5ELEA

Cholera toxin el tor b-pentamer in complex with a lewis-y
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIYTLNDKIFSYTESLAGKREMAIITFKNGAIFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Cholera enterotoxin subunit B
publication title High-Resolution Crystal Structures Elucidate the Molecular Basis of Cholera Blood Group Dependence.
pubmed doi rcsb
source organism Vibrio cholerae o1
total genus 26
structure length 103
sequence length 103
chains with identical sequence B, C, D, E, F, G, H, I, J
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5eleA00
2O2LD 1PYWD 1EU3A 1I4GA 1PTOF 1I4PA 1I4HA 1T5XD 1XXGA 4UDUC 1AN8A 1S5ED 1LTSD 1BCPD 1S5BD 3EFXD 3OWEB 4RH6A 5D3IB 3EA6A 1I4XA 4K6LA 2ICIA 1RD9D 2IPKD 1ET6A 1FNWA 1FD7D 1TY2A 4RGNA 4O1NA 1JCKB 2RDGA 3CHBD 1I4RA 1ESFA 1HA5A 3BYYB 1HXYD 2WV6D 2CHBD 1LTAD 5ELEA 1SE4A 1LLRD 1LT4D 1L0XB 1SBBB 1PZID 4RHRA 1PRTD 5ELDA 3SEBA 1PTOC 1UNSA 1G8ZD 1MD2D 2SEBD 1PRTC 3V05A 1SJHD 1TS5A 1BCPF 2QILA 1SEBD 2RDHA 1KLUD 1LT6D 1SXTA 1BCPB 3BVGA 3MFGA 4ZYSA 1M4VA 2XRSD 1SJED 4RGOS 3R8BA 4C56C 1D6EC 3DWQA 2XN9C 1CK1A 1FGBD 2Z8LA 1EEFD 1CHQD 1PZKD 4DXFA 1CT1D 1GOZA 1DJRD 5FK9C 1CQVA 1BXTA 1PTOH 1I4QA 2NTTA 3BZDB 1UUPA 5ELCA 1EU4A 1S5FD 4L63B 1LTID 4DXGA 1LO5D 1PTOD 4TSSA 1LT3D 1RDPD 1PRTB 1V1PA 2TSSA 3GP7A 3URYA 1EWCA 1STEA 4RGMA 4RGTA 1D5XC 5D3DA 2AQ3B 2XRQD 2J4XA 1EFID 1RCVD 1HTLD 1CHPD 1LTGD 1QILA 3KLSX 2QEJC 1B1ZA 1V1OA 2G9HD 1TS3A 3TSSA 1SE2A 2R61A 5FKAC 3DWPA 1XTCD 1AW7A 1F77A 1D5ZC 1SE3A 1TY0A 2NTSA 3R2IA 3BYTB 3MC0B 1V1PB 3DWAA 1ENFA 1B44D 1JQYD 4OHJA 2IJ0A 1EEID 3BVMA 1KTKA 1LTRD 4RHSA 1LT5D 4RCOA 1PTOB 1PRTF 1FNUA 1PZJD 3BVZA 1S5CD 1BCPC 2XNAC 1D5MC 1RF2D 3O13A 5ELFA 5I4DA 1LTTD 1TS2A 4L6TB 1FNVA 3R2TA 1ET9A 1KLGD 4Z9CB 5ELBA 4RFBA 3W2DA 1DYQA 4BWGB 1TS4A 1LTBD 1L0YB 1JWSD 1JR0D 1S5DD 5TSSA 1HQRD 1JWUD 1JWMD 2AQ2B 2AQ1B
chains in the Genus database with same CATH superfamily
3WDNA 2JQOA 1F9QA 5KNDA 2CCZA 5EJWA 2HHHQ 2LKVA 5T1GA 1AP0A 1V43A 2NVXB 1I4XA 3ONAB 1B70B 3MXNB 2OTJA 5IODA 3MEHA 1TWCH 1VQGA 1YHBA 3DXJC 4KKSA 2JJQA 4IPDA 1JCKB 1I50B 4X66L 2LMCB 4JI6L 5C4XH 2IWHA 1I94L 1J5EQ 3CKIB 4NB3A 1Y8OB 1SE4A 4C2MB 5IWAL 3GTPH 1VQ5A 2K5DA 1DZ1A 4JI3L 3C46A 4Q0FA 5ELNA 1EIGA 2X6LA 4GKKL 4A3IH 2ID0A 4IUQA 2CQAA 4ZYSA 1Y1WG 1M4VA 3L9AX 1CZWA 1D6EC 2CKZB 2K32A 5C0XG 5IGBA 1X3FA 4JPBW 2XIWA 2KOLA 3E9HA 2JA7G 1OXSC 3GTLH 2UXDQ 4ZCKA 3OW2A 1A3UA 4IPGA 4FNFA 4A3BG 4DXGA 2SDFA 1LT3D 1J9OA 1G51A 5I2XA 3GP7A 2A73B 2CH4W 4QQBX 1A3TA 2L1BA 3Q22A 3UI2A 3I3CA 1HUMA 4KMUC 1HTLD 1LTGD 1O7LA 2IT1A 4J8QA 1Q8KA 3W3AA 2HDLA 1XTCD 3H0GB 3CMAA 1Y8PB 4JBKA 1DOKA 3S1MB 2A68C 3DM1A 2RVLA 4HMJA 2CH4A 2IJ0A 5EGTA 2OQ0A 4DKAC 2EQSA 1Q81C 2BA0A 3KF6B 3AFQA 3RN2A 5CV9A 5C44H 3NHHA 2O4XA 4RKLA 4L5QA 3PGZA 4UP8A 1NMFA 2E2JB 3I90A 3GTKH 2F0QA 4TQUS 2NVTB 1LTBD 1DOMA 1B4OA 3OWFA 5TSSA 3RLFA 2PPBC 4RMFA 3D3RA 5M9OA 1I5FA 1MKHA 3Q0AA 5C5MA 1QVCA 5K36G 5BN5A 2K04A 5KYLA 4DV4L 4ME5A 1C8CA 1YHAA 4GZYC 4OO1H 5EBCA 3EFXD 5L37A 1BR9A 2KHJA 2MJ8A 1SROA 4G57A 1TY2A 4RGNA 5K5PA 2P5ZX 3T16A 4LFCL 3HOWH 1PA6A 3M4QA 4Y7NH 1HZBA 2AUKA 3RLNA 5M5XH 5KIXA 4MZ9A 1EQQA 4AQYQ 4O2DA 4BY1H 3SEBA 3OTOL 1VDZA 4G7HC 1AZQA 5DLQE 2B8FA 4F87A 1SJHD 3FDTA 2QILA 1HZAA 1BOSA 3MXUA 4XYOA 3MFGA 4C3IH 4JI7Q 2K7VA 4IZ8A 5J22A 4JOIA 1STNA 3AYHB 1X6OA 2VXWA 1A15A 3FRPB 5LMUQ 2CQOA 4KD4A 2O5JC 4DK6C 3G4SA 2RCFA 4OX9Q 2PO4A 4B3TL 2EYFA 3D8GA 3F8TA 1YJWA 1CKNA 2A6ED 3I8ZA 1S5FD 3HOVG 1HQMC 2Z6KC 1XNRQ 1K83H 4DV5Q 1PRTB 1KQSA 1V1PA 4CDFC 2HQEA 1STEA 2NZHA 2N8NA 5CMDA 2JA5G 1D5XC 1VQ8A 2NVQH 3IRBA 3KLSA 4HJ9A 3AMUA 1Z9FA 4JI2L 4PG3A 3KLSX 1Y1VB 1CA5A 1EWHA 1YNNC 4Q5VA 1BF4A 1S72A 3NBIA 1CTMA 4J1MA 2NZOA 1STYA 2ZTCA 4B08A 1B44D 4DU9A 1Y14B 4OHJA 4JI4L 4JV5Q 4A3KB 3X3NA 2Q2IA 4DAYB 4A3LG 1R4QB 1S5CD 4FF2A 1HFNA 4A76A 2JA8B 4BBSG 3MXGA 5FJ8H 4A3FB 2RHSB 2WAQB 3PO3B 2K5HA 1SE8A 4RFBA 1HNXQ 2JA9A 2R7DA 1J6QA 2WFWA 4ZKCB 1OTCA 1ILQA 1T9HA 1HQRD 3NTHA 1CI3M 4QL5A 1SNDA 4DV6L 4B3MQ 1VQJA 1QG7A 3PF4A 3VYSA 1S5BD 3NWTA 1TWFH 5FOBB 2FHTA 4IFDH 1TXYA 4LFBL 5CBAE 4A93B 1HA5A 1E24A 5E4WC 1I3QB 2XGTA 1LLRD 4DV1L 1O7YA 1VF7A 4HJ5A 3S16B 3M4YA 2R93H 3S14H 3PO2H 3A5ZB 1IL8A 1CZGA 1EYDA 2UXCL 5JAVA 2ATWA 1U0LA 1IBML 2EDGA 4DR2L 3RUZA 3KF8A 1PLFA 3H0GG 5HURA 3K0XA 2B2WC 3DM3A 1FJGL 3PIOA 3NTIA 1S40A 2R92G 1QJOA 3CC4A 2IX0A 3PV0A 1Q90A 3MEFA 3CRKC 2ZJQA 4NKLA 2L55A 2MPMA 1WFQA 2YU9B 4NPSA 2NWGA 4GNXC 1B2TA 1SYFA 4DNRB 3J81c 4RGMA 3S2DH 3QR8A 4B9XA 2QKIC 1KNEA 2F0DA 3KJOA 1JE4A 2JEBI 2N55A 1EY6A 5IP9G 5E7NA 1KDBA 1DXMA 2AWOA 1K73C 1PV4A 4A3DG 1IYVA 1N32L 1LYLA 2IHEA 3KBGA 3I56A 1VQLA 4FVMA 1SR3A 1A6XA 3T4AC 3ITPA 4DA2A 3K5LA 5C3EB 5ELFA 4JI8Q 2UUAQ 3FHWA 1E2VA 1CSPA 4RG1A 2SNSA 2K5NA 3MXNA 4KTAA 3J7A5 1HNZL 2HCCA 1X55A 2PYKA 4LF4Q 3T51B 1CQFA 5LL6S 3KLRA 2VQEL 1QUQB 4KY7A 1WYDA 3DMUA 5IYDH 5JJZA 3TRZA 5M3FB 1PYWD 4GNXB 4ALPA 3W1GA 1XYIA 3HOZB 4NDXA 5D3IB 5FLXc 3BDCA 4K8IA 4BY7H 2AKWB 4YHHQ 5C0XJ 1CUKA 3NELA 3T1HQ 4O1NA 4V0BA 2WIIB 1E22A 1GUGA 2QDLA 3IFTA 1E3PA 3I91A 2UUCL 1TWHB 1HXYD 3VYTA 3TP7A 3E9IA 2A6EC 2UUBL 2E2IH 5IIFA 3PIO3 3AU7A 2NN6G 2WB1B 3D0FA 3EJIA 4RHRA 3D31A 3HOYB 2N49A 3PCOB 2K14A 4JOIC 1Y1VG 4HCSA 1HR0Q 5IT9E 3A7AB 1VQEA 4DV2Q 1N34Q 1JC7A 1B9NA 2VW9A 3E0JA 1CKMA 3LGJA 3M9BA 5E3FA 3GD7A 3DWQA 3GTMH 3VR6A 1P16A 3ND9A 5JPMC 2JSOA 2C5CA 1TKWB 1PH5A 4JI5Q 1LABA 1W6JA 2Y0SE 2NZ1D 3GQBA 1V1QA 2CVRA 2LY7A 2XVSA 3PO3G 4LF8Q 3GTOB 2A74C 2JA7B 5IGEA 2N3SA 5D3DA 1ONLA 4X62Q 3KF6A 1K3RA 3OPOA 2X69A 3N52A 5C5LA 3S1QB 1MSHA 3I4MB 4DV7Q 2PI2E 2KHSA 1LTLA 3D4RA 3AQQA 4DK1A 3PF5A 2R7ZB 3BVMA 3HEJA 3CF5A 4RCOA 2SNMA 1IHZA 3VR5A 4FXDA 4IQZA 4N8X1 1WTWA 2ASBA 2RCNA 1GUWA 2LXJA 3OMCA 4K5WA 5IYBG 2EJGC 4DNIA 4A93G 2KCTA 1I6HB 1H95A 1BO0A 1UE7A 2F3VA 2K03A 1HPCA 4O0AA 2GN5A 1D1IA 1ET9A 4C3HB 3J7ZC 1DYQA 2EJFC 5GAHC 3I4OA 2D5DA 2KHIA 1UE1A 1Y1WB 3L2PA 4JBWA 3HOXB 5EQ0A 3H6MA 1O7ZA 2MNAA 4L5SA 3U9SA 4X66Q 4IUNA 4X3TA 2Z4IA 4H44C 1I94Q 4RH6A 2B2VC 1SN8A 1MGSA 4LK1C 4A3BB 2F0EA 3CHBD 1C9OA 4GLAC 4R4QA 1RJTA 3JAME 1NUCA 5ELEA 1K3BC 2BH8A 2LFNA 1LM0A 1EY8A 1W3SA 5LMNL 4FF3A 1MD2D 3G48A 3TEHB 1OXXK 1SEBD 3BVGA 4OO1I 3D4WA 3QOJA 3J7YW 1KAAA 4FO2A 2EIFA 4C56C 4EQOA 2DY8A 2D9UA 4X64Q 1X54A 2GVAA 3NQTA 1DD2A 4DR5L 2F4VL 2ES2A 5JJIA 1I4QA 1C4QA 5CBEE 1K0RA 4NMZA 2MP1A 1HZCA 1STBA 4OWTB 5C4JH 3A0JA 1R9TH 4LF6L 2ENBA 1VCIA 2JA5H 2H1EA 1L0WA 4AYBE 4DAYA 2JA6H 2QEJC 4OGQC 3VA5A 1JJCB 1PYSB 4JVZA 2C35B 1VQ7A 2F0HA 2F0PA 3HOZG 1U4LA 3A54A 1VQMA 2K05A 2NVXH 1NMGA 3GTQB 1F2ZA 4YY3Q 2VUMB 1NAPA 2K5VA 5JEAG 1H9JA 1VMPA 4A3LH 1VF5C 1I50H 2Z6KA 1DONA 1T5EA 5D65A 3SK8A 3Q24A 1QVFA 4DR4L 4QY7A 4ZQ3A 4X3SA 1GUNA 4L6TB 3A8JE 5A2QL 4R8IA 5CR3A 4C2MH 1R4PB 2XSCA 1P8LA 3UDXA 4HTHA 2YYZA 4R1JA 4RKBA 1JWSD 1JR0D 3CRLC 2KEDA 5AFWA 1JWUD 4RWSC 4BXXG 5G3LF 4K2LA 3F2UA 2RDFA 4LFCQ 4IPCA 1S5ED 3EVQA 1SDFA 1PXUA 3QJYA 1N33Q 4KKTA 3EA6A 3HOVB 5CC4A 1PFMA 1RD9D 3IAYA 2KEEA 5GAEC 4FF4A 3VR4A 1N8RC 3UDGA 1IXRA 3G7LA 2A19A 2EVBA 3AFPA 4XT1B 4DGZA 5DEHA 2JEAI 1UNSA 1BBXC 1KDCA 1U4PA 2DN8A 5KEEA 3I4MG 4PMWA 3I55A 2JXMB 2KBNA 3H0GH 1S3OA 2HD3A 4ABNA 1Q1EA 2EYPA 1EY9A 4IPHA 1PFBA 3P1HA 3S1MH 4IFDI 2R7ZG 4C1NI 5KRUA 1ZEQX 4P73A 4BBSB 4KY5A 4CGYB 1S4ZA 2QW7A 1Q7YC 4NXML 3PUWA 4HAEA 4A3EG 4DR6Q 2E2JH 4C3HG 2WKCA 2CWAA 3T13A 2NVTH 2ALYB 1VQ9A 3M4OB 2B2UA 4L5RC 2J4XA 1PH2A 1E7ZA 2EYOA 3HOXG 1NBWA 1TS3A 1BKBA 4LJZC 3UE0A 4QUFA 3J7AF 1Q1BA 3PUYA 2AUJD 2B2WA 3MAQA 1SE3A 4ILWA 3R2IA 5IP9H 1XMQL 3TREA 1B50A 1UE6A 2ZXRA 1QUQA 1A8VA 2E76C 1PRTF 3AB9A 3ERSX 4DUYL 1EY7A 4KI0A 5D14A 5BR8Q 2G9DA 1KL9A 1ZKOA 3RMHA 4GNXA 3ULLA 4HSVA 4CJ1B 1LV9A 5M3MG 2A69C 2GVBA 3BG3A 3R2TA 4EGVA 1EIYB 3TP6A 3HZXA 1PH3A 3V2TA 5HGTA 1YZ6A 2NYZD 1U4MA 3TS0A 4YWMA 4H02A 3WWVA 4EVOA 4L8JA 1VS0A 2R92B 1STHA 1M90C 4UDUC 4JG2A 1X32A 2L4NA 5I6WA 1YEZA 3CCMA 1SYEA 2OQKA 4H7BA 4LFAL 5CV8A 3VR2A 5GAGC 3I4NB 1VQDA 4XT3B 1L2FA 2G5DA 1KRSA 2UXCQ 2E5LL 1TWCB 4PMCA 5GROA 1VQCA 1SFOB 3OSOA 4JK1C 4QMGA 3FVQA 1LT4D 1FR3A 1FGUA 3A74A 2LXKA 4YWKA 1XMOL 3VYRA 2D0OA 2J0TD 4MIUA 4MTKA 2Z4HA 2KCNA 1F2YA 5ELOA 3ULJA 1PRTC 1K8GA 4DK0A 2F1MA 4A3DB 4A3IB 1D8LA 3R8BA 1RL2A 3NP8A 1MSGA 4C1NK 2I5MX 3EN2A 4H0LC 2BOSA 3K8AA 1DJRD 3TP5A 4A3KH 2VUMG 3SK6A 4KKUA 3GV6A 3C2PA 4GOPC 1HRJA 5IY0A 1EU4A 2EJMA 3T56B 2JA8H 4A3FH 3K6OA 