3L3OC

Staphylococcal complement inhibitor (scin) in complex with human complement component c3c
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
306
structure length
294
Chain Sequence
b'CNKFDLKVTIKPAPEAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C3
publication title Molecular Basis for Complement Recognition and Inhibition Determined by Crystallographic Studies of the Staphylococcal Complement Inhibitor (SCIN) Bound to C3c and C3b.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 53
structure length 294
sequence length 306
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3l3oC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 3l3oC01
1AYOA 3HRZC 1JC7A 1BV8A 2J0TD 3G6JB 5JPNC 3CKIB 1OO9B 3OHXC 2QKIC 3KLSA 2ICEC 3V96A 1EDYA 5FO8B 1D2BA 1UEAB 1BQQT 5FOBB 2WINB 1GXDC 1JB3A 4FXGC 2A74C 4FXKC 4D94A 3MA2B 2WIIB 2I07B 3L3OC 2XWJB 1BUVT 3I70A 3HS0C 5FO7B 1UAPA 1PXUA 2A73B 2B39A 2TMPA 4LNVA 1BR9A 2E2DC 2PN5A 5JPMC 3T4AC 1XWEA 5FO9B 3CU7A 2XWBB 3FRPB 4ILWA
chains in the Genus database with same CATH superfamily
5E9DA 1KTCA 4F7CB 2RCSL 3OJDA 1HZHH 1HCFX 1MDAA 4I0CC 1CIUA 4PJIF 4POZC 3V4VL 3QPXL 2K7VA 2F1BA 3SKJH 4JGUA 1DUZB 1A47A 4PBXA 3IFNH 1IYJB 3GRGA 5EU4B 5KW9H 4XR8C 3BSZH 3QEQA 3HR5B 3UAFA 4CBPA 3EXJA 1L9NA 2ITDB 2KT6A 1IQWL 4G7HC 1CLOL 2NTSP 2GC4C 4GPVA 5EOCL 2E6JA 5AB1A 3SY0A 2BH8A 1D6EC 1KN2L 4HJ1A 1KPRB 4R26L 3UDXA 2VOTA 2PO6A 5E4IA 3EYVB 4XO4A 5C0XH 3S1MH 1WHOA 1S46A 3GSNB 4R0LB 1G8ZD 2NTFB 4PGDB 3ASWA 1F2XK 3HE6A 4U6XB 3CCMA 3L9AX 1CA5A 3W2DA 3Q5TA 3QR1A 5E1AA 1S5CD 4K5WA 4IGBD 4PR5B 5E5MA 2WFWA 3D25A 4R1JA 3D6WA 2JB6B 3RMHA 1MFDH 1K0SA 3WUWA 4IJLA 1OVZA 3HEJA 5E95B 1O5DT 4WSGA 2DYPA 1NGWB 3H9SE 4GKNA 5E0QA 1OXTA 1IKNC 3VR3A 1LEGA 1NGPL 4JFDD 4WO4A 5D7IE 2R69A 5EU5B 3ZMEA 1RMFL 5CGYD 1MRDH 2DNCA 4JL1A 1CKNA 5E1FA 1TXYA 2WQAA 1YEDB 2AEOA 4N9OB 3MNWB 2COVD 4YSDA 3ZY7A 1CBJA 3BVTA 3RZWA 4ZSOB 4XP6L 2XCMC 1J8HA 1QHQA 2CD0A 1J7VR 4IJTA 3E80A 1CG9A 2F19L 2E2HB 3ESOA 1SXAA 2YEZB 1CL7L 4TVUA 5BNXD 4R8IA 1JGVL 2YTXA 1FIEA 4FQLL 5JTWA 1HN1A 1A7OH 1RHFA 1N70A 4M02A 2FINB 4FO2A 1BBJA 5LB1A 4PP1C 4PJBE 4ZUUB 2XJLA 2H0EA 4CADB 1WWWX 1NIBA 2V17H 1P7QD 3IDGA 3QJFA 4TNVF 1HWWA 1YG9A 1DDTA 2W60B 1EY5A 3ZE2F 2BIIA 3BUDA 4V1DE 4N2LA 2WQXA 4KROB 5FLMG 3MXVH 4LVHB 2Y36L 4FYTA 1YUHA 3SBPA 4MA1B 3TBVB 5CCKL 1OAQH 2GITA 3OAYH 2NX5E 3QFGA 4YHZL 1QG3A 3QSKB 3VXMD 2X4PB 5ACZB 4ODVL 2IOOA 4LASH 3A4EA 3STZB 4ZNCD 1K4CA 5C0AD 4FI6A 1KCBA 4P5SA 2VR8A 3PU7A 4UTBH 3U30B 4AJWA 4HSQA 4UQAA 4JI4Q 1NCDH 1G7MA 4Q6IA 4ZUWB 2Q10A 4G8FB 4GMTL 4RQQB 4BYHA 2X1WL 3FO2A 1T03H 1CD8A 3DHJA 1FG2B 1WAAA 5EZIL 3T4YA 3RTQB 5IFAH 5CUSH 4XBGA 3VI3E 3FAXA 1E50A 3IVKB 1OCWL 4B9XA 2YA0A 3PJSB 4NKOA 2ORBH 3L3GA 3WHE1 5IV2A 2Q8BL 1C5DA 4GXUM 2JIXB 3OHXA 4TQ8A 3UYOD 1PZ5A 3RP1A 3IETB 4WGKA 1DN2A 4X6DB 2WXKA 3BAYA 1YUKB 3QO1B 5B39G 3STBD 2WLNA 2JJVA 2D0OA 4L3FA 3AQXA 2EIMB 1BDYA 3EIFA 3GQFA 4LNRB 4NUGL 4MLIA 1CJYA 4NDMB 5KJ4A 1GTNA 3NBHA 3HMXH 4F91B 4MNGE 3WDHA 1Q1JH 1KLFB 3ISRA 2EAEA 3HKZA 1EEYB 4WFFE 5KVGL 1NFDF 2VB2X 1OTUC 3DC0A 5F89A 2WVTA 3RAJH 2ZUUA 2WLKA 4RCOA 2BXZA 5GRXG 3SPVB 3G6JA 4JUTA 4UTAH 3N5AA 5IIFA 1W91A 4KJYB 5GZNC 3UYPB 3V5HB 2F0TA 4GRLD 4L8CA 4NIYE 4LPCA 2PZTA 2AV7A 3A74A 4QXGL 2VDQB 4JQXA 4X50A 4Z7NB 1F11B 1P6WA 3UE0A 3S15H 3GK8H 3MROA 5GPRA 4ETYA 3Q01A 2YGOA 2R2BB 3RE0A 4Q9CA 3VFMB 2ZXBA 2B2VA 3GS7A 3U9UA 1J5OL 2G5RA 4OX9Q 3A6OA 1T0MB 4LDEB 1LT5D 3II1A 3HKSA 4NC2B 2YARA 2DWYA 3T0DA 4WV1A 4Y7NH 1ACXA 1U8PB 1N6UA 3BPCA 1IIIA 4NO2B 4F7PB 2AJ3B 1CGXA 4JY6B 1WWCA 3LZRA 3BKCL 4OTXH 5KTEH 1OXUA 1WTPA 2VLKE 1CGSH 3TT3L 1YSOA 3QJQB 3SODB 4P71A 5ISZE 4J2XA 3OW2A 1LT4D 3LHPL 3RA7H 2VB3X 3ZKMC 1AGBA 1FC1A 2GT9B 4F7EB 1PLBA 4PJ8D 5KYWA 3HZKA 3QARA 1F2ZA 1L1OA 3CQZH 1QVOB 3QUKB 4MXVE 5G55A 5HVWA 2JF1A 1M7DA 3GTTA 1QLFA 2XWZA 4KXCA 4XCNA 3VD3A 1U3HD 3HPJA 4AIXA 5CV8A 4M5ZL 2X40A 4AYGA 1LTRD 2WKDA 1X9NA 3VA6A 4QHLA 5K1JA 5GS0H 2FO1A 4X6FB 5BVPH 4YC2B 2RCFA 4B3RQ 1MI5A 1ZT4A 1YJDH 2K5HA 3EFOB 3H42H 1Q9LB 1RJZA 3CFBB 4RRPM 3O45A 4DV6Q 1AE6H 3G4SA 4ZS6C 2NY3D 2ZTDA 3LOWA 4UOQA 1UACL 5FK9B 1KXHA 5I2IB 4LPVA 1ML0D 4WFHE 1YN6B 2MNAA 3RGBA 3WIHL 3ULVF 5DI8B 5BZXA 3QO2A 4GG6A 4HEDA 1WIPA 5B7MA 1AZNA 1PY9A 3T1WA 1XGUB 1P4LA 2IGTA 5C6TH 4F7MB 5AVQB 3R4DA 1NCOA 4Y4KA 1PH8A 3DMMB 2BNUA 1ZEAL 3IGFA 4RGTA 5J8OA 4IPGA 5MERB 4IFDI 3EDEA 4K0OA 3I9IA 2UUAL 4HJIA 5CJBA 1AIFB 3CZFB 3P7JA 4A2DA 3D4WA 4P3CH 1B3AA 2J4XA 1T7XA 4IBLT 4AUUA 1F97A 3FQXA 1ZXQA 5GGTA 5E24E 3EW3B 4DAMA 3VW3H 2A6JA 4FTDA 4L8BB 3VGHA 1HWGB 2DJ4A 3RWGA 5AG9A 2XBZA 4ONOA 3O41B 3PXLA 3DJTA 3FB6A 2WAHA 4LCYA 4LSTL 5D8JL 4PGEB 3UBXG 4Y16D 3CPUA 2VERA 1IM3B 1V43A 4HIOA 4MJ4A 5F2DA 5FV2A 1PZBA 3ZT5A 1XGTB 4QRPB 3VJ6B 1R3KB 2JJTA 3C8HA 1STBA 3DROA 3P77A 1SBBB 3T13A 1ETZA 3K8LA 3D4DA 2NR6D 5J56B 4IBTA 5JHBA 3IGKA 2Y2WA 3UMNA 4X98B 2Z31B 5DM73 3D0LA 3FN0H 3Q44A 3IDIA 4D9RE 1U30A 2VKXA 1WD1A 4JB9H 1IFRA 3MRDB 3DSNA 1X9UA 4LKCA 4H0LC 1SMYD 3TP6A 3GJEA 2Y24A 1MJCA 1WEJL 3JWOC 1PH9A 1UHVA 3L3DB 1HHVA 2JCCE 3LRGA 5GHWL 1T04B 1WAPA 2F54B 