3MEFA

Major cold-shock protein from escherichia coli solution nmr structure
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
69
structure length
69
Chain Sequence
b'SGKMTGIVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKSLDEGQKVSFTIESGAKGPAAGNVTSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (COLD-SHOCK PROTEIN A)
publication title Solution NMR structure and backbone dynamics of the major cold-shock protein (CspA) from Escherichia coli: evidence for conformational dynamics in the single-stranded RNA-binding site.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Gene regulation
total genus 5
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1998-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00313 CSD 'Cold-shock' DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3mefA00
1QUQB 4A3BH 3HOVG 3ULLA 1HNWQ 1TWFH 2IX0A 5ELOA 1MKHA 1TWGH 4UY8C 4YCWA 2ATWA 3E0EA 4IPCA 1GO3E 3E9IA 3JAMi 3GO5A 2F52A 2NVYH 3HOYG 3CQZH 3I4MG 3HKZG 4A75A 4L5QA 1G51A 4A3BG 2I5HA 1VQFA 2XGTA 4A3IH 3GTOH 1Y14B 4A3JG 1PHJA 1N36L 1FL0A 5FLXc 1IBLL 2Q2TA 1CKNA 1PH4A 4OWWB 1AE3A 5IYDH 2KHJA 5BR8L 1HH2P 3I4NH 1SE8A 1IBKL 2HHHQ 5HGQA 1N34Q 4DR4L 1WI5A 4DV5Q 2IY5B 4BXXG 4A3LH 1IYJB 3M3YH 3PO3H 3GD7A 2RHSB 2K52A 1NY4A 1YHBA 1WFQA 2KHIA 3KJPA 2VQFL 2UUAL 3BZCA 2ASBA 3I4NG 4BBSH 1E7ZA 1I50H 3KF6B 3RLFA 4DAYB 2CQOA 2JEBI 1EIFA 4DV6L 4RMFA 3RNUA 4JI3Q 3J7A5 3B6YA 1PH2A 3GTMH 4JV5L 2VZAA 1VQ8A 4B3ML 3STBC 1YIJA 1S3OA 2RCNA 4DV7Q 1VQGA 4LF6Q 4AH6A 1Q46A 1QVCA 2QGQA 1HR0L 2R7ZH 3T1HQ 2CCZA 3KYHC 4JI4Q 2LXKA 3U50C 4C3IH 4LUOA 2MFIA 2F4VL 1XNQQ 1X54A 3GTGH 2R7FA 5IP7H 3CC7A 5GAGC 1O7IA 4DV2L 1E22A 1BBUA 1HJPA 4TVAB 4X66Q 4ALPA 5JJKA 5M5WH 2VY3A 4PMWA 4C2MH 3CCMA 3M7NA 2K4KA 4DV4Q 4FDBA 5IP7G 3JAMc 1XMOQ 2WP8J 1KRSA 2K5NA 2F3IA 1KIXA 4IJHA 2E2HH 2PQAB 2A1AA 2NZOA 5IYBG 1C0AA 4GKKQ 1WCMG 2WFWA 3KDFB 3I55A 1NMGA 3HOXH 1IBMQ 4K0KQ 5IWAL 4A3EH 2JA9A 1B8AA 3D31A 1L0WA 3W5OA 1HNXL 4DR6Q 2K14A 1G291 3CCSA 4PG3A 5GQOA 2UXDL 4X6AH 4UPAA 4DUZL 2GVAA 3PUZA 4YHHL 4DV0L 4JG2A 4DNIA 4A93H 4DR7L 1YJ9A 3W1BA 4OWTB 2E2JH 2C35B 3HKZE 1L1OA 1EQRA 3ER0A 1KQSA 4B3TL 1WJJA 2B3GA 1A0IA 3I7FA 1PFSA 3CPFA 3LGJA 4BBRG 4A93G 3EN2A 4P75A 4BA1I 4NB3A 1VQ4A 2QEXA 2FXQA 3M9BA 3HOWH 2OCEA 1YHQA 3OW2A 2IHFA 4LF8Q 3UE1A 4HJ9A 1K8GA 1U5KA 2Z6KC 4JI6L 1M1KC 2NZHA 4IPHA 2YTYA 4R4IA 5M3MH 2IX1A 1GVPA 2YTVA 1ASZA 2HT1A 1VCIA 2L15A 1GD7A 1C7YA 4GOPA 5ELNA 2D62A 3RN5A 3K80C 2GVBA 4MNOA 4LFCL 2Z0SA 4J15A 1HNZL 1FJGL 1XNRQ 2JJQA 4X65L 1VQ6A 3RR5A 3STBD 1Q86C 3PSIA 4HJ7A 2PQAA 3PF5A 4A3DH 4P74A 3BJUA 4B3SL 1PH3A 1NTGA 3J7ZC 2UUBQ 3AEVA 4Y52H 2KBNA 4QY7A 1CKNB 4QL5A 4UP8A 3H0GG 4Y7NH 4DV3Q 4YY3Q 4DUYQ 2NVQH 5IP9H 2LXJA 3L7ZC 1SN8A 4DV1L 4QIWE 2JA6G 4GNXC 5AJ3L 2B29A 4R4TA 3T1YL 1I3QH 1DGSA 4AYBG 3CCUA 4A3MH 1PH7A 3GTLH 2YV5A 3S2DH 1KXLA 1OTCA 2Y0SE 3RN2A 5C3EH 2HIVA 4DR5L 5GROA 1A62A 4HIOA 3NBHB 5FLMH 1YNXA 2N78A 2R6GA 3ZJYC 3AYHB 3BZKA 1NBWA 3CP0A 1I94Q 4DK6C 4GN3B 3HOVH 4DK3C 5C3EG 2DUDA 4KHPL 1NMFA 4LF5L 3A5ZB 1VQKA 3S24A 5FLMG 3I4MH 4WJ4A 5BR8Q 1EQQA 3HOYH 1IBKQ 1E1TA 1Q8KA 2CFMA 1N32L 5HY6A 3CC4A 3J80i 4A3JH 1L2FA 3F8TA 3S1MH 4BY7H 2ZM6L 2UUAQ 4LF7L 3S14H 4OX9Q 1KL9A 2YTXA 1EIYB 5FJ8G 4LUVA 5C0XG 4AQYQ 1X56A 2XTIA 1K73C 2CWPA 4APVA 4JOIC 2VQEL 3M4OH 1VQBA 4BY7G 4BXXH 4JV5Q 1IZ6A 3JC66 4DR3Q 3A0JA 1KAWA 4B3MQ 5C0XJ 4JI1L 3WWVA 4GLXA 2JA8G 5C0XI 3CCQA 1VQ5A 2A8VA 1HZCA 5IY0A 1GM5A 1HR0Q 4A3CH 4A76A 2ES2A 1EUJA 1XPUA 4A4IA 1C9OA 1LTLA 1CUKA 5GAHC 2F4VQ 3H15A 3MXNB 1I5FA 2BH2A 3L2PA 2HIXA 4X64L 3J81c 4NXML 5M3FH 4A3CG 2E5LL 3CC2A 1CSQA 2A19A 4JI0Q 1MJCA 1S40A 1J5EL 1Q1EA 1XTDA 2ALYB 2JQOA 1KHIA 3K7UC 2UUCL 1QVGA 1L1OB 1SLJA 2IHEA 2JK8A 4EX5A 3PIOA 5LMNQ 5JEAG 1OXUA 5LMUQ 3RZDH 1Q7YC 5M3FG 5K36G 4YWKA 2MNAA 4LF4L 3M4QA 4UP7A 1SROA 5JEAJ 3RLNA 1X3EA 1VQ9A 4JI7Q 3HFZB 1QZGA 4OONA 1HNXQ 4YCVA 2Y0SG 4R4CA 2UXCL 3AFPA 1E3PA 1L1OC 1OXXK 1GKHA 4JBMA 4DR2Q 2E8GA 3OTOQ 4IOAA 2UXDQ 4AYBE 2D0PA 4GKJQ 5IYBH 2H5XA 4YHHQ 3L0OA 1WCMH 1JJCB 4GN4B 3G6EA 1X3FA 4GOPB 2RHQB 3AFQA 4B3TQ 4NXNL 3CMEA 4KLKA 2Q2IA 4BY1H 1D8LA 1X55A 3HKSA 2HHHL 1N34L 1JT8A 3EIVA 3ULJA 1LUZA 1CKMA 1V1QA 4HIMA 4BY1G 4P73A 4JI5L 1UE6A 2AHOB 4LFBL 2EIFA 1YJWA 2N3SA 2WAQE 2K75A 4JI2Q 2UXBL 1JE5A 1YHAA 1RL2A 3KOJA 4RG1A 4BBRH 1PH1A 4MTNA 4A3GH 2NVTH 1K0RA 2OQ0A 1XJVA 1VQHA 1IL2A 1JB7A 2MO1A 3PUVA 1PH5A 1SFOH 1V43A 1YBYA 4DV7L 4A3GG 1HNWL 1KRTA 2BA0A 4B3SQ 3A5UA 4JI4L 1IXRA 3PGZA 4LNQA 1V9PA 3CW2C 4GLAC 3CCVA 2PNHA 3CF5A 1XNQL 1MIUA 1KD1C 1AH9A 1VQDA 2VUMG 1Q81C 2OTJA 3PO2G 3NELA 1TWHH 4DV1Q 4JI8L 1N33Q 4BA2I 2B63G 1NE3A 4IO9A 3K81C 2HQLA 4L5RC 3KF8B 4X66L 2YU9H 3T1YQ 1Q1BA 1YEZA 2QA4A 2AWNA 4DV4L 3K8AA 4JCVE 1Z47A 4PZ6A 2KENA 4DR5Q 3H0GH 2JA7G 5JJIA 1BBWA 2JA6H 2I5LX 1EYGA 3FP9A 3NENA 4GKKL 1CKOA 4POFA 2V1CC 1G6PA 1WYDA 2UU9L 3CCJA 4OO1G 4KHPQ 2CWAA 1JMCA 1OXVA 5M5YH 4B3RQ 1E1OA 4LW1A 1UEBA 5C44H 2DGYA 1N32Q 4YWMA 5C4XG 2PI2A 4OO1I 2NVXH 4AIMA 3CCLA 1LM0A 4X62L 3BU2A 2K5HA 5C44G 1XMQL 4LF7Q 2EXDA 3FKIH 4HIDA 1TWAH 1Y1VG 3E9HA 4R4QA 1S72A 1VQAA 1N36Q 1JJ2A 1QVFA 5IYCG 2D0OA 3CAMA 1IBLQ 2I0QA 2N8NA 1EFWA 4L5TA 3GTKH 3FKIG 5H1SE 4LF8L 2R92H 3ICEA 3K7AH 4DR4Q 2WAQG 1EOVA 5FJ8H 2AMCB 3DLLA 2NN6G 4IPGA 2CKZB 3UDFA 2R92G 3U4ZA 1PYBA 4LFAL 2VQFQ 1SRUA 4L5SA 5GAEC 4JYAL 4X64Q 2PMZE 4NXMQ 1X6OA 1ASYA 2JA8H 4DV6Q 2VNUD 5GADC 2NN6I 1J5EQ 2ID0A 3CMAA 3U58A 4LF9L 2UUBL 2K50A 3KFUA 2VL6A 3AQQA 1A8VA 3F1ZA 4DV3L 3K0XA 3S17H 1UE7A 2PI2E 3EBEA 1H95A 1VQMA 1VS0A 1U0LA 2OQKA 4TQUS 2ZJRA 3MEFA 4LUZA 4ME3A 4MZ9A 3UDIA 1N8RC 1VQ7A 1YVCA 1HZBA 4P72A 3PUXA 4YWLA 1NJIC 3PUYA 5IT9c 2AWOA 2KCTA 3S1NH 4GNXA 1TWCH 2JE6I 4PZ8A 1PYSB 1HR0W 1Q12A 1HZAA 1FVIA 2MQHA 2WB1G 4YCUA 2UXCQ 3ERSX 4H02A 5EAYA 3UDXA 1SMXA 4R1JA 4DV2Q 3NEMA 3PV0A 1PH6A 2Q2UA 3RLOA 4DR1L 4GLVB 4A3KH 1I94L 2OWOA 2JEAI 4HJ8A 3I2ZA 1PH9A 2YYZA 3U4VA 1K83H 5IE8A 3TS0A 4NXNQ 1UWVA 4IPDA 4A3IG 4A3KG 3PUWA 1YJNA 3Q8DA 2ZTDA 5LMNW 1VQNA 3I4OA 4JBJA 3OYYA 2EQSA 3UDGA 3S1QH 5IWAQ 1K3RA 3TEHB 5IYDG 3GTPH 3HOUH 4JI5Q 1B7YB 4LFBQ 1UE5A 4HJ5A 4KHZA 4NPSA 3G71A 3CCRA 4OX9L 2UXBQ 2ZTEA 4DUZQ 1X9NA 1N9WA 2R7DA 4AQYL 4A3LG 2RF4A 3J80c 3G4SA 4DV0Q 3PO3G 3HOZH 4O2DA 3HOUG 3W1GA 4DR7Q 4DR3L 1RIPA 4R4OA 4BBSG 3F2CA 3SGIA 1Z9FA 3RZOH 3D0FA 1VQIA 4PZ7A 1VQEA 2MO0A 4JOIA 1YZ6A 4DAMA 3IRBA 5J3BA 4DV5L 4IOCA 3HOZG 1OXTA 1QUQA 4UP9A 1VQOA 1SR3A 2VS1A 4C3JH 3A74A 4POGA 1J6QA 4OWXB 2BH8A 2KCMA 4GOPC 4JC0A 2R7ZG 4JI8Q 4JI6Q 4JI0L 3PCOB 4JI3L 1X3GA 3VDYA 1Q82C 4C3HH 1D7QA 5LMNL 5LMUL 4A3FH 1YITA 1K9MC 4LFCQ 1HNZQ 1PH8A 3GTQH 4X65Q 2VUMH 4LF6L 3PO2H 1A63A 3T1HL 3F2BA 4QQBX 2K5VA 3CXCA 2B63H 4A3FG 2UU9Q 1LYLA 2AKWB 4GN5A 4HIKA 3M4PA 4JI7L 1WOCA 4XTCS 3TREA 4DKAC 2BA1A 2JA7H 1T9HA 5AJ3Q 1VQPA 4DR2L 3OTOL 1XPOA 3HOXG 1MJEA 3KF6A 1B70B 1QZHA 4A3EG 4GKJL 3GTJH 2ZJQA 4JBKA 2WB1E 1XMOL 1M90C 3M85A 4X62Q 4GS3A 4OXPA 1XMQQ 2I5MX 1AE2A 1PA6A 2GN5A 2OTLA 4DPGA 1IBML 3S2HH 2E2IH 1KC8C 3H3VI 3TRZA 5C4XH 4K0KL 2ZTCA 3KLWA 4QGUA 1CSPA 4LF5Q 3PF4A 3ULPA 4DR6L 3S15H 1JJGA 4JI2L 3CCEA 3HOWG 4KI0A 3G48A 4WJ3M 1FGUA 4HJAA 2LSSA 4GNXB 1R9TH 2Q2HA 1UE1A 1Y1VH 1Y1WH 3CD6A 1P16A 3TS2A 1EWIA 2ZM6Q 5IYCH 4LFAQ 1VQCA 3J81j 4JYAQ 3F2DA 3FHWA 2VW9A 5M3MG 1BKBA 1Y1WG 1K8AC 2VQEQ 4LF9Q 1PVOA 3KDFA 2N49A 5JJLA 4QJFA 4IJLA 2JA5H 4JI1Q 4IFDG 3S1RH 4A3DG 1N33L 3GDEA 3KJOA 3J81i 1YI2A 1X65A 1VQLA 1W3SA 2R93H 1VQJA 1FJGQ 1PV4A 4JBWA 4IFDJ 4P71A 1OXSC 5IP9G 2JA5G 1XNRL 2Z6KA 5DLQE 1HZ9A 5E7NA 4IFDI 3DM3A 2R93G 1XPRA 2E5LQ 2ZJPA 5C4JH 1TXYA 4XIGS 3UE0A 1P8LA 2IT1A 4DR1Q 4A3MG 2UUCQ 3H3VH 1I6HH 3S16H 4O0AA 3TQYA 4YY3L 4DUYL 1BVSA 4EQ5A 1W2BA 3CPWA 4LF4Q 4LWCA 3I56A 4B3RL 1E24A 3PIPA 5M5XH
chains in the Genus database with same CATH superfamily
2QW7A 4A3BH 3DEOA 2RVLA 2CH4A 2CW0D 5CYUA 1GO3E 3I4MG 3GO5A 2NVYB 1Q90A 3CQZB 3HKZG 3QG1A 2XN9C 4A75A 1G51A 3ZYYX 2I5HA 1VQFA 4A3IB 2NUCA 2WKCA 1N36L 3JAML 1CKNA 1LABA 4L8JA 1PH4A 3NQIA 1RHPA 3M3YH 3PO3H 1FNUA 3GD7A 1DXMA 1YHBA 2DY8A 2VQFL 3C1FA 2ASBA 4BBSH 2DN8A 2L1BA 4EQPA 5CBEE 4UAIA 3NBHA 2CQOA 1EIFA 3BG3A 5IT9E 2LKVA 3RNUA 4JI3Q 3B6YA 3GTMB 2QKIC 1VQ8A 1YNJD 5T1GA 1YIJA 3DM1A 2RCNA 3OW7A 1VQGA 2QGQA 1RJTA 1KDCA 3T1HQ 3BVMA 4OELB 4ZKBB 1X3QA 3EVQA 4C3IB 2F0QA 2AUKA 1X54A 3GTGB 1D2BA 1NUCA 5IP7H 1PTOC 1BBUA 1MSGA 2LS01 4X66Q 1B3QA 1I4GA 5M5WB 2VY3A 4C2MH 3RMHA 1QG7A 5I4DA 1XMOQ 1KIXA 2E2HH 4CHTB 1PTOF 3K58A 5IYBG 3KDFB 2BCOA 2F0MA 1LTGD 2K14A 4PG3A 3RUZA 2PW5A 1CQFA 4DNIA 1E2WA 3W1BA 4V0BA 1L1OA 1EQRA 3ER0A 4B3TL 3PIP3 1A0IA 2IX3A 3I72A 3LGJA 4BBRG 3EN2A 1LO5D 4P75A 4Q5VA 4NB3A 3M9BA 5DNFA 3H94A 3HOWB 2OCEA 5JJZA 1CM9A 4CDCC 1F9QA 2YTYA 4R4IA 3LNNA 2IX1A 2L15A 3RN5A 1XNRQ 4CGYB 1QCBD 1LT4D 2JJQA 4X65L 1VQ6A 2F0TA 3RR5A 2EYMA 3A56A 4A3DH 1LTBD 2D5DA 4QY7A 1CKNB 2B2UA 2R61A 2Z9HA 5IP9H 4FYDA 3CCUA 2IJ0A 4A3MB 1PH7A 3GTLB 3S2DB 1OTCA 5C3EB 2HIVA 3I73A 1I4QA 3NBHB 1B1ZA 1EWCA 1YNXA 1GHKA 3BZKA 1MI2A 1FNWA 4GN3B 4DK3C 2KVMA 4HMIA 1ICWA 2DUDA 4KHPL 4LF5L 3A5ZB 1VQKA 5FLMG 3I4MH 4WJ4A 5BR8Q 1IBKQ 1JB3A 1U4LA 2B2TC 5C0XH 3J80i 3KF8A 3WDNA 3W2DA 4A3JB 4BY7H 2ZM6L 2EE1A 3NWTA 3QWNA 1S5ED 1KL9A 2YTXA 5FJ8G 3SK8A 2XTIA 4K6DA 1F9SA 2VQEL 2EOTA 1VQBA 2K32A 1CTMA 2V4DA 3W3AA 2XNAC 5A2QL 4B3MQ 4JI1L 3WWVA 4GLXA 3TZDA 2A8VA 4A76A 2ES2A 1ESRA 4CDDC 2F4VQ 1I5FA 3OOCA 3L2PA 2HIXA 4X64L 1CA5A 2F0HA 2Z1CA 5M3FB 4NXML 2E5LL 3AU7A 