3L3OC

Staphylococcal complement inhibitor (scin) in complex with human complement component c3c
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
306
structure length
294
Chain Sequence
CNKFDLKVTIKPAPEAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis for Complement Recognition and Inhibition Determined by Crystallographic Studies of the Staphylococcal Complement Inhibitor (SCIN) Bound to C3c and C3b.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords Complement C3
total genus 53
structure length 294
sequence length 306
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3l3oC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 3l3oC01
1PXUA 1OO9B 1JC7A 4ILWA 3CU7A 5FO8B 3I70A 3L3OC 3HRZC 2J0TD 3T4AC 3V96A 2E2DC 5FOBB 4D94A 4LNVA 1JB3A 5FO9B 5JPNC 2A74C 2I07B 4FXGC 3OHXC 2QKIC 3HS0C 1UAPA 3CKIB 5FO7B 2WINB 3FRPB 3G6JB 5JPMC 1D2BA 1EDYA 2XWJB 2TMPA 4FXKC 3KLSA 2PN5A 1BUVT 1XWEA 2ICEC 2XWBB 1BQQT 2WIIB 1BV8A 2A73B 1GXDC 1AYOA 1UEAB 1BR9A 3MA2B 2B39A
chains in the Genus database with same CATH superfamily
1QHPA 3BAJA 1RMFL 2FBOJ 4X65Q 1RK1A 3LKPB 3I6KA 2GVAA 2ATKB 2XWDA 3K6DA 3THMH 3D4ZA 4KKBC 5IBUB 1PD6A 4WUUB 1HZLA 1AGDB 5CP3A 1EQVA 4HCIA 4WI5A 4EI5C 4LLVA 3V4PB 3QA3A 1RHPA 5IQ9B 1FVEA 2HJKB 1JZ3A 4B9WA 1S2EA 2JA5H 1OD9A 2R83A 1H15A 4MA3A 3ALPA 1J8HB 4DV4L 4G1EB 5IFHH 1ASZA 5DWUH 3WHE1 2CJUH 3QEGH 2CFMA 4R3SB 3KEDA 2MHAA 4UTBA 4BSJA 3EDDA 1UE5A 1Q94B 1GGBL 2QVIA 1S7XB 1I1CA 1C16B 4NPKA 3KPRD 4U7MA 4UT9L 4A3JH 4NKMA 2NR6C 5DHXB 1YYLL 3OQRA 4ONHB 3L45A 4OLVH 3ZHKA 3BZCA 3PWLA 3S16H 3GS0A 4PP1D 2PCPB 1QZGA 4IMKC 2XZCL 4B08A 3DETD 5C08A 1DBMH 2P24A 5GGRB 4QF1A 4FDWA 4N2NA 1IYVA 4FLHA 4R4NC 1LTBD 3F7PC 4P2QB 3MFYA 1U95B 3OWFA 4BY7G 1WAEA 3RUGB 5ALBH 1D3CA 3HNTL 4OGYH 2YJQA 2ZUWA 4JPKL 5BW7C 3BPNB 3FHEA 5DJZB 2IBBA 1J1OL 1MW2A 1Z66A 1G7MB 3DMMA 2AQ2B 3FB7A 4TLUA 4E2OA 3CP0A 3FUKA 3LQMA 4FLRA 3MRPA 4QNPE 2ZWNA 3SK4A 1PY9A 2G4EA 3GSRB 2DQIH 2RGSA 3P2TA 1I4GA 3E2HB 3V6OC 3S2HB 2Z8VC 1OAYH 1FJGQ 3QS2A 4WKZB 5EFIA 4KTYA 1QVOB 2J88L 4BUGA 4LCWD 1OZTG 3VXSA 1I82A 1MFBH 4JY4B 2Y7MA 1HZHH 3QORC 2YWYA 2EYSA 3S3BB 2A5HA 4HFUL 5ICZB 1A6AA 2FJGA 1AGBB 2UXCQ 3C8DA 3VWKA 1A21A 5EF1A 1G7PB 4CUCA 4NQDB 3N43F 4B3MQ 2JA6H 3J7AV 1S5DD 1JVKA 3GZPA 2PW1B 2VM3A 4G7ZC 1U8CA 1JOOA 3A8IE 1SMDA 5I75C 4L9LC 4P2AA 1NOLA 4X6BA 5F72S 1E6JH 4M00A 2Z8RA 5SWZB 1CR9H 4P2OB 5F96L 3X1GA 3VCLA 4KHXH 4ZS7L 3T3PF 5CJQH 2NQDA 1GAFL 4RGMA 4IRZA 2XRQD 2R2HA 3BW9A 4MD4A 3QYNA 4MNQD 3EOBA 2WO3B 5AD0B 4B3RQ 3EIFA 5FIEA 1T20A 3HG4A 5E6ID 3L4ZA 4F7EB 3HG5A 1BXVA 1Q9LB 3LIUA 4LMQI 4QO1A 1IFGA 3T3ME 1SUJA 4WQOA 5KYYA 3TREA 3GSVA 2WB1E 2ZUVA 5BQ7A 1UM6H 3LYRA 4A3EH 1V7NL 4AVHA 3TASA 3PXHA 1J0ZA 2ZAGA 4B9ZA 1NMAH 5D7LB 5IMKA 1C5BL 4XPFH 4XWOC 4MDRA 1U8QB 4MNQE 4KHZA 3KVQA 4J27A 4DEWA 1ET8A 1VQAA 2D31B 1NEZA 3T8VA 2V3DA 3WUWA 4ELMF 4J7RA 4QD2E 4Z5RA 4DUYQ 2BERA 3LKQA 1L7TL 3T09A 2KA7A 4FF2A 3VR2A 3VJ6B 1U8HA 5AZ2L 1W72B 4GAAA 2XXGA 4HWZA 3JWDH 1Q9WB 5CMDA 2F0LA 1J1PH 4DR3Q 2A6DA 4ELME 1B6UA 5HHXL 3D8MA 1O5PA 1A14H 4ZPVB 2WVVB 4L1DA 4AM0B 2UWEE 2FBRA 1YEKL 1C7TA 4UHVA 2HD3A 2LT9A 1VQ7A 3MJ9A 5DO8A 5MP6H 3EBAA 1V1PA 3TCXA 4LK1C 1MLCB 3NELA 3NBHA 5KIXA 3B6SA 1FNAA 1PIGA 2XVLA 5CCJA 1OB1A 2ZOOA 4OBSA 2F1AA 4NO3B 4RAUB 4UMSA 5AAPA 3M1BA 5I0XA 3KW8A 5DJAB 4FADA 3K91A 1XF2B 2GTQA 4J6IA 2HKAA 4UOZA 1BQLL 1E40A 1MEXH 1OB1B 4RAUA 4X6AH 1KTCA 3SSGA 3WIIH 1I4FA 4K55A 3N6YA 4PV1C 3OXSA 4HJ7A 3BYTA 3I9GH 3TZVA 4K8RC 3PWUB 1MCEA 4R26L 4A93H 5CSZB 3OTOL 2VXSL 2DJGC 1S78D 2OS7A 2MO1A 2ZX9A 3PGFL 1C16A 2NN6G 4FEMA 1BG9A 5FGSA 5JPNB 4TUUA 4APQB 1HEZA 1R24B 4G8IB 1B7YB 2R29H 3CVIH 4UB0H 1RJLA 1WD0A 3KH3A 5ELEA 4P5KB 4G72B 4ELKA 4FZ8L 3BSZA 1JNLL 3FQNA 4KRPD 3CCQA 4EQPA 4UYQA 5AL0A 3BPLB 1H3UA 3V4PA 5INDB 5KJRH 1DQLH 3GTJH 4HZLB 1JXFA 3MSPA 4JR9L 5ESQB 3I74A 2WLHA 1KRTA 3I6KB 2BDOA 1KIRA 1EGJH 1OT4A 1RP9A 1QBMH 3KVDD 4NQEE 4OF3A 1TXYA 1CMOA 1FF5A 3MREB 4HUXA 5IBLD 1LWHA 3R1GL 1CTOA 2CMRH 1KC5L 2G60L 3Q06A 1ZS8B 4WU5A 1PZBA 2VGLM 2WLIB 5E94B 5I17B 5L7XH 1A8JH 4H1LA 4QOKE 4GG8A 3ASNB 1EEYB 3JTSA 1TJHH 1AZCA 4P9HC 4TNVK 2O5ZH 3FKUS 3ZT6A 5I76A 1FVCB 3QO0A 5EUOF 5T1MB 3ZN6A 5IP7H 5L6YH 1NGPL 3GQBA 1CDJA 1ZTMA 2AJVL 1EEUA 4KUZL 5ISZB 4MB4A 1TTRA 2VR9A 2IAMA 4KD3A 2Q3ZA 2WXQA 2IBGA 2GAZA 3HFMH 3MAQA 5BZWB 5JPMA 5T3ZL 1HA6A 3OGCB 1Z0MA 3NA9H 3NPPA 2BXYA 5LAXB 2OBGA 3FS9A 4XMWA 3MOBL 4DV7L 1T4KB 4N8VB 3AG1B 2GG1A 4ZFOB 1T7YA 2C3HA 2HX8A 5ID1B 5L2KE 3TZVB 4FXKC 5JTWA 1MWAL 3EFXD 2AVGA 4XCNA 2P52A 4Y5VC 2Z6KC 3OMGA 1BM7A 3FTZA 5G2NA 3N5AA 1EWIA 4KDVA 3U30C 3MRQB 3ARVA 5D3DA 2G5BA 3U9UA 4B7IA 2R27A 4TULH 4U6HB 1QCBD 4XP4L 1XZ0B 3W9EA 4V2CB 2PPAA 5KVMC 1UWEH 2OAAA 3VR4A 1MVYA 4MXQD 1X5MA 1T1YB 3QK0A 1S7VA 1IC7H 2X1WL 3JWOC 1YECL 1JPFA 2H6OA 3HE6C 3PRZA 4EXKA 1E8WA 4D0CB 3NTCL 3TP5A 2HP4A 1FL6B 2B8OT 3DROB 1YJWA 4M6OL 4UQDA 3LZLA 2R7ZG 2ENQA 4CMHB 3AU1B 2M9VA 2BFVH 4L8SB 3QDHA 4NKQB 4X83A 3D4WA 3WMQA 1EY5A 1HXYA 1CFQB 3T2NL 1YC8A 5J6HA 5F88B 3AITA 3PHSA 1B4JL 1I7TA 3A56A 1N0XL 1T21A 5D1XD 1TWCB 1LD9B 1MVFA 3H4HA 3O4OB 