3L3OC

Staphylococcal complement inhibitor (scin) in complex with human complement component c3c
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
306
structure length
294
Chain Sequence
CNKFDLKVTIKPAPEAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
molecule keywords Complement C3
publication title Molecular Basis for Complement Recognition and Inhibition Determined by Crystallographic Studies of the Staphylococcal Complement Inhibitor (SCIN) Bound to C3c and C3b.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 53
structure length 294
sequence length 306
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3l3oC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 3l3oC01
2B39A 1XWEA 4D94A 2WIIB 4FXGC 4ILWA 3HRZC 3CKIB 1BV8A 3MA2B 2XWJB 1JC7A 2ICEC 3HS0C 3KLSA 5FO8B 2QKIC 2I07B 1UEAB 3I70A 1GXDC 2TMPA 3OHXC 1UAPA 3L3OC 2A73B 3G6JB 1EDYA 3V96A 2WINB 2PN5A 4FXKC 5JPNC 5JPMC 1D2BA 3CU7A 2E2DC 2XWBB 1AYOA 2J0TD 1PXUA 1OO9B 2A74C 1BUVT 1JB3A 3T4AC 4LNVA 5FOBB 1BQQT 3FRPB 5FO7B 5FO9B 1BR9A
chains in the Genus database with same CATH superfamily
4K94L 4HUKB 2OYKA 3QNXB 2FO4B 5CIPB 3UTTA 1NCAH 4GW4B 1A7BA 3O4LA 4W6WB 4K55A 4DKTA 3OMNB 1ZD6A 5CD3B 2ETWA 3VSQA 2XG4B 1UCBH 1LLAA 3HMXA 4UMSA 1EHKB 3FCTB 2Y6SC 1JJUA 5D1XB 3BRDA 4NQED 3J27A 3QEUA 1BA9A 3I85A 4KTAA 2VNCA 5EDSA 4GRLD 3TCLB 4NZDA 1XIWD 5C3IA 1EY9A 1IKNA 2VDML 3RIKA 4HQQH 2B2UC 5KW9L 2YARA 5CP7A 4F8LA 1O5PA 1QD0A 4OFIA 1BJMA 4GS7B 3Q0HA 2FWOB 2QSCH 4OZIF 3SD2A 4LSSH 1UFGA 3V6OE 4Z7NB 4Z3GA 2FQEA 3D39E 5AOIA 4JE4B 2IPTH 1S2EA 4G6MH 5IK3A 1CLYH 2UUDK 3TYGH 2B7DT 3LZRA 4WI8A 3UX9B 4LEEA 4ABUA 5LWYH 1P7QA 3AAZA 3T4AA 5CCGE 1DQIA 4NFBA 2NY2B 1U92B 3IFNH 1WZAA 2AJVL 1JJ2A 4FABL 4HAGA 1CVRA 2WPGA 3Q5OA 3SKNB 2NW3A 5M5YH 4PI2A 2E7BA 2CDFB 4FQLL 2LV4A 4G8FA 3DKHA 4GQPH 1RZJH 4PW9A 1HCZA 4YDIL 5F8RC 2BWDA 2DEXX 1PIGA 5TH2B 2E5LL 3D39D 4NW2A 4A3GH 3DHJA 3OR6B 2A4ZA 1WEJH 3FPYA 4PH8A 4AIZB 4E9QA 3RZOB 4WSGA 5AKRA 1AKJD 2N1TE 1RUMH 3T09A 4DP1X 5L0QC 1MKFA 3RWFB 3CLEL 2EDXA 4AZ8A 5EO0A 3U9PH 3KYOA 1HKLL 1UWEH 2C26A 3EYQD 1R3KA 4G7YL 1EJFA 3IETA 3NUCA 2OSLB 2F4IA 2CUAA 3MV9A 4DV7L 3EH5B 1NBZA 3H9SE 5H37G 3VGHA 3AS0A 1OGAB 3TNNB 3K6SB 2XV3A 1ZKOA 4Z5RA 4KDTC 1OXUA 4JI5L 1IB5A 3B6YA 2VZUA 3MYJB 2AW2A 1DOLA 2A5HA 1NFIB 1LDPH 2Q1EA 4NERA 4XE0A 2JELL 3S1NB 3EBIA 3PHQA 3ZHLA 5IFHL 3TWCL 4YWMA 4BGLA 2BZDA 3NGBC 3M3YH 2MKWA 1Z47A 4JAMA 4OB5L 3H9SD 1CFQB 3BZEA 3QNFA 4KGLA 4BA0A 1ACYL 2DWXA 2EYSA 3O8XB 5FYKE 2Z4QB 5IREA 1AZUA 1BQHA 4HIJB 5IB5A 1BAGA 4P46B 3HUJF 5I75C 3AREC 3RWGA 2DMCA 1FE8H 2W0PA 3GI9L 4DA2A 3HG9A 5C1MB 5IKCA 5ALBH 2B4CH 3IFOB 5AOMA 5D96B 3PGDA 4I5BA 5EU7C 4QTFA 2XICA 3T9WA 4LARL 3RGVD 2C1PA 5ETUB 4H1LG 4PJXF 3K3QA 3WL9B 5FYKD 4LBEB 4NZTL 1GUGA 1PW3A 3AWEA 5C09A 1RJLB 1F3JA 1VDGA 1SE3A 2XA3A 4DESA 1ZE3H 3FONA 4LJZC 3RUGA 3BPLB 1CFVH 1VB9A 1FPTH 1WFTA 4AYBE 1U8KB 4LF6L 1QG3A 3QRGL 3T2OA 3NSDA 4YHLH 4EZJA 2A9CA 4HZAA 2AHOB 2AJSH 4F80A 3GTQH 2FO4A 2RB8A 5CIPA 5FM5O 3WTWA 1N9WA 4N2FA 4GW4A 3EBEA 3U4BH 4NQCD 4OCRL 2NB0A 4M1UB 1KIQB 3PPEA 4KKBD 4OD2B 5CD3A 1NBCA 4OF8A 1STEA 1A8JH 2XTJB 2XG4A 4DF7A 3HTLX 3BUTA 3OZKA 4PJ5B 2EO7A 2XWTB 3FCTA 2XN9C 2ZM6Q 5D1XA 1A3LL 2WLZA 5JW4Q 1T20B 3KJ6L 3AROA 3F04A 4PGZA 4XVSH 3WGUB 4XN4A 1ZY9A 2J8OA 2C3GA 2V2TB 4ZKBB 3TCLA 1AH1A 3TREA 1RJCA 1MFAH 2FEJA 4N2IA 1Q38A 4O5LL 1TOXA 2E74C 4IUVA 1BNZA 3RWHB 4W93A 5ICYB 3SKUD 2FWOA 3L9AX 1UOLA 4KHXL 3S16B 1EXUB 3RZCB 3DPDA 4I18B 4XNYH 3PCOB 1AHMA 2YD1A 1UB6B 4XI5D 7TAAA 5J12B 3ZL4H 3FPPA 3HOWG 4WEEA 1ACZA 2VR7A 3SGJC 1XQ4A 1E4WL 1TQBB 1UEAB 2FMMA 1OK8A 4UTBL 1U92A 2P3YA 1TSHA 2H6UA 1TKWB 4DSYA 1CXLA 2XQYG 2IH3B 4MJ2A 1Y69U 5C08B 3SKNA 4DV2L 4N2BA 1YEDB 5FUZL 5B1AB 3U0WL 1HQRB 3ZVVA 1AE3A 3PUXA 2Y5QA 3GS4A 2VGLM 5F7BA 3MZGB 5HHOE 1HINL 5TH2A 5E2WL 1DBJL 4MNQD 1ML0D 2H1PL 3OR6A 4AIZA 2EEBA 4OLXH 5JW3L 3DX7B 3KOJA 1L0QA 1UGNA 4RGMA 1T5KA 2E47A 2FIKB 3O6MH 4B9CA 3TCXA 3D09A 2QADC 4B6ZA 1K3BC 1JGVL 1SOKA 3GSNB 3IGAB 3SGKA 3VYTA 1OTSC 3V0DA 4XPHL 5I1CH 1J6QA 1T4WA 3ATAA 4UYQA 5DWUH 1A1MB 4POZC 2PPBC 4AH2B 2LTQB 3V0EA 5HHOD 2OSLA 2K5NA 4A3JG 5EV7A 3TEHB 1OCWH 1T1WB 1OGAA 4JFYB 4UHVA 3TNNA 1IU1A 2VDOB 3K6SA 2AK1H 2MRYA 4I1NB 5C70A 1KAWA 3L54A 1B6UA 4I85A 4EN3C 2N8NA 5BXFB 4JUTA 3CFKB 3MYJA 3FT2B 1PY9A 2E7MA 3QAQA 1A9BA 4LOVA 5GZOD 1I1AD 3SBWC 4L9LC 4HIMA 2MH4A 3QCUH 1JBJA 4HSAC 1KBWA 1MCOL 3FRPG 2J7ZA 4PJ9D 1HIML 5FLVA 1CFQA 5C0EB 4P05A 3LD8B 1S3KL 1D1IA 1H9RA 3VI3E 2D03H 3ULVE 4Z8FH 1PH4A 5KYIA 3O8XA 3OMCA 4AVIA 4CW1B 2Z4QA 3TEWA 4PM1A 4QRFA 3WNMA 4HIJA 2OMVB 5C2BH 5L4MA 1NCDH 4P46A 3A7AB 1D2PA 1Q72L 3WUWB 4KX7A 1E22A 1E28B 3AQYA 4HS8L 4DKAC 3D6GA 3TJEL 2PNRC 1JGDB 3IFOA 2DQCH 3WSQL 3ZYJA 2WXQA 3CFNA 4WFED 2JIXB 1ZV9A 2RBLA 4ENEC 3KPNB 4TUKH 2K7VA 5ESAB 5ETUA 5DEHA 2ITFA 4JMNA 4C3JB 1HAWA 3WL9A 4LBEA 4JGMA 3EROA 2E27H 3FTUA 4DV1L 1JGEB 1RJLA 1XYIA 2X88A 4PMFA 2DOCA 5JEAJ 5CBAB 5HVHB 3RDTD 5J13B 4GFXA 1TEYA 2XTSA 2WGXA 1U8KA 2Z31C 4P4KB 3PJLA 4N86A 5T33H 4PCSA 4F9LC 2YFOA 1MIMH 5M9OA 3F58L 3CDCA 1P7HL 2WLIB 3C6LD 3IDNB 2A83B 5IP9G 