3L3OC

Staphylococcal complement inhibitor (scin) in complex with human complement component c3c
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
306
structure length
294
Chain Sequence
CNKFDLKVTIKPAPEAKNTMILEICTRYRGDQDATMSILDISMMTGFAPDTDDLKQLANGVDRYISKYELDKAFSDRNTLIIYLDKVSHSEDDCLAFKVHQYFNVELIQPGAVKVYAYYNLEESCTRFYHPEKEDGKLNKLCRDELCRCAEENCFIKVTLEERLDKACEPGVDYVYKTRLVKVQLSNDFDEYIMAIEQTIKSGSDEVQVGQQRTFISPIKCREALKLEEKKHYLMWGLSSDFWGEKPNLSYIIGKDTWVEHWPEEDECQDEENQKQCQDLGAFTESMVVFGCPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Complement C3
publication title Molecular Basis for Complement Recognition and Inhibition Determined by Crystallographic Studies of the Staphylococcal Complement Inhibitor (SCIN) Bound to C3c and C3b.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immune system
total genus 53
structure length 294
sequence length 306
chains with identical sequence F
ec nomenclature
pdb deposition date 2009-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3l3oC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 3l3oC01
4ILWA 2J0TD 2ICEC 5JPNC 1UEAB 2XWJB 3G6JB 3OHXC 2A73B 1D2BA 3CKIB 5FO7B 5FOBB 1OO9B 2PN5A 3CU7A 2I07B 1BUVT 3V96A 1BQQT 3MA2B 1GXDC 2QKIC 3FRPB 5FO9B 3I70A 2WINB 5FO8B 2TMPA 2WIIB 2E2DC 3T4AC 4FXGC 1BR9A 1XWEA 4D94A 1AYOA 4LNVA 3KLSA 1PXUA 1JB3A 3HS0C 5JPMC 2B39A 1EDYA 2XWBB 3L3OC 1UAPA 4FXKC 1BV8A 2A74C 1JC7A 3HRZC
chains in the Genus database with same CATH superfamily
1MRFL 4OCXH 1NCOA 1GM5A 5K9OA 5JR1H 1JXFA 3ZTNL 2VQFL 1F2YA 1U8CB 2ICWB 4IU2B 4OM0L 5SWSA 4LCIL 1NC2A 2H9GA 2A38A 1GUNA 3P77B 1FL5A 2NPLX 2QV2A 3ARED 4MVBC 4OIIL 4ZS7H 2WAHA 1BP3B 2G5BA 5CZVH 1CZGA 1FJ1B 3SSGA 3CLEH 2V17L 3ZGIA 2N56A 4H2AA 5EU5A 3ZHNA 2CZNA 3VJ6A 1HNXQ 1BXAA 2BX5A 2VERN 1W8OA 2NX5B 3RRQA 1YQVH 2OMTB 3L1FA 4XH2B 2GBAA 4U6TA 4CDHA 4PJ8D 4PMFA 5I15H 1AHKA 2XX0A 3ULVE 3J7ZC 4L4VE 1FORL 3EFFB 3T6WA 3KLAA 2HJFA 3B2XA 4D8OA 1JZ2A 1RTNA 4YHPB 4U6YA 4AC4A 3KPTA 5JVG3 4Y0GA 4KX7A 3MX0B 2R92G 1NAMB 5EKKA 4KHVA 3J7A5 1AQKH 1CB4A 3O41B 5D1ZD 1KPRA 3T51B 5F0PB 5KG9B 1PH9A 5DMIL 1QAWA 1EY4A 4AT6A 3LOWA 3U2IA 2G3MA 4YBHA 4HJ7A 2F19L 5C44G 1IKNC 5KYXB 1ZEQX 1KGIA 25C8H 3GIVA 5F0JB 3JWDL 3DWAA 3D48R 3STZB 3WFBH 3EJSA 4L1DA 2P3YA 3FSAA 4H20L 3CN4A 4UAIA 4YGVB 4HS8H 2R2EB 4R4FL 3FONA 2QEXA 2GI0A 1YUHA 4XXDA 5B39A 5AOIA 1KGCD 1EZVX 3T4AB 2FX7L 1K9MC 3VWJC 3O2VL 2I7SA 4Q97A 3X3FH 4JQXA 5DA4A 2CDEB 3NA9H 5DMGD 5ILTH 4JGUA 1KJ2B 4EQOA 4G59C 3OKDB 4AIEA 4LGRB 5CJBA 4GP4B 3L0OA 1EUTA 3BQVA 1BVOA 1I7TA 1LDPL 4LO9A 4KGLA 1JQYD 3ZL2A 4HISA 4KXZI 3VXUB 2VR4A 5IYDG 3KPRE 3RWIB 1INDL 3IFNL 4I8DA 2G9KA 2BMKA 4OCLC 5I6NA 3UJTL 3CMEA 1QBML 3NPPA 4QHUA 4A3EH 4XVSH 5EDXA 3PDOA 3QYMA 3BPCA 2BHZA 5GADC 1ET8A 1Y18B 1P7KA 1MVFA 4QRAA 3EQLC 3QXAA 1MAMH 1HL4A 1KPUB 4HBCL 3U36B 6PCYA 1GH7A 1EHLH 5DWUH 2XTJD 1A4BA 1UZ8B 3QPKA 4WU5B 4KTDL 5IVXF 4X9FA 2Z31D 1R9TB 4Y4FD 1U8QA 2Y69B 1CIDA 3DHJA 4FQ1L 4ZMOA 2A99A 4P99A 2GAZB 5D7LA 1BBJA 1W6JA 1V7ML 1ZA6B 1K2DA 2ZICA 3LJ3A 3U83A 4DT2A 1EANA 4WVRA 2R92H 1BDYA 1Z9NA 4FG2A 4LLUA 2G9HA 4FQCL 3TM6A 4U1GC 3KPRB 2DQ6A 4NKOA 3PGDA 1T1XA 3BVTA 3HGBA 5C44H 1QPPA 2IANA 1XJVA 2VO8A 1X65A 4LLWB 2YA1A 3P9LA 5C0RL 1JPEA 4GKJL 4OKDA 4IRJB 1VDGA 4AMKH 5AWNH 3BP5A 1M9SA 4AUYA 4XI5D 3VRIA 3PPSA 2JV6A 3I4NG 1T20B 4WJKB 1RY7B 1YC8A 3MEFA 3QNXA 5H35B 3SDXB 3ZDYF 1LK2B 3RDTC 4YSAA 4LLQA 4Y9EA 1C12B 4LCCB 1XIWC 1INEL 1JOKA 3BZCA 4ES8A 2HHHL 1CICD 5CBEA 2D9CA 4JL1A 2WZ6A 3UIYA 4X62Q 4J3BA 5L9DL 1MFBH 4J4PA 1RDPD 3G9AB 1XMQL 1MRCH 3BPLC 3NJLA 3ARBA 4WHYH 1IGIL 2XX1A 1IVLA 4AXWB 5I6PA 2WLHA 4Q2ZB 5IYDH 4Q9RH 1X5IA 2EYLA 1JZJA 5IREA 5E51A 4BBRG 3QO0B 3LMJL 4Y16A 5EQ0A 1TT2A 4PGBB 1DEDA 2IPKA 3PJSA 1A6WH 4L3EA 1G1OA 1M42A 3AXIA 5I2IB 4JZJB 4JRYD 2CQOA 3IMRA 3NIDE 3NBHB 3ZT6A 3GTGH 2K6ZA 3CVHH 4JI2Q 2UZIL 1QQDA 2PI2E 4LDOB 5JO5B 4YJZL 3HLAA 3UBXB 2BWQA 2D31A 4N1EA 1ZGLA 3IKCB 1FZKB 1XGRA 4APVA 2BDNL 1FVCB 1RZ8A 2X4UA 4Z7UE 2JA7B 1ASQA 3MN8A 2EXWC 4K71C 1CYXA 3M46A 1DQQA 5LO7A 1NDGB 4S1RH 1ETB1 1H5BA 2PP8A 1NUDA 4JHAH 4PJIA 3BUBA 3C2SA 3G08B 3N43F 5DO8A 3SGKC 2F52A 1FYTD 1RZQA 4LVNB 4P59H 3OHXB 2XXGA 2B2XL 3PWVA 1HXKA 1KB9K 1X3GA 1KTDA 3O45A 2YAFA 4M93B 4ZKCB 1G7PA 1KYOK 3HNVH 3G04B 2LLNA 5LGJB 3M4PA 3GZQA 4QRQB 2K5HA 1MJJB 3MROA 1WD1A 2AABH 1ZANH 2DZEA 3L5XL 1V7NH 1IL1A 2JFCA 4G80B 4Q4EA 4F7CA 5KNCA 2CRMA 2WSKA 5C3XA 3O6MH 1OGAD 5EU6A 1DCZA 3DJ9A 4Z7UB 1M4KA 2L3BA 3BO8A 3D4DA 4KTEH 1DUYA 5CEZH 2NZOA 1WZLA 4K8RC 5FHBH 1VEMA 3JUZA 2NN6G 4JCLA 4I2XE 5F9DC 1TS3A 4JFQB 1JOQA 4OTXH 4HJGB 2CW0D 3IPEA 3RWFA 1Q9OB 3I6SA 4YXKH 3VA5A 1F9SA 4BBRH 4KVNL 4I0PA 2Z91A 4CJ0B 2HLAB 4OF6A 4Q9BA 4KUZH 4U1MA 1S7XB 3RVUD 1JS4A 4GQZA 2ATPB 3TEUA 1WOCA 3F7LA 5L4JA 4DK6C 5FYJL 3ZL1A 1ONQA 2FWOA 3KHOA 1FL3B 2EE1A 1UFGA 4UYPA 1YNNC 5GAHC 1KGCE 3LKPA 3IGKA 3OIQA 4C59B 1YI2A 3J81j 1N6QL 4YR6A 3V9EA 2ZSVA 5DVMA 5M5XH 4MWFB 1RHHA 2FATH 5F7DA 4R4CA 1HWHB 3IDYB 1ZE3C 2FEEI 3PHQA 5IV2B 1NUGA 2JI3A 1XF2A 3KWVA 4GKNB 2R29H 1LJMA 4YQXL 2EZVA 1XGZA 3EH5B 4KHZA 1HRJA 4GAYA 2O2LD 3O8XA 3ESOA 5D1ZB 3AXLB 1MCPL 5C07A 4ULLA 3FFDB 4ZNCD 4GAGL 1BYNA 