4HTHA

Crystal structure of staphylococcal nuclease variant delta+viagla at cryogenic temperature
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMVFRLLLVDIPEFNEKYGPEAAAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+VIAGLA at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 34
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-11-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4hthA00
5CV7A 4QMGA 3SXHA 4DFAA 1STAA 3NUCA 4RKBA 3ITPA 2F0DA 3S9WA 2PZTA 5CGKA 5KEEA 2EY1A 4KJOA 4EQNA 3U9OA 1EY6A 3ERQA 2F0TA 2O4XA 2F0UA 3NXWA 4DF7A 3QOJA 1U9RA 3BDLA 3D8GA 3P75A 2LKVA 2SOBA 3C1FA 3EVQA 2F0PA 1KDAA 4KY7A 5ISRA 3BDCA 2SNSA 4J6HA 4KY6A 5KGUA 1SYBA 1AEXA 1TR5A 3TMEA 3TP7A 4KD4A 1F2YA 4KV6A 5DEHA 1ENAA 1NUCA 3D6CA 5IGBA 1SNPA 4DGZA 5HURA 2EYOA 2F0WA 4KJNA 1JOKA 4HMIA 4NMZA 5CV8A 5E1FA 5NUCA 3SHLA 5DAUA 5F2DA 2PZUA 3EROA 2OF1A 1II3A 1SNDA 4I65A 4IALA 5KYIA 4ZUIA 2WACA 4K2LA 4YIJA 4N9PA 4KTAA 5M9OA 3SK5A 1KDCA 1EYCA 5IGDA 2NUCA 2KHSA 5C3XA 1SNQA 5CV5A 3SK6A 1EY5A 2F0KA 1EQVA 4K8JA 3P1HA 4EQPA 5I9OA 1JORA 4QF4A 5C4ZA 2M00A 4G57A 4RKLA 3TP8A 2EYHA 2F0MA 4B9WA 1SNCA 1TT2A 2F0GA 1EYAA 3VA5A 1IHZA 1A2UA 5I6WA 3OMGA 2EY5A 4IUNA 5KIXA 1TQOA 4HTHA 3PMFA 3TP6A 3H6MA 3T13A 4EQOA 4EVOA 1EYDA 4IZ8A 1STYA 1STHA 2EYJA 2F0EA 4K5WA 1JOQA 5I6YA 2RDFA 2EY6A 1A3VA 4K2KA 2KQ3A 1SYFA 1SYDA 5JOBA 5IGEA 3OMCA 5JAVA 2F0NA 5CV4A 1F2MA 2F0QA 1SNOA 1ENCA 4NP5A 5KRUA 1A3UA 5CV9A 2PZWA 2F0SA 2F3VA 1A3TA 4H7BA 4TRDA 5CR3A 4LAAA 4ZQ3A 5J39A 1EZ6A 2EY2A 2F0OA 5CC4A 4DU9A 3R3OA 1EZ8A 3DMUA 3E5SA 4K6DA 3NHHA 3SR1A 5C4HA 3MEHA 4K14A 3MZ5A 4ID6A 5C3WA 4WRDA 3QB3A 1EY8A 4OL7A 4PNYA 4PMCA 5IOCA 1KDBA 5J1ZA 1RKNA 3NK9A 5IGFA 2PW7A 2F0LA 4F8MA 5I9PA 2PW5A 3D4DA 3HZXA 4F7XA 3D4WA 4MIUA 3NQTA 4ZUJA 2EYLA 3OSOA 5C5MA 5HGTA 4NDXA 2ENBA 4ME5A 3TP5A 2PYKA 4WORA 4B9XA 1KABA 5K5PA 4PMBA 5J22A 1EY9A 1NSNS 2RKSA 2PQEA 3SK8A 3T16A 2EYMA 4K5XA 1SYGA 1SYEA 5EKLA 3QOLA 4N9TA 3DHQA 4KHVA 2F0IA 3RUZA 5KYLA 4E6IA 4ODGA 1F2ZA 2F0JA 1EY7A 3MHBA 5EKKA 2EYPA 5E3FA 5EGTA 4HMJA 2HQEA 4NKLA 1STBA 3V2TA 3SK4A 2EYFA 4R8NA 5C5LA 1EY0A 4J1MA 5IGGA 1SNMA 2F0HA 2SNMA 2F0FA 1SYCA 3NP8A 1EY4A 4K8IA 2EXZA 4KY5A 4S3SA 1STGA 4QB4A 5IGCA 2OEOA 3C1EA 3MXPA 4K5VA 5C6AA 2OXPA 1A2TA 2F3WA 3MVVA 5IODA 3OWFA 1STNA 3EJIA 1JOOA 4KD3A 2F0VA 5IIFA 5CV6A 3HEJA 3LX0A 2QDBA 1KAAA 2RBMA
chains in the Genus database with same CATH superfamily
2D0PA 1SBBB 4MTNA 4HEDA 4QMGA 1BF4A 2QCPX 1EWIA 2RDHA 3AEVA 1OXSC 1HNZQ 4KJOA 3HP3A 2ASBA 4JI1L 1I94Q 3MA2B 1DZ1A 1AH9A 5JJKA 4IPDA 5EBCA 2SNSA 1DXMA 3JC66 2F03A 2NVYH 3TP7A 2K05A 3UE0A 1Z6HA 3KF8B 4DV3Q 1RTNA 5DAUA 5IE8A 2WAQB 3S15B 1RODA 4AYBG 2J7ZA 4ZKCB 5M9OA 4FO2A 2RF4A 2KVMA 4RGTA 5EJWA 2Z6KC 4DAMA 4BA2I 1PMRA 3HKZB 2TSSA 3GV6A 4IUQA 1X9NA 1D5ZC 1GUOA 1WD1A 2F4VQ 2A6ED 2JEBI 1CKMA 4EQOA 1IBLQ 4EX5A 4DR1L 1V8QA 5C4JB 4UP8A 4JI4L 4DR4Q 4HSPA 5I6YA 2A74C 2EY6A 2YU9H 1KL9A 3PO2H 1TWAB 4MN3A 3TEHB 4YHHQ 4X65L 1VF7A 1MD2D 4LFAQ 1UEBA 1BR9A 2NVQB 4P75A 3A74A 4C3IH 3SEBA 4GKKL 3HOVH 2VUMG 5A35A 3D4DA 1FNWA 1S5ED 5C5MA 3TS2A 5ELNA 1VQ6A 4V190 3ND9A 1GUSA 1TS5A 3CMEA 1GUTA 2NYZD 3H91A 1GXDC 5C3EB 1AFPA 5EGTA 1A8VA 4FF1A 2KBNA 3OOCA 2E5LQ 4P73A 4CDFC 2NVTH 4J1MA 3S1MB 1IW7C 2EJFC 2F0FA 2PNHA 1BVSA 3HKSA 3F2DA 1EOVA 1M8AA 2L9HA 2PCFB 3EJIA 4A3LH 3NBHB 3X3NA 1SROA 4K5WA 3K7AB 5M3MH 2B29A 2MO1A 1QWYA 2EIFA 1SAPA 2GVAA 2F0UA 4CKBA 1E22A 4DR4L 1AEXA 3PIPA 1F2YA 3OTOL 3CPWA 1SMXA 1QZHA 1I6HB 3GTJB 3OWEB 4G7OC 3Q6SA 4L6TB 3DEOA 3T1HQ 5TSSA 4LFAL 4BY1B 1FD7D 3FEWX 1QB5D 2BA0A 1JJCB 1AZPA 1W6KA 1VQ9A 2JA5H 3CU7A 1E2VA 3HOXG 2NVXB 4G57A 3S2HB 5FOBB 2F0MA 3OMGA 2EY5A 4GN3B 4JVZA 3D6WA 4LW1A 3CRLC 5C44G 1FR3A 4P71A 1SYDA 1VQMA 3HGBA 1ENCA 1Q1BA 3WOFA 2JP1A 1LTAD 1EZ6A 2XN9C 2Z6KA 3I90A 1B7YB 2QEJC 3CMAA 1X3FA 4JW0A 3QB3A 2K14A 2M2LA 2WKDA 4L8JA 1N32Q 2R92G 1XNRQ 3EIVA 5M5YH 3DUZA 2X6LA 3OW2A 3L9AX 1NSNS 4A93B 5IP7H 4JI5L 3M4PA 4DV1Q 1TWGB 4LF5Q 1PDQA 2F0IA 3QWNA 3FDTA 2PMZE 1HFGA 2L5TA 2LXJA 1CKNB 3TZUA 2RCNA 2K6AA 5CR3A 4ZQ3A 2NVYB 3DLLA 4NXML 1WTHA 1I6VC 1TWCH 4A3EH 1XJVA 3QO2A 5LMNL 3ND8A 3SGIA 2ZM6Q 1U0LA 2F0VA 1ICFB 2PQAB 2QDBA 5C4XG 3SE0A 1G8ZD 2WKCA 1KRTA 2KENA 3TS0A 1CA5A 1K3BC 1BCPC 3UE1A 2G9DA 5GAGC 1DOKA 2YTXA 3HG9A 1K9MC 2LKVA 2F0PA 5JEAJ 4KY6A 1IZ6A 3J81c 1VQ7A 1QVGA 3D6CA 3W5OA 4KJNA 1XTDA 4CJ2C 4LF7L 4GKJL 5IT9E 1U4LA 2YU9B 2OF1A 3FP9A 3PO2B 3CRKC 5CORA 4XYOA 5JJZA 2WACA 5M5XB 2VQFQ 2UUBL 5C3XA 1PFBA 1N32L 3K81C 1XNRL 3JAML 3CC2A 4K0KL 4C3IB 5M3FB 1IYJB 3IFTA 3S2DH 1VMCA 4EGVA 5D14A 1JT8A 5J3BA 4IUPA 1WJJA 1VQLA 2VUMH 4K2KA 1N36L 5IGEA 3PCOB 3K80C 2K5DA 4ZYSA 1FNUA 1K0RA 1HZCA 4L5TA 2F0SA 1BDOA 2A68C 3GTKH 2EY2A 4DAPA 5CC4A 1XYIA 3VR5A 1YNNC 2ZM6L 4B3SQ 4A3BH 3G6JB 1RKNA 3HOYG 1OXUA 3MTSA 2B63G 4L5QA 4MIUA 1G91A 3KJOA 3SVMA 5M3MB 4PMBA 1JE4A 2NN6I 5BN4A 1Q82C 1MBYA 3PUXA 3L7ZC 3BYTB 2O5JC 1DM0B 3VYUA 2K75A 1OTCA 3MHBA 3C46A 4YWKA 3BYYB 4HMJA 3KLSA 4I7AA 4JYAL 3NELA 4AQYQ 4JI2Q 1L1OC 2RQXA 3I70A 4XQNA 3GTQB 2F1MA 3BZKA 3RN2A 1JOOA 4R4CA 1BUVT 1PTOD 5FKAC 4B3TQ 1WCMG 1BCPF 4IPGA 4MNOA 3GV3A 4YY3L 1YIJA 1RJTA 2KHJA 1TXYA 2K4KA 3CQZH 1SSOA 3CCJA 2JA5B 1EY6A 1NAPA 2F0TA 3BDOA 5CYUA 1I3QB 2M9VA 1VQNA 3BDLA 4KY7A 3P75A 4C3HG 4DUYL 1VQJA 2BH8A 1KC8C 2VQEQ 1G2SA 2B8GA 1SE4A 4R4TA 1F9RA 3MXNA 3HOZG 2B2YC 2E2IH 4N9PA 5C44H 5GAHC 1KDCA 2NUCA 2KHIA 4C3JG 2R93B 1C9OA 1SNQA 4K8JA 3BG3A 5T1GA 3CP0A 1QE6A 3K5NA 4P72A 2CW0C 1RIPA 5KIXA 1B4OA 2I0QA 1GUGA 2AQ2B 3HOWG 1UUPA 2UXDQ 4A3GH 3M7NA 2SEBD 4GN5A 4IN3A 2I07B 1YEZA 3H3VI 2R92H 1HQRD 2C5CA 5JOBA 2DJGC 4C1NI 2CWPA 4HJAA 4Y52H 4K6LA 3EQLC 4PG3A 4JBMA 1VQGA 3P7JA 1X3GA 3CAMA 2RCFA 4K14A 3K5LA 1WVLA 4P74A 3RD4A 1UNSA 2JA8B 3LWUA 1D1IA 3BS1A 4A3MH 2HCIA 2HCCA 2F0LA 3D0FA 1FGUA 4RA8A 1PFNA 1RL2A 1IL8A 4HAEA 2WB1G 3S17H 3Q8DA 1S40A 2F4IA 2L11A 1B8AA 1CA6A 2K03A 3T1YL 3DHQA 4FXDA 4DV0L 3OW7A 4LMQD 4OIKA 4AYBB 3ULJA 2EJGC 2B3GA 2N3SA 4Y7NH 1BBUA 3ULLA 2HT1A 2ZXPA 1EY0A 4TQUS 2E2JB 1V1PB 2PI2A 2D9UA 4DNTB 2LXKA 3MVVA 3KOJA 4H0LC 1ILPA 4R1JA 2AHOB 3CKIB 3I8ZA 3NHHA 3E3XA 1CQFA 2UXCL 1B3QA 4DXGA 5IT9c 1VQ4A 2F0DA 4NPSA 3S9WA 2CQAA 2TMPA 4A76A 3B6YA 5KEEA 2A8VA 4X64L 3U9OA 1YHQA 3KF6B 3ONAB 2DJFC 2X6GA 3Q23A 2UXDL 1ASZA 2YYZA 1XMQQ 4HCEA 3EN2A 4JI0L 4J6HA 1SYBA 1L1OA 2BDOA 5AJ3Q 4KD4A 1CUKA 1SNPA 2VUMB 2BOSA 1XX8A 4FNFA 5ELCA 5GAEC 1PH2A 2LSSA 3CCRA 2F0KA 3J81j 1D1KA 1X54A 4CJ1B 3OHXC 5HY6A 1HR0L 1TT2A 1JB3A 2CKZB 1C48A 3D3RA 4HTHA 3NTKA 1W6JA 5KNCA 2R61A 3M85A 3NPPA 4NXNQ 3HOYH 1SYFA 2B2YA 2CVRA 4HN7A 4KN7C 2JE6I 4A3JH 1NR2A 2RSOA 1K8MA 3K5OA 2EE1A 5FO7B 2Z9HA 5I9PA 1Z9FA 5FO8B 2MUYA 3JAME 1TVXA 3S1RH 2UU9Q 1IW7D 1I4XA 4WRDA 5C3WA 1PZKD 2FFKB 1VQFA 1VQ8A 3U50C 1WTOA 2K1BA 1WTRA 4NDXA 1PRTC 5EBDA 4MHEA 3H3VC 2HQLA 4FF4A 5LL6S 3V05A 1ML0D 1GO3E 4BBRG 3I4MH 1WCMH 1XMQL 5JPNC 3HS0C 4FYDA 5E3FA 3PV0A 2HDLA 1O7LA 1BBWA 3L2PA 1YITA 5LMUQ 3GTMB 3HOXB 1SNMA 2FXQA 4U673 3I7FA 4CDDC 3KBGA 3CCMA 1A2TA 3KFUA 4LFCL 5FLXL 1SFOH 5IT9L 3PQIA 2UUAQ 3PO3B 2E2IB 5C44B 2NZ1D 5JVH3 3WDNA 3ITPA 5BN3A 3HOZH 5CGKA 3I4NG 3H0GH 1MJEA 4HIOA 2UXBQ 3D8GA 2BA1A 3QIAA 3C1FA 3EBEA 1IYVA 3PGZA 3AYHB 1EIYB 1VQAA 1NMGA 4F88A 1WTQA 4JI3L 1PA6A 1SXTA 2JA7H 2EYOA 3S14H 4HCSA 1AN8A 3RR5A 2H4OA 1ESFA 4XXEA 1GVPA 1T9HA 2R92B 3EROA 4I65A 1I50H 2Z0SA 1TU2B 4K2LA 4DA2A 3Q24A 5FK9C 4DV2Q 1LT6D 4DR3L 3KLSX 1EL0A 2QGQA 4PZ7A 4HJ9A 3A5UA 5JEAH 5D3DA 4RH6A 4A3EG 4B9WA 1FGBD 1EYAA 1PTOB 1QNUA 2Y0SE 4IJHA 2K28A 1HUNA 3AMUA 3DXJC 2QW7A 1PXUA 5KNBA 1LTLA 4B08A 4MTKA 4H02A 3KLWA 1JOQA 4DK0A 2IL8A 1LM0A 1YBYA 1DOLA 2KA7A 5C4XB 5LMUL 1WTPA 2R7ZH 2L15A 3IFDA 1QNKA 4HSVA 1A3TA 4H7BA 4IPCA 4TRDA 1ENFA 4DR6Q 2IX0A 3NEMA 1LT5D 3SR1A 3J81E 1S5BD 1JC7A 1PRTF 1LTRD 4BWGB 2Q2TA 2OWOA 3GTOH 4UHVA 1TIID 4ME5A 1J6QA 2PYKA 1KABA 2Z8LA 2RKSA 2LFNA 4LF9L 4BS9A 1SYEA 1PZID 3J80c 1BCPD 4LUVA 3RUZA 5KYLA 4E6IA 1WD0A 3TREA 1NBWA 1JICA 1I4PA 2B8FA 1NMFA 1LT3D 3I55A 1I4HA 2G9HD 2HHHQ 2EXZA 3J81i 2ZJQA 1KLUD 3PSIA 4AH6A 1B53A 1F9SA 2FMMA 3ERSX 1HH2P 1YNXA 3K6OA 2KEEA 1HNZL 4HJ7A 1LTSD 4IJLA 1I94L 1XTCD 2HD3A 3U58A 3IKJA 4A3BG 4UP7A 4XQQA 3NXWA 2O4XA 2R7FA 3FRPB 1KNEA 3F1ZA 4GNXC 3WOEA 1PYWD 5A2QE 4DV3L 2R3ZA 2EVBA 4JI6Q 4CKCA 1L2FA 2E2HH 1QCBD 3A54A 4GS3A 3J7ZC 2VS1A 1W3SA 3HOYB 2D5DA 2XRSD 4G7ZC 4DK3C 2B63B 1EEFD 4IALA 3N6RA 4UY8C 5ELDA 2Q2UA 2H5XA 2A68D 4LF8Q 1EYCA 3M9BA 1SE3A 4FVMA 1YNND 1C0AA 2M00A 3S1RB 2E74C 2F4VL 1YHBA 2K5QA 3MAQA 4QL5A 4EQ5A 1IBLL 1A2UA 1EQTA 3JAMc 2A5HA 1U4MA 1CSQA 1PH3A 3PUVA 2BDNA 