;  1STH A;  1EY4 A;  2SEB D;  2DY8 A;  4BBR H;  1GHK A;  1SE8 A;  3ZYY X;  3JC6 6;  3EQL C;  4QY7 A;  4DFA A;  1X3F A;  3E3X A;  3F1Z A;  2B8F A;  4C1N I;  1HQM C;  1YNJ D;  1AN8 A;  2JA8 B;  1XYI A;  1AZQ A;  2D0P A;  3I7F A;  2H4O A;  4KHZ A;  2N55 A;  5IP9 H;  3AEV A;  3S2D B;  3HOU B;  3S9W A;  1HZ9 A;  5CBE E;  4JI6 Q;  2XNA C;  2PW5 A;  3CPF A;  1Q1B A;  4NXM Q;  2CQA A;  3CCV A;  1D2B A;  3OW2 A;  1AE2 A;  1F9Q A;  1K0R A;  4R9W A;  1AW7 A;  1P8L A;  4GNX C;  1N33 L;  3J80 E;  3M4Y A;  3HKZ E;  1SBB B;  4XQJ A;  4Y7N H;  4HCE A;  3GTQ B;  5IWA Q;  4DR7 L;  4DV3 L;  4X65 Q;  2KCM A;  1B7Y B;  2D9U A;  3PO2 H;  4N9P A;  3JAM E;  1XX8 A;  1F2M A;  5T1I A;  1BBX C;  2L11 A;  1VDZ A;  2FHT A;  1Q8K A;  3HOV H;  2NVY H;  4K0K L;  5FO9 B;  1H9M A;  4RWS C;  5GAH C;  4MTK A; 
#chains in the Genus database with same CATH homology
 1GXD C;  2IT1 A;  4QMG A;  5IGE A;  1A3U A;  4U67 3;  1IKL A;  1G8Z D;  4ZUI A;  4YIJ A;  2D62 A;  1KAA A;  3MXN A;  2AQ2 B;  3BDL A;  4OO1 H;  3VR4 A;  1KDA A;  5K36 H;  4BY1 B;  4FF3 A;  1TY0 A;  4CGY B;  4CKE A;  2XVS A;  3G6J B;  3M7G A;  2QKI C;  2CW0 C;  1GUT A;  5ELB A;  5M5Y B;  2KA7 A;  2MGS A;  1EY9 A;  1SMY C;  4J6H A;  4IUT A;  1LTR D;  2XWB B;  5IOD A;  1H9S B;  1HA6 A;  1I6H B;  1HUN A;  2HCC A;  3CQZ B;  2X69 A;  2F3V A;  2I07 B;  5J22 A;  3D6C A;  3TP7 A;  4FVM A;  1F2L A;  1K8M A;  5EKL A;  3MFY A;  1I4H A;  1SYE A;  2EYP A;  2KED A;  3IL8 A;  1QCB D;  2F0U A;  3F2U A;  4NW2 A;  1B44 D;  3K57 A;  2MUY A;  1WD0 A;  4FXD A;  3K6O A;  1WVL A;  3H3V C;  4DK1 A;  4RCN A;  3K5M A;  1HFG A;  2O5J C;  4B9W A;  2QEJ C;  1BOS A;  5CV9 A;  1ZEQ X;  1LTA D;  1ENC A;  3DMU A;  1ROD A;  4WFN 3;  1SE4 A;  2LS0 1;  1OXT A;  1EYC A;  4I65 A;  3FVQ A;  4OO1 I;  4TSS A;  1TU2 B;  3WOE A;  4A3M B;  4KD4 A;  4IUR A;  3C1F A;  3NWS A;  3RZO B;  5M3M B;  2RVL A;  4IQZ A;  2A73 B;  3QOJ A;  1KNE A;  2JA5 B;  1PTO H;  2K04 A;  1R9T B;  3OIQ A;  3N6R A;  1CHQ D;  3P7J A;  4B9X A;  5CV4 A;  5E4W C;  1PZJ D;  2NB0 A;  3J81 E;  3MZ5 A;  2PMZ B;  3RD4 A;  3VR5 A;  1EY6 A;  1CI3 M;  4F87 A;  4KMU C;  4K6D A;  3OOC A;  4BY7 B;  4OO1 G;  4IZ8 A;  5K36 G;  4HSV A;  1IW7 C;  4J1M A;  1EL0 A;  1B2T A;  4L63 B;  5C4H A;  1XTC D;  1SNO A;  1EOT A;  1EZ8 A;  2PQE A;  4ABN A;  1MSG A;  3GV6 A;  5IT9 E;  1BCP D;  4FO2 A;  1JWM D;  3NK9 A;  2EY6 A;  1DYQ A;  1BQQ T;  2RSN A;  1IHZ A;  3D6W A;  5A2Q L;  2XN9 C;  2EPB A;  1RTO A;  1CA5 A;  1BF4 A;  4B08 A;  3MC0 B;  4OHJ A;  2V4D A;  4HR7 B;  3TSS A;  4Q0F A;  1S4Z A;  1H9K A;  2M2L A;  2WKD A;  5M5X B;  2FJ2 A;  4RKB A;  3T16 A;  1Y8P B;  2YU9 B;  3ERO A;  5KNB A;  5KRU A;  2JA7 B;  2R6G A;  2L1B A;  4Q5V A;  5E3F A;  4XQQ A;  2A6E C;  5CGK A;  2NTT A;  1LTG D;  4K14 A;  4K8J A;  4FXK C;  1PXU A;  1JCK B;  3W3A A;  3KF8 A;  2NVT B;  1JQY D;  3K59 A;  1FD7 D;  2PZT A;  5EQ0 A;  2B2V A;  2F0H A;  3NTH A;  5FKA C;  2E2J B;  1JC7 A;  1IKM A;  1PMR A;  2EVB A;  3BG3 A;  3S16 B;  2E2D C;  2EYO A;  2QDB A;  1MSH A;  1GOZ A;  1AFP A;  3SK6 A;  1NSN S;  3GQB A;  3I70 A;  2NYZ D;  5EPL A;  2FMC A;  3PUW A;  1C48 A;  1DOM A;  5BN4 A;  1DOK A;  1SNC A;  3QG1 A;  2G9D A;  5C5L A;  4DGZ A;  5A35 A;  4HCS A;  4KKU A;  3K58 A;  3GTJ B;  2YYZ A;  1QIL A;  5CV7 A;  3I3C A;  1GUN A;  3G7L A;  2JEA I;  3MWY W;  1LTI D;  3U9O A;  4K5X A;  3FPU B;  3Q22 A;  2BA0 A;  5EPK A;  4C3I G;  1MGS A;  3T56 B;  1JOR A;  3IFD A;  4HMI A;  5IGB A;  2F4I A;  5ELF A;  1ZYR C;  1EY0 A;  1STY A;  3NQT A;  3A8J E;  4M8A A;  1H9R A;  1C4Q A;  2NN6 H;  2X6G A;  4PV1 C;  3GO5 A;  4A3E B;  3NBH A;  5JPM C;  3W2D A;  3X3M A;  4OIK A;  3NTI A;  5CV6 A;  3S1R B;  4IUU A;  5EKI A;  2IX0 A;  2A6H C;  1OXV A;  2Z4H A;  1QG7 A;  3PUV A;  5LL6 S;  1MI2 A;  3TME A;  2CW0 D;  1V1P A;  1A3T A;  1KLG D;  3T4A C;  1G2T A;  1TWG B;  1QNU A;  2LMC B;  1V1O A;  1AP0 A;  3QJY A;  2WII B;  1Y8O B;  3PUZ A;  3KK7 A;  2SOB A;  3R93 A;  2EYJ A;  2F0W A;  3EFX D;  1TWF B;  2A69 C;  2C9O A;  1TQO A;  3I91 A;  1G6Z A;  4L8J A;  2KUM A;  1X3Q A;  1ET6 A;  4KN7 C;  1UEA B;  4DXF A;  3VA7 A;  4RFB A;  3A8K E;  1U4R A;  