4PG9B 4RBPH 3TX4A 2FYYB 1IGFH 2MFIA 4PLKC 1UOWA 3MJ9H 2GSIA 4ZTEA 3CPWA 1P7QB 2CCWA 3B5GA 1AZUA 1U8HB 2C4XA 1CT1D 4DV0L 4RDQF 2ZUTA 3KJ6L 1MEXL 3TZVD 1FN4A 3C60C 5ICXA 3V4PH 5BVPH 3VFRA 1Y1VB 5FUZH 3GV3A 3I70A 1OKEA 2PNRC 3O6KL 4L8CA 2NY2B 1CDHA 2OJEA 3Q1SH 4NDXA 2XTJE 2B3IA 4AJ0A 4FYDA 3LN9A 1EWIA 5CR1A 5BVJB 1SYFA 3BSHA 1I3GL 1ML0A 2CLZA 3GTKH 4LARL 5BXFB 1S7TB 5J4MA 3G6JE 4MA7H 2YHGA 1STYA 5JDSA 3M4OH 1F4WL 1H8NA 3EW3B 3C75A 5J13C 2XIWA 5FDWA 1B0GA 1ILQA 3H9SB 3SBWC 4GO6B 3UZQB 2NN6H 5AZ2H 2YU9H 3ME0A 4ANXA 3N44F 4EDXB 5A43C 4A3CG 3JBG7 1N34L 4DVBA 4WTWA 2YMXH 3T0AA 3AU7A 1D2OA 4AUJA 5EF3A 2PTUA 4KJPC 5DJ8B 1DDTA 3LVTA 1OM9A 1QPXA 3RIKA 3U4BH 5HYSA 1K0SA 4GLRH 5FR3A 5E8PB 2VR5A 1KF9B 3PQYB 2FCBA 3W9EA 2XQYA 1AOHA 1E27A 2XVGA 3A8IE 1SFDA 1ZDQA 3LEXA 5DD5H 1NAPA 2XTJB 3TXAA 1X3PA 5HYQB 1QCBD 1F90L 3MOAH 2Z31B 2BC4A 3NUCA 2NNXA 2MSPA 2ZG1A 3FCSB 5D5ME 2IGFL 2RH0A 2HT2D 3G6JB 2Y24A 4XC3H 4NO3B 2B2VA 4A3LG 3M4YA 3O6LH 4CKCA 1DFBL 3ROLB 4XTRC 3WOEA 12E8H 2IDTA 1KENL 4Z7NF 3MXNA 4WHDA 4K9JA 4CBZA 5FPIA 3F5WA 3CFJA 3NCFB 2QADD 2D3NA 4NQTA 5G3LF 3TH4T 1I9JH 2XXCB 1IBDA 2YGOA 1MIMH 3SKJL 1CFVH 4UB0H 5EWIL 5IB1B 4ZS7L 5KVFE 5JAVA 1DOLA 2EKSB 4CJ2C 2YXVA 4KK9C 1FG9C 5CZVL 1IIIA 3IU3B 1T3FB 3VB9A 1TWFB 4GQPH 2EO9A 3O3EB 3IFPB 3F12B 5E9DD 4JRYE 1GGYA 3V8OA 4AQ8C 4C83B 2KLTA 4MVBD 2DW5A 3WIFB 1D2BA 3NFPA 3CHOA 2B8FA 4QRRD 3QC6X 4AQZA 3GTOH 4MJ2A 1FNEB 1JZEA 5AKSA 3PFUA 3S98A 4KK6C 2VSCA 3TYGL 5HPMA 3JYBA 4LW1A 4LSSL 3FMGL 2BOBB 4YO0A 1F9RA 2BRQA 3DPBB 1ZT4A 2HTKD 3OXSA 1JBJA 1H95A 1AQKL 4N6QA 4HG4J 3HKZE 1ZVSA 2EY5A 2OW6A 3GKWH 3CPLB 5EV7A 4JGMA 1FYTE 4A3CH 5DZPA 1VACB 2NDGA 2W94A 4FKHA 1ZLUK 4IUUA 3WFBL 1RZ7H 2VDQH 4ZRGA 1J5CA 3P54A 4YBLB 5C4XB 1Z6HA 2K03A 3B83A 2DLGA 4MX7A 4RVBA 2WWKT 5ID0A 3O9WB 4J12A 2VJ8A 4PJAE 4WDIB 2NCMA 3SDAA 2F0MA 4HS8L 4A7GA 3GBNL 1BXXA 1BUVT 5FW8A 2EXZA 1L0YB 5LMUL 3WHXB 3O81A 5F9OH 5ISZD 3L3IB 1A63A 3M17B 4IOCA 3PNWB 3QHFH 4OQTA 1OGAE 3P0GB 3NA9L 2BP8B 2KVMA 1AGEB 2OLDA 2WV3A 3MGTB 1CE6B 1IAOB 3ATFA 1GKEA 4OCRH 1JGEA 5HGDB 1YEGL 5LUMA 1BX2A 2PO4A 5JTWA 3VWJD 4MN3A 3QFJA 5ITFA 4QTHA 2UZYA 1FAKT 1AY1H 4BDVA 5FK9A 1XBRA 3U7WH 3IKJA 1JVLA 4BXXG 3HKZB 1S7SB 2ZXAA 5IVXA 4LRNH 2ITDA 1GD7A 4G7SB 3W1ZA 4FCHA 1AGDB 4N8CH 2ZP9A 4XVSL 3UYRH 5DK3A 3VI4A 3AM8C 3X11A 5FS5A 4X5WB 4ZW3A 3T16A 3NPSB 5IVNA 1QA9A 3EUDA 2I5YL 3D18B 5ITBH 2I60H 1NCTA 4PJAB 2OTUA 1K83H 4GUPA 4XNZC 1WAEA 3VSUA 3LS5H 2VRAA 3TBVB 4F37K 2AK4D 2A4EA 3GS0A 4FJ6A 3VXNA 3FKUS 3IMVA 4PS8A 2HX8A 5AOLA 4ZAKB 4ZW5A 1MSHA 3MUGB 5I8EA 1FNWA 3ARZA 3MUUA 4DV5Q 1KGYE 1AP0A 1R6VA 4DGWC 1VQCA 4DV4L 1KIRA 4N5EC 1HINL 2HUEA 5IHUH 1HHIB 2NVXH 2VXVH 4MA1B 3V4VA 1XAKA 2VXUL 3WGVB 1DP0A 3DWTA 2XU9A 5A2QL 3GJEB 4LCYA 3SDCA 2AJZA 2DQJL 3AY2A 2DQCH 2VYRE 2DQFB 2BNRA 2ZUQC 4GIAA 4DR2Q 4XMWA 1RFDH 3T1HL 2AXFA 1XH3B 2OMUA 1FJGQ 3IMSA 3MUJA 4UT9A 1DZ0A 3FQ4A 1HNGA 4U6VH 5DFVC 5I82A 1CF1A 2J8UA 1U5KA 5FYKL 2BY3A 1KJMB 4AMKL 5AWNL 4IPGA 1M6UA 2NW2A 1WFJA 4XAWL 1J48A 5D8JH 1Y14B 4L9LB 1UD3A 4A67A 4OI7A 3VTAA 5CU5A 3LD8C 3T56B 4AM0B 3P3YA 4PR5B 1OEZW 4YHIA 2LFNA 2A8VA 2OX5A 3I4NB 3BRFA 3F7VA 2L8AA 2Y36H 3KDFA 2EIZB 4X8CA 2WQRA 5C0AA 4NNPH 3JWOC 2F0HA 3F84A 2FHBA 3AU1A 3JV0A 4KJYA 1MELA 4I0PC 4YZFF 1MRCL 3CZUB 3OJDA 3SB3A 3NTCH 5E6ID 3S3SA 3ASOB 3KDMA 1XIWD 1BQKA 2L7QA 4HKBA 2ZT9C 1ZHNA 3A55A 5DD3L 1AGCA 1OF2A 1PKQE 1CKNA 1CDUA 1A6TA 3SDZA 1A4JA 1ECYA 3GDBA 1PAMA 1CI3M 1B9NA 1FV1B 1FH2A 2FSDA 2YAEA 3HMXA 4IOFC 4FNRA 2JE8A 1INQB 1XL4A 3NJXA 2DQTH 3RWCA 2WQ8A 4X7CC 3TZVB 4FQXA 5EAYA 4G3YH 5J1AB 3HHSA 3MODH 1G43A 3Q43A 3K58A 2DWDB 2ZQKA 5C0ND 1UEAB 4B3RQ 1KBVA 3LKRA 1EZ8A 2COQA 3CVHL 2XWTB 2MCAA 2MNAA 4NKDA 1JZ3A 3BAXA 2GHZA 3AUVA 2CCVA 4B9JA 3W5NA 2DV6A 3CXHK 1SY6H 5DM63 1OXUA 3CXDH 4WHTA 4X5LA 1KEGL 2UUDK 4C8XA 2XJKA 2XG4A 7FABL 5FKAC 4G7ZC 1UE7A 2W0PA 3NRFA 3QK0A 2PNDA 3QZNA 4S1RL 4FNQA 4OZFA 3GEWB 4O00A 5E8EA 4D8PB 4MTMA 4FERA 2B59A 3KWWB 4JHAL 4Z0XA 4DPAX 1TTCA 3P4NB 1ZK5A 3HFZB 3CMOH 3T3MF 4ZJ9A 3DSFH 4XVJH 1X9RA 3GSRA 4P59L 4Q6IA 1KIPB 3OB8A 4Z7OB 1E28B 1WAAF 4YFDB 2A3TA 1FI8C 2E8ZA 2UWEA 4QXVA 3ECBB 5E9DE 4AEHH 1DQLH 3MFYA 2E7LA 5IYCG 3HNVL 5IP9H 4WJ5B 5FYJU 4QRRE 1NCAL 2EABA 1H9SB 1PFSA 1F0LA 2C3GA 4GXUN 3C8DA 4PVNA 3QB3A 4A3MG 3QUMH 4OLXH 2QKIB 3GMOA 4KTEL 4E0RA 5CEZL 2VABA 2Z7UA 4PY7B 4DCQB 3GSNA 3L7ZC 1PZJD 1WG3A 4PGCB 2QHRH 3D69B 4G71B 1FVEB 4WKZB 2CR6A 4LVOC 3VGHA 2R7ZG 2CJUH 2QADB 1YJWA 4HETA 1V10A 2E8YA 5LN4A 2YC1B 1QSFA 5IZ7A 3FU3A 1MFDH 3GDCA 4KUZL 4ZPTA 3OM3B 4M8QB 3GK8H 3BHBA 4IRSA 5EF2A 4JFDD 5KEZA 3QBTB 5CF3A 3V7AE 1D5BA 1J8KA 1CG9B 5D1QC 5E9DB 2JKRM 1NEUA 3CFEB 3IM1A 2FIKA 5ISZE 2VQ4A 3TNNB 3O6FA 5I19H 1P4IH 3THMH 5IEKA 1SEQH 4QRRB 1JXKA 2FH6A 4XBGA 3SKUD 4LNRB 1DN0B 1HSBB 1YNND 5L4IA 1A14H 1IC5L 1JTPA 3D2UA 3I6KA 3ZE1B 2Y7QA 2C9UA 3UP6A 3S34H 2WSPA 1WD0A 2E46A 5K59E 5DHYB 3TTSA 4KZDH 4OLZL 1U8MB 4CGUB 2R7FA 3AADB 1CZWA 3EZJB 1UGNA 1DVQA 3B2UC 3QPXH 3UG3A 1T0PB 4Z7WF 1I3UA 1K3BC 4DA2A 4HMCA 5LAPA 5AALA 5I6XC 1ZHKB 1E67A 4PJ5B 1QR1A 2CBMA 3P3UA 1BZ9A 1C7TA 3GTQH 3FCTB 2WQUA 3OGOE 1UACH 4LEXH 5EFIB 3V4PL 4QJ5B 2GSMB 5FUZL 4JI1Q 2VN3A 2AV7B 