1SYDA

Engineering alternative beta-turn types in staphylococcal nuclease
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Engineering alternative beta-turn types in staphylococcal nuclease.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 37
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sydA00
4F8MA 3D6CA 4WRDA 3MEHA 1EY8A 4EQOA 5IGDA 5CV8A 2EY6A 3PMFA 4ZUIA 3P75A 4HTHA 4N9TA 1NSNS 4KV6A 1EQVA 3C1EA 1STBA 3EVQA 3T16A 2PW7A 3NQTA 4TRDA 3OMGA 3D4WA 2SNMA 3QB3A 4R8NA 4H7BA 4I65A 1EY7A 1EZ6A 1SNPA 5C3XA 5JAVA 4KY5A 4NDXA 4YIJA 1KDBA 5C5MA 1SNQA 2F0EA 5KRUA 5DAUA 5HURA 1EZ8A 4N9PA 4KY7A 2F0QA 4K5XA 4B9XA 3D4DA 1JOKA 4K14A 1STGA 4K5WA 5CR3A 1RKNA 2PYKA 5KIXA 1JOQA 5IGEA 4DF7A 1F2YA 2F3VA 3SK4A 4EQNA 4NKLA 2QDBA 3TMEA 1EY6A 4QF4A 5IGFA 2EYLA 2F0JA 4DFAA 5NUCA 5KEEA 1SNDA 4QB4A 2O4XA 4KY6A 5E1FA 2NUCA 2PQEA 2F0VA 4ZQ3A 4KD3A 1TQOA 3SHLA 4IUNA 4B9WA 4ZUJA 4WORA 5C3WA 1STHA 1SYDA 2PZUA 2SNSA 3ERQA 1TT2A 4G57A 4PMCA 5EKLA 1EYDA 4ID6A 1SNCA 4EVOA 3EROA 2F0IA 4K5VA 5KYIA 4OL7A 4HMIA 4LAAA 4DGZA 5C4ZA 4QMGA 2F0PA 1A2TA 3NHHA 4HMJA 4K8IA 1EYCA 4KJOA 4KJNA 2EY2A 1A3TA 3U9OA 4S3SA 5HGTA 5KGUA 2HQEA 3SK5A 2EYPA 3OWFA 2F0KA 2F0GA 2EY1A 5CV6A 1KAAA 1SYBA 5IGGA 1SNMA 4NMZA 1AEXA 2PW5A 3H6MA 4KHVA 5IIFA 1F2ZA 2F0SA 2EYOA 5F2DA 3RUZA 5CC4A 1EY4A 4RKLA 1KDCA 3SR1A 5I6YA 5I9PA 2F0UA 3HEJA 4F7XA 1ENCA 5M9OA 2ENBA 2KHSA 5C4HA 5K5PA 2PZTA 3VA5A 2F0FA 4KD4A 1A3UA 2EYHA 3MHBA 3NK9A 5JOBA 3OMCA 5IGCA 3R3OA 2LKVA 3MXPA 3P1HA 3QOLA 4E6IA 1SYEA 5I9OA 1NUCA 1SYFA 2OXPA 5E3FA 1JORA 1IHZA 4K6DA 2SOBA 4K8JA 1EYAA 2F0LA 4PMBA 2OEOA 2WACA 3C1FA 3LX0A 3MZ5A 4ODGA 4EQPA 2F3WA 1STNA 4IZ8A 3V2TA 2F0OA 2F0HA 2M00A 5KYLA 5CGKA 5ISRA 4RKBA 1II3A 1KABA 3T13A 5I6WA 5EKKA 1SYCA 2EYMA 1U9RA 3BDCA 4J1MA 2RDFA 3DMUA 1ENAA 3ITPA 5DEHA 3NP8A 1KDAA 3SK6A 3TP7A 2EXZA 1SNOA 3TP6A 3TP8A 1F2MA 4NP5A 4PNYA 1EY5A 4IALA 2F0NA 1JOOA 2OF1A 5C5LA 3BDLA 5EGTA 5J22A 3NUCA 5CV9A 3QOJA 5CV7A 1EY0A 2PZWA 4ME5A 4MIUA 2EY5A 3E5SA 4J6HA 4KTAA 2RBMA 5CV5A 3OSOA 3EJIA 5IGBA 5CV4A 1A2UA 2EYFA 2F0TA 4DU9A 2RKSA 1TR5A 1SYGA 1EY9A 4K2LA 3SK8A 3DHQA 2KQ3A 5J39A 1STAA 3MVVA 5IOCA 1STYA 3D8GA 3TP5A 5C6AA 2F0MA 3HZXA 3NXWA 1A3VA 2EYJA 3S9WA 3SXHA 5IODA 2F0WA 5J1ZA 4K2KA 2F0DA
chains in the Genus database with same CATH superfamily
4G4KA 2E5LL 3FKIH 5JEAH 5JPNC 1Y14B 2K6AA 2RHSB 3LWUA 3VDYA 4A3FB 2NVQB 5C0XJ 3S1QH 2WB1G 1ENFA 3F2CA 4RH6A 3A8KE 4K5XA 3PIP3 1I6HH 2Q8IB 2K5QA 2PYKA 3TZUA 4DF7A 5M3FH 1WOCA 3F2UA 3U9SA 1SNDA 2ASBA 1I4PA 3VYRA 3MXUA 1Q81C 4CDFC 3CCVA 2K52A 3J7AF 3GTKB 1AZPA 4G57A 3D31A 1XNRL 4APVA 4P71A 2C9OA 3VA7A 5IGGA 5D3IB 2CKZB 1TWFH 4S3SA 1N34Q 1LTTD 5IWAL 2HQEA 4A3IG 5CV6A 1Q1EA 1GO3E 2K04A 1QVGA 1K73C 4OX9L 2K05A 4L6TB 1I3QH 1ILPA 1XPOA 1S40A 4DK3C 3FHWA 4DR1Q 4RCNA 4A3BB 2H4OA 3M7NA 2HCIA 1EUJA 1UAPA 3GDEA 1VQEA 4E6IA 1WTOA 5I9OA 2F4VQ 1IHZA 1XTDA 4YCUA 2F52A 4ZKCB 2E5LQ 1EU3A 3Q24A 4EQPA 1J9OA 2K50A 2LFNA 4QUCA 5ISRA 4C3IH 4L5TA 3CKIB 3J7AV 5I6WA 1GXDC 1HUMA 5FK9C 4GZYC 1B7YB 2SEBD 4GLVB 3HOVB 4A3KB 1KIXA 3HKSA 2B2TA 1YNJD 5CV7A 1LT4D 4IFDJ 2KCNA 2EY5A 2AMCB 4H44C 5CMDA 5T1GA 1GUWA 1E1TA 2Y0SG 4DR4Q 3X3MA 1G51A 4TVAB 3QJYA 5EAYA 1D1KA 4LUOA 2N78A 3DHQA 2PCFB 3M3YB 5IOCA 2JA6B 3A7AB 2RDHA 3NE5B 4HJ7A 2WINB 4RA8A 4FXKC 1Y1VH 3SXHA 2WP8J 4OIKA 5H1SE 4X3SA 4UPAA 4V0BA 1TWCB 1A6XA 2KJXA 5IGDA 2X6LA 4XQNA 2A5HA 4N9TA 4Q5VA 4CJ0B 4X3KA 5C3XA 3M4YA 1Q8KA 2CCZA 5FO7B 3CCEA 3AFQA 4X62L 3WDNA 3D4DA 2Q2UA 3CRLC 1IBKL 1Q8IA 1Z9FA 4OO1G 4CJ1B 2CH4A 4LF6Q 2QDBA 1X9NA 4JBMA 1TS5A 5ELFA 2E2DC 4BY7B 2Y0SE 3SHLA 5HGQA 2SNSA 5EKLA 1ESRA 1GUSA 2A6ED 1I50B 3PQIA 4DV0Q 2E2JB 5FLXc 2L1BA 1S5BD 5IYCG 4QY7A 4WJWA 4LF7L 3SK5A 1SMXA 4FF2A 2JSOA 3PIPA 1DOLA 1ZYRD 5C3EB 5I6YA 2WAQB 1HFGA 4DV2L 5IGCA 3URYA 2IL8A 2K5WA 3BDOA 1PRTF 2JA9A 2ZTCA 3U50C 2K14A 1U5KA 3DM1A 1YHQA 1PTOH 5J3BA 5M5YH 3S1NH 4CDCC 2F0HA 2M00A 1K83B 2AWOA 2ZXPA 4X64Q 2BE5C 1SE4A 1H9KA 3TP7A 3NBHB 4DK6C 1GHKA 1IYUA 3GTOH 4R8IA 4P74A 2R7DA 4QGUA 5C5LA 3S15H 3GTPB 3D6WA 3FDTA 3G6EA 1JWUD 2UUCQ 4MIUA 2OT2A 5CBEE 1JR0D 1MJEA 1I4GA 1B50A 1F9RA 2VW9A 4GOPB 1EWIA 2L5TA 4LFCL 1DOKA 1CM9A 1UE6A 2NVXH 4JI6Q 4HJ9A 4DR5L 2OQ0A 2YU9H 4DR3L 1XX8A 1YNJC 3ONAB 4OEMB 5LL6S 4L5QA 4NXML 2A19A 4BY1G 4AQYL 2NZOA 4HR7B 3FRPB 5G3LF 2QCPX 2KBNA 3PUWA 2MNAA 4BWGB 5M5WB 1VQDA 2QDLA 4PZ7A 1DCZA 1YIJA 1SJHD 3RZOB 1BBXC 4PZ8A 4TQUS 3L7ZC 1SNPA 1R9TH 3GTQH 1JC7A 2CQOA 1RIPA 2Z6KA 5EQ0A 4GKKL 2MGSA 5CR3A 3MXNA 3RMHA 1HNXL 4YWKA 3P7JA 1HNWL 1WCMG 3GTJB 2JN4A 4C3JB 1IL8A 2HCCA 3K7AH 4P2CB 2PQEA 4X3TA 3J81i 4G7ZC 1BCPD 4X66L 3M4QA 4A3JG 3TS2A 3TSSA 4YHHQ 1VMPA 4ID6A 3A7LA 5E4WC 3CXCA 1F77A 4JI7Q 4A3FH 2NVQH 4DV5L 4IFDG 1TIID 4HMJA 3MAQA 2BA0A 3S2HB 4RG1A 1VQNA 4IPDA 4R4IA 5BR8L 3GTGB 3EBEA 1IKMA 2A6EC 3S24A 1F2LA 3S2DH 3Q8DA 1FJGL 1VQ5A 1A3UA 1KLGD 2ZTEA 1HA5A 4DR3Q 4AYBE 1I94Q 3GTKH 4RGTA 1SYFA 4FF3A 2KCTA 2PNHA 1CSQA 4UDUC 4IUVA 1O7LA 4B3ML 2XNAC 3K0YA 1PFSA 2D2CC 3NPPA 3KLRA 3T13A 1CKMA 3MFYA 3DMUA 4FP5D 4DV4Q 3GP7A 2MQHA 4GKJL 1NMFA 3BDLA 4PMWA 4L5SA 1FGUA 1SJED 2A68C 3KJPA 4A3BH 2D5DA 4JPBW 2G9HD 2JP1A 3W3AA 1L1OA 1D7QA 1NJIC 1UE5A 2KUMA 3AYHB 4JC0A 3T53B 3HOUH 3L3OC 1H9JA 1DJRD 2I0QA 3H09A 2EVBA 4ZRZA 1Q82C 3DWPA 2N3SA 3IRBA 1YJWA 5FO8B 3EFXD 3M9BA 5LMUL 5I2XA 2JA8G 1Q90A 5FLXE 2K5NA 2L55A 4A3MB 1LO5D 1LTAD 1O80A 4PZ6A 3D6CA 1WTVA 5FKAC 5G3LD 1MIUA 4A3KH 3LWEA 3I4NG 1UUPA 3IFTA 3VR6A 3JC66 1OXVA 3S1QB 2R93B 1ET6A 3S17H 5LMNW 5JPMC 5IYBH 2UXBQ 1BBWA 3MTSA 2HD3A 1I6HB 1KRSA 1D5MC 4H02A 1RKNA 4RGOS 2DN8A 1XMOL 2XVSA 5IGEA 1Q1BA 3M3YH 3SK4A 2JA6H 4NKLA 3FVQA 4GOPC 2J4XA 1AFPA 4A3DG 3ULLA 2XIWA 1TWAH 4LF5L 1TWCH 2KEEA 1U0LA 1PLFA 1UEBA 1SYDA 1FGBD 4C3HG 1C7YA 4FF1A 5IT9L 3J81E 4RCOA 2TSSA 1LT6D 1LTLA 4HN7A 4OIJA 1A62A 5HGTA 1KD1C 2D9UA 1I6VC 4HIOA 3T1HL 1XMQL 1PH9A 4HIKA 5F2DA 3D3RA 3C46A 1KDCA 5FLXL 2QA4A 4BBRG 2KHSA 1GUGA 4CDEC 1BNZA 4BY7H 1TWHH 2RVLA 4QIWB 3P1HA 2ZT9C 1C0AA 1VQAA 4JBKA 1QILA 2WV6D 2D0PA 2F3WA 1PH2A 4CKBA 5KYLA 3EQLC 3NTKA 3I4MG 5FJ8H 1SE2A 2UUBL 1QUQA 1ENAA 2NN6G 4IUTA 3RLNA 4JI2L 5C3EH 3ULPA 2OF1A 3H3VC 1VF5C 1O7IA 1S72A 3W1BA 5EBDA 1MJCA 4CDDC 2Q2HA 2I5MX 2KVMA 1PXUA 5LL6X 4OGQC 2DGYA 1GHJA 2AKWB 1VQ4A 2CQAA 3J81L 1YNND 1A0IA 1U4LA 1STYA 2BH2A 4R4CA 2XRSD 4J8QA 2ATWA 2B3GA 4LMQD 3BS1A 4K8JA 2X6GA 3C2PA 2JA7B 2H5XA 2K33A 3CCRA 1HZBA 3CC2A 2CVRA 4KV6A 3HOYG 3GTPH 3EVQA 4C2MB 4U673 2K5VA 2WIIB 3D4WA 2L9HA 4I65A 1WTXA 1NCVA 2ZXRA 4KY5A 4NDXA 5GROA 3TQYA 3CD6A 1V9PA 4IPCA 5DAUA 1DONA 2F0QA 3EA6A 3QIAA 2IX0A 3ICEA 4DV1Q 1VQMA 1WFQA 3TMEA 4ULLA 1EIFA 4DFAA 5NUCA 2RA4A 4A3EG 3BZDB 1VQKA 4LWCA 1EIGA 1JMCA 4M8AA 3DXJC 4A76A 1Q86C 2PZUA 5IP7G 5M5WH 1SNCA 4R4TA 2JEBI 2F0IA 4K5VA 2PPBC 2VUMG 3RZOH 4GNXA 4IOCA 2NWGA 1G6ZA 5D14A 1KXLA 2GVBA 2PI2A 3I4OA 3I90A 1FNUA 3PO2G 3HKZE 1KAAA 4A3CG 2PQAA 1F2ZA 1NR4A 3J81j 4J15A 3GTJH 3G71A 3CF5A 4C3JH 4ILWA 5C0XI 4IN3A 2A6HD 1HR0W 2EYHA 2RF4A 3KBGA 1HPCA 3J80i 2OTLA 1S5ED 1SYEA 3JAMi 4K0KL 2R92B 2SOBA 3PO3B 2WACA 2F4IA 4KKSA 2QEXA 3KLSA 2F0OA 3CMAA 2CHBD 4GN3B 3H0GB 2AHOB 3H3VH 4WJ4A 3S2HH 1TKWB 1CKOA 2EYMA 1LTBD 2CH4W 3NP8A 1KC8C 3SK6A 3WOEA 4JYAL 3IKJA 1PZKD 3GTGH 3FPUB 5ELOA 1E0BA 2B8FA 5C0XH 1EL0A 1GUTA 5CV9A 3QOJA 2PZWA 3TN2A 1BO0A 1PTOD 3GV3A 3K57A 2DY8A 2FMMA 1A8VA 4UY8C 5CV5A 4DV6Q 1YVCA 5IGBA 1ZEQX 1N32Q 5M3MB 4DK1A 5GAEC 2NVXB 1F9SA 4C1NK 1Z6HA 2VQEQ 2YU9B 2F03A 3FP9A 2L12A 5IODA 4A3GB 1PH1A 5J1ZA 1H9SA 4LFAL 1CA5A 3M4PA 1G2TA 3CP0A 2EPBA 4P75A 4KI0A 3K0XA 5K36H 5DLQE 3CCJA 4DV3Q 1R9TB 3GTQB 1EY7A 4DAVA 1LT5D 1C9OA 2AWNA 4GLAC 4NXNL 5C4XH 4B9XA 4DAPA 1DOMA 2J0TD 5EPJA 4IFDI 4XXEA 4DR7Q 3K7AB 1CFMA 4A3MH 5CYUA 5IP9G 1UE7A 1TQOA 4HAEA 2EXDA 1EEID 1MI2A 2R3ZA 4LUZA 3BVMA 2R7ZG 3NELA 2R93H 4PMBA 3U9OA 5C44G 4BXXG 1VCIA 3HOVG 4OELB 2EYOA 3BZKA 1LTID 1ENCA 3TZDA 1Q46A 2B2UA 3S2DB 3VA5A 1CI3M 2Z4IA 1EQTA 1M1KC 4CKCA 4A93H 3G4SA 3R3OA 1OO9B 2IT1A 2O2LD 2UU9Q 1NUCA 2JA5H 4LFAQ 3W5OA 3CMEA 3GQBA 2EDGA 1U4PA 3JAME 3K5MA 1KABA 1SYCA 2A6HC 3ND9A 2AQ2B 1X3QA 2EZVA 3TP6A 4HJAA 4NP5A 4FF4A 5A2QE 4OWWB 4JI8L 3NTIA 3VYSA 2A1AA 3I56A 3TRZA 3N6RA 1HNZQ 1VMCA 2BE5D 4DV7Q 3HOUB 1JWMD 4QQBX 2OTJA 1MD2D 3NENA 3GD7A 1MKHA 2EE1A 2K03A 1PTOC 2OQKA 5FLMH 1S3OA 3RN2A 1TWGB 1RL2A 1V1PA 4KHPL 5CV8A 2MUYA 1H95A 4ZAIA 2QGQA 3CPFA 3STBD 1GKHA 2UXCL 4TRDA 3S1RB 4CHTB 2AQ1B 1D2BA 4R8NA 1SE8A 5JEAJ 3S17B 3A56A 3OIQA 1TS4A 2FMCA 2FFKB 2D0OA 3HOXG 3K5OA 2JK8A 4JW0A 2YYZA 1SBBB 1WI5A 4RHRA 4TKOB 1XYIA 2WB1B 4QL5A 1ZXTA 4RHSA 