5FOB B;  4RHS A;  2QIL A;  4R8N A;  1FYC A;  2VB2 X;  4IAL A;  3MXG A;  3I4L A;  1WTW A;  3LWE A;  1SYG A;  2NN6 I;  2MPM A;  3HKZ B;  2L5T A;  1XXG A;  1EU4 A;  5T1G A;  4IUV A;  4JBW A;  3AU7 A;  1WD1 A;  4G7H C;  1VMP A;  2ENB A;  3ONA B;  1TY2 A;  4QUF A;  2B63 B;  3P75 A;  2IX1 A;  5IIF A;  1QOH A;  1CK1 A;  3NP8 A;  4CKB A;  1LV9 A;  3K7A B;  1SXT A;  5JPN C;  3BS1 A;  1EFI D;  2F0E A;  3VYT A;  1T5X D;  4WJW A;  1TWC B;  2EZV A;  4TKO B;  1ESR A;  1NCV A;  5E1F A;  3D31 A;  3D8G A;  3RZD B;  1HCZ A;  2E75 C;  1EYA A;  3I4N B;  3A7L A;  5C4X B;  1SJE D;  3LX0 A;  2RKS A;  1SEB D;  3I8Z A;  4DAP A;  5IGG A;  4PNY A;  2CVR A;  4DXG A;  1KNA A;  3A8I E;  4RCO A;  3OPO A;  5I9P A;  5F2D A;  3PV0 A;  1G91 A;  4DAY A;  2A68 C;  4XT1 B;  1PRT C;  1SYB A;  2KVM A;  4A3G B;  3QIA A;  3K5L A;  4DA2 A;  2H1E A;  4ID6 A;  1DON A;  3R2I A;  1BUV T;  4EQP A;  1YNN C;  1ENA A;  4FF1 A;  2K5D A;  1I4P A;  1Q12 A;  3DM1 A;  3WDN A;  2Q8I B;  3J7A F;  3OWE B;  2B2U C;  3KBG A;  4OIJ A;  3NUC A;  3RLF A;  3M3Y B;  1LT5 D;  2Q8R E;  1JOO A;  3L3O C;  1F9S A;  4F88 A;  1EYD A;  2F0K A;  2F03 A;  2K28 A;  4DAV A;  1STG A;  3E0J A;  3RMH A;  1ML0 D;  1QJO A;  4EGV A;  1TS5 A;  3K5O A;  2IPK D;  2XIW A;  1DJR D;  2A6E D;  5C44 B;  4L6T B;  1PFB A;  5ELE A;  1E0B A;  4UAI A;  4X3T A;  1ZXT A;  5C4J B;  1G29 1;  2VNU D;  2E2H B;  3K0Y A;  2B39 A;  1EY8 A;  5C3E B;  1EEF D;  1S5B D;  2VB3 X;  3Q23 A;  1JR0 D;  2R93 B;  1EY5 A;  4A3I B;  2HUG A;  1I4G A;  2RDG A;  3ITP A;  5ELD A;  1Y69 U;  1SDF A;  4EQN A;  2LY7 A;  3OHX C;  3OW7 A;  4UDU C;  1DZ1 A;  3C3L A;  5IOC A;  3PIO 3;  2KQ3 A;  1HPC A;  3UI2 A;  3T13 A;  2TMP A;  1OXX K;  3BDC A;  3OWF A;  4C2M B;  4HSP A;  3CHB D;  3O13 A;  1D1K A;  4R8I A;  4IUQ A;  4BA1 I;  3CKI B;  3D3R A;  3TBI B;  5M9O A;  2XSC A;  4G4K A;  3D4R A;  2BE5 C;  1I4Q A;  3K5N A;  4C1N K;  5EBD A;  4DNT B;  1CTM A;  3T53 B;  2DNC A;  3QB3 A;  3DXJ C;  5ISR A;  3S1N B;  1C8C A;  2OT2 A;  4A3J B;  4K2K A;  3MEH A;  1ZYR D;  2B2U A;  2BDN A;  3OSO