2PNHA 2BCOA 1OE3A 4PLKD 2OT2A 5HGAA 1FNGA 3CFDB 2Z8SA 5IYCH 2AK4E 1F11A 3E0JA 3Q1SL 4Y2LA 4KFZC 3UAFA 1DVUA 4F33A 5I28A 4LVHB 4JHWH 5ISZB 3C60D 2EYTA 2AQ2B 3D5OF 1JTOA 1WC7B 1PTOC 3ES6B 1Q9KA 4I77H 1PDKA 2ZCHL 3E2HB 4XNQA 2CJSA 1IM9D 1F02I 3D4CA 2EYSA 2GVBA 2VAAA 2VZTA 4HX1A 5TE6H 1BVNT 4A2MA 5IB3A 1PZSA 3NZHL 5D96B 5AZ2L 2HJKA 4ALPA 1LNUB 3FHEA 4BJLA 2R7ZH 5IE8A 1TTAA 2ZUYA 5KBPA 1B9ZA 4X3SA 4U33A 2EY1A 1L9PA 1KACB 1LYQA 5ENWB 1UA3A 2DOCA 2A83B 3MLRL 4IMLA 3E1F1 2DLEA 4P2OA 1XPUA 2G2RB 2VKWA 4OT1H 3SGEI 4YC2C 5E23A 3ZKMC 3WENA 3HVDA 1X3DA 3N85H 4UQAA 3ZKQD 4F9PC 4HCSA 2DMGA 2Z6KC 2AK4B 5L6YL 3UE0A 3WJMA 1BAWA 4NDMA 5JMOC 3GXDA 2JQOA 1HHHA 2YAOA 1EYGA 2P8MA 1X4ZA 2WVVB 4M7ZB 4OJEH 3CZLA 3WNIA 5L0QC 4QO1B 12E8L 4U1LB 1IYJB 1BAGA 2WLZA 3BIAX 2EDFA 3OPZL 2NVQB 1UT1A 1KG0A 3H2PA 4X9GA 1NIEA 2LU5A 3L5IA 5DJ2A 5KVDE 1TVBA 1FAIH 1KGWA 2VNCA 1I9JL 2W8CA 5ID1A 4R5XA 5ELOA 1MIML 1S4IA 2ED7A 2DLHA 4UB0L 1G4MA 3VMPA 4AENB 1AHMA 1STAA 2YIHA 2ALAA 4K5WA 3DMMD 5K9KA 3PMFA 2ZOLA 3GM0A 2B5IB 1SLVA 3JTSB 1E3ZA 1M7UA 1OOWA 5F3BB 3MUZ1 4KK9D 5DUBA 4MCMA 2A0LD 4GBXD 2WBJA 5IGFA 1XSJA 1ZHLA 5DMKB 2X7LA 2IGLA 3KPOB 5CINH 5DUPH 5I5MA 3UTQB 1R5WB 3PLYA 4ZT1A 1B6UA 1BZOA 3WMQA 4FXLA 2DY8A 4KHTH 4XXWA 5E8DH 3HUJB 4PCSA 5CGKA 1GZHC 1GAFL 3LRSA 1KWKA 3D0AA 2XWJB 1E0BA 1SSOA 1J18A 3IF1B 4KK6D 3Q23A 3QDGD 2F68X 4Y5YC 5DJZA 4M5YL 5IK3B 5JOEA 2OKMA 3K6SB 1E0OB 1RZ7L 1OARL 5BRQA 2XNAB 3II2A 1QNZL 4R2GD 5EULV 2YUWA 3CK0H 3MLZL 1U8IA 2HSIA 5JPNB 3A7LA 3CV5A 3R3OA 5DT1L 4AJWA 3OZLA 3FS9A 3ZYIA 3QHFL 5F7UA 1UE6A 1B3QA 4LSQH 5M3FH 1OD9A 4PJGB 1EFXB 2CIKA 2LV4A 5J11B 1LWHA 5E4OA 4UV7L 3MRFB 5AAWA 4G5ZH 5EKIA 1BVKB 2V9TA 3EG9B 1AY1L 3N41F 4G1EB 1IBKQ 1OCCB 1RURL 4QDGA 3U7WL 5JZ7C 5KAQF 4G6FD 5DK0A 2YTVA 5CIPB 1VADB 4JZOB 3DXJC 3MBED 3DVNB 5AW1B 5C4JB 4LGPB 2JKNA 4E41B 1SYGA 1OAXL 1H0DA 3CQFA 1IM3D 2JA6B 1XCTA 2V3FA 3NSDA 4JFDE 3X1NA 4KKAC 5I5RA 2YSTA 2R9HC 3FQUA 1P1VA 2JKTM 3U0PB 1CUOA 4YMPA 2KENA 2L1BA 1NCHA 1QW8A 1PZAA 3LYRA 4A3FB 4JANA 1UEYA 5TTRA 2P42B 5DJYB 3V7MA 4TNWF 3VMNA 5DSCB 2Z7WA 4DV3L 1WIPA 4X64L 3ZIMA 4K3GA 1YN6A 5I76A 3J7HA 4FC3E 3RGVC 3MCYA 4KK8C 2APSA 4P9HL 2O72A 5IHUL 2VXVL 2ZSWB 3S9WA 4EGVA 2YPLB 5D4HA 2FINB 4YSEA 2DQCL 2W91A 2DQEH 1TZHA 4RETB 5BPPA 4WFED 2PP7A 1A9BA 1LM8V 1KDBA 4S2SA 5GS1C 2YD2A 1ZSDB 2XWDA 1OTCA 2XTLA 2XZQH 1X7QB 5AYUH 3S48A 3BWZA 3BLBA 4IDJH 4M43L 3T65A 4URTB 1EIGA 1P4BH 3IJYB 3K8KA 5DJCB 4ZUWA 4WAFA 3TEYA 4P48A 3MC0B 2VQEQ 1E2WA 4LPWA 4S1DC 4JI3Q 1B4OA 4MDJB 2WCGA 1GUTA 4NXSA 5CLWA 5DFVD 4QAMB 2VDKH 3O11B 4DUZL 4ICWA 5LN8A 3E8VA 2DJMA 3VD2A 1OIOA 4Z0BH 3QG7H 4PJCB 3G48A 1ASYA 3KXFA 5B1KA 3ZDZB 3O4LD 4ONOA 1G1KA 4CVXB 4E9LA 1W16A 4WI8A 1K9TA 1SJED 4PTUB 3H9ZA 4WUUD 1KYDA 4DO6A 2KECA 3NIGF 5KBDA 3W5OA 2HX9A 5JW3L 3EYFA 2Q86A 1CFSB 4HIPA 3TEXA 5GGTA 1A62A 1RIUL 3JZ7A 1QZ1A 3O4OB 1ZLUH 3EFDL 2KCTA 1MSGA 1BQHA 1WT5A 3R4DA 3TBIB 1E4WH 4KXDA 3UTPD 1SFOH 1CLZH 3RL1B 2EYMA 4GXFA 4QLRA 2A6EC 4PREA 2X4PB 1OOAA 2F1EA 4XNMB 1UA6H 2XETA 4HWEH 3WUWG 1G7HB 4G5AA 1KRSA 2FECL 1WAAA 1CU4H 1Z2KA 2JKXA 3QCUL 3FF8A 4XP6L 3L6FB 1F00I 4P2QA 3ERSX 1PLAA 3ESUF 3HNSH 3T4YA 2ZXEB 3RVVC 1C7SA 1F4XL 4YHHQ 4UU9B 2Q76B 5IJVA 4LCWB 4GW4A 5JNYA 1RAMA 1NINA 3HS0B 5BS0D 5IR1B 4HD9A 4NHUB 3WHE1 1BD2D 3VR2A 2JNZA 3CMOL 4K94H 3D1MC 1TZAA 3DSFL 3I56A 5D7IB 3CCRA 4FNFA 3H0TA 4K5MA 4NQQA 1GSMA 3QWOB 1QNIA 1DCLA 1JF1B 1TJGH 2GHWB 4PWGA 4Y2DD 4AEHL 1DQLL 3AGWA 4P3CH 3JAML 5J89A 2B9AA 4G7VL 2WPGA 4XCCH 5GPRA 2KA7A 2E27L 1TQUA 1G7LB 4HSQA 2AJ3A 4MRCA 4PJBE 5I5JA 2DWYA 3CCHA 3NIFF 1LWJA 2AEIT 4L2LA 1H3UA 1NAKH 5DTFA 2CHWA 5EU4A 4FG0A 4ETYA 2EEDA 1PVHA 3GLDA 1MJ7L 4X6DA 4NHCL 3QUML 2VE6A 4TUKH 2H1PL 1T1YB 1ZXKA 5D1XB 3UTTA 3OGCA 5CMAA 2RDHA 4ZFFA 3D31A 3GTTA 4I18B 4HJ0C 4LEOA 1EK3A 1K8GA 4A3MB 3QDGE 2CJUL 3BAWA 4DWHA 5K9QG 3Q48A 1EEFD 5AL0A 3RBGA 5E4EB 3SDXF 3VI3F 2EJGC 1MFDL 3BWUC 5JIDA 2Y22A 3IFDA 3CX2A 5AW7B 3GK8L 4A2FA 4WO4B 3DMMB 4X4MA 3LB6C 2PMZB 4Y52H 1L9MA 3F83A 3L3JA 3MRPA 5EN3A 2BS9A 3N9GH 4K3JH 4LUVA 4M8VA 1KJVB 1K72A 2KEEA 3PWUB 4J3SA 2DH3A 2JK5A 3PWJB 1JWUA 1SYSA 3EDEA 1Q0YL 3OMNB 3S35H 2JSFA 4PJBB 1HWGB 3TN0B 5I0DA 4GBXB 4UOZA 2PPFA 4P4KB 2ZOWA 3OLEA 3KL3A 4L8JA 5D1QD 3AEVA 4A3GG 3ARQA 2CM6A 2BSSB 1A14L 3QNZA 1RF2D 5DJ6A 2ADJA 1PZ5A 4QJ3B 4ZDHA 1FNSL 1R5VB 2EEXA 4UOW1 1B9MA 4MJ6B 5KVGH 4KZDL 1V05A 2CLRA 3QCVH 4W70A 2FO1A 5E1HB 5JIKA 3QDGB 4B50A 3QPXL 1D7BA 3BWSA 3ET9F 2NVYH 2IC2A 3C1EA 2CO7B 5TQ0H 1UXWA 4R2GB 2YD4A 2WAQE 4UIKH 2WBJC 4EIGB 3EBIA 4M1CD 2F58H 3B2UD 3BOVA 3IFOA 2CQAA 3QEGL 1CL7H 3C9NB 4PRHD 1MVUA 3QQXA 5IGGA 4FF1A 2E2JH 4Q9CA 4JHWL 3VDBA 1ICTA 4L4TD 3BUTA 1V8QA 5FLXL 4BCYA 2O6PA 1IGCH 3IAQA 3UG4A 3A5ZB 1ZWIA 3VXSD 1U33A 2MPMA 1KCSL 4LE8A 4I77L 4HIQA 3A47A 4BA8A 3CXHJ 3KPPA 1WS8A 5EF1A 4MB1A 4WFEE 1PTOD 1KN4H 4A3KB 1LK3H 2J43A 2UXTA 5D70L 3EJUA 2VGLM 4ATWA 1PCXA 3MBEB 3QFGA 1OQOA 4O2EB 5H94A 3S2HB 1KB5B 1IM3B 3RWEB 4MD5A 3MLUL 3RWGA 3L5WB 3LV3A 3TTYA 4I5BA 5A2BA 2JI1A 5D3IB 1A3LH 1XD1A 3UYPB 3N85L 3MNMA 2KHAA 4YNYB 2YSSB 3NCMA 2B3RA 4OZ4A 1CMOA 3RYMA 4EQ5A 2BSED 1O7SA 2ZYHA 4A7UA 4EI6A 3ZKMD 2AQ3B 3TOPA 5IUSA 4CU8A 