2B2TA 2EE3A 3RVXD 5K5YA 3HAEB 3OVUB 4C54A 1QBLL 4A3FB 5HYJD 4JFDD 2IADB 2VRAA 3DHUA 3LKNB 4A6YA 3U2SA 4NC1E 1UH2A 3JAMc 5BZZA 2H4OA 3K8KA 2BSRB 5DQ9B 4A7GF 3KPSA 2R2HB 3BW9B 3R0NA 1LEGB 3WKYA 1M71A 1P7HL 2E56A 2PLTA 4N3TA 1UM4H 2VB5A 2GBAA 3H0GG 5I1DA 2C7UA 3FQWA 2EACA 1UATA 4LVOB 1F45A 1TS2A 4AKOA 1I3GL 1I3RB 1JVOA 4OLZL 4JFVA 4IRZL 1Z5LA 3O41B 4BXSV 2ATPA 3CVCA 4MCZA 4UDTA 1LYLA 2VMEA 2EDLA 4OONA 1S7SA 1A1NA 4MNOA 2XWCA 3GRWL 5IB4A 2CIIA 3X1EA 5MEND 1XGPA 3X14B 3WHXA 2H6PB 2IJ0C 2J21A 3RDTA 2A1AA 4C1NI 1ORQB 2CE6A 3MCKA 4GN4B 1JWMD 3FB5B 1U8LB 1IRAY 1KCVH 4AMWA 2VR4A 1II4E 5FXCH 1XT5A 4X99B 3ZE1F 5H37A 6PAZA 1NBZA 3CCJA 3MRIA 3NH7H 2H45A 3JV4A 3K4AA 5B39G 3KWVA 3KGUA 3TTSA 1DFBH 1RULL 1GA2A 5IW3A 5ID0A 2F7OA 3VG0H 1JWMB 4PW3A 1HZKA 2WXGA 3NPZB 3UDGA 4ID6A 5JLZA 2RKSA 3LNFA 4Q97A 2E2JB 2BSBA 4UOQA 3UZQA 3GEWB 4PWEA 1T7VA 1P6AB 2B9AA 2K6ZA 2CPUA 3FT1A 1XL6A 2X1XR 3HB3D 3P3RA 2AQ1B 2R2CA 1VIWA 4K9EL 5M5YB 5E03A 3FULA 4MAZA 1E2ZA 1X9LA 1EVTC 4UCFA 1XMOQ 4S1SL 3NXWA 5C0BE 3REWA 1QSEE 2L04A 1OCWH 3OJ2C 1OCRB 5JXAH 3L0OA 3MGTA 3VW3H 2FIKA 2H1PH 3DJTA 4PPTA 1TQOA 1MLBB 4IIQA 3O45A 4LFAQ 2DWTA 1ZVNA 1F4XH 2KZKA 3HIZA 3M88A 5TH2A 2DTML 5KJ4A 3QG7L 1HH9B 1NCVA 2X69A 2I7SA 5C3LD 4NSKA 2ADIB 3JVGA 3MR9B 5FDYA 3G08B 3NCWA 3VG9C 1L9NA 5K9KA 3KJ4C 1B0RA 1P5VB 4BKLB 4U1JA 3Q6SA 2EZ0D 4PJXB 5CR8A 1MNUH 2AERT 1OSZB 2GSIB 4IKJA 4QJ3B 4Q4EA 1LLAA 5FX3A 5GAGC 2FVNA 5ALBL 3F62A 4HS8L 4EKJA 4YHMH 3NAAH 1NFAA 3DOSA 4DP4X 4M9PA 5CJQL 3HOUG 2EXWD 3ZR5A 1YNTF 2MWCA 3TX4A 3ZTJG 5EPMA 1CFSA 1UEAB 4GIOA 3SVMA 2AEPH 2CXKA 1IM3A 4XR8C 3T0VA 4MMXA 2Y5QA 3GBEA 1BEYH 2XX0A 3RI5K 4FD0A 3VNYA 4TOYL 1FVDA 4L4VD 3DRTB 4K5LA 1TZGH 4HIQA 3NJVA 1BCPF 1EWHA 1CGYA 3FAXA 3RPBA 3EIVA 5J12C 3WJJA 4HQQL 3V5HA 2VNUD 4V1DA 3SODB 4RFBA 5H8DA 5J8OA 1FRGL 3U7WL 3DRQA 3DX9B 4FZEL 1GVPA 1I6HH 4JDEA 3ATDA 4KI5D 3U4BL 2VLJA 2CJUL 5CBEB 3E9TA 1PTOF 3QG1A 1H19A 4R7NB 4KY7A 4CVUA 5GQOA 1KABA 5KTEH 3FUFA 4LBEA 4XT3B 2P42B 3IKKA 5IBTH 3ROOA 5CSBA 1AEXA 2WAHA 3WENA 4ES8A 4QRRB 4WI9A 4WWKB 4HH9B 4IEFB 1WE5A 2W0KA 1KAWA 2Q7NA 2X88A 4M6AA 4MDJB 3BJLA 8FABA 3U1SL 1CGUA 1DGSA 2BNUA 3LH2H 4HCSA 4OTXH 1KYOK 3K5NA 1KJ2A 4F2EA 3QEUA 3HG1E 4IMKA 4KHXL 4ZS7H 3WL9B 1XNRQ 2VAAA 3UGEA 1T5KA 3JWOH 4GP8B 4P49A 3TCTA 1HAUA 4PYHA 4KI5C 5IEKB 3UEQA 4DUVA 3QJYA 1EVUA 3CDZB 1RUML 1LT6D 5CGKA 1VPOH 2N56A 4JO8A 4UT6L 2D7OA 3NWSA 4X8XA 4AT6A 4NBYB 4ZTPH 4WI2A 4ZCKA 2R4RL 1W0YT 4H44C 4IFDH 4HN7A 4IPDA 5IEKA 4WDIB 4GIPD 5J06A 2VM9A 4HWUA 3C46A 1KBBA 1YRKA 5DRWA 3CTTA 1EXUB 3VI4F 3IU4L 1CGSH 3B8YA 2ZTDA 3R06A 2QSVA 3SIKA 5FHAH 5EZIL 5KVFL 4TVPL 4Z7OF 4GW4B 3Q24A 4BHUI 5JW4R 4EI5B 1E27A 2X4OB 4FNFA 1C5DA 3A67H 4M93B 5F2FA 1VERA 4IYKA 4AEFA 4OM0L 5T1IA 2VW9A 2QDWA 2QGDA 4KH9A 5IW1B 3BGFB 4P2CG 4WO4B 1FIGL 1UWVA 3J7ZC 3F6IA 1AS6A 2BZ7A 5GS2D 3IS1X 3ULVE 3STBA 2PZTA 4NJ9L 1OARH 1TYJA 1EJ6A 1NPJA 2WLLB 2VZUA 3KS0J 1S46A 4DGIH 2JWYA 5A40E 3CU1A 2Z92B 5I1LA 3E6HB 3V10A 4YHIA 4DN4L 2VLKA 1UZ8A 2F4IA 3D34A 5F9WC 5EU5B 3ARUA 2ZSVA 4HUMB 3QIBA 1D7DA 1DJZA 3OMAB 4JR9H 2EINB 2F19H 2YJLA 3GFUA 2MUYA 4LP5A 4NZDA 1DUZA 4F9LA 3TSSA 4WDIA 4DV0L 3QWRD 1T3FB 1NJ9A 4LDCA 5C3WA 2ICEA 4K7PX 3S1RH 4ME5A 2O5YL 3GKWL 3U46A 1W8EA 1WGOA 2BWQA 3I3EA 5EG6C 1NCOA 4LVEA 4AI7A 2B7DT 1ZLEA 3OR7A 4LK4A 4XTRD 2NZHA 1AFPA 2Z7ZA 4BWUA 2KEEA 3D06A 4LPWA 1U3NA 5CCHE 1J5OL 1XBRA 5BUAA 2IVFC 3NZ8A 3C60D 4N8VA 2VITA 3CLWA 1PDKB 4Y16D 2MPVA 4GLVB 5AG8A 2CVRA 3M4OH 2E5LL 5KVEL 4AL8H 1NSNL 3E7JA 3QULB 4TNEA 1HTLD 4JOIA 2JIXB 2Q9OA 4M5ZH 5C8JB 2N1KA 3DX6B 4ZK8A 1P4LA 2WIIA 1AGFA 4MJ6B 2UZXA 4X80H 4AGQA 1G6VK 1GL4B 5BMFH 2J8HA 5E95B 2IXQB 3TGXA 3RR5A 3LS4L 3OHXB 5I73C 4AQYQ 1ZT4B 4Y4KA 3KJ4B 3SBQA 4RAVB 4GN3B 2R0ZL 1OAQL 3S7GA 4U3SB 3CC4A 2VLLB 5IFAH 3VI3E 5GS0C 1SXSA 5IM7B 4A93B 2ZWZA 3I50H 1TNMA 2VXVH 3QGVA 4ZPTA 2DAVA 2MQCA 1P5UA 3PDOB 1IAOB 3PLYA 4HX1A 4DN3H 4I3SH 1BFVL 3DRQB 4JG0H 2KH2B 1DQVA 5HDBF 4RMBA 2AI0H 2VABA 3IE4A 5IESL 1TETH 3M85A 1Q46A 1KENL 3CHSA 4LARH 4N2LA 5CS7A 4ODGA 1X6NA 5LBVA 1SFOH 3DK0A 5K33A 5SWZD 4MSWB 1KACB 3ZYJA 4U3HA 5K9KB 2R59A 2A74B 2I9TA 3I4NB 1NGQH 3ARTA 3MNMA 2Q0ZX 4JGJA 2Z8LA 4FQJH 2JV6A 1CVRA 3PG2A 5EO0A 4GNXC 4FYQA 1LEGA 4JKNA 5E99L 2Y7LA 2H2SC 5DQ9A 3SDDD 1AY1H 4O2EA 3RIAF 4XWOD 2BRQA 4QJFA 2CWPA 5F1NA 1RUPL 4NP4L 2AXJA 3L3OA 5FB8A 3BDXA 4GIAA 1OZUA 2I46A 1LACA 3G6DL 4QHNA 4AQ8A 4BS9A 4HJUA 3D85D 1TS5A 5CV4A 4GG6E 1KDBA 1AZBA 2PZWA 3Q43A 1UAPA 4ZSOE 5LNEA 1O7ZA 3QDGD 1AP2A 1ECYA 3UFIA 2F5BH 4S1RL 2EYJA 4RHSA 3B43A 3MROB 4FHKA 1YHBA 5EAYA 1VACB 4RA3A 3J81j 4A67A 1CGSL 1YYCA 1GZQA 2QJDA 4LLUB 3SB3A 4DEPC 4Y7MA 3IMBA 3MRIB 1IARB 4JVWA 1PEZA 3WJMB 4OIIH 1G0XA 3GHPA 4OFDA 3CMEA 4YZFF 4GFXA 2RDFA 2NYYD 4P3DA 4XP9L 3CFBB 1LP9A 5BXFB 1DFBL 4MRCA 1NOFA 3WJLA 2LV4A 3NJMA 1AFVL 2V2WA 2VDNL 1PQZB 4I4WA 3HLKA 4IRSB 3HKZA 3RX8A 3UDFA 3EN2A 2XQYA 4YS4A 1G51A 3AB9A 5A2JH 5JLZB 4YEEA 1H5BB 2ISDA 1JNHB 1UXSA 2B8GA 2ZJPA 3DK2A 4Q8BA 4QRRD 2X4TB 5EMYA 4UNVA 5H2BA 4DUYL 4OF0A 1H3VA 1N5YH 2MRYA 3TBWB 3CD4A 3EBIA 2MOVA 4TULL 3V0WL 1U3HD 2F9BT 2ZCKL 3S17H 2KS0A 2F4VQ 5BUGA 