3DEOA 1F2MA 2AUJD 2WC7A 4HHWA 3X3GL 5A3ID 5BR8Q 2DW5A 3CZGA 1EERB 1TIUA 4GIOA 4KVCL 3I3CA 2BNQA 2YAPA 4KTDH 2Q5BA 3F85A 3LVEA 3IDNB 1KXTA 4OM1H 2UU9L 2BNRD 4XCEB 3H09A 3CLWA 4S0TD 4AMKL 3IXAB 2K8QA 3C12A 1JR0D 2GHWB 4PJBF 3EYUL 3BVGA 2VW6A 4GKLA 5D1ZB 1NMAH 1UFUA 1XV8A 2J71A 1H15A 1LP9E 2VE6B 3S5LA 4EN3B 3H54A 1A2UA 1FFTB 5DMGC 4LGSB 4MNOA 1GSMA 5B1AB 2XLLA 2BVEA 3D18A 2KZWA 3T6ZA 1GJIA 1SMXA 1KV3A 2VKWA 1OTTC 4TYUA 3ZX1A 5M5YB 4ETQA 2IH8A 1LYQA 5J13C 3VFRB 4GUPB 1LYLA 2FJGA 3NCCB 4PWJA 5GJTH 1XJVA 4PW4A 1PYWB 3MRGB 5AB2A 5T3XL 4UIKL 4P46C 2P3YA 3R3OA 3MX0A 4DTGH 5E08L 2N1KA 2FQFA 1TU2B 1YZ6A 2OTUB 5GZOA 4CSZA 3SSGA 2RDHA 3MRJB 3VI3F 4M3HA 1OIOA 1KCVH 5CIPB 4Y8AA 3FHQA 3QO0B 4TVPE 5LBVA 4PS8A 3M4OB 1KCUL 4KJPD 1L5GA 3V6FA 4CJ0B 1NSNS 1G6RL 1XIWD 3S1NB 3K6SB 3E6ZX 3WTWA 3SCMD 3OC5A 4CJ2C 1QUNA 3QRBA 4LLMB 2NTSA 4LIQE 2X7LA 1RHPA 1CL7I 1EEZA 3ME0A 5D7LD 4DV1Q 5C0NC 5D7JD 4FF4A 3T0AA 4F2FA 3GSNA 3ZBMA 3VACA 3QQ9D 4HKZB 4PGDA 2C1OB 1LO4L 2R29H 5AOMA 4F8OA 4HA1A 3S3BB 4NJAH 3A47A 2EYJA 4WEEA 3GMLA 1FQ9C 2K8MA 2QVFB 3VFUB 1RVFL 3FBQA 3MRNA 1G9NC 3SGKC 2AC0A 1Y1VH 3UXFA 4PJ5E 4EDWH 4MJJA 1I6HH 5M94B 3K6OA 3OIQA 5MENE 2NVYH 4U1SB 4AGOA 3O3BA 3BVMA 3N50A 4JFZH 4UDTB 4ODUA 1B7YB 1Q0XH 4F57H 2MQ0A 2VZ3A 4FQ2L 3SGJA 2FK9A 1AZPA 1U2YA 1VJSA 3CFJB 2PXYD 3HNVH 3HB3D 5E4EB 5JW5B 1J18A 2C3VB 4IOAA 4IKLA 5EU5A 1NBCA 3SYAA 5E0FA 4BSVA 4KNTA 4YS4A 3N42B 2DLIA 2Q9OA 3FRPA 3TJEL 3ATDA 4IHOB 5EBMB 5HHPA 3MNWA 1MFVA 2DQDH 3HI5L 2I5YL 2HHHQ 4OXPA 4PJDA 4DUYL 3DUSB 3OWEA 2HRLA 1I1YA 4OKVB 4PIBA 5GRJH 5IKCA 3L48A 2ZWLT 4G8IB 2X0WA 3Q6GL 4CBVA 3M85A 4OZFA 4G7YL 4WUKH 4KJOA 1VERA 3FL7A 3VI4E 1AO7D 2JI2A 2J56A 2Z8WC 1YECH 2LFGA 5JLZA 5I1EL 4A3IG 1CBVH 4ZRGA 3OMIB 2XXMB 3J8F7 3V79C 1O7DE 4M6NH 4NPYB 2KHJA 3HOVG 3TBVA 2BM3A 4MXVF 4OV5B 4OIIH 5EOTA 1FN4A 4MD4A 5EZLA 3BKML 5C0FB 2OJ1A 2W9LA 4FNRA 5EF0A 2EH8L 2BE5C 1UH2A 3UTSD 3ULPA 3MHZA 1VGKA 2VCOA 1DVFB 2WO4A 2F0WA 1CZ8H 3I6KB 4RQQA 4IDJH 3GSRB 4J3OG 3QOLA 1A7RL 2CH8A 4F8LA 2Q3ZA 5NUCA 3KPRE 4UOZA 3T77A 5E3FA 1CYGA 5B1JC 1V1QA 1UZGA 4OONA 1AY1L 5DWUL 2VLMD 1V1OA 1KN4L 3K72B 1DOLA 1DLHB 1BOGB 2X4NA 3SGEI 5K9OB 3MLYH 2HMIC 1I94L 3HAEB 4X42A 4AYBE 2C9RA 5DQ9A 4YHMH 1U8IA 4J6HA 4N2FA 4NXKA 2XPYA 4P2AA 3MV01 4TUOB 3QO1A 4YCVA 4N8PA 5DJ0A 3CMGA 4KKRA 3HI1A 1OAYH 5C3EH 3WWVA 5DZAA 3JAMi 4AGQA 3ULVH 1ZDQA 2CRZA 3D30A 4LNRA 5TE7L 3ARBC 4XP5L 4NB7A 1KLFA 4Z7WE 1YDPB 2DBJA 4B3VA 1VZGA 1ZEQX 1NCIA 3U83A 1OF0A 1BVLA 2Y1AA 3TS2A 4BY7B 4FL4B 3D3VB 2YD2A 1L9RA 1RKNA 4KKNA 4LF5Q 5C4ZA 3SPVA 2EABA 2FQGA 3VX1A 3B1TA 2YPLA 4TNGA 1H5BA 3UYPA 3FAWA 4TUUA 1ZV2A 4RZCB 2D7NA 4TM9A 2UXTA 1CFSB 4F9LA 1KLUB 4QDGA 1VIWA 3CD4A 5I1GL 4X8CA 2K4WA 3EYFB 3QQXA 4JZJC 4P2OA 3WFCL 3Q2LA 2EDXA 3ZW3A 3P9LA 2Y6TE 4YSQA 1HEHC 2X9WA 4ADGA 2R2BA 4K3JH 2KECA 1T4WA 2AMUA 4JBWA 2R0KL 1FGVH 2B2XL 4AYBG 4Y9FA 5HJDA 3UOAB 3FCTB 4F8TA 5JW4R 4MJIB 1KQSA 4Z9CB 1F4YL 3GSUA 5LDSA 3H3VH 5LMUQ 4M8VA 2IANE 4N8CH 4PY7A 3BGFC 3MRQB 2RBMA 4JY6A 1ET9A 4I13B 5JHDD 5FLMH 2EC8A 4BDVB 4DGYL 3LGJA 2JCCF 5CAYB 3BQUC 1N2RB 3T4AC 2A6KA 5KS9E 4I0PC 3HC3L 2AZAA 1LTTD 1QUQA 1XGYL 3NYKA 1EPFA 4MAUL 1T5KA 1O6VA 1AZVA 3HRZB 2F0EA 3NJFA 4OLEA 1JC7A 1EZ6A 3EYOB 3NCXA 2UY6A 4MZ9A 1NMBL 3VXUB 4HWBL 4UUJA 3A21A 1SM3H 1TQSA 5KSBB 4BS9A 1F8TL 2QMJA 2RR3A 5FOBB 1UE7A 4AYSA 3RWFB 4LF7Q 5IM7B 1LP9F 4D94A 2X2HA 5FKPA 5KVDL 1IKOP 3T51B 4PWKA 3CFCL 3QT2A 1ERNA 4WTZG 4EI5C 1I3QB 4C83A 1TQWA 2G2RA 3ZTEA 1BWMA 4Z3FA 1PDKA 4HGMA 3HHSB 2LABA 3BZ5A 1QA9B 4GKZB 5BZWB 3DETD 4U1HB 2VZOA 4WJ5A 5CMAB 2D3VA 4FQCH 3TEHB 2VRKA 4JI6Q 3NJXA 1KLGB 4KI5E 3H55A 2JA5G 4LFHD 4Q6KA 5E6RB 5D5MA 5ACMA 1TZGL 2IPKB 2N7SA 3B2VH 4HIDA 3EJZC 1MAJA 3ESPA 3CHRA 1SBSH 4HIEA 5ICXA 2B2TA 3UERA 1IGYB 6TAAA 4RAUA 4ZS7L 1K8IA 1SEBA 2YA2A 3TP8A 4JV5L 3PWLB 2H9GA 3K71B 1WUZA 4GW5B 4L8BA 4HIIA 4EIBA 3F83A 1JNHA 5JUEH 1FLTX 3W9DA 2CVRA 3C5ZB 1XD1A 3FO0L 5KOMC 5J6GB 3CZEA 3U1PA 4XBPA 1CZWA 4JFFA 5EEVA 1HQRA 4M93C 1OPOA 3GMPA 2IO5A 5DXWA 4OF6A 4MVBC 4XP9L 3RIFK 5EPJA 1G7QB 5I1DB 1LACA 2WCPA 1WTWA 5T3ZH 4Z3IA 4KXAA 4IJ3C 5C0CE 3IN0A 1M2VA 1OGAE 3IGAB 4HUUA 1E8ZA 1T5WB 5T1LA 4LF3B 1TZAA 2Y7LA 5JIIA 1QKZH 1VAHA 2R23B 5CILL 5CBAA 5JOEA 1BPVA 4ZPTB 1GZPB 4Z7OE 4RGOS 3GJFK 4OUOA 4JREC 3QRGL 3S16H 3MRBA 4ZODA 3HZXA 2ESVD 4PRBB 1KCLA 1DBKH 4GUOA 2CE6A 1PQZB 4HKBB 1TWAH 1MJJB 3KYOA 1KJVA 1DO5A 4NQEA 2IAMA 4MQ7B 4J3OF 2YAHA 4E0RB 4H26A 1U9RA 4LSPL 1T04A 1MFCH 4IMKA 1PKQA 2C5DC 3BP7A 4O5LH 3A8KE 2F54A 4UQCA 1MH5B 1X32A 2XV0A 4DR1Q 2ICWB 5LXGL 4KMQA 3MXNA 5LGJA 2XXCB 2MTAA 2QVMA 3LQMA 1T6VN 4I48A 5DRWA 3IDNA 1QSFE 1E3PA 1H8LA 5A16B 3LIZL 4ZUSA 5JA9A 5KVFL 3L3JB 1J1XL 4YBHA 2EYFA 4N6QA 3S37X 1GGUA 4G6JH 1I6VC 1OSYA 3VI4F 3TZDA 5C0RL 5D1ZA 4ILDA 2I5HA 4HFUL 2VE6A 5LHY1 4GXVH 3ZE1B 1GS6X 1C1EL 4LU5L 4O4YL 3L1OL 3RTQD 3ZR6A 4PRHB 1PS3A 1XVSA 4HUXA 3LWEA 3I9AA 1JORA 2O4XA 4R90H 5EKKA 2OMBA 2Y22A 2EE3A 5DC4B 1UKQA 1G0XA 4PG9B 1TTBA 4QY7A 1DBBL 1RIVH 4Y9GA 3H9SB 2P8LA 3R8BB 2Z64C 2BVPB 3BP5A 3GI9L 4WO0A 3NAAH 1AQKL 4HLEA 4NUJA 2DLTA 2WO2B 3AXLA 1UT9A 3S48A 5JDJA 4ZW7A 1A6TB 3QO0A 