1UEBA 1EQVA 1B9MA 1RDPD 4A3GB 3M7GA 3ICEA 3URYA 4HJAA 4DR1L 4DV3L 3PO3H 1A3VA 2VQFL 1SNOA 4CDDC 2EXDA 3GTGB 1B53A 4A3CH 3JC66 4N9TA 3HRZC 5KYIA 2EY6A 4A3MH 4ZUJA 1PVOA 1HTPA 4DUZQ 3CPWA 1YITA 4IJHA 4RCNA 4V190 3BZCA 5FKAC 4X65L 4JYAL 1SYBA 2YTXA 2R7FA 4G7OC 1YIJA 2NTSA 5EKLA 4YIJA 3J80L 3J80i 3TDQA 3Q6SA 4C3JB 4CDEC 2KENA 4X3UA 1HNZQ 1JOQA 1CA6A 5KNCA 5IYCH 4MTNA 3FPUB 4YCUA 1DM0B 4LF9L 2F0FA 5FLMH 3K58A 5I4DA 1I3QH 3H3VH 2DNEA 1X9NA 4K0KL 2HHHL 1JT8A 2AMCB 3S16H 2FXQA 4UP7A 2AWNA 4OL7A 1SYGA 4DAMA 3H3VC 5EBDA 4GOPB 2MQHA 2B2TC 3IKJA 2B2YC 4FP5D 1EU3A 2UUCQ 1J5EL 1BCPD 1PFNA 2UUBQ 4LF5Q 4KN4C 3QG1A 4DR7L 3W1BA 3HOUG 1QE6A 3BU2A 1KRTA 4OELB 2RDGA 2YU9H 4NXNQ 4F7XA 1OXVA 2BH2A 4DV0L 3CP0A 2F03A 1Q12A 3BDOA 5IGCA 1EL0A 1OXUA 1A62A 4R4TA 1RTNA 1QOHA 1Q86C 4JCVE 1IKMA 5M5XB 1IBLQ 3SXHA 1II3A 3I2ZA 4DR3Q 5C6AA 2PW5A 5CGKA 5LHY1 4XQQA 4J6HA 2UXDL 3BDLA 4K5VA 1SJED 3MFYA 3VDYA 4PZ6A 4QIWB 2DUDA 3HP3A 2B2VA 2Q2HA 3J81E 2BA1A 5M5YB 4POGA 1NE3A 1YNJD 2F0LA 2WACA 3CD6A 2H4OA 3M7NA 2BDOA 3NE5B 4L63B 2Z0SA 4RA8A 1PTOD 2XWBB 3MZ5A 5JEAJ 3TZUA 5C3EH 2B2UC 3SHLA 2A6HD 4BBRG 1HFGA 1Z7TA 1XNQQ 1GHJA 2HUGA 1VQHA 1CHPD 1Q82C 1SMYD 3UE1A 3EQLC 3PSIA 4ZLTF 2CFMA 1BVSA 5M3FH 3G6JB 2Q8IB 4QB4A 3DWAA 3HOZH 4XQJA 3NXWA 2PMZB 4POFA 5I6YA 3I4NG 4ZK9B 1FNUA 2B63B 2E8GA 2ZJRA 3P20A 4EX5A 5JEAH 2UU9Q 4K5XA 5EPJA 4B3RL 4CKCA 1GO3E 1TWHH 4FXGC 5DM63 2HT1A 1VQIA 5CV7A 4X3KA 1ZYRD 5FLXE 1SNPA 3HOYH 1JWMD 1ESRA 1U9RA 3U58A 4G7ZC 4BXXH 2O2LD 3SK4A 1N36Q 5E4XA 2F0WA 4ZKBB 4A3IG 1Z6HA 3U4VA 1I4GA 1I4HA 1SAPA 1E1TA 4QCLA 3LWEA 1JOKA 4S3SA 3Q8DA 5COYA 4AQYL 1ET6A 3H91A 3G6EA 1I4RA 5J1ZA 5CV6A 2Y0SG 3R3OA 4A3GG 4JBMA 4MN3A 1L1OA 5EPLA 1L0XB 4CJ2C 3T1YQ 3GTOH 2JA7H 4XXEA 4OX9L 2QGQA 3ND8A 3M85A 3PO2B 4HSPA 1KABA 2RSOA 1BCPF 2DGYA 4DR5Q 2F4VQ 3NTKA 3S1QH 1SXTA 4HJ7A 3ULPA 3L0OA 1WCMB 3EROA 2PZTA 2I0QA 1RTOA 4DV5L 4P74A 2ZM6Q 3TN2A 2J7ZA 1QWYA 2R7ZH 4C3JG 5FK9C 1CQVA 3SK5A 5AJ3Q 1H9SB 2K4KA 3K80C 1WTXA 2E75C 2PQAB 1I6HH 2L11A 1UAPA 4KHPQ 3MHBA 5C44G 4LW1A 3CC7A 1IKLA 1RHPA 4C3HH 1EUJA 3NPPA 1QZHA 4HMIA 2OWOA 1Y1WH 3C3LA 2BE5D 3E3XA 5BN3A 4K14A 5A35A 3HOXH 3RN5A 1PH7A 5C0XH 3FMCA 2R61A 3PQIA 1EFWA 4OONA 1TWAB 2KA7A 3K5OA 4E6IA 3SDZA 1G2TA 1E0BA 1HA6A 3OW7A 2BCOA 3F2BA 1HNXL 1B3AA 4IALA 1NR2A 1X3EA 1WOCA 4OO1G 4A3BH 2K52A 2DNCA 3BVZA 1VQOA 1JJGA 1BCPC 4IUPA 3K7AB 1XPRA 3M3YH 1F2LA 5CV4A 2K50A 1PH1A 1TS2A 4B3ML 5KGUA 1KLGD 2MFIA 2HDMA 4Z9CB 3HOWG 3V96A 2I5LX 2KCCA 3LX0A 3MXPA 3EBEA 1PH6A 2KVMA 4LF7Q 4A3JB 2VS1A 3EIVA 5IGFA 3KOJA 2Q8RE 4J15A 4LUOA 4BY1G 5BN4A 1XX8A 2OTLA 1XXGA 2NVYB 4UP9A 1HUNA 4GKJQ 3SGIA 4P72A 2ICIA 3OMGA 4A3EB 4P71A 3KDFB 4B3SL 4JBJA 2KJXA 2E2HB 1JMCA 4I65A 4R9WA 2A1AA 1DGSA 4YCWA 2K5QA 3L7ZC 2B3GA 4ZAIA 3AEVA 5K36H 1CM9A 4AYBG 2H5XA 1PTOC 5IGDA 5JPNC 1MBYA 3D6WA 5M5WB 4IUUA 4MNOA 4JI6Q 1F9SA 2A6HC 1BCPB 2CWPA 3KK7A 3LNNA 1M1KC 4QJFA 5IWAQ 4NXMQ 3RZDB 4GN3B 1NCVA 3NENA 1HZ9A 4P75A 1SMYC 1XPOA 3CW2C 3GTJB 4EQNA 4JI3Q 1VQBA 3BZKA 4GKKQ 3S17B 5I9PA 3GTQH 2B63G 1VQPA 2V4DA 5M3MB 1Y69U 3OIPA 3K5MA 3A55A 1SRUA 2VZAA 1VQKA 1MIUA 4YCVA 1UWVA 2WAQE 3FKIB 3TP8A 3A8KE 4I7AA 2M9VA 2L5TA 1MJEA 2B39A 2XTIA 4CHTB 1C0AA 1JOOA 1YBYA 3DWPA 3VYUA 4DUYQ 1ZYRC 4ID6A 1IBKL 1TWGB 5EPKA 4JI8L 2UUAL 2F52A 4GN4B 2Q2UA 3HOVH 1PTOB 1AE3A 1X56A 4XDXA 4GOPA 1TVXA 1VQFA 3G71A 2XNAC 4IFDG 2MO1A 2F0NA 5IP7G 3W2DA 4U68A 4FF1A 3DEPA 2XWJB 3J80c 2ZXPA 4R4OA 4DK3C 1KC8C 2R93G 4YHHL 2PNHA 1Q3LA 4TVAB 5C3WA 4CJ0B 2RBMA 3PO2G 1KIXA 4LFAQ 1V8QA 2EYLA 1PH4A 2F0UA 2N88A 2ZTEA 1WCMG 2Z9HA 3KJPA 4DPGA 3S1RB 1K0SA 4LWCA 3RR5A 5F2DA 4PZ8A 4K6LA 4JI1L 2R6GA 1XWEA 2E2DC 1XMOQ 2SOBA 4BBSH 4PZ7A 1L1OC 4DV4Q 2QCPX 1HR0L 3Q23A 4DV2L 2F0MA 2FFKB 4BA1I 4M8AA 3GDEA 4U673 3S1NB 1OXTA 1EIFA 2VNUD 1PFSA 4KJOA 2K01A 3S2HB 3M4OH 3CQZB 2L9HA 2SEBD 3A5UA 1VQNA 2B2TA 2F3IA 2NBFA 2B2YA 4XQNA 5ISRA 1ILPA 1DCZA 4JI5L 4HCEA 2F0IA 2KUMA 3I7FA 2BE5C 1EEFD 1GD7A 2RQXA 3X3MA 2UXBL 3OIQA 3OTOQ 3RZOB 4DR1Q 4F8MA 1WVLA 3I4LA 4B9WA 2VQFQ 1W6KA 4X62L 1JB3A 1ML0D 2Q2TA 4IUTA 3F2DA 3H15A 5FO8B 4DV7L 4CKEA 1IYUA 1C48A 1RODA 4P2CB 4B3TQ 1IL2A 4JYAQ 1EWCA 3IL8A 1QZGA 2BDNA 2MO0A 3FEWX 3S9WA 4A3JG 1PDQA 3KUPA 2FMCA 4KV6A 3WOEA 4I7ZC 3S15B 1L1OB 3TSSA 2FJ2A 3PUZA 1AZPA 1EY0A 2R92H 1D5ZC 5IYDG 5FO9B 3HOUB 4LF9Q 2LS01 2F0JA 3OHXC 4JI2Q 1BBUA 3C1EA 1LTRD 4K0KQ 1OO9B 1WTOA 3DLLA 4PMBA 3I4NH 4BY7G 1SSOA 5J39A 2A5HA 3O13A 3ER0A 4LNQA 2D0PA 4M1UB 1SFOH 1U5KA 3CC2A 4JI4Q 1HH2P 4ZUIA 4WORA 4WFN3 1K8AC 3K57A 4IURA 2EYMA 4DR7Q 4OWWB 1G291 4PV1C 1HNWL 2WB1E 3D4DA 4A3DH 4JW0A 1BDOA 2JE6I 3E6ZX 4GLXA 3HKZE 1Q46A 2RKSA 4DV0Q 4Y52H 2EZVA 1AFPA 2K75A 4NP5A 1U4RA 2QDBA 5CV5A 3MWYW 4DV6Q 1YJNA 4TKOB 4BBRB 1TR5A 2PQEA 4FYDA 2CW0D 3BYYB 3SR1A 4A3GH 4X64L 2RF4A 1QNKA 3GTGH 3VA7A 3FKIG 1H9SA 1G8ZD 2D62A 4K2KA 4LFBQ 2F0KA 5IT9L 2PQAA 3V05A 1B7YB 3QB3A 2QF7A 1KLUD 4DV1Q 1SYCA 3SVMA 2PW7A 2K28A 2IHFA 1CK1A 2F3WA 1CHQD 3LWUA 1SYDA 2OEOA 1ASZA 2A8VA 5LL6X 2K33A 4C3JH 1IBMQ 4DR2Q 1UUPA 1M8AA 1EZ6A 3BS1A 5C4XB 4UY8C 1LO5D 4PQXA 2NN6H 4JI0L 1FJGQ 2F4IA 4DAPA 5H1SE 3GTPB 3L3OC 2L12A 1Y1VH 3E0EA 4RGTA 4CDCC 1EFID 1B1ZA 4QUCA 4YY3L 2F0SA 4KK7A 1ASYA 4L5TA 3U50C 1ENCA 3K5NA 3CU7A 4B3RQ 2DJFC 3MC0B 4CBVA 1ENFA 4IUVA 3HG9A 1EEID 1A2UA 2JYOA 3MVVA 2Y0SB 3GTLB 1X3QA 3CCJA 1KXLA 5JVH3 1EZ8A 1NY4A 2JN4A 3QWNA 2ZTDA 1SLJA 1N32Q 4HIDA 4BWGB 5C3XA 1TS4A 2HCIA 5EKKA 1VMCA 3BJUA 3GO5A 2L0CA 4ULLA 1N33L 4BA2I 5C0XI 1WD0A 3KDFA 4OWXB 4GN5A 4R8NA 4DAVA 1SNQA 4KY6A 1LTSD 1K9MC 2F0TA 3CCVA 2VQEQ 2C9OA 3DHQA 1VQ4A 1X3PA 3K7UC 4DF7A 3ERQA 5IYBH 3CCLA 4A93H 5M5YH 4XTCS 5C44B 4GLVB 3GV3A 3GTKB 3JAML 1JJ2A 5GQOA 3JAMi 3NUCA 1WTQA 3VR3A 3CCUA 1BNZA 1EWIA 1D7QA 1J8IA 3HKSA 3H09A 1PH9A 1G2SA 4HEDA 1GUSA 1XPUA 4TRDA 3KFUA 5FO7B 1E2ZA 1KDAA 2HQLA 5IE8A 4IN3A 3K59A 2JA6G 4HIKA 4DR6L 1MJCA 2JP1A 1JE5A 3R93A 2XN9C 1PZKD 1NJIC 1STGA 1GOZA 3PIPA 1D2BA 5LMNW 1EY4A 1BXTA 4JC0A 5JVG3 1IZ6A 3BZDB 2B63H 1AEXA 3HOWB 2IX1A 3PMFA 4Y7NB 4TSSA 4AH6A 4IFDJ 4QF4A 3RD4A 2AQ3B 2KQ3A 4BY1B 2DJGC 1KNAA 3D6CA 2YTVA 1F9PA 1GKHA 3MTSA 1GM5A 4C3IB 3CCQA 1E2WA 1SE2A 1SNMA 4A3MB 1AW7A 1SNCA 5BR8L 2B8GA 3K81C 4BS9A 4XYQA 3T53B 1KTKA 4ZRZA 5KNBA 2RA4A 3U4ZA 1TQOA 2OXPA 1RIPA 1STAA 1PZJD 4DFAA 2IX3A 3QOLA 1KD1C 2X6GA 1D5MC 1RF2D 1D1KA 1YHQA 1K83B 4AYBB 5JOBA 3WOFA 1CKOA 5ELBA 5IP7H 4WJWA 5A2QE 2NVQB 2GA4B 2CW0C 4PNYA 1GVPA 1YJ9A 3FPPA 2AQ1B 3RLOA 1CFMA 1PHJA 4B3SQ 1MHWC 1WCMH 5DNFA 5DAUA 1YI2A 4IJLA 2RHQB 3CCRA 1HR0W 1G6ZA 3I72A 5CYUA 1WTHA 3NBHB 3TMEA 1RKNA 1WJJA 2FINB 2IL8A 1ENAA 4WJ4A 5C4XG 1WD1A 2K1BA 3J7AV 1FYCA 3IFDA 1C7YA 1K8OA 1SBBB 1PZID 3PIP3 2F0GA 2KECA 2MGSA 2F0OA 2K5WA 1TWAH 4N9PA 2QEXA 4KN7C 1FGBD 3HGBA 5LMNQ 4DN4M 1CT1D 1TWFB 2YTYA 4JI7L 2NTTA 3HS0C 2EYHA 2EXZA 2NUCA 1LTID 1QCBD 1B3QA 5LMUL 2Q8TA 3K7AH 4DUZL 4AIMA 3RNUA 4IO9A 2ZJPA 2IW3A 2R93B 2PCFB 3S14B 1IBKQ 4GS3A 5IOCA 2LSSA 3I4MH 3H94A 1EIHA 4A75A 4K6DA 3QIAA 4A3JH 1EQTA 2AHOB 4FDBA 1XNRL 5NUCA 1FVIA 5GADC 1F77A 4LF6Q 1EY5A 1IW7D 2NVYH 3TBIB 1VQAA 3NK9A 1JQYD 4OEMB 1IYJB 1NNXA 4RAUC 1EQRA 1V9PA 4RHSA 4A3EH 5T1IA 4IOAA 1JB7A 3CCSA 1QB5D 2Z6BA 3J81j 2E2HH 1LTTD 1GHKA 2ZXOA 4JV5L 4LUZA 1O78A 3CXCA 3KLWA 5EKIA 3S2DB 1S5DD 1PMRA 3ZJYC 2OCEA 4N8FA 4LF5L 1UE5A 2EYJA 3SE0A 5M5WH 1KAWA 2DY7A 4JI1Q 4DR4Q 1EOVA 1VQ6A 3KYHC 4NXNL 1PTOF 1WTPA 3HKZB 1I4PA 1T5XD 3RZDH 1N9WA 2VY3A 3DUZA 4X6AH 1QVGA 3GTJH 1WTRA 3S17H 4DNTB 1FNWA 1GXDC 1IBLL 4DR3L 4OIKA 5M3MH 4A3KG 2K6AA 3STBD 4A4IA 2WV6D 2WKDA 1LTAD 1NR4A 5JJLA 2JA8G 1O80A 5C4ZA 4IOCA 4A3FG 3TZDA 1ICWA 1W2BA 4HIOA 2E74C 2WAQG 3HFZB 3FKIH 2UXBQ 2EPBA 4C3IG 1TS5A 4A3CG 4R4CA 1UEAB 4A3MG 1TIID 5IGGA 4HJ8A 2XRSD 4OXPA 2EOTA 4RGOS 4YWLA 1GJXA 1AE2A 3S24A 1TWGH 1ZXTA 2Z8LA 4DXFA 1A63A 4BY7B 1K8MA 1XNQL 3PUXA 1BUVT 3N6RA 3CAMA 1PTOH 1A2TA 4KJNA 5IT9c 5G3LD 5ELCA 3CCEA 1YNJC 4R4IA 1LACA 4G4KA 2JK8A 5IYCG 2VL6A 3UDFA 2RSNA 2E2IB 1HCZA 1CSQA 2KCMA 2N78A 4KLKA 1H9MA 1FL0A 1WTVA 2PZWA 2NB0A 5FLMG 2PNRC 4ODGA 1I6VC 1GUTA 2VB3X 1RCVD 3I73A 1XJVA 1HHVA 1CKNB 2V1CC 2D2CC 1V1OA 3U9OA 2G9HD 1EYCA 2EY2A 2WINB 2EE1A 2UU9L 4ME3A 4FXKC 5HGQA 3GTMB 3BYTB 2VUMH 1V1PB 3S1RH 3FP9A 2PI2A 1H9KA 1LT5D 4APVA 3J80E 2NN6I 4KHVA 1JORA 1G91A 4KD3A 5FJ8G 4OIJA 1X3GA 2A69D 1N36L 1HNWQ 1G6PA 1DOLA 5HY6A 2I46A 1XMQQ 4UAIA 3S1NH 3M3YB 2MHVA 4LMQD 1PYBA 1L0YB 1EYGA 5C4HA 3TS2A 2YV5A 3S2HH 1GUOA 2OT2A 3CQZH 2A68D 2AQ2B 1QNUA 3F2CA 3OYYA 1TT2A 2ZT9C 1XTDA 1YNXA 1Y8NB 1AN8A 2TMPA 4LF4L 2FMMA 1Q8IA 5CORA 3NEMA 2Z1CA 3OWEB 3QO2A 1YVCA 2HIVA 3RZOH 3T1YL 2IPKD 4HN7A 1EOTA 3KBXA 1FD7D 4QIWE 1O7IA 3P75A 4UHVA 5DM73 3PUVA 2F0VA 1ESFA 3P7JA 2I5HA 2L15A 2CHBD 4HR7B 3DEOA 3E5SA 4LUVA 2EY5A 3K0YA 3T1HL 1X65A 5I9OA 2WP8J 4K8JA 5C3EG 5EAYA 3A8IE 1PRTD 5ELDA 2ZM6L 1BBWA 3CPFA 2M00A 2E5LQ 2HIXA 4WJ3M 5AJ3L 2RDHA 3S15H 1LT6D 4HIMA 1WI5A 1TU2B 3NWSA 3JAMc 3NQIA 4KHPL 3B6YA 1Z47A 3OOCA 3W5OA 1LUZA 4JI0Q 3HOUH 3J81L 3J81i 3H3VI 5M3FG 1KHIA 2MUYA 2OF1A 2ICEC 4EQ5A 1N34L 5I2YA 1IW7C 3F1ZA 4CKBA 2PMZE 3ZYYX 3M4PA 1BQQT 1SMXA 1F2MA 4KHZA 3KF8B 4H13C 1B8AA 2TSSA 5JJKA 2M2LA 2XRQD 4NW2A 4MHEA 3C1FA 1QILA 2EY1A 1H9RA 4O42A 2B29A 2I07B 1ICFB 2WB1G 4EQPA 2R3ZA 3CMEA 3HOYG 4LF8L 3HKZG 4DV3Q 1HJPA 1TY0A 1AH9A 3A7LA 3MA2B 3UDIA 4F88A 2QA4A 3A56A 3NSWA 3I70A 1NSNS 4X65Q 1PH8A 2PZUA 1E1OA 4LF7L 4UPAA 4BBRH 1MI2A 1K28A 1YNND 1FNVA 5C4JB 1R9TB 5J3BA 4LAAA 1NTGA 4WRDA 4XIGS 5FLXL 5E1FA 3NBHA 2JA5B 2VB2X 1A0IA 1EYAA 4QGUA 4GKJL 3STBC 2JA6B 2O5IC 1F9RA 2IY5B 1JICA 3TQYA