2EYHA 1CWVA 1ETZB 1UXWA 1Y1UA 2LU7A 1S9XA 4U49A 1KDIA 4XNZB 3TBCA 4BA0A 4PJ9A 1MAKA 3U9OA 1OAZH 4FNTA 2GAZB 1O7IA 4M1CD 2R9HC 5KYXA 1IAIH 1DL7L 4OZHF 4YBQC 3N44F 1JGDA 4ABVA 4FQLH 4JVPA 2CKBB 1K3BC 4EI0A 5T33H 3RZDB 1G7IA 4N0FB 1G7QB 1UA3A 2D9QB 3HS9A 1RIVH 1JPGA 1JWSA 3OF6A 4BSVA 1LO3H 2ICEC 4YDLB 1OTUD 1T1XA 3IDNA 4M8VA 3CVDA 4MLIA 3MLWH 4LZKA 4YHZL 4XCYB 4OFKA 4BSWA 4RMFA 1GSKA 2ESVA 1XB8A 4QRPB 4S11A 4L4TA 2Z1CA 3U30B 3DC0A 4K3JH 4HSQA 1Z6HA 3KWXA 5CIPB 4C56A 4HIXH 2UWEB 3KPLA 3V0VB 4UAOB 1E7UA 3QCUL 2FWOA 3GEFA 5C7XH 1U3YA 2K5HA 1Y07A 3VRJB 3VXMD 4YSAA 4FP5D 3RNKB 4XVUC 2X6LA 5GS2H 2VTFA 5KVEH 2GQHA 1XAKA 3CN4A 2PMZE 2OQKA 4DGYH 3CRLC 5IHLB 1I9JL 2B2XH 5CD5D 2A1WL 4XN8A 4J4PA 5FECA 2XHNA 1KC8C 3BO8B 4JW3A 4W4OC 1CLOH 2AK4E 1O75A 3UTQB 2KZBA 3U4ZA 4JGMA 2GKIA 3BZFA 4WEBH 3PV6B 1EY8A 4EOWH 1BIIA 4NAQA 1UENA 5D4IA 4XTRC 3V8CA 2PCFB 5TE6L 4GMSH 4M8QA 4B5EA 4A3MG 2F0OA 2XI9A 4O02H 1M42A 1MNUL 1N8RC 4JKWA 4PJEF 5IG7A 3MNWB 4FRWA 4HCGA 1NBQA 3IRPX 4HEPG 2R8SL 1IKMA 1XXFC 4B9GA 3TBTB 4A3DH 1L5GA 4KQ3L 4TNWK 3I72A 1SEBA 3G08A 4OCNC 4YHPA 1I8KA 2GVBA 2JJSC 1EYCA 1HFUA 3MUY1 4Y4HD 5DS8A 1IQDB 3H6MA 3LSOB 4ODBD 1GZPB 2AXFB 1KJ3L 1PV4A 3RZCA 4FKEA 4X2UA 2Y6TE 1D9KB 3RG1C 4HUVA 5IB5A 2HZHA 3CN3A 2AQQA 5ISZD 3DVFA 1VF5C 1CICC 2H2PC 3IF1B 2F53D 4FFVD 4L63B 2BH2A 5FWQA 1R9FA 4AUJA 4M3HA 3T2NH 4L3FA 4HLEA 3FAWA 2NUTB 3WAKA 1B4JH 1TZIA 3BWSA 3CN0A 3W1GA 3QC6X 3BX7C 1HJPA 1JHKL 4BY1B 2Z6KA 1QNZL 3CVHA 5AEAA 5E2VH 1NCIA 4DKEH 2BIPA 3PYCA 1PD0A 1N2RA 2NMSA 1HNWQ 1INEL 3DDGA 2OL3B 1EEQA 1X4ZA 1WWBX 3BWUC 4P5TB 4S1DC 1TS4A 4LVNC 5FWRA 4RWSC 3IRBA 3EYUH 3LS5L 1K73C 2PW7A 3UTQA 5DUPH 5DVKA 2HLAB 1NAML 2SDFA 1FZKB 3CUPB 2D31A 3VD1A 1P69B 4G7QB 4WU5B 4FFVC 1KXQA 1NEPA 1NCDH 2MQGA 4H5SA 1GUOA 4PS4H 4L5RC 4X99A 4PRID 4F5CE 2WP8J 3CZGA 1KTDA 1XCQB 4BGLA 4WUKL 5GGSA 1PH5A 5ESQA 4KI5F 4PRIA 2CLRA 2YAQA 5GQBA 2P47B 4XIGS 5GISL 3WAJA 1SROA 4X8GA 1KLUD 2AJZA 3QYMA 5DMKA 1PEWA 4NPYB 1URZA 4XP1H 1F97A 1XSOA 4ELKB 2XWBB 4IRZH 5DC2A 3ZYYX 2UXBQ 3AQXA 4Z7QF 1GJXA 3RAJL 1JCKA 1ECZA 4IDJL 1HE7A 2IAMD 3ULUF 3G5XB 1QNIA 4OI9A 1GSMA 1INDL 2FXQA 5DM63 1LO0H 1W80A 3B9KD 2X4TA 1U8CB 4AEHL 1HCVA 3TA4D 3F7QA 3RZWA 2QGEA 1CXLA 1WO2A 4R84A 1KB9K 3BIKA 3K7AB 4LLQB 2FSEB 2NT1A 3QIAA 3T13A 1MG3C 1I1AC 1ZANL 2WWNA 4A7SA 3S35L 3L5WA 2W0LA 5CCGE 5FOJA 3JAML 2JK8A 1PG7H 4QXVA 3IDIB 4PYGA 1U8HB 3RVWD 5A1AA 1BZ7A 4K9EH 5D7JD 4AGLA 3FB6B 4Y89A 3HPJA 1AZVA 3X1NA 1KXQE 2CHWA 2DJUA 3S88H 3SZKC 4QCIB 3FMGL 3NMEA 4K8JA 4GLRI 3NCBB 4FOMA 3OV6A 3D69B 5IOKA 4P72A 2QQLL 1FR3A 4HOXA 2X28A 4YMPA 4Y2DA 5JW4Q 2R1WA 2R0WL 1I8IB 3OKLA 1U8QA 3V0GA 4QCIA 5CFHA 4UV7H 1STHA 2PR9A 2R4SL 1GO3E 2WJ5A 3LD8C 2R7DA 1OQXA 2K9UA 4O9HL 5GS0L 2UY7B 4ACPA 4DGZA 1JIBA 1MJJB 1YNTB 1S5IH 1JB7A 5JHDB 1QMUA 1YO4A 3ZYOA 5E1IA 1UC6A 4KMUC 1DN0A 4OIFA 1Z9PA 4NO2A 2JEBI 2VDQB 2XFXB 3MRCA 5IVXF 3X12B 1CB4A 3EDKA 4AIMA 2KDGA 3S17B 4LHJB 4C56D 2PF6A 2OI9C 3VXRE 4LVHB 3PABA 4BZ1H 2KBNA 5BRZB 3SOTA 2A74A 1JNNH 4R2GD 3K57A 5GGUB 3ZRFC 1CD1B 5DRXA 2PW1A 1SY6H 3RIKA 1OCWL 3VGGA 4Y2DD 3QQNA 2BOBA 1GHKA 5IB3A 5I1HH 4KO6A 4Q4IA 2AJZB 3BJ91 4XVTH 4CKEA 3IPEA 1I8LC 3CK0H 5DVMA 3S2AA 1XYIA 1F2YA 1I9RH 5FYJE 3VA2C 1NPNA 3VXUE 3VFSA 4NRZA 4CMHC 4ZW3A 4LF5L 3FFCD 1VLXA 2NNXA 4JG1H 3IXAA 4P4RA 1PH1A 2X70B 3MV8E 1MZZA 2JJSA 5FYLH 4JZOA 5D71H 3MBXL 4MB5A 3HOZH 1EGJA 3D0VA 4R4FH 1YJDC 5GSRB 4U6TA 4BKSC 4N6RA 4L8CB 2EVHA 5I26A 1QLFA 4XQQA 3CZFB 3KJOA 3J81E 4M8RA 3M8OL 3B9KA 2FX7H 4PJFB 3X2QB 3SKNA 1X7TA 1BBDL 2WV3A 3QPQC 1Z9SB 4U1LA 3FQNB 3IK2A 4GW5B 1TJIL 5DLMH 4X7CC 3PAUA 5B1AB 1CXFA 3QUZD 4Y5VB 4EUPA 4F57L 2WLYA 1R5VA 2OP4L 3BEVA 3L2NA 1BDYA 4DGUA 1TKWB 3RFZA 4BK4A 1SM3L 1Y0LA 4H7BA 3PO3H 3G5YB 1A6PA 1UACL 3BQUA 4ZO7A 5C08B 3TYFA 4X6FA 3K4DA 5HDBB 1G7HA 3DSNB 3HI6H 4PTTA 1RP8A 5I19H 3JXAA 1KLUA 1EYAA 3NIDE 2QTVA 4O2FA 4PCKA 4YHLL 3BVGA 3MRFA 3VMPA 4DPGA 5DDHA 4UILL 1G9EA 1VS0A 2Y5TB 2SOBA 1QATA 5BQDA 5HGGS 1ZYRD 5HDWA 2IC2A 1F1GA 5E2WL 1L9SA 3DURA 3PXJA 2PWGA 4Z23A 2VLME 5TDNB 1IGFH 2ADJA 2CHNA 3LWEA 5IT9E 3QUXC 2ICEB 1UGKA 1G7LA 1L0YA 2I0QA 4EXPX 2BHYA 1HHGB 2A77L 1O7VA 3CFMA 1EOTA 3OOCA 3E8VA 4Z3FA 4PY8J 1WTVA 1EZVY 1HHIB 5D2NB 5EN2B 3FH8A 1UEYA 4QGTA 5D8JH 5IODA 2OSYA 3HHSA 3A8JE 2R0ZH 4NKMB 3HI1A 1MCWW 1CFTA 4GT0A 5E4AA 3PIQB 2YTXA 3LWUA 2X0WA 3QRLA 4L3AA 2GUOB 5NUCA 5HI5D 1A2UA 2FJ2A 1A8VA 4RIRA 2APXA 5I24A 5JOEA 5FV1L 4GBXB 4C2MB 1CXEA 4OCRL 1U8MB 4TN9A 4ODUA 2HG5A 5IYCG 4W6WB 1AAJA 3PWPE 3IJ8A 2B2YA 1DVSA 1SYDA 1R3LA 2ZXDA 4X5QA 4Y4HA 3VFMA 5CEXB 4KVPA 3ZX1A 2HKFH 4DN4M 3AREB 4GRLB 4I3RH 1VKXB 3KNBB 5FYLE 3MXVL 1IJNA 3WNNA 3FVQA 4MAYD 3OLGA 4NUQA 5CIPA 1OB0A 3LEYL 5F6IB 1U42A 4LUZA 4B3VA 3OD3A 4M43L 4AC4A 3VH8B 1EBAA 1JF1A 4GNXA 4LQFL 2OFQA 1MAJA 5D9SB 1R0AL 4G9FA 2IXQA 4QL5A 4GKNB 4YSPA 3U0PA 5LMUQ 1P4IH 5BQ7B 2WWMD 1A02N 1NLDL 2RSOA 4R0LA 5DZOA 2BP3A 2E9IA 1Q38A 3MUZ1 3WIHA 2Y4SA 3CMAA 1YUHA 2BO0A 2OXGA 3IJEA 3MNVB 4ZZKA 5MENE 4XB8A 1SJXA 4FQLL 3AS0A 1JF6A 3C12A 2Q76A 1JVLA 3MLPA 1DVYA 4Y16C 3C1EA 1MCLA 3PGDA 4DEUA 4HC1L 2LMCB 4YHOL 3JTTA 3O6KL 4UOW1 