1SYDA

Engineering alternative beta-turn types in staphylococcal nuclease
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Engineering alternative beta-turn types in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sydA00
1SNMA 4ZUIA 4MIUA 4K8IA 3OMGA 1TQOA 2F3WA 5IGCA 3NHHA 5ISRA 1U9RA 2SNSA 4DF7A 2F0HA 1KAAA 3BDLA 5C3XA 5CGKA 5CV8A 3DMUA 5CR3A 4EQNA 4EQOA 5IOCA 5KYLA 3TP7A 2F0WA 4IUNA 2F0UA 2F0EA 3HZXA 5KIXA 4J6HA 5CV4A 2PYKA 3EROA 3SXHA 5CC4A 1STGA 4ME5A 2OEOA 4K6DA 3SK4A 5KRUA 1AEXA 4J1MA 4S3SA 1KABA 1NUCA 1EY4A 2F0KA 4HTHA 4K5WA 5CV7A 5DEHA 3NK9A 5JOBA 4PMCA 2EYOA 1EYDA 4KV6A 1II3A 2EY6A 5NUCA 3TP6A 3P75A 2PW7A 1SYDA 1TR5A 3EVQA 4DU9A 4K2LA 1EYCA 2SOBA 2F0QA 3MHBA 1EY6A 1STBA 5K5PA 5E3FA 3OWFA 4PNYA 5M9OA 3P1HA 4LAAA 1A3UA 2F0GA 2EY2A 3TP5A 4B9XA 2F0JA 4RKBA 2F0OA 3OMCA 2F0NA 2RBMA 3ERQA 5KYIA 1A3TA 4ODGA 5KGUA 2RKSA 1ENAA 4TRDA 3D6CA 3LX0A 5IGGA 2PZWA 2EYFA 3V2TA 2OF1A 5C6AA 1JOQA 3NXWA 1EYAA 4K8JA 3D8GA 4N9TA 3TP8A 5IIFA 3D4DA 5EKLA 3HEJA 1IHZA 1F2MA 3SK8A 1EY8A 1KDCA 2SNMA 2EYMA 4K5VA 2WACA 4K5XA 5HGTA 2F0MA 4DFAA 4QB4A 5HURA 3C1FA 4ZQ3A 4DGZA 1JOOA 1EY9A 1SNPA 2F0FA 2KHSA 4IALA 5CV6A 3SK6A 5DAUA 2LKVA 1STHA 2F3VA 1SYBA 2PZUA 5I6WA 4N9PA 5J22A 4ZUJA 3C1EA 4NDXA 2M00A 1TT2A 3EJIA 4K14A 1SYGA 4KY7A 4EVOA 1EZ6A 1STYA 1F2ZA 1SNCA 3U9OA 1SYEA 1STNA 4I65A 4OL7A 2EY1A 4E6IA 4ID6A 1EZ8A 2PZTA 2F0PA 3SR1A 1EY0A 2EYJA 1A3VA 5IGBA 5J1ZA 1ENCA 1SYFA 3OSOA 4NKLA 1KDAA 5IGDA 4H7BA 2F0LA 2F0DA 3T13A 3MVVA 4KJNA 3ITPA 4QMGA 5C5LA 4WRDA 5JAVA 2PW5A 3R3OA 1NSNS 4F8MA 4B9WA 5EGTA 4G57A 1SYCA 1A2UA 5C4HA 5E1FA 3VA5A 1KDBA 2F0TA 3D4WA 3MZ5A 4KD4A 2F0VA 2RDFA 5EKKA 4K2KA 3DHQA 5F2DA 3SK5A 2EYPA 4NP5A 4EQPA 2EYHA 2EY5A 3NQTA 4NMZA 2QDBA 1SNOA 3PMFA 3NP8A 1SNDA 1JOKA 5I6YA 2PQEA 3RUZA 5I9OA 5J39A 2EXZA 3TMEA 4IZ8A 4PMBA 1F2YA 5C5MA 4WORA 1EY5A 2O4XA 2ENBA 1STAA 3BDCA 4F7XA 5IGFA 3S9WA 2F0SA 3H6MA 3QOLA 4HMIA 4KTAA 1A2TA 2NUCA 3MXPA 5CV5A 3T16A 1SNQA 4KD3A 5KEEA 3SHLA 2HQEA 3QOJA 4QF4A 4KY6A 4R8NA 3NUCA 2KQ3A 5IGEA 4YIJA 1EY7A 2OXPA 1RKNA 3E5SA 1EQVA 5CV9A 5C4ZA 5I9PA 4KHVA 1JORA 4HMJA 2EYLA 3QB3A 4KJOA 4RKLA 5C3WA 3MEHA 4KY5A 2F0IA 5IODA
chains in the Genus database with same CATH superfamily
3T1HQ 3AU7A 3KJOA 1U4RA 2F3WA 4PQXA 2B2UA 1VQ6A 1LTID 3BZCA 5M3FH 1XMOQ 3U4ZA 3I3CA 4OX9Q 2O5JC 2PCFB 4IO9A 3TP7A 3DEOA 2UXBQ 1HZCA 5IT9L 1EU3A 5A35A 4A3BB 4ME5A 1HQMC 5FKAC 1CKNA 4K6DA 4ME3A 1H95A 1WTQA 3NTHA 4X64L 2KEDA 3NK9A 3NQIA 5IYBH 1HA6A 2I0QA 1II3A 2EY6A 1I94L 3P75A 2PW7A 3SEBA 1B50A 2K32A 3E0JA 4A3CH 2L12A 1F9PA 1EY6A 3M9BA 4UP9A 2PQAB 1M90C 3D3RA 3DLLA 1Y8OB 2K4KA 4AH6A 3ERQA 3MXUA 1XNRQ 4IJHA 3PUXA 1LTGD 1WTHA 4P74A 2CCZA 2ZTDA 3HOYH 2KUMA 4B3TL 4CJ2C 2K6AA 3S1MB 3NWSA 4J8QA 3C3LA 2E75C 1CT1D 1H9KA 2NVTB 3M4YA 4DGZA 4KKTA 2IPKD 5BR8L 3PUWA 1HA5A 1STHA 3I56A 3L9AX 1LT3D 4NDXA 1EEFD 1UEAB 4HJAA 3VR6A 1N33L 1BCPC 3CMAA 4LMQD 4MTKA 4X66Q 4JBJA 4WJ4A 2NN6H 1K28A 5IGBA 2PI2E 3C46A 2MJ8A 2CQOA 1BF4A 3J81j 3M3YB 2JP1A 3X3MA 1D5ZC 3WOFA 3E9IA 5DNFA 1YHQA 3HS0C 1K3BC 4GN4B 3SK5A 4A3MH 1EUJA 3D31A 5LL6X 4GZYC 3HOWB 4V190 3LWUA 1WD0A 4PMBA 5M5YH 3PF4A 2RHSB 4LF9L 4A3IB 4K0KL 2LS01 1R4QB 1PRTD 2RSNA 1TIID 2ZTEA 1EQVA 1EWCA 3T4AC 4DUYQ 1KXLA 2GVBA 3T1YL 2UUBL 2OQ0A 4R4QA 4CKBA 4NXML 1SNMA 2YTXA 3OMGA 4OIKA 5EPKA 1LM0A 2BE5D 5KNCA 2UU9L 3HOUH 3W3AA 1HNWL 3F8TA 2G9DA 5C3XA 3QJYA 4A3LG 2JA9A 3W2DA 5BN3A 3PUYA 3S15H 4IUUA 4QUFA 2RHQB 3TZDA 1ZYRC 1WTOA 1CHPD 4A3DB 5KNDA 4DV4Q 2JA8B 1SXTA 2WB1B 3Q8DA 1SLJA 1PYWD 3D6WA 2VQEL 2QW7A 2LFNA 3SVMA 4DXGA 4LAAA 2M9VA 3DM3A 3IL8A 3F2CA 5C3EG 3N52A 4DKAC 1IBLL 5LMUL 1HTPA 2OF1A 4KMUC 4BA2I 4U673 1WD1A 5IIFA 3J81E 3U4VA 4L6TB 3J7YW 4DV5Q 2EYMA 1BKBA 5HURA 1YJWA 2Z8LA 3BYTB 2LKVA 1D6EC 4H44C 1B7YB 1KC8C 3VR5A 2LY7A 4JI4L 3KF8A 4BY1G 3A8IE 2HDLA 4CDCC 2K52A 3GO5A 2H1EA 4LW1A 3HGBA 1NTGA 3I4NB 3CC2A 3CP0A 2F0PA 1KLGD 5J1ZA 5IGDA 1TS2A 2B63B 4Q5VA 1L0YB 2I5HA 1X3QA 1SE8A 5COYA 2PW5A 3R3OA 2TSSA 2B2VA 2A68C 5EGTA 2BA1A 4CBVA 2E2DC 2UUAQ 5CYUA 2CQAA 3FMCA 2DUDA 4DXFA 1Z9FA 2WIIB 4H02A 1GJXA 2ZM6L 1G8ZD 1TS3A 1GHJA 1JB3A 1JCKB 4GN3B 3W1BA 2Q8TA 4X62L 1O7YA 1EQQA 1F9RA 4Z9CB 1IBKQ 3CCLA 4LF5Q 2KQ3A 1I3QH 5C4ZA 1HFNA 1K83H 1VQCA 2RDGA 1RTNA 4F88A 4OO1G 4LFAQ 1EIYB 3BDLA 1SEBD 2F4VL 1TWCB 5CGKA 2J4XA 4IUNA 1PH3A 2DJFC 3SK4A 1EY4A 1CSPA 1A0IA 4QY7A 3RZOB 2AQ2B 2AWOA 4DR4L 1QILA 1V9PA 4DR6L 4HAEA 4A3LH 4JG2A 2MGSA 3IAYA 5HY6A 4C3JG 4GLVB 4XYQA 4HIDA 4HJ7A 1E3PA 1W6KA 1PZKD 3D6CA 5EBCA 1TXYA 2BCOA 1MJCA 1QZGA 5EQ0A 3BS1A 2Q2IA 4DNTB 1MKHA 2XVSA 3OWEB 4OEMB 3CCJA 4RHSA 3LGJA 2WP8J 1SNPA 1HJPA 4OO1I 3K5MA 1TT2A 5C3EH 1TWAH 3A7AB 4EVOA 1STYA 4R4OA 5I2XA 1V43A 3CHBD 1SE2A 1FJGL 1BBXC 1EZ8A 3VR3A 2E5LL 1VQ9A 4YWKA 4YCVA 4FP5D 4R4CA 2IX1A 5GADC 5AJ3Q 4RGOS 1SYCA 1H9MA 5C44B 4BY1H 3OIPA 2WB1E 1TVXA 1PFMA 4B08A 3OTOQ 2UXCL 3CPFA 3KDFB 5J39A 4DV3L 4MTNA 1I4RA 2AUKA 3J80c 5C5MA 2O4XA 3KLSX 2CH4A 1IBML 2BDOA 2NUCA 3K5NA 2D0PA 4QCLA 2WV6D 2Z0SA 5FLXc 5IGEA 1TWFH 3I7FA 3E5SA 4A3MB 2A6EC 3JAMc 2EYLA 3DWQA 3RMHA 1XXGA 3BU2A 4JI5L 3S1RH 2PNRC 2MUYA 4ZUIA 3MFYA 4K8IA 3TS2A 1TQOA 2GVAA 1QZHA 2JYOA 4L5SA 4O2DA 1B4OA 3L7ZC 3URYA 1B3AA 1D1IA 5LMNL 1K8AC 1E1OA 1EIFA 3H0GB 5C4XG 4X65Q 3U50C 1ESRA 1SMYC 5CMDA 1WTRA 3AYHB 2L55A 1NY4A 1HZAA 3DXJC 3ER0A 2EIFA 1RIPA 1HNXQ 2QA4A 4M1UB 2FMMA 1JE5A 2QGQA 3M4PA 4IPDA 4DV1Q 2N55A 1UE5A 5KRUA 1AFPA 1O78A 2WAQG 3PO2G 1OO9B 4OO1H 3NE5B 2H5XA 1SYDA 4JI6L 4GKJQ 1YVCA 1V1PB 1LO5D 3CF5A 1I5FA 1PLFA 4LFCQ 3V2TA 1EOTA 1EWHA 4B3SQ 4DV0L 5M5WB 1S40A 3OW2A 3Q0AA 2KOLA 1NMGA 3TN2A 3I8ZA 5TSSA 4K5XA 3OPOA 2A6HC 1J5EL 5ELCA 5DAUA 1GUOA 2F3VA 2AMCB 4O0AA 1D2BA 4C3JH 4OGQC 4QIWB 5FJ8H 2RCFA 4RWSC 1A63A 3F2BA 5JJLA 3R2IA 3HKZG 1SE4A 4E6IA 4Y7NH 1YNND 4N8X1 3D4RA 2IT1A 3ICEA 1IXRA 4OXPA 2Z4HA 5T1IA 2DJGC 3OSOA 3FP9A 2MO0A 2SEBD 4P71A 2L5TA 2XRSD 2FINB 1OXSC 1H9SA 4UDUC 1QNKA 2CWAA 4AIMA 1E22A 4K2KA 1IKMA 4NP5A 1ZXTA 3S1QH 2VUMG 2CKZB 1SNDA 2ZJPA 1K3RA 1KL9A 1LYLA 1Q8IA 4XTCS 4HIMA 4ILWA 2KECA 2XNAC 4M8AA 4F7XA 3EQLC 4ZYSA 2B2YC 3BZDB 1IYUA 1GUWA 3MXPA 1ICFB 1LTAD 1JICA 1IZ6A 1T5XD 3KUPA 2OCEA 1LTBD 1VQAA 2AQ1B 4LUZA 5IE8A 4KJOA 1HZBA 3DWPA 1PVOA 4JV5L 1OTCA 1MSGA 4MIUA 2IJ0A 1ASYA 1Y8PB 5ISRA 1W2BA 1FD7D 2VZAA 3H94A 4U68A 3K7AB 4GLAC 3X3NA 4LF7Q 5IT9E 1CKNB 2C35B 1ASZA 4OHJA 2ZJRA 4XIGS 5JVH3 3PIP3 2NYZD 2YU9H 3VA7A 1K83B 4RH6A 3QWNA 3FHWA 2DY7A 5H1SE 1QVGA 4K5WA 2O5IC 4HIKA 4DR2L 4C3HG 3GP7A 4O42A 4LFBQ 2OWOA 2K5NA 2C9OA 1QNUA 2ASBA 5C4XH 4P75A 5IYCH 4XQQA 3GTOH 1SBBB 5BN4A 3SGIA 1QG7A 4DAVA 1PRTB 3HOVG 2YYZA 1JWSD 3PO2H 2ICEC 2ZT9C 5EKLA 1SMXA 1S4ZA 2EQSA 1S5FD 1S5DD 2HUGA 3GTKH 4PZ7A 4ZQ3A 4TQUS 4OELB 1GUTA 4ZK9B 5IY0A 1R4PB 2B2YA 1HRJA 1B2TA 4MHEA 3J7A5 1SNCA 1XTCD 1V8QA 4YWMA 1SYEA 2X6LA 1UE6A 4IUPA 2LXJA 4IQZA 4UP7A 2EJFC 1YNJD 2L9HA 3GV6A 3M4QA 4DK0A 2AUJD 2JEAI 4LF4Q 2EJGC 3CAMA 1XTDA 1YIJA 1X65A 1I4QA 1R9TH 4YY3Q 2Z6KC 3NQTA 2EY5A 4DK6C 5D65A 5DM73 4OONA 1TKWB 5I6YA 2EXZA 1WOCA 2IX3A 4R9WA 1IW7C 2ZXPA 3GTJH 3TBIB 4YHHL 4IUQA 4QJFA 3NBHB 3QOJA 3S2HB 4RCOA 4G7OC 5ELBA 4POGA 3CC7A 3GTQB 2VUMH 3UE1A 1VQHA 3L3OC 1TY0A 4XDXA 1NR2A 2WKDA 1PTOC 4DAYA 3CMEA 1Q1EA 4QIWE 2LMCB 2I46A 5M3MB 3GTLH 4RHRA 1GVPA 3WWVA 4LF6L 1BCPB 1RJTA 1HXYD 3CW2C 4TKOB 2EYOA 1EYDA 2K1BA 1WTXA 1K8MA 1U0LA 4X64Q 2CHBD 1QB5D 3U9SA 1I94Q 2NVQH 3SDZA 2F0GA 1BXTA 1L0XB 4AQYL 3BZKA 2RKSA 3G7LA 5IGGA 3NELA 4JI7L 4UP8A 3BVMA 2PMZB 1NJIC 3V05A 4K8JA 1HUNA 2J7ZA 4C3HH 4DAPA 3K58A 1VQBA 3OIQA 4B3TQ 2Z6KA 2IW3A 1TS4A 3PIO3 4UY8C 2JA6G 3L0OA 1N36L 4ULLA 4A3FG 4BA1I 1MGSA 3A54A 2PZUA 1GUSA 2ICIA 4ZUJA 1VQLA 3HOVH 2M00A 1CQFA 5BR8Q 1I4XA 3K0XA 5BN5A 2UXDL 2QILA 1YHBA 1CFMA 1D7QA 1O80A 1WCMG 1N33Q 1DXMA 3E0EA 1A3VA 4KK7A 2YV5A 4NKLA 4CKEA 2E2IB 4O1NA 4ZAIA 1VQIA 1FVIA 4C3JB 3ZJYC 4DR3L 4F8MA 1TWGH 3NENA 4KD4A 4GNXC 3VR2A 1K8OA 1DOKA 4C3IH 4DA2A 4MZ9A 2B2TC 3MXGA 4DUZL 4DN4M 3RUZA 4DR5L 5JJKA 1JC7A 1HH2P 4IZ8A 2B29A 1X56A 3T16A 4CHTB 3KF6B 1ILPA 4R4TA 3UDGA 2FHTA 1VQMA 2N3SA 1NE3A 1X3FA 3G6EA 4LF9Q 5I9PA 5CV9A 1X3PA 3S1QB 4K0KQ 2O2LD 3CCEA 4KY5A 5KYLA 4BBSG 1J9OA 4YCWA 3PO3G 2D5DA 2UUBQ 1EL0A 3Q6SA 4JI1L 1GKHA 4NXMQ 1I50H 2F0HA 1EOVA 2JXMB 1DGSA 4A3JH 2UU9Q 1UWVA 3I4OA 1HNWQ 3FEWX 3M4OH 1PH9A 3HZXA 4Q0FA 3EA6A 2EDGA 2K03A 3FRPB 3IFDA 4EX5A 3SXHA 5CC4A 1VQOA 2ZXOA 1E24A 3F1ZA 5JVG3 5DEHA 3I72A 3T51B 4KV6A 3EFXD 4XQJA 2BH8A 4DU9A 1VQPA 3K5OA 1GXDC 5FO8B 1J8IA 4KN4C 4HJ5A 4EGVA 1P16A 1DD2A 1A3UA 3VYRA 2VQEQ 3TSSA 1XWEA 1MD2D 2BH2A 3NXWA 