4HTHA

Crystal structure of staphylococcal nuclease variant delta+viagla at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMVFRLLLVDIPEFNEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+VIAGLA at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hthA00
3HEJA 1NUCA 3ITPA 5CV5A 1A3TA 2KHSA 4KV6A 4NP5A 4K5XA 1SNMA 2F0TA 5EKLA 3BDCA 3EROA 3QOLA 1EYCA 2RDFA 3NQTA 1TQOA 4KHVA 4K6DA 3NP8A 2F0HA 2F0OA 5JOBA 4PMBA 4DF7A 4B9XA 3NK9A 5J39A 2EYPA 4KY6A 1STNA 3MEHA 5EKKA 5KGUA 2HQEA 3NXWA 1A2UA 4J6HA 4ZQ3A 5C4ZA 4MIUA 4OL7A 5IIFA 3BDLA 2PYKA 2EYOA 2NUCA 3MZ5A 4KJOA 4B9WA 4DFAA 3V2TA 5C6AA 4PMCA 1STHA 2EY6A 3C1EA 5F2DA 4ZUIA 1II3A 5M9OA 3MXPA 2F0JA 1AEXA 2F0VA 3D6CA 2M00A 1TR5A 4EQPA 5KIXA 4EQOA 3D4DA 2PZWA 4NKLA 5CV4A 5CV7A 2PZUA 4K8IA 1STYA 3OMGA 1NSNS 1KABA 3RUZA 3SR1A 5HURA 1ENCA 1RKNA 1EY7A 1EZ6A 4E6IA 1ENAA 1EY6A 5C5MA 4I65A 4KD3A 3TP8A 1SNCA 4DGZA 5ISRA 4K2KA 1SYEA 1EY0A 3T13A 5I9OA 5C4HA 3PMFA 5I6WA 4RKBA 5IGGA 2O4XA 3TMEA 4HMJA 2OEOA 3MHBA 1A3VA 3D4WA 2F0WA 2EYFA 1KDBA 3DMUA 4K5VA 4ZUJA 4K14A 4EVOA 1JORA 3D8GA 2KQ3A 3P1HA 4HMIA 1JOOA 4ID6A 4N9TA 4WRDA 2EYJA 4K2LA 3SK6A 5KEEA 3E5SA 2EY5A 2F3WA 3TP7A 3HZXA 2F0FA 5IODA 3ERQA 5KYLA 3OMCA 1SYFA 1EQVA 1SYBA 3S9WA 3NUCA 4IZ8A 3OWFA 4QB4A 1TT2A 2F0QA 1EYDA 5K5PA 4F7XA 5C3WA 5I9PA 5IGFA 2F0GA 4N9PA 4KY7A 2PZTA 1EY9A 3R3OA 2F0NA 5CV6A 2PW7A 3TP5A 2EYLA 5DAUA 1EY5A 1JOKA 2WACA 2F0UA 5C3XA 5HGTA 2F0SA 3C1FA 5J1ZA 1U9RA 1F2MA 2EY2A 4KTAA 5IGDA 1EYAA 5KYIA 2F0DA 5IOCA 2RKSA 4IALA 4KJNA 4IUNA 3T16A 2F0PA 4PNYA 2SOBA 2F0KA 4K5WA 4KD4A 1SNQA 3QB3A 2PQEA 3SK5A 3VA5A 2OF1A 1F2YA 3SXHA 5J22A 1KAAA 2EYMA 2LKVA 2PW5A 3SK8A 2OXPA 5CV8A 3SHLA 2F0LA 1F2ZA 4QMGA 4F8MA 3OSOA 4LAAA 1STBA 5I6YA 3EVQA 5KRUA 1IHZA 1STGA 1SNOA 3SK4A 1SNPA 3MVVA 3P75A 1SYDA 2F0MA 1STAA 3QOJA 2SNMA 5CGKA 5IGEA 5DEHA 3DHQA 4S3SA 2SNSA 4RKLA 5C5LA 1JOQA 5CV9A 1A2TA 5EGTA 4NDXA 4DU9A 5IGBA 1KDCA 2EYHA 3EJIA 2EXZA 4J1MA 4ME5A 5E3FA 5JAVA 1A3UA 2RBMA 1KDAA 2QDBA 4K8JA 3TP6A 4ODGA 3U9OA 1EY4A 2F3VA 3NHHA 4WORA 3H6MA 4KY5A 4R8NA 5NUCA 4EQNA 4HTHA 4QF4A 3LX0A 2EY1A 2F0IA 4G57A 1SYCA 4YIJA 2F0EA 5CR3A 5E1FA 1SNDA 1EY8A 5CC4A 1EZ8A 4NMZA 4TRDA 5IGCA 1SYGA 2ENBA 4H7BA
chains in the Genus database with same CATH superfamily
3MXNB 2KHSA 2NWGA 3S16H 5G3LD 4R9WA 3A0JA 1X55A 1TIID 1KC8C 1K83H 3J80E 2MPMA 2H1EA 2HQEA 4JI3L 2VQFQ 4WJ3M 4A3EH 1II3A 5ELFA 1BUVT 1NCVA 3RLNA 4RGMA 1G6PA 4Y7NH 4OX9Q 1WTPA 1PZKD 3F2DA 3CPFA 3KFUA 1B70B 1EZ6A 1ENAA 1EY6A 4KD3A 3TP8A 5AJ3Q 4JI4Q 3HKZB 2K1BA 1EIHA 1K0SA 4A3JH 1WCMB 2IY5B 4DR1Q 3PO2H 3AEVA 4HJ5A 3H15A 2F0WA 4ZUJA 3PSIA 2NBFA 1DCZA 3CCMA 1XJVA 2EYJA 1RCVD 4IFDJ 1IYUA 1AE2A 3M7NA 4DR5L 1X3FA 3OTOQ 1HH2P 3BU2A 2QEJC 2F0QA 3HOZH 1E2VA 1B8AA 2F0GA 4DAMA 2VY3A 4A3CH 3H3VH 1RHPA 4OXPA 4IPHA 4C3JG 1F2MA 2EY2A 3SE0A 2Q2IA 5E7NA 5C0XH 4YCUA 2F0PA 4PNYA 3NTIA 1BBXC 1HQMC 1XNRQ 4A3KG 3PO3B 1HNXQ 4QMGA 1MBYA 4LAAA 2Z0SA 1STGA 4HIOA 3P75A 2B2VA 2E2IB 3T56B 3Q8DA 1D5ZC 4L63B 4FF1A 2ICEC 4FYDA 1SJED 3EJIA 4XQNA 5FJ8G 3J80c 1EY4A 5NUCA 1N33L 2UUAL 1X3PA 1T9HA 2F0EA 3H3VI 1QUQA 1VQHA 5C3EB 5C44B 2DY7A 3HOVG 1OTCA 4H7BA 1P8LA 2UUBL 1E7ZA 2EOTA 5BR8Q 3HOYH 3PIO3 3HKZE 3EROA 3I3CA 1D2BA 4DF7A 4FP5D 1UWVA 3H0GB 3J7AV 4DUYL 4DR4L 5K36H 1TWGH 4A3LG 1V1QA 4A93G 5IYCG 4ZK9B 2NUCA 1CT1D 4BY7H 4B9WA 2EIFA 2AMCB 2BA1A 4POFA 1TWCH 1ET9A 2K6AA 2J4XA 3GQBA 4A3BH 3NBHA 1YJNA 1SFOB 2JA6B 1NSNS 1CHQD 3FP9A 4OHJA 3RUZA 1MSHA 4E6IA 4NXMQ 1BCPC 1EWHA 1AP0A 3UDFA 1U5KA 2HDMA 5KNCA 1YZ6A 3I4NB 2EQSA 1A8VA 5HY6A 2EYFA 4BWGB 1BR9A 2JA7G 1VQAA 4QJFA 3P1HA 2B3GA 3CCEA 4NXNL 2R93H 3KDFB 4WRDA 4P75A 4LFAL 1DXMA 3L3OC 2NZHA 3ERQA 1JR0D 1SYFA 1VQ8A 4MZ9A 2BH2A 2B2VC 4HR7B 5G3LF 2JE6I 1Q8KA 1JMCA 1ZXTA 2PZTA 2DY8A 5ELBA 2D5DA 2CCZA 1VQ6A 2WACA 1FYCA 4RWSC 4X64Q 3EQLC 4DUZQ 4ALPA 2D9UA 2KCMA 3K80C 3CW2C 1SE3A 2L15A 1JICA 1SMYC 2SOBA 2KBNA 4YHHL 1U0LA 3X3NA 3C3LA 2K5VA 1SNQA 2OF1A 1F2YA 2RHQB 2LKVA 1YI2A 2Y0SG 3OHXC 1X56A 1R9TH 4R4CA 4LF5L 1VMPA 1S40A 2E5LL 2HD3A 2JA8G 4QUCA 4HJ7A 1I94Q 3A56A 2XNAC 4LFBQ 1KQSA 3I56A 3HOXB 1N34Q 5IGBA 1O7LA 2EDGA 4QL5A 1Y1VH 2A74C 4ME3A 2EJMA 4QF4A 3GTGH 2JA5H 3J7A5 1CTMA 2EZVA 4KKTA 1WTXA 3HP3A 3V05A 1VDZA 1QVFA 4XXEA 1KLUD 3QWNA 1LTTD 2FJ2A 1CM9A 4RGOS 3ITPA 4JI5L 3MTSA 1SXTA 3OW2A 4YWMA 2B2TC 2F0OA 1AZQA 1C9OA 3UDXA 3KK7A 3NK9A 4LW1A 3CCRA 2AUJD 4TVAB 2E2JB 1JQYD 1RDPD 4QIWB 1K8MA 2I0QA 1H9SA 2UXCQ 3E0JA 1V1PB 3I70A 4CJ1B 1PH1A 3RZDH 2ICIA 2B8GA 2NVYH 3CQZB 3I4OA 3MWYW 4EQOA 3D4DA 2R6GA 3K57A 4JI6L 1H9KA 2CWAA 1LABA 1Y14B 4WJWA 2IHFA 4LF9Q 4ZCKA 3RLFA 3GTOH 1I6VC 5C4XH 2BE5D 2NVQB 4B3MQ 2I07B 2QF7A 5A2QL 4ID6A 5IYBG 2YU9B 1K8OA 5KEEA 1NR2A 2OWOA 5GAGC 1IW7C 4GKJQ 2N49A 2RCFA 5FK9C 1TT2A 2NN6H 2O5IC 1RF2D 1SE2A 1PTOB 4FDBA 1D8LA 4OONA 3AQQA 1NJIC 3SEBA 3KOJA 1SE8A 3QR8A 2KUMA 1LTRD 1EYAA 3CC7A 2XRSD 4IUNA 3KBXA 2F52A 5EPKA 3VA5A 5J22A 2MHVA 1PRTF 2PMZB 4K0KL 4CJ0B 3QJYA 2UU9L 1IHZA 1LUZA 5HGQA 1Y1WG 1KL9A 3H94A 1NBWA 3MVVA 3VYSA 5FLMH 4LUZA 5M5WB 4CKCA 4S3SA 3TZDA 2ZXPA 2R7FA 3JAMi 1GUNA 3TEHB 2NN6I 2EXZA 1E24A 3J7AF 1PZID 2RVLA 3CAMA 4QIWE 5LMNW 3NHHA 1GJXA 2MJ8A 1XXGA 3I4MG 3W1GA 1K73C 5DM73 1BKBA 1JWMD 2YV5A 1WCMH 4XQQA 2VQEQ 2G9HD 4DR2Q 1A3TA 3AFQA 2E2DC 2Z8LA 2MFIA 1NE3A 2J7ZA 4BBSB 5IP9G 1QE6A 3I91A 1FR3A 3L2PA 2PYKA 2H4OA 1J5EL 1KIXA 3V2TA 1VQEA 2K28A 5F2DA 5M9OA 1K8GA 4ZYSA 2F0JA 1AEXA 4KLKA 3G6EA 2RSNA 1W6JA 2MNAA 4A3FG 2JEAI 3UDIA 3HGBA 5IWAL 3RN2A 4JI7L 2R7DA 4L5TA 3ICEA 3FKIB 4GZYC 4K2KA 5H1SE 2VZAA 3NTHA 3PO3H 4LF6Q 4YCWA 4IURA 1YNNC 2X6LA 3IAYA 2N78A 1N36Q 2KEEA 4TKOB 4POGA 4B3RQ 1YBYA 2PMZE 4K14A 2RF4A 2WAQE 2E2IH 3OPOA 1NMFA 4KHZA 5LMUQ 1CKNB 1WTVA 2RA4A 2AQ2B 1VF5C 1Q90A 4YY3Q 3TSSA 1IYJB 3F8TA 3PIPA 4ZAIA 3K5NA 4IZ8A 4F7XA 1UE5A 2RSOA 2O5JC 1XNQL 4DAYB 4UY8C 2MO0A 4JI4L 1U9RA 5C3EH 3CCVA 5C44H 3LNNA 1JT8A 2F0DA 1X6OA 4B3SQ 2K14A 4BA1I 2VUMG 1VQBA 2KENA 4BBRG 2Q8RE 2V1CC 1YNJC 1G8ZD 3FRPB 4BY1G 2IX3A 1F2ZA 4F8MA 3H0GH 5ELDA 5C4JB 3E6ZX 1VQGA 1I4RA 4DR3Q 2Q2UA 4A3GB 1TWAB 3DHQA 1PZJD 5IYDH 3R2TA 5CV9A 1IZ6A 1JWSD 1CZWA 4DV7Q 4X3KA 3JAME 1JC7A 1EEFD 2JA6H 2J0TD 3U9OA 1SFOH 3H6MA 5CORA 1GD7A 4V0BA 4YIJA 3HRZC 2FMMA 5E1FA 3TREA 1Q46A 4OO1H 3AMUA 2LSSA 5D3DA 3K0YA 1HNXL 4IN3A 3I4NH 2YTVA 1TS3A 1UE6A 4B3TQ 2PPBC 4M1UB 3RR5A 4J15A 1J9OA 2CHBD 2NVXB 3A7AB 1DD2A 2L4NA 3BZDB 3E9HA 3G6JB 1HFNA 4EQPA 4KMUC 4C3HB 4NKLA 2C9OA 3BZCA 3M3YB 1FGUA 2PZUA 1Q82C 3OMGA 1CKOA 2A5HA 4L5RC 3AB9A 4PMWA 1FGBD 1X54A 3KJOA 1EQRA 3NE5B 3T13A 1X9NA 3NWTA 4JI1Q 1O7IA 5EPLA 2XGTA 1LTID 5J3BA 4K5VA 1KAWA 1DYQA 1QILA 1U4RA 4PZ7A 2LY7A 1DM0B 1SROA 3E5SA 2EY5A 3EFXD 3HOXH 4DV6Q 1W2BA 5C0XJ 4QB4A 4A3JG 1XMOQ 2JA5B 5A35A 3E0EA 3EA6A 1XPUA 4LF8L 1HFGA 4HEDA 4ABNA 2HHHQ 3F1ZA 2XSCA 4OWXB 1GUOA 3DWAA 1LTGD 2Z6KA 2LFNA 4ZKCB 1PMRA 4Q5VA 3CCJA 3SK5A 3JAMc 1PYSB 1F9QA 3NSWA 1DOMA 3I90A 3C46A 5I6YA 3OSOA 1VQ7A 3UE0A 2QW7A 4JW0A 3DWQA 1ICWA 3GV3A 3SK4A 2E2JH 4IPDA 1Q1BA 3BVZA 1F9RA 1VQ9A 1KRTA 1N9WA 3J80L 2SNSA 4FVMA 1S72A 2F4IA 2BDNA 2KOLA 4NDXA 5JVG3 1KDCA 1PRTC 3CQZH 3PUWA 4GOPA 5E3FA 3FHWA 4YWLA 4LJZC 2F3VA 3QIAA 3LX0A 3HOVB 4OWTB 1PXUA 1QCBD 2CW0C 2Q2TA 1EZ8A 4X66Q 2PQAB 3HS0C 1HCZA 4C3IG 5IGCA 2N88A 1FL0A 5EAYA 2H5XA 3LWUA 2NVQH 3GTQB 3FEWX 5FO8B 2AQ1B 5AFWA 4A93B 1I94L 3CMAA 2L0CA 1VQ4A 1K28A 1N34L 4LF7Q 3I55A 2A19A 2F0VA 1QZHA 1SJHD 4KKSA 1PTOD 1JB7A 1TR5A 1MIUA 5KIXA 1EIFA 2XIWA 1OO9B 1JCKB 2XVSA 1PDQA 4XQJA 1KABA 1E2WA 1MHWC 1SYEA 4FXKC 4AYBE 2Z6KC 2F4VL 2JA7B 1WTHA 4YCVA 4DNIA 3S1RB 1AH9A 4R4OA 5BN4A 5LMNQ 5D3IB 5M5WH 2KCTA 2WP8J 2UXCL 4DK0A 3RNUA 3HZXA 1IBKL 4JI8L 3OMCA 1B3AA 2M9VA 2ID0A 3CXCA 5I9PA 3W5OA 4Z9CB 2NB0A 4J8QA 4IPCA 1N32Q 2A69D 1EY9A 3K5MA 4OGQC 5CV6A 1IBLQ 3GP7A 1WYDA 1QWYA 1I4PA 1IBMQ 4GOPC 2R93G 3S15H 4GN5A 3K5LA 4HIMA 2KHJA 3DXJC 4R8IA 2Y0SB 1QJOA 1STEA 1C8CA 1TVXA 2R7ZH 2OXPA 1S5BD 2JA8B 2F0LA 4BBSH 4GNXA 4BXXG 1BCPB 3U9SA 5COYA 2LXKA 4RH6A 5ELNA 5IGEA 2ZM6L 1HNZL 1LACA 5T1GA 4JBJA 4KN4C 3MFGA 2LS01 4LF4Q 2B63G 1F9PA 4ME5A 2K7VA 1KDAA 2JK8A 1VMCA 1I6HB 3MXGA 1PFSA 2EJGC 2I5HA 5JEAH 4DV4L 3FKIH 5CR3A 2A1AA 2MQHA 2CQAA 2E76C 4IFDG 2BE5C 2UUCQ 1F9SA 5CV5A 4A3MH 3GTPB 4KV6A 1EOTA 4IOCA 2ZTEA 3VR2A 4K6DA 1PYBA 3M4PA 4JI2Q 2I46A 2KCNA 2NVTB 2K01A 1SAPA 4KY6A 3TBIB 1QUQB 1D5XC 4J6HA 4ZQ3A 2JP1A 1MSGA 2R92H 2KA7A 3VYTA 4DK6C 1LT4D 4KHPL 5C6AA 1NAPA 1STHA 2GVAA 4UP7A 4ZUIA 3BYYB 1GOZA 1YIJA 4JPBW 2PZWA 1PVOA 5C0XI 2B39A 1VQNA 2EXDA 3I73A 2VQEL 3K0XA 1CQVA 5E4XA 3VDYA 3G48A 1PH6A 1EY0A 2RCNA 