A;  3PIP 3;  3DHQ A;  2DNE A;  2EYL A;  4RGO S;  3CRL C;  1VCI A;  4RAU C;  2F0G A;  3NTK A;  2PNR C;  2K32 A;  1LT6 D;  3M4O B;  1I3Q B;  2X6L A;  2DY7 A;  1OXU A;  3FEW X;  2AWN A;  2B8G A;  2A6H D;  3FKI B;  3WOF A;  3OMG A;  4K5V A;  1SE2 A;  3FMC A;  4LMQ D;  2B2V C;  3ND9 A;  3V96 A;  3KLS A;  4HTH A;  4PMW A;  1HA5 A;  2RDH A;  2HCI A;  5COY A;  1TS2 A;  2IJ0 A;  3SHL A;  2AQ1 B;  1KAB A;  3DEP A;  4NKL A;  3MXU A;  1JIC A;  1STN A;  5DM7 3;  1GUS A;  2Z1C A;  3NPP A;  5COR A;  3VR2 A;  5JVH 3;  1SFO B;  4DN4 M;  4NDX A;  3A55 A;  2AQ3 B;  3HRZ C;  3SXH A;  3SR1 A;  5KIX A;  1CQV A;  5AFW A;  1EQV A;  1B9M A;  1SNQ A;  3J7A V;  1PRT F;  4KN4 C;  1GUO A;  1SAP A;  3MHB A;  4XDX A;  5I9O A;  3NE5 B;  1I6V C;  3BVM A;  1IYV A;  5I2Y A;  2JYO A;  1ZKO A;  1Y1V B;  1HHV A;  4PQX A;  2L0C A;  1LTB D;  5FLX L;  4CKC A;  3BYT B;  2AUK A;  1O78 A;  1PFM A;  4K2L A;  5I6Y A;  2J4X A;  3EA6 A;  1O7Y A;  1TII D;  3IAY A;  3MA2 B;  4KY7 A;  2IWH A;  3VYR A;  2JE6 I;  2PYK A;  4WOR A;  5EGT A;  1FNU A;  3L7Z C;  5KYL A;  2FMM A;  4ZKB B;  2R92 B;  1NUC A;  1STE A;  1CA6 A;  1STB A;  3I4M B;  2F0N A;  3HOW B;  4KJN A;  4M1U B;  4MIU A;  1CHP D;  1O7Z A;  1TWH B;  3MFG A;  1LAC A;  2F0M A;  2F0S A;  4BBS B;  4LAA A;  2F0T A;  3GTP B;  2KHS A;  4ZRZ A;  2RBM A;  2EXZ A;  1TS4 A;  2OEO A;  3R2T A;  4KKS A;  1X32 A;  3R8B A;  3IKJ A;  3HP3 A;  3HZX A;  3S17 B;  1E2W A;  3S14 B;  1ILP A;  1DM0 B;  5JJZ A;  5ELC A;  3MAQ A;  5C3X A;  1PZI D;  1A2T A;  1U4M A;  4O1N A;  3NSW A;  4N9T A;  2BOS A;  1PFN A;  1GHJ A;  2PCF B;  1TWA B;  5CV8 A;  2F0L A;  2QCP X;  5CBA E;  1D6E C;  1OXS C;  3GTM B;  1DCZ A;  2SNS A;  2XRQ D;  2E2I B;  4C3H B;  4RGM A;  5TSS A;  1FNV A;  1RDP D;  2PW7 A;  1HTP A;  3KLR A;  1TT2 A;  2F0V A;  4FNF A;  3EJI A;  2K33 A;  3D4D A;  2RQX A;  2B2T C;  4EQO A;  1LTT D;  2RA4 A;  2BDO A;  5CC4 A;  4K6L A;  1F2Y A;  2JP1 A;  5C3W A;  3FRP B;  4KKT A;  3IFT A;  1K83 B;  2R7Z B;  3I72 A;  4KD3 A;  1RTN A;  1SMY D;  5M5W B;  4LK1 C;  4IUN A;  4KV6 A;  4RHR