5ELEA

Cholera toxin el tor b-pentamer in complex with a lewis-y
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Crystal Structures Elucidate the Molecular Basis of Cholera Blood Group Dependence.
pubmed doi rcsb
source organism Vibrio cholerae o1
molecule tags Toxin
molecule keywords Cholera enterotoxin subunit B
total genus 26
structure length 103
sequence length 103
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5eleA00
1FNUA 4ZYSA 3TSSA 1D5XC 1SXTA 2AQ1B 3DWAA 3R8BA 1B44D 1SJHD 4RGMA 4C56C 1D6EC 1SEBD 3KLSX 1BCPC 1LTAD 2RDHA 3DWQA 2CHBD 2R61A 4RCOA 1BCPB 1JWMD 2WV6D 3BZDB 1CT1D 3BYTB 2NTTA 1G8ZD 1KTKA 1S5BD 1KLGD 2SEBD 1HTLD 1B1ZA 1FGBD 1TY0A 2AQ2B 4DXGA 5TSSA 1PRTD 2IPKD 3R2IA 1BCPD 1I4QA 4OHJA 1QILA 4Z9CB 3BYYB 1JWUD 1LT3D 1PTOB 3MC0B 1EEID 1UNSA 3GP7A 4DXFA 1JQYD 1V1OA 3R2TA 1EFID 2XRSD 5D3IB 1AW7A 1SE2A 1LT4D 1S5DD 3DWPA 4L6TB 1I4GA 2TSSA 5ELBA 1STEA 1UUPA 5ELCA 3CHBD 5FK9C 2RDGA 1ET6A 3V05A 2IJ0A 1TS3A 2XNAC 3URYA 5FKAC 1HXYD 5ELDA 1PTOD 1CK1A 1RCVD 1LTID 2XRQD 1PZJD 1I4HA 1I4XA 4RHSA 1XTCD 1JR0D 1PRTB 1PZID 4RHRA 1S5CD 1PTOH 4O1NA 1JCKB 1LTRD 3SEBA 5ELFA 1RD9D 4TSSA 1I4PA 2ICIA 1RDPD 1T5XD 1LT5D 2AQ3B 3O13A 1EEFD 1LTTD 1ESFA 1GOZA 1ENFA 4RGNA 2O2LD 1LTGD 1LT6D 1V1PB 2QILA 1D5ZC 1MD2D 2Z8LA 1M4VA 1SE3A 1TS2A 2QEJC 4RGOS 1PYWD 3EA6A 1CQVA 1PRTF 1EU4A 4RFBA 2G9HD 1S5FD 1BCPF 1PRTC 3EFXD 4K6LA 1L0XB 3OWEB 5D3DA 3W2DA 1EU3A 4L63B 4UDUC 5ELEA 1S5ED 4RGTA 1TS5A 3MFGA 1V1PA 1SBBB 1SJED 1LTSD 3BVZA 1PZKD 1DJRD 2XN9C 1FNWA 1CHPD 1LTBD 1RF2D 1LO5D 1BXTA 1F77A 1KLUD 1SE4A 2NTSA 2J4XA 4RH6A 3BVMA 1HQRD 1FD7D 1I4RA 1LLRD 1EWCA 1AN8A 1TY2A 1PTOC 1CHQD 1HA5A 1XXGA 3BVGA 1D5MC 1PTOF 4BWGB 5I4DA 1JWSD 1TS4A 1L0YB 1FNVA 1DYQA 1ET9A
chains in the Genus database with same CATH superfamily
5CYUA 1UE5A 2B63H 2UXCQ 4MN3A 1VQOA 1I3QB 4U673 3HOZB 5KRUA 4Y7NB 2F0UA 3CQZH 4A93G 3UE0A 5ELNA 2JEAI 2D0OA 2CHBD 3D4WA 4LUVA 4WFN3 5M3FB 3U9SA 3K5OA 4A3JH 1JOKA 3FRPB 4UP8A 4BBSH 5GADC 1VQEA 3J7YW 5K5PA 1Z6HA 3FVQA 2NVQB 2JXMB 4JC0A 2OT2A 3D4RA 2M00A 2YTVA 2LFNA 2MFIA 1IKLA 4CKBA 1IKMA 4R9WA 3HS0C 5D3IB 1LYLA 3IKJA 2JQOA 4QF4A 1LABA 1PH4A 3CCRA 1WCMB 4M1UB 2A19A 1KNAA 2FMMA 2D2CC 2OF1A 4XT1B 4BBSB 4A3DH 4A3KH 3ND9A 2F0JA 1HRJA 5FOBB 4GN3B 4QGUA 1XTCD 5E7NA 1JOOA 1XWEA 1H9RA 4KTAA 2B63B 1B3QA 5IODA 1V43A 4NXNL 3VR5A 1CM9A 3QIAA 1KD1C 2CVRA 3S14B 3CCVA 2FXQA 3KF8B 1V1PB 1PFBA 2HCCA 2K14A 3TREA 5M3MB 3EA6A 2XTIA 4RFBA 4ZUJA 3GTLH 2AWOA 1KHIA 3EFXD 1CUKA 4QIWB 1HH2P 3IFDA 2ALYB 3KK7A 1VMCA 2IWHA 2KEDA 3BVZA 3OSOA 3TDQA 4AYBE 1LTBD 1F77A 2MQHA 4H0LC 3S1RB 2R7ZH 3RMHA 3P7JA 4PG3A 5ISRA 4G7HC 1WVLA 3NBHA 3M9BA 1SMXA 1IBLQ 5FLMG 3HOXH 1N33L 4LUOA 3SXHA 1QVCA 3HOYH 2MP1A 4LW1A 2F0TA 4OXPA 4DGZA 5C4JB 4JVZA 1BCPB 1HNWL 2Y0SE 1MSGA 2ZXRA 1IBMQ 2DUDA 2MO0A 1TY0A 4DXGA 3KDFA 2IW3A 5TSSA 4JI5L 3VYTA 3CC4A 4DR6Q 1AH9A 1K3RA 3L9AX 1K0SA 4LFAQ 2R92H 2KHSA 1EEID 4A3BG 2XRSD 3HKZB 1OXVA 4IN3A 4B08A 5ELOA 4FYDA 4V190 1B3AA 4K6DA 1TQOA 4FXGC 3Q23A 1IBLL 2R93H 4DNIA 1I50B 4YCVA 4IOCA 5I2YA 4O42A 1BDOA 1N34Q 1A6XA 4KN7C 4BY7G 3I4NB 4DNTB 2UXBL 1HNWQ 1HZ9A 2K5VA 2NVXH 2F0KA 3J7AF 3GTKH 5CV8A 2F0IA 5C3EG 1AE3A 4KY7A 4X64Q 2LXKA 2EYHA 4OIKA 2JE6I 1VQIA 3P20A 4NXNQ 3KF6B 4GOPB 4DR6L 2F0EA 1K8AC 2CQOA 2HDLA 1AZPA 3R93A 2F52A 1G6ZA 3D0FA 2R7FA 2KOLA 1EU3A 3D31A 3AFPA 2ENBA 2Z0SA 4A3FG 5IYDG 1V1PA 1X3QA 2ZJPA 1WTWA 1ONLA 1MI2A 3HEJA 5FLXL 3CC7A 1IZ6A 1DJRD 4EGVA 2NVTH 2HIVA 1CHPD 3S1RH 1Y8NB 1YNJC 1DD2A 4B9XA 3H3VI 2F0FA 2NZHA 4S3SA 3RN5A 4R4QA 2I5LX 3W1BA 5IGEA 2V4DA 1WFQA 3RN2A 1DOLA 1G2TA 3K0XA 1HA5A 4QJFA 1JMCA 3L7ZC 3PO2B 4PZ8A 1ET9A 2N78A 1FR3A 5EPKA 2E75C 4A3EG 2D5DA 3V96A 4GNXC 4X64L 4NXMQ 1NJIC 1Q86C 4HTHA 4OIJA 1WYDA 1S40A 4HEDA 3G6JB 1HTLD 5E4XA 1NBWA 2AKWB 1CA6A 2UUBL 3GTKB 1SYBA 2PI2E 3SDZA 4MZ9A 2OQ0A 5M3FH 3GP7A 4GLVB 4R8NA 3SK8A 1EWHA 5FLXc 1PH8A 3QO2A 5I6WA 1LT4D 4FXKC 1XPRA 1HUNA 4EQ5A 3ND8A 2KVMA 2L9HA 1GUNA 4ME3A 5M3MH 4UHVA 2BE5D 1Q81C 4YCUA 1EQRA 1CZGA 1JJ2A 4A3CG 2LY7A 4LMQD 4NXML 3K0YA 1PZID 4C3HB 3HOVH 1RKNA 4O1NA 4KD4A 2SDFA 2EQSA 2WACA 3OOCA 3F2BA 2F0LA 5I2XA 1FVIA 1EIYB 1N34L 2AHOB 1G6PA 1WTRA 1LTTD 3ULJA 3PIOA 3BG3A 3A5ZB 4WJ4A 4G7OC 4O0AA 1VQJA 3S14H 3Q8DA 3A8JE 3K6OA 4POGA 2EYLA 1E22A 2G9HD 5IYBH 5HY6A 3E0EA 4A3GB 3GTJH 3CRKC 1PVOA 3E5SA 5AJ3L 4YHHQ 1W6KA 2RVLA 1ASYA 4X62L 1SJED 3KLSA 4IPCA 2XIWA 1MJEA 1KRSA 3ONAB 3H0GG 4F88A 1ZKOA 3DM1A 1XYIA 2HUGA 3KBXA 3M4PA 1PFNA 3AEVA 4N8FA 4QMGA 4CDDC 1U4MA 1FJGQ 2J7ZA 4DV0Q 3TN2A 1FD7D 1E24A 2JA5H 3NBHB 3SK6A 3NEMA 4X3TA 2V1CC 1CTMA 1PYBA 2JA7H 4ME5A 3HGBA 4IUVA 3J80E 3FHWA 1AZQA 1KC8C 2MHVA 4IUQA 4CJ2C 5KYIA 2ASBA 2JA9A 3VDYA 5JEAG 4RCOA 1WD0A 1BF4A 2WB1E 3KBGA 4A3BB 4GKKQ 4ZUIA 4IPDA 5IGDA 4GNXB 5DNFA 5JJZA 4OONA 1L0WA 4DK0A 4A76A 4A3MH 1JB3A 4DV4L 1JWUD 1GUSA 3S16B 2RCNA 1ENAA 3I4NH 4B3RL 1QUQA 5JEAH 5FK9C 2F4VQ 1C7YA 1TU2B 1TS3A 5F2DA 5J22A 2KBNA 4ZKBB 3HKZE 3RNUA 1B70B 4LFBQ 3TQYA 5ELDA 1IL2A 4A93H 2RDFA 5E1FA 4FVMA 4RHRA 2JSOA 1P8LA 1PTOH 4CJ0B 4LF7L 3Q0AA 3C3LA 1E2ZA 5IGBA 3O13A 3MAQA 4RKBA 2EE1A 3MXGA 2K5WA 2B8FA 2FHTA 3GTPB 4RGOS 1EQVA 2F0WA 2K04A 1XMOQ 2R6GA 3ZYYX 3I3CA 2AUKA 1SFOB 2WKCA 1IBML 3R3OA 1H9SA 1JJGA 2AMCB 2EZVA 4FF2A 4QCLA 1YBYA 3TP8A 3AQQA 3HKZG 1Y1WB 1ENCA 5C0XH 1C4QA 3NQIA 4LFAL 1L2FA 3ER0A 1VQGA 1HZAA 2RF4A 3S15B 2IT1A 4ZRZA 2Z6KC 4X62Q 4ODGA 4XYOA 2OTJA 1SYCA 5C44H 4DR3Q 1NCVA 2NVYB 4BS9A 2HHHL 1X65A 2BE5C 2L12A 5D14A 4HIDA 2PMZE 5IP7G 2A6HD 2PZWA 2JEBI 1D5MC 1PTOF 1TR5A 5E4WC 4BWGB 1JWSD 3I70A 4LF7Q 1FJGL 2O5IC 2RBMA 3PO2H 3BZDB 1UE6A 4ZYSA 1MJCA 1STAA 1TWGB 1A8VA 1N8RC 4JI8Q 1PYSB 1BCPC 2WB1G 4DNRB 3DWQA 5JJIA 3J7ZC 4RWSC 1SNPA 3BZCA 3I8ZA 3LNNA 3J80L 5C44G 4CDFC 5J39A 3FDTA 4C1NI 2DGYA 2N88A 4DK1A 5IP7H 3EIVA 4MIUA 1EFID 4JI1L 1B7YB 1YNXA 1VQAA 1E7ZA 3SVMA 4DR3L 1BVSA 2RDGA 2KHJA 4FF3A 1IBKQ 2VB2X 1ZYRD 5IGFA 3T53B 4IUPA 4DAPA 2F4VL 3I4OA 5IGCA 4KY5A 3I7FA 4IFDI 1JR0D 4JI8L 4ZK9B 4A3EB 1S5CD 2R7ZB 1U9RA 2MO1A 2VUMH 4PMCA 2LMCB 1LT5D 3CU7A 4HCSA 1HUMA 2ZJQA 1ICWA 4IJLA 1N9WA 2BA0A 4RGNA 3FKIG 1GHKA 4TRDA 1Q1EA 1B9MA 2E76C 4C3JH 2ZJRA 3I91A 4DUYL 1SFOH 5IE8A 4B3ML 4X65Q 4L5RC 1FGUA 3LGJA 4B3SQ 4M8AA 4DFAA 4AYBB 1XMOL 4CJ1B 4OO1I 2E2IB 4MHEA 4JI0L 5C5LA 4UDUC 2F4IA 5JPNC 1XJVA 1F2YA 5KYLA 4ZAIA 4A3KB 4JI6Q 5CV6A 2B2YA 1QWYA 1TIID 5EBCA 1GXDC 2IHFA 2EJMA 1BXTA 2PZUA 1A3TA 4DAYA 3HOUG 2MUYA 1BO0A 2PCFB 1O7LA 2K75A 3H0GB 4KKTA 2K5HA 4LF6Q 4P71A 1HTPA 5I4DA 1F2MA 3QOJA 1UEBA 5CBEE 1NSNS 1Y1VG 1W3SA 4GLAC 1EOTA 3F1ZA 2WAQB 1KABA 2Z1CA 1D6EC 4N9TA 1N33Q 2C5CA 1QOHA 2RDHA 3STBD 1A2UA 2CCZA 3S15H 4B3MQ 5C4XG 4XXEA 4POFA 3BYTB 2Z6KA 1K8MA 3I72A 5A2QE 3CRLC 2E2JH 4JBMA 4JW0A 2SEBD 3BS1A 2MPMA 1WTPA 3AFQA 1TT2A 1PRTD 3TRZA 4OHJA 3I90A 3T56B 3MVVA 1DZ1A 3S17H 4IOAA 3NBIA 2UU9Q 1YJWA 1NTGA 1QNUA 1SAPA 1YNNC 2KUMA 2TSSA 1UUPA 4JI1Q 1A0IA 2A6ED 2GVAA 5D65A 3HOXB 2ZT9C 3G4SA 1IBKL 1ZEQX 5GAHC 1D8LA 2XRQD 1WJJA 4JG2A 1A2TA 4DV0L 4KHVA 3TP5A 1PH1A 1JORA 4IO9A 2ICIA 3HOZG 1JJCB 4A93B 4DA2A 1GOZA 2HIXA 1HR0W 4ABNA 4OO1H 4AH6A 2QILA 1II3A 2L4NA 5CMDA 2CW0C 1XNQL 3A8KE 1CSPA 4CDEC 4A3JB 2X6LA 1K28A 3K81C 1S3OA 2EY5A 1NMFA 2KECA 3TBIB 4C3IB 4I7ZC 1BUVT 1TVXA 3K57A 4GKKL 4DUYQ 1L0XB 3BDOA 3DUZA 4YWMA 2PQAB 1VQFA 3F2DA 1H9JA 1H9SB 3KF8A 2H1EA 4KKSA 3GTMH 1GO3E 4A3KG 1SNQA 4DV4Q 2B8GA 2PNRC 5CV9A 1G51A 1SBBB 3U58A 4JI0Q 5EQ0A 3KDFB 3OPOA 1QZHA 4JI6L 1IL8A 2A69C 1RF2D 1SE4A 1JICA 1KLUD 1CKNB 2KCMA 1OXXK 2NTSA 3S1MB 2E2HH 3T13A 2JA7B 1I4RA 1ICFB 2R7DA 5FJ8H 5IYBG 1CHQD 2K03A 1VQLA 1HNZL 4C2MB 1TS4A 3T16A 5FLMH 3HOXG 4APVA 1HZBA 1SROA 2F0OA 1CKNA 1CZWA 4LF6L 4DR2Q 1IW7D 4EVOA 1NR4A 2LSSA 4RGMA 3HOWH 3CCLA 3S9WA 1SEBD 1I94Q 1EYAA 3L0OA 2H4OA 2G9DA 2NZOA 3QJYA 1CT1D 1RTNA 3OIQA 4C3HH 3HOVB 3PO3B 1S5BD 1EY4A 1HR0Q 1RIPA 2JA6H 3C1EA 3JC66 4JCVE 3VYSA 3A7AB 4ZCKA 1J6QA 1EUJA 1Y1WG 1SNOA 1TWCB 2C35B 4ALPA 3HOZH 4DR4L 3SGIA 3M7GA 3J7AV 4GZYC 1SMYC 1SSOA 4WJ3M 4A4IA 4UY8C 3ERSX 1EL0A 2JA6G 3H3VH 2BH8A 1UE7A 4HIMA 1DXMA 1C0AA 2HHHQ 2XSCA 1S72A 3FPUB 1STYA 1ZYRC 1F9PA 1I5FA 2IX0A 1JCKB 4AQYL 3OW7A 3PV0A 1CI3M 1D7QA 1H9MA 2P5ZX 1HFNA 2O2LD 5C3EH 1LT6D 5EJWA 4L5QA 4L5SA 3KJOA 2EYOA 2RA4A 4BBRH 2Q8RE 3DXJC 2BOSA 4NPSA 3PCOB 4FDBA 3S2DH 5FJ8G 4C3IG 1E3PA 1BCPF 1PRTC 3VA7A 5M5WH 1SNMA 5DEHA 4DV2L 4DAMA 1RJTA 4XYQA 2VB3X 