4A3CG 1SXTA 5DM63 1BNZA 1S40A 2UUCL 1Q1EA 2L9HA 1KHIA 1L1OB 2IHEA 3RZDH 5LMNQ 5LMUQ 1Q7YC 2K6AA 1OXUA 2B2YA 5JEAG 1HCZA 4YWKA 4OGQC 1PRTB 4JW0A 1VF7A 5JEAJ 3T13A 1JC7A 1DD2A 2Y0SG 4JBMA 4IOAA 3BVGA 3R2IA 3OTOQ 4DR2Q 2UXDQ 4AYBE 2D0PA 5IYBH 2H5XA 3G6EA 2RHQB 1Z7TA 3CMEA 4M8AA 1I4XA 2XIWA 3HKSA 5J1ZA 1M4VA 1DZ1A 1R4PB 2HQEA 2BE5C 2F0DA 3Q23A 3LX0A 1ILPA 1TQOA 3NBIA 2UXBL 1EIHA 3G7LA 3KOJA 4RG1A 5ELDA 4BBRH 3K5LA 4A3GB 2A69D 4C3JG 2NVTH 1BUVT 5IGFA 1C48A 4F88A 4DV7L 1HNWL 3P75A 2BA0A 2WV6D 4HEDA 1DOKA 4JI4L 1IXRA 3PGZA 4LNQA 2RDHA 5HURA 3M4YA 2OTJA 1F2MA 4DV1Q 1SYBA 3MVVA 3VR6A 1ENCA 1EFID 2BDNA 4L5RC 3KF8B 2YU9H 2EVBA 3T1YQ 5D3IB 2F3VA 3D8GA 4DR5Q 2GA4B 2SDFA 1BBWA 2Z4IA 2JA6B 3NENA 4GKKL 2M9VA 4EQOA 1RTNA 3C2PA 3HGBA 2KECA 4OO1G 4AYBB 1JMCA 5BN3A 1E1OA 3MZ5A 1N32Q 4WORA 4BS9A 3FMCA 5C4XG 5IT9L 4OO1I 3U9SA 1MHWC 2ZXPA 1NCVA 2K5HA 3R8BA 1XMQL 4LF7Q 3FKIH 4HIDA 1SE2A 1U4MA 1Y1VG 3E9HA 4X3TA 1S72A 2HUGA 1VQAA 1N36Q 1JJ2A 4HCSA 2F0VA 1XWEA 1EYDA 3MXGA 1EFWA 1EEFD 1SE3A 5JPMC 1WTQA 2FJ2A 5FJ8H 5C6AA 3QJYA 4IPGA 2CKZB 1CQVA 2F0SA 3UDFA 2R92G 1O80A 2VQFQ 1SRUA 2VB3X 5CV8A 5EPJA 4MN3A 2VNUD 1J5EQ 2ID0A 2UUBL 2VB2X 5I6WA 2JP1A 1B50A 1B9MA 3QOLA 1VS0A 1VQMA 2OQKA 4FF4A 4KK7A 3Q0AA 4DGZA 3MEFA 3GV3A 4IUUA 1VQ7A 1YVCA 5I2YA 4R8NA 3UI2A 2PQEA 1IYVA 5JPNC 1TWCH 3GQBA 1PYSB 2E76C 1ILQA 1JJGA 4H02A 1SMXA 4R1JA 3NEMA 2Q2UA 4N8X1 3HG9A 1I94L 1HTLD 3VR5A 3NWSA 3TMEA 2OWOA 2JEAI 4F87A 4IUVA 3OWFA 1PH9A 2YYZA 3OPOA 1K83B 4NXNQ 3AMUA 4A3IG 4DAPA 1JWUD 1L0YB 1JQYD 2EQSA 2K5DA 3V2TA 1SYFA 3S1QH 1IKLA 4B08A 2K03A 5IYDG 3GTPH 1MGSA 1B7YB 3L3OC 1UE5A 1U4RA 5FO7B 2B2TA 2P5ZX 3D3RA 1X9NA 1GUSA 2R7DA 4P2CB 2K05A 3HOZH 4IURA 3HOUG 1PTOB 2JXMB 4R4OA 3J7AF 5C5LA 1VQIA 4XQJA 4IOCA 3IRBA 1BDOA 4C3JH 4IUNA 4O1NA 2KCMA 4JI8Q 1B3AA 1SJHD 4HMJA 3ND8A 4JI3L 5KRUA 4C3IG 4C3HH 1S5FD 1YITA 1PH8A 4X65Q 2KCNA 3PO2B 3E5SA 3OHXC 3T1HL 1TS5A 2K5VA 3VR3A 5LHY1 2J7ZA 3M4PA 3BZDB 3T16A 5J22A 5C4ZA 3TREA 2BA1A 1STNA 1XPOA 1IL8A 4GKJL 3GTJH 2WB1E 1XMOL 1M90C 1SYEA 4X62Q 4OO1H 4OXPA 1S5DD 3S2HH 5C4XH 3N6RA 3KLWA 4RGOS 3LWEA 4LF5Q 1MSHA 3MWYW 3NPPA 1EQTA 1V1OA 4MTKA 4DF7A 3HOWG 1SEBD 2J4XA 1DOLA 4HJAA 2RQXA 1R9TH 1HRJA 1B4OA 1UE1A 1Y1VH 2TMPA 2ZM6Q 1XX8A 3E3XA 1UUPA 4X3UA 3FKIB 3FHWA 4QUCA 1JE4A 1K8AC 2VQEQ 2CQAA 1SYDA 2L4NA 2D9UA 4QJFA 4JI1Q 4IFDG 1N33L 1LV9A 1CK1A 1BCPD 3K5MA 1FJGQ 4CKCA 4IFDJ 1QE6A 1XNRL 3A8JE 2Z6KA 4IFDI 1BQQT 5KIXA 2R93G 2E5LQ 1S5BD 2MPMA 2JN4A 1TXYA 5C4JH 2UUCQ 4DR1Q 4A3MG 1I6HH 3S16H 3LWUA 2B2VC 3TQYA 5TSSA 2H1EA 2B2WC 3I56A 2EJGC 1E24A 3CF5A 2WB1B 4RCOA 2B8GA 3ULLA 4QCLA 4Q0FA 3FPPA 3E9IA 3D6CA 2F52A 2NVYH 1BF4A 3CQZH 3H3VC 5AFWA 4ULLA 2SNMA 4L5QA 4A3BG 2XGTA 4A3IH 4A3JG 3WOFA 2MUYA 3R93A 1PHJA 1A6XA 1IBLL 1AE3A 5IYDH 2KHJA 4L6TB 5BR8L 3I4NB 1IBKL 1AZQA 4N8FA 3DUZA 2F0LA 1IYJB 2G5DA 3DWPA 4ZKCB 2K52A 4JPBW 3BZCA 2RCFA 1E7ZA 1G6ZA 1I50B 3J7A5 4RMFA 1O7YA 3HOZB 3GTMH 2KEDA 1F2YA 4DU9A 4RHRA 4B3ML 3STBC 1S3OA 2K7VA 4DV7Q 4KKSA 4B9WA 4AH6A 1Q46A 4LF6Q 2R7ZB 2OF1A 4KJOA 4JI4Q 4C3IH 1Y8OB 2F4VL 1HUNA 3SK6A 3GTGH 2R7FA 5EBDA 5GAGC 4RA8A 2F0NA 2Q8IB 5I9PA 4C3HB 5M5WH 4PMWA 2K4KA 5IOCA 3AB9A 4FDBA 5IP7G 3J7AV 2F3WA 2K5NA 2A1AA 1NR2A 4GKKQ 3I55A 2L0CA 3HOXB 5KEEA 4A3EB 2JA9A 4FVMA 4ZUJA 1SMYC 3EQLC 3FEWX 3MXNA 3W5OA 1G291 3CCSA 2UXDL 4UPAA 1HHVA 2GVAA 2CW0C 4A93B 1STBA 1LTTD 2A74C 1KQSA 5DAUA 3I7FA 1U4PA 1PFSA 3A8KE 3MXPA 3MEHA 3HOWH 2RDFA 1CT1D 1NR4A 4KTAA 2IHFA 4ZUIA 3UE1A 2EYOA 2ZXOA 4JI6L 4IPHA 2K01A 2RBMA 1GVPA 2YTVA 2HT1A 2D62A 4X3KA 2GVBA 2Z0SA 1KNAA 5ELEA 5M9OA 3STBD 1Q86C 3PSIA 4IFDH 3K5NA 3PF5A 1EU3A 3BJUA 3IFDA 1YNJC 2UUBQ 2PO4A 3VR2A 4Y7NH 4DUYQ 2JA6G 4MHEA 4QIWE 4DV1L 2EXZA 5AJ3L 3T1YL 4AYBG 4A3MH 1ZXTA 3GTLH 2YV5A 3S2DH 5C3EH 1PRTD 4DR5L 3OMCA 4HIOA 3AYHB 1I94Q 1TU2B 4DK6C 3HOVB 2OXPA 1NMFA 2EYLA 1D5ZC 5I2XA 3HOYB 4Z9CB 2CFMA 1N32L 3CC4A 3D6WA 4A3JH 3F8TA 4EGVA 5CORA 3MFGA 4LF7L 3S14B 5CGKA 5C0XG 2CWPA 1CHQD 4APVA 4JOIC 4BY7G 1IZ6A 1JWMD 3NUCA 3P1HA 3JC66 3BS1A 1QNUA 5C0XJ 3A54A 4IN3A 5C0XI 3CCQA 1VQ5A 1HZCA 1HR0Q 4I7AA 2EYPA 1LTLA 4KMUC 4XYQA 3MXNB 4ME5A 2BH2A 4H7BA 2RSOA 4QUFA 5M3FH 3CC2A 2A19A 1MJCA 1ESFA 1J5EL 1AFPA 1XTDA 2WINB 4QIWB 4TKOB 1QVGA 4TRDA 4EX5A 3PIOA 1CI3M 1LTSD 4UP7A 2F0EA 2B2VA 1STAA 3RLNA 2B2WA 1X3EA 3CU7A 4XT3B 1HNXQ 2BDOA 3MHBA 4R4CA 1E3PA 3X3NA 1GJXA 4GKJQ 3L0OA 1WCMB 4GN4B 5G3LD 4QB4A 5I9OA 1IHZA 3TZUA 4NXNL 4BY1B 1STHA 1X55A 1X32A 3VA5A 3D4RA 1N34L 1EEID 3SR1A 4FXGC 4ZK9B 4K5VA 4FXDA 2AHOB 4K2KA 2EIFA 2MP1A 2WAQE 3NHHA 1NNXA 4B9XA 4C56C 4A3GH 4O42A 5ISRA 1K0RA 2MO1A 3VA7A 4BWGB 4RGMA 1YBYA 1DYQA 1T5XD 2AQ1B 1EY0A 3CCVA 1WVLA 2PNHA 4IALA 3QIAA 1H9JA 1VQDA 1Q81C 3PO2G 3NTHA 3VYSA 4JI8L 1N33Q 3TBIB 1V1PA 4QF4A 4BA2I 3K81C 2AQ2B 1CFMA 3K8AA 5JJIA 4ID6A 1A2TA 4IUTA 5E4XA 2JA6H 2I5LX 2JSOA 4NKLA 1CKOA 1FGBD 1WYDA 2DY7A 2XSCA 2H4OA 1QNKA 4Y7NB 1K3BC 4PNYA 3F2UA 1S5CD 1F2ZA 3SHLA 5C44B 1KLUD 5ELBA 3MFYA 3PIO3 5EKKA 2F0FA 2LMCB 4AIMA 3CCLA 4X62L 1M8AA 2O4XA 4K14A 1DM0B 4RH6A 5D65A 3HEJA 4J1MA 5BN5A 2WAQB 1GUOA 1RODA 5EGTA 1QVFA 5IYCG 1ENAA 3CAMA 1IBLQ 2Z4HA 3GTKB 3FKIG 3GP7A 1DOMA 3K7AB 5E3FA 2AMCB 1ZYRD 5LL6S 3U4ZA 3BYTB 1ZKOA 3KLSA 3K59A 4L5SA 3H6MA 4RKBA 4HN7A 1X6OA 2N88A 2A69C 3Q22A 1EWHA 5GADC 2A68D 4NDXA 3KFUA 2K50A 1TS4A 2FMMA 1A8VA 3F1ZA 1S4ZA 4H44C 3EBEA 5CV5A 2ZJRA 3UDIA 1FJGL 2AWOA 4WFN3 1Q8IA 2MQHA 1K8MA 2WB1G 4WJWA 4YCUA 4HAEA 3PV0A 1PMRA 4A3KB 4DR1L 4GLVB 2SEBD 4NP5A 4HJ8A 2NBFA 3U4VA 1K83H 2KCCA 2QF7A 3TS0A 3SDZA 1VMCA 1UWVA 2ZTDA 3UDGA 1QOHA 4CDEC 5KNBA 1V1PB 3KBXA 4OX9L 1N9WA 4AQYL 3G4SA 1PYWD 3W1GA 1PTOH 1GUNA 3RZOB 4JOIA 3HOZG 2HDLA 1QUQA 1SBBB 4KV6A 1J6QA 4OWXB 2K1BA 2C5CA 4JC0A 1AN8A 2R7ZG 2FINB 4JI6Q 3C3LA 4JI0L 2MGSA 3IFTA 1X3GA 3VDYA 2A6ED 5J39A 4ABNA 4A3FB 2QCPX 5C4HA 4LF6L 3PO2H 4ZYSA 1A15A 4C3HG 3J80E 1A63A 2ICIA 1VF5C 2UU9Q 1LYLA 4GN5A 1DCZA 4HIKA 2Z6BA 1WTWA 1IW7D 2JA7B 5ELCA 5AJ3Q 3HOXG 2XRSD 3T4AC 4DAYA 3KLRA 2Q8TA 4A3EG 4FNFA 2DJFC 4JBKA 1F9RA 2NB0A 3M85A 3I90A 2I5MX 2ZT9C 3SXHA 1LACA 2OTLA 4DK1A 1CSPA 3PF4A 3S15B 5E1FA 4JI2L 5CV6A 3OMGA 3ND9A 4WJ3M 4XDXA 2RDGA 2LSSA 1TKWB 1Y1WB 3TS2A 3CD6A 1P16A 5IYCH 4LFAQ 4JYAQ 1D6EC 4CDFC 3F2DA 2O5JC 2VW9A 1BKBA 1PVOA 4KKTA 4IJLA 2JA5B 3HP3A 1D5MC 1WTOA 3KJOA 1OO9B 1JCKB 2TSSA 1W3SA 1VQJA 4KD4A 1PV4A 2NTSA 5EBCA 2KQ3A 1HQMC 1HFNA 1PFNA 2O2LD 1HZ9A 5DLQE 5E7NA 3T53B 3J81L 1XPRA 5L37A 3UE0A 1F77A 1P8LA 2IT1A 3X3MA 2F0KA 5D3DA 1BOSA 4DUYL 1BVSA 1TS3A 2PYKA 1STGA 5M5XH 3HKZB 1QUQB 2C9OA 3HOVG 1TWFB 2IX0A 5ELOA 1MKHA 1TWGB 4UY8C 1EZ8A 3E0EA 3R2TA 3JAMi 4KN4C 2PCFB 3HOYG 1EU4A 3GTOB 3P7JA 1FL0A 2Q2TA 3VYUA 3MXUA 4KHVA 2PNRC 5IIFA 1HH2P 3I4NH 1SE8A 2A6HD 1CHPD 3TP5A 5HGQA 1N34Q 1WI5A 1PDQA 1HA5A 3OWEB 2RHSB 1SNOA 2KHIA 2KHSA 1WFQA 3KJPA 1I50H 1D5XC 1LT5D 4DAYB 2JEBI 4DV6L 1KABA 2K5QA 4K6LA 1QVCA 1HR0L 2R7ZH 3KYHC 2LXKA 4LUOA 2MFIA 1MD2D 2M00A 3CC7A 1BCPC 1E22A 1HJPA 3HZXA 1IYUA 1TR5A 4TVAB 4N9PA 4ALPA 2L12A 3VYRA 2I07B 1KRSA 1WD1A 1BCPF 2PQAB 4XYOA 2FHTA 3C46A 1WCMG 1NMGA 3HOXH 4K0KQ 5IWAL 4A3EH 1NSNS 3J7YW 1B8AA 3D31A 1L0WA 1HNXL 2F1MA 4DR6Q 2E74C 5GQOA 3PUZA 4DV0L 2EJMA 4JG2A 4A93H 4DR7L 1YJ9A 4H0LC 2C35B 4CJ0B 2E2JH 1Z6HA 1WJJA 3CPFA 4H13C 4MIUA 4BA1I 4K5WA 1EY8A 2QEXA 5EQ0A 1YHQA 1FD7D 1W6JA 3QR8A 3OW2A 5CV7A 5EKLA 1RDPD 1M1KC 3EFXD 5KNCA 1AP0A 5M3MB 3OIQA 1VCIA 2WACA 1C7YA 5ELNA 4LFCL 4MNOA 2JYOA 1HNZL 5IODA 3TN2A 2XWBB 1PH3A 1NTGA 3AEVA 2KBNA 5DM73 4OL7A 4QL5A 4UP8A 1I4RA 1JOOA 2NTTA 2NVQB 2LXJA 3L7ZC 1SN8A 3MA2B 3NE5B 4DNRB 4GNXC 3ERQA 4R4TA 3P20A 1I3QB 1KXLA 2Y0SE 3T56B 3RN2A 5GROA 1A62A 1T5EA 3ZJYC 2R6GA 2XRQD 1NBWA 2AUJD 4PQXA 1RKNA 3DXJC 3HOVH 5C3EG 2F0WA 4CKEA 1O7LA 1TS2A 2KEEA 1TT2A 1HTPA 3HOYH 5M5XB 1E1TA 1Q8KA 5CR3A 1L2FA 3S1MB 1EY4A 2UUAQ 2K5WA 1G2TA 3S14H 4OX9Q 1K28A 2PZUA 4DFAA 4LUVA 2RSNA 4AQYQ 1X56A 1K73C 3J80L 1X3PA 4PV1C 3M4OB 4YIJA 4JV5Q 1YNND 1KAWA 1UAPA 1XXGA 1GUTA 5IY0A 5EPLA 1GM5A 3I4LA 2E2DC 4NMZA 1HPCA 4CJ1B 5IGGA 4OIKA 1V8QA 2WIIB 1C9OA 2K04A 1CUKA 5GAHC 3V96A 2E75C 3J81c 4F7XA 1BBXC 1CSQA 4JI0Q 1HXYD 5COYA 4F8MA 4TSSA 2JQOA 2ALYB 3FPUB 5JJKA 1SLJA 2JK8A 2M2LA 4I65A 3I8ZA 5M3FG 4HSVA 2MNAA 3M4QA 1SROA 2Y0SB 3QO2A 4ZAIA 4LAAA 1VQ9A 3HFZB 4OONA 5C3XA 2G9HD 1L1OC 1OXXK 1WTPA 1GKHA 2E8GA 3DMUA 4YHHQ 1WCMH 1JJCB 1X3FA 1PRTC 4HR7B 5JOBA 3AFQA 5D14A 3HS0C 2F4IA 4BY1H 4FF3A 2F0PA 1ET9A 5CMDA 2HHHL 4K5XA 3DHQA 3FVQA 5FK9C 1JT8A 3SEBA 1V1QA 1UE6A 3HRZC 2N3SA 4JI2Q 1RTOA 1JE5A 2WKDA 1YHAA 1PZJD 1PH1A 1SE4A 4C1NK 1XJVA 1VQHA 2E2JB 1IL2A 3VYTA 4NW2A 5A35A 1PH5A 1SFOB 1V43A 2B2UC 4A3GG 4LMQD 4B3SQ 3A5UA 2EDGA 4UHVA 2HD3A 1A2UA 1ICFB 1V9PA 4GLAC 2EY2A 1QB5D 3CW2C 3DEPA 1XNQL 2L11A 1AH9A 4R9WA 1TWHB 1AW7A 5FKAC 3TP6A 3D4DA 3I3CA 2HQLA 1PXUA 2QA4A 4DV4L 2JA7G 3A7LA 1JICA 3H0GB 5IGDA 1SNMA 3CKIB 2QEJC 3FP9A 1EYGA 4FP5D 2V1CC 4OIJA 2UU9L 2CWAA 5M5YB 4G7OC 3M7GA 1H9MA 5C44H 4YWMA 1EY6A 3PQIA 2PI2A 3NP8A 2NVXB 1RCVD 4DNTB 4ZCKA 1TWAB 4R4QA 4ZLTF 1JOKA 3GTKH 4LF8L 5H1SE 2R92B 2SNSA 1ONLA 5E4WC 3K7AH 3URYA 2NN6G 1PYBA 4LFAL 5GAEC 3K5OA 4JYAL 2PMZE 1ASYA 2JA8B 4DV6Q 2NN6I 2F0JA 3AQQA 4DV3L 3K0XA 3S17B 1UE7A 2PI2E 1U0LA 1R4QB 4ME3A 3ONAB 4MZ9A 1N8RC 1TY2A 1HZBA 3S1NB 3PUYA 2KCTA 4GNXA 2JE6I 2LY7A 1GXDC 1LTAD 3ITPA 1Q12A 1HZAA 1FVIA 2UXCQ 1A3TA 1E2ZA 3ERSX 1PH6A 3RLOA 4A3KH 4ZQ3A 2XVSA 5JVH3 1EY5A 1SNDA 5IE8A 3PUWA 3Q8DA 5LMNW 1VQNA 4JBJA 3OYYA 5IWAQ 