4JBWA 1EYDA 1MI2A 1TWHB 1STHA 1EU4A 1PH1A 2I5MX 2RDFA 4YHHL 1A3VA 5EPLA 5IP9G 2CH4W 1KLGD 4QJFA 2HHHL 3R2IA 5COYA 2F0OA 2N88A 2Q8IB 4BBRH 3UDGA 2NN6G 5C4HA 1H9SA 4ID6A 4KI0A 4WJWA 3J7AV 1LTID 2AKWB 1PH4A 2QF7A 2PMZB 2Y0SG 4C3HB 1AE2A 2ICIA 1DGSA 4L5SA 4ZUJA 2RHSB 1SFOB 1UE5A 2VY3A 3DM1A 3R93A 3C3LA 5DM73 3HOZB 2E5LL 1VQBA 2P5ZX 4X6AH 1KXLA 1Q86C 1CT1D 2EYPA 1BO0A 3L0OA 1KD1C 4C3JB 3U4VA 1R9TH 3I4NH 4IUUA 5IY0A 2E75C 3GTPH 1J8IA 1STGA 3M3YH 4A3GG 4DV5Q 2H1EA 1HFNA 3KYHC 2MJ8A 2I46A 4C56C 2K5VA 3OYYA 4YWLA 2A69D 1ET6A 1Q3LA 3VYSA 3HOWB 2JA6H 1V43A 3J80L 2BH2A 4P2CB 5BN5A 2HUGA 2NWGA 2ZTEA 4OXPA 1K0SA 4LUOA 3PUWA 3Q0AA 1PH9A 3M4OH 3ZJYC 4A3MG 2CW0D 4GZYC 1QG7A 1BBXC 3T1HL 3MWYW 2Z6BA 2MO0A 1U4RA 3F2CA 4QUCA 1OO9B 1SNDA 5DLQE 2JSOA 2YV5A 1Q7YC 3CPFA 5EPJA 2A19A 4DR2Q 2Z4IA 2WB1B 4A3DH 1HJPA 1IBMQ 2NTTA 2VB2X 3R2TA 1S4ZA 3M4YA 2IHFA 5I4DA 2L1BA 2IT1A 3OPOA 2L0CA 4RKLA 4ILWA 4GNXA 1EFID 4IUNA 1E2ZA 4DK1A 1CFMA 4CDEC 3CF5A 1HPCA 1UWVA 1I4GA 2KCNA 3S16H 2KUMA 1D2BA 4X3KA 3AU7A 4NP5A 5D3IB 1A3UA 2AQ3B 4DFAA 3A8JE 2B2TC 3K59A 4YCVA 5ELOA 1V1OA 2ICEC 4ABNA 1W2BA 4K6DA 1MKHA 3GD7A 5IGFA 3HOVB 5K36G 4OX9Q 1TWFH 2CH4A 1XMOQ 3D4RA 1TS4A 3D4WA 1Y1VG 4DV1L 2J0TD 1VCIA 1B44D 4LF5L 3RZOH 3TZDA 3VR2A 4K5XA 1SYGA 4O42A 4OIJA 4IFDI 1QUQA 3BZCA 2RSNA 1PLFA 4KHVA 1KQSA 2XIWA 4XT3B 2IWHA 1GHKA 1NJIC 1LACA 4IO9A 2NVTB 1SYCA 2FJ2A 2E2HB 2OEOA 4K5VA 1GKHA 3OWFA 4KD3A 4DV6Q 3A7LA 4LJZC 4JCVE 4A3JG 3FMCA 4XIGS 1B3AA 3A55A 3SXHA 4APVA 2DY8A 2E76C 3I73A 4JI8Q 3LGJA 2EY1A 2O5IC 5E4XA 4DR5Q 1STEA 1OXTA 3PUYA 3MXNB 4GOPC 2SOBA 3BVZA 3TMEA 1JWMD 3KDFA 3A8KE 4A75A 3MFYA 4WJ3M 5ELBA 3VYRA 1BCPB 4HMIA 4GLAC 2VQFL 3BZDB 3Q22A 1X3PA 3I4MG 4LF4Q 4OWXB 1RF2D 2WP8J 4GN4B 5JVG3 1K28A 5IP9H 4BA1I 3T51B 1N34Q 3SK6A 4QF4A 4BBRB 3MC0B 4O2DA 1IBKQ 5FO9B 1LO5D 2NN6H 4UAIA 1CTMA 1D5MC 1MIUA 1VQCA 2DNCA 2Q2IA 5DNFA 1K73C 2F0EA 1RD9D 1Y69U 4YCWA 3H0GG 1XWEA 1LV9A 4KKTA 2K52A 2PZWA 3O13A 3PIO3 4B3SL 1Y14B 2B39A 3TQYA 1C7YA 3FPUB 1EZ8A 5IGDA 1NCVA 3I4NB 5T1IA 3G71A 1Q81C 3GTPB 2JA7G 4R4OA 5G3LF 3LNNA 5EAYA 3H15A 3I4OA 3PF4A 4F87A 5M5YB 1K8AC 2C9OA 5BR8Q 4DV7Q 3I56A 3L3OC 2XWBB 2DNEA 5JEAG 4AQYL 2F0JA 1EY7A 5H1SE 2B2TA 4JI2L 4RGNA 1STBA 1JB7A 3TRZA 2JYOA 4DPGA 2K32A 4C1NK 3AFQA 4A3EB 1TWCB 4HIMA 3A5ZB 4B3TL 2K01A 2QA4A 4HR7B 3SDZA 1L0XB 3LX0A 4O0AA 2B2UC 5FLXc 3GO5A 4G7HC 2R7ZG 1LLRD 1UE6A 4DAYA 3DWPA 3J7A5 1L1OB 1ZXTA 1DJRD 1LT4D 3K5MA 4TSSA 5L37A 4OO1I 2VQEL 2IY5B 4RG1A 3E9IA 3H3VH 1CM9A 5CMDA 4OEMB 4Q5VA 1UAPA 1I4RA 2ZTDA 3J7AF 1Y8OB 5ELFA 4N8X1 1SMYC 4LF6Q 3J80E 3BVGA 1RCVD 2J4XA 2A73B 1BNZA 4QIWE 4C2MH 1P8LA 4RWSC 4ZAIA 5I9OA 4RHRA 2HDMA 1EIHA 3PUZA 4GOPA 3ER0A 2ES2A 1SE2A 3ZYYX 1TQOA 3S2DB 4JI7Q 3PMFA 5BR8L 1SEBD 3I3CA 1X32A 3I2ZA 3RLOA 3EFXD 5M5WH 5C4JH 4QY7A 5K36H 2EDGA 1TWAH 4OO1H 5CV4A 1Y1VH 3K58A 5KRUA 2F3VA 3KUPA 4CKEA 3CCQA 3GTKB 2MNAA 3RLFA 2NBFA 2NVQH 3RN5A 3MEHA 2EJMA 1DYQA 4A3BB 2DN8A 2EPBA 2KEDA 1Q8KA 4F8MA 1YJ9A 2BE5C 4R4QA 3M7GA 1I4QA 3G4SA 2IHEA 5GADC 3K57A 1N33Q 5HGTA 4AYBE 3TP5A 2AQ1B 5DM63 3G48A 2RHQB 1D7QA 2OT2A 5EKLA 1E7ZA 4PQXA 5C3EH 1K8GA 3GTLH 5LL6X 2UUCQ 2Z1CA 1HTPA 2ZJRA 2HQEA 1H95A 2JJQA 3X3MA 1YNJC 3S1MH 1TY2A 4S3SA 3T4AC 4RGOS 1VS0A 2F3IA 2ZTCA 3MXGA 3C1EA 3MXPA 5C6AA 2B2WC 4LNQA 5IYDG 1FNVA 1EEID 1HQMC 3CCUA 2IJ0A 5C0XI 2LMCB 2K50A 4JK1C 2QDLA 2A1AA 2KOLA 1ESRA 4B3MQ 3RZDH 2A6HC 1PYBA 1O80A 4KHPQ 3NBIA 3CQZB 4OELB 1H9RA 4JG2A 5AJ3L 1H9MA 1X6OA 4DF7A 3QOJA 1GJXA 2OTJA 5ISRA 3EVQA 3I91A 5FLMH 1KDAA 1Q12A 2D62A 2O2LD 3STBC 3JAMi 3M4QA 4YCUA 4A3CH 1FJGQ 1YZ6A 1I6HH 4RCNA 4CDCC 5NUCA 1JWSD 2MP1A 1TS2A 4IFDJ 3CCVA 1Y1WG 1TY0A 3KBXA 4ZCKA 2B2UA 4ZUIA 3I4LA 4PZ8A 1B70B 3SK5A 5FJ8H 1PFMA 4ZLTF 3K0YA 4UPAA 2NVXH 4HJ5A 3U4ZA 5C4ZA 1VDZA 1HA5A 4A3FG 3S2HH 2Z4HA 1NTGA 1VQ5A 4NXNL 1Y8PB 1Q46A 3FKIG 2JA6G 3T13A 4FDBA 4A3GB 4IZ8A 3KJPA 3CC4A 1F2LA 1WI5A 1M90C 2KQ3A 1Q90A 2BCOA 2WIIB 4DR1Q 4A3KG 4MZ9A 4AIMA 4JI4Q 1WOCA 1D6EC 2UU9L 1VMPA 1BOSA 3GDEA 5CBEE 1VQHA 4TVAB 1E2WA 3VA7A 4X65Q 4ULLA 1EYGA 1EWCA 1U4PA 1BKBA 1EQRA 4PNYA 3GP7A 5IOCA 2DY7A 4A3MB 5GQOA 1SR3A 5KNDA 3HZXA 1GUWA 3RNUA 3F2BA 1HR0W 4GKKQ 4KHPL 4QCLA 4WORA 2PPBC 1LTGD 5IYBG 3S17B 1KAWA 4A93H 4A3DG 2EYMA 1GM5A 1ZYRC 4RCOA 2K5WA 1TWGH 4OGQC 4ODGA 2JN4A 1Q1EA 2WFWA 3H09A 1S3OA 2JA8G 1X65A 2K04A 1FJGL 3V2TA 4Y7NB 1PRTB 4A3IG 2F0HA 3CD6A 1TKWB 1A6XA 1KHIA 1PTOF 2XRQD 2VW9A 2UUAL 2OXPA 2D0OA 3FHWA 4JOIC 4JBKA 1JR0D 4JV5Q 3S1QH 2I5LX 3TSSA 2K5NA 2DGYA 4R9WA 2KCMA 3TN2A 4L63B 4C2MB 1IKMA 2N55A 1YJWA 2PZTA 4RAUC 3IRBA 2UXBL 1NE3A 4NB3A 1UE1A 1X3QA 1VQDA 1JQYD 1XXGA 2MHVA 4U68A 5KGUA 2AUJD 5DEHA 2B2WA 2JA9A 5M5WB 1CHPD 5CV8A 1CI3M 4KHZA 2NTSA 1FVIA 2EQSA 3K7UC 5F2DA 3OTOQ 2PZUA 1VF5C 5KYIA 4DV2L 2IX1A 5M5XH 3E9HA 2ALYB 4YIJA 3UI2A 1Y1VB 1JCKB 1R4PB 3PIOA 3KF8A 3TDQA 5CV5A 1XPOA 1O7IA 1LUZA 2EYHA 5M3FH 2DUDA 2WAQE 1HXYD 1S5DD 4UP9A 5G3LD 3HFZB 1D8LA 4EVOA 1ET9A 2L12A 1H9SB 4CHTB 2YTVA 2QILA 4DR6L 3HKZE 4A3JB 1KRSA 4CGYB 3GTLB 1HZAA 3BU2A 1ILQA 4KLKA 3F8TA 4DKAC 4LAAA 2PNRC 2YTYA 2C35B 3C2PA 3R3OA 1C8CA 4BBSG 4IUTA 3VR3A 2EZVA 4OONA 4ALPA 3MZ5A 4UDUC 4IFDG 4OL7A 2ZXOA 4JV5L 1Z47A 2NZHA 2RDGA 4F7XA 4G4KA 3ULPA 4LUZA 1QVFA 3ICEA 3VR6A 4WFN3 4HIKA 3AB9A 5J22A 5GROA 3EA6A 4B9XA 5HGQA 4IUVA 3RZDB 5IYDH 4POGA 2PQEA 2VB3X 2OTLA 3P20A 1G6ZA 4N9TA 4FXKC 1HTLD 3I4MB 1WCMB 4WJ4A 1SN8A 4JI5Q 1JJGA 2AWNA 2V1CC 2NZOA 4GLVB 2SNMA 4K8IA 4KY5A 4DV4Q 1E1OA 1RDPD 3U9SA 5JJLA 1EIGA 4O1NA 4HIDA 3GTQH 3CHBD 3CC7A 1STNA 3W2DA 1HZ9A 1VQEA 1C4QA 4XQJA 4NXMQ 2F52A 2XTIA 5LMNQ 2XSCA 2PO4A 3HOUG 3OIPA 1STAA 3NTHA 1Y1WH 4PMWA 3H0GB 2AUKA 3NBHA 4JBJA 3R8BA 2RA4A 4JI6L 1I3QH 1F9QA 1U9RA 1E24A 2HIXA 4RGMA 1TR5A 4A3FH 3PO3G 3QJYA 1K3RA 2V4DA 2JA7B 2AMCB 2F0WA 4JOIA 1JOKA 4H44C 3S14B 1YHAA 3GQBA 2RVLA 4LF8L 4LFBQ 1II3A 1I50B 3FKIH 3KK7A 4JPBW 4POFA 4GNXB 3DWQA 2LY7A 4LF7Q 4GKJQ 4BXXH 2R93H 3NQIA 1EY5A 4A3KH 1WYDA 1XNQQ 3P1HA 1JORA 1VQKA 1CZGA 2NB0A 3UDXA 2UUBQ 4BY7G 5I6WA 2F0GA 4X3UA 5C0XJ 2WV6D 4IOAA 3DM3A 1A15A 4QQBX 2MPMA 4K0KQ 4QGUA 2ZXRA 4OWWB 5FLXE 2L4NA 1VQOA 1AP0A 3G7LA 3AFPA 2F0NA 1F2MA 4XDXA 2JK8A 1VQIA 1MJCA 1K83H 5IYBH 4IQZA 2R7ZB 1N36Q 1AW7A 4DU9A 4DV4L 1ZKOA 5EPKA 3RMHA 1B50A 3BVMA 2E8GA 1O78A 4CBVA 2N8NA 2JA8H 4PMCA 3NE5B 3CCLA 5J1ZA 1QUQB 4PZ6A 2PW5A 4A3IH 2MGSA 2WAQG 2A6EC 3NQTA 3GTOB 3S1QB 5J39A 5K5PA 4DR7Q 2EXDA 2B2VC 1R4QB 2FINB 3QG1A 4X66Q 2X69A 4X3TA 2CCZA 3HKZG 1SJED 4DV5L 1JE5A 5C5LA 2E2JH 1BQQT 3N52A 4R4IA 1N8RC 4DXFA 4LFBL 4JYAQ 1G291 3OIQA 3WWVA 1MHWC 1CHQD 1SMYD 1YJNA 4OO1G 1CKNA 5EKKA 4QUFA 2RBMA 4RFBA 1SLJA 1QILA 5CV7A 1HRJA 1NY4A 1XNQL 3E0EA 3G6EA 3GTGH 1BXTA 2KECA 3KDFB 4N8FA 1B2TA 4YY3Q 2LS01 5IWAQ 2PQAA 4CJ0B 4ZK9B 4OWTB 1ENAA 2WB1E 1CK1A 5HURA 4DGZA 2XWJB 4DUYQ 1GD7A 2R6GA 4R8IA 4DR2L 1PFSA 3DWAA 1K8OA 1IBML 3NSWA 5C3EG 1RHPA 2K7VA 1A62A 4KTAA 1YI2A 3NTIA 3MEFA 1HA6A 2VNUD 1HUMA 4EQPA 1B1ZA 1E3PA 3E6ZX 1NNXA 3TP8A 4BBSH 4DR7L 3MXUA 1QJOA 2JXMB 2D2CC 2BE5D 4KKUA 2ZT9C 1I5FA 4IFDH 4DUZQ 1AZQA 1N9WA 4X66L 2ATWA 2JQOA 1A0IA 1VQPA 5JAVA 1PH6A 1YVCA 2F0QA 4RMFA 5LMNW 5E1FA 5CV9A 1G51A 1J5EQ 3TBIB 1H9JA 4ZKBB 4KKSA 5FLMG 1YNJD 3DMUA 1EUJA 1UE7A 2HIVA 4OX9L 1DONA 4A3CG 1XMOL 4RHSA 2ZJPA 1EY8A 1PHJA 1RTOA 4IOCA 3NK9A 2PW7A 5LHY1 3S1NH 4J15A 1LYLA 1PRTD 4DK6C 2ENBA 4BY1G 2A6HD 1EY9A 1E1TA 5FJ8G 3SK8A 5IWAL 3W3AA 3A56A 3QOLA 1Y1WB 2MFIA 3CCSA 1MGSA 1P16A 1IKLA 5C0XG 1F2ZA 1T5XD 1ZEQX 3HOUH 1E0BA 2N78A 4NKLA 2KCCA 4ME3A 3GTMH 3T1YQ 4R8NA 3HOXH 4DV0Q 1R9TB 3STBD 5D65A 2IX3A 3NP8A 1EY4A 1G2TA 4DV6L 5IGCA 4A3FB 2Q2HA 3M3YB 4DAYB 3RLNA 3AQQA 4JC0A 1PV4A 1V9PA 3IL8A 3W1GA 1J9OA 4FF2A 5E7NA 5IIFA 2A69C 4NW2A 1KAAA 2XNAC 3PO3H 3FKIB 2JA6B 4JI8L 3FPPA 2KJXA 2VXWA 1GOZA 4DR5L 2B2VA 5IYCG 1EU3A 1Z7TA 2GVBA 3I72A 4A3KB 4EQNA 2G5DA 2WINB 3LWEA 1EWHA 2UXCQ 4XT1B 1OXXK 1CKOA 3M4OB 3J81L 4QIWB 4DUZL 3J7YW 1NR4A 4PV1C 4X64Q 4LK1C 4KV6A 1NUCA 4Q0FA 4FXGC 1L0YB 4BY7H 4LF4L 4JI0Q 4A93G 4NMZA 4LWCA 3SHLA 1J5EL 1JWUD 1F9PA 3T53B 3KLRA 4GOPB 1N34L 1B9MA 3URYA 3IAYA 1EIFA 2QKIC 4I7ZC 1K83B 4A3DB 2KHSA 1QOHA 1U5KA 1CQVA 1EQVA 3V96A 1IBKL 2I5HA 1PTOH 1IHZA 2CFMA 4A4IA 3TP6A 4A3IB 3PIP3 1HR0Q 3UDFA 1STYA 1PH5A 2K33A 1GUNA 4KK7A 1ICWA 2SDFA 1M4VA 1ZYRD 4DNIA 1LABA 3A0JA 3S16B 3S15H 5C4XH 1SNOA 4FF3A 2QEXA 1PVOA 2XVSA 1IXRA 2CQOA 3QR8A 3E5SA 2VZAA 3A7AB 1KTKA 1S5CD 1LTBD 3DEPA 5A2QL 3UDIA 1WFQA 1ASYA 1TS3A 2GA4B 4DAVA 1A63A 1KDBA 1PZJD 1QZGA 1KNAA 1TWFB 1HZBA 2PI2E 4DV7L 2R7DA 2K5HA 3PO2G 5CBAE 3OSOA 5I2YA 1SE8A 2AWOA 1SDFA 3RZOB 1F77A 2JEAI 3GTGB 2VL6A 3K0XA 4FP5D 3J80i 1LTTD 4ZRZA 2OQKA 4XYQA 3PF5A 4C3IG 5M3FG 2OCEA 2CWAA 1EFWA 3HOVG 3SK4A 1SJHD 5AFWA 5E4WC 3NWTA 3NENA 3W1BA 4B3RQ 4QB4A 1X55A 1L0WA 2F3WA 4V0BA 5IODA 5ELEA 4M8AA 5CV6A 1OXVA 3H6MA 1V1PA 2L55A 1G6PA 4LFCQ 4KN4C 1DD2A 1H9KA 3NUCA 2FHTA 4RKBA 3CXCA 1HNXQ 1HNWQ 3ERQA 1QVCA 1KIXA 3BDCA 4BBSB 4A3LG 3NWSA 1HCZA 2GN5A 5I2XA 2IW3A 4LF6L 5M3MG 5IGBA 1JMCA 1ONLA 1S5FD 3KF6A 2N49A 1O7YA 4L5RC 2B63H 1S72A 3K7AH 1V1QA 1PTOC 4X62Q 4JI3Q 1CSPA 4H13C 3A8IE 1CZWA 3HRZC 5EKIA 3VDYA 1MSHA 4M1UB 1O7ZA 1HHVA 1WTWA 3E0JA 4JI7L 4IURA 4DR3Q 1D5XC 1X3EA 1SNCA 4DN4M 3VA5A 1PH8A 2EOTA 5JPMC 4JI1Q 3S1NB 4TKOB 1IYUA 4GLXA 3GTJH 2E2DC 1WTVA 1TWHH 2EYJA 1X56A 2Y0SB 1PYSB 4DNRB 3OMCA 2JA5G 2CHBD 4BY1H 1JJ2A 2FMCA 5JJIA 1EQQA 2MQHA 3HOUB 4B3RL 3D31A 4X3SA 3CW2C 1WTXA 4J8QA 1IL2A 1XPUA 3MFGA 3VYTA 5C0XH 4HJ8A 1MSGA 1N33L 3F2UA 1B9NA 1SRUA 3K8AA 4C3HH 3BJUA 1XPRA 2EYLA 2KCTA 1HNXL 1DCZA 4BXXG 1Y8NB 2UUCL 1HNWL 3T16A 2R93G 1Q8IA 5EQ0A 3T56B 3VR4A 3FVQA 2OQ0A 4LF9Q 2XGTA 1EOTA 2Q8TA 2IPKD 4C3JH 5IYCH 4KMUC 1PH7A 1FL0A 2EYFA 1AE3A 5IGGA 1T5EA 3S24A 3CCEA 4XTCS 4OHJA 1DOMA 4X62L 3H94A 4BY7B 4Z9CB 4B3ML 1GHJA 1M1KC 4IPHA 4YWMA 5IP7G 1FYCA 2ID0A 1UEAB 3HEJA 3HOWH 2Q8RE