2KA7A 2RA4A 2JA7H 2NTSA 1VF7A 4IUVA 4APVA 1IBLQ 5LMUQ 4GNXA 4A3GB 1DM0B 3I55A 1XMQL 2B2TA 3C1FA 4XT1B 2R7ZH 5CV6A 2KHSA 2EVBA 3CD6A 2PPBC 3A7LA 3GV3A 4JI2L 4DNIA 4KHPL 3RN5A 4JBMA 3EJIA 2JA5G 2WAQB 3PO2B 4ALPA 1F2ZA 2RVLA 1STNA 1FNUA 3CCVA 1RCVD 4XQNA 1SDFA 3Q22A 1ENCA 1O7IA 2Z1CA 4HEDA 4KI0A 2F0DA 2JA6H 4A93G 4RA8A 4A3FH 4H13C 2EJMA 4WRDA 1Y1VG 2KCNA 4XXEA 1Q81C 3N6RA 1V1OA 1QVFA 3O13A 2MPMA 5FK9C 3M7NA 1SNOA 3KLSA 2AKWB 4DV7L 5K36G 5JJIA 1WCMH 1G6ZA 1AP0A 2HIVA 4EQ5A 2PO4A 1N32L 2D62A 1WTPA 5I4DA 2ZM6Q 3HFZB 4BBRB 3GD7A 3PGZA 3GTMB 4TVAB 3TQYA 1MIUA 4X62Q 2KJXA 3HKZB 1JORA 2P5ZX 3MWYW 2FJ2A 2PMZE 1CM9A 3HRZC 1C48A 3IKJA 5JEAJ 2HCIA 2NVYB 1X54A 4NPSA 5LMNW 1BCPD 4RMFA 1M4VA 3GTJB 3MXNB 3STBC 2NTTA 3PQIA 2PQAA 2F4VQ 3M7GA 5ELDA 4DV5L 2X6GA 3GTGB 1SAPA 2YTYA 4BBSH 3W5OA 1AEXA 3PO3H 2F0KA 1LLRD 1X6OA 3CQZB 1K0SA 3S17B 3R2TA 4FF1A 1VQJA 2NVXB 1U4PA 2DN8A 1VQNA 2OT2A 4LJZC 5E4XA 3S1NH 1AN8A 1SFOH 5M5XB 4DR4Q 4IFDJ 1B9MA 4DR6Q 2K28A 4P73A 5KGUA 4DAMA 1VMPA 1XPOA 2MHVA 2PZWA 3LWEA 1X32A 1D5XC 5ELEA 1WYDA 4OWXB 1CZGA 2SNMA 3I4MH 2B2WC 4IURA 1HNZL 1U4MA 3K81C 4Y52H 1JOOA 3HOXH 4C56C 3NTIA 5M3FB 4X3SA 1YZ6A 1LABA 4K14A 1G291 2K5HA 4BWGB 4C3HB 1YBYA 3BVZA 5FJ8G 1ZYRD 1VCIA 1SYFA 1FJGQ 3NBIA 2A8VA 3T13A 1O7LA 2RF4A 2E5LQ 3HOVB 2Z9HA 1E2VA 1NSNS 3FDTA 1A62A 1L0WA 3PIPA 2JA5H 1PFSA 4HN7A 4L5TA 2EYHA 3J81c 1F77A 3J7ZC 2CVRA 4GKKQ 3PMFA 2EPBA 2V1CC 3HOYB 3AEVA 2AWNA 3GTPH 1J6QA 2UXCQ 2A1AA 4AYBB 4KN7C 4A93H 4DV3Q 2XRQD 1Y1VH 2HD3A 2KVMA 4PG3A 4LK1C 3S16H 4X3TA 1VQGA 1Y14B 4YIJA 4JYAL 3J80i 2A69C 5K36H 3H09A 1L1OB 1ILQA 4JI5Q 1C0AA 5ELNA 4XYOA 4IFDG 3VYUA 3JAMi 3CCRA 3E9HA 3DMUA 2R3ZA 1ET9A 3P20A 1LACA 4TSSA 5GQOA 5LMNQ 2WAQE 4P2CB 5KIXA 1YHAA 2B2WA 1TWHH 1BBUA 2RDHA 4HSPA 1NUCA 5EJWA 1Q12A 3TP6A 4C1NI 1SE3A 1ONLA 4C2MH 1LTLA 1V1QA 3TDQA 2RQXA 2RCNA 2MNAA 5GAGC 4YWLA 3M4OB 4PNYA 2CW0D 5M9OA 5M5YB 4JI6Q 1AZQA 2EY2A 4RKBA 2F0OA 2K5VA 4JVZA 4XT3B 2FXQA 3LX0A 2MP1A 2CH4W 5IYCG 1YEZA 2EXDA 3ULJA 1UE1A 2R6GA 5C6AA 5D14A 2E76C 1DONA 2XSCA 1CQVA 4DV0Q 2OQKA 1EY8A 4L5RC 3QG1A 1XNQL 2HT1A 3HOUB 4QB4A 3E3XA 3H3VC 1EY9A 3HKZE 3TS0A 1XJVA 4WJ3M 1PDQA 3C1EA 1M1KC 1J5EQ 4A3DG 1RF2D 2X69A 4KY7A 4X3KA 3J80L 3S15B 4IFDI 1VQFA 3ERSX 3FPUB 1DOLA 2JA8G 1CK1A 3L2PA 1Y8NB 3AFPA 1LTRD 1EFWA 1SSOA 1EEID 5FLXL 4MN3A 4RG1A 3JAML 4CJ0B 4QMGA 3BYYB 3BDOA 2QF7A 4A3BH 1BO0A 5EKKA 3ULLA 3FPPA 1G2SA 4GOPB 2R93G 1PZID 4A4IA 1RTOA 5I9OA 1PFBA 2JA6B 5ELFA 4A3FB 3S9WA 3S2DH 4HMIA 1A2TA 1B44D 3W1GA 2K5QA 4QF4A 4KY6A 3NUCA 3PCOB 4B3RQ 4H0LC 5J3BA 1X9NA 1WCMB 3I4NG 4DAYB 2E2JH 3S1MH 1FR3A 2NVTH 4BS9A 1DZ1A 1K0RA 3G6JB 5IWAL 1B1ZA 4DF7A 2A74C 2XTIA 5A2QL 3PIOA 2F1MA 3UDIA 2NB0A 1QE6A 3JC66 1AE2A 2F0EA 3K8AA 1L2FA 3DWAA 2PYKA 1EQRA 2R61A 3T56B 3V96A 5KNBA 4J1MA 4IFDH 1TR5A 3A5ZB 4JI3L 2JE6I 1N34L 3M3YH 4DR2Q 2K50A 1W6JA 3D0FA 3AFQA 4B9XA 4DV6L 3TZUA 3EBEA 1CA5A 3RLNA 1UEBA 3HOWH 1I3QB 3QR8A 1VQ5A 2A6ED 4AYBE 2L4NA 4ZKBB 2HIXA 5LL6S 4JI0L 3VYTA 4DFAA 4A3IH 3KYHC 1XX8A 1HR0L 1PTOF 1FGUA 2K5WA 3NPPA 1SR3A 1LTSD 4UAIA 1ICWA 1SMYD 4X6AH 2MFIA 2K5DA 1MSHA 4NXNL 3QO2A 2VQFL 1RD9D 1XPRA 3I4LA 4POFA 1PYSB 4HCEA 2PZTA 2DY8A 1Q86C 1KTKA 3KDFA 2QDLA 4UHVA 4I7AA 1PRTF 1N8RC 3RN2A 3OOCA 2K04A 2EOTA 1IKLA 1Q90A 4B3MQ 4A3DH 1QUQA 2JA8H 3HOZG 3A8JE 3NP8A 4PZ6A 3PV0A 4DV2L 1JOKA 2HQLA 4CJ1B 4CGYB 1A8VA 4C3IG 2ENBA 4L8JA 4KTAA 2B8FA 4KD3A 2Y0SG 5LHY1 3SHLA 2A6HD 2MQHA 2JA5B 2D2CC 4YHHQ 4KHVA 5FO7B 3BVGA 4J15A 3MEHA 5C3EB 3B6YA 2R93H 1TWAB 4A93B 2Q2HA 2SNSA 3I73A 1MI2A 2HDMA 5IP9G 1E2WA 5C44G 1I4PA 1PYBA 3ND8A 1H9RA 3I2ZA 4A3JG 1STGA 4BY7G 2GN5A 1Z6HA 4BY1B 3I4NH 3CC4A 4PZ8A 1PH2A 1GO3E 1VQEA 4LF6Q 4DR7L 4FO2A 5NUCA 2B63H 3H3VI 1BVSA 4ZCKA 3I70A 1VQDA 4A3KG 4L5QA 2FFKB 2Z6BA 3CKIB 2N49A 3P1HA 3TRZA 5DLQE 3RR5A 2F0JA 1LV9A 1NAPA 4ODGA 2JQOA 5JJZA 1TWFB 2WINB 1KRTA 4AQYQ 4JI8L 1OXTA 1XYIA 4GS3A 1KNAA 2VY3A 3S1RB 3MA2B 2KENA 2IY5B 5IT9c 4JI7Q 1FGBD 2WKCA 3H0GG 2XIWA 4HR7B 1B70B 1RL2A 2JA7G 1PRTC 1QWYA 1AZPA 3EIVA 1SYBA 3PUZA 4DR1L 2R7ZG 2D0OA 2IX0A 4G7ZC 1EZ6A 4FF2A 2BE5C 2QEXA 4ID6A 1EWIA 5C0XJ 2UXDQ 1EY0A 1SROA 3J7AV 1TWCH 4X3UA 2NZ1D 3ITPA 1PH7A 4PV1C 4LF8L 2L1BA 2R92G 1VMCA 3AMUA 2UUCL 1VQKA 2MO1A 3KF8B 1A2UA 1RHPA 1STEA 2F0VA 3FKIG 4DR3Q 1CI3M 4IPGA 2QDBA 1I6HH 3RZOH 4DNRB 2E2HH 1HQRD 1X55A 4DUZQ 1CZWA 4UPAA 5GROA 4DR5Q 1QJOA 3TREA 2HHHL 1HHVA 3H3VH 2K7VA 3T1HL 2VB2X 1JQYD 1WJJA 3HOZH 3ZYYX 5E4WC 2G5DA 1XMOL 3WDNA 4OX9L 1PH4A 3S2DB 4Y7NB 2JN4A 1RODA 3GDEA 1KAAA 3RNUA 2UXBL 4JI1Q 1WFQA 1ET6A 1SJHD 2BOSA 2QCPX 5CV4A 1K8GA 3CPWA 3F2DA 2E2JB 2PI2A 4CDDC 5CBEE 4JCVE 5JOBA 4PMCA 3TEHB 1U5KA 4KKSA 1EYCA 2SOBA 2F0QA 1WTVA 1HUMA 5IP9H 5E3FA 3T1YQ 2KCTA 1MJEA 1NMFA 1H9JA 1XNRL 4RFBA 5C44H 1IW7D 2PNHA 4ZKCB 3Q23A 3J7AF 1QVCA 5EKIA 2RBMA 5KYIA 1KRSA 2SDFA 1GUGA 4LUVA 5C0XG 1ENAA 4TRDA 4BY7H 5FOBB 1E0BA 1JOQA 4JW0A 1GUNA 5IYDG 2B39A 3HEJA 1TU2B 2F52A 3ULPA 1S5ED 1AE3A 1KNEA 1KDCA 4A3KH 2WACA 2D9UA 5HGTA 2F0MA 3UI2A 4ABNA 1F9QA 1HFGA 2K01A 1S72A 1JJ2A 1PTOD 1XMQQ 5I6WA 1PHJA 3I4MG 4R4IA 2XWBB 1SYGA 3K5LA 1G91A 4F87A 2ZXRA 1OXUA 4X66L 3HOXG 4JI2Q 4KHPQ 5E7NA 2YU9B 5CORA 1VF5C 1JWMD 1JT8A 2KCMA 1G2TA 3H0GH 2LXKA 4H7BA 2F0LA 2BA0A 1EFID 3H15A 5C4XB 3MAQA 2A5HA 4B9WA 1HTLD 3K0YA 3NBHA 5E1FA 3GTOB 2F0TA 2VL6A 3CRLC 1F9SA 4FXDA 2B2VC 2WFWA 2JSOA 4GN5A 1BBWA 4DV7Q 1Q3LA 1S3OA 2KCCA 1KQSA 5C0XI 4JI4Q 1STAA 4P72A 2JJQA 4K6LA 1N32Q 1I4GA 5G3LF 4DUYL 2R92H 2ALYB 5JPMC 3GTKB 3P7JA 3PSIA 1Y1WG 2QEJC 1ZKOA 3DUZA 3FKIH 1D1KA 1S5BD 3BJUA 4RKLA 3KLRA 5M5WH 2F4IA 1PH6A 4G4KA 3IRBA 4CDEC 3OW7A 3CCMA 3OYYA 2E8GA 1IYJB 5CR3A 3F2UA 5L37A 2NWGA 4IPHA 3A5UA 4WFN3 4DV4L 1E1TA 2R93B 2K05A 4KHZA 4LNQA 2R7FA 1KABA 5CV7A 1R9TB 1DCZA 1UNSA 5DM63 4QUCA 4IUTA 5K5PA 2Q2TA 5EPJA 1YI2A 1Y69U 3IFTA 3OMCA 2CWPA 1UUPA 1LT6D 1BQQT 4A3EG 1W3SA 4RAUC 1PV4A 1EYAA 1DOMA 1T5EA 1B8AA 3D4DA 4G7HC 2OTJA 2VUMB 1F2MA 3SK8A 1I6VC 3VYSA 3K7UC 4K5VA 4A75A 4WJWA 5M3MG 4FXGC 3J80E 1MHWC 3RD4A 4N9PA 1HNZQ 1PZJD 5C0XH 3GTLB 2Q8IB 5FLXE 2CW0C 1SRUA 3A74A 1K9MC 1C4QA 5IYDH 3JAME 4JOIC 4RGNA 3K7AH 1BUVT 1HPCA 3H91A 2UUAL 1TS5A 2NVQB 3KF6A 4G57A 2TMPA 2VNUD 3MZ5A 1PTOH 3K59A 2RDFA 2DNCA 4I7ZC 3A56A 4NMZA 1U4LA 4A3BG 3G71A 5GAEC 2KHJA 4FDBA 3NEMA 3G4SA 3K57A 4A76A 1PMRA 4IN3A 1F2YA 1AH9A 1CUKA 1N9WA 1JWUD 1GOZA 5IGFA 1KD1C 2F0SA 1IBKL 4LF5L 3WOEA 3J81i 1NBWA 2N88A 1JE4A 1H9SB 3CCUA 1Z7TA 1F2LA 2OXPA 1RKNA 5JEAG 2N8NA 1VS0A 1EQTA 1I6HB 3QB3A 4L63B 1CTMA 1SN8A 2KHIA 3AB9A 4FF3A 1IL2A 4JYAQ 2E2HB 2L0CA 2L11A 4LFAL 5A2QE 1VQ4A 3MC0B 1CA6A 1U9RA 5EBDA 1UE7A 1BOSA 1PFNA 3R8BA 3PUVA 2F0WA 1Y1WH 1YITA 3LNNA 1Q46A 4C1NK 2DGYA 3HOZB 1OXXK 1YNNC 2RSOA 1TWGB 2B3GA 3NTKA 2OEOA 5I2YA 1IBMQ 4FF4A 1Q7YC 4HTHA 4C3IB 3FVQA 2IL8A 1AW7A 5JPNC 4K2LA 2Y0SB 3MHBA 1KIXA 3OWFA 3QIAA 4JOIA 3SE0A 2Z4IA 2B8GA 1PXUA 1A3TA 2L15A 1ZEQX 2NBFA 2EYFA 4CKCA 1OXVA 4NW2A 3HKSA 1KLUD 1LUZA 1HCZA 4JBKA 5D3IB 3PF5A 3I90A 1NCVA 4DPGA 3HOWG 1MBYA 2A68D 2K33A 1BR9A 1P8LA 2V4DA 1HR0W 2XWJB 4GKKL 1I50B 3J81L 3S2HH 1TY2A 4GLXA 1XNQQ 4A3JB 4BY7B 3STBD 4N8FA 3GTQH 4A3IG 4A3EH 4HIOA 2BDNA 3U9OA 3RZDH 2KBNA 4LWCA 5GAHC 1PH5A 3AQQA 5HGQA 2NZHA 4BXXG 4ZRZA 3SR1A 4A3KB 1GHKA 2EYJA 3MTSA 3Q24A 1JMCA 2ES2A 5AJ3L 1QUQB 5M3MH 1QCBD 3MVVA 3U58A 5C5LA 5C4JH 1ESFA 4QGUA 5JAVA 1C7YA 2LSSA 2GA4B 1LT4D 5C4HA 2VXWA 3VA5A 3OTOL 3RLFA 3KOJA 1UAPA 2EYPA 2E74C 2I07B 3S14H 5ELOA 4A3GG 5FO9B 2PQEA 1LTTD 1KAWA 2JA7B 2I5MX 4WORA 2WB1G 2IHEA 3H6MA 5G3LD 4JPBW 3MXNA 4FYDA 5KEEA 2R7ZB 1VDZA 1WTWA 1EY7A 4OWWB 2Q8RE 5C3WA 1KHIA 3KBGA 2C5CA 4JK1C 4X65L 1FNWA 1PA6A 2R92B 2J0TD 1Q1BA 2VS1A 4IOCA 5IWAQ 5CV8A 1HNXL 4EQOA 5IOCA 1BNZA 3FKIB 4IPCA 2F0UA 4DV1L 2EZVA 5JEAH 3ONAB 3EROA 4RGMA 3EN2A 1L1OC 1DYQA 2XGTA 3BG3A 3E6ZX 1WI5A 4GKJL 1JJCB 1YNJC 2QKIC 2H4OA 2E2IH 1D8LA 4BBRG 4HJ8A 3NWTA 2A73B 1VQ7A 1N34Q 4JI3Q 3TP5A 3UE0A 3KJPA 4LFCL 4FVMA 2B63G 3KFUA 4JV5Q 2G9HD 3A55A 4B3SL 4KKUA 3CXCA 2ID0A 3VDYA 4DV6Q 2NZOA 3VR4A 2F03A 1GM5A 3OHXC 3TP8A 2A69D 3KK7A 1IHZA 1NNXA 5EPLA 1M8AA 3CU7A 2F0FA 4QL5A 3SK6A 1EIGA 4JI0Q 1IYVA 3R93A 4ZLTF 1VQ8A 1HR0Q 5IP7G 2IHFA 2F3IA 1QOHA 5AFWA 2YTVA 5FLMG 3KLWA 3ND9A 1X3GA 4OIJA 4OL7A 1G6PA 4BBSB 2CFMA 4NXNQ 2VQFQ 3PO3B 3C2PA 4HSVA 4B3RL 3NSWA 1DJRD 3UDXA 1KDAA 1Z47A 3S1NB 2EE1A 1KDBA 1Q8KA 2AHOB 3D4WA 1SFOB 1I4HA 3UDFA 5F2DA 4EQPA 2VW9A 1ML0D 4BXXH 1C8CA 2OTLA 2Y0SE 1B53A 3TMEA 1NR4A 1L1OA 3HG9A 4DV2Q 5M3FG 2A19A 4DK1A 1SNQA 3I4MB 1SJED 4GOPC 1PTOB 3HOXB 4R8IA 3MEFA 1EYGA 3K80C 1RDPD 4HJ9A 2ZJQA 4NB3A 1GD7A 4A3GH 1PH8A 5IGCA 5IYBG 3CCQA 4LF7L 1YNXA 3NHHA 2IWHA 1T9HA 3GQBA 3CRKC 4A3CG 2K14A 2R7DA 1IL8A 1EIHA 4EQNA 4RCNA 4KLKA 4J6HA 4HCSA 2Q2UA 1YJ9A 1BDOA 4LFBL 5D3DA 4IJLA 4S3SA 3HOYG 1D5MC 1G51A 1X3EA 1C9OA 1S5CD 4FXKC 4AYBG 3EVQA 3GTPB 4DR7Q 4IOAA 1STBA 3I91A 4QQBX 2ZTCA 1Y1WB 5EAYA 2K75A 2N78A 1YJNA 1Y1VB 1CHQD 2F0NA 1JB7A 2I5LX 2ATWA 3A0JA 3S16B 1FNVA 2B2UC 1K73C 1V1PA 3KBXA 2JEBI 2HCCA 3D8GA 4N9TA 3HP3A 4B3ML 3DEPA 4JI8Q 4JC0A 1Q82C 1B9NA 2JK8A 4BBRH 2NN6G 4PMWA 3GTMH 4IALA 1EU4A 1XPUA 5J22A 1A6XA 4MNOA 4YCUA 2NVYH 3DM1A 1ENFA 4DR1Q 4R1JA 3MFGA 1CKOA 4A3MG 1TWHB 1CSQA 4GOPA 4I65A 1HZ9A 2EY1A 3T53B 3CCSA 4GNXB 4FNFA 3RLOA 3G48A 1O7ZA 4DK3C 1E7ZA 5T1GA 1LT5D 4LF4L 4V0BA 4KJNA 4C2MB 2DNEA 2M2LA 3GTGH 4OWTB 4YY3L 4A3EB 5CBAE 1JJGA 5IP7H 4LUOA 1WVLA 4LF8Q 3RZDB 5FLMH 2KEEA 3DHQA 2UUCQ 3A8KE 1A15A 3CQZH 4RGTA 1BCPF 3S17H 1PH1A 1CKMA 1N36Q 2NVXH 4JBWA 2VB3X 1FYCA 3HOUG 1EY5A 4CDFC 3BDCA 5C4JB 3QOLA 2AQ3B 5M5XH 5CV5A 3M85A 2FMCA 1FL0A 3K6OA 1E2ZA 2HQEA 3S24A 4R8NA 2HHHQ 2NN6I 4HMJA 3S14B 1JR0D 2XN9C 2F0IA 1B3QA 5IODA