3J81L 1NC2B 1T89C 5HYQB 1U92B 4LRNL 3IWVA 3ABKB 4P59L 3C8KA 4LLWB 3JWOL 3X3MA 3KGSA 2GYSA 1BECA 4L1LA 3O8XB 3SD2A 1P53A 3AU0A 4MXQD 3NA9H 2EOTA 2X4RA 5FB8A 5B39B 3QCTL 4GMSH 1N8ZA 4LGPB 1JD7A 1JCKB 4NCDA 1OWWA 2HVJA 3J7HA 5FUZL 3WIFA 1NFIA 4V1DB 2JK5B 2WNKA 3G6DL 3OX8A 1FSKC 1NCCL 1DM0B 2NX5B 4G1EA 5CEZD 2C1OA 1GZHC 3JAME 4Z7WF 2F3WA 1YNJC 3WLWC 1QSEA 1RJLB 2X3AA 1RJYA 3DJ9A 3U4ZA 3ZZ1A 5F3HA 1BJ1H 3SOBH 1WE5A 1F9QA 3QZNA 4M9PA 5HBBA 2Y0SA 4PHZA 2GI7A 2E5LL 1UWGH 4DGVL 2WYIA 3UL4A 3VI3B 3UZVA 1D5XA 2YQBA 5T3XE 2C3VA 4LVOB 1DZ0A 3DA0A 1NMCB 4LCUA 2L9HA 1OF2B 1UD3A 4G59C 2B2WA 1X3EA 2O61B 4AQAB 3OAUH 4C3IG 4HGKC 3TCLB 2DGYA 2HLAA 1UWFA 5K39A 3NESA 2I9LB 3T1HL 5DJXA 4E36A 4M62H 4IRZH 1PY4A 4U6YB 4K5XA 4QHUB 5SX5H 5IHZA 1JV5B 3T04D 1KBGH 3KF8A 1X4ZA 3WFHA 1YEEH 3D4ZA 3S14B 4CKEA 1FAKT 1STEA 4JHAL 5BN3A 3JV6B 5DK0A 1CLZL 1HZCA 2H7WA 2R83A 3BP6B 2MQCA 4HSPA 1CHQD 1A14H 4ABNA 2FZ3A 5DD5H 1P4BH 5KS9F 2CW0D 4LSVH 1I9IL 5FFOA 1RZKH 3TT1H 5IREA 1S3KL 5KBMA 4UILL 2EE1A 3SE6A 3CXCA 4QCLA 2NQCA 3SXHA 4IOCA 5C0FA 5TH2A 5EAYA 4I0KA 3ML9A 4FZEH 2R0WH 5D93C 1ZPUA 2ICWJ 5EIIG 1OGSA 1DD2A 3DMMD 1A7QL 5ETUB 1ZMYA 2NSMA 4ZD3L 3I6KA 3N85L 3WO4C 4X5RA 1G9NL 4WQOA 5KVEL 1LO5A 1MCLA 4NCC2 1Z7JA 1VQ5A 3B1UA 1BW8A 3UX9B 3X1FA 1DOMA 2RACA 5BV7C 1UM6L 2B59A 2HRPH 4YE4L 2JE6I 5CD5C 1ND0A 3B9KB 1KY7A 1JI1A 3CMAA 1XMQQ 3HJEA 1TSRA 3LS4L 4PZ8A 1LEKA 2AFNA 3P0VL 3NSWA 3PV0A 3VG9B 4BUGA 4DP7X 3T3PB 3RDTD 4H0GA 5MP6L 5A6LA 3GSQB 1L7TL 1HSBB 3F12B 4KI5F 5ANHA 5I73C 4FQQA 5IB1B 2H32B 5JQ6H 3IDJB 1SOSA 2A6IB 1A0QL 3AT8A 5ISZB 3MRRA 1CQKA 1X9QA 4ZAKB 2FWOB 3O11A 4YR6A 2Q8TA 2V2TB 1SY6A 2X9ZA 4B5ZA 3MLUL 3RL2B 3ES6B 2Q7NA 1GKHA 4XMUA 1OP9A 3MJ8A 3DHUA 4HH8A 3O0RH 5C6AA 3AU1B 3D2UD 3ZKNC 4I5BB 4XWOD 3BVDB 2RIKA 5A2AA 5LJYH 2D5DA 1RIHH 2DI9A 2CUAA 2A9MH 2WANA 3ECVA 4YBQD 2Z31D 5A2KH 4B9KC 3NSXA 2QSCL 1RPKA 3VFGL 2B3IA 1KJ2H 4JO5A 3BZ4A 4ONHB 1HH6A 1NCAH 4TVPH 5C07E 2Y6SC 1CM9A 1FDLH 4IEFB 5EO0B 5I8CA 5TDPA 1AP2B 5AAPA 1KLUA 3M3YH 5JJLA 1BAGA 1WC7B 3RWCA 3UGXA 4BFJA 3EYFA 2H3NB 4XMXA 3V0GA 5DS1A 1HZBA 3UG3A 1B44D 4RKLA 4LIQH 4CSTA 5GS1C 1HXMB 3BVZA 2V3FA 3AFLA 4Z7OF 5E2UH 3IJYB 1G7HB 2APXA 4X6EB 3I02A 3C2PA 2XBDA 4OFYD 4AK2A 5BPPA 2CALA 2F08A 3O6LH 4A3IH 2J25A 3MLSH 3OD3A 3RVUD 5I0WA 4FXKB 4EN3D 5E8NA 3ETSA 1O78A 4ODWB 1SYFA 4JI0Q 2E76C 2BSSB 2OKMA 4IDLA 5FYJL 4X7SL 1LT3D 4M7ZC 1SLUA 2P46B 3OXSB 4Q0FA 3C60A 1KIQA 2V2XB 2YD1A 1G7PB 4NN5C 1IC1A 3UP1A 3TASA 2BSED 2CZNA 4JNXA 1NDMA 5H35B 5A7BA 4JQVC 1EZVX 5EO1A 3QAZB 4JFXB 1EZVY 1PYWD 4WFN3 4IBUA 1IIKA 1X56A 1JN6A 2RCSH 4J3OH 2L7UA 2L7EA 3GWJA 5GS0D 2HKFL 2K6AA 1BO0A 1ASZA 2VLRE 3ARDB 3QPXH 4GRWE 3IMSA 4PLKD 3V4VH 1DQJB 3I7FA 2K33A 1ROWA 4Z7QB 5I6KA 4QIRA 3ZHDA 2F1EA 4WW2F 1Z9MA 4JN2B 3RHWF 2EO1A 2JKRM 4OLVL 4KWUA 4RFBA 3HVDA 1LQBC 5ESQB 3D39B 1M05A 4ZO6A 1TZHA 4LSQL 1OSEA 1HNXL 1IQWH 1YEJL 3OMNB 1CLOH 2ZICA 4A2GA 4GKZA 5EOCH 2OMYA 3BIBX 4XMVA 4L63B 1H3VA 5CMAA 1KN2H 4R26H 2R27A 1BCPB 5DD1L 5IYCG 1PMYA 3KM2A 5JOFB 1QZ1A 5LBSA 1TITA 5SWZA 3FQRA 2G60L 3IFPA 1QSZA 3MZ5A 2WP3O 4PV9A 5DJ2B 1K4DA 3MV9D 3HOZG 3QYNA 4AV4A 1LDPL 3Q5YA 3RGVB 5HPMB 1BMZA 2JKSA 2CWAA 3PWLA 3JZ7A 5F7FA 4DERA 1S3RA 1JV2B 2CHBD 4P5TC 3ZTCC 1PD6A 2L11A 3M7GA 1GH7A 1CWVA 5IR1B 2KCMA 3MKGA 3W1BA 1TDQA 3IJEB 5ADPL 1NGPH 4PJHA 4XO9A 1QWYA 1RMFH 2FECI 1AQMA 3L4VA 2D73A 1I8AA 1Z6HA 4DNRB 3NTIA 5B22A 4B3SQ 1YEFL 4BWTA 2N49A 4Z77A 4XP6H 2HT1A 4XNUL 1R6VA 4MHHG 3KBHE 2F19H 2R23A 1T4KB 1I31A 1CL7H 2HWZL 1JGVH 1D7FA 2YTVA 4FQLH 5DHMC 3U0TA 3B6SB 3H7LA 5ALCL 1DOKA 4YWLA 1JJGA 1FHNA 2QGQA 2DM7A 4PRBA 3RI5F 5CV5A 4DV0L 4HS6B 3EFXD 5FLXL 1HNWQ 1AH9A 5IT9c 1Y1UA 4KJNA 2C4FT 4KKBC 3G5VB 3WY3A 1BG1A 1TWCB 2EDWA 4E0RA 2JKXA 1BREA 4BHUI 1U8QB 4DVBB 4JRYE 5E8EA 5CCKH 4JPSA 3HN5A 4YHZH 3QH3B 1SNRA 2ICWA 2R2HB 1KCKA 4JJ5B 1ZK9A 4D3CL 5E6ID 4ODVH 5CINL 1DVYA 1ZPLA 2J73A 2OYMA 1BJ8A 3L5XL 3MRIB 3O6ML 5IGFA 2JJSA 4D8PA 4IIQB 3L3JA 1HOCB 4NT6B 3DTDA 4AJVA 1NKGA 2VL5A 5E7FA 3I4LA 1DVFD 1GRWA 2XIDA 4HWZA 4NNXB 4CW1B 2GIXA 2A6ED 3TDQA 3KPOB 2QHLA 2VMCA 3HOVB 1FWXA 1OCWH 3NP4A 4PRHA 4N0RA 2MQHA 2F7OA 4J1UB 2VLJE 2V9TA 4PTUB 2Q8BH 3K4AA 4KK6C 4Q6YA 4X9GA 2JA5H 2PW7A 3NN8A 4XPHL 5E8DL 4A55A 1NLDL 4F88A 1KFAL 1LEIA 4ZUIA 3FOLA 3MBEC 4PG9A 5DQJA 3OKEA 3CSGA 4RNRA 4OZIE 3U2JA 4HCRL 2EEAA 2BVPA 4NO0A 4PZ7A 1E8XA 2XX0A 4JFYA 3BH8A 5HXMA 4NUGH 1JF1A 4MMZC 4UM9A 4XXDB 4JDTL 4V190 4Z7AA 3WMQA 2KBNA 1KFGA 1ZWIB 2H2PC 3B34A 4AQ8C 1Y18B 4FI8A 4QXWA 5DK2A 4YEFA 3QR2A 5KVGH 1THAA 5BZDB 5C4JH 3O9WB 4DV1L 2R3ZA 3CUPB 3FSVA 2K70A 3VI4B 4ZXBC 3D3VD 2XRAL 4M1CC 4U1GC 2PWGA 3P2DA 5KVFE 3QCVL 4FKHA 3K80C 5H2BA 1VMCA 3CVIH 4AXWA 2YUVA 4QXGH 1S7QB 4YOKA 2W0FB 1MHCA 2JH2A 1PX3A 3F5WB 3DRTB 3H94A 1ITBB 5GGVY 1RLWA 4N8VG 3SGEH 4HWNA 1XF1A 3PFUA 4S1QL 2PQAB 2Y2TA 4XTRD 3ULLA 2YD0A 3EUUA 2ZCLL 4HVBA 4HGWB 4YFDB 4HU2A 4L4VE 5HHNA 3DX8B 2XRQD 4PRIE 1YJ9A 3ZT7A 2NY6C 4CN1A 5CJ8A 2C3HA 3KLHC 4C4KO 4KHVA 4F5CA 5L4IA 3BKCH 3KPRB 3TT3H 2JKLA 3AABA 5IJBC 3LHPH 4WHTA 2C5CA 4LSUL 3BYTA 4Y2DC 1TZOA 2NYYC 1OF2A 2A83B 3NPSC 2WQSA 1WIOA 1JK9A 1D2BA 