chains in the Genus database with same CATH topology
1SBBB 4HEDA 4QMGA 1BF4A 2QCPX 2RDHA 1OXSC 4KJOA 3HP3A 3MA2B 1DZ1A 5EBCA 2SNSA 1DXMA 2F03A 3TP7A 2K05A 1Z6HA 1RTNA 5DAUA 2WAQB 3S15B 1RODA 2J7ZA 4ZKCB 5M9OA 4FO2A 2KVMA 4RGTA 5EJWA 4BA2I 1PMRA 3HKZB 2TSSA 3GV6A 4IUQA 1D5ZC 1GUOA 1WD1A 2A6ED 2JEBI 4EQOA 1V8QA 5C4JB 4HSPA 5I6YA 2A74C 2EY6A 1TWAB 4MN3A 1VF7A 1MD2D 1BR9A 2NVQB 3SEBA 5A35A 3D4DA 1FNWA 1S5ED 5C5MA 4V190 3ND9A 1GUSA 1TS5A 1GUTA 2NYZD 3H91A 1GXDC 5C3EB 1AFPA 5EGTA 4FF1A 3OOCA 4J1MA 3S1MB 1IW7C 2EJFC 2F0FA 1M8AA 2L9HA 2PCFB 3EJIA 3X3NA 4K5WA 3K7AB 1QWYA 1SAPA 2F0UA 4CKBA 1AEXA 1F2YA 1I6HB 3GTJB 3OWEB 4G7OC 3Q6SA 4L6TB 3DEOA 5TSSA 4BY1B 1FD7D 3FEWX 1QB5D 2BA0A 1AZPA 1W6KA 3CU7A 1E2VA 2NVXB 4G57A 3S2HB 5FOBB 2F0MA 3OMGA 2EY5A 3D6WA 3CRLC 1FR3A 1SYDA 3HGBA 1ENCA 1Q1BA 3WOFA 2JP1A 1LTAD 1EZ6A 2XN9C 3I90A 2QEJC 3QB3A 2M2LA 2WKDA 4L8JA 3DUZA 2X6LA 3L9AX 1NSNS 4A93B 1TWGB 1PDQA 2F0IA 3FDTA 3QWNA 1HFGA 2L5TA 3TZUA 2K6AA 5CR3A 4ZQ3A 2NVYB 1I6VC 3QO2A 3ND8A 2F0VA 2QDBA 3SE0A 1G8ZD 2WKCA 1CA5A 1BCPC 2G9DA 1DOKA 3HG9A 2LKVA 2F0PA 5JEAJ 4KY6A 3D6CA 4KJNA 4CJ2C 5IT9E 1U4LA 2YU9B 2OF1A 3PO2B 3CRKC 5CORA 4XYOA 5JJZA 2WACA 5M5XB 5C3XA 1PFBA 3JAML 4C3IB 5M3FB 3IFTA 1VMCA 4EGVA 5D14A 4IUPA 4K2KA 5IGEA 2K5DA 4ZYSA 1FNUA 2F0SA 1BDOA 2A68C 2EY2A 4DAPA 5CC4A 1XYIA 3VR5A 1YNNC 3G6JB 1RKNA 1OXUA 3MTSA 4MIUA 1G91A 3SVMA 5M3MB 4PMBA 1JE4A 2NN6I 5BN4A 1MBYA 3PUXA 3L7ZC 3BYTB 2O5JC 1DM0B 3VYUA 3MHBA 3C46A 3BYYB 4HMJA 3KLSA 2RQXA 3I70A 4XQNA 3GTQB 2F1MA 1JOOA 1PTOD 1BUVT 5FKAC 1BCPF 3GV3A 1RJTA 1SSOA 2JA5B 1EY6A 1NAPA 2F0TA 3BDOA 5CYUA 1I3QB 2M9VA 3BDLA 4KY7A 3P75A 4C3HG 1G2SA 2B8GA 1SE4A 1F9RA 3MXNA 2B2YC 4N9PA 1KDCA 2NUCA 4C3JG 2R93B 1SNQA 4K8JA 3BG3A 5T1GA 1QE6A 3K5NA 5KIXA 2CW0C 1B4OA 1GUGA 2AQ2B 1UUPA 3M7NA 2SEBD 4IN3A 2I07B 1HQRD 2C5CA 5JOBA 4C1NI 4K6LA 3EQLC 3P7JA 4K14A 3K5LA 1WVLA 3RD4A 1UNSA 2JA8B 3LWUA 1D1IA 3BS1A 2HCIA 2HCCA 2F0LA 4RA8A 1PFNA 1IL8A 4HAEA 2F4IA 2L11A 1CA6A 2K03A 3DHQA 4FXDA 3OW7A 4LMQD 4OIKA 4AYBB 2EJGC 2ZXPA 1EY0A 4TQUS 2E2JB 1V1PB 2D9UA 4DNTB 3MVVA 4H0LC 1ILPA 3CKIB 3I8ZA 3NHHA 1CQFA 4DXGA 2F0DA 3S9WA 2CQAA 2TMPA 5KEEA 3U9OA 3ONAB 2X6GA 3Q23A 2YYZA 4HCEA 4J6HA 1SYBA 2BDOA 4KD4A 1SNPA 2VUMB 2BOSA 1XX8A 4FNFA 5ELCA 2F0KA 1D1KA 4CJ1B 3OHXC 1TT2A 1JB3A 1C48A 3D3RA 4HTHA 3NTKA 1W6JA 5KNCA 2R61A 3M85A 3NPPA 1SYFA 2B2YA 2CVRA 4HN7A 4KN7C 2JE6I 1NR2A 2RSOA 1K8MA 3K5OA 2EE1A 5FO7B 5I9PA 5FO8B 2MUYA 3JAME 1TVXA 1IW7D 1I4XA 4WRDA 5C3WA 1PZKD 2FFKB 1WTOA 2K1BA 1WTRA 4NDXA 1PRTC 5EBDA 4MHEA 3H3VC 4FF4A 5LL6S 3V05A 1ML0D 5JPNC 3HS0C 4FYDA 5E3FA 3PV0A 2HDLA 1O7LA 3GTMB 3HOXB 1SNMA 4U673 3KBGA 1A2TA 5FLXL 3PO3B 2E2IB 5C44B 2NZ1D 5JVH3 3WDNA 3ITPA 5BN3A 5CGKA 3D8GA 2BA1A 3QIAA 3C1FA 1IYVA 4F88A 1WTQA 1SXTA 2EYOA 4HCSA 1AN8A 2H4OA 1ESFA 4XXEA 2R92B 3EROA 4I65A 1TU2B 4K2LA 4DA2A 3Q24A 5FK9C 1LT6D 3KLSX 1EL0A 5JEAH 5D3DA 4RH6A 4B9WA 1FGBD 1EYAA 1PTOB 1QNUA 2K28A 1HUNA 3AMUA 3DXJC 1PXUA 5KNBA 4B08A 1JOQA 4DK0A 2IL8A 1DOLA 2KA7A 5C4XB 1WTPA 3IFDA 4HSVA 1QNKA 1A3TA 4H7BA 4TRDA 1ENFA 2IX0A 1LT5D 3SR1A 3J81E 1S5BD 1JC7A 1PRTF 1LTRD 4BWGB 1TIID 4ME5A 2PYKA 1KABA 2Z8LA 2RKSA 2LFNA 4BS9A 1SYEA 1PZID 1BCPD 3RUZA 5KYLA 4E6IA 1WD0A 1JICA 1I4PA 2B8FA 1LT3D 1I4HA 2G9HD 2EXZA 1KLUD 1B53A 1F9SA 2FMMA 3K6OA 2KEEA 1LTSD 1XTCD 3IKJA 4XQQA 2O4XA 3FRPB 3NXWA 1KNEA 3WOEA 1PYWD 5A2QE 2R3ZA 2EVBA 4CKCA 1QCBD 3A54A 3HOYB 2D5DA 2XRSD 4G7ZC 2B63B 1EEFD 4IALA 3N6RA 5ELDA 2A68D 1EYCA 1SE3A 4FVMA 1YNND 2M00A 3S1RB 2E74C 2K5QA 3MAQA 1A2UA 1EQTA 2A5HA 1U4MA 3PUVA 2BDNA 4JBWA 1EYDA 1MI2A 1TWHB 1STHA 1EU4A 2RDFA 1A3VA 5EPLA 1KLGD 3R2IA 5COYA 2F0OA 2N88A 2Q8IB 2NN6G 5C4HA 1H9SA 4ID6A 4KI0A 4WJWA 3J7AV 1LTID 2QF7A 2PMZB 4C3HB 2ICIA 4ZUJA 1SFOB 3DM1A 3R93A 3C3LA 5DM73 3HOZB 1CT1D 2EYPA 1BO0A 4C3JB 4IUUA 2E75C 1J8IA 1STGA 2H1EA 1HFNA 2MJ8A 2I46A 4C56C 2A69D 1ET6A 1Q3LA 3VYSA 3HOWB 1V43A 3J80L 4P2CB 5BN5A 2HUGA 2NWGA 3PUWA 3Q0AA 2CW0D 4GZYC 1QG7A 1BBXC 3MWYW 1U4RA 4QUCA 1OO9B 1SNDA 2JSOA 5EPJA 2Z4IA 2WB1B 2NTTA 2VB2X 3R2TA 1S4ZA 3M4YA 5I4DA 2L1BA 2IT1A 3OPOA 2L0CA 4RKLA 4ILWA 1EFID 4IUNA 1E2ZA 4DK1A 1CFMA 1HPCA 2KCNA 1I4GA 2KUMA 1D2BA 4X3KA 3AU7A 4NP5A 5D3IB 1A3UA 2AQ3B 4DFAA 3A8JE 2B2TC 3K59A 1V1OA 2ICEC 4ABNA 4K6DA 3GD7A 5IGFA 3HOVB 5K36G 3D4RA 1TS4A 3D4WA 2J0TD 1VCIA 1B44D 3TZDA 3VR2A 4K5XA 1SYGA 4O42A 4OIJA 4IFDI 2RSNA 1PLFA 4KHVA 2XIWA 4XT3B 2IWHA 1GHKA 1LACA 2NVTB 1SYCA 2FJ2A 2E2HB 2OEOA 4K5VA 3OWFA 4KD3A 3A7LA 4LJZC 3FMCA 4XIGS 1B3AA 3A55A 3SXHA 2DY8A 2E76C 3I73A 2EY1A 2O5IC 5E4XA 1STEA 1OXTA 3PUYA 2SOBA 3BVZA 3TMEA 1JWMD 3A8KE 3MFYA 5ELBA 3VYRA 1BCPB 4HMIA 3BZDB 3Q22A 1X3PA 1RF2D 2WP8J 5JVG3 4BA1I 3T51B 3SK6A 4QF4A 4BBRB 3MC0B 5FO9B 1LO5D 2NN6H 4UAIA 1CTMA 1D5MC 2DNCA 5DNFA 2F0EA 1RD9D 1Y69U 1XWEA 1LV9A 4KKTA 2PZWA 3O13A 3PIO3 2B39A 3FPUB 5IGDA 1EZ8A 1NCVA 3I4NB 5T1IA 3GTPB 5G3LF 3LNNA 4F87A 5M5YB 2C9OA 3L3OC 2XWBB 2DNEA 5JEAG 2F0JA 1EY7A 2B2TA 4RGNA 1STBA 2JYOA 2K32A 4C1NK 4A3EB 1TWCB 2K01A 4HR7B 3SDZA 1L0XB 3LX0A 2B2UC 3GO5A 4G7HC 1LLRD 4DAYA 3DWPA 1ZXTA 1DJRD 1LT4D 3K5MA 4TSSA 4OO1I 1CM9A 5CMDA 4Q5VA 1UAPA 1I4RA 3J7AF 1Y8OB 5ELFA 1SMYC 3J80E 3BVGA 1RCVD 2J4XA 2A73B 1BNZA 4RWSC 4ZAIA 5I9OA 4RHRA 2HDMA 1EIHA 3PUZA 1SE2A 3ZYYX 1TQOA 3S2DB 3PMFA 1SEBD 3I3CA 1X32A 3EFXD 5K36H 2EDGA 4OO1H 5CV4A 3K58A 5KRUA 2F3VA 3KUPA 4CKEA 3GTKB 3RLFA 2NBFA 3MEHA 2EJMA 1DYQA 4A3BB 2DN8A 2EPBA 2KEDA 4F8MA 2BE5C 3M7GA 1I4QA 3K57A 5HGTA 3TP5A 2AQ1B 5DM63 2OT2A 5EKLA 4PQXA 5LL6X 2Z1CA 1HTPA 2HQEA 3X3MA 1YNJC 1TY2A 4S3SA 3T4AC 4RGOS 3MXGA 3C1EA 3MXPA 5C6AA 2B2WC 1FNVA 1EEID 1HQMC 2IJ0A 5C0XI 2LMCB 4JK1C 2KOLA 1ESRA 2A6HC 1O80A 3NBIA 3CQZB 1H9RA 1GJXA 1H9MA 4DF7A 3QOJA 5ISRA 3EVQA 3I91A 1KDAA 1Q12A 2D62A 2O2LD 4RCNA 5NUCA 1JWSD 2MP1A 1TS2A 4IFDJ 1TY0A 3KBXA 2B2UA 4ZUIA 3I4LA 3SK5A 1PFMA 4ZLTF 3K0YA 5C4ZA 1VDZA 1HA5A 2Z4HA 1Y8PB 3T13A 4A3GB 4IZ8A 1F2LA 2KQ3A 1Q90A 2BCOA 2WIIB 1D6EC 1VMPA 1BOSA 5CBEE 1E2WA 3VA7A 4ULLA 1EWCA 1U4PA 4PNYA 3GP7A 5IOCA 2DY7A 4A3MB 5KNDA 3HZXA 1GUWA 4QCLA 4WORA 2PPBC 1LTGD 3S17B 2EYMA 1ZYRC 4RCOA 2K5WA 4OGQC 4ODGA 1Q1EA 3H09A 2K04A 3V2TA 4Y7NB 1PRTB 2F0HA 1TKWB 1A6XA 1PTOF 2XRQD 2OXPA 1JR0D 3TSSA 4R9WA 3TN2A 4L63B 4C2MB 1IKMA 2N55A 2PZTA 4RAUC 1X3QA 1JQYD 1XXGA 2MHVA 4U68A 5KGUA 2AUJD 5DEHA 2B2WA 5M5WB 1CHPD 5CV8A 1CI3M 4KHZA 2NTSA 5F2DA 2PZUA 1VF5C 5KYIA 2IX1A 4YIJA 3UI2A 1Y1VB 1JCKB 1R4PB 3KF8A 3TDQA 5CV5A 2EYHA 1HXYD 1S5DD 5G3LD 4EVOA 1ET9A 2L12A 1H9SB 4CHTB 2QILA 4A3JB 4CGYB 3GTLB 1ILQA 4LAAA 2PNRC 3C2PA 3R3OA 1C8CA 4IUTA 3VR3A 2EZVA 3MZ5A 4UDUC 4IFDG 4OL7A 2ZXOA 1Z47A 2RDGA 4F7XA 4G4KA 3VR6A 4WFN3 3AB9A 5J22A 4B9XA 3EA6A 4IUVA 3RZDB 2PQEA 2VB3X 3P20A 1G6ZA 4N9TA 4FXKC 1HTLD 3I4MB 1WCMB 2AWNA 2SNMA 4K8IA 4KY5A 1RDPD 3U9SA 1EIGA 4O1NA 3CHBD 1STNA 3W2DA 4XQJA 1C4QA 2XSCA 2PO4A 3OIPA 1STAA 3NTHA 4PMWA 3H0GB 2AUKA 3NBHA 3R8BA 2RA4A 1F9QA 1U9RA 4RGMA 1TR5A 3QJYA 2V4DA 2JA7B 2F0WA 3S14B 1JOKA 4H44C 3GQBA 2RVLA 1II3A 1I50B 3KK7A 3DWQA 2LY7A 3NQIA 1EY5A 3P1HA 1JORA 1CZGA 2NB0A 5I6WA 2F0GA 4X3UA 5C0XJ 2WV6D 1A15A 2MPMA 2ZXRA 5FLXE 2L4NA 1AP0A 3G7LA 2F0NA 1F2MA 4XDXA 4IQZA 2R7ZB 1AW7A 4DU9A 1ZKOA 5EPKA 3RMHA 1B50A 3BVMA 1O78A 4CBVA 4PMCA 3NE5B 5J1ZA 2PW5A 2MGSA 2A6EC 3NQTA 3GTOB 3S1QB 5J39A 5K5PA 2B2VC 