5ELEA

Cholera toxin el tor b-pentamer in complex with a lewis-y
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cholera enterotoxin subunit B
publication title High-Resolution Crystal Structures Elucidate the Molecular Basis of Cholera Blood Group Dependence.
pubmed doi rcsb
source organism Vibrio cholerae o1
molecule tags Toxin
total genus 26
structure length 103
sequence length 103
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5eleA00
1FNWA 1LT5D 1CHQD 1GOZA 1JWUD 1STEA 4TSSA 1JR0D 4UDUC 1I4QA 1PYWD 4DXFA 3MC0B 1LTAD 4C56C 1LO5D 1T5XD 2TSSA 4RGNA 4ZYSA 5I4DA 1CHPD 2QILA 1TS3A 3DWAA 1FNUA 3BVMA 5ELEA 1I4GA 2CHBD 4RGMA 2NTSA 1LTSD 1V1OA 1KTKA 1AN8A 1FGBD 1LLRD 1S5CD 3KLSX 1SJED 1B44D 1TS4A 5ELDA 1HTLD 1MD2D 1XTCD 1HXYD 3URYA 4RFBA 1D5XC 1S5BD 2O2LD 5ELFA 1AW7A 2AQ1B 1EFID 1BCPB 1LT4D 1S5ED 2NTTA 1RD9D 1SE4A 1EEFD 1RF2D 1UNSA 3SEBA 3GP7A 1CK1A 1TY0A 1LT3D 1FD7D 1EEID 1JWMD 1D5MC 1G8ZD 1SBBB 3EA6A 1LTRD 5TSSA 3W2DA 1CT1D 1PTOB 1PRTB 1EU4A 3CHBD 1HQRD 1BCPF 3R2IA 1TS2A 5D3DA 1B1ZA 1V1PA 2XNAC 1JWSD 1JCKB 4K6LA 1LTID 3BYTB 1CQVA 1ET9A 1PZID 4RH6A 4RGTA 1TS5A 1LTBD 1ET6A 1LTGD 1F77A 1SJHD 1PTOF 1PZKD 1I4HA 1PRTF 1DYQA 1KLGD 1PTOH 1I4XA 2J4XA 4RGOS 3BVGA 4RHSA 3DWQA 1BCPC 1BCPD 3EFXD 2IJ0A 1RDPD 1L0YB 2AQ3B 3TSSA 2XN9C 1SE2A 5FK9C 2WV6D 1RCVD 1SXTA 2QEJC 4O1NA 3BVZA 1ESFA 1UUPA 2XRSD 4Z9CB 1TY2A 1QILA 1KLUD 2RDHA 5D3IB 1V1PB 1S5DD 2SEBD 2XRQD 3BZDB 1S5FD 1XXGA 5ELBA 3MFGA 1M4VA 2ICIA 4DXGA 2R61A 1LTTD 4L63B 1EU3A 4BWGB 4OHJA 3R2TA 3V05A 4RHRA 1SEBD 1DJRD 4RCOA 1EWCA 3O13A 1HA5A 1SE3A 1LT6D 2G9HD 1ENFA 1FNVA 5FKAC 2AQ2B 1D6EC 2RDGA 3OWEB 1BXTA 3BYYB 2IPKD 1I4RA 5ELCA 3R8BA 4L6TB 1D5ZC 1I4PA 1L0XB 1JQYD 2Z8LA 3DWPA 1PTOC 1PZJD 1PTOD 1PRTC 1PRTD
chains in the Genus database with same CATH superfamily
3A7LA 3GTOH 3S2DH 3HS0C 1JR0D 2A6HD 3A5ZB 4C3JH 1EFWA 3GTMH 4KHZA 2K5QA 2E76C 3N6RA 1CHPD 1BBUA 3MTSA 5AJ3L 3BVMA 2E74C 3HG9A 1IHZA 1KTKA 3GD7A 1WCMB 4JK1C 3H3VC 3G4SA 1VQPA 3JAMi 2PQAA 1M90C 1DM0B 1D5XC 4B3TQ 1A3TA 3HKZG 3CQZB 4C3HG 1YHQA 3PIP3 1B50A 3C2PA 4CKEA 1K0RA 2E2HB 4J6HA 1LT3D 4IUPA 3DEPA 1JWMD 3NBHB 5F2DA 2SDFA 1HUNA 3A74A 2F4VL 1KC8C 3RD4A 4PZ8A 1O7LA 2XNAC 1I94Q 5EKKA 2PMZB 4UAIA 5IP7G 2EY5A 3CQZH 5IYDG 4K14A 5J1ZA 3K5NA 5C6AA 2DNCA 2H4OA 1XPRA 2E2JH 1VQ8A 4A3BG 1H9JA 1W6JA 1ET6A 4LF5L 3ULPA 2PZTA 2A8VA 1XMQL 2IX3A 1SNDA 1STGA 4IUQA 3FEWX 5HGTA 2AQ3B 1NMGA 1SXTA 4RKLA 1IBMQ 3ZYYX 3FVQA 3H6MA 4XT3B 1V8QA 1EY7A 2B2VA 4HAEA 4DR1L 2JA6H 1B3AA 2B8GA 4HSPA 2F3VA 5CV4A 3I3CA 3STBC 1E24A 2FMCA 1DJRD 4G7HC 1A62A 1HQMC 3L9AX 1VDZA 1STAA 1G6PA 2OF1A 5FLXc 2DN8A 4BY7G 2K01A 4JI1L 3TRZA 1X9NA 1C8CA 4A3FG 1D1KA 3CCEA 3K6OA 3FHWA 1UWVA 1PRTC 2AWOA 1DD2A 4NXMQ 4ZUIA 3ULJA 4LF6L 3DM3A 4JI4Q 3T53B 1L0WA 3D31A 3I73A 3LWUA 3PIO3 2EXZA 5IE8A 2VNUD 1T5XD 3C46A 1F9SA 1UE1A 4K5WA 2NB0A 5FO7B 4DR3L 5CORA 3DMUA 3HOWG 3NWSA 1XTCD 1YNXA 2QGQA 3T4AC 2RBMA 1HNWQ 2F03A 2B2WC 2LS01 2K28A 2VQFQ 5FO9B 2FJ2A 4JI7L 3RMHA 2R92H 3RN5A 2UU9L 4YHHQ 2K7VA 3K0XA 4DAYB 4FP5D 1CSQA 5K36G 3N52A 1R4PB 3HGBA 2WFWA 4PMBA 1AFPA 4GKJL 2QDBA 2PQEA 1N9WA 1L1OC 2VB3X 1ESRA 5A35A 3NSWA 3E3XA 4HJ8A 3FP9A 4JI3L 1K9MC 4AIMA 4OXPA 2JA8H 5CMDA 4RGOS 3ND9A 4BA2I 1XJVA 2EVBA 5HURA 2A69C 4O1NA 1RCVD 1ZEQX 5DM63 1G51A 3CMEA 5JOBA 3T56B 5CV7A 1JB7A 4E6IA 2HT1A 1C48A 1X56A 3IFDA 1STYA 4FXKC 1A0IA 1GJXA 3NQTA 4X3KA 1EQTA 2WP8J 2XVSA 3AU7A 1EU3A 5E1FA 1EWCA 1VQ5A 5E7NA 4R4OA 2GVAA 5FKAC 4DV1L 1EYDA 3OWEB 2ENBA 3KF6B 1ZYRC 1BDOA 3OSOA 1PZJD 4DGZA 3ULLA 1TWHB 4IZ8A 3UI2A 3M4PA 2MO0A 3CRLC 1B7YB 2HDMA 5IY0A 5IT9E 1I6HB 2VW9A 1MGSA 4R4TA 4KY7A 4DR6Q 4DF7A 4A3IB 1LO5D 3GDEA 1BOSA 4M1UB 1BBWA 4LNQA 4A3DG 4TKOB 3GTGB 2QILA 5J39A 4JI0Q 1PYSB 2PO4A 2L11A 1I4GA 3GTJB 3BZCA 3HOZB 2K32A 2Z6BA 5ELDA 3WDNA 1E2WA 4OONA 3F8TA 4KHPL 3NUCA 2KHIA 4A3IH 2P5ZX 4P74A 3OTOL 3S16B 3GTGH 4IURA 1F2YA 1HFGA 3A8KE 1SYGA 1NY4A 3EA6A 1KRSA 5C4XG 2KUMA 2RF4A 4X64Q 3HOZH 1PTOB 1NE3A 2F0MA 2V1CC 4QIWE 3NHHA 2NZ1D 4BBRG 3HP3A 3OYYA 3TP6A 1JOQA 1NAPA 1Z9FA 4ZCKA 1XPUA 1UAPA 4WORA 4N9PA 3J80c 3IAYA 3PO3B 3K7AB 2Q2HA 1HJPA 3D4DA 3S16H 4A3MH 1XNQL 1WCMG 4GNXB 3F1ZA 4KMUC 5KYLA 2VS1A 1A2TA 1T5EA 1PTOH 1RJTA 1VQ7A 5ELOA 2RKSA 1BCPC 3CU7A 3FMCA 5LMNL 2KJXA 2HCCA 4Q5VA 1L0YB 2CQAA 5C4JB 3CCUA 1HNXL 3I4NG 1TU2B 2UXBQ 2AHOB 1S4ZA 1TXYA 1DXMA 4JBWA 2B2VC 2MNAA 1QZGA 3PO3H 1DGSA 3K80C 2DUDA 2XRSD 1HR0Q 4NPSA 4JI6Q 4K5VA 3E9IA 4JV5Q 2NYZD 2UUAL 4ULLA 2A68C 3H15A 2DNEA 5ELBA 3VA5A 4LFBQ 3IL8A 4OELB 4LWCA 4BWGB 4RHRA 4DN4M 3EQLC 3FPPA 1HA5A 3HOYB 5IYBG 3QJYA 1D2BA 1LT6D 2BOSA 5IYCH 1FYCA 4O2DA 4MIUA 4LF7L 1MHWC 2QKIC 4JYAL 5C3EH 4B3TL 3SR1A 1GXDC 2ZJRA 1H9SA 5M3FB 1SDFA 1CUKA 1JOOA 1W6KA 5GADC 3HOXB 1CHQD 4I65A 2F0VA 5JJKA 2MJ8A 3MC0B 1HR0W 1CZGA 4A3KH 4OGQC 4K2KA 2EYMA 2C5CA 3LX0A 2Q2IA 4ALPA 1LLRD 5IP9G 3A5UA 4UP7A 3MXPA 1PMRA 4X66L 2Y0SE 1JORA 1EQRA 2D5DA 2J0TD 1Y1WB 1K8OA 1A8VA 1X3EA 2F0QA 1N32Q 4O0AA 1TY0A 1PFBA 3PUZA 1D5MC 4I7ZC 3MXUA 3QOJA 4C3HH 1WTRA 2CKZB 4A3BB 1BVSA 4OEMB 2M00A 1JWSD 1IL2A 2PW5A 1J9OA 1GUGA 2WB1E 4R8NA 1I3QB 5GROA 3VYTA 4CBVA 3CCJA 1STNA 1NTGA 5IOCA 4XQNA 1SNQA 1VF7A 3T51B 4KJOA 4DR2Q 5IYDH 5IGGA 1HPCA 1WTQA 4RHSA 4AQYQ 1I6VC 4A3BH 2NVQH 4LF9Q 1Y14B 2RDFA 4DV3Q 1B3QA 4CDEC 1I3QH 4RCNA 4BBSG 2X6LA 3IRBA 4ZK9B 4NXML 1MI2A 2RDHA 1M1KC 2R6GA 1B53A 4DV4Q 4IJLA 1V1PB 4GLVB 2XRQD 4JI4L 1S5FD 4ODGA 4DNRB 3DUZA 3F2BA 4LF8L 3K59A 2NVTB 2K5VA 4IUVA 1SEBD 3D6CA 3J80i 3M4QA 2L12A 3D0FA 4XQJA 1D1IA 3M4OH 1WVLA 2RHQB 2RCNA 4IPGA 3LNNA 1D5ZC 3M4YA 1U4MA 1HNWL 1L0XB 4L5TA 5E4XA 1K8GA 3VR6A 3MA2B 4BY7H 3ERQA 3BDOA 4IPCA 1GOZA 1B9NA 1BQQT 4DXFA 4A3FH 2NVYB 4H44C 3HOWB 4YY3Q 2TSSA 2ZTDA 4A3JG 4RWSC 4JI2L 1RTNA 5I4DA 3K58A 2ZXOA 4JI8Q 4QF4A 1Y1VG 2NTSA 1YVCA 3CW2C 3SHLA 4CJ0B 4HCEA 1CKMA 4QIWB 1X3FA 5JPMC 4N8X1 4UHVA 1EQQA 3SE0A 2RSOA 3J81j 1L2FA 2NVYH 4RKBA 1STHA 3U58A 1VCIA 3HOWH 1K0SA 2BDOA 3Q22A 4HCSA 1LABA 3W5OA 1YITA 1PH1A 2BE5D 4LFAQ 1YNJD 2A73B 2UXCL 1KDAA 5HY6A 1BCPF 2EYLA 2WIIB 2XWJB 3R2IA 1QVGA 2HIXA 4A3IG 1VQGA 3KLRA 1KXLA 2F0TA 3ERSX 1EWHA 2TMPA 2V4DA 4HJ9A 5K36H 2MO1A 4X3SA 5C5LA 3HOZG 5CV6A 2F0FA 2IHEA 3C3LA 1HFNA 2F1MA 1PZKD 4M8AA 4DNTB 2CWPA 2B2WA 2J7ZA 3F2DA 1I4XA 3KYHC 2X6GA 3I4MB 5LMUQ 4ZRZA 1DONA 4A3CG 3EFXD 2JEAI 5IODA 2B29A 2JJQA 1IXRA 3DEOA 2OTLA 2PI2E 3OHXC 2BH8A 1VQFA 1OXTA 4C1NI 3CC7A 5JVG3 4POGA 4GOPB 4CHTB 1HZ9A 2B3GA 2L15A 1C7YA 1TY2A 3ER0A 2QF7A 1S3OA 4DKAC 3K57A 4ABNA 1MBYA 4P71A 3I4MH 3Q24A 2EZVA 2LXJA 3IFTA 1X65A 1F2MA 1PXUA 4RCOA 4JI0L 2EYPA 1LUZA 2FXQA 1SE3A 5E4WC 2A6ED 4V190 2E5LQ 1BXTA 2OXPA 3RZDB 2ICEC 2R93G 1W2BA 1O7YA 4QY7A 1EY6A 1G91A 3CKIB 3ZJYC 2HHHQ 2A19A 3DWPA 4EQNA 1U5KA 2F52A 3MHBA 3SGIA 2Y0SB 3T1HQ 4QUCA 2CVRA 3S1NH 3KLSA 3PGZA 1JE5A 4X64L 1Q1EA 4RGMA 4C3IB 3A8JE 1N36Q 1SYDA 5BN3A 3AEVA 3G7LA 1TS4A 4DV7L 1E7ZA 1Y8NB 1XWEA 4GLAC 2JA5B 2BA1A 4YWKA 3HOYG 1D7QA 1EFID 1LT4D 4PMCA 2WB1B 1QUQA 5GQOA 1LV9A 1UNSA 2F0JA 4BBRB 4EX5A 4IUUA 3M3YH 3MVVA 1EOTA 1EEID 1RHPA 4KLKA 5K5PA 5M3FG 1P8LA 1VQIA 2OWOA 2DGYA 4GKKQ 1HH2P 1J8IA 3HOXG 4JPBW 2UXBL 5KGUA 3T1YQ 2M2LA 4B3RQ 2XSCA 2JA5H 2EDGA 2YYZA 1PA6A 1WFQA 5T1IA 5C4XH 1EIFA 1XTDA 1Y8OB 4JV5L 2AKWB 2B2TA 3GTKB 2K5DA 1AP0A 4RGTA 2XIWA 4BBRH 1EYAA 1VQAA 2CH4A 3EROA 2JN4A 1K83B 5IT9L 1IBKQ 2LSSA 3J7A5 3I4NB 3TP7A 1VQBA 4JOIC 4YWMA 3BDCA 2VQEQ 5AFWA 1Y1WG 4JBMA 1CKNB 1WCMH 3BZKA 4R8IA 1J5EQ 3J81L 4AYBE 4DK6C 2EYHA 3GTKH 5LMNW 4NB3A 4DUZL 4GS3A 1TKWB 4G4KA 1PH8A 3QB3A 1TT2A 3KFUA 1K83H 1KLUD 2VY3A 4FXGC 4DR7Q 4X65Q 3BZDB 1XX8A 3I4NH 2E2HH 1TWGB 5GAGC 3STBD 1TWFB 4R4QA 3PIPA 3CCVA 5M5WB 1B4OA 1LYLA 4DV5L 1QNKA 2EYOA 4GNXC 3PO2B 4G7OC 4L5QA 2EOTA 2RDGA 3NEMA 2EY1A 3QWNA 2N88A 4YIJA 5EAYA 1YJWA 3GTLB 3RNUA 2NWGA 5IYBH 1PRTD 4A4IA 1EUJA 2MPMA 5FLXL 1TWFH 3DHQA 2KHSA 2QEXA 1PV4A 2M9VA 3ITPA 4IUTA 2CW0C 2F0IA 2OQ0A 4RGNA 1K28A 3S24A 1OXVA 1MJEA 4H0LC 3KBXA 3FRPB 1U0LA 4DV6L 4PMWA 2F3IA 4YWLA 1PH3A 3GTLH 1MD2D 2VXWA 3NE5B 5JJZA 2MFIA 1IBLQ 3D4WA 2CWAA 5IP9H 1SE4A 2B39A 1EY8A 3H0GG 1CK1A 1X32A 4MZ9A 1B8AA 5IGFA 1PVOA 3I4LA 1YJ9A 3EJIA 4LF9L 3S14B 3CHBD 4B3SQ 1TS2A 1V43A 1B1ZA 4NXNQ 4DUYQ 4NW2A 5G3LD 3BYTB 1QVCA 1N33Q 4JI5Q 1QG7A 2UUBQ 5CBAE 2F3WA 1TS5A 2EE1A 4IJHA 4XTCS 1SJHD 3OMCA 3CCRA 2I46A 5C4ZA 2AUJD 4BBSB 4ILWA 3PIOA 4RAUC 2A69D 3GTQB 1EZ8A 5DNFA 