2CUIA 4PJFE 1JNNL 2WN2A 1EPFA 3N85L 5KZCB 5KBDA 4OD2A 1KIQA 1F58H 1I3QB 3JXAA 2ICWB 1WF5A 3IJHA 4PJ5A 4XODA 2XG5A 1FH5L 4H8QA 1T21B 3K74B 3G08B 3DIFB 3K7UA 2RACA 1T20A 2ZKYA 5TQ0H 4OLWL 1ITCA 3W0WD 3KDFB 4RFNB 2V2TA 3R06B 1AW7A 3G04B 4RMWA 2X69A 5EG6C 2CJUH 4M6NH 1ZHLB 2FNBA 2H26B 3BT0A 4GH7B 4WAFA 3RWHA 3MRNB 4GSXA 4QRRE 4CMMB 5ICYA 2R0LL 5DO2C 5LMUL 5HP5A 1H9KA 4XPTH 1EXUA 3RZCA 4I18A 4CDGC 2HTLD 4X5LA 1NC2D 4MD5B 1UB6A 2K45A 4F7XA 2HKAA 1W0WB 5A6MA 2A9ML 1N34L 3TZUA 1WWCA 2AJYH 5C0XJ 1LO2H 3FT3B 2OX5B 1KXVC 1N64L 3RZDB 1G7JB 4R4TA 4Y5VB 4XP4L 5GGVL 3E5SA 1I53A 2IH3A 3BN9C 2BNQE 4H8UA 5C08A 1YEDA 4QRRD 2R0WH 4JY4B 1HQRA 1E7ZA 1Z9LA 3IF1B 4YQXH 4GP4B 3PP3K 4DN3L 1E43A 4WFN3 5TGBB 3S37H 3OAZH 5CZVH 1FLRH 4WWNA 1BUVT 4CGYB 4DFHA 3DX7A 4PP2B 4IPCA 3LS5L 4K7PX 2FIKA 2DDQH 1EEFD 4K3DH 5A6LA 4F7PB 1Z5LB 3X3FL 3KLDA 1BQLH 3DXAD 3GSNA 3IGAA 4WQOA 4AENB 5HHQB 2CO4A 1J1OL 2NY1C 1BG9A 4R8WH 2FJFB 1KB5H 5C0BB 1K4DB 1H9MA 3I3CA 3AUWB 4AH2A 4DEPC 4E2OA 8PAZA 3CCRA 3PAZA 3POHA 4ZNCD 4V11A 1T1WA 4K94H 1WA2X 2V3EA 4JFYA 5D6DC 2BWIA 4U1GC 3CX5J 3DROB 2JJSA 4IK7A 4NWTL 4PPTA 5EHFA 2CPCA 1RL2A 5BXFA 4X65Q 3MGAA 3FT2A 4LIQL 5GS0C 3N6YA 2EH8L 2ENSA 5GGVY 2F0CA 1GJIA 1I3VA 3A7LA 3U7WL 5F2DA 3D85D 3T71A 4P2OD 4DPGA 1WTWA 5C0EA 1JCVA 4Q4IA 2VDMH 4CW1A 4Z7VE 5KOMC 5KW9H 2DLFL 5JO5B 2OMVA 1O7DC 3QJXA 4M1GL 4CDHA 5AL0A 1T6BX 1BG1A 1KB9J 1JGDA 3FN3A 3UBFA 3FUFA 4EBQL 1KYOJ 3P11L 3CX2A 5BV7L 2ZJRA 1BF2A 1QLEB 4WFGE 3TP7A 4PP1D 2JIXA 4EQ5A 1N19A 3F2BA 1R5VB 5C0AD 3ZGIA 3KPNA 5ESAA 1XSJA 3GUTB 4A3JH 2AJVH 4FABH 1XZWA 3TN2A 1SNQA 3OR7B 5L9DL 1JGEA 2MMXA 4BV1A 4UQ3A 4FQLH 4YDIH 1R5WB 1W9XA 2RD0A 1I85C 4BRVA 5CBAA 5C4HA 3QFJD 3AFQA 5E94B 2J55A 3K2KA 3CLWA 1GM5A 4P4KA 3F7PC 4DV3L 1CBVL 3S1RH 1VFBB 4LSTL 1XTCD 2ZTDA 4Z7WF 3KBFA 3KS0H 1AR1C 1UWVA 2WLIA 3C08H 3SE4C 3GRWA 4XNAA 2A83A 4DIXA 1CZWA 4XQNA 2JA6B 4A3IG 3W2DL 1R24B 4L4TD 4EXPX 4G7YH 2L3BA 2V8LA 1G1KA 2IPUG 4MXVE 2ICWA 4C2MH 4DEWA 3EOYG 4TQPA 2NR6A 3CDGB 3L5XL 4MZ9A 4O02H 1T21A 3BVDB 3G08A 1XR9B 2CRYA 2Q86A 2QILA 4NZ8A 4B9GA 1KTRL 4FNTA 3ECUA 4XGZB 3VG0H 4XAKE 3F64A 3KDFA 5MENB 1LQBC 4TQUS 4ZUIA 1J88A 2X1XR 3T2LA 1GY2A 3G04A 2IWHA 3T3PE 3MCYA 1ZHLA 3M7GA 1SXSA 2WB1E 2JELH 1OIOA 1IM3D 4BY1G 1J5EQ 3TWCH 1F9RA 1OD9A 3OX8B 4CMMA 3QXWA 1WJ3A 3HG4A 3RU8L 4OB5H 5B3SB 1DOKA 4MAYC 3M1BA 2QSVA 3V0HA 3GMNB 1KNAA 4MD5A 2PETA 4YBLC 4YDKL 1W0WA 5CD5D 4NC2B 1R3IL 4Q6IB 3HHSB 1ZCRA 3FT3A 5FUCC 3W3AA 2OX5A 4AIXA 4EN2A 1LHZA 1G7JA 1I9EA 4Y5VA 4ZAKB 3CSFA 4OM0L 3PS6A 2C35B 1HS6A 3RIFK 2D2CC 3GI9H 3NIFE 4W9CC 4BZ2H 3CZGA 4JY4A 1EBPA 2EDWA 1H15B 3IF1A 1QSEE 5C4XG 4KVPA 1JWSA 3SY6A 2DGYA 3GPSA 1S3OA 5CEZL 5TGBA 3R19A 4QCIB 4TSCL 1MI5E 5EC1B 4PJ7E 1GGTA 2A73B 4GOPC 1Y1WG 1U3JA 4XN1A 4NZTH 2OPCA 4M1CC 1UWFA 4PP2A 4DPCX 3H0TB 4GKSB 1I4FB 4K8IA 4F7PA 1Z5LA 2MQCA 2AMUA 3ABMB 4AENA 5DMKB 1YJDC 4QTHB 3MV11 3VI4B 4M7LT 2FJFA 1HNYA 1QSED 3QRGH 1K4DA 5C0BA 4OL7A 2ZUUA 3KPSE 3ET9F 1DM0B 4K5VA 4NUJB 2BC4B 2GJ6E 5D4JA 1MI5D 3WTSA 3IDYC 4RDBA 4LCWE 2GVBA 3DROA 4OCRH 3UTTE 4G80B 1TEFA 4QQBX 1YNTF 3WNNA 3O4LE 2L7EA 2UY6B 5I9OA 4W1TA 1G6RL 4AV5A 2Z4IA 2EUZA 3OGCB 3QQ4B 1A3LH 3QXUA 3TVMD 4PJFF 1AHWB 3KJ6H 3KPSD 3APNA 2NNCA 3B2DC 4FE9A 2GJ6D 2EXDA 2YD0A 4MQSB 3ASOB 4YHIA 3F8TA 2ICCA 2FSEB 3D51A 1JYXA 2WQSA 4O5LH 1ASYA 3UTTD 4PWKA 3RL2B 4FNUA 5JO5A 2ZT9C 3O4LD 4I8DA 5IQNA 2HFGL 2W8CA 4M8QB 3LKOA 5ICZB 1OL0A 2JJTC 4NNYB 1QWHA 2WXHA 5DJYB 3BO8B 2EXSA 1R5VA 4CGUB 1E4WH 1X4YA 2PO4A 2F0HA 4UTBH 3QIAA 3GUTA 5GPRA 2ITCB 3U0WH 1ZS8B 3OR7A 5FUZH 1DCLA 3W1BA 3HOUH 1J0ZA 3W11C 1R5WA 1MCWM 5JVG3 2NZ1A 2DMKA 2WNWA 5E94A 5EC2A 1HINH 2ITDB 5E2WH 1X5AA 1TWFB 1DBJH 1CN4A 2H1PH 3JWNE 5FFGA 1VFBA 5C0DB 1CM9A 1KQSA 2OXHB 1FNUA 1J0YA 3K8LA 4ONHB 2WCGA 4LE8A 2RDHA 1WFQA 4HETA 2F0IA 4A3KH 3ECBB 1P7QD 1XCWA 2DQJL 4UQIM 1FGVH 1JGVH 4JANB 4FMFA 1P16A 1UHVA 1R24A 4L1DA 2GTZB 2VN5A 4DGZA 3NP3A 3POCA 2BJML 3CDGA 5FFOA 3WDIA 3ZDYE 1JMCA 5IWLA 3CCLA 4F33A 1XR9A 4TLUA 5IGXH 2DNCA 5K39A 2E7HA 3J7A5 3A0OA 3MV9E 2JE6I 1J8SA 3B7YA 3OMIB 4XGZA 2BNUB 1DBKL 5MENA 2VR9A 4DP5X 4PRIB 1A7RL 1REIA 3IE9A 4ODSL 3Q1SL 2AQ1B 3X3GL 3HRZB 3QPQD 3ZE1E 2KPNA 1F5WA 2P8MB 3ARBB 2Q9OA 3NIDB 3OKMB 3DVGB 1F45A 3N44B 2EY6A 1GYCA 4Z7QE 2DJ4A 3OX8A 1MCOH 1MFEL 1WA1X 4HKXB 3T0WA 2YRZA 3W81A 5AW9B 3APFA 3B34A 1WFOA 2A0LD 1HIMH 1H5BB 4MJJA 4CKQA 1NAKL 3MV9D 3GMNA 1JZDC 3BAKA 1S3KH 4RFEB 3P0VL 4G9FB 4Q6IA 2O5JC 3HHSA 4AXWB 5IHUL 3TC9A 3O3DA 4ZAKA 2YKLL 4IIQB 3O6LL 35C8L 4FYRA 2LR4A 4HS8H 2NTTA 3TJEH 3UTSA 2HKHL 1H15A 1ICTA 1KDIA 1JPFB 4A3IH 3LRKA 3NJLA 4Y5YC 1CFNB 5A43C 4K07A 4Z7VF 3PXHA 1MJ7L 1URLA 4QCIA 5LL6X 3EJSA 3ELQA 2VO8A 3ULPA 3PCYA 2A73A 4JKKA 1ET5A 4ZO8A 3C09C 4FS0A 2ADJB 4JS7A 4ZQKB 4B3RQ 2FJSA 2IV8A 2NXZB 3EBGA 1MREL 3H0TA 4GKSA 1I4FA 1KCVH 3ZQXA 5MHSD 5DMKA 5C09E 2EOTA 3HR6A 1TZIB 5E6IC 4QTHA 2XRAL 2XRQD 3VI4A 4JFEE 2LT9A 5KS9E 3QOJA 1Y8NB 4KK6D 4JQIA 4BY1H 1BCPB 4NUJA 4JKNA 3F58H 3SE3C 3PGZA 1ET9A 5IIFA 1GUOA 2BC4A 2WBJB 1JNNH 4XMVA 3K5LA 4B5EA 4ZMLA 5FFLA 5HPOA 3N85H 3HG5A 3QA3B 4C56E 1M56B 4G80A 3HPLB 1FRGL 2UY6A 5C09D 