4WFN3 1FNGB 1X9RA 2O5XL 2DDQL 5IVXA 1DBJH 2E7MA 5HI3D 4LFBL 2VAAB 1PCXA 2J2ZB 2XV6B 5LG1A 1TWCH 1QZNA 3HE7A 1TZHB 2EY6A 2BVQB 3NK9A 3K7AH 4PGJA 5IGXH 1H5BA 4Z7UA 3KFUA 4QHKJ 2ZWYA 4EN3B 4TUKL 4AT6B 1QR1A 1A6WH 4U673 3K1DA 4WSJA 1UD8A 3GLAA 3PJSA 3H3PL 3J27A 1EFWA 4ETYA 1KV3A 1WTGT 2A74C 3TP6A 2E0PA 3BAEL 2EYRB 2YGOA 5F9DC 4AITA 5D14A 4IFDI 1HOCA 4YXHL 1E7ZA 1J18A 1ZV9A 3VD4A 1ZGLB 4FG4A 2TSSA 1PH8A 5FAAA 3QWRA 3UROR 4HPOL 5HHNB 5LGHH 3M9BA 2HMIC 1B4LA 4JOIC 4A3IH 3AMUA 3FQUB 4N68A 1Q8MA 3S3DB 3BAWA 1SN5A 1QWUA 3L95A 2ZG3A 5AW4B 1BZ9A 1WYJA 4U1KB 5B1JA 3LDBC 1V54B 1MUJB 2FEJA 4Q6IB 3A4DA 3RWGA 3MRJB 4OFIA 1WGVA 4IKNA 4MAYB 2I9LB 2VLKD 1OAZL 1Q1JH 3WD5H 5IEHB 2P5EA 4JI7L 1JNJA 1J9RA 3O3DA 4N5UA 1FFPB 1HZCA 3HN3A 5D93B 1H6TA 1HNZL 2Y36L 3T3PE 3KOJA 1QNKA 1MCHA 2NY7H 4L9LB 4AH2B 3NSWA 3WFHB 5B1CA 3W9EB 5IFAL 43C9B 1OALA 1AH1A 3G48A 3MLWL 3GJFH 1ZY9A 4I2XB 3E5SA 3E6FB 2WMPA 3K2KA 3UJJH 2DQHH 4FQQB 3VR5A 1NGXB 2WXRA 3H2QA 3H9SB 4O51B 1P7QA 2R39A 4POZC 1NLBL 3ZHFA 1MHPH 5KSAC 4XQJA 1T0NA 3GGWB 3MKKA 4QWWD 43C9A 4DFIA 5ICYA 3IDGA 1E4HA 1W8NA 3EOYG 4C3JG 4MJ5A 4D94A 5L4MA 3F84A 3TV8A 3BVTA 1NPUA 1MHCA 3LHPL 2PW5A 1B0RB 1P5VA 3DI2B 3QDGA 1UJTA 3MFGB 2WXKA 5IIFA 1A7PL 1X9QA 1G6ZA 6TAAA 1N6QL 2FIRT 5I1KL 3LMJH 3OKKB 5HTSA 2ATKA 3SGEI 5C92A 4OELB 1BVKB 2VB3X 1ZLWH 4NUJA 4LGPB 4A3DB 5B38B 3MVVA 2E6QA 4GI8A 4AYEC 1HAWA 3UG4A 1G7HB 3TM6A 1BW8A 4JQXC 3HG3A 5JOBA 3RU8L 3T2OA 4KTAA 4PLJC 1GHJA 2F0DA 3KYAA 3D07A 4OZIB 4HJ9A 4IRSD 2YA1A 3Q0AA 2UZXB 3IFNL 4Z7QE 3X11A 4IDLA 2XZAL 3LKOB 5DHVB 1MAML 2J1XA 3CFDA 1QA9A 4RH4A 4ODWA 4X0KA 4W6XB 1T04B 2ZYHA 1GAFH 3T0WA 4BDVB 1WWAX 2P8MA 4QHLA 1JZ6A 3IGKA 2ATPB 3V0IA 3STBC 3M3YB 3DI3B 1ZHNB 2UXVA 1WZKA 2XBZA 5BRPA 1OF2B 5GXBB 4HCRH 2HKFL 5CM1A 5ICYB 3WN5A 2B1OA 2ZIDA 1HHJB 1UURA 3JAMi 1H9VA 4JFHE 1YBYA 4X6EB 4ABNA 2X6CA 1J1XL 4BZ1A 5EU3A 1DCLA 2IL8A 5DLQE 2CKBL 1S9YB 3E6FA 4MJHA 3FPXA 1CDYA 4TM9A 2XQ0A 4Y0GA 5F6HJ 3VFNB 1WBYB 1OXXK 1KCSH 2HVJA 2ILLA 1FC1A 2YRPA 4JV5Q 1P7QD 2ZYIA 2K78A 4LUVA 3OLIA 2JMRA 2F0IA 4M7LH 4MJ5B 5I2IA 1K9TA 1DUZB 5DRXB 5DWPA 2O4XA 1ACCA 2NYZA 3PO2G 1YEIH 4WY7L 1PLGL 3LKSB 1DLFH 3V0HA 1LTRD 3VMNA 2I69A 4JRXB 1IBGL 3JV5A 3G7LA 2VOTA 1BCPB 3IFLH 1SR3A 1JF1B 4NNPH 1CT1D 1X5AA 4NDMA 5E00A 2P5ED 4B9IA 3FP9A 3L2MA 1WT5C 4IBSA 4C2MH 4JY5L 4RHRA 2JF1A 4PJEB 1HNXQ 3AREA 3L9BA 4GRLA 4Z7WE 5AVUB 3TYGL 4DA2A 4KUCD 4QB4A 4WI6A 1ICFB 2CNZA 4BA2I 1HSBA 3EO0B 3MYJB 3OWRA 3KLSX 3NCCB 3US1A 1UQSA 4ENEC 1L9PA 1A7OH 1WHOA 1AZQA 2YV5A 3R93A 1FYTB 3CF5A 2TRHA 4HJ0C 4MQSB 2VQUA 4NKIH 3NIDF 3VDBA 3Q05A 3BDBA 1IKLA 4WWKC 5D1ZC 4XHJD 3D31A 3DBXB 1KDJA 4TSBH 1MIUA 5A3IC 1NCUA 1T6WA 5F3FA 3RWJA 1K8OA 1TTAA 1MFVA 3OKOB 3PWVB 1M2VA 5KG9A 1T6VN 3O6LL 1RZPA 2YN3A 4ZFOL 5I6NA 3ECWA 1LTTD 3ZMRA 4URTB 1NUNB 4ZMZA 4H8WC 2RA1A 4NWTL 5A7EA 3DVGA 1WVZA 5JHLA 1K85A 4YXKL 4NB7A 4X0NA 4EQ3A 5T1LB 1JFQH 1QUPA 5LXGL 5DA0B 5J6SA 1ZKAA 5DMGD 2R61A 4QAMB 4FI7A 1B4RA 4N0CD 4NZTL 4D8PB 2J8UF 2SEBB 3HI6L 5CSZA 1I7RA 2XQYG 4ZG1A 2G2RA 1Q3LA 2XRAL 1EHXA 1CF1A 2FYVA 3VXPA 4JDVB 1Z3GL 4UM9B 1XXGA 4ZTOL 3BN9D 5JHDE 3X3GL 2GI0A 1UWGL 3KAAA 5DQDH 1OO9B 5I9QC 4JHVA 3F2DA 4Y19A 5HD8D 5LMNW 2AK1L 2VXQL 4L37A 4ZQ3A 1AANA 4DERA 3HG1D 4P2OA 5I76B 4AC2A 1DQJB 1MCOH 1KL9A 4O0AA 4I48B 4KK6C 4UQ3A 1TOXA 3U36B 5KBNC 2PWEA 4IIZA 3BUPA 4Y2OA 2KHAA 3PGDB 5E94A 3S3PA 4YCWA 4MD5B 4X64Q 3H3VH 4MJJA 4ATTA 3JAME 3CCUA 4LNRB 1AR1C 4K3EH 3VNZA 1BA9A 3T5WA 3FO1A 3TJEL 3PUYA 1HNGA 2CDEA 3UBFA 3GMPB 4DUXA 1NAMA 1IE5A 1AOHA 5IGCA 1ZHBA 2JKIS 4N1HB 1WTRA 5CD3A 1K8IB 4J6RH 4HS3A 3UYPA 5KSBF 4JBWA 5CNHA 3ZUNC 2ICWJ 3II1A 4HQQH 5HYJA 4OLUL 2NCEA 4XPTL 4G1MA 5AW3B 1E4WH 3H3VI 3KNBA 1PZ2A 3N0PB 1YJ9A 3QIUB 3V0AC 3ULVF 4WV1A 4DKEL 3HOWB 4G7SB 1Q72L 1SUHA 2CUAA 1CKNA 4A3FG 4JV5L 4GUPA 3ULUL 1JPFB 2VMFA 5J11B 5M5WH 1D5IL 2XKNB 1MW3A 5LGJB 2J6EA 2UWEF 3T6ZA 3GZOA 4HKZB 1KB9J 2RAMA 1U0LA 1BP3B 4KKQA 1O80A 4JANB 4RFNB 4Y19E 1J6QA 3RD4A 5IGEA 1G91A 2L7QA 5DJ0A 3S98A 4B96A 4NQCE 4M7JL 2AQPA 3QQ4B 2EXYD 1QVCA 4LGSB 5EBWA 4FQCH 5GJSL 3DV4A 4EQOA 3L16A 3J7HA 5K69A 3UTPE 3VXMB 5KSBA 1HYSC 1HQ4B 1Z47A 2DOCA 2BSDA 2FIKB 4C3HB 2C4XA 2X7LB 3ECBB 3MU3A 4JM2C 4HC1H 4Q2ZA 3OW7A 1LNUB 1XF5B 5CILH 3M4YA 1E28B 3T1WA 1G6RA 3QDME 1J5HA 4L4VA 1SN0A 4WK4B 4X5XB 2IAMB 4XC3L 2APFA 4P2RB 1AIFB 4XX1E 3ULVL 3L5JA 4PTUA 4KXCA 3HC0B 4KZ0A 3BLPX 1WDAA 3O4LE 5BN4A 1I1AA 4OZ4A 4DUZL 3PDGA 3L3DA 4P57A 4Y1AA 3QUZA 3RUGE 4H8UA 3L1GA 3FTUA 4G3YH 4KRPB 1H3PL 1TO4A 3QNYB 4HBCL 2W0PA 2WGXA 1I6HB 3ML9A 2PPEA 5DVLA 2ESVB 5DZJA 3CSYB 5CZVH 5D55A 3B2UC 2DTSA 4DESA 4G59C 3ARDC 1YN7B 3QZLA 4CN4A 2GK0B 4TNGA 2G2PA 3AWEA 4C56C 2D3LA 4KNUA 4LOUC 4ODHL 4XMLH 1J5CA 4IJHA 3FFCA 3K46A 3TL5A 1VESA 3SDDB 1DQQA 4KUCF 5HHOA 1JGDB 3IMWA 4KY1H 2NY6C 3FPPA 2EY1A 3Q3GA 2AK4A 1QBBA 5I15L 4OFPA 2O6EA 1UEBA 3NSFA 4R2GB 5C0CA 1VEOA 2R4SH 4B3SQ 25C8L 2XIIA 5BRZA 4ABWA 2DQGH 1T1XB 3VWJB 2YMXL 5K9QG 4KX7A 1DONA 3EYQC 1FLRH 3QUXB 4HF5L 4YE4H 1KEGL 3WEMA 5HDBE 2AJYL 5F9OH 2QHLA 4M62H 4W4NA 1UXMA 1JK9A 4WO0A 5HDOA 2YHGA 1J9QA 3L3GA 4LOUD 1DR9A 3ZE1E 3PQYE 5IB3B 