2YU9H 5ELEA 3CMEA 5LMNL 2PYKA 3MFGA 3MXUA 3E3XA 1K3BC 5AJ3Q 1JOQA 4N9PA 4X66Q 4YHHL 3TEHB 5EGTA 1X9NA 1VQBA 2E2IH 1LV9A 1J8IA 4IFDJ 4J6HA 1H95A 4DPGA 4P72A 5KIXA 5IP9H 1HQRD 1Y1VB 1EIHA 4HMJA 2KHIA 1WTQA 4WORA 3I4MH 3CCMA 5BN4A 4OGQC 2NVTB 4P2CB 2L15A 1LACA 3GTGB 1FNVA 1IYJB 1B50A 4DV5Q 2K33A 3I4LA 3DWAA 3MEFA 2B63G 3X3MA 4C56C 4C3IH 4A3LG 2N8NA 2RHQB 2IY5B 4A3GH 4DR2L 2TMPA 2K7VA 2PO4A 4KMUC 3ZJYC 3RZDB 4HMIA 1K0RA 4DKAC 3UDIA 3KJPA 4WRDA 2A1AA 3OIPA 1EZ6A 3I4MG 1JT8A 4DN4M 4N8X1 3BZKA 2K05A 4Z9CB 4QQBX 1QJOA 2DNCA 5IT9L 4R4IA 4X65L 1UNSA 4JI4Q 4B3SL 1D2BA 2XGTA 3OWFA 3JAME 1DOKA 4LJZC 1U4PA 2B2VA 1AW7A 1KRTA 5C5MA 4KK7A 1S5DD 3DWPA 1O7IA 1Y8PB 3CP0A 4WJWA 5LL6S 3CCEA 5M5YH 4JV5L 2I5MX 1Q1BA 2BDOA 2IJ0A 4Y52H 5G3LF 2MNAA 4A3DG 1X3FA 5FKAC 4PQXA 1X3EA 3KYHC 1WTOA 3NWTA 1O7ZA 4HSPA 1U5KA 1GUWA 1HFGA 1T9HA 3BDLA 2RCFA 2YTXA 1C48A 2HD3A 1PA6A 1GHJA 5C44B 1DM0B 3BU2A 5FO8B 1K8OA 1Z47A 2L0CA 3EROA 3J81i 1IYUA 1SRUA 4LK1C 1A15A 1KDCA 5I6YA 3D4DA 4RCNA 5IT9c 4A3MB 3K59A 1O80A 2HCIA 3H6MA 4BY7B 4NKLA 3I4NG 3PO3G 1OXSC 1EU4A 3KFUA 1K83H 3K7AH 1E0BA 3CW2C 3QOLA 4J1MA 2I0QA 1VDZA 1UE1A 1TWHH 4ILWA 2Z6BA 3CXCA 3CC2A 4R4OA 2N49A 4DV2Q 4LUZA 1X32A 1GD7A 1LTSD 4RMFA 3H0GH 2QCPX 3NHHA 2EPBA 3GTJB 2UU9L 1FNWA 3QB3A 4B9WA 1EWIA 4DR5Q 5LHY1 4RH6A 1WD1A 3M3YH 1XPUA 4EQPA 2PNHA 4QIWE 3S24A 3S2DB 1F9RA 4LF8L 2R92B 3MFYA 4F7XA 4JYAQ 3K7UC 4BBRB 1XMQQ 1E2VA 4JI2L 1SJHD 4DR1Q 3ULLA 2Q2HA 1A63A 1Q90A 2F0GA 1ILQA 1DGSA 3HFZB 2OCEA 5M5WB 2DNEA 3HG9A 4RA8A 5C4JH 2EYFA 4IQZA 3PMFA 2NTTA 4A3JG 2WFWA 1ZXTA 2B2YC 2DY7A 4K5VA 4DU9A 3FP9A 5IT9E 4C1NK 1PXUA 3SE0A 4LWCA 4Q5VA 1SNCA 1AP0A 3HZXA 4PMWA 4A3BH 3PUVA 4GN4B 2B2UC 1SE2A 2YTYA 3E6ZX 5GAGC 3PGZA 5ELBA 4TQUS 2A5HA 4XIGS 4DR5L 4LNQA 3G7LA 2A69D 2DN8A 1Q8KA 1QVGA 3QR8A 3TP6A 3BJUA 2JJQA 4JV5Q 1VQMA 3F8TA 3U4ZA 3DEOA 1EQTA 2E5LQ 2B29A 4DR1L 5C4XB 4OWXB 4H02A 1STNA 4TVAB 3JAML 4CDCC 1TWFH 3JAMi 1HNZQ 1BBUA 1I4PA 3ICEA 1VF7A 1NUCA 4Y7NH 1WTVA 1ESFA 3K80C 4IZ8A 1LTGD 4DR7Q 4QUCA 3HKSA 5C3EB 3IAYA 3PF4A 1D1KA 3LX0A 2JK8A 1I94L 2D9UA 3W3AA 4DUZQ 1EY5A 2VNUD 1K9MC 3HOYG 1SDFA 3CPWA 4DV1L 5T1IA 4BA1I 4K6LA 1HR0L 5C3WA 1R4PB 4HJ9A 1TWCH 1B53A 3IFTA 3JAMc 3NK9A 1MBYA 4CHTB 1YI2A 5JVH3 4IJHA 1O78A 3F2UA 3E9IA 2KA7A 4UPAA 1Y14B 3ULPA 1KL9A 4XT3B 3TZDA 2ATWA 5BN5A 3GD7A 3GTOB 1S4ZA 1SR3A 4BY7H 4FO2A 2DY8A 2IHEA 2Q8IB 2G5DA 4HJAA 4G4KA 1O7YA 2SNSA 2X69A 1Q3LA 4LAAA 2B2WA 5M9OA 3RLOA 1P16A 4JYAL 4FXDA 1QNKA 1C9OA 3NQTA 4DUZL 4AQYQ 3QG1A 4IALA 4JI2Q 1V1QA 3J81j 2QW7A 3D3RA 1M90C 4K14A 2GN5A 4YCWA 5CORA 1HHVA 1K73C 1EFWA 2NVQH 4XQQA 1I4QA 4RKLA 1CKOA 4UP7A 5IYCG 2F0SA 2DJFC 5CBAE 4DXFA 5GQOA 3QWNA 4NMZA 2VQEQ 5C0XI 1VS0A 1PV4A 1STEA 4K8JA 4E6IA 1OTCA 3CQZB 2F0DA 2XWJB 3K5LA 2I07B 5I9OA 3PO2G 2CQAA 2GVBA 3NWSA 2ID0A 4X66L 3SK5A 1PH9A 4ID6A 1VQ9A 4KHPQ 3J81L 4J8QA 3AU7A 4P75A 1LTID 1EZ8A 1I4HA 1I4XA 4EX5A 1PRTB 1YEZA 2F03A 2JN4A 3GTPH 4KY6A 4GLXA 2K1BA 1X56A 1KIXA 1SYEA 4OELB 4LFCL 1L1OB 1F9QA 2F3VA 3N52A 4C2MH 3MZ5A 5CV4A 2Z8LA 1SE3A 3K8AA 5K36G 1PYWD 1X55A 3VR3A 3C2PA 4DR7L 3TP7A 2EY1A 1E2WA 1XNQQ 4IFDG 3PUWA 1GVPA 2Y0SG 5FO7B 2VQEL 1I6HB 1VQPA 1ASZA 2CH4W 5D3DA 3A8IE 3NELA 1TS5A 3G71A 5I9PA 3A7LA 5AFWA 4R1JA 2RQXA 3DMUA 1VQ7A 4LF4L 3SK4A 3DLLA 1VQ5A 1MHWC 2R92G 1GM5A 2B2TC 2ZTEA 3S16H 3E0JA 3HOUH 2YYZA 4I7AA 4JPBW 3EBEA 2D62A 2ICEC 4JBJA 5EPLA 3S2HB 4OO1G 1W6JA 4H13C 4UP9A 1L0YB 3Q6SA 5T1GA 4K2LA 3TSSA 4OX9Q 1D5XC 1SE8A 3GTQH 1QB5D 2LXJA 2ZM6Q 2EYPA 2OXPA 4DK6C 2B2VC 1T5EA 3WWVA 2D0PA 1EIGA 1LTAD 4PNYA 2B2UA 4DAYB 2KCTA 1G8ZD 4OL7A 1X54A 1FGBD 2EYMA 5IYDH 1HZCA 2NN6H 2PW5A 1CA5A 1BCPD 3A55A 4YIJA 1PFSA 1LT3D 4R8IA 3D6CA 5HGTA 1N32Q 2E2JB 3R2TA 4GOPA 1Z9FA 4ZLTF 5BR8Q 4XQJA 2JP1A 3NSWA 2B2WC 4JK1C 3IRBA 2FFKB 2JA5G 3M4OH 3S1NB 3TZUA 4KLKA 5H1SE 1OO9B 4HJ5A 3CCSA 4DR4Q 1VQKA 2XNAC 5HGQA 3AYHB 3P75A 3SR1A 3EQLC 4KHPL 1TXYA 4BY1G 5DAUA 1EYGA 3NTKA 2UUAQ 2F0VA 1YJNA 1F2ZA 2IL8A 2NVYH 4LF8Q 3VR4A 1RD9D 2NBFA 5BN3A 3SHLA 4IPHA 1FL0A 3D8GA 1EEFD 4DV3L 1A62A 3RLNA 1TWHB 3BDCA 5JPMC 2QEJC 4PZ6A 2QA4A 3X3NA 3PIPA 3HP3A 1PRTF 3VR2A 4OWTB 1Q7YC 4B3TQ 1PHJA 2WINB 5BR8L 3W2DA 1K8GA 3PUXA 4JBWA 1YNJD 1V8QA 4CBVA 4OWWB 1YITA 1RHPA 2Z4IA 1PFMA 1IXRA 5LMNQ 2KENA 3M4YA 1JB7A 1D1IA 5J1ZA 4HJ8A 4BY1H 3CCQA 2K5DA 5CV7A 4DV6L 4QY7A 3NE5B 4JI3L 4XQNA 1AN8A 1TY2A 1EY9A 1PTOC 2UUAL 1G291 4X3SA 3BVGA 3TMEA 4KD3A 3TS0A 3GTMB 3MXPA 4IUUA 4BBRG 1JE5A 1QUQB 1B44D 1Y69U 2F3IA 4DV5L 3J80c 3KLSX 5L37A 4A3CH 3DM3A 1PMRA 1SYFA 2R61A 4A75A 2WB1B 4BY1B 3A56A 4C3HG 2EIFA 1YIJA 3NPPA 4L8JA 5NUCA 4NDXA 2WAQG 3G6EA 1Q12A 1DCZA 1VQ6A 3M4QA 4F87A 1ML0D 3BYYB 3CD6A 3K5MA 4DV1Q 1Y1WH 3PIO3 1EY6A 2EJFC 2B39A 3RLFA 1QVFA 2VZAA 4JI4L 3M7NA 1N32L 5ELCA 2ZXOA 2N3SA 4DV6Q 3OYYA 3AMUA 2L55A 3Q24A 3NUCA 4HN7A 3WOEA 5LMNW 2JA6B 4O2DA 5C0XG 3GV6A 1XPOA 1AEXA 4BXXH 1YNND 2QF7A 3J7A5 4KJNA 2A6EC 1CK1A 3NENA 1PZJD 4X3KA 1I50H 2O5JC 3UDGA 5IWAQ 1SYDA 1HNXQ 2NZ1D 1OXUA 1NMGA 2EVBA 1M1KC 2CWAA 1CKMA 2OEOA 2NVXB 1STBA 1PLFA 4U68A 1MKHA 3FKIH 5M5XH 1J5EQ 3I55A 1VCIA 1D5ZC 5FO9B 1KXLA 5DM73 4DK3C 4F8MA 3PF5A 4CKEA 1S5FD 3T1HL 2OWOA 3MWYW 2KCCA 5DLQE 1B8AA 1MSHA 2BCOA 4DV7L 5M5YB 2QDBA 4HSVA 2F0MA 4BBSG 1WTHA 4BA2I 4BXXG 2QEXA 4I65A 5LMUL 3H3VC 1H9KA 1VF5C 1STHA 3A0JA 3K58A 2C9OA 3LWEA 3HOUB 3BVMA 3OMGA 2JYOA 2L5TA 3ITPA 5C3XA 3L2PA 3LWUA 1U4RA 2VW9A 1KDAA 2JA7G 4A3DB 3PO3H 1Y1VH 3CF5A 5IIFA 3DHQA 3EVQA 1HCZA 1HQMC 5A2QL 1XMQL 2E74C 3FMCA 2Z4HA 2HQEA 5JEAJ 5C4XH 3KOJA 1B9NA 2ZTCA 3U4VA 1KTKA 2Q2TA 2AQ2B 3PQIA 4DF7A 4DV7Q 2HT1A 4GKJL 3R2IA 3STBC 2JA5B 3VA5A 1TWAH 4A3MG 3FPPA 1GUOA 2MGSA 3GO5A 2ZTDA 3MC0B 1ESRA 2KJXA 1JQYD 2K4KA 2QDLA 3U50C 2YU9B 4FP5D 1IYVA 1VQ8A 3S17B 1A3UA 3GV3A 2NB0A 1Y8OB 2NUCA 1YHAA 4FF1A 3V05A 1KAWA 1XTDA 1R9TH 4LF4Q 2F0QA 1W2BA 2K5QA 4HJ7A 2NYZD 4FF4A 3M4OB 1Q8IA 1PTOD 4JOIC 3PSIA 3M85A 2PW7A 1STGA 2JA8G 4EQOA 3GTOH 1EYDA 1U0LA 3GTQB 1LTRD 4PMBA 1GUGA 2E5LL 2E2HB 1MIUA 3RD4A 3IL8A 1T5XD 3PUZA 1EY8A 4K5WA 5IWAL 1PDQA 3F2CA 2ZM6L 4ZKCB 1MD2D 4GKJQ 1M4VA 4QUFA 2KQ3A 2KEEA 4KV6A 3RZDH 4R4TA 2Q8TA 5EBDA 2XVSA 5EKLA 1KDBA 3OWEB 2JA8H 1BBWA 2A68C 1WTXA 4LF5Q 4OEMB 5JJLA 4RGTA 4Q0FA 2EXZA 3MHBA 1PH5A 5KNBA 1C8CA 2A6HC 1PH7A 5J3BA 1SYGA 1JE4A 1EOVA 1NAPA 1NY4A 1XX8A 3UDFA 1VQNA 1CQFA 1YHQA 2GA4B 1X6OA 3NTHA 1ILPA 1K83B 3K7AB 1WCMG 2X6GA 5IYCH 4KI0A 1BKBA 5DM63 1DYQA 3CKIB 4C3JG 1R9TB 1FNUA 3GQBA 3TS2A 2AQ1B 2R93G 4YY3Q 3A74A 4CKCA 3HOWB 4IFDH 2PZTA 2Y0SB 2VL6A 1RL2A 2WV6D 4K8IA 3MXNA 3HOVG 3J81c 4DV3Q 2VUMG 3UE1A 2PI2A 1Q46A 2M9VA 4ULLA 5IGGA 5IY0A 5C0XJ 1TWAB 4LF5L 2EYJA 2ZXPA 2EDGA 1HPCA 2FMCA 2AWNA 2IX1A 1PTOB 4B3TL 5LL6X 5GAEC 5C4ZA 1EQQA 2SNMA 4L6TB 4RAUC 5FLXE 2YV5A 5G3LD 1QZGA 2PPBC 1PH3A 4A3FH 1QCBD 5K36H 1GUTA 3KUPA 2EY6A 2F0HA 2BH2A 1QE6A 1N36Q 5HURA 1GJXA 3T51B 1YHBA 1L1OA 1M8AA 1SMYD 4RHSA 4YY3L 4A3IB 1BBXC 4FNFA 4LF9Q 2DJGC 3SEBA 4EQNA 1OXTA 4TSSA 3OMCA 5COYA 1MGSA 2WKDA 4DAVA 1ENFA 4AIMA 1NNXA 1CSQA 2CFMA 3I2ZA 4RG1A 5KGUA 1VQDA 4XDXA 4C3JB 4LFCQ 1X3PA 1Q82C 3V2TA 2F0PA 2R3ZA 4PV1C 3I4MB 2BA1A 3W5OA 3HOWG 4AYBG 5CR3A 2A73B 4QB4A 3EN2A 1BOSA 3H09A 3J81E 2ES2A 1VQ4A 2OTLA 1S5ED 3OHXC 4IUNA 4X6AH 1E1OA 5KEEA 1RTOA 2BDNA 1LTLA 1WOCA 1N36L 2F3WA 1SNDA 3S1QH 2E2DC 2LKVA 1LLRD 3GTLB 4IPGA 3J80i 1R4QB 3H15A 3NP8A 4G57A 2NN6I 1JC7A 4KHZA 3HRZC 1PH6A 2HDMA 2KCNA 2QGQA 4K5XA 1AE2A 5JVG3 3WOFA 3OTOL 2UUCQ 1NE3A 3C1FA 3CPFA 1HNXL 4OX9L 2K6AA 1KQSA 1LM0A 4A3IG 3C46A 1XNRQ 2K52A 1HJPA 2UUBQ 1TWGH 4P73A 1B1ZA 1B2TA 2SOBA 2PQAA 4G7ZC 1LUZA 1UAPA 2IPKD 2VQFL 2LS01 4JI7L 1QILA 5M3FG 1DOMA 1EY0A 2A68D 1QG7A 5JOBA 3T1HQ 1V1OA 5EAYA 2F1MA 1V9PA 3D6WA 3K5NA 1WCMH 4V0BA 2PMZB 4GS3A 4X3UA 3A54A 4K2KA 4KKUA 5GROA 1ET6A 3RR5A 5M5XB 2Z9HA 1TKWB 2HQLA 1TWFB 2MJ8A 3AB9A 3UI2A 3URYA 5C6AA 4MNOA 1G2SA 4YWKA 1FYCA 2RSOA 3OTOQ 3I56A 1BNZA 2UUCL 1WI5A 2AUJD 1NR2A 3S1QB 4HR7B 4GOPC 1XNRL 3HOYB 2R93B 4LF9L 1EY7A 2NN6G 3PUYA 4NB3A 3T1YQ 3MTSA 4CGYB 2Q2UA 1F9SA 4J15A 3E9HA 4IUTA 4JI5Q 1E1TA 1L1OC 4A3EH 1IHZA 3WDNA 2VQFQ 2A8VA 5E3FA 1UWVA 3M3YB 4K0KL 2RHSB 1CQVA 2VUMB 1YVCA 1BR9A 3KLWA 3W1GA 3NXWA 5EPJA 3KLRA 2M2LA 2B3GA 5CC4A 2VY3A 2EJGC 4KJOA 2WIIB 3CCJA 4A3FB 1I3QH 2I46A 3MXNB 2K50A 1BQQT 5C4HA 3H94A 1VQHA 3MEHA 4XTCS 5JAVA 1PZKD 4PZ7A 2XN9C 4A3IH 1LO5D 3ERQA 1GKHA 3CAMA 1YJ9A 3RZOB 4KN4C 3VYUA 1EWCA 3VYRA 1XXGA 3FEWX 1UEAB 3RUZA 2PQEA 1SN8A 4L5TA 2UXBQ 4JI3Q 3U9OA 1SXTA 3T1YL 4NP5A 2IX3A 3R8BA 2CH4A 5KNCA 4A3LH 4HIOA 1A3VA 3I73A 1JWMD 3VR6A 4IURA 5M3MG 4TKOB 1KLGD 2L11A 3GDEA 4NW2A 1U4LA 5IOCA 3S2HH 3MA2B 2RKSA 3CCUA 2UXDQ 4JBKA 4P74A 4B3RQ 2E8GA 2EOTA 1I6HH 3H91A 2CWPA 4GNXA 4H44C 4JI7Q 2XWBB 2K32A 5IP9G 3EJIA 1IW7C 5EKKA 1I4GA 1G91A 1AFPA 2J0TD 3CHBD 1Z7TA 4HIKA 2QKIC 2N55A 1EIFA 4LFBL 2VXWA 4ZQ3A 2CKZB 2K28A 1HXYD 2A74C 1VQCA 2K5NA 1RCVD 4HAEA 3S1NH 5EKIA 3CMAA 2FJ2A 2EY2A 1RODA 2NWGA 2JA8B 1VMPA 2CW0D 5A35A 2R7ZG 2RSNA 2FINB 4H7BA 5ELFA 5CV5A 1B4OA 3T4AC 1I6VC 1RDPD 2AQ3B 3G48A 4UAIA 5CGKA 1F2LA 2UXCL 3A5UA 1SLJA 1J9OA 2UXDL 1TS2A 2H5XA 3B6YA 4HCEA 5KNDA 3N6RA 2B2TA 2WAQE 3NTIA 1J5EL 2I5HA 1KAAA 4GN5A 4A3GG 4K0KQ 3OW2A 2O4XA 2Q2IA 2L1BA 4L63B 2F0NA 3DEPA 3UDXA 4JOIA 1KNEA 1DONA 1YZ6A 3KF6A 1EYCA 3P1HA 1X3GA 4MTKA 3Q22A 1PH2A 5JJKA 3L3OC 4R4CA 1HA6A 3RZOH 2J4XA 2WP8J 2EXDA 4QL5A 3S1MH 4YWLA 5LMUQ 1CFMA 3PIP3 2OQKA 3GTGH 3FKIB 4MTNA 2K01A 2VS1A