chains in the Genus database with same CATH topology
3WDNA 1F9QA 5KNDA 5EJWA 2LKVA 5T1GA 1AP0A 1V43A 2NVXB 1I4XA 3ONAB 5IODA 3MEHA 3DXJC 4KKSA 1JCKB 1I50B 2LMCB 2IWHA 3CKIB 1Y8OB 1SE4A 4C2MB 2K5DA 1DZ1A 3C46A 4Q0FA 1EIGA 2X6LA 2ID0A 4IUQA 2CQAA 4ZYSA 1M4VA 3L9AX 1CZWA 1D6EC 2K32A 5C0XG 5IGBA 2XIWA 2KOLA 1OXSC 1A3UA 4FNFA 4DXGA 2SDFA 1LT3D 1J9OA 5I2XA 3GP7A 2A73B 1A3TA 2L1BA 3Q22A 3UI2A 3I3CA 1HUMA 4KMUC 1HTLD 1LTGD 1O7LA 2IT1A 4J8QA 3W3AA 2HDLA 1XTCD 3H0GB 1Y8PB 1DOKA 3S1MB 2A68C 3DM1A 2RVLA 4HMJA 2IJ0A 5EGTA 2BA0A 5CV9A 3NHHA 2O4XA 4RKLA 2E2JB 3I90A 2F0QA 4TQUS 2NVTB 1LTBD 1DOMA 1B4OA 5TSSA 3OWFA 3RLFA 2PPBC 3D3RA 5M9OA 3Q0AA 5C5MA 5K36G 5BN5A 2K04A 5KYLA 4ME5A 1C8CA 4GZYC 4OO1H 5EBCA 3EFXD 1BR9A 2MJ8A 4G57A 1TY2A 4RGNA 5K5PA 3T16A 2AUKA 5KIXA 3SEBA 1VDZA 4G7HC 1AZQA 2B8FA 4F87A 1SJHD 3FDTA 2QILA 4XYOA 1BOSA 3MXUA 3MFGA 2K7VA 4IZ8A 5J22A 1STNA 2VXWA 1A15A 3FRPB 4KD4A 2O5JC 2PO4A 2EYFA 3D8GA 2A6ED 3I8ZA 1S5FD 1HQMC 1PRTB 1V1PA 2HQEA 1STEA 5CMDA 1D5XC 3KLSA 3AMUA 3KLSX 1Y1VB 1CA5A 1EWHA 1YNNC 4Q5VA 1BF4A 3NBIA 1CTMA 4J1MA 1STYA 4B08A 1B44D 4DU9A 4OHJA 4A3KB 3X3NA 1R4QB 1S5CD 4FF2A 1HFNA 2JA8B 3MXGA 4A3FB 2WAQB 3PO3B 4RFBA 4ZKCB 1ILQA 1HQRD 3NTHA 1CI3M 1SNDA 1QG7A 3VYSA 1S5BD 3NWTA 5FOBB 2FHTA 4IFDH 5CBAE 4A93B 1HA5A 5E4WC 1I3QB 1LLRD 1O7YA 1VF7A 3S16B 3M4YA 1IL8A 1CZGA 1EYDA 5JAVA 2EDGA 3RUZA 3KF8A 1PLFA 5HURA 2B2WC 3NTIA 1QJOA 2IX0A 3PV0A 1Q90A 3CRKC 4NKLA 2L55A 2MPMA 2YU9B 2NWGA 1B2TA 1SYFA 4DNRB 4RGMA 4B9XA 2QKIC 1KNEA 2F0DA 1JE4A 2JEBI 2N55A 1EY6A 1KDBA 1DXMA 2AWOA 1IYVA 3KBGA 4FVMA 1A6XA 3T4AC 3ITPA 4DA2A 3K5LA 5C3EB 5ELFA 1E2VA 2SNSA 3MXNA 4KTAA 2HCCA 2PYKA 3T51B 1CQFA 5LL6S 3KLRA 4KY7A 3DMUA 5JJZA 5M3FB 1PYWD 1XYIA 3HOZB 4NDXA 5D3IB 3BDCA 4K8IA 5C0XJ 4O1NA 4V0BA 2WIIB 1GUGA 3IFTA 3I91A 1TWHB 1HXYD 3VYTA 3TP7A 2A6EC 5IIFA 3PIO3 3AU7A 2NN6G 2WB1B 3EJIA 4RHRA 3D31A 3HOYB 4HCSA 5IT9E 3A7AB 1JC7A 1B9NA 3E0JA 5E3FA 3GD7A 3DWQA 3VR6A 3ND9A 5JPMC 2JSOA 2C5CA 1TKWB 1LABA 1W6JA 2NZ1D 3GQBA 2LY7A 2CVRA 2XVSA 3GTOB 2A74C 2JA7B 5IGEA 5D3DA 1ONLA 3OPOA 2X69A 3N52A 5C5LA 3S1QB 1MSHA 3I4MB 2KHSA 3D4RA 4DK1A 2R7ZB 3BVMA 3HEJA 4RCOA 2SNMA 1IHZA 3VR5A 4FXDA 4IQZA 1WTWA 1GUWA 3OMCA 1I6HB 4K5WA 2EJGC 1BO0A 2F3VA 2K03A 1HPCA 1D1IA 1ET9A 4C3HB 1DYQA 2EJFC 2D5DA 1Y1WB 4JBWA 3HOXB 5EQ0A 3H6MA 1O7ZA 3U9SA 4IUNA 4X3TA 2Z4IA 4H44C 4RH6A 2B2VC 1MGSA 4LK1C 4A3BB 2F0EA 3CHBD 1RJTA 3JAME 1NUCA 5ELEA 2LFNA 1EY8A 4FF3A 1MD2D 1OXXK 1SEBD 3BVGA 4OO1I 3D4WA 3QOJA 3J7YW 1KAAA 4FO2A 4C56C 4EQOA 2DY8A 2D9UA 3NQTA 1DD2A 1I4QA 1C4QA 5CBEE 4NMZA 2MP1A 1STBA 2ENBA 1VCIA 2H1EA 4DAYA 2QEJC 4OGQC 3VA5A 2F0HA 2F0PA 1U4LA 3A54A 2K05A 3GTQB 1F2ZA 2VUMB 1NAPA 5JEAG 1H9JA 1VMPA 1VF5C 1DONA 1T5EA 5D65A 3SK8A 3Q24A 4ZQ3A 4X3SA 1GUNA 4L6TB 3A8JE 5A2QL 4R8IA 5CR3A 1R4PB 2XSCA 4HTHA 2YYZA 4RKBA 1JWSD 1JR0D 3CRLC 2KEDA 5AFWA 1JWUD 4RWSC 5G3LF 4K2LA 3F2UA 2RDFA 1S5ED 3EVQA 1SDFA 1PXUA 3QJYA 4KKTA 3EA6A 3HOVB 5CC4A 1PFMA 1RD9D 3IAYA 2KEEA 4FF4A 3VR4A 3G7LA 2EVBA 4XT1B 4DGZA 5DEHA 2JEAI 1UNSA 1BBXC 1KDCA 1U4PA 2DN8A 5KEEA 4PMWA 2JXMB 4ABNA 1Q1EA 2EYPA 1EY9A 1PFBA 3P1HA 4IFDI 4C1NI 5KRUA 1ZEQX 4BBSB 4KY5A 4CGYB 1S4ZA 3PUWA 4HAEA 4C3HG 2WKCA 3T13A 3M4OB 2B2UA 2J4XA 2EYOA 1TS3A 4LJZC 4QUFA 3J7AF 1Q1BA 3PUYA 2AUJD 2B2WA 3MAQA 1SE3A 4ILWA 3R2IA 1B50A 2ZXRA 2E76C 1PRTF 3AB9A 1EY7A 4KI0A 5D14A 2G9DA 1ZKOA 3RMHA 4HSVA 4CJ1B 1LV9A 2A69C 3R2TA 3BG3A 4EGVA 3TP6A 3HZXA 3V2TA 5HGTA 2NYZD 1U4MA 4EVOA 4L8JA 2R92B 1STHA 4UDUC 1X32A 2L4NA 5I6WA 1SYEA 4H7BA 5CV8A 3VR2A 3I4NB 4XT3B 1TWCB 4PMCA 1SFOB 3OSOA 4JK1C 4QMGA 3FVQA 1LT4D 1FR3A 3VYRA 2J0TD 4MIUA 2Z4HA 2KCNA 1F2YA 1PRTC 4DK0A 2F1MA 4A3DB 4A3IB 3R8BA 3NP8A 1MSGA 4C1NK 4H0LC 2BOSA 1DJRD 3TP5A 3SK6A 4KKUA 3GV6A 3C2PA 1HRJA 1EU4A 2EJMA 3T56B 4A3GB 3K6OA 1EQVA 1B9MA 1RDPD 3M7GA 3URYA 1A3VA 1SNOA 3GTGB 1B53A 4N9TA 3HRZC 5KYIA 2EY6A 4ZUJA 1HTPA 4RCNA 4V190 5FKAC 1SYBA 4G7OC 2NTSA 5EKLA 4YIJA 3J80L 3TDQA 3Q6SA 4C3JB 4X3UA 1JOQA 1CA6A 5KNCA 3FPUB 1DM0B 2F0FA 3K58A 5I4DA 2DNEA 2AWNA 4OL7A 1SYGA 3H3VC 5EBDA 2B2TC 3IKJA 2B2YC 4FP5D 1EU3A 1BCPD 1PFNA 4KN4C 3QG1A 1QE6A 2RDGA 4F7XA 1OXVA 2F03A 1EL0A 1Q12A 3BDOA 5IGCA 1OXUA 1RTNA 1QOHA 1IKMA 5M5XB 3SXHA 1II3A 5C6AA 2PW5A 5CGKA 5LHY1 4XQQA 4J6HA 3BDLA 4K5VA 1SJED 3MFYA 4QIWB 3HP3A 2B2VA 3J81E 2BA1A 5M5YB 1YNJD 2F0LA 2WACA 2H4OA 3M7NA 2BDOA 3NE5B 4L63B 4RA8A 1PTOD 2XWBB 3MZ5A 5JEAJ 3TZUA 2B2UC 3SHLA 2A6HD 1HFGA 1Z7TA 1GHJA 2HUGA 1CHPD 1SMYD 3EQLC 4ZLTF 3G6JB 2Q8IB 4QB4A 3DWAA 4XQJA 3NXWA 2PMZB 5I6YA 4ZK9B 1FNUA 2B63B 3P20A 5JEAH 4K5XA 5EPJA 4CKCA 4FXGC 5DM63 5CV7A 4X3KA 1ZYRD 5FLXE 1SNPA 1JWMD 1ESRA 1U9RA 4G7ZC 2O2LD 3SK4A 5E4XA 2F0WA 4ZKBB 1Z6HA 1I4GA 1I4HA 1SAPA 4QCLA 3LWEA 1JOKA 4S3SA 5COYA 1ET6A 3H91A 1I4RA 5J1ZA 5CV6A 3R3OA 4MN3A 5EPLA 1L0XB 4CJ2C 4XXEA 3ND8A 3M85A 3PO2B 4HSPA 1KABA 2RSOA 1BCPF 3NTKA 1SXTA 1WCMB 3EROA 2PZTA 1RTOA 3TN2A 2J7ZA 1QWYA 4C3JG 5FK9C 1CQVA 3SK5A 1H9SB 1WTXA 2E75C 2L11A 1UAPA 3MHBA 1IKLA 1RHPA 3NPPA 4HMIA 3C3LA 2BE5D 5BN3A 4K14A 5A35A 5C0XH 3FMCA 2R61A 1TWAB 2KA7A 3K5OA 4E6IA 3SDZA 1G2TA 1E0BA 1HA6A 3OW7A 2BCOA 1B3AA 4IALA 1NR2A 4OO1G 2DNCA 3BVZA 1BCPC 4IUPA 3K7AB 1F2LA 5CV4A 1TS2A 5KGUA 1KLGD 4Z9CB 2HDMA 3V96A 3LX0A 2KCCA 3MXPA 2KVMA 4A3JB 5IGFA 2Q8RE 5BN4A 1XX8A 1XXGA 2NVYB 1HUNA 2ICIA 3OMGA 4A3EB 2KJXA 2E2HB 4I65A 4R9WA 2K5QA 3L7ZC 4ZAIA 5K36H 1CM9A 1PTOC 5IGDA 5JPNC 1MBYA 3D6WA 5M5WB 4IUUA 1F9SA 2A6HC 1BCPB 3KK7A 3LNNA 3RZDB 1NCVA 1SMYC 3GTJB 4EQNA 3S17B 5I9PA 2V4DA 5M3MB 1Y69U 3OIPA 3K5MA 3A55A 3FKIB 3TP8A 3A8KE 2M9VA 2L5TA 2B39A 4CHTB 1JOOA 3DWPA 3VYUA 1ZYRC 4ID6A 1TWGB 5EPKA 1PTOB 4XDXA 1TVXA 2XNAC 4IFDG 2F0NA 3W2DA 4U68A 4FF1A 3DEPA 2XWJB 2ZXPA 5C3WA 1Q3LA 4CJ0B 2RBMA 1V8QA 2EYLA 2F0UA 2N88A 3S1RB 5F2DA 4K6LA 2R6GA 1XWEA 2E2DC 2SOBA 2QCPX 3Q23A 2F0MA 2FFKB 4BA1I 4M8AA 4U673 3S1NB 1OXTA 2VNUD 4KJOA 2K01A 3S2HB 3CQZB 2L9HA 2SEBD 2B2TA 2NBFA 2B2YA 4XQNA 5ISRA 1ILPA 1DCZA 4HCEA 2F0IA 2KUMA 2BE5C 1EEFD 2RQXA 3X3MA 3OIQA 3RZOB 4F8MA 1WVLA 4B9WA 3I4LA 1W6KA 1JB3A 1ML0D 4IUTA 5FO8B 4CKEA 1IYUA 1C48A 1RODA 4P2CB 1EWCA 3IL8A 2BDNA 3FEWX 3S9WA 1PDQA 3KUPA 2FMCA 4KV6A 3WOEA 4I7ZC 3S15B 3TSSA 2FJ2A 3PUZA 1AZPA 1EY0A 1D5ZC 5FO9B 3HOUB 2LS01 2F0JA 3OHXC 3C1EA 1LTRD 1OO9B 1WTOA 4PMBA 1SSOA 5J39A 2A5HA 3O13A 4M1UB 4ZUIA 4WORA 4WFN3 3K57A 4IURA 2EYMA 1G291 4PV1C 3D4DA 1BDOA 2JE6I 3E6ZX 2RKSA 2EZVA 1AFPA 4NP5A 1U4RA 2QDBA 5CV5A 3MWYW 4TKOB 4BBRB 1TR5A 2PQEA 4FYDA 2CW0D 3BYYB 3SR1A 1QNKA 3VA7A 1H9SA 1G8ZD 2D62A 4K2KA 2F0KA 5IT9L 3V05A 3QB3A 2QF7A 1KLUD 1SYCA 3SVMA 2PW7A 2K28A 1CK1A 2F3WA 1CHQD 3LWUA 1SYDA 2OEOA 5LL6X 2K33A 1UUPA 1M8AA 1EZ6A 3BS1A 5C4XB 1LO5D 4PQXA 2NN6H 2F4IA 4DAPA 3GTPB 3L3OC 2L12A 4RGTA 1EFID 1B1ZA 4QUCA 2F0SA 4KK7A 1ENCA 3K5NA 3CU7A 3MC0B 4CBVA 1ENFA 4IUVA 3HG9A 1EEID 1A2UA 2JYOA 3MVVA 2Y0SB 3GTLB 1X3QA 5JVH3 1EZ8A 3QWNA 4BWGB 5C3XA 1TS4A 2HCIA 5EKKA 1VMCA 3GO5A 2L0CA 4ULLA 4BA2I 5C0XI 1WD0A 4R8NA 4DAVA 1SNQA 4KY6A 1LTSD 2F0TA 2C9OA 3DHQA 1X3PA 4DF7A 3ERQA 4XTCS 5C44B 3GV3A 3GTKB 3JAML 3NUCA 1WTQA 3VR3A 1BNZA 1J8IA 3H09A 1G2SA 4HEDA 1GUSA 4TRDA 5FO7B 1E2ZA 1KDAA 4IN3A 3K59A 2JP1A 3R93A 2XN9C 1PZKD 1STGA 1GOZA 1D2BA 1EY4A 1BXTA 5JVG3 3BZDB 