1R4QB 2FINB 3QG1A 2X69A 4X3TA 1SJED 5C5LA 1BQQT 3N52A 4DXFA 1G291 3OIQA 1CHQD 1SMYD 4OO1G 5EKKA 4QUFA 2RBMA 4RFBA 1QILA 5CV7A 1HRJA 1BXTA 2KECA 1B2TA 2LS01 4CJ0B 4ZK9B 1ENAA 1CK1A 5HURA 4DGZA 2XWJB 2R6GA 4R8IA 3DWAA 1K8OA 3NSWA 1RHPA 2K7VA 4KTAA 3NTIA 1HA6A 2VNUD 1HUMA 4EQPA 1B1ZA 3E6ZX 3TP8A 3MXUA 1QJOA 2JXMB 2D2CC 2BE5D 4KKUA 2ZT9C 4IFDH 1AZQA 5JAVA 2F0QA 5E1FA 5CV9A 3TBIB 1H9JA 4ZKBB 4KKSA 1YNJD 3DMUA 1DONA 4RHSA 1EY8A 1RTOA 3NK9A 2PW7A 5LHY1 1PRTD 2ENBA 2A6HD 1EY9A 3SK8A 3W3AA 3A56A 3QOLA 1Y1WB 1MGSA 1IKLA 5C0XG 1F2ZA 1T5XD 1ZEQX 1E0BA 4NKLA 2KCCA 4R8NA 1R9TB 5D65A 2IX3A 3NP8A 1EY4A 1G2TA 5IGCA 4A3FB 3M3YB 3IL8A 1J9OA 4FF2A 5IIFA 2A69C 4NW2A 1KAAA 2XNAC 3FKIB 2JA6B 3FPPA 2KJXA 2VXWA 1GOZA 2B2VA 1EU3A 1Z7TA 3I72A 4A3KB 4EQNA 2WINB 3LWEA 1EWHA 4XT1B 1OXXK 3M4OB 3J81L 4QIWB 3J7YW 1NR4A 4PV1C 4LK1C 4KV6A 1NUCA 4Q0FA 4FXGC 1L0YB 4NMZA 3SHLA 1JWUD 1F9PA 3T53B 3KLRA 1B9MA 3URYA 3IAYA 4I7ZC 2QKIC 1K83B 4A3DB 2KHSA 1QOHA 3V96A 1CQVA 1EQVA 1PTOH 1IHZA 3TP6A 4A3IB 3PIP3 1STYA 2K33A 1GUNA 4KK7A 1ICWA 2Q8RE 2SDFA 1M4VA 1ZYRD 1LABA 3S16B 1SNOA 4FF3A 2XVSA 3E5SA 3A7AB 1KTKA 1S5CD 1LTBD 3DEPA 5A2QL 1TS3A 2GA4B 4DAVA 1KDBA 1PZJD 1KNAA 1TWFB 5CBAE 3OSOA 5I2YA 2AWOA 1SDFA 3RZOB 1F77A 2JEAI 3GTGB 4FP5D 1LTTD 4ZRZA 4XYQA 4C3IG 3SK4A 1SJHD 5AFWA 5E4WC 3NWTA 4QB4A 2F3WA 4V0BA 5IODA 5ELEA 4M8AA 5CV6A 1OXVA 3H6MA 1V1PA 2L55A 4KN4C 1DD2A 1H9KA 3NUCA 2FHTA 4RKBA 3ERQA 3BDCA 4BBSB 3NWSA 1HCZA 5I2XA 2IW3A 5IGBA 1ONLA 1S5FD 1O7YA 1PTOC 4H13C 3A8IE 1CZWA 3HRZC 5EKIA 1MSHA 4M1UB 1O7ZA 1HHVA 1WTWA 3E0JA 4IURA 1D5XC 1SNCA 4DN4M 3VA5A 2EOTA 5JPMC 3S1NB 4TKOB 1IYUA 1WTVA 2E2DC 2EYJA 2Y0SB 4DNRB 3OMCA 2CHBD 2FMCA 3HOUB 3D31A 4X3SA 1WTXA 4J8QA 3MFGA 3VYTA 5C0XH 1MSGA 3F2UA 1B9NA 2EYLA 1DCZA 1Y8NB 3T16A 1Q8IA 5EQ0A 3T56B 3VR4A 3FVQA 1EOTA 2Q8TA 2IPKD 4KMUC 2EYFA 5IGGA 1T5EA 4XTCS 4OHJA 1DOMA 3H94A 4BY7B 4Z9CB 1GHJA 1FYCA 2ID0A 1UEAB 3HEJA 5IT9L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CV7 A;  4QMG A;  3SXH A;  4DFA A;  1STA A;  3NUC A;  4RKB A;  3ITP A;  2F0D A;  3S9W A;  2PZT A;  5CGK A;  5KEE A;  2EY1 A;  4KJO A;  4EQN A;  3U9O A;  1EY6 A;  3ERQ A;  2F0T A;  2O4X A;  2F0U A;  3NXW A;  4DF7 A;  3QOJ A;  1U9R A;  3BDL A;  3D8G A;  3P75 A;  2LKV A;  2SOB A;  3C1F A;  3EVQ A;  2F0P A;  1KDA A;  4KY7 A;  5ISR A;  3BDC A;  2SNS A;  4J6H A;  4KY6 A;  5KGU A;  1SYB A;  1AEX A;  1TR5 A;  3TME A;  3TP7 A;  4KD4 A;  1F2Y A;  4KV6 A;  5DEH A;  1ENA A;  1NUC A;  3D6C A;  5IGB A;  1SNP A;  4DGZ A;  5HUR A;  2EYO A;  2F0W A;  4KJN A;  1JOK A;  4HMI A;  4NMZ A;  5CV8 A;  5E1F A;  5NUC A;  3SHL A;  5DAU A;  5F2D A;  2PZU A;  3ERO A;  2OF1 A;  1II3 A;  1SND A;  4I65 A;  4IAL A;  5KYI A;  4ZUI A;  2WAC A;  4K2L A;  4YIJ A;  4N9P A;  4KTA A;  5M9O A;  3SK5 A;  1KDC A;  1EYC A;  5IGD A;  2NUC A;  2KHS A;  5C3X A;  1SNQ A;  5CV5 A;  3SK6 A;  1EY5 A;  2F0K A;  1EQV A;  4K8J A;  3P1H A;  4EQP A;  5I9O A;  1JOR A;  4QF4 A;  5C4Z A;  2M00 A;  4G57 A;  4RKL A;  3TP8 A;  2EYH A;  2F0M A;  4B9W A;  1SNC A;  1TT2 A;  2F0G A;  1EYA A;  3VA5 A;  1IHZ A;  1A2U A;  5I6W A;  3OMG A;  2EY5 A;  4IUN A;  5KIX A;  1TQO A;  4HTH A;  3PMF A;  3TP6 A;  3H6M A;  3T13 A;  4EQO A;  4EVO A;  1EYD A;  4IZ8 A;  1STY A;  1STH A;  2EYJ A;  2F0E A;  4K5W A;  1JOQ A;  5I6Y A;  2RDF A;  2EY6 A;  1A3V A;  4K2K A;  2KQ3 A;  1SYF A;  1SYD A;  5JOB A;  5IGE A;  3OMC A;  5JAV A;  2F0N A;  5CV4 A;  1F2M A;  2F0Q A;  1SNO A;  1ENC A;  4NP5 A;  5KRU A;  1A3U A;  5CV9 A;  2PZW A;  2F0S A;  2F3V A;  1A3T A;  4H7B A;  4TRD A;  5CR3 A;  4LAA A;  4ZQ3 A;  5J39 A;  1EZ6 A;  2EY2 A;  2F0O A;  5CC4 A;  4DU9 A;  3R3O A;  1EZ8 A;  3DMU A;  3E5S A;  4K6D A;  3NHH A;  3SR1 A;  5C4H A;  3MEH A;  4K14 A;  3MZ5 A;  4ID6 A;  5C3W A;  4WRD A;  3QB3 A;  1EY8 A;  4OL7 A;  4PNY A;  4PMC A;  5IOC A;  1KDB A;  5J1Z A;  1RKN A;  3NK9 A;  5IGF A;  2PW7 A;  2F0L A;  4F8M A;  5I9P A;  2PW5 A;  3D4D A;  3HZX A;  4F7X A;  3D4W A;  4MIU A;  3NQT A;  4ZUJ A;  2EYL A;  3OSO A;  5C5M A;  5HGT A;  4NDX A;  2ENB A;  4ME5 A;  3TP5 A;  2PYK A;  4WOR A;  4B9X A;  1KAB A;  5K5P A;  4PMB A;  5J22 A;  1EY9 A;  1NSN S;  2RKS A;  2PQE A;  3SK8 A;  3T16 A;  2EYM A;  4K5X A;  1SYG A;  1SYE A;  5EKL A;  3QOL A;  4N9T A;  3DHQ A;  4KHV A;  2F0I A;  3RUZ A;  5KYL A;  4E6I A;  4ODG A;  1F2Z A;  2F0J A;  1EY7 A;  3MHB A;  5EKK A;  2EYP A;  5E3F A;  5EGT A;  4HMJ A;  2HQE A;  4NKL A;  1STB A;  3V2T A;  3SK4 A;  2EYF A;  4R8N A;  5C5L A;  1EY0 A;  4J1M A;  5IGG A;  1SNM A;  2F0H A;  2SNM A;  2F0F A;  1SYC A;  3NP8 A;  1EY4 A;  4K8I A;  2EXZ A;  4KY5 A;  4S3S A;  1STG A;  4QB4 A;  5IGC A;  2OEO A;  3C1E A;  3MXP A;  4K5V A;  5C6A A;  2OXP A;  1A2T A;  2F3W A;  3MVV A;  5IOD A;  3OWF A;  1STN A;  3EJI A;  1JOO A;  4KD3 A;  2F0V A;  5IIF A;  5CV6 A;  3HEJ A;  3LX0 A;  2QDB A;  1KAA A;  2RBM A; 
#chains in the Genus database with same CATH topology
 2D0P A;  1SBB B;  4MTN A;  4HED A;  4QMG A;  1BF4 A;  2QCP X;  1EWI A;  2RDH A;  3AEV A;  1OXS C;  1HNZ Q;  4KJO A;  3HP3 A;  2ASB A;  4JI1 L;  1I94 Q;  3MA2 B;  1DZ1 A;  1AH9 A;  5JJK A;  4IPD A;  5EBC A;  2SNS A;  1DXM A;  3JC6 6;  2F03 A;  2NVY H;  3TP7 A;  2K05 A;  3UE0 A;  1Z6H A;  3KF8 B;  4DV3 Q;  1RTN A;  5DAU A;  5IE8 A;  2WAQ B;  3S15 B;  1ROD A;  4AYB G;  2J7Z A;  4ZKC B;  5M9O A;  4FO2 A;  2RF4 A;  2KVM A;  4RGT A;  5EJW A;  2Z6K C;  4DAM A;  4BA2 I;  1PMR A;  3HKZ B;  2TSS A;  3GV6 A;  4IUQ A;  1X9N A;  1D5Z C;  1GUO A;  1WD1 A;  2F4V Q;  2A6E D;  2JEB I;  1CKM A;  4EQO A;  1IBL Q;  4EX5 A;  4DR1 L;  1V8Q A;  5C4J B;  4UP8 A;  4JI4 L;  4DR4 Q;  4HSP A;  5I6Y A;  2A74 C;  2EY6 A;  2YU9 H;  1KL9 A;  3PO2 H;  1TWA B;  4MN3 A;  3TEH B;  4YHH Q;  4X65 L;  1VF7 A;  1MD2 D;  4LFA Q;  1UEB A;  1BR9 A;  2NVQ B;  4P75 A;  3A74 A;  4C3I H;  3SEB A;  4GKK L;  3HOV H;  2VUM G;  5A35 A;  3D4D A;  1FNW A;  1S5E D;  5C5M A;  3TS2 A;  5ELN A;  1VQ6 A;  4V19 0;  3ND9 A;  1GUS A;  1TS5 A;  3CME A;  1GUT A;  2NYZ D;  3H91 A;  1GXD C;  5C3E B;  1AFP A;  5EGT A;  1A8V A;  4FF1 A;  2KBN A;  3OOC A;  2E5L Q;  4P73 A;  4CDF C;  2NVT H;  4J1M A;  3S1M B;  1IW7 C;  2EJF C;  2F0F A;  2PNH A;  1BVS A;  3HKS A;  3F2D A;  1EOV A;  1M8A A;  2L9H A;  2PCF B;  3EJI A;  4A3L H;  3NBH B;  3X3N A;  1SRO A;  4K5W A;  3K7A B;  5M3M H;  2B29 A;  2MO1 A;  1QWY A;  2EIF A;  1SAP A;  2GVA A;  2F0U A;  4CKB A;  1E22 A;  4DR4 L;  1AEX A;  3PIP A;  1F2Y A;  3OTO L;  3CPW A;  1SMX A;  1QZH A;  1I6H B;  3GTJ B;  3OWE B;  4G7O C;  3Q6S A;  4L6T B;  3DEO A;  3T1H Q;  5TSS A;  4LFA L;  4BY1 B;  1FD7 D;  3FEW X;  1QB5 D;  2BA0 A;  1JJC B;  1AZP A;  1W6K A;  1VQ9 A;  2JA5 H;  3CU7 A;  1E2V A;  3HOX G;  2NVX B;  4G57 A;  3S2H B;  5FOB B;  2F0M A;  3OMG A;  2EY5 A;  4GN3 B;  4JVZ A;  3D6W A;  4LW1 A;  3CRL C;  5C44 G;  1FR3 A;  4P71 A;  1SYD A;  1VQM A;  3HGB A;  1ENC A;  1Q1B A;  3WOF A;  2JP1 A;  1LTA D;  1EZ6 A;  2XN9 C;  2Z6K A;  3I90 A;  1B7Y B;  2QEJ C;  3CMA A;  1X3F A;  4JW0 A;  3QB3 A;  2K14 A;  2M2L A;  2WKD A;  4L8J A;  1N32 Q;  2R92 G;  1XNR Q;  3EIV A;  5M5Y H;  3DUZ A;  2X6L A;  3OW2 A;  3L9A X;  1NSN S;  4A93 B;  5IP7 H;  4JI5 L;  3M4P A;  4DV1 Q;  1TWG B;  4LF5 Q;  1PDQ A;  2F0I A;  3QWN A;  3FDT A;  2PMZ E;  1HFG A;  2L5T A;  2LXJ A;  1CKN B;  3TZU A;  2RCN A;  2K6A A;  5CR3 A;  4ZQ3 A;  2NVY B;  3DLL A;  4NXM L;  1WTH A;  1I6V C;  1TWC H;  4A3E H;  1XJV A;  3QO2 A;  5LMN L;  3ND8 A;  3SGI A;  2ZM6 Q;  1U0L A;  2F0V A;  1ICF B;  2PQA B;  2QDB A;  5C4X G;  3SE0 A;  1G8Z D;  2WKC A;  1KRT A;  2KEN A;  3TS0 A;  1CA5 A;  1K3B C;  1BCP C;  3UE1 A;  2G9D A;  5GAG C;  1DOK A;  2YTX A;  3HG9 A;  1K9M C;  2LKV A;  2F0P A;  5JEA J;  4KY6 A;  1IZ6 A;  3J81 c;  1VQ7 A;  1QVG A;  3D6C A;  3W5O A;  4KJN A;  1XTD A;  4CJ2 C;  4LF7 L;  4GKJ L;  5IT9 E;  1U4L A;  2YU9 B;  2OF1 A;  3FP9 A;  3PO2 B;  3CRK C;  5COR A;  4XYO A;  5JJZ A;  2WAC A;  5M5X B;  2VQF Q;  2UUB L;  5C3X A;  1PFB A;  1N32 L;  3K81 C;  1XNR L;  3JAM L;  3CC2 A;  4K0K L;  4C3I B;  5M3F B;  1IYJ B;  3IFT A;  3S2D H;  1VMC A;  4EGV A;  5D14 A;  1JT8 A;  5J3B A;  4IUP A;  1WJJ A;  1VQL A;  2VUM H;  4K2K A;  1N36 L;  5IGE A;  3PCO B;  3K80 C;  2K5D A;  4ZYS A;  1FNU A;  1K0R A;  1HZC A;  4L5T A;  2F0S A;  1BDO A;  2A68 C;  3GTK H;  2EY2 A;  4DAP A;  5CC4 A;  1XYI A;  3VR5 A;  1YNN C;  2ZM6 L;  4B3S Q;  4A3B H;  3G6J B;  1RKN A;  3HOY G;  1OXU A;  3MTS A;  2B63 G;  4L5Q A;  4MIU A;  