3BLKA 3JVGA 1MNNA 1RVFL 3O4LE 2A6HC 2BO0A 1G0XA 4QUOA 4GSUA 4L5FE 1HHGA 4LSTL 3F8TA 3ECWA 4WUUE 1LTXA 4X5RA 4B0MB 5KSUA 1UOVA 4E2OA 1E8XA 4JFED 1DE4A 1YJDC 5EOTB 4ZW6A 2CO6A 4H7VA 1I3VA 4HJTA 3VR6A 2GK0B 4J2QA 4P0DA 4DZ8B 5I66A 4JPIB 1JCVA 1EY7A 1WICA 4NUMA 2JEBI 2N55A 3ARDA 3QIUB 1YEKH 4FZ8H 4OX9Q 4JREC 4H5SA 1YNLH 5KUKA 4ORGA 3BVDB 5F1OB 4UQIM 2A4ZA 3UTPE 1LO3H 2V9UA 3GGWA 2F0QA 5T1KD 5IMMA 5GGQH 2X3CA 1JZ5A 4JDVA 4U31A 1QI5A 1PH7A 3EROA 3KJPA 3QORA 3ULVH 2HYMA 2VB2X 1HNWL 5DUPL 3S15B 1HI6A 3L7FB 3E3XA 1YIJA 1AGBA 1NEZA 2F08A 2WOBA 2X40A 3NAAH 3O4LB 4E9XA 1IC7H 2EYRA 2ZPKH 2B1OA 4AJVA 5TDPA 1SMOA 2N78A 4Q7DA 3D3RA 2Q9OA 3ZXAC 4KY1H 4WUUB 5BS0E 2VB3X 1I50H 1MCWW 1N8ZA 1Q46A 4OM1L 4W68A 3BAEL 5TD4A 3VYOA 1BD2E 1GOZA 3ELAT 5HPOA 3VXRA 4X9HA 1YHPA 5C97A 1NANH 3C87A 3Q8DA 1F6AB 1IKFH 3UO1H 1AVAA 3GPEA 4Y9GA 2W60A 3CK0L 2PCPA 1JVOA 4G7RB 4HJSA 5CEXB 4GUCA 4ILDA 3L9YA 4YLQT 3KL5A 2KKQA 4MD0A 2ZWNA 1RJTA 3STBA 2FFKB 4DGIL 3L16A 5IP4A 3ZW3A 1NGZB 1MIUA 1G5GA 1U2HA 2BOCA 3FL7A 3G5YB 2MO0A 3E6ZX 3NFNA 4FI7A 2W9LA 5A2JH 3ESMA 3A56A 3QO2A 1RQ5A 4W9IC 4YHLL 1VFUA 2RFXA 1TCRB 2F5AL 3IFLH 1NDMB 2BIMA 1VZIA 1SROA 1WZ1L 3UJJL 1ZHBB 4LPYA 2C9PA 3LXUX 5I1IL 2PABA 2LY7A 1M8AA 3ONAB 5BS0B 2VB5A 1GZPB 5BRPA 4DEPC 1ND0B 1YEDA 3IWVA 2WLIA 3QJHA 1JGVL 4L29A 4OQ1A 4WY7L 3U4EA 5GS2H 3D4ZA 2N7SA 2VZSA 1CYGA 5JZ7D 4XMLL 4XC1H 2VCOA 3GXIA 4HALA 3FF7A 2JQAA 1U95B 1RD6A 3QJUB 4Y2DB 5E1AA 3QQNA 3RFZB 4U1JA 1IYUA 2JJUA 5EU7E 2QMJA 3DTXB 4LL1A 1KXTB 1UA7A 1KIQA 3BGMB 4OJAA 2NYYD 1WZAA 3GHEH 3QXDA 1VQFA 1N26A 2YD0A 3AS0A 3MMEA 1SXCA 4HJAA 2R61A 5D1QE 4YWMA 5LB1A 4U3XA 2ARJQ 1X5MA 5G5DA 1STEA 4GP5B 3JV4A 4FA6A 2NTFB 3FH7A 4HSPA 2B4CC 1U8OA 2DQEL 3KOJA 1S5CD 5ESQB 5J8OA 3MTSA 4MJIB 3WL9B 5I23A 4WEBL 4FNLH 1A6AB 4TQHA 2BVPA 2VQUA 4WGVB 2VMFA 4AYID 1QSZA 5ABAA 4HUVA 3SVMA 4QQBX 1YYCA 5AYUL 4N2IA 2WLKA 3DM1A 3P1HA 1ET5A 1CT8B 2G75A 1CGUA 5GRYA 4Y4HA 4TNGA 4FF3A 5E2WH 2XACC 4GNXC 3VXSE 3L3OC 2IJ0C 1DQML 4KI5F 5EH1A 1OY3B 1P84K 1OXXK 2A9DA 4S1DD 1M2OA 3QS2A 4O0AA 2EO7A 2FBRA 2JA7H 3GTPH 1WBZB 3MXWH 4WV1A 2QPEB 3B5HA 1DVFB 1E50A 1FRGH 2J88L 1RJLA 3MJ8B 1EEYA 5E2UH 4AJYV 3SHLA 2WXMA 1HIML 4HGKC 5FCUL 5AW4B 3RKDC 4KROB 1AXSA 1PNDA 2V5MA 1MJEA 1S6NA 4J8RB 3QXUA 1AACA 3AXHA 4OBRA 3QIWA 3HBGA 5DLML 4DAVA 5K39A 4FJZA 3L4XA 2R7DA 1E4WL 5HHMB 1S9KC 2ZXBA 1QOHA 3MR9A 3WFDL 4LDEB 3WEAA 5I17A 3EVQA 2Y6TE 4N9PA 1V9PA 1H3GA 1TENA 2E9WA 2O5XH 4DV7L 2CPUA 3WO3B 1HCZA 5EU3A 3VXSB 3OR6A 3VFNA 3SE0A 2DBLH 3TT1L 2V7HB 4KPHL 1TJHL 1Q9LA 2GFBB 4M8RA 4D0DB 3HNSL 5EO9A 3T0EA 2FUQA 5LWYH 1PRTF 1KDIA 4AQEB 4LLYA 5T1LD 3TJEH 4AG4H 2C4FT 5KSAD 4JFEE 5E6RB 2F0FA 1VPOH 1G7QB 4IUQA 2A2QT 1JV5B 5DHDA 4DP2X 1FVDA 4K94L 1J8HA 2HPTA 3RVVD 2BDNA 4LOUD 4BSVA 4DOHE 4KV5F 1OAYL 4CW1B 2H0EA 3LEYL 3MLSH 4N2NA 4P4RB 5IM7A 5CFHA 5CZXC 3Q8EA 4JW0A 2ASBA 2KC0A 4P3CL 3DVGA 4XCCL 4KRLB 2Q2EB 2P24A 3QZWA 2OSYA 5CSBA 3HE6B 4FQJH 3VM5A 4DIXA 2D7OA 3NOIA 2VLKD 4F2FA 3VI3A 4A3DG 3IXTB 4N85A 5SX4H 1E4JA 5B4MC 5KS9E 2DI9A 4OB5L 4A7SA 4FO2A 1RZJC 2DWEB 2J1YA 3MV8D 4JHUA 5GGRY 3QJQB 4YDVB 2BWIA 3KYKL 1BFOA 1GUGA 2IFFH 4CC4A 4XYQA 4Z3TA 4OGYH 5T1DL 1VFBB 2Q2IA 4K0OA 4R90L 4ODVL 1WA1X 3LXCA 2L15A 4Z7VE 4DNLA 4WKXA 1NGXB 1LTRD 1NBVL 1QHOA 3WKMH 5EIIG 3DIFA 1BQUA 3D07A 2PR4L 3BQUD 4HJ0D 3PUYA 5CV5A 3U9PH 4FZEH 5JXEC 1J8IA 4WSJA 4KKLD 5F88A 3LIUA 3BYTA 1VQBA 3N9GL 4F3FA 2Z4IA 3HC0A 1B50A 3PIQB 5I1KL 1IEHA 1QFWI 1KLUD 1QG7A 3RI5F 3ULUD 3NGBB 2IG2H 5D7JC 5DRWA 1UCBH 3S35L 5K69A 2VO5A 1CVRA 4MYWB 3DX7B 4R7XA 4MS6A 2EACA 4P05A 5KS9B 3BVGA 4P5TA 5J1ZA 5GRZA 4ZZFA 4PJDF 2R4RH 4CC0A 1JERA 2EH7H 1D5ZB 5EDSA 4HPOL 3D3VB 3K2MC 1KZQA 4NQCB 5KVGL 1HSAB 1FFPB 3MCKB 1O0VA 2DWSA 3E6HA 2QJDA 3QCVL 4DERA 3BH8A 5C8JA 1J5EQ 2V5YA 2AJVH 3I2CH 3LS4H 5E2TH 2GT9A 1JJ2A 4HZLA 3HR6A 5DS1A 5D6DA 5GRVL 1L0WA 3HPJB 5TQ0L 1MIEH 5FCSH 1FNVA 4DK1A 1I7ZA 1I5FA 2WW8A 4UIKL 3SE4A 3ZHDA 1ANUA 1F3DJ 1F3DH 1R34A 3LNNA 1MCCA 2F58L 3IPFA 3QORC 5DO2D 5KW9H 4N28A 2BVQA 2OMVB 3RVXD 1JCKB 4YVUA 1CL7L 1SFHA 4UQ2A 5JOFB 3EO1A 4A66A 4QTIH 1SHMA 5JPMC 5G4NA 1WE5A 1P6FA 3QHZL 3IGAA 1IGCL 4XOBA 1MHHB 4A3DH 1E9OB 5F7AA 3IXAB 2W07A 3S2CA 3QUXC 4QHNA 5CUSH 2XI9A 5F7YC 4CVZA 5JXAL 1T7XA 1IT9H 3NBIA 2G2NA 3PHOA 3DEPA 2XDHA 4J3VA 4Z7OF 1RUPL 1FGVL 2PWEA 1LK3L 2BIIA 1F56A 3N1QC 3U25A 4Z95H 2BXZA 1AI1H 3AABA 4X80H 5TE7L 3RY4A 1YVCA 3NH7L 5GSVB 2LOEA 4DESA 3VFTA 1YNJC 3EGXA 5L2KB 3FW6A 4GRMA 2VH5H 4MQXC 1MFEH 1PXUA 3GO1H 3BKMH 4O4YH 4X7EC 3D87B 5EKLA 4Q5VA 1A3LL 3L4WA 5GSRA 5EZIL 4HKZB 2AXGB 3LKQB 2FBJL 4QYOA 4ODSL 4J3OD 1J88A 1WCMB 1WFQA 3WSQL 3QAZC 4I0CC 1KZYA 3EHBD 4DP9X 2Y0SA 2ZWLT 3TESA 2RTTA 2W0FA 2P46B 4F2EA 3R8BA 1DBML 3GXPA 5K5YA 4F7PB 3TF7C 1AN8A 1X5ZA 4CGYB 3K5LA 3HB3B 2DM4A 4LSVH 4N90D 1LE9A 3RG1C 4BWWA 2VC2B 2F3WA 2A6HD 4D7PA 4NQDA 2FJUB 5C4XH 3T2LA 1YNLL 1KCUH 4XMKL 3QQ4B 5DD0H 4ATTA 5KVFH 2H6UA 2CO4A 1CKOA 2AEQH 2OMNA 1P9MC 3WTVA 2EYFA 3E5SA 3WDJA 4OD3L 1TR5A 4FGMA 2JXMA 3REWA 3FHWA 2HDMA 1PV4A 3ZPDA 4UOJA 5GGQL 4S0SD 3LQAH 2K5DA 3GF8A 4LZKA 5DHVH 1WK0A 5IB5A 3KPMA 3ZE1F 4PJXA 1FL6A 3LKOB 1CGVA 2XVBA 2WXGA 4P46A 4TUJA 4N8PA 5D93B 1J8SA 