chains in the Genus database with same CATH topology
3AU7A 1U4RA 2F3WA 4PQXA 2B2UA 1LTID 3I3CA 2O5JC 2PCFB 3TP7A 3DEOA 5IT9L 1EU3A 5A35A 4A3BB 4ME5A 1HQMC 5FKAC 4K6DA 1WTQA 3NTHA 2KEDA 3NK9A 3NQIA 1HA6A 1II3A 2EY6A 3P75A 2PW7A 3SEBA 1B50A 2K32A 3E0JA 2L12A 1F9PA 1EY6A 3D3RA 1Y8OB 3ERQA 3MXUA 3PUXA 1LTGD 2KUMA 4CJ2C 2K6AA 3S1MB 3NWSA 4J8QA 3C3LA 2E75C 1CT1D 1H9KA 2NVTB 3M4YA 4DGZA 4KKTA 2IPKD 3PUWA 1STHA 1HA5A 3L9AX 1LT3D 4NDXA 1EEFD 1UEAB 3VR6A 1BCPC 4LMQD 2NN6H 5IGBA 3C46A 2MJ8A 1BF4A 3M3YB 2JP1A 3X3MA 1D5ZC 3WOFA 5DNFA 3HS0C 3SK5A 3D31A 5LL6X 4GZYC 3HOWB 4V190 3LWUA 1WD0A 4PMBA 4A3IB 2LS01 1R4QB 1PRTD 2RSNA 1TIID 1EQVA 1EWCA 3T4AC 4CKBA 1SNMA 3OMGA 4OIKA 5EPKA 2BE5D 5KNCA 3W3AA 2G9DA 5C3XA 3QJYA 3W2DA 5BN3A 3PUYA 4IUUA 4QUFA 3TZDA 1ZYRC 1WTOA 1CHPD 4A3DB 5KNDA 2JA8B 1SXTA 2WB1B 1PYWD 3D6WA 2LFNA 3SVMA 4DXGA 4LAAA 2M9VA 3IL8A 3N52A 1HTPA 2OF1A 4KMUC 4BA2I 4U673 1WD1A 5IIFA 3J81E 4L6TB 3J7YW 2EYMA 5HURA 2Z8LA 3BYTB 2LKVA 1D6EC 4H44C 3VR5A 2LY7A 3KF8A 3A8IE 2HDLA 3GO5A 2H1EA 3HGBA 3I4NB 2F0PA 1KLGD 5J1ZA 5IGDA 1TS2A 2B63B 4Q5VA 1L0YB 1X3QA 5COYA 2PW5A 3R3OA 2TSSA 2B2VA 5EGTA 2A68C 2BA1A 4CBVA 2E2DC 5CYUA 2CQAA 3FMCA 4DXFA 2WIIB 1GJXA 1G8ZD 1TS3A 1GHJA 1JB3A 1JCKB 2Q8TA 1O7YA 1F9RA 4Z9CB 2KQ3A 5C4ZA 1HFNA 2RDGA 1RTNA 4F88A 4OO1G 3BDLA 1SEBD 1TWCB 5CGKA 2J4XA 4IUNA 3SK4A 1EY4A 3RZOB 2AQ2B 2AWOA 1QILA 4HAEA 2MGSA 3IAYA 4C3JG 4XYQA 5EBCA 1W6KA 1PZKD 3D6CA 2BCOA 5EQ0A 3BS1A 4DNTB 2XVSA 3OWEB 4RHSA 2WP8J 1SNPA 4OO1I 3K5MA 1TT2A 3A7AB 4EVOA 1STYA 5I2XA 1V43A 3CHBD 1SE2A 1BBXC 1EZ8A 3VR3A 4FP5D 2IX1A 4RGOS 1SYCA 1H9MA 5C44B 3OIPA 1TVXA 1PFMA 4B08A 5J39A 1I4RA 2AUKA 5C5MA 2O4XA 3KLSX 2BDOA 2NUCA 3K5NA 4QCLA 2WV6D 5IGEA 3E5SA 4A3MB 2A6EC 2EYLA 3DWQA 3RMHA 1XXGA 2PNRC 2MUYA 4ZUIA 3MFYA 4K8IA 1TQOA 2JYOA 1B4OA 3L7ZC 3URYA 1B3AA 1D1IA 3H0GB 1ESRA 1SMYC 5CMDA 1WTRA 2L55A 3DXJC 4M1UB 2FMMA 2N55A 5KRUA 1AFPA 1O78A 1OO9B 4OO1H 3NE5B 1SYDA 1V1PB 1LO5D 1PLFA 3V2TA 1EOTA 1EWHA 5M5WB 3Q0AA 2KOLA 3TN2A 3I8ZA 5TSSA 4K5XA 3OPOA 2A6HC 5ELCA 5DAUA 1GUOA 2F3VA 1D2BA 4OGQC 4QIWB 4RWSC 3R2IA 1SE4A 4E6IA 1YNND 3D4RA 2IT1A 2Z4HA 5T1IA 3OSOA 2SEBD 2L5TA 2XRSD 2FINB 1OXSC 1H9SA 4UDUC 1QNKA 4K2KA 1IKMA 4NP5A 1ZXTA 1SNDA 4XTCS 1Q8IA 4ILWA 2KECA 2XNAC 4M8AA 4F7XA 3EQLC 4ZYSA 2B2YC 3BZDB 1IYUA 1GUWA 3MXPA 1LTAD 1JICA 1T5XD 3KUPA 1LTBD 2AQ1B 4KJOA 3DWPA 1MSGA 4MIUA 2IJ0A 1Y8PB 5ISRA 1FD7D 3H94A 4U68A 3K7AB 3X3NA 5IT9E 4OHJA 4XIGS 5JVH3 3PIP3 2NYZD 3VA7A 1K83B 4RH6A 3QWNA 2DY7A 4K5WA 2O5IC 4C3HG 3GP7A 4O42A 2C9OA 1QNUA 4XQQA 1SBBB 5BN4A 1QG7A 4DAVA 1PRTB 2YYZA 1JWSD 2ICEC 2ZT9C 5EKLA 1S4ZA 1S5FD 1S5DD 2HUGA 4ZQ3A 4TQUS 1GUTA 4ZK9B 1R4PB 2B2YA 1HRJA 1B2TA 4MHEA 1SNCA 1XTCD 1V8QA 1SYEA 2X6LA 4IUPA 4IQZA 2EJFC 1YNJD 2L9HA 3GV6A 4DK0A 2AUJD 2JEAI 2EJGC 1I4QA 3NQTA 2EY5A 5D65A 5DM73 1TKWB 5I6YA 2EXZA 2IX3A 4R9WA 1IW7C 2ZXPA 3TBIB 4IUQA 3QOJA 3S2HB 4RCOA 4G7OC 5ELBA 3GTQB 3L3OC 1TY0A 4XDXA 1NR2A 2WKDA 1PTOC 4DAYA 1Q1EA 2LMCB 2I46A 5M3MB 4RHRA 1BCPB 1RJTA 1HXYD 4TKOB 2EYOA 1EYDA 2K1BA 1WTXA 1K8MA 2CHBD 1QB5D 3U9SA 3SDZA 2F0GA 1BXTA 1L0XB 2RKSA 3G7LA 5IGGA 3BVMA 2PMZB 3V05A 4K8JA 1HUNA 2J7ZA 4DAPA 3K58A 3OIQA 2IW3A 1TS4A 3PIO3 4ULLA 4BA1I 1MGSA 3A54A 2PZUA 1GUSA 2ICIA 4ZUJA 2M00A 1CQFA 1I4XA 5BN5A 2QILA 1CFMA 1O80A 1DXMA 4KK7A 1A3VA 4NKLA 4CKEA 2E2IB 4O1NA 4ZAIA 4C3JB 4F8MA 4KD4A 3VR2A 1K8OA 1DOKA 4DA2A 2B2TC 3MXGA 4DN4M 3RUZA 1JC7A 4IZ8A 3T16A 4CHTB 1ILPA 2FHTA 5I9PA 5CV9A 1X3PA 3S1QB 2O2LD 4KY5A 5KYLA 1J9OA 2D5DA 1EL0A 3Q6SA 2F0HA 2JXMB 3FEWX 3HZXA 4Q0FA 3EA6A 2EDGA 2K03A 3FRPB 3IFDA 5CC4A 3SXHA 2ZXOA 5JVG3 5DEHA 3I72A 3T51B 4KV6A 3EFXD 4XQJA 4DU9A 3K5OA 1GXDC 5FO8B 1J8IA 4KN4C 4EGVA 1DD2A 1A3UA 3VYRA 3TSSA 1XWEA 1MD2D 3NXWA 2KA7A 2RA4A 2NTSA 1VF7A 4IUVA 4A3GB 1DM0B 2B2TA 3C1FA 4XT1B 5CV6A 2KHSA 2EVBA 2PPBC 3A7LA 3GV3A 3EJIA 2WAQB 3PO2B 1F2ZA 2RVLA 1STNA 1FNUA 1RCVD 4XQNA 1SDFA 3Q22A 1ENCA 2Z1CA 4HEDA 4KI0A 2F0DA 4RA8A 4H13C 2EJMA 4WRDA 2KCNA 4XXEA 3N6RA 1V1OA 3O13A 2MPMA 5FK9C 3M7NA 1SNOA 3KLSA 5K36G 1G6ZA 1AP0A 2PO4A 2D62A 1WTPA 5I4DA 4BBRB 3GD7A 3GTMB 2KJXA 3HKZB 1JORA 3MWYW 2FJ2A 1CM9A 3HRZC 1C48A 3IKJA 5JEAJ 2HCIA 2NVYB 1BCPD 1M4VA 3GTJB 2NTTA 3M7GA 5ELDA 2X6GA 3GTGB 1SAPA 1AEXA 2F0KA 1LLRD 3CQZB 3S17B 3R2TA 4FF1A 2NVXB 1U4PA 2DN8A 2OT2A 4LJZC 5E4XA 1AN8A 5M5XB 4IFDJ 1B9MA 2K28A 5KGUA 1VMPA 2MHVA 2PZWA 3LWEA 1X32A 1D5XC 5ELEA 1CZGA 2SNMA 2B2WC 4IURA 1U4MA 1JOOA 5M3FB 4C56C 3NTIA 4X3SA 1LABA 4K14A 1G291 4BWGB 4C3HB 3BVZA 1ZYRD 1VCIA 1SYFA 3NBIA 3T13A 1O7LA 3HOVB 1E2VA 1NSNS 3FDTA 4HN7A 2EYHA 1F77A 2CVRA 3PMFA 2EPBA 3HOYB 2AWNA 4AYBB 4KN7C 2XRQD 2KVMA 4LK1C 4X3TA 4YIJA 2A69C 5K36H 3H09A 1ILQA 4XYOA 4IFDG 3VYUA 3DMUA 2R3ZA 1ET9A 3P20A 1LACA 4TSSA 4P2CB 5KIXA 2B2WA 2RDHA 4HSPA 1NUCA 5EJWA 1Q12A 3TP6A 4C1NI 1SE3A 1ONLA 3TDQA 2RQXA 3M4OB 5M5YB 4PNYA 2CW0D 5M9OA 1AZQA 2EY2A 4RKBA 2F0OA 4XT3B 3LX0A 2MP1A 2R6GA 5C6AA 5D14A 2E76C 1DONA 2XSCA 1CQVA 1EY8A 3QG1A 3HOUB 4QB4A 3H3VC 1EY9A 1PDQA 3C1EA 1RF2D 2X69A 4KY7A 4X3KA 3J80L 3S15B 4IFDI 3FPUB 1DOLA 1CK1A 1Y8NB 1LTRD 1SSOA 1EEID 5FLXL 4MN3A 3JAML 4CJ0B 4QMGA 3BYYB 3BDOA 2QF7A 1BO0A 5EKKA 3FPPA 1G2SA 1PZID 1RTOA 5I9OA 1PFBA 2JA6B 5ELFA 4A3FB 3S9WA 4HMIA 1A2TA 1B44D 2K5QA 4QF4A 4KY6A 3NUCA 4H0LC 1WCMB 1FR3A 4BS9A 1DZ1A 3G6JB 1B1ZA 4DF7A 2A74C 5A2QL 2F1MA 2NB0A 1QE6A 2F0EA 3DWAA 2PYKA 2R61A 3T56B 3V96A 5KNBA 4J1MA 4IFDH 1TR5A 2JE6I 1W6JA 4B9XA 3TZUA 1CA5A 1I3QB 2A6ED 2L4NA 4ZKBB 5LL6S 3VYTA 4DFAA 1XX8A 1PTOF 2K5WA 3NPPA 1LTSD 4UAIA 1ICWA 1SMYD 2K5DA 1MSHA 3QO2A 1RD9D 3I4LA 4HCEA 2PZTA 2DY8A 1KTKA 1PRTF 3OOCA 2K04A 2EOTA 1IKLA 1Q90A 3A8JE 3NP8A 3PV0A 1JOKA 4CJ1B 4CGYB 4C3IG 2ENBA 4L8JA 4KTAA 2B8FA 4KD3A 5LHY1 3SHLA 2A6HD 2JA5B 2D2CC 4KHVA 5FO7B 3BVGA 3MEHA 5C3EB 1TWAB 4A93B 2SNSA 3I73A 1MI2A 2HDMA 1E2WA 1I4PA 3ND8A 1H9RA 1STGA 1Z6HA 4BY1B 4FO2A 5NUCA 3I70A 2FFKB 3CKIB 3P1HA 2F0JA 1LV9A 1NAPA 4ODGA 5JJZA 1TWFB 2WINB 1OXTA 1XYIA 1KNAA 3S1RB 3MA2B 1FGBD 2WKCA 4HR7B 2XIWA 1PRTC 1QWYA 1AZPA 3PUZA 1SYBA 2IX0A 4G7ZC 1EZ6A 4FF2A 2BE5C 4ID6A 5C0XJ 1EY0A 3J7AV 4X3UA 2NZ1D 3ITPA 4PV1C 2L1BA 1VMCA 3AMUA 1A2UA 1RHPA 1STEA 2F0VA 1CI3M 2QDBA 4DNRB 1HQRD 1CZWA 1QJOA 1HHVA 2K7VA 2VB2X 1JQYD 3ZYYX 5E4WC 3WDNA 3S2DB 4Y7NB 1RODA 1KAAA 1ET6A 1SJHD 2BOSA 2QCPX 5CV4A 2E2JB 5CBEE 5JOBA 4PMCA 4KKSA 1EYCA 2SOBA 2F0QA 1WTVA 1HUMA 5E3FA 1H9JA 4RFBA 1IW7D 4ZKCB 3J7AF 3Q23A 5EKIA 2RBMA 5KYIA 2SDFA 1GUGA 5C0XG 1ENAA 4TRDA 5FOBB 1E0BA 1JOQA 1GUNA 2B39A 3HEJA 1TU2B 1S5ED 1KNEA 1KDCA 2WACA 2D9UA 5HGTA 2F0MA 3UI2A 4ABNA 1F9QA 1HFGA 2K01A 1PTOD 5I6WA 2XWBB 1SYGA 3K5LA 1G91A 4F87A 2ZXRA 1OXUA 2YU9B 5CORA 1VF5C 1JWMD 1G2TA 4H7BA 2F0LA 2BA0A 1EFID 5C4XB 3MAQA 2A5HA 4B9WA 1HTLD 3K0YA 3NBHA 5E1FA 3GTOB 2F0TA 3CRLC 1F9SA 4FXDA 2B2VC 2JSOA 1Q3LA 2KCCA 5C0XI 1STAA 4K6LA 1I4GA 5G3LF 5JPMC 3GTKB 3P7JA 2QEJC 1ZKOA 3DUZA 1D1KA 1S5BD 4RKLA 3KLRA 2F4IA 4G4KA 3OW7A 5CR3A 3F2UA 2NWGA 4WFN3 2R93B 2K05A 4KHZA 1KABA 5CV7A 1R9TB 1DCZA 1UNSA 5DM63 4QUCA 4IUTA 5K5PA 5EPJA 1Y69U 3IFTA 3OMCA 1UUPA 1LT6D 1BQQT 4RAUC 1EYAA 1DOMA 1T5EA 3D4DA 4G7HC 2VUMB 1F2MA 3SK8A 1I6VC 3VYSA 4K5VA 4WJWA 4FXGC 3J80E 3RD4A 4N9PA 1PZJD 5C0XH 3GTLB 2Q8IB 5FLXE 2CW0C 1C4QA 3JAME 4RGNA 1BUVT 1HPCA 3H91A 1TS5A 2NVQB 4G57A 2TMPA 2VNUD 3MZ5A 1PTOH 3K59A 2RDFA 2DNCA 4I7ZC 3A56A 4NMZA 1U4LA 3K57A 1PMRA 4IN3A 1F2YA 5IGFA 1JWUD 1GOZA 2F0SA 3WOEA 2N88A 1JE4A 1H9SB 