1A9BB 1X4YA 3QNFA 3O9WB 3PUUA 4ANXA 3AVEA 2JKXA 2XWBA 2LXJA 3VG0L 4NHUB 1EIBA 1YEHL 5D5ME 3EOBB 1Q9KA 3SE4C 1I7RB 3UBXB 4GRWH 1Y1WH 1G1CA 2EYSB 4L6TB 3Q9QA 4IQZA 4WNQB 4JKMA 43CAA 3S36H 5HJBA 1PZCA 1YEDA 3QDJB 3MX0A 3MMEA 2MNAA 4GAJH 1O78A 3EYQD 2Y72A 2W94A 3GK8L 4C4KT 1CBVL 3TT3L 5BZXA 1FGVH 4LF9Q 3ZYZA 1ZXKA 2PWDA 1MDAA 1U58A 4NENB 4PJCF 5KG9B 2VQTA 3J80c 3NSCA 4IJ3B 1AGBA 3M7OA 4OJFH 3V6FB 1Z1WA 1PLAA 5EU6D 3P3SA 4MKMA 3NRQA 2MKWA 3HOGA 3DSFH 1UE6A 4G9FE 3EROA 3C2SA 1Q82C 1YVLA 2VDKB 5BV7L 1BZ7B 2LLGA 1ZLVH 2BP0B 4PY7B 2QKIB 5DI8B 2GC7C 4B3SL 2YGNA 5FEBA 4CKQA 2YRLA 2GIXA 1SMXA 4A3KG 3MV8B 5FLUA 4LFBQ 4N9PA 3QRBA 2V5MA 2EXZA 2Z3FA 3P0VL 5F1NB 3APCA 2FEEI 4A7UA 5E6IB 3MRQA 3CHQA 4HJTA 3I9IA 2P7TB 3GXMA 4KROD 2CUMA 2IHEA 3BPLC 3CHOA 2VQ1A 3MRKB 4RGND 2CMRL 1OD7A 4JFDA 2R69H 2RCNA 4WHYG 4GW1A 4Z77A 3S2DH 1WA0X 3P4MB 2NTFA 5AVYB 5K9OA 3KGSA 4Q6KA 2G9HB 2PW2A 3P9LA 2IALB 4JPWL 2DKMA 5IT9L 4F7MA 4FA8A 2ODIA 4RDQF 5DUMH 4ZMOA 4BXXG 5HDRA 4GMTH 4BIKA 1MJ8L 2FGZA 2KUTA 4DVBA 1TJGH 3KDFB 5LGJA 4XXCC 3QJVB 4J15A 1CYWA 4OCRH 3GHEL 5I19L 3DLQR 1UWXK 3N1PC 1EHLL 4ZOEA 2IBZX 5F6HI 3ETBF 4HMCA 3RGVC 2VDPH 3WEBA 1KCRH 1OM3L 2WWOA 2NY2B 4PI2A 3BUTA 1CZ8H 4QYOA 5FC9A 1DVQA 1ILQA 1R9TB 3GTLB 5B7EA 4PFEA 2GEQA 4K7PH 4GH7B 4RAUC 2AV7B 1JNHA 1NMCC 5G4OA 5EEWA 2NY2D 3R1GH 2F74A 4MCYB 2HJKA 3D30A 2V5RA 1BPVA 5CILL 3RE0A 2NNRA 1SVBA 4Z7VB 4RFOH 4ZFFB 4OZIF 1N32L 5CKAA 2WACA 1OGTB 1D5MB 4JKPL 5IYDH 4Q74A 4LNRA 1A4CA 3HUJA 3WS6A 3MTSA 3AY4C 2IW3A 5LCVL 4E41B 4N2HA 5EO9A 8CGTA 3VXSD 2ITCB 4OGXH 1RDPD 1BZOA 1W0VB 3AGWA 2NSMA 1ORSA 1AP0A 5FHBL 2Z0UA 1JPGB 1JWSB 1XHHA 1T2XA 2G2NA 2VLKE 3WDIA 4A38A 3BYTB 2QVKA 4AJ0A 2EZ0C 2ZKMX 1AQHA 2ZUSA 1QSED 4HC1A 1SLXA 3N06B 5CP7A 5E8PB 2WTOA 3GSNB 3RY5A 3V52H 4FQXB 3WKML 3ESUF 1PTOB 4BKTC 5I66B 2RHSB 4KPHL 4ZUWA 4FQ1H 2GCYA 1KWKA 3QJFA 1YEIL 2YBGA 3NABH 3VFRA 2P26A 4DPRA 2NNAB 3G7TA 3T0XA 1PRTD 2JKJA 4X3TA 1IBGH 1S5HA 2Z31D 1EZSA 1TFHA 3HVNA 4TQEH 3UTSA 3RHWF 5E7NA 5C44H 4QTHB 5AOMA 4PGDA 3BZKA 2EC9T 2MPAL 4I2XA 1RZGA 4LSPH 3DTUB 4NZFA 2HH0L 3RKDC 5CEZE 2BLFA 3NIGB 1RZJL 1TWFH 2JCCB 4YE4L 3PQYB 3WCYA 3HOYH 5EUOB 1BLIA 2UZIH 1KEGH 2XKSA 3OKNB 1NJ9B 3WGUB 1WI5A 4Q14A 5JNYA 1RIVL 3CBRA 5JXEA 1SYVB 4ODSL 3G6JB 3J7YW 1IIKA 2APTA 1J7VR 4DP8X 4N5ED 5BNXD 2R1XB 1SYBA 2LOEA 3PHQB 1A4JB 2UYLB 5GGVY 4B5ZA 3T2QA 3LOWA 2Y0SG 1NCCL 1OAXL 4PRNA 1TLMA 4L3EB 3TV3L 1PKQE 1JAEA 2H4EA 5F97E 4ZUVA 5AG9A 3WTWA 4F7CA 1S4ZA 3GTQH 3OWEA 2BIMA 1WF5A 2OSWA 2APVA 1M7IB 4CJ1B 4L5QA 1XWVA 3CFEB 5C0XJ 4H2AA 3OKMB 4Y4FC 5D7LE 1CURA 2QR0B 3EH5B 5AW6B 1D1IA 3DXAD 1UD6A 3G4SA 1UKSA 1EOVA 3F7YB 1D6EB 3O4LB 4LSSL 2JIXD 3UJJL 1SXAA 5BVPL 2YPLB 4ETQB 4XN4A 4DZ8A 1MQKL 3S8GB 4N5EC 4IBTA 2IWHA 3BUYA 3B7TA 4ORGA 4G82A 1NA8A 3S4SB 2ESVD 3LZQA 1J11A 3POHA 5EA0H 3SPIA 3DOIA 3AADB 1Q9LA 4HPOH 3EHBD 5TQ2H 4PB9L 5AJ3L 5ISRA 4XH2A 1E4WL 5SWSD 3EYOA 2ENJA 4O2EB 2NLJB 2BVPA 1GW0A 3NDYE 1I3GH 3WFZA 3ZUCA 2BNRB 3NYKA 4YL9A 2P43B 1Z32X 2CDFB 4K23L 4EI5A 1NGYB 2W95A 1NAKH 1A7PH 3FCSA 3VXOA 4B9JA 2LTQC 1LO3L 4BXXH 3RY6A 3OPOA 5M3FG 1ZJBA 3L9EA 3NQKA 3TCLA 2EDOA 5H2BB 1EERB 4JMNA 2KT6A 2EC8A 2VDMB 3FBQA 4PJ9D 2LAGB 4KKPA 4XNMB 3GBNL 3T77B 2E2HB 3GXUB 5E5MA 5IR1A 3QS3A 4XVJH 1YEJL 2L3BA 1TCMA 2B4CL 2ZD0A 5DC0A 2DNEA 4TVSa 4PNYA 1UOLA 2FLBT 2IPKD 4QRRA 1IAKB 2Q8AL 1YEZA 2YAOA 4G83A 2JE8A 4HX1B 5GAHC 2ADGB 2I5YH 2YUZA 5I1CL 2H1LM 4FS0A 4PHXA 3ZT7A 4DKDC 3VFOB 3C9NA 4ZMWA 1T66D 1TCRB 3FJTA 1E9PB 3GDBA 1P7BA 4WJ4A 5AALA 5E4EB 1FL0A 4G8FA 3QQDA 5J3BA 2FATH 2E46A 2K5DA 5EBDA 1RJTA 1Z9OA 1NGPH 3QI9B 4WVRA 3CDYA 3BZ4A 2G3NA 4TPRH 1Q72H 3L3DB 4P57B 5FUCC 5EJWA 5ELDA 1M7IA 3K6FA 15C8H 1S3KH 1X55A 5C0JB 1YQVH 3H0TB 4RGNC 4R5XA 5CHNB 3ZDXE 3DX6A 4RSVA 4KVCH 5I1KH 1AZPA 4O00A 3CCRA 1KB5A 5D1QE 1FYTA 4DV4Q 3HZKB 1QVGA 3JC66 1DLHB 1VZGA 2CCWA 4JBSA 2C1PB 3QQ9C 4JFYB 4ODUB 5M5YH 5D96C 3T6WA 3X3GH 4KITB 2QLYA 1J9TA 3UEZA 4AYBA 3RY4A 3KUPA 4ZZFA 1ODAA 5E2TH 1YDPB 4B60A 3N6RA 1OAQH 3KPSE 1ZLSH 4WUKH 3MROA 3S2CA 3ND8A 2ZP9A 4IU3A 3HKZE 2OMVA 3RL1A 3G6DH 4PJ8C 3I50L 4XMPH 1PAMA 3LH2L 5AW9B 3DUZA 4G7HC 1U0QA 5A35A 1B2YA 1WPCA 3I85A 4K15A 4HOMA 2R0LL 4XNZC 3ZDYE 4I9WD 4GO8A 2JI3A 2BC4B 4PJDB 1ZS2A 5I15H 2UU9Q 1FGNL 2DIJA 1NBWA 2Y06L 1Y6MR 4XMXA 1F0LA 3UXFA 4IUQA 2H7WA 1NGZB 2ENYA 3VUAA 2P8PB 3D12B 4JI0Q 3OL2A 4DPBX 4BKLA 1GD7A 5FK9B 1IAIM 3UTSE 4DAMA 1FVEB 3WO4B 5IJKC 3I4LA 3O3DB 3V96A 4I85A 5J0BA 2X3BA 2A6KA 3BFWA 5FLVA 1GYWA 2K1MA 5C0EB 4ZMTA 1I3QB 4HWBH 3D4GA 1UJ3C 1A2TA 4RKLA 3KW7A 4JMXA 2ITCA 1SQMA 1A4BA 1TFPA 4YDNA 3S8FB 1JXDA 3A67L 3X3FH 1QOKA 1FG2B 1XQ4A 3SE6A 2ZCLH 2V7HB 1DLHA 3IDYB 4KN4C 4H20H 1PZJD 1WFNA 3HUJB 4K94H 4H8VA 4LSPL 3ZTEA 2CDEB 1DLFL 3E9UA 4H0IA 3TNMA 3BH8A 2H26B 5HJGA 4U1LB 3VFTA 2K7PA 3WSQL 3MBEC 2H6PA 4LGRB 3U4VA 2DM7A 2FD6H 3ECVA 3WKPA 5D7LD 1IX2A 1NFIA 5DHYB 3GXIA 3SGEH 5I82A 4ZXBB 1QLFB 3HB3B 1E27B 4K5XA 2F74B 2X4OA 1PLBA 3QXDA 4RWHA 5A2AA 3RTLA 5K59F 2KCMA 2R2EA 4WEEA 2WD0A 2XG4A 2A4CA 2VSCA 1RUMH 3EDEA 1E9PA 2D7MA 3EGDB 4KV6A 1OWRM 3G6EA 5EPLA 1A9VA 2WIIB 1JP5A 4M1UB 4JI0L 3BWUF 4CA4A 1RK0B 