3J80L 3JAML 1VQ7A 3AQQA 1XNRQ 2Q8RE 1TWAB 3J7YW 4LF8L 2AUKA 5GADC 2JA7H 1LV9A 5IWAQ 2K01A 2HUGA 1IBLL 1MSHA 1HRJA 5A2QL 4ME3A 1HTPA 1YZ6A 1J6QA 4C2MH 5JJKA 1V1PB 4OX9Q 1VQBA 1GUNA 2Z1CA 1MGSA 2VL6A 4ZCKA 5E7NA 5I2YA 4KKTA 2EYPA 1QZGA 2EY1A 1XPRA 4A3LG 4LFBL 1Y1WG 3VR5A 4OWTB 2GA4B 3A74A 4A3IB 1Q3LA 1BCPF 1VF7A 5IT9c 4F7XA 3HFZB 4B3RL 3MC0B 1NMGA 3RN5A 3IAYA 4H13C 3W1GA 1TWHB 1EU4A 3F2BA 1QCBD 4XYQA 1PFNA 5IYDH 4L63B 2VXWA 2PMZB 1SR3A 2WAQE 2M9VA 5JJLA 2JQOA 4BBSH 1W2BA 4XDXA 1JT8A 4EX5A 3ITPA 3OOCA 1PMRA 1HJPA 2Z9HA 3S1MH 1GM5A 4JOIA 4RGMA 1DXMA 4YWLA 5GAGC 1CKNA 4DPGA 2RBMA 1SDFA 3I73A 5IE8A 1K9MC 3HOWG 3E6ZX 1OTCA 2MO1A 2F3IA 4JI4L 2RKSA 4C1NI 2R92H 5DNFA 1SYGA 3PO3H 2A68D 3NBIA 2VZAA 1CT1D 1VQOA 1RTOA 3SEBA 4Y52H 2F0MA 3H0GH 4FDBA 3S9WA 3GV6A 2YTYA 4CBVA 2JYOA 1C8CA 1HR0L 4X62Q 4F87A 4PQXA 3J81c 1IBKQ 4JV5L 3R8BA 4UP9A 1NY4A 4IUPA 2IJ0A 2N49A 2F0EA 2ICIA 5M3MH 5C4JH 1IBML 3K80C 1HQMC 3S14B 5IGFA 3R2TA 3G6JB 1L0XB 2EYLA 3STBC 3HOZG 3I72A 1G91A 4A3GH 4DUZL 1M90C 2VB2X 2N8NA 4LF7Q 2NYZD 4JG2A 3UDFA 4IURA 5HY6A 3A0JA 1BOSA 4DNIA 3OHXC 3BU2A 1ICFB 3WOFA 1CHPD 4OL7A 4FNFA 4DGZA 2KOLA 5JVG3 4AYBG 1A3TA 4JBWA 2F0GA 4DV2Q 2L15A 1B4OA 4DXGA 4XTCS 4GN5A 3I55A 3A54A 1V1OA 3K6OA 3RR5A 2VS1A 1AE3A 4DA2A 2B63G 5EPKA 3PV0A 1JORA 4KMUC 3M4OB 3LX0A 4LW1A 2E76C 3PF5A 1ESFA 3FKIG 5JEAG 3PUYA 4G7OC 1U9RA 5ELBA 4DAYA 2YTXA 1KTKA 5EJWA 1WTHA 1D8LA 4XIGS 5TSSA 2A8VA 4LFCQ 2N55A 5KNDA 1EIYB 2B2TC 3NUCA 3MXNB 4NW2A 4DR5Q 4EGVA 3HG9A 1VQGA 4FXDA 3K5LA 2XWBB 3OSOA 5M3FG 3KF8A 4NXMQ 4V190 3I91A 2NBFA 1PRTB 2JXMB 4AQYQ 3PIO3 4DUZQ 4JI0L 3T56B 1I4HA 3I8ZA 1RODA 3SK8A 3SGIA 2YV5A 1J5EL 1X65A 3HZXA 3NXWA 1QNUA 1AZQA 1A3VA 2EYJA 4FO2A 1HXYD 1HCZA 4JI5L 5KNBA 3K5NA 1M4VA 3MEHA 4GKKQ 4EQOA 2EY6A 1B3QA 2FXQA 1JE4A 1V1QA 1HNXQ 1IW7C 1E2WA 5BN3A 5IT9E 4BY1B 1HNWQ 3CC7A 1T5EA 4KLKA 4L5RC 4ZK9B 2UUAL 4BS9A 5HURA 4B3TL 5C4XB 4X66Q 4DNTB 3E0EA 2IPKD 1PH7A 1JB7A 3QWNA 5KIXA 1F2YA 2BDOA 2HHHL 3Q23A 4DV5Q 1SAPA 1TWGH 2F0VA 1VQFA 4R9WA 2B2WA 1M8AA 1WCMB 4IUNA 2KCCA 1K0RA 3ERQA 4C56C 4C3IG 3PGZA 1S5DD 4EVOA 5BR8Q 5KYIA 3S1RH 1L2FA 2HDLA 1H9RA 4I7ZC 1E2ZA 4DR6L 3KYHC 4MNOA 2NTTA 4A4IA 4XT1B 1FJGQ 2B2VA 2XN9C 1L1OB 2BA1A 4KHVA 1RHPA 1TXYA 4MZ9A 5I9PA 1PFMA 1OXTA 3BZCA 3KUPA 4B3MQ 3BVZA 4A93B 3MHBA 4O1NA 2VB3X 4QCLA 4RFBA 2H1EA 2JA5B 4K6LA 1P16A 1HUNA 4HCSA 2QILA 1Y1VG 4GKJQ 4ODGA 3SVMA 4JK1C 1TS3A 1E2VA 2YTVA 4QIWE 2XGTA 1Y8OB 4NPSA 5KNCA 4X65L 1YITA 1Q7YC 2B2YA 3BDCA 1VS0A 3Q22A 1Y69U 3ZJYC 1PV4A 1F9QA 1PH3A 1ILQA 2EXZA 2Q8TA 2UUAQ 2JEAI 5GAHC 4A3IH 1NNXA 3ERSX 3VR2A 1JJGA 2KHJA 5LMUQ 1I4QA 1EWHA 1EFID 3TREA 3E0JA 2MFIA 3V05A 1L0WA 2ZJQA 2J7ZA 2EYFA 4GS3A 4DR2L 4K2LA 4IJLA 1B1ZA 4YY3L 1EQQA 3BYTB 1TS2A 4JVZA 3TP5A 1IXRA 4XT3B 1Z47A 2F0WA 1L0YB 4K2KA 2RCFA 2LS01 2RSOA 1QOHA 1CUKA 4WRDA 1VQ8A 2M2LA 3PMFA 2C35B 2CW0D 1PVOA 1STBA 1PTOF 1XMOQ 2IX1A 5M5XH 3OTOL 3OIPA 2E8GA 2RHQB 5JAVA 4YIJA 2K28A 2Z6KC 1XNQL 3I4NB 5JJZA 1EZ8A 4KY7A 2B8GA 1DYQA 4LF5Q 1KNAA 3DLLA 4U68A 2UXDL 2EJMA 1WTQA 3KF6A 4HIMA 1PRTC 4OHJA 3HKZG 1AN8A 4OO1I 1EOTA 4X65Q 1ET9A 1B70B 3T1HQ 1XMQQ 4IOAA 4ZYSA 1QUQB 4A3DB 3MWYW 3KFUA 2I5LX 5LHY1 3CCSA 1LTGD 3GTMB 4LAAA 3J80c 3JAMc 2IHEA 3BVGA 1EFWA 4K8IA 4WFN3 4DNRB 1FNWA 2F0KA 2ZXOA 3AMUA 1PFBA 1SNMA 3KDFA 3F1ZA 3S14H 5CC4A 4M1UB 3HEJA 2E75C 2GN5A 5C4HA 3LGJA 5K5PA 2PZTA 4OO1H 1BR9A 4KD4A 1K8GA 4DUYL 2UUBQ 4BBRB 3E9IA 1EYAA 2TMPA 4Q0FA 3DM3A 4JI2Q 4KHZA 1ASZA 4IZ8A 3NSWA 4EQ5A 4ZKBB 4BBSB 1SSOA 3CCUA 1II3A 5EKKA 3OTOQ 2V1CC 5DEHA 4Z9CB 4KK7A 1XNQQ 1KLUD 3S1MB 3I4MB 3TP8A 5IYCH 2VQFL 1XJVA 4IALA 1SFOB 1JOOA 4ABNA 1HTLD 1D1IA 1KAWA 1CHQD 1EYGA 4P73A 2QW7A 4OXPA 3RD4A 1L1OC 1DD2A 4O2DA 5JJIA 2K32A 2DJGC 3CU7A 1A2UA 4MHEA 3M4OH 4AH6A 4IUQA 2O5IC 1TVXA 1STAA 2HQLA 3A8JE 2K1BA 3AFPA 1K8OA 2ZM6L 2I5HA 5C6AA 1YBYA 1JJ2A 4PV1C 3UE0A 1ICWA 5AJ3L 4GNXB 2F0DA 4F8MA 1EY8A 4A3FG 1IYJB 2Z6BA 4CKEA 1EEFD 1NSNS 3U58A 3L0OA 1AP0A 1VQCA 1SRUA 2PW7A 2PQAB 3K81C 4X3UA 1VQLA 4H7BA 3A5ZB 3A5UA 1N36L 4YCWA 2IHFA 5C5MA 3HOYB 1QNKA 3PUVA 2PO4A 2R6GA 3VR4A 5C4JB 3Q0AA 4DUYQ 3X3NA 3KLSX 1CZGA 2CW0C 3MFGA 1FVIA 1UEAB 3CAMA 2BOSA 2F0JA 1YJNA 2CWPA 2MP1A 5EPLA 2NUCA 2NZHA 2K4KA 4ZQ3A 3O13A 2AQ3B 5EBCA 4ZUJA 4WORA 2CWAA 3UDXA 2JJQA 4PMCA 1BUVT 4A3EB 2DNCA 4BY1H 3ULJA 5C4ZA 4ZLTF 1U4RA 1A2TA 1DGSA 5KGUA 1X3FA 2EY2A 2VUMB 3VYTA 4A3BG 1QG7A 4LK1C 4K0KQ 3K59A 4GLXA 3BG3A 3U4VA 4IO9A 3HOUG 4JCVE 1N34L 2LMCB 3OWEB 3PCOB 2F0FA 3NK9A 1T5XD 1WCMH 1I4RA 2RQXA 1IZ6A 1RJTA 2HT1A 2ES2A 1H9SB 2F0LA 1K8MA 2OEOA 4O42A 3MZ5A 4OWXB 4A3JH 4JYAQ 1J8IA 1IL2A 2WFWA 1D6EC 4A3KG 2F4VL 2RSNA 1N36Q 3RZDB 4IFDH 3OW7A 1QWYA 1JICA 5A35A 5IYBG 2K5DA 3QG1A 3TDQA 5LMNL 2JA6G 1B44D 1HA6A 2EJFC 2NTSA 1WVLA 3FMCA 4H0LC 3IFDA 1EIHA 3J80E 3D8GA 4DR4L 1BBUA 2X69A 3GTLB 4KN4C 3F8TA 1VQHA 2PNRC 4LF9L 2ID0A 1S5FD 2KHIA 2ZTDA 4NXNQ 4QUFA 3R2IA 4MTKA 3K58A 1EQVA 3NQTA 1YI2A 3NEMA 1EZ6A 1R4QB 1EWCA 2RDGA 1KDBA 3FPPA 3MA2B 2VNUD 4N9PA 1AW7A 3N52A 1N33L 1JOKA 4K5WA 2L0CA 3CQZB 1G291 4BY7G 4EQNA 2IX3A 5KEEA 1PZID 3CCQA 4QB4A 2O4XA 4A75A 2K75A 1FD7D 4UHVA 2EOTA 2WB1E 1B9NA 4POGA 4JI3L 2JA8H 4LF6L 5FJ8G 1N9WA 3GO5A 1K0SA 2JE6I 2XSCA 4GNXC 1LM0A 5ELEA 1U4MA 4KJNA 3I4NH 2R7ZB 5C3EG 3UDGA 3CCMA 3UDIA 2I07B 2KCMA 2QF7A 2E2HB 2WAQG 3CW2C 5LMNQ 5GQOA 1OXUA 5IIFA 3K7UC 5C44B 4RKLA 2V4DA 4DV0L 3TBIB 4FXGC 2R61A 3U4ZA 3QOLA 4IQZA 1SE3A 4RGNA 5E3FA 4A3DH 3W2DA 3I70A 2A74C 2E2IH 2MHVA 4LF9Q 3GTMH 1VQJA 4UP8A 1STNA 4R4QA 1ONLA 4C3HH 1SMYC 4JI8Q 2Z0SA 2RDFA 3E9HA 1DM0B 2PMZE 3CCLA 1N33Q 1CSPA 1BXTA 3I3CA 4XYOA 2NVTB 1MHWC 4ME5A 4HIDA 1O7YA 3PUZA 2HIXA 4X64L 4RAUC 2NN6I 1KHIA 2EJGC 1GVPA 4BBRH 2FHTA 1WTRA 5AFWA 3J7ZC 1EY9A 4KHPQ 1XXGA 3H15A 1RF2D 1S4ZA 3D0FA 4JI3Q 2UUCL 1E7ZA 3RLFA 2FJ2A 2DJFC 3P20A 2UXCQ 2G9DA 4JI1L 1FYCA 2O5JC 4QJFA 4PG3A 1NTGA 3I4MH 2IWHA 3OYYA 4JI6L 1SFOH 3P75A 1CA6A 1KL9A 4YWMA 4OONA 5M5XB 3DEOA 5CBAE 1G2SA 2NN6H 5IY0A 1LUZA 3NBHA 3I2ZA 2B29A 1SNQA 1VDZA 3RNUA 3HGBA 3HP3A 4R1JA 4LF8Q 3EN2A 4C3JG 4GN4B 1STGA 1IW7D 1SLJA 1PH4A 2Y0SB 1JOQA 1K3BC 1IBLQ 2XTIA 3M85A 2GVAA 3RLOA 3KBXA 3A55A 4QF4A 3ER0A 3HOXB 1KRTA 3S16B 4GOPA 4RWSC 4KY6A 3PUXA 2A69D 3E3XA 2K5HA 5C3WA 1STHA 2RCNA 1XTCD 4LFBQ 1MSGA 3EROA 1PH5A 1LACA 4HMIA 3AB9A 1S5CD 1STEA 4B3RQ 3HOYH 3PF4A 1G6PA 1CKNB 5C0XG 4YHHL 1N8RC 3BYYB 2QKIC 2ZJRA 3RUZA 4JI7L 1YNXA 1NE3A 2B2UC 1HZ9A 2F0UA 2BCOA 1QVFA 4LF4L 1E22A 3H94A 1Y1WB 5JOBA 3OMCA 1KNEA 4F88A 4IPGA 1LT3D 2OXPA 1ASYA 4A3EH 4JI1Q 1TY0A 2KENA 3V2TA 5IP7H 2WKCA 3L9AX 4RKBA 2OCEA 4CGYB 1I94L 4J1MA 3VR3A 2VUMH 5K36G 3KJOA 3DEPA 4JI4Q 1X55A 1PH8A 1PYBA 3PO2H 1BCPB 4HSVA 1EY0A 5C4XG 4A3CH 1EQRA 2HDMA 1GOZA 2NVYB 4DV4L 1SROA 4BA1I 4DU9A 1PHJA 1TR5A 1EOVA 1HR0Q 4A3MG 3AEVA 1W3SA 1W6KA 3HOWB 4JV5Q 5BN5A 1QJOA 1RDPD 1FR3A 1X6OA 4NB3A 3OW2A 1HZCA 1CZWA 4N8X1 3RZDH 1WYDA 2K7VA 2R93G 1PH6A 4HTHA 1E3PA 1Q12A 1K3RA 1IBMQ 1TU2B 3OMGA 2SNMA 3QB3A 3HRZC 4LF4Q 3Q6SA 2KEDA 4K14A 1K8AC 1WD0A 4A93G 1LYLA 4TSSA 1UE1A 3D4RA 1GD7A 5EKIA 2JA5G 3C3LA 3GTLH 1KQSA 2UXBL 3H91A 1IYVA 1PZJD 4KD3A 1PYSB 4B9WA 4LJZC 4KKUA 4HCEA 4N8FA 3HOZB 4DAYB 3KLWA 3NQIA 1A15A 1PRTD 3EIVA 1WD1A 1QVCA 4WJ3M 4IPHA 1ZYRC 1Z7TA 4QMGA 1QE6A 1PA6A 4KJOA 3SE0A 4B3SL 3K8AA 4HEDA 2A69C 1R4PB 3TEHB 3CQZH 3DWAA 2CFMA 1AEXA 2PW5A 3H6MA 4NMZA 4UP7A 3UE1A 4AYBB 1UWVA 2D62A 3KF8B 2KECA 1QB5D 3M7GA 4AIMA 4DK0A 1VQPA 1HFNA 1B3AA 4MTNA 1V8QA 2Z8LA 2Q2TA 4A3JB 5IP9H 5FLMG 1JB3A 1JWSD 4Y7NB 3F2DA 3V96A 4ALPA 2B63B 4FVMA 3AU7A 1ZKOA 1G8ZD 2R7ZH 1WJJA 2NB0A 2E2HH 1LLRD 1CQFA 4JOIC 1F2MA 3FKIB 4PNYA 2ICEC 1EY5A 5C44H 4JI0Q 2F0NA 4BXXH 3HOVH 1NAPA 4IUUA 5J22A 5JVH3 3E5SA 4J6HA 4KTAA 1J5EQ 4DN4M 5E4XA 3EJIA 2LY7A 5CV4A 5DM73 4JI5Q 1CK1A 4DXFA 2LXJA 2KQ3A 2JA7G 5M3FB 3MVVA 1LABA 5FOBB 5FO9B 3DUZA 1X3EA 4MN3A 1B8AA 4B3SQ 4B3TQ 1JJCB 5BN4A 3C1EA 1YHAA 3T16A 2NVTH 1FL0A 2HHHQ 2DNEA 2C5CA 3CHBD 1TWFB 1SXTA 5ELDA 3TS0A 1HZAA 1BCPC 3J7A5 1B2TA 1VQIA 1X54A 5CORA 2F3VA 1A63A 2R7FA 1EY6A 5ELNA 1I3QB 2I46A 3VYUA 1C48A 3NWSA 5IYDG 4UAIA 5E1FA 4DR6Q 1BVSA 1F9PA 2JA8B 2SDFA 1WTPA 4RMFA 1B9MA 4DV1L 3IL8A 4BBSG 1OXSC 2AUJD 1EYDA 3CC4A 3MEFA 2BDNA 4I7AA 1I50H 2F0PA 5J39A 2E2JH 4C3IB 4FYDA 1GJXA 3OWFA 3SDZA 1SYBA 1P8LA 4DKAC 3PIOA 5I4DA 3QO2A 1XPUA 3HOXH 1YEZA 3S16H 5M9OA 2ENBA 2KA7A 2R92G 3FEWX 3PO3G 1V43A 1W6JA 1HQRD 3MXPA 5T1IA 3WWVA 1CQVA 2E2IB 2N88A 2Z4HA 1SN8A 3H0GG 2XRQD 3I4LA 5D3DA 2Q2IA 4C3HB 5CGKA 4BA2I 1YJ9A 1K28A 1Y1VB 1K83H 3T1YL 1HHVA 1KDAA 1Y8PB 1VQ9A 1B53A 4X6AH 1GUOA 4DR2Q 4HJ5A 5D65A 5M3MG 4A3LH 5L37A 3DWQA 3B6YA 4YY3Q 2MPMA 3NTHA 1Y1WH 2VY3A 1I4XA 1IKLA 5DM63 2NZ1D 3L2PA 3KF6B 3G7LA 3CPWA 1PDQA 1X56A 1X3GA 2F0TA 2WKDA 1X32A 2DUDA 4B08A 4A3GG 2MJ8A 1JE5A 4LNQA 2G5DA 2F1MA 1XWEA 1ML0D 4DV6L 3KK7A 1D5XC 1N32L 2ZJPA 3HS0C 2ALYB 2IY5B 4IJHA 4ZUIA 4G7HC 2VQEL 4HJ8A 1BQQT 4O0AA 1BKBA 2UXDQ 3KDFB 1E24A 3A8IE 2NVYH 1E1OA 5KRUA 1WTWA 2EQSA 1OXXK 2PI2E 4P72A 4LUVA 3ZYYX 3H3VI 4POFA 1T9HA 4HSPA 1YHBA 3HOWH 4DV3L 3NWTA 1CTMA 1RCVD 4XQJA 1PYWD 1O78A 2B2WC 2QEJC 2EIFA 4L8JA 1MBYA 1TT2A 3T1YQ 2L11A 3HKZB 1PTOB 5COYA 4DR7L 3S1NB 5M5YB 3I7FA 2L4NA 3NHHA 1EYCA 1NBWA 2B2VC 3OPOA 4YCVA 1VQ6A 1I5FA 2FINB 3PSIA 1AE2A 3ND8A 2MO0A 1JQYD 3GTOB 1SEBD 2F0SA 1EY4A 2BH8A 3SR1A 3S15B 3KOJA 1AH9A 1D5ZC 3LNNA 1DZ1A 4DAMA 4JBJA 2P5ZX 1C4QA 3R93A 2LKVA 2IW3A 3G48A 4CJ2C 3HOZH 3T51B 2LXKA 4K6DA 3C1FA 2VQFQ 2B39A 2XWJB 3QR8A 2B2YC 4KN7C 1LTRD 2UU9L 1RTNA 2A73B 1NR2A 2E74C 2HIVA 1SNOA 1HH2P 2DY7A 4R4OA 3UI2A 3CRKC 3PO2B 1LTSD 5EGTA 1YNNC 2OWOA 1SMYD 3T4AC 2LSSA 1Y8NB 2ZM6Q 1QZHA 5ELCA 3MXGA 1BDOA 3BJUA 1UNSA 5AJ3Q 1RD9D 1O7ZA 4Y7NH 2B63H 4DR1L 1BF4A 1HNZL 1TY2A 1JCKB 4DV7L 1FNVA 4XQQA 1X3PA 1H9MA