1Z7TA 1F2LA 2OXPA 1RKNA 5JEAG 1EQTA 1I6HB 3QB3A 4L63B 1CTMA 4FF3A 3AB9A 2E2HB 2L0CA 2L11A 5A2QE 3MC0B 1CA6A 1U9RA 5EBDA 1BOSA 1PFNA 3R8BA 3PUVA 2F0WA 3LNNA 4C1NK 3HOZB 1OXXK 1YNNC 2RSOA 1TWGB 3NTKA 2OEOA 5I2YA 4FF4A 4HTHA 4C3IB 3FVQA 2IL8A 1AW7A 5JPNC 4K2LA 2Y0SB 3MHBA 3OWFA 3QIAA 3SE0A 2Z4IA 2B8GA 1PXUA 1A3TA 1ZEQX 2NBFA 2EYFA 4CKCA 1OXVA 4NW2A 1KLUD 1HCZA 5D3IB 3I90A 1NCVA 1MBYA 2A68D 2K33A 1BR9A 2V4DA 2XWJB 1I50B 3J81L 1TY2A 4A3JB 4BY7B 2BDNA 3U9OA 4ZRZA 3SR1A 4A3KB 1GHKA 2EYJA 3MTSA 3Q24A 1QCBD 3MVVA 5C5LA 1ESFA 5JAVA 2GA4B 1LT4D 5C4HA 2VXWA 3VA5A 3RLFA 1UAPA 2EYPA 2E74C 2I07B 5FO9B 2PQEA 1LTTD 2JA7B 4WORA 3H6MA 5G3LD 3MXNA 4FYDA 5KEEA 2R7ZB 1VDZA 1WTWA 1EY7A 2Q8RE 5C3WA 3KBGA 2C5CA 4JK1C 1FNWA 2R92B 2J0TD 1Q1BA 5CV8A 4EQOA 5IOCA 1BNZA 3FKIB 2F0UA 2EZVA 5JEAH 3ONAB 3EROA 4RGMA 1DYQA 3BG3A 3E6ZX 1YNJC 2QKIC 2H4OA 3NWTA 2A73B 3TP5A 4FVMA 2G9HD 3A55A 4KKUA 2ID0A 3VR4A 2F03A 3OHXC 3TP8A 2A69D 3KK7A 1IHZA 5EPLA 1M8AA 3CU7A 2F0FA 3SK6A 1EIGA 1IYVA 3R93A 4ZLTF 1QOHA 5AFWA 3ND9A 4OIJA 4OL7A 4BBSB 3PO3B 3C2PA 4HSVA 3NSWA 1DJRD 1KDAA 1Z47A 3S1NB 2EE1A 1KDBA 1SFOB 3D4WA 1I4HA 5F2DA 4EQPA 1ML0D 1C8CA 1B53A 3TMEA 1NR4A 3HG9A 3I4MB 4DK1A 1SNQA 1SJED 1PTOB 3HOXB 4R8IA 1RDPD 5IGCA 2IWHA 3NHHA 3GQBA 3CRKC 1IL8A 1EIHA 4EQNA 4RCNA 4J6HA 4HCSA 1BDOA 5D3DA 4S3SA 1D5MC 1S5CD 4FXKC 3EVQA 3GTPB 1STBA 3I91A 1Y1WB 1Y1VB 1CHQD 2F0NA 3S16B 1FNVA 2B2UC 1V1PA 3KBXA 2JEBI 2HCCA 3D8GA 4N9TA 3HP3A 3DEPA 1B9NA 2NN6G 4PMWA 4IALA 1EU4A 5J22A 1A6XA 3DM1A 1ENFA 3MFGA 1TWHB 4I65A 2EY1A 3T53B 4FNFA 1O7ZA 5T1GA 1LT5D 4V0BA 4KJNA 4C2MB 2DNEA 2M2LA 4A3EB 5CBAE 1WVLA 3RZDB 2KEEA 3DHQA 3A8KE 1A15A 4RGTA 1BCPF 4JBWA 2VB3X 1FYCA 1EY5A 3BDCA 5C4JB 3QOLA 2AQ3B 3M85A 5CV5A 2FMCA 3K6OA 1E2ZA 2HQEA 4R8NA 2NN6I 4HMJA 3S14B 1JR0D 2XN9C 2F0IA 5IODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNM A;  4ZUI A;  4MIU A;  4K8I A;  3OMG A;  1TQO A;  2F3W A;  5IGC A;  3NHH A;  5ISR A;  1U9R A;  2SNS A;  4DF7 A;  2F0H A;  1KAA A;  3BDL A;  5C3X A;  5CGK A;  5CV8 A;  3DMU A;  5CR3 A;  4EQN A;  4EQO A;  5IOC A;  5KYL A;  3TP7 A;  2F0W A;  4IUN A;  2F0U A;  2F0E A;  3HZX A;  5KIX A;  4J6H A;  5CV4 A;  2PYK A;  3ERO A;  3SXH A;  5CC4 A;  1STG A;  4ME5 A;  2OEO A;  4K6D A;  3SK4 A;  5KRU A;  1AEX A;  4J1M A;  4S3S A;  1KAB A;  1NUC A;  1EY4 A;  2F0K A;  4HTH A;  4K5W A;  5CV7 A;  5DEH A;  3NK9 A;  5JOB A;  4PMC A;  2EYO A;  1EYD A;  4KV6 A;  1II3 A;  2EY6 A;  5NUC A;  3TP6 A;  3P75 A;  2PW7 A;  1SYD A;  1TR5 A;  3EVQ A;  4DU9 A;  4K2L A;  1EYC A;  2SOB A;  2F0Q A;  3MHB A;  1EY6 A;  1STB A;  5K5P A;  5E3F A;  3OWF A;  4PNY A;  5M9O A;  3P1H A;  4LAA A;  1A3U A;  2F0G A;  2EY2 A;  3TP5 A;  4B9X A;  2F0J A;  4RKB A;  2F0O A;  3OMC A;  2F0N A;  2RBM A;  3ERQ A;  5KYI A;  1A3T A;  4ODG A;  5KGU A;  2RKS A;  1ENA A;  4TRD A;  3D6C A;  3LX0 A;  5IGG A;  2PZW A;  2EYF A;  3V2T A;  2OF1 A;  5C6A A;  1JOQ A;  3NXW A;  1EYA A;  4K8J A;  3D8G A;  4N9T A;  3TP8 A;  5IIF A;  3D4D A;  5EKL A;  3HEJ A;  1IHZ A;  1F2M A;  3SK8 A;  1EY8 A;  1KDC A;  2SNM A;  2EYM A;  4K5V A;  2WAC A;  4K5X A;  5HGT A;  2F0M A;  4DFA A;  4QB4 A;  5HUR A;  3C1F A;  4ZQ3 A;  4DGZ A;  1JOO A;  1EY9 A;  1SNP A;  2F0F A;  2KHS A;  4IAL A;  5CV6 A;  3SK6 A;  5DAU A;  2LKV A;  1STH A;  2F3V A;  1SYB A;  2PZU A;  5I6W A;  4N9P A;  5J22 A;  4ZUJ A;  3C1E A;  4NDX A;  2M00 A;  1TT2 A;  3EJI A;  4K14 A;  1SYG A;  4KY7 A;  4EVO A;  1EZ6 A;  1STY A;  1F2Z A;  1SNC A;  3U9O A;  1SYE A;  1STN A;  4I65 A;  4OL7 A;  2EY1 A;  4E6I A;  4ID6 A;  1EZ8 A;  2PZT A;  2F0P A;  3SR1 A;  1EY0 A;  2EYJ A;  1A3V A;  5IGB A;  5J1Z A;  1ENC A;  1SYF A;  3OSO A;  4NKL A;  1KDA A;  5IGD A;  4H7B A;  2F0L A;  2F0D A;  3T13 A;  3MVV A;  4KJN A;  3ITP A;  4QMG A;  5C5L A;  4WRD A;  5JAV A;  2PW5 A;  3R3O A;  1NSN S;  4F8M A;  4B9W A;  5EGT A;  4G57 A;  1SYC A;  1A2U A;  5C4H A;  5E1F A;  3VA5 A;  1KDB A;  2F0T A;  3D4W A;  3MZ5 A;  4KD4 A;  2F0V A;  2RDF A;  5EKK A;  4K2K A;  3DHQ A;  5F2D A;  3SK5 A;  2EYP A;  4NP5 A;  4EQP A;  2EYH A;  2EY5 A;  3NQT A;  4NMZ A;  2QDB A;  1SNO A;  3PMF A;  3NP8 A;  1SND A;  1JOK A;  5I6Y A;  2PQE A;  3RUZ A;  5I9O A;  5J39 A;  2EXZ A;  3TME A;  4IZ8 A;  4PMB A;  1F2Y A;  5C5M A;  4WOR A;  1EY5 A;  2O4X A;  2ENB A;  1STA A;  3BDC A;  4F7X A;  5IGF A;  3S9W A;  2F0S A;  3H6M A;  3QOL A;  4HMI A;  4KTA A;  1A2T A;  2NUC A;  3MXP A;  5CV5 A;  3T16 A;  1SNQ A;  4KD3 A;  5KEE A;  3SHL A;  2HQE A;  3QOJ A;  4QF4 A;  4KY6 A;  4R8N A;  3NUC A;  2KQ3 A;  5IGE A;  4YIJ A;  1EY7 A;  2OXP A;  1RKN A;  3E5S A;  1EQV A;  5CV9 A;  5C4Z A;  5I9P A;  4KHV A;  1JOR A;  4HMJ A;  2EYL A;  3QB3 A;  4KJO A;  4RKL A;  5C3W A;  3MEH A;  4KY5 A;  2F0I A;  5IOD A; 
#chains in the Genus database with same CATH topology
 3T1H Q;  3AU7 A;  3KJO A;  1U4R A;  2F3W A;  4PQX A;  2B2U A;  1VQ6 A;  1LTI D;  3BZC A;  5M3F H;  1XMO Q;  3U4Z A;  3I3C A;  4OX9 Q;  2O5J C;  2PCF B;  4IO9 A;  3TP7 A;  3DEO A;  2UXB Q;  1HZC A;  5IT9 L;  1EU3 A;  5A35 A;  4A3B B;  4ME5 A;  1HQM C;  5FKA C;  1CKN A;  4K6D A;  4ME3 A;  1H95 A;  1WTQ A;  3NTH A;  4X64 L;  2KED A;  3NK9 A;  3NQI A;  5IYB H;  1HA6 A;  2I0Q A;  1II3 A;  2EY6 A;  1I94 L;  3P75 A;  2PW7 A;  3SEB A;  1B50 A;  2K32 A;  3E0J A;  4A3C H;  2L12 A;  1F9P A;  1EY6 A;  3M9B A;  4UP9 A;  2PQA B;  1M90 C;  3D3R A;  3DLL A;  1Y8O B;  2K4K A;  4AH6 A;  3ERQ A;  3MXU A;  1XNR Q;  4IJH A;  3PUX A;  1LTG D;  1WTH A;  4P74 A;  2CCZ A;  2ZTD A;  3HOY H;  2KUM A;  4B3T L;  4CJ2 C;  2K6A A;  3S1M B;  3NWS A;  4J8Q A;  3C3L A;  2E75 C;  1CT1 D;  1H9K A;  2NVT B;  3M4Y A;  4DGZ A;  4KKT A;  2IPK D;  5BR8 L;  3PUW A;  1HA5 A;  1STH A;  3I56 A;  3L9A X;  1LT3 D;  4NDX A;  1EEF D;  1UEA B;  4HJA A;  3VR6 A;  1N33 L;  1BCP C;  3CMA A;  4LMQ D;  4MTK A;  4X66 Q;  4JBJ A;  4WJ4 A;  2NN6 H;  1K28 A;  5IGB A;  2PI2 E;  3C46 A;  2MJ8 A;  2CQO A;  1BF4 A;  3J81 j;  3M3Y B;  2JP1 A;  3X3M A;  1D5Z C;  3WOF A;  3E9I A;  5DNF A;  1YHQ A;  3HS0 C;  1K3B C;  4GN4 B;  3SK5 A;  4A3M H;  1EUJ A;  3D31 A;  5LL6 X;  4GZY C;  3HOW B;  4V19 0;  3LWU A;  1WD0 A;  4PMB A;  5M5Y H;  3PF4 A;  2RHS B;  4LF9 L;  4A3I B;  4K0K L;  2LS0 1;  1R4Q B;  1PRT D;  2RSN A;  1TII D;  2ZTE A;  1EQV A;  1EWC A;  3T4A C;  4DUY Q;  1KXL A;  2GVB A;  3T1Y L;  2UUB L;  2OQ0 A;  4R4Q A;  4CKB A;  4NXM L;  1SNM A;  2YTX A;  3OMG A;  4OIK A;  5EPK A;  1LM0 A;  2BE5 D;  5KNC A;  2UU9 L;  3HOU H;  3W3A A;  1HNW L;  3F8T A;  2G9D A;  5C3X A;  3QJY A;  4A3L G;  2JA9 A;  3W2D A;  5BN3 A;  3PUY A;  3S15 H;  4IUU A;  4QUF A;  2RHQ B;  3TZD A;  1ZYR C;  1WTO A;  1CHP D;  4A3D B;  5KND A;  4DV4 Q;  2JA8 B;  1SXT A;  2WB1 B;  3Q8D A;  1SLJ A;  1PYW D;  3D6W A;  2VQE L;  2QW7 A;  2LFN A;  3SVM A;  4DXG A;  4LAA A;  2M9V A;  3DM3 A;  3IL8 A;  3F2C A;  5C3E G;  3N52 A;  4DKA C;  1IBL L;  5LMU L;  1HTP A;  2OF1 A;  4KMU C;  4BA2 I;  4U67 3;  1WD1 A;  5IIF A;  3J81 E;  3U4V A;  4L6T B;  3J7Y W;  4DV5 Q;  2EYM A;  1BKB A;  5HUR A;  1YJW A;  2Z8L A;  3BYT B;  2LKV A;  1D6E C;  4H44 C;  1B7Y B;  1KC8 C;  3VR5 A;  2LY7 A;  4JI4 L;  3KF8 A;  4BY1 G;  3A8I E;  2HDL A;  4CDC C;  2K52 A;  3GO5 A;  2H1E A;  4LW1 A;  3HGB A;  1NTG A;  3I4N B;  3CC2 A;  3CP0 A;  2F0P A;  1KLG D;  5J1Z A;  5IGD A;  1TS2 A;  2B63 B;  4Q5V A;  1L0Y B;  2I5H A;  1X3Q A;  1SE8 A;  5COY A;  2PW5 A;  3R3O A;  2TSS A;  2B2V A;  2A68 C;  5EGT A;  2BA1 A;  4CBV A;  2E2D C;  2UUA Q;  5CYU A;  2CQA A;  3FMC A;  2DUD A;  4DXF A;  1Z9F A;  2WII B;  4H02 A;  1GJX A;  2ZM6 L;  1G8Z D;  1TS3 A;  1GHJ A;  1JB3 A;  1JCK B;  4GN3 B;  3W1B A;  2Q8T A;  4X62 L;  1O7Y A;  1EQQ A;  1F9R A;  4Z9C B;  1IBK Q;  3CCL A;  4LF5 Q;  2KQ3 A;  1I3Q H;  5C4Z A;  1HFN A;  1K83 H;  1VQC A;  2RDG A;  1RTN A;  4F88 A;  4OO1 G;  4LFA Q;  1EIY B;  3BDL A;  1SEB D;  2F4V L;  1TWC B;  5CGK A;  2J4X A;  4IUN A;  1PH3 A;  2DJF C;  3SK4 A;  1EY4 A;  1CSP A;  1A0I A;  4QY7 A;  3RZO B;  2AQ2 B;  2AWO A;  4DR4 L;  1QIL A;  1V9P A;  4DR6 L;  4HAE A;  4A3L H;  4JG2 A;  2MGS A;  3IAY A;  5HY6 A;  4C3J G;  4GLV B;  4XYQ A;  4HID A;  4HJ7 A;  1E3P A;  1W6K A;  1PZK D;  3D6C A;  5EBC A;  1TXY A;  2BCO A;  1MJC A;  1QZG A;  5EQ0 A;  3BS1 A;  2Q2I A;  4DNT B;  1MKH A;  2XVS A;  3OWE B;  4OEM B;  3CCJ A;  4RHS A;  3LGJ A;  2WP8 J;  1SNP A;  1HJP A;  4OO1 I;  3K5M A;  1TT2 A;  5C3E H;  1TWA H;  3A7A B;  4EVO A;  1STY A;  4R4O A;  