3AMKA 1FH5H 3HN8A 3L1GA 4KXZI 3C87A 4JFED 3OGCA 4PJCB 3QQ4A 1MFVA 5JHBA 2BCKA 1AHWA 3GTOH 4OLWH 5IBUB 1RJTA 4BDVB 5D1XE 2LFGA 4ZFFB 2JE8A 4HUNB 4RFBA 4MXVF 3TBCA 1MLBA 2FSEA 4XB8A 1HZBA 4C1NI 4OI7A 3E9UA 1UKSA 3RL2A 3MRGB 4FL4C 4RGOL 4FA7B 2C4FT 4PY8J 3I3BA 4DZBB 3EDEA 2Y06L 1PQZB 4R4ND 2ZYHA 4Y7MA 5EWIL 1P53A 5ICZA 3T3PF 4CBZA 1GUSA 4NNYA 4WGWB 3I6LE 5D1XD 2A9MH 1PL3A 3OTOL 1CR9L 3BO8A 3CG8A 4JC0A 2OKMA 3KGSA 4XP4H 5GGVH 2WLJA 2ITCA 1ZS8A 4UAHA 1QZGA 3Q13A 1ASPA 3E6ZX 2GKIA 4YSOA 5GRUH 4N2LA 3TBIB 2ITDA 3QPXL 3FH7A 1CFBA 1TTCA 2YPVL 3QJFB 1PVHA 3ZX1A 4DN3H 2GBUA 43CAB 3I6LD 5D6CB 3WHE0 4EIUA 5ERWB 5C0DA 4GAFB 3NIFF 2OXHA 4ONHA 5T5NF 1PZCA 3LS5H 3T1YL 3BUPA 4L0ZA 3ECBA 3CMAA 1NOAA 3C75A 1TR7A 3X3FH 4ZNEE 1X4ZA 3N2JA 4JANA 1I94L 3JUZA 1J1OH 2NY2D 2OTJA 3QJTB 2FEDD 1SFOH 1WZ1L 2W9EL 5JQIB 4PJ7F 4UV7L 2BDNL 2GTZA 4ZAIA 1R4XA 3RWJB 1CE6B 1SY6A 2IDQA 3C9NB 5JIMA 4Y89A 1I4QA 4YSDA 5DHMC 2NUPA 1WD8A 4NENB 1DJGA 2ZSVB 3M4QA 4DR2Q 2BNUA 1U0LA 2CQVA 2Q3XA 2QQQA 1E5AA 4NWTH 1BZQK 2IX0A 3H0GB 3D4RA 1SMXA 1DJYA 1KYUA 2AQ1A 2ZCHL 3HRZA 4FFYA 2IH9A 1AQHA 1C48A 1HDMB 2P8MA 3ARBA 3GDCA 4LIQH 5LCVL 5EKLA 3OKMA 3VXMA 3DVGA 3UBXG 3WOFA 2EH8H 3M1CA 5DHYB 5MEQB 3R0NA 5DMJB 4G4KA 3QQNA 1H5BA 4KY2A 4AL8C 3HOZB 2WWNA 2QVFB 1NY4A 2XZCL 2ZKWA 4RFEA 4G9FA 2J21A 2DLFH 4XBMA 4AXWA 1HWGB 2EXWC 3T8XB 2Y7SA 1UA7A 1WBXB 4M1GH 4IIQA 1JNLL 2HAZA 3RI5F 4B9FA 4JGUA 1GGUA 1T5XB 2EEXA 2V3FA 4GJTB 4BFRA 4WWPA 2I9LB 4P9MH 3SDDB 3T6WA 4EBQH 1JPFA 3P11H 1CFNA 5BV7H 2X4RB 4EQNA 1JXDA 5I73B 3V52L 2QPFA 4YC2C 5KYLA 1XCQB 3BFWA 3OZ9L 4M3JA 2QZQA 5E8NB 5K9QG 4ZQKA 2QA4A 5L9DH 2UWEB 3O8XD 1HSAB 4FDWA 3RFZB 1TZIA 2YZ1A 2NYYC 1VQFA 3KVDD 4P46D 3X2QB 4WCYL 4P48A 1CBVH 4D2NA 3WN5C 1QQDB 1OT4A 3TU6A 4PS3A 1QHOA 4LSTH 1GHFL 3RURA 1IKOP 1R3JB 3CGTA 1AVAA 4O42A 2WBJA 5I71B 2YAHA 3NESA 4ZMNA 3TP4A 3BUYA 5E99L 3QA3A 2H32B 2IPKB 4L29B 3W2DH 3JSSA 4R6UA 4ZOCA 3HPLA 3KXFB 4WSJA 4BE6A 4F7KA 4M5YH 5FV2A 2A99A 3L5XH 3MJGX 3VACA 2W95A 1Z9MA 2B16A 2F1EA 2R59A 4PJCA 4JY6A 4XVJL 3BI9X 3HE7B 4YBHA 2CH8A 4RWYL 3MRQB 4KTEL 4D0CB 3NFNB 4LSVL 1A3UA 3SYCA 4BDVA 3E8VA 4CKEA 1G0XA 1NOFA 5A2KH 4ZFFA 3ZDYF 1VSCA 4KJOA 2R92B 2OMYB 4LHQB 3MRGA 3B3BA 3BS1A 3K7AH 4WWKC 3WY1A 1QG7A 4DZBA 4IS6B 2Z64C 4OUOA 3RU8H 1PQZA 2XTJD 5AJ3Q 4G42B 4PJ5D 4MXWH 3UYRL 1KN2L 2VXQL 5I0XA 1FL6A 3VFSB 1GZQB 2B2WC 3WS6C 3ZE1F 3EYUL 4AUUA 1R3IH 3OKKB 3R8QA 4YDKH 5C4JB 1XB8A 5JOEA 2KQMA 3QHFL 4Z7QF 3RWCA 4KHZA 1UWYA 5AALA 4OM0H 4QIWB 3S5YA 3O41B 1NDTA 2YC1B 1V7NL 4X4KA 1P9MA 2DS4A 1OAYH 3U36B 4TSCH 43CAA 1TTFA 4HV8B 3FQ4A 3AC0A 4Q6KA 1WVZA 5D6CA 2HRGA 2ZIDA 3HI5L 5FGSA 1AEXA 3WNOA 5ERWA 5HI5C 1D5MB 2ZCKL 5IJKC 1V5JA 4MDJB 4FQCL 1LE9B 1TS5A 5FR3A 5GJSL 6CGTA 2O5XL 5LGJB 1ENCA 4IGBC 2FMCA 2DQGL 4HPYH 1O6VA 4XX1G 5C08D 4KXZH 2VSKB 1SF5A 3RWJA 1HQRD 3C9NA 3TEUA 2WB7A 3VAEA 4N5EC 3TWYA 5D1QB 4YLCA 3WDNA 4NENA 1XEDA 3BSZA 2WXIA 2ZSVA 3DO7B 1HL8A 3RVXC 5KS9F 1U91B 3HLKA 4KI5C 1BBWA 3FO0L 2O6PA 2Y1AA 5LXGL 3CE1A 1QP1A 2RA1A 5GRVL 1W91A 4ETQB 2CK2A 3UAJA 1MF2L 1KCKA 3FTSA 5KG9B 4LDEB 5DHYA 3ZT6A 2AK4E 4MS8C 5MEQA 3DTDA 3MRDB 2M9VA 3D06A 2JKRM 4WI6A 4E42B 3JWOL 4KH2A 2EQDA 1EYAA 3NPPA 2BCOA 2QR0B 2XKNA 3D0LB 3N0PB 3IGFA 1WPCA 2PCFB 3T8XA 5DJCB 1QRNE 1WBXA 4UU9B 3UAAA 4BFJA 4CVZB 1XMEB 2A6ED 4N9OB 4PVNA 1FDLL 3HN3A 1T5XA 2I9LA 1UYWL 5GJTL 3SDDA 4C4UA 5J89A 4NQXB 2X4RA 1Y6MR 1MKHA 2XPZA 1XCQA 2NY6B 5T1MA 4YIJA 1G7LB 1CKNB 5E8NA 3VMPA 4D3CH 3F6LA 1PV4A 2UWEA 3MEHA 4AQEB 3VD0A 1X7SA 1HSAA 5F72S 4Z7NF 4FDBA 4XMLL 3RFZA 1CGYA 3L1EA 3OW7A 1QQDA 1NAMB 5B39B 2VAJA 4OGQC 4IKKA 1TQUA 1AGEB 1R3JA 3CFJB 4CNIB 3FKIH 4A93G 2DQJH 2JIXD 2K0RA 3JT2A 3KD4A 5A2QL 2H32A 2IPKA 4L29A 3SYPA 4QHUB 4HK0B 3SDAB 5FOBB 4MA3B 1V1PB 4I2XB 4W9LC 4DVRL 3KXFA 3VDCA 2BJMH 3NZUA 2WZPD 3GIVB 1U30A 3MLVL 4PHZA 3H2QA 5FPIA 3K7AB 1KCUL 3LN4B 3HE7A 4Z3IA 1GIGL 2GQHA 2PYEB 3MRQA 4D0CA 1PGRB 3NFNA 2EEFA 5C9JB 3ESVF 3UAFA 3P0YL 4P4KD 1DBKH 5M3FH 4HG4J 1J9QA 1O6TA 1A7RH 4I88A 4ODSH 1T03L 3Q1SH 5EEVA 2NTSP 4U2YA 4EX5A 3X3GH 4FLOA 5C0ND 2DM2A 4X0KB 1MCWW 2MCPL 1DQML 4ZFGL 5KZCD 1U8PB 5J3HC 1MFEH 1H8LA 4IS6A 4LHUG 3S35L 2VZ1A 3IMUA 1WCMG 4G42A 3D3VE 3BZKA 2NR6D 3QUZC 1NAKH 3SY0B 4DW2L 1ROWA 4JL2A 1S7UB 5DO8A 3VFSA 1GZQA 3CXHK 1XB3A 3WNLA 2G60L 3OKKA 3P0VH 3S36L 5C8JB 2HN7B 2V9TA 1WFUA 3INOA 3LIZL 3P73B 1WD9A 1NMCC 4GP8B 2P5EE 5IHUH 2YGQA 3U2IA 1Z9NA 5MP6L 2YKLH 1QRKA 35C8H 2YRBA 5A7BA 3ZDZE 1GOZA 3NEXA 2Q2IA 5JEAG 1E4XL 3AM8C 3O41A 4U0QB 4WDIA 2LMCB 3T3ME 2HKHH 3PY9A 2YC1A 1PPIA 2YPKB 2X44D 2J5LC 3JAML 1MJ7H 2EDFA 4NAQA 4FKHA 3DEOA 2P24B 2K01A 2R2BB 3C5JB 4HV8A 3FUJA 4HKZB 5CS7A 1MELA 4BUQA 5SWSB 4Z76B 3TS0A 4Y4FC 1MREH 4MDJA 5C07B 4AM0B 3MBWB 1LE9A 5LGJA 5F1NB 1GGCL 3AACA 4BFBD 1ZLWK 2XRAH 3NQTA 1MXGA 3U9OA 1AHKA 3GXIA 3MA7B 1CLZL 4HUXB 1G6RB 2Y24A 3MBEC 1G4RA 3GPEA 3GUFA 2N78A 2H0EA 4OGZA 5LUMA 4UT9L 3SYQA 3GEFA 1CS6A 3ZE0B 1ADQA 1PX4A 25C8L 1IZJA 5EBMB 4YN3A 1M8AA 5BO0D 4Q9RL 1EY8A 3X1BA 1FRGH 1YNND 1OZTG 1FFPB 5J3BA 4ETQA 3S4SG 3SO3B 1FC1A 4I3SL 5KG9A 5DVPA 4BWTA 4X8GA 4FFTA 3RJOA 3MRDA 4DUVA 5IV2B 4E42A 4OJDH 