1RJZB 2YZ8A 1UA6L 2PYFB 3KBFA 3I6LD 4WSKA 3UBXI 3S36X 5J11C 1RMFH 3MBED 3C60A 4ODTH 1FVIA 4NNYA 3INUL 3CU7A 3KHOA 4U1SA 5DJ2A 3KGRA 1X32A 4MMXC 5IIEB 1Q0YH 5E1GA 4RSYA 3RA7H 1HUMA 1L3NA 2C26A 2DLFL 1X5ZA 1ILUA 2E7DA 5BS0E 1LE9A 2X6UA 2X1QA 1VA9A 4CC0A 4JPWH 3P11L 1IKOP 4K4KA 2HRLA 4Q9BA 5ANHA 4DP9X 2DLHA 4YDVB 4NX0A 3DIVA 4QQBX 1HH9A 2BNUB 4QRTA 3BEWB 4ZOBA 4J12A 5CINH 3C6SB 4JFEA 1EXGA 3ZKMC 4U6VH 3L7EB 1EAJA 3SO3C 3D39D 1VQJA 2ZZUT 4MJIE 2J1ZA 4JQIL 4KKLC 4NBXB 4XP6H 3B2DC 2C1OA 1U93B 4L29B 5HBBA 5IROC 2RHEA 3EJYD 2GJPA 3V5KA 1JZGA 2Z7YA 4G8GD 3KLHC 2WBKA 2MQ3A 1IBLQ 3GTQB 1ND0A 1XGZA 4LAJH 3C6LC 3WNPA 5IF0A 4LEOA 3AU0A 3KYKH 3DGDA 1QR1B 1D7BA 3CLEL 3CSBA 5DO2D 4AX3A 1W2BA 5EKIA 1YITA 5I9QB 4LQ1A 3K80C 3QI9A 1U3HC 2FX7L 2JA7B 5EEZA 2G9DA 3PCOB 4N4YB 2WZ5A 2X89A 5DLLA 3RBSA 1O9VA 2ZP0T 4FHBD 5ANMA 2X6BA 3AXLA 1N4XL 5FDWA 5DEZA 5CMAA 2VZ3A 1XPOA 1U6AH 4N0UB 1EFQA 1URLA 4GKKQ 1OF0A 3CCEA 4IPCA 4DH2A 5EOTB 1A8ZA 2Z7UA 4PI0A 3WFBH 4A3IB 2VDKH 2J5WA 1MCJA 1ZSHA 5F0LB 1M1KC 3GBMH 3FCGA 3MRMB 4IRJA 1K0RA 2RALA 3CFTA 1LTAD 4K7PL 4C58B 1TPXB 3QEUB 2F5AH 3QIWD 5D1ZB 1QLEL 1T66C 1Z3RA 3MHZA 1YYLH 2WWKT 3ESPA 4ZUWB 1AGCB 1YEFL 3G5YA 4Z3IA 2B77A 2P45B 2HDLA 4WWKD 5BV7H 1AI1H 3VTMA 1JB3A 2K5NA 4XBGB 3BH9B 1CFNB 3M8OH 1GUSA 2WGNB 5F7EH 7FABH 3HOZB 5GRVL 4LCIH 4MA7L 4G80A 4MWFB 4LCUA 3M4OB 3DEPA 2XBDA 4XNQB 3NT0A 4GXVL 2OSXA 4FTDA 3EVQA 3CXDL 1HR0W 3UZQB 3QXWA 3FSOA 2AXGA 3E3QE 5GRVK 1MI2A 4DNIA 4ZD3L 4CVXA 3JTSB 1GGYA 3ARGB 3PPEA 4OM1H 5IK3A 5IT2L 4V0BA 3S1NB 2VLJD 3NRPA 3BUBA 1IL1A 5IWLA 5EEXA 4G7YH 4JX0A 4YHLH 1FVDB 2VR6A 4A3CH 1OGTA 3PO3B 4MNGE 4FMKA 3ARGD 4KXBA 2Z35A 4PWKA 3VFSB 3VRIA 3ZL1A 4APQA 5AWNH 2K4WA 1Y6KR 3OAYH 2FQFA 3HHSB 2AJYH 4Q0XL 3HZVB 1WJJA 5JMOC 4DTGL 2YK1L 4RFEA 1N18A 5ADOL 3W5MA 3SDCA 5EIIA 2R1YA 2VDOL 4OGAC 3INOA 1NGZA 4PVMA 5JUEL 2E7LC 1Z5LB 3O41A 4TL5A 4J2XA 4G5ZL 5A6MA 4TRDA 3URYA 1DXMA 4P2QE 3CZNA 4N2GA 1LO5B 1J5IA 2FTAA 1N32Q 3DOHA 4LL1A 5DRNA 1AO7E 4NN6B 3VGEA 3NGBB 5BVPH 2UXCL 5J4MA 4J3TA 5CBAA 2HH0H 4Z3TA 3HS8A 2VJ8A 3BVMA 1QO3A 1WIPA 3BKML 5IJCC 2VQ1B 3F83A 5KNBA 3TF7C 1RUQL 1BBWA 2VN3A 4D8OA 4YEFA 1HNWL 4YSOA 1LT3D 2E27L 2Y7QA 5KVFE 4DV3L 5JHDA 3FTSA 4DGIL 3D0LA 3S37H 1NCGA 5DFTA 1BJ1J 2IDSA 1DN2A 1DJIA 3CC2A 2DM3A 3V4PH 2PCFA 1YEJH 1OK0A 4AYSA 2HWZH 3NCYP 4UAIA 3PV6A 1AO7D 5FGBA 4AQEB 4AVJA 5IUSA 4Z5RB 2OTWA 3DKHA 1GVIA 1BQ5A 1EZ6A 1IKFH 1JN6B 4PVNA 3TH3T 4MNGA 4Z76A 1SF3A 3FT0A 4PRDB 3KWUA 3HN5A 1QTSA 1NBZB 3F00A 1YJNA 3B2MA 3CCVA 4HWZB 4KROC 4MQ7B 3C9NB 4TL4A 2WHVA 5DJ6B 3CFJB 4QRPE 4BD4A 3FN9A 4YFLI 3AFPA 4ISVB 4ZDHA 2NY5H 5H4YA 4F8LA 1M4KA 3B8SA 3GTOH 1JNNL 1K2DA 5KSAB 1XD1A 3MV7D 3I4MG 4F7EA 1ONQA 4PJIB 2AITA 4R9WA 2BSED 2GVYA 3GS4A 1V7MH 2DL2A 1P7KB 2NQ3A 1PGRB 3ETBJ 3RDTD 3ZDYF 4JZOB 4OZFA 3F5WA 5MENA 4BY7H 2QQKH 3F12A 3OSVA 2UUCQ 2VQFL 1NC4D 1XCWA 1FNUA 5I9PA 5IYBG 4MDIB 4NQCD 4UQ3B 2Q8BH 2IFFH 3KBGA 3W0WE 4ZYKA 3E8UH 1YPZB 4J4PC 1XF3A 3N1MC 2F52A 4MMYA 4E42A 5IB4B 1STNA 4I1NB 3UP6A 1MPAH 3MRDB 1K0SA 4BUHA 2X2YA 4ZI8A 1XCTA 1U41A 3JWDC 5F0PB 5E8OA 1M6OA 1YY8B 5ADPL 4HPYH 1MIMH 5CU9A 3MXGA 4LL4A 2H0FA 5I1CH 1G43A 4KV5E 1M6UA 1CG9B 5FGBC 2ZCHL 3QR8A 5ICZA 5AVXB 1F86A 5JIDA 2A9ML 4YK4B 4JRYD 3BUYB 4Z18A 1TF4A 5HGBB 3D3VD 4QT5A 1SLUA 1L6ZA 4DCQB 3FMCA 1I94L 1EEYA 3GXDA 1MOEA 3P4MA 1IHZA 1XVSA 3DUUB 1ZV5A 3V4UH 1SE3A 4B0MB 3O8XA 1T21B 3MOBH 1IC0A 4K8RL 2YTYA 3MNDA 2BWIA 1OVZA 4ZMAT 3FUIA 2GIYA 3MLXH 5FO8A 5TQ0H 4QJ5B 1L0QA 3AQZA 4Z76B 4KHTH 1PRTB 5CJXC 4F37K 2QGQA 3EADA 4B3TL 1K2DB 1S7WB 4NWUL 3HAEG 4YDJA 1CTMA 5EC1B 1KCRL 4QUOA 4NPJA 4Z3EA 3A23A 1G7JA 4HJEA 1NR4A 4WEBL 4MQXD 4P0DA 5DJ6A 2ZYSA 4HJGA 4P2RA 2F3WA 4PLKD 5F7EL 1S7WA 1BQHA 4LW1A 2EDTA 4NNXB 4DV0Q 4LEXH 4DWHA 3PIOA 1FL3B 5AYUH 1QD0A 2JSFA 4RWYL 1MHHB 3PWLB 1JJ2A 1F18A 4PJGE 1KC5H 2Y07H 5I16A 4UOJA 1WFUA 3P54A 5J13B 5L7XL 4UV4L 4NERA 3SDZA 1I75A 5EHFA 4O2DA 1HIML 4JRXA 3RLFA 2FB4H 2O5ZL 1P9MC 1KJ3H 4TQPA 1XIWD 4P9HL 1U95A 3P9WB 3BUIA 4LVOC 1U4EA 1TS3A 3T3MB 4DV2Q 1J12A 4KJOA 5GGRA 3FCTA 4H7VA 1ZPUA 3Q1SH 2G5BB 4MJID 3TN2A 5IHHA 2R29L 4UB0L 1RCYA 1YY8A 1M6OB 5F7MC 5FCUL 2ATAA 5CBAE 5DMKB 3Q23A 4XAWH 1JZ2A 3QNXA 4GB9A 1PFSA 3VA7A 1WCBB 3H54A 4CVZA 1OKEA 1I50B 4R96B 12E8H 2HFFA 2QPDB 3K72A 4WI3A 1RK1B 3F12B 1BQLH 1ZS8A 1F8TL 3DARA 4DR1L 5A7BA 3PWPB 4UQ2A 1R5VB 1X3DA 2VUMG 3BEVB 3I9GL 3ERXA 4MNHA 3BC9A 3CDFA 4Y4FD 4A68A 2ADYA 3KJPA 2X9XA 3PP4H 1L1OA 3LEXA 2FJGB 1UCTA 4JI6L 3ZTDC 2N78A 2E27H 3K6SA 3BIAX 4L3CA 5F9JA 5BUPA 2LFEA 4BCYA 2WUCH 5IFJA 4LUOA 3ATEA 3D2TA 3NJFA 2IGTA 2XY2A 1E5ZA 2Z6BA 1ID2A 1WLHA 4FAAB 1C5CH 3Q0HA 4FL4B 1XTCD 4QRPA 3OJDB 4L9DA 4D9RE 5C0DB 3ME0B 1CK0L 3BVWA 2C9RA 3AS1A 4PRHD 1AMXA 2RBLA 4I87A 5AVRB 3H1ZA 4W9KC 2AXGB 2MO0A 4ZX3A 4YAQB 1B4OA 4L37B 3AXIA 4FG0A 3SGDH 3SPCA 4M61A 2Y6SC 2FWSA 2WZAA 2W88A 4AIZA 5C8JA 1OP3H 4N8UA 3W11D 1JPTL 1WAAF 3KGTA 3WS3B 3QQ3A 2JJTC 4CDGC 1IGCH 2DLGA 4WIQA 2OF1A 4J8RA 3R4RA 4TUKH 2JB6A 3ZKQD 2VR8A 5KYUB 3QR2A 4JN2B 1KZQA 1YNJC 4JKKA 4R96A 5TDOA 2Q5BA 1WV7T 4BQ6A 1XPUA 4OFYA 1QE6A 5F8QC 1OAUH 1GKEA 1SN2A 1T2QH 2LLNA 