5I2X A;  1V43 A;  3CHB D;  1SE2 A;  1FJG L;  1BBX C;  1EZ8 A;  3VR3 A;  2E5L L;  1VQ9 A;  4YWK A;  4YCV A;  4FP5 D;  4R4C A;  2IX1 A;  5GAD C;  5AJ3 Q;  4RGO S;  1SYC A;  1H9M A;  5C44 B;  4BY1 H;  3OIP A;  2WB1 E;  1TVX A;  1PFM A;  4B08 A;  3OTO Q;  2UXC L;  3CPF A;  3KDF B;  5J39 A;  4DV3 L;  4MTN A;  1I4R A;  2AUK A;  3J80 c;  5C5M A;  2O4X A;  3KLS X;  2CH4 A;  1IBM L;  2BDO A;  2NUC A;  3K5N A;  2D0P A;  4QCL A;  2WV6 D;  2Z0S A;  5FLX c;  5IGE A;  1TWF H;  3I7F A;  3E5S A;  4A3M B;  2A6E C;  3JAM c;  2EYL A;  3DWQ A;  3RMH A;  1XXG A;  3BU2 A;  4JI5 L;  3S1R H;  2PNR C;  2MUY A;  4ZUI A;  3MFY A;  4K8I A;  3TS2 A;  1TQO A;  2GVA A;  1QZH A;  2JYO A;  4L5S A;  4O2D A;  1B4O A;  3L7Z C;  3URY A;  1B3A A;  1D1I A;  5LMN L;  1K8A C;  1E1O A;  1EIF A;  3H0G B;  5C4X G;  4X65 Q;  3U50 C;  1ESR A;  1SMY C;  5CMD A;  1WTR A;  3AYH B;  2L55 A;  1NY4 A;  1HZA A;  3DXJ C;  3ER0 A;  2EIF A;  1RIP A;  1HNX Q;  2QA4 A;  4M1U B;  2FMM A;  1JE5 A;  2QGQ A;  3M4P A;  4IPD A;  4DV1 Q;  2N55 A;  1UE5 A;  5KRU A;  1AFP A;  1O78 A;  2WAQ G;  3PO2 G;  1OO9 B;  4OO1 H;  3NE5 B;  2H5X A;  1SYD A;  4JI6 L;  4GKJ Q;  1YVC A;  1V1P B;  1LO5 D;  3CF5 A;  1I5F A;  1PLF A;  4LFC Q;  3V2T A;  1EOT A;  1EWH A;  4B3S Q;  4DV0 L;  5M5W B;  1S40 A;  3OW2 A;  3Q0A A;  2KOL A;  1NMG A;  3TN2 A;  3I8Z A;  5TSS A;  4K5X A;  3OPO A;  2A6H C;  1J5E L;  5ELC A;  5DAU A;  1GUO A;  2F3V A;  2AMC B;  4O0A A;  1D2B A;  4C3J H;  4OGQ C;  4QIW B;  5FJ8 H;  2RCF A;  4RWS C;  1A63 A;  3F2B A;  5JJL A;  3R2I A;  3HKZ G;  1SE4 A;  4E6I A;  4Y7N H;  1YNN D;  4N8X 1;  3D4R A;  2IT1 A;  3ICE A;  1IXR A;  4OXP A;  2Z4H A;  5T1I A;  2DJG C;  3OSO A;  3FP9 A;  2MO0 A;  2SEB D;  4P71 A;  2L5T A;  2XRS D;  2FIN B;  1OXS C;  1H9S A;  4UDU C;  1QNK A;  2CWA A;  4AIM A;  1E22 A;  4K2K A;  1IKM A;  4NP5 A;  1ZXT A;  3S1Q H;  2VUM G;  2CKZ B;  1SND A;  2ZJP A;  1K3R A;  1KL9 A;  1LYL A;  1Q8I A;  4XTC S;  4HIM A;  4ILW A;  2KEC A;  2XNA C;  4M8A A;  4F7X A;  3EQL C;  4ZYS A;  2B2Y C;  3BZD B;  1IYU A;  1GUW A;  3MXP A;  1ICF B;  1LTA D;  1JIC A;  1IZ6 A;  1T5X D;  3KUP A;  2OCE A;  1LTB D;  1VQA A;  2AQ1 B;  4LUZ A;  5IE8 A;  4KJO A;  1HZB A;  3DWP A;  1PVO A;  4JV5 L;  1OTC A;  1MSG A;  4MIU A;  2IJ0 A;  1ASY A;  1Y8P B;  5ISR A;  1W2B A;  1FD7 D;  2VZA A;  3H94 A;  4U68 A;  3K7A B;  4GLA C;  3X3N A;  4LF7 Q;  5IT9 E;  1CKN B;  2C35 B;  1ASZ A;  4OHJ A;  2ZJR A;  4XIG S;  5JVH 3;  3PIP 3;  2NYZ D;  2YU9 H;  3VA7 A;  1K83 B;  4RH6 A;  3QWN A;  3FHW A;  2DY7 A;  5H1S E;  1QVG A;  4K5W A;  2O5I C;  4HIK A;  4DR2 L;  4C3H G;  3GP7 A;  4O42 A;  4LFB Q;  2OWO A;  2K5N A;  2C9O A;  1QNU A;  2ASB A;  5C4X H;  4P75 A;  5IYC H;  4XQQ A;  3GTO H;  1SBB B;  5BN4 A;  3SGI A;  1QG7 A;  4DAV A;  1PRT B;  3HOV G;  2YYZ A;  1JWS D;  3PO2 H;  2ICE C;  2ZT9 C;  5EKL A;  1SMX A;  1S4Z A;  2EQS A;  1S5F D;  1S5D D;  2HUG A;  3GTK H;  4PZ7 A;  4ZQ3 A;  4TQU S;  4OEL B;  1GUT A;  4ZK9 B;  5IY0 A;  1R4P B;  2B2Y A;  1HRJ A;  1B2T A;  4MHE A;  3J7A 5;  1SNC A;  1XTC D;  1V8Q A;  4YWM A;  1SYE A;  2X6L A;  1UE6 A;  4IUP A;  2LXJ A;  4IQZ A;  4UP7 A;  2EJF C;  1YNJ D;  2L9H A;  3GV6 A;  3M4Q A;  4DK0 A;  2AUJ D;  2JEA I;  4LF4 Q;  2EJG C;  3CAM A;  1XTD A;  1YIJ A;  1X65 A;  1I4Q A;  1R9T H;  4YY3 Q;  2Z6K C;  3NQT A;  2EY5 A;  4DK6 C;  5D65 A;  5DM7 3;  4OON A;  1TKW B;  5I6Y A;  2EXZ A;  1WOC A;  2IX3 A;  4R9W A;  1IW7 C;  2ZXP A;  3GTJ H;  3TBI B;  4YHH L;  4IUQ A;  4QJF A;  3NBH B;  3QOJ A;  3S2H B;  4RCO A;  4G7O C;  5ELB A;  4POG A;  3CC7 A;  3GTQ B;  2VUM H;  3UE1 A;  1VQH A;  3L3O C;  1TY0 A;  4XDX A;  1NR2 A;  2WKD A;  1PTO C;  4DAY A;  3CME A;  1Q1E A;  4QIW E;  2LMC B;  2I46 A;  5M3M B;  3GTL H;  4RHR A;  1GVP A;  3WWV A;  4LF6 L;  1BCP B;  1RJT A;  1HXY D;  3CW2 C;  4TKO B;  2EYO A;  1EYD A;  2K1B A;  1WTX A;  1K8M A;  1U0L A;  4X64 Q;  2CHB D;  1QB5 D;  3U9S A;  1I94 Q;  2NVQ H;  3SDZ A;  2F0G A;  1BXT A;  1L0X B;  4AQY L;  3BZK A;  2RKS A;  3G7L A;  5IGG A;  3NEL A;  4JI7 L;  4UP8 A;  3BVM A;  2PMZ B;  1NJI C;  3V05 A;  4K8J A;  1HUN A;  2J7Z A;  4C3H H;  4DAP A;  3K58 A;  1VQB A;  3OIQ A;  4B3T Q;  2Z6K A;  2IW3 A;  1TS4 A;  3PIO 3;  4UY8 C;  2JA6 G;  3L0O A;  1N36 L;  4ULL A;  4A3F G;  4BA1 I;  1MGS A;  3A54 A;  2PZU A;  1GUS A;  2ICI A;  4ZUJ A;  1VQL A;  3HOV H;  2M00 A;  1CQF A;  5BR8 Q;  1I4X A;  3K0X A;  5BN5 A;  2UXD L;  2QIL A;  1YHB A;  1CFM A;  1D7Q A;  1O80 A;  1WCM G;  1N33 Q;  1DXM A;  3E0E A;  1A3V A;  4KK7 A;  2YV5 A;  4NKL A;  4CKE A;  2E2I B;  4O1N A;  4ZAI A;  1VQI A;  1FVI A;  4C3J B;  3ZJY C;  4DR3 L;  4F8M A;  1TWG H;  3NEN A;  4KD4 A;  4GNX C;  3VR2 A;  1K8O A;  1DOK A;  4C3I H;  4DA2 A;  4MZ9 A;  2B2T C;  3MXG A;  4DUZ L;  4DN4 M;  3RUZ A;  4DR5 L;  5JJK A;  1JC7 A;  1HH2 P;  4IZ8 A;  2B29 A;  1X56 A;  3T16 A;  4CHT B;  3KF6 B;  1ILP A;  4R4T A;  3UDG A;  2FHT A;  1VQM A;  2N3S A;  1NE3 A;  1X3F A;  3G6E A;  4LF9 Q;  5I9P A;  5CV9 A;  1X3P A;  3S1Q B;  4K0K Q;  2O2L D;  3CCE A;  4KY5 A;  5KYL A;  4BBS G;  1J9O A;  4YCW A;  3PO3 G;  2D5D A;  2UUB Q;  1EL0 A;  3Q6S A;  4JI1 L;  1GKH A;  4NXM Q;  1I50 H;  2F0H A;  1EOV A;  2JXM B;  1DGS A;  4A3J H;  2UU9 Q;  1UWV A;  3I4O A;  1HNW Q;  3FEW X;  3M4O H;  1PH9 A;  3HZX A;  4Q0F A;  3EA6 A;  2EDG A;  2K03 A;  3FRP B;  3IFD A;  4EX5 A;  3SXH A;  5CC4 A;  1VQO A;  2ZXO A;  1E24 A;  3F1Z A;  5JVG 3;  5DEH A;  3I72 A;  3T51 B;  4KV6 A;  3EFX D;  4XQJ A;  2BH8 A;  4DU9 A;  1VQP A;  3K5O A;  1GXD C;  5FO8 B;  1J8I A;  4KN4 C;  4HJ5 A;  4EGV A;  1P16 A;  1DD2 A;  1A3U A;  3VYR A;  2VQE Q;  3TSS A;  1XWE A;  1MD2 D;  2BH2 A;  3NXW A;  2KA7 A;  2RA4 A;  2JA7 H;  2NTS A;  1VF7 A;  4IUV A;  4APV A;  1IBL Q;  5LMU Q;  4GNX A;  4A3G B;  1DM0 B;  3I55 A;  1XMQ L;  2B2T A;  3C1F A;  4XT1 B;  2R7Z H;  5CV6 A;  2KHS A;  2EVB A;  3CD6 A;  2PPB C;  3A7L A;  3GV3 A;  4JI2 L;  4DNI A;  4KHP L;  3RN5 A;  4JBM A;  3EJI A;  2JA5 G;  2WAQ B;  3PO2 B;  4ALP A;  1F2Z A;  2RVL A;  1STN A;  1FNU A;  3CCV A;  1RCV D;  4XQN A;  1SDF A;  3Q22 A;  1ENC A;  1O7I A;  2Z1C A;  4HED A;  4KI0 A;  2F0D A;  2JA6 H;  4A93 G;  4RA8 A;  4A3F H;  4H13 C;  2EJM A;  4WRD A;  1Y1V G;  2KCN A;  4XXE A;  1Q81 C;  3N6R A;  1V1O A;  1QVF A;  3O13 A;  2MPM A;  5FK9 C;  3M7N A;  1SNO A;  3KLS A;  2AKW B;  4DV7 L;  5K36 G;  5JJI A;  1WCM H;  1G6Z A;  1AP0 A;  2HIV A;  4EQ5 A;  2PO4 A;  1N32 L;  2D62 A;  1WTP A;  5I4D A;  2ZM6 Q;  3HFZ B;  4BBR B;  3GD7 A;  3PGZ A;  3GTM B;  4TVA B;  3TQY A;  1MIU A;  4X62 Q;  2KJX A;  3HKZ B;  1JOR A;  2P5Z X;  3MWY W;  2FJ2 A;  2PMZ E;  1CM9 A;  3HRZ C;  1C48 A;  3IKJ A;  5JEA J;  2HCI A;  2NVY B;  1X54 A;  4NPS A;  5LMN W;  1BCP D;  4RMF A;  1M4V A;  3GTJ B;  3MXN B;  3STB C;  2NTT A;  3PQI A;  2PQA A;  2F4V Q;  3M7G A;  5ELD A;  4DV5 L;  2X6G A;  3GTG B;  1SAP A;  2YTY A;  4BBS H;  3W5O A;  1AEX A;  3PO3 H;  2F0K A;  1LLR D;  1X6O A;  3CQZ B;  1K0S A;  3S17 B;  3R2T A;  4FF1 A;  1VQJ A;  2NVX B;  1U4P A;  2DN8 A;  1VQN A;  2OT2 A;  4LJZ C;  5E4X A;  3S1N H;  1AN8 A;  1SFO H;  5M5X B;  4DR4 Q;  4IFD J;  1B9M A;  4DR6 Q;  2K28 A;  4P73 A;  5KGU A;  4DAM A;  1VMP A;  1XPO A;  2MHV A;  2PZW A;  3LWE A;  1X32 A;  1D5X C;  5ELE A;  1WYD A;  4OWX B;  1CZG A;  2SNM A;  3I4M H;  2B2W C;  4IUR A;  1HNZ L;  1U4M A;  3K81 C;  4Y52 H;  1JOO A;  3HOX H;  4C56 C;  3NTI A;  5M3F B;  4X3S A;  1YZ6 A;  1LAB A;  4K14 A;  1G29 1;  2K5H A;  4BWG B;  4C3H B;  1YBY A;  3BVZ A;  5FJ8 G;  1ZYR D;  1VCI A;  1SYF A;  1FJG Q;  3NBI A;  2A8V A;  3T13 A;  1O7L A;  2RF4 A;  2E5L Q;  3HOV B;  2Z9H A;  1E2V A;  1NSN S;  3FDT A;  1A62 A;  1L0W A;  3PIP A;  2JA5 H;  1PFS A;  4HN7 A;  4L5T A;  2EYH A;  3J81 c;  1F77 A;  3J7Z C;  2CVR A;  4GKK Q;  3PMF A;  2EPB A;  2V1C C;  3HOY B;  3AEV A;  2AWN A;  3GTP H;  1J6Q A;  2UXC Q;  2A1A A;  4AYB B;  4KN7 C;  4A93 H;  4DV3 Q;  2XRQ D;  1Y1V H;  2HD3 A;  2KVM A;  4PG3 A;  4LK1 C;  3S16 H;  4X3T A;  1VQG A;  1Y14 B;  4YIJ A;  4JYA L;  3J80 i;  2A69 C;  5K36 H;  3H09 A;  1L1O B;  1ILQ A;  4JI5 Q;  1C0A A;  5ELN A;  4XYO A;  4IFD G;  3VYU A;  3JAM i;  3CCR A;  3E9H A;  3DMU A;  2R3Z A;  1ET9 A;  3P20 A;  1LAC A;  4TSS A;  5GQO A;  5LMN Q;  2WAQ E;  4P2C B;  5KIX A;  1YHA A;  2B2W A;  1TWH H;  1BBU A;  2RDH A;  4HSP A;  1NUC A;  5EJW A;  1Q12 A;  3TP6 A;  4C1N I;  1SE3 A;  1ONL A;  4C2M H;  1LTL A;  1V1Q