1RUPL 5C0BD 5KSVB 3BP7B 1X5GA 5AZEL 1M3IA 2VNUD 1ZAGA 2H8PB 3U46B 3QI9C 5C0XG 3CC2A 1H3TA 4X0NA 2DJFC 3OLIA 2QR0A 3D0LA 4Y16A 4N2EA 3F83A 4P3WA 2PCFA 5H1SE 4XNZC 2IJ0C 4UU9A 5DJCA 3V5HB 1WTRA 2GSMB 2QKIB 2Y06H 1D5IL 4Y8DC 4CVZA 4HOZA 1WTHA 5EWIH 2FGWH 3P4MB 4JFTA 2DZEA 3DYOA 2X2UA 4NQXA 4TLTA 4F24A 4LEBA 4U7SA 3US0A 5FXCH 1RODA 2IAMC 1I6VC 4FJZA 2F19L 1OXXK 2P49B 3SODB 2F5BL 3ALWA 3WCYA 2ODIA 1G7LA 1CKNA 4JRLA 3FKIB 1DJZA 4AQEA 1GZHA 4BJLA 4OR1A 2RDFA 2ATKB 3OB0H 3TS2A 3UDWA 1Q1BA 4R9WA 3VA7A 3MNDA 3QPXH 1NR4A 3EYVA 4DTGL 4N8VG 3LNGA 3F6IA 1NAMA 3ZDWA 5B39A 4LF9Q 1EEID 3VXTB 3D31A 1G9EA 1AGEA 2CQOA 3CFJA 2HP4A 4CNIA 4LLQB 4PJ8B 2UXTA 2GSIB 4NIYE 4ONGL 1MCFA 4QHUA 2W9EH 3HB3C 1WZ1H 4HK0A 1V1PA 4I2XA 2JCCB 4MA3A 2BDNH 4OFDA 4Q8BA 4UV7H 5TF0A 4B3MQ 4J3BA 1AZRA 3GIVA 4QT5B 1GYWA 3JWOC 4N1HB 3S5ZA 5D1ZB 5DXWA 2EICA 1MVUB 1UD5A 3LN4A 2FD6L 2PYEA 3A74A 3MJ9L 4E41E 4F3FB 3A6OA 5C9JA 3BC9A 2PP8A 2EILB 2GBVA 2WIIB 1IGML 4XCFL 1JOQA 2DIAA 2ZCHH 3BZFB 3D33A 4YE4L 5D2NB 3FCSB 3IMTA 4X0KA 1J0KA 2OR7A 3D4CA 5LCVH 2NVYB 3FEWX 1QHPA 2C9OA 2NY3B 1U8PA 4MRBA 5I1LB 1N5YL 2HT3C 3L2PA 2QVTA 3VGAB 4K0OA 3IDJB 4L3AA 2H0FA 1PBYA 3SY0A 2IANE 2AAAA 1S7UA 3CBJB 3L4XA 1A6UL 4YDLB 3A4EA 5IMOB 2Q8IB 2X41A 1F77A 4Y52H 2HN7A 1SOSA 3PAYA 3LNDA 3VXSA 3P73A 2F53B 4EI5B 1VQ9A 5MEND 5J7CC 1SLXA 4JRYE 4EOWH 3NWTA 4FQXC 4RSVA 2MUYA 2HZHA 3LKRB 3TH4T 5AFAA 1DJWA 2NNFA 1U2CA 2YPKA 1WFMA 4RMVA 4Z3FA 3BW9B 4ZMPA 5KAQF 2D7OA 1JPEA 1TLKA 2IAND 3EJTA 2JFCA 3V52H 3LZLA 2QEJC 2P24A 2HRHA 3C5JA 2R2BA 4F2FA 2WZ0A 4HKZA 4IBSA 2ZJPA 4LHJB 4LLYB 5IHLB 1TVDA 5SWSA 2CO7A 4Z76A 1BBXC 1F4XH 4DK3A 1I50B 1J10A 5C07A 1YHQA 4AM0A 3KL3A 1E4XI 3MBWA 4JRYD 5F1NA 4ZAKD 1BVZA 1SPDA 8FABB 4HUXA 4WCYH 1AIZA 1UEMA 2X53A 5IWAL 3GSOB 3MA7A 5JXED 1G6RA 2F54B 1PTOC 2B2TA 5FW7A 1GHFH 3VI4E 1JP5A 1WCQA 3NACL 4XHJD 1VQBA 4B7LA 1BLNB 3P3SA 5HHVL 3EJIA 5E99H 1BMWA 3QBTB 5EBMA 3NSWA 1FG9C 5FGRA 3E9IA 4LGSB 1FL3B 4N90E 1FFPA 1K5NB 4OF5A 3QJZA 2A6HC 3VGBA 3TS8A 3VR2A 1KWGA 3NUKA 3MUY1 2VDPL 4RWYH 4LSVH 5FOJA 5IV2A 3DV6B 5KSVA 3BP7A 2BHUA 5T3XL 5B3NA 3VSVA 2H8PA 2CXGA 3U46A 5I5IA 1WIUA 1A9VA 5DM73 1IZKA 4LF3B 1E8ZA 3FU8A 1CA6A 4OD1L 2IDUA 2DY2A 1Z0MA 1PLCA 2PKDA 4YGAB 2AC0A 1JTTA 3V5HA 2F8IA 2QKIA 5E9DB 4OO1I 4A37A 4F7TB 4CKCA 3R8BB 1U8HB 4XNDA 1TFHA 4YBQD 1XH1A 2HX8A 3P4MA 4OX9L 3UYRH 3ZHDA 3GSVB 2VXQH 3HNVL 3QWRD 4XXWC 1J5OL 1ENFA 3EYUH 5CSZB 2IHEA 5PCYA 2FDBP 3QHFH 1PH5A 4DPRA 2AZAA 4JI8L 1RIVH 1ID2A 4JPVL 2MJ8A 3L16A 4AX3A 3J80c 4DV4Q 4XXDB 4IRSC 3BH8B 3FTZA 4G82A 5IFAH 4AKPA 2R1XB 1W6WA 2ATKA 5IF0B 3BZDB 1K8DB 2HH0L 1KFAL 2AXWA 4HCRL 3HI5H 1EXHA 3VXTA 1K8GA 5G4NA 3SIKA 2J6WA 3ZDZF 2ZCKH 4KO6A 1EEUA 2OQKA 4LLQA 4RA3A 1EY5A 4PJ8A 4D7PA 2ZSWB 2GSIA 2Q8TA 2O5XH 4AMXA 1FFOB 2DQGH 2QV2A 1J11A 1NGQL 2JCCA 1MCLA 3BVNB 3G6JB 2XHNA 3ZY7A 3D69B 1NCNA 3OYYA 1OSZA 4QT5A 5CHNB 1BVNP 1BVKB 3T04D 2Z0SA 5D1ZA 3TJHC 1MVUA 2CQAA 4G59C 2PI2A 4F3FA 4MCNA 4LDLB 4ZO7A 1H9DA 3A67L 1DBAL 5TK2A 4ESKA 1J5DA 5KSAB 2WIIA 5LXGH 3BZFA 3FO0H 1GZPB 5D2NA 5DC9B 3SPIA 4UP9A 3FCSA 2EIDA 4PRIE 5DHXB 2F0FA 4KDVA 1MF2H 2OZ4L 2BX5A 1KY7A 1PRTB 1SYEA 2VQ1B 5FK9B 5I1LA 4M93B 4GI9A 2AMGA 3HN5A 1BQRA 3CPUA 3JWOH 3IDJA 3L9YA 3NCYS 4W9KC 5LN4A 3WEBA 5F6HJ 4X6CB 1JDCA 2A1AA 3GV6A 2EDMA 5IMOA 4F37F 3V79C 4JHUA 4K23H 1VERA 1D5XB 1FYTB 2F53A 3D34A 3BG3A 3GI8L 3DDGA 4EI5A 4PRID 2J7LA 5DWPA 5BPPA 4WHTB 1XMWA 1FDLH 3RPIB 3O3BB 1IEHA 3ARBD 3LKRA 1UYWH 3R1GL 4M6OL 5FGCE 4JFOB 5FHBL 2VM4A 1I1YB 2WUBL 2AJXL 3BW9A 3HC3L 5GZNC 3PV7A 2NY4B 1EDQA 4Q2ZB 32C2B 4LLYA 1B6DA 4JREB 4UQCA 1SMYC 4XO5A 1AH9A 4JR9L 3DIDA 1EWIA 2FJHB 1QFWM 1RCVD 3AGVA 1NQBA 1XAKA 2H4EA 4XMLH 1DZBA 3LH9A 2AQ2B 5A2IH 2ITEA 8FABA 1TQVA 3GSOA 5L6YH 2F54A 4NN6B 3NTKA 4TVPL 4H7VA 2VLLB 4O4YH 2RHQB 2UXVA 1JHKL 3K5MA 1BZDA 1G7HB 1J8RA 3FW6A 3NJKA 1BLNA 1RU9L 1TTBA 2J57A 5CF3A 5A2AA 4DVRH 4IM8A 1WE5A 3LPPA 4Y1AB 1S5BD 1K5NA 4I3RL 4EQPA 3BIAX 3MLVH 4GFTB 5GAGC 3PUWA 1JF6A 4JY5L 4U6HB 3VFVB 3AXLB 4RRPA 2WCSA 1GIGH 4ADIA 3U1PA 4YO0A 5I9QB 3FPUB 2OI9C 4PJCE 2JJVA 3DV6A 3P0YH 4ZFZB 3PE9A 1I1FB 1ZJBA 5ISZB 1T03H 3JT0A 4PJAB 4WV1C 3LNFA 2XDHA 1VLXA 2MCPH 2WBJD 1DQMH 4ZFGH 4A2DA 3GTMH 3E8UL 2V4DA 5I1EH 4LWCA 2FO1A 4F5CA 1YPZB 3PJSB 5E9DA 3DETD 4F7TA 4OLVL 3R8BA 1NIEA 1U8HA 1A64A 3BDCA 1Z9OA 4BKLB 1J48A 1G1OA 2CM5A 3GSVA 4DW2H 4MA1B 2CVRA 3ZJYC 2G60H 4N2MA 5CSZA 3S36H 4R4QA 2YPVA 3A4AA 3LRGA 3MTXA 3LIZH 2J1YA 3CCEA 5MP6H 2V5YA 1X3QA 2XX1A 5D72L 4EPSA 2V37A 3PJNA 3BH8A 4MCMA 3M4PA 1MCRA 4GBXB 5HHPB 2R1XA 5IF0A 2UU9Q 1EZSA 1K8DA 3K4AA 3TV8A 3GBDA 5CV6A 3EJCA 1X5ZA 3WEOA 3UGUA 3P4NB 1BPVA 1DGSA 1PH8A 1A7OL 4KK8D 4KFZC 1BXTA 4QDGA 1GGCH 3OWEB 1I8KB 2X2JA 1FFOA 2YD5A 4QLWA 3GMRA 3BVNA 3G6JA 1CI5A 3J80i 4NO2B 3D69A 4LF4L 3ARGB 5I5RA 1BVKA 1JGLL 2JKIS 1HTLD 5F7YC 1TTAA 2X05A 1EFXB 2FO8A 2CDEB 2H0JA 4WNQB 5SV3A 3VRJB 5HYQB 3STBC 25C8H 2MHAB 5KSAA 4Q9RH 1U4MA 5TTRA 2OCJA 2AABH 1GZPA 2I25N 3K80C 3NBHA 2ZWNA 1RUQL 3VI4F 1RPQA 1T04B 2ZICA 4UF7C 4POGA 3BFQG 4I3SH 5FK9A 4LFBQ 4OO1H 2VQ1A 4LNQA 1AD9B 4JI6Q 1RUPH 4AQ8A 5AZEH 3W9DB 1N0XL 1OGSA 2FX9L 