1G91 A;  3KJO A;  3SVM A;  5M3M B;  4PMB A;  1JE4 A;  2NN6 I;  5BN4 A;  1Q82 C;  1MBY A;  3PUX A;  3L7Z C;  3BYT B;  2O5J C;  1DM0 B;  3VYU A;  2K75 A;  1OTC A;  3MHB A;  3C46 A;  4YWK A;  3BYY B;  4HMJ A;  3KLS A;  4I7A A;  4JYA L;  3NEL A;  4AQY Q;  4JI2 Q;  1L1O C;  2RQX A;  3I70 A;  4XQN A;  3GTQ B;  2F1M A;  3BZK A;  3RN2 A;  1JOO A;  4R4C A;  1BUV T;  1PTO D;  5FKA C;  4B3T Q;  1WCM G;  1BCP F;  4IPG A;  4MNO A;  3GV3 A;  4YY3 L;  1YIJ A;  1RJT A;  2KHJ A;  1TXY A;  2K4K A;  3CQZ H;  1SSO A;  3CCJ A;  2JA5 B;  1EY6 A;  1NAP A;  2F0T A;  3BDO A;  5CYU A;  1I3Q B;  2M9V A;  1VQN A;  3BDL A;  4KY7 A;  3P75 A;  4C3H G;  4DUY L;  1VQJ A;  2BH8 A;  1KC8 C;  2VQE Q;  1G2S A;  2B8G A;  1SE4 A;  4R4T A;  1F9R A;  3MXN A;  3HOZ G;  2B2Y C;  2E2I H;  4N9P A;  5C44 H;  5GAH C;  1KDC A;  2NUC A;  2KHI A;  4C3J G;  2R93 B;  1C9O A;  1SNQ A;  4K8J A;  3BG3 A;  5T1G A;  3CP0 A;  1QE6 A;  3K5N A;  4P72 A;  2CW0 C;  1RIP A;  5KIX A;  1B4O A;  2I0Q A;  1GUG A;  2AQ2 B;  3HOW G;  1UUP A;  2UXD Q;  4A3G H;  3M7N A;  2SEB D;  4GN5 A;  4IN3 A;  2I07 B;  1YEZ A;  3H3V I;  2R92 H;  1HQR D;  2C5C A;  5JOB A;  2DJG C;  4C1N I;  2CWP A;  4HJA A;  4Y52 H;  4K6L A;  3EQL C;  4PG3 A;  4JBM A;  1VQG A;  3P7J A;  1X3G A;  3CAM A;  2RCF A;  4K14 A;  3K5L A;  1WVL A;  4P74 A;  3RD4 A;  1UNS A;  2JA8 B;  3LWU A;  1D1I A;  3BS1 A;  4A3M H;  2HCI A;  2HCC A;  2F0L A;  3D0F A;  1FGU A;  4RA8 A;  1PFN A;  1RL2 A;  1IL8 A;  4HAE A;  2WB1 G;  3S17 H;  3Q8D A;  1S40 A;  2F4I A;  2L11 A;  1B8A A;  1CA6 A;  2K03 A;  3T1Y L;  3DHQ A;  4FXD A;  4DV0 L;  3OW7 A;  4LMQ D;  4OIK A;  4AYB B;  3ULJ A;  2EJG C;  2B3G A;  2N3S A;  4Y7N H;  1BBU A;  3ULL A;  2HT1 A;  2ZXP A;  1EY0 A;  4TQU S;  2E2J B;  1V1P B;  2PI2 A;  2D9U A;  4DNT B;  2LXK A;  3MVV A;  3KOJ A;  4H0L C;  1ILP A;  4R1J A;  2AHO B;  3CKI B;  3I8Z A;  3NHH A;  3E3X A;  1CQF A;  2UXC L;  1B3Q A;  4DXG A;  5IT9 c;  1VQ4 A;  2F0D A;  4NPS A;  3S9W A;  2CQA A;  2TMP A;  4A76 A;  3B6Y A;  5KEE A;  2A8V A;  4X64 L;  3U9O A;  1YHQ A;  3KF6 B;  3ONA B;  2DJF C;  2X6G A;  3Q23 A;  2UXD L;  1ASZ A;  2YYZ A;  1XMQ Q;  4HCE A;  3EN2 A;  4JI0 L;  4J6H A;  1SYB A;  1L1O A;  2BDO A;  5AJ3 Q;  4KD4 A;  1CUK A;  1SNP A;  2VUM B;  2BOS A;  1XX8 A;  4FNF A;  5ELC A;  5GAE C;  1PH2 A;  2LSS A;  3CCR A;  2F0K A;  3J81 j;  1D1K A;  1X54 A;  4CJ1 B;  3OHX C;  5HY6 A;  1HR0 L;  1TT2 A;  1JB3 A;  2CKZ B;  1C48 A;  3D3R A;  4HTH A;  3NTK A;  1W6J A;  5KNC A;  2R61 A;  3M85 A;  3NPP A;  4NXN Q;  3HOY H;  1SYF A;  2B2Y A;  2CVR A;  4HN7 A;  4KN7 C;  2JE6 I;  4A3J H;  1NR2 A;  2RSO A;  1K8M A;  3K5O A;  2EE1 A;  5FO7 B;  2Z9H A;  5I9P A;  1Z9F A;  5FO8 B;  2MUY A;  3JAM E;  1TVX A;  3S1R H;  2UU9 Q;  1IW7 D;  1I4X A;  4WRD A;  5C3W A;  1PZK D;  2FFK B;  1VQF A;  1VQ8 A;  3U50 C;  1WTO A;  2K1B A;  1WTR A;  4NDX A;  1PRT C;  5EBD A;  4MHE A;  3H3V C;  2HQL A;  4FF4 A;  5LL6 S;  3V05 A;  1ML0 D;  1GO3 E;  4BBR G;  3I4M H;  1WCM H;  1XMQ L;  5JPN C;  3HS0 C;  4FYD A;  5E3F A;  3PV0 A;  2HDL A;  1O7L A;  1BBW A;  3L2P A;  1YIT A;  5LMU Q;  3GTM B;  3HOX B;  1SNM A;  2FXQ A;  4U67 3;  3I7F A;  4CDD C;  3KBG A;  3CCM A;  1A2T A;  3KFU A;  4LFC L;  5FLX L;  1SFO H;  5IT9 L;  3PQI A;  2UUA Q;  3PO3 B;  2E2I B;  5C44 B;  2NZ1 D;  5JVH 3;  3WDN A;  3ITP A;  5BN3 A;  3HOZ H;  5CGK A;  3I4N G;  3H0G H;  1MJE A;  4HIO A;  2UXB Q;  3D8G A;  2BA1 A;  3QIA A;  3C1F A;  3EBE A;  1IYV A;  3PGZ A;  3AYH B;  1EIY B;  1VQA A;  1NMG A;  4F88 A;  1WTQ A;  4JI3 L;  1PA6 A;  1SXT A;  2JA7 H;  2EYO A;  3S14 H;  4HCS A;  1AN8 A;  3RR5 A;  2H4O A;  1ESF A;  4XXE A;  1GVP A;  1T9H A;  2R92 B;  3ERO A;  4I65 A;  1I50 H;  2Z0S A;  1TU2 B;  4K2L A;  4DA2 A;  3Q24 A;  5FK9 C;  4DV2 Q;  1LT6 D;  4DR3 L;  3KLS X;  1EL0 A;  2QGQ A;  4PZ7 A;  4HJ9 A;  3A5U A;  5JEA H;  5D3D A;  4RH6 A;  4A3E G;  4B9W A;  1FGB D;  1EYA A;  1PTO B;  1QNU A;  2Y0S E;  4IJH A;  2K28 A;  1HUN A;  3AMU A;  3DXJ C;  2QW7 A;  1PXU A;  5KNB A;  1LTL A;  4B08 A;  4MTK A;  4H02 A;  3KLW A;  1JOQ A;  4DK0 A;  2IL8 A;  1LM0 A;  1YBY A;  1DOL A;  2KA7 A;  5C4X B;  5LMU L;  1WTP A;  2R7Z H;  2L15 A;  3IFD A;  1QNK A;  4HSV A;  1A3T A;  4H7B A;  4IPC A;  4TRD A;  1ENF A;  4DR6 Q;  2IX0 A;  3NEM A;  1LT5 D;  3SR1 A;  3J81 E;  1S5B D;  1JC7 A;  1PRT F;  1LTR D;  4BWG B;  2Q2T A;  2OWO A;  3GTO H;  4UHV A;  1TII D;  4ME5 A;  1J6Q A;  2PYK A;  1KAB A;  2Z8L A;  2RKS A;  2LFN A;  4LF9 L;  4BS9 A;  1SYE A;  1PZI D;  3J80 c;  1BCP D;  4LUV A;  3RUZ A;  5KYL A;  4E6I A;  1WD0 A;  3TRE A;  1NBW A;  1JIC A;  1I4P A;  2B8F A;  1NMF A;  1LT3 D;  3I55 A;  1I4H A;  2G9H D;  2HHH Q;  2EXZ A;  3J81 i;  2ZJQ A;  1KLU D;  3PSI A;  4AH6 A;  1B53 A;  1F9S A;  2FMM A;  3ERS X;  1HH2 P;  1YNX A;  3K6O A;  2KEE A;  1HNZ L;  4HJ7 A;  1LTS D;  4IJL A;  1I94 L;  1XTC D;  2HD3 A;  3U58 A;  3IKJ A;  4A3B G;  4UP7 A;  4XQQ A;  3NXW A;  2O4X A;  2R7F A;  3FRP B;  1KNE A;  3F1Z A;  4GNX C;  3WOE A;  1PYW D;  5A2Q E;  4DV3 L;  2R3Z A;  2EVB A;  4JI6 Q;  4CKC A;  1L2F A;  2E2H H;  1QCB D;  3A54 A;  4GS3 A;  3J7Z C;  2VS1 A;  1W3S A;  3HOY B;  2D5D A;  2XRS D;  4G7Z C;  4DK3 C;  2B63 B;  1EEF D;  4IAL A;  3N6R A;  4UY8 C;  5ELD A;  2Q2U A;  2H5X A;  2A68 D;  4LF8 Q;  1EYC A;  3M9B A;  1SE3 A;  4FVM A;  1YNN D;  1C0A A;  2M00 A;  3S1R B;  2E74 C;  2F4V L;  1YHB A;  2K5Q A;  3MAQ A;  4QL5 A;  4EQ5 A;  1IBL L;  1A2U A;  1EQT A;  3JAM c;  2A5H A;  1U4M A;  1CSQ A;  1PH3 A;  3PUV A;  2BDN A;  4JBW A;  1EYD A;  1MI2 A;  1TWH B;  1STH A;  1EU4 A;  1PH1 A;  2I5M X;  2RDF A;  4YHH L;  1A3V A;  5EPL A;  5IP9 G;  2CH4 W;  1KLG D;  4QJF A;  2HHH L;  3R2I A;  5COY A;  2F0O A;  2N88 A;  2Q8I B;  4BBR H;  3UDG A;  2NN6 G;  5C4H A;  1H9S A;  4ID6 A;  4KI0 A;  4WJW A;  3J7A V;  1LTI D;  2AKW B;  1PH4 A;  2QF7 A;  2PMZ B;  2Y0S G;  4C3H B;  1AE2 A;  2ICI A;  1DGS A;  4L5S A;  4ZUJ A;  2RHS B;  1SFO B;  1UE5 A;  2VY3 A;  3DM1 A;  3R93 A;  3C3L A;  5DM7 3;  3HOZ B;  2E5L L;  1VQB A;  2P5Z X;  4X6A H;  1KXL A;  1Q86 C;  1CT1 D;  2EYP A;  1BO0 A;  3L0O A;  1KD1 C;  4C3J B;  3U4V A;  1R9T H;  3I4N H;  4IUU A;  5IY0 A;  2E75 C;  3GTP H;  1J8I A;  1STG A;  3M3Y H;  4A3G G;  4DV5 Q;  2H1E A;  1HFN A;  3KYH C;  2MJ8 A;  2I46 A;  4C56 C;  2K5V A;  3OYY A;  4YWL A;  2A69 D;  1ET6 A;  1Q3L A;  3VYS A;  3HOW B;  2JA6 H;  1V43 A;  3J80 L;  2BH2 A;  4P2C B;  5BN5 A;  2HUG A;  2NWG A;  2ZTE A;  4OXP A;  1K0S A;  4LUO A;  3PUW A;  3Q0A A;  1PH9 A;  3M4O H;  3ZJY C;  4A3M G;  2CW0 D;  4GZY C;  1QG7 A;  1BBX C;  3T1H L;  3MWY W;  2Z6B A;  2MO0 A;  1U4R A;  3F2C A;  4QUC A;  1OO9 B;  1SND A;  5DLQ E;  2JSO A;  2YV5 A;  1Q7Y C;  3CPF A;  5EPJ A;  2A19 A;  4DR2 Q;  2Z4I A;  2WB1 B;  4A3D H;  1HJP A;  1IBM Q;  2NTT A;  2VB2 X;  3R2T A;  1S4Z A;  3M4Y A;  2IHF A;  5I4D A;  2L1B A;  2IT1 A;  3OPO A;  2L0C A;  4RKL A;  4ILW A;  4GNX A;  1EFI D;  4IUN A;  1E2Z A;  4DK1 A;  1CFM A;  4CDE C;  3CF5 A;  1HPC A;  1UWV A;  1I4G A;  2KCN A;  3S16 H;  2KUM A;  1D2B A;  4X3K A;  3AU7 A;  4NP5 A;  5D3I B;  1A3U A;  2AQ3 B;  4DFA A;  3A8J E;  2B2T C;  3K59 A;  4YCV A;  5ELO A;  1V1O A;  2ICE C;  4ABN A;  1W2B A;  4K6D A;  1MKH A;  3GD7 A;  5IGF A;  3HOV B;  5K36 G;  4OX9 Q;  1TWF H;  2CH4 A;  1XMO Q;  3D4R A;  1TS4 A;  3D4W A;  1Y1V G;  4DV1 L;  2J0T D;  1VCI A;  1B44 D;  4LF5 L;  3RZO H;  3TZD A;  3VR2 A;  4K5X A;  1SYG A;  4O42 A;  4OIJ A;  4IFD I;  1QUQ A;  3BZC A;  2RSN A;  1PLF A;  4KHV A;  1KQS A;  2XIW A;  4XT3 B;  2IWH A;  1GHK A;  1NJI C;  1LAC A;  4IO9 A;  2NVT B;  1SYC A;  2FJ2 A;  2E2H B;  2OEO A;  4K5V A;  1GKH A;  3OWF A;  4KD3 A;  4DV6 Q;  3A7L A;  4LJZ C;  4JCV E;  4A3J G;  3FMC A;  4XIG S;  1B3A A;  3A55 A;  3SXH A;  4APV A;  2DY8 A;  2E76 C;  3I73 A;  4JI8 Q;  3LGJ A;  2EY1 A;  2O5I C;  5E4X A;  4DR5 Q;  1STE A;  1OXT A;  3PUY A;  3MXN B;  4GOP C;  2SOB A;  3BVZ A;  3TME A;  1JWM D;  3KDF A;  3A8K E;  4A75 A;  3MFY A;  4WJ3 M;  5ELB A;  3VYR A;  1BCP B;  4HMI A;  4GLA C;  2VQF L;  3BZD B;  3Q22 A;  1X3P A;  3I4M G;  4LF4 Q;  4OWX B;  1RF2 D;  2WP8 J;  4GN4 B;  5JVG 3;  1K28 A;  5IP9 H;  4BA1 I;  3T51 B;  1N34 Q;  3SK6 A;  4QF4 A;  4BBR B;  3MC0 B;  4O2D A;  1IBK Q;  5FO9 B;  1LO5 D;  2NN6 H;  4UAI A;  1CTM A;  1D5M C;  1MIU A;  1VQC A;  2DNC A;  2Q2I A;  5DNF A;  1K73 C;  2F0E A;  1RD9 D;  1Y69 U;  4YCW A;  3H0G G;  1XWE A;  1LV9 A;  4KKT A;  2K52 A;  2PZW A;  