4L8JA 3QO2A 4EQPA 2D62A 5M5XB 1HHVA 2F0LA 5J3BA 1Q12A 2WAQE 3M9BA 1EQVA 3RLOA 2F0NA 4IALA 1S5DD 4JVZA 2LMCB 3S1RB 1KRTA 4P2CB 1M4VA 3J7AV 1PDQA 1BUVT 2R61A 2BDNA 5IWAL 4HMIA 3R2TA 3V05A 4YY3L 4BBSH 2LKVA 2F0KA 3T16A 3O13A 4XYOA 2MGSA 1N34Q 3MFYA 4Y52H 4DR5Q 1YIJA 1ASYA 2VUMB 1I4RA 5EJWA 3M7NA 1ZYRD 1EL0A 2C35B 1DZ1A 3VYUA 3I4MG 4ME5A 1NR4A 1TVXA 4A3JB 3AYHB 1AE3A 1IZ6A 1FNWA 4DFAA 3NBHA 1NNXA 3TS2A 2F0UA 1BO0A 2F0SA 4OWXB 1Y1VB 4NDXA 1PYWD 1TQOA 5M5YB 2ZM6Q 4LFAL 1JT8A 4LF4L 2NZHA 1DCZA 3K5OA 2C9OA 3DWAA 3DXJC 2NN6G 2YU9B 1MSHA 1E22A 1FNUA 4FF1A 2ID0A 5JEAG 2YTXA 3KJOA 4BY1B 1SJED 3I56A 2EY6A 1SNOA 1X55A 1HTLD 3HFZB 3CXCA 2PCFB 4A3JH 1SN8A 1NMFA 2X69A 4C1NK 5JVH3 4DR4Q 1AW7A 2AQ1B 1Y1VH 4B08A 1Q3LA 2ALYB 5FLMG 2OTJA 1HUMA 5KEEA 5NUCA 3NTKA 3SEBA 3GP7A 2UUCQ 2EJGC 1K8AC 4LFCQ 1FJGL 2JP1A 2N3SA 3Q0AA 4A3EG 3QG1A 2ASBA 1JICA 2Y0SG 4CJ2C 4HIOA 2A5HA 1WTOA 5D3DA 2B2TC 4ZLTF 3J81E 4PQXA 3TQYA 1KDCA 4KY6A 3QOLA 1TWHH 1CQVA 4C3IG 1I6HH 4KKSA 5E3FA 4K0KQ 3B6YA 5I6WA 1LTBD 5C3XA 3KBGA 1PTOF 2Z0SA 1I4HA 1DOMA 1XMOL 4XYQA 3MXGA 3QIAA 3I91A 2JQOA 2JA5G 4KI0A 1BCPD 5CV9A 1SMYC 2WB1G 2YTYA 3GTJH 1V9PA 1QVFA 3EIVA 1F9RA 1WD0A 4Q0FA 1SNMA 4A3GB 4N8FA 1CA6A 2XTIA 2KEDA 4ID6A 2HHHL 3JC66 2LFNA 3MXNB 4A3CH 1QILA 5KNDA 1RL2A 4LUOA 2SEBD 3H3VH 3A54A 2A68D 4IOAA 1QCBD 3SDZA 5FLXE 5C44B 5D14A 4OIJA 2KQ3A 4EQOA 1GUTA 2R93B 3E9HA 5FJ8G 5C3WA 3NBIA 1D8LA 3LWEA 2BA0A 3OMGA 4MTKA 1FNVA 2AQ2B 2A74C 3KF8B 3UE1A 1P16A 3QR8A 3R8BA 3PF5A 2HQEA 2Z4IA 2Z8LA 3K7AH 1Y8PB 2JXMB 4DAYA 5C44H 2DJFC 3SXHA 3AFPA 3TMEA 2R93H 1JWUD 5CR3A 1BR9A 1I4QA 1YNNC 3NXWA 5KIXA 1RKNA 4P72A 4YCVA 4GKKL 4IQZA 5C4JH 5AJ3Q 1KAAA 1CI3M 1V1OA 4G7ZC 2B2UA 1S5CD 5KYIA 4OO1G 4QQBX 3UDXA 1YBYA 3MZ5A 2AWNA 2K03A 2NBFA 3PO2G 5I2XA 3BJUA 1CKOA 1JJCB 3VR2A 1IBKL 2K5HA 3C1FA 5BN4A 1VMPA 3CPWA 3A55A 3CCQA 1EWIA 1ZKOA 2HDLA 5EPKA 3F2UA 4OIKA 3HOYH 4MHEA 3W2DA 1PRTB 1YHBA 2E2DC 2F4VQ 2K50A 1I94L 1GO3E 4K6LA 1Q81C 1T9HA 4DR7L 4X65L 5M3FH 1GUSA 3HOXH 4XDXA 1R9TB 2EPBA 2WAQB 2F0WA 2RVLA 1G6ZA 4A3LG 1IYVA 1Q1BA 3KF6A 5DEHA 1JJ2A 1HZCA 4WJ3M 3CCSA 1VQLA 1RDPD 4K2LA 1GKHA 2YTVA 5C0XH 1IBML 1SAPA 1NR2A 3WWVA 1Q86C 4LK1C 4Z9CB 1Y1WH 1H9RA 4UPAA 5D3IB 2PPBC 4DR1Q 4HEDA 4ZAIA 5JJIA 3KDFB 2AMCB 1L1OB 4S3SA 3TP5A 5IGDA 5J22A 3V2TA 4LAAA 5A2QL 2I0QA 1AEXA 2EJMA 4JOIA 2F0HA 3BYYB 2Q8TA 3E6ZX 2GVBA 4FF4A 1IBLL 3I7FA 1XPOA 5KNCA 4FF3A 1WTXA 1X3GA 2L4NA 2UXDQ 3FPUB 5M3MG 2ZJQA 3NTHA 5LL6X 1JC7A 4IUNA 5IIFA 4ME3A 5EBDA 1MJCA 2JE6I 1GUNA 1K3RA 1F9PA 3SK4A 1KHIA 4X62Q 3S15B 1X3PA 5ISRA 1KAWA 3A56A 4IFDG 4NXNL 3JAML 4GNXA 2IT1A 1HXYD 3CMAA 3H0GB 1SSOA 2JK8A 2IY5B 2FMMA 3U9OA 2VQFL 1S5ED 4EQ5A 2VUMG 5IGCA 5JJLA 2NVTH 2VL6A 3VDYA 3X3MA 4YHHL 4TRDA 5GAEC 4F87A 3BS1A 4XIGS 2UU9Q 4GN4B 1SBBB 2K5WA 3EVQA 3MWYW 1CT1D 1HCZA 2PMZE 3H09A 4JCVE 1JOKA 3H0GH 1A3UA 1F9QA 1JCKB 1PTOD 4DAPA 3P1HA 4WFN3 4HJ7A 1PFNA 1Q8KA 4JC0A 1AZPA 1X54A 1C0AA 4BY1G 5DAUA 4B9XA 3K7UC 2PQAB 5I2YA 4R1JA 2KCTA 1BF4A 1E0BA 2I5MX 4JI3Q 1PH7A 3G71A 1IYJB 4J8QA 2J4XA 3Q23A 4CDDC 1GVPA 2VB2X 1EYCA 3TBIB 2ZTCA 4DR5L 2CCZA 3H3VI 4EGVA 4QUFA 4A93G 1PFMA 1GD7A 1CA5A 1OO9B 2K1BA 2Q2TA 2F0OA 2B2YA 2PZWA 3I70A 3S2HB 2Q2UA 1WI5A 1VQHA 1XXGA 4IN3A 3TEHB 4QGUA 4OX9Q 4L63B 4OHJA 5C4HA 4AYBG 3VYRA 2HIVA 3TZDA 4DV1Q 1NJIC 2PZUA 2PW7A 4IPHA 1I5FA 1MSGA 4IO9A 4X6AH 1PHJA 2ZXRA 2HUGA 1R4QB 5M9OA 2ATWA 4ZQ3A 4CDCC 1VS0A 4UP9A 1KDBA 1STBA 3R93A 1VQJA 1TWCB 2UUCL 4CKCA 4L5RC 2E8GA 4A3GG 4TQUS 2KENA 3RUZA 4DR6L 4LFCL 1QE6A 3PCOB 1LTAD 4C2MB 3FKIB 2DJGC 2GN5A 1I50B 4C56C 2QCPX 1CM9A 2B2UC 1VMCA 4ZYSA 4J15A 1YJNA 4PZ7A 1ML0D 3TS0A 5C44G 4DAVA 2L9HA 4K8IA 3KLWA 3UDGA 4RFBA 1KQSA 5EKLA 4B3MQ 2NN6H 3EBEA 5JEAH 5DM73 4A3EB 3Q8DA 2RSNA 3CC4A 1YZ6A 1VQ6A 1I50H 3I8ZA 3P75A 3RR5A 3GTPB 1C4QA 1TWAB 4CKBA 5TSSA 2MP1A 5FLMH 1E2ZA 3RZDH 1II3A 4X3UA 4MNOA 1HQRD 3L3OC 1XNRQ 3PUVA 1V1PA 2L0CA 2EY2A 5C0XJ 3W1BA 4A3EH 1QB5D 2WINB 3E5SA 3IKJA 1B70B 1XNQQ 1LTGD 5EGTA 2PYKA 5CYUA 3GO5A 3GTOB 1TWAH 4K5XA 2EYFA 3OOCA 4UP8A 5H1SE 3GTMB 3CRKC 4C3IH 1JMCA 4HR7B 5LMNQ 3SK8A 5A2QE 2XN9C 3VA7A 3HKSA 4JBKA 1SR3A 5L37A 2QEJC 2R3ZA 4PZ6A 3J7ZC 3HOVG 2OCEA 3BVZA 1AZQA 3WOEA 3TN2A 3K5MA 2XWBB 1Q82C 4LUVA 5I9PA 3AB9A 1PH4A 1UUPA 4LW1A 1SYCA 1HR0L 4JI6L 4FF2A 2O5IC 4A75A 2K75A 3U9SA 2UUAQ 4LFBL 1HZAA 4F8MA 1EIHA 4EVOA 1FVIA 5C0XG 3VYSA 4R9WA 1IW7C 1G2TA 5COYA 1YHAA 4DV0Q 3RN2A 2WAQG 5ELCA 1PH5A 4LF7Q 3F2CA 4POFA 5FJ8H 3W3AA 5I6YA 4JYAQ 2MUYA 2L1BA 2AUKA 3JAME 4XQQA 3UE0A 1PTOC 1TR5A 4UDUC 2A6HC 1SROA 2E2JB 3X3NA 3CD6A 2KA7A 1FL0A 1QWYA 4DK0A 2CW0D 1LM0A 3EN2A 3PV0A 2Q8IB 2A1AA 5IT9c 4G57A 2F0EA 3NQIA 1AN8A 3CC2A 3KK7A 1UE6A 3L0OA 4HIMA 2QA4A 1K73C 1EIGA 1F2ZA 3NK9A 3KJPA 1WJJA 2LXKA 3URYA 4X66Q 3HRZC 2MHVA 1QNUA 1X6OA 1U9RA 1TWGH 3J81c 3ND8A 2NTTA 2JA6B 1BKBA 1EEFD 1RF2D 2E75C 1N32L 3GV3A 5M5WH 4OO1H 4HTHA 1PH9A 2IX0A 1G2SA 4I7AA 4DA2A 1A6XA 1EZ6A 3PO2H 1WTHA 5CC4A 4WJWA 2FHTA 1VQ4A 1Y69U 3P7JA 4GOPA 1XYIA 1K8MA 1G291 1GHKA 3PUWA 3P20A 2R7FA 4O42A 2SOBA 4XXEA 1IKMA 1KNAA 2D9UA 2PNHA 4DR2L 2O5JC 3LGJA 2BH2A 1PFSA 1KIXA 3BVGA 3TDQA 2NVXB 4AQYL 2B8FA 3NWTA 1CTMA 1WOCA 1Z7TA 4DV3L 1EYGA 4KKUA 5FK9C 4A76A 4CDFC 1GUOA 3TP8A 2B2YC 1VQEA 3J7AF 1E3PA 4A3LH 1ESFA 2R7DA 2UXDL 4DV4L 1Z6HA 1CQFA 1NBWA 1SYEA 1QOHA 2NVXH 1H9MA 2E2IB 1Q90A 4LF8Q 2L5TA 4X62L 2R92B 3H91A 4GLXA 1BNZA 4H7BA 3S14H 2XGTA 4CJ1B 4HN7A 4H02A 5M3MB 1SMXA 3KUPA 3RZOB 4KD3A 4RA8A 5JPNC 3G48A 1TIID 1ENCA 1EOVA 2E2IH 2IHFA 4TSSA 5JEAJ 1QJOA 2OQKA 3HKZE 2Z6KC 2NN6I 2JA8B 4JI2Q 3GTQH 1ZXTA 4JI8L 5M3MH 1QZHA 3CAMA 2WACA 3T13A 2CHBD 3AMUA 3RZOH 1UE7A 3KLSX 1FGBD 3PMFA 2RA4A 5M5XH 1OXSC 3KOJA 4FO2A 4PNYA 3K5LA 4H13C 1KNEA 1S5BD 4U673 2GA4B 3S1RH 1ICFB 1EY9A 5LL6S 4IFDH 4OWTB 1UE5A 2RHSB 2MQHA 4J1MA 1CKNA 1V1QA 4HIDA 5EBCA 1H9SB 4DV2Q 4QJFA 1G8ZD 3TZUA 1X3QA 5BN5A 2JA7B 5KNBA 3ICEA 2VUMH 2UXCQ 3BU2A 4HIKA 2WKCA 3FKIG 3PF4A 2ZJPA 1J6QA 2PNRC 1WTPA 3D8GA 3OIPA 2K04A 2IW3A 1ET9A 1S72A 5CBEE 1HZBA 4OX9L 5M5YH 1OXUA 4BXXH 2JA7H 5DLQE 2DY8A 4LUZA 3S1QB 3NENA 4A93B 1RODA 5LMUL 2YU9H 4BS9A 4MN3A 3U50C 1SMYD 4BY1H 3I90A 3J81i 2EXDA 3DLLA 1HNZQ 2WV6D 1DOKA 4KD4A 3D3RA 1YI2A 3FDTA 4JG2A 1B9MA 3ONAB 5BR8Q 4AYBB 2B63B 2EJFC 3E0JA 2OEOA 3MFGA 3S1QH 4DXGA 3PUXA 4A93H 2FINB 4QL5A 1SYFA 4V0BA 4AH6A 4WJ4A 1PH2A 3J80L 3HZXA 4DK1A 1ENFA 3NELA 2E5LL 3AFQA 2K52A 4L6TB 4TVAB 3GV6A 4C3JG 1VF5C 3HOUB 3J7YW 2B63H 4B3ML 2K14A 3I4OA 5D65A 5FO8B 1O78A 1F2LA 3T1HL 4FXDA 1EIYB 2CFMA 1STEA 1UEAB 4A3MB 1AH9A 1UEBA 4FNFA 3CP0A 1YNND 1EY0A 1HA6A 4KKTA 4LMQD 3RLNA 1NCVA 1VQDA 1RIPA 2QW7A 1N36L 1LTLA 4UY8C 1LTSD 4A3GH 1XNRL 3OPOA 4OO1I 2PI2A 3HOUH 5FOBB 4DV7Q 1IYUA 5KRUA 1E1OA 2O2LD 2JEBI 1JE4A 5ELFA 1OTCA 2N55A 4WRDA 2HQLA 2R7ZB 1FGUA 5EPLA 5JAVA 3CCMA 4MTNA 4ZKBB 4GOPC 1FD7D 4R4CA 3D4RA 1HTPA 4IOCA 1CFMA 1M8AA 2D0OA 4KN4C 5C5MA 3T1YL 4ZKCB 4JBJA 5CV5A 3H94A 4B3RL 2OT2A 1VQKA 3L2PA 2VZAA 5EPJA 3Q6SA 5C3EB 2JSOA 2R7ZH 2EIFA 2I5HA 1PRTF 1DYQA 4HJAA 3E0EA 4KY5A 2HD3A 3HOVB 2Z4HA 2VQEL 3G6JB 3S1MB 4A3KB 2SNSA 2WKDA 4DV0L 2KCNA 1KABA 2JA6G 3TSSA 1RTOA 4KV6A 1VQOA 1J5EL 1B2TA 4P73A 2L55A 1GM5A 3S17B 3OWFA 3GQBA 2K6AA 4DUZQ 2SNMA 1IL8A 4GN5A 3BDLA 2NUCA 2EQSA 3HOVH 2F0DA 1LTTD 3UDFA 4LF5Q 4GN3B 3S1MH 2DY7A 1Q46A 3PUYA 5IGBA 3S9WA 1XMQQ 1ILPA 3HKZB 4DV5Q 2K05A 4NP5A 3S17H 2EYJA 4C3HB 3A7AB 1A3VA 1NSNS 1K3BC 1O7ZA 4OWWB 1JB3A 1IKLA 1I4PA 4RMFA 1WD1A 1N8RC 1R9TH 2O4XA 3OW2A 5G3LF 3TREA 2K5NA 3G6EA 1LT5D 4IFDJ 3VR5A 1CSPA 1MKHA 2KCMA 1O80A 1SE8A 1EY4A 1VQCA 4DAMA 4IFDI 1TS3A 2NZOA 5ELEA 3I2ZA 4QB4A 4DV6Q 1B44D 2H1EA 2NVQB 4JI1Q 2R92G 2Q8RE 2D2CC 2ZT9C 1PYBA 2N49A 3D6WA 5IP7H 4LF6Q 1ENAA 3MEFA 3V96A 1NUCA 1Z47A 4LJZC 1VQMA 1S40A 3K0YA 2K33A 1LTRD 2CH4W 2FFKB 4DU9A 3SK6A 1ONLA 3OIQA 5CGKA 4B3SL 1A63A 3MXNA 3M4OB 4DUYL 4DR3Q 3NPPA 2JA8G 3CPFA 2F4IA 1N33L 1SLJA 2KVMA 4JI5L 3U4VA 5GAHC 2UUBL 4YCUA 3U4ZA 3L7ZC 4BY7B 4KHVA 2I5LX 4JW0A 2Z9HA 2N78A 3KF8A 3NTIA 1SFOB 1KLGD 4JI7Q 3S15H 4A3FB 1GUWA 1QUQB 3DWQA 4PG3A 2K4KA 3R3OA 4U68A 2IJ0A 3J80E 2KHJA 1SE2A 1U4LA 2Z1CA 1WTVA 4YCWA 4PV1C 3RLFA 4BXXG 4KTAA 4GKJQ 2KECA 2JA7G 3DM1A 2CQOA 1PLFA 1SNPA 2BCOA 5T1GA 1FR3A 4CGYB 3PSIA 4ZUJA 4RG1A 1SFOH 3VR4A 3JAMc 5IWAQ 3C1EA 2G5DA 1N34L 1A2UA 3K81C 4Y7NB 2IX1A 2G9HD 4K8JA 4NMZA 4L5SA 2IPKD 3A0JA 1H95A 3OW7A 2HCIA 2G9DA 3K8AA 4HJ5A 4GZYC 1E2VA 2H5XA 2IL8A 4DV2L 2ZM6L 4K6DA 3CCLA 1KD1C 4Y7NH 1JJGA 4LF4Q 1W3SA 2B63G 3HEJA 3VR3A 1C9OA 1HRJA 1ASZA 1WYDA 1EY5A 3CF5A 2ZTEA 4KJNA 2JYOA 2YV5A 3A8IE 5LHY1 5IGEA 1GHJA 3SVMA 4R4IA 4DR4L 3S2HH 5EKIA 1BCPB 1U4PA 1WTWA 1U4RA 1E1TA 1RD9D 1H9KA 5ELNA 3HOUG 2BE5C 3PQIA 2F0PA 1DOLA 2JA9A 1FJGQ 2KOLA 1OXXK 1YNJC 4BA1I 2ZXPA 1PH6A 1HNZL 1EU4A 4F88A 2Z6KA 4A3MG 1Q7YC 1VQ9A 2KCCA 5CV8A 1BBXC 3UDIA 1LTID 5BR8L 1VQNA 4B9WA 3KDFA 4X3TA 1PZID 4RH6A 4HMJA 1TWCH 1SRUA 4QMGA 4K0KL 1L1OA 4KHPQ 3M7GA 1F77A 1ICWA 3FKIH 3BG3A 4C2MH 3I55A 1KL9A 2KBNA 1XMOQ 3OTOQ 3S1NB 3PO3G 1ILQA 4HSVA 4F7XA 4OL7A 4IPDA 1MIUA 2N8NA 4KK7A 4N9TA 2I07B 1CZWA 4FDBA 2R7ZG 2KEEA 3NP8A 4XT1B 4DPGA 1O7IA 4DK3C 1LACA 4KN7C 5HGQA 2RCFA 4APVA 4A3DB 3MAQA 4P75A 4NKLA 4QCLA 1AE2A 5IYCG 5C0XI 2ICIA 5EQ0A 2IWHA 5I9OA 1Q8IA 2D0PA 2F0GA 4DNIA 3M85A 3GTPH 3S2DB 4FYDA 3SK5A 1SYBA 1IW7D 5C3EG 3M3YB 4C3JB 3MEHA 2A6EC 1D6EC 3W1GA 2LY7A 1HNXQ 3I72A 1A15A 4A3DH 2RQXA 3WOFA 3AQQA 4A3KG 1JQYD 1SNCA 4FVMA 1YEZA 5C4XB 2ES2A 2QDLA