chains in the Genus database with same CATH topology
5CYUA 4MN3A 1I3QB 4U673 3HOZB 5KRUA 4Y7NB 2F0UA 2JEAI 2CHBD 3D4WA 4WFN3 5M3FB 3U9SA 3K5OA 1JOKA 3FRPB 3J7YW 5K5PA 1Z6HA 3FVQA 2NVQB 2JXMB 2OT2A 3D4RA 2M00A 2LFNA 1IKLA 4CKBA 1IKMA 4R9WA 3HS0C 5D3IB 3IKJA 4QF4A 1LABA 1WCMB 4M1UB 1KNAA 2FMMA 2D2CC 2OF1A 4XT1B 4BBSB 3ND9A 2F0JA 1HRJA 5FOBB 1XTCD 1JOOA 1XWEA 1H9RA 4KTAA 2B63B 5IODA 1V43A 3VR5A 1CM9A 3QIAA 3S14B 2CVRA 1V1PB 1PFBA 2HCCA 5M3MB 3EA6A 4RFBA 4ZUJA 2AWOA 3EFXD 4QIWB 3IFDA 3KK7A 1VMCA 2IWHA 2KEDA 3BVZA 3OSOA 3TDQA 1LTBD 1F77A 4H0LC 3S1RB 3RMHA 3P7JA 5ISRA 4G7HC 1WVLA 3NBHA 3SXHA 2MP1A 2F0TA 4DGZA 5C4JB 1BCPB 1MSGA 2ZXRA 1TY0A 4DXGA 2IW3A 5TSSA 3VYTA 3L9AX 2KHSA 1EEID 2XRSD 3HKZB 1OXVA 4IN3A 4B08A 4FYDA 4V190 1B3AA 4K6DA 1TQOA 4FXGC 3Q23A 1I50B 5I2YA 4O42A 1BDOA 1A6XA 4KN7C 3I4NB 4DNTB 2F0KA 3J7AF 5CV8A 2F0IA 4KY7A 2EYHA 4OIKA 2JE6I 3P20A 2F0EA 2HDLA 1AZPA 3R93A 1G6ZA 2KOLA 1EU3A 3D31A 2ENBA 1V1PA 1X3QA 1WTWA 1ONLA 1MI2A 3HEJA 5FLXL 4EGVA 1DJRD 1CHPD 1Y8NB 1YNJC 1DD2A 4B9XA 2F0FA 4S3SA 5IGEA 2V4DA 1DOLA 1G2TA 1HA5A 3L7ZC 3PO2B 1ET9A 1FR3A 5EPKA 2E75C 2D5DA 3V96A 4HTHA 4OIJA 4HEDA 3G6JB 1HTLD 5E4XA 1CA6A 3GTKB 1SYBA 3SDZA 3GP7A 4R8NA 3SK8A 1EWHA 3QO2A 5I6WA 1LT4D 4FXKC 1HUNA 3ND8A 2KVMA 2L9HA 1GUNA 2BE5D 1CZGA 2LY7A 4LMQD 3K0YA 1PZID 4C3HB 1RKNA 4O1NA 4KD4A 2SDFA 2WACA 3OOCA 2F0LA 5I2XA 1WTRA 1LTTD 3BG3A 4G7OC 3A8JE 3K6OA 2EYLA 2G9HD 4A3GB 3CRKC 3E5SA 1W6KA 2RVLA 1SJED 3KLSA 2XIWA 3ONAB 4F88A 1XYIA 1ZKOA 3DM1A 2HUGA 3KBXA 1PFNA 4QMGA 1U4MA 2J7ZA 3TN2A 1FD7D 3SK6A 4X3TA 1CTMA 4ME5A 3HGBA 4IUVA 3J80E 1AZQA 2MHVA 4IUQA 4CJ2C 5KYIA 5JEAG 4RCOA 1WD0A 1BF4A 3KBGA 4A3BB 4ZUIA 5IGDA 5DNFA 5JJZA 4DK0A 1JB3A 1JWUD 1GUSA 3S16B 1ENAA 5JEAH 5FK9C 1TU2B 1TS3A 5F2DA 5J22A 4ZKBB 5ELDA 2RDFA 5E1FA 4FVMA 4RHRA 2JSOA 1PTOH 4CJ0B 3Q0AA 3C3LA 5IGBA 1E2ZA 3O13A 3MAQA 4RKBA 2EE1A 3GTPB 2K5WA 3MXGA 2B8FA 2FHTA 4RGOS 1EQVA 2F0WA 2K04A 2R6GA 3ZYYX 3I3CA 2AUKA 1SFOB 2WKCA 3R3OA 1H9SA 2EZVA 4FF2A 4QCLA 3TP8A 1Y1WB 1ENCA 5C0XH 1C4QA 3NQIA 3S15B 2IT1A 4ZRZA 4ODGA 4XYOA 1SYCA 1NCVA 2NVYB 4BS9A 2BE5C 5D14A 2L12A 2A6HD 2PZWA 2JEBI 1D5MC 1PTOF 1TR5A 5E4WC 4BWGB 1JWSD 3I70A 2O5IC 2RBMA 3BZDB 4ZYSA 1STAA 1TWGB 1BCPC 4DNRB 3DWQA 4RWSC 1SNPA 3I8ZA 3LNNA 3J80L 5J39A 3FDTA 4C1NI 4DK1A 2N88A 4MIUA 1EFID 3SVMA 2RDGA 4FF3A 2VB2X 1ZYRD 5IGFA 3T53B 4IUPA 4DAPA 5IGCA 4KY5A 4IFDI 1JR0D 4A3EB 4ZK9B 1S5CD 2R7ZB 1U9RA 4PMCA 2LMCB 1LT5D 3CU7A 4HCSA 1HUMA 1ICWA 2BA0A 4RGNA 1GHKA 4TRDA 1Q1EA 1B9MA 2E76C 3I91A 4M8AA 4DFAA 4AYBB 4CJ1B 4OO1I 2E2IB 4MHEA 5C5LA 4UDUC 2F4IA 5JPNC 1F2YA 5KYLA 4ZAIA 4A3KB 5CV6A 2B2YA 1QWYA 1TIID 5EBCA 1GXDC 2EJMA 1BXTA 2PZUA 1A3TA 4DAYA 2MUYA 1BO0A 2PCFB 1O7LA 3H0GB 4KKTA 1HTPA 5I4DA 1F2MA 3QOJA 5CBEE 1NSNS 1EOTA 2WAQB 1KABA 2Z1CA 1D6EC 4N9TA 2C5CA 1QOHA 2RDHA 1A2UA 4XXEA 3BYTB 1K8MA 3I72A 5A2QE 3CRLC 2SEBD 3BS1A 2MPMA 1WTPA 1TT2A 1PRTD 4OHJA 3I90A 3T56B 3MVVA 1DZ1A 3NBIA 1QNUA 1SAPA 1YNNC 2KUMA 2TSSA 1UUPA 2A6ED 5D65A 3HOXB 2ZT9C 1ZEQX 2XRQD 1A2TA 4KHVA 3TP5A 1JORA 2ICIA 4A93B 4DA2A 1GOZA 4ABNA 4OO1H 2QILA 1II3A 2L4NA 5CMDA 2CW0C 3A8KE 4A3JB 2X6LA 2EY5A 2KECA 3TBIB 4C3IB 4I7ZC 1BUVT 1TVXA 3K57A 1L0XB 3BDOA 3DUZA 1H9JA 1H9SB 3KF8A 2H1EA 4KKSA 1SNQA 2B8GA 2PNRC 5CV9A 1SBBB 5EQ0A 3OPOA 1IL8A 2A69C 1RF2D 1SE4A 1JICA 1KLUD 2NTSA 3S1MB 1OXXK 3T13A 2JA7B 1I4RA 1CHQD 2K03A 4C2MB 1TS4A 3T16A 2F0OA 1CZWA 1IW7D 4EVOA 1NR4A 4RGMA 3S9WA 1SEBD 1EYAA 2H4OA 2G9DA 3QJYA 1CT1D 1RTNA 3OIQA 3HOVB 3PO3B 1S5BD 1EY4A 3C1EA 3VYSA 3A7AB 1SNOA 1TWCB 3J7AV 3M7GA 4GZYC 1SMYC 1SSOA 1EL0A 1DXMA 2XSCA 3FPUB 1STYA 1ZYRC 1F9PA 2IX0A 1JCKB 3OW7A 3PV0A 1CI3M 1H9MA 1HFNA 2O2LD 1LT6D 5EJWA 2EYOA 2RA4A 2Q8RE 3DXJC 2BOSA 4C3IG 1BCPF 1PRTC 3VA7A 1SNMA 5DEHA 1RJTA 4XYQA 2VB3X 5ELEA 2PYKA 3MFGA 3MXUA 1JOQA 4N9PA 5EGTA 1LV9A 1J8IA 4IFDJ 4J6HA 5KIXA 1EIHA 1HQRD 1Y1VB 4HMJA 1WTQA 4WORA 5BN4A 4OGQC 2NVTB 4P2CB 3GTGB 1LACA 1FNVA 1B50A 2K33A 3I4LA 3DWAA 3X3MA 4C56C 2TMPA 2K7VA 2PO4A 4KMUC 3RZDB 4HMIA 4WRDA 3OIPA 1EZ6A 4DN4M 2K05A 4Z9CB 1QJOA 2DNCA 5IT9L 1UNSA 1D2BA 3OWFA 3JAME 1DOKA 4LJZC 1U4PA 2B2VA 1AW7A 5C5MA 4KK7A 1S5DD 3DWPA 1Y8PB 4WJWA 5LL6S 1Q1BA 2BDOA 2IJ0A 5G3LF 5FKAC 4PQXA 1WTOA 3NWTA 1O7ZA 4HSPA 1GUWA 1HFGA 3BDLA 1C48A 1GHJA 5C44B 1DM0B 5FO8B 1K8OA 1Z47A 2L0CA 3EROA 1IYUA 4LK1C 1A15A 1KDCA 5I6YA 3D4DA 4RCNA 4A3MB 3K59A 1O80A 2HCIA 3H6MA 4BY7B 4NKLA 1OXSC 1EU4A 1E0BA 4J1MA 3QOLA 1VDZA 4ILWA 1X32A 1LTSD 2QCPX 3NHHA 2EPBA 3GTJB 1FNWA 3QB3A 4B9WA 5LHY1 4RH6A 1WD1A 4EQPA 3S2DB 1F9RA 2R92B 3MFYA 4F7XA 4BBRB 1E2VA 1SJHD 1Q90A 2F0GA 1ILQA 5M5WB 2DNEA 3HG9A 4RA8A 2EYFA 4IQZA 3PMFA 2NTTA 1ZXTA 2B2YC 2DY7A 4K5VA 4DU9A 5IT9E 4C1NK 1PXUA 3SE0A 4Q5VA 1SNCA 1AP0A 3HZXA 4PMWA 3PUVA 2B2UC 1SE2A 3E6ZX 5ELBA 4TQUS 2A5HA 4XIGS 3G7LA 2A69D 2DN8A 3TP6A 3DEOA 1EQTA 5C4XB 1STNA 3JAML 1I4PA 1VF7A 1NUCA 1WTVA 1ESFA 4IZ8A 1LTGD 4QUCA 5C3EB 3IAYA 1D1KA 3LX0A 2D9UA 3W3AA 1EY5A 2VNUD 1SDFA 5T1IA 4BA1I 4K6LA 5C3WA 1R4PB 1B53A 3IFTA 3NK9A 1MBYA 4CHTB 5JVH3 1O78A 3F2UA 2KA7A 4XT3B 3TZDA 5BN5A 3GD7A 3GTOB 1S4ZA 4FO2A 2DY8A 2Q8IB 4G4KA 1O7YA 2SNSA 2X69A 1Q3LA 4LAAA 2B2WA 5M9OA 4FXDA 1QNKA 3NQTA 3QG1A 4IALA 3D3RA 4K14A 5CORA 1HHVA 4XQQA 1I4QA 4RKLA 2F0SA 5CBAE 4DXFA 3QWNA 4NMZA 5C0XI 1STEA 4K8JA 4E6IA 3CQZB 2F0DA 2XWJB 3K5LA 2I07B 5I9OA 2CQAA 3NWSA 2ID0A 3SK5A 4ID6A 3J81L 4J8QA 3AU7A 1LTID 1EZ8A 1I4HA 1I4XA 1PRTB 2F03A 4KY6A 2K1BA 1SYEA 1F9QA 2F3VA 3N52A 3MZ5A 5CV4A 2Z8LA 1SE3A 5K36G 1PYWD 3VR3A 3C2PA 3TP7A 2EY1A 1E2WA 4IFDG 3PUWA 5FO7B 1I6HB 5D3DA 3A8IE 1TS5A 5I9PA 3A7LA 5AFWA 2RQXA 3DMUA 3SK4A 2B2TC 3E0JA 2YYZA 2D62A 2ICEC 5EPLA 3S2HB 4OO1G 1W6JA 4H13C 1L0YB 3Q6SA 5T1GA 4K2LA 3TSSA 1D5XC 1QB5D 2EYPA 2OXPA 2B2VC 1T5EA 1EIGA 1LTAD 4PNYA 2B2UA 1G8ZD 4OL7A 1FGBD 2EYMA 2NN6H 2PW5A 1CA5A 1BCPD 3A55A 4YIJA 1LT3D 4R8IA 3D6CA 5HGTA 2E2JB 3R2TA 4ZLTF 4XQJA 2JP1A 3NSWA 2B2WC 4JK1C 2FFKB 3S1NB 3TZUA 1OO9B 2XNAC 3P75A 3SR1A 3EQLC 5DAUA 3NTKA 2F0VA 1F2ZA 2IL8A 3VR4A 1RD9D 2NBFA 5BN3A 3SHLA 3D8GA 1EEFD 1TWHB 3BDCA 5JPMC 2QEJC 3X3NA 3HP3A 1PRTF 3VR2A 2WINB 3W2DA 3PUXA 4JBWA 1YNJD 1V8QA 4CBVA 1RHPA 2Z4IA 1PFMA 3M4YA 1D1IA 5J1ZA 2K5DA 5CV7A 3NE5B 4XQNA 1AN8A 1TY2A 1EY9A 1PTOC 1G291 4X3SA 3BVGA 3TMEA 4KD3A 3GTMB 3MXPA 4IUUA 1B44D 1Y69U 3KLSX 1PMRA 1SYFA 2R61A 2WB1B 4BY1B 3A56A 4C3HG 3NPPA 4L8JA 5NUCA 4NDXA 1Q12A 1DCZA 4F87A 1ML0D 3BYYB 3K5MA 3PIO3 1EY6A 2EJFC 2B39A 3RLFA 3M7NA 5ELCA 2ZXOA 3AMUA 2L55A 3Q24A 3NUCA 4HN7A 3WOEA 2JA6B 5C0XG 3GV6A 1AEXA 1YNND 2QF7A 4KJNA 2A6EC 1CK1A 1PZJD 4X3KA 2O5JC 1SYDA 2NZ1D 1OXUA 2EVBA 2OEOA 2NVXB 1STBA 1PLFA 4U68A 1VCIA 1D5ZC 5FO9B 5DM73 4F8MA 4CKEA 1S5FD 3MWYW 2KCCA 1MSHA 2BCOA 5M5YB 2QDBA 4HSVA 2F0MA 4BA2I 4I65A 3H3VC 1H9KA 1VF5C 1STHA 3K58A 2C9OA 3LWEA 3HOUB 3BVMA 3OMGA 2JYOA 2L5TA 3ITPA 5C3XA 3LWUA 1U4RA 1KDAA 4A3DB 5IIFA 3DHQA 3EVQA 1HCZA 1HQMC 5A2QL 2E74C 3FMCA 2Z4HA 2HQEA 5JEAJ 1B9NA 1KTKA 2AQ2B 4DF7A 3R2IA 2JA5B 3VA5A 3FPPA 1GUOA 2MGSA 3GO5A 3MC0B 1ESRA 2KJXA 1JQYD 2YU9B 4FP5D 1IYVA 3S17B 1A3UA 3GV3A 2NB0A 1Y8OB 2NUCA 4FF1A 3V05A 2F0QA 2K5QA 2NYZD 4FF4A 3M4OB 1Q8IA 1PTOD 3M85A 2PW7A 1STGA 4EQOA 1EYDA 3GTQB 1LTRD 4PMBA 1GUGA 2E2HB 3RD4A 3IL8A 1T5XD 3PUZA 1EY8A 4K5WA 1PDQA 4ZKCB 1MD2D 1M4VA 4QUFA 2KQ3A 2KEEA 4KV6A 2Q8TA 5EBDA 2XVSA 5EKLA 1KDBA 3OWEB 