4OIAA 3T0WA 4NRZB 4HH9A 1IC7L 3TPUA 3T6VA 1RL1A 4JY4B 3ICEA 4P71A 1A7QL 2G5DA 2B9BA 2FJSA 1AG6A 1A6ZA 1NBCA 3N50A 1QTSA 4XNYH 1SXAA 4X0KB 2E9IA 5JEAG 1XXDC 5HHXH 1JJUA 2EIJB 4HIDA 1Y1WG 2JJSA 1PYBA 3UO1L 4XMVA 1MHCB 3VFVB 1KTLA 3VVWA 3WHE0 4Y4KB 2XIIA 5DUJA 3CFBB 1BXUA 3DX6B 3HRZA 1DUZB 2DLIA 2CDFB 4PJFE 3W9DA 2VLMD 2VLKE 4KXBA 4NN6B 2EEAA 3OKMA 3VG9B 4FXDA 4NNXB 4RMRA 1WWCA 4PRPA 1XWVA 2IBGA 1EHNA 2Z92B 5BNXD 3MV8E 4G8FA 4RGOL 4V2BA 1P6WA 4R84A 2VC2L 3KH4A 4K4KA 1KELH 2J6EH 2WK2A 2K6WA 3RUZA 2LU4A 1A7NL 2K6AA 3TEHB 2X1QA 3GXUB 4LKXB 2DLFH 4HAEA 1SDYA 2QTEA 5KSAB 5J6HB 4K07A 4ZUUA 4FNSA 1E1OA 4FFWD 4JVUA 1I31A 1H3PH 2CH4W 1MCWM 1MFCH 4HK3N 4POZC 3V0AC 1I3RB 3VH8A 4IIQC 3ZKSD 3BD4A 4DKTA 4HK0A 1Z9OA 2GB2A 2J2ZA 3L4VA 2G0KA 2ZOKA 2AJYL 1PYWB 5CJQH 4Z8FL 2MJ8A 1O9ZA 5BN5A 2Y1YA 3ULUE 1RK7A 5FGBC 4APQB 5F71A 4C56A 2OCCB 2AMUA 4K7FB 1R3KB 4JI5L 1NUFA 3Q8AA 4MXQC 2YJLA 1GOFA 4PJFB 5BUPA 4FQIH 2VLKB 2TSSA 1S7UB 1N2RA 3GHEL 2N8NA 5CSZB 1Q8MA 1ESFA 2C3XA 2WKLA 2OM5A 4P23D 3MV8B 5A3IC 1QO3B 2R2BB 4AKOA 1YEJH 1YBYA 2HX7A 1CTMA 4JPKL 5ESVB 2QT6A 2BFVH 4CNIB 1WCBB 1UUPA 4HUUB 1G94A 1ZDSA 1TVDA 3NSWA 1R33A 3MXPA 4DR6L 4FNLL 3S5LB 3UZEA 1TPXB 2VW6A 4XX1E 5JEAJ 3TVMC 4DR7Q 5CJXA 1PQZB 3PUWA 2Z3FA 1NKOA 3EFXD 3RLOA 3BH9A 5AZEH 4BHUA 4YDIL 4UQBA 1TS2A 1VQMA 4FYSA 4IFDH 3PO3G 2E7HA 1TVXA 3K5MA 2K7QA 3O3AB 1IZ6A 4PP1C 5HDOA 2YK1H 1I8IA 2R1XA 32C2A 2WUCH 3T08A 4KHPL 2BNQA 3SYCA 2PYEA 3LRHA 5FFOA 1YN7B 1TZIB 2WFWA 4CC4C 1NWOA 5DVKA 4KXCA 2FDBP 35C8H 4S3SA 2YPVH 3HUJF 3G3LA 4HEPG 1QI4A 1ZVHA 3OZ9L 5GJSH 4J6RH 4RKLA 4CJ1B 1EERB 1AEXA 5IGDA 3BCFA 2CGZA 3ARUA 2KDYA 4S11A 43CAB 5C7XH 5EEVA 1A7PH 5KGUA 1IQDB 3WV0A 2JB5H 1CQFA 3A54A 4HLEA 4R4NC 2I0QA 2NQ3A 3L17A 2K01A 1X54A 4QTFA 1VGKA 1O7ZA 5E03A 3KPQB 2XN1A 1GRWA 3RX9A 3I02A 4BY1G 1UH4A 5DJ0B 3L54A 1YMMD 4HIHB 4PJGF 3UC2A 3QDAA 3RKDD 4P5TC 2P9RA 3BAJA 1A1MA 1UADC 5KJ4A 4OV5A 4GKSA 5EBLA 3WIAA 1NMBL 3H3BC 2YJQA 4LSPH 5F8QC 2ENPA 3BFWA 5B21A 4P5KA 4OAWB 5MEOA 3OKNB 5GS0D 1RIPA 2F7QA 4M6OL 2AEPL 3UZVB 3QG6A 4N6RA 4UZUA 4HHAA 4PWFA 5I24A 4EPSA 4IBWA 3GZOA 2OTJA 1QBAA 3DBXB 5D4IA 3GJFB 4V11A 4AYBA 2EDDA 5I71B 5FLVA 3VAEA 2JA5G 3RR5A 3QUYC 4HUWB 3TJEL 2J7ZA 5F7HA 3TONA 1RP8A 1UKTA 1Z9SB 3CVHA 1I1FA 3QZPA 1AHWC 4HUXA 4K8JA 3HRPA 4UCFA 2PWGA 5B8CC 1EXHA 4MXVE 3NELA 1UWGH 4HMJA 4RMWA 2KCNA 4RMSA 2UY7B 2PYFB 4QHKI 3NQTA 4LF9Q 1E3FA 1UXSA 2APXA 4A6YB 4C4KO 1T66D 1KGUA 5ETUA 4DV1Q 5DYOA 2F7OA 4JG0H 1B0RB 3T1FA 1I4QA 3HEIB 4NXMQ 3FU9A 3N52A 3K80A 1TTUA 4JI4Q 1D6EA 1R0AH 8FABA 3P73A 3SE3C 3V6FA 1UE1A 2LAGB 4AIMA 1X55A 2NVTB 4RFBA 2C26A 3X3MA 3EHBB 4Y9CA 3UTSA 1TEYA 2DJSA 3ARGA 4AE1A 2GUYA 2CMRL 1GUSA 2R0WH 2VLRD 1HZCA 2IFFL 3CSBA 4DAGH 1UATA 3DXAA 4OGYL 3K4DA 1XD0A 3AWGA 5HYJD 5FM8A 5EO1A 3RJOA 2AKRB 4BE6A 5B4MD 2DUDA 1IKLA 4HEDA 3S1QB 1F4YH 2F15A 2PTTB 3NBNA 3OX8B 1R5IB 5IQNA 1OT1A 3GMPA 3WKML 2P5EB 3DK0A 2NLJA 3KHQA 4LHUD 2QA4A 3WEBA 4N0CC 2ESVB 2R69H 2WC7A 3D25B 5L8KB 4Y8DC 1X32A 4PJDA 2AWOA 4RGNA 4FZEL 3I91A 3SQBA 3U9PL 3WO4B 2AQNA 4LDCA 3N1PC 4RFNC 2AV1B 1FBIH 3IS1X 1YNKH 2Y3AA 2K32A 3BEVB 4LHJB 3IAPA 2CKBH 2GVYA 2ID5A 1UCBL 2VLME 2EDOA 3DSNB 4PJCF 5F89B 1S7QB 3SEPA 3ZDZF 4BKLB 3NJFA 2A6KA 2XUWA 5FM5O 4PGDA 3M3YB 4D2NA 4Z3EA 4BK5C 4X7TB 1O7VA 3MXUA 2PN5A 3WBDA 4GKKL 1P4LB 1GPOH 5E5RB 4GEJA 2EH7L 4TRDA 3FQRA 4JFFA 5HI3D 4GRLD 2A68C 2APFA 3W1BA 2WB1G 2QVMA 3Q6GH 3QDJA 4M3KB 4AIOA 5EZLB 1PFMA 4HIKA 3IGFA 1BO0A 2AJVL 4A6YL 4HWBL 1CXHA 2X4SA 3IU4H 5E2TL 1N33L 4APXA 1A2YB 4GB9A 3SPGA 2R29A 4BEIA 3CZGA 5LG6A 5KW9L 1YLBB 5DAUA 2CD0A 4IOIA 4IW4C 4P46C 5I26A 3SDDA 3B6YA 4R4TA 4XIGS 5C9KA 3J81L 3HVNA 4A3BG 2WWNA 3BMWA 4NOFA 4Y7NB 5GISL 1L2FA 3GB7A 3DV6B 3RJQB 4X4YB 2X05A 1MI5D 4LUZA 3V4PA 4HEMA 2XHNA 4R0LC 5CUSL 4O2CA 4QRFA 2FGWL 3ZO0A 3D9AH 5KN5A 1EAPB 1T7VA 3LPOA 2WZPD 4K5XA 5D7IF 2VL4A 1M05A 1NICA 2R15A 2VZOA 2HB0A 2FGZA 4Z95L 1GJUA 1AI1L 3HKFA 4X80L 1OXYA 1XPOA 3B3IA 3L9RB 4PAZA 1K8AC 1Y6MR 1HH2P 1MCFA 1T4KB 2NR6A 4RDBA 2EEBA 1AD0B 1XO8A 2KYIA 3CSPA 1FNLA 3OSOA 3ZRSA 1QB5D 4YWGH 1KUMA 2YRBA 2V5TA 4HJJL 1V1PA 3I4MH 3DUSA 3GDEA 4J1UB 4ZFOB 1GY1A 4NQEE 3WTTA 4PZ8A 4GN5A 4DFIA 3H6JA 1I8KB 3EGSB 4PBXA 1IGTA 3GSWA 5IMLA 1IAKB 5J5EA 1A8JH 1TNMA 1GIGH 3EZ8A 2K9UA 4XP1H 4LSVL 1CR9H 3HG1D 4FJYA 4JO3H 4A7TA 3U9UA 1UJ3C 5IIFA 4DHLA 3PPEA 4LF8L 2QQLH 2APTA 3FFCD 1RZKL 4FYQA 1YDPA 1BLNA 4HC1L 3VWKA 1JWMA 1L5GA 4B9XA 2K8QA 4Y5XA 5DVNA 3WXVH 4JEGB 1ENCA 4YAQB 4EXPX 5C09B 3ROOA 1YMME 4ZFGH 3JZYA 1JE4A 2AEQL 3PWLA 4NWTH 2H2PC 2DEXX 1FG2A 1NWPA 3EGDA 3J80E 3NZUA 2X70A 4KNUA 1EJ8A 3IDJB 5EIQA 3EYQD 1G6RB 2ED8A 1U93B 1EY6A 2ZAGA 1N3NB 4HDIA 2ENSA 4NQEB 2HA1A 5IW1B 4DXFA 1IX2A 1G2SA 1PZDA 4C2MB 1QPKA 1X5HA 2Z9TA 3AT8A 4R26L 1CXFA 3CUPA 9PCYA 2X4TA 4WWKB 1JFHA 3BDCA 4YDLC 1SBSH 2HKFL 4YHNA 3EH1A 2IH3A 1NGQL 4QWWC 2IALB 5CIPH 3U1QA 3OKOB 3Q9PA 4XNYL 5TDOB 3GMRA 3QRGL 1S7RB 1SHXA 2AUJD 3FBQA 1LEKA 3S96B 4JV5Q 2JA6H 1K8DA 2E6JA 4GSQA 1K3RA 1YMMB 2XG5B 4JB9H 3E7JA 1XF5A 4FHBD 3S4SG 4UF7C 1UYWH 5C0JA 1H9JA 3OAWA 2XWBA 1G9MC 4GT7A 4RZCA 1OP4A 4TUKL 5C0CD 3LXAA 1NSNS 3S1RB 2A6DB 2ICEC 4OLYH 4HJEA 3L4ZA 4HS3A 4JO2H 5GXBB 