3O13 A;  3PIO 3;  4B3S L;  1Y14 B;  2B39 A;  3TQY A;  1C7Y A;  3FPU B;  1EZ8 A;  5IGD A;  1NCV A;  3I4N B;  5T1I A;  3G71 A;  1Q81 C;  3GTP B;  2JA7 G;  4R4O A;  5G3L F;  3LNN A;  5EAY A;  3H15 A;  3I4O A;  3PF4 A;  4F87 A;  5M5Y B;  1K8A C;  2C9O A;  5BR8 Q;  4DV7 Q;  3I56 A;  3L3O C;  2XWB B;  2DNE A;  5JEA G;  4AQY L;  2F0J A;  1EY7 A;  5H1S E;  2B2T A;  4JI2 L;  4RGN A;  1STB A;  1JB7 A;  3TRZ A;  2JYO A;  4DPG A;  2K32 A;  4C1N K;  3AFQ A;  4A3E B;  1TWC B;  4HIM A;  3A5Z B;  4B3T L;  2K01 A;  2QA4 A;  4HR7 B;  3SDZ A;  1L0X B;  3LX0 A;  4O0A A;  2B2U C;  5FLX c;  3GO5 A;  4G7H C;  2R7Z G;  1LLR D;  1UE6 A;  4DAY A;  3DWP A;  3J7A 5;  1L1O B;  1ZXT A;  1DJR D;  1LT4 D;  3K5M A;  4TSS A;  5L37 A;  4OO1 I;  2VQE L;  2IY5 B;  4RG1 A;  3E9I A;  3H3V H;  1CM9 A;  5CMD A;  4OEM B;  4Q5V A;  1UAP A;  1I4R A;  2ZTD A;  3J7A F;  1Y8O B;  5ELF A;  4N8X 1;  1SMY C;  4LF6 Q;  3J80 E;  3BVG A;  1RCV D;  2J4X A;  2A73 B;  1BNZ A;  4QIW E;  4C2M H;  1P8L A;  4RWS C;  4ZAI A;  5I9O A;  4RHR A;  2HDM A;  1EIH A;  3PUZ A;  4GOP A;  3ER0 A;  2ES2 A;  1SE2 A;  3ZYY X;  1TQO A;  3S2D B;  4JI7 Q;  3PMF A;  5BR8 L;  1SEB D;  3I3C A;  1X32 A;  3I2Z A;  3RLO A;  3EFX D;  5M5W H;  5C4J H;  4QY7 A;  5K36 H;  2EDG A;  1TWA H;  4OO1 H;  5CV4 A;  1Y1V H;  3K58 A;  5KRU A;  2F3V A;  3KUP A;  4CKE A;  3CCQ A;  3GTK B;  2MNA A;  3RLF A;  2NBF A;  2NVQ H;  3RN5 A;  3MEH A;  2EJM A;  1DYQ A;  4A3B B;  2DN8 A;  2EPB A;  2KED A;  1Q8K A;  4F8M A;  1YJ9 A;  2BE5 C;  4R4Q A;  3M7G A;  1I4Q A;  3G4S A;  2IHE A;  5GAD C;  3K57 A;  1N33 Q;  5HGT A;  4AYB E;  3TP5 A;  2AQ1 B;  5DM6 3;  3G48 A;  2RHQ B;  1D7Q A;  2OT2 A;  5EKL A;  1E7Z A;  4PQX A;  5C3E H;  1K8G A;  3GTL H;  5LL6 X;  2UUC Q;  2Z1C A;  1HTP A;  2ZJR A;  2HQE A;  1H95 A;  2JJQ A;  3X3M A;  1YNJ C;  3S1M H;  1TY2 A;  4S3S A;  3T4A C;  4RGO S;  1VS0 A;  2F3I A;  2ZTC A;  3MXG A;  3C1E A;  3MXP A;  5C6A A;  2B2W C;  4LNQ A;  5IYD G;  1FNV A;  1EEI D;  1HQM C;  3CCU A;  2IJ0 A;  5C0X I;  2LMC B;  2K50 A;  4JK1 C;  2QDL A;  2A1A A;  2KOL A;  1ESR A;  4B3M Q;  3RZD H;  2A6H C;  1PYB A;  1O80 A;  4KHP Q;  3NBI A;  3CQZ B;  4OEL B;  1H9R A;  4JG2 A;  5AJ3 L;  1H9M A;  1X6O A;  4DF7 A;  3QOJ A;  1GJX A;  2OTJ A;  5ISR A;  3EVQ A;  3I91 A;  5FLM H;  1KDA A;  1Q12 A;  2D62 A;  2O2L D;  3STB C;  3JAM i;  3M4Q A;  4YCU A;  4A3C H;  1FJG Q;  1YZ6 A;  1I6H H;  4RCN A;  4CDC C;  5NUC A;  1JWS D;  2MP1 A;  1TS2 A;  4IFD J;  3CCV A;  1Y1W G;  1TY0 A;  3KBX A;  4ZCK A;  2B2U A;  4ZUI A;  3I4L A;  4PZ8 A;  1B70 B;  3SK5 A;  5FJ8 H;  1PFM A;  4ZLT F;  3K0Y A;  4UPA A;  2NVX H;  4HJ5 A;  3U4Z A;  5C4Z A;  1VDZ A;  1HA5 A;  4A3F G;  3S2H H;  2Z4H A;  1NTG A;  1VQ5 A;  4NXN L;  1Y8P B;  1Q46 A;  3FKI G;  2JA6 G;  3T13 A;  4FDB A;  4A3G B;  4IZ8 A;  3KJP A;  3CC4 A;  1F2L A;  1WI5 A;  1M90 C;  2KQ3 A;  1Q90 A;  2BCO A;  2WII B;  4DR1 Q;  4A3K G;  4MZ9 A;  4AIM A;  4JI4 Q;  1WOC A;  1D6E C;  2UU9 L;  1VMP A;  1BOS A;  3GDE A;  5CBE E;  1VQH A;  4TVA B;  1E2W A;  3VA7 A;  4X65 Q;  4ULL A;  1EYG A;  1EWC A;  1U4P A;  1BKB A;  1EQR A;  4PNY A;  3GP7 A;  5IOC A;  2DY7 A;  4A3M B;  5GQO A;  1SR3 A;  5KND A;  3HZX A;  1GUW A;  3RNU A;  3F2B A;  1HR0 W;  4GKK Q;  4KHP L;  4QCL A;  4WOR A;  2PPB C;  1LTG D;  5IYB G;  3S17 B;  1KAW A;  4A93 H;  4A3D G;  2EYM A;  1GM5 A;  1ZYR C;  4RCO A;  2K5W A;  1TWG H;  4OGQ C;  4ODG A;  2JN4 A;  1Q1E A;  2WFW A;  3H09 A;  1S3O A;  2JA8 G;  1X65 A;  2K04 A;  1FJG L;  3V2T A;  4Y7N B;  1PRT B;  4A3I G;  2F0H A;  3CD6 A;  1TKW B;  1A6X A;  1KHI A;  1PTO F;  2XRQ D;  2VW9 A;  2UUA L;  2OXP A;  2D0O A;  3FHW A;  4JOI C;  4JBK A;  1JR0 D;  4JV5 Q;  3S1Q H;  2I5L X;  3TSS A;  2K5N A;  2DGY A;  4R9W A;  2KCM A;  3TN2 A;  4L63 B;  4C2M B;  1IKM A;  2N55 A;  1YJW A;  2PZT A;  4RAU C;  3IRB A;  2UXB L;  1NE3 A;  4NB3 A;  1UE1 A;  1X3Q A;  1VQD A;  1JQY D;  1XXG A;  2MHV A;  4U68 A;  5KGU A;  2AUJ D;  5DEH A;  2B2W A;  2JA9 A;  5M5W B;  1CHP D;  5CV8 A;  1CI3 M;  4KHZ A;  2NTS A;  1FVI A;  2EQS A;  3K7U C;  5F2D A;  3OTO Q;  2PZU A;  1VF5 C;  5KYI A;  4DV2 L;  2IX1 A;  5M5X H;  3E9H A;  2ALY B;  4YIJ A;  3UI2 A;  1Y1V B;  1JCK B;  1R4P B;  3PIO A;  3KF8 A;  3TDQ A;  5CV5 A;  1XPO A;  1O7I A;  1LUZ A;  2EYH A;  5M3F H;  2DUD A;  2WAQ E;  1HXY D;  1S5D D;  4UP9 A;  5G3L D;  3HFZ B;  1D8L A;  4EVO A;  1ET9 A;  2L12 A;  1H9S B;  4CHT B;  2YTV A;  2QIL A;  4DR6 L;  3HKZ E;  4A3J B;  1KRS A;  4CGY B;  3GTL B;  1HZA A;  3BU2 A;  1ILQ A;  4KLK A;  3F8T A;  4DKA C;  4LAA A;  2PNR C;  2YTY A;  2C35 B;  3C2P A;  3R3O A;  1C8C A;  4BBS G;  4IUT A;  3VR3 A;  2EZV A;  4OON A;  4ALP A;  3MZ5 A;  4UDU C;  4IFD G;  4OL7 A;  2ZXO A;  4JV5 L;  1Z47 A;  2NZH A;  2RDG A;  4F7X A;  4G4K A;  3ULP A;  4LUZ A;  1QVF A;  3ICE A;  3VR6 A;  4WFN 3;  4HIK A;  3AB9 A;  5J22 A;  5GRO A;  3EA6 A;  4B9X A;  5HGQ A;  4IUV A;  3RZD B;  5IYD H;  4POG A;  2PQE A;  2VB3 X;  2OTL A;  3P20 A;  1G6Z A;  4N9T A;  4FXK C;  1HTL D;  3I4M B;  1WCM B;  4WJ4 A;  1SN8 A;  4JI5 Q;  1JJG A;  2AWN A;  2V1C C;  2NZO A;  4GLV B;  2SNM A;  4K8I A;  4KY5 A;  4DV4 Q;  1E1O A;  1RDP D;  3U9S A;  5JJL A;  1EIG A;  4O1N A;  4HID A;  3GTQ H;  3CHB D;  3CC7 A;  1STN A;  3W2D A;  1HZ9 A;  1VQE A;  1C4Q A;  4XQJ A;  4NXM Q;  2F52 A;  2XTI A;  5LMN Q;  2XSC A;  2PO4 A;  3HOU G;  3OIP A;  1STA A;  3NTH A;  1Y1W H;  4PMW A;  3H0G B;  2AUK A;  3NBH A;  4JBJ A;  3R8B A;  2RA4 A;  4JI6 L;  1I3Q H;  1F9Q A;  1U9R A;  1E24 A;  2HIX A;  4RGM A;  1TR5 A;  4A3F H;  3PO3 G;  3QJY A;  1K3R A;  2V4D A;  2JA7 B;  2AMC B;  2F0W A;  4JOI A;  1JOK A;  4H44 C;  3S14 B;  1YHA A;  3GQB A;  2RVL A;  4LF8 L;  4LFB Q;  1II3 A;  1I50 B;  3FKI H;  3KK7 A;  4JPB W;  4POF A;  4GNX B;  3DWQ A;  2LY7 A;  4LF7 Q;  4GKJ Q;  4BXX H;  2R93 H;  3NQI A;  1EY5 A;  4A3K H;  1WYD A;  1XNQ Q;  3P1H A;  1JOR A;  1VQK A;  1CZG A;  2NB0 A;  3UDX A;  2UUB Q;  4BY7 G;  5I6W A;  2F0G A;  4X3U A;  5C0X J;  2WV6 D;  4IOA A;  3DM3 A;  1A15 A;  4QQB X;  2MPM A;  4K0K Q;  4QGU A;  2ZXR A;  4OWW B;  5FLX E;  2L4N A;  1VQO A;  1AP0 A;  3G7L A;  3AFP A;  2F0N A;  1F2M A;  4XDX A;  2JK8 A;  1VQI A;  1MJC A;  1K83 H;  5IYB H;  4IQZ A;  2R7Z B;  1N36 Q;  1AW7 A;  4DU9 A;  4DV4 L;  1ZKO A;  5EPK A;  3RMH A;  1B50 A;  3BVM A;  2E8G A;  1O78 A;  4CBV A;  2N8N A;  2JA8 H;  4PMC A;  3NE5 B;  3CCL A;  5J1Z A;  1QUQ B;  4PZ6 A;  2PW5 A;  4A3I H;  2MGS A;  2WAQ G;  2A6E C;  3NQT A;  3GTO B;  3S1Q B;  5J39 A;  5K5P A;  4DR7 Q;  2EXD A;  2B2V C;  1R4Q B;  2FIN B;  3QG1 A;  4X66 Q;  2X69 A;  4X3T A;  2CCZ A;  3HKZ G;  1SJE D;  4DV5 L;  1JE5 A;  5C5L A;  2E2J H;  1BQQ T;  3N52 A;  4R4I A;  1N8R C;  4DXF A;  4LFB L;  4JYA Q;  1G29 1;  3OIQ A;  3WWV A;  1MHW C;  1CHQ D;  1SMY D;  1YJN A;  4OO1 G;  1CKN A;  5EKK A;  4QUF A;  2RBM A;  4RFB A;  1SLJ A;  1QIL A;  5CV7 A;  1HRJ A;  1NY4 A;  1XNQ L;  3E0E A;  3G6E A;  3GTG H;  1BXT A;  2KEC A;  3KDF B;  4N8F A;  1B2T A;  4YY3 Q;  2LS0 1;  5IWA Q;  2PQA A;  4CJ0 B;  4ZK9 B;  4OWT B;  1ENA A;  2WB1 E;  1CK1 A;  5HUR A;  4DGZ A;  2XWJ B;  4DUY Q;  1GD7 A;  2R6G A;  4R8I A;  4DR2 L;  1PFS A;  3DWA A;  1K8O A;  1IBM L;  3NSW A;  5C3E G;  1RHP A;  2K7V A;  1A62 A;  4KTA A;  1YI2 A;  3NTI A;  3MEF A;  1HA6 A;  2VNU D;  1HUM A;  4EQP A;  1B1Z A;  1E3P A;  3E6Z X;  1NNX A;  3TP8 A;  4BBS H;  4DR7 L;  3MXU A;  1QJO A;  2JXM B;  2D2C C;  2BE5 D;  4KKU A;  2ZT9 C;  1I5F A;  4IFD H;  4DUZ Q;  1AZQ A;  1N9W A;  4X66 L;  2ATW A;  2JQO A;  1A0I A;  1VQP A;  5JAV A;  1PH6 A;  1YVC A;  2F0Q A;  4RMF A;  5LMN W;  5E1F A;  5CV9 A;  1G51 A;  1J5E Q;  3TBI B;  1H9J A;  4ZKB B;  4KKS A;  5FLM G;  1YNJ D;  3DMU A;  1EUJ A;  1UE7 A;  2HIV A;  4OX9 L;  1DON A;  4A3C G;  1XMO L;  4RHS A;  2ZJP A;  1EY8 A;  1PHJ A;  1RTO A;  4IOC A;  3NK9 A;  2PW7 A;  5LHY 1;  3S1N H;  4J15 A;  1LYL A;  1PRT D;  4DK6 C;  2ENB A;  4BY1 G;  2A6H D;  1EY9 A;  1E1T A;  5FJ8 G;  3SK8 A;  5IWA L;  3W3A A;  3A56 A;  3QOL A;  1Y1W B;  2MFI A;  3CCS A;  1MGS A;  1P16 A;  1IKL A;  5C0X G;  1F2Z A;  1T5X D;  1ZEQ X;  3HOU H;  1E0B A;  2N78 A;  4NKL A;  2KCC A;  4ME3 A;  3GTM H;  3T1Y Q;  4R8N A;  3HOX H;  4DV0 Q;  1R9T B;  3STB D;  5D65 A;  2IX3 A;  3NP8 A;  1EY4 A;  1G2T A;  4DV6 L;  5IGC A;  4A3F B;  2Q2H A;  3M3Y B;  4DAY B;  3RLN A;  3AQQ A;  4JC0 A;  1PV4 A;  1V9P A;  3IL8 A;  3W1G A;  1J9O A;  4FF2 A;  5E7N A;  5IIF A;  2A69 C;  4NW2 