chains in the Genus database with same CATH topology
3A7LA 3HS0C 1JR0D 2A6HD 4KHZA 2K5QA 2E76C 3N6RA 1CHPD 3MTSA 3BVMA 2E74C 3HG9A 1IHZA 1KTKA 3GD7A 1WCMB 4JK1C 3H3VC 1DM0B 1D5XC 1A3TA 3CQZB 4C3HG 3PIP3 1B50A 3C2PA 4CKEA 2E2HB 4J6HA 1LT3D 4IUPA 3DEPA 1JWMD 5F2DA 2SDFA 1HUNA 3RD4A 1O7LA 2XNAC 5EKKA 2PMZB 4UAIA 2EY5A 4K14A 5J1ZA 3K5NA 5C6AA 2DNCA 2H4OA 1H9JA 1W6JA 1ET6A 2PZTA 2IX3A 1SNDA 1STGA 4IUQA 3FEWX 5HGTA 2AQ3B 1SXTA 4RKLA 3ZYYX 3FVQA 3H6MA 4XT3B 1V8QA 1EY7A 2B2VA 4HAEA 1B3AA 2B8GA 4HSPA 2F3VA 5CV4A 3I3CA 2FMCA 1DJRD 4G7HC 1HQMC 3L9AX 1VDZA 1STAA 2OF1A 2DN8A 2K01A 1C8CA 1D1KA 3K6OA 1PRTC 2AWOA 1DD2A 4ZUIA 3T53B 3D31A 3I73A 3LWUA 3PIO3 2EXZA 2VNUD 1T5XD 3C46A 1F9SA 4K5WA 5FO7B 2NB0A 5CORA 3DMUA 3NWSA 1XTCD 3T4AC 2RBMA 2F03A 2B2WC 2LS01 2K28A 5FO9B 2FJ2A 3RMHA 2K7VA 4FP5D 5K36G 3N52A 1R4PB 3HGBA 4PMBA 1AFPA 2QDBA 2PQEA 2VB3X 1ESRA 5A35A 3NSWA 5CMDA 4RGOS 3ND9A 4BA2I 2EVBA 5HURA 2A69C 4O1NA 1RCVD 1ZEQX 5DM63 5JOBA 3T56B 5CV7A 4E6IA 1C48A 3IFDA 1STYA 4FXKC 1GJXA 3NQTA 4X3KA 1EQTA 2WP8J 2XVSA 3AU7A 1EU3A 5E1FA 1EWCA 5FKAC 1EYDA 3OWEB 2ENBA 1ZYRC 1BDOA 3OSOA 1PZJD 4DGZA 1TWHB 4IZ8A 3UI2A 3CRLC 2HDMA 1I6HB 5IT9E 1MGSA 4KY7A 4DF7A 4A3IB 1LO5D 1BOSA 4M1UB 4TKOB 3GTGB 2QILA 5J39A 2PO4A 2L11A 1I4GA 3GTJB 3HOZB 2K32A 5ELDA 3WDNA 1E2WA 3NUCA 3S16B 4IURA 1F2YA 1HFGA 3A8KE 1SYGA 3EA6A 2KUMA 1PTOB 2F0MA 3NHHA 2NZ1D 3HP3A 3TP6A 1JOQA 1NAPA 1UAPA 4WORA 4N9PA 3IAYA 3PO3B 3K7AB 3D4DA 4KMUC 5KYLA 1A2TA 1T5EA 1PTOH 1RJTA 2RKSA 1BCPC 3CU7A 3FMCA 2KJXA 2HCCA 4Q5VA 1L0YB 2CQAA 5C4JB 1TU2B 1S4ZA 4JBWA 1DXMA 2B2VC 2XRSD 4K5VA 2NYZD 4ULLA 2A68C 2DNEA 5ELBA 3VA5A 3IL8A 4BWGB 4RHRA 4DN4M 3EQLC 3FPPA 1HA5A 3HOYB 3QJYA 1D2BA 1LT6D 2BOSA 1FYCA 4MIUA 2QKIC 3SR1A 1GXDC 1H9SA 5M3FB 1SDFA 1W6KA 1JOOA 3HOXB 1CHQD 4I65A 2F0VA 2MJ8A 3MC0B 1CZGA 4OGQC 4K2KA 2EYMA 2C5CA 3LX0A 1LLRD 3MXPA 1PMRA 1JORA 2D5DA 2J0TD 1Y1WB 1K8OA 2F0QA 1TY0A 1PFBA 3PUZA 1D5MC 4I7ZC 3MXUA 3QOJA 1WTRA 4A3BB 2M00A 1JWSD 2PW5A 1J9OA 1GUGA 4R8NA 1I3QB 3VYTA 4CBVA 1STNA 5IOCA 4XQNA 1SNQA 1VF7A 3T51B 4KJOA 5IGGA 1HPCA 1WTQA 4RHSA 1I6VC 2RDFA 4RCNA 2X6LA 4ZK9B 1MI2A 2RDHA 2R6GA 1B53A 1V1PB 2XRQD 1S5FD 4ODGA 4DNRB 3DUZA 3K59A 2NVTB 4IUVA 1SEBD 3D6CA 2L12A 4XQJA 1D1IA 1WVLA 3LNNA 1D5ZC 3M4YA 1U4MA 1L0XB 5E4XA 3VR6A 3MA2B 3ERQA 3BDOA 1GOZA 1B9NA 1BQQT 4DXFA 2NVYB 4H44C 3HOWB 2TSSA 4RWSC 1RTNA 5I4DA 3K58A 2ZXOA 4QF4A 2NTSA 3SHLA 4CJ0B 4HCEA 4QIWB 5JPMC 3SE0A 2RSOA 4RKBA 1STHA 1VCIA 2BDOA 3Q22A 4HCSA 1LABA 2BE5D 1YNJD 2A73B 1KDAA 1BCPF 2EYLA 2WIIB 2XWJB 3R2IA 3KLRA 2F0TA 1EWHA 2TMPA 2V4DA 5K36H 5C5LA 4X3SA 5CV6A 2F0FA 3C3LA 1HFNA 2F1MA 1PZKD 4M8AA 4DNTB 2B2WA 2J7ZA 1I4XA 2X6GA 3I4MB 4ZRZA 1DONA 3EFXD 2JEAI 5IODA 3DEOA 3OHXC 4C1NI 5JVG3 1OXTA 4CHTB 1TY2A 2QF7A 3K57A 4ABNA 1MBYA 3Q24A 2EZVA 3IFTA 1F2MA 1PXUA 4RCOA 2EYPA 1SE3A 5E4WC 2A6ED 4V190 1BXTA 2OXPA 3RZDB 2ICEC 1O7YA 1EY6A 1G91A 3CKIB 3DWPA 4EQNA 3MHBA 2Y0SB 4QUCA 2CVRA 3KLSA 1Q1EA 4RGMA 4C3IB 3A8JE 1SYDA 5BN3A 3G7LA 1TS4A 1Y8NB 1XWEA 2JA5B 2BA1A 1EFID 1LT4D 4PMCA 2WB1B 1LV9A 1UNSA 2F0JA 4BBRB 4IUUA 3MVVA 1EOTA 1EEID 1RHPA 5K5PA 1J8IA 5KGUA 2M2LA 2XSCA 2EDGA 2YYZA 5T1IA 1Y8OB 2B2TA 3GTKB 2K5DA 1AP0A 4RGTA 2XIWA 1EYAA 3EROA 5IT9L 1K83B 3I4NB 3TP7A 3BDCA 5AFWA 4R8IA 3J81L 2EYHA 4G4KA 1TKWB 3QB3A 1TT2A 1KLUD 4FXGC 3BZDB 1XX8A 1TWGB 1TWFB 5M5WB 1B4OA 1QNKA 2EYOA 3PO2B 4G7OC 2EOTA 2RDGA 2EY1A 3QWNA 2N88A 4YIJA 3GTLB 2NWGA 1PRTD 2MPMA 5FLXL 3DHQA 2KHSA 2M9VA 3ITPA 4IUTA 2CW0C 2F0IA 4RGNA 1OXVA 4H0LC 3KBXA 3FRPB 4PMWA 1MD2D 2VXWA 3NE5B 5JJZA 3D4WA 1SE4A 2B39A 1EY8A 1CK1A 1X32A 5IGFA 3I4LA 3EJIA 3S14B 3CHBD 1TS2A 1V43A 1B1ZA 4NW2A 5G3LD 3BYTB 1QG7A 5CBAE 2F3WA 1TS5A 2EE1A 4XTCS 1SJHD 3OMCA 2I46A 5C4ZA 2AUJD 4BBSB 4ILWA 4RAUC 2A69D 3GTQB 1EZ8A 5DNFA 4L8JA 3QO2A 4EQPA 2D62A 5M5XB 1HHVA 2F0LA 1Q12A 1EQVA 2F0NA 4IALA 1S5DD 2LMCB 3S1RB 4P2CB 1M4VA 3J7AV 1PDQA 1BUVT 2R61A 2BDNA 4HMIA 3R2TA 3V05A 2LKVA 2F0KA 3T16A 3O13A 4XYOA 2MGSA 3MFYA 2VUMB 1I4RA 5EJWA 3M7NA 1ZYRD 1EL0A 1DZ1A 3VYUA 4ME5A 1NR4A 1TVXA 4A3JB 1FNWA 4DFAA 3NBHA 2F0UA 1BO0A 2F0SA 1Y1VB 4NDXA 1PYWD 1TQOA 5M5YB 1DCZA 3K5OA 2C9OA 3DWAA 3DXJC 2NN6G 2YU9B 1MSHA 1FNUA 4FF1A 2ID0A 5JEAG 4BY1B 1SJED 2EY6A 1SNOA 1HTLD 2PCFB 2X69A 4C1NK 5JVH3 1AW7A 2AQ1B 4B08A 1Q3LA 1HUMA 5KEEA 5NUCA 3NTKA 3SEBA 3GP7A 2EJGC 2JP1A 3Q0AA 3QG1A 1JICA 4CJ2C 2A5HA 1WTOA 5D3DA 2B2TC 4ZLTF 3J81E 4PQXA 1KDCA 4KY6A 3QOLA 1CQVA 4C3IG 4KKSA 5E3FA 5I6WA 1LTBD 5C3XA 3KBGA 1PTOF 1I4HA 1DOMA 4XYQA 3MXGA 3QIAA 3I91A 4KI0A 1BCPD 5CV9A 1SMYC 1F9RA 1WD0A 4Q0FA 1SNMA 4A3GB 1CA6A 2KEDA 4ID6A 2LFNA 1QILA 5KNDA 2SEBD 3A54A 2A68D 1QCBD 3SDZA 5FLXE 5C44B 5D14A 4OIJA 2KQ3A 4EQOA 1GUTA 2R93B 5C3WA 3NBIA 3LWEA 2BA0A 3OMGA 1FNVA 2AQ2B 2A74C 3R8BA 2HQEA 2Z4IA 2Z8LA 1Y8PB 2JXMB 4DAYA 3SXHA 3TMEA 1JWUD 5CR3A 1BR9A 1I4QA 1YNNC 3NXWA 5KIXA 1RKNA 4IQZA 1KAAA 1CI3M 1V1OA 4G7ZC 2B2UA 1S5CD 5KYIA 4OO1G 3MZ5A 2AWNA 2K03A 2NBFA 5I2XA 3VR2A 3C1FA 5BN4A 1VMPA 3A55A 1ZKOA 2HDLA 5EPKA 3F2UA 4OIKA 4MHEA 3W2DA 1PRTB 2E2DC 4K6LA 1GUSA 4XDXA 1R9TB 2EPBA 2WAQB 2F0WA 2RVLA 1G6ZA 1IYVA 1Q1BA 5DEHA 1RDPD 4K2LA 5C0XH 1SAPA 1NR2A 4LK1C 4Z9CB 1H9RA 5D3IB 2PPBC 4HEDA 4ZAIA 3TP5A 4S3SA 5IGDA 5J22A 3V2TA 4LAAA 5A2QL 1AEXA 2EJMA 2F0HA 3BYYB 2Q8TA 3E6ZX 4FF4A 5KNCA 4FF3A 1WTXA 2L4NA 3FPUB 3NTHA 5LL6X 1JC7A 4IUNA 5IIFA 5EBDA 2JE6I 1GUNA 1F9PA 3SK4A 3S15B 1X3PA 5ISRA 3A56A 4IFDG 3JAML 2IT1A 1HXYD 3H0GB 1SSOA 2FMMA 3U9OA 1S5ED 5IGCA 3X3MA 4TRDA 4F87A 3BS1A 4XIGS 1SBBB 2K5WA 3EVQA 1CT1D 1HCZA 3MWYW 3H09A 1JOKA 1A3UA 1F9QA 1JCKB 4DAPA 3P1HA 4WFN3 1PFNA 1AZPA 5DAUA 4B9XA 5I2YA 1BF4A 1E0BA 4J8QA 2J4XA 3Q23A 2VB2X 1EYCA 3TBIB 4EGVA 4QUFA 1PFMA 1CA5A 1OO9B 2K1BA 2F0OA 2B2YA 2PZWA 3I70A 3S2HB 1XXGA 4IN3A 4L63B 4OHJA 5C4HA 3VYRA 3TZDA 2PZUA 2PW7A 1MSGA 2ZXRA 2HUGA 1R4QB 5M9OA 4ZQ3A 1KDBA 1STBA 3R93A 1TWCB 4CKCA 4TQUS 3RUZA 1QE6A 1LTAD 4C2MB 3FKIB 4C56C 1I50B 2QCPX 1CM9A 2B2UC 1VMCA 4ZYSA 1ML0D 4DAVA 2L9HA 4K8IA 4RFBA 5EKLA 2NN6H 5JEAH 5DM73 4A3EB 2RSNA 3I8ZA 3P75A 3GTPB 1C4QA 1TWAB 4CKBA 5TSSA 2MP1A 1E2ZA 1II3A 4X3UA 1HQRD 3L3OC 3PUVA 1V1PA 2L0CA 2EY2A 5C0XJ 1QB5D 2WINB 3E5SA 3IKJA 1LTGD 5EGTA 2PYKA 5CYUA 3GO5A 3GTOB 4K5XA 2EYFA 3OOCA 3GTMB 3CRKC 4HR7B 3SK8A 5A2QE 2XN9C 3VA7A 2QEJC 2R3ZA 3BVZA 1AZQA 3WOEA 3TN2A 3K5MA 2XWBB 5I9PA 3AB9A 1UUPA 2O5IC 1SYCA 4FF2A 3U9SA 4F8MA 1EIHA 4EVOA 5C0XG 3VYSA 4R9WA 1IW7C 1G2TA 5COYA 5ELCA 3W3AA 5I6YA 2MUYA 2L1BA 2AUKA 3JAME 4XQQA 1PTOC 1TR5A 4UDUC 2A6HC 2E2JB 3X3NA 2KA7A 1QWYA 4DK0A 2CW0D 3PV0A 2Q8IB 2F0EA 4G57A 3NQIA 1AN8A 3KK7A 1EIGA 1F2ZA 3NK9A 3URYA 3HRZC 2MHVA 1QNUA 1U9RA 3ND8A 2NTTA 2JA6B 1EEFD 1RF2D 2E75C 3GV3A 4OO1H 4HTHA 2IX0A 1G2SA 4DA2A 1A6XA 1EZ6A 5CC4A 4WJWA 2FHTA 1Y69U 3P7JA 1XYIA 1K8MA 1G291 1GHKA 3PUWA 3P20A 4O42A 2SOBA 4XXEA 1IKMA 1KNAA 2D9UA 2O5JC 3BVGA 3TDQA 2NVXB 2B8FA 3NWTA 1CTMA 1Z7TA 4KKUA 5FK9C 1GUOA 3TP8A 2B2YC 3J7AF 1ESFA 1Z6HA 1CQFA 1SYEA 1QOHA 1H9MA 2E2IB 1Q90A 2L5TA 2R92B 3H91A 1BNZA 4H7BA 4CJ1B 4HN7A 5M3MB 3KUPA 3RZOB 4KD3A 4RA8A 5JPNC 1TIID 1ENCA 4TSSA 5JEAJ 1QJOA 2NN6I 2JA8B 1ZXTA 2WACA 3T13A 2CHBD 3AMUA 3KLSX 1FGBD 3PMFA 2RA4A 1OXSC 4FO2A 4PNYA 3K5LA 4H13C 1KNEA 1S5BD 4U673 2GA4B 1EY9A 5LL6S 4IFDH 4J1MA 5EBCA 1H9SB 1G8ZD 3TZUA 1X3QA 5BN5A 2JA7B 5KNBA 2WKCA 2PNRC 1WTPA 