2FJGA 4WHCA 4QHLA 5I18H 1HNZL 2R83A 2VDLH 2VLRE 5C0EB 1OXTA 5HYJE 4ABWA 2MNJB 5EBWB 5KVMC 2DLFL 4JRLA 5GIRA 4R97B 3PE9A 2QSQA 3D6WA 3NG5A 1ZLSH 3GO5A 2TAAA 3BN9C 4AMXA 3SDYH 3DI3B 3M86A 4MNQD 4UTAH 1MFCL 4K8RH 4C4UA 1SUHA 3NCJH 3MCLL 1KN2H 3MRHB 3T3PF 1FPTL 5CJQL 4RX4A 4DV2Q 4Z7QE 4QXGL 3L3KA 3FTXA 2CRIA 3QFDB 1SYCA 1C7YA 5I8OH 4POZD 1NCVA 3VXQB 4IU3A 2I5LX 2Z93A 4BFOA 1PPIA 3J07A 5ANME 4PS7A 4KKNA 3H3PH 5D7SL 4MQ7A 1G87A 1BWMA 4YEFA 1EFQA 3Q0HA 1YEJL 2QFRA 2ZUUA 5D6CB 5EUKA 4Y2OB 3RB5A 2FX9H 2BFVL 5TE4H 4DPRA 1MQ8A 5HYJB 4LMQI 4HKJB 3MA9H 5C08B 2F5BH 1AQ8A 1ZE3H 2GJZA 2F54A 4CSZA 1M7IB 4LHUB 2D4FA 2H1EA 4WRDA 4XP4H 4XPBH 4Y5VC 1O7DC 1JUFA 3DROA 4PRBB 3V4UH 3P9MB 5AZEL 4DUVA 4UDUB 5GGRA 2EZ0C 2PXYD 4HPHA 2IHFA 5L2JB 3SQRA 3CDZB 1AO7D 2W65B 4PJHE 5F1IA 3X1FA 2WUCL 1UVQA 4Z7QB 4PB9L 3RPBA 1IHZA 2F7IA 1BGXL 3TP8A 1T5WA 3MRBA 4LOFA 1CD1B 2F53D 3PO3B 3NK4A 3SK5A 35C8L 5EC1B 1FH5H 1XX9C 2EQSA 3CH1B 5ANMB 1MI5E 4J6RL 3U2JA 2Y2YA 2R8SL 4HIJB 3V2AR 4GMSH 3WJJC 4M5ZH 1TQBB 4OZGB 3QC5X 4N0YH 1A7PL 4XGZB 4B3ML 4YPGB 1D8LA 3CZKA 2JB5L 3PG2A 3N40P 4GRLB 1IL8A 2HN7B 2VDNH 2D2CC 2D7QA 2NXYC 3BDBA 4GS7B 5LXVA 4NQXB 2WXJA 5L88L 4ELKA 2NY1C 1BQQT 2IXQB 3QNFA 3ZDXE 2ZZUT 2WWMC 1Q90A 3C6LA 1BOYA 3I9GH 3TREA 3OAYK 4QXUH 4LFCQ 5AW6B 5KYUA 3ZU8A 4F8QA 3MFFB 3BRDA 3M4QA 1S8DA 4QD2E 4PJHB 4BY1B 1E9QA 3ISYA 1LACA 2YZ8A 1MGSA 1QG3A 2Y5TA 3AAZB 3P2BA 4LSPL 3JV6A 3GYRA 2NSQA 1NGWA 4GW5A 4OZIB 2WP3O 1YYLH 1YY8A 1HILB 1DJYA 1MI5B 5AW9B 1UT9A 3OF6D 4EE2A 2GIMA 5E7FA 1HE7A 3NSJA 5TF1H 3FTUA 2VSDA 4ECNA 5BV7B 1DQIA 3OR7A 3FFCE 3PFQA 1TMCB 2AQPA 5DEFA 5H37G 4WSGA 2Y7NA 3FBKA 4BH7B 2PO6C 4NBXB 1GYAA 3DYOA 2VL5A 3BAKA 4E6IA 3ZDXB 1HFGA 3GSOA 3QUYD 1RMFL 4L1SA 2JCCE 4XPFL 4GG6F 1KYAA 3UTZA 3FO2A 2E86A 3PV7A 3TFKC 4DH2A 5I75C 5EEYA 2WAQG 1Q86C 3PIOA 1I1YA 2VXQH 3MLTA 4M5TA 1U92B 4WTZG 3EJPA 4R6UA 1DSFL 1XGUB 1QLFB 1PMRA 2I32A 2MKLC 2XFXB 4JAMB 4WFGE 5DEZA 5E5LA 4BQ8A 3MZGB 4R8WL 3D05A 5IQOA 4L1BA 1NSNL 1Y6NR 3C46A 1V54B 3W0WD 5IFJB 4ONHA 2R0WL 4NZJA 3H0GG 3RTQB 4NN7C 3TNMB 2Q2TA 2LS01 3IE9A 1T7WA 4AVKA 5AUMA 4NCC2 4BUQA 1FC1A 2E9GA 2ZYIA 1F4YL 1M57B 2XA3A 4KN7C 2EC8A 4P2RD 3FFCB 2A1WH 2CK0H 2IDQA 4XN9A 3KG5A 3MRGB 4MA8L 3DHPA 2EIKB 3WXWL 3CZFB 1SGKA 2R69L 1CFNA 2J1WA 1EEUA 3QUMA 1RSFA 4JRXB 2Q7YB 3SO5A 4G8GA 5AD0A 4TS6A 2ALYB 1N36L 3RNKB 3GMMA 5BCAA 1FBIL 2ICWI 3WDIA 2DDQL 4N0CD 1ZY9A 2CKBL 1B1ZA 1WUZA 2I07A 1X5LA 1WITA 2IH8A 5ALCH 4XMPL 4HZ1A 4BXSV 4FXTA 1P5UC 2XY2A 4LRIC 5D2NA 1GPOL 3QIBC 1M7DB 1NCDL 2JJTC 2QVIA 5CGYC 4YE0A 4Y5XC 5JOBA 5E5MA 1TTBA 4FD0A 5K9JL 2AAAA 4WF7A 2ATAA 5JW4M 4WU7B 2P52A 1YECH 5CNHA 3QR8A 5H37H 3MOBH 5HHOB 4MNQE 3HS9A 2CUAA 3IU4L 1H6EA 5GRUH 1IQWL 3RL2B 4FQHA 4ALAH 2WB1B 1OF0A 2HVKA 2A6IB 2PTVA 3OBAA 2A68D 1MCQA 4XMUA 1ZYRC 2F3VA 2L0CA 3MA2B 1LVEA 4LFBL 2UXDQ 5F97E 2OCJA 1SE4A 4JI0L 1X5GA 5E1FA 3RGHA 4NO2A 3BPLB 1JHKH 2VZ1A 1F13A 5GRJH 5IG7A 4N2CA 4QB4A 1CJYA 5LGHH 1AFVL 1SRDA 3IETA 2BIQA 3S1MB 4JO4H 4A93B 4OHJA 1UZ6F 3TA3B 1JOIA 3FOLB 4KC3B 4RGMA 2ISDA 3M1CA 4MZIA 1VMCA 4A3BB 1M56B 1A8ZA 2YS4A 3O3DA 4X62L 1FCCA 2IDCA 1R4QB 3B6SA 2G4EA 4ODXB 4HIOA 2ZUXA 1C16A 2MKWA 3L5HA 3CFIC 4ZSOA 1PAZA 3B9VA 2E74C 2AI0L 4MNQB 2ATKB 2XRAH 1GGUA 4FFTA 1SE3A 3L9AX 1PY9A 1D1IA 1AO7E 3FT0A 2BCKA 3INOA 3QE5A 3FQNA 1JJGA 1DQKA 2F53E 1CE1L 1W2KT 1W91A 3KPSD 4PW4A 4XBMA 4L3ED 2YOAA 3LEVH 4MZRA 3F2UA 1D9KA 1MZZA 3G7TA 2NQCA 3WOFA 3IMTA 2HT3D 3ARYA 1S9XB 4Z76B 2GY7B 2XZAH 1D7CA 5KYNA 4YSPA 2UYLA 5IKCB 1O9VA 1LUZA 3IJSA 3ZMNA 4PRAA 43C9A 1E7UA 2FJHA 4A55A 1GIGL 3VGEA 4DGYH 3J7AV 1E90A 4XP1L 2XWRA 2ADGB 4OIKA 3KD4A 5ICUA 1VGEH 1FHGA 3QOJA 2XN9B 3JWOH 1NKRA 2B2UA 2I69A 4PPTA 1SBBA 5IY0A 4OH2A 2A69C 4LL9A 4JJ5B 5C0DB 1WBXA 2UUAQ 4IGBC 5KSBF 2V2XA 2IMNA 5H2BA 1GS6X 3WXVL 3AYHB 2OMWA 3QI9A 4NQSB 3BW9A 3K5SA 2PXYB 2O6DA 1QSEA 3X12B 1T83A 1CLOH 4NWTL 1AO7B 5KOVC 3U0TB 5HY9B 1RK1A 4P9ML 1BXVA 2QR0A 3UGXA 2XQYG 1PG7H 1SVBA 1U8JA 2F53B 2WNXA 3BVNB 3OKEA 4Q58C 1HUMA 3FN3A 5IW3A 2P48B 3M8OH 4TSBL 5DC0A 2H2PD 3P0VL 4TPRL 5MHSD 5C0GB 2HG5A 3CFCH 4L3CA 2FQGA 4CMMA 2R1YB 3B7RL 4YHZH 1F2XK 3D0VB 4OFYA 5EZJA 2F7RA 4EQPA 4EDWH 1MUJB 4O42A 4G72B 4L8SB 5M94B 2R2CA 4GOPC 4OW6A 4B96A 2C9OA 4HCEA 2CAKA 5K9OB 4HCGA 4JBKA 2LXJA 3BU2A 1J1XH 5SWSB 1QASA 4QWWD 1NC2B 2H9GB 3FHAA 1NJ9A 2Y2WA 2DQHH 1FL5B 4FQLL 3TO2A 1YJ9A 2G5BB 1CN4A 2WYHA 4LPUA 3K6IA 4D0BA 2GJPA 4LP5A 5AKRA 5I8CA 4OLYL 4TULH 2J25A 4UNVA 2OEOA 4JO2L 5EU5B 3VJ6B 4PI0A 4F2MA 5I18L 3W0WE 2VR6A 1G7JA 3VGAB 2VDLL 3HE7D 3A24A 4UI2A 5MP6H 2WLLA 1RPKA 1SZNA 4HCIA 5CKGA 1EPFA 2HJFB 3KLAB 4P2RE 4MGXA 4U6YB 5JOPD 1A5FH 1Y07A 1Z0MA 4GINA 3SDYL 4D7BA 3EOBA 3MRLA 4ZZKA 4YHOL 2ZKXA 3HI5H 1KPRB 4K8RL 5C07D 3KWTA 3PL6A 3NCJL 5B38G 4UBDC 2CUMA 4AT6B 1KC5H 3TH3T 3ZTJG 5E94A 5HJDA 4FP8L 3GIVB 5AQ0A 3SKMA 5I8OL 2OMZA 1GJIA 5CEYA 2XFGB 4PZ6A 1GGCH 2EE0A 1W0WA 4BQ6A 1BA9A 5AEAA 2RAMA 2QKSA 3GI9L 4JM2D 3AWFA 3FONB 4UWQB 1YUHB 3DRTA 3MLVH 4XXDB 2F8IA 4H40A 5B39B 1R46A 4H1LG 4WENB 3R8QA 3RVWC 2KCCA 4OVUA 2WTRA 3MA9L 1I1AA 4OI9A 2F4VQ 2EUWA 3CU7A 2G4GA 5IQLA 1NBZA 4PRDA 5JHDD 3IYLW 1I7TB 4AW7A 4JBMA 3A6OA 4XP4L 3ZE0E 1QVGA 