3L3OC

Staphylococcal complement inhibitor (scin) in complex with human complement component c3c
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
306
structure length
294
Chain Sequence
CNKFDLKVTIKPAPEAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Basis for Complement Recognition and Inhibition Determined by Crystallographic Studies of the Staphylococcal Complement Inhibitor (SCIN) Bound to C3c and C3b.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
molecule keywords Complement C3
total genus 53
structure length 294
sequence length 306
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3l3oC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 3l3oC01
2B39A 3OHXC 1OO9B 1D2BA 2I07B 2WINB 2E2DC 1PXUA 4LNVA 2XWBB 5FO7B 1AYOA 3HS0C 2PN5A 1GXDC 3CKIB 1EDYA 4D94A 1UAPA 1XWEA 3I70A 4FXKC 2A73B 5JPMC 2A74C 5FO9B 3CU7A 1BQQT 5JPNC 3L3OC 1JC7A 3HRZC 4FXGC 2J0TD 1BV8A 5FOBB 2XWJB 4ILWA 1BR9A 1JB3A 3KLSA 3MA2B 2ICEC 2WIIB 1UEAB 3T4AC 5FO8B 3FRPB 3V96A 3G6JB 2QKIC 1BUVT 2TMPA
chains in the Genus database with same CATH superfamily
3PREA 2WLLB 3FN0L 5KYYA 2UUDK 5LN8A 4UP8A 5AALA 4ZW6A 4WEUD 1EZ6A 4JFDD 2WQ8A 5ADPH 3WKPA 5J57B 2XWCA 3KVPA 3WY2A 3OTOQ 4EBQL 1MFEL 1P4IH 2B08A 3QUMA 2EH7H 3RKPA 2EUZA 4IKKA 4TUKH 2OMVB 5CR8A 3K80A 5K93A 5DM73 1LO2L 3D5OF 5D1ZD 1KJMB 1NMCC 5F3HB 4F15B 1RULH 3TNMB 3QG7L 4FG6D 3SDYH 1JCKB 1CGXA 1PY9A 4TRPL 4OUUB 3D31A 3K1DA 3KJ6L 5B39G 3NPPA 4EX5A 3P20A 1OL0A 1SNOA 4LPXA 4P2AA 3W38A 5A7EA 2WAQB 3VFTB 1SJED 2FBOJ 1TZOA 2CBTA 3LYRA 4QRTB 4RSVA 5AAWC 5BVJA 1I4HA 1AANA 2XWZA 2XSKA 3CVBA 3DOSA 1U8JB 1Y18A 4HDIA 2OL3B 2F3VA 4W4OA 2Y7MA 1K0RA 1OAYL 3LWEA 2J21A 4ZUSB 1KLGD 4UBDC 3H0TB 5E8DL 4QT5A 2J0TD 3S1NB 1AKJA 4BFEA 2BSSB 3B9DA 4BH7A 5JJKA 4WVRA 5DRNB 1E27B 3WAKA 1YAIA 2ZF8A 4JFVA 2MGSA 4C2MH 3PQYA 4IO9A 3L7EB 3RWEB 5J13C 2GVAA 1IAIL 4MD4A 4N6RB 1NWOA 3Q0HA 3QHFL 4ZFOB 1TLMA 1WD1A 2XWRA 2Y9RT 3W1BA 3BDXA 3L5XL 4Y9FA 4YPJA 3TPUB 3VRJA 4A7VA 5C9JB 4G8IB 1IU1A 4NM8L 3HFZB 4K8RC 3DWTA 2NXYB 4Y19B 4HX1A 3DMMC 3M46A 4UTBA 5FR3A 3FU7B 1I1CA 2WP3O 4BFRA 2A6JB 4MB3A 3FONA 4A3DB 1H15B 4PJAF 1HC1A 4X0KA 3P30H 1NCBH 1JPEA 3CH8A 1STGA 1PKQB 2CBOA 3ASOB 2AVGA 1HH6A 1B0RB 4AYSA 3Q7JA 1T0OA 1JUFA 3IPEA 5C0RL 1AGEB 1TYRA 1WA0X 2FBJL 3ET9F 4O2CB 4G71B 5CJ5A 1LEKA 3K81C 4HXBL 1K72A 4RETB 4E9XA 1FA4A 3HB3B 2P48B 4XN4A 2ATKB 3MXVL 1U9KA 4LQFL 4M6AA 5DMGC 3ARPA 2M8XA 4XX5A 4KI5F 1T03H 5IE8A 1ZKAA 2A0LC 4NLAA 4U2ZA 2FMMA 4XX1G 3IVKA 4GUQA 4YH6A 2J7LA 4QAMB 1G6RA 4BYHA 1Y14B 5I6WA 1UD6A 3IFNH 1EJOL 4ZW8A 2UWEB 2X0WA 1M7DA 3GMLA 3ETSA 5A3ID 3T3PF 3IMUA 4R9WA 4GSDL 5HI5D 4ZZFA 2VQFQ 1CLOH 2VDPB 1CTMA 5TH2A 4RMFA 3F8TA 4MJIA 1C8PA 3RIFK 3FN3A 3FBQA 2MIZA 4BY1B 4CSPA 1B4LA 3L95A 2CUAA 3S14H 1JGUL 3J81i 3ARDC 1D2OA 2DS4A 2OTUA 4K3EL 1GIGH 5L8LB 3WNJA 5EU5A 1JNLL 1RUKL 2Z31D 3G7LA 5JIDA 5AYTA 3GTKH 4P59L 1S4IA 4MZIA 1Q9WA 2EILB 4KDVA 4QHKJ 2F0TA 2APTA 3CVHL 3KPMA 4DEPB 3BQUD 5I1DB 4IUVA 2BIMA 4C3IG 2E7MA 2ZG2A 3HNTL 3ZE2F 4G83A 1JVKA 4PUBH 4OO1G 2FINB 1IILE 1SJHB 3BAYA 3L3KB 3P4LA 4MMZA 3MEFA 4AXWA 1B9KA 4YE4L 3Q8BA 4QRBA 3WN6A 3GO1H 1DE4A 4L4TE 3VM5A 2IHEA 1F6LL 3M3YH 1T1ZB 1LK2A 2J8UE 5C0EB 4IRZL 2Y6SC 4FG2A 1L0YA 3JVGA 3IEAA 4H5SA 2JTDA 2AQQA 2EYRB 1XL4A 2X2JA 3NIFB 3WOVA 2QLYA 4ZAIA 1HHIB 3BYTA 2RTTA 2XZQL 4XI5C 1MJ8H 5GPRA 1CFSA 1I4XA 1YYMH 2X28A 3M7FB 2A77H 3MLVL 2E9WA 5KAQF 2CHBD 1X3DA 4I7ZC 2A9AA 2IH1B 5HVWA 2BS8A 3GD1C 4LP4A 4PJEB 4GFXA 5KTEH 4GG6F 3AFLA 3W0WB 4D0DA 3MYJB 3T6XA 1A1MA 2HLAA 4AENB 2FQFA 4QXUH 3FRPB 2J8UA 4NQVA 2VZTA 4DQAA 1NMBH 4EZJA 5LAXA 5E8DH 2NY1D 2JA6B 2FEJA 1AGFB 3QISA 4OO1I 2WB1G 4HLZH 4Z0BL 3T0WA 3BKYL 3I4NB 3CVDA 4WV1A 4GSUA 2XSCA 1Q1PA 3GSOA 4U3XA 2Z4QA 2FYVA 2XTJE 1FSKB 4KPHH 5IT9L 2IDQA 2W95A 3K2KA 2ZXWB 3QO0B 1KIUA 1RIVL 2V9UA 1HXMB 2JIXA 3FQ4A 1RJZA 5EGTA 2Z64C 3BI9X 4YPGB 3GBDA 1IBFA 2UXCL 4J3OH 3KS0J 1OW0C 4XVUD 4DP1X 2YRLA 3TFBA 1DQDL 4G5ZH 3QG6B 5KSAB 3CC5B 4AM0A 5HGAB 1AIZA 3TYGL 5L4FA 3RWDA 4XH2B 2XN2A 1KWKA 2BWDA 1N67A 2TRYA 5JPMB 1N6QH 1K3RA 2ZSVA 4MJ2A 4DV6Q 5CR1A 1GSMA 3HOWB 2QKIB 4HAGA 2A6IB 1BZEA 1KNAA 3FCBA 2ITDA 2WNWA 4LFBL 4M8QA 3C6LD 4P23D 4UANA 4M4RB 3RBGA 3V5KB 5AAPA 3EOTL 3KLHC 2EQSA 1SYSA 1QW8A 1D1KA 3BKCH 2R7DA 3PIQA 4K8RD 2APXA 2AJXH 2Q7NA 4IZ8A 1OB0A 2Y2WA 4U673 1AIFB 1F5WA 5I24A 4QNPE 3I4NG 1FFNB 1VQ8A 3ZL4H 5C0CD 3E6HB 3MMEA 1P6AB 3W2DA 1EO7A 2FQGA 2PPAA 5IP4A 5KW9H 1Z6HA 1TKWB 4X62Q 1PZAA 2J71A 4WI4A 5E7BA 2WBKA 4HPYL 1A7NL 1TPXB 3O11B 5I17A 3SK4A 5IGFA 2I60H 3BZFA 2YU9H 4I5BB 2X12A 4TLTA 3TVMD 2Q2EB 5DR5L 2F7QA 4NEHB 4AEFA 2BRRH 4NRZA 5DMGD 1A3TA 4KK6C 3MX0B 2H6UA 2KECA 3TS0A 1CD1A 2FB4L 2Y36H 3NA4A 3PLYA 5GRWA 4NXNL 1M7DB 3CVIL 2EEBA 4FG4A 4PYGA 3DM3A 3F7VA 1R9TB 1XCQA 4PLKC 4IJ3C 3HRZB 3EUDA 3SDDC 4N85A 1IYJB 1CD9B 2OCJA 5A3IC 4E0RA 5GSRA 1HIMH 5DRWB 1TMCB 5TQ0L 5KBLA 2A6HD 4LXFA 3QEQB 3KDFA 1M8AA 4BQCA 1BNZA 2VXQH 2XBDA 3S1QH 3QJVB 1OP5K 2R0ZH 1OP3H 5B22A 4AWJC 2B2UA 1GS6X 2CAKA 5DJDB 2RQXA 1JC7A 3A5VA 4AE1A 5HDBF 4AGLA 2ZNWA 4TQEH 5FLMH 3DRTB 3BSZH 1PKQE 1BZOA 1MRCH 4XCFH 1P16A 3K5LA 