3L2LA 4X6CA 3TT1L 5GAHC 5GISH 3A3YB 3QIUB 1WVLA 2K5DA 3U2SB 1XL4A 4RCAA 4G7ZC 5A2BA 3L0OA 1D5XA 1FYTA 3TZVC 4I77L 3R2TA 4WHTA 3RPIA 3O3BA 1M7DB 4MMXC 1A9EB 4LF7Q 5ENWB 3UAJD 3E2HB 3GK8L 4JFOA 1I1YA 4Z0XB 3FMCA 4A3EB 2PP7A 1G9NC 1C5BL 4Q2ZA 2AXFA 2EE0A 3RFRA 3NENA 5D5ME 3X3NA 2F5BH 4R97C 4Z9KB 4BUHA 3TL5A 2W0FB 4EJ1C 1P5UB 2FJHA 3T0XA 4RBPH 5AAMC 3W5NA 3ND9A 3K6DA 3T6ZA 2X89A 4NSKB 2AQ2A 1LO4L 1CYXA 2EDBA 5JHLA 1XH2A 4FULA 3HHRB 4ONFH 1KTKA 3Q5YA 4QKXB 5D7JC 3GZKA 2AKWB 1KPRA 4JPWL 2ZP8A 2K6AA 1G7HA 1ZJAA 3PL6B 5I1KL 1RPUA 2EYHA 5IROC 2AJUL 1SVCP 2K5QA 1SRDA 1RK0B 2G5DA 5IVXB 4IUTA 1HZKA 4FQIL 1T7ZA 4Y1AA 3GTMB 2Z93A 3KXFE 5M3MB 2FVNA 4KTYA 3VYPA 1GUTA 2WWMD 3BJLA 3AXLA 4U6HA 2FD6H 3ESMA 3VFVA 3MJ9H 3VWJC 1LEIB 4XNXH 3E6HB 3ZKXC 4ZFZA 3VA5A 3C1EA 1RURL 5GADC 1I1FA 5ISZA 4XCFH 1IGMH 4EQ2A 1X5JA 4PJAA 4YE4H 1GS8A 1IW7C 3EJPA 5HJGA 4POYA 4M7KL 4NP5A 1A6PA 1N5YH 4N2GA 2IPKD 3TLRA 1YPZA 3PJSA 1NBQA 5I8OH 1UADC 3MV7E 1P7BA 3BQVA 5LVEA 3AU0A 3KXFD 4WW2B 1U8NB 5E1HB 5FHAL 4NJAL 4BKLA 3BPOC 3DJSA 5ICXB 1RIUH 3HE7D 2YAMA 4MJ5B 1RDPD 4RKBA 4ACTA 1I3GL 5F3BB 3WIHL 1CF8L 1HVXA 1QR1B 1FH2A 3K0XA 3FDWA 3N44F 4BYHA 2AEIT 4K7PL 3QG6B 4WORA 1UACL 1V3JA 1NA8A 4OM1L 1YNJC 2CFMA 3PWPB 3IKJA 5HHPA 4QIWE 3I4MH 2CUMA 2ZAHA 3OVUB 4KKCC 4MJHA 4AQYQ 4WI7A 1N0LB 2I5LX 1Q9OB 1E2WA 2A9BA 4PJIB 2E2HB 1Y1DA 5LHY1 4E9TA 3LZNA 2NZ9D 2VZ3A 4OU3A 3SBPA 4ZTOL 2H3XC 2UUAL 4R4CA 2MPMA 4ODVL 3OWEA 1I8KA 1VCBC 2XV2A 4FKEA 3C6EA 1ET7A 2VAAB 2HT2C 2XNAC 1J9CT 3QG1A 2Y2YA 4NO2A 1GMEA 3UO1L 3ARGA 4BEIA 2YQ3A 1FZKB 4D9RE 4LIQE 1EFXA 3NACH 2CDEA 1I6HB 4WNQA 3VRJA 5HYQA 2NCEA 2NUCA 4K3HA 5HHVH 1UJ3B 1W2BA 4BCXA 2V0AA 2MHAA 5D1QE 2J73A 3KHOA 2WOBA 3VFNB 2DQMA 4FF1A 1WS8A 1PFNA 4KV6A 1E0BA 3OM3B 5AKTA 1MVYA 1T04A 3BJ91 4UNTA 3BMVA 2VDPH 2R1WB 2YBGA 3KPLB 4HJJL 1AD9A 3S2HB 2OYPA 1FJ1A 4DR4Q 1MCEA 2HPTA 3W9DA 2F4VL 3AYHB 3WFBL 4DPBX 3DTXB 2H2PD 5AW6B 3PGCB 2VL5B 3QIUA 1W8EA 5I16B 3C2AL 4OD1H 5D1QD 1JF5A 5CBEB 5FO2A 4L5FL 4KUCD 4PJCF 1ZVSA 4ZO6A 2WAQB 3QZBA 3UC0L 4OGAC 1M7DA 1A9EA 3HNVH 1JB7A 1J5OH 1F6FB 3HOXG 1P4LB 4Z0XA 4G7SB 5BZDB 2YQGA 3T51B 4QOKE 4KHTL 1BVLB 4P06A 3VYNA 3TQYA 1HNXL 3LH2L 2ENJA 4DR5L 1E5BA 2XA8H 2W0FA 4RETB 4AC2A 1DANU 1AQDB 3MKGA 1P5UA 5IG7A 4I65A 2ZXWB 2ZWZA 3HKZG 4NQDE 3EQLC 3M4OB 1LT6D 3F65A 1YEEH 3EDDA 2D7PA 4GKNB 5JW4N 5FWQA 1KFAH 1IFHL 4JCWA 3WOVA 2XN2A 2WYIA 4HCRH 1FJGL 1CT8B 4IJTA 2CHBD 2YA2A 3VFWB 5BR8Q 2LVEA 4P57A 4M7LH 1WTPA 3PL6A 2VW4A 1WH0A 4WZ9A 1UD8A 3RX5A 4GQ9L 2PZUA 2XWBB 5EZOL 3SE9H 1RK0A 1GH7A 2OL3L 3EN2A 3IDGB 4L23A 3V5KA 5IVXA 4P59L 3GLZA 2FEEL 3IS1X 4MZIA 4I2XE 3OLEA 4RLDA 4UY8C 1LEIA 1SBBB 2Z35B 5ADPL 4YSEA 1DQVA 3BH9B 3E6HA 5EU3B 1DBAH 2F0PA 2MWCA 4WGKA 2FHTA 5L0QB 4CU8A 1EU3A 4F15C 4YSAA 4NB7A 1UD4A 2VN6A 1YMHA 1HHHB 2OZ4H 2BA1A 3V5DB 4JI0L 1FNLA 3GXFA 5IGGA 3SDAD 3SBRA 4OY9A 1U8NA 1HHKB 5ELBA 3HMWL 3TXAA 5ICXA 3LB6D 3I4MB 4ELMB 4K0KQ 1X55A 5EAYA 4MJ5A 2W9LA 1BWWA 2HSIA 3FTXA 3LIUA 3B83A 4HISA 4QGUA 5F3BA 2D8KA 5DZ9A 5AW0B 2RHSB 1QR1A 2B39A 2MOQA 4HJ0D 4P49A 1Q0EA 1P1ZB 3QG6A 5CNHA 4YOKA 4A55A 3VE0B 3PWPA 3R1GH 4OCSL 1L9TA 3NGBB 1JXKA 1LLRD 1I9IL 1OAQL 2AEQL 1N0LA 2AJXH 3QJVB 4X3TA 4P71A 3ROLB 1VFUA 1J1PL 1Q9OA 3IDMB 1GAFL 4PJIA 1HXYD 3RTQC 5ID0B 5L4FA 3PWVB 3BDXA 4N0YL 1XGZA 4FHJA 4WKZB 4XN8A 5B4MC 3UE1A 1NGYB 2QV4A 4JR9H 5IHWA 3TTYA 2NYKA 4UT9A 3I91A 3ARQA 5CEZD 2YIHA 4YHMH 1CICD 5I75B 3AREB 5C07E 4PG2A 2VAAA 2BY3A 3T5WA 1S46A 5D5MF 5K5YA 5JOPD 3P9LB 3SN6N 4TVPH 1FZKA 3ZK0A 4TQEL 4XQQA 5CV7A 2YWYA 1JHKH 2L4OA 4MBRA 1H8SA 5F9AC 2OR9L 3S96B 1RU9H 1UJ3A 2YD8A 4KO9A 5FCSH 4IUQA 5SWSD 3VFNA 3TO2B 1E2ZA 1EMTL 4JI3L 2X4TB 1UH4A 4I3RH 3D05A 5C07D 4OQTL 3QYNA 5C7ZA 1WBZA 4Y1SA 4JY5H 3VWKB 1WK0A 3LQMA 4JFXB 2R1WA 4U6VL 2OYLA 4BA1I 1J8HB 5TF1H 3K2IA 4NN7C 1FIEA 4JJOA 2DI7A 1E5ZA 4HMCA 1J1XL 5JMRA 2V7NB 3DTXA 4JDEB 3PGCA 2J6EL 1DO6A 3I4LA 2XN1A 4YX2H 5I16A 5JHDA 1D5RA 4YEEA 3JQOB 4H1LB 4UCFA 4YZFE 1INEL 5JLZA 2XZQL 4L8CA 4QJ3B 4WIQA 4XN7A 2HXAA 4XVTL 4U7KA 4P23C 3P4LA 1EDHA 1BF5A 3KPOB 3CSYB 1S78D 2O5YH 3U0TB 5KYUB 5A35A 4XHQA 1P4LA 2APWA 3SYAA 5BZDA 4QGTA 5KTEL 1X5HA 1SE8A 1STGA 2FLRT 4PEEA 3FZUD 5SWQB 1BVLA 3E0JA 1CKMA 1E30A 3WE6B 2QPDB 5D72H 2B2UA 1COBA 1JGUL 1RZFH 2AWNA 1AQDA 1IARB 2Y0SE 3BAIA 3SK6A 3O13A 4HC1A 1OP3H 2BSDA 4GKNA 1SOQA 1X9UA 1SYFA 2K7PA 4KRLB 2VB5A 1BMGA 1ZA3B 2XZAL 2DMGA 2E2JH 3ARVA 1CT8A 1YCSA 3FFOA 3FOMB 3VYOA 1JZJA 3VFWA 1T66C 3GTKH 1VQ7A 4NHUB 2ZOTA 1ITBB 1CFMA 2AQNA 2X1WL 4XWOC 4HULB 2XWXA 5JORB 5M7QA 3IDGA 2J4WL 2R2CA 1LTTD 1G0DA 1TZAA 1JGLH 1U8JB 1J5HA 1SBBA 2Z35A 2KMWA 4DGYL 3ABZA 4NKLA 4KY5A 3GNML 5EU3A 1Q9WA 4W9DC 3HOWB 1ZT1B 4K71B 5JNYB 2IWKA 3HOXH 4X6DE 2QADB 3RBSA 2DQHL 3BEVB 3AWGA 1E5CA 4KITB 1MJJB 2DKUA 1HHHA 4LOUD 4PJ8D 4UOZA 3V5DA 2FEEI 4LSUH 4BSWB 1SBSL 2UZYB 4IBYA 2NVXH 4G6KL 5E95B 3ECVA 4K14A 1HHKA 1N0XH 1BZ7B 1W2KT 4KUCF 3TN0B 4ELMA 5D1ZD 3TT1H 4KDTA 3UBHA 1SN2A 1KZQA 1U3HC 3KLAB 3MV8E 4I77H 1FL0A 2F7QA 4N4YB 3NCFB 2F53E 4XCCL 1P1ZA 3TH3T 4ZT1A 5H2BB 4IFDJ 1PH2A 3RAJL 1YC7A 3RGBA 4QWWC 3MOAL 4K6LA 1DVFC 4LAQL 2NY3D 4XNMB 4Y9EA 