5T1IA 2HRLA 2PCFA 4Q6YA 4TTDD 3B9KA 4W6XB 4F7KA 1KDCA 2BMKB 2NT1A 3BESR 1JB3A 3H7LA 5EZOH 4GZYC 4QHUB 4A7VA 1BEYH 3PDOB 4LU5L 3BPCB 5AYTA 1K4DA 3QDHA 2EXDA 3RZCA 1P7KB 4YY3Q 1FH5L 2EZ0D 2H32A 3VFOA 1H3WM 3BN3B 4ILWA 4EBQH 4JBSA 3QXAB 2OP4L 1A47A 3B37A 2CNYA 3TP4A 4XN8A 4GMSL 2A9NH 1ROWA 5ELBA 2VAJA 3VA7A 3C6SA 3QJOA 3NABH 1I8MA 5EBDA 1KCRL 4G7QB 2VR9A 2O26U 1U8QB 4MMZA 4HULB 1TITA 5SX4I 3WAJA 2VDNL 4JFTA 5D7LB 1PTOH 3FQ2A 3ZTEA 1BBJB 5CAYB 1K2DB 3PXLA 4Z23A 1JPFA 4A3IB 1EAQA 2J4XA 1Z9FA 1T04A 1IBMQ 1A3RL 2G9HB 4TVAB 3OKKA 4LLUB 4ZFZA 3I9GL 4NKOB 1JJCB 2EY2A 5D1ZI 3PGDB 1T1XB 2A74C 2NXYD 2K7PA 3N6YA 4D0CA 2IANB 3LRMA 3GD1C 2NY1D 3P9LB 3KPSE 5D2NC 3RUGA 1W8EA 4L3EE 4DW2H 1H9KA 1OO9B 1A6PA 2G5RA 3BP5B 3WUZA 4RG1A 3ITPA 1SR3A 4O58H 3VRIB 1NFKA 2DQDL 1XFPA 3WJLA 3QNXB 1NTDA 2E3VA 4GG6A 3VFMA 1UTDA 3UADA 1P8LA 3P0YH 2E75C 1GO3E 4H1LH 4LLQB 4NKMA 3WN5C 3CMAA 4P3DA 5TF1L 3BVMA 1IKMA 3CU1A 5I6WA 5CBEB 1LEIA 4KQ4H 2G30A 3SE8H 4Z3HA 1XNRQ 4AYBG 2YO3A 4ZMYA 3ARBB 4WJ4A 2ZCKH 3IMWA 4ZXBA 2C9SA 3PWNA 2WY3B 3S37L 1EY8A 2OR9L 3FT4A 1C5CH 2VXQL 2GTZA 4G4KA 3K4AA 3WE6A 1HZHH 2PO6D 1M3IA 4LLVA 4ODHH 1AS8A 4M6ML 2FEDC 4XNUL 4Y16B 5SX5K 2IPKB 3PJSB 2K05A 3SGJA 1KLFA 2VDMH 4L3EB 4NN5C 3TYFA 5JMRA 3SDAD 2D2OA 4CDGC 2AGJH 3EJQA 3KR3L 2NUTA 3FRUA 1ESRA 2HQLA 1KBBA 2Q20A 5MHSE 1G6ZA 2FE0A 5JHAA 3M88A 1QQDB 1WJJA 1NQBA 3MV7D 3HLAB 2D31B 3P11L 1ZGLB 4UP7A 1JGLL 1XGRB 4OZFG 1RZ8B 1KXVA 2X4UB 1YNTF 1RP9A 5JHLH 3H0GB 2A1WL 2CK0L 3QFJD 3KF6A 4AQ1A 1DQQB 1KY7A 1J0YA 1Z5YD 1H5BB 4FULA 1FO0H 2X6BA 1MNUH 4PJIB 3AB0B 4MMXA 3SE9H 1KQSA 4EIUA 5HVWA 1B4LA 2KLSA 4WZ9A 3AQYA 4K0KQ 3PWVB 3HG3A 2IL8A 3UC0H 5ALCL 1T6VN 4N2KA 1KTDB 3O45B 4KJWC 4V1DA 3S2DB 4XCFL 1G7PB 4LF5L 1DFXA 2HAZA 1HCVA 1XH1A 3OLDA 2BRRH 1TXYA 2V33A 4YZWA 3DDFA 1D5MC 3MROB 4DV5L 3GSQA 1IL1B 3IN0A 4NO0A 5J57B 2YWZA 4W6WB 4F7CB 4CSSA 1MH5A 4KMTH 4YVNA 5EU6B 4GYBA 3U9SA 1XB3A 2YD5A 3HZMA 1KBWA 4P5MA 1PX8A 3BO8B 1Q81C 4PS4L 5T3XD 3SCMA 1DUYB 3WUWA 4ZMWA 3CBKB 3QIBD 2NY0B 2JKIS 1GOGA 3DIDA 4JRWA 5C07E 3SDCD 2NT0A 2R0LH 3D4YA 2XWZA 1SXSA 3JYCA 3LPPA 4PRID 1FJGL 2VITA 3N91A 3RWFB 3RLSA 4I0PB 2Z91B 4OKVA 1HJPA 1JHKL 1U41A 2DJUA 3SPVA 2SOBA 4U1MB 5KYIA 1L9NA 4HHGA 2MPAL 3QR1A 4URKA 3N1FC 3JWNE 3V6ZA 1YVLA 4IBLT 1ZYRD 3QP3A 5AB9A 1ONQB 2FWOB 4BFJA 2PKDA 5ADPH 4RSVA 4WNSA 4PWHA 2G3ZA 5BOJA 3LKPB 1CCZA 4WJ3M 2Z1PA 4TTGA 3BUYA 4YR6B 1ASOA 1T22A 2VISA 2ZSVB 2ZOOA 1RHHB 3BVUA 3MDJA 1H6FA 5F7DB 5HHVH 3RPIA 5C0AD 3UE1A 1IFHL 3PHQB 2CIIA 3BP6A 1XF2B 1PG7W 4F8TA 4MNHA 5FA4A 2G60H 4CADA 1EFWA 3M7FB 4U6XA 4GAYB 3QJYA 1A6VL 2VDOB 2VIRA 3C5JA 3NCBB 3O8XB 3QUHA 3ULLA 3KEDA 2O5JC 1VQHA 4M4RA 4XOEA 5C07B 2FMMA 4U1KA 2UUBQ 3UX9B 2GSIB 4BRJA 1G7IA 4M56A 1RUKH 2ADYA 1O7DE 3FOMA 2WTOA 4RAUA 1FN4B 3CHXA 4FQXD 4W9CC 5ICXB 3UMTA 5T3ZL 3VFRB 3LEVL 3LZFH 3TF4A 2J71A 5KSBA 4OLWH 4L8CB 2XZAL 2OJEB 3QUZC 5F7KC 4QHPA 1LLAA 2DYPA 4JQIH 5BW7A 2ZAIA 1PFNA 3D2TA 5HJ3A 4PBDA 5E7BA 2CLZB 3A6CH 3T2NL 5DS2A 3FRPG 3HOYB 4ESKA 2FH8A 2VSMB 1BBUA 1J6QA 3VA2C 1VGEL 4PM1A 4BFFA 1U3HC 4EN3C 5JDSB 3N2JA 2BJML 4ZOCA 3JWOL 1AZVA 3CFUA 3UDFA 1FFOA 3A6BH 2QPDB 1B0GB 1I3QB 3CC5A 2ERJB 3F64A 3PCYA 5FDWB 3T2PA 2FB4L 1RIHL 4EIZC 3BPOB 3ME0B 1H8LA 3CDGA 1F58L 1QVOA 3K7AH 1ET7A 1CLOL 1JHLH 1ILSA 3DOHA 4LEEA 4MAYA 4DVBB 3OG6B 1DHKA 1QFPA 1XXGA 3WTWA 4GY4A 1PG7L 2EDNA 2OZ4H 4IGBD 5HYSB 4KJOA 2QBWA 2G0LA 4XNXH 1CQKA 1F2ZA 1UD8A 1WA0X 4E9WA 4OF0A 3TO4A 3W9EB 3RZOB 1E27B 1E5UI 2OBGA 2R4SH 2AZAA 1GCYA 3LEXB 5EZPA 3CFCL 3WS3A 5DEGA 2G3NA 3VYPA 3C5ZA 4FHKA 2BC4B 1HH9A 2VDOL 1W72H 3HIZA 2DKUA 2TSAA 4UNTA 4DQOH 4QRPD 2JK8A 1TS5A 4LBEA 1SQ2N 2HTLD 3VXTA 4EDWL 1BOSA 3QXWA 2EVGA 2JLLA 4L8BA 1KFAL 2QEJA 3I50L 3MXNB 3WDNA 3Q7JA 4L4VA 4XX1G 5F7NC 3ZYZA 3F5WB 1AKJD 3PV0A 4NZFA 3CFJB 4DPBX 1MCOH 1I4FA 2WJ7A 1QSFD 5I0WA 3F04A 4C55A 1JK9A 3AQZA 5FW6A 1GCFA 2FT7A 4IRSD 1YPZF 1PZUB 1AH9A 1WIUA 3FTSA 3CFNA 2LSSA 4GMTH 4NUGH 4TULL 4IFDI 4FXKC 4NQUA 1UKSA 3LSOA 1B88A 3V0IA 3H42H 1CA5A 1Z7JA 1T0OA 1TZOA 5MP6L 3NFPB 3HOXG 1KCLA 4AQYQ 3NXWA 3EOTH 2PYKA 5AJ3Q 1MVYA 3EIFA 3VCLA 5IFHL 1HH6A 3D2UD 5HPMB 3QFJE 4YO0B 3F2LA 4DFAA 3VD9A 3OXSB 1ZT4B 2UU9L 4Y9FA 1GGIL 3HI5L 4B9CA 4LSRL 2UUCQ 3SJVD 2WKCA 1WFOA 4H0GA 1ZVSB 5IVXE 2NY3C 4QRBA 1KC5L 1HR0Q 1MWOA 1P2CA 4XZUA 1BYOA 4K2KA 5DF0A 4P57A 5ID0B 3ULUH 4MX7B 4KRPD 1TWHH 2B8GA 4PW9A 4UBDD 4YK4C 2R56H 3SDAB 3IAGC 1X6LA 2IY5B 4ABQA 1E3PA 5A6LA 2J73A 4XOAA 3MLVL 3MNDA 3UIZA 4F7TA 3RP1A 4WWPA 1A3ZA 4JFPA 4H7BA 2R27A 4B3SL 2A6JA 4GSRA 1FIEA 3HOGA 1ZS2A 4FHJA 5T3XE 3KBFA 1JGEB 4K3HA 2F0PA 1BX2B 3ZDYE 3K46A 4OJFL 4V2CB 5ITFB 3QFJB 2YARA 4MMYA 4QTHB 2UZYB 1PLGH 4BDVB 5FK9B 1KCVH 1UWXK 3A7AB 1NA8A 1ZV5A 5I1CH 3UACA 5AAPA 1WWBX 5IVXB 3TWCH 1X9NA 2ITDB 3D0FA 4NLAA 1A3QA 5EZOL 3VI4B 2OPCA 1BEYL 1I8UA 3ZKXB 2OK0H 3X11B 3GTLB 4KFMA 1QA9B 4JI8Q 2DGYA 4MB4A 2QFPA 3NEMA 3CZJA 1NLBH 5ACZA 3VFPA 4DEUA 4TVPL 2OTUB 4EBQL 4GUPB 3US0A 3RGBA 2WIIA 4CAGA 1EJOH 5HDQH 2A9NL 2RACA 3VXNB 5G3LD 3IT8D 4F15C 4PEEA 4ZKBB 1BOGA 3HOXH 4PVMA 4L37A 5I8EB 5C0AE 3P4MA 4IBQA 2XYBA 2P26A 2YUXA 1RSYA 2XIBA 3ESNA 1KIRB 3DJSA 1EVUA 1SOSA 5PCYA 3V4VB 1VA9A 2CH4A 