2A68C 1WTXA 4RGTA 4Q0FA 2EXZA 3MHBA 5KNBA 1C8CA 2A6HC 1SYGA 1JE4A 1NAPA 1XX8A 1CQFA 2GA4B 3NTHA 1ILPA 1K83B 3K7AB 2X6GA 4KI0A 5DM63 1DYQA 3CKIB 4C3JG 1R9TB 1FNUA 3GQBA 2AQ1B 4CKCA 3HOWB 4IFDH 2PZTA 2Y0SB 2WV6D 4K8IA 3MXNA 4ULLA 2M9VA 5IGGA 5C0XJ 1TWAB 2EYJA 2ZXPA 2EDGA 1HPCA 2FMCA 2AWNA 2IX1A 1PTOB 5LL6X 5C4ZA 2SNMA 4L6TB 4RAUC 5FLXE 5G3LD 2PPBC 1QCBD 5K36H 1GUTA 3KUPA 2EY6A 2F0HA 1QE6A 5HURA 1GJXA 3T51B 1M8AA 1SMYD 4RHSA 4A3IB 1BBXC 4FNFA 3SEBA 4EQNA 1OXTA 4TSSA 3OMCA 5COYA 1MGSA 2WKDA 4DAVA 1ENFA 5KGUA 4XDXA 4C3JB 1X3PA 3V2TA 2F0PA 2R3ZA 4PV1C 3I4MB 2BA1A 5CR3A 2A73B 4QB4A 1BOSA 3H09A 3J81E 1S5ED 3OHXC 4IUNA 5KEEA 1RTOA 2BDNA 2F3WA 1SNDA 2E2DC 2LKVA 1LLRD 3GTLB 1R4QB 3NP8A 4G57A 2NN6I 1JC7A 4KHZA 3HRZC 2HDMA 2KCNA 4K5XA 5JVG3 3WOFA 3C1FA 2K6AA 3C46A 1B1ZA 1B2TA 2SOBA 4G7ZC 1UAPA 2IPKD 2LS01 1QILA 1DOMA 1EY0A 2A68D 1QG7A 5JOBA 1V1OA 2F1MA 3D6WA 3K5NA 4V0BA 2PMZB 4X3UA 3A54A 4K2KA 4KKUA 1ET6A 5M5XB 1TKWB 1TWFB 2MJ8A 3AB9A 3UI2A 3URYA 5C6AA 1G2SA 1FYCA 2RSOA 1BNZA 2AUJD 1NR2A 3S1QB 4HR7B 3HOYB 2R93B 1EY7A 2NN6G 3PUYA 3MTSA 4CGYB 1F9SA 4IUTA 1IHZA 3WDNA 3M3YB 5E3FA 1CQVA 2VUMB 1BR9A 3NXWA 5EPJA 3KLRA 2M2LA 5CC4A 2EJGC 4KJOA 2WIIB 4A3FB 2I46A 1BQQT 5C4HA 3H94A 3MEHA 4XTCS 5JAVA 1PZKD 2XN9C 1LO5D 3ERQA 3RZOB 4KN4C 3VYUA 1EWCA 3VYRA 1XXGA 3FEWX 1UEAB 3RUZA 2PQEA 3U9OA 1SXTA 4NP5A 2IX3A 3R8BA 5KNCA 1A3VA 3I73A 1JWMD 3VR6A 4IURA 4TKOB 1KLGD 2L11A 4NW2A 1U4LA 5IOCA 3MA2B 2RKSA 2EOTA 3H91A 4H44C 2XWBB 2K32A 3EJIA 1IW7C 5EKKA 1I4GA 1G91A 1AFPA 2J0TD 3CHBD 1Z7TA 2QKIC 2N55A 2VXWA 4ZQ3A 2K28A 1HXYD 2A74C 1RCVD 4HAEA 5EKIA 2FJ2A 2EY2A 1RODA 2NWGA 2JA8B 1VMPA 2CW0D 5A35A 2RSNA 2FINB 4H7BA 5ELFA 5CV5A 1B4OA 3T4AC 1I6VC 1RDPD 2AQ3B 4UAIA 5CGKA 1F2LA 1J9OA 1TS2A 4HCEA 5KNDA 3N6RA 2B2TA 3NTIA 1KAAA 2O4XA 2L1BA 4L63B 2F0NA 3DEPA 1KNEA 1DONA 1EYCA 3P1HA 3Q22A 3L3OC 1HA6A 2J4XA 2WP8J 1CFMA 3PIP3 3FKIB 2K01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNU A;  4ZYS A;  3TSS A;  1D5X C;  1SXT A;  2AQ1 B;  3DWA A;  3R8B A;  1B44 D;  1SJH D;  4RGM A;  4C56 C;  1D6E C;  1SEB D;  3KLS X;  1BCP C;  1LTA D;  2RDH A;  3DWQ A;  2CHB D;  2R61 A;  4RCO A;  1BCP B;  1JWM D;  2WV6 D;  3BZD B;  1CT1 D;  3BYT B;  2NTT A;  1G8Z D;  1KTK A;  1S5B D;  1KLG D;  2SEB D;  1HTL D;  1B1Z A;  1FGB D;  1TY0 A;  2AQ2 B;  4DXG A;  5TSS A;  1PRT D;  2IPK D;  3R2I A;  1BCP D;  1I4Q A;  4OHJ A;  1QIL A;  4Z9C B;  3BYY B;  1JWU D;  1LT3 D;  1PTO B;  3MC0 B;  1EEI D;  1UNS A;  3GP7 A;  4DXF A;  1JQY D;  1V1O A;  3R2T A;  1EFI D;  2XRS D;  5D3I B;  1AW7 A;  1SE2 A;  1LT4 D;  1S5D D;  3DWP A;  4L6T B;  1I4G A;  2TSS A;  5ELB A;  1STE A;  1UUP A;  5ELC A;  3CHB D;  5FK9 C;  2RDG A;  1ET6 A;  3V05 A;  2IJ0 A;  1TS3 A;  2XNA C;  3URY A;  5FKA C;  1HXY D;  5ELD A;  1PTO D;  1CK1 A;  1RCV D;  1LTI D;  2XRQ D;  1PZJ D;  1I4H A;  1I4X A;  4RHS A;  1XTC D;  1JR0 D;  1PRT B;  1PZI D;  4RHR A;  1S5C D;  1PTO H;  4O1N A;  1JCK B;  1LTR D;  3SEB A;  5ELF A;  1RD9 D;  4TSS A;  1I4P A;  2ICI A;  1RDP D;  1T5X D;  1LT5 D;  2AQ3 B;  3O13 A;  1EEF D;  1LTT D;  1ESF A;  1GOZ A;  1ENF A;  4RGN A;  2O2L D;  1LTG D;  1LT6 D;  1V1P B;  2QIL A;  1D5Z C;  1MD2 D;  2Z8L A;  1M4V A;  1SE3 A;  1TS2 A;  2QEJ C;  4RGO S;  1PYW D;  3EA6 A;  1CQV A;  1PRT F;  1EU4 A;  4RFB A;  2G9H D;  1S5F D;  1BCP F;  1PRT C;  3EFX D;  4K6L A;  1L0X B;  3OWE B;  5D3D A;  3W2D A;  1EU3 A;  4L63 B;  4UDU C;  5ELE A;  1S5E D;  4RGT A;  1TS5 A;  3MFG A;  1V1P A;  1SBB B;  1SJE D;  1LTS D;  3BVZ A;  1PZK D;  1DJR D;  2XN9 C;  1FNW A;  1CHP D;  1LTB D;  1RF2 D;  1LO5 D;  1BXT A;  1F77 A;  1KLU D;  1SE4 A;  2NTS A;  2J4X A;  4RH6 A;  3BVM A;  1HQR D;  1FD7 D;  1I4R A;  1LLR D;  1EWC A;  1AN8 A;  1TY2 A;  1PTO C;  1CHQ D;  1HA5 A;  1XXG A;  3BVG A;  1D5M C;  1PTO F;  4BWG B;  5I4D A;  1JWS D;  1TS4 A;  1L0Y B;  1FNV A;  1DYQ A;  1ET9 A; 
#chains in the Genus database with same CATH topology
 5CYU A;  1UE5 A;  2B63 H;  2UXC Q;  4MN3 A;  1VQO A;  1I3Q B;  4U67 3;  3HOZ B;  5KRU A;  4Y7N B;  2F0U A;  3CQZ H;  4A93 G;  3UE0 A;  5ELN A;  2JEA I;  2D0O A;  2CHB D;  3D4W A;  4LUV A;  4WFN 3;  5M3F B;  3U9S A;  3K5O A;  4A3J H;  1JOK A;  3FRP B;  4UP8 A;  4BBS H;  5GAD C;  1VQE A;  3J7Y W;  5K5P A;  1Z6H A;  3FVQ A;  2NVQ B;  2JXM B;  4JC0 A;  2OT2 A;  3D4R A;  2M00 A;  2YTV A;  2LFN A;  2MFI A;  1IKL A;  4CKB A;  1IKM A;  4R9W A;  3HS0 C;  5D3I B;  1LYL A;  3IKJ A;  2JQO A;  4QF4 A;  1LAB A;  1PH4 A;  3CCR A;  1WCM B;  4M1U B;  2A19 A;  1KNA A;  2FMM A;  2D2C C;  2OF1 A;  4XT1 B;  4BBS B;  4A3D H;  4A3K H;  3ND9 A;  2F0J A;  1HRJ A;  5FOB B;  4GN3 B;  4QGU A;  1XTC D;  5E7N A;  1JOO A;  1XWE A;  1H9R A;  4KTA A;  2B63 B;  1B3Q A;  5IOD A;  1V43 A;  4NXN L;  3VR5 A;  1CM9 A;  3QIA A;  1KD1 C;  2CVR A;  3S14 B;  3CCV A;  2FXQ A;  3KF8 B;  1V1P B;  1PFB A;  2HCC A;  2K14 A;  3TRE A;  5M3M B;  3EA6 A;  2XTI A;  4RFB A;  4ZUJ A;  3GTL H;  2AWO A;  1KHI A;  3EFX D;  1CUK A;  4QIW B;  1HH2 P;  3IFD A;  2ALY B;  3KK7 A;  1VMC A;  2IWH A;  2KED A;  3BVZ A;  3OSO A;  3TDQ A;  4AYB E;  1LTB D;  1F77 A;  2MQH A;  4H0L C;  3S1R B;  2R7Z H;  3RMH A;  3P7J A;  4PG3 A;  5ISR A;  4G7H C;  1WVL A;  3NBH A;  3M9B A;  1SMX A;  1IBL Q;  5FLM G;  3HOX H;  1N33 L;  4LUO A;  3SXH A;  1QVC A;  3HOY H;  2MP1 A;  4LW1 A;  2F0T A;  4OXP A;  4DGZ A;  5C4J B;  4JVZ A;  1BCP B;  1HNW L;  2Y0S E;  1MSG A;  2ZXR A;  1IBM Q;  2DUD A;  2MO0 A;  1TY0 A;  4DXG A;  3KDF A;  2IW3 A;  5TSS A;  4JI5 L;  3VYT A;  3CC4 A;  4DR6 Q;  1AH9 A;  1K3R A;  3L9A X;  1K0S A;  4LFA Q;  2R92 H;  2KHS A;  1EEI D;  4A3B G;  2XRS D;  3HKZ B;  1OXV A;  4IN3 A;  4B08 A;  5ELO A;  4FYD A;  4V19 0;  1B3A A;  4K6D A;  1TQO A;  4FXG C;  3Q23 A;  1IBL L;  2R93 H;  4DNI A;  1I50 B;  4YCV A;  4IOC A;  5I2Y A;  4O42 A;  1BDO A;  1N34 Q;  1A6X A;  4KN7 C;  4BY7 G;  3I4N B;  4DNT B;  2UXB L;  1HNW Q;  1HZ9 A;  2K5V A;  2NVX H;  2F0K A;  3J7A F;  3GTK H;  5CV8 A;  2F0I A;  5C3E G;  1AE3 A;  4KY7 A;  4X64 Q;  2LXK A;  2EYH A;  4OIK A;  2JE6 I;  1VQI A;  3P20 A;  4NXN Q;  3KF6 B;  4GOP B;  4DR6 L;  2F0E A;  1K8A C;  2CQO A;  2HDL A;  1AZP A;  3R93 A;  2F52 A;  1G6Z A;  3D0F A;  2R7F A;  2KOL A;  1EU3 A;  3D31 A;  3AFP A;  2ENB A;  2Z0S A;  4A3F G;  5IYD G;  1V1P A;  1X3Q A;  2ZJP A;  1WTW A;  1ONL A;  1MI2 A;  3HEJ A;  5FLX L;  3CC7 A;  1IZ6 A;  1DJR D;  4EGV A;  2NVT H;  2HIV A;  1CHP D;  3S1R H;  1Y8N B;  1YNJ C;  1DD2 A;  4B9X A;  3H3V I;  2F0F A;  2NZH A;  4S3S A;  3RN5 A;  4R4Q A;  2I5L X;  3W1B A;  5IGE A;  2V4D A;  1WFQ A;  3RN2 A;  1DOL A;  1G2T A;  3K0X A;  1HA5 A;  4QJF A;  1JMC A;  3L7Z C;  3PO2 B;  4PZ8 A;  1ET9 A;  2N78 A;  1FR3 A;  5EPK A;  2E75 C;  4A3E G;  2D5D A;  3V96 A;  4GNX C;  4X64 L;  4NXM Q;  1NJI C;  1Q86 C;  4HTH A;  4OIJ A;  1WYD A;  1S40 A;  4HED A;  3G6J B;  1HTL D;  5E4X A;  1NBW A;  2AKW B;  1CA6 A;  2UUB L;  3GTK B;  1SYB A;  2PI2 E;  3SDZ A;  4MZ9 A;  2OQ0 A;  5M3F H;  3GP7 A;  4GLV B;  4R8N A;  3SK8 A;  1EWH A;  5FLX c;  1PH8 A;  3QO2 A;  5I6W A;  1LT4 D;  4FXK C;  1XPR A;  1HUN A;  4EQ5 A;  3ND8 A;  2KVM A;  2L9H A;  1GUN A;  4ME3 A;  5M3M H;  4UHV A;  2BE5 D;  1Q81 C;  4YCU A;  1EQR A;  1CZG A;  1JJ2 A;  4A3C G;  2LY7 A;  4LMQ D;  4NXM L;  3K0Y A;  1PZI D;  4C3H B;  3HOV H;  1RKN A;  4O1N A;  4KD4 A;  2SDF A;  2EQS A;  2WAC A;  3OOC A;  3F2B A;  2F0L A;  5I2X A;  1FVI A;  1EIY B;  1N34 L;  2AHO B;  1G6P A;  1WTR A;  1LTT D;  3ULJ A;  3PIO A;  3BG3 A;  3A5Z B;  4WJ4 A;  4G7O C;  4O0A A;  1VQJ A;  3S14 H;  3Q8D A;  3A8J E;  3K6O A;  4POG A;  2EYL A;  1E22 A;  2G9H D;  5IYB H;  5HY6 A;  3E0E A;  4A3G B;  3GTJ H;  3CRK C;  1PVO A;  3E5S A;  5AJ3 L;  4YHH Q;  1W6K A;  2RVL A;  1ASY A;  4X62 L;  1SJE D;  3KLS A;  4IPC A;  2XIW A;  1MJE A;  1KRS A;  3ONA B;  3H0G G;  4F88 A;  1ZKO A;  3DM1 A;  1XYI A;  2HUG A;  3KBX A;  3M4P A;  1PFN A;  3AEV A;  4N8F A;  4QMG A;  4CDD C;  1U4M A;  1FJG Q;  2J7Z A;  4DV0 Q;  3TN2 A;  1FD7 D;  1E24 A;  2JA5 H;  3NBH B;  3SK6 A;  3NEM A;  4X3T A;  2V1C C;  1CTM A;  1PYB A;  2JA7 H;  4ME5 A;  3HGB A;  4IUV A;  3J80 E;  3FHW A;  1AZQ A;  1KC8 C;  2MHV A;  4IUQ A;  4CJ2 C;  5KYI A;  2ASB A;  2JA9 A;  3VDY A;  5JEA G;  4RCO A;  1WD0 A;  1BF4 A;  2WB1 