chains in the Genus database with same CATH topology
4G4KA 5JEAH 5JPNC 2K6AA 3LWUA 4A3FB 2NVQB 5C0XJ 1ENFA 4RH6A 3A8KE 4K5XA 3PIP3 2Q8IB 2K5QA 2PYKA 3TZUA 4DF7A 3F2UA 3U9SA 1SNDA 1I4PA 3VYRA 3MXUA 3J7AF 3GTKB 1AZPA 4G57A 3D31A 2C9OA 3VA7A 5IGGA 5D3IB 4S3SA 1LTTD 2HQEA 5CV6A 1Q1EA 2K04A 2K05A 4L6TB 1ILPA 4RCNA 4A3BB 2H4OA 3M7NA 2HCIA 1UAPA 4E6IA 1WTOA 5I9OA 1IHZA 4ZKCB 1EU3A 3Q24A 4EQPA 1J9OA 2LFNA 4QUCA 5ISRA 3CKIB 3J7AV 5I6WA 1GXDC 1HUMA 5FK9C 4GZYC 2SEBD 3HOVB 4A3KB 2B2TA 1YNJD 5CV7A 1LT4D 4IFDJ 2KCNA 2EY5A 4H44C 1GUWA 5CMDA 5T1GA 3X3MA 3QJYA 1D1KA 3DHQA 2PCFB 3M3YB 5IOCA 2JA6B 3A7AB 2RDHA 3NE5B 2WINB 4RA8A 4FXKC 3SXHA 2WP8J 4OIKA 4X3SA 4V0BA 1TWCB 1A6XA 2KJXA 5IGDA 2X6LA 4XQNA 2A5HA 4N9TA 4Q5VA 4CJ0B 4X3KA 5C3XA 3M4YA 5FO7B 3WDNA 3D4DA 3CRLC 1Q8IA 4OO1G 4CJ1B 2QDBA 1TS5A 5ELFA 2E2DC 4BY7B 3SHLA 2SNSA 5EKLA 1ESRA 1GUSA 2A6ED 1I50B 2E2JB 2L1BA 1S5BD 4WJWA 3SK5A 4FF2A 2JSOA 1DOLA 1ZYRD 5C3EB 5I6YA 2WAQB 1HFGA 5IGCA 3URYA 2IL8A 2K5WA 3BDOA 1PRTF 3DM1A 1PTOH 2F0HA 2M00A 1K83B 2AWOA 2ZXPA 2BE5C 1SE4A 1H9KA 3TP7A 1GHKA 1IYUA 4R8IA 5C5LA 3GTPB 3D6WA 3FDTA 1JWUD 4MIUA 2OT2A 5CBEE 1JR0D 1I4GA 1B50A 1F9RA 2L5TA 1DOKA 1CM9A 1XX8A 1YNJC 3ONAB 5LL6S 4HR7B 3FRPB 5G3LF 2QCPX 3PUWA 4BWGB 5M5WB 1DCZA 1SJHD 3RZOB 1BBXC 4TQUS 3L7ZC 1SNPA 1JC7A 5EQ0A 2MGSA 5CR3A 3MXNA 3RMHA 3P7JA 3GTJB 4C3JB 1IL8A 2HCCA 4X3TA 4P2CB 2PQEA 4G7ZC 1BCPD 3TSSA 1VMPA 4ID6A 3A7LA 5E4WC 1F77A 4IFDG 1TIID 4HMJA 3MAQA 2BA0A 3S2HB 3GTGB 1IKMA 2A6EC 1F2LA 1A3UA 1KLGD 1HA5A 4RGTA 1SYFA 4FF3A 4UDUC 4IUVA 1O7LA 2XNAC 3K0YA 2D2CC 3NPPA 3KLRA 3T13A 3MFYA 3DMUA 4FP5D 3GP7A 3BDLA 4PMWA 1SJED 2A68C 2D5DA 2G9HD 2JP1A 3W3AA 2KUMA 3T53B 1H9JA 1DJRD 3L3OC 3H09A 2EVBA 4ZRZA 3DWPA 5FO8B 3EFXD 5I2XA 1Q90A 5FLXE 2L55A 4A3MB 1LO5D 1LTAD 1O80A 3D6CA 1WTVA 5FKAC 5G3LD 3LWEA 1UUPA 3IFTA 3VR6A 1OXVA 3S1QB 2R93B 1ET6A 5JPMC 3MTSA 1I6HB 1D5MC 1RKNA 4RGOS 2DN8A 2XVSA 5IGEA 1Q1BA 3SK4A 4NKLA 3FVQA 2J4XA 1AFPA 2XIWA 2KEEA 1PLFA 1SYDA 1FGBD 4C3HG 4FF1A 5IT9L 3J81E 4RCOA 2TSSA 1LT6D 4HN7A 4OIJA 5HGTA 2D9UA 1I6VC 5F2DA 3D3RA 3C46A 1KDCA 5FLXL 2KHSA 1GUGA 1BNZA 2RVLA 4QIWB 3P1HA 2ZT9C 1QILA 2WV6D 2F3WA 4CKBA 5KYLA 3EQLC 3NTKA 1SE2A 1ENAA 2NN6G 4IUTA 2OF1A 3H3VC 1VF5C 5EBDA 2KVMA 1PXUA 5LL6X 4OGQC 1GHJA 2CQAA 3J81L 1YNND 1U4LA 1STYA 2XRSD 4J8QA 4LMQD 3BS1A 4K8JA 2X6GA 3C2PA 2JA7B 2K33A 2CVRA 4KV6A 3EVQA 4C2MB 4U673 2WIIB 3D4WA 2L9HA 4I65A 1WTXA 1NCVA 2ZXRA 4KY5A 4NDXA 5DAUA 1DONA 2F0QA 3EA6A 3QIAA 2IX0A 3TMEA 4ULLA 4DFAA 5NUCA 2RA4A 3BZDB 1EIGA 4M8AA 3DXJC 2PZUA 1SNCA 2JEBI 2F0IA 4K5VA 2PPBC 2NWGA 1G6ZA 5D14A 3I90A 1FNUA 1KAAA 1F2ZA 1NR4A 4ILWA 5C0XI 4IN3A 2A6HD 2EYHA 3KBGA 1HPCA 1S5ED 1SYEA 2R92B 2SOBA 3PO3B 2WACA 2F4IA 4KKSA 3KLSA 2F0OA 2CHBD 3H0GB 1TKWB 2EYMA 1LTBD 3NP8A 3SK6A 3WOEA 3IKJA 1PZKD 3FPUB 1E0BA 2B8FA 5C0XH 1EL0A 1GUTA 5CV9A 3QOJA 2PZWA 3TN2A 1BO0A 1PTOD 3GV3A 3K57A 2DY8A 2FMMA 5CV5A 5IGBA 1ZEQX 5M3MB 4DK1A 2NVXB 1F9SA 4C1NK 1Z6HA 2YU9B 2F03A 2L12A 5IODA 4A3GB 5J1ZA 1H9SA 1CA5A 1G2TA 2EPBA 4KI0A 5K36H 1R9TB 3GTQB 1EY7A 4DAVA 1LT5D 2AWNA 4B9XA 4DAPA 1DOMA 2J0TD 5EPJA 4IFDI 4XXEA 3K7AB 1CFMA 5CYUA 1TQOA 4HAEA 1EEID 1MI2A 2R3ZA 3BVMA 4PMBA 3U9OA 1VCIA 2EYOA 1LTID 1ENCA 3TZDA 2B2UA 3S2DB 3VA5A 1CI3M 2Z4IA 1EQTA 4CKCA 3R3OA 1OO9B 2IT1A 2O2LD 1NUCA 3GQBA 2EDGA 1U4PA 3JAME 3K5MA 1KABA 1SYCA 2A6HC 3ND9A 2AQ2B 1X3QA 2EZVA 3TP6A 4NP5A 4FF4A 5A2QE 3NTIA 3VYSA 3N6RA 1VMCA 2BE5D 3HOUB 1JWMD 1MD2D 3GD7A 2EE1A 2K03A 1PTOC 1TWGB 1V1PA 5CV8A 2MUYA 4ZAIA 4TRDA 3S1RB 4CHTB 2AQ1B 1D2BA 4R8NA 5JEAJ 3S17B 3A56A 3OIQA 1TS4A 2FMCA 2FFKB 3K5OA 2YYZA 1SBBB 4RHRA 1XYIA 4TKOB 2WB1B 1ZXTA 4RHSA 3J80L 3JAML 2Q8RE 1TWAB 3J7YW 2AUKA 1LV9A 2K01A 2HUGA 1MSHA 1HRJA 5A2QL 1HTPA 1V1PB 2Z1CA 1GUNA 1MGSA 5I2YA 4KKTA 2EYPA 2EY1A 3VR5A 2GA4B 4A3IB 1Q3LA 1BCPF 1VF7A 4F7XA 3MC0B 3IAYA 4H13C 1TWHB 1EU4A 1QCBD 4XYQA 1PFNA 4L63B 2VXWA 2PMZB 2M9VA 4XDXA 3ITPA 3OOCA 1PMRA 4RGMA 1DXMA 2RBMA 1SDFA 3I73A 3E6ZX 2RKSA 4C1NI 5DNFA 1SYGA 2A68D 3NBIA 1CT1D 1RTOA 3SEBA 2F0MA 3S9WA 3GV6A 4CBVA 2JYOA 1C8CA 4F87A 4PQXA 3R8BA 4IUPA 2IJ0A 2F0EA 2ICIA 1HQMC 3S14B 5IGFA 3R2TA 3G6JB 1L0XB 2EYLA 3I72A 1G91A 2VB2X 2NYZD 4IURA 1BOSA 3OHXC 3WOFA 1CHPD 4OL7A 4FNFA 4DGZA 2KOLA 5JVG3 1A3TA 4JBWA 2F0GA 1B4OA 4DXGA 4XTCS 3A54A 1V1OA 3K6OA 4DA2A 5EPKA 3PV0A 1JORA 4KMUC 3M4OB 3LX0A 2E76C 1ESFA 4G7OC 5JEAG 3PUYA 1U9RA 5ELBA 4DAYA 1KTKA 5EJWA 4XIGS 5TSSA 2N55A 5KNDA 2B2TC 3NUCA 4NW2A 4EGVA 3HG9A 4FXDA 3K5LA 2XWBB 3OSOA 3KF8A 4V190 3I91A 2NBFA 1PRTB 2JXMB 3PIO3 3T56B 1I4HA 3I8ZA 1RODA 3SK8A 3HZXA 3NXWA 1QNUA 1AZQA 1A3VA 2EYJA 4FO2A 1HXYD 1HCZA 5KNBA 3K5NA 1M4VA 3MEHA 4EQOA 2EY6A 1JE4A 1IW7C 1E2WA 5BN3A 5IT9E 4BY1B 1T5EA 4ZK9B 4BS9A 5HURA 5C4XB 4DNTB 2IPKD 3QWNA 5KIXA 1F2YA 2BDOA 3Q23A 1SAPA 2F0VA 4R9WA 2B2WA 1M8AA 1WCMB 4IUNA 2KCCA 3ERQA 4C56C 4C3IG 1S5DD 4EVOA 5KYIA 2HDLA 1H9RA 4I7ZC 1E2ZA 2NTTA 4XT1B 2B2VA 2XN9C 2BA1A 4KHVA 1RHPA 5I9PA 1PFMA 1OXTA 3KUPA 3BVZA 4A93B 3MHBA 4O1NA 2VB3X 4QCLA 4RFBA 2H1EA 2JA5B 4K6LA 1HUNA 4HCSA 2QILA 4ODGA 3SVMA 4JK1C 1TS3A 1E2VA 1Y8OB 5KNCA 2B2YA 3BDCA 3Q22A 1Y69U 1F9QA 1ILQA 2EXZA 2Q8TA 2JEAI 3VR2A 1I4QA 1EWHA 1EFID 3E0JA 3V05A 2J7ZA 2EYFA 4K2LA 1B1ZA 3BYTB 1TS2A 3TP5A 4XT3B 1Z47A 2F0WA 1L0YB 4K2KA 2LS01 2RSOA 1QOHA 4WRDA 2M2LA 3PMFA 2CW0D 1STBA 1PTOF 2IX1A 3OIPA 5JAVA 4YIJA 2K28A 3I4NB 5JJZA 1EZ8A 4KY7A 2B8GA 1DYQA 1KNAA 4U68A 2EJMA 1WTQA 1PRTC 4OHJA 1AN8A 4OO1I 1EOTA 1ET9A 4ZYSA 4A3DB 3MWYW 5LHY1 1LTGD 3GTMB 4LAAA 3BVGA 4K8IA 4WFN3 4DNRB 1FNWA 2F0KA 2ZXOA 3AMUA 1PFBA 1SNMA 5CC4A 4M1UB 3HEJA 2E75C 5C4HA 5K5PA 2PZTA 4OO1H 1BR9A 4KD4A 4BBRB 1EYAA 2TMPA 4Q0FA 4KHZA 4IZ8A 3NSWA 4BBSB 4ZKBB 1SSOA 1II3A 5EKKA 5DEHA 4Z9CB 4KK7A 3S1MB 1KLUD 3I4MB 3TP8A 4IALA 1SFOB 1JOOA 4ABNA 1HTLD 1D1IA 1CHQD 3RD4A 1DD2A 2K32A 3CU7A 1A2UA 4MHEA 4IUQA 2O5IC 1TVXA 1STAA 3A8JE 2K1BA 1K8OA 5C6AA 4PV1C 1ICWA 2F0DA 4F8MA 1EY8A 4CKEA 1EEFD 1NSNS 1AP0A 2PW7A 4X3UA 4H7BA 5C5MA 3HOYB 1QNKA 3PUVA 2PO4A 2R6GA 3VR4A 5C4JB 3Q0AA 3X3NA 3KLSX 1CZGA 2CW0C 3MFGA 1UEAB 2BOSA 2F0JA 2MP1A 5EPLA 2NUCA 4ZQ3A 3O13A 2AQ3B 5EBCA 4ZUJA 4WORA 4PMCA 1BUVT 4A3EB 2DNCA 5C4ZA 4ZLTF 1U4RA 1A2TA 5KGUA 2EY2A 2VUMB 3VYTA 1QG7A 4LK1C 3K59A 3BG3A 2LMCB 3OWEB 2F0FA 3NK9A 1T5XD 2RQXA 1I4RA 1RJTA 1H9SB 2F0LA 1K8MA 2OEOA 4O42A 3MZ5A 1J8IA 1D6EC 2RSNA 3RZDB 4IFDH 3OW7A 1QWYA 1JICA 5A35A 2K5DA 3QG1A 3TDQA 1B44D 1HA6A 2EJFC 2NTSA 1WVLA 3FMCA 4H0LC 3IFDA 1EIHA 3J80E 3D8GA 2X69A 3GTLB 4KN4C 2PNRC 2ID0A 1S5FD 4QUFA 3R2IA 3K58A 1EQVA 3NQTA 1EZ6A 1R4QB 1EWCA 2RDGA 1KDBA 3FPPA 3MA2B 2VNUD 4N9PA 1AW7A 3N52A 1JOKA 4K5WA 2L0CA 3CQZB 1G291 4EQNA 2IX3A 5KEEA 1PZID 4QB4A 2O4XA 1FD7D 2EOTA 1B9NA 3GO5A 2JE6I 2XSCA 5ELEA 1U4MA 4KJNA 2R7ZB 2I07B 2QF7A 2E2HB 5IIFA 1OXUA 5C44B 4RKLA 2V4DA 3TBIB 4FXGC 2R61A 3QOLA 4IQZA 1SE3A 4RGNA 5E3FA 3W2DA 3I70A 2A74C 2MHVA 1STNA 1ONLA 1SMYC 2RDFA 1DM0B 1BXTA 3I3CA 4XYOA 2NVTB 4ME5A 1O7YA 3PUZA 4RAUC 2NN6I 2EJGC 2FHTA 1WTRA 5AFWA 1EY9A 1XXGA 1RF2D 1S4ZA 3RLFA 2FJ2A 3P20A 2G9DA 1FYCA 2O5JC 2IWHA 3P75A 1CA6A 5M5XB 3DEOA 5CBAE 1G2SA 2NN6H 3NBHA 1SNQA 1VDZA 3HGBA 3HP3A 4C3JG 1STGA 1IW7D 2Y0SB 1JOQA 3M85A 3KBXA 3A55A 4QF4A 3HOXB 3S16B 4RWSC 4KY6A 3PUXA 2A69D 5C3WA 1STHA 1XTCD 1MSGA 3EROA 1LACA 4HMIA 3AB9A 1S5CD 1STEA 5C0XG 3BYYB 2QKIC 3RUZA 2B2UC 2F0UA 2BCOA 3H94A 1Y1WB 5JOBA 3OMCA 