2VUMG 4LCYB 2ENQA 3Q2LA 3SDCB 2GVAA 2AJZB 3CDYA 3IBEA 2BNRB 4K7PL 2P5WD 3FUFA 3IJEA 5F1NA 2AXFB 3UH8A 5EBMA 2OMUB 2QVFB 5ECGA 5HDBF 2J8UB 1VKXA 1ERNA 3VQLA 4X8GA 2NW2B 3E3QC 3TV3L 4ELMF 4F58H 5CC4A 3KM2A 5M95B 1ICWA 2VM3A 4OIBA 3PWPA 4X5QA 2MGSA 3IK2A 4IRZH 3HNTH 4FG6C 2WQVA 5CJ5A 3K7UC 3MYZA 5T5FH 1H8OA 4JPVL 1QLEH 4YHIB 2ALWA 3BDLA 1ZOXA 1O5PA 3DX1A 2OX5B 3FQXA 3M7GA 3F7VB 2ZXRA 3ETTA 3KDFB 5IBUB 5C0AB 1Y8PB 4GRWF 4KQ4L 5IROC 3RHWF 5JQ6L 4ZTPH 3SE8L 1DVYA 1EAOA 3AU1B 4YSRA 2O6CA 1ICFB 4KJYB 3OAZH 5LNDA 3OJDB 2PI2A 2EILB 3KDMB 1HQ4A 1ITCA 4HKBB 3RN5A 1ZHNB 4RNRA 2ROXA 1AGCB 1OF2B 4JW3A 4IBUA 1CKNB 1DEEA 2IADA 1A6TB 1A4JB 5FECA 3Q2NA 4AYBB 1LD9A 1BQHG 1L9TA 1HZHL 4ODHL 2CDGA 3RWCB 5I19L 1YNTA 4XTCS 2YEQA 3K81A 4CDFC 1KABA 4HFWA 3LNDA 4MYPA 1IBZA 2ZF8A 1SJVA 3FAWA 3G6AA 4FQXB 3DX2A 3S6CA 1OAUH 5K1JA 1IGMH 3HHSB 2VQFQ 3AREA 5DVLA 1NMCC 2IH1A 3EDKA 3LKRB 4IHBA 3X3GL 3V4VL 5SWQA 1B6DA 4NKDB 3LIZH 3EIVA 1I82A 1II4E 4PLOB 1DBJL 5FKPA 5KJ7E 3UI2A 2IDUA 3MPCA 1AW7A 3MLWH 4WHTB 1B3AA 4AVHA 1IBKL 4W9DC 4P2CG 2BZDA 3U2SA 4PJ8A 1JNLH 2XG4B 2W5PA 4FDBA 3MRIA 1BMWA 1FSKB 4HFUH 4UT9L 4OZFB 5E8EB 4Z0XB 1Q72L 2B59B 3ZJAA 4QRUA 1MNUL 4MAUL 1QSFE 3GSRB 4Q6IB 3GRBA 4CSPA 1DBAL 4MHHG 4I2XA 3QOLA 1ONLA 2ZX5A 5BW7C 4YCWA 5BR8L 2UWEB 2XN2A 2BSTA 1X4XA 4OZGF 3UC0L 2IVFC 5JA9A 3G6EA 3H54A 1X3FA 3P75A 3FUMA 3LN4A 3WIHH 4WI9A 5KBKA 4FAAB 2H45A 4N2GA 2F0VA 4TSSA 2BRRL 2H3KA 2BFGA 3ZE2B 4HJ5A 1LO0L 1FNUA 1D5XA 2ZTCA 4KMTL 2VXTH 4KJWD 2K5WA 2JQZA 4PG2C 4NJAL 4XN1A 3GMOB 4E0RB 2D73A 1R3HA 2VABB 2EDHA 1YAIA 3UAJC 4IKNA 1JK8A 3HMXL 3I90A 1ZTXL 2BZ7A 2YBRA 4MA3A 4TM9A 3SJVE 2B3GA 2R0LL 3NRPA 4XCEA 4LIQL 5FUCC 2GTWA 4FXGA 3ZOAA 5AOJA 2PW5A 4HIXL 1HESA 5FJ8H 3UL4A 4IMKC 1QSFB 1KTBA 4OZIF 3MUHL 1EIBA 2IPUK 3AS3A 4ZPTB 5ELNA 3T71A 3BHBB 4IRSB 1Z5HA 3PGFH 2V6HA 1N12A 3Q8BA 4EI0A 4QKTA 1D5BB 3HOVH 5HGGS 1BVLA 3T4AC 2M8XA 5M7QA 2FIKB 4XO5A 3O0RL 3LAFA 4DKFH 2IPTL 3L4TA 3O6FB 2LU3A 5IEKB 3ULVC 1JPTL 1SM3H 3D4GA 4XBGB 4DAYA 1M1KC 1SYDA 3KXFD 3QRFM 2ZTDA 4JGNA 2R93B 3D4WA 2YD7A 2MRYA 2NQDA 3D2UB 3I6KB 2Y7QB 4PJ9A 3RKPA 1GL4B 1MPAL 2ODHA 4GQ9H 3DO4A 4Y4FA 4ZOAA 2XPGA 2XPZA 2F0TA 3RE0A 1GYCA 1OPGH 2X4NA 1UB6A 2UX7A 4KDTA 4OF8A 1VEOA 4GJTB 1RUKL 4NIYE 1QR1B 4C3HH 1BZ9B 1W2BA 1FUNA 3LZFL 4KRPB 5EIIA 3K2UL 4Z7NE 4FLOA 4YL9A 5SX5H 2I24N 2X4OA 3NQKA 2YA0A 2DMKA 3DETC 3FUJA 3GXNA 4DK0A 1FNGB 3KS0J 1DJSA 1A7RH 5HGAB 1F11B 1D5RA 4NFCA 3N44B 1U8PA 2VMDA 4MXWH 5GHWH 4F33B 2KZ1B 3KLHC 4JQIL 1NM9A 4C2MH 4GKJQ 2EYTB 3EAKA 3BT2L 5KSVA 5J9PA 4U1SA 4POFA 1BF2A 3H3KA 3RX7A 1Q9KB 2GSGA 3QUZD 1PDKB 3ARFA 4XNQB 2X10A 2EYSB 4HX1B 2VAAB 3A6BL 4UINL 5DQ9A 5IB3B 3NCEB 3OPOA 1CICA 1XGTA 2HJKB 5BZDA 3QQDA 5D5MA 2P5WE 2FECI 4NP9A 3DIVA 2HHHQ 3WS6A 1GMIA 1JHLL 3RIAK 4QGUA 4W4OA 2WIMA 3OAUH 3WFZA 1XNQL 4IRJC 2ZX9A 1FGBD 1XMQQ 3ML9A 3HZ3A 4IMLB 3UDWC 2QVKA 4P2OB 3HKSA 1V3JA 2F4IA 2YQ3A 1GGBL 2LGNA 4XNXL 3MXGA 2LVCA 2QSVA 1RJZA 4F7EA 3GQBA 4JFUA 2YEVB 3VDCA 4Z9CB 4RRPG 4LCCC 2QL1A 3QPQC 3TBYA 3WJMB 4NDMB 1QFUH 2XV3A 2EOTA 1HHHB 4NNYA 4JRYA 2P8MB 4DQOL 2FJ2A 1EY0A 1NLDH 1YPZA 5DHVA 1T89C 5HJGA 3I75A 4N2FA 2O6FA 2HKHH 1Z47A 2WCPA 3TQYA 4MKTA 1KG0B 4XPAH 5DJ2B 4DZBA 1TWCH 1TVBB 4MS8D 4PIRF 3U48A 2CWRA 1IW7C 1M3JA 5ID1B 2Q2LA 1VQIA 1EMTL 2X9XA 3AFPA 2OI9B 3HI1A 3CFKA 5K9KB 4JZJC 4NUGL 2FAUA 2ZOLB 2Z65C 1FYTA 1TWAB 3DI2B 3V9FA 1HHJA 4C3IG 3KNBA 4WW2A 1YQ2A 1V3KA 4FOMA 5DUBB 4EI5A 3NJNA 4QNPF 5JIIA 3T1WA 1F45A 4P5SA 2WBJB 3CVIH 1F2LA 1ZHLB 2X7LB 3EOTL 4TUOA 1QWHA 2EE9A 1KJ3H 3GMNA 3VFGH 3SODB 5IB4A 3CQZB 4U2YA 1QEWA 2GJ6A 4B5EA 2PZTA 5IJBC 2BIPA 5KVEL 1W9XA 4KKSA 2ZD0A 1A1NA 3LRSB 1OGAA 4D9RE 2Y06H 4GAJH 5GZNA 2J6EA 4LVNC 5DJZB 1TG8A 4AIZA 1HL8A 2CHXA 4WWID 4XP9H 4HIEA 4UAHA 3U30B 4HJ8A 2B2TC 2OL3H 2YAHA 1E7VA 2FHTA 3NJJA 5C92A 3D85A 5LGYA 4DF7A 3GSXA 1U8IB 4M93C 2NY3D 1UWEL 4UT6H 3X1BA 1JWSA 1GHFL 1OCRB 4ZS6C 4FCAA 4NYLA 2B2WA 4JO1H 5AW2B 2IQAA 1PF3A 2IIJA 3D52A 3MNVA 4I48A 4H88H 3NSYA 4GPVA 4Y8AA 2FEEL 5AVXB 2XSCA 2CIKB 2AF2A 2BCMA 4H25A 4GXVH 3BS1A 3G5ZA 1WFIA 4JFOA 4F7MA 3GI8H 3K4ZA 3OSVA 4AL8C 1H15A 1BFTA 4LSUL 4HR7B 1PLGL 4N8UA 3UYOD 5I1CL 1CWVA 3TIEA 1DVXA 2FO4A 4MKMA 5DK0B 3PO2G 1XVSA 3ZQ9A 4QCIA 1JZGA 2MQ0A 2WVUA 3PF2A 3Q5TA 3U4VA 5E0FA 3S16B 1BMZA 1NCBH 3U0WL 3V6BR 1BSIA 1PYSB 2DMHA 1H0DB 1RERA 4ICXA 1XCTB 4JJHA 4KVPA 5IF0A 4YZFE 5E24E 1HZLA 4JG1L 3FQUB 4KTGA 5AENA 2GG1A 3APNA 4YLBA 1EJOL 4O02H 4C3IH 3ATBA 4QIRA 1OAKH 4JANB 4YS4A 3VRJA 5EGTA 5HDQL 4NC0B 3PABA 4QRSA 4DV0Q 3IDYC 2VL6A 2MWCA 1YN6B 4P2YA 5I76B 5H4ZA 4FE9A 2C5CA 3RU8H 1A25A 5ECJE 3KXFE 5TPWL 5EN2A 3NTHA 3W57A 3VB8A 4ELMA 1XMOL 3PRZA 4MCNA 5D1ZC 1WTGT 4O51A 3T0DA 4PP2A 3F58H 4GKZA 1IIKA 1UHVA 2XBZA 3HBZA 3UAAA 1TZHB 1Y7VA 4YX2H 3KJOA 2IAMD 5CHNB 1A9BB 2N0MA 1T5XA 2VUMB 1XZ0A 4S2SB 3SGEH 3V6OE 2BIHA 3T65B 3B2VH 3ZQWA 1PKQA 2NY2C 4ZUWB 3WYRA 4F58L 1AQMA 1DJRD 4I3SL 4NJ9L 4IRZL 1AD9A 3HNTL 5IMKA 1N34Q 4N8VG 5T5FL 4HSCX 3UJIH 5F7MC 3T3ME 1IC4H 1WAAE 1C8CA 3D06A 5DMGC 3WFCL 4AVJA 5BRZD 1VCAA 3CC2A 2MCG1 4P2QE 3GP7A 3KXFB 4FG6D 3Q5YA 4ZTPL 5C0BA 4KLKA 4OJDH 3S35X 2BVTA 3V8CA 1KFGA 2ZKHL 4U6HA 4WO0A 3L2LA 3GKZA 2L04A