2FSDA 4OU3A 1YNLH 2WXGA 5FLXc 4PJFE 2H26A 5I75C 2CWRA 1RTOA 3J81E 4TXVB 4XT1C 2P5WD 4M5ZH 4HXBL 4U6YA 1IE4A 3VXUD 1IV8A 4PMEA 4UV4L 4DR6Q 3BO8A 5DZJA 1GOZA 1KGCD 15C8L 4HZAA 1P5UB 1HQ4A 5GAGC 3JV6A 5I74B 3RYMA 4CRPA 3WIIH 2EXSA 1UACH 4X7TB 4NAMA 5JAVA 4E9SA 1B70B 3WIHH 3CVBA 1BVOA 3PQIA 3PCOB 4MB3A 1GD7A 1N5YL 1FNSL 3QIBC 1LVEA 2FXQA 2WP8J 3FH5A 3QDGB 1E65A 2ZXQA 1BZ9A 3DOHA 1MLCB 2CO6B 4UB0L 1ZEAH 5KSAB 1XGQB 1XB6A 1ZT1A 2ADFL 3SPIA 1Z9OA 3GTMB 3CTTA 2P8PA 4GRWF 5IBTL 2IPKD 2ZNXA 4L4TE 2NTTA 4UAIA 1DJIA 3PS6A 5F6HJ 5LN4A 1A3QA 3X14A 1DQQB 3T0EB 1C12B 1S7SB 2ZD0A 4P73A 1D7DA 4NUPA 2F1MA 5GSVB 4ZMYA 4K71B 4E5XG 2AQQA 2V5TA 3W39A 1DL7L 1NAML 3C6LC 2IANB 4N2BA 4AC2A 3BW9A 1E3FA 2JKIS 3ZE0E 1YMHA 3DURA 3F12A 3NIFE 4LSTH 5D8JH 1XH2A 2J43A 3IDJA 5C3LD 4AJ0A 1WBZB 4ZAKA 4BGDA 4ZG1A 3H6AA 4KRPB 2V2TA 1YNNC 4OCXL 4OGXL 3VH8G 2UXCQ 3GTKB 1XGRB 1HA5A 3SBWA 1E4KC 3MVVA 3FTYA 3HN8A 4YBLC 2IADB 3RLSA 4IGBA 4EJ1C 4I5BA 1EVTC 1KOAA 3L08A 3U79A 3M17B 2K6YA 5F70A 2YK1H 3TC9A 4PGZA 2R93G 4DNLA 3AMKA 2FO4B 2FJUB 4Y5YA 1FO0A 1R0AL 1KTLB 4JI5Q 4K5PA 3JTBA 4N1EA 5I6NA 2UXGA 4HD9A 1WEJH 1OALA 4IEFA 2A9DA 4G80B 4OIBA 5GHWH 3ZZSA 1AP2A 2Q8AL 2I07B 4NNYA 3X3GH 1YITA 2C1PB 2OR7A 5E03A 4AT6B 2XZZA 5KVEE 4HS3A 3PWVA 4HK3N 4KVCH 4XO8A 4QB4A 2R56L 1BFOA 4H25A 4JDZB 4KH9A 3V0HA 1RPUA 1G51A 3U2IA 2DQFB 1HC1A 2X69A 4AMKH 5BV7L 3FTSA 4W70A 3EFDL 3IJYA 3L45A 4HN7A 3EYUH 2DF3A 4OFIA 1B50A 2V9RA 1I5FA 4XN2A 2R4SL 1EA9C 4ZX4A 3MLWL 2WXQA 2X4SB 5EBWB 3F7YB 4NO5A 2FNBA 3SKNB 4OJAA 1CLYH 3HGBA 1G7PA 1CI5A 3ZGIA 3S1QB 3L6FB 1L9SA 1GS7A 3VXMA 4MDRA 5ES4B 1FNEB 2JA6B 4U4BA 1ZRUA 2X12A 4UIKH 5T3XH 2N8NA 2I60L 5IW1A 3H9SD 5E08H 1WWBX 1ZK5A 3PL6A 3PIQB 1A3LL 1XMOQ 1WLHA 1GUWA 5GQBA 1OXXK 3JYCA 4XVUD 5C0CB 3GTOB 4BFRA 3FN3A 3ARFB 3BEVB 2XKNB 1YIJA 4FQJL 3MRCA 1ZLUK 2O4EA 3RIAK 2BVQA 1V5JA 1KCUH 3NJGA 2NY4D 4UIMA 2C34A 1G6RH 1S9YA 2ZXEB 2CXKA 1SJMA 4PN6A 3BSGA 4XYQA 3OSOA 1ED3A 2ZXRA 4GYBA 1JRHI 5C8JA 1DUYA 4LF8L 2ZAIA 3OSVA 4OZIF 1TWHB 1HEJC 2B14A 2ZT9C 3D4GA 3VM5A 2CQOA 3TQYA 3G9AB 3LXAA 4ALPA 4C56C 4FFWC 4RSYA 3SO5A 1MCHA 1MCWM 4LAAA 2BJML 4V1DD 5JXEC 1LO4H 3U82B 1Q8KA 2DS4A 2EEFA 4O2FB 2UXBL 2R51A 2NX5D 1XSIA 4DP5X 5HVHB 2VITB 4NM4L 4X4XB 4QOKE 1E8WA 1QSFB 1RUML 2DICA 1RVFH 4WHCA 4X8GA 5EF1A 1JI2A 1ETJA 2L12A 3HC0A 4GXFA 5L7XL 2XHNA 1NUGA 2TRYA 3KWUA 3B8YA 4KDTC 3P1HA 4A7UA 1XTDA 2PZWA 2GVYA 4FQ2H 4N85A 3RWDB 3CVCA 5IR1A 3WIAA 2BERA 1D9KB 2DTSA 2PNHA 2NLJA 2ED6A 4UAOC 1G87A 1UFGA 1JYXA 5AKVA 2WZ6A 3TJEH 1DBAL 1JAEA 2KQNA 2B63G 2CMRL 2HLFD 4FF2A 3M7NA 2HCIA 3HI5H 2I5YH 2D0PA 1X5LA 1XL4A 3K74B 3O2VL 4QKXB 5MHSE 3T8XA 4A93G 5E23A 1KENL 1EQRA 2XTJB 4AKQA 3CHOA 4NN7B 5DJZB 2P24A 4G8EA 4MN3A 5CSZA 2DWDA 3Q6GH 2PMZB 2PQEA 2FATL 4AIZB 4I65A 4G7YH 2VJXA 1K0RA 2H8PB 1NPNA 3CCUA 2BS71 1CE6B 4LLVB 1RLBA 1NICA 5I1EH 5EPMB 4PSPA 5IJVB 5CEXA 5ESVB 5PCYA 1BA9A 2JJUA 4C3IB 1IAKB 1Z2KA 4DVBA 3IBEA 2P43B 3KYMB 4M1UB 3LD8C 4PJFF 1GTFA 2WSPA 3BKMH 4LLQA 3EA6A 5DS2A 4BK5A 1MCJA 2WQRA 2AANA 1Q94A 4WWKC 2QKIA 2EH8H 4QLWA 3MRPB 1PNCA 1F4AA 1W80A 3HI6L 4MYPA 4RBPK 1KAWA 1GMIA 2F53E 3S36L 1AYOA 4R4BB 4BKTC 4L8DA 4ODHH 4PVNA 1BQHG 1UJTA 3SYOA 1OB1B 4HQQL 3TOPA 1A7RH 2E9WA 3CN4A 3IMVA 3O2DL 5DEGA 3WHXA 4BK4A 4QAWA 3L4TA 2JELL 1AY1H 5DWUH 1IAII 1XF5B 3B9KD 1KN4H 4NQDE 2HH0L 2J1WA 3PHOA 4OM0L 4NKIL 4JK1C 3ZZQA 4DETA 1HA6A 1SJHD 1H6UA 3LH9A 4OSUL 4Y5VC 5EIIB 4Y4FC 4NHCL 4M8AA 3RG1C 2P44B 3J27A 4C4BA 1VADB 2VLKD 3S4SG 2FJFB 1H8OA 3GV3A 4BH8B 5ISZD 4N1CA 2WAQB 2OMXB 4U6TA 1EQWA 3HOZH 5C1MB 5I26A 5TE7H 4K8IA 4XXDA 4XP5H 1ZWIA 1VQLA 1JZGA 5F6IB 4HJAA 2PF6A 2W38A 2DMKA 4QJ3B 3QUML 2BCKA 1GYAA 5I6YA 2ZXCA 4ICWA 1T5EA 3U36A 4M43L 2IJ0C 4GRWH 3ZE0F 4JANB 3NIFF 3RZCA 3FKIH 2OX5B 3FUHA 4ALAC 4UAHA 2L4OA 4Y16A 2AS5M 2EDHA 1A1NB 1NUDA 3QXDB 2HTKD 1U3NA 2DY2A 1GY1A 4YGVA 1T0PB 4BBSG 2K3HA 1TPXB 5I1GH 3EJSA 1AGFB 4WFHD 5FHBH 3WFCH 1DVUA 3DRTA 4LHUG 3ZKXB 1W6JA 5E94B 3AQQA 2VZ1A 2R0KH 2YU9B 2IXQB 2B2XH 1K72A 3RZOB 1BZDA 1U4RA 1F4YH 2K5QA 4LF9Q 2WM0A 1A1MA 1ZKAA 2LLLA 2X1XR 4PP2A 4NZ8A 2DI7A 4LOUD 1R4PB 2KMWA 2ZWNA 4JFOA 5DRNA 3LNGA 1KWKA 1J5CA 4DGYH 3HC3H 3TZVD 3WL9B 1YEIL 1AKJB 4MAUH 5D1XB 3CH1B 2IH3B 5CZXD 1YC8A 2EKSB 1V9PA 4JI2Q 1BZOA 1E5BA 1ZHNA 2EDJA 3E6FA 5IYBG 3GF8A 3LH2L 2C7FA 4LDLB 5F9AC 1NMBH 3F7VA 4HWBH 4XGZA 1BZQK 3QJHB 3TF7C 4K55A 3EDFA 4HIXL 3CW2C 1AQDA 5C4XH 2PR9A 3AQYA 1PD0A 2SOBA 2I9TB 3FXIC 5KVDH 4OO1I 3ARDD 5IZ7A 3A6CL 1NEZA 3CFCH 4YFLI 4ZJ9A 4DHLA 1PNDA 2YIHA 2NBFA 2D9QB 2W0PA 4LLYA 1BD2B 4JQIL 4YMPA 2CM5A 3OLDA 3U4VA 4YSUA 2OQ0A 1TWGH 3D39D 1J88A 3DK2A 1A63A 1I85A 3LRMA 4HBCL 4RA0C 2VXTL 5CCGE 3H0TA 4D9RD 4F9PC 4MNHA 1TO5A 2BRQA 5EU6B 5C07B 4HIKA 3VSUA 4L3EE 1STNA 1TZGH 2J12B 2VR6A 3CSFA 5TFSH 3WJJA 1DN0A 2VUMG 1I9RL 1NCNA 1XMQL 4G83A 3ARWA 4S2SB 1BIIB 4NRXB 5AWNL 4ZS7H 3WD5L 4YDKL 1WCBA 4G11A 3DIVA 3OAZK 2L4NA 3IFLL 2ADJA 5BRZA 1BNZA 3UDIA 3RGVD 2Z92B 4BXXH 3CDCA 3QRLA 4HV8B 3FO9B 4L37B 4WUUB 1C08B 3O4LA 4QLRA 4R97C 3SDDA 3ILPA 3UZQA 5IEKB 3SCMA 3EJIA 3N0PB 4AM0A 4XP4H 2E74C 4OBSA 5HGBA 1C0AA 5K9QI 4JGNA 4DP4X 4JCVE 