1KNEA 4F88A 1LT3D 2OXPA 1TY0A 3V2TA 2WKCA 3L9AX 4RKBA 4CGYB 4J1MA 3VR3A 5K36G 3DEPA 1BCPB 4HSVA 1EY0A 2HDMA 1GOZA 2NVYB 4BA1I 4DU9A 1TR5A 1W6KA 3HOWB 5BN5A 1QJOA 1RDPD 1FR3A 1CZWA 2K7VA 4HTHA 1Q12A 1TU2B 3OMGA 2SNMA 3QB3A 3HRZC 3Q6SA 2KEDA 4K14A 1WD0A 4TSSA 3D4RA 5EKIA 3C3LA 3H91A 1IYVA 1PZJD 4KD3A 4B9WA 4LJZC 4KKUA 4HCEA 3HOZB 3NQIA 1A15A 1PRTD 1WD1A 1ZYRC 1Z7TA 4QMGA 1QE6A 4KJOA 3SE0A 4HEDA 2A69C 1R4PB 3DWAA 4NMZA 1AEXA 2PW5A 3H6MA 4AYBB 2D62A 2KECA 1QB5D 3M7GA 4DK0A 1HFNA 1B3AA 1V8QA 2Z8LA 4A3JB 1JB3A 1JWSD 4Y7NB 3V96A 2B63B 4FVMA 3AU7A 1ZKOA 1G8ZD 2NB0A 1LLRD 1CQFA 1F2MA 3FKIB 4PNYA 2ICEC 1EY5A 2F0NA 1NAPA 4IUUA 5J22A 5JVH3 3E5SA 4J6HA 4KTAA 4DN4M 5E4XA 3EJIA 2LY7A 5CV4A 5DM73 1CK1A 4DXFA 2KQ3A 5M3FB 3MVVA 1LABA 5FOBB 5FO9B 3DUZA 4MN3A 5BN4A 3C1EA 3T16A 2DNEA 2C5CA 3CHBD 1TWFB 1SXTA 5ELDA 1BCPC 1B2TA 5CORA 2F3VA 1EY6A 1I3QB 2I46A 3VYUA 1C48A 3NWSA 4UAIA 5E1FA 1F9PA 2JA8B 2SDFA 1WTPA 1B9MA 3IL8A 1OXSC 2AUJD 1EYDA 2BDNA 2F0PA 5J39A 4C3IB 4FYDA 1GJXA 3OWFA 3SDZA 1SYBA 5I4DA 3QO2A 5M9OA 2ENBA 2KA7A 3FEWX 1V43A 1W6JA 1HQRD 3MXPA 5T1IA 1CQVA 2E2IB 2N88A 2Z4HA 2XRQD 3I4LA 5D3DA 4C3HB 5CGKA 4BA2I 1Y1VB 1HHVA 1KDAA 1Y8PB 1B53A 1GUOA 5D65A 3DWQA 2MPMA 3NTHA 5DM63 1I4XA 1IKLA 2NZ1D 3G7LA 1PDQA 2F0TA 2WKDA 1X32A 4B08A 2MJ8A 2F1MA 1XWEA 1ML0D 3KK7A 1D5XC 3HS0C 4ZUIA 4G7HC 1BQQT 3A8IE 5KRUA 1WTWA 1OXXK 3ZYYX 4HSPA 3NWTA 1CTMA 1RCVD 4XQJA 1PYWD 1O78A 2B2WC 2QEJC 4L8JA 1MBYA 1TT2A 2L11A 3HKZB 1PTOB 5COYA 3S1NB 5M5YB 2L4NA 3NHHA 1EYCA 2B2VC 3OPOA 2FINB 3ND8A 1JQYD 3GTOB 1SEBD 2F0SA 1EY4A 3SR1A 3S15B 1D5ZC 3LNNA 1DZ1A 1C4QA 3R93A 2LKVA 2IW3A 4CJ2C 3T51B 4K6DA 3C1FA 2B39A 2XWJB 2B2YC 4KN7C 1LTRD 1RTNA 2A73B 1NR2A 2E74C 1SNOA 2DY7A 3UI2A 3CRKC 3PO2B 1LTSD 5EGTA 1YNNC 1SMYD 3T4AC 1Y8NB 5ELCA 3MXGA 1BDOA 1UNSA 1RD9D 1O7ZA 1BF4A 1TY2A 1JCKB 1FNVA 4XQQA 1X3PA 1H9MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F8M A;  3D6C A;  4WRD A;  3MEH A;  1EY8 A;  4EQO A;  5IGD A;  5CV8 A;  2EY6 A;  3PMF A;  4ZUI A;  3P75 A;  4HTH A;  4N9T A;  1NSN S;  4KV6 A;  1EQV A;  3C1E A;  1STB A;  3EVQ A;  3T16 A;  2PW7 A;  3NQT A;  4TRD A;  3OMG A;  3D4W A;  2SNM A;  3QB3 A;  4R8N A;  4H7B A;  4I65 A;  1EY7 A;  1EZ6 A;  1SNP A;  5C3X A;  5JAV A;  4KY5 A;  4NDX A;  4YIJ A;  1KDB A;  5C5M A;  1SNQ A;  2F0E A;  5KRU A;  5DAU A;  5HUR A;  1EZ8 A;  4N9P A;  4KY7 A;  2F0Q A;  4K5X A;  4B9X A;  3D4D A;  1JOK A;  4K14 A;  1STG A;  4K5W A;  5CR3 A;  1RKN A;  2PYK A;  5KIX A;  1JOQ A;  5IGE A;  4DF7 A;  1F2Y A;  2F3V A;  3SK4 A;  4EQN A;  4NKL A;  2QDB A;  3TME A;  1EY6 A;  4QF4 A;  5IGF A;  2EYL A;  2F0J A;  4DFA A;  5NUC A;  5KEE A;  1SND A;  4QB4 A;  2O4X A;  4KY6 A;  5E1F A;  2NUC A;  2PQE A;  2F0V A;  4ZQ3 A;  4KD3 A;  1TQO A;  3SHL A;  4IUN A;  4B9W A;  4ZUJ A;  4WOR A;  5C3W A;  1STH A;  1SYD A;  2PZU A;  2SNS A;  3ERQ A;  1TT2 A;  4G57 A;  4PMC A;  5EKL A;  1EYD A;  4ID6 A;  1SNC A;  4EVO A;  3ERO A;  2F0I A;  4K5V A;  5KYI A;  4OL7 A;  4HMI A;  4LAA A;  4DGZ A;  5C4Z A;  4QMG A;  2F0P A;  1A2T A;  3NHH A;  4HMJ A;  4K8I A;  1EYC A;  4KJO A;  4KJN A;  2EY2 A;  1A3T A;  3U9O A;  4S3S A;  5HGT A;  5KGU A;  2HQE A;  3SK5 A;  2EYP A;  3OWF A;  2F0K A;  2F0G A;  2EY1 A;  5CV6 A;  1KAA A;  1SYB A;  5IGG A;  1SNM A;  4NMZ A;  1AEX A;  2PW5 A;  3H6M A;  4KHV A;  5IIF A;  1F2Z A;  2F0S A;  2EYO A;  5F2D A;  3RUZ A;  5CC4 A;  1EY4 A;  4RKL A;  1KDC A;  3SR1 A;  5I6Y A;  5I9P A;  2F0U A;  3HEJ A;  4F7X A;  1ENC A;  5M9O A;  2ENB A;  2KHS A;  5C4H A;  5K5P A;  2PZT A;  3VA5 A;  2F0F A;  4KD4 A;  1A3U A;  2EYH A;  3MHB A;  3NK9 A;  5JOB A;  3OMC A;  5IGC A;  3R3O A;  2LKV A;  3MXP A;  3P1H A;  3QOL A;  4E6I A;  1SYE A;  5I9O A;  1NUC A;  1SYF A;  2OXP A;  5E3F A;  1JOR A;  1IHZ A;  4K6D A;  2SOB A;  4K8J A;  1EYA A;  2F0L A;  4PMB A;  2OEO A;  2WAC A;  3C1F A;  3LX0 A;  3MZ5 A;  4ODG A;  4EQP A;  2F3W A;  1STN A;  4IZ8 A;  3V2T A;  2F0O A;  2F0H A;  2M00 A;  5KYL A;  5CGK A;  5ISR A;  4RKB A;  1II3 A;  1KAB A;  3T13 A;  5I6W A;  5EKK A;  1SYC A;  2EYM A;  1U9R A;  3BDC A;  4J1M A;  2RDF A;  3DMU A;  1ENA A;  3ITP A;  5DEH A;  3NP8 A;  1KDA A;  3SK6 A;  3TP7 A;  2EXZ A;  1SNO A;  3TP6 A;  3TP8 A;  1F2M A;  4NP5 A;  4PNY A;  1EY5 A;  4IAL A;  2F0N A;  1JOO A;  2OF1 A;  5C5L A;  3BDL A;  5EGT A;  5J22 A;  3NUC A;  5CV9 A;  3QOJ A;  5CV7 A;  1EY0 A;  2PZW A;  4ME5 A;  4MIU A;  2EY5 A;  3E5S A;  4J6H A;  4KTA A;  2RBM A;  5CV5 A;  3OSO A;  3EJI A;  5IGB A;  5CV4 A;  1A2U A;  2EYF A;  2F0T A;  4DU9 A;  2RKS A;  1TR5 A;  1SYG A;  1EY9 A;  4K2L A;  3SK8 A;  3DHQ A;  2KQ3 A;  5J39 A;  1STA A;  3MVV A;  5IOC A;  1STY A;  3D8G A;  3TP5 A;  5C6A A;  2F0M A;  3HZX A;  3NXW A;  1A3V A;  2EYJ A;  3S9W A;  3SXH A;  5IOD A;  2F0W A;  5J1Z A;  4K2K A;  2F0D A; 
#chains in the Genus database with same CATH topology
 4G4K A;  2E5L L;  3FKI H;  5JEA H;  5JPN C;  1Y14 B;  2K6A A;  2RHS B;  3LWU A;  3VDY A;  4A3F B;  2NVQ B;  5C0X J;  3S1Q H;  2WB1 G;  1ENF A;  3F2C A;  4RH6 A;  3A8K E;  4K5X A;  3PIP 3;  1I6H H;  2Q8I B;  2K5Q A;  2PYK A;  3TZU A;  4DF7 A;  5M3F H;  1WOC A;  3F2U A;  3U9S A;  1SND A;  2ASB A;  1I4P A;  3VYR A;  3MXU A;  1Q81 C;  4CDF C;  3CCV A;  2K52 A;  3J7A F;  3GTK B;  1AZP A;  4G57 A;  3D31 A;  1XNR L;  4APV A;  4P71 A;  2C9O A;  3VA7 A;  5IGG A;  5D3I B;  2CKZ B;  1TWF H;  4S3S A;  1N34 Q;  1LTT D;  5IWA L;  2HQE A;  4A3I G;  5CV6 A;  1Q1E A;  1GO3 E;  2K04 A;  1QVG A;  1K73 C;  4OX9 L;  2K05 A;  4L6T B;  1I3Q H;  1ILP A;  1XPO A;  1S40 A;  4DK3 C;  3FHW A;  4DR1 Q;  4RCN A;  4A3B B;  2H4O A;  3M7N A;  2HCI A;  1EUJ A;  1UAP A;  3GDE A;  1VQE A;  4E6I A;  1WTO A;  5I9O A;  2F4V Q;  1IHZ A;  1XTD A;  4YCU A;  2F52 A;  4ZKC B;  2E5L Q;  1EU3 A;  3Q24 A;  4EQP A;  1J9O A;  2K50 A;  2LFN A;  4QUC A;  5ISR A;  4C3I H;  4L5T A;  3CKI B;  3J7A V;  5I6W A;  1GXD C;  1HUM A;  5FK9 C;  4GZY C;  1B7Y B;  2SEB D;  4GLV B;  3HOV B;  4A3K B;  1KIX A;  3HKS A;  2B2T A;  1YNJ D;  5CV7 A;  1LT4 D;  4IFD J;  2KCN A;  2EY5 A;  2AMC B;  4H44 C;  5CMD A;  5T1G A;  1GUW A;  1E1T A;  2Y0S G;  4DR4 Q;  3X3M A;  1G51 A;  4TVA B;  3QJY A;  5EAY A;  1D1K A;  4LUO A;  2N78 A;  3DHQ A;  2PCF B;  3M3Y B;  5IOC A;  2JA6 B;  3A7A B;  2RDH A;  3NE5 B;  4HJ7 A;  2WIN B;  4RA8 A;  4FXK C;  1Y1V H;  3SXH A;  2WP8 J;  4OIK A;  5H1S E;  4X3S A;  4UPA A;  4V0B A;  1TWC B;  1A6X A;  2KJX A;  5IGD A;  2X6L A;  4XQN A;  2A5H A;  4N9T A;  4Q5V A;  4CJ0 B;  4X3K A;  5C3X A;  3M4Y A;  1Q8K A;  2CCZ A;  5FO7 B;  3CCE A;  3AFQ A;  4X62 L;  3WDN A;  3D4D A;  2Q2U A;  3CRL C;  1IBK L;  1Q8I A;  1Z9F A;  4OO1 G;  4CJ1 B;  2CH4 A;  4LF6 Q;  2QDB A;  1X9N A;  4JBM A;  1TS5 A;  5ELF A;  2E2D C;  4BY7 B;  2Y0S E;  3SHL A;  5HGQ A;  2SNS A;  5EKL A;  1ESR A;  1GUS A;  2A6E D;  1I50 B;  3PQI A;  4DV0 Q;  2E2J B;  5FLX c;  2L1B A;  1S5B D;  5IYC G;  4QY7 A;  4WJW A;  4LF7 L;  3SK5 A;  1SMX A;  4FF2 A;  2JSO A;  3PIP A;  1DOL A;  1ZYR D;  5C3E B;  5I6Y A;  2WAQ B;  1HFG A;  4DV2 L;  5IGC A;  3URY A;  2IL8 A;  2K5W A;  3BDO A;  1PRT F;  2JA9 A;  2ZTC A;  3U50 C;  2K14 A;  1U5K A;  3DM1 A;  1YHQ A;  1PTO H;  5J3B A;  5M5Y H;  3S1N H;  4CDC C;  2F0H A;  2M00 A;  1K83 B;  2AWO A;  2ZXP A;  4X64 Q;  2BE5 C;  1SE4 A;  1H9K A;  3TP7 A;  3NBH B;  4DK6 C;  1GHK A;  1IYU A;  3GTO H;  4R8I A;  4P74 A;  2R7D A;  4QGU A;  5C5L A;  3S15 H;  3GTP B;  3D6W A;  3FDT A;  3G6E A;  1JWU D;  2UUC Q;  4MIU A;  2OT2 A;  5CBE E;  1JR0 D;  1MJE A;  1I4G A;  1B50 A;  1F9R A;  2VW9 A;  4GOP B;  1EWI A;  2L5T A;  4LFC L;  1DOK A;  1CM9 A;  1UE6 A;  2NVX H;  4JI6 Q;  4HJ9 A;  4DR5 L;  2OQ0 A;  2YU9 H;  4DR3 L;  1XX8 A;  1YNJ C;  3ONA B;  4OEM B;  5LL6 S;  4L5Q A;  4NXM L;  2A19 A;  4BY1 G;  4AQY L;  2NZO A;  4HR7 B;  3FRP B;  5G3L F;  2QCP X;  2KBN A;  3PUW A;  2MNA A;  4BWG B;  5M5W B;  1VQD A;  2QDL A;  4PZ7 A;  1DCZ A;  1YIJ A;  1SJH D;  3RZO B;  1BBX C;  4PZ8 A;  4TQU S;  3L7Z C;  1SNP A;  1R9T H;  3GTQ H;  1JC7 A;  2CQO A;  1RIP A;  2Z6K A;  5EQ0 A;  4GKK L;  2MGS A;  5CR3 A;  3MXN A;  3RMH A;  1HNX L;  4YWK A;  3P7J A;  1HNW L;  1WCM G;  3GTJ B;  2JN4 A;  4C3J B;  1IL8 A;  2HCC A;  3K7A H;  4P2C B;  2PQE A;  4X3T A;  3J81 i;  4G7Z C;  1BCP D;  4X66 L;  3M4Q A;  4A3J G;  3TS2 A;  3TSS A;  4YHH Q;  1VMP A;  4ID6 A;  3A7L A;  5E4W C;  3CXC A;  1F77 A;  4JI7 Q;  4A3F H;  2NVQ H;  4DV5 L;  4IFD G;  1TII D;  4HMJ A;  3MAQ A;  2BA0 