3TEHB 3SE0A 3HOUB 4JI5Q 4LFBQ 1J9OA 3NTIA 4KHZA 4NPSA 3OIPA 4RFBA 4A3LG 2RF4A 3J80c 4DV0Q 5BN4A 4DR7Q 1BCPB 4DR3L 3J81E 3BYYB 3SGIA 2LFNA 4RWSC 2DNCA 3RZOH 4PZ7A 2MO0A 1YZ6A 5J3BA 2X6LA 3D4WA 1OXTA 4UP9A 2PMZB 1AEXA 3IKJA 4POGA 2BH8A 4GOPC 1ZYRC 4M1UB 4V190 3E6ZX 1QWYA 3N52A 4A3FH 4LFCQ 1K9MC 1HNZQ 3GTQB 3BDLA 2A68C 2VUMB 1B2TA 3F2BA 4QQBX 2B63B 1JWSD 3CXCA 3Q24A 3EJIA 4JI7L 1WOCA 4XTCS 4I7ZC 1VDZA 1B53A 2DJGC 3H91A 1T9HA 4DKAC 2JA7H 1F2LA 1VQPA 1SNQA 3FRPB 3KF6A 1B70B 3TP8A 4WRDA 2ZJQA 3CRLC 2QDLA 1PFBA 1AE2A 2N55A 1EIGA 1PA6A 4DPGA 4K0KL 2E2IB 2CVRA 2FFKB 4QGUA 2L55A 1KLGD 1KAAA 1SYCA 3S15H 3TP7A 4DN4M 2EYFA 4J6HA 4DR6L 1FR3A 3CCEA 2KJXA 1SNPA 4KI0A 1STEA 3KK7A 1WTRA 4GNXB 2Q2HA 1Y1WH 1EWIA 1VQCA 5C5MA 3NXWA 1C8CA 1EZ6A 2XWJB 5M3MG 3EROA 3E0JA 4LF9Q 1MBYA 1LTID 2NN6H 3K57A 2JA5H 5KGUA 3S1RB 1KTKA 2R93B 1PTOD 3G6JB 4K8JA 4X3SA 4P71A 3IL8A 1OXSC 1L0XB 1EYCA 2ZJPA 2DNEA 2A6EC 1G2SA 2O5IC 1PFMA 2K28A 3FDTA 4XT1B 4FF1A 1JORA 1RD9D 4LWCA 4B3RL 3PMFA 4RHSA 3QB3A 1BO0A 4A3BB 4HTHA 1KNEA 1TWFH 5K5PA 1TWGH 2B8FA 3C1EA 4YCWA 5JVG3 1IW7C 2ATWA 4IPCA 4KKUA 3SK4A 1HUMA 4K8IA 3KBGA 1ML0D 3GTOH 1Y14B 1DJRD 3T51B 2A5HA 4ZRZA 4E6IA 3WOEA 5FLXc 4OWWB 5ELFA 5NUCA 4DXFA 2PZWA 2HHHQ 4DR4L 4J8QA 2IY5B 4DV5Q 4BXXG 4RCNA 4A3LH 4XXEA 5C3WA 3M3YB 3PO3B 1JOQA 1NY4A 3I4NG 2UUAL 4BBSB 2F0GA 1BR9A 3KF6B 3RLFA 1G8ZD 1PH2A 3DWQA 5KYIA 4JV5L 4KY5A 2VZAA 2MJ8A 1E0BA 2OEOA 2F03A 2CCZA 2HDMA 3U50C 4U68A 3NQTA 1XNQQ 1O7IA 2IPKD 4IUQA 4DV2L 1CA6A 4DK0A 1H9KA 1SDFA 3M7NA 4C2MB 3CCMA 4DV4Q 3JAMc 1K8OA 2WP8J 2F3IA 2E2HB 4IJHA 1QJOA 2NZOA 1C0AA 2WFWA 1EY9A 3MTSA 4PMBA 1IBMQ 3A55A 1B44D 3MAQA 4X6AH 4DUZL 2BOSA 4CJ2C 4YHHL 4OWTB 3HKZE 1GHJA 2B3GA 5F2DA 4A93G 5EPKA 1PLFA 1VQ4A 2FXQA 1TVXA 2IW3A 1FYCA 3U9OA 2A6HC 2EYJA 4LF8Q 4HJ9A 1K8GA 1NAPA 1U5KA 2Z6KC 2NZHA 3NTKA 5M3MH 1ASZA 3K6OA 1EL0A 1GD7A 4GOPA 3K80C 1QILA 4J15A 4DA2A 2ZXRA 1J8IA 2KA7A 4HJ7A 2PQAA 4LK1C 4A3DB 4P74A 4B3SL 3J7ZC 4KD3A 4Y52H 3IAYA 3H0GG 3TDQA 4YY3Q 4DV3Q 2NVQH 2Z8LA 1WD0A 2PW7A 5IGEA 2B29A 1I3QH 1DGSA 4CBVA 4IUPA 2QDBA 4G7ZC 1PZKD 2I46A 1II3A 5FLMH 2N78A 1KDBA 4PMCA 3CP0A 3CRKC 2BE5D 3S24A 3I70A 3I4MB 4CKBA 1EQQA 1LT6D 5HY6A 5EKIA 4N9TA 3S1MH 4BY7B 5CV4A 4G57A 2D2CC 1EIYB 4OHJA 5CBAE 3R3OA 3M4OH 4BXXH 4DR3Q 3A0JA 1SAPA 4EQNA 1TY0A 2JA8G 1AZPA 4FXKC 4A3CH 1G91A 4HCEA 1EUJA 4JK1C 3RD4A 1XPUA 4A4IA 2X6GA 5KYLA 3H15A 3V05A 5JEAH 2VXWA 1U9RA 2QILA 1SNCA 4UDUC 3K7UC 2A73B 2RKSA 3RZDB 5K36G 4FO2A 4LF4L 3VR4A 5FLXE 1VMPA 4XQQA 4JI7Q 1D1KA 1QZGA 4YCVA 1I6VC 2UXCL 3AFPA 1WTVA 2EY5A 2NWGA 4GOPB 1HQRD 4B3TQ 4KLKA 2Q2IA 1D8LA 1B9NA 3EIVA 3DWAA 3ULJA 2K33A 1LUZA 1CKMA 4HIMA 1ENFA 4BY1G 4P73A 4JI5L 2NZ1D 4LFBL 2PZTA 2SOBA 2HCIA 3L9AX 4IQZA 1YJWA 2K75A 1RL2A 4BBRB 4MTNA 2NVTB 2OQ0A 4L63B 1JB7A 4RAUC 3PUVA 1SFOH 1LTRD 5I6YA 3BVZA 1KRTA 1YNNC 4G7HC 3JAME 1EOTA 1GUGA 2CH4W 3TSSA 4IZ8A 2CHBD 1MIUA 2Q8RE 1KD1C 5IGBA 2VUMG 3NELA 1TWHH 2B63G 1NE3A 4IO9A 1HA6A 4X66L 2YU9B 1Q1BA 1YEZA 2EYHA 2AWNA 1KDAA 4JCVE 1Z47A 4PZ6A 2KENA 3H0GH 1H9SA 3SVMA 4RGTA 4POFA 1G6PA 3CCJA 1E2VA 4KHPQ 1OXVA 1A3VA 5M5YH 1W6KA 4ODGA 4B3RQ 4LW1A 1UEBA 1A3UA 1O7ZA 2ENBA 2EY6A 2DGYA 3EA6A 2F0IA 4HSPA 4RGNA 2NVXH 1C4QA 1LM0A 4DXGA 3BU2A 5C44G 2EXDA 3NSWA 2FMCA 1SMYD 1TWAH 3A8IE 1XTCD 2D0OA 2I0QA 2N8NA 2RA4A 4L5TA 2L5TA 2R92H 3ICEA 4DR4Q 2WAQG 1EOVA 4KN7C 3DLLA 3KUPA 2EJFC 4X64Q 4NXMQ 1O78A 2EY1A 2KOLA 3BDOA 2JA8H 2KUMA 4R8IA 4LF9L 3CMAA 1H9RA 3U58A 2F0OA 1STYA 2VL6A 3S17H 1H95A 4TQUS 4DAVA 4LUZA 1Q3LA 2MHVA 4LJZC 2F0UA 4P72A 5HGTA 3PUXA 4YWLA 1NJIC 5IT9c 3S1NH 1TWCB 1WTXA 4PZ8A 3K0YA 1HR0W 1Y8NB 4KY7A 5EAYA 3H3VI 4U673 3UDXA 4DV2Q 5K36H 2X69A 1I4HA 1I4PA 3I2ZA 3NK9A 5IGCA 4IPDA 4S3SA 1YJNA 4A3KG 1DONA 1UNSA 3I4OA 2PPBC 3S1QB 1IKMA 1SYGA 5FOBB 1K3RA 5T1IA 3GTPB 3HOUH 3A7AB 4HJ5A 3G71A 3CCRA 2UXBQ 2ZTEA 4DUZQ 4KJNA 1K0SA 3PO3G 4O2DA 1RIPA 4FF2A 4BBSG 1H9SB 3F2CA 3SK5A 1Z9FA 1RF2D 3D0FA 1HNWQ 1VQEA 5CC4A 4DAMA 4DV5L 1HFGA 1VQOA 1PRTF 1SR3A 1Y69U 2VS1A 4C3JB 3A74A 5FO8B 4C1NI 2AQ3B 1WTHA 5JAVA 4RKLA 5CV9A 1EY7A 3PCOB 1FNVA 1Q82C 1UEAB 1EYAA 1D7QA 4ILWA 5LMNL 5LMUL 3GTQH 2EZVA 2VUMH 1CZWA 3O13A 2NYZD 4GZYC 4K2LA 2B63H 3OSOA 2IWHA 5EJWA 5FO9B 4A3FG 5A2QE 2AKWB 4XQNA 3QOJA 1PZID 4DR2L 3OTOL 1MJEA 2IL8A 1LLRD 1QZHA 3GTJB 3Q6SA 1GOZA 4GS3A 1XMQQ 1Y8PB 4KY6A 5LL6X 2GN5A 3S2HB 1IBML 2E2IH 1SJED 1KC8C 3TRZA 5C4XB 2ZTCA 2J0TD 1CZGA 3I91A 3GV6A 3ULPA 3MC0B 2EPBA 3G48A 5KNDA 1FGUA 1R9TB 1Y1VB 3J81j 1TIID 1XYIA 3KLSX 1LT3D 4QMGA 1EQVA 4G4KA 1Y1WG 3KDFA 1SSOA 5DEHA 2N49A 5FLXL 5JJLA 4JVZA 2G9DA 2B39A 2OT2A 5G3LF 3S1RH 4A3DG 4EVOA 3GDEA 1YI2A 3J81i 1X65A 1VQLA 2R93H 1GUWA 1ET6A 3CHBD 4JBWA 3H09A 5IP9G 1BXTA 2JA5G 2HCCA 3DM3A 1D1IA 2B2YC 2R3ZA 4OEMB 5C4JB 4XIGS 3S9WA 3H3VH 1I6HB 3S16B 4O0AA 1ZEQX 1F9PA 4YY3L 1W2BA 4EQ5A 3CPWA 4LF4Q 2ICEC 3PIPA 3BDCA 1JR0D
chains in the Genus database with same CATH topology
1QUQB 4A3BH 3HOVG 3ULLA 1HNWQ 1TWFH 2IX0A 5ELOA 1MKHA 1TWGH 4UY8C 4YCWA 2ATWA 3E0EA 4IPCA 1GO3E 3E9IA 3JAMi 3GO5A 2F52A 2NVYH 3HOYG 3CQZH 3I4MG 3HKZG 4A75A 4L5QA 1G51A 4A3BG 2I5HA 1VQFA 2XGTA 4A3IH 3GTOH 1Y14B 4A3JG 1PHJA 1N36L 1FL0A 5FLXc 1IBLL 2Q2TA 1CKNA 1PH4A 4OWWB 1AE3A 5IYDH 2KHJA 5BR8L 1HH2P 3I4NH 1SE8A 1IBKL 2HHHQ 5HGQA 1N34Q 4DR4L 1WI5A 4DV5Q 2IY5B 4BXXG 4A3LH 1IYJB 3M3YH 3PO3H 3GD7A 2RHSB 2K52A 1NY4A 1YHBA 1WFQA 2KHIA 3KJPA 2VQFL 2UUAL 3BZCA 2ASBA 3I4NG 4BBSH 1E7ZA 1I50H 3KF6B 3RLFA 4DAYB 2CQOA 2JEBI 1EIFA 4DV6L 4RMFA 3RNUA 4JI3Q 3J7A5 3B6YA 1PH2A 3GTMH 4JV5L 2VZAA 1VQ8A 4B3ML 3STBC 1YIJA 1S3OA 2RCNA 4DV7Q 1VQGA 4LF6Q 4AH6A 1Q46A 1QVCA 2QGQA 1HR0L 2R7ZH 3T1HQ 2CCZA 3KYHC 4JI4Q 2LXKA 3U50C 4C3IH 4LUOA 2MFIA 2F4VL 1XNQQ 1X54A 3GTGH 2R7FA 5IP7H 3CC7A 5GAGC 1O7IA 4DV2L 1E22A 1BBUA 1HJPA 4TVAB 4X66Q 4ALPA 5JJKA 5M5WH 2VY3A 4PMWA 4C2MH 3CCMA 3M7NA 2K4KA 4DV4Q 4FDBA 5IP7G 3JAMc 1XMOQ 2WP8J 1KRSA 2K5NA 2F3IA 1KIXA 4IJHA 2E2HH 2PQAB 2A1AA 2NZOA 5IYBG 1C0AA 4GKKQ 1WCMG 2WFWA 3KDFB 3I55A 1NMGA 3HOXH 1IBMQ 4K0KQ 5IWAL 4A3EH 2JA9A 1B8AA 3D31A 1L0WA 3W5OA 1HNXL 4DR6Q 2K14A 1G291 3CCSA 4PG3A 5GQOA 2UXDL 4X6AH 4UPAA 4DUZL 2GVAA 3PUZA 4YHHL 4DV0L 4JG2A 4DNIA 4A93H 4DR7L 1YJ9A 3W1BA 4OWTB 2E2JH 2C35B 3HKZE 1L1OA 1EQRA 3ER0A 1KQSA 4B3TL 1WJJA 2B3GA 1A0IA 3I7FA 1PFSA 3CPFA 3LGJA 4BBRG 4A93G 3EN2A 4P75A 4BA1I 4NB3A 1VQ4A 2QEXA 2FXQA 3M9BA 3HOWH 2OCEA 1YHQA 3OW2A 2IHFA 4LF8Q 3UE1A 4HJ9A 1K8GA 1U5KA 2Z6KC 4JI6L 1M1KC 2NZHA 4IPHA 2YTYA 4R4IA 5M3MH 2IX1A 1GVPA 2YTVA 1ASZA 2HT1A 1VCIA 2L15A 1GD7A 1C7YA 4GOPA 5ELNA 2D62A 3RN5A 3K80C 2GVBA 4MNOA 4LFCL 2Z0SA 4J15A 1HNZL 1FJGL 1XNRQ 2JJQA 4X65L 1VQ6A 3RR5A 3STBD 1Q86C 3PSIA 4HJ7A 2PQAA 3PF5A 4A3DH 4P74A 3BJUA 4B3SL 1PH3A 1NTGA 3J7ZC 2UUBQ 3AEVA 4Y52H 2KBNA 4QY7A 1CKNB 4QL5A 4UP8A 3H0GG 4Y7NH 4DV3Q 4YY3Q 4DUYQ 2NVQH 5IP9H 2LXJA 3L7ZC 1SN8A 4DV1L 4QIWE 2JA6G 4GNXC 5AJ3L 2B29A 4R4TA 3T1YL 1I3QH 1DGSA 4AYBG 3CCUA 4A3MH 1PH7A 3GTLH 2YV5A 3S2DH 1KXLA 1OTCA 2Y0SE 3RN2A 5C3EH 2HIVA 4DR5L 5GROA 1A62A 4HIOA 3NBHB 5FLMH 1YNXA 2N78A 2R6GA 3ZJYC 3AYHB 3BZKA 1NBWA 3CP0A 1I94Q 4DK6C 4GN3B 3HOVH 4DK3C 5C3EG 2DUDA 4KHPL 1NMFA 4LF5L 3A5ZB 1VQKA 3S24A 5FLMG 3I4MH 4WJ4A 5BR8Q 1EQQA 3HOYH 1IBKQ 1E1TA 1Q8KA 2CFMA 1N32L 5HY6A 3CC4A 3J80i 4A3JH 1L2FA 3F8TA 3S1MH 4BY7H 2ZM6L 2UUAQ 4LF7L 3S14H 4OX9Q 1KL9A 2YTXA 1EIYB 5FJ8G 4LUVA 5C0XG 4AQYQ 1X56A 2XTIA 1K73C 2CWPA 4APVA 4JOIC 2VQEL 3M4OH 1VQBA 4BY7G 4BXXH 4JV5Q 1IZ6A 3JC66 4DR3Q 3A0JA 1KAWA 4B3MQ 5C0XJ 4JI1L 3WWVA 4GLXA 2JA8G 5C0XI 3CCQA 1VQ5A 2A8VA 1HZCA 5IY0A 1GM5A 1HR0Q 4A3CH 4A76A 2ES2A 1EUJA 1XPUA 4A4IA 1C9OA 1LTLA 1CUKA 5GAHC 2F4VQ 3H15A 3MXNB 1I5FA 2BH2A 3L2PA 2HIXA 4X64L 3J81c 4NXML 5M3FH 4A3CG 2E5LL 3CC2A 1CSQA 2A19A 4JI0Q 1MJCA 1S40A 1J5EL 1Q1EA 1XTDA 2ALYB 2JQOA 1KHIA 3K7UC 2UUCL 1QVGA 1L1OB 1SLJA 2IHEA 2JK8A 4EX5A 3PIOA 5LMNQ 5JEAG 1OXUA 5LMUQ 3RZDH 1Q7YC 5M3FG 5K36G 4YWKA 2MNAA 4LF4L 3M4QA 4UP7A 1SROA 5JEAJ 3RLNA 1X3EA 1VQ9A 4JI7Q 3HFZB 1QZGA 4OONA 1HNXQ 4YCVA 2Y0SG 4R4CA 2UXCL 3AFPA 1E3PA 1L1OC 1OXXK 1GKHA 4JBMA 4DR2Q 2E8GA 3OTOQ 4IOAA 2UXDQ 4AYBE 2D0PA 4GKJQ 5IYBH 2H5XA 4YHHQ 3L0OA 1WCMH 1JJCB 4GN4B 3G6EA 1X3FA 4GOPB 2RHQB 3AFQA 4B3TQ 4NXNL 3CMEA 4KLKA 2Q2IA 4BY1H 1D8LA 1X55A 3HKSA 2HHHL 1N34L 1JT8A 3EIVA 3ULJA 1LUZA 1CKMA 1V1QA 4HIMA 4BY1G 4P73A 4JI5L 1UE6A 2AHOB 4LFBL 2EIFA 1YJWA 2N3SA 2WAQE 2K75A 4JI2Q 2UXBL 1JE5A 1YHAA 1RL2A 3KOJA 4RG1A 4BBRH 1PH1A 4MTNA 4A3GH 2NVTH 1K0RA 2OQ0A 1XJVA 1VQHA 1IL2A 1JB7A 2MO1A 3PUVA 1PH5A 1SFOH 1V43A 1YBYA 4DV7L 4A3GG 1HNWL 1KRTA 2BA0A 4B3SQ 3A5UA 4JI4L 1IXRA 3PGZA 4LNQA 1V9PA 3CW2C 4GLAC 3CCVA 2PNHA 3CF5A 1XNQL 1MIUA 1KD1C 1AH9A 1VQDA 2VUMG 1Q81C 2OTJA 3PO2G 3NELA 1TWHH 4DV1Q 4JI8L 1N33Q 4BA2I 2B63G 1NE3A 4IO9A 3K81C 2HQLA 4L5RC 3KF8B 4X66L 2YU9H 3T1YQ 1Q1BA 1YEZA 2QA4A 2AWNA 4DV4L 3K8AA 4JCVE 1Z47A 4PZ6A 2KENA 4DR5Q 3H0GH 2JA7G 5JJIA 1BBWA 2JA6H 2I5LX 1EYGA 3FP9A 3NENA 4GKKL 1CKOA 4POFA 2V1CC 1G6PA 1WYDA 2UU9L 3CCJA 4OO1G 4KHPQ 2CWAA 1JMCA 1OXVA 5M5YH 4B3RQ 1E1OA 4LW1A 1UEBA 5C44H 2DGYA 1N32Q 4YWMA 5C4XG 2PI2A 4OO1I 2NVXH 4AIMA 3CCLA 1LM0A 4X62L 3BU2A 2K5HA 5C44G 1XMQL 4LF7Q 2EXDA 3FKIH 4HIDA 1TWAH 1Y1VG 3E9HA 4R4QA 1S72A 1VQAA 1N36Q 1JJ2A 1QVFA 5IYCG 2D0OA 3CAMA 1IBLQ 2I0QA 2N8NA 1EFWA 4L5TA 3GTKH 3FKIG 5H1SE 4LF8L 2R92H 3ICEA 3K7AH 4DR4Q 2WAQG 1EOVA 5FJ8H 2AMCB 3DLLA 2NN6G 4IPGA 2CKZB 3UDFA 2R92G 3U4ZA 1PYBA 4LFAL 2VQFQ 1SRUA 4L5SA 5GAEC 