5BQ7B 5C44H 3EROA 3V0AC 2OI9B 2A1WH 3HJ0A 3FUMA 1WSST 5JO5A 4K3DL 3K80C 4H1LA 3VRJB 1U8LA 3X3NA 2N7AA 4GKLA 1YMME 2DJ4A 3NCJL 4XIGS 3RTQD 1DOLA 3Q44A 4HS6A 4AQAB 4B53A 1AP0A 2VDPL 3HUJF 4IBZA 1EUTA 1KSRA 2JQAA 3ARGA 3T3PB 3OX8B 3L3DB 5C07D 5IB2B 5C0AD 4N8CL 4ME5A 2WQVA 2K14A 2H6OA 4P2RE 1F58H 3GKWL 5CBEB 5AW5B 5C0FB 2WVTA 4K5WA 2OTLA 3HKZA 1G9NC 2OW7A 4QRTA 5FYKL 5BVJB 2NYZD 4HPOL 1YEFL 2DKUA 5B38G 3WJMB 3QFJD 3DHMA 1OGSA 3BSGA 4BZ1H 2UU9L 3F01A 5AOKA 4QOKD 1YNJD 2K5DA 4UQAA 3OQ3B 5F1SA 5DUMH 1DQDH 1IKFL 2NZ1D 1HQRB 1T83C 5HGQA 2D03H 2WC7A 2XG5B 3FU0A 1RIUL 2DM7A 3JWDL 1XF2B 1T7ZA 6PAZA 2BSCA 4S1SH 4PJAB 4BFOA 2NY1C 1Y1WH 5CU5A 2PWFA 3TM6A 3CX5K 4LPTA 4P04A 4BBSB 1JNNH 4G6AD 4A4IA 5EU3B 2XRQD 2H9GA 4F8LA 4JI2L 3HMXL 5H35A 2OMTA 4K3EH 4G82A 1Q3LA 1JOIA 3M4OH 4KXDA 5I6XB 1WRFA 2OMZB 1YEEL 4FNLH 3SKJL 2XPZA 4FFZH 1RVFL 2SEBB 2XIIA 3X12A 3QZBA 5ISRA 4IMKA 4A7UA 4EN3D 4LPUA 3GS7A 4ODSL 5HBBA 1ZT1A 1CYWA 3B43A 4WUUE 3ZTCC 3DV4B 3TURA 2FSDA 3STBD 1K8GA 4JO4L 5JR1L 3JAME 2JIXD 1S5FD 3QULB 2IWGA 4Y52H 1MHPL 2GI0A 3QEHB 2AQ2B 1AO7A 2XLLA 3D7PA 5DQDH 4DAPA 4ECNA 4JQIH 3L4TA 5D1XB 2VR9A 2K04A 2ZXOA 3BVXA 4WJ4A 2EDGA 2HCCA 2VZ1A 2XVKA 1LYQA 2BVPA 1MIEH 5E5RB 5BRZD 3WGVB 1WTOA 3RL2B 1VCBC 2ZKHL 4XNAA 2VERA 3B9AA 1LMKA 1NAMB 4Y89A 5AENA 3L3GB 3AXLA 4FXGA 1LQSR 3ZL1A 4M48L 3IDYB 5DGQA 1O6SA 1VEPA 3LN5A 2R0KH 5EZJA 1FBIL 5JQ6L 3VXUE 2BVQA 3QORD 4WLCA 2QT6A 2ARJA 1D9KA 4ANWA 4KY2A 4R8WL 4DP7X 4K6LA 2LR4A 4FQXD 4LF3B 4IGBD 3R4RA 3FU9A 4X99A 5AYUL 3SO3B 2L9HA 4PAZA 3QDGE 3J81E 3C08H 5E2JA 1LDPL 1KFAL 4Y9CA 4PRPE 2B15A 5DLQE 3BH9A 5JPMA 3QHZH 3TBTB 5CUSH 3B6SA 3KYNB 4PS4H 2OK0L 4Z7WE 3WEAA 5F1NB 4AQ1B 4MMXC 3WEXB 1GUSA 1RZGB 5MERA 1OCWH 1XXGA 5DEFB 5C97A 2B2WC 2AW2A 3I6GA 4NO0A 2BK8A 1BGXH 5CINL 2YN3A 1NBQA 3ARFA 1T20A 4P2CG 3S1QB 5E2TH 1FFPB 2N4IA 2UUCL 1EEYB 4L4VA 1QZGA 1WZAA 3BQUA 2JJVA 3G6DL 4L0YA 5TH2B 4IBTA 4ZTPH 4ZUJA 2HTKC 2GJJA 1WCMB 2A6HC 1G1YA 4R2GC 5GZND 2K05A 3QDGB 2VQEL 2HAZA 4TNWF 4YAQB 4A38A 1C0AA 4M5YH 2VLJD 5KSAA 1KLUB 4Q0FA 3SYAA 2H1XA 5EKLA 4K94H 2GITA 4S2SB 3D0LB 3QZMA 3JTSA 3TEXA 3VR6A 2P5EB 3PNWB 1CFSB 5PCYA 3VW3H 1W8EA 4B9JA 3QUXC 1G1CA 2EUWA 5AVYB 4JDVA 1O5PA 3VSVA 4RWSC 2PO6C 4LLYA 4H26B 2ZX5A 3E9UA 5F1IA 2IV9A 4ZD3L 3GLDA 4PJIE 4X0KB 3D85B 1BR9A 3EGDA 5DRXA 4CBPA 1EY4A 2I9LA 3DETD 3HNSH 3ZE1F 2V5RA 1XR9B 4KKZA 1K4DB 5BQDA 5ETUB 5T3XD 4ONOA 2VXTH 5C4JB 2DWSA 2H3NA 1HYSC 4FA6A 3QUHA 1VFBB 2IBZY 4RFEA 1JWMD 4ZFOA 2DD8L 2ES2A 2XPGA 2BXYA 4BE5A 3ECUA 2AQ1B 1SYVA 4LF7L 3CCEA 1PY0A 2LLNA 1TS3A 3ULUD 3WJLC 4FNLL 1KGWA 5JPNC 2HPTA 4F57L 5I19H 5IR1B 4HT1L 1A6UL 5E2WH 1RD6A 1AJ7H 2CE6A 2XKNB 5KZCB 1JZEA 3PIO3 3RWFB 3RFZA 1KTDB 2FWLB 2OPCA 5J22A 5EBLA 1I8IA 4TNGA 5C0IB 2EDNA 3MA2B 4M5TA 5G4OA 1OAYH 3SDCB 3JAMc 5CCJA 4CDFC 1AQKL 5EWIH 4AK1A 1TITA 4X66Q 4F5CE 2JKIS 2DWEA 1JRHH 1UWYA 4FXDA 3SK6A 2WANA 5JMOC 3RN5A 4FABH 2TSSA 1W2BA 4LCCC 2CQVA 3D05A 3WXVL 3GLEA 2HB0A 1XCTA 2HH0H 5DVPA 1N34L 2ZOKB 4OJCA 1FNUA 3PAVA 1J88A 2WXHA 5B4MD 3E1ZA 2Y72A 4EN3C 1KABA 1PTZA 4HZLB 2GC7C 3C1EA 3AB0C 4KV6A 1JERA 3AU1A 3JXAA 1H6EA 4UT6A 2X38A 1MQKL 4HUXA 5E6YA 2PZTA 5DUBA 4TN9A 4LL4A 3A8IE 1R5WA 3PGCA 5BW7A 1U91B 3JWOC 5J06A 3M1CA 1G7JA 3KYAA 4NPYA 1MG3C 5IB5B 4AJ0A 2F1EA 4F92B 1UA6L 5IVXB 1MIML 2W9DH 4N0FB 4ZO9A 1A1NB 1CGUA 4ISVB 5JW4M 1E7UA 3GMRA 3X17A 3KLKA 5FV1L 4CNIB 4JM2C 1LD9A 1UQSA 4JGNA 3CHBD 3PHAA 1YEGH 3M6DA 4S1DC 4NQTA 2UY6A 1CICA 3T1YL 3KLLA 3G5YB 3HG1B 3QJRB 5TE7L 1P5VA 5FHAL 3V6OC 3WIFA 2X4TA 4F33A 3OGCB 1DVZA 1S78D 2QGQA 1A6TA 2VLRB 4MDJB 4HHAA 4JR9H 1YSOA 2YUVA 1Q0YH 4U1GC 1TCRB 1FVDA 4XMWA 2VN5A 4HKBA 4NAJA 3UBXI 1AR1C 1AACA 6CGTA 3DOHA 4JYAQ 2EIBA 4ZSOA 1MJ7L 3PAZA 3SKNA 2JK5B 1JPSL 3JWOL 5E8PA 4KY6A 3U9SA 3MLZH 1F4HA 2WN3A 4W6XB 4IIQC 1WV7T 1B2YA 2AWNA 1B44D 2YUWA 3PV0A 3QJFA 4PRHD 4IK6A 3UMNA 2NY6C 1S5IL 3GUTA 4OLEA 3FP9A 1A0IA 1QPXA 2P52A 4KBPA 2YKKA 2PZWA 1N2RB 4DPCX 2HMIC 3EYQD 3EADA 1RVFH 4NO0D 1X5ZA 3NBHB 5BZDB 2PW1B 2NXZC 4UTAA 2WBJD 1CGWA 1PYSB 3WS6A 1GKEA 1XAKA 4QIWE 4XVOA 2YD7A 1AKJB 2VW7A 2AAVA 3LQAL 2K7PA 1B7YB 3D9AL 3PUUA 4QY8A 4R2GD 3VD2A 2PN5A 4Y4HD 3WNKA 3CSYA 1KB3A 4NUGH 5JHLH 2N7BA 3S4SA 1XHHA 2K50A 5FA3B 3AG2B 4GRWB 4HDIB 4YVNA 5CBAA 2XVLA 3L9BA 5I71C 4QO1A 2EJMA 3UDWA 1Q46A 4NGHL 4A3IB 3H6AA 4OD2A 4YY3Q 1QLEB 2VAJA 2WBJB 1MF2H 5B3SB 3CLFL 1IX2A 3ES6A 3NCXA 5EBMA 3FO2B 3S3PA 5GAGC 4WI8A 3S24A 3QI9C 4JUTA 4F80A 2HLEB 4PRIB 1Q1JL 4Y4HB 3N43B 5DJXA 5T1LB 3GXTA 5GRZA 2GJRA 2QGDA 5IQNA 3IFPB 5C4XG 1BOYA 1MWAH 4Q4EA 5DFVD 1QEWB 1PPIA 4D9RE 2EEAA 4OCSH 5HGDA 4ZLTF 1LNUA 2FJHB 2XETA 2CCZA 5BPPA 1LT4D 4PJ5A 1NMAH 3BPOC 2F0IA 1JIBA 4W68A 2I5LX 4Z7OE 1T80A 1KC8C 2NZOA 3QHZL 2GSIB 4PV9B 3MNMA 3N50A 1ZA6A 1SM3L 3SODB 1GMIA 3HZYA 2IJ0C 3BOVA 4YX2L 1LTID 5AG8A 5AL0A 2VISB 2OQJB 2VABB 1URZA 2ZWKA 4JY4B 5FX3A 1HH9A 4H2CA 4XNBA 1QTSA 3HG5A 4A3EG 1RIHH 3L3DA 3QNZA 3S5LB 4RBPH 1M9WA 4ES9A 1K5WA 3MR9A 2VQTA 4ZZKA 4JK1C 4OF6A 5BUGA 4N2MA 3GTJH 3LZOA 5E8OA 1KXHA 4Z3JA 5GS1B 1QO3A 1L1OA 4G42B 1ED3A 1BREA 3G5YA 3AAZA 3IU4L 1CK0H 4BUHA 1TQCC 1MZYA 1TQOA 1DBBL 3G5ZB 