A;  1EY7 A;  1HRJ A;  1B53 A;  2Z8L A;  5C5M A;  5CR3 A;  4OL7 A;  3H0G B;  1PDQ A;  3NXW A;  5D65 A;  4ZK9 B;  2HDM A;  2RSO A;  3PO3 B;  3M7N A;  2Y0S B;  4QF4 A;  1LTS D;  4F8M A;  1VF5 C;  2Z4I A;  4XQN A;  2PO4 A;  1PTO F;  1B50 A;  2BE5 D;  3OMC A;  1DOL A;  1Z7T A;  1BCP C;  4G57 A;  1O7L A;  3GTO B;  4RGT A;  1UNS A;  5G3L F;  4V0B A;  1UUP A;  4ILW A;  4RA8 A;  3L9A X;  2A74 C;  1RD9 D;  1KDC A;  4GZY C;  4XYO A;  2LKV A;  1VF7 A;  1EZ6 A;  1DXM A;  4TQU S;  5M3F B;  3SEB A;  1IL8 A;  4O42 A;  1X3P A;  3PUX A;  3GTG B;  2ID0 A;  2SDF A;  4JK1 C;  2L4N A;  1WCM B;  4A3B B;  3P1H A;  1SNM A;  1JWU D;  1BR9 A;  3NHH A;  2B2T A;  1AZP A;  1T5E A;  5CYU A;  2F3W A;  5FK9 C;  5IGD A;  4KI0 A;  1IW7 D;  5JEA G;  3H6M A;  1SND A;  3J7Y W;  3DWP A;  1V1P B;  1HQR D;  4ZYS A;  3TZU A;  4A3D B;  3MXP A;  4ME5 A;  1UAP A;  1EWH A;  4ULL A;  3FDT A;  1PYW D;  1QWY A;  4NP5 A;  5C0X H;  1DD2 A;  2J7Z A;  1B4O A;  4KJO A;  4DK0 A;  1Q90 A;  1CZW A;  4QCL A;  1U4P A;  2JXM B;  1JWS D;  4Z9C B;  5C0X J;  4DF7 A;  3PUY A;  3NWT A;  3TZD A;  1F9R A;  2PZW A;  5DNF A;  1SYF A;  1H9J A;  3I73 A;  5FLX E;  1A6X A;  2O2L D;  4HN7 A;  2FIN B;  5J39 A;  2N88 A;  2A5H A;  4BWG B;  2EJF C;  4A93 B;  3D4W A;  3GV3 A;  3LWU A;  1KLU D;  3AB9 A;  3T51 B;  1LT3 D;  5D3D A;  1EQT A;  1A2U A;  3CU7 A;  2E74 C;  1Q8I A;  1CFM A;  2K05 A;  1WTQ A;  1I50 B;  3GTK B;  5BN5 A;  3SK8 A;  2ZT9 C;  1V8Q A;  2NTS A;  1ENF A;  1TR5 A;  3P20 A;  5D14 A;  1J8I A;  3BYY B;  4NMZ A;  2EY2 A;  4A3K B;  1CZG A;  5JOB A;  2WIN B;  3KLS X;  4ZKC B;  1LO5 D;  5HUR A;  1FGB D;  2EDG A;  3Q0A A;  4ZUJ A;  2F0Q A;  3SE0 A;  1D5M C;  4FF2 A;  1AEX A;  1L0Y B;  2DN8 A;  3H09 A;  5EBC A;  5J1Z A;  5C0X I;  1S5D D;  5EPJ A;  4ZLT F;  1G2S A;  4OGQ C;  1KDB A;  4AYB B;  1RCV D;  3C2P A;  2WV6 D;  4CJ0 B;  2EJG C;  5EKK A;  3N52 A;  3GTL B;  4ZAI A;  1LLR D;  2B2W C;  3ND8 A;  2F0I A;  4TRD A;  3HOX B;  5FO8 B;  1ONL A;  1EIH A;  1RF2 D;  4FXG C;  2ZXP A;  5I4D A;  5KND A;  2K5W A;  4DU9 A;  1ILQ A;  