E;  3KBG A;  4A3B B;  4GKK Q;  4ZUI A;  4IPD A;  5IGD A;  4GNX B;  5DNF A;  5JJZ A;  4OON A;  1L0W A;  4DK0 A;  4A76 A;  4A3M H;  1JB3 A;  4DV4 L;  1JWU D;  1GUS A;  3S16 B;  2RCN A;  1ENA A;  3I4N H;  4B3R L;  1QUQ A;  5JEA H;  5FK9 C;  2F4V Q;  1C7Y A;  1TU2 B;  1TS3 A;  5F2D A;  5J22 A;  2KBN A;  4ZKB B;  3HKZ E;  3RNU A;  1B70 B;  4LFB Q;  3TQY A;  5ELD A;  1IL2 A;  4A93 H;  2RDF A;  5E1F A;  4FVM A;  4RHR A;  2JSO A;  1P8L A;  1PTO H;  4CJ0 B;  4LF7 L;  3Q0A A;  3C3L A;  1E2Z A;  5IGB A;  3O13 A;  3MAQ A;  4RKB A;  2EE1 A;  3MXG A;  2K5W A;  2B8F A;  2FHT A;  3GTP B;  4RGO S;  1EQV A;  2F0W A;  2K04 A;  1XMO Q;  2R6G A;  3ZYY X;  3I3C A;  2AUK A;  1SFO B;  2WKC A;  1IBM L;  3R3O A;  1H9S A;  1JJG A;  2AMC B;  2EZV A;  4FF2 A;  4QCL A;  1YBY A;  3TP8 A;  3AQQ A;  3HKZ G;  1Y1W B;  1ENC A;  5C0X H;  1C4Q A;  3NQI A;  4LFA L;  1L2F A;  3ER0 A;  1VQG A;  1HZA A;  2RF4 A;  3S15 B;  2IT1 A;  4ZRZ A;  2Z6K C;  4X62 Q;  4ODG A;  4XYO A;  2OTJ A;  1SYC A;  5C44 H;  4DR3 Q;  1NCV A;  2NVY B;  4BS9 A;  2HHH L;  1X65 A;  2BE5 C;  2L12 A;  5D14 A;  4HID A;  2PMZ E;  5IP7 G;  2A6H D;  2PZW A;  2JEB I;  1D5M C;  1PTO F;  1TR5 A;  5E4W C;  4BWG B;  1JWS D;  3I70 A;  4LF7 Q;  1FJG L;  2O5I C;  2RBM A;  3PO2 H;  3BZD B;  1UE6 A;  4ZYS A;  1MJC A;  1STA A;  1TWG B;  1A8V A;  1N8R C;  4JI8 Q;  1PYS B;  1BCP C;  2WB1 G;  4DNR B;  3DWQ A;  5JJI A;  3J7Z C;  4RWS C;  1SNP A;  3BZC A;  3I8Z A;  3LNN A;  3J80 L;  5C44 G;  4CDF C;  5J39 A;  3FDT A;  4C1N I;  2DGY A;  2N88 A;  4DK1 A;  5IP7 H;  3EIV A;  4MIU A;  1EFI D;  4JI1 L;  1B7Y B;  1YNX A;  1VQA A;  1E7Z A;  3SVM A;  4DR3 L;  1BVS A;  2RDG A;  2KHJ A;  4FF3 A;  1IBK Q;  2VB2 X;  1ZYR D;  5IGF A;  3T53 B;  4IUP A;  4DAP A;  2F4V L;  3I4O A;  5IGC A;  4KY5 A;  3I7F A;  4IFD I;  1JR0 D;  4JI8 L;  4ZK9 B;  4A3E B;  1S5C D;  2R7Z B;  1U9R A;  2MO1 A;  2VUM H;  4PMC A;  2LMC B;  1LT5 D;  3CU7 A;  4HCS A;  1HUM A;  2ZJQ A;  1ICW A;  4IJL A;  1N9W A;  2BA0 A;  4RGN A;  3FKI G;  1GHK A;  4TRD A;  1Q1E A;  1B9M A;  2E76 C;  4C3J H;  2ZJR A;  3I91 A;  4DUY L;  1SFO H;  5IE8 A;  4B3M L;  4X65 Q;  4L5R C;  1FGU A;  3LGJ A;  4B3S Q;  4M8A A;  4DFA A;  4AYB B;  1XMO L;  4CJ1 B;  4OO1 I;  2E2I B;  4MHE A;  4JI0 L;  5C5L A;  4UDU C;  2F4I A;  5JPN C;  1XJV A;  1F2Y A;  5KYL A;  4ZAI A;  4A3K B;  4JI6 Q;  5CV6 A;  2B2Y A;  1QWY A;  1TII D;  5EBC A;  1GXD C;  2IHF A;  2EJM A;  1BXT A;  2PZU A;  1A3T A;  4DAY A;  3HOU G;  2MUY A;  1BO0 A;  2PCF B;  1O7L A;  2K75 A;  3H0G B;  4KKT A;  2K5H A;  4LF6 Q;  4P71 A;  1HTP A;  5I4D A;  1F2M A;  3QOJ A;  1UEB A;  5CBE E;  1NSN S;  1Y1V G;  1W3S A;  4GLA C;  1EOT A;  3F1Z A;  2WAQ B;  1KAB A;  2Z1C A;  1D6E C;  4N9T A;  1N33 Q;  2C5C A;  1QOH A;  2RDH A;  3STB D;  1A2U A;  2CCZ A;  3S15 H;  4B3M Q;  5C4X G;  4XXE A;  4POF A;  3BYT B;  2Z6K A;  1K8M A;  3I72 A;  5A2Q E;  3CRL C;  2E2J H;  4JBM A;  4JW0 A;  2SEB D;  3BS1 A;  2MPM A;  1WTP A;  3AFQ A;  1TT2 A;  1PRT D;  3TRZ A;  4OHJ A;  3I90 A;  3T56 B;  3MVV A;  1DZ1 A;  3S17 H;  4IOA A;  3NBI A;  2UU9 Q;  1YJW A;  1NTG A;  1QNU A;  1SAP A;  1YNN C;  2KUM A;  2TSS A;  1UUP A;  4JI1 Q;  1A0I A;  2A6E D;  2GVA A;  5D65 A;  3HOX B;  2ZT9 C;  3G4S A;  1IBK L;  1ZEQ X;  5GAH C;  1D8L A;  2XRQ D;  1WJJ A;  4JG2 A;  1A2T A;  4DV0 L;  4KHV A;  3TP5 A;  1PH1 A;  1JOR A;  4IO9 A;  2ICI A;  3HOZ G;  1JJC B;  4A93 B;  4DA2 A;  1GOZ A;  2HIX A;  1HR0 W;  4ABN A;  4OO1 H;  4AH6 A;  2QIL A;  1II3 A;  2L4N A;  5CMD A;  2CW0 C;  1XNQ L;  3A8K E;  1CSP A;  4CDE C;  4A3J B;  2X6L A;  1K28 A;  3K81 C;  1S3O A;  2EY5 A;  1NMF A;  2KEC A;  3TBI B;  4C3I B;  4I7Z C;  1BUV T;  1TVX A;  3K57 A;  4GKK L;  4DUY Q;  1L0X B;  3BDO A;  3DUZ A;  4YWM A;  2PQA B;  1VQF A;  3F2D A;  1H9J A;  1H9S B;  3KF8 A;  2H1E A;  4KKS A;  3GTM H;  1GO3 E;  4A3K G;  1SNQ A;  4DV4 Q;  2B8G A;  2PNR C;  5CV9 A;  1G51 A;  1SBB B;  3U58 A;  4JI0 Q;  5EQ0 A;  3KDF B;  3OPO A;  1QZH A;  4JI6 L;  1IL8 A;  2A69 C;  1RF2 D;  1SE4 A;  1JIC A;  1KLU D;  1CKN B;  2KCM A;  1OXX K;  2NTS A;  3S1M B;  2E2H H;  3T13 A;  2JA7 B;  1I4R A;  1ICF B;  2R7D A;  5FJ8 H;  5IYB G;  1CHQ D;  2K03 A;  1VQL A;  1HNZ L;  4C2M B;  1TS4 A;  3T16 A;  5FLM H;  3HOX G;  4APV A;  1HZB A;  1SRO A;  2F0O A;  1CKN A;  1CZW A;  4LF6 L;  4DR2 Q;  1IW7 D;  4EVO A;  1NR4 A;  2LSS A;  4RGM A;  3HOW H;  3CCL A;  3S9W A;  1SEB D;  1I94 Q;  1EYA A;  3L0O A;  2H4O A;  2G9D A;  2NZO A;  3QJY A;  1CT1 D;  1RTN A;  3OIQ A;  4C3H H;  3HOV B;  3PO3 B;  1S5B D;  1EY4 A;  1HR0 Q;  1RIP A;  2JA6 H;  3C1E A;  3JC6 6;  4JCV E;  3VYS A;  3A7A B;  4ZCK A;  1J6Q A;  1EUJ A;  1Y1W G;  1SNO A;  1TWC B;  2C35 B;  4ALP A;  3HOZ H;  4DR4 L;  3SGI A;  3M7G A;  3J7A V;  4GZY C;  1SMY C;  1SSO A;  4WJ3 M;  4A4I A;  4UY8 C;  3ERS X;  1EL0 A;  2JA6 G;  3H3V H;  2BH8 A;  1UE7 A;  4HIM A;  1DXM A;  1C0A A;  2HHH Q;  2XSC A;  1S72 A;  3FPU B;  1STY A;  1ZYR C;  1F9P A;  1I5F A;  2IX0 A;  1JCK B;  4AQY L;  3OW7 A;  3PV0 A;  1CI3 M;  1D7Q A;  1H9M A;  2P5Z X;  1HFN A;  2O2L D;  5C3E H;  1LT6 D;  5EJW A;  4L5Q A;  4L5S A;  3KJO A;  2EYO A;  2RA4 A;  4BBR H;  2Q8R E;  3DXJ C;  2BOS A;  4NPS A;  3PCO B;  4FDB A;  3S2D H;  5FJ8 G;  4C3I G;  1E3P A;  1BCP F;  1PRT C;  3VA7 A;  5M5W H;  1SNM A;  5DEH A;  4DV2 L;  4DAM A;  1RJT A;  4XYQ A;  2VB3 X;  2YU9 H;  5ELE A;  3CME A;  5LMN L;  2PYK A;  3MFG A;  3MXU A;  3E3X A;  1K3B C;  5AJ3 Q;  1JOQ A;  4N9P A;  4X66 Q;  4YHH L;  3TEH B;  5EGT A;  1X9N A;  1VQB A;  2E2I H;  1LV9 A;  1J8I A;  4IFD J;  4J6H A;  1H95 A;  4DPG A;  4P72 A;  5KIX A;  5IP9 H;  1HQR D;  1Y1V B;  1EIH A;  4HMJ A;  2KHI A;  1WTQ A;  4WOR A;  3I4M H;  3CCM A;  5BN4 A;  4OGQ C;  2NVT B;  4P2C B;  2L15 A;  1LAC A;  3GTG B;  1FNV A;  1IYJ B;  1B50 A;  4DV5 Q;  2K33 A;  3I4L A;  3DWA A;  3MEF A;  2B63 G;  3X3M A;  4C56 C;  4C3I H;  4A3L G;  2N8N A;  2RHQ B;  2IY5 B;  4A3G H;  4DR2 L;  2TMP A;  2K7V A;  2PO4 A;  4KMU C;  3ZJY C;  3RZD B;  4HMI A;  1K0R A;  4DKA C;  3UDI A;  3KJP A;  4WRD A;  2A1A A;  3OIP A;  1EZ6 A;  3I4M G;  1JT8 A;  4DN4 M;  4N8X 1;  3BZK A;  2K05 A;  4Z9C B;  4QQB X;  1QJO A;  2DNC A;  5IT9 L;  4R4I A;  4X65 L;  1UNS A;  4JI4 Q;  4B3S L;  1D2B A;  2XGT A;  3OWF A;  3JAM E;  1DOK A;  4LJZ C;  1U4P A;  2B2V A;  1AW7 A;  1KRT A;  5C5M A;  4KK7 A;  1S5D D;  3DWP A;  1O7I A;  1Y8P B;  3CP0 A;  4WJW A;  5LL6 S;  3CCE A;  5M5Y H;  4JV5 L;  2I5M X;  1Q1B A;  2BDO A;  2IJ0 A;  4Y52 H;  5G3L F;  2MNA A;  4A3D G;  1X3F A;  5FKA C;  4PQX A;  1X3E A;  3KYH C;  1WTO A;  3NWT A;  1O7Z A;  4HSP A;  1U5K A;  1GUW A;  1HFG A;  1T9H A;  3BDL A;  2RCF A;  2YTX A;  1C48 A;  2HD3 A;  1PA6 A;  1GHJ A;  5C44 B;  1DM0 B;  3BU2 A;  5FO8 B;  1K8O A;  1Z47 A;  2L0C A;  3ERO A;  3J81 i;  1IYU A;  1SRU A;  4LK1 C;  1A15 A;  1KDC A;  5I6Y A;  3D4D A;  4RCN A;  5IT9 c;  4A3M B;  3K59 A;  1O80 A;  2HCI A;  3H6M A;  4BY7 B;  4NKL A;  3I4N G;  3PO3 G;  1OXS C;  1EU4 A;  3KFU A;  1K83 H;  3K7A H;  1E0B A;  3CW2 C;  3QOL A;  4J1M A;  2I0Q A;  1VDZ A;  1UE1 A;  1TWH H;  4ILW A;  2Z6B A;  3CXC A;  3CC2 A;  4R4O A;  2N49 A;  4DV2 Q;  4LUZ A;  1X32 A;  1GD7 A;  1LTS D;  4RMF A;  3H0G H;  2QCP X;  3NHH A;  2EPB A;  3GTJ B;  2UU9 L;  1FNW A;  3QB3 A;  4B9W A;  1EWI A;  4DR5 Q;  5LHY 1;  4RH6 A;  1WD1 A;  3M3Y H;  1XPU A;  4EQP A;  2PNH A;  4QIW E;  3S24 A;  3S2D B;  1F9R A;  4LF8 L;  2R92 B;  3MFY A;  4F7X A;  4JYA Q;  3K7U C;  4BBR B;  1XMQ Q;  1E2V A;  4JI2 L;  1SJH D;  4DR1 Q;  3ULL A;  2Q2H A;  1A63 A;  1Q90 A;  2F0G A;  1ILQ A;  1DGS A;  3HFZ B;  2OCE A;  5M5W B;  2DNE A;  3HG9 A;  4RA8 A;  5C4J H;  2EYF A;  4IQZ A;  3PMF A;  2NTT A;  4A3J G;  2WFW A;  1ZXT A;  2B2Y C;  2DY7 A;  4K5V A;  4DU9 A;  3FP9 A;  5IT9 E;  4C1N K;  1PXU A;  3SE0 A;  4LWC A;  4Q5V A;  1SNC A;  1AP0 A;  3HZX A;  4PMW A;  4A3B H;  3PUV A;  4GN4 B;  2B2U C;  1SE2 A;  2YTY A;  3E6Z X;  5GAG C;  3PGZ A;  5ELB A;  4TQU S;  2A5H A;  4XIG S;  4DR5 L;  4LNQ A;  3G7L A;  2A69 D;  2DN8 A;  1Q8K A;  1QVG A;  3QR8 A;  3TP6 A;  3BJU A;  2JJQ A;  4JV5 Q;  1VQM A;  3F8T A;  3U4Z A;  3DEO A;  1EQT A;  2E5L Q;  2B29 A;  4DR1 L;  5C4X B;  4OWX B;  4H02 A;  1STN A;  4TVA B;  3JAM L;  4CDC C;  1TWF H;  