5D7LA 3GQBA 5D7JA 1WBZA 1U95A 4H5SB 4RGMB 2YPVL 2YPKA 1NTDA 1DQLL 1OP5H 2IQAB 5I30L 1S7VA 2YEQA 4RHSA 1IBLL 3GMRB 2X4TB 5G5DB 5AAWC 2IADA 2AAAA 3KCPB 2XQYA 5CILH 4EQ2A 2BSDA 3S3DB 3QRGH 4IUUA 4W81A 5J9PB 2F7QA 2WBKA 2FJHB 4L3AA 4XN8A 3AJ7A 5CR1A 4PLNC 5IWLA 3S96A 3W38A 1HHKB 1YHBA 2VH5L 4K3HA 2VUKA 3RVVD 1JYWA 5I4DA 4OD3L 1HXYD 3P4NB 3PWUB 5M3MG 3LRSA 1VCBC 1SFHA 2VY3A 3ZOAA 1BV8A 3QPQD 4KC3B 4LSPH 4Y5XB 4M8QB 3ZTJH 1Q1EA 2UXDL 3KE0A 4XNBA 5CCJA 2CJSA 2I07A 1XB3A 3Q2CA 4X6CA 4NAJA 5LXGH 5E5LA 4YLQT 3FQUB 2YV5A 3NABL 4NP4L 1OLLA 3L5HA 4XNQB 5KVFH 1S78D 5DJCB 3LIZH 5D4HA 1GSKA 1J1XH 3QJYA 4X5XA 3KK7A 4L3CB 2QFPA 2DQTL 4I77L 1V27A 5L0QC 2ERJC 5GGQL 5C0RH 3GSWA 4ATWA 1D5IL 4WNSA 5D7KE 2VW9A 1IJNA 4HFUH 5JW3L 3SDCA 1C1EH 1S5HA 2DL9A 4LU5H 4O4YH 1NDGA 3CX5K 2F0VA 3L1OH 2QLYA 3VWJC 4BFOA 4B9YA 3FFOA 4P57B 2GJ6B 1Q90A 1DDHA 3HOWG 2WWNA 3ALXA 2J8UB 4ZI8A 2ASBA 4KDWA 1VSCA 4RAVA 1WTOA 3BIKA 5AOKA 5D3DA 4PJ5D 1P2CB 3B83A 4BKSC 1RZ7L 5C5LA 2NY1D 3LXCA 1ET7A 1MVFA 1ZA3B 2E56A 1DBBH 2ZPKL 1QILA 1E7VA 3QNFA 1URZA 1YMMB 5HJ3B 1H9DA 2WGNB 2BO0A 3HZYB 2Y07L 3GI9H 2WZ5A 3MVSA 2NNRA 4J3OD 4OFQA 3S9WA 2Y4SA 2RVLA 4LQFL 4OD2A 1QAWA 1KXVA 3GSVA 2OCCB 3AXHA 1MIEL 2NW2A 2ICCA 4P59H 3QUHA 4BXSV 2Z93A 3JWOH 1ZHKA 5FYKE 3TFBA 2XZCL 5BN4A 3O9WD 3N1MC 1NCHA 3QCTH 2VT0A 3QUYD 2X4QA 3OKNA 4HKXB 1EEID 5BS0E 4PJXB 1TMCB 5FUZH 3V4LA 1P7KB 4J4PA 1A02N 2EDDA 2J7LA 3JVGC 3G6DH 4GKSB 4UQ2B 3FQ4A 1NCCH 3H6MA 2PW2A 2BIOA 1NANH 1JVKA 2AQTA 2ZKXA 2OR8A 5AD0B 4EI6A 3HS8A 4KLKA 1EJ6A 1UH4A 4HULB 2R93H 2ZAHA 3S35X 2RMNA 1OQXA 3L5IA 2GVAA 2LLGA 3VYNA 1UVQB 2V37A 2G9KA 1IC7L 1UQSB 4BZ1L 2F0IA 3V0EA 1I7ZA 3VXTA 4DGVH 3P75A 1UC6A 2W5PA 3CKIB 1T1YB 4HUMB 3PIO3 5DDHA 4ZT1A 4PRAB 2KPWA 4U1IA 1KC5L 3FPXA 1IZKA 2LFNA 3KPRD 4MD0A 5DQDL 3TL5A 1VACA 5T1KA 4HXAL 4N2IA 2UZXB 4QGTA 2VLJB 1E6JL 2XY1A 1B2TA 5GRUL 5C0XJ 3L7EA 3UPRB 1MFEL 3QULA 3KWXA 1YY9C 4FNTA 2QPUA 3FTGA 2ZJRA 1AOZA 4LP4A 4KHPQ 2IALA 2PMZA 1WDAA 3LNNA 1Y6KR 3HTLX 3VFPB 3QXAB 4YUEL 5DHEA 4AIZA 1B6DA 3E3QC 3H2QA 4IRJB 4JHAH 4W9ZA 5IOPB 1CLZH 2ARJB 2PO6C 2CDEB 2ZX9A 4TS6A 2E86A 3QUXC 2A0LC 4WJG3 3WJLA 2XNAB 1TTCA 5JDSA 5A40E 5IJVA 5ESVA 1I9IH 1IGML 4TKWA 4TOYH 3TBWA 1HZLA 5TDOA 1S3KH 4QHKJ 5I5RA 2DBLL 3KAAA 3PP3K 4UILH 2WLMA 5M5XB 3VXNB 1PRTC 1VESA 1I8MB 3CFEA 4YIJA 5CBEE 2WQUA 4ELME 1X6OA 3VGGA 3MRPA 1EANA 2CRYA 5KSAD 3UC0L 1A7QH 4ZD3H 2Z9TA 3WE1A 4BH7B 3N85H 1WK0A 1PGRB 1G9NH 5KVEH 1QFUL 3ZDYB 1G9MC 1OB1A 3BAXA 3E5SA 4TNEA 1UM6H 3DJRA 4YE4H 4GW1A 3WKYA 3SK4A 4WO4C 3U9OA 3T0ED 3LS4H 5KN5A 3WJMA 4PGCB 1UD6A 4L4VB 2QDLA 3P0VH 3UAEA 2A5HA 2AUKA 1HJCA 2NR6C 5MP6H 1NPUA 4XN7A 3OYYA 5KNCA 1L7TH 2PYEE 2IAND 4GAGL 5JW4N 2FWLB 2AMGA 4BZ2A 3T2QA 1SVZA 1QLEL 1XR8B 1NNXA 3FTZA 3L9RA 2FJFA 4E42B 3LB6D 2QEJA 5B21A 3MLUH 4KRPD 4GNKB 3REVA 5LGKA 4NQSB 1BVKB 1A3VA 1KXQA 2QZQA 4GH7B 4JAMA 4PJFB 4E5XB 1B3JA 1KBVA 3GBLA 3RTLA 3TU6A 4MMYB 2FUQA 4PJ6A 2BX5A 5TDNA 4YO0A 2ISDA 4WF7A 1MW0A 1E90A 3V5KA 5HD8C 1ENAA 5A3IC 4GOSA 4X65L 1FNHA 2V7NA 2QSCH 3QJVB 1P84K 3ARSA 3LZLA 4OF0A 4BA2I 4PJEB 4P0DA 3I4MG 1O80A 1HHGB 1I3RB 3VFGH 1C7SA 2NPLX 1AZQA 3GTJB 3QISA 2D03L 2B63H 1KIRB 3QXDA 4RMTA 1U8MB 1XO8A 5GGUA 4YL4A 4Q6IC 5C0EB 1YN7B 1RCYA 4GZYC 1I75A 4A93H 1AGFA 1JMZA 1G7JB 1M7XA 1QFOA 1ZV9A 2OULB 1IBDA 2NUPB 2YKLL 3FFCB 7PCYA 5HP5A 4OLZL 3SE0A 1SN2A 4ZNEA 1BF4A 4KI5D 2QR0A 5KWYC 1G7IB 2VQEQ 4HMCA 1CT8B 1PF3A 4G9FE 3H0GG 3MRMA 1IAIM 1EX0A 2IVFC 4X9HA 2HFFA 1INDL 2ESVA 2WYTA 3X11B 3HE7D 4BWUA 1QFWM 4W6XB 2W92A 3QDMB 8FABB 4C4UA 3ZUCA 4R8NA 4LCWB 1CD0A 1JK8B 5FYJH 4GS7C 3FU5A 1JMXA 1QOKA 4W9IC 4PHXA 4X7SH 1L9QA 3RVTC 1T83C 3RWJA 4P46B 5CLYA 5JOPE 3CH1A 2F18A 5J11B 2ATWA 3PV6B 1HESA 1M42A 1S2EA 3EG9A 4NKMB 3BESR 5K1NA 4MSWB 4QYOB 3BWZA 1S7XA 4QRQA 3BMWA 1XIWC 4P3DB 7FABL 3ARTA 2YSTA 4NI3A 2MP1A 2HKFH 1G0YR 3BH9B 4XNZB 4DKAA 2F7RA 1C5BL 5C0CD 2W8CA 1OGAD 2JXMB 4KGLA 3ARFD 2K52A 1KY6A 2JI3A 4YFLF 5HYFA 4ALAL 4MXWL 4XP1L 3NA4A 3HCVB 4JQXC 2QILA 1Z5LA 4LSQH 1YEJH 4PJAE 3ZYIA 1OP4A 4FQHA 1XCQB 5C9JA 4ZFFA 4NQCE 3DM3A 1PBYA 1QW9A 2BH0A 3ATBA 4PCKA 5DD1H 5FEBA 1XF2A 3PO2B 4HCFA 2ZYHA 3EHBC 5CXPA 1FIGL 5EU6A 3GKZA 2OS7A 1X6NA 4LBEA 5C08A 2FL5B 1VF7A 3U4EB 1AANA 1ZS8B 4XN5A 4DEWA 2ZXDA 1T0NA 4R4IA 4Q74A 2X89A 3N43B 4L5SA 1DQKA 3RFZB 2KLSA 1DJXA 3QXUA 4NRXA 1M1SA 4PD4J 1J0ZA 4WU7A 1LDPH 3VFNA 3CD6A 2CH4A 5ESAA 2BSBA 4A3GG 4EX5A 1QSFD 3QORA 4ZZKA 4AQ1A 1L1OC 3BSZA 3UAJA 4DFIA 4YWGL 3NUCA 1S7RB 3VFVB 1IQDB 1N12A 2XKUA 3V7MA 3WEMA 5AB0A 1IKFL 4DGIL 1HH2P 4CGUB 1BMWA 1QASA 4DKDC 3B9VA 3VCLB 3CCJA 1UA7A 5CSGA 5F7KC 2B77A 2H45A 5ADPH 2BDNL 5EIQA 1CFTB 5HGHA 3VFWA 3MRKA 1WOCA 1KB3A 4PMBA 5FGBC 4QUFA 1T22B 1F2QA 4J3TA 5GGSY 1LO3L 5J89A 3W5NA 1RZGA 2B1OA 3W3AA 4EZLA 1YEFH 1SLWA 5BUGA 2BY0A 5AAMA 2X4TA 3BUIA 4XNUH 1E27B 3TJHD 5I1CL 1XAUA 3P3RA 3VXRB 5B8CA 3RVWD 2Y2YA 3IU3A 3HFZB 2HWZH 3IJSB 2APFA 1GGTA 4HKJA 5AL0A 1M71A 4JI5L 1J05B 5ALCH 3UJTL 2E27L 1URLA 2P5PA 4UQDA 2X44D 2C3WA 5HI3C 1JWMD 1N5AB 3ILQD 1K8AC 3K7UA 5E00B 3AY2A 3GLDA 2VDNB 4K7FB 1SE3A 1AD0B 1OD7A 4F7TB 3VD1A 1FZOB 1PZJD 2VN6A 2G3ZA 3BFQG 