3D8GA 3OIPA 2K04A 2IW3A 1ET9A 5CBEE 1OXUA 2DY8A 3S1QB 4A93B 1RODA 4BS9A 4MN3A 1SMYD 3I90A 2WV6D 1DOKA 4KD4A 3D3RA 3FDTA 1B9MA 3ONAB 4AYBB 2B63B 2EJFC 3E0JA 2OEOA 3MFGA 4DXGA 3PUXA 2FINB 1SYFA 4V0BA 3J80L 3HZXA 4DK1A 1ENFA 4L6TB 3GV6A 4C3JG 1VF5C 3HOUB 3J7YW 5D65A 5FO8B 1O78A 1F2LA 4FXDA 1STEA 1UEAB 4A3MB 4FNFA 1YNND 1EY0A 1HA6A 4KKTA 4LMQD 1NCVA 1LTSD 4OO1I 3OPOA 5FOBB 1IYUA 5KRUA 2O2LD 2JEBI 1JE4A 5ELFA 2N55A 4WRDA 2R7ZB 5EPLA 5JAVA 4ZKBB 1FD7D 3D4RA 1HTPA 1CFMA 1M8AA 4KN4C 5C5MA 4ZKCB 5CV5A 3H94A 2OT2A 5EPJA 3Q6SA 5C3EB 2JSOA 1PRTF 1DYQA 4KY5A 3HOVB 2Z4HA 3G6JB 3S1MB 4A3KB 2SNSA 2WKDA 2KCNA 1KABA 3TSSA 1RTOA 4KV6A 1B2TA 2L55A 3S17B 3OWFA 3GQBA 2K6AA 2SNMA 1IL8A 3BDLA 2NUCA 2F0DA 1LTTD 2DY7A 3PUYA 5IGBA 3S9WA 1ILPA 3HKZB 2K05A 4NP5A 2EYJA 4C3HB 3A7AB 1A3VA 1NSNS 1O7ZA 1JB3A 1IKLA 1I4PA 1WD1A 2O4XA 5G3LF 1LT5D 4IFDJ 3VR5A 1O80A 1EY4A 4IFDI 1TS3A 5ELEA 4QB4A 1B44D 2H1EA 2NVQB 2Q8RE 2D2CC 2ZT9C 3D6WA 1ENAA 3V96A 1NUCA 1Z47A 4LJZC 3K0YA 2K33A 1LTRD 2FFKB 4DU9A 3SK6A 1ONLA 3OIQA 5CGKA 3MXNA 3M4OB 3NPPA 2F4IA 2KVMA 3L7ZC 4BY7B 4KHVA 1GUWA 3KF8A 3NTIA 1SFOB 1KLGD 4A3FB 3DWQA 3R3OA 4U68A 2IJ0A 3J80E 1SE2A 1U4LA 2Z1CA 1WTVA 4PV1C 3RLFA 4KTAA 2KECA 3DM1A 1PLFA 1SNPA 2BCOA 5T1GA 1FR3A 4CGYB 4ZUJA 3VR4A 3C1EA 1A2UA 2IX1A 4Y7NB 2G9HD 4K8JA 4NMZA 2IPKD 3OW7A 2HCIA 2G9DA 4GZYC 1E2VA 2IL8A 4K6DA 3HEJA 3VR3A 1HRJA 1EY5A 4KJNA 2JYOA 3A8IE 5LHY1 5IGEA 1GHJA 3SVMA 5EKIA 1BCPB 1U4PA 1WTWA 1U4RA 1RD9D 1H9KA 2BE5C 2F0PA 1DOLA 2KOLA 1OXXK 1YNJC 4BA1I 2ZXPA 1EU4A 4F88A 2KCCA 5CV8A 1BBXC 1LTID 4B9WA 4X3TA 1PZID 4RH6A 4HMJA 4QMGA 3M7GA 1F77A 1ICWA 3BG3A 3S1NB 1ILQA 4HSVA 4F7XA 4OL7A 4KK7A 4N9TA 2I07B 1CZWA 2KEEA 3NP8A 4XT1B 1LACA 4KN7C 4A3DB 3MAQA 4NKLA 4QCLA 5C0XI 2ICIA 5EQ0A 2IWHA 5I9OA 1Q8IA 2F0GA 4FYDA 3M85A 3S2DB 3SK5A 1SYBA 1IW7D 3M3YB 4C3JB 3MEHA 2A6EC 1D6EC 2LY7A 3I72A 1A15A 2RQXA 3WOFA 1JQYD 1SNCA 4FVMA 1PTOD 5C4XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNW A;  1LT5 D;  1CHQ D;  1GOZ A;  1JWU D;  1STE A;  4TSS A;  1JR0 D;  4UDU C;  1I4Q A;  1PYW D;  4DXF A;  3MC0 B;  1LTA D;  4C56 C;  1LO5 D;  1T5X D;  2TSS A;  4RGN A;  4ZYS A;  5I4D A;  1CHP D;  2QIL A;  1TS3 A;  3DWA A;  1FNU A;  3BVM A;  5ELE A;  1I4G A;  2CHB D;  4RGM A;  2NTS A;  1LTS D;  1V1O A;  1KTK A;  1AN8 A;  1FGB D;  1LLR D;  1S5C D;  3KLS X;  1SJE D;  1B44 D;  1TS4 A;  5ELD A;  1HTL D;  1MD2 D;  1XTC D;  1HXY D;  3URY A;  4RFB A;  1D5X C;  1S5B D;  2O2L D;  5ELF A;  1AW7 A;  2AQ1 B;  1EFI D;  1BCP B;  1LT4 D;  1S5E D;  2NTT A;  1RD9 D;  1SE4 A;  1EEF D;  1RF2 D;  1UNS A;  3SEB A;  3GP7 A;  1CK1 A;  1TY0 A;  1LT3 D;  1FD7 D;  1EEI D;  1JWM D;  1D5M C;  1G8Z D;  1SBB B;  3EA6 A;  1LTR D;  5TSS A;  3W2D A;  1CT1 D;  1PTO B;  1PRT B;  1EU4 A;  3CHB D;  1HQR D;  1BCP F;  3R2I A;  1TS2 A;  5D3D A;  1B1Z A;  1V1P A;  2XNA C;  1JWS D;  1JCK B;  4K6L A;  1LTI D;  3BYT B;  1CQV A;  1ET9 A;  1PZI D;  4RH6 A;  4RGT A;  1TS5 A;  1LTB D;  1ET6 A;  1LTG D;  1F77 A;  1SJH D;  1PTO F;  1PZK D;  1I4H A;  1PRT F;  1DYQ A;  1KLG D;  1PTO H;  1I4X A;  2J4X A;  4RGO S;  3BVG A;  4RHS A;  3DWQ A;  1BCP C;  1BCP D;  3EFX D;  2IJ0 A;  1RDP D;  1L0Y B;  2AQ3 B;  3TSS A;  2XN9 C;  1SE2 A;  5FK9 C;  2WV6 D;  1RCV D;  1SXT A;  2QEJ C;  4O1N A;  3BVZ A;  1ESF A;  1UUP A;  2XRS D;  4Z9C B;  1TY2 A;  1QIL A;  1KLU D;  2RDH A;  5D3I B;  1V1P B;  1S5D D;  2SEB D;  2XRQ D;  3BZD B;  1S5F D;  1XXG A;  5ELB A;  3MFG A;  1M4V A;  2ICI A;  4DXG A;  2R61 A;  1LTT D;  4L63 B;  1EU3 A;  4BWG B;  4OHJ A;  3R2T A;  3V05 A;  4RHR A;  1SEB D;  1DJR D;  4RCO A;  1EWC A;  3O13 A;  1HA5 A;  1SE3 A;  1LT6 D;  2G9H D;  1ENF A;  1FNV A;  5FKA C;  2AQ2 B;  1D6E C;  2RDG A;  3OWE B;  1BXT A;  3BYY B;  2IPK D;  1I4R A;  5ELC A;  3R8B A;  4L6T B;  1D5Z C;  1I4P A;  1L0X B;  1JQY D;  2Z8L A;  3DWP A;  1PTO C;  1PZJ D;  1PTO D;  1PRT C;  1PRT D; 
#chains in the Genus database with same CATH topology
 3A7L A;  3GTO H;  3S2D H;  3HS0 C;  1JR0 D;  2A6H D;  3A5Z B;  4C3J H;  1EFW A;  3GTM H;  4KHZ A;  2K5Q A;  2E76 C;  3N6R A;  1CHP D;  1BBU A;  3MTS A;  5AJ3 L;  3BVM A;  2E74 C;  3HG9 A;  1IHZ A;  1KTK A;  3GD7 A;  1WCM B;  4JK1 C;  3H3V C;  3G4S A;  1VQP A;  3JAM i;  2PQA A;  1M90 C;  1DM0 B;  1D5X C;  4B3T Q;  1A3T A;  3HKZ G;  3CQZ B;  4C3H G;  1YHQ A;  3PIP 3;  1B50 A;  3C2P A;  4CKE A;  1K0R A;  2E2H B;  4J6H A;  1LT3 D;  4IUP A;  3DEP A;  1JWM D;  3NBH B;  5F2D A;  2SDF A;  1HUN A;  3A74 A;  2F4V L;  1KC8 C;  3RD4 A;  4PZ8 A;  1O7L A;  2XNA C;  1I94 Q;  5EKK A;  2PMZ B;  4UAI A;  5IP7 G;  2EY5 A;  3CQZ H;  5IYD G;  4K14 A;  5J1Z A;  3K5N A;  5C6A A;  2DNC A;  2H4O A;  1XPR A;  2E2J H;  1VQ8 A;  4A3B G;  1H9J A;  1W6J A;  1ET6 A;  4LF5 L;  3ULP A;  2PZT A;  2A8V A;  1XMQ L;  2IX3 A;  1SND A;  1STG A;  4IUQ A;  3FEW X;  5HGT A;  2AQ3 B;  1NMG A;  1SXT A;  4RKL A;  1IBM Q;  3ZYY X;  3FVQ A;  3H6M A;  4XT3 B;  1V8Q A;  1EY7 A;  2B2V A;  4HAE A;  4DR1 L;  2JA6 H;  1B3A A;  2B8G A;  4HSP A;  2F3V A;  5CV4 A;  3I3C A;  3STB C;  1E24 A;  2FMC A;  1DJR D;  4G7H C;  1A62 A;  1HQM C;  3L9A X;  1VDZ A;  1STA A;  1G6P A;  2OF1 A;  5FLX c;  2DN8 A;  4BY7 G;  2K01 A;  4JI1 L;  3TRZ A;  1X9N A;  1C8C A;  4A3F G;  1D1K A;  3CCE A;  3K6O A;  3FHW A;  1UWV A;  1PRT C;  2AWO A;  1DD2 A;  4NXM Q;  4ZUI A;  3ULJ A;  4LF6 L;  3DM3 A;  4JI4 Q;  3T53 B;  1L0W A;  3D31 A;  3I73 A;  3LWU A;  3PIO 3;  2EXZ A;  5IE8 A;  2VNU D;  1T5X D;  3C46 A;  1F9S A;  1UE1 A;  4K5W A;  2NB0 A;  5FO7 B;  4DR3 L;  5COR A;  3DMU A;  3HOW G;  3NWS A;  1XTC D;  1YNX A;  2QGQ A;  3T4A C;  2RBM A;  1HNW Q;  2F03 A;  2B2W C;  2LS0 1;  2K28 A;  2VQF Q;  5FO9 B;  2FJ2 A;  4JI7 L;  3RMH A;  2R92 H;  3RN5 A;  2UU9 L;  4YHH Q;  2K7V A;  3K0X A;  4DAY B;  4FP5 D;  1CSQ A;  5K36 G;  3N52 A;  1R4P B;  3HGB A;  2WFW A;  4PMB A;  1AFP A;  4GKJ L;  2QDB A;  2PQE A;  1N9W A;  1L1O C;  2VB3 X;  1ESR A;  5A35 A;  3NSW A;  3E3X A;  4HJ8 A;  3FP9 A;  4JI3 L;  1K9M C;  4AIM A;  4OXP A;  2JA8 H;  5CMD A;  4RGO S;  3ND9 A;  4BA2 I;  1XJV A;  2EVB A;  5HUR A;  2A69 C;  4O1N A;  1RCV D;  1ZEQ X;  5DM6 3;  1G51 A;  3CME A;  5JOB A;  3T56 B;  5CV7 A;  1JB7 A;  4E6I A;  2HT1 A;  1C48 A;  1X56 A;  3IFD A;  1STY A;  4FXK C;  1A0I A;  1GJX A;  3NQT A;  4X3K A;  1EQT A;  2WP8 J;  2XVS A;  3AU7 A;  1EU3 A;  5E1F A;  1EWC A;  1VQ5 A;  5E7N A;  4R4O A;  2GVA A;  5FKA C;  4DV1 L;  1EYD A;  3OWE B;  2ENB A;  3KF6 B;  1ZYR C;  1BDO A;  3OSO A;  1PZJ D;  4DGZ A;  3ULL A;  1TWH B;  4IZ8 A;  3UI2 A;  3M4P A;  2MO0 A;  3CRL C;  1B7Y B;  2HDM A;  5IY0 A;  5IT9 E;  1I6H B;  2VW9 A;  1MGS A;  4R4T A;  4KY7 A;  4DR6 Q;  4DF7 A;  4A3I B;  1LO5 D;  3GDE A;  1BOS A;  4M1U B;  1BBW A;  4LNQ A;  4A3D G;  4TKO B;  3GTG B;  2QIL A;  5J39 A;  4JI0 Q;  1PYS B;  2PO4 A;  2L11 A;  1I4G A;  3GTJ B;  3BZC A;  3HOZ B;  2K32 A;  2Z6B A;  5ELD A;  3WDN A;  1E2W A;  4OON A;  3F8T A;  4KHP L;  3NUC A;  2KHI A;  4A3I H;  2P5Z X;  4P74 A;  3OTO L;  3S16 B;  3GTG H;  4IUR A;  1F2Y A;  1HFG A;  3A8K E;  1SYG A;  1NY4 A;  3EA6 A;  1KRS A;  5C4X G;  2KUM A;  2RF4 A;  4X64 Q;  3HOZ H;  1PTO B;  1NE3 A;  2F0M A;  2V1C C;  4QIW E;  3NHH A;  2NZ1 D;  4BBR G;  3HP3 A;  3OYY A;  3TP6 A;  1JOQ A;  1NAP A;  1Z9F A;  4ZCK A;  1XPU A;  1UAP A;  4WOR A;  4N9P A;  3J80 c;  3IAY A;  3PO3 B;  3K7A B;  2Q2H A;  1HJP A;  3D4D A;  3S16 H;  4A3M H;  1XNQ L;  1WCM G;  4GNX B;  3F1Z A;  4KMU C;  5KYL A;  2VS1 A;  1A2T A;  1T5E A;  1PTO H;  1RJT A;  1VQ7 A;  5ELO A;  2RKS A;  1BCP C;  3CU7 A;  3FMC A;  5LMN L;  2KJX A;  2HCC A;  4Q5V A;  1L0Y B;  2CQA A;  5C4J B;  3CCU A;  1HNX L;  3I4N G;  1TU2 B;  2UXB Q;  2AHO B;  1S4Z A;  1TXY A;  1DXM A;  4JBW A;  2B2V C;  2MNA A;  1QZG A;  3PO3 H;  1DGS A;  3K80 C;  2DUD A;  2XRS D;  1HR0 Q;  4NPS A;  4JI6 Q;  4K5V A;  3E9I A;  4JV5 Q;  2NYZ D;  2UUA L;  4ULL A;  2A68 C;  3H15 A;  2DNE A;  5ELB A;  3VA5 A;  4LFB Q;  3IL8 A;  4OEL B;  4LWC A;  4BWG B;  4RHR A;  4DN4 M;  3EQL C;  3FPP A;  1HA5 A;  3HOY B;  5IYB G;  3QJY A;  1D2B A;  1LT6 D;  2BOS A;  5IYC H;  1FYC A;  4O2D A;  4MIU A;  4LF7 L;  1MHW C;  2QKI C;  4JYA L;  5C3E H;  4B3T L;  3SR1 A;  1GXD C;  2ZJR A;  1H9S A;  5M3F B;  1SDF A;  1CUK A;  1JOO A;  1W6K A;  5GAD