3NCWA 5FF6B 2J88H 5J5EA 1HXYD 4XNYL 2F5AL 4AQ8A 1T7VA 3QFJA 5CFAA 3K71B 1W72A 2AQ1A 5H4ZA 1XPOA 3AMKA 5JHDB 2E5EA 1BBXC 2B39A 1N0XH 1WTWA 4GT0A 1MFBL 3IXTA 4O58H 2D5DA 3PHSA 1TF4A 4WHTB 3FTWA 5BZWB 3F7RA 1CL7L 3EO0A 5HTSA 4PJ8A 4UM8B 1R5WB 3PGCB 4Y5XA 2CLVA 5AZUA 5LBVA 3ARBA 5CGKA 2NB0A 3KDFB 1MY5A 3EJTA 2ADIA 3GIZH 4JFFA 4LEOB 4MMXA 4ODHL 2V9QA 3ATBA 4Y16C 3MLSH 4PJ8D 1ETJA 1EEUA 1FNVA 3TA3D 3D85A 1WLHA 4R4FL 3G5XA 3O6MH 2R92G 2KDYA 4WJKB 1JB7A 2OYKA 3STLA 1JGLL 2X53A 4GLVB 3DPBA 3V96A 4ABNA 1TNNA 4N0UE 4MXVE 3SGKC 5EOQL 5HHXL 3ROOB 4HSVA 2NPLX 2L7JA 2IPKA 2WXFA 3JV4A 4K8RL 4IJTA 4OM0L 5DU7A 4UP7A 5I5RA 2KC0A 5AZEL 4QYOA 2GTWA 3K2MC 4TUOA 1OGTB 5IW6B 2JF1A 3Q3GA 3MROA 3QFJE 1MELA 1RK1A 3O4LB 5D1QA 4A3KH 4Z9KB 3N52A 1SNDA 2YU9B 3O3BA 5IMLB 5E99H 4JQVC 4QF1B 3W11C 2LU4A 3HHSA 4UV4H 3VXME 1LEGA 4X4XB 4XNXL 4LGPB 4DP9X 3PHOA 1LHZA 1E3ZA 4NDXA 3BVWA 1PRTB 1YN7B 5I2YA 4BY7B 1OTTC 3TZVC 3HHRB 4G70B 4TXVB 5T1KA 3AU7A 2IAMC 2JB6A 3I3BA 3MXWH 2FQEA 4OBRA 1CS6A 3RZDH 3O4OC 4EIGB 3P0VH 4QRSB 1MXGA 1GOHA 1RHHA 2R6GA 1RUAL 4DV2L 3KPRE 4J12A 5I15H 3K6SA 3JWDC 4L9LC 1MNNA 2DF3A 3DX4A 2L11A 4WDIA 1DJXA 3EFFA 3TU6A 2P46B 4A3GH 4KMQA 4BJLA 5IKCB 3MO1A 4JHZA 3LTVA 5F2FA 2D7QA 2B2VC 3EGXA 4GP5B 1RUQL 1YMMD 2J8UF 1ZYRC 2G4EA 5C3EB 4NZTL 1TWHH 3MUGB 2IQ9L 2ZTBA 4J8QA 3IU3A 4LPYA 1L0WA 4GAAA 3N06B 4ZXBD 2BRRL 2HCZX 3D0LA 3R18A 1OZUA 2VXWA 1Y6MR 5B39A 1HXKA 4I1PA 3TBWB 3VXSE 3EYVA 4IU2B 3X3GL 4DR3Q 3GD7A 5IHBA 2K32A 3TIDA 1DYQA 4YX2H 4X7SL 2ZJRA 2E8GA 2A8VA 3GC3A 4YAQA 4XVJH 4XXWC 2F03A 3MJ6A 3ZTDC 4PJCE 3SJVE 3MV01 4J3TA 4BQ9A 4DGYH 4KNQA 2FIKA 1OT1A 1QFWH 1U41A 1UM4H 4C83B 2RCSH 1AO7B 4UT6L 1X5GA 1S7RA 1C8CA 3I4NH 5KYWA 1REIA 1RIUH 2VC2B 4A3JH 1W15A 4N0RA 4L8DA 5E1AA 3VGAC 3UAAA 2ZUYA 1Z6JT 2JCCB 1CTNA 4JM0A 1F1GA 3VXOA 5L2KB 1W0VA 3BP4A 3D0VB 3C09B 1BDYA 4XHJD 4HWUA 3RLFA 1L9SA 2EE9A 4WJ5B 4HCIA 2JJSA 3ZUCA 2IOMA 4LCYA 2E8ZA 3TV3H 4GMSL 3O13A 1WJ3A 3WTYA 4XCNB 4ENEC 2BS71 1RP9A 4PZ8A 2CJ3A 1U4RA 5LO7A 3U6RA 1UEMA 3LV3A 3JTBA 3PIQB 2DQ6A 4MQ7A 5D14A 1CFQA 1CL7I 3U7YH 3GQBA 1AZQA 2G75A 4JRXA 4A6YL 3QZWG 4PRBB 5EIQA 3CFNA 1U8QB 5IIEB 2QSTA 3U7WH 4ZKBB 1UOVA 1XCXA 3D9AH 2Q6WA 2A5UA 3ZKXB 4OKDA 2HG5A 3KW7A 5IK3B 4ZG1A 2YPKB 3O6FB 5I6MA 4UTBH 4WGVB 1UACL 4OXPA 4CC4C 2TSBA 4IURA 2E9BA 1ETA1 2R1XA 3BVVA 4YK4C 5GGQH 5IP9G 1EBPA 4PJ7F 3AWEA 3IMRA 4QUFA 2ZXQA 2F5BL 3R7RA 2EE0A 3GZPA 1AGDB 5D1XA 4MMZC 3NSFA 1I4QA 2C1OB 1ZHLA 4PVMA 3NJJA 3X1EA 1NCHA 3UAJD 2PPBC 3DARA 1EEQA 4XP6H 5LNEA 1WHOA 5ICZA 4ERSH 1ASZA 2EEXA 5FUCC 4CSZA 3MA7A 2KCNA 5CLYA 3NOIA 4JHBA 3BVUA 3O6FD 4JDEB 3BRDA 4UTAH 1RZKH 4NQXA 4BGLA 2ZXRA 4FHBD 2OTJA 5IY5B 4RCNA 4OCSL 1AGCB 32C2A 3GO5A 1NMFA 5T3XE 5KG9B 3L2LA 4DR5L 2G0KA 4HJJH 4XPGH 5TDPB 5DJ6B 1BXTA 1JZ7A 1IBGH 3M4PA 2CO3A 4PTUB 1NGQH 4MA1C 4U3SA 2ZUUA 2C5DC 4ZPVA 1F4WH 2QZ5A 1AVAA 4MMYB 4YBQD 3FL7A 3ATDA 1X5IA 3M7GA 3LPFA 4R96B 1SE8A 1HQRA 2XG5A 4JQIA 1V9PA 2NYZA 1UVQB 2EYRA 2D2OA 3I4MH 1NIEA 4U3SB 3EH3B 5DLML 3VYNA 5IWLC 1QFWI 1HHKB 4PP2B 2A7BA 3TBBA 1FV1A 1U3HB 1I4GA 2R0WL 1TJHH 3VXMA 1A2YA 3I70A 5CD3B 1GZPB 3O8XD 2BDOA 3CGTA 1AI1H 4G3YH 2XN9C 4LLVA 2MO1A 1E50A 1SOKA 1E5AA 4HG4J 3DUSA 3HZ3A 3PABB 2GG1A 2ENPA 2HUGA 2XRAH 3DWAA 1IL2A 4ZMTA 2BNRD 2YUXA 5J7CC 2VZOA 1JTOA 5KYWB 2EIJB 2AVFA 4XTRC 3PQYB 3P9MA 1XGQB 4XVSH 2DNCA 1ZHLB 2UXBQ 4X98B 2UXCQ 5DRNA 1G5GA 3ML9A 1FJ1A 5DHYA 4KO7A 3LZPA 1TS5A 3UADA 3NZ8B 1X65A 2E7BA 3UZVA 2B1AL 5I6XC 1HWHB 3C08L 3QZOA 1FLRL 5GROA 2NW2A 2PI2E 1F45A 1XD1A 4WJ5A 1OM3L 1IT9H 4KC3B 4GJTB 3EYFA 1KTKA 2WLHA 3UDXA 3PDOA 2IGFL 1N9WA 4OIFA 5ITBL 2EDXA 4A2MA 3GPSA 1XB6A 3IGLA 1MXDA 2FTAA 1BVOA 2UZXB 3QH3A 2N0MA 1MFNA 1BZ7A 5JOPE 1D5XB 1H95A 1I1AC 2OQJA 2QV2A 2VABA 3F5WA 3QHTC 3CFTA 4KRPD 4Q2ZA 1NGPH 2J57A 4ZXBA 5LG6A 2DEXX 3BSHA 3MRBB 5CU9A 3WHXB 5F93C 4HWEL 5CLXA 2IEPA 4MN3A 3Q0AA 2OSXA 3B7RL 3B2DC 2XN0A 2X1PA 3BWAB 2C9UA 2J72A 5E5LA 4M43L 4WTWA 3ZXAC 2Q87A 4LSUL 5JW3H 5E4AA 3TEZA 4QDGA 1UXSA 2BVYA 4HK3N 4XP1H 5LBSL 3IJYB 1OZTG 1U2YA 5HGDB 1P6FA 2R1YB 3LIZH 4KVCH 5HDQH 1SXZA 3QRGH 5KSUA 4AZ8A 3BP4B 2CBQA 2FATL 3K7AH 4YDMA 3AY4A 4Y2NA 1T2XA 1IFRA 1U8KB 2Q76A 2HH0L 2APBA 4O02L 4LVOB 4GN4B 3UE0A 1UACH 2IV8A 1VENA 4IS6A 4DV7Q 1Y1WB 4POUB 4X64Q 5FM5O 2XVBA 4P2CB 3LKQA 3HRPA 4KI5C 4KTYA 4M5SA 3HAEG 3N9GH 1B6DA 1ZEAL 3MLWH 4Y1AD 3O6LH 3DX6A 3I74A 4B3TQ 3ABGA 5AVSB 4AV5A 4TQPA 3VDAA 4F7CA 5JUEL 4DR1L 2A6DA 2KQMA 2JA6G 3GSVB 3MRHA 3ARDD 3VXNB 2E6JA 1I8MA 2ICWA 3ND9A 1NJ9B 1W2KT 3RGVB 1KB5B 1N68A 2YQGA 4GSDH 4DR2L 1RUQH 2HFFB 3TZDA 2EIKB 5MI0C 1QA9A 2WPGA 3IRCA 4WTQA 5D7LB 4EF3A 5LHDA 3DPBB 1HESA 1TVHB 3PGZA 4OGQC 4B60A 4W9GC 1ONQB 3I2ZA 2AKRB 3Q9QA 4PG2A 5D7KD 5DFTA 3WV0A 5KOMC 4XBPB 3FKIH 5DD5H 1IKNC 1GAFH 1XMOQ 2HX9A 3GJEB 3LHPH 2D3VA 4QRQA 5BNXD 2E2HB 2XWTA 3GRBA 3MROB 2FH6A 3O3BB 4HZ1A 5IMLA 5FYLD 1DE4B 4Z76A 3UZQA 2CBMA 1KJ2H 4V1DE 4R90H 5EEUA 4K5XA 4LSVL 5D7IB 1SE4A 4GI6A 1G7IA 3BAWA 1NC4A 1RULL 3W2DH 4N86A 2LAAA 5SWZB 4JRXE 4J3WA 1LT3D 1MI2A 4XC1L 1BXUA 4XAWH 4H8UA 4MAUH 2VN6A 4JOIA 4IM8A 1HZKA 3GXFA 4GRLB 2HJLB 4KK9C 4PV8A 4JZJB 1UH2A 