5C0X G;  1QNK A;  3MVV A;  1EWC A;  4IFD H;  1CQF A;  1FNW A;  1GUW A;  3TP6 A;  1MD2 D;  4QUC A;  2F0F A;  1NAP A;  2JA6 B;  5LL6 X;  3NQI A;  4K8I A;  2M00 A;  4IFD J;  3HOY B;  2L12 A;  3TN2 A;  3S2H B;  3H91 A;  1E2Z A;  4FYD A;  4G7Z C;  4I7Z C;  1WTX A;  3S1M B;  3DWA A;  4X3S A;  4H7B A;  3A7A B;  5E4X A;  4CHT B;  1BCP B;  3S15 B;  2MHV A;  1BCP F;  3HEJ A;  3SK5 A;  3VA5 A;  4BS9 A;  1Z6H A;  2ZXR A;  2ZXO A;  3AMU A;  2K01 A;  4BA2 I;  1Q1E A;  4QB4 A;  3FPP A;  5KEE A;  1JB3 A;  2G9H D;  2EYH A;  2KJX A;  2AUJ D;  3BZD B;  2F0P A;  4FF4 A;  3SDZ A;  3LNN A;  1PTO C;  5NUC A;  3MTS A;  2K1B A;  1W6K A;  4X3K A;  1MBY A;  4XIG S;  3CRK C;  3QO2 A;  3KBX A;  3QWN A;  2A69 D;  1PZK D;  1S5E D;  4IFD I;  5JAV A;  4E6I A;  4IN3 A;  2HQE A;  3DWQ A;  4KK7 A;  1D1I A;  5DEH A;  2EYM A;  3DEO A;  4HAE A;  2K7V A;  2R3Z A;  4C3J G;  2B2W A;  5KYI A;  2O5I C;  2PZU A;  1PRT B;  1F77 A;  2IX3 A;  1WTV A;  3QOL A;  3DUZ A;  4XXE A;  1SNP A;  1XWE A;  1WTP A;  4HMJ A;  2LFN A;  1YNJ C;  1SYC A;  4C3H G;  5HGT A;  1SE3 A;  3TP5 A;  2CHB D;  2IW3 A;  4IFD G;  2ICE C;  5EJW A;  3V2T A;  5I2X A;  4A3F B;  5CMD A;  4H0L C;  1PLF A;  3X3N A;  1Y1W B;  1BXT A;  3VR6 A;  1KTK A;  4BBR B;  3VR3 A;  4IUP A;  1Z47 A;  1F9P A;  1OO9 B;  5C4Z A;  3Q6S A;  2FFK B;  2EJM A;  4KTA A;  2K5Q A;  4FP5 D;  5KGU A;  5BN3 A;  2NUC A;  1S5F D;  2F1M A;  1BO0 A;  2RDF A;  1RJT A;  3J80 L;  3NBI A;  1SJH D;  2IL8 A;  1F2Z A;  1LT4 D;  2NWG A;  3A56 A;  4LJZ C;  4Y7N B;  4ODG A;  4X3U A;  3JAM L;  2ICI A;  3EVQ A;  2A68 D;  1K8O A;  4G7O C;  4HED A;  1PRT D;  1HTL D;  1JE4 A;  3C1E A;  1TKW B;  3OIP A;  2M9V A;  5LHY 1;  4H44 C;  4WRD A;  4F7X A;  3PO2 B;  2EYF A;  1LAB A;  1M4V A;  1CM9 A;  4PMC A;  5CV5 A;  2KCC A;  2MJ8 A;  3HOV B;  2OF1 A;  2SNM A;  1NR4 A;  1YNN D;  2NVY B;  4H13 C;  3RUZ A;  4J8Q A;  1ESF A;  2Q8T A;  1TS3 A;  2EOT A;  1EU3 A;  3PMF A;  3URY A;  4KY6 A;  5KNC A;  4ZQ3 A;  1BDO A;  4XT3 B;  2KOL A;  2JEB I;  2QF7 A;  4QIW B;  2EY1 A;  3TP8 A;  3HGB A;  1JOK A;  