3CHSA 2YGQA 4HFWA 3ARGD 2IX3A 4YWMA 2J6WA 3A3YB 3IMUA 4M8QA 5IYBH 5IG7B 2V2WA 4I2XE 1L9MA 1QI5A 2OEOA 4LZKA 2WYHA 3W0WB 4ORGB 4D3CH 5DO2C 2A2QT 2OZNA 3FQUA 5EUKB 5J6HB 4Z0XA 5CINH 3SEBA 3R8QA 5DUBA 3L5XH 3O6MH 3VNYA 3MACL 3BD4A 1R5IB 1HSAB 1LWHA 3CK0L 4JEGB 2AXGB 3R0MA 4U3XA 3V4PL 3DGGA 2VM4A 3BD5A 2RHQB 4MD5A 2EXWD 5IHHA 3M4QA 2YAEA 3MGOA 2ZZUT 4QD2E 1OOAA 4KHTL 1GOHA 4QOKB 5FO9A 2E2JH 2JJTC 4FE9A 5IMMA 2VDML 4R9WA 2A1WL 1S7WB 4L05A 4HJUA 5ANME 2QADB 2NZ9D 4H8HA 3H3PL 1N33Q 1PZSA 3F7PC 3L3KA 4XPHH 4BIKA 3S88L 1NLDH 1W16A 1YNTF 1KFAH 3FYEB 3LSOA 4ELMF 3IB4A 4QTHB 4G7ZC 2V3DA 3ERQA 5HHMB 4BWWA 1MWAH 1YMMA 2VUMH 2N7AA 2SEBB 4HCRH 4HEMA 2Y23A 5T3XD 3GZQA 4A2EA 2YMTA 3M45A 4MAYB 4UTBA 2J5LC 2W65B 4Q89A 4JDTH 1MAKA 3ND9A 3CP0A 4TSAL 5INDA 1FL6B 3WNPA 4AQOA 4E9QA 2R7EA 2BZCA 3PGCB 1AFVL 1XGZA 1MN4A 2A6DA 3NUKA 1TJMA 3EOAB 2LHAA 2FEDC 4FQXD 3MKKA 3WKNA 2VN3A 3GSOB 4IRSA 4Z7UB 1EBAA 3QI9B 4LO9A 2X4OB 3P30L 1V10A 2FCBA 2ZE0A 1Q9KA 2GBVA 4R96B 2XRAH 4DV3L 4Z78A 5ALBH 4I18A 4D7BA 3QNXB 3FUDA 3CC7A 4HKXA 3QCVH 4PJXA 4FEIA 4LKXA 4QRSA 1P7KA 1GY2A 2BCMA 1FNGB 4PLJC 3FP9A 2ZM6L 1K8OA 1W0VB 2FDBP 2JFCA 3FQWA 3IAPA 1P6FA 4G6ML 4N2HA 4S1QH 4QGYA 2F7PA 4BBRH 1M56B 2ZCLH 2VAAB 4KNUA 4YE0A 3HMXA 2Q7YB 4ODBD 5C09E 1EUUA 2F53B 4UYQA 4DUXA 2PP7A 1UQSA 3BPLC 5JEAG 4B27A 2I85A 4Y1AB 2OMVB 2QQNL 4FLSA 3FOMA 5AW1B 2YN3A 3BUTA 4PRAA 5CHNB 3VQLA 4APVA 1Y1WG 2ICEA 4UTAA 2BC4A 2H2SD 1LMIA 4LSUH 3HG1E 3KVQA 4ZMTA 4LHUB 5IVXA 3WEOA 5FR3A 5GZOC 5DZNA 4U6HA 3IDXL 3R2IA 4X64Q 1T2XA 3VYSA 4KJQD 3DRQA 3TJPA 3M4YA 3F8TA 4Y52H 1LD9A 2A74B 3CDFA 5DD0L 3BJ91 3T65B 3ZYOA 4POZD 3RY6C 3IRPX 4HXBH 4QXTA 3RBSA 4XQNA 4A3FB 4HWUA 4UDUA 5EU3B 3DETC 4ERSL 4KXZI 3RPKA 5I24A 3KS0H 1RKRA 15C8H 1SVBA 2X2IA 4A38A 4PG3A 2FR4A 4OFYA 3U1SL 3RUGA 5L2JB 4AOFA 1CTNA 2VDRB 1OSPL 4LHQB 4R0LC 3NSDA 4MASA 5F7WC 2KDGA 3TP4A 2O6EA 1Z9NA 5CU5A 1UM4L 3K8AA 1S5FD 4TQPA 5HDBB 1SNPA 1A6PA 2AW2A 1FNSH 1PYSB 3M07A 4RMWA 1U4LA 5HGDB 1I8MA 2Y7MA 4K8RC 4GAYA 2P5ZX 1UZ8B 2MCMA 5K9JL 3M8OL 4UB0H 3UADA 3LKSA 2ADFH 3QCUL 5C07D 5DJAB 5IBTH 3MJ7A 3GZPA 1Z3GL 5FKAB 5EUOE 3H91A 3DNKA 3B7RL 3IJHA 3GO1L 4PV1C 1GC1C 2V5MA 2NY2B 3OJMB 3SGJC 1SJEB 2AXFA 4X3SA 1AZCA 2YBRA 4A4IA 4EUPG 4PJ7E 5IP9G 5D3IB 1EJ8A 2XU9A 1DL7H 3MV8E 4PJAF 5FWQA 4AI7A 1NAMH 3RN2A 2DWTA 2YEVB 1B0GB 4PJGA 3WNLA 1UGNA 7PAZA 1WZMA 1KIPA 3V96A 4XMTA 1UB6B 2HFEB 5I1AA 4OO1H 1AZUA 4FNPA 2X2UA 2FLBT 1KABA 4AGNA 3NP8A 4B9GA 3RWHB 1OXYA 4OCXH 1SXSA 1D7BA 4OGXH 3A23A 1RUAL 4QR7A 1WIUA 3IWUA 3WKPA 1YYML 2EIEA 1KB5L 5EPKA 1CLCA 1HTYA 3MV9A 4PP1D 1NIFA 1REIA 1WO2A 1CSPA 3SZ6A 4RAHA 3G5ZA 4HK3J 5AJ3L 2WB7A 3T9WA 4KROC 4LVHC 4MA1C 1F3JA 4JM2B 4WK0B 3AB0B 4XNYL 2APVA 1X7QB 1EHKB 5HYSB 2OW7A 3QUZB 2VLRD 1R0AH 3T6VA 1I3RA 4PJIA 1TNMA 2CUHA 4FVMA 4Q2ZB 2FGZA 1GGCL 5C7ZA 1KIRA 4ABQA 3DPBA 3EZ8A 5AW2B 1E42A 3WEXA 1NUCA 3HOXB 1HKLL 3BG3A 4F33B 2Q8AH 2EUXA 3WFBL 2A69D 3BZDA 4WU5B 2NUPA 4H8VA 3E9TA 3ARQA 5KNBA 4PMFA 3CFTA 1HL8A 1G9ML 5BO0D 1O7SA 4IMLB 3JT2A 4H8WC 1BLNB 4HETA 1HR0Q 5BV7H 1IBZA 3WS3B 3EFDH 1NQBA 4Y1TA 4L29A 2KH2B 1WICA 1OSZA 1FYTA 1U42A 5M3MB 2HDLA 3W9EA 4XI5C 3UYRL 1XL6A 2R4SH 2DPKA 4N20A 3MLWH 5EC2B 3MC0A 5ABDE 1JZ2A 1U8OA 5KYXA 1O7ZA 4UT7L 5IJCC 1XPRA 3CDZB 5IHUL 1C7TA 3BJLA 3BCDA 4GKJQ 1H3GA 4XPTL 2P47B 1M57B 5BUPA 4NKMA 4BY1H 3MOQA 1KRTA 2HG5B 5DGRA 3UPAA 4QYOA 4EEEA 4JYAQ 1JPFA 3BFWA 2A68D 5D4JA 2CKBL 4UHVA 1NC4B 2DAVA 2I60H 2WO3B 3SQOL 5EEZA 4A2FA 1DVQA 3TPUA 2PPCA 3KJ6L 1A3LH 1EWIA 3CU7A 5C0BE 1X7TA 2AXWA 3K91A 3HOWB 4DR3Q 1OTUD 1IHZA 1H5BC 1NPJA 2JXMA 1IGTA 2XPGB 4FQJH 4TMPA 4WI2A 5IMKA 4I7AA 4BUHA 1D5BA 1HS6A 1CXEA 2FIKB 2Y7NA 3NQIA 1HL5A 4FNFA 3BKYL 3CMOL 4P2OC 3QZWA 5GZND 3NBNA 3GB7B 3FS9A 3DX9B 4DK3A 4XYOA 5LMNW 4KXDA 1FSKB 3APNA 1HDMA 1C4QA 4N2NA 3I4NB 5CR8A 3VO0A 1KNAA 1UURA 3IRCA 2ZJSL 4JM4L 4J27A 5GSRB 3SYCA 4LK1C 4NKQB 4ACPA 2OSWA 2GK2A 5IHWA 3EFFA 1Z6JT 3P3UA 2YJLA 3NTHA 2BJMH 1ZS8A 1I8UA 4JRYD 5KSVA 4P8QA 5H94A 3IMRA 1KYOK 1XR9A 4NM4H 3RFZA 1VQPA 5FGCE 4AYFB 5DD6A 2LW3A 1RUMH 3PNWA 4CDGC 3R93A 5DUJA 1SOQA 4A3MH 1FJGQ 3F8UB 4Z7IA 5L7XH 3I4MH 4UT6L 1KPVA 2E46A 1PH4A 1EO8L 3P73A 4GOPA 4H1LB 1QO3A 5DHVH 5CLZA 3KYAA 1AOHA 4Q9BA 1HFGA 4D8OA 1CFTA 4YC2C 3I50L 3NCWA 4OZGE 1TO4A 5F9WB 2O26U 4JFPA 4F8QA 2CMRH 4UNVA 3G5YA 3PDGA 2VLJD 1P1ZB 3CZLA 3O2VH 4BQ9A 1E9OB 2ITCB 4P5KA 1KENH 2R29A 4JI3L 5FK9C 1YQVL 3H0GH 3GRWL 1BBDL 5IB2A 2ZONA 4NYLA 2IH1B 1F3DH 3FB5B 3MA7A 3NFPA 2FATH 4FABL 1PJWA 2C9SA 1A9BB 3CPLA 2HVKB 2OXPA 4ZS6D 4HIPA 4APXA 3LCYA 4IRJD 1MUJB 5E00A 5L88L 1HEZB 4L0YA 1A6ZB 3DMMC 4JI1L 1B6UA 4WDIA 5AUMA 5FM5M 1M6OB 4EE2A 4F7TA 1A4JB 4LCCB 2WTRB 5D93B 4RZKA 2K03A 2GUOA 3BUYA 2TAAA 3H9YA 5F1IB 1H95A 4MX7B 4RAUC 4X9IA 3W0WA 3D85B 4I3RL 4DK6C 3K59A 3BT2L 3VD4A 3MCYA 2QPDB 1ZSDB 1VMPA 2GTWB 1CFMA 2P5WA 4Y2OB 4F37F 3HI6H 1HSAA 1N9WA 2VDOB 3CFNA 4GT0A 3PQYB 4HQQH 5IEHB 2C4FU 4LPTA 3O2DH 4OAWB 2VABB 5LCVL 1E30A 3PG2A 3KPQA 1SYVB 4S3SA 3GBML 4OGQC 1INQA 4O02L 4JI7L 5I9PA 1PLFA 3WXWH 2HH0H 3LV3B 1RCVD 5D7IF 2D3LA 1FVEB 1FVCA 1VGEL 4GAAA 1S7WA 4NKIH 4OM0H 4L4VD 3ZDZB 