4JYAL 4X64Q 2PMZE 4NXMQ 1X6OA 1ASYA 2JA8H 4DV6Q 2VNUD 5GADC 2NN6I 1J5EQ 2ID0A 3CMAA 3U58A 4LF9L 2UUBL 2K50A 3KFUA 2VL6A 3AQQA 1A8VA 3F1ZA 4DV3L 3K0XA 3S17H 1UE7A 2PI2E 3EBEA 1H95A 1VQMA 1VS0A 1U0LA 2OQKA 4TQUS 2ZJRA 3MEFA 4LUZA 4ME3A 4MZ9A 3UDIA 1N8RC 1VQ7A 1YVCA 1HZBA 4P72A 3PUXA 4YWLA 1NJIC 3PUYA 5IT9c 2AWOA 2KCTA 3S1NH 4GNXA 1TWCH 2JE6I 4PZ8A 1PYSB 1HR0W 1Q12A 1HZAA 1FVIA 2MQHA 2WB1G 4YCUA 2UXCQ 3ERSX 4H02A 5EAYA 3UDXA 1SMXA 4R1JA 4DV2Q 3NEMA 3PV0A 1PH6A 2Q2UA 3RLOA 4DR1L 4GLVB 4A3KH 1I94L 2OWOA 2JEAI 4HJ8A 3I2ZA 1PH9A 2YYZA 3U4VA 1K83H 5IE8A 3TS0A 4NXNQ 1UWVA 4IPDA 4A3IG 4A3KG 3PUWA 1YJNA 3Q8DA 2ZTDA 5LMNW 1VQNA 3I4OA 4JBJA 3OYYA 2EQSA 3UDGA 3S1QH 5IWAQ 1K3RA 3TEHB 5IYDG 3GTPH 3HOUH 4JI5Q 1B7YB 4LFBQ 1UE5A 4HJ5A 4KHZA 4NPSA 3G71A 3CCRA 4OX9L 2UXBQ 2ZTEA 4DUZQ 1X9NA 1N9WA 2R7DA 4AQYL 4A3LG 2RF4A 3J80c 3G4SA 4DV0Q 3PO3G 3HOZH 4O2DA 3HOUG 3W1GA 4DR7Q 4DR3L 1RIPA 4R4OA 4BBSG 3F2CA 3SGIA 1Z9FA 3RZOH 3D0FA 1VQIA 4PZ7A 1VQEA 2MO0A 4JOIA 1YZ6A 4DAMA 3IRBA 5J3BA 4DV5L 4IOCA 3HOZG 1OXTA 1QUQA 4UP9A 1VQOA 1SR3A 2VS1A 4C3JH 3A74A 4POGA 1J6QA 4OWXB 2BH8A 2KCMA 4GOPC 4JC0A 2R7ZG 4JI8Q 4JI6Q 4JI0L 3PCOB 4JI3L 1X3GA 3VDYA 1Q82C 4C3HH 1D7QA 5LMNL 5LMUL 4A3FH 1YITA 1K9MC 4LFCQ 1HNZQ 1PH8A 3GTQH 4X65Q 2VUMH 4LF6L 3PO2H 1A63A 3T1HL 3F2BA 4QQBX 2K5VA 3CXCA 2B63H 4A3FG 2UU9Q 1LYLA 2AKWB 4GN5A 4HIKA 3M4PA 4JI7L 1WOCA 4XTCS 3TREA 4DKAC 2BA1A 2JA7H 1T9HA 5AJ3Q 1VQPA 4DR2L 3OTOL 1XPOA 3HOXG 1MJEA 3KF6A 1B70B 1QZHA 4A3EG 4GKJL 3GTJH 2ZJQA 4JBKA 2WB1E 1XMOL 1M90C 3M85A 4X62Q 4GS3A 4OXPA 1XMQQ 2I5MX 1AE2A 1PA6A 2GN5A 2OTLA 4DPGA 1IBML 3S2HH 2E2IH 1KC8C 3H3VI 3TRZA 5C4XH 4K0KL 2ZTCA 3KLWA 4QGUA 1CSPA 4LF5Q 3PF4A 3ULPA 4DR6L 3S15H 1JJGA 4JI2L 3CCEA 3HOWG 4KI0A 3G48A 4WJ3M 1FGUA 4HJAA 2LSSA 4GNXB 1R9TH 2Q2HA 1UE1A 1Y1VH 1Y1WH 3CD6A 1P16A 3TS2A 1EWIA 2ZM6Q 5IYCH 4LFAQ 1VQCA 3J81j 4JYAQ 3F2DA 3FHWA 2VW9A 5M3MG 1BKBA 1Y1WG 1K8AC 2VQEQ 4LF9Q 1PVOA 3KDFA 2N49A 5JJLA 4QJFA 4IJLA 2JA5H 4JI1Q 4IFDG 3S1RH 4A3DG 1N33L 3GDEA 3KJOA 3J81i 1YI2A 1X65A 1VQLA 1W3SA 2R93H 1VQJA 1FJGQ 1PV4A 4JBWA 4IFDJ 4P71A 1OXSC 5IP9G 2JA5G 1XNRL 2Z6KA 5DLQE 1HZ9A 5E7NA 4IFDI 3DM3A 2R93G 1XPRA 2E5LQ 2ZJPA 5C4JH 1TXYA 4XIGS 3UE0A 1P8LA 2IT1A 4DR1Q 4A3MG 2UUCQ 3H3VH 1I6HH 3S16H 4O0AA 3TQYA 4YY3L 4DUYL 1BVSA 4EQ5A 1W2BA 3CPWA 4LF4Q 4LWCA 3I56A 4B3RL 1E24A 3PIPA 5M5XH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QUQ B;  4A3B H;  3HOV G;  3ULL A;  1HNW Q;  1TWF H;  2IX0 A;  5ELO A;  1MKH A;  1TWG H;  4UY8 C;  4YCW A;  2ATW A;  3E0E A;  4IPC A;  1GO3 E;  3E9I A;  3JAM i;  3GO5 A;  2F52 A;  2NVY H;  3HOY G;  3CQZ H;  3I4M G;  3HKZ G;  4A75 A;  4L5Q A;  1G51 A;  4A3B G;  2I5H A;  1VQF A;  2XGT A;  4A3I H;  3GTO H;  1Y14 B;  4A3J G;  1PHJ A;  1N36 L;  1FL0 A;  5FLX c;  1IBL L;  2Q2T A;  1CKN A;  1PH4 A;  4OWW B;  1AE3 A;  5IYD H;  2KHJ A;  5BR8 L;  1HH2 P;  3I4N H;  1SE8 A;  1IBK L;  2HHH Q;  5HGQ A;  1N34 Q;  4DR4 L;  1WI5 A;  4DV5 Q;  2IY5 B;  4BXX G;  4A3L H;  1IYJ B;  3M3Y H;  3PO3 H;  3GD7 A;  2RHS B;  2K52 A;  1NY4 A;  1YHB A;  1WFQ A;  2KHI A;  3KJP A;  2VQF L;  2UUA L;  3BZC A;  2ASB A;  3I4N G;  4BBS H;  1E7Z A;  1I50 H;  3KF6 B;  3RLF A;  4DAY B;  2CQO A;  2JEB I;  1EIF A;  4DV6 L;  4RMF A;  3RNU A;  4JI3 Q;  3J7A 5;  3B6Y A;  1PH2 A;  3GTM H;  4JV5 L;  2VZA A;  1VQ8 A;  4B3M L;  3STB C;  1YIJ A;  1S3O A;  2RCN A;  4DV7 Q;  1VQG A;  4LF6 Q;  4AH6 A;  1Q46 A;  1QVC A;  2QGQ A;  1HR0 L;  2R7Z H;  3T1H Q;  2CCZ A;  3KYH C;  4JI4 Q;  2LXK A;  3U50 C;  4C3I H;  4LUO A;  2MFI A;  2F4V L;  1XNQ Q;  1X54 A;  3GTG H;  2R7F A;  5IP7 H;  3CC7 A;  5GAG C;  1O7I A;  4DV2 L;  1E22 A;  1BBU A;  1HJP A;  4TVA B;  4X66 Q;  4ALP A;  5JJK A;  5M5W H;  2VY3 A;  4PMW A;  4C2M H;  3CCM A;  3M7N A;  2K4K A;  4DV4 Q;  4FDB A;  5IP7 G;  3JAM c;  1XMO Q;  2WP8 J;  1KRS A;  2K5N A;  2F3I A;  1KIX A;  4IJH A;  2E2H H;  2PQA B;  2A1A A;  2NZO A;  5IYB G;  1C0A A;  4GKK Q;  1WCM G;  2WFW A;  3KDF B;  3I55 A;  1NMG A;  3HOX H;  1IBM Q;  4K0K Q;  5IWA L;  4A3E H;  2JA9 A;  1B8A A;  3D31 A;  1L0W A;  3W5O A;  1HNX L;  4DR6 Q;  2K14 A;  1G29 1;  3CCS A;  4PG3 A;  5GQO A;  2UXD L;  4X6A H;  4UPA A;  4DUZ L;  2GVA A;  3PUZ A;  4YHH L;  4DV0 L;  4JG2 A;  4DNI A;  4A93 H;  4DR7 L;  1YJ9 A;  3W1B A;  4OWT B;  2E2J H;  2C35 B;  3HKZ E;  1L1O A;  1EQR A;  3ER0 A;  1KQS A;  4B3T L;  1WJJ A;  2B3G A;  1A0I A;  3I7F A;  1PFS A;  3CPF A;  3LGJ A;  4BBR G;  4A93 G;  3EN2 A;  4P75 A;  4BA1 I;  4NB3 A;  1VQ4 A;  2QEX A;  2FXQ A;  3M9B A;  3HOW H;  2OCE A;  1YHQ A;  3OW2 A;  2IHF A;  4LF8 Q;  3UE1 A;  4HJ9 A;  1K8G A;  1U5K A;  2Z6K C;  4JI6 L;  1M1K C;  2NZH A;  4IPH A;  2YTY A;  4R4I A;  5M3M H;  2IX1 A;  1GVP A;  2YTV A;  1ASZ A;  2HT1 A;  1VCI A;  2L15 A;  1GD7 A;  1C7Y A;  4GOP A;  5ELN A;  2D62 A;  3RN5 A;  3K80 C;  2GVB A;  4MNO A;  4LFC L;  2Z0S A;  4J15 A;  1HNZ L;  1FJG L;  1XNR Q;  2JJQ A;  4X65 L;  1VQ6 A;  3RR5 A;  3STB D;  1Q86 C;  3PSI A;  4HJ7 A;  2PQA A;  3PF5 A;  4A3D H;  4P74 A;  3BJU A;  4B3S L;  1PH3 A;  1NTG A;  3J7Z C;  2UUB Q;  3AEV A;  4Y52 H;  2KBN A;  4QY7 A;  1CKN B;  4QL5 A;  4UP8 A;  3H0G G;  4Y7N H;  4DV3 Q;  4YY3 Q;  4DUY Q;  2NVQ H;  5IP9 H;  2LXJ A;  3L7Z C;  1SN8 A;  4DV1 L;  4QIW E;  2JA6 G;  4GNX C;  5AJ3 L;  2B29 A;  4R4T A;  3T1Y L;  1I3Q H;  1DGS A;  4AYB G;  3CCU A;  4A3M H;  1PH7 A;  3GTL H;  2YV5 A;  3S2D H;  1KXL A;  1OTC A;  2Y0S E;  3RN2 A;  5C3E H;  2HIV A;  4DR5 L;  5GRO A;  1A62 A;  4HIO A;  3NBH B;  5FLM H;  1YNX A;  2N78 A;  2R6G A;  3ZJY C;  3AYH B;  3BZK A;  1NBW A;  3CP0 A;  1I94 Q;  4DK6 C;  4GN3 B;  3HOV H;  4DK3 C;  5C3E G;  2DUD A;  4KHP L;  1NMF A;  4LF5 L;  3A5Z B;  1VQK A;  3S24 A;  5FLM G;  3I4M H;  4WJ4 A;  5BR8 Q;  1EQQ A;  3HOY H;  1IBK Q;  1E1T A;  1Q8K A;  2CFM A;  1N32 L;  5HY6 A;  3CC4 A;  3J80 i;  4A3J H;  1L2F A;  3F8T A;  3S1M H;  4BY7 H;  2ZM6 L;  2UUA Q;  4LF7 L;  3S14 H;  4OX9 Q;  1KL9 A;  2YTX A;  1EIY B;  5FJ8 G;  4LUV A;  5C0X G;  4AQY Q;  1X56 A;  2XTI A;  1K73 C;  2CWP A;  4APV A;  4JOI C;  2VQE L;  3M4O H;  1VQB A;  4BY7 G;  4BXX H;  4JV5 Q;  1IZ6 A;  3JC6 6;  4DR3 Q;  3A0J A;  1KAW A;  4B3M Q;  5C0X J;  4JI1 L;  3WWV A;  4GLX A;  2JA8 G;  5C0X I;  3CCQ A;  1VQ5 A;  2A8V A;  1HZC A;  5IY0 A;  1GM5 A;  1HR0 Q;  4A3C H;  4A76 A;  2ES2 A;  1EUJ A;  1XPU A;  4A4I A;  1C9O A;  1LTL A;  1CUK A;  5GAH C;  2F4V Q;  3H15 A;  3MXN B;  1I5F A;  2BH2 A;  3L2P A;  2HIX A;  4X64 L;  3J81 c;  4NXM L;  5M3F H;  4A3C G;  2E5L L;  3CC2 A;  1CSQ A;  2A19 A;  4JI0 Q;  1MJC A;  1S40 A;  1J5E L;  1Q1E A;  1XTD A;  2ALY B;  2JQO A;  1KHI A;  3K7U C;  2UUC L;  1QVG A;  1L1O B;  1SLJ A;  2IHE A;  2JK8 A;  4EX5 A;  3PIO A;  5LMN Q;  5JEA G;  1OXU A;  5LMU Q;  3RZD H;  1Q7Y C;  5M3F G;  5K36 G;  4YWK A;  2MNA A;  4LF4 L;  3M4Q A;  4UP7 A;  1SRO A;  5JEA J;  3RLN A;  1X3E A;  1VQ9 A;  4JI7 Q;  3HFZ B;  1QZG A;  4OON A;  1HNX Q;  4YCV A;  2Y0S G;  4R4C A;  2UXC L;  3AFP A;  1E3P A;  1L1O C;  1OXX K;  1GKH A;  4JBM A;  4DR2 Q;  2E8G A;  3OTO Q;  4IOA A;  2UXD Q;  4AYB E;  2D0P A;  4GKJ Q;  5IYB H;  2H5X A;  4YHH Q;  3L0O A;  1WCM H;  1JJC B;  4GN4 B;  3G6E A;  1X3F A;  4GOP B;  2RHQ B;  3AFQ A;  4B3T Q;  4NXN L;  3CME A;  4KLK A;  2Q2I A;  4BY1 H;  1D8L A;  1X55 A;  3HKS A;  2HHH L;  1N34 L;  1JT8 A;  3EIV A;  3ULJ A;  1LUZ A;  1CKM A;  1V1Q A;  4HIM A;  4BY1 G;  4P73 A;  4JI5 L;  1UE6 A;  2AHO B;  4LFB L;  2EIF A;  1YJW A;  2N3S A;  2WAQ E;  2K75 A;  4JI2 Q;  2UXB L;  1JE5 A;  1YHA A;  1RL2 A;  3KOJ A;  4RG1 A;  4BBR H;  1PH1 A;  4MTN A;  4A3G H;  2NVT H;  1K0R A;  2OQ0 A;  1XJV A;  1VQH A;  1IL2 A;  1JB7 A;  2MO1 A;  3PUV A;  1PH5 A;  1SFO H;  1V43 A;  1YBY A;  4DV7 L;  4A3G G;  1HNW L;  1KRT A;  2BA0 A;  4B3S Q;  3A5U A;  4JI4 L;  1IXR A;  3PGZ A;  4LNQ A;  1V9P A;  3CW2 C;  4GLA C;  3CCV A;  2PNH A;  3CF5 A;  1XNQ L;  1MIU A;  1KD1 C;  1AH9 A;  1VQD A;  2VUM G;  1Q81 C;  2OTJ A;  3PO2 G;  3NEL A;  1TWH H;  4DV1 Q;  4JI8 L;  1N33 Q;  4BA2 I;  2B63 G;  1NE3 A;  4IO9 A;  3K81 C;  2HQL A;  4L5R C;  3KF8 B;  4X66 L;  2YU9 H;  3T1Y Q;  1Q1B A;  1YEZ A;  2QA4 A;  2AWN A;  4DV4 L;  3K8A A;  4JCV E;  1Z47 A;  4PZ6 A;  2KEN A;  4DR5 Q;  3H0G H;  2JA7 G;  5JJI A;  1BBW A;  2JA6 H;  2I5L X;  1EYG A;  3FP9 A;  3NEN A;  4GKK L;  1CKO A;  4POF A;  2V1C C;  1G6P A;  1WYD A;  2UU9 L;  3CCJ A;  4OO1 G;  4KHP Q;  2CWA A;  1JMC A;  1OXV A;  5M5Y H;  4B3R Q;  1E1O A;  4LW1 A;  1UEB A;  5C44 H;  2DGY A;  1N32 Q;  4YWM A;  5C4X G;  2PI2 A;  4OO1 I;  2NVX H;  4AIM A;  3CCL A;  1LM0 A;  4X62 L;  3BU2 A;  2K5H A;  5C44 G;  1XMQ L;  4LF7 Q;  2EXD A;  3FKI H;  4HID A;  1TWA H;  1Y1V G;  3E9H A;  4R4Q A;  1S72 A;  1VQA A;  1N36 Q;  1JJ2 A;  1QVF A;  5IYC G;  2D0O A;  3CAM A;  1IBL Q;  2I0Q A;  2N8N A;  1EFW A;  4L5T A;  3GTK H;  3FKI G;  5H1S E;  4LF8 L;  2R92 H;  3ICE A;  3K7A H;  4DR4 Q;  2WAQ G;  1EOV A;  5FJ8 H;  2AMC B;  3DLL A;  2NN6 G;  4IPG A;  2CKZ B;  3UDF A;  2R92 G;  3U4Z A;  1PYB A;  4LFA L;  2VQF Q;  1SRU A;  4L5S A;  5GAE C;  4JYA L;  4X64 Q;  2PMZ E;  4NXM Q;  1X6O A;  1ASY A;  2JA8 H;  4DV6 Q;  2VNU D;  5GAD C;  2NN6 I;  1J5E Q;  2ID0 A;  3CMA A;  3U58 A;  4LF9 L;  2UUB L;  2K50 A;  3KFU A;  2VL6 A;  3AQQ A;  1A8V A;  3F1Z A;  4DV3 L;  3K0X A;  3S17 H;  1UE7 A;  