2R23A 1BQ5A 3HN5A 3VDYA 4KK7A 1IBKL 1CKNA 4YBQC 5F7AA 3CKIB 3A4AA 4UYQA 2DMKA 1F3DH 3Q3GB 4FJ6A 3MN8A 1D1IA 1CUKA 4ZOBA 4KY5A 2BSTA 3UAEA 3KPPB 1OSZB 3MOBH 4L0ZA 4GBXB 1SN8A 4M7LT 4NC0B 4ETQB 3PUCA 4P5KB 2ZSWA 1MG2C 2F3WA 4K2LA 3QFJB 1A63A 1JFHA 2QKIC 1LO4L 5DVNA 4Y2DB 1WTGT 4QOKB 1YNLH 2JA7G 1ZJAA 5EZLB 1F56A 3GSWB 2KOLA 3SDCC 4OJDH 1N8OE 2WKOA 4L1BA 4PRIE 4Q74A 5ESAA 1MJEA 4NUMA 4WFN3 4S1RH 5I4DA 2NR6C 3ME0A 2VUYA 1PZ3A 4UTCA 3HKZE 4LVHB 3HAEB 5HDRA 4JFZL 2CQOA 3MHZA 4JZNA 4YL9A 1RL2A 5GS2D 1ZGLA 5HHQB 3KPPA 2EY6A 1B3QA 2CHDA 4Z7UE 4KK5D 2JFCA 4KJQD 1P53A 2HQLA 1EHKB 1LTBD 4HUUB 5SX5K 3C6LC 3Q23A 3O6KL 2K3TA 3IDJB 2XJKA 4GIPD 3IVKB 1A14L 3CMAA 2X9ZA 5D6CB 3D3VA 4A3FH 1NFDB 2Y1VA 3RJDA 5DDHB 3CN0A 3SOBH 4OWWB 2ZJPA 1HUMA 3P0YH 2R27A 3QZLA 2H45A 4PJFF 5K36H 4WU5B 3GIZL 4UAIA 4H7BA 1SNPA 3ARDA 3DC0A 2XWJA 4JRYE 1PKQA 1F4WL 1LTXA 3R19A 1ZWIA 1CE1L 4YHOL 2C9AA 2VT0A 3C6SB 4J4PC 5LXGH 5JZ7C 2EXDA 4IRSD 3TVMC 1YEIL 4KXAA 3PWUB 1UD5A 2CJUH 2QGCA 4FEIA 2D7PA 3DOSB 5CN2A 5SWSE 4CMMB 5BJTB 3D33A 4YHZH 1JFQL 5JQIB 2WAQA 1CDUA 2CU9A 4RVBA 4Z3EA 3SDDB 4NHCH 3MXGA 1JPTL 2CIIB 5EN3A 2PWGA 3AQXA 1J9RA 4O1NA 3VG9C 2EZ0D 5SV4A 3ZTNL 2XXGA 5CEXB 1QRKA 4XP9H 2RSNA 1XF4B 2DM2A 1YPZE 4IKNA 5ANHA 4F9PC 2Z3FA 5KYXA 5D7IE 3DKHA 1EVTC 1WQVT 1R4XA 1S8DB 1AHKA 3QJOA 4OLWH 3S88H 4RZCA 2PQAA 4Z5RA 3MRHB 4ZFFB 5LMNQ 3OG6B 1CZGA 4IIQB 3OGCA 4CADB 4XXDB 2FJFB 1DSWA 4J6RH 1X5MA 2DAVA 3OMGA 2V5SA 4L4TD 4V1DD 4OR1A 5AW4B 3WY3A 5CYUA 2F18A 2G5UA 4RGMC 3IS0X 4MXVF 4LAJH 3OB0K 4XZUA 4BDVB 2KVMA 3BQUB 4KGJA 2DY7A 1NBZB 3NA9L 3OJ2C 3TO4A 4OZIF 4ZSOB 1QILA 1G6RH 1OM9A 2XZQH 4I13B 4L4VB 3WFEL 4AEHL 4LF4Q 3FB7A 5IB3A 4FL4C 1T66C 3KGUA 3LKOB 2AJ3A 1BQRA 2OJZH 1X5FA 2CIKA 1MI5D 4PRPD 1WZKA 4PG2C 1N3NB 1YHAA 3V6BR 3NIDB 2VNUD 4Z6AT 1MH5A 1MRDH 4JDZB 3IXAB 3HOWG 4XRCA 3QDAA 2Y7OA 4WW2F 3JZYA 3KW8A 3TBTA 2Z65C 2CA3A 4PJCF 5DYOA 1ZPUA 2D9QB 1CCZA 1NM9A 1W8NA 4GW4A 4FN0A 3VXMD 5M3MH 4PWGA 4KKQA 2VB2X 3SHLA 4JKWA 1XB8A 4ELKA 4P4KC 4HUNB 2K33A 5JJIA 2VM4A 4AEIL 3ZDWA 4RMWA 3CAFA 1UM4L 1KJMA 1ZD6A 4S0HA 2HRPL 3QSKB 1YNJC 1R24A 3PJSA 4FADA 3Q06A 1GO3E 1HAWA 4TNWK 2X70A 5JA8B 1DUZA 4QHKI 4NP5A 1EBAA 5E51A 4A93B 1BXVA 1U8OA 4DUWA 3AS2A 3ETTA 2PYFB 4HCGA 4A3GG 1ZCRA 1D5BA 1U95B 3RIAK 3MBED 4BZ1L 4Z7VA 1VQ5A 4DR7Q 4IDJH 3GTNA 2WCSA 4HF5H 4CNIA 1SYVB 4R83A 1T1XA 3B1TA 3SBPA 4DTGH 1AY1L 1BLNB 2F0PA 3QZWB 4XCCL 5L0QB 5C07A 2EABA 4G1MB 2NNAB 2Z8RA 5FOBB 3QARA 3SDCD 4BFBD 2B9BA 1SFHA 1OGAD 3FQ2A 4N2CA 1QZ1A 4X8CA 5EUKB 1ZLWK 2NR6D 2K45A 1XR8A 1MAML 5EEYA 3SDCA 3QDJB 1T6BX 4RIRB 4OIAA 4R84A 4NB7A 2ADGA 3MNVA 1SJEB 5IY0A 4JFEA 1XGTB 4Q5VA 5EU4A 2R7ZH 3ARTA 5CBAE 1E3XA 1Q8MA 3WFCL 1CFMA 3VMPA 1TTFA 2X40A 2BLFA 2ZUWA 2PYED 2LTQC 1HHJB 1F8TH 2WLNA 1B0WA 3TZUA 3MGTB 3JUYA 3QIAA 1UT1A 3T3MF 4Y8AA 3WJJA 2X41A 2CWRA 4WKXA 1GUNA 1X7QA 2L0CA 5G4MA 1D9KD 4HHWA 3ATEA 4AQ1C 1TT2A 4PG3A 3P02A 4HXBH 4H1LG 2MJ8A 2N88A 4K07A 2W0FA 1FL5A 4OQTL 4DP4X 4M1GH 3T0EB 3QZNA 2E0PA 3F58H 3TYGH 4CJ1A 3PSIA 3GRWL 4PJHA 25C8L 2CKNA 4X8JB 3A6BL 1G7PA 1DSYA 4YHMH 1ITCA 5DEJA 1CJYA 1ILUA 3CFUA 3C5ZB 2IL8A 3WNLA 2R0LL 2JNZA 4FKKA 5BV7H 1K4CA 3OR6B 1JHLH 3MA9H 1BF5A 5D7LA 4CC0A 3ZDZF 3L3IA 1QA9B 3QR0A 1QW9A 3LEYL 2P8PB 4KJYA 3I9GL 2F54A 4RAHA 1UJ3C 5DZAA 5T3ZL 1ACYH 1WT5C 3HLAA 1TEFA 2YGQA 4JFOB 5AAMC 3U1SL 1UXSB 1JWUB 3LCYA 4N2HA 3VXSA 2ZCLH 2ZE0A 4FG0A 4J3OF 3T4YB 3NRPA 3BAEH 2KENA 2B3RA 4HKZA 1S2EA 4PHZA 1FH5L 2ODIA 2MHVA 2DW5A 3RNKA 3VI4F 3TN0B 5ISZB 5E4IA 2WKCA 2GB2A 4ZX5A 4TQIA 4KKTA 3GTOH 4J23A 4LSTH 5FGRA 3S3DB 1FUNA 3E8VA 5I18H 6PCYA 3EKCA 5CCKH 2AJZB 1Q82C 1KELH 2JKNA 3G71A 1ZVSA 4Y4KA 3ZTEA 2NWGA 2BNRE 3I6GB 4NO0B 4YS4A 1YMMA 2P5PA 2NY7L 3Q8AA 4LCYB 5FJ8H 4OLYL 1KGJA 1LM8V 3Q43A 2FSEA 2N49A 2PMZA 4K9EC 4YIJA 3BGFC 4X6FA 2LAGB 2IX1A 3DROB 3KDMA 3VH8B 3AFQA 3AMUA 2R2CA 4LGRB 3MFFB 1TZHA 3GB7B 4MWFB 1KDAA 4HR7B 1HCFX 1V54B 3GMQA 2VC2H 1E90A 5LCVA 2A77L 1ET7A 4DVRL 5E8NA 1I5FA 1X5XA 1DEEA 2J6WA 4ZUIA 5M5WB 4WK4B 1Z9SA 1C08B 1HWGB 2YWYA 4F5CA 1HYSD 2NY4D 2O2LD 1DFXA 2X44D 1QR1A 2H4OA 2ENQA 4OGZA 3A4EA 3JYBA 3BC9A 2OMZA 2EOTA 5ALCH 5LN4A 1U58B 1TVXA 2GYSA 4JG0L 4QRPB 2CH4W 2R61A 3ZDXE 4G3YL 2HT3C 1R3KB 1AIFA 2AGJH 1DLHA 2VYRE 4ODXB 3TBCA 4XCCH 3ZRFC 1NZRA 4B9KC 1SEQH 4CC4A 3DX8A 1WBZB 1ULVA 1CLVA 4G80B 3S15H 4CBVA 1UA3A 4OZHE 5CP3A 5MEND 3SE8L 2PYEA 1PZID 1UB6B 1X5HA 5E08H 4NZFA 1N7ML 4Q4IA 1MHPH 4C4KT 1KBGH 1KN2L 4FNQA 3TN0A 1CBVH 3OKMB 1E4KA 3C09C 2E56A 3QYNA 4MJ5B 4UT7H 4BK8A 3DUSB 4R4OA 4O00A 4AY0A 1KENH 2AJUL 3VFOA 3PS6A 2NY0B 3E1F1 4IN3A 4JKKA 4EN3B 3R0NA 4PIRF 1OARH 2RA4A 3DX0A 3QP3A 5D4HA 4X2UA 5B4MC 3VFPB 3C75A 1KIPB 4PJAA 1F18A 3SE3C 3F12B 4WEBL 2M1KA 4GN5A 3MOQA 4M8RA 3QUKB 3VFVB 2JQZA 3ZE1E 1RK0B 4B9CA 4DP2X 2H5XA 4GQ9H 3DO3A 2HUEA 1IFGA 3S35X 2X4NA 2VJ8A 1AN8A 1IKFH 4U3HA 5CMAA 2O5ZL 1CA5A 4WEMB 1MWAL 2RDHA 1SDFA 3HVNA 4FX5A 3DJRA 4LVEA 3TPKA 4LLVB 2YS4A 3IDMB 4N2FA 5KVDL 4HCEA 1UM6L 4WCYH 5DLMH 3QQ9C 3GTLH 4EN2A 2EH7L 3G6JF 1J5EQ 1ASYA 3NN8B 1PRTD 4YNYB 1DBAL 3SBWA 4DNTB 2NVTB 1FO0B 2PETA 3I6SA 2NT0A 1U33A 3C5SB 4Y7NB 5IHUH 2XHNA 