1AEXA 3HOWB 2IX1A 3PMFA 4Y7NB 4TSSA 4IFDJ 4QF4A 3RD4A 2AQ3B 2KQ3A 4BY1B 1KNAA 3D6CA 1F9PA 3MTSA 4C3IB 1E2WA 1SE2A 1SNMA 4A3MB 1AW7A 1SNCA 2B8GA 4BS9A 4XYQA 3T53B 1KTKA 4ZRZA 5KNBA 2RA4A 1TQOA 2OXPA 1STAA 1PZJD 4DFAA 2IX3A 3QOLA 2X6GA 1D5MC 1RF2D 1D1KA 1K83B 4AYBB 5JOBA 3WOFA 5ELBA 4WJWA 5A2QE 2NVQB 2GA4B 2CW0C 4PNYA 3FPPA 2AQ1B 1CFMA 5DNFA 5DAUA 1G6ZA 3I72A 5CYUA 3TMEA 1RKNA 2FINB 2IL8A 1ENAA 1WD1A 2K1BA 3J7AV 1FYCA 3IFDA 1K8OA 1SBBB 1PZID 3PIP3 2F0GA 2KECA 2MGSA 2F0OA 2K5WA 4N9PA 4KN7C 1FGBD 3HGBA 4DN4M 1CT1D 1TWFB 2NTTA 3HS0C 2EYHA 2EXZA 2NUCA 1LTID 1QCBD 2Q8TA 2IW3A 2R93B 2PCFB 3S14B 5IOCA 3H94A 1EIHA 4K6DA 3QIAA 1EQTA 5NUCA 1F77A 1EY5A 1IW7D 3TBIB 3NK9A 1JQYD 4RAUC 4RHSA 5T1IA 1QB5D 1LTTD 1GHKA 2ZXOA 1O78A 5EKIA 3S2DB 1S5DD 1PMRA 2EYJA 3SE0A 2DY7A 1PTOF 1WTPA 3HKZB 1I4PA 1T5XD 3DUZA 1WTRA 4DNTB 1FNWA 1GXDC 4OIKA 2K6AA 2WV6D 2WKDA 1LTAD 1NR4A 1O80A 5C4ZA 3TZDA 1ICWA 2E74C 2EPBA 4C3IG 1TS5A 1UEAB 1TIID 5IGGA 2XRSD 2EOTA 4RGOS 1GJXA 1ZXTA 2Z8LA 4DXFA 4BY7B 1K8MA 3PUXA 1BUVT 3N6RA 4KJNA 1PTOH 1A2TA 5G3LD 5ELCA 1YNJC 1LACA 4G4KA 2RSNA 2E2IB 1HCZA 1H9MA 1WTVA 2PZWA 2NB0A 2PNRC 4ODGA 1I6VC 1GUTA 2VB3X 1RCVD 3I73A 1HHVA 2D2CC 1V1OA 3U9OA 2G9HD 1EYCA 2EY2A 2WINB 2EE1A 4FXKC 3GTMB 3BYTB 1V1PB 1H9KA 1LT5D 3J80E 2NN6I 4KHVA 1JORA 1G91A 4KD3A 4OIJA 2A69D 1DOLA 2I46A 4UAIA 3M3YB 2MHVA 4LMQD 1L0YB 5C4HA 1GUOA 2OT2A 2A68D 2AQ2B 1QNUA 1TT2A 2ZT9C 1Y8NB 1AN8A 2TMPA 2FMMA 1Q8IA 5CORA 2Z1CA 3OWEB 3QO2A 2IPKD 4HN7A 1EOTA 3KBXA 1FD7D 5DM73 3P75A 3PUVA 2F0VA 1ESFA 3P7JA 2CHBD 4HR7B 3DEOA 3E5SA 2EY5A 3K0YA 5I9OA 2WP8J 4K8JA 3A8IE 1PRTD 5ELDA 2M00A 2RDHA 1LT6D 1TU2B 3NWSA 3NQIA 1Z47A 3OOCA 3J81L 2MUYA 2OF1A 2ICEC 5I2YA 1IW7C 4CKBA 3ZYYX 1BQQT 1F2MA 4KHZA 4H13C 2TSSA 2M2LA 2XRQD 4NW2A 4MHEA 3C1FA 1QILA 2EY1A 1H9RA 4O42A 2I07B 4EQPA 2R3ZA 1TY0A 3A7LA 3MA2B 4F88A 3A56A 3NSWA 3I70A 1NSNS 2PZUA 1MI2A 1YNND 1FNVA 5C4JB 1R9TB 4LAAA 4WRDA 4XIGS 5FLXL 5E1FA 3NBHA 2JA5B 2VB2X 1EYAA 2JA6B 2O5IC 1F9RA 1JICA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O2L D;  1PYW D;  1EU3 A;  1I4G A;  1PTO F;  1I4P A;  1I4H A;  1T5X D;  1XXG A;  4UDU C;  1AN8 A;  1S5E D;  1LTS D;  1BCP D;  1S5B D;  3EFX D;  3OWE B;  4RH6 A;  5D3I B;  3EA6 A;  1I4X A;  4K6L A;  2ICI A;  1RD9 D;  2IPK D;  1ET6 A;  1FNW A;  1FD7 D;  1TY2 A;  4RGN A;  4O1N A;  1JCK B;  2RDG A;  3CHB D;  1I4R A;  1ESF A;  1HA5 A;  3BYY B;  1HXY D;  2WV6 D;  2CHB D;  1LTA D;  5ELE A;  1SE4 A;  1LLR D;  1LT4 D;  1L0X B;  1SBB B;  1PZI D;  4RHR A;  1PRT D;  5ELD A;  3SEB A;  1PTO C;  1UNS A;  1G8Z D;  1MD2 D;  2SEB D;  1PRT C;  3V05 A;  1SJH D;  1TS5 A;  1BCP F;  2QIL A;  1SEB D;  2RDH A;  1KLU D;  1LT6 D;  1SXT A;  1BCP B;  3BVG A;  3MFG A;  4ZYS A;  1M4V A;  2XRS D;  1SJE D;  4RGO S;  3R8B A;  4C56 C;  1D6E C;  3DWQ A;  2XN9 C;  1CK1 A;  1FGB D;  2Z8L A;  1EEF D;  1CHQ D;  1PZK D;  4DXF A;  1CT1 D;  1GOZ A;  1DJR D;  5FK9 C;  1CQV A;  1BXT A;  1PTO H;  1I4Q A;  2NTT A;  3BZD B;  1UUP A;  5ELC A;  1EU4 A;  1S5F D;  4L63 B;  1LTI D;  4DXG A;  1LO5 D;  1PTO D;  4TSS A;  1LT3 D;  1RDP D;  1PRT B;  1V1P A;  2TSS A;  3GP7 A;  3URY A;  1EWC A;  1STE A;  4RGM A;  4RGT A;  1D5X C;  5D3D A;  2AQ3 B;  2XRQ D;  2J4X A;  1EFI D;  1RCV D;  1HTL D;  1CHP D;  1LTG D;  1QIL A;  3KLS X;  2QEJ C;  1B1Z A;  1V1O A;  2G9H D;  1TS3 A;  3TSS A;  1SE2 A;  2R61 A;  5FKA C;  3DWP A;  1XTC D;  1AW7 A;  1F77 A;  1D5Z C;  1SE3 A;  1TY0 A;  2NTS A;  3R2I A;  3BYT B;  3MC0 B;  1V1P B;  3DWA A;  1ENF A;  1B44 D;  1JQY D;  4OHJ A;  2IJ0 A;  1EEI D;  3BVM A;  1KTK A;  1LTR D;  4RHS A;  1LT5 D;  4RCO A;  1PTO B;  1PRT F;  1FNU A;  1PZJ D;  3BVZ A;  1S5C D;  1BCP C;  2XNA C;  1D5M C;  1RF2 D;  3O13 A;  5ELF A;  5I4D A;  1LTT D;  1TS2 A;  4L6T B;  1FNV A;  3R2T A;  1ET9 A;  1KLG D;  4Z9C B;  5ELB A;  4RFB A;  3W2D A;  1DYQ A;  4BWG B;  1TS4 A;  1LTB D;  1L0Y B;  1JWS D;  1JR0 D;  1S5D D;  5TSS A;  1HQR D;  1JWU D;  1JWM D;  2AQ2 B;  2AQ1 B; 
#chains in the Genus database with same CATH topology
 3WDN A;  2JQO A;  1F9Q A;  5KND A;  2CCZ A;  5EJW A;  2HHH Q;  2LKV A;  5T1G A;  1AP0 A;  1V43 A;  2NVX B;  1I4X A;  3ONA B;  1B70 B;  3MXN B;  2OTJ A;  5IOD A;  3MEH A;  1TWC H;  1VQG A;  1YHB A;  3DXJ C;  4KKS A;  2JJQ A;  4IPD A;  1JCK B;  1I50 B;  4X66 L;  2LMC B;  4JI6 L;  5C4X H;  2IWH A;  1I94 L;  1J5E Q;  3CKI B;  4NB3 A;  1Y8O B;  1SE4 A;  4C2M B;  5IWA L;  3GTP H;  1VQ5 A;  2K5D A;  1DZ1 A;  4JI3 L;  3C46 A;  4Q0F A;  5ELN A;  1EIG A;  2X6L A;  4GKK L;  4A3I H;  2ID0 A;  4IUQ A;  2CQA A;  4ZYS A;  1Y1W G;  1M4V A;  3L9A X;  1CZW A;  1D6E C;  2CKZ B;  2K32 A;  5C0X G;  5IGB A;  1X3F A;  4JPB W;  2XIW A;  2KOL A;  3E9H A;  2JA7 G;  1OXS C;  3GTL H;  2UXD Q;  4ZCK A;  3OW2 A;  1A3U A;  4IPG A;  4FNF A;  4A3B G;  4DXG A;  2SDF A;  1LT3 D;  1J9O A;  1G51 A;  5I2X A;  3GP7 A;  2A73 B;  2CH4 W;  4QQB X;  1A3T A;  2L1B A;  3Q22 A;  3UI2 A;  3I3C A;  1HUM A;  4KMU C;  1HTL D;  1LTG D;  1O7L A;  2IT1 A;  4J8Q A;  1Q8K A;  3W3A A;  2HDL A;  1XTC D;  3H0G B;  3CMA A;  1Y8P B;  4JBK A;  1DOK A;  3S1M B;  2A68 C;  3DM1 A;  2RVL A;  4HMJ A;  2CH4 A;  2IJ0 A;  5EGT A;  2OQ0 A;  4DKA C;  2EQS A;  1Q81 C;  2BA0 A;  3KF6 B;  3AFQ A;  3RN2 A;  5CV9 A;  5C44 H;  3NHH A;  2O4X A;  4RKL A;  4L5Q A;  3PGZ A;  4UP8 A;  1NMF A;  2E2J B;  3I90 A;  3GTK H;  2F0Q A;  4TQU S;  2NVT B;  1LTB D;  1DOM A;  1B4O A;  3OWF A;  5TSS A;  3RLF A;  2PPB C;  4RMF A;  3D3R A;  5M9O A;  1I5F A;  1MKH A;  3Q0A A;  5C5M A;  1QVC A;  5K36 G;  5BN5 A;  2K04 A;  5KYL A;  4DV4 L;  4ME5 A;  1C8C A;  1YHA A;  4GZY C;  4OO1 H;  5EBC A;  3EFX D;  5L37 A;  1BR9 A;  2KHJ A;  2MJ8 A;  1SRO A;  4G57 A;  1TY2 A;  4RGN A;  5K5P A;  2P5Z X;  3T16 A;  4LFC L;  3HOW H;  1PA6 A;  3M4Q A;  4Y7N H;  1HZB A;  2AUK A;  3RLN A;  5M5X H;  5KIX A;  4MZ9 A;  1EQQ A;  4AQY Q;  4O2D A;  4BY1 H;  3SEB A;  3OTO L;  1VDZ A;  4G7H C;  1AZQ A;  5DLQ E;  2B8F A;  4F87 A;  1SJH D;  3FDT A;  2QIL A;  1HZA A;  1BOS A;  3MXU A;  4XYO A;  3MFG A;  4C3I H;  4JI7 Q;  2K7V A;  4IZ8 A;  5J22 A;  4JOI A;  1STN A;  3AYH B;  1X6O A;  2VXW A;  1A15 A;  3FRP B;  5LMU Q;  2CQO A;  4KD4 A;  2O5J C;  4DK6 C;  3G4S A;  2RCF A;  4OX9 Q;  2PO4 A;  4B3T L;  2EYF A;  3D8G A;  3F8T A;  1YJW A;  1CKN A;  2A6E D;  3I8Z A;  1S5F D;  3HOV G;  1HQM C;  2Z6K C;  1XNR Q;  1K83 H;  4DV5 Q;  1PRT B;  1KQS A;  1V1P A;  4CDF C;  2HQE A;  1STE A;  2NZH A;  2N8N A;  5CMD A;  2JA5 G;  1D5X C;  1VQ8 A;  2NVQ H;  3IRB A;  3KLS A;  4HJ9 A;  3AMU A;  1Z9F A;  4JI2 L;  4PG3 A;  3KLS X;  1Y1V B;  1CA5 A;  1EWH A;  1YNN C;  4Q5V A;  1BF4 A;  1S72 A;  3NBI A;  1CTM A;  4J1M A;  2NZO A;  1STY A;  2ZTC A;  4B08 A;  1B44 D;  4DU9 A;  1Y14 B;  4OHJ A;  4JI4 L;  4JV5 Q;  4A3K B;  3X3N A;  2Q2I A;  4DAY B;  4A3L G;  1R4Q B;  1S5C D;  4FF2 A;  1HFN A;  4A76 A;  2JA8 B;  4BBS G;  3MXG A;  5FJ8 H;  4A3F B;  2RHS B;  2WAQ B;  3PO3 B;  2K5H A;  1SE8 A;  4RFB A;  1HNX Q;  2JA9 A;  2R7D A;  1J6Q A;  2WFW A;  4ZKC B;  1OTC A;  1ILQ A;  1T9H A;  1HQR D;  3NTH A;  1CI3 M;  4QL5 A;  1SND A;  4DV6 L;  4B3M Q;  1VQJ A;  1QG7 A;  3PF4 A;  3VYS A;  1S5B D;  3NWT A;  1TWF H;  5FOB B;  2FHT A;  4IFD H;  1TXY A;  4LFB L;  5CBA E;  4A93 B;  1HA5 A;  1E24 A;  5E4W C;  1I3Q B;  2XGT A;  1LLR D;  4DV1 L;  1O7Y A;  1VF7 A;  4HJ5 A;  3S16 B;  3M4Y A;  2R93 H;  3S14 H;  3PO2 H;  3A5Z B;  1IL8 A;  1CZG A;  1EYD A;  2UXC L;  5JAV A;  2ATW A;  1U0L A;  1IBM L;  2EDG A;  4DR2 L;  3RUZ A;  3KF8 A;  1PLF A;  3H0G G;  5HUR A;  3K0X A;  2B2W C;  3DM3 A;  1FJG L;  3PIO A;  3NTI A;  1S40 A;  2R92 G;  1QJO A;  3CC4 A;  2IX0 A;  3PV0 A;  1Q90 A;  3MEF A;  3CRK C;  2ZJQ A;  4NKL A;  2L55 A;  2MPM A;  1WFQ A;  2YU9 B;  4NPS A;  2NWG A;  4GNX C;  1B2T A;  1SYF A;  4DNR B;  3J81 c;  4RGM A;  3S2D H;  3QR8 A;  4B9X A;  2QKI C;  1KNE A;  2F0D A;  3KJO A;  1JE4 A;  2JEB I;  2N55 A;  1EY6 A;  5IP9 G;  5E7N A;  1KDB A;  1DXM A;  2AWO A;  1K73 C;  1PV4 A;  4A3D G;  1IYV A;  1N32 L;  1LYL A;  2IHE A;  3KBG A;  3I56 A;  1VQL A;  4FVM A;  1SR3 A;  1A6X A;  3T4A C;  3ITP A;  4DA2 A;  3K5L A;  5C3E B;  5ELF A;  4JI8 Q;  2UUA Q;  3FHW A;  1E2V A;  1CSP A;  4RG1 A;  2SNS A;  2K5N A;  3MXN A;  4KTA A;  3J7A 5;  1HNZ L;  2HCC A;  1X55 A;  2PYK