2PI2 E;  3EBE A;  1H95 A;  1VQM A;  1VS0 A;  1U0L A;  2OQK A;  4TQU S;  2ZJR A;  3MEF A;  4LUZ A;  4ME3 A;  4MZ9 A;  3UDI A;  1N8R C;  1VQ7 A;  1YVC A;  1HZB A;  4P72 A;  3PUX A;  4YWL A;  1NJI C;  3PUY A;  5IT9 c;  2AWO A;  2KCT A;  3S1N H;  4GNX A;  1TWC H;  2JE6 I;  4PZ8 A;  1PYS B;  1HR0 W;  1Q12 A;  1HZA A;  1FVI A;  2MQH A;  2WB1 G;  4YCU A;  2UXC Q;  3ERS X;  4H02 A;  5EAY A;  3UDX A;  1SMX A;  4R1J A;  4DV2 Q;  3NEM A;  3PV0 A;  1PH6 A;  2Q2U A;  3RLO A;  4DR1 L;  4GLV B;  4A3K H;  1I94 L;  2OWO A;  2JEA I;  4HJ8 A;  3I2Z A;  1PH9 A;  2YYZ A;  3U4V A;  1K83 H;  5IE8 A;  3TS0 A;  4NXN Q;  1UWV A;  4IPD A;  4A3I G;  4A3K G;  3PUW A;  1YJN A;  3Q8D A;  2ZTD A;  5LMN W;  1VQN A;  3I4O A;  4JBJ A;  3OYY A;  2EQS A;  3UDG A;  3S1Q H;  5IWA Q;  1K3R A;  3TEH B;  5IYD G;  3GTP H;  3HOU H;  4JI5 Q;  1B7Y B;  4LFB Q;  1UE5 A;  4HJ5 A;  4KHZ A;  4NPS A;  3G71 A;  3CCR A;  4OX9 L;  2UXB Q;  2ZTE A;  4DUZ Q;  1X9N A;  1N9W A;  2R7D A;  4AQY L;  4A3L G;  2RF4 A;  3J80 c;  3G4S A;  4DV0 Q;  3PO3 G;  3HOZ H;  4O2D A;  3HOU G;  3W1G A;  4DR7 Q;  4DR3 L;  1RIP A;  4R4O A;  4BBS G;  3F2C A;  3SGI A;  1Z9F A;  3RZO H;  3D0F A;  1VQI A;  4PZ7 A;  1VQE A;  2MO0 A;  4JOI A;  1YZ6 A;  4DAM A;  3IRB A;  5J3B A;  4DV5 L;  4IOC A;  3HOZ G;  1OXT A;  1QUQ A;  4UP9 A;  1VQO A;  1SR3 A;  2VS1 A;  4C3J H;  3A74 A;  4POG A;  1J6Q A;  4OWX B;  2BH8 A;  2KCM A;  4GOP C;  4JC0 A;  2R7Z G;  4JI8 Q;  4JI6 Q;  4JI0 L;  3PCO B;  4JI3 L;  1X3G A;  3VDY A;  1Q82 C;  4C3H H;  1D7Q A;  5LMN L;  5LMU L;  4A3F H;  1YIT A;  1K9M C;  4LFC Q;  1HNZ Q;  1PH8 A;  3GTQ H;  4X65 Q;  2VUM H;  4LF6 L;  3PO2 H;  1A63 A;  3T1H L;  3F2B A;  4QQB X;  2K5V A;  3CXC A;  2B63 H;  4A3F G;  2UU9 Q;  1LYL A;  2AKW B;  4GN5 A;  4HIK A;  3M4P A;  4JI7 L;  1WOC A;  4XTC S;  3TRE A;  4DKA C;  2BA1 A;  2JA7 H;  1T9H A;  5AJ3 Q;  1VQP A;  4DR2 L;  3OTO L;  1XPO A;  3HOX G;  1MJE A;  3KF6 A;  1B70 B;  1QZH A;  4A3E G;  4GKJ L;  3GTJ H;  2ZJQ A;  4JBK A;  2WB1 E;  1XMO L;  1M90 C;  3M85 A;  4X62 Q;  4GS3 A;  4OXP A;  1XMQ Q;  2I5M X;  1AE2 A;  1PA6 A;  2GN5 A;  2OTL A;  4DPG A;  1IBM L;  3S2H H;  2E2I H;  1KC8 C;  3H3V I;  3TRZ A;  5C4X H;  4K0K L;  2ZTC A;  3KLW A;  4QGU A;  1CSP A;  4LF5 Q;  3PF4 A;  3ULP A;  4DR6 L;  3S15 H;  1JJG A;  4JI2 L;  3CCE A;  3HOW G;  4KI0 A;  3G48 A;  4WJ3 M;  1FGU A;  4HJA A;  2LSS A;  4GNX B;  1R9T H;  2Q2H A;  1UE1 A;  1Y1V H;  1Y1W H;  3CD6 A;  1P16 A;  3TS2 A;  1EWI A;  2ZM6 Q;  5IYC H;  4LFA Q;  1VQC A;  3J81 j;  4JYA Q;  3F2D A;  3FHW A;  2VW9 A;  5M3M G;  1BKB A;  1Y1W G;  1K8A C;  2VQE Q;  4LF9 Q;  1PVO A;  3KDF A;  2N49 A;  5JJL A;  4QJF A;  4IJL A;  2JA5 H;  4JI1 Q;  4IFD G;  3S1R H;  4A3D G;  1N33 L;  3GDE A;  3KJO A;  3J81 i;  1YI2 A;  1X65 A;  1VQL A;  1W3S A;  2R93 H;  1VQJ A;  1FJG Q;  1PV4 A;  4JBW A;  4IFD J;  4P71 A;  1OXS C;  5IP9 G;  2JA5 G;  1XNR L;  2Z6K A;  5DLQ E;  1HZ9 A;  5E7N A;  4IFD I;  3DM3 A;  2R93 G;  1XPR A;  2E5L Q;  2ZJP A;  5C4J H;  1TXY A;  4XIG S;  3UE0 A;  1P8L A;  2IT1 A;  4DR1 Q;  4A3M G;  2UUC Q;  3H3V H;  1I6H H;  3S16 H;  4O0A A;  3TQY A;  4YY3 L;  4DUY L;  1BVS A;  4EQ5 A;  1W2B A;  3CPW A;  4LF4 Q;  4LWC A;  3I56 A;  4B3R L;  1E24 A;  3PIP A;  5M5X H; 
#chains in the Genus database with same CATH topology
 2QW7 A;  4A3B H;  3DEO A;  2RVL A;  2CH4 A;  2CW0 D;  5CYU A;  1GO3 E;  3I4M G;  3GO5 A;  2NVY B;  1Q90 A;  3CQZ B;  3HKZ G;  3QG1 A;  2XN9 C;  4A75 A;  1G51 A;  3ZYY X;  2I5H A;  1VQF A;  4A3I B;  2NUC A;  2WKC A;  1N36 L;  3JAM L;  1CKN A;  1LAB A;  4L8J A;  1PH4 A;  3NQI A;  1RHP A;  3M3Y H;  3PO3 H;  1FNU A;  3GD7 A;  1DXM A;  1YHB A;  2DY8 A;  2VQF L;  3C1F A;  2ASB A;  4BBS H;  2DN8 A;  2L1B A;  4EQP A;  5CBE E;  4UAI A;  3NBH A;  2CQO A;  1EIF A;  3BG3 A;  5IT9 E;  2LKV A;  3RNU A;  4JI3 Q;  3B6Y A;  3GTM B;  2QKI C;  1VQ8 A;  1YNJ D;  5T1G A;  1YIJ A;  3DM1 A;  2RCN A;  3OW7 A;  1VQG A;  2QGQ A;  1RJT A;  1KDC A;  3T1H Q;  3BVM A;  4OEL B;  4ZKB B;  1X3Q A;  3EVQ A;  4C3I B;  2F0Q A;  2AUK A;  1X54 A;  3GTG B;  1D2B A;  1NUC A;  5IP7 H;  1PTO C;  1BBU A;  1MSG A;  2LS0 1;  4X66 Q;  1B3Q A;  1I4G A;  5M5W B;  2VY3 A;  4C2M H;  3RMH A;  1QG7 A;  5I4D A;  1XMO Q;  1KIX A;  2E2H H;  4CHT B;  1PTO F;  3K58 A;  5IYB G;  3KDF B;  2BCO A;  2F0M A;  1LTG D;  2K14 A;  4PG3 A;  3RUZ A;  2PW5 A;  1CQF A;  4DNI A;  1E2W A;  3W1B A;  4V0B A;  1L1O A;  1EQR A;  3ER0 A;  4B3T L;  3PIP 3;  1A0I A;  2IX3 A;  3I72 A;  3LGJ A;  4BBR G;  3EN2 A;  1LO5 D;  4P75 A;  4Q5V A;  4NB3 A;  3M9B A;  5DNF A;  3H94 A;  3HOW B;  2OCE A;  5JJZ A;  1CM9 A;  4CDC C;  1F9Q A;  2YTY A;  4R4I A;  3LNN A;  2IX1 A;  2L15 A;  3RN5 A;  1XNR Q;  4CGY B;  1QCB D;  1LT4 D;  2JJQ A;  4X65 L;  1VQ6 A;  2F0T A;  3RR5 A;  2EYM A;  3A56 A;  4A3D H;  1LTB D;  2D5D A;  4QY7 A;  1CKN B;  2B2U A;  2R61 A;  2Z9H A;  5IP9 H;  4FYD A;  3CCU A;  2IJ0 A;  4A3M B;  1PH7 A;  3GTL B;  3S2D B;  1OTC A;  5C3E B;  2HIV A;  3I73 A;  1I4Q A;  3NBH B;  1B1Z A;  1EWC A;  1YNX A;  1GHK A;  3BZK A;  1MI2 A;  1FNW A;  4GN3 B;  4DK3 C;  2KVM A;  4HMI A;  1ICW A;  2DUD A;  4KHP L;  4LF5 L;  3A5Z B;  1VQK A;  5FLM G;  3I4M H;  4WJ4 A;  5BR8 Q;  1IBK Q;  1JB3 A;  1U4L A;  2B2T C;  5C0X H;  3J80 i;  3KF8 A;  3WDN A;  3W2D A;  4A3J B;  4BY7 H;  2ZM6 L;  2EE1 A;  3NWT A;  3QWN A;  1S5E D;  1KL9 A;  2YTX A;  5FJ8 G;  3SK8 A;  2XTI A;  4K6D A;  1F9S A;  2VQE L;  2EOT A;  1VQB A;  2K32 A;  1CTM A;  2V4D A;  3W3A A;  2XNA C;  5A2Q L;  4B3M Q;  4JI1 L;  3WWV A;  4GLX A;  3TZD A;  2A8V A;  4A76 A;  2ES2 A;  1ESR A;  4CDD C;  2F4V Q;  1I5F A;  3OOC A;  3L2P A;  2HIX A;  4X64 L;  1CA5 A;  2F0H A;  2Z1C A;  5M3F B;  4NXM L;  2E5L L;  3AU7 A;  4A3C G;  1SXT A;  5DM6 3;  1BNZ A;  1S40 A;  2UUC L;  1Q1E A;  2L9H A;  1KHI A;  1L1O B;  2IHE A;  3RZD H;  5LMN Q;  5LMU Q;  1Q7Y C;  2K6A A;  1OXU A;  2B2Y A;  5JEA G;  1HCZ A;  4YWK A;  4OGQ C;  1PRT B;  4JW0 A;  1VF7 A;  5JEA J;  3T13 A;  1JC7 A;  1DD2 A;  2Y0S G;  4JBM A;  4IOA A;  3BVG A;  3R2I A;  3OTO Q;  4DR2 Q;  2UXD Q;  4AYB E;  2D0P A;  5IYB H;  2H5X A;  3G6E A;  2RHQ B;  1Z7T A;  3CME A;  4M8A A;  1I4X A;  2XIW A;  3HKS A;  5J1Z A;  1M4V A;  1DZ1 A;  1R4P B;  2HQE A;  2BE5 C;  2F0D A;  3Q23 A;  3LX0 A;  1ILP A;  1TQO A;  3NBI A;  2UXB L;  1EIH A;  3G7L A;  3KOJ A;  4RG1 A;  5ELD A;  4BBR H;  3K5L A;  4A3G B;  2A69 D;  4C3J G;  2NVT H;  1BUV T;  5IGF A;  1C48 A;  4F88 A;  4DV7 L;  1HNW L;  3P75 A;  2BA0 A;  2WV6 D;  4HED A;  1DOK A;  4JI4 L;  1IXR A;  3PGZ A;  4LNQ A;  2RDH A;  5HUR A;  3M4Y A;  2OTJ A;  1F2M A;  4DV1 Q;  1SYB A;  3MVV A;  3VR6 A;  1ENC A;  1EFI D;  2BDN A;  4L5R C;  3KF8 B;  2YU9 H;  2EVB A;  3T1Y Q;  5D3I B;  2F3V A;  3D8G A;  4DR5 Q;  2GA4 B;  2SDF A;  1BBW A;  2Z4I A;  2JA6 B;  3NEN A;  4GKK L;  2M9V A;  4EQO A;  1RTN A;  3C2P A;  3HGB A;  2KEC A;  4OO1 G;  4AYB B;  1JMC A;  5BN3 A;  1E1O A;  3MZ5 A;  1N32 Q;  4WOR A;  4BS9 A;  3FMC A;  5C4X G;  5IT9 L;  4OO1 I;  3U9S A;  1MHW C;  2ZXP A;  1NCV A;  2K5H A;  3R8B A;  1XMQ L;  4LF7 Q;  3FKI H;  4HID A;  1SE2 A;  1U4M A;  1Y1V G;  3E9H A;  4X3T A;  1S72 A;  2HUG A;  1VQA A;  1N36 Q;  1JJ2 A;  4HCS A;  2F0V A;  1XWE A;  1EYD A;  3MXG A;  1EFW A;  1EEF D;  1SE3 A;  5JPM C;  1WTQ A;  2FJ2 A;  5FJ8 H;  5C6A A;  3QJY A;  4IPG A;  2CKZ B;  1CQV A;  2F0S A;  3UDF A;  2R92 G;  1O80 A;  2VQF Q;  1SRU A;  2VB3 X;  5CV8 A;  5EPJ A;  4MN3 A;  2VNU D;  1J5E Q;  2ID0 A;  2UUB L;  2VB2 X;  5I6W A;  2JP1 A;  1B50 A;  1B9M A;  3QOL A;  1VS0 A;  1VQM A;  2OQK A;  4FF4 A;  4KK7 A;  3Q0A A;  4DGZ A;  3MEF A;  3GV3 A;  4IUU A;  1VQ7 A;  1YVC A;  5I2Y A;  4R8N A;  3UI2 A;  2PQE A;  1IYV A;  5JPN C;  1TWC H;  3GQB A;  1PYS B;  2E76 C;  1ILQ A;  1JJG A;  4H02 A;  1SMX A;  4R1J A;  3NEM A;  2Q2U A;  4N8X 1;  3HG9 A;  1I94 L;  1HTL D;  3VR5 A;  3NWS A;  3TME A;  2OWO A;  2JEA I;  4F87 A;  4IUV A;  3OWF A;  1PH9 A;  2YYZ A;  3OPO A;  1K83 B;  4NXN Q;  3AMU A;  4A3I G;  4DAP A;  1JWU D;  1L0Y B;  1JQY D;  2EQS A;  2K5D A;  3V2T A;  1SYF A;  3S1Q H;  1IKL A;  4B08 A;  2K03 A;  5IYD G;  3GTP H;  1MGS A;  1B7Y B;  3L3O C;  1UE5 A;  1U4R A;  5FO7 B;  2B2T A;  2P5Z X;  3D3R A;  1X9N A;  1GUS A;  2R7D A;  4P2C B;  2K05 A;  3HOZ H;  4IUR A;  3HOU G;  1PTO B;  2JXM B;  4R4O A;  3J7A F;  5C5L A;  1VQI A;  4XQJ A;  4IOC A;  3IRB A;  1BDO A;  4C3J H;  4IUN A;  4O1N A;  2KCM A;  4JI8 Q;  1B3A A;  1SJH D;  4HMJ A;  3ND8 A;  4JI3 L;  5KRU A;  4C3I G;  4C3H H;  1S5F D;  1YIT A;  1PH8 A;  4X65 Q;  2KCN A;  3PO2 B;  3E5S A;  3OHX C;  3T1H L;  1TS5 A;  2K5V A;  3VR3 A;  5LHY 1;  2J7Z A;  3M4P A;  3BZD B;  3T16 A;  5J22 A;  5C4Z A;  3TRE A;  2BA1 A;  1STN A;  1XPO A;  1IL8 A;  4GKJ L;  3GTJ H;  2WB1 E;  1XMO L;  1M90 C;  1SYE A;  4X62 Q;  4OO1 H;  4OXP A;  1S5D D;  3S2H H;  5C4X H;  3N6R A;  3KLW A;  4RGO S;  3LWE A;  4LF5 Q;  1MSH A;  3MWY W;  3NPP A;  1EQT A;  1V1O A;  4MTK A;  4DF7 A;  3HOW G;  1SEB D;  2J4X A;  1DOL A;  4HJA A;  2RQX A;  1R9T H;  1HRJ A;  1B4O A;  1UE1 A;  1Y1V H;  2TMP A;  2ZM6 Q;  1XX8 A;  3E3X A;  1UUP A;  4X3U A;  3FKI B;  3FHW A;  4QUC A;  1JE4 A;  1K8A C;  2VQE Q;  2CQA A;  1SYD A;  2L4N A;  2D9U A;  4QJF A;  4JI1 Q;  4IFD G;  1N33 L;  1LV9 A;  1CK1 A;  1BCP D;  3K5M A;  