5DI8B 1KXVA 1SE2A 1T3FA 2JJTA 4A3CG 3DGGA 1DJHA 3IDUA 4HUKB 4M6NL 4MCYA 4U1GB 5D72L 4NCDA 2NX5B 5MEQA 3TL5A 1CICC 1ICTA 3MUZ1 2VXSH 2VL4A 3PQYE 3QIBD 3RUZA 1BBDL 3KYMB 4HIQA 5I9QB 3CZNA 4HW6A 4IUNA 4GY4A 2W92A 4X6DF 2YSSB 5IOCA 1S7UB 1Y8NB 1NR2A 3PIP3 1FH5H 3L5WA 5IFJB 1CHPD 4K8IA 1I85A 4FD0A 4PLJC 4LLWB 2NY5L 1PH1A 4POGA 4PJ6A 5HHOB 2KUMA 2L12A 1IFHL 1W0VB 5ELOA 5FYJU 4C4KO 1YVCA 4JQVA 1OPGL 3HOUH 3QYCA 2CKBH 3EDFA 4O2FB 3BVDB 2ADFH 3N41F 1U8HB 2VXQL 4NXML 1QLRA 4LF6L 2EXWC 1MCLA 2V7HB 3QG7H 5CEZL 3VXUA 3CU1A 3EYQC 1BCPD 3U25A 2HMID 4TOYL 4FQLH 1AD0B 2H1EA 4BBRB 3WEMA 3T2NL 1EFXA 2WUCH 3EA6A 3FMGH 1ENAA 1FNAA 1IGTA 4DAYA 3SEPA 4MQ7B 3HS0B 4P2RB 1QHOA 4YL4A 3WIIL 2DY2A 3PWVB 3BEVB 1HJBC 1SMXA 4LIQL 4OD3H 2EVFA 2JV6A 2E5LL 2J4WL 3QWRD 4ABQA 5F0JB 5KYLA 1YDPB 2F7PA 4Z95H 2FEEL 4MTNA 5HHNA 5C0XG 1O78A 1WS7A 3QEQD 1NCWH 3CDZA 1DANU 3S5LA 1K28A 1RUPL 3J7YW 3S1MH 5E70A 4ZW7A 3TYFB 2GIXA 1RURH 3BPOB 4PV1C 2DBLL 1WTQA 2WY3B 1DSFH 4IRJA 4K5VA 2KBNA 2B0SL 3KGSA 4JY5H 5D7JB 1R33A 2XXMB 1KULA 4FF1A 2EDJA 2CVRA 3F05A 3AADB 1GJWA 2XWEA 2B5IC 4FQ1H 1K5NA 3VH8A 1BF8A 5B21A 1BMZA 1U21A 2HJFB 3BPCB 4XMPH 4IRSA 2OJEA 3L54A 4QRRB 1BM3H 2V37A 5CHNB 3M1OA 4QHPA 2VB3X 1Z5LB 3F65A 4MZ3A 5I6PA 1SDYA 3UZQB 1T7WA 2WSKA 2SNSA 3LS4H 3SGEH 1QR1B 5G55A 1J0KA 2V7NB 2EDRA 1GS8A 1VQGA 2E27H 2QR0B 1OLZA 2VZAA 2EDYA 2ROXA 2VW6A 3P54A 4UOQA 2PUQT 3VYRA 4N8UA 2QQQA 4PBVC 1E6JH 1KZQA 1S7SA 2BP0B 3DWQA 4HGMA 1AO7D 4LE8A 2KYIA 4PNYA 1HJCA 3NCMA 3ONAB 3PJLA 4X6FB 4QXGL 4ZMWA 4CC1A 1G51A 3MEHA 5T1MB 1SXBA 5CEZE 4AGOA 1EJ6A 3N04A 1FL6A 3UOAB 3NIFE 1FDLL 5HHMB 5ANMA 4FJYA 4Y9EA 5E2TL 3UBFA 4OWXB 3LZFL 3L7EA 1KB9J 1XF5B 3H4HA 5I1GH 3QIUA 1KXTA 1BP3B 3KYKH 2BS9A 1MZZA 4QHUA 3VXRB 4APXB 3JV6B 5DC0A 1CLZH 4N90E 5HURA 1Y1VB 1STYA 4LSTL 2L4OA 5DQJA 1QASA 4GMTL 4RGTA 5KBMA 5T1GA 3VR4A 1EQVA 1V1OA 1MVUB 3GSOB 4ZTOH 4A2DA 4DOHB 5A2IH 4R4BB 5D93B 3DTUB 1H6UA 1SHMA 3MRQB 5JDSA 3EBHA 2AUKA 3LKPA 5EV7A 4N9PA 1S3OA 4MAUL 5JNYB 4A3FG 2Q9OA 4MNQE 4PWEA 4ZYKB 2C9RA 4UPAA 2VMFA 3T8MA 2CLVB 1K0SA 4A3LH 4APQC 2YQ2A 2OCEA 1BVNT 3K5RA 3AT0A 4Y16D 3MXPA 4FLRA 4FF3A 4PJ8C 4Y5XC 3FUFA 5CMDA 3S4SG 1FVDB 4DPGA 1PLGL 2IH1A 1ZANL 1K4CB 2X2IA 3NWSA 3R8QA 3S8FB 4DVRH 1FD7D 2K1BA 4OIJA 5LMNW 5D96C 1BECA 3BXNA 3RUGA 5IW3A 1QZNA 2DKMA 4NERA 1IQDB 1YNTF 1PRTC 5GS0L 3ZGIA 3TLRA 1E8XA 1TS2A 4IRZH 2GY7B 3TZVB 1JFQH 5CKAA 2EO9A 1K83H 2UY6B 5C08D 3QWOA 4NZ8A 4KTGA 2K4KA 3A67L 3H55A 1MOEA 4XC3L 4BELD 1JK9A 4N9GB 1QX1A 3N6YA 5C0EA 1JI1A 3O6ML 5K9JH 1DFBH 1RU9H 2X42A 3FNKA 3HNVH 5I1KH 2BWQA 3ZYZA 5F88B 4OT1H 3S9DB 3QIBC 3T51B 1GOFA 1MJ8L 2GCYB 3VWJD 2EXSA 2OXHB 2XNAA 4A66A 2VDNB 1ECYA 3FAXA 3NPZB 5DJAA 4N0CC 3CPFA 2A9NH 1V8QA 2ZICA 1W80A 3PV6B 3QNXA 1VESA 4N68A 1PGRB 2D0HA 1EERB 4NUGL 4LKXB 4G5ZL 4HJ0C 4G8GA 4OQ1A 2Z6FA 2LVCA 3TZVD 3VFNA 5M95B 3CVHH 4N1HB 2E2IB 1S5HA 5DT1H 4BA0A 3M86A 3FFOA 3K5MA 4HIDA 15C8L 2GI7A 3KLAB 3B5HA 4V0BA 1FG2B 3FO1A 3GV6A 1PTOF 1EAQA 2W81C 3HMWH 4GLRI 4BZ2H 1AZCA 1A9BA 4HWZA 2BHYA 4HCFA 2VQEQ 1OSPL 1XSIA 2XN9A 3PJSB 1H9VA 6FABH 4PGBB 1YJDC 4LOUD 2JA7H 1PEZA 3KPSB 3NACL 1HKLH 3LKNA 2FLBT 1GVPA 4J3SA 5F7UA 2BZCA 4E5XA 1GW0A 3E5SA 2CKBA 4PGEB 1MJUL 1KGYE 3T65B 1WWBX 4LSSL 2R56H 2ZOLB 4J8RB 4IRZA 2JK8A 1P7KB 5E2VH 5IJVB 1IGYA 3QDGD 2WZ6A 5HYSB 4XNQB 4BHUA 5KSAD 5ABDE 2E27L 2O5IC 2FWOA 2XKSA 2ZUXA 3DX9A 4ODWB 4AYID 2YV5A 4JKMA 4LLUA 4N2OA 5K9KB 4KITB 2J43A 1OAQH 2YHGA 2C26A 2CO1A 1ICWA 2UXVA 4LL1A 4FF4A 1CFTA 2NY3B 3HEIB 4O2CA 1KPUB 1PS3A 1CMOA 3WDJA 2W91A 2PXYD 2Z1KA 3LXUX 2P5ED 3Q8FA 3CN1A 1BLIA 4MJ4A 4AEIH 3K72B 2OYPA 4QT5B 5B7FA 4OFQA 5DSCB 3B2XA 4YHHQ 4PJXE 3RZDB 3VR5A 2R1WA 1YPZF 4Y1AA 4Z7WA 5CZKA 4L48A 3KPNB 4RSYA 3TO4B 1F41A 3UTSA 5C0GA 4JOIC 5LG1A 4FZEH 2H32H 3QJFB 3CNKA 1VQ6A 4JI5Q 2CZNA 3I85A 4MAZA 2MMXA 4RKBA 2JXMA 2ZCKH 2AV7A 4JFHD 5KVFE 4IDJL 2M2LA 5H35B 4DNRB 4DV7L 4BY1H 4Z3GA 4JI8L 1OAXH 1QSEA 3RFZC 3GI9L 2ZKWA 3BX7C 4JLRA 3L17A 4FTDA 2CIKB 2YJQA 4F7TB 4EI5C 3NEXA 3BZDB 4HHAB 3QEGL 3N40P 4XXCC 5KVGE 2EYHA 2QQKH 3VD9A 4QHMA 1MWAA 2YD5A 1OQOA 3KYHC 1B4JH 2P44B 3FF7A 1VB9A 4GMSH 1ORSB 2Z91B 1SN0A 3T2PA 4WZ9A 3R8BB 1OP3K 4TVPL 2C3XA 3DLLA 3HHMA 2JJTC 3T3MB 4PJGA 1IM9B 4OM1L 5B8CC 3WLBB 3CFBA 3IETA 3VFMA 4A7GA 2FO1A 2ZT9C 3LMJL 5DD3L 2R0ZL 3DK2A 2WXOA 4YO0A 4O02B 5EA0H 1HTPA 4AI7A 1E2VA 3QDME 4Z7UF 4A3BB 3GJFH 4HC1A 5G3LD 1GD7A 3FQRB 3DXAA 1TR5A 5KVFL 4FQ1L 3D4DA 4XGZA 4QXWA 2F61A 3CV5A 1HOCA 3MJ8B 2EYSB 2AS5M 4G7VH 5AFWA 2MPMA 5IESL 4DWHA 2RBMA 5CEYA 4AYDC 3E6FA 4QL5A 2YPLA 4JRFA 1EH9A 4G7OC 4UM9B 4PHXA 5EN2A 3RAJH 4NYLB 3HOWH 1QUPA 4XP6L 1JCKA 3OF6A 4OLXH 1SYEA 3KF6A 1K2DA 3L7ZC 1V3LA 3PE9A 5D70L 3RTQB 3WE6B 4DTGL 2JCCE 4AIZB 3V6ZA 1PYWD 3S3CB 1E4XH 4X4YB 3NMEA 5C2BL 3VXRE 3N91A 3MXNB 4GT7A 4WU5A 3EZ8A 1V43A 5LWYL 2A5HA 3I3CA 1NICA 2BNQB 3BT0A 2D31B 2AQ3B 5C08A 4DV1L 1CKOA 1T89A 3VXPB 4MNGA 4D3CL 2CRZA 1WPCA 4NRYA 5HD8C 3JTTA 3LNFA 4HU8A 4JGJA 4Y1TA 4P2YA 4MKTA 4N1CA 3LN4B 2WYZA 1TFHA 3MBWB 5LMUQ 2MHAA 1NCGA 2K03A 1KC5H 4I89A 4J28A 3BRGC 4X6EB 2CWPA 5F0PB 2AXFA 2Q0ZX 3DPDA 4PG9A 1AHMA 5TF1L 1IGJB 2EQDA 