A;  3S2H B;  4RG1 A;  1VQN A;  4IPD A;  4R4I A;  5BR8 L;  3GTG B;  3EBE A;  1IKM A;  2A6E C;  3S24 A;  1F2L A;  3S2D H;  3Q8D A;  1FJG L;  1VQ5 A;  1A3U A;  1KLG D;  2ZTE A;  1HA5 A;  4DR3 Q;  4AYB E;  1I94 Q;  3GTK H;  4RGT A;  1SYF A;  4FF3 A;  2KCT A;  2PNH A;  1CSQ A;  4UDU C;  4IUV A;  1O7L A;  4B3M L;  2XNA C;  3K0Y A;  1PFS A;  2D2C C;  3NPP A;  3KLR A;  3T13 A;  1CKM A;  3MFY A;  3DMU A;  4FP5 D;  4DV4 Q;  3GP7 A;  2MQH A;  4GKJ L;  1NMF A;  3BDL A;  4PMW A;  4L5S A;  1FGU A;  1SJE D;  2A68 C;  3KJP A;  4A3B H;  2D5D A;  4JPB W;  2G9H D;  2JP1 A;  3W3A A;  1L1O A;  1D7Q A;  1NJI C;  1UE5 A;  2KUM A;  3AYH B;  4JC0 A;  3T53 B;  3HOU H;  3L3O C;  1H9J A;  1DJR D;  2I0Q A;  3H09 A;  2EVB A;  4ZRZ A;  1Q82 C;  3DWP A;  2N3S A;  3IRB A;  1YJW A;  5FO8 B;  3EFX D;  3M9B A;  5LMU L;  5I2X A;  2JA8 G;  1Q90 A;  5FLX E;  2K5N A;  2L55 A;  4A3M B;  1LO5 D;  1LTA D;  1O80 A;  4PZ6 A;  3D6C A;  1WTV A;  5FKA C;  5G3L D;  1MIU A;  4A3K H;  3LWE A;  3I4N G;  1UUP A;  3IFT A;  3VR6 A;  3JC6 6;  1OXV A;  3S1Q B;  2R93 B;  1ET6 A;  3S17 H;  5LMN W;  5JPM C;  5IYB H;  2UXB Q;  1BBW A;  3MTS A;  2HD3 A;  1I6H B;  1KRS A;  1D5M C;  4H02 A;  1RKN A;  4RGO S;  2DN8 A;  1XMO L;  2XVS A;  5IGE A;  1Q1B A;  3M3Y H;  3SK4 A;  2JA6 H;  4NKL A;  3FVQ A;  4GOP C;  2J4X A;  1AFP A;  4A3D G;  3ULL A;  2XIW A;  1TWA H;  4LF5 L;  1TWC H;  2KEE A;  1U0L A;  1PLF A;  1UEB A;  1SYD A;  1FGB D;  4C3H G;  1C7Y A;  4FF1 A;  5IT9 L;  3J81 E;  4RCO A;  2TSS A;  1LT6 D;  1LTL A;  4HN7 A;  4OIJ A;  1A62 A;  5HGT A;  1KD1 C;  2D9U A;  1I6V C;  4HIO A;  3T1H L;  1XMQ L;  1PH9 A;  4HIK A;  5F2D A;  3D3R A;  3C46 A;  1KDC A;  5FLX L;  2QA4 A;  4BBR G;  2KHS A;  1GUG A;  4CDE C;  1BNZ A;  4BY7 H;  1TWH H;  2RVL A;  4QIW B;  3P1H A;  2ZT9 C;  1C0A A;  1VQA A;  4JBK A;  1QIL A;  2WV6 D;  2D0P A;  2F3W A;  1PH2 A;  4CKB A;  5KYL A;  3EQL C;  3NTK A;  3I4M G;  5FJ8 H;  1SE2 A;  2UUB L;  1QUQ A;  1ENA A;  2NN6 G;  4IUT A;  3RLN A;  4JI2 L;  5C3E H;  3ULP A;  2OF1 A;  3H3V C;  1VF5 C;  1O7I A;  1S72 A;  3W1B A;  5EBD A;  1MJC A;  4CDD C;  2Q2H A;  2I5M X;  2KVM A;  1PXU A;  5LL6 X;  4OGQ C;  2DGY A;  1GHJ A;  2AKW B;  1VQ4 A;  2CQA A;  3J81 L;  1YNN D;  1A0I A;  1U4L A;  1STY A;  2BH2 A;  4R4C A;  2XRS D;  4J8Q A;  2ATW A;  2B3G A;  4LMQ D;  3BS1 A;  4K8J A;  2X6G A;  3C2P A;  2JA7 B;  2H5X A;  2K33 A;  3CCR A;  1HZB A;  3CC2 A;  2CVR A;  4KV6 A;  3HOY G;  3GTP H;  3EVQ A;  4C2M B;  4U67 3;  2K5V A;  2WII B;  3D4W A;  2L9H A;  4I65 A;  1WTX A;  1NCV A;  2ZXR A;  4KY5 A;  4NDX A;  5GRO A;  3TQY A;  3CD6 A;  1V9P A;  4IPC A;  5DAU A;  1DON A;  2F0Q A;  3EA6 A;  3QIA A;  2IX0 A;  3ICE A;  4DV1 Q;  1VQM A;  1WFQ A;  3TME A;  4ULL A;  1EIF A;  4DFA A;  5NUC A;  2RA4 A;  4A3E G;  3BZD B;  1VQK A;  4LWC A;  1EIG A;  1JMC A;  4M8A A;  3DXJ C;  4A76 A;  1Q86 C;  2PZU A;  5IP7 G;  5M5W H;  1SNC A;  4R4T A;  2JEB I;  2F0I A;  4K5V A;  2PPB C;  2VUM G;  3RZO H;  4GNX A;  4IOC A;  2NWG A;  1G6Z A;  5D14 A;  1KXL A;  2GVB A;  2PI2 A;  3I4O A;  3I90 A;  1FNU A;  3PO2 G;  3HKZ E;  1KAA A;  4A3C G;  2PQA A;  1F2Z A;  1NR4 A;  3J81 j;  4J15 A;  3GTJ H;  3G71 A;  3CF5 A;  4C3J H;  4ILW A;  5C0X I;  4IN3 A;  2A6H D;  1HR0 W;  2EYH A;  2RF4 A;  3KBG A;  1HPC A;  3J80 i;  2OTL A;  1S5E D;  1SYE A;  3JAM i;  4K0K L;  2R92 B;  2SOB A;  3PO3 B;  2WAC A;  2F4I A;  4KKS A;  2QEX A;  3KLS A;  2F0O A;  3CMA A;  2CHB D;  4GN3 B;  3H0G B;  2AHO B;  3H3V H;  4WJ4 A;  3S2H H;  1TKW B;  1CKO A;  2EYM A;  1LTB D;  2CH4 W;  3NP8 A;  1KC8 C;  3SK6 A;  3WOE A;  4JYA L;  3IKJ A;  1PZK D;  3GTG H;  3FPU B;  5ELO A;  1E0B A;  2B8F A;  5C0X H;  1EL0 A;  1GUT A;  5CV9 A;  3QOJ A;  2PZW A;  3TN2 A;  1BO0 A;  1PTO D;  3GV3 A;  3K57 A;  2DY8 A;  2FMM A;  1A8V A;  4UY8 C;  5CV5 A;  4DV6 Q;  1YVC A;  5IGB A;  1ZEQ X;  1N32 Q;  5M3M B;  4DK1 A;  5GAE C;  2NVX B;  1F9S A;  4C1N K;  1Z6H A;  2VQE Q;  2YU9 B;  2F03 A;  3FP9 A;  2L12 A;  5IOD A;  4A3G B;  1PH1 A;  5J1Z A;  1H9S A;  4LFA L;  1CA5 A;  3M4P A;  1G2T A;  3CP0 A;  2EPB A;  4P75 A;  4KI0 A;  3K0X A;  5K36 H;  5DLQ E;  3CCJ A;  4DV3 Q;  1R9T B;  3GTQ B;  1EY7 A;  4DAV A;  1LT5 D;  1C9O A;  2AWN A;  4GLA C;  4NXN L;  5C4X H;  4B9X A;  4DAP A;  1DOM A;  2J0T D;  5EPJ A;  4IFD I;  4XXE A;  4DR7 Q;  3K7A B;  1CFM A;  4A3M H;  5CYU A;  5IP9 G;  1UE7 A;  1TQO A;  4HAE A;  2EXD A;  1EEI D;  1MI2 A;  2R3Z A;  4LUZ A;  3BVM A;  2R7Z G;  3NEL A;  2R93 H;  4PMB A;  3U9O A;  5C44 G;  4BXX G;  1VCI A;  3HOV G;  4OEL B;  2EYO A;  3BZK A;  1LTI D;  1ENC A;  3TZD A;  1Q46 A;  2B2U A;  3S2D B;  3VA5 A;  1CI3 M;  2Z4I A;  1EQT A;  1M1K C;  4CKC A;  4A93 H;  3G4S A;  3R3O A;  1OO9 B;  2IT1 A;  2O2L D;  2UU9 Q;  1NUC A;  2JA5 H;  4LFA Q;  3W5O A;  3CME A;  3GQB A;  2EDG A;  1U4P A;  3JAM E;  3K5M A;  1KAB A;  1SYC A;  2A6H C;  3ND9 A;  2AQ2 B;  1X3Q A;  2EZV A;  3TP6 A;  4HJA A;  4NP5 A;  4FF4 A;  5A2Q E;  4OWW B;  4JI8 L;  3NTI A;  3VYS A;  2A1A A;  3I56 A;  3TRZ A;  3N6R A;  1HNZ Q;  1VMC A;  2BE5 D;  4DV7 Q;  3HOU B;  1JWM D;  4QQB X;  2OTJ A;  1MD2 D;  3NEN A;  3GD7 A;  1MKH A;  2EE1 A;  2K03 A;  1PTO C;  2OQK A;  5FLM H;  1S3O A;  3RN2 A;  1TWG B;  1RL2 A;  1V1P A;  4KHP L;  5CV8 A;  2MUY A;  1H95 A;  4ZAI A;  2QGQ A;  3CPF A;  3STB D;  1GKH A;  2UXC L;  4TRD A;  3S1R B;  4CHT B;  2AQ1 B;  1D2B A;  4R8N A;  1SE8 A;  5JEA J;  3S17 B;  3A56 A;  3OIQ A;  1TS4 A;  2FMC A;  2FFK B;  2D0O A;  3HOX G;  3K5O A;  2JK8 A;  4JW0 A;  2YYZ A;  1SBB B;  1WI5 A;  4RHR A;  4TKO B;  1XYI A;  2WB1 B;  4QL5 A;  1ZXT A;  4RHS A;  3J80 L;  3JAM L;  1VQ7 A;  3AQQ A;  1XNR Q;  2Q8R E;  1TWA B;  3J7Y W;  4LF8 L;  2AUK A;  5GAD C;  2JA7 H;  1LV9 A;  5IWA Q;  2K01 A;  2HUG A;  1IBL L;  1MSH A;  1HRJ A;  5A2Q L;  4ME3 A;  1HTP A;  1YZ6 A;  1J6Q A;  4C2M H;  5JJK A;  1V1P B;  4OX9 Q;  1VQB A;  1GUN A;  2Z1C A;  1MGS A;  2VL6 A;  4ZCK A;  5E7N A;  5I2Y A;  4KKT A;  2EYP A;  1QZG A;  2EY1 A;  1XPR A;  4A3L G;  4LFB L;  1Y1W G;  3VR5 A;  4OWT B;  2GA4 B;  3A74 A;  4A3I B;  1Q3L A;  1BCP F;  1VF7 A;  5IT9 c;  4F7X A;  3HFZ B;  4B3R L;  3MC0 B;  1NMG A;  3RN5 A;  3IAY A;  4H13 C;  3W1G A;  1TWH B;  1EU4 A;  3F2B A;  1QCB D;  4XYQ A;  1PFN A;  5IYD H;  4L63 B;  2VXW A;  2PMZ B;  1SR3 A;  2WAQ E;  2M9V A;  5JJL A;  2JQO A;  4BBS H;  1W2B A;  4XDX A;  1JT8 A;  4EX5 A;  3ITP A;  3OOC A;  1PMR A;  1HJP A;  2Z9H A;  3S1M H;  1GM5 A;  4JOI A;  4RGM A;  1DXM A;  4YWL A;  5GAG C;  1CKN A;  4DPG A;  2RBM A;  1SDF A;  3I73 A;  5IE8 A;  1K9M C;  3HOW G;  3E6Z X;  1OTC A;  2MO1 A;  2F3I A;  4JI4 L;  2RKS A;  4C1N I;  2R92 H;  5DNF A;  1SYG A;  3PO3 H;  2A68 D;  3NBI A;  2VZA A;  1CT1 D;  1VQO A;  1RTO A;  3SEB A;  4Y52 H;  2F0M A;  3H0G H;  4FDB A;  3S9W A;  3GV6 A;  2YTY A;  4CBV A;  2JYO A;  1C8C A;  1HR0 L;  4X62 Q;  4F87 A;  4PQX A;  3J81 c;  1IBK Q;  4JV5 L;  3R8B A;  4UP9 A;  1NY4 A;  4IUP A;  2IJ0 A;  2N49 A;  2F0E A;  2ICI A;  5M3M H;  5C4J H;  1IBM L;  3K80 C;  1HQM C;  3S14 B;  5IGF A;  3R2T A;  3G6J B;  1L0X B;  2EYL A;  3STB C;  3HOZ G;  3I72 A;  1G91 A;  4A3G H;  4DUZ L;  1M90 C;  2VB2 X;  2N8N A;  4LF7 Q;  2NYZ D;  4JG2 A;  3UDF A;  4IUR A;  5HY6 A;  3A0J A;  1BOS A;  4DNI A;  3OHX C;  3BU2 A;  1ICF B;  3WOF A;  1CHP D;  4OL7 A;  4FNF A;  4DGZ A;  2KOL A;  5JVG 3;  4AYB G;  1A3T A;  4JBW A;  2F0G A;  4DV2 Q;  2L15 A;  1B4O A;  4DXG A;  4XTC S;  4GN5 A;  3I55 A;  3A54 A;  1V1O A;  3K6O A;  3RR5 A;  2VS1 A;  1AE3 A;  4DA2 A;  2B63 G;  5EPK A;  3PV0 A;  1JOR A;  4KMU C;  3M4O B;  3LX0 A;  4LW1 A;  2E76 C;  3PF5 A;  1ESF A;  3FKI G;  5JEA G;  3PUY A;  4G7O C;  1U9R A;  5ELB A;  4DAY A;  2YTX A;  1KTK A;  5EJW A;  1WTH A;  1D8L A;  4XIG S;  5TSS A;  2A8V A;  4LFC Q;  2N55 A;  5KND A;  1EIY B;  2B2T C;  3NUC A;  3MXN B;  4NW2 A;  4DR5 Q;  4EGV A;  3HG9 A;  1VQG A;  4FXD A;  3K5L A;  2XWB B;  3OSO A;  5M3F G;  3KF8 A;  4NXM Q;  4V19 0;  3I91 A;  2NBF A;  1PRT B;  2JXM B;  4AQY Q;  3PIO 3;  4DUZ Q;  4JI0 L;  3T56 B;  1I4H A;  3I8Z A;  1ROD A;  3SK8 A;  3SGI A;  2YV5 A;  1J5E L;  1X65 A;  3HZX A;  3NXW A;  1QNU A;  1AZQ A;  1A3V A;  2EYJ A;  4FO2 A;  1HXY D;  1HCZ A;  4JI5 L;  5KNB A;  3K5N A;  1M4V A;  3MEH A;  4GKK Q;  4EQO A;  2EY6 A;  1B3Q A;  2FXQ A;  1JE4 A;  1V1Q A;  1HNX Q;  1IW7 C;  1E2W A;  5BN3 A;  5IT9 E;  4BY1 B;  1HNW Q;  3CC7 A;  1T5E A;  4KLK A;  4L5R C;  4ZK9 B;  2UUA L;  4BS9 