1FJG Q;  4CKC A;  4IFD J;  1QE6 A;  1XNR L;  3A8J E;  2Z6K A;  4IFD I;  1BQQ T;  5KIX A;  2R93 G;  2E5L Q;  1S5B D;  2MPM A;  2JN4 A;  1TXY A;  5C4J H;  2UUC Q;  4DR1 Q;  4A3M G;  1I6H H;  3S16 H;  3LWU A;  2B2V C;  3TQY A;  5TSS A;  2H1E A;  2B2W C;  3I56 A;  2EJG C;  1E24 A;  3CF5 A;  2WB1 B;  4RCO A;  2B8G A;  3ULL A;  4QCL A;  4Q0F A;  3FPP A;  3E9I A;  3D6C A;  2F52 A;  2NVY H;  1BF4 A;  3CQZ H;  3H3V C;  5AFW A;  4ULL A;  2SNM A;  4L5Q A;  4A3B G;  2XGT A;  4A3I H;  4A3J G;  3WOF A;  2MUY A;  3R93 A;  1PHJ A;  1A6X A;  1IBL L;  1AE3 A;  5IYD H;  2KHJ A;  4L6T B;  5BR8 L;  3I4N B;  1IBK L;  1AZQ A;  4N8F A;  3DUZ A;  2F0L A;  1IYJ B;  2G5D A;  3DWP A;  4ZKC B;  2K52 A;  4JPB W;  3BZC A;  2RCF A;  1E7Z A;  1G6Z A;  1I50 B;  3J7A 5;  4RMF A;  1O7Y A;  3HOZ B;  3GTM H;  2KED A;  1F2Y A;  4DU9 A;  4RHR A;  4B3M L;  3STB C;  1S3O A;  2K7V A;  4DV7 Q;  4KKS A;  4B9W A;  4AH6 A;  1Q46 A;  4LF6 Q;  2R7Z B;  2OF1 A;  4KJO A;  4JI4 Q;  4C3I H;  1Y8O B;  2F4V L;  1HUN A;  3SK6 A;  3GTG H;  2R7F A;  5EBD A;  5GAG C;  4RA8 A;  2F0N A;  2Q8I B;  5I9P A;  4C3H B;  5M5W H;  4PMW A;  2K4K A;  5IOC A;  3AB9 A;  4FDB A;  5IP7 G;  3J7A V;  2F3W A;  2K5N A;  2A1A A;  1NR2 A;  4GKK Q;  3I55 A;  2L0C A;  3HOX B;  5KEE A;  4A3E B;  2JA9 A;  4FVM A;  4ZUJ A;  1SMY C;  3EQL C;  3FEW X;  3MXN A;  3W5O A;  1G29 1;  3CCS A;  2UXD L;  4UPA A;  1HHV A;  2GVA A;  2CW0 C;  4A93 B;  1STB A;  1LTT D;  2A74 C;  1KQS A;  5DAU A;  3I7F A;  1U4P A;  1PFS A;  3A8K E;  3MXP A;  3MEH A;  3HOW H;  2RDF A;  1CT1 D;  1NR4 A;  4KTA A;  2IHF A;  4ZUI A;  3UE1 A;  2EYO A;  2ZXO A;  4JI6 L;  4IPH A;  2K01 A;  2RBM A;  1GVP A;  2YTV A;  2HT1 A;  2D62 A;  4X3K A;  2GVB A;  2Z0S A;  1KNA A;  5ELE A;  5M9O A;  3STB D;  1Q86 C;  3PSI A;  4IFD H;  3K5N A;  3PF5 A;  1EU3 A;  3BJU A;  3IFD A;  1YNJ C;  2UUB Q;  2PO4 A;  3VR2 A;  4Y7N H;  4DUY Q;  2JA6 G;  4MHE A;  4QIW E;  4DV1 L;  2EXZ A;  5AJ3 L;  3T1Y L;  4AYB G;  4A3M H;  1ZXT A;  3GTL H;  2YV5 A;  3S2D H;  5C3E H;  1PRT D;  4DR5 L;  3OMC A;  4HIO A;  3AYH B;  1I94 Q;  1TU2 B;  4DK6 C;  3HOV B;  2OXP A;  1NMF A;  2EYL A;  1D5Z C;  5I2X A;  3HOY B;  4Z9C B;  2CFM A;  1N32 L;  3CC4 A;  3D6W A;  4A3J H;  3F8T A;  4EGV A;  5COR A;  3MFG A;  4LF7 L;  3S14 B;  5CGK A;  5C0X G;  2CWP A;  1CHQ D;  4APV A;  4JOI C;  4BY7 G;  1IZ6 A;  1JWM D;  3NUC A;  3P1H A;  3JC6 6;  3BS1 A;  1QNU A;  5C0X J;  3A54 A;  4IN3 A;  5C0X I;  3CCQ A;  1VQ5 A;  1HZC A;  1HR0 Q;  4I7A A;  2EYP A;  1LTL A;  4KMU C;  4XYQ A;  3MXN B;  4ME5 A;  2BH2 A;  4H7B A;  2RSO A;  4QUF A;  5M3F H;  3CC2 A;  2A19 A;  1MJC A;  1ESF A;  1J5E L;  1AFP A;  1XTD A;  2WIN B;  4QIW B;  4TKO B;  1QVG A;  4TRD A;  4EX5 A;  3PIO A;  1CI3 M;  1LTS D;  4UP7 A;  2F0E A;  2B2V A;  1STA A;  3RLN A;  2B2W A;  1X3E A;  3CU7 A;  4XT3 B;  1HNX Q;  2BDO A;  3MHB A;  4R4C A;  1E3P A;  3X3N A;  1GJX A;  4GKJ Q;  3L0O A;  1WCM B;  4GN4 B;  5G3L D;  4QB4 A;  5I9O A;  1IHZ A;  3TZU A;  4NXN L;  4BY1 B;  1STH A;  1X55 A;  1X32 A;  3VA5 A;  3D4R A;  1N34 L;  1EEI D;  3SR1 A;  4FXG C;  4ZK9 B;  4K5V A;  4FXD A;  2AHO B;  4K2K A;  2EIF A;  2MP1 A;  2WAQ E;  3NHH A;  1NNX A;  4B9X A;  4C56 C;  4A3G H;  4O42 A;  5ISR A;  1K0R A;  2MO1 A;  3VA7 A;  4BWG B;  4RGM A;  1YBY A;  1DYQ A;  1T5X D;  2AQ1 B;  1EY0 A;  3CCV A;  1WVL A;  2PNH A;  4IAL A;  3QIA A;  1H9J A;  1VQD A;  1Q81 C;  3PO2 G;  3NTH A;  3VYS A;  4JI8 L;  1N33 Q;  3TBI B;  1V1P A;  4QF4 A;  4BA2 I;  3K81 C;  2AQ2 B;  1CFM A;  3K8A A;  5JJI A;  4ID6 A;  1A2T A;  4IUT A;  5E4X A;  2JA6 H;  2I5L X;  2JSO A;  4NKL A;  1CKO A;  1FGB D;  1WYD A;  2DY7 A;  2XSC A;  2H4O A;  1QNK A;  4Y7N B;  1K3B C;  4PNY A;  3F2U A;  1S5C D;  1F2Z A;  3SHL A;  5C44 B;  1KLU D;  5ELB A;  3MFY A;  3PIO 3;  5EKK A;  2F0F A;  2LMC B;  4AIM A;  3CCL A;  4X62 L;  1M8A A;  2O4X A;  4K14 A;  1DM0 B;  4RH6 A;  5D65 A;  3HEJ A;  4J1M A;  5BN5 A;  2WAQ B;  1GUO A;  1ROD A;  5EGT A;  1QVF A;  5IYC G;  1ENA A;  3CAM A;  1IBL Q;  2Z4H A;  3GTK B;  3FKI G;  3GP7 A;  1DOM A;  3K7A B;  5E3F A;  2AMC B;  1ZYR D;  5LL6 S;  3U4Z A;  3BYT B;  1ZKO A;  3KLS A;  3K59 A;  4L5S A;  3H6M A;  4RKB A;  4HN7 A;  1X6O A;  2N88 A;  2A69 C;  3Q22 A;  1EWH A;  5GAD C;  2A68 D;  4NDX A;  3KFU A;  2K50 A;  1TS4 A;  2FMM A;  1A8V A;  3F1Z A;  1S4Z A;  4H44 C;  3EBE A;  5CV5 A;  2ZJR A;  3UDI A;  1FJG L;  2AWO A;  4WFN 3;  1Q8I A;  2MQH A;  1K8M A;  2WB1 G;  4WJW A;  4YCU A;  4HAE A;  3PV0 A;  1PMR A;  4A3K B;  4DR1 L;  4GLV B;  2SEB D;  4NP5 A;  4HJ8 A;  2NBF A;  3U4V A;  1K83 H;  2KCC A;  2QF7 A;  3TS0 A;  3SDZ A;  1VMC A;  1UWV A;  2ZTD A;  3UDG A;  1QOH A;  4CDE C;  5KNB A;  1V1P B;  3KBX A;  4OX9 L;  1N9W A;  4AQY L;  3G4S A;  1PYW D;  3W1G A;  1PTO H;  1GUN A;  3RZO B;  4JOI A;  3HOZ G;  2HDL A;  1QUQ A;  1SBB B;  4KV6 A;  1J6Q A;  4OWX B;  2K1B A;  2C5C A;  4JC0 A;  1AN8 A;  2R7Z G;  2FIN B;  4JI6 Q;  3C3L A;  4JI0 L;  2MGS A;  3IFT A;  1X3G A;  3VDY A;  2A6E D;  5J39 A;  4ABN A;  4A3F B;  2QCP X;  5C4H A;  4LF6 L;  3PO2 H;  4ZYS A;  1A15 A;  4C3H G;  3J80 E;  1A63 A;  2ICI A;  1VF5 C;  2UU9 Q;  1LYL A;  4GN5 A;  1DCZ A;  4HIK A;  2Z6B A;  1WTW A;  1IW7 D;  2JA7 B;  5ELC A;  5AJ3 Q;  3HOX G;  2XRS D;  3T4A C;  4DAY A;  3KLR A;  2Q8T A;  4A3E G;  4FNF A;  2DJF C;  4JBK A;  1F9R A;  2NB0 A;  3M85 A;  3I90 A;  2I5M X;  2ZT9 C;  3SXH A;  1LAC A;  2OTL A;  4DK1 A;  1CSP A;  3PF4 A;  3S15 B;  5E1F A;  4JI2 L;  5CV6 A;  3OMG A;  3ND9 A;  4WJ3 M;  4XDX A;  2RDG A;  2LSS A;  1TKW B;  1Y1W B;  3TS2 A;  3CD6 A;  1P16 A;  5IYC H;  4LFA Q;  4JYA Q;  1D6E C;  4CDF C;  3F2D A;  2O5J C;  2VW9 A;  1BKB A;  1PVO A;  4KKT A;  4IJL A;  2JA5 B;  3HP3 A;  1D5M C;  1WTO A;  3KJO A;  1OO9 B;  1JCK B;  2TSS A;  1W3S A;  1VQJ A;  4KD4 A;  1PV4 A;  2NTS A;  5EBC A;  2KQ3 A;  1HQM C;  1HFN A;  1PFN A;  2O2L D;  1HZ9 A;  5DLQ E;  5E7N A;  3T53 B;  3J81 L;  1XPR A;  5L37 A;  3UE0 A;  1F77 A;  1P8L A;  2IT1 A;  3X3M A;  2F0K A;  5D3D A;  1BOS A;  4DUY L;  1BVS A;  1TS3 A;  2PYK A;  1STG A;  5M5X H;  3HKZ B;  1QUQ B;  2C9O A;  3HOV G;  1TWF B;  2IX0 A;  5ELO A;  1MKH A;  1TWG B;  4UY8 C;  1EZ8 A;  3E0E A;  3R2T A;  3JAM i;  4KN4 C;  2PCF B;  3HOY G;  1EU4 A;  3GTO B;  3P7J A;  1FL0 A;  2Q2T A;  3VYU A;  3MXU A;  4KHV A;  2PNR C;  5IIF A;  1HH2 P;  3I4N H;  1SE8 A;  2A6H D;  1CHP D;  3TP5 A;  5HGQ A;  1N34 Q;  1WI5 A;  1PDQ A;  1HA5 A;  3OWE B;  2RHS B;  1SNO A;  2KHI A;  2KHS A;  1WFQ A;  3KJP A;  1I50 H;  1D5X C;  1LT5 D;  4DAY B;  2JEB I;  4DV6 L;  1KAB A;  2K5Q A;  4K6L A;  1QVC A;  1HR0 L;  2R7Z H;  3KYH C;  2LXK A;  4LUO A;  2MFI A;  1MD2 D;  2M00 A;  3CC7 A;  1BCP C;  1E22 A;  1HJP A;  3HZX A;  1IYU A;  1TR5 A;  4TVA B;  4N9P A;  4ALP A;  2L12 A;  3VYR A;  2I07 B;  1KRS A;  1WD1 A;  1BCP F;  2PQA B;  4XYO A;  2FHT A;  3C46 A;  1WCM G;  1NMG A;  3HOX H;  4K0K Q;  5IWA L;  4A3E H;  1NSN S;  3J7Y W;  1B8A A;  3D31 A;  1L0W A;  1HNX L;  2F1M A;  4DR6 Q;  2E74 C;  5GQO A;  3PUZ A;  4DV0 L;  2EJM A;  4JG2 A;  4A93 H;  4DR7 L;  1YJ9 A;  4H0L C;  2C35 B;  4CJ0 B;  2E2J H;  1Z6H A;  1WJJ A;  3CPF A;  4H13 C;  4MIU A;  4BA1 I;  4K5W A;  1EY8 A;  2QEX A;  5EQ0 A;  1YHQ A;  1FD7 D;  1W6J A;  3QR8 A;  3OW2 A;  5CV7 A;  5EKL A;  1RDP D;  1M1K C;  3EFX D;  5KNC A;  1AP0 A;  5M3M B;  3OIQ A;  1VCI A;  2WAC A;  1C7Y A;  5ELN A;  4LFC L;  4MNO A;  2JYO A;  1HNZ L;  5IOD A;  3TN2 A;  2XWB B;  1PH3 A;  1NTG A;  3AEV A;  2KBN A;  5DM7 3;  4OL7 A;  4QL5 A;  4UP8 A;  1I4R A;  1JOO A;  2NTT A;  2NVQ B;  2LXJ A;  3L7Z C;  1SN8 A;  3MA2 B;  3NE5 B;  4DNR B;  4GNX C;  3ERQ A;  4R4T A;  3P20 A;  1I3Q B;  1KXL A;  2Y0S E;  3T56 B;  3RN2 A;  5GRO A;  1A62 A;  1T5E A;  3ZJY C;  2R6G A;  2XRQ D;  1NBW A;  2AUJ D;  4PQX A;  1RKN A;  3DXJ C;  3HOV H;  5C3E G;  2F0W A;  4CKE A;  1O7L A;  1TS2 A;  2KEE A;  1TT2 A;  1HTP A;  3HOY H;  5M5X B;  1E1T A;  1Q8K A;  5CR3 A;  1L2F A;  3S1M B;  1EY4 A;  2UUA Q;  2K5W A;  1G2T A;  3S14 H;  4OX9 Q;  1K28 A;  2PZU A;  4DFA A;  4LUV A;  2RSN A;  4AQY Q;  1X56 A;  1K73 C;  3J80 L;  1X3P A;  4PV1 C;  3M4O B;  4YIJ A;  4JV5 Q;  1YNN D;  1KAW A;  1UAP A;  1XXG A;  1GUT A;  5IY0 A;  5EPL A;  1GM5 A;  3I4L A;  2E2D C;  4NMZ A;  1HPC A;  4CJ1 B;  5IGG A;  4OIK A;  1V8Q A;  2WII B;  1C9O A;  2K04 A;  1CUK A;  5GAH C;  3V96 A;  2E75 C;  3J81 c;  4F7X A;  1BBX C;  1CSQ A;  4JI0 Q;  1HXY D;  5COY A;  4F8M A;  4TSS A;  2JQO A;  2ALY B;  3FPU B;  5JJK A;  1SLJ A;  2JK8 A;  2M2L A;  4I65 A;  3I8Z A;  5M3F G;  4HSV A;  2MNA A;  3M4Q A;  1SRO A;  2Y0S B;  3QO2 A;  4ZAI A;  4LAA A;  1VQ9 A;  3HFZ B;  4OON A;  5C3X A;  2G9H D;  1L1O C;  1OXX K;  1WTP A;  1GKH A;  2E8G A;  3DMU A;  4YHH Q;  1WCM H;  1JJC B;  1X3F A;  1PRT C;  4HR7 B;  5JOB A;  3AFQ A;  5D14 A;  3HS0 C;  2F4I A;  4BY1 H;  4FF3 A;  2F0P A;  1ET9 A;  5CMD A;  2HHH L;  4K5X A;  3DHQ A;  3FVQ A;  5FK9 C;  1JT8 A;  3SEB A;  1V1Q A;  1UE6 A;  3HRZ C;  2N3S A;  4JI2 Q;  1RTO A;  1JE5 A;  2WKD A;  1YHA A;  1PZJ D;  1PH1 A;  1SE4 A;  4C1N K;  1XJV A;  1VQH A;  2E2J B;  1IL2 A;  3VYT A;  4NW2 A;  5A35 A;  1PH5 A;  1SFO B;  1V43 A;  2B2U C;  4A3G G;  4LMQ D;  4B3S Q;  3A5U A;  2EDG A;  4UHV A;  2HD3 A;  1A2U A;  1ICF B;  1V9P A;  4GLA C;  2EY2 A;  1QB5 D;  