A;  4LF4 Q;  3T51 B;  1CQF A;  5LL6 S;  3KLR A;  2VQE L;  1QUQ B;  4KY7 A;  1WYD A;  3DMU A;  5IYD H;  5JJZ A;  3TRZ A;  5M3F B;  1PYW D;  4GNX B;  4ALP A;  3W1G A;  1XYI A;  3HOZ B;  4NDX A;  5D3I B;  5FLX c;  3BDC A;  4K8I A;  4BY7 H;  2AKW B;  4YHH Q;  5C0X J;  1CUK A;  3NEL A;  3T1H Q;  4O1N A;  4V0B A;  2WII B;  1E22 A;  1GUG A;  2QDL A;  3IFT A;  1E3P A;  3I91 A;  2UUC L;  1TWH B;  1HXY D;  3VYT A;  3TP7 A;  3E9I A;  2A6E C;  2UUB L;  2E2I H;  5IIF A;  3PIO 3;  3AU7 A;  2NN6 G;  2WB1 B;  3D0F A;  3EJI A;  4RHR A;  3D31 A;  3HOY B;  2N49 A;  3PCO B;  2K14 A;  4JOI C;  1Y1V G;  4HCS A;  1HR0 Q;  5IT9 E;  3A7A B;  1VQE A;  4DV2 Q;  1N34 Q;  1JC7 A;  1B9N A;  2VW9 A;  3E0J A;  1CKM A;  3LGJ A;  3M9B A;  5E3F A;  3GD7 A;  3DWQ A;  3GTM H;  3VR6 A;  1P16 A;  3ND9 A;  5JPM C;  2JSO A;  2C5C A;  1TKW B;  1PH5 A;  4JI5 Q;  1LAB A;  1W6J A;  2Y0S E;  2NZ1 D;  3GQB A;  1V1Q A;  2CVR A;  2LY7 A;  2XVS A;  3PO3 G;  4LF8 Q;  3GTO B;  2A74 C;  2JA7 B;  5IGE A;  2N3S A;  5D3D A;  1ONL A;  4X62 Q;  3KF6 A;  1K3R A;  3OPO A;  2X69 A;  3N52 A;  5C5L A;  3S1Q B;  1MSH A;  3I4M B;  4DV7 Q;  2PI2 E;  2KHS A;  1LTL A;  3D4R A;  3AQQ A;  4DK1 A;  3PF5 A;  2R7Z B;  3BVM A;  3HEJ A;  3CF5 A;  4RCO A;  2SNM A;  1IHZ A;  3VR5 A;  4FXD A;  4IQZ A;  4N8X 1;  1WTW A;  2ASB A;  2RCN A;  1GUW A;  2LXJ A;  3OMC A;  4K5W A;  5IYB G;  2EJG C;  4DNI A;  4A93 G;  2KCT A;  1I6H B;  1H95 A;  1BO0 A;  1UE7 A;  2F3V A;  2K03 A;  1HPC A;  4O0A A;  2GN5 A;  1D1I A;  1ET9 A;  4C3H B;  3J7Z C;  1DYQ A;  2EJF C;  5GAH C;  3I4O A;  2D5D A;  2KHI A;  1UE1 A;  1Y1W B;  3L2P A;  4JBW A;  3HOX B;  5EQ0 A;  3H6M A;  1O7Z A;  2MNA A;  4L5S A;  3U9S A;  4X66 Q;  4IUN A;  4X3T A;  2Z4I A;  4H44 C;  1I94 Q;  4RH6 A;  2B2V C;  1SN8 A;  1MGS A;  4LK1 C;  4A3B B;  2F0E A;  3CHB D;  1C9O A;  4GLA C;  4R4Q A;  1RJT A;  3JAM E;  1NUC A;  5ELE A;  1K3B C;  2BH8 A;  2LFN A;  1LM0 A;  1EY8 A;  1W3S A;  5LMN L;  4FF3 A;  1MD2 D;  3G48 A;  3TEH B;  1OXX K;  1SEB D;  3BVG A;  4OO1 I;  3D4W A;  3QOJ A;  3J7Y W;  1KAA A;  4FO2 A;  2EIF A;  4C56 C;  4EQO A;  2DY8 A;  2D9U A;  4X64 Q;  1X54 A;  2GVA A;  3NQT A;  1DD2 A;  4DR5 L;  2F4V L;  2ES2 A;  5JJI A;  1I4Q A;  1C4Q A;  5CBE E;  1K0R A;  4NMZ A;  2MP1 A;  1HZC A;  1STB A;  4OWT B;  5C4J H;  3A0J A;  1R9T H;  4LF6 L;  2ENB A;  1VCI A;  2JA5 H;  2H1E A;  1L0W A;  4AYB E;  4DAY A;  2JA6 H;  2QEJ C;  4OGQ C;  3VA5 A;  1JJC B;  1PYS B;  4JVZ A;  2C35 B;  1VQ7 A;  2F0H A;  2F0P A;  3HOZ G;  1U4L A;  3A54 A;  1VQM A;  2K05 A;  2NVX H;  1NMG A;  3GTQ B;  1F2Z A;  4YY3 Q;  2VUM B;  1NAP A;  2K5V A;  5JEA G;  1H9J A;  1VMP A;  4A3L H;  1VF5 C;  1I50 H;  2Z6K A;  1DON A;  1T5E A;  5D65 A;  3SK8 A;  3Q24 A;  1QVF A;  4DR4 L;  4QY7 A;  4ZQ3 A;  4X3S A;  1GUN A;  4L6T B;  3A8J E;  5A2Q L;  4R8I A;  5CR3 A;  4C2M H;  1R4P B;  2XSC A;  1P8L A;  3UDX A;  4HTH A;  2YYZ A;  4R1J A;  4RKB A;  1JWS D;  1JR0 D;  3CRL C;  2KED A;  5AFW A;  1JWU D;  4RWS C;  4BXX G;  5G3L F;  4K2L A;  3F2U A;  2RDF A;  4LFC Q;  4IPC A;  1S5E D;  3EVQ A;  1SDF A;  1PXU A;  3QJY A;  1N33 Q;  4KKT A;  3EA6 A;  3HOV B;  5CC4 A;  1PFM A;  1RD9 D;  3IAY A;  2KEE A;  5GAE C;  4FF4 A;  3VR4 A;  1N8R C;  3UDG A;  1IXR A;  3G7L A;  2A19 A;  2EVB A;  3AFP A;  4XT1 B;  4DGZ A;  5DEH A;  2JEA I;  1UNS A;  1BBX C;  1KDC A;  1U4P A;  2DN8 A;  5KEE A;  3I4M G;  4PMW A;  3I55 A;  2JXM B;  2KBN A;  3H0G H;  1S3O A;  2HD3 A;  4ABN A;  1Q1E A;  2EYP A;  1EY9 A;  4IPH A;  1PFB A;  3P1H A;  3S1M H;  4IFD I;  2R7Z G;  4C1N I;  5KRU A;  1ZEQ X;  4P73 A;  4BBS B;  4KY5 A;  4CGY B;  1S4Z A;  2QW7 A;  1Q7Y C;  4NXM L;  3PUW A;  4HAE A;  4A3E G;  4DR6 Q;  2E2J H;  4C3H G;  2WKC A;  2CWA A;  3T13 A;  2NVT H;  2ALY B;  1VQ9 A;  3M4O B;  2B2U A;  4L5R C;  2J4X A;  1PH2 A;  1E7Z A;  2EYO A;  3HOX G;  1NBW A;  1TS3 A;  1BKB A;  4LJZ C;  3UE0 A;  4QUF A;  3J7A F;  1Q1B A;  3PUY A;  2AUJ D;  2B2W A;  3MAQ A;  1SE3 A;  4ILW A;  3R2I A;  5IP9 H;  1XMQ L;  3TRE A;  1B50 A;  1UE6 A;  2ZXR A;  1QUQ A;  1A8V A;  2E76 C;  1PRT F;  3AB9 A;  3ERS X;  4DUY L;  1EY7 A;  4KI0 A;  5D14 A;  5BR8 Q;  2G9D A;  1KL9 A;  1ZKO A;  3RMH A;  4GNX A;  3ULL A;  4HSV A;  4CJ1 B;  1LV9 A;  5M3M G;  2A69 C;  2GVB A;  3BG3 A;  3R2T A;  4EGV A;  1EIY B;  3TP6 A;  3HZX A;  1PH3 A;  3V2T A;  5HGT A;  1YZ6 A;  2NYZ D;  1U4M A;  3TS0 A;  4YWM A;  4H02 A;  3WWV A;  4EVO A;  4L8J A;  1VS0 A;  2R92 B;  1STH A;  1M90 C;  4UDU C;  4JG2 A;  1X32 A;  2L4N A;  5I6W A;  1YEZ A;  3CCM A;  1SYE A;  2OQK A;  4H7B A;  4LFA L;  5CV8 A;  3VR2 A;  5GAG C;  3I4N B;  1VQD A;  4XT3 B;  1L2F A;  2G5D A;  1KRS A;  2UXC Q;  2E5L L;  1TWC B;  4PMC A;  5GRO A;  1VQC A;  1SFO B;  3OSO A;  4JK1 C;  4QMG A;  3FVQ A;  1LT4 D;  1FR3 A;  1FGU A;  3A74 A;  2LXK A;  4YWK A;  1XMO L;  3VYR A;  2D0O A;  2J0T D;  4MIU A;  4MTK A;  2Z4H A;  2KCN A;  1F2Y A;  5ELO A;  3ULJ A;  1PRT C;  1K8G A;  4DK0 A;  2F1M A;  4A3D B;  4A3I B;  1D8L A;  3R8B A;  1RL2 A;  3NP8 A;  1MSG A;  4C1N K;  2I5M X;  3EN2 A;  4H0L C;  2BOS A;  3K8A A;  1DJR D;  3TP5 A;  4A3K H;  2VUM G;  3SK6 A;  4KKU A;  3GV6 A;  3C2P A;  4GOP C;  1HRJ A;  5IY0 A;  1EU4 A;  2EJM A;  3T56 B;  2JA8 H;  4A3F H;  3K6O A;  1UEB A;  1EQV A;  1B9M A;  1RDP D;  4A3G B;  3M7G A;  3ICE A;  3URY A;  4HJA A;  4DR1 L;  4DV3 L;  3PO3 H;  1A3V A;  2VQF L;  1SNO A;  4CDD C;  2EXD A;  3GTG B;  1B53 A;  4A3C H;  3JC6 6;  4N9T A;  3HRZ C;  5KYI A;  2EY6 A;  4A3M H;  4ZUJ A;  1PVO A;  1HTP A;  4DUZ Q;  3CPW A;  1YIT A;  4IJH A;  4RCN A;  4V19 0;  3BZC A;  5FKA C;  4X65 L;  4JYA L;  1SYB A;  2YTX A;  2R7F A;  4G7O C;  1YIJ A;  2NTS A;  5EKL A;  4YIJ A;  3J80 L;  3J80 i;  3TDQ A;  3Q6S A;  4C3J B;  4CDE C;  2KEN A;  4X3U A;  1HNZ Q;  1JOQ A;  1CA6 A;  5KNC A;  5IYC H;  4MTN A;  3FPU B;  4YCU A;  1DM0 B;  4LF9 L;  2F0F A;  5FLM H;  3K58 A;  5I4D A;  1I3Q H;  3H3V H;  2DNE A;  1X9N A;  4K0K L;  2HHH L;  1JT8 A;  2AMC B;  3S16 H;  2FXQ A;  4UP7 A;  2AWN A;  4OL7 A;  1SYG A;  4DAM A;  3H3V C;  5EBD A;  4GOP B;  2MQH A;  2B2T C;  3IKJ A;  2B2Y C;  4FP5 D;  1EU3 A;  2UUC Q;  1J5E L;  1BCP D;  1PFN A;  2UUB Q;  4LF5 Q;  4KN4 C;  3QG1 A;  4DR7 L;  3W1B A;  3HOU G;  1QE6 A;  3BU2 A;  1KRT A;  4OEL B;  2RDG A;  2YU9 H;  4NXN Q;  4F7X A;  1OXV A;  2BH2 A;  4DV0 L;  3CP0 A;  2F03 A;  1Q12 A;  3BDO A;  5IGC A;  1EL0 A;  1OXU A;  1A62 A;  4R4T A;  1RTN A;  1QOH A;  1Q86 C;  4JCV E;  1IKM A;  5M5X B;  1IBL Q;  3SXH A;  1II3 A;  3I2Z A;  4DR3 Q;  5C6A A;  2PW5 A;  5CGK A;  5LHY 1;  4XQQ A;  4J6H A;  2UXD L;  3BDL A;  4K5V A;  1SJE D;  3MFY A;  3VDY A;  4PZ6 A;  4QIW B;  2DUD A;  3HP3 A;  2B2V A;  2Q2H A;  3J81 E;  2BA1 A;  5M5Y B;  4POG A;  1NE3 A;  1YNJ D;  2F0L A;  2WAC A;  3CD6 A;  2H4O A;  3M7N A;  2BDO A;  3NE5 B;  4L63 B;  2Z0S A;  4RA8 A;  1PTO D;  2XWB B;  3MZ5 A;  5JEA J;  3TZU A;  5C3E H;  2B2U C;  3SHL A;  2A6H D;  4BBR G;  1HFG A;  1Z7T A;  1XNQ Q;  1GHJ A;  2HUG A;  1VQH A;  1CHP D;  1Q82 C;  1SMY D;  3UE1 A;  3EQL C;  3PSI A;  4ZLT F;  2CFM A;  1BVS A;  5M3F H;  3G6J B;  2Q8I B;  4QB4 A;  3DWA A;  3HOZ H;  4XQJ A;  3NXW A;  2PMZ B;  4POF A;  5I6Y A;  3I4N G;  4ZK9 B;  1FNU A;  2B63 B;  2E8G A;  2ZJR A;  3P20 A;  4EX5 A;  5JEA H;  2UU9 Q;  4K5X A;  5EPJ A;  4B3R L;  4CKC A;  1GO3 E;  1TWH H;  4FXG C;  5DM6 3;  2HT1 A;  1VQI A;  5CV7 A;  4X3K A;  1ZYR D;  5FLX E;  1SNP A;  3HOY H;  1JWM D;  1ESR A;  1U9R A;  3U58 A;  4G7Z C;  4BXX H;  2O2L D;  3SK4 A;  1N36 Q;  5E4X A;  2F0W A;  4ZKB B;  4A3I G;  1Z6H A;  3U4V A;  1I4G A;  1I4H A;  1SAP A;  1E1T A;  4QCL A;  3LWE A;  1JOK A;  4S3S A;  3Q8D A;  5COY A;  4AQY L;  1ET6 A;  3H91 A;  3G6E A;  1I4R A;  5J1Z A;  5CV6 A;  2Y0S G;  3R3O A;  4A3G G;  4JBM A;  4MN3 A;  1L1O A;  5EPL A;  1L0X B;  4CJ2 C;  3T1Y Q;  3GTO H;  2JA7 H;  4XXE A;  4OX9 L;  2QGQ A;  3ND8 A;  3M85 A;  3PO2 B;  4HSP A;  1KAB A;  2RSO A;  1BCP F;  2DGY A;  4DR5 Q;  2F4V Q;  3NTK A;  3S1Q H;  1SXT A;  4HJ7 A;  3ULP A;  3L0O A;  1WCM B;  3ERO A;  2PZT A;  2I0Q A;  1RTO A;  4DV5 L;  4P74 A;  2ZM6 Q;  3TN2 A;  2J7Z A;  1QWY A;  2R7Z H;  4C3J G;  5FK9 C;  1CQV A;  3SK5 A;  5AJ3 Q;  1H9S B;  2K4K A;  3K80 C;  1WTX A;  2E75 C;  2PQA B;  1I6H H;  2L11 A;  1UAP A;  