4OSUH 4NGHL 4PRID 5KBNC 1RIUL 4NHCH 3QQ3B 1ZKOA 3Q13A 5HI5D 3WNJA 4HP5A 2NN6I 4ZMNA 2SEBA 1JYVA 4LEEA 4B9IA 5F9OL 1SDFA 2AK4E 1CIDA 1NBVL 1E22A 4JLRB 4MJHA 3W11D 5DVOA 4IU3B 1CA6A 4UQEA 1IGFL 4OLUL 3M86A 4ZRZA 5FYKU 4PJ7F 1FL6A 3C9NA 4DN3L 1DLFL 5D14A 3N41B 1X5YA 3QUMH 5CJ5A 4IMKC 2WXJA 8CGTA 1UH3A 3L5JA 3B2DC 4M43H 4KBPA 4A3EB 2E0PA 4U3HA 4QRRE 2NCEA 3VB9A 3BUQA 2XIWA 4APQB 1PFNA 2HP4A 4YHIA 3LZNA 3D9AL 4TUJA 4XMWA 4P4RB 5M7QA 3I73A 4G2AA 3NQTA 1WFQA 1ZLEA 4FP5D 5D1ZC 3VXOB 4M4RB 3SE4A 3V2TA 4AW7A 1G5GA 3I3DA 3MV7B 3MEHA 2VZSA 3FFCD 3PO3G 3KBPA 3QA3A 3MLZL 1KIXA 3CC2A 3KHOA 1JG9A 1F13A 2NZ1D 3B56A 2CDGA 5DMGD 4OD1L 3QG1A 4M7ZB 4Y1AA 5DJ8B 3QUGA 1OTTD 2DM4A 4NN5B 2F74A 4LEOA 3C6SB 4P4KB 5FGSA 3T0XA 2XVLA 4WI3A 4LCWD 3PGFL 1YEIH 1Q38A 1ORSB 1QNUA 3DJZA 2ZCZA 1ZCRA 4WHYG 4P46D 4KI1A 2PYEB 4KITB 3LH2H 3QEGL 1KD1C 4KHPL 1QPKA 1X5GA 4Y19A 1R1CA 5A2QE 2A9NL 2A74A 4LF6Q 2BOCA 5C0AE 4YL9A 3U6RA 2YBGA 1CICB 1RFDL 4UNIA 2YQGA 2GTZB 4HIXH 2C26A 1SYEA 3OM3B 4HSAC 3RZDB 2ZKHH 4P04A 4I87A 4UNUA 5FM8A 1KHIA 3A6CH 1B9ZA 4GSRA 1UXWB 1IEAB 1QNKA 1BJ1J 2R1YB 2VW4A 3JWNE 3NFNB 1KTJA 3FT9A 2F4VL 4JQIH 4W9KC 1OANA 3ZKQD 4ISVA 4A7GF 5AZEL 5DM63 5C0ND 2XY2A 1A7PL 3NJJA 2VXTH 2PR4L 3PJLA 5I5MA 4UWQB 2KVMA 1XGPA 2I69A 1UB5B 4N4YB 4GEJA 4LSSL 2XA3A 4IJHA 5E5RB 4EIGB 2K75A 2EVGA 1MKHA 1SOXA 4P9HC 5DJAA 1I9RH 3EF4A 3AREB 3VSVA 1E28A 1ZIAA 1NLBL 3T6QC 3U4AA 2OQJB 1EY7A 5E4EC 1QRNE 3HW7A 3DV6A 5AWNH 4HAFA 3WD5H 4YDKH 4LFAQ 2DQEL 3IFLH 1LO0L 2D31A 3NBIA 3OLGA 4G42A 1IM9A 3RHWK 2Q86A 3OJ2C 2PTTA 1ZTXL 4OJDH 1U8CB 4PJBA 1KAAA 1LE9A 1IILE 1FZKB 1QHPA 2CIIA 4AL8L 3KZ8A 5I66B 3L4YA 4CMMB 4XO3A 3CMEA 2YPVH 2EADA 3JWNG 1KJMB 3P3SA 4QIWB 3RWHA 1EL0A 1DQLH 2CJTA 5I30H 1JHTB 3PXJA 5H4YA 2OYPA 2GK0A 4EO5A 3BWAB 2GQHA 4A3GB 4GG8A 4HHAA 3JV0A 3TYFB 2Y7OA 4KD3A 1AIZA 3T3ME 5JEAH 3W37A 4X5LA 4ZPVA 4TRPL 1CFQA 3EJYC 1MCFA 3WLBB 4EAEA 2OYKA 1Y1WH 1DCEA 3RR5A 2VH5H 4JZNB 1N59A 1XCXA 1JNNL 4U1LA 4OD3H 1YRKA 3MU3A 3I72A 4GFTB 4LL9A 4MWFA 4QMEA 1BBWA 4EVOA 3F2UA 2Z9HA 3GHEH 3JV4B 2MCPL 3KDFB 2H6PB 2ODIA 3Q1SL 4F33A 1PLGL 2J2ZB 1BX2B 2AQ3A 4P2RE 3AUWB 2VNUD 5TD4A 3UROR 5LHDA 2QVKA 7TAAA 1NM4A 4ES8A 3PNRB 4NP4H 5KYUA 2ATKA 4ZAIA 1GC1L 5L37A 3GMMA 5IB3B 4PJCE 4I77H 5E9DE 3TO4B 4FG2A 5EO9B 5GGQH 4C47A 3IAQA 4UV7L 1KBKA 3STLB 2Z1PA 2XVBA 4DK5A 5B4MC 3BXNA 5JW3H 3UDGA 1A2YB 2LXKA 1JIBA 3EBGA 5E8OB 3PMFA 4LQ1A 3RI5K 1YHQA 2QSVA 4MNGA 4QOKD 2CO7A 3AG3B 1O75A 2EIZB 3P02A 4HJ0C 3CDZA 4AQZA 3F2BA 4G6KL 1RZ7H 2ZP8A 1W0YT 3C75A 2QADD 4QQBX 4MDIA 4RISH 4UY8C 2WIIA 2GSIA 3E3QE 1QWHA 2HG5A 2WXOA 2HX7A 4LUZA 5LAPA 2ZPKH 1QX1A 3ERSX 2EDFA 2D7MA 4PEEA 4IQZA 2EVJA 1TVBA 3OTTA 1M7IA 1BOSA 3ARBD 4OJYA 3IMWA 2AGJL 2Y07H 3GTNA 4FL4C 1QZGA 3S1RH 1QTYT 4MAYD 4EUPH 4LQFH 2W81C 2WBJA 5FAAA 2CLRA 3ZTDC 2JKTM 5IP9H 3KPNA 2VMJA 3F64A 4O2EA 1MIEH 5MHSD 2H1LM 4U1GB 2FIKA 4JHWL 1SUJA 1MFUA 4FTVA 4PREA 3CRKC 2XZCH 4QT5B 3N40P 1SJHA 3QI9D 1ILUA 2K4KA 2RKSA 3LKRB 2RQ8A 3EDKA 4KNSA 3IU4L 1BQQT 4TULL 1KCRL 1AJ7L 5B1CA 3JUYA 4H8WL 3QNYB 3R7QA 1CO1A 5CCHE 4I2XB 3BC9A 1T0OA 3HPLA 4ZCKA 5LL6X 2YD3A 3QZOA 3BX7C 4JOIA 2FSEA 1Y8NB 3BLBA 4FX5A 1TZIB 5AVRB 4RFOL 3S2AA 3VGEA 3VDAA 3C60C 2V0AA 3T0BA 1IC7H 1UXMA 3CSTA 2F53D 3O4OB 4G8GB 3BIAX 2P5EE 5AW4B 3BQUD 2F8OA 1OOWA 1SQ2N 3I2ZA 1MBYA 2TSAA 4I0PD 4W6YB 4Y2DB 3NPSB 3UBXA 5L2KB 1QR1B 1CCZA 5L4MA 4KK7A 2HJKA 3VRJB 1J8IA 1KC5H 3NK4A 4M00A 1KDBA 2NNXA 3L3HA 3LZQA 5DQDH 5EOCJ 4Y4HB 5I75B 1TUPA 1ZANL 4HC1L 2OSLB 4HXAH 4G43B 1SLVA 3QR8A 1ZLVK 4NQDD 1E6JH 3HC2A 4LHUD 3Q6FA 1GUTA 5GRUH 2DQMA 1MFEH 3CV5A 2XYBA 2YKKA 3NWSA 3D05A 2M26A 2XPZA 1DQML 5EC1B 4EKXA 4QF4A 2IH1A 4YUEH 4EI5D 4DO4A 1CYXA 3N3EA 1HHIB 3FCUB 1ICWA 1I9EA 5CEZL 1KDIA 3QFJA 5CP3H 4F2MA 1UUPA 3N04A 3T0WA 3U7YL 1U36A 4NQXA 2IT1A 1MREL 4J6IA 1JUFB 3OTOL 1K8DB 1ORQB 2P9RA 3H4FA 4HEPG 3ECBB 4LCCA 1IGMH 2W88A 4WEBL 3KPSB 2CBTA 3TZVA 1LL1A 3U7WL 3HN3A 1EUJA 1PH1A 4IOIB 4NQQA 2WCSA 3TYGH 3D85A 2FX8L 3EJZD 4GSQA 1TXKA 1CN4A 1Q82C 4PBVC 1ZSDA 4YDIL 2L8AA 1WVLA 2DDQL 4IRZA 3UC0H 1J6QA 4DV5L 3C5ZC 3EGXA 5IBUB 1QFUH 5IEHA 1M1XB 2DMGA 4OGYL 3TREA 3FN9A 4UQBA 1RZQA 1SFOH 4JRXB 2COQA 4A6YB 2BY2A 1O9WA 2QDWA 4N6RA 2Z7YA 3LV3A 1R46A 5D4IA 4B95C 5AW6B 3IS0X 4KXZH 3RPIB 4IU2B 3TWCL 1O6TA 2FHTA 4K2KA 4GAGH 4MVBD 1EY9A 4ID6A 3QQ3A 3G6JE 4R7LA 4X4KA 2DLHA 1QLEH 5FWRA 1L6XA 1O6SA 3LPPA 4BQ6A 4N86A 5HYJB 4NPKA 4U7KA 2F0DA 2B15A 4Q4IA 4W68A 2UX6A 1THCA 2GAZA 5HGAB 2JCCA 2AQ2B 3B7UX 4JLRA 1VFBB 2MKWA 1HILB 2F7IA 3CBKB 4C3HH 1YHPA 4JY4B 2WWKT 4CNIA 2GBAA 1NJIC 4LASL 1WFUA 2V3EA 4ANVA 1EFXB 1NOAA 1I3VA 1XBDA 1SOKA 1TG8A 3GXPA 3HG3A 1XF3B 3ZPDA 2OMUB 5JHLL 2MPVA 4JO2L 4J3BA 4ZDHA 4G7RB 3SJVB 2BXYA 2VQUA 1EU4A 4MA3A 3LKOB 1NOLA 5FLUA 1LP9A 5M3FG 5IOKA 5IFAL 2JJSC 3QYMA 2D03H 4KKAC 3APMA 5CMDA 6CGTA 1HE7A 4YX2L 1L0YB 2RHEA 2NSXA 5DRZA 4GINA 4FLQA 3F2CA 2IHEA 2Y7QB 2YKLH 3VXOA 1WGOA 4N0FB 4AQEB 4BFNA 5I8KH 2VC2B 1STAA 2OTPA 4PRPA 4OLZH 1IL1A 3FCBA 3Q3GB 4Y1SA 2UWEE 3T3MF 1I4GA 1I4FA 1ZV5A 2YWYA 4IUTA 3ILEA 3IAYA 1EXUA 4L3ED 5A7EA 4N9GB 4YDVB 1U3ZA 1RP8A 3IT8D 5EUOB 2IOMA 