3CW2 C;  3DEP A;  1XNQ L;  2L11 A;  1AH9 A;  4R9W A;  1TWH B;  1AW7 A;  5FKA C;  3TP6 A;  3D4D A;  3I3C A;  2HQL A;  1PXU A;  2QA4 A;  4DV4 L;  2JA7 G;  3A7L A;  1JIC A;  3H0G B;  5IGD A;  1SNM A;  3CKI B;  2QEJ C;  3FP9 A;  1EYG A;  4FP5 D;  2V1C C;  4OIJ A;  2UU9 L;  2CWA A;  5M5Y B;  4G7O C;  3M7G A;  1H9M A;  5C44 H;  4YWM A;  1EY6 A;  3PQI A;  2PI2 A;  3NP8 A;  2NVX B;  1RCV D;  4DNT B;  4ZCK A;  1TWA B;  4R4Q A;  4ZLT F;  1JOK A;  3GTK H;  4LF8 L;  5H1S E;  2R92 B;  2SNS A;  1ONL A;  5E4W C;  3K7A H;  3URY A;  2NN6 G;  1PYB A;  4LFA L;  5GAE C;  3K5O A;  4JYA L;  2PMZ E;  1ASY A;  2JA8 B;  4DV6 Q;  2NN6 I;  2F0J A;  3AQQ A;  4DV3 L;  3K0X A;  3S17 B;  1UE7 A;  2PI2 E;  1U0L A;  1R4Q B;  4ME3 A;  3ONA B;  4MZ9 A;  1N8R C;  1TY2 A;  1HZB A;  3S1N B;  3PUY A;  2KCT A;  4GNX A;  2JE6 I;  2LY7 A;  1GXD C;  1LTA D;  3ITP A;  1Q12 A;  1HZA A;  1FVI A;  2UXC Q;  1A3T A;  1E2Z A;  3ERS X;  1PH6 A;  3RLO A;  4A3K H;  4ZQ3 A;  2XVS A;  5JVH 3;  1EY5 A;  1SND A;  5IE8 A;  3PUW A;  3Q8D A;  5LMN W;  1VQN A;  4JBJ A;  3OYY A;  5IWA Q;  3TEH B;  3SE0 A;  3HOU B;  4JI5 Q;  4LFB Q;  1J9O A;  3NTI A;  4KHZ A;  4NPS A;  3OIP A;  4RFB A;  4A3L G;  2RF4 A;  3J80 c;  4DV0 Q;  5BN4 A;  4DR7 Q;  1BCP B;  4DR3 L;  3J81 E;  3BYY B;  3SGI A;  2LFN A;  4RWS C;  2DNC A;  3RZO H;  4PZ7 A;  2MO0 A;  1YZ6 A;  5J3B A;  2X6L A;  3D4W A;  1OXT A;  4UP9 A;  2PMZ B;  1AEX A;  3IKJ A;  4POG A;  2BH8 A;  4GOP C;  1ZYR C;  4M1U B;  4V19 0;  3E6Z X;  1QWY A;  3N52 A;  4A3F H;  4LFC Q;  1K9M C;  1HNZ Q;  3GTQ B;  3BDL A;  2A68 C;  2VUM B;  1B2T A;  3F2B A;  4QQB X;  2B63 B;  1JWS D;  3CXC A;  3Q24 A;  3EJI A;  4JI7 L;  1WOC A;  4XTC S;  4I7Z C;  1VDZ A;  1B53 A;  2DJG C;  3H91 A;  1T9H A;  4DKA C;  2JA7 H;  1F2L A;  1VQP A;  1SNQ A;  3FRP B;  3KF6 A;  1B70 B;  3TP8 A;  4WRD A;  2ZJQ A;  3CRL C;  2QDL A;  1PFB A;  1AE2 A;  2N55 A;  1EIG A;  1PA6 A;  4DPG A;  4K0K L;  2E2I B;  2CVR A;  2FFK B;  4QGU A;  2L55 A;  1KLG D;  1KAA A;  1SYC A;  3S15 H;  3TP7 A;  4DN4 M;  2EYF A;  4J6H A;  4DR6 L;  1FR3 A;  3CCE A;  2KJX A;  1SNP A;  4KI0 A;  1STE A;  3KK7 A;  1WTR A;  4GNX B;  2Q2H A;  1Y1W H;  1EWI A;  1VQC A;  5C5M A;  3NXW A;  1C8C A;  1EZ6 A;  2XWJ B;  5M3M G;  3ERO A;  3E0J A;  4LF9 Q;  1MBY A;  1LTI D;  2NN6 H;  3K57 A;  2JA5 H;  5KGU A;  3S1R B;  1KTK A;  2R93 B;  1PTO D;  3G6J B;  4K8J A;  4X3S A;  4P71 A;  3IL8 A;  1OXS C;  1L0X B;  1EYC A;  2ZJP A;  2DNE A;  2A6E C;  1G2S A;  2O5I C;  1PFM A;  2K28 A;  3FDT A;  4XT1 B;  4FF1 A;  1JOR A;  1RD9 D;  4LWC A;  4B3R L;  3PMF A;  4RHS A;  3QB3 A;  1BO0 A;  4A3B B;  4HTH A;  1KNE A;  1TWF H;  5K5P A;  1TWG H;  2B8F A;  3C1E A;  4YCW A;  5JVG 3;  1IW7 C;  2ATW A;  4IPC A;  4KKU A;  3SK4 A;  1HUM A;  4K8I A;  3KBG A;  1ML0 D;  3GTO H;  1Y14 B;  1DJR D;  3T51 B;  2A5H A;  4ZRZ A;  4E6I A;  3WOE A;  5FLX c;  4OWW B;  5ELF A;  5NUC A;  4DXF A;  2PZW A;  2HHH Q;  4DR4 L;  4J8Q A;  2IY5 B;  4DV5 Q;  4BXX G;  4RCN A;  4A3L H;  4XXE A;  5C3W A;  3M3Y B;  3PO3 B;  1JOQ A;  1NY4 A;  3I4N G;  2UUA L;  4BBS B;  2F0G A;  1BR9 A;  3KF6 B;  3RLF A;  1G8Z D;  1PH2 A;  3DWQ A;  5KYI A;  4JV5 L;  4KY5 A;  2VZA A;  2MJ8 A;  1E0B A;  2OEO A;  2F03 A;  2CCZ A;  2HDM A;  3U50 C;  4U68 A;  3NQT A;  1XNQ Q;  1O7I A;  2IPK D;  4IUQ A;  4DV2 L;  1CA6 A;  4DK0 A;  1H9K A;  1SDF A;  3M7N A;  4C2M B;  3CCM A;  4DV4 Q;  3JAM c;  1K8O A;  2WP8 J;  2F3I A;  2E2H B;  4IJH A;  1QJO A;  2NZO A;  1C0A A;  2WFW A;  1EY9 A;  3MTS A;  4PMB A;  1IBM Q;  3A55 A;  1B44 D;  3MAQ A;  4X6A H;  4DUZ L;  2BOS A;  4CJ2 C;  4YHH L;  4OWT B;  3HKZ E;  1GHJ A;  2B3G A;  5F2D A;  4A93 G;  5EPK A;  1PLF A;  1VQ4 A;  2FXQ A;  1TVX A;  2IW3 A;  1FYC A;  3U9O A;  2A6H C;  2EYJ A;  4LF8 Q;  4HJ9 A;  1K8G A;  1NAP A;  1U5K A;  2Z6K C;  2NZH A;  3NTK A;  5M3M H;  1ASZ A;  3K6O A;  1EL0 A;  1GD7 A;  4GOP A;  3K80 C;  1QIL A;  4J15 A;  4DA2 A;  2ZXR A;  1J8I A;  2KA7 A;  4HJ7 A;  2PQA A;  4LK1 C;  4A3D B;  4P74 A;  4B3S L;  3J7Z C;  4KD3 A;  4Y52 H;  3IAY A;  3H0G G;  3TDQ A;  4YY3 Q;  4DV3 Q;  2NVQ H;  2Z8L A;  1WD0 A;  2PW7 A;  5IGE A;  2B29 A;  1I3Q H;  1DGS A;  4CBV A;  4IUP A;  2QDB A;  4G7Z C;  1PZK D;  2I46 A;  1II3 A;  5FLM H;  2N78 A;  1KDB A;  4PMC A;  3CP0 A;  3CRK C;  2BE5 D;  3S24 A;  3I70 A;  3I4M B;  4CKB A;  1EQQ A;  1LT6 D;  5HY6 A;  5EKI A;  4N9T A;  3S1M H;  4BY7 B;  5CV4 A;  4G57 A;  2D2C C;  1EIY B;  4OHJ A;  5CBA E;  3R3O A;  3M4O H;  4BXX H;  4DR3 Q;  3A0J A;  1SAP A;  4EQN A;  1TY0 A;  2JA8 G;  1AZP A;  4FXK C;  4A3C H;  1G91 A;  4HCE A;  1EUJ A;  4JK1 C;  3RD4 A;  1XPU A;  4A4I A;  2X6G A;  5KYL A;  3H15 A;  3V05 A;  5JEA H;  2VXW A;  1U9R A;  2QIL A;  1SNC A;  4UDU C;  3K7U C;  2A73 B;  2RKS A;  3RZD B;  5K36 G;  4FO2 A;  4LF4 L;  3VR4 A;  5FLX E;  1VMP A;  4XQQ A;  4JI7 Q;  1D1K A;  1QZG A;  4YCV A;  1I6V C;  2UXC L;  3AFP A;  1WTV A;  2EY5 A;  2NWG A;  4GOP B;  1HQR D;  4B3T Q;  4KLK A;  2Q2I A;  1D8L A;  1B9N A;  3EIV A;  3DWA A;  3ULJ A;  2K33 A;  1LUZ A;  1CKM A;  4HIM A;  1ENF A;  4BY1 G;  4P73 A;  4JI5 L;  2NZ1 D;  4LFB L;  2PZT A;  2SOB A;  2HCI A;  3L9A X;  4IQZ A;  1YJW A;  2K75 A;  1RL2 A;  4BBR B;  4MTN A;  2NVT B;  2OQ0 A;  4L63 B;  1JB7 A;  4RAU C;  3PUV A;  1SFO H;  1LTR D;  5I6Y A;  3BVZ A;  1KRT A;  1YNN C;  4G7H C;  3JAM E;  1EOT A;  1GUG A;  2CH4 W;  3TSS A;  4IZ8 A;  2CHB D;  1MIU A;  2Q8R E;  1KD1 C;  5IGB A;  2VUM G;  3NEL A;  1TWH H;  2B63 G;  1NE3 A;  4IO9 A;  1HA6 A;  4X66 L;  2YU9 B;  1Q1B A;  1YEZ A;  2EYH A;  2AWN A;  1KDA A;  4JCV E;  1Z47 A;  4PZ6 A;  2KEN A;  3H0G H;  1H9S A;  3SVM A;  4RGT A;  4POF A;  1G6P A;  3CCJ A;  1E2V A;  4KHP Q;  1OXV A;  1A3V A;  5M5Y H;  1W6K A;  4ODG A;  4B3R Q;  4LW1 A;  1UEB A;  1A3U A;  1O7Z A;  2ENB A;  2EY6 A;  2DGY A;  3EA6 A;  2F0I A;  4HSP A;  4RGN A;  2NVX H;  1C4Q A;  1LM0 A;  4DXG A;  3BU2 A;  5C44 G;  2EXD A;  3NSW A;  2FMC A;  1SMY D;  1TWA H;  3A8I E;  1XTC D;  2D0O A;  2I0Q A;  2N8N A;  2RA4 A;  4L5T A;  2L5T A;  2R92 H;  3ICE A;  4DR4 Q;  2WAQ G;  1EOV A;  4KN7 C;  3DLL A;  3KUP A;  2EJF C;  4X64 Q;  4NXM Q;  1O78 A;  2EY1 A;  2KOL A;  3BDO A;  2JA8 H;  2KUM A;  4R8I A;  4LF9 L;  3CMA A;  1H9R A;  3U58 A;  2F0O A;  1STY A;  2VL6 A;  3S17 H;  1H95 A;  4TQU S;  4DAV A;  4LUZ A;  1Q3L A;  2MHV A;  4LJZ C;  2F0U A;  4P72 A;  5HGT A;  3PUX A;  4YWL A;  1NJI C;  5IT9 c;  3S1N H;  1TWC B;  1WTX A;  4PZ8 A;  3K0Y A;  1HR0 W;  1Y8N B;  4KY7 A;  5EAY A;  3H3V I;  4U67 3;  3UDX A;  4DV2 Q;  5K36 H;  2X69 A;  1I4H A;  1I4P A;  3I2Z A;  3NK9 A;  5IGC A;  4IPD A;  4S3S A;  1YJN A;  4A3K G;  1DON A;  1UNS A;  3I4O A;  2PPB C;  3S1Q B;  1IKM A;  1SYG A;  5FOB B;  1K3R A;  5T1I A;  3GTP B;  3HOU H;  3A7A B;  4HJ5 A;  3G71 A;  3CCR A;  2UXB Q;  2ZTE A;  4DUZ Q;  4KJN A;  1K0S A;  3PO3 G;  4O2D A;  1RIP A;  4FF2 A;  4BBS G;  1H9S B;  3F2C A;  3SK5 A;  1Z9F A;  1RF2 D;  3D0F A;  1HNW Q;  1VQE A;  5CC4 A;  4DAM A;  4DV5 L;  1HFG A;  1VQO A;  1PRT F;  1SR3 A;  1Y69 U;  2VS1 A;  4C3J B;  3A74 A;  5FO8 B;  4C1N I;  2AQ3 B;  1WTH A;  5JAV A;  4RKL A;  5CV9 A;  1EY7 A;  3PCO B;  1FNV A;  1Q82 C;  1UEA B;  1EYA A;  1D7Q A;  4ILW A;  5LMN L;  5LMU L;  3GTQ H;  2EZV A;  2VUM H;  1CZW A;  3O13 A;  2NYZ D;  4GZY C;  4K2L A;  2B63 H;  3OSO A;  2IWH A;  5EJW A;  5FO9 B;  4A3F G;  5A2Q E;  2AKW B;  4XQN A;  3QOJ A;  1PZI D;  4DR2 L;  3OTO L;  1MJE A;  2IL8 A;  1LLR D;  1QZH A;  3GTJ B;  3Q6S A;  1GOZ A;  4GS3 A;  1XMQ Q;  1Y8P B;  4KY6 A;  5LL6 X;  2GN5 A;  3S2H B;  1IBM L;  2E2I H;  1SJE D;  1KC8 C;  3TRZ A;  5C4X B;  2ZTC A;  2J0T D;  1CZG A;  3I91 A;  3GV6 A;  3ULP A;  3MC0 B;  2EPB A;  3G48 A;  5KND A;  1FGU A;  1R9T B;  1Y1V B;  3J81 j;  1TII D;  1XYI A;  3KLS X;  1LT3 D;  4QMG A;  1EQV A;  4G4K A;  1Y1W G;  3KDF A;  1SSO A;  5DEH A;  2N49 A;  5FLX L;  5JJL A;  4JVZ A;  2G9D A;  2B39 A;  2OT2 A;  5G3L F;  3S1R H;  4A3D G;  4EVO A;  3GDE A;  1YI2 A;  3J81 i;  1X65 A;  1VQL A;  2R93 H;  1GUW A;  1ET6 A;  3CHB D;  4JBW A;  3H09 A;  5IP9 G;  1BXT A;  2JA5 G;  2HCC A;  3DM3 A;  1D1I A;  2B2Y C;  2R3Z A;  4OEM B;  5C4J B;  4XIG S;  3S9W A;  3H3V H;  1I6H B;  3S16 B;  4O0A A;  1ZEQ X;  1F9P A;  4YY3 L;  1W2B A;  4EQ5 A;  3CPW A;  4LF4 Q;  2ICE C;  3PIP A;  3BDC A;  1JR0 D; 
#chains in the Genus database with same CATH homology