3GTJB 4JG2A 1E3PA 4DK3C 4RKBA 1YJWA 4A3IG 1CQFA 1CZGA 5C4JH 1A3VA 3KJPA 1KDBA 1S5ED 3NBHB 4EVOA 4GKKL 1NY4A 4HMIA 4A3GH 1TWAH 4GNXC 3PF4A 4H02A 2D0OA 4HSPA 4HSVA 3BYTB 4CHTB 2L12A 1SMXA 2UXBL 4N9PA 1B53A 5C4XG 3TP5A 5HGTA 2F0UA 4DXFA 1EFWA 1D6EC 2WV6D 2B2TA 5CBAE 4LF6L 1A15A 3T16A 2UXDL 4DV5L 1PTOF 3STBC 3CPWA 1N36L 4DV3L 2NN6G 1S5CD 1CA6A 3PV0A 1EWCA 1SDFA 1SR3A 5JPNC 2Z6BA 3P20A 4IUTA 1EOVA 2NVXH 1WI5A 1XMQL 4QUFA 3T1HQ 4AQYL 4DA2A 4A3DG 1RD9D 2OQKA 3NTKA 1NMGA 2EYHA 2RQXA 4C3HH 2X69A 4UAIA 2A6HC 4K8JA 3M3YH 1VQIA 4ODGA 3E3XA 4FF3A 2ZJRA 3IRBA 2EY1A 4H0LC 1EU3A 1TWFB 2BOSA 1SBBB 1C4QA 4JYAL 2A68D 1QOHA 4X3UA 2R3ZA 1UAPA 4CDCC 4DR6Q 2B8FA 1GUGA 3HEJA 1JB3A 1H9MA 5IT9L 3BDCA 4HN7A 4XIGS 3TQYA 3ZYYX 2KCCA 3T1YL 2CVRA 5CBEE 2CWPA 2EYPA 4PZ6A 3HKZG 1HNWL 1SLJA 3CC4A 4DFAA 2QCPX 2GA4B 2BA0A 3X3MA 4A3FB 4C3JH 1YHAA 2K5QA 5FO9B 4K8IA 3CCUA 1STYA 3I4LA 4JC0A 3OIQA 3TZUA 1RKNA 1I4XA 3K81C 5C5MA 4ZRZA 5ISRA 2HIVA 2OTLA 1PHJA 1LTAD 4RA8A 1H9SB 4OIKA 3G4SA 3GD7A 2MO1A 4ILWA 1DOLA 4IOAA 2OEOA 3J7YW 4DV0Q 1M1KC 3D8GA 3KF6A 2SDFA 2V4DA 5FJ8H 1I4HA 1WOCA 1B3QA 2CH4A 3KF8A 3PUZA 2JN4A 3HOVH 1RL2A 3L0OA 1OXSC 4R1JA 3S24A 5I4DA 2VUMB 5T1IA 1HJPA 4GLXA 5IT9E 3U58A 3ER0A 4XYQA 5ELOA 4BY1B 1NNXA 4RAUC 3FMCA 4DV1L 2I5MX 3GTQH 2IT1A 5JJKA 4MN3A 4JVZA 4UP9A 4A3LH 1EUJA 4A93H 5IYCH 3KLWA 4NPSA 3HOUB 1Y8NB 4H44C 5C44G 4DV6L 2DUDA 1STAA 3KBGA 4RKLA 1W3SA 4DN4M 1SEBD 2TMPA 3L7ZC 1LT6D 2DN8A 4IO9A 3MEFA 1D1IA 3H0GG 4DNTB 4EQ5A 2K5NA 4C1NI 5FLXE 1MD2D 1YJ9A 1VQDA 4X62Q 4G57A 2LMCB 3ND9A 3AU7A 5D65A 1MI2A 1H9JA 4TRDA 2JQOA 2JA7H 4FF4A 1GVPA 4HJ8A 3HOWB 2ALYB 1NUCA 3S1RH 4R4IA 3S2DB 4NP5A 4U68A 4IUVA 2GVBA 2K5HA 3NQTA 1E0BA 1TQOA 2Q8IB 3MC0B 1MJCA 4HJAA 3KLSA 2Q2HA 2K50A 1B2TA 3M4YA 2K5WA 3CKIB 4U673 1FJGQ 1JJCB 2KECA 3F2UA 3OWEB 3S17B 1TY2A 2EYOA 1ESRA 2AHOB 4DR7Q 3I4NG 1JE4A 4X3TA 2IHEA 3JC66 5EJWA 1EU4A 3S15B 1Q12A 1HTLD 3GDEA 4RGNA 3BG3A 1VF7A 1PH8A 3KYHC 4R4QA 2R7ZB 1HRJA 5IGGA 2JA8H 1N33Q 3CCQA 2UUAQ 4L8JA 5M3FG 1S4ZA 1YHQA 2K75A 5IT9c 1E2ZA 2A73B 1PA6A 3T4AC 1W6KA 2D0PA 2XWBB 4C1NK 1LT5D 1FNUA 1PFNA 1HXYD 4X6AH 1BVSA 2NTTA 5IP7G 5I2YA 3NELA 4DV2Q 5C3WA 4HJ9A 3BZKA 1I6HH 1B44D 4EGVA 4DUYQ 2EYLA 2P5ZX 1ICFB 1EY5A 1QB5D 3PUYA 3JAML 1V9PA 3DEPA 1CUKA 2ZXOA 4P72A 5KNDA 1EL0A 4IALA 3HOXG 4A3MB 3D0FA 3GTPH 1CFMA 1L1OC 2VQFL 5LMNL 5FLXc 2NVTH 4CBVA 5JJIA 1LLRD 4O0AA 2R92B 1SNOA 1EIYB 1SMYD 4ULLA 4OX9L 2K04A 3TN2A 3Q22A 2WIIB 1K3RA 3PQIA 3DWPA 3J81i 1IBLL 4DU9A 1NTGA 5AJ3L 1Z9FA 5LHY1 3GO5A 3FDTA 4WORA 1K8AC 2KHIA 1BF4A 2PI2A 4DR1L 3CMEA 5JPMC 5FO7B 3L9AX 1K0RA 2K5DA 1ONLA 5I2XA 2WINB 3GTJH 1B1ZA 1HA5A 3BJUA 2VS1A 4A75A 3OTOL 1I3QB 2IJ0A 1JJGA 3NP8A 4PMBA 4LWCA 2F3IA 1Y69U 4OWWB 2FFKB 1BBUA 2A69C 2R61A 2RHSB 3MXPA 3A5UA 2AWNA 1HZBA 3PF5A 1XNRL 1WTWA 1I4QA 2E5LQ 4GLVB 1T5XD 5KNBA 1E1OA 1EQTA 2MUYA 1LTLA 2HUGA 1G6ZA 2XN9C 3Q23A 3Q24A 1ENCA 3CC2A 1KD1C 1B4OA 4RGTA 1PRTB 1C7YA 1HZAA 1SNCA 1UUPA 4DK1A 3H91A 2B2UC 5C4HA 4JI2L 3K58A 3CD6A 1ILQA 1MGSA 4DPGA 1DJRD 5M3MG 2MP1A 1BO0A 1JE5A 1VQJA 2Z4HA 1HR0W 4BA2I 4V190 3W3AA 2CFMA 3GV6A 2WAQG 3GTLB 3H3VC 1KTKA 4QGUA 1XPRA 1EYDA 2B29A 2C35B 3I4MH 5L37A 3BVMA 5TSSA 1VQKA 1FD7D 1L2FA 1DONA 2EPBA 4OO1I 1TWFH 5C3XA 5BR8L 4G7OC 4A3EG 1IW7D 3KLSX 1LM0A 5IOCA 3S1MB 5M5YB 2F0KA 5DNFA 3T53B 2K4KA 5IP9H 1B7YB 2EJFC 3A7LA 4L5SA 2L11A 2ZT9C 4JI6Q 1PH7A 5JEAJ 3PO2G 4C3JB 3K8AA 1I4GA 4A3FH 4NXML 3FPUB 3IFDA 3D3RA 2JSOA 3W2DA 3J81E 3D6WA 2E8GA 4A3KB 3EIVA 1I5FA 4EQNA 4CKBA 1B9MA 4H13C 1KXLA 3WDNA 3HOZG 3S2HB 1SYCA 3RLOA 1DGSA 4ZLTF 1KLGD 1JJ2A 4IQZA 4A3CG 4WJ4A 2QILA 4NMZA 2K32A 2X6GA 4LFCQ 4GOPB 1CHPD 5C0XG 4K5XA 3URYA 1Y8PB 2VB3X 5JOBA 4UP8A 2O2LD 2Z4IA 3NWSA 2ES2A 5EKKA 1WTRA 4K6LA 4OL7A 4X64L 4DUZL 5FKAC 1SRUA 2EVBA 1G2TA 2XWJB 1GUTA 4K0KQ 2K05A 1U4MA 2HCCA 4CKEA 1QVGA 1UE1A 3CRLC 2VUMH 4BBRH 2G5DA 5ELCA 5GQOA 3VYUA 4BY1H 2QKIC 4QQBX 1YVCA 3Q0AA 4A3IB 4RCNA 1CA5A 4LFBL 4O1NA 2C5CA 3CCLA 1GO3E 3HOUH 1JWUD 1EWIA 1J6QA 5EPJA 3R2IA 3HOYG 3OW7A 2SEBD 4DAPA 4G7HC 2A6ED 1Q1EA 3HKSA 3PIOA 1EQVA 4O2DA 5K36G 4IUQA 1H9RA 1GHJA 3C2PA 4RMFA 4BY7G 1JOKA 3BVGA 5JJZA 5J1ZA 4KTAA 1J5EQ 2WKDA 1KRSA 1WVLA 3GTKB 5EBDA 2OCEA 1RJTA 3J81c 3R93A 3HOWH 4A3BG 2PQEA 4HIDA 3S2DH 4IUPA 4DV0L 2HT1A 4UPAA 4B08A 3SHLA 5IWAQ 4JI7Q 3EVQA 4IJHA 1WD1A 1SNPA 2Z1CA 1Q7YC 4A3DB 3QOJA 3S17H 3B6YA 3I72A 1G291 2WFWA 1YNJD 4JOIA 3S14B 4JV5Q 1TS5A 1I50B 5LL6S 3F2CA 2WB1G 1BXTA 1L0XB 1PLFA 3MXNA 3K59A 4LF9L 1BBWA 3GTMB 4GNXB 1B9NA 1X3QA 4HTHA 3PGZA 4B3ML 1YITA 1OXXK 1CI3M 2IW3A 4MHEA 2VB2X 3HFZB 3M85A 1XNQQ 3TRZA 4C3HG 2NYZD 2D2CC 3AFPA 4GKJL 5EKLA 2DGYA 1GXDC 1D5MC 4IJLA 2N55A 1GHKA 1HTPA 4RHRA 5IE8A 2L5TA 3M4OB 1N8RC 4PMCA 2EY6A 2F03A 4OELB 1ENFA 1TY0A 1XTDA 3DM3A 5M5XB 1A63A 4X62L 4XTCS 1QVCA 4PG3A 2BH8A 3TS0A 1KHIA 1K9MC 1IYVA 3KLRA 5CV7A 4RFBA 1ZYRD 3S1NB 4AIMA 2B2YA 3OOCA 1C0AA 1OXTA 1Y1VG 4HCEA 2ASBA 2NZOA 3NENA 2JA5G 4JBMA 2F1MA 1UEAB 3LGJA 1TU2B 2JYOA 1FJGL 1R4QB 4AYBG 2VNUD 1JORA 1U4PA 2YYZA 1LO5D 2RDGA 3M7GA 4FNFA 4N9TA 1VQ5A 4DR7L 2ZTDA 2PO4A 4JI0Q 3UE1A 1SYBA 3OWFA 4JOIC 3H09A 4KY7A 4GLAC 2F0NA 4DR2L 4C3IH 3VR3A 4MTNA 2I5LX 2N3SA 3NPPA 5KYIA 3Q6SA 2Y0SE 3MAQA 3OYYA 2N8NA 4TQUS 1F77A 4PQXA 4O42A 3SXHA 1I3QH 4XT3B 4PV1C 1Z47A 1EYGA 3RZOB 3J7ZC 1SN8A 1Z7TA 1EFID 1STBA 3ND8A 4LMQD 2D62A 2OQ0A 4C2MB 1PH2A 1AE3A 2SNMA 1BQQT 4I7ZC 5CGKA 1HUMA 5EQ0A 4DV2L 1M4VA 3E9IA 3D4RA 1XX8A 1WTQA 1BOSA 3IKJA 4R8NA 4KY5A 4KKUA 1FNVA 4UHVA 4FO2A 4B3RL 2XTIA 1X3GA 1Y1WB 1HR0Q 1L0YB 1PRTD 5LMUL 2VW9A 2B2YC 3RD4A 1GM5A 2A8VA 1T5EA 3I7FA 2AUKA 4YY3L 4LF8Q 1SNMA 2F0TA 1V1OA 2RDFA 1M8AA 1PH3A 3CU7A 2CW0D 3W1BA 1STNA 3DLLA 3CCSA 5IIFA 3GTLH 3QG1A 2AKWB 3I4MB 3A5ZB 3MZ5A 2K33A 1TS4A 4B3SL 4L6TB 5FLMG 2KEDA 1BDOA 2E2HB 3ONAB 2DJFC 2DNEA 4JBWA 5CV4A 1CKMA 3SR1A 3KDFA 5HURA 3S1MH 1X32A 1EY7A 5M5YH 3UI2A 4X65Q 2CH4W 1VQFA 3A74A 5M3FB 4DR3L 4BXXH 4MTKA 2O4XA 2YTYA 1HUNA 1L0WA 4WFN3 3ERSX 4DV7L 3R8BA 3U4ZA 1WCMG 1JOOA 1O7YA 4Q0FA 2B63H 3SK6A 1OXUA 1PH4A 5KYLA 3NUCA 2ZJPA 1G91A 3CF5A 3ULPA 2YTXA 1S3OA 4A3KH 5DAUA 3S2HH 2F0SA 4IFDH 2PNRC 4B3TL 3KF6B 2TSSA 2Q8TA 5FLXL 3TDQA 3CHBD 1ZKOA 1TWHB 3DEOA 4CDEC 4K5WA 3P7JA 3N52A 3IL8A 1WJJA 1IXRA 5EKIA 5CV8A 1M90C 3KF8B 1QZGA 3KUPA 5BN3A 3K5OA 5BN5A 1RTOA 3PO3G 3ZJYC 2F0MA 2L9HA 5D14A 1A62A 3NQIA 4F87A 2F4VQ 1VCIA 1JOQA 2ZXRA 3A8JE 4XYOA 1CSQA 4JI3Q 4BBRB 2L1BA 2RBMA 4JI1L 1XWEA 1B50A 2EE1A 4OEMB 4JI8Q 1IBKQ 1F2LA 4IFDI 4A3IH 3DM1A 1V43A 1AW7A 1IKLA 1HZ9A 4RG1A 4APVA 1SSOA 5C3EG 1V1PA 1YNXA 3QOLA 4KHVA 2E75C 2IL8A 2FMCA 3I8ZA 4JBKA 1VQOA 1XMOL 3A8IE 5GADC 1Y8OB 5C4ZA 2HHHL 1L1OB 4KJOA 3C1EA 1VQLA 1LYLA 2K03A 4JCVE 4GN3B 1ESFA 4DR5Q 4R4TA 3I2ZA 4XDXA 2XRQD 1YHBA 1L1OA 1DZ1A 5IYDG 1UEBA 1ZEQX 5EBCA 3GTKH 3K7AB 1PYWD 4KK7A 4LFCL 2ZM6Q 1HNZQ 3S1QB 3K6OA 4CDFC 3CP0A 2LXJA 2JA6G 2HQLA 4LK1C 3A55A 1AN8A 3MA2B 5M3MB 1MKHA 2JA9A 3PMFA 3TMEA 4OO1G 1CK1A 4DV4Q 4F88A 4A3DH 3S16B 2WAQB 3SDZA 4K2LA 3A8KE 4G7ZC 3S14H 1K83B 3N6RA 1I50H 2F0FA 4XT1B 4P74A 2JXMB 1HA6A 2RDHA 3A54A 1RIPA 4X66L 5IGFA 4A3EB 1WD0A 1HZCA 3GTMH 3R3OA 1ASYA 1EQQA 4P2CB 3C1FA 1D1KA 4Y7NB 2NTSA 2K52A 1YEZA 1AZPA 4KHPQ 1CSPA 1O78A 1IL8A 5E4WC 2QA4A 3NEMA 3QB3A 3G71A 2AWOA 1WTOA 4LF7L 1LT3D 4P71A 1BCPD 1QG7A 5CYUA 3VYRA 5GAHC 1G2SA 3PUVA 5DLQE 3U4VA 4A3JB 3FPPA 5KRUA 5A2QE 2UUBQ 3PO2B 3OIPA 4P73A 2FHTA 4AH6A 1E1TA 1QNUA 3NBIA 4LUVA 4QY7A 3STBD 1XPOA 1XYIA 1IL2A 3M4OH 4C56C 1AFPA 1VQPA 5C5LA 4DR4Q 4CDDC 5M5XH 5EGTA 2QGQA 4EX5A 2NZ1D 1VQCA 3HOZB 4GKKQ 2QDBA 1TKWB 2B2UA 3AYHB 1NR4A 2PCFB 4YWKA 3S1NH 1ET6A 4DNRB 4N8X1 1SNDA 5JJLA 4IUUA 4BS9A 1RODA 4GS3A 5IY0A 2UXBQ 3TS2A 2HIXA 2A6HD 5GAEC 3U50C 2VXWA 4JK1C 3WOEA 4MNOA 1N32L 1X65A 3M4QA 1PTOC 2A6EC 4B9XA 4JV5L 2UXDQ 2OTJA 4DV5Q 1H95A 3NXWA 4DV3Q 2G9DA 2IPKD 3EN2A 1IBML 1PH9A 4NXNQ 1X3EA 5LL6X 1TS2A 4LFAQ 4C3IB 3D6CA 1VQMA 2FINB 4NB3A 4NW2A 2Z9HA 2IWHA 2KJXA 1O7ZA 1XMQQ 1BNZA 4AQYQ 1CKNA 5IYBH 1FVIA 3D31A 5I9OA 4CJ2C 5I6WA 4YHHQ 3VA7A 4DAVA 2OT2A 3RZOH 4HMJA 1RTNA 3HOYB 3D4WA 4LF4L 4JYAQ 4C2MH 2KQ3A 4DAYA 1S5DD 1XTCD 4LF5Q 2F3WA 1TWGB 3TP7A 2BCOA 2HCIA 1VS0A 1FNWA 3WOFA 3S9WA 4GN4B 4BY7B 1Q3LA 2FXQA 1Z6HA 1G51A 3T1YQ 3HOUG 1D7QA 1TWCB 1K3BC 2UUCL 1HPCA 3F2BA 1PFBA 2PW7A 4IPGA 3J81L 3WWVA 4ZKBB 1HNWQ 4A3BB 1Y1WH 5IGDA 4RHSA 3UDGA 4FXGC 1MJEA 5DM63 4OIJA 2EYMA 2PW5A 3MFYA 3K7UC 5GROA 4DXGA 4JI5Q 4JI0L 3M9BA 4HAEA 1SYDA 2HDLA 4G4KA 1Q81C 2WB1B 2R93B 3VR6A 2PI2E 2DNCA 5CMDA 3HOWG 1C48A 1ML0D 2E2HH 2PNHA 3DUZA 4J1MA 1S5FD 1A3UA 3TP6A 4L5QA 1ZYRC 4A4IA 1U4LA 4FXDA 2F0IA 1R4PB 4N8FA 4KN7C 1GUWA 4UDUC 5M3FH 5CC4A 1PH5A 1UNSA 1SYGA 3QO2A 1GKHA 4LNQA 3MXUA 1ASZA 2CQOA 3CRKC 2IX1A 1EYCA 2B2WA 5ELEA 2B63B 2F0HA 3J80i 5IP7H 1Q86C 2MGSA 1J8IA 2IX0A 1TXYA 1R9TB 3RN5A 2CKZB 5J39A 1A0IA 2R7ZG 3MEHA 5KGUA 1A2UA 4DV1Q 2DJGC 4MIUA 3VR4A 1BCPF 3BDLA 3G7LA 4BBSG 1HQRD 3PUXA 2ATWA 4I7AA 2M00A 4M8AA 3FVQA 1KNAA 1HR0L 4QCLA 1Y1VB 3J81j 1TWHH 3GTGB 4I65A 3PIP3 3T51B 4DGZA 3HG9A 2WKCA 5JEAG 3FKIG 4AYBB 3T1HL 1IKMA 3VR5A 1DOKA 1QNKA 3MHBA 4X3SA 3V96A 1LV9A 3RMHA 3DMUA 1O80A 4FF2A 3ULJA 4DKAC 1UE7A 3BDOA 4CGYB 2GN5A 2L55A 2VL6A 4HIKA 3PCOB 4A3MG 2UU9Q 2AQ3B 5IODA 1EEID 1V8QA 3ULLA 5K5PA 2WB1E 4LUOA 4Y52H 4DR6L 1EIGA 3RZDB 4HCSA 2R92G 2NVYB 3IFTA 4X65L 1LTSD 2M2LA 1SE4A 4RCOA 2E74C 2ZJQA 2RKSA 4KJNA 4KD4A 1WFQA 4A76A 3LWEA 1KAAA 1HHVA 5FOBB 3SK8A 1PFMA 1PV4A 2QEXA 5JVH3 3GTOB 2JEBI 1OXVA 5C4XB 1LTBD 1YNND 3EBEA 4PZ8A 2BDOA 2B2WC 3SVMA 3BS1A 5DEHA 1KNEA 1A6XA 2PQAA 2YU9H 2A68C 1A2TA 4A3GG 5JAVA 3O13A 2KVMA 2QDLA 4KI0A 3S1QH 3K7AH 1PTOH 4TSSA 3SGIA 1ILPA 1P16A 1EY8A 1GUSA 1Q8IA 5M3MH 2ENBA 2JJQA 1E22A 2ZTCA