A;  5HUR A;  4B3T L;  5C4X B;  4X66 Q;  4DNT B;  3E0E A;  2IPK D;  1PH7 A;  1JB7 A;  3QWN A;  5KIX A;  1F2Y A;  2BDO A;  2HHH L;  3Q23 A;  4DV5 Q;  1SAP A;  1TWG H;  2F0V A;  1VQF A;  4R9W A;  2B2W A;  1M8A A;  1WCM B;  4IUN A;  2KCC A;  1K0R A;  3ERQ A;  4C56 C;  4C3I G;  3PGZ A;  1S5D D;  4EVO A;  5BR8 Q;  5KYI A;  3S1R H;  1L2F A;  2HDL A;  1H9R A;  4I7Z C;  1E2Z A;  4DR6 L;  3KYH C;  4MNO A;  2NTT A;  4A4I A;  4XT1 B;  1FJG Q;  2B2V A;  2XN9 C;  1L1O B;  2BA1 A;  4KHV A;  1RHP A;  1TXY A;  4MZ9 A;  5I9P A;  1PFM A;  1OXT A;  3BZC A;  3KUP A;  4B3M Q;  3BVZ A;  4A93 B;  3MHB A;  4O1N A;  2VB3 X;  4QCL A;  4RFB A;  2H1E A;  2JA5 B;  4K6L A;  1P16 A;  1HUN A;  4HCS A;  2QIL A;  1Y1V G;  4GKJ Q;  4ODG A;  3SVM A;  4JK1 C;  1TS3 A;  1E2V A;  2YTV A;  4QIW E;  2XGT A;  1Y8O B;  4NPS A;  5KNC A;  4X65 L;  1YIT A;  1Q7Y C;  2B2Y A;  3BDC A;  1VS0 A;  3Q22 A;  1Y69 U;  3ZJY C;  1PV4 A;  1F9Q A;  1PH3 A;  1ILQ A;  2EXZ A;  2Q8T A;  2UUA Q;  2JEA I;  5GAH C;  4A3I H;  1NNX A;  3ERS X;  3VR2 A;  1JJG A;  2KHJ A;  5LMU Q;  1I4Q A;  1EWH A;  1EFI D;  3TRE A;  3E0J A;  2MFI A;  3V05 A;  1L0W A;  2ZJQ A;  2J7Z A;  2EYF A;  4GS3 A;  4DR2 L;  4K2L A;  4IJL A;  1B1Z A;  4YY3 L;  1EQQ A;  3BYT B;  1TS2 A;  4JVZ A;  3TP5 A;  1IXR A;  4XT3 B;  1Z47 A;  2F0W A;  1L0Y B;  4K2K A;  2RCF A;  2LS0 1;  2RSO A;  1QOH A;  1CUK A;  4WRD A;  1VQ8 A;  2M2L A;  3PMF A;  2C35 B;  2CW0 D;  1PVO A;  1STB A;  1PTO F;  1XMO Q;  2IX1 A;  5M5X H;  3OTO L;  3OIP A;  2E8G A;  2RHQ B;  5JAV A;  4YIJ A;  2K28 A;  2Z6K C;  1XNQ L;  3I4N B;  5JJZ A;  1EZ8 A;  4KY7 A;  2B8G A;  1DYQ A;  4LF5 Q;  1KNA A;  3DLL A;  4U68 A;  2UXD L;  2EJM A;  1WTQ A;  3KF6 A;  4HIM A;  1PRT C;  4OHJ A;  3HKZ G;  1AN8 A;  4OO1 I;  1EOT A;  4X65 Q;  1ET9 A;  1B70 B;  3T1H Q;  1XMQ Q;  4IOA A;  4ZYS A;  1QUQ B;  4A3D B;  3MWY W;  3KFU A;  2I5L X;  5LHY 1;  3CCS A;  1LTG D;  3GTM B;  4LAA A;  3J80 c;  3JAM c;  2IHE A;  3BVG A;  1EFW A;  4K8I A;  4WFN 3;  4DNR B;  1FNW A;  2F0K A;  2ZXO A;  3AMU A;  1PFB A;  1SNM A;  3KDF A;  3F1Z A;  3S14 H;  5CC4 A;  4M1U B;  3HEJ A;  2E75 C;  2GN5 A;  5C4H A;  3LGJ A;  5K5P A;  2PZT A;  4OO1 H;  1BR9 A;  4KD4 A;  1K8G A;  4DUY L;  2UUB Q;  4BBR B;  3E9I A;  1EYA A;  2TMP A;  4Q0F A;  3DM3 A;  4JI2 Q;  4KHZ A;  1ASZ A;  4IZ8 A;  3NSW A;  4EQ5 A;  4ZKB B;  4BBS B;  1SSO A;  3CCU A;  1II3 A;  5EKK A;  3OTO Q;  2V1C C;  5DEH A;  4Z9C B;  4KK7 A;  1XNQ Q;  1KLU D;  3S1M B;  3I4M B;  3TP8 A;  5IYC H;  2VQF L;  1XJV A;  4IAL A;  1SFO B;  1JOO A;  4ABN A;  1HTL D;  1D1I A;  1KAW A;  1CHQ D;  1EYG A;  4P73 A;  2QW7 A;  4OXP A;  3RD4 A;  1L1O C;  1DD2 A;  4O2D A;  5JJI A;  2K32 A;  2DJG C;  3CU7 A;  1A2U A;  4MHE A;  3M4O H;  4AH6 A;  4IUQ A;  2O5I C;  1TVX A;  1STA A;  2HQL A;  3A8J E;  2K1B A;  3AFP A;  1K8O A;  2ZM6 L;  2I5H A;  5C6A A;  1YBY A;  1JJ2 A;  4PV1 C;  3UE0 A;  1ICW A;  5AJ3 L;  4GNX B;  2F0D A;  4F8M A;  1EY8 A;  4A3F G;  1IYJ B;  2Z6B A;  4CKE A;  1EEF D;  1NSN S;  3U58 A;  3L0O A;  1AP0 A;  1VQC A;  1SRU A;  2PW7 A;  2PQA B;  3K81 C;  4X3U A;  1VQL A;  4H7B A;  3A5Z B;  3A5U A;  1N36 L;  4YCW A;  2IHF A;  5C5M A;  3HOY B;  1QNK A;  3PUV A;  2PO4 A;  2R6G A;  3VR4 A;  5C4J B;  3Q0A A;  4DUY Q;  3X3N A;  3KLS X;  1CZG A;  2CW0 C;  3MFG A;  1FVI A;  1UEA B;  3CAM A;  2BOS A;  2F0J A;  1YJN A;  2CWP A;  2MP1 A;  5EPL A;  2NUC A;  2NZH A;  2K4K A;  4ZQ3 A;  3O13 A;  2AQ3 B;  5EBC A;  4ZUJ A;  4WOR A;  2CWA A;  3UDX A;  2JJQ A;  4PMC A;  1BUV T;  4A3E B;  2DNC A;  4BY1 H;  3ULJ A;  5C4Z A;  4ZLT F;  1U4R A;  1A2T A;  1DGS A;  5KGU A;  1X3F A;  2EY2 A;  2VUM B;  3VYT A;  4A3B G;  1QG7 A;  4LK1 C;  4K0K Q;  3K59 A;  4GLX A;  3BG3 A;  3U4V A;  4IO9 A;  3HOU G;  4JCV E;  1N34 L;  2LMC B;  3OWE B;  3PCO B;  2F0F A;  3NK9 A;  1T5X D;  1WCM H;  1I4R A;  2RQX A;  1IZ6 A;  1RJT A;  2HT1 A;  2ES2 A;  1H9S B;  2F0L A;  1K8M A;  2OEO A;  4O42 A;  3MZ5 A;  4OWX B;  4A3J H;  4JYA Q;  1J8I A;  1IL2 A;  2WFW A;  1D6E C;  4A3K G;  2F4V L;  2RSN A;  1N36 Q;  3RZD B;  4IFD H;  3OW7 A;  1QWY A;  1JIC A;  5A35 A;  5IYB G;  2K5D A;  3QG1 A;  3TDQ A;  5LMN L;  2JA6 G;  1B44 D;  1HA6 A;  2EJF C;  2NTS A;  1WVL A;  3FMC A;  4H0L C;  3IFD A;  1EIH A;  3J80 E;  3D8G A;  4DR4 L;  1BBU A;  2X69 A;  3GTL B;  4KN4 C;  3F8T A;  1VQH A;  2PNR C;  4LF9 L;  2ID0 A;  1S5F D;  2KHI A;  2ZTD A;  4NXN Q;  4QUF A;  3R2I A;  4MTK A;  3K58 A;  1EQV A;  3NQT A;  1YI2 A;  3NEM A;  1EZ6 A;  1R4Q B;  1EWC A;  2RDG A;  1KDB A;  3FPP A;  3MA2 B;  2VNU D;  4N9P A;  1AW7 A;  3N52 A;  1N33 L;  1JOK A;  4K5W A;  2L0C A;  3CQZ B;  1G29 1;  4BY7 G;  4EQN A;  2IX3 A;  5KEE A;  1PZI D;  3CCQ A;  4QB4 A;  2O4X A;  4A75 A;  2K75 A;  1FD7 D;  4UHV A;  2EOT A;  2WB1 E;  1B9N A;  4POG A;  4JI3 L;  2JA8 H;  4LF6 L;  5FJ8 G;  1N9W A;  3GO5 A;  1K0S A;  2JE6 I;  2XSC A;  4GNX C;  1LM0 A;  5ELE A;  1U4M A;  4KJN A;  3I4N H;  2R7Z B;  5C3E G;  3UDG A;  3CCM A;  3UDI A;  2I07 B;  2KCM A;  2QF7 A;  2E2H B;  2WAQ G;  3CW2 C;  5LMN Q;  5GQO A;  1OXU A;  5IIF A;  3K7U C;  5C44 B;  4RKL A;  2V4D A;  4DV0 L;  3TBI B;  4FXG C;  2R61 A;  3U4Z A;  3QOL A;  4IQZ A;  1SE3 A;  4RGN A;  5E3F A;  4A3D H;  3W2D A;  3I70 A;  2A74 C;  2E2I H;  2MHV A;  4LF9 Q;  3GTM H;  1VQJ A;  4UP8 A;  1STN A;  4R4Q A;  1ONL A;  4C3H H;  1SMY C;  4JI8 Q;  2Z0S A;  2RDF A;  3E9H A;  1DM0 B;  2PMZ E;  3CCL A;  1N33 Q;  1CSP A;  1BXT A;  3I3C A;  4XYO A;  2NVT B;  1MHW C;  4ME5 A;  4HID A;  1O7Y A;  3PUZ A;  2HIX A;  4X64 L;  4RAU C;  2NN6 I;  1KHI A;  2EJG C;  1GVP A;  4BBR H;  2FHT A;  1WTR A;  5AFW A;  3J7Z C;  1EY9 A;  4KHP Q;  1XXG A;  3H15 A;  1RF2 D;  1S4Z A;  3D0F A;  4JI3 Q;  2UUC L;  1E7Z A;  3RLF A;  2FJ2 A;  2DJF C;  3P20 A;  2UXC Q;  2G9D A;  4JI1 L;  1FYC A;  2O5J C;  4QJF A;  4PG3 A;  1NTG A;  3I4M H;  2IWH A;  3OYY A;  4JI6 L;  1SFO H;  3P75 A;  1CA6 A;  1KL9 A;  4YWM A;  4OON A;  5M5X B;  3DEO A;  5CBA E;  1G2S A;  2NN6 H;  5IY0 A;  1LUZ A;  3NBH A;  3I2Z A;  2B29 A;  1SNQ A;  1VDZ A;  3RNU A;  3HGB A;  3HP3 A;  4R1J A;  4LF8 Q;  3EN2 A;  4C3J G;  4GN4 B;  1STG A;  1IW7 D;  1SLJ A;  1PH4 A;  2Y0S B;  1JOQ A;  1K3B C;  1IBL Q;  2XTI A;  3M85 A;  2GVA A;  3RLO A;  3KBX A;  3A55 A;  4QF4 A;  3ER0 A;  3HOX B;  1KRT A;  3S16 B;  4GOP A;  4RWS C;  4KY6 A;  3PUX A;  2A69 D;  3E3X A;  2K5H A;  5C3W A;  1STH A;  2RCN A;  1XTC D;  4LFB Q;  1MSG A;  3ERO A;  1PH5 A;  1LAC A;  4HMI A;  3AB9 A;  1S5C D;  1STE A;  4B3R Q;  3HOY H;  3PF4 A;  1G6P A;  1CKN B;  5C0X G;  4YHH L;  1N8R C;  3BYY B;  2QKI C;  2ZJR A;  3RUZ A;  4JI7 L;  1YNX A;  1NE3 A;  2B2U C;  1HZ9 A;  2F0U A;  2BCO A;  1QVF A;  4LF4 L;  1E22 A;  3H94 A;  1Y1W B;  5JOB A;  3OMC A;  1KNE A;  4F88 A;  4IPG A;  1LT3 D;  2OXP A;  1ASY A;  4A3E H;  4JI1 Q;  1TY0 A;  2KEN A;  3V2T A;  5IP7 H;  2WKC A;  3L9A X;  4RKB A;  2OCE A;  4CGY B;  1I94 L;  4J1M A;  3VR3 A;  2VUM H;  5K36 G;  3KJO A;  3DEP A;  4JI4 Q;  1X55 A;  1PH8 A;  1PYB A;  3PO2 H;  1BCP B;  4HSV A;  1EY0 A;  5C4X G;  4A3C H;  1EQR A;  2HDM A;  1GOZ A;  2NVY B;  4DV4 L;  1SRO A;  4BA1 I;  4DU9 A;  1PHJ A;  1TR5 A;  1EOV A;  1HR0 Q;  4A3M G;  3AEV A;  1W3S A;  1W6K A;  3HOW B;  4JV5 Q;  5BN5 A;  1QJO A;  1RDP D;  1FR3 A;  1X6O A;  4NB3 A;  3OW2 A;  1HZC A;  1CZW A;  4N8X 1;  3RZD H;  1WYD A;  2K7V A;  2R93 G;  1PH6 A;  4HTH A;  1E3P A;  1Q12 A;  1K3R A;  1IBM Q;  1TU2 B;  3OMG A;  2SNM A;  3QB3 A;  3HRZ C;  4LF4 Q;  3Q6S A;  2KED A;  4K14 A;  1K8A C;  1WD0 A;  4A93 G;  1LYL A;  4TSS A;  1UE1 A;  3D4R A;  1GD7 A;  5EKI A;  2JA5 G;  3C3L A;  3GTL H;  1KQS A;  2UXB L;  3H91 A;  1IYV A;  1PZJ D;  4KD3 A;  1PYS B;  4B9W A;  4LJZ C;  4KKU A;  4HCE A;  4N8F A;  3HOZ B;  4DAY B;  3KLW A;  3NQI A;  1A15 A;  1PRT D;  3EIV A;  1WD1 A;  1QVC A;  4WJ3 M;  4IPH A;  1ZYR C;  1Z7T A;  4QMG A;  1QE6 A;  1PA6 A;  4KJO A;  3SE0 A;  4B3S L;  3K8A A;  4HED A;  2A69 C;  1R4P B;  3TEH B;  3CQZ H;  3DWA A;  2CFM A;  1AEX A;  2PW5 A;  3H6M A;  4NMZ A;  4UP7 A;  3UE1 A;  4AYB B;  1UWV A;  2D62 A;  3KF8 B;  2KEC A;  1QB5 D;  3M7G A;  4AIM A;  4DK0 A;  1VQP A;  1HFN A;  1B3A A;  4MTN A;  1V8Q A;  2Z8L A;  2Q2T A;  4A3J B;  5IP9 H;  5FLM G;  1JB3 A;  1JWS D;  4Y7N B;  3F2D A;  3V96 A;  4ALP A;  2B63 B;  4FVM A;  3AU7 A;  1ZKO A;  1G8Z D;  2R7Z H;  1WJJ A;  2NB0 A;  2E2H H;  1LLR D;  1CQF A;  4JOI C;  1F2M A;  3FKI B;  4PNY A;  2ICE C;  