 1QUQ B;  4A3B H;  3HOV G;  3ULL A;  1HNW Q;  1TWF H;  2IX0 A;  5ELO A;  1MKH A;  1TWG H;  4UY8 C;  4YCW A;  2ATW A;  3E0E A;  4IPC A;  1GO3 E;  3E9I A;  3JAM i;  3GO5 A;  2F52 A;  2NVY H;  3HOY G;  3CQZ H;  3I4M G;  3HKZ G;  4A75 A;  4L5Q A;  1G51 A;  4A3B G;  2I5H A;  1VQF A;  2XGT A;  4A3I H;  3GTO H;  1Y14 B;  4A3J G;  1PHJ A;  1N36 L;  1FL0 A;  5FLX c;  1IBL L;  2Q2T A;  1CKN A;  1PH4 A;  4OWW B;  1AE3 A;  5IYD H;  2KHJ A;  5BR8 L;  1HH2 P;  3I4N H;  1SE8 A;  1IBK L;  2HHH Q;  5HGQ A;  1N34 Q;  4DR4 L;  1WI5 A;  4DV5 Q;  2IY5 B;  4BXX G;  4A3L H;  1IYJ B;  3M3Y H;  3PO3 H;  3GD7 A;  2RHS B;  2K52 A;  1NY4 A;  1YHB A;  1WFQ A;  2KHI A;  3KJP A;  2VQF L;  2UUA L;  3BZC A;  2ASB A;  3I4N G;  4BBS H;  1E7Z A;  1I50 H;  3KF6 B;  3RLF A;  4DAY B;  2CQO A;  2JEB I;  1EIF A;  4DV6 L;  4RMF A;  3RNU A;  4JI3 Q;  3J7A 5;  3B6Y A;  1PH2 A;  3GTM H;  4JV5 L;  2VZA A;  1VQ8 A;  4B3M L;  3STB C;  1YIJ A;  1S3O A;  2RCN A;  4DV7 Q;  1VQG A;  4LF6 Q;  4AH6 A;  1Q46 A;  1QVC A;  2QGQ A;  1HR0 L;  2R7Z H;  3T1H Q;  2CCZ A;  3KYH C;  4JI4 Q;  2LXK A;  3U50 C;  4C3I H;  4LUO A;  2MFI A;  2F4V L;  1XNQ Q;  1X54 A;  3GTG H;  2R7F A;  5IP7 H;  3CC7 A;  5GAG C;  1O7I A;  4DV2 L;  1E22 A;  1BBU A;  1HJP A;  4TVA B;  4X66 Q;  4ALP A;  5JJK A;  5M5W H;  2VY3 A;  4PMW A;  4C2M H;  3CCM A;  3M7N A;  2K4K A;  4DV4 Q;  4FDB A;  5IP7 G;  3JAM c;  1XMO Q;  2WP8 J;  1KRS A;  2K5N A;  2F3I A;  1KIX A;  4IJH A;  2E2H H;  2PQA B;  2A1A A;  2NZO A;  5IYB G;  1C0A A;  4GKK Q;  1WCM G;  2WFW A;  3KDF B;  3I55 A;  1NMG A;  3HOX H;  1IBM Q;  4K0K Q;  5IWA L;  4A3E H;  2JA9 A;  1B8A A;  3D31 A;  1L0W A;  3W5O A;  1HNX L;  4DR6 Q;  2K14 A;  1G29 1;  3CCS A;  4PG3 A;  5GQO A;  2UXD L;  4X6A H;  4UPA A;  4DUZ L;  2GVA A;  3PUZ A;  4YHH L;  4DV0 L;  4JG2 A;  4DNI A;  4A93 H;  4DR7 L;  1YJ9 A;  3W1B A;  4OWT B;  2E2J H;  2C35 B;  3HKZ E;  1L1O A;  1EQR A;  3ER0 A;  1KQS A;  4B3T L;  1WJJ A;  2B3G A;  1A0I A;  3I7F A;  1PFS A;  3CPF A;  3LGJ A;  4BBR G;  4A93 G;  3EN2 A;  4P75 A;  4BA1 I;  4NB3 A;  1VQ4 A;  2QEX A;  2FXQ A;  3M9B A;  3HOW H;  2OCE A;  1YHQ A;  3OW2 A;  2IHF A;  4LF8 Q;  3UE1 A;  4HJ9 A;  1K8G A;  1U5K A;  2Z6K C;  4JI6 L;  1M1K C;  2NZH A;  4IPH A;  2YTY A;  4R4I A;  5M3M H;  2IX1 A;  1GVP A;  2YTV A;  1ASZ A;  2HT1 A;  1VCI A;  2L15 A;  1GD7 A;  1C7Y A;  4GOP A;  5ELN A;  2D62 A;  3RN5 A;  3K80 C;  2GVB A;  4MNO A;  4LFC L;  2Z0S A;  4J15 A;  1HNZ L;  1FJG L;  1XNR Q;  2JJQ A;  4X65 L;  1VQ6 A;  3RR5 A;  3STB D;  1Q86 C;  3PSI A;  4HJ7 A;  2PQA A;  3PF5 A;  4A3D H;  4P74 A;  3BJU A;  4B3S L;  1PH3 A;  1NTG A;  3J7Z C;  2UUB Q;  3AEV A;  4Y52 H;  2KBN A;  4QY7 A;  1CKN B;  4QL5 A;  4UP8 A;  3H0G G;  4Y7N H;  4DV3 Q;  4YY3 Q;  4DUY Q;  2NVQ H;  5IP9 H;  2LXJ A;  3L7Z C;  1SN8 A;  4DV1 L;  4QIW E;  2JA6 G;  4GNX C;  5AJ3 L;  2B29 A;  4R4T A;  3T1Y L;  1I3Q H;  1DGS A;  4AYB G;  3CCU A;  4A3M H;  1PH7 A;  3GTL H;  2YV5 A;  3S2D H;  1KXL A;  1OTC A;  2Y0S E;  3RN2 A;  5C3E H;  2HIV A;  4DR5 L;  5GRO A;  1A62 A;  4HIO A;  3NBH B;  5FLM H;  1YNX A;  2N78 A;  2R6G A;  3ZJY C;  3AYH B;  3BZK A;  1NBW A;  3CP0 A;  1I94 Q;  4DK6 C;  4GN3 B;  3HOV H;  4DK3 C;  5C3E G;  2DUD A;  4KHP L;  1NMF A;  4LF5 L;  3A5Z B;  1VQK A;  3S24 A;  5FLM G;  3I4M H;  4WJ4 A;  5BR8 Q;  1EQQ A;  3HOY H;  1IBK Q;  1E1T A;  1Q8K A;  2CFM A;  1N32 L;  5HY6 A;  3CC4 A;  3J80 i;  4A3J H;  1L2F A;  3F8T A;  3S1M H;  4BY7 H;  2ZM6 L;  2UUA Q;  4LF7 L;  3S14 H;  4OX9 Q;  1KL9 A;  2YTX A;  1EIY B;  5FJ8 G;  4LUV A;  5C0X G;  4AQY Q;  1X56 A;  2XTI A;  1K73 C;  2CWP A;  4APV A;  4JOI C;  2VQE L;  3M4O H;  1VQB A;  4BY7 G;  4BXX H;  4JV5 Q;  1IZ6 A;  3JC6 6;  4DR3 Q;  3A0J A;  1KAW A;  4B3M Q;  5C0X J;  4JI1 L;  3WWV A;  4GLX A;  2JA8 G;  5C0X I;  3CCQ A;  1VQ5 A;  2A8V A;  1HZC A;  5IY0 A;  1GM5 A;  1HR0 Q;  4A3C H;  4A76 A;  2ES2 A;  1EUJ A;  1XPU A;  4A4I A;  1C9O A;  1LTL A;  1CUK A;  5GAH C;  2F4V Q;  3H15 A;  3MXN B;  1I5F A;  2BH2 A;  3L2P A;  2HIX A;  4X64 L;  3J81 c;  4NXM L;  5M3F H;  4A3C G;  2E5L L;  3CC2 A;  1CSQ A;  2A19 A;  4JI0 Q;  1MJC A;  1S40 A;  1J5E L;  1Q1E A;  1XTD A;  2ALY B;  2JQO A;  1KHI A;  3K7U C;  2UUC L;  1QVG A;  1L1O B;  1SLJ A;  2IHE A;  2JK8 A;  4EX5 A;  3PIO A;  5LMN Q;  5JEA G;  1OXU A;  5LMU Q;  3RZD H;  1Q7Y C;  5M3F G;  5K36 G;  4YWK A;  2MNA A;  4LF4 L;  3M4Q A;  4UP7 A;  1SRO A;  5JEA J;  3RLN A;  1X3E A;  1VQ9 A;  4JI7 Q;  3HFZ B;  1QZG A;  4OON A;  1HNX Q;  4YCV A;  2Y0S G;  4R4C A;  2UXC L;  3AFP A;  1E3P A;  1L1O C;  1OXX K;  1GKH A;  4JBM A;  4DR2 Q;  2E8G A;  3OTO Q;  4IOA A;  2UXD Q;  4AYB E;  2D0P A;  4GKJ Q;  5IYB H;  2H5X A;  4YHH Q;  3L0O A;  1WCM H;  1JJC B;  4GN4 B;  3G6E A;  1X3F A;  4GOP B;  2RHQ B;  3AFQ A;  4B3T Q;  4NXN L;  3CME A;  4KLK A;  2Q2I A;  4BY1 H;  1D8L A;  1X55 A;  3HKS A;  2HHH L;  1N34 L;  1JT8 A;  3EIV A;  3ULJ A;  1LUZ A;  1CKM A;  1V1Q A;  4HIM A;  4BY1 G;  4P73 A;  4JI5 L;  1UE6 A;  2AHO B;  4LFB L;  2EIF A;  1YJW A;  2N3S A;  2WAQ E;  2K75 A;  4JI2 Q;  2UXB L;  1JE5 A;  1YHA A;  1RL2 A;  3KOJ A;  4RG1 A;  4BBR H;  1PH1 A;  4MTN A;  4A3G H;  2NVT H;  1K0R A;  2OQ0 A;  1XJV A;  1VQH A;  1IL2 A;  1JB7 A;  2MO1 A;  3PUV A;  1PH5 A;  1SFO H;  1V43 A;  1YBY A;  4DV7 L;  4A3G G;  1HNW L;  1KRT A;  2BA0 A;  4B3S Q;  3A5U A;  4JI4 L;  1IXR A;  3PGZ A;  4LNQ A;  1V9P A;  3CW2 C;  4GLA C;  3CCV A;  2PNH A;  3CF5 A;  1XNQ L;  1MIU A;  1KD1 C;  1AH9 A;  1VQD A;  2VUM G;  1Q81 C;  2OTJ A;  3PO2 G;  3NEL A;  1TWH H;  4DV1 Q;  4JI8 L;  1N33 Q;  4BA2 I;  2B63 G;  1NE3 A;  4IO9 A;  3K81 C;  2HQL A;  4L5R C;  3KF8 B;  4X66 L;  2YU9 H;  3T1Y Q;  1Q1B A;  1YEZ A;  2QA4 A;  2AWN A;  4DV4 L;  3K8A A;  4JCV E;  1Z47 A;  4PZ6 A;  2KEN A;  4DR5 Q;  3H0G H;  2JA7 G;  5JJI A;  1BBW A;  2JA6 H;  2I5L X;  1EYG A;  3FP9 A;  3NEN A;  4GKK L;  1CKO A;  4POF A;  2V1C C;  1G6P A;  1WYD A;  2UU9 L;  3CCJ A;  4OO1 G;  4KHP Q;  2CWA A;  1JMC A;  1OXV A;  5M5Y H;  4B3R Q;  1E1O A;  4LW1 A;  1UEB A;  5C44 H;  2DGY A;  1N32 Q;  4YWM A;  5C4X G;  2PI2 A;  4OO1 I;  2NVX H;  4AIM A;  3CCL A;  1LM0 A;  4X62 L;  3BU2 A;  2K5H A;  5C44 G;  1XMQ L;  4LF7 Q;  2EXD A;  3FKI H;  4HID A;  1TWA H;  1Y1V G;  3E9H A;  4R4Q A;  1S72 A;  1VQA A;  1N36 Q;  1JJ2 A;  1QVF A;  5IYC G;  2D0O A;  3CAM A;  1IBL Q;  2I0Q A;  2N8N A;  1EFW A;  4L5T A;  3GTK H;  3FKI G;  5H1S E;  4LF8 L;  2R92 H;  3ICE A;  3K7A H;  4DR4 Q;  2WAQ G;  1EOV A;  5FJ8 H;  2AMC B;  3DLL A;  2NN6 G;  4IPG A;  2CKZ B;  3UDF A;  2R92 G;  3U4Z A;  1PYB A;  4LFA L;  2VQF Q;  1SRU A;  4L5S A;  5GAE C;  4JYA L;  4X64 Q;  2PMZ E;  4NXM Q;  1X6O A;  1ASY A;  2JA8 H;  4DV6 Q;  2VNU D;  5GAD C;  2NN6 I;  1J5E Q;  2ID0 A;  3CMA A;  3U58 A;  4LF9 L;  2UUB L;  2K50 A;  3KFU A;  2VL6 A;  3AQQ A;  1A8V A;  3F1Z A;  4DV3 L;  3K0X A;  3S17 H;  1UE7 A;  2PI2 E;  3EBE A;  1H95 A;  1VQM A;  1VS0 A;  1U0L A;  2OQK A;  4TQU S;  2ZJR A;  3MEF A;  4LUZ A;  4ME3 A;  4MZ9 A;  3UDI A;  1N8R C;  1VQ7 A;  1YVC A;  1HZB A;  4P72 A;  3PUX A;  4YWL A;  1NJI C;  3PUY A;  5IT9 c;  2AWO A;  2KCT A;  3S1N H;  4GNX A;  1TWC H;  2JE6 I;  4PZ8 A;  1PYS B;  1HR0 W;  1Q12 A;  1HZA A;  1FVI A;  2MQH A;  2WB1 G;  4YCU A;  2UXC Q;  3ERS X;  4H02 A;  5EAY A;  3UDX A;  1SMX A;  4R1J A;  4DV2 Q;  3NEM A;  3PV0 A;  1PH6 A;  2Q2U A;  3RLO A;  4DR1 L;  4GLV B;  4A3K H;  1I94 L;  2OWO A;  2JEA I;  4HJ8 A;  3I2Z A;  1PH9 A;  2YYZ A;  3U4V A;  1K83 H;  5IE8 A;  3TS0 A;  4NXN Q;  1UWV A;  4IPD A;  4A3I G;  4A3K G;  3PUW A;  1YJN A;  3Q8D A;  2ZTD A;  5LMN W;  1VQN A;  3I4O A;  4JBJ A;  3OYY A;  2EQS A;  3UDG A;  3S1Q H;  5IWA Q;  1K3R A;  3TEH B;  5IYD G;  3GTP H;  3HOU H;  4JI5 Q;  1B7Y B;  4LFB Q;  1UE5 A;  4HJ5 A;  4KHZ A;  4NPS A;  3G71 A;  3CCR A;  4OX9 L;  2UXB Q;  2ZTE A;  4DUZ Q;  1X9N A;  1N9W A;  2R7D A;  4AQY L;  4A3L G;  2RF4 A;  3J80 c;  3G4S A;  4DV0 Q;  3PO3 G;  3HOZ H;  4O2D A;  3HOU G;  3W1G A;  4DR7 Q;  4DR3 L;  1RIP A;  4R4O A;  4BBS G;  3F2C A;  3SGI A;  1Z9F A;  3RZO H;  3D0F A;  1VQI A;  4PZ7 A;  1VQE A;  2MO0 A;  4JOI A;  1YZ6 A;  4DAM A;  3IRB A;  5J3B A;  4DV5 L;  4IOC A;  3HOZ G;  1OXT A;  1QUQ A;  4UP9 A;  1VQO A;  1SR3 A;  2VS1 A;  4C3J H;  3A74 A;  4POG A;  1J6Q A;  4OWX B;  2BH8 A;  2KCM A;  4GOP C;  4JC0 A;  2R7Z G;  4JI8 Q;  4JI6 Q;  4JI0 L;  3PCO B;  4JI3 L;  1X3G A;  3VDY A;  1Q82 C;  4C3H H;  1D7Q A;  5LMN L;  5LMU L;  4A3F H;  1YIT A;  1K9M C;  4LFC Q;  1HNZ Q;  1PH8 A;  3GTQ H;  4X65 Q;  2VUM H;  4LF6 L;  3PO2 H;  1A63 A;  3T1H L;  3F2B A;  4QQB X;  2K5V A;  3CXC A;  2B63 H;  4A3F G;  2UU9 Q;  1LYL A;  2AKW B;  4GN5 A;  4HIK A;  3M4P A;  4JI7 L;  1WOC A;  4XTC S;  3TRE A;  4DKA C;  2BA1 A;  2JA7 H;  1T9H A;  5AJ3 Q;  1VQP A;  4DR2 L;  3OTO L;  1XPO A;  3HOX G;  1MJE A;  3KF6 A;  1B70 B;  1QZH A;  4A3E G;  4GKJ L;  3GTJ H;  2ZJQ A;  4JBK A;  2WB1 E;  1XMO L;  1M90 C;  3M85 A;  4X62 Q;  4GS3 A;  4OXP A;  1XMQ Q;  2I5M X;  1AE2 A;  1PA6 A;  2GN5 A;  2OTL A;  4DPG A;  1IBM L;  3S2H H;  2E2I H;  1KC8 C;  3H3V I;  3TRZ A;  5C4X H;  4K0K L;  2ZTC A;  3KLW A;  4QGU A;  1CSP A;  4LF5 Q;  3PF4 A;  3ULP A;  4DR6 L;  3S15 H;  1JJG A;  4JI2 L;  3CCE A;  3HOW G;  4KI0 A;  3G48 A;  4WJ3 M;  1FGU A;  4HJA A;  2LSS A;  4GNX B;  1R9T H;  2Q2H A;  1UE1 A;  1Y1V H;  1Y1W H;  3CD6 A;  1P16 A;  3TS2 A;  1EWI A;  2ZM6 Q;  5IYC H;  4LFA Q;  1VQC A;  3J81 j;  4JYA Q;  3F2D A;  3FHW A;  2VW9 A;  5M3M G;  1BKB A;  1Y1W G;  1K8A C;  2VQE Q;  4LF9 Q;  1PVO A;  3KDF A;  2N49 A;  5JJL A;  4QJF A;  4IJL A;  2JA5 H;  4JI1 Q;  4IFD G;  3S1R H;  4A3D G;  1N33 L;  3GDE A;  3KJO A;  3J81 i;  1YI2 A;  1X65 A;  1VQL A;  1W3S A;  2R93 H;  1VQJ A;  1FJG Q;  1PV4 A;  4JBW A;  4IFD J;  4P71 A;  1OXS C;  5IP9 G;  2JA5 G;  1XNR L;  2Z6K A;  5DLQ E;  1HZ9 A;  5E7N A;  4IFD I;  3DM3 A;  2R93 G;  1XPR A;  2E5L Q;  2ZJP A;  5C4J H;  1TXY A;  4XIG S;  3UE0 A;  1P8L A;  2IT1 A;  4DR1 Q;  4A3M G;  2UUC Q;  3H3V H;  1I6H H;  3S16 H;  4O0A A;  3TQY A;  4YY3 L;  4DUY L;  1BVS A;  4EQ5 A;  1W2B A;  3CPW A;  4LF4 Q;  4LWC A;  3I56 A;  4B3R L;  1E24 A;  3PIP A;  5M5X H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...