C;  3HOX B;  1CHQ D;  4I65 A;  2F0V A;  5JJK A;  2MJ8 A;  3MC0 B;  1HR0 W;  1CZG A;  4A3K H;  4OGQ C;  4K2K A;  2EYM A;  2C5C A;  3LX0 A;  2Q2I A;  4ALP A;  1LLR D;  5IP9 G;  3A5U A;  4UP7 A;  3MXP A;  1PMR A;  4X66 L;  2Y0S E;  1JOR A;  1EQR A;  2D5D A;  2J0T D;  1Y1W B;  1K8O A;  1A8V A;  1X3E A;  2F0Q A;  1N32 Q;  4O0A A;  1TY0 A;  1PFB A;  3PUZ A;  1D5M C;  4I7Z C;  3MXU A;  3QOJ A;  4C3H H;  1WTR A;  2CKZ B;  4A3B B;  1BVS A;  4OEM B;  2M00 A;  1JWS D;  1IL2 A;  2PW5 A;  1J9O A;  1GUG A;  2WB1 E;  4R8N A;  1I3Q B;  5GRO A;  3VYT A;  4CBV A;  3CCJ A;  1STN A;  1NTG A;  5IOC A;  4XQN A;  1SNQ A;  1VF7 A;  3T51 B;  4KJO A;  4DR2 Q;  5IYD H;  5IGG A;  1HPC A;  1WTQ A;  4RHS A;  4AQY Q;  1I6V C;  4A3B H;  2NVQ H;  4LF9 Q;  1Y14 B;  2RDF A;  4DV3 Q;  1B3Q A;  4CDE C;  1I3Q H;  4RCN A;  4BBS G;  2X6L A;  3IRB A;  4ZK9 B;  4NXM L;  1MI2 A;  2RDH A;  1M1K C;  2R6G A;  1B53 A;  4DV4 Q;  4IJL A;  1V1P B;  4GLV B;  2XRQ D;  4JI4 L;  1S5F D;  4ODG A;  4DNR B;  3DUZ A;  3F2B A;  4LF8 L;  3K59 A;  2NVT B;  2K5V A;  4IUV A;  1SEB D;  3D6C A;  3J80 i;  3M4Q A;  2L12 A;  3D0F A;  4XQJ A;  1D1I A;  3M4O H;  1WVL A;  2RHQ B;  2RCN A;  4IPG A;  3LNN A;  1D5Z C;  3M4Y A;  1U4M A;  1HNW L;  1L0X B;  4L5T A;  5E4X A;  1K8G A;  3VR6 A;  3MA2 B;  4BY7 H;  3ERQ A;  3BDO A;  4IPC A;  1GOZ A;  1B9N A;  1BQQ T;  4DXF A;  4A3F H;  2NVY B;  4H44 C;  3HOW B;  4YY3 Q;  2TSS A;  2ZTD A;  4A3J G;  4RWS C;  4JI2 L;  1RTN A;  5I4D A;  3K58 A;  2ZXO A;  4JI8 Q;  4QF4 A;  1Y1V G;  2NTS A;  1YVC A;  3CW2 C;  3SHL A;  4CJ0 B;  4HCE A;  1CKM A;  4QIW B;  1X3F A;  5JPM C;  4N8X 1;  4UHV A;  1EQQ A;  3SE0 A;  2RSO A;  3J81 j;  1L2F A;  2NVY H;  4RKB A;  1STH A;  3U58 A;  1VCI A;  3HOW H;  1K0S A;  2BDO A;  3Q22 A;  4HCS A;  1LAB A;  3W5O A;  1YIT A;  1PH1 A;  2BE5 D;  4LFA Q;  1YNJ D;  2A73 B;  2UXC L;  1KDA A;  5HY6 A;  1BCP F;  2EYL A;  2WII B;  2XWJ B;  3R2I A;  1QVG A;  2HIX A;  4A3I G;  1VQG A;  3KLR A;  1KXL A;  2F0T A;  3ERS X;  1EWH A;  2TMP A;  2V4D A;  4HJ9 A;  5K36 H;  2MO1 A;  4X3S A;  5C5L A;  3HOZ G;  5CV6 A;  2F0F A;  2IHE A;  3C3L A;  1HFN A;  2F1M A;  1PZK D;  4M8A A;  4DNT B;  2CWP A;  2B2W A;  2J7Z A;  3F2D A;  1I4X A;  3KYH C;  2X6G A;  3I4M B;  5LMU Q;  4ZRZ A;  1DON A;  4A3C G;  3EFX D;  2JEA I;  5IOD A;  2B29 A;  2JJQ A;  1IXR A;  3DEO A;  2OTL A;  2PI2 E;  3OHX C;  2BH8 A;  1VQF A;  1OXT A;  4C1N I;  3CC7 A;  5JVG 3;  4POG A;  4GOP B;  4CHT B;  1HZ9 A;  2B3G A;  2L15 A;  1C7Y A;  1TY2 A;  3ER0 A;  2QF7 A;  1S3O A;  4DKA C;  3K57 A;  4ABN A;  1MBY A;  4P71 A;  3I4M H;  3Q24 A;  2EZV A;  2LXJ A;  3IFT A;  1X65 A;  1F2M A;  1PXU A;  4RCO A;  4JI0 L;  2EYP A;  1LUZ A;  2FXQ A;  1SE3 A;  5E4W C;  2A6E D;  4V19 0;  2E5L Q;  1BXT A;  2OXP A;  3RZD B;  2ICE C;  2R93 G;  1W2B A;  1O7Y A;  4QY7 A;  1EY6 A;  1G91 A;  3CKI B;  3ZJY C;  2HHH Q;  2A19 A;  3DWP A;  4EQN A;  1U5K A;  2F52 A;  3MHB A;  3SGI A;  2Y0S B;  3T1H Q;  4QUC A;  2CVR A;  3S1N H;  3KLS A;  3PGZ A;  1JE5 A;  4X64 L;  1Q1E A;  4RGM A;  4C3I B;  3A8J E;  1N36 Q;  1SYD A;  5BN3 A;  3AEV A;  3G7L A;  1TS4 A;  4DV7 L;  1E7Z A;  1Y8N B;  1XWE A;  4GLA C;  2JA5 B;  2BA1 A;  4YWK A;  3HOY G;  1D7Q A;  1EFI D;  1LT4 D;  4PMC A;  2WB1 B;  1QUQ A;  5GQO A;  1LV9 A;  1UNS A;  2F0J A;  4BBR B;  4EX5 A;  4IUU A;  3M3Y H;  3MVV A;  1EOT A;  1EEI D;  1RHP A;  4KLK A;  5K5P A;  5M3F G;  1P8L A;  1VQI A;  2OWO A;  2DGY A;  4GKK Q;  1HH2 P;  1J8I A;  3HOX G;  4JPB W;  2UXB L;  5KGU A;  3T1Y Q;  2M2L A;  4B3R Q;  2XSC A;  2JA5 H;  2EDG A;  2YYZ A;  1PA6 A;  1WFQ A;  5T1I A;  5C4X H;  1EIF A;  1XTD A;  1Y8O B;  4JV5 L;  2AKW B;  2B2T A;  3GTK B;  2K5D A;  1AP0 A;  4RGT A;  2XIW A;  4BBR H;  1EYA A;  1VQA A;  2CH4 A;  3ERO A;  2JN4 A;  1K83 B;  5IT9 L;  1IBK Q;  2LSS A;  3J7A 5;  3I4N B;  3TP7 A;  1VQB A;  4JOI C;  4YWM A;  3BDC A;  2VQE Q;  5AFW A;  1Y1W G;  4JBM A;  1CKN B;  1WCM H;  3BZK A;  4R8I A;  1J5E Q;  3J81 L;  4AYB E;  4DK6 C;  2EYH A;  3GTK H;  5LMN W;  4NB3 A;  4DUZ L;  4GS3 A;  1TKW B;  4G4K A;  1PH8 A;  3QB3 A;  1TT2 A;  3KFU A;  1K83 H;  1KLU D;  2VY3 A;  4FXG C;  4DR7 Q;  4X65 Q;  3BZD B;  1XX8 A;  3I4N H;  2E2H H;  1TWG B;  5GAG C;  3STB D;  1TWF B;  4R4Q A;  3PIP A;  3CCV A;  5M5W B;  1B4O A;  1LYL A;  4DV5 L;  1QNK A;  2EYO A;  4GNX C;  3PO2 B;  4G7O C;  4L5Q A;  2EOT A;  2RDG A;  3NEM A;  2EY1 A;  3QWN A;  2N88 A;  4YIJ A;  5EAY A;  1YJW A;  3GTL B;  3RNU A;  2NWG A;  5IYB H;  1PRT D;  4A4I A;  1EUJ A;  2MPM A;  5FLX L;  1TWF H;  3DHQ A;  2KHS A;  2QEX A;  1PV4 A;  2M9V A;  3ITP A;  4IUT A;  2CW0 C;  2F0I A;  2OQ0 A;  4RGN A;  1K28 A;  3S24 A;  1OXV A;  1MJE A;  4H0L C;  3KBX A;  3FRP B;  1U0L A;  4DV6 L;  4PMW A;  2F3I A;  4YWL A;  1PH3 A;  3GTL H;  1MD2 D;  2VXW A;  3NE5 B;  5JJZ A;  2MFI A;  1IBL Q;  3D4W A;  2CWA A;  5IP9 H;  1SE4 A;  2B39 A;  1EY8 A;  3H0G G;  1CK1 A;  1X32 A;  4MZ9 A;  1B8A A;  5IGF A;  1PVO A;  3I4L A;  1YJ9 A;  3EJI A;  4LF9 L;  3S14 B;  3CHB D;  4B3S Q;  1TS2 A;  1V43 A;  1B1Z A;  4NXN Q;  4DUY Q;  4NW2 A;  5G3L D;  3BYT B;  1QVC A;  1N33 Q;  4JI5 Q;  1QG7 A;  2UUB Q;  5CBA E;  2F3W A;  1TS5 A;  2EE1 A;  4IJH A;  4XTC S;  1SJH D;  3OMC A;  3CCR A;  2I46 A;  5C4Z A;  2AUJ D;  4BBS B;  4ILW A;  3PIO A;  4RAU C;  2A69 D;  3GTQ B;  1EZ8 A;  5DNF A;  4L8J A;  3QO2 A;  4EQP A;  2D62 A;  5M5X B;  1HHV A;  2F0L A;  5J3B A;  1Q12 A;  2WAQ E;  3M9B A;  1EQV A;  3RLO A;  2F0N A;  4IAL A;  1S5D D;  4JVZ A;  2LMC B;  3S1R B;  1KRT A;  4P2C B;  1M4V A;  3J7A V;  1PDQ A;  1BUV T;  2R61 A;  2BDN A;  5IWA L;  4HMI A;  3R2T A;  3V05 A;  4YY3 L;  4BBS H;  2LKV A;  2F0K A;  3T16 A;  3O13 A;  4XYO A;  2MGS A;  1N34 Q;  3MFY A;  4Y52 H;  4DR5 Q;  1YIJ A;  1ASY A;  2VUM B;  1I4R A;  5EJW A;  3M7N A;  1ZYR D;  1EL0 A;  2C35 B;  1DZ1 A;  3VYU A;  3I4M G;  4ME5 A;  1NR4 A;  1TVX A;  4A3J B;  3AYH B;  1AE3 A;  1IZ6 A;  1FNW A;  4DFA A;  3NBH A;  1NNX A;  3TS2 A;  2F0U A;  1BO0 A;  2F0S A;  4OWX B;  1Y1V B;  4NDX A;  1PYW D;  1TQO A;  5M5Y B;  2ZM6 Q;  4LFA L;  1JT8 A;  4LF4 L;  2NZH A;  1DCZ A;  3K5O A;  2C9O A;  3DWA A;  3DXJ C;  2NN6 G;  2YU9 B;  1MSH A;  1E22 A;  1FNU A;  4FF1 A;  2ID0 A;  5JEA G;  2YTX A;  3KJO A;  4BY1 B;  1SJE D;  3I56 A;  2EY6 A;  1SNO A;  1X55 A;  1HTL D;  3HFZ B;  3CXC A;  2PCF B;  4A3J H;  1SN8 A;  1NMF A;  2X69 A;  4C1N K;  5JVH 3;  4DR4 Q;  1AW7 A;  2AQ1 B;  1Y1V H;  4B08 A;  1Q3L A;  2ALY B;  5FLM G;  2OTJ A;  1HUM A;  5KEE A;  5NUC A;  3NTK A;  3SEB A;  3GP7 A;  2UUC Q;  2EJG C;  1K8A C;  4LFC Q;  1FJG L;  2JP1 A;  2N3S A;  3Q0A A;  4A3E G;  3QG1 A;  2ASB A;  1JIC A;  2Y0S G;  4CJ2 C;  4HIO A;  2A5H A;  1WTO A;  5D3D A;  2B2T C;  4ZLT F;  3J81 E;  4PQX A;  3TQY A;  1KDC A;  4KY6 A;  3QOL A;  1TWH H;  1CQV A;  4C3I G;  1I6H H;  4KKS A;  5E3F A;  4K0K Q;  3B6Y A;  5I6W A;  1LTB D;  5C3X A;  3KBG A;  1PTO F;  2Z0S A;  1I4H A;  1DOM A;  1XMO L;  4XYQ A;  3MXG A;  3QIA A;  3I91 A;  2JQO A;  2JA5 G;  4KI0 A;  1BCP D;  5CV9 A;  1SMY C;  2WB1 G;  2YTY A;  3GTJ H;  1V9P A;  1QVF A;  3EIV A;  1F9R A;  1WD0 A;  4Q0F A;  1SNM A;  4A3G B;  4N8F A;  1CA6 A;  2XTI A;  2KED A;  4ID6 A;  2HHH L;  3JC6 6;  2LFN A;  3MXN B;  4A3C H;  1QIL A;  5KND A;  1RL2 A;  4LUO A;  2SEB D;  3H3V H;  3A54 A;  2A68 D;  4IOA A;  1QCB D;  3SDZ A;  5FLX E;  5C44 B;  5D14 A;  4OIJ A;  2KQ3 A;  4EQO A;  1GUT A;  2R93 B;  3E9H A;  5FJ8 G;  5C3W A;  3NBI A;  1D8L A;  3LWE A;  2BA0 A;  3OMG A;  4MTK A;  1FNV A;  2AQ2 B;  2A74 C;  3KF8 B;  3UE1 A;  1P16 A;  3QR8 A;  3R8B A;  3PF5 A;  2HQE A;  2Z4I A;  2Z8L A;  3K7A H;  1Y8P B;  2JXM B;  4DAY A;  5C44 H;  2DJF C;  3SXH A;  3AFP A;  3TME A;  2R93 H;  1JWU D;  5CR3 A;  1BR9 A;  1I4Q A;  1YNN C;  3NXW A;  5KIX A;  1RKN A;  4P72 A;  4YCV A;  4GKK L;  4IQZ A;  5C4J H;  5AJ3 Q;  1KAA A;  1CI3 M;  1V1O A;  4G7Z C;  2B2U A;  1S5C D;  5KYI A;  4OO1 G;  4QQB X;  3UDX A;  1YBY A;  3MZ5 A;  2AWN A;  2K03 A;  2NBF A;  3PO2 G;  5I2X A;  3BJU A;  1CKO A;  1JJC B;  3VR2 A;  1IBK L;  2K5H A;  3C1F A;  5BN4 A;  1VMP A;  3CPW A;  3A55 A;  3CCQ A;  1EWI A;  1ZKO A;  2HDL A;  5EPK A;  3F2U A;  4OIK A;  3HOY H;  4MHE A;  3W2D A;  1PRT B;  1YHB A;  2E2D C;  2F4V Q;  2K50 A;  