4D94A 1GS7A 1M9WA 3ROLA 3CFBB 1C5BH 4ICXA 1XMQQ 3IDMA 5ID0A 1WAAE 3ND8A 3PWVA 3VNZA 3SR1A 5M5WH 3MUGB 4WKZA 1NGYA 4FEIA 1IBLQ 3QO2A 2WBWB 1ZANL 2A6IA 2YUZA 1KJMB 2F53D 4M8AA 2R7ZG 1GL4B 1WUZA 3AREA 4HUMB 4JPSA 1JZGA 4GI8A 1LO4H 4OUUB 4Y19B 5LMNW 2XXCB 3EGXB 3DBXB 1QPPA 3ZR5A 2V7HB 3ASWA 4C83B 3WHXB 3GIZL 2BH8A 4JPWH 3W5OA 1AS7A 3SYOA 3FRPB 2F54E 2X4UB 4B7IA 4OVVA 2WXNA 4LK4A 3S96A 5I1KH 1Y07A 5E2JA 1U95B 3P1HA 1HK6A 2YGNA 2AJUH 3EFFB 2L0DA 4KKAD 3TO2A 3V7AG 4L3CB 4FQIH 2X4TA 5LNGA 2JI3A 5FJ8G 3GC3A 4U3XA 3NWSA 1HI6B 2NNXA 3U6RB 2Z31B 4P2CG 3VWKA 4ETYA 4JFXA 3ZQWA 1ICWA 4GN3B 4XTCS 1J8HA 4IRZL 3KYNB 1X56A 2F54D 4KI5E 4QMEA 5BUAA 5HURA 3FB7B 2V7NA 1BXVA 4MHHI 3Q8AA 1Q7YC 4KK9D 5G5DB 5C44G 2Z1KA 1IGJB 1VA9A 4GAYB 4H1LA 3BSGA 4XX1E 4JZJC 2NNAB 1EJ8A 5FHAH 4BK8A 2YFNA 3B9EA 1RF2D 4NJAH 1N36Q 3CSYA 3KPOA 3U0TA 1AZVA 1CLOH 5EIVA 5KYUA 2PXYB 2VO5A 3ZHNA 3W37A 3ROOA 5SWQA 2OK0L 2AFNA 3WIHH 4HGKC 3LJ3A 4Y1TA 1CF8H 1OPGL 2CKNA 3OAZK 5DQDH 3WE6A 4BA8A 2BIHA 4B97A 4WI9A 4K7PH 4PJEB 4PV1C 4GKJQ 1RUAL 1UACH 4OM1H 4V2BA 3QDMB 5G3LD 1MCBA 3Q01A 4TXVB 4MZRA 3MFYA 1DONA 2XT1B 3L3IB 3B5GA 2R0KH 3EHBB 1KNOB 3OKLB 4MXQC 1TWAH 4HEPG 1V05A 5E9DD 4BXXH 1ZA3A 3HAEG 4ACPA 3QRLA 1YVCA 1KXHA 4H0LC 2C3HA 3JC66 3FOMA 3RUGE 1IE5A 2ZXRA 5D7IE 1RUKL 2OMNA 4ZTOH 2Q2EB 1OPOA 1F4HA 1NBWA 4NHUA 4ODVH 3OAUL 3H85A 1QUNB 5JORA 2HFTA 4LKCB 1DDHB 3BWSA 1QW8A 3UO1H 1F6AB 2YHGA 3QULB 3QZMA 1HE7A 3VM7A 3QFDA 4B0MB 5CSGA 2WXOA 1AP2B 3RY6A 1E8WA 2XQYK 2ZQKA 2G0KA 1P84K 1CXHA 2LLGA 1ZT1A 3QUXB 4NLHA 1MCCA 5JNYA 2XV6B 4ODWB 1MAKA 4MIUA 1MJJA 3U6XS 1I4GA 4DV0L 4BSWA 3QVAA 2UZYA 1F42A 3HS9A 3FAXA 4HJJH 5F96L 4DEPB 3D4GA 3SDXB 4ZUWB 3RY4A 4ZRZA 1T0NB 3WFBH 1BZ7A 3TN0A 3ZE0F 4V33A 4E36A 5E8DL 1HN1A 3C2AH 3QW9A 1OEZW 3AG1B 2VLKB 3KLAA 4L5FH 1I31A 2QHLA 1HSBB 3AY4A 4TS6A 5KSAD 3TO4C 1IBBA 3M86A 5M5WB 3SBWA 3UC0H 3VFOA 3K8KA 5H2BA 5AUMB 5HDWA 1FHNA 2YXVA 4XNMA 1NL0L 3ILPB 3CFMA 3CFBA 3MXPA 1UA3A 4KHTH 1N3NB 4YZFF 3VMNA 1U4FA 4KK5D 3MC0B 1THAA 3MUGA 1FFRA 4X5WA 4U3SB 4KJWC 3FYIB 1QWNA 3FVQA 4HIOA 1NIBA 1LO0H 1WLHA 2GG1A 3ATBA 1KJMA 5DRZA 1FYTD 4OUUA 4Y19A 5F9DC 3IAYA 4DKAA 3F00A 1IFHH 1M6UA 4JO4L 5JPMB 2ESVE 2AJZB 3EGXA 3DBXA 4NCC2 3GM0A 3WOEA 2V7HA 4C83A 5FLUA 1FO0L 3FRPA 4DO6A 1T83C 2NT1A 2VMJA 3A4DA 3QJOA 5E4AA 3GB7B 1TT6A 2NY4D 3GSRB 4MQXC 1U95A 4GQ9H 4Y9GA 3M4YA 3EFFA 4J3VA 2OL3H 3ISWA 1Q8MA 2NVQH 1NEZG 1NFKA 3F5WB 4P59H 1MCSA 4G8EB 1X9LA 1TQTA 3CSGA 1HI6A 3HFFA 5LMNQ 2EEDA 2Z31A 1RZKL 2X89D 2FLBT 3QS2A 4NO0B 3U6RA 5ADPH 1KT2B 4L1SA 4F9LA 1PS3A 3KYNA 2NSXA 5ACMA 5I26A 2VYRE 2F7IA 3GMQB 3N9GL 1RZ8B 4OLZL 4HEMA 5G5DA 5ISZE 4N28A 4A3MH 1EEQA 5EOQL 2IOIA 1IGJA 5AVUB 4PJAE 4GAYA 1A7QL 3PG2A 1RVFL 4U31A 1FFNB 3LKSB 2E4TA 4ZFOL 2NNAA 1Z32X 1EHLL 3HMWH 3QIWC 2UZXB 4OTXL 3KVQA 4P2RE 3V05A 2CUHA 2EE6A 1A25A 4X6DF 1AZNA 3CCHB 2PXYA 4Y5XB 4JEGB 1A4JB 2AVFA 3JZ7A 5ISZD 3PDOB 5HGQA 2CCVA 1BXAA 1UWXK 2YXMA 2OMUB 1G7QB 2P5WE 4PJEA 5JQ6L 3QDMA 2YUWA 3OKEB 3DWAA 3WTUA 4PR5B 1OAQH 2AEQH 2BSED 2F2HA 3DVFA 3L3IA 3OKLA 4MAYB 4YSPA 1B0RB 1KNOA 3OJDB 4BFKA 2KQ3A 1J1PH 5L37A 1GAFH 4F8TA 4FADA 4X6EB 1IBMQ 1GHKA 1ZHKB 5FJ8H 1XAUA 4LP8A 4N0YH 4RGNC 1J12A 1CKOA 1EUUA 2CHXA 4Y4KC 2XETA 1SYGA 2B77A 4B3VA 2P5WD 3KJ4C 5IQOA 4UP7A 5FKAC 1QUNA 4UDTB 4EKXA 5H4ZA 3FQXA 4K6DA 3G71A 2P44B 1DDHA 4LKCA 1DHKA 1F6AA 3KHQA 3QULA 4GBXD 4UBDC 3VFRB 4TQEH 4AQ1B 1V1QA 2UXDQ 4RWSC 2MOGA 3PP4L 3SDCC 1X3GA 4GOPB 1WUNT 4OIIL 4ODUB 4PJGE 4OIBA 3O45B 2P45B 1INDL 5IFJA 3BD5A 2P42B 1B3AA 4MZ3A 5DZNA 4ODWA 5DZVA 3RYMA 1RZPA 4OQTH 5D93C 2EC8A 5KNCA 2BSTB 4OONA 4U6VH 3ZTDC 3C2SA 4QUOA 4OFVA 1E4KA 4U2ZA 4R8NA 5E1AB 4ZUWA 4H8WC 3ARGD 5C4XB 3PO3H 1J1XH 1T0NA 4QKTA 2IW3A 2NQ3A 5DRNB 1LTXA 2H3NB 2J6EH 4NJ9L 1EFXD 4JHAH 2R69L 1VGKB 4H5SB 3HAEH 2VLKA 1Y1WB 1INEH 4UM8B 1HSBA 2XZQH 3BMWA 5A1AA 5C6PB 1P5VB 3TPUB 4XVTH 1D6EC 2G2RB 4P5TC 1EV2E 5AUMA 3P0GB 4DP8X 5J1AA 1Z1WA 2HX7A 5KTEH 3ILPA 1FYHB 4GRWB 2MGSA 2R29L 2B63G 5G3LF 4FTVB 3MC0A 4KJQC 4YAQB 5CN1A 2ZOLB 1JGUH 4U3SA 2PO6B 3QIUD 1II3A 2XFGB 5GGSB 1Y1VB 3CXFA 5FLMH 1FAIH 3UIZA 2BOBB 5KJ7E 2GAZA 1WISA 5JPMA 3FFCE 2NVQB 5A2QE 2AJZA 4RA0C 5AB9A 3FHWA 4PVLA 2E9GA 4GAJH 3MROB 5DJ0B 4N0CD 2D4DA 2IOOA 3GB7A 4HTHA 4Q4EA 3GSRA 1P6FA 1H3GA 4IW4C 2RQEA 1A7PH 3CZJA 5LBSL 2HCCA 2J43A 2PQAB 2SOBA 2GW5A 5DVKA 2J4WH 3NDYE 4KVCL 1I85A 4NP9A 3F5WA 3FCGA 1DVTA 5CM1A 2C3WA 4G8EA 1B44D 5D7IF 4NO0A 1KXQE 4DGYH 1KT2A 3CF5A 1TF4A 1TPXB 3AGWA 5I9PA 3GNMH 2IGTA 4W6XB 1YNLH 1AFPA 3CFQA 5IZ7A 3UZVB 3GMQA 3TA3B 4JI7Q 1RZ8A 4GINA 3F1ZA 1HILB 3L1FA 3B2MA 3WNJA 1SN0A 3G6JF 1WZLA 3PL6D 1ESFA 1ZSDB 2WGNB 3K5SA 1SBSH 1FFNA 3FTVA 3P9WB 3LKSA 4G6KH 1JNHA 3M7FB 4UZSA 5AOLA 5INDB 3RNUA 4J3XA 2A74B 4KMQA 1H3PL 2UZXA 3KCPB 1S7WB 4KJYB 4HOXA 2OXGB 1Y14B 1YMME 5MEOB 3U2JA 1E65A 1MZZA 2IPUK 4NQSB 2R9HD 1A62A 3JAME 3MJ7B 1A4JA 3IFDA 1A3VA 3H53A 3PDOA 3ZR6A 2J88L 4XCCH 2OMUA 1G7QA 5NUCA 3QZWG 2EDRA 3GTNA 3WJLA 3RAJH 4UTAL 1LVEA 3OKEA 2WXRA 3TM6A 1PH7A 4PR5A 3MOAH 4LAQH 1SLJA 1ID5I 4J3SA 1IGTB 3H15A 1SXNA 3KAAA 4MAYA 1B0RA 3OJDA 3K4ZA 3PWPE 4X6CF 1HTPA 3EH4B 4PS4L 