1MI5E 1KPUB 2WMPB 3C1EA 1HXYA 1G7LA 1KJ2A 4AGLA 3GT6A 4K5MA 3MV8B 4MBRA 2ZWZA 4DV4L 4U1NB 4LXFA 2XICA 4O51A 5DK3A 5DJYB 1SXCA 1XZ0B 3CN2A 3UTTE 3VGFA 5D2LB 4B3TQ 2HJFA 5FUOL 4C57C 1BDOA 2JK8A 3GTGB 4N0CD 1IJ9A 2CJUL 2LV4A 4PJCF 7FABH 2B9BA 3QDJE 4C1NK 1CICA 1NC4D 4WKZA 3O8XC 4KZEL 3NZ8B 4YHPA 2VSCA 1C5BH 2YO3A 5FDWA 1ZHLA 2KLRA 3RLNA 3EDJA 3DV4A 5MEQB 4ZMAT 3N2JA 2OJEA 3QIWA 2G4EA 1SDDB 2C4XA 4ALAH 4MXWH 3PAVA 3K0WA 4XP1H 3UZEC 2EZVA 2X6AA 2BIHA 4WW1A 1SMDA 5SWQB 1JGDB 3QDAA 2ZX8A 3PAZA 4GSDL 4IKNA 3B5HA 4X8XA 1DZBA 5MENA 4FLHA 1UB5A 4PTTB 1FIGH 1CGSL 3CIQA 5F9JB 5AKSA 2ZTBA 4Z9KB 1YNJD 3BZFB 3WLWD 3AREA 3MLRL 5IY0A 3TBYB 4Z7VA 1UEYA 1ZLWK 3V4VA 4ES9A 1I3UA 1PRTF 1KGJA 1L9OA 5E4WC 3FNKA 3IYLW 3MBWA 3LVTA 4LVOC 2G75B 3L95A 3CG8A 3TVMB 4KTYA 2HT2D 1WBXB 3MOBL 1EHAA 3BMVA 3L3OB 1DJZA 2EDKA 4YWGH 2EE2A 4N90E 3RB7A 4DGIH 1EAPA 3A8JE 2LXJA 1U8CA 5D7KD 3SE3A 1R5VA 2F5BL 3WGVB 3IFOB 3DKHA 5J1AB 5I66A 2BDNH 5BRPA 1LO3H 1I1FB 2CCWA 2Y3NA 3PO3H 5FO8A 2A4ZA 2ZTEA 1XFPA 3ARUA 1CD1B 3ZYYX 5ISRA 4A76A 2R4RL 2DEXX 2ROYA 4X4YB 2ZOKB 1J8RA 5I1CH 2KDYA 3TYFA 2L7QA 4E9WA 1STHA 3BHBB 1B3QA 1Z9SA 3VD0A 1A66A 1MCBA 3ABLB 3ZLQC 2F0OA 5HDRA 3UJTH 2E27H 1X3PA 4JZOA 3UZVB 2ROXA 1I50B 1TF4A 3TA3B 1P8LA 3B6YA 2LQRA 4LESA 5AFAA 3U4KA 4P99A 3ZYJA 2BZDA 3VFSB 4WHYH 3LPGA 4A3CG 2VSDA 3IE4A 2K01A 2NUTA 3BPNC 4YPGA 1DSYA 2RB8A 1AR1C 2J2ZA 1MRFL 4FFVD 1BX2A 4P9HL 1FD7D 5FYKD 2BSRB 4F3FB 4TF4A 2LR4A 1S9WA 3J80E 2CHWA 3LNEA 3B9KC 3U0WL 5J0BA 1EXGA 5D6CB 4AYBA 5KBPA 4ORZC 2D7PA 1VQEA 3TEWA 1VLXA 2CSPA 3MACH 2WTOA 3CK0H 3TN0A 3TX4A 1KTRL 4M56A 3V4PH 3SDAA 5BS0D 3TO4A 1NJ9B 4AMXA 5CD5D 2BP0A 5TQ0L 2X1OA 3FSOA 1TSHA 3STLA 2OXHA 2V1CC 3F7KA 5CJOL 2X6UA 4NXNL 4NI6A 5CKAA 3CC4A 5AOLA 5CS7A 2IPUG 4ZAKC 4KHTH 4Y4FB 5FGCB 4GKJL 5JW4Q 3GP7A 5C7XL 2XYCA 4DA2A 2GFBA 1U4FA 2DNEA 2A1WH 2EIZA 2VDMH 4HJ8A 5A35A 1UJ3A 5ITFB 3PUWA 1I7UB 1OM3L 3S88H 3O13A 2E75C 2VB5A 1T9HA 4RGNB 5EORL 4YXHL 4PMCA 5JXAL 4HIQA 4YK4B 3MGTA 3GJFH 3KPPB 2L1BA 3GO5A 5C44G 4ODXA 4DR3L 5JZ7C 1TTAA 4K7PL 2A5UA 3DM1A 4FQ1L 2A6HD 4OZGB 43CAA 5FLVA 2QW7A 1UE6A 1OZUA 3F58H 3ZKND 2EUWA 5AW8B 4AW4A 1JJUA 4TSAH 4UT9L 3WMPA 5I1HH 1UE1A 2EVFA 1AFVH 2M2LA 1PJ9A 3LMJL 4NENB 4QCIA 3PDOA 1A2TA 1Z32X 3I91A 2QELA 2AEWA 2EDRA 5GGRA 1C9OA 2CJ3A 2EYTA 2Y6SD 1MHHB 3P30H 5JPNA 5DLML 4CA4A 1R9TB 3B8SA 3G6JF 5DFAA 3L5WB 4FF3A 4TQUS 3ZDXB 2EJMA 1GGIL 2OTWA 3D0FA 1FF5A 3VFTA 2G9HB 3ZO9A 1B0RB 1RZ8A 3QNYA 2E7CA 3MXPA 1IVLA 3EJQA 2HKHL 3TBSA 5KS9A 4G6MH 5EF3A 5D1QB 4QRUB 5D2NA 2NY7L 2VDKB 4FXKC 1FJGL 4GLAC 3QS2A 5DRXA 3E1ZA 2YD9A 3OKYA 4ZSOE 4PJDE 3ESUF 2LAAA 1UENA 3PUUA 1MXDA 43C9B 2LY7A 3TH4T 4WCYL 2NY0C 1L3NA 1RULL 4G8GA 4U1KA 4ZMOA 5CV4A 2AVFA 1CR9L 3NWTA 2FBRA 1Q1BA 4QHMA 2QQNH 2YR3A 3FKIB 3ULSB 4F24A 2Y5TB 2CFMA 3QAZC 5BUAA 1KDAA 2WXIA 4M7KL 4Y4HA 2P8MB 1UASA 4G43A 1HL4A 2X4UA 3IDXH 1AD9B 3PWNB 4NRZA 3UI2A 1V3LA 4H4NA 2UWEF 2PYED 5DD0H 4MLSA 2JA9A 3F05A 4NXML 4TVAB 1WBYA 5EC1A 4ERSH 2BK8A 4D0CB 3I2CL 5CNHA 5HY9A 1YNKL 5CEYB 3U1SH 4YDNA 1PZ3A 3VWKB 1BCPC 1EU3A 3GXTA 3K5SA 3DXAA 2OL3B 4YSEA 3CFIC 1OSPH 4U0RB 1JUFA 4MS6A 1K8DA 3NGBB 5E6YA 1S7UB 3T2PA 2OZ4L 4HH9B 3TV3H 1UM4H 4E9VA 4IKKA 5ELIA 1JDCA 4DXGA 1MLBA 4NXSA 4KO7A 2A38A 2FHBA 5E9AA 1X4YA 1Q0XL 3RGVC 5CFAA 4B7LA 3M8OH 1OZTG 2CGZA 2R0LL 5K9JH 3EO1B 5IF0B 1F58H 3QCUH 4AH2B 1PFSA 3ROLB 1Z3GH 5CGBA 1XCTB 2UVEA 2G5BA 3GO1H 2QCPX 4RFNB 4CJ1B 3DX3A 3SQRA 1SNMA 1LE5B 4ZMZA 1FL3B 4P5RA 4FXDA 4GSXA 4RETB 1OGAA 2YN5A 4P5TD 1HFNA 1CVRA 1DVSA 1KBBA 3SB3A 3SN6N 5JJKA 3QEHB 2O6PA 2PPDA 3RN5A 3OKLB 4G9FD 3CLFL 4Z3GA 4EI0A 2NVXH 4RMVA 4U49A 3DX1A 5GGSB 3RPIA 3WIHA 3WKML 2LSSA 5A43C 3WNMA 2WY3B 2AXJA 1RF2D 1I1AA 2K6WA 3I6GB 3RVXC 3EJPA 4YGAB 3S17H 1GKEA 1VQBA 3I74A 4PV8B 2VR9A 5HGAA 4ZMQA 1RUAH 2BW4A 2AQ2A 3BCFA 3DECA 2E7LA 1SE8A 5JHMA 8PAZA 1YYMH 1F1DA 5J39A 1IRAY 1KB5H 3L2NA 3HHMA 3QPQC 1FE8L 3T8VA 2YD4A 3HG4A 4EQOA 2JLPA 3QFDA 1HH9B 5KGUA 4KKBD 1E43A 5F7DA 1EFXA 2F1AA 4XNYH 1TQVA 4NIKB 4YDJB 3SDXB 2Z4TA 4MJ5A 2QKIC 1NSNL 2WINA 2GJZA 1CB4A 2XN9B 3SJVA 3UTZB 5KIXA 2YFOA 2AJSL 2CO3A 1GGCH 2EXZA 2PCFB 1VEPA 4B97A 4Q97A 2UUAQ 4IIQC 5F1KC 1YVCA 1IEBA 2QGEA 3WMSA 4KTGA 4LL1A 1LILA 1HKLH 4WW2A 4XE5B 5JIMA 2VDPB 3WFBH 3NZHH 1OT2A 3AAZA 1M3JA 3MREA 2ERJB 3Q1EA 3S2DH 4NQCD 2Q87A 1G9MH 1KNOA 2X09A 5MEOB 4J3VA 1R24B 1Q8IA 1II3A 4UU9B 1B0WA 1DBJL 2GI0A 1FYCA 3NSFA 4AVJA 4Q52A 1JICA 1QRNB 1ZE3C 3UYRH 2ZOWA 2B20A 4KK6D 5B38B 3QBTB 4UT7H 3OR6B 1T20B 1F3RB 1JZFA 1RV6X 2Q2LA 2Z34A 3ARGA 3MBED 2DUDA 3G5XB 5IHUH 3HLAA 5T5FL 4XPTH 3TIDA 1OGPA 3TBCA 4MDJA 3AQDA 3RWEB 1HQMC 1JPST 4NPJA 4A3KB 3SGDI 3FCSA 2QL1A 2CKBH 3SQOH 2QT6A 1AHWB 2H2PD 3CSPA 1R3JA 4NZJA 5DC9B 3KJ6H 3WN5A 2KHIA 4CN6A 4EZJA 4HJGB 3RZCC 2ZG1A 1RJCA 3OB8A 4DP0X 3RJQB 4LPYA 1BP3B 1BYPA 4EXKA 4ZXBD 4NBXB 3LKQB 1QP1A 3BKYH 3CMOH 3FTVA 4M1CD 5BXFB 4X7DC 1T5XA 3HJ0A 5BOZG 4EZMA 3I55A 1KIUB 4DO5A 3ALWA 3SO3B 3ULJA 2UU9Q 2HG0A 3UDFA 3FT2B 2ZJSH 4JM4H 4LDOB 5DS8B 4MNQB 2VXQL 3KF6B 2RGSA 2IOIA 1JXDA 2X5PA 4ODTL 4W9DC 2XN0A 4WORA 1RK0B 1N67A 5AVTB 1T80A 2OMWB 1KRSA 4X6BA 1T7VA 4P06A