1I94 L;  1GO3 E;  4K6L A;  1Q81 C;  1T9H A;  4DR7 L;  4X65 L;  5M3F H;  1GUS A;  3HOX H;  4XDX A;  1R9T B;  2EPB A;  2WAQ B;  2F0W A;  2RVL A;  1G6Z A;  4A3L G;  1IYV A;  1Q1B A;  3KF6 A;  5DEH A;  1JJ2 A;  1HZC A;  4WJ3 M;  3CCS A;  1VQL A;  1RDP D;  4K2L A;  1GKH A;  2YTV A;  5C0X H;  1IBM L;  1SAP A;  1NR2 A;  3WWV A;  1Q86 C;  4LK1 C;  4Z9C B;  1Y1W H;  1H9R A;  4UPA A;  5D3I B;  2PPB C;  4DR1 Q;  4HED A;  4ZAI A;  5JJI A;  3KDF B;  2AMC B;  1L1O B;  4S3S A;  3TP5 A;  5IGD A;  5J22 A;  3V2T A;  4LAA A;  5A2Q L;  2I0Q A;  1AEX A;  2EJM A;  4JOI A;  2F0H A;  3BYY B;  2Q8T A;  3E6Z X;  2GVB A;  4FF4 A;  1IBL L;  3I7F A;  1XPO A;  5KNC A;  4FF3 A;  1WTX A;  1X3G A;  2L4N A;  2UXD Q;  3FPU B;  5M3M G;  2ZJQ A;  3NTH A;  5LL6 X;  1JC7 A;  4IUN A;  5IIF A;  4ME3 A;  5EBD A;  1MJC A;  2JE6 I;  1GUN A;  1K3R A;  1F9P A;  3SK4 A;  1KHI A;  4X62 Q;  3S15 B;  1X3P A;  5ISR A;  1KAW A;  3A56 A;  4IFD G;  4NXN L;  3JAM L;  4GNX A;  2IT1 A;  1HXY D;  3CMA A;  3H0G B;  1SSO A;  2JK8 A;  2IY5 B;  2FMM A;  3U9O A;  2VQF L;  1S5E D;  4EQ5 A;  2VUM G;  5IGC A;  5JJL A;  2NVT H;  2VL6 A;  3VDY A;  3X3M A;  4YHH L;  4TRD A;  5GAE C;  4F87 A;  3BS1 A;  4XIG S;  2UU9 Q;  4GN4 B;  1SBB B;  2K5W A;  3EVQ A;  3MWY W;  1CT1 D;  1HCZ A;  2PMZ E;  3H09 A;  4JCV E;  1JOK A;  3H0G H;  1A3U A;  1F9Q A;  1JCK B;  1PTO D;  4DAP A;  3P1H A;  4WFN 3;  4HJ7 A;  1PFN A;  1Q8K A;  4JC0 A;  1AZP A;  1X54 A;  1C0A A;  4BY1 G;  5DAU A;  4B9X A;  3K7U C;  2PQA B;  5I2Y A;  4R1J A;  2KCT A;  1BF4 A;  1E0B A;  2I5M X;  4JI3 Q;  1PH7 A;  3G71 A;  1IYJ B;  4J8Q A;  2J4X A;  3Q23 A;  4CDD C;  1GVP A;  2VB2 X;  1EYC A;  3TBI B;  2ZTC A;  4DR5 L;  2CCZ A;  3H3V I;  4EGV A;  4QUF A;  4A93 G;  1PFM A;  1GD7 A;  1CA5 A;  1OO9 B;  2K1B A;  2Q2T A;  2F0O A;  2B2Y A;  2PZW A;  3I70 A;  3S2H B;  2Q2U A;  1WI5 A;  1VQH A;  1XXG A;  4IN3 A;  3TEH B;  4QGU A;  4OX9 Q;  4L63 B;  4OHJ A;  5C4H A;  4AYB G;  3VYR A;  2HIV A;  3TZD A;  4DV1 Q;  1NJI C;  2PZU A;  2PW7 A;  4IPH A;  1I5F A;  1MSG A;  4IO9 A;  4X6A H;  1PHJ A;  2ZXR A;  2HUG A;  1R4Q B;  5M9O A;  2ATW A;  4ZQ3 A;  4CDC C;  1VS0 A;  4UP9 A;  1KDB A;  1STB A;  3R93 A;  1VQJ A;  1TWC B;  2UUC L;  4CKC A;  4L5R C;  2E8G A;  4A3G G;  4TQU S;  2KEN A;  3RUZ A;  4DR6 L;  4LFC L;  1QE6 A;  3PCO B;  1LTA D;  4C2M B;  3FKI B;  2DJG C;  2GN5 A;  1I50 B;  4C56 C;  2QCP X;  1CM9 A;  2B2U C;  1VMC A;  4ZYS A;  4J15 A;  1YJN A;  4PZ7 A;  1ML0 D;  3TS0 A;  5C44 G;  4DAV A;  2L9H A;  4K8I A;  3KLW A;  3UDG A;  4RFB A;  1KQS A;  5EKL A;  4B3M Q;  2NN6 H;  3EBE A;  5JEA H;  5DM7 3;  4A3E B;  3Q8D A;  2RSN A;  3CC4 A;  1YZ6 A;  1VQ6 A;  1I50 H;  3I8Z A;  3P75 A;  3RR5 A;  3GTP B;  1C4Q A;  1TWA B;  4CKB A;  5TSS A;  2MP1 A;  5FLM H;  1E2Z A;  3RZD H;  1II3 A;  4X3U A;  4MNO A;  1HQR D;  3L3O C;  1XNR Q;  3PUV A;  1V1P A;  2L0C A;  2EY2 A;  5C0X J;  3W1B A;  4A3E H;  1QB5 D;  2WIN B;  3E5S A;  3IKJ A;  1B70 B;  1XNQ Q;  1LTG D;  5EGT A;  2PYK A;  5CYU A;  3GO5 A;  3GTO B;  1TWA H;  4K5X A;  2EYF A;  3OOC A;  4UP8 A;  5H1S E;  3GTM B;  3CRK C;  4C3I H;  1JMC A;  4HR7 B;  5LMN Q;  3SK8 A;  5A2Q E;  2XN9 C;  3VA7 A;  3HKS A;  4JBK A;  1SR3 A;  5L37 A;  2QEJ C;  2R3Z A;  4PZ6 A;  3J7Z C;  3HOV G;  2OCE A;  3BVZ A;  1AZQ A;  3WOE A;  3TN2 A;  3K5M A;  2XWB B;  1Q82 C;  4LUV A;  5I9P A;  3AB9 A;  1PH4 A;  1UUP A;  4LW1 A;  1SYC A;  1HR0 L;  4JI6 L;  4FF2 A;  2O5I C;  4A75 A;  2K75 A;  3U9S A;  2UUA Q;  4LFB L;  1HZA A;  4F8M A;  1EIH A;  4EVO A;  1FVI A;  5C0X G;  3VYS A;  4R9W A;  1IW7 C;  1G2T A;  5COY A;  1YHA A;  4DV0 Q;  3RN2 A;  2WAQ G;  5ELC A;  1PH5 A;  4LF7 Q;  3F2C A;  4POF A;  5FJ8 H;  3W3A A;  5I6Y A;  4JYA Q;  2MUY A;  2L1B A;  2AUK A;  3JAM E;  4XQQ A;  3UE0 A;  1PTO C;  1TR5 A;  4UDU C;  2A6H C;  1SRO A;  2E2J B;  3X3N A;  3CD6 A;  2KA7 A;  1FL0 A;  1QWY A;  4DK0 A;  2CW0 D;  1LM0 A;  3EN2 A;  3PV0 A;  2Q8I B;  2A1A A;  5IT9 c;  4G57 A;  2F0E A;  3NQI A;  1AN8 A;  3CC2 A;  3KK7 A;  1UE6 A;  3L0O A;  4HIM A;  2QA4 A;  1K73 C;  1EIG A;  1F2Z A;  3NK9 A;  3KJP A;  1WJJ A;  2LXK A;  3URY A;  4X66 Q;  3HRZ C;  2MHV A;  1QNU A;  1X6O A;  1U9R A;  1TWG H;  3J81 c;  3ND8 A;  2NTT A;  2JA6 B;  1BKB A;  1EEF D;  1RF2 D;  2E75 C;  1N32 L;  3GV3 A;  5M5W H;  4OO1 H;  4HTH A;  1PH9 A;  2IX0 A;  1G2S A;  4I7A A;  4DA2 A;  1A6X A;  1EZ6 A;  3PO2 H;  1WTH A;  5CC4 A;  4WJW A;  2FHT A;  1VQ4 A;  1Y69 U;  3P7J A;  4GOP A;  1XYI A;  1K8M A;  1G29 1;  1GHK A;  3PUW A;  3P20 A;  2R7F A;  4O42 A;  2SOB A;  4XXE A;  1IKM A;  1KNA A;  2D9U A;  2PNH A;  4DR2 L;  2O5J C;  3LGJ A;  2BH2 A;  1PFS A;  1KIX A;  3BVG A;  3TDQ A;  2NVX B;  4AQY L;  2B8F A;  3NWT A;  1CTM A;  1WOC A;  1Z7T A;  4DV3 L;  1EYG A;  4KKU A;  5FK9 C;  4A76 A;  4CDF C;  1GUO A;  3TP8 A;  2B2Y C;  1VQE A;  3J7A F;  1E3P A;  4A3L H;  1ESF A;  2R7D A;  2UXD L;  4DV4 L;  1Z6H A;  1CQF A;  1NBW A;  1SYE A;  1QOH A;  2NVX H;  1H9M A;  2E2I B;  1Q90 A;  4LF8 Q;  2L5T A;  4X62 L;  2R92 B;  3H91 A;  4GLX A;  1BNZ A;  4H7B A;  3S14 H;  2XGT A;  4CJ1 B;  4HN7 A;  4H02 A;  5M3M B;  1SMX A;  3KUP A;  3RZO B;  4KD3 A;  4RA8 A;  5JPN C;  3G48 A;  1TII D;  1ENC A;  1EOV A;  2E2I H;  2IHF A;  4TSS A;  5JEA J;  1QJO A;  2OQK A;  3HKZ E;  2Z6K C;  2NN6 I;  2JA8 B;  4JI2 Q;  3GTQ H;  1ZXT A;  4JI8 L;  5M3M H;  1QZH A;  3CAM A;  2WAC A;  3T13 A;  2CHB D;  3AMU A;  3RZO H;  1UE7 A;  3KLS X;  1FGB D;  3PMF A;  2RA4 A;  5M5X H;  1OXS C;  3KOJ A;  4FO2 A;  4PNY A;  3K5L A;  4H13 C;  1KNE A;  1S5B D;  4U67 3;  2GA4 B;  3S1R H;  1ICF B;  1EY9 A;  5LL6 S;  4IFD H;  4OWT B;  1UE5 A;  2RHS B;  2MQH A;  4J1M A;  1CKN A;  1V1Q A;  4HID A;  5EBC A;  1H9S B;  4DV2 Q;  4QJF A;  1G8Z D;  3TZU A;  1X3Q A;  5BN5 A;  2JA7 B;  5KNB A;  3ICE A;  2VUM H;  2UXC Q;  3BU2 A;  4HIK A;  2WKC A;  3FKI G;  3PF4 A;  2ZJP A;  1J6Q A;  2PNR C;  1WTP A;  3D8G A;  3OIP A;  2K04 A;  2IW3 A;  1ET9 A;  1S72 A;  5CBE E;  1HZB A;  4OX9 L;  5M5Y H;  1OXU A;  4BXX H;  2JA7 H;  5DLQ E;  2DY8 A;  4LUZ A;  3S1Q B;  3NEN A;  4A93 B;  1ROD A;  5LMU L;  2YU9 H;  4BS9 A;  4MN3 A;  3U50 C;  1SMY D;  4BY1 H;  3I90 A;  3J81 i;  2EXD A;  3DLL A;  1HNZ Q;  2WV6 D;  1DOK A;  4KD4 A;  3D3R A;  1YI2 A;  3FDT A;  4JG2 A;  1B9M A;  3ONA B;  5BR8 Q;  4AYB B;  2B63 B;  2EJF C;  3E0J A;  2OEO A;  3MFG A;  3S1Q H;  4DXG A;  3PUX A;  4A93 H;  2FIN B;  4QL5 A;  1SYF A;  4V0B A;  4AH6 A;  4WJ4 A;  1PH2 A;  3J80 L;  3HZX A;  4DK1 A;  1ENF A;  3NEL A;  2E5L L;  3AFQ A;  2K52 A;  4L6T B;  4TVA B;  3GV6 A;  4C3J G;  1VF5 C;  3HOU B;  3J7Y W;  2B63 H;  4B3M L;  2K14 A;  3I4O A;  5D65 A;  5FO8 B;  1O78 A;  1F2L A;  3T1H L;  4FXD A;  1EIY B;  2CFM A;  1STE A;  1UEA B;  4A3M B;  1AH9 A;  1UEB A;  4FNF A;  3CP0 A;  1YNN D;  1EY0 A;  1HA6 A;  4KKT A;  4LMQ D;  3RLN A;  1NCV A;  1VQD A;  1RIP A;  2QW7 A;  1N36 L;  1LTL A;  4UY8 C;  1LTS D;  4A3G H;  1XNR L;  3OPO A;  4OO1 I;  2PI2 A;  3HOU H;  5FOB B;  4DV7 Q;  1IYU A;  5KRU A;  1E1O A;  2O2L D;  2JEB I;  1JE4 A;  5ELF A;  1OTC A;  2N55 A;  4WRD A;  2HQL A;  2R7Z B;  1FGU A;  5EPL A;  5JAV A;  3CCM A;  4MTN A;  4ZKB B;  4GOP C;  1FD7 D;  4R4C A;  3D4R A;  1HTP A;  4IOC A;  1CFM A;  1M8A A;  2D0O A;  4KN4 C;  5C5M A;  3T1Y L;  4ZKC B;  4JBJ A;  5CV5 A;  3H94 A;  4B3R L;  2OT2 A;  1VQK A;  3L2P A;  2VZA A;  5EPJ A;  3Q6S A;  5C3E B;  2JSO A;  2R7Z H;  2EIF A;  2I5H A;  1PRT F;  1DYQ A;  4HJA A;  3E0E A;  4KY5 A;  2HD3 A;  3HOV B;  2Z4H A;  2VQE L;  3G6J B;  3S1M B;  4A3K B;  2SNS A;  2WKD A;  4DV0 L;  2KCN A;  1KAB A;  2JA6 G;  3TSS A;  1RTO A;  4KV6 A;  1VQO A;  1J5E L;  1B2T A;  4P73 A;  2L55 A;  1GM5 A;  3S17 B;  3OWF A;  3GQB A;  2K6A A;  4DUZ Q;  2SNM A;  1IL8 A;  4GN5 A;  3BDL A;  2NUC A;  2EQS A;  3HOV H;  2F0D A;  1LTT D;  3UDF A;  4LF5 Q;  4GN3 B;  3S1M H;  2DY7 A;  1Q46 A;  3PUY A;  5IGB A;  3S9W A;  1XMQ Q;  1ILP A;  3HKZ B;  4DV5 Q;  2K05 A;  4NP5 A;  3S17 H;  2EYJ A;  4C3H B;  3A7A B;  1A3V A;  1NSN S;  1K3B C;  1O7Z A;  4OWW B;  1JB3 A;  1IKL A;  1I4P A;  4RMF A;  1WD1 A;  1N8R C;  1R9T H;  2O4X A;  3OW2 A;  5G3L F;  3TRE A;  2K5N A;  3G6E A;  1LT5 D;  4IFD J;  3VR5 A;  1CSP A;  1MKH A;  2KCM A;  1O80 A;  1SE8 A;  1EY4 A;  1VQC