4KHP Q;  3MHB A;  5C44 G;  4LW1 A;  3CC7 A;  1IKL A;  1RHP A;  4C3H H;  1EUJ A;  3NPP A;  1QZH A;  4HMI A;  2OWO A;  1Y1W H;  3C3L A;  2BE5 D;  3E3X A;  5BN3 A;  4K14 A;  5A35 A;  3HOX H;  3RN5 A;  1PH7 A;  5C0X H;  3FMC A;  2R61 A;  3PQI A;  1EFW A;  4OON A;  1TWA B;  2KA7 A;  3K5O A;  4E6I A;  3SDZ A;  1G2T A;  1E0B A;  1HA6 A;  3OW7 A;  2BCO A;  3F2B A;  1HNX L;  1B3A A;  4IAL A;  1NR2 A;  1X3E A;  1WOC A;  4OO1 G;  4A3B H;  2K52 A;  2DNC A;  3BVZ A;  1VQO A;  1JJG A;  1BCP C;  4IUP A;  3K7A B;  1XPR A;  3M3Y H;  1F2L A;  5CV4 A;  2K50 A;  1PH1 A;  1TS2 A;  4B3M L;  5KGU A;  1KLG D;  2MFI A;  2HDM A;  4Z9C B;  3HOW G;  3V96 A;  2I5L X;  2KCC A;  3LX0 A;  3MXP A;  3EBE A;  1PH6 A;  2KVM A;  4LF7 Q;  4A3J B;  2VS1 A;  3EIV A;  5IGF A;  3KOJ A;  2Q8R E;  4J15 A;  4LUO A;  4BY1 G;  5BN4 A;  1XX8 A;  2OTL A;  1XXG A;  2NVY B;  4UP9 A;  1HUN A;  4GKJ Q;  3SGI A;  4P72 A;  2ICI A;  3OMG A;  4A3E B;  4P71 A;  3KDF B;  4B3S L;  4JBJ A;  2KJX A;  2E2H B;  1JMC A;  4I65 A;  4R9W A;  2A1A A;  1DGS A;  4YCW A;  2K5Q A;  3L7Z C;  2B3G A;  4ZAI A;  3AEV A;  5K36 H;  1CM9 A;  4AYB G;  2H5X A;  1PTO C;  5IGD A;  5JPN C;  1MBY A;  3D6W A;  5M5W B;  4IUU A;  4MNO A;  4JI6 Q;  1F9S A;  2A6H C;  1BCP B;  2CWP A;  3KK7 A;  3LNN A;  1M1K C;  4QJF A;  5IWA Q;  4NXM Q;  3RZD B;  4GN3 B;  1NCV A;  3NEN A;  1HZ9 A;  4P75 A;  1SMY C;  1XPO A;  3CW2 C;  3GTJ B;  4EQN A;  4JI3 Q;  1VQB A;  3BZK A;  4GKK Q;  3S17 B;  5I9P A;  3GTQ H;  2B63 G;  1VQP A;  2V4D A;  5M3M B;  1Y69 U;  3OIP A;  3K5M A;  3A55 A;  1SRU A;  2VZA A;  1VQK A;  1MIU A;  4YCV A;  1UWV A;  2WAQ E;  3FKI B;  3TP8 A;  3A8K E;  4I7A A;  2M9V A;  2L5T A;  1MJE A;  2B39 A;  2XTI A;  4CHT B;  1C0A A;  1JOO A;  1YBY A;  3DWP A;  3VYU A;  4DUY Q;  1ZYR C;  4ID6 A;  1IBK L;  1TWG B;  5EPK A;  4JI8 L;  2UUA L;  2F52 A;  4GN4 B;  2Q2U A;  3HOV H;  1PTO B;  1AE3 A;  1X56 A;  4XDX A;  4GOP A;  1TVX A;  1VQF A;  3G71 A;  2XNA C;  4IFD G;  2MO1 A;  2F0N A;  5IP7 G;  3W2D A;  4U68 A;  4FF1 A;  3DEP A;  2XWJ B;  3J80 c;  2ZXP A;  4R4O A;  4DK3 C;  1KC8 C;  2R93 G;  4YHH L;  2PNH A;  1Q3L A;  4TVA B;  5C3W A;  4CJ0 B;  2RBM A;  3PO2 G;  1KIX A;  4LFA Q;  1V8Q A;  2EYL A;  1PH4 A;  2F0U A;  2N88 A;  2ZTE A;  1WCM G;  2Z9H A;  3KJP A;  4DPG A;  3S1R B;  1K0S A;  4LWC A;  3RR5 A;  5F2D A;  4PZ8 A;  4K6L A;  4JI1 L;  2R6G A;  1XWE A;  2E2D C;  1XMO Q;  2SOB A;  4BBS H;  4PZ7 A;  1L1O C;  4DV4 Q;  2QCP X;  1HR0 L;  3Q23 A;  4DV2 L;  2F0M A;  2FFK B;  4BA1 I;  4M8A A;  3GDE A;  4U67 3;  3S1N B;  1OXT A;  1EIF A;  2VNU D;  1PFS A;  4KJO A;  2K01 A;  3S2H B;  3M4O H;  3CQZ B;  2L9H A;  2SEB D;  3A5U A;  1VQN A;  2B2T A;  2F3I A;  2NBF A;  2B2Y A;  4XQN A;  5ISR A;  1ILP A;  1DCZ A;  4JI5 L;  4HCE A;  2F0I A;  2KUM A;  3I7F A;  2BE5 C;  1EEF D;  1GD7 A;  2RQX A;  3X3M A;  2UXB L;  3OIQ A;  3OTO Q;  3RZO B;  4DR1 Q;  4F8M A;  1WVL A;  3I4L A;  4B9W A;  2VQF Q;  1W6K A;  4X62 L;  1JB3 A;  1ML0 D;  2Q2T A;  4IUT A;  3F2D A;  3H15 A;  5FO8 B;  4DV7 L;  4CKE A;  1IYU A;  1C48 A;  1ROD A;  4P2C B;  4B3T Q;  1IL2 A;  4JYA Q;  1EWC A;  3IL8 A;  1QZG A;  2BDN A;  2MO0 A;  3FEW X;  3S9W A;  4A3J G;  1PDQ A;  3KUP A;  2FMC A;  4KV6 A;  3WOE A;  4I7Z C;  3S15 B;  1L1O B;  3TSS A;  2FJ2 A;  3PUZ A;  1AZP A;  1EY0 A;  2R92 H;  1D5Z C;  5IYD G;  5FO9 B;  3HOU B;  4LF9 Q;  2LS0 1;  2F0J A;  3OHX C;  4JI2 Q;  1BBU A;  3C1E A;  1LTR D;  4K0K Q;  1OO9 B;  1WTO A;  3DLL A;  4PMB A;  3I4N H;  4BY7 G;  1SSO A;  5J39 A;  2A5H A;  3O13 A;  3ER0 A;  4LNQ A;  2D0P A;  4M1U B;  1SFO H;  1U5K A;  3CC2 A;  4JI4 Q;  1HH2 P;  4ZUI A;  4WOR A;  4WFN 3;  1K8A C;  3K57 A;  4IUR A;  2EYM A;  4DR7 Q;  4OWW B;  1G29 1;  4PV1 C;  1HNW L;  2WB1 E;  3D4D A;  4A3D H;  4JW0 A;  1BDO A;  2JE6 I;  3E6Z X;  4GLX A;  3HKZ E;  1Q46 A;  2RKS A;  4DV0 Q;  4Y52 H;  2EZV A;  1AFP A;  2K75 A;  4NP5 A;  1U4R A;  2QDB A;  5CV5 A;  3MWY W;  4DV6 Q;  1YJN A;  4TKO B;  4BBR B;  1TR5 A;  2PQE A;  4FYD A;  2CW0 D;  3BYY B;  3SR1 A;  4A3G H;  4X64 L;  2RF4 A;  1QNK A;  3GTG H;  3VA7 A;  3FKI G;  1H9S A;  1G8Z D;  2D62 A;  4K2K A;  4LFB Q;  2F0K A;  5IT9 L;  2PQA A;  3V05 A;  1B7Y B;  3QB3 A;  2QF7 A;  1KLU D;  4DV1 Q;  1SYC A;  3SVM A;  2PW7 A;  2K28 A;  2IHF A;  1CK1 A;  2F3W A;  1CHQ D;  3LWU A;  1SYD A;  2OEO A;  1ASZ A;  2A8V A;  5LL6 X;  2K33 A;  4C3J H;  1IBM Q;  4DR2 Q;  1UUP A;  1M8A A;  1EZ6 A;  3BS1 A;  5C4X B;  4UY8 C;  1LO5 D;  4PQX A;  2NN6 H;  4JI0 L;  1FJG Q;  2F4I A;  4DAP A;  5H1S E;  3GTP B;  3L3O C;  2L12 A;  1Y1V H;  3E0E A;  4RGT A;  4CDC C;  1EFI D;  1B1Z A;  4QUC A;  4YY3 L;  2F0S A;  4KK7 A;  1ASY A;  4L5T A;  3U50 C;  1ENC A;  3K5N A;  3CU7 A;  4B3R Q;  2DJF C;  3MC0 B;  4CBV A;  1ENF A;  4IUV A;  3HG9 A;  1EEI D;  1A2U A;  2JYO A;  3MVV A;  2Y0S B;  3GTL B;  1X3Q A;  3CCJ A;  1KXL A;  5JVH 3;  1EZ8 A;  1NY4 A;  2JN4 A;  3QWN A;  2ZTD A;  1SLJ A;  1N32 Q;  4HID A;  4BWG B;  5C3X A;  1TS4 A;  2HCI A;  5EKK A;  1VMC A;  3BJU A;  3GO5 A;  2L0C A;  4ULL A;  1N33 L;  4BA2 I;  5C0X I;  1WD0 A;  3KDF A;  4OWX B;  4GN5 A;  4R8N A;  4DAV A;  1SNQ A;  4KY6 A;  1LTS D;  1K9M C;  2F0T A;  3CCV A;  2VQE Q;  2C9O A;  3DHQ A;  1VQ4 A;  1X3P A;  3K7U C;  4DF7 A;  3ERQ A;  5IYB H;  3CCL A;  4A93 H;  5M5Y H;  4XTC S;  5C44 B;  4GLV B;  3GV3 A;  3GTK B;  3JAM L;  1JJ2 A;  5GQO A;  3JAM i;  3NUC A;  1WTQ A;  3VR3 A;  3CCU A;  1BNZ A;  1EWI A;  1D7Q A;  1J8I A;  3HKS A;  3H09 A;  1PH9 A;  1G2S A;  4HED A;  1GUS A;  1XPU A;  4TRD A;  3KFU A;  5FO7 B;  1E2Z A;  1KDA A;  2HQL A;  5IE8 A;  4IN3 A;  3K59 A;  2JA6 G;  4HIK A;  4DR6 L;  1MJC A;  2JP1 A;  1JE5 A;  3R93 A;  2XN9 C;  1PZK D;  1NJI C;  1STG A;  1GOZ A;  3PIP A;  1D2B A;  5LMN W;  1EY4 A;  1BXT A;  4JC0 A;  5JVG 3;  1IZ6 A;  3BZD B;  2B63 H;  1AEX A;  3HOW B;  2IX1 A;  3PMF A;  4Y7N B;  4TSS A;  4AH6 A;  4IFD J;  4QF4 A;  3RD4 A;  2AQ3 B;  2KQ3 A;  4BY1 B;  2DJG C;  1KNA A;  3D6C A;  2YTV A;  1F9P A;  1GKH A;  3MTS A;  1GM5 A;  4C3I B;  3CCQ A;  1E2W A;  1SE2 A;  1SNM A;  4A3M B;  1AW7 A;  1SNC A;  5BR8 L;  2B8G A;  3K81 C;  4BS9 A;  4XYQ A;  3T53 B;  1KTK A;  4ZRZ A;  5KNB A;  2RA4 A;  3U4Z A;  1TQO A;  2OXP A;  1RIP A;  1STA A;  1PZJ D;  4DFA A;  2IX3 A;  3QOL A;  1KD1 C;  2X6G A;  1D5M C;  1RF2 D;  1D1K A;  1YHQ A;  1K83 B;  4AYB B;  5JOB A;  3WOF A;  1CKO A;  5ELB A;  5IP7 H;  4WJW A;  5A2Q E;  2NVQ B;  2GA4 B;  2CW0 C;  4PNY A;  1GVP A;  1YJ9 A;  3FPP A;  2AQ1 B;  3RLO A;  1CFM A;  1PHJ A;  4B3S Q;  1MHW C;  1WCM H;  5DNF A;  5DAU A;  1YI2 A;  4IJL A;  2RHQ B;  3CCR A;  1HR0 W;  1G6Z A;  3I72 A;  5CYU A;  1WTH A;  3NBH B;  3TME A;  1RKN A;  1WJJ A;  2FIN B;  2IL8 A;  1ENA A;  4WJ4 A;  5C4X G;  1WD1 A;  2K1B A;  3J7A V;  1FYC A;  3IFD A;  1C7Y A;  1K8O A;  1SBB B;  1PZI D;  3PIP 3;  2F0G A;  2KEC A;  2MGS A;  2F0O A;  2K5W A;  1TWA H;  4N9P A;  2QEX A;  4KN7 C;  1FGB D;  3HGB A;  5LMN Q;  4DN4 M;  1CT1 D;  1TWF B;  2YTY A;  4JI7 L;  2NTT A;  3HS0 C;  2EYH A;  2EXZ A;  2NUC A;  1LTI D;  1QCB D;  1B3Q A;  5LMU L;  2Q8T A;  3K7A H;  4DUZ L;  4AIM A;  3RNU A;  4IO9 A;  2ZJP A;  2IW3 A;  2R93 B;  2PCF B;  3S14 B;  1IBK Q;  4GS3 A;  5IOC A;  2LSS A;  3I4M H;  3H94 A;  1EIH A;  4A75 A;  4K6D A;  3QIA A;  4A3J H;  1EQT A;  2AHO B;  4FDB A;  1XNR L;  5NUC A;  1FVI A;  5GAD C;  1F77 A;  4LF6 Q;  1EY5 A;  1IW7 D;  2NVY H;  3TBI B;  1VQA A;  3NK9 A;  1JQY D;  4OEM B;  1IYJ B;  1NNX A;  4RAU C;  1EQR A;  1V9P A;  4RHS A;  4A3E H;  5T1I A;  4IOA A;  1JB7 A;  3CCS A;  1QB5 D;  2Z6B A;  3J81 j;  2E2H H;  1LTT D;  1GHK A;  2ZXO A;  4JV5 L;  4LUZ A;  1O78 A;  3CXC A;  3KLW A;  5EKI A;  3S2D B;  1S5D D;  1PMR A;  3ZJY C;  2OCE A;  4N8F A;  4LF5 L;  1UE5 A;  2EYJ A;  3SE0 A;  5M5W H;  1KAW A;  2DY7 A;  4JI1 Q;  4DR4 Q;  1EOV A;  1VQ6 A;  3KYH C;  4NXN L;  1PTO F;  1WTP A;  3HKZ B;  1I4P A;  1T5X D;  3RZD H;  1N9W A;  2VY3 A;  3DUZ A;  4X6A H;  1QVG A;  3GTJ H;  1WTR A;  3S17 H;  4DNT B;  1FNW A;  1GXD C;  1IBL L;  4DR3 L;  4OIK A;  5M3M H;  4A3K G;  2K6A A;  3STB D;  4A4I A;  2WV6 D;  2WKD A;  1LTA D;  1NR4 A;  5JJL A;  2JA8 G;  1O80 A;  5C4Z A;  4IOC A;  4A3F G;  3TZD A;  1ICW A;  1W2B A;  4HIO A;  2E74 C;  2WAQ G;  3HFZ B;  3FKI H;  2UXB Q;  