3JAM i;  1HNZ Q;  1BBU A;  1I4P A;  3ICE A;  1VF7 A;  1NUC A;  4Y7N H;  1WTV A;  1ESF A;  3K80 C;  4IZ8 A;  1LTG D;  4DR7 Q;  4QUC A;  3HKS A;  5C3E B;  3IAY A;  3PF4 A;  1D1K A;  3LX0 A;  2JK8 A;  1I94 L;  2D9U A;  3W3A A;  4DUZ Q;  1EY5 A;  2VNU D;  1K9M C;  3HOY G;  1SDF A;  3CPW A;  4DV1 L;  5T1I A;  4BA1 I;  4K6L A;  1HR0 L;  5C3W A;  1R4P B;  4HJ9 A;  1TWC H;  1B53 A;  3IFT A;  3JAM c;  3NK9 A;  1MBY A;  4CHT B;  1YI2 A;  5JVH 3;  4IJH A;  1O78 A;  3F2U A;  3E9I A;  2KA7 A;  4UPA A;  1Y14 B;  3ULP A;  1KL9 A;  4XT3 B;  3TZD A;  2ATW A;  5BN5 A;  3GD7 A;  3GTO B;  1S4Z A;  1SR3 A;  4BY7 H;  4FO2 A;  2DY8 A;  2IHE A;  2Q8I B;  2G5D A;  4HJA A;  4G4K A;  1O7Y A;  2SNS A;  2X69 A;  1Q3L A;  4LAA A;  2B2W A;  5M9O A;  3RLO A;  1P16 A;  4JYA L;  4FXD A;  1QNK A;  1C9O A;  3NQT A;  4DUZ L;  4AQY Q;  3QG1 A;  4IAL A;  4JI2 Q;  1V1Q A;  3J81 j;  2QW7 A;  3D3R A;  1M90 C;  4K14 A;  2GN5 A;  4YCW A;  5COR A;  1HHV A;  1K73 C;  1EFW A;  2NVQ H;  4XQQ A;  1I4Q A;  4RKL A;  1CKO A;  4UP7 A;  5IYC G;  2F0S A;  2DJF C;  5CBA E;  4DXF A;  5GQO A;  3QWN A;  4NMZ A;  2VQE Q;  5C0X I;  1VS0 A;  1PV4 A;  1STE A;  4K8J A;  4E6I A;  1OTC A;  3CQZ B;  2F0D A;  2XWJ B;  3K5L A;  2I07 B;  5I9O A;  3PO2 G;  2CQA A;  2GVB A;  3NWS A;  2ID0 A;  4X66 L;  3SK5 A;  1PH9 A;  4ID6 A;  1VQ9 A;  4KHP Q;  3J81 L;  4J8Q A;  3AU7 A;  4P75 A;  1LTI D;  1EZ8 A;  1I4H A;  1I4X A;  4EX5 A;  1PRT B;  1YEZ A;  2F03 A;  2JN4 A;  3GTP H;  4KY6 A;  4GLX A;  2K1B A;  1X56 A;  1KIX A;  1SYE A;  4OEL B;  4LFC L;  1L1O B;  1F9Q A;  2F3V A;  3N52 A;  4C2M H;  3MZ5 A;  5CV4 A;  2Z8L A;  1SE3 A;  3K8A A;  5K36 G;  1PYW D;  1X55 A;  3VR3 A;  3C2P A;  4DR7 L;  3TP7 A;  2EY1 A;  1E2W A;  1XNQ Q;  4IFD G;  3PUW A;  1GVP A;  2Y0S G;  5FO7 B;  2VQE L;  1I6H B;  1VQP A;  1ASZ A;  2CH4 W;  5D3D A;  3A8I E;  3NEL A;  1TS5 A;  3G71 A;  5I9P A;  3A7L A;  5AFW A;  4R1J A;  2RQX A;  3DMU A;  1VQ7 A;  4LF4 L;  3SK4 A;  3DLL A;  1VQ5 A;  1MHW C;  2R92 G;  1GM5 A;  2B2T C;  2ZTE A;  3S16 H;  3E0J A;  3HOU H;  2YYZ A;  4I7A A;  4JPB W;  3EBE A;  2D62 A;  2ICE C;  4JBJ A;  5EPL A;  3S2H B;  4OO1 G;  1W6J A;  4H13 C;  4UP9 A;  1L0Y B;  3Q6S A;  5T1G A;  4K2L A;  3TSS A;  4OX9 Q;  1D5X C;  1SE8 A;  3GTQ H;  1QB5 D;  2LXJ A;  2ZM6 Q;  2EYP A;  2OXP A;  4DK6 C;  2B2V C;  1T5E A;  3WWV A;  2D0P A;  1EIG A;  1LTA D;  4PNY A;  2B2U A;  4DAY B;  2KCT A;  1G8Z D;  4OL7 A;  1X54 A;  1FGB D;  2EYM A;  5IYD H;  1HZC A;  2NN6 H;  2PW5 A;  1CA5 A;  1BCP D;  3A55 A;  4YIJ A;  1PFS A;  1LT3 D;  4R8I A;  3D6C A;  5HGT A;  1N32 Q;  2E2J B;  3R2T A;  4GOP A;  1Z9F A;  4ZLT F;  5BR8 Q;  4XQJ A;  2JP1 A;  3NSW A;  2B2W C;  4JK1 C;  3IRB A;  2FFK B;  2JA5 G;  3M4O H;  3S1N B;  3TZU A;  4KLK A;  5H1S E;  1OO9 B;  4HJ5 A;  3CCS A;  4DR4 Q;  1VQK A;  2XNA C;  5HGQ A;  3AYH B;  3P75 A;  3SR1 A;  3EQL C;  4KHP L;  1TXY A;  4BY1 G;  5DAU A;  1EYG A;  3NTK A;  2UUA Q;  2F0V A;  1YJN A;  1F2Z A;  2IL8 A;  2NVY H;  4LF8 Q;  3VR4 A;  1RD9 D;  2NBF A;  5BN3 A;  3SHL A;  4IPH A;  1FL0 A;  3D8G A;  1EEF D;  4DV3 L;  1A62 A;  3RLN A;  1TWH B;  3BDC A;  5JPM C;  2QEJ C;  4PZ6 A;  2QA4 A;  3X3N A;  3PIP A;  3HP3 A;  1PRT F;  3VR2 A;  4OWT B;  1Q7Y C;  4B3T Q;  1PHJ A;  2WIN B;  5BR8 L;  3W2D A;  1K8G A;  3PUX A;  4JBW A;  1YNJ D;  1V8Q A;  4CBV A;  4OWW B;  1YIT A;  1RHP A;  2Z4I A;  1PFM A;  1IXR A;  5LMN Q;  2KEN A;  3M4Y A;  1JB7 A;  1D1I A;  5J1Z A;  4HJ8 A;  4BY1 H;  3CCQ A;  2K5D A;  5CV7 A;  4DV6 L;  4QY7 A;  3NE5 B;  4JI3 L;  4XQN A;  1AN8 A;  1TY2 A;  1EY9 A;  1PTO C;  2UUA L;  1G29 1;  4X3S A;  3BVG A;  3TME A;  4KD3 A;  3TS0 A;  3GTM B;  3MXP A;  4IUU A;  4BBR G;  1JE5 A;  1QUQ B;  1B44 D;  1Y69 U;  2F3I A;  4DV5 L;  3J80 c;  3KLS X;  5L37 A;  4A3C H;  3DM3 A;  1PMR A;  1SYF A;  2R61 A;  4A75 A;  2WB1 B;  4BY1 B;  3A56 A;  4C3H G;  2EIF A;  1YIJ A;  3NPP A;  4L8J A;  5NUC A;  4NDX A;  2WAQ G;  3G6E A;  1Q12 A;  1DCZ A;  1VQ6 A;  3M4Q A;  4F87 A;  1ML0 D;  3BYY B;  3CD6 A;  3K5M A;  4DV1 Q;  1Y1W H;  3PIO 3;  1EY6 A;  2EJF C;  2B39 A;  3RLF A;  1QVF A;  2VZA A;  4JI4 L;  3M7N A;  1N32 L;  5ELC A;  2ZXO A;  2N3S A;  4DV6 Q;  3OYY A;  3AMU A;  2L55 A;  3Q24 A;  3NUC A;  4HN7 A;  3WOE A;  5LMN W;  2JA6 B;  4O2D A;  5C0X G;  3GV6 A;  1XPO A;  1AEX A;  4BXX H;  1YNN D;  2QF7 A;  3J7A 5;  4KJN A;  2A6E C;  1CK1 A;  3NEN A;  1PZJ D;  4X3K A;  1I50 H;  2O5J C;  3UDG A;  5IWA Q;  1SYD A;  1HNX Q;  2NZ1 D;  1OXU A;  1NMG A;  2EVB A;  1M1K C;  2CWA A;  1CKM A;  2OEO A;  2NVX B;  1STB A;  1PLF A;  4U68 A;  1MKH A;  3FKI H;  5M5X H;  1J5E Q;  3I55 A;  1VCI A;  1D5Z C;  5FO9 B;  1KXL A;  5DM7 3;  4DK3 C;  4F8M A;  3PF5 A;  4CKE A;  1S5F D;  3T1H L;  2OWO A;  3MWY W;  2KCC A;  5DLQ E;  1B8A A;  1MSH A;  2BCO A;  4DV7 L;  5M5Y B;  2QDB A;  4HSV A;  2F0M A;  4BBS G;  1WTH A;  4BA2 I;  4BXX G;  2QEX A;  4I65 A;  5LMU L;  3H3V C;  1H9K A;  1VF5 C;  1STH A;  3A0J A;  3K58 A;  2C9O A;  3LWE A;  3HOU B;  3BVM A;  3OMG A;  2JYO A;  2L5T A;  3ITP A;  5C3X A;  3L2P A;  3LWU A;  1U4R A;  2VW9 A;  1KDA A;  2JA7 G;  4A3D B;  3PO3 H;  1Y1V H;  3CF5 A;  5IIF A;  3DHQ A;  3EVQ A;  1HCZ A;  1HQM C;  5A2Q L;  1XMQ L;  2E74 C;  3FMC A;  2Z4H A;  2HQE A;  5JEA J;  5C4X H;  3KOJ A;  1B9N A;  2ZTC A;  3U4V A;  1KTK A;  2Q2T A;  2AQ2 B;  3PQI A;  4DF7 A;  4DV7 Q;  2HT1 A;  4GKJ L;  3R2I A;  3STB C;  2JA5 B;  3VA5 A;  1TWA H;  4A3M G;  3FPP A;  1GUO A;  2MGS A;  3GO5 A;  2ZTD A;  3MC0 B;  1ESR A;  2KJX A;  1JQY D;  2K4K A;  2QDL A;  3U50 C;  2YU9 B;  4FP5 D;  1IYV A;  1VQ8 A;  3S17 B;  1A3U A;  3GV3 A;  2NB0 A;  1Y8O B;  2NUC A;  1YHA A;  4FF1 A;  3V05 A;  1KAW A;  1XTD A;  1R9T H;  4LF4 Q;  2F0Q A;  1W2B A;  2K5Q A;  4HJ7 A;  2NYZ D;  4FF4 A;  3M4O B;  1Q8I A;  1PTO D;  4JOI C;  3PSI A;  3M85 A;  2PW7 A;  1STG A;  2JA8 G;  4EQO A;  3GTO H;  1EYD A;  1U0L A;  3GTQ B;  1LTR D;  4PMB A;  1GUG A;  2E5L L;  2E2H B;  1MIU A;  3RD4 A;  3IL8 A;  1T5X D;  3PUZ A;  1EY8 A;  4K5W A;  5IWA L;  1PDQ A;  3F2C A;  2ZM6 L;  4ZKC B;  1MD2 D;  4GKJ Q;  1M4V A;  4QUF A;  2KQ3 A;  2KEE A;  4KV6 A;  3RZD H;  4R4T A;  2Q8T A;  5EBD A;  2XVS A;  5EKL A;  1KDB A;  3OWE B;  2JA8 H;  1BBW A;  2A68 C;  1WTX A;  4LF5 Q;  4OEM B;  5JJL A;  4RGT A;  4Q0F A;  2EXZ A;  3MHB A;  1PH5 A;  5KNB A;  1C8C A;  2A6H C;  1PH7 A;  5J3B A;  1SYG A;  1JE4 A;  1EOV A;  1NAP A;  1NY4 A;  1XX8 A;  3UDF A;  1VQN A;  1CQF A;  1YHQ A;  2GA4 B;  1X6O A;  3NTH A;  1ILP A;  1K83 B;  3K7A B;  1WCM G;  2X6G A;  5IYC H;  4KI0 A;  1BKB A;  5DM6 3;  1DYQ A;  3CKI B;  4C3J G;  1R9T B;  1FNU A;  3GQB A;  3TS2 A;  2AQ1 B;  2R93 G;  4YY3 Q;  3A74 A;  4CKC A;  3HOW B;  4IFD H;  2PZT A;  2Y0S B;  2VL6 A;  1RL2 A;  2WV6 D;  4K8I A;  3MXN A;  3HOV G;  3J81 c;  4DV3 Q;  2VUM G;  3UE1 A;  2PI2 A;  1Q46 A;  2M9V A;  4ULL A;  5IGG A;  5IY0 A;  5C0X J;  1TWA B;  4LF5 L;  2EYJ A;  2ZXP A;  2EDG A;  1HPC A;  2FMC A;  2AWN A;  2IX1 A;  1PTO B;  4B3T L;  5LL6 X;  5GAE C;  5C4Z A;  1EQQ A;  2SNM A;  4L6T B;  4RAU C;  5FLX E;  2YV5 A;  5G3L D;  1QZG A;  2PPB C;  1PH3 A;  4A3F H;  1QCB D;  5K36 H;  1GUT A;  3KUP A;  2EY6 A;  2F0H A;  2BH2 A;  1QE6 A;  1N36 Q;  5HUR A;  1GJX A;  3T51 B;  1YHB A;  1L1O A;  1M8A A;  1SMY D;  4RHS A;  4YY3 L;  4A3I B;  1BBX C;  4FNF A;  4LF9 Q;  2DJG C;  3SEB A;  4EQN A;  1OXT A;  4TSS A;  3OMC A;  5COY A;  1MGS A;  2WKD A;  4DAV A;  1ENF A;  4AIM A;  1NNX A;  1CSQ A;  2CFM A;  3I2Z A;  4RG1 A;  5KGU A;  1VQD A;  4XDX A;  4C3J B;  4LFC Q;  1X3P A;  1Q82 C;  3V2T A;  2F0P A;  2R3Z A;  4PV1 C;  3I4M B;  2BA1 A;  3W5O A;  3HOW G;  4AYB G;  5CR3 A;  2A73 B;  4QB4 A;  3EN2 A;  1BOS A;  3H09 A;  3J81 E;  2ES2 A;  1VQ4 A;  2OTL A;  1S5E D;  3OHX C;  4IUN A;  4X6A H;  1E1O A;  5KEE A;  1RTO A;  2BDN A;  1LTL A;  1WOC A;  1N36 L;  2F3W A;  1SND A;  3S1Q H;  2E2D C;  2LKV A;  1LLR D;  3GTL B;  4IPG A;  3J80 i;  1R4Q B;  3H15 A;  3NP8 A;  4G57 A;  2NN6 I;  1JC7 A;  4KHZ A;  3HRZ C;  1PH6 A;  2HDM A;  2KCN A;  2QGQ A;  4K5X A;  1AE2 A;  5JVG 3;  3WOF A;  3OTO L;  2UUC Q;  1NE3 A;  3C1F A;  3CPF A;  1HNX L;  4OX9 L;  2K6A A;  1KQS A;  1LM0 A;  4A3I G;  3C46 A;  1XNR Q;  2K52 A;  1HJP A;  2UUB Q;  1TWG H;  4P73 A;  