chains in the Genus database with same CATH topology
2KHSA 2NWGA 5G3LD 4R9WA 1TIID 3J80E 2MPMA 2H1EA 2HQEA 1II3A 5ELFA 1BUVT 1NCVA 4RGMA 1WTPA 1PZKD 1EZ6A 1ENAA 1EY6A 4KD3A 3TP8A 3HKZB 2K1BA 1EIHA 1WCMB 2F0WA 4ZUJA 2NBFA 1DCZA 2EYJA 1RCVD 4IFDJ 1IYUA 3M7NA 2QEJC 2F0QA 1E2VA 2F0GA 1RHPA 4C3JG 1F2MA 2EY2A 3SE0A 5C0XH 2F0PA 4PNYA 3NTIA 1BBXC 1HQMC 3PO3B 4QMGA 1MBYA 4LAAA 1STGA 3P75A 2B2VA 2E2IB 3T56B 1D5ZC 4L63B 4FF1A 2ICEC 4FYDA 1SJED 3EJIA 4XQNA 1EY4A 5NUCA 1X3PA 2F0EA 5C3EB 5C44B 2DY7A 4H7BA 2EOTA 3PIO3 3EROA 3I3CA 1D2BA 4DF7A 4FP5D 3H0GB 3J7AV 5K36H 4ZK9B 2NUCA 1CT1D 4B9WA 2BA1A 1ET9A 2K6AA 2J4XA 3GQBA 3NBHA 1SFOB 2JA6B 1NSNS 1CHQD 4OHJA 3RUZA 1MSHA 4E6IA 1BCPC 1EWHA 1AP0A 2HDMA 5KNCA 3I4NB 2EYFA 4BWGB 1BR9A 3P1HA 4WRDA 1DXMA 3L3OC 3ERQA 1JR0D 1SYFA 2B2VC 4HR7B 5G3LF 2JE6I 1ZXTA 2PZTA 2DY8A 5ELBA 2D5DA 2WACA 1FYCA 4RWSC 3EQLC 2D9UA 1SE3A 1JICA 1SMYC 2SOBA 3C3LA 3X3NA 1SNQA 2OF1A 1F2YA 2LKVA 3OHXC 1VMPA 4QUCA 3A56A 2XNAC 3HOXB 5IGBA 1O7LA 2EDGA 2A74C 2EJMA 4QF4A 1CTMA 2EZVA 4KKTA 1WTXA 3HP3A 3V05A 1VDZA 4XXEA 1KLUD 3QWNA 1LTTD 2FJ2A 1CM9A 4RGOS 3ITPA 3MTSA 1SXTA 2B2TC 2F0OA 1AZQA 3KK7A 3NK9A 2AUJD 2E2JB 1JQYD 1RDPD 4QIWB 1K8MA 1H9SA 3E0JA 1V1PB 3I70A 4CJ1B 2ICIA 2B8GA 3CQZB 3MWYW 4EQOA 3D4DA 2R6GA 3K57A 1H9KA 1LABA 4WJWA 3RLFA 1I6VC 2BE5D 2NVQB 2I07B 2QF7A 5A2QL 4ID6A 2YU9B 1K8OA 5KEEA 1NR2A 1IW7C 5FK9C 1TT2A 2NN6H 2O5IC 1RF2D 1SE2A 1PTOB 3SEBA 2KUMA 1LTRD 1EYAA 2XRSD 4IUNA 3KBXA 5EPKA 3VA5A 5J22A 2MHVA 1PRTF 2PMZB 4CJ0B 3QJYA 1IHZA 3VYSA 3H94A 3MVVA 5M5WB 4CKCA 4S3SA 3TZDA 2ZXPA 1GUNA 2NN6I 2EXZA 3J7AF 1PZID 2RVLA 3NHHA 1GJXA 2MJ8A 1XXGA 5DM73 1JWMD 4XQQA 2G9HD 1A3TA 2E2DC 2Z8LA 2J7ZA 4BBSB 1QE6A 3I91A 1FR3A 2PYKA 2H4OA 3V2TA 5M9OA 2K28A 5F2DA 4ZYSA 2F0JA 1AEXA 2RSNA 1W6JA 2JEAI 3HGBA 3FKIB 4GZYC 4K2KA 3NTHA 4IURA 1YNNC 2X6LA 3IAYA 2KEEA 4TKOB 4K14A 3OPOA 4KHZA 1WTVA 2RA4A 2AQ2B 1VF5C 1Q90A 3TSSA 4ZAIA 3K5NA 4IZ8A 4F7XA 2RSOA 2O5JC 1U9RA 3LNNA 2F0DA 4BA1I 2Q8RE 1YNJC 1G8ZD 3FRPB 2IX3A 1F2ZA 4F8MA 5ELDA 5C4JB 3E6ZX 1I4RA 4A3GB 1TWAB 3DHQA 1PZJD 3R2TA 5CV9A 1JWSD 1CZWA 4X3KA 3JAME 1JC7A 1EEFD 2J0TD 3U9OA 3H6MA 5CORA 4YIJA 4V0BA 3HRZC 2FMMA 5E1FA 4OO1H 3AMUA 5D3DA 3K0YA 4IN3A 1TS3A 2PPBC 4M1UB 1J9OA 2CHBD 2NVXB 3A7AB 1DD2A 2L4NA 3BZDB 3G6JB 1HFNA 4EQPA 4KMUC 4C3HB 4NKLA 2C9OA 3M3YB 2PZUA 3OMGA 2A5HA 3AB9A 4PMWA 1FGBD 3NE5B 3T13A 3NWTA 5EPLA 1LTID 4K5VA 1DYQA 1QILA 1U4RA 2LY7A 1DM0B 3E5SA 2EY5A 3EFXD 5C0XJ 4QB4A 2JA5B 5A35A 3EA6A 1HFGA 4HEDA 4ABNA 2XSCA 1GUOA 3DWAA 1LTGD 2LFNA 4ZKCB 1PMRA 4Q5VA 3SK5A 1F9QA 3NSWA 1DOMA 3I90A 3C46A 5I6YA 3OSOA 3DWQA 1ICWA 3GV3A 3SK4A 1Q1BA 3BVZA 1F9RA 3J80L 2SNSA 4FVMA 2F4IA 2BDNA 2KOLA 4NDXA 5JVG3 1KDCA 1PRTC 3PUWA 5E3FA 4LJZC 2F3VA 3QIAA 3LX0A 3HOVB 1PXUA 1QCBD 2CW0C 1EZ8A 3HS0C 4C3IG 1HCZA 5IGCA 2N88A 3LWUA 3GTQB 3FEWX 5FO8B 2AQ1B 5AFWA 4A93B 2L0CA 2F0VA 1SJHD 4KKSA 1PTOD 1TR5A 5KIXA 2XIWA 1OO9B 1JCKB 2XVSA 1PDQA 4XQJA 1KABA 1E2WA 1SYEA 4FXKC 2JA7B 3S1RB 5BN4A 5D3IB 2WP8J 4DK0A 3HZXA 3OMCA 1B3AA 2M9VA 2ID0A 5I9PA 4Z9CB 2NB0A 4J8QA 2A69D 1EY9A 3K5MA 4OGQC 5CV6A 3GP7A 1QWYA 1I4PA 3K5LA 3DXJC 4R8IA 1QJOA 2Y0SB 1STEA 1C8CA 1TVXA 2OXPA 1S5BD 2JA8B 2F0LA 1BCPB 3U9SA 5COYA 4RH6A 5IGEA 1LACA 5T1GA 4KN4C 3MFGA 2LS01 1F9PA 4ME5A 2K7VA 1KDAA 1VMCA 1I6HB 3MXGA 5JEAH 2EJGC 5CR3A 2CQAA 2E76C 4IFDG 2BE5C 1F9SA 5CV5A 3GTPB 4KV6A 1EOTA 3VR2A 4K6DA 2I46A 2KCNA 2NVTB 2K01A 1SAPA 4KY6A 3TBIB 1D5XC 4J6HA 4ZQ3A 2JP1A 1MSGA 2KA7A 3VYTA 1LT4D 5C6AA 1NAPA 1STHA 4ZUIA 3BYYB 1GOZA 2PZWA 5C0XI 2B39A 3I73A 1CQVA 5E4XA 1EY0A 3GTJB 4RKBA 1CQFA 1CZGA 1A3VA 1KDBA 1S5ED 4EVOA 4HMIA 4HSPA 4HSVA 3BYTB 4CHTB 2L12A 4N9PA 1B53A 3TP5A 5HGTA 2F0UA 4DXFA 1D6EC 2WV6D 2B2TA 5CBAE 1A15A 3T16A 1PTOF 2NN6G 1S5CD 1CA6A 3PV0A 1EWCA 1SDFA 5JPNC 3P20A 4IUTA 4QUFA 4DA2A 1RD9D 3NTKA 2EYHA 2RQXA 2X69A 4UAIA 2A6HC 4K8JA 4ODGA 4FF3A 2EY1A 4H0LC 1EU3A 1TWFB 2BOSA 1SBBB 1C4QA 2A68D 1QOHA 4X3UA 2R3ZA 1UAPA 2B8FA 1GUGA 3HEJA 1JB3A 1H9MA 5IT9L 3BDCA 4HN7A 4XIGS 3ZYYX 2KCCA 2CVRA 5CBEE 2EYPA 4DFAA 2QCPX 2GA4B 2BA0A 3X3MA 4A3FB 2K5QA 5FO9B 4K8IA 1STYA 3I4LA 3OIQA 3TZUA 1RKNA 1I4XA 5C5MA 4ZRZA 5ISRA 1LTAD 4RA8A 1H9SB 4OIKA 3GD7A 4ILWA 1DOLA 2OEOA 3J7YW 3D8GA 2SDFA 2V4DA 1I4HA 3KF8A 3PUZA 5I4DA 2VUMB 1OXSC 5T1IA 5IT9E 4XYQA 4BY1B 4RAUC 3FMCA 2IT1A 4MN3A 3HOUB 1Y8NB 4H44C 1STAA 3KBGA 4RKLA 4DN4M 1SEBD 2TMPA 3L7ZC 1LT6D 2DN8A 1D1IA 4DNTB 4C1NI 5FLXE 1MD2D 4G57A 2LMCB 3ND9A 3AU7A 5D65A 1MI2A 1H9JA 4TRDA 4FF4A 3HOWB 1NUCA 3S2DB 4NP5A 4U68A 4IUVA 3NQTA 1E0BA 1TQOA 2Q8IB 3MC0B 3KLSA 1B2TA 3M4YA 2K5WA 3CKIB 4U673 2KECA 3F2UA 3OWEB 3S17B 1TY2A 2EYOA 1ESRA 1JE4A 4X3TA 5EJWA 1EU4A 3S15B 1Q12A 1HTLD 4RGNA 3BG3A 1VF7A 2R7ZB 1HRJA 5IGGA 4L8JA 1S4ZA 1E2ZA 2A73B 3T4AC 1W6KA 2XWBB 4C1NK 1LT5D 1FNUA 1PFNA 1HXYD 2NTTA 5I2YA 5C3WA 1B44D 4EGVA 2EYLA 1EY5A 1QB5D 3PUYA 3JAML 3DEPA 2ZXOA 5KNDA 1EL0A 4IALA 4A3MB 1CFMA 4CBVA 1LLRD 2R92B 1SNOA 1SMYD 4ULLA 2K04A 3TN2A 3Q22A 2WIIB 3DWPA 4DU9A 5LHY1 3GO5A 3FDTA 4WORA 1BF4A 5JPMC 5FO7B 3L9AX 2K5DA 1ONLA 5I2XA 2WINB 1B1ZA 1HA5A 1I3QB 2IJ0A 3NP8A 4PMBA 1Y69U 2FFKB 2A69C 2R61A 3MXPA 2AWNA 1WTWA 1I4QA 5KNBA 1T5XD 1EQTA 2MUYA 2HUGA 1G6ZA 2XN9C 3Q23A 3Q24A 1ENCA 1B4OA 4RGTA 1PRTB 1SNCA 1UUPA 4DK1A 3H91A 2B2UC 5C4HA 3K58A 1ILQA 1MGSA 1DJRD 2MP1A 1BO0A 2Z4HA 4BA2I 4V190 3W3AA 3GV6A 3GTLB 3H3VC 1KTKA 1EYDA 3BVMA 5TSSA 1FD7D 1DONA 2EPBA 4OO1I 5C3XA 4G7OC 1IW7D 3KLSX 5IOCA 3S1MB 5M5YB 2F0KA 5DNFA 3T53B 2EJFC 3A7LA 2L11A 2ZT9C 5JEAJ 4C3JB 1I4GA 3FPUB 3IFDA 3D3RA 2JSOA 3W2DA 3J81E 3D6WA 4A3KB 4EQNA 4CKBA 1B9MA 4H13C 3WDNA 3S2HB 1SYCA 4ZLTF 1KLGD 4IQZA 2QILA 4NMZA 2K32A 2X6GA 1CHPD 5C0XG 4K5XA 3URYA 1Y8PB 2VB3X 5JOBA 2O2LD 2Z4IA 3NWSA 5EKKA 1WTRA 4K6LA 4OL7A 5FKAC 2EVBA 1G2TA 2XWJB 1GUTA 2K05A 1U4MA 2HCCA 4CKEA 3CRLC 5ELCA 3VYUA 2QKIC 3Q0AA 4A3IB 4RCNA 1CA5A 4O1NA 2C5CA 1JWUD 5EPJA 3R2IA 3OW7A 2SEBD 4DAPA 4G7HC 2A6ED 1Q1EA 1EQVA 5K36G 4IUQA 1H9RA 1GHJA 3C2PA 1JOKA 3BVGA 5JJZA 5J1ZA 4KTAA 2WKDA 1WVLA 3GTKB 5EBDA 1RJTA 3R93A 2PQEA 4IUPA 4B08A 3SHLA 3EVQA 1WD1A 1SNPA 2Z1CA 4A3DB 3QOJA 3I72A 1G291 1YNJD 3S14B 1TS5A 1I50B 5LL6S 1BXTA 1L0XB 1PLFA 3MXNA 3K59A 3GTMB 1B9NA 1X3QA 4HTHA 1OXXK 1CI3M 2IW3A 4MHEA 2VB2X 3M85A 4C3HG 2NYZD 2D2CC 5EKLA 1GXDC 1D5MC 2N55A 1GHKA 1HTPA 4RHRA 2L5TA 3M4OB 4PMCA 2EY6A 2F03A 1ENFA 1TY0A 5M5XB 4XTCS 1IYVA 3KLRA 5CV7A 4RFBA 1ZYRD 3S1NB 2B2YA 3OOCA 1OXTA 4HCEA 2F1MA 1UEAB 1TU2B 2JYOA 1R4QB 2VNUD 1JORA 1U4PA 2YYZA 1LO5D 2RDGA 3M7GA 4FNFA 4N9TA 2PO4A 1SYBA 3OWFA 3H09A 4KY7A 2F0NA 3VR3A 3NPPA 5KYIA 3Q6SA 3MAQA 4TQUS 1F77A 4PQXA 4O42A 3SXHA 4XT3B 4PV1C 1Z47A 3RZOB 1Z7TA 1EFID 1STBA 3ND8A 4LMQD 2D62A 4C2MB 2SNMA 1BQQT 4I7ZC 5CGKA 1HUMA 5EQ0A 1M4VA 3D4RA 1XX8A 1WTQA 1BOSA 3IKJA 4R8NA 4KY5A 4KKUA 1FNVA 4FO2A 1Y1WB 1L0YB 1PRTD 2B2YC 3RD4A 1T5EA 2AUKA 1SNMA 2F0TA 1V1OA 2RDFA 1M8AA 3CU7A 2CW0D 1STNA 5IIFA 3QG1A 3I4MB 3MZ5A 2K33A 1TS4A 4L6TB 2KEDA 1BDOA 2E2HB 3ONAB 2DNEA 4JBWA 5CV4A 3SR1A 5HURA 1X32A 1EY7A 3UI2A 5M3FB 2O4XA 1HUNA 4WFN3 3R8BA 1JOOA 1O7YA 4Q0FA 3SK6A 1OXUA 5KYLA 3NUCA 1G91A 5DAUA 2F0SA 4IFDH 2PNRC 2TSSA 2Q8TA 5FLXL 3TDQA 3CHBD 1ZKOA 1TWHB 3DEOA 4K5WA 3P7JA 3N52A 3IL8A 5EKIA 5CV8A 3KUPA 5BN3A 3K5OA 5BN5A 1RTOA 2F0MA 2L9HA 5D14A 3NQIA 4F87A 1VCIA 1JOQA 2ZXRA 3A8JE 4XYOA 4BBRB 2L1BA 2RBMA 1XWEA 1B50A 2EE1A 1F2LA 4IFDI 3DM1A 1V43A 1AW7A 1IKLA 1SSOA 