1ZHKA 4X6EA 1J5EL 1TLMA 3V4VB 3HBPA 4DR1Q 3WFZA 2EDKA 3N41B 4AEIL 1ZANH 3K81A 4FG4A 2KHSA 1QSZA 1PZBA 2B2XH 2ERJC 1LWRA 4UDTA 2I32A 3CRKC 4ZG1A 4DP0X 3TJPA 1TMCB 1IMHC 2BZ7A 4AQ1A 3PWPD 3DWTA 4CVWA 3CKIB 5B3JE 3IGLA 4K8RC 3DO3A 1BZEA 4W81A 2XBDA 3HNTL 4GOPA 3IAQA 4CN1A 4ODUA 3BLKA 3O45A 5GQBA 1HNWQ 1SJEB 3MUHL 1CK0L 1FC2D 5E4IA 4F7EB 1KIUB 2D7TL 3NCYP 2WO2B 1LM8V 1YO4A 3QUYC 2J12B 5EN2B 2CRZA 5E6IB 3MV01 2BSTA 2XFXB 2D0PA 2WLNA 4EF3A 2G3ZA 1JTPA 2KT6A 4IRZH 1JTOA 2OSYA 5HPMB 5E1AA 1T3FB 4PY7B 3OJVC 2IQ9H 2UZPA 2Y23A 4TM9A 5DRNA 2P5PA 2H3NA 5AZUA 4A3DG 4LQ1A 4JX0A 1VGKA 1WGOA 4H5SA 4JG1L 5I6LA 4XTRD 5KANI 4M6AA 4UM8A 4BELD 1P5VA 4DT2A 5CBEE 2ID0A 4EI0A 3TPUA 3FYEB 1NBYB 2G2RA 2VXVL 3IWUA 2WAQE 5KVGH 4JYAQ 1O5DT 5DD1L 3WXVL 4YR6B 4TNVF 4PJAF 4I87A 4YXKL 4DERA 3GTLB 3O0RL 3BGFC 4FTVA 1OPGH 4YAQA 1JGIA 2APXA 2ZOLA 4UQ9A 4ZRGA 5C0JA 4MNOA 2PO6A 5E24E 5GGSA 1OF2B 2D9QB 2BOBA 1MY7A 1RL1A 3P1VA 4BH8B 4K15A 1XIWC 3R4RA 2JJTA 4TKWA 5DHEA 5KVDL 1CFSB 2MOVA 3KLHD 2WWKO 3MROA 2I0QA 5DJ0A 3SGIA 3APMA 2LSSA 3OWFA 1TQCC 3OAUH 4NDXA 1KACB 1SNMA 2IH8A 3QEQB 4O9HL 5ABZA 2PQAA 1V43A 1BDYA 1HCFX 3WN6A 2KCCA 1Y7VA 2G5BB 3NP4A 1G6PA 2E9BA 4XN9A 1EO7A 2QT6A 5F2FA 2WQ8A 4X64Q 4ZMOA 4KQ0A 5DUML 1E5UI 2PTTB 3CHPA 1BF8A 1SEBB 3OPOA 3NSJA 2KDGA 4KXBA 2HVKA 2KZWA 5F0JB 4S1RL 2B14A 2VMFA 4GLVB 2H1LM 3ERXA 3UZVA 3TA3A 1M57B 3V6OC 4PIRF 2EUWA 3WENA 2B63H 1BF4A 1ZSDA 2R4RL 3CSBA 4NO3B 3HJEA 1IGYB 5F96H 5FGBA 3MJWA 5INDA 4WI5A 4PJGF 2A74A 1PH9A 3CN0A 3GXDA 2X3CA 4LFAQ 1S7WA 2MFIA 2OXGA 2EO9A 5E8DH 3DOIA 5MEOA 4JG2A 4NC0B 1UA6L 2YR3A 3I74A 4H8PA 4BIKA 2H5XA 4NQSA 1U41A 4ABVA 3MJ7A 4N2KA 5C0GB 2CH4A 2VZOA 2EE2A 4I4WB 1RJYB 5AW8B 1UE1A 1QKZH 1YIJA 1X3DA 1SNPA 2M8XA 4BBRB 3BU2A 4MSWB 4QRSB 1X9NA 3PUCA 4X5PA 2HVBA 1QATA 2BVQB 5BZXA 1IGTA 1NL0H 3S1MB 1W8OA 4Y2DB 3SSGA 4WY7L 2BRRL 5MI0C 3OZLA 1OAKL 5JXAH 5LNEA 3V4VA 2ARJA 2F7OA 3NCXA 2LXKA 3VFGL 3WD5H 3IL8A 5C0IB 5JPNC 5B8CB 3ML8A 1X5XA 4UNIA 1SYBA 1ET8A 4OZGB 4JO4H 4CN6A 2ZKHL 2W92A 5I8CB 1ZLEA 3UBXB 3NJJA 1JVKA 2EADA 1KN4L 2VLRB 5I1GL 5AL8A 4K2LA 2X6MA 1C8CA 4DR3L 2JA9A 3II1A 4KNTA 3H1ZA 4U05A 1C16B 5FF6B 5J6SA 5FUOL 3L3KA 4UV4L 1SJEA 3S3JA 5GGUB 4F7EA 1KIUA 3ZZLA 4I1RA 1O6SB 5T3XE 4HF5L 2GBTA 1DUZB 5E6IA 2XFXA 2F58L 3ARED 2WANA 1LEGB 3RGVC 3QUML 3RGHA 1ZGLB 4B3RL 1U9RA 2BS71 3FULA 4WUKH 5GS3A 1T3FA 1RHPA 4PY7A 5HPMA 1X5MA 4AYBG 3N9GH 4K8RH 2XSCA 4OLZH 3F2DA 5E70A 5EOQH 2HT1A 1NCVA 5F7WC 4P2AA 1A7QH 1RVFH 1WYJA 4FI8A 4HBCL 4WUUB 2ICES 5T3XD 2AANA 4R0LB 2XUWA 1NBYA 1EHLH 1ES0B 1R0AL 4XT1C 2YN3A 4FFZA 3EOBB 4OTXH 2X4OB 4AI7A 3QJRB 5DVOA 4N8UA 4N26A 2YTXA 4PI0A 4YR6A 1Z2KA 4N20A 3VWKD 7CGTA 1PSKL 1WTGT 1I9JL 4HJIA 4KKBC 3EJUA 1J8HD 5L2JB 3GXTA 1YEIL 3WTVA 1R6VA 1MD2D 1FVDB 1WGVA 2CU9A 3CHQA 3ZTEA 1EIFA 1HFGA 1DSYA 4JHBA 1ERNA 3N1PC 1RFDL 5CGBA 5BZZA 5JA9A 3GBLA 1BVOA 5JQ6H 1OF2A 5C0CE 4HH8A 3MLSL 4WW2F 4YHPB 4BKTC 3VQ1C 4JI1L 2J25A 4Z7UB 3EGDA 4BH8A 2B9BA 2Z7WA 4JKMA 2X1QA 2OULB 1PZUB 1LGVA 2FBJL 3IMBA 1CFSA 2VSDA 1UC6A 5LL6S 3J8F7 1M05A 3EZJB 1IC7L 5HYFA 3QWOB 1OE2A 1TG8A 3BSHA 3HI1B 3WHE1 3QEQA 4JDZB 5C0CD 4XI5C 1QSFE 4C1NK 2CR3A 2G5BA 2V5MA 3RZWA 4FXKC 4YWKA 4A66A 3ULJA 1NTGA 1C8PA 2PTTA 3PP4H 4RMTA 4YLQT 5LO7A 3MI6A 4OIIH 5IY5B 1INDH 1CXFA 5DHVB 3MO1B 4UQEA 2D3NA 1HH2P 5TD4A 1X4XA 4RHSA 5A6IA 2EIFA 2H1EA 3E3XA 4UOW0 1ED3B 5B3JF 1YHPA 2B1OA 5CEYB 3SJVB 4NO3A 5HD8C 4YHOL 5DEFB 3MNMA 3ZMNA 5FECB 3LNNA 1W15A 4BQCA 4WO0A 1GTNA 2CGYA 1FD7D 2R93H 1S7XB 3FN0L 3UP1A 1FNSL 3RLFA 1WS7A 4NJ9H 4PWEA 1F2ZA 2YA0A 3WNIA 1PJ9A 4HKBB 2R69H 3QB7C 1T22B 5IVNA 2GSGB 4N6QA 1WTXA 3D4YA 3HG1B 5C0GA 3APCA 4I4WA 1RJYA 4MTMA 3GSWA 2QADD 4MSWA 4QRSA 4DR2L 1IM9A 2BVYA 2EIEA 3O4OB 4P5MB 1BEYL 5E4WC 1CCZA 1TETL 2BVQA 4TSAH 4Y2DA 1DO5A 3WY2A 3HI6L 4YY3Q 2YK1L 2R29H 2N59A 2UYLB 1A0IA 1F00I 3M46A 5GZOC 1I1AC 2ICWJ 3TN0D 1FO0B 4D8OA 4G6AD 2DQIL 4LL4A 4PWHA 5KEZA 1PZ3A 4TVPE 5B8CA 5C0IA 4TOYL 2XI9A 4MD4B 4WTQA 4XP6H 3CDYA 4PJ9C 3WEXB 1X32A 2DYSB 5K9JH 1KG0B 4OZGA 5SWZA 5L2KE 4JVUA 4XO4A 2B1AL 2AZUA 3UBXA 2VLRA 2MKLC 1GSMA 2K78A 3WEAA 2ZUWA 1JPTL 2SNMA 4JI2Q 1C16A 3R4DA 4DUYL 4IRZA 5FF6A 4IMKA 5LBSH 4K9JA 1GPOL 4ZKCB 1FVEB 2Y22A 4NN5B 4PRBB 4TVPD 4HD9A 4MRCA 5GGUA 4ZMQA 2CWPA 4N3TA 3QQ3B 1O6SA 4ZI8A 1AXTL 1LP9B 3AXHA 1DUZA 2J3SA 4NLAA 4WK2B 4FLSA 4ZBJA 1WBYB 1CXIA 3ZUCA 1AOZA 1USZA 1JICA 4Y19D 1G51A 3MOQA 3B7TA 2TSSA 1ZGLA 3OIPA 4IFDI 4IOSA 3K0WA 5IVOA 1WRFA 1N8ZB 1BJ1H 2N56A 4LF8Q 1F4WL 3RDTC 2MO1A 3BGMB 1X6NA 1KXTB 4WUUA 5I8EB 4IFDG 4R0LA 4XB7A 3C6LC 3QCTL 3WTYA 1ES0A 2YO3A 1H3PH 2AI0H 3EOBA 4NWUL 2X4OA 1CTNA 2VMCA 2V1CC 3DJ9A 2Z31D 1YYLL 5IBTL 1UASA 2R56H 5D4IA 5FYKH 5L2JA 5FYKU 2EYMA 1FVDA 5HVGB 2GJJA 3RB5A 4UDUB 3T0VA 2J88H 1OE1A 3BVTA 2YD2A 4UTAH 3BZ4B 2Z9HA 3PIQB 1FZJB 1E6JL 3D87B 3NTCL 4YHPA 4PJEE 3X1FA 4IIZA 4ELMF 4Z7UA 3F7YA 3QUZB 2WUCL 5FC9A 2DD8L 5GSRB 4DV5L 3LMJL 2AXHA 4K73A 4LFHD 5HI3D 2PXYD 5AJ3L 3TCTA 3N42F 3EH3B 2AS5M 4U6XB 4ZTPL 3NRFA 4QF4A 3HI1A 2CK0H 1NMFA 3QWOA 4JDZA 4PTUB 5I8KL 4LLVB 5IYDG 1PZID 4EEEA 3VO0A 2J1ZA 3QDMD 2Z8WC 4R8IA 3NFSL 5CJQL 2ARWA 4EUPG 