1EY5 A;  5C44 H;  4JI0 Q;  2F0N A;  4BXX H;  3HOV H;  1NAP A;  4IUU A;  5J22 A;  5JVH 3;  3E5S A;  4J6H A;  4KTA A;  1J5E Q;  4DN4 M;  5E4X A;  3EJI A;  2LY7 A;  5CV4 A;  5DM7 3;  4JI5 Q;  1CK1 A;  4DXF A;  2LXJ A;  2KQ3 A;  2JA7 G;  5M3F B;  3MVV A;  1LAB A;  5FOB B;  5FO9 B;  3DUZ A;  1X3E A;  4MN3 A;  1B8A A;  4B3S Q;  4B3T Q;  1JJC B;  5BN4 A;  3C1E A;  1YHA A;  3T16 A;  2NVT H;  1FL0 A;  2HHH Q;  2DNE A;  2C5C A;  3CHB D;  1TWF B;  1SXT A;  5ELD A;  3TS0 A;  1HZA A;  1BCP C;  3J7A 5;  1B2T A;  1VQI A;  1X54 A;  5COR A;  2F3V A;  1A63 A;  2R7F A;  1EY6 A;  5ELN A;  1I3Q B;  2I46 A;  3VYU A;  1C48 A;  3NWS A;  5IYD G;  4UAI A;  5E1F A;  4DR6 Q;  1BVS A;  1F9P A;  2JA8 B;  2SDF A;  1WTP A;  4RMF A;  1B9M A;  4DV1 L;  3IL8 A;  4BBS G;  1OXS C;  2AUJ D;  1EYD A;  3CC4 A;  3MEF A;  2BDN A;  4I7A A;  1I50 H;  2F0P A;  5J39 A;  2E2J H;  4C3I B;  4FYD A;  1GJX A;  3OWF A;  3SDZ A;  1SYB A;  1P8L A;  4DKA C;  3PIO A;  5I4D A;  3QO2 A;  1XPU A;  3HOX H;  1YEZ A;  3S16 H;  5M9O A;  2ENB A;  2KA7 A;  2R92 G;  3FEW X;  3PO3 G;  1V43 A;  1W6J A;  1HQR D;  3MXP A;  5T1I A;  3WWV A;  1CQV A;  2E2I B;  2N88 A;  2Z4H A;  1SN8 A;  3H0G G;  2XRQ D;  3I4L A;  5D3D A;  2Q2I A;  4C3H B;  5CGK A;  4BA2 I;  1YJ9 A;  1K28 A;  1Y1V B;  1K83 H;  3T1Y L;  1HHV A;  1KDA A;  1Y8P B;  1VQ9 A;  1B53 A;  4X6A H;  1GUO A;  4DR2 Q;  4HJ5 A;  5D65 A;  5M3M G;  4A3L H;  5L37 A;  3DWQ A;  3B6Y A;  4YY3 Q;  2MPM A;  3NTH A;  1Y1W H;  2VY3 A;  1I4X A;  1IKL A;  5DM6 3;  2NZ1 D;  3L2P A;  3KF6 B;  3G7L A;  3CPW A;  1PDQ A;  1X56 A;  1X3G A;  2F0T A;  2WKD A;  1X32 A;  2DUD A;  4B08 A;  4A3G G;  2MJ8 A;  1JE5 A;  4LNQ A;  2G5D A;  2F1M A;  1XWE A;  1ML0 D;  4DV6 L;  3KK7 A;  1D5X C;  1N32 L;  2ZJP A;  3HS0 C;  2ALY B;  2IY5 B;  4IJH A;  4ZUI A;  4G7H C;  2VQE L;  4HJ8 A;  1BQQ T;  4O0A A;  1BKB A;  2UXD Q;  3KDF B;  1E24 A;  3A8I E;  2NVY H;  1E1O A;  5KRU A;  1WTW A;  2EQS A;  1OXX K;  2PI2 E;  4P72 A;  4LUV A;  3ZYY X;  3H3V I;  4POF A;  1T9H A;  4HSP A;  1YHB A;  3HOW H;  4DV3 L;  3NWT A;  1CTM A;  1RCV D;  4XQJ A;  1PYW D;  1O78 A;  2B2W C;  2QEJ C;  2EIF A;  4L8J A;  1MBY A;  1TT2 A;  3T1Y Q;  2L11 A;  3HKZ B;  1PTO B;  5COY A;  4DR7 L;  3S1N B;  5M5Y B;  3I7F A;  2L4N A;  3NHH A;  1EYC A;  1NBW A;  2B2V C;  3OPO A;  4YCV A;  1VQ6 A;  1I5F A;  2FIN B;  3PSI A;  1AE2 A;  3ND8 A;  2MO0 A;  1JQY D;  3GTO B;  1SEB D;  2F0S A;  1EY4 A;  2BH8 A;  3SR1 A;  3S15 B;  3KOJ A;  1AH9 A;  1D5Z C;  3LNN A;  1DZ1 A;  4DAM A;  4JBJ A;  2P5Z X;  1C4Q A;  3R93 A;  2LKV A;  2IW3 A;  3G48 A;  4CJ2 C;  3HOZ H;  3T51 B;  2LXK A;  4K6D A;  3C1F A;  2VQF Q;  2B39 A;  2XWJ B;  3QR8 A;  2B2Y C;  4KN7 C;  1LTR D;  2UU9 L;  1RTN A;  2A73 B;  1NR2 A;  2E74 C;  2HIV A;  1SNO A;  1HH2 P;  2DY7 A;  4R4O A;  3UI2 A;  3CRK C;  3PO2 B;  1LTS D;  5EGT A;  1YNN C;  2OWO A;  1SMY D;  3T4A C;  2LSS A;  1Y8N B;  2ZM6 Q;  1QZH A;  5ELC A;  3MXG A;  1BDO A;  3BJU A;  1UNS A;  5AJ3 Q;  1RD9 D;  1O7Z A;  4Y7N H;  2B63 H;  4DR1 L;  1BF4 A;  1HNZ L;  1TY2 A;  1JCK B;  4DV7 L;  1FNV A;  4XQQ A;  1X3P A;  1H9M A; 
#chains in the Genus database with same CATH homology
 4G4K A;  5JEA H;  5JPN C;  2K6A A;  3LWU A;  4A3F B;  2NVQ B;  5C0X J;  1ENF A;  4RH6 A;  3A8K E;  4K5X A;  3PIP 3;  2Q8I B;  2K5Q A;  2PYK A;  3TZU A;  4DF7 A;  3F2U A;  3U9S A;  1SND A;  1I4P A;  3VYR A;  3MXU A;  3J7A F;  3GTK B;  1AZP A;  4G57 A;  3D31 A;  2C9O A;  3VA7 A;  5IGG A;  5D3I B;  4S3S A;  1LTT D;  2HQE A;  5CV6 A;  1Q1E A;  2K04 A;  2K05 A;  4L6T B;  1ILP A;  4RCN A;  4A3B B;  2H4O A;  3M7N A;  2HCI A;  1UAP A;  4E6I A;  1WTO A;  5I9O A;  1IHZ A;  4ZKC B;  1EU3 A;  3Q24 A;  4EQP A;  1J9O A;  2LFN A;  4QUC A;  5ISR A;  3CKI B;  3J7A V;  5I6W A;  1GXD C;  1HUM A;  5FK9 C;  4GZY C;  2SEB D;  3HOV B;  4A3K B;  2B2T A;  1YNJ D;  5CV7 A;  1LT4 D;  4IFD J;  2KCN A;  2EY5 A;  4H44 C;  1GUW A;  5CMD A;  5T1G A;  3X3M A;  3QJY A;  1D1K A;  3DHQ A;  2PCF B;  3M3Y B;  5IOC A;  2JA6 B;  3A7A B;  2RDH A;  3NE5 B;  2WIN B;  4RA8 A;  4FXK C;  3SXH A;  2WP8 J;  4OIK A;  4X3S A;  4V0B A;  1TWC B;  1A6X A;  2KJX A;  5IGD A;  2X6L A;  4XQN A;  2A5H A;  4N9T A;  4Q5V A;  4CJ0 B;  4X3K A;  5C3X A;  3M4Y A;  5FO7 B;  3WDN A;  3D4D A;  3CRL C;  1Q8I A;  4OO1 G;  4CJ1 B;  2QDB A;  1TS5 A;  5ELF A;  2E2D C;  4BY7 B;  3SHL A;  2SNS A;  5EKL A;  1ESR A;  1GUS A;  2A6E D;  1I50 B;  2E2J B;  2L1B A;  1S5B D;  4WJW A;  3SK5 A;  4FF2 A;  2JSO A;  1DOL A;  1ZYR D;  5C3E B;  5I6Y A;  2WAQ B;  1HFG A;  5IGC A;  3URY A;  2IL8 A;  2K5W A;  3BDO A;  1PRT F;  3DM1 A;  1PTO H;  2F0H A;  2M00 A;  1K83 B;  2AWO A;  2ZXP A;  2BE5 C;  1SE4 A;  1H9K A;  3TP7 A;  1GHK A;  1IYU A;  4R8I A;  5C5L A;  3GTP B;  3D6W A;  3FDT A;  1JWU D;  4MIU A;  2OT2 A;  5CBE E;  1JR0 D;  1I4G A;  1B50 A;  1F9R A;  2L5T A;  1DOK A;  1CM9 A;  1XX8 A;  1YNJ C;  3ONA B;  5LL6 S;  4HR7 B;  3FRP B;  5G3L F;  2QCP X;  3PUW A;  4BWG B;  5M5W B;  1DCZ A;  1SJH D;  3RZO B;  1BBX C;  4TQU S;  3L7Z C;  1SNP A;  1JC7 A;  5EQ0 A;  2MGS A;  5CR3 A;  3MXN A;  3RMH A;  3P7J A;  3GTJ B;  4C3J B;  1IL8 A;  2HCC A;  4X3T A;  4P2C B;  2PQE A;  4G7Z C;  1BCP D;  3TSS A;  1VMP A;  4ID6 A;  3A7L A;  5E4W C;  1F77 A;  4IFD G;  1TII D;  4HMJ A;  3MAQ A;  2BA0 A;  3S2H B;  3GTG B;  1IKM A;  2A6E C;  1F2L A;  1A3U A;  1KLG D;  1HA5 A;  4RGT A;  1SYF A;  4FF3 A;  4UDU C;  4IUV A;  1O7L A;  2XNA C;  3K0Y A;  2D2C C;  3NPP A;  3KLR A;  3T13 A;  3MFY A;  3DMU A;  4FP5 D;  3GP7 A;  3BDL A;  4PMW A;  1SJE D;  2A68 C;  2D5D A;  2G9H D;  2JP1 A;  3W3A A;  2KUM A;  3T53 B;  1H9J A;  1DJR D;  3L3O C;  3H09 A;  2EVB A;  4ZRZ A;  3DWP A;  5FO8 B;  3EFX D;  5I2X A;  1Q90 A;  5FLX E;  2L55 A;  4A3M B;  1LO5 D;  1LTA D;  1O80 A;  3D6C A;  1WTV A;  5FKA C;  5G3L D;  3LWE A;  1UUP A;  3IFT A;  3VR6 A;  1OXV A;  3S1Q B;  2R93 B;  1ET6 A;  5JPM C;  3MTS A;  1I6H B;  1D5M C;  1RKN A;  4RGO S;  2DN8 A;  2XVS A;  5IGE A;  1Q1B A;  3SK4 A;  4NKL A;  3FVQ A;  2J4X A;  1AFP A;  2XIW A;  2KEE A;  1PLF A;  1SYD A;  1FGB D;  4C3H G;  4FF1 A;  5IT9 L;  3J81 E;  4RCO A;  2TSS A;  1LT6 D;  4HN7 A;  4OIJ A;  5HGT A;  2D9U A;  1I6V C;  5F2D A;  3D3R A;  3C46 A;  1KDC A;  5FLX L;  2KHS A;  1GUG A;  1BNZ A;  2RVL A;  4QIW B;  3P1H A;  2ZT9 C;  1QIL A;  2WV6 D;  2F3W A;  4CKB A;  5KYL A;  3EQL C;  3NTK A;  1SE2 A;  1ENA A;  2NN6 G;  4IUT A;  2OF1 A;  3H3V C;  1VF5 C;  5EBD A;  2KVM A;  1PXU A;  5LL6 X;  4OGQ C;  1GHJ A;  2CQA A;  3J81 L;  1YNN D;  1U4L A;  1STY A;  2XRS D;  4J8Q A;  4LMQ D;  3BS1 A;  4K8J A;  2X6G A;  3C2P A;  2JA7 B;  2K33 A;  2CVR A;  4KV6 A;  3EVQ A;  4C2M B;  4U67 3;  2WII B;  3D4W A;  2L9H A;  4I65 A;  1WTX A;  1NCV A;  2ZXR A;  4KY5 A;  4NDX A;  5DAU A;  1DON A;  2F0Q A;  3EA6 A;  3QIA A;  2IX0 A;  3TME A;  4ULL A;  4DFA A;  5NUC A;  2RA4 A;  3BZD B;  1EIG A;  4M8A A;  3DXJ C;  2PZU A;  1SNC A;  2JEB I;  2F0I A;  4K5V A;  2PPB C;  2NWG A;  1G6Z A;  5D14 A;  3I90 A;  1FNU A;  1KAA A;  1F2Z A;  1NR4 A;  4ILW A;  5C0X I;  4IN3 A;  2A6H D;  2EYH A;  3KBG A;  1HPC A;  1S5E D;  1SYE A;  2R92 B;  2SOB A;  3PO3 B;  2WAC A;  2F4I A;  4KKS A;  3KLS A;  2F0O A;  2CHB D;  3H0G B;  1TKW B;  2EYM A;  1LTB D;  3NP8 A;  3SK6 A;  3WOE A;  3IKJ A;  1PZK D;  3FPU B;  1E0B A;  2B8F A;  5C0X H;  1EL0 A;  1GUT A;  5CV9 A;  3QOJ A;  2PZW A;  3TN2 A;  1BO0 A;  1PTO D;  3GV3 A;  3K57 A;  2DY8 A;  2FMM A;  5CV5 A;  5IGB A;  1ZEQ X;  5M3M B;  4DK1 A;  2NVX B;  1F9S A;  4C1N K;  1Z6H A;  2YU9 B;  2F03 A;  2L12 A;  5IOD A;  4A3G B;  5J1Z A;  1H9S A;  1CA5 A;  1G2T A;  2EPB A;  4KI0 A;  5K36 H;  1R9T B;  3GTQ B;  1EY7 A;  4DAV A;  1LT5 D;  2AWN A;  4B9X A;  4DAP A;  1DOM A;  2J0T D;  5EPJ A;  4IFD I;  4XXE A;  3K7A B;  1CFM A;  5CYU A;  1TQO A;  4HAE A;  1EEI D;  1MI2 A;  2R3Z A;  3BVM A;  4PMB A;  3U9O A;  1VCI A;  2EYO A;  1LTI D;  1ENC A;  3TZD A;  2B2U A;  3S2D B;  3VA5 A;  1CI3 M;  2Z4I A;  1EQT A;  4CKC A;  3R3O A;  1OO9 B;  2IT1 A;  2O2L D;  1NUC A;  3GQB A;  2EDG A;  1U4P A;  3JAM E;  3K5M A;  1KAB A;  1SYC A;  2A6H C;  3ND9 A;  2AQ2 B;  1X3Q A;  2EZV A;  3TP6 A;  4NP5 A;  4FF4 A;  5A2Q E;  3NTI A;  3VYS A;  3N6R A;  1VMC A;  2BE5 D;  3HOU B;  1JWM D;  1MD2 D;  3GD7 A;  2EE1 A;  2K03 A;  1PTO C;  1TWG B;  1V1P A;  5CV8 A;  2MUY A;  4ZAI A;  4TRD A;  3S1R B;  4CHT B;  2AQ1 B;  1D2B A;  4R8N A;  5JEA J;  3S17 B;  3A56 A;  3OIQ A;  