A;  1KAA A;  2XNA C;  3PO3 H;  3FKI B;  2JA6 B;  4JI8 L;  3FPP A;  2KJX A;  2VXW A;  1GOZ A;  4DR5 L;  2B2V A;  5IYC G;  1EU3 A;  1Z7T A;  2GVB A;  3I72 A;  4A3K B;  4EQN A;  2G5D A;  2WIN B;  3LWE A;  1EWH A;  2UXC Q;  4XT1 B;  1OXX K;  1CKO A;  3M4O B;  3J81 L;  4QIW B;  4DUZ L;  3J7Y W;  1NR4 A;  4PV1 C;  4X64 Q;  4LK1 C;  4KV6 A;  1NUC A;  4Q0F A;  4FXG C;  1L0Y B;  4BY7 H;  4LF4 L;  4JI0 Q;  4A93 G;  4NMZ A;  4LWC A;  3SHL A;  1J5E L;  1JWU D;  1F9P A;  3T53 B;  3KLR A;  4GOP B;  1N34 L;  1B9M A;  3URY A;  3IAY A;  1EIF A;  2QKI C;  4I7Z C;  1K83 B;  4A3D B;  2KHS A;  1QOH A;  1U5K A;  1CQV A;  1EQV A;  3V96 A;  1IBK L;  2I5H A;  1PTO H;  1IHZ A;  2CFM A;  4A4I A;  3TP6 A;  4A3I B;  3PIP 3;  1HR0 Q;  3UDF A;  1STY A;  1PH5 A;  2K33 A;  1GUN A;  4KK7 A;  1ICW A;  2SDF A;  1M4V A;  1ZYR D;  4DNI A;  1LAB A;  3A0J A;  3S16 B;  3S15 H;  5C4X H;  1SNO A;  4FF3 A;  2QEX A;  1PVO A;  2XVS A;  1IXR A;  2CQO A;  3QR8 A;  3E5S A;  2VZA A;  3A7A B;  1KTK A;  1S5C D;  1LTB D;  3DEP A;  5A2Q L;  3UDI A;  1WFQ A;  1ASY A;  1TS3 A;  2GA4 B;  4DAV A;  1A63 A;  1KDB A;  1PZJ D;  1QZG A;  1KNA A;  1TWF B;  1HZB A;  2PI2 E;  4DV7 L;  2R7D A;  2K5H A;  3PO2 G;  5CBA E;  3OSO A;  5I2Y A;  1SE8 A;  2AWO A;  1SDF A;  3RZO B;  1F77 A;  2JEA I;  3GTG B;  2VL6 A;  3K0X A;  4FP5 D;  3J80 i;  1LTT D;  4ZRZ A;  2OQK A;  4XYQ A;  3PF5 A;  4C3I G;  5M3F G;  2OCE A;  2CWA A;  1EFW A;  3HOV G;  3SK4 A;  1SJH D;  5AFW A;  5E4W C;  3NWT A;  3NEN A;  3W1B A;  4B3R Q;  4QB4 A;  1X55 A;  1L0W A;  2F3W A;  4V0B A;  5IOD A;  5ELE A;  4M8A A;  5CV6 A;  1OXV A;  3H6M A;  1V1P A;  2L55 A;  1G6P A;  4LFC Q;  4KN4 C;  1DD2 A;  1H9K A;  3NUC A;  2FHT A;  4RKB A;  3CXC A;  1HNX Q;  1HNW Q;  3ERQ A;  1QVC A;  1KIX A;  3BDC A;  4BBS B;  4A3L G;  3NWS A;  1HCZ A;  2GN5 A;  5I2X A;  2IW3 A;  4LF6 L;  5M3M G;  5IGB A;  1JMC A;  1ONL A;  1S5F D;  3KF6 A;  2N49 A;  1O7Y A;  4L5R C;  2B63 H;  1S72 A;  3K7A H;  1V1Q A;  1PTO C;  4X62 Q;  4JI3 Q;  1CSP A;  4H13 C;  3A8I E;  1CZW A;  3HRZ C;  5EKI A;  3VDY A;  1MSH A;  4M1U B;  1O7Z A;  1HHV A;  1WTW A;  3E0J A;  4JI7 L;  4IUR A;  4DR3 Q;  1D5X C;  1X3E A;  1SNC A;  4DN4 M;  3VA5 A;  1PH8 A;  2EOT A;  5JPM C;  4JI1 Q;  3S1N B;  4TKO B;  1IYU A;  4GLX A;  3GTJ H;  2E2D C;  1WTV A;  1TWH H;  2EYJ A;  1X56 A;  2Y0S B;  1PYS B;  4DNR B;  3OMC A;  2JA5 G;  2CHB D;  4BY1 H;  1JJ2 A;  2FMC A;  5JJI A;  1EQQ A;  2MQH A;  3HOU B;  4B3R L;  3D31 A;  4X3S A;  3CW2 C;  1WTX A;  4J8Q A;  1IL2 A;  1XPU A;  3MFG A;  3VYT A;  5C0X H;  4HJ8 A;  1MSG A;  1N33 L;  3F2U A;  1B9N A;  1SRU A;  3K8A A;  4C3H H;  3BJU A;  1XPR A;  2EYL A;  2KCT A;  1HNX L;  1DCZ A;  4BXX G;  1Y8N B;  2UUC L;  1HNW L;  3T16 A;  2R93 G;  1Q8I A;  5EQ0 A;  3T56 B;  3VR4 A;  3FVQ A;  2OQ0 A;  4LF9 Q;  2XGT A;  1EOT A;  2Q8T A;  2IPK D;  4C3J H;  5IYC H;  4KMU C;  1PH7 A;  1FL0 A;  2EYF A;  1AE3 A;  5IGG A;  1T5E A;  3S24 A;  3CCE A;  4XTC S;  4OHJ A;  1DOM A;  4X62 L;  3H94 A;  4BY7 B;  4Z9C B;  4B3M L;  1GHJ A;  1M1K C;  4IPH A;  4YWM A;  5IP7 G;  1FYC A;  2ID0 A;  1UEA B;  3HEJ A;  3HOW H;  2Q8R E; 
#chains in the Genus database with same CATH homology
 1SBB B;  4HED A;  4QMG A;  1BF4 A;  2QCP X;  2RDH A;  1OXS C;  4KJO A;  3HP3 A;  3MA2 B;  1DZ1 A;  5EBC A;  2SNS A;  1DXM A;  2F03 A;  3TP7 A;  2K05 A;  1Z6H A;  1RTN A;  5DAU A;  2WAQ B;  3S15 B;  1ROD A;  2J7Z A;  4ZKC B;  5M9O A;  4FO2 A;  2KVM A;  4RGT A;  5EJW A;  4BA2 I;  1PMR A;  3HKZ B;  2TSS A;  3GV6 A;  4IUQ A;  1D5Z C;  1GUO A;  1WD1 A;  2A6E D;  2JEB I;  4EQO A;  1V8Q A;  5C4J B;  4HSP A;  5I6Y A;  2A74 C;  2EY6 A;  1TWA B;  4MN3 A;  1VF7 A;  1MD2 D;  1BR9 A;  2NVQ B;  3SEB A;  5A35 A;  3D4D A;  1FNW A;  1S5E D;  5C5M A;  4V19 0;  3ND9 A;  1GUS A;  1TS5 A;  1GUT A;  2NYZ D;  3H91 A;  1GXD C;  5C3E B;  1AFP A;  5EGT A;  4FF1 A;  3OOC A;  4J1M A;  3S1M B;  1IW7 C;  2EJF C;  2F0F A;  1M8A A;  2L9H A;  2PCF B;  3EJI A;  3X3N A;  4K5W A;  3K7A B;  1QWY A;  1SAP A;  2F0U A;  4CKB A;  1AEX A;  1F2Y A;  1I6H B;  3GTJ B;  3OWE B;  4G7O C;  3Q6S A;  4L6T B;  3DEO A;  5TSS A;  4BY1 B;  1FD7 D;  3FEW X;  1QB5 D;  2BA0 A;  1AZP A;  1W6K A;  3CU7 A;  1E2V A;  2NVX B;  4G57 A;  3S2H B;  5FOB B;  2F0M A;  3OMG A;  2EY5 A;  3D6W A;  3CRL C;  1FR3 A;  1SYD A;  3HGB A;  1ENC A;  1Q1B A;  3WOF A;  2JP1 A;  1LTA D;  1EZ6 A;  2XN9 C;  3I90 A;  2QEJ C;  3QB3 A;  2M2L A;  2WKD A;  4L8J A;  3DUZ A;  2X6L A;  3L9A X;  1NSN S;  4A93 B;  1TWG B;  1PDQ A;  2F0I A;  3FDT A;  3QWN A;  1HFG A;  2L5T A;  3TZU A;  2K6A A;  5CR3 A;  4ZQ3 A;  2NVY B;  1I6V C;  3QO2 A;  3ND8 A;  2F0V A;  2QDB A;  3SE0 A;  1G8Z D;  2WKC A;  1CA5 A;  1BCP C;  2G9D A;  1DOK A;  3HG9 A;  2LKV A;  2F0P A;  5JEA J;  4KY6 A;  3D6C A;  4KJN A;  4CJ2 C;  5IT9 E;  1U4L A;  2YU9 B;  2OF1 A;  3PO2 B;  3CRK C;  5COR A;  4XYO A;  5JJZ A;  2WAC A;  5M5X B;  5C3X A;  1PFB A;  3JAM L;  4C3I B;  5M3F B;  3IFT A;  1VMC A;  4EGV A;  5D14 A;  4IUP A;  4K2K A;  5IGE A;  2K5D A;  4ZYS A;  1FNU A;  2F0S A;  1BDO A;  2A68 C;  2EY2 A;  4DAP A;  5CC4 A;  1XYI A;  3VR5 A;  1YNN C;  3G6J B;  1RKN A;  1OXU A;  3MTS A;  4MIU A;  1G91 A;  3SVM A;  5M3M B;  4PMB A;  1JE4 A;  2NN6 I;  5BN4 A;  1MBY A;  3PUX A;  3L7Z C;  3BYT B;  2O5J C;  1DM0 B;  3VYU A;  3MHB A;  3C46 A;  3BYY B;  4HMJ A;  3KLS A;  2RQX A;  3I70 A;  4XQN A;  3GTQ B;  2F1M A;  1JOO A;  1PTO D;  1BUV T;  5FKA C;  1BCP F;  3GV3 A;  1RJT A;  1SSO A;  2JA5 B;  1EY6 A;  1NAP A;  2F0T A;  3BDO A;  5CYU A;  1I3Q B;  2M9V A;  3BDL A;  4KY7 A;  3P75 A;  4C3H G;  1G2S A;  2B8G A;  1SE4 A;  1F9R A;  3MXN A;  2B2Y C;  4N9P A;  1KDC A;  2NUC A;  4C3J G;  2R93 B;  1SNQ A;  4K8J A;  3BG3 A;  5T1G A;  1QE6 A;  3K5N A;  5KIX A;  2CW0 C;  1B4O A;  1GUG A;  2AQ2 B;  1UUP A;  3M7N A;  2SEB D;  4IN3 A;  2I07 B;  1HQR D;  2C5C A;  5JOB A;  4C1N I;  4K6L A;  3EQL C;  3P7J A;  4K14 A;  3K5L A;  1WVL A;  3RD4 A;  1UNS A;  2JA8 B;  3LWU A;  1D1I A;  3BS1 A;  2HCI A;  2HCC A;  2F0L A;  4RA8 A;  1PFN A;  1IL8 A;  4HAE A;  2F4I A;  2L11 A;  1CA6 A;  2K03 A;  3DHQ A;  4FXD A;  3OW7 A;  4LMQ D;  4OIK A;  4AYB B;  2EJG C;  2ZXP A;  1EY0 A;  4TQU S;  2E2J B;  1V1P B;  2D9U A;  4DNT B;  3MVV A;  4H0L C;  1ILP A;  3CKI B;  3I8Z A;  3NHH A;  1CQF A;  4DXG A;  2F0D A;  3S9W A;  2CQA A;  2TMP A;  5KEE A;  3U9O A;  3ONA B;  2X6G A;  3Q23 A;  2YYZ A;  4HCE A;  4J6H A;  1SYB A;  2BDO A;  4KD4 A;  1SNP A;  2VUM B;  2BOS A;  1XX8 A;  4FNF A;  5ELC A;  2F0K A;  1D1K A;  4CJ1 B;  3OHX C;  1TT2 A;  1JB3 A;  1C48 A;  3D3R A;  4HTH A;  3NTK A;  1W6J A;  5KNC A;  2R61 A;  3M85 A;  3NPP A;  1SYF A;  2B2Y A;  2CVR A;  4HN7 A;  4KN7 C;  2JE6 I;  1NR2 A;  2RSO A;  1K8M A;  3K5O A;  2EE1 A;  5FO7 B;  5I9P A;  5FO8 B;  2MUY A;  3JAM E;  1TVX A;  1IW7 D;  1I4X A;  4WRD A;  5C3W A;  1PZK D;  2FFK B;  1WTO A;  2K1B A;  1WTR A;  4NDX A;  1PRT C;  5EBD A;  4MHE A;  3H3V C;  4FF4 A;  5LL6 S;  3V05 A;  1ML0 D;  5JPN C;  3HS0 C;  4FYD A;  5E3F A;  3PV0 A;  2HDL A;  1O7L A;  3GTM B;  3HOX B;  1SNM A;  4U67 3;  3KBG A;  1A2T A;  5FLX L;  3PO3 B;  2E2I B;  5C44 B;  2NZ1 D;  5JVH 3;  3WDN A;  3ITP A;  5BN3 A;  5CGK A;  3D8G A;  2BA1 A;  3QIA A;  3C1F A;  1IYV A;  4F88 A;  1WTQ A;  1SXT A;  2EYO A;  4HCS A;  1AN8 A;  2H4O A;  1ESF A;  4XXE A;  2R92 B;  3ERO A;  4I65 A;  1TU2 B;  4K2L A;  4DA2 A;  3Q24 A;  5FK9 C;  1LT6 D;  3KLS X;  1EL0 A;  5JEA H;  5D3D A;  4RH6 A;  4B9W A;  1FGB D;  1EYA A;  1PTO B;  1QNU A;  2K28 A;  1HUN A;  3AMU A;  3DXJ C;  1PXU A;  5KNB A;  4B08 A;  1JOQ A;  4DK0 A;  2IL8 A;  1DOL A;  2KA7 A;  5C4X B;  1WTP A;  3IFD A;  4HSV A;  1QNK A;  1A3T A;  4H7B A;  4TRD A;  1ENF A;  2IX0 A;  1LT5 D;  3SR1 A;  3J81 E;  1S5B D;  1JC7 A;  1PRT F;  1LTR D;  4BWG B;  1TII D;  4ME5 A;  2PYK A;  1KAB A;  2Z8L A;  2RKS A;  2LFN A;  4BS9 A;  1SYE A;  1PZI D;  1BCP D;  3RUZ A;  5KYL A;  4E6I A;  1WD0 A;  1JIC A;  1I4P A;  2B8F A;  1LT3 D;  1I4H A;  2G9H D;  2EXZ A;  1KLU D;  1B53 A;  1F9S A;  2FMM A;  3K6O A;  2KEE A;  1LTS D;  1XTC D;  3IKJ A;  4XQQ A;  2O4X A;  3FRP B;  3NXW A;  1KNE A;  3WOE A;  1PYW D;  5A2Q E;  2R3Z A;  2EVB A;  4CKC A;  1QCB D;  3A54 A;  3HOY B;  2D5D A;  2XRS D;  4G7Z C;  2B63 B;  1EEF D;  4IAL A;  3N6R A;  5ELD A;  2A68 D;  1EYC A;  1SE3 A;  4FVM A;  1YNN D;  2M00 A;  3S1R B;  2E74 C;  2K5Q A;  3MAQ A;  1A2U A;  1EQT A;  2A5H A;  1U4M A;  3PUV A;  2BDN