1R4P B;  1U9R A;  4C3J B;  4RH6 A;  3KUP A;  5IGC A;  1VMC A;  1J9O A;  4PMB A;  1ET9 A;  2XWJ B;  4RGN A;  1NR2 A;  1D5Z C;  3SK4 A;  5D3I B;  2BA1 A;  2NVQ B;  3BDO A;  1I4R A;  2L55 A;  4XYQ A;  1Y8N B;  1W6J A;  2D5D A;  3E6Z X;  5I6W A;  2KEE A;  1HUM A;  2WB1 B;  2L9H A;  4MHE A;  4KY5 A;  1R4Q B;  5JEA H;  4CJ1 B;  1GJX A;  2I46 A;  2F0O A;  2WAQ B;  3Q24 A;  4RKL A;  3BVG A;  5JEA J;  1M8A A;  1JOQ A;  4XTC S;  1A3V A;  2OXP A;  2MP1 A;  2NBF A;  2JSO A;  1QE6 A;  2O4X A;  3SVM A;  2F0D A;  5K5P A;  3S1Q B;  3HS0 C;  2R61 A;  1WTO A;  2B2Y C;  5DM6 3;  2BCO A;  3VYU A;  3VYS A;  1B9N A;  1B3A A;  3TDQ A;  2TSS A;  1A15 A;  3GD7 A;  1PTO B;  5IGF A;  3J81 L;  1HXY D;  3HG9 A;  2WAC A;  1I4X A;  1EIG A;  1U4L A;  3C46 A;  2K6A A;  1E2V A;  2NZ1 D;  1B1Z A;  4V19 0;  1II3 A;  1SYD A;  4C56 C;  3E5S A;  5JVG 3;  1SSO A;  3H94 A;  2WKC A;  2XRS D;  1GUG A;  2F0J A;  5IT9 L;  3GP7 A;  4U68 A;  3ERQ A;  2EY5 A;  2GA4 B;  1HFN A;  2J0T D;  1QB5 D;  1BNZ A;  1WTR A;  1V43 A;  2VUM B;  2HDL A;  4S3S A;  4MN3 A;  2NVX B;  1S5C D;  2VXW A;  1CT1 D;  4C3I B;  2PPB C;  4EVO A;  1ICW A;  3HOZ B;  1STA A;  1PTO D;  2NN6 G;  2EE1 A;  1RHP A;  3M85 A;  2KEC A;  1H9S A;  1TVX A;  5C6A A;  5G3L D;  1Q3L A;  3BVZ A;  1EEI D;  2D2C C;  2E76 C;  1O80 A;  1RKN A;  5DAU A;  4CBV A;  1L0X B;  3A54 A;  3I90 A;  2KCN A;  1FR3 A;  2K03 A;  2WP8 J;  3V05 A;  4DNR B;  5A2Q E;  3R3O A;  3U9S A;  4P2C B;  4K5W A;  2AWO A;  2B2Y A;  2C5C A;  4KHV A;  1D5X C;  4CJ2 C;  1IYU A;  5FO7 B;  1STH A;  1EY4 A;  2SEB D;  2DY8 A;  1GHK A;  3ZYY X;  3EQL C;  4DFA A;  2B8F A;  4C1N I;  1HQM C;  1YNJ D;  1AN8 A;  2JA8 B;  1XYI A;  1AZQ A;  2H4O A;  4KHZ A;  2N55 A;  3S2D B;  3HOU B;  3S9W A;  5CBE E;  2XNA C;  2PW5 A;  1Q1B A;  2CQA A;  1D2B A;  1F9Q A;  4R9W A;  1AW7 A;  3J80 E;  3M4Y A;  1SBB B;  4XQJ A;  4HCE A;  3GTQ B;  2D9U A;  4N9P A;  3JAM E;  1XX8 A;  1F2M A;  5T1I A;  1BBX C;  2L11 A;  1VDZ A;  2FHT A;  5FO9 B;  1H9M A;  4RWS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...