1V1PA 3QOLA 4KHVA 2E75C 2IL8A 2FMCA 3I8ZA 3A8IE 1Y8OB 5C4ZA 4KJOA 3C1EA 2K03A 1ESFA 4XDXA 2XRQD 1DZ1A 1ZEQX 5EBCA 3S1QB 3K7AB 1PYWD 4KK7A 3K6OA 4LK1C 3A55A 1AN8A 3MA2B 5M3MB 3PMFA 3TMEA 4OO1G 1CK1A 4F88A 3S16B 2WAQB 3SDZA 4K2LA 3A8KE 4G7ZC 1K83B 3N6RA 2F0FA 4XT1B 2JXMB 1HA6A 2RDHA 3A54A 5IGFA 4A3EB 1WD0A 3R3OA 4P2CB 3C1FA 1D1KA 4Y7NB 2NTSA 1AZPA 1O78A 1IL8A 5E4WC 3QB3A 2AWOA 1WTOA 1LT3D 1BCPD 1QG7A 5CYUA 3VYRA 1G2SA 3PUVA 4A3JB 3FPPA 5KRUA 5A2QE 3PO2B 3OIPA 2FHTA 1QNUA 3NBIA 1XYIA 4C56C 1AFPA 5C5LA 5EGTA 2NZ1D 3HOZB 2QDBA 1TKWB 2B2UA 1NR4A 2PCFB 1ET6A 4DNRB 1SNDA 4IUUA 4BS9A 1RODA 2A6HD 2VXWA 4JK1C 3WOEA 1PTOC 2A6EC 4B9XA 3NXWA 2G9DA 2IPKD 5LL6X 1TS2A 4C3IB 3D6CA 2FINB 4NW2A 2IWHA 2KJXA 1O7ZA 1BNZA 3D31A 5I9OA 4CJ2C 5I6WA 4DAVA 3VA7A 2OT2A 4HMJA 1RTNA 3HOYB 3D4WA 2KQ3A 4DAYA 1S5DD 1XTCD 2F3WA 1TWGB 3TP7A 2BCOA 2HCIA 3WOFA 1FNWA 3S9WA 4BY7B 1Q3LA 1Z6HA 1TWCB 1HPCA 1PFBA 2PW7A 3J81L 4ZKBB 4A3BB 5IGDA 4RHSA 4FXGC 5DM63 4OIJA 2EYMA 2PW5A 3MFYA 4DXGA 4HAEA 1SYDA 2HDLA 4G4KA 2WB1B 2R93B 3VR6A 2DNCA 5CMDA 1C48A 1ML0D 3DUZA 4J1MA 1S5FD 1A3UA 3TP6A 1ZYRC 1U4LA 4FXDA 2F0IA 1R4PB 4KN7C 1GUWA 4UDUC 5CC4A 1UNSA 1SYGA 3QO2A 3MXUA 3CRKC 2IX1A 1EYCA 2B2WA 5ELEA 2B63B 2F0HA 2MGSA 1J8IA 2IX0A 1R9TB 5J39A 3MEHA 5KGUA 1A2UA 4MIUA 3VR4A 1BCPF 3BDLA 3G7LA 1HQRD 3PUXA 2M00A 4M8AA 3FVQA 1KNAA 4QCLA 1Y1VB 3GTGB 4I65A 3PIP3 3T51B 4DGZA 3HG9A 2WKCA 5JEAG 4AYBB 1IKMA 3VR5A 1DOKA 1QNKA 3V96A 3MHBA 4X3SA 1LV9A 3RMHA 1O80A 3DMUA 4FF2A 3BDOA 4CGYB 2L55A 2AQ3B 5IODA 1EEID 1V8QA 5K5PA 1EIGA 3RZDB 4HCSA 2NVYB 3IFTA 1LTSD 2M2LA 1SE4A 4RCOA 2E74C 2RKSA 4KJNA 4KD4A 3LWEA 1KAAA 1HHVA 5FOBB 3SK8A 1PFMA 5JVH3 3GTOB 2JEBI 1OXVA 5C4XB 1LTBD 1YNND 2BDOA 2B2WC 3SVMA 3BS1A 5DEHA 1KNEA 1A6XA 2A68C 1A2TA 5JAVA 3O13A 2KVMA 4KI0A 1PTOH 4TSSA 1ILPA 1EY8A 1GUSA 1Q8IA 2ENBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HEJ A;  1NUC A;  3ITP A;  5CV5 A;  1A3T A;  2KHS A;  4KV6 A;  4NP5 A;  4K5X A;  1SNM A;  2F0T A;  5EKL A;  3BDC A;  3ERO A;  3QOL A;  1EYC A;  2RDF A;  3NQT A;  1TQO A;  4KHV A;  4K6D A;  3NP8 A;  2F0H A;  2F0O A;  5JOB A;  4PMB A;  4DF7 A;  4B9X A;  3NK9 A;  5J39 A;  2EYP A;  4KY6 A;  1STN A;  3MEH A;  5EKK A;  5KGU A;  2HQE A;  3NXW A;  1A2U A;  4J6H A;  4ZQ3 A;  5C4Z A;  4MIU A;  4OL7 A;  5IIF A;  3BDL A;  2PYK A;  2EYO A;  2NUC A;  3MZ5 A;  4KJO A;  4B9W A;  4DFA A;  3V2T A;  5C6A A;  4PMC A;  1STH A;  2EY6 A;  3C1E A;  5F2D A;  4ZUI A;  1II3 A;  5M9O A;  3MXP A;  2F0J A;  1AEX A;  2F0V A;  3D6C A;  2M00 A;  1TR5 A;  4EQP A;  5KIX A;  4EQO A;  3D4D A;  2PZW A;  4NKL A;  5CV4 A;  5CV7 A;  2PZU A;  4K8I A;  1STY A;  3OMG A;  1NSN S;  1KAB A;  3RUZ A;  3SR1 A;  5HUR A;  1ENC A;  1RKN A;  1EY7 A;  1EZ6 A;  4E6I A;  1ENA A;  1EY6 A;  5C5M A;  4I65 A;  4KD3 A;  3TP8 A;  1SNC A;  4DGZ A;  5ISR A;  4K2K A;  1SYE A;  1EY0 A;  3T13 A;  5I9O A;  5C4H A;  3PMF A;  5I6W A;  4RKB A;  5IGG A;  2O4X A;  3TME A;  4HMJ A;  2OEO A;  3MHB A;  1A3V A;  3D4W A;  2F0W A;  2EYF A;  1KDB A;  3DMU A;  4K5V A;  4ZUJ A;  4K14 A;  4EVO A;  1JOR A;  3D8G A;  2KQ3 A;  3P1H A;  4HMI A;  1JOO A;  4ID6 A;  4N9T A;  4WRD A;  2EYJ A;  4K2L A;  3SK6 A;  5KEE A;  3E5S A;  2EY5 A;  2F3W A;  3TP7 A;  3HZX A;  2F0F A;  5IOD A;  3ERQ A;  5KYL A;  3OMC A;  1SYF A;  1EQV A;  1SYB A;  3S9W A;  3NUC A;  4IZ8 A;  3OWF A;  4QB4 A;  1TT2 A;  2F0Q A;  1EYD A;  5K5P A;  4F7X A;  5C3W A;  5I9P A;  5IGF A;  2F0G A;  4N9P A;  4KY7 A;  2PZT A;  1EY9 A;  3R3O A;  2F0N A;  5CV6 A;  2PW7 A;  3TP5 A;  2EYL A;  5DAU A;  1EY5 A;  1JOK A;  2WAC A;  2F0U A;  5C3X A;  5HGT A;  2F0S A;  3C1F A;  5J1Z A;  1U9R A;  1F2M A;  2EY2 A;  4KTA A;  5IGD A;  1EYA A;  5KYI A;  2F0D A;  5IOC A;  2RKS A;  4IAL A;  4KJN A;  4IUN A;  3T16 A;  2F0P A;  4PNY A;  2SOB A;  2F0K A;  4K5W A;  4KD4 A;  1SNQ A;  3QB3 A;  2PQE A;  3SK5 A;  3VA5 A;  2OF1 A;  1F2Y A;  3SXH A;  5J22 A;  1KAA A;  2EYM A;  2LKV A;  2PW5 A;  3SK8 A;  2OXP A;  5CV8 A;  3SHL A;  2F0L A;  1F2Z A;  4QMG A;  4F8M A;  3OSO A;  4LAA A;  1STB A;  5I6Y A;  3EVQ A;  5KRU A;  1IHZ A;  1STG A;  1SNO A;  3SK4 A;  1SNP A;  3MVV A;  3P75 A;  1SYD A;  2F0M A;  1STA A;  3QOJ A;  2SNM A;  5CGK A;  5IGE A;  5DEH A;  3DHQ A;  4S3S A;  2SNS A;  4RKL A;  5C5L A;  1JOQ A;  5CV9 A;  1A2T A;  5EGT A;  4NDX A;  4DU9 A;  5IGB A;  1KDC A;  2EYH A;  3EJI A;  2EXZ A;  4J1M A;  4ME5 A;  5E3F A;  5JAV A;  1A3U A;  2RBM A;  1KDA A;  2QDB A;  4K8J A;  3TP6 A;  4ODG A;  3U9O A;  1EY4 A;  2F3V A;  3NHH A;  4WOR A;  3H6M A;  4KY5 A;  4R8N A;  5NUC A;  4EQN A;  4HTH A;  4QF4 A;  3LX0 A;  2EY1 A;  2F0I A;  4G57 A;  1SYC A;  4YIJ A;  2F0E A;  5CR3 A;  5E1F A;  1SND A;  1EY8 A;  5CC4 A;  1EZ8 A;  4NMZ A;  4TRD A;  5IGC A;  1SYG A;  2ENB A;  4H7B A; 
#chains in the Genus database with same CATH topology
 3MXN B;  2KHS A;  2NWG A;  3S16 H;  5G3L D;  4R9W A;  3A0J A;  1X55 A;  1TII D;  1KC8 C;  1K83 H;  3J80 E;  2MPM A;  2H1E A;  2HQE A;  4JI3 L;  2VQF Q;  4WJ3 M;  4A3E H;  1II3 A;  5ELF A;  1BUV T;  1NCV A;  3RLN A;  4RGM A;  1G6P A;  4Y7N H;  4OX9 Q;  1WTP A;  1PZK D;  3F2D A;  3CPF A;  3KFU A;  1B70 B;  1EZ6 A;  1ENA A;  1EY6 A;  4KD3 A;  3TP8 A;  5AJ3 Q;  4JI4 Q;  3HKZ B;  2K1B A;  1EIH A;  1K0S A;  4A3J H;  1WCM B;  2IY5 B;  4DR1 Q;  3PO2 H;  3AEV A;  4HJ5 A;  3H15 A;  2F0W A;  4ZUJ A;  3PSI A;  2NBF A;  1DCZ A;  3CCM A;  1XJV A;  2EYJ A;  1RCV D;  4IFD J;  1IYU A;  1AE2 A;  3M7N A;  4DR5 L;  1X3F A;  3OTO Q;  1HH2 P;  3BU2 A;  2QEJ C;  2F0Q A;  3HOZ H;  1E2V A;  1B8A A;  2F0G A;  4DAM A;  2VY3 A;  4A3C H;  3H3V H;  1RHP A;  4OXP A;  4IPH A;  4C3J G;  1F2M A;  2EY2 A;  3SE0 A;  2Q2I A;  5E7N A;  5C0X H;  4YCU A;  2F0P A;  4PNY A;  3NTI A;  1BBX C;  1HQM C;  1XNR Q;  4A3K G;  3PO3 B;  1HNX Q;  4QMG A;  1MBY A;  4LAA A;  2Z0S A;  1STG A;  4HIO A;  3P75 A;  2B2V A;  2E2I B;  3T56 B;  3Q8D A;  1D5Z C;  4L63 B;  4FF1 A;  2ICE C;  4FYD A;  1SJE D;  3EJI A;  4XQN A;  5FJ8 G;  3J80 c;  1EY4 A;  5NUC A;  1N33 L;  2UUA L;  1X3P A;  1T9H A;  2F0E A;  3H3V I;  1QUQ A;  1VQH A;  5C3E B;  5C44 B;  2DY7 A;  3HOV G;  1OTC A;  4H7B A;  1P8L A;  2UUB L;  1E7Z A;  2EOT A;  5BR8 Q;  3HOY H;  3PIO 3;  3HKZ E;  3ERO A;  3I3C A;  1D2B A;  4DF7 A;  4FP5 D;  1UWV A;  3H0G B;  3J7A V;  4DUY L;  4DR4 L;  5K36 H;  1TWG H;  4A3L G;  1V1Q A;  4A93 G;  5IYC G;  4ZK9 B;  2NUC A;  1CT1 D;  4BY7 H;  4B9W A;  2EIF A;  2AMC B;  2BA1 A;  4POF A;  1TWC H;  1ET9 A;  2K6A A;  2J4X A;  3GQB A;  4A3B H;  3NBH A;  1YJN A;  1SFO B;  2JA6 B;  1NSN S;  1CHQ D;  3FP9 A;  4OHJ A;  3RUZ A;  1MSH A;  4E6I A;  4NXM Q;  1BCP C;  1EWH A;  1AP0 A;  3UDF A;  1U5K A;  2HDM A;  5KNC A;  1YZ6 A;  3I4N B;  2EQS A;  1A8V A;  5HY6 A;  2EYF A;  4BWG B;  1BR9 A;  2JA7 G;  1VQA A;  4QJF A;  3P1H A;  2B3G A;  3CCE A;  4NXN L;  2R93 H;  3KDF B;  4WRD A;  4P75 A;  4LFA L;  1DXM A;  3L3O C;  2NZH A;  3ERQ A;  1JR0 D;  1SYF A;  1VQ8 A;  4MZ9 A;  2BH2 A;  2B2V C;  4HR7 B;  5G3L F;  2JE6 I;  1Q8K A;  1JMC A;  1ZXT A;  2PZT A;  2DY8 A;  5ELB A;  2D5D A;  2CCZ A;  1VQ6 A;  2WAC A;  1FYC A;  4RWS C;  4X64 Q;  3EQL C;  4DUZ Q;  4ALP A;  2D9U A;  2KCM A;  3K80 C;  3CW2 C;  1SE3 A;  2L15 A;  1JIC A;  1SMY C;  2SOB A;  2KBN A;  4YHH L;  1U0L A;  3X3N A;  3C3L A;  2K5V A;  1SNQ A;  2OF1 A;  1F2Y A;  2RHQ B;  2LKV A;  1YI2 A;  2Y0S G;  3OHX C;  1X56 A;  1R9T H;  4R4C A;  4LF5 L;  1VMP A;  1S40 A;  2E5L L;  2HD3 A;  2JA8 G;  4QUC A;  4HJ7 A;  1I94 Q;  3A56 A;  2XNA C;  4LFB Q;  1KQS A;  3I56 A;  3HOX B;  1N34 Q;  5IGB A;  1O7L A;  2EDG A;  4QL5 A;  1Y1V H;  2A74 C;  4ME3 A;  2EJM A;  4QF4 A;  3GTG H;  2JA5 H;  3J7A 5;  1CTM A;  2EZV A;  4KKT A;  1WTX A;  3HP3 A;  3V05 A;  1VDZ A;  1QVF A;  4XXE A;  1KLU D;  3QWN A;  1LTT D;  2FJ2 A;  1CM9 A;  4RGO S;  3ITP A;  4JI5 L;  3MTS A;  1SXT A;  3OW2 A;  4YWM A;  2B2T C;  2F0O A;  1AZQ A;  1C9O A;  3UDX A;  3KK7 A;  3NK9 A;  4LW1 A;  3CCR A;  2AUJ D;  4TVA B;  2E2J B;  1JQY D;  1RDP D;  4QIW B;  1K8M A;  2I0Q A;  1H9S A;  2UXC Q;  3E0J A;  1V1P B;  3I70 A;  4CJ1 B;  1PH1 A;  3RZD H;  2ICI A;  2B8G A;  2NVY H;  3CQZ B;  3I4O A;  3MWY W;  4EQO A;  3D4D A;  2R6G A;  3K57 A;  4JI6 L;  1H9K A;  2CWA A;  1LAB A;  1Y14 B;  4WJW A;  2IHF A;  4LF9 Q;  4ZCK A;  3RLF A;  3GTO H;  1I6V C;  5C4X H;  2BE5 D;  2NVQ B;  4B3M Q;  2I07 B;  2QF7 A;  5A2Q L;  4ID6 A;  5IYB G;  2YU9 B;  1K8O A;  5KEE A;  1NR2 A;  2OWO A;  5GAG C;  