1B1Z A;  1B2T A;  2SOB A;  2PQA A;  4G7Z C;  1LUZ A;  1UAP A;  2IPK D;  2VQF L;  2LS0 1;  4JI7 L;  1QIL A;  5M3F G;  1DOM A;  1EY0 A;  2A68 D;  1QG7 A;  5JOB A;  3T1H Q;  1V1O A;  5EAY A;  2F1M A;  1V9P A;  3D6W A;  3K5N A;  1WCM H;  4V0B A;  2PMZ B;  4GS3 A;  4X3U A;  3A54 A;  4K2K A;  4KKU A;  5GRO A;  1ET6 A;  3RR5 A;  5M5X B;  2Z9H A;  1TKW B;  2HQL A;  1TWF B;  2MJ8 A;  3AB9 A;  3UI2 A;  3URY A;  5C6A A;  4MNO A;  1G2S A;  4YWK A;  1FYC A;  2RSO A;  3OTO Q;  3I56 A;  1BNZ A;  2UUC L;  1WI5 A;  2AUJ D;  1NR2 A;  3S1Q B;  4HR7 B;  4GOP C;  1XNR L;  3HOY B;  2R93 B;  4LF9 L;  1EY7 A;  2NN6 G;  3PUY A;  4NB3 A;  3T1Y Q;  3MTS A;  4CGY B;  2Q2U A;  1F9S A;  4J15 A;  3E9H A;  4IUT A;  4JI5 Q;  1E1T A;  1L1O C;  4A3E H;  1IHZ A;  3WDN A;  2VQF Q;  2A8V A;  5E3F A;  1UWV A;  3M3Y B;  4K0K L;  2RHS B;  1CQV A;  2VUM B;  1YVC A;  1BR9 A;  3KLW A;  3W1G A;  3NXW A;  5EPJ A;  3KLR A;  2M2L A;  2B3G A;  5CC4 A;  2VY3 A;  2EJG C;  4KJO A;  2WII B;  3CCJ A;  4A3F B;  1I3Q H;  2I46 A;  3MXN B;  2K50 A;  1BQQ T;  5C4H A;  3H94 A;  1VQH A;  3MEH A;  4XTC S;  5JAV A;  1PZK D;  4PZ7 A;  2XN9 C;  4A3I H;  1LO5 D;  3ERQ A;  1GKH A;  3CAM A;  1YJ9 A;  3RZO B;  4KN4 C;  3VYU A;  1EWC A;  3VYR A;  1XXG A;  3FEW X;  1UEA B;  3RUZ A;  2PQE A;  1SN8 A;  4L5T A;  2UXB Q;  4JI3 Q;  3U9O A;  1SXT A;  3T1Y L;  4NP5 A;  2IX3 A;  3R8B A;  2CH4 A;  5KNC A;  4A3L H;  4HIO A;  1A3V A;  3I73 A;  1JWM D;  3VR6 A;  4IUR A;  5M3M G;  4TKO B;  1KLG D;  2L11 A;  3GDE A;  4NW2 A;  1U4L A;  5IOC A;  3S2H H;  3MA2 B;  2RKS A;  3CCU A;  2UXD Q;  4JBK A;  4P74 A;  4B3R Q;  2E8G A;  2EOT A;  1I6H H;  3H91 A;  2CWP A;  4GNX A;  4H44 C;  4JI7 Q;  2XWB B;  2K32 A;  5IP9 G;  3EJI A;  1IW7 C;  5EKK A;  1I4G A;  1G91 A;  1AFP A;  2J0T D;  3CHB D;  1Z7T A;  4HIK A;  2QKI C;  2N55 A;  1EIF A;  4LFB L;  2VXW A;  4ZQ3 A;  2CKZ B;  2K28 A;  1HXY D;  2A74 C;  1VQC A;  2K5N A;  1RCV D;  4HAE A;  3S1N H;  5EKI A;  3CMA A;  2FJ2 A;  2EY2 A;  1ROD A;  2NWG A;  2JA8 B;  1VMP A;  2CW0 D;  5A35 A;  2R7Z G;  2RSN A;  2FIN B;  4H7B A;  5ELF A;  5CV5 A;  1B4O A;  3T4A C;  1I6V C;  1RDP D;  2AQ3 B;  3G48 A;  4UAI A;  5CGK A;  1F2L A;  2UXC L;  3A5U A;  1SLJ A;  1J9O A;  2UXD L;  1TS2 A;  2H5X A;  3B6Y A;  4HCE A;  5KND A;  3N6R A;  2B2T A;  2WAQ E;  3NTI A;  1J5E L;  2I5H A;  1KAA A;  4GN5 A;  4A3G G;  4K0K Q;  3OW2 A;  2O4X A;  2Q2I A;  2L1B A;  4L63 B;  2F0N A;  3DEP A;  3UDX A;  4JOI A;  1KNE A;  1DON A;  1YZ6 A;  3KF6 A;  1EYC A;  3P1H A;  1X3G A;  4MTK A;  3Q22 A;  1PH2 A;  5JJK A;  3L3O C;  4R4C A;  1HA6 A;  3RZO H;  2J4X A;  2WP8 J;  2EXD A;  4QL5 A;  3S1M H;  4YWL A;  5LMU Q;  1CFM A;  3PIP 3;  2OQK A;  3GTG H;  3FKI B;  4MTN A;  2K01 A;  2VS1 A; 
#chains in the Genus database with same CATH homology
 5CYU A;  4MN3 A;  1I3Q B;  4U67 3;  3HOZ B;  5KRU A;  4Y7N B;  2F0U A;  2JEA I;  2CHB D;  3D4W A;  4WFN 3;  5M3F B;  3U9S A;  3K5O A;  1JOK A;  3FRP B;  3J7Y W;  5K5P A;  1Z6H A;  3FVQ A;  2NVQ B;  2JXM B;  2OT2 A;  3D4R A;  2M00 A;  2LFN A;  1IKL A;  4CKB A;  1IKM A;  4R9W A;  3HS0 C;  5D3I B;  3IKJ A;  4QF4 A;  1LAB A;  1WCM B;  4M1U B;  1KNA A;  2FMM A;  2D2C C;  2OF1 A;  4XT1 B;  4BBS B;  3ND9 A;  2F0J A;  1HRJ A;  5FOB B;  1XTC D;  1JOO A;  1XWE A;  1H9R A;  4KTA A;  2B63 B;  5IOD A;  1V43 A;  3VR5 A;  1CM9 A;  3QIA A;  3S14 B;  2CVR A;  1V1P B;  1PFB A;  2HCC A;  5M3M B;  3EA6 A;  4RFB A;  4ZUJ A;  2AWO A;  3EFX D;  4QIW B;  3IFD A;  3KK7 A;  1VMC A;  2IWH A;  2KED A;  3BVZ A;  3OSO A;  3TDQ A;  1LTB D;  1F77 A;  4H0L C;  3S1R B;  3RMH A;  3P7J A;  5ISR A;  4G7H C;  1WVL A;  3NBH A;  3SXH A;  2MP1 A;  2F0T A;  4DGZ A;  5C4J B;  1BCP B;  1MSG A;  2ZXR A;  1TY0 A;  4DXG A;  2IW3 A;  5TSS A;  3VYT A;  3L9A X;  2KHS A;  1EEI D;  2XRS D;  3HKZ B;  1OXV A;  4IN3 A;  4B08 A;  4FYD A;  4V19 0;  1B3A A;  4K6D A;  1TQO A;  4FXG C;  3Q23 A;  1I50 B;  5I2Y A;  4O42 A;  1BDO A;  1A6X A;  4KN7 C;  3I4N B;  4DNT B;  2F0K A;  3J7A F;  5CV8 A;  2F0I A;  4KY7 A;  2EYH A;  4OIK A;  2JE6 I;  3P20 A;  2F0E A;  2HDL A;  1AZP A;  3R93 A;  1G6Z A;  2KOL A;  1EU3 A;  3D31 A;  2ENB A;  1V1P A;  1X3Q A;  1WTW A;  1ONL A;  1MI2 A;  3HEJ A;  5FLX L;  4EGV A;  1DJR D;  1CHP D;  1Y8N B;  1YNJ C;  1DD2 A;  4B9X A;  2F0F A;  4S3S A;  5IGE A;  2V4D A;  1DOL A;  1G2T A;  1HA5 A;  3L7Z C;  3PO2 B;  1ET9 A;  1FR3 A;  5EPK A;  2E75 C;  2D5D A;  3V96 A;  4HTH A;  4OIJ A;  4HED A;  3G6J B;  1HTL D;  5E4X A;  1CA6 A;  3GTK B;  1SYB A;  3SDZ A;  3GP7 A;  4R8N A;  3SK8 A;  1EWH A;  3QO2 A;  5I6W A;  1LT4 D;  4FXK C;  1HUN A;  3ND8 A;  2KVM A;  2L9H A;  1GUN A;  2BE5 D;  1CZG A;  2LY7 A;  4LMQ D;  3K0Y A;  1PZI D;  4C3H B;  1RKN A;  4O1N A;  4KD4 A;  2SDF A;  2WAC A;  3OOC A;  2F0L A;  5I2X A;  1WTR A;  1LTT D;  3BG3 A;  4G7O C;  3A8J E;  3K6O A;  2EYL A;  2G9H D;  4A3G B;  3CRK C;  3E5S A;  1W6K A;  2RVL A;  1SJE D;  3KLS A;  2XIW A;  3ONA B;  4F88 A;  1XYI A;  1ZKO A;  3DM1 A;  2HUG A;  3KBX A;  1PFN A;  4QMG A;  1U4M A;  2J7Z A;  3TN2 A;  1FD7 D;  3SK6 A;  4X3T A;  1CTM A;  4ME5 A;  3HGB A;  4IUV A;  3J80 E;  1AZQ A;  2MHV A;  4IUQ A;  4CJ2 C;  5KYI A;  5JEA G;  4RCO A;  1WD0 A;  1BF4 A;  3KBG A;  4A3B B;  4ZUI A;  5IGD A;  5DNF A;  5JJZ A;  4DK0 A;  1JB3 A;  1JWU D;  1GUS A;  3S16 B;  1ENA A;  5JEA H;  5FK9 C;  1TU2 B;  1TS3 A;  5F2D A;  5J22 A;  4ZKB B;  5ELD A;  2RDF A;  5E1F A;  4FVM A;  4RHR A;  2JSO A;  1PTO H;  4CJ0 B;  3Q0A A;  3C3L A;  5IGB A;  1E2Z A;  3O13 A;  3MAQ A;  4RKB A;  2EE1 A;  3GTP B;  2K5W A;  3MXG A;  2B8F A;  2FHT A;  4RGO S;  1EQV A;  2F0W A;  2K04 A;  2R6G A;  3ZYY X;  3I3C A;  2AUK A;  1SFO B;  2WKC A;  3R3O A;  1H9S A;  2EZV A;  4FF2 A;  4QCL A;  3TP8 A;  1Y1W B;  1ENC A;  5C0X H;  1C4Q A;  3NQI A;  3S15 B;  2IT1 A;  4ZRZ A;  4ODG A;  4XYO A;  1SYC A;  1NCV A;  2NVY B;  4BS9 A;  2BE5 C;  5D14 A;  2L12 A;  2A6H D;  2PZW A;  2JEB I;  1D5M C;  1PTO F;  1TR5 A;  5E4W C;  4BWG B;  1JWS D;  3I70 A;  2O5I C;  2RBM A;  3BZD B;  4ZYS A;  1STA A;  1TWG B;  1BCP C;  4DNR B;  3DWQ A;  4RWS C;  1SNP A;  3I8Z A;  3LNN A;  3J80 L;  5J39 A;  3FDT A;  4C1N I;  4DK1 A;  2N88 A;  4MIU A;  1EFI D;  3SVM A;  2RDG A;  4FF3 A;  2VB2 X;  1ZYR D;  5IGF A;  3T53 B;  4IUP A;  4DAP A;  5IGC A;  4KY5 A;  4IFD I;  1JR0 D;  4A3E B;  4ZK9 B;  1S5C D;  2R7Z B;  1U9R A;  4PMC A;  2LMC B;  1LT5 D;  3CU7 A;  4HCS A;  1HUM A;  1ICW A;  2BA0 A;  4RGN A;  1GHK A;  4TRD A;  1Q1E A;  1B9M A;  2E76 C;  3I91 A;  4M8A A;  4DFA A;  4AYB B;  4CJ1 B;  4OO1 I;  2E2I B;  4MHE A;  5C5L A;  4UDU C;  2F4I A;  5JPN C;  1F2Y A;  5KYL A;  4ZAI A;  4A3K B;  5CV6 A;  2B2Y A;  1QWY A;  1TII D;  5EBC A;  1GXD C;  2EJM A;  1BXT A;  2PZU A;  1A3T A;  4DAY A;  2MUY A;  1BO0 A;  2PCF B;  1O7L A;  3H0G B;  4KKT A;  1HTP A;  5I4D A;  1F2M A;  3QOJ A;  5CBE E;  1NSN S;  1EOT A;  2WAQ B;  1KAB A;  2Z1C A;  1D6E C;  4N9T A;  2C5C A;  1QOH A;  2RDH A;  1A2U A;  4XXE A;  3BYT B;  1K8M A;  3I72 A;  5A2Q E;  3CRL C;  2SEB D;  3BS1 A;  2MPM A;  1WTP A;  1TT2 A;  1PRT D;  4OHJ A;  3I90 A;  3T56 B;  3MVV A;  1DZ1 A;  3NBI A;  1QNU A;  1SAP A;  1YNN C;  2KUM A;  2TSS A;  1UUP A;  2A6E D;  5D65 A;  3HOX B;  2ZT9 C;  1ZEQ X;  2XRQ D;  1A2T A;  4KHV A;  3TP5 A;  1JOR A;  2ICI A;  4A93 B;  4DA2 A;  1GOZ A;  4ABN A;  4OO1 H;  2QIL A;  1II3 A;  2L4N A;  5CMD A;  2CW0 C;  3A8K E;  4A3J B;  2X6L A;  2EY5 A;  2KEC A;  3TBI B;  4C3I B;  4I7Z C;  1BUV T;  1TVX A;  3K57 A;  1L0X B;  3BDO A;  3DUZ A;  1H9J A;  1H9S B;  3KF8 A;  2H1E A;  4KKS A;  1SNQ A;  2B8G A;  2PNR C;  5CV9 A;  1SBB B;  5EQ0 A;  3OPO A;  1IL8 A;  2A69 C;  1RF2 D;  1SE4 A;  1JIC A;  1KLU D;  2NTS A;  3S1M B;  1OXX K;  3T13 A;  2JA7 B;  1I4R A;  1CHQ D;  2K03 A;  4C2M B;  1TS4 A;  3T16 A;  2F0O A;  1CZW A;  1IW7 D;  4EVO A;  1NR4 A;  4RGM A;  3S9W A;  1SEB D;  1EYA A;  2H4O A;  2G9D A;  3QJY A;  1CT1 D;  1RTN A;  3OIQ A;  3HOV B;  3PO3 B;  1S5B D;  1EY4 A;  3C1E A;  3VYS A;  3A7A B;  1SNO A;  1TWC B;  3J7A V;  3M7G A;  4GZY C;  1SMY C;  1SSO A;  1EL0 A;  1DXM A;  2XSC A;  3FPU B;  1STY A;  1ZYR C;  1F9P A;  2IX0 A;  1JCK B;  3OW7 A;  3PV0 A;  1CI3 M;  1H9M A;  1HFN A;  2O2L D;  1LT6 D;  5EJW A;  2EYO A;  2RA4 A;  2Q8R