A;  4JBW A;  1EYD A;  1MI2 A;  1TWH B;  1STH A;  1EU4 A;  2RDF A;  1A3V A;  5EPL A;  1KLG D;  3R2I A;  5COY A;  2F0O A;  2N88 A;  2Q8I B;  2NN6 G;  5C4H A;  1H9S A;  4ID6 A;  4KI0 A;  4WJW A;  3J7A V;  1LTI D;  2QF7 A;  2PMZ B;  4C3H B;  2ICI A;  4ZUJ A;  1SFO B;  3DM1 A;  3R93 A;  3C3L A;  5DM7 3;  3HOZ B;  1CT1 D;  2EYP A;  1BO0 A;  4C3J B;  4IUU A;  2E75 C;  1J8I A;  1STG A;  2H1E A;  1HFN A;  2MJ8 A;  2I46 A;  4C56 C;  2A69 D;  1ET6 A;  1Q3L A;  3VYS A;  3HOW B;  1V43 A;  3J80 L;  4P2C B;  5BN5 A;  2HUG A;  2NWG A;  3PUW A;  3Q0A A;  2CW0 D;  4GZY C;  1QG7 A;  1BBX C;  3MWY W;  1U4R A;  4QUC A;  1OO9 B;  1SND A;  2JSO A;  5EPJ A;  2Z4I A;  2WB1 B;  2NTT A;  2VB2 X;  3R2T A;  1S4Z A;  3M4Y A;  5I4D A;  2L1B A;  2IT1 A;  3OPO A;  2L0C A;  4RKL A;  4ILW A;  1EFI D;  4IUN A;  1E2Z A;  4DK1 A;  1CFM A;  1HPC A;  2KCN A;  1I4G A;  2KUM A;  1D2B A;  4X3K A;  3AU7 A;  4NP5 A;  5D3I B;  1A3U A;  2AQ3 B;  4DFA A;  3A8J E;  2B2T C;  3K59 A;  1V1O A;  2ICE C;  4ABN A;  4K6D A;  3GD7 A;  5IGF A;  3HOV B;  5K36 G;  3D4R A;  1TS4 A;  3D4W A;  2J0T D;  1VCI A;  1B44 D;  3TZD A;  3VR2 A;  4K5X A;  1SYG A;  4O42 A;  4OIJ A;  4IFD I;  2RSN A;  1PLF A;  4KHV A;  2XIW A;  4XT3 B;  2IWH A;  1GHK A;  1LAC A;  2NVT B;  1SYC A;  2FJ2 A;  2E2H B;  2OEO A;  4K5V A;  3OWF A;  4KD3 A;  3A7L A;  4LJZ C;  3FMC A;  4XIG S;  1B3A A;  3A55 A;  3SXH A;  2DY8 A;  2E76 C;  3I73 A;  2EY1 A;  2O5I C;  5E4X A;  1STE A;  1OXT A;  3PUY A;  2SOB A;  3BVZ A;  3TME A;  1JWM D;  3A8K E;  3MFY A;  5ELB A;  3VYR A;  1BCP B;  4HMI A;  3BZD B;  3Q22 A;  1X3P A;  1RF2 D;  2WP8 J;  5JVG 3;  4BA1 I;  3T51 B;  3SK6 A;  4QF4 A;  4BBR B;  3MC0 B;  5FO9 B;  1LO5 D;  2NN6 H;  4UAI A;  1CTM A;  1D5M C;  2DNC A;  5DNF A;  2F0E A;  1RD9 D;  1Y69 U;  1XWE A;  1LV9 A;  4KKT A;  2PZW A;  3O13 A;  3PIO 3;  2B39 A;  3FPU B;  5IGD A;  1EZ8 A;  1NCV A;  3I4N B;  5T1I A;  3GTP B;  5G3L F;  3LNN A;  4F87 A;  5M5Y B;  2C9O A;  3L3O C;  2XWB B;  2DNE A;  5JEA G;  2F0J A;  1EY7 A;  2B2T A;  4RGN A;  1STB A;  2JYO A;  2K32 A;  4C1N K;  4A3E B;  1TWC B;  2K01 A;  4HR7 B;  3SDZ A;  1L0X B;  3LX0 A;  2B2U C;  3GO5 A;  4G7H C;  1LLR D;  4DAY A;  3DWP A;  1ZXT A;  1DJR D;  1LT4 D;  3K5M A;  4TSS A;  4OO1 I;  1CM9 A;  5CMD A;  4Q5V A;  1UAP A;  1I4R A;  3J7A F;  1Y8O B;  5ELF A;  1SMY C;  3J80 E;  3BVG A;  1RCV D;  2J4X A;  2A73 B;  1BNZ A;  4RWS C;  4ZAI A;  5I9O A;  4RHR A;  2HDM A;  1EIH A;  3PUZ A;  1SE2 A;  3ZYY X;  1TQO A;  3S2D B;  3PMF A;  1SEB D;  3I3C A;  1X32 A;  3EFX D;  5K36 H;  2EDG A;  4OO1 H;  5CV4 A;  3K58 A;  5KRU A;  2F3V A;  3KUP A;  4CKE A;  3GTK B;  3RLF A;  2NBF A;  3MEH A;  2EJM A;  1DYQ A;  4A3B B;  2DN8 A;  2EPB A;  2KED A;  4F8M A;  2BE5 C;  3M7G A;  1I4Q A;  3K57 A;  5HGT A;  3TP5 A;  2AQ1 B;  5DM6 3;  2OT2 A;  5EKL A;  4PQX A;  5LL6 X;  2Z1C A;  1HTP A;  2HQE A;  3X3M A;  1YNJ C;  1TY2 A;  4S3S A;  3T4A C;  4RGO S;  3MXG A;  3C1E A;  3MXP A;  5C6A A;  2B2W C;  1FNV A;  1EEI D;  1HQM C;  2IJ0 A;  5C0X I;  2LMC B;  4JK1 C;  2KOL A;  1ESR A;  2A6H C;  1O80 A;  3NBI A;  3CQZ B;  1H9R A;  1GJX A;  1H9M A;  4DF7 A;  3QOJ A;  5ISR A;  3EVQ A;  3I91 A;  1KDA A;  1Q12 A;  2D62 A;  2O2L D;  4RCN A;  5NUC A;  1JWS D;  2MP1 A;  1TS2 A;  4IFD J;  1TY0 A;  3KBX A;  2B2U A;  4ZUI A;  3I4L A;  3SK5 A;  1PFM A;  4ZLT F;  3K0Y A;  5C4Z A;  1VDZ A;  1HA5 A;  2Z4H A;  1Y8P B;  3T13 A;  4A3G B;  4IZ8 A;  1F2L A;  2KQ3 A;  1Q90 A;  2BCO A;  2WII B;  1D6E C;  1VMP A;  1BOS A;  5CBE E;  1E2W A;  3VA7 A;  4ULL A;  1EWC A;  1U4P A;  4PNY A;  3GP7 A;  5IOC A;  2DY7 A;  4A3M B;  5KND A;  3HZX A;  1GUW A;  4QCL A;  4WOR A;  2PPB C;  1LTG D;  3S17 B;  2EYM A;  1ZYR C;  4RCO A;  2K5W A;  4OGQ C;  4ODG A;  1Q1E A;  3H09 A;  2K04 A;  3V2T A;  4Y7N B;  1PRT B;  2F0H A;  1TKW B;  1A6X A;  1PTO F;  2XRQ D;  2OXP A;  1JR0 D;  3TSS A;  4R9W A;  3TN2 A;  4L63 B;  4C2M B;  1IKM A;  2N55 A;  2PZT A;  4RAU C;  1X3Q A;  1JQY D;  1XXG A;  2MHV A;  4U68 A;  5KGU A;  2AUJ D;  5DEH A;  2B2W A;  5M5W B;  1CHP D;  5CV8 A;  1CI3 M;  4KHZ A;  2NTS A;  5F2D A;  2PZU A;  1VF5 C;  5KYI A;  2IX1 A;  4YIJ A;  3UI2 A;  1Y1V B;  1JCK B;  1R4P B;  3KF8 A;  3TDQ A;  5CV5 A;  2EYH A;  1HXY D;  1S5D D;  5G3L D;  4EVO A;  1ET9 A;  2L12 A;  1H9S B;  4CHT B;  2QIL A;  4A3J B;  4CGY B;  3GTL B;  1ILQ A;  4LAA A;  2PNR C;  3C2P A;  3R3O A;  1C8C A;  4IUT A;  3VR3 A;  2EZV A;  3MZ5 A;  4UDU C;  4IFD G;  4OL7 A;  2ZXO A;  1Z47 A;  2RDG A;  4F7X A;  4G4K A;  3VR6 A;  4WFN 3;  3AB9 A;  5J22 A;  4B9X A;  3EA6 A;  4IUV A;  3RZD B;  2PQE A;  2VB3 X;  3P20 A;  1G6Z A;  4N9T A;  4FXK C;  1HTL D;  3I4M B;  1WCM B;  2AWN A;  2SNM A;  4K8I A;  4KY5 A;  1RDP D;  3U9S A;  1EIG A;  4O1N A;  3CHB D;  1STN A;  3W2D A;  4XQJ A;  1C4Q A;  2XSC A;  2PO4 A;  3OIP A;  1STA A;  3NTH A;  4PMW A;  3H0G B;  2AUK A;  3NBH A;  3R8B A;  2RA4 A;  1F9Q A;  1U9R A;  4RGM A;  1TR5 A;  3QJY A;  2V4D A;  2JA7 B;  2F0W A;  3S14 B;  1JOK A;  4H44 C;  3GQB A;  2RVL A;  1II3 A;  1I50 B;  3KK7 A;  3DWQ A;  2LY7 A;  3NQI A;  1EY5 A;  3P1H A;  1JOR A;  1CZG A;  2NB0 A;  5I6W A;  2F0G A;  4X3U A;  5C0X J;  2WV6 D;  1A15 A;  2MPM A;  2ZXR A;  5FLX E;  2L4N A;  1AP0 A;  3G7L A;  2F0N A;  1F2M A;  4XDX A;  4IQZ A;  2R7Z B;  1AW7 A;  4DU9 A;  1ZKO A;  5EPK A;  3RMH A;  1B50 A;  3BVM A;  1O78 A;  4CBV A;  4PMC A;  3NE5 B;  5J1Z A;  2PW5 A;  2MGS A;  2A6E C;  3NQT A;  3GTO B;  3S1Q B;  5J39 A;  5K5P A;  2B2V C;  1R4Q B;  2FIN B;  3QG1 A;  2X69 A;  4X3T A;  1SJE D;  5C5L A;  1BQQ T;  3N52 A;  4DXF A;  1G29 1;  3OIQ A;  1CHQ D;  1SMY D;  4OO1 G;  5EKK A;  4QUF A;  2RBM A;  4RFB A;  1QIL A;  5CV7 A;  1HRJ A;  1BXT A;  2KEC A;  1B2T A;  2LS0 1;  4CJ0 B;  4ZK9 B;  1ENA A;  1CK1 A;  5HUR A;  4DGZ A;  2XWJ B;  2R6G A;  4R8I A;  3DWA A;  1K8O A;  3NSW A;  1RHP A;  2K7V A;  4KTA A;  3NTI A;  1HA6 A;  2VNU D;  1HUM A;  4EQP A;  1B1Z A;  3E6Z X;  3TP8 A;  3MXU A;  1QJO A;  2JXM B;  2D2C C;  2BE5 D;  4KKU A;  2ZT9 C;  4IFD H;  1AZQ A;  5JAV A;  2F0Q A;  5E1F A;  5CV9 A;  3TBI B;  1H9J A;  4ZKB B;  4KKS A;  1YNJ D;  3DMU A;  1DON A;  4RHS A;  1EY8 A;  1RTO A;  3NK9 A;  2PW7 A;  5LHY 1;  1PRT D;  2ENB A;  2A6H D;  1EY9 A;  3SK8 A;  3W3A A;  3A56 A;  3QOL A;  1Y1W B;  1MGS A;  1IKL A;  5C0X G;  1F2Z A;  1T5X D;  1ZEQ X;  1E0B A;  4NKL A;  2KCC A;  4R8N A;  1R9T B;  5D65 A;  2IX3 A;  3NP8 A;  1EY4 A;  1G2T A;  5IGC A;  4A3F B;  3M3Y B;  3IL8 A;  1J9O A;  4FF2 A;  5IIF A;  2A69 C;  4NW2 A;  1KAA A;  2XNA C;  3FKI B;  2JA6 B;  3FPP A;  2KJX A;  2VXW A;  1GOZ A;  2B2V A;  1EU3 A;  1Z7T A;  3I72 A;  4A3K B;  4EQN A;  2WIN B;  3LWE A;  1EWH A;  4XT1 B;  1OXX K;  3M4O B;  3J81 L;  4QIW B;  3J7Y W;  1NR4 A;  4PV1 C;  4LK1 C;  4KV6 A;  1NUC A;  4Q0F A;  4FXG C;  1L0Y B;  4NMZ A;  3SHL A;  1JWU D;  1F9P A;  3T53 B;  3KLR A;  1B9M A;  3URY A;  3IAY A;  4I7Z C;  2QKI C;  1K83 B;  4A3D B;  2KHS A;  1QOH A;  3V96 A;  1CQV A;  1EQV A;  1PTO H;  1IHZ A;  3TP6 A;  4A3I B;  3PIP 3;  1STY A;  2K33 A;  1GUN A;  4KK7 A;  1ICW A;  2Q8R E;  2SDF A;  1M4V A;  1ZYR D;  1LAB A;  3S16 B;  1SNO A;  4FF3 A;  2XVS A;  3E5S A;  3A7A B;  1KTK A;  1S5C D;  1LTB D;  3DEP A;  5A2Q L;  1TS3 A;  2GA4 B;  4DAV A;  1KDB A;  1PZJ D;  1KNA A;  1TWF B;  5CBA E;  3OSO A;  5I2Y A;  2AWO A;  1SDF A;  3RZO B;  1F77 A;  2JEA I;  3GTG B;  4FP5 D;  1LTT D;  4ZRZ A;  4XYQ A;  4C3I G;  3SK4 A;  1SJH D;  5AFW A;  5E4W C;  3NWT A;  4QB4 A;  2F3W A;  4V0B A;  5IOD A;  5ELE A;  4M8A A;  5CV6 A;  1OXV A;  3H6M A;  1V1P A;  2L55 A;  4KN4 C;  1DD2 A;  1H9K A;  3NUC A;  2FHT A;  4RKB A;  3ERQ A;  3BDC A;  4BBS B;  3NWS A;  1HCZ A;  5I2X A;  2IW3 A;  5IGB A;  1ONL A;  1S5F D;  1O7Y A;  1PTO C;  4H13 C;  3A8I E;  1CZW A;  3HRZ C;  5EKI A;  1MSH A;  4M1U B;  1O7Z A;  1HHV A;  1WTW A;  3E0J A;  4IUR A;  1D5X C;  1SNC A;  4DN4 M;  3VA5 A;  2EOT A;  5JPM C;  3S1N B;  4TKO B;  1IYU A;  1WTV A;  2E2D C;  2EYJ A;  2Y0S B;  4DNR B;  3OMC A;  2CHB D;  2FMC A;  3HOU B;  3D31 A;  4X3S A;  1WTX A;  4J8Q A;  3MFG A;  3VYT A;  5C0X H;  1MSG A;  3F2U A;  1B9N A;  2EYL A;  1DCZ A;  1Y8N B;  3T16 A;  1Q8I A;  5EQ0 A;  3T56 B;  3VR4 A;  3FVQ A;  1EOT A;  2Q8T A;  2IPK D;  4KMU C;  2EYF A;  5IGG A;  1T5E A;  4XTC S;  4OHJ A;  1DOM A;  3H94 A;  4BY7 B;  4Z9C B;  1GHJ A;  1FYC A;  2ID0 A;  1UEA B;  3HEJ A;  5IT9 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...