A;  3TDQ A;  2RQX A;  2RCN A;  2MNA A;  5GAG C;  4YWL A;  3M4O B;  4PNY A;  2CW0 D;  5M9O A;  5M5Y B;  4JI6 Q;  1AZQ A;  2EY2 A;  4RKB A;  2F0O A;  2K5V A;  4JVZ A;  4XT3 B;  2FXQ A;  3LX0 A;  2MP1 A;  2CH4 W;  5IYC G;  1YEZ A;  2EXD A;  3ULJ A;  1UE1 A;  2R6G A;  5C6A A;  5D14 A;  2E76 C;  1DON A;  2XSC A;  1CQV A;  4DV0 Q;  2OQK A;  1EY8 A;  4L5R C;  3QG1 A;  1XNQ L;  2HT1 A;  3HOU B;  4QB4 A;  3E3X A;  3H3V C;  1EY9 A;  3HKZ E;  3TS0 A;  1XJV A;  4WJ3 M;  1PDQ A;  3C1E A;  1M1K C;  1J5E Q;  4A3D G;  1RF2 D;  2X69 A;  4KY7 A;  4X3K A;  3J80 L;  3S15 B;  4IFD I;  1VQF A;  3ERS X;  3FPU B;  1DOL A;  2JA8 G;  1CK1 A;  3L2P A;  1Y8N B;  3AFP A;  1LTR D;  1EFW A;  1SSO A;  1EEI D;  5FLX L;  4MN3 A;  4RG1 A;  3JAM L;  4CJ0 B;  4QMG A;  3BYY B;  3BDO A;  2QF7 A;  4A3B H;  1BO0 A;  5EKK A;  3ULL A;  3FPP A;  1G2S A;  4GOP B;  2R93 G;  1PZI D;  4A4I A;  1RTO A;  5I9O A;  1PFB A;  2JA6 B;  5ELF A;  4A3F B;  3S9W A;  3S2D H;  4HMI A;  1A2T A;  1B44 D;  3W1G A;  2K5Q A;  4QF4 A;  4KY6 A;  3NUC A;  3PCO B;  4B3R Q;  4H0L C;  5J3B A;  1X9N A;  1WCM B;  3I4N G;  4DAY B;  2E2J H;  3S1M H;  1FR3 A;  2NVT H;  4BS9 A;  1DZ1 A;  1K0R A;  3G6J B;  5IWA L;  1B1Z A;  4DF7 A;  2A74 C;  2XTI A;  5A2Q L;  3PIO A;  2F1M A;  3UDI A;  2NB0 A;  1QE6 A;  3JC6 6;  1AE2 A;  2F0E A;  3K8A A;  1L2F A;  3DWA A;  2PYK A;  1EQR A;  2R61 A;  3T56 B;  3V96 A;  5KNB A;  4J1M A;  4IFD H;  1TR5 A;  3A5Z B;  4JI3 L;  2JE6 I;  1N34 L;  3M3Y H;  4DR2 Q;  2K50 A;  1W6J A;  3D0F A;  3AFQ A;  4B9X A;  4DV6 L;  3TZU A;  3EBE A;  1CA5 A;  3RLN A;  1UEB A;  3HOW H;  1I3Q B;  3QR8 A;  1VQ5 A;  2A6E D;  4AYB E;  2L4N A;  4ZKB B;  2HIX A;  5LL6 S;  4JI0 L;  3VYT A;  4DFA A;  4A3I H;  3KYH C;  1XX8 A;  1HR0 L;  1PTO F;  1FGU A;  2K5W A;  3NPP A;  1SR3 A;  1LTS D;  4UAI A;  1ICW A;  1SMY D;  4X6A H;  2MFI A;  2K5D A;  1MSH A;  4NXN L;  3QO2 A;  2VQF L;  1RD9 D;  1XPR A;  3I4L A;  4POF A;  1PYS B;  4HCE A;  2PZT A;  2DY8 A;  1Q86 C;  1KTK A;  3KDF A;  2QDL A;  4UHV A;  4I7A A;  1PRT F;  1N8R C;  3RN2 A;  3OOC A;  2K04 A;  2EOT A;  1IKL A;  1Q90 A;  4B3M Q;  4A3D H;  1QUQ A;  2JA8 H;  3HOZ G;  3A8J E;  3NP8 A;  4PZ6 A;  3PV0 A;  4DV2 L;  1JOK A;  2HQL A;  4CJ1 B;  4CGY B;  1A8V A;  4C3I G;  2ENB A;  4L8J A;  4KTA A;  2B8F A;  4KD3 A;  2Y0S G;  5LHY 1;  3SHL A;  2A6H D;  2MQH A;  2JA5 B;  2D2C C;  4YHH Q;  4KHV A;  5FO7 B;  3BVG A;  4J15 A;  3MEH A;  5C3E B;  3B6Y A;  2R93 H;  1TWA B;  4A93 B;  2Q2H A;  2SNS A;  3I73 A;  1MI2 A;  2HDM A;  5IP9 G;  1E2W A;  5C44 G;  1I4P A;  1PYB A;  3ND8 A;  1H9R A;  3I2Z A;  4A3J G;  1STG A;  4BY7 G;  2GN5 A;  1Z6H A;  4BY1 B;  3I4N H;  3CC4 A;  4PZ8 A;  1PH2 A;  1GO3 E;  1VQE A;  4LF6 Q;  4DR7 L;  4FO2 A;  5NUC A;  2B63 H;  3H3V I;  1BVS A;  4ZCK A;  3I70 A;  1VQD A;  4A3K G;  4L5Q A;  2FFK B;  2Z6B A;  3CKI B;  2N49 A;  3P1H A;  3TRZ A;  5DLQ E;  3RR5 A;  2F0J A;  1LV9 A;  1NAP A;  4ODG A;  2JQO A;  5JJZ A;  1TWF B;  2WIN B;  1KRT A;  4AQY Q;  4JI8 L;  1OXT A;  1XYI A;  4GS3 A;  1KNA A;  2VY3 A;  3S1R B;  3MA2 B;  2KEN A;  2IY5 B;  5IT9 c;  4JI7 Q;  1FGB D;  2WKC A;  3H0G G;  2XIW A;  4HR7 B;  1B70 B;  1RL2 A;  2JA7 G;  1PRT C;  1QWY A;  1AZP A;  3EIV A;  1SYB A;  3PUZ A;  4DR1 L;  2R7Z G;  2D0O A;  2IX0 A;  4G7Z C;  1EZ6 A;  4FF2 A;  2BE5 C;  2QEX A;  4ID6 A;  1EWI A;  5C0X J;  2UXD Q;  1EY0 A;  1SRO A;  3J7A V;  1TWC H;  4X3U A;  2NZ1 D;  3ITP A;  1PH7 A;  4PV1 C;  4LF8 L;  2L1B A;  2R92 G;  1VMC A;  3AMU A;  2UUC L;  1VQK A;  2MO1 A;  3KF8 B;  1A2U A;  1RHP A;  1STE A;  2F0V A;  3FKI G;  4DR3 Q;  1CI3 M;  4IPG A;  2QDB A;  1I6H H;  3RZO H;  4DNR B;  2E2H H;  1HQR D;  1X55 A;  4DUZ Q;  1CZW A;  4UPA A;  5GRO A;  4DR5 Q;  1QJO A;  3TRE A;  2HHH L;  1HHV A;  3H3V H;  2K7V A;  3T1H L;  2VB2 X;  1JQY D;  1WJJ A;  3HOZ H;  3ZYY X;  5E4W C;  2G5D A;  1XMO L;  3WDN A;  4OX9 L;  1PH4 A;  3S2D B;  4Y7N B;  2JN4 A;  1ROD A;  3GDE A;  1KAA A;  3RNU A;  2UXB L;  4JI1 Q;  1WFQ A;  1ET6 A;  1SJH D;  2BOS A;  2QCP X;  5CV4 A;  1K8G A;  3CPW A;  3F2D A;  2E2J B;  2PI2 A;  4CDD C;  5CBE E;  4JCV E;  5JOB A;  4PMC A;  3TEH B;  1U5K A;  4KKS A;  1EYC A;  2SOB A;  2F0Q A;  1WTV A;  1HUM A;  5IP9 H;  5E3F A;  3T1Y Q;  2KCT A;  1MJE A;  1NMF A;  1H9J A;  1XNR L;  4RFB A;  5C44 H;  1IW7 D;  2PNH A;  4ZKC B;  3Q23 A;  3J7A F;  1QVC A;  5EKI A;  2RBM A;  5KYI A;  1KRS A;  2SDF A;  1GUG A;  4LUV A;  5C0X G;  1ENA A;  4TRD A;  4BY7 H;  5FOB B;  1E0B A;  1JOQ A;  4JW0 A;  1GUN A;  5IYD G;  2B39 A;  3HEJ A;  1TU2 B;  2F52 A;  3ULP A;  1S5E D;  1AE3 A;  1KNE A;  1KDC A;  4A3K H;  2WAC A;  2D9U A;  5HGT A;  2F0M A;  3UI2 A;  4ABN A;  1F9Q A;  1HFG A;  2K01 A;  1S72 A;  1JJ2 A;  1PTO D;  1XMQ Q;  5I6W A;  1PHJ A;  3I4M G;  4R4I A;  2XWB B;  1SYG A;  3K5L A;  1G91 A;  4F87 A;  2ZXR A;  1OXU A;  4X66 L;  3HOX G;  4JI2 Q;  4KHP Q;  5E7N A;  2YU9 B;  5COR A;  1VF5 C;  1JWM D;  1JT8 A;  2KCM A;  1G2T A;  3H0G H;  2LXK A;  4H7B A;  2F0L A;  2BA0 A;  1EFI D;  3H15 A;  5C4X B;  3MAQ A;  2A5H A;  4B9W A;  1HTL D;  3K0Y A;  3NBH A;  5E1F A;  3GTO B;  2F0T A;  2VL6 A;  3CRL C;  1F9S A;  4FXD A;  2B2V C;  2WFW A;  2JSO A;  4GN5 A;  1BBW A;  4DV7 Q;  1Q3L A;  1S3O A;  2KCC A;  1KQS A;  5C0X I;  4JI4 Q;  1STA A;  4P72 A;  2JJQ A;  4K6L A;  1N32 Q;  1I4G A;  5G3L F;  4DUY L;  2R92 H;  2ALY B;  5JPM C;  3GTK B;  3P7J A;  3PSI A;  1Y1W G;  2QEJ C;  1ZKO A;  3DUZ A;  3FKI H;  1D1K A;  1S5B D;  3BJU A;  4RKL A;  3KLR A;  5M5W H;  2F4I A;  1PH6 A;  4G4K A;  3IRB A;  4CDE C;  3OW7 A;  3CCM A;  3OYY A;  2E8G A;  1IYJ B;  5CR3 A;  3F2U A;  5L37 A;  2NWG A;  4IPH A;  3A5U A;  4WFN 3;  4DV4 L;  1E1T A;  2R93 B;  2K05 A;  4KHZ A;  4LNQ A;  2R7F A;  1KAB A;  5CV7 A;  1R9T B;  1DCZ A;  1UNS A;  5DM6 3;  4QUC A;  4IUT A;  5K5P A;  2Q2T A;  5EPJ A;  1YI2 A;  1Y69 U;  3IFT A;  3OMC A;  2CWP A;  1UUP A;  1LT6 D;  1BQQ T;  4A3E G;  1W3S A;  4RAU C;  1PV4 A;  1EYA A;  1DOM A;  1T5E A;  1B8A A;  3D4D A;  4G7H C;  2OTJ A;  2VUM B;  1F2M A;  3SK8 A;  1I6V C;  3VYS A;  3K7U C;  4K5V A;  4A75 A;  4WJW A;  5M3M G;  4FXG C;  3J80 E;  1MHW C;  3RD4 A;  4N9P A;  1HNZ Q;  1PZJ D;  5C0X H;  3GTL B;  2Q8I B;  5FLX E;  2CW0 C;  1SRU A;  3A74 A;  1K9M C;  1C4Q A;  5IYD H;  3JAM E;  4JOI C;  4RGN A;  3K7A H;  1BUV T;  1HPC A;  3H91 A;  2UUA L;  1TS5 A;  2NVQ B;  3KF6 A;  4G57 A;  2TMP A;  2VNU D;  3MZ5 A;  1PTO H;  3K59 A;  2RDF A;  2DNC A;  4I7Z C;  3A56 A;  4NMZ A;  1U4L A;  4A3B G;  3G71 A;  5GAE C;  2KHJ A;  4FDB A;  3NEM A;  3G4S A;  3K57 A;  4A76 A;  1PMR A;  4IN3 A;  1F2Y A;  1AH9 A;  1CUK A;  1N9W A;  1JWU D;  1GOZ A;  5IGF A;  1KD1 C;  2F0S A;  1IBK L;  4LF5 L;  3WOE A;  3J81 i;  1NBW A;  2N88 A;  1JE4 A;  1H9S B;  3CCU A;  1Z7T A;  1F2L A;  2OXP A;  1RKN A;  5JEA G;  2N8N A;  1VS0 A;  1EQT A;  1I6H B;  3QB3 A;  4L63 B;  1CTM A;  1SN8 A;  2KHI A;  3AB9 A;  4FF3 A;  1IL2 A;  4JYA Q;  2E2H B;  2L0C A;  2L11 A;  4LFA L;  5A2Q E;  1VQ4 A;  3MC0 B;  1CA6 A;  1U9R A;  5EBD A;  1UE7 A;  1BOS A;  1PFN A;  3R8B A;  3PUV A;  2F0W A;  1Y1W H;  1YIT A;  3LNN A;  1Q46 A;  4C1N K;  2DGY A;  3HOZ B;  1OXX K;  1YNN C;  2RSO A;  1TWG B;  2B3G A;  3NTK A;  2OEO A;  5I2Y A;  1IBM Q;  4FF4 A;  1Q7Y C;  4HTH A;  4C3I B;  3FVQ A;  2IL8 A;  1AW7 A;  5JPN C;  4K2L A;  2Y0S B;  3MHB A;  1KIX A;  3OWF A;  3QIA A;  4JOI A;  3SE0 A;  2Z4I A;  2B8G A;  1PXU A;  1A3T A;  2L15 A;  1ZEQ X;  2NBF A;  2EYF A;  4CKC A;  1OXV A;  4NW2 A;  3HKS A;  1KLU D;  1LUZ A;  1HCZ A;  4JBK A;  5D3I B;  3PF5 A;  3I90 A;  1NCV A;  4DPG A;  3HOW G;  1MBY A;  2A68 D;  2K33 A;  1BR9 A;  1P8L A;  2V4D A;  1HR0 W;  2XWJ B;  4GKK L;  1I50 B;  3J81 L;  3S2H H;  1TY2 A;  4GLX A;  1XNQ Q;  4A3J B;  4BY7 B;  3STB D;  4N8F A;  3GTQ H;  4A3I G;  4A3E H;  4HIO A;  2BDN A;  3U9O A;  3RZD H;  2KBN A;  4LWC A;  5GAH C;  1PH5 A;  3AQQ A;  5HGQ A;  2NZH A;  4BXX G;  4ZRZ A;  3SR1 A;  4A3K B;  1GHK A;  2EYJ A;  3MTS A;  3Q24 A;  1JMC A;  2ES2 A;  5AJ3 L;  1QUQ B;  5M3M H;  1QCB D;  3MVV A;  3U58 A;  5C5L A;  5C4J H;  1ESF A;  4QGU A;  5JAV A;  1C7Y A;  2LSS A;  2GA4 B;  1LT4 D;  5C4H A;  2VXW A;  3VA5 A;  3OTO L;  3RLF A;  3KOJ A;  1UAP A;  2EYP A;  2E74 C;  2I07 B;  3S14 H;  5ELO A;  4A3G G;  5FO9 B;  2PQE A;  1LTT D;  1KAW A;  2JA7 B;  2I5M X;  4WOR A;  2WB1 G;  2IHE A;  3H6M A;  5G3L D;  4JPB W;  3MXN A;  4FYD A;  5KEE A;  2R7Z B;  1VDZ A;  1WTW