E;  3DXJ C;  2BOS A;  4C3I G;  1BCP F;  1PRT C;  3VA7 A;  1SNM A;  5DEH A;  1RJT A;  4XYQ A;  2VB3 X;  5ELE A;  2PYK A;  3MFG A;  3MXU A;  1JOQ A;  4N9P A;  5EGT A;  1LV9 A;  1J8I A;  4IFD J;  4J6H A;  5KIX A;  1EIH A;  1HQR D;  1Y1V B;  4HMJ A;  1WTQ A;  4WOR A;  5BN4 A;  4OGQ C;  2NVT B;  4P2C B;  3GTG B;  1LAC A;  1FNV A;  1B50 A;  2K33 A;  3I4L A;  3DWA A;  3X3M A;  4C56 C;  2TMP A;  2K7V A;  2PO4 A;  4KMU C;  3RZD B;  4HMI A;  4WRD A;  3OIP A;  1EZ6 A;  4DN4 M;  2K05 A;  4Z9C B;  1QJO A;  2DNC A;  5IT9 L;  1UNS A;  1D2B A;  3OWF A;  3JAM E;  1DOK A;  4LJZ C;  1U4P A;  2B2V A;  1AW7 A;  5C5M A;  4KK7 A;  1S5D D;  3DWP A;  1Y8P B;  4WJW A;  5LL6 S;  1Q1B A;  2BDO A;  2IJ0 A;  5G3L F;  5FKA C;  4PQX A;  1WTO A;  3NWT A;  1O7Z A;  4HSP A;  1GUW A;  1HFG A;  3BDL A;  1C48 A;  1GHJ A;  5C44 B;  1DM0 B;  5FO8 B;  1K8O A;  1Z47 A;  2L0C A;  3ERO A;  1IYU A;  4LK1 C;  1A15 A;  1KDC A;  5I6Y A;  3D4D A;  4RCN A;  4A3M B;  3K59 A;  1O80 A;  2HCI A;  3H6M A;  4BY7 B;  4NKL A;  1OXS C;  1EU4 A;  1E0B A;  4J1M A;  3QOL A;  1VDZ A;  4ILW A;  1X32 A;  1LTS D;  2QCP X;  3NHH A;  2EPB A;  3GTJ B;  1FNW A;  3QB3 A;  4B9W A;  5LHY 1;  4RH6 A;  1WD1 A;  4EQP A;  3S2D B;  1F9R A;  2R92 B;  3MFY A;  4F7X A;  4BBR B;  1E2V A;  1SJH D;  1Q90 A;  2F0G A;  1ILQ A;  5M5W B;  2DNE A;  3HG9 A;  4RA8 A;  2EYF A;  4IQZ A;  3PMF A;  2NTT A;  1ZXT A;  2B2Y C;  2DY7 A;  4K5V A;  4DU9 A;  5IT9 E;  4C1N K;  1PXU A;  3SE0 A;  4Q5V A;  1SNC A;  1AP0 A;  3HZX A;  4PMW A;  3PUV A;  2B2U C;  1SE2 A;  3E6Z X;  5ELB A;  4TQU S;  2A5H A;  4XIG S;  3G7L A;  2A69 D;  2DN8 A;  3TP6 A;  3DEO A;  1EQT A;  5C4X B;  1STN A;  3JAM L;  1I4P A;  1VF7 A;  1NUC A;  1WTV A;  1ESF A;  4IZ8 A;  1LTG D;  4QUC A;  5C3E B;  3IAY A;  1D1K A;  3LX0 A;  2D9U A;  3W3A A;  1EY5 A;  2VNU D;  1SDF A;  5T1I A;  4BA1 I;  4K6L A;  5C3W A;  1R4P B;  1B53 A;  3IFT A;  3NK9 A;  1MBY A;  4CHT B;  5JVH 3;  1O78 A;  3F2U A;  2KA7 A;  4XT3 B;  3TZD A;  5BN5 A;  3GD7 A;  3GTO B;  1S4Z A;  4FO2 A;  2DY8 A;  2Q8I B;  4G4K A;  1O7Y A;  2SNS A;  2X69 A;  1Q3L A;  4LAA A;  2B2W A;  5M9O A;  4FXD A;  1QNK A;  3NQT A;  3QG1 A;  4IAL A;  3D3R A;  4K14 A;  5COR A;  1HHV A;  4XQQ A;  1I4Q A;  4RKL A;  2F0S A;  5CBA E;  4DXF A;  3QWN A;  4NMZ A;  5C0X I;  1STE A;  4K8J A;  4E6I A;  3CQZ B;  2F0D A;  2XWJ B;  3K5L A;  2I07 B;  5I9O A;  2CQA A;  3NWS A;  2ID0 A;  3SK5 A;  4ID6 A;  3J81 L;  4J8Q A;  3AU7 A;  1LTI D;  1EZ8 A;  1I4H A;  1I4X A;  1PRT B;  2F03 A;  4KY6 A;  2K1B A;  1SYE A;  1F9Q A;  2F3V A;  3N52 A;  3MZ5 A;  5CV4 A;  2Z8L A;  1SE3 A;  5K36 G;  1PYW D;  3VR3 A;  3C2P A;  3TP7 A;  2EY1 A;  1E2W A;  4IFD G;  3PUW A;  5FO7 B;  1I6H B;  5D3D A;  3A8I E;  1TS5 A;  5I9P A;  3A7L A;  5AFW A;  2RQX A;  3DMU A;  3SK4 A;  2B2T C;  3E0J A;  2YYZ A;  2D62 A;  2ICE C;  5EPL A;  3S2H B;  4OO1 G;  1W6J A;  4H13 C;  1L0Y B;  3Q6S A;  5T1G A;  4K2L A;  3TSS A;  1D5X C;  1QB5 D;  2EYP A;  2OXP A;  2B2V C;  1T5E A;  1EIG A;  1LTA D;  4PNY A;  2B2U A;  1G8Z D;  4OL7 A;  1FGB D;  2EYM A;  2NN6 H;  2PW5 A;  1CA5 A;  1BCP D;  3A55 A;  4YIJ A;  1LT3 D;  4R8I A;  3D6C A;  5HGT A;  2E2J B;  3R2T A;  4ZLT F;  4XQJ A;  2JP1 A;  3NSW A;  2B2W C;  4JK1 C;  2FFK B;  3S1N B;  3TZU A;  1OO9 B;  2XNA C;  3P75 A;  3SR1 A;  3EQL C;  5DAU A;  3NTK A;  2F0V A;  1F2Z A;  2IL8 A;  3VR4 A;  1RD9 D;  2NBF A;  5BN3 A;  3SHL A;  3D8G A;  1EEF D;  1TWH B;  3BDC A;  5JPM C;  2QEJ C;  3X3N A;  3HP3 A;  1PRT F;  3VR2 A;  2WIN B;  3W2D A;  3PUX A;  4JBW A;  1YNJ D;  1V8Q A;  4CBV A;  1RHP A;  2Z4I A;  1PFM A;  3M4Y A;  1D1I A;  5J1Z A;  2K5D A;  5CV7 A;  3NE5 B;  4XQN A;  1AN8 A;  1TY2 A;  1EY9 A;  1PTO C;  1G29 1;  4X3S A;  3BVG A;  3TME A;  4KD3 A;  3GTM B;  3MXP A;  4IUU A;  1B44 D;  1Y69 U;  3KLS X;  1PMR A;  1SYF A;  2R61 A;  2WB1 B;  4BY1 B;  3A56 A;  4C3H G;  3NPP A;  4L8J A;  5NUC A;  4NDX A;  1Q12 A;  1DCZ A;  4F87 A;  1ML0 D;  3BYY B;  3K5M A;  3PIO 3;  1EY6 A;  2EJF C;  2B39 A;  3RLF A;  3M7N A;  5ELC A;  2ZXO A;  3AMU A;  2L55 A;  3Q24 A;  3NUC A;  4HN7 A;  3WOE A;  2JA6 B;  5C0X G;  3GV6 A;  1AEX A;  1YNN D;  2QF7 A;  4KJN A;  2A6E C;  1CK1 A;  1PZJ D;  4X3K A;  2O5J C;  1SYD A;  2NZ1 D;  1OXU A;  2EVB A;  2OEO A;  2NVX B;  1STB A;  1PLF A;  4U68 A;  1VCI A;  1D5Z C;  5FO9 B;  5DM7 3;  4F8M A;  4CKE A;  1S5F D;  3MWY W;  2KCC A;  1MSH A;  2BCO A;  5M5Y B;  2QDB A;  4HSV A;  2F0M A;  4BA2 I;  4I65 A;  3H3V C;  1H9K A;  1VF5 C;  1STH A;  3K58 A;  2C9O A;  3LWE A;  3HOU B;  3BVM A;  3OMG A;  2JYO A;  2L5T A;  3ITP A;  5C3X A;  3LWU A;  1U4R A;  1KDA A;  4A3D B;  5IIF A;  3DHQ A;  3EVQ A;  1HCZ A;  1HQM C;  5A2Q L;  2E74 C;  3FMC A;  2Z4H A;  2HQE A;  5JEA J;  1B9N A;  1KTK A;  2AQ2 B;  4DF7 A;  3R2I A;  2JA5 B;  3VA5 A;  3FPP A;  1GUO A;  2MGS A;  3GO5 A;  3MC0 B;  1ESR A;  2KJX A;  1JQY D;  2YU9 B;  4FP5 D;  1IYV A;  3S17 B;  1A3U A;  3GV3 A;  2NB0 A;  1Y8O B;  2NUC A;  4FF1 A;  3V05 A;  2F0Q A;  2K5Q A;  2NYZ D;  4FF4 A;  3M4O B;  1Q8I A;  1PTO D;  3M85 A;  2PW7 A;  1STG A;  4EQO A;  1EYD A;  3GTQ B;  1LTR D;  4PMB A;  1GUG A;  2E2H B;  3RD4 A;  3IL8 A;  1T5X D;  3PUZ A;  1EY8 A;  4K5W A;  1PDQ A;  4ZKC B;  1MD2 D;  1M4V A;  4QUF A;  2KQ3 A;  2KEE A;  4KV6 A;  2Q8T A;  5EBD A;  2XVS A;  5EKL A;  1KDB A;  3OWE B;  2A68 C;  1WTX A;  4RGT A;  4Q0F A;  2EXZ A;  3MHB A;  5KNB A;  1C8C A;  2A6H C;  1SYG A;  1JE4 A;  1NAP A;  1XX8 A;  1CQF A;  2GA4 B;  3NTH A;  1ILP A;  1K83 B;  3K7A B;  2X6G A;  4KI0 A;  5DM6 3;  1DYQ A;  3CKI B;  4C3J G;  1R9T B;  1FNU A;  3GQB A;  2AQ1 B;  4CKC A;  3HOW B;  4IFD H;  2PZT A;  2Y0S B;  2WV6 D;  4K8I A;  3MXN A;  4ULL A;  2M9V A;  5IGG A;  5C0X J;  1TWA B;  2EYJ A;  2ZXP A;  2EDG A;  1HPC A;  2FMC A;  2AWN A;  2IX1 A;  1PTO B;  5LL6 X;  5C4Z A;  2SNM A;  4L6T B;  4RAU C;  5FLX E;  5G3L D;  2PPB C;  1QCB D;  5K36 H;  1GUT A;  3KUP A;  2EY6 A;  2F0H A;  1QE6 A;  5HUR A;  1GJX A;  3T51 B;  1M8A A;  1SMY D;  4RHS A;  4A3I B;  1BBX C;  4FNF A;  3SEB A;  4EQN A;  1OXT A;  4TSS A;  3OMC A;  5COY A;  1MGS A;  2WKD A;  4DAV A;  1ENF A;  5KGU A;  4XDX A;  4C3J B;  1X3P A;  3V2T A;  2F0P A;  2R3Z A;  4PV1 C;  3I4M B;  2BA1 A;  5CR3 A;  2A73 B;  4QB4 A;  1BOS A;  3H09 A;  3J81 E;  1S5E D;  3OHX C;  4IUN A;  5KEE A;  1RTO A;  2BDN A;  2F3W A;  1SND A;  2E2D C;  2LKV A;  1LLR D;  3GTL B;  1R4Q B;  3NP8 A;  4G57 A;  2NN6 I;  1JC7 A;  4KHZ A;  3HRZ C;  2HDM A;  2KCN A;  4K5X A;  5JVG 3;  3WOF A;  3C1F A;  2K6A A;  3C46 A;  1B1Z A;  1B2T A;  2SOB A;  4G7Z C;  1UAP A;  2IPK D;  2LS0 1;  1QIL A;  1DOM A;  1EY0 A;  2A68 D;  1QG7 A;  5JOB A;  1V1O A;  2F1M A;  3D6W A;  3K5N A;  4V0B A;  2PMZ B;  4X3U A;  3A54 A;  4K2K A;  4KKU A;  1ET6 A;  5M5X B;  1TKW B;  1TWF B;  2MJ8 A;  3AB9 A;  3UI2 A;  3URY A;  5C6A A;  1G2S A;  1FYC A;  2RSO A;  1BNZ A;  2AUJ D;  1NR2 A;  3S1Q B;  4HR7 B;  3HOY B;  2R93 B;  1EY7 A;  2NN6 G;  3PUY A;  3MTS A;  4CGY B;  1F9S A;  4IUT A;  1IHZ A;  3WDN A;  3M3Y B;  5E3F A;  1CQV A;  2VUM B;  1BR9 A;  3NXW A;  5EPJ A;  3KLR A;  2M2L A;  5CC4 A;  2EJG C;  4KJO A;  2WII B;  4A3F B;  2I46 A;  1BQQ T;  5C4H A;  3H94 A;  3MEH A;  4XTC S;  5JAV A;  1PZK D;  2XN9 C;  1LO5 D;  3ERQ A;  3RZO B;  4KN4 C;  3VYU A;  1EWC A;  3VYR A;  1XXG A;  3FEW X;  1UEA B;  3RUZ A;  2PQE A;  3U9O A;  1SXT A;  4NP5 A;  2IX3 A;  3R8B A;  5KNC A;  1A3V A;  3I73 A;  1JWM D;  3VR6 A;  4IUR A;  4TKO B;  1KLG D;  2L11 A;  4NW2 A;  1U4L A;  5IOC A;  3MA2 B;  2RKS A;  2EOT A;  3H91 A;  4H44 C;  2XWB B;  2K32 A;  3EJI A;  1IW7 C;  5EKK A;  1I4G A;  1G91 A;  1AFP A;  2J0T D;  3CHB D;  1Z7T A;  2QKI C;  2N55 A;  2VXW A;  4ZQ3 A;  2K28 A;  1HXY D;  2A74 C;  1RCV D;  4HAE A;  5EKI A;  2FJ2 A;  2EY2 A;  1ROD A;  2NWG A;  2JA8 B;  1VMP A;  2CW0 D;  5A35 A;  2RSN A;  2FIN B;  4H7B A;  5ELF A;  5CV5 A;  1B4O A;  3T4A C;  1I6V C;  1RDP D;  2AQ3 B;  4UAI A;  5CGK A;  1F2L A;  1J9O A;  1TS2 A;  4HCE A;  5KND A;  3N6R A;  2B2T A;  3NTI A;  1KAA A;  2O4X A;  2L1B A;  4L63 B;  2F0N A;  3DEP A;  1KNE A;  1DON A;  1EYC A;  3P1H A;  3Q22 A;  3L3O C;  1HA6 A;  2J4X A;  2WP8 J;  1CFM A;  3PIP 3;  3FKI B;  2K01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...