1PZSA 4QGUA 4HCRL 4JCLA 5K9OB 2LU5A 5EU3A 2EJ1A 1GJXA 3IJHA 3HFFA 5CP7A 4NZJA 4M93C 4FYDA 3RURA 3A54A 1AZPA 1N5YH 4P46D 4X5WB 1P5UB 1DOMA 3KPRB 1UFGA 4Q89A 3IJSB 3QQ4A 4NN5B 3PP4H 5L0QC 3GEFA 1J8IA 4IOCA 4I0PA 4O58L 1BWMA 2ZX6A 3AACA 3ZT6A 1G9MH 5ISZE 2MTPA 3V6FA 3DV6A 2ZUTA 4LB8A 1X5AA 5KYUB 3V0WH 4BCZA 1F3RB 4B3EA 3LXCA 3KBHE 3ARQA 1I1AD 2D3LA 3Q22A 4MA7L 4A7SA 4P0DA 1ILPA 2YA1A 4UDTA 2BHZA 1IM3A 4NN6B 3BN9C 3WSQH 5KSBA 4WJG3 1TXYA 1YNKH 3PWUA 3CPUA 4JM4H 2FX9H 1WBXA 2BXZA 1TY0A 2VDMB 3EGDB 2HX8A 1XMOL 5D2NB 2GJZA 2H47C 3GMOA 2QHRH 4KOCA 3GTQB 1DUYB 2YD8A 3UIZA 5FB8A 4OLVL 5DHVB 3TEYA 3S5ZA 2XTLA 3EDDA 4JKNA 4IOAA 3GZQA 3S3BB 2IXQB 2IADB 3WUWA 3LEXB 4DO4A 5CZXC 1U8LB 5T5NF 2NVQB 5D6CA 4M6NH 4A37A 4DN4H 3T16A 1DVXA 4IGBB 2XZCH 5MEPB 2M83A 5HI4C 3OHXB 3ZDXB 3CSPA 3VFNB 4KI5D 4F7CB 4KZEL 2OL3L 1OXTA 3VE0B 4DV6L 4EI5D 4J2QA 4DKFH 1OE2A 4L3EB 5IP9H 1C7SA 2IFFL 2UZYB 1LJMA 4MGXA 4PY7A 4U6HA 1DDTA 3Q01A 4XR8C 1EHXA 1PQZA 4EI5A 2D0OA 5LL6S 1HNWL 3D4CA 4G8FA 5EZOL 5T1JA 1A9BB 3VM7A 3MJ7A 5BN5A 4NO2A 4HJGA 4KDWA 4PUBL 1I3GH 3LAFA 1U8CA 3QEQA 2QDVA 3G6DH 1MFAH 4L1TA 4AYMC 4JG2A 4KTAA 5C3XA 1I8KA 2XBZA 4CVZB 4OIBA 3W9EB 4DAGH 2ZJQA 1OV8A 5IM7A 3X3FL 4Z3FA 1I7UB 2F0CA 5E2UH 2C4FU 2I9TA 2IHFA 4BXVA 4XCYA 3RE0A 4PJDE 4JL1A 4OD3L 1FYTB 4BZ1A 2DD8H 4LRIA 2AXGB 4JRWA 4I9WD 3UYRH 4FJZA 2GCYA 1WDAA 5JHDD 2PP9A 5DEHA 4JV5L 1QLEH 3HUJE 3QEQE 1N64H 4N8FA 1T7YA 1OB1B 5CJQL 1ASQA 2Q7YB 5FO7A 1N7MH 4PCYA 4PGDB 5JHMA 1RHPA 2XU9A 2F7RA 4MHEA 1GYCA 3MV7A 4H88H 3RLSA 4F2EA 4K3DH 4Z1PA 3H3VH 1JXJA 3GINA 2V33A 3DOIA 3BD5A 4AV0A 3E6HA 4K6DA 3MMEB 3OJDA 5IROC 5CCGE 2E9IA 2WCGA 3D85D 4XT1B 1HTLD 3GMMB 4BBWA 3L9RB 1F4AA 4YBLC 4LSPL 4YSDA 3WUZA 3ARBD 4JFFD 1R3JA 1TTCA 1KIQA 2P5WB 4Q52A 1CPUA 4NBYB 1OLLA 4TQHA 3TA3A 4Z7NB 2IX3A 1HNWQ 2HT4D 4OW6A 4U4BA 1IC5L 2QEJC 1DBKL 2KEEA 4AIXA 4GBXC 1DL7H 5FJ8G 5HD8D 3AREC 4DVBB 3OC8A 5KJRH 3D12B 3M7NA 1IT9L 1ZHNA 4MDIA 4FQPA 1WJJA 1DO5A 1GHFL 1HHHA 3WNMA 4CDGC 4EXKA 3U0PA 4WTXA 3POHA 4HLZG 1ADQH 3U46A 1EIHA 1E30A 3GMPA 1VQ9A 2YC1B 4NQDA 1BEYL 1R4PB 4EJ1C 3VU2A 3DVGB 1E9QA 2RHQB 4PW3A 4MQXC 3CXDH 2YLHA 2A74A 3S37L 4B9XA 4JKPL 3SN6N 3BT2H 3M4QA 2X2YA 5JYMA 2NCEA 4N90D 4P3DA 4U1MB 1TYJA 1VPOH 1NEPA 1G2SA 3OR7B 4PD4K 2H32A 4U6YB 3D0FA 4OUOA 4XVJL 1XMQQ 1KTLA 3KFUA 1NIDA 2VDLL 5JOPD 3HOYB 4HPYH 5IBTH 1BCPF 2WFWA 4F27A 1M05B 3C9NA 4GQPH 2MCAA 1NGWA 5J56B 3ROOA 1IFHH 2VL5A 1MIMH 2W9DL 3KGRA 3MV8D 1MGSA 1F9RA 5A2FA 1HDMA 3WMQA 1RK7A 4LKCB 12E8H 2MO0A 4QRAA 1KNOB 5D70H 2QILA 3TT1L 1PDQA 1A7BA 1GY1A 2C1OA 3NSXA 1S9VB 1XNRQ 3FQNB 1A02N 1XGYL 4NO3A 3L4UA 1Y0LB 3DO7A 4GXUM 3VFPA 4KOBA 4OCXL 2WV3A 1KCUL 4J4PD 4X6DA 2H26B 2CD0A 2PWEA 1RI8A 5D2LB 4W9LC 4EQ5A 4NJ9L 3QNYB 4GIAA 1M1XA 3T6ZA 4NC2B 4PJEE 4Q2ZB 4H25A 3ZKNC 5EIIG 1WOCA 5E1HB 1Q1BA 1EEZA 5FHBL 2LXJA 3CD4A 5HHPB 5M3MB 1NSNL 3O2DH 3ELQA 2E4TA 3MNDA 3CZKA 2ESVE 4JPBW 3GIVB 3U36A 1WD0A 2IPTH 1FZJA 1NGYB 5A43C 4N1EA 3QJTB 3G6AB 2R2HA 4MZ2A 1IAKA 4I0CC 4Q6IB 4UOZA 2R8SH 1QBLL 4BZ2A 2EPBA 4EGVA 2VITB 2Z8WC 3I02A 3RZCB 2YRPA 3HKSA 1HILB 4LLQA 5AFAA 4A3FB 3IE4A 3VI3B 1MFCH 1U8MB 1JV5A 4FF2A 4E41E 4PRHB 1ND0A 1THCA 1WFJA 1BYNA 2X2HA 4JVZA 2YARA 4QY7A 2ZXBA 1IKOP 1TJGH 3MQIA 4HWBH 4KI1A 4PJ9C 1PJ9A 4HV8B 2NY4B 4X66L 1GKHA 3TQYA 5T33H 1P84J 1A7PL 1NIBA 3LPGA 4LUZA 1G7MA 4UTAL 5FLXE 4QLRA 1T66D 3O11A 4ZDHA 1LO2H 3DX3A 4QRPD 1WTPA 3TDQA 4X65L 4PJ5B 4Y0GA 3WY4A 5GGVY 1TENA 2CGRL 3FQNA 5DVLA 1EDQA 2ISDA 1EEFD 1J1PL 2BY1A 5C44G 2QDBA 1E43A 2GVYA 2IFGA 3BUBA 2WCPA 3FTGB 4PI2A 4F7PB 5EIIA 2WK2A 1NANI 3OMZA 5FUZL 3U4KA 4ANXA 1DBKH 3TBWA 2G2PA 2H0JA 4HUMB 3ZQWA 4YXKL 3HTLX 2DWDB 2D7MA 2QADD 2AJZA 1UEYA 5DRZB 1R5IA 2UXFA 5KBNC 3CFEB 3FONB 1ZDSA 2AEQL 1J5DA 4YNYA 1JXGA 1N5AA 3MA9L 2OQ0A 2VDQB 5IROD 4EN3A 1QAWA 4CU7A 5ACMA 3MGOB 5DNFA 4JFPA 2BMKB 5T1KD 1P4LB 1QSFE 5TSSA 3G5VA 4FQQB 4OF5A 3M45A 3MDJA 3SCMB 5HYSG 3UEQA 2V2TB 1DANT 3DX7A 1AXSB 3NEMA 1TJHL 2CDFB 1E6OL 4URTB 4YDJB 5J12B 1G0XA 1TZAA 3WGUB 5I1IL 3C5JB 3HZMB 4Q8BA 5SWZE 1IJ9A 2BH0A 2Q8AL 5JORB 4KZCA 4GBXD 4FZEL 1FZOB 2ZNXA 1CXFA 1TQTA 4W70A 4AGPA 4R0LA 4WU7B 5AD0B 5ADOL 1ID5I 3D34A 4M5ZH 1BBJB 4CGUB 3WXWL 5AB0A 1DQMH 3BIAX 4ZNCD 2ENSA 2WJ7A 1R19A 5EZOH 1H9SA 1TTBA 5T1KB 1QMUA 4U7MA 3IGAA 1D5MB 2VDLH 3IMWA 1VQOA 4NKDA 4UBDD 1LEIB 2R39A 1FORL 1SXCA 3RMHA 4LMQE 3I4LA 2VO5A 5FGBC 3WKYA 5J9PA 4YDJA 2ZKHH 1XBDA 2D03L 4IW4C 2QQKL 1D7FA 1NPUA 5C0RH 5SWQB 3KWUA 5DJYA 1HL9A 2C35B 3FOMA 1U0QA 3R06A 3V4UH 5DK2B 4EZLA 2YD9A 1X3EA 1B3JA 3P4MA 3H9SD 5B3JE 3ESVF 4JPVL 2W07A 5EO0A 2AHOB 2AXHA 3TESA 3VGFA 2UZPA 4F88A 3I91A 2HLFD 3X1FA 3W5MA 1PX4A 4BK5C 5CZVL 2XN1A 4FXLA 4MDIB 3HNSL 2VXVL 4Y16A 5EIVA 5ID0A 4F9PA 4DUZQ 3KLQA 4GOPB 3WFDH 4LEXH 1YEKH 3QIWB 3OSVA 2FO4B 4MLSA 4LEOA 1EGJH 1D6EB 1A3QA 2ZX8A 4DV4L 3GZOA 4PJ8B 4Y5XB 2Z7UA 4L5QA 3SPVA 3T77A 2XWXA 3QA3B 4MQTB 4OZHF 2UZYA 3AM8C 4L3EA 4LF8Q 2IWHA 4K7PL 1G7JB 1TFPA 4C1NK 2OMBA 1M1SA 4NPYB 3THML 2O5XH 5IB5A 1YJNA 5AVTB 1UM5L 1Q12A 2A68D 2AV1B 3LD8C 5F9JA 4KN7C 5C09E 3RGBA 3MCLL 1K8IA 1TETH 5CIPB 5DHXB 4M1CC 3B6YA 5HI5C 1C16A 5I8KH 