3WNPA 4CC4A 1WCMB 3EHBD 1CD1B 1T89C 2WTPA 3HNTH 4AW4A 2L8AA 3E6FA 5DHVA 3GGWB 3MO1A 4FMVA 1CK0H 5EUOB 5J56B 1JZ7A 1FFQA 1I7TB 2VR6A 4X5RA 4IJ3B 1D1KA 3SZKC 1IIIA 2VS1A 3KGUA 3LSOB 1ED3A 1XGRB 2DWDB 1IV8A 2QHRL 3HMXL 4IGBA 4LPVA 5CEYA 3ZRSA 4A7SA 5DEFA 5FECA 3WFDL 1FN4B 4EVOA 1WD0A 2DL2A 4AGMA 4OCXL 4L6TB 3FUIA 3S3SA 1S7XA 2CGZA 1T80A 2F0EA 1KTDB 3F05A 4JFZL 3SDXE 1F1GA 4J12A 3V2AR 4HKBA 5DVLA 1WFJA 4LOEA 1XCTB 2YTYA 2I85A 1T22A 4JG1H 4NCC1 4L4VB 3IFPB 4RG1A 2GSGA 4PBDA 4PMEA 2PZWA 2CO6B 1OB0A 2VABB 1A6TB 3CC1A 1YDPB 3HG1A 1YJWA 4PMCA 2O4EA 2VLKE 3QUXD 5KYYB 2VXVH 3MLYL 3I4NG 4WJKB 4P5MA 2VUMG 5DD1H 5EBWB 2V8MA 1EIBA 3OB0K 2ORBL 2EYTB 3PNWB 4ULLA 2HG5B 3QI9B 1J9SA 2DAVA 2UYLA 5C3EH 2GABA 2VIRB 5LBVA 4A67A 5CZXD 1FO0A 1KV7A 2EVIA 3GZPA 5TE6H 3RIAF 2V3DA 3BFOA 4R3SA 4Y2NA 1L9PA 4XNZB 4MD4A 2VLKD 2APBA 3TOPA 3WEXA 2OSXA 1GW0A 3KFUA 1KG0A 4QJ5B 5BRZB 3AS1A 4BBSH 4OZHB 4P2OC 4AKQA 5GS0D 5KVDH 3S4SB 1WA0X 3I6KB 4IKJA 3RD4A 2P46B 4Y4HC 3SOTA 1EHXA 2XVKA 4IKIA 1K85A 5HHXL 2QPEB 3ZKNC 3QJUB 5DFAA 4DGUA 2F5AL 1ZHNB 4YFDB 1B53A 4PRBA 4KD4A 1FVEA 4O9HH 2VWEE 1M4VA 4XPBL 3QQ3A 1OAUL 4N2HA 4JV5Q 1LP9A 4XMPH 3EADA 4PP1C 3ARUA 4E9SA 4OT1L 5DUMH 4HXBH 2Z1PA 4NRZB 3B1TA 3H2WA 4N8FA 5BRPA 2HLAB 4PCYA 2GK0B 5E7NA 4S1RH 4B3SQ 3MA9H 2GVAA 1MQKL 3EYSL 4XNBA 3O2WL 2B8OT 2RBMA 4QUFA 1ZTMA 3DX9B 4QRPB 3BGMA 1KXTA 3DTUB 5I8EA 2H6PB 3LPGA 4TKOB 1CDYA 3HZYB 3GEWB 5F7KC 3LRSB 3U4VA 1TIID 2W07B 2L7QA 2Y07L 4HAKA 4AUYA 2RA4A 2BERA 4PRPB 3S5LG 3VX1A 4N3UA 4N8VB 1DXMA 2BVEA 1ASOA 4NO0D 1UA6H 1ZIAA 3QE5A 1RLWA 3ULLA 3J81i 1AXIB 2CBPA 5HDQL 3UCRA 4UDUA 1ZYRD 4HGWB 3ISYA 4HLZG 4QNPE 3BZ4A 2X0WA 3MLZL 3PIQA 3ARYA 3TURA 1FZJA 1K4CB 1PYWB 1H8OA 4RMRA 3IEAA 1KRTA 3HZVB 2WB1G 2EY2A 3QUZA 1PD0A 2BRRH 4WY7H 1FBIL 1D5ZB 1OAKH 3NJFA 4PGJA 5GSRA 5DZJA 2OJZL 1QFWH 2J8UE 3GSUB 2KENA 3VFGH 1LNUB 1F90H 2WC7A 3HKFA 4JRFA 3WKML 2DLGA 4MHEA 3CXCA 4AYEC 2FXQA 3I6SA 4U6XA 1PFOA 4F9PA 3AM8A 2YWZA 4PTUA 1VQ8A 4OGXH 2ZKHH 3HBQA 4LLVA 2DTSA 4H25B 5CD5C 1EHAA 2YMOA 5SV4A 5C0FB 1KN4H 2JJWA 3FO9B 5I1GH 5J1ZA 2X9XA 4IFDH 3ATEA 1IAMA 4FNSA 1CD1A 5T5NG 2L7JA 5FUOH 4UV4H 1KCLA 3L9RB 4XZ4A 3GGWA 5EUOA 4FEMA 3F7VB 4Q6YA 1I7TA 1QEXA 4HF5H 2VLJB 1ICFB 2DQDL 2Y69B 1XGRA 3LSOA 2DWDA 5GHWL 2F58H 5D7LB 3I7FA 3NAAL 3PLYA 1B2TA 4ZS7L 2HPOA 1PTOB 2F3VA 2VL6A 3QUMH 1FN4A 2D3LA 4I0KA 3S0PA 4L5FE 4J6RH 2Y36L 4G5ZH 3KS0J 1UM5L 3KLQA 4HSCX 5C5MA 2X40A 3FT1A 1DFXA 2C3XA 3MCLL 4JQVC 2F3IA 1MG3C 1A21A 5GXBB 3MN8A 1XCTA 4DHLA 4L4VA 1N18A 2JA8G 2AQQA 2CO6A 2VABA 4HBCH 1A6TA 1BBDL 1YDPA 5KYYA 1ZSHA 4PSRA 3WMPA 4AYSA 4HMIA 1R0AH 2VDKL 4H2CA 1K3ZA 5EBWA 3VD7A 1FZOB 1ECZA 2EH7L 1WSST 1PSKH 2CWAA 1SROA 1I9JH 2EYTA 3PNWA 5HHNB 1YEIH 2HG5A 3OV6A 3QI9A 3CBKB 2VIRA 4KRPB 2QELA 4V2CB 5AW7B 2IBZX 3GTGH 1NM9A 2X4NB 3QR8A 5LLIC 2CHNA 1AMXA 1MWOA 4FTVE 4KKNA 3TVMC 4AJYV 2EAEA 1R4PB 3VD2A 2IJ0A 3KF8B 3MLSH 2J71A 2MIZA 4PIBA 5BRZA 4OZHA 1PKQB 1VQKA 3LV3B 5E8PB 1FA4A 5KGUA 3S4SA 2FBJH 3CQZB 2K5HA 3I6KA 4KUZH 4ELDA 2MPAL 5DM63 2MTAA 1C0AA 2WY3B 5M5XB 2D9UA 1XBDA 2D0GA 2E8YA 5EBCA 4PJEF 2FQDA 1IC7H 3J80L 2I27N 1VGEH 5IJDC 5DR5L 4L0YA 1Q12A 1ZHNA 2QGQA 4FTVD 4IRSB 1M7IB 3C5XA 2PO6D 1N7MH 3M8OL 4WLCA 5E1FA 4JPQA 2KEEA 5TDOB 1HL4A 2F0VA 4NRZA 2J4XA 2HLAA 2GK0A 3H3BC 1YHAA 3H9HB 4UI2A 1UM6H 3QC6X 2A4CA 3UADA 3BAEL 1BYNA 1P7KA 1TNMA 1GC1L 3WG7B 3ZJAA 1RKNA 4BY7H 1XWVA 2R15A 2EDTA 3JWNG 4PLJD 5DK3A 4NP4L 3A56A 2ZYRA 3ECQA 4LF9L 3DX9A 2B5IB 3CUPB 2YD7A 4QRPA 4YHOH 3V96A 2H6PA 5DT1L 3UPCA 2W80C 3W11D 4MX7B 3CX5K 3DX4A 4X50A 5EOCL 5CC4A 3LRSA 4NUPA 2W07A 1MAML 3WLBB 3JVFC 3VW3L 2VLMD 4PRPA 3BWAB 1SUHA 1FNSH 4N8VA 1YYCA 3AB9A 3T4AC 5AWNL 3FTYA 4XMUA 2BOSA 1CJYA 1DQKA 4WEMB 4B3ML 5EBGA 3EGSB 3TIDB 5DJZB 1HNFA 4XH2B 3QWQB 1MW0A 4N0UE 4HGWA 3TA3D 3UFIA 3JWNC 1VEMA 2G2PA 3SDXF 2DKSA 1BEYH 1K4CA 1TETH 1PYWA 2ZXPA 3AS2A 3HZVA 3HI6H 1K2DB 3SEBA 2YK1H 4C3HH 1D5ZA 4G6FB 4Z9CB 1QEWB 4KGJA 2APTA 4ZZKA 2PPEA 4DV7Q 1NDGB 2DQIH 3GSUA 3K46A 4MTKA 1LNUA 3CPFA 4TOYH 4X7TB 4ZOBA 4GMSL 5CGYD 3VUAA 4O58L 4RDQF 3DECA 2A0LC 4XVUD 4Y9CA 1KYOK 3VH8G 2EDEA 4FYDA 1F3DH 2WQRA 4H25A 3VM5A 1JHTB 1IL8A 5C0FA 5KJ4A 5GGRB 3FO9A 1BQHG 4BH7B 4DXGA 1JPTH 2QTEA 3LPWA 4NOBA 4WEBL 4WO4C 3NZHL 3UMTA 3GF8A 3OHXB 3L9RA 2ZF9A 3PWLB 3F7VA 5B7FA 1E1TA 1PZDA 2I9TB 2BE5D 4RIRB 1AXTH 2VLJA 4RAUB 3LRLA 3P69A 1S9YB 4ZXBB 5AYUL 1FI8C 3SHLA 1XTMA 1XSKA 4GB9A 4PRHB 5D7LA 4JK0D 3P3YA 4HLZH 15C8L 2ZPKH 3DOSB 4AH6A 1K5WA 2N49A 1CDCA 4LPUA 2IO5A 1SLWA 2IOMA 4RRPM 3VCLB 1IIKA 5DYOB 1E4JA 3OGOE 4LAJH 1F4WH 4ZZFA 1KCRH 3V0VB 4H0GA 3P02A 4U1IB 4JK1C 5D2LA 2FT6A 4KK6C 1SJED 2Y7QB 3GTGB 4KHPL 3DHUA 3QCTH 3HE6D 3MXVL 2OI9B 4JFVA 4Q7DA 5IE8A 1FZOA 5D7HA 5IBTH 3BUDA 4TQ8A 5HHNA 4LF6Q 3EFXD 1D2BA 3HNSL 4DGIL 4BS9A 2A3TA 4WV1B 2X4NA 3ETBF 4DPAX 3MLXL 1KYDA 3ABGA 2H3KA 3KF8A 1E6JH 5I6WA 2Q6WB 4CSTA 4IDJL 1C4QA 4LMQI 1KULA 3FN9A 1L3WA 3IMVA 1IJNA 1PKQA 4X9HA 3LV3A 4XNQB 2FHCA 5J11C 5IY0A 3CZEA 2F0DA 4L2LA 3WIFB 2DD8H 3GTJH 4C56C 2NVTH 1F2YA 1ZV5A 3GTTA 3LMJH 2WKCA 4QNPF 3ZYIA 4DNRB 2I5YL 4R4NC 4ZTPH 1L7IL 4IRSA 3THML 3HOYG 1PH6A 5I8KH <