A;  1EY7 A;  4OWW B;  2Q8R E;  5C3W A;  1KHI A;  3KBG A;  2C5C A;  4JK1 C;  4X65 L;  1FNW A;  1PA6 A;  2R92 B;  2J0T D;  1Q1B A;  2VS1 A;  4IOC A;  5IWA Q;  5CV8 A;  1HNX L;  4EQO A;  5IOC A;  1BNZ A;  3FKI B;  4IPC A;  2F0U A;  4DV1 L;  2EZV A;  5JEA H;  3ONA B;  3ERO A;  4RGM A;  3EN2 A;  1L1O C;  1DYQ A;  2XGT A;  3BG3 A;  3E6Z X;  1WI5 A;  4GKJ L;  1JJC B;  1YNJ C;  2QKI C;  2H4O A;  2E2I H;  1D8L A;  4BBR G;  4HJ8 A;  3NWT A;  2A73 B;  1VQ7 A;  1N34 Q;  4JI3 Q;  3TP5 A;  3UE0 A;  3KJP A;  4LFC L;  4FVM A;  2B63 G;  3KFU A;  4JV5 Q;  2G9H D;  3A55 A;  4B3S L;  4KKU A;  3CXC A;  2ID0 A;  3VDY A;  4DV6 Q;  2NZO A;  3VR4 A;  2F03 A;  1GM5 A;  3OHX C;  3TP8 A;  2A69 D;  3KK7 A;  1IHZ A;  1NNX A;  5EPL A;  1M8A A;  3CU7 A;  2F0F A;  4QL5 A;  3SK6 A;  1EIG A;  4JI0 Q;  1IYV A;  3R93 A;  4ZLT F;  1VQ8 A;  1HR0 Q;  5IP7 G;  2IHF A;  2F3I A;  1QOH A;  5AFW A;  2YTV A;  5FLM G;  3KLW A;  3ND9 A;  1X3G A;  4OIJ A;  4OL7 A;  1G6P A;  4BBS B;  2CFM A;  4NXN Q;  2VQF Q;  3PO3 B;  3C2P A;  4HSV A;  4B3R L;  3NSW A;  1DJR D;  3UDX A;  1KDA A;  1Z47 A;  3S1N B;  2EE1 A;  1KDB A;  1Q8K A;  2AHO B;  3D4W A;  1SFO B;  1I4H A;  3UDF A;  5F2D A;  4EQP A;  2VW9 A;  1ML0 D;  4BXX H;  1C8C A;  2OTL A;  2Y0S E;  1B53 A;  3TME A;  1NR4 A;  1L1O A;  3HG9 A;  4DV2 Q;  5M3F G;  2A19 A;  4DK1 A;  1SNQ A;  3I4M B;  1SJE D;  4GOP C;  1PTO B;  3HOX B;  4R8I A;  3MEF A;  1EYG A;  3K80 C;  1RDP D;  4HJ9 A;  2ZJQ A;  4NB3 A;  1GD7 A;  4A3G H;  1PH8 A;  5IGC A;  5IYB G;  3CCQ A;  4LF7 L;  1YNX A;  3NHH A;  2IWH A;  1T9H A;  3GQB A;  3CRK C;  4A3C G;  2K14 A;  2R7D A;  1IL8 A;  1EIH A;  4EQN A;  4RCN A;  4KLK A;  4J6H A;  4HCS A;  2Q2U A;  1YJ9 A;  1BDO A;  4LFB L;  5D3D A;  4IJL A;  4S3S A;  3HOY G;  1D5M C;  1G51 A;  1X3E A;  1C9O A;  1S5C D;  4FXK C;  4AYB G;  3EVQ A;  3GTP B;  4DR7 Q;  4IOA A;  1STB A;  3I91 A;  4QQB X;  2ZTC A;  1Y1W B;  5EAY A;  2K75 A;  2N78 A;  1YJN A;  1Y1V B;  1CHQ D;  2F0N A;  1JB7 A;  2I5L X;  2ATW A;  3A0J A;  3S16 B;  1FNV A;  2B2U C;  1K73 C;  1V1P A;  3KBX A;  2JEB I;  2HCC A;  3D8G A;  4N9T A;  3HP3 A;  4B3M L;  3DEP A;  4JI8 Q;  4JC0 A;  1Q82 C;  1B9N A;  2JK8 A;  4BBR H;  2NN6 G;  4PMW A;  3GTM H;  4IAL A;  1EU4 A;  1XPU A;  5J22 A;  1A6X A;  4MNO A;  4YCU A;  2NVY H;  3DM1 A;  1ENF A;  4DR1 Q;  4R1J A;  3MFG A;  1CKO A;  4A3M G;  1TWH B;  1CSQ A;  4GOP A;  4I65 A;  1HZ9 A;  2EY1 A;  3T53 B;  3CCS A;  4GNX B;  4FNF A;  3RLO A;  3G48 A;  1O7Z A;  4DK3 C;  1E7Z A;  5T1G A;  1LT5 D;  4LF4 L;  4V0B A;  4KJN A;  4C2M B;  2DNE A;  2M2L A;  3GTG H;  4OWT B;  4YY3 L;  4A3E B;  5CBA E;  1JJG A;  5IP7 H;  4LUO A;  1WVL A;  4LF8 Q;  3RZD B;  5FLM H;  2KEE A;  3DHQ A;  2UUC Q;  3A8K E;  1A15 A;  3CQZ H;  4RGT A;  1BCP F;  3S17 H;  1PH1 A;  1CKM A;  1N36 Q;  2NVX H;  4JBW A;  2VB3 X;  1FYC A;  3HOU G;  1EY5 A;  4CDF C;  3BDC A;  5C4J B;  3QOL A;  2AQ3 B;  5M5X H;  5CV5 A;  3M85 A;  2FMC A;  1FL0 A;  3K6O A;  1E2Z A;  2HQE A;  3S24 A;  4R8N A;  2HHH Q;  2NN6 I;  4HMJ A;  3S14 B;  1JR0 D;  2XN9 C;  2F0I A;  1B3Q A;  5IOD A; 
#chains in the Genus database with same CATH homology
 3AU7 A;  1U4R A;  2F3W A;  4PQX A;  2B2U A;  1LTI D;  3I3C A;  2O5J C;  2PCF B;  3TP7 A;  3DEO A;  5IT9 L;  1EU3 A;  5A35 A;  4A3B B;  4ME5 A;  1HQM C;  5FKA C;  4K6D A;  1WTQ A;  3NTH A;  2KED A;  3NK9 A;  3NQI A;  1HA6 A;  1II3 A;  2EY6 A;  3P75 A;  2PW7 A;  3SEB A;  1B50 A;  2K32 A;  3E0J A;  2L12 A;  1F9P A;  1EY6 A;  3D3R A;  1Y8O B;  3ERQ A;  3MXU A;  3PUX A;  1LTG D;  2KUM A;  4CJ2 C;  2K6A A;  3S1M B;  3NWS A;  4J8Q A;  3C3L A;  2E75 C;  1CT1 D;  1H9K A;  2NVT B;  3M4Y A;  4DGZ A;  4KKT A;  2IPK D;  3PUW A;  1STH A;  1HA5 A;  3L9A X;  1LT3 D;  4NDX A;  1EEF D;  1UEA B;  3VR6 A;  1BCP C;  4LMQ D;  2NN6 H;  5IGB A;  3C46 A;  2MJ8 A;  1BF4 A;  3M3Y B;  2JP1 A;  3X3M A;  1D5Z C;  3WOF A;  5DNF A;  3HS0 C;  3SK5 A;  3D31 A;  5LL6 X;  4GZY C;  3HOW B;  4V19 0;  3LWU A;  1WD0 A;  4PMB A;  4A3I B;  2LS0 1;  1R4Q B;  1PRT D;  2RSN A;  1TII D;  1EQV A;  1EWC A;  3T4A C;  4CKB A;  1SNM A;  3OMG A;  4OIK A;  5EPK A;  2BE5 D;  5KNC A;  3W3A A;  2G9D A;  5C3X A;  3QJY A;  3W2D A;  5BN3 A;  3PUY A;  4IUU A;  4QUF A;  3TZD A;  1ZYR C;  1WTO A;  1CHP D;  4A3D B;  5KND A;  2JA8 B;  1SXT A;  2WB1 B;  1PYW D;  3D6W A;  2LFN A;  3SVM A;  4DXG A;  4LAA A;  2M9V A;  3IL8 A;  3N52 A;  1HTP A;  2OF1 A;  4KMU C;  4BA2 I;  4U67 3;  1WD1 A;  5IIF A;  3J81 E;  4L6T B;  3J7Y W;  2EYM A;  5HUR A;  2Z8L A;  3BYT B;  2LKV A;  1D6E C;  4H44 C;  3VR5 A;  2LY7 A;  3KF8 A;  3A8I E;  2HDL A;  3GO5 A;  2H1E A;  3HGB A;  3I4N B;  2F0P A;  1KLG D;  5J1Z A;  5IGD A;  1TS2 A;  2B63 B;  4Q5V A;  1L0Y B;  1X3Q A;  5COY A;  2PW5 A;  3R3O A;  2TSS A;  2B2V A;  5EGT A;  2A68 C;  2BA1 A;  4CBV A;  2E2D C;  5CYU A;  2CQA A;  3FMC A;  4DXF A;  2WII B;  1GJX A;  1G8Z D;  1TS3 A;  1GHJ A;  1JB3 A;  1JCK B;  2Q8T A;  1O7Y A;  1F9R A;  4Z9C B;  2KQ3 A;  5C4Z A;  1HFN A;  2RDG A;  1RTN A;  4F88 A;  4OO1 G;  3BDL A;  1SEB D;  1TWC B;  5CGK A;  2J4X A;  4IUN A;  3SK4 A;  1EY4 A;  3RZO B;  2AQ2 B;  2AWO A;  1QIL A;  4HAE A;  2MGS A;  3IAY A;  4C3J G;  4XYQ A;  5EBC A;  1W6K A;  1PZK D;  3D6C A;  2BCO A;  5EQ0 A;  3BS1 A;  4DNT B;  2XVS A;  3OWE B;  4RHS A;  2WP8 J;  1SNP A;  4OO1 I;  3K5M A;  1TT2 A;  3A7A B;  4EVO A;  1STY A;  5I2X A;  1V43 A;  3CHB D;  1SE2 A;  1BBX C;  1EZ8 A;  3VR3 A;  4FP5 D;  2IX1 A;  4RGO S;  1SYC A;  1H9M A;  5C44 B;  3OIP A;  1TVX A;  1PFM A;  4B08 A;  5J39 A;  1I4R A;  2AUK A;  5C5M A;  2O4X A;  3KLS X;  2BDO A;  2NUC A;  3K5N A;  4QCL A;  2WV6 D;  5IGE A;  3E5S A;  4A3M B;  2A6E C;  2EYL A;  3DWQ A;  3RMH A;  1XXG A;  2PNR C;  2MUY A;  4ZUI A;  3MFY A;  4K8I A;  1TQO A;  2JYO A;  1B4O A;  3L7Z C;  3URY A;  1B3A A;  1D1I A;  3H0G B;  1ESR A;  1SMY C;  5CMD A;  1WTR A;  2L55 A;  3DXJ C;  4M1U B;  2FMM A;  2N55 A;  5KRU A;  1AFP A;  1O78 A;  1OO9 B;  4OO1 H;  3NE5 B;  1SYD A;  1V1P B;  1LO5 D;  1PLF A;  3V2T A;  1EOT A;  1EWH A;  5M5W B;  3Q0A A;  2KOL A;  3TN2 A;  3I8Z A;  5TSS A;  4K5X A;  3OPO A;  2A6H C;  5ELC A;  5DAU A;  1GUO A;  2F3V A;  1D2B A;  4OGQ C;  4QIW B;  4RWS C;  3R2I A;  1SE4 A;  4E6I A;  1YNN D;  3D4R A;  2IT1 A;  2Z4H A;  5T1I A;  3OSO A;  2SEB D;  2L5T A;  2XRS D;  2FIN B;  1OXS C;  1H9S A;  4UDU C;  1QNK A;  4K2K A;  1IKM A;  4NP5 A;  1ZXT A;  1SND A;  4XTC S;  1Q8I A;  4ILW A;  2KEC A;  2XNA C;  4M8A A;  4F7X A;  3EQL C;  4ZYS A;  2B2Y C;  3BZD B;  1IYU A;  1GUW A;  3MXP A;  1LTA D;  1JIC A;  1T5X D;  3KUP A;  1LTB D;  2AQ1 B;  4KJO A;  3DWP A;  1MSG A;  4MIU A;  2IJ0 A;  1Y8P B;  5ISR A;  1FD7 D;  3H94 A;  4U68 A;  3K7A B;  3X3N A;  5IT9 E;  4OHJ A;  4XIG S;  5JVH 3;  3PIP 3;  2NYZ D;  3VA7 A;  1K83 B;  4RH6 A;  3QWN A;  2DY7 A;  4K5W A;  2O5I C;  4C3H G;  3GP7 A;  4O42 A;  2C9O A;  1QNU A;  4XQQ A;  1SBB B;  5BN4 A;  1QG7 A;  4DAV A;  1PRT B;  2YYZ A;  1JWS D;  2ICE C;  2ZT9 C;  5EKL A;  1S4Z A;  1S5F D;  1S5D D;  2HUG A;  4ZQ3 A;  4TQU S;  1GUT A;  4ZK9 B;  1R4P B;  2B2Y A;  1HRJ A;  1B2T A;  4MHE A;  1SNC A;  1XTC D;  1V8Q A;  1SYE A;  2X6L A;  4IUP A;  4IQZ A;  2EJF C;  1YNJ D;  2L9H A;  3GV6 A;  4DK0 A;  2AUJ D;  2JEA I;  2EJG C;  1I4Q A;  3NQT A;  2EY5 A;  5D65 A;  5DM7 3;  1TKW B;  5I6Y A;  2EXZ A;  2IX3 A;  4R9W A;  1IW7 C;  2ZXP A;  3TBI B;  4IUQ A;  3QOJ A;  3S2H B;  4RCO A;  4G7O C;  5ELB A;  3GTQ B;  3L3O C;  1TY0 A;  4XDX A;  1NR2 A;  2WKD A;  1PTO C;  4DAY A;  1Q1E A;  2LMC B;  2I46 A;  5M3M B;  4RHR A;  1BCP B;  1RJT A;  1HXY D;  4TKO B;  2EYO A;  1EYD A;  2K1B A;  1WTX A;  1K8M A;  2CHB D;  1QB5 D;  3U9S A;  3SDZ A;  2F0G A;  1BXT A;  1L0X B;  2RKS A;  3G7L A;  5IGG A;  3BVM A;  2PMZ B;  3V05 A;  4K8J A;  1HUN A;  2J7Z A;  4DAP A;  3K58 A;  3OIQ A;  2IW3 A;  1TS4 A;  3PIO 3;  4ULL A;  4BA1 I;  1MGS A;  3A54 A;  2PZU A;  1GUS A;  2ICI A;  4ZUJ A;  2M00 A;  1CQF A;  1I4X A;  5BN5 A;  2QIL A;  1CFM A;  1O80 A;  1DXM A;  4KK7 A;  1A3V A;  4NKL A;  4CKE A;  2E2I B;  4O1N A;  4ZAI A;  4C3J B;  4F8M A;  4KD4 A;  3VR2 A;  1K8O A;  1DOK A;  4DA2 A;  2B2T C;  3MXG A;  4DN4 M;  3RUZ A;  1JC7 A;  4IZ8 A;  3T16 A;  4CHT B;  1ILP A;  2FHT A;  5I9P A;  5CV9 A;  1X3P A;  3S1Q B;  2O2L D;  4KY5 A;  5KYL A;  1J9O A;  2D5D A;  1EL0 A;  3Q6S A;  2F0H A;  2JXM B;  3FEW X;  3HZX A;  4Q0F A;  3EA6 A;  2EDG A;  2K03 A;  3FRP B;  3IFD A;  