A;  4DAM A;  4IFD I;  1TS3 A;  2NZO A;  5ELE A;  3I2Z A;  4QB4 A;  4DV6 Q;  1B44 D;  2H1E A;  2NVQ B;  4JI1 Q;  2R92 G;  2Q8R E;  2D2C C;  2ZT9 C;  1PYB A;  2N49 A;  3D6W A;  5IP7 H;  4LF6 Q;  1ENA A;  3MEF A;  3V96 A;  1NUC A;  1Z47 A;  4LJZ C;  1VQM A;  1S40 A;  3K0Y A;  2K33 A;  1LTR D;  2CH4 W;  2FFK B;  4DU9 A;  3SK6 A;  1ONL A;  3OIQ A;  5CGK A;  4B3S L;  1A63 A;  3MXN A;  3M4O B;  4DUY L;  4DR3 Q;  3NPP A;  2JA8 G;  3CPF A;  2F4I A;  1N33 L;  1SLJ A;  2KVM A;  4JI5 L;  3U4V A;  5GAH C;  2UUB L;  4YCU A;  3U4Z A;  3L7Z C;  4BY7 B;  4KHV A;  2I5L X;  4JW0 A;  2Z9H A;  2N78 A;  3KF8 A;  3NTI A;  1SFO B;  1KLG D;  4JI7 Q;  3S15 H;  4A3F B;  1GUW A;  1QUQ B;  3DWQ A;  4PG3 A;  2K4K A;  3R3O A;  4U68 A;  2IJ0 A;  3J80 E;  2KHJ A;  1SE2 A;  1U4L A;  2Z1C A;  1WTV A;  4YCW A;  4PV1 C;  3RLF A;  4BXX G;  4KTA A;  4GKJ Q;  2KEC A;  2JA7 G;  3DM1 A;  2CQO A;  1PLF A;  1SNP A;  2BCO A;  5T1G A;  1FR3 A;  4CGY B;  3PSI A;  4ZUJ A;  4RG1 A;  1SFO H;  3VR4 A;  3JAM c;  5IWA Q;  3C1E A;  2G5D A;  1N34 L;  1A2U A;  3K81 C;  4Y7N B;  2IX1 A;  2G9H D;  4K8J A;  4NMZ A;  4L5S A;  2IPK D;  3A0J A;  1H95 A;  3OW7 A;  2HCI A;  2G9D A;  3K8A A;  4HJ5 A;  4GZY C;  1E2V A;  2H5X A;  2IL8 A;  4DV2 L;  2ZM6 L;  4K6D A;  3CCL A;  1KD1 C;  4Y7N H;  1JJG A;  4LF4 Q;  1W3S A;  2B63 G;  3HEJ A;  3VR3 A;  1C9O A;  1HRJ A;  1ASZ A;  1WYD A;  1EY5 A;  3CF5 A;  2ZTE A;  4KJN A;  2JYO A;  2YV5 A;  3A8I E;  5LHY 1;  5IGE A;  1GHJ A;  3SVM A;  4R4I A;  4DR4 L;  3S2H H;  5EKI A;  1BCP B;  1U4P A;  1WTW A;  1U4R A;  1E1T A;  1RD9 D;  1H9K A;  5ELN A;  3HOU G;  2BE5 C;  3PQI A;  2F0P A;  1DOL A;  2JA9 A;  1FJG Q;  2KOL A;  1OXX K;  1YNJ C;  4BA1 I;  2ZXP A;  1PH6 A;  1HNZ L;  1EU4 A;  4F88 A;  2Z6K A;  4A3M G;  1Q7Y C;  1VQ9 A;  2KCC A;  5CV8 A;  1BBX C;  3UDI A;  1LTI D;  5BR8 L;  1VQN A;  4B9W A;  3KDF A;  4X3T A;  1PZI D;  4RH6 A;  4HMJ A;  1TWC H;  1SRU A;  4QMG A;  4K0K L;  1L1O A;  4KHP Q;  3M7G A;  1F77 A;  1ICW A;  3FKI H;  3BG3 A;  4C2M H;  3I55 A;  1KL9 A;  2KBN A;  1XMO Q;  3OTO Q;  3S1N B;  3PO3 G;  1ILQ A;  4HSV A;  4F7X A;  4OL7 A;  4IPD A;  1MIU A;  2N8N A;  4KK7 A;  4N9T A;  2I07 B;  1CZW A;  4FDB A;  2R7Z G;  2KEE A;  3NP8 A;  4XT1 B;  4DPG A;  1O7I A;  4DK3 C;  1LAC A;  4KN7 C;  5HGQ A;  2RCF A;  4APV A;  4A3D B;  3MAQ A;  4P75 A;  4NKL A;  4QCL A;  1AE2 A;  5IYC G;  5C0X I;  2ICI A;  5EQ0 A;  2IWH A;  5I9O A;  1Q8I A;  2D0P A;  2F0G A;  4DNI A;  3M85 A;  3GTP H;  3S2D B;  4FYD A;  3SK5 A;  1SYB A;  1IW7 D;  5C3E G;  3M3Y B;  4C3J B;  3MEH A;  2A6E C;  1D6E C;  3W1G A;  2LY7 A;  1HNX Q;  3I72 A;  1A15 A;  4A3D H;  2RQX A;  3WOF A;  3AQQ A;  4A3K G;  1JQY D;  1SNC A;  4FVM A;  1YEZ A;  5C4X B;  2ES2 A;  2QDL A; 
#chains in the Genus database with same CATH homology
 3A7L A;  3HS0 C;  1JR0 D;  2A6H D;  4KHZ A;  2K5Q A;  2E76 C;  3N6R A;  1CHP D;  3MTS A;  3BVM A;  2E74 C;  3HG9 A;  1IHZ A;  1KTK A;  3GD7 A;  1WCM B;  4JK1 C;  3H3V C;  1DM0 B;  1D5X C;  1A3T A;  3CQZ B;  4C3H G;  3PIP 3;  1B50 A;  3C2P A;  4CKE A;  2E2H B;  4J6H A;  1LT3 D;  4IUP A;  3DEP A;  1JWM D;  5F2D A;  2SDF A;  1HUN A;  3RD4 A;  1O7L A;  2XNA C;  5EKK A;  2PMZ B;  4UAI A;  2EY5 A;  4K14 A;  5J1Z A;  3K5N A;  5C6A A;  2DNC A;  2H4O A;  1H9J A;  1W6J A;  1ET6 A;  2PZT A;  2IX3 A;  1SND A;  1STG A;  4IUQ A;  3FEW X;  5HGT A;  2AQ3 B;  1SXT A;  4RKL A;  3ZYY X;  3FVQ A;  3H6M A;  4XT3 B;  1V8Q A;  1EY7 A;  2B2V A;  4HAE A;  1B3A A;  2B8G A;  4HSP A;  2F3V A;  5CV4 A;  3I3C A;  2FMC A;  1DJR D;  4G7H C;  1HQM C;  3L9A X;  1VDZ A;  1STA A;  2OF1 A;  2DN8 A;  2K01 A;  1C8C A;  1D1K A;  3K6O A;  1PRT C;  2AWO A;  1DD2 A;  4ZUI A;  3T53 B;  3D31 A;  3I73 A;  3LWU A;  3PIO 3;  2EXZ A;  2VNU D;  1T5X D;  3C46 A;  1F9S A;  4K5W A;  5FO7 B;  2NB0 A;  5COR A;  3DMU A;  3NWS A;  1XTC D;  3T4A C;  2RBM A;  2F03 A;  2B2W C;  2LS0 1;  2K28 A;  5FO9 B;  2FJ2 A;  3RMH A;  2K7V A;  4FP5 D;  5K36 G;  3N52 A;  1R4P B;  3HGB A;  4PMB A;  1AFP A;  2QDB A;  2PQE A;  2VB3 X;  1ESR A;  5A35 A;  3NSW A;  5CMD A;  4RGO S;  3ND9 A;  4BA2 I;  2EVB A;  5HUR A;  2A69 C;  4O1N A;  1RCV D;  1ZEQ X;  5DM6 3;  5JOB A;  3T56 B;  5CV7 A;  4E6I A;  1C48 A;  3IFD A;  1STY A;  4FXK C;  1GJX A;  3NQT A;  4X3K A;  1EQT A;  2WP8 J;  2XVS A;  3AU7 A;  1EU3 A;  5E1F A;  1EWC A;  5FKA C;  1EYD A;  3OWE B;  2ENB A;  1ZYR C;  1BDO A;  3OSO A;  1PZJ D;  4DGZ A;  1TWH B;  4IZ8 A;  3UI2 A;  3CRL C;  2HDM A;  1I6H B;  5IT9 E;  1MGS A;  4KY7 A;  4DF7 A;  4A3I B;  1LO5 D;  1BOS A;  4M1U B;  4TKO B;  3GTG B;  2QIL A;  5J39 A;  2PO4 A;  2L11 A;  1I4G A;  3GTJ B;  3HOZ B;  2K32 A;  5ELD A;  3WDN A;  1E2W A;  3NUC A;  3S16 B;  4IUR A;  1F2Y A;  1HFG A;  3A8K E;  1SYG A;  3EA6 A;  2KUM A;  1PTO B;  2F0M A;  3NHH A;  2NZ1 D;  3HP3 A;  3TP6 A;  1JOQ A;  1NAP A;  1UAP A;  4WOR A;  4N9P A;  3IAY A;  3PO3 B;  3K7A B;  3D4D A;  4KMU C;  5KYL A;  1A2T A;  1T5E A;  1PTO H;  1RJT A;  2RKS A;  1BCP C;  3CU7 A;  3FMC A;  2KJX A;  2HCC A;  4Q5V A;  1L0Y B;  2CQA A;  5C4J B;  1TU2 B;  1S4Z A;  4JBW A;  1DXM A;  2B2V C;  2XRS D;  4K5V A;  2NYZ D;  4ULL A;  2A68 C;  2DNE A;  5ELB A;  3VA5 A;  3IL8 A;  4BWG B;  4RHR A;  4DN4 M;  3EQL C;  3FPP A;  1HA5 A;  3HOY B;  3QJY A;  1D2B A;  1LT6 D;  2BOS A;  1FYC A;  4MIU A;  2QKI C;  3SR1 A;  1GXD C;  1H9S A;  5M3F B;  1SDF A;  1W6K A;  1JOO A;  3HOX B;  1CHQ D;  4I65 A;  2F0V A;  2MJ8 A;  3MC0 B;  1CZG A;  4OGQ C;  4K2K A;  2EYM A;  2C5C A;  3LX0 A;  1LLR D;  3MXP A;  1PMR A;  1JOR A;  2D5D A;  2J0T D;  1Y1W B;  1K8O A;  2F0Q A;  1TY0 A;  1PFB A;  3PUZ A;  1D5M C;  4I7Z C;  3MXU A;  3QOJ A;  1WTR A;  4A3B B;  2M00 A;  1JWS D;  2PW5 A;  1J9O A;  1GUG A;  4R8N A;  1I3Q B;  3VYT A;  4CBV A;  1STN A;  5IOC A;  4XQN A;  1SNQ A;  1VF7 A;  3T51 B;  4KJO A;  5IGG A;  1HPC A;  1WTQ A;  4RHS A;  1I6V C;  2RDF A;  4RCN A;  2X6L A;  4ZK9 B;  1MI2 A;  2RDH A;  2R6G A;  1B53 A;  1V1P B;  2XRQ D;  1S5F D;  4ODG A;  4DNR B;  3DUZ A;  3K59 A;  2NVT B;  4IUV A;  1SEB D;  3D6C A;  2L12 A;  4XQJ A;  1D1I A;  1WVL A;  3LNN A;  1D5Z C;  3M4Y A;  1U4M A;  1L0X B;  5E4X A;  3VR6 A;  3MA2 B;  3ERQ A;  3BDO A;  1GOZ A;  1B9N A;  1BQQ T;  4DXF A;  2NVY B;  4H44 C;  3HOW B;  2TSS A;  4RWS C;  1RTN A;  5I4D A;  3K58 A;  2ZXO A;  4QF4 A;  2NTS A;  3SHL A;  4CJ0 B;  4HCE A;  4QIW B;  5JPM C;  3SE0 A;  2RSO A;  4RKB A;  1STH A;  1VCI A;  2BDO A;  3Q22 A;  4HCS A;  1LAB A;  2BE5 D;  1YNJ D;  2A73 B;  1KDA A;  1BCP F;  2EYL A;  2WII B;  2XWJ B;  3R2I A;  3KLR A;  2F0T A;  1EWH A;  2TMP A;  2V4D A;  5K36 H;  5C5L A;  4X3S A;  5CV6 A;  2F0F A;  3C3L A;  1HFN A;  2F1M A;  1PZK D;  4M8A A;  4DNT B;  2B2W A;  2J7Z A;  1I4X A;  2X6G A;  3I4M B;  4ZRZ A;  1DON A;  3EFX D;  2JEA I;  5IOD A;  3DEO A;  3OHX C;  4C1N I;  5JVG 3;  1OXT A;  4CHT B;  1TY2 A;  2QF7 A;  3K57 A;  4ABN A;  1MBY A;  3Q24 A;  2EZV A;  3IFT A;  1F2M A;  1PXU A;  4RCO A;  2EYP A;  1SE3 A;  5E4W C;  2A6E D;  4V19 0;  1BXT A;  2OXP A;  3RZD B;  2ICE C;  1O7Y A;  1EY6 A;  1G91 A;  3CKI B;  3DWP A;  4EQN A;  3MHB A;  2Y0S B;  4QUC A;  2CVR A;  3KLS A;  1Q1E A;  4RGM A;  4C3I B;  3A8J E;  1SYD A;  5BN3 A;  3G7L A;  1TS4 A;  1Y8N B;  1XWE A;  2JA5 B;  2BA1 A;  1EFI D;  1LT4 D;  4PMC A;  2WB1 B;  1LV9 A;  1UNS A;  2F0J A;  4BBR B;  4IUU A;  3MVV A;  1EOT A;  1EEI D;  1RHP A;  5K5P A;  1J8I A;  5KGU A;  2M2L A;  2XSC A;  2EDG A;  2YYZ A;  5T1I A;  1Y8O B;  2B2T A;  3GTK B;  2K5D A;  1AP0 A;  4RGT A;  2XIW A;  1EYA A;  3ERO A;  5IT9 L;  1K83 B;  3I4N B;  3TP7 A;  3BDC A;  5AFW A;  4R8I A;  3J81 L;  2EYH A;  4G4K A;  1TKW B;  3QB3 A;  1TT2 A;  1KLU D;  4FXG C;  3BZD B;  1XX8 A;  1TWG B;  1TWF B;  5M5W B;  1B4O A;  1QNK A;  2EYO A;  3PO2 B;  4G7O C;  2EOT A;  2RDG A;  2EY1 A;  3QWN A;  2N88 A;  4YIJ A;  3GTL B;  2NWG A;  1PRT D;  2MPM A;  5FLX L;  3DHQ A;  2KHS A;  2M9V A;  3ITP A;  4IUT A;  2CW0 C;  2F0I A;  4RGN A;  1OXV A;  4H0L C;  3KBX A;  3FRP B;  4PMW A;  1MD2 D;  2VXW A;  3NE5 B;  5JJZ A;  3D4W A;  1SE4 A;  2B39 A;  1EY8 A;  1CK1 A;  1X32 A;  5IGF A;  3I4L A;  3EJI A;  3S14 B;  3CHB D;  1TS2 A;  1V43 A;  1B1Z A;  4NW2 A;  5G3L D;  3BYT B;  1QG7 A;  5CBA E;  2F3W A;  1TS5 A;  2EE1 A;  