5J9PA 3QNXB 1FPTL 2X2JA 4F88A 2DQ6A 1SDDB 1NFDE 1QRNB 2VE6A 2VXUH 4ODXA 3TIEA 2EAEA 1PBYA 3FTWA 4ZNEE 5MEPB 3AFLA 3SCMA 5J7CC 5GAEC 3CZKA 1W0WA 5HHMD 2Y0SE 3U9WA 4NO0A 4AH2A 3ZIMA 3SYCA 2FD6L 4WJ5B 4ISVA 1KCUH 3QI9D 3WLWD 1TYEB 4MCMA 3D05A 2NW3A 3BDYL 1DJHA 3QDGE 1A14L 3QSKB 4UV7L 2VDRL 4NXKA 5KWYC 4YHNA 3OZLA 1N33L 4CJ2C 1SJHD 1FV1B 3K81C 2HXAA 4AYDC 3IJSA 1S7QA 3GC3A 1FO0B 4PJHF 4G8GA 4BFFA 3JVFC 1RD6A 3RDTC 3D4CA 4RGOL 3FB7B 4UAHA 1X3QA 4KI0A 4IGBD 3CMOH 3ZLQC 4BH8A 4A39A 5IK3B 1GUWA 3ZDZF 2F1BA 4DAYB 4K6LA 2BIHA 2IV9A 3HBQA 3MMEB 4HYTB 3T0ED 4ANWA 1PU0A 1OXSC 2O6FA 5LKNA 2P5PA 3IPFA 2ZE0A 4JFED 1MEXL 1ITCA 5T1KB 1MJCA 3W5NA 3NA9L 4PJEA 3B5HA 2BDNH 3CPUA 4KRMB 1PH6A 3F58L 3ZE1B 3STLA 5DJ8A 1P0SE 3WDJA 1BXTA 5JW5B 1SSOA 3QG6A 1FFTB 1VFAB 1M57B 4DK1A 4N2IA 3ZR6A 5LG6A 3QR1A 4YC2C 3M7GA 3MV01 4FNQA 3LKSA 4I0PC 1LILA 3W39A 2KPNA 3HG9A 4OZGB 4W9EC 1SYCA 1CIUA 2G3XA 5BZDA 1JHKH 1LWRA 1VCAA 3R8BB 3EF4A 1CLCA 5FJ8H 4NUMA 3SGJA 3N42F 1FZOB 4JFEE 3CFQA 3RURA 3D0FA 2G2RB 3LB6D 2P8MB 1LMIA 3IE9A 4LF3A 3HKZB 1CFVL 2I07B 4NQXA 5I28A 1JZDC 1MI5E 1ETB1 3HPLA 4MIUA 1F56A 1TQSA 3LKRA 1A4KB 1DSWA 1FORL 4E42B 5KS9E 2F7QA 3HEJA 2W9EH 2Z4TA 4KXZH 2JB5L 3VWKD 4F2MA 1ZIAA 2PCXA 3B9EA 4L2LA 5F3BB 3CW2C 3ZDYB 5J56B 1ZHKB 4GRMB 1THAA 4Z7QB 4AIXA 2R2BA 2UV3A 3Q7JA 5JIMA 2FECL 3FUEA 3M6DA 1SM3H 5JORA 3P0YL 1N4XH 1D6VL 5E24E 3PS6A 2AAVA 4X64L 3S48A 4GOPC 2AGJL 2YK1H 1DEEA 5FLMG 3O2VH 3GSWB 5ADOH 4GG6B 2WKCA 2BMKB 1D5IH 4AZ8B 1HS6A 4ALAC 4KK8D 3MBWB 3INUH 1UADC 3ML8A 4HWBL 1U93A 2VDKL 5BV7B 3SQBA 1Q0XL 2XTLA 3P9MA 1BBJB 4RIRB 1HUNA 1HH6B 1K9MC 3DX8A 4LLDB 5GS0D 2F54B 5D1QC 2ENBA 4F33B 5I18H 4FMFA 4HGMA 5DJZA 4X3SA 3TF4A 1A0QL 2DYPD 1N9WA 3BVNA 1O7SA 2GSGB 4OI8A 1X9NA 1OPGH 3DUSB 3CH8A 2Y1ZA 5C7ZA 4QHNB 1V8HA 7FABL 3HKZG 4FFZH 2QADB 3N85H 4JZJC 5I0YA 3OM3B 4J3OD 1GH7A 2J1YA 2E2JH 1BD2A 5K1VA 1KTLB 4J3SA 4LMQD 4QAWA 5E08L 3EGSB 3NP3A 3F7KA 4GUPB 4LCYB 5I5JA 2FO8A 4GQ9H 2FHCA 4EIGB 2EIJB 4LT7A 1BF2A 5EU3B 4YXLL 1S3RA 3QIBB 4WFGE 3P77B 4MS8D 5F21B 3RWGB 1F3DH 5HVHB 5TH2B 4PW9A 3QCVH 2X4SA 3SPVB 3HC3L 4CBZA 2V2TB 3WFHA 3WLBB 1KCWA 1DJGA 3I75A 4LLYA 1RZKL 4K5WA 1E42A 2JKSA 1QP1A 4HJJL 3VXTA 3Q5OA 1QEWB 1AYRA 2A83B 1F00I 3VGBA 1CO1A 5CGMA 3W1BA 5F1IB 3LNEA 4EQ2A 1O7DC 1P4IL 3GSWA 3PO3G 2UWEA 2Y6SD 5IM7A 1PTOH 1KGIA 2X12A 2NVXH 4PGCA 1UUSA 4EI6A 1ACYH 1S8DA 1J87A 1KHIA 1FG2A 4AJVA 3GSUA 2FT6A 5GGQH 3VXSE 2YXWA 4U1GB 4ACTA 1RIHL 1Z5YD 5GGRY 4WNJA 3D0VB 2WXNA 3GO1L 1WC7A 1A3RH 5HYJE 3R06B 4NZRH 4XNMA 3KBPA 1I9EA 5CO1A 5C09B 4W9LC 5IQ7H 2VLRA 2D0OA 2VXTL 5FYKU 2KPWA 3NACL 1QLEH 1RLWA 3QFGA 3HOZG 4P4KA 4U1HB 1IAMA 3CMOL 3QFJE 4JVZA 1VMPA 3QIWC 1BBXC 1D2BA 3IRZA 1R3HB 3F2UA 1M9SA 2XDHA 3BH4A 5GRZA 3SQOH 3APFA 1T4WA 2FJHB 1G9HA 4A3DG 5B38G 4ZUIA 2PYFA 3GXNA 1Z5HA 4FLOA 3DVGB 3S4SG 2DNCA 1PYSB 3ZIYA 2CWRA 3C8KB 1HNXL 4FQXC 4KRNA 2VYRE 5T1DH 3ENEA 1ZK5A 2BIIA 1E67A 1K8DA 1U4LA 1NBVH 3C5ZA 4GMTL 1Q12A 1BIHA 1CDHA 1UT2A 4ZUJA 1XIWB 4LAAA 2BCMA 2YEZA 3KWWA 2ZUTA 1S7UA 3REVB 4QXGL 5KSBE 2F0NA 1W6KA 2GT9A 1PQZA 4I4WB 4QRUA 3EFFB 4B9PA 4FZEH 5CGTA 3TBSB 5E56A 1LP9B 3RVVC 5LL6X 4S2SB 1D5XC 2Q8IB 5I2YA 1DO6A 5JVH3 1THCA 1NR2A 3DETC 4U05A 5BPPA 5KJ7E 3ARRA 4XI5C 4X7DC 1A4JA 2UYLA 2H1EA 1Y69U 4OF7A 4A6YH 4OFYD 2JQMA 3K6NA 4S2SA 3MLUL 1S4IA 1IBKL 2P80A 5JNYB 1OHZA 2VDMH 5C5MA 3CVHH 1MF2L 4OVUA 4LSUH 4IK7A 3CFEA 3MCYA 4TV3A 1ZSDB 3BGMA 4JCVE 1JPEA 2FCBA 5CWSB 3A6OA 4NC2B 2EDRA 2E8ZA 4B3RL 3PV7A 2CW0C 4AKQA 1DD2A 3FF7A 4U2ZA 3V5KB 5ADPH 1IC4L 4LF7Q 1HPCA 3GD7A 1RTNA 1JDDA 3DXAB 4HS8H 1RKRA 4NB3A 2FJHA 2Q2LA 4OGQC 3CHBD 2GSIA 2JQAA 4RCOA 5D8JL 3J8F7 2GPZA 5EUOA 5HHME 3F7RA 3PQYD 3WEXB 5LUMA 1G87A 3NZUA 4NQED 3PFUA 2KMWA 1U4MA 3DNKA 3JWNC 2J6EH 1E0BA 2J71A 2NZ1A 1V3LA 3GMRB 4WI0A 4YIQB 3WDNA 4DFAA 1YA5A 3TPUB 3A4AA 3GJFB 3RL1B 1IGYB 4B3TQ 1JPTH 2CH8A 4MB3A 4C55A 3H56A 4HK3J 3RWFB 3EGDA 1B9KA 3EOAB 1WC7B 5ABDE 1KFAL 2AQRA 4LEEA 3PP4L 4PBDA 4XQNA 1W72L 1I3UA 1LQSR 2MTPA 5ABZA 1G8ZD 1BBUA 1NICA 4C3HG 3MJ7A 5DFWH 3PDOA 1J5OH 2MEJB 4L3EE 4K3GA 2YIHA 4M7LL 3IAYA 4Z0BH 4DQOH 4PZ8A 5LWYH 4YE0A 5E6IC 4OD3L 1PYBA 5I5MA 3FQXB 3M4QA 4WJKB 1CICD 1UNSA 2CBPA 2YUVA 1KJ2B 4BWTA 3K71A 4PTTB 4AENA 1JUFB 3VXTB 4XNUL 4FDBA 3QQDB 4DK6C 4MJIA 2I26N 3RB7A 1E4JA 4JCLA 1TKWA 2DY8A 4HIPA 2XA3A 2FEDD 3MN8A 3UTTE 3APMA 3C8HA 3IJHA 3N9GL 3Q1SL 1HINH 4IBWA 4KQ4L 1IVLA 1W2KT 2FH8A 5IGDA 4M56A 3QDGB 3RWCA 3IB4A 2EO9A 4RGOH 3NTIA 3EFDH 1ERNA 4GLAC 5IROA 4LFCQ 4X4ZA 1MIML 2IQ9L 1Y7VA 5AKSA 3VFVA 1ACXA 3Q8CA 4AK1A 5DR5H 4NJAL 3N1FC 4FI6A 2VLRE 4HH8A 4GKZB 2C5DC 1J1PL 3IF1A 3NG5A 4TUOA 3P77A 4NSKB 5D1XC 3S5YA 3VYUA 1RJYA 2C3WA 4A7TA 4BV1A 1R3JA 4UQAA 3P40A 1JPSH 3NPSB 2BDNL 4M1DL 5ELBA 3GV3A 5EOCH 2CCVA 3TA3B 1D5ZC 3EH1A 5IJVB 2FO1A 1LDPL 1U91A 2FH6A 4K71C 3G6AA 1V9PA 2IWKA 3FU7A 4NQTA 4PB0L 4PD4J 5MEQA 1MGSA 1QSFB 4GINA 5CSGA 3J81c 4I88A 1JGVH 4ZOAA 2EDEA 2F08A 2X5PA 7CGTA 1WUZA 3B3IB 1NTDA 2DJSA 2J8OA 3L1OL 4IGBA 3WOVA 1E5UI 4S1QH 3BVZA 4XCEA 3O8XD 4FL4C 3FEWX 1AHWB 2DEYX 2DLIA 1J8RA 4UDUC 4WUUD 2AQ1A 2GSMB 1EXHA 1NZRA 1U21A 3DWQA 4QTIH 