1IW7 C;  4GKJ Q;  2N49 A;  2RCF A;  5FK9 C;  1TT2 A;  2NN6 H;  2O5I C;  1RF2 D;  1SE2 A;  1PTO B;  4FDB A;  1D8L A;  4OON A;  3AQQ A;  1NJI C;  3SEB A;  3KOJ A;  1SE8 A;  3QR8 A;  2KUM A;  1LTR D;  1EYA A;  3CC7 A;  2XRS D;  4IUN A;  3KBX A;  2F52 A;  5EPK A;  3VA5 A;  5J22 A;  2MHV A;  1PRT F;  2PMZ B;  4K0K L;  4CJ0 B;  3QJY A;  2UU9 L;  1IHZ A;  1LUZ A;  5HGQ A;  1Y1W G;  1KL9 A;  3H94 A;  1NBW A;  3MVV A;  3VYS A;  5FLM H;  4LUZ A;  5M5W B;  4CKC A;  4S3S A;  3TZD A;  2ZXP A;  2R7F A;  3JAM i;  1GUN A;  3TEH B;  2NN6 I;  2EXZ A;  1E24 A;  3J7A F;  1PZI D;  2RVL A;  3CAM A;  4QIW E;  5LMN W;  3NHH A;  1GJX A;  2MJ8 A;  1XXG A;  3I4M G;  3W1G A;  1K73 C;  5DM7 3;  1BKB A;  1JWM D;  2YV5 A;  1WCM H;  4XQQ A;  2VQE Q;  2G9H D;  4DR2 Q;  1A3T A;  3AFQ A;  2E2D C;  2Z8L A;  2MFI A;  1NE3 A;  2J7Z A;  4BBS B;  5IP9 G;  1QE6 A;  3I91 A;  1FR3 A;  3L2P A;  2PYK A;  2H4O A;  1J5E L;  1KIX A;  3V2T A;  1VQE A;  2K28 A;  5F2D A;  5M9O A;  1K8G A;  4ZYS A;  2F0J A;  1AEX A;  4KLK A;  3G6E A;  2RSN A;  1W6J A;  2MNA A;  4A3F G;  2JEA I;  3UDI A;  3HGB A;  5IWA L;  3RN2 A;  4JI7 L;  2R7D A;  4L5T A;  3ICE A;  3FKI B;  4GZY C;  4K2K A;  5H1S E;  2VZA A;  3NTH A;  3PO3 H;  4LF6 Q;  4YCW A;  4IUR A;  1YNN C;  2X6L A;  3IAY A;  2N78 A;  1N36 Q;  2KEE A;  4TKO B;  4POG A;  4B3R Q;  1YBY A;  2PMZ E;  4K14 A;  2RF4 A;  2WAQ E;  2E2I H;  3OPO A;  1NMF A;  4KHZ A;  5LMU Q;  1CKN B;  1WTV A;  2RA4 A;  2AQ2 B;  1VF5 C;  1Q90 A;  4YY3 Q;  3TSS A;  1IYJ B;  3F8T A;  3PIP A;  4ZAI A;  3K5N A;  4IZ8 A;  4F7X A;  1UE5 A;  2RSO A;  2O5J C;  1XNQ L;  4DAY B;  4UY8 C;  2MO0 A;  4JI4 L;  1U9R A;  5C3E H;  3CCV A;  5C44 H;  3LNN A;  1JT8 A;  2F0D A;  1X6O A;  4B3S Q;  2K14 A;  4BA1 I;  2VUM G;  1VQB A;  2KEN A;  4BBR G;  2Q8R E;  2V1C C;  1YNJ C;  1G8Z D;  3FRP B;  4BY1 G;  2IX3 A;  1F2Z A;  4F8M A;  3H0G H;  5ELD A;  5C4J B;  3E6Z X;  1VQG A;  1I4R A;  4DR3 Q;  2Q2U A;  4A3G B;  1TWA B;  3DHQ A;  1PZJ D;  5IYD H;  3R2T A;  5CV9 A;  1IZ6 A;  1JWS D;  1CZW A;  4DV7 Q;  4X3K A;  3JAM E;  1JC7 A;  1EEF D;  2JA6 H;  2J0T D;  3U9O A;  1SFO H;  3H6M A;  5COR A;  1GD7 A;  4V0B A;  4YIJ A;  3HRZ C;  2FMM A;  5E1F A;  3TRE A;  1Q46 A;  4OO1 H;  3AMU A;  2LSS A;  5D3D A;  3K0Y A;  1HNX L;  4IN3 A;  3I4N H;  2YTV A;  1TS3 A;  1UE6 A;  4B3T Q;  2PPB C;  4M1U B;  3RR5 A;  4J15 A;  1J9O A;  2CHB D;  2NVX B;  3A7A B;  1DD2 A;  2L4N A;  3BZD B;  3E9H A;  3G6J B;  1HFN A;  4EQP A;  4KMU C;  4C3H B;  4NKL A;  2C9O A;  3BZC A;  3M3Y B;  1FGU A;  2PZU A;  1Q82 C;  3OMG A;  1CKO A;  2A5H A;  4L5R C;  3AB9 A;  4PMW A;  1FGB D;  1X54 A;  3KJO A;  1EQR A;  3NE5 B;  3T13 A;  1X9N A;  3NWT A;  4JI1 Q;  1O7I A;  5EPL A;  2XGT A;  1LTI D;  5J3B A;  4K5V A;  1KAW A;  1DYQ A;  1QIL A;  1U4R A;  4PZ7 A;  2LY7 A;  1DM0 B;  1SRO A;  3E5S A;  2EY5 A;  3EFX D;  3HOX H;  4DV6 Q;  1W2B A;  5C0X J;  4QB4 A;  4A3J G;  1XMO Q;  2JA5 B;  5A35 A;  3E0E A;  3EA6 A;  1XPU A;  4LF8 L;  1HFG A;  4HED A;  4ABN A;  2HHH Q;  3F1Z A;  2XSC A;  4OWX B;  1GUO A;  3DWA A;  1LTG D;  2Z6K A;  2LFN A;  4ZKC B;  1PMR A;  4Q5V A;  3CCJ A;  3SK5 A;  3JAM c;  1PYS B;  1F9Q A;  3NSW A;  1DOM A;  3I90 A;  3C46 A;  5I6Y A;  3OSO A;  1VQ7 A;  3UE0 A;  2QW7 A;  4JW0 A;  3DWQ A;  1ICW A;  3GV3 A;  3SK4 A;  2E2J H;  4IPD A;  1Q1B A;  3BVZ A;  1F9R A;  1VQ9 A;  1KRT A;  1N9W A;  3J80 L;  2SNS A;  4FVM A;  1S72 A;  2F4I A;  2BDN A;  2KOL A;  4NDX A;  5JVG 3;  1KDC A;  1PRT C;  3CQZ H;  3PUW A;  4GOP A;  5E3F A;  3FHW A;  4YWL A;  4LJZ C;  2F3V A;  3QIA A;  3LX0 A;  3HOV B;  4OWT B;  1PXU A;  1QCB D;  2CW0 C;  2Q2T A;  1EZ8 A;  4X66 Q;  2PQA B;  3HS0 C;  1HCZ A;  4C3I G;  5IGC A;  2N88 A;  1FL0 A;  5EAY A;  2H5X A;  3LWU A;  2NVQ H;  3GTQ B;  3FEW X;  5FO8 B;  2AQ1 B;  5AFW A;  4A93 B;  1I94 L;  3CMA A;  2L0C A;  1VQ4 A;  1K28 A;  1N34 L;  4LF7 Q;  3I55 A;  2A19 A;  2F0V A;  1QZH A;  1SJH D;  4KKS A;  1PTO D;  1JB7 A;  1TR5 A;  1MIU A;  5KIX A;  1EIF A;  2XIW A;  1OO9 B;  1JCK B;  2XVS A;  1PDQ A;  4XQJ A;  1KAB A;  1E2W A;  1MHW C;  1SYE A;  4FXK C;  4AYB E;  2Z6K C;  2F4V L;  2JA7 B;  1WTH A;  4YCV A;  4DNI A;  3S1R B;  1AH9 A;  4R4O A;  5BN4 A;  5LMN Q;  5D3I B;  5M5W H;  2KCT A;  2WP8 J;  2UXC L;  4DK0 A;  3RNU A;  3HZX A;  1IBK L;  4JI8 L;  3OMC A;  1B3A A;  2M9V A;  2ID0 A;  3CXC A;  5I9P A;  3W5O A;  4Z9C B;  2NB0 A;  4J8Q A;  4IPC A;  1N32 Q;  2A69 D;  1EY9 A;  3K5M A;  4OGQ C;  5CV6 A;  1IBL Q;  3GP7 A;  1WYD A;  1QWY A;  1I4P A;  1IBM Q;  4GOP C;  2R93 G;  3S15 H;  4GN5 A;  3K5L A;  4HIM A;  2KHJ A;  3DXJ C;  4R8I A;  2Y0S B;  1QJO A;  1STE A;  1C8C A;  1TVX A;  2R7Z H;  2OXP A;  1S5B D;  2JA8 B;  2F0L A;  4BBS H;  4GNX A;  4BXX G;  1BCP B;  3U9S A;  5COY A;  2LXK A;  4RH6 A;  5ELN A;  5IGE A;  2ZM6 L;  1HNZ L;  1LAC A;  5T1G A;  4JBJ A;  4KN4 C;  3MFG A;  2LS0 1;  4LF4 Q;  2B63 G;  1F9P A;  4ME5 A;  2K7V A;  1KDA A;  2JK8 A;  1VMC A;  1I6H B;  3MXG A;  1PFS A;  2EJG C;  2I5H A;  5JEA H;  4DV4 L;  3FKI H;  5CR3 A;  2A1A A;  2MQH A;  2CQA A;  2E76 C;  4IFD G;  2BE5 C;  2UUC Q;  1F9S A;  5CV5 A;  4A3M H;  3GTP B;  4KV6 A;  1EOT A;  4IOC A;  2ZTE A;  3VR2 A;  4K6D A;  1PYB A;  3M4P A;  4JI2 Q;  2I46 A;  2KCN A;  2NVT B;  2K01 A;  1SAP A;  4KY6 A;  3TBI B;  1QUQ B;  1D5X C;  4J6H A;  4ZQ3 A;  2JP1 A;  1MSG A;  2R92 H;  2KA7 A;  3VYT A;  4DK6 C;  1LT4 D;  4KHP L;  5C6A A;  1NAP A;  1STH A;  2GVA A;  4UP7 A;  4ZUI A;  3BYY B;  1GOZ A;  1YIJ A;  4JPB W;  2PZW A;  1PVO A;  5C0X I;  2B39 A;  1VQN A;  2EXD A;  3I73 A;  2VQE L;  3K0X A;  1CQV A;  5E4X A;  3VDY A;  3G48 A;  1PH6 A;  1EY0 A;  2RCN A;  3GTJ B;  4JG2 A;  1E3P A;  4DK3 C;  4RKB A;  1YJW A;  4A3I G;  1CQF A;  1CZG A;  5C4J H;  1A3V A;  3KJP A;  1KDB A;  1S5E D;  3NBH B;  4EVO A;  4GKK L;  1NY4 A;  4HMI A;  4A3G H;  1TWA H;  4GNX C;  3PF4 A;  4H02 A;  2D0O A;  4HSP A;  4HSV A;  3BYT B;  4CHT B;  2L12 A;  1SMX A;  2UXB L;  4N9P A;  1B53 A;  5C4X G;  3TP5 A;  5HGT A;  2F0U A;  4DXF A;  1EFW A;  1D6E C;  2WV6 D;  2B2T A;  5CBA E;  4LF6 L;  1A15 A;  3T16 A;  2UXD L;  4DV5 L;  1PTO F;  3STB C;  3CPW A;  1N36 L;  4DV3 L;  2NN6 G;  1S5C D;  1CA6 A;  3PV0 A;  1EWC A;  1SDF A;  1SR3 A;  5JPN C;  2Z6B A;  3P20 A;  4IUT A;  1EOV A;  2NVX H;  1WI5 A;  1XMQ L;  4QUF A;  3T1H Q;  4AQY L;  4DA2 A;  4A3D G;  1RD9 D;  2OQK A;  3NTK A;  1NMG A;  2EYH A;  2RQX A;  4C3H H;  2X69 A;  4UAI A;  2A6H C;  4K8J A;  3M3Y H;  1VQI A;  4ODG A;  3E3X A;  4FF3 A;  2ZJR A;  3IRB A;  2EY1 A;  4H0L C;  1EU3 A;  1TWF B;  2BOS A;  1SBB B;  1C4Q A;  4JYA L;  2A68 D;  1QOH A;  4X3U A;  2R3Z A;  1UAP A;  4CDC C;  4DR6 Q;  2B8F A;  1GUG A;  3HEJ A;  1JB3 A;  1H9M A;  5IT9 L;  3BDC A;  4HN7 A;  4XIG S;  3TQY A;  3ZYY X;  2KCC A;  3T1Y L;  2CVR A;  5CBE E;  2CWP A;  2EYP A;  4PZ6 A;  3HKZ G;  1HNW L;  1SLJ A;  3CC4 A;  4DFA A;  2QCP X;  2GA4 B;  2BA0 A;  3X3M A;  4A3F B;  4C3J H;  1YHA A;  2K5Q A;  5FO9 B;  4K8I A;  3CCU A;  1STY A;  3I4L A;  4JC0 A;  3OIQ A;  3TZU A;  1RKN A;  1I4X A;  3K81 C;  5C5M A;  4ZRZ A;  5ISR A;  2HIV A;  2OTL A;  1PHJ A;  1LTA D;  4RA8 A;  1H9S B;  4OIK A;  3G4S A;  3GD7 A;  2MO1 A;  4ILW A;  1DOL A;  4IOA A;  2OEO A;  3J7Y W;  4DV0 Q;  1M1K C;  3D8G A;  3KF6 A;  2SDF A;  2V4D A;  5FJ8 H;  1I4H A;  1WOC A;  1B3Q A;  2CH4 A;  3KF8 A;  3PUZ A;  2JN4 A;  3HOV H;  1RL2 A;  3L0O A;  1OXS C;  4R1J A;  3S24 A;  5I4D A;  2VUM B;  5T1I A;  1HJP A;  4GLX A;  5IT9 E;  3U58 A;  3ER0 A;  4XYQ A;  5ELO A;  4BY1 B;  1NNX A;  4RAU C;  3FMC A;  4DV1 L;  2I5M X;  3GTQ H;  2IT1 A;  5JJK A;  4MN3 A;  4JVZ A;  4UP9 A;  4A3L H;  1EUJ A;  4A93 H;  5IYC H;  3KLW A;  4NPS A;  3HOU B;  1Y8N B;  4H44 C;  5C44 G;  4DV6 L;  2DUD A;  1STA A;  3KBG A;  4RKL A;  1W3S A;  4DN4 M;  1SEB D;  2TMP A;  3L7Z C;  1LT6 D;  2DN8 A;  4IO9 A;  3MEF A;  1D1I A;  3H0G G;  4DNT B;  4EQ5 A;  2K5N A;  4C1N I;  5FLX E;  1MD2 D;  1YJ9 A;  1VQD A;  4X62 Q;  4G57 A;  2LMC B;  3ND9 A;  3AU7 A;  5D65 A;  1MI2 A;  1H9J A;  4TRD A;  2JQO A;  2JA7 H;  4FF4 A;  1GVP A;  4HJ8 A;  3HOW B;  2ALY B;  1NUC A;  3S1R H;  4R4I A;  3S2D B;  4NP5 A;  4U68 A;  4IUV A;  2GVB A;  2K5H A;  3NQT A;  1E0B A;  1TQO A;  2Q8I B;  3MC0 B;  1MJC A;  4HJA A;  3KLS A;  2Q2H A;  2K50 A;  1B2T A;  3M4Y A;  2K5W A;  3CKI B;  4U67 3;  1FJG Q;  1JJC B;  2KEC A;  3F2U A;  3OWE B;  3S17 B;  1TY2 A;  2EYO A;  1ESR A;  2AHO B;  4DR7 Q;  