4XTC S;  1SJH D;  3OMC A;  2I46 A;  5C4Z A;  2AUJ D;  4BBS B;  4ILW A;  4RAU C;  2A69 D;  3GTQ B;  1EZ8 A;  5DNF A;  4L8J A;  3QO2 A;  4EQP A;  2D62 A;  5M5X B;  1HHV A;  2F0L A;  1Q12 A;  1EQV A;  2F0N A;  4IAL A;  1S5D D;  2LMC B;  3S1R B;  4P2C B;  1M4V A;  3J7A V;  1PDQ A;  1BUV T;  2R61 A;  2BDN A;  4HMI A;  3R2T A;  3V05 A;  2LKV A;  2F0K A;  3T16 A;  3O13 A;  4XYO A;  2MGS A;  3MFY A;  2VUM B;  1I4R A;  5EJW A;  3M7N A;  1ZYR D;  1EL0 A;  1DZ1 A;  3VYU A;  4ME5 A;  1NR4 A;  1TVX A;  4A3J B;  1FNW A;  4DFA A;  3NBH A;  2F0U A;  1BO0 A;  2F0S A;  1Y1V B;  4NDX A;  1PYW D;  1TQO A;  5M5Y B;  1DCZ A;  3K5O A;  2C9O A;  3DWA A;  3DXJ C;  2NN6 G;  2YU9 B;  1MSH A;  1FNU A;  4FF1 A;  2ID0 A;  5JEA G;  4BY1 B;  1SJE D;  2EY6 A;  1SNO A;  1HTL D;  2PCF B;  2X69 A;  4C1N K;  5JVH 3;  1AW7 A;  2AQ1 B;  4B08 A;  1Q3L A;  1HUM A;  5KEE A;  5NUC A;  3NTK A;  3SEB A;  3GP7 A;  2EJG C;  2JP1 A;  3Q0A A;  3QG1 A;  1JIC A;  4CJ2 C;  2A5H A;  1WTO A;  5D3D A;  2B2T C;  4ZLT F;  3J81 E;  4PQX A;  1KDC A;  4KY6 A;  3QOL A;  1CQV A;  4C3I G;  4KKS A;  5E3F A;  5I6W A;  1LTB D;  5C3X A;  3KBG A;  1PTO F;  1I4H A;  1DOM A;  4XYQ A;  3MXG A;  3QIA A;  3I91 A;  4KI0 A;  1BCP D;  5CV9 A;  1SMY C;  1F9R A;  1WD0 A;  4Q0F A;  1SNM A;  4A3G B;  1CA6 A;  2KED A;  4ID6 A;  2LFN A;  1QIL A;  5KND A;  2SEB D;  3A54 A;  2A68 D;  1QCB D;  3SDZ A;  5FLX E;  5C44 B;  5D14 A;  4OIJ A;  2KQ3 A;  4EQO A;  1GUT A;  2R93 B;  5C3W A;  3NBI A;  3LWE A;  2BA0 A;  3OMG A;  1FNV A;  2AQ2 B;  2A74 C;  3R8B A;  2HQE A;  2Z4I A;  2Z8L A;  1Y8P B;  2JXM B;  4DAY A;  3SXH A;  3TME A;  1JWU D;  5CR3 A;  1BR9 A;  1I4Q A;  1YNN C;  3NXW A;  5KIX A;  1RKN A;  4IQZ A;  1KAA A;  1CI3 M;  1V1O A;  4G7Z C;  2B2U A;  1S5C D;  5KYI A;  4OO1 G;  3MZ5 A;  2AWN A;  2K03 A;  2NBF A;  5I2X A;  3VR2 A;  3C1F A;  5BN4 A;  1VMP A;  3A55 A;  1ZKO A;  2HDL A;  5EPK A;  3F2U A;  4OIK A;  4MHE A;  3W2D A;  1PRT B;  2E2D C;  4K6L A;  1GUS A;  4XDX A;  1R9T B;  2EPB A;  2WAQ B;  2F0W A;  2RVL A;  1G6Z A;  1IYV A;  1Q1B A;  5DEH A;  1RDP D;  4K2L A;  5C0X H;  1SAP A;  1NR2 A;  4LK1 C;  4Z9C B;  1H9R A;  5D3I B;  2PPB C;  4HED A;  4ZAI A;  3TP5 A;  4S3S A;  5IGD A;  5J22 A;  3V2T A;  4LAA A;  5A2Q L;  1AEX A;  2EJM A;  2F0H A;  3BYY B;  2Q8T A;  3E6Z X;  4FF4 A;  5KNC A;  4FF3 A;  1WTX A;  2L4N A;  3FPU B;  3NTH A;  5LL6 X;  1JC7 A;  4IUN A;  5IIF A;  5EBD A;  2JE6 I;  1GUN A;  1F9P A;  3SK4 A;  3S15 B;  1X3P A;  5ISR A;  3A56 A;  4IFD G;  3JAM L;  2IT1 A;  1HXY D;  3H0G B;  1SSO A;  2FMM A;  3U9O A;  1S5E D;  5IGC A;  3X3M A;  4TRD A;  4F87 A;  3BS1 A;  4XIG S;  1SBB B;  2K5W A;  3EVQ A;  1CT1 D;  1HCZ A;  3MWY W;  3H09 A;  1JOK A;  1A3U A;  1F9Q A;  1JCK B;  4DAP A;  3P1H A;  4WFN 3;  1PFN A;  1AZP A;  5DAU A;  4B9X A;  5I2Y A;  1BF4 A;  1E0B A;  4J8Q A;  2J4X A;  3Q23 A;  2VB2 X;  1EYC A;  3TBI B;  4EGV A;  4QUF A;  1PFM A;  1CA5 A;  1OO9 B;  2K1B A;  2F0O A;  2B2Y A;  2PZW A;  3I70 A;  3S2H B;  1XXG A;  4IN3 A;  4L63 B;  4OHJ A;  5C4H A;  3VYR A;  3TZD A;  2PZU A;  2PW7 A;  1MSG A;  2ZXR A;  2HUG A;  1R4Q B;  5M9O A;  4ZQ3 A;  1KDB A;  1STB A;  3R93 A;  1TWC B;  4CKC A;  4TQU S;  3RUZ A;  1QE6 A;  1LTA D;  4C2M B;  3FKI B;  4C56 C;  1I50 B;  2QCP X;  1CM9 A;  2B2U C;  1VMC A;  4ZYS A;  1ML0 D;  4DAV A;  2L9H A;  4K8I A;  4RFB A;  5EKL A;  2NN6 H;  5JEA H;  5DM7 3;  4A3E B;  2RSN A;  3I8Z A;  3P75 A;  3GTP B;  1C4Q A;  1TWA B;  4CKB A;  5TSS A;  2MP1 A;  1E2Z A;  1II3 A;  4X3U A;  1HQR D;  3L3O C;  3PUV A;  1V1P A;  2L0C A;  2EY2 A;  5C0X J;  1QB5 D;  2WIN B;  3E5S A;  3IKJ A;  1LTG D;  5EGT A;  2PYK A;  5CYU A;  3GO5 A;  3GTO B;  4K5X A;  2EYF A;  3OOC A;  3GTM B;  3CRK C;  4HR7 B;  3SK8 A;  5A2Q E;  2XN9 C;  3VA7 A;  2QEJ C;  2R3Z A;  3BVZ A;  1AZQ A;  3WOE A;  3TN2 A;  3K5M A;  2XWB B;  5I9P A;  3AB9 A;  1UUP A;  2O5I C;  1SYC A;  4FF2 A;  3U9S A;  4F8M A;  1EIH A;  4EVO A;  5C0X G;  3VYS A;  4R9W A;  1IW7 C;  1G2T A;  5COY A;  5ELC A;  3W3A A;  5I6Y A;  2MUY A;  2L1B A;  2AUK A;  3JAM E;  4XQQ A;  1PTO C;  1TR5 A;  4UDU C;  2A6H C;  2E2J B;  3X3N A;  2KA7 A;  1QWY A;  4DK0 A;  2CW0 D;  3PV0 A;  2Q8I B;  2F0E A;  4G57 A;  3NQI A;  1AN8 A;  3KK7 A;  1EIG A;  1F2Z A;  3NK9 A;  3URY A;  3HRZ C;  2MHV A;  1QNU A;  1U9R A;  3ND8 A;  2NTT A;  2JA6 B;  1EEF D;  1RF2 D;  2E75 C;  3GV3 A;  4OO1 H;  4HTH A;  2IX0 A;  1G2S A;  4DA2 A;  1A6X A;  1EZ6 A;  5CC4 A;  4WJW A;  2FHT A;  1Y69 U;  3P7J A;  1XYI A;  1K8M A;  1G29 1;  1GHK A;  3PUW A;  3P20 A;  4O42 A;  2SOB A;  4XXE A;  1IKM A;  1KNA A;  2D9U A;  2O5J C;  3BVG A;  3TDQ A;  2NVX B;  2B8F A;  3NWT A;  1CTM A;  1Z7T A;  4KKU A;  5FK9 C;  1GUO A;  3TP8 A;  2B2Y C;  3J7A F;  1ESF A;  1Z6H A;  1CQF A;  1SYE A;  1QOH A;  1H9M A;  2E2I B;  1Q90 A;  2L5T A;  2R92 B;  3H91 A;  1BNZ A;  4H7B A;  4CJ1 B;  4HN7 A;  5M3M B;  3KUP A;  3RZO B;  4KD3 A;  4RA8 A;  5JPN C;  1TII D;  1ENC A;  4TSS A;  5JEA J;  1QJO A;  2NN6 I;  2JA8 B;  1ZXT A;  2WAC A;  3T13 A;  2CHB D;  3AMU A;  3KLS X;  1FGB D;  3PMF A;  2RA4 A;  1OXS C;  4FO2 A;  4PNY A;  3K5L A;  4H13 C;  1KNE A;  1S5B D;  4U67 3;  2GA4 B;  1EY9 A;  5LL6 S;  4IFD H;  4J1M A;  5EBC A;  1H9S B;  1G8Z D;  3TZU A;  1X3Q A;  5BN5 A;  2JA7 B;  5KNB A;  2WKC A;  2PNR C;  1WTP A;  3D8G A;  3OIP A;  2K04 A;  2IW3 A;  1ET9 A;  5CBE E;  1OXU A;  2DY8 A;  3S1Q B;  4A93 B;  1ROD A;  4BS9 A;  4MN3 A;  1SMY D;  3I90 A;  2WV6 D;  1DOK A;  4KD4 A;  3D3R A;  3FDT A;  1B9M A;  3ONA B;  4AYB B;  2B63 B;  2EJF C;  3E0J A;  2OEO A;  3MFG A;  4DXG A;  3PUX A;  2FIN B;  1SYF A;  4V0B A;  3J80 L;  3HZX A;  4DK1 A;  1ENF A;  4L6T B;  3GV6 A;  4C3J G;  1VF5 C;  3HOU B;  3J7Y W;  5D65 A;  5FO8 B;  1O78 A;  1F2L A;  4FXD A;  1STE A;  1UEA B;  4A3M B;  4FNF A;  1YNN D;  1EY0 A;  1HA6 A;  4KKT A;  4LMQ D;  1NCV A;  1LTS D;  4OO1 I;  3OPO A;  5FOB B;  1IYU A;  5KRU A;  2O2L D;  2JEB I;  1JE4 A;  5ELF A;  2N55 A;  4WRD A;  2R7Z B;  5EPL A;  5JAV A;  4ZKB B;  1FD7 D;  3D4R A;  1HTP A;  1CFM A;  1M8A A;  4KN4 C;  5C5M A;  4ZKC B;  5CV5 A;  3H94 A;  2OT2 A;  5EPJ A;  3Q6S A;  5C3E B;  2JSO A;  1PRT F;  1DYQ A;  4KY5 A;  3HOV B;  2Z4H A;  3G6J B;  3S1M B;  4A3K B;  2SNS A;  2WKD A;  2KCN A;  1KAB A;  3TSS A;  1RTO A;  4KV6 A;  1B2T A;  2L55 A;  3S17 B;  3OWF A;  3GQB A;  2K6A A;  2SNM A;  1IL8 A;  3BDL A;  2NUC A;  2F0D A;  1LTT D;  2DY7 A;  3PUY A;  5IGB A;  3S9W A;  1ILP A;  3HKZ B;  2K05 A;  4NP5 A;  2EYJ A;  4C3H B;  3A7A B;  1A3V A;  1NSN S;  1O7Z A;  1JB3 A;  1IKL A;  1I4P A;  1WD1 A;  2O4X A;  5G3L F;  1LT5 D;  4IFD J;  3VR5 A;  1O80 A;  1EY4 A;  4IFD I;  1TS3 A;  5ELE A;  4QB4 A;  1B44 D;  2H1E A;  2NVQ B;  2Q8R E;  2D2C C;  2ZT9 C;  3D6W A;  1ENA A;  3V96 A;  1NUC A;  1Z47 A;  4LJZ C;  3K0Y A;  2K33 A;  1LTR D;  2FFK B;  4DU9 A;  3SK6 A;  1ONL A;  3OIQ A;  5CGK A;  3MXN A;  3M4O B;  3NPP A;  2F4I A;  2KVM A;  3L7Z C;  4BY7 B;  4KHV A;  1GUW A;  3KF8 A;  3NTI A;  1SFO B;  1KLG D;  4A3F B;  3DWQ A;  3R3O A;  4U68 A;  2IJ0 A;  3J80 E;  1SE2 A;  1U4L A;  2Z1C A;  1WTV A;  4PV1 C;  3RLF A;  4KTA A;  2KEC A;  3DM1 A;  1PLF A;  1SNP A;  2BCO A;  5T1G A;  1FR3 A;  4CGY B;  4ZUJ A;  3VR4 A;  3C1E A;  1A2U A;  2IX1 A;  4Y7N B;  2G9H D;  4K8J A;  4NMZ A;  2IPK D;  3OW7 A;  2HCI A;  2G9D A;  4GZY C;  1E2V A;  2IL8 A;  4K6D A;  3HEJ A;  3VR3 A;  1HRJ A;  1EY5 A;  4KJN A;  2JYO A;  3A8I E;  5LHY 1;  5IGE A;  1GHJ A;  3SVM A;  5EKI A;  1BCP B;  1U4P A;  1WTW A;  1U4R A;  1RD9 D;  1H9K A;  2BE5 C;  2F0P A;  1DOL A;  2KOL A;  1OXX K;  1YNJ C;  4BA1 I;  2ZXP A;  1EU4 A;  4F88 A;  2KCC A;  5CV8 A;  1BBX C;  1LTI D;  4B9W A;  4X3T A;  1PZI D;  4RH6 A;  4HMJ A;  4QMG A;  3M7G A;  1F77 A;  1ICW A;  3BG3 A;  3S1N B;  1ILQ A;  4HSV A;  4F7X A;  4OL7 A;  4KK7 A;  4N9T A;  2I07 B;  1CZW A;  2KEE A;  3NP8 A;  4XT1 B;  1LAC A;  4KN7 C;  4A3D B;  3MAQ A;  4NKL A;  4QCL A;  5C0X I;  2ICI A;  5EQ0 A;  2IWH A;  5I9O A;  1Q8I A;  2F0G A;  4FYD A;  3M85 A;  3S2D B;  3SK5 A;  1SYB A;  1IW7 D;  3M3Y B;  4C3J B;  3MEH A;  2A6E C;  1D6E C;  2LY7 A;  3I72 A;  1A15 A;  2RQX A;  3WOF A;  1JQY D;  1SNC A;  4FVM A;  1PTO D;  5C4X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...