5CC4 A;  3SXH A;  2ZXO A;  5JVG 3;  5DEH A;  3I72 A;  3T51 B;  4KV6 A;  3EFX D;  4XQJ A;  4DU9 A;  3K5O A;  1GXD C;  5FO8 B;  1J8I A;  4KN4 C;  4EGV A;  1DD2 A;  1A3U A;  3VYR A;  3TSS A;  1XWE A;  1MD2 D;  3NXW A;  2KA7 A;  2RA4 A;  2NTS A;  1VF7 A;  4IUV A;  4A3G B;  1DM0 B;  2B2T A;  3C1F A;  4XT1 B;  5CV6 A;  2KHS A;  2EVB A;  2PPB C;  3A7L A;  3GV3 A;  3EJI A;  2WAQ B;  3PO2 B;  1F2Z A;  2RVL A;  1STN A;  1FNU A;  1RCV D;  4XQN A;  1SDF A;  3Q22 A;  1ENC A;  2Z1C A;  4HED A;  4KI0 A;  2F0D A;  4RA8 A;  4H13 C;  2EJM A;  4WRD A;  2KCN A;  4XXE A;  3N6R A;  1V1O A;  3O13 A;  2MPM A;  5FK9 C;  3M7N A;  1SNO A;  3KLS A;  5K36 G;  1G6Z A;  1AP0 A;  2PO4 A;  2D62 A;  1WTP A;  5I4D A;  4BBR B;  3GD7 A;  3GTM B;  2KJX A;  3HKZ B;  1JOR A;  3MWY W;  2FJ2 A;  1CM9 A;  3HRZ C;  1C48 A;  3IKJ A;  5JEA J;  2HCI A;  2NVY B;  1BCP D;  1M4V A;  3GTJ B;  2NTT A;  3M7G A;  5ELD A;  2X6G A;  3GTG B;  1SAP A;  1AEX A;  2F0K A;  1LLR D;  3CQZ B;  3S17 B;  3R2T A;  4FF1 A;  2NVX B;  1U4P A;  2DN8 A;  2OT2 A;  4LJZ C;  5E4X A;  1AN8 A;  5M5X B;  4IFD J;  1B9M A;  2K28 A;  5KGU A;  1VMP A;  2MHV A;  2PZW A;  3LWE A;  1X32 A;  1D5X C;  5ELE A;  1CZG A;  2SNM A;  2B2W C;  4IUR A;  1U4M A;  1JOO A;  5M3F B;  4C56 C;  3NTI A;  4X3S A;  1LAB A;  4K14 A;  1G29 1;  4BWG B;  4C3H B;  3BVZ A;  1ZYR D;  1VCI A;  1SYF A;  3NBI A;  3T13 A;  1O7L A;  3HOV B;  1E2V A;  1NSN S;  3FDT A;  4HN7 A;  2EYH A;  1F77 A;  2CVR A;  3PMF A;  2EPB A;  3HOY B;  2AWN A;  4AYB B;  4KN7 C;  2XRQ D;  2KVM A;  4LK1 C;  4X3T A;  4YIJ A;  2A69 C;  5K36 H;  3H09 A;  1ILQ A;  4XYO A;  4IFD G;  3VYU A;  3DMU A;  2R3Z A;  1ET9 A;  3P20 A;  1LAC A;  4TSS A;  4P2C B;  5KIX A;  2B2W A;  2RDH A;  4HSP A;  1NUC A;  5EJW A;  1Q12 A;  3TP6 A;  4C1N I;  1SE3 A;  1ONL A;  3TDQ A;  2RQX A;  3M4O B;  5M5Y B;  4PNY A;  2CW0 D;  5M9O A;  1AZQ A;  2EY2 A;  4RKB A;  2F0O A;  4XT3 B;  3LX0 A;  2MP1 A;  2R6G A;  5C6A A;  5D14 A;  2E76 C;  1DON A;  2XSC A;  1CQV A;  1EY8 A;  3QG1 A;  3HOU B;  4QB4 A;  3H3V C;  1EY9 A;  1PDQ A;  3C1E A;  1RF2 D;  2X69 A;  4KY7 A;  4X3K A;  3J80 L;  3S15 B;  4IFD I;  3FPU B;  1DOL A;  1CK1 A;  1Y8N B;  1LTR D;  1SSO A;  1EEI D;  5FLX L;  4MN3 A;  3JAM L;  4CJ0 B;  4QMG A;  3BYY B;  3BDO A;  2QF7 A;  1BO0 A;  5EKK A;  3FPP A;  1G2S A;  1PZI D;  1RTO A;  5I9O A;  1PFB A;  2JA6 B;  5ELF A;  4A3F B;  3S9W A;  4HMI A;  1A2T A;  1B44 D;  2K5Q A;  4QF4 A;  4KY6 A;  3NUC A;  4H0L C;  1WCM B;  1FR3 A;  4BS9 A;  1DZ1 A;  3G6J B;  1B1Z A;  4DF7 A;  2A74 C;  5A2Q L;  2F1M A;  2NB0 A;  1QE6 A;  2F0E A;  3DWA A;  2PYK A;  2R61 A;  3T56 B;  3V96 A;  5KNB A;  4J1M A;  4IFD H;  1TR5 A;  2JE6 I;  1W6J A;  4B9X A;  3TZU A;  1CA5 A;  1I3Q B;  2A6E D;  2L4N A;  4ZKB B;  5LL6 S;  3VYT A;  4DFA A;  1XX8 A;  1PTO F;  2K5W A;  3NPP A;  1LTS D;  4UAI A;  1ICW A;  1SMY D;  2K5D A;  1MSH A;  3QO2 A;  1RD9 D;  3I4L A;  4HCE A;  2PZT A;  2DY8 A;  1KTK A;  1PRT F;  3OOC A;  2K04 A;  2EOT A;  1IKL A;  1Q90 A;  3A8J E;  3NP8 A;  3PV0 A;  1JOK A;  4CJ1 B;  4CGY B;  4C3I G;  2ENB A;  4L8J A;  4KTA A;  2B8F A;  4KD3 A;  5LHY 1;  3SHL A;  2A6H D;  2JA5 B;  2D2C C;  4KHV A;  5FO7 B;  3BVG A;  3MEH A;  5C3E B;  1TWA B;  4A93 B;  2SNS A;  3I73 A;  1MI2 A;  2HDM A;  1E2W A;  1I4P A;  3ND8 A;  1H9R A;  1STG A;  1Z6H A;  4BY1 B;  4FO2 A;  5NUC A;  3I70 A;  2FFK B;  3CKI B;  3P1H A;  2F0J A;  1LV9 A;  1NAP A;  4ODG A;  5JJZ A;  1TWF B;  2WIN B;  1OXT A;  1XYI A;  1KNA A;  3S1R B;  3MA2 B;  1FGB D;  2WKC A;  4HR7 B;  2XIW A;  1PRT C;  1QWY A;  1AZP A;  3PUZ A;  1SYB A;  2IX0 A;  4G7Z C;  1EZ6 A;  4FF2 A;  2BE5 C;  4ID6 A;  5C0X J;  1EY0 A;  3J7A V;  4X3U A;  2NZ1 D;  3ITP A;  4PV1 C;  2L1B A;  1VMC A;  3AMU A;  1A2U A;  1RHP A;  1STE A;  2F0V A;  1CI3 M;  2QDB A;  4DNR B;  1HQR D;  1CZW A;  1QJO A;  1HHV A;  2K7V A;  2VB2 X;  1JQY D;  3ZYY X;  5E4W C;  3WDN A;  3S2D B;  4Y7N B;  1ROD A;  1KAA A;  1ET6 A;  1SJH D;  2BOS A;  2QCP X;  5CV4 A;  2E2J B;  5CBE E;  5JOB A;  4PMC A;  4KKS A;  1EYC A;  2SOB A;  2F0Q A;  1WTV A;  1HUM A;  5E3F A;  1H9J A;  4RFB A;  1IW7 D;  4ZKC B;  3J7A F;  3Q23 A;  5EKI A;  2RBM A;  5KYI A;  2SDF A;  1GUG A;  5C0X G;  1ENA A;  4TRD A;  5FOB B;  1E0B A;  1JOQ A;  1GUN A;  2B39 A;  3HEJ A;  1TU2 B;  1S5E D;  1KNE A;  1KDC A;  2WAC A;  2D9U A;  5HGT A;  2F0M A;  3UI2 A;  4ABN A;  1F9Q A;  1HFG A;  2K01 A;  1PTO D;  5I6W A;  2XWB B;  1SYG A;  3K5L A;  1G91 A;  4F87 A;  2ZXR A;  1OXU A;  2YU9 B;  5COR A;  1VF5 C;  1JWM D;  1G2T A;  4H7B A;  2F0L A;  2BA0 A;  1EFI D;  5C4X B;  3MAQ A;  2A5H A;  4B9W A;  1HTL D;  3K0Y A;  3NBH A;  5E1F A;  3GTO B;  2F0T A;  3CRL C;  1F9S A;  4FXD A;  2B2V C;  2JSO A;  1Q3L A;  2KCC A;  5C0X I;  1STA A;  4K6L A;  1I4G A;  5G3L F;  5JPM C;  3GTK B;  3P7J A;  2QEJ C;  1ZKO A;  3DUZ A;  1D1K A;  1S5B D;  4RKL A;  3KLR A;  2F4I A;  4G4K A;  3OW7 A;  5CR3 A;  3F2U A;  2NWG A;  4WFN 3;  2R93 B;  2K05 A;  4KHZ A;  1KAB A;  5CV7 A;  1R9T B;  1DCZ A;  1UNS A;  5DM6 3;  4QUC A;  4IUT A;  5K5P A;  5EPJ A;  1Y69 U;  3IFT A;  3OMC A;  1UUP A;  1LT6 D;  1BQQ T;  4RAU C;  1EYA A;  1DOM A;  1T5E A;  3D4D A;  4G7H C;  2VUM B;  1F2M A;  3SK8 A;  1I6V C;  3VYS A;  4K5V A;  4WJW A;  4FXG C;  3J80 E;  3RD4 A;  4N9P A;  1PZJ D;  5C0X H;  3GTL B;  2Q8I B;  5FLX E;  2CW0 C;  1C4Q A;  3JAM E;  4RGN A;  1BUV T;  1HPC A;  3H91 A;  1TS5 A;  2NVQ B;  4G57 A;  2TMP A;  2VNU D;  3MZ5 A;  1PTO H;  3K59 A;  2RDF A;  2DNC A;  4I7Z C;  3A56 A;  4NMZ A;  1U4L A;  3K57 A;  1PMR A;  4IN3 A;  1F2Y A;  5IGF A;  1JWU D;  1GOZ A;  2F0S A;  3WOE A;  2N88 A;  1JE4 A;  1H9S B;  1Z7T A;  1F2L A;  2OXP A;  1RKN A;  5JEA G;  1EQT A;  1I6H B;  3QB3 A;  4L63 B;  1CTM A;  4FF3 A;  3AB9 A;  2E2H B;  2L0C A;  2L11 A;  5A2Q E;  3MC0 B;  1CA6 A;  1U9R A;  5EBD A;  1BOS A;  1PFN A;  3R8B A;  3PUV A;  2F0W A;  3LNN A;  4C1N K;  3HOZ B;  1OXX K;  1YNN C;  2RSO A;  1TWG B;  3NTK A;  2OEO A;  5I2Y A;  4FF4 A;  4HTH A;  4C3I B;  3FVQ A;  2IL8 A;  1AW7 A;  5JPN C;  4K2L A;  2Y0S B;  3MHB A;  3OWF A;  3QIA A;  3SE0 A;  2Z4I A;  2B8G A;  1PXU A;  1A3T A;  1ZEQ X;  2NBF A;  2EYF A;  4CKC A;  1OXV A;  4NW2 A;  1KLU D;  1HCZ A;  5D3I B;  3I90 A;  1NCV A;  1MBY A;  2A68 D;  2K33 A;  1BR9 A;  2V4D A;  2XWJ B;  1I50 B;  3J81 L;  1TY2 A;  4A3J B;  4BY7 B;  2BDN A;  3U9O A;  4ZRZ A;  3SR1 A;  4A3K B;  1GHK A;  2EYJ A;  3MTS A;  3Q24 A;  1QCB D;  3MVV A;  5C5L A;  1ESF A;  5JAV A;  2GA4 B;  1LT4 D;  5C4H A;  2VXW A;  3VA5 A;  3RLF A;  1UAP A;  2EYP A;  2E74 C;  2I07 B;  5FO9 B;  2PQE A;  1LTT D;  2JA7 B;  4WOR A;  3H6M A;  5G3L D;  3MXN A;  4FYD A;  5KEE A;  2R7Z B;  1VDZ A;  1WTW A;  1EY7 A;  2Q8R E;  5C3W A;  3KBG A;  2C5C A;  4JK1 C;  1FNW A;  2R92 B;  2J0T D;  1Q1B A;  5CV8 A;  4EQO A;  5IOC A;  1BNZ A;  3FKI B;  2F0U A;  2EZV A;  5JEA H;  3ONA B;  3ERO A;  4RGM A;  1DYQ A;  3BG3 A;  3E6Z X;  1YNJ C;  2QKI C;  2H4O A;  3NWT A;  2A73 B;  3TP5 A;  4FVM A;  2G9H D;  3A55 A;  4KKU A;  2ID0 A;  3VR4 A;  2F03 A;  3OHX C;  3TP8 A;  2A69 D;  3KK7 A;  1IHZ A;  5EPL A;  1M8A A;  3CU7 A;  2F0F A;  3SK6 A;  1EIG A;  1IYV A;  3R93 A;  4ZLT F;  1QOH A;  5AFW A;  3ND9 A;  4OIJ A;  4OL7 A;  4BBS B;  3PO3 B;  3C2P A;  4HSV A;  3NSW A;  1DJR D;  1KDA A;  1Z47 A;  3S1N B;  2EE1 A;  1KDB A;  1SFO B;  3D4W A;  1I4H A;  5F2D A;  4EQP A;  1ML0 D;  1C8C A;  1B53 A;  3TME A;  1NR4 A;  3HG9 A;  3I4M B;  4DK1 A;  1SNQ A;  1SJE D;  1PTO B;  3HOX B;  4R8I A;  1RDP D;  5IGC A;  2IWH A;  3NHH A;  3GQB A;  3CRK C;  1IL8 A;  1EIH A;  4EQN A;  4RCN A;  4J6H A;  4HCS A;  1BDO A;  5D3D A;  4S3S A;  1D5M C;  1S5C D;  4FXK C;  3EVQ A;  3GTP B;  1STB A;  3I91 A;  1Y1W B;  1Y1V B;  1CHQ D;  2F0N A;  3S16 B;  1FNV A;  2B2U C;  1V1P A;  3KBX A;  2JEB I;  2HCC A;  3D8G A;  4N9T A;  3HP3 A;  3DEP A;  1B9N A;  2NN6 G;  4PMW A;  4IAL A;  1EU4 A;  5J22 A;  1A6X A;  3DM1 A;  1ENF A;  3MFG A;  1TWH B;  4I65 A;  2EY1 A;  3T53 B;  4FNF A;  1O7Z A;  5T1G A;  1LT5 D;  4V0B A;  4KJN A;  4C2M B;  2DNE A;  2M2L A;  4A3E B;  5CBA E;  1WVL A;  3RZD B;  2KEE A;  3DHQ A;  3A8K E;  1A15 A;  4RGT A;  1BCP F;  4JBW A;  2VB3 X;  1FYC A;  1EY5 A;  3BDC A;  5C4J B;  3QOL A;  2AQ3 B;  3M85 A;  5CV5 A;  2FMC A;  3K6O A;  1E2Z A;  2HQE A;  4R8N A;  2NN6 I;  4HMJ A;  3S14 B;  1JR0 D;  2XN9 C;  2F0I A;  5IOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...