2F54B 3NABL 4L9DA 4LSSH 3ZYIA 1JRHL 1RUMH 3Q1SL 2DQJH 1ZLVK 2WXRA 5JLZB 1RZJC 3RDTC 1QI5A 2ITCA 2L5TA 2QJDA 3NJMA 2IAMA 2WN2A 4WEBH 5H37H 2OMNA 5B3JF 3C2SA 1BKBA 2AXGA 5DVMA 5BZZA 4JPWH 4LOFA 3HE7A 3L81A 3BYYB 4CJ1B 4OGAC 3HKFA 3FYEB 5GZOA 1W72B 1MCOH 4FZ8H 4BV1A 5L88H 1E9PB 2RHSB 5C92A 4DHLA 5LXGL 3CMOH 3Q5TA 4K9EH 2EXZA 2BSEA 2L4NA 5IQOA 5J6HB 2FX8H 1RLBA 4QTIL 3CFKA 1N6UA 3M17A 2QPUA 3K4AA 4EZMA 4MNQA 1UOWA 4K3JL 3TCXA 1BBUA 1P1ZA 4PVNA 3WYRA 1L9RA 1AGBB 3WEOA 1BAGA 2CM6A 1JPST 2XPGB 2NN6H 2JKJA 3F6LA 4U1LB 3U48A 4TUJA 3IDGB 1IEAA 1CXKA 1GYVA 2LLLA 4WSGA 5CCKL 4HVBA 1OF2A 3ZX1A 2R29H 5DM63 1A22B 1FO0L 4IRJC 2VDNH 3EF7A 4KHTH 1N8ZB 2ZJSH 3INOA 2AEIT 4JFXB 1Q72H 1BZ9A 1ZA6B 2VUMB 3FBKA 4BK4A 4XXWA 4TPRL 3GMNA 5I82A 4HX1B 3W56A 3I6LD 3L3OA 1A0QH 5TFSL 5IFAL 3FF8A 3B2MA 4LSDA 1HNZQ 3WXWH 2I69A 5JXEC 3PO3H 3V6FB 1FRGL 2WTRB 1OP9A 2FZ3A 1JXFA 1TTAA 3P77B 9PCYA 1V1PA 4ZUVB 5BS0D 1JGVL 1DQVA 2XV6B 5SWZD 5F7MC 5F3BB 1WFOA 1Q90A 5EA0L 1WD8A 4A1RA 5AW0B 5FEBA 3QNFA 5FYJH 5KVGL 5I1EL 3F7KA 4LF5Q 3H0TA 2F6AA 4A2HA 4AVJA 5CGYC 1SOSA 3RPKA 3FU7A 4JE4B 3VH8G 3TSSA 4PD4J 1MCPL 1EZLA 3HI1B 4ZS6D 3EFDL 5C4XH 3LY6A 2N8NA 3BLBA 4ADJA 1J5OL 3AS1A 4DVBA 5CV8A 3P0GB 2WOYA 3S96B 2OTPA 3HC3L 2DQDH 4OVVA 2XX0A 4UDUA 3VAEA 5FA4B 4FFYA 4IMKC 4FTVB 1YUKB 3UCQA 5AWNL 4POFA 1E27A 1JDDA 1ZT4A 3R3OA 1R3HA 1C5DB 4JW3A 1B2TA 1P2CA 1L0PA 1YY9C 3DX8B 4KXZI 3T2LA 4AVKA 5B38B 5F1NA 5I76A 1A6TB 1C1EL 3P4OB 2E7DA 5C08B 3H9SE 2ZOOA 4P23C 4GP4B 4WW1B 4F7EA 3UBXB 4XRCB 1OHQA 2DTMH 3CLFH 3CC1A 3GDBA 4NN7C 4PJHF 3VRIB 1KDBA 4PS3A 3ZTJH 4G8GD 4LP8A 2DGYA 4C47A 5KRUA 3UPRA 1UFUA 5LCVH 4ANKA 5E8PB 3VD1A 1VQFA 3AUWB 1D9KB 5E1FA 2FWSA 2A6ED 2QDLA 1Z2KA 4GZYC 2HLFC 4JFYB 5JPMC 1JZ3A 1AW7A 1KV7A 1NBZA 1Z66A 1Q0XL 3IN2A 3BMVA 3PO3B 2YEQA 2AZAA 4XNMB 3HR6A 1HFNA 1TJMA 3RIFF 3AS3A 5T8IA 4A7GF 3OXRB 4G1EB 2EYSA 3FXIC 5D3DA 5EQ0A 3SZKC 4RRPG 3SQBB 4RMSA 1H3WM 5LGKA 4OZGE 4F7EB 1BQHB 2DIBA 3TXAA 5EC2A 4KK6D 3RWJB 3HBZA 4KI5E 1E5YA 3VI4A 2C9SA 3P9LB 4XOEA 1Y8OB 2IANB 2OP4H 5FKPA 3FKIG 3TNNB 3RTQA 5BV7L 1LQBC 4IMLB 3FB7B 3NHHA 1S9WA 5FUOH 5IB3B 5KIXA 1E9OA 4HSAC 5D7KE 5CEXA 5M5WH 4JFYA 4K9EL 2VRAA 4YHLH 2Q86A 4M1CD 4W4NA 2R92H 4XYOA 1HZCA 5I74C 4PREB 1H5BB 4AGQA 3SDAC 2PNRC 1I50B 3D2TA 3ML8A 3EOAB 3F00A 1BZ9B 4JR9L 4KKCC 4PGZA 5E23A 4YHPB 3VXSB 3W9DB 5H37A 3AEVA 1GY2A 5I6KA 2X05A 3GTMH 5JOBA 3SDYL 2R15A 1CI5A 2PW2A 3LH2H 2B5IB 2AJSL 3O8XB 3LVEA 4JFWA 3ABZA 4XVTL 5B8CA 2NT1A 1Q1JH 1EWCA 3GKZA 5GAEC 4ZO7A 1ADWA 3NK4A 3CHPA 4XPGL 2NXYC 2OTWB 2AJVH 2UX7A 4EO5A 1CC3A 1IO4C 1RZ7L 1R5VB 1KGCD 1CU4H 3BIKB 4LIQH 1JGDB 4PJDA 3V0FA 4WFGD 5EFIB 1DYZA 5GJTL 3ITPA 1Q1EA 4B5ZA 1S46A 3IYLW 3V6OE 2W0FB 2AGJL 4M93B 3OTTA 4FTVE 4JAMA 2XZCL 2LXKA 3S16H 4FNRA 1CFVH 2YBGA 2WIMA 4GAYA 3BZDA 1VQLA 3CZLA 4XBPA 4B3MQ 4I65A 4JM2F 1O80A 2X6MA 3RU8H 4B0MB 4V2BA 1JMCA 1PG7H 2Y06L 3MPCA 4XPTH 2FWOB 1X7SA 5CC4A 2N1TE 2NBFA 4ONFL 3FUDA 3MV8E 2K9UA 5IJVA 2MEJB 4Z7QF 2LOEA 3QAQA 1NUNB 2PF6A 2VDQH 4KDTA 4W9KC 3FQXA 3HOVH 4NQQA 5FO8B 5D4JA 3UG5A 2LSSA 1QSFA 4J1UA 1HQ4B 1NLDH 2I32A 1RZKC 2EDLA 2Z7YA 2NVYH 4NKOB 1A1NA 4ISVA 2NCMA 1A8JH 1ZIAA 4LNRB 4X9FA 4X83A 3SXHA 5C0ND 3T53B 1CR9L 1Z1WA 2VDRL 2P24B 1LL1A 1BLNA 2PWDA 2UUCQ 2GEEA 3BDLA 3CXDL 3FQUA 3US0A 3TF7C 1B2WH 4H40A 3PO2G 2FT6A 4APQB 3VWKC 4GO6B 4DZBB 4DAVA 2ZG3A 3GQFA 5CWSB 2RHEA 5IQLA 2WGXA 1M71B 4C55A 3CZFA 1O75A 1K73C 4X5PA 3NVQA 2Q8IB 1P7KA 4TSBH 4CRPA 3HZKB 4AH2A 3Q8DA 4IJLA 1NMGA 4L5SA 1PDKA 2EYJA 1W0WB 4WV1C 3ZHFA 5JW5A 2X5PA 3JWNG 1F4XH 2LKVA 4OLUL 3ZTJG 4DP5X 3UTPE 1QR4A 1S9XB 3KAAA 4NWTL 3NCFB 2IG2L 3GTGH 5HHME 2JCWA 4H20L 1DO6A 3QJUB 2QPDB 4NDMB 3TBSB 4AUYA 5LDSA 2J1KA 2NQDA 2P8MA 4APQD 3IMSA 4I87A 4OM0H 2P80D 4KJOA 1EXUB 3F2UA 2K6YA 4GKSA 4J27A 2A4CA 5PAZA 2ATAA 3WJJC 3ILQC 2YR3A 3LHPL 4PV8B 2J55A 4MX7A 3MRIA 4XWOD 4KTEL 4ZOEA 1K8IB 4JVPA 4Y4FA 1HRJA 1P4BH 3MRRB 3TH3T 4E9QA 5KJRL 2BVPB 1OPGH 2PO6A 2Y0SE 1ODAA 4NCC1 5DEGB 2B63B 1IGCH 3V55A 1IQWH 1A2TA 2C1PB 2CGRH 2Y25A 4Q6KA 1W6WA 3WXVH 3PUWA 2ORBH 1I6HB 2GSGB 4C3IH 4MFHA 3C5JA 4ODTL 2YLKA 3HG1E 1NBYA 3D8MA 2DIAA 3QRFM 2WP3T 1VFAA 2BCKA 4M62H 3US1A 3L1FA 1Q94B 1ZXTA 3LH2L 3MRLA 3QJHA 3QPQC 2XFGB 3PL6D 3MFGA 4NUJA 2K9FB 2DWTA 4WUUD 5LNDA 3VA5A 4NPSA 1Y6NR 4NQUA 4YBLB 3OF6D 3R2IA 3EO9H 3RUGB 4K8RH 4E41D 4I3SL 3KWTA 2K52A 1ZA3A 2HCIA 1TVBA 2L0DA 2VW9A 3H91A 2B4CL 3FQTB 3H9ZA 3MGAA 3ZY7A 3A4DA 2BVUA 4EIZC 1T0NA 1XF4A 2XN9E 4WF7A 2FYYA 5DZNA 3AREB 2X6GA 1E0OB 2YMXH 1QUNB 1ZDQA 4LSVH 4TSSA 1TMQA 3QI9A 1K5NB 2X7LA 4A2LA 5JA9A 4OB5L 1EGJA 4Z23A 4E41B 1KGIA 4Y2DD 1S7WA 4ELDA 4BZ2L 1E7VA 3PWJA 3QUXD 5HVGB 1MCDA 4XN2A 1HAUA 3N42F 2XY2A 4HUCA 4NSKB 1OO9B 4OELB 3BJ91 4GAFB 3W39A 3DX1A 2P9RA 2VCOA 4U1JB 1N18A 5HHOE 3VX0A 1HZBA 3FTGA 1HHGB 4K71C 3T04D 4C1NI 3DJZA 4OZGA 3VI3A 3KYNA 4GAGL 3NBNA 2KCCA 3QFDB 2ZKMX 3IN0A 4N87A 1OK8A 1G91A 1TPXC 2PXYC 3WN5B 4JRXD 1Y1DA 4HIKA 3FT9A 4XXCA 4PFEA 5EBCA 3RVXC 3UH8A 5LGJA 4BKLA 4FI8A 3V95A 4KXCA 5E4OA 5E7FA 5EDXA 1CFNA 1U8PB 3IDJA 4XXEA 4WI6A 5C09A 2GHZA 1X32A 2KMWA 4W9DC 1MIUA 3JV5A 4PGEA 3ULUC 5IVNA 1RZIB 