3I4N G;  1JE4 A;  4X3T A;  2IHE A;  3JC6 6;  5EJW A;  1EU4 A;  3S15 B;  1Q12 A;  1HTL D;  3GDE A;  4RGN A;  3BG3 A;  1VF7 A;  1PH8 A;  3KYH C;  4R4Q A;  2R7Z B;  1HRJ A;  5IGG A;  2JA8 H;  1N33 Q;  3CCQ A;  2UUA Q;  4L8J A;  5M3F G;  1S4Z A;  1YHQ A;  2K75 A;  5IT9 c;  1E2Z A;  2A73 B;  1PA6 A;  3T4A C;  1W6K A;  2D0P A;  2XWB B;  4C1N K;  1LT5 D;  1FNU A;  1PFN A;  1HXY D;  4X6A H;  1BVS A;  2NTT A;  5IP7 G;  5I2Y A;  3NEL A;  4DV2 Q;  5C3W A;  4HJ9 A;  3BZK A;  1I6H H;  1B44 D;  4EGV A;  4DUY Q;  2EYL A;  2P5Z X;  1ICF B;  1EY5 A;  1QB5 D;  3PUY A;  3JAM L;  1V9P A;  3DEP A;  1CUK A;  2ZXO A;  4P72 A;  5KND A;  1EL0 A;  4IAL A;  3HOX G;  4A3M B;  3D0F A;  3GTP H;  1CFM A;  1L1O C;  2VQF L;  5LMN L;  5FLX c;  2NVT H;  4CBV A;  5JJI A;  1LLR D;  4O0A A;  2R92 B;  1SNO A;  1EIY B;  1SMY D;  4ULL A;  4OX9 L;  2K04 A;  3TN2 A;  3Q22 A;  2WII B;  1K3R A;  3PQI A;  3DWP A;  3J81 i;  1IBL L;  4DU9 A;  1NTG A;  5AJ3 L;  1Z9F A;  5LHY 1;  3GO5 A;  3FDT A;  4WOR A;  1K8A C;  2KHI A;  1BF4 A;  2PI2 A;  4DR1 L;  3CME A;  5JPM C;  5FO7 B;  3L9A X;  1K0R A;  2K5D A;  1ONL A;  5I2X A;  2WIN B;  3GTJ H;  1B1Z A;  1HA5 A;  3BJU A;  2VS1 A;  4A75 A;  3OTO L;  1I3Q B;  2IJ0 A;  1JJG A;  3NP8 A;  4PMB A;  4LWC A;  2F3I A;  1Y69 U;  4OWW B;  2FFK B;  1BBU A;  2A69 C;  2R61 A;  2RHS B;  3MXP A;  3A5U A;  2AWN A;  1HZB A;  3PF5 A;  1XNR L;  1WTW A;  1I4Q A;  2E5L Q;  4GLV B;  1T5X D;  5KNB A;  1E1O A;  1EQT A;  2MUY A;  1LTL A;  2HUG A;  1G6Z A;  2XN9 C;  3Q23 A;  3Q24 A;  1ENC A;  3CC2 A;  1KD1 C;  1B4O A;  4RGT A;  1PRT B;  1C7Y A;  1HZA A;  1SNC A;  1UUP A;  4DK1 A;  3H91 A;  2B2U C;  5C4H A;  4JI2 L;  3K58 A;  3CD6 A;  1ILQ A;  1MGS A;  4DPG A;  1DJR D;  5M3M G;  2MP1 A;  1BO0 A;  1JE5 A;  1VQJ A;  2Z4H A;  1HR0 W;  4BA2 I;  4V19 0;  3W3A A;  2CFM A;  3GV6 A;  2WAQ G;  3GTL B;  3H3V C;  1KTK A;  4QGU A;  1XPR A;  1EYD A;  2B29 A;  2C35 B;  3I4M H;  5L37 A;  3BVM A;  5TSS A;  1VQK A;  1FD7 D;  1L2F A;  1DON A;  2EPB A;  4OO1 I;  1TWF H;  5C3X A;  5BR8 L;  4G7O C;  4A3E G;  1IW7 D;  3KLS X;  1LM0 A;  5IOC A;  3S1M B;  5M5Y B;  2F0K A;  5DNF A;  3T53 B;  2K4K A;  5IP9 H;  1B7Y B;  2EJF C;  3A7L A;  4L5S A;  2L11 A;  2ZT9 C;  4JI6 Q;  1PH7 A;  5JEA J;  3PO2 G;  4C3J B;  3K8A A;  1I4G A;  4A3F H;  4NXM L;  3FPU B;  3IFD A;  3D3R A;  2JSO A;  3W2D A;  3J81 E;  3D6W A;  2E8G A;  4A3K B;  3EIV A;  1I5F A;  4EQN A;  4CKB A;  1B9M A;  4H13 C;  1KXL A;  3WDN A;  3HOZ G;  3S2H B;  1SYC A;  3RLO A;  1DGS A;  4ZLT F;  1KLG D;  1JJ2 A;  4IQZ A;  4A3C G;  4WJ4 A;  2QIL A;  4NMZ A;  2K32 A;  2X6G A;  4LFC Q;  4GOP B;  1CHP D;  5C0X G;  4K5X A;  3URY A;  1Y8P B;  2VB3 X;  5JOB A;  4UP8 A;  2O2L D;  2Z4I A;  3NWS A;  2ES2 A;  5EKK A;  1WTR A;  4K6L A;  4OL7 A;  4X64 L;  4DUZ L;  5FKA C;  1SRU A;  2EVB A;  1G2T A;  2XWJ B;  1GUT A;  4K0K Q;  2K05 A;  1U4M A;  2HCC A;  4CKE A;  1QVG A;  1UE1 A;  3CRL C;  2VUM H;  4BBR H;  2G5D A;  5ELC A;  5GQO A;  3VYU A;  4BY1 H;  2QKI C;  4QQB X;  1YVC A;  3Q0A A;  4A3I B;  4RCN A;  1CA5 A;  4LFB L;  4O1N A;  2C5C A;  3CCL A;  1GO3 E;  3HOU H;  1JWU D;  1EWI A;  1J6Q A;  5EPJ A;  3R2I A;  3HOY G;  3OW7 A;  2SEB D;  4DAP A;  4G7H C;  2A6E D;  1Q1E A;  3HKS A;  3PIO A;  1EQV A;  4O2D A;  5K36 G;  4IUQ A;  1H9R A;  1GHJ A;  3C2P A;  4RMF A;  4BY7 G;  1JOK A;  3BVG A;  5JJZ A;  5J1Z A;  4KTA A;  1J5E Q;  2WKD A;  1KRS A;  1WVL A;  3GTK B;  5EBD A;  2OCE A;  1RJT A;  3J81 c;  3R93 A;  3HOW H;  4A3B G;  2PQE A;  4HID A;  3S2D H;  4IUP A;  4DV0 L;  2HT1 A;  4UPA A;  4B08 A;  3SHL A;  5IWA Q;  4JI7 Q;  3EVQ A;  4IJH A;  1WD1 A;  1SNP A;  2Z1C A;  1Q7Y C;  4A3D B;  3QOJ A;  3S17 H;  3B6Y A;  3I72 A;  1G29 1;  2WFW A;  1YNJ D;  4JOI A;  3S14 B;  4JV5 Q;  1TS5 A;  1I50 B;  5LL6 S;  3F2C A;  2WB1 G;  1BXT A;  1L0X B;  1PLF A;  3MXN A;  3K59 A;  4LF9 L;  1BBW A;  3GTM B;  4GNX B;  1B9N A;  1X3Q A;  4HTH A;  3PGZ A;  4B3M L;  1YIT A;  1OXX K;  1CI3 M;  2IW3 A;  4MHE A;  2VB2 X;  3HFZ B;  3M85 A;  1XNQ Q;  3TRZ A;  4C3H G;  2NYZ D;  2D2C C;  3AFP A;  4GKJ L;  5EKL A;  2DGY A;  1GXD C;  1D5M C;  4IJL A;  2N55 A;  1GHK A;  1HTP A;  4RHR A;  5IE8 A;  2L5T A;  3M4O B;  1N8R C;  4PMC A;  2EY6 A;  2F03 A;  4OEL B;  1ENF A;  1TY0 A;  1XTD A;  3DM3 A;  5M5X B;  1A63 A;  4X62 L;  4XTC S;  1QVC A;  4PG3 A;  2BH8 A;  3TS0 A;  1KHI A;  1K9M C;  1IYV A;  3KLR A;  5CV7 A;  4RFB A;  1ZYR D;  3S1N B;  4AIM A;  2B2Y A;  3OOC A;  1C0A A;  1OXT A;  1Y1V G;  4HCE A;  2ASB A;  2NZO A;  3NEN A;  2JA5 G;  4JBM A;  2F1M A;  1UEA B;  3LGJ A;  1TU2 B;  2JYO A;  1FJG L;  1R4Q B;  4AYB G;  2VNU D;  1JOR A;  1U4P A;  2YYZ A;  1LO5 D;  2RDG A;  3M7G A;  4FNF A;  4N9T A;  1VQ5 A;  4DR7 L;  2ZTD A;  2PO4 A;  4JI0 Q;  3UE1 A;  1SYB A;  3OWF A;  4JOI C;  3H09 A;  4KY7 A;  4GLA C;  2F0N A;  4DR2 L;  4C3I H;  3VR3 A;  4MTN A;  2I5L X;  2N3S A;  3NPP A;  5KYI A;  3Q6S A;  2Y0S E;  3MAQ A;  3OYY A;  2N8N A;  4TQU S;  1F77 A;  4PQX A;  4O42 A;  3SXH A;  1I3Q H;  4XT3 B;  4PV1 C;  1Z47 A;  1EYG A;  3RZO B;  3J7Z C;  1SN8 A;  1Z7T A;  1EFI D;  1STB A;  3ND8 A;  4LMQ D;  2D62 A;  2OQ0 A;  4C2M B;  1PH2 A;  1AE3 A;  2SNM A;  1BQQ T;  4I7Z C;  5CGK A;  1HUM A;  5EQ0 A;  4DV2 L;  1M4V A;  3E9I A;  3D4R A;  1XX8 A;  1WTQ A;  1BOS A;  3IKJ A;  4R8N A;  4KY5 A;  4KKU A;  1FNV A;  4UHV A;  4FO2 A;  4B3R L;  2XTI A;  1X3G A;  1Y1W B;  1HR0 Q;  1L0Y B;  1PRT D;  5LMU L;  2VW9 A;  2B2Y C;  3RD4 A;  1GM5 A;  2A8V A;  1T5E A;  3I7F A;  2AUK A;  4YY3 L;  4LF8 Q;  1SNM A;  2F0T A;  1V1O A;  2RDF A;  1M8A A;  1PH3 A;  3CU7 A;  2CW0 D;  3W1B A;  1STN A;  3DLL A;  3CCS A;  5IIF A;  3GTL H;  3QG1 A;  2AKW B;  3I4M B;  3A5Z B;  3MZ5 A;  2K33 A;  1TS4 A;  4B3S L;  4L6T B;  5FLM G;  2KED A;  1BDO A;  2E2H B;  3ONA B;  2DJF C;  2DNE A;  4JBW A;  5CV4 A;  1CKM A;  3SR1 A;  3KDF A;  5HUR A;  3S1M H;  1X32 A;  1EY7 A;  5M5Y H;  3UI2 A;  4X65 Q;  2CH4 W;  1VQF A;  3A74 A;  5M3F B;  4DR3 L;  4BXX H;  4MTK A;  2O4X A;  2YTY A;  1HUN A;  1L0W A;  4WFN 3;  3ERS X;  4DV7 L;  3R8B A;  3U4Z A;  1WCM G;  1JOO A;  1O7Y A;  4Q0F A;  2B63 H;  3SK6 A;  1OXU A;  1PH4 A;  5KYL A;  3NUC A;  2ZJP A;  1G91 A;  3CF5 A;  3ULP A;  2YTX A;  1S3O A;  4A3K H;  5DAU A;  3S2H H;  2F0S A;  4IFD H;  2PNR C;  4B3T L;  3KF6 B;  2TSS A;  2Q8T A;  5FLX L;  3TDQ A;  3CHB D;  1ZKO A;  1TWH B;  3DEO A;  4CDE C;  4K5W A;  3P7J A;  3N52 A;  3IL8 A;  1WJJ A;  1IXR A;  5EKI A;  5CV8 A;  1M90 C;  3KF8 B;  1QZG A;  3KUP A;  5BN3 A;  3K5O A;  5BN5 A;  1RTO A;  3PO3 G;  3ZJY C;  2F0M A;  2L9H A;  5D14 A;  1A62 A;  3NQI A;  4F87 A;  2F4V Q;  1VCI A;  1JOQ A;  2ZXR A;  3A8J E;  4XYO A;  1CSQ A;  4JI3 Q;  4BBR B;  2L1B A;  2RBM A;  4JI1 L;  1XWE A;  1B50 A;  2EE1 A;  4OEM B;  4JI8 Q;  1IBK Q;  1F2L A;  4IFD I;  4A3I H;  3DM1 A;  1V43 A;  1AW7 A;  1IKL A;  1HZ9 A;  4RG1 A;  4APV A;  1SSO A;  5C3E G;  1V1P A;  1YNX A;  3QOL A;  4KHV A;  2E75 C;  2IL8 A;  2FMC A;  3I8Z A;  4JBK A;  1VQO A;  1XMO L;  3A8I E;  5GAD C;  1Y8O B;  5C4Z A;  2HHH L;  1L1O B;  4KJO A;  3C1E A;  1VQL A;  1LYL A;  2K03 A;  4JCV E;  4GN3 B;  1ESF A;  4DR5 Q;  4R4T A;  3I2Z A;  4XDX A;  2XRQ D;  1YHB A;  1L1O A;  1DZ1 A;  5IYD G;  1UEB A;  1ZEQ X;  5EBC A;  3GTK H;  3K7A B;  1PYW D;  4KK7 A;  4LFC L;  2ZM6 Q;  1HNZ Q;  3S1Q B;  3K6O A;  4CDF C;  3CP0 A;  2LXJ A;  2JA6 G;  2HQL A;  4LK1 C;  3A55 A;  1AN8 A;  3MA2 B;  5M3M B;  1MKH A;  2JA9 A;  3PMF A;  3TME A;  4OO1 G;  1CK1 A;  4DV4 Q;  4F88 A;  4A3D H;  3S16 B;  2WAQ B;  3SDZ A;  4K2L A;  3A8K E;  4G7Z C;  3S14 H;  1K83 B;  3N6R A;  1I50 H;  2F0F A;  4XT1 B;  4P74 A;  2JXM B;  1HA6 A;  2RDH A;  3A54 A;  1RIP A;  4X66 L;  5IGF A;  4A3E B;  1WD0 A;  1HZC A;  3GTM H;  3R3O A;  1ASY A;  1EQQ A;  4P2C B;  3C1F A;  1D1K A;  4Y7N B;  2NTS A;  2K52 A;  1YEZ A;  1AZP A;  4KHP Q;  1CSP A;  1O78 A;  1IL8 A;  5E4W C;  2QA4 A;  3NEM A;  3QB3 A;  3G71 A;  2AWO A;  1WTO A;  4LF7 L;  1LT3 D;  4P71 A;  1BCP D;  1QG7 A;  5CYU A;  3VYR A;  5GAH C;  1G2S A;  3PUV A;  5DLQ E;  3U4V A;  4A3J B;  3FPP A;  5KRU A;  5A2Q E;  2UUB Q;  3PO2 B;  3OIP A;  4P73 A;  2FHT A;  4AH6 A;  1E1T A;  1QNU A;  3NBI A;  4LUV A;  4QY7 A;  3STB D;  1XPO A;  1XYI A;  1IL2 A;  3M4O H;  4C56 C;  1AFP A;  1VQP A;  5C5L A;  4DR4 Q;  4CDD C;  5M5X H;  5EGT A;  2QGQ A;  4EX5 A;  2NZ1 D;  1VQC A;  3HOZ B;  4GKK Q;  2QDB A;  1TKW B;  2B2U A;  3AYH B;  1NR4 