1TS4 A;  2FMC A;  2FFK B;  3K5O A;  2YYZ A;  1SBB B;  4RHR A;  1XYI A;  4TKO B;  2WB1 B;  1ZXT A;  4RHS A;  3J80 L;  3JAM L;  2Q8R E;  1TWA B;  3J7Y W;  2AUK A;  1LV9 A;  2K01 A;  2HUG A;  1MSH A;  1HRJ A;  5A2Q L;  1HTP A;  1V1P B;  2Z1C A;  1GUN A;  1MGS A;  5I2Y A;  4KKT A;  2EYP A;  2EY1 A;  3VR5 A;  2GA4 B;  4A3I B;  1Q3L A;  1BCP F;  1VF7 A;  4F7X A;  3MC0 B;  3IAY A;  4H13 C;  1TWH B;  1EU4 A;  1QCB D;  4XYQ A;  1PFN A;  4L63 B;  2VXW A;  2PMZ B;  2M9V A;  4XDX A;  3ITP A;  3OOC A;  1PMR A;  4RGM A;  1DXM A;  2RBM A;  1SDF A;  3I73 A;  3E6Z X;  2RKS A;  4C1N I;  5DNF A;  1SYG A;  2A68 D;  3NBI A;  1CT1 D;  1RTO A;  3SEB A;  2F0M A;  3S9W A;  3GV6 A;  4CBV A;  2JYO A;  1C8C A;  4F87 A;  4PQX A;  3R8B A;  4IUP A;  2IJ0 A;  2F0E A;  2ICI A;  1HQM C;  3S14 B;  5IGF A;  3R2T A;  3G6J B;  1L0X B;  2EYL A;  3I72 A;  1G91 A;  2VB2 X;  2NYZ D;  4IUR A;  1BOS A;  3OHX C;  3WOF A;  1CHP D;  4OL7 A;  4FNF A;  4DGZ A;  2KOL A;  5JVG 3;  1A3T A;  4JBW A;  2F0G A;  1B4O A;  4DXG A;  4XTC S;  3A54 A;  1V1O A;  3K6O A;  4DA2 A;  5EPK A;  3PV0 A;  1JOR A;  4KMU C;  3M4O B;  3LX0 A;  2E76 C;  1ESF A;  4G7O C;  5JEA G;  3PUY A;  1U9R A;  5ELB A;  4DAY A;  1KTK A;  5EJW A;  4XIG S;  5TSS A;  2N55 A;  5KND A;  2B2T C;  3NUC A;  4NW2 A;  4EGV A;  3HG9 A;  4FXD A;  3K5L A;  2XWB B;  3OSO A;  3KF8 A;  4V19 0;  3I91 A;  2NBF A;  1PRT B;  2JXM B;  3PIO 3;  3T56 B;  1I4H A;  3I8Z A;  1ROD A;  3SK8 A;  3HZX A;  3NXW A;  1QNU A;  1AZQ A;  1A3V A;  2EYJ A;  4FO2 A;  1HXY D;  1HCZ A;  5KNB A;  3K5N A;  1M4V A;  3MEH A;  4EQO A;  2EY6 A;  1JE4 A;  1IW7 C;  1E2W A;  5BN3 A;  5IT9 E;  4BY1 B;  1T5E A;  4ZK9 B;  4BS9 A;  5HUR A;  5C4X B;  4DNT B;  2IPK D;  3QWN A;  5KIX A;  1F2Y A;  2BDO A;  3Q23 A;  1SAP A;  2F0V A;  4R9W A;  2B2W A;  1M8A A;  1WCM B;  4IUN A;  2KCC A;  3ERQ A;  4C56 C;  4C3I G;  1S5D D;  4EVO A;  5KYI A;  2HDL A;  1H9R A;  4I7Z C;  1E2Z A;  2NTT A;  4XT1 B;  2B2V A;  2XN9 C;  2BA1 A;  4KHV A;  1RHP A;  5I9P A;  1PFM A;  1OXT A;  3KUP A;  3BVZ A;  4A93 B;  3MHB A;  4O1N A;  2VB3 X;  4QCL A;  4RFB A;  2H1E A;  2JA5 B;  4K6L A;  1HUN A;  4HCS A;  2QIL A;  4ODG A;  3SVM A;  4JK1 C;  1TS3 A;  1E2V A;  1Y8O B;  5KNC A;  2B2Y A;  3BDC A;  3Q22 A;  1Y69 U;  1F9Q A;  1ILQ A;  2EXZ A;  2Q8T A;  2JEA I;  3VR2 A;  1I4Q A;  1EWH A;  1EFI D;  3E0J A;  3V05 A;  2J7Z A;  2EYF A;  4K2L A;  1B1Z A;  3BYT B;  1TS2 A;  3TP5 A;  4XT3 B;  1Z47 A;  2F0W A;  1L0Y B;  4K2K A;  2LS0 1;  2RSO A;  1QOH A;  4WRD A;  2M2L A;  3PMF A;  2CW0 D;  1STB A;  1PTO F;  2IX1 A;  3OIP A;  5JAV A;  4YIJ A;  2K28 A;  3I4N B;  5JJZ A;  1EZ8 A;  4KY7 A;  2B8G A;  1DYQ A;  1KNA A;  4U68 A;  2EJM A;  1WTQ A;  1PRT C;  4OHJ A;  1AN8 A;  4OO1 I;  1EOT A;  1ET9 A;  4ZYS A;  4A3D B;  3MWY W;  5LHY 1;  1LTG D;  3GTM B;  4LAA A;  3BVG A;  4K8I A;  4WFN 3;  4DNR B;  1FNW A;  2F0K A;  2ZXO A;  3AMU A;  1PFB A;  1SNM A;  5CC4 A;  4M1U B;  3HEJ A;  2E75 C;  5C4H A;  5K5P A;  2PZT A;  4OO1 H;  1BR9 A;  4KD4 A;  4BBR B;  1EYA A;  2TMP A;  4Q0F A;  4KHZ A;  4IZ8 A;  3NSW A;  4BBS B;  4ZKB B;  1SSO A;  1II3 A;  5EKK A;  5DEH A;  4Z9C B;  4KK7 A;  3S1M B;  1KLU D;  3I4M B;  3TP8 A;  4IAL A;  1SFO B;  1JOO A;  4ABN A;  1HTL D;  1D1I A;  1CHQ D;  3RD4 A;  1DD2 A;  2K32 A;  3CU7 A;  1A2U A;  4MHE A;  4IUQ A;  2O5I C;  1TVX A;  1STA A;  3A8J E;  2K1B A;  1K8O A;  5C6A A;  4PV1 C;  1ICW A;  2F0D A;  4F8M A;  1EY8 A;  4CKE A;  1EEF D;  1NSN S;  1AP0 A;  2PW7 A;  4X3U A;  4H7B A;  5C5M A;  3HOY B;  1QNK A;  3PUV A;  2PO4 A;  2R6G A;  3VR4 A;  5C4J B;  3Q0A A;  3X3N A;  3KLS X;  1CZG A;  2CW0 C;  3MFG A;  1UEA B;  2BOS A;  2F0J A;  2MP1 A;  5EPL A;  2NUC A;  4ZQ3 A;  3O13 A;  2AQ3 B;  5EBC A;  4ZUJ A;  4WOR A;  4PMC A;  1BUV T;  4A3E B;  2DNC A;  5C4Z A;  4ZLT F;  1U4R A;  1A2T A;  5KGU A;  2EY2 A;  2VUM B;  3VYT A;  1QG7 A;  4LK1 C;  3K59 A;  3BG3 A;  2LMC B;  3OWE B;  2F0F A;  3NK9 A;  1T5X D;  2RQX A;  1I4R A;  1RJT A;  1H9S B;  2F0L A;  1K8M A;  2OEO A;  4O42 A;  3MZ5 A;  1J8I A;  1D6E C;  2RSN A;  3RZD B;  4IFD H;  3OW7 A;  1QWY A;  1JIC A;  5A35 A;  2K5D A;  3QG1 A;  3TDQ A;  1B44 D;  1HA6 A;  2EJF C;  2NTS A;  1WVL A;  3FMC A;  4H0L C;  3IFD A;  1EIH A;  3J80 E;  3D8G A;  2X69 A;  3GTL B;  4KN4 C;  2PNR C;  2ID0 A;  1S5F D;  4QUF A;  3R2I A;  3K58 A;  1EQV A;  3NQT A;  1EZ6 A;  1R4Q B;  1EWC A;  2RDG A;  1KDB A;  3FPP A;  3MA2 B;  2VNU D;  4N9P A;  1AW7 A;  3N52 A;  1JOK A;  4K5W A;  2L0C A;  3CQZ B;  1G29 1;  4EQN A;  2IX3 A;  5KEE A;  1PZI D;  4QB4 A;  2O4X A;  1FD7 D;  2EOT A;  1B9N A;  3GO5 A;  2JE6 I;  2XSC A;  5ELE A;  1U4M A;  4KJN A;  2R7Z B;  2I07 B;  2QF7 A;  2E2H B;  5IIF A;  1OXU A;  5C44 B;  4RKL A;  2V4D A;  3TBI B;  4FXG C;  2R61 A;  3QOL A;  4IQZ A;  1SE3 A;  4RGN A;  5E3F A;  3W2D A;  3I70 A;  2A74 C;  2MHV A;  1STN A;  1ONL A;  1SMY C;  2RDF A;  1DM0 B;  1BXT A;  3I3C A;  4XYO A;  2NVT B;  4ME5 A;  1O7Y A;  3PUZ A;  4RAU C;  2NN6 I;  2EJG C;  2FHT A;  1WTR A;  5AFW A;  1EY9 A;  1XXG A;  1RF2 D;  1S4Z A;  3RLF A;  2FJ2 A;  3P20 A;  2G9D A;  1FYC A;  2O5J C;  2IWH A;  3P75 A;  1CA6 A;  5M5X B;  3DEO A;  5CBA E;  1G2S A;  2NN6 H;  3NBH A;  1SNQ A;  1VDZ A;  3HGB A;  3HP3 A;  4C3J G;  1STG A;  1IW7 D;  2Y0S B;  1JOQ A;  3M85 A;  3KBX A;  3A55 A;  4QF4 A;  3HOX B;  3S16 B;  4RWS C;  4KY6 A;  3PUX A;  2A69 D;  5C3W A;  1STH A;  1XTC D;  1MSG A;  3ERO A;  1LAC A;  4HMI A;  3AB9 A;  1S5C D;  1STE A;  5C0X G;  3BYY B;  2QKI C;  3RUZ A;  2B2U C;  2F0U A;  2BCO A;  3H94 A;  1Y1W B;  5JOB A;  3OMC A;  1KNE A;  4F88 A;  1LT3 D;  2OXP A;  1TY0 A;  3V2T A;  2WKC A;  3L9A X;  4RKB A;  4CGY B;  4J1M A;  3VR3 A;  5K36 G;  3DEP A;  1BCP B;  4HSV A;  1EY0 A;  2HDM A;  1GOZ A;  2NVY B;  4BA1 I;  4DU9 A;  1TR5 A;  1W6K A;  3HOW B;  5BN5 A;  1QJO A;  1RDP D;  1FR3 A;  1CZW A;  2K7V A;  4HTH A;  1Q12 A;  1TU2 B;  3OMG A;  2SNM A;  3QB3 A;  3HRZ C;  3Q6S A;  2KED A;  4K14 A;  1WD0 A;  4TSS A;  3D4R A;  5EKI A;  3C3L A;  3H91 A;  1IYV A;  1PZJ D;  4KD3 A;  4B9W A;  4LJZ C;  4KKU A;  4HCE A;  3HOZ B;  3NQI A;  1A15 A;  1PRT D;  1WD1 A;  1ZYR C;  1Z7T A;  4QMG A;  1QE6 A;  4KJO A;  3SE0 A;  4HED A;  2A69 C;  1R4P B;  3DWA A;  4NMZ A;  1AEX A;  2PW5 A;  3H6M A;  4AYB B;  2D62 A;  2KEC A;  1QB5 D;  3M7G A;  4DK0 A;  1HFN A;  1B3A A;  1V8Q A;  2Z8L A;  4A3J B;  1JB3 A;  1JWS D;  4Y7N B;  3V96 A;  2B63 B;  4FVM A;  3AU7 A;  1ZKO A;  1G8Z D;  2NB0 A;  1LLR D;  1CQF A;  1F2M A;  3FKI B;  4PNY A;  2ICE C;  1EY5 A;  2F0N A;  1NAP A;  4IUU A;  5J22 A;  5JVH 3;  3E5S A;  4J6H A;  4KTA A;  4DN4 M;  5E4X A;  3EJI A;  2LY7 A;  5CV4 A;  5DM7 3;  1CK1 A;  4DXF A;  2KQ3 A;  5M3F B;  3MVV A;  1LAB A;  5FOB B;  5FO9 B;  3DUZ A;  4MN3 A;  5BN4 A;  3C1E A;  3T16 A;  2DNE A;  2C5C A;  3CHB D;  1TWF B;  1SXT A;  5ELD A;  1BCP C;  1B2T A;  5COR A;  2F3V A;  1EY6 A;  1I3Q B;  2I46 A;  3VYU A;  1C48 A;  3NWS A;  4UAI A;  5E1F A;  1F9P A;  2JA8 B;  2SDF A;  1WTP A;  1B9M A;  3IL8 A;  1OXS C;  2AUJ D;  1EYD A;  2BDN A;  2F0P A;  5J39 A;  4C3I B;  4FYD A;  1GJX A;  3OWF A;  3SDZ A;  1SYB A;  5I4D A;  3QO2 A;  5M9O A;  2ENB A;  2KA7 A;  3FEW X;  1V43 A;  1W6J A;  1HQR D;  3MXP A;  5T1I A;  1CQV A;  2E2I B;  2N88 A;  2Z4H A;  2XRQ D;  3I4L A;  5D3D A;  4C3H B;  5CGK A;  4BA2 I;  1Y1V B;  1HHV A;  1KDA A;  1Y8P B;  1B53 A;  1GUO A;  5D65 A;  3DWQ A;  2MPM A;  3NTH A;  5DM6 3;  1I4X A;  1IKL A;  2NZ1 D;  3G7L A;  1PDQ A;  2F0T A;  2WKD A;  1X32 A;  4B08 A;  2MJ8 A;  2F1M A;  1XWE A;  1ML0 D;  3KK7 A;  1D5X C;  3HS0 C;  4ZUI A;  4G7H C;  1BQQ T;  3A8I E;  5KRU A;  1WTW A;  1OXX K;  3ZYY X;  4HSP A;  3NWT A;  1CTM A;  1RCV D;  4XQJ A;  1PYW D;  1O78 A;  2B2W C;  2QEJ C;  4L8J A;  1MBY A;  1TT2 A;  2L11 A;  3HKZ B;  1PTO B;  5COY A;  3S1N B;  5M5Y B;  2L4N A;  3NHH A;  1EYC A;  2B2V C;  3OPO A;  2FIN B;  3ND8 A;  1JQY D;  3GTO B;  1SEB D;  2F0S A;  1EY4 A;  3SR1 A;  3S15 B;  1D5Z C;  3LNN A;  1DZ1 A;  1C4Q A;  3R93 A;  2LKV A;  2IW3 A;  4CJ2 C;  3T51 B;  4K6D A;  3C1F A;  2B39 A;  2XWJ B;  2B2Y C;  4KN7 C;  1LTR D;  1RTN A;  2A73 B;  1NR2 A;  2E74 C;  1SNO A;  2DY7 A;  3UI2 A;  3CRK C;  3PO2 B;  1LTS D;  5EGT A;  1YNN C;  1SMY D;  3T4A C;  1Y8N B;  5ELC A;  3MXG A;  1BDO A;  1UNS A;  1RD9 D;  1O7Z A;  1BF4 A;  1TY2 A;  1JCK B;  1FNV A;  4XQQ A;  1X3P A;  1H9M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...