4XXCA 5C0GB 1SJHA 3P3TA 2YD5A 4MQXC 2EVIA 2JJVA 3BCDA 1JI2A 1FNVA 1S7RA 5GGTL 4G7VL 2H6UA 3SOBH 4DUWA 1KXTA 5C6AA 3U0WH 4HU8A 4B9YA 5E8NA 4KJYB 2GTZA 5G4NA 1YNTA 2A9MH 5C3EB 4B6ZA 1XNRL 1ZOXA 2F7PA 2JJTA 3TH2T 1V1OA 3C5JA 3R8QA 3WNLA 5ELCA 5IQMA 2I5MX 4E9XA 1T7XA 3T71A 2RQ8A 4PB9H 4JG2A 1HK6A 3TT3H 4N20A 4N1CA 3T1YQ 1Q90A 1FGVL 3IGUA 1UE1A 3NCJH 3LAFA 5JORB 3RL2B 2Z4HA 2V5SA 1QACA 4FA6A 1T2QL 2J5LB 2BSEA 4OZFH 3R2TA 3O9WA 2DY2A 1YNXA 5CV8A 5DUPL 4N2EA 3C8KA 4DGWC 4KDWA 2DQEL 4QYOB 1QLEB 1PHJA 5E5UB 6CGTA 4JB9H 3TO4D 1FNGA 1G9NL 1F42A 1YEDB 5KW9H 2EE1A 3RFZC 2Z1KA 2ZOUA 2EY5A 4KNSA 4EOWL 4RLDA 3WIHL 5JPMB 4MTKA 1CU4H 2K32A 3LXCA 5TE6H 3WTTA 1ASQA 1CG9A 1W91A 2BFGA 4V11A 1DYQA 1SOKA 2HHHQ 1WFJA 2NLJA 3BT2H 1KBKA 4AGOA 2RQXA 2EC9U 4R4TA 1IJ9A 1TU2B 3BHBA 4NQDE 4LF9L 4ZFQA 2VLRB 2YR3A 4QRPD 1E22A 1RPQA 2HPOA 5JJLA 4W9HC 2GK0A 5M3FB 1T0PB 1ORSB 2ITDA 3HFML 3MTRA 1RZ8B 5GJSH 1KZYA 2PYEE 5HHOD 2YPVH 5C7XL 3H8NA 3MJWA 1EWCA 4V1DE 3VD9A 4GUQA 2ZT9C 3S9DB 2YMTA 2EH7L 1MJ8H 3ZDXB 4EIUA 2AK4B 3QORD 4CJ1A 1U2HA 5I8OL 4JFPA 2XA8H 4S0TD 5IESH 4Y4FA 1OTTD 1QABA 3UTZA 3MCLL 2IADA 1MHWC 3SK6A 5F44A 1BPLB 2HG5B 2EDHA 4PRIB 2EQDA 4BRJA 1FNFA 4TYUA 2R3ZA 4WKXA 1KTDB 1XCQA 1F5WA 3EH3B 1T22B 3WLBA 4EIZC 3L3HA 1P53A 4FE9A 1U9RA 1IGCL 5C4XH 3P30L 4RRPA 1ZLDA 2CKBH 3QE5A 3LJ3A 2X44D 4AMKH 2CGZA 3MUHL 3L2PA 4FF3A 3W9DB 4QTHA 1FL6A 1FO0L 2HSIA 4WF7A 4D2NA 1REIA 2EXTA 4FFYH 3LSOA 1U8JB 4B9XA 3TZUA 1LEIA 2EDWA 4FJ6A 2GITA 3QDJA 1N0XH 3ZPDA 1H3XA 2ED9A 1I4QA 2UVFA 3ZRCC 1XZ0A 5GISH 1U2CA 3IMUA 3WEAA 1UA7A 4GXFA 1TTUA 2BSSA 3F7VB 3GIVA 2EYLA 1JHTB 4LLQA 4TRPL 5D70L 1EAOA 1J9SA 4FF1A 1S5IL 5ALCH 2JYOA 1MWAA 3LPPA 3VM7A 4J3BA 4GSXA 1XBDA 4Z77B 2HT3C 2AJUH 5DD3H 4QCLA 3SDAA 2IHFA 5KSUA 3ULVH 3RX9A 3S14H 5EBWB 5E7BA 1INDH 4P2RD 3HOWG 4I65A 4B9CA 1KIUB 1UXLA 4JBJA 3PF2A 4LLWB 3OGCA 3RY6C 4E68A 4ZW8A 3D3RA 2L12A 2F3VA 1A9EA 3NBNA 3M3YH 2WB7A 1Y14B 3MQIA 2VXSH 1T1WB 3PGFH 1D5ZA 1Q1EA 1I1RA 3PUVA 3NTKA 3VRLE 1JGVL 1IGTA 3HJ0A 1H3WM 4WFEE 3FSZA 5IQLA 5DD6A 2CLRB 3L1OH 1BCIA 4XVOA 3NFPA 3WU1A 4KKUA 4F8NA 5C0DA 2KENA 2XZZA 4HOZA 5LQBL 3Q2LA 5DQJB 3W56A 4JQVC 4MD5A 3T51B 4P5MA 3IGLA 3RLOA 2PPBC 5KVGE 5DFAA 2BJMH 1MRCH 2Y7OA 1N36L 1GGBH 3QCTL 3BFQG 4U7KA 4A6YL 1DHKA 4O02L 4BRVA 1UWXH 1T1ZB 3Q6GH 2FX8L 4N86A 4YQXH 3K6SB 1AZNA 2PP8A 4YGAB 2FUTA 2WFWA 3MV9D 4KKNA 2LXKA 3S35X 2C3GA 3UO1H 4XNYH 5HHVH 5KBMA 1SFOB 3PY9A 4MXWL 1OLLA 1FYTE 5GZOC 5E8OB 1NC4A 3O0RH 1NUCA 1HNYA 2J73A 5ETUA 1J9CT 1E9QA 2B2TC 1HC1A 2KCCA 1E28A 4PUBL 3ATBA 3LN4B 2UX7A 1OTCA 3LN5A 5F89A 4PWHA 3VCLB 1KIUA 3BRDA 2UUBQ 5KAQF 1TVBB 4GYBA 3RKDD 1A7RH 2XOTA 3B37A 1JZFA 2AZUA 2EDKA 4M93C 2BH8A 5FYKL 5DUJA 4ES9A 2FHBA 3S2HH 1CHPD 1MH5B 3JZ7A 2WOYA 1F6LL 4KU1A 5DHMC 1XF2A 3D39A 1BX2A 1U92B 1X4XA 4BQCA 2KBGA 3RNQA 4HKZA 4NHCL 3RHWK 1E8XA 1KCLA 1RL2A 1FQ9C 1CIDA 4RGNE 1X3PA 5GS1C 1NE3A 2XTJB 5EOQH 1BF4A 3Q8EA 5LO7A 4K3DH 4IK6A 2WW8A 4BY7B 4WHTB 1UQSB 4KLKA 2AKRB 1NBCA 1WSST 2J1WA 1CD0A 4G6KL 1FL3A 1DSFH 5C0AE 3X3MA 4MNGB 1EMTL 5ILTL 4YHIB 1IYUA 1FAKT 4Z0BL 1KGUA 3DROA 5AAMC 1N10A 4P46B 4HMIA 1MI5B 4ME3A 4LDOB 2OYMA 1X7QA 4FNRA 2EVFA 1Q8IA 2DN8A 4FO2A 4P3DB 1UJ3A 5JPMC 3VDYA 2ADFL 4W1TA 4XP1L 4AYFA 4U1GC 1IFRA 2NXYB 1HEJC 1PFMA 4M48H 3WN5C 1SBBB 5I8OH 5HY9A 3PO2B 5IMMA 3B1UA 5AVSB 5I5RA 2PYKA 1ASYA 1M1SA 1K5WA 5TGBA 1KG0A 2ZXWB 4AEIL 5B3SB 2Y7QB 2AMCB 2EOTA 3D2UA 3PGZA 3TNNB 2GHZA 1B88A 5D2LA 3DV6A 1CZWA 3ERQA 3U83A 4PJ9C 2J5LC 2FGWH 1OGAB 4N8CH 3KPOA 4M7ZC 1C7SA 3SKMB 2WQUA 4BSWB 3D85B 5C4JB 1SHXA 2E9BA 2V0AA 5IOCA 2V1CC 5KYWA 1QJOA 4YXLH 5CF3A 1I1FA 4MD0A 5IBUG 2D2CC 5FA3A 1B44D 1MCKA 2YPVA 3ND9A 2WINA 1AGEA 1MFAH 2UX6A 3I6GB 4FXLA 1ZA3A 2DEWX 3NFSL 1PAZA 3GMQB 4A2EA 1PL3A 2IWFA 2CA3A 1ZLSL 2ZX8A 4Q9RH 4APQD 4L5TA 4QPEA 4PGBB 4WTQA 3U25A 1WBYA 4H20L 5F7LB 1SE8A 1NQBA 1NIEA 4HW6A 4U2YA 4LSUL 1F4WH 2ZX5A 3LCYA 2KQNA 2WKGA 4CN6A 1TUPA 3VA5A 3O3BB 5IJKA 4W9GC 3ES6B 5EUKB 3HE6B 1M7UA 2B3GA 4YSCA 2YD4A 3Q9PA 2GB2A 1OSPL 2DWDA 3I6LE 5FFLA 5E08H 1IC4H 3IDUA 5LCVH 5I6XB 3FQRB 1CBJA 1JOKA 2CD0A 2Y9RT 4IRSA 5FFGA 3QQ9D 4LMQE 2YKKA 1UM6L 2DWEA 1P5UB 4PJGB 3GLEA 1D5ZB 2F1EA 3BP4B 3H9HB 4NEHB 1VDGA 1WH0A 2F0CA 2EIMB 4OAWB 2IDFA 1HSBB 3EO0A 5BV7C 2X42A 2EZVA 3TN0B 4IRJD 2LR4A 2NX5E 2LE9A 3SQOL 1NINA 1YZZA 2YD0A 4YWLA 3FT4B 4UBDC 1WTPA 3K81A 2NY5L 6FABL 3MRMA 1MNNA 2WB1B 1CLZH 1YY9D 4O4YL 3THML 3LRSA 1AZZC 1BVLB 1LK3L 1OW0C 2EDXA 2HN7B 3KPMA 4JJOA 1VEPA 3SYOA 3WIFB 4XMTA 1HHKA 1BVOA 3F01A 2BOLA 4HAGA 4X5XA 1W6LA 3IAQA 1CL7H 5I8CA 1KBGH 2R92B 1XB6A 2DV6A 4HHWA 1Z7JA 2P3YA 4U6VL 4IOSD 1E3PA 4GFTB 3ECBA 4G1EA 4ANKA 3VGAC 4P4KC 2ALYB 4NYLA 5EGTA 4FG2A 3EJTA 4P59H 1U91B 2VUOA 2PQEA 1VQ9A 4RFEB 5T5NG 3QWNA 3L4TA 5I74B 1JZ5A 1I5FA 1JDAA 2GSGA 1BM3H 2P5WD 3D18A 4PG9B 1FN4A 1ADQL 4OZIE 1B0GA 4N28A 3VI4A 1TVXA 5KVEE 4NNXA 4ZLTF 3S3SA 2UXDL 3B34A 3U7YL 2SNSA 5DC9B 5HYQA 1CN4A 1MCSA 4I0PA 2K5VA 4PRHB 3WS6C 4OLWL 1Z9FA 3PWNB 5FYKH 4HKBB 1KN4L 3U48A 4P4KD 1KB5H 4G7RB 2C9QA 1VB9A 4FCAA 2H8PA 4XPGL 5EO1A 3AW5A 3DJRA 2VDOB 1AGDA 3HOVH 4Y5YB 1I94Q 4JFPB 3MNZA 2MQ0A 1RAMA