2EPB A;  4C3I G;  1TS5 A;  4A3C G;  4R4C A;  1UEA B;  4A3M G;  1TII D;  5IGG A;  4HJ8 A;  2XRS D;  4OXP A;  2EOT A;  4RGO S;  4YWL A;  1GJX A;  1AE2 A;  3S24 A;  1TWG H;  1ZXT A;  2Z8L A;  4DXF A;  1A63 A;  4BY7 B;  1K8M A;  1XNQ L;  3PUX A;  1BUV T;  3N6R A;  3CAM A;  1PTO H;  1A2T A;  4KJN A;  5IT9 c;  5G3L D;  5ELC A;  3CCE A;  1YNJ C;  4R4I A;  1LAC A;  4G4K A;  2JK8 A;  5IYC G;  2VL6 A;  3UDF A;  2RSN A;  2E2I B;  1HCZ A;  1CSQ A;  2KCM A;  2N78 A;  4KLK A;  1H9M A;  1FL0 A;  1WTV A;  2PZW A;  2NB0 A;  5FLM G;  2PNR C;  4ODG A;  1I6V C;  1GUT A;  2VB3 X;  1RCV D;  3I73 A;  1XJV A;  1HHV A;  1CKN B;  2V1C C;  2D2C C;  1V1O A;  3U9O A;  2G9H D;  1EYC A;  2EY2 A;  2WIN B;  2EE1 A;  2UU9 L;  4ME3 A;  4FXK C;  5HGQ A;  3GTM B;  3BYT B;  2VUM H;  1V1P B;  3S1R H;  3FP9 A;  2PI2 A;  1H9K A;  1LT5 D;  4APV A;  3J80 E;  2NN6 I;  4KHV A;  1JOR A;  1G91 A;  4KD3 A;  5FJ8 G;  4OIJ A;  1X3G A;  2A69 D;  1N36 L;  1HNW Q;  1G6P A;  1DOL A;  5HY6 A;  2I46 A;  1XMQ Q;  4UAI A;  3S1N H;  3M3Y B;  2MHV A;  4LMQ D;  1PYB A;  1L0Y B;  1EYG A;  5C4H A;  3TS2 A;  2YV5 A;  3S2H H;  1GUO A;  2OT2 A;  3CQZ H;  2A68 D;  2AQ2 B;  1QNU A;  3F2C A;  3OYY A;  1TT2 A;  2ZT9 C;  1XTD A;  1YNX A;  1Y8N B;  1AN8 A;  2TMP A;  4LF4 L;  2FMM A;  1Q8I A;  5COR A;  3NEM A;  2Z1C A;  3OWE B;  3QO2 A;  1YVC A;  2HIV A;  3RZO H;  3T1Y L;  2IPK D;  4HN7 A;  1EOT A;  3KBX A;  1FD7 D;  4QIW E;  1O7I A;  3P75 A;  4UHV A;  5DM7 3;  3PUV A;  2F0V A;  1ESF A;  3P7J A;  2I5H A;  2L15 A;  2CHB D;  4HR7 B;  3DEO A;  3E5S A;  4LUV A;  2EY5 A;  3K0Y A;  3T1H L;  1X65 A;  5I9O A;  2WP8 J;  4K8J A;  5C3E G;  5EAY A;  3A8I E;  1PRT D;  5ELD A;  2ZM6 L;  1BBW A;  3CPF A;  2M00 A;  2E5L Q;  2HIX A;  4WJ3 M;  5AJ3 L;  2RDH A;  3S15 H;  1LT6 D;  4HIM A;  1WI5 A;  1TU2 B;  3NWS A;  3JAM c;  3NQI A;  4KHP L;  3B6Y A;  1Z47 A;  3OOC A;  3W5O A;  1LUZ A;  4JI0 Q;  3HOU H;  3J81 L;  3J81 i;  3H3V I;  5M3F G;  1KHI A;  2MUY A;  2OF1 A;  2ICE C;  4EQ5 A;  1N34 L;  5I2Y A;  1IW7 C;  3F1Z A;  4CKB A;  2PMZ E;  3ZYY X;  3M4P A;  1BQQ T;  1SMX A;  1F2M A;  4KHZ A;  3KF8 B;  4H13 C;  1B8A A;  2TSS A;  5JJK A;  2M2L A;  2XRQ D;  4NW2 A;  4MHE A;  3C1F A;  1QIL A;  2EY1 A;  1H9R A;  4O42 A;  2B29 A;  2I07 B;  1ICF B;  2WB1 G;  4EQP A;  2R3Z A;  3CME A;  3HOY G;  4LF8 L;  3HKZ G;  4DV3 Q;  1HJP A;  1TY0 A;  1AH9 A;  3A7L A;  3MA2 B;  3UDI A;  4F88 A;  2QA4 A;  3A56 A;  3NSW A;  3I70 A;  1NSN S;  4X65 Q;  1PH8 A;  2PZU A;  1E1O A;  4LF7 L;  4UPA A;  4BBR H;  1MI2 A;  1K28 A;  1YNN D;  1FNV A;  5C4J B;  1R9T B;  5J3B A;  4LAA A;  1NTG A;  4WRD A;  4XIG S;  5FLX L;  5E1F A;  3NBH A;  2JA5 B;  2VB2 X;  1A0I A;  1EYA A;  4QGU A;  4GKJ L;  3STB C;  2JA6 B;  2O5I C;  1F9R A;  2IY5 B;  1JIC A;  3TQY A; 
#chains in the Genus database with same CATH homology
 3WDN A;  1F9Q A;  5KND A;  5EJW A;  2LKV A;  5T1G A;  1AP0 A;  1V43 A;  2NVX B;  1I4X A;  3ONA B;  5IOD A;  3MEH A;  3DXJ C;  4KKS A;  1JCK B;  1I50 B;  2LMC B;  2IWH A;  3CKI B;  1Y8O B;  1SE4 A;  4C2M B;  2K5D A;  1DZ1 A;  3C46 A;  4Q0F A;  1EIG A;  2X6L A;  2ID0 A;  4IUQ A;  2CQA A;  4ZYS A;  1M4V A;  3L9A X;  1CZW A;  1D6E C;  2K32 A;  5C0X G;  5IGB A;  2XIW A;  2KOL A;  1OXS C;  1A3U A;  4FNF A;  4DXG A;  2SDF A;  1LT3 D;  1J9O A;  5I2X A;  3GP7 A;  2A73 B;  1A3T A;  2L1B A;  3Q22 A;  3UI2 A;  3I3C A;  1HUM A;  4KMU C;  1HTL D;  1LTG D;  1O7L A;  2IT1 A;  4J8Q A;  3W3A A;  2HDL A;  1XTC D;  3H0G B;  1Y8P B;  1DOK A;  3S1M B;  2A68 C;  3DM1 A;  2RVL A;  4HMJ A;  2IJ0 A;  5EGT A;  2BA0 A;  5CV9 A;  3NHH A;  2O4X A;  4RKL A;  2E2J B;  3I90 A;  2F0Q A;  4TQU S;  2NVT B;  1LTB D;  1DOM A;  1B4O A;  5TSS A;  3OWF A;  3RLF A;  2PPB C;  3D3R A;  5M9O A;  3Q0A A;  5C5M A;  5K36 G;  5BN5 A;  2K04 A;  5KYL A;  4ME5 A;  1C8C A;  4GZY C;  4OO1 H;  5EBC A;  3EFX D;  1BR9 A;  2MJ8 A;  4G57 A;  1TY2 A;  4RGN A;  5K5P A;  3T16 A;  2AUK A;  5KIX A;  3SEB A;  1VDZ A;  4G7H C;  1AZQ A;  2B8F A;  4F87 A;  1SJH D;  3FDT A;  2QIL A;  4XYO A;  1BOS A;  3MXU A;  3MFG A;  2K7V A;  4IZ8 A;  5J22 A;  1STN A;  2VXW A;  1A15 A;  3FRP B;  4KD4 A;  2O5J C;  2PO4 A;  2EYF A;  3D8G A;  2A6E D;  3I8Z A;  1S5F D;  1HQM C;  1PRT B;  1V1P A;  2HQE A;  1STE A;  5CMD A;  1D5X C;  3KLS A;  3AMU A;  3KLS X;  1Y1V B;  1CA5 A;  1EWH A;  1YNN C;  4Q5V A;  1BF4 A;  3NBI A;  1CTM A;  4J1M A;  1STY A;  4B08 A;  1B44 D;  4DU9 A;  4OHJ A;  4A3K B;  3X3N A;  1R4Q B;  1S5C D;  4FF2 A;  1HFN A;  2JA8 B;  3MXG A;  4A3F B;  2WAQ B;  3PO3 B;  4RFB A;  4ZKC B;  1ILQ A;  1HQR D;  3NTH A;  1CI3 M;  1SND A;  1QG7 A;  3VYS A;  1S5B D;  3NWT A;  5FOB B;  2FHT A;  4IFD H;  5CBA E;  4A93 B;  1HA5 A;  5E4W C;  1I3Q B;  1LLR D;  1O7Y A;  1VF7 A;  3S16 B;  3M4Y A;  1IL8 A;  1CZG A;  1EYD A;  5JAV A;  2EDG A;  3RUZ A;  3KF8 A;  1PLF A;  5HUR A;  2B2W C;  3NTI A;  1QJO A;  2IX0 A;  3PV0 A;  1Q90 A;  3CRK C;  4NKL A;  2L55 A;  2MPM A;  2YU9 B;  2NWG A;  1B2T A;  1SYF A;  4DNR B;  4RGM A;  4B9X A;  2QKI C;  1KNE A;  2F0D A;  1JE4 A;  2JEB I;  2N55 A;  1EY6 A;  1KDB A;  1DXM A;  2AWO A;  1IYV A;  3KBG A;  4FVM A;  1A6X A;  3T4A C;  3ITP A;  4DA2 A;  3K5L A;  5C3E B;  5ELF A;  1E2V A;  2SNS A;  3MXN A;  4KTA A;  2HCC A;  2PYK A;  3T51 B;  1CQF A;  5LL6 S;  3KLR A;  4KY7 A;  3DMU A;  5JJZ A;  5M3F B;  1PYW D;  1XYI A;  3HOZ B;  4NDX A;  5D3I B;  3BDC A;  4K8I A;  5C0X J;  4O1N A;  4V0B A;  2WII B;  1GUG A;  3IFT A;  3I91 A;  1TWH B;  1HXY D;  3VYT A;  3TP7 A;  2A6E C;  5IIF A;  3PIO 3;  3AU7 A;  2NN6 G;  2WB1 B;  3EJI A;  4RHR A;  3D31 A;  3HOY B;  4HCS A;  5IT9 E;  3A7A B;  1JC7 A;  1B9N A;  3E0J A;  5E3F A;  3GD7 A;  3DWQ A;  3VR6 A;  3ND9 A;  5JPM C;  2JSO A;  2C5C A;  1TKW B;  1LAB A;  1W6J A;  2NZ1 D;  3GQB A;  2LY7 A;  2CVR A;  2XVS A;  3GTO B;  2A74 C;  2JA7 B;  5IGE A;  5D3D A;  1ONL A;  3OPO A;  2X69 A;  3N52 A;  5C5L A;  3S1Q B;  1MSH A;  3I4M B;  2KHS A;  3D4R A;  4DK1 A;  2R7Z B;  3BVM A;  3HEJ A;  4RCO A;  2SNM A;  1IHZ A;  3VR5 A;  4FXD A;  4IQZ A;  1WTW A;  1GUW A;  3OMC A;  1I6H B;  4K5W A;  2EJG C;  1BO0 A;  2F3V A;  2K03 A;  1HPC A;  1D1I A;  1ET9 A;  4C3H B;  1DYQ A;  2EJF C;  2D5D A;  1Y1W B;  4JBW A;  3HOX B;  5EQ0 A;  3H6M A;  1O7Z A;  3U9S A;  4IUN A;  4X3T A;  2Z4I A;  4H44 C;  4RH6 A;  2B2V C;  1MGS A;  4LK1 C;  4A3B B;  2F0E A;  3CHB D;  1RJT A;  3JAM E;  1NUC A;  5ELE A;  2LFN A;  1EY8 A;  4FF3 A;  1MD2 D;  1OXX K;  1SEB D;  3BVG A;  4OO1 I;  3D4W A;  3QOJ A;  3J7Y W;  1KAA A;  4FO2 A;  4C56 C;  4EQO A;  2DY8 A;  2D9U A;  3NQT A;  1DD2 A;  1I4Q A;  1C4Q A;  5CBE E;  4NMZ A;  2MP1 A;  1STB A;  2ENB A;  1VCI A;  2H1E A;  4DAY A;  2QEJ C;  4OGQ C;  3VA5 A;  2F0H A;  2F0P A;  1U4L A;  3A54 A;  2K05 A;  3GTQ B;  1F2Z A;  2VUM B;  1NAP A;  5JEA G;  1H9J A;  1VMP A;  1VF5 C;  1DON A;  1T5E A;  5D65 A;  3SK8 A;  3Q24 A;  4ZQ3 A;  4X3S A;  1GUN A;  4L6T B;  3A8J E;  5A2Q L;  4R8I A;  5CR3 A;  1R4P B;  2XSC A;  4HTH A;  2YYZ A;  4RKB A;  1JWS D;  1JR0 D;  3CRL C;  2KED A;  5AFW A;  1JWU D;  4RWS C;  5G3L F;  4K2L A;  3F2U A;  2RDF A;  1S5E D;  3EVQ A;  1SDF A;  1PXU A;  3QJY A;  4KKT A;  3EA6 A;  3HOV B;  5CC4 A;  1PFM A;  1RD9 D;  3IAY A;  2KEE A;  4FF4 A;  3VR4 A;  3G7L A;  2EVB A;  4XT1 B;  4DGZ A;  5DEH A;  2JEA I;  1UNS A;  1BBX C;  1KDC A;  1U4P A;  2DN8 A;  5KEE A;  4PMW A;  2JXM B;  4ABN A;  1Q1E A;  2EYP A;  1EY9 A;  1PFB A;  3P1H A;  4IFD I;  4C1N I;  5KRU A;  1ZEQ X;  4BBS B;  4KY5 A;  4CGY B;  1S4Z A;  3PUW A;  4HAE A;  4C3H G;  2WKC A;  3T13 A;  3M4O B;  2B2U A;  2J4X A;  2EYO A;  1TS3 A;  4LJZ C;  4QUF A;  3J7A F;  1Q1B A;  3PUY A;  2AUJ D;  2B2W A;  3MAQ A;  1SE3 A;  4ILW A;  3R2I A;  1B50 A;  2ZXR A;  2E76 C;  1PRT F;  3AB9 A;  1EY7 A;  4KI0 A;  5D14 A;  2G9D A;  1ZKO A;  3RMH A;  4HSV A;  4CJ1 B;  1LV9 A;  2A69 C;  3R2T A;  3BG3 A;  4EGV A;  3TP6 A;  3HZX A;  3V2T A;  5HGT A;  2NYZ D;  1U4M A;  4EVO A;  4L8J A;  2R92 B;  1STH A;  4UDU C;  1X32 A;  2L4N A;  5I6W A;  1SYE A;  4H7B A;  5CV8 A;  3VR2 A;  3I4N B;  4XT3 B;  1TWC B;  4PMC A;  1SFO B;  3OSO A;  4JK1 C;  4QMG A;  3FVQ A;  1LT4 D;  1FR3 A;  3VYR A;  2J0T D;  4MIU A;  2Z4H A;  2KCN A;  1F2Y A;  1PRT C;  4DK0 A;  2F1M A;  4A3D B;  4A3I B;  3R8B A;  3NP8 