A;  2PCF B;  4YWK A;  3S1N H;  1ET6 A;  4DNR B;  4N8X 1;  1SND A;  5JJL A;  4IUU A;  4BS9 A;  1ROD A;  4GS3 A;  5IY0 A;  2UXB Q;  3TS2 A;  2HIX A;  2A6H D;  5GAE C;  3U50 C;  2VXW A;  4JK1 C;  3WOE A;  4MNO A;  1N32 L;  1X65 A;  3M4Q A;  1PTO C;  2A6E C;  4B9X A;  4JV5 L;  2UXD Q;  2OTJ A;  4DV5 Q;  1H95 A;  3NXW A;  4DV3 Q;  2G9D A;  2IPK D;  3EN2 A;  1IBM L;  1PH9 A;  4NXN Q;  1X3E A;  5LL6 X;  1TS2 A;  4LFA Q;  4C3I B;  3D6C A;  1VQM A;  2FIN B;  4NB3 A;  4NW2 A;  2Z9H A;  2IWH A;  2KJX A;  1O7Z A;  1XMQ Q;  1BNZ A;  4AQY Q;  1CKN A;  5IYB H;  1FVI A;  3D31 A;  5I9O A;  4CJ2 C;  5I6W A;  4YHH Q;  3VA7 A;  4DAV A;  2OT2 A;  3RZO H;  4HMJ A;  1RTN A;  3HOY B;  3D4W A;  4LF4 L;  4JYA Q;  4C2M H;  2KQ3 A;  4DAY A;  1S5D D;  1XTC D;  4LF5 Q;  2F3W A;  1TWG B;  3TP7 A;  2BCO A;  2HCI A;  1VS0 A;  1FNW A;  3WOF A;  3S9W A;  4GN4 B;  4BY7 B;  1Q3L A;  2FXQ A;  1Z6H A;  1G51 A;  3T1Y Q;  3HOU G;  1D7Q A;  1TWC B;  1K3B C;  2UUC L;  1HPC A;  3F2B A;  1PFB A;  2PW7 A;  4IPG A;  3J81 L;  3WWV A;  4ZKB B;  1HNW Q;  4A3B B;  1Y1W H;  5IGD A;  4RHS A;  3UDG A;  4FXG C;  1MJE A;  5DM6 3;  4OIJ A;  2EYM A;  2PW5 A;  3MFY A;  3K7U C;  5GRO A;  4DXG A;  4JI5 Q;  4JI0 L;  3M9B A;  4HAE A;  1SYD A;  2HDL A;  4G4K A;  1Q81 C;  2WB1 B;  2R93 B;  3VR6 A;  2PI2 E;  2DNC A;  5CMD A;  3HOW G;  1C48 A;  1ML0 D;  2E2H H;  2PNH A;  3DUZ A;  4J1M A;  1S5F D;  1A3U A;  3TP6 A;  4L5Q A;  1ZYR C;  4A4I A;  1U4L A;  4FXD A;  2F0I A;  1R4P B;  4N8F A;  4KN7 C;  1GUW A;  4UDU C;  5M3F H;  5CC4 A;  1PH5 A;  1UNS A;  1SYG A;  3QO2 A;  1GKH A;  4LNQ A;  3MXU A;  1ASZ A;  2CQO A;  3CRK C;  2IX1 A;  1EYC A;  2B2W A;  5ELE A;  2B63 B;  2F0H A;  3J80 i;  5IP7 H;  1Q86 C;  2MGS A;  1J8I A;  2IX0 A;  1TXY A;  1R9T B;  3RN5 A;  2CKZ B;  5J39 A;  1A0I A;  2R7Z G;  3MEH A;  5KGU A;  1A2U A;  4DV1 Q;  2DJG C;  4MIU A;  3VR4 A;  1BCP F;  3BDL A;  3G7L A;  4BBS G;  1HQR D;  3PUX A;  2ATW A;  4I7A A;  2M00 A;  4M8A A;  3FVQ A;  1KNA A;  1HR0 L;  4QCL A;  1Y1V B;  3J81 j;  1TWH H;  3GTG B;  4I65 A;  3PIP 3;  3T51 B;  4DGZ A;  3HG9 A;  2WKC A;  5JEA G;  3FKI G;  4AYB B;  3T1H L;  1IKM A;  3VR5 A;  1DOK A;  1QNK A;  3MHB A;  4X3S A;  3V96 A;  1LV9 A;  3RMH A;  3DMU A;  1O80 A;  4FF2 A;  3ULJ A;  4DKA C;  1UE7 A;  3BDO A;  4CGY B;  2GN5 A;  2L55 A;  2VL6 A;  4HIK A;  3PCO B;  4A3M G;  2UU9 Q;  2AQ3 B;  5IOD A;  1EEI D;  1V8Q A;  3ULL A;  5K5P A;  2WB1 E;  4LUO A;  4Y52 H;  4DR6 L;  1EIG A;  3RZD B;  4HCS A;  2R92 G;  2NVY B;  3IFT A;  4X65 L;  1LTS D;  2M2L A;  1SE4 A;  4RCO A;  2E74 C;  2ZJQ A;  2RKS A;  4KJN A;  4KD4 A;  1WFQ A;  4A76 A;  3LWE A;  1KAA A;  1HHV A;  5FOB B;  3SK8 A;  1PFM A;  1PV4 A;  2QEX A;  5JVH 3;  3GTO B;  2JEB I;  1OXV A;  5C4X B;  1LTB D;  1YNN D;  3EBE A;  4PZ8 A;  2BDO A;  2B2W C;  3SVM A;  3BS1 A;  5DEH A;  1KNE A;  1A6X A;  2PQA A;  2YU9 H;  2A68 C;  1A2T A;  4A3G G;  5JAV A;  3O13 A;  2KVM A;  2QDL A;  4KI0 A;  3S1Q H;  3K7A H;  1PTO H;  4TSS A;  3SGI A;  1ILP A;  1P16 A;  1EY8 A;  1GUS A;  1Q8I A;  5M3M H;  2ENB A;  2JJQ A;  1E22 A;  2ZTC A; 
#chains in the Genus database with same CATH homology
 2KHS A;  2NWG A;  5G3L D;  4R9W A;  1TII D;  3J80 E;  2MPM A;  2H1E A;  2HQE A;  1II3 A;  5ELF A;  1BUV T;  1NCV A;  4RGM A;  1WTP A;  1PZK D;  1EZ6 A;  1ENA A;  1EY6 A;  4KD3 A;  3TP8 A;  3HKZ B;  2K1B A;  1EIH A;  1WCM B;  2F0W A;  4ZUJ A;  2NBF A;  1DCZ A;  2EYJ A;  1RCV D;  4IFD J;  1IYU A;  3M7N A;  2QEJ C;  2F0Q A;  1E2V A;  2F0G A;  1RHP A;  4C3J G;  1F2M A;  2EY2 A;  3SE0 A;  5C0X H;  2F0P A;  4PNY A;  3NTI A;  1BBX C;  1HQM C;  3PO3 B;  4QMG A;  1MBY A;  4LAA A;  1STG A;  3P75 A;  2B2V A;  2E2I B;  3T56 B;  1D5Z C;  4L63 B;  4FF1 A;  2ICE C;  4FYD A;  1SJE D;  3EJI A;  4XQN A;  1EY4 A;  5NUC A;  1X3P A;  2F0E A;  5C3E B;  5C44 B;  2DY7 A;  4H7B A;  2EOT A;  3PIO 3;  3ERO A;  3I3C A;  1D2B A;  4DF7 A;  4FP5 D;  3H0G B;  3J7A V;  5K36 H;  4ZK9 B;  2NUC A;  1CT1 D;  4B9W A;  2BA1 A;  1ET9 A;  2K6A A;  2J4X A;  3GQB A;  3NBH A;  1SFO B;  2JA6 B;  1NSN S;  1CHQ D;  4OHJ A;  3RUZ A;  1MSH A;  4E6I A;  1BCP C;  1EWH A;  1AP0 A;  2HDM A;  5KNC A;  3I4N B;  2EYF A;  4BWG B;  1BR9 A;  3P1H A;  4WRD A;  1DXM A;  3L3O C;  3ERQ A;  1JR0 D;  1SYF A;  2B2V C;  4HR7 B;  5G3L F;  2JE6 I;  1ZXT A;  2PZT A;  2DY8 A;  5ELB A;  2D5D A;  2WAC A;  1FYC A;  4RWS C;  3EQL C;  2D9U A;  1SE3 A;  1JIC A;  1SMY C;  2SOB A;  3C3L A;  3X3N A;  1SNQ A;  2OF1 A;  1F2Y A;  2LKV A;  3OHX C;  1VMP A;  4QUC A;  3A56 A;  2XNA C;  3HOX B;  5IGB A;  1O7L A;  2EDG A;  2A74 C;  2EJM A;  4QF4 A;  1CTM A;  2EZV A;  4KKT A;  1WTX A;  3HP3 A;  3V05 A;  1VDZ A;  4XXE A;  1KLU D;  3QWN A;  1LTT D;  2FJ2 A;  1CM9 A;  4RGO S;  3ITP A;  3MTS A;  1SXT A;  2B2T C;  2F0O A;  1AZQ A;  3KK7 A;  3NK9 A;  2AUJ D;  2E2J B;  1JQY D;  1RDP D;  4QIW B;  1K8M A;  1H9S A;  3E0J A;  1V1P B;  3I70 A;  4CJ1 B;  2ICI A;  2B8G A;  3CQZ B;  3MWY W;  4EQO A;  3D4D A;  2R6G A;  3K57 A;  1H9K A;  1LAB A;  4WJW A;  3RLF A;  1I6V C;  2BE5 D;  2NVQ B;  2I07 B;  2QF7 A;  5A2Q L;  4ID6 A;  2YU9 B;  1K8O A;  5KEE A;  1NR2 A;  1IW7 C;  5FK9 C;  1TT2 A;  2NN6 H;  2O5I C;  1RF2 D;  1SE2 A;  1PTO B;  3SEB A;  2KUM A;  1LTR D;  1EYA A;  2XRS D;  4IUN A;  3KBX A;  5EPK A;  3VA5 A;  5J22 A;  2MHV A;  1PRT F;  2PMZ B;  4CJ0 B;  3QJY A;  1IHZ A;  3VYS A;  3H94 A;  3MVV A;  5M5W B;  4CKC A;  4S3S A;  3TZD A;  2ZXP A;  1GUN A;  2NN6 I;  2EXZ A;  3J7A F;  1PZI D;  2RVL A;  3NHH A;  1GJX A;  2MJ8 A;  1XXG A;  5DM7 3;  1JWM D;  4XQQ A;  2G9H D;  1A3T A;  2E2D C;  2Z8L A;  2J7Z A;  4BBS B;  1QE6 A;  3I91 A;  1FR3 A;  2PYK A;  2H4O A;  3V2T A;  5M9O A;  2K28 A;  5F2D A;  4ZYS A;  2F0J A;  1AEX A;  2RSN A;  1W6J A;  2JEA I;  3HGB A;  3FKI B;  4GZY C;  4K2K A;  3NTH A;  4IUR A;  1YNN C;  2X6L A;  3IAY A;  2KEE A;  4TKO B;  4K14 A;  3OPO A;  4KHZ A;  1WTV A;  2RA4 A;  2AQ2 B;  1VF5 C;  1Q90 A;  3TSS A;  4ZAI A;  3K5N A;  4IZ8 A;  4F7X A;  2RSO A;  2O5J C;  1U9R A;  3LNN A;  2F0D A;  4BA1 I;  2Q8R E;  1YNJ C;  1G8Z D;  3FRP B;  2IX3 A;  1F2Z A;  4F8M A;  5ELD A;  5C4J B;  3E6Z X;  1I4R A;  4A3G B;  1TWA B;  3DHQ A;  1PZJ D;  3R2T A;  5CV9 A;  1JWS D;  1CZW A;  4X3K A;  3JAM E;  1JC7 A;  1EEF D;  2J0T D;  3U9O A;  3H6M A;  5COR A;  4YIJ A;  4V0B A;  3HRZ C;  2FMM A;  5E1F A;  4OO1 H;  3AMU A;  5D3D A;  3K0Y A;  4IN3 A;  1TS3 A;  2PPB C;  4M1U B;  1J9O A;  2CHB D;  2NVX B;  3A7A B;  1DD2 A;  2L4N A;  3BZD B;  3G6J B;  1HFN A;  4EQP A;  4KMU C;  4C3H B;  4NKL A;  2C9O A;  3M3Y B;  2PZU A;  3OMG A;  2A5H A;  3AB9 A;  4PMW A;  1FGB D;  3NE5 B;  3T13 A;  3NWT A;  5EPL A;  1LTI D;  4K5V A;  1DYQ A;  1QIL A;  1U4R A;  2LY7 A;  1DM0 B;  3E5S A;  2EY5 A;  3EFX D;  5C0X J;  4QB4 A;  2JA5 B;  5A35 A;  3EA6 A;  1HFG A;  4HED A;  4ABN A;  2XSC A;  1GUO A;  3DWA A;  1LTG D;  2LFN A;  4ZKC B;  1PMR A;  4Q5V A;  3SK5 A;  1F9Q A;  3NSW A;  1DOM A;  3I90 A;  3C46 A;  5I6Y A;  3OSO A;  3DWQ A;  1ICW A;  3GV3 A;  3SK4 A;  1Q1B A;  3BVZ A;  1F9R A;  3J80 L;  2SNS A;  4FVM A;  2F4I A;  2BDN A;  2KOL A;  4NDX A;  5JVG 3;  1KDC A;  1PRT C;  3PUW A;  5E3F A;  4LJZ C;  2F3V A;  3QIA A;  3LX0 A;  3HOV B;  1PXU A;  1QCB D;  2CW0 C;  1EZ8 A;  3HS0 C;  4C3I G;  1HCZ A;  5IGC A;  2N88 A;  3LWU A;  3GTQ B;  3FEW X;  5FO8 B;  2AQ1 B;  5AFW A;  4A93 B;  2L0C A;  2F0V A;  1SJH D;  4KKS A;  1PTO D;  1TR5 A;  5KIX A;  2XIW A;  1OO9 B;  1JCK B;  2XVS A;  1PDQ A;  4XQJ A;  1KAB A;  1E2W A;  1SYE A;  4FXK C;  2JA7 B;  3S1R B;  5BN4 A;  5D3I B;  2WP8 J;  4DK0 A;  3HZX A;  3OMC A;  1B3A A;  2M9V A;  2ID0 A;  5I9P A;  4Z9C B;  2NB0 A;  4J8Q A;  2A69 D;  1EY9 A;  3K5M A;  4OGQ C;  5CV6 A;  3GP7 A;  1QWY A;  1I4P A;  3K5L A;  3DXJ C;  4R8I A;  1QJO A;  2Y0S B;  1STE A;  1C8C A;  1TVX A;  2OXP A;  1S5B D;  2JA8 B;  2F0L A;  1BCP B;  3U9S A;  5COY A;  4RH6 A;  5IGE A;  1LAC A;  5T1G A;  4KN4 C;  3MFG A;  2LS0 1;  1F9P A;  4ME5 A;  2K7V A;  1KDA A;  1VMC A;  1I6H B;  3MXG A;  5JEA H;  2EJG C;  5CR3 A;  2CQA A;  2E76 C;  4IFD G;  2BE5 C;  1F9S A;  5CV5 A;  3GTP B;  4KV6 A;  1EOT A;  3VR2 A;  4K6D A;  2I46 A;  2KCN A;  2NVT B;  2K01 A;  1SAP A;  4KY6 A;  3TBI B;  1D5X C;  4J6H A;  4ZQ3 A;  2JP1 A;  1MSG A;  2KA7 A;  3VYT A;  1LT4 D;  5C6A A;  1NAP A;  1STH A;  4ZUI A;  3BYY B;  1GOZ A;  2PZW A;  5C0X I;  2B39 A;  3I73 A;  1CQV A;  5E4X A;  1EY0 A;  3GTJ B;  4RKB