4ZQKB 1JYXA 1QLRB 1DBJH 2YAEA 1L6ZA 1XZ0A 2XZAL 4P07A 3WTSA 1JNLH 1FQ9C 1L5GA 1EEZB 1H8LA 3O3AB 1GJIA 4AYBB 3KOJA 4R7VA 1C5CL 1GUTA 2XBTA 2WVVB 5CGTA 1QSEE 4YHLL 3FT3B 5EZIH 4NQEE 1TWFH 4RGOH 3TP6A 3M85A 3KYOA 3QC6X 3QZPA 4DGYL 3V4VA 4U0RB 5IF0A 1HTYA 4CMHC 4RRPM 5E0FA 1PLBA 4RWYL 2LS01 1CQVA 2WAQG 1L0XA 1H3UA 4Z7OB 1N19A 1U4EA 3W3BA 5DD0H 2Y07L 2B2YA 5E9DE 1J8KA 1AXTH 2PR4L 2WBXA 1JWSD 1NAKL 1WF5A 4UIMA 5GGSB 3H94A 4BINA 5D7JA 1T3FB 5DA0B 3VWKD 4U1KB 3PP3K 1ETZB 1XTLA 4P2QD 5IMMA 4CBZA 3EYUH 3GS0A 2WXGA 5IQMA 4GN3B 1U3YA 3B9KA 2EIFA 4OU3A 5IG7B 4HISA 4M3JA 5DJ6A 1JT8A 1A4JB 1DJGA 1PX3A 5FLXL 5C5MA 3HC0A 5B1BB 5HYQB 2FD6L 2G5RA 5KG9A 2NW3B 1VQ7A 4TLSA 4DZ8A 1PYBA 1F90L 1PNCA 2ZX9A 4ZQTA 4IBUA 4HS3B 4B3SQ 4HJJL 4ELMB 4QXGH 5ILTL 1OCRB 4ODVH 3HRZA 3RNQB 4AIMA 4IKIA 2JI2A 4LEEA 3RVVD 5DJ8A 3LMJH 3LGJA 1QQDB 3H0GH 1XTDA 2DQTH 3NJIA 4GS7B 4AQYQ 1N4XL 1U36A 4LRIC 4L23A 5COYA 3WJMA 4TTDD 1N36L 5F96H 4UQ3A 5IQ7L 3D52A 4LNQA 1YJ9A 3GHBL 9CGTA 1BFSA 4JVWA 2Z0UA 4ALPA 1S78C 1VGKB 2FVNA 4WGWB 3UJJH 2E47A 4PRPB 5TDNA 4LF6Q 4M4PA 2K6AA 1WAAA 4RMQA 1O7ZA 1RIVH 3LXAA 4GKKL 1AZVA 2MTAA 3L5WB 4G7QB 1NCOA 2C4XA 3TJPA 2FEDD 3SE4C 3GSRA 1JS4A 4ZFOL 2YJLA 3ULAB 4PIBA 43C9A 1UTDA 1OSPH 1EAPA 1QI3A 1UB6A 1Y1VH 2IH3B 3S37X 3L4CA 1JHKH 2V1CC 1TWAB 5D2LE 4NFDA 5EUOF 2QMKA 4KO6A 3X3MA 4JFDA 4R0LB 5AD0A 2UUAQ 3CZUB 4XHQA 1K3ZA 3PL6C 4PPTA 5BXFA 1VMPA 1A4KB 2DLFL 1I3GL 3D87B 4ZUUB 3VSQA 1YEFH 1XH0A 3KPQA 4K3GA 1V5JA 5C6PB 2FX8L 2J2ZA 3C8KB 1EQQA 2Q10A 3CQZH 4NN5C 1PW3A 3KXFE 3SK8A 4A2FA 3DIFB 1Y07A 2LQRA 3HLKA 1G6ZA 4QRRE 1R47A 3NSYA 4PMEA 2WINA 4C56C 3OKMA 3CN3A 5HHOD 4ZFQA 2B2WA 2FYYB 1XXFC 2KQNA 1AD9B 2D62A 3D25A 3FO0L 4FLSA 4QXTB 1VSCA 4EOWH 3HNVL 1EXGA 4GMTH 4YSTA 1JNHA 4NIKB 2RCFA 2QGEA 3NJFA 4MD5B 4XZ4A 2HRGA 2YXVA 2JKSA 2HN7B 1FVCB 2QVTA 1QQDA 2W9LA 1WCQA 4H8WC 4TV3A 5DMKA 3SKMA 1E8YA 2NXZB 4IHOA 1ROCA 1INQB 1Q9LB 1S7VA 1EOTA 5GGTA 3JBG7 1TR7A 3IJYA 3ZQ9A 3I9PA 4R4ND 3V4PA 3JSSA 3MCLH 3AS0A 2HJFA 2YSTA 5CZRA 5ID1B 1R6VA 3Q6SA 2ADIB 4KK8C 1RTNA 4EPSA 4NQVB 1PFCA 4WWKA 3JVFC 5DFVC 1G4MA 2XUWA 4GSQA 4H0HB 4NNXA 5DGRA 2IDSA 3MRNA 5GRVK 1IXRA 1AD9A 4XNZB 3Q24A 3H6JA 3TO2A 5A2QE 2FFKB 1GGIH 3BAXA 1R9TH 1I1YB 3HBPA 2XDHA 4WNQA 3V0WL 4C54A 4C59B 5T1DL 4DV3Q 3WIHL 2Y07H 5CBEE 1BJMA 1UXWA 4F37K 3N55A 5D4QA 1TWAH 2E75C 4JBWA 2PNDA 2JKTM 4ODUA 5D7EA 2YGPA 4PCTA 1X56A 4IBSA 3RUGF 3UIYA 4ESKA 1PFMA 2ICWI 2HXAA 3FN9A 4GPVA 1UYWL 2K28A 1OAZL 3SJVD 4LSRH 4X9GA 4YHYC 4V190 1QOKA 5HI4D 4OIKA 2H3XC 2ERJC 4KNUA 3VXUB 1FC2D 4ES8A 1V7MH 4MXQD 2Y7LA 1G7PB 3BVTA 3FQ1A 2L1BA 2PTUA 3W37A 4LNRA 1KJ2A 2R59A 2VLKA 3AT8A 4PJBE 4HULB 4R97B 2Q8BH 4YUEL 3QDMD 4F8QA 1KN4L 4R5XA 4HJ8A 4AIEA 1L6XA 2F0UA 2VLKD 4JKPH 3QNYA 5HGAA 1VGKA 4HSCX 3WMSA 5IJCC 2PW5A 1BO0A 2WVUA 4KZEH 3ZRCC 2ICWJ 1QG7A 1NAMH 4KD4A 1VAHA 1A6PA 1IM9D 5CWSA 4EDXB 3A6CH 1J9QA 1T22B 1MW1A 2OXGB 1MWOA 3VXQB 2ZPKL 4C58B 1XF1A 4IPCA 4QHLB 3N9GL 1SUHA 3A47A 4YWKA 2YD2A 4OAWB 2C5CA 5EKKA 4OFIA 1WI5A 4EXPX 1WA2X 1TZGL 1LEGB 4CDEC 4JANB 4B50A 1JGVH 1ROWA 3TBIB 5EUOA 1FAIH 2ZD0A 1H19A 3EJUA 4FA7B 1U2HA 3RVVC 3WKNA 1XPUA 2G3NA 3U9PH 2MCPL 2NN6G 1FFOB 1Q8KA 4OD2B 3EO0B 1I75A 1B90A 4IGBA 4N6QA 3VA6A 1QKZL 3ULSB 4HBCL 5INCA 3UBHA 4JJ5A 2IAAC 4U1KA 3L3IB 3O0LA 3WENA 3UYRL 1UD2A 4ZFZA 1KHIA 4LRNH 3MKKA 5AOIA 1I4RA 5IYCH 1XGPA 4UF7C 3JAMi 1WAAE 5DFWH 1NCBL 1CT8B 1ORQA 2CJUL 2WJ5A 3NJKA 3FHQA 1SLUA 2BA1A 1CDCA 1HQRD 1E3PA 1MW3A 3IGKA 1L0YB 4PMCA 1I1FA 1XWVA 3GJFA 4HC1H 4G9FA 1KCSH 4FG6C 2NDFA 1NFIA 1OAJA 3PIOA 1G43A 4O9HH 1OHZA 1FHGA 1R24B 5I16A 3A74A 4R8IA 3V0VB 1J87A 2BNRA 2ED6A 4DO5A 5CJ8A 1HEJC 1T0MA 2PWHA 3CDGA 1A3VA 2I5MX 3BISA 3OIPA 1M2VB 1AHWB 2MHAB 1NWPA 3TONA 3U58A 1IC5H 3TP7A 2AP2A 1JZJA 2X3AA 1RZKL 3AB0B 2I07A 1WFIA 2DQUH 3LRLA 4OLXL 4NRYB 1WBZA 1QYGL 2CXKA 2CM5A 4C56D 4DN3L 1Q0XH 3MJ8A 5EU5B 1M7UA 4EMZA 1JQYD 1KGCE 1LDPH 2FEEI 3P4NB 5K9OA 3P4OA 3ULPA 4ONGH 5KS9F 1TS4A 4D7PA 2CRIA 5J11C 1AZZC 1UG9A 2KZKA 4DCQA 1QEWA 2HFTA 2A83A 3RTLA 4KY1L 2EE1A 3MRKB 1UWGL 4GKSB 4PCSA 1J1PH 4W9JC 1S9YB 1U2CA 3ECBA 1FYTE 2Q86B 1JGEB 2APVA 5CLZA 1A5FL 1LK3L 5D71L 4G4KA 5FUZH 1IGFH 1IGIL 3WE6A 1UASA 1VJSA 3C87A 5EN2B 1JZHA 1HSBB 1K3BC 1RPQA 3E38A 3H3BC 3T13A 6TAAA 2BJMH 3L45A 2XYBA 3FFCE 4YMPA 5IVXA 4P9HL 4ONFH 2WKOF 2Z1CA 3RZOH 3GTPB 2I26N 3OMIB 4HIHB 3QR2A 4LFHG 4PJBB 3RX8A 3IJ9A 2EJFC 4HN7A 2PPFA 2FL5B 3OXSA 5DUPL 3B9EA 4ID6A 3HOVG 2IO5A 2D31A 4GKZA 3SDXB 5KANI 3KUPA 4HMEA 3DXAB 4ZFGL 5F7HA 1CLYL 1O7VA 1S8DA 2YAMA 5E9NA 4RX4A 1BXXA 1QVOB 1IJNA 2ADFL 3G5WA 2EC9U 3D39B 1SRDA 3OKDA 4FQJL 1NJIC 1YVLA 4Q6IC 4YUEH 5AZ2H 4CW1B 4OFYA 2CUMA 1D7QA 4W6YB 2Z31A 5C2BH 5E6ZA 4WO4A 2JJQA 3CDGB 3CZEA 3ZKND 4AE0A 5DA4A 4MHHG 4L8SC 4KVNH 4R5TA 2B1OA 1PAZA 3DYPA 2ORBL 5FYJD 1V7NH 5IOPB 3B9KD 1SLXA 5F44A 4YDIH 4BE6A 4E6IA 4ZUWA 4Z7WB 1FNEA 4HF5L 4IFDJ 2VW4A 4LFAQ 1HJPA 5C0XJ 1U92B 2GT9B 3ZK0A 5I1LB 1OD7A 4UI2A 3VQLA 3BPLC 2VLJB 2AJ3B 5GZNA 5CO1A 1NR4A 2UXDQ 5E5UB 5FCUL 3EJYD 3NFNB 4K73A 1FR3A 3JC66 2MCG1 1KRSA 3CSFA 4AOFA 4NWUH 5BRQA 3WIFB 5DDHA 3S96A 4EUPA 4W6WB 4OCYH 3NCCB 1IZ6A