A;  1MSG A;  4C1N K;  4H0L C;  2BOS A;  1DJR D;  3TP5 A;  3SK6 A;  4KKU A;  3GV6 A;  3C2P A;  1HRJ A;  1EU4 A;  2EJM A;  3T56 B;  4A3G B;  3K6O A;  1EQV A;  1B9M A;  1RDP D;  3M7G A;  3URY A;  1A3V A;  1SNO A;  3GTG B;  1B53 A;  4N9T A;  3HRZ C;  5KYI A;  2EY6 A;  4ZUJ A;  1HTP A;  4RCN A;  4V19 0;  5FKA C;  1SYB A;  4G7O C;  2NTS A;  5EKL A;  4YIJ A;  3J80 L;  3TDQ A;  3Q6S A;  4C3J B;  4X3U A;  1JOQ A;  1CA6 A;  5KNC A;  3FPU B;  1DM0 B;  2F0F A;  3K58 A;  5I4D A;  2DNE A;  2AWN A;  4OL7 A;  1SYG A;  3H3V C;  5EBD A;  2B2T C;  3IKJ A;  2B2Y C;  4FP5 D;  1EU3 A;  1BCP D;  1PFN A;  4KN4 C;  3QG1 A;  1QE6 A;  2RDG A;  4F7X A;  1OXV A;  2F03 A;  1EL0 A;  1Q12 A;  3BDO A;  5IGC A;  1OXU A;  1RTN A;  1QOH A;  1IKM A;  5M5X B;  3SXH A;  1II3 A;  5C6A A;  2PW5 A;  5CGK A;  5LHY 1;  4XQQ A;  4J6H A;  3BDL A;  4K5V A;  1SJE D;  3MFY A;  4QIW B;  3HP3 A;  2B2V A;  3J81 E;  2BA1 A;  5M5Y B;  1YNJ D;  2F0L A;  2WAC A;  2H4O A;  3M7N A;  2BDO A;  3NE5 B;  4L63 B;  4RA8 A;  1PTO D;  2XWB B;  3MZ5 A;  5JEA J;  3TZU A;  2B2U C;  3SHL A;  2A6H D;  1HFG A;  1Z7T A;  1GHJ A;  2HUG A;  1CHP D;  1SMY D;  3EQL C;  4ZLT F;  3G6J B;  2Q8I B;  4QB4 A;  3DWA A;  4XQJ A;  3NXW A;  2PMZ B;  5I6Y A;  4ZK9 B;  1FNU A;  2B63 B;  3P20 A;  5JEA H;  4K5X A;  5EPJ A;  4CKC A;  4FXG C;  5DM6 3;  5CV7 A;  4X3K A;  1ZYR D;  5FLX E;  1SNP A;  1JWM D;  1ESR A;  1U9R A;  4G7Z C;  2O2L D;  3SK4 A;  5E4X A;  2F0W A;  4ZKB B;  1Z6H A;  1I4G A;  1I4H A;  1SAP A;  4QCL A;  3LWE A;  1JOK A;  4S3S A;  5COY A;  1ET6 A;  3H91 A;  1I4R A;  5J1Z A;  5CV6 A;  3R3O A;  4MN3 A;  5EPL A;  1L0X B;  4CJ2 C;  4XXE A;  3ND8 A;  3M85 A;  3PO2 B;  4HSP A;  1KAB A;  2RSO A;  1BCP F;  3NTK A;  1SXT A;  1WCM B;  3ERO A;  2PZT A;  1RTO A;  3TN2 A;  2J7Z A;  1QWY A;  4C3J G;  5FK9 C;  1CQV A;  3SK5 A;  1H9S B;  1WTX A;  2E75 C;  2L11 A;  1UAP A;  3MHB A;  1IKL A;  1RHP A;  3NPP A;  4HMI A;  3C3L A;  2BE5 D;  5BN3 A;  4K14 A;  5A35 A;  5C0X H;  3FMC A;  2R61 A;  1TWA B;  2KA7 A;  3K5O A;  4E6I A;  3SDZ A;  1G2T A;  1E0B A;  1HA6 A;  3OW7 A;  2BCO A;  1B3A A;  4IAL A;  1NR2 A;  4OO1 G;  2DNC A;  3BVZ A;  1BCP C;  4IUP A;  3K7A B;  1F2L A;  5CV4 A;  1TS2 A;  5KGU A;  1KLG D;  4Z9C B;  2HDM A;  3V96 A;  3LX0 A;  2KCC A;  3MXP A;  2KVM A;  4A3J B;  5IGF A;  2Q8R E;  5BN4 A;  1XX8 A;  1XXG A;  2NVY B;  1HUN A;  2ICI A;  3OMG A;  4A3E B;  2KJX A;  2E2H B;  4I65 A;  4R9W A;  2K5Q A;  3L7Z C;  4ZAI A;  5K36 H;  1CM9 A;  1PTO C;  5IGD A;  5JPN C;  1MBY A;  3D6W A;  5M5W B;  4IUU A;  1F9S A;  2A6H C;  1BCP B;  3KK7 A;  3LNN A;  3RZD B;  1NCV A;  1SMY C;  3GTJ B;  4EQN A;  3S17 B;  5I9P A;  2V4D A;  5M3M B;  1Y69 U;  3OIP A;  3K5M A;  3A55 A;  3FKI B;  3TP8 A;  3A8K E;  2M9V A;  2L5T A;  2B39 A;  4CHT B;  1JOO A;  3DWP A;  3VYU A;  1ZYR C;  4ID6 A;  1TWG B;  5EPK A;  1PTO B;  4XDX A;  1TVX A;  2XNA C;  4IFD G;  2F0N A;  3W2D A;  4U68 A;  4FF1 A;  3DEP A;  2XWJ B;  2ZXP A;  5C3W A;  1Q3L A;  4CJ0 B;  2RBM A;  1V8Q A;  2EYL A;  2F0U A;  2N88 A;  3S1R B;  5F2D A;  4K6L A;  2R6G A;  1XWE A;  2E2D C;  2SOB A;  2QCP X;  3Q23 A;  2F0M A;  2FFK B;  4BA1 I;  4M8A A;  4U67 3;  3S1N B;  1OXT A;  2VNU D;  4KJO A;  2K01 A;  3S2H B;  3CQZ B;  2L9H A;  2SEB D;  2B2T A;  2NBF A;  2B2Y A;  4XQN A;  5ISR A;  1ILP A;  1DCZ A;  4HCE A;  2F0I A;  2KUM A;  2BE5 C;  1EEF D;  2RQX A;  3X3M A;  3OIQ A;  3RZO B;  4F8M A;  1WVL A;  4B9W A;  3I4L A;  1W6K A;  1JB3 A;  1ML0 D;  4IUT A;  5FO8 B;  4CKE A;  1IYU A;  1C48 A;  1ROD A;  4P2C B;  1EWC A;  3IL8 A;  2BDN A;  3FEW X;  3S9W A;  1PDQ A;  3KUP A;  2FMC A;  4KV6 A;  3WOE A;  4I7Z C;  3S15 B;  3TSS A;  2FJ2 A;  3PUZ A;  1AZP A;  1EY0 A;  1D5Z C;  5FO9 B;  3HOU B;  2LS0 1;  2F0J A;  3OHX C;  3C1E A;  1LTR D;  1OO9 B;  1WTO A;  4PMB A;  1SSO A;  5J39 A;  2A5H A;  3O13 A;  4M1U B;  4ZUI A;  4WOR A;  4WFN 3;  3K57 A;  4IUR A;  2EYM A;  1G29 1;  4PV1 C;  3D4D A;  1BDO A;  2JE6 I;  3E6Z X;  2RKS A;  2EZV A;  1AFP A;  4NP5 A;  1U4R A;  2QDB A;  5CV5 A;  3MWY W;  4TKO B;  4BBR B;  1TR5 A;  2PQE A;  4FYD A;  2CW0 D;  3BYY B;  3SR1 A;  1QNK A;  3VA7 A;  1H9S A;  1G8Z D;  2D62 A;  4K2K A;  2F0K A;  5IT9 L;  3V05 A;  3QB3 A;  2QF7 A;  1KLU D;  1SYC A;  3SVM A;  2PW7 A;  2K28 A;  1CK1 A;  2F3W A;  1CHQ D;  3LWU A;  1SYD A;  2OEO A;  5LL6 X;  2K33 A;  1UUP A;  1M8A A;  1EZ6 A;  3BS1 A;  5C4X B;  1LO5 D;  4PQX A;  2NN6 H;  2F4I A;  4DAP A;  3GTP B;  3L3O C;  2L12 A;  4RGT A;  1EFI D;  1B1Z A;  4QUC A;  2F0S A;  4KK7 A;  1ENC A;  3K5N A;  3CU7 A;  3MC0 B;  4CBV A;  1ENF A;  4IUV A;  3HG9 A;  1EEI D;  1A2U A;  2JYO A;  3MVV A;  2Y0S B;  3GTL B;  1X3Q A;  5JVH 3;  1EZ8 A;  3QWN A;  4BWG B;  5C3X A;  1TS4 A;  2HCI A;  5EKK A;  1VMC A;  3GO5 A;  2L0C A;  4ULL A;  4BA2 I;  5C0X I;  1WD0 A;  4R8N A;  4DAV A;  1SNQ A;  4KY6 A;  1LTS D;  2F0T A;  2C9O A;  3DHQ A;  1X3P A;  4DF7 A;  3ERQ A;  4XTC S;  5C44 B;  3GV3 A;  3GTK B;  3JAM L;  3NUC A;  1WTQ A;  3VR3 A;  1BNZ A;  1J8I A;  3H09 A;  1G2S A;  4HED A;  1GUS A;  4TRD A;  5FO7 B;  1E2Z A;  1KDA A;  4IN3 A;  3K59 A;  2JP1 A;  3R93 A;  2XN9 C;  1PZK D;  1STG A;  1GOZ A;  1D2B A;  1EY4 A;  1BXT A;  5JVG 3;  3BZD B;  1AEX A;  3HOW B;  2IX1 A;  3PMF A;  4Y7N B;  4TSS A;  4IFD J;  4QF4 A;  3RD4 A;  2AQ3 B;  2KQ3 A;  4BY1 B;  1KNA A;  3D6C A;  1F9P A;  3MTS A;  4C3I B;  1E2W A;  1SE2 A;  1SNM A;  4A3M B;  1AW7 A;  1SNC A;  2B8G A;  4BS9 A;  4XYQ A;  3T53 B;  1KTK A;  4ZRZ A;  5KNB A;  2RA4 A;  1TQO A;  2OXP A;  1STA A;  1PZJ D;  4DFA A;  2IX3 A;  3QOL A;  2X6G A;  1D5M C;  1RF2 D;  1D1K A;  1K83 B;  4AYB B;  5JOB A;  3WOF A;  5ELB A;  4WJW A;  5A2Q E;  2NVQ B;  2GA4 B;  2CW0 C;  4PNY A;  3FPP A;  2AQ1 B;  1CFM A;  5DNF A;  5DAU A;  1G6Z A;  3I72 A;  5CYU A;  3TME A;  1RKN A;  2FIN B;  2IL8 A;  1ENA A;  1WD1 A;  2K1B A;  3J7A V;  1FYC A;  3IFD A;  1K8O A;  1SBB B;  1PZI D;  3PIP 3;  2F0G A;  2KEC A;  2MGS A;  2F0O A;  2K5W A;  4N9P A;  4KN7 C;  1FGB D;  3HGB A;  4DN4 M;  1CT1 D;  1TWF B;  2NTT A;  3HS0 C;  2EYH A;  2EXZ A;  2NUC A;  1LTI D;  1QCB D;  2Q8T A;  2IW3 A;  2R93 B;  2PCF B;  3S14 B;  5IOC A;  3H94 A;  1EIH A;  4K6D A;  3QIA A;  1EQT A;  5NUC A;  1F77 A;  1EY5 A;  1IW7 D;  3TBI B;  3NK9 A;  1JQY D;  4RAU C;  4RHS A;  5T1I A;  1QB5 D;  1LTT D;  1GHK A;  2ZXO A;  1O78 A;  5EKI A;  3S2D B;  1S5D D;  1PMR A;  2EYJ A;  3SE0 A;  2DY7 A;  1PTO F;  1WTP A;  3HKZ B;  1I4P A;  1T5X D;  3DUZ A;  1WTR A;  4DNT B;  1FNW A;  1GXD C;  4OIK A;  2K6A A;  2WV6 D;  2WKD A;  1LTA D;  1NR4 A;  1O80 A;  5C4Z A;  3TZD A;  1ICW A;  2E74 C;  2EPB A;  4C3I G;  1TS5 A;  1UEA B;  1TII D;  5IGG A;  2XRS D;  2EOT A;  4RGO S;  1GJX A;  1ZXT A;  2Z8L A;  4DXF A;  4BY7 B;  1K8M A;  3PUX A;  1BUV T;  3N6R A;  4KJN A;  1PTO H;  1A2T A;  5G3L D;  5ELC A;  1YNJ C;  1LAC A;  4G4K A;  2RSN A;  2E2I B;  1HCZ A;  1H9M A;  1WTV A;  2PZW A;  2NB0 A;  2PNR C;  4ODG A;  1I6V C;  1GUT A;  2VB3 X;  1RCV D;  3I73 A;  1HHV A;  2D2C C;  1V1O A;  3U9O A;  2G9H D;  1EYC A;  2EY2 A;  2WIN B;  2EE1 A;  4FXK C;  3GTM B;  3BYT B;  1V1P B;  1H9K A;  1LT5 D;  3J80 E;  2NN6 I;  4KHV A;  1JOR A;  1G91 A;  4KD3 A;  4OIJ A;  2A69 D;  1DOL A;  2I46 A;  4UAI A;  3M3Y B;  2MHV A;  4LMQ D;  1L0Y B;  5C4H A;  1GUO A;  2OT2 A;  2A68 D;  2AQ2 B;  1QNU A;  1TT2 A;  2ZT9 C;  1Y8N B;  1AN8 A;  2TMP A;  2FMM A;  1Q8I A;  5COR A;  2Z1C A;  3OWE B;  3QO2 A;  2IPK D;  4HN7 A;  1EOT A;  3KBX A;  1FD7 D;  5DM7 3;  3P75 A;  3PUV A;  2F0V A;  1ESF A;  3P7J A;  2CHB D;  4HR7 B;  3DEO A;  3E5S A;  2EY5 A;  3K0Y A;  5I9O A;  2WP8 J;  4K8J A;  3A8I E;  1PRT D;  5ELD A;  2M00 A;  2RDH A;  1LT6 D;  1TU2 B;  3NWS A;  3NQI A;  1Z47 A;  3OOC A;  3J81 L;  2MUY A;  2OF1 A;  2ICE C;  5I2Y A;  1IW7 C;  4CKB A;  3ZYY X;  1BQQ T;  1F2M A;  4KHZ A;  4H13 C;  2TSS A;  2M2L A;  2XRQ D;  4NW2 A;  4MHE A;  3C1F A;  1QIL A;  2EY1 A;  1H9R A;  4O42 A;  2I07 B;  4EQP A;  2R3Z A;  1TY0 A;  3A7L A;  3MA2 B;  4F88 A;  3A56 A;  3NSW A;  3I70 A;  1NSN S;  2PZU A;  1MI2 A;  1YNN D;  1FNV A;  5C4J B;  1R9T B;  4LAA A;  4WRD A;  4XIG S;  5FLX L;  5E1F A;  3NBH A;  2JA5 B;  2VB2 X;  1EYA A;  2JA6 B;  2O5I C;  1F9R A;  1JIC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...