A;  1CQF A;  1CZG A;  1A3V A;  1KDB A;  1S5E D;  4EVO A;  4HMI A;  4HSP A;  4HSV A;  3BYT B;  4CHT B;  2L12 A;  4N9P A;  1B53 A;  3TP5 A;  5HGT A;  2F0U A;  4DXF A;  1D6E C;  2WV6 D;  2B2T A;  5CBA E;  1A15 A;  3T16 A;  1PTO F;  2NN6 G;  1S5C D;  1CA6 A;  3PV0 A;  1EWC A;  1SDF A;  5JPN C;  3P20 A;  4IUT A;  4QUF A;  4DA2 A;  1RD9 D;  3NTK A;  2EYH A;  2RQX A;  2X69 A;  4UAI A;  2A6H C;  4K8J A;  4ODG A;  4FF3 A;  2EY1 A;  4H0L C;  1EU3 A;  1TWF B;  2BOS A;  1SBB B;  1C4Q A;  2A68 D;  1QOH A;  4X3U A;  2R3Z A;  1UAP A;  2B8F A;  1GUG A;  3HEJ A;  1JB3 A;  1H9M A;  5IT9 L;  3BDC A;  4HN7 A;  4XIG S;  3ZYY X;  2KCC A;  2CVR A;  5CBE E;  2EYP A;  4DFA A;  2QCP X;  2GA4 B;  2BA0 A;  3X3M A;  4A3F B;  2K5Q A;  5FO9 B;  4K8I A;  1STY A;  3I4L A;  3OIQ A;  3TZU A;  1RKN A;  1I4X A;  5C5M A;  4ZRZ A;  5ISR A;  1LTA D;  4RA8 A;  1H9S B;  4OIK A;  3GD7 A;  4ILW A;  1DOL A;  2OEO A;  3J7Y W;  3D8G A;  2SDF A;  2V4D A;  1I4H A;  3KF8 A;  3PUZ A;  5I4D A;  2VUM B;  1OXS C;  5T1I A;  5IT9 E;  4XYQ A;  4BY1 B;  4RAU C;  3FMC A;  2IT1 A;  4MN3 A;  3HOU B;  1Y8N B;  4H44 C;  1STA A;  3KBG A;  4RKL A;  4DN4 M;  1SEB D;  2TMP A;  3L7Z C;  1LT6 D;  2DN8 A;  1D1I A;  4DNT B;  4C1N I;  5FLX E;  1MD2 D;  4G57 A;  2LMC B;  3ND9 A;  3AU7 A;  5D65 A;  1MI2 A;  1H9J A;  4TRD A;  4FF4 A;  3HOW B;  1NUC A;  3S2D B;  4NP5 A;  4U68 A;  4IUV A;  3NQT A;  1E0B A;  1TQO A;  2Q8I B;  3MC0 B;  3KLS A;  1B2T A;  3M4Y A;  2K5W A;  3CKI B;  4U67 3;  2KEC A;  3F2U A;  3OWE B;  3S17 B;  1TY2 A;  2EYO A;  1ESR A;  1JE4 A;  4X3T A;  5EJW A;  1EU4 A;  3S15 B;  1Q12 A;  1HTL D;  4RGN A;  3BG3 A;  1VF7 A;  2R7Z B;  1HRJ A;  5IGG A;  4L8J A;  1S4Z A;  1E2Z A;  2A73 B;  3T4A C;  1W6K A;  2XWB B;  4C1N K;  1LT5 D;  1FNU A;  1PFN A;  1HXY D;  2NTT A;  5I2Y A;  5C3W A;  1B44 D;  4EGV A;  2EYL A;  1EY5 A;  1QB5 D;  3PUY A;  3JAM L;  3DEP A;  2ZXO A;  5KND A;  1EL0 A;  4IAL A;  4A3M B;  1CFM A;  4CBV A;  1LLR D;  2R92 B;  1SNO A;  1SMY D;  4ULL A;  2K04 A;  3TN2 A;  3Q22 A;  2WII B;  3DWP A;  4DU9 A;  5LHY 1;  3GO5 A;  3FDT A;  4WOR A;  1BF4 A;  5JPM C;  5FO7 B;  3L9A X;  2K5D A;  1ONL A;  5I2X A;  2WIN B;  1B1Z A;  1HA5 A;  1I3Q B;  2IJ0 A;  3NP8 A;  4PMB A;  1Y69 U;  2FFK B;  2A69 C;  2R61 A;  3MXP A;  2AWN A;  1WTW A;  1I4Q A;  5KNB A;  1T5X D;  1EQT A;  2MUY A;  2HUG A;  1G6Z A;  2XN9 C;  3Q23 A;  3Q24 A;  1ENC A;  1B4O A;  4RGT A;  1PRT B;  1SNC A;  1UUP A;  4DK1 A;  3H91 A;  2B2U C;  5C4H A;  3K58 A;  1ILQ A;  1MGS A;  1DJR D;  2MP1 A;  1BO0 A;  2Z4H A;  4BA2 I;  4V19 0;  3W3A A;  3GV6 A;  3GTL B;  3H3V C;  1KTK A;  1EYD A;  3BVM A;  5TSS A;  1FD7 D;  1DON A;  2EPB A;  4OO1 I;  5C3X A;  4G7O C;  1IW7 D;  3KLS X;  5IOC A;  3S1M B;  5M5Y B;  2F0K A;  5DNF A;  3T53 B;  2EJF C;  3A7L A;  2L11 A;  2ZT9 C;  5JEA J;  4C3J B;  1I4G A;  3FPU B;  3IFD A;  3D3R A;  2JSO A;  3W2D A;  3J81 E;  3D6W A;  4A3K B;  4EQN A;  4CKB A;  1B9M A;  4H13 C;  3WDN A;  3S2H B;  1SYC A;  4ZLT F;  1KLG D;  4IQZ A;  2QIL A;  4NMZ A;  2K32 A;  2X6G A;  1CHP D;  5C0X G;  4K5X A;  3URY A;  1Y8P B;  2VB3 X;  5JOB A;  2O2L D;  2Z4I A;  3NWS A;  5EKK A;  1WTR A;  4K6L A;  4OL7 A;  5FKA C;  2EVB A;  1G2T A;  2XWJ B;  1GUT A;  2K05 A;  1U4M A;  2HCC A;  4CKE A;  3CRL C;  5ELC A;  3VYU A;  2QKI C;  3Q0A A;  4A3I B;  4RCN A;  1CA5 A;  4O1N A;  2C5C A;  1JWU D;  5EPJ A;  3R2I A;  3OW7 A;  2SEB D;  4DAP A;  4G7H C;  2A6E D;  1Q1E A;  1EQV A;  5K36 G;  4IUQ A;  1H9R A;  1GHJ A;  3C2P A;  1JOK A;  3BVG A;  5JJZ A;  5J1Z A;  4KTA A;  2WKD A;  1WVL A;  3GTK B;  5EBD A;  1RJT A;  3R93 A;  2PQE A;  4IUP A;  4B08 A;  3SHL A;  3EVQ A;  1WD1 A;  1SNP A;  2Z1C A;  4A3D B;  3QOJ A;  3I72 A;  1G29 1;  1YNJ D;  3S14 B;  1TS5 A;  1I50 B;  5LL6 S;  1BXT A;  1L0X B;  1PLF A;  3MXN A;  3K59 A;  3GTM B;  1B9N A;  1X3Q A;  4HTH A;  1OXX K;  1CI3 M;  2IW3 A;  4MHE A;  2VB2 X;  3M85 A;  4C3H G;  2NYZ D;  2D2C C;  5EKL A;  1GXD C;  1D5M C;  2N55 A;  1GHK A;  1HTP A;  4RHR A;  2L5T A;  3M4O B;  4PMC A;  2EY6 A;  2F03 A;  1ENF A;  1TY0 A;  5M5X B;  4XTC S;  1IYV A;  3KLR A;  5CV7 A;  4RFB A;  1ZYR D;  3S1N B;  2B2Y A;  3OOC A;  1OXT A;  4HCE A;  2F1M A;  1UEA B;  1TU2 B;  2JYO A;  1R4Q B;  2VNU D;  1JOR A;  1U4P A;  2YYZ A;  1LO5 D;  2RDG A;  3M7G A;  4FNF A;  4N9T A;  2PO4 A;  1SYB A;  3OWF A;  3H09 A;  4KY7 A;  2F0N A;  3VR3 A;  3NPP A;  5KYI A;  3Q6S A;  3MAQ A;  4TQU S;  1F77 A;  4PQX A;  4O42 A;  3SXH A;  4XT3 B;  4PV1 C;  1Z47 A;  3RZO B;  1Z7T A;  1EFI D;  1STB A;  3ND8 A;  4LMQ D;  2D62 A;  4C2M B;  2SNM A;  1BQQ T;  4I7Z C;  5CGK A;  1HUM A;  5EQ0 A;  1M4V A;  3D4R A;  1XX8 A;  1WTQ A;  1BOS A;  3IKJ A;  4R8N A;  4KY5 A;  4KKU A;  1FNV A;  4FO2 A;  1Y1W B;  1L0Y B;  1PRT D;  2B2Y C;  3RD4 A;  1T5E A;  2AUK A;  1SNM A;  2F0T A;  1V1O A;  2RDF A;  1M8A A;  3CU7 A;  2CW0 D;  1STN A;  5IIF A;  3QG1 A;  3I4M B;  3MZ5 A;  2K33 A;  1TS4 A;  4L6T B;  2KED A;  1BDO A;  2E2H B;  3ONA B;  2DNE A;  4JBW A;  5CV4 A;  3SR1 A;  5HUR A;  1X32 A;  1EY7 A;  3UI2 A;  5M3F B;  2O4X A;  1HUN A;  4WFN 3;  3R8B A;  1JOO A;  1O7Y A;  4Q0F A;  3SK6 A;  1OXU A;  5KYL A;  3NUC A;  1G91 A;  5DAU A;  2F0S A;  4IFD H;  2PNR C;  2TSS A;  2Q8T A;  5FLX L;  3TDQ A;  3CHB D;  1ZKO A;  1TWH B;  3DEO A;  4K5W A;  3P7J A;  3N52 A;  3IL8 A;  5EKI A;  5CV8 A;  3KUP A;  5BN3 A;  3K5O A;  5BN5 A;  1RTO A;  2F0M A;  2L9H A;  5D14 A;  3NQI A;  4F87 A;  1VCI A;  1JOQ A;  2ZXR A;  3A8J E;  4XYO A;  4BBR B;  2L1B A;  2RBM A;  1XWE A;  1B50 A;  2EE1 A;  1F2L A;  4IFD I;  3DM1 A;  1V43 A;  1AW7 A;  1IKL A;  1SSO A;  1V1P A;  3QOL A;  4KHV A;  2E75 C;  2IL8 A;  2FMC A;  3I8Z A;  3A8I E;  1Y8O B;  5C4Z A;  4KJO A;  3C1E A;  2K03 A;  1ESF A;  4XDX A;  2XRQ D;  1DZ1 A;  1ZEQ X;  5EBC A;  3S1Q B;  3K7A B;  1PYW D;  4KK7 A;  3K6O A;  4LK1 C;  3A55 A;  1AN8 A;  3MA2 B;  5M3M B;  3PMF A;  3TME A;  4OO1 G;  1CK1 A;  4F88 A;  3S16 B;  2WAQ B;  3SDZ A;  4K2L A;  3A8K E;  4G7Z C;  1K83 B;  3N6R A;  2F0F A;  4XT1 B;  2JXM B;  1HA6 A;  2RDH A;  3A54 A;  5IGF A;  4A3E B;  1WD0 A;  3R3O A;  4P2C B;  3C1F A;  1D1K A;  4Y7N B;  2NTS A;  1AZP A;  1O78 A;  1IL8 A;  5E4W C;  3QB3 A;  2AWO A;  1WTO A;  1LT3 D;  1BCP D;  1QG7 A;  5CYU A;  3VYR A;  1G2S A;  3PUV A;  4A3J B;  3FPP A;  5KRU A;  5A2Q E;  3PO2 B;  3OIP A;  2FHT A;  1QNU A;  3NBI A;  1XYI A;  4C56 C;  1AFP A;  5C5L A;  5EGT A;  2NZ1 D;  3HOZ B;  2QDB A;  1TKW B;  2B2U A;  1NR4 A;  2PCF B;  1ET6 A;  4DNR B;  1SND A;  4IUU A;  4BS9 A;  1ROD A;  2A6H D;  2VXW A;  4JK1 C;  3WOE A;  1PTO C;  2A6E C;  4B9X A;  3NXW A;  2G9D A;  2IPK D;  5LL6 X;  1TS2 A;  4C3I B;  3D6C A;  2FIN B;  4NW2 A;  2IWH A;  2KJX A;  1O7Z A;  1BNZ A;  3D31 A;  5I9O A;  4CJ2 C;  5I6W A;  4DAV A;  3VA7 A;  2OT2 A;  4HMJ A;  1RTN A;  3HOY B;  3D4W A;  2KQ3 A;  4DAY A;  1S5D D;  1XTC D;  2F3W A;  1TWG B;  3TP7 A;  2BCO A;  2HCI A;  3WOF A;  1FNW A;  3S9W A;  4BY7 B;  1Q3L A;  1Z6H A;  1TWC B;  1HPC A;  1PFB A;  2PW7 A;  3J81 L;  4ZKB B;  4A3B B;  5IGD A;  4RHS A;  4FXG C;  5DM6 3;  4OIJ A;  2EYM A;  2PW5 A;  3MFY A;  4DXG A;  4HAE A;  1SYD A;  2HDL A;  4G4K A;  2WB1 B;  2R93 B;  3VR6 A;  2DNC A;  5CMD A;  1C48 A;  1ML0 D;  3DUZ A;  4J1M A;  1S5F D;  1A3U A;  3TP6 A;  1ZYR C;  1U4L A;  4FXD A;  2F0I A;  1R4P B;  4KN7 C;  1GUW A;  4UDU C;  5CC4 A;  1UNS A;  1SYG A;  3QO2 A;  3MXU A;  3CRK C;  2IX1 A;  1EYC A;  2B2W A;  5ELE A;  2B63 B;  2F0H A;  2MGS A;  1J8I A;  2IX0 A;  1R9T B;  5J39 A;  3MEH A;  5KGU A;  1A2U A;  4MIU A;  3VR4 A;  1BCP F;  3BDL A;  3G7L A;  1HQR D;  3PUX A;  2M00 A;  4M8A A;  3FVQ A;  1KNA A;  4QCL A;  1Y1V B;  3GTG B;  4I65 A;  3PIP 3;  3T51 B;  4DGZ A;  3HG9 A;  2WKC A;  5JEA G;  4AYB B;  1IKM A;  3VR5 A;  1DOK A;  1QNK A;  3V96 A;  3MHB A;  4X3S A;  1LV9 A;  3RMH A;  1O80 A;  3DMU A;  4FF2 A;  3BDO A;  4CGY B;  2L55 A;  2AQ3 B;  5IOD A;  1EEI D;  1V8Q A;  5K5P A;  1EIG A;  3RZD B;  4HCS A;  2NVY B;  3IFT A;  1LTS D;  2M2L A;  1SE4 A;  4RCO A;  2E74 C;  2RKS A;  4KJN A;  4KD4 A;  3LWE A;  1KAA A;  1HHV A;  5FOB B;  3SK8 A;  1PFM A;  5JVH 3;  3GTO B;  2JEB I;  1OXV A;  5C4X B;  1LTB D;  1YNN D;  2BDO A;  2B2W C;  3SVM A;  3BS1 A;  5DEH A;  1KNE A;  1A6X A;  2A68 C;  1A2T A;  5JAV A;  3O13 A;  2KVM A;  4KI0 A;  1PTO H;  4TSS A;  1ILP A;  1EY8 A;  1GUS A;  1Q8I A;  2ENB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...